2A6AA

Crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MNVLALDTSQRIRIGLRKGEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKSCPADGVVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERLFREKKTIHYYEIEPLYLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TM0874
publication title Structure of an essential bacterial protein YeaZ (TM0874) from Thermotoga maritima at 2.5 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 55
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2a6aA01
3.30.420.200 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2a6aA02
5BPLA 1MWKA 5AZIA 3IUCA 3EN9A 2GELA 3WXIA 4H0TB 1T44A 5AQGA 2A3ZA 2FSNA 3CJAA 3DXKB 4H5WA 4FOIA 5AQYA 4FPBA 1QZ5A 3WEEB 3VGKA 3WQTA 5LJVA 3CQXA 2BTFA 2P9SA 3CJBA 3VEXA 4A62A 3O1BA 3WQUA 1ZC6A 3EZWA 3CJ9A 4CZFA 1TUYA 3VEVA 1SAZA 4PKHA 2A40A 3U9ZA 4CD1A 3A5OC 3EO3A 4H5TA 4FWQA 3W0LA 3HBTA 5AQSA 3LDNA 1QHAA 3SMPA 1JCGA 4NO7A 5EX5A 1K8KA 4Z94A 5AFUA 3ZEUA 5F1XA 4H5VA 4Y0WA 4QS8A 2ASMA 2ZGZA 4ISEA 4YDUC 5E84A 4EHTA 1NMDA 4IJAA 3SLCA 2F9TA 2A41A 1ZBSA 4BGAA 5AQOA 4JHDB 3VF6A 2E1YA 2QWOA 3H6EA 2BUPA 4H0PA 3B8AX 1NM1A 1Z6RA 2E2NA 3KVGA 5BN9A 4K42A 4FWPA 2D1KA 4FWMA 1YAGA 3SJHA 4B9QA 4QS9A 1HX1A 3TU5A 2E2PA 4H0XB 4BRPA 4QS7A 4CI6A 4FPAA 1BG3A 3UKUA 3A0IX 5E26A 3R8EA 2KHOA 5AR0A 5BN8A 3LM2A 4A2AA 1BDGA 5KQ8A 1KAZA 3O4WA 5BR9A 4YDUA 1V4TA 2Q31A 1NGAA 3UKRB 2CGKA 3EL2A 4NB4A 3WT0A 4BRAA 2I7PA 5BRDA 1NGDA 3M1FA 4BRCA 2ASPA 4FWNA 1Q18A 1MA9B 2WUSA 3DWLA 2DPNA 4M63C 4CZIA 2NLXA 4CZKA 3H46O 1NGCA 1P8ZA 3M6GA 3ATUA 2HF4A 4BRKA 3JXUA 2NRHA 4IXCA 3H3NO 3QFUA 4CJ7A 3C7NA 3BF1A 5BRHA 2Q2RA 3WXKA 5AQKA 1MDUB 2W40A 1ESVA 2GTDA 1BA1A 1U2VB 1GLEG 2P9LA 1X9JA 4BRQA 4IZ9A 2YCHA 1D4XA 3I33A 2QWPA 2A5XA 3HSCA 4BC3A 5B8HA 5LY3A 1RFQA 3JS6A 4H5NA 3UE5A 3VGMA 4DHYA 3CJ7A 5AQXA 2Q0UA 3VPZA 2QWNA 3DJCA 1ATRA 5AQZA 2AP1A 3U8XA 4BRHA 3UB5A 5F0XA 1HLUA 2CGJA 3WUHA 1S3XA 5AZIB 1SQKA 4BC2A 4BR4A 2GEMA 5AQWA 4RWTA 3CETA 3MMVA 4CZEA 2V51B 2D0PA 2HF3A 3O5BA 4BRMA 1RDWX 2CH5A 1GLAG 2QWRA 4CZHA 1KXPA 2D4WA 3W3DA 4M7XA 4BR7A 4L3QA 2P9UA 3C0BA 1XC3A 3VERA 2IVPA 1BU6O 3O1WA 3P4IA 4FL9A 3MN7A 1V4SA 3FFKB 4BGBA 2P9SB 3ENHA 4B1VA 1GLFO 4BRIA 1DKGD 4XH4A 4BROA 1NBWA 3R6MA 4BG8A 4PKIA 3O6WA 3GE1A 3I8BA 4BRLA 3ZX2A 2CGLA 4H0OA 3QDKA 2IVOA 3OHRA 4K43A 3IDHA 1BO5O 1HPMA 3LL3A 4EHUA 3F9MA 3FZLA 2VCPA 1WOQA 5AQLA 1K8KB 3AAQA 4XH1A 3RSEA 1GLCG 3DXMA 3A5MC 3HM8A 3LM9A 3CJ1A 2QW9A 3ZEUB 1SZ2A 3D2FA 2GWJA 4ISFA 3CI5A 1H1VA 3FR0A 2E1ZA 2QWLA 4CBUA 1QQOA 1C0FA 4FWRA 4XH5A 3VF4A 4BVOA 1QZ6A 2PAVA 4PL7A 3M3ZA 5AQFA 3VEWA 4K41A 5FPEA 3AY9A 3QB0A 3D2EA 5AQVA 5EVZA 2D0OA 5BREA 3AARA 3D2FB 3CJCA 3VF2A 1BOTO 3EKUA 4O8KA 5AFUH 3WXJA 3L0QA 1U6ZA 4JNEA 2YJEA 3GOIA 2AA4A 4JD2A 4JN4A 4AM6A 3VESA 3CIPA 3FE1A 3CERA 5AQPA 4A2BA 4JAXA 4BRFA 4WQ4A 1DGKN 3ZX0A 4B1YB 3G25A 2ZGYA 3MN5A 4BR9A 5JICA 2P9IA 3GL1A 5TKYA 2YJFA 1T6DA 4DQ8A 1E4GT 3UKUB 2FF6A 2ZWHA 2QWMA 4BC5A 5AZJA 2YI1A 5KQDA 1MWMA 1OKJA 1JCFA 1NLVA 4HTLA 5KPZA 5AQHA 3J8AA 1E4FT 3L4IA 3TPQA 3ZX3A 2E20A 1NGFA 1KAYA 3H45C 1HKCA 2J4RA 3A8YA 3HZ6A 3QMLA 2P9NA 3U9DA 4CZMA 4HWIA 1YVNA 1YUWA 1XQSC 3IFRA 2FLOA 4BC4A 4ISGA 1TUUA 5AQRA 5JMVA 1LCUA 1YXQA 2W41A 5FPNA 4MLHA 1QQMA 3O08A 1ATSA 2FXUA 3CQYA 3VENA 3ULEA 4BQLA 4LC9B 1TYQA 4BVPA 4EAHD 2UYTA 1NGGA 5AQUA 2IIRA 2V7ZA 3QFPA 1Z05A 4RCHA 3FLCO 3IMXA 3ID8A 3BP8A 3DAWA 3MN9A 5ADXH 5JLFA 3C7NB 1GLJO 3CHWA 3ENOA 4M7YA 1NGHA 3ZETA 3GG4A 4BG9A 2YHWA 3FZMA 2P9LB 3FZKA 1QQNA 2ZF5O 1Y64A 5FPMA 4C23A 1WUAA 2FSJA 5BPNA 2V52B 1ATNA 1GLLO 2FF3B 4FWOA 4PL8A 5EOYA 1HKBA 2NZTA 1NGBA 4B1XB 2E2OA 3S41A 2A6AA 3D7EO 3LDLA 3A5LC 5AQTA 2Q36A 3VETA 2V7YA 5AQQA 3WEEA 4FSVA 3VEYA 4FO0A 5EY4A 1LOTB 2OANA 4FWSA 2YHXA 4BRNA 1NGIA 3KZBA 1NGJA 2Q1NA 2Q0RA 2I7NA 2QM1A 4BR5A 3MDQA 3U4LA 1JCEA 3BEXA 5KPTA 3R9PA 2Q97A 4AM7A 4IWVA 4I6MA 4A61A 2P9UB 2YHYA 1KAXA 2PBDA 3GDQA 4BRDA 4WYBA 3GBTA 2VYPA 3VEOA 1RGIA 2H3GX 2HMPA 1ZXOA 3O8MA 4WQ4C 2QXLA 3MCPA 4FWLA 4I6MB 4BREA 5EXWA 4EFHA 1G99A 3LDOA 3H1VX 4B1UB 4BR2A 3HI0A 3VGLA 3KHYA 2A42A 3QBWA 4H0VB 3BUZB 1X3MA 3O80A 3H3OB 5AQJA 1CZAN 1DEJA 4H03B 3SMSA 4CZLA 1EQYA 3FZHA 1HUXA 1BUPA 2GWKA 1NGEA 3RSEB 3DXMB 1T6CA 4FOEA 4JHDA 3HTVA 3QBXA 5LJWA 3MK6A 1C0GA 3L6QA 3LDQA 5AQMA 3D2EB 4GY2B 3A5NC 4DCHA 2FSKA 4IO8A 4CBXA 4DB3A 3QICA 1J6ZA 4MO5A 1BA0A 2P9PA 4MLEA 2VWBA 4JD2B 2E8AA 2IVNA 5F2RA 3MN6A 1HKGA 2P9IB 1IJJA 3UKRA 2P9PB 2GUPA 4WQ5C 4CBWA 1X3NA 4CZGA 3EKSA 4BRGA 1IG8A 5I9EB 3VOVA 4EIAA 5AZJB 4BQZA 1R59O 4H5RA 5AQNA 1NWKA 4H0YB 2HOEA 1BWFO 2F9WA 2P9KA 3BF3A 3LDPA 5KPRA 1XUPO 3H1QA 5BPMA 4BR0A 2P9NB 1GLDG 4FWKA 4PKGA 5AQIA 4KBOA 5ADXA 4K25A 4CZJA 3FZFA 5FPDA 2E2QA 3ATVA 2E88A 4GNIA 4J8FA 5JLHA 4CD3A 2P9KB 4MO4A 3SK3A 4B1WB 2EWSA 1U2VA 3WXLA 1GLBG 3ULEB 1HJOA 4B1ZA 3AAPA 2ITMA 4F9OA 1TYQB 5BRFA 4O5FA 4WQ5A 4E1JA 1S22A 4IJNA 2ASOA 4RTFD 3FGUA 4XEIA 3VEZA 3ZETB 5CE3A 2QWQA 3DXKA 5ELZA 2CH6A
chains in the Genus database with same CATH superfamily
4CEZA 1W7AA 3QNOA 5J2PA 1MWKA 4CFDA 3T69A 1RDBA 3EN9A 2GELA 4FJLA 4O5BA 1T44A 1NKBA 5FRNA 1U4BA 3DXKB 3KLEA 3OYLA 4J2BA 1KD1O 5AQYA 2P51A 1U48A 3VGKA 4WFAL 5LJVA 3OYJA 3CQXA 2P9SA 1T05A 2Z1HA 3WQUA 3ZCMA 3L3VA 1VSKA 2RHKA 4NYNA 2D0BA 3HVRA 3P31A 1L3TA 4JKGB 4PKHA 2A40A 3EO3A 3SJJA 1Z25A 3QO9A 1JCGA 4NO7A 1HYSA 1K8KA 4ILGB 1JLAA 5C2FA 3C6UA 4OKJA 2NRZA 2VQEK 1JLGA 3ZEUA 5F1XA 1N34K 2QTDA 4FZZA 2ZGZA 3SUPA 1HYZA 3G71N 4EHTA 3AVLA 3JYTA 3NE6A 3D45A 1XNRK 4JKDA 1VQ8N 4IJAA 4IOXA 1ZBSA 1U04A 3MEGA 2E1YA 2BUPA 4H0PA 1NM1A 3DLBA 1EXQA 1YI2N 4CGIA 4FWMA 3EYZA 3SJHA 1QSSA 2BDPA 4C1NK 4H0XB 1P90A 3THXA 4J2AA 4FPAA 4YOXA 2XY5A 2B6AA 3ZT0A 4L8RB 3VQ7A 1WN7A 3KJVA 5CZ2A 2DFHA 2JGUA 1XWLA 3SPYA 1SS6A 3MEDA 3O9TA 3M8SA 4HUFA 4DMNA 4ID5A 4IG3A 3NVMA 4CESA 2Q31A 1SV5A 3UKRB 4NB4A 3WT0A 3IRXA 4OKEA 2ASPA 3MWTA 4FWNA 1J54A 1MA9B 4M63C 3CM5A 1P8ZA 3ATUA 3DLGA 4K8ZA 4OGEA 3T3FA 4IXCA 3THYA 3SQ4A 4CJ7A 5BRHA 3OYCA 4AHSA 2FBVA 1C0TA 1J5OA 1BA1A 1GLEG 4BRQA 3NF8A 3CCQN 2YCHA 3H08A 4BC3A 1KTQA 3VQPA 1RFQA 3CCEN 3LZIA 2OPRA 4MFBA 1Q8IA 4Z0UA 3LAMA 1KQSM 2QWNA 3O4NA 4IEEA 5AQZA 3TAPA 3AO5A 3U8XA 5F0XA 2X78A 3O3GA 3ZT2A 2QK9A 4KO0A 4BC2A 3IKMA 1KCFA 3CETA 5CZ1A 4JS5A 2V51B 3ZT4A 3QNNA 3O5BA 2A1RA 2YX6A 3J81O 2P9UA 3VERA 2IVPA 3P4IA 4FL9A 3NH1A 1X9MA 1UAXA 2HHTA 3JAMO 4BGBA 4B1VA 1GLFO 4LH5A 4N5SA 4FCYA 4BG8A 4KH4A 4IFYA 3P38A 3O6WA 1RDCA 4BRLA 4DV0K 1VQ6N 2EX3A 3ALYA 3KK2A 3TAGA 3SUOA 1BO5O 4CW7B 4B9NA 2VCPA 1NK0A 1BCMA 1I39A 1R0AA 3PX0A 4A59A 4CEDA 2QW9A 2ZQBA 3NBPA 3D2FA 4LFAK 4OLAA 1VQ9N 1C0FA 2BH1A 4BVOA 3VF4A 1I94K 4DTOA 5J2NA 2ITGA 3QB0A 5AQVA 5EVZA 4FLYA 4CE9A 3EKUA 4BWJA 3G6EN 1N6QA 1U6ZA 4JEPA 4Z4EA 4JD2A 3VESA 3CIPA 4A2BA 3ZSOA 4JAXA 4B1YB 3G25A 3MN5A 3IS9A 1JLCA 2NNWA 1J9AA 2XRIA 3UKUB 4DV3K 1CZ9A 3SAGA 4BC5A 5AZJA 4JK8A 3M8RA 5KQDA 3KKSA 5KPZA 3CFPA 5AQHA 3TPQA 1E4FT 3ENBA 2E20A 1NGFA 1KAYA 1VAZA 3QMLA 3U9DA 4CGGA 4DQIA 3SI6A 1YVNA 1TUUA 5AQRA 4B9VA 1LCUA 1ILYA 3VQCA 3QIOA 4KB0A 2DFFA 5FPNA 4C8LA 3O08A 4IBNA 3VENA 1XMOK 1XNQK 1YTUA 1TYQA 1VSIA 4BVPA 4DLGA 2KFNA 1W9HA 1NGGA 1VSEA 1Z05A 5GAHP 3FLCO 3ID8A 3C7NB 3ENOA 3CHWA 4DR3K 2ZJRL 3V9UA 2P9LB 4BE2A 2KW4A 4RW4A 1WBBA 1WUAA 2HMIA 4FW1A 4OVLA 2FF3B 3RTVA 3LWLA 2VQFK 1Q9YA 1HKBA 4B1XB 2A6AA 4JKBA 3M5RA 4CJEA 4B3RK 3KD5E 5AQTA 2Q36A 3VETA 3L2WA 4CK3A 5AQQA 1T8EA 1SL1A 3NGZA 5KI6A 4KTWA 5EY4A 2OANA 1C0MA 2YHXA 1NGIA 4W5RA 4FM2A 2Q1NA 2Q0RA 2I7NA 4H4OA 3OS2A 3U4LA 1JCEA 4CIFA 3MWPA 4JKGA 4AM7A 1YJNN 4DR7K 3BY5A 4A61A 3THWA 3GBTA 3AO2A 4EZ6A 2RF2A 3C6AA 2HMPA 1XHXA 3TR8A 3MCPA 5M1NA 4MDAA 4I6MB 2NUBA 3MEEA 4MDBA 3H1VX 4DR2K 4FJNA 3VGLA 1N32K 1X3MA 2OPPA 2NRVA 3H3OB 3DRPA 5AQJA 5HRRA 3AO1A 3SMSA 1EQYA 2GWKA 4OX9K 3RSEB 3MCAB 1XMQK 1JXEA 3WXMB 3PO5A 3CC2N 4CGHA 3V1OA 3J7ZO 2BE2A 4R5PA 3P83D 4KH6A 5AQMA 4KTQA 3HT3A 4TSXA 1N8RO 2ETJA 1BQMA 4GY2B 1U45A 1JL1A 4FVUA 4E0DA 4DB3A 4GKJK 3QICA 1J6ZA 5K14A 2DTUA 1FXXA 3TTFA 3VQ4A 4B8AB 3HOTA 5M1QA 3QETA 4GVMA 1K73O 3K9JA 3L2UA 2IVNA 2GV9A 3SBGA 3ZSZA 3CPWM 3UKRA 5MLCQ 3TANA 3VQ5A 1FKPA 4F2RA 4CZGA 4WQ5C 4CBWA 1TK5A 1X3NA 5C10A 4DFPA 1HMVA 1VSHA 4H4MA 4YORA 1ZYQA 4DS5A 1HNXK 2X74A 3CMEN 3EEQA 4CGDA 1QQCA 4W5TA 4BR0A 1GLDG 4JKEA 3OYBA 5AQIA 5ADXA 2NRRA 4KBOA 4EP4A 3L4QA 4HCCA 4K25A 5FPDA 4I9LA 4LH4A 5CYQA 2E2QA 3OBYA 2P9KB 3CG7A 3E1YA 3ULEB 1TL1A 4OJRA 2ITMA 4F9OA 4OPKA 3O4QA 4WQ5A 3O9RA 1YTAA 4CJSA 1HNVA 4DSFA 2BGGA 2CH6A 4CJ5A 3ZLJA 1NNEA 4G9ZA 2FBTA 5GIPA 4B9MA 3B6OA 4ILJA 2XY8A 3QEPA 4CJQA 2FSNA 3CJAA 3ZYYX 3VQQA 4N41A 2QI2A 1Q86O 3ZSXA 3DMJA 2BTFA 3QIPA 4DU3A 4CERA 1TUYA 3AVJA 4IDKA 4CCHA 2D0CA 3U9ZA 4FWQA 1RT4A 3N4PA 5AQSA 4CIEA 3LDNA 1QE1A 1QHAA 2IC3A 1RT6A 2F8SA 1B9DA 5CHIA 1YJWN 1KSPA 3RMAA 4FLTA 4H5VA 4BWMA 4CEFA 4QS8A 3HYFA 4ISEA 4FLZA 4HCBA 1K8AO 4B3MK 1RBUA 4YOYA 5E84A 4DV5K 2WBNA 3SLCA 4BGAA 3LP1A 4JHDB 3AVBA 3PIPL 2QWOA 3LPTA 3V6DA 1Z6RA 2E2NA 3ZT1A 4K42A 1YAGA 3AVHA 5JVHL 2P1JA 1QSYA 3DM2A 3TAQA 4R79A 4EP5A 3HPOA 1BG3A 3UKUA 5BR8K 4E1NA 5E26A 1IBKK 2RKIA 4ID1A 3S3OA 2KHOA 5AR0A 5BN8A 1W2BM 2HHXA 4KH5A 4A2AA 2HB5A 5BR9A 2YHAA 1VQ5N 1V4TA 4Q5VA 4B9LA 1S1TA 1VQNN 3KK1A 2CGKA 1QHTA 3AGKA 3HVTA 5BRDA 3LAKA 1NGDA 1KVCA 4JI0K 4AHCA 4C1NI 2WUSA 4DQPA 4CZIA 5DM6L 3H46O 4KI6A 1X9WA 3AVCA 3F9KA 3CPEA 3SCXA 2UUAK 4CF8A 4BRKA 3JXUA 1WBDA 1A5XA 3O3HA 2G8KA 3H3NO 3QFUA 1EO1A 3C7NA 3K5MA 3AGRA 4MQ3A 2OZSA 5C24A 2P9LA 5TKWA 5LMUK 1NKCA 4IZ9A 1C0UA 3NDKA 2P5GA 1WLJA 3OYAA 4Z4GA 3E9OA 3UE5A 5J1EA 3QERA 5GAEP 2O4IA 2Z1GA 3K58A 3OYHA 3CJ7A 5AQXA 3SQ1A 3U6FA 1S6PA 2AP1A 5FROA 3T19A 1HLUA 3WUHA 4ZTFA 5AZIB 1SQKA 2B5JA 1FKOA 4BR4A 4DLEA 4O0IA 2D0PA 1RDWX 4U7BA 3DOLA 1GLAG 3ZSQA 4JKCA 3OYNA 2D4WA 2P5OA 4LY7A 3HM9A 4L3QA 3SZ2A 3O1WA 4DU1A 4CHOA 4ICLA 1EETA 3ENHA 3PX6A 4M3UA 5FRMA 4KHSA 1ASVA 2E4LA 2Y1JA 1QSLA 4GV6A 3R6MA 4PKIA 1U49A 3I8BA 3O9SA 3NH0A 3HPGA 2CGLA 2F8TA 3LL3A 4M42A 1B9FA 5M1OA 5DM7L 4CJRA 4DWIA 4KKOA 1M1KO 1IKXA 4PY5A 1ASUA 5HRNA 3PLAA 3P5JA 3RSEA 2YHBA 3CC4N 4JKHA 3CJ1A 3OJUA 1S9GA 4ISFA 3CI5A 2ATQA 1C1CA 3F2KA 2E1ZA 5CYMA 3PIOL 4FWRA 4XH5A 2PAVA 5AQFA 1EX4A 1RBVA 4E7LA 1RT3A 4IG0A 4K41A 1Q82O 4FJIA 1IBLK 1VQ7N 3CJCA 5AFUH 3WXJA 1CLQA 3VTIA 1VSLA 4LF4K 2YJEA 1ZBHA 3GOIA 3SUQA 3RVCA 2IS3A 2O4GA 4DTMA 3FE1A 3HP9A 4O4GA 4YFUA 2ZGYA 4YOVA 4BR9A 5JICA 5HLFA 3QESA 3DLLL 1T6DA 4DQ8A 4E1MA 1WSGA 4W5NA 5DMRA 2QWMA 2G8WA 3K2PA 2YI1A 3R1XA 1JCFA 4B3TK 4HTLA 3RMCA 1TV6A 3ZX3A 3CF5L 3KLIA 4CZMA 4HWIA 1OH7A 4DR6K 4A5BA 3KTQA 4ISGA 1VQMN 1YXQA 1YF5L 1ATSA 1C6VA 3ULEA 3ZSRA 3ULDA 1JLEA 3SUNA 3WNEA 4EAHD 1NK9A 4XIUA 3T1HK 1DLOA 4GMJB 4GW6A 3DLHA 4JI2K 5ADXH 3MN9A 3QLHA 1GLJO 4M7YA 1N36K 1GOAA 3NF9A 4AHVA 1JJ2M 2Z1JA 3E9PA 4IFVA 4DV6K 1JXBA 3L8BA 1Y64A 5FPMA 4UY8O 4CJUA 2ZJQL 5A2QO 1LWCA 3AA3A 2GBZA 2NZTA 3U3GA 1NGBA 5KGWA 2Q3SA 3LDLA 4JI6K 4PUOA 3G0ZA 1TK0A 4DV2K 4FSVA 3V1RA 1VQLN 4FO0A 5FDLA 2YNIA 4BRNA 2O8CB 4EZ9A 2ZE2A 3CC7N 4CF9A 2HBMA 3MDQA 4NLCA 3KLFA 1NKEA 4FYDA 3R9PA 2Q97A 4O0JA 1W0HA 4IWVA 3EY1A 4E7JA 3P1GA 2PBDA 4FVMA 5HL7L 2O8FB 2VYPA 3KWGA 4M45A 3J80O 2JWLA 2QXLA 4FWLA 1C1AA 4ELTA 3HRGA 4BREA 3AV9A 4JKFA 3DLRA 4BR2A 4CJ3A 3HI0A 5DK5A 4M3TA 3KHYA 2A42A 4F3OA 3JSMA 5C0YA 3KLHA 5LMNK 2HHQA 2UXDK 3NAEA 4LF6K 1FW6A 1J53A 3EE9A 3AVKA 3HXMA 1CZAN 4CZLA 4IO9L 2W6LA 3FZHA 1HQEA 3BDPA 1NGEA 4JS4A 1T6CA 3AA4A 4JHDA 1O13A 3OYIA 5LJWA 3M8PA 4CFAA 4CJPA 3LDQA 4K8XA 1NG9A 3SV3A 3NMUA 2AJQA 1TKTA 3O9QA 1D8YA 2PFUA 4DTRA 2UUBK 4Q0BA 4DCHA 4IO8A 5C25A 1BA0A 2I5JA 4MLEA 3K5NA 5I3UA 3QEIA 2VWBA 4KAZA 5CY4A 4NXNK 1RBRA 2FBXA 3SQ2A 3OS0A 1IJJA 2HNYA 3LP2A 2P9PB 3VN5A 1VSJA 1IG8A 1G15A 5I9EB 3VOVA 1CZBA 4CF2A 2VGNA 2HOEA 1JKHA 2NRXA 4JK9A 4OGCA 2F9WA 1A5WA 1RDDA 1BI4B 1EP4A 1K9MO 1XUPO 5BPMA 1S1VA 4FWKA 4PKGA 5LL6Z 1IKWA 4DTNA 2UU9K 4QAGA 4DUYK 1C1BA 4IFEA 2VG6A 3G10A 2GUIA 2XY6A 4B1WB 3WXLA 4WFBL 1GLBG 3D6RA 4BDZA 2QA4N 1WSFA 4DR1K 4E7KA 3AO4A 1IKVA 4YY3K 3D0PA 4CIGA 4IJNA 3FGUA 3BGRA 5IWAK 3DLKA 3ZETB 5CE3A 3DXKA 5BPLA 3UIQA 5AZIA 3IUCA 1WSIA 2OPSA 4LFCK 3DLEA 1BL3A 3WXIA 1TVRA 2E5LK 1RTIA 2A3ZA 4KB1A 1WSJA 5HRSA 3VQ8A 3C65A 3R3LA 4JKAA 4FXDA 2NRTA 5HRPA 2Y1IA 4A62A 4GV9A 1VQON 3HO1A 3OVNA 3CCLN 4B3SK 4DSLA 3CJ9A 1WAJA 3RWUA 4CZFA 2A1SA 2BANA 4CF1A 1RTDA 1SAZA 2WC9A 3NH2A 3HL8A 3A5OC 4H5TA 3OS1A 1TKDA 3HBTA 2WFBA 4CHQA 4CJKA 1HNWK 1RILA 5EX5A 4Z94A 3I56N 5AFUA 3SNNA 4FJKA 1DTQA 1KVAA 4B08A 4OKKA 3MX5A 2ASMA 1D9DA 1NJXA 3OJSA 3P39A 3T1YK 4CEAA 3QINA 3LDSA 3SYZA 4E7IA 4YDUC 4N47A 1NK5A 1HQUA 3OYKA 3SPZA 2F9TA 2A41A 1HRHA 3VF6A 4M3XA 3KVGA 4I2PA 5BN9A 4W5QA 1OVYA 4O8UA 4JI1K 2D1KA 4AHRA 1HNZK 4QS9A 1HX1A 4O44A 2GX9A 3V9XA 4QS7A 4FK0A 1F21A 3VQAA 3K0SA 1NMNA 1UA1A 3C6HA 5HP1A 1LW2A 4CHYA 4KREA 1TKZA 3VQ6A 1BDGA 3ISNC 1X1PA 4YDUA 3MXIA 4FLXA 3CQ8A 4BRAA 2I7PA 1SKRA 3M1FA 1Q18A 3BZCA 2DPNA 1ZBLA 4CFCA 3VA3A 4KHNA 5JS1A 4J2DA 4CZKA 3M6GA 1NGCA 4GV3A 2PY5A 2QEXN 2YKMA 3OYMA 3C6TA 4Z4HA 4FJ8A 5HBMA 2HF4A 2ZM6K 2G8IA 4FZXC 1LWEA 3F73A 2HHVA 2NRHA 3LALA 5M1FA 5FLXO 2UXBK 5D3GA 4PHTX 1Y97A 3BF1A 3WXKA 4CECA 5AQKA 4B9SA 1MDUB 2W40A 2GTDA 1NOYA 1U2VB 4JYAK 4M41A 1BISA 4WCEL 5LY3A 4DV1K 2PYJA 1CXUA 2OTJN 1YHQN 4AHTA 4DHYA 2VG5A 1UA0A 3PO4A 4I9QA 3J7AP 2Q0UA 5CR4A 1ATRA 4HHTA 3KLGA 2CGJA 4KFBA 1S3XA 3DOKA 2O8CA 2OA8A 4Y1DA 2GEMA 4HUEA 5AQWA 4RWTA 4A5AA 2HF3A 4BE1A 2CH5A 3MXMA 3W3DA 3I0RA 4M7XA 4BR7A 1NK6A 1S9EA 3C0BA 1XC3A 3PSFA 3F5TA 3MN7A 1M90O 3ZSWA 1JLQA 4BRIA 4E3SA 1DKGD 1L3UA 4XH4A 4BROA 1NBWA 4YOTA 4DTJA 3ZX2A 4JI5K 3OHRA 4K43A 4DUZK 1HPMA 4RW6A 5HROA 2HHSA 3I8DA 5AQLA 4FJGA 3AAQA 1GLCG 3HM8A 3LANA 1TAUA 2YV0X 3B6PA 3PUFA 4G1QA 2FBYA 4LSNA 4NCBA 2GWJA 2IOCA 1H1VA 2QWLA 4FK4A 1EKEA 4PL7A 1IG9A 2KLAA 5GADP 4LF5K 5FPEA 2JWKA 2IDOA 2VWKA 2D0OA 5BREA 1ITGA 3D2FB 3VF2A 1N5YA 1BOTO 2HBKA 3TWHA 4FLVA 3L0QA 2F4VK 4DFJA 3ASMA 4IDHA 4AM6A 3NFAA 5C42A 4WQ4A 1DGKN 4H8KA 3ZX0A 1E3MA 2G8VA 1XHZA 1JLBA 2YJFA 1WSEA 2X6SA 1E4GT 2O8DB 1KLNA 4FK2A 2FF6A 2ZWHA 4BDYA 5JVGL 3PY8A 3TTCA 3NF6A 1L3SA 4CJWA 1RT7A 1GOBA 3L4IA 3ITHA 1S72N 4LF7K 4DSJA 1BI4A 2F7TA 3H45C 1NJIO 2FC0A 1HKCA 2J4RA 2OPQA 3A8YA 4NXMK 4ELUA 1XQSC 4OPJA 3VQDA 5JMVA 3S3NA 2O8EB 1EWRA 1IV0A 1QQMA 3CYMA 3CQYA 1YITN 4C8MA 1VSFA 4BQLA 4FJMA 4LD0A 4J2EA 2E6LA 3VQBA 4QOZB 5AQUA 2IIRA 2V7ZA 3QFPA 4JV5K 4RCHA 1HR0K 2W42A 3BP8A 4YHHK 3MECA 5JLFA 1NGHA 3ZETA 4KHYA 3NVKA 4CEBA 3FZMA 4X65K 1NJYA 3FZKA 3ID6A 1QQNA 4C8KA 4CHPA 5BPNA 2FSJA 1GLLO 5EU7A 1OH6A 2LSNA 4DTXA 4JRPA 2R7YA 1NJWA 3CCRN 4FWOA 4PL8A 5EOYA 4CHNA 1BGXT 4DQSA 3AVMA 3S41A 4U67L 3AVNA 3OYGA 1MU2A 1WSHA 3VEYA 3HP6A 1W97L 4F2SA 4X66K 3KZBA 4YNQA 1NGJA 3KD1E 2QM1A 3LP3A 3OY9A 4LF8K 3THVA 4I6MA 4HUGA 3OBWA 2KTQA 4BRDA 4WYBA 2XHBA 4LF9K 1ZBIA 3WNHA 2RE2A 1RTHA 3VEOA 5C2DA 3HOSA 2D0AA 3O8MA 4CJFA 3TSUA 2Z1IA 2OTLN 2HNZA 5EXWA 4EFHA 3THWB 3LDOA 4B1UB 2G8UA 3QBWA 1TK8A 2HVHA 3BUZB 1DEJA 4WF9L 1HUXA 1BUPA 4F8RA 1BCOA 3TSQA 3DXMB 3MX2A 5M1KA 3HTVA 5I42A 3QBXA 3V4IA 1J5EK 5SWMA 1VQPN 4Z4CA 3SQ0A 4X64K 1DT9A 3D2EB 3RRGA 3A5NC 3IAYA 2YKNA 2WONA 4DTPA 2KKZA 1KLMA 2ZD1A 1RNHA 4CK1A 4FM1A 3KWIA 3MN6A 1HKGA 1TAQA 2P9IB 2HSTA 3PV8A 2GUPA 5GINA 4W5OA 4BRGA 4BE0A 4EIAA 3E66A 4BQZA 5AQNA 3K57A 1BQNA 1LWFA 1NWKA 5J2MA 4H0YB 1L5UA 2HW3A 1QVGM 2P9KA 4KV8A 3CCUN 3LDPA 5KPRA 3ZSVA 1HYVA 3H1QA 4OPAA 2P9NB 4CZJA 1NOZA 3L2RA 4RW7A 4YOUA 3TAMA 1VRTA 3ATVA 4KHPK 5H1SQ 4CEOA 5JLHA 4CD3A 3SK3A 1Q7YO 2HHHK 1U2VA 1HJOA 3HJFA 3AAPA 4CJVA 4JI3K 3V9SA 5AJ3K 4DG1A 1OVQA 4E1JA 1S22A 3CD6N 1HPZA 4C8OA 4XEIA 1IO2A 5C12A 3U3YA 1LW0A 1LV5A 3VEVA 1KC8O 5M1PA 1RDUA 1NU0A 3K5LA 4HVJA 1L3VA 4JI7K 4H0TB 4PWDA 1SL0A 5AQGA 4E89A 3KK3A 1X9SA 4H5WA 4FOIA 4FPBA 1QZ5A 3WEEB 3WQTA 2QKBA 2F96A 4CEQA 3CJBA 3VEXA 3O1BA 4WE1A 3KIOA 2D5RA 4FJXA 3I0SA 1ZC6A 3EZWA 2DFEA 4GKKK 3OYFA 1FK9A 4O55A 4DKWA 2QKKA 3VA0A 1VHXA 1YJ9N 4CJLA 4CD1A 3N4QA 1Q9XA 3W0LA 4DQRA 4DV7K 1TGOA 3SMPA 1BIZA 2YNFA 3IG1A 3PSIA 4CF0A 2IAJA 5HOOA 1RT2A 4LFBK 4Z4FA 4Y0WA 1LAWA 3OYDA 3LZJA 3Q7CA 1WAFA 4OO1J 1S1XA 1RBTA 4A57A 1NMDA 3T7ZA 1IH7A 4GVEA 4M3YA 5AQOA 4IOAL 2G8FA 3H6EA 1XC9A 3B8AX 4N56A 1REVA 3FFIA 4FWPA 4ILHA 1B92A 4B9QA 3TU5A 2E2PA 4BRPA 1RT5A 3NCIA 1UWBA 4BACA 5J2QA 4CI6A 4X62K 2O8DA 3A0IX 3EZ5A 3R8EA 4FJ7A 3TTDA 3ZT3A 3CM6A 3LM2A 3OTOK 5KQ8A 1KAZA 3O4WA 2PYLA 2O8BB 1NGAA 4PQUA 1JLFA 3EL2A 3A2FA 4B9TA 4B8CA 1VK0A 4BRCA 3L2QA 4F4KA 3DWLA 1Q81O 3K5OA 2O8EA 1ZBFA 1LAVA 2NLXA 1QS4A 1WNSA 4FZYA 3LWMA 1K6YA 1JL2A 1EWQA 1KVBA 1RDAA 4DR5K 4PA1A 1WB9A 2Q2RA 1ESVA 4B9UA 1NK4A 1X9JA 3KKRA 1NK7A 3HPHA 4KHUA 1D4XA 3I33A 2QWPA 2A5XA 3HSCA 5B8HA 2G8HA 3SBTA 3JS6A 4H5NA 2HHWA 3NGYA 1S5JA 3TI0A 4KPYA 3VGMA 5T7BA 1FJGK 3Q7BA 3AVGA 3AA5X 4I2QA 3VPZA 2RPIA 3DJCA 3AA2A 4BRHA 3UB5A 3EE8A 3LP0A 4KI4A 3QEWA 3DRRA 3MAQA 3MMVA 1HNIA 1RBSA 4CZEA 4KHWA 4BRMA 3V9WA 3PX4A 3AO3A 2QWRA 3VTHA 4CZHA 1KXPA 4V19S 4AH9A 4C8NA 3OA9A 4RG8A 1BU6O 4M3WA 1VQKN 1V4SA 4ZTJA 3FFKB 3T1AA 2P9SB 4F3TA 2WTUA 4NYFA 4CHZA 3K9KA 1VSMA 4DTSA 2HVIA 3GE1A 1NJZA 4JI8K 2XY7A 4H0OA 1T7PA 3QDKA 2IVOA 4FW2A 1KFDA 1D9FA 3IDHA 4DTUA 1RT1A 1DTTA 3RR8A 4DSIA 2PZSA 4EHUA 3F9MA 4M3RA 3FZLA 3DI6A 2B4JA 4I7FA 1WOQA 1K8KB 1RCHA 1BHLA 4XH1A 3AVIA 3DXMA 3A5MC 3LM9A 4DS4A 4IEIA 1SZ2A 3ZEUB 2HNDA 4BDPA 3HK2A 2HBJA 3FR0A 1Z26A 4FM0A 4CBUA 1QQOA 1QZ6A 4CFBA 3M3ZA 3VEWA 2X6NA 4E7HA 5KRSA 2YNGA 3AY9A 3D2EA 3AARA 1YT3A 4O8KA 3TABA 4OPHA 3CCJN 4JNEA 3E01A 2OCEA 2UUCK 3C94A 2AA4A 4JN4A 3V1QA 1U47A 3CERA 5AQPA 4NCGA 3C95A 4BRFA 4CK2A 4UQGA 2ZJPL 3AVAA 2P9IA 3GL1A 2OZMA 3THXB 5TKYA 5SZTA 4Z4IA 1HJRA 4DF4A 1OH8A 4FLUA 4DSKA 4NLBA 1MWMA 1OKJA 1NLVA 3TSPA 1TKXA 3HSTB 3J8AA 3SAFA 2HHUA 4IOCL 3HZ6A 1KFSA 3K59A 2P9NA 3SV4A 1D5AA 1SL2A 1YUWA 2VGMA 3IFRA 2FLOA 4N76A 4BC4A 3NF7A 2E6MA 2W41A 1T03A 4MLHA 3RMBA 2FXUA 3QEXA 4AF1A 4YOWA 3VMFB 3CXCM 4LC9B 5GIOA 4DQQA 2KZMA 2UYTA 4AQYK 3TARA 4JK7A 3THYB 4RW8A 3IMXA 3DAWA 4DSEA 1SUQA 1NK8A 3E9LA 5KGXA 4BG9A 3GG4A 4CGJA 2VG7A 4Y1CA 2YHWA 4AILC 4QCLA 4IKFA 4FJHA 2ZF5O 1SKSA 4C23A 5KTQA 2V52B 1ATNA 1VSDA 3L3UA 3DYAA 3NHGA 2E2OA 3D7EO 3A5LC 3G4SN 3RRHA 1CXQA 2V7YA 3WEEA 3WNGA 1ASWA 3OYEA 4JI4K 1LOTB 4FWSA 2O8FA 5KRTA 4FLWA 4ZHRA 4BR5A 4DF8A 1GOCA 3AVFA 3BEXA 5KPTA 4ELVA 2DY4A 2P9UB 1S1WA 2YHYA 1KAXA 1RTJA 3GDQA 4AHUA 1RGIA 3LPUA 5JS2A 1YIJN 2H3GX 4KTZA 4DU4A 1ZXOA 4CEEA 4WQ4C 4FJ9A 4WFNL 4M3ZA 1G99A 1VQ4N 4E19A 2XO7A 2RN2A 4H0VB 3QEVA 1O1WA 3O3FA 4CGFA 3O80A 2W6KA 4CVNE 4H03B 4KRFA 4FOEA 2KQ2A 3WNFA 4CJ4A 4BY9C 3MK6A 4HTUA 4CJTA 1ZBUA 1C0GA 3L6QA 1YVUA 4DV4K 2KZZA 2KFZA 2IGIA 2FSKA 3CFRA 4CBXA 3V9ZA 3MXJA 3OW2M 4MO5A 1S6QA 4DR4K 2UXCK 3J7YP 2P9PA 1QVFM 1UOCA 2EHGA 2OYQA 1T3VA 1VRUA 4JD2B 4K0KK 1S1UA 2E8AA 1XI1A 5F2RA 1QTMA 3M8QA 2O8BA 3I55N 5E41A 2NRWA 3KK7A 1IKYA 3EKSA 3CCSN 2QXFA 2YNHA 5AZJB 3S3MA 1R59O 3CCVN 4H5RA 4FJJA 1I3AA 3SAHA 3CCMN 3TAFA 1BWFO 3BF3A 3TAEA 5IT9O 3V81A 3BZKA 1KRPA 3RR7A 3FZFA 4JLHA 3L2VA 1A5VA 4LSLA 3CFOA 5GAGP 2VWJA 3CMAN 2E88A 2JLEA 1N33K 4GNIA 4J8FA 4JRQA 4MO4A 1SKWA 2EWSA 3DRSA 1BIUA 3ZSYA 4DFMA 4B1ZA 4OLBA 1TYQB 4NCAA 4RW9A 5BRFA 3RMDA 4O5FA 3VQEA 1TL3A 5C15A 3S9HA 4KHQA 4DFKA 1OH5A 3O9UA 3VQ9A 2ASOA 4RTFD 1IBMK 3VEZA 4B3OA 2WOMA 3NGIA 4FJ5A 2QWQA 5ELZA 2HBLA
chains in the Genus database with same CATH topology
5BPLA 1KC8O 4G9ZA 1MWKA 1RDUA 5M1PA 5AZIA 3IUCA 3T69A 5GIPA 3EN9A 2GELA 3WXIA 4ILJA 4H0TB 1T44A 5AQGA 2A3ZA 2FSNA 3CJAA 3DXKB 3ZYYX 1KD1O 3C65A 2QI2A 4H5WA 3R3LA 4FOIA 4JKAA 5AQYA 1Q86O 4FPBA 1QZ5A 3WEEB 3VGKA 3WQTA 5LJVA 2NRTA 4WFAL 3CQXA 2BTFA 2P9SA 3CJBA 3VEXA 4A62A 4GV9A 3O1BA 1VQON 3WQUA 2RHKA 3CCLN 1ZC6A 3EZWA 3CJ9A 4CZFA 1TUYA 3P31A 4DKWA 4JKGB 3VEVA 1SAZA 2WC9A 4PKHA 2A40A 1YJ9N 3U9ZA 4CD1A 3N4QA 3A5OC 3EO3A 4H5TA 4FWQA 3W0LA 3HBTA 3N4PA 5AQSA 3LDNA 2WFBA 1QHAA 3SMPA 1JCGA 4NO7A 5CHIA 1YJWN 5EX5A 1K8KA 4ILGB 4Z94A 3I56N 5C2FA 5AFUA 2NRZA 3ZEUA 5F1XA 5HOOA 4H5VA 4Y0WA 3MX5A 2QTDA 4QS8A 2ASMA 2ZGZA 4ISEA 1VQ9N 3Q7CA 3P39A 1K8AO 4OO1J 3G71N 4YOYA 4YDUC 5E84A 4EHTA 4A57A 1NMDA 4JKDA 3T7ZA 1VQ8N 4IJAA 4GVEA 2WBNA 4IOXA 3SLCA 2F9TA 2A41A 1ZBSA 4BGAA 5AQOA 1S72N 4JHDB 3VF6A 4IOAL 2E1YA 3PIPL 2QWOA 3H6EA 2BUPA 4H0PA 3B8AX 1NM1A 1Z6RA 2E2NA 3KVGA 5BN9A 1OVYA 4O8UA 1YI2N 4K42A 4FWPA 4ILHA 2D1KA 4FWMA 1YAGA 3SJHA 4B9QA 4QS9A 1HX1A 3TU5A 2E2PA 4C1NK 4H0XB 2GX9A 4BRPA 4QS7A 5JVHL 1P90A 4CI6A 4R79A 4FPAA 4YOXA 1BG3A 3UKUA 3A0IX 5E26A 3R8EA 3C6HA 2KHOA 5AR0A 5BN8A 1W2BM 3TTDA 1SS6A 3LM2A 4KH5A 4A2AA 3O9TA 1BDGA 5KQ8A 1KAZA 3O4WA 5BR9A 1VQ5N 4YDUA 1V4TA 3NVMA 2Q31A 1NGAA 1VQNN 3UKRB 2CGKA 3EL2A 4NB4A 3WT0A 3AGKA 4BRAA 2I7PA 5BRDA 1NGDA 3M1FA 4BRCA 2ASPA 3MWTA 1Q18A 1MA9B 2WUSA 3DWLA 2DPNA 4FWNA 4C1NI 1Q81O 4M63C 4CZIA 5DM6L 2NLXA 4CZKA 3H46O 1NGCA 1P8ZA 3M6GA 4GV3A 3ATUA 2QEXN 3CPEA 2HF4A 4BRKA 3JXUA 2NRHA 4IXCA 3H3NO 3QFUA 5M1FA 4CJ7A 4PHTX 1EO1A 3C7NA 3BF1A 5BRHA 2Q2RA 3WXKA 3AGRA 5AQKA 1MDUB 2W40A 1ESVA 2GTDA 1BA1A 1U2VB 1GLEG 2P9LA 1X9JA 5TKWA 4BRQA 3SAFA 4IZ9A 2YCHA 3CCQN 1D4XA 3I33A 2QWPA 2A5XA 3HSCA 4BC3A 5B8HA 4WCEL 5LY3A 1RFQA 3JS6A 4H5NA 3SBTA 3CCEN 3E9OA 3UE5A 5GAEP 2OTJN 1YHQN 3VGMA 3Q7BA 4DHYA 3CJ7A 5AQXA 2Q0UA 3VPZA 1KQSM 2QWNA 3DJCA 5CR4A 4IEEA 1ATRA 5AQZA 2AP1A 3U8XA 4BRHA 3UB5A 3EE8A 5F0XA 1HLUA 2CGJA 3WUHA 1S3XA 5AZIB 1SQKA 4BC2A 4BR4A 2GEMA 5AQWA 3IKMA 4RWTA 3CETA 3MMVA 4A5AA 4CZEA 2V51B 2D0PA 2HF3A 3O5BA 4BRMA 1RDWX 4U7BA 2CH5A 1GLAG 2QWRA 3VTHA 4CZHA 1KXPA 4JKCA 2D4WA 3W3DA 4M7XA 4BR7A 2YX6A 4L3QA 2P9UA 3C0BA 1XC3A 3OA9A 2IVPA 1BU6O 3O1WA 3P4IA 3F5TA 3MN7A 4FL9A 1VQKN 1V4SA 1M90O 3FFKB 4BGBA 2P9SB 3ENHA 4B1VA 1GLFO 4BRIA 1DKGD 4XH4A 3PIOL 3K9KA 4BROA 4GV6A 1NBWA 3R6MA 4KH4A 4PKIA 4BG8A 3P38A 3O6WA 3GE1A 3I8BA 4YOTA 3O9SA 4BRLA 1VQ6N 3ZX2A 2CGLA 4H0OA 3QDKA 2IVOA 3OHRA 4K43A 3IDHA 1BO5O 1HPMA 3LL3A 3VERA 5DM7L 5M1OA 4EHUA 3F9MA 3FZLA 2VCPA 1M1KO 1WOQA 5AQLA 1K8KB 3AAQA 3PLAA 4XH1A 3RSEA 4A59A 1GLCG 3DXMA 3A5MC 3HM8A 3LM9A 4JKHA 3CC4N 3CJ1A 2QW9A 4IEIA 1SZ2A 3ZEUB 3D2FA 2GWJA 4ISFA 2HBJA 3CI5A 1H1VA 3FR0A 3F2KA 2E1ZA 2QWLA 4CBUA 1QQOA 1C0FA 2BH1A 4FWRA 4XH5A 3VF4A 1QZ6A 2PAVA 4BVOA 3M3ZA 2KLAA 5AQFA 3VEWA 4PL7A 5GADP 4K41A 5FPEA 2JWKA 1Q82O 3AY9A 3QB0A 3D2EA 5AQVA 5EVZA 2D0OA 5BREA 3AARA 3D2FB 1VQ7N 3CJCA 3VF2A 1BOTO 3EKUA 2HBKA 4O8KA 5AFUH 4OPHA 3CCJN 3WXJA 3G6EN 3L0QA 1U6ZA 4JNEA 3VTIA 4JEPA 2YJEA 3GOIA 2AA4A 3RVCA 4JD2A 4IDHA 4JN4A 4AM6A 2CH6A 3VESA 3CIPA 3FE1A 3CERA 5AQPA 4A2BA 4JAXA 4BRFA 4WQ4A 1DGKN 3ZX0A 4B1YB 3G25A 2ZJPL 2ZGYA 3MN5A 4YOVA 4BR9A 5JICA 2P9IA 3GL1A 2NNWA 2YJFA 5TKYA 3DLLL 1T6DA 4DQ8A 1E4GT 3UKUB 2FF6A 2ZWHA 3SAGA 2QWMA 4BC5A 4JK8A 5AZJA 5JVGL 2YI1A 4NLBA 5KQDA 1MWMA 1OKJA 3R1XA 3TTCA 1JCFA 1NLVA 3TSPA 4HTLA 5KPZA 5AQHA 3J8AA 1E4FT 3ENBA 3L4IA 3TPQA 2E20A 1NGFA 1KAYA 1VAZA 2F7TA 3H45C 3ZX3A 1HKCA 3CF5L 4IOCL 1NJIO 2J4RA 3A8YA 3HZ6A 3QMLA 2P9NA 3U9DA 4CZMA 4HWIA 1YVNA 1YUWA 2VGMA 1XQSC 3IFRA 4A5BA 2FLOA 4BC4A 4ISGA 1TUUA 5AQRA 5JMVA 1LCUA 1ILYA 1VQMN 1YXQA 2W41A 5FPNA 1YF5L 4MLHA 1QQMA 3O08A 1ATSA 2FXUA 3CQYA 1YITN 4AF1A 4YOWA 3VMFB 3VENA 3ULEA 4BQLA 3CXCM 4LC9B 5GIOA 1TYQA 4BVPA 4EAHD 2UYTA 1NGGA 5AQUA 2IIRA 2V7ZA 3QFPA 4JK7A 1Z05A 5GAHP 4RCHA 3FLCO 3IMXA 3ID8A 3BP8A 3DAWA 3MN9A 5ADXH 5JLFA 3C7NB 1GLJO 3CHWA 3E9LA 3ENOA 4M7YA 1NGHA 3ZETA 3GG4A 4BG9A 3NVKA 2ZJRL 2YHWA 1JJ2M 3E9PA 3FZMA 2P9LB 3FZKA 3ID6A 1QQNA 2ZF5O 1Y64A 5FPMA 4C23A 1WUAA 2FSJA 5BPNA 2V52B 1ATNA 4UY8O 1GLLO 2ZJQL 2FF3B 3CCRN 4FWOA 4PL8A 5EOYA 1HKBA 2NZTA 1NGBA 4B1XB 2E2OA 3S41A 2A6AA 4JKBA 3D7EO 3M5RA 3LDLA 4U67L 3A5LC 3G4SN 5AQTA 2Q36A 3VETA 2V7YA 5AQQA 3WEEA 4FSVA 3VEYA 1W97L 4FO0A 1VQLN 5EY4A 1LOTB 2OANA 4FWSA 2YHXA 4BRNA 1NGIA 3KZBA 1NGJA 2Q1NA 2Q0RA 3CC7N 2I7NA 2QM1A 4BR5A 2HBMA 3MDQA 4NLCA 3U4LA 1JCEA 3BEXA 3MWPA 5KPTA 4JKGA 3R9PA 2Q97A 4AM7A 1YJNN 4IWVA 4I6MA 4A61A 2P9UB 2YHYA 1KAXA 2PBDA 3OBWA 3GDQA 5HL7L 4BRDA 4WYBA 3GBTA 2VYPA 2RE2A 3VEOA 1RGIA 3KWGA 5C2DA 3HOSA 1YIJN 2H3GX 3C6AA 2HMPA 2JWLA 1ZXOA 3O8MA 4WQ4C 2QXLA 3MCPA 4FWLA 3TSUA 4MDAA 5M1NA 3HRGA 4WFNL 4I6MB 4BREA 2OTLN 4MDBA 5EXWA 4EFHA 1G99A 1VQ4N 3LDOA 3H1VX 4JKFA 4B1UB 4BR2A 3HI0A 3VGLA 3KHYA 2A42A 3QBWA 4H0VB 3BUZB 5C0YA 1X3MA 3O80A 2NRVA 3H3OB 3EE9A 5AQJA 1CZAN 1DEJA 4H03B 3SMSA 4CZLA 1EQYA 4WF9L 4IO9L 3FZHA 1HUXA 1BUPA 2GWKA 1NGEA 3RSEB 3TSQA 3MCAB 3DXMB 1T6CA 3MX2A 4FOEA 3WXMB 3CC2N 5M1KA 4JHDA 1O13A 3HTVA 3QBXA 5LJWA 3J7ZO 4BY9C 3MK6A 1C0GA 3L6QA 4KH6A 1VQPN 3LDQA 5AQMA 3NMUA 1N8RO 1DT9A 3O9QA 3D2EB 2PFUA 4GY2B 4FVUA 3A5NC 4DCHA 2FSKA 4IO8A 4CBXA 4DB3A 3OW2M 3QICA 1J6ZA 4MO5A 1BA0A 3TTFA 2P9PA 4MLEA 1QVFM 2VWBA 3HOTA 5M1QA 1T3VA 4JD2B 1K73O 2E8AA 3K9JA 2IVNA 5F2RA 2KKZA 3SBGA 3I55N 3KWIA 3MN6A 3CPWM 1HKGA 2P9IB 1IJJA 3UKRA 2HSTA 5MLCQ 2NRWA 3KK7A 2P9PB 2GUPA 4WQ5C 4CBWA 1X3NA 4CZGA 5C10A 5GINA 3EKSA 4BRGA 1IG8A 3CCSN 5I9EB 3VOVA 4EIAA 3E66A 5AZJB 4BQZA 4YORA 1R59O 3CCVN 4H5RA 5AQNA 3SAHA 1NWKA 3CCMN 2VGNA 2HOEA 2NRXA 4H0YB 1BWFO 4JK9A 2F9WA 3CMEN 1QVGM 2P9KA 3CCUN 3BF3A 3LDPA 5KPRA 1K9MO 1XUPO 3H1QA 4OPAA 5BPMA 4BR0A 2P9NB 1GLDG 4FWKA 4JKEA 4PKGA 5AQIA 2NRRA 4KBOA 5ADXA 3L4QA 4K25A 4CZJA 3FZFA 5FPDA 2E2QA 4YOUA 3ATVA 5GAGP 3CMAN 2E88A 4IFEA 3OBYA 4GNIA 5H1SQ 4J8FA 5JLHA 4CD3A 2P9KB 4MO4A 3SK3A 1Q7YO 4B1WB 2EWSA 3E1YA 1U2VA 3WXLA 1GLBG 3ULEB 4WFBL 3D6RA 1HJOA 4B1ZA 3AAPA 2ITMA 4F9OA 1TYQB 2QA4N 5BRFA 4O5FA 4WQ5A 4E1JA 1S22A 5C15A 3CD6N 4IJNA 3O9RA 3O9UA 2ASOA 4RTFD 3FGUA 4XEIA 3VEZA 5C12A 3ZETB 5CE3A 2QWQA 3DXKA 5ELZA 2HBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BPL A;  1MWK A;  5AZI A;  3IUC A;  3EN9 A;  2GEL A;  3WXI A;  4H0T B;  1T44 A;  5AQG A;  2A3Z A;  2FSN A;  3CJA A;  3DXK B;  4H5W A;  4FOI A;  5AQY A;  4FPB A;  1QZ5 A;  3WEE B;  3VGK A;  3WQT A;  5LJV A;  3CQX A;  2BTF A;  2P9S A;  3CJB A;  3VEX A;  4A62 A;  3O1B A;  3WQU A;  1ZC6 A;  3EZW A;  3CJ9 A;  4CZF A;  1TUY A;  3VEV A;  1SAZ A;  4PKH A;  2A40 A;  3U9Z A;  4CD1 A;  3A5O C;  3EO3 A;  4H5T A;  4FWQ A;  3W0L A;  3HBT A;  5AQS A;  3LDN A;  1QHA A;  3SMP A;  1JCG A;  4NO7 A;  5EX5 A;  1K8K A;  4Z94 A;  5AFU A;  3ZEU A;  5F1X A;  4H5V A;  4Y0W A;  4QS8 A;  2ASM A;  2ZGZ A;  4ISE A;  4YDU C;  5E84 A;  4EHT A;  1NMD A;  4IJA A;  3SLC A;  2F9T A;  2A41 A;  1ZBS A;  4BGA A;  5AQO A;  4JHD B;  3VF6 A;  2E1Y A;  2QWO A;  3H6E A;  2BUP A;  4H0P A;  3B8A X;  1NM1 A;  1Z6R A;  2E2N A;  3KVG A;  5BN9 A;  4K42 A;  4FWP A;  2D1K A;  4FWM A;  1YAG A;  3SJH A;  4B9Q A;  4QS9 A;  1HX1 A;  3TU5 A;  2E2P A;  4H0X B;  4BRP A;  4QS7 A;  4CI6 A;  4FPA A;  1BG3 A;  3UKU A;  3A0I X;  5E26 A;  3R8E A;  2KHO A;  5AR0 A;  5BN8 A;  3LM2 A;  4A2A A;  1BDG A;  5KQ8 A;  1KAZ A;  3O4W A;  5BR9 A;  4YDU A;  1V4T A;  2Q31 A;  1NGA A;  3UKR B;  2CGK A;  3EL2 A;  4NB4 A;  3WT0 A;  4BRA A;  2I7P A;  5BRD A;  1NGD A;  3M1F A;  4BRC A;  2ASP A;  4FWN A;  1Q18 A;  1MA9 B;  2WUS A;  3DWL A;  2DPN A;  4M63 C;  4CZI A;  2NLX A;  4CZK A;  3H46 O;  1NGC A;  1P8Z A;  3M6G A;  3ATU A;  2HF4 A;  4BRK A;  3JXU A;  2NRH A;  4IXC A;  3H3N O;  3QFU A;  4CJ7 A;  3C7N A;  3BF1 A;  5BRH A;  2Q2R A;  3WXK A;  5AQK A;  1MDU B;  2W40 A;  1ESV A;  2GTD A;  1BA1 A;  1U2V B;  1GLE G;  2P9L A;  1X9J A;  4BRQ A;  4IZ9 A;  2YCH A;  1D4X A;  3I33 A;  2QWP A;  2A5X A;  3HSC A;  4BC3 A;  5B8H A;  5LY3 A;  1RFQ A;  3JS6 A;  4H5N A;  3UE5 A;  3VGM A;  4DHY A;  3CJ7 A;  5AQX A;  2Q0U A;  3VPZ A;  2QWN A;  3DJC A;  1ATR A;  5AQZ A;  2AP1 A;  3U8X A;  4BRH A;  3UB5 A;  5F0X A;  1HLU A;  2CGJ A;  3WUH A;  1S3X A;  5AZI B;  1SQK A;  4BC2 A;  4BR4 A;  2GEM A;  5AQW A;  4RWT A;  3CET A;  3MMV A;  4CZE A;  2V51 B;  2D0P A;  2HF3 A;  3O5B A;  4BRM A;  1RDW X;  2CH5 A;  1GLA G;  2QWR A;  4CZH A;  1KXP A;  2D4W A;  3W3D A;  4M7X A;  4BR7 A;  4L3Q A;  2P9U A;  3C0B A;  1XC3 A;  3VER A;  2IVP A;  1BU6 O;  3O1W A;  3P4I A;  4FL9 A;  3MN7 A;  1V4S A;  3FFK B;  4BGB A;  2P9S B;  3ENH A;  4B1V A;  1GLF O;  4BRI A;  1DKG D;  4XH4 A;  4BRO A;  1NBW A;  3R6M A;  4BG8 A;  4PKI A;  3O6W A;  3GE1 A;  3I8B A;  4BRL A;  3ZX2 A;  2CGL A;  4H0O A;  3QDK A;  2IVO A;  3OHR A;  4K43 A;  3IDH A;  1BO5 O;  1HPM A;  3LL3 A;  4EHU A;  3F9M A;  3FZL A;  2VCP A;  1WOQ A;  5AQL A;  1K8K B;  3AAQ A;  4XH1 A;  3RSE A;  1GLC G;  3DXM A;  3A5M C;  3HM8 A;  3LM9 A;  3CJ1 A;  2QW9 A;  3ZEU B;  1SZ2 A;  3D2F A;  2GWJ A;  4ISF A;  3CI5 A;  1H1V A;  3FR0 A;  2E1Z A;  2QWL A;  4CBU A;  1QQO A;  1C0F A;  4FWR A;  4XH5 A;  3VF4 A;  4BVO A;  1QZ6 A;  2PAV A;  4PL7 A;  3M3Z A;  5AQF A;  3VEW A;  4K41 A;  5FPE A;  3AY9 A;  3QB0 A;  3D2E A;  5AQV A;  5EVZ A;  2D0O A;  5BRE A;  3AAR A;  3D2F B;  3CJC A;  3VF2 A;  1BOT O;  3EKU A;  4O8K A;  5AFU H;  3WXJ A;  3L0Q A;  1U6Z A;  4JNE A;  2YJE A;  3GOI A;  2AA4 A;  4JD2 A;  4JN4 A;  4AM6 A;  3VES A;  3CIP A;  3FE1 A;  3CER A;  5AQP A;  4A2B A;  4JAX A;  4BRF A;  4WQ4 A;  1DGK N;  3ZX0 A;  4B1Y B;  3G25 A;  2ZGY A;  3MN5 A;  4BR9 A;  5JIC A;  2P9I A;  3GL1 A;  5TKY A;  2YJF A;  1T6D A;  4DQ8 A;  1E4G T;  3UKU B;  2FF6 A;  2ZWH A;  2QWM A;  4BC5 A;  5AZJ A;  2YI1 A;  5KQD A;  1MWM A;  1OKJ A;  1JCF A;  1NLV A;  4HTL A;  5KPZ A;  5AQH A;  3J8A A;  1E4F T;  3L4I A;  3TPQ A;  3ZX3 A;  2E20 A;  1NGF A;  1KAY A;  3H45 C;  1HKC A;  2J4R A;  3A8Y A;  3HZ6 A;  3QML A;  2P9N A;  3U9D A;  4CZM A;  4HWI A;  1YVN A;  1YUW A;  1XQS C;  3IFR A;  2FLO A;  4BC4 A;  4ISG A;  1TUU A;  5AQR A;  5JMV A;  1LCU A;  1YXQ A;  2W41 A;  5FPN A;  4MLH A;  1QQM A;  3O08 A;  1ATS A;  2FXU A;  3CQY A;  3VEN A;  3ULE A;  4BQL A;  4LC9 B;  1TYQ A;  4BVP A;  4EAH D;  2UYT A;  1NGG A;  5AQU A;  2IIR A;  2V7Z A;  3QFP A;  1Z05 A;  4RCH A;  3FLC O;  3IMX A;  3ID8 A;  3BP8 A;  3DAW A;  3MN9 A;  5ADX H;  5JLF A;  3C7N B;  1GLJ O;  3CHW A;  3ENO A;  4M7Y A;  1NGH A;  3ZET A;  3GG4 A;  4BG9 A;  2YHW A;  3FZM A;  2P9L B;  3FZK A;  1QQN A;  2ZF5 O;  1Y64 A;  5FPM A;  4C23 A;  1WUA A;  2FSJ A;  5BPN A;  2V52 B;  1ATN A;  1GLL O;  2FF3 B;  4FWO A;  4PL8 A;  5EOY A;  1HKB A;  2NZT A;  1NGB A;  4B1X B;  2E2O A;  3S41 A;  2A6A A;  3D7E O;  3LDL A;  3A5L C;  5AQT A;  2Q36 A;  3VET A;  2V7Y A;  5AQQ A;  3WEE A;  4FSV A;  3VEY A;  4FO0 A;  5EY4 A;  1LOT B;  2OAN A;  4FWS A;  2YHX A;  4BRN A;  1NGI A;  3KZB A;  1NGJ A;  2Q1N A;  2Q0R A;  2I7N A;  2QM1 A;  4BR5 A;  3MDQ A;  3U4L A;  1JCE A;  3BEX A;  5KPT A;  3R9P A;  2Q97 A;  4AM7 A;  4IWV A;  4I6M A;  4A61 A;  2P9U B;  2YHY A;  1KAX A;  2PBD A;  3GDQ A;  4BRD A;  4WYB A;  3GBT A;  2VYP A;  3VEO A;  1RGI A;  2H3G X;  2HMP A;  1ZXO A;  3O8M A;  4WQ4 C;  2QXL A;  3MCP A;  4FWL A;  4I6M B;  4BRE A;  5EXW A;  4EFH A;  1G99 A;  3LDO A;  3H1V X;  4B1U B;  4BR2 A;  3HI0 A;  3VGL A;  3KHY A;  2A42 A;  3QBW A;  4H0V B;  3BUZ B;  1X3M A;  3O80 A;  3H3O B;  5AQJ A;  1CZA N;  1DEJ A;  4H03 B;  3SMS A;  4CZL A;  1EQY A;  3FZH A;  1HUX A;  1BUP A;  2GWK A;  1NGE A;  3RSE B;  3DXM B;  1T6C A;  4FOE A;  4JHD A;  3HTV A;  3QBX A;  5LJW A;  3MK6 A;  1C0G A;  3L6Q A;  3LDQ A;  5AQM A;  3D2E B;  4GY2 B;  3A5N C;  4DCH A;  2FSK A;  4IO8 A;  4CBX A;  4DB3 A;  3QIC A;  1J6Z A;  4MO5 A;  1BA0 A;  2P9P A;  4MLE A;  2VWB A;  4JD2 B;  2E8A A;  2IVN A;  5F2R A;  3MN6 A;  1HKG A;  2P9I B;  1IJJ A;  3UKR A;  2P9P B;  2GUP A;  4WQ5 C;  4CBW A;  1X3N A;  4CZG A;  3EKS A;  4BRG A;  1IG8 A;  5I9E B;  3VOV A;  4EIA A;  5AZJ B;  4BQZ A;  1R59 O;  4H5R A;  5AQN A;  1NWK A;  4H0Y B;  2HOE A;  1BWF O;  2F9W A;  2P9K A;  3BF3 A;  3LDP A;  5KPR A;  1XUP O;  3H1Q A;  5BPM A;  4BR0 A;  2P9N B;  1GLD G;  4FWK A;  4PKG A;  5AQI A;  4KBO A;  5ADX A;  4K25 A;  4CZJ A;  3FZF A;  5FPD A;  2E2Q A;  3ATV A;  2E88 A;  4GNI A;  4J8F A;  5JLH A;  4CD3 A;  2P9K B;  4MO4 A;  3SK3 A;  4B1W B;  2EWS A;  1U2V A;  3WXL A;  1GLB G;  3ULE B;  1HJO A;  4B1Z A;  3AAP A;  2ITM A;  4F9O A;  1TYQ B;  5BRF A;  4O5F A;  4WQ5 A;  4E1J A;  1S22 A;  4IJN A;  2ASO A;  4RTF D;  3FGU A;  4XEI A;  3VEZ A;  3ZET B;  5CE3 A;  2QWQ A;  3DXK A;  5ELZ A;  2CH6 A; 
#chains in the Genus database with same CATH topology
 4CEZ A;  1W7A A;  3QNO A;  5J2P A;  1MWK A;  4CFD A;  3T69 A;  1RDB A;  3EN9 A;  2GEL A;  4FJL A;  4O5B A;  1T44 A;  1NKB A;  5FRN A;  1U4B A;  3DXK B;  3KLE A;  3OYL A;  4J2B A;  1KD1 O;  5AQY A;  2P51 A;  1U48 A;  3VGK A;  4WFA L;  5LJV A;  3OYJ A;  3CQX A;  2P9S A;  1T05 A;  2Z1H A;  3WQU A;  3ZCM A;  3L3V A;  1VSK A;  2RHK A;  4NYN A;  2D0B A;  3HVR A;  3P31 A;  1L3T A;  4JKG B;  4PKH A;  2A40 A;  3EO3 A;  3SJJ A;  1Z25 A;  3QO9 A;  1JCG A;  4NO7 A;  1HYS A;  1K8K A;  4ILG B;  1JLA A;  5C2F A;  3C6U A;  4OKJ A;  2NRZ A;  2VQE K;  1JLG A;  3ZEU A;  5F1X A;  1N34 K;  2QTD A;  4FZZ A;  2ZGZ A;  3SUP A;  1HYZ A;  3G71 N;  4EHT A;  3AVL A;  3JYT A;  3NE6 A;  3D45 A;  1XNR K;  4JKD A;  1VQ8 N;  4IJA A;  4IOX A;  1ZBS A;  1U04 A;  3MEG A;  2E1Y A;  2BUP A;  4H0P A;  1NM1 A;  3DLB A;  1EXQ A;  1YI2 N;  4CGI A;  4FWM A;  3EYZ A;  3SJH A;  1QSS A;  2BDP A;  4C1N K;  4H0X B;  1P90 A;  3THX A;  4J2A A;  4FPA A;  4YOX A;  2XY5 A;  2B6A A;  3ZT0 A;  4L8R B;  3VQ7 A;  1WN7 A;  3KJV A;  5CZ2 A;  2DFH A;  2JGU A;  1XWL A;  3SPY A;  1SS6 A;  3MED A;  3O9T A;  3M8S A;  4HUF A;  4DMN A;  4ID5 A;  4IG3 A;  3NVM A;  4CES A;  2Q31 A;  1SV5 A;  3UKR B;  4NB4 A;  3WT0 A;  3IRX A;  4OKE A;  2ASP A;  3MWT A;  4FWN A;  1J54 A;  1MA9 B;  4M63 C;  3CM5 A;  1P8Z A;  3ATU A;  3DLG A;  4K8Z A;  4OGE A;  3T3F A;  4IXC A;  3THY A;  3SQ4 A;  4CJ7 A;  5BRH A;  3OYC A;  4AHS A;  2FBV A;  1C0T A;  1J5O A;  1BA1 A;  1GLE G;  4BRQ A;  3NF8 A;  3CCQ N;  2YCH A;  3H08 A;  4BC3 A;  1KTQ A;  3VQP A;  1RFQ A;  3CCE N;  3LZI A;  2OPR A;  4MFB A;  1Q8I A;  4Z0U A;  3LAM A;  1KQS M;  2QWN A;  3O4N A;  4IEE A;  5AQZ A;  3TAP A;  3AO5 A;  3U8X A;  5F0X A;  2X78 A;  3O3G A;  3ZT2 A;  2QK9 A;  4KO0 A;  4BC2 A;  3IKM A;  1KCF A;  3CET A;  5CZ1 A;  4JS5 A;  2V51 B;  3ZT4 A;  3QNN A;  3O5B A;  2A1R A;  2YX6 A;  3J81 O;  2P9U A;  3VER A;  2IVP A;  3P4I A;  4FL9 A;  3NH1 A;  1X9M A;  1UAX A;  2HHT A;  3JAM O;  4BGB A;  4B1V A;  1GLF O;  4LH5 A;  4N5S A;  4FCY A;  4BG8 A;  4KH4 A;  4IFY A;  3P38 A;  3O6W A;  1RDC A;  4BRL A;  4DV0 K;  1VQ6 N;  2EX3 A;  3ALY A;  3KK2 A;  3TAG A;  3SUO A;  1BO5 O;  4CW7 B;  4B9N A;  2VCP A;  1NK0 A;  1BCM A;  1I39 A;  1R0A A;  3PX0 A;  4A59 A;  4CED A;  2QW9 A;  2ZQB A;  3NBP A;  3D2F A;  4LFA K;  4OLA A;  1VQ9 N;  1C0F A;  2BH1 A;  4BVO A;  3VF4 A;  1I94 K;  4DTO A;  5J2N A;  2ITG A;  3QB0 A;  5AQV A;  5EVZ A;  4FLY A;  4CE9 A;  3EKU A;  4BWJ A;  3G6E N;  1N6Q A;  1U6Z A;  4JEP A;  4Z4E A;  4JD2 A;  3VES A;  3CIP A;  4A2B A;  3ZSO A;  4JAX A;  4B1Y B;  3G25 A;  3MN5 A;  3IS9 A;  1JLC A;  2NNW A;  1J9A A;  2XRI A;  3UKU B;  4DV3 K;  1CZ9 A;  3SAG A;  4BC5 A;  5AZJ A;  4JK8 A;  3M8R A;  5KQD A;  3KKS A;  5KPZ A;  3CFP A;  5AQH A;  3TPQ A;  1E4F T;  3ENB A;  2E20 A;  1NGF A;  1KAY A;  1VAZ A;  3QML A;  3U9D A;  4CGG A;  4DQI A;  3SI6 A;  1YVN A;  1TUU A;  5AQR A;  4B9V A;  1LCU A;  1ILY A;  3VQC A;  3QIO A;  4KB0 A;  2DFF A;  5FPN A;  4C8L A;  3O08 A;  4IBN A;  3VEN A;  1XMO K;  1XNQ K;  1YTU A;  1TYQ A;  1VSI A;  4BVP A;  4DLG A;  2KFN A;  1W9H A;  1NGG A;  1VSE A;  1Z05 A;  5GAH P;  3FLC O;  3ID8 A;  3C7N B;  3ENO A;  3CHW A;  4DR3 K;  2ZJR L;  3V9U A;  2P9L B;  4BE2 A;  2KW4 A;  4RW4 A;  1WBB A;  1WUA A;  2HMI A;  4FW1 A;  4OVL A;  2FF3 B;  3RTV A;  3LWL A;  2VQF K;  1Q9Y A;  1HKB A;  4B1X B;  2A6A A;  4JKB A;  3M5R A;  4CJE A;  4B3R K;  3KD5 E;  5AQT A;  2Q36 A;  3VET A;  3L2W A;  4CK3 A;  5AQQ A;  1T8E A;  1SL1 A;  3NGZ A;  5KI6 A;  4KTW A;  5EY4 A;  2OAN A;  1C0M A;  2YHX A;  1NGI A;  4W5R A;  4FM2 A;  2Q1N A;  2Q0R A;  2I7N A;  4H4O A;  3OS2 A;  3U4L A;  1JCE A;  4CIF A;  3MWP A;  4JKG A;  4AM7 A;  1YJN N;  4DR7 K;  3BY5 A;  4A61 A;  3THW A;  3GBT A;  3AO2 A;  4EZ6 A;  2RF2 A;  3C6A A;  2HMP A;  1XHX A;  3TR8 A;  3MCP A;  5M1N A;  4MDA A;  4I6M B;  2NUB A;  3MEE A;  4MDB A;  3H1V X;  4DR2 K;  4FJN A;  3VGL A;  1N32 K;  1X3M A;  2OPP A;  2NRV A;  3H3O B;  3DRP A;  5AQJ A;  5HRR A;  3AO1 A;  3SMS A;  1EQY A;  2GWK A;  4OX9 K;  3RSE B;  3MCA B;  1XMQ K;  1JXE A;  3WXM B;  3PO5 A;  3CC2 N;  4CGH A;  3V1O A;  3J7Z O;  2BE2 A;  4R5P A;  3P83 D;  4KH6 A;  5AQM A;  4KTQ A;  3HT3 A;  4TSX A;  1N8R O;  2ETJ A;  1BQM A;  4GY2 B;  1U45 A;  1JL1 A;  4FVU A;  4E0D A;  4DB3 A;  4GKJ K;  3QIC A;  1J6Z A;  5K14 A;  2DTU A;  1FXX A;  3TTF A;  3VQ4 A;  4B8A B;  3HOT A;  5M1Q A;  3QET A;  4GVM A;  1K73 O;  3K9J A;  3L2U A;  2IVN A;  2GV9 A;  3SBG A;  3ZSZ A;  3CPW M;  3UKR A;  5MLC Q;  3TAN A;  3VQ5 A;  1FKP A;  4F2R A;  4CZG A;  4WQ5 C;  4CBW A;  1TK5 A;  1X3N A;  5C10 A;  4DFP A;  1HMV A;  1VSH A;  4H4M A;  4YOR A;  1ZYQ A;  4DS5 A;  1HNX K;  2X74 A;  3CME N;  3EEQ A;  4CGD A;  1QQC A;  4W5T A;  4BR0 A;  1GLD G;  4JKE A;  3OYB A;  5AQI A;  5ADX A;  2NRR A;  4KBO A;  4EP4 A;  3L4Q A;  4HCC A;  4K25 A;  5FPD A;  4I9L A;  4LH4 A;  5CYQ A;  2E2Q A;  3OBY A;  2P9K B;  3CG7 A;  3E1Y A;  3ULE B;  1TL1 A;  4OJR A;  2ITM A;  4F9O A;  4OPK A;  3O4Q A;  4WQ5 A;  3O9R A;  1YTA A;  4CJS A;  1HNV A;  4DSF A;  2BGG A;  2CH6 A;  4CJ5 A;  3ZLJ A;  1NNE A;  4G9Z A;  2FBT A;  5GIP A;  4B9M A;  3B6O A;  4ILJ A;  2XY8 A;  3QEP A;  4CJQ A;  2FSN A;  3CJA A;  3ZYY X;  3VQQ A;  4N41 A;  2QI2 A;  1Q86 O;  3ZSX A;  3DMJ A;  2BTF A;  3QIP A;  4DU3 A;  4CER A;  1TUY A;  3AVJ A;  4IDK A;  4CCH A;  2D0C A;  3U9Z A;  4FWQ A;  1RT4 A;  3N4P A;  5AQS A;  4CIE A;  3LDN A;  1QE1 A;  1QHA A;  2IC3 A;  1RT6 A;  2F8S A;  1B9D A;  5CHI A;  1YJW N;  1KSP A;  3RMA A;  4FLT A;  4H5V A;  4BWM A;  4CEF A;  4QS8 A;  3HYF A;  4ISE A;  4FLZ A;  4HCB A;  1K8A O;  4B3M K;  1RBU A;  4YOY A;  5E84 A;  4DV5 K;  2WBN A;  3SLC A;  4BGA A;  3LP1 A;  4JHD B;  3AVB A;  3PIP L;  2QWO A;  3LPT A;  3V6D A;  1Z6R A;  2E2N A;  3ZT1 A;  4K42 A;  1YAG A;  3AVH A;  5JVH L;  2P1J A;  1QSY A;  3DM2 A;  3TAQ A;  4R79 A;  4EP5 A;  3HPO A;  1BG3 A;  3UKU A;  5BR8 K;  4E1N A;  5E26 A;  1IBK K;  2RKI A;  4ID1 A;  3S3O A;  2KHO A;  5AR0 A;  5BN8 A;  1W2B M;  2HHX A;  4KH5 A;  4A2A A;  2HB5 A;  5BR9 A;  2YHA A;  1VQ5 N;  1V4T A;  4Q5V A;  4B9L A;  1S1T A;  1VQN N;  3KK1 A;  2CGK A;  1QHT A;  3AGK A;  3HVT A;  5BRD A;  3LAK A;  1NGD A;  1KVC A;  4JI0 K;  4AHC A;  4C1N I;  2WUS A;  4DQP A;  4CZI A;  5DM6 L;  3H46 O;  4KI6 A;  1X9W A;  3AVC A;  3F9K A;  3CPE A;  3SCX A;  2UUA K;  4CF8 A;  4BRK A;  3JXU A;  1WBD A;  1A5X A;  3O3H A;  2G8K A;  3H3N O;  3QFU A;  1EO1 A;  3C7N A;  3K5M A;  3AGR A;  4MQ3 A;  2OZS A;  5C24 A;  2P9L A;  5TKW A;  5LMU K;  1NKC A;  4IZ9 A;  1C0U A;  3NDK A;  2P5G A;  1WLJ A;  3OYA A;  4Z4G A;  3E9O A;  3UE5 A;  5J1E A;  3QER A;  5GAE P;  2O4I A;  2Z1G A;  3K58 A;  3OYH A;  3CJ7 A;  5AQX A;  3SQ1 A;  3U6F A;  1S6P A;  2AP1 A;  5FRO A;  3T19 A;  1HLU A;  3WUH A;  4ZTF A;  5AZI B;  1SQK A;  2B5J A;  1FKO A;  4BR4 A;  4DLE A;  4O0I A;  2D0P A;  1RDW X;  4U7B A;  3DOL A;  1GLA G;  3ZSQ A;  4JKC A;  3OYN A;  2D4W A;  2P5O A;  4LY7 A;  3HM9 A;  4L3Q A;  3SZ2 A;  3O1W A;  4DU1 A;  4CHO A;  4ICL A;  1EET A;  3ENH A;  3PX6 A;  4M3U A;  5FRM A;  4KHS A;  1ASV A;  2E4L A;  2Y1J A;  1QSL A;  4GV6 A;  3R6M A;  4PKI A;  1U49 A;  3I8B A;  3O9S A;  3NH0 A;  3HPG A;  2CGL A;  2F8T A;  3LL3 A;  4M42 A;  1B9F A;  5M1O A;  5DM7 L;  4CJR A;  4DWI A;  4KKO A;  1M1K O;  1IKX A;  4PY5 A;  1ASU A;  5HRN A;  3PLA A;  3P5J A;  3RSE A;  2YHB A;  3CC4 N;  4JKH A;  3CJ1 A;  3OJU A;  1S9G A;  4ISF A;  3CI5 A;  2ATQ A;  1C1C A;  3F2K A;  2E1Z A;  5CYM A;  3PIO L;  4FWR A;  4XH5 A;  2PAV A;  5AQF A;  1EX4 A;  1RBV A;  4E7L A;  1RT3 A;  4IG0 A;  4K41 A;  1Q82 O;  4FJI A;  1IBL K;  1VQ7 N;  3CJC A;  5AFU H;  3WXJ A;  1CLQ A;  3VTI A;  1VSL A;  4LF4 K;  2YJE A;  1ZBH A;  3GOI A;  3SUQ A;  3RVC A;  2IS3 A;  2O4G A;  4DTM A;  3FE1 A;  3HP9 A;  4O4G A;  4YFU A;  2ZGY A;  4YOV A;  4BR9 A;  5JIC A;  5HLF A;  3QES A;  3DLL L;  1T6D A;  4DQ8 A;  4E1M A;  1WSG A;  4W5N A;  5DMR A;  2QWM A;  2G8W A;  3K2P A;  2YI1 A;  3R1X A;  1JCF A;  4B3T K;  4HTL A;  3RMC A;  1TV6 A;  3ZX3 A;  3CF5 L;  3KLI A;  4CZM A;  4HWI A;  1OH7 A;  4DR6 K;  4A5B A;  3KTQ A;  4ISG A;  1VQM N;  1YXQ A;  1YF5 L;  1ATS A;  1C6V A;  3ULE A;  3ZSR A;  3ULD A;  1JLE A;  3SUN A;  3WNE A;  4EAH D;  1NK9 A;  4XIU A;  3T1H K;  1DLO A;  4GMJ B;  4GW6 A;  3DLH A;  4JI2 K;  5ADX H;  3MN9 A;  3QLH A;  1GLJ O;  4M7Y A;  1N36 K;  1GOA A;  3NF9 A;  4AHV A;  1JJ2 M;  2Z1J A;  3E9P A;  4IFV A;  4DV6 K;  1JXB A;  3L8B A;  1Y64 A;  5FPM A;  4UY8 O;  4CJU A;  2ZJQ L;  5A2Q O;  1LWC A;  3AA3 A;  2GBZ A;  2NZT A;  3U3G A;  1NGB A;  5KGW A;  2Q3S A;  3LDL A;  4JI6 K;  4PUO A;  3G0Z A;  1TK0 A;  4DV2 K;  4FSV A;  3V1R A;  1VQL N;  4FO0 A;  5FDL A;  2YNI A;  4BRN A;  2O8C B;  4EZ9 A;  2ZE2 A;  3CC7 N;  4CF9 A;  2HBM A;  3MDQ A;  4NLC A;  3KLF A;  1NKE A;  4FYD A;  3R9P A;  2Q97 A;  4O0J A;  1W0H A;  4IWV A;  3EY1 A;  4E7J A;  3P1G A;  2PBD A;  4FVM A;  5HL7 L;  2O8F B;  2VYP A;  3KWG A;  4M45 A;  3J80 O;  2JWL A;  2QXL A;  4FWL A;  1C1A A;  4ELT A;  3HRG A;  4BRE A;  3AV9 A;  4JKF A;  3DLR A;  4BR2 A;  4CJ3 A;  3HI0 A;  5DK5 A;  4M3T A;  3KHY A;  2A42 A;  4F3O A;  3JSM A;  5C0Y A;  3KLH A;  5LMN K;  2HHQ A;  2UXD K;  3NAE A;  4LF6 K;  1FW6 A;  1J53 A;  3EE9 A;  3AVK A;  3HXM A;  1CZA N;  4CZL A;  4IO9 L;  2W6L A;  3FZH A;  1HQE A;  3BDP A;  1NGE A;  4JS4 A;  1T6C A;  3AA4 A;  4JHD A;  1O13 A;  3OYI A;  5LJW A;  3M8P A;  4CFA A;  4CJP A;  3LDQ A;  4K8X A;  1NG9 A;  3SV3 A;  3NMU A;  2AJQ A;  1TKT A;  3O9Q A;  1D8Y A;  2PFU A;  4DTR A;  2UUB K;  4Q0B A;  4DCH A;  4IO8 A;  5C25 A;  1BA0 A;  2I5J A;  4MLE A;  3K5N A;  5I3U A;  3QEI A;  2VWB A;  4KAZ A;  5CY4 A;  4NXN K;  1RBR A;  2FBX A;  3SQ2 A;  3OS0 A;  1IJJ A;  2HNY A;  3LP2 A;  2P9P B;  3VN5 A;  1VSJ A;  1IG8 A;  1G15 A;  5I9E B;  3VOV A;  1CZB A;  4CF2 A;  2VGN A;  2HOE A;  1JKH A;  2NRX A;  4JK9 A;  4OGC A;  2F9W A;  1A5W A;  1RDD A;  1BI4 B;  1EP4 A;  1K9M O;  1XUP O;  5BPM A;  1S1V A;  4FWK A;  4PKG A;  5LL6 Z;  1IKW A;  4DTN A;  2UU9 K;  4QAG A;  4DUY K;  1C1B A;  4IFE A;  2VG6 A;  3G10 A;  2GUI A;  2XY6 A;  4B1W B;  3WXL A;  4WFB L;  1GLB G;  3D6R A;  4BDZ A;  2QA4 N;  1WSF A;  4DR1 K;  4E7K A;  3AO4 A;  1IKV A;  4YY3 K;  3D0P A;  4CIG A;  4IJN A;  3FGU A;  3BGR A;  5IWA K;  3DLK A;  3ZET B;  5CE3 A;  3DXK A;  5BPL A;  3UIQ A;  5AZI A;  3IUC A;  1WSI A;  2OPS A;  4LFC K;  3DLE A;  1BL3 A;  3WXI A;  1TVR A;  2E5L K;  1RTI A;  2A3Z A;  4KB1 A;  1WSJ A;  5HRS A;  3VQ8 A;  3C65 A;  3R3L A;  4JKA A;  4FXD A;  2NRT A;  5HRP A;  2Y1I A;  4A62 A;  4GV9 A;  1VQO N;  3HO1 A;  3OVN A;  3CCL N;  4B3S K;  4DSL A;  3CJ9 A;  1WAJ A;  3RWU A;  4CZF A;  2A1S A;  2BAN A;  4CF1 A;  1RTD A;  1SAZ A;  2WC9 A;  3NH2 A;  3HL8 A;  3A5O C;  4H5T A;  3OS1 A;  1TKD A;  3HBT A;  2WFB A;  4CHQ A;  4CJK A;  1HNW K;  1RIL A;  5EX5 A;  4Z94 A;  3I56 N;  5AFU A;  3SNN A;  4FJK A;  1DTQ A;  1KVA A;  4B08 A;  4OKK A;  3MX5 A;  2ASM A;  1D9D A;  1NJX A;  3OJS A;  3P39 A;  3T1Y K;  4CEA A;  3QIN A;  3LDS A;  3SYZ A;  4E7I A;  4YDU C;  4N47 A;  1NK5 A;  1HQU A;  3OYK A;  3SPZ A;  2F9T A;  2A41 A;  1HRH A;  3VF6 A;  4M3X A;  3KVG A;  4I2P A;  5BN9 A;  4W5Q A;  1OVY A;  4O8U A;  4JI1 K;  2D1K A;  4AHR A;  1HNZ K;  4QS9 A;  1HX1 A;  4O44 A;  2GX9 A;  3V9X A;  4QS7 A;  4FK0 A;  1F21 A;  3VQA A;  3K0S A;  1NMN A;  1UA1 A;  3C6H A;  5HP1 A;  1LW2 A;  4CHY A;  4KRE A;  1TKZ A;  3VQ6 A;  1BDG A;  3ISN C;  1X1P A;  4YDU A;  3MXI A;  4FLX A;  3CQ8 A;  4BRA A;  2I7P A;  1SKR A;  3M1F A;  1Q18 A;  3BZC A;  2DPN A;  1ZBL A;  4CFC A;  3VA3 A;  4KHN A;  5JS1 A;  4J2D A;  4CZK A;  3M6G A;  1NGC A;  4GV3 A;  2PY5 A;  2QEX N;  2YKM A;  3OYM A;  3C6T A;  4Z4H A;  4FJ8 A;  5HBM A;  2HF4 A;  2ZM6 K;  2G8I A;  4FZX C;  1LWE A;  3F73 A;  2HHV A;  2NRH A;  3LAL A;  5M1F A;  5FLX O;  2UXB K;  5D3G A;  4PHT X;  1Y97 A;  3BF1 A;  3WXK A;  4CEC A;  5AQK A;  4B9S A;  1MDU B;  2W40 A;  2GTD A;  1NOY A;  1U2V B;  4JYA K;  4M41 A;  1BIS A;  4WCE L;  5LY3 A;  4DV1 K;  2PYJ A;  1CXU A;  2OTJ N;  1YHQ N;  4AHT A;  4DHY A;  2VG5 A;  1UA0 A;  3PO4 A;  4I9Q A;  3J7A P;  2Q0U A;  5CR4 A;  1ATR A;  4HHT A;  3KLG A;  2CGJ A;  4KFB A;  1S3X A;  3DOK A;  2O8C A;  2OA8 A;  4Y1D A;  2GEM A;  4HUE A;  5AQW A;  4RWT A;  4A5A A;  2HF3 A;  4BE1 A;  2CH5 A;  3MXM A;  3W3D A;  3I0R A;  4M7X A;  4BR7 A;  1NK6 A;  1S9E A;  3C0B A;  1XC3 A;  3PSF A;  3F5T A;  3MN7 A;  1M90 O;  3ZSW A;  1JLQ A;  4BRI A;  4E3S A;  1DKG D;  1L3U A;  4XH4 A;  4BRO A;  1NBW A;  4YOT A;  4DTJ A;  3ZX2 A;  4JI5 K;  3OHR A;  4K43 A;  4DUZ K;  1HPM A;  4RW6 A;  5HRO A;  2HHS A;  3I8D A;  5AQL A;  4FJG A;  3AAQ A;  1GLC G;  3HM8 A;  3LAN A;  1TAU A;  2YV0 X;  3B6P A;  3PUF A;  4G1Q A;  2FBY A;  4LSN A;  4NCB A;  2GWJ A;  2IOC A;  1H1V A;  2QWL A;  4FK4 A;  1EKE A;  4PL7 A;  1IG9 A;  2KLA A;  5GAD P;  4LF5 K;  5FPE A;  2JWK A;  2IDO A;  2VWK A;  2D0O A;  5BRE A;  1ITG A;  3D2F B;  3VF2 A;  1N5Y A;  1BOT O;  2HBK A;  3TWH A;  4FLV A;  3L0Q A;  2F4V K;  4DFJ A;  3ASM A;  4IDH A;  4AM6 A;  3NFA A;  5C42 A;  4WQ4 A;  1DGK N;  4H8K A;  3ZX0 A;  1E3M A;  2G8V A;  1XHZ A;  1JLB A;  2YJF A;  1WSE A;  2X6S A;  1E4G T;  2O8D B;  1KLN A;  4FK2 A;  2FF6 A;  2ZWH A;  4BDY A;  5JVG L;  3PY8 A;  3TTC A;  3NF6 A;  1L3S A;  4CJW A;  1RT7 A;  1GOB A;  3L4I A;  3ITH A;  1S72 N;  4LF7 K;  4DSJ A;  1BI4 A;  2F7T A;  3H45 C;  1NJI O;  2FC0 A;  1HKC A;  2J4R A;  2OPQ A;  3A8Y A;  4NXM K;  4ELU A;  1XQS C;  4OPJ A;  3VQD A;  5JMV A;  3S3N A;  2O8E B;  1EWR A;  1IV0 A;  1QQM A;  3CYM A;  3CQY A;  1YIT N;  4C8M A;  1VSF A;  4BQL A;  4FJM A;  4LD0 A;  4J2E A;  2E6L A;  3VQB A;  4QOZ B;  5AQU A;  2IIR A;  2V7Z A;  3QFP A;  4JV5 K;  4RCH A;  1HR0 K;  2W42 A;  3BP8 A;  4YHH K;  3MEC A;  5JLF A;  1NGH A;  3ZET A;  4KHY A;  3NVK A;  4CEB A;  3FZM A;  4X65 K;  1NJY A;  3FZK A;  3ID6 A;  1QQN A;  4C8K A;  4CHP A;  5BPN A;  2FSJ A;  1GLL O;  5EU7 A;  1OH6 A;  2LSN A;  4DTX A;  4JRP A;  2R7Y A;  1NJW A;  3CCR N;  4FWO A;  4PL8 A;  5EOY A;  4CHN A;  1BGX T;  4DQS A;  3AVM A;  3S41 A;  4U67 L;  3AVN A;  3OYG A;  1MU2 A;  1WSH A;  3VEY A;  3HP6 A;  1W97 L;  4F2S A;  4X66 K;  3KZB A;  4YNQ A;  1NGJ A;  3KD1 E;  2QM1 A;  3LP3 A;  3OY9 A;  4LF8 K;  3THV A;  4I6M A;  4HUG A;  3OBW A;  2KTQ A;  4BRD A;  4WYB A;  2XHB A;  4LF9 K;  1ZBI A;  3WNH A;  2RE2 A;  1RTH A;  3VEO A;  5C2D A;  3HOS A;  2D0A A;  3O8M A;  4CJF A;  3TSU A;  2Z1I A;  2OTL N;  2HNZ A;  5EXW A;  4EFH A;  3THW B;  3LDO A;  4B1U B;  2G8U A;  3QBW A;  1TK8 A;  2HVH A;  3BUZ B;  1DEJ A;  4WF9 L;  1HUX A;  1BUP A;  4F8R A;  1BCO A;  3TSQ A;  3DXM B;  3MX2 A;  5M1K A;  3HTV A;  5I42 A;  3QBX A;  3V4I A;  1J5E K;  5SWM A;  1VQP N;  4Z4C A;  3SQ0 A;  4X64 K;  1DT9 A;  3D2E B;  3RRG A;  3A5N C;  3IAY A;  2YKN A;  2WON A;  4DTP A;  2KKZ A;  1KLM A;  2ZD1 A;  1RNH A;  4CK1 A;  4FM1 A;  3KWI A;  3MN6 A;  1HKG A;  1TAQ A;  2P9I B;  2HST A;  3PV8 A;  2GUP A;  5GIN A;  4W5O A;  4BRG A;  4BE0 A;  4EIA A;  3E66 A;  4BQZ A;  5AQN A;  3K57 A;  1BQN A;  1LWF A;  1NWK A;  5J2M A;  4H0Y B;  1L5U A;  2HW3 A;  1QVG M;  2P9K A;  4KV8 A;  3CCU N;  3LDP A;  5KPR A;  3ZSV A;  1HYV A;  3H1Q A;  4OPA A;  2P9N B;  4CZJ A;  1NOZ A;  3L2R A;  4RW7 A;  4YOU A;  3TAM A;  1VRT A;  3ATV A;  4KHP K;  5H1S Q;  4CEO A;  5JLH A;  4CD3 A;  3SK3 A;  1Q7Y O;  2HHH K;  1U2V A;  1HJO A;  3HJF A;  3AAP A;  4CJV A;  4JI3 K;  3V9S A;  5AJ3 K;  4DG1 A;  1OVQ A;  4E1J A;  1S22 A;  3CD6 N;  1HPZ A;  4C8O A;  4XEI A;  1IO2 A;  5C12 A;  3U3Y A;  1LW0 A;  1LV5 A;  3VEV A;  1KC8 O;  5M1P A;  1RDU A;  1NU0 A;  3K5L A;  4HVJ A;  1L3V A;  4JI7 K;  4H0T B;  4PWD A;  1SL0 A;  5AQG A;  4E89 A;  3KK3 A;  1X9S A;  4H5W A;  4FOI A;  4FPB A;  1QZ5 A;  3WEE B;  3WQT A;  2QKB A;  2F96 A;  4CEQ A;  3CJB A;  3VEX A;  3O1B A;  4WE1 A;  3KIO A;  2D5R A;  4FJX A;  3I0S A;  1ZC6 A;  3EZW A;  2DFE A;  4GKK K;  3OYF A;  1FK9 A;  4O55 A;  4DKW A;  2QKK A;  3VA0 A;  1VHX A;  1YJ9 N;  4CJL A;  4CD1 A;  3N4Q A;  1Q9X A;  3W0L A;  4DQR A;  4DV7 K;  1TGO A;  3SMP A;  1BIZ A;  2YNF A;  3IG1 A;  3PSI A;  4CF0 A;  2IAJ A;  5HOO A;  1RT2 A;  4LFB K;  4Z4F A;  4Y0W A;  1LAW A;  3OYD A;  3LZJ A;  3Q7C A;  1WAF A;  4OO1 J;  1S1X A;  1RBT A;  4A57 A;  1NMD A;  3T7Z A;  1IH7 A;  4GVE A;  4M3Y A;  5AQO A;  4IOA L;  2G8F A;  3H6E A;  1XC9 A;  3B8A X;  4N56 A;  1REV A;  3FFI A;  4FWP A;  4ILH A;  1B92 A;  4B9Q A;  3TU5 A;  2E2P A;  4BRP A;  1RT5 A;  3NCI A;  1UWB A;  4BAC A;  5J2Q A;  4CI6 A;  4X62 K;  2O8D A;  3A0I X;  3EZ5 A;  3R8E A;  4FJ7 A;  3TTD A;  3ZT3 A;  3CM6 A;  3LM2 A;  3OTO K;  5KQ8 A;  1KAZ A;  3O4W A;  2PYL A;  2O8B B;  1NGA A;  4PQU A;  1JLF A;  3EL2 A;  3A2F A;  4B9T A;  4B8C A;  1VK0 A;  4BRC A;  3L2Q A;  4F4K A;  3DWL A;  1Q81 O;  3K5O A;  2O8E A;  1ZBF A;  1LAV A;  2NLX A;  1QS4 A;  1WNS A;  4FZY A;  3LWM A;  1K6Y A;  1JL2 A;  1EWQ A;  1KVB A;  1RDA A;  4DR5 K;  4PA1 A;  1WB9 A;  2Q2R A;  1ESV A;  4B9U A;  1NK4 A;  1X9J A;  3KKR A;  1NK7 A;  3HPH A;  4KHU A;  1D4X A;  3I33 A;  2QWP A;  2A5X A;  3HSC A;  5B8H A;  2G8H A;  3SBT A;  3JS6 A;  4H5N A;  2HHW A;  3NGY A;  1S5J A;  3TI0 A;  4KPY A;  3VGM A;  5T7B A;  1FJG K;  3Q7B A;  3AVG A;  3AA5 X;  4I2Q A;  3VPZ A;  2RPI A;  3DJC A;  3AA2 A;  4BRH A;  3UB5 A;  3EE8 A;  3LP0 A;  4KI4 A;  3QEW A;  3DRR A;  3MAQ A;  3MMV A;  1HNI A;  1RBS A;  4CZE A;  4KHW A;  4BRM A;  3V9W A;  3PX4 A;  3AO3 A;  2QWR A;  3VTH A;  4CZH A;  1KXP A;  4V19 S;  4AH9 A;  4C8N A;  3OA9 A;  4RG8 A;  1BU6 O;  4M3W A;  1VQK N;  1V4S A;  4ZTJ A;  3FFK B;  3T1A A;  2P9S B;  4F3T A;  2WTU A;  4NYF A;  4CHZ A;  3K9K A;  1VSM A;  4DTS A;  2HVI A;  3GE1 A;  1NJZ A;  4JI8 K;  2XY7 A;  4H0O A;  1T7P A;  3QDK A;  2IVO A;  4FW2 A;  1KFD A;  1D9F A;  3IDH A;  4DTU A;  1RT1 A;  1DTT A;  3RR8 A;  4DSI A;  2PZS A;  4EHU A;  3F9M A;  4M3R A;  3FZL A;  3DI6 A;  2B4J A;  4I7F A;  1WOQ A;  1K8K B;  1RCH A;  1BHL A;  4XH1 A;  3AVI A;  3DXM A;  3A5M C;  3LM9 A;  4DS4 A;  4IEI A;  1SZ2 A;  3ZEU B;  2HND A;  4BDP A;  3HK2 A;  2HBJ A;  3FR0 A;  1Z26 A;  4FM0 A;  4CBU A;  1QQO A;  1QZ6 A;  4CFB A;  3M3Z A;  3VEW A;  2X6N A;  4E7H A;  5KRS A;  2YNG A;  3AY9 A;  3D2E A;  3AAR A;  1YT3 A;  4O8K A;  3TAB A;  4OPH A;  3CCJ N;  4JNE A;  3E01 A;  2OCE A;  2UUC K;  3C94 A;  2AA4 A;  4JN4 A;  3V1Q A;  1U47 A;  3CER A;  5AQP A;  4NCG A;  3C95 A;  4BRF A;  4CK2 A;  4UQG A;  2ZJP L;  3AVA A;  2P9I A;  3GL1 A;  2OZM A;  3THX B;  5TKY A;  5SZT A;  4Z4I A;  1HJR A;  4DF4 A;  1OH8 A;  4FLU A;  4DSK A;  4NLB A;  1MWM A;  1OKJ A;  1NLV A;  3TSP A;  1TKX A;  3HST B;  3J8A A;  3SAF A;  2HHU A;  4IOC L;  3HZ6 A;  1KFS A;  3K59 A;  2P9N A;  3SV4 A;  1D5A A;  1SL2 A;  1YUW A;  2VGM A;  3IFR A;  2FLO A;  4N76 A;  4BC4 A;  3NF7 A;  2E6M A;  2W41 A;  1T03 A;  4MLH A;  3RMB A;  2FXU A;  3QEX A;  4AF1 A;  4YOW A;  3VMF B;  3CXC M;  4LC9 B;  5GIO A;  4DQQ A;  2KZM A;  2UYT A;  4AQY K;  3TAR A;  4JK7 A;  3THY B;  4RW8 A;  3IMX A;  3DAW A;  4DSE A;  1SUQ A;  1NK8 A;  3E9L A;  5KGX A;  4BG9 A;  3GG4 A;  4CGJ A;  2VG7 A;  4Y1C A;  2YHW A;  4AIL C;  4QCL A;  4IKF A;  4FJH A;  2ZF5 O;  1SKS A;  4C23 A;  5KTQ A;  2V52 B;  1ATN A;  1VSD A;  3L3U A;  3DYA A;  3NHG A;  2E2O A;  3D7E O;  3A5L C;  3G4S N;  3RRH A;  1CXQ A;  2V7Y A;  3WEE A;  3WNG A;  1ASW A;  3OYE A;  4JI4 K;  1LOT B;  4FWS A;  2O8F A;  5KRT A;  4FLW A;  4ZHR A;  4BR5 A;  4DF8 A;  1GOC A;  3AVF A;  3BEX A;  5KPT A;  4ELV A;  2DY4 A;  2P9U B;  1S1W A;  2YHY A;  1KAX A;  1RTJ A;  3GDQ A;  4AHU A;  1RGI A;  3LPU A;  5JS2 A;  1YIJ N;  2H3G X;  4KTZ A;  4DU4 A;  1ZXO A;  4CEE A;  4WQ4 C;  4FJ9 A;  4WFN L;  4M3Z A;  1G99 A;  1VQ4 N;  4E19 A;  2XO7 A;  2RN2 A;  4H0V B;  3QEV A;  1O1W A;  3O3F A;  4CGF A;  3O80 A;  2W6K A;  4CVN E;  4H03 B;  4KRF A;  4FOE A;  2KQ2 A;  3WNF A;  4CJ4 A;  4BY9 C;  3MK6 A;  4HTU A;  4CJT A;  1ZBU A;  1C0G A;  3L6Q A;  1YVU A;  4DV4 K;  2KZZ A;  2KFZ A;  2IGI A;  2FSK A;  3CFR A;  4CBX A;  3V9Z A;  3MXJ A;  3OW2 M;  4MO5 A;  1S6Q A;  4DR4 K;  2UXC K;  3J7Y P;  2P9P A;  1QVF M;  1UOC A;  2EHG A;  2OYQ A;  1T3V A;  1VRU A;  4JD2 B;  4K0K K;  1S1U A;  2E8A A;  1XI1 A;  5F2R A;  1QTM A;  3M8Q A;  2O8B A;  3I55 N;  5E41 A;  2NRW A;  3KK7 A;  1IKY A;  3EKS A;  3CCS N;  2QXF A;  2YNH A;  5AZJ B;  3S3M A;  1R59 O;  3CCV N;  4H5R A;  4FJJ A;  1I3A A;  3SAH A;  3CCM N;  3TAF A;  1BWF O;  3BF3 A;  3TAE A;  5IT9 O;  3V81 A;  3BZK A;  1KRP A;  3RR7 A;  3FZF A;  4JLH A;  3L2V A;  1A5V A;  4LSL A;  3CFO A;  5GAG P;  2VWJ A;  3CMA N;  2E88 A;  2JLE A;  1N33 K;  4GNI A;  4J8F A;  4JRQ A;  4MO4 A;  1SKW A;  2EWS A;  3DRS A;  1BIU A;  3ZSY A;  4DFM A;  4B1Z A;  4OLB A;  1TYQ B;  4NCA A;  4RW9 A;  5BRF A;  3RMD A;  4O5F A;  3VQE A;  1TL3 A;  5C15 A;  3S9H A;  4KHQ A;  4DFK A;  1OH5 A;  3O9U A;  3VQ9 A;  2ASO A;  4RTF D;  1IBM K;  3VEZ A;  4B3O A;  2WOM A;  3NGI A;  4FJ5 A;  2QWQ A;  5ELZ A;  2HBL A; 
#chains in the Genus database with same CATH homology
 5BPL A;  1KC8 O;  4G9Z A;  1MWK A;  1RDU A;  5M1P A;  5AZI A;  3IUC A;  3T69 A;  5GIP A;  3EN9 A;  2GEL A;  3WXI A;  4ILJ A;  4H0T B;  1T44 A;  5AQG A;  2A3Z A;  2FSN A;  3CJA A;  3DXK B;  3ZYY X;  1KD1 O;  3C65 A;  2QI2 A;  4H5W A;  3R3L A;  4FOI A;  4JKA A;  5AQY A;  1Q86 O;  4FPB A;  1QZ5 A;  3WEE B;  3VGK A;  3WQT A;  5LJV A;  2NRT A;  4WFA L;  3CQX A;  2BTF A;  2P9S A;  3CJB A;  3VEX A;  4A62 A;  4GV9 A;  3O1B A;  1VQO N;  3WQU A;  2RHK A;  3CCL N;  1ZC6 A;  3EZW A;  3CJ9 A;  4CZF A;  1TUY A;  3P31 A;  4DKW A;  4JKG B;  3VEV A;  1SAZ A;  2WC9 A;  4PKH A;  2A40 A;  1YJ9 N;  3U9Z A;  4CD1 A;  3N4Q A;  3A5O C;  3EO3 A;  4H5T A;  4FWQ A;  3W0L A;  3HBT A;  3N4P A;  5AQS A;  3LDN A;  2WFB A;  1QHA A;  3SMP A;  1JCG A;  4NO7 A;  5CHI A;  1YJW N;  5EX5 A;  1K8K A;  4ILG B;  4Z94 A;  3I56 N;  5C2F A;  5AFU A;  2NRZ A;  3ZEU A;  5F1X A;  5HOO A;  4H5V A;  4Y0W A;  3MX5 A;  2QTD A;  4QS8 A;  2ASM A;  2ZGZ A;  4ISE A;  1VQ9 N;  3Q7C A;  3P39 A;  1K8A O;  4OO1 J;  3G71 N;  4YOY A;  4YDU C;  5E84 A;  4EHT A;  4A57 A;  1NMD A;  4JKD A;  3T7Z A;  1VQ8 N;  4IJA A;  4GVE A;  2WBN A;  4IOX A;  3SLC A;  2F9T A;  2A41 A;  1ZBS A;  4BGA A;  5AQO A;  1S72 N;  4JHD B;  3VF6 A;  4IOA L;  2E1Y A;  3PIP L;  2QWO A;  3H6E A;  2BUP A;  4H0P A;  3B8A X;  1NM1 A;  1Z6R A;  2E2N A;  3KVG A;  5BN9 A;  1OVY A;  4O8U A;  1YI2 N;  4K42 A;  4FWP A;  4ILH A;  2D1K A;  4FWM A;  1YAG A;  3SJH A;  4B9Q A;  4QS9 A;  1HX1 A;  3TU5 A;  2E2P A;  4C1N K;  4H0X B;  2GX9 A;  4BRP A;  4QS7 A;  5JVH L;  1P90 A;  4CI6 A;  4R79 A;  4FPA A;  4YOX A;  1BG3 A;  3UKU A;  3A0I X;  5E26 A;  3R8E A;  3C6H A;  2KHO A;  5AR0 A;  5BN8 A;  1W2B M;  3TTD A;  1SS6 A;  3LM2 A;  4KH5 A;  4A2A A;  3O9T A;  1BDG A;  5KQ8 A;  1KAZ A;  3O4W A;  5BR9 A;  1VQ5 N;  4YDU A;  1V4T A;  3NVM A;  2Q31 A;  1NGA A;  1VQN N;  3UKR B;  2CGK A;  3EL2 A;  4NB4 A;  3WT0 A;  3AGK A;  4BRA A;  2I7P A;  5BRD A;  1NGD A;  3M1F A;  4BRC A;  2ASP A;  3MWT A;  1Q18 A;  1MA9 B;  2WUS A;  3DWL A;  2DPN A;  4FWN A;  4C1N I;  1Q81 O;  4M63 C;  4CZI A;  5DM6 L;  2NLX A;  4CZK A;  3H46 O;  1NGC A;  1P8Z A;  3M6G A;  4GV3 A;  3ATU A;  2QEX N;  3CPE A;  2HF4 A;  4BRK A;  3JXU A;  2NRH A;  4IXC A;  3H3N O;  3QFU A;  5M1F A;  4CJ7 A;  4PHT X;  1EO1 A;  3C7N A;  3BF1 A;  5BRH A;  2Q2R A;  3WXK A;  3AGR A;  5AQK A;  1MDU B;  2W40 A;  1ESV A;  2GTD A;  1BA1 A;  1U2V B;  1GLE G;  2P9L A;  1X9J A;  5TKW A;  4BRQ A;  3SAF A;  4IZ9 A;  2YCH A;  3CCQ N;  1D4X A;  3I33 A;  2QWP A;  2A5X A;  3HSC A;  4BC3 A;  5B8H A;  4WCE L;  5LY3 A;  1RFQ A;  3JS6 A;  4H5N A;  3SBT A;  3CCE N;  3E9O A;  3UE5 A;  5GAE P;  2OTJ N;  1YHQ N;  3VGM A;  3Q7B A;  4DHY A;  3CJ7 A;  5AQX A;  2Q0U A;  3VPZ A;  1KQS M;  2QWN A;  3DJC A;  5CR4 A;  4IEE A;  1ATR A;  5AQZ A;  2AP1 A;  3U8X A;  4BRH A;  3UB5 A;  3EE8 A;  5F0X A;  1HLU A;  2CGJ A;  3WUH A;  1S3X A;  5AZI B;  1SQK A;  4BC2 A;  4BR4 A;  2GEM A;  5AQW A;  3IKM A;  4RWT A;  3CET A;  3MMV A;  4A5A A;  4CZE A;  2V51 B;  2D0P A;  2HF3 A;  3O5B A;  4BRM A;  1RDW X;  4U7B A;  2CH5 A;  1GLA G;  2QWR A;  3VTH A;  4CZH A;  1KXP A;  4JKC A;  2D4W A;  3W3D A;  4M7X A;  4BR7 A;  2YX6 A;  4L3Q A;  2P9U A;  3C0B A;  1XC3 A;  3OA9 A;  2IVP A;  1BU6 O;  3O1W A;  3P4I A;  3F5T A;  3MN7 A;  4FL9 A;  1VQK N;  1V4S A;  1M90 O;  3FFK B;  4BGB A;  2P9S B;  3ENH A;  4B1V A;  1GLF O;  4BRI A;  1DKG D;  4XH4 A;  3PIO L;  3K9K A;  4BRO A;  4GV6 A;  1NBW A;  3R6M A;  4KH4 A;  4PKI A;  4BG8 A;  3P38 A;  3O6W A;  3GE1 A;  3I8B A;  4YOT A;  3O9S A;  4BRL A;  1VQ6 N;  3ZX2 A;  2CGL A;  4H0O A;  3QDK A;  2IVO A;  3OHR A;  4K43 A;  3IDH A;  1BO5 O;  1HPM A;  3LL3 A;  3VER A;  5DM7 L;  5M1O A;  4EHU A;  3F9M A;  3FZL A;  2VCP A;  1M1K O;  1WOQ A;  5AQL A;  1K8K B;  3AAQ A;  3PLA A;  4XH1 A;  3RSE A;  4A59 A;  1GLC G;  3DXM A;  3A5M C;  3HM8 A;  3LM9 A;  4JKH A;  3CC4 N;  3CJ1 A;  2QW9 A;  4IEI A;  1SZ2 A;  3ZEU B;  3D2F A;  2GWJ A;  4ISF A;  2HBJ A;  3CI5 A;  1H1V A;  3FR0 A;  3F2K A;  2E1Z A;  2QWL A;  4CBU A;  1QQO A;  1C0F A;  2BH1 A;  4FWR A;  4XH5 A;  3VF4 A;  1QZ6 A;  2PAV A;  4BVO A;  3M3Z A;  2KLA A;  5AQF A;  3VEW A;  4PL7 A;  5GAD P;  4K41 A;  5FPE A;  2JWK A;  1Q82 O;  3AY9 A;  3QB0 A;  3D2E A;  5AQV A;  5EVZ A;  2D0O A;  5BRE A;  3AAR A;  3D2F B;  1VQ7 N;  3CJC A;  3VF2 A;  1BOT O;  3EKU A;  2HBK A;  4O8K A;  5AFU H;  4OPH A;  3CCJ N;  3WXJ A;  3G6E N;  3L0Q A;  1U6Z A;  4JNE A;  3VTI A;  4JEP A;  2YJE A;  3GOI A;  2AA4 A;  3RVC A;  4JD2 A;  4IDH A;  4JN4 A;  4AM6 A;  2CH6 A;  3VES A;  3CIP A;  3FE1 A;  3CER A;  5AQP A;  4A2B A;  4JAX A;  4BRF A;  4WQ4 A;  1DGK N;  3ZX0 A;  4B1Y B;  3G25 A;  2ZJP L;  2ZGY A;  3MN5 A;  4YOV A;  4BR9 A;  5JIC A;  2P9I A;  3GL1 A;  2NNW A;  2YJF A;  5TKY A;  3DLL L;  1T6D A;  4DQ8 A;  1E4G T;  3UKU B;  2FF6 A;  2ZWH A;  3SAG A;  2QWM A;  4BC5 A;  4JK8 A;  5AZJ A;  5JVG L;  2YI1 A;  4NLB A;  5KQD A;  1MWM A;  1OKJ A;  3R1X A;  3TTC A;  1JCF A;  1NLV A;  3TSP A;  4HTL A;  5KPZ A;  5AQH A;  3J8A A;  1E4F T;  3ENB A;  3L4I A;  3TPQ A;  2E20 A;  1NGF A;  1KAY A;  1VAZ A;  2F7T A;  3H45 C;  3ZX3 A;  1HKC A;  3CF5 L;  4IOC L;  1NJI O;  2J4R A;  3A8Y A;  3HZ6 A;  3QML A;  2P9N A;  3U9D A;  4CZM A;  4HWI A;  1YVN A;  1YUW A;  2VGM A;  1XQS C;  3IFR A;  4A5B A;  2FLO A;  4BC4 A;  4ISG A;  1TUU A;  5AQR A;  5JMV A;  1LCU A;  1ILY A;  1VQM N;  1YXQ A;  2W41 A;  5FPN A;  1YF5 L;  4MLH A;  1QQM A;  3O08 A;  1ATS A;  2FXU A;  3CQY A;  1YIT N;  4AF1 A;  4YOW A;  3VMF B;  3VEN A;  3ULE A;  4BQL A;  3CXC M;  4LC9 B;  5GIO A;  1TYQ A;  4BVP A;  4EAH D;  2UYT A;  1NGG A;  5AQU A;  2IIR A;  2V7Z A;  3QFP A;  4JK7 A;  1Z05 A;  5GAH P;  4RCH A;  3FLC O;  3IMX A;  3ID8 A;  3BP8 A;  3DAW A;  3MN9 A;  5ADX H;  5JLF A;  3C7N B;  1GLJ O;  3CHW A;  3E9L A;  3ENO A;  4M7Y A;  1NGH A;  3ZET A;  3GG4 A;  4BG9 A;  3NVK A;  2ZJR L;  2YHW A;  1JJ2 M;  3E9P A;  3FZM A;  2P9L B;  3FZK A;  3ID6 A;  1QQN A;  2ZF5 O;  1Y64 A;  5FPM A;  4C23 A;  1WUA A;  2FSJ A;  5BPN A;  2V52 B;  1ATN A;  4UY8 O;  1GLL O;  2ZJQ L;  2FF3 B;  3CCR N;  4FWO A;  4PL8 A;  5EOY A;  1HKB A;  2NZT A;  1NGB A;  4B1X B;  2E2O A;  3S41 A;  2A6A A;  4JKB A;  3D7E O;  3M5R A;  3LDL A;  4U67 L;  3A5L C;  3G4S N;  5AQT A;  2Q36 A;  3VET A;  2V7Y A;  5AQQ A;  3WEE A;  4FSV A;  3VEY A;  1W97 L;  4FO0 A;  1VQL N;  5EY4 A;  1LOT B;  2OAN A;  4FWS A;  2YHX A;  4BRN A;  1NGI A;  3KZB A;  1NGJ A;  2Q1N A;  2Q0R A;  3CC7 N;  2I7N A;  2QM1 A;  4BR5 A;  2HBM A;  3MDQ A;  4NLC A;  3U4L A;  1JCE A;  3BEX A;  3MWP A;  5KPT A;  4JKG A;  3R9P A;  2Q97 A;  4AM7 A;  1YJN N;  4IWV A;  4I6M A;  4A61 A;  2P9U B;  2YHY A;  1KAX A;  2PBD A;  3OBW A;  3GDQ A;  5HL7 L;  4BRD A;  4WYB A;  3GBT A;  2VYP A;  2RE2 A;  3VEO A;  1RGI A;  3KWG A;  5C2D A;  3HOS A;  1YIJ N;  2H3G X;  3C6A A;  2HMP A;  2JWL A;  1ZXO A;  3O8M A;  4WQ4 C;  2QXL A;  3MCP A;  4FWL A;  3TSU A;  4MDA A;  5M1N A;  3HRG A;  4WFN L;  4I6M B;  4BRE A;  2OTL N;  4MDB A;  5EXW A;  4EFH A;  1G99 A;  1VQ4 N;  3LDO A;  3H1V X;  4JKF A;  4B1U B;  4BR2 A;  3HI0 A;  3VGL A;  3KHY A;  2A42 A;  3QBW A;  4H0V B;  3BUZ B;  5C0Y A;  1X3M A;  3O80 A;  2NRV A;  3H3O B;  3EE9 A;  5AQJ A;  1CZA N;  1DEJ A;  4H03 B;  3SMS A;  4CZL A;  1EQY A;  4WF9 L;  4IO9 L;  3FZH A;  1HUX A;  1BUP A;  2GWK A;  1NGE A;  3RSE B;  3TSQ A;  3MCA B;  3DXM B;  1T6C A;  3MX2 A;  4FOE A;  3WXM B;  3CC2 N;  5M1K A;  4JHD A;  1O13 A;  3HTV A;  3QBX A;  5LJW A;  3J7Z O;  4BY9 C;  3MK6 A;  1C0G A;  3L6Q A;  4KH6 A;  1VQP N;  3LDQ A;  5AQM A;  3NMU A;  1N8R O;  1DT9 A;  3O9Q A;  3D2E B;  2PFU A;  4GY2 B;  4FVU A;  3A5N C;  4DCH A;  2FSK A;  4IO8 A;  4CBX A;  4DB3 A;  3OW2 M;  3QIC A;  1J6Z A;  4MO5 A;  1BA0 A;  3TTF A;  2P9P A;  4MLE A;  1QVF M;  2VWB A;  3HOT A;  5M1Q A;  1T3V A;  4JD2 B;  1K73 O;  2E8A A;  3K9J A;  2IVN A;  5F2R A;  2KKZ A;  3SBG A;  3I55 N;  3KWI A;  3MN6 A;  3CPW M;  1HKG A;  2P9I B;  1IJJ A;  3UKR A;  2HST A;  5MLC Q;  2NRW A;  3KK7 A;  2P9P B;  2GUP A;  4WQ5 C;  4CBW A;  1X3N A;  4CZG A;  5C10 A;  5GIN A;  3EKS A;  4BRG A;  1IG8 A;  3CCS N;  5I9E B;  3VOV A;  4EIA A;  3E66 A;  5AZJ B;  4BQZ A;  4YOR A;  1R59 O;  3CCV N;  4H5R A;  5AQN A;  3SAH A;  1NWK A;  3CCM N;  2VGN A;  2HOE A;  2NRX A;  4H0Y B;  1BWF O;  4JK9 A;  2F9W A;  3CME N;  1QVG M;  2P9K A;  3CCU N;  3BF3 A;  3LDP A;  5KPR A;  1K9M O;  1XUP O;  3H1Q A;  4OPA A;  5BPM A;  4BR0 A;  2P9N B;  1GLD G;  4FWK A;  4JKE A;  4PKG A;  5AQI A;  2NRR A;  4KBO A;  5ADX A;  3L4Q A;  4K25 A;  4CZJ A;  3FZF A;  5FPD A;  2E2Q A;  4YOU A;  3ATV A;  5GAG P;  3CMA N;  2E88 A;  4IFE A;  3OBY A;  4GNI A;  5H1S Q;  4J8F A;  5JLH A;  4CD3 A;  2P9K B;  4MO4 A;  3SK3 A;  1Q7Y O;  4B1W B;  2EWS A;  3E1Y A;  1U2V A;  3WXL A;  1GLB G;  3ULE B;  4WFB L;  3D6R A;  1HJO A;  4B1Z A;  3AAP A;  2ITM A;  4F9O A;  1TYQ B;  2QA4 N;  5BRF A;  4O5F A;  4WQ5 A;  4E1J A;  1S22 A;  5C15 A;  3CD6 N;  4IJN A;  3O9R A;  3O9U A;  2ASO A;  4RTF D;  3FGU A;  4XEI A;  3VEZ A;  5C12 A;  3ZET B;  5CE3 A;  2QWQ A;  3DXK A;  5ELZ A;  2HBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...