2A6AA

Crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MNVLALDTSQRIRIGLRKGEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKSCPADGVVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERLFREKKTIHYYEIEPLYLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords hypothetical protein TM0874
publication title Structure of an essential bacterial protein YeaZ (TM0874) from Thermotoga maritima at 2.5 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 55
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2a6aA01
3.30.420.200 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2a6aA02
4BVOA 3SMPA 4CBUA 1GLFO 1QQNA 4FWKA 4PL8A 3VERA 3EZWA 3GL1A 4CZLA 1Q18A 3VESA 2FSNA 3WXJA 4JHDA 5EOYA 1C0GA 2HMPA 4NB4A 3DXKB 2AA4A 3O1WA 4A2AA 5LJWA 1NGBA 3DXMA 3FZLA 2A5XA 4PKIA 4MLEA 3G25A 3MN7A 5FPMA 2F9WA 1U6ZA 1HX1A 3U8XA 4H5VA 3O5BA 1ZBSA 1E4FT 1H1VA 3CIPA 4JHDB 1V4TA 2E2PA 3ATUA 2QXLA 5E84A 4CZMA 5KPZA 1U2VA 2QWLA 3P4IA 3BEXA 1YAGA 3GDQA 4FWMA 3M6GA 4FPBA 3DXMB 3HBTA 4I6MA 4H0TB 4CD3A 4LC9B 3QICA 4B1WB 4CZJA 3HTVA 1T44A 1D4XA 2QWRA 3SJHA 1GLDG 3UE5A 4H5WA 4BC2A 1ATNA 1HKBA 3VF6A 1U2VB 3BF1A 3CI5A 2FF6A 4BRFA 3ATVA 3J8AA 5AQNA 3FZFA 2ZWHA 1X3MA 4K43A 4I6MB 4FWSA 5F1XA 3MN5A 4EIAA 3R8EA 1E4GT 4BRHA 3B8AX 3HSCA 4H0YB 3W0LA 4K42A 5JMVA 2E8AA 2EWSA 3VF2A 3WQUA 3ZEUA 3S41A 3SLCA 3VEVA 4RTFD 3QBWA 1YVNA 3CJ7A 2KHOA 5AQUA 5AQXA 5BN8A 5TKYA 2FLOA 3MDQA 5EX5A 4B1UB 4A61A 2Q0UA 4JD2A 1KAYA 3ZEUB 4WQ5C 1DKGD 2QWNA 4XEIA 4H0OA 4BRMA 2H3GX 2D4WA 1KAZA 2P9LA 2QWMA 4JN4A 5AQVA 5FPNA 4BREA 1GLAG 4BVPA 1HJOA 3CHWA 4CZHA 1BA1A 2VYPA 2V51B 2P9UA 3RSEA 2Q2RA 1XC3A 2ZF5O 3EO3A 4JD2B 2QWPA 3HZ6A 1KXPA 3JXUA 5AQZA 3FFKB 4J8FA 5EXWA 4A62A 1Y64A 4EHTA 2P9LB 4EFHA 3A5OC 4FO0A 3KZBA 4BG9A 3RSEB 3D7EO 3M3ZA 4GY2B 4JNEA 4BRCA 5AQOA 2GWJA 5AQIA 4IZ9A 2FSJA 4FWNA 4CBWA 3IMXA 3O08A 2QWQA 3LDLA 4H0PA 4YDUA 1XQSC 2YCHA 4XH4A 3CETA 1HKGA 5BN9A 3UKUB 1QQMA 3UKRA 1SQKA 2W41A 3EKUA 2FF3B 4BRQA 5E26A 1BOTO 4IWVA 5BPLA 3DAWA 1BUPA 2E2QA 5JLFA 2ZGZA 1NGHA 3GOIA 4WYBA 1NGFA 3EN9A 2D1KA 4BR7A 3GE1A 5BREA 4BR5A 4B1XB 2ASOA 4ISFA 4C23A 3AAQA 4M63C 4IJAA 5AQRA 4BGBA 3TPQA 4KBOA 2Q97A 3A5LC 4EAHD 3UKRB 4BROA 4PL7A 3BUZB 5AQYA 2HF3A 2NRHA 2E88A 4AM7A 4BR0A 4BC5A 4FWPA 3H1VX 4BRKA 3C0BA 3SK3A 4BQZA 4BRGA 4BRLA 3ZX0A 2P9NA 2QWOA 3KVGA 4BG8A 5AR0A 2YHWA 3WQTA 2ASPA 4FPAA 2E20A 3BP8A 3D2EA 1GLJO 3F9MA 3ZETA 4BR2A 3H45C 4CD1A 1R59O 2CH6A 2D0OA 2Q0RA 3O80A 3AY9A 5I9EB 2P9NB 1WUAA 2PAVA 3A5MC 4IJNA 2YJFA 2PBDA 3TU5A 2CGJA 3LDNA 3MN9A 3AARA 4AM6A 4BRDA 5AQLA 4DB3A 4B1VA 4H0XB 5AQFA 3L6QA 4Z94A 1MWMA 5AZJA 1MA9B 3CQXA 3IUCA 3QBXA 3O1BA 3ZETB 4ISEA 1BU6O 5AFUH 2E1ZA 5AQMA 2P9KA 5BR9A 1EQYA 2ITMA 2WUSA 3CQYA 1BG3A 3DJCA 4FOEA 5AQJA 1S3XA 3HM8A 1NBWA 1Z6RA 5AZJB 3QMLA 5LY3A 5ADXH 2CGLA 1X3NA 2YJEA 1ESVA 4H03B 4Y0WA 4DCHA 3CJCA 1HPMA 2GTDA 2HF4A 1X9JA 1MWKA 2P9KB 3O6WA 4ISGA 3VEOA 3D2FA 1OKJA 5FPEA 3WUHA 4FWQA 3ENOA 2FXUA 3BF3A 3C7NA 2P9SA 5AQHA 4BR4A 1NGEA 1ATRA 3WXIA 3U9DA 1QQOA 1RGIA 4RWTA 4IO8A 3I33A 2P9PA 2Q1NA 2A6AA 3VGKA 2CH5A 4MO4A 4CZEA 1MDUB 5BPNA 3QFPA 3IDHA 4DHYA 5LJVA 1SAZA 1XUPO 3LM9A 3IFRA 1BDGA 4BGAA 3R9PA 3C7NB 2P9SB 3JS6A 4WQ4A 2I7NA 4YDUC 5AQGA 3VEZA 2P9PB 3ZX3A 3WEEA 5BRFA 4JAXA 3VF4A 2P9UB 1JCFA 2BTFA 4H5RA 1LOTB 3EL2A 4E1JA 3H46O 1IG8A 2D0PA 3AAPA 3WXKA 4WQ5A 1ZC6A 1S22A 1J6ZA 1NGJA 3M1FA 1T6DA 3U9ZA 3WEEB 3FZHA 1GLBG 3A0IX 3LDQA 3ENHA 2P9IA 4MO5A 4FOIA 3LDPA 2IVPA 2A41A 2YHXA 3UB5A 4BC3A 3H3NO 3H6EA 4CI6A 1JCEA 2QM1A 4FWOA 3FR0A 4K25A 3ZX2A 2W40A 4M7XA 1GLCG 4FL9A 2GELA 5JLHA 3CJAA 1ATSA 5KQ8A 2P9IB 3VEWA 4QS7A 3ULEA 3VETA 4RCHA 3DWLA 3GG4A 1GLEG 4FWLA 1K8KA 1V4SA 3O4WA 3A8YA 1ZXOA 4BR9A 1CZAN 4HWIA 2OANA 2GWKA 1HUXA 4XH5A 3MK6A 1QHAA 3ULEB 4B1ZA 5BRDA 2YHYA 3FE1A 1Z05A 1NLVA 2A40A 2Q31A 3R6MA 3EKSA 3FZMA 3OHRA 2VCPA 4FSVA 3WXLA 4PKHA 3L4IA 3W3DA 2GUPA 3QFUA 1K8KB 3H1QA 2NZTA 3CJ9A 4CZGA 1JCGA 4QS8A 1QZ6A 3O8MA 1TYQA 5FPDA 2QW9A 3D2EB 4DQ8A 5AFUA 3LDOA 2YI1A 5BRHA 1NGDA 3WT0A 3MCPA 2A42A 3MN6A 2Q36A 5B8HA 1WOQA 2GEMA 3VGLA 2IIRA 2E2NA 4BQLA 3FZKA 3CERA 1TYQB 3A5NC 4QS9A 2V7ZA 2ASMA 2UYTA 4GNIA 5AQQA 5ADXA 3VPZA 2AP1A 2IVNA 2A3ZA 5EVZA 2V7YA 4L3QA 1IJJA 3SMSA 4H0VB 1NGIA 1T6CA 4BC4A 3QB0A 3VOVA 2E1YA 5ELZA 2HOEA 3CJ1A 4O8KA 3QDKA 1GLLO 4CZKA 4WQ4C 3FLCO 4F9OA 1NGAA 2E2OA 4A2BA 4MLHA 1QZ5A 3VEXA 2FSKA 4EHUA 1SZ2A 1NGGA 2CGKA 4NO7A 1NM1A 3D2FB 1C0FA 3MMVA 3VGMA 2F9TA 5AQWA 4B1YB 3GBTA 4B9QA 4CZIA 1YXQA 5EY4A 2BUPA 2DPNA 4O5FA 4BRAA 1LCUA 3L0QA 4BRNA 5AQTA 2IVOA 1NGCA 3KHYA 3ID8A 4XH1A 1TUUA 3I8BA 3U4LA 5BPMA 1NMDA 2V52B 1BWFO 2ZGYA 5AZIA 2NLXA 4H5NA 2VWBA 5AQSA 1YUWA 1RFQA 4HTLA 3H3OB 4K41A 5F2RA 5KPTA 2J4RA 3VENA 4BRIA 3LM2A 1BA0A 3UKUA 4PKGA 4CJ7A 5JICA 1TUYA 1NWKA 3CJBA 3VEYA 4FWRA 4H5TA 5F0XA 1DEJA 5AZIB 4CBXA 1BO5O 1P8ZA 4CZFA 1G99A 5AQKA 5KQDA 4M7YA 1KAXA 1RDWX 3HI0A 5KPRA 1DGKN 3FGUA 4BRPA 3DXKA 1HLUA 2I7PA 1HKCA 4IXCA 3LL3A 5AQPA 5CE3A
chains in the Genus database with same CATH superfamily
2Q3SA 3LDSA 3CXCM 4LFAK 3OYHA 3K0SA 1QQNA 1FXXA 3TSPA 3VERA 4M42A 3VQBA 1Q18A 1KVBA 3WXJA 1TL1A 3L2UA 4NB4A 2HMPA 3TANA 3OS0A 3FZLA 3KLHA 3D45A 3KJVA 1L3UA 1C1CA 3O5BA 1JLBA 1EP4A 5SWMA 4KREA 3SJJA 4O0IA 4OPAA 2O8FA 4IFYA 2QWLA 3OS2A 4C1NI 3P4IA 1CXQA 2KZZA 4FJHA 3TSUA 4WFNL 3M6GA 5KI6A 4TSXA 3HVRA 4HVJA 5GAGP 4H0TB 1S72N 3OYMA 1YVUA 4CZJA 1LV5A 3NF6A 1HKBA 4E7HA 3VF6A 1SUQA 3NF7A 3ATVA 3V1QA 1D8YA 3ISNC 5FDLA 3FZFA 4K43A 1X3MA 1RBUA 4FWSA 4EIAA 3AVBA 4CEDA 4BRHA 3B8AX 4H0YB 3W0LA 1Q8IA 2EWSA 5M1KA 2ETJA 4AHSA 1BCMA 3QBWA 3KIOA 1NNEA 5TKYA 5EX5A 2A1RA 3ZLJA 1HNXK 1RTDA 4DFMA 2B5JA 3AA2A 1OH5A 4O8UA 4XEIA 4W5NA 3F73A 2H3GX 1KAZA 2HHUA 2QWMA 4JN4A 3KLFA 3THXA 2KFZA 1DTTA 4BVPA 3CHWA 1K73O 2VYPA 3AGRA 4RW8A 1XC3A 3O4QA 1VSJA 3E1YA 3KWIA 1KXPA 1BL3A 4FJNA 3TAGA 1MU2A 4J8FA 5EXWA 4IDKA 4CESA 2BE2A 1QE1A 4YOXA 1U04A 3THXB 3T1YK 3KZBA 3ITHA 4ZTJA 4DKWA 1QQCA 2NUBA 3I0SA 4BG9A 4CJFA 3P38A 1IG9A 3D7EO 3VQDA 5AQOA 1X9SA 1W97L 4FM2A 4IOAL 4CBWA 2QWQA 4EZ9A 4FJ7A 3C6AA 3HVTA 5BN9A 3OYJA 4FCYA 3J7YP 4FLTA 3OJSA 5BPLA 3JYTA 3PX4A 1BUPA 3DM2A 3R1XA 3ZSXA 4YNQA 3NH2A 4FJIA 1NGHA 3UIQA 2VG7A 3HL8A 3AA4A 1L3VA 2ASOA 4C23A 4Z4CA 3TAQA 3OYIA 4N47A 4Z4EA 1LW2A 1Q9YA 2HBLA 1R0AA 1J54A 3VA0A 4FWPA 2RPIA 4CF8A 4E1MA 1SL2A 4ELVA 3SK3A 1RNHA 1IKVA 1WSEA 3PX6A 3DMJA 2QWOA 3LZIA 3KVGA 3KK2A 4WF9L 3WQTA 2ASPA 2O8DA 2YHBA 4FPAA 1RTJA 1OH6A 4BR2A 3L8BA 4CD1A 4NXNK 3A2FA 1TAQA 2F8TA 2UXCK 2X74A 4CJQA 4B3SK 2KKZA 4B1VA 3QINA 2DFHA 2O8DB 5AQFA 4KI4A 1JXBA 1DLOA 4B9UA 1N5YA 1X1PA 5JVHL 4IG3A 3MECA 3T7ZA 3VQ6A 4DTJA 4PA1A 3WXMB 1NOYA 5AFUH 4I2QA 2P9KA 2ITMA 3C6UA 3CQYA 1ZBLA 4FK0A 4CJ3A 4JI1K 3ZSWA 1J53A 1VQLN 4RW7A 4ZHRA 3NCIA 4CECA 1X3NA 4H03B 1C0MA 4ID1A 1S9EA 1L3TA 2FBTA 2HF4A 1X9JA 1MWKA 2P9KB 3MWTA 4CIFA 3L4QA 3VEOA 3RR7A 4ID5A 3J7ZO 3ENOA 1RDAA 4NYNA 4QAGA 4HHTA 2UUCK 4ELUA 3BF3A 4CGGA 4O44A 3T3FA 3I33A 3QESA 4DTRA 1JXEA 2ITGA 2R7YA 1ZBHA 5BPNA 1U49A 3IDHA 4DHYA 5LJVA 1SAZA 3IFRA 3R9PA 4E7KA 3E9OA 5GAEP 4CF9A 4DU1A 1TAUA 4FYDA 4C8MA 4N5SA 1NOZA 4KTZA 3PIOL 5GINA 2JGUA 2D0BA 5IT9O 2HHSA 1CZ9A 4FZXC 3EL2A 4E1JA 4DWIA 2D0PA 2HNDA 4LF8K 4WQ5A 1S22A 4AHUA 3LANA 4CJRA 3DOLA 4MO5A 2IVPA 4KB1A 4X66K 1BISA 3TARA 3Q7BA 4WE1A 4I9QA 3MCAB 4YOTA 1YTAA 3ZX2A 4CIGA 5JLHA 1ATSA 3CJAA 3VEWA 4Z4IA 1BIUA 4A57A 3TR8A 1I94K 4GKJK 2OTJN 4CJWA 3G6EN 1NJWA 2WONA 4IBNA 1Q81O 1GLEG 4FWLA 2QEXN 1ZXOA 4HWIA 3L2VA 3MK6A 4B1ZA 3AA5X 3VQPA 1QSSA 2Q31A 3CM6A 3EKSA 1TVRA 3OYCA 5HL7L 4KHQA 3L4IA 5E41A 3H1QA 3AO3A 3QNNA 1JCGA 1YF5L 3LAMA 1O13A 5FPDA 3ASMA 3OJUA 5AFUA 1C1BA 2YI1A 1GOAA 1JLQA 3HXMA 5I3UA 2BANA 2HVIA 1WOQA 3SAFA 3VGLA 3T19A 1OVYA 3S3MA 1O1WA 4QS9A 2ASMA 5AQQA 4FM1A 3J81O 4DG1A 4Q0BA 4DV4K 4L3QA 4FK4A 4R79A 1RT4A 1XWLA 3QB0A 2ZE2A 1VSMA 1C1AA 4AH9A 2HOEA 4C8LA 1E3MA 1WAFA 3OS1A 3FLCO 4YY3K 4LF5K 4FJKA 2E2OA 5FRNA 5FRMA 1QZ5A 4KHSA 1FJGK 4FLVA 4KTWA 4KV8A 4DR2K 3ZT2A 1KFDA 3K5NA 4E0DA 3D2FB 3O9QA 1C0FA 3VGMA 1RBVA 3N4QA 3VQCA 4CZIA 1YXQA 1W2BM 5C25A 1VSFA 4BRAA 3DLRA 2XY8A 3ZT0A 4CE9A 1ITGA 4KH6A 4B8CA 2IVOA 3KHYA 4K8XA 1NK0A 1EX4A 2XHBA 3LALA 1WAJA 3I8BA 3U4LA 1VQ6N 2B6AA 2V52B 3DRRA 5M1FA 2WOMA 2ZGYA 1T8EA 4PY5A 3OTOK 3NGYA 4JI0K 5KPTA 2HW3A 3MXJA 1HNWK 4AHVA 5JICA 2KLAA 3THYA 5J2PA 4LF6K 4NYFA 5F0XA 3RMBA 1P8ZA 4CGJA 5CY4A 1G99A 3OA9A 4Z0UA 2OYQA 4DV5K 3HI0A 4WFAL 3TABA 2YNFA 3AVAA 3OYDA 3THYB 4CJ5A 3FGUA 4BRPA 2EX3A 4IXCA 4Y1DA 1HPZA 4CJVA 4JKBA 4BVOA 2ZQBA 4FWKA 2YHAA 3QETA 3LWMA 4FJ9A 3GL1A 3O9SA 3CCEN 4N76A 3O1WA 2UUBK 3OY9A 3IG1A 4DTMA 1KD1O 3MX5A 4CEOA 1HX1A 4RG8A 4H5VA 1RT6A 1HMVA 1E4FT 3LP3A 3CIPA 4FJMA 1V4TA 2E2PA 4CZMA 2QXLA 3L2QA 1U48A 4LSLA 3BEXA 3HYFA 3HBTA 1BQMA 2PYLA 3KKRA 3HTVA 3AVIA 4M3TA 1T44A 1D4XA 3SJHA 4GV9A 1ATNA 5HRPA 4E7LA 1T7PA 3K5OA 4KHWA 1ASUA 2E4LA 4BRFA 2HHWA 3CG7A 4OVLA 3C95A 5F1XA 3MN5A 3F2KA 3R8EA 4LH4A 1A5XA 3M8PA 1QVGM 2BGGA 4K42A 2E8AA 3WQUA 1RTIA 1I3AA 2HMIA 3VEVA 3S9HA 3MXMA 2KQ2A 5AQXA 4M3UA 1W7AA 2FLOA 3MDQA 3DRPA 4CF2A 5MLCQ 4V19S 2OPPA 3TTFA 3QEVA 3SI6A 4KHUA 4CEEA 4PQUA 3AO2A 1DKGD 3SZ2A 4BRMA 3QLHA 2D4WA 1RBRA 5FPNA 1GLAG 1HJOA 2YNIA 3HP6A 2NRTA 4CEAA 4DTNA 4PUOA 1KLMA 4CZHA 3HM9A 2P9UA 3RSEA 4DLEA 2QWPA 4CJTA 1Q9XA 2G8UA 3FFKB 4A62A 4CK3A 3CCJN 4IOCL 4B3TK 3A5OC 4CGFA 4JYAK 1BIZA 4FO0A 3VQAA 3AGKA 4OJRA 4DR7K 1LW0A 4G9ZA 3RSEB 4OLBA 3M3ZA 4JNEA 1RT7A 3K9KA 4BRCA 2P51A 2GWJA 4IZ9A 3HSTB 1TKTA 3BZKA 4H0PA 1U45A 1HQEA 1XQSC 4XH4A 1L5UA 3L2WA 1Q7YO 2E6MA 4Y1CA 4HCCA 3UKUB 1QQMA 3UKRA 3EKUA 2PFUA 2OZSA 2FF3B 4BRQA 1J5OA 4IWVA 3KTQA 4YOUA 3TSQA 3S3NA 1WSHA 3C6HA 2NRRA 2QKBA 2D1KA 5GIPA 3O3FA 4BR5A 4B1XB 4M63C 5AQRA 4KBOA 2Q97A 3UKRB 4PL7A 1NKBA 3BUZB 3MX2A 2E88A 4AM7A 3G10A 2Z1HA 4OGEA 1EWQA 3V1OA 3C0BA 3T1HK 1SL1A 3S3OA 4ILJA 4BRGA 2OCEA 3ZCMA 3SQ4A 1T3VA 4NLCA 4J2AA 3SUPA 5AR0A 4QOZB 4YOVA 2OA8A 1RT1A 4C1NK 2E20A 3MEDA 3DLEA 3F9MA 4DR6K 3VTIA 1EWRA 4B9NA 4L8RB 2ZJRL 2F96A 3O9UA 1VSDA 2F7TA 2Q0RA 3LP0A 3Q7CA 2UU9K 3AY9A 4CF1A 5I9EB 1HNIA 1WUAA 4IJNA 3MEGA 4JS4A 4DB3A 1J5EK 2O8FB 4H0XB 3V9ZA 1S5JA 4Z94A 3CQXA 4YFUA 4CFCA 3QBXA 5HRNA 5D3GA 1VSLA 4DMNA 4C8KA 4HUEA 1WNSA 1S9GA 1EQYA 4YHHK 3DJCA 1BG3A 4FOEA 1TL3A 4EP5A 4OKKA 4FVMA 3QMLA 1XI1A 2CGLA 1XMQK 4FZZA 4Y0WA 1VQMN 4CJPA 3O6WA 5HROA 2O4GA 4A5BA 1BCOA 4JRPA 3SBGA 1UA1A 4LFBK 1U47A 4WFBL 4BR4A 1NGEA 3LP2A 3WXIA 1QQOA 2E6LA 4IO8A 3ULDA 2IOCA 2Q1NA 2A6AA 3VGKA 2CH5A 4MO4A 4DQSA 3QFPA 1OH7A 1WN7A 4IFVA 1NJXA 4BGAA 4WQ4A 2HHQA 1IV0A 1JLAA 1Q86O 3ZX3A 3NMUA 1SV5A 4B9TA 5BRFA 2UXBK 4FW1A 2XRIA 1LOTB 3P5JA 1JKHA 2FC0A 3AVGA 1NK8A 3M1FA 1T6DA 3ZYYX 2OPSA 3FZHA 1GLBG 3A0IX 3AVCA 3O9RA 3SUNA 4DF8A 1ZBIA 3CM5A 1HNZK 1VK0A 4CI6A 3C6TA 3K5MA 4F4KA 4KHPK 3SYZA 1HNVA 3PLAA 1GLCG 4FL9A 5KQ8A 4DTOA 1CXUA 1LAVA 4RCHA 3HPGA 1RDCA 4N56A 1KRPA 3DOKA 2UUAK 3E01A 3NBPA 5CYQA 3A8YA 3QERA 1C6VA 4GVEA 1HUXA 1CZBA 4XH5A 3SAGA 1VHXA 3M5RA 2A40A 4OLAA 4CGHA 4HUGA 3FZMA 2VCPA 4FSVA 3WXLA 4PKHA 4DUYK 2GUPA 3QFUA 4CJEA 4CZGA 4DV3K 3AV9A 3BY5A 1QZ6A 4CFBA 4CHPA 2UXDK 3M8SA 5C12A 2QW9A 4XIUA 4JEPA 4DQ8A 3HRGA 2RN2A 3B6PA 2Z1JA 3ZT1A 3VQ7A 1NK9A 1JLFA 2HNZA 3MN6A 3OYAA 3AVLA 3SPYA 3OYNA 3K59A 2IIRA 2E2NA 3CERA 1S1UA 3NFAA 4GNIA 4UY8O 4JV5K 4E3SA 4MFBA 1JLCA 2V7YA 3SMSA 3B6OA 4H0VB 4K8ZA 1T6CA 2RHKA 5KRTA 4Z4FA 3BDPA 4OPHA 4BC4A 3VOVA 5ELZA 3SQ1A 3QDKA 2F4VK 1S1TA 5J2NA 5K14A 2VG6A 1N34K 4AHRA 2I5JA 3ZSOA 2CGKA 4CEBA 5GADP 2WTUA 3THVA 4DSLA 3AVFA 3ZSVA 3CC4N 4JKEA 1F21A 2IAJA 5AQWA 4B9QA 3QEPA 1NKEA 3IRXA 1JL1A 3E9LA 4CJSA 5LMNK 1QTMA 1P90A 4CGIA 2BUPA 2DPNA 3L0QA 4BRNA 3OYFA 2KZMA 5CR4A 1YJWN 4AF1A 1HJRA 3ID8A 5HRSA 4IKFA 4DQIA 1SKWA 4I7FA 4DF4A 3HT3A 1BQNA 5I42A 1ASWA 4FLYA 5AQSA 3SBTA 3H3OB 2PYJA 5F2RA 3VENA 5C15A 4PKGA 4LH5A 1TUYA 1IBKK 2HHVA 3IS9A 3VQ5A 2B4JA 3O3GA 4FWRA 4F3TA 5C2FA 4C8OA 4CBXA 1NK4A 1RBSA 1XMOK 2YNGA 1KAXA 2PZSA 1KVCA 1YTUA 1DGKN 1EETA 2ZD1A 4DR1K 2I7PA 3DXKA 1HKCA 2YKMA 3SMPA 1GOCA 4MDAA 3DYAA 4CBUA 3KD5E 4H4MA 4GKKK 1N36K 4PL8A 3EZWA 4FLZA 4GV3A 4CZLA 1TV6A 3VESA 2FSNA 4JHDA 2O8EA 5EOYA 1C0GA 3CFOA 3DXKB 2AA4A 4A2AA 1RDBA 4J2EA 4MLEA 3G25A 3MN7A 5A2QO 3EE9A 2F9WA 1NJIO 3SCXA 1IKYA 1U6ZA 4HCBA 1WSGA 1H1VA 1TK5A 1DT9A 4JHDB 4KTQA 3ATUA 5E84A 2O8EB 5KPZA 1U2VA 2DTUA 4FWMA 3NAEA 3RMCA 4I6MA 1NK5A 4DFPA 5AJ3K 4JKFA 3UE5A 4H5WA 4BC2A 4DQRA 1N6QA 1U2VB 3BF1A 3OYKA 1RT2A 3J8AA 1QHTA 5AQNA 4KPYA 1YJ9N 4I6MB 1A5VA 1CLQA 2YNHA 1E4GT 4KB0A 1RDUA 3HSCA 4X64K 5JMVA 3SV3A 5HP1A 3VF2A 1WSIA 1EXQA 3ZEUA 3S41A 3SLCA 4JI6K 1NK7A 1WB9A 2NRWA 5DK5A 3CFRA 1SL0A 4B9VA 4RTFD 1VQ9N 4B3RK 2QA4N 3SQ2A 3CJ7A 2KHOA 3VMFB 2VGMA 4CHYA 1W9HA 4M41A 4FLXA 4K0KK 2A1SA 1TK0A 2P5OA 4U67L 3IAYA 2Q0UA 1WSFA 1LWEA 3ZEUB 2HHHK 4FVUA 2QWNA 4CEFA 2W42A 4DV2K 4N41A 1XNQK 1BI4A 5AQVA 4CCHA 2JLEA 3MWPA 4AQYK 4BDPA 4W5OA 3AVJA 2RF2A 5BR8K 4DV1K 3HO1A 2V51B 1ZYQA 4FZYA 2Q2RA 2HSTA 2ZF5O 3K2PA 3CQ8A 3JXUA 5AQZA 4W5RA 4GVMA 4DS5A 4EHTA 2QK9A 2HBKA 3JSMA 1XC9A 4FJJA 3EEQA 1HQUA 3ALYA 4B9SA 4DUZK 3EY1A 4GY2B 3QO9A 4AHTA 3V6DA 3CCQN 3C94A 5AQIA 1RT3A 4FWNA 3OYEA 1N32K 3IMXA 3O08A 4YDUA 2YCHA 2Y1JA 1L3SA 4OKJA 4A59A 5E26A 1YIJN 1RTHA 2E2QA 4E89A 5JLFA 2ZGZA 4WYBA 3GOIA 1NGFA 4BR7A 3EE8A 3LWLA 1VSKA 3PY8A 4ISFA 3NGIA 4KKOA 2VWKA 3CD6N 1HRHA 4J2BA 3AVKA 4CHZA 4BGBA 5C2DA 3TPQA 3OYBA 1Q82O 3VQ9A 4M45A 4EAHD 4BROA 5AQYA 2HF3A 2NRHA 4E7JA 4BR0A 4BC5A 1VSEA 3H1VX 3T1AA 4BRKA 4BE2A 4BQZA 4PHTX 4FM0A 2XY5A 4BY9C 4DS4A 4BRLA 4DFJA 4ICLA 2P9NA 3DLKA 3CPWM 3L3VA 2P1JA 2OPRA 4ILGB 4DU4A 3J7AP 2IC3A 4RW4A 4E7IA 2VG5A 3BP8A 3D2EA 3O3HA 4CJKA 2GBZA 3V4IA 3CCLN 4RW9A 3ZETA 3I8DA 1SS6A 4ILHA 4NXMK 1R59O 2HHTA 2CH6A 3K9JA 1JLGA 3V81A 3O80A 5SZTA 2P9NB 1HYZA 2PAVA 3A5MC 3TU5A 4KHNA 2PBDA 4OPJA 2CGJA 3LDNA 3MN9A 3AARA 5AQLA 3NH1A 1IKWA 5AZJA 1B9FA 1MA9B 3IUCA 3HK2A 1VSHA 3ZETB 4ISEA 4CK2A 1IBLK 3HOTA 4NCBA 1UOCA 2WUSA 1JLEA 3OYGA 4F8RA 5AQJA 1S3XA 3HM8A 2GV9A 1VQ4N 1Z6RA 5AZJB 5LY3A 4KRFA 5ADXH 4DU3A 3HJFA 2OPQA 4IFEA 3EZ5A 3CJCA 3G0ZA 4DV6K 1HPMA 2GTDA 1RBTA 3P39A 1UA0A 1OKJA 1OVQA 2QXFA 1HR0K 4DSIA 4FWQA 2NNWA 3CPEA 2FXUA 1C0UA 2HB5A 4CJLA 4M3ZA 5AQHA 5T7BA 3U9DA 4JS5A 3L3UA 1LWCA 3JAMO 2P9PA 3AVMA 4CZEA 1MDUB 2G8HA 1XUPO 5HBMA 3KLEA 1BDGA 4J2DA 4WCEL 3JS6A 4CK1A 3CCMN 5AQGA 3VEZA 1M1KO 1W0HA 2P9PB 4KO0A 4KHYA 4JI2K 4JAXA 3VF4A 2P9UB 1JCFA 4BDYA 4H5RA 3AO5A 4HUFA 4IG0A 1KFSA 3PSIA 3H46O 4DFKA 4FJ5A 3VQQA 2O8CA 1NGJA 4W5TA 3U9ZA 3OBWA 3P1GA 3FFIA 4FXDA 4M3WA 1WBBA 4M3XA 2PY5A 2Z1IA 3LDQA 3ENHA 2P9IA 3D6RA 2GUIA 1U4BA 3LDPA 3NVKA 2A41A 2YHXA 3KK7A 3UB5A 1JCEA 4Z4HA 2D0CA 2O8CB 1S6PA 3FR0A 4K25A 1KSPA 2HBJA 4M3YA 2W6KA 2GELA 1I39A 3HPHA 2P9IB 4QS7A 4LF4K 3ULEA 4JI4K 1ZBUA 4B9MA 5M1PA 4GV6A 3DWLA 3KKSA 3GG4A 3F9KA 1V4SA 5FLXO 4JK8A 3L2RA 4NCAA 4R5PA 4H4OA 4BR9A 1N33K 2OANA 2GWKA 5C10A 5BRDA 3ULEB 3DLHA 1J9AA 2YHYA 3FE1A 4KH5A 4JRQA 3R6MA 1D9DA 1QSYA 3LPTA 1S6QA 4I9LA 4OX9K 2NZTA 1YT3A 3SAHA 3NDKA 3CCSN 1TYQA 3KWGA 4DTSA 4FJXA 1C0TA 2JWLA 4AHCA 3LDOA 5CZ1A 5BRHA 3QEXA 3WT0A 5IWAK 3MCPA 3THWA 1A5WA 2G8VA 3TAMA 4B3OA 2Q36A 2NRZA 3VQEA 3NH0A 4BQLA 2Y1IA 3VQ4A 3FZKA 1TYQB 5ADXA 1X9WA 2OZMA 3I0RA 3VPZA 1IKXA 2IVNA 3WNFA 1IJJA 2G8IA 3THWB 1NGIA 2QTDA 2X6NA 4JI7K 5CZ2A 4CFDA 2W6LA 3CJ1A 4RW6A 4IO9L 3SPZA 4CZKA 4WQ4C 4F9OA 2GX9A 4A2BA 4MLHA 3V1RA 3VEXA 4X62K 4Z4GA 1SZ2A 4NO7A 2VQEK 3TTDA 3DLBA 4BE1A 3MMVA 2O8BA 4B1YB 3GBTA 1S1VA 3ZSRA 3I56N 5EY4A 3SUQA 1ASVA 4O5FA 4I2PA 3U3GA 1LCUA 5AQTA 3K5LA 3PV8A 4XH1A 3T69A 3HPOA 1UWBA 2D5RA 4NCGA 2O8BB 4LSNA 3PUFA 1NKCA 4JI5K 1KVAA 2FBVA 5AZIA 1NU0A 2NLXA 1RFQA 3J80O 1LAWA 4K41A 2E5LK 2J4RA 4BRIA 4CJ7A 1BA0A 1EO1A 2XO7A 1YI2N 4B08A 3VEYA 3RTVA 3NF8A 3VA3A 1DEJA 1WBDA 5AZIB 1VQ8N 1BO5O 3CCVN 2P5GA 3PSFA 4GW6A 5AQKA 5KQDA 4M7YA 1NG9A 3RMDA 5KPRA 1OH8A 3TAPA 1YITN 5HOOA 3G4SN 4CFAA 1GLFO 1S1WA 4CJ4A 1TKZA 4LF7K 1UAXA 1N8RO 4CF0A 4CHNA 4IOXA 5LJWA 3RR8A 1XNRK 4DV0K 1NGBA 3CF5L 3DXMA 1NJZA 2A5XA 4PKIA 1QS4A 1B9DA 4CEQA 5FPMA 1T05A 3ZT4A 3U8XA 3M8RA 3F5TA 4Q5VA 1D5AA 1ZBSA 2IS3A 4O4GA 3V9UA 4QCLA 3MXIA 5H1SQ 5J2QA 5M1NA 5LL6Z 1YAGA 3GDQA 4FPBA 3DXMB 4CD3A 1IH7A 2EHGA 1G15A 4LC9B 5C0YA 3QICA 4B1WB 3I55N 2IDOA 3PO4A 5C42A 2YX6A 4CW7B 5KGXA 1VQ7N 2QWRA 1GLDG 4JKGA 3R3LA 4LFCK 1TK8A 4HTUA 3CI5A 2G8WA 2FF6A 1NK6A 4DSKA 5LMUK 4B8AB 2ZWHA 5DM7L 3TAEA 3PO5A 3HP9A 4O5BA 4JI8K 3KK1A 4KH4A 4YOYA 4JKGB 1ZBFA 2D0AA 3QNOA 4DV7K 3AO1A 1XHZA 3AA3A 3OYLA 1YVNA 3DRSA 5AQUA 2AJQA 2DFFA 3VTHA 5BN8A 4F3OA 4B1UB 3WNGA 4JKAA 4A61A 4JD2A 5TKWA 4CEZA 4U7BA 3G71N 1KAYA 1RILA 4WQ5C 4H0OA 3OVNA 4CIEA 2P9LA 4BREA 2VQFK 1BA1A 3WNHA 4JD2B 3EO3A 4GMJB 1TKXA 3HZ6A 1WLJA 3TI0A 1Y97A 1Y64A 3ZSZA 2P9LB 4EFHA 4KFBA 2G8KA 1QSLA 3OW2M 2WBNA 1QVFM 1T03A 2FSJA 4JLHA 2ZJQL 4O0JA 1KCFA 1VSIA 3LDLA 1D9FA 3CETA 1HKGA 1REVA 2LSNA 3E66A 4IDHA 1SKRA 1KQSM 3ENBA 1SQKA 2W41A 2ATQA 4YOWA 1BOTO 3M8QA 3DAWA 4E1NA 4CVNE 2XY7A 4DQQA 4JI3K 4FLWA 3PIPL 2DY4A 3EN9A 3GE1A 5BREA 2HNYA 4F2SA 3AAQA 5KRSA 4IJAA 5EU7A 3A5LC 3CYMA 3HOSA 3QEIA 1BGXT 3KD1E 5CYMA 3ZX0A 3CMEN 2JWKA 1VRUA 3NF9A 2HBMA 3O4NA 4BG8A 2YHWA 5M1OA 1VRTA 2YV0X 3K57A 4B3MK 4NLBA 2O4IA 3P31A 3TAFA 4E19A 3NE6A 1TKDA 1GLJO 4DTPA 3H45C 4MQ3A 2D0OA 3CC7N 2XY6A 4OO1J 2YJFA 4AM6A 4BRDA 3ZSQA 4BDZA 3SUOA 1KTQA 5JS2A 4CHQA 3MAQA 3OBYA 1HYVA 2F8SA 3DLGA 5JS1A 3L6QA 1MWMA 3LAKA 2X6SA 1FKOA 3O1BA 3CCRN 1BU6O 5KTQA 2E1ZA 3WNEA 2WC9A 5AQMA 5BR9A 1YHQN 4FLUA 4OKEA 1M90O 3NGZA 3CFPA 2NRVA 5HRRA 1NBWA 4JK7A 4CJUA 4BACA 1RCHA 4YORA 4DSEA 4PWDA 2YJEA 2NRXA 1ESVA 3D0PA 4DCHA 4DTXA 3NHGA 4ISGA 3SNNA 3D2FA 3O9TA 1VQ5N 5FPEA 3WUHA 3TWHA 4CHOA 3C7NA 2P9SA 3N4PA 4W5QA 4AILC 4C8NA 1ATRA 1RGIA 4RWTA 2IGIA 1XHXA 3E9PA 3ZSYA 3AO4A 4LD0A 3LM9A 3C7NB 2P9SB 1GOBA 2I7NA 4YDUC 1BI4B 5JVGL 1DTQA 4IEIA 1FKPA 4DSJA 3WEEA 2BTFA 4MDBA 2X78A 3LP1A 4LY7A 4FK2A 1IG8A 3AAPA 4DLGA 5KGWA 2BH1A 3WXKA 1ZC6A 3U6FA 1J6ZA 4DTUA 2BDPA 1RDDA 2QKKA 4DSFA 2HHXA 3AVHA 4DR4K 3WEEB 3V9WA 1B92A 3IKMA 4JK9A 2ZM6K 4FOIA 3CCUN 1X9MA 3CMAN 1WSJA 4JKHA 4BC3A 1K6YA 3H3NO 3H6EA 2QM1A 4FWOA 3QEWA 4A5AA 3RWUA 3PX0A 2W40A 4M7XA 2KFNA 1RT5A 3VQ8A 2FBXA 2YKNA 3VETA 3U3YA 4FJLA 5J1EA 4DQPA 4EZ6A 1EKEA 5FROA 3NVMA 5HLFA 3KK3A 1K8KA 3O4WA 5DM6L 3DLLL 1CZAN 4FW2A 1IBMK 3EYZA 1VQNN 4CGDA 3LZJA 2G8FA 1QHAA 1Z05A 1NLVA 4M3RA 4ZTFA 3TTCA 3OHRA 4G1QA 3W3DA 1K8KB 1SKSA 3CJ9A 2KTQA 4QS8A 3O8MA 3P83D 3BZCA 1TGOA 4OPKA 3D2EB 3LPUA 1NJYA 3MEEA 3BGRA 1YJNN 1IO2A 1NGDA 3VN5A 2A42A 3RRHA 3QIPA 5J2MA 5B8HA 3V9SA 2GEMA 3DI6A 2VWJA 1LWFA 4JKCA 1Z25A 4BWMA 3A5NC 5CHIA 2V7ZA 2UYTA 4BE0A 2KW4A 4LF9K 1ILYA 4BWJA 2AP1A 4OGCA 2Z1GA 2A3ZA 4KI6A 5EVZA 5GAHP 5DMRA 4IEEA 1KLNA 1VQKN 4DR5K 4F2RA 3K58A 2E1YA 1BHLA 1FW6A 4O8KA 1GLLO 2WFBA 1JJ2M 1NGAA 2RKIA 1KC8O 4EP4A 3RMAA 2FSKA 3ID6A 4EHUA 3QIOA 1NGGA 1NM1A 1VQPN 3SQ0A 2F9TA 4UQGA 4X65K 5C24A 3KLGA 3H08A 1VAZA 4FJ8A 1NGCA 3AVNA 1VQON 3SV4A 1TUUA 5BPMA 1NMDA 1HYSA 1BWFO 4KAZA 2HVHA 1JL2A 4H5NA 2VWBA 1YUWA 4DR3K 4HTLA 4ELTA 2ZJPL 5M1QA 3LM2A 2DFEA 3UKUA 1FK9A 5GIOA 3CC2N 3RRGA 1K9MO 1NWKA 3CJBA 4CERA 3RVCA 1NMNA 2VGNA 4H5TA 4FJGA 1Z26A 3KLIA 4JKDA 2OTLN 1K8AO 4H8KA 4CZFA 4B9LA 1RDWX 2RE2A 3V9XA 3ZT3A 2FBYA 3C65A 1S1XA 2QI2A 1HLUA 3LL3A 4O55A 5AQPA 5CE3A
chains in the Genus database with same CATH topology
5HOOA 4JKBA 4BVOA 3G4SN 3SMPA 4CBUA 4MDAA 3CXCM 1GLFO 1QQNA 4FWKA 4PL8A 3TSPA 3VERA 3EZWA 4GV3A 3GL1A 3O9SA 3CCEN 4CZLA 1Q18A 3VESA 1N8RO 2FSNA 3WXJA 4JHDA 5EOYA 1C0GA 2HMPA 4IOXA 3DXKB 2AA4A 3O1WA 4NB4A 4A2AA 5LJWA 1NGBA 3CF5L 3DXMA 3FZLA 2A5XA 4PKIA 1KD1O 4MLEA 3G25A 3MN7A 3MX5A 3EE9A 5FPMA 2F9WA 1NJIO 1U6ZA 1HX1A 3U8XA 3F5TA 4H5VA 3O5BA 1ZBSA 1E4FT 1H1VA 3CIPA 5H1SQ 1DT9A 4JHDB 1V4TA 2E2PA 3ATUA 2QXLA 4OPAA 5E84A 4CZMA 5KPZA 1U2VA 2QWLA 4C1NI 3P4IA 5M1NA 3BEXA 1YAGA 3TSUA 3GDQA 4FWMA 3M6GA 4FPBA 4WFNL 3DXMB 3HBTA 4I6MA 4H0TB 4CD3A 5GAGP 1S72N 4LC9B 5C0YA 3QICA 4B1WB 4CZJA 3HTVA 3I55N 2YX6A 1T44A 1VQ7N 1D4XA 2QWRA 3SJHA 1GLDG 4JKFA 4JKGA 3R3LA 4H5WA 3UE5A 1ATNA 4BC2A 4GV9A 1HKBA 3VF6A 1U2VB 3BF1A 3CI5A 2FF6A 4BRFA 3ATVA 3J8AA 5AQNA 3FZFA 2ZWHA 1X3MA 4K43A 5DM7L 1YJ9N 4I6MB 4FWSA 5F1XA 3MN5A 4EIAA 3F2KA 3R8EA 1E4GT 4BRHA 1RDUA 3B8AX 3HSCA 4H0YB 3W0LA 1QVGM 4KH4A 4K42A 5JMVA 4YOYA 2E8AA 2EWSA 3VF2A 3WQUA 5M1KA 3ZEUA 4JKGB 3S41A 3SLCA 2NRWA 3VEVA 4RTFD 1VQ9N 3QBWA 2QA4N 1YVNA 3CJ7A 2KHOA 5AQUA 2VGMA 3VMFB 5AQXA 3VTHA 1EO1A 5BN8A 5TKYA 2FLOA 3MDQA 5EX5A 5MLCQ 4B1UB 4U67L 4JKAA 3TTFA 2Q0UA 4JD2A 5TKWA 4A61A 4U7BA 3G71N 1KAYA 3ZEUB 4WQ5C 4O8UA 4FVUA 1DKGD 2QWNA 4XEIA 4H0OA 4BRMA 2H3GX 2D4WA 1KAZA 2P9LA 2QWMA 4JN4A 5AQVA 5FPNA 3MWPA 4BREA 1GLAG 4BVPA 1HJOA 3CHWA 1K73O 2NRTA 4CZHA 1BA1A 2VYPA 3AGRA 2V51B 2P9UA 3RSEA 2Q2RA 2HSTA 1XC3A 2ZF5O 3EO3A 4JD2B 2QWPA 3E1YA 3HZ6A 3KWIA 1KXPA 3JXUA 5AQZA 3FFKB 4J8FA 5EXWA 4A62A 3CCJN 4IOCL 1Y64A 4EHTA 2P9LB 4EFHA 3A5OC 4YOXA 2HBKA 4FO0A 3KZBA 3OW2M 3AGKA 4DKWA 4BG9A 3RSEB 2WBNA 4G9ZA 3P38A 1QVFM 3D7EO 3M3ZA 4GY2B 4JNEA 3K9KA 5AQOA 4BRCA 1W97L 2GWJA 3CCQN 5AQIA 4IZ9A 2FSJA 4FWNA 2ZJQL 4IOAL 4CBWA 3IMXA 3O08A 2QWQA 3LDLA 4H0PA 4YDUA 1XQSC 2YCHA 4XH4A 1Q7YO 3CETA 1HKGA 4IDHA 3C6AA 3E66A 5BN9A 1QQMA 3UKUB 1KQSM 3UKRA 3ENBA 1SQKA 2W41A 3EKUA 2PFUA 4YOWA 2FF3B 4A59A 4BRQA 5E26A 1BOTO 4IWVA 1YIJN 5BPLA 3DAWA 4YOUA 1BUPA 3TSQA 3R1XA 2E2QA 5JLFA 2ZGZA 3C6HA 3PIPL 1NGHA 3GOIA 2NRRA 1NGFA 3EN9A 2D1KA 4WYBA 3EE8A 3GE1A 4BR7A 5BREA 5GIPA 4BR5A 4B1XB 2ASOA 4ISFA 4C23A 3CD6N 3AAQA 4M63C 4IJAA 5AQRA 4BGBA 5C2DA 3TPQA 4KBOA 2Q97A 1Q82O 3A5LC 4EAHD 3UKRB 4BROA 4PL7A 2HBLA 3BUZB 5AQYA 3HOSA 2HF3A 2NRHA 3MX2A 2E88A 4AM7A 4BR0A 4BC5A 4FWPA 3H1VX 4BRKA 3C0BA 3SK3A 4BQZA 4ILJA 4PHTX 4BY9C 4BRGA 4BRLA 3ZX0A 2P9NA 2QWOA 1T3VA 3CPWM 3CMEN 2JWKA 3KVGA 2HBMA 4NLCA 4BG8A 4ILGB 2YHWA 5AR0A 5M1OA 4WF9L 4YOVA 4NLBA 3WQTA 2ASPA 3P31A 4C1NK 4FPAA 2E20A 3BP8A 3D2EA 1GLJO 3F9MA 3CCLN 3VTIA 3ZETA 4BR2A 1SS6A 4ILHA 3H45C 4CD1A 2ZJRL 1R59O 3O9UA 2CH6A 2D0OA 3K9JA 2F7TA 2Q0RA 3Q7CA 3CC7N 3O80A 3AY9A 5I9EB 2P9NB 1WUAA 2PAVA 3A5MC 4IJNA 2YJFA 2PBDA 3TU5A 2CGJA 3LDNA 3MN9A 3AARA 4AM6A 4BRDA 5AQLA 2KKZA 4B1VA 4DB3A 3OBYA 4H0XB 5AQFA 3L6QA 4Z94A 1MWMA 5AZJA 1MA9B 3CQXA 3IUCA 3QBXA 3O1BA 3ZETB 5JVHL 4ISEA 3T7ZA 3CCRN 1BU6O 3WXMB 5AFUH 3HOTA 2E1ZA 2WC9A 5AQMA 2P9KA 5BR9A 1YHQN 1EQYA 2ITMA 2WUSA 1M90O 3CQYA 1BG3A 3DJCA 2NRVA 4FOEA 5AQJA 1S3XA 3HM8A 1NBWA 1VQ4N 1Z6RA 5AZJB 4JK7A 1VQLN 3QMLA 5LY3A 4YORA 5ADXH 2CGLA 1X3NA 2YJEA 2NRXA 1ESVA 4H03B 4IFEA 4Y0WA 1VQMN 4DCHA 3CJCA 1HPMA 2GTDA 2HF4A 1X9JA 1MWKA 2P9KB 3MWTA 3O6WA 3L4QA 3P39A 4ISGA 3D2FA 3O9TA 1OKJA 3VEOA 1VQ5N 4A5BA 5FPEA 3WUHA 4FWQA 3ENOA 3J7ZO 2NNWA 3CPEA 3SBGA 2FXUA 3BF3A 3C7NA 2P9SA 3N4PA 5AQHA 4WFBL 4BR4A 1NGEA 1ATRA 3WXIA 3U9DA 1QQOA 1RGIA 4RWTA 4IO8A 3I33A 2P9PA 3E9PA 2Q1NA 2A6AA 3VGKA 2CH5A 4MO4A 4CZEA 1MDUB 5BPNA 3QFPA 3IDHA 4DHYA 5LJVA 1SAZA 1XUPO 3LM9A 3IFRA 1BDGA 4BGAA 3R9PA 4WCEL 3C7NB 2P9SB 3JS6A 4WQ4A 2I7NA 3E9OA 4YDUC 3CCMN 5GAEP 5JVGL 5AQGA 3VEZA 1M1KO 1Q86O 2P9PB 4IEIA 3ZX3A 3NMUA 4OO1J 3WEEA 3PIOL 5BRFA 4JAXA 3VF4A 2P9UB 1JCFA 2BTFA 4H5RA 5GINA 4MDBA 1LOTB 3EL2A 4E1JA 3H46O 1IG8A 2D0PA 3AAPA 2BH1A 3WXKA 4WQ5A 1ZC6A 1S22A 1J6ZA 1NGJA 3M1FA 1T6DA 3U9ZA 3OBWA 3ZYYX 3WEEB 3FZHA 1GLBG 3A0IX 3IKMA 3ENHA 3LDQA 2P9IA 3D6RA 4JK9A 4MO5A 4FOIA 3CCUN 3LDPA 3O9RA 3NVKA 2IVPA 3CMAN 2A41A 2YHXA 4JKHA 3KK7A 3UB5A 4BC3A 3H3NO 3H6EA 4CI6A 1JCEA 2QM1A 4FWOA 4A5AA 3FR0A 3Q7BA 4K25A 2HBJA 3MCAB 4YOTA 3ZX2A 3PLAA 2W40A 4M7XA 1GLCG 4FL9A 2GELA 5JLHA 1ATSA 3CJAA 5KQ8A 2P9IB 3VEWA 4QS7A 3ULEA 4A57A 3VETA 4RCHA 5M1PA 2OTJN 4GV6A 3G6EN 3DWLA 3GG4A 1Q81O 3NVMA 1GLEG 4FWLA 1K8KA 1V4SA 3O4WA 3A8YA 4JK8A 1ZXOA 2QEXN 5DM6L 4BR9A 3DLLL 1CZAN 4GVEA 4HWIA 2OANA 2GWKA 1HUXA 1VQNN 5C10A 4XH5A 3MK6A 1QHAA 3ULEB 4B1ZA 5BRDA 3SAGA 2YHYA 3FE1A 1Z05A 1NLVA 2A40A 3M5RA 2Q31A 4KH5A 3R6MA 3TTCA 3EKSA 3FZMA 3OHRA 2VCPA 4FSVA 3WXLA 4PKHA 5HL7L 3L4IA 3W3DA 2GUPA 3QFUA 1K8KB 3H1QA 2NZTA 3CJ9A 4CZGA 1JCGA 3SAHA 4QS8A 1QZ6A 3CCSN 1YF5L 3O8MA 1TYQA 1O13A 5FPDA 5C12A 2QW9A 3D2EB 3KWGA 2JWLA 4JEPA 4DQ8A 5AFUA 3HRGA 3LDOA 2YI1A 5BRHA 1YJNN 1NGDA 3WT0A 3MCPA 2A42A 3MN6A 2Q36A 2NRZA 5B8HA 1WOQA 2GEMA 3SAFA 3VGLA 4JKCA 1OVYA 2IIRA 2E2NA 4BQLA 3FZKA 3CERA 1TYQB 3A5NC 4QS9A 2V7ZA 2ASMA 2UYTA 4GNIA 5AQQA 5ADXA 5CHIA 4UY8O 1ILYA 3VPZA 2AP1A 2IVNA 2A3ZA 5EVZA 2V7YA 4L3QA 1IJJA 3SMSA 5GAHP 4IEEA 4R79A 1VQKN 4H0VB 1NGIA 1T6CA 2QTDA 2RHKA 4OPHA 4BC4A 3QB0A 3VOVA 2E1YA 5ELZA 2HOEA 3CJ1A 4O8KA 3QDKA 4IO9L 1GLLO 2WFBA 4CZKA 4WQ4C 3FLCO 4F9OA 1JJ2M 1NGAA 2E2OA 2GX9A 4A2BA 1KC8O 4MLHA 1QZ5A 3VEXA 2FSKA 3ID6A 4EHUA 5GADP 1SZ2A 1NGGA 2CGKA 4NO7A 1NM1A 3D2FB 3TTDA 3O9QA 1VQPN 3CC4N 1C0FA 3MMVA 3VGMA 4JKEA 2F9TA 5AQWA 4B1YB 3GBTA 4B9QA 3N4QA 3E9LA 4CZIA 1P90A 1YXQA 3I56N 1W2BM 5EY4A 2BUPA 2DPNA 4O5FA 4BRAA 4KH6A 1LCUA 1VAZA 3L0QA 4BRNA 5AQTA 2IVOA 1NGCA 5CR4A 3KHYA 1YJWN 1VQON 4AF1A 3ID8A 4XH1A 3T69A 1TUUA 3I8BA 3U4LA 5BPMA 1NMDA 1VQ6N 2V52B 1BWFO 5M1FA 2ZGYA 5AZIA 2NLXA 4H5NA 2VWBA 5AQSA 1YUWA 1RFQA 4HTLA 3SBTA 3H3OB 2ZJPL 5M1QA 4K41A 5F2RA 5KPTA 2J4RA 3VENA 4BRIA 3LM2A 1BA0A 3UKUA 4PKGA 4CJ7A 2KLAA 5C15A 5JICA 5GIOA 1YI2N 3CC2N 1TUYA 1K9MO 1NWKA 3CJBA 3VEYA 3RVCA 2VGNA 4FWRA 4H5TA 5F0XA 1DEJA 5C2FA 5AZIB 4JKDA 4CBXA 1VQ8N 2OTLN 1BO5O 3CCVN 1P8ZA 1K8AO 4CZFA 1G99A 3OA9A 5AQKA 5KQDA 4M7YA 1KAXA 1RDWX 3HI0A 4WFAL 2RE2A 5KPRA 1DGKN 3C65A 2QI2A 3FGUA 4BRPA 2I7PA 1HLUA 3DXKA 1HKCA 4IXCA 1YITN 3LL3A 5AQPA 5CE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BVO A;  3SMP A;  4CBU A;  1GLF O;  1QQN A;  4FWK A;  4PL8 A;  3VER A;  3EZW A;  3GL1 A;  4CZL A;  1Q18 A;  3VES A;  2FSN A;  3WXJ A;  4JHD A;  5EOY A;  1C0G A;  2HMP A;  4NB4 A;  3DXK B;  2AA4 A;  3O1W A;  4A2A A;  5LJW A;  1NGB A;  3DXM A;  3FZL A;  2A5X A;  4PKI A;  4MLE A;  3G25 A;  3MN7 A;  5FPM A;  2F9W A;  1U6Z A;  1HX1 A;  3U8X A;  4H5V A;  3O5B A;  1ZBS A;  1E4F T;  1H1V A;  3CIP A;  4JHD B;  1V4T A;  2E2P A;  3ATU A;  2QXL A;  5E84 A;  4CZM A;  5KPZ A;  1U2V A;  2QWL A;  3P4I A;  3BEX A;  1YAG A;  3GDQ A;  4FWM A;  3M6G A;  4FPB A;  3DXM B;  3HBT A;  4I6M A;  4H0T B;  4CD3 A;  4LC9 B;  3QIC A;  4B1W B;  4CZJ A;  3HTV A;  1T44 A;  1D4X A;  2QWR A;  3SJH A;  1GLD G;  3UE5 A;  4H5W A;  4BC2 A;  1ATN A;  1HKB A;  3VF6 A;  1U2V B;  3BF1 A;  3CI5 A;  2FF6 A;  4BRF A;  3ATV A;  3J8A A;  5AQN A;  3FZF A;  2ZWH A;  1X3M A;  4K43 A;  4I6M B;  4FWS A;  5F1X A;  3MN5 A;  4EIA A;  3R8E A;  1E4G T;  4BRH A;  3B8A X;  3HSC A;  4H0Y B;  3W0L A;  4K42 A;  5JMV A;  2E8A A;  2EWS A;  3VF2 A;  3WQU A;  3ZEU A;  3S41 A;  3SLC A;  3VEV A;  4RTF D;  3QBW A;  1YVN A;  3CJ7 A;  2KHO A;  5AQU A;  5AQX A;  5BN8 A;  5TKY A;  2FLO A;  3MDQ A;  5EX5 A;  4B1U B;  4A61 A;  2Q0U A;  4JD2 A;  1KAY A;  3ZEU B;  4WQ5 C;  1DKG D;  2QWN A;  4XEI A;  4H0O A;  4BRM A;  2H3G X;  2D4W A;  1KAZ A;  2P9L A;  2QWM A;  4JN4 A;  5AQV A;  5FPN A;  4BRE A;  1GLA G;  4BVP A;  1HJO A;  3CHW A;  4CZH A;  1BA1 A;  2VYP A;  2V51 B;  2P9U A;  3RSE A;  2Q2R A;  1XC3 A;  2ZF5 O;  3EO3 A;  4JD2 B;  2QWP A;  3HZ6 A;  1KXP A;  3JXU A;  5AQZ A;  3FFK B;  4J8F A;  5EXW A;  4A62 A;  1Y64 A;  4EHT A;  2P9L B;  4EFH A;  3A5O C;  4FO0 A;  3KZB A;  4BG9 A;  3RSE B;  3D7E O;  3M3Z A;  4GY2 B;  4JNE A;  4BRC A;  5AQO A;  2GWJ A;  5AQI A;  4IZ9 A;  2FSJ A;  4FWN A;  4CBW A;  3IMX A;  3O08 A;  2QWQ A;  3LDL A;  4H0P A;  4YDU A;  1XQS C;  2YCH A;  4XH4 A;  3CET A;  1HKG A;  5BN9 A;  3UKU B;  1QQM A;  3UKR A;  1SQK A;  2W41 A;  3EKU A;  2FF3 B;  4BRQ A;  5E26 A;  1BOT O;  4IWV A;  5BPL A;  3DAW A;  1BUP A;  2E2Q A;  5JLF A;  2ZGZ A;  1NGH A;  3GOI A;  4WYB A;  1NGF A;  3EN9 A;  2D1K A;  4BR7 A;  3GE1 A;  5BRE A;  4BR5 A;  4B1X B;  2ASO A;  4ISF A;  4C23 A;  3AAQ A;  4M63 C;  4IJA A;  5AQR A;  4BGB A;  3TPQ A;  4KBO A;  2Q97 A;  3A5L C;  4EAH D;  3UKR B;  4BRO A;  4PL7 A;  3BUZ B;  5AQY A;  2HF3 A;  2NRH A;  2E88 A;  4AM7 A;  4BR0 A;  4BC5 A;  4FWP A;  3H1V X;  4BRK A;  3C0B A;  3SK3 A;  4BQZ A;  4BRG A;  4BRL A;  3ZX0 A;  2P9N A;  2QWO A;  3KVG A;  4BG8 A;  5AR0 A;  2YHW A;  3WQT A;  2ASP A;  4FPA A;  2E20 A;  3BP8 A;  3D2E A;  1GLJ O;  3F9M A;  3ZET A;  4BR2 A;  3H45 C;  4CD1 A;  1R59 O;  2CH6 A;  2D0O A;  2Q0R A;  3O80 A;  3AY9 A;  5I9E B;  2P9N B;  1WUA A;  2PAV A;  3A5M C;  4IJN A;  2YJF A;  2PBD A;  3TU5 A;  2CGJ A;  3LDN A;  3MN9 A;  3AAR A;  4AM6 A;  4BRD A;  5AQL A;  4DB3 A;  4B1V A;  4H0X B;  5AQF A;  3L6Q A;  4Z94 A;  1MWM A;  5AZJ A;  1MA9 B;  3CQX A;  3IUC A;  3QBX A;  3O1B A;  3ZET B;  4ISE A;  1BU6 O;  5AFU H;  2E1Z A;  5AQM A;  2P9K A;  5BR9 A;  1EQY A;  2ITM A;  2WUS A;  3CQY A;  1BG3 A;  3DJC A;  4FOE A;  5AQJ A;  1S3X A;  3HM8 A;  1NBW A;  1Z6R A;  5AZJ B;  3QML A;  5LY3 A;  5ADX H;  2CGL A;  1X3N A;  2YJE A;  1ESV A;  4H03 B;  4Y0W A;  4DCH A;  3CJC A;  1HPM A;  2GTD A;  2HF4 A;  1X9J A;  1MWK A;  2P9K B;  3O6W A;  4ISG A;  3VEO A;  3D2F A;  1OKJ A;  5FPE A;  3WUH A;  4FWQ A;  3ENO A;  2FXU A;  3BF3 A;  3C7N A;  2P9S A;  5AQH A;  4BR4 A;  1NGE A;  1ATR A;  3WXI A;  3U9D A;  1QQO A;  1RGI A;  4RWT A;  4IO8 A;  3I33 A;  2P9P A;  2Q1N A;  2A6A A;  3VGK A;  2CH5 A;  4MO4 A;  4CZE A;  1MDU B;  5BPN A;  3QFP A;  3IDH A;  4DHY A;  5LJV A;  1SAZ A;  1XUP O;  3LM9 A;  3IFR A;  1BDG A;  4BGA A;  3R9P A;  3C7N B;  2P9S B;  3JS6 A;  4WQ4 A;  2I7N A;  4YDU C;  5AQG A;  3VEZ A;  2P9P B;  3ZX3 A;  3WEE A;  5BRF A;  4JAX A;  3VF4 A;  2P9U B;  1JCF A;  2BTF A;  4H5R A;  1LOT B;  3EL2 A;  4E1J A;  3H46 O;  1IG8 A;  2D0P A;  3AAP A;  3WXK A;  4WQ5 A;  1ZC6 A;  1S22 A;  1J6Z A;  1NGJ A;  3M1F A;  1T6D A;  3U9Z A;  3WEE B;  3FZH A;  1GLB G;  3A0I X;  3LDQ A;  3ENH A;  2P9I A;  4MO5 A;  4FOI A;  3LDP A;  2IVP A;  2A41 A;  2YHX A;  3UB5 A;  4BC3 A;  3H3N O;  3H6E A;  4CI6 A;  1JCE A;  2QM1 A;  4FWO A;  3FR0 A;  4K25 A;  3ZX2 A;  2W40 A;  4M7X A;  1GLC G;  4FL9 A;  2GEL A;  5JLH A;  3CJA A;  1ATS A;  5KQ8 A;  2P9I B;  3VEW A;  4QS7 A;  3ULE A;  3VET A;  4RCH A;  3DWL A;  3GG4 A;  1GLE G;  4FWL A;  1K8K A;  1V4S A;  3O4W A;  3A8Y A;  1ZXO A;  4BR9 A;  1CZA N;  4HWI A;  2OAN A;  2GWK A;  1HUX A;  4XH5 A;  3MK6 A;  1QHA A;  3ULE B;  4B1Z A;  5BRD A;  2YHY A;  3FE1 A;  1Z05 A;  1NLV A;  2A40 A;  2Q31 A;  3R6M A;  3EKS A;  3FZM A;  3OHR A;  2VCP A;  4FSV A;  3WXL A;  4PKH A;  3L4I A;  3W3D A;  2GUP A;  3QFU A;  1K8K B;  3H1Q A;  2NZT A;  3CJ9 A;  4CZG A;  1JCG A;  4QS8 A;  1QZ6 A;  3O8M A;  1TYQ A;  5FPD A;  2QW9 A;  3D2E B;  4DQ8 A;  5AFU A;  3LDO A;  2YI1 A;  5BRH A;  1NGD A;  3WT0 A;  3MCP A;  2A42 A;  3MN6 A;  2Q36 A;  5B8H A;  1WOQ A;  2GEM A;  3VGL A;  2IIR A;  2E2N A;  4BQL A;  3FZK A;  3CER A;  1TYQ B;  3A5N C;  4QS9 A;  2V7Z A;  2ASM A;  2UYT A;  4GNI A;  5AQQ A;  5ADX A;  3VPZ A;  2AP1 A;  2IVN A;  2A3Z A;  5EVZ A;  2V7Y A;  4L3Q A;  1IJJ A;  3SMS A;  4H0V B;  1NGI A;  1T6C A;  4BC4 A;  3QB0 A;  3VOV A;  2E1Y A;  5ELZ A;  2HOE A;  3CJ1 A;  4O8K A;  3QDK A;  1GLL O;  4CZK A;  4WQ4 C;  3FLC O;  4F9O A;  1NGA A;  2E2O A;  4A2B A;  4MLH A;  1QZ5 A;  3VEX A;  2FSK A;  4EHU A;  1SZ2 A;  1NGG A;  2CGK A;  4NO7 A;  1NM1 A;  3D2F B;  1C0F A;  3MMV A;  3VGM A;  2F9T A;  5AQW A;  4B1Y B;  3GBT A;  4B9Q A;  4CZI A;  1YXQ A;  5EY4 A;  2BUP A;  2DPN A;  4O5F A;  4BRA A;  1LCU A;  3L0Q A;  4BRN A;  5AQT A;  2IVO A;  1NGC A;  3KHY A;  3ID8 A;  4XH1 A;  1TUU A;  3I8B A;  3U4L A;  5BPM A;  1NMD A;  2V52 B;  1BWF O;  2ZGY A;  5AZI A;  2NLX A;  4H5N A;  2VWB A;  5AQS A;  1YUW A;  1RFQ A;  4HTL A;  3H3O B;  4K41 A;  5F2R A;  5KPT A;  2J4R A;  3VEN A;  4BRI A;  3LM2 A;  1BA0 A;  3UKU A;  4PKG A;  4CJ7 A;  5JIC A;  1TUY A;  1NWK A;  3CJB A;  3VEY A;  4FWR A;  4H5T A;  5F0X A;  1DEJ A;  5AZI B;  4CBX A;  1BO5 O;  1P8Z A;  4CZF A;  1G99 A;  5AQK A;  5KQD A;  4M7Y A;  1KAX A;  1RDW X;  3HI0 A;  5KPR A;  1DGK N;  3FGU A;  4BRP A;  3DXK A;  1HLU A;  2I7P A;  1HKC A;  4IXC A;  3LL3 A;  5AQP A;  5CE3 A; 
#chains in the Genus database with same CATH topology
 2Q3S A;  3LDS A;  3CXC M;  4LFA K;  3OYH A;  3K0S A;  1QQN A;  1FXX A;  3TSP A;  3VER A;  4M42 A;  3VQB A;  1Q18 A;  1KVB A;  3WXJ A;  1TL1 A;  3L2U A;  4NB4 A;  2HMP A;  3TAN A;  3OS0 A;  3FZL A;  3KLH A;  3D45 A;  3KJV A;  1L3U A;  1C1C A;  3O5B A;  1JLB A;  1EP4 A;  5SWM A;  4KRE A;  3SJJ A;  4O0I A;  4OPA A;  2O8F A;  4IFY A;  2QWL A;  3OS2 A;  4C1N I;  3P4I A;  1CXQ A;  2KZZ A;  4FJH A;  3TSU A;  4WFN L;  3M6G A;  5KI6 A;  4TSX A;  3HVR A;  4HVJ A;  5GAG P;  4H0T B;  1S72 N;  3OYM A;  1YVU A;  4CZJ A;  1LV5 A;  3NF6 A;  1HKB A;  4E7H A;  3VF6 A;  1SUQ A;  3NF7 A;  3ATV A;  3V1Q A;  1D8Y A;  3ISN C;  5FDL A;  3FZF A;  4K43 A;  1X3M A;  1RBU A;  4FWS A;  4EIA A;  3AVB A;  4CED A;  4BRH A;  3B8A X;  4H0Y B;  3W0L A;  1Q8I A;  2EWS A;  5M1K A;  2ETJ A;  4AHS A;  1BCM A;  3QBW A;  3KIO A;  1NNE A;  5TKY A;  5EX5 A;  2A1R A;  3ZLJ A;  1HNX K;  1RTD A;  4DFM A;  2B5J A;  3AA2 A;  1OH5 A;  4O8U A;  4XEI A;  4W5N A;  3F73 A;  2H3G X;  1KAZ A;  2HHU A;  2QWM A;  4JN4 A;  3KLF A;  3THX A;  2KFZ A;  1DTT A;  4BVP A;  3CHW A;  1K73 O;  2VYP A;  3AGR A;  4RW8 A;  1XC3 A;  3O4Q A;  1VSJ A;  3E1Y A;  3KWI A;  1KXP A;  1BL3 A;  4FJN A;  3TAG A;  1MU2 A;  4J8F A;  5EXW A;  4IDK A;  4CES A;  2BE2 A;  1QE1 A;  4YOX A;  1U04 A;  3THX B;  3T1Y K;  3KZB A;  3ITH A;  4ZTJ A;  4DKW A;  1QQC A;  2NUB A;  3I0S A;  4BG9 A;  4CJF A;  3P38 A;  1IG9 A;  3D7E O;  3VQD A;  5AQO A;  1X9S A;  1W97 L;  4FM2 A;  4IOA L;  4CBW A;  2QWQ A;  4EZ9 A;  4FJ7 A;  3C6A A;  3HVT A;  5BN9 A;  3OYJ A;  4FCY A;  3J7Y P;  4FLT A;  3OJS A;  5BPL A;  3JYT A;  3PX4 A;  1BUP A;  3DM2 A;  3R1X A;  3ZSX A;  4YNQ A;  3NH2 A;  4FJI A;  1NGH A;  3UIQ A;  2VG7 A;  3HL8 A;  3AA4 A;  1L3V A;  2ASO A;  4C23 A;  4Z4C A;  3TAQ A;  3OYI A;  4N47 A;  4Z4E A;  1LW2 A;  1Q9Y A;  2HBL A;  1R0A A;  1J54 A;  3VA0 A;  4FWP A;  2RPI A;  4CF8 A;  4E1M A;  1SL2 A;  4ELV A;  3SK3 A;  1RNH A;  1IKV A;  1WSE A;  3PX6 A;  3DMJ A;  2QWO A;  3LZI A;  3KVG A;  3KK2 A;  4WF9 L;  3WQT A;  2ASP A;  2O8D A;  2YHB A;  4FPA A;  1RTJ A;  1OH6 A;  4BR2 A;  3L8B A;  4CD1 A;  4NXN K;  3A2F A;  1TAQ A;  2F8T A;  2UXC K;  2X74 A;  4CJQ A;  4B3S K;  2KKZ A;  4B1V A;  3QIN A;  2DFH A;  2O8D B;  5AQF A;  4KI4 A;  1JXB A;  1DLO A;  4B9U A;  1N5Y A;  1X1P A;  5JVH L;  4IG3 A;  3MEC A;  3T7Z A;  3VQ6 A;  4DTJ A;  4PA1 A;  3WXM B;  1NOY A;  5AFU H;  4I2Q A;  2P9K A;  2ITM A;  3C6U A;  3CQY A;  1ZBL A;  4FK0 A;  4CJ3 A;  4JI1 K;  3ZSW A;  1J53 A;  1VQL N;  4RW7 A;  4ZHR A;  3NCI A;  4CEC A;  1X3N A;  4H03 B;  1C0M A;  4ID1 A;  1S9E A;  1L3T A;  2FBT A;  2HF4 A;  1X9J A;  1MWK A;  2P9K B;  3MWT A;  4CIF A;  3L4Q A;  3VEO A;  3RR7 A;  4ID5 A;  3J7Z O;  3ENO A;  1RDA A;  4NYN A;  4QAG A;  4HHT A;  2UUC K;  4ELU A;  3BF3 A;  4CGG A;  4O44 A;  3T3F A;  3I33 A;  3QES A;  4DTR A;  1JXE A;  2ITG A;  2R7Y A;  1ZBH A;  5BPN A;  1U49 A;  3IDH A;  4DHY A;  5LJV A;  1SAZ A;  3IFR A;  3R9P A;  4E7K A;  3E9O A;  5GAE P;  4CF9 A;  4DU1 A;  1TAU A;  4FYD A;  4C8M A;  4N5S A;  1NOZ A;  4KTZ A;  3PIO L;  5GIN A;  2JGU A;  2D0B A;  5IT9 O;  2HHS A;  1CZ9 A;  4FZX C;  3EL2 A;  4E1J A;  4DWI A;  2D0P A;  2HND A;  4LF8 K;  4WQ5 A;  1S22 A;  4AHU A;  3LAN A;  4CJR A;  3DOL A;  4MO5 A;  2IVP A;  4KB1 A;  4X66 K;  1BIS A;  3TAR A;  3Q7B A;  4WE1 A;  4I9Q A;  3MCA B;  4YOT A;  1YTA A;  3ZX2 A;  4CIG A;  5JLH A;  1ATS A;  3CJA A;  3VEW A;  4Z4I A;  1BIU A;  4A57 A;  3TR8 A;  1I94 K;  4GKJ K;  2OTJ N;  4CJW A;  3G6E N;  1NJW A;  2WON A;  4IBN A;  1Q81 O;  1GLE G;  4FWL A;  2QEX N;  1ZXO A;  4HWI A;  3L2V A;  3MK6 A;  4B1Z A;  3AA5 X;  3VQP A;  1QSS A;  2Q31 A;  3CM6 A;  3EKS A;  1TVR A;  3OYC A;  5HL7 L;  4KHQ A;  3L4I A;  5E41 A;  3H1Q A;  3AO3 A;  3QNN A;  1JCG A;  1YF5 L;  3LAM A;  1O13 A;  5FPD A;  3ASM A;  3OJU A;  5AFU A;  1C1B A;  2YI1 A;  1GOA A;  1JLQ A;  3HXM A;  5I3U A;  2BAN A;  2HVI A;  1WOQ A;  3SAF A;  3VGL A;  3T19 A;  1OVY A;  3S3M A;  1O1W A;  4QS9 A;  2ASM A;  5AQQ A;  4FM1 A;  3J81 O;  4DG1 A;  4Q0B A;  4DV4 K;  4L3Q A;  4FK4 A;  4R79 A;  1RT4 A;  1XWL A;  3QB0 A;  2ZE2 A;  1VSM A;  1C1A A;  4AH9 A;  2HOE A;  4C8L A;  1E3M A;  1WAF A;  3OS1 A;  3FLC O;  4YY3 K;  4LF5 K;  4FJK A;  2E2O A;  5FRN A;  5FRM A;  1QZ5 A;  4KHS A;  1FJG K;  4FLV A;  4KTW A;  4KV8 A;  4DR2 K;  3ZT2 A;  1KFD A;  3K5N A;  4E0D A;  3D2F B;  3O9Q A;  1C0F A;  3VGM A;  1RBV A;  3N4Q A;  3VQC A;  4CZI A;  1YXQ A;  1W2B M;  5C25 A;  1VSF A;  4BRA A;  3DLR A;  2XY8 A;  3ZT0 A;  4CE9 A;  1ITG A;  4KH6 A;  4B8C A;  2IVO A;  3KHY A;  4K8X A;  1NK0 A;  1EX4 A;  2XHB A;  3LAL A;  1WAJ A;  3I8B A;  3U4L A;  1VQ6 N;  2B6A A;  2V52 B;  3DRR A;  5M1F A;  2WOM A;  2ZGY A;  1T8E A;  4PY5 A;  3OTO K;  3NGY A;  4JI0 K;  5KPT A;  2HW3 A;  3MXJ A;  1HNW K;  4AHV A;  5JIC A;  2KLA A;  3THY A;  5J2P A;  4LF6 K;  4NYF A;  5F0X A;  3RMB A;  1P8Z A;  4CGJ A;  5CY4 A;  1G99 A;  3OA9 A;  4Z0U A;  2OYQ A;  4DV5 K;  3HI0 A;  4WFA L;  3TAB A;  2YNF A;  3AVA A;  3OYD A;  3THY B;  4CJ5 A;  3FGU A;  4BRP A;  2EX3 A;  4IXC A;  4Y1D A;  1HPZ A;  4CJV A;  4JKB A;  4BVO A;  2ZQB A;  4FWK A;  2YHA A;  3QET A;  3LWM A;  4FJ9 A;  3GL1 A;  3O9S A;  3CCE N;  4N76 A;  3O1W A;  2UUB K;  3OY9 A;  3IG1 A;  4DTM A;  1KD1 O;  3MX5 A;  4CEO A;  1HX1 A;  4RG8 A;  4H5V A;  1RT6 A;  1HMV A;  1E4F T;  3LP3 A;  3CIP A;  4FJM A;  1V4T A;  2E2P A;  4CZM A;  2QXL A;  3L2Q A;  1U48 A;  4LSL A;  3BEX A;  3HYF A;  3HBT A;  1BQM A;  2PYL A;  3KKR A;  3HTV A;  3AVI A;  4M3T A;  1T44 A;  1D4X A;  3SJH A;  4GV9 A;  1ATN A;  5HRP A;  4E7L A;  1T7P A;  3K5O A;  4KHW A;  1ASU A;  2E4L A;  4BRF A;  2HHW A;  3CG7 A;  4OVL A;  3C95 A;  5F1X A;  3MN5 A;  3F2K A;  3R8E A;  4LH4 A;  1A5X A;  3M8P A;  1QVG M;  2BGG A;  4K42 A;  2E8A A;  3WQU A;  1RTI A;  1I3A A;  2HMI A;  3VEV A;  3S9H A;  3MXM A;  2KQ2 A;  5AQX A;  4M3U A;  1W7A A;  2FLO A;  3MDQ A;  3DRP A;  4CF2 A;  5MLC Q;  4V19 S;  2OPP A;  3TTF A;  3QEV A;  3SI6 A;  4KHU A;  4CEE A;  4PQU A;  3AO2 A;  1DKG D;  3SZ2 A;  4BRM A;  3QLH A;  2D4W A;  1RBR A;  5FPN A;  1GLA G;  1HJO A;  2YNI A;  3HP6 A;  2NRT A;  4CEA A;  4DTN A;  4PUO A;  1KLM A;  4CZH A;  3HM9 A;  2P9U A;  3RSE A;  4DLE A;  2QWP A;  4CJT A;  1Q9X A;  2G8U A;  3FFK B;  4A62 A;  4CK3 A;  3CCJ N;  4IOC L;  4B3T K;  3A5O C;  4CGF A;  4JYA K;  1BIZ A;  4FO0 A;  3VQA A;  3AGK A;  4OJR A;  4DR7 K;  1LW0 A;  4G9Z A;  3RSE B;  4OLB A;  3M3Z A;  4JNE A;  1RT7 A;  3K9K A;  4BRC A;  2P51 A;  2GWJ A;  4IZ9 A;  3HST B;  1TKT A;  3BZK A;  4H0P A;  1U45 A;  1HQE A;  1XQS C;  4XH4 A;  1L5U A;  3L2W A;  1Q7Y O;  2E6M A;  4Y1C A;  4HCC A;  3UKU B;  1QQM A;  3UKR A;  3EKU A;  2PFU A;  2OZS A;  2FF3 B;  4BRQ A;  1J5O A;  4IWV A;  3KTQ A;  4YOU A;  3TSQ A;  3S3N A;  1WSH A;  3C6H A;  2NRR A;  2QKB A;  2D1K A;  5GIP A;  3O3F A;  4BR5 A;  4B1X B;  4M63 C;  5AQR A;  4KBO A;  2Q97 A;  3UKR B;  4PL7 A;  1NKB A;  3BUZ B;  3MX2 A;  2E88 A;  4AM7 A;  3G10 A;  2Z1H A;  4OGE A;  1EWQ A;  3V1O A;  3C0B A;  3T1H K;  1SL1 A;  3S3O A;  4ILJ A;  4BRG A;  2OCE A;  3ZCM A;  3SQ4 A;  1T3V A;  4NLC A;  4J2A A;  3SUP A;  5AR0 A;  4QOZ B;  4YOV A;  2OA8 A;  1RT1 A;  4C1N K;  2E20 A;  3MED A;  3DLE A;  3F9M A;  4DR6 K;  3VTI A;  1EWR A;  4B9N A;  4L8R B;  2ZJR L;  2F96 A;  3O9U A;  1VSD A;  2F7T A;  2Q0R A;  3LP0 A;  3Q7C A;  2UU9 K;  3AY9 A;  4CF1 A;  5I9E B;  1HNI A;  1WUA A;  4IJN A;  3MEG A;  4JS4 A;  4DB3 A;  1J5E K;  2O8F B;  4H0X B;  3V9Z A;  1S5J A;  4Z94 A;  3CQX A;  4YFU A;  4CFC A;  3QBX A;  5HRN A;  5D3G A;  1VSL A;  4DMN A;  4C8K A;  4HUE A;  1WNS A;  1S9G A;  1EQY A;  4YHH K;  3DJC A;  1BG3 A;  4FOE A;  1TL3 A;  4EP5 A;  4OKK A;  4FVM A;  3QML A;  1XI1 A;  2CGL A;  1XMQ K;  4FZZ A;  4Y0W A;  1VQM N;  4CJP A;  3O6W A;  5HRO A;  2O4G A;  4A5B A;  1BCO A;  4JRP A;  3SBG A;  1UA1 A;  4LFB K;  1U47 A;  4WFB L;  4BR4 A;  1NGE A;  3LP2 A;  3WXI A;  1QQO A;  2E6L A;  4IO8 A;  3ULD A;  2IOC A;  2Q1N A;  2A6A A;  3VGK A;  2CH5 A;  4MO4 A;  4DQS A;  3QFP A;  1OH7 A;  1WN7 A;  4IFV A;  1NJX A;  4BGA A;  4WQ4 A;  2HHQ A;  1IV0 A;  1JLA A;  1Q86 O;  3ZX3 A;  3NMU A;  1SV5 A;  4B9T A;  5BRF A;  2UXB K;  4FW1 A;  2XRI A;  1LOT B;  3P5J A;  1JKH A;  2FC0 A;  3AVG A;  1NK8 A;  3M1F A;  1T6D A;  3ZYY X;  2OPS A;  3FZH A;  1GLB G;  3A0I X;  3AVC A;  3O9R A;  3SUN A;  4DF8 A;  1ZBI A;  3CM5 A;  1HNZ K;  1VK0 A;  4CI6 A;  3C6T A;  3K5M A;  4F4K A;  4KHP K;  3SYZ A;  1HNV A;  3PLA A;  1GLC G;  4FL9 A;  5KQ8 A;  4DTO A;  1CXU A;  1LAV A;  4RCH A;  3HPG A;  1RDC A;  4N56 A;  1KRP A;  3DOK A;  2UUA K;  3E01 A;  3NBP A;  5CYQ A;  3A8Y A;  3QER A;  1C6V A;  4GVE A;  1HUX A;  1CZB A;  4XH5 A;  3SAG A;  1VHX A;  3M5R A;  2A40 A;  4OLA A;  4CGH A;  4HUG A;  3FZM A;  2VCP A;  4FSV A;  3WXL A;  4PKH A;  4DUY K;  2GUP A;  3QFU A;  4CJE A;  4CZG A;  4DV3 K;  3AV9 A;  3BY5 A;  1QZ6 A;  4CFB A;  4CHP A;  2UXD K;  3M8S A;  5C12 A;  2QW9 A;  4XIU A;  4JEP A;  4DQ8 A;  3HRG A;  2RN2 A;  3B6P A;  2Z1J A;  3ZT1 A;  3VQ7 A;  1NK9 A;  1JLF A;  2HNZ A;  3MN6 A;  3OYA A;  3AVL A;  3SPY A;  3OYN A;  3K59 A;  2IIR A;  2E2N A;  3CER A;  1S1U A;  3NFA A;  4GNI A;  4UY8 O;  4JV5 K;  4E3S A;  4MFB A;  1JLC A;  2V7Y A;  3SMS A;  3B6O A;  4H0V B;  4K8Z A;  1T6C A;  2RHK A;  5KRT A;  4Z4F A;  3BDP A;  4OPH A;  4BC4 A;  3VOV A;  5ELZ A;  3SQ1 A;  3QDK A;  2F4V K;  1S1T A;  5J2N A;  5K14 A;  2VG6 A;  1N34 K;  4AHR A;  2I5J A;  3ZSO A;  2CGK A;  4CEB A;  5GAD P;  2WTU A;  3THV A;  4DSL A;  3AVF A;  3ZSV A;  3CC4 N;  4JKE A;  1F21 A;  2IAJ A;  5AQW A;  4B9Q A;  3QEP A;  1NKE A;  3IRX A;  1JL1 A;  3E9L A;  4CJS A;  5LMN K;  1QTM A;  1P90 A;  4CGI A;  2BUP A;  2DPN A;  3L0Q A;  4BRN A;  3OYF A;  2KZM A;  5CR4 A;  1YJW N;  4AF1 A;  1HJR A;  3ID8 A;  5HRS A;  4IKF A;  4DQI A;  1SKW A;  4I7F A;  4DF4 A;  3HT3 A;  1BQN A;  5I42 A;  1ASW A;  4FLY A;  5AQS A;  3SBT A;  3H3O B;  2PYJ A;  5F2R A;  3VEN A;  5C15 A;  4PKG A;  4LH5 A;  1TUY A;  1IBK K;  2HHV A;  3IS9 A;  3VQ5 A;  2B4J A;  3O3G A;  4FWR A;  4F3T A;  5C2F A;  4C8O A;  4CBX A;  1NK4 A;  1RBS A;  1XMO K;  2YNG A;  1KAX A;  2PZS A;  1KVC A;  1YTU A;  1DGK N;  1EET A;  2ZD1 A;  4DR1 K;  2I7P A;  3DXK A;  1HKC A;  2YKM A;  3SMP A;  1GOC A;  4MDA A;  3DYA A;  4CBU A;  3KD5 E;  4H4M A;  4GKK K;  1N36 K;  4PL8 A;  3EZW A;  4FLZ A;  4GV3 A;  4CZL A;  1TV6 A;  3VES A;  2FSN A;  4JHD A;  2O8E A;  5EOY A;  1C0G A;  3CFO A;  3DXK B;  2AA4 A;  4A2A A;  1RDB A;  4J2E A;  4MLE A;  3G25 A;  3MN7 A;  5A2Q O;  3EE9 A;  2F9W A;  1NJI O;  3SCX A;  1IKY A;  1U6Z A;  4HCB A;  1WSG A;  1H1V A;  1TK5 A;  1DT9 A;  4JHD B;  4KTQ A;  3ATU A;  5E84 A;  2O8E B;  5KPZ A;  1U2V A;  2DTU A;  4FWM A;  3NAE A;  3RMC A;  4I6M A;  1NK5 A;  4DFP A;  5AJ3 K;  4JKF A;  3UE5 A;  4H5W A;  4BC2 A;  4DQR A;  1N6Q A;  1U2V B;  3BF1 A;  3OYK A;  1RT2 A;  3J8A A;  1QHT A;  5AQN A;  4KPY A;  1YJ9 N;  4I6M B;  1A5V A;  1CLQ A;  2YNH A;  1E4G T;  4KB0 A;  1RDU A;  3HSC A;  4X64 K;  5JMV A;  3SV3 A;  5HP1 A;  3VF2 A;  1WSI A;  1EXQ A;  3ZEU A;  3S41 A;  3SLC A;  4JI6 K;  1NK7 A;  1WB9 A;  2NRW A;  5DK5 A;  3CFR A;  1SL0 A;  4B9V A;  4RTF D;  1VQ9 N;  4B3R K;  2QA4 N;  3SQ2 A;  3CJ7 A;  2KHO A;  3VMF B;  2VGM A;  4CHY A;  1W9H A;  4M41 A;  4FLX A;  4K0K K;  2A1S A;  1TK0 A;  2P5O A;  4U67 L;  3IAY A;  2Q0U A;  1WSF A;  1LWE A;  3ZEU B;  2HHH K;  4FVU A;  2QWN A;  4CEF A;  2W42 A;  4DV2 K;  4N41 A;  1XNQ K;  1BI4 A;  5AQV A;  4CCH A;  2JLE A;  3MWP A;  4AQY K;  4BDP A;  4W5O A;  3AVJ A;  2RF2 A;  5BR8 K;  4DV1 K;  3HO1 A;  2V51 B;  1ZYQ A;  4FZY A;  2Q2R A;  2HST A;  2ZF5 O;  3K2P A;  3CQ8 A;  3JXU A;  5AQZ A;  4W5R A;  4GVM A;  4DS5 A;  4EHT A;  2QK9 A;  2HBK A;  3JSM A;  1XC9 A;  4FJJ A;  3EEQ A;  1HQU A;  3ALY A;  4B9S A;  4DUZ K;  3EY1 A;  4GY2 B;  3QO9 A;  4AHT A;  3V6D A;  3CCQ N;  3C94 A;  5AQI A;  1RT3 A;  4FWN A;  3OYE A;  1N32 K;  3IMX A;  3O08 A;  4YDU A;  2YCH A;  2Y1J A;  1L3S A;  4OKJ A;  4A59 A;  5E26 A;  1YIJ N;  1RTH A;  2E2Q A;  4E89 A;  5JLF A;  2ZGZ A;  4WYB A;  3GOI A;  1NGF A;  4BR7 A;  3EE8 A;  3LWL A;  1VSK A;  3PY8 A;  4ISF A;  3NGI A;  4KKO A;  2VWK A;  3CD6 N;  1HRH A;  4J2B A;  3AVK A;  4CHZ A;  4BGB A;  5C2D A;  3TPQ A;  3OYB A;  1Q82 O;  3VQ9 A;  4M45 A;  4EAH D;  4BRO A;  5AQY A;  2HF3 A;  2NRH A;  4E7J A;  4BR0 A;  4BC5 A;  1VSE A;  3H1V X;  3T1A A;  4BRK A;  4BE2 A;  4BQZ A;  4PHT X;  4FM0 A;  2XY5 A;  4BY9 C;  4DS4 A;  4BRL A;  4DFJ A;  4ICL A;  2P9N A;  3DLK A;  3CPW M;  3L3V A;  2P1J A;  2OPR A;  4ILG B;  4DU4 A;  3J7A P;  2IC3 A;  4RW4 A;  4E7I A;  2VG5 A;  3BP8 A;  3D2E A;  3O3H A;  4CJK A;  2GBZ A;  3V4I A;  3CCL N;  4RW9 A;  3ZET A;  3I8D A;  1SS6 A;  4ILH A;  4NXM K;  1R59 O;  2HHT A;  2CH6 A;  3K9J A;  1JLG A;  3V81 A;  3O80 A;  5SZT A;  2P9N B;  1HYZ A;  2PAV A;  3A5M C;  3TU5 A;  4KHN A;  2PBD A;  4OPJ A;  2CGJ A;  3LDN A;  3MN9 A;  3AAR A;  5AQL A;  3NH1 A;  1IKW A;  5AZJ A;  1B9F A;  1MA9 B;  3IUC A;  3HK2 A;  1VSH A;  3ZET B;  4ISE A;  4CK2 A;  1IBL K;  3HOT A;  4NCB A;  1UOC A;  2WUS A;  1JLE A;  3OYG A;  4F8R A;  5AQJ A;  1S3X A;  3HM8 A;  2GV9 A;  1VQ4 N;  1Z6R A;  5AZJ B;  5LY3 A;  4KRF A;  5ADX H;  4DU3 A;  3HJF A;  2OPQ A;  4IFE A;  3EZ5 A;  3CJC A;  3G0Z A;  4DV6 K;  1HPM A;  2GTD A;  1RBT A;  3P39 A;  1UA0 A;  1OKJ A;  1OVQ A;  2QXF A;  1HR0 K;  4DSI A;  4FWQ A;  2NNW A;  3CPE A;  2FXU A;  1C0U A;  2HB5 A;  4CJL A;  4M3Z A;  5AQH A;  5T7B A;  3U9D A;  4JS5 A;  3L3U A;  1LWC A;  3JAM O;  2P9P A;  3AVM A;  4CZE A;  1MDU B;  2G8H A;  1XUP O;  5HBM A;  3KLE A;  1BDG A;  4J2D A;  4WCE L;  3JS6 A;  4CK1 A;  3CCM N;  5AQG A;  3VEZ A;  1M1K O;  1W0H A;  2P9P B;  4KO0 A;  4KHY A;  4JI2 K;  4JAX A;  3VF4 A;  2P9U B;  1JCF A;  4BDY A;  4H5R A;  3AO5 A;  4HUF A;  4IG0 A;  1KFS A;  3PSI A;  3H46 O;  4DFK A;  4FJ5 A;  3VQQ A;  2O8C A;  1NGJ A;  4W5T A;  3U9Z A;  3OBW A;  3P1G A;  3FFI A;  4FXD A;  4M3W A;  1WBB A;  4M3X A;  2PY5 A;  2Z1I A;  3LDQ A;  3ENH A;  2P9I A;  3D6R A;  2GUI A;  1U4B A;  3LDP A;  3NVK A;  2A41 A;  2YHX A;  3KK7 A;  3UB5 A;  1JCE A;  4Z4H A;  2D0C A;  2O8C B;  1S6P A;  3FR0 A;  4K25 A;  1KSP A;  2HBJ A;  4M3Y A;  2W6K A;  2GEL A;  1I39 A;  3HPH A;  2P9I B;  4QS7 A;  4LF4 K;  3ULE A;  4JI4 K;  1ZBU A;  4B9M A;  5M1P A;  4GV6 A;  3DWL A;  3KKS A;  3GG4 A;  3F9K A;  1V4S A;  5FLX O;  4JK8 A;  3L2R A;  4NCA A;  4R5P A;  4H4O A;  4BR9 A;  1N33 K;  2OAN A;  2GWK A;  5C10 A;  5BRD A;  3ULE B;  3DLH A;  1J9A A;  2YHY A;  3FE1 A;  4KH5 A;  4JRQ A;  3R6M A;  1D9D A;  1QSY A;  3LPT A;  1S6Q A;  4I9L A;  4OX9 K;  2NZT A;  1YT3 A;  3SAH A;  3NDK A;  3CCS N;  1TYQ A;  3KWG A;  4DTS A;  4FJX A;  1C0T A;  2JWL A;  4AHC A;  3LDO A;  5CZ1 A;  5BRH A;  3QEX A;  3WT0 A;  5IWA K;  3MCP A;  3THW A;  1A5W A;  2G8V A;  3TAM A;  4B3O A;  2Q36 A;  2NRZ A;  3VQE A;  3NH0 A;  4BQL A;  2Y1I A;  3VQ4 A;  3FZK A;  1TYQ B;  5ADX A;  1X9W A;  2OZM A;  3I0R A;  3VPZ A;  1IKX A;  2IVN A;  3WNF A;  1IJJ A;  2G8I A;  3THW B;  1NGI A;  2QTD A;  2X6N A;  4JI7 K;  5CZ2 A;  4CFD A;  2W6L A;  3CJ1 A;  4RW6 A;  4IO9 L;  3SPZ A;  4CZK A;  4WQ4 C;  4F9O A;  2GX9 A;  4A2B A;  4MLH A;  3V1R A;  3VEX A;  4X62 K;  4Z4G A;  1SZ2 A;  4NO7 A;  2VQE K;  3TTD A;  3DLB A;  4BE1 A;  3MMV A;  2O8B A;  4B1Y B;  3GBT A;  1S1V A;  3ZSR A;  3I56 N;  5EY4 A;  3SUQ A;  1ASV A;  4O5F A;  4I2P A;  3U3G A;  1LCU A;  5AQT A;  3K5L A;  3PV8 A;  4XH1 A;  3T69 A;  3HPO A;  1UWB A;  2D5R A;  4NCG A;  2O8B B;  4LSN A;  3PUF A;  1NKC A;  4JI5 K;  1KVA A;  2FBV A;  5AZI A;  1NU0 A;  2NLX A;  1RFQ A;  3J80 O;  1LAW A;  4K41 A;  2E5L K;  2J4R A;  4BRI A;  4CJ7 A;  1BA0 A;  1EO1 A;  2XO7 A;  1YI2 N;  4B08 A;  3VEY A;  3RTV A;  3NF8 A;  3VA3 A;  1DEJ A;  1WBD A;  5AZI B;  1VQ8 N;  1BO5 O;  3CCV N;  2P5G A;  3PSF A;  4GW6 A;  5AQK A;  5KQD A;  4M7Y A;  1NG9 A;  3RMD A;  5KPR A;  1OH8 A;  3TAP A;  1YIT N;  5HOO A;  3G4S N;  4CFA A;  1GLF O;  1S1W A;  4CJ4 A;  1TKZ A;  4LF7 K;  1UAX A;  1N8R O;  4CF0 A;  4CHN A;  4IOX A;  5LJW A;  3RR8 A;  1XNR K;  4DV0 K;  1NGB A;  3CF5 L;  3DXM A;  1NJZ A;  2A5X A;  4PKI A;  1QS4 A;  1B9D A;  4CEQ A;  5FPM A;  1T05 A;  3ZT4 A;  3U8X A;  3M8R A;  3F5T A;  4Q5V A;  1D5A A;  1ZBS A;  2IS3 A;  4O4G A;  3V9U A;  4QCL A;  3MXI A;  5H1S Q;  5J2Q A;  5M1N A;  5LL6 Z;  1YAG A;  3GDQ A;  4FPB A;  3DXM B;  4CD3 A;  1IH7 A;  2EHG A;  1G15 A;  4LC9 B;  5C0Y A;  3QIC A;  4B1W B;  3I55 N;  2IDO A;  3PO4 A;  5C42 A;  2YX6 A;  4CW7 B;  5KGX A;  1VQ7 N;  2QWR A;  1GLD G;  4JKG A;  3R3L A;  4LFC K;  1TK8 A;  4HTU A;  3CI5 A;  2G8W A;  2FF6 A;  1NK6 A;  4DSK A;  5LMU K;  4B8A B;  2ZWH A;  5DM7 L;  3TAE A;  3PO5 A;  3HP9 A;  4O5B A;  4JI8 K;  3KK1 A;  4KH4 A;  4YOY A;  4JKG B;  1ZBF A;  2D0A A;  3QNO A;  4DV7 K;  3AO1 A;  1XHZ A;  3AA3 A;  3OYL A;  1YVN A;  3DRS A;  5AQU A;  2AJQ A;  2DFF A;  3VTH A;  5BN8 A;  4F3O A;  4B1U B;  3WNG A;  4JKA A;  4A61 A;  4JD2 A;  5TKW A;  4CEZ A;  4U7B A;  3G71 N;  1KAY A;  1RIL A;  4WQ5 C;  4H0O A;  3OVN A;  4CIE A;  2P9L A;  4BRE A;  2VQF K;  1BA1 A;  3WNH A;  4JD2 B;  3EO3 A;  4GMJ B;  1TKX A;  3HZ6 A;  1WLJ A;  3TI0 A;  1Y97 A;  1Y64 A;  3ZSZ A;  2P9L B;  4EFH A;  4KFB A;  2G8K A;  1QSL A;  3OW2 M;  2WBN A;  1QVF M;  1T03 A;  2FSJ A;  4JLH A;  2ZJQ L;  4O0J A;  1KCF A;  1VSI A;  3LDL A;  1D9F A;  3CET A;  1HKG A;  1REV A;  2LSN A;  3E66 A;  4IDH A;  1SKR A;  1KQS M;  3ENB A;  1SQK A;  2W41 A;  2ATQ A;  4YOW A;  1BOT O;  3M8Q A;  3DAW A;  4E1N A;  4CVN E;  2XY7 A;  4DQQ A;  4JI3 K;  4FLW A;  3PIP L;  2DY4 A;  3EN9 A;  3GE1 A;  5BRE A;  2HNY A;  4F2S A;  3AAQ A;  5KRS A;  4IJA A;  5EU7 A;  3A5L C;  3CYM A;  3HOS A;  3QEI A;  1BGX T;  3KD1 E;  5CYM A;  3ZX0 A;  3CME N;  2JWK A;  1VRU A;  3NF9 A;  2HBM A;  3O4N A;  4BG8 A;  2YHW A;  5M1O A;  1VRT A;  2YV0 X;  3K57 A;  4B3M K;  4NLB A;  2O4I A;  3P31 A;  3TAF A;  4E19 A;  3NE6 A;  1TKD A;  1GLJ O;  4DTP A;  3H45 C;  4MQ3 A;  2D0O A;  3CC7 N;  2XY6 A;  4OO1 J;  2YJF A;  4AM6 A;  4BRD A;  3ZSQ A;  4BDZ A;  3SUO A;  1KTQ A;  5JS2 A;  4CHQ A;  3MAQ A;  3OBY A;  1HYV A;  2F8S A;  3DLG A;  5JS1 A;  3L6Q A;  1MWM A;  3LAK A;  2X6S A;  1FKO A;  3O1B A;  3CCR N;  1BU6 O;  5KTQ A;  2E1Z A;  3WNE A;  2WC9 A;  5AQM A;  5BR9 A;  1YHQ N;  4FLU A;  4OKE A;  1M90 O;  3NGZ A;  3CFP A;  2NRV A;  5HRR A;  1NBW A;  4JK7 A;  4CJU A;  4BAC A;  1RCH A;  4YOR A;  4DSE A;  4PWD A;  2YJE A;  2NRX A;  1ESV A;  3D0P A;  4DCH A;  4DTX A;  3NHG A;  4ISG A;  3SNN A;  3D2F A;  3O9T A;  1VQ5 N;  5FPE A;  3WUH A;  3TWH A;  4CHO A;  3C7N A;  2P9S A;  3N4P A;  4W5Q A;  4AIL C;  4C8N A;  1ATR A;  1RGI A;  4RWT A;  2IGI A;  1XHX A;  3E9P A;  3ZSY A;  3AO4 A;  4LD0 A;  3LM9 A;  3C7N B;  2P9S B;  1GOB A;  2I7N A;  4YDU C;  1BI4 B;  5JVG L;  1DTQ A;  4IEI A;  1FKP A;  4DSJ A;  3WEE A;  2BTF A;  4MDB A;  2X78 A;  3LP1 A;  4LY7 A;  4FK2 A;  1IG8 A;  3AAP A;  4DLG A;  5KGW A;  2BH1 A;  3WXK A;  1ZC6 A;  3U6F A;  1J6Z A;  4DTU A;  2BDP A;  1RDD A;  2QKK A;  4DSF A;  2HHX A;  3AVH A;  4DR4 K;  3WEE B;  3V9W A;  1B92 A;  3IKM A;  4JK9 A;  2ZM6 K;  4FOI A;  3CCU N;  1X9M A;  3CMA N;  1WSJ A;  4JKH A;  4BC3 A;  1K6Y A;  3H3N O;  3H6E A;  2QM1 A;  4FWO A;  3QEW A;  4A5A A;  3RWU A;  3PX0 A;  2W40 A;  4M7X A;  2KFN A;  1RT5 A;  3VQ8 A;  2FBX A;  2YKN A;  3VET A;  3U3Y A;  4FJL A;  5J1E A;  4DQP A;  4EZ6 A;  1EKE A;  5FRO A;  3NVM A;  5HLF A;  3KK3 A;  1K8K A;  3O4W A;  5DM6 L;  3DLL L;  1CZA N;  4FW2 A;  1IBM K;  3EYZ A;  1VQN N;  4CGD A;  3LZJ A;  2G8F A;  1QHA A;  1Z05 A;  1NLV A;  4M3R A;  4ZTF A;  3TTC A;  3OHR A;  4G1Q A;  3W3D A;  1K8K B;  1SKS A;  3CJ9 A;  2KTQ A;  4QS8 A;  3O8M A;  3P83 D;  3BZC A;  1TGO A;  4OPK A;  3D2E B;  3LPU A;  1NJY A;  3MEE A;  3BGR A;  1YJN N;  1IO2 A;  1NGD A;  3VN5 A;  2A42 A;  3RRH A;  3QIP A;  5J2M A;  5B8H A;  3V9S A;  2GEM A;  3DI6 A;  2VWJ A;  1LWF A;  4JKC A;  1Z25 A;  4BWM A;  3A5N C;  5CHI A;  2V7Z A;  2UYT A;  4BE0 A;  2KW4 A;  4LF9 K;  1ILY A;  4BWJ A;  2AP1 A;  4OGC A;  2Z1G A;  2A3Z A;  4KI6 A;  5EVZ A;  5GAH P;  5DMR A;  4IEE A;  1KLN A;  1VQK N;  4DR5 K;  4F2R A;  3K58 A;  2E1Y A;  1BHL A;  1FW6 A;  4O8K A;  1GLL O;  2WFB A;  1JJ2 M;  1NGA A;  2RKI A;  1KC8 O;  4EP4 A;  3RMA A;  2FSK A;  3ID6 A;  4EHU A;  3QIO A;  1NGG A;  1NM1 A;  1VQP N;  3SQ0 A;  2F9T A;  4UQG A;  4X65 K;  5C24 A;  3KLG A;  3H08 A;  1VAZ A;  4FJ8 A;  1NGC A;  3AVN A;  1VQO N;  3SV4 A;  1TUU A;  5BPM A;  1NMD A;  1HYS A;  1BWF O;  4KAZ A;  2HVH A;  1JL2 A;  4H5N A;  2VWB A;  1YUW A;  4DR3 K;  4HTL A;  4ELT A;  2ZJP L;  5M1Q A;  3LM2 A;  2DFE A;  3UKU A;  1FK9 A;  5GIO A;  3CC2 N;  3RRG A;  1K9M O;  1NWK A;  3CJB A;  4CER A;  3RVC A;  1NMN A;  2VGN A;  4H5T A;  4FJG A;  1Z26 A;  3KLI A;  4JKD A;  2OTL N;  1K8A O;  4H8K A;  4CZF A;  4B9L A;  1RDW X;  2RE2 A;  3V9X A;  3ZT3 A;  2FBY A;  3C65 A;  1S1X A;  2QI2 A;  1HLU A;  3LL3 A;  4O55 A;  5AQP A;  5CE3 A; 
#chains in the Genus database with same CATH homology
 5HOO A;  4JKB A;  4BVO A;  3G4S N;  3SMP A;  4CBU A;  4MDA A;  3CXC M;  1GLF O;  1QQN A;  4FWK A;  4PL8 A;  3TSP A;  3VER A;  3EZW A;  4GV3 A;  3GL1 A;  3O9S A;  3CCE N;  4CZL A;  1Q18 A;  3VES A;  1N8R O;  2FSN A;  3WXJ A;  4JHD A;  5EOY A;  1C0G A;  2HMP A;  4IOX A;  3DXK B;  2AA4 A;  3O1W A;  4NB4 A;  4A2A A;  5LJW A;  1NGB A;  3CF5 L;  3DXM A;  3FZL A;  2A5X A;  4PKI A;  1KD1 O;  4MLE A;  3G25 A;  3MN7 A;  3MX5 A;  3EE9 A;  5FPM A;  2F9W A;  1NJI O;  1U6Z A;  1HX1 A;  3U8X A;  3F5T A;  4H5V A;  3O5B A;  1ZBS A;  1E4F T;  1H1V A;  3CIP A;  5H1S Q;  1DT9 A;  4JHD B;  1V4T A;  2E2P A;  3ATU A;  2QXL A;  4OPA A;  5E84 A;  4CZM A;  5KPZ A;  1U2V A;  2QWL A;  4C1N I;  3P4I A;  5M1N A;  3BEX A;  1YAG A;  3TSU A;  3GDQ A;  4FWM A;  3M6G A;  4FPB A;  4WFN L;  3DXM B;  3HBT A;  4I6M A;  4H0T B;  4CD3 A;  5GAG P;  1S72 N;  4LC9 B;  5C0Y A;  3QIC A;  4B1W B;  4CZJ A;  3HTV A;  3I55 N;  2YX6 A;  1T44 A;  1VQ7 N;  1D4X A;  2QWR A;  3SJH A;  1GLD G;  4JKF A;  4JKG A;  3R3L A;  4H5W A;  3UE5 A;  1ATN A;  4BC2 A;  4GV9 A;  1HKB A;  3VF6 A;  1U2V B;  3BF1 A;  3CI5 A;  2FF6 A;  4BRF A;  3ATV A;  3J8A A;  5AQN A;  3FZF A;  2ZWH A;  1X3M A;  4K43 A;  5DM7 L;  1YJ9 N;  4I6M B;  4FWS A;  5F1X A;  3MN5 A;  4EIA A;  3F2K A;  3R8E A;  1E4G T;  4BRH A;  1RDU A;  3B8A X;  3HSC A;  4H0Y B;  3W0L A;  1QVG M;  4KH4 A;  4K42 A;  5JMV A;  4YOY A;  2E8A A;  2EWS A;  3VF2 A;  3WQU A;  5M1K A;  3ZEU A;  4JKG B;  3S41 A;  3SLC A;  2NRW A;  3VEV A;  4RTF D;  1VQ9 N;  3QBW A;  2QA4 N;  1YVN A;  3CJ7 A;  2KHO A;  5AQU A;  2VGM A;  3VMF B;  5AQX A;  3VTH A;  1EO1 A;  5BN8 A;  5TKY A;  2FLO A;  3MDQ A;  5EX5 A;  5MLC Q;  4B1U B;  4U67 L;  4JKA A;  3TTF A;  2Q0U A;  4JD2 A;  5TKW A;  4A61 A;  4U7B A;  3G71 N;  1KAY A;  3ZEU B;  4WQ5 C;  4O8U A;  4FVU A;  1DKG D;  2QWN A;  4XEI A;  4H0O A;  4BRM A;  2H3G X;  2D4W A;  1KAZ A;  2P9L A;  2QWM A;  4JN4 A;  5AQV A;  5FPN A;  3MWP A;  4BRE A;  1GLA G;  4BVP A;  1HJO A;  3CHW A;  1K73 O;  2NRT A;  4CZH A;  1BA1 A;  2VYP A;  3AGR A;  2V51 B;  2P9U A;  3RSE A;  2Q2R A;  2HST A;  1XC3 A;  2ZF5 O;  3EO3 A;  4JD2 B;  2QWP A;  3E1Y A;  3HZ6 A;  3KWI A;  1KXP A;  3JXU A;  5AQZ A;  3FFK B;  4J8F A;  5EXW A;  4A62 A;  3CCJ N;  4IOC L;  1Y64 A;  4EHT A;  2P9L B;  4EFH A;  3A5O C;  4YOX A;  2HBK A;  4FO0 A;  3KZB A;  3OW2 M;  3AGK A;  4DKW A;  4BG9 A;  3RSE B;  2WBN A;  4G9Z A;  3P38 A;  1QVF M;  3D7E O;  3M3Z A;  4GY2 B;  4JNE A;  3K9K A;  5AQO A;  4BRC A;  1W97 L;  2GWJ A;  3CCQ N;  5AQI A;  4IZ9 A;  2FSJ A;  4FWN A;  2ZJQ L;  4IOA L;  4CBW A;  3IMX A;  3O08 A;  2QWQ A;  3LDL A;  4H0P A;  4YDU A;  1XQS C;  2YCH A;  4XH4 A;  1Q7Y O;  3CET A;  1HKG A;  4IDH A;  3C6A A;  3E66 A;  5BN9 A;  1QQM A;  3UKU B;  1KQS M;  3UKR A;  3ENB A;  1SQK A;  2W41 A;  3EKU A;  2PFU A;  4YOW A;  2FF3 B;  4A59 A;  4BRQ A;  5E26 A;  1BOT O;  4IWV A;  1YIJ N;  5BPL A;  3DAW A;  4YOU A;  1BUP A;  3TSQ A;  3R1X A;  2E2Q A;  5JLF A;  2ZGZ A;  3C6H A;  3PIP L;  1NGH A;  3GOI A;  2NRR A;  1NGF A;  3EN9 A;  2D1K A;  4WYB A;  3EE8 A;  3GE1 A;  4BR7 A;  5BRE A;  5GIP A;  4BR5 A;  4B1X B;  2ASO A;  4ISF A;  4C23 A;  3CD6 N;  3AAQ A;  4M63 C;  4IJA A;  5AQR A;  4BGB A;  5C2D A;  3TPQ A;  4KBO A;  2Q97 A;  1Q82 O;  3A5L C;  4EAH D;  3UKR B;  4BRO A;  4PL7 A;  2HBL A;  3BUZ B;  5AQY A;  3HOS A;  2HF3 A;  2NRH A;  3MX2 A;  2E88 A;  4AM7 A;  4BR0 A;  4BC5 A;  4FWP A;  3H1V X;  4BRK A;  3C0B A;  3SK3 A;  4BQZ A;  4ILJ A;  4PHT X;  4BY9 C;  4BRG A;  4BRL A;  3ZX0 A;  2P9N A;  2QWO A;  1T3V A;  3CPW M;  3CME N;  2JWK A;  3KVG A;  2HBM A;  4NLC A;  4BG8 A;  4ILG B;  2YHW A;  5AR0 A;  5M1O A;  4WF9 L;  4YOV A;  4NLB A;  3WQT A;  2ASP A;  3P31 A;  4C1N K;  4FPA A;  2E20 A;  3BP8 A;  3D2E A;  1GLJ O;  3F9M A;  3CCL N;  3VTI A;  3ZET A;  4BR2 A;  1SS6 A;  4ILH A;  3H45 C;  4CD1 A;  2ZJR L;  1R59 O;  3O9U A;  2CH6 A;  2D0O A;  3K9J A;  2F7T A;  2Q0R A;  3Q7C A;  3CC7 N;  3O80 A;  3AY9 A;  5I9E B;  2P9N B;  1WUA A;  2PAV A;  3A5M C;  4IJN A;  2YJF A;  2PBD A;  3TU5 A;  2CGJ A;  3LDN A;  3MN9 A;  3AAR A;  4AM6 A;  4BRD A;  5AQL A;  2KKZ A;  4B1V A;  4DB3 A;  3OBY A;  4H0X B;  5AQF A;  3L6Q A;  4Z94 A;  1MWM A;  5AZJ A;  1MA9 B;  3CQX A;  3IUC A;  3QBX A;  3O1B A;  3ZET B;  5JVH L;  4ISE A;  3T7Z A;  3CCR N;  1BU6 O;  3WXM B;  5AFU H;  3HOT A;  2E1Z A;  2WC9 A;  5AQM A;  2P9K A;  5BR9 A;  1YHQ N;  1EQY A;  2ITM A;  2WUS A;  1M90 O;  3CQY A;  1BG3 A;  3DJC A;  2NRV A;  4FOE A;  5AQJ A;  1S3X A;  3HM8 A;  1NBW A;  1VQ4 N;  1Z6R A;  5AZJ B;  4JK7 A;  1VQL N;  3QML A;  5LY3 A;  4YOR A;  5ADX H;  2CGL A;  1X3N A;  2YJE A;  2NRX A;  1ESV A;  4H03 B;  4IFE A;  4Y0W A;  1VQM N;  4DCH A;  3CJC A;  1HPM A;  2GTD A;  2HF4 A;  1X9J A;  1MWK A;  2P9K B;  3MWT A;  3O6W A;  3L4Q A;  3P39 A;  4ISG A;  3D2F A;  3O9T A;  1OKJ A;  3VEO A;  1VQ5 N;  4A5B A;  5FPE A;  3WUH A;  4FWQ A;  3ENO A;  3J7Z O;  2NNW A;  3CPE A;  3SBG A;  2FXU A;  3BF3 A;  3C7N A;  2P9S A;  3N4P A;  5AQH A;  4WFB L;  4BR4 A;  1NGE A;  1ATR A;  3WXI A;  3U9D A;  1QQO A;  1RGI A;  4RWT A;  4IO8 A;  3I33 A;  2P9P A;  3E9P A;  2Q1N A;  2A6A A;  3VGK A;  2CH5 A;  4MO4 A;  4CZE A;  1MDU B;  5BPN A;  3QFP A;  3IDH A;  4DHY A;  5LJV A;  1SAZ A;  1XUP O;  3LM9 A;  3IFR A;  1BDG A;  4BGA A;  3R9P A;  4WCE L;  3C7N B;  2P9S B;  3JS6 A;  4WQ4 A;  2I7N A;  3E9O A;  4YDU C;  3CCM N;  5GAE P;  5JVG L;  5AQG A;  3VEZ A;  1M1K O;  1Q86 O;  2P9P B;  4IEI A;  3ZX3 A;  3NMU A;  4OO1 J;  3WEE A;  3PIO L;  5BRF A;  4JAX A;  3VF4 A;  2P9U B;  1JCF A;  2BTF A;  4H5R A;  5GIN A;  4MDB A;  1LOT B;  3EL2 A;  4E1J A;  3H46 O;  1IG8 A;  2D0P A;  3AAP A;  2BH1 A;  3WXK A;  4WQ5 A;  1ZC6 A;  1S22 A;  1J6Z A;  1NGJ A;  3M1F A;  1T6D A;  3U9Z A;  3OBW A;  3ZYY X;  3WEE B;  3FZH A;  1GLB G;  3A0I X;  3IKM A;  3ENH A;  3LDQ A;  2P9I A;  3D6R A;  4JK9 A;  4MO5 A;  4FOI A;  3CCU N;  3LDP A;  3O9R A;  3NVK A;  2IVP A;  3CMA N;  2A41 A;  2YHX A;  4JKH A;  3KK7 A;  3UB5 A;  4BC3 A;  3H3N O;  3H6E A;  4CI6 A;  1JCE A;  2QM1 A;  4FWO A;  4A5A A;  3FR0 A;  3Q7B A;  4K25 A;  2HBJ A;  3MCA B;  4YOT A;  3ZX2 A;  3PLA A;  2W40 A;  4M7X A;  1GLC G;  4FL9 A;  2GEL A;  5JLH A;  1ATS A;  3CJA A;  5KQ8 A;  2P9I B;  3VEW A;  4QS7 A;  3ULE A;  4A57 A;  3VET A;  4RCH A;  5M1P A;  2OTJ N;  4GV6 A;  3G6E N;  3DWL A;  3GG4 A;  1Q81 O;  3NVM A;  1GLE G;  4FWL A;  1K8K A;  1V4S A;  3O4W A;  3A8Y A;  4JK8 A;  1ZXO A;  2QEX N;  5DM6 L;  4BR9 A;  3DLL L;  1CZA N;  4GVE A;  4HWI A;  2OAN A;  2GWK A;  1HUX A;  1VQN N;  5C10 A;  4XH5 A;  3MK6 A;  1QHA A;  3ULE B;  4B1Z A;  5BRD A;  3SAG A;  2YHY A;  3FE1 A;  1Z05 A;  1NLV A;  2A40 A;  3M5R A;  2Q31 A;  4KH5 A;  3R6M A;  3TTC A;  3EKS A;  3FZM A;  3OHR A;  2VCP A;  4FSV A;  3WXL A;  4PKH A;  5HL7 L;  3L4I A;  3W3D A;  2GUP A;  3QFU A;  1K8K B;  3H1Q A;  2NZT A;  3CJ9 A;  4CZG A;  1JCG A;  3SAH A;  4QS8 A;  1QZ6 A;  3CCS N;  1YF5 L;  3O8M A;  1TYQ A;  1O13 A;  5FPD A;  5C12 A;  2QW9 A;  3D2E B;  3KWG A;  2JWL A;  4JEP A;  4DQ8 A;  5AFU A;  3HRG A;  3LDO A;  2YI1 A;  5BRH A;  1YJN N;  1NGD A;  3WT0 A;  3MCP A;  2A42 A;  3MN6 A;  2Q36 A;  2NRZ A;  5B8H A;  1WOQ A;  2GEM A;  3SAF A;  3VGL A;  4JKC A;  1OVY A;  2IIR A;  2E2N A;  4BQL A;  3FZK A;  3CER A;  1TYQ B;  3A5N C;  4QS9 A;  2V7Z A;  2ASM A;  2UYT A;  4GNI A;  5AQQ A;  5ADX A;  5CHI A;  4UY8 O;  1ILY A;  3VPZ A;  2AP1 A;  2IVN A;  2A3Z A;  5EVZ A;  2V7Y A;  4L3Q A;  1IJJ A;  3SMS A;  5GAH P;  4IEE A;  4R79 A;  1VQK N;  4H0V B;  1NGI A;  1T6C A;  2QTD A;  2RHK A;  4OPH A;  4BC4 A;  3QB0 A;  3VOV A;  2E1Y A;  5ELZ A;  2HOE A;  3CJ1 A;  4O8K A;  3QDK A;  4IO9 L;  1GLL O;  2WFB A;  4CZK A;  4WQ4 C;  3FLC O;  4F9O A;  1JJ2 M;  1NGA A;  2E2O A;  2GX9 A;  4A2B A;  1KC8 O;  4MLH A;  1QZ5 A;  3VEX A;  2FSK A;  3ID6 A;  4EHU A;  5GAD P;  1SZ2 A;  1NGG A;  2CGK A;  4NO7 A;  1NM1 A;  3D2F B;  3TTD A;  3O9Q A;  1VQP N;  3CC4 N;  1C0F A;  3MMV A;  3VGM A;  4JKE A;  2F9T A;  5AQW A;  4B1Y B;  3GBT A;  4B9Q A;  3N4Q A;  3E9L A;  4CZI A;  1P90 A;  1YXQ A;  3I56 N;  1W2B M;  5EY4 A;  2BUP A;  2DPN A;  4O5F A;  4BRA A;  4KH6 A;  1LCU A;  1VAZ A;  3L0Q A;  4BRN A;  5AQT A;  2IVO A;  1NGC A;  5CR4 A;  3KHY A;  1YJW N;  1VQO N;  4AF1 A;  3ID8 A;  4XH1 A;  3T69 A;  1TUU A;  3I8B A;  3U4L A;  5BPM A;  1NMD A;  1VQ6 N;  2V52 B;  1BWF O;  5M1F A;  2ZGY A;  5AZI A;  2NLX A;  4H5N A;  2VWB A;  5AQS A;  1YUW A;  1RFQ A;  4HTL A;  3SBT A;  3H3O B;  2ZJP L;  5M1Q A;  4K41 A;  5F2R A;  5KPT A;  2J4R A;  3VEN A;  4BRI A;  3LM2 A;  1BA0 A;  3UKU A;  4PKG A;  4CJ7 A;  2KLA A;  5C15 A;  5JIC A;  5GIO A;  1YI2 N;  3CC2 N;  1TUY A;  1K9M O;  1NWK A;  3CJB A;  3VEY A;  3RVC A;  2VGN A;  4FWR A;  4H5T A;  5F0X A;  1DEJ A;  5C2F A;  5AZI B;  4JKD A;  4CBX A;  1VQ8 N;  2OTL N;  1BO5 O;  3CCV N;  1P8Z A;  1K8A O;  4CZF A;  1G99 A;  3OA9 A;  5AQK A;  5KQD A;  4M7Y A;  1KAX A;  1RDW X;  3HI0 A;  4WFA L;  2RE2 A;  5KPR A;  1DGK N;  3C65 A;  2QI2 A;  3FGU A;  4BRP A;  2I7P A;  1HLU A;  3DXK A;  1HKC A;  4IXC A;  1YIT N;  3LL3 A;  5AQP A;  5CE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...