2A6AA

Crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MNVLALDTSQRIRIGLRKGEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKSCPADGVVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERLFREKKTIHYYEIEPLYLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an essential bacterial protein YeaZ (TM0874) from Thermotoga maritima at 2.5 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords hypothetical protein TM0874
total genus 55
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2a6aA01
3.30.420.200 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2a6aA02
2YJFA 2A40A 3AAQA 1NGDA 1BA0A 2YJEA 4FPBA 3R8EA 4BG9A 3WXKA 1HJOA 4CD1A 5KPTA 4RCHA 1BG3A 1ZBSA 5AQJA 4PKGA 4B1UB 4E1JA 4JAXA 4CZJA 1GLAG 4JN4A 2GWKA 3BEXA 3L0QA 3CJ9A 1QZ5A 3FE1A 5EY4A 2QM1A 2YI1A 3GOIA 3KZBA 1YXQA 3AAPA 2QWQA 1SAZA 3VEXA 1GLDG 4H0XB 1ZXOA 3L4IA 3B8AX 4WYBA 4BRLA 3U8XA 3P4IA 3LDQA 4ISFA 2Q0UA 3A5MC 5AQUA 3LDOA 3A8YA 4MLEA 2BUPA 2J4RA 3EZWA 4C23A 2P9IA 3C7NB 4F9OA 3RSEB 1T44A 3D2EA 5KQ8A 1GLCG 3CQXA 4FO0A 3ULEB 3M1FA 3FGUA 4M63C 3DJCA 4BRGA 3VF4A 3ULEA 3IMXA 5AQZA 3FLCO 5FPEA 2P9LB 4B1VA 3JXUA 1K8KB 3CETA 1HKBA 2FXUA 3CJ1A 5ADXH 1RGIA 1C0GA 4PL7A 1NM1A 3FZFA 2I7NA 1TUYA 5FPMA 1KAXA 1NGFA 2E2OA 1YVNA 2FSJA 4EAHD 2E1ZA 3IDHA 1BDGA 2VYPA 3CI5A 1QHAA 4YDUC 4H0PA 4FWPA 5AR0A 3VGKA 2QWPA 1HLUA 1P8ZA 4BRFA 2ASOA 3HI0A 1X9JA 1NMDA 3CJBA 4H0VB 5AQLA 4RTFD 1T6CA 3H45C 3R9PA 2OANA 3MN6A 3EN9A 5LJWA 1QQNA 3D2FB 4BR2A 1YAGA 1IG8A 4K43A 3VOVA 3OHRA 4GNIA 2FF3B 5AQFA 3EKUA 5EOYA 3WXJA 4Z94A 3RSEA 2AP1A 1HKCA 4CZGA 1EQYA 2ASPA 4WQ4C 1NLVA 1ATNA 3MN5A 4NO7A 3A5OC 2QXLA 5ADXA 5AQHA 4WQ5A 4FOEA 3QBXA 3HTVA 4K42A 2DPNA 3DXMA 2QW9A 2KHOA 4H5NA 3VEZA 3HM8A 4K41A 4BR5A 2FSNA 3VEVA 2P9KA 1TUUA 1KAYA 4WQ4A 2BTFA 5AQKA 4BC3A 3SMPA 1GLEG 3BUZB 3GG4A 4B1YB 1IJJA 3ZX2A 4BRPA 5E84A 4IXCA 5AQVA 3O1WA 1ATSA 2IVOA 1QZ6A 3R6MA 3ZEUA 4QS7A 4J8FA 4QS8A 4BRIA 3CJCA 2HOEA 4CZLA 3IFRA 1T6DA 1OKJA 3FZMA 4BC2A 1NGEA 1MWMA 1U2VA 3H46O 3J8AA 4BVOA 4YDUA 2Q1NA 5E26A 4KBOA 2GTDA 3H1VX 1MDUB 1MA9B 3HBTA 5BPNA 4QS9A 3SMSA 1HKGA 3QMLA 4IO8A 1RFQA 3HSCA 5FPDA 4FWNA 4FWMA 4FWSA 4BRDA 2GWJA 4FSVA 2A41A 4BRHA 2P9IB 3DXMB 5JLHA 4CD3A 1RDWX 3FZHA 3VGLA 4MLHA 3SJHA 2PBDA 3LL3A 5AQIA 1DEJA 1HX1A 3MCPA 3UKUA 2ZGZA 3BP8A 2P9LA 5BPMA 2IVNA 3UKRA 5KPRA 1NBWA 4A62A 5BN9A 1NGJA 4FPAA 2E2NA 3H1QA 4BG8A 1HUXA 5AQSA 3D2EB 3W0LA 1S22A 3WEEA 4PKHA 3CJ7A 4DHYA 3C7NA 2WUSA 3GL1A 3O1BA 4DB3A 4BRCA 5AQPA 5AQYA 1BWFO 3VESA 5F0XA 5KQDA 2ZGYA 2YCHA 3HZ6A 2FF6A 2P9PB 4CZMA 5I9EB 3O5BA 2QWMA 4CZHA 1NGIA 1XUPO 3UKRB 4BR0A 3O80A 2VCPA 1TYQA 4AM7A 3ZX3A 3UE5A 3VF6A 4CBUA 2NRHA 4JNEA 5AQXA 1V4TA 5AQOA 1WOQA 3TU5A 4FWRA 2A6AA 4NB4A 5BRDA 2QWNA 2P9NA 3F9MA 4I6MB 3M3ZA 4B1XB 1LOTB 3S41A 4FOIA 4DQ8A 2FLOA 2VWBA 2V52B 2QWRA 3ATUA 5AQNA 1XC3A 3DXKA 2PAVA 3U9ZA 5BN8A 2CGKA 4BR7A 4CBWA 3DXKB 4K25A 3A0IX 4BRAA 3LDNA 2NLXA 5FPNA 3O08A 2E2QA 1Q18A 5BPLA 3WUHA 5B8HA 2P9NB 5AQTA 3JS6A 4B1ZA 4BGBA 3H6EA 4H5TA 3VENA 3O8MA 3MDQA 3U9DA 4FL9A 2E1YA 4BQZA 5AFUA 3A5NC 3I8BA 4CJ7A 1KAZA 3ZETA 3A5LC 1LCUA 2H3GX 1DKGD 3BF3A 1ZC6A 3FFKB 1BU6O 1D4XA 2V7YA 4BC5A 2ZF5O 1JCEA 3VEYA 2CH6A 1NGBA 3UB5A 5EVZA 2E8AA 2F9WA 4PL8A 4BRMA 4CI6A 4FWQA 4CZEA 3MN9A 3M6GA 4A2AA 5AZJA 3BF1A 4BQLA 5BRFA 1WUAA 2QWLA 4JHDB 4ISEA 1ATRA 5BREA 4O5FA 2P9UA 2NZTA 3AY9A 4IWVA 3G25A 2YHXA 3VETA 3ZX0A 4XH1A 2CGJA 1ESVA 4BRKA 3DWLA 5TKYA 3QDKA 2GELA 4B9QA 5LJVA 1GLLO 1G99A 2V7ZA 2E2PA 2HF4A 2D4WA 5F2RA 2P9SA 3ENOA 3VEOA 3WEEB 4EHUA 1Z6RA 2GUPA 4I6MA 3H3OB 3EKSA 3IUCA 3CERA 4BVPA 5AQGA 3FZKA 3I33A 1BA1A 3WXIA 3H3NO 1U2VB 3ZETB 5CE3A 2UYTA 1BUPA 3UKUB 4CZFA 2CGLA 2QWOA 4H0TB 1Y64A 5JICA 5JMVA 1J6ZA 2HMPA 3KVGA 4CZKA 4LC9B 2A5XA 3QFPA 4B1WB 3VEWA 4FWOA 4M7XA 1NGCA 2E88A 1JCGA 4L3QA 1C0FA 1HPMA 3VERA 2Q97A 3O6WA 4H03B 1SQKA 4DCHA 4Y0WA 3SLCA 4O8KA 4JD2A 2P9PA 2I7PA 1KXPA 5AZJB 5F1XA 3WQUA 3CQYA 3LDLA 3KHYA 3W3DA 1U6ZA 1GLJO 1X3NA 3LM2A 4A61A 5AQRA 4IZ9A 2D0PA 2P9UB 3GE1A 2FSKA 3TPQA 1CZAN 5EXWA 4FWKA 2GEMA 5AQQA 3CHWA 4BRQA 1S3XA 4BR9A 4H5RA 3QICA 4H5WA 3ZEUB 4GY2B 4CZIA 3QBWA 5AFUH 2EWSA 3MK6A 3GBTA 1JCFA 1DGKN 1Z05A 3FZLA 3L6QA 1X3MA 2Q36A 3ID8A 4AM6A 3MMVA 3WXLA 3SK3A 2HF3A 1XQSC 3EL2A 5AQWA 1BOTO 3WQTA 4H0OA 1MWKA 2AA4A 4WQ5C 4BROA 1QQMA 4PKIA 4H0YB 4MO4A 4CBXA 2P9KB 4M7YA 3CJAA 4JHDA 4EIAA 2ZWHA 3MN7A 5LY3A 4BRNA 3O4WA 3VF2A 5KPZA 1R59O 3D7EO 4HTLA 3LDPA 4FWLA 1QQOA 3ATVA 3FR0A 4XH5A 3CIPA 4ISGA 5AQMA 4IJNA 4A2BA 4BGAA 4H5VA 3EO3A 3U4LA 2V51B 2Q2RA 1BO5O 4MO5A 2A3ZA 2Q31A 3LM9A 1E4FT 2CH5A 2W41A 5JLFA 3AARA 4EFHA 2A42A 2Q0RA 3D2FA 4BR4A 1K8KA 5BRHA 2ASMA 1V4SA 2W40A 4RWTA 4BREA 4BC4A 3VPZA 4EHTA 2YHYA 2D1KA 1E4GT 5BR9A 3ENHA 3VGMA 2E20A 1NWKA 1TYQB 2ITMA 1NGAA 3C0BA 4XH4A 2IVPA 5EX5A 3QFUA 1YUWA 1NGGA 2YHWA 2P9SB 3GDQA 1SZ2A 1GLFO 5ELZA 5AZIA 3WT0A 4IJAA 4HWIA 2F9TA 5AZIB 4JD2B 2D0OA 1H1VA 4XEIA 1NGHA 3DAWA 1GLBG 2IIRA 3QB0A
chains in the Genus database with same CATH superfamily
2A40A 3NVKA 1NGDA 5J2PA 1BA0A 4CK1A 1Q86O 1RTJA 2YNFA 4X64K 3R8EA 4CEAA 4CGJA 5KI6A 4C8LA 3WXKA 2ZE2A 1HJOA 3DYAA 1NJYA 3EY1A 2JGUA 1BG3A 1ZBSA 2XRIA 4B1UB 3HM9A 2PZSA 3O9TA 4JAXA 4ELTA 4NXNK 2GWKA 1Q81O 4HUGA 2HBLA 2YI1A 1N33K 1VSIA 3CCEN 3AVJA 3K9KA 1SL0A 3G0ZA 3VEXA 4UY8O 2O8CA 4FVUA 3B8AX 4BRLA 4MQ3A 1N36K 4H4OA 3U8XA 3P4IA 1OH5A 4ISFA 4FLTA 4W5NA 2O8EA 1QSSA 4CJVA 3TARA 4AHRA 4F9OA 3RSEB 5GIOA 4FLZA 3O3GA 5J2NA 2WTUA 1GLCG 3CQXA 3EZ5A 4OGEA 4DTJA 4FJ7A 3RR8A 3SJJA 3ULEA 3SV4A 1KVAA 1NOZA 1N32K 4B1VA 3JXUA 4PHTX 1RTHA 1ZBLA 2FXUA 4DTNA 1JJ2M 3THXA 4JKDA 3VQQA 4LF9K 2OPSA 2ZJRL 1T7PA 1KAXA 3V1QA 4JI2K 3OYKA 1YVNA 3FFIA 4MDBA 1GOBA 1OH8A 5C42A 1BDGA 2VYPA 5HRNA 2G8VA 3C6AA 1QHAA 3CFOA 3C94A 3DLLL 1NG9A 1LAWA 3OY9A 1X9JA 3HRGA 3CJBA 3I55N 5M1QA 4RTFD 3OYGA 3R9PA 2HBKA 1QQNA 4BR2A 4C8MA 3LZJA 1YAGA 4GVMA 1IO2A 5J2MA 2FF3B 3LP0A 3WXJA 1S5JA 1HKCA 2A1RA 3I56N 4OVLA 3VQDA 5E41A 4FW1A 5TKWA 3G4SN 2KLAA 3A5OC 3P83D 2QXLA 1JLAA 3HXMA 4WQ5A 4RW6A 2DPNA 3DXMA 2QW9A 2LSNA 2KHOA 4H5NA 4BR5A 3CMAN 1SKRA 2P9KA 1WLJA 5AQKA 3SBTA 3SMPA 5MLCQ 3GG4A 3CCMN 3HK2A 4B1YB 3TR8A 1IJJA 3CPEA 1GOAA 4ID1A 2IVOA 2RPIA 5FLXO 4E89A 3R3LA 4J8FA 2VWJA 4QS8A 2YKMA 3CJCA 3ZT0A 4CZLA 3IFRA 3CCQN 4CJPA 1U2VA 3NFAA 3J8AA 1BGXT 4CJQA 4M3WA 3VTHA 4KBOA 3H1VX 3M8RA 1C0MA 4Z4FA 4JI6K 2D0BA 3O4QA 3HBTA 4WFBL 1HKGA 3E9OA 3NF6A 4BWJA 2A41A 1VQ8N 1DTTA 2P9IB 5HRPA 4DTXA 4DV0K 4EP4A 2QKKA 1DEJA 4CECA 3UKUA 4DSJA 2ZGZA 3BP8A 4G9ZA 1U48A 4K8ZA 2O8FA 2P9LA 1Q82O 4CCHA 1NBWA 1JLGA 4U7BA 4JI7K 2YKNA 4WFAL 4AHTA 2QEXN 2E2NA 4BG8A 3OYJA 3W0LA 3D2EB 4G1QA 1S22A 3F73A 3CJ7A 4LH4A 1JKHA 2WUSA 2G8HA 3A2FA 3QERA 1BWFO 1K73O 3ZSOA 4M42A 1N34K 3HZ6A 3P5JA 2FF6A 3NAEA 4CZMA 1BL3A 5I9EB 3SAGA 1LW2A 3O5BA 1QSLA 2PYJA 2HB5A 1TYQA 3UE5A 3VF6A 2DY4A 1WNSA 4JNEA 5AQXA 1V4TA 1WOQA 3SV3A 4HCBA 3ENBA 4NB4A 2QWNA 3F9MA 3M3ZA 4JS4A 4CGIA 1LOTB 3DLRA 1RDAA 1NK0A 4DQ8A 1JL2A 3K2PA 1C6VA 1XC3A 3N4PA 4FLYA 3DXKA 4NCAA 3AA5X 4E19A 3WXMB 1BIZA 3A0IX 1RT5A 2XY6A 4KHQA 2UUAK 1L3TA 3OBWA 4FZYA 3AVCA 3CG7A 4B9LA 4M3UA 4IEIA 1Q18A 5BPLA 4ILGB 4BDYA 4YOYA 1ZBHA 2P9NB 2E5LK 4NXMK 1NK4A 1NMNA 4IEEA 1ZYQA 1JLCA 5HP1A 4DQIA 1KAZA 2KQ2A 3ZT3A 2BDPA 4F3TA 1LWFA 1VQ9N 1DKGD 3BF3A 2Y1JA 1T05A 1ZC6A 4E7LA 1D4XA 1TK5A 3K59A 4BC5A 4KHNA 1RT1A 3KIOA 3DMJA 2D5RA 3NH1A 3QEPA 4CI6A 4DFKA 4FWQA 3VN5A 3M6GA 3AV9A 4A2AA 1KQSM 4KH5A 4E7JA 1MU2A 2VQFK 5BRFA 1WUAA 3SAHA 3SUQA 3ASMA 2QWLA 4JHDB 3UIQA 3CMEN 2NRWA 2BH1A 3G25A 1YTUA 4XH1A 1ESVA 1XHXA 3LP3A 4E1MA 3DWLA 4B9QA 5LJVA 4EZ6A 1RT7A 1G99A 2V7ZA 2E2PA 2HF4A 3L2UA 4A59A 5F2RA 3ENOA 2KW4A 4FJKA 3I33A 1BA1A 4B3SK 4H0TB 1C0TA 3ID6A 4YOTA 4FK0A 2KZZA 1SUQA 4B9NA 5DMRA 4ZHRA 2WOMA 4FWOA 4M7XA 1B9DA 1CXUA 1KVBA 4TSXA 3VERA 4KREA 3K9JA 3SLCA 4O8KA 4J2DA 2P9PA 1QVFM 3TANA 4FJHA 5F1XA 3WQUA 3LDLA 1VSKA 1NK8A 1L3VA 1X3NA 5AQRA 4O0IA 4IZ9A 2D0PA 2FSKA 3TPQA 3S3OA 5AQQA 4CJUA 3CHWA 3IKMA 3O9QA 4BRQA 3VMFB 3T3FA 3LANA 3QEIA 2OYQA 4GY2B 4CHOA 4CZIA 5D3GA 3DLBA 1ITGA 3KK1A 5AFUH 2EWSA 1X9MA 2O4GA 1JCFA 4FK2A 3OS2A 1IKVA 3VQ7A 3AA4A 1C0UA 1HNIA 1IBMK 3KLIA 1BISA 4AM6A 3NMUA 2NRVA 5HL7L 1HYVA 2HF3A 4N41A 1RDUA 3WQTA 4CK2A 1M90O 4H0OA 2AA4A 2HHQA 4FJMA 4PKIA 4H0YB 4MO4A 1WB9A 2P9KB 3CJAA 5JVHL 2ZWHA 1BQMA 1EXQA 4ID5A 1LW0A 3T1AA 3OYNA 5C24A 5HBMA 3VF2A 5KGWA 1R59O 2P1JA 3ATVA 3FR0A 2RKIA 3KLEA 3AO2A 4IJNA 1RT6A 1RDDA 5HRSA 4NYNA 4CF0A 4BE1A 3OYFA 3TSUA 2Q31A 2CH5A 2W41A 3MXJA 3S3NA 1S6PA 1K8KA 5BRHA 2ASMA 4DU4A 1SL2A 4JK7A 1W9HA 2HVIA 2OZSA 4BC4A 2YHYA 4R5PA 5BR9A 4F2SA 2E20A 3CD6N 4GVEA 4BDZA 4LF6K 4XH4A 5GINA 3CXCM 3AVBA 3HSTB 4JI8K 1VSEA 3WT0A 1HQEA 3K5LA 1WSFA 4KTWA 3J81O 2YJFA 1WSIA 3ULDA 4BG9A 1T03A 2IS3A 4KHYA 1XMQK 3M8QA 4CZJA 2HSTA 1GLAG 3C6TA 4IG0A 4DV3K 1RTIA 2HW3A 3SQ4A 5EY4A 1U47A 1VSLA 2QM1A 3KZBA 3N4QA 3L4IA 3LALA 5DM6L 4F8RA 3L4QA 3TSPA 3THXB 5AQUA 4AHCA 4CEOA 3L3UA 1LAVA 2BUPA 4CF9A 4X66K 3NF9A 2YNGA 4FM0A 3C7NB 4CJKA 3MWPA 5A2QO 1LWEA 1X9SA 5KQ8A 3NHGA 3ULEB 2X78A 2E6MA 1A5XA 4M63C 4BRGA 5HOOA 3FLCO 1NJIO 4CEZA 1K8KB 3CF5L 1F21A 3CCLN 1RGIA 2Z1HA 3OYLA 3O3FA 3NF7A 2IDOA 4PL7A 1NM1A 4JI0K 1TUYA 2G8FA 1NGFA 2FBTA 1L3SA 1BQNA 3VQ9A 5KGXA 3CI5A 4YDUC 4LF7K 4FJLA 1TAUA 5AR0A 3VGKA 2QWPA 1WAJA 3L8BA 2ASOA 3HI0A 1I39A 3VQAA 3F2KA 4JK9A 3H45C 3OJSA 3PV8A 3PY8A 4AF1A 2OANA 3NGYA 4CEDA 1Q7YO 3EN9A 3VOVA 4K43A 4M45A 5KRSA 4E7HA 5AQFA 3EKUA 3G6EN 1IV0A 1EO1A 2HBJA 1UA1A 3DI6A 2AP1A 2HHXA 1KSPA 4FVMA 4OGCA 4IDHA 4WQ4C 4YOXA 1OH7A 4NO7A 5GADP 3CCSN 1WN7A 4FOEA 4K42A 1W2BM 1VSHA 3THWA 3VEZA 4LF5K 2P5GA 2KKZA 3VEVA 3LP1A 4C8KA 2BTFA 3CPWM 4I7FA 2GBZA 4E3SA 4CJFA 4BRPA 3SYZA 5E84A 4IO9L 4IXCA 2X6NA 1TK8A 4CF1A 4FM1A 3R6MA 4QS7A 3ALYA 4BACA 3V4IA 4CIFA 1VK0A 3BY5A 3AO1A 4BC2A 3OYBA 3SAFA 3U6FA 3MXIA 3DM2A 1SV5A 4PUOA 4QS9A 3SMSA 3E1YA 3QMLA 4IO8A 1RFQA 5C12A 4DV5K 4BRDA 2GWJA 4BRHA 5JS1A 2JWLA 1O1WA 3FZHA 4MLHA 3VGLA 1HX1A 3MCPA 1VQ4N 2BANA 4Q5VA 5SZTA 3WNFA 4B8AB 4N56A 5KPRA 1LWCA 1NGJA 2OPRA 3ZSXA 2F96A 4JV5K 4Z4CA 4LD0A 4ELVA 3O1BA 3CCVN 2A1SA 4DB3A 1KCFA 4BRCA 3VA0A 3VESA 5F0XA 4GV9A 4PQUA 2ZGYA 3ZYYX 2YCHA 4NYFA 4N47A 1T8EA 3OJUA 1S1VA 3AVNA 1NGIA 1XUPO 3UKRB 3ZT4A 4BR0A 5C2FA 2RE2A 2VCPA 4AM7A 1TKTA 4Z4GA 1ASVA 3TAMA 2NRHA 1WSHA 5AQOA 1TVRA 4FWRA 3ZSWA 4CESA 4CF8A 3V1RA 5BRDA 2P9NA 1RBVA 3L2WA 3I8DA 1J9AA 4JKAA 4WCEL 1YVUA 2G8UA 2VWBA 3AVFA 1ASUA 1RILA 4CFAA 3U9ZA 2UUBK 2QTDA 4CJTA 2HHHK 2B4JA 1RTDA 2BE2A 1HNXK 4F4KA 4DQSA 1TKZA 4JRPA 2YHBA 3NBPA 2ETJA 4X62K 3JS6A 4BGBA 4CGHA 4BQZA 3O8MA 3MDQA 1EX4A 3A5NC 2QI2A 4LH5A 1X9WA 3AGKA 4C8NA 3ZETA 3P1GA 1LCUA 2UXDK 2H3GX 3FFKB 4HCCA 3RVCA 1BU6O 2V7YA 1KLNA 4CERA 1A5WA 3VEYA 2E8AA 4F2RA 4W5QA 4CZEA 1YT3A 1K9MO 3O9RA 1JL1A 3SCXA 4BQLA 4DSLA 1FKOA 4CEQA 4U67L 4KV8A 4GKKK 4ISEA 4ELUA 3ZSYA 4DF8A 2O8BB 3OYMA 4CHYA 4KHSA 3AVHA 3RMBA 2CGJA 3CCJN 3QDKA 2PYLA 2Z1GA 3MEDA 4YHHK 4I9QA 2VG6A 3VEOA 3WEEB 2GUPA 3MECA 3THYA 4BVPA 3HYFA 3K0SA 2P5OA 2GX9A 4CJ3A 1BUPA 3UKUB 2QWOA 3QNOA 4KHPK 3SNNA 1S72N 1Y64A 4BY9C 5JMVA 2HMPA 1YF5L 3KVGA 4IFEA 2A5XA 4CIEA 3KK7A 3VEWA 1VQON 4GV6A 4GKJK 5DM7L 1JCGA 3VQ5A 3KJVA 1EWQA 4L3QA 1C0FA 2Q97A 3O6WA 4AH9A 1WBBA 4Y0WA 1S9EA 1CZ9A 1VQLN 3WNGA 3AA2A 3RTVA 1U6ZA 1NJZA 1I94K 1GLJO 3D6RA 4A61A 4JRQA 1YIJN 4NLCA 5EXWA 3K5OA 3RRHA 1S3XA 4BR9A 3KLFA 2XY7A 3CM5A 1B9FA 3QICA 4FLWA 3MK6A 3GBTA 1DGKN 1Z05A 3HJFA 1YHQN 4K8XA 4B9MA 1X3MA 1UWBA 3T7ZA 3SQ1A 4OKEA 3ID8A 1C1AA 3ZT1A 2NRTA 4JKFA 3WXLA 4HTUA 1XNRK 3Q7CA 4CEBA 1BOTO 4C1NK 1XI1A 5CYMA 4CE9A 2YX6A 2QK9A 3TAQA 1EP4A 2OPPA 4M7YA 4CIGA 4KH4A 4EIAA 3NGZA 3SBGA 5LY3A 4J2BA 1FW6A 2VQEK 3O4WA 3ZLJA 3AVAA 1KRPA 5KPZA 4HUEA 3AVGA 4FWLA 5J2QA 1W7AA 4JYAK 4DF4A 3SUOA 3CIPA 1RT4A 5AQMA 2YNIA 3VA3A 1S6QA 4DSEA 4A2BA 4BGAA 4JI5K 3EO3A 3K57A 3U4LA 2KFZA 1IKXA 2Q2RA 2IGIA 4C1NI 4YORA 2XY5A 4LSLA 4DR1K 5JLFA 3HP9A 4OKKA 4FJJA 5M1PA 2QKBA 5FRMA 1VQMN 3KK2A 1HNVA 2W40A 4CJ5A 4H4MA 4E0DA 1DLOA 1HNZK 2ZM6K 4DTUA 1TYQB 2ITMA 1NGAA 3LAKA 2IVPA 3QFUA 2IAJA 3C6HA 1YUWA 2YHWA 2P9SB 3GDQA 1T3VA 1W0HA 4JD2B 1H1VA 4XEIA 1NGHA 1GLBG 2OTLN 2VGNA 3AAQA 3HPOA 3JYTA 2YJEA 1DTQA 4FPBA 3VQBA 2FBXA 4M41A 3AGRA 4E1NA 5KPTA 3KWGA 4RCHA 5AQJA 4E1JA 1FKPA 3BDPA 4IOAL 4JEPA 3NF8A 4ILJA 4O0JA 3CJ9A 1BIUA 1QZ5A 4DUZK 4BE0A 3ZT2A 3DLKA 3GOIA 3TABA 1RBUA 3CC7N 3MEEA 3T1YK 3AAPA 3RMCA 3ZSRA 2UUCK 2UXCK 1SAZA 2G8KA 1GLDG 4DU1A 3D45A 4WYBA 3T69A 3DRSA 3LDQA 3NGIA 3A5MC 1YI2N 2GV9A 3A8YA 1VQ5N 4W5RA 4MLEA 3QNNA 2J4RA 1VQKN 2P9IA 3VQEA 1T44A 3D2EA 4BDPA 1QHTA 4DUYK 3M1FA 2HHWA 2ZQBA 3FGUA 3BZCA 1C1CA 3DJCA 3C95A 3MWTA 4FLVA 5AQZA 1TGOA 3OYAA 3CC4N 2P9LB 1J53A 3CETA 5ADXH 4DU3A 1C0GA 3MCAB 3FZFA 2ZJQL 5FPMA 4GW6A 5J1EA 3SPYA 2KTQA 1WBDA 3TTDA 2E2OA 2FSJA 4NCGA 4EAHD 2VG7A 1YTAA 3IDHA 1LV5A 5HROA 3K5MA 1NK6A 4LFCK 2RHKA 2QXFA 3CFRA 4FLXA 4B3RK 1TV6A 1UOCA 4AHSA 1NMDA 3U3YA 1TK0A 4DR2K 5LJWA 3D2FB 3VQ6A 1IG8A 1KVCA 5H1SQ 5EOYA 3NH2A 4Z94A 3RSEA 1UAXA 3AVLA 1EQYA 1NLVA 3AA3A 1ATNA 3MN5A 1EKEA 5ADXA 5AQHA 4DV2K 3F5TA 3MAQA 1G15A 3LDSA 1A5VA 2Q3SA 4K41A 4N5SA 1TUUA 4WQ4A 4YOVA 2FBYA 2F4VK 3O9UA 2HMIA 4KI4A 1HPZA 2F7TA 5AQVA 1ATSA 4YNQA 4EP5A 3ZEUA 1S1UA 4FZZA 1IKWA 3THYB 2HOEA 4JKGB 5JVGL 2PY5A 1OKJA 3FZMA 4IDKA 4DTRA 3LPUA 1Z26A 3EE8A 4B9VA 4YDUA 5C2DA 3CCRN 1S1XA 3TTFA 1NK7A 1MDUB 1MA9B 2HHUA 5BPNA 4XIUA 4DQQA 5FPDA 2GUIA 1VSJA 3DXMB 2OA8A 3AO3A 5JLHA 4DTMA 4KRFA 4CD3A 1RDWX 4CJSA 3CYMA 4FW2A 3SJHA 1XWLA 3RMDA 3V9XA 4DV4K 5SWMA 3RR7A 2O8CB 5LMUK 1U45A 4B9TA 5BPMA 3HPHA 3UKRA 1RNHA 2O8EB 4A62A 3LP2A 1HJRA 3H1QA 3V1OA 3O4NA 5AQSA 3EE9A 4PKHA 3C7NA 3GL1A 4B08A 1RDBA 5AQPA 5AQYA 4Z4EA 5KQDA 1RCHA 5I42A 1GOCA 4WF9L 3QO9A 4AILC 4N76A 2QA4N 4PY5A 3KWIA 2QWMA 4CZHA 4FJXA 3RMAA 3ZX3A 1SS6A 5GIPA 4CBUA 1KTQA 3P31A 1HYZA 3TU5A 3L3VA 4IFVA 1VSMA 4I6MB 4B1XB 3AO5A 4FOIA 3V81A 2O8DB 3OYEA 3PX6A 4DR7K 4JI4K 2V52B 3ATUA 4DLGA 5AQNA 1TL3A 5EU7A 2UU9K 2PAVA 4PA1A 5BN8A 3KLHA 4BWMA 2O4IA 1Z25A 5M1KA 4L8RB 2NLXA 5FPNA 2FBVA 1KLMA 1XHZA 4Z4IA 3QEXA 3M8SA 1C1BA 4HVJA 4FJGA 4B1ZA 5AQTA 1S1TA 1WSGA 3NH0A 3NDKA 4FLUA 3H6EA 4H5TA 1TAQA 3U9DA 3VENA 4FL9A 2E1YA 1DT9A 1L3UA 4QCLA 4CJ7A 3A5LC 4CVNE 4IOXA 3OYIA 3BGRA 5C15A 4ICLA 1KC8O 1JCEA 4Y1DA 2IC3A 2G8WA 4PL8A 4FM2A 3PX4A 4CJWA 3V9SA 4DTSA 3IS9A 3MN9A 3IAYA 3TAGA 1ILYA 5AZJA 1S1WA 1TKDA 3DLEA 3V9ZA 4O55A 4OKJA 4IFYA 2RF2A 2P9UA 4LY7A 3AY9A 4IWVA 2DTUA 2O8FB 4LF4K 1CLQA 3LWMA 2NUBA 4O4GA 4O8UA 3HO1A 4KHWA 4M3YA 2D4WA 3F9KA 1NU0A 3EYZA 4EHUA 4MFBA 4FYDA 4I6MA 3H3OB 3IUCA 3CERA 3E66A 1VRTA 3WNHA 3H3NO 3TAPA 4OPHA 4CGFA 1VHXA 3KKRA 3MXMA 2F8SA 1L5UA 5C0YA 2NRZA 4V19S 1QS4A 2B6AA 4CZKA 4LC9B 2XHBA 2HBMA 3G10A 2IOCA 3I0SA 2OPQA 3DOKA 3OVNA 1NGCA 4FCYA 3QIPA 4DFJA 4KPYA 1HNWK 4M3ZA 4AHVA 3C65A 1HPMA 2NRXA 4DCHA 4H03B 1SQKA 4M3TA 4JD2A 1JLFA 4M3XA 2I7PA 1KXPA 3DLGA 1BI4A 3O3HA 3K58A 1VAZA 4DQRA 2Y1IA 5CHIA 3CQ8A 4KTZA 4FWKA 1Y97A 4CGGA 2KFNA 1YJ9N 1ZBUA 4H5RA 4H5WA 3SPZA 2B5JA 4LF8K 5T7BA 2G8IA 3QBWA 3OYCA 4F3OA 3PIPL 2JLEA 2W6LA 4DTPA 1BCMA 4I2QA 2XY8A 1J5OA 3QESA 4E7KA 4KTQA 1U49A 4HUFA 1RDCA 3I0RA 4J2EA 4RG8A 4CHPA 2OCEA 4CJLA 3SK3A 1M1KO 1RT3A 5IT9O 4BROA 4GMJB 1QQMA 5GAHP 1K6YA 1D8YA 1KFSA 2OTJN 5M1NA 3MN7A 4DQPA 4WE1A 1WSEA 3D7EO 4HTLA 1BCOA 4KFBA 4OPKA 4XH5A 3OW2M 4CW7B 4DSKA 4DR5K 1VQ7N 4OLAA 1D5AA 2JWKA 4H5VA 4DSFA 3BZKA 2FC0A 1BO5O 4MO5A 4DR4K 3AARA 4EFHA 4JKCA 1NKBA 1B92A 4KB1A 2WC9A 4YFUA 4DMNA 3NVMA 4X65K 1V4SA 1QSYA 2F8TA 4EHTA 1E3MA 3HVTA 1E4GT 4FZXC 2VG5A 3ENHA 1JLEA 3VGMA 1NWKA 4JK8A 3C0BA 3V9WA 2EX3A 3TSQA 1NGGA 5ELZA 1SZ2A 3LPTA 1N6QA 4HWIA 1N8RO 1HRHA 4FJIA 5AZIB 3DAWA 2WONA 3AVMA 3NE6A 3L2QA 4WFNL 4CFBA 4LFAK 3OYDA 4LSNA 3RWUA 5CZ2A 1JLBA 4CD1A 3QEWA 4CJ4A 4NCBA 4A57A 2VWKA 4PKGA 2HVHA 4CEEA 2HNDA 3SUPA 3TTCA 4JN4A 3BEXA 3L0QA 3FE1A 3THVA 1HMVA 3E9PA 4CK3A 1YXQA 1U4BA 3J7AP 3L2VA 1Q9XA 3HPGA 2QWQA 5GAEP 3VQ8A 3JSMA 4H0XB 1ZXOA 4CHNA 2VGMA 3P39A 3CCUN 3S9HA 2Q0UA 3LDOA 3JAMO 3U3GA 5GAGP 2HNYA 3EZWA 4C23A 4CJRA 4B9UA 2P51A 3G71N 3SQ0A 1CXQA 4FO0A 4JS5A 3M5RA 4IG3A 3VF4A 3IMXA 5FPEA 4B3OA 3SQ2A 1VSDA 1HKBA 3CJ1A 2YNHA 3J7YP 1IG9A 2NRRA 1QTMA 4B8CA 1ASWA 3C6UA 2BGGA 3LZIA 2I7NA 5K14A 3IRXA 2E1ZA 2EHGA 2AJQA 4DKWA 4H0PA 3MX5A 4FWPA 4OLBA 1HLUA 1P8ZA 2XO7A 3RRGA 4BRFA 1YJNN 4H0VB 3OTOK 5AQLA 1T6CA 4IOCL 2ZD1A 3MN6A 4H8KA 1VSFA 4AQYK 1P90A 2Z1IA 3OHRA 4GNIA 3QINA 3TAEA 3PSFA 1KFDA 4CZGA 2D0AA 4DWIA 2ASPA 4EZ9A 2RN2A 3B6OA 1N5YA 3IG1A 4W5OA 1NJWA 3QBXA 3HTVA 4HHTA 3DRRA 4NLBA 3HM8A 2I5JA 2FSNA 4W5TA 4CJEA 3Q7BA 1KAYA 3D0PA 4BC3A 1GLEG 3BUZB 1W97L 1NKCA 1D9DA 2WFBA 3VTIA 3ZX2A 4OPJA 4FJ9A 1OVYA 3OBYA 3O1WA 2DFHA 1QZ6A 4DSIA 3PLAA 4A5BA 4E7IA 4BRIA 1T6DA 3CM6A 4JKBA 1NGEA 1MWMA 3ZSVA 1XC9A 3H46O 2HNZA 3MX2A 4BVOA 4ZTFA 1IBLK 2Q1NA 4YOUA 5E26A 1OH6A 4CEFA 5BR8K 2GTDA 3KKSA 3WNEA 4B9SA 2O8BA 1OVQA 3HSCA 2HHTA 4CHZA 3KTQA 3PSIA 4FWNA 4FWMA 4FWSA 4RW7A 4FSVA 4DV1K 3O9SA 4CHQA 2PBDA 3LL3A 5AQIA 5LL6Z 1BI4B 4FJ8A 4DV6K 2DFEA 1U04A 1HR0K 2IVNA 3HOTA 5BN9A 1K8AO 3VQ4A 1NK5A 4FPAA 4Z0UA 3L2RA 3CC2N 1HUXA 4PWDA 3HVRA 3VQCA 3WEEA 4DHYA 3ZCMA 3QEVA 4QAGA 3ISNC 2R7YA 3R1XA 1IH7A 4R79A 2OZMA 4JKEA 2P9PB 3OS0A 1Q8IA 4GV3A 4Q0BA 1S9GA 4FK4A 4OO1J 3O80A 2W6KA 1ZBIA 1FK9A 4O44A 2A6AA 2O8DA 3QLHA 3S41A 3DOLA 4M3RA 1SKWA 1Q9YA 5HLFA 2FLOA 2QWRA 3AVKA 3VQPA 5KRTA 1KD1O 4DS4A 5AJ3K 3MEGA 2UXBK 4AHUA 2CGKA 4BR7A 4CBWA 3DXKB 4K25A 2PFUA 3T1HK 4KAZA 4BRAA 3LDNA 1VQPN 3O08A 1FJGK 2E2QA 3ZSZA 5KTQA 5DK5A 1J5EK 2HHSA 3WUHA 5B8HA 3P38A 2YV0X 4O5BA 2E4LA 4OPAA 3M8PA 4JKHA 4K0KK 5AFUA 4OX9K 4RW9A 1WSJA 3I8BA 1QE1A 3SUNA 3T19A 1FXXA 4DLEA 5FDLA 2DFFA 1YJWN 4ZTJA 3KLGA 5FRNA 3PUFA 3PO4A 4FXDA 1XMOK 5I3UA 5IWAK 2Z1JA 2ZF5O 5LMNK 2CH6A 1NGBA 3NCIA 3UB5A 5EVZA 1EWRA 3DLHA 1XNQK 3HP6A 2F9WA 4BRMA 5M1FA 3OYHA 3BF1A 3B6PA 4DR3K 2X74A 3E01A 5BREA 1ATRA 4O5FA 1D9FA 2NZTA 1VQ6N 2YHXA 3VETA 3ZX0A 4KHUA 4DTOA 1NOYA 4BRKA 3PO5A 5TKYA 2GELA 3V9UA 1GLLO 1O13A 2P9SA 1RBTA 1Z6RA 3EKSA 5AQGA 3AVIA 3FZKA 1REVA 1HYSA 3WXIA 1U2VB 3ZETB 5CE3A 2UYTA 4CZFA 2CGLA 4DFMA 4Z4HA 4CFCA 5JICA 1VRUA 1JXEA 1J6ZA 1BHLA 3DRPA 2D0CA 3QFPA 1RBRA 4B1WB 1TKXA 4DS5A 4I2PA 1HQUA 3AO4A 2E88A 3LAMA 2KZMA 4JI3K 2ATQA 3SI6A 5AZJB 1QQCA 3CQYA 4IBNA 3KHYA 3W3DA 4KI6A 1J54A 4BE2A 4B3MK 4KH6A 3LM2A 1JLQA 1JXBA 3OA9A 5M1OA 3KD5E 2P9UB 3GE1A 3SZ2A 1CZAN 2GEMA 4DFPA 1VQNN 3QIOA 5FROA 4IKFA 3S3MA 3ZEUB 4DV7K 4YOWA 1NK9A 1NNEA 4UQGA 4CGDA 3FZLA 4KB0A 3L6QA 1NJXA 3HT3A 3HOSA 2Q36A 1TL1A 1UA0A 2E6LA 2ZJPL 3MMVA 4YY3K 5JS2A 4RW4A 1XQSC 5C10A 2W42A 4QOZB 3EL2A 5AQWA 4RW8A 1IKYA 4CF2A 1MWKA 4WQ5C 4ILHA 4J2AA 2YHAA 3PX0A 5CY4A 4DR6K 3QETA 1RT2A 3KD1E 4CBXA 4I9LA 4JLHA 4JHDA 4FJNA 3KK3A 3EEQA 4BRNA 3J7ZO 2NNWA 1QVGM 3THWB 4B3TK 4DG1A 5CR4A 1IBKK 3LDPA 3TAFA 1QQOA 1WAFA 1SKSA 4CFDA 4C8OA 3E9LA 4JI1K 1NKEA 4ISGA 4MDAA 4LFBK 3V6DA 3LWLA 4KO0A 2X6SA 2V51B 2A3ZA 3LM9A 4FJ5A 1E4FT 3PIOL 2A42A 2Q0RA 3D2FA 4BR4A 5HRRA 3ITHA 2ITGA 1ZBFA 3OS1A 4RWTA 4BREA 1I3AA 5CYQA 5CZ1A 3VPZA 3K5NA 1R0AA 2D1KA 3TI0A 4A5AA 4KKOA 3ZSQA 5EX5A 3J80O 1YITN 1RBSA 1X1PA 3TWHA 5AZIA 1GLFO 5C25A 2HHVA 3H08A 4IJAA 1SL1A 3CFPA 4JKGA 2F9TA 3HL8A 2D0OA 2WBNA 4Y1CA 1EETA 2IIRA 3QB0A 1CZBA 4OJRA
chains in the Genus database with same CATH topology
2VGNA 2A40A 3AAQA 1NGDA 2YJFA 1BA0A 4WFNL 2YJEA 1Q86O 3NVKA 4FPBA 3R8EA 4BG9A 3WXKA 1HJOA 4CD1A 3AGRA 5KPTA 3KWGA 4RCHA 1BG3A 1ZBSA 5AQJA 4PKGA 4A57A 4B1UB 4E1JA 4IOAL 3O9TA 4JAXA 4CZJA 3TTCA 4JEPA 2HSTA 1GLAG 4JN4A 2GWKA 4ILJA 3BEXA 3L0QA 3CJ9A 1Q81O 1QZ5A 3FE1A 5EY4A 2HBLA 2QM1A 2YI1A 3E9PA 3GOIA 3KZBA 1YXQA 3N4QA 3CC7N 3AAPA 3CCEN 2QWQA 5GAEP 1SAZA 3K9KA 4UY8O 3VEXA 1GLDG 4H0XB 1ZXOA 3L4IA 3B8AX 4WYBA 4BRLA 4FVUA 2VGMA 3T69A 3P4IA 3L4QA 3LDQA 3TSPA 3U8XA 3P39A 4ISFA 5DM6L 2Q0UA 3A5MC 3CCUN 5AQUA 1YI2N 3LDOA 3A8YA 1VQ5N 5GAGP 4MLEA 1VQKN 2BUPA 2J4RA 3EZWA 4C23A 2P9IA 3C7NB 4F9OA 3G71N 3RSEB 3MWPA 1T44A 5GIOA 3D2EA 5KQ8A 1GLCG 3CQXA 4FO0A 3ULEB 3M1FA 3FGUA 3M5RA 4M63C 3DJCA 3MWTA 4BRGA 3VF4A 3ULEA 3IMXA 5AQZA 5HOOA 3CC4N 3FLCO 5FPEA 1NJIO 2P9LB 4B1VA 3JXUA 1K8KB 4PHTX 3CETA 1HKBA 2FXUA 3CJ1A 3CF5L 3CCLN 5ADXH 1RGIA 2NRRA 1C0GA 1JJ2M 4JKDA 3MCAB 4PL7A 1NM1A 3FZFA 2ZJRL 2ZJQL 2I7NA 1TUYA 5FPMA 1KAXA 1NGFA 3TTDA 2E2OA 1YVNA 2FSJA 4MDBA 4EAHD 2E1ZA 3IDHA 1BDGA 2VYPA 3C6AA 3CI5A 1QHAA 4YDUC 4DKWA 4H0PA 3MX5A 4FWPA 5AR0A 3VGKA 2QWPA 1HLUA 1P8ZA 2RHKA 3DLLL 4BRFA 1YJNN 2ASOA 3HI0A 1X9JA 3HRGA 1NMDA 3CJBA 3F2KA 4H0VB 4RTFD 5AQLA 4JK9A 1T6CA 3H45C 5M1QA 3I55N 3R9PA 2OANA 3MN6A 4AF1A 4IOCL 1Q7YO 2HBKA 3EN9A 5LJWA 1QQNA 3D2FB 4BR2A 1P90A 1YAGA 1IG8A 4K43A 3VOVA 3OHRA 4GNIA 5H1SQ 2FF3B 5AQFA 3EKUA 5EOYA 3G6EN 3WXJA 1EO1A 2HBJA 4Z94A 3RSEA 2AP1A 1HKCA 4CZGA 4IDHA 1EQYA 3I56N 2ASPA 4WQ4C 1NLVA 4YOXA 5TKWA 1ATNA 3MN5A 3G4SN 2KLAA 3A5OC 4NO7A 2QXLA 5GADP 5ADXA 3CCSN 5AQHA 4WQ5A 3F5TA 4FOEA 3QBXA 3HTVA 4K42A 1W2BM 2DPNA 3DXMA 2QW9A 2KHOA 4H5NA 3VEZA 4NLBA 3HM8A 4K41A 4BR5A 2FSNA 3CMAN 2KKZA 3VEVA 3Q7BA 2P9KA 1TUUA 1KAYA 4WQ4A 4YOVA 2BTFA 5AQKA 3CPWM 3SBTA 4BC3A 3SMPA 1GLEG 3BUZB 3GG4A 5MLCQ 3O9UA 1W97L 4B1YB 3CCMN 2WFBA 3VTIA 1IJJA 3ZX2A 3CPEA 4BRPA 5E84A 2F7TA 4IO9L 4IXCA 1OVYA 3OBYA 5AQVA 3O1WA 1ATSA 2IVOA 1QZ6A 3R6MA 3ZEUA 4QS7A 3R3LA 4J8FA 3PLAA 4A5BA 4QS8A 4BRIA 3CJCA 2HOEA 4CZLA 4JKGB 5JVGL 3IFRA 1T6DA 1OKJA 3FZMA 4JKBA 4BC2A 1NGEA 3CCQN 1MWMA 1U2VA 3EE8A 3H46O 3MX2A 3J8AA 4BVOA 3SAFA 4YDUA 2Q1NA 4YOUA 5E26A 5C2DA 3CCRN 3TTFA 3VTHA 4KBOA 2GTDA 3H1VX 1MDUB 1MA9B 4WFBL 3HBTA 5BPNA 4QS9A 3SMSA 1HKGA 3E1YA 3QMLA 4IO8A 1RFQA 3HSCA 5C12A 5FPDA 3E9OA 4FWNA 4FWMA 4FWSA 4BRDA 2GWJA 4FSVA 2A41A 1VQ8N 4BRHA 2P9IB 2JWLA 3DXMB 5JLHA 4CD3A 1RDWX 3FZHA 3VGLA 3O9SA 4MLHA 3SJHA 2PBDA 3LL3A 5AQIA 1DEJA 1HX1A 3MCPA 1VQ4N 3UKUA 2ZGZA 3BP8A 4G9ZA 2P9LA 1Q82O 5BPMA 2IVNA 3UKRA 5KPRA 1NBWA 4A62A 3HOTA 5BN9A 1K8AO 4U7BA 1NGJA 4WFAL 4FPAA 2QEXN 3CC2N 2E2NA 3H1QA 4BG8A 1HUXA 5AQSA 3D2EB 3W0LA 3EE9A 1S22A 3WEEA 4PKHA 3CJ7A 4DHYA 3C7NA 2WUSA 3GL1A 3O1BA 3CCVN 4DB3A 4BRCA 5AQPA 5AQYA 1BWFO 3VESA 5F0XA 1K73O 5KQDA 4GV9A 2ZGYA 3ZYYX 3R1XA 2YCHA 3HZ6A 4R79A 4JKEA 2FF6A 2P9PB 4CZMA 4WF9L 5I9EB 3SAGA 3O5BA 2QA4N 3KWIA 2QWMA 4CZHA 4GV3A 1NGIA 1XUPO 3UKRB 4BR0A 5C2FA 4OO1J 2RE2A 3O80A 2VCPA 1TYQA 4AM7A 3ZX3A 1SS6A 3UE5A 5GIPA 3VF6A 4CBUA 2NRHA 4JNEA 5AQXA 3P31A 1V4TA 5AQOA 1WOQA 3TU5A 4FWRA 2A6AA 3ENBA 4NB4A 5BRDA 2QWNA 2P9NA 3F9MA 4I6MB 3M3ZA 4B1XB 1LOTB 3S41A 4JKAA 4WCEL 4FOIA 4DQ8A 2FLOA 2VWBA 2V52B 2QWRA 3ATUA 5AQNA 1XC3A 3N4PA 1KD1O 3DXKA 3WXMB 2PAVA 3U9ZA 5BN8A 2CGKA 4BR7A 4CBWA 3DXKB 4K25A 2PFUA 3A0IX 4BRAA 3LDNA 5M1KA 1VQPN 2QTDA 3OBWA 2NLXA 5FPNA 3O08A 4IEIA 2E2QA 1Q18A 5BPLA 4ILGB 4YOYA 3WUHA 5B8HA 2P9NB 3P38A 5AQTA 3JS6A 4OPAA 4B1ZA 4BGBA 4JKHA 3H6EA 4H5TA 3VENA 3O8MA 3MDQA 4IEEA 4FL9A 2E1YA 3U9DA 4BQZA 5AFUA 1DT9A 3A5NC 2QI2A 3I8BA 4CJ7A 1KAZA 3AGKA 3ZETA 3A5LC 1LCUA 2H3GX 1YJWN 1VQ9N 1DKGD 3BF3A 1ZC6A 3FFKB 4IOXA 3RVCA 1BU6O 1D4XA 2V7YA 5C15A 4BC5A 2ZF5O 1KC8O 1JCEA 3VEYA 2CH6A 1NGBA 3UB5A 5EVZA 2E8AA 2F9WA 4PL8A 4BRMA 4CI6A 4FWQA 4CZEA 3MN9A 3M6GA 4A2AA 1KQSM 1ILYA 4KH5A 5M1FA 1K9MO 5AZJA 3BF1A 3O9RA 4BQLA 5BRFA 1WUAA 3SAHA 4U67L 2QWLA 4JHDB 4ISEA 1ATRA 5BREA 4O5FA 2P9UA 2NZTA 3AY9A 3CMEN 2NRWA 4IWVA 1VQ6N 2BH1A 3G25A 2YHXA 3VETA 3ZX0A 4XH1A 2CGJA 1ESVA 4BRKA 3DWLA 5TKYA 3QDKA 2GELA 4B9QA 5LJVA 3CCJN 1GLLO 4O8UA 1G99A 2V7ZA 2E2PA 2HF4A 4A59A 1O13A 2D4WA 5F2RA 2P9SA 3ENOA 3VEOA 3WEEB 4EHUA 1Z6RA 2GUPA 4I6MA 3H3OB 3EKSA 3IUCA 3CERA 3E66A 4BVPA 5AQGA 3FZKA 3I33A 1BA1A 2GX9A 3WXIA 3H3NO 1U2VB 3ZETB 5CE3A 2UYTA 1BUPA 4OPHA 3UKUB 2CGLA 2QWOA 4H0TB 4CZFA 1S72N 1Y64A 5JICA 4BY9C 3ID6A 5JMVA 4YOTA 1J6ZA 2HMPA 5C0YA 1YF5L 3KVGA 2NRZA 4CZKA 4IFEA 4LC9B 2A5XA 2HBMA 3QFPA 4B1WB 3KK7A 3VEWA 1VQON 4FWOA 4GV6A 4M7XA 1NGCA 2E88A 5DM7L 1JCGA 4L3QA 3C65A 1C0FA 1HPMA 3VERA 2NRXA 2Q97A 3K9JA 1SQKA 3O6WA 4H03B 4Y0WA 3SLCA 4DCHA 4O8KA 4JD2A 2P9PA 2I7PA 1QVFM 1KXPA 5AZJB 5F1XA 3WQUA 3CQYA 3LDLA 3KHYA 3W3DA 1VAZA 1VQLN 5CHIA 1U6ZA 4KH6A 1GLJO 1X3NA 3D6RA 3LM2A 4A61A 3OA9A 5M1OA 5AQRA 4IZ9A 2D0PA 2P9UB 1YIJN 3GE1A 4NLCA 2FSKA 3TPQA 1CZAN 5EXWA 4FWKA 2GEMA 1VQNN 5AQQA 3CHWA 3IKMA 3O9QA 4BRQA 1S3XA 3VMFB 1YJ9N 4BR9A 4H5RA 3QICA 4H5WA 3ZEUB 4GY2B 4CZIA 3QBWA 5AFUH 4YOWA 2EWSA 3MK6A 3GBTA 3PIPL 1JCFA 1DGKN 1Z05A 1YHQN 3FZLA 3L6QA 1X3MA 3T7ZA 2Q36A 3HOSA 3ID8A 2ZJPL 4AM6A 3MMVA 3NMUA 2NRVA 2NRTA 4JKFA 5HL7L 3WXLA 3SK3A 2HF3A 1XQSC 5C10A 1M1KO 3EL2A 1RDUA 3Q7CA 5AQWA 1BOTO 3WQTA 4C1NK 1M90O 4H0OA 1MWKA 2AA4A 2YX6A 4WQ5C 4BROA 4ILHA 1QQMA 5GAHP 4PKIA 4H0YB 4MO4A 4CBXA 2OTJN 5M1NA 2P9KB 4M7YA 3CJAA 4JHDA 4KH4A 4EIAA 2ZWHA 5JVHL 3MN7A 3SBGA 5LY3A 4BRNA 3J7ZO 2NNWA 3O4WA 3VF2A 1QVGM 5KPZA 1R59O 3D7EO 4HTLA 5CR4A 3LDPA 4FWLA 1QQOA 3ATVA 3FR0A 4XH5A 3OW2M 3E9LA 3CIPA 1VQ7N 4ISGA 5AQMA 4MDAA 4IJNA 2JWKA 4A2BA 4BGAA 4H5VA 3EO3A 3U4LA 2V51B 2Q2RA 1BO5O 4MO5A 4YORA 3TSUA 4C1NI 2A3ZA 2Q31A 3LM9A 1E4FT 2CH5A 2W41A 5JLFA 3AARA 4EFHA 2A42A 2Q0RA 3D2FA 4JKCA 5M1PA 4BR4A 3PIOL 2WC9A 1K8KA 1VQMN 5BRHA 2ASMA 3NVMA 4JK7A 1V4SA 2W40A 4RWTA 4BREA 4BC4A 3VPZA 4EHTA 2YHYA 2D1KA 1E4GT 5BR9A 4A5AA 3ENHA 3VGMA 2E20A 3CD6N 1NWKA 4JK8A 1TYQB 2ITMA 1NGAA 3C0BA 4GVEA 4XH4A 2IVPA 5EX5A 5GINA 3QFUA 1YITN 3C6HA 3TSQA 1YUWA 3CXCM 1NGGA 2YHWA 2P9SB 3GDQA 1SZ2A 1GLFO 1T3VA 5ELZA 5AZIA 3WT0A 4IJAA 4HWIA 4JKGA 1N8RO 2F9TA 5AZIB 4JD2B 2D0OA 2WBNA 1H1VA 4XEIA 1NGHA 3DAWA 1GLBG 2IIRA 3QB0A 2OTLN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJF A;  2A40 A;  3AAQ A;  1NGD A;  1BA0 A;  2YJE A;  4FPB A;  3R8E A;  4BG9 A;  3WXK A;  1HJO A;  4CD1 A;  5KPT A;  4RCH A;  1BG3 A;  1ZBS A;  5AQJ A;  4PKG A;  4B1U B;  4E1J A;  4JAX A;  4CZJ A;  1GLA G;  4JN4 A;  2GWK A;  3BEX A;  3L0Q A;  3CJ9 A;  1QZ5 A;  3FE1 A;  5EY4 A;  2QM1 A;  2YI1 A;  3GOI A;  3KZB A;  1YXQ A;  3AAP A;  2QWQ A;  1SAZ A;  3VEX A;  1GLD G;  4H0X B;  1ZXO A;  3L4I A;  3B8A X;  4WYB A;  4BRL A;  3U8X A;  3P4I A;  3LDQ A;  4ISF A;  2Q0U A;  3A5M C;  5AQU A;  3LDO A;  3A8Y A;  4MLE A;  2BUP A;  2J4R A;  3EZW A;  4C23 A;  2P9I A;  3C7N B;  4F9O A;  3RSE B;  1T44 A;  3D2E A;  5KQ8 A;  1GLC G;  3CQX A;  4FO0 A;  3ULE B;  3M1F A;  3FGU A;  4M63 C;  3DJC A;  4BRG A;  3VF4 A;  3ULE A;  3IMX A;  5AQZ A;  3FLC O;  5FPE A;  2P9L B;  4B1V A;  3JXU A;  1K8K B;  3CET A;  1HKB A;  2FXU A;  3CJ1 A;  5ADX H;  1RGI A;  1C0G A;  4PL7 A;  1NM1 A;  3FZF A;  2I7N A;  1TUY A;  5FPM A;  1KAX A;  1NGF A;  2E2O A;  1YVN A;  2FSJ A;  4EAH D;  2E1Z A;  3IDH A;  1BDG A;  2VYP A;  3CI5 A;  1QHA A;  4YDU C;  4H0P A;  4FWP A;  5AR0 A;  3VGK A;  2QWP A;  1HLU A;  1P8Z A;  4BRF A;  2ASO A;  3HI0 A;  1X9J A;  1NMD A;  3CJB A;  4H0V B;  5AQL A;  4RTF D;  1T6C A;  3H45 C;  3R9P A;  2OAN A;  3MN6 A;  3EN9 A;  5LJW A;  1QQN A;  3D2F B;  4BR2 A;  1YAG A;  1IG8 A;  4K43 A;  3VOV A;  3OHR A;  4GNI A;  2FF3 B;  5AQF A;  3EKU A;  5EOY A;  3WXJ A;  4Z94 A;  3RSE A;  2AP1 A;  1HKC A;  4CZG A;  1EQY A;  2ASP A;  4WQ4 C;  1NLV A;  1ATN A;  3MN5 A;  4NO7 A;  3A5O C;  2QXL A;  5ADX A;  5AQH A;  4WQ5 A;  4FOE A;  3QBX A;  3HTV A;  4K42 A;  2DPN A;  3DXM A;  2QW9 A;  2KHO A;  4H5N A;  3VEZ A;  3HM8 A;  4K41 A;  4BR5 A;  2FSN A;  3VEV A;  2P9K A;  1TUU A;  1KAY A;  4WQ4 A;  2BTF A;  5AQK A;  4BC3 A;  3SMP A;  1GLE G;  3BUZ B;  3GG4 A;  4B1Y B;  1IJJ A;  3ZX2 A;  4BRP A;  5E84 A;  4IXC A;  5AQV A;  3O1W A;  1ATS A;  2IVO A;  1QZ6 A;  3R6M A;  3ZEU A;  4QS7 A;  4J8F A;  4QS8 A;  4BRI A;  3CJC A;  2HOE A;  4CZL A;  3IFR A;  1T6D A;  1OKJ A;  3FZM A;  4BC2 A;  1NGE A;  1MWM A;  1U2V A;  3H46 O;  3J8A A;  4BVO A;  4YDU A;  2Q1N A;  5E26 A;  4KBO A;  2GTD A;  3H1V X;  1MDU B;  1MA9 B;  3HBT A;  5BPN A;  4QS9 A;  3SMS A;  1HKG A;  3QML A;  4IO8 A;  1RFQ A;  3HSC A;  5FPD A;  4FWN A;  4FWM A;  4FWS A;  4BRD A;  2GWJ A;  4FSV A;  2A41 A;  4BRH A;  2P9I B;  3DXM B;  5JLH A;  4CD3 A;  1RDW X;  3FZH A;  3VGL A;  4MLH A;  3SJH A;  2PBD A;  3LL3 A;  5AQI A;  1DEJ A;  1HX1 A;  3MCP A;  3UKU A;  2ZGZ A;  3BP8 A;  2P9L A;  5BPM A;  2IVN A;  3UKR A;  5KPR A;  1NBW A;  4A62 A;  5BN9 A;  1NGJ A;  4FPA A;  2E2N A;  3H1Q A;  4BG8 A;  1HUX A;  5AQS A;  3D2E B;  3W0L A;  1S22 A;  3WEE A;  4PKH A;  3CJ7 A;  4DHY A;  3C7N A;  2WUS A;  3GL1 A;  3O1B A;  4DB3 A;  4BRC A;  5AQP A;  5AQY A;  1BWF O;  3VES A;  5F0X A;  5KQD A;  2ZGY A;  2YCH A;  3HZ6 A;  2FF6 A;  2P9P B;  4CZM A;  5I9E B;  3O5B A;  2QWM A;  4CZH A;  1NGI A;  1XUP O;  3UKR B;  4BR0 A;  3O80 A;  2VCP A;  1TYQ A;  4AM7 A;  3ZX3 A;  3UE5 A;  3VF6 A;  4CBU A;  2NRH A;  4JNE A;  5AQX A;  1V4T A;  5AQO A;  1WOQ A;  3TU5 A;  4FWR A;  2A6A A;  4NB4 A;  5BRD A;  2QWN A;  2P9N A;  3F9M A;  4I6M B;  3M3Z A;  4B1X B;  1LOT B;  3S41 A;  4FOI A;  4DQ8 A;  2FLO A;  2VWB A;  2V52 B;  2QWR A;  3ATU A;  5AQN A;  1XC3 A;  3DXK A;  2PAV A;  3U9Z A;  5BN8 A;  2CGK A;  4BR7 A;  4CBW A;  3DXK B;  4K25 A;  3A0I X;  4BRA A;  3LDN A;  2NLX A;  5FPN A;  3O08 A;  2E2Q A;  1Q18 A;  5BPL A;  3WUH A;  5B8H A;  2P9N B;  5AQT A;  3JS6 A;  4B1Z A;  4BGB A;  3H6E A;  4H5T A;  3VEN A;  3O8M A;  3MDQ A;  3U9D A;  4FL9 A;  2E1Y A;  4BQZ A;  5AFU A;  3A5N C;  3I8B A;  4CJ7 A;  1KAZ A;  3ZET A;  3A5L C;  1LCU A;  2H3G X;  1DKG D;  3BF3 A;  1ZC6 A;  3FFK B;  1BU6 O;  1D4X A;  2V7Y A;  4BC5 A;  2ZF5 O;  1JCE A;  3VEY A;  2CH6 A;  1NGB A;  3UB5 A;  5EVZ A;  2E8A A;  2F9W A;  4PL8 A;  4BRM A;  4CI6 A;  4FWQ A;  4CZE A;  3MN9 A;  3M6G A;  4A2A A;  5AZJ A;  3BF1 A;  4BQL A;  5BRF A;  1WUA A;  2QWL A;  4JHD B;  4ISE A;  1ATR A;  5BRE A;  4O5F A;  2P9U A;  2NZT A;  3AY9 A;  4IWV A;  3G25 A;  2YHX A;  3VET A;  3ZX0 A;  4XH1 A;  2CGJ A;  1ESV A;  4BRK A;  3DWL A;  5TKY A;  3QDK A;  2GEL A;  4B9Q A;  5LJV A;  1GLL O;  1G99 A;  2V7Z A;  2E2P A;  2HF4 A;  2D4W A;  5F2R A;  2P9S A;  3ENO A;  3VEO A;  3WEE B;  4EHU A;  1Z6R A;  2GUP A;  4I6M A;  3H3O B;  3EKS A;  3IUC A;  3CER A;  4BVP A;  5AQG A;  3FZK A;  3I33 A;  1BA1 A;  3WXI A;  3H3N O;  1U2V B;  3ZET B;  5CE3 A;  2UYT A;  1BUP A;  3UKU B;  4CZF A;  2CGL A;  2QWO A;  4H0T B;  1Y64 A;  5JIC A;  5JMV A;  1J6Z A;  2HMP A;  3KVG A;  4CZK A;  4LC9 B;  2A5X A;  3QFP A;  4B1W B;  3VEW A;  4FWO A;  4M7X A;  1NGC A;  2E88 A;  1JCG A;  4L3Q A;  1C0F A;  1HPM A;  3VER A;  2Q97 A;  3O6W A;  4H03 B;  1SQK A;  4DCH A;  4Y0W A;  3SLC A;  4O8K A;  4JD2 A;  2P9P A;  2I7P A;  1KXP A;  5AZJ B;  5F1X A;  3WQU A;  3CQY A;  3LDL A;  3KHY A;  3W3D A;  1U6Z A;  1GLJ O;  1X3N A;  3LM2 A;  4A61 A;  5AQR A;  4IZ9 A;  2D0P A;  2P9U B;  3GE1 A;  2FSK A;  3TPQ A;  1CZA N;  5EXW A;  4FWK A;  2GEM A;  5AQQ A;  3CHW A;  4BRQ A;  1S3X A;  4BR9 A;  4H5R A;  3QIC A;  4H5W A;  3ZEU B;  4GY2 B;  4CZI A;  3QBW A;  5AFU H;  2EWS A;  3MK6 A;  3GBT A;  1JCF A;  1DGK N;  1Z05 A;  3FZL A;  3L6Q A;  1X3M A;  2Q36 A;  3ID8 A;  4AM6 A;  3MMV A;  3WXL A;  3SK3 A;  2HF3 A;  1XQS C;  3EL2 A;  5AQW A;  1BOT O;  3WQT A;  4H0O A;  1MWK A;  2AA4 A;  4WQ5 C;  4BRO A;  1QQM A;  4PKI A;  4H0Y B;  4MO4 A;  4CBX A;  2P9K B;  4M7Y A;  3CJA A;  4JHD A;  4EIA A;  2ZWH A;  3MN7 A;  5LY3 A;  4BRN A;  3O4W A;  3VF2 A;  5KPZ A;  1R59 O;  3D7E O;  4HTL A;  3LDP A;  4FWL A;  1QQO A;  3ATV A;  3FR0 A;  4XH5 A;  3CIP A;  4ISG A;  5AQM A;  4IJN A;  4A2B A;  4BGA A;  4H5V A;  3EO3 A;  3U4L A;  2V51 B;  2Q2R A;  1BO5 O;  4MO5 A;  2A3Z A;  2Q31 A;  3LM9 A;  1E4F T;  2CH5 A;  2W41 A;  5JLF A;  3AAR A;  4EFH A;  2A42 A;  2Q0R A;  3D2F A;  4BR4 A;  1K8K A;  5BRH A;  2ASM A;  1V4S A;  2W40 A;  4RWT A;  4BRE A;  4BC4 A;  3VPZ A;  4EHT A;  2YHY A;  2D1K A;  1E4G T;  5BR9 A;  3ENH A;  3VGM A;  2E20 A;  1NWK A;  1TYQ B;  2ITM A;  1NGA A;  3C0B A;  4XH4 A;  2IVP A;  5EX5 A;  3QFU A;  1YUW A;  1NGG A;  2YHW A;  2P9S B;  3GDQ A;  1SZ2 A;  1GLF O;  5ELZ A;  5AZI A;  3WT0 A;  4IJA A;  4HWI A;  2F9T A;  5AZI B;  4JD2 B;  2D0O A;  1H1V A;  4XEI A;  1NGH A;  3DAW A;  1GLB G;  2IIR A;  3QB0 A; 
#chains in the Genus database with same CATH topology
 2A40 A;  3NVK A;  1NGD A;  5J2P A;  1BA0 A;  4CK1 A;  1Q86 O;  1RTJ A;  2YNF A;  4X64 K;  3R8E A;  4CEA A;  4CGJ A;  5KI6 A;  4C8L A;  3WXK A;  2ZE2 A;  1HJO A;  3DYA A;  1NJY A;  3EY1 A;  2JGU A;  1BG3 A;  1ZBS A;  2XRI A;  4B1U B;  3HM9 A;  2PZS A;  3O9T A;  4JAX A;  4ELT A;  4NXN K;  2GWK A;  1Q81 O;  4HUG A;  2HBL A;  2YI1 A;  1N33 K;  1VSI A;  3CCE N;  3AVJ A;  3K9K A;  1SL0 A;  3G0Z A;  3VEX A;  4UY8 O;  2O8C A;  4FVU A;  3B8A X;  4BRL A;  4MQ3 A;  1N36 K;  4H4O A;  3U8X A;  3P4I A;  1OH5 A;  4ISF A;  4FLT A;  4W5N A;  2O8E A;  1QSS A;  4CJV A;  3TAR A;  4AHR A;  4F9O A;  3RSE B;  5GIO A;  4FLZ A;  3O3G A;  5J2N A;  2WTU A;  1GLC G;  3CQX A;  3EZ5 A;  4OGE A;  4DTJ A;  4FJ7 A;  3RR8 A;  3SJJ A;  3ULE A;  3SV4 A;  1KVA A;  1NOZ A;  1N32 K;  4B1V A;  3JXU A;  4PHT X;  1RTH A;  1ZBL A;  2FXU A;  4DTN A;  1JJ2 M;  3THX A;  4JKD A;  3VQQ A;  4LF9 K;  2OPS A;  2ZJR L;  1T7P A;  1KAX A;  3V1Q A;  4JI2 K;  3OYK A;  1YVN A;  3FFI A;  4MDB A;  1GOB A;  1OH8 A;  5C42 A;  1BDG A;  2VYP A;  5HRN A;  2G8V A;  3C6A A;  1QHA A;  3CFO A;  3C94 A;  3DLL L;  1NG9 A;  1LAW A;  3OY9 A;  1X9J A;  3HRG A;  3CJB A;  3I55 N;  5M1Q A;  4RTF D;  3OYG A;  3R9P A;  2HBK A;  1QQN A;  4BR2 A;  4C8M A;  3LZJ A;  1YAG A;  4GVM A;  1IO2 A;  5J2M A;  2FF3 B;  3LP0 A;  3WXJ A;  1S5J A;  1HKC A;  2A1R A;  3I56 N;  4OVL A;  3VQD A;  5E41 A;  4FW1 A;  5TKW A;  3G4S N;  2KLA A;  3A5O C;  3P83 D;  2QXL A;  1JLA A;  3HXM A;  4WQ5 A;  4RW6 A;  2DPN A;  3DXM A;  2QW9 A;  2LSN A;  2KHO A;  4H5N A;  4BR5 A;  3CMA N;  1SKR A;  2P9K A;  1WLJ A;  5AQK A;  3SBT A;  3SMP A;  5MLC Q;  3GG4 A;  3CCM N;  3HK2 A;  4B1Y B;  3TR8 A;  1IJJ A;  3CPE A;  1GOA A;  4ID1 A;  2IVO A;  2RPI A;  5FLX O;  4E89 A;  3R3L A;  4J8F A;  2VWJ A;  4QS8 A;  2YKM A;  3CJC A;  3ZT0 A;  4CZL A;  3IFR A;  3CCQ N;  4CJP A;  1U2V A;  3NFA A;  3J8A A;  1BGX T;  4CJQ A;  4M3W A;  3VTH A;  4KBO A;  3H1V X;  3M8R A;  1C0M A;  4Z4F A;  4JI6 K;  2D0B A;  3O4Q A;  3HBT A;  4WFB L;  1HKG A;  3E9O A;  3NF6 A;  4BWJ A;  2A41 A;  1VQ8 N;  1DTT A;  2P9I B;  5HRP A;  4DTX A;  4DV0 K;  4EP4 A;  2QKK A;  1DEJ A;  4CEC A;  3UKU A;  4DSJ A;  2ZGZ A;  3BP8 A;  4G9Z A;  1U48 A;  4K8Z A;  2O8F A;  2P9L A;  1Q82 O;  4CCH A;  1NBW A;  1JLG A;  4U7B A;  4JI7 K;  2YKN A;  4WFA L;  4AHT A;  2QEX N;  2E2N A;  4BG8 A;  3OYJ A;  3W0L A;  3D2E B;  4G1Q A;  1S22 A;  3F73 A;  3CJ7 A;  4LH4 A;  1JKH A;  2WUS A;  2G8H A;  3A2F A;  3QER A;  1BWF O;  1K73 O;  3ZSO A;  4M42 A;  1N34 K;  3HZ6 A;  3P5J A;  2FF6 A;  3NAE A;  4CZM A;  1BL3 A;  5I9E B;  3SAG A;  1LW2 A;  3O5B A;  1QSL A;  2PYJ A;  2HB5 A;  1TYQ A;  3UE5 A;  3VF6 A;  2DY4 A;  1WNS A;  4JNE A;  5AQX A;  1V4T A;  1WOQ A;  3SV3 A;  4HCB A;  3ENB A;  4NB4 A;  2QWN A;  3F9M A;  3M3Z A;  4JS4 A;  4CGI A;  1LOT B;  3DLR A;  1RDA A;  1NK0 A;  4DQ8 A;  1JL2 A;  3K2P A;  1C6V A;  1XC3 A;  3N4P A;  4FLY A;  3DXK A;  4NCA A;  3AA5 X;  4E19 A;  3WXM B;  1BIZ A;  3A0I X;  1RT5 A;  2XY6 A;  4KHQ A;  2UUA K;  1L3T A;  3OBW A;  4FZY A;  3AVC A;  3CG7 A;  4B9L A;  4M3U A;  4IEI A;  1Q18 A;  5BPL A;  4ILG B;  4BDY A;  4YOY A;  1ZBH A;  2P9N B;  2E5L K;  4NXM K;  1NK4 A;  1NMN A;  4IEE A;  1ZYQ A;  1JLC A;  5HP1 A;  4DQI A;  1KAZ A;  2KQ2 A;  3ZT3 A;  2BDP A;  4F3T A;  1LWF A;  1VQ9 N;  1DKG D;  3BF3 A;  2Y1J A;  1T05 A;  1ZC6 A;  4E7L A;  1D4X A;  1TK5 A;  3K59 A;  4BC5 A;  4KHN A;  1RT1 A;  3KIO A;  3DMJ A;  2D5R A;  3NH1 A;  3QEP A;  4CI6 A;  4DFK A;  4FWQ A;  3VN5 A;  3M6G A;  3AV9 A;  4A2A A;  1KQS M;  4KH5 A;  4E7J A;  1MU2 A;  2VQF K;  5BRF A;  1WUA A;  3SAH A;  3SUQ A;  3ASM A;  2QWL A;  4JHD B;  3UIQ A;  3CME N;  2NRW A;  2BH1 A;  3G25 A;  1YTU A;  4XH1 A;  1ESV A;  1XHX A;  3LP3 A;  4E1M A;  3DWL A;  4B9Q A;  5LJV A;  4EZ6 A;  1RT7 A;  1G99 A;  2V7Z A;  2E2P A;  2HF4 A;  3L2U A;  4A59 A;  5F2R A;  3ENO A;  2KW4 A;  4FJK A;  3I33 A;  1BA1 A;  4B3S K;  4H0T B;  1C0T A;  3ID6 A;  4YOT A;  4FK0 A;  2KZZ A;  1SUQ A;  4B9N A;  5DMR A;  4ZHR A;  2WOM A;  4FWO A;  4M7X A;  1B9D A;  1CXU A;  1KVB A;  4TSX A;  3VER A;  4KRE A;  3K9J A;  3SLC A;  4O8K A;  4J2D A;  2P9P A;  1QVF M;  3TAN A;  4FJH A;  5F1X A;  3WQU A;  3LDL A;  1VSK A;  1NK8 A;  1L3V A;  1X3N A;  5AQR A;  4O0I A;  4IZ9 A;  2D0P A;  2FSK A;  3TPQ A;  3S3O A;  5AQQ A;  4CJU A;  3CHW A;  3IKM A;  3O9Q A;  4BRQ A;  3VMF B;  3T3F A;  3LAN A;  3QEI A;  2OYQ A;  4GY2 B;  4CHO A;  4CZI A;  5D3G A;  3DLB A;  1ITG A;  3KK1 A;  5AFU H;  2EWS A;  1X9M A;  2O4G A;  1JCF A;  4FK2 A;  3OS2 A;  1IKV A;  3VQ7 A;  3AA4 A;  1C0U A;  1HNI A;  1IBM K;  3KLI A;  1BIS A;  4AM6 A;  3NMU A;  2NRV A;  5HL7 L;  1HYV A;  2HF3 A;  4N41 A;  1RDU A;  3WQT A;  4CK2 A;  1M90 O;  4H0O A;  2AA4 A;  2HHQ A;  4FJM A;  4PKI A;  4H0Y B;  4MO4 A;  1WB9 A;  2P9K B;  3CJA A;  5JVH L;  2ZWH A;  1BQM A;  1EXQ A;  4ID5 A;  1LW0 A;  3T1A A;  3OYN A;  5C24 A;  5HBM A;  3VF2 A;  5KGW A;  1R59 O;  2P1J A;  3ATV A;  3FR0 A;  2RKI A;  3KLE A;  3AO2 A;  4IJN A;  1RT6 A;  1RDD A;  5HRS A;  4NYN A;  4CF0 A;  4BE1 A;  3OYF A;  3TSU A;  2Q31 A;  2CH5 A;  2W41 A;  3MXJ A;  3S3N A;  1S6P A;  1K8K A;  5BRH A;  2ASM A;  4DU4 A;  1SL2 A;  4JK7 A;  1W9H A;  2HVI A;  2OZS A;  4BC4 A;  2YHY A;  4R5P A;  5BR9 A;  4F2S A;  2E20 A;  3CD6 N;  4GVE A;  4BDZ A;  4LF6 K;  4XH4 A;  5GIN A;  3CXC M;  3AVB A;  3HST B;  4JI8 K;  1VSE A;  3WT0 A;  1HQE A;  3K5L A;  1WSF A;  4KTW A;  3J81 O;  2YJF A;  1WSI A;  3ULD A;  4BG9 A;  1T03 A;  2IS3 A;  4KHY A;  1XMQ K;  3M8Q A;  4CZJ A;  2HST A;  1GLA G;  3C6T A;  4IG0 A;  4DV3 K;  1RTI A;  2HW3 A;  3SQ4 A;  5EY4 A;  1U47 A;  1VSL A;  2QM1 A;  3KZB A;  3N4Q A;  3L4I A;  3LAL A;  5DM6 L;  4F8R A;  3L4Q A;  3TSP A;  3THX B;  5AQU A;  4AHC A;  4CEO A;  3L3U A;  1LAV A;  2BUP A;  4CF9 A;  4X66 K;  3NF9 A;  2YNG A;  4FM0 A;  3C7N B;  4CJK A;  3MWP A;  5A2Q O;  1LWE A;  1X9S A;  5KQ8 A;  3NHG A;  3ULE B;  2X78 A;  2E6M A;  1A5X A;  4M63 C;  4BRG A;  5HOO A;  3FLC O;  1NJI O;  4CEZ A;  1K8K B;  3CF5 L;  1F21 A;  3CCL N;  1RGI A;  2Z1H A;  3OYL A;  3O3F A;  3NF7 A;  2IDO A;  4PL7 A;  1NM1 A;  4JI0 K;  1TUY A;  2G8F A;  1NGF A;  2FBT A;  1L3S A;  1BQN A;  3VQ9 A;  5KGX A;  3CI5 A;  4YDU C;  4LF7 K;  4FJL A;  1TAU A;  5AR0 A;  3VGK A;  2QWP A;  1WAJ A;  3L8B A;  2ASO A;  3HI0 A;  1I39 A;  3VQA A;  3F2K A;  4JK9 A;  3H45 C;  3OJS A;  3PV8 A;  3PY8 A;  4AF1 A;  2OAN A;  3NGY A;  4CED A;  1Q7Y O;  3EN9 A;  3VOV A;  4K43 A;  4M45 A;  5KRS A;  4E7H A;  5AQF A;  3EKU A;  3G6E N;  1IV0 A;  1EO1 A;  2HBJ A;  1UA1 A;  3DI6 A;  2AP1 A;  2HHX A;  1KSP A;  4FVM A;  4OGC A;  4IDH A;  4WQ4 C;  4YOX A;  1OH7 A;  4NO7 A;  5GAD P;  3CCS N;  1WN7 A;  4FOE A;  4K42 A;  1W2B M;  1VSH A;  3THW A;  3VEZ A;  4LF5 K;  2P5G A;  2KKZ A;  3VEV A;  3LP1 A;  4C8K A;  2BTF A;  3CPW M;  4I7F A;  2GBZ A;  4E3S A;  4CJF A;  4BRP A;  3SYZ A;  5E84 A;  4IO9 L;  4IXC A;  2X6N A;  1TK8 A;  4CF1 A;  4FM1 A;  3R6M A;  4QS7 A;  3ALY A;  4BAC A;  3V4I A;  4CIF A;  1VK0 A;  3BY5 A;  3AO1 A;  4BC2 A;  3OYB A;  3SAF A;  3U6F A;  3MXI A;  3DM2 A;  1SV5 A;  4PUO A;  4QS9 A;  3SMS A;  3E1Y A;  3QML A;  4IO8 A;  1RFQ A;  5C12 A;  4DV5 K;  4BRD A;  2GWJ A;  4BRH A;  5JS1 A;  2JWL A;  1O1W A;  3FZH A;  4MLH A;  3VGL A;  1HX1 A;  3MCP A;  1VQ4 N;  2BAN A;  4Q5V A;  5SZT A;  3WNF A;  4B8A B;  4N56 A;  5KPR A;  1LWC A;  1NGJ A;  2OPR A;  3ZSX A;  2F96 A;  4JV5 K;  4Z4C A;  4LD0 A;  4ELV A;  3O1B A;  3CCV N;  2A1S A;  4DB3 A;  1KCF A;  4BRC A;  3VA0 A;  3VES A;  5F0X A;  4GV9 A;  4PQU A;  2ZGY A;  3ZYY X;  2YCH A;  4NYF A;  4N47 A;  1T8E A;  3OJU A;  1S1V A;  3AVN A;  1NGI A;  1XUP O;  3UKR B;  3ZT4 A;  4BR0 A;  5C2F A;  2RE2 A;  2VCP A;  4AM7 A;  1TKT A;  4Z4G A;  1ASV A;  3TAM A;  2NRH A;  1WSH A;  5AQO A;  1TVR A;  4FWR A;  3ZSW A;  4CES A;  4CF8 A;  3V1R A;  5BRD A;  2P9N A;  1RBV A;  3L2W A;  3I8D A;  1J9A A;  4JKA A;  4WCE L;  1YVU A;  2G8U A;  2VWB A;  3AVF A;  1ASU A;  1RIL A;  4CFA A;  3U9Z A;  2UUB K;  2QTD A;  4CJT A;  2HHH K;  2B4J A;  1RTD A;  2BE2 A;  1HNX K;  4F4K A;  4DQS A;  1TKZ A;  4JRP A;  2YHB A;  3NBP A;  2ETJ A;  4X62 K;  3JS6 A;  4BGB A;  4CGH A;  4BQZ A;  3O8M A;  3MDQ A;  1EX4 A;  3A5N C;  2QI2 A;  4LH5 A;  1X9W A;  3AGK A;  4C8N A;  3ZET A;  3P1G A;  1LCU A;  2UXD K;  2H3G X;  3FFK B;  4HCC A;  3RVC A;  1BU6 O;  2V7Y A;  1KLN A;  4CER A;  1A5W A;  3VEY A;  2E8A A;  4F2R A;  4W5Q A;  4CZE A;  1YT3 A;  1K9M O;  3O9R A;  1JL1 A;  3SCX A;  4BQL A;  4DSL A;  1FKO A;  4CEQ A;  4U67 L;  4KV8 A;  4GKK K;  4ISE A;  4ELU A;  3ZSY A;  4DF8 A;  2O8B B;  3OYM A;  4CHY A;  4KHS A;  3AVH A;  3RMB A;  2CGJ A;  3CCJ N;  3QDK A;  2PYL A;  2Z1G A;  3MED A;  4YHH K;  4I9Q A;  2VG6 A;  3VEO A;  3WEE B;  2GUP A;  3MEC A;  3THY A;  4BVP A;  3HYF A;  3K0S A;  2P5O A;  2GX9 A;  4CJ3 A;  1BUP A;  3UKU B;  2QWO A;  3QNO A;  4KHP K;  3SNN A;  1S72 N;  1Y64 A;  4BY9 C;  5JMV A;  2HMP A;  1YF5 L;  3KVG A;  4IFE A;  2A5X A;  4CIE A;  3KK7 A;  3VEW A;  1VQO N;  4GV6 A;  4GKJ K;  5DM7 L;  1JCG A;  3VQ5 A;  3KJV A;  1EWQ A;  4L3Q A;  1C0F A;  2Q97 A;  3O6W A;  4AH9 A;  1WBB A;  4Y0W A;  1S9E A;  1CZ9 A;  1VQL N;  3WNG A;  3AA2 A;  3RTV A;  1U6Z A;  1NJZ A;  1I94 K;  1GLJ O;  3D6R A;  4A61 A;  4JRQ A;  1YIJ N;  4NLC A;  5EXW A;  3K5O A;  3RRH A;  1S3X A;  4BR9 A;  3KLF A;  2XY7 A;  3CM5 A;  1B9F A;  3QIC A;  4FLW A;  3MK6 A;  3GBT A;  1DGK N;  1Z05 A;  3HJF A;  1YHQ N;  4K8X A;  4B9M A;  1X3M A;  1UWB A;  3T7Z A;  3SQ1 A;  4OKE A;  3ID8 A;  1C1A A;  3ZT1 A;  2NRT A;  4JKF A;  3WXL A;  4HTU A;  1XNR K;  3Q7C A;  4CEB A;  1BOT O;  4C1N K;  1XI1 A;  5CYM A;  4CE9 A;  2YX6 A;  2QK9 A;  3TAQ A;  1EP4 A;  2OPP A;  4M7Y A;  4CIG A;  4KH4 A;  4EIA A;  3NGZ A;  3SBG A;  5LY3 A;  4J2B A;  1FW6 A;  2VQE K;  3O4W A;  3ZLJ A;  3AVA A;  1KRP A;  5KPZ A;  4HUE A;  3AVG A;  4FWL A;  5J2Q A;  1W7A A;  4JYA K;  4DF4 A;  3SUO A;  3CIP A;  1RT4 A;  5AQM A;  2YNI A;  3VA3 A;  1S6Q A;  4DSE A;  4A2B A;  4BGA A;  4JI5 K;  3EO3 A;  3K57 A;  3U4L A;  2KFZ A;  1IKX A;  2Q2R A;  2IGI A;  4C1N I;  4YOR A;  2XY5 A;  4LSL A;  4DR1 K;  5JLF A;  3HP9 A;  4OKK A;  4FJJ A;  5M1P A;  2QKB A;  5FRM A;  1VQM N;  3KK2 A;  1HNV A;  2W40 A;  4CJ5 A;  4H4M A;  4E0D A;  1DLO A;  1HNZ K;  2ZM6 K;  4DTU A;  1TYQ B;  2ITM A;  1NGA A;  3LAK A;  2IVP A;  3QFU A;  2IAJ A;  3C6H A;  1YUW A;  2YHW A;  2P9S B;  3GDQ A;  1T3V A;  1W0H A;  4JD2 B;  1H1V A;  4XEI A;  1NGH A;  1GLB G;  2OTL N;  2VGN A;  3AAQ A;  3HPO A;  3JYT A;  2YJE A;  1DTQ A;  4FPB A;  3VQB A;  2FBX A;  4M41 A;  3AGR A;  4E1N A;  5KPT A;  3KWG A;  4RCH A;  5AQJ A;  4E1J A;  1FKP A;  3BDP A;  4IOA L;  4JEP A;  3NF8 A;  4ILJ A;  4O0J A;  3CJ9 A;  1BIU A;  1QZ5 A;  4DUZ K;  4BE0 A;  3ZT2 A;  3DLK A;  3GOI A;  3TAB A;  1RBU A;  3CC7 N;  3MEE A;  3T1Y K;  3AAP A;  3RMC A;  3ZSR A;  2UUC K;  2UXC K;  1SAZ A;  2G8K A;  1GLD G;  4DU1 A;  3D45 A;  4WYB A;  3T69 A;  3DRS A;  3LDQ A;  3NGI A;  3A5M C;  1YI2 N;  2GV9 A;  3A8Y A;  1VQ5 N;  4W5R A;  4MLE A;  3QNN A;  2J4R A;  1VQK N;  2P9I A;  3VQE A;  1T44 A;  3D2E A;  4BDP A;  1QHT A;  4DUY K;  3M1F A;  2HHW A;  2ZQB A;  3FGU A;  3BZC A;  1C1C A;  3DJC A;  3C95 A;  3MWT A;  4FLV A;  5AQZ A;  1TGO A;  3OYA A;  3CC4 N;  2P9L B;  1J53 A;  3CET A;  5ADX H;  4DU3 A;  1C0G A;  3MCA B;  3FZF A;  2ZJQ L;  5FPM A;  4GW6 A;  5J1E A;  3SPY A;  2KTQ A;  1WBD A;  3TTD A;  2E2O A;  2FSJ A;  4NCG A;  4EAH D;  2VG7 A;  1YTA A;  3IDH A;  1LV5 A;  5HRO A;  3K5M A;  1NK6 A;  4LFC K;  2RHK A;  2QXF A;  3CFR A;  4FLX A;  4B3R K;  1TV6 A;  1UOC A;  4AHS A;  1NMD A;  3U3Y A;  1TK0 A;  4DR2 K;  5LJW A;  3D2F B;  3VQ6 A;  1IG8 A;  1KVC A;  5H1S Q;  5EOY A;  3NH2 A;  4Z94 A;  3RSE A;  1UAX A;  3AVL A;  1EQY A;  1NLV A;  3AA3 A;  1ATN A;  3MN5 A;  1EKE A;  5ADX A;  5AQH A;  4DV2 K;  3F5T A;  3MAQ A;  1G15 A;  3LDS A;  1A5V A;  2Q3S A;  4K41 A;  4N5S A;  1TUU A;  4WQ4 A;  4YOV A;  2FBY A;  2F4V K;  3O9U A;  2HMI A;  4KI4 A;  1HPZ A;  2F7T A;  5AQV A;  1ATS A;  4YNQ A;  4EP5 A;  3ZEU A;  1S1U A;  4FZZ A;  1IKW A;  3THY B;  2HOE A;  4JKG B;  5JVG L;  2PY5 A;  1OKJ A;  3FZM A;  4IDK A;  4DTR A;  3LPU A;  1Z26 A;  3EE8 A;  4B9V A;  4YDU A;  5C2D A;  3CCR N;  1S1X A;  3TTF A;  1NK7 A;  1MDU B;  1MA9 B;  2HHU A;  5BPN A;  4XIU A;  4DQQ A;  5FPD A;  2GUI A;  1VSJ A;  3DXM B;  2OA8 A;  3AO3 A;  5JLH A;  4DTM A;  4KRF A;  4CD3 A;  1RDW X;  4CJS A;  3CYM A;  4FW2 A;  3SJH A;  1XWL A;  3RMD A;  3V9X A;  4DV4 K;  5SWM A;  3RR7 A;  2O8C B;  5LMU K;  1U45 A;  4B9T A;  5BPM A;  3HPH A;  3UKR A;  1RNH A;  2O8E B;  4A62 A;  3LP2 A;  1HJR A;  3H1Q A;  3V1O A;  3O4N A;  5AQS A;  3EE9 A;  4PKH A;  3C7N A;  3GL1 A;  4B08 A;  1RDB A;  5AQP A;  5AQY A;  4Z4E A;  5KQD A;  1RCH A;  5I42 A;  1GOC A;  4WF9 L;  3QO9 A;  4AIL C;  4N76 A;  2QA4 N;  4PY5 A;  3KWI A;  2QWM A;  4CZH A;  4FJX A;  3RMA A;  3ZX3 A;  1SS6 A;  5GIP A;  4CBU A;  1KTQ A;  3P31 A;  1HYZ A;  3TU5 A;  3L3V A;  4IFV A;  1VSM A;  4I6M B;  4B1X B;  3AO5 A;  4FOI A;  3V81 A;  2O8D B;  3OYE A;  3PX6 A;  4DR7 K;  4JI4 K;  2V52 B;  3ATU A;  4DLG A;  5AQN A;  1TL3 A;  5EU7 A;  2UU9 K;  2PAV A;  4PA1 A;  5BN8 A;  3KLH A;  4BWM A;  2O4I A;  1Z25 A;  5M1K A;  4L8R B;  2NLX A;  5FPN A;  2FBV A;  1KLM A;  1XHZ A;  4Z4I A;  3QEX A;  3M8S A;  1C1B A;  4HVJ A;  4FJG A;  4B1Z A;  5AQT A;  1S1T A;  1WSG A;  3NH0 A;  3NDK A;  4FLU A;  3H6E A;  4H5T A;  1TAQ A;  3U9D A;  3VEN A;  4FL9 A;  2E1Y A;  1DT9 A;  1L3U A;  4QCL A;  4CJ7 A;  3A5L C;  4CVN E;  4IOX A;  3OYI A;  3BGR A;  5C15 A;  4ICL A;  1KC8 O;  1JCE A;  4Y1D A;  2IC3 A;  2G8W A;  4PL8 A;  4FM2 A;  3PX4 A;  4CJW A;  3V9S A;  4DTS A;  3IS9 A;  3MN9 A;  3IAY A;  3TAG A;  1ILY A;  5AZJ A;  1S1W A;  1TKD A;  3DLE A;  3V9Z A;  4O55 A;  4OKJ A;  4IFY A;  2RF2 A;  2P9U A;  4LY7 A;  3AY9 A;  4IWV A;  2DTU A;  2O8F B;  4LF4 K;  1CLQ A;  3LWM A;  2NUB A;  4O4G A;  4O8U A;  3HO1 A;  4KHW A;  4M3Y A;  2D4W A;  3F9K A;  1NU0 A;  3EYZ A;  4EHU A;  4MFB A;  4FYD A;  4I6M A;  3H3O B;  3IUC A;  3CER A;  3E66 A;  1VRT A;  3WNH A;  3H3N O;  3TAP A;  4OPH A;  4CGF A;  1VHX A;  3KKR A;  3MXM A;  2F8S A;  1L5U A;  5C0Y A;  2NRZ A;  4V19 S;  1QS4 A;  2B6A A;  4CZK A;  4LC9 B;  2XHB A;  2HBM A;  3G10 A;  2IOC A;  3I0S A;  2OPQ A;  3DOK A;  3OVN A;  1NGC A;  4FCY A;  3QIP A;  4DFJ A;  4KPY A;  1HNW K;  4M3Z A;  4AHV A;  3C65 A;  1HPM A;  2NRX A;  4DCH A;  4H03 B;  1SQK A;  4M3T A;  4JD2 A;  1JLF A;  4M3X A;  2I7P A;  1KXP A;  3DLG A;  1BI4 A;  3O3H A;  3K58 A;  1VAZ A;  4DQR A;  2Y1I A;  5CHI A;  3CQ8 A;  4KTZ A;  4FWK A;  1Y97 A;  4CGG A;  2KFN A;  1YJ9 N;  1ZBU A;  4H5R A;  4H5W A;  3SPZ A;  2B5J A;  4LF8 K;  5T7B A;  2G8I A;  3QBW A;  3OYC A;  4F3O A;  3PIP L;  2JLE A;  2W6L A;  4DTP A;  1BCM A;  4I2Q A;  2XY8 A;  1J5O A;  3QES A;  4E7K A;  4KTQ A;  1U49 A;  4HUF A;  1RDC A;  3I0R A;  4J2E A;  4RG8 A;  4CHP A;  2OCE A;  4CJL A;  3SK3 A;  1M1K O;  1RT3 A;  5IT9 O;  4BRO A;  4GMJ B;  1QQM A;  5GAH P;  1K6Y A;  1D8Y A;  1KFS A;  2OTJ N;  5M1N A;  3MN7 A;  4DQP A;  4WE1 A;  1WSE A;  3D7E O;  4HTL A;  1BCO A;  4KFB A;  4OPK A;  4XH5 A;  3OW2 M;  4CW7 B;  4DSK A;  4DR5 K;  1VQ7 N;  4OLA A;  1D5A A;  2JWK A;  4H5V A;  4DSF A;  3BZK A;  2FC0 A;  1BO5 O;  4MO5 A;  4DR4 K;  3AAR A;  4EFH A;  4JKC A;  1NKB A;  1B92 A;  4KB1 A;  2WC9 A;  4YFU A;  4DMN A;  3NVM A;  4X65 K;  1V4S A;  1QSY A;  2F8T A;  4EHT A;  1E3M A;  3HVT A;  1E4G T;  4FZX C;  2VG5 A;  3ENH A;  1JLE A;  3VGM A;  1NWK A;  4JK8 A;  3C0B A;  3V9W A;  2EX3 A;  3TSQ A;  1NGG A;  5ELZ A;  1SZ2 A;  3LPT A;  1N6Q A;  4HWI A;  1N8R O;  1HRH A;  4FJI A;  5AZI B;  3DAW A;  2WON A;  3AVM A;  3NE6 A;  3L2Q A;  4WFN L;  4CFB A;  4LFA K;  3OYD A;  4LSN A;  3RWU A;  5CZ2 A;  1JLB A;  4CD1 A;  3QEW A;  4CJ4 A;  4NCB A;  4A57 A;  2VWK A;  4PKG A;  2HVH A;  4CEE A;  2HND A;  3SUP A;  3TTC A;  4JN4 A;  3BEX A;  3L0Q A;  3FE1 A;  3THV A;  1HMV A;  3E9P A;  4CK3 A;  1YXQ A;  1U4B A;  3J7A P;  3L2V A;  1Q9X A;  3HPG A;  2QWQ A;  5GAE P;  3VQ8 A;  3JSM A;  4H0X B;  1ZXO A;  4CHN A;  2VGM A;  3P39 A;  3CCU N;  3S9H A;  2Q0U A;  3LDO A;  3JAM O;  3U3G A;  5GAG P;  2HNY A;  3EZW A;  4C23 A;  4CJR A;  4B9U A;  2P51 A;  3G71 N;  3SQ0 A;  1CXQ A;  4FO0 A;  4JS5 A;  3M5R A;  4IG3 A;  3VF4 A;  3IMX A;  5FPE A;  4B3O A;  3SQ2 A;  1VSD A;  1HKB A;  3CJ1 A;  2YNH A;  3J7Y P;  1IG9 A;  2NRR A;  1QTM A;  4B8C A;  1ASW A;  3C6U A;  2BGG A;  3LZI A;  2I7N A;  5K14 A;  3IRX A;  2E1Z A;  2EHG A;  2AJQ A;  4DKW A;  4H0P A;  3MX5 A;  4FWP A;  4OLB A;  1HLU A;  1P8Z A;  2XO7 A;  3RRG A;  4BRF A;  1YJN N;  4H0V B;  3OTO K;  5AQL A;  1T6C A;  4IOC L;  2ZD1 A;  3MN6 A;  4H8K A;  1VSF A;  4AQY K;  1P90 A;  2Z1I A;  3OHR A;  4GNI A;  3QIN A;  3TAE A;  3PSF A;  1KFD A;  4CZG A;  2D0A A;  4DWI A;  2ASP A;  4EZ9 A;  2RN2 A;  3B6O A;  1N5Y A;  3IG1 A;  4W5O A;  1NJW A;  3QBX A;  3HTV A;  4HHT A;  3DRR A;  4NLB A;  3HM8 A;  2I5J A;  2FSN A;  4W5T A;  4CJE A;  3Q7B A;  1KAY A;  3D0P A;  4BC3 A;  1GLE G;  3BUZ B;  1W97 L;  1NKC A;  1D9D A;  2WFB A;  3VTI A;  3ZX2 A;  4OPJ A;  4FJ9 A;  1OVY A;  3OBY A;  3O1W A;  2DFH A;  1QZ6 A;  4DSI A;  3PLA A;  4A5B A;  4E7I A;  4BRI A;  1T6D A;  3CM6 A;  4JKB A;  1NGE A;  1MWM A;  3ZSV A;  1XC9 A;  3H46 O;  2HNZ A;  3MX2 A;  4BVO A;  4ZTF A;  1IBL K;  2Q1N A;  4YOU A;  5E26 A;  1OH6 A;  4CEF A;  5BR8 K;  2GTD A;  3KKS A;  3WNE A;  4B9S A;  2O8B A;  1OVQ A;  3HSC A;  2HHT A;  4CHZ A;  3KTQ A;  3PSI A;  4FWN A;  4FWM A;  4FWS A;  4RW7 A;  4FSV A;  4DV1 K;  3O9S A;  4CHQ A;  2PBD A;  3LL3 A;  5AQI A;  5LL6 Z;  1BI4 B;  4FJ8 A;  4DV6 K;  2DFE A;  1U04 A;  1HR0 K;  2IVN A;  3HOT A;  5BN9 A;  1K8A O;  3VQ4 A;  1NK5 A;  4FPA A;  4Z0U A;  3L2R A;  3CC2 N;  1HUX A;  4PWD A;  3HVR A;  3VQC A;  3WEE A;  4DHY A;  3ZCM A;  3QEV A;  4QAG A;  3ISN C;  2R7Y A;  3R1X A;  1IH7 A;  4R79 A;  2OZM A;  4JKE A;  2P9P B;  3OS0 A;  1Q8I A;  4GV3 A;  4Q0B A;  1S9G A;  4FK4 A;  4OO1 J;  3O80 A;  2W6K A;  1ZBI A;  1FK9 A;  4O44 A;  2A6A A;  2O8D A;  3QLH A;  3S41 A;  3DOL A;  4M3R A;  1SKW A;  1Q9Y A;  5HLF A;  2FLO A;  2QWR A;  3AVK A;  3VQP A;  5KRT A;  1KD1 O;  4DS4 A;  5AJ3 K;  3MEG A;  2UXB K;  4AHU A;  2CGK A;  4BR7 A;  4CBW A;  3DXK B;  4K25 A;  2PFU A;  3T1H K;  4KAZ A;  4BRA A;  3LDN A;  1VQP N;  3O08 A;  1FJG K;  2E2Q A;  3ZSZ A;  5KTQ A;  5DK5 A;  1J5E K;  2HHS A;  3WUH A;  5B8H A;  3P38 A;  2YV0 X;  4O5B A;  2E4L A;  4OPA A;  3M8P A;  4JKH A;  4K0K K;  5AFU A;  4OX9 K;  4RW9 A;  1WSJ A;  3I8B A;  1QE1 A;  3SUN A;  3T19 A;  1FXX A;  4DLE A;  5FDL A;  2DFF A;  1YJW N;  4ZTJ A;  3KLG A;  5FRN A;  3PUF A;  3PO4 A;  4FXD A;  1XMO K;  5I3U A;  5IWA K;  2Z1J A;  2ZF5 O;  5LMN K;  2CH6 A;  1NGB A;  3NCI A;  3UB5 A;  5EVZ A;  1EWR A;  3DLH A;  1XNQ K;  3HP6 A;  2F9W A;  4BRM A;  5M1F A;  3OYH A;  3BF1 A;  3B6P A;  4DR3 K;  2X74 A;  3E01 A;  5BRE A;  1ATR A;  4O5F A;  1D9F A;  2NZT A;  1VQ6 N;  2YHX A;  3VET A;  3ZX0 A;  4KHU A;  4DTO A;  1NOY A;  4BRK A;  3PO5 A;  5TKY A;  2GEL A;  3V9U A;  1GLL O;  1O13 A;  2P9S A;  1RBT A;  1Z6R A;  3EKS A;  5AQG A;  3AVI A;  3FZK A;  1REV A;  1HYS A;  3WXI A;  1U2V B;  3ZET B;  5CE3 A;  2UYT A;  4CZF A;  2CGL A;  4DFM A;  4Z4H A;  4CFC A;  5JIC A;  1VRU A;  1JXE A;  1J6Z A;  1BHL A;  3DRP A;  2D0C A;  3QFP A;  1RBR A;  4B1W B;  1TKX A;  4DS5 A;  4I2P A;  1HQU A;  3AO4 A;  2E88 A;  3LAM A;  2KZM A;  4JI3 K;  2ATQ A;  3SI6 A;  5AZJ B;  1QQC A;  3CQY A;  4IBN A;  3KHY A;  3W3D A;  4KI6 A;  1J54 A;  4BE2 A;  4B3M K;  4KH6 A;  3LM2 A;  1JLQ A;  1JXB A;  3OA9 A;  5M1O A;  3KD5 E;  2P9U B;  3GE1 A;  3SZ2 A;  1CZA N;  2GEM A;  4DFP A;  1VQN N;  3QIO A;  5FRO A;  4IKF A;  3S3M A;  3ZEU B;  4DV7 K;  4YOW A;  1NK9 A;  1NNE A;  4UQG A;  4CGD A;  3FZL A;  4KB0 A;  3L6Q A;  1NJX A;  3HT3 A;  3HOS A;  2Q36 A;  1TL1 A;  1UA0 A;  2E6L A;  2ZJP L;  3MMV A;  4YY3 K;  5JS2 A;  4RW4 A;  1XQS C;  5C10 A;  2W42 A;  4QOZ B;  3EL2 A;  5AQW A;  4RW8 A;  1IKY A;  4CF2 A;  1MWK A;  4WQ5 C;  4ILH A;  4J2A A;  2YHA A;  3PX0 A;  5CY4 A;  4DR6 K;  3QET A;  1RT2 A;  3KD1 E;  4CBX A;  4I9L A;  4JLH A;  4JHD A;  4FJN A;  3KK3 A;  3EEQ A;  4BRN A;  3J7Z O;  2NNW A;  1QVG M;  3THW B;  4B3T K;  4DG1 A;  5CR4 A;  1IBK K;  3LDP A;  3TAF A;  1QQO A;  1WAF A;  1SKS A;  4CFD A;  4C8O A;  3E9L A;  4JI1 K;  1NKE A;  4ISG A;  4MDA A;  4LFB K;  3V6D A;  3LWL A;  4KO0 A;  2X6S A;  2V51 B;  2A3Z A;  3LM9 A;  4FJ5 A;  1E4F T;  3PIO L;  2A42 A;  2Q0R A;  3D2F A;  4BR4 A;  5HRR A;  3ITH A;  2ITG A;  1ZBF A;  3OS1 A;  4RWT A;  4BRE A;  1I3A A;  5CYQ A;  5CZ1 A;  3VPZ A;  3K5N A;  1R0A A;  2D1K A;  3TI0 A;  4A5A A;  4KKO A;  3ZSQ A;  5EX5 A;  3J80 O;  1YIT N;  1RBS A;  1X1P A;  3TWH A;  5AZI A;  1GLF O;  5C25 A;  2HHV A;  3H08 A;  4IJA A;  1SL1 A;  3CFP A;  4JKG A;  2F9T A;  3HL8 A;  2D0O A;  2WBN A;  4Y1C A;  1EET A;  2IIR A;  3QB0 A;  1CZB A;  4OJR A; 
#chains in the Genus database with same CATH homology
 2VGN A;  2A40 A;  3AAQ A;  1NGD A;  2YJF A;  1BA0 A;  4WFN L;  2YJE A;  1Q86 O;  3NVK A;  4FPB A;  3R8E A;  4BG9 A;  3WXK A;  1HJO A;  4CD1 A;  3AGR A;  5KPT A;  3KWG A;  4RCH A;  1BG3 A;  1ZBS A;  5AQJ A;  4PKG A;  4A57 A;  4B1U B;  4E1J A;  4IOA L;  3O9T A;  4JAX A;  4CZJ A;  3TTC A;  4JEP A;  2HST A;  1GLA G;  4JN4 A;  2GWK A;  4ILJ A;  3BEX A;  3L0Q A;  3CJ9 A;  1Q81 O;  1QZ5 A;  3FE1 A;  5EY4 A;  2HBL A;  2QM1 A;  2YI1 A;  3E9P A;  3GOI A;  3KZB A;  1YXQ A;  3N4Q A;  3CC7 N;  3AAP A;  3CCE N;  2QWQ A;  5GAE P;  1SAZ A;  3K9K A;  4UY8 O;  3VEX A;  1GLD G;  4H0X B;  1ZXO A;  3L4I A;  3B8A X;  4WYB A;  4BRL A;  4FVU A;  2VGM A;  3T69 A;  3P4I A;  3L4Q A;  3LDQ A;  3TSP A;  3U8X A;  3P39 A;  4ISF A;  5DM6 L;  2Q0U A;  3A5M C;  3CCU N;  5AQU A;  1YI2 N;  3LDO A;  3A8Y A;  1VQ5 N;  5GAG P;  4MLE A;  1VQK N;  2BUP A;  2J4R A;  3EZW A;  4C23 A;  2P9I A;  3C7N B;  4F9O A;  3G71 N;  3RSE B;  3MWP A;  1T44 A;  5GIO A;  3D2E A;  5KQ8 A;  1GLC G;  3CQX A;  4FO0 A;  3ULE B;  3M1F A;  3FGU A;  3M5R A;  4M63 C;  3DJC A;  3MWT A;  4BRG A;  3VF4 A;  3ULE A;  3IMX A;  5AQZ A;  5HOO A;  3CC4 N;  3FLC O;  5FPE A;  1NJI O;  2P9L B;  4B1V A;  3JXU A;  1K8K B;  4PHT X;  3CET A;  1HKB A;  2FXU A;  3CJ1 A;  3CF5 L;  3CCL N;  5ADX H;  1RGI A;  2NRR A;  1C0G A;  1JJ2 M;  4JKD A;  3MCA B;  4PL7 A;  1NM1 A;  3FZF A;  2ZJR L;  2ZJQ L;  2I7N A;  1TUY A;  5FPM A;  1KAX A;  1NGF A;  3TTD A;  2E2O A;  1YVN A;  2FSJ A;  4MDB A;  4EAH D;  2E1Z A;  3IDH A;  1BDG A;  2VYP A;  3C6A A;  3CI5 A;  1QHA A;  4YDU C;  4DKW A;  4H0P A;  3MX5 A;  4FWP A;  5AR0 A;  3VGK A;  2QWP A;  1HLU A;  1P8Z A;  2RHK A;  3DLL L;  4BRF A;  1YJN N;  2ASO A;  3HI0 A;  1X9J A;  3HRG A;  1NMD A;  3CJB A;  3F2K A;  4H0V B;  4RTF D;  5AQL A;  4JK9 A;  1T6C A;  3H45 C;  5M1Q A;  3I55 N;  3R9P A;  2OAN A;  3MN6 A;  4AF1 A;  4IOC L;  1Q7Y O;  2HBK A;  3EN9 A;  5LJW A;  1QQN A;  3D2F B;  4BR2 A;  1P90 A;  1YAG A;  1IG8 A;  4K43 A;  3VOV A;  3OHR A;  4GNI A;  5H1S Q;  2FF3 B;  5AQF A;  3EKU A;  5EOY A;  3G6E N;  3WXJ A;  1EO1 A;  2HBJ A;  4Z94 A;  3RSE A;  2AP1 A;  1HKC A;  4CZG A;  4IDH A;  1EQY A;  3I56 N;  2ASP A;  4WQ4 C;  1NLV A;  4YOX A;  5TKW A;  1ATN A;  3MN5 A;  3G4S N;  2KLA A;  3A5O C;  4NO7 A;  2QXL A;  5GAD P;  5ADX A;  3CCS N;  5AQH A;  4WQ5 A;  3F5T A;  4FOE A;  3QBX A;  3HTV A;  4K42 A;  1W2B M;  2DPN A;  3DXM A;  2QW9 A;  2KHO A;  4H5N A;  3VEZ A;  4NLB A;  3HM8 A;  4K41 A;  4BR5 A;  2FSN A;  3CMA N;  2KKZ A;  3VEV A;  3Q7B A;  2P9K A;  1TUU A;  1KAY A;  4WQ4 A;  4YOV A;  2BTF A;  5AQK A;  3CPW M;  3SBT A;  4BC3 A;  3SMP A;  1GLE G;  3BUZ B;  3GG4 A;  5MLC Q;  3O9U A;  1W97 L;  4B1Y B;  3CCM N;  2WFB A;  3VTI A;  1IJJ A;  3ZX2 A;  3CPE A;  4BRP A;  5E84 A;  2F7T A;  4IO9 L;  4IXC A;  1OVY A;  3OBY A;  5AQV A;  3O1W A;  1ATS A;  2IVO A;  1QZ6 A;  3R6M A;  3ZEU A;  4QS7 A;  3R3L A;  4J8F A;  3PLA A;  4A5B A;  4QS8 A;  4BRI A;  3CJC A;  2HOE A;  4CZL A;  4JKG B;  5JVG L;  3IFR A;  1T6D A;  1OKJ A;  3FZM A;  4JKB A;  4BC2 A;  1NGE A;  3CCQ N;  1MWM A;  1U2V A;  3EE8 A;  3H46 O;  3MX2 A;  3J8A A;  4BVO A;  3SAF A;  4YDU A;  2Q1N A;  4YOU A;  5E26 A;  5C2D A;  3CCR N;  3TTF A;  3VTH A;  4KBO A;  2GTD A;  3H1V X;  1MDU B;  1MA9 B;  4WFB L;  3HBT A;  5BPN A;  4QS9 A;  3SMS A;  1HKG A;  3E1Y A;  3QML A;  4IO8 A;  1RFQ A;  3HSC A;  5C12 A;  5FPD A;  3E9O A;  4FWN A;  4FWM A;  4FWS A;  4BRD A;  2GWJ A;  4FSV A;  2A41 A;  1VQ8 N;  4BRH A;  2P9I B;  2JWL A;  3DXM B;  5JLH A;  4CD3 A;  1RDW X;  3FZH A;  3VGL A;  3O9S A;  4MLH A;  3SJH A;  2PBD A;  3LL3 A;  5AQI A;  1DEJ A;  1HX1 A;  3MCP A;  1VQ4 N;  3UKU A;  2ZGZ A;  3BP8 A;  4G9Z A;  2P9L A;  1Q82 O;  5BPM A;  2IVN A;  3UKR A;  5KPR A;  1NBW A;  4A62 A;  3HOT A;  5BN9 A;  1K8A O;  4U7B A;  1NGJ A;  4WFA L;  4FPA A;  2QEX N;  3CC2 N;  2E2N A;  3H1Q A;  4BG8 A;  1HUX A;  5AQS A;  3D2E B;  3W0L A;  3EE9 A;  1S22 A;  3WEE A;  4PKH A;  3CJ7 A;  4DHY A;  3C7N A;  2WUS A;  3GL1 A;  3O1B A;  3CCV N;  4DB3 A;  4BRC A;  5AQP A;  5AQY A;  1BWF O;  3VES A;  5F0X A;  1K73 O;  5KQD A;  4GV9 A;  2ZGY A;  3ZYY X;  3R1X A;  2YCH A;  3HZ6 A;  4R79 A;  4JKE A;  2FF6 A;  2P9P B;  4CZM A;  4WF9 L;  5I9E B;  3SAG A;  3O5B A;  2QA4 N;  3KWI A;  2QWM A;  4CZH A;  4GV3 A;  1NGI A;  1XUP O;  3UKR B;  4BR0 A;  5C2F A;  4OO1 J;  2RE2 A;  3O80 A;  2VCP A;  1TYQ A;  4AM7 A;  3ZX3 A;  1SS6 A;  3UE5 A;  5GIP A;  3VF6 A;  4CBU A;  2NRH A;  4JNE A;  5AQX A;  3P31 A;  1V4T A;  5AQO A;  1WOQ A;  3TU5 A;  4FWR A;  2A6A A;  3ENB A;  4NB4 A;  5BRD A;  2QWN A;  2P9N A;  3F9M A;  4I6M B;  3M3Z A;  4B1X B;  1LOT B;  3S41 A;  4JKA A;  4WCE L;  4FOI A;  4DQ8 A;  2FLO A;  2VWB A;  2V52 B;  2QWR A;  3ATU A;  5AQN A;  1XC3 A;  3N4P A;  1KD1 O;  3DXK A;  3WXM B;  2PAV A;  3U9Z A;  5BN8 A;  2CGK A;  4BR7 A;  4CBW A;  3DXK B;  4K25 A;  2PFU A;  3A0I X;  4BRA A;  3LDN A;  5M1K A;  1VQP N;  2QTD A;  3OBW A;  2NLX A;  5FPN A;  3O08 A;  4IEI A;  2E2Q A;  1Q18 A;  5BPL A;  4ILG B;  4YOY A;  3WUH A;  5B8H A;  2P9N B;  3P38 A;  5AQT A;  3JS6 A;  4OPA A;  4B1Z A;  4BGB A;  4JKH A;  3H6E A;  4H5T A;  3VEN A;  3O8M A;  3MDQ A;  4IEE A;  4FL9 A;  2E1Y A;  3U9D A;  4BQZ A;  5AFU A;  1DT9 A;  3A5N C;  2QI2 A;  3I8B A;  4CJ7 A;  1KAZ A;  3AGK A;  3ZET A;  3A5L C;  1LCU A;  2H3G X;  1YJW N;  1VQ9 N;  1DKG D;  3BF3 A;  1ZC6 A;  3FFK B;  4IOX A;  3RVC A;  1BU6 O;  1D4X A;  2V7Y A;  5C15 A;  4BC5 A;  2ZF5 O;  1KC8 O;  1JCE A;  3VEY A;  2CH6 A;  1NGB A;  3UB5 A;  5EVZ A;  2E8A A;  2F9W A;  4PL8 A;  4BRM A;  4CI6 A;  4FWQ A;  4CZE A;  3MN9 A;  3M6G A;  4A2A A;  1KQS M;  1ILY A;  4KH5 A;  5M1F A;  1K9M O;  5AZJ A;  3BF1 A;  3O9R A;  4BQL A;  5BRF A;  1WUA A;  3SAH A;  4U67 L;  2QWL A;  4JHD B;  4ISE A;  1ATR A;  5BRE A;  4O5F A;  2P9U A;  2NZT A;  3AY9 A;  3CME N;  2NRW A;  4IWV A;  1VQ6 N;  2BH1 A;  3G25 A;  2YHX A;  3VET A;  3ZX0 A;  4XH1 A;  2CGJ A;  1ESV A;  4BRK A;  3DWL A;  5TKY A;  3QDK A;  2GEL A;  4B9Q A;  5LJV A;  3CCJ N;  1GLL O;  4O8U A;  1G99 A;  2V7Z A;  2E2P A;  2HF4 A;  4A59 A;  1O13 A;  2D4W A;  5F2R A;  2P9S A;  3ENO A;  3VEO A;  3WEE B;  4EHU A;  1Z6R A;  2GUP A;  4I6M A;  3H3O B;  3EKS A;  3IUC A;  3CER A;  3E66 A;  4BVP A;  5AQG A;  3FZK A;  3I33 A;  1BA1 A;  2GX9 A;  3WXI A;  3H3N O;  1U2V B;  3ZET B;  5CE3 A;  2UYT A;  1BUP A;  4OPH A;  3UKU B;  2CGL A;  2QWO A;  4H0T B;  4CZF A;  1S72 N;  1Y64 A;  5JIC A;  4BY9 C;  3ID6 A;  5JMV A;  4YOT A;  1J6Z A;  2HMP A;  5C0Y A;  1YF5 L;  3KVG A;  2NRZ A;  4CZK A;  4IFE A;  4LC9 B;  2A5X A;  2HBM A;  3QFP A;  4B1W B;  3KK7 A;  3VEW A;  1VQO N;  4FWO A;  4GV6 A;  4M7X A;  1NGC A;  2E88 A;  5DM7 L;  1JCG A;  4L3Q A;  3C65 A;  1C0F A;  1HPM A;  3VER A;  2NRX A;  2Q97 A;  3K9J A;  1SQK A;  3O6W A;  4H03 B;  4Y0W A;  3SLC A;  4DCH A;  4O8K A;  4JD2 A;  2P9P A;  2I7P A;  1QVF M;  1KXP A;  5AZJ B;  5F1X A;  3WQU A;  3CQY A;  3LDL A;  3KHY A;  3W3D A;  1VAZ A;  1VQL N;  5CHI A;  1U6Z A;  4KH6 A;  1GLJ O;  1X3N A;  3D6R A;  3LM2 A;  4A61 A;  3OA9 A;  5M1O A;  5AQR A;  4IZ9 A;  2D0P A;  2P9U B;  1YIJ N;  3GE1 A;  4NLC A;  2FSK A;  3TPQ A;  1CZA N;  5EXW A;  4FWK A;  2GEM A;  1VQN N;  5AQQ A;  3CHW A;  3IKM A;  3O9Q A;  4BRQ A;  1S3X A;  3VMF B;  1YJ9 N;  4BR9 A;  4H5R A;  3QIC A;  4H5W A;  3ZEU B;  4GY2 B;  4CZI A;  3QBW A;  5AFU H;  4YOW A;  2EWS A;  3MK6 A;  3GBT A;  3PIP L;  1JCF A;  1DGK N;  1Z05 A;  1YHQ N;  3FZL A;  3L6Q A;  1X3M A;  3T7Z A;  2Q36 A;  3HOS A;  3ID8 A;  2ZJP L;  4AM6 A;  3MMV A;  3NMU A;  2NRV A;  2NRT A;  4JKF A;  5HL7 L;  3WXL A;  3SK3 A;  2HF3 A;  1XQS C;  5C10 A;  1M1K O;  3EL2 A;  1RDU A;  3Q7C A;  5AQW A;  1BOT O;  3WQT A;  4C1N K;  1M90 O;  4H0O A;  1MWK A;  2AA4 A;  2YX6 A;  4WQ5 C;  4BRO A;  4ILH A;  1QQM A;  5GAH P;  4PKI A;  4H0Y B;  4MO4 A;  4CBX A;  2OTJ N;  5M1N A;  2P9K B;  4M7Y A;  3CJA A;  4JHD A;  4KH4 A;  4EIA A;  2ZWH A;  5JVH L;  3MN7 A;  3SBG A;  5LY3 A;  4BRN A;  3J7Z O;  2NNW A;  3O4W A;  3VF2 A;  1QVG M;  5KPZ A;  1R59 O;  3D7E O;  4HTL A;  5CR4 A;  3LDP A;  4FWL A;  1QQO A;  3ATV A;  3FR0 A;  4XH5 A;  3OW2 M;  3E9L A;  3CIP A;  1VQ7 N;  4ISG A;  5AQM A;  4MDA A;  4IJN A;  2JWK A;  4A2B A;  4BGA A;  4H5V A;  3EO3 A;  3U4L A;  2V51 B;  2Q2R A;  1BO5 O;  4MO5 A;  4YOR A;  3TSU A;  4C1N I;  2A3Z A;  2Q31 A;  3LM9 A;  1E4F T;  2CH5 A;  2W41 A;  5JLF A;  3AAR A;  4EFH A;  2A42 A;  2Q0R A;  3D2F A;  4JKC A;  5M1P A;  4BR4 A;  3PIO L;  2WC9 A;  1K8K A;  1VQM N;  5BRH A;  2ASM A;  3NVM A;  4JK7 A;  1V4S A;  2W40 A;  4RWT A;  4BRE A;  4BC4 A;  3VPZ A;  4EHT A;  2YHY A;  2D1K A;  1E4G T;  5BR9 A;  4A5A A;  3ENH A;  3VGM A;  2E20 A;  3CD6 N;  1NWK A;  4JK8 A;  1TYQ B;  2ITM A;  1NGA A;  3C0B A;  4GVE A;  4XH4 A;  2IVP A;  5EX5 A;  5GIN A;  3QFU A;  1YIT N;  3C6H A;  3TSQ A;  1YUW A;  3CXC M;  1NGG A;  2YHW A;  2P9S B;  3GDQ A;  1SZ2 A;  1GLF O;  1T3V A;  5ELZ A;  5AZI A;  3WT0 A;  4IJA A;  4HWI A;  4JKG A;  1N8R O;  2F9T A;  5AZI B;  4JD2 B;  2D0O A;  2WBN A;  1H1V A;  4XEI A;  1NGH A;  3DAW A;  1GLB G;  2IIR A;  3QB0 A;  2OTL N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...