2A6AA

Crystal structure of glycoprotein endopeptidase (tm0874) from thermotoga maritima at 2.50 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
193
structure length
193
Chain Sequence
MNVLALDTSQRIRIGLRKGEDLFEISYTGEKKHAEILPVVVKKLLDELDLKVKDLDVVGVGIGPGGLTGLRVGIATVVGLVSPYDIPVAPLNSFEMTAKSCPADGVVLVARRARKGYHYCAVYLKDKGLNPLKEPSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERLFREKKTIHYYEIEPLYLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an essential bacterial protein YeaZ (TM0874) from Thermotoga maritima at 2.5 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords hypothetical protein TM0874
total genus 55
structure length 193
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00814 Peptidase_M22 Glycoprotease family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2a6aA01
3.30.420.200 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2a6aA02
3A8YA 3VPZA 2P9IA 1QHAA 5AQQA 4XH1A 3W3DA 4EHTA 1YUWA 4H0VB 4BVOA 5BPNA 1LOTB 1GLFO 4PKGA 4H5WA 1KAYA 3D2FB 1U2VB 2IIRA 1NGJA 3MN9A 3VEVA 4JD2A 4PKHA 3H46O 5LY3A 4WYBA 3SMSA 1K8KA 3M1FA 3WEEA 4WQ4A 5JLHA 4IWVA 5AQLA 1OKJA 3H1VX 5AQMA 3WUHA 1QQMA 4FWQA 5AFUH 4A2AA 3C7NA 4E1JA 2CGKA 3CJ7A 3I33A 2E20A 3C7NB 3CETA 3ULEB 2VYPA 3UKUA 3HM8A 2V51B 3ZX2A 2NZTA 4WQ4C 3GDQA 5F1XA 5ADXA 5AQIA 1YAGA 3LDPA 4DQ8A 3O8MA 1BA0A 3H6EA 2CGLA 2E2QA 1C0FA 2P9LB 4XH4A 1LCUA 3RSEB 3HTVA 2ASPA 5E84A 1G99A 4BC5A 3VEWA 5JLFA 1T44A 3G25A 3P4IA 1KXPA 4FOIA 1HKCA 2YHYA 4B1YB 5KPRA 5FPEA 3IMXA 2IVPA 2P9KA 1HJOA 3FZKA 1NGCA 1R59O 2D0OA 4CBWA 3R9PA 2E2PA 4FWSA 5F2RA 1TUYA 2GEMA 4BRFA 2WUSA 3UKRA 4F9OA 1ZC6A 2P9PB 2FSNA 5BPMA 4QS9A 5AZIA 2BUPA 1BUPA 5I9EB 4BRIA 5AFUA 3LM9A 3WXJA 3LDOA 4B9QA 4CBUA 1BA1A 5KQDA 3DXMB 3IDHA 5BN8A 4AM7A 4FSVA 4CD3A 2P9KB 5BPLA 1HUXA 1X9JA 3QFUA 2BTFA 1MDUB 5B8HA 1MA9B 4ISFA 1S3XA 3QB0A 4M7XA 5AQWA 4BRPA 1DGKN 3LDLA 3ENOA 3VETA 2QM1A 3W0LA 4H5NA 1JCGA 2FSKA 1BWFO 4NO7A 3CJ9A 3C0BA 3IUCA 4BROA 4K25A 5BRDA 2QXLA 3TU5A 2OANA 3H1QA 1NGFA 2Q1NA 4BR7A 4J8FA 1JCEA 2FF6A 5FPDA 4EIAA 2ZWHA 3ID8A 1NGBA 4YDUC 5JMVA 4A61A 4K41A 4B1UB 4BC4A 4BRMA 2V52B 3U9DA 2YJEA 4MO4A 1V4TA 2GTDA 2QWNA 2QWPA 4FWNA 2FXUA 5E26A 1NBWA 3GBTA 3ZETB 5AQXA 3MDQA 2FF3B 5EOYA 1C0GA 1IG8A 4BRHA 3R6MA 3WQTA 2I7NA 3CJCA 3O1BA 5AZJB 5AQNA 4CBXA 4AM6A 1X3NA 1NM1A 5AZJA 3SJHA 1S22A 4QS7A 4BRCA 3CHWA 2VWBA 3FZMA 5AQRA 4BREA 3BEXA 4FWMA 4EHUA 1BDGA 2YCHA 4MO5A 3MK6A 1DKGD 2DPNA 4BGBA 1NMDA 1TYQB 2NLXA 3D2EA 3ATUA 4MLHA 2D1KA 2ZGZA 4FOEA 3LM2A 5AQVA 2P9SA 4FWRA 4MLEA 3ENHA 1GLDG 5AR0A 3CJBA 5BN9A 3KHYA 1D4XA 3LDNA 4H0YB 2HF4A 5AQJA 3D7EO 3O5BA 4HTLA 4CZGA 2Q31A 3CI5A 3HZ6A 3O1WA 2A40A 2IVOA 3H3OB 2FSJA 5AZIB 3A0IX 3TPQA 1E4GT 2P9PA 3QBWA 2A41A 1KAXA 5AQGA 1TUUA 4BRGA 3VF2A 4BGAA 4A62A 1E4FT 4DHYA 3H3NO 3MN6A 3QFPA 4BQLA 3A5NC 4H0TB 4BRQA 5AQYA 5KQ8A 4IO8A 3DXKB 3AAPA 3FFKB 3KVGA 4H0OA 3DXKA 4BR9A 4BR0A 3VERA 4BC3A 1NGGA 4H5RA 1NWKA 4GNIA 4PL8A 4LC9B 1XUPO 5F0XA 1NGDA 5TKYA 4K43A 2AA4A 3O6WA 4FWPA 3M3ZA 4KBOA 2QWQA 2E88A 3VGLA 1XC3A 4C23A 3FZLA 3J8AA 2P9IB 3VESA 4BRNA 3O4WA 3WQUA 5EXWA 4PL7A 4CZIA 4CZMA 3S41A 4H5VA 4BVPA 3CQYA 2UYTA 3SMPA 1RGIA 1GLJO 3WXLA 3DJCA 3UKUB 3WXKA 2D4WA 4BG8A 1J6ZA 3F9MA 2GWJA 1HKGA 2FLOA 2HMPA 3HI0A 3LDQA 4XH5A 1NGEA 4BQZA 1P8ZA 3HSCA 2NRHA 2KHOA 1NLVA 3FZFA 4B1WB 4BRDA 3O08A 3BF3A 1YVNA 3KZBA 3L0QA 5AQFA 2GWKA 1Z05A 2HOEA 4H0XB 5BRHA 1BG3A 3GOIA 4EAHD 3A5LC 3GG4A 5FPNA 4B1XB 1BO5O 4L3QA 1Z6RA 3ZX3A 3SLCA 3B8AX 1XQSC 4IZ9A 2V7YA 3EKUA 4M7YA 3DWLA 1QZ5A 5BRFA 4FPBA 1NGIA 3UB5A 3D2EB 5AQHA 2VCPA 1H1VA 4I6MB 4JNEA 1RFQA 3VEOA 4IJAA 2J4RA 3AY9A 1Q18A 1GLLO 3L6QA 1IJJA 2GUPA 5AQKA 5AQSA 3EL2A 5LJWA 1MWKA 4BRAA 3ZEUA 3UKRB 4H5TA 2YI1A 4K42A 4JHDB 1MWMA 3ZX0A 2ASMA 2HF3A 3QMLA 4ISGA 3VF6A 5CE3A 4I6MA 2E2OA 3FR0A 3L4IA 1GLAG 1SZ2A 3HBTA 2E2NA 5EY4A 1QQOA 1ATSA 2Q36A 4B1VA 3UE5A 2I7PA 1NGAA 4CZEA 3BF1A 1YXQA 1BOTO 4CZJA 2Q0UA 3AARA 1ATNA 1SAZA 3MN7A 1GLBG 1HKBA 3BUZB 3MCPA 4JHDA 5FPMA 1BU6O 2PAVA 3VF4A 2A3ZA 4CJ7A 2E1YA 1ATRA 2F9WA 2ITMA 3VOVA 2P9NB 3BP8A 3WT0A 4WQ5C 4IXCA 4O5FA 3ZETA 2P9UA 2A42A 2CH6A 2PBDA 4FWOA 1EQYA 4YDUA 4RWTA 3DXMA 3FGUA 2P9UB 2YHXA 3R8EA 3VEYA 5BREA 3QDKA 5LJVA 4H0PA 2E1ZA 2Q97A 2Q0RA 3A5OC 3CIPA 3GL1A 4FPAA 2W40A 1U2VA 4CZLA 4DCHA 1WUAA 4JD2B 5AQZA 1V4SA 1SQKA 1U6ZA 3D2FA 5AQTA 3MMVA 4ISEA 2CGJA 2QWMA 2V7ZA 1GLCG 3JS6A 1HX1A 1CZAN 4Y0WA 4BR2A 1GLEG 2A5XA 4NB4A 4CZFA 4HWIA 4RTFD 3AAQA 3CERA 2CH5A 2YHWA 4GY2B 3SK3A 2P9SB 4CI6A 3JXUA 4BR5A 4FWKA 2ASOA 2IVNA 4Z94A 3VGKA 1T6CA 4JAXA 4M63C 3ZEUB 4CZKA 1ESVA 1TYQA 1K8KB 4BG9A 3GE1A 3WEEB 3FLCO 1HLUA 1T6DA 3LL3A 5BR9A 3QICA 3RSEA 2W41A 4XEIA 3VEXA 3H45C 4A2BA 1RDWX 1JCFA 5ELZA 1KAZA 2QWOA 3CJ1A 3QBXA 3OHRA 5EX5A 1X3MA 2QWRA 3ULEA 1HPMA 4FO0A 2GELA 4O8KA 3IFRA 2F9TA 4PKIA 2QWLA 1QZ6A 4FL9A 3CJAA 4RCHA 4CD1A 3EO3A 4CZHA 3U8XA 3EZWA 5KPTA 1Y64A 1WOQA 4WQ5A 3FE1A 4BRKA 4DB3A 3MN5A 3U4LA 5AQUA 2A6AA 2P9LA 2YJFA 2ZGYA 5EVZA 4EFHA 5ADXH 2QW9A 1NGHA 4BC2A 2ZF5O 1QQNA 2E8AA 2Q2RA 2H3GX 1DEJA 3VENA 1ZBSA 2D0PA 5AQOA 4H03B 3I8BA 3FZHA 4IJNA 3O80A 1ZXOA 3DAWA 2AP1A 3M6GA 3U9ZA 3CQXA 3VGMA 3ATVA 4QS8A 5JICA 2EWSA 4FWLA 4JN4A 4B1ZA 3EKSA 4BRLA 5AQPA 5KPZA 3WXIA 3EN9A 2P9NA 4BR4A 3A5MC 3VEZA
chains in the Genus database with same CATH superfamily
1QS4A 2WBNA 5AQQA 3V9WA 3WNFA 4H0VB 1YF5L 4B9LA 2IOCA 3WNGA 1LWFA 4JD2A 4W5QA 4PKHA 3M1FA 2X6SA 4LF9K 3HK2A 4DQPA 3E9LA 4UY8O 4JKDA 5AFUH 2OYQA 4E1JA 4DSKA 1YTUA 4JLHA 5LMNK 3RRHA 2E20A 3CETA 5M1NA 3HM8A 2V51B 1HRHA 3ZX2A 5J1EA 3AO5A 1RBSA 4LD0A 4WQ4C 5CYQA 3LDPA 4DQ8A 3J7AP 4MQ3A 4FLUA 4FK4A 1LCUA 3ISNC 3HTVA 3CC2N 3V9SA 3VQDA 4YFUA 3VEWA 4JKCA 1CZ9A 1T44A 3QEIA 3V4IA 2YNIA 2YHYA 4C1NI 1JKHA 3FZKA 2HNDA 4CJQA 3R9PA 2BGGA 2XO7A 2GEMA 4BRFA 4IG3A 4PY5A 2HBMA 2R7YA 4NCBA 3KTQA 1QHTA 1LWEA 5AFUA 3WXJA 4EP5A 1BA1A 4W5NA 3IDHA 4FSVA 3TSQA 4PUOA 3T3FA 3RMAA 2GBZA 1IG9A 2GX9A 1TVRA 3S3MA 1WLJA 2BTFA 4M41A 4CEOA 4CJ3A 3KK3A 2G8IA 3R1XA 3TABA 1UA0A 1DGKN 5HRSA 3VETA 2F96A 3L4QA 4CHPA 4FJHA 1JCGA 3N4PA 2FSKA 4NO7A 1HR0K 3CJ9A 3IUCA 1JLFA 4K25A 5BRDA 4DTUA 2QXLA 3ZT3A 4X66K 3OYMA 3AVJA 1NGFA 5SZTA 3RTVA 4CESA 5DMRA 4E7LA 3QEXA 1KD1O 3WNEA 4AQYK 5JMVA 1NGBA 4K41A 4OPJA 3VN5A 2V52B 3MX5A 4MO4A 1V4TA 1GOAA 5AQXA 3MDQA 3NBPA 5LMUK 5EOYA 2JWKA 3KKSA 2HHWA 1EWQA 3R6MA 5FRMA 4FJ9A 4C8KA 3CJCA 1VHXA 5AZJB 4DV7K 4CBXA 4A57A 1SV5A 1C0UA 2EHGA 1VQ9N 2QEXN 4CFBA 4BRCA 1NJYA 1OH7A 4IO9L 4M3YA 4YY3K 2XY8A 5JS1A 4M3RA 3LP1A 2YCHA 4MO5A 2QKKA 4HCCA 1DKGD 2HW3A 1NMDA 1TYQB 4LSNA 1Z25A 4I7FA 1CXQA 5CY4A 4N41A 3HL8A 3LZIA 4LFAK 4DSEA 3D0PA 4FOEA 3LM2A 5AQVA 4FWRA 5GINA 2QI2A 3ENHA 4FK2A 4DV6K 3PX0A 1RDBA 3KHYA 3KIOA 3KK7A 4DV0K 1RT4A 3HP9A 4YOTA 1HYSA 4AF1A 3O5BA 3S3NA 3EEQA 5SWMA 4EZ6A 4IBNA 2A40A 3A0IX 3CFPA 1TGOA 2P51A 4B3MK 3I0RA 3QBWA 2G8WA 4CFAA 4BGAA 3KK1A 2YX6A 1E4FT 1Q82O 1O13A 3CC7N 3C94A 5JVGL 4BRQA 3FFKB 2X78A 3VQBA 1ZBLA 4DFJA 3DXKA 1RT3A 4KPYA 4H5RA 3F2KA 4O55A 4LC9B 3HM9A 3T1AA 5F0XA 3WXMB 2W6LA 3J81O 4FJXA 3M3ZA 5C2FA 4LF6K 1EXQA 3VGLA 4O4GA 4ZTJA 3J8AA 3VESA 4NXNK 3O4WA 3WQUA 3V1QA 4AHSA 3S41A 2Z1IA 4H5VA 3EZ5A 5DK5A 3K5NA 1FJGK 1RGIA 4CEFA 4EZ9A 4BG8A 4U7BA 3F9MA 1RT2A 3HI0A 3FFIA 4JI4K 5HROA 3HSCA 3FZFA 4BRDA 1VQKN 4FJLA 4LFCK 5CZ2A 3OYEA 2JWLA 2HOEA 4B08A 5HRNA 3U3YA 3GOIA 3A5LC 2OPRA 1XI1A 4X65K 4GMJB 1K6YA 1OVYA 1XQSC 4FJ7A 4ELUA 1JL1A 2FBTA 4FPBA 2JGUA 1ZBHA 1DTQA 1B9DA 1RFQA 3AV9A 4IJAA 2J4RA 1KSPA 4DMNA 3AY9A 1X9MA 3CF5L 2GUPA 4JRPA 3JAMO 1TKDA 4YOXA 4JI5K 4CEQA 2QKBA 4KHUA 4OGCA 4H5TA 3HP6A 4E19A 4K42A 3C6HA 2PZSA 4O44A 3QMLA 1QTMA 3VF6A 2B5JA 4I6MA 1WB9A 3FR0A 3ZSVA 1QSYA 3TAPA 1NNEA 4LH5A 1S1UA 4DLEA 3K59A 1VQON 4X64K 4JK9A 4J2EA 1HYVA 4JHDA 5FPMA 4DR3K 1NU0A 1BU6O 2PAVA 2A3ZA 4CJ7A 3THVA 2F9WA 3CYMA 3NH1A 3TR8A 1RTIA 2P9NB 1KLNA 4FJKA 3WNHA 3LWLA 3CFOA 3AVFA 4RWTA 3R8EA 2YHXA 4NLCA 2X74A 3LPTA 1VSLA 4M3TA 3CIPA 4FPAA 4TSXA 3B6OA 3HVTA 1F21A 5DM6L 1NMNA 2YKMA 5AQZA 1V4SA 3NH2A 1U6ZA 3O9RA 2CGJA 2F8TA 5HRRA 1OH6A 2V7ZA 4FW2A 1LW2A 2RE2A 1NK9A 4Y0WA 2A5XA 1N36K 1L5UA 2CH5A 4MDBA 3SK3A 2KQ2A 4CI6A 3O3FA 3JXUA 3PO4A 4CECA 4FWKA 3KJVA 3LDSA 3LALA 3K5OA 1RT5A 4I2QA 4CZKA 1NJZA 1K8KB 1YITN 3GE1A 3FLCO 2HHVA 3QICA 2OPPA 2VGMA 3SV4A 4XEIA 2OPQA 4JK7A 3VEXA 4A2BA 1KVCA 5JS2A 1JCFA 3NCIA 4C8LA 3SQ4A 1T8EA 3OVNA 4PKIA 2EX3A 3IFRA 3L2WA 4CIEA 3CJAA 3HJFA 4CD1A 3EO3A 4RG8A 4CZHA 3I56N 3TAFA 5CR4A 4G9ZA 3MN5A 1NOYA 4FXDA 4CJKA 4YHHK 2P9LA 2YJFA 2XRIA 5EVZA 1R0AA 5ADXH 5I42A 1VQMN 3SCXA 2KZMA 5J2MA 2UXBK 2D0AA 1RCHA 2YKNA 1RBRA 3CQXA 3ATVA 4HVJA 1NK0A 2YNFA 1Q86O 1TAQA 4B1ZA 2NRXA 4B9SA 4KAZA 3CCRN 2HHHK 4AHVA 4DV2K 3A5MC 3U8XA 3VEZA 2E6LA 3PSIA 3A8YA 3VPZA 4GKJK 2F8SA 4CJSA 3PLAA 4WF9L 3OBYA 4EHTA 4ICLA 1LOTB 4KFBA 3THYB 2UUBK 4H5WA 1NG9A 4E0DA 4F8RA 3D2FB 4F4KA 2IIRA 1NGJA 3MN9A 3DMJA 3KLFA 3PY8A 3VEVA 4QCLA 5M1KA 3H46O 5LY3A 3SMSA 1NOZA 3KK2A 3P38A 4FYDA 5M1QA 5JLHA 5AQLA 3H1VX 3OS0A 3TTCA 4CGIA 1QQMA 4FWQA 3NGYA 4A2AA 2RHKA 1WAFA 3CJ7A 1Z26A 1S1XA 1KCFA 4JI7K 4X62K 4IEIA 4DQRA 1I3AA 2HHSA 2ZJRL 5ADXA 4CFCA 3H6EA 3O4QA 2CGLA 2IAJA 4CJFA 2B4JA 1YVUA 1SL2A 3CG7A 1U48A 4XH4A 4B3TK 1D5AA 3RSEB 3PUFA 1OVQA 3TTFA 3QEVA 5E84A 1U49A 4BC5A 3MECA 5JLFA 4IKFA 1VQ4N 4FOIA 4B1YB 5KPRA 4B9NA 5FRNA 5FPEA 2IVPA 3M5RA 2NRRA 2E2PA 1CLQA 3CM6A 1Q81O 2BANA 2WUSA 4CHZA 4DS4A 2P9PB 1FW6A 2FSNA 4KREA 5BPMA 4RW8A 4QS9A 3I55N 5AZIA 4Q0BA 2E6MA 2BUPA 3C6TA 4FZXC 1BUPA 3DYAA 3U3GA 1S6PA 3ZSRA 4BRIA 3LM9A 4LY7A 4F2RA 2HVIA 4B9QA 3VA0A 4IFEA 2YNGA 2ITGA 4AM7A 4CD3A 2P9KB 3L2QA 4Z4EA 3AVKA 4FJGA 3VQ4A 2FC0A 1MDUB 3QB0A 1VQPN 3F9KA 4FJNA 4DF8A 3OS1A 2OZMA 4FJIA 1U45A 1EETA 2YNHA 3W0LA 3QEPA 4NCAA 1N33K 3MEGA 1SKWA 1VQ8N 3QIPA 3LP2A 3G6EN 1HNWK 4BROA 1BWFO 4ILHA 4KHPK 4CF1A 3L3VA 3TU5A 1EP4A 3HRGA 3H1QA 3S3OA 2WFBA 5DM7L 2UU9K 4BR7A 1RBUA 5HOOA 4JKFA 5J2QA 2VGNA 3DLGA 2HHXA 3Q7CA 4DU3A 2G8VA 2ZWHA 3ID8A 4YDUC 1QQCA 4BC4A 3DLBA 1IKXA 2QWNA 2QWPA 4FWNA 1NBWA 3GBTA 3ZETB 1LAVA 1EO1A 1C0GA 2UXDK 3ZT0A 4K8ZA 1X3NA 2A1SA 1NM1A 5EU7A 3SJHA 3L3UA 4QS7A 2LSNA 1EX4A 4KHSA 2DTUA 3CHWA 2VWBA 1NKCA 4EHUA 3OYAA 4C8NA 1BDGA 4FLYA 4BGBA 1D9FA 2NLXA 3SQ2A 2D1KA 5CHIA 4H4MA 4DSIA 4DTMA 3ZCMA 1GLDG 4RW6A 4YOVA 5BN9A 5M1PA 2HF4A 5AQJA 3QIOA 4CJ5A 4Z4HA 4CZGA 3HZ6A 5GIPA 4B9UA 5AZIB 4GVMA 2P9PA 4BRGA 2E5LK 1KVAA 1YT3A 4A62A 4GV9A 3QFPA 4JV5K 3CCJN 1TKZA 4BQLA 5AQYA 5KQ8A 3TTDA 3KVGA 3S9HA 4JI2K 1M1KO 3SJJA 3T1YK 4O5BA 2ZM6K 4FLXA 4PL8A 3THYA 1XUPO 1NGDA 5TKYA 4FLWA 4K43A 4E1NA 4B9MA 4CEAA 1XC3A 3V9UA 1IKYA 4AHUA 4HHTA 3IAYA 5EXWA 4PL7A 4CZIA 4CZMA 4FM1A 4BVPA 3AO4A 1WNSA 1WSJA 4O0IA 3P83D 4YOUA 2PY5A 4B3SK 2IDOA 3ZSWA 2GWJA 1HKGA 3O9QA 2AJQA 1NGEA 4CK3A 4AHTA 4BQZA 1GOBA 4FW1A 4DQSA 3O08A 3OY9A 4CK1A 3K9KA 3BF3A 1YVNA 5HRPA 1YIJN 4UQGA 4CCHA 4ILJA 5J2NA 1ZYQA 5BRHA 3AVAA 1BG3A 3DLHA 2HBKA 4B1XB 1T03A 2ETJA 4CF2A 3ZX3A 3OBWA 4IZ9A 2V7YA 4OJRA 4M7YA 1QZ5A 5BRFA 3UB5A 2VCPA 4I6MB 3VEOA 3TAMA 2OTLN 4DR6K 4HUGA 3K2PA 3F73A 3L6QA 4GV3A 1ILYA 3MWPA 4FLVA 5AQSA 1MWKA 1VQLN 1QE1A 4WFNL 3UKRB 4O8UA 3T7ZA 3QERA 3TANA 1BQNA 5FDLA 1IO2A 1JLGA 5CE3A 1HPZA 3L4IA 3CCQN 4JS5A 4OKJA 1RDUA 1J9AA 3N4QA 1ATSA 1S1WA 3UE5A 4WCEL 3MAQA 2OTJN 2O8CA 2BDPA 3SYZA 5HP1A 1B9FA 3DRSA 3AARA 3V1OA 1SAZA 1XHXA 3MN7A 4J2BA 3T1HK 1W9HA 3C65A 3AA4A 4BE0A 3TARA 1ATRA 1BIUA 5M1FA 4CJEA 4JKGA 4OKEA 1YHQN 3BP8A 4FM0A 4GKKK 3BZCA 4WQ5C 1NJWA 2I5JA 4O5FA 4KH6A 1S9GA 2UUCK 2O8CB 1EQYA 2Q3SA 2PYJA 3NH0A 4M3WA 4DTPA 2E1ZA 1A5WA 2Q0RA 1DTTA 3A5OC 1U2VA 4BDPA 3T19A 3O3GA 4RW9A 1SQKA 3DRRA 3JS6A 2NRWA 1T05A 1A5VA 1CZAN 4CERA 4BR2A 1GLEG 4NB4A 3VQ5A 3ZSYA 4DTOA 3ULDA 4HWIA 4RTFD 4KTQA 4MFBA 4Z4FA 2YHWA 3E01A 3QESA 4BR5A 3OTOK 1BI4B 3AVCA 1P90A 4M63C 3G10A 4DFKA 3AVNA 3OYIA 1XNRK 5C12A 2HHQA 3WEEB 1HLUA 4JKBA 5BR9A 4DTXA 1ITGA 2W41A 2FBYA 1JXBA 3THWA 3SUNA 3H45C 4B3OA 3THWB 3CJ1A 3OHRA 5EX5A 1X3MA 3DLEA 3ZSOA 2YHBA 4O8KA 4CF9A 2G8HA 1W97L 2QWLA 1QZ6A 3AVGA 4KI6A 3RVCA 4RCHA 2XY5A 1XNQK 1KRPA 3EZWA 2WOMA 1WOQA 3ID6A 4DB3A 2IS3A 5AQUA 4GV6A 4EFHA 2QW9A 1NGHA 4Y1CA 2KTQA 2ZF5O 1QQNA 2KLAA 4DS5A 2Q2RA 3MEEA 4BWMA 5M1OA 3VENA 3I8BA 4IJNA 1M90O 1ZXOA 2AP1A 5C25A 3M6GA 1SKRA 1E3MA 3VGMA 1VQ7N 2HBLA 4FWLA 3SPZA 3EKSA 4CGHA 5KPZA 4OVLA 3WXIA 4NYFA 3THXA 1X1PA 2WTUA 4ID5A 3O9TA 3VF2A 1OKJA 4CJTA 3P5JA 1IBMK 3ENBA 2P9IA 3W3DA 2NUBA 4F3OA 1YUWA 3U6FA 4F3TA 4A5AA 4CGGA 1CZBA 1KAYA 2Z1JA 3T69A 1U2VB 1NK7A 1C1CA 4I9LA 4E1MA 4WYBA 3RWUA 3SBTA 1RT7A 4PWDA 1WSHA 2ZQBA 3MXJA 3C7NA 4YORA 3AVMA 2CGKA 1JL2A 3K5LA 3ULEB 1C6VA 3UKUA 5J2PA 1C1BA 5A2QO 2DFEA 4J2DA 3NGZA 1HNXK 3QETA 3GDQA 4WFBL 4FLZA 5AQIA 1N32K 1BA0A 3TAQA 1TK8A 2E2QA 2P9LB 2ASPA 3K58A 1GOCA 2G8FA 3C95A 4YOYA 3P4IA 2DFFA 3RMCA 1KXPA 4CJ4A 1XWLA 1HKCA 3TWHA 1RTDA 1XHZA 2OPSA 5FROA 1HJOA 1NGCA 5D3GA 2RPIA 4FWSA 4M3ZA 4CJWA 3AA5X 4KO0A 3UKRA 1K9MO 4KKOA 3SUQA 3AVHA 2O8DB 1A5XA 3ZSZA 3K0SA 5I9EB 4ILGB 5KQDA 2HVHA 1KFDA 5BN8A 3CCEN 1HUXA 4DTNA 1X9JA 4ISFA 1NKBA 2JLEA 5AQWA 4CEEA 3MWTA 4A5BA 2BH1A 3V9ZA 1HNIA 3LDLA 3ENOA 4OKKA 5JVHL 2QM1A 5TKWA 1XMQK 2ATQA 3PX4A 3NDKA 4CGFA 1JJ2M 3SQ1A 3C0BA 3ITHA 3TAGA 1LW0A 3OYNA 3AO2A 1S1TA 3AO1A 2Q1NA 2G8KA 1JCEA 2FF6A 5FPDA 5GAGP 5IWAK 4QAGA 1J5EK 1TKXA 2YV0X 3MXIA 4LF4K 3HOTA 4G1QA 2GTDA 2FXUA 3P1GA 2FF3B 3J7YP 1IG8A 3SQ0A 4BRHA 3WQTA 5C10A 4DR5K 2VWKA 1IBKK 3D6RA 4DR7K 3ZYYX 3DLRA 3O1BA 3L8BA 5AQNA 4IOAL 4FZYA 1NK4A 1S22A 1BHLA 2PYLA 4ZTFA 5AQRA 4FJJA 4BREA 3BEXA 4FWMA 3E1YA 1WN7A 4PQUA 2D0CA 4OX9K 3PSFA 3D2EA 3ATUA 5C15A 4NLBA 4IFVA 4ELVA 5AJ3K 1J53A 1RTJA 4CFDA 1NKEA 3OYKA 1YJWN 2ZGZA 1RTHA 4E7IA 4NYNA 4I9QA 4B8AB 4DV4K 4IFYA 5AR0A 4BWJA 3LDNA 3DRPA 3NAEA 4BE2A 4IOCL 4HTLA 3NVKA 3CI5A 4HUEA 2FSJA 3ASMA 3TPQA 5KRSA 1E4GT 1XMOK 3C6AA 3ZT1A 5AQGA 1TUUA 2O8DA 2Y1JA 4NXMK 3SZ2A 3H3NO 3MN6A 3VQEA 4CEDA 4C8MA 1YTAA 3A5NC 4H0TB 1TKTA 4DV5K 4DKWA 3DXKB 2X6NA 3IG1A 4H0OA 1N5YA 3B6PA 3VERA 4DLGA 4MDAA 1NGGA 1NWKA 1WSGA 4GNIA 3JYTA 1RT1A 3E9PA 1NJIO 4A59A 1QVGM 4M3UA 2AA4A 4FWPA 4AILC 4KBOA 3VQ7A 2RN2A 3TAEA 1VQNN 1WSEA 1Q8IA 3FZLA 3HXMA 1VRUA 4BRNA 4L8RB 4PHTX 2HNYA 3LAKA 3M8SA 3V9XA 4OO1J 3VQ6A 3WXLA 4FM2A 3H08A 4KHQA 1XC9A 3KWIA 3UKUB 4JI1K 3OYDA 3HVRA 2D4WA 1J6ZA 4C1NK 5MLCQ 2FLOA 2HMPA 3Q7BA 3DM2A 3R3LA 4HTUA 4CJLA 2BE2A 4R79A 2NRHA 2KHOA 3KLEA 3P39A 1NLVA 3PX6A 1X9SA 5AQFA 2GWKA 1L3VA 1RILA 4EAHD 3GG4A 3HO1A 5KGXA 2OCEA 1T7PA 4E3SA 1BO5O 1Z6RA 1SL0A 3SLCA 4JRQA 3E9OA 4W5RA 4N76A 4K8XA 3VA3A 1N34K 4WE1A 2RF2A 3ZT4A 1WBDA 3DWLA 5C0YA 1FKPA 3D2EB 5AQHA 4IG0A 4JNEA 1U47A 4DQQA 4OLAA 4LH4A 3OJUA 2DY4A 5AQKA 1IKVA 4K0KK 5KRTA 3CPWM 5GADP 2GV9A 4HCBA 3EL2A 4DR2K 3NMUA 4BRAA 3LPUA 4J2AA 3QO9A 4JHDB 4IDHA 1UAXA 3J7ZO 4KTZA 2ASMA 3K57A 2O8BB 3SPYA 1IKWA 3VQQA 1VQ6N 2KZZA 1SZ2A 3HBTA 2E2NA 1QQOA 4C8OA 4E7JA 2Q36A 3OYGA 4JI8K 2I7PA 1NGAA 5K14A 1FK9A 3BF1A 1YXQA 1L3TA 3TSPA 4CZJA 1CXUA 4N47A 1GLBG 3BUZB 3MCPA 1WSFA 3SUOA 4N5SA 3VF4A 2E1YA 3QNNA 1TAUA 1VRTA 3VOVA 3THXB 1NK6A 3WT0A 1N6QA 3KWGA 3TSUA 4JKEA 5BR8K 2O8FA 2F4VK 4AH9A 2KFNA 2P9UA 2A42A 2RKIA 2CH6A 2PBDA 4LF5K 2UXCK 4YDUA 3DXMA 2P9UB 2O4GA 3ZT2A 4EP4A 2E4LA 1VK0A 5BREA 3M8RA 4H0PA 3QEWA 4DR4K 1HQEA 1RDAA 1ZBUA 1T3VA 2PFUA 4CZLA 4DCHA 3G4SN 4LF8K 3O3HA 3D2FA 5AQTA 1Y97A 2NRVA 3MMVA 3VQPA 4JS4A 1G15A 1GLCG 5LL6Z 3CQ8A 4IEEA 3NFAA 1RDDA 4H4OA 4CZFA 3I8DA 2VG5A 3G0ZA 3AAQA 5FLXO 1KLMA 1L3UA 2NRTA 4Y1DA 3OYHA 1TK5A 2ASOA 2IVNA 3AA2A 1KQSM 3VGKA 1T6CA 4JAXA 3ZEUB 1TYQA 4Z4CA 3OYBA 3DOKA 4BG9A 1EKEA 3NF7A 2XY6A 1T6DA 4FZZA 1JLAA 1WSIA 3CFRA 1RBTA 4E89A 3VQ8A 2QWRA 1J5OA 1HPMA 1VSMA 2GELA 1YJ9N 2F9TA 4FL9A 3CCMN 4JI0K 4YOWA 3ZLJA 2D0BA 4DSFA 5KPTA 3NHGA 1Y64A 2QA4N 4WQ5A 3OW2M 4BRKA 4PA1A 3O9SA 1WBBA 2D5RA 3MCAB 1K73O 1S5JA 4DTJA 1ZBIA 3BZKA 1QSSA 3PO5A 4KV8A 2GUIA 2HHUA 4NCGA 4CK2A 4GW6A 4RW7A 1C1AA 3SBGA 3UIQA 3MX2A 3AVLA 3RR8A 5AQOA 2Z1GA 4H03B 2OZSA 4BDZA 3EYZA 4R5PA 3AGKA 3M8QA 4CJRA 1L3SA 4QS8A 2EWSA 1DT9A 2HSTA 1S72N 4I2PA 1REVA 3VMFB 4B9TA 3CCLN 1X9WA 4BR4A 3RRGA 1ASVA 3LAMA 4DU1A 1QHAA 4XH1A 3NF8A 4BDYA 3G71N 4M3XA 4BVOA 5BPNA 1GLFO 4PKGA 1I39A 4OPHA 3CXCM 4CJUA 3OYFA 1U04A 4BACA 2HNZA 3QLHA 1K8KA 1Q7YO 3WEEA 4WQ4A 3HSTB 4IWVA 1KTQA 5AQMA 3WUHA 1D9DA 3I33A 3C7NB 2VYPA 3LP0A 3O4NA 4CJPA 3DLLL 2QK9A 3OJSA 1S1VA 1VAZA 5T7BA 1Q9YA 4DU4A 3A2FA 2NZTA 5F1XA 3L2UA 3L2VA 3VTIA 3SV3A 1YAGA 5H1SQ 3O8MA 3QINA 5CZ1A 3SI6A 1C0FA 5I3UA 4FLTA 1C0MA 1JLEA 1LWCA 3V81A 1G99A 3G25A 3MXMA 3IMXA 1JLBA 2P9KA 5HLFA 1R59O 2D0OA 4CBWA 4CIGA 5F2RA 4F2SA 1TUYA 4F9OA 3PIPL 1ZC6A 1NK5A 4LFBK 2XHBA 1D8YA 5C24A 4DFPA 2QXFA 5C42A 1BL3A 3CMAN 4RW4A 3O9UA 3LDOA 1ASWA 3CCUN 4CBUA 3DXMB 3HT3A 5BPLA 1VSIA 2P5OA 4KHYA 3QFUA 1W0HA 5B8HA 1MA9B 1JXEA 1S3XA 1JLCA 4M7XA 2IGIA 4DSJA 1MU2A 4DSLA 4KRFA 4BRPA 4U67L 3KD5E 2P1JA 4H5NA 3CCVN 4JKGB 3NGIA 3CM5A 3RR7A 2DFHA 2OANA 3AVIA 4FJMA 3D45A 2VWJA 3CMEN 4J8FA 1OH5A 1RNHA 1TK0A 3K5MA 1FKOA 4DQIA 4EIAA 4A61A 4B1UB 4BRMA 3U9DA 1BCOA 1YJNN 2YJEA 3NVMA 3AO3A 3HOSA 5C2DA 5E26A 3KLGA 2O8FB 3L2RA 3ZSXA 3IKMA 2HB5A 5KI6A 2I7NA 3I0SA 4Q5VA 3PV8A 1N8RO 4AM6A 2VG7A 5AZJA 4CVNE 2IC3A 3DI6A 3FZMA 4CHQA 3HPOA 4DTSA 1HYZA 4CF8A 4CGJA 2VQEK 4CHNA 3MK6A 2DPNA 4WFAL 4Z4GA 4MLHA 4ID1A 3OS2A 4M42A 4Z4IA 1WAJA 3M8PA 1BISA 2P9SA 3EE9A 4LSLA 3SUPA 4MLEA 5E41A 3CJBA 3JSMA 4KHWA 1D4XA 4H0YB 3BDPA 3D7EO 3P31A 1SS6A 1W2BM 2Q31A 3O1WA 4KH4A 2IVOA 3H3OB 2FBXA 1HNVA 3LWMA 2A41A 1KAXA 3NE6A 3HYFA 3OYJA 4HUFA 1VSHA 2A1RA 4JI3K 1SL1A 4JEPA 4DUZK 4DHYA 4YNQA 1JLQA 1DLOA 4CGDA 4IO8A 3AAPA 2O8EA 4BR9A 1IV0A 4DV1K 2F7TA 4BR0A 4CE9A 4XIUA 4BC3A 3IS9A 5CYMA 4BE1A 5GIOA 4DWIA 3F5TA 2FBVA 2WONA 3O6WA 2QWQA 1OH8A 2E88A 4C23A 3AGRA 3HPGA 2HHTA 4CHOA 4O0JA 4FK0A 2P9IB 3SAGA 2ZJQL 1U4BA 4H8KA 3CC4N 2O8EB 1B92A 3CQYA 2UYTA 3SMPA 1VSDA 3V1RA 1GLJO 2OA8A 4KH5A 4GVEA 3DJCA 3KLHA 2VQFK 3WXKA 4JKAA 3E66A 3CCSN 3LDQA 2ZE2A 4XH5A 1KFSA 3LP3A 2UUAK 4CHYA 1P8ZA 4FVMA 4B1WB 1HNZK 1VQ5N 1BCMA 4DG1A 4W5OA 1VSFA 3L0QA 3KZBA 4CEZA 4DUYK 1Z05A 4H0XB 3ZSQA 1Q9XA 3V6DA 1IBLK 5FPNA 1FXXA 1S9EA 1UOCA 3RMBA 4L3QA 1UA1A 1SKSA 3B8AX 1BI4A 2G8UA 4FCYA 1I94K 3EKUA 2Y1IA 1K8AO 1BIZA 3LZJA 5GAHP 1NGIA 1H1VA 1SUQA 1UWBA 4V19S 1RT6A 1Q18A 3VQCA 4E7KA 1GLLO 1IJJA 4CJVA 4B8CA 3DLKA 3HPHA 3CD6N 5LJWA 1HMVA 3NF9A 1S6QA 1TV6A 4AHCA 3ZEUA 3OYCA 4KB1A 2KW4A 3SAFA 2P5GA 2YI1A 5KTQA 1MWMA 1HQUA 1BQMA 3ZX0A 4FJ5A 1C0TA 3IRXA 5GAEP 2HF3A 3J80O 3SNNA 3OA9A 4ISGA 4ELTA 2E2OA 4W5TA 1GLAG 5EY4A 4B3RK 4OLBA 2VG6A 1LV5A 4B1VA 4CZEA 4JKHA 4KB0A 1BOTO 4LF7K 3BY5A 2HMIA 2Q0UA 3CPEA 3DOLA 1ATNA 1HKBA 1O1WA 2O4IA 3TI0A 3SAHA 1ZBFA 2ZD1A 2QTDA 2ITMA 4B9VA 4FJ8A 2B6AA 3VQAA 3RMDA 3VTHA 4IXCA 2KFZA 2YHAA 3ZETA 4FWOA 3ALYA 3EE8A 4OPAA 3BGRA 2HBJA 3AA3A 3FGUA 2KKZA 4JK8A 3VEYA 3QDKA 3NF6A 5LJVA 1W7AA 2Q97A 1RDCA 3C6UA 3GL1A 2W40A 1VSKA 3MEDA 1WUAA 4JD2B 1VSJA 4QOZB 4N56A 4ISEA 2QWMA 2WC9A 1EWRA 1HX1A 4Z0UA 4IDKA 3EY1A 4OGEA 3CERA 2XY7A 3K9JA 4GY2B 2P9SB 2W42A 3OYLA 3KLIA 1YI2N 4Z94A 4BY9C 4JI6K 1ESVA 3VQ9A 4DF4A 4KHNA 2Z1HA 5HBMA 5KGWA 3LL3A 3RSEA 1IH7A 3QNOA 1QVFM 1RDWX 5ELZA 1KAZA 1ASUA 2QWOA 1NK8A 3QBXA 3ULEA 4FO0A 3KKRA 1TL3A 4DTRA 2W6KA 4ZHRA 2ZJPL 4M45A 3FE1A 3U4LA 4DV3K 2A6AA 5HL7L 1BGXT 5IT9O 4KTWA 2O8BA 2ZGYA 1RBVA 4CEBA 4DFMA 4DR1K 4BC2A 2E8AA 1QSLA 3KD1E 4OPKA 3AVBA 2H3GX 1DEJA 4AHRA 4E7HA 1KC8O 4KI4A 4FVUA 1ZBSA 2D0PA 4IOXA 2NRZA 1VSEA 3FZHA 3O80A 3DAWA 3PIOL 1LAWA 4JYAK 4CIFA 3U9ZA 1HJRA 3LANA 4CF0A 5JICA 1J54A 4JN4A 1TL1A 4BRLA 5AQPA 1KVBA 4CW7B 2NNWA 3EN9A 1NJXA 2P9NA
chains in the Genus database with same CATH topology
3A8YA 2WBNA 3ENBA 3VPZA 2P9IA 1QHAA 5AQQA 4XH1A 3W3DA 3PLAA 4WF9L 3OBYA 4EHTA 3G71N 1YUWA 4H0VB 4BVOA 5BPNA 1YF5L 1LOTB 4A5AA 1GLFO 4PKGA 4OPHA 3CXCM 4H5WA 1KAYA 3D2FB 3T69A 1U2VB 2IIRA 1NGJA 3MN9A 3VEVA 4JD2A 4PKHA 5M1KA 3H46O 5LY3A 4WYBA 3SMSA 1K8KA 3M1FA 3P38A 3SBTA 4WQ4A 5M1QA 3WEEA 1Q7YO 5JLHA 4IWVA 5AQLA 1OKJA 3H1VX 3E9LA 3TTCA 4UY8O 4JKDA 5AQMA 3WUHA 1QQMA 4FWQA 5AFUH 4A2AA 2RHKA 3C7NA 4YORA 4E1JA 2CGKA 3CJ7A 3I33A 2E20A 3C7NB 3CETA 3ULEB 2VYPA 3UKUA 5M1NA 3DLLL 3HM8A 2V51B 4IEIA 3ZX2A 1VAZA 2NZTA 4WQ4C 3GDQA 5F1XA 2ZJRL 5ADXA 4WFBL 3VTIA 5AQIA 1YAGA 3LDPA 4DQ8A 3O8MA 1BA0A 3H6EA 5H1SQ 2CGLA 2E2QA 1C0FA 2P9LB 4XH4A 1LCUA 3RSEB 3HTVA 3CC2N 2ASPA 3TTFA 3NVKA 5E84A 1G99A 4BC5A 3VEWA 4JKCA 5JLFA 1T44A 3G25A 3P4IA 4YOYA 1VQ4N 1KXPA 4FOIA 1HKCA 2YHYA 4B1YB 4C1NI 5KPRA 5FPEA 3IMXA 2IVPA 2P9KA 1HJOA 3FZKA 1NGCA 1R59O 2D0OA 2NRRA 3M5RA 4CBWA 3R9PA 2E2PA 4FWSA 5F2RA 1TUYA 2GEMA 4BRFA 1Q81O 2WUSA 3UKRA 4F9OA 3PIPL 1ZC6A 1K9MO 2HBMA 2P9PB 2FSNA 5BPMA 4QS9A 3I55N 5AZIA 2BUPA 1BUPA 5I9EB 3CMAN 4BRIA 5AFUA 3LM9A 3WXJA 3O9UA 3LDOA 4ILGB 4B9QA 3CCUN 4CBUA 1BA1A 5KQDA 4IFEA 3DXMB 3IDHA 5BN8A 4AM7A 4FSVA 4CD3A 3TSQA 2P9KB 3CCEN 5BPLA 1HUXA 2GX9A 1X9JA 3QFUA 2BTFA 1MDUB 5B8HA 1MA9B 4ISFA 1S3XA 3QB0A 1VQPN 4M7XA 5AQWA 3MWTA 4A5BA 3R1XA 2BH1A 4BRPA 4U67L 1DGKN 3LDLA 3ENOA 3VETA 5JVHL 2QM1A 5TKWA 3L4QA 3W0LA 4H5NA 3CCVN 4JKGB 1VQ8N 1JCGA 3N4PA 3G6EN 1JJ2M 2FSKA 1BWFO 4NO7A 3CJ9A 3C0BA 3IUCA 4ILHA 4BROA 4K25A 5BRDA 2QXLA 3TU5A 2OANA 3HRGA 3H1QA 2WFBA 1NGFA 2Q1NA 5DM7L 4BR7A 5HOOA 3CMEN 4J8FA 1JCEA 4JKFA 2FF6A 5FPDA 2VGNA 5GAGP 3Q7CA 1KD1O 4EIAA 2ZWHA 3ID8A 1NGBA 4YDUC 5JMVA 4A61A 4K41A 4B1UB 4BC4A 4BRMA 2V52B 3MX5A 3U9DA 3HOTA 1YJNN 2YJEA 3NVMA 4MO4A 1V4TA 3HOSA 2GTDA 2QWNA 2QWPA 4FWNA 2FXUA 5C2DA 5E26A 1NBWA 3GBTA 3ZETB 5AQXA 1EO1A 3MDQA 2FF3B 3IKMA 5EOYA 1C0GA 2JWKA 1IG8A 4BRHA 3R6MA 3WQTA 5C10A 2I7NA 3D6RA 3CJCA 3ZYYX 3O1BA 5AZJB 1N8RO 5AQNA 4CBXA 4AM6A 1X3NA 4A57A 4IOAL 1NM1A 5AZJA 3SJHA 1S22A 4QS7A 1VQ9N 4BRCA 2QEXN 3CHWA 2VWBA 3FZMA 5AQRA 4IO9L 4BREA 3BEXA 4FWMA 4EHUA 1BDGA 3E1YA 2YCHA 4MO5A 3MK6A 1DKGD 2DPNA 4BGBA 1NMDA 1TYQB 2NLXA 4WFAL 3D2EA 3ATUA 5C15A 4NLBA 4MLHA 2D1KA 5CHIA 1YJWN 2ZGZA 4FOEA 3LM2A 5AQVA 2P9SA 3EE9A 4FWRA 5GINA 2QI2A 4MLEA 3ENHA 1GLDG 5AR0A 4YOVA 3CJBA 5BN9A 3KHYA 1D4XA 3LDNA 3KK7A 5M1PA 4H0YB 2HF4A 5AQJA 4YOTA 3D7EO 3P31A 4AF1A 3O5BA 4IOCL 1SS6A 4HTLA 4CZGA 1W2BM 2Q31A 3CI5A 3HZ6A 3O1WA 2A40A 2IVOA 3H3OB 4KH4A 2FSJA 5GIPA 5AZIB 3A0IX 3TPQA 1E4GT 2P9PA 3QBWA 2A41A 3C6AA 1KAXA 5AQGA 1TUUA 4BRGA 3VF2A 4BGAA 4JEPA 4A62A 2YX6A 4GV9A 1E4FT 4DHYA 1Q82O 3H3NO 1O13A 3MN6A 3QFPA 3CCJN 3CC7N 4BQLA 5JVGL 3A5NC 4H0TB 4BRQA 5AQYA 5KQ8A 4IO8A 3TTDA 3DXKB 3AAPA 3FFKB 3KVGA 4DKWA 4H0OA 1M1KO 3DXKA 4BR9A 2F7TA 3VERA 4BR0A 4MDAA 4BC3A 1NGGA 4H5RA 1NWKA 4GNIA 3F2KA 4PL8A 5GIOA 4LC9B 1XUPO 3F5TA 3E9PA 5F0XA 1NGDA 1NJIO 5TKYA 4A59A 4K43A 2AA4A 3O6WA 3WXMB 1QVGM 4FWPA 3M3ZA 4KBOA 5C2FA 2QWQA 2E88A 3VGLA 1XC3A 3AGRA 4C23A 1VQNN 3FZLA 3J8AA 2P9IB 3VESA 4BRNA 3O4WA 3WQUA 4PHTX 3SAGA 2ZJQL 5EXWA 4PL7A 4CZIA 4CZMA 3S41A 3CC4N 4H5VA 4BVPA 3CQYA 2UYTA 3SMPA 1RGIA 4OO1J 1GLJO 3WXLA 4KH5A 4GVEA 3KWIA 4YOUA 3DJCA 3UKUB 3WXKA 2D4WA 4BG8A 4JKAA 4U7BA 1J6ZA 4C1NK 3F9MA 3E66A 5MLCQ 2GWJA 1HKGA 2FLOA 2HMPA 3HI0A 3LDQA 3Q7BA 3O9QA 3R3LA 4XH5A 1NGEA 3CCSN 4BQZA 4R79A 1P8ZA 3HSCA 2NRHA 2KHOA 3P39A 1NLVA 3FZFA 4B1WB 4BRDA 1VQ5N 3O08A 1VQKN 3K9KA 3BF3A 1YVNA 3KZBA 3L0QA 5AQFA 2GWKA 2JWLA 1Z05A 1YIJN 2HOEA 4ILJA 4H0XB 5BRHA 1BG3A 3GOIA 4EAHD 3A5LC 3GG4A 2HBKA 5FPNA 4B1XB 1BO5O 4L3QA 1Z6RA 3ZX3A 1OVYA 3B8AX 1XQSC 3E9OA 3OBWA 3SLCA 4IZ9A 2V7YA 3EKUA 4M7YA 1K8AO 3DWLA 1QZ5A 5GAHP 5C0YA 5BRFA 4FPBA 1NGIA 3UB5A 3D2EB 5AQHA 2VCPA 1H1VA 4I6MB 4JNEA 1RFQA 3VEOA 2OTLN 4IJAA 2J4RA 3AY9A 1Q18A 1GLLO 3CF5L 3L6QA 1IJJA 2GUPA 5AQKA 4GV3A 1ILYA 3MWPA 3CPWM 4YOXA 5AQSA 5GADP 3CD6N 3EL2A 5LJWA 3NMUA 1MWKA 1VQLN 4BRAA 3ZEUA 4WFNL 3UKRB 4H5TA 4O8UA 3SAFA 2YI1A 4K42A 3C6HA 4JHDB 3T7ZA 1MWMA 4IDHA 3J7ZO 3ZX0A 2ASMA 5GAEP 2HF3A 3QMLA 3OA9A 4ISGA 3VF6A 1VQ6N 5CE3A 4I6MA 2E2OA 3FR0A 3L4IA 3CCQN 1GLAG 1RDUA 1SZ2A 3HBTA 2E2NA 5EY4A 1QQOA 3N4QA 1ATSA 2Q36A 4B1VA 3UE5A 2I7PA 1NGAA 4CZEA 4JKHA 4WCEL 2OTJN 3BF1A 1YXQA 1BOTO 3TSPA 4CZJA 1VQON 2Q0UA 3CPEA 3AARA 1ATNA 1SAZA 3MN7A 1GLBG 1HKBA 3BUZB 4JK9A 3MCPA 4JHDA 5FPMA 3C65A 1BU6O 2PAVA 3VF4A 2A3ZA 4CJ7A 2E1YA 3SAHA 1ATRA 2F9WA 5M1FA 4JKGA 1YHQN 2QTDA 2ITMA 3VOVA 2P9NB 3BP8A 3WT0A 3KWGA 4WQ5C 4JKEA 3TSUA 3VTHA 4IXCA 4O5FA 4KH6A 3ZETA 2P9UA 2A42A 2CH6A 2PBDA 4FWOA 1EQYA 3EE8A 4YDUA 4OPAA 4RWTA 2HBJA 3DXMA 3FGUA 2P9UB 2KKZA 2YHXA 4JK8A 4NLCA 3R8EA 3VEYA 5BREA 3QDKA 5LJVA 4H0PA 2E1ZA 2Q97A 2Q0RA 3A5OC 3CIPA 3GL1A 4FPAA 2W40A 1U2VA 5DM6L 4CZLA 2PFUA 1T3VA 4DCHA 1WUAA 4JD2B 5AQZA 1V4SA 3G4SN 1SQKA 1U6ZA 3D2FA 5AQTA 3O9RA 2NRVA 3MMVA 4ISEA 2CGJA 2QWMA 2WC9A 2V7ZA 1GLCG 3JS6A 2RE2A 2NRWA 1HX1A 1CZAN 4IEEA 4Y0WA 4BR2A 1GLEG 2A5XA 4NB4A 4CZFA 4HWIA 4RTFD 3AAQA 3CERA 2CH5A 3K9JA 4MDBA 2YHWA 4GY2B 3SK3A 2P9SB 4CI6A 3JXUA 2NRTA 4BR5A 4FWKA 2ASOA 2IVNA 1YI2N 1KQSM 4Z94A 3VGKA 1T6CA 1P90A 4JAXA 4M63C 3ZEUB 4CZKA 1ESVA 1TYQA 4BY9C 1K8KB 4BG9A 1YITN 5C12A 3GE1A 3WEEB 3FLCO 1HLUA 1T6DA 4JKBA 3LL3A 5BR9A 3QICA 3RSEA 2VGMA 2W41A 4XEIA 4JK7A 1QVFM 3VEXA 3H45C 4A2BA 1RDWX 1JCFA 5ELZA 1KAZA 2QWOA 3CJ1A 3QBXA 3OHRA 5EX5A 1X3MA 2QWRA 3ULEA 1HPMA 4FO0A 2GELA 4O8KA 3IFRA 2F9TA 4PKIA 1YJ9N 1W97L 2QWLA 1QZ6A 4FL9A 3CCMN 3CJAA 3RVCA 4RCHA 4CD1A 3EO3A 4CZHA 3I56N 4G9ZA 4YOWA 5CR4A 3U8XA 2ZJPL 3EZWA 5KPTA 2QA4N 1Y64A 1WOQA 3ID6A 4WQ5A 3OW2M 3FE1A 4BRKA 3O9SA 4DB3A 3MN5A 3U4LA 3MCAB 5AQUA 2A6AA 5HL7L 1K73O 2P9LA 2YJFA 2ZGYA 5EVZA 4EFHA 4GV6A 5ADXH 2QW9A 1NGHA 4BC2A 2ZF5O 1QQNA 2E8AA 2KLAA 1VQMN 2Q2RA 2H3GX 1DEJA 1KC8O 5M1OA 3SBGA 3VENA 1ZBSA 3MX2A 2D0PA 4FVUA 4IOXA 2NRZA 5AQOA 4H03B 3I8BA 3FZHA 4IJNA 3O80A 1ZXOA 3DAWA 2AP1A 3PIOL 1M90O 3M6GA 3U9ZA 3AGKA 3CQXA 3VGMA 3ATVA 1VQ7N 2HBLA 4QS8A 5JICA 1Q86O 2EWSA 4FWLA 4JN4A 1DT9A 4B1ZA 2HSTA 3EKSA 4BRLA 5AQPA 5KPZA 1S72N 2NRXA 3VMFB 3WXIA 2NNWA 3CCLN 3EN9A 3CCRN 2P9NA 3O9TA 4BR4A 3A5MC 3VEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8Y A;  3VPZ A;  2P9I A;  1QHA A;  5AQQ A;  4XH1 A;  3W3D A;  4EHT A;  1YUW A;  4H0V B;  4BVO A;  5BPN A;  1LOT B;  1GLF O;  4PKG A;  4H5W A;  1KAY A;  3D2F B;  1U2V B;  2IIR A;  1NGJ A;  3MN9 A;  3VEV A;  4JD2 A;  4PKH A;  3H46 O;  5LY3 A;  4WYB A;  3SMS A;  1K8K A;  3M1F A;  3WEE A;  4WQ4 A;  5JLH A;  4IWV A;  5AQL A;  1OKJ A;  3H1V X;  5AQM A;  3WUH A;  1QQM A;  4FWQ A;  5AFU H;  4A2A A;  3C7N A;  4E1J A;  2CGK A;  3CJ7 A;  3I33 A;  2E20 A;  3C7N B;  3CET A;  3ULE B;  2VYP A;  3UKU A;  3HM8 A;  2V51 B;  3ZX2 A;  2NZT A;  4WQ4 C;  3GDQ A;  5F1X A;  5ADX A;  5AQI A;  1YAG A;  3LDP A;  4DQ8 A;  3O8M A;  1BA0 A;  3H6E A;  2CGL A;  2E2Q A;  1C0F A;  2P9L B;  4XH4 A;  1LCU A;  3RSE B;  3HTV A;  2ASP A;  5E84 A;  1G99 A;  4BC5 A;  3VEW A;  5JLF A;  1T44 A;  3G25 A;  3P4I A;  1KXP A;  4FOI A;  1HKC A;  2YHY A;  4B1Y B;  5KPR A;  5FPE A;  3IMX A;  2IVP A;  2P9K A;  1HJO A;  3FZK A;  1NGC A;  1R59 O;  2D0O A;  4CBW A;  3R9P A;  2E2P A;  4FWS A;  5F2R A;  1TUY A;  2GEM A;  4BRF A;  2WUS A;  3UKR A;  4F9O A;  1ZC6 A;  2P9P B;  2FSN A;  5BPM A;  4QS9 A;  5AZI A;  2BUP A;  1BUP A;  5I9E B;  4BRI A;  5AFU A;  3LM9 A;  3WXJ A;  3LDO A;  4B9Q A;  4CBU A;  1BA1 A;  5KQD A;  3DXM B;  3IDH A;  5BN8 A;  4AM7 A;  4FSV A;  4CD3 A;  2P9K B;  5BPL A;  1HUX A;  1X9J A;  3QFU A;  2BTF A;  1MDU B;  5B8H A;  1MA9 B;  4ISF A;  1S3X A;  3QB0 A;  4M7X A;  5AQW A;  4BRP A;  1DGK N;  3LDL A;  3ENO A;  3VET A;  2QM1 A;  3W0L A;  4H5N A;  1JCG A;  2FSK A;  1BWF O;  4NO7 A;  3CJ9 A;  3C0B A;  3IUC A;  4BRO A;  4K25 A;  5BRD A;  2QXL A;  3TU5 A;  2OAN A;  3H1Q A;  1NGF A;  2Q1N A;  4BR7 A;  4J8F A;  1JCE A;  2FF6 A;  5FPD A;  4EIA A;  2ZWH A;  3ID8 A;  1NGB A;  4YDU C;  5JMV A;  4A61 A;  4K41 A;  4B1U B;  4BC4 A;  4BRM A;  2V52 B;  3U9D A;  2YJE A;  4MO4 A;  1V4T A;  2GTD A;  2QWN A;  2QWP A;  4FWN A;  2FXU A;  5E26 A;  1NBW A;  3GBT A;  3ZET B;  5AQX A;  3MDQ A;  2FF3 B;  5EOY A;  1C0G A;  1IG8 A;  4BRH A;  3R6M A;  3WQT A;  2I7N A;  3CJC A;  3O1B A;  5AZJ B;  5AQN A;  4CBX A;  4AM6 A;  1X3N A;  1NM1 A;  5AZJ A;  3SJH A;  1S22 A;  4QS7 A;  4BRC A;  3CHW A;  2VWB A;  3FZM A;  5AQR A;  4BRE A;  3BEX A;  4FWM A;  4EHU A;  1BDG A;  2YCH A;  4MO5 A;  3MK6 A;  1DKG D;  2DPN A;  4BGB A;  1NMD A;  1TYQ B;  2NLX A;  3D2E A;  3ATU A;  4MLH A;  2D1K A;  2ZGZ A;  4FOE A;  3LM2 A;  5AQV A;  2P9S A;  4FWR A;  4MLE A;  3ENH A;  1GLD G;  5AR0 A;  3CJB A;  5BN9 A;  3KHY A;  1D4X A;  3LDN A;  4H0Y B;  2HF4 A;  5AQJ A;  3D7E O;  3O5B A;  4HTL A;  4CZG A;  2Q31 A;  3CI5 A;  3HZ6 A;  3O1W A;  2A40 A;  2IVO A;  3H3O B;  2FSJ A;  5AZI B;  3A0I X;  3TPQ A;  1E4G T;  2P9P A;  3QBW A;  2A41 A;  1KAX A;  5AQG A;  1TUU A;  4BRG A;  3VF2 A;  4BGA A;  4A62 A;  1E4F T;  4DHY A;  3H3N O;  3MN6 A;  3QFP A;  4BQL A;  3A5N C;  4H0T B;  4BRQ A;  5AQY A;  5KQ8 A;  4IO8 A;  3DXK B;  3AAP A;  3FFK B;  3KVG A;  4H0O A;  3DXK A;  4BR9 A;  4BR0 A;  3VER A;  4BC3 A;  1NGG A;  4H5R A;  1NWK A;  4GNI A;  4PL8 A;  4LC9 B;  1XUP O;  5F0X A;  1NGD A;  5TKY A;  4K43 A;  2AA4 A;  3O6W A;  4FWP A;  3M3Z A;  4KBO A;  2QWQ A;  2E88 A;  3VGL A;  1XC3 A;  4C23 A;  3FZL A;  3J8A A;  2P9I B;  3VES A;  4BRN A;  3O4W A;  3WQU A;  5EXW A;  4PL7 A;  4CZI A;  4CZM A;  3S41 A;  4H5V A;  4BVP A;  3CQY A;  2UYT A;  3SMP A;  1RGI A;  1GLJ O;  3WXL A;  3DJC A;  3UKU B;  3WXK A;  2D4W A;  4BG8 A;  1J6Z A;  3F9M A;  2GWJ A;  1HKG A;  2FLO A;  2HMP A;  3HI0 A;  3LDQ A;  4XH5 A;  1NGE A;  4BQZ A;  1P8Z A;  3HSC A;  2NRH A;  2KHO A;  1NLV A;  3FZF A;  4B1W B;  4BRD A;  3O08 A;  3BF3 A;  1YVN A;  3KZB A;  3L0Q A;  5AQF A;  2GWK A;  1Z05 A;  2HOE A;  4H0X B;  5BRH A;  1BG3 A;  3GOI A;  4EAH D;  3A5L C;  3GG4 A;  5FPN A;  4B1X B;  1BO5 O;  4L3Q A;  1Z6R A;  3ZX3 A;  3SLC A;  3B8A X;  1XQS C;  4IZ9 A;  2V7Y A;  3EKU A;  4M7Y A;  3DWL A;  1QZ5 A;  5BRF A;  4FPB A;  1NGI A;  3UB5 A;  3D2E B;  5AQH A;  2VCP A;  1H1V A;  4I6M B;  4JNE A;  1RFQ A;  3VEO A;  4IJA A;  2J4R A;  3AY9 A;  1Q18 A;  1GLL O;  3L6Q A;  1IJJ A;  2GUP A;  5AQK A;  5AQS A;  3EL2 A;  5LJW A;  1MWK A;  4BRA A;  3ZEU A;  3UKR B;  4H5T A;  2YI1 A;  4K42 A;  4JHD B;  1MWM A;  3ZX0 A;  2ASM A;  2HF3 A;  3QML A;  4ISG A;  3VF6 A;  5CE3 A;  4I6M A;  2E2O A;  3FR0 A;  3L4I A;  1GLA G;  1SZ2 A;  3HBT A;  2E2N A;  5EY4 A;  1QQO A;  1ATS A;  2Q36 A;  4B1V A;  3UE5 A;  2I7P A;  1NGA A;  4CZE A;  3BF1 A;  1YXQ A;  1BOT O;  4CZJ A;  2Q0U A;  3AAR A;  1ATN A;  1SAZ A;  3MN7 A;  1GLB G;  1HKB A;  3BUZ B;  3MCP A;  4JHD A;  5FPM A;  1BU6 O;  2PAV A;  3VF4 A;  2A3Z A;  4CJ7 A;  2E1Y A;  1ATR A;  2F9W A;  2ITM A;  3VOV A;  2P9N B;  3BP8 A;  3WT0 A;  4WQ5 C;  4IXC A;  4O5F A;  3ZET A;  2P9U A;  2A42 A;  2CH6 A;  2PBD A;  4FWO A;  1EQY A;  4YDU A;  4RWT A;  3DXM A;  3FGU A;  2P9U B;  2YHX A;  3R8E A;  3VEY A;  5BRE A;  3QDK A;  5LJV A;  4H0P A;  2E1Z A;  2Q97 A;  2Q0R A;  3A5O C;  3CIP A;  3GL1 A;  4FPA A;  2W40 A;  1U2V A;  4CZL A;  4DCH A;  1WUA A;  4JD2 B;  5AQZ A;  1V4S A;  1SQK A;  1U6Z A;  3D2F A;  5AQT A;  3MMV A;  4ISE A;  2CGJ A;  2QWM A;  2V7Z A;  1GLC G;  3JS6 A;  1HX1 A;  1CZA N;  4Y0W A;  4BR2 A;  1GLE G;  2A5X A;  4NB4 A;  4CZF A;  4HWI A;  4RTF D;  3AAQ A;  3CER A;  2CH5 A;  2YHW A;  4GY2 B;  3SK3 A;  2P9S B;  4CI6 A;  3JXU A;  4BR5 A;  4FWK A;  2ASO A;  2IVN A;  4Z94 A;  3VGK A;  1T6C A;  4JAX A;  4M63 C;  3ZEU B;  4CZK A;  1ESV A;  1TYQ A;  1K8K B;  4BG9 A;  3GE1 A;  3WEE B;  3FLC O;  1HLU A;  1T6D A;  3LL3 A;  5BR9 A;  3QIC A;  3RSE A;  2W41 A;  4XEI A;  3VEX A;  3H45 C;  4A2B A;  1RDW X;  1JCF A;  5ELZ A;  1KAZ A;  2QWO A;  3CJ1 A;  3QBX A;  3OHR A;  5EX5 A;  1X3M A;  2QWR A;  3ULE A;  1HPM A;  4FO0 A;  2GEL A;  4O8K A;  3IFR A;  2F9T A;  4PKI A;  2QWL A;  1QZ6 A;  4FL9 A;  3CJA A;  4RCH A;  4CD1 A;  3EO3 A;  4CZH A;  3U8X A;  3EZW A;  5KPT A;  1Y64 A;  1WOQ A;  4WQ5 A;  3FE1 A;  4BRK A;  4DB3 A;  3MN5 A;  3U4L A;  5AQU A;  2A6A A;  2P9L A;  2YJF A;  2ZGY A;  5EVZ A;  4EFH A;  5ADX H;  2QW9 A;  1NGH A;  4BC2 A;  2ZF5 O;  1QQN A;  2E8A A;  2Q2R A;  2H3G X;  1DEJ A;  3VEN A;  1ZBS A;  2D0P A;  5AQO A;  4H03 B;  3I8B A;  3FZH A;  4IJN A;  3O80 A;  1ZXO A;  3DAW A;  2AP1 A;  3M6G A;  3U9Z A;  3CQX A;  3VGM A;  3ATV A;  4QS8 A;  5JIC A;  2EWS A;  4FWL A;  4JN4 A;  4B1Z A;  3EKS A;  4BRL A;  5AQP A;  5KPZ A;  3WXI A;  3EN9 A;  2P9N A;  4BR4 A;  3A5M C;  3VEZ A; 
#chains in the Genus database with same CATH topology
 1QS4 A;  2WBN A;  5AQQ A;  3V9W A;  3WNF A;  4H0V B;  1YF5 L;  4B9L A;  2IOC A;  3WNG A;  1LWF A;  4JD2 A;  4W5Q A;  4PKH A;  3M1F A;  2X6S A;  4LF9 K;  3HK2 A;  4DQP A;  3E9L A;  4UY8 O;  4JKD A;  5AFU H;  2OYQ A;  4E1J A;  4DSK A;  1YTU A;  4JLH A;  5LMN K;  3RRH A;  2E20 A;  3CET A;  5M1N A;  3HM8 A;  2V51 B;  1HRH A;  3ZX2 A;  5J1E A;  3AO5 A;  1RBS A;  4LD0 A;  4WQ4 C;  5CYQ A;  3LDP A;  4DQ8 A;  3J7A P;  4MQ3 A;  4FLU A;  4FK4 A;  1LCU A;  3ISN C;  3HTV A;  3CC2 N;  3V9S A;  3VQD A;  4YFU A;  3VEW A;  4JKC A;  1CZ9 A;  1T44 A;  3QEI A;  3V4I A;  2YNI A;  2YHY A;  4C1N I;  1JKH A;  3FZK A;  2HND A;  4CJQ A;  3R9P A;  2BGG A;  2XO7 A;  2GEM A;  4BRF A;  4IG3 A;  4PY5 A;  2HBM A;  2R7Y A;  4NCB A;  3KTQ A;  1QHT A;  1LWE A;  5AFU A;  3WXJ A;  4EP5 A;  1BA1 A;  4W5N A;  3IDH A;  4FSV A;  3TSQ A;  4PUO A;  3T3F A;  3RMA A;  2GBZ A;  1IG9 A;  2GX9 A;  1TVR A;  3S3M A;  1WLJ A;  2BTF A;  4M41 A;  4CEO A;  4CJ3 A;  3KK3 A;  2G8I A;  3R1X A;  3TAB A;  1UA0 A;  1DGK N;  5HRS A;  3VET A;  2F96 A;  3L4Q A;  4CHP A;  4FJH A;  1JCG A;  3N4P A;  2FSK A;  4NO7 A;  1HR0 K;  3CJ9 A;  3IUC A;  1JLF A;  4K25 A;  5BRD A;  4DTU A;  2QXL A;  3ZT3 A;  4X66 K;  3OYM A;  3AVJ A;  1NGF A;  5SZT A;  3RTV A;  4CES A;  5DMR A;  4E7L A;  3QEX A;  1KD1 O;  3WNE A;  4AQY K;  5JMV A;  1NGB A;  4K41 A;  4OPJ A;  3VN5 A;  2V52 B;  3MX5 A;  4MO4 A;  1V4T A;  1GOA A;  5AQX A;  3MDQ A;  3NBP A;  5LMU K;  5EOY A;  2JWK A;  3KKS A;  2HHW A;  1EWQ A;  3R6M A;  5FRM A;  4FJ9 A;  4C8K A;  3CJC A;  1VHX A;  5AZJ B;  4DV7 K;  4CBX A;  4A57 A;  1SV5 A;  1C0U A;  2EHG A;  1VQ9 N;  2QEX N;  4CFB A;  4BRC A;  1NJY A;  1OH7 A;  4IO9 L;  4M3Y A;  4YY3 K;  2XY8 A;  5JS1 A;  4M3R A;  3LP1 A;  2YCH A;  4MO5 A;  2QKK A;  4HCC A;  1DKG D;  2HW3 A;  1NMD A;  1TYQ B;  4LSN A;  1Z25 A;  4I7F A;  1CXQ A;  5CY4 A;  4N41 A;  3HL8 A;  3LZI A;  4LFA K;  4DSE A;  3D0P A;  4FOE A;  3LM2 A;  5AQV A;  4FWR A;  5GIN A;  2QI2 A;  3ENH A;  4FK2 A;  4DV6 K;  3PX0 A;  1RDB A;  3KHY A;  3KIO A;  3KK7 A;  4DV0 K;  1RT4 A;  3HP9 A;  4YOT A;  1HYS A;  4AF1 A;  3O5B A;  3S3N A;  3EEQ A;  5SWM A;  4EZ6 A;  4IBN A;  2A40 A;  3A0I X;  3CFP A;  1TGO A;  2P51 A;  4B3M K;  3I0R A;  3QBW A;  2G8W A;  4CFA A;  4BGA A;  3KK1 A;  2YX6 A;  1E4F T;  1Q82 O;  1O13 A;  3CC7 N;  3C94 A;  5JVG L;  4BRQ A;  3FFK B;  2X78 A;  3VQB A;  1ZBL A;  4DFJ A;  3DXK A;  1RT3 A;  4KPY A;  4H5R A;  3F2K A;  4O55 A;  4LC9 B;  3HM9 A;  3T1A A;  5F0X A;  3WXM B;  2W6L A;  3J81 O;  4FJX A;  3M3Z A;  5C2F A;  4LF6 K;  1EXQ A;  3VGL A;  4O4G A;  4ZTJ A;  3J8A A;  3VES A;  4NXN K;  3O4W A;  3WQU A;  3V1Q A;  4AHS A;  3S41 A;  2Z1I A;  4H5V A;  3EZ5 A;  5DK5 A;  3K5N A;  1FJG K;  1RGI A;  4CEF A;  4EZ9 A;  4BG8 A;  4U7B A;  3F9M A;  1RT2 A;  3HI0 A;  3FFI A;  4JI4 K;  5HRO A;  3HSC A;  3FZF A;  4BRD A;  1VQK N;  4FJL A;  4LFC K;  5CZ2 A;  3OYE A;  2JWL A;  2HOE A;  4B08 A;  5HRN A;  3U3Y A;  3GOI A;  3A5L C;  2OPR A;  1XI1 A;  4X65 K;  4GMJ B;  1K6Y A;  1OVY A;  1XQS C;  4FJ7 A;  4ELU A;  1JL1 A;  2FBT A;  4FPB A;  2JGU A;  1ZBH A;  1DTQ A;  1B9D A;  1RFQ A;  3AV9 A;  4IJA A;  2J4R A;  1KSP A;  4DMN A;  3AY9 A;  1X9M A;  3CF5 L;  2GUP A;  4JRP A;  3JAM O;  1TKD A;  4YOX A;  4JI5 K;  4CEQ A;  2QKB A;  4KHU A;  4OGC A;  4H5T A;  3HP6 A;  4E19 A;  4K42 A;  3C6H A;  2PZS A;  4O44 A;  3QML A;  1QTM A;  3VF6 A;  2B5J A;  4I6M A;  1WB9 A;  3FR0 A;  3ZSV A;  1QSY A;  3TAP A;  1NNE A;  4LH5 A;  1S1U A;  4DLE A;  3K59 A;  1VQO N;  4X64 K;  4JK9 A;  4J2E A;  1HYV A;  4JHD A;  5FPM A;  4DR3 K;  1NU0 A;  1BU6 O;  2PAV A;  2A3Z A;  4CJ7 A;  3THV A;  2F9W A;  3CYM A;  3NH1 A;  3TR8 A;  1RTI A;  2P9N B;  1KLN A;  4FJK A;  3WNH A;  3LWL A;  3CFO A;  3AVF A;  4RWT A;  3R8E A;  2YHX A;  4NLC A;  2X74 A;  3LPT A;  1VSL A;  4M3T A;  3CIP A;  4FPA A;  4TSX A;  3B6O A;  3HVT A;  1F21 A;  5DM6 L;  1NMN A;  2YKM A;  5AQZ A;  1V4S A;  3NH2 A;  1U6Z A;  3O9R A;  2CGJ A;  2F8T A;  5HRR A;  1OH6 A;  2V7Z A;  4FW2 A;  1LW2 A;  2RE2 A;  1NK9 A;  4Y0W A;  2A5X A;  1N36 K;  1L5U A;  2CH5 A;  4MDB A;  3SK3 A;  2KQ2 A;  4CI6 A;  3O3F A;  3JXU A;  3PO4 A;  4CEC A;  4FWK A;  3KJV A;  3LDS A;  3LAL A;  3K5O A;  1RT5 A;  4I2Q A;  4CZK A;  1NJZ A;  1K8K B;  1YIT N;  3GE1 A;  3FLC O;  2HHV A;  3QIC A;  2OPP A;  2VGM A;  3SV4 A;  4XEI A;  2OPQ A;  4JK7 A;  3VEX A;  4A2B A;  1KVC A;  5JS2 A;  1JCF A;  3NCI A;  4C8L A;  3SQ4 A;  1T8E A;  3OVN A;  4PKI A;  2EX3 A;  3IFR A;  3L2W A;  4CIE A;  3CJA A;  3HJF A;  4CD1 A;  3EO3 A;  4RG8 A;  4CZH A;  3I56 N;  3TAF A;  5CR4 A;  4G9Z A;  3MN5 A;  1NOY A;  4FXD A;  4CJK A;  4YHH K;  2P9L A;  2YJF A;  2XRI A;  5EVZ A;  1R0A A;  5ADX H;  5I42 A;  1VQM N;  3SCX A;  2KZM A;  5J2M A;  2UXB K;  2D0A A;  1RCH A;  2YKN A;  1RBR A;  3CQX A;  3ATV A;  4HVJ A;  1NK0 A;  2YNF A;  1Q86 O;  1TAQ A;  4B1Z A;  2NRX A;  4B9S A;  4KAZ A;  3CCR N;  2HHH K;  4AHV A;  4DV2 K;  3A5M C;  3U8X A;  3VEZ A;  2E6L A;  3PSI A;  3A8Y A;  3VPZ A;  4GKJ K;  2F8S A;  4CJS A;  3PLA A;  4WF9 L;  3OBY A;  4EHT A;  4ICL A;  1LOT B;  4KFB A;  3THY B;  2UUB K;  4H5W A;  1NG9 A;  4E0D A;  4F8R A;  3D2F B;  4F4K A;  2IIR A;  1NGJ A;  3MN9 A;  3DMJ A;  3KLF A;  3PY8 A;  3VEV A;  4QCL A;  5M1K A;  3H46 O;  5LY3 A;  3SMS A;  1NOZ A;  3KK2 A;  3P38 A;  4FYD A;  5M1Q A;  5JLH A;  5AQL A;  3H1V X;  3OS0 A;  3TTC A;  4CGI A;  1QQM A;  4FWQ A;  3NGY A;  4A2A A;  2RHK A;  1WAF A;  3CJ7 A;  1Z26 A;  1S1X A;  1KCF A;  4JI7 K;  4X62 K;  4IEI A;  4DQR A;  1I3A A;  2HHS A;  2ZJR L;  5ADX A;  4CFC A;  3H6E A;  3O4Q A;  2CGL A;  2IAJ A;  4CJF A;  2B4J A;  1YVU A;  1SL2 A;  3CG7 A;  1U48 A;  4XH4 A;  4B3T K;  1D5A A;  3RSE B;  3PUF A;  1OVQ A;  3TTF A;  3QEV A;  5E84 A;  1U49 A;  4BC5 A;  3MEC A;  5JLF A;  4IKF A;  1VQ4 N;  4FOI A;  4B1Y B;  5KPR A;  4B9N A;  5FRN A;  5FPE A;  2IVP A;  3M5R A;  2NRR A;  2E2P A;  1CLQ A;  3CM6 A;  1Q81 O;  2BAN A;  2WUS A;  4CHZ A;  4DS4 A;  2P9P B;  1FW6 A;  2FSN A;  4KRE A;  5BPM A;  4RW8 A;  4QS9 A;  3I55 N;  5AZI A;  4Q0B A;  2E6M A;  2BUP A;  3C6T A;  4FZX C;  1BUP A;  3DYA A;  3U3G A;  1S6P A;  3ZSR A;  4BRI A;  3LM9 A;  4LY7 A;  4F2R A;  2HVI A;  4B9Q A;  3VA0 A;  4IFE A;  2YNG A;  2ITG A;  4AM7 A;  4CD3 A;  2P9K B;  3L2Q A;  4Z4E A;  3AVK A;  4FJG A;  3VQ4 A;  2FC0 A;  1MDU B;  3QB0 A;  1VQP N;  3F9K A;  4FJN A;  4DF8 A;  3OS1 A;  2OZM A;  4FJI A;  1U45 A;  1EET A;  2YNH A;  3W0L A;  3QEP A;  4NCA A;  1N33 K;  3MEG A;  1SKW A;  1VQ8 N;  3QIP A;  3LP2 A;  3G6E N;  1HNW K;  4BRO A;  1BWF O;  4ILH A;  4KHP K;  4CF1 A;  3L3V A;  3TU5 A;  1EP4 A;  3HRG A;  3H1Q A;  3S3O A;  2WFB A;  5DM7 L;  2UU9 K;  4BR7 A;  1RBU A;  5HOO A;  4JKF A;  5J2Q A;  2VGN A;  3DLG A;  2HHX A;  3Q7C A;  4DU3 A;  2G8V A;  2ZWH A;  3ID8 A;  4YDU C;  1QQC A;  4BC4 A;  3DLB A;  1IKX A;  2QWN A;  2QWP A;  4FWN A;  1NBW A;  3GBT A;  3ZET B;  1LAV A;  1EO1 A;  1C0G A;  2UXD K;  3ZT0 A;  4K8Z A;  1X3N A;  2A1S A;  1NM1 A;  5EU7 A;  3SJH A;  3L3U A;  4QS7 A;  2LSN A;  1EX4 A;  4KHS A;  2DTU A;  3CHW A;  2VWB A;  1NKC A;  4EHU A;  3OYA A;  4C8N A;  1BDG A;  4FLY A;  4BGB A;  1D9F A;  2NLX A;  3SQ2 A;  2D1K A;  5CHI A;  4H4M A;  4DSI A;  4DTM A;  3ZCM A;  1GLD G;  4RW6 A;  4YOV A;  5BN9 A;  5M1P A;  2HF4 A;  5AQJ A;  3QIO A;  4CJ5 A;  4Z4H A;  4CZG A;  3HZ6 A;  5GIP A;  4B9U A;  5AZI B;  4GVM A;  2P9P A;  4BRG A;  2E5L K;  1KVA A;  1YT3 A;  4A62 A;  4GV9 A;  3QFP A;  4JV5 K;  3CCJ N;  1TKZ A;  4BQL A;  5AQY A;  5KQ8 A;  3TTD A;  3KVG A;  3S9H A;  4JI2 K;  1M1K O;  3SJJ A;  3T1Y K;  4O5B A;  2ZM6 K;  4FLX A;  4PL8 A;  3THY A;  1XUP O;  1NGD A;  5TKY A;  4FLW A;  4K43 A;  4E1N A;  4B9M A;  4CEA A;  1XC3 A;  3V9U A;  1IKY A;  4AHU A;  4HHT A;  3IAY A;  5EXW A;  4PL7 A;  4CZI A;  4CZM A;  4FM1 A;  4BVP A;  3AO4 A;  1WNS A;  1WSJ A;  4O0I A;  3P83 D;  4YOU A;  2PY5 A;  4B3S K;  2IDO A;  3ZSW A;  2GWJ A;  1HKG A;  3O9Q A;  2AJQ A;  1NGE A;  4CK3 A;  4AHT A;  4BQZ A;  1GOB A;  4FW1 A;  4DQS A;  3O08 A;  3OY9 A;  4CK1 A;  3K9K A;  3BF3 A;  1YVN A;  5HRP A;  1YIJ N;  4UQG A;  4CCH A;  4ILJ A;  5J2N A;  1ZYQ A;  5BRH A;  3AVA A;  1BG3 A;  3DLH A;  2HBK A;  4B1X B;  1T03 A;  2ETJ A;  4CF2 A;  3ZX3 A;  3OBW A;  4IZ9 A;  2V7Y A;  4OJR A;  4M7Y A;  1QZ5 A;  5BRF A;  3UB5 A;  2VCP A;  4I6M B;  3VEO A;  3TAM A;  2OTL N;  4DR6 K;  4HUG A;  3K2P A;  3F73 A;  3L6Q A;  4GV3 A;  1ILY A;  3MWP A;  4FLV A;  5AQS A;  1MWK A;  1VQL N;  1QE1 A;  4WFN L;  3UKR B;  4O8U A;  3T7Z A;  3QER A;  3TAN A;  1BQN A;  5FDL A;  1IO2 A;  1JLG A;  5CE3 A;  1HPZ A;  3L4I A;  3CCQ N;  4JS5 A;  4OKJ A;  1RDU A;  1J9A A;  3N4Q A;  1ATS A;  1S1W A;  3UE5 A;  4WCE L;  3MAQ A;  2OTJ N;  2O8C A;  2BDP A;  3SYZ A;  5HP1 A;  1B9F A;  3DRS A;  3AAR A;  3V1O A;  1SAZ A;  1XHX A;  3MN7 A;  4J2B A;  3T1H K;  1W9H A;  3C65 A;  3AA4 A;  4BE0 A;  3TAR A;  1ATR A;  1BIU A;  5M1F A;  4CJE A;  4JKG A;  4OKE A;  1YHQ N;  3BP8 A;  4FM0 A;  4GKK K;  3BZC A;  4WQ5 C;  1NJW A;  2I5J A;  4O5F A;  4KH6 A;  1S9G A;  2UUC K;  2O8C B;  1EQY A;  2Q3S A;  2PYJ A;  3NH0 A;  4M3W A;  4DTP A;  2E1Z A;  1A5W A;  2Q0R A;  1DTT A;  3A5O C;  1U2V A;  4BDP A;  3T19 A;  3O3G A;  4RW9 A;  1SQK A;  3DRR A;  3JS6 A;  2NRW A;  1T05 A;  1A5V A;  1CZA N;  4CER A;  4BR2 A;  1GLE G;  4NB4 A;  3VQ5 A;  3ZSY A;  4DTO A;  3ULD A;  4HWI A;  4RTF D;  4KTQ A;  4MFB A;  4Z4F A;  2YHW A;  3E01 A;  3QES A;  4BR5 A;  3OTO K;  1BI4 B;  3AVC A;  1P90 A;  4M63 C;  3G10 A;  4DFK A;  3AVN A;  3OYI A;  1XNR K;  5C12 A;  2HHQ A;  3WEE B;  1HLU A;  4JKB A;  5BR9 A;  4DTX A;  1ITG A;  2W41 A;  2FBY A;  1JXB A;  3THW A;  3SUN A;  3H45 C;  4B3O A;  3THW B;  3CJ1 A;  3OHR A;  5EX5 A;  1X3M A;  3DLE A;  3ZSO A;  2YHB A;  4O8K A;  4CF9 A;  2G8H A;  1W97 L;  2QWL A;  1QZ6 A;  3AVG A;  4KI6 A;  3RVC A;  4RCH A;  2XY5 A;  1XNQ K;  1KRP A;  3EZW A;  2WOM A;  1WOQ A;  3ID6 A;  4DB3 A;  2IS3 A;  5AQU A;  4GV6 A;  4EFH A;  2QW9 A;  1NGH A;  4Y1C A;  2KTQ A;  2ZF5 O;  1QQN A;  2KLA A;  4DS5 A;  2Q2R A;  3MEE A;  4BWM A;  5M1O A;  3VEN A;  3I8B A;  4IJN A;  1M90 O;  1ZXO A;  2AP1 A;  5C25 A;  3M6G A;  1SKR A;  1E3M A;  3VGM A;  1VQ7 N;  2HBL A;  4FWL A;  3SPZ A;  3EKS A;  4CGH A;  5KPZ A;  4OVL A;  3WXI A;  4NYF A;  3THX A;  1X1P A;  2WTU A;  4ID5 A;  3O9T A;  3VF2 A;  1OKJ A;  4CJT A;  3P5J A;  1IBM K;  3ENB A;  2P9I A;  3W3D A;  2NUB A;  4F3O A;  1YUW A;  3U6F A;  4F3T A;  4A5A A;  4CGG A;  1CZB A;  1KAY A;  2Z1J A;  3T69 A;  1U2V B;  1NK7 A;  1C1C A;  4I9L A;  4E1M A;  4WYB A;  3RWU A;  3SBT A;  1RT7 A;  4PWD A;  1WSH A;  2ZQB A;  3MXJ A;  3C7N A;  4YOR A;  3AVM A;  2CGK A;  1JL2 A;  3K5L A;  3ULE B;  1C6V A;  3UKU A;  5J2P A;  1C1B A;  5A2Q O;  2DFE A;  4J2D A;  3NGZ A;  1HNX K;  3QET A;  3GDQ A;  4WFB L;  4FLZ A;  5AQI A;  1N32 K;  1BA0 A;  3TAQ A;  1TK8 A;  2E2Q A;  2P9L B;  2ASP A;  3K58 A;  1GOC A;  2G8F A;  3C95 A;  4YOY A;  3P4I A;  2DFF A;  3RMC A;  1KXP A;  4CJ4 A;  1XWL A;  1HKC A;  3TWH A;  1RTD A;  1XHZ A;  2OPS A;  5FRO A;  1HJO A;  1NGC A;  5D3G A;  2RPI A;  4FWS A;  4M3Z A;  4CJW A;  3AA5 X;  4KO0 A;  3UKR A;  1K9M O;  4KKO A;  3SUQ A;  3AVH A;  2O8D B;  1A5X A;  3ZSZ A;  3K0S A;  5I9E B;  4ILG B;  5KQD A;  2HVH A;  1KFD A;  5BN8 A;  3CCE N;  1HUX A;  4DTN A;  1X9J A;  4ISF A;  1NKB A;  2JLE A;  5AQW A;  4CEE A;  3MWT A;  4A5B A;  2BH1 A;  3V9Z A;  1HNI A;  3LDL A;  3ENO A;  4OKK A;  5JVH L;  2QM1 A;  5TKW A;  1XMQ K;  2ATQ A;  3PX4 A;  3NDK A;  4CGF A;  1JJ2 M;  3SQ1 A;  3C0B A;  3ITH A;  3TAG A;  1LW0 A;  3OYN A;  3AO2 A;  1S1T A;  3AO1 A;  2Q1N A;  2G8K A;  1JCE A;  2FF6 A;  5FPD A;  5GAG P;  5IWA K;  4QAG A;  1J5E K;  1TKX A;  2YV0 X;  3MXI A;  4LF4 K;  3HOT A;  4G1Q A;  2GTD A;  2FXU A;  3P1G A;  2FF3 B;  3J7Y P;  1IG8 A;  3SQ0 A;  4BRH A;  3WQT A;  5C10 A;  4DR5 K;  2VWK A;  1IBK K;  3D6R A;  4DR7 K;  3ZYY X;  3DLR A;  3O1B A;  3L8B A;  5AQN A;  4IOA L;  4FZY A;  1NK4 A;  1S22 A;  1BHL A;  2PYL A;  4ZTF A;  5AQR A;  4FJJ A;  4BRE A;  3BEX A;  4FWM A;  3E1Y A;  1WN7 A;  4PQU A;  2D0C A;  4OX9 K;  3PSF A;  3D2E A;  3ATU A;  5C15 A;  4NLB A;  4IFV A;  4ELV A;  5AJ3 K;  1J53 A;  1RTJ A;  4CFD A;  1NKE A;  3OYK A;  1YJW N;  2ZGZ A;  1RTH A;  4E7I A;  4NYN A;  4I9Q A;  4B8A B;  4DV4 K;  4IFY A;  5AR0 A;  4BWJ A;  3LDN A;  3DRP A;  3NAE A;  4BE2 A;  4IOC L;  4HTL A;  3NVK A;  3CI5 A;  4HUE A;  2FSJ A;  3ASM A;  3TPQ A;  5KRS A;  1E4G T;  1XMO K;  3C6A A;  3ZT1 A;  5AQG A;  1TUU A;  2O8D A;  2Y1J A;  4NXM K;  3SZ2 A;  3H3N O;  3MN6 A;  3VQE A;  4CED A;  4C8M A;  1YTA A;  3A5N C;  4H0T B;  1TKT A;  4DV5 K;  4DKW A;  3DXK B;  2X6N A;  3IG1 A;  4H0O A;  1N5Y A;  3B6P A;  3VER A;  4DLG A;  4MDA A;  1NGG A;  1NWK A;  1WSG A;  4GNI A;  3JYT A;  1RT1 A;  3E9P A;  1NJI O;  4A59 A;  1QVG M;  4M3U A;  2AA4 A;  4FWP A;  4AIL C;  4KBO A;  3VQ7 A;  2RN2 A;  3TAE A;  1VQN N;  1WSE A;  1Q8I A;  3FZL A;  3HXM A;  1VRU A;  4BRN A;  4L8R B;  4PHT X;  2HNY A;  3LAK A;  3M8S A;  3V9X A;  4OO1 J;  3VQ6 A;  3WXL A;  4FM2 A;  3H08 A;  4KHQ A;  1XC9 A;  3KWI A;  3UKU B;  4JI1 K;  3OYD A;  3HVR A;  2D4W A;  1J6Z A;  4C1N K;  5MLC Q;  2FLO A;  2HMP A;  3Q7B A;  3DM2 A;  3R3L A;  4HTU A;  4CJL A;  2BE2 A;  4R79 A;  2NRH A;  2KHO A;  3KLE A;  3P39 A;  1NLV A;  3PX6 A;  1X9S A;  5AQF A;  2GWK A;  1L3V A;  1RIL A;  4EAH D;  3GG4 A;  3HO1 A;  5KGX A;  2OCE A;  1T7P A;  4E3S A;  1BO5 O;  1Z6R A;  1SL0 A;  3SLC A;  4JRQ A;  3E9O A;  4W5R A;  4N76 A;  4K8X A;  3VA3 A;  1N34 K;  4WE1 A;  2RF2 A;  3ZT4 A;  1WBD A;  3DWL A;  5C0Y A;  1FKP A;  3D2E B;  5AQH A;  4IG0 A;  4JNE A;  1U47 A;  4DQQ A;  4OLA A;  4LH4 A;  3OJU A;  2DY4 A;  5AQK A;  1IKV A;  4K0K K;  5KRT A;  3CPW M;  5GAD P;  2GV9 A;  4HCB A;  3EL2 A;  4DR2 K;  3NMU A;  4BRA A;  3LPU A;  4J2A A;  3QO9 A;  4JHD B;  4IDH A;  1UAX A;  3J7Z O;  4KTZ A;  2ASM A;  3K57 A;  2O8B B;  3SPY A;  1IKW A;  3VQQ A;  1VQ6 N;  2KZZ A;  1SZ2 A;  3HBT A;  2E2N A;  1QQO A;  4C8O A;  4E7J A;  2Q36 A;  3OYG A;  4JI8 K;  2I7P A;  1NGA A;  5K14 A;  1FK9 A;  3BF1 A;  1YXQ A;  1L3T A;  3TSP A;  4CZJ A;  1CXU A;  4N47 A;  1GLB G;  3BUZ B;  3MCP A;  1WSF A;  3SUO A;  4N5S A;  3VF4 A;  2E1Y A;  3QNN A;  1TAU A;  1VRT A;  3VOV A;  3THX B;  1NK6 A;  3WT0 A;  1N6Q A;  3KWG A;  3TSU A;  4JKE A;  5BR8 K;  2O8F A;  2F4V K;  4AH9 A;  2KFN A;  2P9U A;  2A42 A;  2RKI A;  2CH6 A;  2PBD A;  4LF5 K;  2UXC K;  4YDU A;  3DXM A;  2P9U B;  2O4G A;  3ZT2 A;  4EP4 A;  2E4L A;  1VK0 A;  5BRE A;  3M8R A;  4H0P A;  3QEW A;  4DR4 K;  1HQE A;  1RDA A;  1ZBU A;  1T3V A;  2PFU A;  4CZL A;  4DCH A;  3G4S N;  4LF8 K;  3O3H A;  3D2F A;  5AQT A;  1Y97 A;  2NRV A;  3MMV A;  3VQP A;  4JS4 A;  1G15 A;  1GLC G;  5LL6 Z;  3CQ8 A;  4IEE A;  3NFA A;  1RDD A;  4H4O A;  4CZF A;  3I8D A;  2VG5 A;  3G0Z A;  3AAQ A;  5FLX O;  1KLM A;  1L3U A;  2NRT A;  4Y1D A;  3OYH A;  1TK5 A;  2ASO A;  2IVN A;  3AA2 A;  1KQS M;  3VGK A;  1T6C A;  4JAX A;  3ZEU B;  1TYQ A;  4Z4C A;  3OYB A;  3DOK A;  4BG9 A;  1EKE A;  3NF7 A;  2XY6 A;  1T6D A;  4FZZ A;  1JLA A;  1WSI A;  3CFR A;  1RBT A;  4E89 A;  3VQ8 A;  2QWR A;  1J5O A;  1HPM A;  1VSM A;  2GEL A;  1YJ9 N;  2F9T A;  4FL9 A;  3CCM N;  4JI0 K;  4YOW A;  3ZLJ A;  2D0B A;  4DSF A;  5KPT A;  3NHG A;  1Y64 A;  2QA4 N;  4WQ5 A;  3OW2 M;  4BRK A;  4PA1 A;  3O9S A;  1WBB A;  2D5R A;  3MCA B;  1K73 O;  1S5J A;  4DTJ A;  1ZBI A;  3BZK A;  1QSS A;  3PO5 A;  4KV8 A;  2GUI A;  2HHU A;  4NCG A;  4CK2 A;  4GW6 A;  4RW7 A;  1C1A A;  3SBG A;  3UIQ A;  3MX2 A;  3AVL A;  3RR8 A;  5AQO A;  2Z1G A;  4H03 B;  2OZS A;  4BDZ A;  3EYZ A;  4R5P A;  3AGK A;  3M8Q A;  4CJR A;  1L3S A;  4QS8 A;  2EWS A;  1DT9 A;  2HST A;  1S72 N;  4I2P A;  1REV A;  3VMF B;  4B9T A;  3CCL N;  1X9W A;  4BR4 A;  3RRG A;  1ASV A;  3LAM A;  4DU1 A;  1QHA A;  4XH1 A;  3NF8 A;  4BDY A;  3G71 N;  4M3X A;  4BVO A;  5BPN A;  1GLF O;  4PKG A;  1I39 A;  4OPH A;  3CXC M;  4CJU A;  3OYF A;  1U04 A;  4BAC A;  2HNZ A;  3QLH A;  1K8K A;  1Q7Y O;  3WEE A;  4WQ4 A;  3HST B;  4IWV A;  1KTQ A;  5AQM A;  3WUH A;  1D9D A;  3I33 A;  3C7N B;  2VYP A;  3LP0 A;  3O4N A;  4CJP A;  3DLL L;  2QK9 A;  3OJS A;  1S1V A;  1VAZ A;  5T7B A;  1Q9Y A;  4DU4 A;  3A2F A;  2NZT A;  5F1X A;  3L2U A;  3L2V A;  3VTI A;  3SV3 A;  1YAG A;  5H1S Q;  3O8M A;  3QIN A;  5CZ1 A;  3SI6 A;  1C0F A;  5I3U A;  4FLT A;  1C0M A;  1JLE A;  1LWC A;  3V81 A;  1G99 A;  3G25 A;  3MXM A;  3IMX A;  1JLB A;  2P9K A;  5HLF A;  1R59 O;  2D0O A;  4CBW A;  4CIG A;  5F2R A;  4F2S A;  1TUY A;  4F9O A;  3PIP L;  1ZC6 A;  1NK5 A;  4LFB K;  2XHB A;  1D8Y A;  5C24 A;  4DFP A;  2QXF A;  5C42 A;  1BL3 A;  3CMA N;  4RW4 A;  3O9U A;  3LDO A;  1ASW A;  3CCU N;  4CBU A;  3DXM B;  3HT3 A;  5BPL A;  1VSI A;  2P5O A;  4KHY A;  3QFU A;  1W0H A;  5B8H A;  1MA9 B;  1JXE A;  1S3X A;  1JLC A;  4M7X A;  2IGI A;  4DSJ A;  1MU2 A;  4DSL A;  4KRF A;  4BRP A;  4U67 L;  3KD5 E;  2P1J A;  4H5N A;  3CCV N;  4JKG B;  3NGI A;  3CM5 A;  3RR7 A;  2DFH A;  2OAN A;  3AVI A;  4FJM A;  3D45 A;  2VWJ A;  3CME N;  4J8F A;  1OH5 A;  1RNH A;  1TK0 A;  3K5M A;  1FKO A;  4DQI A;  4EIA A;  4A61 A;  4B1U B;  4BRM A;  3U9D A;  1BCO A;  1YJN N;  2YJE A;  3NVM A;  3AO3 A;  3HOS A;  5C2D A;  5E26 A;  3KLG A;  2O8F B;  3L2R A;  3ZSX A;  3IKM A;  2HB5 A;  5KI6 A;  2I7N A;  3I0S A;  4Q5V A;  3PV8 A;  1N8R O;  4AM6 A;  2VG7 A;  5AZJ A;  4CVN E;  2IC3 A;  3DI6 A;  3FZM A;  4CHQ A;  3HPO A;  4DTS A;  1HYZ A;  4CF8 A;  4CGJ A;  2VQE K;  4CHN A;  3MK6 A;  2DPN A;  4WFA L;  4Z4G A;  4MLH A;  4ID1 A;  3OS2 A;  4M42 A;  4Z4I A;  1WAJ A;  3M8P A;  1BIS A;  2P9S A;  3EE9 A;  4LSL A;  3SUP A;  4MLE A;  5E41 A;  3CJB A;  3JSM A;  4KHW A;  1D4X A;  4H0Y B;  3BDP A;  3D7E O;  3P31 A;  1SS6 A;  1W2B M;  2Q31 A;  3O1W A;  4KH4 A;  2IVO A;  3H3O B;  2FBX A;  1HNV A;  3LWM A;  2A41 A;  1KAX A;  3NE6 A;  3HYF A;  3OYJ A;  4HUF A;  1VSH A;  2A1R A;  4JI3 K;  1SL1 A;  4JEP A;  4DUZ K;  4DHY A;  4YNQ A;  1JLQ A;  1DLO A;  4CGD A;  4IO8 A;  3AAP A;  2O8E A;  4BR9 A;  1IV0 A;  4DV1 K;  2F7T A;  4BR0 A;  4CE9 A;  4XIU A;  4BC3 A;  3IS9 A;  5CYM A;  4BE1 A;  5GIO A;  4DWI A;  3F5T A;  2FBV A;  2WON A;  3O6W A;  2QWQ A;  1OH8 A;  2E88 A;  4C23 A;  3AGR A;  3HPG A;  2HHT A;  4CHO A;  4O0J A;  4FK0 A;  2P9I B;  3SAG A;  2ZJQ L;  1U4B A;  4H8K A;  3CC4 N;  2O8E B;  1B92 A;  3CQY A;  2UYT A;  3SMP A;  1VSD A;  3V1R A;  1GLJ O;  2OA8 A;  4KH5 A;  4GVE A;  3DJC A;  3KLH A;  2VQF K;  3WXK A;  4JKA A;  3E66 A;  3CCS N;  3LDQ A;  2ZE2 A;  4XH5 A;  1KFS A;  3LP3 A;  2UUA K;  4CHY A;  1P8Z A;  4FVM A;  4B1W B;  1HNZ K;  1VQ5 N;  1BCM A;  4DG1 A;  4W5O A;  1VSF A;  3L0Q A;  3KZB A;  4CEZ A;  4DUY K;  1Z05 A;  4H0X B;  3ZSQ A;  1Q9X A;  3V6D A;  1IBL K;  5FPN A;  1FXX A;  1S9E A;  1UOC A;  3RMB A;  4L3Q A;  1UA1 A;  1SKS A;  3B8A X;  1BI4 A;  2G8U A;  4FCY A;  1I94 K;  3EKU A;  2Y1I A;  1K8A O;  1BIZ A;  3LZJ A;  5GAH P;  1NGI A;  1H1V A;  1SUQ A;  1UWB A;  4V19 S;  1RT6 A;  1Q18 A;  3VQC A;  4E7K A;  1GLL O;  1IJJ A;  4CJV A;  4B8C A;  3DLK A;  3HPH A;  3CD6 N;  5LJW A;  1HMV A;  3NF9 A;  1S6Q A;  1TV6 A;  4AHC A;  3ZEU A;  3OYC A;  4KB1 A;  2KW4 A;  3SAF A;  2P5G A;  2YI1 A;  5KTQ A;  1MWM A;  1HQU A;  1BQM A;  3ZX0 A;  4FJ5 A;  1C0T A;  3IRX A;  5GAE P;  2HF3 A;  3J80 O;  3SNN A;  3OA9 A;  4ISG A;  4ELT A;  2E2O A;  4W5T A;  1GLA G;  5EY4 A;  4B3R K;  4OLB A;  2VG6 A;  1LV5 A;  4B1V A;  4CZE A;  4JKH A;  4KB0 A;  1BOT O;  4LF7 K;  3BY5 A;  2HMI A;  2Q0U A;  3CPE A;  3DOL A;  1ATN A;  1HKB A;  1O1W A;  2O4I A;  3TI0 A;  3SAH A;  1ZBF A;  2ZD1 A;  2QTD A;  2ITM A;  4B9V A;  4FJ8 A;  2B6A A;  3VQA A;  3RMD A;  3VTH A;  4IXC A;  2KFZ A;  2YHA A;  3ZET A;  4FWO A;  3ALY A;  3EE8 A;  4OPA A;  3BGR A;  2HBJ A;  3AA3 A;  3FGU A;  2KKZ A;  4JK8 A;  3VEY A;  3QDK A;  3NF6 A;  5LJV A;  1W7A A;  2Q97 A;  1RDC A;  3C6U A;  3GL1 A;  2W40 A;  1VSK A;  3MED A;  1WUA A;  4JD2 B;  1VSJ A;  4QOZ B;  4N56 A;  4ISE A;  2QWM A;  2WC9 A;  1EWR A;  1HX1 A;  4Z0U A;  4IDK A;  3EY1 A;  4OGE A;  3CER A;  2XY7 A;  3K9J A;  4GY2 B;  2P9S B;  2W42 A;  3OYL A;  3KLI A;  1YI2 N;  4Z94 A;  4BY9 C;  4JI6 K;  1ESV A;  3VQ9 A;  4DF4 A;  4KHN A;  2Z1H A;  5HBM A;  5KGW A;  3LL3 A;  3RSE A;  1IH7 A;  3QNO A;  1QVF M;  1RDW X;  5ELZ A;  1KAZ A;  1ASU A;  2QWO A;  1NK8 A;  3QBX A;  3ULE A;  4FO0 A;  3KKR A;  1TL3 A;  4DTR A;  2W6K A;  4ZHR A;  2ZJP L;  4M45 A;  3FE1 A;  3U4L A;  4DV3 K;  2A6A A;  5HL7 L;  1BGX T;  5IT9 O;  4KTW A;  2O8B A;  2ZGY A;  1RBV A;  4CEB A;  4DFM A;  4DR1 K;  4BC2 A;  2E8A A;  1QSL A;  3KD1 E;  4OPK A;  3AVB A;  2H3G X;  1DEJ A;  4AHR A;  4E7H A;  1KC8 O;  4KI4 A;  4FVU A;  1ZBS A;  2D0P A;  4IOX A;  2NRZ A;  1VSE A;  3FZH A;  3O80 A;  3DAW A;  3PIO L;  1LAW A;  4JYA K;  4CIF A;  3U9Z A;  1HJR A;  3LAN A;  4CF0 A;  5JIC A;  1J54 A;  4JN4 A;  1TL1 A;  4BRL A;  5AQP A;  1KVB A;  4CW7 B;  2NNW A;  3EN9 A;  1NJX A;  2P9N A; 
#chains in the Genus database with same CATH homology
 3A8Y A;  2WBN A;  3ENB A;  3VPZ A;  2P9I A;  1QHA A;  5AQQ A;  4XH1 A;  3W3D A;  3PLA A;  4WF9 L;  3OBY A;  4EHT A;  3G71 N;  1YUW A;  4H0V B;  4BVO A;  5BPN A;  1YF5 L;  1LOT B;  4A5A A;  1GLF O;  4PKG A;  4OPH A;  3CXC M;  4H5W A;  1KAY A;  3D2F B;  3T69 A;  1U2V B;  2IIR A;  1NGJ A;  3MN9 A;  3VEV A;  4JD2 A;  4PKH A;  5M1K A;  3H46 O;  5LY3 A;  4WYB A;  3SMS A;  1K8K A;  3M1F A;  3P38 A;  3SBT A;  4WQ4 A;  5M1Q A;  3WEE A;  1Q7Y O;  5JLH A;  4IWV A;  5AQL A;  1OKJ A;  3H1V X;  3E9L A;  3TTC A;  4UY8 O;  4JKD A;  5AQM A;  3WUH A;  1QQM A;  4FWQ A;  5AFU H;  4A2A A;  2RHK A;  3C7N A;  4YOR A;  4E1J A;  2CGK A;  3CJ7 A;  3I33 A;  2E20 A;  3C7N B;  3CET A;  3ULE B;  2VYP A;  3UKU A;  5M1N A;  3DLL L;  3HM8 A;  2V51 B;  4IEI A;  3ZX2 A;  1VAZ A;  2NZT A;  4WQ4 C;  3GDQ A;  5F1X A;  2ZJR L;  5ADX A;  4WFB L;  3VTI A;  5AQI A;  1YAG A;  3LDP A;  4DQ8 A;  3O8M A;  1BA0 A;  3H6E A;  5H1S Q;  2CGL A;  2E2Q A;  1C0F A;  2P9L B;  4XH4 A;  1LCU A;  3RSE B;  3HTV A;  3CC2 N;  2ASP A;  3TTF A;  3NVK A;  5E84 A;  1G99 A;  4BC5 A;  3VEW A;  4JKC A;  5JLF A;  1T44 A;  3G25 A;  3P4I A;  4YOY A;  1VQ4 N;  1KXP A;  4FOI A;  1HKC A;  2YHY A;  4B1Y B;  4C1N I;  5KPR A;  5FPE A;  3IMX A;  2IVP A;  2P9K A;  1HJO A;  3FZK A;  1NGC A;  1R59 O;  2D0O A;  2NRR A;  3M5R A;  4CBW A;  3R9P A;  2E2P A;  4FWS A;  5F2R A;  1TUY A;  2GEM A;  4BRF A;  1Q81 O;  2WUS A;  3UKR A;  4F9O A;  3PIP L;  1ZC6 A;  1K9M O;  2HBM A;  2P9P B;  2FSN A;  5BPM A;  4QS9 A;  3I55 N;  5AZI A;  2BUP A;  1BUP A;  5I9E B;  3CMA N;  4BRI A;  5AFU A;  3LM9 A;  3WXJ A;  3O9U A;  3LDO A;  4ILG B;  4B9Q A;  3CCU N;  4CBU A;  1BA1 A;  5KQD A;  4IFE A;  3DXM B;  3IDH A;  5BN8 A;  4AM7 A;  4FSV A;  4CD3 A;  3TSQ A;  2P9K B;  3CCE N;  5BPL A;  1HUX A;  2GX9 A;  1X9J A;  3QFU A;  2BTF A;  1MDU B;  5B8H A;  1MA9 B;  4ISF A;  1S3X A;  3QB0 A;  1VQP N;  4M7X A;  5AQW A;  3MWT A;  4A5B A;  3R1X A;  2BH1 A;  4BRP A;  4U67 L;  1DGK N;  3LDL A;  3ENO A;  3VET A;  5JVH L;  2QM1 A;  5TKW A;  3L4Q A;  3W0L A;  4H5N A;  3CCV N;  4JKG B;  1VQ8 N;  1JCG A;  3N4P A;  3G6E N;  1JJ2 M;  2FSK A;  1BWF O;  4NO7 A;  3CJ9 A;  3C0B A;  3IUC A;  4ILH A;  4BRO A;  4K25 A;  5BRD A;  2QXL A;  3TU5 A;  2OAN A;  3HRG A;  3H1Q A;  2WFB A;  1NGF A;  2Q1N A;  5DM7 L;  4BR7 A;  5HOO A;  3CME N;  4J8F A;  1JCE A;  4JKF A;  2FF6 A;  5FPD A;  2VGN A;  5GAG P;  3Q7C A;  1KD1 O;  4EIA A;  2ZWH A;  3ID8 A;  1NGB A;  4YDU C;  5JMV A;  4A61 A;  4K41 A;  4B1U B;  4BC4 A;  4BRM A;  2V52 B;  3MX5 A;  3U9D A;  3HOT A;  1YJN N;  2YJE A;  3NVM A;  4MO4 A;  1V4T A;  3HOS A;  2GTD A;  2QWN A;  2QWP A;  4FWN A;  2FXU A;  5C2D A;  5E26 A;  1NBW A;  3GBT A;  3ZET B;  5AQX A;  1EO1 A;  3MDQ A;  2FF3 B;  3IKM A;  5EOY A;  1C0G A;  2JWK A;  1IG8 A;  4BRH A;  3R6M A;  3WQT A;  5C10 A;  2I7N A;  3D6R A;  3CJC A;  3ZYY X;  3O1B A;  5AZJ B;  1N8R O;  5AQN A;  4CBX A;  4AM6 A;  1X3N A;  4A57 A;  4IOA L;  1NM1 A;  5AZJ A;  3SJH A;  1S22 A;  4QS7 A;  1VQ9 N;  4BRC A;  2QEX N;  3CHW A;  2VWB A;  3FZM A;  5AQR A;  4IO9 L;  4BRE A;  3BEX A;  4FWM A;  4EHU A;  1BDG A;  3E1Y A;  2YCH A;  4MO5 A;  3MK6 A;  1DKG D;  2DPN A;  4BGB A;  1NMD A;  1TYQ B;  2NLX A;  4WFA L;  3D2E A;  3ATU A;  5C15 A;  4NLB A;  4MLH A;  2D1K A;  5CHI A;  1YJW N;  2ZGZ A;  4FOE A;  3LM2 A;  5AQV A;  2P9S A;  3EE9 A;  4FWR A;  5GIN A;  2QI2 A;  4MLE A;  3ENH A;  1GLD G;  5AR0 A;  4YOV A;  3CJB A;  5BN9 A;  3KHY A;  1D4X A;  3LDN A;  3KK7 A;  5M1P A;  4H0Y B;  2HF4 A;  5AQJ A;  4YOT A;  3D7E O;  3P31 A;  4AF1 A;  3O5B A;  4IOC L;  1SS6 A;  4HTL A;  4CZG A;  1W2B M;  2Q31 A;  3CI5 A;  3HZ6 A;  3O1W A;  2A40 A;  2IVO A;  3H3O B;  4KH4 A;  2FSJ A;  5GIP A;  5AZI B;  3A0I X;  3TPQ A;  1E4G T;  2P9P A;  3QBW A;  2A41 A;  3C6A A;  1KAX A;  5AQG A;  1TUU A;  4BRG A;  3VF2 A;  4BGA A;  4JEP A;  4A62 A;  2YX6 A;  4GV9 A;  1E4F T;  4DHY A;  1Q82 O;  3H3N O;  1O13 A;  3MN6 A;  3QFP A;  3CCJ N;  3CC7 N;  4BQL A;  5JVG L;  3A5N C;  4H0T B;  4BRQ A;  5AQY A;  5KQ8 A;  4IO8 A;  3TTD A;  3DXK B;  3AAP A;  3FFK B;  3KVG A;  4DKW A;  4H0O A;  1M1K O;  3DXK A;  4BR9 A;  2F7T A;  3VER A;  4BR0 A;  4MDA A;  4BC3 A;  1NGG A;  4H5R A;  1NWK A;  4GNI A;  3F2K A;  4PL8 A;  5GIO A;  4LC9 B;  1XUP O;  3F5T A;  3E9P A;  5F0X A;  1NGD A;  1NJI O;  5TKY A;  4A59 A;  4K43 A;  2AA4 A;  3O6W A;  3WXM B;  1QVG M;  4FWP A;  3M3Z A;  4KBO A;  5C2F A;  2QWQ A;  2E88 A;  3VGL A;  1XC3 A;  3AGR A;  4C23 A;  1VQN N;  3FZL A;  3J8A A;  2P9I B;  3VES A;  4BRN A;  3O4W A;  3WQU A;  4PHT X;  3SAG A;  2ZJQ L;  5EXW A;  4PL7 A;  4CZI A;  4CZM A;  3S41 A;  3CC4 N;  4H5V A;  4BVP A;  3CQY A;  2UYT A;  3SMP A;  1RGI A;  4OO1 J;  1GLJ O;  3WXL A;  4KH5 A;  4GVE A;  3KWI A;  4YOU A;  3DJC A;  3UKU B;  3WXK A;  2D4W A;  4BG8 A;  4JKA A;  4U7B A;  1J6Z A;  4C1N K;  3F9M A;  3E66 A;  5MLC Q;  2GWJ A;  1HKG A;  2FLO A;  2HMP A;  3HI0 A;  3LDQ A;  3Q7B A;  3O9Q A;  3R3L A;  4XH5 A;  1NGE A;  3CCS N;  4BQZ A;  4R79 A;  1P8Z A;  3HSC A;  2NRH A;  2KHO A;  3P39 A;  1NLV A;  3FZF A;  4B1W B;  4BRD A;  1VQ5 N;  3O08 A;  1VQK N;  3K9K A;  3BF3 A;  1YVN A;  3KZB A;  3L0Q A;  5AQF A;  2GWK A;  2JWL A;  1Z05 A;  1YIJ N;  2HOE A;  4ILJ A;  4H0X B;  5BRH A;  1BG3 A;  3GOI A;  4EAH D;  3A5L C;  3GG4 A;  2HBK A;  5FPN A;  4B1X B;  1BO5 O;  4L3Q A;  1Z6R A;  3ZX3 A;  1OVY A;  3B8A X;  1XQS C;  3E9O A;  3OBW A;  3SLC A;  4IZ9 A;  2V7Y A;  3EKU A;  4M7Y A;  1K8A O;  3DWL A;  1QZ5 A;  5GAH P;  5C0Y A;  5BRF A;  4FPB A;  1NGI A;  3UB5 A;  3D2E B;  5AQH A;  2VCP A;  1H1V A;  4I6M B;  4JNE A;  1RFQ A;  3VEO A;  2OTL N;  4IJA A;  2J4R A;  3AY9 A;  1Q18 A;  1GLL O;  3CF5 L;  3L6Q A;  1IJJ A;  2GUP A;  5AQK A;  4GV3 A;  1ILY A;  3MWP A;  3CPW M;  4YOX A;  5AQS A;  5GAD P;  3CD6 N;  3EL2 A;  5LJW A;  3NMU A;  1MWK A;  1VQL N;  4BRA A;  3ZEU A;  4WFN L;  3UKR B;  4H5T A;  4O8U A;  3SAF A;  2YI1 A;  4K42 A;  3C6H A;  4JHD B;  3T7Z A;  1MWM A;  4IDH A;  3J7Z O;  3ZX0 A;  2ASM A;  5GAE P;  2HF3 A;  3QML A;  3OA9 A;  4ISG A;  3VF6 A;  1VQ6 N;  5CE3 A;  4I6M A;  2E2O A;  3FR0 A;  3L4I A;  3CCQ N;  1GLA G;  1RDU A;  1SZ2 A;  3HBT A;  2E2N A;  5EY4 A;  1QQO A;  3N4Q A;  1ATS A;  2Q36 A;  4B1V A;  3UE5 A;  2I7P A;  1NGA A;  4CZE A;  4JKH A;  4WCE L;  2OTJ N;  3BF1 A;  1YXQ A;  1BOT O;  3TSP A;  4CZJ A;  1VQO N;  2Q0U A;  3CPE A;  3AAR A;  1ATN A;  1SAZ A;  3MN7 A;  1GLB G;  1HKB A;  3BUZ B;  4JK9 A;  3MCP A;  4JHD A;  5FPM A;  3C65 A;  1BU6 O;  2PAV A;  3VF4 A;  2A3Z A;  4CJ7 A;  2E1Y A;  3SAH A;  1ATR A;  2F9W A;  5M1F A;  4JKG A;  1YHQ N;  2QTD A;  2ITM A;  3VOV A;  2P9N B;  3BP8 A;  3WT0 A;  3KWG A;  4WQ5 C;  4JKE A;  3TSU A;  3VTH A;  4IXC A;  4O5F A;  4KH6 A;  3ZET A;  2P9U A;  2A42 A;  2CH6 A;  2PBD A;  4FWO A;  1EQY A;  3EE8 A;  4YDU A;  4OPA A;  4RWT A;  2HBJ A;  3DXM A;  3FGU A;  2P9U B;  2KKZ A;  2YHX A;  4JK8 A;  4NLC A;  3R8E A;  3VEY A;  5BRE A;  3QDK A;  5LJV A;  4H0P A;  2E1Z A;  2Q97 A;  2Q0R A;  3A5O C;  3CIP A;  3GL1 A;  4FPA A;  2W40 A;  1U2V A;  5DM6 L;  4CZL A;  2PFU A;  1T3V A;  4DCH A;  1WUA A;  4JD2 B;  5AQZ A;  1V4S A;  3G4S N;  1SQK A;  1U6Z A;  3D2F A;  5AQT A;  3O9R A;  2NRV A;  3MMV A;  4ISE A;  2CGJ A;  2QWM A;  2WC9 A;  2V7Z A;  1GLC G;  3JS6 A;  2RE2 A;  2NRW A;  1HX1 A;  1CZA N;  4IEE A;  4Y0W A;  4BR2 A;  1GLE G;  2A5X A;  4NB4 A;  4CZF A;  4HWI A;  4RTF D;  3AAQ A;  3CER A;  2CH5 A;  3K9J A;  4MDB A;  2YHW A;  4GY2 B;  3SK3 A;  2P9S B;  4CI6 A;  3JXU A;  2NRT A;  4BR5 A;  4FWK A;  2ASO A;  2IVN A;  1YI2 N;  1KQS M;  4Z94 A;  3VGK A;  1T6C A;  1P90 A;  4JAX A;  4M63 C;  3ZEU B;  4CZK A;  1ESV A;  1TYQ A;  4BY9 C;  1K8K B;  4BG9 A;  1YIT N;  5C12 A;  3GE1 A;  3WEE B;  3FLC O;  1HLU A;  1T6D A;  4JKB A;  3LL3 A;  5BR9 A;  3QIC A;  3RSE A;  2VGM A;  2W41 A;  4XEI A;  4JK7 A;  1QVF M;  3VEX A;  3H45 C;  4A2B A;  1RDW X;  1JCF A;  5ELZ A;  1KAZ A;  2QWO A;  3CJ1 A;  3QBX A;  3OHR A;  5EX5 A;  1X3M A;  2QWR A;  3ULE A;  1HPM A;  4FO0 A;  2GEL A;  4O8K A;  3IFR A;  2F9T A;  4PKI A;  1YJ9 N;  1W97 L;  2QWL A;  1QZ6 A;  4FL9 A;  3CCM N;  3CJA A;  3RVC A;  4RCH A;  4CD1 A;  3EO3 A;  4CZH A;  3I56 N;  4G9Z A;  4YOW A;  5CR4 A;  3U8X A;  2ZJP L;  3EZW A;  5KPT A;  2QA4 N;  1Y64 A;  1WOQ A;  3ID6 A;  4WQ5 A;  3OW2 M;  3FE1 A;  4BRK A;  3O9S A;  4DB3 A;  3MN5 A;  3U4L A;  3MCA B;  5AQU A;  2A6A A;  5HL7 L;  1K73 O;  2P9L A;  2YJF A;  2ZGY A;  5EVZ A;  4EFH A;  4GV6 A;  5ADX H;  2QW9 A;  1NGH A;  4BC2 A;  2ZF5 O;  1QQN A;  2E8A A;  2KLA A;  1VQM N;  2Q2R A;  2H3G X;  1DEJ A;  1KC8 O;  5M1O A;  3SBG A;  3VEN A;  1ZBS A;  3MX2 A;  2D0P A;  4FVU A;  4IOX A;  2NRZ A;  5AQO A;  4H03 B;  3I8B A;  3FZH A;  4IJN A;  3O80 A;  1ZXO A;  3DAW A;  2AP1 A;  3PIO L;  1M90 O;  3M6G A;  3U9Z A;  3AGK A;  3CQX A;  3VGM A;  3ATV A;  1VQ7 N;  2HBL A;  4QS8 A;  5JIC A;  1Q86 O;  2EWS A;  4FWL A;  4JN4 A;  1DT9 A;  4B1Z A;  2HST A;  3EKS A;  4BRL A;  5AQP A;  5KPZ A;  1S72 N;  2NRX A;  3VMF B;  3WXI A;  2NNW A;  3CCL N;  3EN9 A;  3CCR N;  2P9N A;  3O9T A;  4BR4 A;  3A5M C;  3VEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...