4CHNA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 55
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4chnA00
1BIZA 3V1QA 4E7HA 3KK3A 4ZTFA 3AO5A 4KAZA 2Z1HA 3O3GA 1UWBA 3ZCMA 4F2SA 3AA3A 4CJ4A 3T3FA 3PO5A 1UAXA 1RT5A 2Z1IA 3F73A 1C1AA 3ZSQA 4CEZA 4I2PA 2XO7A 1TV6A 4DFJA 2OA8A 4C8LA 1RT6A 2B4JA 1HQEA 1C0UA 2HNDA 4CF2A 1N5YA 1LWEA 1SUQA 1D9FA 4DSIA 4M3XA 3OYBA 3KLIA 3MECA 1RT7A 2XY8A 3AA5X 1BISA 3T19A 4DS5A 4CIEA 1UA0A 2PYJA 3KD5E 2XY6A 4ELVA 1RTJA 1VSKA 3VQ9A 5FRMA 4JLHA 4Z4FA 4KREA 1VSMA 3OS1A 4CEDA 4Z4HA 3LWLA 4FJMA 3SNNA 2OPPA 4C8NA 3TAMA 3RRGA 3U3GA 2XHBA 4JRQA 1ZBHA 1HJRA 3TWHA 3KK1A 4Z0UA 1LW2A 2BE2A 4OLBA 4FW1A 5K14A 2DY4A 3NGZA 3RTVA 1S1TA 4HUEA 3TAPA 4DQIA 4I9QA 5KGWA 3LAMA 3V9UA 3OS2A 5EU7A 1RT2A 3ZT3A 1T8EA 3QIOA 1N6QA 3NE6A 4FJ9A 3NDKA 1VSHA 1S1UA 4CGDA 4CJVA 3MAQA 2OPQA 3HM9A 3K57A 1C1CA 4FM1A 3K5LA 1NKEA 3NGYA 1TKXA 4F2RA 3DMJA 3K5MA 3CYMA 3AVFA 3B6PA 2IOCA 4C8KA 1RBTA 3L2VA 4O4GA 2B6AA 4FLYA 1KLNA 3C94A 1WSGA 3VQ6A 4CFCA 2F8SA 4FXDA 2EX3A 4PQUA 5KGXA 3DOKA 4XIUA 3D45A 3EYZA 1QQCA 4LH5A 4CJUA 4N5SA 3OYLA 3V6DA 4DWIA 3VQ5A 4J2AA 3DRSA 1U48A 3U6FA 1IO2A 5J1EA 2G8FA 4IFVA 4EZ6A 3QEWA 3WNHA 2YKMA 3LPUA 1HYVA 2KFNA 3SYZA 1LV5A 2JGUA 4Q5VA 3QEPA 3AVKA 1WAFA 3KTQA 3SI6A 3VQ7A 2XRIA 4DF4A 4EP5A 4FM2A 1DLOA 3ULDA 4KRFA 1GOBA 4W5TA 3O3FA 4E7KA 4FJIA 4KB1A 4YNQA 1QSYA 4ELUA 4FJ7A 4M3YA 3QEIA 2YNFA 1BCMA 3VQAA 5FROA 5CYMA 3QO9A 3KLHA 3HSTB 1TKZA 4DLEA 4DTXA 1KFSA 4EZ9A 4CE9A 4LSLA 4M45A 4F4KA 4CHNA 4E7JA 1VSLA 1JLGA 2KTQA 4DFMA 3TANA 4FLVA 2FBTA 2P51A 1GOAA 3SPZA 4KPYA 3RWUA 1JKHA 3TARA 3TAEA 1U49A 4AHCA 3HYFA 4FJLA 4F3TA 2VG5A 1U45A 1BIUA 1QE1A 1EETA 5HRRA 3AV9A 3O3HA 1QSSA 3ZSRA 4ID1A 5C24A 1REVA 2P5GA 4QOZB 4ICLA 4Y1CA 1QS4A 1T03A 2RKIA 4FZXC 3C6TA 3V81A 2IAJA 3THVA 2QKKA 2FBVA 2DFFA 3ISNC 3I8DA 4W5OA 3L2WA 4DTUA 1TK8A 3AVNA 3IG1A 4DF8A 3RR7A 3V1RA 4E89A 2ITGA 4UQGA 1LWCA 3ZT0A 4DTRA 1RBUA 4DTOA 1NKCA 3SZ2A 3QEVA 4B9NA 4RW9A 4BWMA 3RMDA 3FFIA 1ZBLA 1CXQA 2O4GA 4LY7A 3VQPA 4DTJA 3S3MA 1SL1A 1RILA 4CJKA 2D0CA 5JS2A 3HPOA 4CJPA 3HVTA 4J2DA 3DRPA 1U47A 2XY5A 4L8RB 3E01A 1A5WA 5FRNA 2A1SA 1HNVA 4FLZA 1EX4A 3HVRA 4IG3A 2YHBA 4B3OA 3K5NA 3PV8A 2Q3SA 3SQ4A 3AVLA 1CZBA 4Z4GA 3OYAA 2DFHA 3P1GA 4DS4A 1JLFA 3CQ8A 1SKWA 3NHGA 3NH0A 2FBYA 3VQDA 1RTHA 5DMRA 4E1MA 1JLBA 4M3RA 5HRNA 4H4MA 1QTMA 1FKPA 3PUFA 3HJFA 1TAUA 1TK0A 2YNHA 4RW7A 2ZE2A 4RW4A 4YFUA 5CZ2A 4FJGA 1XI1A 2ZD1A 4QAGA 2HNZA 3KLGA 1EKEA 4W5RA 3DLKA 1L3SA 4CJQA 1L3UA 4CK2A 3LDSA 4B9VA 1XWLA 3K2PA 5HP1A 4CK1A 2ZQBA 4CGJA 1O1WA 4CJTA 4CJSA 2OZMA 2QK9A 3ZSVA 4CF9A 3MXIA 4FJNA 1T7PA 3S3OA 3VQEA 2OPRA 1FK9A 1C6VA 4F8RA 2LSNA 5J2MA 4FZYA 4Z4CA 3NCIA 3K58A 3ASMA 2HVHA 1JL2A 3V9XA 3PY8A 2X6SA 4KFBA 1F21A 3L8BA 3ZSYA 2Y1JA 4OKKA 4KTZA 4BE2A 3HPGA 4CF8A 3EY1A 3SQ2A 3VQQA 1LW0A 3B6OA 1EP4A 2Y1IA 3DLRA 2KFZA 1WAJA 1W0HA 2VWKA 4C8MA 4FLTA 4DQRA 1G15A 3ZSOA 4DSKA 4CJ3A 3OYGA 1NOYA 4DSJA 3LPTA 4E7LA 3MXJA 3OS0A 1W9HA 3SV4A 2AJQA 2RN2A 3LAKA 4DTNA 4BDZA 3I0SA 1ZBUA 5KI6A 4CIGA 4FLUA 4KKOA 1WSIA 1JLEA 2FC0A 4E19A 4FVMA 1IG9A 2HHSA 4NCAA 4AHSA 3V4IA 3HK2A 2GV9A 4B8CA 5HROA 3HPHA 1IKWA 1T05A 1ASUA 1WSHA 1ASWA 1CXUA 1CZ9A 1JL1A 1RBRA 1WN7A 1IH7A 4ID5A 4CGIA 2HB5A 3LP3A 3ZT1A 1SL0A 1XHXA 3M8PA 3H08A 4W5QA 3AVAA 2G8HA 1NJYA 4M42A 1S1VA 4B9TA 3L2RA 1HQUA 1NK4A 1NK8A 4IKFA 4B8AB 1TL1A 3UIQA 3DRRA 4IFYA 2Z1JA 2F96A 4FK4A 1VRUA 4CJEA 3CG7A 1L3VA 3OY9A 1Q8IA 1VSIA 4CCHA 1FXXA 1TL3A 1KLMA 1KSPA 1VSDA 4BACA 4W5NA 3DYAA 5CY4A 1TKTA 3NF8A 2OPSA 3LP0A 4PA1A 3SQ1A 3AO3A 4DFKA 3QESA 3SCXA 2HHQA 3NH2A 4CHZA 1L3TA 4HVJA 4CGGA 3TI0A 3L3VA 4E3SA 2YV0X 1U04A 1XHZA 4Q0BA 4K8XA 2W42A 3RMCA 4MFBA 4E0DA 4TSXA 5JS1A 1NOZA 5J2PA 2X78A 2HHWA 1NK6A 1RT3A 4LD0A 1RDDA 3DLHA 1RBVA 1JXBA 1S5JA 3KIOA 4JS4A 4N56A 3NAEA 1BGXT 4HUGA 1LAWA 1QHTA 1VSEA 2E6MA 1ITGA 4CHPA 1IKVA 3QLHA 1L5UA 3KJVA 5HLFA 1S1XA 2E4LA 3K5OA 4DSEA 2RF2A 3P5JA 4B08A 4IG0A 4FJXA 2WOMA 4KO0A 1SKSA 1HYZA 2B5JA 4DSFA 2IGIA 2VWJA 1KVBA 3OYIA 3LWMA 3NF7A 1NK9A 1KTQA 1R0AA 4O44A 3KK2A 3S3NA 4KHQA 4N76A 1S1WA 4AHUA 2DTUA 1NK0A 1X1PA 1JLAA 4AH9A 4FZZA 1U4BA 5KTQA 1X9SA 1B92A 3OYEA 4CFBA 3HP6A 4DQQA 3QERA 1DTTA 1DTQA 3NF9A 4RW8A 4DU1A 4KHYA 2HHUA 4MQ3A 2RPIA 3DM2A 4OJRA 1HMVA 3AVJA 2IDOA 3PO4A 2IS3A 4E1NA 4Y1DA 4J2EA 3AVMA 4FYDA 4AHRA 1BHLA 3F9KA 3M8QA 1J53A 2HHTA 1IKXA 2PYLA 4FJJA 4Z4IA 4AHVA 2ATQA 3HL8A 4BDYA 4DU4A 2BDPA 4DLGA 3ALYA 3LANA 5C42A 4CJWA 2X74A 5T7BA 3AA2A 4HUFA 4CIFA 2YHAA 3DLGA 1SKRA 3DLEA 3S9HA 4CK3A 1Q9YA 4OVLA 3V9WA 2FBXA 4M3ZA 4AHTA 1WLJA 3MEGA 1TKDA 4K8ZA 2Z1GA 1I3AA 4ELTA 3IAYA 3PX4A 1UA1A 1TVRA 1VSFA 1RBSA 3ZT2A 3AO1A 1C1BA 4GMJB 1KRPA 4B9UA 1BCOA 1NJZA 4CEQA 4WE1A 1X9WA 2HHVA 3K59A 3WNGA 3OYCA 4M41A 4CJFA 3U3YA 4HCCA 4N47A 3OYMA 1KVCA 3BDPA 1Z26A 3VA0A 5D3GA 3PX6A 3C95A 1EXQA 4CJLA 3MXMA 4FJKA 4DTPA 2BGGA 4LH4A 4CESA 4PWDA 5CYQA 3L3UA 3M8RA 3HO1A 3O4QA 2P1JA 5KRSA 4DMNA 2VG7A 4CGHA 3OYHA 5HBMA 3L2UA 2HHXA 4KHWA 4CGFA 4FJHA 2F8TA 4OLAA 3VQBA 3ZT4A 2G8WA 3DOLA 3L2QA 5I42A 3AO4A 1YVUA 3SJJA 4KB0A 2G8IA 1BQMA 4KI6A 4BE0A 3TABA 4R5PA 4J2BA 3AVBA 2HVIA 3WNEA 3ZSXA 3NBPA 2GUIA 3QNOA 1ZYQA 2NUBA 3KKRA 4F3OA 4FW2A 2OYQA 1YT3A 4IDKA 4BWJA 4OPJA 1TAQA 4FCYA 3QEXA 1JXEA 4I7FA 1C0MA 1RT4A 1S9GA 3TAQA 3LZJA 4RG8A 4CF1A 1JLQA 3SV3A 2G8VA 3AO2A 3M8SA 3C6UA 3DLBA 1YTAA 3LALA 5DK5A 3NGIA 3TAFA 4CERA 4KHUA 3NH1A 4CFDA 3RRHA 1RTDA 1Y97A 4H4OA 1KVAA 3ITHA 4HHTA 3SPYA 3LP2A 3OYFA 1D5AA 4CEBA 4DTSA 3G0ZA 1RT1A 1RDCA 4GW6A 3QETA 4EP4A 3VQCA 4AILC 2G8UA 5E41A 1NKBA 1X9MA 3OJSA 1FKOA 3RR8A 1HRHA 3LP1A 4NCBA 1S6QA 4LSNA 3MEEA 5I3UA 4CJ5A 3AVIA 1BL3A 4G1QA 2O4IA 1B9DA 4DQPA 5J2QA 5KRTA 1VK0A 3TR8A 4OPKA 2KW4A 3ZSWA 4CHYA 2GBZA 1J5OA 4M3TA 3AVGA 3SUOA 1B9FA 1RNHA 4GVMA 2D0AA 4CEEA 3OYNA 3RMAA 2D5RA 4KTQA 4OKEA 4KTWA 4FJ8A 4O0IA 2XY7A 2JLEA 5HRPA 1HNIA 1RCHA 2EHGA 4FM0A 1A5XA 4JS5A 3SUNA 3BGRA 1IKYA 1TGOA 2KQ2A 1HYSA 3V1OA 3KKSA 1K6YA 3DI6A 2PZSA 4B9LA 3AVHA 3SQ0A 3CM6A 3RMBA 4HCBA 3TAGA 1BI4B 3OYKA 1ZBFA 2WONA 4FLWA 1MU2A 1S9EA 1D9DA 3LZIA 1LAVA 4CHQA 1VRTA 4CF0A 1SL2A 4DTMA 4PUOA 4OGEA 5SZTA 4FLXA 3KD1E 1BI4A 3MEDA 4IBNA 3V9SA 3OYJA 2DFEA 3AVCA 4DFPA 4B9MA 3HP9A 2BANA 4KHNA 2P5OA 2R7YA 3HT3A 5J2NA 3SUQA 4N41A 2YNIA 3VQ4A 4C8OA 3CFOA 4KHSA 4I9LA 1KCFA 1WSEA 1Z25A 4O55A 3ZSZA 3SUPA 4NYNA 2A1RA 3KLFA 1NK5A 3IRXA 4NYFA 3VQ8A 1D8YA 2KZMA 3HXMA 2QXFA 4M3UA 4ZTJA 4O0JA 3CFRA 3D0PA 3JYTA 3AA4A 3T1AA 1JLCA 5HRSA 1S6PA 3JSMA 3P83D 3OJUA 3EZ5A 3VN5A 4CEOA 1HPZA 3NF6A 1ASVA 1J54A 4DQSA 1RDBA 5CZ1A 4CJRA 3CM5A 3V9ZA 2ETJA 1XC9A 1QSLA 3O4NA 1VSJA 4H8KA 4B9SA 3CFPA 1ZBIA 4DG1A 5SWMA 4CEFA 4NCGA 2QKBA 1LWFA 4DU3A 4FJ5A 2IC3A 1I39A 5C25A 4FK2A 1C0TA 1WSJA 2I5JA 4I2QA 4KV8A 4O5BA 1WNSA 3G10A 2G8KA 4BDPA 4KI4A 3NFAA 1CLQA 3IS9A 1A5VA 1YTUA 2HW3A 3I0RA 2E6LA 4Z4EA 1NJXA 4CECA 2VG6A 4ZHRA 3A2FA 2D0BA 3VA3A 1SV5A 4DSLA 1KFDA 3QNNA 4PY5A 5FDLA 3KLEA 4JRPA 1WSFA 4RW6A 1UOCA 1RTIA 4E7IA 2KZZA 2YNGA 4FK0A 1GOCA 4BE1A 4M3WA 3PX0A 3QIPA 4CEAA 2YKNA 1TK5A 1NJWA 4CFAA 4HTUA 2PY5A 1NK7A 2OZSA 3OVNA 4OGCA 4CHOA 1BQNA 2HNYA 1Q9XA 2HMIA 2X6NA 3OYDA 1RDAA 3WNFA 1J9AA 3QINA 4QCLA 4OKJA
chains in the Genus database with same CATH superfamily
3QFPA 3KK3A 4ZTFA 5M1KA 1UAXA 2OA8A 4I2PA 3THXA 1TV6A 4H5TA 1HQEA 4DSIA 1LWEA 3T1YK 5CE3A 3OYBA 2ZJQL 3KLIA 3CPEA 1RT7A 1UA0A 4CIEA 2E5LK 3CERA 3ZEUA 2ZJRL 4Z4HA 3SNNA 3A5OC 4C8NA 3TAMA 3RRGA 3U3GA 2CGJA 4JK9A 1HKGA 3KK1A 1LW2A 4OLBA 2DY4A 4JI8K 1IG8A 5EVZA 2RHKA 4PKHA 3V9UA 3OS2A 5EU7A 1RT2A 3ZT3A 4PHTX 3E9PA 1OH5A 3NE6A 4GV9A 1VSHA 4WQ5A 3MAQA 4FM1A 3NGYA 1QQOA 4C8KA 1IJJA 3B6PA 4O4GA 1VQON 2A42A 2QI2A 4FXDA 4FWKA 1T44A 3V6DA 4CJUA 1M90O 1EWQA 1FW6A 5AZIB 3LM9A 4EZ6A 3TTDA 1QHAA 3O9SA 2GELA 3GBTA 4DCHA 1OVYA 4O8KA 3VESA 2JGUA 3EZWA 3KTQA 3SI6A 4WFNL 4DV7K 4EP5A 4FM2A 3ULDA 4JI5K 1GLLO 4KRFA 1GOBA 4K42A 4W5TA 3UKUB 4YNQA 1QSYA 4M3YA 2YNFA 1BCMA 2D1KA 3VQAA 5CYMA 3KLHA 3HSTB 2YHXA 4M45A 3R9PA 5EOYA 3TANA 1Q86O 1DEJA 3SPZA 1GOAA 2H3GX 3TARA 1U49A 4AHCA 4F3TA 3O5BA 1BIUA 1QE1A 5HRRA 3AV9A 4YOTA 3ZSRA 4G9ZA 4Y1CA 1T03A 3ISNC 3U9DA 2VGMA 3DAWA 4ILGB 4OX9K 2UUAK 1VQ5N 4DF8A 4LF8K 3RR7A 1KAYA 1C0FA 1RBUA 4B9NA 4RW9A 1CXQA 1JCGA 4FWQA 3BF3A 3HPOA 4B3MK 1O13A 4CJPA 3FZFA 2XY5A 4L8RB 5FRNA 4L3QA 2YJEA 2ZGYA 4FLZA 1SZ2A 3L6QA 3K5NA 2Q3SA 3C65A 1CZBA 3P1GA 3EO3A 1JLFA 1HPMA 3NHGA 3A8YA 1RTHA 4CZJA 2HMPA 1HKCA 3BZCA 1JLBA 3MMVA 4BC3A 1QTMA 1TAUA 4IWVA 4BG8A 1XI1A 2ZD1A 4FJGA 3TTCA 3KLGA 1EKEA 1K8KB 4MDBA 3J7YP 1JCEA 3LDSA 5BR8K 1XWLA 4CK1A 2ZQBA 4CGJA 4CJSA 4CF9A 1J9AA 2WFBA 1C6VA 4DV6K 3NCIA 2UXBK 3EKUA 2X6SA 3L8BA 3ZSYA 5C2DA 3H1QA 3HPGA 1LW0A 3AARA 2QTDA 4C8MA 1W0HA 3BF1A 3OYGA 2OCEA 3SV4A 2AJQA 2RN2A 4DV5K 4RTFD 5KI6A 4CIGA 4FLUA 4JAXA 5AQTA 5BPNA 4KH6A 1IKWA 1JL1A 2V52B 5DM6L 3VGMA 5FPEA 4OPHA 3FR0A 4A2BA 4M42A 1NK8A 4IKFA 1TL1A 3SLCA 4EIAA 2O8CA 1E4GT 4FK4A 4CJEA 1L3VA 1VSIA 1FXXA 1TL3A 4YOXA 1VSDA 3DYAA 4ISFA 2OPSA 4PA1A 1HNZK 3AO3A 4JHDB 4DFKA 4JI4K 3QESA 3SCXA 4CHZA 3AGKA 4CGGA 1IBLK 3UKRB 2W42A 4TSXA 5JS1A 2HHWA 4FWOA 3DLHA 1RDUA 1JXBA 4GKKK 1BA0A 4DV0K 4BVPA 1NGBA 1S3XA 2F9WA 3QLHA 1BA1A 2W6LA 1NU0A 4DV4K 4B08A 4IG0A 5AQFA 3U9ZA 2IGIA 1KVBA 4NXMK 3VTHA 2Q0UA 4O44A 3KK2A 1VQ9N 2DTUA 1NK0A 3GOIA 1X1PA 4AH9A 3ZX2A 4DQQA 4KHYA 3NF9A 4DU1A 2RPIA 3AVJA 2VCPA 5AQQA 1N32K 3F9KA 4AHVA 2ATQA 4NXNK 3A5LC 5C42A 3CJ9A 5AQVA 2P9UB 2HSTA 5M1QA 2YHAA 4WFBL 1Q9YA 2EWSA 1WLJA 2VGNA 4YHHK 5AQLA 1RBSA 3AO1A 4GMJB 5GIOA 2WBNA 3CIPA 2HHVA 4BRLA 3K59A 3CMAN 1NGEA 2W41A 2RE2A 3MXMA 4M63C 3O4QA 2P9LA 3THWA 3D2FB 3L2UA 4OLAA 3VQBA 4IJAA 4KB0A 4ILHA 3TABA 4R5PA 3WNEA 3NBPA 3A0IX 2O8EA 1YI2N 4IDKA 4BWJA 4OPJA 1TAQA 1K9MO 3A5MC 1JXEA 1C0MA 3DXMA 3LZJA 4CF1A 1JLQA 3SV3A 3DLBA 5ADXA 1NGAA 4CERA 3JS6A 4IJNA 5AQIA 4JV5K 4CFDA 3BEXA 1KVAA 3ITHA 3R1XA 5HOOA 5JMVA 3S41A 3VQCA 3I56N 1NKBA 3W3DA 1N36K 2CGKA 3OJSA 5AQYA 1I94K 1BL3A 1YJWN 4JI0K 2O4IA 3D7EO 3O9UA 1B9DA 3ZSWA 3T69A 4CHYA 5LY3A 3GL1A 3SUOA 2O8BB 1RNHA 4CEEA 4YDUA 5BRHA 4DR7K 3IUCA 4O0IA 2JLEA 3CJBA 2KQ2A 2P9KB 1VQ8N 3VEVA 1YJ9N 4A61A 3DI6A 1MDUB 4B9LA 4A5AA 3MWPA 3TAGA 1ZBFA 4MLEA 1S9EA 1D9DA 1LAVA 1Q7YO 3NMUA 1HX1A 5LL6Z 4OGEA 4FLXA 3M3ZA 3O9TA 3OYJA 4Z94A 3AVCA 4IXCA 3HP9A 4NLCA 5M1FA 3IDHA 4GY2B 4I9LA 1WSEA 3ULEA 1D8YA 3KLFA 1NGGA 4BRKA 4JEPA 4ZTJA 5MLCQ 3CHWA 1S6PA 1EQYA 3P83D 3G71N 3EZ5A 3VN5A 3HBTA 3CM5A 3R3LA 2ETJA 1VSJA 1H1VA 4B9SA 4DG1A 2IVOA 2QKBA 1I39A 4JI1K 1GLAG 3JXUA 4I2QA 4KV8A 4BDPA 4B1VA 1WNSA 2A6AA 2E6LA 4ZHRA 3OHRA 2P9PB 4PY5A 5FDLA 3KLEA 4JRPA 2O8DB 1KAZA 4BE1A 3IMXA 3MX5A 1TK5A 3EEQA 1X3MA 4I6MA 4HTUA 1NK7A 2OZSA 4BG9A 3OVNA 1BQNA 2AP1A 2QWNA 2X6NA 1NJZA 3QINA 3HOTA 4HTLA 4OKJA 4MDAA 5C0YA 1GLDG 3ZLJA 3ENHA 3THXB 4KAZA 3MWTA 2Q0RA 3ZCMA 3AA3A 4CJ4A 4CEZA 1RT6A 2HNDA 3F5TA 3ZEUB 1D9FA 1SUQA 4M3XA 3MECA 2PYJA 1RTJA 3O9RA 5AQUA 3I55N 4JLHA 4Z4FA 2P9NB 4B9QA 4CEDA 2XHBA 4JRQA 3TWHA 3O4WA 4Z0UA 3J81O 1ILYA 3NGZA 3TAPA 5KGWA 4BVOA 2QWOA 4RWTA 3QIOA 2PFUA 3VF2A 3NDKA 4A2AA 4CGDA 2P9SA 2OPQA 3HM9A 2GWKA 4WCEL 3CYMA 3OA9A 2IOCA 2B6AA 3VQ6A 4XIUA 3EYZA 4N5SA 2ASPA 3U6FA 5J1EA 2G8FA 5DM7L 4IFVA 2YKMA 3LDQA 3VTIA 3AVKA 1RGIA 4DF4A 2A40A 4KB1A 3QEIA 4CZHA 5LJVA 3UE5A 3CCRN 1TKZA 4DTXA 1KFSA 2Q31A 3E1YA 3NVMA 4F4KA 3HM8A 4DR2K 4DFMA 4AF1A 3QBWA 2P51A 4GNIA 3RWUA 1JKHA 2E1YA 3SJHA 5BN8A 1QSSA 2E20A 4ID1A 5C24A 2P5GA 1BOTO 4H5NA 5JICA 2RKIA 2CH6A 5LMUK 3THVA 2FBVA 4W5OA 3SBTA 5B8HA 4DTUA 1TK8A 3AVNA 4DV3K 1T6CA 5BRDA 3CETA 1GLFO 4FWSA 3V1RA 4DTRA 4JI7K 1LWCA 3PSFA 1LOTB 3QEVA 4H0VB 3RMDA 3HZ6A 5KQ8A 2BH1A 4XH1A 3DRPA 1U47A 1MA9B 3E01A 2A1SA 4JKEA 3QB0A 3VOVA 1DT9A 4IG3A 3PV8A 3KWGA 4Z4GA 1NMNA 4DS4A 1NWKA 2E2NA 4LFCK 3NH0A 2FBYA 1HKBA 1BWFO 2NRHA 3ENOA 4YOUA 1FKPA 3HJFA 3EE8A 2ZE2A 4LF5K 3WXMB 3VEZA 5BPLA 2FF6A 1OH6A 4CJTA 2OZMA 4UY8O 3SBGA 3ZSVA 2QWRA 4WF9L 3MXIA 1FK9A 3FGUA 2LSNA 5J2MA 4FZYA 1BU6O 1Z6RA 3ASMA 1ZXOA 4FPAA 2VYPA 4CBXA 2Y1JA 4KTZA 3VQQA 2Y1IA 1VQPN 3DLRA 4DSKA 4J8FA 4LC9B 4DSJA 3LPTA 4E7LA 1W9HA 5M1OA 4FPBA 4DTNA 3LAKA 3HSCA 3I0SA 1BG3A 1WSIA 3QMLA 4E19A 4BRFA 4LFAK 3HK2A 4B8CA 5AQRA 4B1ZA 1WSHA 1CZ9A 1WN7A 1IH7A 1TUYA 3ZT1A 1SL0A 4FOIA 1OH7A 2G8HA 4B9TA 3L2RA 3CPWM 1NK4A 3N4QA 3P39A 3UIQA 5M1NA 3C6HA 3CG7A 3ENBA 3HOSA 4BACA 5CY4A 3LDPA 3NF8A 3LP0A 3NH2A 4H0PA 4PL7A 5AQXA 2ZGZA 1ESVA 3BY5A 2YX6A 4K8XA 3RMCA 1GLCG 1NOZA 1NK6A 3TSUA 4LD0A 1RDDA 3KIOA 3CMEN 4BR9A 3NAEA 1BGXT 4HUGA 3KK7A 1LAWA 1QHTA 1VSEA 2E6MA 4BRDA 1ITGA 4CHPA 5HL7L 1L5UA 3KJVA 5JVGL 5HLFA 2W6KA 2E4LA 3A5NC 2CH5A 3P5JA 4KO0A 2UXDK 2B5JA 3CJAA 2VWJA 3LWMA 1R0AA 4KHQA 4FWLA 1S1WA 3ID6A 4FZZA 3R6MA 1X9SA 4JKGA 1DTTA 4MQ3A 1YAGA 1HMVA 4FWRA 2IDOA 1ATNA 4Y1DA 4J2EA 1BHLA 5GAHP 5E26A 1J53A 2HHTA 2PYLA 3HL8A 3RSEA 1VQLN 4BDYA 4DU4A 3ALYA 3LANA 4BRMA 2X74A 4IOXA 4HUFA 4CIFA 2VQFK 4M7XA 1SKRA 2ZM6K 3V9WA 4GV3A 2FBXA 4M3ZA 3MEGA 1TKDA 4K8ZA 1I3AA 3IAYA 3VPZA 3PX4A 1TVRA 1VSFA 3ZT2A 4Y0WA 1KRPA 4B9UA 1X9WA 3LDOA 3M1FA 4QS7A 4HCCA 1Z26A 2P9LB 3THWB 3PX6A 1MWMA 4FJKA 4DTPA 1P90A 4CESA 4PWDA 5CYQA 3G25A 2P1JA 5KRSA 2HHXA 4FJHA 2F8TA 5IT9O 4EFHA 1VQMN 3AO4A 1YVUA 3SJJA 2O8EB 1Q82O 4J2BA 4FWMA 5BPMA 2HVIA 1NGJA 3ZSXA 3VGLA 4C1NK 3KKRA 2OYQA 1LCUA 4I7FA 1RT4A 4IOAL 4PKIA 2G8VA 1XNQK 3MN9A 1YTAA 3LALA 4YDUC 5JLHA 5LMNK 3NH1A 2WUSA 4H4OA 3SAFA 4WFAL 1WBDA 3OYFA 4CEBA 4DTSA 5C2FA 4BQLA 3F9MA 2G8UA 3D6RA 3SMPA 3LP1A 3DWLA 1CZAN 5AQOA 5I3UA 5AQHA 3AVIA 4G1QA 1W7AA 3CJCA 3TR8A 4OPKA 3CJ1A 4K41A 2BUPA 4JK8A 4JKFA 3WT0A 2NRZA 1NM1A 3H6EA 2Q36A 1HNIA 1RCHA 2EHGA 5KPRA 4FM0A 3SUNA 3BGRA 1TGOA 3KKSA 3K0SA 2Q2RA 3RMBA 4HCBA 3OYKA 5E84A 4NLBA 2KLAA 1ZC6A 3LZIA 1NGCA 2QM1A 5AQJA 1VRTA 4CF0A 5AQNA 3KD1E 1BI4A 3MEDA 4IBNA 1IBMK 2DFEA 2BANA 5C12A 4RCHA 3CCQN 3FZKA 1M1KO 3SUQA 3VENA 4N41A 2YNIA 1EO1A 3CFOA 2V7ZA 1KCFA 4O55A 3ZSZA 4NYFA 2KZMA 4FOEA 2QXFA 3HXMA 1GLJO 3AA4A 3T1AA 1V4TA 2NRTA 3DJCA 2W40A 3ZETA 4CEOA 3OJUA 3NF6A 4CJRA 5AZJA 2UYTA 4PKGA 4AQYK 3UB5A 1WBBA 4NCGA 5C25A 5ELZA 2I5JA 4KI4A 4BROA 1CLQA 3IS9A 3NVKA 2HW3A 4Z4EA 2VG6A 2D0BA 1E4FT 1SV5A 4FWPA 4H5VA 1KFDA 1HJOA 2HBLA 4I6MB 4RW6A 5GAGP 3WUHA 2V51B 1RTIA 1XQSC 1GOCA 3W0LA 3PX0A 3U8XA 2YKNA 5KPTA 1NJWA 2OTLN 4BRIA 2A3ZA 4CHOA 4OGCA 4K0KK 4ISGA 1XC3A 3WNFA 1BIZA 4E7HA 2ZJPL 5ADXH 2Z1HA 4EAHD 2HF3A 3R8EA 3CF5L 2GTDA 3T3FA 3PLAA 1RT5A 2Z1IA 1C1AA 3ZSQA 2XO7A 3H46O 4FJLA 1N5YA 4CF2A 4IZ9A 2QA4N 2XY8A 3CCLN 1BISA 3T19A 4DS5A 4ELVA 1VSKA 4BY9C 3LWLA 3DXKB 1QVGM 4JI6K 3FE1A 5LJWA 2BE2A 3RTVA 4LFBK 1S1TA 3OW2M 4LF7K 4DQIA 4JI2K 4I9QA 2P9SB 3VF6A 3LAMA 1T8EA 4BRPA 1U2VA 3PIPL 4XEIA 4FJ9A 1S1UA 1NKEA 3RVCA 4F2RA 3K5MA 3AVFA 1RBTA 4FLYA 3C94A 4DB3A 1U6ZA 5BREA 3DOKA 4BC2A 1N33K 1JCFA 4OO1J 1QQCA 4LH5A 4DWIA 2D0OA 1KXPA 1IO2A 4C23A 4BR7A 3QEWA 3WNHA 3CQXA 4IO9L 1LV5A 4MLHA 4WQ4C 3H3OB 4Q5VA 1G99A 4NO7A 3TSQA 4IEEA 2XRIA 1GLBG 4FJIA 2FSJA 1OKJA 4EZ9A 3ZX0A 4LSLA 3IKMA 4CHNA 1VSLA 1JLGA 2KTQA 4DR6K 2FBTA 2NRWA 4BRGA 3LDNA 2VG5A 1EETA 3O3HA 5BN9A 4CZKA 4ICLA 2O8FA 2NLXA 4EHTA 3V81A 2QKKA 3JAMO 2PBDA 3EE9A 3L2WA 4JKHA 3IG1A 4DUYK 4DHYA 4E89A 1WB9A 4DTOA 1NKCA 4CZIA 3CD6N 3O80A 4O5FA 2GUPA 2UXCK 3OBYA 3VQPA 3S3MA 4DTJA 4MO4A 1SL1A 4H5WA 4CJKA 2D0CA 5JS2A 2OANA 1XMQK 1EX4A 3CJ7A 1BUPA 3VF4A 4B3OA 4JKCA 3D2EA 1TYQA 3SQ4A 3AVLA 2DFHA 3CQ8A 2GWJA 2A5XA 4JN4A 3VQDA 3THYA 5DMRA 4U7BA 5HRNA 4JD2A 4H4MA 4CI6A 2WC9A 1TK0A 3WXJA 1YJNN 2I7PA 2CGLA 4RW4A 5CZ2A 3ZYYX 4H03B 4FVUA 4QAGA 2HNZA 4BR4A 4JKAA 3DLKA 1BO5O 3FZLA 4CJQA 2HOEA 4WQ5C 3EL2A 1T7PA 3S3OA 2OPRA 3TTFA 5BR9A 4Z4CA 1JL2A 1VQ6N 2V7YA 4BE2A 4CF8A 3EY1A 1J6ZA 1VHXA 3ID8A 3B6OA 2KFZA 1WAJA 4DQRA 2VWKA 3ZSOA 4CJ3A 2KKZA 1NOYA 3OS0A 1ZBUA 4FSVA 1JLEA 2FC0A 4FVMA 1IG9A 4NCAA 4YY3K 3J7ZO 1T05A 1ASUA 1ASWA 3I8BA 1RBRA 4ID5A 3FFKB 4CGIA 3LP3A 4GKJK 1IBKK 3B8AX 4GV6A 1DGKN 3H08A 4W5QA 3AVAA 3T7ZA 1HQUA 4WYBA 1QQMA 3DRRA 3CC2N 1NNEA 1VRUA 2F7TA 4LF6K 1Q8IA 3C0BA 4CCHA 4CZGA 2ITMA 5TKWA 1QZ6A 4DKWA 4BQZA 3C6AA 2FF3B 3L3VA 5EY4A 4E3SA 2YV0X 1U04A 4YORA 5J2PA 3C7NA 2JWLA 1RT3A 1RBVA 3CC4N 1X9JA 4V19S 1TUUA 1S1XA 3K5OA 3ATUA 5EXWA 1HYZA 4DSFA 3BZKA 4JKGB 4CBUA 1YIJN 2IVNA 3S3NA 1D4XA 3HI0A 5EX5A 1JLAA 1K73O 3CCUN 3WEEA 1B92A 3OYEA 4CFBA 3E9OA 4XH5A 4RW8A 2HHUA 3VEXA 3DM2A 4OJRA 4BGAA 3WQTA 3RSEB 2IS3A 4E1NA 4DR3K 4FYDA 4AHRA 3M8QA 1IKXA 4Z4IA 3O9QA 4KH4A 4DLGA 5JLFA 4CJWA 3AA2A 2YHWA 3DLGA 4CK3A 4AHTA 3P31A 4JNEA 2Z1GA 5AQKA 5A2QO 4ELTA 3SK3A 5GIPA 1BCOA 4CEQA 4CVNE 4M41A 3U3YA 4N47A 5FPMA 4A59A 3BDPA 3VA0A 4BC4A 5D3GA 3C95A 2GX9A 2P9PA 4BRAA 3J7AP 4LH4A 3L3UA 4DMNA 2VG7A 4B3TK 3ZT4A 2G8WA 4IDHA 2ZF5O 3E66A 4BE0A 4H5RA 3AVBA 2GUIA 3QNOA 2E88A 4AM7A 1ZYQA 2NUBA 4FW2A 4B1YB 4FCYA 3QEXA 3FZMA 4BRNA 2OTJN 5KQDA 3O1WA 3TAQA 4CW7B 3QBXA 1VQNN 1RFQA 3AO2A 3C6UA 5DK5A 3NGIA 3TAFA 2P9IA 3MCPA 4OPAA 3RRHA 1WUAA 3O6WA 2O8CB 2P9NA 4HHTA 3SPYA 3LP2A 1QVFM 2QEXN 3PSIA 4GW6A 4EP4A 1GLEG 3ATVA 4AILC 5E41A 3RR8A 1HRHA 4LSNA 3MN5A 3MEEA 4CJ5A 1XUPO 4BC5A 4BR2A 1N8RO 4DQPA 3Q7CA 5J2QA 4CZEA 2GBZA 4YOVA 2NNWA 1B9FA 4DR4K 4GVMA 4DV1K 3OYNA 2NRRA 1YF5L 1IV0A 1DKGD 2D5RA 3GG4A 3KVGA 4KTWA 4OKEA 4KTQA 2XY7A 4FJ8A 3MK6A 3H1VX 5HRPA 2E2PA 1A5XA 4JS5A 5CHIA 4CD1A 4DR5K 3F2KA 1HYSA 3V1OA 1K6YA 2VWBA 3AVHA 3SQ0A 1BI4B 4H0TB 1MU2A 2FXUA 4CHQA 4A5BA 3MN6A 4PUOA 1NLVA 3KHYA 4JKDA 3TSPA 3CCSN 4KHNA 2P5OA 2KHOA 3QICA 5J2NA 3VQ4A 4KHSA 2A1RA 2BTFA 4KHWA 4IOCL 3SUPA 1NK5A 5C10A 3ZETB 1HNXK 5AZJB 4IEIA 3L0QA 3HRGA 3VEYA 3JYTA 3D0PA 4CD3A 4FL9A 3WXKA 3SMSA 1Q81O 1ZBIA 1HPZA 1ZBHA 4DQSA 1U4BA 3AAPA 1RDBA 1QSLA 1NGIA 3O4NA 4CEFA 1VQKN 2HBJA 4DU3A 2E2OA 1WSJA 1NGFA 4O5BA 5IWAK 1YTUA 4JYAK 4DR1K 1FJGK 3A2FA 3VA3A 4DSLA 1KAXA 3QNNA 1UOCA 4E7IA 5C15A 4FK0A 2A41A 4CEAA 4CFAA 2Q97A 1SQKA 1Q9XA 2HMIA 4X66K 1ATSA 3OYDA 1HLUA 3MDQA 4QCLA 3V1QA 1S72N 2YCHA 3AO5A 5AQPA 3J8AA 3O3GA 1UWBA 4F2SA 2GEMA 3DXMB 3PO5A 3EN9A 4DFJA 3F73A 4C8LA 2QWPA 2B4JA 2QWMA 1C0UA 4FWNA 4YOYA 4M7YA 3AGRA 2F9TA 3L4QA 3AA5X 4NB4A 4IO8A 3KD5E 2G8IA 4BR0A 1NG9A 2XY6A 3VQ9A 5FRMA 4KREA 1VSMA 3OS1A 3VERA 2FLOA 3H3NO 4FJMA 2OPPA 4H0OA 3O08A 4R79A 1HJRA 3CI5A 2F4VK 1ATRA 4FW1A 5K14A 1U2VB 4HUEA 3MX2A 1J5EK 4BRHA 2HF4A 1XNRK 1N6QA 3H45C 4B1XB 5GAEP 4CJVA 3K57A 1C1CA 3K5LA 2UUCK 2HBMA 1TKXA 4X65K 3SAHA 3L2VA 5F1XA 1KLNA 1WSGA 4CFCA 2F8SA 3ZX3A 2EX3A 4PQUA 5KGXA 1KC8O 3D45A 3OYLA 3VQ5A 4J2AA 3DRSA 1U48A 3PIOL 3LPUA 1SAZA 1HYVA 2KFNA 3SYZA 3QEPA 4CZMA 1WAFA 5AZIA 3VQ7A 1DLOA 4FO0A 3WXLA 3O3FA 4DQ8A 4E7KA 4ELUA 4FJ7A 4H0YB 5FROA 3QO9A 5AR0A 5FLXO 4DLEA 3P38A 4CE9A 3ULEB 1Q18A 2E1ZA 2ASMA 3UKUA 4E7JA 2QWLA 3O1BA 4FLVA 3KWIA 4KPYA 3TAEA 2O8FB 2NRVA 3HYFA 1U45A 1VQ7N 4B1WB 1NMDA 4QS8A 1C0GA 2FSNA 4QOZB 1REVA 3K9KA 1W2BM 1QS4A 4FZXC 3C6TA 1OVQA 2IAJA 3I8DA 2DFFA 3VMFB 1SS6A 2ITGA 3ZT0A 3SZ2A 3TU5A 2NRXA 4BWMA 2ZWHA 3FFIA 2IVPA 1ZBLA 3CCMN 2O4GA 4LY7A 1QQNA 1RILA 3D2EB 4J2DA 3HVTA 4HWIA 1TYQB 1A5WA 4JKBA 1HNVA 4LF9K 3HVRA 2YHBA 4YOWA 3QFUA 3THYB 3OYAA 4JD2B 1SKWA 4ISEA 2ASOA 1HUXA 4JK7A 4E1MA 1HR0K 4M3RA 3LM2A 5I9EB 3PUFA 2YNHA 1VAZA 4RW7A 4YFUA 4MO5A 2JWKA 3MN7A 4CBWA 4W5RA 2NZTA 1L3SA 2J4RA 1NGHA 1L3UA 4CK2A 4B9VA 3K2PA 5HP1A 2QK9A 1O1WA 4DUZK 3OTOK 4FJNA 3HTVA 3VEWA 1K8KA 3VQEA 3L4IA 1NJIO 4JI3K 4B3RK 2HHHK 4F8RA 3K58A 2HVHA 3VETA 1RDWX 3V9XA 4KBOA 3PY8A 4KFBA 4CZFA 1F21A 1Y64A 1OH8A 2D4WA 4OKKA 3SQ2A 1EP4A 4FLTA 1G15A 1R59O 3FLCO 3MXJA 1T3VA 4BDZA 4KKOA 3CCEN 1V4SA 1KQSM 2HHSA 4AHSA 3V4IA 5JVHL 2UUBK 1Z05A 2GV9A 5HROA 3HPHA 4UQGA 1CXUA 2HB5A 1XHXA 3M8PA 1YVNA 1NJYA 1S1VA 3AAQA 4B1UB 2YI1A 5AQGA 4B8AB 4CZLA 1P8ZA 1XMOK 5AQSA 4IFYA 2Z1JA 2F96A 3GDQA 1NBWA 3OY9A 1KSPA 1KLMA 3G6EN 4W5NA 1TKTA 4H0XB 4AM6A 3SQ1A 3C7NB 2HHQA 1L3TA 5TKYA 4HVJA 3TI0A 3VGKA 1XHZA 3E9LA 3N4PA 4Q0BA 2QWQA 4GVEA 4JHDA 4MFBA 4EHUA 4E0DA 1W97L 2X78A 1E3MA 1S5JA 3UKRA 4JS4A 4N56A 1HNWK 5BRFA 1IKVA 5FPDA 4DSEA 2RF2A 4FJXA 2WOMA 3KZBA 1SKSA 3MCAB 2YHYA 2YJFA 3WEEB 3OYIA 3DLLL 3NF7A 1NK9A 1KTQA 3U4LA 4N76A 4AHUA 5F0XA 5KTQA 3HP6A 3QERA 1DTQA 3PO4A 3AVMA 2FSKA 4KH5A 4FJJA 2BDPA 5AQZA 4BGBA 5T7BA 3DLEA 3S9HA 2QW9A 4OVLA 2D0PA 1YITN 5GADP 1VQ4N 1WOQA 2P9UA 4F9OA 2Q1NA 1UA1A 1C1BA 4WE1A 2PAVA 3WNGA 3OYCA 4CJFA 2UU9K 3OYMA 1KVCA 3CCJN 2DPNA 3WXIA 1EXQA 4CJLA 2BGGA 3HO1A 4QS9A 3M8RA 1X3NA 2IIRA 3TPQA 4CGHA 3OYHA 5HBMA 1NGDA 4CGFA 4IFEA 3AY9A 3DOLA 3L2QA 5CR4A 5I42A 1BQMA 4KI6A 3D2FA 5AQWA 2I7NA 1S22A 4F3OA 2HBKA 1YT3A 2WTUA 5AFUH 2P9IB 1S9GA 4RG8A 4BR5A 4PL8A 3M8SA 3M6GA 1K8AO 1YUWA 4BRQA 3CC7N 4KHUA 3OBWA 1RTDA 1Y97A 1KD1O 3GE1A 1JJ2M 3DXKA 4KHPK 1D5AA 4E1JA 4LF4K 4X62K 3G0ZA 1RT1A 1RDCA 3T1HK 3QETA 1T6DA 5AFUA 5AQMA 1X9MA 1FKOA 4NCBA 1S6QA 5F2RA 3WQUA 3SAGA 2QXLA 5KRTA 1VK0A 1QZ5A 3FZHA 3LDLA 2KW4A 4M3TA 1J5OA 1BDGA 3AVGA 4O8UA 4DV2K 3CCVN 4X64K 1ZBSA 2D0AA 3RMAA 2O8BA 1IKYA 3BUZB 4U67L 4K25A 2PZSA 1N34K 3CM6A 2WONA 4FLWA 2P9KA 3CQYA 1SL2A 4DTMA 4A62A 1MWKA 4ILJA 5SZTA 4K43A 3V9SA 2AA4A 4DFPA 3EKSA 4B9MA 3O8MA 4B3SK 5H1SQ 2R7YA 3HT3A 4C8OA 3BP8A 1Z25A 4NYNA 3IRXA 3VQ8A 4BREA 4M3UA 4O0JA 2E8AA 3CFRA 3P4IA 3J80O 4WQ4A 2VQEK 1YHQN 1JLCA 2E2QA 3LL3A 5HRSA 3JSMA 1YXQA 1ASVA 1J54A 1XC9A 3V9ZA 5CZ1A 4BRCA 4H8KA 3G4SN 3CFPA 4C1NI 5SWMA 1LWFA 4XH4A 5M1PA 2IC3A 4FJ5A 3M5RA 5AJ3K 1C0TA 4FK2A 2G8KA 3G10A 3NFAA 5GINA 1A5VA 3I0RA 1NJXA 4CECA 4CJ7A 3QDKA 3K9JA 3IFRA 1WSFA 2KZZA 5FPNA 2YNGA 4M3WA 3Q7BA 3CXCM 3QIPA 2O8DA 2PY5A 2HNYA 3VEOA 5KPZA 1EWRA 1RDAA 4A57A 3DMJA 3I33A
chains in the Genus database with same CATH topology
1BIZA 3V1QA 4E7HA 3KK3A 4ZTFA 3AO5A 4KAZA 2Z1HA 3O3GA 1UWBA 3ZCMA 4F2SA 3AA3A 4CJ4A 3T3FA 3PO5A 1UAXA 1RT5A 2Z1IA 3F73A 1C1AA 3ZSQA 4CEZA 4I2PA 2XO7A 1TV6A 4DFJA 2OA8A 4C8LA 1RT6A 2B4JA 1HQEA 1C0UA 2HNDA 4CF2A 1N5YA 1LWEA 1SUQA 1D9FA 4DSIA 4M3XA 3OYBA 3KLIA 3MECA 1RT7A 2XY8A 3AA5X 1BISA 3T19A 4DS5A 4CIEA 1UA0A 2PYJA 3KD5E 2XY6A 4ELVA 1RTJA 1VSKA 3VQ9A 5FRMA 4JLHA 4Z4FA 4KREA 1VSMA 3OS1A 4CEDA 4Z4HA 3LWLA 4FJMA 3SNNA 2OPPA 4C8NA 3TAMA 3RRGA 3U3GA 2XHBA 4JRQA 1ZBHA 1HJRA 3TWHA 3KK1A 4Z0UA 1LW2A 2BE2A 4OLBA 4FW1A 5K14A 2DY4A 3NGZA 3RTVA 1S1TA 4HUEA 3TAPA 4DQIA 4I9QA 5KGWA 3LAMA 3V9UA 3OS2A 5EU7A 1RT2A 3ZT3A 1T8EA 3QIOA 1N6QA 3NE6A 4FJ9A 3NDKA 1VSHA 1S1UA 4CGDA 4CJVA 3MAQA 2OPQA 3HM9A 3K57A 1C1CA 4FM1A 3K5LA 1NKEA 3NGYA 1TKXA 4F2RA 3DMJA 3K5MA 3CYMA 3AVFA 3B6PA 2IOCA 4C8KA 1RBTA 3L2VA 4O4GA 2B6AA 4FLYA 1KLNA 3C94A 1WSGA 3VQ6A 4CFCA 2F8SA 4FXDA 2EX3A 4PQUA 5KGXA 3DOKA 4XIUA 3D45A 3EYZA 1QQCA 4LH5A 4CJUA 4N5SA 3OYLA 3V6DA 4DWIA 3VQ5A 4J2AA 3DRSA 1U48A 3U6FA 1IO2A 5J1EA 2G8FA 4IFVA 4EZ6A 3QEWA 3WNHA 2YKMA 3LPUA 1HYVA 2KFNA 3SYZA 1LV5A 2JGUA 4Q5VA 3QEPA 3AVKA 1WAFA 3KTQA 3SI6A 3VQ7A 2XRIA 4DF4A 4EP5A 4FM2A 1DLOA 3ULDA 4KRFA 1GOBA 4W5TA 3O3FA 4E7KA 4FJIA 4KB1A 4YNQA 1QSYA 4ELUA 4FJ7A 4M3YA 3QEIA 2YNFA 1BCMA 3VQAA 5FROA 5CYMA 3QO9A 3KLHA 3HSTB 1TKZA 4DLEA 4DTXA 1KFSA 4EZ9A 4CE9A 4LSLA 4M45A 4F4KA 4CHNA 4E7JA 1VSLA 1JLGA 2KTQA 4DFMA 3TANA 4FLVA 2FBTA 2P51A 1GOAA 3SPZA 4KPYA 3RWUA 1JKHA 3TARA 3TAEA 1U49A 4AHCA 3HYFA 4FJLA 4F3TA 2VG5A 1U45A 1BIUA 1QE1A 1EETA 5HRRA 3AV9A 3O3HA 1QSSA 3ZSRA 4ID1A 5C24A 1REVA 2P5GA 4QOZB 4ICLA 4Y1CA 1QS4A 1T03A 2RKIA 4FZXC 3C6TA 3V81A 2IAJA 3THVA 2QKKA 2FBVA 2DFFA 3ISNC 3I8DA 4W5OA 3L2WA 4DTUA 1TK8A 3AVNA 3IG1A 4DF8A 3RR7A 3V1RA 4E89A 2ITGA 4UQGA 1LWCA 3ZT0A 4DTRA 1RBUA 4DTOA 1NKCA 3SZ2A 3QEVA 4B9NA 4RW9A 4BWMA 3RMDA 3FFIA 1ZBLA 1CXQA 2O4GA 4LY7A 3VQPA 4DTJA 3S3MA 1SL1A 1RILA 4CJKA 2D0CA 5JS2A 3HPOA 4CJPA 3HVTA 4J2DA 3DRPA 1U47A 2XY5A 4L8RB 3E01A 1A5WA 5FRNA 2A1SA 1HNVA 4FLZA 1EX4A 3HVRA 4IG3A 2YHBA 4B3OA 3K5NA 3PV8A 2Q3SA 3SQ4A 3AVLA 1CZBA 4Z4GA 3OYAA 2DFHA 3P1GA 4DS4A 1JLFA 3CQ8A 1SKWA 3NHGA 3NH0A 2FBYA 3VQDA 1RTHA 5DMRA 4E1MA 1JLBA 4M3RA 5HRNA 4H4MA 1QTMA 1FKPA 3PUFA 3HJFA 1TAUA 1TK0A 2YNHA 4RW7A 2ZE2A 4RW4A 4YFUA 5CZ2A 4FJGA 1XI1A 2ZD1A 4QAGA 2HNZA 3KLGA 1EKEA 4W5RA 3DLKA 1L3SA 4CJQA 1L3UA 4CK2A 3LDSA 4B9VA 1XWLA 3K2PA 5HP1A 4CK1A 2ZQBA 4CGJA 1O1WA 4CJTA 4CJSA 2OZMA 2QK9A 3ZSVA 4CF9A 3MXIA 4FJNA 1T7PA 3S3OA 3VQEA 2OPRA 1FK9A 1C6VA 4F8RA 2LSNA 5J2MA 4FZYA 4Z4CA 3NCIA 3K58A 3ASMA 2HVHA 1JL2A 3V9XA 3PY8A 2X6SA 4KFBA 1F21A 3L8BA 3ZSYA 2Y1JA 4OKKA 4KTZA 4BE2A 3HPGA 4CF8A 3EY1A 3SQ2A 3VQQA 1LW0A 3B6OA 1EP4A 2Y1IA 3DLRA 2KFZA 1WAJA 1W0HA 2VWKA 4C8MA 4FLTA 4DQRA 1G15A 3ZSOA 4DSKA 4CJ3A 3OYGA 1NOYA 4DSJA 3LPTA 4E7LA 3MXJA 3OS0A 1W9HA 3SV4A 2AJQA 2RN2A 3LAKA 4DTNA 4BDZA 3I0SA 1ZBUA 5KI6A 4CIGA 4FLUA 4KKOA 1WSIA 1JLEA 2FC0A 4E19A 4FVMA 1IG9A 2HHSA 4NCAA 4AHSA 3V4IA 3HK2A 2GV9A 4B8CA 5HROA 3HPHA 1IKWA 1T05A 1ASUA 1WSHA 1ASWA 1CXUA 1CZ9A 1JL1A 1RBRA 1WN7A 1IH7A 4ID5A 4CGIA 2HB5A 3LP3A 3ZT1A 1SL0A 1XHXA 3M8PA 3H08A 4W5QA 3AVAA 2G8HA 1NJYA 4M42A 1S1VA 4B9TA 3L2RA 1HQUA 1NK4A 1NK8A 4IKFA 4B8AB 1TL1A 3UIQA 3DRRA 4IFYA 2Z1JA 2F96A 4FK4A 1VRUA 4CJEA 3CG7A 1L3VA 3OY9A 1Q8IA 1VSIA 4CCHA 1FXXA 1TL3A 1KLMA 1KSPA 1VSDA 4BACA 4W5NA 3DYAA 5CY4A 1TKTA 3NF8A 2OPSA 3LP0A 4PA1A 3SQ1A 3AO3A 4DFKA 3QESA 3SCXA 2HHQA 3NH2A 4CHZA 1L3TA 4HVJA 4CGGA 3TI0A 3L3VA 4E3SA 2YV0X 1U04A 1XHZA 4Q0BA 4K8XA 2W42A 3RMCA 4MFBA 4E0DA 4TSXA 5JS1A 1NOZA 5J2PA 2X78A 2HHWA 1NK6A 1RT3A 4LD0A 1RDDA 3DLHA 1RBVA 1JXBA 1S5JA 3KIOA 4JS4A 4N56A 3NAEA 1BGXT 4HUGA 1LAWA 1QHTA 1VSEA 2E6MA 1ITGA 4CHPA 1IKVA 3QLHA 1L5UA 3KJVA 5HLFA 1S1XA 2E4LA 3K5OA 4DSEA 2RF2A 3P5JA 4B08A 4IG0A 4FJXA 2WOMA 4KO0A 1SKSA 1HYZA 2B5JA 4DSFA 2IGIA 2VWJA 1KVBA 3OYIA 3LWMA 3NF7A 1NK9A 1KTQA 1R0AA 4O44A 3KK2A 3S3NA 4KHQA 4N76A 1S1WA 4AHUA 2DTUA 1NK0A 1X1PA 1JLAA 4AH9A 4FZZA 1U4BA 5KTQA 1X9SA 1B92A 3OYEA 4CFBA 3HP6A 4DQQA 3QERA 1DTTA 1DTQA 3NF9A 4RW8A 4DU1A 4KHYA 2HHUA 4MQ3A 2RPIA 3DM2A 4OJRA 1HMVA 3AVJA 2IDOA 3PO4A 2IS3A 4E1NA 4Y1DA 4J2EA 3AVMA 4FYDA 4AHRA 1BHLA 3F9KA 3M8QA 1J53A 2HHTA 1IKXA 2PYLA 4FJJA 4Z4IA 4AHVA 2ATQA 3HL8A 4BDYA 4DU4A 2BDPA 4DLGA 3ALYA 3LANA 5C42A 4CJWA 2X74A 5T7BA 3AA2A 4HUFA 4CIFA 2YHAA 3DLGA 1SKRA 3DLEA 3S9HA 4CK3A 1Q9YA 4OVLA 3V9WA 2FBXA 4M3ZA 4AHTA 1WLJA 3MEGA 1TKDA 4K8ZA 2Z1GA 1I3AA 4ELTA 3IAYA 3PX4A 1UA1A 1TVRA 1VSFA 1RBSA 3ZT2A 3AO1A 1C1BA 4GMJB 1KRPA 4B9UA 1BCOA 1NJZA 4CEQA 4WE1A 1X9WA 2HHVA 3K59A 3WNGA 3OYCA 4M41A 4CJFA 3U3YA 4HCCA 4N47A 3OYMA 1KVCA 3BDPA 1Z26A 3VA0A 5D3GA 3PX6A 3C95A 1EXQA 4CJLA 3MXMA 4FJKA 4DTPA 2BGGA 4LH4A 4CESA 4PWDA 5CYQA 3L3UA 3M8RA 3HO1A 3O4QA 2P1JA 5KRSA 4DMNA 2VG7A 4CGHA 3OYHA 5HBMA 3L2UA 2HHXA 4KHWA 4CGFA 4FJHA 2F8TA 4OLAA 3VQBA 3ZT4A 2G8WA 3DOLA 3L2QA 5I42A 3AO4A 1YVUA 3SJJA 4KB0A 2G8IA 1BQMA 4KI6A 4BE0A 3TABA 4R5PA 4J2BA 3AVBA 2HVIA 3WNEA 3ZSXA 3NBPA 2GUIA 3QNOA 1ZYQA 2NUBA 3KKRA 4F3OA 4FW2A 2OYQA 1YT3A 4IDKA 4BWJA 4OPJA 1TAQA 4FCYA 3QEXA 1JXEA 4I7FA 1C0MA 1RT4A 1S9GA 3TAQA 3LZJA 4RG8A 4CF1A 1JLQA 3SV3A 2G8VA 3AO2A 3M8SA 3C6UA 3DLBA 1YTAA 3LALA 5DK5A 3NGIA 3TAFA 4CERA 4KHUA 3NH1A 4CFDA 3RRHA 1RTDA 1Y97A 4H4OA 1KVAA 3ITHA 4HHTA 3SPYA 3LP2A 3OYFA 1D5AA 4CEBA 4DTSA 3G0ZA 1RT1A 1RDCA 4GW6A 3QETA 4EP4A 3VQCA 4AILC 2G8UA 5E41A 1NKBA 1X9MA 3OJSA 1FKOA 3RR8A 1HRHA 3LP1A 4NCBA 1S6QA 4LSNA 3MEEA 5I3UA 4CJ5A 3AVIA 1BL3A 4G1QA 2O4IA 1B9DA 4DQPA 5J2QA 5KRTA 1VK0A 3TR8A 4OPKA 2KW4A 3ZSWA 4CHYA 2GBZA 1J5OA 4M3TA 3AVGA 3SUOA 1B9FA 1RNHA 4GVMA 2D0AA 4CEEA 3OYNA 3RMAA 2D5RA 4KTQA 4OKEA 4KTWA 4FJ8A 4O0IA 2XY7A 2JLEA 5HRPA 1HNIA 1RCHA 2EHGA 4FM0A 1A5XA 4JS5A 3SUNA 3BGRA 1IKYA 1TGOA 2KQ2A 1HYSA 3V1OA 3KKSA 1K6YA 3DI6A 2PZSA 4B9LA 3AVHA 3SQ0A 3CM6A 3RMBA 4HCBA 3TAGA 1BI4B 3OYKA 1ZBFA 2WONA 4FLWA 1MU2A 1S9EA 1D9DA 3LZIA 1LAVA 4CHQA 1VRTA 4CF0A 1SL2A 4DTMA 4PUOA 4OGEA 5SZTA 4FLXA 3KD1E 1BI4A 3MEDA 4IBNA 3V9SA 3OYJA 2DFEA 3AVCA 4DFPA 4B9MA 3HP9A 2BANA 4KHNA 2P5OA 2R7YA 3HT3A 5J2NA 3SUQA 4N41A 2YNIA 3VQ4A 4C8OA 3CFOA 4KHSA 4I9LA 1KCFA 1WSEA 1Z25A 4O55A 3ZSZA 3SUPA 4NYNA 2A1RA 3KLFA 1NK5A 3IRXA 4NYFA 3VQ8A 1D8YA 2KZMA 3HXMA 2QXFA 4M3UA 4ZTJA 4O0JA 3CFRA 3D0PA 3JYTA 3AA4A 3T1AA 1JLCA 5HRSA 1S6PA 3JSMA 3P83D 3OJUA 3EZ5A 3VN5A 4CEOA 1HPZA 3NF6A 1ASVA 1J54A 4DQSA 1RDBA 5CZ1A 4CJRA 3CM5A 3V9ZA 2ETJA 1XC9A 1QSLA 3O4NA 1VSJA 4H8KA 4B9SA 3CFPA 1ZBIA 4DG1A 5SWMA 4CEFA 4NCGA 2QKBA 1LWFA 4DU3A 4FJ5A 2IC3A 1I39A 5C25A 4FK2A 1C0TA 1WSJA 2I5JA 4I2QA 4KV8A 4O5BA 1WNSA 3G10A 2G8KA 4BDPA 4KI4A 3NFAA 1CLQA 3IS9A 1A5VA 1YTUA 2HW3A 3I0RA 2E6LA 4Z4EA 1NJXA 4CECA 2VG6A 4ZHRA 3A2FA 2D0BA 3VA3A 1SV5A 4DSLA 1KFDA 3QNNA 4PY5A 5FDLA 3KLEA 4JRPA 1WSFA 4RW6A 1UOCA 1RTIA 4E7IA 2KZZA 2YNGA 4FK0A 1GOCA 4BE1A 4M3WA 3PX0A 3QIPA 4CEAA 2YKNA 1TK5A 1NJWA 4CFAA 4HTUA 2PY5A 1NK7A 2OZSA 3OVNA 4OGCA 4CHOA 1BQNA 2HNYA 1Q9XA 2HMIA 2X6NA 3OYDA 1RDAA 3WNFA 1J9AA 3QINA 4QCLA 4OKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIZ A;  3V1Q A;  4E7H A;  3KK3 A;  4ZTF A;  3AO5 A;  4KAZ A;  2Z1H A;  3O3G A;  1UWB A;  3ZCM A;  4F2S A;  3AA3 A;  4CJ4 A;  3T3F A;  3PO5 A;  1UAX A;  1RT5 A;  2Z1I A;  3F73 A;  1C1A A;  3ZSQ A;  4CEZ A;  4I2P A;  2XO7 A;  1TV6 A;  4DFJ A;  2OA8 A;  4C8L A;  1RT6 A;  2B4J A;  1HQE A;  1C0U A;  2HND A;  4CF2 A;  1N5Y A;  1LWE A;  1SUQ A;  1D9F A;  4DSI A;  4M3X A;  3OYB A;  3KLI A;  3MEC A;  1RT7 A;  2XY8 A;  3AA5 X;  1BIS A;  3T19 A;  4DS5 A;  4CIE A;  1UA0 A;  2PYJ A;  3KD5 E;  2XY6 A;  4ELV A;  1RTJ A;  1VSK A;  3VQ9 A;  5FRM A;  4JLH A;  4Z4F A;  4KRE A;  1VSM A;  3OS1 A;  4CED A;  4Z4H A;  3LWL A;  4FJM A;  3SNN A;  2OPP A;  4C8N A;  3TAM A;  3RRG A;  3U3G A;  2XHB A;  4JRQ A;  1ZBH A;  1HJR A;  3TWH A;  3KK1 A;  4Z0U A;  1LW2 A;  2BE2 A;  4OLB A;  4FW1 A;  5K14 A;  2DY4 A;  3NGZ A;  3RTV A;  1S1T A;  4HUE A;  3TAP A;  4DQI A;  4I9Q A;  5KGW A;  3LAM A;  3V9U A;  3OS2 A;  5EU7 A;  1RT2 A;  3ZT3 A;  1T8E A;  3QIO A;  1N6Q A;  3NE6 A;  4FJ9 A;  3NDK A;  1VSH A;  1S1U A;  4CGD A;  4CJV A;  3MAQ A;  2OPQ A;  3HM9 A;  3K57 A;  1C1C A;  4FM1 A;  3K5L A;  1NKE A;  3NGY A;  1TKX A;  4F2R A;  3DMJ A;  3K5M A;  3CYM A;  3AVF A;  3B6P A;  2IOC A;  4C8K A;  1RBT A;  3L2V A;  4O4G A;  2B6A A;  4FLY A;  1KLN A;  3C94 A;  1WSG A;  3VQ6 A;  4CFC A;  2F8S A;  4FXD A;  2EX3 A;  4PQU A;  5KGX A;  3DOK A;  4XIU A;  3D45 A;  3EYZ A;  1QQC A;  4LH5 A;  4CJU A;  4N5S A;  3OYL A;  3V6D A;  4DWI A;  3VQ5 A;  4J2A A;  3DRS A;  1U48 A;  3U6F A;  1IO2 A;  5J1E A;  2G8F A;  4IFV A;  4EZ6 A;  3QEW A;  3WNH A;  2YKM A;  3LPU A;  1HYV A;  2KFN A;  3SYZ A;  1LV5 A;  2JGU A;  4Q5V A;  3QEP A;  3AVK A;  1WAF A;  3KTQ A;  3SI6 A;  3VQ7 A;  2XRI A;  4DF4 A;  4EP5 A;  4FM2 A;  1DLO A;  3ULD A;  4KRF A;  1GOB A;  4W5T A;  3O3F A;  4E7K A;  4FJI A;  4KB1 A;  4YNQ A;  1QSY A;  4ELU A;  4FJ7 A;  4M3Y A;  3QEI A;  2YNF A;  1BCM A;  3VQA A;  5FRO A;  5CYM A;  3QO9 A;  3KLH A;  3HST B;  1TKZ A;  4DLE A;  4DTX A;  1KFS A;  4EZ9 A;  4CE9 A;  4LSL A;  4M45 A;  4F4K A;  4CHN A;  4E7J A;  1VSL A;  1JLG A;  2KTQ A;  4DFM A;  3TAN A;  4FLV A;  2FBT A;  2P51 A;  1GOA A;  3SPZ A;  4KPY A;  3RWU A;  1JKH A;  3TAR A;  3TAE A;  1U49 A;  4AHC A;  3HYF A;  4FJL A;  4F3T A;  2VG5 A;  1U45 A;  1BIU A;  1QE1 A;  1EET A;  5HRR A;  3AV9 A;  3O3H A;  1QSS A;  3ZSR A;  4ID1 A;  5C24 A;  1REV A;  2P5G A;  4QOZ B;  4ICL A;  4Y1C A;  1QS4 A;  1T03 A;  2RKI A;  4FZX C;  3C6T A;  3V81 A;  2IAJ A;  3THV A;  2QKK A;  2FBV A;  2DFF A;  3ISN C;  3I8D A;  4W5O A;  3L2W A;  4DTU A;  1TK8 A;  3AVN A;  3IG1 A;  4DF8 A;  3RR7 A;  3V1R A;  4E89 A;  2ITG A;  4UQG A;  1LWC A;  3ZT0 A;  4DTR A;  1RBU A;  4DTO A;  1NKC A;  3SZ2 A;  3QEV A;  4B9N A;  4RW9 A;  4BWM A;  3RMD A;  3FFI A;  1ZBL A;  1CXQ A;  2O4G A;  4LY7 A;  3VQP A;  4DTJ A;  3S3M A;  1SL1 A;  1RIL A;  4CJK A;  2D0C A;  5JS2 A;  3HPO A;  4CJP A;  3HVT A;  4J2D A;  3DRP A;  1U47 A;  2XY5 A;  4L8R B;  3E01 A;  1A5W A;  5FRN A;  2A1S A;  1HNV A;  4FLZ A;  1EX4 A;  3HVR A;  4IG3 A;  2YHB A;  4B3O A;  3K5N A;  3PV8 A;  2Q3S A;  3SQ4 A;  3AVL A;  1CZB A;  4Z4G A;  3OYA A;  2DFH A;  3P1G A;  4DS4 A;  1JLF A;  3CQ8 A;  1SKW A;  3NHG A;  3NH0 A;  2FBY A;  3VQD A;  1RTH A;  5DMR A;  4E1M A;  1JLB A;  4M3R A;  5HRN A;  4H4M A;  1QTM A;  1FKP A;  3PUF A;  3HJF A;  1TAU A;  1TK0 A;  2YNH A;  4RW7 A;  2ZE2 A;  4RW4 A;  4YFU A;  5CZ2 A;  4FJG A;  1XI1 A;  2ZD1 A;  4QAG A;  2HNZ A;  3KLG A;  1EKE A;  4W5R A;  3DLK A;  1L3S A;  4CJQ A;  1L3U A;  4CK2 A;  3LDS A;  4B9V A;  1XWL A;  3K2P A;  5HP1 A;  4CK1 A;  2ZQB A;  4CGJ A;  1O1W A;  4CJT A;  4CJS A;  2OZM A;  2QK9 A;  3ZSV A;  4CF9 A;  3MXI A;  4FJN A;  1T7P A;  3S3O A;  3VQE A;  2OPR A;  1FK9 A;  1C6V A;  4F8R A;  2LSN A;  5J2M A;  4FZY A;  4Z4C A;  3NCI A;  3K58 A;  3ASM A;  2HVH A;  1JL2 A;  3V9X A;  3PY8 A;  2X6S A;  4KFB A;  1F21 A;  3L8B A;  3ZSY A;  2Y1J A;  4OKK A;  4KTZ A;  4BE2 A;  3HPG A;  4CF8 A;  3EY1 A;  3SQ2 A;  3VQQ A;  1LW0 A;  3B6O A;  1EP4 A;  2Y1I A;  3DLR A;  2KFZ A;  1WAJ A;  1W0H A;  2VWK A;  4C8M A;  4FLT A;  4DQR A;  1G15 A;  3ZSO A;  4DSK A;  4CJ3 A;  3OYG A;  1NOY A;  4DSJ A;  3LPT A;  4E7L A;  3MXJ A;  3OS0 A;  1W9H A;  3SV4 A;  2AJQ A;  2RN2 A;  3LAK A;  4DTN A;  4BDZ A;  3I0S A;  1ZBU A;  5KI6 A;  4CIG A;  4FLU A;  4KKO A;  1WSI A;  1JLE A;  2FC0 A;  4E19 A;  4FVM A;  1IG9 A;  2HHS A;  4NCA A;  4AHS A;  3V4I A;  3HK2 A;  2GV9 A;  4B8C A;  5HRO A;  3HPH A;  1IKW A;  1T05 A;  1ASU A;  1WSH A;  1ASW A;  1CXU A;  1CZ9 A;  1JL1 A;  1RBR A;  1WN7 A;  1IH7 A;  4ID5 A;  4CGI A;  2HB5 A;  3LP3 A;  3ZT1 A;  1SL0 A;  1XHX A;  3M8P A;  3H08 A;  4W5Q A;  3AVA A;  2G8H A;  1NJY A;  4M42 A;  1S1V A;  4B9T A;  3L2R A;  1HQU A;  1NK4 A;  1NK8 A;  4IKF A;  4B8A B;  1TL1 A;  3UIQ A;  3DRR A;  4IFY A;  2Z1J A;  2F96 A;  4FK4 A;  1VRU A;  4CJE A;  3CG7 A;  1L3V A;  3OY9 A;  1Q8I A;  1VSI A;  4CCH A;  1FXX A;  1TL3 A;  1KLM A;  1KSP A;  1VSD A;  4BAC A;  4W5N A;  3DYA A;  5CY4 A;  1TKT A;  3NF8 A;  2OPS A;  3LP0 A;  4PA1 A;  3SQ1 A;  3AO3 A;  4DFK A;  3QES A;  3SCX A;  2HHQ A;  3NH2 A;  4CHZ A;  1L3T A;  4HVJ A;  4CGG A;  3TI0 A;  3L3V A;  4E3S A;  2YV0 X;  1U04 A;  1XHZ A;  4Q0B A;  4K8X A;  2W42 A;  3RMC A;  4MFB A;  4E0D A;  4TSX A;  5JS1 A;  1NOZ A;  5J2P A;  2X78 A;  2HHW A;  1NK6 A;  1RT3 A;  4LD0 A;  1RDD A;  3DLH A;  1RBV A;  1JXB A;  1S5J A;  3KIO A;  4JS4 A;  4N56 A;  3NAE A;  1BGX T;  4HUG A;  1LAW A;  1QHT A;  1VSE A;  2E6M A;  1ITG A;  4CHP A;  1IKV A;  3QLH A;  1L5U A;  3KJV A;  5HLF A;  1S1X A;  2E4L A;  3K5O A;  4DSE A;  2RF2 A;  3P5J A;  4B08 A;  4IG0 A;  4FJX A;  2WOM A;  4KO0 A;  1SKS A;  1HYZ A;  2B5J A;  4DSF A;  2IGI A;  2VWJ A;  1KVB A;  3OYI A;  3LWM A;  3NF7 A;  1NK9 A;  1KTQ A;  1R0A A;  4O44 A;  3KK2 A;  3S3N A;  4KHQ A;  4N76 A;  1S1W A;  4AHU A;  2DTU A;  1NK0 A;  1X1P A;  1JLA A;  4AH9 A;  4FZZ A;  1U4B A;  5KTQ A;  1X9S A;  1B92 A;  3OYE A;  4CFB A;  3HP6 A;  4DQQ A;  3QER A;  1DTT A;  1DTQ A;  3NF9 A;  4RW8 A;  4DU1 A;  4KHY A;  2HHU A;  4MQ3 A;  2RPI A;  3DM2 A;  4OJR A;  1HMV A;  3AVJ A;  2IDO A;  3PO4 A;  2IS3 A;  4E1N A;  4Y1D A;  4J2E A;  3AVM A;  4FYD A;  4AHR A;  1BHL A;  3F9K A;  3M8Q A;  1J53 A;  2HHT A;  1IKX A;  2PYL A;  4FJJ A;  4Z4I A;  4AHV A;  2ATQ A;  3HL8 A;  4BDY A;  4DU4 A;  2BDP A;  4DLG A;  3ALY A;  3LAN A;  5C42 A;  4CJW A;  2X74 A;  5T7B A;  3AA2 A;  4HUF A;  4CIF A;  2YHA A;  3DLG A;  1SKR A;  3DLE A;  3S9H A;  4CK3 A;  1Q9Y A;  4OVL A;  3V9W A;  2FBX A;  4M3Z A;  4AHT A;  1WLJ A;  3MEG A;  1TKD A;  4K8Z A;  2Z1G A;  1I3A A;  4ELT A;  3IAY A;  3PX4 A;  1UA1 A;  1TVR A;  1VSF A;  1RBS A;  3ZT2 A;  3AO1 A;  1C1B A;  4GMJ B;  1KRP A;  4B9U A;  1BCO A;  1NJZ A;  4CEQ A;  4WE1 A;  1X9W A;  2HHV A;  3K59 A;  3WNG A;  3OYC A;  4M41 A;  4CJF A;  3U3Y A;  4HCC A;  4N47 A;  3OYM A;  1KVC A;  3BDP A;  1Z26 A;  3VA0 A;  5D3G A;  3PX6 A;  3C95 A;  1EXQ A;  4CJL A;  3MXM A;  4FJK A;  4DTP A;  2BGG A;  4LH4 A;  4CES A;  4PWD A;  5CYQ A;  3L3U A;  3M8R A;  3HO1 A;  3O4Q A;  2P1J A;  5KRS A;  4DMN A;  2VG7 A;  4CGH A;  3OYH A;  5HBM A;  3L2U A;  2HHX A;  4KHW A;  4CGF A;  4FJH A;  2F8T A;  4OLA A;  3VQB A;  3ZT4 A;  2G8W A;  3DOL A;  3L2Q A;  5I42 A;  3AO4 A;  1YVU A;  3SJJ A;  4KB0 A;  2G8I A;  1BQM A;  4KI6 A;  4BE0 A;  3TAB A;  4R5P A;  4J2B A;  3AVB A;  2HVI A;  3WNE A;  3ZSX A;  3NBP A;  2GUI A;  3QNO A;  1ZYQ A;  2NUB A;  3KKR A;  4F3O A;  4FW2 A;  2OYQ A;  1YT3 A;  4IDK A;  4BWJ A;  4OPJ A;  1TAQ A;  4FCY A;  3QEX A;  1JXE A;  4I7F A;  1C0M A;  1RT4 A;  1S9G A;  3TAQ A;  3LZJ A;  4RG8 A;  4CF1 A;  1JLQ A;  3SV3 A;  2G8V A;  3AO2 A;  3M8S A;  3C6U A;  3DLB A;  1YTA A;  3LAL A;  5DK5 A;  3NGI A;  3TAF A;  4CER A;  4KHU A;  3NH1 A;  4CFD A;  3RRH A;  1RTD A;  1Y97 A;  4H4O A;  1KVA A;  3ITH A;  4HHT A;  3SPY A;  3LP2 A;  3OYF A;  1D5A A;  4CEB A;  4DTS A;  3G0Z A;  1RT1 A;  1RDC A;  4GW6 A;  3QET A;  4EP4 A;  3VQC A;  4AIL C;  2G8U A;  5E41 A;  1NKB A;  1X9M A;  3OJS A;  1FKO A;  3RR8 A;  1HRH A;  3LP1 A;  4NCB A;  1S6Q A;  4LSN A;  3MEE A;  5I3U A;  4CJ5 A;  3AVI A;  1BL3 A;  4G1Q A;  2O4I A;  1B9D A;  4DQP A;  5J2Q A;  5KRT A;  1VK0 A;  3TR8 A;  4OPK A;  2KW4 A;  3ZSW A;  4CHY A;  2GBZ A;  1J5O A;  4M3T A;  3AVG A;  3SUO A;  1B9F A;  1RNH A;  4GVM A;  2D0A A;  4CEE A;  3OYN A;  3RMA A;  2D5R A;  4KTQ A;  4OKE A;  4KTW A;  4FJ8 A;  4O0I A;  2XY7 A;  2JLE A;  5HRP A;  1HNI A;  1RCH A;  2EHG A;  4FM0 A;  1A5X A;  4JS5 A;  3SUN A;  3BGR A;  1IKY A;  1TGO A;  2KQ2 A;  1HYS A;  3V1O A;  3KKS A;  1K6Y A;  3DI6 A;  2PZS A;  4B9L A;  3AVH A;  3SQ0 A;  3CM6 A;  3RMB A;  4HCB A;  3TAG A;  1BI4 B;  3OYK A;  1ZBF A;  2WON A;  4FLW A;  1MU2 A;  1S9E A;  1D9D A;  3LZI A;  1LAV A;  4CHQ A;  1VRT A;  4CF0 A;  1SL2 A;  4DTM A;  4PUO A;  4OGE A;  5SZT A;  4FLX A;  3KD1 E;  1BI4 A;  3MED A;  4IBN A;  3V9S A;  3OYJ A;  2DFE A;  3AVC A;  4DFP A;  4B9M A;  3HP9 A;  2BAN A;  4KHN A;  2P5O A;  2R7Y A;  3HT3 A;  5J2N A;  3SUQ A;  4N41 A;  2YNI A;  3VQ4 A;  4C8O A;  3CFO A;  4KHS A;  4I9L A;  1KCF A;  1WSE A;  1Z25 A;  4O55 A;  3ZSZ A;  3SUP A;  4NYN A;  2A1R A;  3KLF A;  1NK5 A;  3IRX A;  4NYF A;  3VQ8 A;  1D8Y A;  2KZM A;  3HXM A;  2QXF A;  4M3U A;  4ZTJ A;  4O0J A;  3CFR A;  3D0P A;  3JYT A;  3AA4 A;  3T1A A;  1JLC A;  5HRS A;  1S6P A;  3JSM A;  3P83 D;  3OJU A;  3EZ5 A;  3VN5 A;  4CEO A;  1HPZ A;  3NF6 A;  1ASV A;  1J54 A;  4DQS A;  1RDB A;  5CZ1 A;  4CJR A;  3CM5 A;  3V9Z A;  2ETJ A;  1XC9 A;  1QSL A;  3O4N A;  1VSJ A;  4H8K A;  4B9S A;  3CFP A;  1ZBI A;  4DG1 A;  5SWM A;  4CEF A;  4NCG A;  2QKB A;  1LWF A;  4DU3 A;  4FJ5 A;  2IC3 A;  1I39 A;  5C25 A;  4FK2 A;  1C0T A;  1WSJ A;  2I5J A;  4I2Q A;  4KV8 A;  4O5B A;  1WNS A;  3G10 A;  2G8K A;  4BDP A;  4KI4 A;  3NFA A;  1CLQ A;  3IS9 A;  1A5V A;  1YTU A;  2HW3 A;  3I0R A;  2E6L A;  4Z4E A;  1NJX A;  4CEC A;  2VG6 A;  4ZHR A;  3A2F A;  2D0B A;  3VA3 A;  1SV5 A;  4DSL A;  1KFD A;  3QNN A;  4PY5 A;  5FDL A;  3KLE A;  4JRP A;  1WSF A;  4RW6 A;  1UOC A;  1RTI A;  4E7I A;  2KZZ A;  2YNG A;  4FK0 A;  1GOC A;  4BE1 A;  4M3W A;  3PX0 A;  3QIP A;  4CEA A;  2YKN A;  1TK5 A;  1NJW A;  4CFA A;  4HTU A;  2PY5 A;  1NK7 A;  2OZS A;  3OVN A;  4OGC A;  4CHO A;  1BQN A;  2HNY A;  1Q9X A;  2HMI A;  2X6N A;  3OYD A;  1RDA A;  3WNF A;  1J9A A;  3QIN A;  4QCL A;  4OKJ A; 
#chains in the Genus database with same CATH topology
 3QFP A;  3KK3 A;  4ZTF A;  5M1K A;  1UAX A;  2OA8 A;  4I2P A;  3THX A;  1TV6 A;  4H5T A;  1HQE A;  4DSI A;  1LWE A;  3T1Y K;  5CE3 A;  3OYB A;  2ZJQ L;  3KLI A;  3CPE A;  1RT7 A;  1UA0 A;  4CIE A;  2E5L K;  3CER A;  3ZEU A;  2ZJR L;  4Z4H A;  3SNN A;  3A5O C;  4C8N A;  3TAM A;  3RRG A;  3U3G A;  2CGJ A;  4JK9 A;  1HKG A;  3KK1 A;  1LW2 A;  4OLB A;  2DY4 A;  4JI8 K;  1IG8 A;  5EVZ A;  2RHK A;  4PKH A;  3V9U A;  3OS2 A;  5EU7 A;  1RT2 A;  3ZT3 A;  4PHT X;  3E9P A;  1OH5 A;  3NE6 A;  4GV9 A;  1VSH A;  4WQ5 A;  3MAQ A;  4FM1 A;  3NGY A;  1QQO A;  4C8K A;  1IJJ A;  3B6P A;  4O4G A;  1VQO N;  2A42 A;  2QI2 A;  4FXD A;  4FWK A;  1T44 A;  3V6D A;  4CJU A;  1M90 O;  1EWQ A;  1FW6 A;  5AZI B;  3LM9 A;  4EZ6 A;  3TTD A;  1QHA A;  3O9S A;  2GEL A;  3GBT A;  4DCH A;  1OVY A;  4O8K A;  3VES A;  2JGU A;  3EZW A;  3KTQ A;  3SI6 A;  4WFN L;  4DV7 K;  4EP5 A;  4FM2 A;  3ULD A;  4JI5 K;  1GLL O;  4KRF A;  1GOB A;  4K42 A;  4W5T A;  3UKU B;  4YNQ A;  1QSY A;  4M3Y A;  2YNF A;  1BCM A;  2D1K A;  3VQA A;  5CYM A;  3KLH A;  3HST B;  2YHX A;  4M45 A;  3R9P A;  5EOY A;  3TAN A;  1Q86 O;  1DEJ A;  3SPZ A;  1GOA A;  2H3G X;  3TAR A;  1U49 A;  4AHC A;  4F3T A;  3O5B A;  1BIU A;  1QE1 A;  5HRR A;  3AV9 A;  4YOT A;  3ZSR A;  4G9Z A;  4Y1C A;  1T03 A;  3ISN C;  3U9D A;  2VGM A;  3DAW A;  4ILG B;  4OX9 K;  2UUA K;  1VQ5 N;  4DF8 A;  4LF8 K;  3RR7 A;  1KAY A;  1C0F A;  1RBU A;  4B9N A;  4RW9 A;  1CXQ A;  1JCG A;  4FWQ A;  3BF3 A;  3HPO A;  4B3M K;  1O13 A;  4CJP A;  3FZF A;  2XY5 A;  4L8R B;  5FRN A;  4L3Q A;  2YJE A;  2ZGY A;  4FLZ A;  1SZ2 A;  3L6Q A;  3K5N A;  2Q3S A;  3C65 A;  1CZB A;  3P1G A;  3EO3 A;  1JLF A;  1HPM A;  3NHG A;  3A8Y A;  1RTH A;  4CZJ A;  2HMP A;  1HKC A;  3BZC A;  1JLB A;  3MMV A;  4BC3 A;  1QTM A;  1TAU A;  4IWV A;  4BG8 A;  1XI1 A;  2ZD1 A;  4FJG A;  3TTC A;  3KLG A;  1EKE A;  1K8K B;  4MDB A;  3J7Y P;  1JCE A;  3LDS A;  5BR8 K;  1XWL A;  4CK1 A;  2ZQB A;  4CGJ A;  4CJS A;  4CF9 A;  1J9A A;  2WFB A;  1C6V A;  4DV6 K;  3NCI A;  2UXB K;  3EKU A;  2X6S A;  3L8B A;  3ZSY A;  5C2D A;  3H1Q A;  3HPG A;  1LW0 A;  3AAR A;  2QTD A;  4C8M A;  1W0H A;  3BF1 A;  3OYG A;  2OCE A;  3SV4 A;  2AJQ A;  2RN2 A;  4DV5 K;  4RTF D;  5KI6 A;  4CIG A;  4FLU A;  4JAX A;  5AQT A;  5BPN A;  4KH6 A;  1IKW A;  1JL1 A;  2V52 B;  5DM6 L;  3VGM A;  5FPE A;  4OPH A;  3FR0 A;  4A2B A;  4M42 A;  1NK8 A;  4IKF A;  1TL1 A;  3SLC A;  4EIA A;  2O8C A;  1E4G T;  4FK4 A;  4CJE A;  1L3V A;  1VSI A;  1FXX A;  1TL3 A;  4YOX A;  1VSD A;  3DYA A;  4ISF A;  2OPS A;  4PA1 A;  1HNZ K;  3AO3 A;  4JHD B;  4DFK A;  4JI4 K;  3QES A;  3SCX A;  4CHZ A;  3AGK A;  4CGG A;  1IBL K;  3UKR B;  2W42 A;  4TSX A;  5JS1 A;  2HHW A;  4FWO A;  3DLH A;  1RDU A;  1JXB A;  4GKK K;  1BA0 A;  4DV0 K;  4BVP A;  1NGB A;  1S3X A;  2F9W A;  3QLH A;  1BA1 A;  2W6L A;  1NU0 A;  4DV4 K;  4B08 A;  4IG0 A;  5AQF A;  3U9Z A;  2IGI A;  1KVB A;  4NXM K;  3VTH A;  2Q0U A;  4O44 A;  3KK2 A;  1VQ9 N;  2DTU A;  1NK0 A;  3GOI A;  1X1P A;  4AH9 A;  3ZX2 A;  4DQQ A;  4KHY A;  3NF9 A;  4DU1 A;  2RPI A;  3AVJ A;  2VCP A;  5AQQ A;  1N32 K;  3F9K A;  4AHV A;  2ATQ A;  4NXN K;  3A5L C;  5C42 A;  3CJ9 A;  5AQV A;  2P9U B;  2HST A;  5M1Q A;  2YHA A;  4WFB L;  1Q9Y A;  2EWS A;  1WLJ A;  2VGN A;  4YHH K;  5AQL A;  1RBS A;  3AO1 A;  4GMJ B;  5GIO A;  2WBN A;  3CIP A;  2HHV A;  4BRL A;  3K59 A;  3CMA N;  1NGE A;  2W41 A;  2RE2 A;  3MXM A;  4M63 C;  3O4Q A;  2P9L A;  3THW A;  3D2F B;  3L2U A;  4OLA A;  3VQB A;  4IJA A;  4KB0 A;  4ILH A;  3TAB A;  4R5P A;  3WNE A;  3NBP A;  3A0I X;  2O8E A;  1YI2 N;  4IDK A;  4BWJ A;  4OPJ A;  1TAQ A;  1K9M O;  3A5M C;  1JXE A;  1C0M A;  3DXM A;  3LZJ A;  4CF1 A;  1JLQ A;  3SV3 A;  3DLB A;  5ADX A;  1NGA A;  4CER A;  3JS6 A;  4IJN A;  5AQI A;  4JV5 K;  4CFD A;  3BEX A;  1KVA A;  3ITH A;  3R1X A;  5HOO A;  5JMV A;  3S41 A;  3VQC A;  3I56 N;  1NKB A;  3W3D A;  1N36 K;  2CGK A;  3OJS A;  5AQY A;  1I94 K;  1BL3 A;  1YJW N;  4JI0 K;  2O4I A;  3D7E O;  3O9U A;  1B9D A;  3ZSW A;  3T69 A;  4CHY A;  5LY3 A;  3GL1 A;  3SUO A;  2O8B B;  1RNH A;  4CEE A;  4YDU A;  5BRH A;  4DR7 K;  3IUC A;  4O0I A;  2JLE A;  3CJB A;  2KQ2 A;  2P9K B;  1VQ8 N;  3VEV A;  1YJ9 N;  4A61 A;  3DI6 A;  1MDU B;  4B9L A;  4A5A A;  3MWP A;  3TAG A;  1ZBF A;  4MLE A;  1S9E A;  1D9D A;  1LAV A;  1Q7Y O;  3NMU A;  1HX1 A;  5LL6 Z;  4OGE A;  4FLX A;  3M3Z A;  3O9T A;  3OYJ A;  4Z94 A;  3AVC A;  4IXC A;  3HP9 A;  4NLC A;  5M1F A;  3IDH A;  4GY2 B;  4I9L A;  1WSE A;  3ULE A;  1D8Y A;  3KLF A;  1NGG A;  4BRK A;  4JEP A;  4ZTJ A;  5MLC Q;  3CHW A;  1S6P A;  1EQY A;  3P83 D;  3G71 N;  3EZ5 A;  3VN5 A;  3HBT A;  3CM5 A;  3R3L A;  2ETJ A;  1VSJ A;  1H1V A;  4B9S A;  4DG1 A;  2IVO A;  2QKB A;  1I39 A;  4JI1 K;  1GLA G;  3JXU A;  4I2Q A;  4KV8 A;  4BDP A;  4B1V A;  1WNS A;  2A6A A;  2E6L A;  4ZHR A;  3OHR A;  2P9P B;  4PY5 A;  5FDL A;  3KLE A;  4JRP A;  2O8D B;  1KAZ A;  4BE1 A;  3IMX A;  3MX5 A;  1TK5 A;  3EEQ A;  1X3M A;  4I6M A;  4HTU A;  1NK7 A;  2OZS A;  4BG9 A;  3OVN A;  1BQN A;  2AP1 A;  2QWN A;  2X6N A;  1NJZ A;  3QIN A;  3HOT A;  4HTL A;  4OKJ A;  4MDA A;  5C0Y A;  1GLD G;  3ZLJ A;  3ENH A;  3THX B;  4KAZ A;  3MWT A;  2Q0R A;  3ZCM A;  3AA3 A;  4CJ4 A;  4CEZ A;  1RT6 A;  2HND A;  3F5T A;  3ZEU B;  1D9F A;  1SUQ A;  4M3X A;  3MEC A;  2PYJ A;  1RTJ A;  3O9R A;  5AQU A;  3I55 N;  4JLH A;  4Z4F A;  2P9N B;  4B9Q A;  4CED A;  2XHB A;  4JRQ A;  3TWH A;  3O4W A;  4Z0U A;  3J81 O;  1ILY A;  3NGZ A;  3TAP A;  5KGW A;  4BVO A;  2QWO A;  4RWT A;  3QIO A;  2PFU A;  3VF2 A;  3NDK A;  4A2A A;  4CGD A;  2P9S A;  2OPQ A;  3HM9 A;  2GWK A;  4WCE L;  3CYM A;  3OA9 A;  2IOC A;  2B6A A;  3VQ6 A;  4XIU A;  3EYZ A;  4N5S A;  2ASP A;  3U6F A;  5J1E A;  2G8F A;  5DM7 L;  4IFV A;  2YKM A;  3LDQ A;  3VTI A;  3AVK A;  1RGI A;  4DF4 A;  2A40 A;  4KB1 A;  3QEI A;  4CZH A;  5LJV A;  3UE5 A;  3CCR N;  1TKZ A;  4DTX A;  1KFS A;  2Q31 A;  3E1Y A;  3NVM A;  4F4K A;  3HM8 A;  4DR2 K;  4DFM A;  4AF1 A;  3QBW A;  2P51 A;  4GNI A;  3RWU A;  1JKH A;  2E1Y A;  3SJH A;  5BN8 A;  1QSS A;  2E20 A;  4ID1 A;  5C24 A;  2P5G A;  1BOT O;  4H5N A;  5JIC A;  2RKI A;  2CH6 A;  5LMU K;  3THV A;  2FBV A;  4W5O A;  3SBT A;  5B8H A;  4DTU A;  1TK8 A;  3AVN A;  4DV3 K;  1T6C A;  5BRD A;  3CET A;  1GLF O;  4FWS A;  3V1R A;  4DTR A;  4JI7 K;  1LWC A;  3PSF A;  1LOT B;  3QEV A;  4H0V B;  3RMD A;  3HZ6 A;  5KQ8 A;  2BH1 A;  4XH1 A;  3DRP A;  1U47 A;  1MA9 B;  3E01 A;  2A1S A;  4JKE A;  3QB0 A;  3VOV A;  1DT9 A;  4IG3 A;  3PV8 A;  3KWG A;  4Z4G A;  1NMN A;  4DS4 A;  1NWK A;  2E2N A;  4LFC K;  3NH0 A;  2FBY A;  1HKB A;  1BWF O;  2NRH A;  3ENO A;  4YOU A;  1FKP A;  3HJF A;  3EE8 A;  2ZE2 A;  4LF5 K;  3WXM B;  3VEZ A;  5BPL A;  2FF6 A;  1OH6 A;  4CJT A;  2OZM A;  4UY8 O;  3SBG A;  3ZSV A;  2QWR A;  4WF9 L;  3MXI A;  1FK9 A;  3FGU A;  2LSN A;  5J2M A;  4FZY A;  1BU6 O;  1Z6R A;  3ASM A;  1ZXO A;  4FPA A;  2VYP A;  4CBX A;  2Y1J A;  4KTZ A;  3VQQ A;  2Y1I A;  1VQP N;  3DLR A;  4DSK A;  4J8F A;  4LC9 B;  4DSJ A;  3LPT A;  4E7L A;  1W9H A;  5M1O A;  4FPB A;  4DTN A;  3LAK A;  3HSC A;  3I0S A;  1BG3 A;  1WSI A;  3QML A;  4E19 A;  4BRF A;  4LFA K;  3HK2 A;  4B8C A;  5AQR A;  4B1Z A;  1WSH A;  1CZ9 A;  1WN7 A;  1IH7 A;  1TUY A;  3ZT1 A;  1SL0 A;  4FOI A;  1OH7 A;  2G8H A;  4B9T A;  3L2R A;  3CPW M;  1NK4 A;  3N4Q A;  3P39 A;  3UIQ A;  5M1N A;  3C6H A;  3CG7 A;  3ENB A;  3HOS A;  4BAC A;  5CY4 A;  3LDP A;  3NF8 A;  3LP0 A;  3NH2 A;  4H0P A;  4PL7 A;  5AQX A;  2ZGZ A;  1ESV A;  3BY5 A;  2YX6 A;  4K8X A;  3RMC A;  1GLC G;  1NOZ A;  1NK6 A;  3TSU A;  4LD0 A;  1RDD A;  3KIO A;  3CME N;  4BR9 A;  3NAE A;  1BGX T;  4HUG A;  3KK7 A;  1LAW A;  1QHT A;  1VSE A;  2E6M A;  4BRD A;  1ITG A;  4CHP A;  5HL7 L;  1L5U A;  3KJV A;  5JVG L;  5HLF A;  2W6K A;  2E4L A;  3A5N C;  2CH5 A;  3P5J A;  4KO0 A;  2UXD K;  2B5J A;  3CJA A;  2VWJ A;  3LWM A;  1R0A A;  4KHQ A;  4FWL A;  1S1W A;  3ID6 A;  4FZZ A;  3R6M A;  1X9S A;  4JKG A;  1DTT A;  4MQ3 A;  1YAG A;  1HMV A;  4FWR A;  2IDO A;  1ATN A;  4Y1D A;  4J2E A;  1BHL A;  5GAH P;  5E26 A;  1J53 A;  2HHT A;  2PYL A;  3HL8 A;  3RSE A;  1VQL N;  4BDY A;  4DU4 A;  3ALY A;  3LAN A;  4BRM A;  2X74 A;  4IOX A;  4HUF A;  4CIF A;  2VQF K;  4M7X A;  1SKR A;  2ZM6 K;  3V9W A;  4GV3 A;  2FBX A;  4M3Z A;  3MEG A;  1TKD A;  4K8Z A;  1I3A A;  3IAY A;  3VPZ A;  3PX4 A;  1TVR A;  1VSF A;  3ZT2 A;  4Y0W A;  1KRP A;  4B9U A;  1X9W A;  3LDO A;  3M1F A;  4QS7 A;  4HCC A;  1Z26 A;  2P9L B;  3THW B;  3PX6 A;  1MWM A;  4FJK A;  4DTP A;  1P90 A;  4CES A;  4PWD A;  5CYQ A;  3G25 A;  2P1J A;  5KRS A;  2HHX A;  4FJH A;  2F8T A;  5IT9 O;  4EFH A;  1VQM N;  3AO4 A;  1YVU A;  3SJJ A;  2O8E B;  1Q82 O;  4J2B A;  4FWM A;  5BPM A;  2HVI A;  1NGJ A;  3ZSX A;  3VGL A;  4C1N K;  3KKR A;  2OYQ A;  1LCU A;  4I7F A;  1RT4 A;  4IOA L;  4PKI A;  2G8V A;  1XNQ K;  3MN9 A;  1YTA A;  3LAL A;  4YDU C;  5JLH A;  5LMN K;  3NH1 A;  2WUS A;  4H4O A;  3SAF A;  4WFA L;  1WBD A;  3OYF A;  4CEB A;  4DTS A;  5C2F A;  4BQL A;  3F9M A;  2G8U A;  3D6R A;  3SMP A;  3LP1 A;  3DWL A;  1CZA N;  5AQO A;  5I3U A;  5AQH A;  3AVI A;  4G1Q A;  1W7A A;  3CJC A;  3TR8 A;  4OPK A;  3CJ1 A;  4K41 A;  2BUP A;  4JK8 A;  4JKF A;  3WT0 A;  2NRZ A;  1NM1 A;  3H6E A;  2Q36 A;  1HNI A;  1RCH A;  2EHG A;  5KPR A;  4FM0 A;  3SUN A;  3BGR A;  1TGO A;  3KKS A;  3K0S A;  2Q2R A;  3RMB A;  4HCB A;  3OYK A;  5E84 A;  4NLB A;  2KLA A;  1ZC6 A;  3LZI A;  1NGC A;  2QM1 A;  5AQJ A;  1VRT A;  4CF0 A;  5AQN A;  3KD1 E;  1BI4 A;  3MED A;  4IBN A;  1IBM K;  2DFE A;  2BAN A;  5C12 A;  4RCH A;  3CCQ N;  3FZK A;  1M1K O;  3SUQ A;  3VEN A;  4N41 A;  2YNI A;  1EO1 A;  3CFO A;  2V7Z A;  1KCF A;  4O55 A;  3ZSZ A;  4NYF A;  2KZM A;  4FOE A;  2QXF A;  3HXM A;  1GLJ O;  3AA4 A;  3T1A A;  1V4T A;  2NRT A;  3DJC A;  2W40 A;  3ZET A;  4CEO A;  3OJU A;  3NF6 A;  4CJR A;  5AZJ A;  2UYT A;  4PKG A;  4AQY K;  3UB5 A;  1WBB A;  4NCG A;  5C25 A;  5ELZ A;  2I5J A;  4KI4 A;  4BRO A;  1CLQ A;  3IS9 A;  3NVK A;  2HW3 A;  4Z4E A;  2VG6 A;  2D0B A;  1E4F T;  1SV5 A;  4FWP A;  4H5V A;  1KFD A;  1HJO A;  2HBL A;  4I6M B;  4RW6 A;  5GAG P;  3WUH A;  2V51 B;  1RTI A;  1XQS C;  1GOC A;  3W0L A;  3PX0 A;  3U8X A;  2YKN A;  5KPT A;  1NJW A;  2OTL N;  4BRI A;  2A3Z A;  4CHO A;  4OGC A;  4K0K K;  4ISG A;  1XC3 A;  3WNF A;  1BIZ A;  4E7H A;  2ZJP L;  5ADX H;  2Z1H A;  4EAH D;  2HF3 A;  3R8E A;  3CF5 L;  2GTD A;  3T3F A;  3PLA A;  1RT5 A;  2Z1I A;  1C1A A;  3ZSQ A;  2XO7 A;  3H46 O;  4FJL A;  1N5Y A;  4CF2 A;  4IZ9 A;  2QA4 N;  2XY8 A;  3CCL N;  1BIS A;  3T19 A;  4DS5 A;  4ELV A;  1VSK A;  4BY9 C;  3LWL A;  3DXK B;  1QVG M;  4JI6 K;  3FE1 A;  5LJW A;  2BE2 A;  3RTV A;  4LFB K;  1S1T A;  3OW2 M;  4LF7 K;  4DQI A;  4JI2 K;  4I9Q A;  2P9S B;  3VF6 A;  3LAM A;  1T8E A;  4BRP A;  1U2V A;  3PIP L;  4XEI A;  4FJ9 A;  1S1U A;  1NKE A;  3RVC A;  4F2R A;  3K5M A;  3AVF A;  1RBT A;  4FLY A;  3C94 A;  4DB3 A;  1U6Z A;  5BRE A;  3DOK A;  4BC2 A;  1N33 K;  1JCF A;  4OO1 J;  1QQC A;  4LH5 A;  4DWI A;  2D0O A;  1KXP A;  1IO2 A;  4C23 A;  4BR7 A;  3QEW A;  3WNH A;  3CQX A;  4IO9 L;  1LV5 A;  4MLH A;  4WQ4 C;  3H3O B;  4Q5V A;  1G99 A;  4NO7 A;  3TSQ A;  4IEE A;  2XRI A;  1GLB G;  4FJI A;  2FSJ A;  1OKJ A;  4EZ9 A;  3ZX0 A;  4LSL A;  3IKM A;  4CHN A;  1VSL A;  1JLG A;  2KTQ A;  4DR6 K;  2FBT A;  2NRW A;  4BRG A;  3LDN A;  2VG5 A;  1EET A;  3O3H A;  5BN9 A;  4CZK A;  4ICL A;  2O8F A;  2NLX A;  4EHT A;  3V81 A;  2QKK A;  3JAM O;  2PBD A;  3EE9 A;  3L2W A;  4JKH A;  3IG1 A;  4DUY K;  4DHY A;  4E89 A;  1WB9 A;  4DTO A;  1NKC A;  4CZI A;  3CD6 N;  3O80 A;  4O5F A;  2GUP A;  2UXC K;  3OBY A;  3VQP A;  3S3M A;  4DTJ A;  4MO4 A;  1SL1 A;  4H5W A;  4CJK A;  2D0C A;  5JS2 A;  2OAN A;  1XMQ K;  1EX4 A;  3CJ7 A;  1BUP A;  3VF4 A;  4B3O A;  4JKC A;  3D2E A;  1TYQ A;  3SQ4 A;  3AVL A;  2DFH A;  3CQ8 A;  2GWJ A;  2A5X A;  4JN4 A;  3VQD A;  3THY A;  5DMR A;  4U7B A;  5HRN A;  4JD2 A;  4H4M A;  4CI6 A;  2WC9 A;  1TK0 A;  3WXJ A;  1YJN N;  2I7P A;  2CGL A;  4RW4 A;  5CZ2 A;  3ZYY X;  4H03 B;  4FVU A;  4QAG A;  2HNZ A;  4BR4 A;  4JKA A;  3DLK A;  1BO5 O;  3FZL A;  4CJQ A;  2HOE A;  4WQ5 C;  3EL2 A;  1T7P A;  3S3O A;  2OPR A;  3TTF A;  5BR9 A;  4Z4C A;  1JL2 A;  1VQ6 N;  2V7Y A;  4BE2 A;  4CF8 A;  3EY1 A;  1J6Z A;  1VHX A;  3ID8 A;  3B6O A;  2KFZ A;  1WAJ A;  4DQR A;  2VWK A;  3ZSO A;  4CJ3 A;  2KKZ A;  1NOY A;  3OS0 A;  1ZBU A;  4FSV A;  1JLE A;  2FC0 A;  4FVM A;  1IG9 A;  4NCA A;  4YY3 K;  3J7Z O;  1T05 A;  1ASU A;  1ASW A;  3I8B A;  1RBR A;  4ID5 A;  3FFK B;  4CGI A;  3LP3 A;  4GKJ K;  1IBK K;  3B8A X;  4GV6 A;  1DGK N;  3H08 A;  4W5Q A;  3AVA A;  3T7Z A;  1HQU A;  4WYB A;  1QQM A;  3DRR A;  3CC2 N;  1NNE A;  1VRU A;  2F7T A;  4LF6 K;  1Q8I A;  3C0B A;  4CCH A;  4CZG A;  2ITM A;  5TKW A;  1QZ6 A;  4DKW A;  4BQZ A;  3C6A A;  2FF3 B;  3L3V A;  5EY4 A;  4E3S A;  2YV0 X;  1U04 A;  4YOR A;  5J2P A;  3C7N A;  2JWL A;  1RT3 A;  1RBV A;  3CC4 N;  1X9J A;  4V19 S;  1TUU A;  1S1X A;  3K5O A;  3ATU A;  5EXW A;  1HYZ A;  4DSF A;  3BZK A;  4JKG B;  4CBU A;  1YIJ N;  2IVN A;  3S3N A;  1D4X A;  3HI0 A;  5EX5 A;  1JLA A;  1K73 O;  3CCU N;  3WEE A;  1B92 A;  3OYE A;  4CFB A;  3E9O A;  4XH5 A;  4RW8 A;  2HHU A;  3VEX A;  3DM2 A;  4OJR A;  4BGA A;  3WQT A;  3RSE B;  2IS3 A;  4E1N A;  4DR3 K;  4FYD A;  4AHR A;  3M8Q A;  1IKX A;  4Z4I A;  3O9Q A;  4KH4 A;  4DLG A;  5JLF A;  4CJW A;  3AA2 A;  2YHW A;  3DLG A;  4CK3 A;  4AHT A;  3P31 A;  4JNE A;  2Z1G A;  5AQK A;  5A2Q O;  4ELT A;  3SK3 A;  5GIP A;  1BCO A;  4CEQ A;  4CVN E;  4M41 A;  3U3Y A;  4N47 A;  5FPM A;  4A59 A;  3BDP A;  3VA0 A;  4BC4 A;  5D3G A;  3C95 A;  2GX9 A;  2P9P A;  4BRA A;  3J7A P;  4LH4 A;  3L3U A;  4DMN A;  2VG7 A;  4B3T K;  3ZT4 A;  2G8W A;  4IDH A;  2ZF5 O;  3E66 A;  4BE0 A;  4H5R A;  3AVB A;  2GUI A;  3QNO A;  2E88 A;  4AM7 A;  1ZYQ A;  2NUB A;  4FW2 A;  4B1Y B;  4FCY A;  3QEX A;  3FZM A;  4BRN A;  2OTJ N;  5KQD A;  3O1W A;  3TAQ A;  4CW7 B;  3QBX A;  1VQN N;  1RFQ A;  3AO2 A;  3C6U A;  5DK5 A;  3NGI A;  3TAF A;  2P9I A;  3MCP A;  4OPA A;  3RRH A;  1WUA A;  3O6W A;  2O8C B;  2P9N A;  4HHT A;  3SPY A;  3LP2 A;  1QVF M;  2QEX N;  3PSI A;  4GW6 A;  4EP4 A;  1GLE G;  3ATV A;  4AIL C;  5E41 A;  3RR8 A;  1HRH A;  4LSN A;  3MN5 A;  3MEE A;  4CJ5 A;  1XUP O;  4BC5 A;  4BR2 A;  1N8R O;  4DQP A;  3Q7C A;  5J2Q A;  4CZE A;  2GBZ A;  4YOV A;  2NNW A;  1B9F A;  4DR4 K;  4GVM A;  4DV1 K;  3OYN A;  2NRR A;  1YF5 L;  1IV0 A;  1DKG D;  2D5R A;  3GG4 A;  3KVG A;  4KTW A;  4OKE A;  4KTQ A;  2XY7 A;  4FJ8 A;  3MK6 A;  3H1V X;  5HRP A;  2E2P A;  1A5X A;  4JS5 A;  5CHI A;  4CD1 A;  4DR5 K;  3F2K A;  1HYS A;  3V1O A;  1K6Y A;  2VWB A;  3AVH A;  3SQ0 A;  1BI4 B;  4H0T B;  1MU2 A;  2FXU A;  4CHQ A;  4A5B A;  3MN6 A;  4PUO A;  1NLV A;  3KHY A;  4JKD A;  3TSP A;  3CCS N;  4KHN A;  2P5O A;  2KHO A;  3QIC A;  5J2N A;  3VQ4 A;  4KHS A;  2A1R A;  2BTF A;  4KHW A;  4IOC L;  3SUP A;  1NK5 A;  5C10 A;  3ZET B;  1HNX K;  5AZJ B;  4IEI A;  3L0Q A;  3HRG A;  3VEY A;  3JYT A;  3D0P A;  4CD3 A;  4FL9 A;  3WXK A;  3SMS A;  1Q81 O;  1ZBI A;  1HPZ A;  1ZBH A;  4DQS A;  1U4B A;  3AAP A;  1RDB A;  1QSL A;  1NGI A;  3O4N A;  4CEF A;  1VQK N;  2HBJ A;  4DU3 A;  2E2O A;  1WSJ A;  1NGF A;  4O5B A;  5IWA K;  1YTU A;  4JYA K;  4DR1 K;  1FJG K;  3A2F A;  3VA3 A;  4DSL A;  1KAX A;  3QNN A;  1UOC A;  4E7I A;  5C15 A;  4FK0 A;  2A41 A;  4CEA A;  4CFA A;  2Q97 A;  1SQK A;  1Q9X A;  2HMI A;  4X66 K;  1ATS A;  3OYD A;  1HLU A;  3MDQ A;  4QCL A;  3V1Q A;  1S72 N;  2YCH A;  3AO5 A;  5AQP A;  3J8A A;  3O3G A;  1UWB A;  4F2S A;  2GEM A;  3DXM B;  3PO5 A;  3EN9 A;  4DFJ A;  3F73 A;  4C8L A;  2QWP A;  2B4J A;  2QWM A;  1C0U A;  4FWN A;  4YOY A;  4M7Y A;  3AGR A;  2F9T A;  3L4Q A;  3AA5 X;  4NB4 A;  4IO8 A;  3KD5 E;  2G8I A;  4BR0 A;  1NG9 A;  2XY6 A;  3VQ9 A;  5FRM A;  4KRE A;  1VSM A;  3OS1 A;  3VER A;  2FLO A;  3H3N O;  4FJM A;  2OPP A;  4H0O A;  3O08 A;  4R79 A;  1HJR A;  3CI5 A;  2F4V K;  1ATR A;  4FW1 A;  5K14 A;  1U2V B;  4HUE A;  3MX2 A;  1J5E K;  4BRH A;  2HF4 A;  1XNR K;  1N6Q A;  3H45 C;  4B1X B;  5GAE P;  4CJV A;  3K57 A;  1C1C A;  3K5L A;  2UUC K;  2HBM A;  1TKX A;  4X65 K;  3SAH A;  3L2V A;  5F1X A;  1KLN A;  1WSG A;  4CFC A;  2F8S A;  3ZX3 A;  2EX3 A;  4PQU A;  5KGX A;  1KC8 O;  3D45 A;  3OYL A;  3VQ5 A;  4J2A A;  3DRS A;  1U48 A;  3PIO L;  3LPU A;  1SAZ A;  1HYV A;  2KFN A;  3SYZ A;  3QEP A;  4CZM A;  1WAF A;  5AZI A;  3VQ7 A;  1DLO A;  4FO0 A;  3WXL A;  3O3F A;  4DQ8 A;  4E7K A;  4ELU A;  4FJ7 A;  4H0Y B;  5FRO A;  3QO9 A;  5AR0 A;  5FLX O;  4DLE A;  3P38 A;  4CE9 A;  3ULE B;  1Q18 A;  2E1Z A;  2ASM A;  3UKU A;  4E7J A;  2QWL A;  3O1B A;  4FLV A;  3KWI A;  4KPY A;  3TAE A;  2O8F B;  2NRV A;  3HYF A;  1U45 A;  1VQ7 N;  4B1W B;  1NMD A;  4QS8 A;  1C0G A;  2FSN A;  4QOZ B;  1REV A;  3K9K A;  1W2B M;  1QS4 A;  4FZX C;  3C6T A;  1OVQ A;  2IAJ A;  3I8D A;  2DFF A;  3VMF B;  1SS6 A;  2ITG A;  3ZT0 A;  3SZ2 A;  3TU5 A;  2NRX A;  4BWM A;  2ZWH A;  3FFI A;  2IVP A;  1ZBL A;  3CCM N;  2O4G A;  4LY7 A;  1QQN A;  1RIL A;  3D2E B;  4J2D A;  3HVT A;  4HWI A;  1TYQ B;  1A5W A;  4JKB A;  1HNV A;  4LF9 K;  3HVR A;  2YHB A;  4YOW A;  3QFU A;  3THY B;  3OYA A;  4JD2 B;  1SKW A;  4ISE A;  2ASO A;  1HUX A;  4JK7 A;  4E1M A;  1HR0 K;  4M3R A;  3LM2 A;  5I9E B;  3PUF A;  2YNH A;  1VAZ A;  4RW7 A;  4YFU A;  4MO5 A;  2JWK A;  3MN7 A;  4CBW A;  4W5R A;  2NZT A;  1L3S A;  2J4R A;  1NGH A;  1L3U A;  4CK2 A;  4B9V A;  3K2P A;  5HP1 A;  2QK9 A;  1O1W A;  4DUZ K;  3OTO K;  4FJN A;  3HTV A;  3VEW A;  1K8K A;  3VQE A;  3L4I A;  1NJI O;  4JI3 K;  4B3R K;  2HHH K;  4F8R A;  3K58 A;  2HVH A;  3VET A;  1RDW X;  3V9X A;  4KBO A;  3PY8 A;  4KFB A;  4CZF A;  1F21 A;  1Y64 A;  1OH8 A;  2D4W A;  4OKK A;  3SQ2 A;  1EP4 A;  4FLT A;  1G15 A;  1R59 O;  3FLC O;  3MXJ A;  1T3V A;  4BDZ A;  4KKO A;  3CCE N;  1V4S A;  1KQS M;  2HHS A;  4AHS A;  3V4I A;  5JVH L;  2UUB K;  1Z05 A;  2GV9 A;  5HRO A;  3HPH A;  4UQG A;  1CXU A;  2HB5 A;  1XHX A;  3M8P A;  1YVN A;  1NJY A;  1S1V A;  3AAQ A;  4B1U B;  2YI1 A;  5AQG A;  4B8A B;  4CZL A;  1P8Z A;  1XMO K;  5AQS A;  4IFY A;  2Z1J A;  2F96 A;  3GDQ A;  1NBW A;  3OY9 A;  1KSP A;  1KLM A;  3G6E N;  4W5N A;  1TKT A;  4H0X B;  4AM6 A;  3SQ1 A;  3C7N B;  2HHQ A;  1L3T A;  5TKY A;  4HVJ A;  3TI0 A;  3VGK A;  1XHZ A;  3E9L A;  3N4P A;  4Q0B A;  2QWQ A;  4GVE A;  4JHD A;  4MFB A;  4EHU A;  4E0D A;  1W97 L;  2X78 A;  1E3M A;  1S5J A;  3UKR A;  4JS4 A;  4N56 A;  1HNW K;  5BRF A;  1IKV A;  5FPD A;  4DSE A;  2RF2 A;  4FJX A;  2WOM A;  3KZB A;  1SKS A;  3MCA B;  2YHY A;  2YJF A;  3WEE B;  3OYI A;  3DLL L;  3NF7 A;  1NK9 A;  1KTQ A;  3U4L A;  4N76 A;  4AHU A;  5F0X A;  5KTQ A;  3HP6 A;  3QER A;  1DTQ A;  3PO4 A;  3AVM A;  2FSK A;  4KH5 A;  4FJJ A;  2BDP A;  5AQZ A;  4BGB A;  5T7B A;  3DLE A;  3S9H A;  2QW9 A;  4OVL A;  2D0P A;  1YIT N;  5GAD P;  1VQ4 N;  1WOQ A;  2P9U A;  4F9O A;  2Q1N A;  1UA1 A;  1C1B A;  4WE1 A;  2PAV A;  3WNG A;  3OYC A;  4CJF A;  2UU9 K;  3OYM A;  1KVC A;  3CCJ N;  2DPN A;  3WXI A;  1EXQ A;  4CJL A;  2BGG A;  3HO1 A;  4QS9 A;  3M8R A;  1X3N A;  2IIR A;  3TPQ A;  4CGH A;  3OYH A;  5HBM A;  1NGD A;  4CGF A;  4IFE A;  3AY9 A;  3DOL A;  3L2Q A;  5CR4 A;  5I42 A;  1BQM A;  4KI6 A;  3D2F A;  5AQW A;  2I7N A;  1S22 A;  4F3O A;  2HBK A;  1YT3 A;  2WTU A;  5AFU H;  2P9I B;  1S9G A;  4RG8 A;  4BR5 A;  4PL8 A;  3M8S A;  3M6G A;  1K8A O;  1YUW A;  4BRQ A;  3CC7 N;  4KHU A;  3OBW A;  1RTD A;  1Y97 A;  1KD1 O;  3GE1 A;  1JJ2 M;  3DXK A;  4KHP K;  1D5A A;  4E1J A;  4LF4 K;  4X62 K;  3G0Z A;  1RT1 A;  1RDC A;  3T1H K;  3QET A;  1T6D A;  5AFU A;  5AQM A;  1X9M A;  1FKO A;  4NCB A;  1S6Q A;  5F2R A;  3WQU A;  3SAG A;  2QXL A;  5KRT A;  1VK0 A;  1QZ5 A;  3FZH A;  3LDL A;  2KW4 A;  4M3T A;  1J5O A;  1BDG A;  3AVG A;  4O8U A;  4DV2 K;  3CCV N;  4X64 K;  1ZBS A;  2D0A A;  3RMA A;  2O8B A;  1IKY A;  3BUZ B;  4U67 L;  4K25 A;  2PZS A;  1N34 K;  3CM6 A;  2WON A;  4FLW A;  2P9K A;  3CQY A;  1SL2 A;  4DTM A;  4A62 A;  1MWK A;  4ILJ A;  5SZT A;  4K43 A;  3V9S A;  2AA4 A;  4DFP A;  3EKS A;  4B9M A;  3O8M A;  4B3S K;  5H1S Q;  2R7Y A;  3HT3 A;  4C8O A;  3BP8 A;  1Z25 A;  4NYN A;  3IRX A;  3VQ8 A;  4BRE A;  4M3U A;  4O0J A;  2E8A A;  3CFR A;  3P4I A;  3J80 O;  4WQ4 A;  2VQE K;  1YHQ N;  1JLC A;  2E2Q A;  3LL3 A;  5HRS A;  3JSM A;  1YXQ A;  1ASV A;  1J54 A;  1XC9 A;  3V9Z A;  5CZ1 A;  4BRC A;  4H8K A;  3G4S N;  3CFP A;  4C1N I;  5SWM A;  1LWF A;  4XH4 A;  5M1P A;  2IC3 A;  4FJ5 A;  3M5R A;  5AJ3 K;  1C0T A;  4FK2 A;  2G8K A;  3G10 A;  3NFA A;  5GIN A;  1A5V A;  3I0R A;  1NJX A;  4CEC A;  4CJ7 A;  3QDK A;  3K9J A;  3IFR A;  1WSF A;  2KZZ A;  5FPN A;  2YNG A;  4M3W A;  3Q7B A;  3CXC M;  3QIP A;  2O8D A;  2PY5 A;  2HNY A;  3VEO A;  5KPZ A;  1EWR A;  1RDA A;  4A57 A;  3DMJ A;  3I33 A; 
#chains in the Genus database with same CATH homology
 1BIZ A;  3V1Q A;  4E7H A;  3KK3 A;  4ZTF A;  3AO5 A;  4KAZ A;  2Z1H A;  3O3G A;  1UWB A;  3ZCM A;  4F2S A;  3AA3 A;  4CJ4 A;  3T3F A;  3PO5 A;  1UAX A;  1RT5 A;  2Z1I A;  3F73 A;  1C1A A;  3ZSQ A;  4CEZ A;  4I2P A;  2XO7 A;  1TV6 A;  4DFJ A;  2OA8 A;  4C8L A;  1RT6 A;  2B4J A;  1HQE A;  1C0U A;  2HND A;  4CF2 A;  1N5Y A;  1LWE A;  1SUQ A;  1D9F A;  4DSI A;  4M3X A;  3OYB A;  3KLI A;  3MEC A;  1RT7 A;  2XY8 A;  3AA5 X;  1BIS A;  3T19 A;  4DS5 A;  4CIE A;  1UA0 A;  2PYJ A;  3KD5 E;  2XY6 A;  4ELV A;  1RTJ A;  1VSK A;  3VQ9 A;  5FRM A;  4JLH A;  4Z4F A;  4KRE A;  1VSM A;  3OS1 A;  4CED A;  4Z4H A;  3LWL A;  4FJM A;  3SNN A;  2OPP A;  4C8N A;  3TAM A;  3RRG A;  3U3G A;  2XHB A;  4JRQ A;  1ZBH A;  1HJR A;  3TWH A;  3KK1 A;  4Z0U A;  1LW2 A;  2BE2 A;  4OLB A;  4FW1 A;  5K14 A;  2DY4 A;  3NGZ A;  3RTV A;  1S1T A;  4HUE A;  3TAP A;  4DQI A;  4I9Q A;  5KGW A;  3LAM A;  3V9U A;  3OS2 A;  5EU7 A;  1RT2 A;  3ZT3 A;  1T8E A;  3QIO A;  1N6Q A;  3NE6 A;  4FJ9 A;  3NDK A;  1VSH A;  1S1U A;  4CGD A;  4CJV A;  3MAQ A;  2OPQ A;  3HM9 A;  3K57 A;  1C1C A;  4FM1 A;  3K5L A;  1NKE A;  3NGY A;  1TKX A;  4F2R A;  3DMJ A;  3K5M A;  3CYM A;  3AVF A;  3B6P A;  2IOC A;  4C8K A;  1RBT A;  3L2V A;  4O4G A;  2B6A A;  4FLY A;  1KLN A;  3C94 A;  1WSG A;  3VQ6 A;  4CFC A;  2F8S A;  4FXD A;  2EX3 A;  4PQU A;  5KGX A;  3DOK A;  4XIU A;  3D45 A;  3EYZ A;  1QQC A;  4LH5 A;  4CJU A;  4N5S A;  3OYL A;  3V6D A;  4DWI A;  3VQ5 A;  4J2A A;  3DRS A;  1U48 A;  3U6F A;  1IO2 A;  5J1E A;  2G8F A;  4IFV A;  4EZ6 A;  3QEW A;  3WNH A;  2YKM A;  3LPU A;  1HYV A;  2KFN A;  3SYZ A;  1LV5 A;  2JGU A;  4Q5V A;  3QEP A;  3AVK A;  1WAF A;  3KTQ A;  3SI6 A;  3VQ7 A;  2XRI A;  4DF4 A;  4EP5 A;  4FM2 A;  1DLO A;  3ULD A;  4KRF A;  1GOB A;  4W5T A;  3O3F A;  4E7K A;  4FJI A;  4KB1 A;  4YNQ A;  1QSY A;  4ELU A;  4FJ7 A;  4M3Y A;  3QEI A;  2YNF A;  1BCM A;  3VQA A;  5FRO A;  5CYM A;  3QO9 A;  3KLH A;  3HST B;  1TKZ A;  4DLE A;  4DTX A;  1KFS A;  4EZ9 A;  4CE9 A;  4LSL A;  4M45 A;  4F4K A;  4CHN A;  4E7J A;  1VSL A;  1JLG A;  2KTQ A;  4DFM A;  3TAN A;  4FLV A;  2FBT A;  2P51 A;  1GOA A;  3SPZ A;  4KPY A;  3RWU A;  1JKH A;  3TAR A;  3TAE A;  1U49 A;  4AHC A;  3HYF A;  4FJL A;  4F3T A;  2VG5 A;  1U45 A;  1BIU A;  1QE1 A;  1EET A;  5HRR A;  3AV9 A;  3O3H A;  1QSS A;  3ZSR A;  4ID1 A;  5C24 A;  1REV A;  2P5G A;  4QOZ B;  4ICL A;  4Y1C A;  1QS4 A;  1T03 A;  2RKI A;  4FZX C;  3C6T A;  3V81 A;  2IAJ A;  3THV A;  2QKK A;  2FBV A;  2DFF A;  3ISN C;  3I8D A;  4W5O A;  3L2W A;  4DTU A;  1TK8 A;  3AVN A;  3IG1 A;  4DF8 A;  3RR7 A;  3V1R A;  4E89 A;  2ITG A;  4UQG A;  1LWC A;  3ZT0 A;  4DTR A;  1RBU A;  4DTO A;  1NKC A;  3SZ2 A;  3QEV A;  4B9N A;  4RW9 A;  4BWM A;  3RMD A;  3FFI A;  1ZBL A;  1CXQ A;  2O4G A;  4LY7 A;  3VQP A;  4DTJ A;  3S3M A;  1SL1 A;  1RIL A;  4CJK A;  2D0C A;  5JS2 A;  3HPO A;  4CJP A;  3HVT A;  4J2D A;  3DRP A;  1U47 A;  2XY5 A;  4L8R B;  3E01 A;  1A5W A;  5FRN A;  2A1S A;  1HNV A;  4FLZ A;  1EX4 A;  3HVR A;  4IG3 A;  2YHB A;  4B3O A;  3K5N A;  3PV8 A;  2Q3S A;  3SQ4 A;  3AVL A;  1CZB A;  4Z4G A;  3OYA A;  2DFH A;  3P1G A;  4DS4 A;  1JLF A;  3CQ8 A;  1SKW A;  3NHG A;  3NH0 A;  2FBY A;  3VQD A;  1RTH A;  5DMR A;  4E1M A;  1JLB A;  4M3R A;  5HRN A;  4H4M A;  1QTM A;  1FKP A;  3PUF A;  3HJF A;  1TAU A;  1TK0 A;  2YNH A;  4RW7 A;  2ZE2 A;  4RW4 A;  4YFU A;  5CZ2 A;  4FJG A;  1XI1 A;  2ZD1 A;  4QAG A;  2HNZ A;  3KLG A;  1EKE A;  4W5R A;  3DLK A;  1L3S A;  4CJQ A;  1L3U A;  4CK2 A;  3LDS A;  4B9V A;  1XWL A;  3K2P A;  5HP1 A;  4CK1 A;  2ZQB A;  4CGJ A;  1O1W A;  4CJT A;  4CJS A;  2OZM A;  2QK9 A;  3ZSV A;  4CF9 A;  3MXI A;  4FJN A;  1T7P A;  3S3O A;  3VQE A;  2OPR A;  1FK9 A;  1C6V A;  4F8R A;  2LSN A;  5J2M A;  4FZY A;  4Z4C A;  3NCI A;  3K58 A;  3ASM A;  2HVH A;  1JL2 A;  3V9X A;  3PY8 A;  2X6S A;  4KFB A;  1F21 A;  3L8B A;  3ZSY A;  2Y1J A;  4OKK A;  4KTZ A;  4BE2 A;  3HPG A;  4CF8 A;  3EY1 A;  3SQ2 A;  3VQQ A;  1LW0 A;  3B6O A;  1EP4 A;  2Y1I A;  3DLR A;  2KFZ A;  1WAJ A;  1W0H A;  2VWK A;  4C8M A;  4FLT A;  4DQR A;  1G15 A;  3ZSO A;  4DSK A;  4CJ3 A;  3OYG A;  1NOY A;  4DSJ A;  3LPT A;  4E7L A;  3MXJ A;  3OS0 A;  1W9H A;  3SV4 A;  2AJQ A;  2RN2 A;  3LAK A;  4DTN A;  4BDZ A;  3I0S A;  1ZBU A;  5KI6 A;  4CIG A;  4FLU A;  4KKO A;  1WSI A;  1JLE A;  2FC0 A;  4E19 A;  4FVM A;  1IG9 A;  2HHS A;  4NCA A;  4AHS A;  3V4I A;  3HK2 A;  2GV9 A;  4B8C A;  5HRO A;  3HPH A;  1IKW A;  1T05 A;  1ASU A;  1WSH A;  1ASW A;  1CXU A;  1CZ9 A;  1JL1 A;  1RBR A;  1WN7 A;  1IH7 A;  4ID5 A;  4CGI A;  2HB5 A;  3LP3 A;  3ZT1 A;  1SL0 A;  1XHX A;  3M8P A;  3H08 A;  4W5Q A;  3AVA A;  2G8H A;  1NJY A;  4M42 A;  1S1V A;  4B9T A;  3L2R A;  1HQU A;  1NK4 A;  1NK8 A;  4IKF A;  4B8A B;  1TL1 A;  3UIQ A;  3DRR A;  4IFY A;  2Z1J A;  2F96 A;  4FK4 A;  1VRU A;  4CJE A;  3CG7 A;  1L3V A;  3OY9 A;  1Q8I A;  1VSI A;  4CCH A;  1FXX A;  1TL3 A;  1KLM A;  1KSP A;  1VSD A;  4BAC A;  4W5N A;  3DYA A;  5CY4 A;  1TKT A;  3NF8 A;  2OPS A;  3LP0 A;  4PA1 A;  3SQ1 A;  3AO3 A;  4DFK A;  3QES A;  3SCX A;  2HHQ A;  3NH2 A;  4CHZ A;  1L3T A;  4HVJ A;  4CGG A;  3TI0 A;  3L3V A;  4E3S A;  2YV0 X;  1U04 A;  1XHZ A;  4Q0B A;  4K8X A;  2W42 A;  3RMC A;  4MFB A;  4E0D A;  4TSX A;  5JS1 A;  1NOZ A;  5J2P A;  2X78 A;  2HHW A;  1NK6 A;  1RT3 A;  4LD0 A;  1RDD A;  3DLH A;  1RBV A;  1JXB A;  1S5J A;  3KIO A;  4JS4 A;  4N56 A;  3NAE A;  1BGX T;  4HUG A;  1LAW A;  1QHT A;  1VSE A;  2E6M A;  1ITG A;  4CHP A;  1IKV A;  3QLH A;  1L5U A;  3KJV A;  5HLF A;  1S1X A;  2E4L A;  3K5O A;  4DSE A;  2RF2 A;  3P5J A;  4B08 A;  4IG0 A;  4FJX A;  2WOM A;  4KO0 A;  1SKS A;  1HYZ A;  2B5J A;  4DSF A;  2IGI A;  2VWJ A;  1KVB A;  3OYI A;  3LWM A;  3NF7 A;  1NK9 A;  1KTQ A;  1R0A A;  4O44 A;  3KK2 A;  3S3N A;  4KHQ A;  4N76 A;  1S1W A;  4AHU A;  2DTU A;  1NK0 A;  1X1P A;  1JLA A;  4AH9 A;  4FZZ A;  1U4B A;  5KTQ A;  1X9S A;  1B92 A;  3OYE A;  4CFB A;  3HP6 A;  4DQQ A;  3QER A;  1DTT A;  1DTQ A;  3NF9 A;  4RW8 A;  4DU1 A;  4KHY A;  2HHU A;  4MQ3 A;  2RPI A;  3DM2 A;  4OJR A;  1HMV A;  3AVJ A;  2IDO A;  3PO4 A;  2IS3 A;  4E1N A;  4Y1D A;  4J2E A;  3AVM A;  4FYD A;  4AHR A;  1BHL A;  3F9K A;  3M8Q A;  1J53 A;  2HHT A;  1IKX A;  2PYL A;  4FJJ A;  4Z4I A;  4AHV A;  2ATQ A;  3HL8 A;  4BDY A;  4DU4 A;  2BDP A;  4DLG A;  3ALY A;  3LAN A;  5C42 A;  4CJW A;  2X74 A;  5T7B A;  3AA2 A;  4HUF A;  4CIF A;  2YHA A;  3DLG A;  1SKR A;  3DLE A;  3S9H A;  4CK3 A;  1Q9Y A;  4OVL A;  3V9W A;  2FBX A;  4M3Z A;  4AHT A;  1WLJ A;  3MEG A;  1TKD A;  4K8Z A;  2Z1G A;  1I3A A;  4ELT A;  3IAY A;  3PX4 A;  1UA1 A;  1TVR A;  1VSF A;  1RBS A;  3ZT2 A;  3AO1 A;  1C1B A;  4GMJ B;  1KRP A;  4B9U A;  1BCO A;  1NJZ A;  4CEQ A;  4WE1 A;  1X9W A;  2HHV A;  3K59 A;  3WNG A;  3OYC A;  4M41 A;  4CJF A;  3U3Y A;  4HCC A;  4N47 A;  3OYM A;  1KVC A;  3BDP A;  1Z26 A;  3VA0 A;  5D3G A;  3PX6 A;  3C95 A;  1EXQ A;  4CJL A;  3MXM A;  4FJK A;  4DTP A;  2BGG A;  4LH4 A;  4CES A;  4PWD A;  5CYQ A;  3L3U A;  3M8R A;  3HO1 A;  3O4Q A;  2P1J A;  5KRS A;  4DMN A;  2VG7 A;  4CGH A;  3OYH A;  5HBM A;  3L2U A;  2HHX A;  4KHW A;  4CGF A;  4FJH A;  2F8T A;  4OLA A;  3VQB A;  3ZT4 A;  2G8W A;  3DOL A;  3L2Q A;  5I42 A;  3AO4 A;  1YVU A;  3SJJ A;  4KB0 A;  2G8I A;  1BQM A;  4KI6 A;  4BE0 A;  3TAB A;  4R5P A;  4J2B A;  3AVB A;  2HVI A;  3WNE A;  3ZSX A;  3NBP A;  2GUI A;  3QNO A;  1ZYQ A;  2NUB A;  3KKR A;  4F3O A;  4FW2 A;  2OYQ A;  1YT3 A;  4IDK A;  4BWJ A;  4OPJ A;  1TAQ A;  4FCY A;  3QEX A;  1JXE A;  4I7F A;  1C0M A;  1RT4 A;  1S9G A;  3TAQ A;  3LZJ A;  4RG8 A;  4CF1 A;  1JLQ A;  3SV3 A;  2G8V A;  3AO2 A;  3M8S A;  3C6U A;  3DLB A;  1YTA A;  3LAL A;  5DK5 A;  3NGI A;  3TAF A;  4CER A;  4KHU A;  3NH1 A;  4CFD A;  3RRH A;  1RTD A;  1Y97 A;  4H4O A;  1KVA A;  3ITH A;  4HHT A;  3SPY A;  3LP2 A;  3OYF A;  1D5A A;  4CEB A;  4DTS A;  3G0Z A;  1RT1 A;  1RDC A;  4GW6 A;  3QET A;  4EP4 A;  3VQC A;  4AIL C;  2G8U A;  5E41 A;  1NKB A;  1X9M A;  3OJS A;  1FKO A;  3RR8 A;  1HRH A;  3LP1 A;  4NCB A;  1S6Q A;  4LSN A;  3MEE A;  5I3U A;  4CJ5 A;  3AVI A;  1BL3 A;  4G1Q A;  2O4I A;  1B9D A;  4DQP A;  5J2Q A;  5KRT A;  1VK0 A;  3TR8 A;  4OPK A;  2KW4 A;  3ZSW A;  4CHY A;  2GBZ A;  1J5O A;  4M3T A;  3AVG A;  3SUO A;  1B9F A;  1RNH A;  4GVM A;  2D0A A;  4CEE A;  3OYN A;  3RMA A;  2D5R A;  4KTQ A;  4OKE A;  4KTW A;  4FJ8 A;  4O0I A;  2XY7 A;  2JLE A;  5HRP A;  1HNI A;  1RCH A;  2EHG A;  4FM0 A;  1A5X A;  4JS5 A;  3SUN A;  3BGR A;  1IKY A;  1TGO A;  2KQ2 A;  1HYS A;  3V1O A;  3KKS A;  1K6Y A;  3DI6 A;  2PZS A;  4B9L A;  3AVH A;  3SQ0 A;  3CM6 A;  3RMB A;  4HCB A;  3TAG A;  1BI4 B;  3OYK A;  1ZBF A;  2WON A;  4FLW A;  1MU2 A;  1S9E A;  1D9D A;  3LZI A;  1LAV A;  4CHQ A;  1VRT A;  4CF0 A;  1SL2 A;  4DTM A;  4PUO A;  4OGE A;  5SZT A;  4FLX A;  3KD1 E;  1BI4 A;  3MED A;  4IBN A;  3V9S A;  3OYJ A;  2DFE A;  3AVC A;  4DFP A;  4B9M A;  3HP9 A;  2BAN A;  4KHN A;  2P5O A;  2R7Y A;  3HT3 A;  5J2N A;  3SUQ A;  4N41 A;  2YNI A;  3VQ4 A;  4C8O A;  3CFO A;  4KHS A;  4I9L A;  1KCF A;  1WSE A;  1Z25 A;  4O55 A;  3ZSZ A;  3SUP A;  4NYN A;  2A1R A;  3KLF A;  1NK5 A;  3IRX A;  4NYF A;  3VQ8 A;  1D8Y A;  2KZM A;  3HXM A;  2QXF A;  4M3U A;  4ZTJ A;  4O0J A;  3CFR A;  3D0P A;  3JYT A;  3AA4 A;  3T1A A;  1JLC A;  5HRS A;  1S6P A;  3JSM A;  3P83 D;  3OJU A;  3EZ5 A;  3VN5 A;  4CEO A;  1HPZ A;  3NF6 A;  1ASV A;  1J54 A;  4DQS A;  1RDB A;  5CZ1 A;  4CJR A;  3CM5 A;  3V9Z A;  2ETJ A;  1XC9 A;  1QSL A;  3O4N A;  1VSJ A;  4H8K A;  4B9S A;  3CFP A;  1ZBI A;  4DG1 A;  5SWM A;  4CEF A;  4NCG A;  2QKB A;  1LWF A;  4DU3 A;  4FJ5 A;  2IC3 A;  1I39 A;  5C25 A;  4FK2 A;  1C0T A;  1WSJ A;  2I5J A;  4I2Q A;  4KV8 A;  4O5B A;  1WNS A;  3G10 A;  2G8K A;  4BDP A;  4KI4 A;  3NFA A;  1CLQ A;  3IS9 A;  1A5V A;  1YTU A;  2HW3 A;  3I0R A;  2E6L A;  4Z4E A;  1NJX A;  4CEC A;  2VG6 A;  4ZHR A;  3A2F A;  2D0B A;  3VA3 A;  1SV5 A;  4DSL A;  1KFD A;  3QNN A;  4PY5 A;  5FDL A;  3KLE A;  4JRP A;  1WSF A;  4RW6 A;  1UOC A;  1RTI A;  4E7I A;  2KZZ A;  2YNG A;  4FK0 A;  1GOC A;  4BE1 A;  4M3W A;  3PX0 A;  3QIP A;  4CEA A;  2YKN A;  1TK5 A;  1NJW A;  4CFA A;  4HTU A;  2PY5 A;  1NK7 A;  2OZS A;  3OVN A;  4OGC A;  4CHO A;  1BQN A;  2HNY A;  1Q9X A;  2HMI A;  2X6N A;  3OYD A;  1RDA A;  3WNF A;  1J9A A;  3QIN A;  4QCL A;  4OKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...