3AV9A

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
154
structure length
150
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 57
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3av9A00
1RT7A 1CXQA 1C0UA 3LP3A 4CJVA 1B9DA 1I3AA 2P1JA 1BQMA 3P5JA 4I7FA 3O3FA 3RMCA 1NJZA 1X9WA 1T8EA 5CY4A 2OZMA 4I2QA 3DI6A 1Q8IA 3S9HA 1CXUA 4N56A 4N76A 4OPKA 4M3XA 4FW1A 4KFBA 2OA8A 3TAPA 4CFBA 1LW2A 4FCYA 1JLQA 4CGDA 4EP4A 3OY9A 5FROA 1NJWA 4FM1A 3O4NA 3SV4A 1NK9A 4EZ6A 1EXQA 3HVRA 4FK0A 3V9UA 4E7HA 1SKWA 4W5OA 3QNNA 4LH4A 1XWLA 2WONA 1TK0A 3I0RA 4O0IA 3HP9A 2PYLA 3HK2A 4KTQA 4FLXA 3DLRA 1BGXT 2X6NA 5CYMA 3M8PA 3SI6A 2DY4A 3MEGA 1S1XA 2VG6A 4HHTA 4DTOA 3OS2A 3CFPA 1Q9YA 3WNHA 4PUOA 1JLEA 3QEVA 1JLFA 4IG0A 1LV5A 3DM2A 3AVCA 3MECA 1RDDA 2IAJA 4F3TA 2DFEA 4KHQA 4I9LA 2DFFA 4I2PA 4CFDA 3OYLA 5J2PA 5J2MA 2KW4A 3MEEA 3EYZA 3DRPA 4MFBA 4IFVA 1WN7A 1NK4A 1HQUA 1NJYA 1X9MA 1QSSA 1S1VA 1RT4A 1TL1A 3V81A 1XC9A 4DSIA 1J53A 3HT3A 4CHYA 4Z4FA 1BI4B 4FJ5A 4CEEA 1C6VA 3OYFA 3M8SA 3KKSA 1A5VA 2GUIA 4E7JA 3T3FA 3MAQA 2OPSA 4H4OA 4F2RA 1J54A 3K58A 4OPJA 5SZTA 3TAFA 4BE1A 4F2SA 3KTQA 2HHTA 3ZSQA 4CK1A 3VQCA 1HPZA 3TANA 4CEQA 3HYFA 4BE0A 3NF9A 3QLHA 4CIFA 4DG1A 1FXXA 3G10A 1RCHA 5HRRA 2G8WA 4FLTA 4HTUA 2HVIA 1TAUA 3SZ2A 1L3SA 4CJTA 4RW8A 3HO1A 2O4IA 3K2PA 1NKCA 4CCHA 3C6UA 4CE9A 4FJJA 3LZIA 4IG3A 3CFOA 2RF2A 2B6AA 2ZD1A 4CJSA 3OYBA 4CEAA 3K57A 1RBTA 4DFPA 4PWDA 4HCBA 3OYKA 3QEPA 3SQ1A 4YNQA 4BWJA 4DTRA 2QKBA 4ID1A 4CF0A 1TGOA 2XO7A 1X9SA 1VSLA 1J5OA 4Y1DA 3V1OA 2QXFA 4N5SA 4F3OA 1WSHA 1JLAA 3IG1A 4KRFA 2X6SA 1VRUA 3ZSYA 3L2WA 4FM2A 4DTSA 4B9TA 2G8KA 3HSTB 4CHQA 1QHTA 3NH1A 4OVLA 4OJRA 3TAMA 3PX4A 3RR7A 1XI1A 2B5JA 1KRPA 4KI4A 4CESA 1RDBA 4LY7A 1NKBA 3AA3A 5J2QA 1LWEA 4BE2A 4F4KA 3VQPA 1BCOA 4DU4A 4JRQA 2RN2A 1KLMA 1SUQA 3P1GA 3C94A 4DS4A 3WNFA 3SV3A 4DTUA 5HP1A 3TI0A 4KHNA 3AVMA 3TWHA 2YNGA 1ZYQA 3ITHA 3KLHA 5HLFA 1RDAA 2G8VA 2XY6A 2YKMA 3VQDA 2F8SA 5HRPA 3PV8A 4NYFA 1REVA 2DFHA 2JGUA 5SWMA 5I3UA 1UAXA 3U3YA 1CLQA 4DTMA 2D0BA 4CJ4A 1KFDA 1U49A 3IRXA 4AHTA 3O3HA 3OYEA 1TV6A 3ZSOA 1TK8A 2ZQBA 1KFSA 3SQ0A 4CHPA 1NK8A 3HXMA 3QEIA 5HBMA 3VQ5A 4YFUA 5D3GA 5JS1A 3VA0A 1QSYA 3AVAA 3ZSRA 2YHAA 3L2RA 4FLYA 3AVJA 3F73A 1VSJA 2KZMA 2ITGA 3NF7A 4KPYA 4OLBA 4DSJA 3LAKA 1U04A 1C1BA 3HVTA 5KRTA 3RTVA 4FLZA 4B9MA 4EZ9A 4Q0BA 4L8RB 1JKHA 4Z4IA 1HYSA 5J2NA 4FJMA 2FC0A 3OYAA 4DQPA 1U48A 4DFMA 3AO4A 4N47A 4AHUA 3MEDA 4CK2A 4J2DA 2HHXA 4FM0A 2IS3A 4DSFA 4DTNA 3LANA 4H4MA 4E89A 1RTIA 2YV0X 4M3YA 4QOZB 3HPHA 3C6TA 2Q3SA 4LSLA 1BL3A 4CGIA 3ULDA 1BIZA 3SYZA 1U4BA 4FJLA 5J1EA 4NCAA 4M3ZA 1RT2A 4JS4A 4CF2A 2Z1GA 2GV9A 1JXBA 3V1RA 2PYJA 3L8BA 4CF9A 3U6FA 1BIUA 4OGCA 5EU7A 1BCMA 4O4GA 3VQBA 4BACA 3PO4A 4EP5A 3NF6A 3K5NA 1S1UA 3VQEA 1JL1A 4M41A 4RW6A 1JXEA 3T19A 2HNZA 4JS5A 5K14A 3MXMA 1MU2A 1WSGA 1XHZA 3NDKA 1L5UA 2DTUA 3NE6A 3LZJA 4DU1A 1N5YA 1LAVA 4CFCA 4KHYA 4CJ3A 4C8KA 2IDOA 2HHUA 4B9VA 3I8DA 4DFJA 3PY8A 4CGFA 1IKVA 3LAMA 4OKKA 4FJGA 4AH9A 4B3OA 3DLHA 1VSMA 4GW6A 3QO9A 3B6PA 5HRSA 3SUOA 3JSMA 4H8KA 3CM5A 4CEFA 4BDYA 4ELVA 4IDKA 4PA1A 3RRHA 5DK5A 2A1RA 2NUBA 3NH0A 4FLVA 4DTPA 4KB0A 3TAQA 3VA3A 3KIOA 3QINA 3AO1A 5DMRA 4CJRA 4FJ8A 4FYDA 1FK9A 2AJQA 2OPPA 1S5JA 3KKRA 4HVJA 1HMVA 5KGXA 2R7YA 4CF1A 1WNSA 3KK1A 3TAGA 4N41A 4IBNA 4CJLA 3V9XA 1UA1A 1IG9A 2HHVA 4E1NA 3CM6A 3AA2A 3DLBA 3FFIA 1D8YA 3ISNC 3NGYA 3OYNA 3SNNA 4CJ5A 3LP2A 4B9LA 1LWCA 1ITGA 2A1SA 3THVA 4KHWA 3LP1A 1EETA 4B8AB 2RKIA 3RMBA 4BDPA 4KHUA 4AHVA 1S6QA 4K8ZA 4CJPA 2W42A 1IKYA 1KVAA 2OPRA 3DOLA 4RW7A 5I42A 4ELTA 2O4GA 3LWMA 4TSXA 3PX0A 3SUQA 4Z0UA 1RBRA 4E1MA 3HL8A 4DQIA 4I9QA 1VRTA 4DQQA 3V9WA 3PX6A 4HCCA 1QE1A 2XHBA 1VSEA 1NOZA 3OYDA 4FJ7A 3AO3A 4K8XA 1K6YA 2EHGA 3AVGA 3S3OA 1L3TA 3SUPA 2YNFA 5JS2A 4LSNA 1SL1A 4CHZA 4DQSA 1FKOA 4FZZA 1R0AA 4W5NA 1JL2A 1WSIA 5T7BA 5FRNA 3M8RA 3AVLA 4FVMA 4KREA 1SL0A 1A5XA 3OYGA 2P5GA 4GMJB 4GVMA 1J9AA 4AILC 1Y97A 1Z26A 3SJJA 4KTZA 4B9SA 3CG7A 1C1CA 1RDCA 3KJVA 5KGWA 4UQGA 1WAFA 4JRPA 3AA4A 4FLWA 1EKEA 4JLHA 1TK5A 1SKRA 1QSLA 3ZSXA 2FBYA 4CGGA 4DLGA 3VQAA 5HROA 1ZBFA 4E3SA 3OYIA 3ZCMA 1VSKA 3V9ZA 1LW0A 4MQ3A 3MXIA 5C42A 1RTHA 2HNDA 4DTXA 3LPTA 3SUNA 3TARA 1A5WA 1TKDA 3IAYA 2XRIA 3I0SA 1ASWA 3DRRA 3BGRA 2PZSA 4AHCA 3RMAA 1NK6A 3M8QA 4O55A 4RW4A 3ZSWA 1KTQA 4FJXA 2KTQA 1HJRA 3OVNA 1S1WA 2E6LA 5C25A 4NCBA 3DOKA 1C0MA 1RBSA 3V1QA 4CIEA 3EZ5A 3VQ4A 3CQ8A 3HPGA 4NCGA 5CZ2A 4DTJA 2E6MA 3AVKA 4CGJA 3NBPA 1WSJA 1JLBA 1GOBA 2Z1IA 4B9UA 1VSDA 1TKZA 2ETJA 2D5RA 2EX3A 4OLAA 2YHBA 4CEBA 4KAZA 4E7KA 4FJHA 1HQEA 2VG7A 1T03A 3RWUA 1O1WA 1G15A 3S3MA 3H08A 3SQ4A 3VN5A 2YKNA 2YNIA 1UA0A 1XHXA 1IKWA 2HW3A 1VSFA 3G0ZA 4WE1A 1Z25A 1NK7A 3K5OA 4FJKA 1UWBA 4FK2A 4CHNA 4J2AA 1KSPA 4HUGA 1NKEA 1L3UA 1HRHA 2X74A 4OGEA 1C0TA 3L2UA 5CZ1A 2RPIA 3NFAA 3SPZA 2KFZA 4CJUA 2HMIA 3O3GA 3T1AA 3NCIA 2X78A 2VWKA 5KRSA 1RT5A 2YNHA 3DLKA 4R5PA 1SL2A 2PY5A 4FZXC 1IH7A 4CEOA 5HRNA 2QK9A 3KK3A 4F8RA 4W5QA 2OPQA 2ZE2A 2VG5A 4Y1CA 4FJNA 1Q9XA 3BDPA 4PQUA 4O5BA 2P5OA 4B8CA 3VQ8A 4M42A 1IKXA 1ZBIA 3SPYA 1WSEA 3TABA 1S9GA 4CGHA 2Y1JA 3L3UA 3OYCA 3A2FA 2IOCA 4C8NA 1RBVA 4O0JA 3QETA 3MXJA 4CJWA 1ZBHA 4OKJA 3LP0A 3QNOA 1YVUA 1QQCA 3NGIA 4E7IA 3DLGA 2BDPA 1KVCA 2HB5A 3ZT3A 2OZSA 1HYVA 2Z1JA 5KI6A 4AHRA 4DSEA 2D0AA 1W9HA 2HHWA 3SQ2A 1QTMA 1VSIA 4KHSA 3HM9A 3QEWA 2KZZA 1U45A 1RT3A 1X1PA 4NYNA 1B92A 2ATQA 1GOCA 4FZYA 1GOAA 2BANA 1ASVA 1BISA 2HNYA 1S1TA 4FXDA 4CERA 1W0HA 3OJSA 4DLEA 1LAWA 2KQ2A 2F8TA 3AV9A 3K59A 2WOMA 3DMJA 1NK5A 3WNEA 3O4QA 1WAJA 3JYTA 4KO0A 4BDZA 1LWFA 2XY8A 1UOCA 3ZSZA 4AHSA 2FBTA 3NH2A 3OYHA 3HP6A 3D0PA 4DFKA 1L3VA 3KLGA 4CFAA 3QIOA 2VWJA 4O44A 4FJ9A 3KD1E 1KCFA 1DTTA 4PY5A 2HHQA 4CF8A 3OYJA 1TKTA 4KB1A 2IGIA 3QEXA 4CEDA 4CJFA 4DS5A 3NF8A 1FKPA 4DU3A 3EY1A 3LWLA 3NAEA 3C95A 3QERA 4M3UA 4RW9A 2F96A 3HPOA 3CFRA 2FBVA 3ZT4A 1NJXA 3B6OA 3V4IA 1U47A 3AVNA 2P51A 3ZT1A 1ZBUA 3AVBA 1B9FA 3AVFA 4E19A 4M3RA 2G8FA 2E4LA 1S6PA 4DSLA 3U3GA 3D45A 4OKEA 3V6DA 4C8OA 3UIQA 3LALA 3HJFA 4B08A 4DWIA 3KK2A 1RTDA 4C8LA 1TKXA 3L2VA 2XY7A 2G8UA 1D5AA 4CK3A 1YTAA 3PO5A 1WLJA 5KTQA 1EP4A 4KTWA 1ZBLA 1HNIA 4CJKA 3NGZA 4KI6A 4HUEA 1SV5A 5CYQA 4J2EA 1HYZA 1ASUA 4ZTJA 4E7LA 4RG8A 2OYQA 1I39A 3QIPA 3LDSA 2Y1IA 1QS4A 1BI4A 4Q5VA 1DTQA 4FJIA 1NOYA 1F21A 4DMNA 1D9FA 3RRGA 1KVBA 3AO2A 3KLIA 1TVRA 4CIGA 4CJQA 1RTJA 5E41A 3OJUA 2LSNA 3K5LA 3S3NA 3OS1A 1BHLA 4DQRA 1VK0A 3L3VA 3AVHA 4DF8A 1VSHA 1NK0A 3ZT0A 3V9SA 3F9KA 4Z4GA 5C24A 4C8MA 4DSKA 3ASMA 4CECA 1RNHA 3L2QA 3SCXA 2G8HA 3WNGA 1SKSA 4M3TA 2KFNA 3RR8A 1WSFA 1TAQA 3ZSVA 3QESA 2I5JA 3VQQA 1HNVA 4CEZA 4XIUA 1EX4A 2IC3A 4J2BA 1IO2A 1BQNA 3DLEA 2GBZA 3K5MA 1C1AA 2Z1HA 3DYAA 4KKOA 2XY5A 4ZTFA 3PUFA 4HUFA 4FW2A 4LD0A 4LH5A 4Z4CA 4FLUA 1N6QA 4BWMA 4W5TA 2FBXA 2HVHA 4ID5A 4M3WA 3KD5E 4FK4A 4W5RA 3AO5A 4CJEA 1DLOA 2QKKA 3CYMA 2G8IA 4IKFA 2BGGA 4ICLA 4G1QA 3VQ6A 3NHGA 1YTUA 2D0CA 5FRMA 1CZBA 2BE2A 3VQ9A 4CHOA 2HHSA 1JLCA 1D9DA 3IS9A 3TAEA 4IFYA 4DF4A 4Z4EA 1JLGA 1KLNA 1T7PA 3AA5X 3AVIA 3DRSA 3RMDA 3KLFA 1YT3A 3VQ7A 3OS0A 3OYMA 1TL3A 3ALYA 5FDLA 1T05A 1RT6A 4B9NA 3P83D 3KLEA 1CZ9A 3ZT2A 4ZHRA 4KV8A 3TR8A 4M45A 4QCLA 4ELUA 1S9EA 4E0DA 4Z4HA 1RILA 4QAGA 1RBUA 3E01A 2B4JA 1RT1A 3LPUA 2JLEA
chains in the Genus database with same CATH superfamily
1B9DA 1I3AA 1NJZA 4E1JA 1YI2N 1X9WA 3VF2A 2A6AA 1Q8IA 3S9HA 2A42A 5LJVA 3O1BA 4FWSA 4FCYA 1JLQA 3BF3A 4CGDA 3OY9A 1NJWA 4CZLA 3SV4A 4O8KA 3V9UA 1SKWA 4W5OA 3QNNA 4LH4A 1XWLA 2WONA 1TK0A 3D6RA 4YOXA 3MCPA 3HK2A 5I9EB 5CYMA 1S1XA 2F7TA 5AQLA 4BRDA 4BG8A 2Q97A 1GLDG 2E2PA 3DM2A 3I55N 2YCHA 4F3TA 2IVPA 3CC7N 2CGKA 3BEXA 3A8YA 4MFBA 1HQUA 4A62A 1QSSA 1XC9A 1NBWA 4Z4FA 1IJJA 3KK7A 4BR0A 4E7JA 3T3FA 1FJGK 3MAQA 4H4OA 4A5BA 4BE1A 3SJHA 4CEQA 4IZ9A 1RDUA 4BRFA 3NVKA 1TUYA 4QS7A 4RW8A 2O4IA 3K2PA 1NKCA 1NG9A 4FJJA 4IG3A 4CJSA 2ZD1A 4CEAA 1YIJN 4XH5A 3QEPA 2VQFK 1TGOA 1X9SA 5GAHP 2E5LK 1J5OA 4OPAA 2O8EA 1WSHA 1JLAA 4MO4A 1V4SA 1YAGA 4B9TA 3L2WA 4JEPA 4FM2A 4DTSA 4OVLA 4OJRA 4BC5A 3PX4A 1RDBA 4LY7A 3AA3A 2QWLA 4FWRA 3F5TA 3U8XA 3VQPA 4F4KA 2GELA 1KLMA 4DS4A 3C94A 4JAXA 3PIPL 1OH7A 3AVMA 3TWHA 3KLHA 2UXCK 3THWB 2XY6A 2YKMA 3VQDA 5HRPA 2PAVA 4NYFA 3MN7A 3O9RA 4AHTA 2P9PA 3OYEA 1KFSA 3QBXA 4DR7K 4FWLA 3K9JA 1YXQA 4FSVA 1KAXA 1ZBSA 3CJCA 3NF7A 4OLBA 1U04A 4BRAA 4FLZA 4Q0BA 4LF4K 4L8RB 1JKHA 1HYSA 1QVFM 2FC0A 4N47A 3H46O 2UXDK 5AFUA 4QOZB 3HPHA 3H6EA 3C6TA 4CGIA 1QHAA 2RHKA 4M3ZA 4JS4A 3FZMA 4CF2A 1N34K 3V1RA 5B8HA 1BIUA 4OGCA 3MWTA 3PO4A 4RW6A 1JXEA 4JV5K 1MU2A 4B1UB 5F0XA 3LZJA 2ZJRL 4KHYA 1NM1A 2O8FB 2IDOA 3I8DA 4DFJA 4CGFA 3JAMO 1MWMA 2GWKA 4AH9A 3B6PA 5HRSA 3JSMA 3SBGA 4CEFA 2A1RA 5DK5A 3A5LC 4AQYK 3KIOA 1NGCA 4CJRA 3AO1A 5DMRA 1HR0K 2VWBA 4AM6A 2FSJA 3KKRA 3UB5A 2R7YA 3KK1A 4B3SK 4N41A 1IG9A 1XNQK 1E4GT 4CZGA 4BC4A 2E20A 2HF4A 2A1SA 5AQYA 1GLBG 1XNRK 4B8AB 4CZKA 3RMBA 4BDPA 4DV0K 1S6QA 2OPRA 3LWMA 3BZCA 4JI3K 3C65A 4DQQA 4JK8A 3CXCM 4HCCA 1NOZA 3OYDA 2I7NA 1K6YA 4JD2B 2YNFA 3ZX2A 3TPQA 4K41A 4JKCA 1JL2A 1WSIA 3RSEA 3AVLA 4FVMA 3TSPA 3OYGA 4GMJB 4GVMA 4AILC 3P4IA 3VF4A 4B9SA 4JRPA 1DGKN 4DR4K 4DLGA 3ZCMA 1R59O 4IJAA 5LJWA 4H0YB 1RTHA 2OCEA 4BRHA 3TARA 1TKDA 2J4RA 2QWPA 2P9NA 3DRRA 3LDNA 3OVNA 1VQ8N 2JWLA 3V1QA 4CIEA 3D2EA 3T1YK 2E88A 3AVKA 3FE1A 3I33A 2V7ZA 3TTFA 3SAFA 4OLAA 4E7KA 3THXA 1O1WA 3H08A 4PKHA 4NXMK 1RGIA 3TSQA 3SQ4A 1Z05A 1IKWA 2HW3A 1VSFA 2QI2A 4CHNA 4JHDB 1KSPA 1WOQA 3R6MA 4HUGA 3AGKA 4LF9K 3LM9A 1VQMN 2O8CB 3SPZA 1M1KO 2KFZA 4K8ZA 3NCIA 3THYB 2VWKA 1SL2A 1YITN 1IH7A 4DV1K 3DXMA 4C1NK 4ISGA 4KH5A 4CZFA 3SPYA 1XMOK 1S9GA 4JI2K 3CJBA 4CJWA 1VAZA 4OKJA 5AQTA 3VEYA 3NGIA 3DLGA 4BG9A 3ZT3A 2OZSA 1HYVA 2Z1JA 4H0TB 5KI6A 4DSEA 2HHWA 1W9HA 2YI1A 4IEIA 3KVGA 5FPMA 3QEWA 4U67L 1U45A 1RT3A 4EFHA 4FZYA 1GOAA 2BANA 4FXDA 1JCFA 1W0HA 4M7XA 1YF5L 3SAHA 4FL9A 3AV9A 3CETA 1VQNN 2WOMA 3VEVA 1NK5A 3WNEA 3O4QA 4CVNE 4KO0A 4BDZA 2XY8A 1XQSC 3ZSZA 4AHSA 2FBTA 4DFKA 3QIOA 3KD1E 1KCFA 2NZTA 3HM8A 2IGIA 1FKPA 3QERA 2QK9A 2W6LA 3C95A 4BRCA 1NJXA 2FBVA 3ZT4A 3B6OA 3ZT1A 3DLLL 4E19A 4CJ7A 3E9PA 2QEXN 1KAZA 4YOVA 3HJFA 4B08A 4DWIA 1I94K 1RTDA 3W3DA 1TKXA 2GUPA 3L2VA 2G8UA 3VEZA 2CH6A 2HBKA 4JKEA 1WLJA 4KTWA 1HNIA 3NGZA 5CYQA 1HYZA 4E7LA 3CERA 1BI4A 1NOYA 1G99A 1F21A 3WXIA 1KVBA 3AO2A 5FPDA 4BVPA 3EEQA 1RTJA 5E41A 1P8ZA 1U2VB 3L3VA 1BOTO 1VSHA 1NK0A 4A5AA 1IG8A 4CECA 4YOUA 5KPRA 1TAQA 3ZSVA 1W2BM 1HNVA 4J2BA 2ZWHA 5BN8A 4ZTFA 1LOTB 1N6QA 4ISEA 5F1XA 3KD5E 5JVGL 5KPZA 5EXWA 2PBDA 4FPBA 4ICLA 3VQ6A 5FRMA 5BRFA 1CZBA 2BE2A 3ATUA 1JLGA 1KLNA 4JKGA 3RMDA 3KLFA 3VQ7A 3OS0A 1TL3A 3ALYA 1RT6A 3O5BA 3P83D 2GEMA 3KLEA 3ZT2A 4QCLA 4FWOA 1S9EA 1QZ6A 1RILA 4QAGA 1NNEA 2JLEA 1CXQA 3O3FA 2P1JA 2UUAK 1T8EA 3G25A 5DM7L 3E9LA 1CXUA 5H1SQ 4IWVA 5FROA 4FM1A 3O4NA 4EZ6A 3BUZB 3HVRA 4FK0A 3UKUA 4X66K 4O0IA 4A2AA 3HP9A 2PYLA 4ILHA 4KTQA 3DLRA 1BGXT 3MMVA 1CZAN 3M8PA 3MEGA 2NRRA 4HHTA 1QZ5A 1JLEA 4DCHA 3VERA 3I56N 4EAHD 3MECA 4WYBA 2IAJA 5M1OA 4CFDA 2QWQA 1HPMA 2VQEK 1X9MA 4UY8O 1NJYA 1BWFO 1RT4A 4DSIA 3V81A 4JKFA 2O8BA 2O8EB 3DJCA 1C6VA 3ULEA 3OYFA 1A5VA 1EWQA 1M90O 4DUYK 4F2RA 2HHTA 3K58A 3S41A 3KTQA 3VQCA 4DKWA 3PSIA 4QS8A 4H0XB 5JLHA 5KQ8A 3O08A 3CMAN 3G10A 3QICA 2HVIA 4BVOA 3SZ2A 1JCEA 4CJTA 3HO1A 3C6UA 4CE9A 2E8AA 3CHWA 3CFOA 2A3ZA 2RF2A 3K57A 1RBTA 4DFPA 4PWDA 4BRIA 4YNQA 4CF0A 2P9PB 3D2FB 4L3QA 2E2NA 1ILYA 4N5SA 4F3OA 4KRFA 5HOOA 3ZSYA 5AZJA 4CHQA 3NH1A 5AQMA 4BRNA 3RR7A 1GLJO 3WXJA 1VQ7N 3E1YA 2Q36A 4JRQA 1SUQA 1NGAA 4DTUA 3WNFA 4OX9K 2YNGA 1EQYA 5HLFA 1WBDA 1YVNA 4KH4A 3DWLA 1BG3A 5I3UA 2DFHA 2JGUA 1UAXA 3U3YA 3O3HA 3PIOL 3ZSOA 2ZQBA 4GKKK 3HXMA 4YFUA 2YHAA 3ENOA 2F9WA 3TU5A 4IOCL 4BR4A 4KPYA 3H3OB 3QMLA 4R79A 4DSJA 4DV6K 3LAKA 1C1BA 3HVTA 4EZ9A 2QTDA 4JI5K 3CCJN 2HHHK 3AO4A 4NLBA 4AHUA 3BP8A 4FM0A 4DSFA 4DTNA 3LANA 4H4MA 4BRGA 4E89A 3CCRN 3O9UA 4LSLA 2Q3SA 3EN9A 1N32K 1BL3A 3SYZA 4FJLA 3AGRA 5C12A 4G9ZA 2Z1GA 4BREA 1ATSA 2GV9A 1MDUB 1K8AO 2PYJA 5A2QO 4CF9A 5TKYA 1VQLN 1ZC6A 1E3MA 4FOIA 4B3TK 1JL1A 4M41A 1T6DA 3T19A 4IO9L 4ILJA 5K14A 3MXMA 3NDKA 4H5TA 1LAVA 4CFCA 4CJ3A 4C8KA 2HHUA 4B9VA 2A5XA 3PY8A 2ZJPL 4OKKA 4B3OA 4GW6A 4LF6K 3O4WA 3QO9A 1KXPA 1VQKN 3NMUA 2Q31A 4V19S 4BDYA 4IDKA 5M1PA 4DTPA 3FR0A 2AJQA 4FYDA 2QXLA 5GIOA 4CF1A 3UKRA 1QQMA 4CJLA 2HHVA 3ZETA 4E1NA 3RSEB 3FFIA 2V7YA 3WT0A 3O9TA 1N36K 3LP2A 2P9UA 1LWCA 1ITGA 3THVA 5DM6L 3LP1A 1JCGA 3CJ7A 4BGAA 4BY9C 2I7PA 2CGLA 4CJPA 1KVAA 3DOLA 4H5VA 5I42A 1S3XA 3SUQA 3VEWA 4Z0UA 4DQIA 3H1QA 2P9NB 1VSEA 1T6CA 5BN9A 5C2FA 3S3OA 5JS2A 4LSNA 3D2EB 4DQSA 1FKOA 4FZZA 3T69A 1VQ9N 3F2KA 5BRDA 3HOTA 1NMNA 1A5XA 1J9AA 3CJAA 3THXB 1TAUA 1RDCA 5KGWA 2QA4N 1EKEA 2EWSA 1QSLA 3ZSXA 4NLCA 5GAGP 5AQFA 5HROA 4E3SA 1VSKA 5MLCQ 5BR8K 3V9ZA 1LW0A 4MQ3A 1SQKA 3LPTA 1T3VA 1A5WA 2IIRA 3I0SA 1ASWA 4A59A 4IOXA 4B1VA 4O55A 2NRVA 1KTQA 4FJXA 2O8DA 1S1WA 4H0PA 1C0MA 3DXMB 5AQRA 3EZ5A 3VQ4A 3EKSA 5C0YA 5CZ2A 4CGJA 2Z1IA 1GOBA 5AQIA 4B9UA 1TKZA 3M1FA 5ADXH 2YHBA 4FJHA 1HQEA 4RTFD 2VG7A 1YJNN 3S3MA 3VN5A 3CIPA 2BUPA 1T44A 4B1ZA 4FJKA 2ASMA 1UWBA 1YJ9N 3TTDA 3MX5A 2QWRA 1NKEA 3SAGA 4OGEA 1C0TA 3P31A 4WQ5A 2X78A 5KRSA 1RT5A 2PY5A 4B3MK 5AQHA 1NJIO 3LDPA 2W6KA 3AAPA 5HRNA 3KK3A 1VQ5N 2OPQA 4Y1CA 4WFAL 1Q9XA 3WXMB 3L4IA 4B8CA 4M42A 4CZIA 1HUXA 5BPLA 3TABA 2Y1JA 1QVGM 1IBMK 4M63C 2IOCA 2NRZA 3GG4A 2P9LA 5AQKA 1QQCA 4E7IA 3KHYA 2HBLA 4JKDA 1J5EK 4CZMA 3CJ9A 4FWQA 4DV7K 1QTMA 4GV9A 2KZZA 4FWNA 3K0SA 4IEEA 2ATQA 1GOCA 1ASVA 4LC9B 4H5WA 4DB3A 4H0VB 4CERA 2P9KA 1DKGD 3EZWA 3DMJA 1WAJA 3JYTA 1LWFA 3NH2A 3OYHA 4FVUA 3HP6A 4KH6A 2VWJA 4FJ9A 4O44A 2GX9A 2W41A 3BF1A 1OH6A 3F9MA 3OYJA 3QEXA 3O1WA 4DS5A 4DU3A 2OANA 2IVNA 3CCMN 2V51B 3CFRA 3V4IA 3AVNA 1ZBUA 4H0OA 4LFCK 3AVBA 3AVFA 4MLHA 2G8FA 4K42A 5HL7L 3U3GA 4OKEA 3V6DA 3LALA 2VGMA 3CCSN 3KK2A 2XY7A 2HBMA 1D5AA 4CK3A 4YOWA 1EP4A 4BRQA 4HUEA 1SV5A 4J2EA 2VCPA 1I39A 2YHWA 3QIPA 1ATRA 4BRLA 2Y1IA 1VHXA 1X3NA 5GIPA 1H1VA 2WC9A 4DMNA 5JMVA 1D9FA 3QDKA 3RRGA 3VENA 3KLIA 2P9IB 4CIGA 4CJQA 4DV2K 4GV3A 4JKGB 4A2BA 2LSNA 3K5LA 3OS1A 1VK0A 4J8FA 4Z4GA 5C24A 3C6AA 4DV5K 3L2QA 3SCXA 4DSKA 3WNGA 1SKSA 2KFNA 4K43A 3VQQA 4PL8A 1EX4A 2IC3A 1IO2A 5EVZA 3TAGA 3U9DA 3MWPA 1GLEG 3PUFA 4AM7A 4FW2A 5E84A 4LH5A 4BWMA 4W5TA 2HVHA 2RE2A 2QKKA 3CYMA 3UKUB 2G8IA 2HSTA 4MLEA 2BGGA 4G1QA 1YTUA 3IFRA 1QQOA 1JLCA 1D9DA 3TAEA 3R1XA 3AA5X 3AVIA 3Q7BA 3CCLN 4KHPK 1X9JA 4EHUA 3OYMA 4B9NA 3CCQN 3TR8A 2HMPA 4E0DA 3LDQA 1RBUA 4BR9A 1C0FA 3LPUA 1GLAG 3V9XA 3LP3A 1BQMA 3P5JA 4C8OA 5CY4A 3DI6A 4F9OA 2O8BB 4N56A 3VF6A 4FW1A 2OA8A 3TAPA 3ULEB 1LW2A 3GBTA 5KPTA 1EXQA 2FLOA 3I0RA 2D0OA 5ADXA 4RWTA 4JK9A 3SI6A 5GAEP 2VG6A 4DTOA 4PUOA 3GDQA 4C1NI 3IDHA 1JLFA 4IG0A 1LV5A 4HTLA 4KHQA 4JKAA 5J2PA 1HLUA 4O5FA 5J2MA 2UUBK 2KW4A 3MEEA 3DRPA 4IFVA 1NK4A 4CD1A 3QFUA 1TL1A 3HT3A 4CHYA 1C0GA 1XC3A 1NGEA 4BR7A 4CEEA 2H3GX 4JI8K 3KKSA 4FOEA 2GUIA 3OA9A 5BREA 5AZJB 2Q0RA 1K8KA 3KZBA 4YY3K 1J54A 4OPJA 5SZTA 1NMDA 3J81O 1YHQN 4CK1A 4DV4K 3GL1A 3HYFA 5EY4A 3VMFB 4BE0A 3NF9A 5AZIA 1RCHA 4CZEA 2G8WA 4FLTA 4PKIA 3OYBA 3OYKA 4DTRA 3FZKA 4BWJA 3U4LA 4ID1A 1VSLA 4Y1DA 5C2DA 1NGIA 3V1OA 5LMNK 3IG1A 3ID8A 3CQYA 1ATNA 4BQZA 4YDUA 1XI1A 2AP1A 1KRPA 1MA9B 4CESA 1NKBA 2UYTA 3VGMA 4BE2A 4DU4A 3CC4N 2RN2A 3B8AX 3ZX0A 3TI0A 4KHNA 3SV3A 3J80O 5CR4A 1ZYQA 3ITHA 4JI6K 2G8VA 1RDAA 3MN5A 2F8SA 2VGNA 1REVA 4FWKA 2YJEA 4CJ4A 3IRXA 4AF1A 1TV6A 1TK8A 3CD6N 4PHTX 4DR3K 1NK8A 5HBMA 4BC2A 1XMQK 3L2RA 2A40A 4FLYA 3AAQA 3F73A 5M1QA 2KZMA 3CI5A 3VTIA 2FF6A 4Z4IA 1WB9A 2E2OA 3OYAA 3HOSA 1U48A 3WQTA 1WBBA 3VEXA 3MEDA 4CK2A 4J2DA 2HHXA 3WXLA 3H3NO 5GADP 3DXKA 3O80A 3R3LA 3ULDA 1BIZA 1NGBA 1U4BA 5J1EA 1RT2A 2UUCK 1JXBA 1GLLO 3UKRB 3L6QA 3L8BA 2D0PA 3ZETB 1BCMA 4O4GA 3VQBA 3FGUA 4BACA 1VQ4N 4EP5A 1S1UA 3VQEA 5BPNA 2P9UB 3E66A 1Z6RA 4H5RA 3G6EN 1N5YA 3A0IX 4H5NA 1HNWK 4DUZK 1IKVA 3RVCA 1BUPA 4FJGA 3J8AA 3SUOA 5LY3A 4H8KA 1E4FT 4ELVA 3CCEN 1K73O 3VTHA 3NH0A 4FLVA 3VA3A 1BU6O 2OPPA 1S5JA 4HVJA 4PKGA 2V52B 5FPEA 1WNSA 3WEEA 2WUSA 1UA1A 2BH1A 1GLCG 3CM6A 3A5NC 1D8YA 3NGYA 1V4TA 4WQ5C 3FZFA 3JS6A 3CPEA 5TKWA 1EO1A 2KLAA 4AHVA 3C7NA 3AY9A 1IKYA 4XEIA 4B9QA 3WUHA 2O4GA 3O6WA 1RBRA 4LFBK 3OBWA 4ILGB 3VETA 5E26A 2XHBA 5C10A 4FJ7A 3AO3A 4JKBA 4K8XA 2O8DB 2EHGA 1RDWX 3SUPA 4OO1J 1XUPO 1R0AA 1Q18A 4W5NA 2BTFA 3Q7CA 1X3MA 3M8RA 2UU9K 4U7BA 2P5GA 4DR5K 3OHRA 1Z26A 1IBLK 3KJVA 1C1CA 4FLWA 4UQGA 5AQWA 1WAFA 1TK5A 1SKRA 2G8KA 4JLHA 4GKJK 3UE5A 1ZBFA 4CBWA 4LF8K 1DEJA 3MXIA 1P90A 5C42A 3SMPA 2HNDA 3IAYA 1SAZA 4YHHK 3BGRA 2PZSA 4AHCA 1NK6A 3M8QA 4RW4A 3ZSWA 5AFUH 2KTQA 1BA1A 5C25A 4NCBA 3DOKA 1RBSA 2NRHA 4JNEA 3CQ8A 2ZGYA 3NBPA 1WSJA 1VSDA 2ETJA 1KD1O 2D5RA 2EX3A 2Q0UA 3KWIA 1IV0A 4KAZA 3CF5L 4MDAA 3TTCA 3RWUA 1HKGA 2P9LB 2YKNA 3VEOA 3G0ZA 2PFUA 3HSCA 4FK2A 2A41A 2P9SA 2X74A 3CQXA 4GNIA 2UXBK 4DR1K 2RPIA 3NFAA 2HMIA 3O3GA 4HCBA 4FZXC 2QWMA 4CEOA 4DQ8A 2P9KB 2ZE2A 2VG5A 1BDGA 4A57A 4O5BA 2P5OA 1SS6A 3VQ8A 4B3RK 3PLAA 4CGHA 3VESA 3L3UA 3OYCA 4CZJA 2D4WA 4LF7K 1KAYA 1RBVA 2QWOA 4O0JA 3MXJA 5AQQA 2HOEA 3LP0A 3QNOA 1OH5A 3ZLJA 2BDPA 4NB4A 4AHRA 3SQ2A 3HBTA 1TUUA 1Q7YO 3MCAB 1VSIA 3HM9A 1J6ZA 3MDQA 4BQLA 4IOAL 3BY5A 4FO0A 1BISA 2HNYA 2OTLN 3OJSA 2FXUA 4DLEA 1LAWA 2KQ2A 3SK3A 3CC2N 2F8TA 3K59A 1JJ2M 4GV6A 4MO5A 1UOCA 3D0PA 5BR9A 1L3VA 3KLGA 1DTTA 4PY5A 1NGFA 4YORA 4KB1A 4X65K 4CJFA 3NF8A 4M3UA 3EY1A 3LWLA 3NAEA 2FF3B 4RW9A 2F96A 3HPOA 4PL7A 2OZMA 5EX5A 4IO8A 1D4XA 1TYQA 4DSLA 3G71N 1Q82O 4C8LA 1YTAA 3PO5A 3J7YP 4CZHA 1NGGA 1ZBLA 4B1XB 3HZ6A 3A5MC 1BO5O 2OYQA 3LDSA 4CD3A 1QS4A 1OVQA 4Q5VA 1DTQA 4FJIA 1ESVA 3W0LA 3KWGA 4EIAA 3OJUA 3S3NA 1BHLA 3R8EA 2FSKA 1SZ2A 3O8MA 3ZT0A 3V9SA 3F9KA 4HWIA 4M3TA 2YHXA 2HF3A 3RR8A 4WQ4A 3QESA 4C23A 1N8RO 4CEZA 4XIUA 3K9KA 2KKZA 1BQNA 2GBZA 3K5MA 1NGJA 4KKOA 2XY5A 2E1YA 5M1FA 4LD0A 4Z4CA 2FBXA 3FZLA 2YHYA 4ID5A 4LFAK 5LMUK 4FK4A 3D2FA 3AO5A 1DLOA 1GLFO 4IKFA 3NHGA 4O8UA 4IFYA 4I6MA 1YT3A 5AJ3K 1T05A 1ZXOA 5M1KA 4NXNK 1CZ9A 4ZHRA 3ATVA 4M45A 4Z94A 4ELUA 3N4PA 2B4JA 1RT1A 1RT7A 4YDUC 1C0UA 4CJVA 4YOYA 3RMCA 4I7FA 4BGBA 5AQJA 4QS9A 4I2QA 3QB0A 2AA4A 4CI6A 3IUCA 4X62K 2Q2RA 4OPHA 4N76A 4OPKA 4M3XA 4KFBA 4CFBA 2E1ZA 4EP4A 1NK9A 3L0QA 2F4VK 1K8KB 4E7HA 2NRXA 3IMXA 1Q86O 5IT9O 4FLXA 2DY4A 2X6NA 2E2QA 1KQSM 5AZIB 4FWPA 3CCUN 3OS2A 3CFPA 1Q9YA 3WNHA 3QEVA 3AVCA 3QBWA 1RDDA 1HX1A 1NGDA 2DFEA 2DPNA 4I9LA 2DFFA 1LCUA 5AQXA 4I2PA 3ZEUA 4BRMA 3OYLA 3EYZA 4CBUA 4M7YA 1WN7A 4X64K 1S1VA 2QWNA 1J53A 1YJWN 3FZHA 2GTDA 3FFKB 4IDHA 1BI4B 3ZYYX 4BRPA 4FJ5A 3IKMA 3M8SA 1U6ZA 5GINA 2OPSA 5KQDA 4WF9L 3TAFA 4F2SA 4CW7B 3ZSQA 1HPZA 2F9TA 2VYPA 3TANA 3T7ZA 4YOTA 3QLHA 4CIFA 4DG1A 1FXXA 5HRRA 4HTUA 1L3SA 4DV3K 4CCHA 3LZIA 2B6AA 3L4QA 3SQ1A 1IBKK 4BR5A 2QKBA 3OW2M 2XO7A 3VGLA 3OBYA 4JI0K 2QXFA 3SMSA 2X6SA 1VRUA 3HSTB 1QHTA 4BC3A 3TAMA 3EO3A 2WFBA 2B5JA 4IJNA 5J2QA 1LWEA 4JI4K 1BCOA 3P1GA 3HTVA 3ID6A 5HP1A 1NLVA 3R9PA 3PV8A 3D7EO 5SWMA 2D1KA 3DXKB 1K9MO 1CLQA 4DTMA 2D0BA 4H03B 1KFDA 1U49A 4RCHA 3SQ0A 3P39A 4CHPA 5JS1A 1W97L 5CE3A 3VQ5A 3QEIA 3VA0A 1QSYA 3AVAA 3ZSRA 3AVJA 5JLFA 1VSJA 2ITGA 4WCEL 3C0BA 5KRTA 3RTVA 4B9MA 2GWJA 5AQOA 2JWKA 5J2NA 4FJMA 4DQPA 3LDOA 4DFMA 3THWA 2ZGZA 2IS3A 3LDLA 4M3YA 1RTIA 2YV0X 3AARA 4NCAA 3DAWA 1MWKA 1NWKA 3HRGA 3WEEB 5JICA 3U6FA 5EU7A 4A61A 3K5NA 3NF6A 3U9ZA 3M6GA 5ELZA 2HNZA 2Q1NA 4JS5A 1XHZA 1WSGA 1L5UA 5EOYA 2DTUA 3NE6A 1NU0A 4DU1A 4JK7A 1N33K 1VQPN 2CGJA 3LAMA 3C7NB 3CMEN 4JYAK 3MN6A 3DLHA 1VSMA 4EHTA 1HKBA 1WUAA 1HNXK 3CM5A 4PA1A 3RRHA 2CH5A 4KB0A 2NUBA 2ASPA 3TAQA 3QINA 4FJ8A 1FK9A 5CHIA 3ZX3A 1HMVA 3LM2A 3I8BA 5KGXA 1VQON 4IBNA 3AA2A 3DLBA 4WFNL 3ISNC 3OYNA 3SNNA 4CJ5A 5IWAK 4B9LA 1O13A 3EL2A 4KHWA 4NO7A 2O8FA 1EETA 1VQ6N 1HKCA 4K25A 2RKIA 4KHUA 2FSNA 2W42A 4RW7A 4ELTA 3OTOK 4TSXA 3PX0A 4E1MA 3HL8A 5AQPA 4I9QA 1VRTA 3V9WA 1BA0A 4IXCA 3PX6A 1QE1A 4B1YB 3H1VX 3AVGA 3GE1A 1L3TA 4MDBA 4FPAA 1SL1A 3VOVA 3WXKA 4CHZA 2ZJQL 5T7BA 5FRNA 4KREA 3EE8A 1SL0A 1Y97A 3SJJA 4KTZA 4BROA 3CG7A 4GY2B 3AA4A 1KC8O 2FBYA 4CGGA 3VQAA 3OYIA 1OH8A 2QM1A 2P9SB 3M3ZA 4DTXA 3SUNA 2XRIA 3GOIA 3RMAA 4LF5K 2QW9A 1HJRA 2E6LA 4JD2A 2WBNA 3HPGA 4NCGA 4DTJA 2E6MA 3TSUA 4IFEA 1JLBA 5AQSA 4CBXA 3BZKA 4CEBA 1EWRA 3EKUA 1T03A 1G15A 2YNIA 1UA0A 1XHXA 4JI7K 4WE1A 1Z25A 1NK7A 3K5OA 5JVHL 2P9IA 4J2AA 1HRHA 3L2UA 5CZ1A 3O9QA 1S72N 4CJUA 2YJFA 3T1AA 3VGKA 4KI4A 4R5PA 2YNHA 3DLKA 3QFPA 3ENBA 1HNZK 2W40A 4F8RA 4W5QA 1FW6A 2ITMA 4FJNA 4KBOA 3BDPA 1Y64A 4PQUA 3SBTA 3CCVN 1IKXA 3C6HA 1ZBIA 1WSEA 2WTUA 2ZM6K 4WQ4C 3A2FA 4C8NA 3FLCO 3CPWM 3QETA 3NVMA 5AR0A 1ZBHA 1YVUA 1KVCA 2HB5A 1RFQA 5BPMA 4JHDA 2D0AA 3HI0A 3WQUA 3P38A 4GVEA 4DHYA 2O8CA 1TYQB 4KHSA 5AQVA 3THYA 1X1PA 4NYNA 5C15A 1B92A 4Y0WA 3H45C 3MN9A 1S1TA 3O9SA 3M5RA 3E9OA 1L3UA 3T1HK 4CFAA 5F2RA 2HHQA 5FPNA 4CF8A 1TKTA 4CEDA 4JN4A 4BRKA 5D3GA 3CJ1A 1U47A 2P51A 1Q81O 1B9FA 4M3RA 2E4LA 1S6PA 4DR6K 4WFBL 3D45A 4B1WB 3UIQA 4FWMA 5AQUA 5M1NA 5KTQA 3PSFA 3LL3A 2OTJN 3MK6A 4XH1A 4JKHA 4CJKA 4KI6A 2NLXA 1ASUA 4ISFA 4ZTJA 4RG8A 1DT9A 1W7AA 3G4SN 2ZF5O 2IVOA 1TVRA 5LL6Z 4I6MB 3A5OC 3JXUA 3J7ZO 4DQRA 4DF8A 3AVHA 5BRHA 4C8MA 4JI1K 3ASMA 1RNHA 2G8HA 1WSFA 3N4QA 1S22A 2I5JA 1OKJA 3SLCA 2YX6A 4K0KK 3DLEA 2ASOA 5AQNA 1C1AA 2NRWA 2Z1HA 3DYAA 3J7AP 1QQNA 3VPZA 4HUFA 4FLUA 3ENHA 2KHOA 4M3WA 4W5RA 4CJEA 5AQZA 2D0CA 5AQGA 2HHSA 3VQ9A 3EE9A 4CHOA 2NNWA 3IS9A 4DF4A 4DR2K 5FLXO 4Z4EA 1T7PA 1HJOA 3DRSA 4XH4A 3MX2A 4BR2A 1U2VA 5FDLA 1YUWA 2HBJA 4KV8A 1NGHA 4Z4HA 1OVYA 2NRTA 3E01A 3ZEUB
chains in the Genus database with same CATH topology
1RT7A 1CXQA 1C0UA 3LP3A 4CJVA 1B9DA 1I3AA 2P1JA 1BQMA 3P5JA 4I7FA 3O3FA 3RMCA 1NJZA 1X9WA 1T8EA 5CY4A 2OZMA 4I2QA 3DI6A 1Q8IA 3S9HA 1CXUA 4N56A 4N76A 4OPKA 4M3XA 4FW1A 4KFBA 2OA8A 3TAPA 4CFBA 1LW2A 4FCYA 1JLQA 4CGDA 4EP4A 3OY9A 5FROA 1NJWA 4FM1A 3O4NA 3SV4A 1NK9A 4EZ6A 1EXQA 3HVRA 4FK0A 3V9UA 4E7HA 1SKWA 4W5OA 3QNNA 4LH4A 1XWLA 2WONA 1TK0A 3I0RA 4O0IA 3HP9A 2PYLA 3HK2A 4KTQA 4FLXA 3DLRA 1BGXT 2X6NA 5CYMA 3M8PA 3SI6A 2DY4A 3MEGA 1S1XA 2VG6A 4HHTA 4DTOA 3OS2A 3CFPA 1Q9YA 3WNHA 4PUOA 1JLEA 3QEVA 1JLFA 4IG0A 1LV5A 3DM2A 3AVCA 3MECA 1RDDA 2IAJA 4F3TA 2DFEA 4KHQA 4I9LA 2DFFA 4I2PA 4CFDA 3OYLA 5J2PA 5J2MA 2KW4A 3MEEA 3EYZA 3DRPA 4MFBA 4IFVA 1WN7A 1NK4A 1HQUA 1NJYA 1X9MA 1QSSA 1S1VA 1RT4A 1TL1A 3V81A 1XC9A 4DSIA 1J53A 3HT3A 4CHYA 4Z4FA 1BI4B 4FJ5A 4CEEA 1C6VA 3OYFA 3M8SA 3KKSA 1A5VA 2GUIA 4E7JA 3T3FA 3MAQA 2OPSA 4H4OA 4F2RA 1J54A 3K58A 4OPJA 5SZTA 3TAFA 4BE1A 4F2SA 3KTQA 2HHTA 3ZSQA 4CK1A 3VQCA 1HPZA 3TANA 4CEQA 3HYFA 4BE0A 3NF9A 3QLHA 4CIFA 4DG1A 1FXXA 3G10A 1RCHA 5HRRA 2G8WA 4FLTA 4HTUA 2HVIA 1TAUA 3SZ2A 1L3SA 4CJTA 4RW8A 3HO1A 2O4IA 3K2PA 1NKCA 4CCHA 3C6UA 4CE9A 4FJJA 3LZIA 4IG3A 3CFOA 2RF2A 2B6AA 2ZD1A 4CJSA 3OYBA 4CEAA 3K57A 1RBTA 4DFPA 4PWDA 4HCBA 3OYKA 3QEPA 3SQ1A 4YNQA 4BWJA 4DTRA 2QKBA 4ID1A 4CF0A 1TGOA 2XO7A 1X9SA 1VSLA 1J5OA 4Y1DA 3V1OA 2QXFA 4N5SA 4F3OA 1WSHA 1JLAA 3IG1A 4KRFA 2X6SA 1VRUA 3ZSYA 3L2WA 4FM2A 4DTSA 4B9TA 2G8KA 3HSTB 4CHQA 1QHTA 3NH1A 4OVLA 4OJRA 3TAMA 3PX4A 3RR7A 1XI1A 2B5JA 1KRPA 4KI4A 4CESA 1RDBA 4LY7A 1NKBA 3AA3A 5J2QA 1LWEA 4BE2A 4F4KA 3VQPA 1BCOA 4DU4A 4JRQA 2RN2A 1KLMA 1SUQA 3P1GA 3C94A 4DS4A 3WNFA 3SV3A 4DTUA 5HP1A 3TI0A 4KHNA 3AVMA 3TWHA 2YNGA 1ZYQA 3ITHA 3KLHA 5HLFA 1RDAA 2G8VA 2XY6A 2YKMA 3VQDA 2F8SA 5HRPA 3PV8A 4NYFA 1REVA 2DFHA 2JGUA 5SWMA 5I3UA 1UAXA 3U3YA 1CLQA 4DTMA 2D0BA 4CJ4A 1KFDA 1U49A 3IRXA 4AHTA 3O3HA 3OYEA 1TV6A 3ZSOA 1TK8A 2ZQBA 1KFSA 3SQ0A 4CHPA 1NK8A 3HXMA 3QEIA 5HBMA 3VQ5A 4YFUA 5D3GA 5JS1A 3VA0A 1QSYA 3AVAA 3ZSRA 2YHAA 3L2RA 4FLYA 3AVJA 3F73A 1VSJA 2KZMA 2ITGA 3NF7A 4KPYA 4OLBA 4DSJA 3LAKA 1U04A 1C1BA 3HVTA 5KRTA 3RTVA 4FLZA 4B9MA 4EZ9A 4Q0BA 4L8RB 1JKHA 4Z4IA 1HYSA 5J2NA 4FJMA 2FC0A 3OYAA 4DQPA 1U48A 4DFMA 3AO4A 4N47A 4AHUA 3MEDA 4CK2A 4J2DA 2HHXA 4FM0A 2IS3A 4DSFA 4DTNA 3LANA 4H4MA 4E89A 1RTIA 2YV0X 4M3YA 4QOZB 3HPHA 3C6TA 2Q3SA 4LSLA 1BL3A 4CGIA 3ULDA 1BIZA 3SYZA 1U4BA 4FJLA 5J1EA 4NCAA 4M3ZA 1RT2A 4JS4A 4CF2A 2Z1GA 2GV9A 1JXBA 3V1RA 2PYJA 3L8BA 4CF9A 3U6FA 1BIUA 4OGCA 5EU7A 1BCMA 4O4GA 3VQBA 4BACA 3PO4A 4EP5A 3NF6A 3K5NA 1S1UA 3VQEA 1JL1A 4M41A 4RW6A 1JXEA 3T19A 2HNZA 4JS5A 5K14A 3MXMA 1MU2A 1WSGA 1XHZA 3NDKA 1L5UA 2DTUA 3NE6A 3LZJA 4DU1A 1N5YA 1LAVA 4CFCA 4KHYA 4CJ3A 4C8KA 2IDOA 2HHUA 4B9VA 3I8DA 4DFJA 3PY8A 4CGFA 1IKVA 3LAMA 4OKKA 4FJGA 4AH9A 4B3OA 3DLHA 1VSMA 4GW6A 3QO9A 3B6PA 5HRSA 3SUOA 3JSMA 4H8KA 3CM5A 4CEFA 4BDYA 4ELVA 4IDKA 4PA1A 3RRHA 5DK5A 2A1RA 2NUBA 3NH0A 4FLVA 4DTPA 4KB0A 3TAQA 3VA3A 3KIOA 3QINA 3AO1A 5DMRA 4CJRA 4FJ8A 4FYDA 1FK9A 2AJQA 2OPPA 1S5JA 3KKRA 4HVJA 1HMVA 5KGXA 2R7YA 4CF1A 1WNSA 3KK1A 3TAGA 4N41A 4IBNA 4CJLA 3V9XA 1UA1A 1IG9A 2HHVA 4E1NA 3CM6A 3AA2A 3DLBA 3FFIA 1D8YA 3ISNC 3NGYA 3OYNA 3SNNA 4CJ5A 3LP2A 4B9LA 1LWCA 1ITGA 2A1SA 3THVA 4KHWA 3LP1A 1EETA 4B8AB 2RKIA 3RMBA 4BDPA 4KHUA 4AHVA 1S6QA 4K8ZA 4CJPA 2W42A 1IKYA 1KVAA 2OPRA 3DOLA 4RW7A 5I42A 4ELTA 2O4GA 3LWMA 4TSXA 3PX0A 3SUQA 4Z0UA 1RBRA 4E1MA 3HL8A 4DQIA 4I9QA 1VRTA 4DQQA 3V9WA 3PX6A 4HCCA 1QE1A 2XHBA 1VSEA 1NOZA 3OYDA 4FJ7A 3AO3A 4K8XA 1K6YA 2EHGA 3AVGA 3S3OA 1L3TA 3SUPA 2YNFA 5JS2A 4LSNA 1SL1A 4CHZA 4DQSA 1FKOA 4FZZA 1R0AA 4W5NA 1JL2A 1WSIA 5T7BA 5FRNA 3M8RA 3AVLA 4FVMA 4KREA 1SL0A 1A5XA 3OYGA 2P5GA 4GMJB 4GVMA 1J9AA 4AILC 1Y97A 1Z26A 3SJJA 4KTZA 4B9SA 3CG7A 1C1CA 1RDCA 3KJVA 5KGWA 4UQGA 1WAFA 4JRPA 3AA4A 4FLWA 1EKEA 4JLHA 1TK5A 1SKRA 1QSLA 3ZSXA 2FBYA 4CGGA 4DLGA 3VQAA 5HROA 1ZBFA 4E3SA 3OYIA 3ZCMA 1VSKA 3V9ZA 1LW0A 4MQ3A 3MXIA 5C42A 1RTHA 2HNDA 4DTXA 3LPTA 3SUNA 3TARA 1A5WA 1TKDA 3IAYA 2XRIA 3I0SA 1ASWA 3DRRA 3BGRA 2PZSA 4AHCA 3RMAA 1NK6A 3M8QA 4O55A 4RW4A 3ZSWA 1KTQA 4FJXA 2KTQA 1HJRA 3OVNA 1S1WA 2E6LA 5C25A 4NCBA 3DOKA 1C0MA 1RBSA 3V1QA 4CIEA 3EZ5A 3VQ4A 3CQ8A 3HPGA 4NCGA 5CZ2A 4DTJA 2E6MA 3AVKA 4CGJA 3NBPA 1WSJA 1JLBA 1GOBA 2Z1IA 4B9UA 1VSDA 1TKZA 2ETJA 2D5RA 2EX3A 4OLAA 2YHBA 4CEBA 4KAZA 4E7KA 4FJHA 1HQEA 2VG7A 1T03A 3RWUA 1O1WA 1G15A 3S3MA 3H08A 3SQ4A 3VN5A 2YKNA 2YNIA 1UA0A 1XHXA 1IKWA 2HW3A 1VSFA 3G0ZA 4WE1A 1Z25A 1NK7A 3K5OA 4FJKA 1UWBA 4FK2A 4CHNA 4J2AA 1KSPA 4HUGA 1NKEA 1L3UA 1HRHA 2X74A 4OGEA 1C0TA 3L2UA 5CZ1A 2RPIA 3NFAA 3SPZA 2KFZA 4CJUA 2HMIA 3O3GA 3T1AA 3NCIA 2X78A 2VWKA 5KRSA 1RT5A 2YNHA 3DLKA 4R5PA 1SL2A 2PY5A 4FZXC 1IH7A 4CEOA 5HRNA 2QK9A 3KK3A 4F8RA 4W5QA 2OPQA 2ZE2A 2VG5A 4Y1CA 4FJNA 1Q9XA 3BDPA 4PQUA 4O5BA 2P5OA 4B8CA 3VQ8A 4M42A 1IKXA 1ZBIA 3SPYA 1WSEA 3TABA 1S9GA 4CGHA 2Y1JA 3L3UA 3OYCA 3A2FA 2IOCA 4C8NA 1RBVA 4O0JA 3QETA 3MXJA 4CJWA 1ZBHA 4OKJA 3LP0A 3QNOA 1YVUA 1QQCA 3NGIA 4E7IA 3DLGA 2BDPA 1KVCA 2HB5A 3ZT3A 2OZSA 1HYVA 2Z1JA 5KI6A 4AHRA 4DSEA 2D0AA 1W9HA 2HHWA 3SQ2A 1QTMA 1VSIA 4KHSA 3HM9A 3QEWA 2KZZA 1U45A 1RT3A 1X1PA 4NYNA 1B92A 2ATQA 1GOCA 4FZYA 1GOAA 2BANA 1ASVA 1BISA 2HNYA 1S1TA 4FXDA 4CERA 1W0HA 3OJSA 4DLEA 1LAWA 2KQ2A 2F8TA 3AV9A 3K59A 2WOMA 3DMJA 1NK5A 3WNEA 3O4QA 1WAJA 3JYTA 4KO0A 4BDZA 1LWFA 2XY8A 1UOCA 3ZSZA 4AHSA 2FBTA 3NH2A 3OYHA 3HP6A 3D0PA 4DFKA 1L3VA 3KLGA 4CFAA 3QIOA 2VWJA 4O44A 4FJ9A 3KD1E 1KCFA 1DTTA 4PY5A 2HHQA 4CF8A 3OYJA 1TKTA 4KB1A 2IGIA 3QEXA 4CEDA 4CJFA 4DS5A 3NF8A 1FKPA 4DU3A 3EY1A 3LWLA 3NAEA 3C95A 3QERA 4M3UA 4RW9A 2F96A 3HPOA 3CFRA 2FBVA 3ZT4A 1NJXA 3B6OA 3V4IA 1U47A 3AVNA 2P51A 3ZT1A 1ZBUA 3AVBA 1B9FA 3AVFA 4E19A 4M3RA 2G8FA 2E4LA 1S6PA 4DSLA 3U3GA 3D45A 4OKEA 3V6DA 4C8OA 3UIQA 3LALA 3HJFA 4B08A 4DWIA 3KK2A 1RTDA 4C8LA 1TKXA 3L2VA 2XY7A 2G8UA 1D5AA 4CK3A 1YTAA 3PO5A 1WLJA 5KTQA 1EP4A 4KTWA 1ZBLA 1HNIA 4CJKA 3NGZA 4KI6A 4HUEA 1SV5A 5CYQA 4J2EA 1HYZA 1ASUA 4ZTJA 4E7LA 4RG8A 2OYQA 1I39A 3QIPA 3LDSA 2Y1IA 1QS4A 1BI4A 4Q5VA 1DTQA 4FJIA 1NOYA 1F21A 4DMNA 1D9FA 3RRGA 1KVBA 3AO2A 3KLIA 1TVRA 4CIGA 4CJQA 1RTJA 5E41A 3OJUA 2LSNA 3K5LA 3S3NA 3OS1A 1BHLA 4DQRA 1VK0A 3L3VA 3AVHA 4DF8A 1VSHA 1NK0A 3ZT0A 3V9SA 3F9KA 4Z4GA 5C24A 4C8MA 4DSKA 3ASMA 4CECA 1RNHA 3L2QA 3SCXA 2G8HA 3WNGA 1SKSA 4M3TA 2KFNA 3RR8A 1WSFA 1TAQA 3ZSVA 3QESA 2I5JA 3VQQA 1HNVA 4CEZA 4XIUA 1EX4A 2IC3A 4J2BA 1IO2A 1BQNA 3DLEA 2GBZA 3K5MA 1C1AA 2Z1HA 3DYAA 4KKOA 2XY5A 4ZTFA 3PUFA 4HUFA 4FW2A 4LD0A 4LH5A 4Z4CA 4FLUA 1N6QA 4BWMA 4W5TA 2FBXA 2HVHA 4ID5A 4M3WA 3KD5E 4FK4A 4W5RA 3AO5A 4CJEA 1DLOA 2QKKA 3CYMA 2G8IA 4IKFA 2BGGA 4ICLA 4G1QA 3VQ6A 3NHGA 1YTUA 2D0CA 5FRMA 1CZBA 2BE2A 3VQ9A 4CHOA 2HHSA 1JLCA 1D9DA 3IS9A 3TAEA 4IFYA 4DF4A 4Z4EA 1JLGA 1KLNA 1T7PA 3AA5X 3AVIA 3DRSA 3RMDA 3KLFA 1YT3A 3VQ7A 3OS0A 3OYMA 1TL3A 3ALYA 5FDLA 1T05A 1RT6A 4B9NA 3P83D 3KLEA 1CZ9A 3ZT2A 4ZHRA 4KV8A 3TR8A 4M45A 4QCLA 4ELUA 1S9EA 4E0DA 4Z4HA 1RILA 4QAGA 1RBUA 3E01A 2B4JA 1RT1A 3LPUA 2JLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RT7 A;  1CXQ A;  1C0U A;  3LP3 A;  4CJV A;  1B9D A;  1I3A A;  2P1J A;  1BQM A;  3P5J A;  4I7F A;  3O3F A;  3RMC A;  1NJZ A;  1X9W A;  1T8E A;  5CY4 A;  2OZM A;  4I2Q A;  3DI6 A;  1Q8I A;  3S9H A;  1CXU A;  4N56 A;  4N76 A;  4OPK A;  4M3X A;  4FW1 A;  4KFB A;  2OA8 A;  3TAP A;  4CFB A;  1LW2 A;  4FCY A;  1JLQ A;  4CGD A;  4EP4 A;  3OY9 A;  5FRO A;  1NJW A;  4FM1 A;  3O4N A;  3SV4 A;  1NK9 A;  4EZ6 A;  1EXQ A;  3HVR A;  4FK0 A;  3V9U A;  4E7H A;  1SKW A;  4W5O A;  3QNN A;  4LH4 A;  1XWL A;  2WON A;  1TK0 A;  3I0R A;  4O0I A;  3HP9 A;  2PYL A;  3HK2 A;  4KTQ A;  4FLX A;  3DLR A;  1BGX T;  2X6N A;  5CYM A;  3M8P A;  3SI6 A;  2DY4 A;  3MEG A;  1S1X A;  2VG6 A;  4HHT A;  4DTO A;  3OS2 A;  3CFP A;  1Q9Y A;  3WNH A;  4PUO A;  1JLE A;  3QEV A;  1JLF A;  4IG0 A;  1LV5 A;  3DM2 A;  3AVC A;  3MEC A;  1RDD A;  2IAJ A;  4F3T A;  2DFE A;  4KHQ A;  4I9L A;  2DFF A;  4I2P A;  4CFD A;  3OYL A;  5J2P A;  5J2M A;  2KW4 A;  3MEE A;  3EYZ A;  3DRP A;  4MFB A;  4IFV A;  1WN7 A;  1NK4 A;  1HQU A;  1NJY A;  1X9M A;  1QSS A;  1S1V A;  1RT4 A;  1TL1 A;  3V81 A;  1XC9 A;  4DSI A;  1J53 A;  3HT3 A;  4CHY A;  4Z4F A;  1BI4 B;  4FJ5 A;  4CEE A;  1C6V A;  3OYF A;  3M8S A;  3KKS A;  1A5V A;  2GUI A;  4E7J A;  3T3F A;  3MAQ A;  2OPS A;  4H4O A;  4F2R A;  1J54 A;  3K58 A;  4OPJ A;  5SZT A;  3TAF A;  4BE1 A;  4F2S A;  3KTQ A;  2HHT A;  3ZSQ A;  4CK1 A;  3VQC A;  1HPZ A;  3TAN A;  4CEQ A;  3HYF A;  4BE0 A;  3NF9 A;  3QLH A;  4CIF A;  4DG1 A;  1FXX A;  3G10 A;  1RCH A;  5HRR A;  2G8W A;  4FLT A;  4HTU A;  2HVI A;  1TAU A;  3SZ2 A;  1L3S A;  4CJT A;  4RW8 A;  3HO1 A;  2O4I A;  3K2P A;  1NKC A;  4CCH A;  3C6U A;  4CE9 A;  4FJJ A;  3LZI A;  4IG3 A;  3CFO A;  2RF2 A;  2B6A A;  2ZD1 A;  4CJS A;  3OYB A;  4CEA A;  3K57 A;  1RBT A;  4DFP A;  4PWD A;  4HCB A;  3OYK A;  3QEP A;  3SQ1 A;  4YNQ A;  4BWJ A;  4DTR A;  2QKB A;  4ID1 A;  4CF0 A;  1TGO A;  2XO7 A;  1X9S A;  1VSL A;  1J5O A;  4Y1D A;  3V1O A;  2QXF A;  4N5S A;  4F3O A;  1WSH A;  1JLA A;  3IG1 A;  4KRF A;  2X6S A;  1VRU A;  3ZSY A;  3L2W A;  4FM2 A;  4DTS A;  4B9T A;  2G8K A;  3HST B;  4CHQ A;  1QHT A;  3NH1 A;  4OVL A;  4OJR A;  3TAM A;  3PX4 A;  3RR7 A;  1XI1 A;  2B5J A;  1KRP A;  4KI4 A;  4CES A;  1RDB A;  4LY7 A;  1NKB A;  3AA3 A;  5J2Q A;  1LWE A;  4BE2 A;  4F4K A;  3VQP A;  1BCO A;  4DU4 A;  4JRQ A;  2RN2 A;  1KLM A;  1SUQ A;  3P1G A;  3C94 A;  4DS4 A;  3WNF A;  3SV3 A;  4DTU A;  5HP1 A;  3TI0 A;  4KHN A;  3AVM A;  3TWH A;  2YNG A;  1ZYQ A;  3ITH A;  3KLH A;  5HLF A;  1RDA A;  2G8V A;  2XY6 A;  2YKM A;  3VQD A;  2F8S A;  5HRP A;  3PV8 A;  4NYF A;  1REV A;  2DFH A;  2JGU A;  5SWM A;  5I3U A;  1UAX A;  3U3Y A;  1CLQ A;  4DTM A;  2D0B A;  4CJ4 A;  1KFD A;  1U49 A;  3IRX A;  4AHT A;  3O3H A;  3OYE A;  1TV6 A;  3ZSO A;  1TK8 A;  2ZQB A;  1KFS A;  3SQ0 A;  4CHP A;  1NK8 A;  3HXM A;  3QEI A;  5HBM A;  3VQ5 A;  4YFU A;  5D3G A;  5JS1 A;  3VA0 A;  1QSY A;  3AVA A;  3ZSR A;  2YHA A;  3L2R A;  4FLY A;  3AVJ A;  3F73 A;  1VSJ A;  2KZM A;  2ITG A;  3NF7 A;  4KPY A;  4OLB A;  4DSJ A;  3LAK A;  1U04 A;  1C1B A;  3HVT A;  5KRT A;  3RTV A;  4FLZ A;  4B9M A;  4EZ9 A;  4Q0B A;  4L8R B;  1JKH A;  4Z4I A;  1HYS A;  5J2N A;  4FJM A;  2FC0 A;  3OYA A;  4DQP A;  1U48 A;  4DFM A;  3AO4 A;  4N47 A;  4AHU A;  3MED A;  4CK2 A;  4J2D A;  2HHX A;  4FM0 A;  2IS3 A;  4DSF A;  4DTN A;  3LAN A;  4H4M A;  4E89 A;  1RTI A;  2YV0 X;  4M3Y A;  4QOZ B;  3HPH A;  3C6T A;  2Q3S A;  4LSL A;  1BL3 A;  4CGI A;  3ULD A;  1BIZ A;  3SYZ A;  1U4B A;  4FJL A;  5J1E A;  4NCA A;  4M3Z A;  1RT2 A;  4JS4 A;  4CF2 A;  2Z1G A;  2GV9 A;  1JXB A;  3V1R A;  2PYJ A;  3L8B A;  4CF9 A;  3U6F A;  1BIU A;  4OGC A;  5EU7 A;  1BCM A;  4O4G A;  3VQB A;  4BAC A;  3PO4 A;  4EP5 A;  3NF6 A;  3K5N A;  1S1U A;  3VQE A;  1JL1 A;  4M41 A;  4RW6 A;  1JXE A;  3T19 A;  2HNZ A;  4JS5 A;  5K14 A;  3MXM A;  1MU2 A;  1WSG A;  1XHZ A;  3NDK A;  1L5U A;  2DTU A;  3NE6 A;  3LZJ A;  4DU1 A;  1N5Y A;  1LAV A;  4CFC A;  4KHY A;  4CJ3 A;  4C8K A;  2IDO A;  2HHU A;  4B9V A;  3I8D A;  4DFJ A;  3PY8 A;  4CGF A;  1IKV A;  3LAM A;  4OKK A;  4FJG A;  4AH9 A;  4B3O A;  3DLH A;  1VSM A;  4GW6 A;  3QO9 A;  3B6P A;  5HRS A;  3SUO A;  3JSM A;  4H8K A;  3CM5 A;  4CEF A;  4BDY A;  4ELV A;  4IDK A;  4PA1 A;  3RRH A;  5DK5 A;  2A1R A;  2NUB A;  3NH0 A;  4FLV A;  4DTP A;  4KB0 A;  3TAQ A;  3VA3 A;  3KIO A;  3QIN A;  3AO1 A;  5DMR A;  4CJR A;  4FJ8 A;  4FYD A;  1FK9 A;  2AJQ A;  2OPP A;  1S5J A;  3KKR A;  4HVJ A;  1HMV A;  5KGX A;  2R7Y A;  4CF1 A;  1WNS A;  3KK1 A;  3TAG A;  4N41 A;  4IBN A;  4CJL A;  3V9X A;  1UA1 A;  1IG9 A;  2HHV A;  4E1N A;  3CM6 A;  3AA2 A;  3DLB A;  3FFI A;  1D8Y A;  3ISN C;  3NGY A;  3OYN A;  3SNN A;  4CJ5 A;  3LP2 A;  4B9L A;  1LWC A;  1ITG A;  2A1S A;  3THV A;  4KHW A;  3LP1 A;  1EET A;  4B8A B;  2RKI A;  3RMB A;  4BDP A;  4KHU A;  4AHV A;  1S6Q A;  4K8Z A;  4CJP A;  2W42 A;  1IKY A;  1KVA A;  2OPR A;  3DOL A;  4RW7 A;  5I42 A;  4ELT A;  2O4G A;  3LWM A;  4TSX A;  3PX0 A;  3SUQ A;  4Z0U A;  1RBR A;  4E1M A;  3HL8 A;  4DQI A;  4I9Q A;  1VRT A;  4DQQ A;  3V9W A;  3PX6 A;  4HCC A;  1QE1 A;  2XHB A;  1VSE A;  1NOZ A;  3OYD A;  4FJ7 A;  3AO3 A;  4K8X A;  1K6Y A;  2EHG A;  3AVG A;  3S3O A;  1L3T A;  3SUP A;  2YNF A;  5JS2 A;  4LSN A;  1SL1 A;  4CHZ A;  4DQS A;  1FKO A;  4FZZ A;  1R0A A;  4W5N A;  1JL2 A;  1WSI A;  5T7B A;  5FRN A;  3M8R A;  3AVL A;  4FVM A;  4KRE A;  1SL0 A;  1A5X A;  3OYG A;  2P5G A;  4GMJ B;  4GVM A;  1J9A A;  4AIL C;  1Y97 A;  1Z26 A;  3SJJ A;  4KTZ A;  4B9S A;  3CG7 A;  1C1C A;  1RDC A;  3KJV A;  5KGW A;  4UQG A;  1WAF A;  4JRP A;  3AA4 A;  4FLW A;  1EKE A;  4JLH A;  1TK5 A;  1SKR A;  1QSL A;  3ZSX A;  2FBY A;  4CGG A;  4DLG A;  3VQA A;  5HRO A;  1ZBF A;  4E3S A;  3OYI A;  3ZCM A;  1VSK A;  3V9Z A;  1LW0 A;  4MQ3 A;  3MXI A;  5C42 A;  1RTH A;  2HND A;  4DTX A;  3LPT A;  3SUN A;  3TAR A;  1A5W A;  1TKD A;  3IAY A;  2XRI A;  3I0S A;  1ASW A;  3DRR A;  3BGR A;  2PZS A;  4AHC A;  3RMA A;  1NK6 A;  3M8Q A;  4O55 A;  4RW4 A;  3ZSW A;  1KTQ A;  4FJX A;  2KTQ A;  1HJR A;  3OVN A;  1S1W A;  2E6L A;  5C25 A;  4NCB A;  3DOK A;  1C0M A;  1RBS A;  3V1Q A;  4CIE A;  3EZ5 A;  3VQ4 A;  3CQ8 A;  3HPG A;  4NCG A;  5CZ2 A;  4DTJ A;  2E6M A;  3AVK A;  4CGJ A;  3NBP A;  1WSJ A;  1JLB A;  1GOB A;  2Z1I A;  4B9U A;  1VSD A;  1TKZ A;  2ETJ A;  2D5R A;  2EX3 A;  4OLA A;  2YHB A;  4CEB A;  4KAZ A;  4E7K A;  4FJH A;  1HQE A;  2VG7 A;  1T03 A;  3RWU A;  1O1W A;  1G15 A;  3S3M A;  3H08 A;  3SQ4 A;  3VN5 A;  2YKN A;  2YNI A;  1UA0 A;  1XHX A;  1IKW A;  2HW3 A;  1VSF A;  3G0Z A;  4WE1 A;  1Z25 A;  1NK7 A;  3K5O A;  4FJK A;  1UWB A;  4FK2 A;  4CHN A;  4J2A A;  1KSP A;  4HUG A;  1NKE A;  1L3U A;  1HRH A;  2X74 A;  4OGE A;  1C0T A;  3L2U A;  5CZ1 A;  2RPI A;  3NFA A;  3SPZ A;  2KFZ A;  4CJU A;  2HMI A;  3O3G A;  3T1A A;  3NCI A;  2X78 A;  2VWK A;  5KRS A;  1RT5 A;  2YNH A;  3DLK A;  4R5P A;  1SL2 A;  2PY5 A;  4FZX C;  1IH7 A;  4CEO A;  5HRN A;  2QK9 A;  3KK3 A;  4F8R A;  4W5Q A;  2OPQ A;  2ZE2 A;  2VG5 A;  4Y1C A;  4FJN A;  1Q9X A;  3BDP A;  4PQU A;  4O5B A;  2P5O A;  4B8C A;  3VQ8 A;  4M42 A;  1IKX A;  1ZBI A;  3SPY A;  1WSE A;  3TAB A;  1S9G A;  4CGH A;  2Y1J A;  3L3U A;  3OYC A;  3A2F A;  2IOC A;  4C8N A;  1RBV A;  4O0J A;  3QET A;  3MXJ A;  4CJW A;  1ZBH A;  4OKJ A;  3LP0 A;  3QNO A;  1YVU A;  1QQC A;  3NGI A;  4E7I A;  3DLG A;  2BDP A;  1KVC A;  2HB5 A;  3ZT3 A;  2OZS A;  1HYV A;  2Z1J A;  5KI6 A;  4AHR A;  4DSE A;  2D0A A;  1W9H A;  2HHW A;  3SQ2 A;  1QTM A;  1VSI A;  4KHS A;  3HM9 A;  3QEW A;  2KZZ A;  1U45 A;  1RT3 A;  1X1P A;  4NYN A;  1B92 A;  2ATQ A;  1GOC A;  4FZY A;  1GOA A;  2BAN A;  1ASV A;  1BIS A;  2HNY A;  1S1T A;  4FXD A;  4CER A;  1W0H A;  3OJS A;  4DLE A;  1LAW A;  2KQ2 A;  2F8T A;  3AV9 A;  3K59 A;  2WOM A;  3DMJ A;  1NK5 A;  3WNE A;  3O4Q A;  1WAJ A;  3JYT A;  4KO0 A;  4BDZ A;  1LWF A;  2XY8 A;  1UOC A;  3ZSZ A;  4AHS A;  2FBT A;  3NH2 A;  3OYH A;  3HP6 A;  3D0P A;  4DFK A;  1L3V A;  3KLG A;  4CFA A;  3QIO A;  2VWJ A;  4O44 A;  4FJ9 A;  3KD1 E;  1KCF A;  1DTT A;  4PY5 A;  2HHQ A;  4CF8 A;  3OYJ A;  1TKT A;  4KB1 A;  2IGI A;  3QEX A;  4CED A;  4CJF A;  4DS5 A;  3NF8 A;  1FKP A;  4DU3 A;  3EY1 A;  3LWL A;  3NAE A;  3C95 A;  3QER A;  4M3U A;  4RW9 A;  2F96 A;  3HPO A;  3CFR A;  2FBV A;  3ZT4 A;  1NJX A;  3B6O A;  3V4I A;  1U47 A;  3AVN A;  2P51 A;  3ZT1 A;  1ZBU A;  3AVB A;  1B9F A;  3AVF A;  4E19 A;  4M3R A;  2G8F A;  2E4L A;  1S6P A;  4DSL A;  3U3G A;  3D45 A;  4OKE A;  3V6D A;  4C8O A;  3UIQ A;  3LAL A;  3HJF A;  4B08 A;  4DWI A;  3KK2 A;  1RTD A;  4C8L A;  1TKX A;  3L2V A;  2XY7 A;  2G8U A;  1D5A A;  4CK3 A;  1YTA A;  3PO5 A;  1WLJ A;  5KTQ A;  1EP4 A;  4KTW A;  1ZBL A;  1HNI A;  4CJK A;  3NGZ A;  4KI6 A;  4HUE A;  1SV5 A;  5CYQ A;  4J2E A;  1HYZ A;  1ASU A;  4ZTJ A;  4E7L A;  4RG8 A;  2OYQ A;  1I39 A;  3QIP A;  3LDS A;  2Y1I A;  1QS4 A;  1BI4 A;  4Q5V A;  1DTQ A;  4FJI A;  1NOY A;  1F21 A;  4DMN A;  1D9F A;  3RRG A;  1KVB A;  3AO2 A;  3KLI A;  1TVR A;  4CIG A;  4CJQ A;  1RTJ A;  5E41 A;  3OJU A;  2LSN A;  3K5L A;  3S3N A;  3OS1 A;  1BHL A;  4DQR A;  1VK0 A;  3L3V A;  3AVH A;  4DF8 A;  1VSH A;  1NK0 A;  3ZT0 A;  3V9S A;  3F9K A;  4Z4G A;  5C24 A;  4C8M A;  4DSK A;  3ASM A;  4CEC A;  1RNH A;  3L2Q A;  3SCX A;  2G8H A;  3WNG A;  1SKS A;  4M3T A;  2KFN A;  3RR8 A;  1WSF A;  1TAQ A;  3ZSV A;  3QES A;  2I5J A;  3VQQ A;  1HNV A;  4CEZ A;  4XIU A;  1EX4 A;  2IC3 A;  4J2B A;  1IO2 A;  1BQN A;  3DLE A;  2GBZ A;  3K5M A;  1C1A A;  2Z1H A;  3DYA A;  4KKO A;  2XY5 A;  4ZTF A;  3PUF A;  4HUF A;  4FW2 A;  4LD0 A;  4LH5 A;  4Z4C A;  4FLU A;  1N6Q A;  4BWM A;  4W5T A;  2FBX A;  2HVH A;  4ID5 A;  4M3W A;  3KD5 E;  4FK4 A;  4W5R A;  3AO5 A;  4CJE A;  1DLO A;  2QKK A;  3CYM A;  2G8I A;  4IKF A;  2BGG A;  4ICL A;  4G1Q A;  3VQ6 A;  3NHG A;  1YTU A;  2D0C A;  5FRM A;  1CZB A;  2BE2 A;  3VQ9 A;  4CHO A;  2HHS A;  1JLC A;  1D9D A;  3IS9 A;  3TAE A;  4IFY A;  4DF4 A;  4Z4E A;  1JLG A;  1KLN A;  1T7P A;  3AA5 X;  3AVI A;  3DRS A;  3RMD A;  3KLF A;  1YT3 A;  3VQ7 A;  3OS0 A;  3OYM A;  1TL3 A;  3ALY A;  5FDL A;  1T05 A;  1RT6 A;  4B9N A;  3P83 D;  3KLE A;  1CZ9 A;  3ZT2 A;  4ZHR A;  4KV8 A;  3TR8 A;  4M45 A;  4QCL A;  4ELU A;  1S9E A;  4E0D A;  4Z4H A;  1RIL A;  4QAG A;  1RBU A;  3E01 A;  2B4J A;  1RT1 A;  3LPU A;  2JLE A; 
#chains in the Genus database with same CATH topology
 1B9D A;  1I3A A;  1NJZ A;  4E1J A;  1YI2 N;  1X9W A;  3VF2 A;  2A6A A;  1Q8I A;  3S9H A;  2A42 A;  5LJV A;  3O1B A;  4FWS A;  4FCY A;  1JLQ A;  3BF3 A;  4CGD A;  3OY9 A;  1NJW A;  4CZL A;  3SV4 A;  4O8K A;  3V9U A;  1SKW A;  4W5O A;  3QNN A;  4LH4 A;  1XWL A;  2WON A;  1TK0 A;  3D6R A;  4YOX A;  3MCP A;  3HK2 A;  5I9E B;  5CYM A;  1S1X A;  2F7T A;  5AQL A;  4BRD A;  4BG8 A;  2Q97 A;  1GLD G;  2E2P A;  3DM2 A;  3I55 N;  2YCH A;  4F3T A;  2IVP A;  3CC7 N;  2CGK A;  3BEX A;  3A8Y A;  4MFB A;  1HQU A;  4A62 A;  1QSS A;  1XC9 A;  1NBW A;  4Z4F A;  1IJJ A;  3KK7 A;  4BR0 A;  4E7J A;  3T3F A;  1FJG K;  3MAQ A;  4H4O A;  4A5B A;  4BE1 A;  3SJH A;  4CEQ A;  4IZ9 A;  1RDU A;  4BRF A;  3NVK A;  1TUY A;  4QS7 A;  4RW8 A;  2O4I A;  3K2P A;  1NKC A;  1NG9 A;  4FJJ A;  4IG3 A;  4CJS A;  2ZD1 A;  4CEA A;  1YIJ N;  4XH5 A;  3QEP A;  2VQF K;  1TGO A;  1X9S A;  5GAH P;  2E5L K;  1J5O A;  4OPA A;  2O8E A;  1WSH A;  1JLA A;  4MO4 A;  1V4S A;  1YAG A;  4B9T A;  3L2W A;  4JEP A;  4FM2 A;  4DTS A;  4OVL A;  4OJR A;  4BC5 A;  3PX4 A;  1RDB A;  4LY7 A;  3AA3 A;  2QWL A;  4FWR A;  3F5T A;  3U8X A;  3VQP A;  4F4K A;  2GEL A;  1KLM A;  4DS4 A;  3C94 A;  4JAX A;  3PIP L;  1OH7 A;  3AVM A;  3TWH A;  3KLH A;  2UXC K;  3THW B;  2XY6 A;  2YKM A;  3VQD A;  5HRP A;  2PAV A;  4NYF A;  3MN7 A;  3O9R A;  4AHT A;  2P9P A;  3OYE A;  1KFS A;  3QBX A;  4DR7 K;  4FWL A;  3K9J A;  1YXQ A;  4FSV A;  1KAX A;  1ZBS A;  3CJC A;  3NF7 A;  4OLB A;  1U04 A;  4BRA A;  4FLZ A;  4Q0B A;  4LF4 K;  4L8R B;  1JKH A;  1HYS A;  1QVF M;  2FC0 A;  4N47 A;  3H46 O;  2UXD K;  5AFU A;  4QOZ B;  3HPH A;  3H6E A;  3C6T A;  4CGI A;  1QHA A;  2RHK A;  4M3Z A;  4JS4 A;  3FZM A;  4CF2 A;  1N34 K;  3V1R A;  5B8H A;  1BIU A;  4OGC A;  3MWT A;  3PO4 A;  4RW6 A;  1JXE A;  4JV5 K;  1MU2 A;  4B1U B;  5F0X A;  3LZJ A;  2ZJR L;  4KHY A;  1NM1 A;  2O8F B;  2IDO A;  3I8D A;  4DFJ A;  4CGF A;  3JAM O;  1MWM A;  2GWK A;  4AH9 A;  3B6P A;  5HRS A;  3JSM A;  3SBG A;  4CEF A;  2A1R A;  5DK5 A;  3A5L C;  4AQY K;  3KIO A;  1NGC A;  4CJR A;  3AO1 A;  5DMR A;  1HR0 K;  2VWB A;  4AM6 A;  2FSJ A;  3KKR A;  3UB5 A;  2R7Y A;  3KK1 A;  4B3S K;  4N41 A;  1IG9 A;  1XNQ K;  1E4G T;  4CZG A;  4BC4 A;  2E20 A;  2HF4 A;  2A1S A;  5AQY A;  1GLB G;  1XNR K;  4B8A B;  4CZK A;  3RMB A;  4BDP A;  4DV0 K;  1S6Q A;  2OPR A;  3LWM A;  3BZC A;  4JI3 K;  3C65 A;  4DQQ A;  4JK8 A;  3CXC M;  4HCC A;  1NOZ A;  3OYD A;  2I7N A;  1K6Y A;  4JD2 B;  2YNF A;  3ZX2 A;  3TPQ A;  4K41 A;  4JKC A;  1JL2 A;  1WSI A;  3RSE A;  3AVL A;  4FVM A;  3TSP A;  3OYG A;  4GMJ B;  4GVM A;  4AIL C;  3P4I A;  3VF4 A;  4B9S A;  4JRP A;  1DGK N;  4DR4 K;  4DLG A;  3ZCM A;  1R59 O;  4IJA A;  5LJW A;  4H0Y B;  1RTH A;  2OCE A;  4BRH A;  3TAR A;  1TKD A;  2J4R A;  2QWP A;  2P9N A;  3DRR A;  3LDN A;  3OVN A;  1VQ8 N;  2JWL A;  3V1Q A;  4CIE A;  3D2E A;  3T1Y K;  2E88 A;  3AVK A;  3FE1 A;  3I33 A;  2V7Z A;  3TTF A;  3SAF A;  4OLA A;  4E7K A;  3THX A;  1O1W A;  3H08 A;  4PKH A;  4NXM K;  1RGI A;  3TSQ A;  3SQ4 A;  1Z05 A;  1IKW A;  2HW3 A;  1VSF A;  2QI2 A;  4CHN A;  4JHD B;  1KSP A;  1WOQ A;  3R6M A;  4HUG A;  3AGK A;  4LF9 K;  3LM9 A;  1VQM N;  2O8C B;  3SPZ A;  1M1K O;  2KFZ A;  4K8Z A;  3NCI A;  3THY B;  2VWK A;  1SL2 A;  1YIT N;  1IH7 A;  4DV1 K;  3DXM A;  4C1N K;  4ISG A;  4KH5 A;  4CZF A;  3SPY A;  1XMO K;  1S9G A;  4JI2 K;  3CJB A;  4CJW A;  1VAZ A;  4OKJ A;  5AQT A;  3VEY A;  3NGI A;  3DLG A;  4BG9 A;  3ZT3 A;  2OZS A;  1HYV A;  2Z1J A;  4H0T B;  5KI6 A;  4DSE A;  2HHW A;  1W9H A;  2YI1 A;  4IEI A;  3KVG A;  5FPM A;  3QEW A;  4U67 L;  1U45 A;  1RT3 A;  4EFH A;  4FZY A;  1GOA A;  2BAN A;  4FXD A;  1JCF A;  1W0H A;  4M7X A;  1YF5 L;  3SAH A;  4FL9 A;  3AV9 A;  3CET A;  1VQN N;  2WOM A;  3VEV A;  1NK5 A;  3WNE A;  3O4Q A;  4CVN E;  4KO0 A;  4BDZ A;  2XY8 A;  1XQS C;  3ZSZ A;  4AHS A;  2FBT A;  4DFK A;  3QIO A;  3KD1 E;  1KCF A;  2NZT A;  3HM8 A;  2IGI A;  1FKP A;  3QER A;  2QK9 A;  2W6L A;  3C95 A;  4BRC A;  1NJX A;  2FBV A;  3ZT4 A;  3B6O A;  3ZT1 A;  3DLL L;  4E19 A;  4CJ7 A;  3E9P A;  2QEX N;  1KAZ A;  4YOV A;  3HJF A;  4B08 A;  4DWI A;  1I94 K;  1RTD A;  3W3D A;  1TKX A;  2GUP A;  3L2V A;  2G8U A;  3VEZ A;  2CH6 A;  2HBK A;  4JKE A;  1WLJ A;  4KTW A;  1HNI A;  3NGZ A;  5CYQ A;  1HYZ A;  4E7L A;  3CER A;  1BI4 A;  1NOY A;  1G99 A;  1F21 A;  3WXI A;  1KVB A;  3AO2 A;  5FPD A;  4BVP A;  3EEQ A;  1RTJ A;  5E41 A;  1P8Z A;  1U2V B;  3L3V A;  1BOT O;  1VSH A;  1NK0 A;  4A5A A;  1IG8 A;  4CEC A;  4YOU A;  5KPR A;  1TAQ A;  3ZSV A;  1W2B M;  1HNV A;  4J2B A;  2ZWH A;  5BN8 A;  4ZTF A;  1LOT B;  1N6Q A;  4ISE A;  5F1X A;  3KD5 E;  5JVG L;  5KPZ A;  5EXW A;  2PBD A;  4FPB A;  4ICL A;  3VQ6 A;  5FRM A;  5BRF A;  1CZB A;  2BE2 A;  3ATU A;  1JLG A;  1KLN A;  4JKG A;  3RMD A;  3KLF A;  3VQ7 A;  3OS0 A;  1TL3 A;  3ALY A;  1RT6 A;  3O5B A;  3P83 D;  2GEM A;  3KLE A;  3ZT2 A;  4QCL A;  4FWO A;  1S9E A;  1QZ6 A;  1RIL A;  4QAG A;  1NNE A;  2JLE A;  1CXQ A;  3O3F A;  2P1J A;  2UUA K;  1T8E A;  3G25 A;  5DM7 L;  3E9L A;  1CXU A;  5H1S Q;  4IWV A;  5FRO A;  4FM1 A;  3O4N A;  4EZ6 A;  3BUZ B;  3HVR A;  4FK0 A;  3UKU A;  4X66 K;  4O0I A;  4A2A A;  3HP9 A;  2PYL A;  4ILH A;  4KTQ A;  3DLR A;  1BGX T;  3MMV A;  1CZA N;  3M8P A;  3MEG A;  2NRR A;  4HHT A;  1QZ5 A;  1JLE A;  4DCH A;  3VER A;  3I56 N;  4EAH D;  3MEC A;  4WYB A;  2IAJ A;  5M1O A;  4CFD A;  2QWQ A;  1HPM A;  2VQE K;  1X9M A;  4UY8 O;  1NJY A;  1BWF O;  1RT4 A;  4DSI A;  3V81 A;  4JKF A;  2O8B A;  2O8E B;  3DJC A;  1C6V A;  3ULE A;  3OYF A;  1A5V A;  1EWQ A;  1M90 O;  4DUY K;  4F2R A;  2HHT A;  3K58 A;  3S41 A;  3KTQ A;  3VQC A;  4DKW A;  3PSI A;  4QS8 A;  4H0X B;  5JLH A;  5KQ8 A;  3O08 A;  3CMA N;  3G10 A;  3QIC A;  2HVI A;  4BVO A;  3SZ2 A;  1JCE A;  4CJT A;  3HO1 A;  3C6U A;  4CE9 A;  2E8A A;  3CHW A;  3CFO A;  2A3Z A;  2RF2 A;  3K57 A;  1RBT A;  4DFP A;  4PWD A;  4BRI A;  4YNQ A;  4CF0 A;  2P9P B;  3D2F B;  4L3Q A;  2E2N A;  1ILY A;  4N5S A;  4F3O A;  4KRF A;  5HOO A;  3ZSY A;  5AZJ A;  4CHQ A;  3NH1 A;  5AQM A;  4BRN A;  3RR7 A;  1GLJ O;  3WXJ A;  1VQ7 N;  3E1Y A;  2Q36 A;  4JRQ A;  1SUQ A;  1NGA A;  4DTU A;  3WNF A;  4OX9 K;  2YNG A;  1EQY A;  5HLF A;  1WBD A;  1YVN A;  4KH4 A;  3DWL A;  1BG3 A;  5I3U A;  2DFH A;  2JGU A;  1UAX A;  3U3Y A;  3O3H A;  3PIO L;  3ZSO A;  2ZQB A;  4GKK K;  3HXM A;  4YFU A;  2YHA A;  3ENO A;  2F9W A;  3TU5 A;  4IOC L;  4BR4 A;  4KPY A;  3H3O B;  3QML A;  4R79 A;  4DSJ A;  4DV6 K;  3LAK A;  1C1B A;  3HVT A;  4EZ9 A;  2QTD A;  4JI5 K;  3CCJ N;  2HHH K;  3AO4 A;  4NLB A;  4AHU A;  3BP8 A;  4FM0 A;  4DSF A;  4DTN A;  3LAN A;  4H4M A;  4BRG A;  4E89 A;  3CCR N;  3O9U A;  4LSL A;  2Q3S A;  3EN9 A;  1N32 K;  1BL3 A;  3SYZ A;  4FJL A;  3AGR A;  5C12 A;  4G9Z A;  2Z1G A;  4BRE A;  1ATS A;  2GV9 A;  1MDU B;  1K8A O;  2PYJ A;  5A2Q O;  4CF9 A;  5TKY A;  1VQL N;  1ZC6 A;  1E3M A;  4FOI A;  4B3T K;  1JL1 A;  4M41 A;  1T6D A;  3T19 A;  4IO9 L;  4ILJ A;  5K14 A;  3MXM A;  3NDK A;  4H5T A;  1LAV A;  4CFC A;  4CJ3 A;  4C8K A;  2HHU A;  4B9V A;  2A5X A;  3PY8 A;  2ZJP L;  4OKK A;  4B3O A;  4GW6 A;  4LF6 K;  3O4W A;  3QO9 A;  1KXP A;  1VQK N;  3NMU A;  2Q31 A;  4V19 S;  4BDY A;  4IDK A;  5M1P A;  4DTP A;  3FR0 A;  2AJQ A;  4FYD A;  2QXL A;  5GIO A;  4CF1 A;  3UKR A;  1QQM A;  4CJL A;  2HHV A;  3ZET A;  4E1N A;  3RSE B;  3FFI A;  2V7Y A;  3WT0 A;  3O9T A;  1N36 K;  3LP2 A;  2P9U A;  1LWC A;  1ITG A;  3THV A;  5DM6 L;  3LP1 A;  1JCG A;  3CJ7 A;  4BGA A;  4BY9 C;  2I7P A;  2CGL A;  4CJP A;  1KVA A;  3DOL A;  4H5V A;  5I42 A;  1S3X A;  3SUQ A;  3VEW A;  4Z0U A;  4DQI A;  3H1Q A;  2P9N B;  1VSE A;  1T6C A;  5BN9 A;  5C2F A;  3S3O A;  5JS2 A;  4LSN A;  3D2E B;  4DQS A;  1FKO A;  4FZZ A;  3T69 A;  1VQ9 N;  3F2K A;  5BRD A;  3HOT A;  1NMN A;  1A5X A;  1J9A A;  3CJA A;  3THX B;  1TAU A;  1RDC A;  5KGW A;  2QA4 N;  1EKE A;  2EWS A;  1QSL A;  3ZSX A;  4NLC A;  5GAG P;  5AQF A;  5HRO A;  4E3S A;  1VSK A;  5MLC Q;  5BR8 K;  3V9Z A;  1LW0 A;  4MQ3 A;  1SQK A;  3LPT A;  1T3V A;  1A5W A;  2IIR A;  3I0S A;  1ASW A;  4A59 A;  4IOX A;  4B1V A;  4O55 A;  2NRV A;  1KTQ A;  4FJX A;  2O8D A;  1S1W A;  4H0P A;  1C0M A;  3DXM B;  5AQR A;  3EZ5 A;  3VQ4 A;  3EKS A;  5C0Y A;  5CZ2 A;  4CGJ A;  2Z1I A;  1GOB A;  5AQI A;  4B9U A;  1TKZ A;  3M1F A;  5ADX H;  2YHB A;  4FJH A;  1HQE A;  4RTF D;  2VG7 A;  1YJN N;  3S3M A;  3VN5 A;  3CIP A;  2BUP A;  1T44 A;  4B1Z A;  4FJK A;  2ASM A;  1UWB A;  1YJ9 N;  3TTD A;  3MX5 A;  2QWR A;  1NKE A;  3SAG A;  4OGE A;  1C0T A;  3P31 A;  4WQ5 A;  2X78 A;  5KRS A;  1RT5 A;  2PY5 A;  4B3M K;  5AQH A;  1NJI O;  3LDP A;  2W6K A;  3AAP A;  5HRN A;  3KK3 A;  1VQ5 N;  2OPQ A;  4Y1C A;  4WFA L;  1Q9X A;  3WXM B;  3L4I A;  4B8C A;  4M42 A;  4CZI A;  1HUX A;  5BPL A;  3TAB A;  2Y1J A;  1QVG M;  1IBM K;  4M63 C;  2IOC A;  2NRZ A;  3GG4 A;  2P9L A;  5AQK A;  1QQC A;  4E7I A;  3KHY A;  2HBL A;  4JKD A;  1J5E K;  4CZM A;  3CJ9 A;  4FWQ A;  4DV7 K;  1QTM A;  4GV9 A;  2KZZ A;  4FWN A;  3K0S A;  4IEE A;  2ATQ A;  1GOC A;  1ASV A;  4LC9 B;  4H5W A;  4DB3 A;  4H0V B;  4CER A;  2P9K A;  1DKG D;  3EZW A;  3DMJ A;  1WAJ A;  3JYT A;  1LWF A;  3NH2 A;  3OYH A;  4FVU A;  3HP6 A;  4KH6 A;  2VWJ A;  4FJ9 A;  4O44 A;  2GX9 A;  2W41 A;  3BF1 A;  1OH6 A;  3F9M A;  3OYJ A;  3QEX A;  3O1W A;  4DS5 A;  4DU3 A;  2OAN A;  2IVN A;  3CCM N;  2V51 B;  3CFR A;  3V4I A;  3AVN A;  1ZBU A;  4H0O A;  4LFC K;  3AVB A;  3AVF A;  4MLH A;  2G8F A;  4K42 A;  5HL7 L;  3U3G A;  4OKE A;  3V6D A;  3LAL A;  2VGM A;  3CCS N;  3KK2 A;  2XY7 A;  2HBM A;  1D5A A;  4CK3 A;  4YOW A;  1EP4 A;  4BRQ A;  4HUE A;  1SV5 A;  4J2E A;  2VCP A;  1I39 A;  2YHW A;  3QIP A;  1ATR A;  4BRL A;  2Y1I A;  1VHX A;  1X3N A;  5GIP A;  1H1V A;  2WC9 A;  4DMN A;  5JMV A;  1D9F A;  3QDK A;  3RRG A;  3VEN A;  3KLI A;  2P9I B;  4CIG A;  4CJQ A;  4DV2 K;  4GV3 A;  4JKG B;  4A2B A;  2LSN A;  3K5L A;  3OS1 A;  1VK0 A;  4J8F A;  4Z4G A;  5C24 A;  3C6A A;  4DV5 K;  3L2Q A;  3SCX A;  4DSK A;  3WNG A;  1SKS A;  2KFN A;  4K43 A;  3VQQ A;  4PL8 A;  1EX4 A;  2IC3 A;  1IO2 A;  5EVZ A;  3TAG A;  3U9D A;  3MWP A;  1GLE G;  3PUF A;  4AM7 A;  4FW2 A;  5E84 A;  4LH5 A;  4BWM A;  4W5T A;  2HVH A;  2RE2 A;  2QKK A;  3CYM A;  3UKU B;  2G8I A;  2HST A;  4MLE A;  2BGG A;  4G1Q A;  1YTU A;  3IFR A;  1QQO A;  1JLC A;  1D9D A;  3TAE A;  3R1X A;  3AA5 X;  3AVI A;  3Q7B A;  3CCL N;  4KHP K;  1X9J A;  4EHU A;  3OYM A;  4B9N A;  3CCQ N;  3TR8 A;  2HMP A;  4E0D A;  3LDQ A;  1RBU A;  4BR9 A;  1C0F A;  3LPU A;  1GLA G;  3V9X A;  3LP3 A;  1BQM A;  3P5J A;  4C8O A;  5CY4 A;  3DI6 A;  4F9O A;  2O8B B;  4N56 A;  3VF6 A;  4FW1 A;  2OA8 A;  3TAP A;  3ULE B;  1LW2 A;  3GBT A;  5KPT A;  1EXQ A;  2FLO A;  3I0R A;  2D0O A;  5ADX A;  4RWT A;  4JK9 A;  3SI6 A;  5GAE P;  2VG6 A;  4DTO A;  4PUO A;  3GDQ A;  4C1N I;  3IDH A;  1JLF A;  4IG0 A;  1LV5 A;  4HTL A;  4KHQ A;  4JKA A;  5J2P A;  1HLU A;  4O5F A;  5J2M A;  2UUB K;  2KW4 A;  3MEE A;  3DRP A;  4IFV A;  1NK4 A;  4CD1 A;  3QFU A;  1TL1 A;  3HT3 A;  4CHY A;  1C0G A;  1XC3 A;  1NGE A;  4BR7 A;  4CEE A;  2H3G X;  4JI8 K;  3KKS A;  4FOE A;  2GUI A;  3OA9 A;  5BRE A;  5AZJ B;  2Q0R A;  1K8K A;  3KZB A;  4YY3 K;  1J54 A;  4OPJ A;  5SZT A;  1NMD A;  3J81 O;  1YHQ N;  4CK1 A;  4DV4 K;  3GL1 A;  3HYF A;  5EY4 A;  3VMF B;  4BE0 A;  3NF9 A;  5AZI A;  1RCH A;  4CZE A;  2G8W A;  4FLT A;  4PKI A;  3OYB A;  3OYK A;  4DTR A;  3FZK A;  4BWJ A;  3U4L A;  4ID1 A;  1VSL A;  4Y1D A;  5C2D A;  1NGI A;  3V1O A;  5LMN K;  3IG1 A;  3ID8 A;  3CQY A;  1ATN A;  4BQZ A;  4YDU A;  1XI1 A;  2AP1 A;  1KRP A;  1MA9 B;  4CES A;  1NKB A;  2UYT A;  3VGM A;  4BE2 A;  4DU4 A;  3CC4 N;  2RN2 A;  3B8A X;  3ZX0 A;  3TI0 A;  4KHN A;  3SV3 A;  3J80 O;  5CR4 A;  1ZYQ A;  3ITH A;  4JI6 K;  2G8V A;  1RDA A;  3MN5 A;  2F8S A;  2VGN A;  1REV A;  4FWK A;  2YJE A;  4CJ4 A;  3IRX A;  4AF1 A;  1TV6 A;  1TK8 A;  3CD6 N;  4PHT X;  4DR3 K;  1NK8 A;  5HBM A;  4BC2 A;  1XMQ K;  3L2R A;  2A40 A;  4FLY A;  3AAQ A;  3F73 A;  5M1Q A;  2KZM A;  3CI5 A;  3VTI A;  2FF6 A;  4Z4I A;  1WB9 A;  2E2O A;  3OYA A;  3HOS A;  1U48 A;  3WQT A;  1WBB A;  3VEX A;  3MED A;  4CK2 A;  4J2D A;  2HHX A;  3WXL A;  3H3N O;  5GAD P;  3DXK A;  3O80 A;  3R3L A;  3ULD A;  1BIZ A;  1NGB A;  1U4B A;  5J1E A;  1RT2 A;  2UUC K;  1JXB A;  1GLL O;  3UKR B;  3L6Q A;  3L8B A;  2D0P A;  3ZET B;  1BCM A;  4O4G A;  3VQB A;  3FGU A;  4BAC A;  1VQ4 N;  4EP5 A;  1S1U A;  3VQE A;  5BPN A;  2P9U B;  3E66 A;  1Z6R A;  4H5R A;  3G6E N;  1N5Y A;  3A0I X;  4H5N A;  1HNW K;  4DUZ K;  1IKV A;  3RVC A;  1BUP A;  4FJG A;  3J8A A;  3SUO A;  5LY3 A;  4H8K A;  1E4F T;  4ELV A;  3CCE N;  1K73 O;  3VTH A;  3NH0 A;  4FLV A;  3VA3 A;  1BU6 O;  2OPP A;  1S5J A;  4HVJ A;  4PKG A;  2V52 B;  5FPE A;  1WNS A;  3WEE A;  2WUS A;  1UA1 A;  2BH1 A;  1GLC G;  3CM6 A;  3A5N C;  1D8Y A;  3NGY A;  1V4T A;  4WQ5 C;  3FZF A;  3JS6 A;  3CPE A;  5TKW A;  1EO1 A;  2KLA A;  4AHV A;  3C7N A;  3AY9 A;  1IKY A;  4XEI A;  4B9Q A;  3WUH A;  2O4G A;  3O6W A;  1RBR A;  4LFB K;  3OBW A;  4ILG B;  3VET A;  5E26 A;  2XHB A;  5C10 A;  4FJ7 A;  3AO3 A;  4JKB A;  4K8X A;  2O8D B;  2EHG A;  1RDW X;  3SUP A;  4OO1 J;  1XUP O;  1R0A A;  1Q18 A;  4W5N A;  2BTF A;  3Q7C A;  1X3M A;  3M8R A;  2UU9 K;  4U7B A;  2P5G A;  4DR5 K;  3OHR A;  1Z26 A;  1IBL K;  3KJV A;  1C1C A;  4FLW A;  4UQG A;  5AQW A;  1WAF A;  1TK5 A;  1SKR A;  2G8K A;  4JLH A;  4GKJ K;  3UE5 A;  1ZBF A;  4CBW A;  4LF8 K;  1DEJ A;  3MXI A;  1P90 A;  5C42 A;  3SMP A;  2HND A;  3IAY A;  1SAZ A;  4YHH K;  3BGR A;  2PZS A;  4AHC A;  1NK6 A;  3M8Q A;  4RW4 A;  3ZSW A;  5AFU H;  2KTQ A;  1BA1 A;  5C25 A;  4NCB A;  3DOK A;  1RBS A;  2NRH A;  4JNE A;  3CQ8 A;  2ZGY A;  3NBP A;  1WSJ A;  1VSD A;  2ETJ A;  1KD1 O;  2D5R A;  2EX3 A;  2Q0U A;  3KWI A;  1IV0 A;  4KAZ A;  3CF5 L;  4MDA A;  3TTC A;  3RWU A;  1HKG A;  2P9L B;  2YKN A;  3VEO A;  3G0Z A;  2PFU A;  3HSC A;  4FK2 A;  2A41 A;  2P9S A;  2X74 A;  3CQX A;  4GNI A;  2UXB K;  4DR1 K;  2RPI A;  3NFA A;  2HMI A;  3O3G A;  4HCB A;  4FZX C;  2QWM A;  4CEO A;  4DQ8 A;  2P9K B;  2ZE2 A;  2VG5 A;  1BDG A;  4A57 A;  4O5B A;  2P5O A;  1SS6 A;  3VQ8 A;  4B3R K;  3PLA A;  4CGH A;  3VES A;  3L3U A;  3OYC A;  4CZJ A;  2D4W A;  4LF7 K;  1KAY A;  1RBV A;  2QWO A;  4O0J A;  3MXJ A;  5AQQ A;  2HOE A;  3LP0 A;  3QNO A;  1OH5 A;  3ZLJ A;  2BDP A;  4NB4 A;  4AHR A;  3SQ2 A;  3HBT A;  1TUU A;  1Q7Y O;  3MCA B;  1VSI A;  3HM9 A;  1J6Z A;  3MDQ A;  4BQL A;  4IOA L;  3BY5 A;  4FO0 A;  1BIS A;  2HNY A;  2OTL N;  3OJS A;  2FXU A;  4DLE A;  1LAW A;  2KQ2 A;  3SK3 A;  3CC2 N;  2F8T A;  3K59 A;  1JJ2 M;  4GV6 A;  4MO5 A;  1UOC A;  3D0P A;  5BR9 A;  1L3V A;  3KLG A;  1DTT A;  4PY5 A;  1NGF A;  4YOR A;  4KB1 A;  4X65 K;  4CJF A;  3NF8 A;  4M3U A;  3EY1 A;  3LWL A;  3NAE A;  2FF3 B;  4RW9 A;  2F96 A;  3HPO A;  4PL7 A;  2OZM A;  5EX5 A;  4IO8 A;  1D4X A;  1TYQ A;  4DSL A;  3G71 N;  1Q82 O;  4C8L A;  1YTA A;  3PO5 A;  3J7Y P;  4CZH A;  1NGG A;  1ZBL A;  4B1X B;  3HZ6 A;  3A5M C;  1BO5 O;  2OYQ A;  3LDS A;  4CD3 A;  1QS4 A;  1OVQ A;  4Q5V A;  1DTQ A;  4FJI A;  1ESV A;  3W0L A;  3KWG A;  4EIA A;  3OJU A;  3S3N A;  1BHL A;  3R8E A;  2FSK A;  1SZ2 A;  3O8M A;  3ZT0 A;  3V9S A;  3F9K A;  4HWI A;  4M3T A;  2YHX A;  2HF3 A;  3RR8 A;  4WQ4 A;  3QES A;  4C23 A;  1N8R O;  4CEZ A;  4XIU A;  3K9K A;  2KKZ A;  1BQN A;  2GBZ A;  3K5M A;  1NGJ A;  4KKO A;  2XY5 A;  2E1Y A;  5M1F A;  4LD0 A;  4Z4C A;  2FBX A;  3FZL A;  2YHY A;  4ID5 A;  4LFA K;  5LMU K;  4FK4 A;  3D2F A;  3AO5 A;  1DLO A;  1GLF O;  4IKF A;  3NHG A;  4O8U A;  4IFY A;  4I6M A;  1YT3 A;  5AJ3 K;  1T05 A;  1ZXO A;  5M1K A;  4NXN K;  1CZ9 A;  4ZHR A;  3ATV A;  4M45 A;  4Z94 A;  4ELU A;  3N4P A;  2B4J A;  1RT1 A;  1RT7 A;  4YDU C;  1C0U A;  4CJV A;  4YOY A;  3RMC A;  4I7F A;  4BGB A;  5AQJ A;  4QS9 A;  4I2Q A;  3QB0 A;  2AA4 A;  4CI6 A;  3IUC A;  4X62 K;  2Q2R A;  4OPH A;  4N76 A;  4OPK A;  4M3X A;  4KFB A;  4CFB A;  2E1Z A;  4EP4 A;  1NK9 A;  3L0Q A;  2F4V K;  1K8K B;  4E7H A;  2NRX A;  3IMX A;  1Q86 O;  5IT9 O;  4FLX A;  2DY4 A;  2X6N A;  2E2Q A;  1KQS M;  5AZI B;  4FWP A;  3CCU N;  3OS2 A;  3CFP A;  1Q9Y A;  3WNH A;  3QEV A;  3AVC A;  3QBW A;  1RDD A;  1HX1 A;  1NGD A;  2DFE A;  2DPN A;  4I9L A;  2DFF A;  1LCU A;  5AQX A;  4I2P A;  3ZEU A;  4BRM A;  3OYL A;  3EYZ A;  4CBU A;  4M7Y A;  1WN7 A;  4X64 K;  1S1V A;  2QWN A;  1J53 A;  1YJW N;  3FZH A;  2GTD A;  3FFK B;  4IDH A;  1BI4 B;  3ZYY X;  4BRP A;  4FJ5 A;  3IKM A;  3M8S A;  1U6Z A;  5GIN A;  2OPS A;  5KQD A;  4WF9 L;  3TAF A;  4F2S A;  4CW7 B;  3ZSQ A;  1HPZ A;  2F9T A;  2VYP A;  3TAN A;  3T7Z A;  4YOT A;  3QLH A;  4CIF A;  4DG1 A;  1FXX A;  5HRR A;  4HTU A;  1L3S A;  4DV3 K;  4CCH A;  3LZI A;  2B6A A;  3L4Q A;  3SQ1 A;  1IBK K;  4BR5 A;  2QKB A;  3OW2 M;  2XO7 A;  3VGL A;  3OBY A;  4JI0 K;  2QXF A;  3SMS A;  2X6S A;  1VRU A;  3HST B;  1QHT A;  4BC3 A;  3TAM A;  3EO3 A;  2WFB A;  2B5J A;  4IJN A;  5J2Q A;  1LWE A;  4JI4 K;  1BCO A;  3P1G A;  3HTV A;  3ID6 A;  5HP1 A;  1NLV A;  3R9P A;  3PV8 A;  3D7E O;  5SWM A;  2D1K A;  3DXK B;  1K9M O;  1CLQ A;  4DTM A;  2D0B A;  4H03 B;  1KFD A;  1U49 A;  4RCH A;  3SQ0 A;  3P39 A;  4CHP A;  5JS1 A;  1W97 L;  5CE3 A;  3VQ5 A;  3QEI A;  3VA0 A;  1QSY A;  3AVA A;  3ZSR A;  3AVJ A;  5JLF A;  1VSJ A;  2ITG A;  4WCE L;  3C0B A;  5KRT A;  3RTV A;  4B9M A;  2GWJ A;  5AQO A;  2JWK A;  5J2N A;  4FJM A;  4DQP A;  3LDO A;  4DFM A;  3THW A;  2ZGZ A;  2IS3 A;  3LDL A;  4M3Y A;  1RTI A;  2YV0 X;  3AAR A;  4NCA A;  3DAW A;  1MWK A;  1NWK A;  3HRG A;  3WEE B;  5JIC A;  3U6F A;  5EU7 A;  4A61 A;  3K5N A;  3NF6 A;  3U9Z A;  3M6G A;  5ELZ A;  2HNZ A;  2Q1N A;  4JS5 A;  1XHZ A;  1WSG A;  1L5U A;  5EOY A;  2DTU A;  3NE6 A;  1NU0 A;  4DU1 A;  4JK7 A;  1N33 K;  1VQP N;  2CGJ A;  3LAM A;  3C7N B;  3CME N;  4JYA K;  3MN6 A;  3DLH A;  1VSM A;  4EHT A;  1HKB A;  1WUA A;  1HNX K;  3CM5 A;  4PA1 A;  3RRH A;  2CH5 A;  4KB0 A;  2NUB A;  2ASP A;  3TAQ A;  3QIN A;  4FJ8 A;  1FK9 A;  5CHI A;  3ZX3 A;  1HMV A;  3LM2 A;  3I8B A;  5KGX A;  1VQO N;  4IBN A;  3AA2 A;  3DLB A;  4WFN L;  3ISN C;  3OYN A;  3SNN A;  4CJ5 A;  5IWA K;  4B9L A;  1O13 A;  3EL2 A;  4KHW A;  4NO7 A;  2O8F A;  1EET A;  1VQ6 N;  1HKC A;  4K25 A;  2RKI A;  4KHU A;  2FSN A;  2W42 A;  4RW7 A;  4ELT A;  3OTO K;  4TSX A;  3PX0 A;  4E1M A;  3HL8 A;  5AQP A;  4I9Q A;  1VRT A;  3V9W A;  1BA0 A;  4IXC A;  3PX6 A;  1QE1 A;  4B1Y B;  3H1V X;  3AVG A;  3GE1 A;  1L3T A;  4MDB A;  4FPA A;  1SL1 A;  3VOV A;  3WXK A;  4CHZ A;  2ZJQ L;  5T7B A;  5FRN A;  4KRE A;  3EE8 A;  1SL0 A;  1Y97 A;  3SJJ A;  4KTZ A;  4BRO A;  3CG7 A;  4GY2 B;  3AA4 A;  1KC8 O;  2FBY A;  4CGG A;  3VQA A;  3OYI A;  1OH8 A;  2QM1 A;  2P9S B;  3M3Z A;  4DTX A;  3SUN A;  2XRI A;  3GOI A;  3RMA A;  4LF5 K;  2QW9 A;  1HJR A;  2E6L A;  4JD2 A;  2WBN A;  3HPG A;  4NCG A;  4DTJ A;  2E6M A;  3TSU A;  4IFE A;  1JLB A;  5AQS A;  4CBX A;  3BZK A;  4CEB A;  1EWR A;  3EKU A;  1T03 A;  1G15 A;  2YNI A;  1UA0 A;  1XHX A;  4JI7 K;  4WE1 A;  1Z25 A;  1NK7 A;  3K5O A;  5JVH L;  2P9I A;  4J2A A;  1HRH A;  3L2U A;  5CZ1 A;  3O9Q A;  1S72 N;  4CJU A;  2YJF A;  3T1A A;  3VGK A;  4KI4 A;  4R5P A;  2YNH A;  3DLK A;  3QFP A;  3ENB A;  1HNZ K;  2W40 A;  4F8R A;  4W5Q A;  1FW6 A;  2ITM A;  4FJN A;  4KBO A;  3BDP A;  1Y64 A;  4PQU A;  3SBT A;  3CCV N;  1IKX A;  3C6H A;  1ZBI A;  1WSE A;  2WTU A;  2ZM6 K;  4WQ4 C;  3A2F A;  4C8N A;  3FLC O;  3CPW M;  3QET A;  3NVM A;  5AR0 A;  1ZBH A;  1YVU A;  1KVC A;  2HB5 A;  1RFQ A;  5BPM A;  4JHD A;  2D0A A;  3HI0 A;  3WQU A;  3P38 A;  4GVE A;  4DHY A;  2O8C A;  1TYQ B;  4KHS A;  5AQV A;  3THY A;  1X1P A;  4NYN A;  5C15 A;  1B92 A;  4Y0W A;  3H45 C;  3MN9 A;  1S1T A;  3O9S A;  3M5R A;  3E9O A;  1L3U A;  3T1H K;  4CFA A;  5F2R A;  2HHQ A;  5FPN A;  4CF8 A;  1TKT A;  4CED A;  4JN4 A;  4BRK A;  5D3G A;  3CJ1 A;  1U47 A;  2P51 A;  1Q81 O;  1B9F A;  4M3R A;  2E4L A;  1S6P A;  4DR6 K;  4WFB L;  3D45 A;  4B1W B;  3UIQ A;  4FWM A;  5AQU A;  5M1N A;  5KTQ A;  3PSF A;  3LL3 A;  2OTJ N;  3MK6 A;  4XH1 A;  4JKH A;  4CJK A;  4KI6 A;  2NLX A;  1ASU A;  4ISF A;  4ZTJ A;  4RG8 A;  1DT9 A;  1W7A A;  3G4S N;  2ZF5 O;  2IVO A;  1TVR A;  5LL6 Z;  4I6M B;  3A5O C;  3JXU A;  3J7Z O;  4DQR A;  4DF8 A;  3AVH A;  5BRH A;  4C8M A;  4JI1 K;  3ASM A;  1RNH A;  2G8H A;  1WSF A;  3N4Q A;  1S22 A;  2I5J A;  1OKJ A;  3SLC A;  2YX6 A;  4K0K K;  3DLE A;  2ASO A;  5AQN A;  1C1A A;  2NRW A;  2Z1H A;  3DYA A;  3J7A P;  1QQN A;  3VPZ A;  4HUF A;  4FLU A;  3ENH A;  2KHO A;  4M3W A;  4W5R A;  4CJE A;  5AQZ A;  2D0C A;  5AQG A;  2HHS A;  3VQ9 A;  3EE9 A;  4CHO A;  2NNW A;  3IS9 A;  4DF4 A;  4DR2 K;  5FLX O;  4Z4E A;  1T7P A;  1HJO A;  3DRS A;  4XH4 A;  3MX2 A;  4BR2 A;  1U2V A;  5FDL A;  1YUW A;  2HBJ A;  4KV8 A;  1NGH A;  4Z4H A;  1OVY A;  2NRT A;  3E01 A;  3ZEU B; 
#chains in the Genus database with same CATH homology
 1RT7 A;  1CXQ A;  1C0U A;  3LP3 A;  4CJV A;  1B9D A;  1I3A A;  2P1J A;  1BQM A;  3P5J A;  4I7F A;  3O3F A;  3RMC A;  1NJZ A;  1X9W A;  1T8E A;  5CY4 A;  2OZM A;  4I2Q A;  3DI6 A;  1Q8I A;  3S9H A;  1CXU A;  4N56 A;  4N76 A;  4OPK A;  4M3X A;  4FW1 A;  4KFB A;  2OA8 A;  3TAP A;  4CFB A;  1LW2 A;  4FCY A;  1JLQ A;  4CGD A;  4EP4 A;  3OY9 A;  5FRO A;  1NJW A;  4FM1 A;  3O4N A;  3SV4 A;  1NK9 A;  4EZ6 A;  1EXQ A;  3HVR A;  4FK0 A;  3V9U A;  4E7H A;  1SKW A;  4W5O A;  3QNN A;  4LH4 A;  1XWL A;  2WON A;  1TK0 A;  3I0R A;  4O0I A;  3HP9 A;  2PYL A;  3HK2 A;  4KTQ A;  4FLX A;  3DLR A;  1BGX T;  2X6N A;  5CYM A;  3M8P A;  3SI6 A;  2DY4 A;  3MEG A;  1S1X A;  2VG6 A;  4HHT A;  4DTO A;  3OS2 A;  3CFP A;  1Q9Y A;  3WNH A;  4PUO A;  1JLE A;  3QEV A;  1JLF A;  4IG0 A;  1LV5 A;  3DM2 A;  3AVC A;  3MEC A;  1RDD A;  2IAJ A;  4F3T A;  2DFE A;  4KHQ A;  4I9L A;  2DFF A;  4I2P A;  4CFD A;  3OYL A;  5J2P A;  5J2M A;  2KW4 A;  3MEE A;  3EYZ A;  3DRP A;  4MFB A;  4IFV A;  1WN7 A;  1NK4 A;  1HQU A;  1NJY A;  1X9M A;  1QSS A;  1S1V A;  1RT4 A;  1TL1 A;  3V81 A;  1XC9 A;  4DSI A;  1J53 A;  3HT3 A;  4CHY A;  4Z4F A;  1BI4 B;  4FJ5 A;  4CEE A;  1C6V A;  3OYF A;  3M8S A;  3KKS A;  1A5V A;  2GUI A;  4E7J A;  3T3F A;  3MAQ A;  2OPS A;  4H4O A;  4F2R A;  1J54 A;  3K58 A;  4OPJ A;  5SZT A;  3TAF A;  4BE1 A;  4F2S A;  3KTQ A;  2HHT A;  3ZSQ A;  4CK1 A;  3VQC A;  1HPZ A;  3TAN A;  4CEQ A;  3HYF A;  4BE0 A;  3NF9 A;  3QLH A;  4CIF A;  4DG1 A;  1FXX A;  3G10 A;  1RCH A;  5HRR A;  2G8W A;  4FLT A;  4HTU A;  2HVI A;  1TAU A;  3SZ2 A;  1L3S A;  4CJT A;  4RW8 A;  3HO1 A;  2O4I A;  3K2P A;  1NKC A;  4CCH A;  3C6U A;  4CE9 A;  4FJJ A;  3LZI A;  4IG3 A;  3CFO A;  2RF2 A;  2B6A A;  2ZD1 A;  4CJS A;  3OYB A;  4CEA A;  3K57 A;  1RBT A;  4DFP A;  4PWD A;  4HCB A;  3OYK A;  3QEP A;  3SQ1 A;  4YNQ A;  4BWJ A;  4DTR A;  2QKB A;  4ID1 A;  4CF0 A;  1TGO A;  2XO7 A;  1X9S A;  1VSL A;  1J5O A;  4Y1D A;  3V1O A;  2QXF A;  4N5S A;  4F3O A;  1WSH A;  1JLA A;  3IG1 A;  4KRF A;  2X6S A;  1VRU A;  3ZSY A;  3L2W A;  4FM2 A;  4DTS A;  4B9T A;  2G8K A;  3HST B;  4CHQ A;  1QHT A;  3NH1 A;  4OVL A;  4OJR A;  3TAM A;  3PX4 A;  3RR7 A;  1XI1 A;  2B5J A;  1KRP A;  4KI4 A;  4CES A;  1RDB A;  4LY7 A;  1NKB A;  3AA3 A;  5J2Q A;  1LWE A;  4BE2 A;  4F4K A;  3VQP A;  1BCO A;  4DU4 A;  4JRQ A;  2RN2 A;  1KLM A;  1SUQ A;  3P1G A;  3C94 A;  4DS4 A;  3WNF A;  3SV3 A;  4DTU A;  5HP1 A;  3TI0 A;  4KHN A;  3AVM A;  3TWH A;  2YNG A;  1ZYQ A;  3ITH A;  3KLH A;  5HLF A;  1RDA A;  2G8V A;  2XY6 A;  2YKM A;  3VQD A;  2F8S A;  5HRP A;  3PV8 A;  4NYF A;  1REV A;  2DFH A;  2JGU A;  5SWM A;  5I3U A;  1UAX A;  3U3Y A;  1CLQ A;  4DTM A;  2D0B A;  4CJ4 A;  1KFD A;  1U49 A;  3IRX A;  4AHT A;  3O3H A;  3OYE A;  1TV6 A;  3ZSO A;  1TK8 A;  2ZQB A;  1KFS A;  3SQ0 A;  4CHP A;  1NK8 A;  3HXM A;  3QEI A;  5HBM A;  3VQ5 A;  4YFU A;  5D3G A;  5JS1 A;  3VA0 A;  1QSY A;  3AVA A;  3ZSR A;  2YHA A;  3L2R A;  4FLY A;  3AVJ A;  3F73 A;  1VSJ A;  2KZM A;  2ITG A;  3NF7 A;  4KPY A;  4OLB A;  4DSJ A;  3LAK A;  1U04 A;  1C1B A;  3HVT A;  5KRT A;  3RTV A;  4FLZ A;  4B9M A;  4EZ9 A;  4Q0B A;  4L8R B;  1JKH A;  4Z4I A;  1HYS A;  5J2N A;  4FJM A;  2FC0 A;  3OYA A;  4DQP A;  1U48 A;  4DFM A;  3AO4 A;  4N47 A;  4AHU A;  3MED A;  4CK2 A;  4J2D A;  2HHX A;  4FM0 A;  2IS3 A;  4DSF A;  4DTN A;  3LAN A;  4H4M A;  4E89 A;  1RTI A;  2YV0 X;  4M3Y A;  4QOZ B;  3HPH A;  3C6T A;  2Q3S A;  4LSL A;  1BL3 A;  4CGI A;  3ULD A;  1BIZ A;  3SYZ A;  1U4B A;  4FJL A;  5J1E A;  4NCA A;  4M3Z A;  1RT2 A;  4JS4 A;  4CF2 A;  2Z1G A;  2GV9 A;  1JXB A;  3V1R A;  2PYJ A;  3L8B A;  4CF9 A;  3U6F A;  1BIU A;  4OGC A;  5EU7 A;  1BCM A;  4O4G A;  3VQB A;  4BAC A;  3PO4 A;  4EP5 A;  3NF6 A;  3K5N A;  1S1U A;  3VQE A;  1JL1 A;  4M41 A;  4RW6 A;  1JXE A;  3T19 A;  2HNZ A;  4JS5 A;  5K14 A;  3MXM A;  1MU2 A;  1WSG A;  1XHZ A;  3NDK A;  1L5U A;  2DTU A;  3NE6 A;  3LZJ A;  4DU1 A;  1N5Y A;  1LAV A;  4CFC A;  4KHY A;  4CJ3 A;  4C8K A;  2IDO A;  2HHU A;  4B9V A;  3I8D A;  4DFJ A;  3PY8 A;  4CGF A;  1IKV A;  3LAM A;  4OKK A;  4FJG A;  4AH9 A;  4B3O A;  3DLH A;  1VSM A;  4GW6 A;  3QO9 A;  3B6P A;  5HRS A;  3SUO A;  3JSM A;  4H8K A;  3CM5 A;  4CEF A;  4BDY A;  4ELV A;  4IDK A;  4PA1 A;  3RRH A;  5DK5 A;  2A1R A;  2NUB A;  3NH0 A;  4FLV A;  4DTP A;  4KB0 A;  3TAQ A;  3VA3 A;  3KIO A;  3QIN A;  3AO1 A;  5DMR A;  4CJR A;  4FJ8 A;  4FYD A;  1FK9 A;  2AJQ A;  2OPP A;  1S5J A;  3KKR A;  4HVJ A;  1HMV A;  5KGX A;  2R7Y A;  4CF1 A;  1WNS A;  3KK1 A;  3TAG A;  4N41 A;  4IBN A;  4CJL A;  3V9X A;  1UA1 A;  1IG9 A;  2HHV A;  4E1N A;  3CM6 A;  3AA2 A;  3DLB A;  3FFI A;  1D8Y A;  3ISN C;  3NGY A;  3OYN A;  3SNN A;  4CJ5 A;  3LP2 A;  4B9L A;  1LWC A;  1ITG A;  2A1S A;  3THV A;  4KHW A;  3LP1 A;  1EET A;  4B8A B;  2RKI A;  3RMB A;  4BDP A;  4KHU A;  4AHV A;  1S6Q A;  4K8Z A;  4CJP A;  2W42 A;  1IKY A;  1KVA A;  2OPR A;  3DOL A;  4RW7 A;  5I42 A;  4ELT A;  2O4G A;  3LWM A;  4TSX A;  3PX0 A;  3SUQ A;  4Z0U A;  1RBR A;  4E1M A;  3HL8 A;  4DQI A;  4I9Q A;  1VRT A;  4DQQ A;  3V9W A;  3PX6 A;  4HCC A;  1QE1 A;  2XHB A;  1VSE A;  1NOZ A;  3OYD A;  4FJ7 A;  3AO3 A;  4K8X A;  1K6Y A;  2EHG A;  3AVG A;  3S3O A;  1L3T A;  3SUP A;  2YNF A;  5JS2 A;  4LSN A;  1SL1 A;  4CHZ A;  4DQS A;  1FKO A;  4FZZ A;  1R0A A;  4W5N A;  1JL2 A;  1WSI A;  5T7B A;  5FRN A;  3M8R A;  3AVL A;  4FVM A;  4KRE A;  1SL0 A;  1A5X A;  3OYG A;  2P5G A;  4GMJ B;  4GVM A;  1J9A A;  4AIL C;  1Y97 A;  1Z26 A;  3SJJ A;  4KTZ A;  4B9S A;  3CG7 A;  1C1C A;  1RDC A;  3KJV A;  5KGW A;  4UQG A;  1WAF A;  4JRP A;  3AA4 A;  4FLW A;  1EKE A;  4JLH A;  1TK5 A;  1SKR A;  1QSL A;  3ZSX A;  2FBY A;  4CGG A;  4DLG A;  3VQA A;  5HRO A;  1ZBF A;  4E3S A;  3OYI A;  3ZCM A;  1VSK A;  3V9Z A;  1LW0 A;  4MQ3 A;  3MXI A;  5C42 A;  1RTH A;  2HND A;  4DTX A;  3LPT A;  3SUN A;  3TAR A;  1A5W A;  1TKD A;  3IAY A;  2XRI A;  3I0S A;  1ASW A;  3DRR A;  3BGR A;  2PZS A;  4AHC A;  3RMA A;  1NK6 A;  3M8Q A;  4O55 A;  4RW4 A;  3ZSW A;  1KTQ A;  4FJX A;  2KTQ A;  1HJR A;  3OVN A;  1S1W A;  2E6L A;  5C25 A;  4NCB A;  3DOK A;  1C0M A;  1RBS A;  3V1Q A;  4CIE A;  3EZ5 A;  3VQ4 A;  3CQ8 A;  3HPG A;  4NCG A;  5CZ2 A;  4DTJ A;  2E6M A;  3AVK A;  4CGJ A;  3NBP A;  1WSJ A;  1JLB A;  1GOB A;  2Z1I A;  4B9U A;  1VSD A;  1TKZ A;  2ETJ A;  2D5R A;  2EX3 A;  4OLA A;  2YHB A;  4CEB A;  4KAZ A;  4E7K A;  4FJH A;  1HQE A;  2VG7 A;  1T03 A;  3RWU A;  1O1W A;  1G15 A;  3S3M A;  3H08 A;  3SQ4 A;  3VN5 A;  2YKN A;  2YNI A;  1UA0 A;  1XHX A;  1IKW A;  2HW3 A;  1VSF A;  3G0Z A;  4WE1 A;  1Z25 A;  1NK7 A;  3K5O A;  4FJK A;  1UWB A;  4FK2 A;  4CHN A;  4J2A A;  1KSP A;  4HUG A;  1NKE A;  1L3U A;  1HRH A;  2X74 A;  4OGE A;  1C0T A;  3L2U A;  5CZ1 A;  2RPI A;  3NFA A;  3SPZ A;  2KFZ A;  4CJU A;  2HMI A;  3O3G A;  3T1A A;  3NCI A;  2X78 A;  2VWK A;  5KRS A;  1RT5 A;  2YNH A;  3DLK A;  4R5P A;  1SL2 A;  2PY5 A;  4FZX C;  1IH7 A;  4CEO A;  5HRN A;  2QK9 A;  3KK3 A;  4F8R A;  4W5Q A;  2OPQ A;  2ZE2 A;  2VG5 A;  4Y1C A;  4FJN A;  1Q9X A;  3BDP A;  4PQU A;  4O5B A;  2P5O A;  4B8C A;  3VQ8 A;  4M42 A;  1IKX A;  1ZBI A;  3SPY A;  1WSE A;  3TAB A;  1S9G A;  4CGH A;  2Y1J A;  3L3U A;  3OYC A;  3A2F A;  2IOC A;  4C8N A;  1RBV A;  4O0J A;  3QET A;  3MXJ A;  4CJW A;  1ZBH A;  4OKJ A;  3LP0 A;  3QNO A;  1YVU A;  1QQC A;  3NGI A;  4E7I A;  3DLG A;  2BDP A;  1KVC A;  2HB5 A;  3ZT3 A;  2OZS A;  1HYV A;  2Z1J A;  5KI6 A;  4AHR A;  4DSE A;  2D0A A;  1W9H A;  2HHW A;  3SQ2 A;  1QTM A;  1VSI A;  4KHS A;  3HM9 A;  3QEW A;  2KZZ A;  1U45 A;  1RT3 A;  1X1P A;  4NYN A;  1B92 A;  2ATQ A;  1GOC A;  4FZY A;  1GOA A;  2BAN A;  1ASV A;  1BIS A;  2HNY A;  1S1T A;  4FXD A;  4CER A;  1W0H A;  3OJS A;  4DLE A;  1LAW A;  2KQ2 A;  2F8T A;  3AV9 A;  3K59 A;  2WOM A;  3DMJ A;  1NK5 A;  3WNE A;  3O4Q A;  1WAJ A;  3JYT A;  4KO0 A;  4BDZ A;  1LWF A;  2XY8 A;  1UOC A;  3ZSZ A;  4AHS A;  2FBT A;  3NH2 A;  3OYH A;  3HP6 A;  3D0P A;  4DFK A;  1L3V A;  3KLG A;  4CFA A;  3QIO A;  2VWJ A;  4O44 A;  4FJ9 A;  3KD1 E;  1KCF A;  1DTT A;  4PY5 A;  2HHQ A;  4CF8 A;  3OYJ A;  1TKT A;  4KB1 A;  2IGI A;  3QEX A;  4CED A;  4CJF A;  4DS5 A;  3NF8 A;  1FKP A;  4DU3 A;  3EY1 A;  3LWL A;  3NAE A;  3C95 A;  3QER A;  4M3U A;  4RW9 A;  2F96 A;  3HPO A;  3CFR A;  2FBV A;  3ZT4 A;  1NJX A;  3B6O A;  3V4I A;  1U47 A;  3AVN A;  2P51 A;  3ZT1 A;  1ZBU A;  3AVB A;  1B9F A;  3AVF A;  4E19 A;  4M3R A;  2G8F A;  2E4L A;  1S6P A;  4DSL A;  3U3G A;  3D45 A;  4OKE A;  3V6D A;  4C8O A;  3UIQ A;  3LAL A;  3HJF A;  4B08 A;  4DWI A;  3KK2 A;  1RTD A;  4C8L A;  1TKX A;  3L2V A;  2XY7 A;  2G8U A;  1D5A A;  4CK3 A;  1YTA A;  3PO5 A;  1WLJ A;  5KTQ A;  1EP4 A;  4KTW A;  1ZBL A;  1HNI A;  4CJK A;  3NGZ A;  4KI6 A;  4HUE A;  1SV5 A;  5CYQ A;  4J2E A;  1HYZ A;  1ASU A;  4ZTJ A;  4E7L A;  4RG8 A;  2OYQ A;  1I39 A;  3QIP A;  3LDS A;  2Y1I A;  1QS4 A;  1BI4 A;  4Q5V A;  1DTQ A;  4FJI A;  1NOY A;  1F21 A;  4DMN A;  1D9F A;  3RRG A;  1KVB A;  3AO2 A;  3KLI A;  1TVR A;  4CIG A;  4CJQ A;  1RTJ A;  5E41 A;  3OJU A;  2LSN A;  3K5L A;  3S3N A;  3OS1 A;  1BHL A;  4DQR A;  1VK0 A;  3L3V A;  3AVH A;  4DF8 A;  1VSH A;  1NK0 A;  3ZT0 A;  3V9S A;  3F9K A;  4Z4G A;  5C24 A;  4C8M A;  4DSK A;  3ASM A;  4CEC A;  1RNH A;  3L2Q A;  3SCX A;  2G8H A;  3WNG A;  1SKS A;  4M3T A;  2KFN A;  3RR8 A;  1WSF A;  1TAQ A;  3ZSV A;  3QES A;  2I5J A;  3VQQ A;  1HNV A;  4CEZ A;  4XIU A;  1EX4 A;  2IC3 A;  4J2B A;  1IO2 A;  1BQN A;  3DLE A;  2GBZ A;  3K5M A;  1C1A A;  2Z1H A;  3DYA A;  4KKO A;  2XY5 A;  4ZTF A;  3PUF A;  4HUF A;  4FW2 A;  4LD0 A;  4LH5 A;  4Z4C A;  4FLU A;  1N6Q A;  4BWM A;  4W5T A;  2FBX A;  2HVH A;  4ID5 A;  4M3W A;  3KD5 E;  4FK4 A;  4W5R A;  3AO5 A;  4CJE A;  1DLO A;  2QKK A;  3CYM A;  2G8I A;  4IKF A;  2BGG A;  4ICL A;  4G1Q A;  3VQ6 A;  3NHG A;  1YTU A;  2D0C A;  5FRM A;  1CZB A;  2BE2 A;  3VQ9 A;  4CHO A;  2HHS A;  1JLC A;  1D9D A;  3IS9 A;  3TAE A;  4IFY A;  4DF4 A;  4Z4E A;  1JLG A;  1KLN A;  1T7P A;  3AA5 X;  3AVI A;  3DRS A;  3RMD A;  3KLF A;  1YT3 A;  3VQ7 A;  3OS0 A;  3OYM A;  1TL3 A;  3ALY A;  5FDL A;  1T05 A;  1RT6 A;  4B9N A;  3P83 D;  3KLE A;  1CZ9 A;  3ZT2 A;  4ZHR A;  4KV8 A;  3TR8 A;  4M45 A;  4QCL A;  4ELU A;  1S9E A;  4E0D A;  4Z4H A;  1RIL A;  4QAG A;  1RBU A;  3E01 A;  2B4J A;  1RT1 A;  3LPU A;  2JLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...