3AV9A

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 57
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3av9A00
4DG1A 4CEOA 1S1XA 3LALA 3KJVA 3DLRA 3NF7A 4LSNA 3K5MA 1QS4A 2A1SA 4CK2A 3PO4A 3C95A 3PY8A 1X1PA 2E4LA 4KFBA 1HRHA 5CY4A 2XHBA 2DTUA 4FLTA 2JLEA 3TAQA 4CEQA 1ZBLA 3RR7A 3AVMA 1VSJA 4OGCA 4I9QA 3U3GA 4I2PA 3ZCMA 4B08A 1Z26A 4Z0UA 3NGYA 4J2BA 3KLEA 3V9SA 4FJGA 1GOBA 1EP4A 4IG0A 4E7JA 4KKOA 3ZT4A 4CJQA 3HPOA 2HHTA 1JL2A 1R0AA 3MEEA 3ZSVA 2XY7A 1NK4A 2ZQBA 2D0BA 4E7LA 3TI0A 4PWDA 4DFPA 4CIEA 3V9ZA 3V9UA 5KRTA 1Q9XA 2G8HA 1VRUA 3VQPA 3L3UA 4CEFA 5I3UA 1LW2A 3OYFA 3AO5A 3AVIA 3LANA 3G0ZA 4F4KA 3VQ7A 1VSIA 1VSMA 1ZBFA 2B5JA 4KTQA 4CHOA 2IAJA 3PO5A 1RT1A 1A5WA 2GV9A 3OVNA 3KD1E 1SV5A 1X9SA 4I2QA 3V4IA 4CESA 2XO7A 1I3AA 1KCFA 4IFYA 2OPSA 3VQDA 1TAQA 4G1QA 3VQ9A 3DYAA 4B8CA 3ZSWA 1WSGA 2VWJA 3CFRA 1RTDA 1S5JA 4CK3A 4N47A 4KI6A 4TSXA 4BWJA 3K2PA 4W5TA 2DFHA 3OYEA 2FC0A 1VSDA 3OYHA 4FJXA 1S9GA 2HW3A 3MEDA 1WSIA 1LAVA 1S1TA 4HCCA 2HNYA 1RBRA 3TAPA 4DQPA 4DTRA 4E1MA 3DM2A 3H08A 1J53A 1YTAA 2YKNA 3AO2A 4RW8A 3ZT3A 3SNNA 1D9DA 4E1NA 4CJFA 1UOCA 5C25A 1SKSA 5CZ2A 2OZMA 3QEVA 4EZ6A 4N41A 3MEGA 3BGRA 4KTZA 3QEPA 1SKWA 1XWLA 3M8SA 2RN2A 4Y1DA 4DQSA 3T19A 1XHZA 1RCHA 1KSPA 2FBTA 2P1JA 3DLBA 3KLIA 2HHWA 4RW4A 4FJNA 1C0UA 1J9AA 4CJVA 4HUGA 3LPTA 4GMJB 3OYNA 1T05A 1CLQA 3HPGA 4E19A 3OYMA 2RF2A 4CJKA 3QEIA 5HP1A 1X9MA 1U47A 4UQGA 4B9TA 4Q5VA 4DU1A 1T03A 3KKSA 1UA0A 4KREA 2A1RA 1IO2A 1WAJA 1DTTA 1YVUA 3SPZA 2F8SA 4OLAA 4CJRA 3AVJA 1ZBIA 4CEDA 2VG7A 3OYIA 5JS2A 5KTQA 4AHRA 4OVLA 4XIUA 2X6SA 3VQ6A 3V6DA 3ZSRA 3PX6A 1JKHA 1Z25A 4E3SA 2LSNA 4B9UA 3VA0A 3JSMA 4AH9A 4CHQA 1QTMA 2HHUA 4LD0A 4CGFA 5SZTA 3SYZA 2D0CA 2D5RA 4IG3A 3VQEA 3L2QA 2NUBA 3D0PA 1XC9A 1QSYA 4N56A 3IAYA 1JL1A 3AA2A 1ZBHA 5HRRA 2KFZA 3VQ5A 1NJXA 4BE1A 4IDKA 1L3VA 3LAMA 1BQMA 1D5AA 1DTQA 4OKKA 3CFOA 5E41A 2HHVA 2WONA 3FFIA 4B8AB 1J5OA 4N76A 1WNSA 4FJMA 1B92A 3SQ2A 4KTWA 5FROA 3O4QA 4DF4A 4M3YA 1WSFA 4B9VA 4FJ9A 3K58A 4AHSA 2OPQA 3DI6A 4E0DA 4FYDA 4CECA 1F21A 3DLKA 4PUOA 3QESA 5FRNA 3L3VA 4DF8A 2IOCA 4FZYA 4DSJA 3WNGA 1U48A 1D8YA 2OPPA 4KHYA 3OYCA 3MECA 2IS3A 3QNOA 4FJ7A 3K5NA 4RW6A 3AV9A 3V1OA 1NK9A 1NKBA 4K8ZA 2DY4A 1IKYA 3V1RA 2ATQA 1TKTA 3AVAA 4CGJA 3C6UA 4DS4A 4RW7A 4DQQA 1ASWA 4DTJA 3CM6A 2G8UA 4J2EA 1JLBA 2XY6A 3LDSA 4OKJA 5HLFA 4ELVA 1QQCA 1WSHA 1TL1A 1CXQA 1HMVA 2P51A 2Q3SA 4CJWA 4DSIA 1KFDA 4Z4IA 2KZZA 4AHVA 1NOYA 1GOAA 3TR8A 4O4GA 3SJJA 3S3MA 4CF1A 3QETA 4KO0A 3TWHA 2O4IA 4DFJA 3WNFA 2ZE2A 4CJLA 1RTIA 5KRSA 4FJHA 4BACA 1VSKA 1KLMA 1HPZA 1RTHA 1WAFA 2BANA 3RRHA 3UIQA 1SL2A 3RR8A 3CG7A 3CFPA 4FJLA 4OGEA 1U04A 4IBNA 4NCAA 1S9EA 3SV3A 2YHBA 3TAFA 4FZXC 4F2RA 4HUFA 4DFKA 4FJIA 3HSTB 3ZT2A 1MU2A 3LZJA 4FXDA 4M3WA 1UAXA 4FJ8A 3KLHA 2B4JA 1W0HA 4O55A 3L8BA 3LP0A 2G8WA 2P5OA 4BWMA 1C1BA 4H4MA 5J2NA 3KK2A 3RMDA 3WNEA 4AHTA 2FBYA 1B9FA 3P83D 3M8PA 1EKEA 3SPYA 2PYLA 2ETJA 5C24A 3T1AA 4FLXA 3QEWA 1KVAA 4FJJA 2BGGA 1S1VA 1IKVA 4WE1A 3KLFA 4K8XA 1NKEA 3DOKA 2RKIA 4EP5A 4M3UA 1QE1A 2Z1JA 5C42A 1SL1A 4Z4GA 2O4GA 1IH7A 5JS1A 1RBSA 4FLYA 4CFBA 4CJ4A 4KPYA 1FKPA 2Z1IA 3NCIA 3HP9A 1BIZA 2X74A 1WN7A 3DOLA 3NF9A 1NK6A 3BDPA 2F8TA 2HHXA 3QIPA 3AA4A 4LH5A 2FBVA 3OYLA 3NE6A 1U49A 3O4NA 1NK8A 2HMIA 4NCBA 4Y1CA 3OS1A 3LWMA 2W42A 4IKFA 5K14A 4HHTA 4M3ZA 1FKOA 4DTUA 2QK9A 3OYKA 4HVJA 2PY5A 5DMRA 3NAEA 3G10A 3NFAA 4CJ5A 2RPIA 1YT3A 3LP2A 1SUQA 5CYMA 3AVLA 1S1WA 1LWCA 4O0IA 3NGIA 1RT5A 4KI4A 3DLEA 4I7FA 2HHSA 3HYFA 4JRQA 4GW6A 4DTPA 4RW9A 4CE9A 3SQ0A 3DMJA 1NK5A 2GBZA 4CHNA 5FDLA 1L3UA 2WOMA 3AA5X 3AVFA 4QOZB 4CERA 5J1EA 3VQ8A 5FRMA 4FM0A 1T8EA 2OPRA 2Z1HA 5HRPA 1A5XA 1BCMA 1I39A 1LAWA 2VG6A 3B6OA 2G8VA 2OZSA 4KHNA 1RBVA 3DRSA 4FVMA 1VRTA 1DLOA 1J54A 2HB5A 2FBXA 3EYZA 2BDPA 4FK4A 2PYJA 4PQUA 3KD5E 4N5SA 3KTQA 2DFEA 1BL3A 2P5GA 4B9SA 4O5BA 1SKRA 1YTUA 1KTQA 3TANA 1ASVA 4FLWA 3RMBA 4F3TA 1NJZA 1NKCA 2AJQA 1VSHA 4JS5A 4DSLA 4DS5A 1G15A 1HJRA 1HYVA 1K6YA 3IS9A 2XY5A 3IG1A 3OYGA 3OS2A 4ZTFA 4FK2A 2X78A 4ID1A 3SI6A 2VG5A 1BI4A 3OYAA 1XI1A 1HQEA 3NGZA 4NYFA 5CZ1A 3CQ8A 1UA1A 4FLVA 1S1UA 1Q8IA 5I42A 1NJYA 4F8RA 1JLCA 4CHPA 4KAZA 4FCYA 5HRSA 4C8KA 1SL0A 4JS4A 3SUQA 3I8DA 4EP4A 3O3GA 4DTXA 4KHUA 1TK8A 1RT7A 4NCGA 2Z1GA 4LY7A 4OPKA 4KHSA 4QCLA 1U45A 1C1AA 4CF0A 5HROA 2G8IA 3NF6A 5HRNA 1NJWA 5SWMA 5CYQA 2KZMA 3ZT0A 3SQ4A 2ZD1A 3QEXA 4EZ9A 3PUFA 4HCBA 3HVTA 3TAEA 4KHQA 3ALYA 3SUNA 1TK0A 1JLFA 1RT6A 1QHTA 4E7IA 3TARA 4M45A 5KGXA 3U3YA 4OKEA 2QKBA 2ITGA 3MXJA 5DK5A 4CHYA 3NH2A 4CIFA 4CJPA 4YNQA 2D0AA 3SUPA 4JLHA 3KLGA 2YV0X 4E7HA 1HQUA 4RG8A 3U6FA 3HPHA 3ASMA 1S6QA 3MAQA 1JLGA 2PZSA 3C6TA 2HVHA 3OJUA 4F2SA 4E89A 1IKXA 3O3FA 3K59A 3LPUA 4CGIA 4FJKA 3SUOA 3OYJA 3PX4A 4BDPA 1TL3A 4DTMA 1WSEA 4DU3A 4CEZA 1TKDA 3QLHA 3VQQA 3TAGA 4BE0A 1Q9YA 1WSJA 1RBTA 3DLGA 1RTJA 4ID5A 4W5NA 1HNVA 3D45A 1EXQA 3NF8A 4BDZA 1RT3A 1JLEA 3OYBA 3HM9A 4FW1A 4CEAA 4CFCA 5KI6A 3K57A 3B6PA 4O0JA 2GUIA 3ZT1A 5J2MA 3SCXA 4KB0A 1VSFA 1BIUA 1GOCA 1X9WA 4DLGA 3VA3A 1KVCA 4GVMA 4CEBA 1TVRA 4CGGA 1C0MA 3OS0A 1ITGA 2HNDA 2YHAA 4W5RA 3V9XA 2YKMA 1L3SA 3AA3A 1ZBUA 3HP6A 3HXMA 4M3RA 3WNHA 4ZTJA 4F3OA 1LV5A 1HYSA 1FK9A 1NK0A 2F96A 4I9LA 3OYDA 2KQ2A 3S3NA 4L8RB 2E6LA 4ZHRA 4OJRA 1B9DA 1A5VA 4KHWA 3F9KA 4DSKA 3NH0A 3T3FA 3A2FA 2JGUA 4Z4EA 2B6AA 3P5JA 3QIOA 4HTUA 1BQNA 2YNIA 1KLNA 1XHXA 4J2DA 1NK7A 1S6PA 1CZBA 2EX3A 4E7KA 1VK0A 4DTNA 3KK1A 3JYTA 2Y1IA 3QNNA 4NYNA 1ASUA 4CCHA 4CEEA 4YFUA 2IC3A 1EETA 3PX0A 3VN5A 4Z4FA 4CFAA 3E01A 1TAUA 3ZSXA 3ZSZA 3NH1A 3MXMA 1QSLA 3NBPA 3L2RA 3S9HA 2DFFA 4OPJA 2X6NA 1HYZA 4H4OA 3ISNC 4W5OA 3QINA 4DSEA 1L3TA 3QO9A 2KTQA 3K5LA 3L2WA 3RMCA 2Y1JA 3ITHA 1TGOA 5D3GA 4DU4A 4DLEA 2OYQA 3RTVA 4IFVA 4OLBA 1JXBA 4C8LA 1C0TA 1FXXA 1L5UA 2OA8A 4Z4HA 3CM5A 4FZZA 4PA1A 1ZYQA 3AVGA 4DFMA 2KFNA 3OY9A 2IDOA 3LZIA 3KKRA 2HVIA 1N5YA 4ICLA 2G8FA 3LP1A 3HK2A 3AO4A 3RRGA 4CJUA 4DTSA 4CGDA 4CJTA 3PV8A 3DRRA 2G8KA 1RDAA 4B9LA 3LP3A 1Y97A 3AVBA 4DTOA 2QXFA 1D9FA 1N6QA 1W9HA 1WLJA 3AVNA 4CJEA 3HT3A 2IGIA 3NDKA 3TABA 3P1GA 3KK3A 3I0SA 3M8QA 3ULDA 3HO1A 1RBUA 4B3OA 5J2PA 1HNIA 1O1WA 4AHUA 4H8KA 4KRFA 2YNHA 4LSLA 2XRIA 4LH4A 4BDYA 1U4BA 3O3HA 4DWIA 4CF2A 4CJSA 1TKZA 1RILA 3MXIA 2BE2A 4KV8A 3LAKA 2EHGA 1UWBA 3ZSQA 4W5QA 3L2VA 1LWFA 1RT2A 1NOZA 1VSEA 1REVA 3ZSYA 2XY8A 1QSSA 4AILC 1T7PA 2HNZA 4CFDA 3QERA 3V9WA 3IRXA 4J2AA 3LWLA 4MQ3A 4AHCA 1BISA 4Q0BA 5HBMA 3HL8A 5T7BA 4M3TA 1EX4A 4CJ3A 4M42A 4HUEA 1BGXT 2E6MA 1BI4B 4ELTA 1CZ9A 2VWKA 3RWUA 4Z4CA 4DQRA 2YNGA 4QAGA 4CHZA 3M8RA 3SZ2A 3V81A 3OJSA 1RT4A 3AO3A 4FM1A 4DQIA 3AVKA 3SV4A 1CXUA 1LWEA 4ELUA 3EY1A 1TK5A 1TKXA 1TV6A 1BCOA 1LW0A 2YNFA 4O44A 1RNHA 1RDDA 4FM2A 1KVBA 1IG9A 1C1CA 3CYMA 4CGHA 4DMNA 3K5OA 4CF9A 4R5PA 3V1QA 4PY5A 1KFSA 4MFBA 3HJFA 1JXEA 4C8NA 4B9NA 2QKKA 4FLUA 3VQBA 3DLHA 3VQAA 4CF8A 4FJ5A 3DRPA 5EU7A 2R7YA 4FLZA 4JRPA 3I0RA 3VQCA 3S3OA 4CK1A 4B9MA 4BE2A 2I5JA 4M41A 3AO1A 2KW4A 4KB1A 4M3XA 3VQ4A 3AVHA 1RDBA 1BHLA 5KGWA 3THVA 3F73A 3SQ1A 4FK0A 3EZ5A 1RDCA 1JLQA 1JLAA 4FW2A 5J2QA 1IKWA 3AVCA 3TAMA 1VSLA 4C8MA 3HVRA 1KRPA 3RMAA 4DSFA 3L2UA 4C8OA 2HHQA 3NHGA 3KIOA 3ZSOA 3C94A 1C6VA 4CIGA
chains in the Genus database with same CATH superfamily
4DR4K 4MDBA 2A1SA 3A5LC 3PO4A 3GDQA 4KFBA 3O6WA 5KQDA 4I9QA 4BRCA 2QTDA 2NRTA 4NLBA 2FSJA 1Z26A 3KLEA 4FJGA 3TSUA 1EP4A 4KKOA 4LF9K 3QDKA 1JL2A 1NK4A 3MEEA 2CH5A 4U7BA 4JI6K 1DKGD 1KXPA 2O8CB 2QW9A 4CZMA 3L3UA 4CEFA 3OYFA 3AVIA 3LANA 2B5JA 1OH5A 3PO5A 4IO9L 3CQXA 4BRQA 5TKYA 1I3AA 4DV7K 5BN9A 3DYAA 3T69A 2VWJA 4I6MA 2UXBK 1RTDA 3LL3A 3O9TA 4CK3A 2P9SB 5JVHL 4BWJA 4FJXA 1S9GA 3QBWA 1LAVA 2E20A 1RBRA 4DTRA 1NJIO 3DM2A 5AQZA 3AO2A 1YTAA 1QQMA 3SNNA 5ELZA 4E1NA 4MLEA 4CJFA 5CZ2A 4EZ6A 3QEVA 3H1VX 1BOTO 3M8SA 1IJJA 3BF3A 1KSPA 1S72N 3DLBA 3THWB 4HUGA 3LPTA 4L3QA 2PBDA 1CLQA 2E2PA 4CJKA 3DXMB 4B9TA 3VTHA 1NGJA 2P9UA 3FZKA 3KKSA 3SPZA 2F8SA 1WBBA 1RDUA 4CEDA 3FE1A 4KH4A 2PFUA 3PX6A 1J6ZA 4LD0A 2GWJA 3SYZA 3VQEA 3F5TA 4IDKA 4YDUC 1L3VA 3LAMA 1DTQA 3ATVA 5KPZA 1J5OA 4DR2K 4IEEA 4N76A 5C15A 2KKZA 1FJGK 3ZEUA 4A62A 5FROA 1WSFA 4B9VA 1TYQA 3CJAA 3O8MA 3QESA 4ISGA 3WNGA 4BRKA 1U48A 4KHYA 4FJ7A 3AV9A 4QS8A 3SJHA 4QS7A 1NKBA 1IKYA 1KC8O 2IVPA 3WUHA 4DQQA 1ASWA 4DB3A 2A42A 1JLBA 4GV9A 4AHVA 4BR9A 1NOYA 4JI4K 4DFJA 4FWMA 2HF4A 1HNXK 3E9OA 1RTHA 1HPZA 4X62K 3RRHA 5GAEP 1SL2A 3RR8A 4BC3A 2O8BA 4FJLA 2GTDA 3SV3A 5ADXH 3JAMO 4DV0K 3ZT2A 4M3WA 1UAXA 4JKDA 5BREA 4O55A 3L8BA 3E9PA 1C1BA 4H4MA 3MN9A 3ZETA 4CZHA 3WNEA 3C65A 1OVQA 2ZM6K 2YX6A 2ETJA 3QEWA 2YI1A 1IKVA 4UY8O 4LFBK 2FSNA 1QE1A 3ENBA 5C42A 4OX9K 2VWBA 5JS1A 4FWRA 3G25A 5AZJB 3GE1A 3CCEN 3HP9A 1BIZA 5FPEA 1WN7A 4FOEA 5C2DA 1NK8A 2GELA 4IO8A 4XH1A 4HHTA 2ASMA 1C0GA 3M6GA 4CJ5A 4C1NI 3D2EA 3HOTA 5CYMA 1JJ2M 1ILYA 3DXKB 3VPZA 3NGIA 4O0IA 1RT5A 4KI4A 4K41A 1MWMA 4GNIA 4DTPA 4RW9A 4BR0A 1ZBSA 5FDLA 2D0PA 1L3UA 3AA5X 3D2EB 5AQQA 3VESA 4CERA 5J1EA 3VQ8A 1I39A 2EWSA 4CW7B 4KHNA 4DKWA 3O08A 1J54A 3U9ZA 3VEXA 4PQUA 2ZGZA 5AQFA 4DV4K 4PKHA 5GIPA 1NKCA 3SAFA 1HYVA 1K6YA 4A2BA 4DR1K 3SI6A 2VG5A 1HLUA 2P9NB 3M3ZA 3OYAA 1BG3A 3KVGA 5CZ1A 1NJYA 2G8HA 1S1UA 2OTLN 5HRSA 3SUQA 3I8DA 3O9SA 4KHUA 2Z1GA 2CGKA 5E84A 3VEOA 2IVNA 4DUZK 2UUCK 1BO5O 2Q97A 1HKBA 3TAEA 1RT6A 1QHTA 3FZFA 4M63C 5KGXA 3TARA 2NRHA 2ITGA 3M1FA 3MXJA 4CJPA 4M7YA 3EE9A 5M1OA 5KPRA 3CF5L 3TTCA 3U6FA 1R59O 3B8AX 2FLOA 2PZSA 3C6TA 2HVHA 2ZGYA 3N4PA 3R1XA 4A5BA 3OYJA 2ZJRL 4DU3A 3EZWA 1TKDA 3VQQA 4JKFA 1Q9YA 1IBMK 1RBTA 1RTJA 2YHWA 3NF8A 3D7EO 3WEEB 1JLEA 4FW1A 4JK8A 4CEAA 2QK9A 3CI5A 3K57A 3A0IX 1VSFA 1BIUA 3GL1A 4DV3K 4BGBA 4GVMA 1TVRA 2YHXA 1C0MA 2HNDA 1LCUA 3V9XA 3AA3A 1VHXA 1ZBUA 4M3RA 3WNHA 3S3NA 1VQ8N 3F9KA 1GLFO 3HM8A 3TTFA 3A2FA 3U8XA 3QIOA 1KLNA 4JV5K 1IV0A 1CZBA 4E7KA 3D2FA 4CBXA 2Y1IA 5EVZA 4BRPA 3TTDA 4CCHA 1EETA 2NNWA 3CCSN 3L2RA 2D1KA 1IBKK 2DFFA 1Z05A 4BRAA 3ISNC 4W5OA 1DEJA 4CZIA 3L2WA 2Y1JA 4H0TB 2ZJPL 3VERA 3MCPA 1KD1O 1C0TA 4H0VB 4Z4HA 4PA1A 3AVGA 4DFMA 3S41A 3KKRA 4YOXA 2G8FA 2UYTA 3LP1A 3HK2A 4IJNA 3RRGA 4CJTA 4EIAA 5C12A 4B9LA 2QXFA 1W97L 2DPNA 3AVNA 3KK3A 1RBUA 4IDHA 5J2PA 2YNHA 4K42A 1BU6O 4BDYA 4NXMK 4FWKA 4CF2A 2QM1A 4KV8A 3OTOK 2EHGA 4W5QA 3L2VA 1BWFO 1RT2A 1NOZA 1REVA 5FLXO 1N36K 2CGJA 3LWLA 2YJFA 4Q0BA 3HL8A 1NGEA 4ELTA 2E1ZA 3TSQA 1CZ9A 1K9MO 3R9PA 4QAGA 3SZ2A 3V81A 3M8RA 3AO3A 3AVKA 4BG8A 3SV4A 3HRGA 4ELUA 5IT9O 3FLCO 3CC7N 1RNHA 3AAQA 3HI0A 1IG9A 4CGHA 4FLZA 4JRPA 3I0RA 1VAZA 4B9MA 1YIJN 4KB1A 4M3XA 3VQ4A 3AVHA 4MDAA 4BRGA 1BHLA 5KGWA 3THVA 3SQ1A 4FK0A 5J2QA 4FW2A 1HNZK 3TAMA 1XQSC 3HVRA 3RSEA 4H5NA 4ILGB 3NHGA 1QSLA 4CIGA 3LALA 3NF7A 4EFHA 4PKGA 1X1PA 1Y64A 3J8AA 2O8EB 1ZBLA 3AVMA 1VSJA 1SAZA 2QWPA 5AJ3K 4CZGA 4B08A 4J2BA 1GOBA 4E7JA 4IG0A 4JHDA 5FPDA 1R0AA 2ZQBA 2D0BA 3AY9A 3TI0A 4PWDA 5JMVA 4DFPA 3V9ZA 3V9UA 4MLHA 3T1HK 5AZIA 3THXA 3AARA 3G0ZA 1ZBFA 4KTQA 4JI1K 3KD1E 1X9SA 4I2QA 3TPQA 4BREA 3J7AP 2H3GX 3VQDA 1TAQA 4G1QA 3EL2A 4WQ4C 1W2BM 4E1JA 1S5JA 4B3SK 1KAYA 4N47A 4KI6A 4FWSA 2DFHA 5M1KA 1K8KB 4CD3A 1YI2N 3OYHA 3SK3A 5GINA 3PIPL 3WXJA 4JI0K 3CXCM 3TAPA 2YKNA 2YJEA 5M1FA 1LOTB 1YAGA 4N41A 2JWKA 3BGRA 3FR0A 2E2NA 3NVKA 2GEMA 4DQSA 3T19A 4JKHA 1XHZA 1RCHA 2P1JA 4H5RA 5AQGA 1I94K 4FJNA 1C0UA 1J9AA 4CJVA 3G71N 2HHWA 1HX1A 4GMJB 5LJVA 3OYNA 1T05A 1N33K 1NBWA 2V51B 1U47A 1GLAG 3KHYA 4DU1A 1YHQN 1T03A 2A1RA 1WAJA 1DTTA 1YVUA 1Q7YO 3AVJA 4NLCA 3O80A 3OYIA 5KTQA 4AHRA 1E4GT 2X6SA 3AGRA 3SMPA 3ZSRA 1Z25A 4E3SA 1VQ4N 2HHUA 3VA0A 3JSMA 4AH9A 3LM9A 3SAHA 1BA0A 2D5RA 4M3UA 2NUBA 4N56A 2KFZA 1JL1A 1ZBHA 5ADXA 5HRRA 1T44A 1XNQK 1NJXA 1GLCG 1HUXA 2HF3A 1BQMA 3M5RA 3CFOA 4B8AB 4FJMA 5H1SQ 4KTWA 4U67L 4M3YA 2P9IA 4JK9A 3A5NC 3ZX0A 4B1XB 4FYDA 1F21A 4PUOA 2FF3B 3GG4A 2IOCA 4DSJA 4DR3K 3L0QA 3OBYA 2CGLA 1NK9A 4K8ZA 2ITMA 4CGJA 1TKTA 3C6UA 4RW7A 3E1YA 1QZ6A 3LDSA 1QHAA 5HLFA 1WSHA 2J4RA 1HMVA 1TUYA 4Z4IA 5JICA 4DSIA 1KFDA 2WC9A 3S3MA 3RSEB 2ZE2A 1RTIA 1VSKA 3WXIA 5KPTA 1Q86O 1D4XA 4GV3A 1O13A 3E9LA 5FPNA 3CFPA 3DLLL 4DHYA 4IBNA 4NCAA 2O8EA 1S9EA 1NGBA 3TAFA 4DFKA 3HSTB 3KLHA 1N34K 3CMEN 3LP0A 2G8WA 4BWMA 5J2NA 3RMDA 1HNWK 1B9FA 4FWOA 2BGGA 3T1AA 1KVAA 1S1VA 4K8XA 4GKJK 2NRZA 2RKIA 5AQOA 3CJ9A 4CJ7A 4YOWA 1SL1A 2O4GA 4KPYA 4CJ4A 3THXB 3NCIA 4B1VA 2F8TA 4B3RK 2FBVA 3FZMA 4LFCK 4BGAA 1N32K 5EX5A 3LWMA 4IKFA 4V19S 5K14A 4M7XA 1FKOA 3IDHA 2RPIA 1YT3A 3MMVA 4JI7K 1RDWX 4BG9A 2HHSA 4BVPA 2F7TA 3SQ0A 1NK5A 2GBZA 3J80O 3AVFA 2BTFA 2OPRA 4JKBA 1BCMA 1LAWA 1NGCA 2VG6A 3B6OA 2G8VA 5M1QA 1NMDA 1RBVA 2NRWA 4FVMA 1VRTA 3VF6A 3EYZA 3I8BA 2PYJA 5HL7L 4N5SA 1BL3A 3SBGA 3RMBA 4JN4A 2UXCK 2NRXA 2AJQA 2CH6A 4ILHA 3H46O 4DS5A 4DV2K 5CHIA 5C0YA 4CZJA 3OYGA 2XY5A 1T6DA 1NGDA 1BI4A 1XI1A 3CQ8A 4NYFA 4F8RA 5I42A 4FL9A 2ASPA 4XEIA 3G6EN 3ZX3A 4YOYA 4C8KA 1S22A 2YCHA 4EP4A 3O3GA 4DTXA 4Z94A 1TK8A 1RT7A 4LY7A 4QCLA 4CF0A 4A57A 2G8IA 5C10A 3AGKA 1VQPN 3ZT0A 4X64K 3SQ4A 4IZ9A 3QEXA 4EZ9A 4KHQA 4PL8A 4BR5A 1TK0A 2I7PA 2P9IB 3U3YA 4CHYA 3NH2A 1C0FA 3KLGA 1U2VB 4K0KK 3HPHA 3ZYYX 1S6QA 4BRNA 4F2SA 5IWAK 4GVEA 5GIOA 1OH7A 2OANA 2IIRA 3LPUA 4FJKA 4FWPA 4BDPA 5AQKA 1ZXOA 4ID5A 4H0YB 1HNVA 3D45A 1EXQA 4K25A 1BA1A 2Q31A 4BDZA 1VQLN 1RT3A 1E3MA 4YY3K 3O9UA 4CFCA 3SCXA 4KB0A 1X9WA 3VA3A 4BC5A 3EO3A 1KVCA 3GBTA 4CGGA 3CERA 3A5MC 4ZTJA 3HXMA 4F3OA 1LV5A 1FK9A 2F96A 4I9LA 2E6LA 1A5VA 4BC2A 5F2RA 3NH0A 4GY2B 4WFAL 4Z4EA 3P5JA 2YNIA 1NK7A 4FOIA 4CEEA 3Q7CA 1TAUA 1U6ZA 3S9HA 3TSPA 3LDQA 4I6MB 4DSEA 3ZX2A 2KTQA 4K43A 4MO5A 5BN8A 2NRVA 1KAZA 1JXBA 2KFNA 1ZYQA 3WXLA 1X3NA 3J7ZO 1YJWN 2HVIA 1N5YA 3KZBA 3ID8A 3MCAB 4JI2K 3DRRA 2G8KA 3F9MA 1ESVA 1YXQA 4DTOA 4JKGB 1WLJA 4WQ5A 1NNEA 3VMFB 3A5OC 3P1GA 4B3OA 4AHUA 4H8KA 4DWIA 1TKZA 3MXIA 4JKGA 1UWBA 2QXLA 2P9PB 3ZSYA 4BR7A 5LJWA 3WXKA 5LMUK 3IRXA 4AHCA 3EE8A 3LM2A 4M3TA 2E1YA 1BI4B 4LC9B 3C0BA 3RWUA 4FM1A 4DQIA 1M90O 1YJNN 4O44A 4FM2A 5AQRA 3G4SN 1C1CA 4DMNA 2HBJA 3HJFA 4C8NA 4B9NA 2QKKA 4FLUA 3E66A 4CF8A 4FJ5A 5AQMA 4PHTX 2I5JA 1RDBA 1JLQA 2UUAK 3UE5A 2O8FB 1QZ5A 1IG8A 3KWIA 1VSLA 4C8MA 5B8HA 5BRFA 4H5TA 4BRHA 4C8OA 2WFBA 3OYCA 3MX5A 3BDPA 2HBMA 4CEOA 3F2KA 1S1XA 3DLRA 3LDPA 4LSNA 2FF6A 4CK2A 4DR6K 3C95A 3PY8A 4NXNK 2E4LA 1HRHA 2F9TA 5CY4A 2DTUA 3CJCA 4FLTA 2JLEA 3L4QA 3RR7A 4CEQA 4OGCA 1VQNN 3U3GA 4I2PA 3V9SA 3GOIA 2D4WA 3HOSA 3HPOA 5EOYA 2HHTA 5I9EB 3ZSVA 4E7LA 4A61A 5KRTA 1Q9XA 1VRUA 4H03B 3CCRN 3OBWA 5JLFA 3VQ7A 1VSIA 1VSMA 4BC4A 1RT1A 2GV9A 3OVNA 4AM7A 3O9QA 3V4IA 4CESA 4B8CA 3ZSWA 1WSGA 4EHTA 4MO4A 3CMAN 4RWTA 4BY9C 3QFUA 4JK7A 3K2PA 2FC0A 3DXKA 1VSDA 1G99A 4IEIA 4IWVA 4KHPK 1WSIA 1S1TA 1XMOK 4HCCA 2HNYA 4H5VA 4DQPA 4E1MA 3H08A 5M1PA 1D9DA 1UOCA 2P9SA 4BRDA 5C25A 1SKSA 4B3TK 3DXMA 2OZMA 3MEGA 1WOQA 4KTZA 3QEPA 1SKWA 1XWLA 5AQIA 2RN2A 3W0LA 2UXDK 4RW4A 3MK6A 1SQKA 4JNEA 3QEIA 1X9MA 4KREA 2VGMA 4FPAA 4CJRA 2VG7A 2A6AA 5JS2A 3THWA 4XIUA 3VQ6A 3V6DA 4NB4A 1JKHA 2W6LA 4FSVA 4B9UA 4A5AA 1JCGA 4CHQA 2DY4A 4IG3A 3L2QA 1Q18A 3VEZA 4DR5K 2OCEA 3IAYA 3P4IA 3VQ5A 4BE1A 1D5AA 1JCEA 4OKKA 2A3ZA 5E41A 1HR0K 2WONA 3SQ2A 3CC4N 2O8DB 1VQMN 4DF4A 3PSIA 4FJ9A 1QVFM 4IJAA 3DI6A 3H6EA 1XUPO 3DLKA 5FPMA 5FRNA 3L3VA 4FZYA 1D8YA 3MECA 2IS3A 3QNOA 4LF5K 3K5NA 3V1OA 3ATUA 1VQ5N 4DS4A 2G8UA 3FZHA 4J2EA 3CM6A 4OKJA 4ELVA 1QQCA 1CXQA 4CD1A 4IOCL 2Q3SA 2KZZA 3HBTA 3TR8A 4O4GA 4KO0A 5JVGL 5AFUA 3WEEA 3TWHA 3WNFA 1OKJA 4CJLA 2O4IA 1JCFA 3VGMA 4BACA 2BANA 1KLMA 3J81O 4WQ4A 3CC2N 3CG7A 4R79A 2YHBA 4F2RA 4HUFA 3VEVA 1NLVA 3LZJA 4FJ8A 1IBLK 2B4JA 1W0HA 5AZJA 5F1XA 2P5OA 2Q36A 3KK2A 3L4IA 2O8BB 3P83D 3M8PA 1EKEA 3SPYA 2PYLA 5C24A 4FLXA 4WE1A 3CCJN 3KLFA 3VETA 1N8RO 2GWKA 1GLDG 3D2FB 4EP5A 2O8CA 2V7ZA 4CZLA 1OH6A 1SZ2A 1CZAN 1RBSA 1ATNA 4DUYK 4CFBA 1FKPA 3NF9A 5BRHA 2HHXA 3QIPA 3NE6A 3C7NB 2HMIA 2QWNA 3OS1A 4EHUA 4JYAK 3EEQA 3SBTA 3OYKA 4HVJA 2PY5A 5DMRA 3NAEA 2ASOA 3FZLA 3NFAA 2QEXN 3BF1A 4LF8K 4HWIA 3C7NA 1S1WA 1LWCA 1ATSA 4XH4A 4X66K 4JRQA 4GW6A 1YJ9N 4KH5A 4YDUA 4F9OA 3DMJA 3CETA 4CHNA 5CE3A 3QFPA 1QQOA 1T8EA 5HRPA 3CCUN 3DRSA 2E2OA 2BDPA 4RCHA 4WCEL 3KD5E 2P9NA 3KTQA 2DFEA 3ENOA 4B9SA 3MN7A 1SKRA 1YTUA 1KTQA 3TANA 4BR2A 4FLWA 1NJZA 1VSHA 4JS5A 4BRFA 2IVOA 4DSLA 1OVYA 1HJRA 3IS9A 3IG1A 4FK2A 4H0PA 2NZTA 3NGZA 3BY5A 1Q8IA 1QVGM 4ISFA 1SL0A 3PLAA 3CHWA 3O1WA 3VF2A 5AQNA 4OPKA 1U45A 1C1AA 5HROA 3NF6A 3IFRA 4EAHD 1NJWA 5SWMA 3K9KA 5CYQA 3ZEUB 3CD6N 4Y0WA 4GV6A 2O8DA 3CCLN 3KK7A 4HCBA 3PUFA 3H1QA 3VEWA 3SUNA 1TYQB 2Q0RA 2KHOA 1Q82O 4CIFA 2HSTA 4JLHA 1HPMA 2YV0X 5A2QO 4E7HA 1HQUA 5DM7L 3ASMA 4YORA 3MAQA 4A2AA 5GAGP 3W3DA 1VQ7N 4H0XB 1IKXA 2BUPA 1FW6A 2QWMA 5GAHP 2WBNA 4DCHA 4CEZA 3QLHA 4IOXA 4BE0A 3DLGA 3OYBA 3HM9A 1K8AO 5KI6A 3B6PA 3PSFA 2GUIA 4O0JA 3ZT1A 2E2QA 5C2FA 1GOCA 3MWTA 4WFNL 2Q1NA 1ITGA 2YHAA 4IXCA 4JHDB 4W5RA 4XH5A 1HYSA 2VGNA 1NK0A 2HMPA 3OYDA 2Q2RA 4OJRA 3ZETB 4HTUA 1BQNA 5AZIB 1S6PA 2EX3A 3OA9A 1E4FT 1VK0A 4DTNA 3KK1A 1EWRA 4NYNA 4YFUA 2IC3A 3VN5A 3ZSXA 3SLCA 3ZSZA 3NBPA 4AQYK 4OPJA 2X6NA 4H4OA 3WQUA 1KAXA 1L3TA 3K5LA 2GUPA 3RMCA 5BPMA 5D3GA 1V4TA 1WB9A 2Q0UA 3RTVA 3HZ6A 4OLBA 4C8LA 1FXXA 1L5UA 3OY9A 4DV1K 1MDUB 3LZIA 5BPLA 4ICLA 3AO4A 2VQEK 4CJUA 4DV5K 4CGDA 5LY3A 4H0OA 1Y97A 3AVBA 1D9FA 1N6QA 2F4VK 4CJEA 3HT3A 4BRMA 3NDKA 3A8YA 3TABA 3I0SA 3M8QA 5HOOA 3NMUA 1HNIA 1O1WA 4KRFA 4LSLA 3WXMB 1U4BA 3O3HA 1P8ZA 3P39A 1TUUA 4CJSA 2BE2A 3LAKA 1LWFA 4BRIA 2XY8A 1KQSM 2HNZA 3L6QA 5BR9A 1NGGA 4B1UB 3J7YP 2BH1A 5HBMA 2QI2A 5T7BA 4YOTA 4JD2A 1YF5L 4M42A 4HUEA 1BGXT 4LF4K 5AQXA 2YNGA 1DT9A 1CXUA 1LWEA 2V52B 1TK5A 1BCOA 4OPAA 2YNFA 1VQKN 1RDDA 1KVBA 3CYMA 3ID6A 3K5OA 3U4LA 4BRLA 3DAWA 2QA4N 2V7YA 4CI6A 3DRPA 5EU7A 3VTIA 3VQCA 4BE2A 4M41A 4HTLA 3AO1A 5AQVA 3F73A 3O5BA 1RDCA 2JWLA 1IKWA 3RMAA 2HHHK 1EO1A 4PL7A 4B1YB 3C94A 5MLCQ 3VENA 5EXWA 4DG1A 3P31A 1P90A 3KJVA 3K5MA 1QS4A 3C6HA 4O8UA 3MN6A 2XHBA 1J5EK 4DR7K 3TAQA 1YVNA 1WUAA 2AP1A 4FWQA 4G9ZA 1VQ9N 2NLXA 3ZCMA 4Z0UA 3NGYA 4IOAL 2W41A 2HOEA 4NO7A 3ZT4A 4CJQA 5CR4A 2XY7A 3ENHA 4CIEA 5DM6L 3EKSA 1M1KO 3VQPA 1VQ6N 5I3UA 1LW2A 3AO5A 4F4KA 4CHOA 2IAJA 1A5WA 1SV5A 4WQ5C 2XO7A 4DV6K 1KCFA 4IFYA 2OPSA 4B1ZA 3VQ9A 1W7AA 3HTVA 3OW2M 4JKAA 3CFRA 1XC3A 3ZLJA 5AQTA 4TSXA 3U9DA 4W5TA 3BZKA 3OYEA 2UUBK 2HW3A 3MEDA 3TU5A 3FFKB 1S3XA 4H5WA 1J53A 4RW8A 1ATRA 3ZT3A 2VYPA 4JI8K 1RGIA 5AQLA 4Y1DA 4BR4A 5AR0A 1T6CA 2FBTA 3O9RA 3KLIA 4O5FA 1OH8A 1EQYA 5AQUA 2QWQA 3N4QA 3HPGA 4E19A 3OYMA 2RF2A 5HP1A 4UQGA 4Q5VA 1UA0A 1IO2A 4OLAA 1ZBIA 3FGUA 4OVLA 3H45C 3IMXA 2HBLA 2LSNA 4ILJA 3P38A 1QTMA 4CGFA 4CVNE 5SZTA 2D0CA 5GADP 1QSYA 3D0PA 1XC9A 3AA2A 2F9WA 4JD2B 3MN5A 3AAPA 2HHVA 2GX9A 3FFIA 4JKEA 1GLLO 1WNSA 1Z6RA 1B92A 2PAVA 1ZC6A 3T7ZA 3O4QA 1QQNA 2NRRA 3K58A 4AHSA 2OPQA 5LL6Z 4E0DA 5JLHA 1WBDA 4CECA 3VEYA 1BUPA 4OPHA 4DF8A 4YHHK 2OPPA 4B3MK 3C6AA 3I33A 4RW6A 2QWLA 2YHYA 3O1BA 3V1RA 2ATQA 2FSKA 3AVAA 4YOVA 4DTJA 2I7NA 2XY6A 4CBWA 4FWNA 1TL1A 2P51A 4CJWA 3BEXA 1GOAA 3SJJA 3VF4A 4CF1A 3QETA 1NGHA 4A59A 5KRSA 4FJHA 3R6MA 1WAFA 1SS6A 3UIQA 4KH6A 3EKUA 3LDOA 4OGEA 1U04A 1NMNA 4JI3K 4FZXC 4FJIA 1MU2A 4FXDA 1RFQA 3CJBA 4AHTA 2FBYA 3WQTA 3VGKA 4FJJA 5M1NA 1GLEG 1NKEA 1V4SA 3I55N 3DOKA 2Z1JA 1K73O 4Z4GA 2OTJN 1IH7A 3I56N 4FLYA 4ISEA 4LFAK 3NVMA 2AA4A 1X3MA 2Z1IA 2X74A 2P9LB 5AQJA 3DOLA 1NK6A 4KBOA 3AA4A 1NGIA 4LH5A 3OYLA 1U49A 3O4NA 4NCBA 3PIOL 4Y1CA 2W42A 2ZWHA 3CPEA 4M3ZA 4DTUA 3EN9A 3G10A 3LP2A 1SUQA 3AVLA 1K8KA 5EY4A 4OO1J 3DLEA 4I7FA 2QWOA 3CIPA 3HYFA 4CE9A 4AF1A 4YOUA 4PKIA 2WOMA 1YITN 4QOZB 4BROA 5FRMA 4FM0A 3MDQA 2Z1HA 1A5XA 5TKWA 2OZSA 3CJ7A 3IKMA 4FWLA 3JS6A 4CZKA 1DLOA 2E8AA 2FBXA 2HB5A 4FK4A 4IFEA 3QB0A 2QWRA 2P5GA 1MA9B 2RHKA 3JXUA 4O5BA 4LF6K 1ASVA 4F3TA 5E26A 4B9QA 3MWPA 1G15A 1EWQA 4ZTFA 3OS2A 2X78A 4ID1A 1XMQK 3CCQN 1HQEA 1UA1A 4FLVA 1JLCA 4CHPA 4KAZA 4FCYA 2E88A 3UKRB 4JS4A 4B1WB 2FXUA 4JEPA 4NCGA 4KHSA 4FVUA 1X9JA 5HRNA 1U2VA 2KZMA 2ZD1A 2VCPA 3HVTA 3UKRA 3ALYA 3LDLA 3UB5A 1JLFA 5BRDA 3K0SA 4E7IA 4M45A 4OKEA 2QKBA 2W6KA 5DK5A 4YNQA 2E5LK 2D0AA 3SUPA 4GKKK 3VOVA 4RG8A 3KWGA 2P9KA 1JLGA 3DJCA 3OJUA 4E89A 3O3FA 3K59A 3UKUA 4CGIA 3SUOA 3PX4A 3T1YK 1HKCA 1TL3A 4DTMA 1WSEA 3CQYA 3TAGA 2A41A 1WSJA 1YUWA 4W5NA 3MX2A 5BR8K 3BZCA 5J2MA 1HKGA 2VQFK 3UKUB 4DQ8A 3R8EA 4DLGA 5AQHA 4CEBA 3OS0A 4CBUA 3VGLA 1L3SA 5AQYA 2YKMA 1NWKA 2A40A 3Q7BA 3HP6A 4O8KA 2W40A 4L8RB 2KQ2A 4CZFA 5LMNK 4ZHRA 1B9DA 4KHWA 4BQZA 4WFBL 3T3FA 4DSKA 2JGUA 2HBKA 2B6AA 3CJ1A 4CZEA 1XHXA 4J2DA 3BP8A 3JYTA 5F0XA 3QNNA 1H1VA 1ASUA 3LDNA 3IUCA 1T3VA 3PX0A 4Z4FA 4CFAA 3E01A 3CCVN 4LF7K 2A5XA 3NH1A 3MXMA 2P9LA 1HYZA 4WYBA 4BQLA 3QINA 3QO9A 3ITHA 1TGOA 4DU4A 1GLBG 4DLEA 3CPWM 2OYQA 4IFVA 3HSCA 3OHRA 4FZZA 1NU0A 2OA8A 3CM5A 3D6RA 3SMSA 1VQON 2IDOA 5AFUH 3O4WA 1GLJO 3K9JA 3THYB 2KLAA 4QS9A 4DTSA 4WF9L 1BDGA 3H3OB 3PV8A 1RDAA 3LP3A 2WUSA 1W9HA 3WT0A 2ZJQL 2IGIA 3HO1A 3CCMN 5KQ8A 3ULDA 4FPBA 2P9UB 4X65K 2WTUA 3THYA 2ZF5O 2XRIA 4LH4A 5AQWA 1NG9A 1RILA 1HJOA 3QBXA 5AQSA 3ZSQA 4BVOA 1VSEA 4C1NK 1QSSA 1XNRK 4AILC 1T7PA 1DGKN 4CFDA 3QERA 3V9WA 4J2AA 4JKCA 1Q81O 4MQ3A 1BISA 1EX4A 4CJ3A 3QMLA 5AQPA 2E6MA 2VWKA 3QICA 4Z4CA 4DQRA 4CHZA 2P9PA 3OJSA 1RT4A 1NGFA 1NGAA 4RTFD 3R3LA 2RE2A 3EY1A 1TKXA 4JAXA 1TV6A 1LW0A 3RVCA 4AM6A 5BPNA 4CF9A 4R5PA 3V1QA 4PY5A 1KFSA 4MFBA 1JXEA 1NM1A 2O8FA 3VQBA 3DLHA 3VQAA 2R7YA 3H3NO 3ULEA 3BUZB 4CK1A 2D0OA 3S3OA 2UU9K 4J8FA 2KW4A 4JI5K 4FO0A 3DWLA 3EZ5A 1JLAA 2P9KB 3AVCA 1KRPA 4DSFA 3SAGA 3L2UA 3ULEB 2HHQA 4C23A 3KIOA 3ZSOA 1C6VA 1MWKA
chains in the Genus database with same CATH topology
4DG1A 4CEOA 1S1XA 3LALA 3KJVA 3DLRA 3NF7A 4LSNA 3K5MA 1QS4A 2A1SA 4CK2A 3PO4A 3C95A 3PY8A 1X1PA 2E4LA 4KFBA 1HRHA 5CY4A 2XHBA 2DTUA 4FLTA 2JLEA 3TAQA 4CEQA 1ZBLA 3RR7A 3AVMA 1VSJA 4OGCA 4I9QA 3U3GA 4I2PA 3ZCMA 4B08A 1Z26A 4Z0UA 3NGYA 4J2BA 3KLEA 3V9SA 4FJGA 1GOBA 1EP4A 4IG0A 4E7JA 4KKOA 3ZT4A 4CJQA 3HPOA 2HHTA 1JL2A 1R0AA 3MEEA 3ZSVA 2XY7A 1NK4A 2ZQBA 2D0BA 4E7LA 3TI0A 4PWDA 4DFPA 4CIEA 3V9ZA 3V9UA 5KRTA 1Q9XA 2G8HA 1VRUA 3VQPA 3L3UA 4CEFA 5I3UA 1LW2A 3OYFA 3AO5A 3AVIA 3LANA 3G0ZA 4F4KA 3VQ7A 1VSIA 1VSMA 1ZBFA 2B5JA 4KTQA 4CHOA 2IAJA 3PO5A 1RT1A 1A5WA 2GV9A 3OVNA 3KD1E 1SV5A 1X9SA 4I2QA 3V4IA 4CESA 2XO7A 1I3AA 1KCFA 4IFYA 2OPSA 3VQDA 1TAQA 4G1QA 3VQ9A 3DYAA 4B8CA 3ZSWA 1WSGA 2VWJA 3CFRA 1RTDA 1S5JA 4CK3A 4N47A 4KI6A 4TSXA 4BWJA 3K2PA 4W5TA 2DFHA 3OYEA 2FC0A 1VSDA 3OYHA 4FJXA 1S9GA 2HW3A 3MEDA 1WSIA 1LAVA 1S1TA 4HCCA 2HNYA 1RBRA 3TAPA 4DQPA 4DTRA 4E1MA 3DM2A 3H08A 1J53A 1YTAA 2YKNA 3AO2A 4RW8A 3ZT3A 3SNNA 1D9DA 4E1NA 4CJFA 1UOCA 5C25A 1SKSA 5CZ2A 2OZMA 3QEVA 4EZ6A 4N41A 3MEGA 3BGRA 4KTZA 3QEPA 1SKWA 1XWLA 3M8SA 2RN2A 4Y1DA 4DQSA 3T19A 1XHZA 1RCHA 1KSPA 2FBTA 2P1JA 3DLBA 3KLIA 2HHWA 4RW4A 4FJNA 1C0UA 1J9AA 4CJVA 4HUGA 3LPTA 4GMJB 3OYNA 1T05A 1CLQA 3HPGA 4E19A 3OYMA 2RF2A 4CJKA 3QEIA 5HP1A 1X9MA 1U47A 4UQGA 4B9TA 4Q5VA 4DU1A 1T03A 3KKSA 1UA0A 4KREA 2A1RA 1IO2A 1WAJA 1DTTA 1YVUA 3SPZA 2F8SA 4OLAA 4CJRA 3AVJA 1ZBIA 4CEDA 2VG7A 3OYIA 5JS2A 5KTQA 4AHRA 4OVLA 4XIUA 2X6SA 3VQ6A 3V6DA 3ZSRA 3PX6A 1JKHA 1Z25A 4E3SA 2LSNA 4B9UA 3VA0A 3JSMA 4AH9A 4CHQA 1QTMA 2HHUA 4LD0A 4CGFA 5SZTA 3SYZA 2D0CA 2D5RA 4IG3A 3VQEA 3L2QA 2NUBA 3D0PA 1XC9A 1QSYA 4N56A 3IAYA 1JL1A 3AA2A 1ZBHA 5HRRA 2KFZA 3VQ5A 1NJXA 4BE1A 4IDKA 1L3VA 3LAMA 1BQMA 1D5AA 1DTQA 4OKKA 3CFOA 5E41A 2HHVA 2WONA 3FFIA 4B8AB 1J5OA 4N76A 1WNSA 4FJMA 1B92A 3SQ2A 4KTWA 5FROA 3O4QA 4DF4A 4M3YA 1WSFA 4B9VA 4FJ9A 3K58A 4AHSA 2OPQA 3DI6A 4E0DA 4FYDA 4CECA 1F21A 3DLKA 4PUOA 3QESA 5FRNA 3L3VA 4DF8A 2IOCA 4FZYA 4DSJA 3WNGA 1U48A 1D8YA 2OPPA 4KHYA 3OYCA 3MECA 2IS3A 3QNOA 4FJ7A 3K5NA 4RW6A 3AV9A 3V1OA 1NK9A 1NKBA 4K8ZA 2DY4A 1IKYA 3V1RA 2ATQA 1TKTA 3AVAA 4CGJA 3C6UA 4DS4A 4RW7A 4DQQA 1ASWA 4DTJA 3CM6A 2G8UA 4J2EA 1JLBA 2XY6A 3LDSA 4OKJA 5HLFA 4ELVA 1QQCA 1WSHA 1TL1A 1CXQA 1HMVA 2P51A 2Q3SA 4CJWA 4DSIA 1KFDA 4Z4IA 2KZZA 4AHVA 1NOYA 1GOAA 3TR8A 4O4GA 3SJJA 3S3MA 4CF1A 3QETA 4KO0A 3TWHA 2O4IA 4DFJA 3WNFA 2ZE2A 4CJLA 1RTIA 5KRSA 4FJHA 4BACA 1VSKA 1KLMA 1HPZA 1RTHA 1WAFA 2BANA 3RRHA 3UIQA 1SL2A 3RR8A 3CG7A 3CFPA 4FJLA 4OGEA 1U04A 4IBNA 4NCAA 1S9EA 3SV3A 2YHBA 3TAFA 4FZXC 4F2RA 4HUFA 4DFKA 4FJIA 3HSTB 3ZT2A 1MU2A 3LZJA 4FXDA 4M3WA 1UAXA 4FJ8A 3KLHA 2B4JA 1W0HA 4O55A 3L8BA 3LP0A 2G8WA 2P5OA 4BWMA 1C1BA 4H4MA 5J2NA 3KK2A 3RMDA 3WNEA 4AHTA 2FBYA 1B9FA 3P83D 3M8PA 1EKEA 3SPYA 2PYLA 2ETJA 5C24A 3T1AA 4FLXA 3QEWA 1KVAA 4FJJA 2BGGA 1S1VA 1IKVA 4WE1A 3KLFA 4K8XA 1NKEA 3DOKA 2RKIA 4EP5A 4M3UA 1QE1A 2Z1JA 5C42A 1SL1A 4Z4GA 2O4GA 1IH7A 5JS1A 1RBSA 4FLYA 4CFBA 4CJ4A 4KPYA 1FKPA 2Z1IA 3NCIA 3HP9A 1BIZA 2X74A 1WN7A 3DOLA 3NF9A 1NK6A 3BDPA 2F8TA 2HHXA 3QIPA 3AA4A 4LH5A 2FBVA 3OYLA 3NE6A 1U49A 3O4NA 1NK8A 2HMIA 4NCBA 4Y1CA 3OS1A 3LWMA 2W42A 4IKFA 5K14A 4HHTA 4M3ZA 1FKOA 4DTUA 2QK9A 3OYKA 4HVJA 2PY5A 5DMRA 3NAEA 3G10A 3NFAA 4CJ5A 2RPIA 1YT3A 3LP2A 1SUQA 5CYMA 3AVLA 1S1WA 1LWCA 4O0IA 3NGIA 1RT5A 4KI4A 3DLEA 4I7FA 2HHSA 3HYFA 4JRQA 4GW6A 4DTPA 4RW9A 4CE9A 3SQ0A 3DMJA 1NK5A 2GBZA 4CHNA 5FDLA 1L3UA 2WOMA 3AA5X 3AVFA 4QOZB 4CERA 5J1EA 3VQ8A 5FRMA 4FM0A 1T8EA 2OPRA 2Z1HA 5HRPA 1A5XA 1BCMA 1I39A 1LAWA 2VG6A 3B6OA 2G8VA 2OZSA 4KHNA 1RBVA 3DRSA 4FVMA 1VRTA 1DLOA 1J54A 2HB5A 2FBXA 3EYZA 2BDPA 4FK4A 2PYJA 4PQUA 3KD5E 4N5SA 3KTQA 2DFEA 1BL3A 2P5GA 4B9SA 4O5BA 1SKRA 1YTUA 1KTQA 3TANA 1ASVA 4FLWA 3RMBA 4F3TA 1NJZA 1NKCA 2AJQA 1VSHA 4JS5A 4DSLA 4DS5A 1G15A 1HJRA 1HYVA 1K6YA 3IS9A 2XY5A 3IG1A 3OYGA 3OS2A 4ZTFA 4FK2A 2X78A 4ID1A 3SI6A 2VG5A 1BI4A 3OYAA 1XI1A 1HQEA 3NGZA 4NYFA 5CZ1A 3CQ8A 1UA1A 4FLVA 1S1UA 1Q8IA 5I42A 1NJYA 4F8RA 1JLCA 4CHPA 4KAZA 4FCYA 5HRSA 4C8KA 1SL0A 4JS4A 3SUQA 3I8DA 4EP4A 3O3GA 4DTXA 4KHUA 1TK8A 1RT7A 4NCGA 2Z1GA 4LY7A 4OPKA 4KHSA 4QCLA 1U45A 1C1AA 4CF0A 5HROA 2G8IA 3NF6A 5HRNA 1NJWA 5SWMA 5CYQA 2KZMA 3ZT0A 3SQ4A 2ZD1A 3QEXA 4EZ9A 3PUFA 4HCBA 3HVTA 3TAEA 4KHQA 3ALYA 3SUNA 1TK0A 1JLFA 1RT6A 1QHTA 4E7IA 3TARA 4M45A 5KGXA 3U3YA 4OKEA 2QKBA 2ITGA 3MXJA 5DK5A 4CHYA 3NH2A 4CIFA 4CJPA 4YNQA 2D0AA 3SUPA 4JLHA 3KLGA 2YV0X 4E7HA 1HQUA 4RG8A 3U6FA 3HPHA 3ASMA 1S6QA 3MAQA 1JLGA 2PZSA 3C6TA 2HVHA 3OJUA 4F2SA 4E89A 1IKXA 3O3FA 3K59A 3LPUA 4CGIA 4FJKA 3SUOA 3OYJA 3PX4A 4BDPA 1TL3A 4DTMA 1WSEA 4DU3A 4CEZA 1TKDA 3QLHA 3VQQA 3TAGA 4BE0A 1Q9YA 1WSJA 1RBTA 3DLGA 1RTJA 4ID5A 4W5NA 1HNVA 3D45A 1EXQA 3NF8A 4BDZA 1RT3A 1JLEA 3OYBA 3HM9A 4FW1A 4CEAA 4CFCA 5KI6A 3K57A 3B6PA 4O0JA 2GUIA 3ZT1A 5J2MA 3SCXA 4KB0A 1VSFA 1BIUA 1GOCA 1X9WA 4DLGA 3VA3A 1KVCA 4GVMA 4CEBA 1TVRA 4CGGA 1C0MA 3OS0A 1ITGA 2HNDA 2YHAA 4W5RA 3V9XA 2YKMA 1L3SA 3AA3A 1ZBUA 3HP6A 3HXMA 4M3RA 3WNHA 4ZTJA 4F3OA 1LV5A 1HYSA 1FK9A 1NK0A 2F96A 4I9LA 3OYDA 2KQ2A 3S3NA 4L8RB 2E6LA 4ZHRA 4OJRA 1B9DA 1A5VA 4KHWA 3F9KA 4DSKA 3NH0A 3T3FA 3A2FA 2JGUA 4Z4EA 2B6AA 3P5JA 3QIOA 4HTUA 1BQNA 2YNIA 1KLNA 1XHXA 4J2DA 1NK7A 1S6PA 1CZBA 2EX3A 4E7KA 1VK0A 4DTNA 3KK1A 3JYTA 2Y1IA 3QNNA 4NYNA 1ASUA 4CCHA 4CEEA 4YFUA 2IC3A 1EETA 3PX0A 3VN5A 4Z4FA 4CFAA 3E01A 1TAUA 3ZSXA 3ZSZA 3NH1A 3MXMA 1QSLA 3NBPA 3L2RA 3S9HA 2DFFA 4OPJA 2X6NA 1HYZA 4H4OA 3ISNC 4W5OA 3QINA 4DSEA 1L3TA 3QO9A 2KTQA 3K5LA 3L2WA 3RMCA 2Y1JA 3ITHA 1TGOA 5D3GA 4DU4A 4DLEA 2OYQA 3RTVA 4IFVA 4OLBA 1JXBA 4C8LA 1C0TA 1FXXA 1L5UA 2OA8A 4Z4HA 3CM5A 4FZZA 4PA1A 1ZYQA 3AVGA 4DFMA 2KFNA 3OY9A 2IDOA 3LZIA 3KKRA 2HVIA 1N5YA 4ICLA 2G8FA 3LP1A 3HK2A 3AO4A 3RRGA 4CJUA 4DTSA 4CGDA 4CJTA 3PV8A 3DRRA 2G8KA 1RDAA 4B9LA 3LP3A 1Y97A 3AVBA 4DTOA 2QXFA 1D9FA 1N6QA 1W9HA 1WLJA 3AVNA 4CJEA 3HT3A 2IGIA 3NDKA 3TABA 3P1GA 3KK3A 3I0SA 3M8QA 3ULDA 3HO1A 1RBUA 4B3OA 5J2PA 1HNIA 1O1WA 4AHUA 4H8KA 4KRFA 2YNHA 4LSLA 2XRIA 4LH4A 4BDYA 1U4BA 3O3HA 4DWIA 4CF2A 4CJSA 1TKZA 1RILA 3MXIA 2BE2A 4KV8A 3LAKA 2EHGA 1UWBA 3ZSQA 4W5QA 3L2VA 1LWFA 1RT2A 1NOZA 1VSEA 1REVA 3ZSYA 2XY8A 1QSSA 4AILC 1T7PA 2HNZA 4CFDA 3QERA 3V9WA 3IRXA 4J2AA 3LWLA 4MQ3A 4AHCA 1BISA 4Q0BA 5HBMA 3HL8A 5T7BA 4M3TA 1EX4A 4CJ3A 4M42A 4HUEA 1BGXT 2E6MA 1BI4B 4ELTA 1CZ9A 2VWKA 3RWUA 4Z4CA 4DQRA 2YNGA 4QAGA 4CHZA 3M8RA 3SZ2A 3V81A 3OJSA 1RT4A 3AO3A 4FM1A 4DQIA 3AVKA 3SV4A 1CXUA 1LWEA 4ELUA 3EY1A 1TK5A 1TKXA 1TV6A 1BCOA 1LW0A 2YNFA 4O44A 1RNHA 1RDDA 4FM2A 1KVBA 1IG9A 1C1CA 3CYMA 4CGHA 4DMNA 3K5OA 4CF9A 4R5PA 3V1QA 4PY5A 1KFSA 4MFBA 3HJFA 1JXEA 4C8NA 4B9NA 2QKKA 4FLUA 3VQBA 3DLHA 3VQAA 4CF8A 4FJ5A 3DRPA 5EU7A 2R7YA 4FLZA 4JRPA 3I0RA 3VQCA 3S3OA 4CK1A 4B9MA 4BE2A 2I5JA 4M41A 3AO1A 2KW4A 4KB1A 4M3XA 3VQ4A 3AVHA 1RDBA 1BHLA 5KGWA 3THVA 3F73A 3SQ1A 4FK0A 3EZ5A 1RDCA 1JLQA 1JLAA 4FW2A 5J2QA 1IKWA 3AVCA 3TAMA 1VSLA 4C8MA 3HVRA 1KRPA 3RMAA 4DSFA 3L2UA 4C8OA 2HHQA 3NHGA 3KIOA 3ZSOA 3C94A 1C6VA 4CIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DG1 A;  4CEO A;  1S1X A;  3LAL A;  3KJV A;  3DLR A;  3NF7 A;  4LSN A;  3K5M A;  1QS4 A;  2A1S A;  4CK2 A;  3PO4 A;  3C95 A;  3PY8 A;  1X1P A;  2E4L A;  4KFB A;  1HRH A;  5CY4 A;  2XHB A;  2DTU A;  4FLT A;  2JLE A;  3TAQ A;  4CEQ A;  1ZBL A;  3RR7 A;  3AVM A;  1VSJ A;  4OGC A;  4I9Q A;  3U3G A;  4I2P A;  3ZCM A;  4B08 A;  1Z26 A;  4Z0U A;  3NGY A;  4J2B A;  3KLE A;  3V9S A;  4FJG A;  1GOB A;  1EP4 A;  4IG0 A;  4E7J A;  4KKO A;  3ZT4 A;  4CJQ A;  3HPO A;  2HHT A;  1JL2 A;  1R0A A;  3MEE A;  3ZSV A;  2XY7 A;  1NK4 A;  2ZQB A;  2D0B A;  4E7L A;  3TI0 A;  4PWD A;  4DFP A;  4CIE A;  3V9Z A;  3V9U A;  5KRT A;  1Q9X A;  2G8H A;  1VRU A;  3VQP A;  3L3U A;  4CEF A;  5I3U A;  1LW2 A;  3OYF A;  3AO5 A;  3AVI A;  3LAN A;  3G0Z A;  4F4K A;  3VQ7 A;  1VSI A;  1VSM A;  1ZBF A;  2B5J A;  4KTQ A;  4CHO A;  2IAJ A;  3PO5 A;  1RT1 A;  1A5W A;  2GV9 A;  3OVN A;  3KD1 E;  1SV5 A;  1X9S A;  4I2Q A;  3V4I A;  4CES A;  2XO7 A;  1I3A A;  1KCF A;  4IFY A;  2OPS A;  3VQD A;  1TAQ A;  4G1Q A;  3VQ9 A;  3DYA A;  4B8C A;  3ZSW A;  1WSG A;  2VWJ A;  3CFR A;  1RTD A;  1S5J A;  4CK3 A;  4N47 A;  4KI6 A;  4TSX A;  4BWJ A;  3K2P A;  4W5T A;  2DFH A;  3OYE A;  2FC0 A;  1VSD A;  3OYH A;  4FJX A;  1S9G A;  2HW3 A;  3MED A;  1WSI A;  1LAV A;  1S1T A;  4HCC A;  2HNY A;  1RBR A;  3TAP A;  4DQP A;  4DTR A;  4E1M A;  3DM2 A;  3H08 A;  1J53 A;  1YTA A;  2YKN A;  3AO2 A;  4RW8 A;  3ZT3 A;  3SNN A;  1D9D A;  4E1N A;  4CJF A;  1UOC A;  5C25 A;  1SKS A;  5CZ2 A;  2OZM A;  3QEV A;  4EZ6 A;  4N41 A;  3MEG A;  3BGR A;  4KTZ A;  3QEP A;  1SKW A;  1XWL A;  3M8S A;  2RN2 A;  4Y1D A;  4DQS A;  3T19 A;  1XHZ A;  1RCH A;  1KSP A;  2FBT A;  2P1J A;  3DLB A;  3KLI A;  2HHW A;  4RW4 A;  4FJN A;  1C0U A;  1J9A A;  4CJV A;  4HUG A;  3LPT A;  4GMJ B;  3OYN A;  1T05 A;  1CLQ A;  3HPG A;  4E19 A;  3OYM A;  2RF2 A;  4CJK A;  3QEI A;  5HP1 A;  1X9M A;  1U47 A;  4UQG A;  4B9T A;  4Q5V A;  4DU1 A;  1T03 A;  3KKS A;  1UA0 A;  4KRE A;  2A1R A;  1IO2 A;  1WAJ A;  1DTT A;  1YVU A;  3SPZ A;  2F8S A;  4OLA A;  4CJR A;  3AVJ A;  1ZBI A;  4CED A;  2VG7 A;  3OYI A;  5JS2 A;  5KTQ A;  4AHR A;  4OVL A;  4XIU A;  2X6S A;  3VQ6 A;  3V6D A;  3ZSR A;  3PX6 A;  1JKH A;  1Z25 A;  4E3S A;  2LSN A;  4B9U A;  3VA0 A;  3JSM A;  4AH9 A;  4CHQ A;  1QTM A;  2HHU A;  4LD0 A;  4CGF A;  5SZT A;  3SYZ A;  2D0C A;  2D5R A;  4IG3 A;  3VQE A;  3L2Q A;  2NUB A;  3D0P A;  1XC9 A;  1QSY A;  4N56 A;  3IAY A;  1JL1 A;  3AA2 A;  1ZBH A;  5HRR A;  2KFZ A;  3VQ5 A;  1NJX A;  4BE1 A;  4IDK A;  1L3V A;  3LAM A;  1BQM A;  1D5A A;  1DTQ A;  4OKK A;  3CFO A;  5E41 A;  2HHV A;  2WON A;  3FFI A;  4B8A B;  1J5O A;  4N76 A;  1WNS A;  4FJM A;  1B92 A;  3SQ2 A;  4KTW A;  5FRO A;  3O4Q A;  4DF4 A;  4M3Y A;  1WSF A;  4B9V A;  4FJ9 A;  3K58 A;  4AHS A;  2OPQ A;  3DI6 A;  4E0D A;  4FYD A;  4CEC A;  1F21 A;  3DLK A;  4PUO A;  3QES A;  5FRN A;  3L3V A;  4DF8 A;  2IOC A;  4FZY A;  4DSJ A;  3WNG A;  1U48 A;  1D8Y A;  2OPP A;  4KHY A;  3OYC A;  3MEC A;  2IS3 A;  3QNO A;  4FJ7 A;  3K5N A;  4RW6 A;  3AV9 A;  3V1O A;  1NK9 A;  1NKB A;  4K8Z A;  2DY4 A;  1IKY A;  3V1R A;  2ATQ A;  1TKT A;  3AVA A;  4CGJ A;  3C6U A;  4DS4 A;  4RW7 A;  4DQQ A;  1ASW A;  4DTJ A;  3CM6 A;  2G8U A;  4J2E A;  1JLB A;  2XY6 A;  3LDS A;  4OKJ A;  5HLF A;  4ELV A;  1QQC A;  1WSH A;  1TL1 A;  1CXQ A;  1HMV A;  2P51 A;  2Q3S A;  4CJW A;  4DSI A;  1KFD A;  4Z4I A;  2KZZ A;  4AHV A;  1NOY A;  1GOA A;  3TR8 A;  4O4G A;  3SJJ A;  3S3M A;  4CF1 A;  3QET A;  4KO0 A;  3TWH A;  2O4I A;  4DFJ A;  3WNF A;  2ZE2 A;  4CJL A;  1RTI A;  5KRS A;  4FJH A;  4BAC A;  1VSK A;  1KLM A;  1HPZ A;  1RTH A;  1WAF A;  2BAN A;  3RRH A;  3UIQ A;  1SL2 A;  3RR8 A;  3CG7 A;  3CFP A;  4FJL A;  4OGE A;  1U04 A;  4IBN A;  4NCA A;  1S9E A;  3SV3 A;  2YHB A;  3TAF A;  4FZX C;  4F2R A;  4HUF A;  4DFK A;  4FJI A;  3HST B;  3ZT2 A;  1MU2 A;  3LZJ A;  4FXD A;  4M3W A;  1UAX A;  4FJ8 A;  3KLH A;  2B4J A;  1W0H A;  4O55 A;  3L8B A;  3LP0 A;  2G8W A;  2P5O A;  4BWM A;  1C1B A;  4H4M A;  5J2N A;  3KK2 A;  3RMD A;  3WNE A;  4AHT A;  2FBY A;  1B9F A;  3P83 D;  3M8P A;  1EKE A;  3SPY A;  2PYL A;  2ETJ A;  5C24 A;  3T1A A;  4FLX A;  3QEW A;  1KVA A;  4FJJ A;  2BGG A;  1S1V A;  1IKV A;  4WE1 A;  3KLF A;  4K8X A;  1NKE A;  3DOK A;  2RKI A;  4EP5 A;  4M3U A;  1QE1 A;  2Z1J A;  5C42 A;  1SL1 A;  4Z4G A;  2O4G A;  1IH7 A;  5JS1 A;  1RBS A;  4FLY A;  4CFB A;  4CJ4 A;  4KPY A;  1FKP A;  2Z1I A;  3NCI A;  3HP9 A;  1BIZ A;  2X74 A;  1WN7 A;  3DOL A;  3NF9 A;  1NK6 A;  3BDP A;  2F8T A;  2HHX A;  3QIP A;  3AA4 A;  4LH5 A;  2FBV A;  3OYL A;  3NE6 A;  1U49 A;  3O4N A;  1NK8 A;  2HMI A;  4NCB A;  4Y1C A;  3OS1 A;  3LWM A;  2W42 A;  4IKF A;  5K14 A;  4HHT A;  4M3Z A;  1FKO A;  4DTU A;  2QK9 A;  3OYK A;  4HVJ A;  2PY5 A;  5DMR A;  3NAE A;  3G10 A;  3NFA A;  4CJ5 A;  2RPI A;  1YT3 A;  3LP2 A;  1SUQ A;  5CYM A;  3AVL A;  1S1W A;  1LWC A;  4O0I A;  3NGI A;  1RT5 A;  4KI4 A;  3DLE A;  4I7F A;  2HHS A;  3HYF A;  4JRQ A;  4GW6 A;  4DTP A;  4RW9 A;  4CE9 A;  3SQ0 A;  3DMJ A;  1NK5 A;  2GBZ A;  4CHN A;  5FDL A;  1L3U A;  2WOM A;  3AA5 X;  3AVF A;  4QOZ B;  4CER A;  5J1E A;  3VQ8 A;  5FRM A;  4FM0 A;  1T8E A;  2OPR A;  2Z1H A;  5HRP A;  1A5X A;  1BCM A;  1I39 A;  1LAW A;  2VG6 A;  3B6O A;  2G8V A;  2OZS A;  4KHN A;  1RBV A;  3DRS A;  4FVM A;  1VRT A;  1DLO A;  1J54 A;  2HB5 A;  2FBX A;  3EYZ A;  2BDP A;  4FK4 A;  2PYJ A;  4PQU A;  3KD5 E;  4N5S A;  3KTQ A;  2DFE A;  1BL3 A;  2P5G A;  4B9S A;  4O5B A;  1SKR A;  1YTU A;  1KTQ A;  3TAN A;  1ASV A;  4FLW A;  3RMB A;  4F3T A;  1NJZ A;  1NKC A;  2AJQ A;  1VSH A;  4JS5 A;  4DSL A;  4DS5 A;  1G15 A;  1HJR A;  1HYV A;  1K6Y A;  3IS9 A;  2XY5 A;  3IG1 A;  3OYG A;  3OS2 A;  4ZTF A;  4FK2 A;  2X78 A;  4ID1 A;  3SI6 A;  2VG5 A;  1BI4 A;  3OYA A;  1XI1 A;  1HQE A;  3NGZ A;  4NYF A;  5CZ1 A;  3CQ8 A;  1UA1 A;  4FLV A;  1S1U A;  1Q8I A;  5I42 A;  1NJY A;  4F8R A;  1JLC A;  4CHP A;  4KAZ A;  4FCY A;  5HRS A;  4C8K A;  1SL0 A;  4JS4 A;  3SUQ A;  3I8D A;  4EP4 A;  3O3G A;  4DTX A;  4KHU A;  1TK8 A;  1RT7 A;  4NCG A;  2Z1G A;  4LY7 A;  4OPK A;  4KHS A;  4QCL A;  1U45 A;  1C1A A;  4CF0 A;  5HRO A;  2G8I A;  3NF6 A;  5HRN A;  1NJW A;  5SWM A;  5CYQ A;  2KZM A;  3ZT0 A;  3SQ4 A;  2ZD1 A;  3QEX A;  4EZ9 A;  3PUF A;  4HCB A;  3HVT A;  3TAE A;  4KHQ A;  3ALY A;  3SUN A;  1TK0 A;  1JLF A;  1RT6 A;  1QHT A;  4E7I A;  3TAR A;  4M45 A;  5KGX A;  3U3Y A;  4OKE A;  2QKB A;  2ITG A;  3MXJ A;  5DK5 A;  4CHY A;  3NH2 A;  4CIF A;  4CJP A;  4YNQ A;  2D0A A;  3SUP A;  4JLH A;  3KLG A;  2YV0 X;  4E7H A;  1HQU A;  4RG8 A;  3U6F A;  3HPH A;  3ASM A;  1S6Q A;  3MAQ A;  1JLG A;  2PZS A;  3C6T A;  2HVH A;  3OJU A;  4F2S A;  4E89 A;  1IKX A;  3O3F A;  3K59 A;  3LPU A;  4CGI A;  4FJK A;  3SUO A;  3OYJ A;  3PX4 A;  4BDP A;  1TL3 A;  4DTM A;  1WSE A;  4DU3 A;  4CEZ A;  1TKD A;  3QLH A;  3VQQ A;  3TAG A;  4BE0 A;  1Q9Y A;  1WSJ A;  1RBT A;  3DLG A;  1RTJ A;  4ID5 A;  4W5N A;  1HNV A;  3D45 A;  1EXQ A;  3NF8 A;  4BDZ A;  1RT3 A;  1JLE A;  3OYB A;  3HM9 A;  4FW1 A;  4CEA A;  4CFC A;  5KI6 A;  3K57 A;  3B6P A;  4O0J A;  2GUI A;  3ZT1 A;  5J2M A;  3SCX A;  4KB0 A;  1VSF A;  1BIU A;  1GOC A;  1X9W A;  4DLG A;  3VA3 A;  1KVC A;  4GVM A;  4CEB A;  1TVR A;  4CGG A;  1C0M A;  3OS0 A;  1ITG A;  2HND A;  2YHA A;  4W5R A;  3V9X A;  2YKM A;  1L3S A;  3AA3 A;  1ZBU A;  3HP6 A;  3HXM A;  4M3R A;  3WNH A;  4ZTJ A;  4F3O A;  1LV5 A;  1HYS A;  1FK9 A;  1NK0 A;  2F96 A;  4I9L A;  3OYD A;  2KQ2 A;  3S3N A;  4L8R B;  2E6L A;  4ZHR A;  4OJR A;  1B9D A;  1A5V A;  4KHW A;  3F9K A;  4DSK A;  3NH0 A;  3T3F A;  3A2F A;  2JGU A;  4Z4E A;  2B6A A;  3P5J A;  3QIO A;  4HTU A;  1BQN A;  2YNI A;  1KLN A;  1XHX A;  4J2D A;  1NK7 A;  1S6P A;  1CZB A;  2EX3 A;  4E7K A;  1VK0 A;  4DTN A;  3KK1 A;  3JYT A;  2Y1I A;  3QNN A;  4NYN A;  1ASU A;  4CCH A;  4CEE A;  4YFU A;  2IC3 A;  1EET A;  3PX0 A;  3VN5 A;  4Z4F A;  4CFA A;  3E01 A;  1TAU A;  3ZSX A;  3ZSZ A;  3NH1 A;  3MXM A;  1QSL A;  3NBP A;  3L2R A;  3S9H A;  2DFF A;  4OPJ A;  2X6N A;  1HYZ A;  4H4O A;  3ISN C;  4W5O A;  3QIN A;  4DSE A;  1L3T A;  3QO9 A;  2KTQ A;  3K5L A;  3L2W A;  3RMC A;  2Y1J A;  3ITH A;  1TGO A;  5D3G A;  4DU4 A;  4DLE A;  2OYQ A;  3RTV A;  4IFV A;  4OLB A;  1JXB A;  4C8L A;  1C0T A;  1FXX A;  1L5U A;  2OA8 A;  4Z4H A;  3CM5 A;  4FZZ A;  4PA1 A;  1ZYQ A;  3AVG A;  4DFM A;  2KFN A;  3OY9 A;  2IDO A;  3LZI A;  3KKR A;  2HVI A;  1N5Y A;  4ICL A;  2G8F A;  3LP1 A;  3HK2 A;  3AO4 A;  3RRG A;  4CJU A;  4DTS A;  4CGD A;  4CJT A;  3PV8 A;  3DRR A;  2G8K A;  1RDA A;  4B9L A;  3LP3 A;  1Y97 A;  3AVB A;  4DTO A;  2QXF A;  1D9F A;  1N6Q A;  1W9H A;  1WLJ A;  3AVN A;  4CJE A;  3HT3 A;  2IGI A;  3NDK A;  3TAB A;  3P1G A;  3KK3 A;  3I0S A;  3M8Q A;  3ULD A;  3HO1 A;  1RBU A;  4B3O A;  5J2P A;  1HNI A;  1O1W A;  4AHU A;  4H8K A;  4KRF A;  2YNH A;  4LSL A;  2XRI A;  4LH4 A;  4BDY A;  1U4B A;  3O3H A;  4DWI A;  4CF2 A;  4CJS A;  1TKZ A;  1RIL A;  3MXI A;  2BE2 A;  4KV8 A;  3LAK A;  2EHG A;  1UWB A;  3ZSQ A;  4W5Q A;  3L2V A;  1LWF A;  1RT2 A;  1NOZ A;  1VSE A;  1REV A;  3ZSY A;  2XY8 A;  1QSS A;  4AIL C;  1T7P A;  2HNZ A;  4CFD A;  3QER A;  3V9W A;  3IRX A;  4J2A A;  3LWL A;  4MQ3 A;  4AHC A;  1BIS A;  4Q0B A;  5HBM A;  3HL8 A;  5T7B A;  4M3T A;  1EX4 A;  4CJ3 A;  4M42 A;  4HUE A;  1BGX T;  2E6M A;  1BI4 B;  4ELT A;  1CZ9 A;  2VWK A;  3RWU A;  4Z4C A;  4DQR A;  2YNG A;  4QAG A;  4CHZ A;  3M8R A;  3SZ2 A;  3V81 A;  3OJS A;  1RT4 A;  3AO3 A;  4FM1 A;  4DQI A;  3AVK A;  3SV4 A;  1CXU A;  1LWE A;  4ELU A;  3EY1 A;  1TK5 A;  1TKX A;  1TV6 A;  1BCO A;  1LW0 A;  2YNF A;  4O44 A;  1RNH A;  1RDD A;  4FM2 A;  1KVB A;  1IG9 A;  1C1C A;  3CYM A;  4CGH A;  4DMN A;  3K5O A;  4CF9 A;  4R5P A;  3V1Q A;  4PY5 A;  1KFS A;  4MFB A;  3HJF A;  1JXE A;  4C8N A;  4B9N A;  2QKK A;  4FLU A;  3VQB A;  3DLH A;  3VQA A;  4CF8 A;  4FJ5 A;  3DRP A;  5EU7 A;  2R7Y A;  4FLZ A;  4JRP A;  3I0R A;  3VQC A;  3S3O A;  4CK1 A;  4B9M A;  4BE2 A;  2I5J A;  4M41 A;  3AO1 A;  2KW4 A;  4KB1 A;  4M3X A;  3VQ4 A;  3AVH A;  1RDB A;  1BHL A;  5KGW A;  3THV A;  3F73 A;  3SQ1 A;  4FK0 A;  3EZ5 A;  1RDC A;  1JLQ A;  1JLA A;  4FW2 A;  5J2Q A;  1IKW A;  3AVC A;  3TAM A;  1VSL A;  4C8M A;  3HVR A;  1KRP A;  3RMA A;  4DSF A;  3L2U A;  4C8O A;  2HHQ A;  3NHG A;  3KIO A;  3ZSO A;  3C94 A;  1C6V A;  4CIG A; 
#chains in the Genus database with same CATH topology
 4DR4 K;  4MDB A;  2A1S A;  3A5L C;  3PO4 A;  3GDQ A;  4KFB A;  3O6W A;  5KQD A;  4I9Q A;  4BRC A;  2QTD A;  2NRT A;  4NLB A;  2FSJ A;  1Z26 A;  3KLE A;  4FJG A;  3TSU A;  1EP4 A;  4KKO A;  4LF9 K;  3QDK A;  1JL2 A;  1NK4 A;  3MEE A;  2CH5 A;  4U7B A;  4JI6 K;  1DKG D;  1KXP A;  2O8C B;  2QW9 A;  4CZM A;  3L3U A;  4CEF A;  3OYF A;  3AVI A;  3LAN A;  2B5J A;  1OH5 A;  3PO5 A;  4IO9 L;  3CQX A;  4BRQ A;  5TKY A;  1I3A A;  4DV7 K;  5BN9 A;  3DYA A;  3T69 A;  2VWJ A;  4I6M A;  2UXB K;  1RTD A;  3LL3 A;  3O9T A;  4CK3 A;  2P9S B;  5JVH L;  4BWJ A;  4FJX A;  1S9G A;  3QBW A;  1LAV A;  2E20 A;  1RBR A;  4DTR A;  1NJI O;  3DM2 A;  5AQZ A;  3AO2 A;  1YTA A;  1QQM A;  3SNN A;  5ELZ A;  4E1N A;  4MLE A;  4CJF A;  5CZ2 A;  4EZ6 A;  3QEV A;  3H1V X;  1BOT O;  3M8S A;  1IJJ A;  3BF3 A;  1KSP A;  1S72 N;  3DLB A;  3THW B;  4HUG A;  3LPT A;  4L3Q A;  2PBD A;  1CLQ A;  2E2P A;  4CJK A;  3DXM B;  4B9T A;  3VTH A;  1NGJ A;  2P9U A;  3FZK A;  3KKS A;  3SPZ A;  2F8S A;  1WBB A;  1RDU A;  4CED A;  3FE1 A;  4KH4 A;  2PFU A;  3PX6 A;  1J6Z A;  4LD0 A;  2GWJ A;  3SYZ A;  3VQE A;  3F5T A;  4IDK A;  4YDU C;  1L3V A;  3LAM A;  1DTQ A;  3ATV A;  5KPZ A;  1J5O A;  4DR2 K;  4IEE A;  4N76 A;  5C15 A;  2KKZ A;  1FJG K;  3ZEU A;  4A62 A;  5FRO A;  1WSF A;  4B9V A;  1TYQ A;  3CJA A;  3O8M A;  3QES A;  4ISG A;  3WNG A;  4BRK A;  1U48 A;  4KHY A;  4FJ7 A;  3AV9 A;  4QS8 A;  3SJH A;  4QS7 A;  1NKB A;  1IKY A;  1KC8 O;  2IVP A;  3WUH A;  4DQQ A;  1ASW A;  4DB3 A;  2A42 A;  1JLB A;  4GV9 A;  4AHV A;  4BR9 A;  1NOY A;  4JI4 K;  4DFJ A;  4FWM A;  2HF4 A;  1HNX K;  3E9O A;  1RTH A;  1HPZ A;  4X62 K;  3RRH A;  5GAE P;  1SL2 A;  3RR8 A;  4BC3 A;  2O8B A;  4FJL A;  2GTD A;  3SV3 A;  5ADX H;  3JAM O;  4DV0 K;  3ZT2 A;  4M3W A;  1UAX A;  4JKD A;  5BRE A;  4O55 A;  3L8B A;  3E9P A;  1C1B A;  4H4M A;  3MN9 A;  3ZET A;  4CZH A;  3WNE A;  3C65 A;  1OVQ A;  2ZM6 K;  2YX6 A;  2ETJ A;  3QEW A;  2YI1 A;  1IKV A;  4UY8 O;  4LFB K;  2FSN A;  1QE1 A;  3ENB A;  5C42 A;  4OX9 K;  2VWB A;  5JS1 A;  4FWR A;  3G25 A;  5AZJ B;  3GE1 A;  3CCE N;  3HP9 A;  1BIZ A;  5FPE A;  1WN7 A;  4FOE A;  5C2D A;  1NK8 A;  2GEL A;  4IO8 A;  4XH1 A;  4HHT A;  2ASM A;  1C0G A;  3M6G A;  4CJ5 A;  4C1N I;  3D2E A;  3HOT A;  5CYM A;  1JJ2 M;  1ILY A;  3DXK B;  3VPZ A;  3NGI A;  4O0I A;  1RT5 A;  4KI4 A;  4K41 A;  1MWM A;  4GNI A;  4DTP A;  4RW9 A;  4BR0 A;  1ZBS A;  5FDL A;  2D0P A;  1L3U A;  3AA5 X;  3D2E B;  5AQQ A;  3VES A;  4CER A;  5J1E A;  3VQ8 A;  1I39 A;  2EWS A;  4CW7 B;  4KHN A;  4DKW A;  3O08 A;  1J54 A;  3U9Z A;  3VEX A;  4PQU A;  2ZGZ A;  5AQF A;  4DV4 K;  4PKH A;  5GIP A;  1NKC A;  3SAF A;  1HYV A;  1K6Y A;  4A2B A;  4DR1 K;  3SI6 A;  2VG5 A;  1HLU A;  2P9N B;  3M3Z A;  3OYA A;  1BG3 A;  3KVG A;  5CZ1 A;  1NJY A;  2G8H A;  1S1U A;  2OTL N;  5HRS A;  3SUQ A;  3I8D A;  3O9S A;  4KHU A;  2Z1G A;  2CGK A;  5E84 A;  3VEO A;  2IVN A;  4DUZ K;  2UUC K;  1BO5 O;  2Q97 A;  1HKB A;  3TAE A;  1RT6 A;  1QHT A;  3FZF A;  4M63 C;  5KGX A;  3TAR A;  2NRH A;  2ITG A;  3M1F A;  3MXJ A;  4CJP A;  4M7Y A;  3EE9 A;  5M1O A;  5KPR A;  3CF5 L;  3TTC A;  3U6F A;  1R59 O;  3B8A X;  2FLO A;  2PZS A;  3C6T A;  2HVH A;  2ZGY A;  3N4P A;  3R1X A;  4A5B A;  3OYJ A;  2ZJR L;  4DU3 A;  3EZW A;  1TKD A;  3VQQ A;  4JKF A;  1Q9Y A;  1IBM K;  1RBT A;  1RTJ A;  2YHW A;  3NF8 A;  3D7E O;  3WEE B;  1JLE A;  4FW1 A;  4JK8 A;  4CEA A;  2QK9 A;  3CI5 A;  3K57 A;  3A0I X;  1VSF A;  1BIU A;  3GL1 A;  4DV3 K;  4BGB A;  4GVM A;  1TVR A;  2YHX A;  1C0M A;  2HND A;  1LCU A;  3V9X A;  3AA3 A;  1VHX A;  1ZBU A;  4M3R A;  3WNH A;  3S3N A;  1VQ8 N;  3F9K A;  1GLF O;  3HM8 A;  3TTF A;  3A2F A;  3U8X A;  3QIO A;  1KLN A;  4JV5 K;  1IV0 A;  1CZB A;  4E7K A;  3D2F A;  4CBX A;  2Y1I A;  5EVZ A;  4BRP A;  3TTD A;  4CCH A;  1EET A;  2NNW A;  3CCS N;  3L2R A;  2D1K A;  1IBK K;  2DFF A;  1Z05 A;  4BRA A;  3ISN C;  4W5O A;  1DEJ A;  4CZI A;  3L2W A;  2Y1J A;  4H0T B;  2ZJP L;  3VER A;  3MCP A;  1KD1 O;  1C0T A;  4H0V B;  4Z4H A;  4PA1 A;  3AVG A;  4DFM A;  3S41 A;  3KKR A;  4YOX A;  2G8F A;  2UYT A;  3LP1 A;  3HK2 A;  4IJN A;  3RRG A;  4CJT A;  4EIA A;  5C12 A;  4B9L A;  2QXF A;  1W97 L;  2DPN A;  3AVN A;  3KK3 A;  1RBU A;  4IDH A;  5J2P A;  2YNH A;  4K42 A;  1BU6 O;  4BDY A;  4NXM K;  4FWK A;  4CF2 A;  2QM1 A;  4KV8 A;  3OTO K;  2EHG A;  4W5Q A;  3L2V A;  1BWF O;  1RT2 A;  1NOZ A;  1REV A;  5FLX O;  1N36 K;  2CGJ A;  3LWL A;  2YJF A;  4Q0B A;  3HL8 A;  1NGE A;  4ELT A;  2E1Z A;  3TSQ A;  1CZ9 A;  1K9M O;  3R9P A;  4QAG A;  3SZ2 A;  3V81 A;  3M8R A;  3AO3 A;  3AVK A;  4BG8 A;  3SV4 A;  3HRG A;  4ELU A;  5IT9 O;  3FLC O;  3CC7 N;  1RNH A;  3AAQ A;  3HI0 A;  1IG9 A;  4CGH A;  4FLZ A;  4JRP A;  3I0R A;  1VAZ A;  4B9M A;  1YIJ N;  4KB1 A;  4M3X A;  3VQ4 A;  3AVH A;  4MDA A;  4BRG A;  1BHL A;  5KGW A;  3THV A;  3SQ1 A;  4FK0 A;  5J2Q A;  4FW2 A;  1HNZ K;  3TAM A;  1XQS C;  3HVR A;  3RSE A;  4H5N A;  4ILG B;  3NHG A;  1QSL A;  4CIG A;  3LAL A;  3NF7 A;  4EFH A;  4PKG A;  1X1P A;  1Y64 A;  3J8A A;  2O8E B;  1ZBL A;  3AVM A;  1VSJ A;  1SAZ A;  2QWP A;  5AJ3 K;  4CZG A;  4B08 A;  4J2B A;  1GOB A;  4E7J A;  4IG0 A;  4JHD A;  5FPD A;  1R0A A;  2ZQB A;  2D0B A;  3AY9 A;  3TI0 A;  4PWD A;  5JMV A;  4DFP A;  3V9Z A;  3V9U A;  4MLH A;  3T1H K;  5AZI A;  3THX A;  3AAR A;  3G0Z A;  1ZBF A;  4KTQ A;  4JI1 K;  3KD1 E;  1X9S A;  4I2Q A;  3TPQ A;  4BRE A;  3J7A P;  2H3G X;  3VQD A;  1TAQ A;  4G1Q A;  3EL2 A;  4WQ4 C;  1W2B M;  4E1J A;  1S5J A;  4B3S K;  1KAY A;  4N47 A;  4KI6 A;  4FWS A;  2DFH A;  5M1K A;  1K8K B;  4CD3 A;  1YI2 N;  3OYH A;  3SK3 A;  5GIN A;  3PIP L;  3WXJ A;  4JI0 K;  3CXC M;  3TAP A;  2YKN A;  2YJE A;  5M1F A;  1LOT B;  1YAG A;  4N41 A;  2JWK A;  3BGR A;  3FR0 A;  2E2N A;  3NVK A;  2GEM A;  4DQS A;  3T19 A;  4JKH A;  1XHZ A;  1RCH A;  2P1J A;  4H5R A;  5AQG A;  1I94 K;  4FJN A;  1C0U A;  1J9A A;  4CJV A;  3G71 N;  2HHW A;  1HX1 A;  4GMJ B;  5LJV A;  3OYN A;  1T05 A;  1N33 K;  1NBW A;  2V51 B;  1U47 A;  1GLA G;  3KHY A;  4DU1 A;  1YHQ N;  1T03 A;  2A1R A;  1WAJ A;  1DTT A;  1YVU A;  1Q7Y O;  3AVJ A;  4NLC A;  3O80 A;  3OYI A;  5KTQ A;  4AHR A;  1E4G T;  2X6S A;  3AGR A;  3SMP A;  3ZSR A;  1Z25 A;  4E3S A;  1VQ4 N;  2HHU A;  3VA0 A;  3JSM A;  4AH9 A;  3LM9 A;  3SAH A;  1BA0 A;  2D5R A;  4M3U A;  2NUB A;  4N56 A;  2KFZ A;  1JL1 A;  1ZBH A;  5ADX A;  5HRR A;  1T44 A;  1XNQ K;  1NJX A;  1GLC G;  1HUX A;  2HF3 A;  1BQM A;  3M5R A;  3CFO A;  4B8A B;  4FJM A;  5H1S Q;  4KTW A;  4U67 L;  4M3Y A;  2P9I A;  4JK9 A;  3A5N C;  3ZX0 A;  4B1X B;  4FYD A;  1F21 A;  4PUO A;  2FF3 B;  3GG4 A;  2IOC A;  4DSJ A;  4DR3 K;  3L0Q A;  3OBY A;  2CGL A;  1NK9 A;  4K8Z A;  2ITM A;  4CGJ A;  1TKT A;  3C6U A;  4RW7 A;  3E1Y A;  1QZ6 A;  3LDS A;  1QHA A;  5HLF A;  1WSH A;  2J4R A;  1HMV A;  1TUY A;  4Z4I A;  5JIC A;  4DSI A;  1KFD A;  2WC9 A;  3S3M A;  3RSE B;  2ZE2 A;  1RTI A;  1VSK A;  3WXI A;  5KPT A;  1Q86 O;  1D4X A;  4GV3 A;  1O13 A;  3E9L A;  5FPN A;  3CFP A;  3DLL L;  4DHY A;  4IBN A;  4NCA A;  2O8E A;  1S9E A;  1NGB A;  3TAF A;  4DFK A;  3HST B;  3KLH A;  1N34 K;  3CME N;  3LP0 A;  2G8W A;  4BWM A;  5J2N A;  3RMD A;  1HNW K;  1B9F A;  4FWO A;  2BGG A;  3T1A A;  1KVA A;  1S1V A;  4K8X A;  4GKJ K;  2NRZ A;  2RKI A;  5AQO A;  3CJ9 A;  4CJ7 A;  4YOW A;  1SL1 A;  2O4G A;  4KPY A;  4CJ4 A;  3THX B;  3NCI A;  4B1V A;  2F8T A;  4B3R K;  2FBV A;  3FZM A;  4LFC K;  4BGA A;  1N32 K;  5EX5 A;  3LWM A;  4IKF A;  4V19 S;  5K14 A;  4M7X A;  1FKO A;  3IDH A;  2RPI A;  1YT3 A;  3MMV A;  4JI7 K;  1RDW X;  4BG9 A;  2HHS A;  4BVP A;  2F7T A;  3SQ0 A;  1NK5 A;  2GBZ A;  3J80 O;  3AVF A;  2BTF A;  2OPR A;  4JKB A;  1BCM A;  1LAW A;  1NGC A;  2VG6 A;  3B6O A;  2G8V A;  5M1Q A;  1NMD A;  1RBV A;  2NRW A;  4FVM A;  1VRT A;  3VF6 A;  3EYZ A;  3I8B A;  2PYJ A;  5HL7 L;  4N5S A;  1BL3 A;  3SBG A;  3RMB A;  4JN4 A;  2UXC K;  2NRX A;  2AJQ A;  2CH6 A;  4ILH A;  3H46 O;  4DS5 A;  4DV2 K;  5CHI A;  5C0Y A;  4CZJ A;  3OYG A;  2XY5 A;  1T6D A;  1NGD A;  1BI4 A;  1XI1 A;  3CQ8 A;  4NYF A;  4F8R A;  5I42 A;  4FL9 A;  2ASP A;  4XEI A;  3G6E N;  3ZX3 A;  4YOY A;  4C8K A;  1S22 A;  2YCH A;  4EP4 A;  3O3G A;  4DTX A;  4Z94 A;  1TK8 A;  1RT7 A;  4LY7 A;  4QCL A;  4CF0 A;  4A57 A;  2G8I A;  5C10 A;  3AGK A;  1VQP N;  3ZT0 A;  4X64 K;  3SQ4 A;  4IZ9 A;  3QEX A;  4EZ9 A;  4KHQ A;  4PL8 A;  4BR5 A;  1TK0 A;  2I7P A;  2P9I B;  3U3Y A;  4CHY A;  3NH2 A;  1C0F A;  3KLG A;  1U2V B;  4K0K K;  3HPH A;  3ZYY X;  1S6Q A;  4BRN A;  4F2S A;  5IWA K;  4GVE A;  5GIO A;  1OH7 A;  2OAN A;  2IIR A;  3LPU A;  4FJK A;  4FWP A;  4BDP A;  5AQK A;  1ZXO A;  4ID5 A;  4H0Y B;  1HNV A;  3D45 A;  1EXQ A;  4K25 A;  1BA1 A;  2Q31 A;  4BDZ A;  1VQL N;  1RT3 A;  1E3M A;  4YY3 K;  3O9U A;  4CFC A;  3SCX A;  4KB0 A;  1X9W A;  3VA3 A;  4BC5 A;  3EO3 A;  1KVC A;  3GBT A;  4CGG A;  3CER A;  3A5M C;  4ZTJ A;  3HXM A;  4F3O A;  1LV5 A;  1FK9 A;  2F96 A;  4I9L A;  2E6L A;  1A5V A;  4BC2 A;  5F2R A;  3NH0 A;  4GY2 B;  4WFA L;  4Z4E A;  3P5J A;  2YNI A;  1NK7 A;  4FOI A;  4CEE A;  3Q7C A;  1TAU A;  1U6Z A;  3S9H A;  3TSP A;  3LDQ A;  4I6M B;  4DSE A;  3ZX2 A;  2KTQ A;  4K43 A;  4MO5 A;  5BN8 A;  2NRV A;  1KAZ A;  1JXB A;  2KFN A;  1ZYQ A;  3WXL A;  1X3N A;  3J7Z O;  1YJW N;  2HVI A;  1N5Y A;  3KZB A;  3ID8 A;  3MCA B;  4JI2 K;  3DRR A;  2G8K A;  3F9M A;  1ESV A;  1YXQ A;  4DTO A;  4JKG B;  1WLJ A;  4WQ5 A;  1NNE A;  3VMF B;  3A5O C;  3P1G A;  4B3O A;  4AHU A;  4H8K A;  4DWI A;  1TKZ A;  3MXI A;  4JKG A;  1UWB A;  2QXL A;  2P9P B;  3ZSY A;  4BR7 A;  5LJW A;  3WXK A;  5LMU K;  3IRX A;  4AHC A;  3EE8 A;  3LM2 A;  4M3T A;  2E1Y A;  1BI4 B;  4LC9 B;  3C0B A;  3RWU A;  4FM1 A;  4DQI A;  1M90 O;  1YJN N;  4O44 A;  4FM2 A;  5AQR A;  3G4S N;  1C1C A;  4DMN A;  2HBJ A;  3HJF A;  4C8N A;  4B9N A;  2QKK A;  4FLU A;  3E66 A;  4CF8 A;  4FJ5 A;  5AQM A;  4PHT X;  2I5J A;  1RDB A;  1JLQ A;  2UUA K;  3UE5 A;  2O8F B;  1QZ5 A;  1IG8 A;  3KWI A;  1VSL A;  4C8M A;  5B8H A;  5BRF A;  4H5T A;  4BRH A;  4C8O A;  2WFB A;  3OYC A;  3MX5 A;  3BDP A;  2HBM A;  4CEO A;  3F2K A;  1S1X A;  3DLR A;  3LDP A;  4LSN A;  2FF6 A;  4CK2 A;  4DR6 K;  3C95 A;  3PY8 A;  4NXN K;  2E4L A;  1HRH A;  2F9T A;  5CY4 A;  2DTU A;  3CJC A;  4FLT A;  2JLE A;  3L4Q A;  3RR7 A;  4CEQ A;  4OGC A;  1VQN N;  3U3G A;  4I2P A;  3V9S A;  3GOI A;  2D4W A;  3HOS A;  3HPO A;  5EOY A;  2HHT A;  5I9E B;  3ZSV A;  4E7L A;  4A61 A;  5KRT A;  1Q9X A;  1VRU A;  4H03 B;  3CCR N;  3OBW A;  5JLF A;  3VQ7 A;  1VSI A;  1VSM A;  4BC4 A;  1RT1 A;  2GV9 A;  3OVN A;  4AM7 A;  3O9Q A;  3V4I A;  4CES A;  4B8C A;  3ZSW A;  1WSG A;  4EHT A;  4MO4 A;  3CMA N;  4RWT A;  4BY9 C;  3QFU A;  4JK7 A;  3K2P A;  2FC0 A;  3DXK A;  1VSD A;  1G99 A;  4IEI A;  4IWV A;  4KHP K;  1WSI A;  1S1T A;  1XMO K;  4HCC A;  2HNY A;  4H5V A;  4DQP A;  4E1M A;  3H08 A;  5M1P A;  1D9D A;  1UOC A;  2P9S A;  4BRD A;  5C25 A;  1SKS A;  4B3T K;  3DXM A;  2OZM A;  3MEG A;  1WOQ A;  4KTZ A;  3QEP A;  1SKW A;  1XWL A;  5AQI A;  2RN2 A;  3W0L A;  2UXD K;  4RW4 A;  3MK6 A;  1SQK A;  4JNE A;  3QEI A;  1X9M A;  4KRE A;  2VGM A;  4FPA A;  4CJR A;  2VG7 A;  2A6A A;  5JS2 A;  3THW A;  4XIU A;  3VQ6 A;  3V6D A;  4NB4 A;  1JKH A;  2W6L A;  4FSV A;  4B9U A;  4A5A A;  1JCG A;  4CHQ A;  2DY4 A;  4IG3 A;  3L2Q A;  1Q18 A;  3VEZ A;  4DR5 K;  2OCE A;  3IAY A;  3P4I A;  3VQ5 A;  4BE1 A;  1D5A A;  1JCE A;  4OKK A;  2A3Z A;  5E41 A;  1HR0 K;  2WON A;  3SQ2 A;  3CC4 N;  2O8D B;  1VQM N;  4DF4 A;  3PSI A;  4FJ9 A;  1QVF M;  4IJA A;  3DI6 A;  3H6E A;  1XUP O;  3DLK A;  5FPM A;  5FRN A;  3L3V A;  4FZY A;  1D8Y A;  3MEC A;  2IS3 A;  3QNO A;  4LF5 K;  3K5N A;  3V1O A;  3ATU A;  1VQ5 N;  4DS4 A;  2G8U A;  3FZH A;  4J2E A;  3CM6 A;  4OKJ A;  4ELV A;  1QQC A;  1CXQ A;  4CD1 A;  4IOC L;  2Q3S A;  2KZZ A;  3HBT A;  3TR8 A;  4O4G A;  4KO0 A;  5JVG L;  5AFU A;  3WEE A;  3TWH A;  3WNF A;  1OKJ A;  4CJL A;  2O4I A;  1JCF A;  3VGM A;  4BAC A;  2BAN A;  1KLM A;  3J81 O;  4WQ4 A;  3CC2 N;  3CG7 A;  4R79 A;  2YHB A;  4F2R A;  4HUF A;  3VEV A;  1NLV A;  3LZJ A;  4FJ8 A;  1IBL K;  2B4J A;  1W0H A;  5AZJ A;  5F1X A;  2P5O A;  2Q36 A;  3KK2 A;  3L4I A;  2O8B B;  3P83 D;  3M8P A;  1EKE A;  3SPY A;  2PYL A;  5C24 A;  4FLX A;  4WE1 A;  3CCJ N;  3KLF A;  3VET A;  1N8R O;  2GWK A;  1GLD G;  3D2F B;  4EP5 A;  2O8C A;  2V7Z A;  4CZL A;  1OH6 A;  1SZ2 A;  1CZA N;  1RBS A;  1ATN A;  4DUY K;  4CFB A;  1FKP A;  3NF9 A;  5BRH A;  2HHX A;  3QIP A;  3NE6 A;  3C7N B;  2HMI A;  2QWN A;  3OS1 A;  4EHU A;  4JYA K;  3EEQ A;  3SBT A;  3OYK A;  4HVJ A;  2PY5 A;  5DMR A;  3NAE A;  2ASO A;  3FZL A;  3NFA A;  2QEX N;  3BF1 A;  4LF8 K;  4HWI A;  3C7N A;  1S1W A;  1LWC A;  1ATS A;  4XH4 A;  4X66 K;  4JRQ A;  4GW6 A;  1YJ9 N;  4KH5 A;  4YDU A;  4F9O A;  3DMJ A;  3CET A;  4CHN A;  5CE3 A;  3QFP A;  1QQO A;  1T8E A;  5HRP A;  3CCU N;  3DRS A;  2E2O A;  2BDP A;  4RCH A;  4WCE L;  3KD5 E;  2P9N A;  3KTQ A;  2DFE A;  3ENO A;  4B9S A;  3MN7 A;  1SKR A;  1YTU A;  1KTQ A;  3TAN A;  4BR2 A;  4FLW A;  1NJZ A;  1VSH A;  4JS5 A;  4BRF A;  2IVO A;  4DSL A;  1OVY A;  1HJR A;  3IS9 A;  3IG1 A;  4FK2 A;  4H0P A;  2NZT A;  3NGZ A;  3BY5 A;  1Q8I A;  1QVG M;  4ISF A;  1SL0 A;  3PLA A;  3CHW A;  3O1W A;  3VF2 A;  5AQN A;  4OPK A;  1U45 A;  1C1A A;  5HRO A;  3NF6 A;  3IFR A;  4EAH D;  1NJW A;  5SWM A;  3K9K A;  5CYQ A;  3ZEU B;  3CD6 N;  4Y0W A;  4GV6 A;  2O8D A;  3CCL N;  3KK7 A;  4HCB A;  3PUF A;  3H1Q A;  3VEW A;  3SUN A;  1TYQ B;  2Q0R A;  2KHO A;  1Q82 O;  4CIF A;  2HST A;  4JLH A;  1HPM A;  2YV0 X;  5A2Q O;  4E7H A;  1HQU A;  5DM7 L;  3ASM A;  4YOR A;  3MAQ A;  4A2A A;  5GAG P;  3W3D A;  1VQ7 N;  4H0X B;  1IKX A;  2BUP A;  1FW6 A;  2QWM A;  5GAH P;  2WBN A;  4DCH A;  4CEZ A;  3QLH A;  4IOX A;  4BE0 A;  3DLG A;  3OYB A;  3HM9 A;  1K8A O;  5KI6 A;  3B6P A;  3PSF A;  2GUI A;  4O0J A;  3ZT1 A;  2E2Q A;  5C2F A;  1GOC A;  3MWT A;  4WFN L;  2Q1N A;  1ITG A;  2YHA A;  4IXC A;  4JHD B;  4W5R A;  4XH5 A;  1HYS A;  2VGN A;  1NK0 A;  2HMP A;  3OYD A;  2Q2R A;  4OJR A;  3ZET B;  4HTU A;  1BQN A;  5AZI B;  1S6P A;  2EX3 A;  3OA9 A;  1E4F T;  1VK0 A;  4DTN A;  3KK1 A;  1EWR A;  4NYN A;  4YFU A;  2IC3 A;  3VN5 A;  3ZSX A;  3SLC A;  3ZSZ A;  3NBP A;  4AQY K;  4OPJ A;  2X6N A;  4H4O A;  3WQU A;  1KAX A;  1L3T A;  3K5L A;  2GUP A;  3RMC A;  5BPM A;  5D3G A;  1V4T A;  1WB9 A;  2Q0U A;  3RTV A;  3HZ6 A;  4OLB A;  4C8L A;  1FXX A;  1L5U A;  3OY9 A;  4DV1 K;  1MDU B;  3LZI A;  5BPL A;  4ICL A;  3AO4 A;  2VQE K;  4CJU A;  4DV5 K;  4CGD A;  5LY3 A;  4H0O A;  1Y97 A;  3AVB A;  1D9F A;  1N6Q A;  2F4V K;  4CJE A;  3HT3 A;  4BRM A;  3NDK A;  3A8Y A;  3TAB A;  3I0S A;  3M8Q A;  5HOO A;  3NMU A;  1HNI A;  1O1W A;  4KRF A;  4LSL A;  3WXM B;  1U4B A;  3O3H A;  1P8Z A;  3P39 A;  1TUU A;  4CJS A;  2BE2 A;  3LAK A;  1LWF A;  4BRI A;  2XY8 A;  1KQS M;  2HNZ A;  3L6Q A;  5BR9 A;  1NGG A;  4B1U B;  3J7Y P;  2BH1 A;  5HBM A;  2QI2 A;  5T7B A;  4YOT A;  4JD2 A;  1YF5 L;  4M42 A;  4HUE A;  1BGX T;  4LF4 K;  5AQX A;  2YNG A;  1DT9 A;  1CXU A;  1LWE A;  2V52 B;  1TK5 A;  1BCO A;  4OPA A;  2YNF A;  1VQK N;  1RDD A;  1KVB A;  3CYM A;  3ID6 A;  3K5O A;  3U4L A;  4BRL A;  3DAW A;  2QA4 N;  2V7Y A;  4CI6 A;  3DRP A;  5EU7 A;  3VTI A;  3VQC A;  4BE2 A;  4M41 A;  4HTL A;  3AO1 A;  5AQV A;  3F73 A;  3O5B A;  1RDC A;  2JWL A;  1IKW A;  3RMA A;  2HHH K;  1EO1 A;  4PL7 A;  4B1Y B;  3C94 A;  5MLC Q;  3VEN A;  5EXW A;  4DG1 A;  3P31 A;  1P90 A;  3KJV A;  3K5M A;  1QS4 A;  3C6H A;  4O8U A;  3MN6 A;  2XHB A;  1J5E K;  4DR7 K;  3TAQ A;  1YVN A;  1WUA A;  2AP1 A;  4FWQ A;  4G9Z A;  1VQ9 N;  2NLX A;  3ZCM A;  4Z0U A;  3NGY A;  4IOA L;  2W41 A;  2HOE A;  4NO7 A;  3ZT4 A;  4CJQ A;  5CR4 A;  2XY7 A;  3ENH A;  4CIE A;  5DM6 L;  3EKS A;  1M1K O;  3VQP A;  1VQ6 N;  5I3U A;  1LW2 A;  3AO5 A;  4F4K A;  4CHO A;  2IAJ A;  1A5W A;  1SV5 A;  4WQ5 C;  2XO7 A;  4DV6 K;  1KCF A;  4IFY A;  2OPS A;  4B1Z A;  3VQ9 A;  1W7A A;  3HTV A;  3OW2 M;  4JKA A;  3CFR A;  1XC3 A;  3ZLJ A;  5AQT A;  4TSX A;  3U9D A;  4W5T A;  3BZK A;  3OYE A;  2UUB K;  2HW3 A;  3MED A;  3TU5 A;  3FFK B;  1S3X A;  4H5W A;  1J53 A;  4RW8 A;  1ATR A;  3ZT3 A;  2VYP A;  4JI8 K;  1RGI A;  5AQL A;  4Y1D A;  4BR4 A;  5AR0 A;  1T6C A;  2FBT A;  3O9R A;  3KLI A;  4O5F A;  1OH8 A;  1EQY A;  5AQU A;  2QWQ A;  3N4Q A;  3HPG A;  4E19 A;  3OYM A;  2RF2 A;  5HP1 A;  4UQG A;  4Q5V A;  1UA0 A;  1IO2 A;  4OLA A;  1ZBI A;  3FGU A;  4OVL A;  3H45 C;  3IMX A;  2HBL A;  2LSN A;  4ILJ A;  3P38 A;  1QTM A;  4CGF A;  4CVN E;  5SZT A;  2D0C A;  5GAD P;  1QSY A;  3D0P A;  1XC9 A;  3AA2 A;  2F9W A;  4JD2 B;  3MN5 A;  3AAP A;  2HHV A;  2GX9 A;  3FFI A;  4JKE A;  1GLL O;  1WNS A;  1Z6R A;  1B92 A;  2PAV A;  1ZC6 A;  3T7Z A;  3O4Q A;  1QQN A;  2NRR A;  3K58 A;  4AHS A;  2OPQ A;  5LL6 Z;  4E0D A;  5JLH A;  1WBD A;  4CEC A;  3VEY A;  1BUP A;  4OPH A;  4DF8 A;  4YHH K;  2OPP A;  4B3M K;  3C6A A;  3I33 A;  4RW6 A;  2QWL A;  2YHY A;  3O1B A;  3V1R A;  2ATQ A;  2FSK A;  3AVA A;  4YOV A;  4DTJ A;  2I7N A;  2XY6 A;  4CBW A;  4FWN A;  1TL1 A;  2P51 A;  4CJW A;  3BEX A;  1GOA A;  3SJJ A;  3VF4 A;  4CF1 A;  3QET A;  1NGH A;  4A59 A;  5KRS A;  4FJH A;  3R6M A;  1WAF A;  1SS6 A;  3UIQ A;  4KH6 A;  3EKU A;  3LDO A;  4OGE A;  1U04 A;  1NMN A;  4JI3 K;  4FZX C;  4FJI A;  1MU2 A;  4FXD A;  1RFQ A;  3CJB A;  4AHT A;  2FBY A;  3WQT A;  3VGK A;  4FJJ A;  5M1N A;  1GLE G;  1NKE A;  1V4S A;  3I55 N;  3DOK A;  2Z1J A;  1K73 O;  4Z4G A;  2OTJ N;  1IH7 A;  3I56 N;  4FLY A;  4ISE A;  4LFA K;  3NVM A;  2AA4 A;  1X3M A;  2Z1I A;  2X74 A;  2P9L B;  5AQJ A;  3DOL A;  1NK6 A;  4KBO A;  3AA4 A;  1NGI A;  4LH5 A;  3OYL A;  1U49 A;  3O4N A;  4NCB A;  3PIO L;  4Y1C A;  2W42 A;  2ZWH A;  3CPE A;  4M3Z A;  4DTU A;  3EN9 A;  3G10 A;  3LP2 A;  1SUQ A;  3AVL A;  1K8K A;  5EY4 A;  4OO1 J;  3DLE A;  4I7F A;  2QWO A;  3CIP A;  3HYF A;  4CE9 A;  4AF1 A;  4YOU A;  4PKI A;  2WOM A;  1YIT N;  4QOZ B;  4BRO A;  5FRM A;  4FM0 A;  3MDQ A;  2Z1H A;  1A5X A;  5TKW A;  2OZS A;  3CJ7 A;  3IKM A;  4FWL A;  3JS6 A;  4CZK A;  1DLO A;  2E8A A;  2FBX A;  2HB5 A;  4FK4 A;  4IFE A;  3QB0 A;  2QWR A;  2P5G A;  1MA9 B;  2RHK A;  3JXU A;  4O5B A;  4LF6 K;  1ASV A;  4F3T A;  5E26 A;  4B9Q A;  3MWP A;  1G15 A;  1EWQ A;  4ZTF A;  3OS2 A;  2X78 A;  4ID1 A;  1XMQ K;  3CCQ N;  1HQE A;  1UA1 A;  4FLV A;  1JLC A;  4CHP A;  4KAZ A;  4FCY A;  2E88 A;  3UKR B;  4JS4 A;  4B1W B;  2FXU A;  4JEP A;  4NCG A;  4KHS A;  4FVU A;  1X9J A;  5HRN A;  1U2V A;  2KZM A;  2ZD1 A;  2VCP A;  3HVT A;  3UKR A;  3ALY A;  3LDL A;  3UB5 A;  1JLF A;  5BRD A;  3K0S A;  4E7I A;  4M45 A;  4OKE A;  2QKB A;  2W6K A;  5DK5 A;  4YNQ A;  2E5L K;  2D0A A;  3SUP A;  4GKK K;  3VOV A;  4RG8 A;  3KWG A;  2P9K A;  1JLG A;  3DJC A;  3OJU A;  4E89 A;  3O3F A;  3K59 A;  3UKU A;  4CGI A;  3SUO A;  3PX4 A;  3T1Y K;  1HKC A;  1TL3 A;  4DTM A;  1WSE A;  3CQY A;  3TAG A;  2A41 A;  1WSJ A;  1YUW A;  4W5N A;  3MX2 A;  5BR8 K;  3BZC A;  5J2M A;  1HKG A;  2VQF K;  3UKU B;  4DQ8 A;  3R8E A;  4DLG A;  5AQH A;  4CEB A;  3OS0 A;  4CBU A;  3VGL A;  1L3S A;  5AQY A;  2YKM A;  1NWK A;  2A40 A;  3Q7B A;  3HP6 A;  4O8K A;  2W40 A;  4L8R B;  2KQ2 A;  4CZF A;  5LMN K;  4ZHR A;  1B9D A;  4KHW A;  4BQZ A;  4WFB L;  3T3F A;  4DSK A;  2JGU A;  2HBK A;  2B6A A;  3CJ1 A;  4CZE A;  1XHX A;  4J2D A;  3BP8 A;  3JYT A;  5F0X A;  3QNN A;  1H1V A;  1ASU A;  3LDN A;  3IUC A;  1T3V A;  3PX0 A;  4Z4F A;  4CFA A;  3E01 A;  3CCV N;  4LF7 K;  2A5X A;  3NH1 A;  3MXM A;  2P9L A;  1HYZ A;  4WYB A;  4BQL A;  3QIN A;  3QO9 A;  3ITH A;  1TGO A;  4DU4 A;  1GLB G;  4DLE A;  3CPW M;  2OYQ A;  4IFV A;  3HSC A;  3OHR A;  4FZZ A;  1NU0 A;  2OA8 A;  3CM5 A;  3D6R A;  3SMS A;  1VQO N;  2IDO A;  5AFU H;  3O4W A;  1GLJ O;  3K9J A;  3THY B;  2KLA A;  4QS9 A;  4DTS A;  4WF9 L;  1BDG A;  3H3O B;  3PV8 A;  1RDA A;  3LP3 A;  2WUS A;  1W9H A;  3WT0 A;  2ZJQ L;  2IGI A;  3HO1 A;  3CCM N;  5KQ8 A;  3ULD A;  4FPB A;  2P9U B;  4X65 K;  2WTU A;  3THY A;  2ZF5 O;  2XRI A;  4LH4 A;  5AQW A;  1NG9 A;  1RIL A;  1HJO A;  3QBX A;  5AQS A;  3ZSQ A;  4BVO A;  1VSE A;  4C1N K;  1QSS A;  1XNR K;  4AIL C;  1T7P A;  1DGK N;  4CFD A;  3QER A;  3V9W A;  4J2A A;  4JKC A;  1Q81 O;  4MQ3 A;  1BIS A;  1EX4 A;  4CJ3 A;  3QML A;  5AQP A;  2E6M A;  2VWK A;  3QIC A;  4Z4C A;  4DQR A;  4CHZ A;  2P9P A;  3OJS A;  1RT4 A;  1NGF A;  1NGA A;  4RTF D;  3R3L A;  2RE2 A;  3EY1 A;  1TKX A;  4JAX A;  1TV6 A;  1LW0 A;  3RVC A;  4AM6 A;  5BPN A;  4CF9 A;  4R5P A;  3V1Q A;  4PY5 A;  1KFS A;  4MFB A;  1JXE A;  1NM1 A;  2O8F A;  3VQB A;  3DLH A;  3VQA A;  2R7Y A;  3H3N O;  3ULE A;  3BUZ B;  4CK1 A;  2D0O A;  3S3O A;  2UU9 K;  4J8F A;  2KW4 A;  4JI5 K;  4FO0 A;  3DWL A;  3EZ5 A;  1JLA A;  2P9K B;  3AVC A;  1KRP A;  4DSF A;  3SAG A;  3L2U A;  3ULE B;  2HHQ A;  4C23 A;  3KIO A;  3ZSO A;  1C6V A;  1MWK A; 
#chains in the Genus database with same CATH homology
 4DG1 A;  4CEO A;  1S1X A;  3LAL A;  3KJV A;  3DLR A;  3NF7 A;  4LSN A;  3K5M A;  1QS4 A;  2A1S A;  4CK2 A;  3PO4 A;  3C95 A;  3PY8 A;  1X1P A;  2E4L A;  4KFB A;  1HRH A;  5CY4 A;  2XHB A;  2DTU A;  4FLT A;  2JLE A;  3TAQ A;  4CEQ A;  1ZBL A;  3RR7 A;  3AVM A;  1VSJ A;  4OGC A;  4I9Q A;  3U3G A;  4I2P A;  3ZCM A;  4B08 A;  1Z26 A;  4Z0U A;  3NGY A;  4J2B A;  3KLE A;  3V9S A;  4FJG A;  1GOB A;  1EP4 A;  4IG0 A;  4E7J A;  4KKO A;  3ZT4 A;  4CJQ A;  3HPO A;  2HHT A;  1JL2 A;  1R0A A;  3MEE A;  3ZSV A;  2XY7 A;  1NK4 A;  2ZQB A;  2D0B A;  4E7L A;  3TI0 A;  4PWD A;  4DFP A;  4CIE A;  3V9Z A;  3V9U A;  5KRT A;  1Q9X A;  2G8H A;  1VRU A;  3VQP A;  3L3U A;  4CEF A;  5I3U A;  1LW2 A;  3OYF A;  3AO5 A;  3AVI A;  3LAN A;  3G0Z A;  4F4K A;  3VQ7 A;  1VSI A;  1VSM A;  1ZBF A;  2B5J A;  4KTQ A;  4CHO A;  2IAJ A;  3PO5 A;  1RT1 A;  1A5W A;  2GV9 A;  3OVN A;  3KD1 E;  1SV5 A;  1X9S A;  4I2Q A;  3V4I A;  4CES A;  2XO7 A;  1I3A A;  1KCF A;  4IFY A;  2OPS A;  3VQD A;  1TAQ A;  4G1Q A;  3VQ9 A;  3DYA A;  4B8C A;  3ZSW A;  1WSG A;  2VWJ A;  3CFR A;  1RTD A;  1S5J A;  4CK3 A;  4N47 A;  4KI6 A;  4TSX A;  4BWJ A;  3K2P A;  4W5T A;  2DFH A;  3OYE A;  2FC0 A;  1VSD A;  3OYH A;  4FJX A;  1S9G A;  2HW3 A;  3MED A;  1WSI A;  1LAV A;  1S1T A;  4HCC A;  2HNY A;  1RBR A;  3TAP A;  4DQP A;  4DTR A;  4E1M A;  3DM2 A;  3H08 A;  1J53 A;  1YTA A;  2YKN A;  3AO2 A;  4RW8 A;  3ZT3 A;  3SNN A;  1D9D A;  4E1N A;  4CJF A;  1UOC A;  5C25 A;  1SKS A;  5CZ2 A;  2OZM A;  3QEV A;  4EZ6 A;  4N41 A;  3MEG A;  3BGR A;  4KTZ A;  3QEP A;  1SKW A;  1XWL A;  3M8S A;  2RN2 A;  4Y1D A;  4DQS A;  3T19 A;  1XHZ A;  1RCH A;  1KSP A;  2FBT A;  2P1J A;  3DLB A;  3KLI A;  2HHW A;  4RW4 A;  4FJN A;  1C0U A;  1J9A A;  4CJV A;  4HUG A;  3LPT A;  4GMJ B;  3OYN A;  1T05 A;  1CLQ A;  3HPG A;  4E19 A;  3OYM A;  2RF2 A;  4CJK A;  3QEI A;  5HP1 A;  1X9M A;  1U47 A;  4UQG A;  4B9T A;  4Q5V A;  4DU1 A;  1T03 A;  3KKS A;  1UA0 A;  4KRE A;  2A1R A;  1IO2 A;  1WAJ A;  1DTT A;  1YVU A;  3SPZ A;  2F8S A;  4OLA A;  4CJR A;  3AVJ A;  1ZBI A;  4CED A;  2VG7 A;  3OYI A;  5JS2 A;  5KTQ A;  4AHR A;  4OVL A;  4XIU A;  2X6S A;  3VQ6 A;  3V6D A;  3ZSR A;  3PX6 A;  1JKH A;  1Z25 A;  4E3S A;  2LSN A;  4B9U A;  3VA0 A;  3JSM A;  4AH9 A;  4CHQ A;  1QTM A;  2HHU A;  4LD0 A;  4CGF A;  5SZT A;  3SYZ A;  2D0C A;  2D5R A;  4IG3 A;  3VQE A;  3L2Q A;  2NUB A;  3D0P A;  1XC9 A;  1QSY A;  4N56 A;  3IAY A;  1JL1 A;  3AA2 A;  1ZBH A;  5HRR A;  2KFZ A;  3VQ5 A;  1NJX A;  4BE1 A;  4IDK A;  1L3V A;  3LAM A;  1BQM A;  1D5A A;  1DTQ A;  4OKK A;  3CFO A;  5E41 A;  2HHV A;  2WON A;  3FFI A;  4B8A B;  1J5O A;  4N76 A;  1WNS A;  4FJM A;  1B92 A;  3SQ2 A;  4KTW A;  5FRO A;  3O4Q A;  4DF4 A;  4M3Y A;  1WSF A;  4B9V A;  4FJ9 A;  3K58 A;  4AHS A;  2OPQ A;  3DI6 A;  4E0D A;  4FYD A;  4CEC A;  1F21 A;  3DLK A;  4PUO A;  3QES A;  5FRN A;  3L3V A;  4DF8 A;  2IOC A;  4FZY A;  4DSJ A;  3WNG A;  1U48 A;  1D8Y A;  2OPP A;  4KHY A;  3OYC A;  3MEC A;  2IS3 A;  3QNO A;  4FJ7 A;  3K5N A;  4RW6 A;  3AV9 A;  3V1O A;  1NK9 A;  1NKB A;  4K8Z A;  2DY4 A;  1IKY A;  3V1R A;  2ATQ A;  1TKT A;  3AVA A;  4CGJ A;  3C6U A;  4DS4 A;  4RW7 A;  4DQQ A;  1ASW A;  4DTJ A;  3CM6 A;  2G8U A;  4J2E A;  1JLB A;  2XY6 A;  3LDS A;  4OKJ A;  5HLF A;  4ELV A;  1QQC A;  1WSH A;  1TL1 A;  1CXQ A;  1HMV A;  2P51 A;  2Q3S A;  4CJW A;  4DSI A;  1KFD A;  4Z4I A;  2KZZ A;  4AHV A;  1NOY A;  1GOA A;  3TR8 A;  4O4G A;  3SJJ A;  3S3M A;  4CF1 A;  3QET A;  4KO0 A;  3TWH A;  2O4I A;  4DFJ A;  3WNF A;  2ZE2 A;  4CJL A;  1RTI A;  5KRS A;  4FJH A;  4BAC A;  1VSK A;  1KLM A;  1HPZ A;  1RTH A;  1WAF A;  2BAN A;  3RRH A;  3UIQ A;  1SL2 A;  3RR8 A;  3CG7 A;  3CFP A;  4FJL A;  4OGE A;  1U04 A;  4IBN A;  4NCA A;  1S9E A;  3SV3 A;  2YHB A;  3TAF A;  4FZX C;  4F2R A;  4HUF A;  4DFK A;  4FJI A;  3HST B;  3ZT2 A;  1MU2 A;  3LZJ A;  4FXD A;  4M3W A;  1UAX A;  4FJ8 A;  3KLH A;  2B4J A;  1W0H A;  4O55 A;  3L8B A;  3LP0 A;  2G8W A;  2P5O A;  4BWM A;  1C1B A;  4H4M A;  5J2N A;  3KK2 A;  3RMD A;  3WNE A;  4AHT A;  2FBY A;  1B9F A;  3P83 D;  3M8P A;  1EKE A;  3SPY A;  2PYL A;  2ETJ A;  5C24 A;  3T1A A;  4FLX A;  3QEW A;  1KVA A;  4FJJ A;  2BGG A;  1S1V A;  1IKV A;  4WE1 A;  3KLF A;  4K8X A;  1NKE A;  3DOK A;  2RKI A;  4EP5 A;  4M3U A;  1QE1 A;  2Z1J A;  5C42 A;  1SL1 A;  4Z4G A;  2O4G A;  1IH7 A;  5JS1 A;  1RBS A;  4FLY A;  4CFB A;  4CJ4 A;  4KPY A;  1FKP A;  2Z1I A;  3NCI A;  3HP9 A;  1BIZ A;  2X74 A;  1WN7 A;  3DOL A;  3NF9 A;  1NK6 A;  3BDP A;  2F8T A;  2HHX A;  3QIP A;  3AA4 A;  4LH5 A;  2FBV A;  3OYL A;  3NE6 A;  1U49 A;  3O4N A;  1NK8 A;  2HMI A;  4NCB A;  4Y1C A;  3OS1 A;  3LWM A;  2W42 A;  4IKF A;  5K14 A;  4HHT A;  4M3Z A;  1FKO A;  4DTU A;  2QK9 A;  3OYK A;  4HVJ A;  2PY5 A;  5DMR A;  3NAE A;  3G10 A;  3NFA A;  4CJ5 A;  2RPI A;  1YT3 A;  3LP2 A;  1SUQ A;  5CYM A;  3AVL A;  1S1W A;  1LWC A;  4O0I A;  3NGI A;  1RT5 A;  4KI4 A;  3DLE A;  4I7F A;  2HHS A;  3HYF A;  4JRQ A;  4GW6 A;  4DTP A;  4RW9 A;  4CE9 A;  3SQ0 A;  3DMJ A;  1NK5 A;  2GBZ A;  4CHN A;  5FDL A;  1L3U A;  2WOM A;  3AA5 X;  3AVF A;  4QOZ B;  4CER A;  5J1E A;  3VQ8 A;  5FRM A;  4FM0 A;  1T8E A;  2OPR A;  2Z1H A;  5HRP A;  1A5X A;  1BCM A;  1I39 A;  1LAW A;  2VG6 A;  3B6O A;  2G8V A;  2OZS A;  4KHN A;  1RBV A;  3DRS A;  4FVM A;  1VRT A;  1DLO A;  1J54 A;  2HB5 A;  2FBX A;  3EYZ A;  2BDP A;  4FK4 A;  2PYJ A;  4PQU A;  3KD5 E;  4N5S A;  3KTQ A;  2DFE A;  1BL3 A;  2P5G A;  4B9S A;  4O5B A;  1SKR A;  1YTU A;  1KTQ A;  3TAN A;  1ASV A;  4FLW A;  3RMB A;  4F3T A;  1NJZ A;  1NKC A;  2AJQ A;  1VSH A;  4JS5 A;  4DSL A;  4DS5 A;  1G15 A;  1HJR A;  1HYV A;  1K6Y A;  3IS9 A;  2XY5 A;  3IG1 A;  3OYG A;  3OS2 A;  4ZTF A;  4FK2 A;  2X78 A;  4ID1 A;  3SI6 A;  2VG5 A;  1BI4 A;  3OYA A;  1XI1 A;  1HQE A;  3NGZ A;  4NYF A;  5CZ1 A;  3CQ8 A;  1UA1 A;  4FLV A;  1S1U A;  1Q8I A;  5I42 A;  1NJY A;  4F8R A;  1JLC A;  4CHP A;  4KAZ A;  4FCY A;  5HRS A;  4C8K A;  1SL0 A;  4JS4 A;  3SUQ A;  3I8D A;  4EP4 A;  3O3G A;  4DTX A;  4KHU A;  1TK8 A;  1RT7 A;  4NCG A;  2Z1G A;  4LY7 A;  4OPK A;  4KHS A;  4QCL A;  1U45 A;  1C1A A;  4CF0 A;  5HRO A;  2G8I A;  3NF6 A;  5HRN A;  1NJW A;  5SWM A;  5CYQ A;  2KZM A;  3ZT0 A;  3SQ4 A;  2ZD1 A;  3QEX A;  4EZ9 A;  3PUF A;  4HCB A;  3HVT A;  3TAE A;  4KHQ A;  3ALY A;  3SUN A;  1TK0 A;  1JLF A;  1RT6 A;  1QHT A;  4E7I A;  3TAR A;  4M45 A;  5KGX A;  3U3Y A;  4OKE A;  2QKB A;  2ITG A;  3MXJ A;  5DK5 A;  4CHY A;  3NH2 A;  4CIF A;  4CJP A;  4YNQ A;  2D0A A;  3SUP A;  4JLH A;  3KLG A;  2YV0 X;  4E7H A;  1HQU A;  4RG8 A;  3U6F A;  3HPH A;  3ASM A;  1S6Q A;  3MAQ A;  1JLG A;  2PZS A;  3C6T A;  2HVH A;  3OJU A;  4F2S A;  4E89 A;  1IKX A;  3O3F A;  3K59 A;  3LPU A;  4CGI A;  4FJK A;  3SUO A;  3OYJ A;  3PX4 A;  4BDP A;  1TL3 A;  4DTM A;  1WSE A;  4DU3 A;  4CEZ A;  1TKD A;  3QLH A;  3VQQ A;  3TAG A;  4BE0 A;  1Q9Y A;  1WSJ A;  1RBT A;  3DLG A;  1RTJ A;  4ID5 A;  4W5N A;  1HNV A;  3D45 A;  1EXQ A;  3NF8 A;  4BDZ A;  1RT3 A;  1JLE A;  3OYB A;  3HM9 A;  4FW1 A;  4CEA A;  4CFC A;  5KI6 A;  3K57 A;  3B6P A;  4O0J A;  2GUI A;  3ZT1 A;  5J2M A;  3SCX A;  4KB0 A;  1VSF A;  1BIU A;  1GOC A;  1X9W A;  4DLG A;  3VA3 A;  1KVC A;  4GVM A;  4CEB A;  1TVR A;  4CGG A;  1C0M A;  3OS0 A;  1ITG A;  2HND A;  2YHA A;  4W5R A;  3V9X A;  2YKM A;  1L3S A;  3AA3 A;  1ZBU A;  3HP6 A;  3HXM A;  4M3R A;  3WNH A;  4ZTJ A;  4F3O A;  1LV5 A;  1HYS A;  1FK9 A;  1NK0 A;  2F96 A;  4I9L A;  3OYD A;  2KQ2 A;  3S3N A;  4L8R B;  2E6L A;  4ZHR A;  4OJR A;  1B9D A;  1A5V A;  4KHW A;  3F9K A;  4DSK A;  3NH0 A;  3T3F A;  3A2F A;  2JGU A;  4Z4E A;  2B6A A;  3P5J A;  3QIO A;  4HTU A;  1BQN A;  2YNI A;  1KLN A;  1XHX A;  4J2D A;  1NK7 A;  1S6P A;  1CZB A;  2EX3 A;  4E7K A;  1VK0 A;  4DTN A;  3KK1 A;  3JYT A;  2Y1I A;  3QNN A;  4NYN A;  1ASU A;  4CCH A;  4CEE A;  4YFU A;  2IC3 A;  1EET A;  3PX0 A;  3VN5 A;  4Z4F A;  4CFA A;  3E01 A;  1TAU A;  3ZSX A;  3ZSZ A;  3NH1 A;  3MXM A;  1QSL A;  3NBP A;  3L2R A;  3S9H A;  2DFF A;  4OPJ A;  2X6N A;  1HYZ A;  4H4O A;  3ISN C;  4W5O A;  3QIN A;  4DSE A;  1L3T A;  3QO9 A;  2KTQ A;  3K5L A;  3L2W A;  3RMC A;  2Y1J A;  3ITH A;  1TGO A;  5D3G A;  4DU4 A;  4DLE A;  2OYQ A;  3RTV A;  4IFV A;  4OLB A;  1JXB A;  4C8L A;  1C0T A;  1FXX A;  1L5U A;  2OA8 A;  4Z4H A;  3CM5 A;  4FZZ A;  4PA1 A;  1ZYQ A;  3AVG A;  4DFM A;  2KFN A;  3OY9 A;  2IDO A;  3LZI A;  3KKR A;  2HVI A;  1N5Y A;  4ICL A;  2G8F A;  3LP1 A;  3HK2 A;  3AO4 A;  3RRG A;  4CJU A;  4DTS A;  4CGD A;  4CJT A;  3PV8 A;  3DRR A;  2G8K A;  1RDA A;  4B9L A;  3LP3 A;  1Y97 A;  3AVB A;  4DTO A;  2QXF A;  1D9F A;  1N6Q A;  1W9H A;  1WLJ A;  3AVN A;  4CJE A;  3HT3 A;  2IGI A;  3NDK A;  3TAB A;  3P1G A;  3KK3 A;  3I0S A;  3M8Q A;  3ULD A;  3HO1 A;  1RBU A;  4B3O A;  5J2P A;  1HNI A;  1O1W A;  4AHU A;  4H8K A;  4KRF A;  2YNH A;  4LSL A;  2XRI A;  4LH4 A;  4BDY A;  1U4B A;  3O3H A;  4DWI A;  4CF2 A;  4CJS A;  1TKZ A;  1RIL A;  3MXI A;  2BE2 A;  4KV8 A;  3LAK A;  2EHG A;  1UWB A;  3ZSQ A;  4W5Q A;  3L2V A;  1LWF A;  1RT2 A;  1NOZ A;  1VSE A;  1REV A;  3ZSY A;  2XY8 A;  1QSS A;  4AIL C;  1T7P A;  2HNZ A;  4CFD A;  3QER A;  3V9W A;  3IRX A;  4J2A A;  3LWL A;  4MQ3 A;  4AHC A;  1BIS A;  4Q0B A;  5HBM A;  3HL8 A;  5T7B A;  4M3T A;  1EX4 A;  4CJ3 A;  4M42 A;  4HUE A;  1BGX T;  2E6M A;  1BI4 B;  4ELT A;  1CZ9 A;  2VWK A;  3RWU A;  4Z4C A;  4DQR A;  2YNG A;  4QAG A;  4CHZ A;  3M8R A;  3SZ2 A;  3V81 A;  3OJS A;  1RT4 A;  3AO3 A;  4FM1 A;  4DQI A;  3AVK A;  3SV4 A;  1CXU A;  1LWE A;  4ELU A;  3EY1 A;  1TK5 A;  1TKX A;  1TV6 A;  1BCO A;  1LW0 A;  2YNF A;  4O44 A;  1RNH A;  1RDD A;  4FM2 A;  1KVB A;  1IG9 A;  1C1C A;  3CYM A;  4CGH A;  4DMN A;  3K5O A;  4CF9 A;  4R5P A;  3V1Q A;  4PY5 A;  1KFS A;  4MFB A;  3HJF A;  1JXE A;  4C8N A;  4B9N A;  2QKK A;  4FLU A;  3VQB A;  3DLH A;  3VQA A;  4CF8 A;  4FJ5 A;  3DRP A;  5EU7 A;  2R7Y A;  4FLZ A;  4JRP A;  3I0R A;  3VQC A;  3S3O A;  4CK1 A;  4B9M A;  4BE2 A;  2I5J A;  4M41 A;  3AO1 A;  2KW4 A;  4KB1 A;  4M3X A;  3VQ4 A;  3AVH A;  1RDB A;  1BHL A;  5KGW A;  3THV A;  3F73 A;  3SQ1 A;  4FK0 A;  3EZ5 A;  1RDC A;  1JLQ A;  1JLA A;  4FW2 A;  5J2Q A;  1IKW A;  3AVC A;  3TAM A;  1VSL A;  4C8M A;  3HVR A;  1KRP A;  3RMA A;  4DSF A;  3L2U A;  4C8O A;  2HHQ A;  3NHG A;  3KIO A;  3ZSO A;  3C94 A;  1C6V A;  4CIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...