3AV9A

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 57
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3av9A00
3RMDA 3TAMA 4E1NA 4FJ7A 1JLQA 3LAKA 1WN7A 4F3TA 4XIUA 1S1XA 4O44A 2X74A 4CESA 1S9GA 3K5LA 3K59A 4DFKA 1UWBA 1HRHA 1SL2A 4OLAA 4CHOA 3NFAA 4G1QA 3I8DA 3SUNA 4C8LA 3ZT1A 3RR8A 5J2MA 2DFEA 1EXQA 3AVBA 3VQQA 1YTAA 4E1MA 3AVAA 3TABA 3DLHA 1HYZA 3ZSXA 3CFPA 1C0TA 4FM0A 2G8IA 4CJLA 2A1RA 4CGFA 3V9UA 3WNHA 3O3HA 4CJ5A 4DU3A 3U3YA 1NK5A 1SKRA 3OS1A 3M8RA 2G8VA 4I2QA 1KFDA 2QXFA 4RW9A 4FJGA 3L2QA 4FK4A 4AILC 4Z4GA 4CJKA 4BDZA 3PV8A 3PX0A 4EP5A 3DRRA 4NCBA 2VWKA 1BHLA 3T1AA 2VG7A 3CFOA 3VQ6A 2QK9A 4PY5A 3PX6A 1VSKA 1BISA 3PUFA 4KV8A 1S6PA 4IG3A 5DMRA 4M3WA 4FJHA 4W5OA 5CY4A 4PWDA 3IRXA 3MXMA 2HW3A 1LV5A 1DTTA 1WAJA 4CEDA 3LZIA 3CQ8A 4ELUA 3KK3A 4FJLA 4DTXA 1EX4A 2DY4A 3OJSA 2GV9A 4CJPA 1JLAA 2HVHA 4GMJB 3KLEA 3CFRA 4CEFA 4LSLA 1U47A 4AHCA 5KI6A 4B08A 4N56A 4B9UA 3WNFA 4M3XA 4J2DA 2X6SA 1TK5A 4LD0A 2PYJA 5J1EA 4W5RA 1KLMA 3P83D 1C1AA 5K14A 4DU1A 1HPZA 3LP1A 1VK0A 1BCOA 1EP4A 1CZBA 2NUBA 4EZ6A 2R7YA 4FJNA 1BI4A 4DTUA 4E19A 3HO1A 4M41A 2IOCA 3ZSZA 3AVGA 4CEAA 3S9HA 2BANA 2D0BA 4CEZA 4CHYA 1QSYA 4L8RB 3DLBA 4B3OA 4HHTA 4KB1A 4CIGA 1A5VA 1LWFA 4OJRA 5KTQA 1YTUA 2B6AA 4UQGA 2PY5A 3MEDA 3SNNA 1TV6A 4DU4A 1BQNA 1N6QA 1NOZA 4PA1A 3AO4A 3HXMA 3THVA 4CCHA 1VSIA 4MFBA 1RBRA 1WSGA 3B6OA 3QNNA 2KFNA 1Q9XA 5FRNA 1UAXA 1KTQA 2BE2A 1FKOA 4KHUA 4CFDA 1WSJA 4DLEA 2YNFA 4Z4CA 3S3MA 3L3VA 1KSPA 1RT6A 1SUQA 1VSDA 2ZQBA 3AVCA 1XWLA 3QERA 1ASVA 1X9MA 1QQCA 3SZ2A 3AVHA 1U48A 3V1QA 1L5UA 4B9SA 4CEBA 1LAWA 4I2PA 3RMCA 2OZMA 1GOCA 4Z4HA 4FJKA 2Y1IA 2XY8A 1IH7A 4CJWA 1ZBHA 1QTMA 2YKNA 3OYJA 3AVIA 4DQIA 5CZ2A 1QHTA 4NCAA 3QEWA 1RBVA 4BDPA 4KREA 4B9VA 1S1WA 3D0PA 4Z0UA 4CK1A 4RW8A 4KKOA 1L3VA 4CGDA 4FLXA 1KVAA 4KPYA 1LW2A 4FCYA 1BIZA 1TKZA 2ETJA 1IO2A 3RTVA 4AH9A 3QEXA 4B8CA 3DOLA 3OS2A 4FLTA 1KLNA 5E41A 4KHYA 4IBNA 1RILA 3HT3A 2P5GA 1NK9A 4K8XA 3C95A 4CJVA 3OYMA 3OYGA 3L2RA 2P5OA 3KK2A 3EZ5A 5DK5A 2DFFA 3DM2A 2Z1JA 1SKSA 4B9NA 3A2FA 5T7BA 1NK4A 3BDPA 4H4OA 4CF8A 4QCLA 4GW6A 2XY7A 4DTJA 3MXJA 2WONA 3KLFA 3LALA 3OYIA 1VSEA 1CZ9A 1S5JA 2FBTA 1IKWA 3AO1A 3LP3A 4BWMA 3VQEA 1DTQA 4CGJA 1TAUA 4Q0BA 3NH2A 5KGXA 1RBTA 4FLVA 3V81A 2OPSA 3OYDA 3MEEA 3QINA 3CYMA 2E4LA 1JL2A 4JS4A 1TKDA 4DTRA 2HNDA 3BGRA 4CE9A 3VA3A 4EZ9A 1BI4B 4DSJA 4FJJA 3MECA 4DQQA 3MAQA 4O5BA 3LZJA 3SQ2A 1Q9YA 4CEOA 3OYLA 1BQMA 2D0AA 1J54A 4DQRA 1ZYQA 4LSNA 4C8KA 1VRUA 4FW2A 4BWJA 4DG1A 4DTNA 1S9EA 1SKWA 4KI4A 1CLQA 1GOBA 1Q8IA 1QSSA 1U45A 1VSJA 3PX4A 3QLHA 1S1UA 3QEIA 2O4IA 2OZSA 4NYFA 4DFPA 3D45A 5HROA 4E0DA 4K8ZA 2ZE2A 2B5JA 3SPZA 2KTQA 1ITGA 4E7KA 3UIQA 4E89A 4DS4A 3NF9A 1RDBA 4RW6A 3F73A 4KHNA 1REVA 3HSTB 4DFMA 2FC0A 4RW7A 1S6QA 3ZSVA 5HBMA 4CIFA 4CF9A 3M8PA 4DSFA 2HHUA 1X9WA 4R5PA 4AHUA 1QSLA 1RCHA 1RTJA 3NH1A 4CHZA 2VG6A 3CM6A 1D9FA 4C8OA 4FJ9A 4B9MA 1JLEA 1RTIA 4BE2A 1JXBA 2JLEA 4NYNA 1UA1A 1TK8A 3NGYA 1RBSA 1W9HA 1NJYA 4M3TA 1A5WA 1JXEA 3H08A 3SQ0A 4E3SA 3LWLA 2Z1GA 4FYDA 3G0ZA 3T19A 4DSIA 1TL1A 4Z4EA 4KHSA 4FJMA 2AJQA 3LPTA 4AHSA 2Z1HA 4ID5A 4FLYA 3IAYA 3AA3A 3QNOA 2Z1IA 1SV5A 4IKFA 4DTPA 1KRPA 2O4GA 2P1JA 1UOCA 3TI0A 1NK7A 4E7IA 2HHTA 4OLBA 3OS0A 4OKKA 1LW0A 4F2RA 5C24A 5FDLA 3ZSQA 2E6LA 4HUGA 5SWMA 1CXUA 4GVMA 4W5NA 1HNIA 4HUFA 4BE1A 4OPKA 4E7LA 2QKBA 4CFAA 4CHQA 4KTWA 2OA8A 3AVJA 3L3UA 3VQ9A 4CECA 4N5SA 5HRSA 2YV0X 3AVFA 1JKHA 1TAQA 2FBXA 4KHWA 1WSEA 3NF8A 4CK3A 3VQDA 3NGIA 1S1TA 1C0UA 3HM9A 4M3YA 4Y1DA 4DTOA 4DSEA 3FFIA 3I0SA 2W42A 3K57A 2BGGA 1F21A 4FM1A 2YHBA 4WE1A 2P51A 4CJUA 3TWHA 2XY6A 1L3TA 2PZSA 3DRPA 2G8UA 1JLCA 1JLBA 3HVRA 3HJFA 3U6FA 5KRSA 3MEGA 3AO2A 1C0MA 1QS4A 3RMAA 1FKPA 2Y1JA 3NCIA 3LP0A 4CGGA 1WSHA 5J2PA 2KZMA 3ZCMA 1SL1A 2B4JA 3OYAA 2BDPA 4F4KA 4ELVA 3HYFA 3KK1A 1NJWA 4I9QA 4FVMA 1HJRA 1TKTA 1WNSA 2YNIA 3LPUA 1RT4A 3B6PA 3DLEA 3IS9A 3OYNA 3VA0A 2IGIA 3QESA 1T05A 1QE1A 3ZT3A 3TAPA 5C25A 2HHQA 2JGUA 5FROA 4ZHRA 3AVMA 3E01A 4H8KA 3TR8A 3AVNA 3LANA 4ZTJA 1J5OA 1J9AA 4CHNA 1NOYA 3ULDA 3PY8A 4KHQA 4OVLA 4PUOA 5KGWA 3K5OA 4CEQA 4CJRA 4BDYA 2QKKA 3L8BA 3DLKA 5FRMA 3HPHA 1KVBA 4FXDA 2X78A 1BIUA 4CHPA 4N41A 4YNQA 4KI6A 1JLGA 4CJEA 2HHXA 3L2VA 2DTUA 1VSLA 3NF6A 4RG8A 4FLWA 3SQ4A 4IFVA 1T7PA 2E6MA 3VQ7A 5SZTA 3PO4A 1RT7A 4M3RA 4FLUA 3NDKA 2OPPA 3IG1A 3KJVA 4F3OA 5CYMA 4CFBA 1R0AA 4FJ5A 1D8YA 1HYVA 3TARA 4FZXC 4C8MA 2HB5A 5I3UA 4CJ4A 3SQ1A 2F8SA 2G8WA 4B8AB 4ZTFA 1VSHA 2GUIA 1BCMA 3AO5A 4YFUA 1NK8A 3CG7A 4AHVA 3SV3A 3T3FA 3AA2A 4DFJA 3C6UA 3NE6A 3NGZA 3DRSA 5J2QA 4JRQA 3DMJA 3P5JA 3O4QA 2ZD1A 1BGXT 3LAMA 3SUOA 1RNHA 4FLZA 4DQSA 3AVKA 4CJ3A 3HP9A 5HRNA 2I5JA 3K5MA 2G8HA 5D3GA 4E7JA 4KRFA 1JL1A 2HNZA 2EX3A 4O0JA 1DLOA 1RT2A 3V4IA 2XO7A 3OJUA 2D0CA 1HQUA 2LSNA 3HK2A 5KRTA 4N76A 3SYZA 3K2PA 1VRTA 2KW4A 2IDOA 1JLFA 5CZ1A 3V1RA 2IS3A 2ATQA 2OPRA 3KLGA 2OPQA 2KFZA 1YVUA 2YKMA 3AA4A 1I39A 4RW4A 3SV4A 4KAZA 1RT3A 4CF2A 3LWMA 1N5YA 4FJXA 1WSIA 4CJSA 2RPIA 3RMBA 1UA0A 1L3UA 3CM5A 3KKSA 4OKEA 4CF1A 1WLJA 1IG9A 1TL3A 3HPGA 2RN2A 4N47A 4DQPA 1GOAA 3M8SA 3SI6A 1NJXA 4CJQA 4LY7A 3VQPA 2A1SA 4FM2A 4IFYA 1EETA 4O55A 1D5AA 3VQAA 4HVJA 1XHZA 4ELTA 4J2EA 3K58A 1A5XA 2Q3SA 3RR7A 1RDCA 4FW1A 1EKEA 1J53A 4DF8A 3TAFA 5HLFA 4FZYA 3ZT0A 3DI6A 4CF0A 5HP1A 5C42A 4CFCA 3DYAA 3NBPA 1RT1A 4DMNA 4I9LA 4LH4A 2XY5A 5HRRA 3QIOA 2DFHA 4Z4FA 2RKIA 1U49A 1HYSA 3DLRA 4CIEA 3ZT2A 1NK6A 4FK0A 4HCCA 3I0RA 3HL8A 3C6TA 3OVNA 4NCGA 2HVIA 2HHVA 3QO9A 4CERA 4JLHA 4F8RA 4DS5A 5J2NA 4DSLA 3VQ4A 3AV9A 4AHRA 4HTUA 3ZSWA 4B9LA 3NAEA 4DLGA 1ASWA 2EHGA 1C1CA 1ZBIA 2YHAA 1NKEA 2X6NA 3WNGA 3SJJA 1Y97A 3HVTA 4CGHA 4M3UA 1U04A 4F2SA 3QIPA 4OGEA 1KFSA 3G10A 4FJIA 4Z4IA 4QAGA 4Y1CA 3SUQA 4H4MA 4HCBA 1T8EA 1X1PA 1TK0A 5CYQA 3V9SA 1RTDA 4OPJA 3KLIA 4W5QA 2F8TA 3F9KA 2FBYA 1X9SA 5JS2A 4CK2A 3RRHA 3KIOA 3NF7A 3JSMA 3V9WA 3TAGA 2IC3A 4W5TA 4B9TA 1G15A 4IDKA 3SCXA 4PQUA 1NJZA 3MXIA 3OYKA 1D9DA 3EY1A 4J2BA 3RRGA 4AHTA 1B9FA 3VQ8A 2RF2A 1CXQA 2HNYA 4KTZA 4C8NA 2HMIA 3SUPA 1TVRA 1IKXA 1B92A 2YNGA 1LWCA 4LH5A 4CJTA 3ZSYA 3OYBA 4M3ZA 3LDSA 3QEVA 1WSFA 1XI1A 1L3SA 1IKYA 4HUEA 3EYZA 4DSKA 2GBZA 2VG5A 4BACA 3KTQA 4QOZB 2G8FA 2KZZA 2G8KA 4Q5VA 1W0HA 1FXXA 3ISNC 3HPOA 3QEPA 3TAEA 3V9ZA 5I42A 3L2WA 1I3AA 4BE0A 3JYTA 2HHWA 3KKRA 4OKJA 3C94A 4OGCA 4IG0A 3OY9A 2FBVA 1KCFA 2YNHA 1VSMA 3ALYA 2ITGA 4KFBA 5JS1A 1HMVA 1C1BA 1U4BA 3P1GA 3TANA 1HQEA 4MQ3A 1KVCA 3OYHA 4DTSA 1ZBFA 1B9DA 1RTHA 3QETA 1SL0A 1VSFA 3KD1E 4KB0A 3O3FA 3DOKA 4J2AA 2F96A 4O4GA 1RDAA 3U3GA 4ID1A 4M45A 3SPYA 1BL3A 3VQBA 4DF4A 1LWEA 1RBUA 3ZSOA 4CJFA 3KLHA 3WNEA 1O1WA 3ZSRA 3KD5E 1WAFA 3NHGA 2OYQA 4KO0A 1S1VA 3AA5X 1C6VA 4TSXA 3DLGA 1RDDA 4CGIA 2VWJA 4DTMA 3V9XA 1NKBA 1TGOA 4FZZA 1Z26A 3AVLA 2D5RA 3ASMA 2XHBA 1LAVA 1IKVA 3V1OA 1FK9A 3L2UA 4JS5A 1T03A 1K6YA 4I7FA 4ICLA 3OYEA 3VQCA 5HRPA 2HHSA 3HP6A 3O3GA 1ZBUA 4JRPA 1ZBLA 3S3OA 4O0IA 3S3NA 1MU2A 3ITHA 3AO3A 3K5NA 1Z25A 3RWUA 3PO5A 3ZT4A 1RT5A 3NH0A 3OYCA 4M42A 1HNVA 1YT3A 2KQ2A 3O4NA 4E7HA 1XC9A 3VQ5A 4KTQA 2XRIA 1NKCA 3LP2A 1XHXA 4EP4A 2PYLA 1ASUA 3M8QA 4CEEA 3OYFA 3TAQA 4FK2A 4DWIA 2WOMA 5EU7A 3VN5A 1TKXA 4FJ8A 2IAJA 1NK0A 3V6DA
chains in the Genus database with same CATH superfamily
5E84A 3SK3A 3LAKA 5TKWA 1WN7A 4XIUA 4JD2B 4CHOA 5C0YA 4H5RA 3ZT1A 3RR8A 5J2MA 2DFEA 4BR7A 1EXQA 3FZLA 3VQQA 2V52B 3AVAA 3WEEA 3I56N 4PL8A 3DLHA 1HYZA 4MLHA 1C0TA 3MN9A 3MWPA 4PHTX 3T1HK 3U3YA 3VEXA 3M8RA 3M6GA 4RW9A 3VEOA 4FK4A 5JMVA 4BDZA 3IMXA 4NCBA 4PY5A 3T1AA 3PX6A 4X62K 1S6PA 1K73O 2KKZA 4HTLA 5C15A 4FJHA 4LF6K 4YOXA 2FLOA 1LV5A 4DTXA 2GEMA 4GMJB 5F2RA 5JLFA 5KI6A 2HSTA 1OH7A 4BQLA 4M3XA 2NRWA 4FWKA 2PYJA 2F9TA 3CETA 4W5RA 3P83D 5K14A 1HPZA 1EP4A 4FJNA 1BI4A 5ELZA 4DTUA 2P9UB 4CEZA 4FWRA 4BC3A 1P90A 2QTDA 1LWFA 1YTUA 4H0TB 2W40A 3SNNA 1N6QA 4QS8A 3AO4A 1RBRA 4R79A 3QNNA 5FRNA 1Y64A 4JV5K 5AQGA 3ENBA 4CFDA 4DLEA 4B3MK 3QERA 3AVCA 4B1WB 3SZ2A 3UKRA 4DHYA 2P9LB 3D7EO 1LAWA 2IIRA 1GOCA 4JI8K 4FJKA 3ZEUB 4K43A 4DQIA 1WUAA 5TKYA 4BR2A 5CZ2A 1QHTA 3TSUA 4KREA 1S1WA 4KKOA 1BIZA 3CJCA 3DOLA 1RILA 4K8XA 2VQEK 3DM2A 4GVEA 4QCLA 5I9EB 3MXJA 3KLFA 2PFUA 3P38A 1CZ9A 1S5JA 3EE8A 3CC2N 4Q0BA 3EE9A 4XH4A 1RBTA 4K41A 3MMVA 4IXCA 4I6MA 3CYMA 2E4LA 2QM1A 4FPBA 4BRCA 4JS4A 3FZHA 1TKDA 4DSJA 3MECA 4DQQA 3MAQA 1BG3A 4CEOA 1J54A 4GV6A 1VRUA 4DG1A 1S22A 3CCJN 1CLQA 1G99A 1U45A 2OZSA 4NYFA 4BG8A 5ADXA 5HROA 3SPZA 1TUUA 2J4RA 3WQTA 4CBXA 3HSTB 3VTHA 1S6QA 5HBMA 4CF9A 1RCHA 4CHZA 3CM6A 3TSPA 4ILHA 2JLEA 4M7XA 1TK8A 3TU5A 1W9HA 1NJYA 4M3TA 4E3SA 1U6ZA 3T19A 1OVQA 2Z1HA 3ATUA 3IAYA 3AA3A 3QNOA 2E20A 3E9LA 4DTPA 4WFBL 2O4GA 3H6EA 2HHTA 3OS0A 5SWMA 1HNIA 3D2FA 4OPKA 4CFAA 4X64K 2OA8A 3OBWA 2WC9A 1BUPA 1TAQA 2FBXA 1WSEA 3NGIA 4DTOA 2OTJN 2YHBA 3VMFB 2E1YA 2FSNA 4H5VA 4DR4K 4B1ZA 3HSCA 3M3ZA 1JLBA 3S41A 3HJFA 1IBMK 4AM7A 2CGLA 3KZBA 2AA4A 2KHOA 2BDPA 1SQKA 3KK1A 4IO8A 1RT4A 3DLEA 3OYNA 2IGIA 3MDQA 4OO1J 5AQXA 2JGUA 2HHQA 3J8AA 3KHYA 4YORA 2YX6A 3AVNA 2OTLN 4CHNA 4KHQA 3EEQA 3K5OA 5HL7L 4A5BA 3HPHA 4FXDA 2X78A 4EHUA 2AP1A 1JLGA 1HNWK 4FLUA 2D4WA 3AY9A 3NDKA 3KJVA 4F3OA 4CFBA 2QXLA 3TARA 2HB5A 5I3UA 5BR9A 3BP8A 1VQMN 3ZX2A 3LM9A 3LDPA 4B8AB 4ZTFA 1VSHA 3JS6A 1NK8A 3CG7A 4K25A 4AHVA 3T3FA 4BREA 2JWKA 5J2QA 3E9PA 5DM6L 1ZXOA 1RNHA 2A3ZA 2A41A 3K5MA 2I5JA 5AQOA 2CGKA 1DLOA 1NU0A 2XO7A 3HK2A 1HQUA 2LSNA 4WFAL 3ZX0A 5KRTA 3Q7BA 1HJOA 1BOTO 1VRTA 2ATQA 4A2BA 5LY3A 4JI0K 1YVUA 2GUPA 3M1FA 4L3QA 1RT3A 4CF2A 5AQMA 3O08A 4FJXA 1TYQB 4CJSA 4JI2K 3RMBA 1UA0A 3G25A 3KKSA 1WLJA 4DV3K 2P9KA 4FWSA 4LY7A 3PIOL 3VQPA 4DV4K 1N34K 2UYTA 1D5AA 4J2EA 3K58A 1A5XA 1XNQK 1NGGA 1RDCA 4BR5A 4JI5K 4QS7A 1EKEA 1T3VA 3TAFA 3HTVA 5HLFA 4FZYA 5DM7L 3CIPA 1SAZA 3I55N 2A40A 5M1KA 5HRRA 4LF9K 4NLBA 3PLAA 4CIEA 3ZT2A 4X66K 3C6HA 3H3OB 4BRDA 5KPZA 3THYB 1HX1A 5J2NA 4DSLA 4GY2B 3VQ4A 4RWTA 1NNEA 1VQ7N 4FO0A 4DUYK 2YHAA 1ZBIA 1W97L 4WQ5C 4CGHA 4M3UA 3QIPA 4BVOA 3QBWA 3G10A 1N32K 1Q86O 4H4MA 4HCBA 1T8EA 5CYQA 4OPJA 2F8TA 4BRIA 1HUXA 3KIOA 4FWPA 3JSMA 3V9WA 3VEWA 1D9DA 2Q31A 1OH8A 4AHTA 3C7NA 4IFEA 3CJ9A 3BF1A 3LDQA 4JHDB 2O8BA 4JK8A 2VWBA 3ZSYA 4DR2K 4U67L 1XI1A 3H46O 1IKYA 3EYZA 4WF9L 1GLLO 3KTQA 3CI5A 4JI3K 3HPOA 3QEPA 2E2OA 3V9ZA 3BZCA 4BE0A 3C94A 2QWPA 2CGJA 5B8HA 2YNHA 1X9JA 4GKKK 2GWJA 4C1NI 1E3MA 1RTHA 4UY8O 1VSFA 2O8FB 2Q1NA 4LFAK 3U3GA 4ID1A 3VQBA 1LWEA 4GV9A 5AQKA 3Q7CA 3KLHA 1WB9A 4LF4K 3VF6A 3AA5X 1C6VA 2FSJA 3DLGA 3VETA 3ASMA 2XHBA 3UB5A 1FK9A 3L2UA 1T03A 4I7FA 1VQON 4IOCL 2FF6A 3VQCA 3O3GA 4JRPA 3CPEA 1ZBLA 4O0IA 2BH1A 1T6DA 3ZT4A 1RT5A 3NH0A 4BC4A 1HNVA 3BEXA 1KC8O 3FZMA 4KTQA 1BDGA 4EFHA 4FK2A 1ASUA 3M8QA 4CEEA 3OYFA 3CPWM 2IAJA 3RMDA 4FJ7A 2P9PA 4O44A 4XH1A 2X74A 4H5WA 3K5LA 1UWBA 4BQZA 2O8CB 2UXCK 4C8LA 2W41A 3RSEA 1OVYA 2D0PA 3CERA 3CFPA 3QB0A 3NVKA 5BRFA 2A1RA 3LL3A 3V9UA 3O3HA 4CJ5A 5A2QO 4DU3A 1NK5A 3AGRA 3FFKB 4I2QA 2G8VA 2QXFA 4FJGA 4NO7A 4CJKA 3PX0A 2QK9A 1BHLA 2VG7A 3VQ6A 5KPRA 1VSKA 4K0KK 4PL7A 2V7ZA 4M3WA 5CY4A 4U7BA 3MXMA 1XMQK 2E5LK 5M1NA 3SMSA 3F5TA 2DY4A 1YUWA 2GV9A 1JLAA 3H1QA 3KLEA 4LF8K 4X65K 1OH6A 3THXA 1H1VA 3LDLA 1W7AA 5J1EA 3BUZB 1KLMA 3CCRN 4JI7K 3LP1A 1VK0A 1CZBA 4EZ6A 3CCUN 4CZKA 4E19A 3HO1A 4M41A 2IOCA 5M1PA 3ZETA 2BANA 2D0BA 4CHYA 4YHHK 1QSYA 4B3OA 4HHTA 1A5VA 5KTQA 5AZJB 2B6AA 4UQGA 2PY5A 3MEDA 1BQNA 3HXMA 4MFBA 2KFNA 1UAXA 2OCEA 2BE2A 3CMAN 4KHUA 5H1SQ 2YNFA 3CJ7A 1KSPA 3VTIA 4CZFA 2GX9A 1XWLA 4B9SA 4I2PA 3RMCA 4Z4HA 3UKUB 3CC7N 4AQYK 1IH7A 4BRLA 2YKNA 3AVIA 2NNWA 3CJ1A 3QEWA 5AQPA 4BDPA 1XNRK 4Z0UA 3SMPA 4CK1A 1FJGK 4CGDA 1KVAA 1TKZA 4AH9A 3OS2A 1U2VA 4FWNA 4FLTA 2P5GA 1YI2N 4OPHA 3OYGA 3OHRA 3T69A 3KK2A 2VCPA 3A2FA 1NK4A 3BDPA 3O9TA 4CZGA 4JN4A 4GW6A 4FOEA 3D2EA 4WQ4C 2XY7A 4DTJA 1HPMA 1NGIA 2E8AA 1HR0K 1IKWA 3AO1A 3LP3A 1DTQA 1BWFO 4FLVA 4O5FA 2FSKA 2OPSA 3MCPA 3R1XA 4B3RK 1K8AO 1JL2A 2D1KA 4JK7A 4JKEA 4FWMA 4LFCK 4H0OA 3VA3A 1BI4B 3THWA 3SQ2A 1BQMA 3F9MA 4BR4A 4QS9A 4JYAK 1GOBA 3PX4A 3QLHA 4BC2A 3P39A 2O4IA 4IEIA 2ZGYA 1VQ6N 2B5JA 2KTQA 3UIQA 1RDBA 1YHQN 4DFMA 2FC0A 4MDAA 4BRPA 3ZSVA 4DSFA 2ZF5O 4CIFA 1BA0A 3NH1A 1NGCA 4FJ9A 2VG6A 1W2BM 4H5NA 2ITMA 2I7NA 3WXMB 3NGYA 4BGBA 2PAVA 2Z1GA 5EXWA 1YJNN 4FLYA 4ID5A 5KQDA 4KHPK 1SV5A 2YHYA 1KRPA 3C0BA 1NK7A 2CH5A 1LW0A 3WXIA 4BG9A 4HUGA 5LMNK 2E6LA 1CXUA 4W5NA 4HUFA 1ZC6A 5AQNA 3D6RA 3VEZA 4E7LA 4CHQA 2ZWHA 3L3UA 4N5SA 5BR8K 3LDOA 4DV0K 4CK3A 4M3YA 1S1TA 1C0UA 4Y1DA 2ZGZA 2W42A 2BGGA 4F9OA 4IZ9A 4FM1A 4I6MB 3WXJA 3DRPA 4BC5A 1JLCA 3HOTA 5GAEP 4WQ5A 3RMAA 3LDNA 3LP0A 1WSHA 5J2PA 2B4JA 1LOTB 4WCEL 3IKMA 4BROA 2HBLA 4I9QA 3DWLA 3LPUA 3B6PA 3VESA 3O1WA 1QE1A 1ILYA 3MWTA 3ZT3A 4EHTA 4LF7K 5C25A 1ATRA 1J5OA 4H0XB 1NOYA 2WTUA 2VGMA 4OVLA 2QI2A 4PUOA 5KGWA 4CJRA 3L8BA 1EQYA 2HBMA 3DLKA 5FRMA 3GE1A 2HOEA 4N41A 1Q7YO 4CJEA 3CHWA 2DTUA 1VSLA 1T7PA 4FLWA 3SAGA 1RT7A 2OPPA 1X3NA 2QWNA 5CYMA 5KQ8A 5C10A 1GLCG 4FJ5A 4FZXC 4CJ4A 1YF5L 2QWLA 3SQ1A 2F8SA 3D2FB 3NE6A 3V6DA 5LL6Z 3NGZA 4JRQA 3DMJA 2F4VK 3O4QA 3JXUA 3VENA 2HMPA 4A61A 4DQSA 4CJ3A 1X3MA 2W6LA 3HP9A 5D3GA 3IUCA 1VAZA 1RT2A 2D0CA 4LFBK 1EWQA 4N76A 3K2PA 1HLUA 1VQ4N 4CZMA 2KW4A 4CBUA 2IDOA 3VEVA 5CZ1A 3DXKA 3V1RA 5AQQA 3DLLL 5LMUK 2OPQA 1NGBA 2A42A 1WSIA 3HBTA 3CM5A 4OKEA 1IG9A 4BR9A 2BTFA 2RN2A 3A8YA 4DQPA 1GOAA 3SI6A 5JVGL 2HBJA 1YVNA 4FM2A 4IFYA 4O55A 1HKGA 2Q3SA 4FW1A 4DF8A 2Q0RA 3ZT0A 4CF0A 4CFCA 4J8FA 4I9LA 4LH4A 2DFHA 2PBDA 3DLRA 1NK6A 3RVCA 4FK0A 3I0RA 2O8EB 3E1YA 4EAHD 3SBGA 4Z94A 1N33K 4NXMK 3ZSWA 1ASWA 2QW9A 1NKEA 2X6NA 3SJJA 3HVTA 3P31A 1GLJO 4FJIA 3SUQA 1TK0A 1RTDA 1Q18A 2Q97A 3F9KA 2FBYA 1O13A 5JS2A 4CK2A 3EO3A 1G15A 3SCXA 4BY9C 4DR1K 5BPLA 3EY1A 4J2BA 2BUPA 5EOYA 3RRGA 5GAHP 4FOIA 1GLDG 3M5RA 1IKXA 4LH5A 1ZBSA 4CJTA 3PIPL 4M3ZA 3LDSA 3QEVA 2YJFA 1IBLK 1C0FA 4DSKA 4BACA 3ATVA 3I33A 2KZZA 2G8KA 4Q5VA 5I42A 3CF5L 1I3AA 2HBKA 3JYTA 3OY9A 2P9KB 1VSMA 3ALYA 4KFBA 5JS1A 3P1GA 5AFUA 3KD1E 4B1UB 3QETA 3O3FA 3DOKA 3G71N 4J2AA 2NRZA 4O4GA 1RDAA 4DF4A 1IBKK 2KLAA 5BREA 3WNEA 1VQNN 3GG4A 2O8DB 1RGIA 4FJ8A 4TSXA 1RDDA 3EN9A 3V9XA 1WOQA 2D5RA 2A5XA 1LAVA 4YOUA 4DR7K 1K6YA 3OYEA 2NRXA 3P4IA 5M1OA 1CZAN 5JICA 4BR0A 5CE3A 1MU2A 3RWUA 1QZ6A 3K5NA 1ESVA 4M42A 3OYCA 3O4NA 4A62A 4KH6A 1SZ2A 4YOWA 4E7HA 3TTFA 1YITN 1XC9A 1JJ2M 3LP2A 3ULEB 4DWIA 3ID8A 4WQ4A 3O6WA 1NK0A 5BPNA 3VGLA 4DKWA 1S1XA 1S9GA 1NGEA 3AAQA 1HRHA 1SL2A 4OLAA 4MO4A 3NFAA 4G1QA 3SUNA 3AVBA 5F0XA 3TABA 3N4PA 3ZSXA 4JKGB 4FM0A 4CGFA 3WNHA 1VQ8N 2WBNA 3OS1A 1KFDA 3MCAB 1GLAG 4EP5A 3DRRA 3CFOA 5AQFA 4CD1A 4KV8A 3PUFA 4IG3A 4W5OA 3CJBA 4OX9K 4CEDA 4FJLA 3A5LC 3MX2A 3MN5A 3KK3A 1IV0A 1K8KA 1EX4A 3OJSA 4CJPA 4JI6K 4MDBA 4NLCA 4A59A 3DXMA 4AHCA 4N56A 4B9UA 3WNFA 3J7ZO 3ZYYX 4LD0A 5AQLA 3QFPA 4Y0WA 4IOAL 3A5NC 3WT0A 3AARA 3I8BA 4JKDA 3AVGA 3S9HA 1JCGA 4H0VB 4L8RB 2VGNA 1LCUA 5LJVA 4CZEA 1TV6A 1NOZA 4PA1A 3THVA 1YJ9N 4CCHA 1WSGA 5AQHA 4KH5A 4M7YA 5AQRA 1FKOA 4ISEA 1WSJA 3AAPA 4Z4CA 5M1FA 1VSDA 1SUQA 3BZKA 1ASVA 1X9MA 1QQCA 1OH5A 4MO5A 5IWAK 1K9MO 1L5UA 2YHWA 4M63C 3CCVN 2Y1IA 3VF4A 3PSIA 5AQZA 3OYJA 1KXPA 3O5BA 4NCAA 1RBVA 1NMDA 3ZX3A 3OW2M 4PKIA 1VQ5N 1L3VA 3WXLA 1DT9A 4FLXA 5AQIA 4KPYA 3WUHA 3RTVA 2ETJA 5AQYA 1MWMA 3QEXA 1YJWN 4KHYA 3HT3A 3DAWA 1NK9A 3C95A 4CJVA 4V19S 4ISFA 3EZ5A 3THYA 1NG9A 3L6QA 2DFFA 2DPNA 5MLCQ 2FBTA 4BRGA 4BWMA 3A5MC 3VQEA 2P9IB 3NH2A 4H0PA 3N4QA 3V81A 3OYDA 3MEEA 4CW7B 3QINA 5AFUH 2V51B 4FJJA 4CZLA 3LZJA 4O5BA 3ZETB 3U8XA 1Q9YA 2WFBA 3OYLA 2D0AA 3FE1A 2YCHA 1ZYQA 4K42A 1NGJA 1S9EA 3W3DA 2UU9K 1E4GT 1QSSA 1GLBG 1VSJA 2YHXA 4DV6K 1P8ZA 1S1UA 3QEIA 2FF3B 3FR0A 2ZE2A 1ITGA 4E7KA 3GDQA 4E89A 4RW6A 4RW7A 4JK9A 5KPTA 4XH5A 2HHUA 4AHUA 4B9MA 1JLEA 2P9SA 1NWKA 1RTIA 4BE2A 1UA1A 1JXEA 3H08A 3SQ0A 3G0ZA 1TL1A 3SAFA 4KHSA 4FJMA 3O1BA 1J6ZA 4AHSA 4OPAA 2O8FA 2P9NB 3TTCA 4E7IA 4EIAA 4OLBA 4OKKA 3J7AP 3F2KA 3G4SN 5C24A 3ZSQA 3VPZA 1N36K 3UE5A 4CVNE 1IJJA 1QQMA 3VQ9A 4CECA 5HRSA 2YV0X 1JKHA 1NGAA 5AJ3K 4KHWA 3QDKA 5EY4A 3GL1A 3VQDA 3HM9A 3FFIA 2I7PA 3TPQA 1HKBA 3K57A 1F21A 4FVUA 5AZIB 2XY6A 1L3TA 4FWQA 2QWQA 3HVRA 3U6FA 3SLCA 3MEGA 3AO2A 1C0MA 1QS4A 2JWLA 1FKPA 3HM8A 2KZMA 4CGGA 2UXDK 1SL1A 4F4KA 2E2NA 3HYFA 1J5EK 2O8CA 4FVMA 1TKTA 3WEEB 2YNIA 3IS9A 3VA0A 3QESA 5FROA 4ZHRA 5AR0A 3E01A 4H8KA 3TR8A 4LF5K 3PY8A 1HNXK 2QKKA 1KVBA 4CHPA 3L2VA 3NF6A 5SZTA 4M3RA 3CXCM 1T6CA 3O8MA 3K0SA 1D8YA 1HYVA 1I94K 2G8WA 5BPMA 2GUIA 4YFUA 4DFJA 3C6UA 1DEJA 2ZD1A 4IJNA 4YOYA 1BGXT 4DV1K 3LAMA 4YOTA 3SUOA 4FLZA 1VQKN 5HRNA 4KRFA 2QWOA 3ENOA 1JL1A 2HNZA 1KQSM 4O0JA 3OJUA 5GADP 2GWKA 1C0GA 3SYZA 3R3LA 4GNIA 3C6AA 1JLFA 2IS3A 2OPRA 3KLGA 4IO9L 2KFZA 2YKMA 3AA4A 1I39A 4KAZA 1NM1A 5IT9O 1KAZA 3CCSN 2RPIA 4CD3A 3UKRB 4CF1A 1QZ5A 2ASMA 3HPGA 4N47A 1NBWA 5CR4A 1NJXA 4GV3A 4CJQA 1VHXA 1XHZA 1EETA 3VQAA 4ELTA 3MX5A 3OTOK 4DR5K 3UKUA 5FLXO 3DI6A 5HP1A 5C42A 3DYAA 3NBPA 1RT1A 2XY5A 1FW6A 5AQUA 4HWIA 2UUAK 1HYSA 4ISGA 4HCCA 1NLVA 2QWRA 1XC3A 3HL8A 3C6TA 3OVNA 4NCGA 2OANA 2HVIA 2VYPA 2HHVA 3QO9A 4B3SK 4DS5A 3EZWA 4AHRA 3AV9A 4HTUA 1R59O 4B9LA 3NAEA 4DLGA 1XUPO 2EHGA 1Y97A 4YDUC 3TTDA 1KFSA 4Z4IA 4QAGA 3V9SA 4BRAA 3KLIA 3NVMA 1JCEA 5JLHA 3RRHA 1QVGM 3NF7A 2IC3A 4W5TA 4IDKA 1V4TA 1NJZA 3T7ZA 5AQWA 3VQ8A 2RF2A 1S72N 1CXQA 1YAGA 4JD2A 3CQXA 4C8NA 2HMIA 3SUPA 1B92A 2ZJPL 1LWCA 3DXKB 1L3SA 3E66A 2UUCK 2GBZA 4QOZB 2G8FA 1NGDA 1V4SA 3ISNC 5AQSA 3QMLA 3L2WA 3O9QA 2HHWA 2QWMA 3KKRA 4OKJA 5BRDA 2FBVA 1KCFA 4G9ZA 4WFNL 1T44A 5BRHA 4MQ3A 1KVCA 3OYHA 4DTSA 1ZBFA 1B9DA 1SL0A 3AGKA 4H0YB 3SPYA 1RBUA 1XMOK 3IDHA 3O9RA 4C1NK 1O1WA 3CCEN 3NHGA 1S1VA 4DTMA 4CGIA 3CCQN 1NKBA 4FWOA 3VERA 1TGOA 3AVLA 3H3NO 3V1OA 4FL9A 4ICLA 5HRPA 1M1KO 3HP6A 1ZBUA 2P9UA 3S3OA 3AO3A 3PO5A 3FLCO 1YT3A 4EP4A 1XHXA 3MK6A 2NRTA 1NGHA 1TKXA 3TAMA 4E1NA 5CHIA 1JLQA 5GAGP 4F3TA 4CESA 4IOXA 4DFKA 1EWRA 3K59A 4JKAA 4DV7K 5BN9A 4RTFD 3O80A 3I8DA 5C2DA 2P9LA 3FGUA 1YTAA 4E1MA 4JNEA 3SJHA 3ZEUA 1VQ9N 4DCHA 2G8IA 4CJLA 1MA9B 1QTMA 1SKRA 3VEYA 3L2QA 4Z4GA 4AILC 3PV8A 2VWKA 1BISA 2E1ZA 4JEPA 5DMRA 3E9OA 1Q81O 3IRXA 4PWDA 2HW3A 1QHAA 1WAJA 1DTTA 2IVPA 2HF3A 4BRHA 4RCHA 3LZIA 3CQ8A 4ILJA 4ELUA 2HVHA 3KWGA 3CFRA 4CEFA 4LSLA 1U47A 3G6EN 4B08A 3J80O 1SS6A 3DJCA 4DUZK 2NZTA 4J2DA 2X6SA 1TK5A 5C12A 3HOSA 1C1AA 4JKHA 4DU1A 3HZ6A 3J81O 1BCOA 2NUBA 3GOIA 3MN6A 2R7YA 4CZIA 3FZKA 3ZSZA 4CEAA 3DLBA 2E2QA 4KB1A 4CIGA 4OJRA 5BN8A 2IVOA 3VGKA 4DU4A 1RFQA 4O8UA 1YIJN 3U4LA 1VSIA 3B6OA 1Q9XA 1KTQA 2ZM6K 3GBTA 3S3MA 3L3VA 1RT6A 2ZQBA 3AVHA 1U48A 3V1QA 2ZJRL 4CEBA 2OZMA 4ILGB 2XY8A 5C2FA 4CJWA 1ZBHA 5M1QA 3D0PA 4B9VA 1ATSA 4RW8A 2FXUA 1LW2A 4FCYA 1IO2A 4A57A 4AF1A 4B1XB 4B8CA 4XEIA 1KLNA 5E41A 3EKSA 5EX5A 4IBNA 2NRHA 3L2RA 3OYMA 5FPMA 2P5OA 5DK5A 2O8EA 2Z1JA 1SKSA 4E1JA 4B9NA 5T7BA 1K8KB 4H4OA 4CF8A 2WONA 1HNZK 3DXMB 3LALA 3OYIA 1VSEA 4NXNK 4CGJA 2GELA 1TAUA 1QVFM 5KGXA 1RDUA 4LC9B 2Q0UA 4DQ8A 2WUSA 4JKFA 2F9WA 4DV2K 2RE2A 4DTRA 2HNDA 3BGRA 4CE9A 4EZ9A 3OA9A 2UUBK 3VOVA 2F7TA 3HRGA 4B1YB 3C7NB 4GKJK 3A0IX 3L0QA 3ZLJA 4DQRA 3J7YP 3CMEN 2O8BB 4LSNA 1MDUB 4PKGA 4C8KA 4FW2A 4BWJA 1IG8A 3JAMO 4DTNA 1SKWA 4KI4A 2YJEA 1Q8IA 2E2PA 1QQOA 3CQYA 4DFPA 3D45A 4K8ZA 4E0DA 3L4IA 4DS4A 2H3GX 3NF9A 3F73A 4KHNA 1REVA 3R8EA 3M8PA 4JKBA 4BGAA 1X9WA 4R5PA 1QSLA 1D9FA 1RTJA 4C8OA 1NMNA 1JXBA 4NYNA 5F1XA 1RBSA 3FZFA 1A5WA 4B3TK 3U9ZA 4A2AA 2D0OA 3LWLA 4FYDA 4DSIA 3A5OC 4Z4EA 3EL2A 4BRNA 2AJQA 4JAXA 3SAHA 2GTDA 3LPTA 5EVZA 3C65A 2Z1IA 4IKFA 4BRQA 4CZJA 2P1JA 1UOCA 3TI0A 4DR6K 3ID6A 4C23A 4IJAA 4F2RA 4JI4K 5FDLA 4GVMA 4FPAA 4BE1A 2QKBA 2QA4N 2O8DA 3O9SA 1RDWX 4KTWA 3AVJA 3IFRA 3AVFA 3VGMA 3QBXA 2ASPA 3SBTA 5ADXH 2Q2RA 3NF8A 1TUYA 3VF2A 3CJAA 2QEXN 4MLEA 3U9DA 2Q36A 4DSEA 3I0SA 4BRFA 1VQLN 4WE1A 2P51A 4CJUA 3TWHA 2PZSA 2G8UA 2ZJQL 2P9PB 3ULEA 2ASOA 4FSVA 5KRSA 4YDUA 4DV5K 2Y1JA 1Z6RA 3NCIA 1GLEG 1NJIO 3ZCMA 1TYQA 3OYAA 3RSEB 4B9QA 4ELVA 1NJWA 1HJRA 1WNSA 2A6AA 4O8KA 3KVGA 1T05A 3TSQA 1MWKA 1E4FT 3TAPA 3WQUA 1JCFA 1HKCA 4KH4A 3AVMA 4JKGA 1M90O 3LANA 4ZTJA 1J9AA 2P9SB 3ULDA 4CEQA 3R6MA 4BDYA 4DR3K 1EO1A 1BIUA 3KK7A 4YNQA 4KI6A 3CCLN 5FPNA 3T1YK 2HHXA 1KD1O 4RG8A 3SQ4A 4IFVA 1YXQA 2E6MA 3VQ7A 3PO4A 3IG1A 1R0AA 3THXB 1N8RO 4C8MA 2W6KA 4IEEA 3PSFA 3L4QA 1BA1A 1BCMA 3AO5A 4JI1K 3SV3A 2YI1A 3AA2A 3DRSA 3P5JA 4AM6A 3W0LA 3AVKA 3R9PA 1NGFA 5E26A 2G8HA 4E7JA 3BF3A 2EX3A 1ATNA 3V4IA 5GIOA 4JHDA 4DB3A 3EKUA 3KWIA 4RW4A 3SV4A 3LWMA 1N5YA 2HF4A 5AQTA 1Q82O 2V7YA 4CBWA 1L3UA 4B1VA 1TL3A 3M8SA 4CI6A 3O4WA 2A1SA 3K9JA 1GLFO 4HVJA 2UXBK 2NLXA 4BRMA 3RR7A 3CC4N 1J53A 4H5TA 4PKHA 3CCMN 4DMNA 1U2VB 3QIOA 4YOVA 4Z4FA 2IVNA 2RKIA 1U49A 1XQSC 5LJWA 4IDHA 4CERA 1DGKN 2CH6A 1D4XA 4JLHA 4F8RA 2NRVA 3LM2A 3D2EB 3B8AX 5AQVA 1C1CA 3WNGA 1U04A 4F2SA 3H1VX 4H03B 4OGEA 2RHKA 4Y1CA 4CJ7A 1X1PA 2P9IA 1WBBA 4KBOA 4IWVA 4W5QA 1X9SA 4BRKA 3QICA 3H45C 3WXKA 3TAGA 4B9TA 3THWB 4PQUA 3MXIA 3OYKA 1B9FA 1BU6O 3OBYA 2HNYA 4KTZA 1Z05A 1TVRA 3CD6N 2YNGA 3OYBA 1WSFA 1S3XA 3K9KA 2EWSA 4HUEA 5GINA 2VG5A 5FPEA 1W0HA 1FXXA 4BVPA 4CZHA 3O9UA 3TAEA 4OGCA 4IG0A 2NRRA 3MN7A 2ITGA 1HMVA 3QFUA 1C1BA 1U4BA 3TANA 2E88A 1HQEA 5JVHL 4WYBA 1DKGD 4KB0A 2HHHK 1KAXA 5GIPA 2F96A 2P9NA 4M45A 1BL3A 3ZSOA 4CJFA 4FWLA 4JKCA 3ZSRA 3KD5E 4NB4A 1WAFA 2OYQA 4KO0A 5HOOA 2VWJA 4FZZA 1Z26A 1IKVA 3NMUA 4YY3K 4JS5A 2HHSA 4A5AA 2VQFK 3ENHA 3HI0A 3S3NA 3ITHA 1Z25A 1KAYA 1OKJA 2KQ2A 1VQPN 5AZJA 3VQ5A 2XRIA 1NKCA 2PYLA 1QQNA 3TAQA 5AZIA 1WBDA 2WOMA 1BO5O 5EU7A 3VN5A 5FPDA 5AQJA 3BY5A
chains in the Genus database with same CATH topology
3RMDA 3TAMA 4E1NA 4FJ7A 1JLQA 3LAKA 1WN7A 4F3TA 4XIUA 1S1XA 4O44A 2X74A 4CESA 1S9GA 3K5LA 3K59A 4DFKA 1UWBA 1HRHA 1SL2A 4OLAA 4CHOA 3NFAA 4G1QA 3I8DA 3SUNA 4C8LA 3ZT1A 3RR8A 5J2MA 2DFEA 1EXQA 3AVBA 3VQQA 1YTAA 4E1MA 3AVAA 3TABA 3DLHA 1HYZA 3ZSXA 3CFPA 1C0TA 4FM0A 2G8IA 4CJLA 2A1RA 4CGFA 3V9UA 3WNHA 3O3HA 4CJ5A 4DU3A 3U3YA 1NK5A 1SKRA 3OS1A 3M8RA 2G8VA 4I2QA 1KFDA 2QXFA 4RW9A 4FJGA 3L2QA 4FK4A 4AILC 4Z4GA 4CJKA 4BDZA 3PV8A 3PX0A 4EP5A 3DRRA 4NCBA 2VWKA 1BHLA 3T1AA 2VG7A 3CFOA 3VQ6A 2QK9A 4PY5A 3PX6A 1VSKA 1BISA 3PUFA 4KV8A 1S6PA 4IG3A 5DMRA 4M3WA 4FJHA 4W5OA 5CY4A 4PWDA 3IRXA 3MXMA 2HW3A 1LV5A 1DTTA 1WAJA 4CEDA 3LZIA 3CQ8A 4ELUA 3KK3A 4FJLA 4DTXA 1EX4A 2DY4A 3OJSA 2GV9A 4CJPA 1JLAA 2HVHA 4GMJB 3KLEA 3CFRA 4CEFA 4LSLA 1U47A 4AHCA 5KI6A 4B08A 4N56A 4B9UA 3WNFA 4M3XA 4J2DA 2X6SA 1TK5A 4LD0A 2PYJA 5J1EA 4W5RA 1KLMA 3P83D 1C1AA 5K14A 4DU1A 1HPZA 3LP1A 1VK0A 1BCOA 1EP4A 1CZBA 2NUBA 4EZ6A 2R7YA 4FJNA 1BI4A 4DTUA 4E19A 3HO1A 4M41A 2IOCA 3ZSZA 3AVGA 4CEAA 3S9HA 2BANA 2D0BA 4CEZA 4CHYA 1QSYA 4L8RB 3DLBA 4B3OA 4HHTA 4KB1A 4CIGA 1A5VA 1LWFA 4OJRA 5KTQA 1YTUA 2B6AA 4UQGA 2PY5A 3MEDA 3SNNA 1TV6A 4DU4A 1BQNA 1N6QA 1NOZA 4PA1A 3AO4A 3HXMA 3THVA 4CCHA 1VSIA 4MFBA 1RBRA 1WSGA 3B6OA 3QNNA 2KFNA 1Q9XA 5FRNA 1UAXA 1KTQA 2BE2A 1FKOA 4KHUA 4CFDA 1WSJA 4DLEA 2YNFA 4Z4CA 3S3MA 3L3VA 1KSPA 1RT6A 1SUQA 1VSDA 2ZQBA 3AVCA 1XWLA 3QERA 1ASVA 1X9MA 1QQCA 3SZ2A 3AVHA 1U48A 3V1QA 1L5UA 4B9SA 4CEBA 1LAWA 4I2PA 3RMCA 2OZMA 1GOCA 4Z4HA 4FJKA 2Y1IA 2XY8A 1IH7A 4CJWA 1ZBHA 1QTMA 2YKNA 3OYJA 3AVIA 4DQIA 5CZ2A 1QHTA 4NCAA 3QEWA 1RBVA 4BDPA 4KREA 4B9VA 1S1WA 3D0PA 4Z0UA 4CK1A 4RW8A 4KKOA 1L3VA 4CGDA 4FLXA 1KVAA 4KPYA 1LW2A 4FCYA 1BIZA 1TKZA 2ETJA 1IO2A 3RTVA 4AH9A 3QEXA 4B8CA 3DOLA 3OS2A 4FLTA 1KLNA 5E41A 4KHYA 4IBNA 1RILA 3HT3A 2P5GA 1NK9A 4K8XA 3C95A 4CJVA 3OYMA 3OYGA 3L2RA 2P5OA 3KK2A 3EZ5A 5DK5A 2DFFA 3DM2A 2Z1JA 1SKSA 4B9NA 3A2FA 5T7BA 1NK4A 3BDPA 4H4OA 4CF8A 4QCLA 4GW6A 2XY7A 4DTJA 3MXJA 2WONA 3KLFA 3LALA 3OYIA 1VSEA 1CZ9A 1S5JA 2FBTA 1IKWA 3AO1A 3LP3A 4BWMA 3VQEA 1DTQA 4CGJA 1TAUA 4Q0BA 3NH2A 5KGXA 1RBTA 4FLVA 3V81A 2OPSA 3OYDA 3MEEA 3QINA 3CYMA 2E4LA 1JL2A 4JS4A 1TKDA 4DTRA 2HNDA 3BGRA 4CE9A 3VA3A 4EZ9A 1BI4B 4DSJA 4FJJA 3MECA 4DQQA 3MAQA 4O5BA 3LZJA 3SQ2A 1Q9YA 4CEOA 3OYLA 1BQMA 2D0AA 1J54A 4DQRA 1ZYQA 4LSNA 4C8KA 1VRUA 4FW2A 4BWJA 4DG1A 4DTNA 1S9EA 1SKWA 4KI4A 1CLQA 1GOBA 1Q8IA 1QSSA 1U45A 1VSJA 3PX4A 3QLHA 1S1UA 3QEIA 2O4IA 2OZSA 4NYFA 4DFPA 3D45A 5HROA 4E0DA 4K8ZA 2ZE2A 2B5JA 3SPZA 2KTQA 1ITGA 4E7KA 3UIQA 4E89A 4DS4A 3NF9A 1RDBA 4RW6A 3F73A 4KHNA 1REVA 3HSTB 4DFMA 2FC0A 4RW7A 1S6QA 3ZSVA 5HBMA 4CIFA 4CF9A 3M8PA 4DSFA 2HHUA 1X9WA 4R5PA 4AHUA 1QSLA 1RCHA 1RTJA 3NH1A 4CHZA 2VG6A 3CM6A 1D9FA 4C8OA 4FJ9A 4B9MA 1JLEA 1RTIA 4BE2A 1JXBA 2JLEA 4NYNA 1UA1A 1TK8A 3NGYA 1RBSA 1W9HA 1NJYA 4M3TA 1A5WA 1JXEA 3H08A 3SQ0A 4E3SA 3LWLA 2Z1GA 4FYDA 3G0ZA 3T19A 4DSIA 1TL1A 4Z4EA 4KHSA 4FJMA 2AJQA 3LPTA 4AHSA 2Z1HA 4ID5A 4FLYA 3IAYA 3AA3A 3QNOA 2Z1IA 1SV5A 4IKFA 4DTPA 1KRPA 2O4GA 2P1JA 1UOCA 3TI0A 1NK7A 4E7IA 2HHTA 4OLBA 3OS0A 4OKKA 1LW0A 4F2RA 5C24A 5FDLA 3ZSQA 2E6LA 4HUGA 5SWMA 1CXUA 4GVMA 4W5NA 1HNIA 4HUFA 4BE1A 4OPKA 4E7LA 2QKBA 4CFAA 4CHQA 4KTWA 2OA8A 3AVJA 3L3UA 3VQ9A 4CECA 4N5SA 5HRSA 2YV0X 3AVFA 1JKHA 1TAQA 2FBXA 4KHWA 1WSEA 3NF8A 4CK3A 3VQDA 3NGIA 1S1TA 1C0UA 3HM9A 4M3YA 4Y1DA 4DTOA 4DSEA 3FFIA 3I0SA 2W42A 3K57A 2BGGA 1F21A 4FM1A 2YHBA 4WE1A 2P51A 4CJUA 3TWHA 2XY6A 1L3TA 2PZSA 3DRPA 2G8UA 1JLCA 1JLBA 3HVRA 3HJFA 3U6FA 5KRSA 3MEGA 3AO2A 1C0MA 1QS4A 3RMAA 1FKPA 2Y1JA 3NCIA 3LP0A 4CGGA 1WSHA 5J2PA 2KZMA 3ZCMA 1SL1A 2B4JA 3OYAA 2BDPA 4F4KA 4ELVA 3HYFA 3KK1A 1NJWA 4I9QA 4FVMA 1HJRA 1TKTA 1WNSA 2YNIA 3LPUA 1RT4A 3B6PA 3DLEA 3IS9A 3OYNA 3VA0A 2IGIA 3QESA 1T05A 1QE1A 3ZT3A 3TAPA 5C25A 2HHQA 2JGUA 5FROA 4ZHRA 3AVMA 3E01A 4H8KA 3TR8A 3AVNA 3LANA 4ZTJA 1J5OA 1J9AA 4CHNA 1NOYA 3ULDA 3PY8A 4KHQA 4OVLA 4PUOA 5KGWA 3K5OA 4CEQA 4CJRA 4BDYA 2QKKA 3L8BA 3DLKA 5FRMA 3HPHA 1KVBA 4FXDA 2X78A 1BIUA 4CHPA 4N41A 4YNQA 4KI6A 1JLGA 4CJEA 2HHXA 3L2VA 2DTUA 1VSLA 3NF6A 4RG8A 4FLWA 3SQ4A 4IFVA 1T7PA 2E6MA 3VQ7A 5SZTA 3PO4A 1RT7A 4M3RA 4FLUA 3NDKA 2OPPA 3IG1A 3KJVA 4F3OA 5CYMA 4CFBA 1R0AA 4FJ5A 1D8YA 1HYVA 3TARA 4FZXC 4C8MA 2HB5A 5I3UA 4CJ4A 3SQ1A 2F8SA 2G8WA 4B8AB 4ZTFA 1VSHA 2GUIA 1BCMA 3AO5A 4YFUA 1NK8A 3CG7A 4AHVA 3SV3A 3T3FA 3AA2A 4DFJA 3C6UA 3NE6A 3NGZA 3DRSA 5J2QA 4JRQA 3DMJA 3P5JA 3O4QA 2ZD1A 1BGXT 3LAMA 3SUOA 1RNHA 4FLZA 4DQSA 3AVKA 4CJ3A 3HP9A 5HRNA 2I5JA 3K5MA 2G8HA 5D3GA 4E7JA 4KRFA 1JL1A 2HNZA 2EX3A 4O0JA 1DLOA 1RT2A 3V4IA 2XO7A 3OJUA 2D0CA 1HQUA 2LSNA 3HK2A 5KRTA 4N76A 3SYZA 3K2PA 1VRTA 2KW4A 2IDOA 1JLFA 5CZ1A 3V1RA 2IS3A 2ATQA 2OPRA 3KLGA 2OPQA 2KFZA 1YVUA 2YKMA 3AA4A 1I39A 4RW4A 3SV4A 4KAZA 1RT3A 4CF2A 3LWMA 1N5YA 4FJXA 1WSIA 4CJSA 2RPIA 3RMBA 1UA0A 1L3UA 3CM5A 3KKSA 4OKEA 4CF1A 1WLJA 1IG9A 1TL3A 3HPGA 2RN2A 4N47A 4DQPA 1GOAA 3M8SA 3SI6A 1NJXA 4CJQA 4LY7A 3VQPA 2A1SA 4FM2A 4IFYA 1EETA 4O55A 1D5AA 3VQAA 4HVJA 1XHZA 4ELTA 4J2EA 3K58A 1A5XA 2Q3SA 3RR7A 1RDCA 4FW1A 1EKEA 1J53A 4DF8A 3TAFA 5HLFA 4FZYA 3ZT0A 3DI6A 4CF0A 5HP1A 5C42A 4CFCA 3DYAA 3NBPA 1RT1A 4DMNA 4I9LA 4LH4A 2XY5A 5HRRA 3QIOA 2DFHA 4Z4FA 2RKIA 1U49A 1HYSA 3DLRA 4CIEA 3ZT2A 1NK6A 4FK0A 4HCCA 3I0RA 3HL8A 3C6TA 3OVNA 4NCGA 2HVIA 2HHVA 3QO9A 4CERA 4JLHA 4F8RA 4DS5A 5J2NA 4DSLA 3VQ4A 3AV9A 4AHRA 4HTUA 3ZSWA 4B9LA 3NAEA 4DLGA 1ASWA 2EHGA 1C1CA 1ZBIA 2YHAA 1NKEA 2X6NA 3WNGA 3SJJA 1Y97A 3HVTA 4CGHA 4M3UA 1U04A 4F2SA 3QIPA 4OGEA 1KFSA 3G10A 4FJIA 4Z4IA 4QAGA 4Y1CA 3SUQA 4H4MA 4HCBA 1T8EA 1X1PA 1TK0A 5CYQA 3V9SA 1RTDA 4OPJA 3KLIA 4W5QA 2F8TA 3F9KA 2FBYA 1X9SA 5JS2A 4CK2A 3RRHA 3KIOA 3NF7A 3JSMA 3V9WA 3TAGA 2IC3A 4W5TA 4B9TA 1G15A 4IDKA 3SCXA 4PQUA 1NJZA 3MXIA 3OYKA 1D9DA 3EY1A 4J2BA 3RRGA 4AHTA 1B9FA 3VQ8A 2RF2A 1CXQA 2HNYA 4KTZA 4C8NA 2HMIA 3SUPA 1TVRA 1IKXA 1B92A 2YNGA 1LWCA 4LH5A 4CJTA 3ZSYA 3OYBA 4M3ZA 3LDSA 3QEVA 1WSFA 1XI1A 1L3SA 1IKYA 4HUEA 3EYZA 4DSKA 2GBZA 2VG5A 4BACA 3KTQA 4QOZB 2G8FA 2KZZA 2G8KA 4Q5VA 1W0HA 1FXXA 3ISNC 3HPOA 3QEPA 3TAEA 3V9ZA 5I42A 3L2WA 1I3AA 4BE0A 3JYTA 2HHWA 3KKRA 4OKJA 3C94A 4OGCA 4IG0A 3OY9A 2FBVA 1KCFA 2YNHA 1VSMA 3ALYA 2ITGA 4KFBA 5JS1A 1HMVA 1C1BA 1U4BA 3P1GA 3TANA 1HQEA 4MQ3A 1KVCA 3OYHA 4DTSA 1ZBFA 1B9DA 1RTHA 3QETA 1SL0A 1VSFA 3KD1E 4KB0A 3O3FA 3DOKA 4J2AA 2F96A 4O4GA 1RDAA 3U3GA 4ID1A 4M45A 3SPYA 1BL3A 3VQBA 4DF4A 1LWEA 1RBUA 3ZSOA 4CJFA 3KLHA 3WNEA 1O1WA 3ZSRA 3KD5E 1WAFA 3NHGA 2OYQA 4KO0A 1S1VA 3AA5X 1C6VA 4TSXA 3DLGA 1RDDA 4CGIA 2VWJA 4DTMA 3V9XA 1NKBA 1TGOA 4FZZA 1Z26A 3AVLA 2D5RA 3ASMA 2XHBA 1LAVA 1IKVA 3V1OA 1FK9A 3L2UA 4JS5A 1T03A 1K6YA 4I7FA 4ICLA 3OYEA 3VQCA 5HRPA 2HHSA 3HP6A 3O3GA 1ZBUA 4JRPA 1ZBLA 3S3OA 4O0IA 3S3NA 1MU2A 3ITHA 3AO3A 3K5NA 1Z25A 3RWUA 3PO5A 3ZT4A 1RT5A 3NH0A 3OYCA 4M42A 1HNVA 1YT3A 2KQ2A 3O4NA 4E7HA 1XC9A 3VQ5A 4KTQA 2XRIA 1NKCA 3LP2A 1XHXA 4EP4A 2PYLA 1ASUA 3M8QA 4CEEA 3OYFA 3TAQA 4FK2A 4DWIA 2WOMA 5EU7A 3VN5A 1TKXA 4FJ8A 2IAJA 1NK0A 3V6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMD A;  3TAM A;  4E1N A;  4FJ7 A;  1JLQ A;  3LAK A;  1WN7 A;  4F3T A;  4XIU A;  1S1X A;  4O44 A;  2X74 A;  4CES A;  1S9G A;  3K5L A;  3K59 A;  4DFK A;  1UWB A;  1HRH A;  1SL2 A;  4OLA A;  4CHO A;  3NFA A;  4G1Q A;  3I8D A;  3SUN A;  4C8L A;  3ZT1 A;  3RR8 A;  5J2M A;  2DFE A;  1EXQ A;  3AVB A;  3VQQ A;  1YTA A;  4E1M A;  3AVA A;  3TAB A;  3DLH A;  1HYZ A;  3ZSX A;  3CFP A;  1C0T A;  4FM0 A;  2G8I A;  4CJL A;  2A1R A;  4CGF A;  3V9U A;  3WNH A;  3O3H A;  4CJ5 A;  4DU3 A;  3U3Y A;  1NK5 A;  1SKR A;  3OS1 A;  3M8R A;  2G8V A;  4I2Q A;  1KFD A;  2QXF A;  4RW9 A;  4FJG A;  3L2Q A;  4FK4 A;  4AIL C;  4Z4G A;  4CJK A;  4BDZ A;  3PV8 A;  3PX0 A;  4EP5 A;  3DRR A;  4NCB A;  2VWK A;  1BHL A;  3T1A A;  2VG7 A;  3CFO A;  3VQ6 A;  2QK9 A;  4PY5 A;  3PX6 A;  1VSK A;  1BIS A;  3PUF A;  4KV8 A;  1S6P A;  4IG3 A;  5DMR A;  4M3W A;  4FJH A;  4W5O A;  5CY4 A;  4PWD A;  3IRX A;  3MXM A;  2HW3 A;  1LV5 A;  1DTT A;  1WAJ A;  4CED A;  3LZI A;  3CQ8 A;  4ELU A;  3KK3 A;  4FJL A;  4DTX A;  1EX4 A;  2DY4 A;  3OJS A;  2GV9 A;  4CJP A;  1JLA A;  2HVH A;  4GMJ B;  3KLE A;  3CFR A;  4CEF A;  4LSL A;  1U47 A;  4AHC A;  5KI6 A;  4B08 A;  4N56 A;  4B9U A;  3WNF A;  4M3X A;  4J2D A;  2X6S A;  1TK5 A;  4LD0 A;  2PYJ A;  5J1E A;  4W5R A;  1KLM A;  3P83 D;  1C1A A;  5K14 A;  4DU1 A;  1HPZ A;  3LP1 A;  1VK0 A;  1BCO A;  1EP4 A;  1CZB A;  2NUB A;  4EZ6 A;  2R7Y A;  4FJN A;  1BI4 A;  4DTU A;  4E19 A;  3HO1 A;  4M41 A;  2IOC A;  3ZSZ A;  3AVG A;  4CEA A;  3S9H A;  2BAN A;  2D0B A;  4CEZ A;  4CHY A;  1QSY A;  4L8R B;  3DLB A;  4B3O A;  4HHT A;  4KB1 A;  4CIG A;  1A5V A;  1LWF A;  4OJR A;  5KTQ A;  1YTU A;  2B6A A;  4UQG A;  2PY5 A;  3MED A;  3SNN A;  1TV6 A;  4DU4 A;  1BQN A;  1N6Q A;  1NOZ A;  4PA1 A;  3AO4 A;  3HXM A;  3THV A;  4CCH A;  1VSI A;  4MFB A;  1RBR A;  1WSG A;  3B6O A;  3QNN A;  2KFN A;  1Q9X A;  5FRN A;  1UAX A;  1KTQ A;  2BE2 A;  1FKO A;  4KHU A;  4CFD A;  1WSJ A;  4DLE A;  2YNF A;  4Z4C A;  3S3M A;  3L3V A;  1KSP A;  1RT6 A;  1SUQ A;  1VSD A;  2ZQB A;  3AVC A;  1XWL A;  3QER A;  1ASV A;  1X9M A;  1QQC A;  3SZ2 A;  3AVH A;  1U48 A;  3V1Q A;  1L5U A;  4B9S A;  4CEB A;  1LAW A;  4I2P A;  3RMC A;  2OZM A;  1GOC A;  4Z4H A;  4FJK A;  2Y1I A;  2XY8 A;  1IH7 A;  4CJW A;  1ZBH A;  1QTM A;  2YKN A;  3OYJ A;  3AVI A;  4DQI A;  5CZ2 A;  1QHT A;  4NCA A;  3QEW A;  1RBV A;  4BDP A;  4KRE A;  4B9V A;  1S1W A;  3D0P A;  4Z0U A;  4CK1 A;  4RW8 A;  4KKO A;  1L3V A;  4CGD A;  4FLX A;  1KVA A;  4KPY A;  1LW2 A;  4FCY A;  1BIZ A;  1TKZ A;  2ETJ A;  1IO2 A;  3RTV A;  4AH9 A;  3QEX A;  4B8C A;  3DOL A;  3OS2 A;  4FLT A;  1KLN A;  5E41 A;  4KHY A;  4IBN A;  1RIL A;  3HT3 A;  2P5G A;  1NK9 A;  4K8X A;  3C95 A;  4CJV A;  3OYM A;  3OYG A;  3L2R A;  2P5O A;  3KK2 A;  3EZ5 A;  5DK5 A;  2DFF A;  3DM2 A;  2Z1J A;  1SKS A;  4B9N A;  3A2F A;  5T7B A;  1NK4 A;  3BDP A;  4H4O A;  4CF8 A;  4QCL A;  4GW6 A;  2XY7 A;  4DTJ A;  3MXJ A;  2WON A;  3KLF A;  3LAL A;  3OYI A;  1VSE A;  1CZ9 A;  1S5J A;  2FBT A;  1IKW A;  3AO1 A;  3LP3 A;  4BWM A;  3VQE A;  1DTQ A;  4CGJ A;  1TAU A;  4Q0B A;  3NH2 A;  5KGX A;  1RBT A;  4FLV A;  3V81 A;  2OPS A;  3OYD A;  3MEE A;  3QIN A;  3CYM A;  2E4L A;  1JL2 A;  4JS4 A;  1TKD A;  4DTR A;  2HND A;  3BGR A;  4CE9 A;  3VA3 A;  4EZ9 A;  1BI4 B;  4DSJ A;  4FJJ A;  3MEC A;  4DQQ A;  3MAQ A;  4O5B A;  3LZJ A;  3SQ2 A;  1Q9Y A;  4CEO A;  3OYL A;  1BQM A;  2D0A A;  1J54 A;  4DQR A;  1ZYQ A;  4LSN A;  4C8K A;  1VRU A;  4FW2 A;  4BWJ A;  4DG1 A;  4DTN A;  1S9E A;  1SKW A;  4KI4 A;  1CLQ A;  1GOB A;  1Q8I A;  1QSS A;  1U45 A;  1VSJ A;  3PX4 A;  3QLH A;  1S1U A;  3QEI A;  2O4I A;  2OZS A;  4NYF A;  4DFP A;  3D45 A;  5HRO A;  4E0D A;  4K8Z A;  2ZE2 A;  2B5J A;  3SPZ A;  2KTQ A;  1ITG A;  4E7K A;  3UIQ A;  4E89 A;  4DS4 A;  3NF9 A;  1RDB A;  4RW6 A;  3F73 A;  4KHN A;  1REV A;  3HST B;  4DFM A;  2FC0 A;  4RW7 A;  1S6Q A;  3ZSV A;  5HBM A;  4CIF A;  4CF9 A;  3M8P A;  4DSF A;  2HHU A;  1X9W A;  4R5P A;  4AHU A;  1QSL A;  1RCH A;  1RTJ A;  3NH1 A;  4CHZ A;  2VG6 A;  3CM6 A;  1D9F A;  4C8O A;  4FJ9 A;  4B9M A;  1JLE A;  1RTI A;  4BE2 A;  1JXB A;  2JLE A;  4NYN A;  1UA1 A;  1TK8 A;  3NGY A;  1RBS A;  1W9H A;  1NJY A;  4M3T A;  1A5W A;  1JXE A;  3H08 A;  3SQ0 A;  4E3S A;  3LWL A;  2Z1G A;  4FYD A;  3G0Z A;  3T19 A;  4DSI A;  1TL1 A;  4Z4E A;  4KHS A;  4FJM A;  2AJQ A;  3LPT A;  4AHS A;  2Z1H A;  4ID5 A;  4FLY A;  3IAY A;  3AA3 A;  3QNO A;  2Z1I A;  1SV5 A;  4IKF A;  4DTP A;  1KRP A;  2O4G A;  2P1J A;  1UOC A;  3TI0 A;  1NK7 A;  4E7I A;  2HHT A;  4OLB A;  3OS0 A;  4OKK A;  1LW0 A;  4F2R A;  5C24 A;  5FDL A;  3ZSQ A;  2E6L A;  4HUG A;  5SWM A;  1CXU A;  4GVM A;  4W5N A;  1HNI A;  4HUF A;  4BE1 A;  4OPK A;  4E7L A;  2QKB A;  4CFA A;  4CHQ A;  4KTW A;  2OA8 A;  3AVJ A;  3L3U A;  3VQ9 A;  4CEC A;  4N5S A;  5HRS A;  2YV0 X;  3AVF A;  1JKH A;  1TAQ A;  2FBX A;  4KHW A;  1WSE A;  3NF8 A;  4CK3 A;  3VQD A;  3NGI A;  1S1T A;  1C0U A;  3HM9 A;  4M3Y A;  4Y1D A;  4DTO A;  4DSE A;  3FFI A;  3I0S A;  2W42 A;  3K57 A;  2BGG A;  1F21 A;  4FM1 A;  2YHB A;  4WE1 A;  2P51 A;  4CJU A;  3TWH A;  2XY6 A;  1L3T A;  2PZS A;  3DRP A;  2G8U A;  1JLC A;  1JLB A;  3HVR A;  3HJF A;  3U6F A;  5KRS A;  3MEG A;  3AO2 A;  1C0M A;  1QS4 A;  3RMA A;  1FKP A;  2Y1J A;  3NCI A;  3LP0 A;  4CGG A;  1WSH A;  5J2P A;  2KZM A;  3ZCM A;  1SL1 A;  2B4J A;  3OYA A;  2BDP A;  4F4K A;  4ELV A;  3HYF A;  3KK1 A;  1NJW A;  4I9Q A;  4FVM A;  1HJR A;  1TKT A;  1WNS A;  2YNI A;  3LPU A;  1RT4 A;  3B6P A;  3DLE A;  3IS9 A;  3OYN A;  3VA0 A;  2IGI A;  3QES A;  1T05 A;  1QE1 A;  3ZT3 A;  3TAP A;  5C25 A;  2HHQ A;  2JGU A;  5FRO A;  4ZHR A;  3AVM A;  3E01 A;  4H8K A;  3TR8 A;  3AVN A;  3LAN A;  4ZTJ A;  1J5O A;  1J9A A;  4CHN A;  1NOY A;  3ULD A;  3PY8 A;  4KHQ A;  4OVL A;  4PUO A;  5KGW A;  3K5O A;  4CEQ A;  4CJR A;  4BDY A;  2QKK A;  3L8B A;  3DLK A;  5FRM A;  3HPH A;  1KVB A;  4FXD A;  2X78 A;  1BIU A;  4CHP A;  4N41 A;  4YNQ A;  4KI6 A;  1JLG A;  4CJE A;  2HHX A;  3L2V A;  2DTU A;  1VSL A;  3NF6 A;  4RG8 A;  4FLW A;  3SQ4 A;  4IFV A;  1T7P A;  2E6M A;  3VQ7 A;  5SZT A;  3PO4 A;  1RT7 A;  4M3R A;  4FLU A;  3NDK A;  2OPP A;  3IG1 A;  3KJV A;  4F3O A;  5CYM A;  4CFB A;  1R0A A;  4FJ5 A;  1D8Y A;  1HYV A;  3TAR A;  4FZX C;  4C8M A;  2HB5 A;  5I3U A;  4CJ4 A;  3SQ1 A;  2F8S A;  2G8W A;  4B8A B;  4ZTF A;  1VSH A;  2GUI A;  1BCM A;  3AO5 A;  4YFU A;  1NK8 A;  3CG7 A;  4AHV A;  3SV3 A;  3T3F A;  3AA2 A;  4DFJ A;  3C6U A;  3NE6 A;  3NGZ A;  3DRS A;  5J2Q A;  4JRQ A;  3DMJ A;  3P5J A;  3O4Q A;  2ZD1 A;  1BGX T;  3LAM A;  3SUO A;  1RNH A;  4FLZ A;  4DQS A;  3AVK A;  4CJ3 A;  3HP9 A;  5HRN A;  2I5J A;  3K5M A;  2G8H A;  5D3G A;  4E7J A;  4KRF A;  1JL1 A;  2HNZ A;  2EX3 A;  4O0J A;  1DLO A;  1RT2 A;  3V4I A;  2XO7 A;  3OJU A;  2D0C A;  1HQU A;  2LSN A;  3HK2 A;  5KRT A;  4N76 A;  3SYZ A;  3K2P A;  1VRT A;  2KW4 A;  2IDO A;  1JLF A;  5CZ1 A;  3V1R A;  2IS3 A;  2ATQ A;  2OPR A;  3KLG A;  2OPQ A;  2KFZ A;  1YVU A;  2YKM A;  3AA4 A;  1I39 A;  4RW4 A;  3SV4 A;  4KAZ A;  1RT3 A;  4CF2 A;  3LWM A;  1N5Y A;  4FJX A;  1WSI A;  4CJS A;  2RPI A;  3RMB A;  1UA0 A;  1L3U A;  3CM5 A;  3KKS A;  4OKE A;  4CF1 A;  1WLJ A;  1IG9 A;  1TL3 A;  3HPG A;  2RN2 A;  4N47 A;  4DQP A;  1GOA A;  3M8S A;  3SI6 A;  1NJX A;  4CJQ A;  4LY7 A;  3VQP A;  2A1S A;  4FM2 A;  4IFY A;  1EET A;  4O55 A;  1D5A A;  3VQA A;  4HVJ A;  1XHZ A;  4ELT A;  4J2E A;  3K58 A;  1A5X A;  2Q3S A;  3RR7 A;  1RDC A;  4FW1 A;  1EKE A;  1J53 A;  4DF8 A;  3TAF A;  5HLF A;  4FZY A;  3ZT0 A;  3DI6 A;  4CF0 A;  5HP1 A;  5C42 A;  4CFC A;  3DYA A;  3NBP A;  1RT1 A;  4DMN A;  4I9L A;  4LH4 A;  2XY5 A;  5HRR A;  3QIO A;  2DFH A;  4Z4F A;  2RKI A;  1U49 A;  1HYS A;  3DLR A;  4CIE A;  3ZT2 A;  1NK6 A;  4FK0 A;  4HCC A;  3I0R A;  3HL8 A;  3C6T A;  3OVN A;  4NCG A;  2HVI A;  2HHV A;  3QO9 A;  4CER A;  4JLH A;  4F8R A;  4DS5 A;  5J2N A;  4DSL A;  3VQ4 A;  3AV9 A;  4AHR A;  4HTU A;  3ZSW A;  4B9L A;  3NAE A;  4DLG A;  1ASW A;  2EHG A;  1C1C A;  1ZBI A;  2YHA A;  1NKE A;  2X6N A;  3WNG A;  3SJJ A;  1Y97 A;  3HVT A;  4CGH A;  4M3U A;  1U04 A;  4F2S A;  3QIP A;  4OGE A;  1KFS A;  3G10 A;  4FJI A;  4Z4I A;  4QAG A;  4Y1C A;  3SUQ A;  4H4M A;  4HCB A;  1T8E A;  1X1P A;  1TK0 A;  5CYQ A;  3V9S A;  1RTD A;  4OPJ A;  3KLI A;  4W5Q A;  2F8T A;  3F9K A;  2FBY A;  1X9S A;  5JS2 A;  4CK2 A;  3RRH A;  3KIO A;  3NF7 A;  3JSM A;  3V9W A;  3TAG A;  2IC3 A;  4W5T A;  4B9T A;  1G15 A;  4IDK A;  3SCX A;  4PQU A;  1NJZ A;  3MXI A;  3OYK A;  1D9D A;  3EY1 A;  4J2B A;  3RRG A;  4AHT A;  1B9F A;  3VQ8 A;  2RF2 A;  1CXQ A;  2HNY A;  4KTZ A;  4C8N A;  2HMI A;  3SUP A;  1TVR A;  1IKX A;  1B92 A;  2YNG A;  1LWC A;  4LH5 A;  4CJT A;  3ZSY A;  3OYB A;  4M3Z A;  3LDS A;  3QEV A;  1WSF A;  1XI1 A;  1L3S A;  1IKY A;  4HUE A;  3EYZ A;  4DSK A;  2GBZ A;  2VG5 A;  4BAC A;  3KTQ A;  4QOZ B;  2G8F A;  2KZZ A;  2G8K A;  4Q5V A;  1W0H A;  1FXX A;  3ISN C;  3HPO A;  3QEP A;  3TAE A;  3V9Z A;  5I42 A;  3L2W A;  1I3A A;  4BE0 A;  3JYT A;  2HHW A;  3KKR A;  4OKJ A;  3C94 A;  4OGC A;  4IG0 A;  3OY9 A;  2FBV A;  1KCF A;  2YNH A;  1VSM A;  3ALY A;  2ITG A;  4KFB A;  5JS1 A;  1HMV A;  1C1B A;  1U4B A;  3P1G A;  3TAN A;  1HQE A;  4MQ3 A;  1KVC A;  3OYH A;  4DTS A;  1ZBF A;  1B9D A;  1RTH A;  3QET A;  1SL0 A;  1VSF A;  3KD1 E;  4KB0 A;  3O3F A;  3DOK A;  4J2A A;  2F96 A;  4O4G A;  1RDA A;  3U3G A;  4ID1 A;  4M45 A;  3SPY A;  1BL3 A;  3VQB A;  4DF4 A;  1LWE A;  1RBU A;  3ZSO A;  4CJF A;  3KLH A;  3WNE A;  1O1W A;  3ZSR A;  3KD5 E;  1WAF A;  3NHG A;  2OYQ A;  4KO0 A;  1S1V A;  3AA5 X;  1C6V A;  4TSX A;  3DLG A;  1RDD A;  4CGI A;  2VWJ A;  4DTM A;  3V9X A;  1NKB A;  1TGO A;  4FZZ A;  1Z26 A;  3AVL A;  2D5R A;  3ASM A;  2XHB A;  1LAV A;  1IKV A;  3V1O A;  1FK9 A;  3L2U A;  4JS5 A;  1T03 A;  1K6Y A;  4I7F A;  4ICL A;  3OYE A;  3VQC A;  5HRP A;  2HHS A;  3HP6 A;  3O3G A;  1ZBU A;  4JRP A;  1ZBL A;  3S3O A;  4O0I A;  3S3N A;  1MU2 A;  3ITH A;  3AO3 A;  3K5N A;  1Z25 A;  3RWU A;  3PO5 A;  3ZT4 A;  1RT5 A;  3NH0 A;  3OYC A;  4M42 A;  1HNV A;  1YT3 A;  2KQ2 A;  3O4N A;  4E7H A;  1XC9 A;  3VQ5 A;  4KTQ A;  2XRI A;  1NKC A;  3LP2 A;  1XHX A;  4EP4 A;  2PYL A;  1ASU A;  3M8Q A;  4CEE A;  3OYF A;  3TAQ A;  4FK2 A;  4DWI A;  2WOM A;  5EU7 A;  3VN5 A;  1TKX A;  4FJ8 A;  2IAJ A;  1NK0 A;  3V6D A; 
#chains in the Genus database with same CATH topology
 5E84 A;  3SK3 A;  3LAK A;  5TKW A;  1WN7 A;  4XIU A;  4JD2 B;  4CHO A;  5C0Y A;  4H5R A;  3ZT1 A;  3RR8 A;  5J2M A;  2DFE A;  4BR7 A;  1EXQ A;  3FZL A;  3VQQ A;  2V52 B;  3AVA A;  3WEE A;  3I56 N;  4PL8 A;  3DLH A;  1HYZ A;  4MLH A;  1C0T A;  3MN9 A;  3MWP A;  4PHT X;  3T1H K;  3U3Y A;  3VEX A;  3M8R A;  3M6G A;  4RW9 A;  3VEO A;  4FK4 A;  5JMV A;  4BDZ A;  3IMX A;  4NCB A;  4PY5 A;  3T1A A;  3PX6 A;  4X62 K;  1S6P A;  1K73 O;  2KKZ A;  4HTL A;  5C15 A;  4FJH A;  4LF6 K;  4YOX A;  2FLO A;  1LV5 A;  4DTX A;  2GEM A;  4GMJ B;  5F2R A;  5JLF A;  5KI6 A;  2HST A;  1OH7 A;  4BQL A;  4M3X A;  2NRW A;  4FWK A;  2PYJ A;  2F9T A;  3CET A;  4W5R A;  3P83 D;  5K14 A;  1HPZ A;  1EP4 A;  4FJN A;  1BI4 A;  5ELZ A;  4DTU A;  2P9U B;  4CEZ A;  4FWR A;  4BC3 A;  1P90 A;  2QTD A;  1LWF A;  1YTU A;  4H0T B;  2W40 A;  3SNN A;  1N6Q A;  4QS8 A;  3AO4 A;  1RBR A;  4R79 A;  3QNN A;  5FRN A;  1Y64 A;  4JV5 K;  5AQG A;  3ENB A;  4CFD A;  4DLE A;  4B3M K;  3QER A;  3AVC A;  4B1W B;  3SZ2 A;  3UKR A;  4DHY A;  2P9L B;  3D7E O;  1LAW A;  2IIR A;  1GOC A;  4JI8 K;  4FJK A;  3ZEU B;  4K43 A;  4DQI A;  1WUA A;  5TKY A;  4BR2 A;  5CZ2 A;  1QHT A;  3TSU A;  4KRE A;  1S1W A;  4KKO A;  1BIZ A;  3CJC A;  3DOL A;  1RIL A;  4K8X A;  2VQE K;  3DM2 A;  4GVE A;  4QCL A;  5I9E B;  3MXJ A;  3KLF A;  2PFU A;  3P38 A;  1CZ9 A;  1S5J A;  3EE8 A;  3CC2 N;  4Q0B A;  3EE9 A;  4XH4 A;  1RBT A;  4K41 A;  3MMV A;  4IXC A;  4I6M A;  3CYM A;  2E4L A;  2QM1 A;  4FPB A;  4BRC A;  4JS4 A;  3FZH A;  1TKD A;  4DSJ A;  3MEC A;  4DQQ A;  3MAQ A;  1BG3 A;  4CEO A;  1J54 A;  4GV6 A;  1VRU A;  4DG1 A;  1S22 A;  3CCJ N;  1CLQ A;  1G99 A;  1U45 A;  2OZS A;  4NYF A;  4BG8 A;  5ADX A;  5HRO A;  3SPZ A;  1TUU A;  2J4R A;  3WQT A;  4CBX A;  3HST B;  3VTH A;  1S6Q A;  5HBM A;  4CF9 A;  1RCH A;  4CHZ A;  3CM6 A;  3TSP A;  4ILH A;  2JLE A;  4M7X A;  1TK8 A;  3TU5 A;  1W9H A;  1NJY A;  4M3T A;  4E3S A;  1U6Z A;  3T19 A;  1OVQ A;  2Z1H A;  3ATU A;  3IAY A;  3AA3 A;  3QNO A;  2E20 A;  3E9L A;  4DTP A;  4WFB L;  2O4G A;  3H6E A;  2HHT A;  3OS0 A;  5SWM A;  1HNI A;  3D2F A;  4OPK A;  4CFA A;  4X64 K;  2OA8 A;  3OBW A;  2WC9 A;  1BUP A;  1TAQ A;  2FBX A;  1WSE A;  3NGI A;  4DTO A;  2OTJ N;  2YHB A;  3VMF B;  2E1Y A;  2FSN A;  4H5V A;  4DR4 K;  4B1Z A;  3HSC A;  3M3Z A;  1JLB A;  3S41 A;  3HJF A;  1IBM K;  4AM7 A;  2CGL A;  3KZB A;  2AA4 A;  2KHO A;  2BDP A;  1SQK A;  3KK1 A;  4IO8 A;  1RT4 A;  3DLE A;  3OYN A;  2IGI A;  3MDQ A;  4OO1 J;  5AQX A;  2JGU A;  2HHQ A;  3J8A A;  3KHY A;  4YOR A;  2YX6 A;  3AVN A;  2OTL N;  4CHN A;  4KHQ A;  3EEQ A;  3K5O A;  5HL7 L;  4A5B A;  3HPH A;  4FXD A;  2X78 A;  4EHU A;  2AP1 A;  1JLG A;  1HNW K;  4FLU A;  2D4W A;  3AY9 A;  3NDK A;  3KJV A;  4F3O A;  4CFB A;  2QXL A;  3TAR A;  2HB5 A;  5I3U A;  5BR9 A;  3BP8 A;  1VQM N;  3ZX2 A;  3LM9 A;  3LDP A;  4B8A B;  4ZTF A;  1VSH A;  3JS6 A;  1NK8 A;  3CG7 A;  4K25 A;  4AHV A;  3T3F A;  4BRE A;  2JWK A;  5J2Q A;  3E9P A;  5DM6 L;  1ZXO A;  1RNH A;  2A3Z A;  2A41 A;  3K5M A;  2I5J A;  5AQO A;  2CGK A;  1DLO A;  1NU0 A;  2XO7 A;  3HK2 A;  1HQU A;  2LSN A;  4WFA L;  3ZX0 A;  5KRT A;  3Q7B A;  1HJO A;  1BOT O;  1VRT A;  2ATQ A;  4A2B A;  5LY3 A;  4JI0 K;  1YVU A;  2GUP A;  3M1F A;  4L3Q A;  1RT3 A;  4CF2 A;  5AQM A;  3O08 A;  4FJX A;  1TYQ B;  4CJS A;  4JI2 K;  3RMB A;  1UA0 A;  3G25 A;  3KKS A;  1WLJ A;  4DV3 K;  2P9K A;  4FWS A;  4LY7 A;  3PIO L;  3VQP A;  4DV4 K;  1N34 K;  2UYT A;  1D5A A;  4J2E A;  3K58 A;  1A5X A;  1XNQ K;  1NGG A;  1RDC A;  4BR5 A;  4JI5 K;  4QS7 A;  1EKE A;  1T3V A;  3TAF A;  3HTV A;  5HLF A;  4FZY A;  5DM7 L;  3CIP A;  1SAZ A;  3I55 N;  2A40 A;  5M1K A;  5HRR A;  4LF9 K;  4NLB A;  3PLA A;  4CIE A;  3ZT2 A;  4X66 K;  3C6H A;  3H3O B;  4BRD A;  5KPZ A;  3THY B;  1HX1 A;  5J2N A;  4DSL A;  4GY2 B;  3VQ4 A;  4RWT A;  1NNE A;  1VQ7 N;  4FO0 A;  4DUY K;  2YHA A;  1ZBI A;  1W97 L;  4WQ5 C;  4CGH A;  4M3U A;  3QIP A;  4BVO A;  3QBW A;  3G10 A;  1N32 K;  1Q86 O;  4H4M A;  4HCB A;  1T8E A;  5CYQ A;  4OPJ A;  2F8T A;  4BRI A;  1HUX A;  3KIO A;  4FWP A;  3JSM A;  3V9W A;  3VEW A;  1D9D A;  2Q31 A;  1OH8 A;  4AHT A;  3C7N A;  4IFE A;  3CJ9 A;  3BF1 A;  3LDQ A;  4JHD B;  2O8B A;  4JK8 A;  2VWB A;  3ZSY A;  4DR2 K;  4U67 L;  1XI1 A;  3H46 O;  1IKY A;  3EYZ A;  4WF9 L;  1GLL O;  3KTQ A;  3CI5 A;  4JI3 K;  3HPO A;  3QEP A;  2E2O A;  3V9Z A;  3BZC A;  4BE0 A;  3C94 A;  2QWP A;  2CGJ A;  5B8H A;  2YNH A;  1X9J A;  4GKK K;  2GWJ A;  4C1N I;  1E3M A;  1RTH A;  4UY8 O;  1VSF A;  2O8F B;  2Q1N A;  4LFA K;  3U3G A;  4ID1 A;  3VQB A;  1LWE A;  4GV9 A;  5AQK A;  3Q7C A;  3KLH A;  1WB9 A;  4LF4 K;  3VF6 A;  3AA5 X;  1C6V A;  2FSJ A;  3DLG A;  3VET A;  3ASM A;  2XHB A;  3UB5 A;  1FK9 A;  3L2U A;  1T03 A;  4I7F A;  1VQO N;  4IOC L;  2FF6 A;  3VQC A;  3O3G A;  4JRP A;  3CPE A;  1ZBL A;  4O0I A;  2BH1 A;  1T6D A;  3ZT4 A;  1RT5 A;  3NH0 A;  4BC4 A;  1HNV A;  3BEX A;  1KC8 O;  3FZM A;  4KTQ A;  1BDG A;  4EFH A;  4FK2 A;  1ASU A;  3M8Q A;  4CEE A;  3OYF A;  3CPW M;  2IAJ A;  3RMD A;  4FJ7 A;  2P9P A;  4O44 A;  4XH1 A;  2X74 A;  4H5W A;  3K5L A;  1UWB A;  4BQZ A;  2O8C B;  2UXC K;  4C8L A;  2W41 A;  3RSE A;  1OVY A;  2D0P A;  3CER A;  3CFP A;  3QB0 A;  3NVK A;  5BRF A;  2A1R A;  3LL3 A;  3V9U A;  3O3H A;  4CJ5 A;  5A2Q O;  4DU3 A;  1NK5 A;  3AGR A;  3FFK B;  4I2Q A;  2G8V A;  2QXF A;  4FJG A;  4NO7 A;  4CJK A;  3PX0 A;  2QK9 A;  1BHL A;  2VG7 A;  3VQ6 A;  5KPR A;  1VSK A;  4K0K K;  4PL7 A;  2V7Z A;  4M3W A;  5CY4 A;  4U7B A;  3MXM A;  1XMQ K;  2E5L K;  5M1N A;  3SMS A;  3F5T A;  2DY4 A;  1YUW A;  2GV9 A;  1JLA A;  3H1Q A;  3KLE A;  4LF8 K;  4X65 K;  1OH6 A;  3THX A;  1H1V A;  3LDL A;  1W7A A;  5J1E A;  3BUZ B;  1KLM A;  3CCR N;  4JI7 K;  3LP1 A;  1VK0 A;  1CZB A;  4EZ6 A;  3CCU N;  4CZK A;  4E19 A;  3HO1 A;  4M41 A;  2IOC A;  5M1P A;  3ZET A;  2BAN A;  2D0B A;  4CHY A;  4YHH K;  1QSY A;  4B3O A;  4HHT A;  1A5V A;  5KTQ A;  5AZJ B;  2B6A A;  4UQG A;  2PY5 A;  3MED A;  1BQN A;  3HXM A;  4MFB A;  2KFN A;  1UAX A;  2OCE A;  2BE2 A;  3CMA N;  4KHU A;  5H1S Q;  2YNF A;  3CJ7 A;  1KSP A;  3VTI A;  4CZF A;  2GX9 A;  1XWL A;  4B9S A;  4I2P A;  3RMC A;  4Z4H A;  3UKU B;  3CC7 N;  4AQY K;  1IH7 A;  4BRL A;  2YKN A;  3AVI A;  2NNW A;  3CJ1 A;  3QEW A;  5AQP A;  4BDP A;  1XNR K;  4Z0U A;  3SMP A;  4CK1 A;  1FJG K;  4CGD A;  1KVA A;  1TKZ A;  4AH9 A;  3OS2 A;  1U2V A;  4FWN A;  4FLT A;  2P5G A;  1YI2 N;  4OPH A;  3OYG A;  3OHR A;  3T69 A;  3KK2 A;  2VCP A;  3A2F A;  1NK4 A;  3BDP A;  3O9T A;  4CZG A;  4JN4 A;  4GW6 A;  4FOE A;  3D2E A;  4WQ4 C;  2XY7 A;  4DTJ A;  1HPM A;  1NGI A;  2E8A A;  1HR0 K;  1IKW A;  3AO1 A;  3LP3 A;  1DTQ A;  1BWF O;  4FLV A;  4O5F A;  2FSK A;  2OPS A;  3MCP A;  3R1X A;  4B3R K;  1K8A O;  1JL2 A;  2D1K A;  4JK7 A;  4JKE A;  4FWM A;  4LFC K;  4H0O A;  3VA3 A;  1BI4 B;  3THW A;  3SQ2 A;  1BQM A;  3F9M A;  4BR4 A;  4QS9 A;  4JYA K;  1GOB A;  3PX4 A;  3QLH A;  4BC2 A;  3P39 A;  2O4I A;  4IEI A;  2ZGY A;  1VQ6 N;  2B5J A;  2KTQ A;  3UIQ A;  1RDB A;  1YHQ N;  4DFM A;  2FC0 A;  4MDA A;  4BRP A;  3ZSV A;  4DSF A;  2ZF5 O;  4CIF A;  1BA0 A;  3NH1 A;  1NGC A;  4FJ9 A;  2VG6 A;  1W2B M;  4H5N A;  2ITM A;  2I7N A;  3WXM B;  3NGY A;  4BGB A;  2PAV A;  2Z1G A;  5EXW A;  1YJN N;  4FLY A;  4ID5 A;  5KQD A;  4KHP K;  1SV5 A;  2YHY A;  1KRP A;  3C0B A;  1NK7 A;  2CH5 A;  1LW0 A;  3WXI A;  4BG9 A;  4HUG A;  5LMN K;  2E6L A;  1CXU A;  4W5N A;  4HUF A;  1ZC6 A;  5AQN A;  3D6R A;  3VEZ A;  4E7L A;  4CHQ A;  2ZWH A;  3L3U A;  4N5S A;  5BR8 K;  3LDO A;  4DV0 K;  4CK3 A;  4M3Y A;  1S1T A;  1C0U A;  4Y1D A;  2ZGZ A;  2W42 A;  2BGG A;  4F9O A;  4IZ9 A;  4FM1 A;  4I6M B;  3WXJ A;  3DRP A;  4BC5 A;  1JLC A;  3HOT A;  5GAE P;  4WQ5 A;  3RMA A;  3LDN A;  3LP0 A;  1WSH A;  5J2P A;  2B4J A;  1LOT B;  4WCE L;  3IKM A;  4BRO A;  2HBL A;  4I9Q A;  3DWL A;  3LPU A;  3B6P A;  3VES A;  3O1W A;  1QE1 A;  1ILY A;  3MWT A;  3ZT3 A;  4EHT A;  4LF7 K;  5C25 A;  1ATR A;  1J5O A;  4H0X B;  1NOY A;  2WTU A;  2VGM A;  4OVL A;  2QI2 A;  4PUO A;  5KGW A;  4CJR A;  3L8B A;  1EQY A;  2HBM A;  3DLK A;  5FRM A;  3GE1 A;  2HOE A;  4N41 A;  1Q7Y O;  4CJE A;  3CHW A;  2DTU A;  1VSL A;  1T7P A;  4FLW A;  3SAG A;  1RT7 A;  2OPP A;  1X3N A;  2QWN A;  5CYM A;  5KQ8 A;  5C10 A;  1GLC G;  4FJ5 A;  4FZX C;  4CJ4 A;  1YF5 L;  2QWL A;  3SQ1 A;  2F8S A;  3D2F B;  3NE6 A;  3V6D A;  5LL6 Z;  3NGZ A;  4JRQ A;  3DMJ A;  2F4V K;  3O4Q A;  3JXU A;  3VEN A;  2HMP A;  4A61 A;  4DQS A;  4CJ3 A;  1X3M A;  2W6L A;  3HP9 A;  5D3G A;  3IUC A;  1VAZ A;  1RT2 A;  2D0C A;  4LFB K;  1EWQ A;  4N76 A;  3K2P A;  1HLU A;  1VQ4 N;  4CZM A;  2KW4 A;  4CBU A;  2IDO A;  3VEV A;  5CZ1 A;  3DXK A;  3V1R A;  5AQQ A;  3DLL L;  5LMU K;  2OPQ A;  1NGB A;  2A42 A;  1WSI A;  3HBT A;  3CM5 A;  4OKE A;  1IG9 A;  4BR9 A;  2BTF A;  2RN2 A;  3A8Y A;  4DQP A;  1GOA A;  3SI6 A;  5JVG L;  2HBJ A;  1YVN A;  4FM2 A;  4IFY A;  4O55 A;  1HKG A;  2Q3S A;  4FW1 A;  4DF8 A;  2Q0R A;  3ZT0 A;  4CF0 A;  4CFC A;  4J8F A;  4I9L A;  4LH4 A;  2DFH A;  2PBD A;  3DLR A;  1NK6 A;  3RVC A;  4FK0 A;  3I0R A;  2O8E B;  3E1Y A;  4EAH D;  3SBG A;  4Z94 A;  1N33 K;  4NXM K;  3ZSW A;  1ASW A;  2QW9 A;  1NKE A;  2X6N A;  3SJJ A;  3HVT A;  3P31 A;  1GLJ O;  4FJI A;  3SUQ A;  1TK0 A;  1RTD A;  1Q18 A;  2Q97 A;  3F9K A;  2FBY A;  1O13 A;  5JS2 A;  4CK2 A;  3EO3 A;  1G15 A;  3SCX A;  4BY9 C;  4DR1 K;  5BPL A;  3EY1 A;  4J2B A;  2BUP A;  5EOY A;  3RRG A;  5GAH P;  4FOI A;  1GLD G;  3M5R A;  1IKX A;  4LH5 A;  1ZBS A;  4CJT A;  3PIP L;  4M3Z A;  3LDS A;  3QEV A;  2YJF A;  1IBL K;  1C0F A;  4DSK A;  4BAC A;  3ATV A;  3I33 A;  2KZZ A;  2G8K A;  4Q5V A;  5I42 A;  3CF5 L;  1I3A A;  2HBK A;  3JYT A;  3OY9 A;  2P9K B;  1VSM A;  3ALY A;  4KFB A;  5JS1 A;  3P1G A;  5AFU A;  3KD1 E;  4B1U B;  3QET A;  3O3F A;  3DOK A;  3G71 N;  4J2A A;  2NRZ A;  4O4G A;  1RDA A;  4DF4 A;  1IBK K;  2KLA A;  5BRE A;  3WNE A;  1VQN N;  3GG4 A;  2O8D B;  1RGI A;  4FJ8 A;  4TSX A;  1RDD A;  3EN9 A;  3V9X A;  1WOQ A;  2D5R A;  2A5X A;  1LAV A;  4YOU A;  4DR7 K;  1K6Y A;  3OYE A;  2NRX A;  3P4I A;  5M1O A;  1CZA N;  5JIC A;  4BR0 A;  5CE3 A;  1MU2 A;  3RWU A;  1QZ6 A;  3K5N A;  1ESV A;  4M42 A;  3OYC A;  3O4N A;  4A62 A;  4KH6 A;  1SZ2 A;  4YOW A;  4E7H A;  3TTF A;  1YIT N;  1XC9 A;  1JJ2 M;  3LP2 A;  3ULE B;  4DWI A;  3ID8 A;  4WQ4 A;  3O6W A;  1NK0 A;  5BPN A;  3VGL A;  4DKW A;  1S1X A;  1S9G A;  1NGE A;  3AAQ A;  1HRH A;  1SL2 A;  4OLA A;  4MO4 A;  3NFA A;  4G1Q A;  3SUN A;  3AVB A;  5F0X A;  3TAB A;  3N4P A;  3ZSX A;  4JKG B;  4FM0 A;  4CGF A;  3WNH A;  1VQ8 N;  2WBN A;  3OS1 A;  1KFD A;  3MCA B;  1GLA G;  4EP5 A;  3DRR A;  3CFO A;  5AQF A;  4CD1 A;  4KV8 A;  3PUF A;  4IG3 A;  4W5O A;  3CJB A;  4OX9 K;  4CED A;  4FJL A;  3A5L C;  3MX2 A;  3MN5 A;  3KK3 A;  1IV0 A;  1K8K A;  1EX4 A;  3OJS A;  4CJP A;  4JI6 K;  4MDB A;  4NLC A;  4A59 A;  3DXM A;  4AHC A;  4N56 A;  4B9U A;  3WNF A;  3J7Z O;  3ZYY X;  4LD0 A;  5AQL A;  3QFP A;  4Y0W A;  4IOA L;  3A5N C;  3WT0 A;  3AAR A;  3I8B A;  4JKD A;  3AVG A;  3S9H A;  1JCG A;  4H0V B;  4L8R B;  2VGN A;  1LCU A;  5LJV A;  4CZE A;  1TV6 A;  1NOZ A;  4PA1 A;  3THV A;  1YJ9 N;  4CCH A;  1WSG A;  5AQH A;  4KH5 A;  4M7Y A;  5AQR A;  1FKO A;  4ISE A;  1WSJ A;  3AAP A;  4Z4C A;  5M1F A;  1VSD A;  1SUQ A;  3BZK A;  1ASV A;  1X9M A;  1QQC A;  1OH5 A;  4MO5 A;  5IWA K;  1K9M O;  1L5U A;  2YHW A;  4M63 C;  3CCV N;  2Y1I A;  3VF4 A;  3PSI A;  5AQZ A;  3OYJ A;  1KXP A;  3O5B A;  4NCA A;  1RBV A;  1NMD A;  3ZX3 A;  3OW2 M;  4PKI A;  1VQ5 N;  1L3V A;  3WXL A;  1DT9 A;  4FLX A;  5AQI A;  4KPY A;  3WUH A;  3RTV A;  2ETJ A;  5AQY A;  1MWM A;  3QEX A;  1YJW N;  4KHY A;  3HT3 A;  3DAW A;  1NK9 A;  3C95 A;  4CJV A;  4V19 S;  4ISF A;  3EZ5 A;  3THY A;  1NG9 A;  3L6Q A;  2DFF A;  2DPN A;  5MLC Q;  2FBT A;  4BRG A;  4BWM A;  3A5M C;  3VQE A;  2P9I B;  3NH2 A;  4H0P A;  3N4Q A;  3V81 A;  3OYD A;  3MEE A;  4CW7 B;  3QIN A;  5AFU H;  2V51 B;  4FJJ A;  4CZL A;  3LZJ A;  4O5B A;  3ZET B;  3U8X A;  1Q9Y A;  2WFB A;  3OYL A;  2D0A A;  3FE1 A;  2YCH A;  1ZYQ A;  4K42 A;  1NGJ A;  1S9E A;  3W3D A;  2UU9 K;  1E4G T;  1QSS A;  1GLB G;  1VSJ A;  2YHX A;  4DV6 K;  1P8Z A;  1S1U A;  3QEI A;  2FF3 B;  3FR0 A;  2ZE2 A;  1ITG A;  4E7K A;  3GDQ A;  4E89 A;  4RW6 A;  4RW7 A;  4JK9 A;  5KPT A;  4XH5 A;  2HHU A;  4AHU A;  4B9M A;  1JLE A;  2P9S A;  1NWK A;  1RTI A;  4BE2 A;  1UA1 A;  1JXE A;  3H08 A;  3SQ0 A;  3G0Z A;  1TL1 A;  3SAF A;  4KHS A;  4FJM A;  3O1B A;  1J6Z A;  4AHS A;  4OPA A;  2O8F A;  2P9N B;  3TTC A;  4E7I A;  4EIA A;  4OLB A;  4OKK A;  3J7A P;  3F2K A;  3G4S N;  5C24 A;  3ZSQ A;  3VPZ A;  1N36 K;  3UE5 A;  4CVN E;  1IJJ A;  1QQM A;  3VQ9 A;  4CEC A;  5HRS A;  2YV0 X;  1JKH A;  1NGA A;  5AJ3 K;  4KHW A;  3QDK A;  5EY4 A;  3GL1 A;  3VQD A;  3HM9 A;  3FFI A;  2I7P A;  3TPQ A;  1HKB A;  3K57 A;  1F21 A;  4FVU A;  5AZI B;  2XY6 A;  1L3T A;  4FWQ A;  2QWQ A;  3HVR A;  3U6F A;  3SLC A;  3MEG A;  3AO2 A;  1C0M A;  1QS4 A;  2JWL A;  1FKP A;  3HM8 A;  2KZM A;  4CGG A;  2UXD K;  1SL1 A;  4F4K A;  2E2N A;  3HYF A;  1J5E K;  2O8C A;  4FVM A;  1TKT A;  3WEE B;  2YNI A;  3IS9 A;  3VA0 A;  3QES A;  5FRO A;  4ZHR A;  5AR0 A;  3E01 A;  4H8K A;  3TR8 A;  4LF5 K;  3PY8 A;  1HNX K;  2QKK A;  1KVB A;  4CHP A;  3L2V A;  3NF6 A;  5SZT A;  4M3R A;  3CXC M;  1T6C A;  3O8M A;  3K0S A;  1D8Y A;  1HYV A;  1I94 K;  2G8W A;  5BPM A;  2GUI A;  4YFU A;  4DFJ A;  3C6U A;  1DEJ A;  2ZD1 A;  4IJN A;  4YOY A;  1BGX T;  4DV1 K;  3LAM A;  4YOT A;  3SUO A;  4FLZ A;  1VQK N;  5HRN A;  4KRF A;  2QWO A;  3ENO A;  1JL1 A;  2HNZ A;  1KQS M;  4O0J A;  3OJU A;  5GAD P;  2GWK A;  1C0G A;  3SYZ A;  3R3L A;  4GNI A;  3C6A A;  1JLF A;  2IS3 A;  2OPR A;  3KLG A;  4IO9 L;  2KFZ A;  2YKM A;  3AA4 A;  1I39 A;  4KAZ A;  1NM1 A;  5IT9 O;  1KAZ A;  3CCS N;  2RPI A;  4CD3 A;  3UKR B;  4CF1 A;  1QZ5 A;  2ASM A;  3HPG A;  4N47 A;  1NBW A;  5CR4 A;  1NJX A;  4GV3 A;  4CJQ A;  1VHX A;  1XHZ A;  1EET A;  3VQA A;  4ELT A;  3MX5 A;  3OTO K;  4DR5 K;  3UKU A;  5FLX O;  3DI6 A;  5HP1 A;  5C42 A;  3DYA A;  3NBP A;  1RT1 A;  2XY5 A;  1FW6 A;  5AQU A;  4HWI A;  2UUA K;  1HYS A;  4ISG A;  4HCC A;  1NLV A;  2QWR A;  1XC3 A;  3HL8 A;  3C6T A;  3OVN A;  4NCG A;  2OAN A;  2HVI A;  2VYP A;  2HHV A;  3QO9 A;  4B3S K;  4DS5 A;  3EZW A;  4AHR A;  3AV9 A;  4HTU A;  1R59 O;  4B9L A;  3NAE A;  4DLG A;  1XUP O;  2EHG A;  1Y97 A;  4YDU C;  3TTD A;  1KFS A;  4Z4I A;  4QAG A;  3V9S A;  4BRA A;  3KLI A;  3NVM A;  1JCE A;  5JLH A;  3RRH A;  1QVG M;  3NF7 A;  2IC3 A;  4W5T A;  4IDK A;  1V4T A;  1NJZ A;  3T7Z A;  5AQW A;  3VQ8 A;  2RF2 A;  1S72 N;  1CXQ A;  1YAG A;  4JD2 A;  3CQX A;  4C8N A;  2HMI A;  3SUP A;  1B92 A;  2ZJP L;  1LWC A;  3DXK B;  1L3S A;  3E66 A;  2UUC K;  2GBZ A;  4QOZ B;  2G8F A;  1NGD A;  1V4S A;  3ISN C;  5AQS A;  3QML A;  3L2W A;  3O9Q A;  2HHW A;  2QWM A;  3KKR A;  4OKJ A;  5BRD A;  2FBV A;  1KCF A;  4G9Z A;  4WFN L;  1T44 A;  5BRH A;  4MQ3 A;  1KVC A;  3OYH A;  4DTS A;  1ZBF A;  1B9D A;  1SL0 A;  3AGK A;  4H0Y B;  3SPY A;  1RBU A;  1XMO K;  3IDH A;  3O9R A;  4C1N K;  1O1W A;  3CCE N;  3NHG A;  1S1V A;  4DTM A;  4CGI A;  3CCQ N;  1NKB A;  4FWO A;  3VER A;  1TGO A;  3AVL A;  3H3N O;  3V1O A;  4FL9 A;  4ICL A;  5HRP A;  1M1K O;  3HP6 A;  1ZBU A;  2P9U A;  3S3O A;  3AO3 A;  3PO5 A;  3FLC O;  1YT3 A;  4EP4 A;  1XHX A;  3MK6 A;  2NRT A;  1NGH A;  1TKX A;  3TAM A;  4E1N A;  5CHI A;  1JLQ A;  5GAG P;  4F3T A;  4CES A;  4IOX A;  4DFK A;  1EWR A;  3K59 A;  4JKA A;  4DV7 K;  5BN9 A;  4RTF D;  3O80 A;  3I8D A;  5C2D A;  2P9L A;  3FGU A;  1YTA A;  4E1M A;  4JNE A;  3SJH A;  3ZEU A;  1VQ9 N;  4DCH A;  2G8I A;  4CJL A;  1MA9 B;  1QTM A;  1SKR A;  3VEY A;  3L2Q A;  4Z4G A;  4AIL C;  3PV8 A;  2VWK A;  1BIS A;  2E1Z A;  4JEP A;  5DMR A;  3E9O A;  1Q81 O;  3IRX A;  4PWD A;  2HW3 A;  1QHA A;  1WAJ A;  1DTT A;  2IVP A;  2HF3 A;  4BRH A;  4RCH A;  3LZI A;  3CQ8 A;  4ILJ A;  4ELU A;  2HVH A;  3KWG A;  3CFR A;  4CEF A;  4LSL A;  1U47 A;  3G6E N;  4B08 A;  3J80 O;  1SS6 A;  3DJC A;  4DUZ K;  2NZT A;  4J2D A;  2X6S A;  1TK5 A;  5C12 A;  3HOS A;  1C1A A;  4JKH A;  4DU1 A;  3HZ6 A;  3J81 O;  1BCO A;  2NUB A;  3GOI A;  3MN6 A;  2R7Y A;  4CZI A;  3FZK A;  3ZSZ A;  4CEA A;  3DLB A;  2E2Q A;  4KB1 A;  4CIG A;  4OJR A;  5BN8 A;  2IVO A;  3VGK A;  4DU4 A;  1RFQ A;  4O8U A;  1YIJ N;  3U4L A;  1VSI A;  3B6O A;  1Q9X A;  1KTQ A;  2ZM6 K;  3GBT A;  3S3M A;  3L3V A;  1RT6 A;  2ZQB A;  3AVH A;  1U48 A;  3V1Q A;  2ZJR L;  4CEB A;  2OZM A;  4ILG B;  2XY8 A;  5C2F A;  4CJW A;  1ZBH A;  5M1Q A;  3D0P A;  4B9V A;  1ATS A;  4RW8 A;  2FXU A;  1LW2 A;  4FCY A;  1IO2 A;  4A57 A;  4AF1 A;  4B1X B;  4B8C A;  4XEI A;  1KLN A;  5E41 A;  3EKS A;  5EX5 A;  4IBN A;  2NRH A;  3L2R A;  3OYM A;  5FPM A;  2P5O A;  5DK5 A;  2O8E A;  2Z1J A;  1SKS A;  4E1J A;  4B9N A;  5T7B A;  1K8K B;  4H4O A;  4CF8 A;  2WON A;  1HNZ K;  3DXM B;  3LAL A;  3OYI A;  1VSE A;  4NXN K;  4CGJ A;  2GEL A;  1TAU A;  1QVF M;  5KGX A;  1RDU A;  4LC9 B;  2Q0U A;  4DQ8 A;  2WUS A;  4JKF A;  2F9W A;  4DV2 K;  2RE2 A;  4DTR A;  2HND A;  3BGR A;  4CE9 A;  4EZ9 A;  3OA9 A;  2UUB K;  3VOV A;  2F7T A;  3HRG A;  4B1Y B;  3C7N B;  4GKJ K;  3A0I X;  3L0Q A;  3ZLJ A;  4DQR A;  3J7Y P;  3CME N;  2O8B B;  4LSN A;  1MDU B;  4PKG A;  4C8K A;  4FW2 A;  4BWJ A;  1IG8 A;  3JAM O;  4DTN A;  1SKW A;  4KI4 A;  2YJE A;  1Q8I A;  2E2P A;  1QQO A;  3CQY A;  4DFP A;  3D45 A;  4K8Z A;  4E0D A;  3L4I A;  4DS4 A;  2H3G X;  3NF9 A;  3F73 A;  4KHN A;  1REV A;  3R8E A;  3M8P A;  4JKB A;  4BGA A;  1X9W A;  4R5P A;  1QSL A;  1D9F A;  1RTJ A;  4C8O A;  1NMN A;  1JXB A;  4NYN A;  5F1X A;  1RBS A;  3FZF A;  1A5W A;  4B3T K;  3U9Z A;  4A2A A;  2D0O A;  3LWL A;  4FYD A;  4DSI A;  3A5O C;  4Z4E A;  3EL2 A;  4BRN A;  2AJQ A;  4JAX A;  3SAH A;  2GTD A;  3LPT A;  5EVZ A;  3C65 A;  2Z1I A;  4IKF A;  4BRQ A;  4CZJ A;  2P1J A;  1UOC A;  3TI0 A;  4DR6 K;  3ID6 A;  4C23 A;  4IJA A;  4F2R A;  4JI4 K;  5FDL A;  4GVM A;  4FPA A;  4BE1 A;  2QKB A;  2QA4 N;  2O8D A;  3O9S A;  1RDW X;  4KTW A;  3AVJ A;  3IFR A;  3AVF A;  3VGM A;  3QBX A;  2ASP A;  3SBT A;  5ADX H;  2Q2R A;  3NF8 A;  1TUY A;  3VF2 A;  3CJA A;  2QEX N;  4MLE A;  3U9D A;  2Q36 A;  4DSE A;  3I0S A;  4BRF A;  1VQL N;  4WE1 A;  2P51 A;  4CJU A;  3TWH A;  2PZS A;  2G8U A;  2ZJQ L;  2P9P B;  3ULE A;  2ASO A;  4FSV A;  5KRS A;  4YDU A;  4DV5 K;  2Y1J A;  1Z6R A;  3NCI A;  1GLE G;  1NJI O;  3ZCM A;  1TYQ A;  3OYA A;  3RSE B;  4B9Q A;  4ELV A;  1NJW A;  1HJR A;  1WNS A;  2A6A A;  4O8K A;  3KVG A;  1T05 A;  3TSQ A;  1MWK A;  1E4F T;  3TAP A;  3WQU A;  1JCF A;  1HKC A;  4KH4 A;  3AVM A;  4JKG A;  1M90 O;  3LAN A;  4ZTJ A;  1J9A A;  2P9S B;  3ULD A;  4CEQ A;  3R6M A;  4BDY A;  4DR3 K;  1EO1 A;  1BIU A;  3KK7 A;  4YNQ A;  4KI6 A;  3CCL N;  5FPN A;  3T1Y K;  2HHX A;  1KD1 O;  4RG8 A;  3SQ4 A;  4IFV A;  1YXQ A;  2E6M A;  3VQ7 A;  3PO4 A;  3IG1 A;  1R0A A;  3THX B;  1N8R O;  4C8M A;  2W6K A;  4IEE A;  3PSF A;  3L4Q A;  1BA1 A;  1BCM A;  3AO5 A;  4JI1 K;  3SV3 A;  2YI1 A;  3AA2 A;  3DRS A;  3P5J A;  4AM6 A;  3W0L A;  3AVK A;  3R9P A;  1NGF A;  5E26 A;  2G8H A;  4E7J A;  3BF3 A;  2EX3 A;  1ATN A;  3V4I A;  5GIO A;  4JHD A;  4DB3 A;  3EKU A;  3KWI A;  4RW4 A;  3SV4 A;  3LWM A;  1N5Y A;  2HF4 A;  5AQT A;  1Q82 O;  2V7Y A;  4CBW A;  1L3U A;  4B1V A;  1TL3 A;  3M8S A;  4CI6 A;  3O4W A;  2A1S A;  3K9J A;  1GLF O;  4HVJ A;  2UXB K;  2NLX A;  4BRM A;  3RR7 A;  3CC4 N;  1J53 A;  4H5T A;  4PKH A;  3CCM N;  4DMN A;  1U2V B;  3QIO A;  4YOV A;  4Z4F A;  2IVN A;  2RKI A;  1U49 A;  1XQS C;  5LJW A;  4IDH A;  4CER A;  1DGK N;  2CH6 A;  1D4X A;  4JLH A;  4F8R A;  2NRV A;  3LM2 A;  3D2E B;  3B8A X;  5AQV A;  1C1C A;  3WNG A;  1U04 A;  4F2S A;  3H1V X;  4H03 B;  4OGE A;  2RHK A;  4Y1C A;  4CJ7 A;  1X1P A;  2P9I A;  1WBB A;  4KBO A;  4IWV A;  4W5Q A;  1X9S A;  4BRK A;  3QIC A;  3H45 C;  3WXK A;  3TAG A;  4B9T A;  3THW B;  4PQU A;  3MXI A;  3OYK A;  1B9F A;  1BU6 O;  3OBY A;  2HNY A;  4KTZ A;  1Z05 A;  1TVR A;  3CD6 N;  2YNG A;  3OYB A;  1WSF A;  1S3X A;  3K9K A;  2EWS A;  4HUE A;  5GIN A;  2VG5 A;  5FPE A;  1W0H A;  1FXX A;  4BVP A;  4CZH A;  3O9U A;  3TAE A;  4OGC A;  4IG0 A;  2NRR A;  3MN7 A;  2ITG A;  1HMV A;  3QFU A;  1C1B A;  1U4B A;  3TAN A;  2E88 A;  1HQE A;  5JVH L;  4WYB A;  1DKG D;  4KB0 A;  2HHH K;  1KAX A;  5GIP A;  2F96 A;  2P9N A;  4M45 A;  1BL3 A;  3ZSO A;  4CJF A;  4FWL A;  4JKC A;  3ZSR A;  3KD5 E;  4NB4 A;  1WAF A;  2OYQ A;  4KO0 A;  5HOO A;  2VWJ A;  4FZZ A;  1Z26 A;  1IKV A;  3NMU A;  4YY3 K;  4JS5 A;  2HHS A;  4A5A A;  2VQF K;  3ENH A;  3HI0 A;  3S3N A;  3ITH A;  1Z25 A;  1KAY A;  1OKJ A;  2KQ2 A;  1VQP N;  5AZJ A;  3VQ5 A;  2XRI A;  1NKC A;  2PYL A;  1QQN A;  3TAQ A;  5AZI A;  1WBD A;  2WOM A;  1BO5 O;  5EU7 A;  3VN5 A;  5FPD A;  5AQJ A;  3BY5 A; 
#chains in the Genus database with same CATH homology
 3RMD A;  3TAM A;  4E1N A;  4FJ7 A;  1JLQ A;  3LAK A;  1WN7 A;  4F3T A;  4XIU A;  1S1X A;  4O44 A;  2X74 A;  4CES A;  1S9G A;  3K5L A;  3K59 A;  4DFK A;  1UWB A;  1HRH A;  1SL2 A;  4OLA A;  4CHO A;  3NFA A;  4G1Q A;  3I8D A;  3SUN A;  4C8L A;  3ZT1 A;  3RR8 A;  5J2M A;  2DFE A;  1EXQ A;  3AVB A;  3VQQ A;  1YTA A;  4E1M A;  3AVA A;  3TAB A;  3DLH A;  1HYZ A;  3ZSX A;  3CFP A;  1C0T A;  4FM0 A;  2G8I A;  4CJL A;  2A1R A;  4CGF A;  3V9U A;  3WNH A;  3O3H A;  4CJ5 A;  4DU3 A;  3U3Y A;  1NK5 A;  1SKR A;  3OS1 A;  3M8R A;  2G8V A;  4I2Q A;  1KFD A;  2QXF A;  4RW9 A;  4FJG A;  3L2Q A;  4FK4 A;  4AIL C;  4Z4G A;  4CJK A;  4BDZ A;  3PV8 A;  3PX0 A;  4EP5 A;  3DRR A;  4NCB A;  2VWK A;  1BHL A;  3T1A A;  2VG7 A;  3CFO A;  3VQ6 A;  2QK9 A;  4PY5 A;  3PX6 A;  1VSK A;  1BIS A;  3PUF A;  4KV8 A;  1S6P A;  4IG3 A;  5DMR A;  4M3W A;  4FJH A;  4W5O A;  5CY4 A;  4PWD A;  3IRX A;  3MXM A;  2HW3 A;  1LV5 A;  1DTT A;  1WAJ A;  4CED A;  3LZI A;  3CQ8 A;  4ELU A;  3KK3 A;  4FJL A;  4DTX A;  1EX4 A;  2DY4 A;  3OJS A;  2GV9 A;  4CJP A;  1JLA A;  2HVH A;  4GMJ B;  3KLE A;  3CFR A;  4CEF A;  4LSL A;  1U47 A;  4AHC A;  5KI6 A;  4B08 A;  4N56 A;  4B9U A;  3WNF A;  4M3X A;  4J2D A;  2X6S A;  1TK5 A;  4LD0 A;  2PYJ A;  5J1E A;  4W5R A;  1KLM A;  3P83 D;  1C1A A;  5K14 A;  4DU1 A;  1HPZ A;  3LP1 A;  1VK0 A;  1BCO A;  1EP4 A;  1CZB A;  2NUB A;  4EZ6 A;  2R7Y A;  4FJN A;  1BI4 A;  4DTU A;  4E19 A;  3HO1 A;  4M41 A;  2IOC A;  3ZSZ A;  3AVG A;  4CEA A;  3S9H A;  2BAN A;  2D0B A;  4CEZ A;  4CHY A;  1QSY A;  4L8R B;  3DLB A;  4B3O A;  4HHT A;  4KB1 A;  4CIG A;  1A5V A;  1LWF A;  4OJR A;  5KTQ A;  1YTU A;  2B6A A;  4UQG A;  2PY5 A;  3MED A;  3SNN A;  1TV6 A;  4DU4 A;  1BQN A;  1N6Q A;  1NOZ A;  4PA1 A;  3AO4 A;  3HXM A;  3THV A;  4CCH A;  1VSI A;  4MFB A;  1RBR A;  1WSG A;  3B6O A;  3QNN A;  2KFN A;  1Q9X A;  5FRN A;  1UAX A;  1KTQ A;  2BE2 A;  1FKO A;  4KHU A;  4CFD A;  1WSJ A;  4DLE A;  2YNF A;  4Z4C A;  3S3M A;  3L3V A;  1KSP A;  1RT6 A;  1SUQ A;  1VSD A;  2ZQB A;  3AVC A;  1XWL A;  3QER A;  1ASV A;  1X9M A;  1QQC A;  3SZ2 A;  3AVH A;  1U48 A;  3V1Q A;  1L5U A;  4B9S A;  4CEB A;  1LAW A;  4I2P A;  3RMC A;  2OZM A;  1GOC A;  4Z4H A;  4FJK A;  2Y1I A;  2XY8 A;  1IH7 A;  4CJW A;  1ZBH A;  1QTM A;  2YKN A;  3OYJ A;  3AVI A;  4DQI A;  5CZ2 A;  1QHT A;  4NCA A;  3QEW A;  1RBV A;  4BDP A;  4KRE A;  4B9V A;  1S1W A;  3D0P A;  4Z0U A;  4CK1 A;  4RW8 A;  4KKO A;  1L3V A;  4CGD A;  4FLX A;  1KVA A;  4KPY A;  1LW2 A;  4FCY A;  1BIZ A;  1TKZ A;  2ETJ A;  1IO2 A;  3RTV A;  4AH9 A;  3QEX A;  4B8C A;  3DOL A;  3OS2 A;  4FLT A;  1KLN A;  5E41 A;  4KHY A;  4IBN A;  1RIL A;  3HT3 A;  2P5G A;  1NK9 A;  4K8X A;  3C95 A;  4CJV A;  3OYM A;  3OYG A;  3L2R A;  2P5O A;  3KK2 A;  3EZ5 A;  5DK5 A;  2DFF A;  3DM2 A;  2Z1J A;  1SKS A;  4B9N A;  3A2F A;  5T7B A;  1NK4 A;  3BDP A;  4H4O A;  4CF8 A;  4QCL A;  4GW6 A;  2XY7 A;  4DTJ A;  3MXJ A;  2WON A;  3KLF A;  3LAL A;  3OYI A;  1VSE A;  1CZ9 A;  1S5J A;  2FBT A;  1IKW A;  3AO1 A;  3LP3 A;  4BWM A;  3VQE A;  1DTQ A;  4CGJ A;  1TAU A;  4Q0B A;  3NH2 A;  5KGX A;  1RBT A;  4FLV A;  3V81 A;  2OPS A;  3OYD A;  3MEE A;  3QIN A;  3CYM A;  2E4L A;  1JL2 A;  4JS4 A;  1TKD A;  4DTR A;  2HND A;  3BGR A;  4CE9 A;  3VA3 A;  4EZ9 A;  1BI4 B;  4DSJ A;  4FJJ A;  3MEC A;  4DQQ A;  3MAQ A;  4O5B A;  3LZJ A;  3SQ2 A;  1Q9Y A;  4CEO A;  3OYL A;  1BQM A;  2D0A A;  1J54 A;  4DQR A;  1ZYQ A;  4LSN A;  4C8K A;  1VRU A;  4FW2 A;  4BWJ A;  4DG1 A;  4DTN A;  1S9E A;  1SKW A;  4KI4 A;  1CLQ A;  1GOB A;  1Q8I A;  1QSS A;  1U45 A;  1VSJ A;  3PX4 A;  3QLH A;  1S1U A;  3QEI A;  2O4I A;  2OZS A;  4NYF A;  4DFP A;  3D45 A;  5HRO A;  4E0D A;  4K8Z A;  2ZE2 A;  2B5J A;  3SPZ A;  2KTQ A;  1ITG A;  4E7K A;  3UIQ A;  4E89 A;  4DS4 A;  3NF9 A;  1RDB A;  4RW6 A;  3F73 A;  4KHN A;  1REV A;  3HST B;  4DFM A;  2FC0 A;  4RW7 A;  1S6Q A;  3ZSV A;  5HBM A;  4CIF A;  4CF9 A;  3M8P A;  4DSF A;  2HHU A;  1X9W A;  4R5P A;  4AHU A;  1QSL A;  1RCH A;  1RTJ A;  3NH1 A;  4CHZ A;  2VG6 A;  3CM6 A;  1D9F A;  4C8O A;  4FJ9 A;  4B9M A;  1JLE A;  1RTI A;  4BE2 A;  1JXB A;  2JLE A;  4NYN A;  1UA1 A;  1TK8 A;  3NGY A;  1RBS A;  1W9H A;  1NJY A;  4M3T A;  1A5W A;  1JXE A;  3H08 A;  3SQ0 A;  4E3S A;  3LWL A;  2Z1G A;  4FYD A;  3G0Z A;  3T19 A;  4DSI A;  1TL1 A;  4Z4E A;  4KHS A;  4FJM A;  2AJQ A;  3LPT A;  4AHS A;  2Z1H A;  4ID5 A;  4FLY A;  3IAY A;  3AA3 A;  3QNO A;  2Z1I A;  1SV5 A;  4IKF A;  4DTP A;  1KRP A;  2O4G A;  2P1J A;  1UOC A;  3TI0 A;  1NK7 A;  4E7I A;  2HHT A;  4OLB A;  3OS0 A;  4OKK A;  1LW0 A;  4F2R A;  5C24 A;  5FDL A;  3ZSQ A;  2E6L A;  4HUG A;  5SWM A;  1CXU A;  4GVM A;  4W5N A;  1HNI A;  4HUF A;  4BE1 A;  4OPK A;  4E7L A;  2QKB A;  4CFA A;  4CHQ A;  4KTW A;  2OA8 A;  3AVJ A;  3L3U A;  3VQ9 A;  4CEC A;  4N5S A;  5HRS A;  2YV0 X;  3AVF A;  1JKH A;  1TAQ A;  2FBX A;  4KHW A;  1WSE A;  3NF8 A;  4CK3 A;  3VQD A;  3NGI A;  1S1T A;  1C0U A;  3HM9 A;  4M3Y A;  4Y1D A;  4DTO A;  4DSE A;  3FFI A;  3I0S A;  2W42 A;  3K57 A;  2BGG A;  1F21 A;  4FM1 A;  2YHB A;  4WE1 A;  2P51 A;  4CJU A;  3TWH A;  2XY6 A;  1L3T A;  2PZS A;  3DRP A;  2G8U A;  1JLC A;  1JLB A;  3HVR A;  3HJF A;  3U6F A;  5KRS A;  3MEG A;  3AO2 A;  1C0M A;  1QS4 A;  3RMA A;  1FKP A;  2Y1J A;  3NCI A;  3LP0 A;  4CGG A;  1WSH A;  5J2P A;  2KZM A;  3ZCM A;  1SL1 A;  2B4J A;  3OYA A;  2BDP A;  4F4K A;  4ELV A;  3HYF A;  3KK1 A;  1NJW A;  4I9Q A;  4FVM A;  1HJR A;  1TKT A;  1WNS A;  2YNI A;  3LPU A;  1RT4 A;  3B6P A;  3DLE A;  3IS9 A;  3OYN A;  3VA0 A;  2IGI A;  3QES A;  1T05 A;  1QE1 A;  3ZT3 A;  3TAP A;  5C25 A;  2HHQ A;  2JGU A;  5FRO A;  4ZHR A;  3AVM A;  3E01 A;  4H8K A;  3TR8 A;  3AVN A;  3LAN A;  4ZTJ A;  1J5O A;  1J9A A;  4CHN A;  1NOY A;  3ULD A;  3PY8 A;  4KHQ A;  4OVL A;  4PUO A;  5KGW A;  3K5O A;  4CEQ A;  4CJR A;  4BDY A;  2QKK A;  3L8B A;  3DLK A;  5FRM A;  3HPH A;  1KVB A;  4FXD A;  2X78 A;  1BIU A;  4CHP A;  4N41 A;  4YNQ A;  4KI6 A;  1JLG A;  4CJE A;  2HHX A;  3L2V A;  2DTU A;  1VSL A;  3NF6 A;  4RG8 A;  4FLW A;  3SQ4 A;  4IFV A;  1T7P A;  2E6M A;  3VQ7 A;  5SZT A;  3PO4 A;  1RT7 A;  4M3R A;  4FLU A;  3NDK A;  2OPP A;  3IG1 A;  3KJV A;  4F3O A;  5CYM A;  4CFB A;  1R0A A;  4FJ5 A;  1D8Y A;  1HYV A;  3TAR A;  4FZX C;  4C8M A;  2HB5 A;  5I3U A;  4CJ4 A;  3SQ1 A;  2F8S A;  2G8W A;  4B8A B;  4ZTF A;  1VSH A;  2GUI A;  1BCM A;  3AO5 A;  4YFU A;  1NK8 A;  3CG7 A;  4AHV A;  3SV3 A;  3T3F A;  3AA2 A;  4DFJ A;  3C6U A;  3NE6 A;  3NGZ A;  3DRS A;  5J2Q A;  4JRQ A;  3DMJ A;  3P5J A;  3O4Q A;  2ZD1 A;  1BGX T;  3LAM A;  3SUO A;  1RNH A;  4FLZ A;  4DQS A;  3AVK A;  4CJ3 A;  3HP9 A;  5HRN A;  2I5J A;  3K5M A;  2G8H A;  5D3G A;  4E7J A;  4KRF A;  1JL1 A;  2HNZ A;  2EX3 A;  4O0J A;  1DLO A;  1RT2 A;  3V4I A;  2XO7 A;  3OJU A;  2D0C A;  1HQU A;  2LSN A;  3HK2 A;  5KRT A;  4N76 A;  3SYZ A;  3K2P A;  1VRT A;  2KW4 A;  2IDO A;  1JLF A;  5CZ1 A;  3V1R A;  2IS3 A;  2ATQ A;  2OPR A;  3KLG A;  2OPQ A;  2KFZ A;  1YVU A;  2YKM A;  3AA4 A;  1I39 A;  4RW4 A;  3SV4 A;  4KAZ A;  1RT3 A;  4CF2 A;  3LWM A;  1N5Y A;  4FJX A;  1WSI A;  4CJS A;  2RPI A;  3RMB A;  1UA0 A;  1L3U A;  3CM5 A;  3KKS A;  4OKE A;  4CF1 A;  1WLJ A;  1IG9 A;  1TL3 A;  3HPG A;  2RN2 A;  4N47 A;  4DQP A;  1GOA A;  3M8S A;  3SI6 A;  1NJX A;  4CJQ A;  4LY7 A;  3VQP A;  2A1S A;  4FM2 A;  4IFY A;  1EET A;  4O55 A;  1D5A A;  3VQA A;  4HVJ A;  1XHZ A;  4ELT A;  4J2E A;  3K58 A;  1A5X A;  2Q3S A;  3RR7 A;  1RDC A;  4FW1 A;  1EKE A;  1J53 A;  4DF8 A;  3TAF A;  5HLF A;  4FZY A;  3ZT0 A;  3DI6 A;  4CF0 A;  5HP1 A;  5C42 A;  4CFC A;  3DYA A;  3NBP A;  1RT1 A;  4DMN A;  4I9L A;  4LH4 A;  2XY5 A;  5HRR A;  3QIO A;  2DFH A;  4Z4F A;  2RKI A;  1U49 A;  1HYS A;  3DLR A;  4CIE A;  3ZT2 A;  1NK6 A;  4FK0 A;  4HCC A;  3I0R A;  3HL8 A;  3C6T A;  3OVN A;  4NCG A;  2HVI A;  2HHV A;  3QO9 A;  4CER A;  4JLH A;  4F8R A;  4DS5 A;  5J2N A;  4DSL A;  3VQ4 A;  3AV9 A;  4AHR A;  4HTU A;  3ZSW A;  4B9L A;  3NAE A;  4DLG A;  1ASW A;  2EHG A;  1C1C A;  1ZBI A;  2YHA A;  1NKE A;  2X6N A;  3WNG A;  3SJJ A;  1Y97 A;  3HVT A;  4CGH A;  4M3U A;  1U04 A;  4F2S A;  3QIP A;  4OGE A;  1KFS A;  3G10 A;  4FJI A;  4Z4I A;  4QAG A;  4Y1C A;  3SUQ A;  4H4M A;  4HCB A;  1T8E A;  1X1P A;  1TK0 A;  5CYQ A;  3V9S A;  1RTD A;  4OPJ A;  3KLI A;  4W5Q A;  2F8T A;  3F9K A;  2FBY A;  1X9S A;  5JS2 A;  4CK2 A;  3RRH A;  3KIO A;  3NF7 A;  3JSM A;  3V9W A;  3TAG A;  2IC3 A;  4W5T A;  4B9T A;  1G15 A;  4IDK A;  3SCX A;  4PQU A;  1NJZ A;  3MXI A;  3OYK A;  1D9D A;  3EY1 A;  4J2B A;  3RRG A;  4AHT A;  1B9F A;  3VQ8 A;  2RF2 A;  1CXQ A;  2HNY A;  4KTZ A;  4C8N A;  2HMI A;  3SUP A;  1TVR A;  1IKX A;  1B92 A;  2YNG A;  1LWC A;  4LH5 A;  4CJT A;  3ZSY A;  3OYB A;  4M3Z A;  3LDS A;  3QEV A;  1WSF A;  1XI1 A;  1L3S A;  1IKY A;  4HUE A;  3EYZ A;  4DSK A;  2GBZ A;  2VG5 A;  4BAC A;  3KTQ A;  4QOZ B;  2G8F A;  2KZZ A;  2G8K A;  4Q5V A;  1W0H A;  1FXX A;  3ISN C;  3HPO A;  3QEP A;  3TAE A;  3V9Z A;  5I42 A;  3L2W A;  1I3A A;  4BE0 A;  3JYT A;  2HHW A;  3KKR A;  4OKJ A;  3C94 A;  4OGC A;  4IG0 A;  3OY9 A;  2FBV A;  1KCF A;  2YNH A;  1VSM A;  3ALY A;  2ITG A;  4KFB A;  5JS1 A;  1HMV A;  1C1B A;  1U4B A;  3P1G A;  3TAN A;  1HQE A;  4MQ3 A;  1KVC A;  3OYH A;  4DTS A;  1ZBF A;  1B9D A;  1RTH A;  3QET A;  1SL0 A;  1VSF A;  3KD1 E;  4KB0 A;  3O3F A;  3DOK A;  4J2A A;  2F96 A;  4O4G A;  1RDA A;  3U3G A;  4ID1 A;  4M45 A;  3SPY A;  1BL3 A;  3VQB A;  4DF4 A;  1LWE A;  1RBU A;  3ZSO A;  4CJF A;  3KLH A;  3WNE A;  1O1W A;  3ZSR A;  3KD5 E;  1WAF A;  3NHG A;  2OYQ A;  4KO0 A;  1S1V A;  3AA5 X;  1C6V A;  4TSX A;  3DLG A;  1RDD A;  4CGI A;  2VWJ A;  4DTM A;  3V9X A;  1NKB A;  1TGO A;  4FZZ A;  1Z26 A;  3AVL A;  2D5R A;  3ASM A;  2XHB A;  1LAV A;  1IKV A;  3V1O A;  1FK9 A;  3L2U A;  4JS5 A;  1T03 A;  1K6Y A;  4I7F A;  4ICL A;  3OYE A;  3VQC A;  5HRP A;  2HHS A;  3HP6 A;  3O3G A;  1ZBU A;  4JRP A;  1ZBL A;  3S3O A;  4O0I A;  3S3N A;  1MU2 A;  3ITH A;  3AO3 A;  3K5N A;  1Z25 A;  3RWU A;  3PO5 A;  3ZT4 A;  1RT5 A;  3NH0 A;  3OYC A;  4M42 A;  1HNV A;  1YT3 A;  2KQ2 A;  3O4N A;  4E7H A;  1XC9 A;  3VQ5 A;  4KTQ A;  2XRI A;  1NKC A;  3LP2 A;  1XHX A;  4EP4 A;  2PYL A;  1ASU A;  3M8Q A;  4CEE A;  3OYF A;  3TAQ A;  4FK2 A;  4DWI A;  2WOM A;  5EU7 A;  3VN5 A;  1TKX A;  4FJ8 A;  2IAJ A;  1NK0 A;  3V6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...