3AV9A

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
154
structure length
150
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination/inhibitor
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 57
structure length 150
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3av9A00
4ID5A 2YV0X 5T7BA 4B08A 4BE2A 5HRPA 1JXBA 3VQ9A 2OPPA 2GBZA 5C24A 4CJRA 3OJSA 4FM0A 4Z4IA 3SNNA 1K6YA 1DLOA 1ZBFA 1CXUA 1NK6A 2AJQA 1CZ9A 1LW2A 5CYQA 4CGFA 3AVLA 3QETA 1RBUA 3SQ2A 1S1TA 5J2NA 2X6NA 1IKVA 3IS9A 3SV3A 4EP4A 1TKTA 4LD0A 1S1WA 3WNGA 1T05A 4N76A 1RBRA 1XWLA 4PY5A 1XC9A 4Z4GA 3O3FA 1VSEA 4CJPA 1FKPA 4DFPA 1VSLA 1LV5A 3VQ4A 1NJZA 3SPYA 4DLGA 3SUNA 3OYDA 1NK4A 1NJXA 4FJ7A 3AV9A 4CHOA 4AHUA 1JKHA 2X74A 4HCCA 4FXDA 2HHQA 4HUGA 1U45A 1W9HA 3B6PA 4AHSA 1BGXT 3THVA 3OYFA 2P5GA 4FJ5A 3DOLA 1A5XA 3HK2A 2ZD1A 3ZSWA 3OS2A 4LH5A 4O0JA 4CJTA 4E7HA 1BQMA 2IC3A 3T3FA 4CEEA 1IG9A 1D8YA 4KHNA 2IGIA 4FZYA 4L8RB 1HYVA 1QHTA 2W42A 2FBVA 3SI6A 3L3VA 3PUFA 4DSJA 4CJWA 2OPQA 4KV8A 2ZQBA 1C0UA 2FBYA 2X6SA 3SYZA 4FYDA 4FJHA 1C1CA 4JLHA 3KK2A 1WAFA 3KKRA 2KZMA 2NUBA 1S9EA 3FFIA 4CF0A 3MAQA 4CF1A 3M8SA 1I3AA 2QXFA 2HHXA 4CEFA 1TKDA 4DTPA 4CIFA 4OPKA 3I0SA 2JGUA 3P83D 4Z0UA 3KIOA 1GOBA 4FJ9A 2HHUA 4AILC 4CF8A 4BWJA 4H8KA 3WNHA 2Y1IA 3RMAA 2G8HA 4F8RA 3SQ1A 2IS3A 4CEZA 3SJJA 1Q9XA 5HBMA 1CXQA 3TR8A 4DTNA 3I0RA 3KD5E 2KTQA 3DYAA 4KKOA 4I2QA 2YNHA 3VQAA 3QNNA 4LSLA 2FBXA 1Q9YA 3H08A 4CEBA 1TK5A 1RT6A 1YTAA 4ICLA 3OYLA 4CJLA 4IBNA 1ZBLA 2E6MA 3L2WA 4FLTA 3RMCA 4FJKA 4F3TA 1BISA 1UA0A 4HHTA 1TVRA 3IAYA 3DLGA 1LWFA 1Q8IA 3PO4A 4LH4A 3V6DA 3EY1A 4BE1A 3O4NA 5KGXA 2PYJA 5K14A 3OYKA 3VQDA 3I8DA 3CYMA 4M42A 3NGZA 1ZBIA 4FM2A 1HYZA 1VSFA 2A1RA 2ITGA 4ZHRA 3LALA 2KQ2A 1NK5A 1XHZA 2PZSA 3NCIA 3SUPA 2DTUA 2DFFA 5SWMA 2OPRA 1VSHA 2XHBA 4BDZA 1L3TA 1LWEA 1J5OA 5FRMA 4CFDA 4CGIA 3LP0A 3AA5X 5KTQA 4OVLA 4FK4A 2G8IA 4KRFA 3ZT4A 1U49A 4FZXC 3U3YA 3OYEA 4E89A 1HJRA 4B3OA 3D0PA 3LAKA 3DLRA 4BWMA 2YKNA 1TL1A 2VG7A 1Z26A 3HJFA 1KTQA 1T7PA 1VRUA 4FW1A 2OYQA 4M3YA 3KKSA 4DWIA 2P1JA 1RTJA 3KK3A 3LP3A 4CJFA 4MFBA 1J53A 5J1EA 1NKEA 4J2AA 4UQGA 4GW6A 3NF6A 3P1GA 1BI4B 1VSKA 1MU2A 2Z1JA 2IDOA 3ZSZA 1T8EA 4QOZB 4Q0BA 4O4GA 4N56A 1NKCA 2G8UA 2P5OA 2A1SA 4F2SA 3U6FA 2HW3A 4XIUA 4KHYA 3M8PA 4H4OA 4GMJB 4C8OA 1N5YA 1VSDA 4E7IA 3LP1A 3K5OA 1LWCA 3HVRA 4DTRA 3QEXA 3NGYA 5CZ1A 4OJRA 5KGWA 2I5JA 3U3GA 4FCYA 3V9SA 1KFSA 1U04A 1W0HA 4E1MA 2XY7A 2IOCA 3O4QA 1RT1A 4AH9A 4KB0A 3QLHA 3VA0A 1WAJA 1RT3A 3LP2A 4DFMA 5HLFA 3ALYA 1HMVA 1HYSA 3AO5A 3LDSA 1SKWA 2HHSA 1JLCA 3A2FA 4M3UA 1B92A 3AVKA 1QSSA 4KHSA 3IG1A 4GVMA 1KFDA 3DOKA 4DQQA 4W5QA 1NK7A 2G8FA 3ZT3A 1RDDA 2X78A 3WNFA 4FLWA 3PX4A 1RTDA 4CHQA 1S9GA 2HNZA 2Z1GA 3BGRA 2HNYA 2LSNA 3ISNC 4CJEA 4DTXA 1SUQA 3AVAA 5FROA 1TAQA 2XY6A 4W5TA 2E4LA 3TABA 2G8VA 1G15A 1RDAA 1QE1A 3ZSOA 4DF4A 1S1VA 1NOYA 4FJMA 3V9ZA 2OA8A 2HHWA 1UA1A 4OPJA 3AVMA 4HVJA 4JRQA 4CJVA 2Q3SA 1L3VA 2B4JA 4LY7A 4DG1A 1TGOA 4DSKA 3QINA 3M8RA 4W5NA 4RG8A 4HUEA 3ZCMA 4CEQA 1D9FA 3K5NA 1GOCA 3V1OA 3SZ2A 1JLQA 4RW9A 3NH1A 4KHUA 1KLMA 4DQPA 4CEOA 4B9MA 1WNSA 3VQCA 4CIGA 3KK1A 3E01A 3HYFA 3ZSYA 3JSMA 3RTVA 3MXIA 3OYIA 3NF8A 2PY5A 4KTQA 4FLVA 3HO1A 3ITHA 1B9DA 3OYHA 3ZT2A 3O3HA 3CM6A 1KRPA 5J2MA 1BHLA 1QSLA 3VN5A 3SV4A 2QKBA 4IG0A 2ATQA 1WSHA 4ELTA 1QQCA 4O5BA 1LAVA 4OLBA 1ZBUA 4QAGA 2XO7A 1TL3A 4DF8A 1X9WA 4YNQA 4O44A 3NH2A 3TI0A 3NH0A 2XY5A 2F8TA 3OYJA 3L2UA 3V9WA 2YHBA 3OYMA 3VA3A 3DM2A 3LZIA 2Z1HA 5FRNA 3ZSRA 4FM1A 1J9AA 4I7FA 4DU1A 2HB5A 3AVIA 1EP4A 1RBVA 2Z1IA 4C8NA 1BIUA 4YFUA 2R7YA 3QEVA 3TAEA 3L2VA 3ULDA 2HNDA 1BCOA 5EU7A 3DRRA 1X9MA 1D9DA 3RR8A 1D5AA 4E0DA 3L8BA 3SCXA 1BL3A 3AO2A 3C6TA 1U4BA 2OZSA 3RMBA 1KLNA 1CLQA 1GOAA 3MEEA 4N47A 1RT4A 1SKRA 4ZTFA 4E7KA 1BCMA 3B6OA 4PA1A 4Z4CA 2B5JA 2IAJA 4NYFA 3V1QA 3VQBA 2HMIA 3HM9A 3TAQA 4F3OA 4AHCA 4J2EA 1ZBHA 4B8CA 4B9TA 3DLKA 1VSJA 1BQNA 1RTHA 3OVNA 4OKJA 3F73A 3CQ8A 1NK8A 4B8AB 4DTSA 4FJJA 5HROA 3VQ7A 2D0AA 1ASUA 1WLJA 4FLXA 5SZTA 3KLGA 4MQ3A 1BI4A 1KCFA 3PO5A 4DS5A 5J2PA 1WSFA 4Y1DA 2QKKA 2XRIA 3CG7A 4FK0A 3MXJA 4J2DA 4CCHA 3HSTB 1R0AA 3AO1A 1N6QA 4DS4A 4CJSA 4FW2A 3T19A 3CFPA 4NCAA 3NHGA 4FLYA 4B9UA 1C1AA 1Z25A 3P5JA 4DSEA 4JS5A 4O55A 4RW8A 3ZSQA 3OS0A 5E41A 3S3MA 3EYZA 1REVA 4W5RA 4DQRA 1IKXA 4DTJA 1X1PA 1SL2A 3BDPA 4KTWA 4ELUA 2F96A 4FJNA 1CZBA 4BDPA 1JLAA 4E1NA 3UIQA 4I9QA 4KTZA 3QIOA 3AA3A 3V9XA 1DTTA 2HHTA 4WE1A 4M3XA 3LWMA 4IFVA 4I2PA 3CFRA 1TKXA 1IO2A 1LAWA 2OPSA 3NF9A 3KLIA 2D0BA 3M8QA 1WSGA 1L3SA 4Z4FA 5I42A 4FJIA 4LSNA 4OKKA 4AHTA 4CHYA 3LWLA 3L2RA 1X9SA 2RPIA 3DMJA 1TKZA 4IG3A 4EP5A 1XI1A 3DLHA 1RT7A 3SUQA 4EZ9A 1SV5A 2VWJA 1FK9A 4NCGA 4CK1A 4AHRA 4BE0A 4DTMA 1T03A 2OZMA 3KLFA 1C6VA 2DY4A 4W5OA 3K5LA 4M41A 5C42A 1NK0A 3ZT0A 3AA2A 3V81A 4DQSA 1S6QA 1Y97A 3NBPA 3LPTA 1C0MA 3T1AA 3KJVA 1JL2A 4ELVA 4FJLA 3MEGA 1VSMA 2O4GA 1JLEA 4KI4A 1I39A 3TAMA 1QSYA 3DLEA 3ZSXA 3OYBA 4AHVA 1ITGA 3S3NA 4DLEA 1UWBA 1EX4A 4PQUA 3NE6A 4R5PA 3AO3A 4BACA 4CJ4A 4Y1CA 4KI6A 3RMDA 2HVHA 2HVIA 4DMNA 1QTMA 2JLEA 1LW0A 4N41A 4OKEA 1IKWA 2GV9A 4HUFA 3SQ4A 2ZE2A 4M3ZA 4DTUA 4NCBA 3IRXA 2BANA 4CIEA 4K8XA 4FLZA 3QEWA 2DFEA 3QO9A 4CJKA 4CJ3A 1NJYA 1YTUA 3OYCA 1FKOA 3SQ0A 4CK3A 4NYNA 1NJWA 2D5RA 4ID1A 5C25A 1RDBA 2EHGA 3LANA 1S1XA 4KAZA 3OY9A 4M3WA 2YKMA 1TV6A 2Y1JA 3AA4A 1IH7A 1C0TA 3AVGA 4CJ5A 3C94A 4DFKA 4DSIA 1S1UA 4FJGA 2FC0A 2VG6A 4CF2A 1VRTA 1WSIA 5HP1A 4ZTJA 1HQUA 4KFBA 2HHVA 3L2QA 3OYAA 3JYTA 3L3UA 5I3UA 3K57A 3LZJA 3K59A 3AVJA 3D45A 1RBSA 1S6PA 3TWHA 4B9NA 3DRPA 3MXMA 1JLFA 4FK2A 5JS1A 1HNIA 2ETJA 3RWUA 4B9LA 1IKYA 3VQEA 3TAGA 2D0CA 1VSIA 5DK5A 1RTIA 1XHXA 3KLEA 3KTQA 2EX3A 4E7LA 2BE2A 3TARA 3KLHA 4H4MA 1RDCA 4M45A 3EZ5A 3V9UA 3VQ5A 4CHNA 3PX0A 5KI6A 1F21A 3DI6A 3TANA 5FDLA 1L3UA 3ASMA 4QCLA 2WONA 4C8LA 2RN2A 3MECA 4CJUA 1JL1A 4CECA 2P51A 3HVTA 3SUOA 3HT3A 4DQIA 5KRSA 4FVMA 4BDYA 1WSJA 1C1BA 3KD1E 3QEPA 4I9LA 4PWDA 3HP9A 2YNFA 2QK9A 3OYGA 3K58A 5HRSA 4DSFA 3QEIA 4C8MA 4FJ8A 5D3GA 3TAFA 1EXQA 5KRTA 3O3GA 3WNEA 1HRHA 1NKBA 4F2RA 1TAUA 3HPHA 4CHZA 2FBTA 4RW6A 3VQ6A 2KZZA 4CESA 4FZZA 4DU4A 4HCBA 2VWKA 1U48A 1HNVA 1QS4A 1VK0A 4CJQA 1S5JA 4KO0A 3F9KA 1WSEA 1SL1A 2RF2A 2KFNA 1NK9A 1YVUA 4Z4HA 4CE9A 4J2BA 2XY8A 4IKFA 4F4KA 3V1RA 4CGJA 1FXXA 4CGGA 3AVCA 4B9SA 5HRNA 3RRHA 3PV8A 1DTQA 4DU3A 3NFAA 4KPYA 1TK8A 3QNOA 1KSPA 1TK0A 1JXEA 1SL0A 2G8KA 2BDPA 1KVBA 4CFCA 2PYLA 1ZYQA 4CERA 3VQQA 4CHPA 2WOMA 4OLAA 4KREA 1RBTA 3K2PA 1A5VA 1JLBA 3MEDA 1HPZA 2E6LA 2KW4A 3CFOA 3VQ8A 4N5SA 3HXMA 4JS4A 3QESA 3AVBA 3QERA 4KHWA 4E7JA 3S3OA 4RW7A 1YT3A 1WN7A 3RRGA 3LAMA 4IDKA 1ASWA 4CGHA 4CEDA 4E19A 3QIPA 1KVCA 3HPOA 4KHQA 5HRRA 4CFBA 4C8KA 5CZ2A 2VG5A 4DTOA 4OGEA 1EETA 3RR7A 1RILA 1UOCA 3K5MA 3V4IA 4K8ZA 4DSLA 3AVNA 5DMRA 1L5UA 3C6UA 2GUIA 3NAEA 1A5WA 2O4IA 3NGIA 2YNIA 4HTUA 5JS2A 4Q5VA 4OGCA 1EKEA 3ZSVA 4E3SA 2RKIA 3G10A 2YNGA 4G1QA 4O0IA 4CFAA 3AVFA 3HP6A 1J54A 3PY8A 4JRPA 3AO4A 4CK2A 3OJUA 4DFJA 3NDKA 2G8WA 1NOZA 3DRSA 4B9VA 4M3TA 2KFZA 2F8SA 1RNHA 3AVHA 3VQPA 3OYNA 1ASVA 3HL8A 4CEAA 4FLUA 4FJXA 1U47A 4EZ6A 2DFHA 2BGGA 3LPUA 3C95A 4PUOA 3PX6A 4Z4EA 1SKSA 1JLGA 5CYMA 4KB1A 3HPGA 1B9FA 3DLBA 1BIZA 1RT5A 4TSXA 1HQEA 3CM5A 2B6AA 2YHAA 3NF7A 1RCHA 4M3RA 3ZT1A 4CGDA 3OS1A 4CF9A 3SPZA 1KVAA 1O1WA 4IFYA 3S9HA 4RW4A 1RT2A 3G0ZA 5CY4A 1UAXA 3TAPA 5J2QA
chains in the Genus database with same CATH superfamily
3HSCA 1BA1A 2GBZA 3OJSA 4FM0A 2W6LA 1NBWA 1NK6A 1VQKN 2AJQA 1VQ7N 5CYQA 2IVNA 3VEYA 4EP4A 2I7PA 1S1WA 3MDQA 1VSEA 3G71N 5JICA 5GAGP 3FE1A 4DLGA 3SUNA 1QHAA 1NK4A 4FJ7A 3AV9A 2YCHA 4C1NK 4FXDA 4HCCA 5FPNA 2QWMA 3A5OC 1W9HA 1YITN 4YORA 4CZEA 4GV6A 3HK2A 2ZD1A 2ASPA 3ZSWA 4LH5A 3OS2A 1BQMA 3WT0A 1D8YA 4IO9L 4FZYA 4DR7K 4IDHA 1HYVA 2FBVA 5AQPA 2FBYA 3CCUN 3KK2A 1BO5O 2GELA 3EEQA 3EZWA 1V4SA 1Y64A 4CD1A 1WAFA 2NUBA 2FSNA 4CF1A 1I3AA 2QXFA 1Q82O 4DR4K 3QMLA 2HHXA 5FPDA 4Z0UA 2HHUA 3SJHA 4CF8A 2G8HA 3SQ1A 3SJJA 1Q9XA 5CHIA 1CXQA 2KTQA 3DYAA 1N34K 2O8CB 3QNNA 2IIRA 4CEBA 1TK5A 2NLXA 1UA0A 3IAYA 3DLGA 3EY1A 3O4NA 5KGXA 3VQDA 2JWLA 4M42A 1ZBIA 4FM2A 2ITGA 4ZHRA 2KQ2A 3SUPA 3UE5A 4M63C 1HJOA 5FRMA 1L3TA 4CZFA 4PKIA 4NLCA 5IWAK 3U9DA 3SBGA 5KTQA 1U49A 3TSUA 4E89A 4U7BA 3T69A 1T7PA 2OYQA 4M3YA 1OH6A 1Q86O 1J53A 5J1EA 4J2AA 4GW6A 4BY9C 3CCLN 4QOZB 3T1HK 4Q0BA 4O4GA 2VGNA 4N56A 4H0XB 5BRFA 2G8UA 1NU0A 2VWBA 2Q0RA 4KHYA 4IEIA 2HMPA 2CH5A 4BRFA 4LF8K 5CZ1A 2QWNA 4OJRA 5KGWA 3U3GA 4FCYA 1KFSA 2XY7A 3P31A 3P4IA 4PKGA 3QLHA 1YAGA 5LY3A 4DFMA 5M1KA 2PAVA 2YI1A 3AO5A 3LDSA 1SKWA 3A2FA 4YOWA 3IG1A 4DQQA 1NK7A 2O8BA 4FLWA 2WFBA 2A3ZA 5LJWA 4DTXA 3AVAA 1TAQA 4BRLA 3TABA 4FWSA 4FJMA 3V9ZA 2FSJA 3FLCO 5M1PA 2Q3SA 2A6AA 4LC9B 4LY7A 4DG1A 3ZCMA 4CEQA 3CC7N 5AQVA 5BN9A 4H5VA 1GOCA 3N4PA 4RW9A 2UYTA 4BRMA 3VF6A 2NRZA 4JV5K 3NF8A 3HO1A 3CERA 3ITHA 3VF4A 1BHLA 1QSLA 2ATQA 2PFUA 1ZBUA 3KWGA 2XO7A 4WCEL 2F4VK 3MX5A 4JKBA 2Q1NA 2YHBA 4A2BA 3CI5A 2GTDA 3LZIA 2HF4A 5FRNA 4JD2B 5DM7L 4FM1A 1J9AA 4ILJA 4C23A 4B3TK 1RBVA 5B8HA 2FSKA 2Z1IA 1BIUA 4DHYA 4YFUA 2R7YA 3QEVA 3LDLA 3RR8A 2J4RA 4WQ5C 3TSQA 1YXQA 3AO2A 3C6TA 1U4BA 3RMBA 1VHXA 2QWPA 1YUWA 1RT4A 1SKRA 3QICA 3B6OA 3VGLA 4Z4CA 2B5JA 5GADP 4A61A 3V1QA 3VQBA 4PHTX 4B8CA 4B9TA 3DLKA 1NK8A 2BUPA 4DTSA 2ZJPL 3VQ7A 2D0AA 1WLJA 4FLXA 3GBTA 1OH5A 1BI4A 3O1BA 2YHWA 1KCFA 4H5WA 3PO5A 5J2PA 1WSFA 1ESVA 4IXCA 5ADXH 3CFPA 3NHGA 1C1AA 1Z25A 3AGRA 4O55A 4RW8A 4YHHK 2P9LB 3S3MA 4W5RA 4K42A 1NG9A 1TYQB 4FJNA 4FPAA 3BZKA 2V7ZA 3WUHA 2E20A 2HHTA 3FFKB 3H1QA 4OPHA 3LWMA 2OPSA 1ZBSA 2D0BA 4BVOA 4Z4FA 5I42A 1XI1A 2P9UA 3DLHA 1Z6RA 1FK9A 4B9QA 1T03A 5AQZA 1C6VA 1NK0A 2W40A 3KVGA 3QBXA 5C42A 4DQSA 1S6QA 3T1AA 3W0LA 3KJVA 4KI4A 3TAMA 3UKRA 3ZSXA 5C12A 1ITGA 3M1FA 3E1YA 3ZX3A 4PQUA 5EX5A 4CJ4A 4KI6A 2E1YA 1CZAN 1IKWA 5JVGL 4M3ZA 2ZE2A 4CIEA 3PIPL 4FLZA 1BG3A 3DXMB 3OYCA 3SQ0A 2P9SA 1NJWA 2D5RA 4ID1A 5C25A 1OKJA 1S1XA 4AM6A 4KAZA 4M3WA 3HBTA 3CIPA 4DV4K 2YKMA 1TV6A 4CF2A 2UXDK 3L3UA 3NVMA 3TWHA 4B9NA 3THYB 1RBSA 1JLFA 2ETJA 5DK5A 3TARA 3CCEN 2BE2A 2NRWA 3A5LC 1Q18A 2NRHA 4WQ5A 5KI6A 3I8BA 1F21A 3TANA 1MDUB 3GL1A 2P51A 4BRPA 1NGEA 3HT3A 4DQIA 5KRSA 3HM8A 4FVMA 1WSJA 3HOSA 3KD1E 4I9LA 1NNEA 2QK9A 4JAXA 5M1QA 4QS7A 5D3GA 3THXA 5AQMA 1HRHA 1NKBA 4CHZA 4YOTA 4MO4A 4RW6A 3VQ6A 3A5NC 2P9PB 4MLHA 2VWKA 1C0GA 4EIAA 1HNVA 1WSEA 1NK9A 1YVUA 4Z4HA 1Z05A 4H0OA 4J2BA 2XY8A 4IKFA 2W41A 3O4WA 3AVCA 3VEXA 3RRHA 4JK9A 1KSPA 3BP8A 1P8ZA 1BWFO 2WOMA 3MEDA 1RBTA 3JS6A 2KW4A 4JS4A 4MLEA 4KHWA 4H5TA 3RRGA 3I55N 2VQEK 1KVCA 2P9KB 4FWNA 1UOCA 2GUIA 3NAEA 2KHOA 3SBTA 1EKEA 4A2AA 3G10A 2QI2A 2YNGA 4O0IA 3AVFA 1GLFO 4ISEA 4JRPA 3AO4A 4GNIA 2F8SA 3O9QA 3VQPA 4FJXA 4CZKA 1MA9B 3GE1A 4JKHA 5JVHL 4PUOA 4NXMK 3L4QA 4KBOA 1SKSA 3W3DA 3C6AA 1B9FA 4O5FA 3J7YP 4RCHA 1HQEA 3CM5A 3VPZA 3CPWM 4CW7B 4M3RA 4CZJA 1VQ4N 1O1WA 1RT2A 4CZHA 1NLVA 2QWRA 4BE2A 5HRPA 2OPPA 4C1NI 2F7TA 5C24A 4CJRA 1GLBG 4JI3K 1ZBFA 2X6NA 1IKVA 3WNGA 1K9MO 1ATRA 1RBRA 1XWLA 1FKPA 1VSLA 3VERA 3HZ6A 4LF7K 3VGMA 1LV5A 3VQ4A 1NJZA 2HHQA 4HUGA 3B6PA 2NRTA 1BGXT 3AAQA 4B1ZA 3OYFA 4FJ5A 3N4QA 1A5XA 1BDGA 3AAPA 4CJTA 2IC3A 4JHDB 1IG9A 4FWLA 4XH4A 5AQRA 4FWPA 3K9JA 2W42A 2D4WA 3SI6A 3PUFA 4DSJA 2OPQA 4KV8A 2ZQBA 3SYZA 2BTFA 3HOTA 4FJHA 5GIOA 2Q2RA 2KZMA 3FFIA 4CF0A 3MAQA 3M8SA 5LJVA 1TKDA 3I0SA 3P83D 3CHWA 4JKFA 2IS3A 3TR8A 3KD5E 4KKOA 2P9IA 1BU6O 2YNHA 3ID6A 2RHKA 4V19S 1GLJO 4LSLA 2FBXA 2FLOA 3FGUA 1Q9YA 3H08A 3OYLA 4CJLA 4IBNA 3L2WA 2F9WA 4FLTA 1H1VA 4JI6K 3D2EA 5AQQA 1LWFA 4LFCK 1Q8IA 1E3MA 5CR4A 4BE1A 5K14A 3OYKA 3O08A 5JMVA 3QFUA 3D2FA 1WUAA 4DV5K 3EE9A 1XHZA 3CXCM 3WXLA 1S72N 2DTUA 1WBBA 2OPRA 1VSHA 4BDZA 1KD1O 1J5OA 4H03B 1KAXA 3CMEN 4WQ4A 5BPMA 3AA5X 4OVLA 5GAHP 3ZT4A 4FZXC 3U3YA 3OYEA 4DUZK 4IZ9A 3D0PA 1Z26A 3HJFA 1VAZA 3JAMO 4FW1A 5AZJA 2O8DB 4F9OA 4UQGA 3NF6A 3T1YK 3ATVA 5ELZA 1NKCA 4B1XB 3CJCA 3U6FA 3MN7A 4XIUA 3M8PA 1VSDA 3AY9A 3K5OA 1LWCA 3FZHA 2VYPA 3QEXA 1GLDG 2I5JA 4E1MA 2CGJA 2IOCA 1S3XA 3R6MA 1WAJA 1OH8A 2NZTA 3LP2A 3GG4A 4GVEA 4CBUA 1HMVA 4GV9A 1MWKA 4B3RK 1B92A 3AVKA 1QSSA 4KHSA 1ZBHA 1KFDA 3ZT3A 3WNFA 4CHQA 1QQNA 2LSNA 3ISNC 4CJEA 1ILYA 1SUQA 4BC4A 2G8VA 1QE1A 4DF4A 3AVMA 5AFUA 4JRQA 4CJVA 2B4JA 2KKZA 4Z94A 1TGOA 4JI8K 4W5NA 4RG8A 4HUEA 3K5NA 3J7ZO 3NH1A 1KLMA 4CEOA 4B9MA 1WNSA 3KK1A 4CIGA 3E01A 3JSMA 3ZSYA 3MXIA 3OYIA 4KTQA 4FLVA 3BF3A 2E8AA 1B9DA 2HF3A 3CM6A 5J2MA 1VQ8N 5GAEP 3VN5A 3SV4A 4H0PA 2O8CA 1LAVA 5BREA 4FOEA 1X9WA 4O44A 3M5RA 4BC5A 3MN6A 4K0KK 3OYMA 3DM2A 4JNEA 1VQON 3ZSRA 3WEEB 1VQ6N 3RSEB 3GOIA 1SZ2A 1JCGA 1E4GT 1RDUA 4C8NA 3TAEA 4LF5K 3ULDA 5EU7A 2OANA 4YY3K 3DRRA 3CETA 1D5AA 4M7YA 3PIOL 3OBYA 4MDBA 4NO7A 3U9ZA 4EAHD 1NGHA 3MEEA 4N47A 4M7XA 2A41A 4E7KA 3PLAA 1JCFA 3L0QA 3TAQA 4J2EA 4AHCA 3ENBA 1BQNA 1KXPA 1Q81O 2QWLA 1KAYA 4FWQA 4B1UB 4DS5A 2QKKA 4FWOA 1M90O 3SMSA 3MXJA 3THWB 2AA4A 4CJSA 4FW2A 4FLYA 1NMDA 3BZCA 2UXCK 3OS0A 1IKXA 1SL2A 4ELUA 2HSTA 4OPAA 4KTZA 3V9XA 4WE1A 3G25A 4KH5A 1TKXA 4FOIA 1LAWA 1XUPO 4QS8A 1WSGA 3Q7BA 1L3SA 3U8XA 4CHYA 2E2NA 3L2RA 3DMJA 4EP5A 1O13A 1RT7A 4KH6A 3SUQA 4EZ9A 2VWJA 2YX6A 4AHRA 4CK1A 2OZMA 2O8FB 4W5OA 3K5LA 1ATSA 2D1KA 1P90A 1DEJA 1QSYA 3OYBA 4AHVA 2VCPA 1UWBA 1EX4A 3VENA 3AO3A 4UY8O 3RMDA 1HUXA 2HVIA 1QTMA 2JLEA 3DJCA 4OKEA 5MLCQ 2GV9A 3QBWA 4BREA 4DTUA 4NCBA 2BANA 4K8XA 4K43A 3QEWA 1NJYA 4JD2A 4NYNA 2EHGA 3LANA 1T3VA 3WXJA 2Y1JA 1GLAG 4X66K 3AVGA 4CJ5A 3C94A 4DFKA 1S1UA 2FC0A 1KAZA 2VG6A 1WSIA 5HP1A 4BGAA 1RGIA 3L2QA 3OYAA 3H45C 3K59A 4FK2A 1HNIA 4HWIA 3RWUA 4JI5K 3KTQA 3CCMN 1YHQN 3TU5A 1VSIA 2FF3B 2A5XA 2EX3A 5M1NA 1ATNA 3R1XA 4WFNL 1K8KB 3CJ7A 3KWIA 1RDCA 4H4MA 3KLHA 3V9UA 4JYAK 3A5MC 1L3UA 5FDLA 1FW6A 2WUSA 3HVTA 5AQTA 4BDYA 1C1BA 2D0OA 3QEPA 4PWDA 1W7AA 2AP1A 3K58A 5HRSA 3CPEA 4LF4K 4FJ8A 3TAFA 5KRTA 5FPMA 4WF9L 3WNEA 4BQZA 1EQYA 4AQYK 1GLCG 3LL3A 4DU4A 1QS4A 2P9LA 2KFNA 1S5JA 2QTDA 2RF2A 2ASOA 1TYQA 4F4KA 3V1RA 4CGJA 2CGLA 5GINA 2PBDA 1R59O 4Y0WA 4IOCL 4DU3A 3NFAA 1TK8A 1X3NA 3QNOA 3F9MA 1TK0A 1JXEA 1NMNA 1KVBA 1RDWX 1ZYQA 4CHPA 4KREA 4OLAA 1EWRA 3CFOA 4N5SA 3HXMA 3AVBA 2E2OA 3S3OA 1YT3A 4IDKA 4CGHA 4CEDA 3QIPA 4RTFD 3HPOA 3D6RA 5HRRA 4C8KA 4DTOA 2VG5A 1RILA 3FZLA 4K8ZA 5E84A 4DSLA 3AVNA 1L5UA 4CBWA 4BG8A 4WFAL 4AF1A 4H5RA 2YNIA 4K25A 4Q5VA 4HTUA 4OGCA 3ZSVA 5F1XA 3NVKA 2CH6A 2RKIA 4YOXA 4CFAA 2I7NA 1HLUA 5EOYA 5LMUK 3OJUA 4DB3A 4B9VA 4M3TA 1DGKN 1RNHA 1ASVA 4FLUA 5AQGA 3J81O 4A57A 4A5BA 4LF6K 3PX6A 1KC8O 5AQOA 3DXMA 1BIZA 4TSXA 4L3QA 4B1WB 3NF7A 3I56N 3UB5A 4CGDA 3CCRN 3OHRA 3H46O 4CF9A 3ENHA 1YJNN 5CY4A 5KPRA 2D0PA 1NGBA 4IFEA 2ITMA 5T7BA 4B08A 4YOYA 4I6MB 4CVNE 4BR5A 3THYA 5HOOA 2UUBK 1GLEG 4Z4IA 3SNNA 1CXUA 1CZ9A 1LW2A 4CGFA 3AVLA 4IOAL 1LCUA 1RBUA 1S1TA 5J2NA 4I9QA 3H1VX 4N76A 1TKTA 5AQUA 4BG9A 4PY5A 4Z4GA 4CJPA 4DFPA 2UUAK 3DLLL 3M6GA 3DXKB 3MK6A 1NJXA 4OO1J 4AHUA 1JKHA 5DM6L 1U45A 1N36K 2HBLA 3THVA 1XMOK 3DOLA 4O0JA 3T3FA 2P9PA 3MX2A 2V51B 2UU9K 3VTHA 3IUCA 2IGIA 3L3VA 4DUYK 1OVQA 3C65A 1C0UA 2X6SA 3QFPA 1C1CA 4JLHA 4DR1K 4ISFA 4JKCA 3KKRA 4B3MK 3H6EA 5I9EB 2OTLN 1YJWN 4FL9A 4BRCA 4OPKA 1YJ9N 2JGUA 4FJ9A 3KIOA 1GOBA 4AILC 4O8KA 2Y1IA 4H8KA 3RMAA 4F8RA 1WBDA 4BR7A 1WB9A 1XNQK 5AJ3K 4I2QA 4JKEA 2P9KA 2ZF5O 1HKGA 3HI0A 4ICLA 4JKGB 1ZBLA 2E6MA 4BROA 1DT9A 4FJKA 1BISA 4F3TA 1TVRA 5AFUH 3PO4A 5C15A 4LH4A 3V6DA 2PYJA 1VQPN 3VESA 3NGZA 1HYZA 2E88A 5EXWA 3WQUA 3EKUA 3LALA 2PZSA 3CCQN 3QDKA 3NCIA 1W97L 2DFFA 4YDUC 5SWMA 1LWEA 4YOVA 3ULEB 1W2BM 5FLXO 4FK4A 4DQ8A 1T6DA 4DR2K 1V4TA 4B3OA 3DLRA 5AQLA 1KTQA 1VRUA 3EE8A 1LOTB 1NKEA 4H0TB 1T8EA 3ZSZA 1VSKA 1MU2A 2Z1JA 3O6WA 3MWTA 3AGKA 2A1SA 4F2SA 2P9NB 3VEWA 4GMJB 5AQFA 1U2VB 4E7IA 3LP1A 4DTRA 5BRHA 1C0FA 3PSIA 1W0HA 1ZC6A 3O4QA 3IDHA 1RT1A 4AH9A 4KB0A 5LL6Z 3IMXA 1VQLN 3O8MA 1HNZK 3G6EN 5BN8A 3ALYA 1SS6A 2HHSA 1JLCA 3CJBA 4GVMA 3DOKA 3VTIA 2A42A 2G8FA 3C0BA 5AR0A 1S9GA 2V7YA 2ZWHA 3BGRA 1XMQK 2HNYA 4JHDA 4DV3K 3MMVA 3ID8A 2XY6A 4GY2B 2H3GX 1NOYA 4DCHA 4HVJA 1L3VA 2OTJN 3QINA 3M8RA 1EO1A 3WXKA 1D9FA 3V1OA 3SZ2A 1JLQA 4KHUA 3VGKA 3TSPA 4DQPA 3VQCA 2PY5A 3CD6N 3ZT2A 1OH7A 3O3HA 1KRPA 2E1ZA 4DV0K 4ELTA 1HX1A 1WSHA 1QQCA 3UKUB 1TL3A 5ADXA 4DF8A 1WOQA 3TI0A 3NH0A 3OYJA 3V9WA 3VA3A 2Z1HA 1HNXK 4I7FA 4DU1A 2HB5A 4BRDA 4BRNA 3VEOA 5IT9O 3L6QA 4CZLA 3L2VA 1BCOA 3T7ZA 1D9DA 4E0DA 5AQSA 3HTVA 2OZSA 1KLNA 1CLQA 4JKDA 5AQIA 4PA1A 4MDAA 4NYFA 3O9TA 3HM9A 4F3OA 4YDUA 3C7NB 2V52B 4BRHA 1VSJA 3OVNA 4OKJA 3CQ8A 1N32K 4FJJA 4HTLA 2O8DA 2O8EB 1HKBA 3KLGA 4IEEA 4Y1DA 2Q0UA 2XRIA 3CG7A 5AQYA 1R0AA 3AO1A 1N6QA 4DS4A 3T19A 4NCAA 3P5JA 3ZETB 4DSEA 1BUPA 4JS5A 3ZSQA 3E9PA 3EYZA 4IJAA 1X1PA 4KTWA 1CZBA 1IBLK 4E1NA 3TTFA 5AZIB 3KHYA 4O8UA 4XH1A 1DTTA 4G9ZA 4R79A 4IFVA 3VOVA 2BH1A 4I2PA 3CFRA 3WQTA 3KLIA 2E2PA 4FJIA 4LSNA 4PL7A 2FF6A 3U4LA 1J6ZA 1X9SA 2RPIA 1T6CA 4IG3A 3CCJN 4PKHA 4XH5A 4BE0A 4DTMA 3AA2A 5E26A 4ELVA 1GLLO 4FWMA 3MEGA 1I39A 3P39A 3DLEA 3CJ9A 4OX9K 4DLEA 1N8RO 1MWMA 3NE6A 4R5PA 3MWPA 3ZEUB 2HVHA 5M1OA 2YJEA 4DMNA 1LW0A 4N41A 1NGJA 2A40A 4HUFA 3IRXA 3C6HA 4DV1K 3QO9A 4CJKA 3JXUA 1YTUA 5FPEA 4MO5A 3WEEA 4FWRA 3OY9A 3RSEA 3O9UA 3L4IA 3AA4A 3D7EO 1IH7A 4FJGA 2HOEA 3SAFA 3K57A 4A62A 3LZJA 3AVJA 3D45A 1S6PA 3DRPA 3EO3A 4B9LA 3VQEA 3TAGA 1RTIA 3MN9A 4JI2K 3VQ5A 3DI6A 5EY4A 3ASMA 4QCLA 2WONA 2ASMA 3MECA 1JL1A 3KK7A 5BR9A 4CECA 4ILHA 3CCVN 3CJAA 3WXMB 5CE3A 3HP9A 5AQJA 4LFBK 1YF5L 3OYGA 3HRGA 3MN5A 4JK7A 3THWA 1JJ2M 4FWKA 1QQOA 1IBKK 3CF5L 3HPHA 4JI0K 2FBTA 3CJ1A 2KZZA 4A59A 2QW9A 2DPNA 3E66A 3AARA 1U48A 3S41A 1VK0A 3K0SA 1Q7YO 4KO0A 3F9KA 1SL1A 1K8AO 3TTDA 1YIJN 4CE9A 3ATUA 3K9KA 4CGGA 4BGBA 3DAWA 4B9SA 5HRNA 3PV8A 2OCEA 3K2PA 1JLBA 3VQ8A 1HPZA 4DKWA 3O9RA 3OBWA 4E7JA 4BC3A 4RW7A 1ASWA 4E19A 4B3SK 4KHQA 4CFBA 1NGGA 2O8FA 1EETA 3RR7A 3K5MA 3V4IA 5DMRA 4BRQA 2O4IA 3R9PA 2W6KA 3EL2A 4E3SA 4G1QA 1J54A 1KQSM 4DFJA 3NDKA 2G8WA 1NOZA 3DRSA 3AVHA 3HL8A 4CEAA 2DFHA 5C0YA 4JI7K 5H1SQ 3HPGA 3BEXA 1RT5A 2B6AA 3A8YA 2YHAA 4CZIA 3OW2M 2NNWA 3ZT1A 3OS1A 3SPZA 1KVAA 3G0ZA 1UAXA 2QWQA 4ID5A 2YV0X 3WXIA 1JXBA 3VQ9A 1NGIA 3ENOA 1K6YA 1DLOA 3VF2A 3QETA 4KH4A 3SQ2A 2OA8A 1K8KA 3IS9A 1T05A 3SV3A 4LD0A 1XC9A 4DR5K 3O3FA 2NRRA 4BRIA 5JLFA 1NJIO 3SPYA 3OYDA 4CHOA 2X74A 1IJJA 4AHSA 3G4SN 2P5GA 4H0YB 4DV7K 4LF9K 2O8BB 4ILGB 4GKJK 5AQKA 4E7HA 4WFBL 4CEEA 1M1KO 4KHNA 2ZM6K 4JI1K 1DKGD 4L8RB 1QHTA 2ZJQL 4CJWA 3FR0A 3ZX2A 4FYDA 3SK3A 3ZX0A 3FZKA 2HHHK 1S9EA 4FPBA 4JEPA 3A0IX 4CEFA 5KQ8A 4IO8A 4CIFA 4DTPA 4BWJA 3CQYA 3WNHA 1VQMN 1VQ9N 4CEZA 1N33K 2KLAA 3H3OB 5HBMA 3SAHA 2QM1A 5JLHA 4DTNA 3I0RA 3Q7CA 3OA9A 5C2DA 2IVOA 3VQAA 3LDOA 1XC3A 1RT6A 1EWQA 3O80A 1YTAA 2NRXA 3RMCA 4HHTA 4X65K 4FVUA 3CC4N 1HR0K 3I33A 3I8DA 3CYMA 4LFAK 2UXBK 2A1RA 1VSFA 2YJFA 1NK5A 4YOUA 4EHUA 1NGFA 2XHBA 4CFDA 4CGIA 4IJNA 3LP0A 2G8IA 4KRFA 3IFRA 1HJRA 3TTCA 3O5BA 3LAKA 4BWMA 2YKNA 1TL1A 2VG7A 1QVFM 3KKSA 4DWIA 2P1JA 1RTJA 3KK3A 3LP3A 4CJFA 5KQDA 4B1VA 4MFBA 5AQWA 3FZMA 5C10A 3P1GA 1BI4B 1NWKA 2IDOA 2YHXA 4I6MA 4WYBA 4RWTA 3OTOK 2P5OA 3LDQA 2HW3A 4H4OA 4C8OA 1N5YA 3HVRA 3NGYA 3V9SA 1U04A 3CCSN 5TKWA 3DXKA 4DV6K 2QXLA 3VA0A 1RT3A 2HBMA 3TPQA 1NGCA 5HLFA 1QQMA 1HYSA 4CJ7A 1NM1A 2QWOA 4M3UA 4W5QA 3PX4A 1RDDA 2X78A 3M3ZA 1RTDA 2Z1GA 2HNZA 1QZ6A 3PSFA 2EWSA 5FROA 1BA0A 4XEIA 2P9UB 2E4LA 3R3LA 4W5TA 1G15A 1RDAA 5EVZA 3ZSOA 1S1VA 2HHWA 1UA1A 4OPJA 4DSKA 3VEZA 3NMUA 4BC2A 2CGKA 5AQNA 4NLBA 4QS9A 4X62K 3IKMA 3UKRB 3RTVA 3HYFA 5C2FA 5HL7L 2GUPA 1XNRK 3OYHA 4BVPA 1D4XA 4IG0A 4O5BA 4OLBA 4QAGA 2YHYA 4YNQA 3R8EA 3NH2A 4JKGA 2ZJRL 3EN9A 3J8AA 5BRDA 2XY5A 3ZLJA 2F8TA 3L2UA 2QA4N 4H0VB 4BQLA 2P9SB 4FO0A 2GWKA 4KHPK 3AVIA 1G99A 1EP4A 3F2KA 2HNDA 4CI6A 1X9MA 3L8BA 3SCXA 1BL3A 2Q36A 3ULEA 1GOAA 3LDNA 3KZBA 4ZTFA 1BCMA 5M1FA 2IAJA 2HMIA 3VMFB 5AQXA 2VGMA 3F73A 1RTHA 3MCAB 4B8AB 1ZXOA 5HROA 1ASUA 1IV0A 4PL8A 1JCEA 5SZTA 4MQ3A 4NXNK 2WTUA 1SQKA 5AQHA 4FK0A 1HKCA 3GDQA 3E9LA 4CZGA 1IBMK 4J2DA 3P38A 4CCHA 2P9NA 3HSTB 3THXB 1U2VA 4CD3A 5KPZA 4B9UA 4GV3A 1OVYA 1VQNN 5E41A 1REVA 3SMPA 4DQRA 3CMAN 4DTJA 3BDPA 5BPLA 3CQXA 3VETA 2F96A 1X3MA 4U67L 4BDPA 4GKKK 1JLAA 3UIQA 2QEXN 3QIOA 3AA3A 1T44A 4NB4A 1QVGM 4M3XA 3O1WA 4H5NA 2NRVA 1IO2A 3NF9A 3M8QA 3BY5A 5BR8K 4OKKA 4AHTA 4WQ4C 4IOXA 3LWLA 3EKSA 1TKZA 1TUYA 1SV5A 4NCGA 3E9OA 3KLFA 1NGAA 2DY4A 4M41A 2WC9A 3ZT0A 3V81A 1Y97A 3NBPA 3LPTA 1C0MA 4FJLA 1JL2A 1VSMA 2O4GA 2UUCK 1JLEA 2IVPA 4JI4K 2GWJA 4JKAA 3S3NA 1VQ5N 2E2QA 4BACA 4Y1CA 3BUZB 1BOTO 3CC2N 3UKUA 3SQ4A 3SLCA 5TKYA 4X64K 2DFEA 1S22A 4CJ3A 3ZYYX 1FKOA 4CK3A 1RDBA 2VQFK 3SAGA 4BRKA 1C0TA 2GX9A 4DSIA 3DWLA 1VRTA 3B8AX 4ZTJA 1HQUA 4KFBA 2HHVA 2WBNA 3JYTA 5I3UA 4BR9A 5F0XA 1NGDA 4JK8A 3MXMA 5JS1A 4ISGA 1FJGK 2GEMA 1IKYA 2D0CA 1XHXA 3KLEA 4E7LA 3EZ5A 4M45A 3C7NA 4E1JA 4CHNA 3PX0A 4EFHA 1HNWK 4C8LA 2RN2A 4CJUA 1QZ5A 2Q31A 2O8EA 1RFQA 5KPTA 3SUOA 1YVNA 4EHTA 2YNFA 4K41A 3LM9A 2Q97A 4DSFA 1X9JA 3QEIA 4C8MA 3J80O 2HBKA 1EXQA 3LM2A 3O3GA 1TAUA 4F2RA 3ZETA 4CESA 4FZZA 4DR3K 4HCBA 1TUUA 1I94K 4DV2K 2QKBA 4CJQA 4BRGA 4J8FA 1YI2N 4IWVA 4CBXA 5A2QO 1FXXA 4FSVA 5AZIA 1DTQA 4KPYA 1K73O 1SL0A 2G8KA 2BDPA 4CFCA 2E5LK 2PYLA 4CERA 3VQQA 2ZGZA 1A5VA 2E6LA 3QESA 3RVCA 3QERA 4JN4A 4B1YB 1WN7A 3BF1A 3LAMA 4BRAA 4BR0A 2P9IB 2RE2A 5CZ2A 4OGEA 2FXUA 3J7AP 1U6ZA 3MCPA 4DR6K 3C6UA 3O9SA 3FZFA 4BR2A 1A5WA 4CZMA 3VEVA 5GIPA 3D2EB 3NGIA 5JS2A 3PY8A 3HP6A 1XQSC 4A5AA 4CK2A 1HPMA 3D2FB 3ZEUA 5F2RA 1IG8A 2KFZA 3OYNA 2ZGYA 3F5TA 2JWKA 1U47A 4EZ6A 4BR4A 2BGGA 5LMNK 3LPUA 3C95A 2F9TA 3LDPA 4Z4EA 1JLGA 5CYMA 4KB1A 3DLBA 3QB0A 3H3NO 1SAZA 1J5EK 1RCHA 5BPNA 2HBJA 1E4FT 4AM7A 3S9HA 4IFYA 4RW4A 5AZJB 3TAPA 5J2QA
chains in the Genus database with same CATH topology
4ID5A 2YV0X 5T7BA 4B08A 4BE2A 5HRPA 1JXBA 3VQ9A 2OPPA 2GBZA 5C24A 4CJRA 3OJSA 4FM0A 4Z4IA 3SNNA 1K6YA 1DLOA 1ZBFA 1CXUA 1NK6A 2AJQA 1CZ9A 1LW2A 5CYQA 4CGFA 3AVLA 3QETA 1RBUA 3SQ2A 1S1TA 5J2NA 2X6NA 1IKVA 3IS9A 3SV3A 4EP4A 1TKTA 4LD0A 1S1WA 3WNGA 1T05A 4N76A 1RBRA 1XWLA 4PY5A 1XC9A 4Z4GA 3O3FA 1VSEA 4CJPA 1FKPA 4DFPA 1VSLA 1LV5A 3VQ4A 1NJZA 3SPYA 4DLGA 3SUNA 3OYDA 1NK4A 1NJXA 4FJ7A 3AV9A 4CHOA 4AHUA 1JKHA 2X74A 4HCCA 4FXDA 2HHQA 4HUGA 1U45A 1W9HA 3B6PA 4AHSA 1BGXT 3THVA 3OYFA 2P5GA 4FJ5A 3DOLA 1A5XA 3HK2A 2ZD1A 3ZSWA 3OS2A 4LH5A 4O0JA 4CJTA 4E7HA 1BQMA 2IC3A 3T3FA 4CEEA 1IG9A 1D8YA 4KHNA 2IGIA 4FZYA 4L8RB 1HYVA 1QHTA 2W42A 2FBVA 3SI6A 3L3VA 3PUFA 4DSJA 4CJWA 2OPQA 4KV8A 2ZQBA 1C0UA 2FBYA 2X6SA 3SYZA 4FYDA 4FJHA 1C1CA 4JLHA 3KK2A 1WAFA 3KKRA 2KZMA 2NUBA 1S9EA 3FFIA 4CF0A 3MAQA 4CF1A 3M8SA 1I3AA 2QXFA 2HHXA 4CEFA 1TKDA 4DTPA 4CIFA 4OPKA 3I0SA 2JGUA 3P83D 4Z0UA 3KIOA 1GOBA 4FJ9A 2HHUA 4AILC 4CF8A 4BWJA 4H8KA 3WNHA 2Y1IA 3RMAA 2G8HA 4F8RA 3SQ1A 2IS3A 4CEZA 3SJJA 1Q9XA 5HBMA 1CXQA 3TR8A 4DTNA 3I0RA 3KD5E 2KTQA 3DYAA 4KKOA 4I2QA 2YNHA 3VQAA 3QNNA 4LSLA 2FBXA 1Q9YA 3H08A 4CEBA 1TK5A 1RT6A 1YTAA 4ICLA 3OYLA 4CJLA 4IBNA 1ZBLA 2E6MA 3L2WA 4FLTA 3RMCA 4FJKA 4F3TA 1BISA 1UA0A 4HHTA 1TVRA 3IAYA 3DLGA 1LWFA 1Q8IA 3PO4A 4LH4A 3V6DA 3EY1A 4BE1A 3O4NA 5KGXA 2PYJA 5K14A 3OYKA 3VQDA 3I8DA 3CYMA 4M42A 3NGZA 1ZBIA 4FM2A 1HYZA 1VSFA 2A1RA 2ITGA 4ZHRA 3LALA 2KQ2A 1NK5A 1XHZA 2PZSA 3NCIA 3SUPA 2DTUA 2DFFA 5SWMA 2OPRA 1VSHA 2XHBA 4BDZA 1L3TA 1LWEA 1J5OA 5FRMA 4CFDA 4CGIA 3LP0A 3AA5X 5KTQA 4OVLA 4FK4A 2G8IA 4KRFA 3ZT4A 1U49A 4FZXC 3U3YA 3OYEA 4E89A 1HJRA 4B3OA 3D0PA 3LAKA 3DLRA 4BWMA 2YKNA 1TL1A 2VG7A 1Z26A 3HJFA 1KTQA 1T7PA 1VRUA 4FW1A 2OYQA 4M3YA 3KKSA 4DWIA 2P1JA 1RTJA 3KK3A 3LP3A 4CJFA 4MFBA 1J53A 5J1EA 1NKEA 4J2AA 4UQGA 4GW6A 3NF6A 3P1GA 1BI4B 1VSKA 1MU2A 2Z1JA 2IDOA 3ZSZA 1T8EA 4QOZB 4Q0BA 4O4GA 4N56A 1NKCA 2G8UA 2P5OA 2A1SA 4F2SA 3U6FA 2HW3A 4XIUA 4KHYA 3M8PA 4H4OA 4GMJB 4C8OA 1N5YA 1VSDA 4E7IA 3LP1A 3K5OA 1LWCA 3HVRA 4DTRA 3QEXA 3NGYA 5CZ1A 4OJRA 5KGWA 2I5JA 3U3GA 4FCYA 3V9SA 1KFSA 1U04A 1W0HA 4E1MA 2XY7A 2IOCA 3O4QA 1RT1A 4AH9A 4KB0A 3QLHA 3VA0A 1WAJA 1RT3A 3LP2A 4DFMA 5HLFA 3ALYA 1HMVA 1HYSA 3AO5A 3LDSA 1SKWA 2HHSA 1JLCA 3A2FA 4M3UA 1B92A 3AVKA 1QSSA 4KHSA 3IG1A 4GVMA 1KFDA 3DOKA 4DQQA 4W5QA 1NK7A 2G8FA 3ZT3A 1RDDA 2X78A 3WNFA 4FLWA 3PX4A 1RTDA 4CHQA 1S9GA 2HNZA 2Z1GA 3BGRA 2HNYA 2LSNA 3ISNC 4CJEA 4DTXA 1SUQA 3AVAA 5FROA 1TAQA 2XY6A 4W5TA 2E4LA 3TABA 2G8VA 1G15A 1RDAA 1QE1A 3ZSOA 4DF4A 1S1VA 1NOYA 4FJMA 3V9ZA 2OA8A 2HHWA 1UA1A 4OPJA 3AVMA 4HVJA 4JRQA 4CJVA 2Q3SA 1L3VA 2B4JA 4LY7A 4DG1A 1TGOA 4DSKA 3QINA 3M8RA 4W5NA 4RG8A 4HUEA 3ZCMA 4CEQA 1D9FA 3K5NA 1GOCA 3V1OA 3SZ2A 1JLQA 4RW9A 3NH1A 4KHUA 1KLMA 4DQPA 4CEOA 4B9MA 1WNSA 3VQCA 4CIGA 3KK1A 3E01A 3HYFA 3ZSYA 3JSMA 3RTVA 3MXIA 3OYIA 3NF8A 2PY5A 4KTQA 4FLVA 3HO1A 3ITHA 1B9DA 3OYHA 3ZT2A 3O3HA 3CM6A 1KRPA 5J2MA 1BHLA 1QSLA 3VN5A 3SV4A 2QKBA 4IG0A 2ATQA 1WSHA 4ELTA 1QQCA 4O5BA 1LAVA 4OLBA 1ZBUA 4QAGA 2XO7A 1TL3A 4DF8A 1X9WA 4YNQA 4O44A 3NH2A 3TI0A 3NH0A 2XY5A 2F8TA 3OYJA 3L2UA 3V9WA 2YHBA 3OYMA 3VA3A 3DM2A 3LZIA 2Z1HA 5FRNA 3ZSRA 4FM1A 1J9AA 4I7FA 4DU1A 2HB5A 3AVIA 1EP4A 1RBVA 2Z1IA 4C8NA 1BIUA 4YFUA 2R7YA 3QEVA 3TAEA 3L2VA 3ULDA 2HNDA 1BCOA 5EU7A 3DRRA 1X9MA 1D9DA 3RR8A 1D5AA 4E0DA 3L8BA 3SCXA 1BL3A 3AO2A 3C6TA 1U4BA 2OZSA 3RMBA 1KLNA 1CLQA 1GOAA 3MEEA 4N47A 1RT4A 1SKRA 4ZTFA 4E7KA 1BCMA 3B6OA 4PA1A 4Z4CA 2B5JA 2IAJA 4NYFA 3V1QA 3VQBA 2HMIA 3HM9A 3TAQA 4F3OA 4AHCA 4J2EA 1ZBHA 4B8CA 4B9TA 3DLKA 1VSJA 1BQNA 1RTHA 3OVNA 4OKJA 3F73A 3CQ8A 1NK8A 4B8AB 4DTSA 4FJJA 5HROA 3VQ7A 2D0AA 1ASUA 1WLJA 4FLXA 5SZTA 3KLGA 4MQ3A 1BI4A 1KCFA 3PO5A 4DS5A 5J2PA 1WSFA 4Y1DA 2QKKA 2XRIA 3CG7A 4FK0A 3MXJA 4J2DA 4CCHA 3HSTB 1R0AA 3AO1A 1N6QA 4DS4A 4CJSA 4FW2A 3T19A 3CFPA 4NCAA 3NHGA 4FLYA 4B9UA 1C1AA 1Z25A 3P5JA 4DSEA 4JS5A 4O55A 4RW8A 3ZSQA 3OS0A 5E41A 3S3MA 3EYZA 1REVA 4W5RA 4DQRA 1IKXA 4DTJA 1X1PA 1SL2A 3BDPA 4KTWA 4ELUA 2F96A 4FJNA 1CZBA 4BDPA 1JLAA 4E1NA 3UIQA 4I9QA 4KTZA 3QIOA 3AA3A 3V9XA 1DTTA 2HHTA 4WE1A 4M3XA 3LWMA 4IFVA 4I2PA 3CFRA 1TKXA 1IO2A 1LAWA 2OPSA 3NF9A 3KLIA 2D0BA 3M8QA 1WSGA 1L3SA 4Z4FA 5I42A 4FJIA 4LSNA 4OKKA 4AHTA 4CHYA 3LWLA 3L2RA 1X9SA 2RPIA 3DMJA 1TKZA 4IG3A 4EP5A 1XI1A 3DLHA 1RT7A 3SUQA 4EZ9A 1SV5A 2VWJA 1FK9A 4NCGA 4CK1A 4AHRA 4BE0A 4DTMA 1T03A 2OZMA 3KLFA 1C6VA 2DY4A 4W5OA 3K5LA 4M41A 5C42A 1NK0A 3ZT0A 3AA2A 3V81A 4DQSA 1S6QA 1Y97A 3NBPA 3LPTA 1C0MA 3T1AA 3KJVA 1JL2A 4ELVA 4FJLA 3MEGA 1VSMA 2O4GA 1JLEA 4KI4A 1I39A 3TAMA 1QSYA 3DLEA 3ZSXA 3OYBA 4AHVA 1ITGA 3S3NA 4DLEA 1UWBA 1EX4A 4PQUA 3NE6A 4R5PA 3AO3A 4BACA 4CJ4A 4Y1CA 4KI6A 3RMDA 2HVHA 2HVIA 4DMNA 1QTMA 2JLEA 1LW0A 4N41A 4OKEA 1IKWA 2GV9A 4HUFA 3SQ4A 2ZE2A 4M3ZA 4DTUA 4NCBA 3IRXA 2BANA 4CIEA 4K8XA 4FLZA 3QEWA 2DFEA 3QO9A 4CJKA 4CJ3A 1NJYA 1YTUA 3OYCA 1FKOA 3SQ0A 4CK3A 4NYNA 1NJWA 2D5RA 4ID1A 5C25A 1RDBA 2EHGA 3LANA 1S1XA 4KAZA 3OY9A 4M3WA 2YKMA 1TV6A 2Y1JA 3AA4A 1IH7A 1C0TA 3AVGA 4CJ5A 3C94A 4DFKA 4DSIA 1S1UA 4FJGA 2FC0A 2VG6A 4CF2A 1VRTA 1WSIA 5HP1A 4ZTJA 1HQUA 4KFBA 2HHVA 3L2QA 3OYAA 3JYTA 3L3UA 5I3UA 3K57A 3LZJA 3K59A 3AVJA 3D45A 1RBSA 1S6PA 3TWHA 4B9NA 3DRPA 3MXMA 1JLFA 4FK2A 5JS1A 1HNIA 2ETJA 3RWUA 4B9LA 1IKYA 3VQEA 3TAGA 2D0CA 1VSIA 5DK5A 1RTIA 1XHXA 3KLEA 3KTQA 2EX3A 4E7LA 2BE2A 3TARA 3KLHA 4H4MA 1RDCA 4M45A 3EZ5A 3V9UA 3VQ5A 4CHNA 3PX0A 5KI6A 1F21A 3DI6A 3TANA 5FDLA 1L3UA 3ASMA 4QCLA 2WONA 4C8LA 2RN2A 3MECA 4CJUA 1JL1A 4CECA 2P51A 3HVTA 3SUOA 3HT3A 4DQIA 5KRSA 4FVMA 4BDYA 1WSJA 1C1BA 3KD1E 3QEPA 4I9LA 4PWDA 3HP9A 2YNFA 2QK9A 3OYGA 3K58A 5HRSA 4DSFA 3QEIA 4C8MA 4FJ8A 5D3GA 3TAFA 1EXQA 5KRTA 3O3GA 3WNEA 1HRHA 1NKBA 4F2RA 1TAUA 3HPHA 4CHZA 2FBTA 4RW6A 3VQ6A 2KZZA 4CESA 4FZZA 4DU4A 4HCBA 2VWKA 1U48A 1HNVA 1QS4A 1VK0A 4CJQA 1S5JA 4KO0A 3F9KA 1WSEA 1SL1A 2RF2A 2KFNA 1NK9A 1YVUA 4Z4HA 4CE9A 4J2BA 2XY8A 4IKFA 4F4KA 3V1RA 4CGJA 1FXXA 4CGGA 3AVCA 4B9SA 5HRNA 3RRHA 3PV8A 1DTQA 4DU3A 3NFAA 4KPYA 1TK8A 3QNOA 1KSPA 1TK0A 1JXEA 1SL0A 2G8KA 2BDPA 1KVBA 4CFCA 2PYLA 1ZYQA 4CERA 3VQQA 4CHPA 2WOMA 4OLAA 4KREA 1RBTA 3K2PA 1A5VA 1JLBA 3MEDA 1HPZA 2E6LA 2KW4A 3CFOA 3VQ8A 4N5SA 3HXMA 4JS4A 3QESA 3AVBA 3QERA 4KHWA 4E7JA 3S3OA 4RW7A 1YT3A 1WN7A 3RRGA 3LAMA 4IDKA 1ASWA 4CGHA 4CEDA 4E19A 3QIPA 1KVCA 3HPOA 4KHQA 5HRRA 4CFBA 4C8KA 5CZ2A 2VG5A 4DTOA 4OGEA 1EETA 3RR7A 1RILA 1UOCA 3K5MA 3V4IA 4K8ZA 4DSLA 3AVNA 5DMRA 1L5UA 3C6UA 2GUIA 3NAEA 1A5WA 2O4IA 3NGIA 2YNIA 4HTUA 5JS2A 4Q5VA 4OGCA 1EKEA 3ZSVA 4E3SA 2RKIA 3G10A 2YNGA 4G1QA 4O0IA 4CFAA 3AVFA 3HP6A 1J54A 3PY8A 4JRPA 3AO4A 4CK2A 3OJUA 4DFJA 3NDKA 2G8WA 1NOZA 3DRSA 4B9VA 4M3TA 2KFZA 2F8SA 1RNHA 3AVHA 3VQPA 3OYNA 1ASVA 3HL8A 4CEAA 4FLUA 4FJXA 1U47A 4EZ6A 2DFHA 2BGGA 3LPUA 3C95A 4PUOA 3PX6A 4Z4EA 1SKSA 1JLGA 5CYMA 4KB1A 3HPGA 1B9FA 3DLBA 1BIZA 1RT5A 4TSXA 1HQEA 3CM5A 2B6AA 2YHAA 3NF7A 1RCHA 4M3RA 3ZT1A 4CGDA 3OS1A 4CF9A 3SPZA 1KVAA 1O1WA 4IFYA 3S9HA 4RW4A 1RT2A 3G0ZA 5CY4A 1UAXA 3TAPA 5J2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ID5 A;  2YV0 X;  5T7B A;  4B08 A;  4BE2 A;  5HRP A;  1JXB A;  3VQ9 A;  2OPP A;  2GBZ A;  5C24 A;  4CJR A;  3OJS A;  4FM0 A;  4Z4I A;  3SNN A;  1K6Y A;  1DLO A;  1ZBF A;  1CXU A;  1NK6 A;  2AJQ A;  1CZ9 A;  1LW2 A;  5CYQ A;  4CGF A;  3AVL A;  3QET A;  1RBU A;  3SQ2 A;  1S1T A;  5J2N A;  2X6N A;  1IKV A;  3IS9 A;  3SV3 A;  4EP4 A;  1TKT A;  4LD0 A;  1S1W A;  3WNG A;  1T05 A;  4N76 A;  1RBR A;  1XWL A;  4PY5 A;  1XC9 A;  4Z4G A;  3O3F A;  1VSE A;  4CJP A;  1FKP A;  4DFP A;  1VSL A;  1LV5 A;  3VQ4 A;  1NJZ A;  3SPY A;  4DLG A;  3SUN A;  3OYD A;  1NK4 A;  1NJX A;  4FJ7 A;  3AV9 A;  4CHO A;  4AHU A;  1JKH A;  2X74 A;  4HCC A;  4FXD A;  2HHQ A;  4HUG A;  1U45 A;  1W9H A;  3B6P A;  4AHS A;  1BGX T;  3THV A;  3OYF A;  2P5G A;  4FJ5 A;  3DOL A;  1A5X A;  3HK2 A;  2ZD1 A;  3ZSW A;  3OS2 A;  4LH5 A;  4O0J A;  4CJT A;  4E7H A;  1BQM A;  2IC3 A;  3T3F A;  4CEE A;  1IG9 A;  1D8Y A;  4KHN A;  2IGI A;  4FZY A;  4L8R B;  1HYV A;  1QHT A;  2W42 A;  2FBV A;  3SI6 A;  3L3V A;  3PUF A;  4DSJ A;  4CJW A;  2OPQ A;  4KV8 A;  2ZQB A;  1C0U A;  2FBY A;  2X6S A;  3SYZ A;  4FYD A;  4FJH A;  1C1C A;  4JLH A;  3KK2 A;  1WAF A;  3KKR A;  2KZM A;  2NUB A;  1S9E A;  3FFI A;  4CF0 A;  3MAQ A;  4CF1 A;  3M8S A;  1I3A A;  2QXF A;  2HHX A;  4CEF A;  1TKD A;  4DTP A;  4CIF A;  4OPK A;  3I0S A;  2JGU A;  3P83 D;  4Z0U A;  3KIO A;  1GOB A;  4FJ9 A;  2HHU A;  4AIL C;  4CF8 A;  4BWJ A;  4H8K A;  3WNH A;  2Y1I A;  3RMA A;  2G8H A;  4F8R A;  3SQ1 A;  2IS3 A;  4CEZ A;  3SJJ A;  1Q9X A;  5HBM A;  1CXQ A;  3TR8 A;  4DTN A;  3I0R A;  3KD5 E;  2KTQ A;  3DYA A;  4KKO A;  4I2Q A;  2YNH A;  3VQA A;  3QNN A;  4LSL A;  2FBX A;  1Q9Y A;  3H08 A;  4CEB A;  1TK5 A;  1RT6 A;  1YTA A;  4ICL A;  3OYL A;  4CJL A;  4IBN A;  1ZBL A;  2E6M A;  3L2W A;  4FLT A;  3RMC A;  4FJK A;  4F3T A;  1BIS A;  1UA0 A;  4HHT A;  1TVR A;  3IAY A;  3DLG A;  1LWF A;  1Q8I A;  3PO4 A;  4LH4 A;  3V6D A;  3EY1 A;  4BE1 A;  3O4N A;  5KGX A;  2PYJ A;  5K14 A;  3OYK A;  3VQD A;  3I8D A;  3CYM A;  4M42 A;  3NGZ A;  1ZBI A;  4FM2 A;  1HYZ A;  1VSF A;  2A1R A;  2ITG A;  4ZHR A;  3LAL A;  2KQ2 A;  1NK5 A;  1XHZ A;  2PZS A;  3NCI A;  3SUP A;  2DTU A;  2DFF A;  5SWM A;  2OPR A;  1VSH A;  2XHB A;  4BDZ A;  1L3T A;  1LWE A;  1J5O A;  5FRM A;  4CFD A;  4CGI A;  3LP0 A;  3AA5 X;  5KTQ A;  4OVL A;  4FK4 A;  2G8I A;  4KRF A;  3ZT4 A;  1U49 A;  4FZX C;  3U3Y A;  3OYE A;  4E89 A;  1HJR A;  4B3O A;  3D0P A;  3LAK A;  3DLR A;  4BWM A;  2YKN A;  1TL1 A;  2VG7 A;  1Z26 A;  3HJF A;  1KTQ A;  1T7P A;  1VRU A;  4FW1 A;  2OYQ A;  4M3Y A;  3KKS A;  4DWI A;  2P1J A;  1RTJ A;  3KK3 A;  3LP3 A;  4CJF A;  4MFB A;  1J53 A;  5J1E A;  1NKE A;  4J2A A;  4UQG A;  4GW6 A;  3NF6 A;  3P1G A;  1BI4 B;  1VSK A;  1MU2 A;  2Z1J A;  2IDO A;  3ZSZ A;  1T8E A;  4QOZ B;  4Q0B A;  4O4G A;  4N56 A;  1NKC A;  2G8U A;  2P5O A;  2A1S A;  4F2S A;  3U6F A;  2HW3 A;  4XIU A;  4KHY A;  3M8P A;  4H4O A;  4GMJ B;  4C8O A;  1N5Y A;  1VSD A;  4E7I A;  3LP1 A;  3K5O A;  1LWC A;  3HVR A;  4DTR A;  3QEX A;  3NGY A;  5CZ1 A;  4OJR A;  5KGW A;  2I5J A;  3U3G A;  4FCY A;  3V9S A;  1KFS A;  1U04 A;  1W0H A;  4E1M A;  2XY7 A;  2IOC A;  3O4Q A;  1RT1 A;  4AH9 A;  4KB0 A;  3QLH A;  3VA0 A;  1WAJ A;  1RT3 A;  3LP2 A;  4DFM A;  5HLF A;  3ALY A;  1HMV A;  1HYS A;  3AO5 A;  3LDS A;  1SKW A;  2HHS A;  1JLC A;  3A2F A;  4M3U A;  1B92 A;  3AVK A;  1QSS A;  4KHS A;  3IG1 A;  4GVM A;  1KFD A;  3DOK A;  4DQQ A;  4W5Q A;  1NK7 A;  2G8F A;  3ZT3 A;  1RDD A;  2X78 A;  3WNF A;  4FLW A;  3PX4 A;  1RTD A;  4CHQ A;  1S9G A;  2HNZ A;  2Z1G A;  3BGR A;  2HNY A;  2LSN A;  3ISN C;  4CJE A;  4DTX A;  1SUQ A;  3AVA A;  5FRO A;  1TAQ A;  2XY6 A;  4W5T A;  2E4L A;  3TAB A;  2G8V A;  1G15 A;  1RDA A;  1QE1 A;  3ZSO A;  4DF4 A;  1S1V A;  1NOY A;  4FJM A;  3V9Z A;  2OA8 A;  2HHW A;  1UA1 A;  4OPJ A;  3AVM A;  4HVJ A;  4JRQ A;  4CJV A;  2Q3S A;  1L3V A;  2B4J A;  4LY7 A;  4DG1 A;  1TGO A;  4DSK A;  3QIN A;  3M8R A;  4W5N A;  4RG8 A;  4HUE A;  3ZCM A;  4CEQ A;  1D9F A;  3K5N A;  1GOC A;  3V1O A;  3SZ2 A;  1JLQ A;  4RW9 A;  3NH1 A;  4KHU A;  1KLM A;  4DQP A;  4CEO A;  4B9M A;  1WNS A;  3VQC A;  4CIG A;  3KK1 A;  3E01 A;  3HYF A;  3ZSY A;  3JSM A;  3RTV A;  3MXI A;  3OYI A;  3NF8 A;  2PY5 A;  4KTQ A;  4FLV A;  3HO1 A;  3ITH A;  1B9D A;  3OYH A;  3ZT2 A;  3O3H A;  3CM6 A;  1KRP A;  5J2M A;  1BHL A;  1QSL A;  3VN5 A;  3SV4 A;  2QKB A;  4IG0 A;  2ATQ A;  1WSH A;  4ELT A;  1QQC A;  4O5B A;  1LAV A;  4OLB A;  1ZBU A;  4QAG A;  2XO7 A;  1TL3 A;  4DF8 A;  1X9W A;  4YNQ A;  4O44 A;  3NH2 A;  3TI0 A;  3NH0 A;  2XY5 A;  2F8T A;  3OYJ A;  3L2U A;  3V9W A;  2YHB A;  3OYM A;  3VA3 A;  3DM2 A;  3LZI A;  2Z1H A;  5FRN A;  3ZSR A;  4FM1 A;  1J9A A;  4I7F A;  4DU1 A;  2HB5 A;  3AVI A;  1EP4 A;  1RBV A;  2Z1I A;  4C8N A;  1BIU A;  4YFU A;  2R7Y A;  3QEV A;  3TAE A;  3L2V A;  3ULD A;  2HND A;  1BCO A;  5EU7 A;  3DRR A;  1X9M A;  1D9D A;  3RR8 A;  1D5A A;  4E0D A;  3L8B A;  3SCX A;  1BL3 A;  3AO2 A;  3C6T A;  1U4B A;  2OZS A;  3RMB A;  1KLN A;  1CLQ A;  1GOA A;  3MEE A;  4N47 A;  1RT4 A;  1SKR A;  4ZTF A;  4E7K A;  1BCM A;  3B6O A;  4PA1 A;  4Z4C A;  2B5J A;  2IAJ A;  4NYF A;  3V1Q A;  3VQB A;  2HMI A;  3HM9 A;  3TAQ A;  4F3O A;  4AHC A;  4J2E A;  1ZBH A;  4B8C A;  4B9T A;  3DLK A;  1VSJ A;  1BQN A;  1RTH A;  3OVN A;  4OKJ A;  3F73 A;  3CQ8 A;  1NK8 A;  4B8A B;  4DTS A;  4FJJ A;  5HRO A;  3VQ7 A;  2D0A A;  1ASU A;  1WLJ A;  4FLX A;  5SZT A;  3KLG A;  4MQ3 A;  1BI4 A;  1KCF A;  3PO5 A;  4DS5 A;  5J2P A;  1WSF A;  4Y1D A;  2QKK A;  2XRI A;  3CG7 A;  4FK0 A;  3MXJ A;  4J2D A;  4CCH A;  3HST B;  1R0A A;  3AO1 A;  1N6Q A;  4DS4 A;  4CJS A;  4FW2 A;  3T19 A;  3CFP A;  4NCA A;  3NHG A;  4FLY A;  4B9U A;  1C1A A;  1Z25 A;  3P5J A;  4DSE A;  4JS5 A;  4O55 A;  4RW8 A;  3ZSQ A;  3OS0 A;  5E41 A;  3S3M A;  3EYZ A;  1REV A;  4W5R A;  4DQR A;  1IKX A;  4DTJ A;  1X1P A;  1SL2 A;  3BDP A;  4KTW A;  4ELU A;  2F96 A;  4FJN A;  1CZB A;  4BDP A;  1JLA A;  4E1N A;  3UIQ A;  4I9Q A;  4KTZ A;  3QIO A;  3AA3 A;  3V9X A;  1DTT A;  2HHT A;  4WE1 A;  4M3X A;  3LWM A;  4IFV A;  4I2P A;  3CFR A;  1TKX A;  1IO2 A;  1LAW A;  2OPS A;  3NF9 A;  3KLI A;  2D0B A;  3M8Q A;  1WSG A;  1L3S A;  4Z4F A;  5I42 A;  4FJI A;  4LSN A;  4OKK A;  4AHT A;  4CHY A;  3LWL A;  3L2R A;  1X9S A;  2RPI A;  3DMJ A;  1TKZ A;  4IG3 A;  4EP5 A;  1XI1 A;  3DLH A;  1RT7 A;  3SUQ A;  4EZ9 A;  1SV5 A;  2VWJ A;  1FK9 A;  4NCG A;  4CK1 A;  4AHR A;  4BE0 A;  4DTM A;  1T03 A;  2OZM A;  3KLF A;  1C6V A;  2DY4 A;  4W5O A;  3K5L A;  4M41 A;  5C42 A;  1NK0 A;  3ZT0 A;  3AA2 A;  3V81 A;  4DQS A;  1S6Q A;  1Y97 A;  3NBP A;  3LPT A;  1C0M A;  3T1A A;  3KJV A;  1JL2 A;  4ELV A;  4FJL A;  3MEG A;  1VSM A;  2O4G A;  1JLE A;  4KI4 A;  1I39 A;  3TAM A;  1QSY A;  3DLE A;  3ZSX A;  3OYB A;  4AHV A;  1ITG A;  3S3N A;  4DLE A;  1UWB A;  1EX4 A;  4PQU A;  3NE6 A;  4R5P A;  3AO3 A;  4BAC A;  4CJ4 A;  4Y1C A;  4KI6 A;  3RMD A;  2HVH A;  2HVI A;  4DMN A;  1QTM A;  2JLE A;  1LW0 A;  4N41 A;  4OKE A;  1IKW A;  2GV9 A;  4HUF A;  3SQ4 A;  2ZE2 A;  4M3Z A;  4DTU A;  4NCB A;  3IRX A;  2BAN A;  4CIE A;  4K8X A;  4FLZ A;  3QEW A;  2DFE A;  3QO9 A;  4CJK A;  4CJ3 A;  1NJY A;  1YTU A;  3OYC A;  1FKO A;  3SQ0 A;  4CK3 A;  4NYN A;  1NJW A;  2D5R A;  4ID1 A;  5C25 A;  1RDB A;  2EHG A;  3LAN A;  1S1X A;  4KAZ A;  3OY9 A;  4M3W A;  2YKM A;  1TV6 A;  2Y1J A;  3AA4 A;  1IH7 A;  1C0T A;  3AVG A;  4CJ5 A;  3C94 A;  4DFK A;  4DSI A;  1S1U A;  4FJG A;  2FC0 A;  2VG6 A;  4CF2 A;  1VRT A;  1WSI A;  5HP1 A;  4ZTJ A;  1HQU A;  4KFB A;  2HHV A;  3L2Q A;  3OYA A;  3JYT A;  3L3U A;  5I3U A;  3K57 A;  3LZJ A;  3K59 A;  3AVJ A;  3D45 A;  1RBS A;  1S6P A;  3TWH A;  4B9N A;  3DRP A;  3MXM A;  1JLF A;  4FK2 A;  5JS1 A;  1HNI A;  2ETJ A;  3RWU A;  4B9L A;  1IKY A;  3VQE A;  3TAG A;  2D0C A;  1VSI A;  5DK5 A;  1RTI A;  1XHX A;  3KLE A;  3KTQ A;  2EX3 A;  4E7L A;  2BE2 A;  3TAR A;  3KLH A;  4H4M A;  1RDC A;  4M45 A;  3EZ5 A;  3V9U A;  3VQ5 A;  4CHN A;  3PX0 A;  5KI6 A;  1F21 A;  3DI6 A;  3TAN A;  5FDL A;  1L3U A;  3ASM A;  4QCL A;  2WON A;  4C8L A;  2RN2 A;  3MEC A;  4CJU A;  1JL1 A;  4CEC A;  2P51 A;  3HVT A;  3SUO A;  3HT3 A;  4DQI A;  5KRS A;  4FVM A;  4BDY A;  1WSJ A;  1C1B A;  3KD1 E;  3QEP A;  4I9L A;  4PWD A;  3HP9 A;  2YNF A;  2QK9 A;  3OYG A;  3K58 A;  5HRS A;  4DSF A;  3QEI A;  4C8M A;  4FJ8 A;  5D3G A;  3TAF A;  1EXQ A;  5KRT A;  3O3G A;  3WNE A;  1HRH A;  1NKB A;  4F2R A;  1TAU A;  3HPH A;  4CHZ A;  2FBT A;  4RW6 A;  3VQ6 A;  2KZZ A;  4CES A;  4FZZ A;  4DU4 A;  4HCB A;  2VWK A;  1U48 A;  1HNV A;  1QS4 A;  1VK0 A;  4CJQ A;  1S5J A;  4KO0 A;  3F9K A;  1WSE A;  1SL1 A;  2RF2 A;  2KFN A;  1NK9 A;  1YVU A;  4Z4H A;  4CE9 A;  4J2B A;  2XY8 A;  4IKF A;  4F4K A;  3V1R A;  4CGJ A;  1FXX A;  4CGG A;  3AVC A;  4B9S A;  5HRN A;  3RRH A;  3PV8 A;  1DTQ A;  4DU3 A;  3NFA A;  4KPY A;  1TK8 A;  3QNO A;  1KSP A;  1TK0 A;  1JXE A;  1SL0 A;  2G8K A;  2BDP A;  1KVB A;  4CFC A;  2PYL A;  1ZYQ A;  4CER A;  3VQQ A;  4CHP A;  2WOM A;  4OLA A;  4KRE A;  1RBT A;  3K2P A;  1A5V A;  1JLB A;  3MED A;  1HPZ A;  2E6L A;  2KW4 A;  3CFO A;  3VQ8 A;  4N5S A;  3HXM A;  4JS4 A;  3QES A;  3AVB A;  3QER A;  4KHW A;  4E7J A;  3S3O A;  4RW7 A;  1YT3 A;  1WN7 A;  3RRG A;  3LAM A;  4IDK A;  1ASW A;  4CGH A;  4CED A;  4E19 A;  3QIP A;  1KVC A;  3HPO A;  4KHQ A;  5HRR A;  4CFB A;  4C8K A;  5CZ2 A;  2VG5 A;  4DTO A;  4OGE A;  1EET A;  3RR7 A;  1RIL A;  1UOC A;  3K5M A;  3V4I A;  4K8Z A;  4DSL A;  3AVN A;  5DMR A;  1L5U A;  3C6U A;  2GUI A;  3NAE A;  1A5W A;  2O4I A;  3NGI A;  2YNI A;  4HTU A;  5JS2 A;  4Q5V A;  4OGC A;  1EKE A;  3ZSV A;  4E3S A;  2RKI A;  3G10 A;  2YNG A;  4G1Q A;  4O0I A;  4CFA A;  3AVF A;  3HP6 A;  1J54 A;  3PY8 A;  4JRP A;  3AO4 A;  4CK2 A;  3OJU A;  4DFJ A;  3NDK A;  2G8W A;  1NOZ A;  3DRS A;  4B9V A;  4M3T A;  2KFZ A;  2F8S A;  1RNH A;  3AVH A;  3VQP A;  3OYN A;  1ASV A;  3HL8 A;  4CEA A;  4FLU A;  4FJX A;  1U47 A;  4EZ6 A;  2DFH A;  2BGG A;  3LPU A;  3C95 A;  4PUO A;  3PX6 A;  4Z4E A;  1SKS A;  1JLG A;  5CYM A;  4KB1 A;  3HPG A;  1B9F A;  3DLB A;  1BIZ A;  1RT5 A;  4TSX A;  1HQE A;  3CM5 A;  2B6A A;  2YHA A;  3NF7 A;  1RCH A;  4M3R A;  3ZT1 A;  4CGD A;  3OS1 A;  4CF9 A;  3SPZ A;  1KVA A;  1O1W A;  4IFY A;  3S9H A;  4RW4 A;  1RT2 A;  3G0Z A;  5CY4 A;  1UAX A;  3TAP A;  5J2Q A; 
#chains in the Genus database with same CATH topology
 3HSC A;  1BA1 A;  2GBZ A;  3OJS A;  4FM0 A;  2W6L A;  1NBW A;  1NK6 A;  1VQK N;  2AJQ A;  1VQ7 N;  5CYQ A;  2IVN A;  3VEY A;  4EP4 A;  2I7P A;  1S1W A;  3MDQ A;  1VSE A;  3G71 N;  5JIC A;  5GAG P;  3FE1 A;  4DLG A;  3SUN A;  1QHA A;  1NK4 A;  4FJ7 A;  3AV9 A;  2YCH A;  4C1N K;  4FXD A;  4HCC A;  5FPN A;  2QWM A;  3A5O C;  1W9H A;  1YIT N;  4YOR A;  4CZE A;  4GV6 A;  3HK2 A;  2ZD1 A;  2ASP A;  3ZSW A;  4LH5 A;  3OS2 A;  1BQM A;  3WT0 A;  1D8Y A;  4IO9 L;  4FZY A;  4DR7 K;  4IDH A;  1HYV A;  2FBV A;  5AQP A;  2FBY A;  3CCU N;  3KK2 A;  1BO5 O;  2GEL A;  3EEQ A;  3EZW A;  1V4S A;  1Y64 A;  4CD1 A;  1WAF A;  2NUB A;  2FSN A;  4CF1 A;  1I3A A;  2QXF A;  1Q82 O;  4DR4 K;  3QML A;  2HHX A;  5FPD A;  4Z0U A;  2HHU A;  3SJH A;  4CF8 A;  2G8H A;  3SQ1 A;  3SJJ A;  1Q9X A;  5CHI A;  1CXQ A;  2KTQ A;  3DYA A;  1N34 K;  2O8C B;  3QNN A;  2IIR A;  4CEB A;  1TK5 A;  2NLX A;  1UA0 A;  3IAY A;  3DLG A;  3EY1 A;  3O4N A;  5KGX A;  3VQD A;  2JWL A;  4M42 A;  1ZBI A;  4FM2 A;  2ITG A;  4ZHR A;  2KQ2 A;  3SUP A;  3UE5 A;  4M63 C;  1HJO A;  5FRM A;  1L3T A;  4CZF A;  4PKI A;  4NLC A;  5IWA K;  3U9D A;  3SBG A;  5KTQ A;  1U49 A;  3TSU A;  4E89 A;  4U7B A;  3T69 A;  1T7P A;  2OYQ A;  4M3Y A;  1OH6 A;  1Q86 O;  1J53 A;  5J1E A;  4J2A A;  4GW6 A;  4BY9 C;  3CCL N;  4QOZ B;  3T1H K;  4Q0B A;  4O4G A;  2VGN A;  4N56 A;  4H0X B;  5BRF A;  2G8U A;  1NU0 A;  2VWB A;  2Q0R A;  4KHY A;  4IEI A;  2HMP A;  2CH5 A;  4BRF A;  4LF8 K;  5CZ1 A;  2QWN A;  4OJR A;  5KGW A;  3U3G A;  4FCY A;  1KFS A;  2XY7 A;  3P31 A;  3P4I A;  4PKG A;  3QLH A;  1YAG A;  5LY3 A;  4DFM A;  5M1K A;  2PAV A;  2YI1 A;  3AO5 A;  3LDS A;  1SKW A;  3A2F A;  4YOW A;  3IG1 A;  4DQQ A;  1NK7 A;  2O8B A;  4FLW A;  2WFB A;  2A3Z A;  5LJW A;  4DTX A;  3AVA A;  1TAQ A;  4BRL A;  3TAB A;  4FWS A;  4FJM A;  3V9Z A;  2FSJ A;  3FLC O;  5M1P A;  2Q3S A;  2A6A A;  4LC9 B;  4LY7 A;  4DG1 A;  3ZCM A;  4CEQ A;  3CC7 N;  5AQV A;  5BN9 A;  4H5V A;  1GOC A;  3N4P A;  4RW9 A;  2UYT A;  4BRM A;  3VF6 A;  2NRZ A;  4JV5 K;  3NF8 A;  3HO1 A;  3CER A;  3ITH A;  3VF4 A;  1BHL A;  1QSL A;  2ATQ A;  2PFU A;  1ZBU A;  3KWG A;  2XO7 A;  4WCE L;  2F4V K;  3MX5 A;  4JKB A;  2Q1N A;  2YHB A;  4A2B A;  3CI5 A;  2GTD A;  3LZI A;  2HF4 A;  5FRN A;  4JD2 B;  5DM7 L;  4FM1 A;  1J9A A;  4ILJ A;  4C23 A;  4B3T K;  1RBV A;  5B8H A;  2FSK A;  2Z1I A;  1BIU A;  4DHY A;  4YFU A;  2R7Y A;  3QEV A;  3LDL A;  3RR8 A;  2J4R A;  4WQ5 C;  3TSQ A;  1YXQ A;  3AO2 A;  3C6T A;  1U4B A;  3RMB A;  1VHX A;  2QWP A;  1YUW A;  1RT4 A;  1SKR A;  3QIC A;  3B6O A;  3VGL A;  4Z4C A;  2B5J A;  5GAD P;  4A61 A;  3V1Q A;  3VQB A;  4PHT X;  4B8C A;  4B9T A;  3DLK A;  1NK8 A;  2BUP A;  4DTS A;  2ZJP L;  3VQ7 A;  2D0A A;  1WLJ A;  4FLX A;  3GBT A;  1OH5 A;  1BI4 A;  3O1B A;  2YHW A;  1KCF A;  4H5W A;  3PO5 A;  5J2P A;  1WSF A;  1ESV A;  4IXC A;  5ADX H;  3CFP A;  3NHG A;  1C1A A;  1Z25 A;  3AGR A;  4O55 A;  4RW8 A;  4YHH K;  2P9L B;  3S3M A;  4W5R A;  4K42 A;  1NG9 A;  1TYQ B;  4FJN A;  4FPA A;  3BZK A;  2V7Z A;  3WUH A;  2E20 A;  2HHT A;  3FFK B;  3H1Q A;  4OPH A;  3LWM A;  2OPS A;  1ZBS A;  2D0B A;  4BVO A;  4Z4F A;  5I42 A;  1XI1 A;  2P9U A;  3DLH A;  1Z6R A;  1FK9 A;  4B9Q A;  1T03 A;  5AQZ A;  1C6V A;  1NK0 A;  2W40 A;  3KVG A;  3QBX A;  5C42 A;  4DQS A;  1S6Q A;  3T1A A;  3W0L A;  3KJV A;  4KI4 A;  3TAM A;  3UKR A;  3ZSX A;  5C12 A;  1ITG A;  3M1F A;  3E1Y A;  3ZX3 A;  4PQU A;  5EX5 A;  4CJ4 A;  4KI6 A;  2E1Y A;  1CZA N;  1IKW A;  5JVG L;  4M3Z A;  2ZE2 A;  4CIE A;  3PIP L;  4FLZ A;  1BG3 A;  3DXM B;  3OYC A;  3SQ0 A;  2P9S A;  1NJW A;  2D5R A;  4ID1 A;  5C25 A;  1OKJ A;  1S1X A;  4AM6 A;  4KAZ A;  4M3W A;  3HBT A;  3CIP A;  4DV4 K;  2YKM A;  1TV6 A;  4CF2 A;  2UXD K;  3L3U A;  3NVM A;  3TWH A;  4B9N A;  3THY B;  1RBS A;  1JLF A;  2ETJ A;  5DK5 A;  3TAR A;  3CCE N;  2BE2 A;  2NRW A;  3A5L C;  1Q18 A;  2NRH A;  4WQ5 A;  5KI6 A;  3I8B A;  1F21 A;  3TAN A;  1MDU B;  3GL1 A;  2P51 A;  4BRP A;  1NGE A;  3HT3 A;  4DQI A;  5KRS A;  3HM8 A;  4FVM A;  1WSJ A;  3HOS A;  3KD1 E;  4I9L A;  1NNE A;  2QK9 A;  4JAX A;  5M1Q A;  4QS7 A;  5D3G A;  3THX A;  5AQM A;  1HRH A;  1NKB A;  4CHZ A;  4YOT A;  4MO4 A;  4RW6 A;  3VQ6 A;  3A5N C;  2P9P B;  4MLH A;  2VWK A;  1C0G A;  4EIA A;  1HNV A;  1WSE A;  1NK9 A;  1YVU A;  4Z4H A;  1Z05 A;  4H0O A;  4J2B A;  2XY8 A;  4IKF A;  2W41 A;  3O4W A;  3AVC A;  3VEX A;  3RRH A;  4JK9 A;  1KSP A;  3BP8 A;  1P8Z A;  1BWF O;  2WOM A;  3MED A;  1RBT A;  3JS6 A;  2KW4 A;  4JS4 A;  4MLE A;  4KHW A;  4H5T A;  3RRG A;  3I55 N;  2VQE K;  1KVC A;  2P9K B;  4FWN A;  1UOC A;  2GUI A;  3NAE A;  2KHO A;  3SBT A;  1EKE A;  4A2A A;  3G10 A;  2QI2 A;  2YNG A;  4O0I A;  3AVF A;  1GLF O;  4ISE A;  4JRP A;  3AO4 A;  4GNI A;  2F8S A;  3O9Q A;  3VQP A;  4FJX A;  4CZK A;  1MA9 B;  3GE1 A;  4JKH A;  5JVH L;  4PUO A;  4NXM K;  3L4Q A;  4KBO A;  1SKS A;  3W3D A;  3C6A A;  1B9F A;  4O5F A;  3J7Y P;  4RCH A;  1HQE A;  3CM5 A;  3VPZ A;  3CPW M;  4CW7 B;  4M3R A;  4CZJ A;  1VQ4 N;  1O1W A;  1RT2 A;  4CZH A;  1NLV A;  2QWR A;  4BE2 A;  5HRP A;  2OPP A;  4C1N I;  2F7T A;  5C24 A;  4CJR A;  1GLB G;  4JI3 K;  1ZBF A;  2X6N A;  1IKV A;  3WNG A;  1K9M O;  1ATR A;  1RBR A;  1XWL A;  1FKP A;  1VSL A;  3VER A;  3HZ6 A;  4LF7 K;  3VGM A;  1LV5 A;  3VQ4 A;  1NJZ A;  2HHQ A;  4HUG A;  3B6P A;  2NRT A;  1BGX T;  3AAQ A;  4B1Z A;  3OYF A;  4FJ5 A;  3N4Q A;  1A5X A;  1BDG A;  3AAP A;  4CJT A;  2IC3 A;  4JHD B;  1IG9 A;  4FWL A;  4XH4 A;  5AQR A;  4FWP A;  3K9J A;  2W42 A;  2D4W A;  3SI6 A;  3PUF A;  4DSJ A;  2OPQ A;  4KV8 A;  2ZQB A;  3SYZ A;  2BTF A;  3HOT A;  4FJH A;  5GIO A;  2Q2R A;  2KZM A;  3FFI A;  4CF0 A;  3MAQ A;  3M8S A;  5LJV A;  1TKD A;  3I0S A;  3P83 D;  3CHW A;  4JKF A;  2IS3 A;  3TR8 A;  3KD5 E;  4KKO A;  2P9I A;  1BU6 O;  2YNH A;  3ID6 A;  2RHK A;  4V19 S;  1GLJ O;  4LSL A;  2FBX A;  2FLO A;  3FGU A;  1Q9Y A;  3H08 A;  3OYL A;  4CJL A;  4IBN A;  3L2W A;  2F9W A;  4FLT A;  1H1V A;  4JI6 K;  3D2E A;  5AQQ A;  1LWF A;  4LFC K;  1Q8I A;  1E3M A;  5CR4 A;  4BE1 A;  5K14 A;  3OYK A;  3O08 A;  5JMV A;  3QFU A;  3D2F A;  1WUA A;  4DV5 K;  3EE9 A;  1XHZ A;  3CXC M;  3WXL A;  1S72 N;  2DTU A;  1WBB A;  2OPR A;  1VSH A;  4BDZ A;  1KD1 O;  1J5O A;  4H03 B;  1KAX A;  3CME N;  4WQ4 A;  5BPM A;  3AA5 X;  4OVL A;  5GAH P;  3ZT4 A;  4FZX C;  3U3Y A;  3OYE A;  4DUZ K;  4IZ9 A;  3D0P A;  1Z26 A;  3HJF A;  1VAZ A;  3JAM O;  4FW1 A;  5AZJ A;  2O8D B;  4F9O A;  4UQG A;  3NF6 A;  3T1Y K;  3ATV A;  5ELZ A;  1NKC A;  4B1X B;  3CJC A;  3U6F A;  3MN7 A;  4XIU A;  3M8P A;  1VSD A;  3AY9 A;  3K5O A;  1LWC A;  3FZH A;  2VYP A;  3QEX A;  1GLD G;  2I5J A;  4E1M A;  2CGJ A;  2IOC A;  1S3X A;  3R6M A;  1WAJ A;  1OH8 A;  2NZT A;  3LP2 A;  3GG4 A;  4GVE A;  4CBU A;  1HMV A;  4GV9 A;  1MWK A;  4B3R K;  1B92 A;  3AVK A;  1QSS A;  4KHS A;  1ZBH A;  1KFD A;  3ZT3 A;  3WNF A;  4CHQ A;  1QQN A;  2LSN A;  3ISN C;  4CJE A;  1ILY A;  1SUQ A;  4BC4 A;  2G8V A;  1QE1 A;  4DF4 A;  3AVM A;  5AFU A;  4JRQ A;  4CJV A;  2B4J A;  2KKZ A;  4Z94 A;  1TGO A;  4JI8 K;  4W5N A;  4RG8 A;  4HUE A;  3K5N A;  3J7Z O;  3NH1 A;  1KLM A;  4CEO A;  4B9M A;  1WNS A;  3KK1 A;  4CIG A;  3E01 A;  3JSM A;  3ZSY A;  3MXI A;  3OYI A;  4KTQ A;  4FLV A;  3BF3 A;  2E8A A;  1B9D A;  2HF3 A;  3CM6 A;  5J2M A;  1VQ8 N;  5GAE P;  3VN5 A;  3SV4 A;  4H0P A;  2O8C A;  1LAV A;  5BRE A;  4FOE A;  1X9W A;  4O44 A;  3M5R A;  4BC5 A;  3MN6 A;  4K0K K;  3OYM A;  3DM2 A;  4JNE A;  1VQO N;  3ZSR A;  3WEE B;  1VQ6 N;  3RSE B;  3GOI A;  1SZ2 A;  1JCG A;  1E4G T;  1RDU A;  4C8N A;  3TAE A;  4LF5 K;  3ULD A;  5EU7 A;  2OAN A;  4YY3 K;  3DRR A;  3CET A;  1D5A A;  4M7Y A;  3PIO L;  3OBY A;  4MDB A;  4NO7 A;  3U9Z A;  4EAH D;  1NGH A;  3MEE A;  4N47 A;  4M7X A;  2A41 A;  4E7K A;  3PLA A;  1JCF A;  3L0Q A;  3TAQ A;  4J2E A;  4AHC A;  3ENB A;  1BQN A;  1KXP A;  1Q81 O;  2QWL A;  1KAY A;  4FWQ A;  4B1U B;  4DS5 A;  2QKK A;  4FWO A;  1M90 O;  3SMS A;  3MXJ A;  3THW B;  2AA4 A;  4CJS A;  4FW2 A;  4FLY A;  1NMD A;  3BZC A;  2UXC K;  3OS0 A;  1IKX A;  1SL2 A;  4ELU A;  2HST A;  4OPA A;  4KTZ A;  3V9X A;  4WE1 A;  3G25 A;  4KH5 A;  1TKX A;  4FOI A;  1LAW A;  1XUP O;  4QS8 A;  1WSG A;  3Q7B A;  1L3S A;  3U8X A;  4CHY A;  2E2N A;  3L2R A;  3DMJ A;  4EP5 A;  1O13 A;  1RT7 A;  4KH6 A;  3SUQ A;  4EZ9 A;  2VWJ A;  2YX6 A;  4AHR A;  4CK1 A;  2OZM A;  2O8F B;  4W5O A;  3K5L A;  1ATS A;  2D1K A;  1P90 A;  1DEJ A;  1QSY A;  3OYB A;  4AHV A;  2VCP A;  1UWB A;  1EX4 A;  3VEN A;  3AO3 A;  4UY8 O;  3RMD A;  1HUX A;  2HVI A;  1QTM A;  2JLE A;  3DJC A;  4OKE A;  5MLC Q;  2GV9 A;  3QBW A;  4BRE A;  4DTU A;  4NCB A;  2BAN A;  4K8X A;  4K43 A;  3QEW A;  1NJY A;  4JD2 A;  4NYN A;  2EHG A;  3LAN A;  1T3V A;  3WXJ A;  2Y1J A;  1GLA G;  4X66 K;  3AVG A;  4CJ5 A;  3C94 A;  4DFK A;  1S1U A;  2FC0 A;  1KAZ A;  2VG6 A;  1WSI A;  5HP1 A;  4BGA A;  1RGI A;  3L2Q A;  3OYA A;  3H45 C;  3K59 A;  4FK2 A;  1HNI A;  4HWI A;  3RWU A;  4JI5 K;  3KTQ A;  3CCM N;  1YHQ N;  3TU5 A;  1VSI A;  2FF3 B;  2A5X A;  2EX3 A;  5M1N A;  1ATN A;  3R1X A;  4WFN L;  1K8K B;  3CJ7 A;  3KWI A;  1RDC A;  4H4M A;  3KLH A;  3V9U A;  4JYA K;  3A5M C;  1L3U A;  5FDL A;  1FW6 A;  2WUS A;  3HVT A;  5AQT A;  4BDY A;  1C1B A;  2D0O A;  3QEP A;  4PWD A;  1W7A A;  2AP1 A;  3K58 A;  5HRS A;  3CPE A;  4LF4 K;  4FJ8 A;  3TAF A;  5KRT A;  5FPM A;  4WF9 L;  3WNE A;  4BQZ A;  1EQY A;  4AQY K;  1GLC G;  3LL3 A;  4DU4 A;  1QS4 A;  2P9L A;  2KFN A;  1S5J A;  2QTD A;  2RF2 A;  2ASO A;  1TYQ A;  4F4K A;  3V1R A;  4CGJ A;  2CGL A;  5GIN A;  2PBD A;  1R59 O;  4Y0W A;  4IOC L;  4DU3 A;  3NFA A;  1TK8 A;  1X3N A;  3QNO A;  3F9M A;  1TK0 A;  1JXE A;  1NMN A;  1KVB A;  1RDW X;  1ZYQ A;  4CHP A;  4KRE A;  4OLA A;  1EWR A;  3CFO A;  4N5S A;  3HXM A;  3AVB A;  2E2O A;  3S3O A;  1YT3 A;  4IDK A;  4CGH A;  4CED A;  3QIP A;  4RTF D;  3HPO A;  3D6R A;  5HRR A;  4C8K A;  4DTO A;  2VG5 A;  1RIL A;  3FZL A;  4K8Z A;  5E84 A;  4DSL A;  3AVN A;  1L5U A;  4CBW A;  4BG8 A;  4WFA L;  4AF1 A;  4H5R A;  2YNI A;  4K25 A;  4Q5V A;  4HTU A;  4OGC A;  3ZSV A;  5F1X A;  3NVK A;  2CH6 A;  2RKI A;  4YOX A;  4CFA A;  2I7N A;  1HLU A;  5EOY A;  5LMU K;  3OJU A;  4DB3 A;  4B9V A;  4M3T A;  1DGK N;  1RNH A;  1ASV A;  4FLU A;  5AQG A;  3J81 O;  4A57 A;  4A5B A;  4LF6 K;  3PX6 A;  1KC8 O;  5AQO A;  3DXM A;  1BIZ A;  4TSX A;  4L3Q A;  4B1W B;  3NF7 A;  3I56 N;  3UB5 A;  4CGD A;  3CCR N;  3OHR A;  3H46 O;  4CF9 A;  3ENH A;  1YJN N;  5CY4 A;  5KPR A;  2D0P A;  1NGB A;  4IFE A;  2ITM A;  5T7B A;  4B08 A;  4YOY A;  4I6M B;  4CVN E;  4BR5 A;  3THY A;  5HOO A;  2UUB K;  1GLE G;  4Z4I A;  3SNN A;  1CXU A;  1CZ9 A;  1LW2 A;  4CGF A;  3AVL A;  4IOA L;  1LCU A;  1RBU A;  1S1T A;  5J2N A;  4I9Q A;  3H1V X;  4N76 A;  1TKT A;  5AQU A;  4BG9 A;  4PY5 A;  4Z4G A;  4CJP A;  4DFP A;  2UUA K;  3DLL L;  3M6G A;  3DXK B;  3MK6 A;  1NJX A;  4OO1 J;  4AHU A;  1JKH A;  5DM6 L;  1U45 A;  1N36 K;  2HBL A;  3THV A;  1XMO K;  3DOL A;  4O0J A;  3T3F A;  2P9P A;  3MX2 A;  2V51 B;  2UU9 K;  3VTH A;  3IUC A;  2IGI A;  3L3V A;  4DUY K;  1OVQ A;  3C65 A;  1C0U A;  2X6S A;  3QFP A;  1C1C A;  4JLH A;  4DR1 K;  4ISF A;  4JKC A;  3KKR A;  4B3M K;  3H6E A;  5I9E B;  2OTL N;  1YJW N;  4FL9 A;  4BRC A;  4OPK A;  1YJ9 N;  2JGU A;  4FJ9 A;  3KIO A;  1GOB A;  4AIL C;  4O8K A;  2Y1I A;  4H8K A;  3RMA A;  4F8R A;  1WBD A;  4BR7 A;  1WB9 A;  1XNQ K;  5AJ3 K;  4I2Q A;  4JKE A;  2P9K A;  2ZF5 O;  1HKG A;  3HI0 A;  4ICL A;  4JKG B;  1ZBL A;  2E6M A;  4BRO A;  1DT9 A;  4FJK A;  1BIS A;  4F3T A;  1TVR A;  5AFU H;  3PO4 A;  5C15 A;  4LH4 A;  3V6D A;  2PYJ A;  1VQP N;  3VES A;  3NGZ A;  1HYZ A;  2E88 A;  5EXW A;  3WQU A;  3EKU A;  3LAL A;  2PZS A;  3CCQ N;  3QDK A;  3NCI A;  1W97 L;  2DFF A;  4YDU C;  5SWM A;  1LWE A;  4YOV A;  3ULE B;  1W2B M;  5FLX O;  4FK4 A;  4DQ8 A;  1T6D A;  4DR2 K;  1V4T A;  4B3O A;  3DLR A;  5AQL A;  1KTQ A;  1VRU A;  3EE8 A;  1LOT B;  1NKE A;  4H0T B;  1T8E A;  3ZSZ A;  1VSK A;  1MU2 A;  2Z1J A;  3O6W A;  3MWT A;  3AGK A;  2A1S A;  4F2S A;  2P9N B;  3VEW A;  4GMJ B;  5AQF A;  1U2V B;  4E7I A;  3LP1 A;  4DTR A;  5BRH A;  1C0F A;  3PSI A;  1W0H A;  1ZC6 A;  3O4Q A;  3IDH A;  1RT1 A;  4AH9 A;  4KB0 A;  5LL6 Z;  3IMX A;  1VQL N;  3O8M A;  1HNZ K;  3G6E N;  5BN8 A;  3ALY A;  1SS6 A;  2HHS A;  1JLC A;  3CJB A;  4GVM A;  3DOK A;  3VTI A;  2A42 A;  2G8F A;  3C0B A;  5AR0 A;  1S9G A;  2V7Y A;  2ZWH A;  3BGR A;  1XMQ K;  2HNY A;  4JHD A;  4DV3 K;  3MMV A;  3ID8 A;  2XY6 A;  4GY2 B;  2H3G X;  1NOY A;  4DCH A;  4HVJ A;  1L3V A;  2OTJ N;  3QIN A;  3M8R A;  1EO1 A;  3WXK A;  1D9F A;  3V1O A;  3SZ2 A;  1JLQ A;  4KHU A;  3VGK A;  3TSP A;  4DQP A;  3VQC A;  2PY5 A;  3CD6 N;  3ZT2 A;  1OH7 A;  3O3H A;  1KRP A;  2E1Z A;  4DV0 K;  4ELT A;  1HX1 A;  1WSH A;  1QQC A;  3UKU B;  1TL3 A;  5ADX A;  4DF8 A;  1WOQ A;  3TI0 A;  3NH0 A;  3OYJ A;  3V9W A;  3VA3 A;  2Z1H A;  1HNX K;  4I7F A;  4DU1 A;  2HB5 A;  4BRD A;  4BRN A;  3VEO A;  5IT9 O;  3L6Q A;  4CZL A;  3L2V A;  1BCO A;  3T7Z A;  1D9D A;  4E0D A;  5AQS A;  3HTV A;  2OZS A;  1KLN A;  1CLQ A;  4JKD A;  5AQI A;  4PA1 A;  4MDA A;  4NYF A;  3O9T A;  3HM9 A;  4F3O A;  4YDU A;  3C7N B;  2V52 B;  4BRH A;  1VSJ A;  3OVN A;  4OKJ A;  3CQ8 A;  1N32 K;  4FJJ A;  4HTL A;  2O8D A;  2O8E B;  1HKB A;  3KLG A;  4IEE A;  4Y1D A;  2Q0U A;  2XRI A;  3CG7 A;  5AQY A;  1R0A A;  3AO1 A;  1N6Q A;  4DS4 A;  3T19 A;  4NCA A;  3P5J A;  3ZET B;  4DSE A;  1BUP A;  4JS5 A;  3ZSQ A;  3E9P A;  3EYZ A;  4IJA A;  1X1P A;  4KTW A;  1CZB A;  1IBL K;  4E1N A;  3TTF A;  5AZI B;  3KHY A;  4O8U A;  4XH1 A;  1DTT A;  4G9Z A;  4R79 A;  4IFV A;  3VOV A;  2BH1 A;  4I2P A;  3CFR A;  3WQT A;  3KLI A;  2E2P A;  4FJI A;  4LSN A;  4PL7 A;  2FF6 A;  3U4L A;  1J6Z A;  1X9S A;  2RPI A;  1T6C A;  4IG3 A;  3CCJ N;  4PKH A;  4XH5 A;  4BE0 A;  4DTM A;  3AA2 A;  5E26 A;  4ELV A;  1GLL O;  4FWM A;  3MEG A;  1I39 A;  3P39 A;  3DLE A;  3CJ9 A;  4OX9 K;  4DLE A;  1N8R O;  1MWM A;  3NE6 A;  4R5P A;  3MWP A;  3ZEU B;  2HVH A;  5M1O A;  2YJE A;  4DMN A;  1LW0 A;  4N41 A;  1NGJ A;  2A40 A;  4HUF A;  3IRX A;  3C6H A;  4DV1 K;  3QO9 A;  4CJK A;  3JXU A;  1YTU A;  5FPE A;  4MO5 A;  3WEE A;  4FWR A;  3OY9 A;  3RSE A;  3O9U A;  3L4I A;  3AA4 A;  3D7E O;  1IH7 A;  4FJG A;  2HOE A;  3SAF A;  3K57 A;  4A62 A;  3LZJ A;  3AVJ A;  3D45 A;  1S6P A;  3DRP A;  3EO3 A;  4B9L A;  3VQE A;  3TAG A;  1RTI A;  3MN9 A;  4JI2 K;  3VQ5 A;  3DI6 A;  5EY4 A;  3ASM A;  4QCL A;  2WON A;  2ASM A;  3MEC A;  1JL1 A;  3KK7 A;  5BR9 A;  4CEC A;  4ILH A;  3CCV N;  3CJA A;  3WXM B;  5CE3 A;  3HP9 A;  5AQJ A;  4LFB K;  1YF5 L;  3OYG A;  3HRG A;  3MN5 A;  4JK7 A;  3THW A;  1JJ2 M;  4FWK A;  1QQO A;  1IBK K;  3CF5 L;  3HPH A;  4JI0 K;  2FBT A;  3CJ1 A;  2KZZ A;  4A59 A;  2QW9 A;  2DPN A;  3E66 A;  3AAR A;  1U48 A;  3S41 A;  1VK0 A;  3K0S A;  1Q7Y O;  4KO0 A;  3F9K A;  1SL1 A;  1K8A O;  3TTD A;  1YIJ N;  4CE9 A;  3ATU A;  3K9K A;  4CGG A;  4BGB A;  3DAW A;  4B9S A;  5HRN A;  3PV8 A;  2OCE A;  3K2P A;  1JLB A;  3VQ8 A;  1HPZ A;  4DKW A;  3O9R A;  3OBW A;  4E7J A;  4BC3 A;  4RW7 A;  1ASW A;  4E19 A;  4B3S K;  4KHQ A;  4CFB A;  1NGG A;  2O8F A;  1EET A;  3RR7 A;  3K5M A;  3V4I A;  5DMR A;  4BRQ A;  2O4I A;  3R9P A;  2W6K A;  3EL2 A;  4E3S A;  4G1Q A;  1J54 A;  1KQS M;  4DFJ A;  3NDK A;  2G8W A;  1NOZ A;  3DRS A;  3AVH A;  3HL8 A;  4CEA A;  2DFH A;  5C0Y A;  4JI7 K;  5H1S Q;  3HPG A;  3BEX A;  1RT5 A;  2B6A A;  3A8Y A;  2YHA A;  4CZI A;  3OW2 M;  2NNW A;  3ZT1 A;  3OS1 A;  3SPZ A;  1KVA A;  3G0Z A;  1UAX A;  2QWQ A;  4ID5 A;  2YV0 X;  3WXI A;  1JXB A;  3VQ9 A;  1NGI A;  3ENO A;  1K6Y A;  1DLO A;  3VF2 A;  3QET A;  4KH4 A;  3SQ2 A;  2OA8 A;  1K8K A;  3IS9 A;  1T05 A;  3SV3 A;  4LD0 A;  1XC9 A;  4DR5 K;  3O3F A;  2NRR A;  4BRI A;  5JLF A;  1NJI O;  3SPY A;  3OYD A;  4CHO A;  2X74 A;  1IJJ A;  4AHS A;  3G4S N;  2P5G A;  4H0Y B;  4DV7 K;  4LF9 K;  2O8B B;  4ILG B;  4GKJ K;  5AQK A;  4E7H A;  4WFB L;  4CEE A;  1M1K O;  4KHN A;  2ZM6 K;  4JI1 K;  1DKG D;  4L8R B;  1QHT A;  2ZJQ L;  4CJW A;  3FR0 A;  3ZX2 A;  4FYD A;  3SK3 A;  3ZX0 A;  3FZK A;  2HHH K;  1S9E A;  4FPB A;  4JEP A;  3A0I X;  4CEF A;  5KQ8 A;  4IO8 A;  4CIF A;  4DTP A;  4BWJ A;  3CQY A;  3WNH A;  1VQM N;  1VQ9 N;  4CEZ A;  1N33 K;  2KLA A;  3H3O B;  5HBM A;  3SAH A;  2QM1 A;  5JLH A;  4DTN A;  3I0R A;  3Q7C A;  3OA9 A;  5C2D A;  2IVO A;  3VQA A;  3LDO A;  1XC3 A;  1RT6 A;  1EWQ A;  3O80 A;  1YTA A;  2NRX A;  3RMC A;  4HHT A;  4X65 K;  4FVU A;  3CC4 N;  1HR0 K;  3I33 A;  3I8D A;  3CYM A;  4LFA K;  2UXB K;  2A1R A;  1VSF A;  2YJF A;  1NK5 A;  4YOU A;  4EHU A;  1NGF A;  2XHB A;  4CFD A;  4CGI A;  4IJN A;  3LP0 A;  2G8I A;  4KRF A;  3IFR A;  1HJR A;  3TTC A;  3O5B A;  3LAK A;  4BWM A;  2YKN A;  1TL1 A;  2VG7 A;  1QVF M;  3KKS A;  4DWI A;  2P1J A;  1RTJ A;  3KK3 A;  3LP3 A;  4CJF A;  5KQD A;  4B1V A;  4MFB A;  5AQW A;  3FZM A;  5C10 A;  3P1G A;  1BI4 B;  1NWK A;  2IDO A;  2YHX A;  4I6M A;  4WYB A;  4RWT A;  3OTO K;  2P5O A;  3LDQ A;  2HW3 A;  4H4O A;  4C8O A;  1N5Y A;  3HVR A;  3NGY A;  3V9S A;  1U04 A;  3CCS N;  5TKW A;  3DXK A;  4DV6 K;  2QXL A;  3VA0 A;  1RT3 A;  2HBM A;  3TPQ A;  1NGC A;  5HLF A;  1QQM A;  1HYS A;  4CJ7 A;  1NM1 A;  2QWO A;  4M3U A;  4W5Q A;  3PX4 A;  1RDD A;  2X78 A;  3M3Z A;  1RTD A;  2Z1G A;  2HNZ A;  1QZ6 A;  3PSF A;  2EWS A;  5FRO A;  1BA0 A;  4XEI A;  2P9U B;  2E4L A;  3R3L A;  4W5T A;  1G15 A;  1RDA A;  5EVZ A;  3ZSO A;  1S1V A;  2HHW A;  1UA1 A;  4OPJ A;  4DSK A;  3VEZ A;  3NMU A;  4BC2 A;  2CGK A;  5AQN A;  4NLB A;  4QS9 A;  4X62 K;  3IKM A;  3UKR B;  3RTV A;  3HYF A;  5C2F A;  5HL7 L;  2GUP A;  1XNR K;  3OYH A;  4BVP A;  1D4X A;  4IG0 A;  4O5B A;  4OLB A;  4QAG A;  2YHY A;  4YNQ A;  3R8E A;  3NH2 A;  4JKG A;  2ZJR L;  3EN9 A;  3J8A A;  5BRD A;  2XY5 A;  3ZLJ A;  2F8T A;  3L2U A;  2QA4 N;  4H0V B;  4BQL A;  2P9S B;  4FO0 A;  2GWK A;  4KHP K;  3AVI A;  1G99 A;  1EP4 A;  3F2K A;  2HND A;  4CI6 A;  1X9M A;  3L8B A;  3SCX A;  1BL3 A;  2Q36 A;  3ULE A;  1GOA A;  3LDN A;  3KZB A;  4ZTF A;  1BCM A;  5M1F A;  2IAJ A;  2HMI A;  3VMF B;  5AQX A;  2VGM A;  3F73 A;  1RTH A;  3MCA B;  4B8A B;  1ZXO A;  5HRO A;  1ASU A;  1IV0 A;  4PL8 A;  1JCE A;  5SZT A;  4MQ3 A;  4NXN K;  2WTU A;  1SQK A;  5AQH A;  4FK0 A;  1HKC A;  3GDQ A;  3E9L A;  4CZG A;  1IBM K;  4J2D A;  3P38 A;  4CCH A;  2P9N A;  3HST B;  3THX B;  1U2V A;  4CD3 A;  5KPZ A;  4B9U A;  4GV3 A;  1OVY A;  1VQN N;  5E41 A;  1REV A;  3SMP A;  4DQR A;  3CMA N;  4DTJ A;  3BDP A;  5BPL A;  3CQX A;  3VET A;  2F96 A;  1X3M A;  4U67 L;  4BDP A;  4GKK K;  1JLA A;  3UIQ A;  2QEX N;  3QIO A;  3AA3 A;  1T44 A;  4NB4 A;  1QVG M;  4M3X A;  3O1W A;  4H5N A;  2NRV A;  1IO2 A;  3NF9 A;  3M8Q A;  3BY5 A;  5BR8 K;  4OKK A;  4AHT A;  4WQ4 C;  4IOX A;  3LWL A;  3EKS A;  1TKZ A;  1TUY A;  1SV5 A;  4NCG A;  3E9O A;  3KLF A;  1NGA A;  2DY4 A;  4M41 A;  2WC9 A;  3ZT0 A;  3V81 A;  1Y97 A;  3NBP A;  3LPT A;  1C0M A;  4FJL A;  1JL2 A;  1VSM A;  2O4G A;  2UUC K;  1JLE A;  2IVP A;  4JI4 K;  2GWJ A;  4JKA A;  3S3N A;  1VQ5 N;  2E2Q A;  4BAC A;  4Y1C A;  3BUZ B;  1BOT O;  3CC2 N;  3UKU A;  3SQ4 A;  3SLC A;  5TKY A;  4X64 K;  2DFE A;  1S22 A;  4CJ3 A;  3ZYY X;  1FKO A;  4CK3 A;  1RDB A;  2VQF K;  3SAG A;  4BRK A;  1C0T A;  2GX9 A;  4DSI A;  3DWL A;  1VRT A;  3B8A X;  4ZTJ A;  1HQU A;  4KFB A;  2HHV A;  2WBN A;  3JYT A;  5I3U A;  4BR9 A;  5F0X A;  1NGD A;  4JK8 A;  3MXM A;  5JS1 A;  4ISG A;  1FJG K;  2GEM A;  1IKY A;  2D0C A;  1XHX A;  3KLE A;  4E7L A;  3EZ5 A;  4M45 A;  3C7N A;  4E1J A;  4CHN A;  3PX0 A;  4EFH A;  1HNW K;  4C8L A;  2RN2 A;  4CJU A;  1QZ5 A;  2Q31 A;  2O8E A;  1RFQ A;  5KPT A;  3SUO A;  1YVN A;  4EHT A;  2YNF A;  4K41 A;  3LM9 A;  2Q97 A;  4DSF A;  1X9J A;  3QEI A;  4C8M A;  3J80 O;  2HBK A;  1EXQ A;  3LM2 A;  3O3G A;  1TAU A;  4F2R A;  3ZET A;  4CES A;  4FZZ A;  4DR3 K;  4HCB A;  1TUU A;  1I94 K;  4DV2 K;  2QKB A;  4CJQ A;  4BRG A;  4J8F A;  1YI2 N;  4IWV A;  4CBX A;  5A2Q O;  1FXX A;  4FSV A;  5AZI A;  1DTQ A;  4KPY A;  1K73 O;  1SL0 A;  2G8K A;  2BDP A;  4CFC A;  2E5L K;  2PYL A;  4CER A;  3VQQ A;  2ZGZ A;  1A5V A;  2E6L A;  3QES A;  3RVC A;  3QER A;  4JN4 A;  4B1Y B;  1WN7 A;  3BF1 A;  3LAM A;  4BRA A;  4BR0 A;  2P9I B;  2RE2 A;  5CZ2 A;  4OGE A;  2FXU A;  3J7A P;  1U6Z A;  3MCP A;  4DR6 K;  3C6U A;  3O9S A;  3FZF A;  4BR2 A;  1A5W A;  4CZM A;  3VEV A;  5GIP A;  3D2E B;  3NGI A;  5JS2 A;  3PY8 A;  3HP6 A;  1XQS C;  4A5A A;  4CK2 A;  1HPM A;  3D2F B;  3ZEU A;  5F2R A;  1IG8 A;  2KFZ A;  3OYN A;  2ZGY A;  3F5T A;  2JWK A;  1U47 A;  4EZ6 A;  4BR4 A;  2BGG A;  5LMN K;  3LPU A;  3C95 A;  2F9T A;  3LDP A;  4Z4E A;  1JLG A;  5CYM A;  4KB1 A;  3DLB A;  3QB0 A;  3H3N O;  1SAZ A;  1J5E K;  1RCH A;  5BPN A;  2HBJ A;  1E4F T;  4AM7 A;  3S9H A;  4IFY A;  4RW4 A;  5AZJ B;  3TAP A;  5J2Q A; 
#chains in the Genus database with same CATH homology
 4ID5 A;  2YV0 X;  5T7B A;  4B08 A;  4BE2 A;  5HRP A;  1JXB A;  3VQ9 A;  2OPP A;  2GBZ A;  5C24 A;  4CJR A;  3OJS A;  4FM0 A;  4Z4I A;  3SNN A;  1K6Y A;  1DLO A;  1ZBF A;  1CXU A;  1NK6 A;  2AJQ A;  1CZ9 A;  1LW2 A;  5CYQ A;  4CGF A;  3AVL A;  3QET A;  1RBU A;  3SQ2 A;  1S1T A;  5J2N A;  2X6N A;  1IKV A;  3IS9 A;  3SV3 A;  4EP4 A;  1TKT A;  4LD0 A;  1S1W A;  3WNG A;  1T05 A;  4N76 A;  1RBR A;  1XWL A;  4PY5 A;  1XC9 A;  4Z4G A;  3O3F A;  1VSE A;  4CJP A;  1FKP A;  4DFP A;  1VSL A;  1LV5 A;  3VQ4 A;  1NJZ A;  3SPY A;  4DLG A;  3SUN A;  3OYD A;  1NK4 A;  1NJX A;  4FJ7 A;  3AV9 A;  4CHO A;  4AHU A;  1JKH A;  2X74 A;  4HCC A;  4FXD A;  2HHQ A;  4HUG A;  1U45 A;  1W9H A;  3B6P A;  4AHS A;  1BGX T;  3THV A;  3OYF A;  2P5G A;  4FJ5 A;  3DOL A;  1A5X A;  3HK2 A;  2ZD1 A;  3ZSW A;  3OS2 A;  4LH5 A;  4O0J A;  4CJT A;  4E7H A;  1BQM A;  2IC3 A;  3T3F A;  4CEE A;  1IG9 A;  1D8Y A;  4KHN A;  2IGI A;  4FZY A;  4L8R B;  1HYV A;  1QHT A;  2W42 A;  2FBV A;  3SI6 A;  3L3V A;  3PUF A;  4DSJ A;  4CJW A;  2OPQ A;  4KV8 A;  2ZQB A;  1C0U A;  2FBY A;  2X6S A;  3SYZ A;  4FYD A;  4FJH A;  1C1C A;  4JLH A;  3KK2 A;  1WAF A;  3KKR A;  2KZM A;  2NUB A;  1S9E A;  3FFI A;  4CF0 A;  3MAQ A;  4CF1 A;  3M8S A;  1I3A A;  2QXF A;  2HHX A;  4CEF A;  1TKD A;  4DTP A;  4CIF A;  4OPK A;  3I0S A;  2JGU A;  3P83 D;  4Z0U A;  3KIO A;  1GOB A;  4FJ9 A;  2HHU A;  4AIL C;  4CF8 A;  4BWJ A;  4H8K A;  3WNH A;  2Y1I A;  3RMA A;  2G8H A;  4F8R A;  3SQ1 A;  2IS3 A;  4CEZ A;  3SJJ A;  1Q9X A;  5HBM A;  1CXQ A;  3TR8 A;  4DTN A;  3I0R A;  3KD5 E;  2KTQ A;  3DYA A;  4KKO A;  4I2Q A;  2YNH A;  3VQA A;  3QNN A;  4LSL A;  2FBX A;  1Q9Y A;  3H08 A;  4CEB A;  1TK5 A;  1RT6 A;  1YTA A;  4ICL A;  3OYL A;  4CJL A;  4IBN A;  1ZBL A;  2E6M A;  3L2W A;  4FLT A;  3RMC A;  4FJK A;  4F3T A;  1BIS A;  1UA0 A;  4HHT A;  1TVR A;  3IAY A;  3DLG A;  1LWF A;  1Q8I A;  3PO4 A;  4LH4 A;  3V6D A;  3EY1 A;  4BE1 A;  3O4N A;  5KGX A;  2PYJ A;  5K14 A;  3OYK A;  3VQD A;  3I8D A;  3CYM A;  4M42 A;  3NGZ A;  1ZBI A;  4FM2 A;  1HYZ A;  1VSF A;  2A1R A;  2ITG A;  4ZHR A;  3LAL A;  2KQ2 A;  1NK5 A;  1XHZ A;  2PZS A;  3NCI A;  3SUP A;  2DTU A;  2DFF A;  5SWM A;  2OPR A;  1VSH A;  2XHB A;  4BDZ A;  1L3T A;  1LWE A;  1J5O A;  5FRM A;  4CFD A;  4CGI A;  3LP0 A;  3AA5 X;  5KTQ A;  4OVL A;  4FK4 A;  2G8I A;  4KRF A;  3ZT4 A;  1U49 A;  4FZX C;  3U3Y A;  3OYE A;  4E89 A;  1HJR A;  4B3O A;  3D0P A;  3LAK A;  3DLR A;  4BWM A;  2YKN A;  1TL1 A;  2VG7 A;  1Z26 A;  3HJF A;  1KTQ A;  1T7P A;  1VRU A;  4FW1 A;  2OYQ A;  4M3Y A;  3KKS A;  4DWI A;  2P1J A;  1RTJ A;  3KK3 A;  3LP3 A;  4CJF A;  4MFB A;  1J53 A;  5J1E A;  1NKE A;  4J2A A;  4UQG A;  4GW6 A;  3NF6 A;  3P1G A;  1BI4 B;  1VSK A;  1MU2 A;  2Z1J A;  2IDO A;  3ZSZ A;  1T8E A;  4QOZ B;  4Q0B A;  4O4G A;  4N56 A;  1NKC A;  2G8U A;  2P5O A;  2A1S A;  4F2S A;  3U6F A;  2HW3 A;  4XIU A;  4KHY A;  3M8P A;  4H4O A;  4GMJ B;  4C8O A;  1N5Y A;  1VSD A;  4E7I A;  3LP1 A;  3K5O A;  1LWC A;  3HVR A;  4DTR A;  3QEX A;  3NGY A;  5CZ1 A;  4OJR A;  5KGW A;  2I5J A;  3U3G A;  4FCY A;  3V9S A;  1KFS A;  1U04 A;  1W0H A;  4E1M A;  2XY7 A;  2IOC A;  3O4Q A;  1RT1 A;  4AH9 A;  4KB0 A;  3QLH A;  3VA0 A;  1WAJ A;  1RT3 A;  3LP2 A;  4DFM A;  5HLF A;  3ALY A;  1HMV A;  1HYS A;  3AO5 A;  3LDS A;  1SKW A;  2HHS A;  1JLC A;  3A2F A;  4M3U A;  1B92 A;  3AVK A;  1QSS A;  4KHS A;  3IG1 A;  4GVM A;  1KFD A;  3DOK A;  4DQQ A;  4W5Q A;  1NK7 A;  2G8F A;  3ZT3 A;  1RDD A;  2X78 A;  3WNF A;  4FLW A;  3PX4 A;  1RTD A;  4CHQ A;  1S9G A;  2HNZ A;  2Z1G A;  3BGR A;  2HNY A;  2LSN A;  3ISN C;  4CJE A;  4DTX A;  1SUQ A;  3AVA A;  5FRO A;  1TAQ A;  2XY6 A;  4W5T A;  2E4L A;  3TAB A;  2G8V A;  1G15 A;  1RDA A;  1QE1 A;  3ZSO A;  4DF4 A;  1S1V A;  1NOY A;  4FJM A;  3V9Z A;  2OA8 A;  2HHW A;  1UA1 A;  4OPJ A;  3AVM A;  4HVJ A;  4JRQ A;  4CJV A;  2Q3S A;  1L3V A;  2B4J A;  4LY7 A;  4DG1 A;  1TGO A;  4DSK A;  3QIN A;  3M8R A;  4W5N A;  4RG8 A;  4HUE A;  3ZCM A;  4CEQ A;  1D9F A;  3K5N A;  1GOC A;  3V1O A;  3SZ2 A;  1JLQ A;  4RW9 A;  3NH1 A;  4KHU A;  1KLM A;  4DQP A;  4CEO A;  4B9M A;  1WNS A;  3VQC A;  4CIG A;  3KK1 A;  3E01 A;  3HYF A;  3ZSY A;  3JSM A;  3RTV A;  3MXI A;  3OYI A;  3NF8 A;  2PY5 A;  4KTQ A;  4FLV A;  3HO1 A;  3ITH A;  1B9D A;  3OYH A;  3ZT2 A;  3O3H A;  3CM6 A;  1KRP A;  5J2M A;  1BHL A;  1QSL A;  3VN5 A;  3SV4 A;  2QKB A;  4IG0 A;  2ATQ A;  1WSH A;  4ELT A;  1QQC A;  4O5B A;  1LAV A;  4OLB A;  1ZBU A;  4QAG A;  2XO7 A;  1TL3 A;  4DF8 A;  1X9W A;  4YNQ A;  4O44 A;  3NH2 A;  3TI0 A;  3NH0 A;  2XY5 A;  2F8T A;  3OYJ A;  3L2U A;  3V9W A;  2YHB A;  3OYM A;  3VA3 A;  3DM2 A;  3LZI A;  2Z1H A;  5FRN A;  3ZSR A;  4FM1 A;  1J9A A;  4I7F A;  4DU1 A;  2HB5 A;  3AVI A;  1EP4 A;  1RBV A;  2Z1I A;  4C8N A;  1BIU A;  4YFU A;  2R7Y A;  3QEV A;  3TAE A;  3L2V A;  3ULD A;  2HND A;  1BCO A;  5EU7 A;  3DRR A;  1X9M A;  1D9D A;  3RR8 A;  1D5A A;  4E0D A;  3L8B A;  3SCX A;  1BL3 A;  3AO2 A;  3C6T A;  1U4B A;  2OZS A;  3RMB A;  1KLN A;  1CLQ A;  1GOA A;  3MEE A;  4N47 A;  1RT4 A;  1SKR A;  4ZTF A;  4E7K A;  1BCM A;  3B6O A;  4PA1 A;  4Z4C A;  2B5J A;  2IAJ A;  4NYF A;  3V1Q A;  3VQB A;  2HMI A;  3HM9 A;  3TAQ A;  4F3O A;  4AHC A;  4J2E A;  1ZBH A;  4B8C A;  4B9T A;  3DLK A;  1VSJ A;  1BQN A;  1RTH A;  3OVN A;  4OKJ A;  3F73 A;  3CQ8 A;  1NK8 A;  4B8A B;  4DTS A;  4FJJ A;  5HRO A;  3VQ7 A;  2D0A A;  1ASU A;  1WLJ A;  4FLX A;  5SZT A;  3KLG A;  4MQ3 A;  1BI4 A;  1KCF A;  3PO5 A;  4DS5 A;  5J2P A;  1WSF A;  4Y1D A;  2QKK A;  2XRI A;  3CG7 A;  4FK0 A;  3MXJ A;  4J2D A;  4CCH A;  3HST B;  1R0A A;  3AO1 A;  1N6Q A;  4DS4 A;  4CJS A;  4FW2 A;  3T19 A;  3CFP A;  4NCA A;  3NHG A;  4FLY A;  4B9U A;  1C1A A;  1Z25 A;  3P5J A;  4DSE A;  4JS5 A;  4O55 A;  4RW8 A;  3ZSQ A;  3OS0 A;  5E41 A;  3S3M A;  3EYZ A;  1REV A;  4W5R A;  4DQR A;  1IKX A;  4DTJ A;  1X1P A;  1SL2 A;  3BDP A;  4KTW A;  4ELU A;  2F96 A;  4FJN A;  1CZB A;  4BDP A;  1JLA A;  4E1N A;  3UIQ A;  4I9Q A;  4KTZ A;  3QIO A;  3AA3 A;  3V9X A;  1DTT A;  2HHT A;  4WE1 A;  4M3X A;  3LWM A;  4IFV A;  4I2P A;  3CFR A;  1TKX A;  1IO2 A;  1LAW A;  2OPS A;  3NF9 A;  3KLI A;  2D0B A;  3M8Q A;  1WSG A;  1L3S A;  4Z4F A;  5I42 A;  4FJI A;  4LSN A;  4OKK A;  4AHT A;  4CHY A;  3LWL A;  3L2R A;  1X9S A;  2RPI A;  3DMJ A;  1TKZ A;  4IG3 A;  4EP5 A;  1XI1 A;  3DLH A;  1RT7 A;  3SUQ A;  4EZ9 A;  1SV5 A;  2VWJ A;  1FK9 A;  4NCG A;  4CK1 A;  4AHR A;  4BE0 A;  4DTM A;  1T03 A;  2OZM A;  3KLF A;  1C6V A;  2DY4 A;  4W5O A;  3K5L A;  4M41 A;  5C42 A;  1NK0 A;  3ZT0 A;  3AA2 A;  3V81 A;  4DQS A;  1S6Q A;  1Y97 A;  3NBP A;  3LPT A;  1C0M A;  3T1A A;  3KJV A;  1JL2 A;  4ELV A;  4FJL A;  3MEG A;  1VSM A;  2O4G A;  1JLE A;  4KI4 A;  1I39 A;  3TAM A;  1QSY A;  3DLE A;  3ZSX A;  3OYB A;  4AHV A;  1ITG A;  3S3N A;  4DLE A;  1UWB A;  1EX4 A;  4PQU A;  3NE6 A;  4R5P A;  3AO3 A;  4BAC A;  4CJ4 A;  4Y1C A;  4KI6 A;  3RMD A;  2HVH A;  2HVI A;  4DMN A;  1QTM A;  2JLE A;  1LW0 A;  4N41 A;  4OKE A;  1IKW A;  2GV9 A;  4HUF A;  3SQ4 A;  2ZE2 A;  4M3Z A;  4DTU A;  4NCB A;  3IRX A;  2BAN A;  4CIE A;  4K8X A;  4FLZ A;  3QEW A;  2DFE A;  3QO9 A;  4CJK A;  4CJ3 A;  1NJY A;  1YTU A;  3OYC A;  1FKO A;  3SQ0 A;  4CK3 A;  4NYN A;  1NJW A;  2D5R A;  4ID1 A;  5C25 A;  1RDB A;  2EHG A;  3LAN A;  1S1X A;  4KAZ A;  3OY9 A;  4M3W A;  2YKM A;  1TV6 A;  2Y1J A;  3AA4 A;  1IH7 A;  1C0T A;  3AVG A;  4CJ5 A;  3C94 A;  4DFK A;  4DSI A;  1S1U A;  4FJG A;  2FC0 A;  2VG6 A;  4CF2 A;  1VRT A;  1WSI A;  5HP1 A;  4ZTJ A;  1HQU A;  4KFB A;  2HHV A;  3L2Q A;  3OYA A;  3JYT A;  3L3U A;  5I3U A;  3K57 A;  3LZJ A;  3K59 A;  3AVJ A;  3D45 A;  1RBS A;  1S6P A;  3TWH A;  4B9N A;  3DRP A;  3MXM A;  1JLF A;  4FK2 A;  5JS1 A;  1HNI A;  2ETJ A;  3RWU A;  4B9L A;  1IKY A;  3VQE A;  3TAG A;  2D0C A;  1VSI A;  5DK5 A;  1RTI A;  1XHX A;  3KLE A;  3KTQ A;  2EX3 A;  4E7L A;  2BE2 A;  3TAR A;  3KLH A;  4H4M A;  1RDC A;  4M45 A;  3EZ5 A;  3V9U A;  3VQ5 A;  4CHN A;  3PX0 A;  5KI6 A;  1F21 A;  3DI6 A;  3TAN A;  5FDL A;  1L3U A;  3ASM A;  4QCL A;  2WON A;  4C8L A;  2RN2 A;  3MEC A;  4CJU A;  1JL1 A;  4CEC A;  2P51 A;  3HVT A;  3SUO A;  3HT3 A;  4DQI A;  5KRS A;  4FVM A;  4BDY A;  1WSJ A;  1C1B A;  3KD1 E;  3QEP A;  4I9L A;  4PWD A;  3HP9 A;  2YNF A;  2QK9 A;  3OYG A;  3K58 A;  5HRS A;  4DSF A;  3QEI A;  4C8M A;  4FJ8 A;  5D3G A;  3TAF A;  1EXQ A;  5KRT A;  3O3G A;  3WNE A;  1HRH A;  1NKB A;  4F2R A;  1TAU A;  3HPH A;  4CHZ A;  2FBT A;  4RW6 A;  3VQ6 A;  2KZZ A;  4CES A;  4FZZ A;  4DU4 A;  4HCB A;  2VWK A;  1U48 A;  1HNV A;  1QS4 A;  1VK0 A;  4CJQ A;  1S5J A;  4KO0 A;  3F9K A;  1WSE A;  1SL1 A;  2RF2 A;  2KFN A;  1NK9 A;  1YVU A;  4Z4H A;  4CE9 A;  4J2B A;  2XY8 A;  4IKF A;  4F4K A;  3V1R A;  4CGJ A;  1FXX A;  4CGG A;  3AVC A;  4B9S A;  5HRN A;  3RRH A;  3PV8 A;  1DTQ A;  4DU3 A;  3NFA A;  4KPY A;  1TK8 A;  3QNO A;  1KSP A;  1TK0 A;  1JXE A;  1SL0 A;  2G8K A;  2BDP A;  1KVB A;  4CFC A;  2PYL A;  1ZYQ A;  4CER A;  3VQQ A;  4CHP A;  2WOM A;  4OLA A;  4KRE A;  1RBT A;  3K2P A;  1A5V A;  1JLB A;  3MED A;  1HPZ A;  2E6L A;  2KW4 A;  3CFO A;  3VQ8 A;  4N5S A;  3HXM A;  4JS4 A;  3QES A;  3AVB A;  3QER A;  4KHW A;  4E7J A;  3S3O A;  4RW7 A;  1YT3 A;  1WN7 A;  3RRG A;  3LAM A;  4IDK A;  1ASW A;  4CGH A;  4CED A;  4E19 A;  3QIP A;  1KVC A;  3HPO A;  4KHQ A;  5HRR A;  4CFB A;  4C8K A;  5CZ2 A;  2VG5 A;  4DTO A;  4OGE A;  1EET A;  3RR7 A;  1RIL A;  1UOC A;  3K5M A;  3V4I A;  4K8Z A;  4DSL A;  3AVN A;  5DMR A;  1L5U A;  3C6U A;  2GUI A;  3NAE A;  1A5W A;  2O4I A;  3NGI A;  2YNI A;  4HTU A;  5JS2 A;  4Q5V A;  4OGC A;  1EKE A;  3ZSV A;  4E3S A;  2RKI A;  3G10 A;  2YNG A;  4G1Q A;  4O0I A;  4CFA A;  3AVF A;  3HP6 A;  1J54 A;  3PY8 A;  4JRP A;  3AO4 A;  4CK2 A;  3OJU A;  4DFJ A;  3NDK A;  2G8W A;  1NOZ A;  3DRS A;  4B9V A;  4M3T A;  2KFZ A;  2F8S A;  1RNH A;  3AVH A;  3VQP A;  3OYN A;  1ASV A;  3HL8 A;  4CEA A;  4FLU A;  4FJX A;  1U47 A;  4EZ6 A;  2DFH A;  2BGG A;  3LPU A;  3C95 A;  4PUO A;  3PX6 A;  4Z4E A;  1SKS A;  1JLG A;  5CYM A;  4KB1 A;  3HPG A;  1B9F A;  3DLB A;  1BIZ A;  1RT5 A;  4TSX A;  1HQE A;  3CM5 A;  2B6A A;  2YHA A;  3NF7 A;  1RCH A;  4M3R A;  3ZT1 A;  4CGD A;  3OS1 A;  4CF9 A;  3SPZ A;  1KVA A;  1O1W A;  4IFY A;  3S9H A;  4RW4 A;  1RT2 A;  3G0Z A;  5CY4 A;  1UAX A;  3TAP A;  5J2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...