3CM6A

Crystal structure of cell-death related nuclease 4 (crn-4) bound with er
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
294
structure length
294
Chain Sequence
HCPFDTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFERVLPLVVTTIRAGDFRLEMYGVCRYCRKGMDVCGTSHQQTPHDLYKNEEDPIHFAKIAGYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell death-related nuclease 4
publication title Crystal structure of CRN-4: implications for domain function in apoptotic DNA degradation
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase, apoptosis
total genus 87
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cm6A01
2VG7A 1XC9A 3VQ5A 4I2PA 3S9HA 1VSFA 4I7FA 4DU1A 4N76A 4DWIA 1CZBA 4OKKA 5HRPA 2KFNA 3L2UA 4BDYA 4IBNA 1XWLA 1FKOA 2XHBA 1J53A 1J9AA 4FCYA 3IAYA 1WN7A 1S1WA 1WSIA 2IS3A 4OKEA 1BHLA 4M42A 3K5LA 3SQ1A 3CFOA 2F96A 4CJTA 4N5SA 4B9SA 4J2BA 3HSTB 4FLXA 4CJRA 5KGXA 3TAQA 4Z4IA 3CQ8A 1C1BA 3A2FA 4DLGA 3TI0A 3HM9A 4CHOA 4DSFA 1IKXA 2OPRA 3M8PA 3K57A 1REVA 3OS2A 3NAEA 3LANA 1T05A 1LAWA 2HNYA 3BGRA 3TAMA 3V9WA 1MU2A 4FK4A 1FKPA 3P83D 1LAVA 2HB5A 3SV3A 3ZT2A 4IKFA 3DI6A 4CJ5A 3LP2A 5KRTA 3CYMA 4F3TA 1RDBA 2QKKA 3OYJA 3CM5A 3S3MA 1A5WA 4K8ZA 3C6TA 3DM2A 3LZJA 2ZD1A 1RT1A 1WSGA 1S5JA 4HHTA 3SUOA 1NK7A 1TK0A 3VA3A 1T7PA 3RRGA 4C8MA 1SKWA 2BE2A 3ZSOA 4HUGA 4C8OA 3VQDA 1J5OA 2BDPA 4G1QA 1VSKA 4YFUA 3VQBA 4CEQA 1Q9XA 4CESA 4CJQA 4F2RA 3ZT1A 4K8XA 3L3VA 3HPOA 4FLUA 2OA8A 3B6PA 4RW7A 4PA1A 4LH4A 1D9FA 2OPQA 4KTWA 2BGGA 4HUFA 4QOZB 4E0DA 2IGIA 4ID1A 2FC0A 4O44A 2R7YA 4DTSA 1D5AA 3S3NA 1UOCA 1BL3A 2DFFA 1GOBA 3K5MA 1N6QA 1RT7A 4WE1A 3AVHA 5J2QA 3CG7A 4H4MA 4CFDA 3OYMA 3OYBA 3RMDA 3AO2A 1NJZA 3AVNA 1X9SA 3OS1A 4IG3A 4B8AB 1YT3A 4M41A 1DLOA 1HMVA 1WAFA 2IAJA 4EP4A 1T03A 3VQPA 4BDPA 3LPUA 2B5JA 4E89A 3NDKA 3DYAA 4CIEA 3PX0A 1RCHA 4W5RA 3QIOA 5JS1A 4DFJA 1G15A 1KTQA 3RTVA 3T3FA 4CJPA 4RW4A 4Z4HA 1D8YA 4M3XA 4ZTFA 4IG0A 4KFBA 3NH2A 2Z1JA 4OLBA 4CGHA 4W5NA 2Y1JA 3AVFA 3IS9A 4XIUA 4DTOA 1VSDA 3RRHA 3B6OA 2HHTA 5HROA 1F21A 3LZIA 1K6YA 3NFAA 1SL0A 4Z4EA 3SUNA 3VQQA 1D9DA 1XHXA 3SQ4A 1NJXA 4UQGA 4FM0A 3M8SA 3HP9A 3AA4A 4KTZA 4CJFA 2RPIA 4CFBA 3KK3A 2ZQBA 3D0PA 1SKRA 4Q0BA 3RMCA 4KHSA 3NH0A 2O4GA 3LDSA 3VA0A 1S1UA 1ASVA 1ITGA 1SV5A 4W5OA 3OYKA 4JRPA 2HHVA 2IC3A 3MEEA 1JL2A 5CZ1A 4DTPA 1O1WA 4TSXA 4KB0A 4JS4A 1ZBLA 1WAJA 2G8UA 4KI6A 3AA3A 4CF1A 4AHTA 1R0AA 5DK5A 1L5UA 3DRPA 2EHGA 5CYQA 1HQEA 1ZBUA 4CECA 4CHYA 1KVCA 4E7LA 3MAQA 1UAXA 3PX6A 1BI4B 3V9UA 3DOLA 4H8KA 1RTDA 4F3OA 3QERA 4CJUA 4B9UA 3V9ZA 1TGOA 4I9QA 3HJFA 3VQ6A 3TARA 1ASUA 5HRSA 1RILA 4B9LA 4FXDA 5KGWA 1TL1A 4FLZA 4CEZA 3AO4A 4CE9A 5KI6A 4GW6A 1RTHA 1TKZA 3KLFA 3KLHA 3KK2A 4CGIA 3PY8A 4DLEA 4C8KA 4F8RA 3SQ2A 2GUIA 3NGIA 4BDZA 4B3OA 4DS5A 2DY4A 1VSJA 3O3FA 4JS5A 2A1RA 3QNOA 3AVLA 3DLRA 1BI4A 4CGFA 3HP6A 2XRIA 4CJSA 1C0UA 3VN5A 5E41A 3KKSA 4E1MA 2PY5A 3UIQA 3TABA 3DRRA 2OYQA 4DSKA 4FJLA 5FRNA 3ASMA 4FZYA 2JLEA 1C1CA 2X6SA 2IOCA 4JRQA 1A5XA 2OZMA 3OYDA 1UA0A 1Q8IA 3HPHA 3NF7A 3VQ7A 1TKDA 4E7HA 1WSJA 4QCLA 3P1GA 2YKNA 3BDPA 3HXMA 1LWFA 3QNNA 1S1VA 4FJ5A 4KB1A 1RT5A 3U3GA 4DFPA 1NK6A 3AVGA 4ZHRA 1L3SA 1BIUA 2X6NA 4L8RB 4AHSA 3F9KA 4DF4A 2LSNA 3WNFA 5KTQA 3QEVA 3RMBA 3SPYA 4GMJB 2YHBA 2D0BA 4N47A 1QSYA 3L3UA 4CJVA 3K58A 2YV0X 1TKXA 2GBZA 3V1QA 3S3OA 4O4GA 3HPGA 2G8VA 3KLEA 2YHAA 3HT3A 1UA1A 1WLJA 3TAPA 3V81A 1NK5A 1J54A 3OYGA 2P1JA 4FVMA 3AVKA 2KQ2A 4FLYA 4FJNA 4AH9A 1ASWA 4BACA 2BANA 4CJLA 3G0ZA 3LP1A 3TANA 2DFEA 1JL1A 3AVCA 4BE1A 3LAMA 3NBPA 4DQRA 1ZBFA 4RW8A 4PWDA 4LD0A 4DFKA 3M8QA 4KKOA 3VQ9A 1LWCA 3WNHA 4HVJA 3AO1A 4M3WA 1C0MA 1RDAA 2FBVA 1JLQA 1KVBA 3NHGA 4CJWA 2B4JA 4HTUA 1UWBA 3ZSVA 1YTUA 5K14A 1L3VA 1I3AA 2FBTA 1EP4A 1JKHA 3AV9A 4YNQA 4CJEA 4PY5A 4KREA 3AA5X 4CERA 1HRHA 2VG5A 4E7IA 1JLGA 3SQ0A 1LWEA 1TAUA 4H4OA 3DLBA 4DTMA 4J2EA 4DMNA 3NGYA 4Z4CA 3ALYA 3LP0A 3RR7A 3VQCA 4OGEA 1QS4A 3PO5A 2HHQA 3ZSXA 4IDKA 4FZZA 4E7JA 4BWMA 1RBTA 1IO2A 1HPZA 2P51A 4DTRA 3LWLA 4FJ8A 3TAFA 3OYCA 4CCHA 4KI4A 2XY5A 3LAKA 5DMRA 3C95A 4DSEA 4DU4A 1RBRA 1LW0A 4FJ9A 1XHZA 1VSMA 3L8BA 2VWJA 3TWHA 3SNNA 2KTQA 1RT3A 3RWUA 1VRTA 3AVAA 3QO9A 1IKVA 5I42A 3TAEA 1KFSA 3K59A 4MQ3A 3T19A 1RT6A 3LP3A 4FJMA 3WNEA 1TL3A 1WNSA 4C8LA 2Y1IA 4BWJA 4J2AA 4N41A 3TAGA 3OYEA 3HO1A 3OYHA 4DFMA 2FBYA 1X9WA 4ICLA 1EETA 5D3GA 3CM6A 4AHRA 5CZ2A 5KRSA 4E3SA 1U47A 3MEGA 1GOAA 3V4IA 2E6LA 2A1SA 1EKEA 4RW9A 3EY1A 1HNVA 1KRPA 4CGGA 3D45A 1QQCA 3E01A 1LV5A 4B08A 1YTAA 2ITGA 3SUQA 3QEIA 3QLHA 4CHPA 4FLWA 5J2PA 4CK2A 5HP1A 3ZT3A 4AHUA 4DQPA 3OYFA 4B9TA 1S6PA 5C24A 4LSNA 1X1PA 2JGUA 2PYLA 1VSLA 4KHYA 1RT4A 3JYTA 3NCIA 3V9XA 3AVBA 4CF8A 1S6QA 1U45A 1JXEA 1Y97A 1SKSA 3L2RA 2G8FA 4FM1A 1BIZA 3K5OA 1SL1A 2F8TA 2KZZA 4OKJA 1BGXT 4OVLA 2HMIA 2YNIA 4OPKA 4Y1DA 1VRUA 2X78A 1X9MA 2HVHA 4M45A 3KD5E 5I3UA 3O3GA 4F2SA 1GOCA 4NYFA 1Z26A 1NK8A 4IFYA 4NCAA 3QEXA 3OJSA 3PX4A 3DLEA 4LH5A 3OY9A 2GV9A 4FLVA 1RT2A 5HLFA 1IG9A 3DRSA 4CHZA 1KSPA 4CHNA 3I8DA 2E6MA 1NK0A 4RG8A 4O0JA 4RW6A 3OJUA 4C8NA 3ZSYA 2VWKA 4BE2A 4FJKA 2Z1HA 1RBUA 3K2PA 5J1EA 2XY7A 3QIPA 3FFIA 1VSIA 3NF8A 4CJKA 1U4BA 1NJWA 3HK2A 3PUFA 3U3YA 2HNZA 3AVIA 4GVMA 4AHVA 1C0TA 4CGJA 4CK1A 2IDOA 4HUEA 2G8IA 2HW3A 4QAGA 3KLGA 3VQEA 4ZTJA 1N5YA 2G8HA 3HL8A 4Z0UA 4CGDA 3SV4A 3JSMA 1HYZA 4W5TA 3CFPA 2G8KA 3KKRA 1WSFA 3KTQA 4KTQA 4FJXA 4M3YA 1ZBHA 1NK9A 2F8SA 4CFAA 1NOZA 1TK5A 3OYIA 4NCGA 5SZTA 3M8RA 3RMAA 1U49A 1TV6A 4FW2A 4W5QA 2B6AA 1QHTA 4OGCA 4CFCA 3DLHA 1JLAA 4ID5A 1NKCA 2YNFA 3NH1A 1KFDA 3LALA 3L2WA 3THVA 1U48A 1HQUA 4DSLA 4KRFA 2ATQA 1IKWA 4CF2A 3QEPA 3DMJA 3OYNA 1RDCA 3KIOA 4DQQA 1HYVA 1WSHA 2D0AA 4FK0A 1S9GA 2P5GA 4J2DA 4CEEA 3SYZA 4KHNA 4FZXC 1RDDA 2YKMA 5EU7A 2Z1GA 5CY4A 1TAQA 3MECA 2X74A 4CEFA 2G8WA 3O4NA 3RR8A 4FJHA 3OYAA 1HYSA 4IFVA 2D0CA 3AO5A 4AILC 4CJ3A 2KW4A 2HNDA 4CIGA 5C42A 1NKBA 3C6UA 4DTUA 4OJRA 1VSEA 4OPJA 1ZBIA 3ISNC 1SL2A 4ELVA 4R5PA 4DU3A 4Z4FA 2OZSA 4E19A 3G10A 4JLHA 2WOMA 2W42A 3CFRA 1T8EA 1LW2A 1C6VA 4DG1A 2PYJA 1XI1A 4NCBA 2HVIA 1NKEA 4B8CA 1EXQA 1JLCA 4CF0A 2RKIA 1I39A 4E7KA 1NJYA 4LY7A 4O5BA 3ZT0A 3QEWA 4ELUA 3NF6A 3WNGA 4LSLA 2HHXA 1Z25A 4AHCA 1Q9YA 5JS2A 2ETJA 1QTMA 3NE6A 3QETA 3KD1E 4KHUA 3SJJA 2DFHA 4CEBA 4EP5A 1IH7A 1WSEA 5HRRA 4CEDA 4DSIA 3TR8A 3H08A 4NYNA 3VQ4A 1RTIA 4N56A 1YVUA 4CIFA 3MXIA 2PZSA 4FJ7A 5HBMA 3OS0A 3V1RA 4OLAA 1JLFA 4DSJA 3QESA 3AA2A 1KLMA 3NF9A 4I9LA 1IKYA 3HVTA 3I0RA 1CZ9A 2WONA 3VQ8A 4B9VA 3MEDA 2DTUA 2ZE2A 3ZSWA 1TK8A 3V6DA 1W9HA 2HHSA 3C94A 1JLBA 2OPPA 3ZT4A 1W0HA 2KFZA 4EZ9A 3DLKA 3V9SA 3O3HA 1EX4A 4ELTA 4DTJA 2XO7A 4DTNA 1QSSA 3KJVA 4M3RA 1VK0A 3QINA 5FROA 5C25A 3ITHA 3HVRA 5J2NA 3KLIA 1CLQA 3I0SA 2XY6A 3KK1A 3MXJA 3EZ5A 4MFBA 4CHQA 4FJGA 4FJJA 1ZYQA 2AJQA 2NUBA 4M3UA 2QK9A 1SUQA 5CYMA 2P5OA 2QKBA 4HCBA 3SI6A 4CEAA 4KAZA 5FRMA 3AVJA 4PQUA 2OPSA 3SUPA 2HHWA 4EZ6A 4FJIA 1KVAA 1L3TA 4CF9A 3V1OA 1NOYA 4PUOA 2KZMA 2EX3A 3SZ2A 4DQSA 1BISA 1B9FA 1B9DA 3LPTA 3NGZA 1FK9A 3AO3A 3P5JA 4BE0A 4DTXA 4DF8A 4KHWA 3HYFA 4I2QA 5FDLA 2O4IA 5T7BA 3K5NA 4O55A 1A5VA 3PO4A 1KCFA 1DTTA 1S1XA 3AVMA 3MXMA 4FYDA 1CXUA 3SPZA 2FBXA 1RBSA 1BCOA 4HCCA 2D5RA 4Y1CA 1NK4A 3OVNA 3L2QA 4CJ4A 3SCXA 4KO0A 2XY8A 1U04A 1HJRA 3VQAA 4B9NA 4O0IA 4M3ZA 4M3TA 3OYLA 1B92A 1CXQA 3DLGA 1BCMA 1BQNA 3IRXA 3O4QA 4KV8A 1L3UA 3F73A 1TKTA 1VSHA 2QXFA 4DS4A 2VG6A 2Z1IA 4Q5VA 1QSLA 1JLEA 1RNHA 4FW1A 4KHQA 1S9EA 4B9MA 4Z4GA 1HNIA 1C1AA 3ULDA 3ZSZA 3DOKA 1BQMA 3T1AA 1RBVA 3LWMA 1FXXA 4DQIA 4E1NA 3U6FA 4KPYA 4CEOA 3ZCMA 2E4LA 5SWMA 3PV8A 4FK2A 2Q3SA 5J2MA 3IG1A 3ZSRA 1KLNA 5HRNA 3ZSQA 4FLTA 4F4KA 1RTJA 1S1TA 2RN2A 2RF2A 1JXBA 4CK3A 1TVRA 2YNHA 3L2VA 3EYZA 2YNGA 1QE1A 2HHUA 1DTQA 4FM2A 2I5JA
chains in the Genus database with same CATH superfamily
2VG7A 5GIPA 1VQON 4I2PA 5BRFA 1VSFA 1NGFA 2QWOA 3L2UA 4BDYA 2W41A 2XHBA 2UXBK 1J9AA 4OKEA 4V19S 1BHLA 3K5LA 2UXCK 4FLXA 5LMUK 3TAQA 4DLGA 4JKAA 3HM9A 4CHOA 1Z6RA 3EE8A 3NAEA 1NGCA 1T05A 3VERA 1MU2A 2QWNA 4FWLA 2HB5A 3H6EA 4BR5A 4CJ5A 3CYMA 4GV9A 3OYJA 3CM5A 2CGKA 3J81O 3SK3A 1RT1A 1WSGA 1S5JA 4HHTA 1NK7A 1TK0A 2P9NA 1T7PA 5AQRA 5BR9A 2HOEA 3H3NO 4G1QA 3VQBA 2UU9K 1Q9XA 4F2RA 3L3VA 3HPOA 5HOOA 4IOAL 1D9FA 2WUSA 4KTWA 4QOZB 4E0DA 4K41A 4O44A 3S3NA 1RT7A 4WE1A 1LCUA 3AVHA 4H5VA 4CFDA 3OS1A 4B8AB 2E2OA 4A59A 1YT3A 4BC4A 2OTLN 4EP4A 1T03A 3D2FA 5AQQA 3PSFA 3CETA 3QIOA 3MN9A 4DFJA 5JLHA 3CIPA 1KTQA 4BVPA 3ID8A 1C0FA 3AVFA 4GNIA 1F21A 1K6YA 3NFAA 3VETA 3SUNA 3VQQA 1JJ2M 4Z4EA 5EXWA 3DXMB 3D0PA 3KK3A 2ZQBA 2QI2A 2V7ZA 2E1ZA 5AQWA 3MCAB 2CGJA 2Q1NA 1ASVA 2HHVA 4CD1A 5CZ1A 5JMVA 4TSXA 1YJ9N 1RFQA 2BH1A 2NLXA 4PL8A 1WBDA 3AA3A 4AHTA 1L5UA 5CYQA 1HQEA 4E7LA 4CHYA 1KVCA 1VQPN 3MAQA 1UAXA 4LF4K 3QERA 3GBTA 5HRSA 2V51B 4DB3A 4CEZA 1TYQB 3GOIA 1QVFM 1QQNA 2NNWA 1P90A 4CZHA 3NGIA 3QNOA 3DLRA 5E41A 2WC9A 3VN5A 2PY5A 4E1MA 1WB9A 3TABA 2OYQA 1C1CA 2X6SA 4IZ9A 1KQSM 2GWKA 4JRQA 3QBWA 4FO0A 1Q8IA 3THYB 3P1GA 2YKNA 3QNNA 1LWFA 2KZMA 1NK6A 1L3SA 3CCJN 3CJ1A 4JV5K 3HSCA 3BEXA 3F2KA 2LSNA 3QEVA 3RMBA 1MWMA 4LFCK 2D0BA 4JI4K 1QSYA 4CJVA 2ASPA 3M1FA 2YV0X 1TKXA 2G8VA 4O4GA 1YJWN 1UA1A 1NK5A 3KHYA 1J54A 5AQPA 3OYGA 2P1JA 3AVKA 1YITN 3VTIA 4BACA 2DFEA 2QWMA 4I6MB 1EQYA 3NBPA 3PSIA 3LDNA 4LFAK 3R6MA 3CCSN 1GLLO 2FSKA 1C0MA 2NRHA 2FBVA 2P9PB 1JLQA 2B4JA 3SMPA 4O8KA 1GLBG 1I3AA 1JKHA 1KAZA 4CJEA 1QZ6A 1HRHA 1JLGA 2E2NA 2ZWHA 1N8RO 3PO5A 1BWFO 3CPWM 4JHDB 5JICA 3TAFA 3OYCA 1OH6A 4DU4A 3VGLA 1GLAG 5TKYA 2FF3B 2KTQA 1RT3A 1IKVA 1KFSA 5C0YA 3T19A 1RT6A 4FJMA 4C8LA 3P4IA 4J2AA 4GKKK 3OYHA 1HR0K 4H5NA 4WCEL 5MLCQ 1VQKN 3TSPA 3MX5A 3U8XA 4AHRA 1EKEA 4RW9A 3AY9A 1HNVA 4CGGA 4NLCA 1LV5A 5FPEA 3QEIA 4FLWA 5HP1A 4AHUA 3CERA 3OYFA 2RHKA 1VSLA 1RT4A 3V9XA 4IO8A 3AVBA 1S6QA 3CJ9A 4FM1A 3DXMA 3K5OA 2F8TA 1BGXT 3R9PA 2X78A 4JEPA 4M45A 3O3GA 2HF4A 1QZ5A 4JNEA 4U67L 4NYFA 3MWPA 1HKGA 4IFYA 4ILHA 3DLEA 5KPTA 4LH5A 5GIOA 4FLVA 1RT2A 3DRSA 1NGEA 3IDHA 3OJUA 1EWRA 3G6EN 1HLUA 3QIPA 4MLEA 3U3YA 4CK1A 2G8IA 4K0KK 4QAGA 1N5YA 3HL8A 4PL7A 4YOUA 3CFPA 4FJXA 1NK9A 4YDUA 3CCVN 4CFAA 1NOZA 2E20A 2HHHK 1Q86O 4BRHA 1U49A 2BTFA 4FW2A 4W5QA 1HJOA 3DLHA 1NKCA 3NH1A 3THVA 4PKGA 1JCEA 4JK7A 3DMJA 1NGIA 1RDCA 1HYVA 2ZGYA 1N36K 1W2BM 5M1FA 1X3NA 2P5GA 1R59O 3CJAA 2PFUA 4CEEA 1XNRK 2YJEA 2Z1GA 3MECA 5KQ8A 1HNWK 1HYSA 4IFVA 2D0CA 3J7ZO 1ATNA 4AILC 3UKRB 2KW4A 5C42A 1NKBA 4DTUA 3FZLA 1NLVA 3G10A 4JLHA 1T8EA 2QWPA 1LW2A 4DG1A 2PYJA 3KZBA 1W97L 1IBMK 2HVIA 1NKEA 1KD1O 1JLCA 2RKIA 4O5BA 4K43A 5BPMA 5KPRA 3ENBA 2HHXA 4WFAL 4B1VA 5JS2A 4ILJA 1QTMA 5BN9A 3KD1E 4KHUA 4CEBA 3FGUA 3AAPA 4N56A 3KWGA 4CIFA 4FJ7A 4WFBL 3O9TA 3V1RA 1JLFA 5BPNA 1IKYA 3WEEB 3BY5A 2ASOA 1K73O 2HBKA 3MEDA 2ZE2A 3H45C 3V6DA 2HHSA 4FWNA 4FOEA 5LJVA 4WQ5A 3DLKA 2AP1A 4KH4A 3O3HA 1QQOA 4ELTA 4DTJA 4WQ4A 4M3RA 3ITHA 4BY9C 4M7XA 2PBDA 2NUBA 2NRRA 1SUQA 4KAZA 4H0YB 4K25A 2OPSA 2O8DA 3VEOA 1T3VA 2EX3A 3E9LA 4ISFA 2QWQA 2ZM6K 5CE3A 1CXUA 4WFNL 2FBXA 1RBSA 4JI5K 4LF6K 4CVNE 3L2QA 1DEJA 2XY8A 1U04A 4JK8A 1XMQK 3OYLA 1B92A 3DLGA 4BROA 1BQNA 3O4QA 3ENOA 2QXFA 2AA4A 4Q5VA 1MDUB 2VGMA 4Z4GA 3ULDA 3T1AA 4A5BA 3C6HA 5AQOA 4E1NA 2YCHA 3ZSRA 5AQMA 4CD3A 4FLTA 4YDUC 2YNHA 2YNGA 1QE1A 3S9HA 2WTUA 3QFUA 4IO9L 2VQEK 2KFNA 3P39A 4FCYA 1YVNA 4B1WB 3IAYA 4M42A 1S1WA 2IS3A 3CFOA 4N5SA 4B9SA 2P9NB 4BR0A 5KGXA 2IVNA 3TI0A 4DSFA 2OPRA 4C23A 3K57A 3BGRA 2HSTA 3SV3A 3ZT2A 3DI6A 3ZX2A 1RDBA 3S3MA 4K8ZA 3M3ZA 3C6TA 3DM2A 2ZD1A 4YY3K 4JKCA 2YHYA 4C1NI 2QXLA 4HUGA 4C8OA 1VSKA 4K8XA 4CESA 3D2FB 4FLUA 5M1OA 3EEQA 5AQYA 4UY8O 3L6QA 1K8KA 3I56N 4ID1A 3QDKA 4JI0K 3M5RA 2O8BA 3UKUA 2QWRA 1BL3A 3K5MA 1KC8O 3DWLA 4H4MA 3OYBA 1X9SA 4DV2K 3AVNA 4DR7K 1BO5O 2CH6A 1DLOA 4JKBA 4BDPA 3C6AA 2B5JA 4E89A 4DV6K 2D4WA 1QHAA 3EZWA 1WUAA 4Z4HA 1D8YA 3W3DA 2Z1JA 4YOTA 3RRHA 3B6OA 2HHTA 5HROA 1Q81O 1Q7YO 3M6GA 4JKGB 5JLFA 4WQ5C 4H03B 1XHXA 5E26A 3SQ4A 4UQGA 4FM0A 3AA4A 2RPIA 4CFBA 1SKRA 1NU0A 4L3QA 3RMCA 2GX9A 3S41A 2ZF5O 3OYKA 2YHWA 2IC3A 1JL2A 4B9QA 3QICA 5C2DA 3T1YK 2G8UA 4KI6A 1NWKA 5DK5A 1HKBA 1ZBUA 4CECA 3DOLA 2V52B 4CJUA 3O5BA 4AM6A 1RILA 4B9LA 4FLZA 3F5TA 2F4VK 4GW6A 4CZKA 1TKZA 3KK2A 1TUYA 3SQ2A 1IBKK 4XH1A 2KKZA 4BDZA 2DY4A 1VSJA 2A1RA 3AVLA 1BI4A 2XRIA 3KKSA 2A40A 3A8YA 4H5WA 3DRRA 4DSKA 5FRNA 2JLEA 3CJBA 3WXJA 3G4SN 2IOCA 3OYDA 1UA0A 1TKDA 4E7HA 1WSJA 4FWOA 3BDPA 3THWB 3AVGA 4IWVA 4ZHRA 1DT9A 4QS8A 5LMNK 4XH4A 4DF4A 3VEYA 3AAQA 5KTQA 2YHBA 5AZJB 3CC2N 2F7TA 4JD2A 3V1QA 4BG9A 3S3OA 3KLEA 2CH5A 1WLJA 4NLBA 1JCGA 1QQMA 4FJNA 1EO1A 2P9UA 4AH9A 3G0ZA 1JL1A 2NZTA 2QTDA 4RW8A 3CC4N 4PWDA 4LD0A 4HVJA 4M3WA 1OVQA 4Z94A 1E4FT 3NHGA 4CJWA 1FW6A 2J4RA 3ZSVA 1YTUA 5K14A 3AV9A 2PAVA 3ENHA 4KREA 5AQSA 3C65A 3SQ0A 2A6AA 3DLBA 4JI7K 4J2EA 4Z4CA 3LP0A 3RR7A 3O9RA 4BGAA 3H3OB 3ZSXA 4H0XB 1QVGM 1ZXOA 4BWMA 3LWLA 4IEEA 3K0SA 5DMRA 3C95A 4RCHA 3Q7BA 5KPZA 3NVKA 3SNNA 4MDBA 4R79A 3R8EA 3A5OC 3QO9A 5I42A 3TAEA 3K59A 3CCMN 3EE9A 4MQ3A 3LP3A 5BR8K 1TL3A 1WBBA 5FPDA 3OYEA 3CCQN 5IT9O 3HM8A 4CZFA 4ICLA 3RVCA 3TSUA 5D3GA 1GOAA 5EOYA 3EY1A 4GVEA 5FPNA 1KRPA 3E01A 3GDQA 3MN6A 3VEVA 3A5NC 5JVHL 4CHPA 3O9QA 3ZT3A 1S6PA 4LSNA 1X1PA 2JGUA 4CZLA 1SKSA 4JKGA 5AFUH 3SBTA 1BIZA 1HNXK 1YJNN 4Y1DA 4CZGA 3KD5E 3CD6N 1GOCA 3QMLA 2H3GX 4KH6A 4NCAA 2IVPA 3OJSA 5HL7L 2GV9A 4JI6K 1IG9A 5HLFA 1RGIA 4DR3K 4CHNA 3FLCO 4C1NK 4C8NA 4BE2A 1RBUA 1I94K 3Q7CA 3K2PA 5J1EA 4BC2A 1VSIA 4CJKA 1U4BA 1NJWA 3PUFA 3GE1A 3AVIA 4GVMA 4CGJA 1HNZK 3KLGA 2CGLA 1CZAN 2NRXA 4Z0UA 4EIAA 3JAMO 3SV4A 4QS9A 1HYZA 4M3YA 1OKJA 3DAWA 4OO1J 4YOXA 2Q31A 4CW7B 4Y0WA 1TK5A 4NCGA 3O8MA 3FZKA 1GLDG 1QHTA 3EKUA 4AQYK 4ID5A 5EY4A 1ATRA 4CF2A 3THWA 1S9GA 3LL3A 4FZXC 3O08A 5EU7A 4JAXA 2QWLA 4AM7A 2I7PA 5AZJA 1YHQN 4CIGA 1VSEA 4OPJA 2WBNA 4DU3A 4Z4FA 2W42A 3CFRA 1HPMA 4BRLA 4JN4A 3RSEA 1OH5A 4NCBA 3ATUA 2E88A 1NJYA 3OA9A 5FLXO 4LY7A 3QEWA 3NF6A 1Q9YA 4H0TB 1X9JA 4YHHK 3QETA 2WFBA 1IH7A 3PLAA 4DQ8A 3H08A 3K9KA 3IFRA 3VQ4A 3IKMA 3BUZB 2PZSA 2V7YA 1EWQA 1S72N 3I0RA 2DTUA 2E2PA 2UYTA 2O8DB 1W0HA 4EZ9A 2NRWA 4BR4A 3V9SA 1EX4A 4LF5K 1QSSA 1VK0A 3QINA 1KAXA 3KLIA 3KK1A 3MXJA 4FJGA 5AQJA 5CYMA 4JKDA 2O8CA 5FRMA 3AVJA 3SUPA 3IMXA 1KVAA 2OCEA 1NOYA 3A0IX 1BISA 3NGZA 4KHWA 1J5EK 4I2QA 3K5NA 1A5VA 2A5XA 1KCFA 1U6ZA 1DTTA 1S1XA 3G71N 3SPZA 3C0BA 1BCOA 3CI5A 2O8FA 3MMVA 4HCCA 2D5RA 2P9KA 3OVNA 4CJ4A 5CR4A 1HJRA 1QSLA 1JLEA 4FW1A 4KHQA 1HNIA 4X65K 3DOKA 1LOTB 1RBVA 3LWMA 4KHPK 1FXXA 3U6FA 4EFHA 3OTOK 5SWMA 2E4LA 3VENA 4FK2A 5J2MA 2P9SA 5HRNA 4EHUA 2RN2A 2RF2A 5GAGP 4CK3A 1TVRA 3L2VA 1DTQA 4MLHA 1H1VA 5AR0A 3C7NA 4DU1A 4DWIA 1CZBA 5HRPA 4IFEA 1XWLA 4YOYA 1WN7A 4WYBA 3THXA 5H1SQ 3MN7A 3SQ1A 2QM1A 2F96A 3HSTB 4BR9A 4Z4IA 1C0GA 3A2FA 3KVGA 3LDQA 1IKXA 3M8PA 4JI3K 3HZ6A 1LAWA 2FF6A 5AZIA 3MN5A 3P83D 4DR4K 3OW2M 1K8KB 1OVYA 4FWSA 4IKFA 4RTFD 3E66A 2O8EA 2QKKA 2O8BB 3UKUB 1NM1A 3RR8A 3SUOA 4BRDA 2A42A 2Q2RA 3WQTA 3CF5L 1SKWA 3I8BA 1NGGA 3RRGA 3ZSOA 3WXMB 4CEQA 2QA4N 3O9UA 4IJAA 4CJQA 3CMEN 4RW7A 4LH4A 3R3LA 2OPQA 1N33K 1WOQA 2BGGA 4YOWA 2IGIA 2FC0A 4DTSA 4CZJA 1NG9A 1UOCA 2QW9A 3D2EA 4CBUA 1N6QA 3WQUA 3RMDA 1NJZA 3AO2A 4M41A 3D6RA 1HMVA 1BU6O 1WAFA 4FWRA 4J2DA 3VQPA 3U4LA 1G15A 3RTVA 4CJPA 3EL2A 2I7NA 1K9MO 4KFBA 3NH2A 2Y1JA 2D0PA 3IS9A 4AF1A 3OHRA 4XIUA 1VSDA 3CJCA 3GL1A 3LZIA 1SL0A 3FZHA 4KRFA 3M8SA 3HP9A 4BRCA 4Q0BA 3TSQA 1U2VA 4JI8K 3ULEA 2O4GA 4FWQA 1JCFA 1ITGA 3WXLA 4JRPA 3MEEA 2P9IA 2NRVA 4DTPA 1MWKA 1O1WA 3OBYA 2ASMA 4KB0A 1ZBLA 1R0AA 1BDGA 1YUWA 2D0OA 3J8AA 1BI4B 3O1BA 3V9UA 4H8KA 1XUPO 3ID6A 4B9UA 3TARA 1ASUA 3A5MC 3EO3A 4FXDA 5KGWA 1TL1A 3AO4A 4BRNA 4CE9A 1XNQK 3KLFA 3KLHA 4F8RA 4CGIA 4RWTA 1VQNN 3LDOA 2NRZA 4DS5A 1IJJA 2IVOA 3UIQA 4LF9K 4FJLA 3FZFA 5AQLA 3T1HK 2UXDK 3VGMA 4B3TK 1A5XA 4DCHA 4JD2B 3T69A 3HPHA 3VQ7A 3CMAN 4QCLA 2NRTA 3HXMA 4FJ5A 1S1VA 4KB1A 4DFPA 2P9UB 3GG4A 5AQZA 2Q97A 1VQ8N 3I33A 5BN8A 3CQYA 4AHSA 4X64K 3F9KA 2HF3A 1BA0A 3PIPL 3WNFA 3SPYA 2GWJA 2E5LK 3L3UA 3SLCA 3VF2A 2VQFK 3SAHA 1Q18A 2GBZA 3EN9A 3HPGA 3U9DA 5EVZA 2YHAA 3HT3A 3TAPA 3V81A 4FVMA 4FLYA 2KQ2A 2YX6A 1NGHA 3CHWA 4CJLA 2GEMA 4BE1A 3AVCA 1YXQA 3LAMA 2UUCK 4JYAK 4DFKA 4KKOA 3VQ9A 1LWCA 5GADP 5LJWA 1GLCG 1KVBA 4HTUA 1L3VA 1EP4A 2FSNA 5C12A 4DR2K 3AA5X 2VG5A 1LWEA 3UE5A 4GV3A 1VQ6N 4DMNA 3N4PA 4CZMA 3ALYA 3L0QA 2HHQA 1QS4A 4BRFA 4IDKA 4FZZA 1K8AO 1IO2A 3HRGA 4FJ8A 4CCHA 1KAYA 4HWIA 4DUYK 2XY5A 4KI4A 3LAKA 4DSEA 1RBRA 1NNEA 3L8BA 2GUPA 4H0VB 4JI1K 3WNEA 2Y1IA 1D4XA 4BWJA 5AQHA 4DV7K 3KWIA 3TAGA 3SBGA 3E9PA 4DFMA 4BC3A 2FBYA 5BRHA 3AGRA 3CM6A 4WQ4C 5CZ2A 3DXKB 5KRSA 4E3SA 1U47A 2OANA 3MEGA 3V4IA 2A1SA 3KK7A 3CXCM 1GLEG 1QQCA 4B08A 1YTAA 3R1XA 3CCRN 2OTJN 5J2PA 5C10A 4B9TA 5AJ3K 1RDWX 3CJ7A 2PYLA 3JYTA 3NCIA 4CF8A 1ESVA 1Y97A 2G8FA 3L2RA 1M1KO 2KZZA 2HMIA 4OVLA 1ILYA 2YNIA 4LFBK 5I3UA 5ADXH 3ZETA 1NGBA 2Q0UA 3LDLA 5AQVA 3QEXA 4IXCA 5KQDA 3OY9A 1SAZA 4HTLA 3TU5A 4BRQA 5AQXA 1KSPA 3I8DA 2E6MA 4RG8A 4RW6A 3ZSYA 2VWKA 2XY7A 1Q82O 3NF8A 4DUZK 2HNZA 2JWLA 2HW3A 2IDOA 1ATSA 4DV5K 3VQEA 1T44A 4IEIA 4CGDA 4FL9A 3JSMA 2YJFA 4W5TA 2G8KA 4KTQA 3KKRA 1WSFA 3KTQA 1ZBHA 4B1ZA 1E4GT 3OYIA 5SZTA 4FSVA 1TV6A 2UUAK 4OGCA 4CFCA 1VAZA 3LDPA 2YNFA 1KFDA 3LALA 3L2WA 1XQSC 4O8UA 4DR1K 5JVGL 3SAFA 5M1QA 3OYNA 3KIOA 4FWMA 1WSHA 2D0AA 4FK0A 4U7BA 3BZKA 1X3MA 3RSEB 4KHNA 1RDDA 2FSJA 2YKMA 4KH5A 5CY4A 2ITMA 2X74A 3O4NA 4FJHA 3OYAA 3AO5A 2HBJA 4NO7A 4OJRA 4X62K 1ZBIA 4ELVA 4R5PA 4PHTX 2OZSA 3D7EO 2WOMA 1XI1A 4B8CA 1EXQA 4JKEA 4DV3K 4CF0A 1I39A 4E7KA 3WT0A 3ZT0A 4PKHA 4BQLA 2W6KA 3WNGA 4ELUA 5AQIA 1Z25A 4AHCA 4M7YA 2ETJA 4YOVA 3NE6A 1WSEA 4FVUA 5HRRA 2BUPA 4CEDA 4DSIA 3TR8A 1SZ2A 4KBOA 3MXIA 5AQFA 3PIOL 4OLAA 4DSJA 3QESA 3AA2A 3NF9A 3HVTA 4G9ZA 4B9VA 1KXPA 1VHXA 4DR6K 4B1YB 2IIRA 5BRDA 2ZJRL 3C94A 1JLBA 2O8CB 4NXMK 3ZT4A 2KFZA 1YI2N 4BRGA 2XO7A 4ILGB 5C25A 3I0SA 2KHOA 3CC7N 3EZ5A 4FJJA 4CHQA 1ZYQA 2O8FB 4M3UA 2QK9A 2P9KB 3DXKA 2UUBK 2P5OA 2QKBA 4HCBA 4PQUA 2D1KA 2HHWA 4CF9A 3V1OA 4PUOA 5M1KA 3SZ2A 4DQSA 4BE0A 3LPTA 1YAGA 4DF8A 3AO3A 3P5JA 2O4IA 5T7BA 3PO4A 3ZEUA 5B8HA 3AVMA 3NVMA 4X66K 2P9SB 1DKGD 1S3XA 1J6ZA 3O80A 4B9NA 4O0IA 4M3ZA 4B3RK 1CXQA 4KV8A 1L3UA 2P9LA 3F73A 1VSHA 4DS4A 2VG6A 2Z1IA 2VGNA 1RNHA 4B9MA 4B3SK 3C7NB 1VQ7N 4BVOA 1HKCA 4DQIA 4CEOA 4J8FA 1HX1A 3CQXA 3THXB 1T6CA 3IG1A 1KLNA 3ZSQA 4OPAA 3MK6A 4A2BA 4F4KA 1RTJA 1JXBA 3EYZA 2F9WA 2I5JA 1XC9A 5E84A 4WF9L 3VQ5A 3WXIA 4I7FA 5AZIB 4N76A 4OKKA 4A57A 3TPQA 4IBNA 1FKOA 1J53A 2O8EB 1WSIA 4CJTA 4J2BA 4CJRA 3SJHA 4FWPA 3P31A 3CQ8A 1C1BA 3EKSA 3N4QA 3HOTA 1REVA 3OS2A 3LANA 2HNYA 3TAMA 3V9WA 4BRPA 4FK4A 1FKPA 1LAVA 1T6DA 4GV6A 2FXUA 3VPZA 3LP2A 5KRTA 5A2QO 4F3TA 1A5WA 3LZJA 4DV1K 3D2EB 3O6WA 3VA3A 2HBMA 4C8MA 3DLLL 2BE2A 3B8AX 3VQDA 2BDPA 1P8ZA 4YFUA 2E1YA 3ZT1A 4H5RA 2OA8A 3B6PA 4PA1A 3FR0A 4HUFA 3VEZA 3VF4A 3U9ZA 5GAEP 2R7YA 1D5AA 2DFFA 1GOBA 1E3MA 5J2QA 3CG7A 3OYMA 1W7AA 5LL6Z 4IG3A 5AQNA 4MO5A 5CHIA 4DV0K 5ADXA 2IAJA 4BRMA 5DM7L 3LPUA 3NDKA 3DYAA 4CIEA 1U2VB 3PX0A 3ULEB 1RCHA 4LC9B 3H1QA 3OBWA 4W5RA 5JS1A 3T3FA 4RW4A 2F9TA 2P9IB 4M3XA 4ZTFA 4IG0A 4OLBA 3LM9A 4W5NA 4CGHA 3VOVA 4DTOA 4BRAA 4OX9K 3HBTA 3UB5A 1D9DA 1NJXA 1NK8A 4KTZA 4CJFA 5DM6L 2HMPA 2RE2A 1GLJO 4KHSA 3NH0A 3H46O 4BR2A 4FWKA 3LDSA 1S1UA 3VA0A 1N34K 1SV5A 4B1XB 4W5OA 2YI1A 2ZJPL 4JS4A 5FPMA 1WAJA 3ATVA 4CF1A 4DV4K 3DRPA 2EHGA 3ZX0A 3PX6A 4CZEA 1Z05A 4M63C 1RTDA 1BA1A 4F3OA 3DJCA 3G25A 5ELZA 3V9ZA 1TGOA 4I9QA 3HJFA 3VQ6A 3SMSA 4BRIA 4IOXA 4JKHA 5KI6A 1RTHA 4C8KA 3PY8A 4DLEA 3BZCA 4CBWA 2GUIA 4B3OA 5AQKA 4JS5A 3O3FA 4CGFA 3HP6A 3ZX3A 4CJSA 1C0UA 1OH7A 1GLFO 4OPHA 3IUCA 3CCUN 3E9OA 2EWSA 4DHYA 4PKIA 3ASMA 2E8AA 4FZYA 2OZMA 3J7YP 3NF7A 1TYQA 5BPLA 2DPNA 1RDUA 1RT5A 3U3GA 1XC3A 3A5LC 1BIUA 1VQ4N 2X6NA 4L8RB 3HI0A 1N32K 1IG8A 4CJ7A 4E1JA 4NB4A 4GMJB 2KLAA 4N47A 2YHXA 3K58A 3THYA 3VTHA 1VQLN 1ASWA 4A61A 2BANA 3JXUA 3LP1A 3TANA 4DQRA 3MDQA 5TKWA 1ZBFA 3M8QA 3WNHA 4BRKA 3AO1A 2Q36A 1RDAA 5AQUA 4A62A 2QEXN 1UWBA 2FBTA 5GAHP 4YNQA 4PY5A 4CERA 4E7IA 1OH8A 1TAUA 4H4OA 4LF7K 4DTMA 3NGYA 1HUXA 3AGKA 4I6MA 3VQCA 4OGEA 5AFUA 4E7JA 1RBTA 4H0OA 1HPZA 2P51A 2W40A 1FJGK 4DTRA 3O9SA 1VQ9N 3SAGA 5C15A 1V4SA 1IBLK 5GINA 2P9PA 3FE1A 2GELA 1LW0A 4FJ9A 1XHZA 3O4WA 1VSMA 2VWJA 3TWHA 4CI6A 3BP8A 1VRTA 1ZBSA 3AVAA 3RWUA 1XMOK 3FFKB 1WNSA 4N41A 3L4IA 3BF3A 3E1YA 4YORA 3TTFA 4BQZA 3HO1A 4JHDA 4ISEA 1X9WA 1EETA 2W6LA 3MCPA 2E6LA 3HTVA 4FOIA 3ZETB 3W0LA 3D45A 3MX2A 5M1PA 3TTDA 4CZIA 4IOCL 3SUQA 2ITGA 3QLHA 5F1XA 1BG3A 4CK2A 4NXNK 4DQPA 3QB0A 5C24A 2VCPA 3K9JA 3J7AP 4KHYA 1U45A 1J5OA 1JXEA 1NGDA 3VMFB 3VEWA 1SL1A 4OKJA 4H0PA 1X9MA 4FPBA 4OPKA 1VRUA 2HVHA 1NGAA 4DKWA 5IWAK 3JS6A 4F2SA 1Z26A 3VF6A 3TTCA 3ZYYX 4BREA 3PX4A 2JWKA 4CHZA 1NK0A 4O0JA 4FJKA 2Z1HA 3CPEA 3FFIA 3HK2A 4IJNA 3VEXA 4AHVA 1C0TA 4O5FA 4HUEA 4ZTJA 2G8HA 3AARA 4BG8A 4B1UB 1BUPA 3P38A 2F8SA 5F2RA 4GKJK 3M8RA 3RMAA 4F9OA 2B6AA 1NJIO 1DGKN 1JLAA 4JK9A 1U48A 1HQUA 5M1NA 3CCEN 4EAHD 4QS7A 5AQGA 4DSLA 2ATQA 1IKWA 3BF1A 3QEPA 3NMUA 5F0XA 4DQQA 3I55N 3MWTA 1NBWA 2VWBA 1G99A 4ISGA 2HBLA 3CCLN 3SYZA 5AQTA 1TAQA 4CEFA 2G8WA 4MDAA 5LY3A 1NGJA 3J80O 4CJ3A 2HNDA 3T7ZA 3C6UA 3ISNC 1SL2A 4K42A 4JI2K 4E19A 3L4QA 2A3ZA 1M90O 1C6VA 4CBXA 3ZLJA 4DR5K 4BGBA 4JKFA 4XEIA 5BREA 4LSLA 4B3MK 3UKRA 3VESA 3SJJA 2DFHA 4EP5A 2E2QA 3LM2A 1NMDA 4NYNA 1RTIA 4IDHA 1YIJN 4H5TA 4FPAA 1YVUA 5HBMA 3OS0A 1KLMA 2ZGZA 4I9LA 4GY2B 1CZ9A 2WONA 1NMNA 1TUUA 3VQ8A 3ZSWA 2ZJQL 1TK8A 1W9HA 1ZC6A 3QBXA 4MO4A 1O13A 2OPPA 4A5AA 4A2AA 4DTNA 3KJVA 5FROA 3HVRA 5J2NA 1CLQA 3ZEUB 2XY6A 3WEEA 4MFBA 2AJQA 5I9EB 2Q0RA 1YF5L 3F9MA 3WXKA 3HOSA 1SQKA 3SI6A 4CEAA 3WUHA 2FLOA 1SS6A 5C2FA 4EZ6A 4FJIA 1L3TA 2P9LB 1MA9B 1B9FA 1B9DA 4DTXA 1FK9A 3HYFA 2GTDA 5FDLA 4O55A 4FYDA 3MXMA 4Y1CA 1NK4A 1VQMN 3SCXA 2A41A 4KO0A 3VQAA 5EX5A 4M3TA 2VYPA 1BCMA 3IRXA 1TKTA 4XH5A 3O1WA 1S9EA 1C1AA 3FZMA 3ZSZA 4LF8K 1BQMA 4KPYA 1V4TA 4BC5A 3QFPA 1S22A 1Y64A 3ZCMA 3PV8A 1IV0A 4EHTA 2Q3SA 4BR7A 3VGKA 3H1VX 1S1TA 1VQ5N 2HHUA 4FM2A 1BOTO
chains in the Genus database with same CATH topology
2VG7A 1XC9A 3VQ5A 4I2PA 3S9HA 1VSFA 4I7FA 4DU1A 4N76A 4DWIA 1CZBA 4OKKA 5HRPA 2KFNA 3L2UA 4BDYA 4IBNA 1XWLA 1FKOA 2XHBA 1J53A 1J9AA 4FCYA 3IAYA 1WN7A 1S1WA 1WSIA 2IS3A 4OKEA 1BHLA 4M42A 3K5LA 3SQ1A 3CFOA 2F96A 4CJTA 4N5SA 4B9SA 4J2BA 3HSTB 4FLXA 4CJRA 5KGXA 3TAQA 4Z4IA 3CQ8A 1C1BA 3A2FA 4DLGA 3TI0A 3HM9A 4CHOA 4DSFA 1IKXA 2OPRA 3M8PA 3K57A 1REVA 3OS2A 3NAEA 3LANA 1T05A 1LAWA 2HNYA 3BGRA 3TAMA 3V9WA 1MU2A 4FK4A 1FKPA 3P83D 1LAVA 2HB5A 3SV3A 3ZT2A 4IKFA 3DI6A 4CJ5A 3LP2A 5KRTA 3CYMA 4F3TA 1RDBA 2QKKA 3OYJA 3CM5A 3S3MA 1A5WA 4K8ZA 3C6TA 3DM2A 3LZJA 2ZD1A 1RT1A 1WSGA 1S5JA 4HHTA 3SUOA 1NK7A 1TK0A 3VA3A 1T7PA 3RRGA 4C8MA 1SKWA 2BE2A 3ZSOA 4HUGA 4C8OA 3VQDA 1J5OA 2BDPA 4G1QA 1VSKA 4YFUA 3VQBA 4CEQA 1Q9XA 4CESA 4CJQA 4F2RA 3ZT1A 4K8XA 3L3VA 3HPOA 4FLUA 2OA8A 3B6PA 4RW7A 4PA1A 4LH4A 1D9FA 2OPQA 4KTWA 2BGGA 4HUFA 4QOZB 4E0DA 2IGIA 4ID1A 2FC0A 4O44A 2R7YA 4DTSA 1D5AA 3S3NA 1UOCA 1BL3A 2DFFA 1GOBA 3K5MA 1N6QA 1RT7A 4WE1A 3AVHA 5J2QA 3CG7A 4H4MA 4CFDA 3OYMA 3OYBA 3RMDA 3AO2A 1NJZA 3AVNA 1X9SA 3OS1A 4IG3A 4B8AB 1YT3A 4M41A 1DLOA 1HMVA 1WAFA 2IAJA 4EP4A 1T03A 3VQPA 4BDPA 3LPUA 2B5JA 4E89A 3NDKA 3DYAA 4CIEA 3PX0A 1RCHA 4W5RA 3QIOA 5JS1A 4DFJA 1G15A 1KTQA 3RTVA 3T3FA 4CJPA 4RW4A 4Z4HA 1D8YA 4M3XA 4ZTFA 4IG0A 4KFBA 3NH2A 2Z1JA 4OLBA 4CGHA 4W5NA 2Y1JA 3AVFA 3IS9A 4XIUA 4DTOA 1VSDA 3RRHA 3B6OA 2HHTA 5HROA 1F21A 3LZIA 1K6YA 3NFAA 1SL0A 4Z4EA 3SUNA 3VQQA 1D9DA 1XHXA 3SQ4A 1NJXA 4UQGA 4FM0A 3M8SA 3HP9A 3AA4A 4KTZA 4CJFA 2RPIA 4CFBA 3KK3A 2ZQBA 3D0PA 1SKRA 4Q0BA 3RMCA 4KHSA 3NH0A 2O4GA 3LDSA 3VA0A 1S1UA 1ASVA 1ITGA 1SV5A 4W5OA 3OYKA 4JRPA 2HHVA 2IC3A 3MEEA 1JL2A 5CZ1A 4DTPA 1O1WA 4TSXA 4KB0A 4JS4A 1ZBLA 1WAJA 2G8UA 4KI6A 3AA3A 4CF1A 4AHTA 1R0AA 5DK5A 1L5UA 3DRPA 2EHGA 5CYQA 1HQEA 1ZBUA 4CECA 4CHYA 1KVCA 4E7LA 3MAQA 1UAXA 3PX6A 1BI4B 3V9UA 3DOLA 4H8KA 1RTDA 4F3OA 3QERA 4CJUA 4B9UA 3V9ZA 1TGOA 4I9QA 3HJFA 3VQ6A 3TARA 1ASUA 5HRSA 1RILA 4B9LA 4FXDA 5KGWA 1TL1A 4FLZA 4CEZA 3AO4A 4CE9A 5KI6A 4GW6A 1RTHA 1TKZA 3KLFA 3KLHA 3KK2A 4CGIA 3PY8A 4DLEA 4C8KA 4F8RA 3SQ2A 2GUIA 3NGIA 4BDZA 4B3OA 4DS5A 2DY4A 1VSJA 3O3FA 4JS5A 2A1RA 3QNOA 3AVLA 3DLRA 1BI4A 4CGFA 3HP6A 2XRIA 4CJSA 1C0UA 3VN5A 5E41A 3KKSA 4E1MA 2PY5A 3UIQA 3TABA 3DRRA 2OYQA 4DSKA 4FJLA 5FRNA 3ASMA 4FZYA 2JLEA 1C1CA 2X6SA 2IOCA 4JRQA 1A5XA 2OZMA 3OYDA 1UA0A 1Q8IA 3HPHA 3NF7A 3VQ7A 1TKDA 4E7HA 1WSJA 4QCLA 3P1GA 2YKNA 3BDPA 3HXMA 1LWFA 3QNNA 1S1VA 4FJ5A 4KB1A 1RT5A 3U3GA 4DFPA 1NK6A 3AVGA 4ZHRA 1L3SA 1BIUA 2X6NA 4L8RB 4AHSA 3F9KA 4DF4A 2LSNA 3WNFA 5KTQA 3QEVA 3RMBA 3SPYA 4GMJB 2YHBA 2D0BA 4N47A 1QSYA 3L3UA 4CJVA 3K58A 2YV0X 1TKXA 2GBZA 3V1QA 3S3OA 4O4GA 3HPGA 2G8VA 3KLEA 2YHAA 3HT3A 1UA1A 1WLJA 3TAPA 3V81A 1NK5A 1J54A 3OYGA 2P1JA 4FVMA 3AVKA 2KQ2A 4FLYA 4FJNA 4AH9A 1ASWA 4BACA 2BANA 4CJLA 3G0ZA 3LP1A 3TANA 2DFEA 1JL1A 3AVCA 4BE1A 3LAMA 3NBPA 4DQRA 1ZBFA 4RW8A 4PWDA 4LD0A 4DFKA 3M8QA 4KKOA 3VQ9A 1LWCA 3WNHA 4HVJA 3AO1A 4M3WA 1C0MA 1RDAA 2FBVA 1JLQA 1KVBA 3NHGA 4CJWA 2B4JA 4HTUA 1UWBA 3ZSVA 1YTUA 5K14A 1L3VA 1I3AA 2FBTA 1EP4A 1JKHA 3AV9A 4YNQA 4CJEA 4PY5A 4KREA 3AA5X 4CERA 1HRHA 2VG5A 4E7IA 1JLGA 3SQ0A 1LWEA 1TAUA 4H4OA 3DLBA 4DTMA 4J2EA 4DMNA 3NGYA 4Z4CA 3ALYA 3LP0A 3RR7A 3VQCA 4OGEA 1QS4A 3PO5A 2HHQA 3ZSXA 4IDKA 4FZZA 4E7JA 4BWMA 1RBTA 1IO2A 1HPZA 2P51A 4DTRA 3LWLA 4FJ8A 3TAFA 3OYCA 4CCHA 4KI4A 2XY5A 3LAKA 5DMRA 3C95A 4DSEA 4DU4A 1RBRA 1LW0A 4FJ9A 1XHZA 1VSMA 3L8BA 2VWJA 3TWHA 3SNNA 2KTQA 1RT3A 3RWUA 1VRTA 3AVAA 3QO9A 1IKVA 5I42A 3TAEA 1KFSA 3K59A 4MQ3A 3T19A 1RT6A 3LP3A 4FJMA 3WNEA 1TL3A 1WNSA 4C8LA 2Y1IA 4BWJA 4J2AA 4N41A 3TAGA 3OYEA 3HO1A 3OYHA 4DFMA 2FBYA 1X9WA 4ICLA 1EETA 5D3GA 3CM6A 4AHRA 5CZ2A 5KRSA 4E3SA 1U47A 3MEGA 1GOAA 3V4IA 2E6LA 2A1SA 1EKEA 4RW9A 3EY1A 1HNVA 1KRPA 4CGGA 3D45A 1QQCA 3E01A 1LV5A 4B08A 1YTAA 2ITGA 3SUQA 3QEIA 3QLHA 4CHPA 4FLWA 5J2PA 4CK2A 5HP1A 3ZT3A 4AHUA 4DQPA 3OYFA 4B9TA 1S6PA 5C24A 4LSNA 1X1PA 2JGUA 2PYLA 1VSLA 4KHYA 1RT4A 3JYTA 3NCIA 3V9XA 3AVBA 4CF8A 1S6QA 1U45A 1JXEA 1Y97A 1SKSA 3L2RA 2G8FA 4FM1A 1BIZA 3K5OA 1SL1A 2F8TA 2KZZA 4OKJA 1BGXT 4OVLA 2HMIA 2YNIA 4OPKA 4Y1DA 1VRUA 2X78A 1X9MA 2HVHA 4M45A 3KD5E 5I3UA 3O3GA 4F2SA 1GOCA 4NYFA 1Z26A 1NK8A 4IFYA 4NCAA 3QEXA 3OJSA 3PX4A 3DLEA 4LH5A 3OY9A 2GV9A 4FLVA 1RT2A 5HLFA 1IG9A 3DRSA 4CHZA 1KSPA 4CHNA 3I8DA 2E6MA 1NK0A 4RG8A 4O0JA 4RW6A 3OJUA 4C8NA 3ZSYA 2VWKA 4BE2A 4FJKA 2Z1HA 1RBUA 3K2PA 5J1EA 2XY7A 3QIPA 3FFIA 1VSIA 3NF8A 4CJKA 1U4BA 1NJWA 3HK2A 3PUFA 3U3YA 2HNZA 3AVIA 4GVMA 4AHVA 1C0TA 4CGJA 4CK1A 2IDOA 4HUEA 2G8IA 2HW3A 4QAGA 3KLGA 3VQEA 4ZTJA 1N5YA 2G8HA 3HL8A 4Z0UA 4CGDA 3SV4A 3JSMA 1HYZA 4W5TA 3CFPA 2G8KA 3KKRA 1WSFA 3KTQA 4KTQA 4FJXA 4M3YA 1ZBHA 1NK9A 2F8SA 4CFAA 1NOZA 1TK5A 3OYIA 4NCGA 5SZTA 3M8RA 3RMAA 1U49A 1TV6A 4FW2A 4W5QA 2B6AA 1QHTA 4OGCA 4CFCA 3DLHA 1JLAA 4ID5A 1NKCA 2YNFA 3NH1A 1KFDA 3LALA 3L2WA 3THVA 1U48A 1HQUA 4DSLA 4KRFA 2ATQA 1IKWA 4CF2A 3QEPA 3DMJA 3OYNA 1RDCA 3KIOA 4DQQA 1HYVA 1WSHA 2D0AA 4FK0A 1S9GA 2P5GA 4J2DA 4CEEA 3SYZA 4KHNA 4FZXC 1RDDA 2YKMA 5EU7A 2Z1GA 5CY4A 1TAQA 3MECA 2X74A 4CEFA 2G8WA 3O4NA 3RR8A 4FJHA 3OYAA 1HYSA 4IFVA 2D0CA 3AO5A 4AILC 4CJ3A 2KW4A 2HNDA 4CIGA 5C42A 1NKBA 3C6UA 4DTUA 4OJRA 1VSEA 4OPJA 1ZBIA 3ISNC 1SL2A 4ELVA 4R5PA 4DU3A 4Z4FA 2OZSA 4E19A 3G10A 4JLHA 2WOMA 2W42A 3CFRA 1T8EA 1LW2A 1C6VA 4DG1A 2PYJA 1XI1A 4NCBA 2HVIA 1NKEA 4B8CA 1EXQA 1JLCA 4CF0A 2RKIA 1I39A 4E7KA 1NJYA 4LY7A 4O5BA 3ZT0A 3QEWA 4ELUA 3NF6A 3WNGA 4LSLA 2HHXA 1Z25A 4AHCA 1Q9YA 5JS2A 2ETJA 1QTMA 3NE6A 3QETA 3KD1E 4KHUA 3SJJA 2DFHA 4CEBA 4EP5A 1IH7A 1WSEA 5HRRA 4CEDA 4DSIA 3TR8A 3H08A 4NYNA 3VQ4A 1RTIA 4N56A 1YVUA 4CIFA 3MXIA 2PZSA 4FJ7A 5HBMA 3OS0A 3V1RA 4OLAA 1JLFA 4DSJA 3QESA 3AA2A 1KLMA 3NF9A 4I9LA 1IKYA 3HVTA 3I0RA 1CZ9A 2WONA 3VQ8A 4B9VA 3MEDA 2DTUA 2ZE2A 3ZSWA 1TK8A 3V6DA 1W9HA 2HHSA 3C94A 1JLBA 2OPPA 3ZT4A 1W0HA 2KFZA 4EZ9A 3DLKA 3V9SA 3O3HA 1EX4A 4ELTA 4DTJA 2XO7A 4DTNA 1QSSA 3KJVA 4M3RA 1VK0A 3QINA 5FROA 5C25A 3ITHA 3HVRA 5J2NA 3KLIA 1CLQA 3I0SA 2XY6A 3KK1A 3MXJA 3EZ5A 4MFBA 4CHQA 4FJGA 4FJJA 1ZYQA 2AJQA 2NUBA 4M3UA 2QK9A 1SUQA 5CYMA 2P5OA 2QKBA 4HCBA 3SI6A 4CEAA 4KAZA 5FRMA 3AVJA 4PQUA 2OPSA 3SUPA 2HHWA 4EZ6A 4FJIA 1KVAA 1L3TA 4CF9A 3V1OA 1NOYA 4PUOA 2KZMA 2EX3A 3SZ2A 4DQSA 1BISA 1B9FA 1B9DA 3LPTA 3NGZA 1FK9A 3AO3A 3P5JA 4BE0A 4DTXA 4DF8A 4KHWA 3HYFA 4I2QA 5FDLA 2O4IA 5T7BA 3K5NA 4O55A 1A5VA 3PO4A 1KCFA 1DTTA 1S1XA 3AVMA 3MXMA 4FYDA 1CXUA 3SPZA 2FBXA 1RBSA 1BCOA 4HCCA 2D5RA 4Y1CA 1NK4A 3OVNA 3L2QA 4CJ4A 3SCXA 4KO0A 2XY8A 1U04A 1HJRA 3VQAA 4B9NA 4O0IA 4M3ZA 4M3TA 3OYLA 1B92A 1CXQA 3DLGA 1BCMA 1BQNA 3IRXA 3O4QA 4KV8A 1L3UA 3F73A 1TKTA 1VSHA 2QXFA 4DS4A 2VG6A 2Z1IA 4Q5VA 1QSLA 1JLEA 1RNHA 4FW1A 4KHQA 1S9EA 4B9MA 4Z4GA 1HNIA 1C1AA 3ULDA 3ZSZA 3DOKA 1BQMA 3T1AA 1RBVA 3LWMA 1FXXA 4DQIA 4E1NA 3U6FA 4KPYA 4CEOA 3ZCMA 2E4LA 5SWMA 3PV8A 4FK2A 2Q3SA 5J2MA 3IG1A 3ZSRA 1KLNA 5HRNA 3ZSQA 4FLTA 4F4KA 1RTJA 1S1TA 2RN2A 2RF2A 1JXBA 4CK3A 1TVRA 2YNHA 3L2VA 3EYZA 2YNGA 1QE1A 2HHUA 1DTQA 4FM2A 2I5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VG7 A;  1XC9 A;  3VQ5 A;  4I2P A;  3S9H A;  1VSF A;  4I7F A;  4DU1 A;  4N76 A;  4DWI A;  1CZB A;  4OKK A;  5HRP A;  2KFN A;  3L2U A;  4BDY A;  4IBN A;  1XWL A;  1FKO A;  2XHB A;  1J53 A;  1J9A A;  4FCY A;  3IAY A;  1WN7 A;  1S1W A;  1WSI A;  2IS3 A;  4OKE A;  1BHL A;  4M42 A;  3K5L A;  3SQ1 A;  3CFO A;  2F96 A;  4CJT A;  4N5S A;  4B9S A;  4J2B A;  3HST B;  4FLX A;  4CJR A;  5KGX A;  3TAQ A;  4Z4I A;  3CQ8 A;  1C1B A;  3A2F A;  4DLG A;  3TI0 A;  3HM9 A;  4CHO A;  4DSF A;  1IKX A;  2OPR A;  3M8P A;  3K57 A;  1REV A;  3OS2 A;  3NAE A;  3LAN A;  1T05 A;  1LAW A;  2HNY A;  3BGR A;  3TAM A;  3V9W A;  1MU2 A;  4FK4 A;  1FKP A;  3P83 D;  1LAV A;  2HB5 A;  3SV3 A;  3ZT2 A;  4IKF A;  3DI6 A;  4CJ5 A;  3LP2 A;  5KRT A;  3CYM A;  4F3T A;  1RDB A;  2QKK A;  3OYJ A;  3CM5 A;  3S3M A;  1A5W A;  4K8Z A;  3C6T A;  3DM2 A;  3LZJ A;  2ZD1 A;  1RT1 A;  1WSG A;  1S5J A;  4HHT A;  3SUO A;  1NK7 A;  1TK0 A;  3VA3 A;  1T7P A;  3RRG A;  4C8M A;  1SKW A;  2BE2 A;  3ZSO A;  4HUG A;  4C8O A;  3VQD A;  1J5O A;  2BDP A;  4G1Q A;  1VSK A;  4YFU A;  3VQB A;  4CEQ A;  1Q9X A;  4CES A;  4CJQ A;  4F2R A;  3ZT1 A;  4K8X A;  3L3V A;  3HPO A;  4FLU A;  2OA8 A;  3B6P A;  4RW7 A;  4PA1 A;  4LH4 A;  1D9F A;  2OPQ A;  4KTW A;  2BGG A;  4HUF A;  4QOZ B;  4E0D A;  2IGI A;  4ID1 A;  2FC0 A;  4O44 A;  2R7Y A;  4DTS A;  1D5A A;  3S3N A;  1UOC A;  1BL3 A;  2DFF A;  1GOB A;  3K5M A;  1N6Q A;  1RT7 A;  4WE1 A;  3AVH A;  5J2Q A;  3CG7 A;  4H4M A;  4CFD A;  3OYM A;  3OYB A;  3RMD A;  3AO2 A;  1NJZ A;  3AVN A;  1X9S A;  3OS1 A;  4IG3 A;  4B8A B;  1YT3 A;  4M41 A;  1DLO A;  1HMV A;  1WAF A;  2IAJ A;  4EP4 A;  1T03 A;  3VQP A;  4BDP A;  3LPU A;  2B5J A;  4E89 A;  3NDK A;  3DYA A;  4CIE A;  3PX0 A;  1RCH A;  4W5R A;  3QIO A;  5JS1 A;  4DFJ A;  1G15 A;  1KTQ A;  3RTV A;  3T3F A;  4CJP A;  4RW4 A;  4Z4H A;  1D8Y A;  4M3X A;  4ZTF A;  4IG0 A;  4KFB A;  3NH2 A;  2Z1J A;  4OLB A;  4CGH A;  4W5N A;  2Y1J A;  3AVF A;  3IS9 A;  4XIU A;  4DTO A;  1VSD A;  3RRH A;  3B6O A;  2HHT A;  5HRO A;  1F21 A;  3LZI A;  1K6Y A;  3NFA A;  1SL0 A;  4Z4E A;  3SUN A;  3VQQ A;  1D9D A;  1XHX A;  3SQ4 A;  1NJX A;  4UQG A;  4FM0 A;  3M8S A;  3HP9 A;  3AA4 A;  4KTZ A;  4CJF A;  2RPI A;  4CFB A;  3KK3 A;  2ZQB A;  3D0P A;  1SKR A;  4Q0B A;  3RMC A;  4KHS A;  3NH0 A;  2O4G A;  3LDS A;  3VA0 A;  1S1U A;  1ASV A;  1ITG A;  1SV5 A;  4W5O A;  3OYK A;  4JRP A;  2HHV A;  2IC3 A;  3MEE A;  1JL2 A;  5CZ1 A;  4DTP A;  1O1W A;  4TSX A;  4KB0 A;  4JS4 A;  1ZBL A;  1WAJ A;  2G8U A;  4KI6 A;  3AA3 A;  4CF1 A;  4AHT A;  1R0A A;  5DK5 A;  1L5U A;  3DRP A;  2EHG A;  5CYQ A;  1HQE A;  1ZBU A;  4CEC A;  4CHY A;  1KVC A;  4E7L A;  3MAQ A;  1UAX A;  3PX6 A;  1BI4 B;  3V9U A;  3DOL A;  4H8K A;  1RTD A;  4F3O A;  3QER A;  4CJU A;  4B9U A;  3V9Z A;  1TGO A;  4I9Q A;  3HJF A;  3VQ6 A;  3TAR A;  1ASU A;  5HRS A;  1RIL A;  4B9L A;  4FXD A;  5KGW A;  1TL1 A;  4FLZ A;  4CEZ A;  3AO4 A;  4CE9 A;  5KI6 A;  4GW6 A;  1RTH A;  1TKZ A;  3KLF A;  3KLH A;  3KK2 A;  4CGI A;  3PY8 A;  4DLE A;  4C8K A;  4F8R A;  3SQ2 A;  2GUI A;  3NGI A;  4BDZ A;  4B3O A;  4DS5 A;  2DY4 A;  1VSJ A;  3O3F A;  4JS5 A;  2A1R A;  3QNO A;  3AVL A;  3DLR A;  1BI4 A;  4CGF A;  3HP6 A;  2XRI A;  4CJS A;  1C0U A;  3VN5 A;  5E41 A;  3KKS A;  4E1M A;  2PY5 A;  3UIQ A;  3TAB A;  3DRR A;  2OYQ A;  4DSK A;  4FJL A;  5FRN A;  3ASM A;  4FZY A;  2JLE A;  1C1C A;  2X6S A;  2IOC A;  4JRQ A;  1A5X A;  2OZM A;  3OYD A;  1UA0 A;  1Q8I A;  3HPH A;  3NF7 A;  3VQ7 A;  1TKD A;  4E7H A;  1WSJ A;  4QCL A;  3P1G A;  2YKN A;  3BDP A;  3HXM A;  1LWF A;  3QNN A;  1S1V A;  4FJ5 A;  4KB1 A;  1RT5 A;  3U3G A;  4DFP A;  1NK6 A;  3AVG A;  4ZHR A;  1L3S A;  1BIU A;  2X6N A;  4L8R B;  4AHS A;  3F9K A;  4DF4 A;  2LSN A;  3WNF A;  5KTQ A;  3QEV A;  3RMB A;  3SPY A;  4GMJ B;  2YHB A;  2D0B A;  4N47 A;  1QSY A;  3L3U A;  4CJV A;  3K58 A;  2YV0 X;  1TKX A;  2GBZ A;  3V1Q A;  3S3O A;  4O4G A;  3HPG A;  2G8V A;  3KLE A;  2YHA A;  3HT3 A;  1UA1 A;  1WLJ A;  3TAP A;  3V81 A;  1NK5 A;  1J54 A;  3OYG A;  2P1J A;  4FVM A;  3AVK A;  2KQ2 A;  4FLY A;  4FJN A;  4AH9 A;  1ASW A;  4BAC A;  2BAN A;  4CJL A;  3G0Z A;  3LP1 A;  3TAN A;  2DFE A;  1JL1 A;  3AVC A;  4BE1 A;  3LAM A;  3NBP A;  4DQR A;  1ZBF A;  4RW8 A;  4PWD A;  4LD0 A;  4DFK A;  3M8Q A;  4KKO A;  3VQ9 A;  1LWC A;  3WNH A;  4HVJ A;  3AO1 A;  4M3W A;  1C0M A;  1RDA A;  2FBV A;  1JLQ A;  1KVB A;  3NHG A;  4CJW A;  2B4J A;  4HTU A;  1UWB A;  3ZSV A;  1YTU A;  5K14 A;  1L3V A;  1I3A A;  2FBT A;  1EP4 A;  1JKH A;  3AV9 A;  4YNQ A;  4CJE A;  4PY5 A;  4KRE A;  3AA5 X;  4CER A;  1HRH A;  2VG5 A;  4E7I A;  1JLG A;  3SQ0 A;  1LWE A;  1TAU A;  4H4O A;  3DLB A;  4DTM A;  4J2E A;  4DMN A;  3NGY A;  4Z4C A;  3ALY A;  3LP0 A;  3RR7 A;  3VQC A;  4OGE A;  1QS4 A;  3PO5 A;  2HHQ A;  3ZSX A;  4IDK A;  4FZZ A;  4E7J A;  4BWM A;  1RBT A;  1IO2 A;  1HPZ A;  2P51 A;  4DTR A;  3LWL A;  4FJ8 A;  3TAF A;  3OYC A;  4CCH A;  4KI4 A;  2XY5 A;  3LAK A;  5DMR A;  3C95 A;  4DSE A;  4DU4 A;  1RBR A;  1LW0 A;  4FJ9 A;  1XHZ A;  1VSM A;  3L8B A;  2VWJ A;  3TWH A;  3SNN A;  2KTQ A;  1RT3 A;  3RWU A;  1VRT A;  3AVA A;  3QO9 A;  1IKV A;  5I42 A;  3TAE A;  1KFS A;  3K59 A;  4MQ3 A;  3T19 A;  1RT6 A;  3LP3 A;  4FJM A;  3WNE A;  1TL3 A;  1WNS A;  4C8L A;  2Y1I A;  4BWJ A;  4J2A A;  4N41 A;  3TAG A;  3OYE A;  3HO1 A;  3OYH A;  4DFM A;  2FBY A;  1X9W A;  4ICL A;  1EET A;  5D3G A;  3CM6 A;  4AHR A;  5CZ2 A;  5KRS A;  4E3S A;  1U47 A;  3MEG A;  1GOA A;  3V4I A;  2E6L A;  2A1S A;  1EKE A;  4RW9 A;  3EY1 A;  1HNV A;  1KRP A;  4CGG A;  3D45 A;  1QQC A;  3E01 A;  1LV5 A;  4B08 A;  1YTA A;  2ITG A;  3SUQ A;  3QEI A;  3QLH A;  4CHP A;  4FLW A;  5J2P A;  4CK2 A;  5HP1 A;  3ZT3 A;  4AHU A;  4DQP A;  3OYF A;  4B9T A;  1S6P A;  5C24 A;  4LSN A;  1X1P A;  2JGU A;  2PYL A;  1VSL A;  4KHY A;  1RT4 A;  3JYT A;  3NCI A;  3V9X A;  3AVB A;  4CF8 A;  1S6Q A;  1U45 A;  1JXE A;  1Y97 A;  1SKS A;  3L2R A;  2G8F A;  4FM1 A;  1BIZ A;  3K5O A;  1SL1 A;  2F8T A;  2KZZ A;  4OKJ A;  1BGX T;  4OVL A;  2HMI A;  2YNI A;  4OPK A;  4Y1D A;  1VRU A;  2X78 A;  1X9M A;  2HVH A;  4M45 A;  3KD5 E;  5I3U A;  3O3G A;  4F2S A;  1GOC A;  4NYF A;  1Z26 A;  1NK8 A;  4IFY A;  4NCA A;  3QEX A;  3OJS A;  3PX4 A;  3DLE A;  4LH5 A;  3OY9 A;  2GV9 A;  4FLV A;  1RT2 A;  5HLF A;  1IG9 A;  3DRS A;  4CHZ A;  1KSP A;  4CHN A;  3I8D A;  2E6M A;  1NK0 A;  4RG8 A;  4O0J A;  4RW6 A;  3OJU A;  4C8N A;  3ZSY A;  2VWK A;  4BE2 A;  4FJK A;  2Z1H A;  1RBU A;  3K2P A;  5J1E A;  2XY7 A;  3QIP A;  3FFI A;  1VSI A;  3NF8 A;  4CJK A;  1U4B A;  1NJW A;  3HK2 A;  3PUF A;  3U3Y A;  2HNZ A;  3AVI A;  4GVM A;  4AHV A;  1C0T A;  4CGJ A;  4CK1 A;  2IDO A;  4HUE A;  2G8I A;  2HW3 A;  4QAG A;  3KLG A;  3VQE A;  4ZTJ A;  1N5Y A;  2G8H A;  3HL8 A;  4Z0U A;  4CGD A;  3SV4 A;  3JSM A;  1HYZ A;  4W5T A;  3CFP A;  2G8K A;  3KKR A;  1WSF A;  3KTQ A;  4KTQ A;  4FJX A;  4M3Y A;  1ZBH A;  1NK9 A;  2F8S A;  4CFA A;  1NOZ A;  1TK5 A;  3OYI A;  4NCG A;  5SZT A;  3M8R A;  3RMA A;  1U49 A;  1TV6 A;  4FW2 A;  4W5Q A;  2B6A A;  1QHT A;  4OGC A;  4CFC A;  3DLH A;  1JLA A;  4ID5 A;  1NKC A;  2YNF A;  3NH1 A;  1KFD A;  3LAL A;  3L2W A;  3THV A;  1U48 A;  1HQU A;  4DSL A;  4KRF A;  2ATQ A;  1IKW A;  4CF2 A;  3QEP A;  3DMJ A;  3OYN A;  1RDC A;  3KIO A;  4DQQ A;  1HYV A;  1WSH A;  2D0A A;  4FK0 A;  1S9G A;  2P5G A;  4J2D A;  4CEE A;  3SYZ A;  4KHN A;  4FZX C;  1RDD A;  2YKM A;  5EU7 A;  2Z1G A;  5CY4 A;  1TAQ A;  3MEC A;  2X74 A;  4CEF A;  2G8W A;  3O4N A;  3RR8 A;  4FJH A;  3OYA A;  1HYS A;  4IFV A;  2D0C A;  3AO5 A;  4AIL C;  4CJ3 A;  2KW4 A;  2HND A;  4CIG A;  5C42 A;  1NKB A;  3C6U A;  4DTU A;  4OJR A;  1VSE A;  4OPJ A;  1ZBI A;  3ISN C;  1SL2 A;  4ELV A;  4R5P A;  4DU3 A;  4Z4F A;  2OZS A;  4E19 A;  3G10 A;  4JLH A;  2WOM A;  2W42 A;  3CFR A;  1T8E A;  1LW2 A;  1C6V A;  4DG1 A;  2PYJ A;  1XI1 A;  4NCB A;  2HVI A;  1NKE A;  4B8C A;  1EXQ A;  1JLC A;  4CF0 A;  2RKI A;  1I39 A;  4E7K A;  1NJY A;  4LY7 A;  4O5B A;  3ZT0 A;  3QEW A;  4ELU A;  3NF6 A;  3WNG A;  4LSL A;  2HHX A;  1Z25 A;  4AHC A;  1Q9Y A;  5JS2 A;  2ETJ A;  1QTM A;  3NE6 A;  3QET A;  3KD1 E;  4KHU A;  3SJJ A;  2DFH A;  4CEB A;  4EP5 A;  1IH7 A;  1WSE A;  5HRR A;  4CED A;  4DSI A;  3TR8 A;  3H08 A;  4NYN A;  3VQ4 A;  1RTI A;  4N56 A;  1YVU A;  4CIF A;  3MXI A;  2PZS A;  4FJ7 A;  5HBM A;  3OS0 A;  3V1R A;  4OLA A;  1JLF A;  4DSJ A;  3QES A;  3AA2 A;  1KLM A;  3NF9 A;  4I9L A;  1IKY A;  3HVT A;  3I0R A;  1CZ9 A;  2WON A;  3VQ8 A;  4B9V A;  3MED A;  2DTU A;  2ZE2 A;  3ZSW A;  1TK8 A;  3V6D A;  1W9H A;  2HHS A;  3C94 A;  1JLB A;  2OPP A;  3ZT4 A;  1W0H A;  2KFZ A;  4EZ9 A;  3DLK A;  3V9S A;  3O3H A;  1EX4 A;  4ELT A;  4DTJ A;  2XO7 A;  4DTN A;  1QSS A;  3KJV A;  4M3R A;  1VK0 A;  3QIN A;  5FRO A;  5C25 A;  3ITH A;  3HVR A;  5J2N A;  3KLI A;  1CLQ A;  3I0S A;  2XY6 A;  3KK1 A;  3MXJ A;  3EZ5 A;  4MFB A;  4CHQ A;  4FJG A;  4FJJ A;  1ZYQ A;  2AJQ A;  2NUB A;  4M3U A;  2QK9 A;  1SUQ A;  5CYM A;  2P5O A;  2QKB A;  4HCB A;  3SI6 A;  4CEA A;  4KAZ A;  5FRM A;  3AVJ A;  4PQU A;  2OPS A;  3SUP A;  2HHW A;  4EZ6 A;  4FJI A;  1KVA A;  1L3T A;  4CF9 A;  3V1O A;  1NOY A;  4PUO A;  2KZM A;  2EX3 A;  3SZ2 A;  4DQS A;  1BIS A;  1B9F A;  1B9D A;  3LPT A;  3NGZ A;  1FK9 A;  3AO3 A;  3P5J A;  4BE0 A;  4DTX A;  4DF8 A;  4KHW A;  3HYF A;  4I2Q A;  5FDL A;  2O4I A;  5T7B A;  3K5N A;  4O55 A;  1A5V A;  3PO4 A;  1KCF A;  1DTT A;  1S1X A;  3AVM A;  3MXM A;  4FYD A;  1CXU A;  3SPZ A;  2FBX A;  1RBS A;  1BCO A;  4HCC A;  2D5R A;  4Y1C A;  1NK4 A;  3OVN A;  3L2Q A;  4CJ4 A;  3SCX A;  4KO0 A;  2XY8 A;  1U04 A;  1HJR A;  3VQA A;  4B9N A;  4O0I A;  4M3Z A;  4M3T A;  3OYL A;  1B92 A;  1CXQ A;  3DLG A;  1BCM A;  1BQN A;  3IRX A;  3O4Q A;  4KV8 A;  1L3U A;  3F73 A;  1TKT A;  1VSH A;  2QXF A;  4DS4 A;  2VG6 A;  2Z1I A;  4Q5V A;  1QSL A;  1JLE A;  1RNH A;  4FW1 A;  4KHQ A;  1S9E A;  4B9M A;  4Z4G A;  1HNI A;  1C1A A;  3ULD A;  3ZSZ A;  3DOK A;  1BQM A;  3T1A A;  1RBV A;  3LWM A;  1FXX A;  4DQI A;  4E1N A;  3U6F A;  4KPY A;  4CEO A;  3ZCM A;  2E4L A;  5SWM A;  3PV8 A;  4FK2 A;  2Q3S A;  5J2M A;  3IG1 A;  3ZSR A;  1KLN A;  5HRN A;  3ZSQ A;  4FLT A;  4F4K A;  1RTJ A;  1S1T A;  2RN2 A;  2RF2 A;  1JXB A;  4CK3 A;  1TVR A;  2YNH A;  3L2V A;  3EYZ A;  2YNG A;  1QE1 A;  2HHU A;  1DTQ A;  4FM2 A;  2I5J A; 
#chains in the Genus database with same CATH topology
 2VG7 A;  5GIP A;  1VQO N;  4I2P A;  5BRF A;  1VSF A;  1NGF A;  2QWO A;  3L2U A;  4BDY A;  2W41 A;  2XHB A;  2UXB K;  1J9A A;  4OKE A;  4V19 S;  1BHL A;  3K5L A;  2UXC K;  4FLX A;  5LMU K;  3TAQ A;  4DLG A;  4JKA A;  3HM9 A;  4CHO A;  1Z6R A;  3EE8 A;  3NAE A;  1NGC A;  1T05 A;  3VER A;  1MU2 A;  2QWN A;  4FWL A;  2HB5 A;  3H6E A;  4BR5 A;  4CJ5 A;  3CYM A;  4GV9 A;  3OYJ A;  3CM5 A;  2CGK A;  3J81 O;  3SK3 A;  1RT1 A;  1WSG A;  1S5J A;  4HHT A;  1NK7 A;  1TK0 A;  2P9N A;  1T7P A;  5AQR A;  5BR9 A;  2HOE A;  3H3N O;  4G1Q A;  3VQB A;  2UU9 K;  1Q9X A;  4F2R A;  3L3V A;  3HPO A;  5HOO A;  4IOA L;  1D9F A;  2WUS A;  4KTW A;  4QOZ B;  4E0D A;  4K41 A;  4O44 A;  3S3N A;  1RT7 A;  4WE1 A;  1LCU A;  3AVH A;  4H5V A;  4CFD A;  3OS1 A;  4B8A B;  2E2O A;  4A59 A;  1YT3 A;  4BC4 A;  2OTL N;  4EP4 A;  1T03 A;  3D2F A;  5AQQ A;  3PSF A;  3CET A;  3QIO A;  3MN9 A;  4DFJ A;  5JLH A;  3CIP A;  1KTQ A;  4BVP A;  3ID8 A;  1C0F A;  3AVF A;  4GNI A;  1F21 A;  1K6Y A;  3NFA A;  3VET A;  3SUN A;  3VQQ A;  1JJ2 M;  4Z4E A;  5EXW A;  3DXM B;  3D0P A;  3KK3 A;  2ZQB A;  2QI2 A;  2V7Z A;  2E1Z A;  5AQW A;  3MCA B;  2CGJ A;  2Q1N A;  1ASV A;  2HHV A;  4CD1 A;  5CZ1 A;  5JMV A;  4TSX A;  1YJ9 N;  1RFQ A;  2BH1 A;  2NLX A;  4PL8 A;  1WBD A;  3AA3 A;  4AHT A;  1L5U A;  5CYQ A;  1HQE A;  4E7L A;  4CHY A;  1KVC A;  1VQP N;  3MAQ A;  1UAX A;  4LF4 K;  3QER A;  3GBT A;  5HRS A;  2V51 B;  4DB3 A;  4CEZ A;  1TYQ B;  3GOI A;  1QVF M;  1QQN A;  2NNW A;  1P90 A;  4CZH A;  3NGI A;  3QNO A;  3DLR A;  5E41 A;  2WC9 A;  3VN5 A;  2PY5 A;  4E1M A;  1WB9 A;  3TAB A;  2OYQ A;  1C1C A;  2X6S A;  4IZ9 A;  1KQS M;  2GWK A;  4JRQ A;  3QBW A;  4FO0 A;  1Q8I A;  3THY B;  3P1G A;  2YKN A;  3QNN A;  1LWF A;  2KZM A;  1NK6 A;  1L3S A;  3CCJ N;  3CJ1 A;  4JV5 K;  3HSC A;  3BEX A;  3F2K A;  2LSN A;  3QEV A;  3RMB A;  1MWM A;  4LFC K;  2D0B A;  4JI4 K;  1QSY A;  4CJV A;  2ASP A;  3M1F A;  2YV0 X;  1TKX A;  2G8V A;  4O4G A;  1YJW N;  1UA1 A;  1NK5 A;  3KHY A;  1J54 A;  5AQP A;  3OYG A;  2P1J A;  3AVK A;  1YIT N;  3VTI A;  4BAC A;  2DFE A;  2QWM A;  4I6M B;  1EQY A;  3NBP A;  3PSI A;  3LDN A;  4LFA K;  3R6M A;  3CCS N;  1GLL O;  2FSK A;  1C0M A;  2NRH A;  2FBV A;  2P9P B;  1JLQ A;  2B4J A;  3SMP A;  4O8K A;  1GLB G;  1I3A A;  1JKH A;  1KAZ A;  4CJE A;  1QZ6 A;  1HRH A;  1JLG A;  2E2N A;  2ZWH A;  1N8R O;  3PO5 A;  1BWF O;  3CPW M;  4JHD B;  5JIC A;  3TAF A;  3OYC A;  1OH6 A;  4DU4 A;  3VGL A;  1GLA G;  5TKY A;  2FF3 B;  2KTQ A;  1RT3 A;  1IKV A;  1KFS A;  5C0Y A;  3T19 A;  1RT6 A;  4FJM A;  4C8L A;  3P4I A;  4J2A A;  4GKK K;  3OYH A;  1HR0 K;  4H5N A;  4WCE L;  5MLC Q;  1VQK N;  3TSP A;  3MX5 A;  3U8X A;  4AHR A;  1EKE A;  4RW9 A;  3AY9 A;  1HNV A;  4CGG A;  4NLC A;  1LV5 A;  5FPE A;  3QEI A;  4FLW A;  5HP1 A;  4AHU A;  3CER A;  3OYF A;  2RHK A;  1VSL A;  1RT4 A;  3V9X A;  4IO8 A;  3AVB A;  1S6Q A;  3CJ9 A;  4FM1 A;  3DXM A;  3K5O A;  2F8T A;  1BGX T;  3R9P A;  2X78 A;  4JEP A;  4M45 A;  3O3G A;  2HF4 A;  1QZ5 A;  4JNE A;  4U67 L;  4NYF A;  3MWP A;  1HKG A;  4IFY A;  4ILH A;  3DLE A;  5KPT A;  4LH5 A;  5GIO A;  4FLV A;  1RT2 A;  3DRS A;  1NGE A;  3IDH A;  3OJU A;  1EWR A;  3G6E N;  1HLU A;  3QIP A;  4MLE A;  3U3Y A;  4CK1 A;  2G8I A;  4K0K K;  4QAG A;  1N5Y A;  3HL8 A;  4PL7 A;  4YOU A;  3CFP A;  4FJX A;  1NK9 A;  4YDU A;  3CCV N;  4CFA A;  1NOZ A;  2E20 A;  2HHH K;  1Q86 O;  4BRH A;  1U49 A;  2BTF A;  4FW2 A;  4W5Q A;  1HJO A;  3DLH A;  1NKC A;  3NH1 A;  3THV A;  4PKG A;  1JCE A;  4JK7 A;  3DMJ A;  1NGI A;  1RDC A;  1HYV A;  2ZGY A;  1N36 K;  1W2B M;  5M1F A;  1X3N A;  2P5G A;  1R59 O;  3CJA A;  2PFU A;  4CEE A;  1XNR K;  2YJE A;  2Z1G A;  3MEC A;  5KQ8 A;  1HNW K;  1HYS A;  4IFV A;  2D0C A;  3J7Z O;  1ATN A;  4AIL C;  3UKR B;  2KW4 A;  5C42 A;  1NKB A;  4DTU A;  3FZL A;  1NLV A;  3G10 A;  4JLH A;  1T8E A;  2QWP A;  1LW2 A;  4DG1 A;  2PYJ A;  3KZB A;  1W97 L;  1IBM K;  2HVI A;  1NKE A;  1KD1 O;  1JLC A;  2RKI A;  4O5B A;  4K43 A;  5BPM A;  5KPR A;  3ENB A;  2HHX A;  4WFA L;  4B1V A;  5JS2 A;  4ILJ A;  1QTM A;  5BN9 A;  3KD1 E;  4KHU A;  4CEB A;  3FGU A;  3AAP A;  4N56 A;  3KWG A;  4CIF A;  4FJ7 A;  4WFB L;  3O9T A;  3V1R A;  1JLF A;  5BPN A;  1IKY A;  3WEE B;  3BY5 A;  2ASO A;  1K73 O;  2HBK A;  3MED A;  2ZE2 A;  3H45 C;  3V6D A;  2HHS A;  4FWN A;  4FOE A;  5LJV A;  4WQ5 A;  3DLK A;  2AP1 A;  4KH4 A;  3O3H A;  1QQO A;  4ELT A;  4DTJ A;  4WQ4 A;  4M3R A;  3ITH A;  4BY9 C;  4M7X A;  2PBD A;  2NUB A;  2NRR A;  1SUQ A;  4KAZ A;  4H0Y B;  4K25 A;  2OPS A;  2O8D A;  3VEO A;  1T3V A;  2EX3 A;  3E9L A;  4ISF A;  2QWQ A;  2ZM6 K;  5CE3 A;  1CXU A;  4WFN L;  2FBX A;  1RBS A;  4JI5 K;  4LF6 K;  4CVN E;  3L2Q A;  1DEJ A;  2XY8 A;  1U04 A;  4JK8 A;  1XMQ K;  3OYL A;  1B92 A;  3DLG A;  4BRO A;  1BQN A;  3O4Q A;  3ENO A;  2QXF A;  2AA4 A;  4Q5V A;  1MDU B;  2VGM A;  4Z4G A;  3ULD A;  3T1A A;  4A5B A;  3C6H A;  5AQO A;  4E1N A;  2YCH A;  3ZSR A;  5AQM A;  4CD3 A;  4FLT A;  4YDU C;  2YNH A;  2YNG A;  1QE1 A;  3S9H A;  2WTU A;  3QFU A;  4IO9 L;  2VQE K;  2KFN A;  3P39 A;  4FCY A;  1YVN A;  4B1W B;  3IAY A;  4M42 A;  1S1W A;  2IS3 A;  3CFO A;  4N5S A;  4B9S A;  2P9N B;  4BR0 A;  5KGX A;  2IVN A;  3TI0 A;  4DSF A;  2OPR A;  4C23 A;  3K57 A;  3BGR A;  2HST A;  3SV3 A;  3ZT2 A;  3DI6 A;  3ZX2 A;  1RDB A;  3S3M A;  4K8Z A;  3M3Z A;  3C6T A;  3DM2 A;  2ZD1 A;  4YY3 K;  4JKC A;  2YHY A;  4C1N I;  2QXL A;  4HUG A;  4C8O A;  1VSK A;  4K8X A;  4CES A;  3D2F B;  4FLU A;  5M1O A;  3EEQ A;  5AQY A;  4UY8 O;  3L6Q A;  1K8K A;  3I56 N;  4ID1 A;  3QDK A;  4JI0 K;  3M5R A;  2O8B A;  3UKU A;  2QWR A;  1BL3 A;  3K5M A;  1KC8 O;  3DWL A;  4H4M A;  3OYB A;  1X9S A;  4DV2 K;  3AVN A;  4DR7 K;  1BO5 O;  2CH6 A;  1DLO A;  4JKB A;  4BDP A;  3C6A A;  2B5J A;  4E89 A;  4DV6 K;  2D4W A;  1QHA A;  3EZW A;  1WUA A;  4Z4H A;  1D8Y A;  3W3D A;  2Z1J A;  4YOT A;  3RRH A;  3B6O A;  2HHT A;  5HRO A;  1Q81 O;  1Q7Y O;  3M6G A;  4JKG B;  5JLF A;  4WQ5 C;  4H03 B;  1XHX A;  5E26 A;  3SQ4 A;  4UQG A;  4FM0 A;  3AA4 A;  2RPI A;  4CFB A;  1SKR A;  1NU0 A;  4L3Q A;  3RMC A;  2GX9 A;  3S41 A;  2ZF5 O;  3OYK A;  2YHW A;  2IC3 A;  1JL2 A;  4B9Q A;  3QIC A;  5C2D A;  3T1Y K;  2G8U A;  4KI6 A;  1NWK A;  5DK5 A;  1HKB A;  1ZBU A;  4CEC A;  3DOL A;  2V52 B;  4CJU A;  3O5B A;  4AM6 A;  1RIL A;  4B9L A;  4FLZ A;  3F5T A;  2F4V K;  4GW6 A;  4CZK A;  1TKZ A;  3KK2 A;  1TUY A;  3SQ2 A;  1IBK K;  4XH1 A;  2KKZ A;  4BDZ A;  2DY4 A;  1VSJ A;  2A1R A;  3AVL A;  1BI4 A;  2XRI A;  3KKS A;  2A40 A;  3A8Y A;  4H5W A;  3DRR A;  4DSK A;  5FRN A;  2JLE A;  3CJB A;  3WXJ A;  3G4S N;  2IOC A;  3OYD A;  1UA0 A;  1TKD A;  4E7H A;  1WSJ A;  4FWO A;  3BDP A;  3THW B;  3AVG A;  4IWV A;  4ZHR A;  1DT9 A;  4QS8 A;  5LMN K;  4XH4 A;  4DF4 A;  3VEY A;  3AAQ A;  5KTQ A;  2YHB A;  5AZJ B;  3CC2 N;  2F7T A;  4JD2 A;  3V1Q A;  4BG9 A;  3S3O A;  3KLE A;  2CH5 A;  1WLJ A;  4NLB A;  1JCG A;  1QQM A;  4FJN A;  1EO1 A;  2P9U A;  4AH9 A;  3G0Z A;  1JL1 A;  2NZT A;  2QTD A;  4RW8 A;  3CC4 N;  4PWD A;  4LD0 A;  4HVJ A;  4M3W A;  1OVQ A;  4Z94 A;  1E4F T;  3NHG A;  4CJW A;  1FW6 A;  2J4R A;  3ZSV A;  1YTU A;  5K14 A;  3AV9 A;  2PAV A;  3ENH A;  4KRE A;  5AQS A;  3C65 A;  3SQ0 A;  2A6A A;  3DLB A;  4JI7 K;  4J2E A;  4Z4C A;  3LP0 A;  3RR7 A;  3O9R A;  4BGA A;  3H3O B;  3ZSX A;  4H0X B;  1QVG M;  1ZXO A;  4BWM A;  3LWL A;  4IEE A;  3K0S A;  5DMR A;  3C95 A;  4RCH A;  3Q7B A;  5KPZ A;  3NVK A;  3SNN A;  4MDB A;  4R79 A;  3R8E A;  3A5O C;  3QO9 A;  5I42 A;  3TAE A;  3K59 A;  3CCM N;  3EE9 A;  4MQ3 A;  3LP3 A;  5BR8 K;  1TL3 A;  1WBB A;  5FPD A;  3OYE A;  3CCQ N;  5IT9 O;  3HM8 A;  4CZF A;  4ICL A;  3RVC A;  3TSU A;  5D3G A;  1GOA A;  5EOY A;  3EY1 A;  4GVE A;  5FPN A;  1KRP A;  3E01 A;  3GDQ A;  3MN6 A;  3VEV A;  3A5N C;  5JVH L;  4CHP A;  3O9Q A;  3ZT3 A;  1S6P A;  4LSN A;  1X1P A;  2JGU A;  4CZL A;  1SKS A;  4JKG A;  5AFU H;  3SBT A;  1BIZ A;  1HNX K;  1YJN N;  4Y1D A;  4CZG A;  3KD5 E;  3CD6 N;  1GOC A;  3QML A;  2H3G X;  4KH6 A;  4NCA A;  2IVP A;  3OJS A;  5HL7 L;  2GV9 A;  4JI6 K;  1IG9 A;  5HLF A;  1RGI A;  4DR3 K;  4CHN A;  3FLC O;  4C1N K;  4C8N A;  4BE2 A;  1RBU A;  1I94 K;  3Q7C A;  3K2P A;  5J1E A;  4BC2 A;  1VSI A;  4CJK A;  1U4B A;  1NJW A;  3PUF A;  3GE1 A;  3AVI A;  4GVM A;  4CGJ A;  1HNZ K;  3KLG A;  2CGL A;  1CZA N;  2NRX A;  4Z0U A;  4EIA A;  3JAM O;  3SV4 A;  4QS9 A;  1HYZ A;  4M3Y A;  1OKJ A;  3DAW A;  4OO1 J;  4YOX A;  2Q31 A;  4CW7 B;  4Y0W A;  1TK5 A;  4NCG A;  3O8M A;  3FZK A;  1GLD G;  1QHT A;  3EKU A;  4AQY K;  4ID5 A;  5EY4 A;  1ATR A;  4CF2 A;  3THW A;  1S9G A;  3LL3 A;  4FZX C;  3O08 A;  5EU7 A;  4JAX A;  2QWL A;  4AM7 A;  2I7P A;  5AZJ A;  1YHQ N;  4CIG A;  1VSE A;  4OPJ A;  2WBN A;  4DU3 A;  4Z4F A;  2W42 A;  3CFR A;  1HPM A;  4BRL A;  4JN4 A;  3RSE A;  1OH5 A;  4NCB A;  3ATU A;  2E88 A;  1NJY A;  3OA9 A;  5FLX O;  4LY7 A;  3QEW A;  3NF6 A;  1Q9Y A;  4H0T B;  1X9J A;  4YHH K;  3QET A;  2WFB A;  1IH7 A;  3PLA A;  4DQ8 A;  3H08 A;  3K9K A;  3IFR A;  3VQ4 A;  3IKM A;  3BUZ B;  2PZS A;  2V7Y A;  1EWQ A;  1S72 N;  3I0R A;  2DTU A;  2E2P A;  2UYT A;  2O8D B;  1W0H A;  4EZ9 A;  2NRW A;  4BR4 A;  3V9S A;  1EX4 A;  4LF5 K;  1QSS A;  1VK0 A;  3QIN A;  1KAX A;  3KLI A;  3KK1 A;  3MXJ A;  4FJG A;  5AQJ A;  5CYM A;  4JKD A;  2O8C A;  5FRM A;  3AVJ A;  3SUP A;  3IMX A;  1KVA A;  2OCE A;  1NOY A;  3A0I X;  1BIS A;  3NGZ A;  4KHW A;  1J5E K;  4I2Q A;  3K5N A;  1A5V A;  2A5X A;  1KCF A;  1U6Z A;  1DTT A;  1S1X A;  3G71 N;  3SPZ A;  3C0B A;  1BCO A;  3CI5 A;  2O8F A;  3MMV A;  4HCC A;  2D5R A;  2P9K A;  3OVN A;  4CJ4 A;  5CR4 A;  1HJR A;  1QSL A;  1JLE A;  4FW1 A;  4KHQ A;  1HNI A;  4X65 K;  3DOK A;  1LOT B;  1RBV A;  3LWM A;  4KHP K;  1FXX A;  3U6F A;  4EFH A;  3OTO K;  5SWM A;  2E4L A;  3VEN A;  4FK2 A;  5J2M A;  2P9S A;  5HRN A;  4EHU A;  2RN2 A;  2RF2 A;  5GAG P;  4CK3 A;  1TVR A;  3L2V A;  1DTQ A;  4MLH A;  1H1V A;  5AR0 A;  3C7N A;  4DU1 A;  4DWI A;  1CZB A;  5HRP A;  4IFE A;  1XWL A;  4YOY A;  1WN7 A;  4WYB A;  3THX A;  5H1S Q;  3MN7 A;  3SQ1 A;  2QM1 A;  2F96 A;  3HST B;  4BR9 A;  4Z4I A;  1C0G A;  3A2F A;  3KVG A;  3LDQ A;  1IKX A;  3M8P A;  4JI3 K;  3HZ6 A;  1LAW A;  2FF6 A;  5AZI A;  3MN5 A;  3P83 D;  4DR4 K;  3OW2 M;  1K8K B;  1OVY A;  4FWS A;  4IKF A;  4RTF D;  3E66 A;  2O8E A;  2QKK A;  2O8B B;  3UKU B;  1NM1 A;  3RR8 A;  3SUO A;  4BRD A;  2A42 A;  2Q2R A;  3WQT A;  3CF5 L;  1SKW A;  3I8B A;  1NGG A;  3RRG A;  3ZSO A;  3WXM B;  4CEQ A;  2QA4 N;  3O9U A;  4IJA A;  4CJQ A;  3CME N;  4RW7 A;  4LH4 A;  3R3L A;  2OPQ A;  1N33 K;  1WOQ A;  2BGG A;  4YOW A;  2IGI A;  2FC0 A;  4DTS A;  4CZJ A;  1NG9 A;  1UOC A;  2QW9 A;  3D2E A;  4CBU A;  1N6Q A;  3WQU A;  3RMD A;  1NJZ A;  3AO2 A;  4M41 A;  3D6R A;  1HMV A;  1BU6 O;  1WAF A;  4FWR A;  4J2D A;  3VQP A;  3U4L A;  1G15 A;  3RTV A;  4CJP A;  3EL2 A;  2I7N A;  1K9M O;  4KFB A;  3NH2 A;  2Y1J A;  2D0P A;  3IS9 A;  4AF1 A;  3OHR A;  4XIU A;  1VSD A;  3CJC A;  3GL1 A;  3LZI A;  1SL0 A;  3FZH A;  4KRF A;  3M8S A;  3HP9 A;  4BRC A;  4Q0B A;  3TSQ A;  1U2V A;  4JI8 K;  3ULE A;  2O4G A;  4FWQ A;  1JCF A;  1ITG A;  3WXL A;  4JRP A;  3MEE A;  2P9I A;  2NRV A;  4DTP A;  1MWK A;  1O1W A;  3OBY A;  2ASM A;  4KB0 A;  1ZBL A;  1R0A A;  1BDG A;  1YUW A;  2D0O A;  3J8A A;  1BI4 B;  3O1B A;  3V9U A;  4H8K A;  1XUP O;  3ID6 A;  4B9U A;  3TAR A;  1ASU A;  3A5M C;  3EO3 A;  4FXD A;  5KGW A;  1TL1 A;  3AO4 A;  4BRN A;  4CE9 A;  1XNQ K;  3KLF A;  3KLH A;  4F8R A;  4CGI A;  4RWT A;  1VQN N;  3LDO A;  2NRZ A;  4DS5 A;  1IJJ A;  2IVO A;  3UIQ A;  4LF9 K;  4FJL A;  3FZF A;  5AQL A;  3T1H K;  2UXD K;  3VGM A;  4B3T K;  1A5X A;  4DCH A;  4JD2 B;  3T69 A;  3HPH A;  3VQ7 A;  3CMA N;  4QCL A;  2NRT A;  3HXM A;  4FJ5 A;  1S1V A;  4KB1 A;  4DFP A;  2P9U B;  3GG4 A;  5AQZ A;  2Q97 A;  1VQ8 N;  3I33 A;  5BN8 A;  3CQY A;  4AHS A;  4X64 K;  3F9K A;  2HF3 A;  1BA0 A;  3PIP L;  3WNF A;  3SPY A;  2GWJ A;  2E5L K;  3L3U A;  3SLC A;  3VF2 A;  2VQF K;  3SAH A;  1Q18 A;  2GBZ A;  3EN9 A;  3HPG A;  3U9D A;  5EVZ A;  2YHA A;  3HT3 A;  3TAP A;  3V81 A;  4FVM A;  4FLY A;  2KQ2 A;  2YX6 A;  1NGH A;  3CHW A;  4CJL A;  2GEM A;  4BE1 A;  3AVC A;  1YXQ A;  3LAM A;  2UUC K;  4JYA K;  4DFK A;  4KKO A;  3VQ9 A;  1LWC A;  5GAD P;  5LJW A;  1GLC G;  1KVB A;  4HTU A;  1L3V A;  1EP4 A;  2FSN A;  5C12 A;  4DR2 K;  3AA5 X;  2VG5 A;  1LWE A;  3UE5 A;  4GV3 A;  1VQ6 N;  4DMN A;  3N4P A;  4CZM A;  3ALY A;  3L0Q A;  2HHQ A;  1QS4 A;  4BRF A;  4IDK A;  4FZZ A;  1K8A O;  1IO2 A;  3HRG A;  4FJ8 A;  4CCH A;  1KAY A;  4HWI A;  4DUY K;  2XY5 A;  4KI4 A;  3LAK A;  4DSE A;  1RBR A;  1NNE A;  3L8B A;  2GUP A;  4H0V B;  4JI1 K;  3WNE A;  2Y1I A;  1D4X A;  4BWJ A;  5AQH A;  4DV7 K;  3KWI A;  3TAG A;  3SBG A;  3E9P A;  4DFM A;  4BC3 A;  2FBY A;  5BRH A;  3AGR A;  3CM6 A;  4WQ4 C;  5CZ2 A;  3DXK B;  5KRS A;  4E3S A;  1U47 A;  2OAN A;  3MEG A;  3V4I A;  2A1S A;  3KK7 A;  3CXC M;  1GLE G;  1QQC A;  4B08 A;  1YTA A;  3R1X A;  3CCR N;  2OTJ N;  5J2P A;  5C10 A;  4B9T A;  5AJ3 K;  1RDW X;  3CJ7 A;  2PYL A;  3JYT A;  3NCI A;  4CF8 A;  1ESV A;  1Y97 A;  2G8F A;  3L2R A;  1M1K O;  2KZZ A;  2HMI A;  4OVL A;  1ILY A;  2YNI A;  4LFB K;  5I3U A;  5ADX H;  3ZET A;  1NGB A;  2Q0U A;  3LDL A;  5AQV A;  3QEX A;  4IXC A;  5KQD A;  3OY9 A;  1SAZ A;  4HTL A;  3TU5 A;  4BRQ A;  5AQX A;  1KSP A;  3I8D A;  2E6M A;  4RG8 A;  4RW6 A;  3ZSY A;  2VWK A;  2XY7 A;  1Q82 O;  3NF8 A;  4DUZ K;  2HNZ A;  2JWL A;  2HW3 A;  2IDO A;  1ATS A;  4DV5 K;  3VQE A;  1T44 A;  4IEI A;  4CGD A;  4FL9 A;  3JSM A;  2YJF A;  4W5T A;  2G8K A;  4KTQ A;  3KKR A;  1WSF A;  3KTQ A;  1ZBH A;  4B1Z A;  1E4G T;  3OYI A;  5SZT A;  4FSV A;  1TV6 A;  2UUA K;  4OGC A;  4CFC A;  1VAZ A;  3LDP A;  2YNF A;  1KFD A;  3LAL A;  3L2W A;  1XQS C;  4O8U A;  4DR1 K;  5JVG L;  3SAF A;  5M1Q A;  3OYN A;  3KIO A;  4FWM A;  1WSH A;  2D0A A;  4FK0 A;  4U7B A;  3BZK A;  1X3M A;  3RSE B;  4KHN A;  1RDD A;  2FSJ A;  2YKM A;  4KH5 A;  5CY4 A;  2ITM A;  2X74 A;  3O4N A;  4FJH A;  3OYA A;  3AO5 A;  2HBJ A;  4NO7 A;  4OJR A;  4X62 K;  1ZBI A;  4ELV A;  4R5P A;  4PHT X;  2OZS A;  3D7E O;  2WOM A;  1XI1 A;  4B8C A;  1EXQ A;  4JKE A;  4DV3 K;  4CF0 A;  1I39 A;  4E7K A;  3WT0 A;  3ZT0 A;  4PKH A;  4BQL A;  2W6K A;  3WNG A;  4ELU A;  5AQI A;  1Z25 A;  4AHC A;  4M7Y A;  2ETJ A;  4YOV A;  3NE6 A;  1WSE A;  4FVU A;  5HRR A;  2BUP A;  4CED A;  4DSI A;  3TR8 A;  1SZ2 A;  4KBO A;  3MXI A;  5AQF A;  3PIO L;  4OLA A;  4DSJ A;  3QES A;  3AA2 A;  3NF9 A;  3HVT A;  4G9Z A;  4B9V A;  1KXP A;  1VHX A;  4DR6 K;  4B1Y B;  2IIR A;  5BRD A;  2ZJR L;  3C94 A;  1JLB A;  2O8C B;  4NXM K;  3ZT4 A;  2KFZ A;  1YI2 N;  4BRG A;  2XO7 A;  4ILG B;  5C25 A;  3I0S A;  2KHO A;  3CC7 N;  3EZ5 A;  4FJJ A;  4CHQ A;  1ZYQ A;  2O8F B;  4M3U A;  2QK9 A;  2P9K B;  3DXK A;  2UUB K;  2P5O A;  2QKB A;  4HCB A;  4PQU A;  2D1K A;  2HHW A;  4CF9 A;  3V1O A;  4PUO A;  5M1K A;  3SZ2 A;  4DQS A;  4BE0 A;  3LPT A;  1YAG A;  4DF8 A;  3AO3 A;  3P5J A;  2O4I A;  5T7B A;  3PO4 A;  3ZEU A;  5B8H A;  3AVM A;  3NVM A;  4X66 K;  2P9S B;  1DKG D;  1S3X A;  1J6Z A;  3O80 A;  4B9N A;  4O0I A;  4M3Z A;  4B3R K;  1CXQ A;  4KV8 A;  1L3U A;  2P9L A;  3F73 A;  1VSH A;  4DS4 A;  2VG6 A;  2Z1I A;  2VGN A;  1RNH A;  4B9M A;  4B3S K;  3C7N B;  1VQ7 N;  4BVO A;  1HKC A;  4DQI A;  4CEO A;  4J8F A;  1HX1 A;  3CQX A;  3THX B;  1T6C A;  3IG1 A;  1KLN A;  3ZSQ A;  4OPA A;  3MK6 A;  4A2B A;  4F4K A;  1RTJ A;  1JXB A;  3EYZ A;  2F9W A;  2I5J A;  1XC9 A;  5E84 A;  4WF9 L;  3VQ5 A;  3WXI A;  4I7F A;  5AZI B;  4N76 A;  4OKK A;  4A57 A;  3TPQ A;  4IBN A;  1FKO A;  1J53 A;  2O8E B;  1WSI A;  4CJT A;  4J2B A;  4CJR A;  3SJH A;  4FWP A;  3P31 A;  3CQ8 A;  1C1B A;  3EKS A;  3N4Q A;  3HOT A;  1REV A;  3OS2 A;  3LAN A;  2HNY A;  3TAM A;  3V9W A;  4BRP A;  4FK4 A;  1FKP A;  1LAV A;  1T6D A;  4GV6 A;  2FXU A;  3VPZ A;  3LP2 A;  5KRT A;  5A2Q O;  4F3T A;  1A5W A;  3LZJ A;  4DV1 K;  3D2E B;  3O6W A;  3VA3 A;  2HBM A;  4C8M A;  3DLL L;  2BE2 A;  3B8A X;  3VQD A;  2BDP A;  1P8Z A;  4YFU A;  2E1Y A;  3ZT1 A;  4H5R A;  2OA8 A;  3B6P A;  4PA1 A;  3FR0 A;  4HUF A;  3VEZ A;  3VF4 A;  3U9Z A;  5GAE P;  2R7Y A;  1D5A A;  2DFF A;  1GOB A;  1E3M A;  5J2Q A;  3CG7 A;  3OYM A;  1W7A A;  5LL6 Z;  4IG3 A;  5AQN A;  4MO5 A;  5CHI A;  4DV0 K;  5ADX A;  2IAJ A;  4BRM A;  5DM7 L;  3LPU A;  3NDK A;  3DYA A;  4CIE A;  1U2V B;  3PX0 A;  3ULE B;  1RCH A;  4LC9 B;  3H1Q A;  3OBW A;  4W5R A;  5JS1 A;  3T3F A;  4RW4 A;  2F9T A;  2P9I B;  4M3X A;  4ZTF A;  4IG0 A;  4OLB A;  3LM9 A;  4W5N A;  4CGH A;  3VOV A;  4DTO A;  4BRA A;  4OX9 K;  3HBT A;  3UB5 A;  1D9D A;  1NJX A;  1NK8 A;  4KTZ A;  4CJF A;  5DM6 L;  2HMP A;  2RE2 A;  1GLJ O;  4KHS A;  3NH0 A;  3H46 O;  4BR2 A;  4FWK A;  3LDS A;  1S1U A;  3VA0 A;  1N34 K;  1SV5 A;  4B1X B;  4W5O A;  2YI1 A;  2ZJP L;  4JS4 A;  5FPM A;  1WAJ A;  3ATV A;  4CF1 A;  4DV4 K;  3DRP A;  2EHG A;  3ZX0 A;  3PX6 A;  4CZE A;  1Z05 A;  4M63 C;  1RTD A;  1BA1 A;  4F3O A;  3DJC A;  3G25 A;  5ELZ A;  3V9Z A;  1TGO A;  4I9Q A;  3HJF A;  3VQ6 A;  3SMS A;  4BRI A;  4IOX A;  4JKH A;  5KI6 A;  1RTH A;  4C8K A;  3PY8 A;  4DLE A;  3BZC A;  4CBW A;  2GUI A;  4B3O A;  5AQK A;  4JS5 A;  3O3F A;  4CGF A;  3HP6 A;  3ZX3 A;  4CJS A;  1C0U A;  1OH7 A;  1GLF O;  4OPH A;  3IUC A;  3CCU N;  3E9O A;  2EWS A;  4DHY A;  4PKI A;  3ASM A;  2E8A A;  4FZY A;  2OZM A;  3J7Y P;  3NF7 A;  1TYQ A;  5BPL A;  2DPN A;  1RDU A;  1RT5 A;  3U3G A;  1XC3 A;  3A5L C;  1BIU A;  1VQ4 N;  2X6N A;  4L8R B;  3HI0 A;  1N32 K;  1IG8 A;  4CJ7 A;  4E1J A;  4NB4 A;  4GMJ B;  2KLA A;  4N47 A;  2YHX A;  3K58 A;  3THY A;  3VTH A;  1VQL N;  1ASW A;  4A61 A;  2BAN A;  3JXU A;  3LP1 A;  3TAN A;  4DQR A;  3MDQ A;  5TKW A;  1ZBF A;  3M8Q A;  3WNH A;  4BRK A;  3AO1 A;  2Q36 A;  1RDA A;  5AQU A;  4A62 A;  2QEX N;  1UWB A;  2FBT A;  5GAH P;  4YNQ A;  4PY5 A;  4CER A;  4E7I A;  1OH8 A;  1TAU A;  4H4O A;  4LF7 K;  4DTM A;  3NGY A;  1HUX A;  3AGK A;  4I6M A;  3VQC A;  4OGE A;  5AFU A;  4E7J A;  1RBT A;  4H0O A;  1HPZ A;  2P51 A;  2W40 A;  1FJG K;  4DTR A;  3O9S A;  1VQ9 N;  3SAG A;  5C15 A;  1V4S A;  1IBL K;  5GIN A;  2P9P A;  3FE1 A;  2GEL A;  1LW0 A;  4FJ9 A;  1XHZ A;  3O4W A;  1VSM A;  2VWJ A;  3TWH A;  4CI6 A;  3BP8 A;  1VRT A;  1ZBS A;  3AVA A;  3RWU A;  1XMO K;  3FFK B;  1WNS A;  4N41 A;  3L4I A;  3BF3 A;  3E1Y A;  4YOR A;  3TTF A;  4BQZ A;  3HO1 A;  4JHD A;  4ISE A;  1X9W A;  1EET A;  2W6L A;  3MCP A;  2E6L A;  3HTV A;  4FOI A;  3ZET B;  3W0L A;  3D45 A;  3MX2 A;  5M1P A;  3TTD A;  4CZI A;  4IOC L;  3SUQ A;  2ITG A;  3QLH A;  5F1X A;  1BG3 A;  4CK2 A;  4NXN K;  4DQP A;  3QB0 A;  5C24 A;  2VCP A;  3K9J A;  3J7A P;  4KHY A;  1U45 A;  1J5O A;  1JXE A;  1NGD A;  3VMF B;  3VEW A;  1SL1 A;  4OKJ A;  4H0P A;  1X9M A;  4FPB A;  4OPK A;  1VRU A;  2HVH A;  1NGA A;  4DKW A;  5IWA K;  3JS6 A;  4F2S A;  1Z26 A;  3VF6 A;  3TTC A;  3ZYY X;  4BRE A;  3PX4 A;  2JWK A;  4CHZ A;  1NK0 A;  4O0J A;  4FJK A;  2Z1H A;  3CPE A;  3FFI A;  3HK2 A;  4IJN A;  3VEX A;  4AHV A;  1C0T A;  4O5F A;  4HUE A;  4ZTJ A;  2G8H A;  3AAR A;  4BG8 A;  4B1U B;  1BUP A;  3P38 A;  2F8S A;  5F2R A;  4GKJ K;  3M8R A;  3RMA A;  4F9O A;  2B6A A;  1NJI O;  1DGK N;  1JLA A;  4JK9 A;  1U48 A;  1HQU A;  5M1N A;  3CCE N;  4EAH D;  4QS7 A;  5AQG A;  4DSL A;  2ATQ A;  1IKW A;  3BF1 A;  3QEP A;  3NMU A;  5F0X A;  4DQQ A;  3I55 N;  3MWT A;  1NBW A;  2VWB A;  1G99 A;  4ISG A;  2HBL A;  3CCL N;  3SYZ A;  5AQT A;  1TAQ A;  4CEF A;  2G8W A;  4MDA A;  5LY3 A;  1NGJ A;  3J80 O;  4CJ3 A;  2HND A;  3T7Z A;  3C6U A;  3ISN C;  1SL2 A;  4K42 A;  4JI2 K;  4E19 A;  3L4Q A;  2A3Z A;  1M90 O;  1C6V A;  4CBX A;  3ZLJ A;  4DR5 K;  4BGB A;  4JKF A;  4XEI A;  5BRE A;  4LSL A;  4B3M K;  3UKR A;  3VES A;  3SJJ A;  2DFH A;  4EP5 A;  2E2Q A;  3LM2 A;  1NMD A;  4NYN A;  1RTI A;  4IDH A;  1YIJ N;  4H5T A;  4FPA A;  1YVU A;  5HBM A;  3OS0 A;  1KLM A;  2ZGZ A;  4I9L A;  4GY2 B;  1CZ9 A;  2WON A;  1NMN A;  1TUU A;  3VQ8 A;  3ZSW A;  2ZJQ L;  1TK8 A;  1W9H A;  1ZC6 A;  3QBX A;  4MO4 A;  1O13 A;  2OPP A;  4A5A A;  4A2A A;  4DTN A;  3KJV A;  5FRO A;  3HVR A;  5J2N A;  1CLQ A;  3ZEU B;  2XY6 A;  3WEE A;  4MFB A;  2AJQ A;  5I9E B;  2Q0R A;  1YF5 L;  3F9M A;  3WXK A;  3HOS A;  1SQK A;  3SI6 A;  4CEA A;  3WUH A;  2FLO A;  1SS6 A;  5C2F A;  4EZ6 A;  4FJI A;  1L3T A;  2P9L B;  1MA9 B;  1B9F A;  1B9D A;  4DTX A;  1FK9 A;  3HYF A;  2GTD A;  5FDL A;  4O55 A;  4FYD A;  3MXM A;  4Y1C A;  1NK4 A;  1VQM N;  3SCX A;  2A41 A;  4KO0 A;  3VQA A;  5EX5 A;  4M3T A;  2VYP A;  1BCM A;  3IRX A;  1TKT A;  4XH5 A;  3O1W A;  1S9E A;  1C1A A;  3FZM A;  3ZSZ A;  4LF8 K;  1BQM A;  4KPY A;  1V4T A;  4BC5 A;  3QFP A;  1S22 A;  1Y64 A;  3ZCM A;  3PV8 A;  1IV0 A;  4EHT A;  2Q3S A;  4BR7 A;  3VGK A;  3H1V X;  1S1T A;  1VQ5 N;  2HHU A;  4FM2 A;  1BOT O; 
#chains in the Genus database with same CATH homology
 2VG7 A;  1XC9 A;  3VQ5 A;  4I2P A;  3S9H A;  1VSF A;  4I7F A;  4DU1 A;  4N76 A;  4DWI A;  1CZB A;  4OKK A;  5HRP A;  2KFN A;  3L2U A;  4BDY A;  4IBN A;  1XWL A;  1FKO A;  2XHB A;  1J53 A;  1J9A A;  4FCY A;  3IAY A;  1WN7 A;  1S1W A;  1WSI A;  2IS3 A;  4OKE A;  1BHL A;  4M42 A;  3K5L A;  3SQ1 A;  3CFO A;  2F96 A;  4CJT A;  4N5S A;  4B9S A;  4J2B A;  3HST B;  4FLX A;  4CJR A;  5KGX A;  3TAQ A;  4Z4I A;  3CQ8 A;  1C1B A;  3A2F A;  4DLG A;  3TI0 A;  3HM9 A;  4CHO A;  4DSF A;  1IKX A;  2OPR A;  3M8P A;  3K57 A;  1REV A;  3OS2 A;  3NAE A;  3LAN A;  1T05 A;  1LAW A;  2HNY A;  3BGR A;  3TAM A;  3V9W A;  1MU2 A;  4FK4 A;  1FKP A;  3P83 D;  1LAV A;  2HB5 A;  3SV3 A;  3ZT2 A;  4IKF A;  3DI6 A;  4CJ5 A;  3LP2 A;  5KRT A;  3CYM A;  4F3T A;  1RDB A;  2QKK A;  3OYJ A;  3CM5 A;  3S3M A;  1A5W A;  4K8Z A;  3C6T A;  3DM2 A;  3LZJ A;  2ZD1 A;  1RT1 A;  1WSG A;  1S5J A;  4HHT A;  3SUO A;  1NK7 A;  1TK0 A;  3VA3 A;  1T7P A;  3RRG A;  4C8M A;  1SKW A;  2BE2 A;  3ZSO A;  4HUG A;  4C8O A;  3VQD A;  1J5O A;  2BDP A;  4G1Q A;  1VSK A;  4YFU A;  3VQB A;  4CEQ A;  1Q9X A;  4CES A;  4CJQ A;  4F2R A;  3ZT1 A;  4K8X A;  3L3V A;  3HPO A;  4FLU A;  2OA8 A;  3B6P A;  4RW7 A;  4PA1 A;  4LH4 A;  1D9F A;  2OPQ A;  4KTW A;  2BGG A;  4HUF A;  4QOZ B;  4E0D A;  2IGI A;  4ID1 A;  2FC0 A;  4O44 A;  2R7Y A;  4DTS A;  1D5A A;  3S3N A;  1UOC A;  1BL3 A;  2DFF A;  1GOB A;  3K5M A;  1N6Q A;  1RT7 A;  4WE1 A;  3AVH A;  5J2Q A;  3CG7 A;  4H4M A;  4CFD A;  3OYM A;  3OYB A;  3RMD A;  3AO2 A;  1NJZ A;  3AVN A;  1X9S A;  3OS1 A;  4IG3 A;  4B8A B;  1YT3 A;  4M41 A;  1DLO A;  1HMV A;  1WAF A;  2IAJ A;  4EP4 A;  1T03 A;  3VQP A;  4BDP A;  3LPU A;  2B5J A;  4E89 A;  3NDK A;  3DYA A;  4CIE A;  3PX0 A;  1RCH A;  4W5R A;  3QIO A;  5JS1 A;  4DFJ A;  1G15 A;  1KTQ A;  3RTV A;  3T3F A;  4CJP A;  4RW4 A;  4Z4H A;  1D8Y A;  4M3X A;  4ZTF A;  4IG0 A;  4KFB A;  3NH2 A;  2Z1J A;  4OLB A;  4CGH A;  4W5N A;  2Y1J A;  3AVF A;  3IS9 A;  4XIU A;  4DTO A;  1VSD A;  3RRH A;  3B6O A;  2HHT A;  5HRO A;  1F21 A;  3LZI A;  1K6Y A;  3NFA A;  1SL0 A;  4Z4E A;  3SUN A;  3VQQ A;  1D9D A;  1XHX A;  3SQ4 A;  1NJX A;  4UQG A;  4FM0 A;  3M8S A;  3HP9 A;  3AA4 A;  4KTZ A;  4CJF A;  2RPI A;  4CFB A;  3KK3 A;  2ZQB A;  3D0P A;  1SKR A;  4Q0B A;  3RMC A;  4KHS A;  3NH0 A;  2O4G A;  3LDS A;  3VA0 A;  1S1U A;  1ASV A;  1ITG A;  1SV5 A;  4W5O A;  3OYK A;  4JRP A;  2HHV A;  2IC3 A;  3MEE A;  1JL2 A;  5CZ1 A;  4DTP A;  1O1W A;  4TSX A;  4KB0 A;  4JS4 A;  1ZBL A;  1WAJ A;  2G8U A;  4KI6 A;  3AA3 A;  4CF1 A;  4AHT A;  1R0A A;  5DK5 A;  1L5U A;  3DRP A;  2EHG A;  5CYQ A;  1HQE A;  1ZBU A;  4CEC A;  4CHY A;  1KVC A;  4E7L A;  3MAQ A;  1UAX A;  3PX6 A;  1BI4 B;  3V9U A;  3DOL A;  4H8K A;  1RTD A;  4F3O A;  3QER A;  4CJU A;  4B9U A;  3V9Z A;  1TGO A;  4I9Q A;  3HJF A;  3VQ6 A;  3TAR A;  1ASU A;  5HRS A;  1RIL A;  4B9L A;  4FXD A;  5KGW A;  1TL1 A;  4FLZ A;  4CEZ A;  3AO4 A;  4CE9 A;  5KI6 A;  4GW6 A;  1RTH A;  1TKZ A;  3KLF A;  3KLH A;  3KK2 A;  4CGI A;  3PY8 A;  4DLE A;  4C8K A;  4F8R A;  3SQ2 A;  2GUI A;  3NGI A;  4BDZ A;  4B3O A;  4DS5 A;  2DY4 A;  1VSJ A;  3O3F A;  4JS5 A;  2A1R A;  3QNO A;  3AVL A;  3DLR A;  1BI4 A;  4CGF A;  3HP6 A;  2XRI A;  4CJS A;  1C0U A;  3VN5 A;  5E41 A;  3KKS A;  4E1M A;  2PY5 A;  3UIQ A;  3TAB A;  3DRR A;  2OYQ A;  4DSK A;  4FJL A;  5FRN A;  3ASM A;  4FZY A;  2JLE A;  1C1C A;  2X6S A;  2IOC A;  4JRQ A;  1A5X A;  2OZM A;  3OYD A;  1UA0 A;  1Q8I A;  3HPH A;  3NF7 A;  3VQ7 A;  1TKD A;  4E7H A;  1WSJ A;  4QCL A;  3P1G A;  2YKN A;  3BDP A;  3HXM A;  1LWF A;  3QNN A;  1S1V A;  4FJ5 A;  4KB1 A;  1RT5 A;  3U3G A;  4DFP A;  1NK6 A;  3AVG A;  4ZHR A;  1L3S A;  1BIU A;  2X6N A;  4L8R B;  4AHS A;  3F9K A;  4DF4 A;  2LSN A;  3WNF A;  5KTQ A;  3QEV A;  3RMB A;  3SPY A;  4GMJ B;  2YHB A;  2D0B A;  4N47 A;  1QSY A;  3L3U A;  4CJV A;  3K58 A;  2YV0 X;  1TKX A;  2GBZ A;  3V1Q A;  3S3O A;  4O4G A;  3HPG A;  2G8V A;  3KLE A;  2YHA A;  3HT3 A;  1UA1 A;  1WLJ A;  3TAP A;  3V81 A;  1NK5 A;  1J54 A;  3OYG A;  2P1J A;  4FVM A;  3AVK A;  2KQ2 A;  4FLY A;  4FJN A;  4AH9 A;  1ASW A;  4BAC A;  2BAN A;  4CJL A;  3G0Z A;  3LP1 A;  3TAN A;  2DFE A;  1JL1 A;  3AVC A;  4BE1 A;  3LAM A;  3NBP A;  4DQR A;  1ZBF A;  4RW8 A;  4PWD A;  4LD0 A;  4DFK A;  3M8Q A;  4KKO A;  3VQ9 A;  1LWC A;  3WNH A;  4HVJ A;  3AO1 A;  4M3W A;  1C0M A;  1RDA A;  2FBV A;  1JLQ A;  1KVB A;  3NHG A;  4CJW A;  2B4J A;  4HTU A;  1UWB A;  3ZSV A;  1YTU A;  5K14 A;  1L3V A;  1I3A A;  2FBT A;  1EP4 A;  1JKH A;  3AV9 A;  4YNQ A;  4CJE A;  4PY5 A;  4KRE A;  3AA5 X;  4CER A;  1HRH A;  2VG5 A;  4E7I A;  1JLG A;  3SQ0 A;  1LWE A;  1TAU A;  4H4O A;  3DLB A;  4DTM A;  4J2E A;  4DMN A;  3NGY A;  4Z4C A;  3ALY A;  3LP0 A;  3RR7 A;  3VQC A;  4OGE A;  1QS4 A;  3PO5 A;  2HHQ A;  3ZSX A;  4IDK A;  4FZZ A;  4E7J A;  4BWM A;  1RBT A;  1IO2 A;  1HPZ A;  2P51 A;  4DTR A;  3LWL A;  4FJ8 A;  3TAF A;  3OYC A;  4CCH A;  4KI4 A;  2XY5 A;  3LAK A;  5DMR A;  3C95 A;  4DSE A;  4DU4 A;  1RBR A;  1LW0 A;  4FJ9 A;  1XHZ A;  1VSM A;  3L8B A;  2VWJ A;  3TWH A;  3SNN A;  2KTQ A;  1RT3 A;  3RWU A;  1VRT A;  3AVA A;  3QO9 A;  1IKV A;  5I42 A;  3TAE A;  1KFS A;  3K59 A;  4MQ3 A;  3T19 A;  1RT6 A;  3LP3 A;  4FJM A;  3WNE A;  1TL3 A;  1WNS A;  4C8L A;  2Y1I A;  4BWJ A;  4J2A A;  4N41 A;  3TAG A;  3OYE A;  3HO1 A;  3OYH A;  4DFM A;  2FBY A;  1X9W A;  4ICL A;  1EET A;  5D3G A;  3CM6 A;  4AHR A;  5CZ2 A;  5KRS A;  4E3S A;  1U47 A;  3MEG A;  1GOA A;  3V4I A;  2E6L A;  2A1S A;  1EKE A;  4RW9 A;  3EY1 A;  1HNV A;  1KRP A;  4CGG A;  3D45 A;  1QQC A;  3E01 A;  1LV5 A;  4B08 A;  1YTA A;  2ITG A;  3SUQ A;  3QEI A;  3QLH A;  4CHP A;  4FLW A;  5J2P A;  4CK2 A;  5HP1 A;  3ZT3 A;  4AHU A;  4DQP A;  3OYF A;  4B9T A;  1S6P A;  5C24 A;  4LSN A;  1X1P A;  2JGU A;  2PYL A;  1VSL A;  4KHY A;  1RT4 A;  3JYT A;  3NCI A;  3V9X A;  3AVB A;  4CF8 A;  1S6Q A;  1U45 A;  1JXE A;  1Y97 A;  1SKS A;  3L2R A;  2G8F A;  4FM1 A;  1BIZ A;  3K5O A;  1SL1 A;  2F8T A;  2KZZ A;  4OKJ A;  1BGX T;  4OVL A;  2HMI A;  2YNI A;  4OPK A;  4Y1D A;  1VRU A;  2X78 A;  1X9M A;  2HVH A;  4M45 A;  3KD5 E;  5I3U A;  3O3G A;  4F2S A;  1GOC A;  4NYF A;  1Z26 A;  1NK8 A;  4IFY A;  4NCA A;  3QEX A;  3OJS A;  3PX4 A;  3DLE A;  4LH5 A;  3OY9 A;  2GV9 A;  4FLV A;  1RT2 A;  5HLF A;  1IG9 A;  3DRS A;  4CHZ A;  1KSP A;  4CHN A;  3I8D A;  2E6M A;  1NK0 A;  4RG8 A;  4O0J A;  4RW6 A;  3OJU A;  4C8N A;  3ZSY A;  2VWK A;  4BE2 A;  4FJK A;  2Z1H A;  1RBU A;  3K2P A;  5J1E A;  2XY7 A;  3QIP A;  3FFI A;  1VSI A;  3NF8 A;  4CJK A;  1U4B A;  1NJW A;  3HK2 A;  3PUF A;  3U3Y A;  2HNZ A;  3AVI A;  4GVM A;  4AHV A;  1C0T A;  4CGJ A;  4CK1 A;  2IDO A;  4HUE A;  2G8I A;  2HW3 A;  4QAG A;  3KLG A;  3VQE A;  4ZTJ A;  1N5Y A;  2G8H A;  3HL8 A;  4Z0U A;  4CGD A;  3SV4 A;  3JSM A;  1HYZ A;  4W5T A;  3CFP A;  2G8K A;  3KKR A;  1WSF A;  3KTQ A;  4KTQ A;  4FJX A;  4M3Y A;  1ZBH A;  1NK9 A;  2F8S A;  4CFA A;  1NOZ A;  1TK5 A;  3OYI A;  4NCG A;  5SZT A;  3M8R A;  3RMA A;  1U49 A;  1TV6 A;  4FW2 A;  4W5Q A;  2B6A A;  1QHT A;  4OGC A;  4CFC A;  3DLH A;  1JLA A;  4ID5 A;  1NKC A;  2YNF A;  3NH1 A;  1KFD A;  3LAL A;  3L2W A;  3THV A;  1U48 A;  1HQU A;  4DSL A;  4KRF A;  2ATQ A;  1IKW A;  4CF2 A;  3QEP A;  3DMJ A;  3OYN A;  1RDC A;  3KIO A;  4DQQ A;  1HYV A;  1WSH A;  2D0A A;  4FK0 A;  1S9G A;  2P5G A;  4J2D A;  4CEE A;  3SYZ A;  4KHN A;  4FZX C;  1RDD A;  2YKM A;  5EU7 A;  2Z1G A;  5CY4 A;  1TAQ A;  3MEC A;  2X74 A;  4CEF A;  2G8W A;  3O4N A;  3RR8 A;  4FJH A;  3OYA A;  1HYS A;  4IFV A;  2D0C A;  3AO5 A;  4AIL C;  4CJ3 A;  2KW4 A;  2HND A;  4CIG A;  5C42 A;  1NKB A;  3C6U A;  4DTU A;  4OJR A;  1VSE A;  4OPJ A;  1ZBI A;  3ISN C;  1SL2 A;  4ELV A;  4R5P A;  4DU3 A;  4Z4F A;  2OZS A;  4E19 A;  3G10 A;  4JLH A;  2WOM A;  2W42 A;  3CFR A;  1T8E A;  1LW2 A;  1C6V A;  4DG1 A;  2PYJ A;  1XI1 A;  4NCB A;  2HVI A;  1NKE A;  4B8C A;  1EXQ A;  1JLC A;  4CF0 A;  2RKI A;  1I39 A;  4E7K A;  1NJY A;  4LY7 A;  4O5B A;  3ZT0 A;  3QEW A;  4ELU A;  3NF6 A;  3WNG A;  4LSL A;  2HHX A;  1Z25 A;  4AHC A;  1Q9Y A;  5JS2 A;  2ETJ A;  1QTM A;  3NE6 A;  3QET A;  3KD1 E;  4KHU A;  3SJJ A;  2DFH A;  4CEB A;  4EP5 A;  1IH7 A;  1WSE A;  5HRR A;  4CED A;  4DSI A;  3TR8 A;  3H08 A;  4NYN A;  3VQ4 A;  1RTI A;  4N56 A;  1YVU A;  4CIF A;  3MXI A;  2PZS A;  4FJ7 A;  5HBM A;  3OS0 A;  3V1R A;  4OLA A;  1JLF A;  4DSJ A;  3QES A;  3AA2 A;  1KLM A;  3NF9 A;  4I9L A;  1IKY A;  3HVT A;  3I0R A;  1CZ9 A;  2WON A;  3VQ8 A;  4B9V A;  3MED A;  2DTU A;  2ZE2 A;  3ZSW A;  1TK8 A;  3V6D A;  1W9H A;  2HHS A;  3C94 A;  1JLB A;  2OPP A;  3ZT4 A;  1W0H A;  2KFZ A;  4EZ9 A;  3DLK A;  3V9S A;  3O3H A;  1EX4 A;  4ELT A;  4DTJ A;  2XO7 A;  4DTN A;  1QSS A;  3KJV A;  4M3R A;  1VK0 A;  3QIN A;  5FRO A;  5C25 A;  3ITH A;  3HVR A;  5J2N A;  3KLI A;  1CLQ A;  3I0S A;  2XY6 A;  3KK1 A;  3MXJ A;  3EZ5 A;  4MFB A;  4CHQ A;  4FJG A;  4FJJ A;  1ZYQ A;  2AJQ A;  2NUB A;  4M3U A;  2QK9 A;  1SUQ A;  5CYM A;  2P5O A;  2QKB A;  4HCB A;  3SI6 A;  4CEA A;  4KAZ A;  5FRM A;  3AVJ A;  4PQU A;  2OPS A;  3SUP A;  2HHW A;  4EZ6 A;  4FJI A;  1KVA A;  1L3T A;  4CF9 A;  3V1O A;  1NOY A;  4PUO A;  2KZM A;  2EX3 A;  3SZ2 A;  4DQS A;  1BIS A;  1B9F A;  1B9D A;  3LPT A;  3NGZ A;  1FK9 A;  3AO3 A;  3P5J A;  4BE0 A;  4DTX A;  4DF8 A;  4KHW A;  3HYF A;  4I2Q A;  5FDL A;  2O4I A;  5T7B A;  3K5N A;  4O55 A;  1A5V A;  3PO4 A;  1KCF A;  1DTT A;  1S1X A;  3AVM A;  3MXM A;  4FYD A;  1CXU A;  3SPZ A;  2FBX A;  1RBS A;  1BCO A;  4HCC A;  2D5R A;  4Y1C A;  1NK4 A;  3OVN A;  3L2Q A;  4CJ4 A;  3SCX A;  4KO0 A;  2XY8 A;  1U04 A;  1HJR A;  3VQA A;  4B9N A;  4O0I A;  4M3Z A;  4M3T A;  3OYL A;  1B92 A;  1CXQ A;  3DLG A;  1BCM A;  1BQN A;  3IRX A;  3O4Q A;  4KV8 A;  1L3U A;  3F73 A;  1TKT A;  1VSH A;  2QXF A;  4DS4 A;  2VG6 A;  2Z1I A;  4Q5V A;  1QSL A;  1JLE A;  1RNH A;  4FW1 A;  4KHQ A;  1S9E A;  4B9M A;  4Z4G A;  1HNI A;  1C1A A;  3ULD A;  3ZSZ A;  3DOK A;  1BQM A;  3T1A A;  1RBV A;  3LWM A;  1FXX A;  4DQI A;  4E1N A;  3U6F A;  4KPY A;  4CEO A;  3ZCM A;  2E4L A;  5SWM A;  3PV8 A;  4FK2 A;  2Q3S A;  5J2M A;  3IG1 A;  3ZSR A;  1KLN A;  5HRN A;  3ZSQ A;  4FLT A;  4F4K A;  1RTJ A;  1S1T A;  2RN2 A;  2RF2 A;  1JXB A;  4CK3 A;  1TVR A;  2YNH A;  3L2V A;  3EYZ A;  2YNG A;  1QE1 A;  2HHU A;  1DTQ A;  4FM2 A;  2I5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...