3CM6A

Crystal structure of cell-death related nuclease 4 (crn-4) bound with er
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
294
structure length
294
Chain Sequence
b'HCPFDTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFERVLPLVVTTIRAGDFRLEMYGVCRYCRKGMDVCGTSHQQTPHDLYKNEEDPIHFAKIAGYY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell death-related nuclease 4
publication title Crystal structure of CRN-4: implications for domain function in apoptotic DNA degradation
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase, apoptosis
total genus 87
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cm6A01
4DSJA 4FJLA 3DRPA 1S1VA 1ASUA 2ZE2A 1JL2A 2F96A 3T19A 5J1EA 3CFRA 3ULDA 4BE2A 4DTMA 3QEVA 3TANA 4IG3A 1S1XA 3SV3A 1UA0A 4FJXA 4CGHA 1IKYA 3DOLA 3HYFA 1RTDA 1NK5A 2ITGA 1EXQA 1LWEA 1JXBA 3C6TA 3AO5A 3KK1A 4Z4IA 1BQNA 3HP6A 1RDBA 1SKRA 3K5LA 1MU2A 4BWJA 3C95A 3LDSA 1RDCA 1EX4A 4HHTA 3L3UA 2Z1IA 5J2NA 1TL1A 3SQ2A 3SYZA 3SUNA 3OJSA 4KPYA 1CXQA 1FKOA 3I8DA 2ZD1A 3DM2A 3SI6A 4KKOA 2RN2A 3NDKA 1BIUA 1NK4A 2JGUA 3V6DA 3LZJA 3VQ6A 1D9DA 2QK9A 2B4JA 3DOKA 4AHRA 4HTUA 4DSEA 4OVLA 3RWUA 4EZ9A 3EYZA 1G15A 2IDOA 3WNFA 3KK2A 2X6NA 2OA8A 5J2QA 4ICLA 4DQRA 5HP1A 4FJ9A 3VA3A 2G8KA 2D5RA 1QSSA 3DLGA 4E7KA 4B9VA 1RT6A 1KTQA 1YT3A 1ASVA 1RT3A 3V1OA 5E41A 3RRHA 4Z4EA 3VQCA 3LWLA 3QETA 1RBUA 4BE1A 3L2WA 3OYLA 1WSGA 1NK9A 4DU1A 4Z0UA 2XHBA 1NJZA 1TK8A 1NK6A 4FVMA 3PV8A 1IKWA 4FLWA 3QEXA 3IRXA 4LSNA 2W42A 1IG9A 3OYFA 4C8MA 3OS1A 2OZSA 1YTAA 3ZT3A 4B8CA 4OKEA 1IKXA 3QEPA 4CEAA 1JLGA 4F3OA 1RILA 3OYDA 3PX4A 1F21A 2HNYA 2A1RA 3K5OA 1GOAA 5T7BA 4JRQA 4C8LA 4CJTA 4CFCA 4E0DA 4DU4A 1X9MA 3P83D 3U3GA 3O4QA 4I2QA 1WN7A 1S1WA 3RMDA 2GUIA 1RBTA 4ID5A 2GV9A 5FRMA 3KD1E 3SQ4A 4OPKA 4E7JA 4HVJA 1QTMA 3HSTB 5D3GA 3U3YA 4EZ6A 4FJIA 3OYAA 3NF8A 3OYBA 2KFZA 4CIEA 5HRPA 3V1RA 3KKRA 4FLUA 1JXEA 4N47A 1C6VA 3AVCA 4FCYA 4C8OA 4PWDA 2Y1IA 2D0AA 2LSNA 4KREA 2AJQA 4CJ4A 3M8SA 3CFPA 1T7PA 2E6LA 1DLOA 1FK9A 1I39A 3HVRA 3RMCA 4GMJB 4JLHA 1U47A 3H08A 4EP4A 4DLEA 1S9GA 2YKNA 3NBPA 3O3GA 1UWBA 2G8HA 1TKXA 3CM6A 4RW8A 1RCHA 4NCGA 1RT5A 4O44A 4AHSA 4CK1A 1NKBA 3AO3A 3AO4A 4QCLA 3AVBA 5JS2A 4DSKA 2BANA 3OYJA 1RTIA 2ETJA 1VRUA 3G0ZA 2YNFA 4CFDA 1SUQA 3B6PA 4FLVA 3AA5X 4BE0A 5I42A 3VN5A 1NK0A 3OY9A 3MAQA 2VG5A 2YHAA 3SPZA 4FJ5A 1B92A 2DFFA 1WSFA 3ZCMA 1VRTA 4QOZB 5CY4A 4CGGA 3SUOA 1NKEA 3NGYA 2QXFA 3KLFA 4DTRA 1SL2A 1QSLA 4F3TA 4W5QA 4OGEA 5J2PA 3PX0A 2OZMA 4DSIA 1TAQA 1S9EA 5HRRA 4B9SA 4O0JA 1RBSA 3LP0A 3AVFA 1JLEA 3AVGA 4Z4HA 3V9UA 3ZT2A 1KVBA 4KV8A 4F4KA 1W0HA 3VA0A 3LZIA 3DLBA 4NYNA 3TARA 1I3AA 3MXMA 1XHZA 1KCFA 4CJKA 4KAZA 5KGWA 3TAFA 2XY6A 4O5BA 4CEDA 4N76A 4CF8A 1ZBIA 2DFHA 3K57A 2A1SA 4KHWA 1JKHA 1HYZA 4BWMA 4DTNA 1SV5A 4CEFA 4I7FA 4BDYA 1U49A 4CJWA 2F8TA 1HYSA 4FZYA 1LAVA 3I0SA 5EU7A 3C6UA 1KFDA 4Q5VA 1L3VA 2X78A 4B9UA 3FFIA 4PQUA 3QEWA 1VK0A 1KVAA 4CHNA 3NH2A 3SZ2A 1BCOA 1L3SA 2G8VA 4J2AA 2G8WA 4KHUA 2E6MA 3HT3A 3VQ5A 1T03A 4B8AB 1A5WA 3KJVA 3TABA 4RW4A 4KTQA 3S3NA 4OPJA 4IFVA 3HXMA 4F2RA 4IBNA 4CIFA 2Y1JA 1LV5A 3NE6A 3MXJA 1EP4A 4LH4A 4CJEA 4AHVA 3QEIA 2FBVA 1S5JA 3WNHA 4E1NA 3CM5A 2X6SA 1RT7A 3SCXA 4GVMA 3KLEA 4CJUA 1S1TA 3ZSYA 5CYQA 3L2VA 1CLQA 3ZSVA 4DQSA 4Y1DA 4HCCA 1TKZA 1WSHA 3QERA 4L8RB 4FJGA 2FBXA 4J2BA 4KHSA 2HNZA 1GOCA 4MFBA 1X9WA 3OYHA 4FLTA 4H4MA 4KHYA 3MECA 3ZSXA 4CEOA 5K14A 1LAWA 3KKSA 3QLHA 1A5VA 4DTJA 4HUEA 4CFBA 4OKKA 4W5OA 3V9ZA 4C8NA 3SPYA 1D8YA 3T1AA 3KLIA 3IS9A 4KHQA 3QIPA 1RT1A 1BHLA 4AILC 3KLGA 2HHQA 1UOCA 4PY5A 3L3VA 4FZXC 4ID1A 1SL0A 2HMIA 3V9XA 2BE2A 4IG0A 3OYGA 3TAGA 3KTQA 3PO5A 1ZBUA 4DQQA 1WAJA 3AA4A 4M3XA 3ASMA 4W5RA 3MEDA 4ZHRA 1J53A 3HP9A 3NF7A 4FJ7A 4CHOA 2KTQA 3LAMA 5KRSA 3WNEA 1NK7A 4BDPA 3EY1A 3QESA 1CXUA 1QE1A 1XHXA 3O4NA 4DFJA 1TL3A 1ZBFA 1FKPA 4AHCA 3C94A 5FROA 1CZBA 4HUFA 1REVA 4DFMA 3CFOA 5C25A 1L3TA 2HW3A 3JYTA 3AV9A 3CQ8A 1NJYA 2RKIA 1KRPA 2Q3SA 1QSYA 3ZT0A 3TAPA 3OYCA 1TGOA 3TAQA 3NHGA 4CF1A 4DTXA 4CHYA 1HQEA 3NH1A 3V9SA 4F8RA 1VSHA 1N6QA 2OYQA 4KO0A 1RT2A 4CJFA 4Z4GA 4CGIA 2F8SA 4DS5A 4CF0A 4Z4FA 4CEEA 2YKMA 3KD5E 4PUOA 4G1QA 3V4IA 2WONA 4CEZA 4LY7A 1B9DA 5HRNA 3SUQA 1TAUA 3QINA 3ZSZA 1XI1A 4DWIA 2KZZA 5C24A 3RMAA 1RDDA 4CK3A 1L5UA 3VQ4A 3BDPA 4TSXA 3OJUA 3M8RA 3ZT1A 1XC9A 4KI6A 4CJRA 1HJRA 4NYFA 3S3OA 2KW4A 2DTUA 2VWKA 4E19A 1SKSA 3ZSRA 4ELTA 4H4OA 3QO9A 1RTJA 4K8XA 4CJLA 4FK4A 3TI0A 4M3YA 4B3OA 1JLCA 1GOBA 4M3RA 3PY8A 4WE1A 5KGXA 3M8PA 2R7YA 2X74A 1RT4A 2YNHA 1QQCA 3AVMA 1U48A 1D5AA 4FJMA 4M3TA 1TKTA 4LD0A 4XIUA 4NCBA 2P5OA 4N41A 4J2EA 3VQBA 2HHSA 1LWFA 1J5OA 1BL3A 3AA2A 4O4GA 4E3SA 3VQDA 3HVTA 2YNIA 5J2MA 1IH7A 1BCMA 4MQ3A 1NOYA 4DTSA 4M45A 4FZZA 1NK8A 4J2DA 1BISA 4FLXA 3LWMA 2B5JA 1KSPA 3A2FA 3PO4A 2OPSA 2OPRA 4DTPA 3SNNA 3VQAA 5HLFA 4C8KA 4HCBA 1C1BA 2IGIA 4CE9A 4M3ZA 4ELVA 1DTTA 5JS1A 3OYKA 2QKBA 1WLJA 1EKEA 3L2RA 5HBMA 2JLEA 2XRIA 4OKJA 3OYIA 1TV6A 3I0RA 4CERA 3OS2A 1TK5A 5FDLA 4KB1A 3TR8A 1QHTA 3S3MA 3VQ9A 1JLQA 3LP2A 4ZTJA 3PUFA 5SZTA 1RBRA 4CJ5A 2VG7A 3OS0A 3PX6A 3OVNA 2P5GA 2O4IA 1ITGA 3MEGA 1HRHA 2OPPA 4DU3A 3KK3A 1T8EA 1NKCA 4F2SA 2EHGA 3LAKA 2RF2A 2Z1GA 4CJPA 4B9NA 2XY7A 4FLYA 2PYJA 3HPHA 4KHNA 4E7IA 3IAYA 5DK5A 3VQPA 1JLAA 2NUBA 1W9HA 2P51A 3HM9A 1KFSA 5KRTA 3DYAA 1JLFA 3OYEA 4FJJA 3VQQA 4FYDA 3LP3A 5SWMA 1IO2A 1WSIA 3DRSA 4M42A 1BQMA 1N5YA 3AO2A 4DTUA 3AVHA 1U04A 3NF6A 1UAXA 4JS5A 2FC0A 4FK0A 1LW2A 1VSDA 4R5PA 3HK2A 2B6AA 1RNHA 1D9FA 1NJWA 5I3UA 2OPQA 1XWLA 1NJXA 1R0AA 1HQUA 3ZSQA 2IOCA 1RTHA 3K2PA 3S9HA 4Q0BA 4CHPA 1BIZA 4FW2A 3P5JA 3F73A 4E7HA 5CZ2A 4Z4CA 3K5MA 3DLHA 3QIOA 4CCHA 3MXIA 3KIOA 4CJQA 4M41A 4QAGA 4DFKA 2FBTA 1VSLA 3LP1A 1HMVA 5HRSA 1U45A 4FJHA 3M8QA 4RW6A 2QKKA 1YTUA 3HPOA 4CJ3A 3CG7A 2VWJA 2IAJA 3EZ5A 1T05A 4DMNA 3DI6A 1Q8IA 1JL1A 3VQEA 4CF9A 4BDZA 4FM2A 4FM1A 4NCAA 2Z1HA 1S1UA 3SUPA 4I9LA 1EETA 1HNVA 5C42A 4CHQA 3L8BA 3RMBA 1TKDA 1S6PA 5HROA 2PZSA 4IKFA 4M3WA 4KRFA 4H8KA 3P1GA 4KTWA 3G10A 1SL1A 2HHVA 1C0UA 3NGIA 4GW6A 3K59A 4DF8A 3QNNA 3THVA 4B08A 4DQIA 2HHTA 3D0PA 4EP5A 4UQGA 4OLBA 3AVJA 2XY5A 3NH0A 1VSFA 2EX3A 2HB5A 4CHZA 2I5JA 3TWHA 1WAFA 3QNOA 1HYVA 3AVAA 3TAMA 3OYNA 3SQ1A 2P1JA 3RR7A 2HVHA 1KLMA 4CF2A 1O1WA 4KTZA 4B9MA 4CECA 2WOMA 1K6YA 2G8UA 3NAEA 3AVNA 1LWCA 1VSEA 3KLHA 3RTVA 1B9FA 4CGJA 1TK0A 4LSLA 3CYMA 4AHUA 4I2PA 3DLEA 4LH5A 3AVLA 4CJSA 4DLGA 4E7LA 3LPTA 1UA1A 1KLNA 2XO7A 3RRGA 3L2QA 1LW0A 4DG1A 1C1AA 4DSFA 1ZYQA 1Y97A 1DTQA 3BGRA 3ISNC 1C0TA 4Y1CA 1J9AA 2IS3A 3VQ8A 2FBYA 3B6OA 3K5NA 2KZMA 3NCIA 2YHBA 3TAEA 4B9LA 4OGCA 4W5TA 1SKWA 4N56A 5CZ1A 1S6QA 2BGGA 4CGDA 1CZ9A 4CGFA 4DSLA 4K8ZA 3DLRA 5CYMA 4E1MA 1VSJA 3O3FA 3ZSOA 5KTQA 2YV0X 5FRNA 3ITHA 1KVCA 2D0BA 3ZSWA 4CESA 3L2UA 4AHTA 3T3FA 4FM0A 2G8FA 2Z1JA 4ELUA 4KI4A 3O3HA 4W5NA 1TVRA 2DY4A 1WSEA 3HJFA 4YNQA 1C1CA 1VSIA 4O0IA 1HNIA 5DMRA 4FK2A 3E01A 3D45A 4RW9A 1C0MA 4RW7A 3U6FA 1WNSA 4DFPA 3V9WA 4M3UA 2G8IA 4PA1A 1IKVA 2DFEA 3NGZA 3LPUA 4ZTFA 2HNDA 4KB0A 1Q9YA 1QS4A 3SQ0A 4FJNA 4RG8A 3HO1A 1JLBA 1WSJA 3DRRA 1J54A 2HVIA 4DS4A 2HHUA 3AVKA 2KFNA 2VG6A 1Z26A 2XY8A 3F9KA 4FJ8A 4OLAA 1VSMA 3LALA 1BGXT 1Z25A 3AO1A 5KI6A 3ZT4A 2GBZA 4HUGA 1Q9XA 3RR8A 4I9QA 4O55A 4CFAA 3SV4A 4CIGA 4DTOA 3DLKA 3NF9A 3V1QA 3AA3A 2ATQA 3NFAA 2D0CA 3OYMA 3HPGA 1RBVA 2E4LA 4FJKA 3WNGA 1ASWA 3HL8A 4N5SA 4DF4A 4OJRA 4YFUA 3SJJA 4FLZA 3MEEA 2PY5A 1NOZA 4IDKA 3LANA 4FW1A 1YVUA 4B9TA 1ZBHA 1BI4A 4CJVA 4FXDA 2PYLA 3ALYA 1X1PA 1BI4B 4KFBA 4JS4A 1X9SA 3VQ7A 2YNGA 3JSMA 1RDAA 4JRPA 2IC3A 4IFYA 1FXXA 4CEQA 3K58A 2KQ2A 3V81A 2ZQBA 4AH9A 3IG1A 2RPIA 4DQPA 1ZBLA 3DMJA 4CK2A 4E89A 4BACA 3AVIA 1U4BA 1L3UA 3UIQA 2BDPA 2HHXA 1A5XA 2HHWA 1HPZA 2O4GA 1VSKA 4CEBA
chains in the Genus database with same CATH superfamily
1ASUA 4JI6K 3QEVA 1NK5A 2ITGA 5EVZA 1JXBA 3AO5A 4Z4IA 3HP6A 1RDBA 5J2NA 1RDCA 2PAVA 2Z1IA 2QTDA 1TL1A 3SUNA 1HR0K 4KPYA 3GL1A 3DM2A 4KKOA 1EWRA 2RN2A 3NDKA 1BIUA 3PIOL 1JCFA 3SK3A 3V6DA 4KBOA 4AHRA 4H0YB 4A2AA 2X6NA 5J2QA 4ICLA 4DQRA 4FJ9A 2G8KA 1QSSA 3QBXA 4B9VA 1RT6A 1YT3A 3ULEA 1ASVA 1RT3A 3V1OA 4BE1A 2HF4A 4DV2K 1WBDA 3O4WA 1TK8A 4FVMA 4QS9A 3PV8A 4K25A 4LSNA 3OYFA 4DB3A 4FWMA 1DGKN 3QEPA 2ZWHA 3OYDA 3ENOA 1VQ8N 5T7BA 4E0DA 5CR4A 3P83D 2GUIA 1RBTA 3KD1E 3SQ4A 4OPKA 4E7JA 4IEEA 1HLUA 4HVJA 5LJVA 3CC7N 4AQYK 3U3YA 2F7TA 3OYAA 3NF8A 4CIEA 5HRPA 3MCPA 5JLHA 4N47A 1C6VA 4B1YB 2Y1IA 2FXUA 1BWFO 2LSNA 1XMQK 2AJQA 5AQGA 4GMJB 1U47A 1TYQB 4JI0K 1N34K 3O3GA 1UWBA 3ATUA 2UUBK 4NO7A 3WQUA 4CFDA 3AA5X 1ATNA 3OY9A 4NXMK 3SPZA 3OBWA 1VRTA 3ZCMA 4CGGA 1J5EK 1QSLA 4W5QA 2OZMA 2O8FB 1RBSA 3O9SA 1HKGA 3AVFA 5IWAK 4JKEA 3ZT2A 1KVBA 4NXNK 3LM9A 3THYB 4ILHA 2XY6A 3GG4A 3CCMN 3BF1A 2DFHA 4BGBA 4BC3A 3P4IA 5E84A 2E1ZA 4CEFA 4XEIA 4FZYA 3O08A 4JI8K 3C6UA 4U7BA 5AQLA 4JKDA 3WXLA 5F0XA 3VESA 4J2AA 1KVAA 1L3SA 2QWPA 1BCOA 3THWB 2G8WA 1RFQA 3VEWA 2E6MA 1T03A 1A5WA 4F9OA 3K9JA 4XH1A 1DEJA 2O8DB 4F2RA 4FWOA 4LH4A 4CJEA 3QEIA 2P9UA 2FBVA 3E66A 1P90A 4CJUA 3L2VA 2HBLA 1QHAA 3ZSVA 4DQSA 3SAHA 1TKZA 3QERA 5FPEA 4FJGA 4KHSA 4J2BA 1GOCA 4MFBA 4FLTA 4KHYA 4H4MA 1OKJA 2NZTA 3ZSXA 1A5VA 4CFBA 1ZBSA 3V9ZA 3D7EO 3ZEUA 3KLIA 4KHQA 3MN5A 1V4SA 4OO1J 3KLGA 5BPNA 1SL0A 2BE2A 4IG0A 3TAGA 5B8HA 1WAJA 4YOXA 1Y64A 1OH7A 4FWQA 4BVOA 4ZHRA 1J53A 4C1NK 4FJ7A 4CHOA 4YOWA 1ESVA 2IVPA 3WNEA 4BDPA 4XH5A 4WQ5A 3DXKA 4DFJA 4ILGB 1ZBFA 1NBWA 5AR0A 4JAXA 3CFOA 2WTUA 3JYTA 1NJYA 1QSYA 3TAPA 4CBUA 1SQKA 4LF4K 3NHGA 2V7YA 4WQ5C 4CF1A 3VEXA 3ENHA 4AM6A 3W3DA 1RT2A 3MMVA 4A2BA 2WUSA 1BA1A 4CEEA 2IIRA 2YKMA 3KD5E 4G1QA 3J7ZO 3MWPA 2Q2RA 4IZ9A 3VGKA 4IJNA 2NLXA 1L5UA 4WFNL 1U2VA 2P9KA 2EWSA 3P38A 4H4OA 1KQSM 5BR8K 4K8XA 2NRRA 1GOBA 4M3RA 5EX5A 4WFBL 3DXMA 4BRDA 3M8PA 1ZC6A 3AVMA 4M3TA 3IKMA 4N41A 3VQBA 2HHSA 1J5OA 4O4GA 1NOYA 2YNIA 4FOEA 1BISA 3LWMA 3VPZA 1Q7YO 5HLFA 4DTPA 4MDAA 3VQAA 4M3ZA 3F5TA 3WEEA 5MLCQ 1DTTA 1XMOK 3H6EA 3HOSA 4M7XA 3K0SA 3OYIA 1YJ9N 2YX6A 4CW7B 4KB1A 5FDLA 4BQZA 3VQ9A 1JLQA 3SMSA 3PUFA 1RBRA 2VG7A 4YOTA 1C0GA 2OTLN 3VF6A 3E1YA 1ITGA 1T8EA 1NKCA 2Z1GA 4B9NA 2BH1A 3SAGA 3A5NC 3HPHA 4KHNA 4E7IA 3A5OC 3VQPA 1JLAA 3CJAA 1IBKK 5KRTA 4A61A 3IDHA 4PL8A 1JLFA 3OYEA 4JD2B 5E26A 1WSIA 3DRSA 1BQMA 4DTUA 1UAXA 5AQFA 1VSDA 1RNHA 2P9IA 1VQ9N 5I3UA 1WOQA 4BRIA 2OPQA 1XWLA 3SBTA 1VQ6N 4A57A 3ZSQA 4JYAK 3THXB 1BIZA 4A59A 5M1NA 2QM1A 3DLHA 3MXIA 3G4SN 2AA4A 4CZGA 4QAGA 2I7NA 1U45A 1KAZA 2UUCK 3C65A 2FSJA 3J7AP 3M8QA 1YTUA 4CBWA 4H0VB 3VEZA 3VEVA 3EZ5A 1Q86O 3DI6A 1Q8IA 3VQEA 1QZ6A 4NCAA 2ASPA 4CZFA 1S1UA 1EETA 1K8KB 5C42A 1TKDA 3RMBA 2PZSA 5HROA 1MDUB 3P1GA 4FVUA 1QZ5A 3G10A 4W5NA 3QNNA 3O6WA 4DQIA 2CGLA 5AQPA 3CXCM 1WAFA 1HYVA 3AVAA 3TAMA 4V19S 4CF2A 5BN8A 5LJWA 3LDLA 2WOMA 4CECA 1K6YA 1VSEA 4BRHA 3DLEA 3AVLA 4GV9A 3LPTA 1KLNA 4DSFA 1LW0A 1C1AA 1HX1A 2KZMA 1E4GT 1J9AA 4JKGA 4H5RA 4W5TA 3C7NA 5BREA 5CZ1A 3MK6A 1S6QA 1VHXA 4CGDA 3DLRA 3ZSWA 3GDQA 4YY3K 2FLOA 4CBXA 4LF9K 1WSEA 2ZF5O 2E5LK 1S22A 3TSPA 3ZETB 3C6HA 3E01A 1C0MA 3U6FA 2VGMA 3V9WA 4PA1A 1J54A 3F2KA 3VF4A 3A0IX 1JCEA 2ZGZA 3M5RA 2JWKA 1Z26A 3F9KA 2P9SB 4OLAA 3AO1A 4I9QA 4BR4A 1FJGK 4DTOA 3DLKA 4X64K 3CCVN 2D0CA 3HL8A 4N5SA 4FWPA 2YI1A 1HNXK 4MO5A 2ASMA 3U4LA 2PYLA 1K8AO 2IC3A 3K58A 4JKAA 2D1KA 2QI2A 1ZBLA 1XUPO 3AVIA 1U4BA 3UIQA 2F9WA 2BDPA 3A8YA 4FSVA 3OVNA 1HPZA 3RMAA 4CEBA 4DSJA 4BC5A 4FJLA 4JV5K 1S1VA 3FFKB 3UKUA 2ZE2A 1NGFA 2F96A 1IV0A 5J1EA 4DTMA 1S1XA 4CGHA 1MWMA 1T6CA 3WXIA 1RTDA 5AQZA 2UYTA 3KVGA 1VQPN 2YJEA 3C95A 4WQ4A 3VOVA 1EX4A 3I8DA 1KXPA 1NK4A 2JGUA 3VQ6A 1D9DA 1NGCA 2E1YA 4HTUA 4OVLA 2V51B 1G15A 4FPAA 3KK2A 1VQ7N 2QWOA 1HUXA 4WQ4C 4YOUA 2GELA 3WXJA 3RRHA 3CD6N 3ULEB 5ADXA 3QETA 1RBUA 2Q0RA 4Z0UA 1NJZA 3QEXA 3UB5A 1N36K 1IG9A 2KHOA 1YTAA 2HF3A 4B8CA 1NGGA 3H3OB 1NWKA 4F3OA 1F21A 2A1RA 1GOAA 2HBKA 4DU4A 1X9MA 4JI2K 4I2QA 1ATSA 1S1WA 1WN7A 4IOXA 3AARA 3EKUA 5FRMA 4CVNE 3HSTB 3V1RA 4BRLA 1JXEA 1EO1A 3AVCA 4PWDA 3H3NO 4IO8A 4KREA 1E4FT 2ASOA 3CFPA 1I39A 1HJOA 3RMCA 4JLHA 5KPZA 4DLEA 1S9GA 2UXBK 2YKNA 2G8HA 5JMVA 3CM6A 4CK1A 1NKBA 4QCLA 4DSKA 5JS2A 3D2EA 3G0ZA 4PKGA 5AZJA 2YNFA 5I42A 1SUQA 4BE0A 4IDHA 1J6ZA 2YHAA 4QOZB 3J8AA 2DFFA 5CY4A 5C15A 2P9NA 2Q1NA 2QXFA 3AGRA 3QICA 2QXLA 4E1JA 1SL2A 1NNEA 1S9EA 5HRRA 4O0JA 3LP0A 3VEYA 3CJ9A 3AVGA 4Z4HA 3V9UA 1W97L 4HWIA 3VA0A 3LZIA 4NYNA 1NJIO 4KAZA 5KGWA 2ZGYA 3IMXA 5AQRA 3ENBA 1XNRK 4M63C 1JKHA 1HYZA 4BWMA 5AQIA 4EAHD 4BQLA 4DTNA 1M90O 5LY3A 1LAVA 1R59O 3HM8A 4B9UA 3FFIA 3BZKA 4O5FA 3QEWA 4PQUA 3FZKA 1VK0A 4CHNA 3WXMB 5TKYA 3HT3A 3VQ5A 3G71N 3CCEN 4KTQA 3S3NA 5GIOA 4IFVA 4J8FA 1OVYA 4BRPA 3O9RA 4AHVA 3CI5A 3QFUA 2P9UB 1YUWA 4E1NA 3CM5A 2X6SA 1RT7A 1YF5L 3SCXA 4GVMA 4HCCA 2HNZA 3EE8A 1X9WA 4DR6K 1LAWA 4OKKA 4DR2K 4BY9C 1D8YA 5JLFA 3T1AA 3ZEUB 1O13A 1VQKN 1BHLA 3SMPA 3L3VA 4ID1A 2HBJA 3CERA 4PL7A 3PO5A 3KTQA 1ZBUA 5A2QO 2P9PA 2UUAK 3MEDA 3O9QA 2KTQA 5KRSA 1NK7A 3EY1A 3QESA 4BRKA 1XHXA 3O4NA 3DXKB 1TL3A 5JVHL 4CZLA 3TTCA 4YORA 1REVA 4DFMA 1L3TA 2UXCK 3UKRA 2Q3SA 3BZCA 4EHTA 3VETA 3FLCO 3TAQA 1K73O 2QA4N 2OANA 4DTXA 4M7YA 2E2PA 3TTDA 3KHYA 4Z4GA 3P39A 2F8SA 4Z4FA 3JXUA 2WONA 4LY7A 4X62K 2FSKA 3QINA 3ZSZA 1QVFM 5KQ8A 1OH6A 4CK3A 3VQ4A 3BDPA 3OJUA 1NGHA 1XC9A 1U2VB 1V4TA 2P9KB 4CJRA 2DTUA 1MWKA 5LL6Z 3O5BA 1H1VA 4CJLA 2Q97A 4DR3K 2GWKA 2GTDA 4X66K 3I55N 3OBYA 1KD1O 4WE1A 2WC9A 3DXMB 2YNHA 1U48A 2FF3B 4LD0A 1IBLK 2P5OA 3BF3A 2W41A 3LDNA 1BL3A 3AA2A 4DR1K 2OA8A 3ZLJA 3K9KA 1LOTB 4EHUA 5J2MA 2OPSA 4RTFD 1C1BA 2YJFA 1DT9A 4ELVA 3WEEB 5JS1A 1WLJA 1EKEA 1ZXOA 3F9MA 4BR5A 2JLEA 3OS2A 4DHYA 4GVEA 5AQXA 3LP2A 4ZTJA 3OS0A 3G25A 3MEGA 3MN6A 3I8BA 4F2SA 1T44A 4CJPA 1C0FA 1YJNN 2NUBA 2W6KA 3HZ6A 4FYDA 3VQQA 4GNIA 5H1SQ 1W7AA 3AO2A 3NF6A 3O1WA 2FC0A 2A42A 4FK0A 4R5PA 2FSNA 2P9IB 1NJXA 4JK8A 1HQUA 5TKWA 4JI7K 1D4XA 3K2PA 4Q0BA 4CHPA 3GBTA 3P5JA 1QQNA 5CZ2A 4CD1A 4CCHA 3KIOA 3FE1A 4CJQA 4M41A 4B1UB 2FBTA 3LP1A 5HRSA 5FPNA 3RSEA 2QKKA 3HPOA 2VQFK 2CH5A 1HNZK 3CG7A 2IAJA 1T05A 4BDZA 4FM1A 4I9LA 1Q81O 1HNVA 3U8XA 4IKFA 4KRFA 1S6PA 3KWGA 3MN9A 1YHQN 4DV3K 4KTWA 5BRHA 1C0UA 3NGIA 4B3SK 4DF8A 3B8AX 4A5AA 4UQGA 3RVCA 2XY5A 3NH0A 2EX3A 3E9LA 3QNOA 2QWRA 3SQ1A 2P1JA 2HVHA 1KLMA 1O1WA 3T69A 2NRXA 3AVNA 4CGJA 1TK0A 2PBDA 3I56N 4AHUA 4I2PA 4E7LA 3QMLA 1FW6A 1UA1A 4O8UA 1ZYQA 3M6GA 1DTQA 3BGRA 3ISNC 3H45C 1X3NA 3K5NA 4IOCL 2FBYA 2YHBA 3G6EN 4JKGB 4IWVA 1Q18A 3SLCA 3TSUA 3C7NB 3QB0A 3TPQA 5C2DA 4DSLA 4LF8K 2BGGA 4E1MA 3ZSOA 5KTQA 5EOYA 1RDUA 5FRNA 4CESA 3VERA 4OX9K 5AJ3K 4ELUA 3H1VX 1TVRA 5LMUK 2ZJQL 2DY4A 3HJFA 4NLBA 4FK2A 1HNIA 5DMRA 4RW7A 2G8IA 3KWIA 1IKVA 3NGZA 3SQ0A 4RG8A 3VGMA 5FLXO 4DS4A 2HHUA 4BRAA 2KFNA 4AM7A 2XY8A 1BO5O 4FJ8A 3LALA 1BGXT 3ZT4A 1Q9XA 2HHTA 3SV4A 4NLCA 3V1QA 2ATQA 4DV1K 1VQMN 4FJKA 2E4LA 1ASWA 4MDBA 1GLLO 1YAGA 4FLZA 2P9LA 3O80A 4IDKA 3CMAN 1BI4A 4GY2B 4MO4A 3DLLL 1X1PA 1Z05A 3L4IA 3I33A 4KFBA 3JSMA 4JRPA 1FXXA 2KQ2A 3CJBA 4AH9A 4LFCK 4DQPA 3DMJA 4CK2A 2E2OA 4E89A 2HHXA 5LMNK 4DV0K 2HHWA 1NLVA 3I0SA 2HHHK 3ZX0A 4ISFA 3DRPA 4CJ7A 3T19A 3CFRA 3TANA 3UKUB 1WUAA 4IG3A 3SV3A 2GUPA 1IKYA 3HYFA 2H3GX 4MLHA 1EXQA 3C6TA 3KK1A 1SKRA 4H0XB 3K5LA 1NMDA 3DAWA 4BWJA 4HHTA 3SYZA 3OJSA 1CXQA 1FKOA 3SI6A 4BGAA 1SZ2A 3KZBA 3NVMA 4WF9L 2QK9A 2B4JA 3DOKA 4DSEA 2IDOA 4IO9L 4CZIA 5HP1A 5I9EB 3DLGA 2KLAA 4E7KA 5E41A 3LWLA 4DKWA 3OYLA 5DM6L 4DU1A 1NK6A 1YVNA 1EWQA 4FLWA 3IRXA 4C8MA 3OS1A 2OZSA 3ZT3A 4CZHA 1U6ZA 4OKEA 1JLGA 3T1HK 1RILA 4YDUA 4EIAA 3K5OA 4CJTA 4CFCA 1YIJN 3U3GA 3EO3A 3J7YP 3CCUN 1VAZA 4WCEL 4UY8O 4ID5A 1BG3A 1QTMA 2HBMA 5D3GA 4EZ6A 1NGJA 3OYBA 4KH5A 4FLUA 4YDUC 2UU9K 4C8OA 3FZHA 2YHYA 2QWQA 3FGUA 4JEPA 4CJ4A 3M8SA 1DLOA 3MX2A 5AQMA 3T1YK 3HVRA 3H08A 3OHRA 2A6AA 1HPMA 1TKXA 4AHSA 1RCHA 1RT5A 4O44A 3AO4A 5EY4A 1W2BM 4DR4K 1RTIA 1GLJO 1IJJA 3B6PA 3D2EB 1RGIA 5AZJB 2GX9A 3VN5A 1NK0A 5KPTA 4B3MK 3FZMA 5AQOA 3MAQA 1WSFA 3TSQA 4CZKA 4AF1A 3SUOA 1NKEA 1WB9A 5J2PA 4OGEA 2P9NB 3PX0A 4DSIA 1TAQA 4B9SA 1P8ZA 3BP8A 1G99A 4DV5K 4KV8A 1VQLN 4F4KA 1W0HA 3QBWA 4GKJK 3DLBA 3AAPA 4DQ8A 1I3AA 3MXMA 1XHZA 3TAFA 4CEDA 4N76A 4CF8A 4JN4A 2A1SA 2NRTA 3JAMO 2Q36A 4BDYA 1L3VA 4Q5VA 1KFDA 4ISGA 3WQTA 1CZAN 5BPLA 2V7ZA 1N32K 3PSIA 1GLAG 2G8VA 4G9ZA 5ELZA 5EXWA 4B8AB 4B3RK 4JI4K 4OPJA 4YHHK 4A62A 3NE6A 3R8EA 2VCPA 1S5JA 3WNHA 2O8BA 4DV4K 3KLEA 1S1TA 5AQWA 3ZSYA 1CLQA 1XNQK 4L8RB 3OYHA 1OH8A 5K14A 4DTJA 3CCQN 2VYPA 4W5OA 4HUEA 1KC8O 2I7PA 2E88A 3SPYA 3FZLA 3IS9A 4FL9A 1T6DA 3Q7BA 3EN9A 3QIPA 4WFAL 3QFPA 4AILC 2HHQA 5DM7L 4FZXC 2HMIA 4JKFA 3OYGA 4A5BA 4GV6A 3AA4A 3ASMA 4W5RA 2P9PB 3HP9A 3R9PA 1CXUA 1QE1A 3VF2A 2OTJN 1FKPA 2VWBA 5FROA 1CZBA 5M1FA 1OH5A 4I6MA 2HW3A 3CF5L 3L6QA 3CQ8A 4DUZK 3MWTA 3UKRB 3ZT0A 4U67L 3OYCA 1TUUA 1NG9A 4CHYA 1HQEA 3V9SA 4F8RA 1N6QA 2OYQA 4CJFA 3OA9A 4CF0A 3V4IA 1X9JA 2GWJA 1B9DA 4IXCA 4EFHA 3SUQA 3CPEA 1XI1A 4DWIA 2KZZA 1NGEA 5C24A 5M1OA 4LFBK 5AZIA 2NRHA 3EE9A 4TSXA 3M8RA 1IBMK 3ZT1A 4KI6A 3VTHA 1HJRA 4NYFA 2KW4A 4E19A 1SKSA 3IUCA 3ZSRA 4ELTA 3CCJN 4M3YA 1JLCA 5KGXA 4HTLA 5GAGP 2X74A 2R7YA 1RT4A 1QQCA 1D5AA 4JHDA 4FJMA 4DCHA 4H0PA 5AQVA 1SAZA 3D2FA 2CH6A 4E3SA 3HVTA 1BCMA 4OPHA 4DTSA 2ZM6K 2GEMA 4FZZA 1BDGA 2WBNA 1NK8A 4J2DA 3WT0A 4JK9A 2B5JA 1KSPA 1DKGD 3A2FA 4DV7K 3PO4A 2OPRA 4HCBA 1BOTO 4FPBA 3MDQA 2IGIA 1VQ4N 2QKBA 4KH4A 3R1XA 4OKJA 1TK5A 1TV6A 3I0RA 5SZTA 5GADP 4CJ5A 3FR0A 3PX6A 1XC3A 3CJ1A 2P5GA 3LDOA 4DU3A 5IT9O 3KK3A 2A3ZA 1Z6RA 3LAKA 4PHTX 3ZX2A 3IAYA 2P51A 3U9ZA 5M1KA 4GKKK 5SWMA 4M42A 2ITMA 3AVHA 1U04A 4JS5A 5GIPA 1LW2A 3HK2A 2B6AA 1D9FA 2OCEA 3C0BA 1NJWA 2QW9A 1R0AA 4CI6A 4JKBA 3Q7CA 2IOCA 1RTHA 2O8CA 2V52B 4H5VA 4FW2A 4E7HA 4Z4CA 4BC4A 4BC2A 1VSLA 4IJAA 1NM1A 4JI1K 2AP1A 3RSEB 1JL1A 4BRFA 3SUPA 4BG9A 4B3TK 2W6LA 3L8BA 4CHQA 1N33K 1E3MA 3CC2N 3E9PA 3GE1A 4H8KA 4FWKA 1HKBA 3O8MA 1SL1A 3K59A 4B08A 3A5MC 4EP5A 4OLBA 1VSFA 4X65K 3SBGA 3LDPA 2I5JA 3EEQA 4RCHA 4BRCA 3OYNA 3CJCA 4KTZA 2W40A 4B9MA 3NAEA 1BUPA 3KLHA 3RTVA 3EZWA 4DLGA 3RRGA 2XO7A 1WBBA 3VGLA 1T3VA 5F1XA 1C0TA 3VQ8A 2VQEK 2NRZA 1MA9B 4B9LA 4OGCA 2BTFA 4CGFA 1CZ9A 5CYMA 1TUYA 2O8EA 3O3FA 3S41A 1EQYA 3LDQA 2D0BA 3L2UA 2BUPA 2G8FA 4KI4A 5BN9A 5GAEP 5C0YA 1VSIA 2QEXN 4M3UA 1NGDA 4FWRA 1N8RO 4KHPK 1RDWX 3ZX3A 4ZTFA 4FJNA 3ID8A 1WSJA 2UXDK 3HRGA 1GLBG 2F4VK 4LF5K 2VG6A 4RWTA 3CCRN 1Z25A 5KI6A 4HUGA 3RR8A 4CIGA 3NF9A 3AA3A 4PKHA 3OYMA 3HPGA 3CPWM 1RBVA 5KPRA 3WNGA 3SJJA 3HBTA 3MEEA 5GAHP 1NOZA 2P9LB 1YVUA 1ZBHA 4FXDA 1ATRA 2E2QA 4CJVA 3ALYA 3T7ZA 1BI4B 2F9TA 3JS6A 1VQ5N 2YNGA 1RDAA 4IFYA 4CEQA 2O4GA 2HOEA 2RPIA 5AFUA 3VEOA 5HOOA 5AQKA 5AQUA 1L3UA 1A5XA 1VSKA 1JL2A 3ULDA 4B9QA 3DJCA 4BE2A 1UA0A 4FJXA 1JJ2M 3DOLA 5C10A 1LWEA 1BQNA 4KH6A 1MU2A 3LDSA 3SQ2A 3L3UA 3M1FA 5HL7L 2ZD1A 5CE3A 1GLCG 5FPMA 3LZJA 3RWUA 4EZ9A 3EYZA 3WNFA 5KQDA 3VA3A 2D5RA 3H1QA 1KTQA 4Z4EA 3VQCA 3L2WA 1WSGA 1GLDG 1NK9A 2XHBA 3H46O 5JICA 2ZJPL 1IKWA 2W42A 3DWLA 3KK7A 2QWMA 1IKXA 4CEAA 1HNWK 3PX4A 2HNYA 5GINA 2ZJRL 4BG8A 4JRQA 4C8LA 4JK7A 4K42A 4MLEA 3O4QA 3RMDA 2GV9A 5BPMA 4FJIA 2KFZA 3PLAA 3CCLN 3KKRA 1QQMA 5C12A 1YJWN 4FCYA 2D0AA 4BRMA 1T7PA 2E6LA 5AQYA 1FK9A 1I94K 3AY9A 4YOVA 1TYQA 4EP4A 3NBPA 3D6RA 3TU5A 2VGNA 4RW8A 3OW2M 4NCGA 5AFUH 3AO3A 3AVBA 2BANA 3OYJA 1VQON 2ETJA 1VRUA 4FLVA 4FWSA 3AAQA 2A5XA 4B1VA 2J4RA 4FJ5A 2VG5A 1B92A 4Y0WA 4ISEA 3CCSN 3NGYA 3KLFA 4DR7K 4DTRA 2HMPA 4F3TA 2O8FA 3GOIA 4BROA 3VENA 4Z94A 2QWNA 1JLEA 4CZEA 5AQNA 5AQQA 3THYA 3TARA 1KCFA 4CJKA 1YI2N 2D4WA 3P31A 4O5BA 3CQXA 1ZBIA 1BA0A 3K57A 4JI3K 4KHWA 5F2RA 4JKCA 4BR0A 1SV5A 4I7FA 1U49A 3O9UA 4CJWA 3J81O 4FWNA 3BY5A 1HYSA 1BU6O 3CMEN 5EU7A 4LC9B 2X78A 4L3QA 4CZMA 3THWA 3E9OA 3ID6A 3NH2A 3SZ2A 4YOYA 4KHUA 4O8KA 4K43A 4DV6K 3CQYA 3KJVA 3TABA 2O8DA 4RW4A 2JWLA 3HXMA 4IBNA 4CIFA 2Y1JA 1LV5A 3MXJA 1EP4A 3M3ZA 3A5LC 4IFEA 2O8BB 5CYQA 3N4QA 4Y1DA 1WSHA 1NMNA 2FBXA 4H5WA 5FPDA 2RHKA 3MECA 4CEOA 3KKSA 4QS7A 2A40A 3QLHA 4C8NA 4C1NI 4H0TB 2D0PA 1RT1A 4BR9A 1UOCA 4PY5A 3V9XA 4DR5K 5M1QA 4DQQA 4M3XA 2DPNA 4BRGA 3NF7A 3LAMA 3SJHA 4GV3A 3SAFA 4AHCA 2E20A 3C94A 4HUFA 5AQJA 5C25A 2PFUA 3AV9A 4I6MB 2RKIA 1KRPA 4JI5K 3NVKA 1Q82O 3FZFA 1TGOA 1S3XA 3ATVA 1GLEG 4B1XB 3NH1A 1VSHA 1KAYA 4KO0A 3CIPA 4CGIA 3BEXA 2IVOA 4DS5A 4PUOA 1HKCA 4CEZA 2CGJA 2NNWA 5HRNA 1TAUA 4BRQA 1GLFO 1RDDA 4B1WB 1NU0A 1VQNN 5AZIB 4IEIA 3MCAB 4FOIA 4LF7K 3S3OA 3R3LA 2VWKA 3HSCA 3QO9A 1IG8A 1RTJA 4FK4A 1ILYA 2A41A 4BR2A 3TI0A 3CJ7A 3IFRA 4B3OA 3PY8A 4C23A 4JKHA 1TKTA 4JHDB 4XIUA 4NCBA 1NGAA 4BR7A 4J2EA 3BUZB 1LWFA 3D2FB 3VQDA 1IH7A 4MQ3A 4M45A 2FF6A 4H5NA 1QVGM 4FLXA 3SNNA 4C8KA 4CE9A 4NB4A 5BRDA 3OYKA 5BR9A 3L2RA 5HBMA 3ZYYX 2XRIA 4CERA 3U9DA 2KKZA 3TR8A 1QHTA 3S3MA 4DUYK 3MN7A 2O4IA 4QS8A 1HRHA 2OPPA 1YITN 2EHGA 2RF2A 5AQTA 3VTIA 1XQSC 2XY7A 4FLYA 5CHIA 3AGKA 3CC4N 3LM2A 2PYJA 5DK5A 1W9HA 3HM9A 1KFSA 3WXKA 2IVNA 5M1PA 3DYAA 4JD2A 3PSFA 4FJJA 3LP3A 1YXQA 1IO2A 3R6MA 1N5YA 1X3MA 3OTOK 4K0KK 3S9HA 3THXA 2O8CB 5AQSA 3F73A 4FWLA 4CZJA 3K5MA 3QIOA 4BREA 1KAXA 3O9TA 4DFKA 4FJHA 4H0OA 4K41A 1HMVA 2YHXA 4RW6A 4CJ3A 2VWJA 4DMNA 4CF9A 4FM2A 3NMUA 2Z1HA 1K8KA 3O1BA 4FO0A 3TTFA 4M3WA 2HHVA 2QWLA 4GW6A 3THVA 1NGBA 3D0PA 2Q31A 3AVJA 3N4PA 4BRNA 1JCGA 2HB5A 4CHZA 3TWHA 3QDKA 4B1ZA 3RR7A 2WFBA 2D0OA 2G8UA 1S72N 2RE2A 1LWCA 3L4QA 4LFAK 1B9FA 4LSLA 3CYMA 3C6AA 4LH5A 4CJSA 5C2FA 5JVGL 2CGKA 3L2QA 4DG1A 3CETA 1Y97A 4Y1CA 2IS3A 3B6OA 3NCIA 3TAEA 3UE5A 4JNEA 5BRFA 3EL2A 1SKWA 4N56A 4K8ZA 1QQOA 3HOTA 1VSJA 2O8EB 1M1KO 2YV0X 1SS6A 3ITHA 1KVCA 3MX5A 1LCUA 4AHTA 4IOAL 3T3FA 4FM0A 2Z1JA 3O3HA 3EKSA 4ILJA 3ZETA 4YNQA 1C1CA 4O0IA 2NRWA 3D45A 2Q0UA 4RW9A 2F8TA 1WNSA 4DFPA 4OPAA 2DFEA 4BVPA 4KB0A 3LPUA 2HNDA 1Q9YA 1QS4A 3HO1A 1JLBA 4LF6K 3DRRA 4PKIA 4CD3A 2HVIA 3AVKA 2P9SA 4XH4A 5AQHA 3PIPL 2YHWA 4R79A 1VSMA 3CHWA 2GBZA 4O55A 4CFAA 3L0QA 2E2NA 1K9MO 1OVQA 3NFAA 4DF4A 3WUHA 4OJRA 4YFUA 3VMFB 2E8AA 3HTVA 2PY5A 4H5TA 3LANA 3J80O 4FW1A 4B9TA 2YCHA 4JS4A 1X9SA 3LL3A 3VQ7A 5ADXH 4H03B 2ZQBA 3V81A 3IG1A 3HI0A 1NGIA 4BACA 2NRVA 2HSTA 3W0LA 4WYBA
chains in the Genus database with same CATH topology
4DSJA 4FJLA 3DRPA 1S1VA 1ASUA 2ZE2A 1JL2A 2F96A 3T19A 5J1EA 3CFRA 3ULDA 4BE2A 4DTMA 3QEVA 3TANA 4IG3A 1S1XA 3SV3A 1UA0A 4FJXA 4CGHA 1IKYA 3DOLA 3HYFA 1RTDA 1NK5A 2ITGA 1EXQA 1LWEA 1JXBA 3C6TA 3AO5A 3KK1A 4Z4IA 1BQNA 3HP6A 1RDBA 1SKRA 3K5LA 1MU2A 4BWJA 3C95A 3LDSA 1RDCA 1EX4A 4HHTA 3L3UA 2Z1IA 5J2NA 1TL1A 3SQ2A 3SYZA 3SUNA 3OJSA 4KPYA 1CXQA 1FKOA 3I8DA 2ZD1A 3DM2A 3SI6A 4KKOA 2RN2A 3NDKA 1BIUA 1NK4A 2JGUA 3V6DA 3LZJA 3VQ6A 1D9DA 2QK9A 2B4JA 3DOKA 4AHRA 4HTUA 4DSEA 4OVLA 3RWUA 4EZ9A 3EYZA 1G15A 2IDOA 3WNFA 3KK2A 2X6NA 2OA8A 5J2QA 4ICLA 4DQRA 5HP1A 4FJ9A 3VA3A 2G8KA 2D5RA 1QSSA 3DLGA 4E7KA 4B9VA 1RT6A 1KTQA 1YT3A 1ASVA 1RT3A 3V1OA 5E41A 3RRHA 4Z4EA 3VQCA 3LWLA 3QETA 1RBUA 4BE1A 3L2WA 3OYLA 1WSGA 1NK9A 4DU1A 4Z0UA 2XHBA 1NJZA 1TK8A 1NK6A 4FVMA 3PV8A 1IKWA 4FLWA 3QEXA 3IRXA 4LSNA 2W42A 1IG9A 3OYFA 4C8MA 3OS1A 2OZSA 1YTAA 3ZT3A 4B8CA 4OKEA 1IKXA 3QEPA 4CEAA 1JLGA 4F3OA 1RILA 3OYDA 3PX4A 1F21A 2HNYA 2A1RA 3K5OA 1GOAA 5T7BA 4JRQA 4C8LA 4CJTA 4CFCA 4E0DA 4DU4A 1X9MA 3P83D 3U3GA 3O4QA 4I2QA 1WN7A 1S1WA 3RMDA 2GUIA 1RBTA 4ID5A 2GV9A 5FRMA 3KD1E 3SQ4A 4OPKA 4E7JA 4HVJA 1QTMA 3HSTB 5D3GA 3U3YA 4EZ6A 4FJIA 3OYAA 3NF8A 3OYBA 2KFZA 4CIEA 5HRPA 3V1RA 3KKRA 4FLUA 1JXEA 4N47A 1C6VA 3AVCA 4FCYA 4C8OA 4PWDA 2Y1IA 2D0AA 2LSNA 4KREA 2AJQA 4CJ4A 3M8SA 3CFPA 1T7PA 2E6LA 1DLOA 1FK9A 1I39A 3HVRA 3RMCA 4GMJB 4JLHA 1U47A 3H08A 4EP4A 4DLEA 1S9GA 2YKNA 3NBPA 3O3GA 1UWBA 2G8HA 1TKXA 3CM6A 4RW8A 1RCHA 4NCGA 1RT5A 4O44A 4AHSA 4CK1A 1NKBA 3AO3A 3AO4A 4QCLA 3AVBA 5JS2A 4DSKA 2BANA 3OYJA 1RTIA 2ETJA 1VRUA 3G0ZA 2YNFA 4CFDA 1SUQA 3B6PA 4FLVA 3AA5X 4BE0A 5I42A 3VN5A 1NK0A 3OY9A 3MAQA 2VG5A 2YHAA 3SPZA 4FJ5A 1B92A 2DFFA 1WSFA 3ZCMA 1VRTA 4QOZB 5CY4A 4CGGA 3SUOA 1NKEA 3NGYA 2QXFA 3KLFA 4DTRA 1SL2A 1QSLA 4F3TA 4W5QA 4OGEA 5J2PA 3PX0A 2OZMA 4DSIA 1TAQA 1S9EA 5HRRA 4B9SA 4O0JA 1RBSA 3LP0A 3AVFA 1JLEA 3AVGA 4Z4HA 3V9UA 3ZT2A 1KVBA 4KV8A 4F4KA 1W0HA 3VA0A 3LZIA 3DLBA 4NYNA 3TARA 1I3AA 3MXMA 1XHZA 1KCFA 4CJKA 4KAZA 5KGWA 3TAFA 2XY6A 4O5BA 4CEDA 4N76A 4CF8A 1ZBIA 2DFHA 3K57A 2A1SA 4KHWA 1JKHA 1HYZA 4BWMA 4DTNA 1SV5A 4CEFA 4I7FA 4BDYA 1U49A 4CJWA 2F8TA 1HYSA 4FZYA 1LAVA 3I0SA 5EU7A 3C6UA 1KFDA 4Q5VA 1L3VA 2X78A 4B9UA 3FFIA 4PQUA 3QEWA 1VK0A 1KVAA 4CHNA 3NH2A 3SZ2A 1BCOA 1L3SA 2G8VA 4J2AA 2G8WA 4KHUA 2E6MA 3HT3A 3VQ5A 1T03A 4B8AB 1A5WA 3KJVA 3TABA 4RW4A 4KTQA 3S3NA 4OPJA 4IFVA 3HXMA 4F2RA 4IBNA 4CIFA 2Y1JA 1LV5A 3NE6A 3MXJA 1EP4A 4LH4A 4CJEA 4AHVA 3QEIA 2FBVA 1S5JA 3WNHA 4E1NA 3CM5A 2X6SA 1RT7A 3SCXA 4GVMA 3KLEA 4CJUA 1S1TA 3ZSYA 5CYQA 3L2VA 1CLQA 3ZSVA 4DQSA 4Y1DA 4HCCA 1TKZA 1WSHA 3QERA 4L8RB 4FJGA 2FBXA 4J2BA 4KHSA 2HNZA 1GOCA 4MFBA 1X9WA 3OYHA 4FLTA 4H4MA 4KHYA 3MECA 3ZSXA 4CEOA 5K14A 1LAWA 3KKSA 3QLHA 1A5VA 4DTJA 4HUEA 4CFBA 4OKKA 4W5OA 3V9ZA 4C8NA 3SPYA 1D8YA 3T1AA 3KLIA 3IS9A 4KHQA 3QIPA 1RT1A 1BHLA 4AILC 3KLGA 2HHQA 1UOCA 4PY5A 3L3VA 4FZXC 4ID1A 1SL0A 2HMIA 3V9XA 2BE2A 4IG0A 3OYGA 3TAGA 3KTQA 3PO5A 1ZBUA 4DQQA 1WAJA 3AA4A 4M3XA 3ASMA 4W5RA 3MEDA 4ZHRA 1J53A 3HP9A 3NF7A 4FJ7A 4CHOA 2KTQA 3LAMA 5KRSA 3WNEA 1NK7A 4BDPA 3EY1A 3QESA 1CXUA 1QE1A 1XHXA 3O4NA 4DFJA 1TL3A 1ZBFA 1FKPA 4AHCA 3C94A 5FROA 1CZBA 4HUFA 1REVA 4DFMA 3CFOA 5C25A 1L3TA 2HW3A 3JYTA 3AV9A 3CQ8A 1NJYA 2RKIA 1KRPA 2Q3SA 1QSYA 3ZT0A 3TAPA 3OYCA 1TGOA 3TAQA 3NHGA 4CF1A 4DTXA 4CHYA 1HQEA 3NH1A 3V9SA 4F8RA 1VSHA 1N6QA 2OYQA 4KO0A 1RT2A 4CJFA 4Z4GA 4CGIA 2F8SA 4DS5A 4CF0A 4Z4FA 4CEEA 2YKMA 3KD5E 4PUOA 4G1QA 3V4IA 2WONA 4CEZA 4LY7A 1B9DA 5HRNA 3SUQA 1TAUA 3QINA 3ZSZA 1XI1A 4DWIA 2KZZA 5C24A 3RMAA 1RDDA 4CK3A 1L5UA 3VQ4A 3BDPA 4TSXA 3OJUA 3M8RA 3ZT1A 1XC9A 4KI6A 4CJRA 1HJRA 4NYFA 3S3OA 2KW4A 2DTUA 2VWKA 4E19A 1SKSA 3ZSRA 4ELTA 4H4OA 3QO9A 1RTJA 4K8XA 4CJLA 4FK4A 3TI0A 4M3YA 4B3OA 1JLCA 1GOBA 4M3RA 3PY8A 4WE1A 5KGXA 3M8PA 2R7YA 2X74A 1RT4A 2YNHA 1QQCA 3AVMA 1U48A 1D5AA 4FJMA 4M3TA 1TKTA 4LD0A 4XIUA 4NCBA 2P5OA 4N41A 4J2EA 3VQBA 2HHSA 1LWFA 1J5OA 1BL3A 3AA2A 4O4GA 4E3SA 3VQDA 3HVTA 2YNIA 5J2MA 1IH7A 1BCMA 4MQ3A 1NOYA 4DTSA 4M45A 4FZZA 1NK8A 4J2DA 1BISA 4FLXA 3LWMA 2B5JA 1KSPA 3A2FA 3PO4A 2OPSA 2OPRA 4DTPA 3SNNA 3VQAA 5HLFA 4C8KA 4HCBA 1C1BA 2IGIA 4CE9A 4M3ZA 4ELVA 1DTTA 5JS1A 3OYKA 2QKBA 1WLJA 1EKEA 3L2RA 5HBMA 2JLEA 2XRIA 4OKJA 3OYIA 1TV6A 3I0RA 4CERA 3OS2A 1TK5A 5FDLA 4KB1A 3TR8A 1QHTA 3S3MA 3VQ9A 1JLQA 3LP2A 4ZTJA 3PUFA 5SZTA 1RBRA 4CJ5A 2VG7A 3OS0A 3PX6A 3OVNA 2P5GA 2O4IA 1ITGA 3MEGA 1HRHA 2OPPA 4DU3A 3KK3A 1T8EA 1NKCA 4F2SA 2EHGA 3LAKA 2RF2A 2Z1GA 4CJPA 4B9NA 2XY7A 4FLYA 2PYJA 3HPHA 4KHNA 4E7IA 3IAYA 5DK5A 3VQPA 1JLAA 2NUBA 1W9HA 2P51A 3HM9A 1KFSA 5KRTA 3DYAA 1JLFA 3OYEA 4FJJA 3VQQA 4FYDA 3LP3A 5SWMA 1IO2A 1WSIA 3DRSA 4M42A 1BQMA 1N5YA 3AO2A 4DTUA 3AVHA 1U04A 3NF6A 1UAXA 4JS5A 2FC0A 4FK0A 1LW2A 1VSDA 4R5PA 3HK2A 2B6AA 1RNHA 1D9FA 1NJWA 5I3UA 2OPQA 1XWLA 1NJXA 1R0AA 1HQUA 3ZSQA 2IOCA 1RTHA 3K2PA 3S9HA 4Q0BA 4CHPA 1BIZA 4FW2A 3P5JA 3F73A 4E7HA 5CZ2A 4Z4CA 3K5MA 3DLHA 3QIOA 4CCHA 3MXIA 3KIOA 4CJQA 4M41A 4QAGA 4DFKA 2FBTA 1VSLA 3LP1A 1HMVA 5HRSA 1U45A 4FJHA 3M8QA 4RW6A 2QKKA 1YTUA 3HPOA 4CJ3A 3CG7A 2VWJA 2IAJA 3EZ5A 1T05A 4DMNA 3DI6A 1Q8IA 1JL1A 3VQEA 4CF9A 4BDZA 4FM2A 4FM1A 4NCAA 2Z1HA 1S1UA 3SUPA 4I9LA 1EETA 1HNVA 5C42A 4CHQA 3L8BA 3RMBA 1TKDA 1S6PA 5HROA 2PZSA 4IKFA 4M3WA 4KRFA 4H8KA 3P1GA 4KTWA 3G10A 1SL1A 2HHVA 1C0UA 3NGIA 4GW6A 3K59A 4DF8A 3QNNA 3THVA 4B08A 4DQIA 2HHTA 3D0PA 4EP5A 4UQGA 4OLBA 3AVJA 2XY5A 3NH0A 1VSFA 2EX3A 2HB5A 4CHZA 2I5JA 3TWHA 1WAFA 3QNOA 1HYVA 3AVAA 3TAMA 3OYNA 3SQ1A 2P1JA 3RR7A 2HVHA 1KLMA 4CF2A 1O1WA 4KTZA 4B9MA 4CECA 2WOMA 1K6YA 2G8UA 3NAEA 3AVNA 1LWCA 1VSEA 3KLHA 3RTVA 1B9FA 4CGJA 1TK0A 4LSLA 3CYMA 4AHUA 4I2PA 3DLEA 4LH5A 3AVLA 4CJSA 4DLGA 4E7LA 3LPTA 1UA1A 1KLNA 2XO7A 3RRGA 3L2QA 1LW0A 4DG1A 1C1AA 4DSFA 1ZYQA 1Y97A 1DTQA 3BGRA 3ISNC 1C0TA 4Y1CA 1J9AA 2IS3A 3VQ8A 2FBYA 3B6OA 3K5NA 2KZMA 3NCIA 2YHBA 3TAEA 4B9LA 4OGCA 4W5TA 1SKWA 4N56A 5CZ1A 1S6QA 2BGGA 4CGDA 1CZ9A 4CGFA 4DSLA 4K8ZA 3DLRA 5CYMA 4E1MA 1VSJA 3O3FA 3ZSOA 5KTQA 2YV0X 5FRNA 3ITHA 1KVCA 2D0BA 3ZSWA 4CESA 3L2UA 4AHTA 3T3FA 4FM0A 2G8FA 2Z1JA 4ELUA 4KI4A 3O3HA 4W5NA 1TVRA 2DY4A 1WSEA 3HJFA 4YNQA 1C1CA 1VSIA 4O0IA 1HNIA 5DMRA 4FK2A 3E01A 3D45A 4RW9A 1C0MA 4RW7A 3U6FA 1WNSA 4DFPA 3V9WA 4M3UA 2G8IA 4PA1A 1IKVA 2DFEA 3NGZA 3LPUA 4ZTFA 2HNDA 4KB0A 1Q9YA 1QS4A 3SQ0A 4FJNA 4RG8A 3HO1A 1JLBA 1WSJA 3DRRA 1J54A 2HVIA 4DS4A 2HHUA 3AVKA 2KFNA 2VG6A 1Z26A 2XY8A 3F9KA 4FJ8A 4OLAA 1VSMA 3LALA 1BGXT 1Z25A 3AO1A 5KI6A 3ZT4A 2GBZA 4HUGA 1Q9XA 3RR8A 4I9QA 4O55A 4CFAA 3SV4A 4CIGA 4DTOA 3DLKA 3NF9A 3V1QA 3AA3A 2ATQA 3NFAA 2D0CA 3OYMA 3HPGA 1RBVA 2E4LA 4FJKA 3WNGA 1ASWA 3HL8A 4N5SA 4DF4A 4OJRA 4YFUA 3SJJA 4FLZA 3MEEA 2PY5A 1NOZA 4IDKA 3LANA 4FW1A 1YVUA 4B9TA 1ZBHA 1BI4A 4CJVA 4FXDA 2PYLA 3ALYA 1X1PA 1BI4B 4KFBA 4JS4A 1X9SA 3VQ7A 2YNGA 3JSMA 1RDAA 4JRPA 2IC3A 4IFYA 1FXXA 4CEQA 3K58A 2KQ2A 3V81A 2ZQBA 4AH9A 3IG1A 2RPIA 4DQPA 1ZBLA 3DMJA 4CK2A 4E89A 4BACA 3AVIA 1U4BA 1L3UA 3UIQA 2BDPA 2HHXA 1A5XA 2HHWA 1HPZA 2O4GA 1VSKA 4CEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSJ A;  4FJL A;  3DRP A;  1S1V A;  1ASU A;  2ZE2 A;  1JL2 A;  2F96 A;  3T19 A;  5J1E A;  3CFR A;  3ULD A;  4BE2 A;  4DTM A;  3QEV A;  3TAN A;  4IG3 A;  1S1X A;  3SV3 A;  1UA0 A;  4FJX A;  4CGH A;  1IKY A;  3DOL A;  3HYF A;  1RTD A;  1NK5 A;  2ITG A;  1EXQ A;  1LWE A;  1JXB A;  3C6T A;  3AO5 A;  3KK1 A;  4Z4I A;  1BQN A;  3HP6 A;  1RDB A;  1SKR A;  3K5L A;  1MU2 A;  4BWJ A;  3C95 A;  3LDS A;  1RDC A;  1EX4 A;  4HHT A;  3L3U A;  2Z1I A;  5J2N A;  1TL1 A;  3SQ2 A;  3SYZ A;  3SUN A;  3OJS A;  4KPY A;  1CXQ A;  1FKO A;  3I8D A;  2ZD1 A;  3DM2 A;  3SI6 A;  4KKO A;  2RN2 A;  3NDK A;  1BIU A;  1NK4 A;  2JGU A;  3V6D A;  3LZJ A;  3VQ6 A;  1D9D A;  2QK9 A;  2B4J A;  3DOK A;  4AHR A;  4HTU A;  4DSE A;  4OVL A;  3RWU A;  4EZ9 A;  3EYZ A;  1G15 A;  2IDO A;  3WNF A;  3KK2 A;  2X6N A;  2OA8 A;  5J2Q A;  4ICL A;  4DQR A;  5HP1 A;  4FJ9 A;  3VA3 A;  2G8K A;  2D5R A;  1QSS A;  3DLG A;  4E7K A;  4B9V A;  1RT6 A;  1KTQ A;  1YT3 A;  1ASV A;  1RT3 A;  3V1O A;  5E41 A;  3RRH A;  4Z4E A;  3VQC A;  3LWL A;  3QET A;  1RBU A;  4BE1 A;  3L2W A;  3OYL A;  1WSG A;  1NK9 A;  4DU1 A;  4Z0U A;  2XHB A;  1NJZ A;  1TK8 A;  1NK6 A;  4FVM A;  3PV8 A;  1IKW A;  4FLW A;  3QEX A;  3IRX A;  4LSN A;  2W42 A;  1IG9 A;  3OYF A;  4C8M A;  3OS1 A;  2OZS A;  1YTA A;  3ZT3 A;  4B8C A;  4OKE A;  1IKX A;  3QEP A;  4CEA A;  1JLG A;  4F3O A;  1RIL A;  3OYD A;  3PX4 A;  1F21 A;  2HNY A;  2A1R A;  3K5O A;  1GOA A;  5T7B A;  4JRQ A;  4C8L A;  4CJT A;  4CFC A;  4E0D A;  4DU4 A;  1X9M A;  3P83 D;  3U3G A;  3O4Q A;  4I2Q A;  1WN7 A;  1S1W A;  3RMD A;  2GUI A;  1RBT A;  4ID5 A;  2GV9 A;  5FRM A;  3KD1 E;  3SQ4 A;  4OPK A;  4E7J A;  4HVJ A;  1QTM A;  3HST B;  5D3G A;  3U3Y A;  4EZ6 A;  4FJI A;  3OYA A;  3NF8 A;  3OYB A;  2KFZ A;  4CIE A;  5HRP A;  3V1R A;  3KKR A;  4FLU A;  1JXE A;  4N47 A;  1C6V A;  3AVC A;  4FCY A;  4C8O A;  4PWD A;  2Y1I A;  2D0A A;  2LSN A;  4KRE A;  2AJQ A;  4CJ4 A;  3M8S A;  3CFP A;  1T7P A;  2E6L A;  1DLO A;  1FK9 A;  1I39 A;  3HVR A;  3RMC A;  4GMJ B;  4JLH A;  1U47 A;  3H08 A;  4EP4 A;  4DLE A;  1S9G A;  2YKN A;  3NBP A;  3O3G A;  1UWB A;  2G8H A;  1TKX A;  3CM6 A;  4RW8 A;  1RCH A;  4NCG A;  1RT5 A;  4O44 A;  4AHS A;  4CK1 A;  1NKB A;  3AO3 A;  3AO4 A;  4QCL A;  3AVB A;  5JS2 A;  4DSK A;  2BAN A;  3OYJ A;  1RTI A;  2ETJ A;  1VRU A;  3G0Z A;  2YNF A;  4CFD A;  1SUQ A;  3B6P A;  4FLV A;  3AA5 X;  4BE0 A;  5I42 A;  3VN5 A;  1NK0 A;  3OY9 A;  3MAQ A;  2VG5 A;  2YHA A;  3SPZ A;  4FJ5 A;  1B92 A;  2DFF A;  1WSF A;  3ZCM A;  1VRT A;  4QOZ B;  5CY4 A;  4CGG A;  3SUO A;  1NKE A;  3NGY A;  2QXF A;  3KLF A;  4DTR A;  1SL2 A;  1QSL A;  4F3T A;  4W5Q A;  4OGE A;  5J2P A;  3PX0 A;  2OZM A;  4DSI A;  1TAQ A;  1S9E A;  5HRR A;  4B9S A;  4O0J A;  1RBS A;  3LP0 A;  3AVF A;  1JLE A;  3AVG A;  4Z4H A;  3V9U A;  3ZT2 A;  1KVB A;  4KV8 A;  4F4K A;  1W0H A;  3VA0 A;  3LZI A;  3DLB A;  4NYN A;  3TAR A;  1I3A A;  3MXM A;  1XHZ A;  1KCF A;  4CJK A;  4KAZ A;  5KGW A;  3TAF A;  2XY6 A;  4O5B A;  4CED A;  4N76 A;  4CF8 A;  1ZBI A;  2DFH A;  3K57 A;  2A1S A;  4KHW A;  1JKH A;  1HYZ A;  4BWM A;  4DTN A;  1SV5 A;  4CEF A;  4I7F A;  4BDY A;  1U49 A;  4CJW A;  2F8T A;  1HYS A;  4FZY A;  1LAV A;  3I0S A;  5EU7 A;  3C6U A;  1KFD A;  4Q5V A;  1L3V A;  2X78 A;  4B9U A;  3FFI A;  4PQU A;  3QEW A;  1VK0 A;  1KVA A;  4CHN A;  3NH2 A;  3SZ2 A;  1BCO A;  1L3S A;  2G8V A;  4J2A A;  2G8W A;  4KHU A;  2E6M A;  3HT3 A;  3VQ5 A;  1T03 A;  4B8A B;  1A5W A;  3KJV A;  3TAB A;  4RW4 A;  4KTQ A;  3S3N A;  4OPJ A;  4IFV A;  3HXM A;  4F2R A;  4IBN A;  4CIF A;  2Y1J A;  1LV5 A;  3NE6 A;  3MXJ A;  1EP4 A;  4LH4 A;  4CJE A;  4AHV A;  3QEI A;  2FBV A;  1S5J A;  3WNH A;  4E1N A;  3CM5 A;  2X6S A;  1RT7 A;  3SCX A;  4GVM A;  3KLE A;  4CJU A;  1S1T A;  3ZSY A;  5CYQ A;  3L2V A;  1CLQ A;  3ZSV A;  4DQS A;  4Y1D A;  4HCC A;  1TKZ A;  1WSH A;  3QER A;  4L8R B;  4FJG A;  2FBX A;  4J2B A;  4KHS A;  2HNZ A;  1GOC A;  4MFB A;  1X9W A;  3OYH A;  4FLT A;  4H4M A;  4KHY A;  3MEC A;  3ZSX A;  4CEO A;  5K14 A;  1LAW A;  3KKS A;  3QLH A;  1A5V A;  4DTJ A;  4HUE A;  4CFB A;  4OKK A;  4W5O A;  3V9Z A;  4C8N A;  3SPY A;  1D8Y A;  3T1A A;  3KLI A;  3IS9 A;  4KHQ A;  3QIP A;  1RT1 A;  1BHL A;  4AIL C;  3KLG A;  2HHQ A;  1UOC A;  4PY5 A;  3L3V A;  4FZX C;  4ID1 A;  1SL0 A;  2HMI A;  3V9X A;  2BE2 A;  4IG0 A;  3OYG A;  3TAG A;  3KTQ A;  3PO5 A;  1ZBU A;  4DQQ A;  1WAJ A;  3AA4 A;  4M3X A;  3ASM A;  4W5R A;  3MED A;  4ZHR A;  1J53 A;  3HP9 A;  3NF7 A;  4FJ7 A;  4CHO A;  2KTQ A;  3LAM A;  5KRS A;  3WNE A;  1NK7 A;  4BDP A;  3EY1 A;  3QES A;  1CXU A;  1QE1 A;  1XHX A;  3O4N A;  4DFJ A;  1TL3 A;  1ZBF A;  1FKP A;  4AHC A;  3C94 A;  5FRO A;  1CZB A;  4HUF A;  1REV A;  4DFM A;  3CFO A;  5C25 A;  1L3T A;  2HW3 A;  3JYT A;  3AV9 A;  3CQ8 A;  1NJY A;  2RKI A;  1KRP A;  2Q3S A;  1QSY A;  3ZT0 A;  3TAP A;  3OYC A;  1TGO A;  3TAQ A;  3NHG A;  4CF1 A;  4DTX A;  4CHY A;  1HQE A;  3NH1 A;  3V9S A;  4F8R A;  1VSH A;  1N6Q A;  2OYQ A;  4KO0 A;  1RT2 A;  4CJF A;  4Z4G A;  4CGI A;  2F8S A;  4DS5 A;  4CF0 A;  4Z4F A;  4CEE A;  2YKM A;  3KD5 E;  4PUO A;  4G1Q A;  3V4I A;  2WON A;  4CEZ A;  4LY7 A;  1B9D A;  5HRN A;  3SUQ A;  1TAU A;  3QIN A;  3ZSZ A;  1XI1 A;  4DWI A;  2KZZ A;  5C24 A;  3RMA A;  1RDD A;  4CK3 A;  1L5U A;  3VQ4 A;  3BDP A;  4TSX A;  3OJU A;  3M8R A;  3ZT1 A;  1XC9 A;  4KI6 A;  4CJR A;  1HJR A;  4NYF A;  3S3O A;  2KW4 A;  2DTU A;  2VWK A;  4E19 A;  1SKS A;  3ZSR A;  4ELT A;  4H4O A;  3QO9 A;  1RTJ A;  4K8X A;  4CJL A;  4FK4 A;  3TI0 A;  4M3Y A;  4B3O A;  1JLC A;  1GOB A;  4M3R A;  3PY8 A;  4WE1 A;  5KGX A;  3M8P A;  2R7Y A;  2X74 A;  1RT4 A;  2YNH A;  1QQC A;  3AVM A;  1U48 A;  1D5A A;  4FJM A;  4M3T A;  1TKT A;  4LD0 A;  4XIU A;  4NCB A;  2P5O A;  4N41 A;  4J2E A;  3VQB A;  2HHS A;  1LWF A;  1J5O A;  1BL3 A;  3AA2 A;  4O4G A;  4E3S A;  3VQD A;  3HVT A;  2YNI A;  5J2M A;  1IH7 A;  1BCM A;  4MQ3 A;  1NOY A;  4DTS A;  4M45 A;  4FZZ A;  1NK8 A;  4J2D A;  1BIS A;  4FLX A;  3LWM A;  2B5J A;  1KSP A;  3A2F A;  3PO4 A;  2OPS A;  2OPR A;  4DTP A;  3SNN A;  3VQA A;  5HLF A;  4C8K A;  4HCB A;  1C1B A;  2IGI A;  4CE9 A;  4M3Z A;  4ELV A;  1DTT A;  5JS1 A;  3OYK A;  2QKB A;  1WLJ A;  1EKE A;  3L2R A;  5HBM A;  2JLE A;  2XRI A;  4OKJ A;  3OYI A;  1TV6 A;  3I0R A;  4CER A;  3OS2 A;  1TK5 A;  5FDL A;  4KB1 A;  3TR8 A;  1QHT A;  3S3M A;  3VQ9 A;  1JLQ A;  3LP2 A;  4ZTJ A;  3PUF A;  5SZT A;  1RBR A;  4CJ5 A;  2VG7 A;  3OS0 A;  3PX6 A;  3OVN A;  2P5G A;  2O4I A;  1ITG A;  3MEG A;  1HRH A;  2OPP A;  4DU3 A;  3KK3 A;  1T8E A;  1NKC A;  4F2S A;  2EHG A;  3LAK A;  2RF2 A;  2Z1G A;  4CJP A;  4B9N A;  2XY7 A;  4FLY A;  2PYJ A;  3HPH A;  4KHN A;  4E7I A;  3IAY A;  5DK5 A;  3VQP A;  1JLA A;  2NUB A;  1W9H A;  2P51 A;  3HM9 A;  1KFS A;  5KRT A;  3DYA A;  1JLF A;  3OYE A;  4FJJ A;  3VQQ A;  4FYD A;  3LP3 A;  5SWM A;  1IO2 A;  1WSI A;  3DRS A;  4M42 A;  1BQM A;  1N5Y A;  3AO2 A;  4DTU A;  3AVH A;  1U04 A;  3NF6 A;  1UAX A;  4JS5 A;  2FC0 A;  4FK0 A;  1LW2 A;  1VSD A;  4R5P A;  3HK2 A;  2B6A A;  1RNH A;  1D9F A;  1NJW A;  5I3U A;  2OPQ A;  1XWL A;  1NJX A;  1R0A A;  1HQU A;  3ZSQ A;  2IOC A;  1RTH A;  3K2P A;  3S9H A;  4Q0B A;  4CHP A;  1BIZ A;  4FW2 A;  3P5J A;  3F73 A;  4E7H A;  5CZ2 A;  4Z4C A;  3K5M A;  3DLH A;  3QIO A;  4CCH A;  3MXI A;  3KIO A;  4CJQ A;  4M41 A;  4QAG A;  4DFK A;  2FBT A;  1VSL A;  3LP1 A;  1HMV A;  5HRS A;  1U45 A;  4FJH A;  3M8Q A;  4RW6 A;  2QKK A;  1YTU A;  3HPO A;  4CJ3 A;  3CG7 A;  2VWJ A;  2IAJ A;  3EZ5 A;  1T05 A;  4DMN A;  3DI6 A;  1Q8I A;  1JL1 A;  3VQE A;  4CF9 A;  4BDZ A;  4FM2 A;  4FM1 A;  4NCA A;  2Z1H A;  1S1U A;  3SUP A;  4I9L A;  1EET A;  1HNV A;  5C42 A;  4CHQ A;  3L8B A;  3RMB A;  1TKD A;  1S6P A;  5HRO A;  2PZS A;  4IKF A;  4M3W A;  4KRF A;  4H8K A;  3P1G A;  4KTW A;  3G10 A;  1SL1 A;  2HHV A;  1C0U A;  3NGI A;  4GW6 A;  3K59 A;  4DF8 A;  3QNN A;  3THV A;  4B08 A;  4DQI A;  2HHT A;  3D0P A;  4EP5 A;  4UQG A;  4OLB A;  3AVJ A;  2XY5 A;  3NH0 A;  1VSF A;  2EX3 A;  2HB5 A;  4CHZ A;  2I5J A;  3TWH A;  1WAF A;  3QNO A;  1HYV A;  3AVA A;  3TAM A;  3OYN A;  3SQ1 A;  2P1J A;  3RR7 A;  2HVH A;  1KLM A;  4CF2 A;  1O1W A;  4KTZ A;  4B9M A;  4CEC A;  2WOM A;  1K6Y A;  2G8U A;  3NAE A;  3AVN A;  1LWC A;  1VSE A;  3KLH A;  3RTV A;  1B9F A;  4CGJ A;  1TK0 A;  4LSL A;  3CYM A;  4AHU A;  4I2P A;  3DLE A;  4LH5 A;  3AVL A;  4CJS A;  4DLG A;  4E7L A;  3LPT A;  1UA1 A;  1KLN A;  2XO7 A;  3RRG A;  3L2Q A;  1LW0 A;  4DG1 A;  1C1A A;  4DSF A;  1ZYQ A;  1Y97 A;  1DTQ A;  3BGR A;  3ISN C;  1C0T A;  4Y1C A;  1J9A A;  2IS3 A;  3VQ8 A;  2FBY A;  3B6O A;  3K5N A;  2KZM A;  3NCI A;  2YHB A;  3TAE A;  4B9L A;  4OGC A;  4W5T A;  1SKW A;  4N56 A;  5CZ1 A;  1S6Q A;  2BGG A;  4CGD A;  1CZ9 A;  4CGF A;  4DSL A;  4K8Z A;  3DLR A;  5CYM A;  4E1M A;  1VSJ A;  3O3F A;  3ZSO A;  5KTQ A;  2YV0 X;  5FRN A;  3ITH A;  1KVC A;  2D0B A;  3ZSW A;  4CES A;  3L2U A;  4AHT A;  3T3F A;  4FM0 A;  2G8F A;  2Z1J A;  4ELU A;  4KI4 A;  3O3H A;  4W5N A;  1TVR A;  2DY4 A;  1WSE A;  3HJF A;  4YNQ A;  1C1C A;  1VSI A;  4O0I A;  1HNI A;  5DMR A;  4FK2 A;  3E01 A;  3D45 A;  4RW9 A;  1C0M A;  4RW7 A;  3U6F A;  1WNS A;  4DFP A;  3V9W A;  4M3U A;  2G8I A;  4PA1 A;  1IKV A;  2DFE A;  3NGZ A;  3LPU A;  4ZTF A;  2HND A;  4KB0 A;  1Q9Y A;  1QS4 A;  3SQ0 A;  4FJN A;  4RG8 A;  3HO1 A;  1JLB A;  1WSJ A;  3DRR A;  1J54 A;  2HVI A;  4DS4 A;  2HHU A;  3AVK A;  2KFN A;  2VG6 A;  1Z26 A;  2XY8 A;  3F9K A;  4FJ8 A;  4OLA A;  1VSM A;  3LAL A;  1BGX T;  1Z25 A;  3AO1 A;  5KI6 A;  3ZT4 A;  2GBZ A;  4HUG A;  1Q9X A;  3RR8 A;  4I9Q A;  4O55 A;  4CFA A;  3SV4 A;  4CIG A;  4DTO A;  3DLK A;  3NF9 A;  3V1Q A;  3AA3 A;  2ATQ A;  3NFA A;  2D0C A;  3OYM A;  3HPG A;  1RBV A;  2E4L A;  4FJK A;  3WNG A;  1ASW A;  3HL8 A;  4N5S A;  4DF4 A;  4OJR A;  4YFU A;  3SJJ A;  4FLZ A;  3MEE A;  2PY5 A;  1NOZ A;  4IDK A;  3LAN A;  4FW1 A;  1YVU A;  4B9T A;  1ZBH A;  1BI4 A;  4CJV A;  4FXD A;  2PYL A;  3ALY A;  1X1P A;  1BI4 B;  4KFB A;  4JS4 A;  1X9S A;  3VQ7 A;  2YNG A;  3JSM A;  1RDA A;  4JRP A;  2IC3 A;  4IFY A;  1FXX A;  4CEQ A;  3K58 A;  2KQ2 A;  3V81 A;  2ZQB A;  4AH9 A;  3IG1 A;  2RPI A;  4DQP A;  1ZBL A;  3DMJ A;  4CK2 A;  4E89 A;  4BAC A;  3AVI A;  1U4B A;  1L3U A;  3UIQ A;  2BDP A;  2HHX A;  1A5X A;  2HHW A;  1HPZ A;  2O4G A;  1VSK A;  4CEB A; 
#chains in the Genus database with same CATH topology
 1ASU A;  4JI6 K;  3QEV A;  1NK5 A;  2ITG A;  5EVZ A;  1JXB A;  3AO5 A;  4Z4I A;  3HP6 A;  1RDB A;  5J2N A;  1RDC A;  2PAV A;  2Z1I A;  2QTD A;  1TL1 A;  3SUN A;  1HR0 K;  4KPY A;  3GL1 A;  3DM2 A;  4KKO A;  1EWR A;  2RN2 A;  3NDK A;  1BIU A;  3PIO L;  1JCF A;  3SK3 A;  3V6D A;  4KBO A;  4AHR A;  4H0Y B;  4A2A A;  2X6N A;  5J2Q A;  4ICL A;  4DQR A;  4FJ9 A;  2G8K A;  1QSS A;  3QBX A;  4B9V A;  1RT6 A;  1YT3 A;  3ULE A;  1ASV A;  1RT3 A;  3V1O A;  4BE1 A;  2HF4 A;  4DV2 K;  1WBD A;  3O4W A;  1TK8 A;  4FVM A;  4QS9 A;  3PV8 A;  4K25 A;  4LSN A;  3OYF A;  4DB3 A;  4FWM A;  1DGK N;  3QEP A;  2ZWH A;  3OYD A;  3ENO A;  1VQ8 N;  5T7B A;  4E0D A;  5CR4 A;  3P83 D;  2GUI A;  1RBT A;  3KD1 E;  3SQ4 A;  4OPK A;  4E7J A;  4IEE A;  1HLU A;  4HVJ A;  5LJV A;  3CC7 N;  4AQY K;  3U3Y A;  2F7T A;  3OYA A;  3NF8 A;  4CIE A;  5HRP A;  3MCP A;  5JLH A;  4N47 A;  1C6V A;  4B1Y B;  2Y1I A;  2FXU A;  1BWF O;  2LSN A;  1XMQ K;  2AJQ A;  5AQG A;  4GMJ B;  1U47 A;  1TYQ B;  4JI0 K;  1N34 K;  3O3G A;  1UWB A;  3ATU A;  2UUB K;  4NO7 A;  3WQU A;  4CFD A;  3AA5 X;  1ATN A;  3OY9 A;  4NXM K;  3SPZ A;  3OBW A;  1VRT A;  3ZCM A;  4CGG A;  1J5E K;  1QSL A;  4W5Q A;  2OZM A;  2O8F B;  1RBS A;  3O9S A;  1HKG A;  3AVF A;  5IWA K;  4JKE A;  3ZT2 A;  1KVB A;  4NXN K;  3LM9 A;  3THY B;  4ILH A;  2XY6 A;  3GG4 A;  3CCM N;  3BF1 A;  2DFH A;  4BGB A;  4BC3 A;  3P4I A;  5E84 A;  2E1Z A;  4CEF A;  4XEI A;  4FZY A;  3O08 A;  4JI8 K;  3C6U A;  4U7B A;  5AQL A;  4JKD A;  3WXL A;  5F0X A;  3VES A;  4J2A A;  1KVA A;  1L3S A;  2QWP A;  1BCO A;  3THW B;  2G8W A;  1RFQ A;  3VEW A;  2E6M A;  1T03 A;  1A5W A;  4F9O A;  3K9J A;  4XH1 A;  1DEJ A;  2O8D B;  4F2R A;  4FWO A;  4LH4 A;  4CJE A;  3QEI A;  2P9U A;  2FBV A;  3E66 A;  1P90 A;  4CJU A;  3L2V A;  2HBL A;  1QHA A;  3ZSV A;  4DQS A;  3SAH A;  1TKZ A;  3QER A;  5FPE A;  4FJG A;  4KHS A;  4J2B A;  1GOC A;  4MFB A;  4FLT A;  4KHY A;  4H4M A;  1OKJ A;  2NZT A;  3ZSX A;  1A5V A;  4CFB A;  1ZBS A;  3V9Z A;  3D7E O;  3ZEU A;  3KLI A;  4KHQ A;  3MN5 A;  1V4S A;  4OO1 J;  3KLG A;  5BPN A;  1SL0 A;  2BE2 A;  4IG0 A;  3TAG A;  5B8H A;  1WAJ A;  4YOX A;  1Y64 A;  1OH7 A;  4FWQ A;  4BVO A;  4ZHR A;  1J53 A;  4C1N K;  4FJ7 A;  4CHO A;  4YOW A;  1ESV A;  2IVP A;  3WNE A;  4BDP A;  4XH5 A;  4WQ5 A;  3DXK A;  4DFJ A;  4ILG B;  1ZBF A;  1NBW A;  5AR0 A;  4JAX A;  3CFO A;  2WTU A;  3JYT A;  1NJY A;  1QSY A;  3TAP A;  4CBU A;  1SQK A;  4LF4 K;  3NHG A;  2V7Y A;  4WQ5 C;  4CF1 A;  3VEX A;  3ENH A;  4AM6 A;  3W3D A;  1RT2 A;  3MMV A;  4A2B A;  2WUS A;  1BA1 A;  4CEE A;  2IIR A;  2YKM A;  3KD5 E;  4G1Q A;  3J7Z O;  3MWP A;  2Q2R A;  4IZ9 A;  3VGK A;  4IJN A;  2NLX A;  1L5U A;  4WFN L;  1U2V A;  2P9K A;  2EWS A;  3P38 A;  4H4O A;  1KQS M;  5BR8 K;  4K8X A;  2NRR A;  1GOB A;  4M3R A;  5EX5 A;  4WFB L;  3DXM A;  4BRD A;  3M8P A;  1ZC6 A;  3AVM A;  4M3T A;  3IKM A;  4N41 A;  3VQB A;  2HHS A;  1J5O A;  4O4G A;  1NOY A;  2YNI A;  4FOE A;  1BIS A;  3LWM A;  3VPZ A;  1Q7Y O;  5HLF A;  4DTP A;  4MDA A;  3VQA A;  4M3Z A;  3F5T A;  3WEE A;  5MLC Q;  1DTT A;  1XMO K;  3H6E A;  3HOS A;  4M7X A;  3K0S A;  3OYI A;  1YJ9 N;  2YX6 A;  4CW7 B;  4KB1 A;  5FDL A;  4BQZ A;  3VQ9 A;  1JLQ A;  3SMS A;  3PUF A;  1RBR A;  2VG7 A;  4YOT A;  1C0G A;  2OTL N;  3VF6 A;  3E1Y A;  1ITG A;  1T8E A;  1NKC A;  2Z1G A;  4B9N A;  2BH1 A;  3SAG A;  3A5N C;  3HPH A;  4KHN A;  4E7I A;  3A5O C;  3VQP A;  1JLA A;  3CJA A;  1IBK K;  5KRT A;  4A61 A;  3IDH A;  4PL8 A;  1JLF A;  3OYE A;  4JD2 B;  5E26 A;  1WSI A;  3DRS A;  1BQM A;  4DTU A;  1UAX A;  5AQF A;  1VSD A;  1RNH A;  2P9I A;  1VQ9 N;  5I3U A;  1WOQ A;  4BRI A;  2OPQ A;  1XWL A;  3SBT A;  1VQ6 N;  4A57 A;  3ZSQ A;  4JYA K;  3THX B;  1BIZ A;  4A59 A;  5M1N A;  2QM1 A;  3DLH A;  3MXI A;  3G4S N;  2AA4 A;  4CZG A;  4QAG A;  2I7N A;  1U45 A;  1KAZ A;  2UUC K;  3C65 A;  2FSJ A;  3J7A P;  3M8Q A;  1YTU A;  4CBW A;  4H0V B;  3VEZ A;  3VEV A;  3EZ5 A;  1Q86 O;  3DI6 A;  1Q8I A;  3VQE A;  1QZ6 A;  4NCA A;  2ASP A;  4CZF A;  1S1U A;  1EET A;  1K8K B;  5C42 A;  1TKD A;  3RMB A;  2PZS A;  5HRO A;  1MDU B;  3P1G A;  4FVU A;  1QZ5 A;  3G10 A;  4W5N A;  3QNN A;  3O6W A;  4DQI A;  2CGL A;  5AQP A;  3CXC M;  1WAF A;  1HYV A;  3AVA A;  3TAM A;  4V19 S;  4CF2 A;  5BN8 A;  5LJW A;  3LDL A;  2WOM A;  4CEC A;  1K6Y A;  1VSE A;  4BRH A;  3DLE A;  3AVL A;  4GV9 A;  3LPT A;  1KLN A;  4DSF A;  1LW0 A;  1C1A A;  1HX1 A;  2KZM A;  1E4G T;  1J9A A;  4JKG A;  4H5R A;  4W5T A;  3C7N A;  5BRE A;  5CZ1 A;  3MK6 A;  1S6Q A;  1VHX A;  4CGD A;  3DLR A;  3ZSW A;  3GDQ A;  4YY3 K;  2FLO A;  4CBX A;  4LF9 K;  1WSE A;  2ZF5 O;  2E5L K;  1S22 A;  3TSP A;  3ZET B;  3C6H A;  3E01 A;  1C0M A;  3U6F A;  2VGM A;  3V9W A;  4PA1 A;  1J54 A;  3F2K A;  3VF4 A;  3A0I X;  1JCE A;  2ZGZ A;  3M5R A;  2JWK A;  1Z26 A;  3F9K A;  2P9S B;  4OLA A;  3AO1 A;  4I9Q A;  4BR4 A;  1FJG K;  4DTO A;  3DLK A;  4X64 K;  3CCV N;  2D0C A;  3HL8 A;  4N5S A;  4FWP A;  2YI1 A;  1HNX K;  4MO5 A;  2ASM A;  3U4L A;  2PYL A;  1K8A O;  2IC3 A;  3K58 A;  4JKA A;  2D1K A;  2QI2 A;  1ZBL A;  1XUP O;  3AVI A;  1U4B A;  3UIQ A;  2F9W A;  2BDP A;  3A8Y A;  4FSV A;  3OVN A;  1HPZ A;  3RMA A;  4CEB A;  4DSJ A;  4BC5 A;  4FJL A;  4JV5 K;  1S1V A;  3FFK B;  3UKU A;  2ZE2 A;  1NGF A;  2F96 A;  1IV0 A;  5J1E A;  4DTM A;  1S1X A;  4CGH A;  1MWM A;  1T6C A;  3WXI A;  1RTD A;  5AQZ A;  2UYT A;  3KVG A;  1VQP N;  2YJE A;  3C95 A;  4WQ4 A;  3VOV A;  1EX4 A;  3I8D A;  1KXP A;  1NK4 A;  2JGU A;  3VQ6 A;  1D9D A;  1NGC A;  2E1Y A;  4HTU A;  4OVL A;  2V51 B;  1G15 A;  4FPA A;  3KK2 A;  1VQ7 N;  2QWO A;  1HUX A;  4WQ4 C;  4YOU A;  2GEL A;  3WXJ A;  3RRH A;  3CD6 N;  3ULE B;  5ADX A;  3QET A;  1RBU A;  2Q0R A;  4Z0U A;  1NJZ A;  3QEX A;  3UB5 A;  1N36 K;  1IG9 A;  2KHO A;  1YTA A;  2HF3 A;  4B8C A;  1NGG A;  3H3O B;  1NWK A;  4F3O A;  1F21 A;  2A1R A;  1GOA A;  2HBK A;  4DU4 A;  1X9M A;  4JI2 K;  4I2Q A;  1ATS A;  1S1W A;  1WN7 A;  4IOX A;  3AAR A;  3EKU A;  5FRM A;  4CVN E;  3HST B;  3V1R A;  4BRL A;  1JXE A;  1EO1 A;  3AVC A;  4PWD A;  3H3N O;  4IO8 A;  4KRE A;  1E4F T;  2ASO A;  3CFP A;  1I39 A;  1HJO A;  3RMC A;  4JLH A;  5KPZ A;  4DLE A;  1S9G A;  2UXB K;  2YKN A;  2G8H A;  5JMV A;  3CM6 A;  4CK1 A;  1NKB A;  4QCL A;  4DSK A;  5JS2 A;  3D2E A;  3G0Z A;  4PKG A;  5AZJ A;  2YNF A;  5I42 A;  1SUQ A;  4BE0 A;  4IDH A;  1J6Z A;  2YHA A;  4QOZ B;  3J8A A;  2DFF A;  5CY4 A;  5C15 A;  2P9N A;  2Q1N A;  2QXF A;  3AGR A;  3QIC A;  2QXL A;  4E1J A;  1SL2 A;  1NNE A;  1S9E A;  5HRR A;  4O0J A;  3LP0 A;  3VEY A;  3CJ9 A;  3AVG A;  4Z4H A;  3V9U A;  1W97 L;  4HWI A;  3VA0 A;  3LZI A;  4NYN A;  1NJI O;  4KAZ A;  5KGW A;  2ZGY A;  3IMX A;  5AQR A;  3ENB A;  1XNR K;  4M63 C;  1JKH A;  1HYZ A;  4BWM A;  5AQI A;  4EAH D;  4BQL A;  4DTN A;  1M90 O;  5LY3 A;  1LAV A;  1R59 O;  3HM8 A;  4B9U A;  3FFI A;  3BZK A;  4O5F A;  3QEW A;  4PQU A;  3FZK A;  1VK0 A;  4CHN A;  3WXM B;  5TKY A;  3HT3 A;  3VQ5 A;  3G71 N;  3CCE N;  4KTQ A;  3S3N A;  5GIO A;  4IFV A;  4J8F A;  1OVY A;  4BRP A;  3O9R A;  4AHV A;  3CI5 A;  3QFU A;  2P9U B;  1YUW A;  4E1N A;  3CM5 A;  2X6S A;  1RT7 A;  1YF5 L;  3SCX A;  4GVM A;  4HCC A;  2HNZ A;  3EE8 A;  1X9W A;  4DR6 K;  1LAW A;  4OKK A;  4DR2 K;  4BY9 C;  1D8Y A;  5JLF A;  3T1A A;  3ZEU B;  1O13 A;  1VQK N;  1BHL A;  3SMP A;  3L3V A;  4ID1 A;  2HBJ A;  3CER A;  4PL7 A;  3PO5 A;  3KTQ A;  1ZBU A;  5A2Q O;  2P9P A;  2UUA K;  3MED A;  3O9Q A;  2KTQ A;  5KRS A;  1NK7 A;  3EY1 A;  3QES A;  4BRK A;  1XHX A;  3O4N A;  3DXK B;  1TL3 A;  5JVH L;  4CZL A;  3TTC A;  4YOR A;  1REV A;  4DFM A;  1L3T A;  2UXC K;  3UKR A;  2Q3S A;  3BZC A;  4EHT A;  3VET A;  3FLC O;  3TAQ A;  1K73 O;  2QA4 N;  2OAN A;  4DTX A;  4M7Y A;  2E2P A;  3TTD A;  3KHY A;  4Z4G A;  3P39 A;  2F8S A;  4Z4F A;  3JXU A;  2WON A;  4LY7 A;  4X62 K;  2FSK A;  3QIN A;  3ZSZ A;  1QVF M;  5KQ8 A;  1OH6 A;  4CK3 A;  3VQ4 A;  3BDP A;  3OJU A;  1NGH A;  1XC9 A;  1U2V B;  1V4T A;  2P9K B;  4CJR A;  2DTU A;  1MWK A;  5LL6 Z;  3O5B A;  1H1V A;  4CJL A;  2Q97 A;  4DR3 K;  2GWK A;  2GTD A;  4X66 K;  3I55 N;  3OBY A;  1KD1 O;  4WE1 A;  2WC9 A;  3DXM B;  2YNH A;  1U48 A;  2FF3 B;  4LD0 A;  1IBL K;  2P5O A;  3BF3 A;  2W41 A;  3LDN A;  1BL3 A;  3AA2 A;  4DR1 K;  2OA8 A;  3ZLJ A;  3K9K A;  1LOT B;  4EHU A;  5J2M A;  2OPS A;  4RTF D;  1C1B A;  2YJF A;  1DT9 A;  4ELV A;  3WEE B;  5JS1 A;  1WLJ A;  1EKE A;  1ZXO A;  3F9M A;  4BR5 A;  2JLE A;  3OS2 A;  4DHY A;  4GVE A;  5AQX A;  3LP2 A;  4ZTJ A;  3OS0 A;  3G25 A;  3MEG A;  3MN6 A;  3I8B A;  4F2S A;  1T44 A;  4CJP A;  1C0F A;  1YJN N;  2NUB A;  2W6K A;  3HZ6 A;  4FYD A;  3VQQ A;  4GNI A;  5H1S Q;  1W7A A;  3AO2 A;  3NF6 A;  3O1W A;  2FC0 A;  2A42 A;  4FK0 A;  4R5P A;  2FSN A;  2P9I B;  1NJX A;  4JK8 A;  1HQU A;  5TKW A;  4JI7 K;  1D4X A;  3K2P A;  4Q0B A;  4CHP A;  3GBT A;  3P5J A;  1QQN A;  5CZ2 A;  4CD1 A;  4CCH A;  3KIO A;  3FE1 A;  4CJQ A;  4M41 A;  4B1U B;  2FBT A;  3LP1 A;  5HRS A;  5FPN A;  3RSE A;  2QKK A;  3HPO A;  2VQF K;  2CH5 A;  1HNZ K;  3CG7 A;  2IAJ A;  1T05 A;  4BDZ A;  4FM1 A;  4I9L A;  1Q81 O;  1HNV A;  3U8X A;  4IKF A;  4KRF A;  1S6P A;  3KWG A;  3MN9 A;  1YHQ N;  4DV3 K;  4KTW A;  5BRH A;  1C0U A;  3NGI A;  4B3S K;  4DF8 A;  3B8A X;  4A5A A;  4UQG A;  3RVC A;  2XY5 A;  3NH0 A;  2EX3 A;  3E9L A;  3QNO A;  2QWR A;  3SQ1 A;  2P1J A;  2HVH A;  1KLM A;  1O1W A;  3T69 A;  2NRX A;  3AVN A;  4CGJ A;  1TK0 A;  2PBD A;  3I56 N;  4AHU A;  4I2P A;  4E7L A;  3QML A;  1FW6 A;  1UA1 A;  4O8U A;  1ZYQ A;  3M6G A;  1DTQ A;  3BGR A;  3ISN C;  3H45 C;  1X3N A;  3K5N A;  4IOC L;  2FBY A;  2YHB A;  3G6E N;  4JKG B;  4IWV A;  1Q18 A;  3SLC A;  3TSU A;  3C7N B;  3QB0 A;  3TPQ A;  5C2D A;  4DSL A;  4LF8 K;  2BGG A;  4E1M A;  3ZSO A;  5KTQ A;  5EOY A;  1RDU A;  5FRN A;  4CES A;  3VER A;  4OX9 K;  5AJ3 K;  4ELU A;  3H1V X;  1TVR A;  5LMU K;  2ZJQ L;  2DY4 A;  3HJF A;  4NLB A;  4FK2 A;  1HNI A;  5DMR A;  4RW7 A;  2G8I A;  3KWI A;  1IKV A;  3NGZ A;  3SQ0 A;  4RG8 A;  3VGM A;  5FLX O;  4DS4 A;  2HHU A;  4BRA A;  2KFN A;  4AM7 A;  2XY8 A;  1BO5 O;  4FJ8 A;  3LAL A;  1BGX T;  3ZT4 A;  1Q9X A;  2HHT A;  3SV4 A;  4NLC A;  3V1Q A;  2ATQ A;  4DV1 K;  1VQM N;  4FJK A;  2E4L A;  1ASW A;  4MDB A;  1GLL O;  1YAG A;  4FLZ A;  2P9L A;  3O80 A;  4IDK A;  3CMA N;  1BI4 A;  4GY2 B;  4MO4 A;  3DLL L;  1X1P A;  1Z05 A;  3L4I A;  3I33 A;  4KFB A;  3JSM A;  4JRP A;  1FXX A;  2KQ2 A;  3CJB A;  4AH9 A;  4LFC K;  4DQP A;  3DMJ A;  4CK2 A;  2E2O A;  4E89 A;  2HHX A;  5LMN K;  4DV0 K;  2HHW A;  1NLV A;  3I0S A;  2HHH K;  3ZX0 A;  4ISF A;  3DRP A;  4CJ7 A;  3T19 A;  3CFR A;  3TAN A;  3UKU B;  1WUA A;  4IG3 A;  3SV3 A;  2GUP A;  1IKY A;  3HYF A;  2H3G X;  4MLH A;  1EXQ A;  3C6T A;  3KK1 A;  1SKR A;  4H0X B;  3K5L A;  1NMD A;  3DAW A;  4BWJ A;  4HHT A;  3SYZ A;  3OJS A;  1CXQ A;  1FKO A;  3SI6 A;  4BGA A;  1SZ2 A;  3KZB A;  3NVM A;  4WF9 L;  2QK9 A;  2B4J A;  3DOK A;  4DSE A;  2IDO A;  4IO9 L;  4CZI A;  5HP1 A;  5I9E B;  3DLG A;  2KLA A;  4E7K A;  5E41 A;  3LWL A;  4DKW A;  3OYL A;  5DM6 L;  4DU1 A;  1NK6 A;  1YVN A;  1EWQ A;  4FLW A;  3IRX A;  4C8M A;  3OS1 A;  2OZS A;  3ZT3 A;  4CZH A;  1U6Z A;  4OKE A;  1JLG A;  3T1H K;  1RIL A;  4YDU A;  4EIA A;  3K5O A;  4CJT A;  4CFC A;  1YIJ N;  3U3G A;  3EO3 A;  3J7Y P;  3CCU N;  1VAZ A;  4WCE L;  4UY8 O;  4ID5 A;  1BG3 A;  1QTM A;  2HBM A;  5D3G A;  4EZ6 A;  1NGJ A;  3OYB A;  4KH5 A;  4FLU A;  4YDU C;  2UU9 K;  4C8O A;  3FZH A;  2YHY A;  2QWQ A;  3FGU A;  4JEP A;  4CJ4 A;  3M8S A;  1DLO A;  3MX2 A;  5AQM A;  3T1Y K;  3HVR A;  3H08 A;  3OHR A;  2A6A A;  1HPM A;  1TKX A;  4AHS A;  1RCH A;  1RT5 A;  4O44 A;  3AO4 A;  5EY4 A;  1W2B M;  4DR4 K;  1RTI A;  1GLJ O;  1IJJ A;  3B6P A;  3D2E B;  1RGI A;  5AZJ B;  2GX9 A;  3VN5 A;  1NK0 A;  5KPT A;  4B3M K;  3FZM A;  5AQO A;  3MAQ A;  1WSF A;  3TSQ A;  4CZK A;  4AF1 A;  3SUO A;  1NKE A;  1WB9 A;  5J2P A;  4OGE A;  2P9N B;  3PX0 A;  4DSI A;  1TAQ A;  4B9S A;  1P8Z A;  3BP8 A;  1G99 A;  4DV5 K;  4KV8 A;  1VQL N;  4F4K A;  1W0H A;  3QBW A;  4GKJ K;  3DLB A;  3AAP A;  4DQ8 A;  1I3A A;  3MXM A;  1XHZ A;  3TAF A;  4CED A;  4N76 A;  4CF8 A;  4JN4 A;  2A1S A;  2NRT A;  3JAM O;  2Q36 A;  4BDY A;  1L3V A;  4Q5V A;  1KFD A;  4ISG A;  3WQT A;  1CZA N;  5BPL A;  2V7Z A;  1N32 K;  3PSI A;  1GLA G;  2G8V A;  4G9Z A;  5ELZ A;  5EXW A;  4B8A B;  4B3R K;  4JI4 K;  4OPJ A;  4YHH K;  4A62 A;  3NE6 A;  3R8E A;  2VCP A;  1S5J A;  3WNH A;  2O8B A;  4DV4 K;  3KLE A;  1S1T A;  5AQW A;  3ZSY A;  1CLQ A;  1XNQ K;  4L8R B;  3OYH A;  1OH8 A;  5K14 A;  4DTJ A;  3CCQ N;  2VYP A;  4W5O A;  4HUE A;  1KC8 O;  2I7P A;  2E88 A;  3SPY A;  3FZL A;  3IS9 A;  4FL9 A;  1T6D A;  3Q7B A;  3EN9 A;  3QIP A;  4WFA L;  3QFP A;  4AIL C;  2HHQ A;  5DM7 L;  4FZX C;  2HMI A;  4JKF A;  3OYG A;  4A5B A;  4GV6 A;  3AA4 A;  3ASM A;  4W5R A;  2P9P B;  3HP9 A;  3R9P A;  1CXU A;  1QE1 A;  3VF2 A;  2OTJ N;  1FKP A;  2VWB A;  5FRO A;  1CZB A;  5M1F A;  1OH5 A;  4I6M A;  2HW3 A;  3CF5 L;  3L6Q A;  3CQ8 A;  4DUZ K;  3MWT A;  3UKR B;  3ZT0 A;  4U67 L;  3OYC A;  1TUU A;  1NG9 A;  4CHY A;  1HQE A;  3V9S A;  4F8R A;  1N6Q A;  2OYQ A;  4CJF A;  3OA9 A;  4CF0 A;  3V4I A;  1X9J A;  2GWJ A;  1B9D A;  4IXC A;  4EFH A;  3SUQ A;  3CPE A;  1XI1 A;  4DWI A;  2KZZ A;  1NGE A;  5C24 A;  5M1O A;  4LFB K;  5AZI A;  2NRH A;  3EE9 A;  4TSX A;  3M8R A;  1IBM K;  3ZT1 A;  4KI6 A;  3VTH A;  1HJR A;  4NYF A;  2KW4 A;  4E19 A;  1SKS A;  3IUC A;  3ZSR A;  4ELT A;  3CCJ N;  4M3Y A;  1JLC A;  5KGX A;  4HTL A;  5GAG P;  2X74 A;  2R7Y A;  1RT4 A;  1QQC A;  1D5A A;  4JHD A;  4FJM A;  4DCH A;  4H0P A;  5AQV A;  1SAZ A;  3D2F A;  2CH6 A;  4E3S A;  3HVT A;  1BCM A;  4OPH A;  4DTS A;  2ZM6 K;  2GEM A;  4FZZ A;  1BDG A;  2WBN A;  1NK8 A;  4J2D A;  3WT0 A;  4JK9 A;  2B5J A;  1KSP A;  1DKG D;  3A2F A;  4DV7 K;  3PO4 A;  2OPR A;  4HCB A;  1BOT O;  4FPB A;  3MDQ A;  2IGI A;  1VQ4 N;  2QKB A;  4KH4 A;  3R1X A;  4OKJ A;  1TK5 A;  1TV6 A;  3I0R A;  5SZT A;  5GAD P;  4CJ5 A;  3FR0 A;  3PX6 A;  1XC3 A;  3CJ1 A;  2P5G A;  3LDO A;  4DU3 A;  5IT9 O;  3KK3 A;  2A3Z A;  1Z6R A;  3LAK A;  4PHT X;  3ZX2 A;  3IAY A;  2P51 A;  3U9Z A;  5M1K A;  4GKK K;  5SWM A;  4M42 A;  2ITM A;  3AVH A;  1U04 A;  4JS5 A;  5GIP A;  1LW2 A;  3HK2 A;  2B6A A;  1D9F A;  2OCE A;  3C0B A;  1NJW A;  2QW9 A;  1R0A A;  4CI6 A;  4JKB A;  3Q7C A;  2IOC A;  1RTH A;  2O8C A;  2V52 B;  4H5V A;  4FW2 A;  4E7H A;  4Z4C A;  4BC4 A;  4BC2 A;  1VSL A;  4IJA A;  1NM1 A;  4JI1 K;  2AP1 A;  3RSE B;  1JL1 A;  4BRF A;  3SUP A;  4BG9 A;  4B3T K;  2W6L A;  3L8B A;  4CHQ A;  1N33 K;  1E3M A;  3CC2 N;  3E9P A;  3GE1 A;  4H8K A;  4FWK A;  1HKB A;  3O8M A;  1SL1 A;  3K59 A;  4B08 A;  3A5M C;  4EP5 A;  4OLB A;  1VSF A;  4X65 K;  3SBG A;  3LDP A;  2I5J A;  3EEQ A;  4RCH A;  4BRC A;  3OYN A;  3CJC A;  4KTZ A;  2W40 A;  4B9M A;  3NAE A;  1BUP A;  3KLH A;  3RTV A;  3EZW A;  4DLG A;  3RRG A;  2XO7 A;  1WBB A;  3VGL A;  1T3V A;  5F1X A;  1C0T A;  3VQ8 A;  2VQE K;  2NRZ A;  1MA9 B;  4B9L A;  4OGC A;  2BTF A;  4CGF A;  1CZ9 A;  5CYM A;  1TUY A;  2O8E A;  3O3F A;  3S41 A;  1EQY A;  3LDQ A;  2D0B A;  3L2U A;  2BUP A;  2G8F A;  4KI4 A;  5BN9 A;  5GAE P;  5C0Y A;  1VSI A;  2QEX N;  4M3U A;  1NGD A;  4FWR A;  1N8R O;  4KHP K;  1RDW X;  3ZX3 A;  4ZTF A;  4FJN A;  3ID8 A;  1WSJ A;  2UXD K;  3HRG A;  1GLB G;  2F4V K;  4LF5 K;  2VG6 A;  4RWT A;  3CCR N;  1Z25 A;  5KI6 A;  4HUG A;  3RR8 A;  4CIG A;  3NF9 A;  3AA3 A;  4PKH A;  3OYM A;  3HPG A;  3CPW M;  1RBV A;  5KPR A;  3WNG A;  3SJJ A;  3HBT A;  3MEE A;  5GAH P;  1NOZ A;  2P9L B;  1YVU A;  1ZBH A;  4FXD A;  1ATR A;  2E2Q A;  4CJV A;  3ALY A;  3T7Z A;  1BI4 B;  2F9T A;  3JS6 A;  1VQ5 N;  2YNG A;  1RDA A;  4IFY A;  4CEQ A;  2O4G A;  2HOE A;  2RPI A;  5AFU A;  3VEO A;  5HOO A;  5AQK A;  5AQU A;  1L3U A;  1A5X A;  1VSK A;  1JL2 A;  3ULD A;  4B9Q A;  3DJC A;  4BE2 A;  1UA0 A;  4FJX A;  1JJ2 M;  3DOL A;  5C10 A;  1LWE A;  1BQN A;  4KH6 A;  1MU2 A;  3LDS A;  3SQ2 A;  3L3U A;  3M1F A;  5HL7 L;  2ZD1 A;  5CE3 A;  1GLC G;  5FPM A;  3LZJ A;  3RWU A;  4EZ9 A;  3EYZ A;  3WNF A;  5KQD A;  3VA3 A;  2D5R A;  3H1Q A;  1KTQ A;  4Z4E A;  3VQC A;  3L2W A;  1WSG A;  1GLD G;  1NK9 A;  2XHB A;  3H46 O;  5JIC A;  2ZJP L;  1IKW A;  2W42 A;  3DWL A;  3KK7 A;  2QWM A;  1IKX A;  4CEA A;  1HNW K;  3PX4 A;  2HNY A;  5GIN A;  2ZJR L;  4BG8 A;  4JRQ A;  4C8L A;  4JK7 A;  4K42 A;  4MLE A;  3O4Q A;  3RMD A;  2GV9 A;  5BPM A;  4FJI A;  2KFZ A;  3PLA A;  3CCL N;  3KKR A;  1QQM A;  5C12 A;  1YJW N;  4FCY A;  2D0A A;  4BRM A;  1T7P A;  2E6L A;  5AQY A;  1FK9 A;  1I94 K;  3AY9 A;  4YOV A;  1TYQ A;  4EP4 A;  3NBP A;  3D6R A;  3TU5 A;  2VGN A;  4RW8 A;  3OW2 M;  4NCG A;  5AFU H;  3AO3 A;  3AVB A;  2BAN A;  3OYJ A;  1VQO N;  2ETJ A;  1VRU A;  4FLV A;  4FWS A;  3AAQ A;  2A5X A;  4B1V A;  2J4R A;  4FJ5 A;  2VG5 A;  1B92 A;  4Y0W A;  4ISE A;  3CCS N;  3NGY A;  3KLF A;  4DR7 K;  4DTR A;  2HMP A;  4F3T A;  2O8F A;  3GOI A;  4BRO A;  3VEN A;  4Z94 A;  2QWN A;  1JLE A;  4CZE A;  5AQN A;  5AQQ A;  3THY A;  3TAR A;  1KCF A;  4CJK A;  1YI2 N;  2D4W A;  3P31 A;  4O5B A;  3CQX A;  1ZBI A;  1BA0 A;  3K57 A;  4JI3 K;  4KHW A;  5F2R A;  4JKC A;  4BR0 A;  1SV5 A;  4I7F A;  1U49 A;  3O9U A;  4CJW A;  3J81 O;  4FWN A;  3BY5 A;  1HYS A;  1BU6 O;  3CME N;  5EU7 A;  4LC9 B;  2X78 A;  4L3Q A;  4CZM A;  3THW A;  3E9O A;  3ID6 A;  3NH2 A;  3SZ2 A;  4YOY A;  4KHU A;  4O8K A;  4K43 A;  4DV6 K;  3CQY A;  3KJV A;  3TAB A;  2O8D A;  4RW4 A;  2JWL A;  3HXM A;  4IBN A;  4CIF A;  2Y1J A;  1LV5 A;  3MXJ A;  1EP4 A;  3M3Z A;  3A5L C;  4IFE A;  2O8B B;  5CYQ A;  3N4Q A;  4Y1D A;  1WSH A;  1NMN A;  2FBX A;  4H5W A;  5FPD A;  2RHK A;  3MEC A;  4CEO A;  3KKS A;  4QS7 A;  2A40 A;  3QLH A;  4C8N A;  4C1N I;  4H0T B;  2D0P A;  1RT1 A;  4BR9 A;  1UOC A;  4PY5 A;  3V9X A;  4DR5 K;  5M1Q A;  4DQQ A;  4M3X A;  2DPN A;  4BRG A;  3NF7 A;  3LAM A;  3SJH A;  4GV3 A;  3SAF A;  4AHC A;  2E20 A;  3C94 A;  4HUF A;  5AQJ A;  5C25 A;  2PFU A;  3AV9 A;  4I6M B;  2RKI A;  1KRP A;  4JI5 K;  3NVK A;  1Q82 O;  3FZF A;  1TGO A;  1S3X A;  3ATV A;  1GLE G;  4B1X B;  3NH1 A;  1VSH A;  1KAY A;  4KO0 A;  3CIP A;  4CGI A;  3BEX A;  2IVO A;  4DS5 A;  4PUO A;  1HKC A;  4CEZ A;  2CGJ A;  2NNW A;  5HRN A;  1TAU A;  4BRQ A;  1GLF O;  1RDD A;  4B1W B;  1NU0 A;  1VQN N;  5AZI B;  4IEI A;  3MCA B;  4FOI A;  4LF7 K;  3S3O A;  3R3L A;  2VWK A;  3HSC A;  3QO9 A;  1IG8 A;  1RTJ A;  4FK4 A;  1ILY A;  2A41 A;  4BR2 A;  3TI0 A;  3CJ7 A;  3IFR A;  4B3O A;  3PY8 A;  4C23 A;  4JKH A;  1TKT A;  4JHD B;  4XIU A;  4NCB A;  1NGA A;  4BR7 A;  4J2E A;  3BUZ B;  1LWF A;  3D2F B;  3VQD A;  1IH7 A;  4MQ3 A;  4M45 A;  2FF6 A;  4H5N A;  1QVG M;  4FLX A;  3SNN A;  4C8K A;  4CE9 A;  4NB4 A;  5BRD A;  3OYK A;  5BR9 A;  3L2R A;  5HBM A;  3ZYY X;  2XRI A;  4CER A;  3U9D A;  2KKZ A;  3TR8 A;  1QHT A;  3S3M A;  4DUY K;  3MN7 A;  2O4I A;  4QS8 A;  1HRH A;  2OPP A;  1YIT N;  2EHG A;  2RF2 A;  5AQT A;  3VTI A;  1XQS C;  2XY7 A;  4FLY A;  5CHI A;  3AGK A;  3CC4 N;  3LM2 A;  2PYJ A;  5DK5 A;  1W9H A;  3HM9 A;  1KFS A;  3WXK A;  2IVN A;  5M1P A;  3DYA A;  4JD2 A;  3PSF A;  4FJJ A;  3LP3 A;  1YXQ A;  1IO2 A;  3R6M A;  1N5Y A;  1X3M A;  3OTO K;  4K0K K;  3S9H A;  3THX A;  2O8C B;  5AQS A;  3F73 A;  4FWL A;  4CZJ A;  3K5M A;  3QIO A;  4BRE A;  1KAX A;  3O9T A;  4DFK A;  4FJH A;  4H0O A;  4K41 A;  1HMV A;  2YHX A;  4RW6 A;  4CJ3 A;  2VWJ A;  4DMN A;  4CF9 A;  4FM2 A;  3NMU A;  2Z1H A;  1K8K A;  3O1B A;  4FO0 A;  3TTF A;  4M3W A;  2HHV A;  2QWL A;  4GW6 A;  3THV A;  1NGB A;  3D0P A;  2Q31 A;  3AVJ A;  3N4P A;  4BRN A;  1JCG A;  2HB5 A;  4CHZ A;  3TWH A;  3QDK A;  4B1Z A;  3RR7 A;  2WFB A;  2D0O A;  2G8U A;  1S72 N;  2RE2 A;  1LWC A;  3L4Q A;  4LFA K;  1B9F A;  4LSL A;  3CYM A;  3C6A A;  4LH5 A;  4CJS A;  5C2F A;  5JVG L;  2CGK A;  3L2Q A;  4DG1 A;  3CET A;  1Y97 A;  4Y1C A;  2IS3 A;  3B6O A;  3NCI A;  3TAE A;  3UE5 A;  4JNE A;  5BRF A;  3EL2 A;  1SKW A;  4N56 A;  4K8Z A;  1QQO A;  3HOT A;  1VSJ A;  2O8E B;  1M1K O;  2YV0 X;  1SS6 A;  3ITH A;  1KVC A;  3MX5 A;  1LCU A;  4AHT A;  4IOA L;  3T3F A;  4FM0 A;  2Z1J A;  3O3H A;  3EKS A;  4ILJ A;  3ZET A;  4YNQ A;  1C1C A;  4O0I A;  2NRW A;  3D45 A;  2Q0U A;  4RW9 A;  2F8T A;  1WNS A;  4DFP A;  4OPA A;  2DFE A;  4BVP A;  4KB0 A;  3LPU A;  2HND A;  1Q9Y A;  1QS4 A;  3HO1 A;  1JLB A;  4LF6 K;  3DRR A;  4PKI A;  4CD3 A;  2HVI A;  3AVK A;  2P9S A;  4XH4 A;  5AQH A;  3PIP L;  2YHW A;  4R79 A;  1VSM A;  3CHW A;  2GBZ A;  4O55 A;  4CFA A;  3L0Q A;  2E2N A;  1K9M O;  1OVQ A;  3NFA A;  4DF4 A;  3WUH A;  4OJR A;  4YFU A;  3VMF B;  2E8A A;  3HTV A;  2PY5 A;  4H5T A;  3LAN A;  3J80 O;  4FW1 A;  4B9T A;  2YCH A;  4JS4 A;  1X9S A;  3LL3 A;  3VQ7 A;  5ADX H;  4H03 B;  2ZQB A;  3V81 A;  3IG1 A;  3HI0 A;  1NGI A;  4BAC A;  2NRV A;  2HST A;  3W0L A;  4WYB A; 
#chains in the Genus database with same CATH homology
 4DSJ A;  4FJL A;  3DRP A;  1S1V A;  1ASU A;  2ZE2 A;  1JL2 A;  2F96 A;  3T19 A;  5J1E A;  3CFR A;  3ULD A;  4BE2 A;  4DTM A;  3QEV A;  3TAN A;  4IG3 A;  1S1X A;  3SV3 A;  1UA0 A;  4FJX A;  4CGH A;  1IKY A;  3DOL A;  3HYF A;  1RTD A;  1NK5 A;  2ITG A;  1EXQ A;  1LWE A;  1JXB A;  3C6T A;  3AO5 A;  3KK1 A;  4Z4I A;  1BQN A;  3HP6 A;  1RDB A;  1SKR A;  3K5L A;  1MU2 A;  4BWJ A;  3C95 A;  3LDS A;  1RDC A;  1EX4 A;  4HHT A;  3L3U A;  2Z1I A;  5J2N A;  1TL1 A;  3SQ2 A;  3SYZ A;  3SUN A;  3OJS A;  4KPY A;  1CXQ A;  1FKO A;  3I8D A;  2ZD1 A;  3DM2 A;  3SI6 A;  4KKO A;  2RN2 A;  3NDK A;  1BIU A;  1NK4 A;  2JGU A;  3V6D A;  3LZJ A;  3VQ6 A;  1D9D A;  2QK9 A;  2B4J A;  3DOK A;  4AHR A;  4HTU A;  4DSE A;  4OVL A;  3RWU A;  4EZ9 A;  3EYZ A;  1G15 A;  2IDO A;  3WNF A;  3KK2 A;  2X6N A;  2OA8 A;  5J2Q A;  4ICL A;  4DQR A;  5HP1 A;  4FJ9 A;  3VA3 A;  2G8K A;  2D5R A;  1QSS A;  3DLG A;  4E7K A;  4B9V A;  1RT6 A;  1KTQ A;  1YT3 A;  1ASV A;  1RT3 A;  3V1O A;  5E41 A;  3RRH A;  4Z4E A;  3VQC A;  3LWL A;  3QET A;  1RBU A;  4BE1 A;  3L2W A;  3OYL A;  1WSG A;  1NK9 A;  4DU1 A;  4Z0U A;  2XHB A;  1NJZ A;  1TK8 A;  1NK6 A;  4FVM A;  3PV8 A;  1IKW A;  4FLW A;  3QEX A;  3IRX A;  4LSN A;  2W42 A;  1IG9 A;  3OYF A;  4C8M A;  3OS1 A;  2OZS A;  1YTA A;  3ZT3 A;  4B8C A;  4OKE A;  1IKX A;  3QEP A;  4CEA A;  1JLG A;  4F3O A;  1RIL A;  3OYD A;  3PX4 A;  1F21 A;  2HNY A;  2A1R A;  3K5O A;  1GOA A;  5T7B A;  4JRQ A;  4C8L A;  4CJT A;  4CFC A;  4E0D A;  4DU4 A;  1X9M A;  3P83 D;  3U3G A;  3O4Q A;  4I2Q A;  1WN7 A;  1S1W A;  3RMD A;  2GUI A;  1RBT A;  4ID5 A;  2GV9 A;  5FRM A;  3KD1 E;  3SQ4 A;  4OPK A;  4E7J A;  4HVJ A;  1QTM A;  3HST B;  5D3G A;  3U3Y A;  4EZ6 A;  4FJI A;  3OYA A;  3NF8 A;  3OYB A;  2KFZ A;  4CIE A;  5HRP A;  3V1R A;  3KKR A;  4FLU A;  1JXE A;  4N47 A;  1C6V A;  3AVC A;  4FCY A;  4C8O A;  4PWD A;  2Y1I A;  2D0A A;  2LSN A;  4KRE A;  2AJQ A;  4CJ4 A;  3M8S A;  3CFP A;  1T7P A;  2E6L A;  1DLO A;  1FK9 A;  1I39 A;  3HVR A;  3RMC A;  4GMJ B;  4JLH A;  1U47 A;  3H08 A;  4EP4 A;  4DLE A;  1S9G A;  2YKN A;  3NBP A;  3O3G A;  1UWB A;  2G8H A;  1TKX A;  3CM6 A;  4RW8 A;  1RCH A;  4NCG A;  1RT5 A;  4O44 A;  4AHS A;  4CK1 A;  1NKB A;  3AO3 A;  3AO4 A;  4QCL A;  3AVB A;  5JS2 A;  4DSK A;  2BAN A;  3OYJ A;  1RTI A;  2ETJ A;  1VRU A;  3G0Z A;  2YNF A;  4CFD A;  1SUQ A;  3B6P A;  4FLV A;  3AA5 X;  4BE0 A;  5I42 A;  3VN5 A;  1NK0 A;  3OY9 A;  3MAQ A;  2VG5 A;  2YHA A;  3SPZ A;  4FJ5 A;  1B92 A;  2DFF A;  1WSF A;  3ZCM A;  1VRT A;  4QOZ B;  5CY4 A;  4CGG A;  3SUO A;  1NKE A;  3NGY A;  2QXF A;  3KLF A;  4DTR A;  1SL2 A;  1QSL A;  4F3T A;  4W5Q A;  4OGE A;  5J2P A;  3PX0 A;  2OZM A;  4DSI A;  1TAQ A;  1S9E A;  5HRR A;  4B9S A;  4O0J A;  1RBS A;  3LP0 A;  3AVF A;  1JLE A;  3AVG A;  4Z4H A;  3V9U A;  3ZT2 A;  1KVB A;  4KV8 A;  4F4K A;  1W0H A;  3VA0 A;  3LZI A;  3DLB A;  4NYN A;  3TAR A;  1I3A A;  3MXM A;  1XHZ A;  1KCF A;  4CJK A;  4KAZ A;  5KGW A;  3TAF A;  2XY6 A;  4O5B A;  4CED A;  4N76 A;  4CF8 A;  1ZBI A;  2DFH A;  3K57 A;  2A1S A;  4KHW A;  1JKH A;  1HYZ A;  4BWM A;  4DTN A;  1SV5 A;  4CEF A;  4I7F A;  4BDY A;  1U49 A;  4CJW A;  2F8T A;  1HYS A;  4FZY A;  1LAV A;  3I0S A;  5EU7 A;  3C6U A;  1KFD A;  4Q5V A;  1L3V A;  2X78 A;  4B9U A;  3FFI A;  4PQU A;  3QEW A;  1VK0 A;  1KVA A;  4CHN A;  3NH2 A;  3SZ2 A;  1BCO A;  1L3S A;  2G8V A;  4J2A A;  2G8W A;  4KHU A;  2E6M A;  3HT3 A;  3VQ5 A;  1T03 A;  4B8A B;  1A5W A;  3KJV A;  3TAB A;  4RW4 A;  4KTQ A;  3S3N A;  4OPJ A;  4IFV A;  3HXM A;  4F2R A;  4IBN A;  4CIF A;  2Y1J A;  1LV5 A;  3NE6 A;  3MXJ A;  1EP4 A;  4LH4 A;  4CJE A;  4AHV A;  3QEI A;  2FBV A;  1S5J A;  3WNH A;  4E1N A;  3CM5 A;  2X6S A;  1RT7 A;  3SCX A;  4GVM A;  3KLE A;  4CJU A;  1S1T A;  3ZSY A;  5CYQ A;  3L2V A;  1CLQ A;  3ZSV A;  4DQS A;  4Y1D A;  4HCC A;  1TKZ A;  1WSH A;  3QER A;  4L8R B;  4FJG A;  2FBX A;  4J2B A;  4KHS A;  2HNZ A;  1GOC A;  4MFB A;  1X9W A;  3OYH A;  4FLT A;  4H4M A;  4KHY A;  3MEC A;  3ZSX A;  4CEO A;  5K14 A;  1LAW A;  3KKS A;  3QLH A;  1A5V A;  4DTJ A;  4HUE A;  4CFB A;  4OKK A;  4W5O A;  3V9Z A;  4C8N A;  3SPY A;  1D8Y A;  3T1A A;  3KLI A;  3IS9 A;  4KHQ A;  3QIP A;  1RT1 A;  1BHL A;  4AIL C;  3KLG A;  2HHQ A;  1UOC A;  4PY5 A;  3L3V A;  4FZX C;  4ID1 A;  1SL0 A;  2HMI A;  3V9X A;  2BE2 A;  4IG0 A;  3OYG A;  3TAG A;  3KTQ A;  3PO5 A;  1ZBU A;  4DQQ A;  1WAJ A;  3AA4 A;  4M3X A;  3ASM A;  4W5R A;  3MED A;  4ZHR A;  1J53 A;  3HP9 A;  3NF7 A;  4FJ7 A;  4CHO A;  2KTQ A;  3LAM A;  5KRS A;  3WNE A;  1NK7 A;  4BDP A;  3EY1 A;  3QES A;  1CXU A;  1QE1 A;  1XHX A;  3O4N A;  4DFJ A;  1TL3 A;  1ZBF A;  1FKP A;  4AHC A;  3C94 A;  5FRO A;  1CZB A;  4HUF A;  1REV A;  4DFM A;  3CFO A;  5C25 A;  1L3T A;  2HW3 A;  3JYT A;  3AV9 A;  3CQ8 A;  1NJY A;  2RKI A;  1KRP A;  2Q3S A;  1QSY A;  3ZT0 A;  3TAP A;  3OYC A;  1TGO A;  3TAQ A;  3NHG A;  4CF1 A;  4DTX A;  4CHY A;  1HQE A;  3NH1 A;  3V9S A;  4F8R A;  1VSH A;  1N6Q A;  2OYQ A;  4KO0 A;  1RT2 A;  4CJF A;  4Z4G A;  4CGI A;  2F8S A;  4DS5 A;  4CF0 A;  4Z4F A;  4CEE A;  2YKM A;  3KD5 E;  4PUO A;  4G1Q A;  3V4I A;  2WON A;  4CEZ A;  4LY7 A;  1B9D A;  5HRN A;  3SUQ A;  1TAU A;  3QIN A;  3ZSZ A;  1XI1 A;  4DWI A;  2KZZ A;  5C24 A;  3RMA A;  1RDD A;  4CK3 A;  1L5U A;  3VQ4 A;  3BDP A;  4TSX A;  3OJU A;  3M8R A;  3ZT1 A;  1XC9 A;  4KI6 A;  4CJR A;  1HJR A;  4NYF A;  3S3O A;  2KW4 A;  2DTU A;  2VWK A;  4E19 A;  1SKS A;  3ZSR A;  4ELT A;  4H4O A;  3QO9 A;  1RTJ A;  4K8X A;  4CJL A;  4FK4 A;  3TI0 A;  4M3Y A;  4B3O A;  1JLC A;  1GOB A;  4M3R A;  3PY8 A;  4WE1 A;  5KGX A;  3M8P A;  2R7Y A;  2X74 A;  1RT4 A;  2YNH A;  1QQC A;  3AVM A;  1U48 A;  1D5A A;  4FJM A;  4M3T A;  1TKT A;  4LD0 A;  4XIU A;  4NCB A;  2P5O A;  4N41 A;  4J2E A;  3VQB A;  2HHS A;  1LWF A;  1J5O A;  1BL3 A;  3AA2 A;  4O4G A;  4E3S A;  3VQD A;  3HVT A;  2YNI A;  5J2M A;  1IH7 A;  1BCM A;  4MQ3 A;  1NOY A;  4DTS A;  4M45 A;  4FZZ A;  1NK8 A;  4J2D A;  1BIS A;  4FLX A;  3LWM A;  2B5J A;  1KSP A;  3A2F A;  3PO4 A;  2OPS A;  2OPR A;  4DTP A;  3SNN A;  3VQA A;  5HLF A;  4C8K A;  4HCB A;  1C1B A;  2IGI A;  4CE9 A;  4M3Z A;  4ELV A;  1DTT A;  5JS1 A;  3OYK A;  2QKB A;  1WLJ A;  1EKE A;  3L2R A;  5HBM A;  2JLE A;  2XRI A;  4OKJ A;  3OYI A;  1TV6 A;  3I0R A;  4CER A;  3OS2 A;  1TK5 A;  5FDL A;  4KB1 A;  3TR8 A;  1QHT A;  3S3M A;  3VQ9 A;  1JLQ A;  3LP2 A;  4ZTJ A;  3PUF A;  5SZT A;  1RBR A;  4CJ5 A;  2VG7 A;  3OS0 A;  3PX6 A;  3OVN A;  2P5G A;  2O4I A;  1ITG A;  3MEG A;  1HRH A;  2OPP A;  4DU3 A;  3KK3 A;  1T8E A;  1NKC A;  4F2S A;  2EHG A;  3LAK A;  2RF2 A;  2Z1G A;  4CJP A;  4B9N A;  2XY7 A;  4FLY A;  2PYJ A;  3HPH A;  4KHN A;  4E7I A;  3IAY A;  5DK5 A;  3VQP A;  1JLA A;  2NUB A;  1W9H A;  2P51 A;  3HM9 A;  1KFS A;  5KRT A;  3DYA A;  1JLF A;  3OYE A;  4FJJ A;  3VQQ A;  4FYD A;  3LP3 A;  5SWM A;  1IO2 A;  1WSI A;  3DRS A;  4M42 A;  1BQM A;  1N5Y A;  3AO2 A;  4DTU A;  3AVH A;  1U04 A;  3NF6 A;  1UAX A;  4JS5 A;  2FC0 A;  4FK0 A;  1LW2 A;  1VSD A;  4R5P A;  3HK2 A;  2B6A A;  1RNH A;  1D9F A;  1NJW A;  5I3U A;  2OPQ A;  1XWL A;  1NJX A;  1R0A A;  1HQU A;  3ZSQ A;  2IOC A;  1RTH A;  3K2P A;  3S9H A;  4Q0B A;  4CHP A;  1BIZ A;  4FW2 A;  3P5J A;  3F73 A;  4E7H A;  5CZ2 A;  4Z4C A;  3K5M A;  3DLH A;  3QIO A;  4CCH A;  3MXI A;  3KIO A;  4CJQ A;  4M41 A;  4QAG A;  4DFK A;  2FBT A;  1VSL A;  3LP1 A;  1HMV A;  5HRS A;  1U45 A;  4FJH A;  3M8Q A;  4RW6 A;  2QKK A;  1YTU A;  3HPO A;  4CJ3 A;  3CG7 A;  2VWJ A;  2IAJ A;  3EZ5 A;  1T05 A;  4DMN A;  3DI6 A;  1Q8I A;  1JL1 A;  3VQE A;  4CF9 A;  4BDZ A;  4FM2 A;  4FM1 A;  4NCA A;  2Z1H A;  1S1U A;  3SUP A;  4I9L A;  1EET A;  1HNV A;  5C42 A;  4CHQ A;  3L8B A;  3RMB A;  1TKD A;  1S6P A;  5HRO A;  2PZS A;  4IKF A;  4M3W A;  4KRF A;  4H8K A;  3P1G A;  4KTW A;  3G10 A;  1SL1 A;  2HHV A;  1C0U A;  3NGI A;  4GW6 A;  3K59 A;  4DF8 A;  3QNN A;  3THV A;  4B08 A;  4DQI A;  2HHT A;  3D0P A;  4EP5 A;  4UQG A;  4OLB A;  3AVJ A;  2XY5 A;  3NH0 A;  1VSF A;  2EX3 A;  2HB5 A;  4CHZ A;  2I5J A;  3TWH A;  1WAF A;  3QNO A;  1HYV A;  3AVA A;  3TAM A;  3OYN A;  3SQ1 A;  2P1J A;  3RR7 A;  2HVH A;  1KLM A;  4CF2 A;  1O1W A;  4KTZ A;  4B9M A;  4CEC A;  2WOM A;  1K6Y A;  2G8U A;  3NAE A;  3AVN A;  1LWC A;  1VSE A;  3KLH A;  3RTV A;  1B9F A;  4CGJ A;  1TK0 A;  4LSL A;  3CYM A;  4AHU A;  4I2P A;  3DLE A;  4LH5 A;  3AVL A;  4CJS A;  4DLG A;  4E7L A;  3LPT A;  1UA1 A;  1KLN A;  2XO7 A;  3RRG A;  3L2Q A;  1LW0 A;  4DG1 A;  1C1A A;  4DSF A;  1ZYQ A;  1Y97 A;  1DTQ A;  3BGR A;  3ISN C;  1C0T A;  4Y1C A;  1J9A A;  2IS3 A;  3VQ8 A;  2FBY A;  3B6O A;  3K5N A;  2KZM A;  3NCI A;  2YHB A;  3TAE A;  4B9L A;  4OGC A;  4W5T A;  1SKW A;  4N56 A;  5CZ1 A;  1S6Q A;  2BGG A;  4CGD A;  1CZ9 A;  4CGF A;  4DSL A;  4K8Z A;  3DLR A;  5CYM A;  4E1M A;  1VSJ A;  3O3F A;  3ZSO A;  5KTQ A;  2YV0 X;  5FRN A;  3ITH A;  1KVC A;  2D0B A;  3ZSW A;  4CES A;  3L2U A;  4AHT A;  3T3F A;  4FM0 A;  2G8F A;  2Z1J A;  4ELU A;  4KI4 A;  3O3H A;  4W5N A;  1TVR A;  2DY4 A;  1WSE A;  3HJF A;  4YNQ A;  1C1C A;  1VSI A;  4O0I A;  1HNI A;  5DMR A;  4FK2 A;  3E01 A;  3D45 A;  4RW9 A;  1C0M A;  4RW7 A;  3U6F A;  1WNS A;  4DFP A;  3V9W A;  4M3U A;  2G8I A;  4PA1 A;  1IKV A;  2DFE A;  3NGZ A;  3LPU A;  4ZTF A;  2HND A;  4KB0 A;  1Q9Y A;  1QS4 A;  3SQ0 A;  4FJN A;  4RG8 A;  3HO1 A;  1JLB A;  1WSJ A;  3DRR A;  1J54 A;  2HVI A;  4DS4 A;  2HHU A;  3AVK A;  2KFN A;  2VG6 A;  1Z26 A;  2XY8 A;  3F9K A;  4FJ8 A;  4OLA A;  1VSM A;  3LAL A;  1BGX T;  1Z25 A;  3AO1 A;  5KI6 A;  3ZT4 A;  2GBZ A;  4HUG A;  1Q9X A;  3RR8 A;  4I9Q A;  4O55 A;  4CFA A;  3SV4 A;  4CIG A;  4DTO A;  3DLK A;  3NF9 A;  3V1Q A;  3AA3 A;  2ATQ A;  3NFA A;  2D0C A;  3OYM A;  3HPG A;  1RBV A;  2E4L A;  4FJK A;  3WNG A;  1ASW A;  3HL8 A;  4N5S A;  4DF4 A;  4OJR A;  4YFU A;  3SJJ A;  4FLZ A;  3MEE A;  2PY5 A;  1NOZ A;  4IDK A;  3LAN A;  4FW1 A;  1YVU A;  4B9T A;  1ZBH A;  1BI4 A;  4CJV A;  4FXD A;  2PYL A;  3ALY A;  1X1P A;  1BI4 B;  4KFB A;  4JS4 A;  1X9S A;  3VQ7 A;  2YNG A;  3JSM A;  1RDA A;  4JRP A;  2IC3 A;  4IFY A;  1FXX A;  4CEQ A;  3K58 A;  2KQ2 A;  3V81 A;  2ZQB A;  4AH9 A;  3IG1 A;  2RPI A;  4DQP A;  1ZBL A;  3DMJ A;  4CK2 A;  4E89 A;  4BAC A;  3AVI A;  1U4B A;  1L3U A;  3UIQ A;  2BDP A;  2HHX A;  1A5X A;  2HHW A;  1HPZ A;  2O4G A;  1VSK A;  4CEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...