3CM6A

Crystal structure of cell-death related nuclease 4 (crn-4) bound with er
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
294
structure length
294
Chain Sequence
HCPFDTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFERVLPLVVTTIRAGDFRLEMYGVCRYCRKGMDVCGTSHQQTPHDLYKNEEDPIHFAKIAGYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, apoptosis
molecule keywords Cell death-related nuclease 4
publication title Crystal structure of CRN-4: implications for domain function in apoptotic DNA degradation
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 87
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cm6A01
1B9DA 1FKPA 4NYNA 1HRHA 3OYBA 4KI4A 1BGXT 1WAFA 2HNYA 3G10A 4HUFA 4DFJA 1LV5A 1YTUA 4CJVA 3L2UA 3ZT4A 4NYFA 4DFMA 3O3FA 2D5RA 1R0AA 2VG6A 1UWBA 3CG7A 1DLOA 3OS0A 3SZ2A 4DFKA 5FROA 2XRIA 5CZ1A 3LWLA 1Y97A 1NJYA 4RW6A 2HHVA 4ZTJA 4KO0A 1BQMA 3KLFA 1TAQA 1FK9A 3NF8A 4Y1CA 4DTMA 3RWUA 3LALA 3LPUA 3AVLA 3OYNA 1HNIA 3HPGA 4FM0A 2BDPA 3MEEA 3AVGA 1L3UA 3B6OA 2HHWA 4KV8A 3K5NA 3D0PA 3KLEA 3K58A 3ZT3A 5DK5A 3V1QA 2JGUA 1WSFA 4FJ5A 4DSJA 1ITGA 4FJ9A 1QHTA 3VQ8A 1HYZA 3NDKA 3C94A 3QESA 4LH5A 1B9FA 2BE2A 3SI6A 4H4MA 3AVMA 4CJLA 3AA2A 3WNHA 4B9TA 2ZD1A 4E3SA 1SUQA 3HM9A 3K57A 3AO4A 4FLVA 3V9WA 1NKCA 4CJUA 3KLGA 1U45A 1D9DA 4UQGA 4CIGA 3LDSA 1BHLA 3D45A 3SQ1A 5KGWA 1KLNA 3TAPA 3OYGA 2BGGA 4ELUA 1ZBFA 2RKIA 4RG8A 1VSJA 3V6DA 4HUGA 4LH4A 1QTMA 1L5UA 2OA8A 4FLWA 2A1SA 4C8MA 1BI4B 1HPZA 3P1GA 5HRSA 3DM2A 2PYJA 1C0TA 3KK1A 2P5GA 1KTQA 2DTUA 3TAMA 4C8KA 3SUQA 3DLEA 3DOLA 1SL1A 4CIFA 4NCGA 1TVRA 4E7LA 3O4QA 1BCMA 1SV5A 1VSHA 3EZ5A 3KD1E 4CESA 2OPSA 1C1AA 3TAFA 2HHUA 3AVHA 4B08A 3K2PA 4FK2A 1WN7A 4FLXA 5HBMA 5KRSA 1RTJA 3LZJA 1C6VA 3OYHA 3QNOA 1L3TA 3T3FA 3SQ0A 3RMAA 4FJKA 3PY8A 4W5QA 1T8EA 2OPQA 4KHYA 2F96A 3ITHA 3QIPA 4GMJB 3VQ6A 2W42A 1RDBA 3QLHA 4B9SA 5C24A 1TV6A 3PO5A 4FJMA 1Z25A 1S5JA 3SYZA 4CHPA 2Z1HA 2O4IA 4CEBA 1GOBA 3L3VA 5K14A 3OJSA 4OGEA 1IG9A 1MU2A 3C95A 3MXMA 3WNGA 4CK3A 1J53A 4DQRA 1JLGA 3CFOA 3KKRA 3M8SA 3T1AA 1HQEA 4CGFA 4NCAA 2KZZA 4DS5A 1WSHA 4B9VA 1BCOA 1C0MA 2D0CA 2KQ2A 3V9ZA 3TANA 1FXXA 4KAZA 3NCIA 3QO9A 4DG1A 2KFZA 2LSNA 2HVHA 3K59A 1HQUA 3DLBA 5C42A 3QEXA 4CFCA 4CEZA 4CJ4A 4FK0A 1YVUA 2YV0X 3VA3A 4CGHA 3OY9A 1SL0A 3SUOA 1KVBA 2IAJA 4ELVA 4CGDA 1CZ9A 3NGIA 1QE1A 1IH7A 4M45A 3RR8A 1LAWA 3AVIA 4M3TA 1SKSA 3U3GA 4FJ7A 1X9WA 1LWCA 1UOCA 2B4JA 2Z1GA 3OYCA 3ZSOA 1JXBA 4CJSA 4CFBA 3MAQA 4DFPA 3HXMA 2XY7A 1NK4A 3KTQA 5SZTA 3SCXA 2E4LA 1GOCA 1S1VA 4CGGA 4HUEA 3RMBA 3OYIA 4LSNA 4PWDA 3PX0A 3AVFA 3LP2A 3QINA 4BDPA 1LW2A 4YNQA 4PUOA 3AA5X 1J5OA 1LWEA 4E1MA 4DU4A 4OGCA 3HL8A 4K8ZA 4F3TA 3TAQA 3LAMA 1JLCA 2RN2A 4B8CA 4DTSA 5HROA 4DSLA 3AVAA 4HCBA 4IDKA 4KTWA 3V1OA 4Z4CA 1JXEA 4Q5VA 4FLYA 1JL2A 1QSYA 1RT1A 3QETA 3ZSWA 2HHXA 3BDPA 4OJRA 5FDLA 2OZMA 1RTDA 3V81A 3OYEA 3I8DA 3DRSA 4AHVA 4DTUA 3QEIA 2OYQA 3SQ2A 1NOYA 3QNNA 4CJTA 4CE9A 1REVA 3IS9A 4CHQA 3O4NA 4FZYA 3HYFA 1RT3A 1RCHA 1KVAA 1KSPA 1K6YA 3O3GA 1D9FA 4O55A 1VSMA 1JLQA 2XY6A 2B6AA 1U47A 4CFDA 4Z4EA 4E7JA 1S1XA 4CGJA 3P5JA 1TKDA 1A5VA 4DQIA 4DSKA 3VQDA 2E6LA 3AVBA 4DQQA 2NUBA 4DLGA 3ZSZA 2KZMA 3ULDA 1B92A 1EX4A 1S9GA 3M8QA 4MQ3A 4CHOA 1LW0A 3MEGA 3NGZA 1I39A 3IAYA 3H08A 4CECA 4OVLA 3MXIA 2XY8A 4FLTA 1HNVA 5T7BA 1RT5A 1TKXA 1NKBA 3DMJA 2HMIA 3VQPA 3S3MA 4KHUA 1BIZA 1RT7A 1S1TA 3NF9A 3VQBA 1TAUA 3DLHA 2G8WA 4F2SA 3LWMA 3AVJA 4DTPA 1RDDA 4CEEA 4F3OA 3SPZA 2HHTA 1YT3A 3DRPA 4BE0A 3I0SA 4M3ZA 3AVNA 1UAXA 1WAJA 3ALYA 3AV9A 4ID1A 3S3OA 1IKXA 2G8VA 3E01A 2WONA 3VA0A 3B6PA 4DWIA 1BI4A 5E41A 5I3UA 1T05A 1U49A 4FM2A 4N41A 2ITGA 3NGYA 2FBYA 4WE1A 2HNZA 4FJLA 4FJNA 3VQQA 4Y1DA 3OYAA 3LP0A 3L2WA 3G0ZA 4RW7A 4B8AB 3VQAA 4W5TA 3TARA 2FBTA 4GW6A 4Z4HA 4CEQA 1TGOA 2IDOA 4LY7A 4KHNA 4FJXA 4NCBA 3LAKA 1NKEA 3KD5E 2YKNA 3UIQA 1RDCA 1S6QA 4Z4FA 4CF1A 1WSGA 3VQ4A 1RDAA 3OYDA 2Z1IA 1BQNA 4KHWA 1WSIA 2KTQA 4CHYA 5I42A 4B9LA 4KREA 3IG1A 1KFDA 2GV9A 3LP1A 4DMNA 3ZSVA 3OYMA 3DLKA 1NK7A 1KFSA 4M3XA 4QCLA 4CHNA 3V9XA 3CM6A 4DF8A 4CJ5A 2PZSA 4MFBA 1VSEA 1CLQA 1WSJA 3HSTB 4Z0UA 1O1WA 3MECA 4FM1A 3WNEA 2ZE2A 3LP3A 4DLEA 3TI0A 4OLBA 3OYFA 2VG7A 4FXDA 1TK5A 3JSMA 3V1RA 4OPKA 3K5MA 4HVJA 4FK4A 3QEVA 4N47A 1NJZA 4ICLA 4EZ9A 3AA4A 4BWMA 4J2BA 3SV4A 1IKVA 3HPOA 4E7IA 4O4GA 3K5LA 4CIEA 5DMRA 3RMCA 3AA3A 1TL1A 5CYMA 3SJJA 2KW4A 4CFAA 4DTXA 3PO4A 3RRGA 4J2DA 2I5JA 1FKOA 4FJIA 3KIOA 2HHQA 1RILA 4H8KA 4B9NA 2IOCA 2QKKA 3PV8A 4IG0A 4CGIA 2BANA 4CJWA 4BDZA 3OYJA 2WOMA 3TAGA 1XHZA 4JS4A 1EKEA 2FC0A 3M8PA 1F21A 2G8HA 1LAVA 4I2QA 3LPTA 4DSEA 1KRPA 3EYZA 4FZZA 4KPYA 4EZ6A 4K8XA 2FBXA 2P5OA 4FYDA 4N56A 4KHQA 4OKEA 4M3UA 3NH1A 3TABA 4M3WA 3OS1A 1JLAA 4C8LA 2DY4A 1RT6A 1S1UA 4KTQA 2RF2A 3PX4A 2QXFA 5EU7A 2YHAA 5FRMA 1X9MA 3NFAA 4AHUA 2IGIA 5C25A 3O3HA 3HVRA 1HMVA 3TR8A 2IS3A 5CY4A 3ZT1A 5J2NA 3QEPA 1KCFA 4CF9A 4KHSA 4KI6A 1HYSA 1IKYA 4E89A 3S9HA 4KB0A 2Y1IA 3KK2A 4DU3A 2Y1JA 4E0DA 3DYAA 3KLIA 3SQ4A 1NK0A 3DI6A 3T19A 1I3AA 3C6TA 4CCHA 1C1CA 4IFVA 4BE1A 3AO5A 2G8UA 1SKRA 3DRRA 5KI6A 2G8KA 4DTJA 1JKHA 2HVIA 4I9QA 1CZBA 3K5OA 2XHBA 3NF6A 4G1QA 3CM5A 1JLFA 1QSSA 4R5PA 4O44A 3V4IA 1RT4A 3FFIA 1NOZA 2KFNA 4DU1A 2X74A 5CYQA 2YNGA 4QAGA 1ZYQA 4C8NA 4CERA 1L3VA 5KRTA 2JLEA 4F8RA 4DTOA 1Q9XA 2X6NA 4DSIA 4J2EA 1GOAA 2VWKA 5CZ2A 4L8RB 1X1PA 3OJUA 3L2QA 4DF4A 1JLEA 1SKWA 2DFEA 3HK2A 1VSKA 3ZSQA 3ZT2A 3SV3A 1BISA 4AHSA 3HP6A 2DFFA 4B9MA 1D5AA 1TK0A 1A5WA 4ZHRA 1NK9A 4CK1A 1DTTA 1XC9A 3HP9A 4FW2A 1VSLA 3PX6A 4HCCA 2HB5A 1J54A 1RNHA 4CK2A 3JYTA 4I2PA 5FRNA 4CJPA 1U04A 3AVCA 2YNIA 1VSFA 2ETJA 3PUFA 4N76A 2P51A 3M8RA 2G8FA 3EY1A 4OKKA 3AO3A 3VQ5A 4AHRA 4KFBA 2VWJA 4AH9A 3ZSXA 1XI1A 4FLUA 1ASVA 4N5SA 4BE2A 3HT3A 1TK8A 4FJGA 4HHTA 4XIUA 4CJ3A 1N5YA 2F8TA 1U4BA 4ID5A 5J2MA 1WSEA 2HHSA 1EP4A 1JL1A 1RBTA 2VG5A 4RW4A 1HJRA 3BGRA 4YFUA 2OZSA 1ZBUA 1VSDA 4AHCA 3L2RA 3QERA 4KTZA 4FJ8A 4FZXC 3VQCA 4FJHA 4W5NA 1J9AA 3VQ9A 3LZIA 4W5RA 5SWMA 1RBUA 3U3YA 3HVTA 3RMDA 4IKFA 1Z26A 4Z4GA 2XO7A 2PY5A 1YTAA 1RBSA 4JLHA 3ISNC 3WNFA 4KKOA 2RPIA 1G15A 4DTRA 4FCYA 1TKTA 5D3GA 3THVA 2QK9A 5KTQA 3CFRA 4OLAA 1ASWA 1JLBA 1T7PA 4Z4IA 4JS5A 1D8YA 1KLMA 4CHZA 4CF2A 1RBVA 4H4OA 5HLFA 4M3YA 2EX3A 3SPYA 3TAEA 3F73A 3C6UA 3V9UA 3QIOA 1ASUA 3KJVA 4CF0A 4BWJA 2X78A 2ATQA 3HO1A 1UA1A 1BL3A 3DOKA 3KKSA 1Q8IA 1IKWA 2GBZA 4DQPA 1N6QA 4HTUA 4C8OA 2ZQBA 4AILC 1CXUA 1ZBHA 3KLHA 3ZCMA 1QS4A 3A2FA 3CQ8A 4E7HA 4DS4A 3VN5A 1TL3A 3SUPA 4FW1A 1VSIA 4FVMA 4DSFA 4J2AA 3DLGA 3L3UA 4AHTA 4CEDA 3TWHA 2IC3A 4RW8A 4EP4A 2FBVA 2YHBA 4CJKA 3NAEA 1ZBIA 4F4KA 2QKBA 3HJFA 2A1RA 4CJFA 1RT2A 4LSLA 1NK8A 3L8BA 2G8IA 3I0RA 3RR7A 5JS1A 1VRTA 1HYVA 3IRXA 3OYKA 5HP1A 3NH2A 2D0AA 2YKMA 1XHXA 1UA0A 1NK5A 2YNFA 2D0BA 3VQ7A 1L3SA 2PYLA 4I9LA 4JRQA 2B5JA 3DLRA 4F2RA 2Q3SA 1CXQA 3RTVA 1DTQA 4W5OA 4OKJA 4JRPA 4DTNA 4M41A 4BDYA 1QSLA 4PQUA 1WLJA 3QEWA 2GUIA 2YNHA 3ZSYA 4TSXA 3OVNA 4RW9A 4CJEA 5J1EA 4DQSA 1T03A 1C0UA 3OYLA 3AO2A 2R7YA 4CEOA 3HPHA 1S6PA 1ZBLA 4LD0A 4IFYA 3MEDA 3CFPA 3SUNA 1EXQA 2X6SA 3NF7A 4CEFA 1RTHA 1NK6A 1Q9YA 4O5BA 3S3NA 3P83D 4QOZB 3V9SA 4CJQA 4CEAA 4B3OA 1RBRA 2OPRA 2HNDA 3AO1A 1EETA 4OPJA 5J2QA 5KGXA 2AJQA 4M3RA 3U6FA 2F8SA 3F9KA 3NBPA 3RRHA 1S9EA 2DFHA 1S1WA 3SNNA 1BIUA 3ZSRA 3CYMA 5HRPA 2Z1JA 3L2VA 1SL2A 1TKZA 5JS2A 4PY5A 1W0HA 1IO2A 1W9HA 4IG3A 4O0JA 4EP5A 1XWLA 4E7KA 4E1NA 4O0IA 4BACA 1QQCA 2OPPA 3AVKA 1U48A 4IBNA 2EHGA 3NHGA 2HW3A 4CF8A 4M42A 2O4GA 1C1BA 3LANA 1WNSA 1KVCA 1RTIA 1VK0A 5HRNA 4I7FA 3NE6A 2XY5A 4KRFA 3OS2A 1NJWA 3NH0A 3ASMA 4GVMA 4PA1A 2E6MA 3MXJA 1NJXA 4B9UA 4ELTA 4ZTFA 3VQEA 3ZT0A 4CJRA 1X9SA 5HRRA 4KB1A 1A5XA 5J2PA 4Q0BA 1LWFA 4E19A 2P1JA 1VRUA 3KK3A 4FLZA 4FJJA
chains in the Genus database with same CATH superfamily
1B9DA 3OYBA 1YTUA 3G10A 1WAFA 4XEIA 4HUFA 4CD3A 3UE5A 1NNEA 3O3FA 4O8UA 4BC5A 2VG6A 3O9RA 2YX6A 2KLAA 5FROA 2XRIA 3I55N 1QZ6A 4RW6A 2P9SB 4NXNK 3KLFA 2F9WA 5AZIA 3CETA 3H45C 4DTMA 2A6AA 4FL9A 3LPUA 4FM0A 1L3UA 4KV8A 3D0PA 1KAXA 4FJ9A 2YCHA 1B9FA 4H4MA 4E3SA 2BH1A 3AO4A 4YHHK 3VGKA 4CJUA 4UQGA 3CJ9A 3LDSA 1BHLA 1TUUA 4WFAL 3THXA 3V6DA 3KWIA 1L5UA 4FLWA 1BI4B 2HF4A 1HPZA 3MWPA 2ASPA 1M90O 1KTQA 2IVOA 3DLEA 5AQOA 3BZCA 3O4QA 1QVFM 4XH5A 3VF4A 3KD1E 4CESA 2OPSA 1C1AA 4B08A 4FLXA 1S72N 2CH5A 3OYHA 3SQ0A 3J8AA 2P9NB 4WQ4C 2W42A 4JI3K 3QLHA 5AFUA 3PO5A 1TV6A 4YY3K 2W6LA 4KH6A 4BRCA 3OJSA 1BG3A 3QBWA 3R8EA 1IG9A 4KHPK 1O13A 4FVUA 2BUPA 1VHXA 2GEMA 4DQRA 4FWOA 3T1AA 4NCAA 2KZZA 1C0GA 4O8KA 4B1YB 1FXXA 3VGMA 4KAZA 3NCIA 1VQ9N 1J6ZA 3VEVA 1LOTB 4CFCA 4CEZA 3SUOA 3CCLN 3SAHA 3UKRA 5GIPA 1LAWA 2O8BB 2QA4N 1BUPA 1NGFA 2B4JA 2Z1GA 4JI2K 1BO5O 1NK4A 4DFPA 3HXMA 3BY5A 2E4LA 4HUEA 4PWDA 2O8DB 4FPAA 1X9JA 4BC2A 2FF6A 3L4IA 4E1MA 1K8AO 2NRVA 3SLCA 3TAQA 4B8CA 4IDKA 4FLYA 1RT1A 4FWMA 5FDLA 2Q97A 3L6QA 3V81A 2IVPA 3DRSA 3QEIA 2OYQA 5F0XA 4CE9A 3IS9A 3O4NA 4IJNA 3HYFA 3O08A 1JJ2M 3FZFA 4K25A 1D9FA 3B8AX 4CI6A 2W41A 3P5JA 1TKDA 1A5VA 3AVBA 4DLGA 2QWMA 3IAYA 3H08A 3SJHA 1TKXA 3VQBA 2G8WA 5IWAK 5KPRA 1RDUA 2QTDA 1RDDA 4BVOA 3SPZA 2HHTA 2ASOA 1WAJA 2P9PB 3N4QA 3S3OA 4PL7A 4IOCL 3B6PA 1GLFO 3ATUA 4H0PA 4DR2K 4R79A 4WE1A 4WFBL 3VQQA 3PSFA 3VQAA 3TARA 2FBTA 3G71N 4CEQA 3CQYA 2IDOA 4FJXA 3KD5E 2WUSA 3CJ7A 3F2KA 4PKHA 1YIJN 1WSGA 3VQ4A 1HLUA 4B1ZA 1WSIA 4CHYA 2GV9A 3ZSVA 3ENBA 1KFSA 3Q7CA 1SS6A 3CM6A 4DF8A 1HPMA 1WSJA 4FM1A 3WNEA 4B1WB 4DLEA 3JSMA 4OPKA 3K5MA 2OTJN 3SV4A 1TUYA 1IBLK 4AF1A 4O4GA 3T69A 4DR1K 1U2VB 4H5WA 2P9LA 2RE2A 3AA3A 4IEIA 1FKOA 1RILA 4B9NA 2QKKA 4IG0A 4BDZA 3TAGA 1XQSC 3LM2A 3M8PA 1F21A 4I2QA 3LPTA 5KPTA 4BR7A 2FBXA 2E1YA 2HF3A 4YOTA 3NH1A 3MMVA 3TABA 1JLAA 4BC4A 3IMXA 2YJFA 1S1UA 3VTIA 3J80O 1K8KA 5FRMA 1X9MA 5JVGL 1YVNA 3LDLA 3QEPA 3O3HA 1HMVA 4JKFA 5J2NA 4KHSA 1HYSA 5ADXH 2V52B 5CE3A 3DYAA 3T19A 4CCHA 1I3AA 2OANA 3C6TA 3QDKA 5BPLA 4BE1A 3AO5A 2G8UA 1SKRA 1CZBA 3P4IA 3NF6A 4G1QA 3EZWA 4YOVA 3V4IA 4O44A 1QSSA 2KFNA 2E20A 4CERA 5KRTA 3ULEB 2FSJA 4ILJA 4F8RA 4L8RB 2X6NA 3ZEUB 4DF4A 1JLEA 3HK2A 1VSKA 4LF5K 3D2EA 4AHSA 4PL8A 2DFFA 4B9MA 1TK0A 4K41A 4ZHRA 1NK9A 2YJEA 4CK1A 4A59A 1XC9A 3HP9A 3WEEA 1VQMN 4I2PA 4N76A 4IXCA 2YNIA 3PUFA 2Q2RA 1ATRA 4OKKA 3VQ5A 4GKJK 4AH9A 4B3MK 3HI0A 4CJ3A 1HR0K 1WSEA 1RBTA 2P9KB 5AQMA 5LMUK 1VSDA 4AHCA 3WXKA 4FZXC 3RMDA 5C0YA 5AQRA 3FZHA 2Q31A 2RPIA 1TKTA 2Q36A 2QK9A 3CFRA 1ASWA 1JLBA 4Z4IA 1H1VA 3D2FB 4LFCK 2EX3A 3TAEA 5AQKA 3F73A 4G9ZA 3HZ6A 3V9UA 1OH6A 1ASUA 1JCFA 2NRWA 3KJVA 1OVQA 4BWJA 1NGDA 1BL3A 2GBZA 1KAZA 2ZQBA 5BRHA 3KLHA 2QEXN 1HJOA 3ZCMA 3A2FA 1EWQA 4B3SK 3O8MA 3SUPA 2HBMA 4FVMA 3G6EN 3DLGA 3L3UA 4CBXA 1YI2N 2J4RA 4JAXA 2YHBA 4GV9A 3OA9A 4JI6K 1NM1A 3HJFA 4LSLA 3L8BA 5KQ8A 5JS1A 5GAEP 3OYKA 5HP1A 3CCRN 1NK5A 2UYTA 2YNFA 2D0BA 3VQ7A 2E2OA 4M7XA 3WXMB 2A40A 4B9QA 2Q3SA 3RVCA 4BQZA 4YORA 4M41A 2YNHA 4DQSA 4FWKA 1T03A 3OYLA 2R7YA 3AO2A 4BC3A 4CEOA 4JD2A 4LD0A 1EXQA 1HNZK 4YOYA 4CEFA 1RTHA 1NK6A 1Q9YA 4DR3K 3V9SA 4CEAA 4B3OA 2KKZA 3H3NO 3CMAN 5J2QA 5KGXA 1ATNA 1HKGA 4M3RA 1NGIA 3A5MC 3RRHA 4MLHA 2QWRA 1NMDA 5JS2A 4PY5A 1W0HA 3C7NA 4EP5A 3CJBA 3FZMA 4K0KK 4BRIA 4E1NA 5F1XA 2HW3A 4QS7A 3EL2A 4NO7A 1C1BA 3K0SA 1RTIA 4AQYK 3NE6A 2XY5A 4JI0K 1NJWA 4ZTFA 3VQEA 4KB1A 1A5XA 2PFUA 2I7NA 3GOIA 5FPNA 5AQLA 4DFJA 1D4XA 3L2UA 3ZT4A 2D5RA 3CG7A 1DLOA 3VETA 5JICA 2AA4A 4IDHA 1XC3A 4JKAA 4CD1A 1ESVA 4IOAL 3AVLA 1HNIA 3E9OA 1NLVA 3MEEA 3B6OA 2HHWA 1DEJA 5C12A 1OH8A 3V1QA 3QFUA 5JVHL 1ITGA 1QHTA 1HYZA 4QS9A 1W2BM 3AA2A 4HTLA 3WNHA 5AJ3K 4DR7K 3K57A 2GX9A 3V9WA 1NKCA 4U67L 1U45A 1D9DA 4O5FA 3OYGA 2BGGA 5JLHA 4HUGA 1T3VA 2OA8A 2O8FA 2A1SA 4C8MA 3D6RA 5HRSA 4JKDA 4BR0A 2P5GA 1DKGD 4CIFA 2O8CA 1GLBG 1SV5A 1VSHA 3NMUA 3TAFA 2HHUA 2P9UA 4E1JA 1NG9A 5HBMA 5KRSA 1RTJA 3QNOA 4BRMA 3PY8A 4W5QA 3MDQA 4ISGA 3T1HK 3ITHA 4DR6K 1RDBA 4DV7K 3SYZA 4CHPA 4CEBA 1GOBA 4DQ8A 4OGEA 3FGUA 3VEZA 1MU2A 3MXMA 3WNGA 3KKRA 1HQEA 4CGFA 5B8HA 1NU0A 3TANA 1MDUB 5AQGA 3JAMO 3QO9A 3E9LA 3MX2A 4JK9A 2KFZA 1HQUA 4JHDA 5C42A 2YI1A 2YV0X 3CJAA 3OY9A 1KVBA 2IAJA 4CGDA 1CZ9A 3U9ZA 3KVGA 4BGBA 4DV2K 1QE1A 1IH7A 3RR8A 2YHXA 4M3TA 1T6DA 1X9WA 1UOCA 3OTOK 3OYCA 3THYB 4CJSA 3EE9A 5SZTA 4CW7B 2JWKA 3VTHA 1OKJA 1LCUA 5FPEA 5DM6L 4PUOA 4BDPA 4YNQA 5BPMA 4H0XB 3VPZA 3OW2M 3HL8A 4F3TA 3AARA 1JLCA 5HROA 4HCBA 2GTDA 1JL2A 4BR9A 3BDPA 1YJ9N 3OYEA 2UXCK 1HKCA 3R9PA 4AHVA 4CZKA 1N32K 3SQ2A 1NOYA 1T44A 3LDPA 4CHQA 4FZYA 1X3NA 1K6YA 1N34K 2E1ZA 2WBNA 1WOQA 1JLQA 2XY6A 2GWJA 5H1SQ 2P9SA 5E26A 1I94K 5FPDA 1GLAG 4Z4EA 4DSKA 3THWB 2KZMA 3ZSZA 3ULDA 1B92A 4XH4A 4NB4A 1LW0A 4BG9A 1YF5L 3T7ZA 2HHHK 2XY8A 4FLTA 3CF5L 4JI4K 1NKBA 3N4PA 1BIZA 2D0PA 2V51B 5AQZA 1VQ4N 3AVJA 4DTPA 4CEEA 3P31A 1VAZA 4BE0A 3I0SA 3ALYA 3AV9A 4ID1A 5AZIB 1IKXA 2G8VA 3E01A 4WCEL 3MN6A 5C2DA 2PAVA 1BI4A 1T05A 4OX9K 4FM2A 1NGCA 4FJNA 2HNZA 1KC8O 3LL3A 3OYAA 1GLEG 4BRFA 4JK8A 4NXMK 3F5TA 1VQ8N 1BA0A 1S3XA 5BRDA 1NKEA 3WXLA 4CJ7A 1S6QA 4EHUA 4BRDA 5AQNA 2Z1IA 4KHWA 3KWGA 4IJAA 2KTQA 4B9LA 2P9IB 3THXB 4KREA 1KFDA 3LP1A 4DMNA 3OYMA 4JKBA 4CHNA 4CJ5A 1VSEA 3JXUA 3IDHA 1NGJA 3TTDA 3LP3A 1S22A 4PKGA 5FLXO 1TK5A 1NJZA 3AA4A 4MLEA 3CCSN 3K5LA 2ZM6K 2V7YA 3A5OC 4J2DA 2I5JA 3H1QA 3VF6A 3PV8A 5FPMA 1T6CA 1EKEA 4JKCA 2UXDK 2NRXA 2AP1A 1LAVA 3A8YA 3HSCA 1C0FA 4DSEA 1KRPA 3EYZA 4FZZA 5AFUH 4K8XA 2O8DA 5BN9A 4KHQA 4M3UA 3AAQA 5LJVA 1RT6A 2NRTA 3HTVA 4LF6K 2VGNA 2QXFA 2YHAA 3I56N 2FSNA 3NFAA 3TSQA 5C25A 3TR8A 3UKRB 3CJ1A 3ZT1A 5C2FA 4DV1K 3VOVA 1IKYA 4B1UB 4BG8A 4E89A 4KB0A 4DU3A 1NK0A 4BRQA 3VEXA 5IT9O 3DRRA 5KI6A 2G8KA 3CMEN 4DTJA 2HVIA 1E4FT 4I9QA 2W40A 2XHBA 1VQNN 5GINA 3CM5A 2CGKA 4R5PA 1RT4A 4L3QA 5CHIA 4DU1A 2X74A 3CD6N 2D4WA 2YNGA 4DTOA 4J2EA 5CZ2A 1XMOK 3M3ZA 2DFEA 2Q0RA 3ZSQA 4K42A 5CR4A 3HP6A 3BP8A 1D5AA 5AQTA 4WYBA 1MA9B 3DAWA 3O6WA 1WBDA 3CCUN 4JYAK 3AVCA 1VSFA 3ZX0A 2QXLA 2P51A 2P9PA 1NGEA 5EVZA 3AO3A 3CCJN 2VWJA 4FLUA 1ASVA 3TSUA 3ZETA 4BE2A 4FJGA 1N5YA 4XIUA 3PSIA 1RFQA 2HHSA 1EP4A 1JL1A 4BRPA 4RCHA 2FLOA 4WF9L 2E2NA 4FWLA 1HJRA 4CBUA 4GKKK 4GY2B 3L2RA 3CCVN 2HBKA 5AQHA 5SWMA 1RBUA 1QVGM 3HVTA 4V19S 4Z4GA 2XO7A 1SAZA 3IKMA 2GWKA 4KKOA 2ZGYA 5D3GA 3THVA 5AQPA 1T7PA 4WQ5A 3C0BA 4CF2A 1RBVA 3IFRA 3C6UA 2ITMA 2BTFA 2ATQA 3EKSA 4KH4A 2ZJRL 1UA1A 1IKWA 4B3RK 4A62A 4HTUA 1N6QA 4A57A 1QS4A 3HOSA 4E7HA 1KQSM 5TKWA 1TL3A 5C15A 1VSIA 4DSFA 3SAFA 4AHTA 5MLCQ 4H0VB 1TYQB 4F4KA 1RT2A 2G8IA 2HSTA 3RR7A 1VRTA 3IRXA 3CI5A 1UA0A 2YKMA 1XHXA 3EN9A 4J8FA 1Q7YO 1Q81O 4GVEA 4F2RA 1EO1A 1CXQA 5F2RA 1BDGA 4A2AA 4PQUA 1U6ZA 1WLJA 3QEWA 4CJEA 5AQJA 5J1EA 3OVNA 4JI8K 3MCPA 3SAGA 1VQ5N 1GLLO 3P38A 3CFPA 3K9JA 1QZ5A 4CJQA 1RBRA 3AO1A 1EETA 4OPJA 2F9TA 4DR4K 3QMLA 2AJQA 3U6FA 2F8SA 1S9EA 2DFHA 1S1WA 3ZSRA 4OPAA 3DXKB 1SL2A 1TKZA 4IG3A 4O0JA 4LF8K 4E7KA 4O0IA 5JLFA 2QWQA 2ZGZA 4IBNA 1U48A 2Q1NA 4M42A 3CCQN 2O4GA 1KVCA 1VK0A 5HRNA 1K8KB 2FXUA 3RSEB 3NH0A 4B9UA 4ELTA 3I33A 3WQUA 4CJRA 4MO5A 5J2PA 3NVKA 4X62K 1OVYA 4E19A 2X6SA 3KK3A 1W97L 4NYNA 4KI4A 2HNYA 4DFMA 4NYFA 2OTLN 1YUWA 1UWBA 4BVPA 1KAYA 4DV0K 3LWLA 1K9MO 3MN9A 1YJNN 2HHVA 4KO0A 4Y1CA 2A41A 4XH1A 5AZJB 3OYNA 3VEYA 3KLEA 2P9KA 3ZT3A 5DK5A 5BRFA 3HRGA 3K58A 2JGUA 4YDUA 4DSJA 4JI5K 3VQ8A 3QESA 2BE2A 1KD1O 3AVMA 4CJLA 4B9TA 5GAGP 4YOWA 1ZC6A 3A0IX 3KLGA 4CIGA 2NLXA 1IBMK 2KHOA 3TAPA 1KLNA 1ZBFA 1Q86O 3NVMA 1QTMA 1GLJO 1V4SA 3DXMB 3P1GA 3DM2A 1C0TA 3KK1A 4CZGA 4C8KA 2WTUA 3DOLA 1SL1A 5EOYA 3AVHA 1ILYA 3K2PA 4FK2A 1WN7A 1C6VA 4FJKA 1T8EA 4GMJB 4B9SA 4FJMA 1N8RO 1S5JA 3ZYYX 1J53A 4FWSA 2UUBK 4DS5A 1C0MA 2D0CA 2KQ2A 3V9ZA 3ZX2A 3K59A 3H46O 1NGAA 4CJ4A 1YVUA 1SL0A 3BF3A 4ELVA 3NGIA 3AVIA 1SKSA 3U3GA 4FJ7A 1LWCA 4H0TB 3ZSOA 1JXBA 2ZF5O 4CFBA 3KTQA 3O80A 2E2PA 1GOCA 1S1VA 4H0OA 4LSNA 1QQNA 3PX0A 3KHYA 3AVFA 3LP2A 5A2QO 3AA5X 1LWEA 2QM1A 4DTSA 4DSLA 3AVAA 3V1OA 4Z4CA 4Q5VA 3QETA 3ZSWA 2PBDA 4OJRA 2OZMA 3WUHA 5AQIA 3I8DA 3UKUB 3QNNA 1REVA 1RCHA 1KVAA 2QWPA 3O3GA 1NWKA 3C7NB 1DT9A 4KBOA 3TTCA 1U47A 3DJCA 1E3MA 4WQ4A 1N33K 4E7JA 4CGJA 2UU9K 5LY3A 4DV5K 3VQDA 2E6LA 2NUBA 1Y64A 4CHOA 3M8QA 2E5LK 3MEGA 3NGZA 1M1KO 4CECA 3GL1A 1QQOA 4OVLA 1BOTO 3MXIA 1HNXK 1HKBA 1RT5A 3E1YA 3DMJA 2HMIA 3VQPA 3S3MA 4KHUA 1RT7A 1S1TA 1TAUA 3VEOA 3DLHA 3MX5A 3WQTA 3LWMA 3GE1A 4M3ZA 3FR0A 1YHQN 2WONA 4FWQA 4JKEA 1VQ6N 1RDWX 4DWIA 5E41A 4HWIA 3BF1A 4JEPA 3TTFA 1JCEA 2A42A 4FJLA 3G0ZA 4RW7A 3G4SN 4B8AB 4JKGA 4GW6A 4Z4HA 4AM7A 4LY7A 4KHNA 3L0QA 1RDCA 3OYDA 1BQNA 4DUZK 3IG1A 4X66K 2O8FB 1NK7A 4M3XA 5GADP 1XMQK 4DHYA 4QCLA 2PZSA 4Z0UA 3MECA 3ATVA 2O8CB 3TI0A 3V1RA 3JS6A 4HVJA 3VERA 4N47A 3QEVA 1ZBSA 4ICLA 4EZ9A 4J2BA 2O8EA 1IKVA 3HPOA 1YJWN 4CIEA 1BA1A 5DMRA 3PO4A 5CYMA 3SJJA 3RRGA 4DTXA 4CFAA 1VQ7N 3MN5A 4I6MB 5TKYA 2HHQA 4H8KA 2IOCA 1DGKN 2BANA 4CJWA 3THYA 2WOMA 2FC0A 4M7YA 4MO4A 4EZ6A 4JI7K 4BRHA 4NLCA 4N56A 3O4WA 4OKEA 4M3WA 3OS1A 1FJGK 4A2BA 4C8LA 2DY4A 5AQVA 3CJCA 5M1OA 2RF2A 4PKIA 4JKHA 3J81O 4LF9K 2WFBA 4AHUA 2IGIA 3HVRA 5BN8A 1SQKA 1U4BA 2IS3A 5CY4A 4OO1J 3HOTA 1KCFA 4CF9A 4KI6A 3SK3A 3HBTA 3S9HA 3KK2A 2Y1JA 3KLIA 3SQ4A 3DI6A 1C1CA 1QHAA 3FFIA 3W3DA 2VCPA 1SZ2A 5CYQA 3THWA 4QAGA 1ZYQA 1NMNA 2JLEA 5KQDA 3TPQA 4DSIA 1GOAA 2VWKA 4CVNE 1X1PA 3ENOA 3CERA 1YXQA 1SKWA 1WB9A 3ZT2A 3LDNA 1BISA 3I8BA 5BR9A 3VMFB 4FW2A 5LL6Z 2ZJQL 1N36K 5HL7L 3PX6A 4MDAA 2HB5A 1J54A 1RNHA 4CK2A 3SMSA 3GG4A 4CJPA 1U04A 1Q18A 3M8RA 4AHRA 1WUAA 4KFBA 3OHRA 1XI1A 4H5NA 2ASMA 3VEWA 2NNWA 4N5SA 1TK8A 2F8TA 4DR5K 2ZJPL 1G99A 3HM8A 4RW4A 3LDQA 3QFPA 3K9KA 2OZSA 3S41A 3LM9A 3QERA 4KTZA 4W5NA 3VQCA 3LZIA 3U4LA 1IG8A 3MCAB 1Z26A 1Q82O 4UY8O 2NRRA 1YTAA 4RTFD 4JLHA 4BR4A 4CZEA 1G15A 3EEQA 4FCYA 3CPWM 2P9IA 2D1KA 2P9NA 3FFKB 4OLAA 1GLDG 4JS5A 3PIOL 1D8YA 5JMVA 4BY9C 4A5AA 3A5NC 3QIOA 4CF0A 3C65A 3U8XA 3J7ZO 3HO1A 1Q8IA 4DQPA 2HBJA 4C8OA 4AILC 2HBLA 2D0OA 4BREA 4DCHA 4FW1A 4J2AA 4DV6K 1VQLN 4CEDA 3TWHA 4RW8A 4MDBA 4CJKA 1ZBIA 1Z6RA 1IJJA 2A1RA 3H1VX 3I0RA 2O8BA 1HYVA 3PLAA 3O1BA 2D0AA 1L3SA 2PYLA 2B5JA 3CPEA 4W5OA 4OKJA 4IWVA 2F7TA 5DM7L 4TSXA 3O9UA 1C0UA 3IUCA 3HPHA 3ID6A 1S6PA 1ZBLA 1E4GT 3MEDA 3SUNA 4BRGA 2QWLA 4O5BA 3S3NA 3P83D 4QOZB 1NGHA 2Q0UA 2HNDA 3AGKA 2WC9A 3Q7BA 5AR0A 4EAHD 4EIAA 4M63C 3EO3A 5BPNA 3BUZB 3SNNA 4C1NI 1ATSA 5HRPA 3L2VA 1X3MA 4LF4K 3QICA 1IO2A 5HOOA 1XWLA 4BACA 1QQCA 3AVKA 3WXIA 2EHGA 1R59O 3KZBA 3NHGA 4A5BA 3LANA 3OBYA 1WNSA 1W7AA 4KRFA 4JK7A 4H5TA 2QW9A 1NJXA 4X64K 4YOXA 2P1JA 1VSLA 1WSHA 1VRUA 4CZHA 4FJJA 1FKPA 1HRHA 5BREA 3J7YP 1BGXT 1LV5A 4CJVA 1R0AA 4IO9L 3OS0A 3SZ2A 4DFKA 2ZWHA 5CZ1A 3CCEN 3AAPA 1Y97A 1NJYA 2A3ZA 4DV4K 4ZTJA 4EHTA 1BQMA 3M6GA 2UXBK 1TAQA 3H3OB 3L4QA 4IOXA 1FK9A 3NF8A 3RWUA 3LALA 4H03B 3HPGA 2BDPA 3AVGA 3K5NA 1J5EK 1RGIA 4FPBA 1WSFA 4FJ5A 3FLCO 4BRAA 3D7EO 3NDKA 3SI6A 3C94A 4LH5A 4Y0WA 2ZD1A 1SUQA 3HM9A 4FLVA 1HX1A 2JWLA 1VQPN 1OH5A 3T1YK 3D45A 3SQ1A 5KGWA 4CBWA 4ELUA 4BR5A 2RKIA 3SMPA 4RG8A 1VSJA 4LH4A 4Z94A 3ZETB 4B3TK 3O9QA 2PYJA 1XNRK 2DTUA 3TAMA 3SUQA 4NCGA 1WBBA 2RHKA 4LFAK 1TVRA 4E7LA 4FWNA 1BCMA 1BWFO 3ENHA 3EZ5A 2VYPA 2HOEA 2CGLA 1FW6A 4NCBA 3LZJA 1P8ZA 3TU5A 1L3TA 3T3FA 1U2VA 3RMAA 2OPQA 1TYQA 2E88A 4CZFA 3E9PA 4KHYA 2IIRA 4IFEA 2F96A 3QIPA 3VQ6A 5C24A 1Z25A 2O4IA 2Z1HA 5K14A 3L3VA 4A61A 3C95A 4QS8A 4BRLA 4B1XB 4CK3A 1JLGA 3CFOA 3CXCM 3M8SA 2VGMA 4IO8A 4B9VA 1BCOA 4U7BA 3VF2A 4DG1A 3O1WA 3DWLA 2LSNA 2HVHA 3DLBA 5ADXA 3QEXA 3WT0A 4FK0A 2P9LB 3VA3A 4CGHA 2UUAK 4M45A 3CC7N 4CZIA 2V7ZA 4CZLA 2GUPA 1XNQK 2XY7A 3MAQA 1V4TA 4ISFA 3SCXA 3RMBA 4CGGA 3TSPA 3OYIA 3DXKA 3PIPL 3QINA 1LW2A 1J5OA 5C10A 4DU4A 1VQON 4OGCA 4K8ZA 3LAMA 2RN2A 3ULEA 4KTWA 3RSEA 1JXEA 2A5XA 1QSYA 2HHXA 5E84A 3ZEUA 1RTDA 1EQYA 4DTUA 2DPNA 4CJTA 4H0YB 1YITN 2QI2A 4FO0A 4EFHA 1RT3A 5AQWA 4BQLA 1KSPA 1KXPA 4B1VA 4O55A 4OPHA 1VSMA 2B6AA 3O9TA 3CIPA 4CFDA 1S1XA 3P39A 1NGGA 4DQIA 4DQQA 4PHTX 1EX4A 1MWKA 1S9GA 4MQ3A 5AZJA 4GV3A 4AM6A 2CGJA 3VESA 3QBXA 1I39A 3MWTA 1HNVA 5T7BA 3D2EB 2I7PA 3NF9A 2YHYA 4F2SA 2YHWA 4F3OA 3WEEB 1YT3A 3DRPA 3FE1A 4BGAA 5GAHP 5AQUA 3AVNA 1UAXA 4GNIA 5AQXA 3VA0A 3D2FA 3W0LA 3DXMA 4H5VA 4YOUA 5I3UA 1U49A 3QB0A 4N41A 2ITGA 3NGYA 2FBYA 2VQFK 4Y1DA 3L2WA 3LP0A 3CC2N 3VENA 4W5TA 3CQXA 3KK7A 1YAGA 1TGOA 3LAKA 2YKNA 3UIQA 4RWTA 4C1NK 4Z4FA 1QQMA 4CF1A 1MWMA 5KPZA 1RDAA 3AY9A 5I42A 3FZKA 4H5RA 3DLKA 3V9XA 1NGBA 4MFBA 1CLQA 3HSTB 1O1WA 5I9EB 3GDQA 2ZE2A 5M1NA 4OLBA 2NZTA 3OYFA 2VG7A 4FXDA 4CZMA 4FK4A 5EY4A 1NJIO 4BWMA 4F9OA 4E7IA 3ZLJA 3RMCA 2FF3B 1TL1A 2KW4A 4LC9B 1NBWA 2FSKA 3R6MA 4FJIA 3H6EA 3KIOA 4CGIA 4CZJA 5M1KA 3BEXA 3OYJA 3OBWA 1XHZA 4JS4A 3O9SA 3AGRA 2G8HA 2H3GX 4DKWA 4IZ9A 4KPYA 4DV3K 4ILGB 2P5OA 3C6AA 1Z05A 2OCEA 3E66A 4KH5A 4FYDA 1K73O 1GLCG 4KTQA 2GELA 4FSVA 3PX4A 5EU7A 4FOEA 4JD2B 4FWRA 3UKUA 3M5RA 4WQ5C 5M1FA 2Y1IA 4E0DA 4JNEA 4LF7K 4IFVA 4BRNA 1JKHA 2VQEK 2NRZA 5AQYA 3K5OA 1XUPO 1JLFA 5ELZA 3A5LC 1NOZA 3LDOA 4JV5K 4C8NA 1L3VA 1Q9XA 2F4VK 3L2QA 2E8AA 3OJUA 2NRHA 4ISEA 3SBTA 3GBTA 3SV3A 1IBKK 2IVNA 1A5WA 1DTTA 3VGLA 4HCCA 3JYTA 5FRNA 2ETJA 2G8FA 3EY1A 3ZSXA 4K43A 3HT3A 4HHTA 4ID5A 3CHWA 5J2MA 2VG5A 4FOIA 4JN4A 3BGRA 4YFUA 1ZBUA 4FJ8A 3U9DA 4FJHA 3SBGA 2HMPA 1J9AA 3VQ9A 4W5RA 3U3YA 4IKFA 1JCGA 3G25A 2PY5A 1RBSA 4FWPA 3ISNC 2UUCK 3WNFA 4C23A 4ILHA 4DTRA 3J7AP 3ZX3A 3MN7A 5KTQA 4NLBA 1KLMA 4CHZA 4H4OA 5HLFA 4M3YA 3SPYA 2QWNA 1CZAN 4DUYK 3R3LA 2X78A 3FZLA 3DOKA 3KKSA 2E2QA 5EX5A 3CC4N 4JKGB 1CXUA 1P90A 1ZBHA 1EWRA 5AQSA 3CQ8A 4DS4A 3VN5A 2P9UB 4BRKA 2W6KA 3R1XA 5AQFA 5GIOA 2IC3A 4WFNL 4EP4A 2FBVA 4X65K 3NAEA 4I6MA 4IEEA 2QKBA 4CJFA 4LFBK 3BZKA 1HUXA 1NK8A 4GV6A 2CH6A 3NH2A 5EXWA 4I9LA 4JRQA 3DLRA 3RTVA 1DTQA 4DTNA 4JRPA 4BDYA 4YDUC 1QSLA 2GUIA 2O8EB 3ZSYA 5M1PA 4RW9A 3DLLL 1ZXOA 5LMNK 4JI1K 4JHDB 4BR2A 4IFYA 3NF7A 3M1FA 2EWSA 2OPRA 3C6HA 4DB3A 3EE8A 3F9KA 3NBPA 1BIUA 1IV0A 3UB5A 3CYMA 2Z1JA 3CCMN 1W9HA 2QWOA 4BROA 2OPPA 5BR8K 4CF8A 1VQKN 3MK6A 4I7FA 1OH7A 3OS2A 1BU6O 3ASMA 4GVMA 4PA1A 2E6MA 3MXJA 3WXJA 3O5BA 3ZT0A 1X9SA 2VWBA 5HRRA 3ID8A 3F9MA 4Q0BA 1HNWK 1LWFA 4FLZA 5AQQA 3EKUA 5M1QA 5LJWA
chains in the Genus database with same CATH topology
1B9DA 1FKPA 4NYNA 1HRHA 3OYBA 4KI4A 1BGXT 1WAFA 2HNYA 3G10A 4HUFA 4DFJA 1LV5A 1YTUA 4CJVA 3L2UA 3ZT4A 4NYFA 4DFMA 3O3FA 2D5RA 1R0AA 2VG6A 1UWBA 3CG7A 1DLOA 3OS0A 3SZ2A 4DFKA 5FROA 2XRIA 5CZ1A 3LWLA 1Y97A 1NJYA 4RW6A 2HHVA 4ZTJA 4KO0A 1BQMA 3KLFA 1TAQA 1FK9A 3NF8A 4Y1CA 4DTMA 3RWUA 3LALA 3LPUA 3AVLA 3OYNA 1HNIA 3HPGA 4FM0A 2BDPA 3MEEA 3AVGA 1L3UA 3B6OA 2HHWA 4KV8A 3K5NA 3D0PA 3KLEA 3K58A 3ZT3A 5DK5A 3V1QA 2JGUA 1WSFA 4FJ5A 4DSJA 1ITGA 4FJ9A 1QHTA 3VQ8A 1HYZA 3NDKA 3C94A 3QESA 4LH5A 1B9FA 2BE2A 3SI6A 4H4MA 3AVMA 4CJLA 3AA2A 3WNHA 4B9TA 2ZD1A 4E3SA 1SUQA 3HM9A 3K57A 3AO4A 4FLVA 3V9WA 1NKCA 4CJUA 3KLGA 1U45A 1D9DA 4UQGA 4CIGA 3LDSA 1BHLA 3D45A 3SQ1A 5KGWA 1KLNA 3TAPA 3OYGA 2BGGA 4ELUA 1ZBFA 2RKIA 4RG8A 1VSJA 3V6DA 4HUGA 4LH4A 1QTMA 1L5UA 2OA8A 4FLWA 2A1SA 4C8MA 1BI4B 1HPZA 3P1GA 5HRSA 3DM2A 2PYJA 1C0TA 3KK1A 2P5GA 1KTQA 2DTUA 3TAMA 4C8KA 3SUQA 3DLEA 3DOLA 1SL1A 4CIFA 4NCGA 1TVRA 4E7LA 3O4QA 1BCMA 1SV5A 1VSHA 3EZ5A 3KD1E 4CESA 2OPSA 1C1AA 3TAFA 2HHUA 3AVHA 4B08A 3K2PA 4FK2A 1WN7A 4FLXA 5HBMA 5KRSA 1RTJA 3LZJA 1C6VA 3OYHA 3QNOA 1L3TA 3T3FA 3SQ0A 3RMAA 4FJKA 3PY8A 4W5QA 1T8EA 2OPQA 4KHYA 2F96A 3ITHA 3QIPA 4GMJB 3VQ6A 2W42A 1RDBA 3QLHA 4B9SA 5C24A 1TV6A 3PO5A 4FJMA 1Z25A 1S5JA 3SYZA 4CHPA 2Z1HA 2O4IA 4CEBA 1GOBA 3L3VA 5K14A 3OJSA 4OGEA 1IG9A 1MU2A 3C95A 3MXMA 3WNGA 4CK3A 1J53A 4DQRA 1JLGA 3CFOA 3KKRA 3M8SA 3T1AA 1HQEA 4CGFA 4NCAA 2KZZA 4DS5A 1WSHA 4B9VA 1BCOA 1C0MA 2D0CA 2KQ2A 3V9ZA 3TANA 1FXXA 4KAZA 3NCIA 3QO9A 4DG1A 2KFZA 2LSNA 2HVHA 3K59A 1HQUA 3DLBA 5C42A 3QEXA 4CFCA 4CEZA 4CJ4A 4FK0A 1YVUA 2YV0X 3VA3A 4CGHA 3OY9A 1SL0A 3SUOA 1KVBA 2IAJA 4ELVA 4CGDA 1CZ9A 3NGIA 1QE1A 1IH7A 4M45A 3RR8A 1LAWA 3AVIA 4M3TA 1SKSA 3U3GA 4FJ7A 1X9WA 1LWCA 1UOCA 2B4JA 2Z1GA 3OYCA 3ZSOA 1JXBA 4CJSA 4CFBA 3MAQA 4DFPA 3HXMA 2XY7A 1NK4A 3KTQA 5SZTA 3SCXA 2E4LA 1GOCA 1S1VA 4CGGA 4HUEA 3RMBA 3OYIA 4LSNA 4PWDA 3PX0A 3AVFA 3LP2A 3QINA 4BDPA 1LW2A 4YNQA 4PUOA 3AA5X 1J5OA 1LWEA 4E1MA 4DU4A 4OGCA 3HL8A 4K8ZA 4F3TA 3TAQA 3LAMA 1JLCA 2RN2A 4B8CA 4DTSA 5HROA 4DSLA 3AVAA 4HCBA 4IDKA 4KTWA 3V1OA 4Z4CA 1JXEA 4Q5VA 4FLYA 1JL2A 1QSYA 1RT1A 3QETA 3ZSWA 2HHXA 3BDPA 4OJRA 5FDLA 2OZMA 1RTDA 3V81A 3OYEA 3I8DA 3DRSA 4AHVA 4DTUA 3QEIA 2OYQA 3SQ2A 1NOYA 3QNNA 4CJTA 4CE9A 1REVA 3IS9A 4CHQA 3O4NA 4FZYA 3HYFA 1RT3A 1RCHA 1KVAA 1KSPA 1K6YA 3O3GA 1D9FA 4O55A 1VSMA 1JLQA 2XY6A 2B6AA 1U47A 4CFDA 4Z4EA 4E7JA 1S1XA 4CGJA 3P5JA 1TKDA 1A5VA 4DQIA 4DSKA 3VQDA 2E6LA 3AVBA 4DQQA 2NUBA 4DLGA 3ZSZA 2KZMA 3ULDA 1B92A 1EX4A 1S9GA 3M8QA 4MQ3A 4CHOA 1LW0A 3MEGA 3NGZA 1I39A 3IAYA 3H08A 4CECA 4OVLA 3MXIA 2XY8A 4FLTA 1HNVA 5T7BA 1RT5A 1TKXA 1NKBA 3DMJA 2HMIA 3VQPA 3S3MA 4KHUA 1BIZA 1RT7A 1S1TA 3NF9A 3VQBA 1TAUA 3DLHA 2G8WA 4F2SA 3LWMA 3AVJA 4DTPA 1RDDA 4CEEA 4F3OA 3SPZA 2HHTA 1YT3A 3DRPA 4BE0A 3I0SA 4M3ZA 3AVNA 1UAXA 1WAJA 3ALYA 3AV9A 4ID1A 3S3OA 1IKXA 2G8VA 3E01A 2WONA 3VA0A 3B6PA 4DWIA 1BI4A 5E41A 5I3UA 1T05A 1U49A 4FM2A 4N41A 2ITGA 3NGYA 2FBYA 4WE1A 2HNZA 4FJLA 4FJNA 3VQQA 4Y1DA 3OYAA 3LP0A 3L2WA 3G0ZA 4RW7A 4B8AB 3VQAA 4W5TA 3TARA 2FBTA 4GW6A 4Z4HA 4CEQA 1TGOA 2IDOA 4LY7A 4KHNA 4FJXA 4NCBA 3LAKA 1NKEA 3KD5E 2YKNA 3UIQA 1RDCA 1S6QA 4Z4FA 4CF1A 1WSGA 3VQ4A 1RDAA 3OYDA 2Z1IA 1BQNA 4KHWA 1WSIA 2KTQA 4CHYA 5I42A 4B9LA 4KREA 3IG1A 1KFDA 2GV9A 3LP1A 4DMNA 3ZSVA 3OYMA 3DLKA 1NK7A 1KFSA 4M3XA 4QCLA 4CHNA 3V9XA 3CM6A 4DF8A 4CJ5A 2PZSA 4MFBA 1VSEA 1CLQA 1WSJA 3HSTB 4Z0UA 1O1WA 3MECA 4FM1A 3WNEA 2ZE2A 3LP3A 4DLEA 3TI0A 4OLBA 3OYFA 2VG7A 4FXDA 1TK5A 3JSMA 3V1RA 4OPKA 3K5MA 4HVJA 4FK4A 3QEVA 4N47A 1NJZA 4ICLA 4EZ9A 3AA4A 4BWMA 4J2BA 3SV4A 1IKVA 3HPOA 4E7IA 4O4GA 3K5LA 4CIEA 5DMRA 3RMCA 3AA3A 1TL1A 5CYMA 3SJJA 2KW4A 4CFAA 4DTXA 3PO4A 3RRGA 4J2DA 2I5JA 1FKOA 4FJIA 3KIOA 2HHQA 1RILA 4H8KA 4B9NA 2IOCA 2QKKA 3PV8A 4IG0A 4CGIA 2BANA 4CJWA 4BDZA 3OYJA 2WOMA 3TAGA 1XHZA 4JS4A 1EKEA 2FC0A 3M8PA 1F21A 2G8HA 1LAVA 4I2QA 3LPTA 4DSEA 1KRPA 3EYZA 4FZZA 4KPYA 4EZ6A 4K8XA 2FBXA 2P5OA 4FYDA 4N56A 4KHQA 4OKEA 4M3UA 3NH1A 3TABA 4M3WA 3OS1A 1JLAA 4C8LA 2DY4A 1RT6A 1S1UA 4KTQA 2RF2A 3PX4A 2QXFA 5EU7A 2YHAA 5FRMA 1X9MA 3NFAA 4AHUA 2IGIA 5C25A 3O3HA 3HVRA 1HMVA 3TR8A 2IS3A 5CY4A 3ZT1A 5J2NA 3QEPA 1KCFA 4CF9A 4KHSA 4KI6A 1HYSA 1IKYA 4E89A 3S9HA 4KB0A 2Y1IA 3KK2A 4DU3A 2Y1JA 4E0DA 3DYAA 3KLIA 3SQ4A 1NK0A 3DI6A 3T19A 1I3AA 3C6TA 4CCHA 1C1CA 4IFVA 4BE1A 3AO5A 2G8UA 1SKRA 3DRRA 5KI6A 2G8KA 4DTJA 1JKHA 2HVIA 4I9QA 1CZBA 3K5OA 2XHBA 3NF6A 4G1QA 3CM5A 1JLFA 1QSSA 4R5PA 4O44A 3V4IA 1RT4A 3FFIA 1NOZA 2KFNA 4DU1A 2X74A 5CYQA 2YNGA 4QAGA 1ZYQA 4C8NA 4CERA 1L3VA 5KRTA 2JLEA 4F8RA 4DTOA 1Q9XA 2X6NA 4DSIA 4J2EA 1GOAA 2VWKA 5CZ2A 4L8RB 1X1PA 3OJUA 3L2QA 4DF4A 1JLEA 1SKWA 2DFEA 3HK2A 1VSKA 3ZSQA 3ZT2A 3SV3A 1BISA 4AHSA 3HP6A 2DFFA 4B9MA 1D5AA 1TK0A 1A5WA 4ZHRA 1NK9A 4CK1A 1DTTA 1XC9A 3HP9A 4FW2A 1VSLA 3PX6A 4HCCA 2HB5A 1J54A 1RNHA 4CK2A 3JYTA 4I2PA 5FRNA 4CJPA 1U04A 3AVCA 2YNIA 1VSFA 2ETJA 3PUFA 4N76A 2P51A 3M8RA 2G8FA 3EY1A 4OKKA 3AO3A 3VQ5A 4AHRA 4KFBA 2VWJA 4AH9A 3ZSXA 1XI1A 4FLUA 1ASVA 4N5SA 4BE2A 3HT3A 1TK8A 4FJGA 4HHTA 4XIUA 4CJ3A 1N5YA 2F8TA 1U4BA 4ID5A 5J2MA 1WSEA 2HHSA 1EP4A 1JL1A 1RBTA 2VG5A 4RW4A 1HJRA 3BGRA 4YFUA 2OZSA 1ZBUA 1VSDA 4AHCA 3L2RA 3QERA 4KTZA 4FJ8A 4FZXC 3VQCA 4FJHA 4W5NA 1J9AA 3VQ9A 3LZIA 4W5RA 5SWMA 1RBUA 3U3YA 3HVTA 3RMDA 4IKFA 1Z26A 4Z4GA 2XO7A 2PY5A 1YTAA 1RBSA 4JLHA 3ISNC 3WNFA 4KKOA 2RPIA 1G15A 4DTRA 4FCYA 1TKTA 5D3GA 3THVA 2QK9A 5KTQA 3CFRA 4OLAA 1ASWA 1JLBA 1T7PA 4Z4IA 4JS5A 1D8YA 1KLMA 4CHZA 4CF2A 1RBVA 4H4OA 5HLFA 4M3YA 2EX3A 3SPYA 3TAEA 3F73A 3C6UA 3V9UA 3QIOA 1ASUA 3KJVA 4CF0A 4BWJA 2X78A 2ATQA 3HO1A 1UA1A 1BL3A 3DOKA 3KKSA 1Q8IA 1IKWA 2GBZA 4DQPA 1N6QA 4HTUA 4C8OA 2ZQBA 4AILC 1CXUA 1ZBHA 3KLHA 3ZCMA 1QS4A 3A2FA 3CQ8A 4E7HA 4DS4A 3VN5A 1TL3A 3SUPA 4FW1A 1VSIA 4FVMA 4DSFA 4J2AA 3DLGA 3L3UA 4AHTA 4CEDA 3TWHA 2IC3A 4RW8A 4EP4A 2FBVA 2YHBA 4CJKA 3NAEA 1ZBIA 4F4KA 2QKBA 3HJFA 2A1RA 4CJFA 1RT2A 4LSLA 1NK8A 3L8BA 2G8IA 3I0RA 3RR7A 5JS1A 1VRTA 1HYVA 3IRXA 3OYKA 5HP1A 3NH2A 2D0AA 2YKMA 1XHXA 1UA0A 1NK5A 2YNFA 2D0BA 3VQ7A 1L3SA 2PYLA 4I9LA 4JRQA 2B5JA 3DLRA 4F2RA 2Q3SA 1CXQA 3RTVA 1DTQA 4W5OA 4OKJA 4JRPA 4DTNA 4M41A 4BDYA 1QSLA 4PQUA 1WLJA 3QEWA 2GUIA 2YNHA 3ZSYA 4TSXA 3OVNA 4RW9A 4CJEA 5J1EA 4DQSA 1T03A 1C0UA 3OYLA 3AO2A 2R7YA 4CEOA 3HPHA 1S6PA 1ZBLA 4LD0A 4IFYA 3MEDA 3CFPA 3SUNA 1EXQA 2X6SA 3NF7A 4CEFA 1RTHA 1NK6A 1Q9YA 4O5BA 3S3NA 3P83D 4QOZB 3V9SA 4CJQA 4CEAA 4B3OA 1RBRA 2OPRA 2HNDA 3AO1A 1EETA 4OPJA 5J2QA 5KGXA 2AJQA 4M3RA 3U6FA 2F8SA 3F9KA 3NBPA 3RRHA 1S9EA 2DFHA 1S1WA 3SNNA 1BIUA 3ZSRA 3CYMA 5HRPA 2Z1JA 3L2VA 1SL2A 1TKZA 5JS2A 4PY5A 1W0HA 1IO2A 1W9HA 4IG3A 4O0JA 4EP5A 1XWLA 4E7KA 4E1NA 4O0IA 4BACA 1QQCA 2OPPA 3AVKA 1U48A 4IBNA 2EHGA 3NHGA 2HW3A 4CF8A 4M42A 2O4GA 1C1BA 3LANA 1WNSA 1KVCA 1RTIA 1VK0A 5HRNA 4I7FA 3NE6A 2XY5A 4KRFA 3OS2A 1NJWA 3NH0A 3ASMA 4GVMA 4PA1A 2E6MA 3MXJA 1NJXA 4B9UA 4ELTA 4ZTFA 3VQEA 3ZT0A 4CJRA 1X9SA 5HRRA 4KB1A 1A5XA 5J2PA 4Q0BA 1LWFA 4E19A 2P1JA 1VRUA 3KK3A 4FLZA 4FJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9D A;  1FKP A;  4NYN A;  1HRH A;  3OYB A;  4KI4 A;  1BGX T;  1WAF A;  2HNY A;  3G10 A;  4HUF A;  4DFJ A;  1LV5 A;  1YTU A;  4CJV A;  3L2U A;  3ZT4 A;  4NYF A;  4DFM A;  3O3F A;  2D5R A;  1R0A A;  2VG6 A;  1UWB A;  3CG7 A;  1DLO A;  3OS0 A;  3SZ2 A;  4DFK A;  5FRO A;  2XRI A;  5CZ1 A;  3LWL A;  1Y97 A;  1NJY A;  4RW6 A;  2HHV A;  4ZTJ A;  4KO0 A;  1BQM A;  3KLF A;  1TAQ A;  1FK9 A;  3NF8 A;  4Y1C A;  4DTM A;  3RWU A;  3LAL A;  3LPU A;  3AVL A;  3OYN A;  1HNI A;  3HPG A;  4FM0 A;  2BDP A;  3MEE A;  3AVG A;  1L3U A;  3B6O A;  2HHW A;  4KV8 A;  3K5N A;  3D0P A;  3KLE A;  3K58 A;  3ZT3 A;  5DK5 A;  3V1Q A;  2JGU A;  1WSF A;  4FJ5 A;  4DSJ A;  1ITG A;  4FJ9 A;  1QHT A;  3VQ8 A;  1HYZ A;  3NDK A;  3C94 A;  3QES A;  4LH5 A;  1B9F A;  2BE2 A;  3SI6 A;  4H4M A;  3AVM A;  4CJL A;  3AA2 A;  3WNH A;  4B9T A;  2ZD1 A;  4E3S A;  1SUQ A;  3HM9 A;  3K57 A;  3AO4 A;  4FLV A;  3V9W A;  1NKC A;  4CJU A;  3KLG A;  1U45 A;  1D9D A;  4UQG A;  4CIG A;  3LDS A;  1BHL A;  3D45 A;  3SQ1 A;  5KGW A;  1KLN A;  3TAP A;  3OYG A;  2BGG A;  4ELU A;  1ZBF A;  2RKI A;  4RG8 A;  1VSJ A;  3V6D A;  4HUG A;  4LH4 A;  1QTM A;  1L5U A;  2OA8 A;  4FLW A;  2A1S A;  4C8M A;  1BI4 B;  1HPZ A;  3P1G A;  5HRS A;  3DM2 A;  2PYJ A;  1C0T A;  3KK1 A;  2P5G A;  1KTQ A;  2DTU A;  3TAM A;  4C8K A;  3SUQ A;  3DLE A;  3DOL A;  1SL1 A;  4CIF A;  4NCG A;  1TVR A;  4E7L A;  3O4Q A;  1BCM A;  1SV5 A;  1VSH A;  3EZ5 A;  3KD1 E;  4CES A;  2OPS A;  1C1A A;  3TAF A;  2HHU A;  3AVH A;  4B08 A;  3K2P A;  4FK2 A;  1WN7 A;  4FLX A;  5HBM A;  5KRS A;  1RTJ A;  3LZJ A;  1C6V A;  3OYH A;  3QNO A;  1L3T A;  3T3F A;  3SQ0 A;  3RMA A;  4FJK A;  3PY8 A;  4W5Q A;  1T8E A;  2OPQ A;  4KHY A;  2F96 A;  3ITH A;  3QIP A;  4GMJ B;  3VQ6 A;  2W42 A;  1RDB A;  3QLH A;  4B9S A;  5C24 A;  1TV6 A;  3PO5 A;  4FJM A;  1Z25 A;  1S5J A;  3SYZ A;  4CHP A;  2Z1H A;  2O4I A;  4CEB A;  1GOB A;  3L3V A;  5K14 A;  3OJS A;  4OGE A;  1IG9 A;  1MU2 A;  3C95 A;  3MXM A;  3WNG A;  4CK3 A;  1J53 A;  4DQR A;  1JLG A;  3CFO A;  3KKR A;  3M8S A;  3T1A A;  1HQE A;  4CGF A;  4NCA A;  2KZZ A;  4DS5 A;  1WSH A;  4B9V A;  1BCO A;  1C0M A;  2D0C A;  2KQ2 A;  3V9Z A;  3TAN A;  1FXX A;  4KAZ A;  3NCI A;  3QO9 A;  4DG1 A;  2KFZ A;  2LSN A;  2HVH A;  3K59 A;  1HQU A;  3DLB A;  5C42 A;  3QEX A;  4CFC A;  4CEZ A;  4CJ4 A;  4FK0 A;  1YVU A;  2YV0 X;  3VA3 A;  4CGH A;  3OY9 A;  1SL0 A;  3SUO A;  1KVB A;  2IAJ A;  4ELV A;  4CGD A;  1CZ9 A;  3NGI A;  1QE1 A;  1IH7 A;  4M45 A;  3RR8 A;  1LAW A;  3AVI A;  4M3T A;  1SKS A;  3U3G A;  4FJ7 A;  1X9W A;  1LWC A;  1UOC A;  2B4J A;  2Z1G A;  3OYC A;  3ZSO A;  1JXB A;  4CJS A;  4CFB A;  3MAQ A;  4DFP A;  3HXM A;  2XY7 A;  1NK4 A;  3KTQ A;  5SZT A;  3SCX A;  2E4L A;  1GOC A;  1S1V A;  4CGG A;  4HUE A;  3RMB A;  3OYI A;  4LSN A;  4PWD A;  3PX0 A;  3AVF A;  3LP2 A;  3QIN A;  4BDP A;  1LW2 A;  4YNQ A;  4PUO A;  3AA5 X;  1J5O A;  1LWE A;  4E1M A;  4DU4 A;  4OGC A;  3HL8 A;  4K8Z A;  4F3T A;  3TAQ A;  3LAM A;  1JLC A;  2RN2 A;  4B8C A;  4DTS A;  5HRO A;  4DSL A;  3AVA A;  4HCB A;  4IDK A;  4KTW A;  3V1O A;  4Z4C A;  1JXE A;  4Q5V A;  4FLY A;  1JL2 A;  1QSY A;  1RT1 A;  3QET A;  3ZSW A;  2HHX A;  3BDP A;  4OJR A;  5FDL A;  2OZM A;  1RTD A;  3V81 A;  3OYE A;  3I8D A;  3DRS A;  4AHV A;  4DTU A;  3QEI A;  2OYQ A;  3SQ2 A;  1NOY A;  3QNN A;  4CJT A;  4CE9 A;  1REV A;  3IS9 A;  4CHQ A;  3O4N A;  4FZY A;  3HYF A;  1RT3 A;  1RCH A;  1KVA A;  1KSP A;  1K6Y A;  3O3G A;  1D9F A;  4O55 A;  1VSM A;  1JLQ A;  2XY6 A;  2B6A A;  1U47 A;  4CFD A;  4Z4E A;  4E7J A;  1S1X A;  4CGJ A;  3P5J A;  1TKD A;  1A5V A;  4DQI A;  4DSK A;  3VQD A;  2E6L A;  3AVB A;  4DQQ A;  2NUB A;  4DLG A;  3ZSZ A;  2KZM A;  3ULD A;  1B92 A;  1EX4 A;  1S9G A;  3M8Q A;  4MQ3 A;  4CHO A;  1LW0 A;  3MEG A;  3NGZ A;  1I39 A;  3IAY A;  3H08 A;  4CEC A;  4OVL A;  3MXI A;  2XY8 A;  4FLT A;  1HNV A;  5T7B A;  1RT5 A;  1TKX A;  1NKB A;  3DMJ A;  2HMI A;  3VQP A;  3S3M A;  4KHU A;  1BIZ A;  1RT7 A;  1S1T A;  3NF9 A;  3VQB A;  1TAU A;  3DLH A;  2G8W A;  4F2S A;  3LWM A;  3AVJ A;  4DTP A;  1RDD A;  4CEE A;  4F3O A;  3SPZ A;  2HHT A;  1YT3 A;  3DRP A;  4BE0 A;  3I0S A;  4M3Z A;  3AVN A;  1UAX A;  1WAJ A;  3ALY A;  3AV9 A;  4ID1 A;  3S3O A;  1IKX A;  2G8V A;  3E01 A;  2WON A;  3VA0 A;  3B6P A;  4DWI A;  1BI4 A;  5E41 A;  5I3U A;  1T05 A;  1U49 A;  4FM2 A;  4N41 A;  2ITG A;  3NGY A;  2FBY A;  4WE1 A;  2HNZ A;  4FJL A;  4FJN A;  3VQQ A;  4Y1D A;  3OYA A;  3LP0 A;  3L2W A;  3G0Z A;  4RW7 A;  4B8A B;  3VQA A;  4W5T A;  3TAR A;  2FBT A;  4GW6 A;  4Z4H A;  4CEQ A;  1TGO A;  2IDO A;  4LY7 A;  4KHN A;  4FJX A;  4NCB A;  3LAK A;  1NKE A;  3KD5 E;  2YKN A;  3UIQ A;  1RDC A;  1S6Q A;  4Z4F A;  4CF1 A;  1WSG A;  3VQ4 A;  1RDA A;  3OYD A;  2Z1I A;  1BQN A;  4KHW A;  1WSI A;  2KTQ A;  4CHY A;  5I42 A;  4B9L A;  4KRE A;  3IG1 A;  1KFD A;  2GV9 A;  3LP1 A;  4DMN A;  3ZSV A;  3OYM A;  3DLK A;  1NK7 A;  1KFS A;  4M3X A;  4QCL A;  4CHN A;  3V9X A;  3CM6 A;  4DF8 A;  4CJ5 A;  2PZS A;  4MFB A;  1VSE A;  1CLQ A;  1WSJ A;  3HST B;  4Z0U A;  1O1W A;  3MEC A;  4FM1 A;  3WNE A;  2ZE2 A;  3LP3 A;  4DLE A;  3TI0 A;  4OLB A;  3OYF A;  2VG7 A;  4FXD A;  1TK5 A;  3JSM A;  3V1R A;  4OPK A;  3K5M A;  4HVJ A;  4FK4 A;  3QEV A;  4N47 A;  1NJZ A;  4ICL A;  4EZ9 A;  3AA4 A;  4BWM A;  4J2B A;  3SV4 A;  1IKV A;  3HPO A;  4E7I A;  4O4G A;  3K5L A;  4CIE A;  5DMR A;  3RMC A;  3AA3 A;  1TL1 A;  5CYM A;  3SJJ A;  2KW4 A;  4CFA A;  4DTX A;  3PO4 A;  3RRG A;  4J2D A;  2I5J A;  1FKO A;  4FJI A;  3KIO A;  2HHQ A;  1RIL A;  4H8K A;  4B9N A;  2IOC A;  2QKK A;  3PV8 A;  4IG0 A;  4CGI A;  2BAN A;  4CJW A;  4BDZ A;  3OYJ A;  2WOM A;  3TAG A;  1XHZ A;  4JS4 A;  1EKE A;  2FC0 A;  3M8P A;  1F21 A;  2G8H A;  1LAV A;  4I2Q A;  3LPT A;  4DSE A;  1KRP A;  3EYZ A;  4FZZ A;  4KPY A;  4EZ6 A;  4K8X A;  2FBX A;  2P5O A;  4FYD A;  4N56 A;  4KHQ A;  4OKE A;  4M3U A;  3NH1 A;  3TAB A;  4M3W A;  3OS1 A;  1JLA A;  4C8L A;  2DY4 A;  1RT6 A;  1S1U A;  4KTQ A;  2RF2 A;  3PX4 A;  2QXF A;  5EU7 A;  2YHA A;  5FRM A;  1X9M A;  3NFA A;  4AHU A;  2IGI A;  5C25 A;  3O3H A;  3HVR A;  1HMV A;  3TR8 A;  2IS3 A;  5CY4 A;  3ZT1 A;  5J2N A;  3QEP A;  1KCF A;  4CF9 A;  4KHS A;  4KI6 A;  1HYS A;  1IKY A;  4E89 A;  3S9H A;  4KB0 A;  2Y1I A;  3KK2 A;  4DU3 A;  2Y1J A;  4E0D A;  3DYA A;  3KLI A;  3SQ4 A;  1NK0 A;  3DI6 A;  3T19 A;  1I3A A;  3C6T A;  4CCH A;  1C1C A;  4IFV A;  4BE1 A;  3AO5 A;  2G8U A;  1SKR A;  3DRR A;  5KI6 A;  2G8K A;  4DTJ A;  1JKH A;  2HVI A;  4I9Q A;  1CZB A;  3K5O A;  2XHB A;  3NF6 A;  4G1Q A;  3CM5 A;  1JLF A;  1QSS A;  4R5P A;  4O44 A;  3V4I A;  1RT4 A;  3FFI A;  1NOZ A;  2KFN A;  4DU1 A;  2X74 A;  5CYQ A;  2YNG A;  4QAG A;  1ZYQ A;  4C8N A;  4CER A;  1L3V A;  5KRT A;  2JLE A;  4F8R A;  4DTO A;  1Q9X A;  2X6N A;  4DSI A;  4J2E A;  1GOA A;  2VWK A;  5CZ2 A;  4L8R B;  1X1P A;  3OJU A;  3L2Q A;  4DF4 A;  1JLE A;  1SKW A;  2DFE A;  3HK2 A;  1VSK A;  3ZSQ A;  3ZT2 A;  3SV3 A;  1BIS A;  4AHS A;  3HP6 A;  2DFF A;  4B9M A;  1D5A A;  1TK0 A;  1A5W A;  4ZHR A;  1NK9 A;  4CK1 A;  1DTT A;  1XC9 A;  3HP9 A;  4FW2 A;  1VSL A;  3PX6 A;  4HCC A;  2HB5 A;  1J54 A;  1RNH A;  4CK2 A;  3JYT A;  4I2P A;  5FRN A;  4CJP A;  1U04 A;  3AVC A;  2YNI A;  1VSF A;  2ETJ A;  3PUF A;  4N76 A;  2P51 A;  3M8R A;  2G8F A;  3EY1 A;  4OKK A;  3AO3 A;  3VQ5 A;  4AHR A;  4KFB A;  2VWJ A;  4AH9 A;  3ZSX A;  1XI1 A;  4FLU A;  1ASV A;  4N5S A;  4BE2 A;  3HT3 A;  1TK8 A;  4FJG A;  4HHT A;  4XIU A;  4CJ3 A;  1N5Y A;  2F8T A;  1U4B A;  4ID5 A;  5J2M A;  1WSE A;  2HHS A;  1EP4 A;  1JL1 A;  1RBT A;  2VG5 A;  4RW4 A;  1HJR A;  3BGR A;  4YFU A;  2OZS A;  1ZBU A;  1VSD A;  4AHC A;  3L2R A;  3QER A;  4KTZ A;  4FJ8 A;  4FZX C;  3VQC A;  4FJH A;  4W5N A;  1J9A A;  3VQ9 A;  3LZI A;  4W5R A;  5SWM A;  1RBU A;  3U3Y A;  3HVT A;  3RMD A;  4IKF A;  1Z26 A;  4Z4G A;  2XO7 A;  2PY5 A;  1YTA A;  1RBS A;  4JLH A;  3ISN C;  3WNF A;  4KKO A;  2RPI A;  1G15 A;  4DTR A;  4FCY A;  1TKT A;  5D3G A;  3THV A;  2QK9 A;  5KTQ A;  3CFR A;  4OLA A;  1ASW A;  1JLB A;  1T7P A;  4Z4I A;  4JS5 A;  1D8Y A;  1KLM A;  4CHZ A;  4CF2 A;  1RBV A;  4H4O A;  5HLF A;  4M3Y A;  2EX3 A;  3SPY A;  3TAE A;  3F73 A;  3C6U A;  3V9U A;  3QIO A;  1ASU A;  3KJV A;  4CF0 A;  4BWJ A;  2X78 A;  2ATQ A;  3HO1 A;  1UA1 A;  1BL3 A;  3DOK A;  3KKS A;  1Q8I A;  1IKW A;  2GBZ A;  4DQP A;  1N6Q A;  4HTU A;  4C8O A;  2ZQB A;  4AIL C;  1CXU A;  1ZBH A;  3KLH A;  3ZCM A;  1QS4 A;  3A2F A;  3CQ8 A;  4E7H A;  4DS4 A;  3VN5 A;  1TL3 A;  3SUP A;  4FW1 A;  1VSI A;  4FVM A;  4DSF A;  4J2A A;  3DLG A;  3L3U A;  4AHT A;  4CED A;  3TWH A;  2IC3 A;  4RW8 A;  4EP4 A;  2FBV A;  2YHB A;  4CJK A;  3NAE A;  1ZBI A;  4F4K A;  2QKB A;  3HJF A;  2A1R A;  4CJF A;  1RT2 A;  4LSL A;  1NK8 A;  3L8B A;  2G8I A;  3I0R A;  3RR7 A;  5JS1 A;  1VRT A;  1HYV A;  3IRX A;  3OYK A;  5HP1 A;  3NH2 A;  2D0A A;  2YKM A;  1XHX A;  1UA0 A;  1NK5 A;  2YNF A;  2D0B A;  3VQ7 A;  1L3S A;  2PYL A;  4I9L A;  4JRQ A;  2B5J A;  3DLR A;  4F2R A;  2Q3S A;  1CXQ A;  3RTV A;  1DTQ A;  4W5O A;  4OKJ A;  4JRP A;  4DTN A;  4M41 A;  4BDY A;  1QSL A;  4PQU A;  1WLJ A;  3QEW A;  2GUI A;  2YNH A;  3ZSY A;  4TSX A;  3OVN A;  4RW9 A;  4CJE A;  5J1E A;  4DQS A;  1T03 A;  1C0U A;  3OYL A;  3AO2 A;  2R7Y A;  4CEO A;  3HPH A;  1S6P A;  1ZBL A;  4LD0 A;  4IFY A;  3MED A;  3CFP A;  3SUN A;  1EXQ A;  2X6S A;  3NF7 A;  4CEF A;  1RTH A;  1NK6 A;  1Q9Y A;  4O5B A;  3S3N A;  3P83 D;  4QOZ B;  3V9S A;  4CJQ A;  4CEA A;  4B3O A;  1RBR A;  2OPR A;  2HND A;  3AO1 A;  1EET A;  4OPJ A;  5J2Q A;  5KGX A;  2AJQ A;  4M3R A;  3U6F A;  2F8S A;  3F9K A;  3NBP A;  3RRH A;  1S9E A;  2DFH A;  1S1W A;  3SNN A;  1BIU A;  3ZSR A;  3CYM A;  5HRP A;  2Z1J A;  3L2V A;  1SL2 A;  1TKZ A;  5JS2 A;  4PY5 A;  1W0H A;  1IO2 A;  1W9H A;  4IG3 A;  4O0J A;  4EP5 A;  1XWL A;  4E7K A;  4E1N A;  4O0I A;  4BAC A;  1QQC A;  2OPP A;  3AVK A;  1U48 A;  4IBN A;  2EHG A;  3NHG A;  2HW3 A;  4CF8 A;  4M42 A;  2O4G A;  1C1B A;  3LAN A;  1WNS A;  1KVC A;  1RTI A;  1VK0 A;  5HRN A;  4I7F A;  3NE6 A;  2XY5 A;  4KRF A;  3OS2 A;  1NJW A;  3NH0 A;  3ASM A;  4GVM A;  4PA1 A;  2E6M A;  3MXJ A;  1NJX A;  4B9U A;  4ELT A;  4ZTF A;  3VQE A;  3ZT0 A;  4CJR A;  1X9S A;  5HRR A;  4KB1 A;  1A5X A;  5J2P A;  4Q0B A;  1LWF A;  4E19 A;  2P1J A;  1VRU A;  3KK3 A;  4FLZ A;  4FJJ A; 
#chains in the Genus database with same CATH topology
 1B9D A;  3OYB A;  1YTU A;  3G10 A;  1WAF A;  4XEI A;  4HUF A;  4CD3 A;  3UE5 A;  1NNE A;  3O3F A;  4O8U A;  4BC5 A;  2VG6 A;  3O9R A;  2YX6 A;  2KLA A;  5FRO A;  2XRI A;  3I55 N;  1QZ6 A;  4RW6 A;  2P9S B;  4NXN K;  3KLF A;  2F9W A;  5AZI A;  3CET A;  3H45 C;  4DTM A;  2A6A A;  4FL9 A;  3LPU A;  4FM0 A;  1L3U A;  4KV8 A;  3D0P A;  1KAX A;  4FJ9 A;  2YCH A;  1B9F A;  4H4M A;  4E3S A;  2BH1 A;  3AO4 A;  4YHH K;  3VGK A;  4CJU A;  4UQG A;  3CJ9 A;  3LDS A;  1BHL A;  1TUU A;  4WFA L;  3THX A;  3V6D A;  3KWI A;  1L5U A;  4FLW A;  1BI4 B;  2HF4 A;  1HPZ A;  3MWP A;  2ASP A;  1M90 O;  1KTQ A;  2IVO A;  3DLE A;  5AQO A;  3BZC A;  3O4Q A;  1QVF M;  4XH5 A;  3VF4 A;  3KD1 E;  4CES A;  2OPS A;  1C1A A;  4B08 A;  4FLX A;  1S72 N;  2CH5 A;  3OYH A;  3SQ0 A;  3J8A A;  2P9N B;  4WQ4 C;  2W42 A;  4JI3 K;  3QLH A;  5AFU A;  3PO5 A;  1TV6 A;  4YY3 K;  2W6L A;  4KH6 A;  4BRC A;  3OJS A;  1BG3 A;  3QBW A;  3R8E A;  1IG9 A;  4KHP K;  1O13 A;  4FVU A;  2BUP A;  1VHX A;  2GEM A;  4DQR A;  4FWO A;  3T1A A;  4NCA A;  2KZZ A;  1C0G A;  4O8K A;  4B1Y B;  1FXX A;  3VGM A;  4KAZ A;  3NCI A;  1VQ9 N;  1J6Z A;  3VEV A;  1LOT B;  4CFC A;  4CEZ A;  3SUO A;  3CCL N;  3SAH A;  3UKR A;  5GIP A;  1LAW A;  2O8B B;  2QA4 N;  1BUP A;  1NGF A;  2B4J A;  2Z1G A;  4JI2 K;  1BO5 O;  1NK4 A;  4DFP A;  3HXM A;  3BY5 A;  2E4L A;  4HUE A;  4PWD A;  2O8D B;  4FPA A;  1X9J A;  4BC2 A;  2FF6 A;  3L4I A;  4E1M A;  1K8A O;  2NRV A;  3SLC A;  3TAQ A;  4B8C A;  4IDK A;  4FLY A;  1RT1 A;  4FWM A;  5FDL A;  2Q97 A;  3L6Q A;  3V81 A;  2IVP A;  3DRS A;  3QEI A;  2OYQ A;  5F0X A;  4CE9 A;  3IS9 A;  3O4N A;  4IJN A;  3HYF A;  3O08 A;  1JJ2 M;  3FZF A;  4K25 A;  1D9F A;  3B8A X;  4CI6 A;  2W41 A;  3P5J A;  1TKD A;  1A5V A;  3AVB A;  4DLG A;  2QWM A;  3IAY A;  3H08 A;  3SJH A;  1TKX A;  3VQB A;  2G8W A;  5IWA K;  5KPR A;  1RDU A;  2QTD A;  1RDD A;  4BVO A;  3SPZ A;  2HHT A;  2ASO A;  1WAJ A;  2P9P B;  3N4Q A;  3S3O A;  4PL7 A;  4IOC L;  3B6P A;  1GLF O;  3ATU A;  4H0P A;  4DR2 K;  4R79 A;  4WE1 A;  4WFB L;  3VQQ A;  3PSF A;  3VQA A;  3TAR A;  2FBT A;  3G71 N;  4CEQ A;  3CQY A;  2IDO A;  4FJX A;  3KD5 E;  2WUS A;  3CJ7 A;  3F2K A;  4PKH A;  1YIJ N;  1WSG A;  3VQ4 A;  1HLU A;  4B1Z A;  1WSI A;  4CHY A;  2GV9 A;  3ZSV A;  3ENB A;  1KFS A;  3Q7C A;  1SS6 A;  3CM6 A;  4DF8 A;  1HPM A;  1WSJ A;  4FM1 A;  3WNE A;  4B1W B;  4DLE A;  3JSM A;  4OPK A;  3K5M A;  2OTJ N;  3SV4 A;  1TUY A;  1IBL K;  4AF1 A;  4O4G A;  3T69 A;  4DR1 K;  1U2V B;  4H5W A;  2P9L A;  2RE2 A;  3AA3 A;  4IEI A;  1FKO A;  1RIL A;  4B9N A;  2QKK A;  4IG0 A;  4BDZ A;  3TAG A;  1XQS C;  3LM2 A;  3M8P A;  1F21 A;  4I2Q A;  3LPT A;  5KPT A;  4BR7 A;  2FBX A;  2E1Y A;  2HF3 A;  4YOT A;  3NH1 A;  3MMV A;  3TAB A;  1JLA A;  4BC4 A;  3IMX A;  2YJF A;  1S1U A;  3VTI A;  3J80 O;  1K8K A;  5FRM A;  1X9M A;  5JVG L;  1YVN A;  3LDL A;  3QEP A;  3O3H A;  1HMV A;  4JKF A;  5J2N A;  4KHS A;  1HYS A;  5ADX H;  2V52 B;  5CE3 A;  3DYA A;  3T19 A;  4CCH A;  1I3A A;  2OAN A;  3C6T A;  3QDK A;  5BPL A;  4BE1 A;  3AO5 A;  2G8U A;  1SKR A;  1CZB A;  3P4I A;  3NF6 A;  4G1Q A;  3EZW A;  4YOV A;  3V4I A;  4O44 A;  1QSS A;  2KFN A;  2E20 A;  4CER A;  5KRT A;  3ULE B;  2FSJ A;  4ILJ A;  4F8R A;  4L8R B;  2X6N A;  3ZEU B;  4DF4 A;  1JLE A;  3HK2 A;  1VSK A;  4LF5 K;  3D2E A;  4AHS A;  4PL8 A;  2DFF A;  4B9M A;  1TK0 A;  4K41 A;  4ZHR A;  1NK9 A;  2YJE A;  4CK1 A;  4A59 A;  1XC9 A;  3HP9 A;  3WEE A;  1VQM N;  4I2P A;  4N76 A;  4IXC A;  2YNI A;  3PUF A;  2Q2R A;  1ATR A;  4OKK A;  3VQ5 A;  4GKJ K;  4AH9 A;  4B3M K;  3HI0 A;  4CJ3 A;  1HR0 K;  1WSE A;  1RBT A;  2P9K B;  5AQM A;  5LMU K;  1VSD A;  4AHC A;  3WXK A;  4FZX C;  3RMD A;  5C0Y A;  5AQR A;  3FZH A;  2Q31 A;  2RPI A;  1TKT A;  2Q36 A;  2QK9 A;  3CFR A;  1ASW A;  1JLB A;  4Z4I A;  1H1V A;  3D2F B;  4LFC K;  2EX3 A;  3TAE A;  5AQK A;  3F73 A;  4G9Z A;  3HZ6 A;  3V9U A;  1OH6 A;  1ASU A;  1JCF A;  2NRW A;  3KJV A;  1OVQ A;  4BWJ A;  1NGD A;  1BL3 A;  2GBZ A;  1KAZ A;  2ZQB A;  5BRH A;  3KLH A;  2QEX N;  1HJO A;  3ZCM A;  3A2F A;  1EWQ A;  4B3S K;  3O8M A;  3SUP A;  2HBM A;  4FVM A;  3G6E N;  3DLG A;  3L3U A;  4CBX A;  1YI2 N;  2J4R A;  4JAX A;  2YHB A;  4GV9 A;  3OA9 A;  4JI6 K;  1NM1 A;  3HJF A;  4LSL A;  3L8B A;  5KQ8 A;  5JS1 A;  5GAE P;  3OYK A;  5HP1 A;  3CCR N;  1NK5 A;  2UYT A;  2YNF A;  2D0B A;  3VQ7 A;  2E2O A;  4M7X A;  3WXM B;  2A40 A;  4B9Q A;  2Q3S A;  3RVC A;  4BQZ A;  4YOR A;  4M41 A;  2YNH A;  4DQS A;  4FWK A;  1T03 A;  3OYL A;  2R7Y A;  3AO2 A;  4BC3 A;  4CEO A;  4JD2 A;  4LD0 A;  1EXQ A;  1HNZ K;  4YOY A;  4CEF A;  1RTH A;  1NK6 A;  1Q9Y A;  4DR3 K;  3V9S A;  4CEA A;  4B3O A;  2KKZ A;  3H3N O;  3CMA N;  5J2Q A;  5KGX A;  1ATN A;  1HKG A;  4M3R A;  1NGI A;  3A5M C;  3RRH A;  4MLH A;  2QWR A;  1NMD A;  5JS2 A;  4PY5 A;  1W0H A;  3C7N A;  4EP5 A;  3CJB A;  3FZM A;  4K0K K;  4BRI A;  4E1N A;  5F1X A;  2HW3 A;  4QS7 A;  3EL2 A;  4NO7 A;  1C1B A;  3K0S A;  1RTI A;  4AQY K;  3NE6 A;  2XY5 A;  4JI0 K;  1NJW A;  4ZTF A;  3VQE A;  4KB1 A;  1A5X A;  2PFU A;  2I7N A;  3GOI A;  5FPN A;  5AQL A;  4DFJ A;  1D4X A;  3L2U A;  3ZT4 A;  2D5R A;  3CG7 A;  1DLO A;  3VET A;  5JIC A;  2AA4 A;  4IDH A;  1XC3 A;  4JKA A;  4CD1 A;  1ESV A;  4IOA L;  3AVL A;  1HNI A;  3E9O A;  1NLV A;  3MEE A;  3B6O A;  2HHW A;  1DEJ A;  5C12 A;  1OH8 A;  3V1Q A;  3QFU A;  5JVH L;  1ITG A;  1QHT A;  1HYZ A;  4QS9 A;  1W2B M;  3AA2 A;  4HTL A;  3WNH A;  5AJ3 K;  4DR7 K;  3K57 A;  2GX9 A;  3V9W A;  1NKC A;  4U67 L;  1U45 A;  1D9D A;  4O5F A;  3OYG A;  2BGG A;  5JLH A;  4HUG A;  1T3V A;  2OA8 A;  2O8F A;  2A1S A;  4C8M A;  3D6R A;  5HRS A;  4JKD A;  4BR0 A;  2P5G A;  1DKG D;  4CIF A;  2O8C A;  1GLB G;  1SV5 A;  1VSH A;  3NMU A;  3TAF A;  2HHU A;  2P9U A;  4E1J A;  1NG9 A;  5HBM A;  5KRS A;  1RTJ A;  3QNO A;  4BRM A;  3PY8 A;  4W5Q A;  3MDQ A;  4ISG A;  3T1H K;  3ITH A;  4DR6 K;  1RDB A;  4DV7 K;  3SYZ A;  4CHP A;  4CEB A;  1GOB A;  4DQ8 A;  4OGE A;  3FGU A;  3VEZ A;  1MU2 A;  3MXM A;  3WNG A;  3KKR A;  1HQE A;  4CGF A;  5B8H A;  1NU0 A;  3TAN A;  1MDU B;  5AQG A;  3JAM O;  3QO9 A;  3E9L A;  3MX2 A;  4JK9 A;  2KFZ A;  1HQU A;  4JHD A;  5C42 A;  2YI1 A;  2YV0 X;  3CJA A;  3OY9 A;  1KVB A;  2IAJ A;  4CGD A;  1CZ9 A;  3U9Z A;  3KVG A;  4BGB A;  4DV2 K;  1QE1 A;  1IH7 A;  3RR8 A;  2YHX A;  4M3T A;  1T6D A;  1X9W A;  1UOC A;  3OTO K;  3OYC A;  3THY B;  4CJS A;  3EE9 A;  5SZT A;  4CW7 B;  2JWK A;  3VTH A;  1OKJ A;  1LCU A;  5FPE A;  5DM6 L;  4PUO A;  4BDP A;  4YNQ A;  5BPM A;  4H0X B;  3VPZ A;  3OW2 M;  3HL8 A;  4F3T A;  3AAR A;  1JLC A;  5HRO A;  4HCB A;  2GTD A;  1JL2 A;  4BR9 A;  3BDP A;  1YJ9 N;  3OYE A;  2UXC K;  1HKC A;  3R9P A;  4AHV A;  4CZK A;  1N32 K;  3SQ2 A;  1NOY A;  1T44 A;  3LDP A;  4CHQ A;  4FZY A;  1X3N A;  1K6Y A;  1N34 K;  2E1Z A;  2WBN A;  1WOQ A;  1JLQ A;  2XY6 A;  2GWJ A;  5H1S Q;  2P9S A;  5E26 A;  1I94 K;  5FPD A;  1GLA G;  4Z4E A;  4DSK A;  3THW B;  2KZM A;  3ZSZ A;  3ULD A;  1B92 A;  4XH4 A;  4NB4 A;  1LW0 A;  4BG9 A;  1YF5 L;  3T7Z A;  2HHH K;  2XY8 A;  4FLT A;  3CF5 L;  4JI4 K;  1NKB A;  3N4P A;  1BIZ A;  2D0P A;  2V51 B;  5AQZ A;  1VQ4 N;  3AVJ A;  4DTP A;  4CEE A;  3P31 A;  1VAZ A;  4BE0 A;  3I0S A;  3ALY A;  3AV9 A;  4ID1 A;  5AZI B;  1IKX A;  2G8V A;  3E01 A;  4WCE L;  3MN6 A;  5C2D A;  2PAV A;  1BI4 A;  1T05 A;  4OX9 K;  4FM2 A;  1NGC A;  4FJN A;  2HNZ A;  1KC8 O;  3LL3 A;  3OYA A;  1GLE G;  4BRF A;  4JK8 A;  4NXM K;  3F5T A;  1VQ8 N;  1BA0 A;  1S3X A;  5BRD A;  1NKE A;  3WXL A;  4CJ7 A;  1S6Q A;  4EHU A;  4BRD A;  5AQN A;  2Z1I A;  4KHW A;  3KWG A;  4IJA A;  2KTQ A;  4B9L A;  2P9I B;  3THX B;  4KRE A;  1KFD A;  3LP1 A;  4DMN A;  3OYM A;  4JKB A;  4CHN A;  4CJ5 A;  1VSE A;  3JXU A;  3IDH A;  1NGJ A;  3TTD A;  3LP3 A;  1S22 A;  4PKG A;  5FLX O;  1TK5 A;  1NJZ A;  3AA4 A;  4MLE A;  3CCS N;  3K5L A;  2ZM6 K;  2V7Y A;  3A5O C;  4J2D A;  2I5J A;  3H1Q A;  3VF6 A;  3PV8 A;  5FPM A;  1T6C A;  1EKE A;  4JKC A;  2UXD K;  2NRX A;  2AP1 A;  1LAV A;  3A8Y A;  3HSC A;  1C0F A;  4DSE A;  1KRP A;  3EYZ A;  4FZZ A;  5AFU H;  4K8X A;  2O8D A;  5BN9 A;  4KHQ A;  4M3U A;  3AAQ A;  5LJV A;  1RT6 A;  2NRT A;  3HTV A;  4LF6 K;  2VGN A;  2QXF A;  2YHA A;  3I56 N;  2FSN A;  3NFA A;  3TSQ A;  5C25 A;  3TR8 A;  3UKR B;  3CJ1 A;  3ZT1 A;  5C2F A;  4DV1 K;  3VOV A;  1IKY A;  4B1U B;  4BG8 A;  4E89 A;  4KB0 A;  4DU3 A;  1NK0 A;  4BRQ A;  3VEX A;  5IT9 O;  3DRR A;  5KI6 A;  2G8K A;  3CME N;  4DTJ A;  2HVI A;  1E4F T;  4I9Q A;  2W40 A;  2XHB A;  1VQN N;  5GIN A;  3CM5 A;  2CGK A;  4R5P A;  1RT4 A;  4L3Q A;  5CHI A;  4DU1 A;  2X74 A;  3CD6 N;  2D4W A;  2YNG A;  4DTO A;  4J2E A;  5CZ2 A;  1XMO K;  3M3Z A;  2DFE A;  2Q0R A;  3ZSQ A;  4K42 A;  5CR4 A;  3HP6 A;  3BP8 A;  1D5A A;  5AQT A;  4WYB A;  1MA9 B;  3DAW A;  3O6W A;  1WBD A;  3CCU N;  4JYA K;  3AVC A;  1VSF A;  3ZX0 A;  2QXL A;  2P51 A;  2P9P A;  1NGE A;  5EVZ A;  3AO3 A;  3CCJ N;  2VWJ A;  4FLU A;  1ASV A;  3TSU A;  3ZET A;  4BE2 A;  4FJG A;  1N5Y A;  4XIU A;  3PSI A;  1RFQ A;  2HHS A;  1EP4 A;  1JL1 A;  4BRP A;  4RCH A;  2FLO A;  4WF9 L;  2E2N A;  4FWL A;  1HJR A;  4CBU A;  4GKK K;  4GY2 B;  3L2R A;  3CCV N;  2HBK A;  5AQH A;  5SWM A;  1RBU A;  1QVG M;  3HVT A;  4V19 S;  4Z4G A;  2XO7 A;  1SAZ A;  3IKM A;  2GWK A;  4KKO A;  2ZGY A;  5D3G A;  3THV A;  5AQP A;  1T7P A;  4WQ5 A;  3C0B A;  4CF2 A;  1RBV A;  3IFR A;  3C6U A;  2ITM A;  2BTF A;  2ATQ A;  3EKS A;  4KH4 A;  2ZJR L;  1UA1 A;  1IKW A;  4B3R K;  4A62 A;  4HTU A;  1N6Q A;  4A57 A;  1QS4 A;  3HOS A;  4E7H A;  1KQS M;  5TKW A;  1TL3 A;  5C15 A;  1VSI A;  4DSF A;  3SAF A;  4AHT A;  5MLC Q;  4H0V B;  1TYQ B;  4F4K A;  1RT2 A;  2G8I A;  2HST A;  3RR7 A;  1VRT A;  3IRX A;  3CI5 A;  1UA0 A;  2YKM A;  1XHX A;  3EN9 A;  4J8F A;  1Q7Y O;  1Q81 O;  4GVE A;  4F2R A;  1EO1 A;  1CXQ A;  5F2R A;  1BDG A;  4A2A A;  4PQU A;  1U6Z A;  1WLJ A;  3QEW A;  4CJE A;  5AQJ A;  5J1E A;  3OVN A;  4JI8 K;  3MCP A;  3SAG A;  1VQ5 N;  1GLL O;  3P38 A;  3CFP A;  3K9J A;  1QZ5 A;  4CJQ A;  1RBR A;  3AO1 A;  1EET A;  4OPJ A;  2F9T A;  4DR4 K;  3QML A;  2AJQ A;  3U6F A;  2F8S A;  1S9E A;  2DFH A;  1S1W A;  3ZSR A;  4OPA A;  3DXK B;  1SL2 A;  1TKZ A;  4IG3 A;  4O0J A;  4LF8 K;  4E7K A;  4O0I A;  5JLF A;  2QWQ A;  2ZGZ A;  4IBN A;  1U48 A;  2Q1N A;  4M42 A;  3CCQ N;  2O4G A;  1KVC A;  1VK0 A;  5HRN A;  1K8K B;  2FXU A;  3RSE B;  3NH0 A;  4B9U A;  4ELT A;  3I33 A;  3WQU A;  4CJR A;  4MO5 A;  5J2P A;  3NVK A;  4X62 K;  1OVY A;  4E19 A;  2X6S A;  3KK3 A;  1W97 L;  4NYN A;  4KI4 A;  2HNY A;  4DFM A;  4NYF A;  2OTL N;  1YUW A;  1UWB A;  4BVP A;  1KAY A;  4DV0 K;  3LWL A;  1K9M O;  3MN9 A;  1YJN N;  2HHV A;  4KO0 A;  4Y1C A;  2A41 A;  4XH1 A;  5AZJ B;  3OYN A;  3VEY A;  3KLE A;  2P9K A;  3ZT3 A;  5DK5 A;  5BRF A;  3HRG A;  3K58 A;  2JGU A;  4YDU A;  4DSJ A;  4JI5 K;  3VQ8 A;  3QES A;  2BE2 A;  1KD1 O;  3AVM A;  4CJL A;  4B9T A;  5GAG P;  4YOW A;  1ZC6 A;  3A0I X;  3KLG A;  4CIG A;  2NLX A;  1IBM K;  2KHO A;  3TAP A;  1KLN A;  1ZBF A;  1Q86 O;  3NVM A;  1QTM A;  1GLJ O;  1V4S A;  3DXM B;  3P1G A;  3DM2 A;  1C0T A;  3KK1 A;  4CZG A;  4C8K A;  2WTU A;  3DOL A;  1SL1 A;  5EOY A;  3AVH A;  1ILY A;  3K2P A;  4FK2 A;  1WN7 A;  1C6V A;  4FJK A;  1T8E A;  4GMJ B;  4B9S A;  4FJM A;  1N8R O;  1S5J A;  3ZYY X;  1J53 A;  4FWS A;  2UUB K;  4DS5 A;  1C0M A;  2D0C A;  2KQ2 A;  3V9Z A;  3ZX2 A;  3K59 A;  3H46 O;  1NGA A;  4CJ4 A;  1YVU A;  1SL0 A;  3BF3 A;  4ELV A;  3NGI A;  3AVI A;  1SKS A;  3U3G A;  4FJ7 A;  1LWC A;  4H0T B;  3ZSO A;  1JXB A;  2ZF5 O;  4CFB A;  3KTQ A;  3O80 A;  2E2P A;  1GOC A;  1S1V A;  4H0O A;  4LSN A;  1QQN A;  3PX0 A;  3KHY A;  3AVF A;  3LP2 A;  5A2Q O;  3AA5 X;  1LWE A;  2QM1 A;  4DTS A;  4DSL A;  3AVA A;  3V1O A;  4Z4C A;  4Q5V A;  3QET A;  3ZSW A;  2PBD A;  4OJR A;  2OZM A;  3WUH A;  5AQI A;  3I8D A;  3UKU B;  3QNN A;  1REV A;  1RCH A;  1KVA A;  2QWP A;  3O3G A;  1NWK A;  3C7N B;  1DT9 A;  4KBO A;  3TTC A;  1U47 A;  3DJC A;  1E3M A;  4WQ4 A;  1N33 K;  4E7J A;  4CGJ A;  2UU9 K;  5LY3 A;  4DV5 K;  3VQD A;  2E6L A;  2NUB A;  1Y64 A;  4CHO A;  3M8Q A;  2E5L K;  3MEG A;  3NGZ A;  1M1K O;  4CEC A;  3GL1 A;  1QQO A;  4OVL A;  1BOT O;  3MXI A;  1HNX K;  1HKB A;  1RT5 A;  3E1Y A;  3DMJ A;  2HMI A;  3VQP A;  3S3M A;  4KHU A;  1RT7 A;  1S1T A;  1TAU A;  3VEO A;  3DLH A;  3MX5 A;  3WQT A;  3LWM A;  3GE1 A;  4M3Z A;  3FR0 A;  1YHQ N;  2WON A;  4FWQ A;  4JKE A;  1VQ6 N;  1RDW X;  4DWI A;  5E41 A;  4HWI A;  3BF1 A;  4JEP A;  3TTF A;  1JCE A;  2A42 A;  4FJL A;  3G0Z A;  4RW7 A;  3G4S N;  4B8A B;  4JKG A;  4GW6 A;  4Z4H A;  4AM7 A;  4LY7 A;  4KHN A;  3L0Q A;  1RDC A;  3OYD A;  1BQN A;  4DUZ K;  3IG1 A;  4X66 K;  2O8F B;  1NK7 A;  4M3X A;  5GAD P;  1XMQ K;  4DHY A;  4QCL A;  2PZS A;  4Z0U A;  3MEC A;  3ATV A;  2O8C B;  3TI0 A;  3V1R A;  3JS6 A;  4HVJ A;  3VER A;  4N47 A;  3QEV A;  1ZBS A;  4ICL A;  4EZ9 A;  4J2B A;  2O8E A;  1IKV A;  3HPO A;  1YJW N;  4CIE A;  1BA1 A;  5DMR A;  3PO4 A;  5CYM A;  3SJJ A;  3RRG A;  4DTX A;  4CFA A;  1VQ7 N;  3MN5 A;  4I6M B;  5TKY A;  2HHQ A;  4H8K A;  2IOC A;  1DGK N;  2BAN A;  4CJW A;  3THY A;  2WOM A;  2FC0 A;  4M7Y A;  4MO4 A;  4EZ6 A;  4JI7 K;  4BRH A;  4NLC A;  4N56 A;  3O4W A;  4OKE A;  4M3W A;  3OS1 A;  1FJG K;  4A2B A;  4C8L A;  2DY4 A;  5AQV A;  3CJC A;  5M1O A;  2RF2 A;  4PKI A;  4JKH A;  3J81 O;  4LF9 K;  2WFB A;  4AHU A;  2IGI A;  3HVR A;  5BN8 A;  1SQK A;  1U4B A;  2IS3 A;  5CY4 A;  4OO1 J;  3HOT A;  1KCF A;  4CF9 A;  4KI6 A;  3SK3 A;  3HBT A;  3S9H A;  3KK2 A;  2Y1J A;  3KLI A;  3SQ4 A;  3DI6 A;  1C1C A;  1QHA A;  3FFI A;  3W3D A;  2VCP A;  1SZ2 A;  5CYQ A;  3THW A;  4QAG A;  1ZYQ A;  1NMN A;  2JLE A;  5KQD A;  3TPQ A;  4DSI A;  1GOA A;  2VWK A;  4CVN E;  1X1P A;  3ENO A;  3CER A;  1YXQ A;  1SKW A;  1WB9 A;  3ZT2 A;  3LDN A;  1BIS A;  3I8B A;  5BR9 A;  3VMF B;  4FW2 A;  5LL6 Z;  2ZJQ L;  1N36 K;  5HL7 L;  3PX6 A;  4MDA A;  2HB5 A;  1J54 A;  1RNH A;  4CK2 A;  3SMS A;  3GG4 A;  4CJP A;  1U04 A;  1Q18 A;  3M8R A;  4AHR A;  1WUA A;  4KFB A;  3OHR A;  1XI1 A;  4H5N A;  2ASM A;  3VEW A;  2NNW A;  4N5S A;  1TK8 A;  2F8T A;  4DR5 K;  2ZJP L;  1G99 A;  3HM8 A;  4RW4 A;  3LDQ A;  3QFP A;  3K9K A;  2OZS A;  3S41 A;  3LM9 A;  3QER A;  4KTZ A;  4W5N A;  3VQC A;  3LZI A;  3U4L A;  1IG8 A;  3MCA B;  1Z26 A;  1Q82 O;  4UY8 O;  2NRR A;  1YTA A;  4RTF D;  4JLH A;  4BR4 A;  4CZE A;  1G15 A;  3EEQ A;  4FCY A;  3CPW M;  2P9I A;  2D1K A;  2P9N A;  3FFK B;  4OLA A;  1GLD G;  4JS5 A;  3PIO L;  1D8Y A;  5JMV A;  4BY9 C;  4A5A A;  3A5N C;  3QIO A;  4CF0 A;  3C65 A;  3U8X A;  3J7Z O;  3HO1 A;  1Q8I A;  4DQP A;  2HBJ A;  4C8O A;  4AIL C;  2HBL A;  2D0O A;  4BRE A;  4DCH A;  4FW1 A;  4J2A A;  4DV6 K;  1VQL N;  4CED A;  3TWH A;  4RW8 A;  4MDB A;  4CJK A;  1ZBI A;  1Z6R A;  1IJJ A;  2A1R A;  3H1V X;  3I0R A;  2O8B A;  1HYV A;  3PLA A;  3O1B A;  2D0A A;  1L3S A;  2PYL A;  2B5J A;  3CPE A;  4W5O A;  4OKJ A;  4IWV A;  2F7T A;  5DM7 L;  4TSX A;  3O9U A;  1C0U A;  3IUC A;  3HPH A;  3ID6 A;  1S6P A;  1ZBL A;  1E4G T;  3MED A;  3SUN A;  4BRG A;  2QWL A;  4O5B A;  3S3N A;  3P83 D;  4QOZ B;  1NGH A;  2Q0U A;  2HND A;  3AGK A;  2WC9 A;  3Q7B A;  5AR0 A;  4EAH D;  4EIA A;  4M63 C;  3EO3 A;  5BPN A;  3BUZ B;  3SNN A;  4C1N I;  1ATS A;  5HRP A;  3L2V A;  1X3M A;  4LF4 K;  3QIC A;  1IO2 A;  5HOO A;  1XWL A;  4BAC A;  1QQC A;  3AVK A;  3WXI A;  2EHG A;  1R59 O;  3KZB A;  3NHG A;  4A5B A;  3LAN A;  3OBY A;  1WNS A;  1W7A A;  4KRF A;  4JK7 A;  4H5T A;  2QW9 A;  1NJX A;  4X64 K;  4YOX A;  2P1J A;  1VSL A;  1WSH A;  1VRU A;  4CZH A;  4FJJ A;  1FKP A;  1HRH A;  5BRE A;  3J7Y P;  1BGX T;  1LV5 A;  4CJV A;  1R0A A;  4IO9 L;  3OS0 A;  3SZ2 A;  4DFK A;  2ZWH A;  5CZ1 A;  3CCE N;  3AAP A;  1Y97 A;  1NJY A;  2A3Z A;  4DV4 K;  4ZTJ A;  4EHT A;  1BQM A;  3M6G A;  2UXB K;  1TAQ A;  3H3O B;  3L4Q A;  4IOX A;  1FK9 A;  3NF8 A;  3RWU A;  3LAL A;  4H03 B;  3HPG A;  2BDP A;  3AVG A;  3K5N A;  1J5E K;  1RGI A;  4FPB A;  1WSF A;  4FJ5 A;  3FLC O;  4BRA A;  3D7E O;  3NDK A;  3SI6 A;  3C94 A;  4LH5 A;  4Y0W A;  2ZD1 A;  1SUQ A;  3HM9 A;  4FLV A;  1HX1 A;  2JWL A;  1VQP N;  1OH5 A;  3T1Y K;  3D45 A;  3SQ1 A;  5KGW A;  4CBW A;  4ELU A;  4BR5 A;  2RKI A;  3SMP A;  4RG8 A;  1VSJ A;  4LH4 A;  4Z94 A;  3ZET B;  4B3T K;  3O9Q A;  2PYJ A;  1XNR K;  2DTU A;  3TAM A;  3SUQ A;  4NCG A;  1WBB A;  2RHK A;  4LFA K;  1TVR A;  4E7L A;  4FWN A;  1BCM A;  1BWF O;  3ENH A;  3EZ5 A;  2VYP A;  2HOE A;  2CGL A;  1FW6 A;  4NCB A;  3LZJ A;  1P8Z A;  3TU5 A;  1L3T A;  3T3F A;  1U2V A;  3RMA A;  2OPQ A;  1TYQ A;  2E88 A;  4CZF A;  3E9P A;  4KHY A;  2IIR A;  4IFE A;  2F96 A;  3QIP A;  3VQ6 A;  5C24 A;  1Z25 A;  2O4I A;  2Z1H A;  5K14 A;  3L3V A;  4A61 A;  3C95 A;  4QS8 A;  4BRL A;  4B1X B;  4CK3 A;  1JLG A;  3CFO A;  3CXC M;  3M8S A;  2VGM A;  4IO8 A;  4B9V A;  1BCO A;  4U7B A;  3VF2 A;  4DG1 A;  3O1W A;  3DWL A;  2LSN A;  2HVH A;  3DLB A;  5ADX A;  3QEX A;  3WT0 A;  4FK0 A;  2P9L B;  3VA3 A;  4CGH A;  2UUA K;  4M45 A;  3CC7 N;  4CZI A;  2V7Z A;  4CZL A;  2GUP A;  1XNQ K;  2XY7 A;  3MAQ A;  1V4T A;  4ISF A;  3SCX A;  3RMB A;  4CGG A;  3TSP A;  3OYI A;  3DXK A;  3PIP L;  3QIN A;  1LW2 A;  1J5O A;  5C10 A;  4DU4 A;  1VQO N;  4OGC A;  4K8Z A;  3LAM A;  2RN2 A;  3ULE A;  4KTW A;  3RSE A;  1JXE A;  2A5X A;  1QSY A;  2HHX A;  5E84 A;  3ZEU A;  1RTD A;  1EQY A;  4DTU A;  2DPN A;  4CJT A;  4H0Y B;  1YIT N;  2QI2 A;  4FO0 A;  4EFH A;  1RT3 A;  5AQW A;  4BQL A;  1KSP A;  1KXP A;  4B1V A;  4O55 A;  4OPH A;  1VSM A;  2B6A A;  3O9T A;  3CIP A;  4CFD A;  1S1X A;  3P39 A;  1NGG A;  4DQI A;  4DQQ A;  4PHT X;  1EX4 A;  1MWK A;  1S9G A;  4MQ3 A;  5AZJ A;  4GV3 A;  4AM6 A;  2CGJ A;  3VES A;  3QBX A;  1I39 A;  3MWT A;  1HNV A;  5T7B A;  3D2E B;  2I7P A;  3NF9 A;  2YHY A;  4F2S A;  2YHW A;  4F3O A;  3WEE B;  1YT3 A;  3DRP A;  3FE1 A;  4BGA A;  5GAH P;  5AQU A;  3AVN A;  1UAX A;  4GNI A;  5AQX A;  3VA0 A;  3D2F A;  3W0L A;  3DXM A;  4H5V A;  4YOU A;  5I3U A;  1U49 A;  3QB0 A;  4N41 A;  2ITG A;  3NGY A;  2FBY A;  2VQF K;  4Y1D A;  3L2W A;  3LP0 A;  3CC2 N;  3VEN A;  4W5T A;  3CQX A;  3KK7 A;  1YAG A;  1TGO A;  3LAK A;  2YKN A;  3UIQ A;  4RWT A;  4C1N K;  4Z4F A;  1QQM A;  4CF1 A;  1MWM A;  5KPZ A;  1RDA A;  3AY9 A;  5I42 A;  3FZK A;  4H5R A;  3DLK A;  3V9X A;  1NGB A;  4MFB A;  1CLQ A;  3HST B;  1O1W A;  5I9E B;  3GDQ A;  2ZE2 A;  5M1N A;  4OLB A;  2NZT A;  3OYF A;  2VG7 A;  4FXD A;  4CZM A;  4FK4 A;  5EY4 A;  1NJI O;  4BWM A;  4F9O A;  4E7I A;  3ZLJ A;  3RMC A;  2FF3 B;  1TL1 A;  2KW4 A;  4LC9 B;  1NBW A;  2FSK A;  3R6M A;  4FJI A;  3H6E A;  3KIO A;  4CGI A;  4CZJ A;  5M1K A;  3BEX A;  3OYJ A;  3OBW A;  1XHZ A;  4JS4 A;  3O9S A;  3AGR A;  2G8H A;  2H3G X;  4DKW A;  4IZ9 A;  4KPY A;  4DV3 K;  4ILG B;  2P5O A;  3C6A A;  1Z05 A;  2OCE A;  3E66 A;  4KH5 A;  4FYD A;  1K73 O;  1GLC G;  4KTQ A;  2GEL A;  4FSV A;  3PX4 A;  5EU7 A;  4FOE A;  4JD2 B;  4FWR A;  3UKU A;  3M5R A;  4WQ5 C;  5M1F A;  2Y1I A;  4E0D A;  4JNE A;  4LF7 K;  4IFV A;  4BRN A;  1JKH A;  2VQE K;  2NRZ A;  5AQY A;  3K5O A;  1XUP O;  1JLF A;  5ELZ A;  3A5L C;  1NOZ A;  3LDO A;  4JV5 K;  4C8N A;  1L3V A;  1Q9X A;  2F4V K;  3L2Q A;  2E8A A;  3OJU A;  2NRH A;  4ISE A;  3SBT A;  3GBT A;  3SV3 A;  1IBK K;  2IVN A;  1A5W A;  1DTT A;  3VGL A;  4HCC A;  3JYT A;  5FRN A;  2ETJ A;  2G8F A;  3EY1 A;  3ZSX A;  4K43 A;  3HT3 A;  4HHT A;  4ID5 A;  3CHW A;  5J2M A;  2VG5 A;  4FOI A;  4JN4 A;  3BGR A;  4YFU A;  1ZBU A;  4FJ8 A;  3U9D A;  4FJH A;  3SBG A;  2HMP A;  1J9A A;  3VQ9 A;  4W5R A;  3U3Y A;  4IKF A;  1JCG A;  3G25 A;  2PY5 A;  1RBS A;  4FWP A;  3ISN C;  2UUC K;  3WNF A;  4C23 A;  4ILH A;  4DTR A;  3J7A P;  3ZX3 A;  3MN7 A;  5KTQ A;  4NLB A;  1KLM A;  4CHZ A;  4H4O A;  5HLF A;  4M3Y A;  3SPY A;  2QWN A;  1CZA N;  4DUY K;  3R3L A;  2X78 A;  3FZL A;  3DOK A;  3KKS A;  2E2Q A;  5EX5 A;  3CC4 N;  4JKG B;  1CXU A;  1P90 A;  1ZBH A;  1EWR A;  5AQS A;  3CQ8 A;  4DS4 A;  3VN5 A;  2P9U B;  4BRK A;  2W6K A;  3R1X A;  5AQF A;  5GIO A;  2IC3 A;  4WFN L;  4EP4 A;  2FBV A;  4X65 K;  3NAE A;  4I6M A;  4IEE A;  2QKB A;  4CJF A;  4LFB K;  3BZK A;  1HUX A;  1NK8 A;  4GV6 A;  2CH6 A;  3NH2 A;  5EXW A;  4I9L A;  4JRQ A;  3DLR A;  3RTV A;  1DTQ A;  4DTN A;  4JRP A;  4BDY A;  4YDU C;  1QSL A;  2GUI A;  2O8E B;  3ZSY A;  5M1P A;  4RW9 A;  3DLL L;  1ZXO A;  5LMN K;  4JI1 K;  4JHD B;  4BR2 A;  4IFY A;  3NF7 A;  3M1F A;  2EWS A;  2OPR A;  3C6H A;  4DB3 A;  3EE8 A;  3F9K A;  3NBP A;  1BIU A;  1IV0 A;  3UB5 A;  3CYM A;  2Z1J A;  3CCM N;  1W9H A;  2QWO A;  4BRO A;  2OPP A;  5BR8 K;  4CF8 A;  1VQK N;  3MK6 A;  4I7F A;  1OH7 A;  3OS2 A;  1BU6 O;  3ASM A;  4GVM A;  4PA1 A;  2E6M A;  3MXJ A;  3WXJ A;  3O5B A;  3ZT0 A;  1X9S A;  2VWB A;  5HRR A;  3ID8 A;  3F9M A;  4Q0B A;  1HNW K;  1LWF A;  4FLZ A;  5AQQ A;  3EKU A;  5M1Q A;  5LJW A; 
#chains in the Genus database with same CATH homology
 1B9D A;  1FKP A;  4NYN A;  1HRH A;  3OYB A;  4KI4 A;  1BGX T;  1WAF A;  2HNY A;  3G10 A;  4HUF A;  4DFJ A;  1LV5 A;  1YTU A;  4CJV A;  3L2U A;  3ZT4 A;  4NYF A;  4DFM A;  3O3F A;  2D5R A;  1R0A A;  2VG6 A;  1UWB A;  3CG7 A;  1DLO A;  3OS0 A;  3SZ2 A;  4DFK A;  5FRO A;  2XRI A;  5CZ1 A;  3LWL A;  1Y97 A;  1NJY A;  4RW6 A;  2HHV A;  4ZTJ A;  4KO0 A;  1BQM A;  3KLF A;  1TAQ A;  1FK9 A;  3NF8 A;  4Y1C A;  4DTM A;  3RWU A;  3LAL A;  3LPU A;  3AVL A;  3OYN A;  1HNI A;  3HPG A;  4FM0 A;  2BDP A;  3MEE A;  3AVG A;  1L3U A;  3B6O A;  2HHW A;  4KV8 A;  3K5N A;  3D0P A;  3KLE A;  3K58 A;  3ZT3 A;  5DK5 A;  3V1Q A;  2JGU A;  1WSF A;  4FJ5 A;  4DSJ A;  1ITG A;  4FJ9 A;  1QHT A;  3VQ8 A;  1HYZ A;  3NDK A;  3C94 A;  3QES A;  4LH5 A;  1B9F A;  2BE2 A;  3SI6 A;  4H4M A;  3AVM A;  4CJL A;  3AA2 A;  3WNH A;  4B9T A;  2ZD1 A;  4E3S A;  1SUQ A;  3HM9 A;  3K57 A;  3AO4 A;  4FLV A;  3V9W A;  1NKC A;  4CJU A;  3KLG A;  1U45 A;  1D9D A;  4UQG A;  4CIG A;  3LDS A;  1BHL A;  3D45 A;  3SQ1 A;  5KGW A;  1KLN A;  3TAP A;  3OYG A;  2BGG A;  4ELU A;  1ZBF A;  2RKI A;  4RG8 A;  1VSJ A;  3V6D A;  4HUG A;  4LH4 A;  1QTM A;  1L5U A;  2OA8 A;  4FLW A;  2A1S A;  4C8M A;  1BI4 B;  1HPZ A;  3P1G A;  5HRS A;  3DM2 A;  2PYJ A;  1C0T A;  3KK1 A;  2P5G A;  1KTQ A;  2DTU A;  3TAM A;  4C8K A;  3SUQ A;  3DLE A;  3DOL A;  1SL1 A;  4CIF A;  4NCG A;  1TVR A;  4E7L A;  3O4Q A;  1BCM A;  1SV5 A;  1VSH A;  3EZ5 A;  3KD1 E;  4CES A;  2OPS A;  1C1A A;  3TAF A;  2HHU A;  3AVH A;  4B08 A;  3K2P A;  4FK2 A;  1WN7 A;  4FLX A;  5HBM A;  5KRS A;  1RTJ A;  3LZJ A;  1C6V A;  3OYH A;  3QNO A;  1L3T A;  3T3F A;  3SQ0 A;  3RMA A;  4FJK A;  3PY8 A;  4W5Q A;  1T8E A;  2OPQ A;  4KHY A;  2F96 A;  3ITH A;  3QIP A;  4GMJ B;  3VQ6 A;  2W42 A;  1RDB A;  3QLH A;  4B9S A;  5C24 A;  1TV6 A;  3PO5 A;  4FJM A;  1Z25 A;  1S5J A;  3SYZ A;  4CHP A;  2Z1H A;  2O4I A;  4CEB A;  1GOB A;  3L3V A;  5K14 A;  3OJS A;  4OGE A;  1IG9 A;  1MU2 A;  3C95 A;  3MXM A;  3WNG A;  4CK3 A;  1J53 A;  4DQR A;  1JLG A;  3CFO A;  3KKR A;  3M8S A;  3T1A A;  1HQE A;  4CGF A;  4NCA A;  2KZZ A;  4DS5 A;  1WSH A;  4B9V A;  1BCO A;  1C0M A;  2D0C A;  2KQ2 A;  3V9Z A;  3TAN A;  1FXX A;  4KAZ A;  3NCI A;  3QO9 A;  4DG1 A;  2KFZ A;  2LSN A;  2HVH A;  3K59 A;  1HQU A;  3DLB A;  5C42 A;  3QEX A;  4CFC A;  4CEZ A;  4CJ4 A;  4FK0 A;  1YVU A;  2YV0 X;  3VA3 A;  4CGH A;  3OY9 A;  1SL0 A;  3SUO A;  1KVB A;  2IAJ A;  4ELV A;  4CGD A;  1CZ9 A;  3NGI A;  1QE1 A;  1IH7 A;  4M45 A;  3RR8 A;  1LAW A;  3AVI A;  4M3T A;  1SKS A;  3U3G A;  4FJ7 A;  1X9W A;  1LWC A;  1UOC A;  2B4J A;  2Z1G A;  3OYC A;  3ZSO A;  1JXB A;  4CJS A;  4CFB A;  3MAQ A;  4DFP A;  3HXM A;  2XY7 A;  1NK4 A;  3KTQ A;  5SZT A;  3SCX A;  2E4L A;  1GOC A;  1S1V A;  4CGG A;  4HUE A;  3RMB A;  3OYI A;  4LSN A;  4PWD A;  3PX0 A;  3AVF A;  3LP2 A;  3QIN A;  4BDP A;  1LW2 A;  4YNQ A;  4PUO A;  3AA5 X;  1J5O A;  1LWE A;  4E1M A;  4DU4 A;  4OGC A;  3HL8 A;  4K8Z A;  4F3T A;  3TAQ A;  3LAM A;  1JLC A;  2RN2 A;  4B8C A;  4DTS A;  5HRO A;  4DSL A;  3AVA A;  4HCB A;  4IDK A;  4KTW A;  3V1O A;  4Z4C A;  1JXE A;  4Q5V A;  4FLY A;  1JL2 A;  1QSY A;  1RT1 A;  3QET A;  3ZSW A;  2HHX A;  3BDP A;  4OJR A;  5FDL A;  2OZM A;  1RTD A;  3V81 A;  3OYE A;  3I8D A;  3DRS A;  4AHV A;  4DTU A;  3QEI A;  2OYQ A;  3SQ2 A;  1NOY A;  3QNN A;  4CJT A;  4CE9 A;  1REV A;  3IS9 A;  4CHQ A;  3O4N A;  4FZY A;  3HYF A;  1RT3 A;  1RCH A;  1KVA A;  1KSP A;  1K6Y A;  3O3G A;  1D9F A;  4O55 A;  1VSM A;  1JLQ A;  2XY6 A;  2B6A A;  1U47 A;  4CFD A;  4Z4E A;  4E7J A;  1S1X A;  4CGJ A;  3P5J A;  1TKD A;  1A5V A;  4DQI A;  4DSK A;  3VQD A;  2E6L A;  3AVB A;  4DQQ A;  2NUB A;  4DLG A;  3ZSZ A;  2KZM A;  3ULD A;  1B92 A;  1EX4 A;  1S9G A;  3M8Q A;  4MQ3 A;  4CHO A;  1LW0 A;  3MEG A;  3NGZ A;  1I39 A;  3IAY A;  3H08 A;  4CEC A;  4OVL A;  3MXI A;  2XY8 A;  4FLT A;  1HNV A;  5T7B A;  1RT5 A;  1TKX A;  1NKB A;  3DMJ A;  2HMI A;  3VQP A;  3S3M A;  4KHU A;  1BIZ A;  1RT7 A;  1S1T A;  3NF9 A;  3VQB A;  1TAU A;  3DLH A;  2G8W A;  4F2S A;  3LWM A;  3AVJ A;  4DTP A;  1RDD A;  4CEE A;  4F3O A;  3SPZ A;  2HHT A;  1YT3 A;  3DRP A;  4BE0 A;  3I0S A;  4M3Z A;  3AVN A;  1UAX A;  1WAJ A;  3ALY A;  3AV9 A;  4ID1 A;  3S3O A;  1IKX A;  2G8V A;  3E01 A;  2WON A;  3VA0 A;  3B6P A;  4DWI A;  1BI4 A;  5E41 A;  5I3U A;  1T05 A;  1U49 A;  4FM2 A;  4N41 A;  2ITG A;  3NGY A;  2FBY A;  4WE1 A;  2HNZ A;  4FJL A;  4FJN A;  3VQQ A;  4Y1D A;  3OYA A;  3LP0 A;  3L2W A;  3G0Z A;  4RW7 A;  4B8A B;  3VQA A;  4W5T A;  3TAR A;  2FBT A;  4GW6 A;  4Z4H A;  4CEQ A;  1TGO A;  2IDO A;  4LY7 A;  4KHN A;  4FJX A;  4NCB A;  3LAK A;  1NKE A;  3KD5 E;  2YKN A;  3UIQ A;  1RDC A;  1S6Q A;  4Z4F A;  4CF1 A;  1WSG A;  3VQ4 A;  1RDA A;  3OYD A;  2Z1I A;  1BQN A;  4KHW A;  1WSI A;  2KTQ A;  4CHY A;  5I42 A;  4B9L A;  4KRE A;  3IG1 A;  1KFD A;  2GV9 A;  3LP1 A;  4DMN A;  3ZSV A;  3OYM A;  3DLK A;  1NK7 A;  1KFS A;  4M3X A;  4QCL A;  4CHN A;  3V9X A;  3CM6 A;  4DF8 A;  4CJ5 A;  2PZS A;  4MFB A;  1VSE A;  1CLQ A;  1WSJ A;  3HST B;  4Z0U A;  1O1W A;  3MEC A;  4FM1 A;  3WNE A;  2ZE2 A;  3LP3 A;  4DLE A;  3TI0 A;  4OLB A;  3OYF A;  2VG7 A;  4FXD A;  1TK5 A;  3JSM A;  3V1R A;  4OPK A;  3K5M A;  4HVJ A;  4FK4 A;  3QEV A;  4N47 A;  1NJZ A;  4ICL A;  4EZ9 A;  3AA4 A;  4BWM A;  4J2B A;  3SV4 A;  1IKV A;  3HPO A;  4E7I A;  4O4G A;  3K5L A;  4CIE A;  5DMR A;  3RMC A;  3AA3 A;  1TL1 A;  5CYM A;  3SJJ A;  2KW4 A;  4CFA A;  4DTX A;  3PO4 A;  3RRG A;  4J2D A;  2I5J A;  1FKO A;  4FJI A;  3KIO A;  2HHQ A;  1RIL A;  4H8K A;  4B9N A;  2IOC A;  2QKK A;  3PV8 A;  4IG0 A;  4CGI A;  2BAN A;  4CJW A;  4BDZ A;  3OYJ A;  2WOM A;  3TAG A;  1XHZ A;  4JS4 A;  1EKE A;  2FC0 A;  3M8P A;  1F21 A;  2G8H A;  1LAV A;  4I2Q A;  3LPT A;  4DSE A;  1KRP A;  3EYZ A;  4FZZ A;  4KPY A;  4EZ6 A;  4K8X A;  2FBX A;  2P5O A;  4FYD A;  4N56 A;  4KHQ A;  4OKE A;  4M3U A;  3NH1 A;  3TAB A;  4M3W A;  3OS1 A;  1JLA A;  4C8L A;  2DY4 A;  1RT6 A;  1S1U A;  4KTQ A;  2RF2 A;  3PX4 A;  2QXF A;  5EU7 A;  2YHA A;  5FRM A;  1X9M A;  3NFA A;  4AHU A;  2IGI A;  5C25 A;  3O3H A;  3HVR A;  1HMV A;  3TR8 A;  2IS3 A;  5CY4 A;  3ZT1 A;  5J2N A;  3QEP A;  1KCF A;  4CF9 A;  4KHS A;  4KI6 A;  1HYS A;  1IKY A;  4E89 A;  3S9H A;  4KB0 A;  2Y1I A;  3KK2 A;  4DU3 A;  2Y1J A;  4E0D A;  3DYA A;  3KLI A;  3SQ4 A;  1NK0 A;  3DI6 A;  3T19 A;  1I3A A;  3C6T A;  4CCH A;  1C1C A;  4IFV A;  4BE1 A;  3AO5 A;  2G8U A;  1SKR A;  3DRR A;  5KI6 A;  2G8K A;  4DTJ A;  1JKH A;  2HVI A;  4I9Q A;  1CZB A;  3K5O A;  2XHB A;  3NF6 A;  4G1Q A;  3CM5 A;  1JLF A;  1QSS A;  4R5P A;  4O44 A;  3V4I A;  1RT4 A;  3FFI A;  1NOZ A;  2KFN A;  4DU1 A;  2X74 A;  5CYQ A;  2YNG A;  4QAG A;  1ZYQ A;  4C8N A;  4CER A;  1L3V A;  5KRT A;  2JLE A;  4F8R A;  4DTO A;  1Q9X A;  2X6N A;  4DSI A;  4J2E A;  1GOA A;  2VWK A;  5CZ2 A;  4L8R B;  1X1P A;  3OJU A;  3L2Q A;  4DF4 A;  1JLE A;  1SKW A;  2DFE A;  3HK2 A;  1VSK A;  3ZSQ A;  3ZT2 A;  3SV3 A;  1BIS A;  4AHS A;  3HP6 A;  2DFF A;  4B9M A;  1D5A A;  1TK0 A;  1A5W A;  4ZHR A;  1NK9 A;  4CK1 A;  1DTT A;  1XC9 A;  3HP9 A;  4FW2 A;  1VSL A;  3PX6 A;  4HCC A;  2HB5 A;  1J54 A;  1RNH A;  4CK2 A;  3JYT A;  4I2P A;  5FRN A;  4CJP A;  1U04 A;  3AVC A;  2YNI A;  1VSF A;  2ETJ A;  3PUF A;  4N76 A;  2P51 A;  3M8R A;  2G8F A;  3EY1 A;  4OKK A;  3AO3 A;  3VQ5 A;  4AHR A;  4KFB A;  2VWJ A;  4AH9 A;  3ZSX A;  1XI1 A;  4FLU A;  1ASV A;  4N5S A;  4BE2 A;  3HT3 A;  1TK8 A;  4FJG A;  4HHT A;  4XIU A;  4CJ3 A;  1N5Y A;  2F8T A;  1U4B A;  4ID5 A;  5J2M A;  1WSE A;  2HHS A;  1EP4 A;  1JL1 A;  1RBT A;  2VG5 A;  4RW4 A;  1HJR A;  3BGR A;  4YFU A;  2OZS A;  1ZBU A;  1VSD A;  4AHC A;  3L2R A;  3QER A;  4KTZ A;  4FJ8 A;  4FZX C;  3VQC A;  4FJH A;  4W5N A;  1J9A A;  3VQ9 A;  3LZI A;  4W5R A;  5SWM A;  1RBU A;  3U3Y A;  3HVT A;  3RMD A;  4IKF A;  1Z26 A;  4Z4G A;  2XO7 A;  2PY5 A;  1YTA A;  1RBS A;  4JLH A;  3ISN C;  3WNF A;  4KKO A;  2RPI A;  1G15 A;  4DTR A;  4FCY A;  1TKT A;  5D3G A;  3THV A;  2QK9 A;  5KTQ A;  3CFR A;  4OLA A;  1ASW A;  1JLB A;  1T7P A;  4Z4I A;  4JS5 A;  1D8Y A;  1KLM A;  4CHZ A;  4CF2 A;  1RBV A;  4H4O A;  5HLF A;  4M3Y A;  2EX3 A;  3SPY A;  3TAE A;  3F73 A;  3C6U A;  3V9U A;  3QIO A;  1ASU A;  3KJV A;  4CF0 A;  4BWJ A;  2X78 A;  2ATQ A;  3HO1 A;  1UA1 A;  1BL3 A;  3DOK A;  3KKS A;  1Q8I A;  1IKW A;  2GBZ A;  4DQP A;  1N6Q A;  4HTU A;  4C8O A;  2ZQB A;  4AIL C;  1CXU A;  1ZBH A;  3KLH A;  3ZCM A;  1QS4 A;  3A2F A;  3CQ8 A;  4E7H A;  4DS4 A;  3VN5 A;  1TL3 A;  3SUP A;  4FW1 A;  1VSI A;  4FVM A;  4DSF A;  4J2A A;  3DLG A;  3L3U A;  4AHT A;  4CED A;  3TWH A;  2IC3 A;  4RW8 A;  4EP4 A;  2FBV A;  2YHB A;  4CJK A;  3NAE A;  1ZBI A;  4F4K A;  2QKB A;  3HJF A;  2A1R A;  4CJF A;  1RT2 A;  4LSL A;  1NK8 A;  3L8B A;  2G8I A;  3I0R A;  3RR7 A;  5JS1 A;  1VRT A;  1HYV A;  3IRX A;  3OYK A;  5HP1 A;  3NH2 A;  2D0A A;  2YKM A;  1XHX A;  1UA0 A;  1NK5 A;  2YNF A;  2D0B A;  3VQ7 A;  1L3S A;  2PYL A;  4I9L A;  4JRQ A;  2B5J A;  3DLR A;  4F2R A;  2Q3S A;  1CXQ A;  3RTV A;  1DTQ A;  4W5O A;  4OKJ A;  4JRP A;  4DTN A;  4M41 A;  4BDY A;  1QSL A;  4PQU A;  1WLJ A;  3QEW A;  2GUI A;  2YNH A;  3ZSY A;  4TSX A;  3OVN A;  4RW9 A;  4CJE A;  5J1E A;  4DQS A;  1T03 A;  1C0U A;  3OYL A;  3AO2 A;  2R7Y A;  4CEO A;  3HPH A;  1S6P A;  1ZBL A;  4LD0 A;  4IFY A;  3MED A;  3CFP A;  3SUN A;  1EXQ A;  2X6S A;  3NF7 A;  4CEF A;  1RTH A;  1NK6 A;  1Q9Y A;  4O5B A;  3S3N A;  3P83 D;  4QOZ B;  3V9S A;  4CJQ A;  4CEA A;  4B3O A;  1RBR A;  2OPR A;  2HND A;  3AO1 A;  1EET A;  4OPJ A;  5J2Q A;  5KGX A;  2AJQ A;  4M3R A;  3U6F A;  2F8S A;  3F9K A;  3NBP A;  3RRH A;  1S9E A;  2DFH A;  1S1W A;  3SNN A;  1BIU A;  3ZSR A;  3CYM A;  5HRP A;  2Z1J A;  3L2V A;  1SL2 A;  1TKZ A;  5JS2 A;  4PY5 A;  1W0H A;  1IO2 A;  1W9H A;  4IG3 A;  4O0J A;  4EP5 A;  1XWL A;  4E7K A;  4E1N A;  4O0I A;  4BAC A;  1QQC A;  2OPP A;  3AVK A;  1U48 A;  4IBN A;  2EHG A;  3NHG A;  2HW3 A;  4CF8 A;  4M42 A;  2O4G A;  1C1B A;  3LAN A;  1WNS A;  1KVC A;  1RTI A;  1VK0 A;  5HRN A;  4I7F A;  3NE6 A;  2XY5 A;  4KRF A;  3OS2 A;  1NJW A;  3NH0 A;  3ASM A;  4GVM A;  4PA1 A;  2E6M A;  3MXJ A;  1NJX A;  4B9U A;  4ELT A;  4ZTF A;  3VQE A;  3ZT0 A;  4CJR A;  1X9S A;  5HRR A;  4KB1 A;  1A5X A;  5J2P A;  4Q0B A;  1LWF A;  4E19 A;  2P1J A;  1VRU A;  3KK3 A;  4FLZ A;  4FJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...