3CM6A

Crystal structure of cell-death related nuclease 4 (crn-4) bound with er
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
294
structure length
294
Chain Sequence
HCPFDTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFERVLPLVVTTIRAGDFRLEMYGVCRYCRKGMDVCGTSHQQTPHDLYKNEEDPIHFAKIAGYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell death-related nuclease 4
publication title Crystal structure of CRN-4: implications for domain function in apoptotic DNA degradation
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase, apoptosis
total genus 87
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3cm6A01
4FW2A 4Z4CA 3ZCMA 3CFRA 1ZBIA 4C8NA 3CYMA 1CXUA 1VSLA 2QXFA 1O1WA 2RN2A 3H08A 3DLKA 3AA2A 3VQ8A 4CHNA 4DQRA 3EZ5A 1D9DA 1FXXA 2XY5A 4FJNA 3HK2A 4AHCA 3JYTA 1R0AA 4HHTA 3HPOA 2BANA 2O4IA 1U04A 1VSHA 4CESA 2OZMA 3SQ1A 3ZT1A 3OYLA 4I2QA 1SKWA 1CZ9A 3SUPA 2Z1IA 4ELTA 4PUOA 3A2FA 3CFPA 1VSFA 3NHGA 2D0AA 3OVNA 4F2RA 3AVKA 5HBMA 3RMCA 2IAJA 3TWHA 1NK5A 4Y1CA 2KFNA 3IRXA 4JRQA 1JLAA 4AHVA 4KAZA 3RMAA 4DU4A 4OKEA 3LP0A 4B9UA 3ZSRA 4CJUA 4FLVA 1RBSA 1FK9A 1RT3A 3PO5A 5JS1A 1XHZA 3LZIA 4B8AB 3QESA 4N76A 1C1CA 2QKBA 4CIFA 4CJSA 3EY1A 4CEOA 1LW0A 1ZBLA 1J54A 4DQIA 1NJXA 4FJGA 4W5OA 3KTQA 4CEFA 1HJRA 4CGHA 2G8WA 2HVHA 3KLHA 4IFYA 4M3UA 3RTVA 4QAGA 3VQ7A 1J5OA 1SL2A 3NH1A 5HRNA 3HVTA 2P51A 1Z25A 4M45A 1D5AA 1JL1A 5FROA 3QERA 4DS5A 3TAFA 3NGIA 1JLEA 4CECA 4CEQA 3KK2A 3PY8A 1HRHA 1YVUA 3MECA 4HUEA 1RT7A 5KGXA 2XHBA 3HYFA 1HYSA 3V1QA 3AVCA 2E4LA 2YHBA 3OS1A 4KPYA 1S1VA 4B9VA 3CM6A 4IBNA 1A5XA 4CHYA 1B9FA 3QEXA 3RMBA 3TAQA 1L3TA 2HNYA 2G8FA 1WSEA 4CJ4A 4L8RB 2B6AA 1D8YA 1ITGA 4F3TA 4CJPA 4CFDA 2BE2A 4LSNA 4LH5A 2XY7A 2ZE2A 3WNHA 3OYJA 2X74A 3MXJA 1CLQA 2VG6A 1S9EA 2YNHA 3VA3A 3SPYA 2ATQA 3DLBA 1LWEA 4Z0UA 2DFEA 1JXEA 3MEEA 1W0HA 4E7LA 4HCCA 1IKVA 2LSNA 1TKDA 4AH9A 1ASUA 1UAXA 4DU1A 1T05A 2A1RA 4DSEA 5D3GA 4CK2A 3DLRA 4MQ3A 1MU2A 4KTZA 3THVA 1YTAA 5CYQA 3QO9A 1DTTA 4FK2A 3OJUA 3V9XA 4E19A 4B8CA 4DTXA 1ZBUA 4O55A 1NK4A 2YHAA 1SV5A 5CZ2A 4ELVA 2HHQA 4KI4A 3L2UA 3ZSWA 3TAEA 1RT1A 1QSSA 3QEPA 4C8LA 3AVFA 1BQNA 1WLJA 4JS5A 4BE0A 4PY5A 3ISNC 3AVMA 4E1NA 1GOBA 3JSMA 5FDLA 3C94A 1WSJA 4KI6A 5J2PA 3VQEA 2F8TA 3DYAA 2P1JA 3L3VA 1TAQA 3PV8A 3SNNA 3IG1A 5C24A 3O3HA 3VQPA 3TI0A 2G8KA 1D9FA 1I39A 4IG0A 1NOYA 1BCMA 3O3GA 3AO4A 3M8QA 4K8ZA 3ZSZA 1RTHA 1SL0A 4RW7A 4KHSA 1J53A 3IS9A 3AVHA 3C6TA 5J2MA 3C95A 4AHTA 3HVRA 2IC3A 2RPIA 4B9SA 1IKYA 1NJYA 1RT5A 2WOMA 4F8RA 4FJXA 1XWLA 3ZSOA 3S3OA 1X9WA 3KLFA 3OYIA 3O4QA 3MXMA 4BDYA 5E41A 4M42A 2IS3A 4WE1A 1NJZA 1KFDA 4CGGA 4BDZA 3NF8A 4H8KA 4CJKA 4FM0A 2G8UA 4C8KA 4IG3A 3D0PA 3HXMA 4KTWA 4YFUA 3AA3A 4NCGA 3WNFA 4E7KA 2XY6A 3I8DA 3HM9A 3AVIA 4DWIA 2HHUA 1KRPA 4J2AA 1DLOA 4CEDA 3NF9A 5I42A 1NKEA 4CE9A 1HNIA 1WNSA 3CFOA 3K5LA 1BIZA 3QINA 2PYLA 1XC9A 1S6PA 2D0BA 4FJ8A 4Q0BA 3QNOA 5KGWA 1S9GA 4DF4A 4BACA 3KJVA 3KKSA 4DTUA 3PX6A 2IGIA 4BDPA 3VQ5A 4DQQA 2F8SA 3P83D 1W9HA 3IAYA 1KVAA 2DTUA 4FJIA 3O4NA 2P5GA 1LWFA 4FVMA 4OKKA 4E7HA 4M3YA 4FYDA 4CFAA 3SZ2A 4FJLA 4CGIA 3RRHA 2KFZA 4CJEA 3D45A 4F2SA 1TVRA 3AVAA 2OZSA 3V1RA 2G8IA 2BGGA 2B5JA 4KTQA 4Z4EA 1XHXA 1G15A 4CEBA 3ZSYA 2X6SA 1WSHA 4O0IA 3SJJA 4FLZA 4DFPA 3SI6A 1N5YA 4B9NA 1UOCA 2HHVA 1GOCA 2HNDA 3V9UA 2DY4A 4FJMA 1UWBA 2FBXA 3VQ9A 3PX4A 3TAPA 1WN7A 3SQ4A 4CHZA 3HSTB 2O4GA 3NGZA 3TAMA 5I3UA 3DRPA 2GUIA 4CEAA 4M3TA 1VSMA 1BIUA 3NF7A 1JL2A 4EP4A 1T8EA 1RDAA 1X9SA 4CGJA 4E7IA 3SCXA 4YNQA 2ETJA 1FKOA 3HP6A 5CZ1A 1S6QA 2EHGA 3G0ZA 3CQ8A 4FZZA 2A1SA 1BHLA 4FLUA 1JXBA 2PYJA 1L5UA 1TL3A 3KD5E 1SKRA 3OYAA 2IDOA 4LY7A 1TL1A 3VQ6A 5KRTA 2ZQBA 4O5BA 3NDKA 1J9AA 3K59A 3SV3A 3HJFA 1EXQA 2Z1JA 3NAEA 3DM2A 2PZSA 2EX3A 1NKCA 1VSIA 1RDBA 4AHSA 1TKTA 2HW3A 2B4JA 3L2QA 4DSIA 1IKWA 3OYHA 4FW1A 3M8SA 1U4BA 4FJ9A 4IFVA 2HHSA 4FLWA 3SQ0A 1LAVA 3F9KA 3DI6A 4RW4A 4KFBA 4DLGA 2KZMA 3K5MA 1QS4A 3SV4A 1ASVA 4B08A 3AO1A 4AHRA 2VG5A 5FRNA 4J2DA 3LPTA 5EU7A 4I2PA 1HMVA 3L2VA 3LZJA 1SKSA 4EZ6A 1EX4A 2E6MA 1IG9A 3QEWA 1S1WA 1JLQA 4W5RA 3AO3A 3KLEA 3KK1A 1Q9YA 4KKOA 3ZT2A 3OYFA 4DSJA 2XY8A 4BE1A 4XIUA 3OJSA 3LAKA 3OYCA 1RTDA 4NYNA 1VRUA 4KREA 4F3OA 3T19A 4CHPA 3AVLA 2KZZA 3OYKA 4W5NA 3SPZA 4QOZB 3BDPA 3L2RA 4JRPA 1NK6A 1ASWA 4M3RA 4E89A 4DU3A 4PWDA 3DLGA 3P5JA 1RCHA 1C6VA 4FLXA 3U3YA 1KLNA 3PO4A 3HPHA 3OYGA 4K8XA 1L3UA 1N6QA 4UQGA 5J2NA 2GBZA 3RMDA 3HL8A 4DQSA 3K5NA 3NH0A 5CY4A 2QK9A 2Z1HA 2DFFA 4DSFA 3RWUA 3LP1A 1TGOA 1HPZA 3QLHA 4OKJA 4DTSA 2HVIA 1B9DA 4NCBA 4N5SA 4OGEA 4E7JA 4DTRA 1VSDA 4DG1A 1QHTA 2YNIA 1WSIA 3VQCA 4OLBA 3CG7A 3L8BA 1F21A 3FFIA 3NH2A 3LANA 3OYEA 4DTMA 1RBVA 4DQPA 1T03A 1S1UA 1ZBHA 4OGCA 4Z4GA 1KLMA 4FJ7A 1REVA 2FC0A 4FK0A 3AO2A 2QKKA 1RT4A 5HRRA 3ZT4A 4E0DA 1I3AA 1LW2A 1TK8A 3SYZA 5SWMA 1HYZA 4JLHA 1Y97A 2F96A 2RF2A 2IOCA 2VG7A 4BWJA 4OVLA 4G1QA 3V81A 1BL3A 1HYVA 3AVGA 3WNEA 4CHOA 4M3WA 2OPSA 1YTUA 4O4GA 4FCYA 4ELUA 1TKXA 3LP3A 4DF8A 3KKRA 1XI1A 1U49A 1QE1A 4LSLA 4AHUA 3ZSVA 4KHYA 4FXDA 4B3OA 4KHQA 2Q3SA 1RBTA 2KQ2A 4KO0A 1TV6A 3VA0A 1X9MA 3AVJA 5FRMA 2ZD1A 5KI6A 3NFAA 4CF2A 4FLYA 1L3VA 4BE2A 3E01A 4DSKA 4J2EA 3U6FA 3DOLA 4Q5VA 3V9WA 1U45A 3VQQA 3SUNA 1C0TA 1C0MA 4FJ5A 4KB0A 1NKBA 1C1BA 1KVBA 1IO2A 4Z4HA 2KTQA 5HROA 1QQCA 4CERA 4CJVA 3RRGA 4LD0A 4CFCA 4NCAA 3L2WA 3B6PA 4HCBA 4CJ3A 3T3FA 2P5OA 1JLGA 3P1GA 1BQMA 3OY9A 3V9ZA 3V6DA 4M3ZA 1HQEA 3O3FA 2HB5A 4CF8A 3TR8A 3CM5A 5DMRA 4RW9A 4DTJA 2XRIA 3AVNA 4ID5A 4CF1A 5T7BA 1BGXT 1C1AA 4HUFA 3AO5A 2X6NA 4M3XA 1QSLA 1KFSA 3VQBA 3ZT3A 2Z1GA 4C8OA 4DLEA 4C8MA 2FBTA 4KRFA 1BCOA 4DTPA 4HVJA 3F73A 3WNGA 2OYQA 1DTQA 2R7YA 4ZTFA 2OPRA 4KHUA 1SL1A 1RDCA 3SUQA 4GMJB 1EP4A 4FZYA 1WSFA 1JLCA 2FBYA 3LWLA 3NGYA 4CGFA 2WONA 1QTMA 1K6YA 1Z26A 1T7PA 3NCIA 5HLFA 1UA0A 3DRSA 4PA1A 3T1AA 4Y1DA 1B92A 1GOAA 1VRTA 2VWKA 4FM2A 4B9TA 4HTUA 1RTJA 4CJLA 4ZHRA 3TABA 5C25A 2VWJA 4CJQA 2JLEA 1S1XA 3C6UA 2XO7A 4IDKA 4EZ9A 4CJWA 3MEGA 3KLIA 4CJRA 3PX0A 3DOKA 3K2PA 3VQ4A 4H4OA 5HRSA 4CHQA 1NK8A 3KIOA 3QIOA 1JLFA 3NF6A 4J2BA 5K14A 3S3MA 3SUOA 5HP1A 2G8HA 3K5OA 4N47A 1S5JA 3LDSA 3AA5X 4OJRA 1Q9XA 4EP5A 3OS0A 3M8RA 4ICLA 1Q8IA 1RTIA 4PQUA 1JLBA 4RG8A 5KRSA 4OPJA 4ZTJA 4RW6A 5C42A 1X1PA 1KCFA 3NE6A 3QEVA 4LH4A 3OS2A 4N56A 2KW4A 1QSYA 4W5QA 4DTOA 5HRPA 3HPGA 4ID1A 3VQAA 1A5VA 1EETA 3K58A 1RBUA 4E3SA 1ZBFA 3U3GA 2AJQA 1LWCA 3SQ2A 3MXIA 4FJHA 4I9LA 1JKHA 2NUBA 3OYMA 1KTQA 4KB1A 2HHTA 3QEIA 2OPPA 4E1MA 3S3NA 1LAWA 4H4MA 5KTQA 1HQUA 4CIGA 2YNGA 4R5PA 3MAQA 1U48A 1VK0A 2DFHA 3B6OA 3LALA 3OYDA 4KHWA 3HO1A 2HHWA 1IKXA 3BGRA 3DLEA 3ULDA 1NOZA 2OA8A 4GW6A 1LV5A 1CXQA 1VSJA 3AV9A 3HP9A 2Y1JA 1IH7A 2X78A 1RILA 4AILC 4DSLA 3L3UA 2YKMA 1CZBA 4JS4A 4HUGA 4TSXA 4FM1A 2YV0X 2D0CA 4N41A 3ITHA 5DK5A 4O44A 3DRRA 3LPUA 4GVMA 1NJWA 2PY5A 1KSPA 2HMIA 4CEEA 1TK0A 3DMJA 3I0RA 1RT6A 4CIEA 2YKNA 4NYFA 2W42A 4FK4A 4CK3A 4B9LA 3ASMA 1HNVA 1TAUA 4CK1A 1S1TA 1KVCA 3QNNA 3KLGA 3M8PA 1VSKA 4DMNA 3TANA 3ZSQA 2E6LA 1NK0A 1RT2A 4Z4FA 1RBRA 2D5RA 1WAFA 2G8VA 2YNFA 1TK5A 1NK9A 1RNHA 1EKEA 3EYZA 2I5JA 3RR8A 3S9HA 1FKPA 4DS4A 3QETA 3RR7A 1WSGA 2ITGA 2RKIA 3ZSXA 3PUFA 4FZXC 3AA4A 2BDPA 4M41A 4FLTA 3OYNA 4QCLA 1BISA 1YT3A 4MFBA 4OLAA 3I0SA 4BWMA 4DFMA 4KHNA 4FJJA 3VN5A 1WAJA 3LP2A 3QIPA 4CJ5A 2GV9A 4DTNA 1C0UA 3KK3A 1NK7A 4I9QA 3HT3A 5CYMA 3LAMA 3MEDA 3ALYA 4DFKA 4CJTA 3V4IA 1ZYQA 1VSEA 4RW8A 3ZT0A 4CF0A 5JS2A 4CGDA 5SZTA 4CF9A 3NBPA 1A5WA 2HNZA 4CFBA 3UIQA 3OYBA 4Z4IA 2FBVA 4F4KA 4IKFA 3V9SA 2HHXA 2Y1IA 5J1EA 3VQDA 1RDDA 3V1OA 3DLHA 1BI4B 4B9MA 4CEZA 4OPKA 1SUQA 2JGUA 4I7FA 3LWMA 4O0JA 4W5TA 4FJKA 3AVBA 4CJFA 1TKZA 3KD1E 2OPQA 3K57A 3G10A 3TAGA 4CCHA 4DFJA 1BI4A 1UA1A 4KV8A 1U47A 5J2QA 3TARA 1L3SA
chains in the Genus database with same CATH superfamily
4BREA 1VSLA 3R9PA 2QXFA 3VQ8A 1S72N 2E1ZA 1FXXA 4XEIA 3F5TA 2BANA 1OKJA 1U04A 4I2QA 1SKWA 1CZ9A 5CR4A 3CFPA 4F2RA 1XC3A 3TWHA 2KFNA 4U7BA 1JLAA 4KAZA 4EIAA 3G6EN 1N33K 1BWFO 3ZSRA 4FLVA 1RT3A 1NGGA 4B8AB 4N76A 4CIFA 4H0TB 4DQIA 5LL6Z 4B1VA 4W5OA 4CEFA 2HVHA 3HSCA 3KLHA 3F9MA 1SL2A 3NH1A 1OVQA 5HRNA 3HVTA 2P51A 3QERA 4DS5A 1HX1A 1HRHA 4HUEA 1YJNN 1RT7A 2JWLA 3HYFA 1HYSA 2P9KA 4KPYA 2QTDA 4CHYA 1B9FA 2G8FA 5KPZA 3SAGA 4ILHA 1OH6A 2XY7A 3OYJA 3WNHA 4FPBA 3SPYA 1N36K 2ATQA 4IO9L 3CCRN 4Z0UA 1YAGA 4HCCA 1IKVA 2LSNA 4DCHA 1ASUA 4CZMA 1T05A 1QVGM 2A1RA 3G4SN 4CK2A 3DLRA 4CZIA 4KTZA 1VQKN 3THVA 3QO9A 5F2RA 3DJCA 1X3MA 3CERA 1ZBUA 1QQOA 1NK4A 1SV5A 2ZM6K 4WFBL 3L2UA 3ZSWA 1RT1A 5HOOA 3QEPA 1WLJA 5M1QA 4JS5A 3SBGA 1YVNA 3JSMA 1BG3A 2Q0RA 5E26A 4KI6A 2F8TA 3VQEA 2YJFA 3SNNA 3IG1A 3VQPA 1JCFA 2DPNA 4CJ7A 3M8QA 3FZKA 1S3XA 3AVHA 1NWKA 5J2MA 1NU0A 3HVRA 3C7NB 4JHDA 4DV1K 1RT5A 1XWLA 3EN9A 3ZSOA 3MXMA 4BDYA 2F4VK 5E41A 4M42A 4WE1A 1KFDA 4BDZA 4FM0A 2G8UA 4WCEL 4MDBA 4F8RA 3HXMA 3AA3A 4WF9L 2CGJA 3I8DA 2D0PA 1C0GA 1WB9A 3QINA 2D0BA 5GIPA 3KJVA 5DM7L 2E88A 3VQ5A 1ILYA 1W9HA 1KVAA 3ID6A 4FJIA 2P5GA 1K73O 4FYDA 4CGIA 3THXB 3AVAA 3V1RA 3O9SA 2OANA 3CJ1A 5LJVA 4Z4EA 4CEBA 1VQ6N 3AGKA 3ZSYA 4O0IA 3SJJA 2UUAK 4B9NA 2VQEK 1WUAA 2ASOA 2HBLA 4WQ4A 1HNXK 3EEQA 2DY4A 1NLVA 4FJMA 3VQ9A 3HBTA 3ZX2A 5M1KA 1WN7A 5I3UA 3Q7BA 1VSMA 3R8EA 3W3DA 5BREA 4E7IA 3HP6A 1S6QA 3G0ZA 3CQ8A 2A1SA 1BHLA 4CZGA 1NGBA 4WQ4C 1L5UA 3FGUA 3OYAA 1QZ6A 2ZQBA 1HNZK 3CQXA 3DM2A 3RVCA 2PZSA 3A8YA 3LDLA 2IVNA 4DHYA 3T1HK 1TKTA 3OA9A 3L2QA 4DSIA 1IKWA 3A5LC 3SQ0A 5C2FA 3WXKA 1HKBA 1Q7YO 2UXDK 2KZMA 4B08A 4AHRA 3CMAN 1GLAG 2QWRA 2IVPA 3GOIA 3L2VA 3LZJA 2VQFK 4EZ6A 3I56N 5FLXO 1IBMK 1U6ZA 4JEPA 1S1WA 1Q9YA 3KK1A 3CI5A 4KKOA 1GLEG 1GLFO 4BE1A 2ASPA 3CF5L 3LAKA 3OYCA 2FSNA 4CHPA 4F3OA 4DR3K 3MDQA 5AQNA 4BY9C 3BDPA 4JRPA 1NK6A 2A3ZA 4BR4A 4E89A 3EKSA 2QA4N 1C6VA 2YHYA 3U3YA 3HPHA 3OYGA 3E9PA 1E4FT 4UQGA 4DQSA 4FO0A 3FZFA 5AQLA 4OKJA 1RFQA 4N5SA 5C0YA 2E2OA 5BRFA 4YOVA 4DTMA 1ZC6A 1T03A 3LM9A 2QW9A 5ADXH 1KAYA 4Z4GA 1KLMA 5TKWA 4FJ7A 4FK0A 3MK6A 1RT4A 3LM2A 3ZT4A 4YDUC 3SYZA 5SWMA 2GWJA 4B1XB 1BL3A 1HYVA 3WNEA 1YTUA 4FCYA 1XI1A 3O6WA 5EOYA 2Q3SA 2HMPA 4XH4A 3C7NA 1X9MA 4EAHD 2UXCK 4CF2A 1TUYA 4FLYA 4DV4K 1GLLO 5EX5A 5JMVA 3VQQA 2P9PA 1NG9A 2UUCK 4AM6A 3CC2N 1NKBA 1KVBA 1IO2A 1QQCA 5LMUK 4CJVA 4LD0A 2IIRA 2NNWA 1K8AO 4JI5K 4HCBA 4PKGA 4CJ3A 1BQMA 3OY9A 3V6DA 3C65A 3ZYYX 1QVFM 4RW9A 4DTJA 4GV6A 3VEXA 5T7BA 1ZXOA 1C1AA 1E4GT 4M3XA 1QSLA 5B8HA 2OYQA 3BUZB 1GLDG 1EP4A 3THXA 4BRGA 5CHIA 5JLHA 3P31A 1QTMA 2KLAA 1T7PA 4CD1A 5AZJA 3DRSA 3T1AA 1B92A 1GOAA 2W6KA 5C25A 2YCHA 3QDKA 2ZWHA 3CHWA 1N32K 3IUCA 1XUPO 4CJRA 3U4LA 3VQ4A 3ZETB 4BRNA 4B1UB 4BRMA 4RCHA 4N47A 1BUPA 3LDSA 3VGMA 4RW6A 1X1PA 2HBMA 1KCFA 5AQXA 3ZX3A 1WOQA 4LH4A 3UKRB 4BRFA 4ID1A 1RBUA 1OH7A 1ZBFA 3SQ2A 3MXIA 4FJHA 1Q82O 3OYMA 1KTQA 3VPZA 4E1MA 3S3NA 4H4MA 3SAHA 1YXQA 4CIGA 1BDGA 3LDPA 3TTCA 3HO1A 2HHWA 1IKXA 3ULEB 3ULDA 1LV5A 1SQKA 2X78A 5AQGA 1Q81O 3L3UA 4HUGA 4BR9A 4PL8A 4B1WB 5AQUA 4FM1A 4H5TA 5DK5A 3HRGA 3DRRA 2PY5A 2HMIA 4JI1K 4BRCA 3DMJA 1TK0A 1RT6A 2QXLA 4IJNA 4NYFA 1JCEA 3ASMA 2OCEA 1TAUA 2HBKA 3QNNA 3KLGA 4FWPA 3HTVA 4IDHA 3AY9A 4BRHA 2E6LA 5C2DA 3J80O 1MA9B 4Z4FA 2CGKA 5AQTA 1WAFA 2YNFA 1NK9A 3K9JA 1OH8A 2I5JA 4DS4A 1WSGA 2RKIA 2E2NA 1RGIA 4FZXC 4FWKA 4M41A 3OYNA 3R3LA 1YT3A 2VGMA 3NVKA 4DFMA 3VN5A 4I9QA 4DTNA 2GV9A 1C0UA 1NK7A 3SMSA 3VF4A 4DFKA 4JKFA 3ZT0A 4CF0A 4A62A 4JAXA 4CGDA 4CVNE 3NBPA 3UIQA 3OYBA 4Z4IA 4IKFA 3JXUA 4G9ZA 3OTOK 2V52B 3QBWA 3P39A 1SUQA 4I7FA 4W5TA 4HWIA 4FJKA 4CJFA 1BI4A 3EL2A 5GADP 4JK7A 5J2QA 1ATNA 1L3SA 4FW2A 3ZCMA 4DR4K 1CXUA 4JI2K 5BR8K 1VQ8N 3H08A 3AA2A 1RDUA 3O08A 3VEZA 4CHNA 2PFUA 2XY5A 4HHTA 4CESA 2OZMA 4FWOA 4O8UA 2FXUA 2Z1IA 4MDAA 4PUOA 3A2FA 1VSFA 3CJAA 3OVNA 1T3VA 4Y1CA 2E2PA 4QS9A 3A5NC 2HOEA 3MWTA 2QWMA 4BC4A 4CJUA 1RBSA 4DR2K 5JS1A 4F3TA 1C1CA 2QKBA 3EY1A 2FLOA 1LW0A 4CEOA 1J54A 1ZBLA 4FJGA 3ZETA 2NRZA 2YHWA 5AZIB 1NGAA 3WXLA 4ILJA 4CGHA 2G8WA 4IFYA 3RTVA 1SS6A 3VENA 3VQ7A 1J5OA 4M45A 1D5AA 1JL1A 3NGIA 1JLEA 4CECA 3MECA 4IOCL 1Y64A 5KGXA 2XHBA 3CD6N 4B9VA 3VMFB 4BC5A 3ID8A 3UKRA 2P9LA 1L3TA 2HNYA 1Z05A 4CZKA 1ITGA 3L4QA 1D8YA 4CFDA 4LSNA 2ZE2A 2NRVA 4H0OA 4OO1J 3CCQN 1LWEA 3ULEA 4BG8A 2DFEA 1JXEA 3MEEA 4PKIA 3TPQA 5KPTA 1W0HA 1TKDA 1DT9A 4DU1A 4DSEA 5D3GA 4BRKA 5M1FA 1HPMA 4DV5K 1HKGA 4MQ3A 3CPWM 1YTAA 4MO4A 5CYQA 4FK2A 3NVMA 5C10A 3KZBA 4A2BA 4B8CA 3F2KA 4O55A 5CZ2A 2Q36A 4KI4A 3TAEA 3FR0A 4A57A 1BQNA 4BRDA 4BE0A 4PY5A 1IV0A 1N34K 3WT0A 3B8AX 1IBKK 4DB3A 3E66A 2P1JA 1VQNN 1NBWA 5C24A 5TKYA 3TI0A 4JHDB 4IG0A 3WXJA 4BC3A 2OTJN 3AO4A 1SL0A 4KHSA 3TSUA 3MN6A 4KH5A 4BR7A 1IKYA 3QFPA 4LFCK 4CZJA 4FJXA 4JKGB 3KLFA 3OYIA 2IS3A 1W97L 3ENHA 1NJZA 4CJKA 1W2BM 4PHTX 3D0PA 1EQYA 4NCGA 3HM9A 3AVIA 3FZMA 3J8AA 4BRIA 4DWIA 3WXIA 1DLOA 4CEDA 2Q2RA 1NKEA 4CE9A 1HNIA 1WNSA 2VGNA 2PYLA 3BZKA 1XC9A 1S6PA 4DR6K 3A5MC 4BACA 1GLCG 1EWQA 4DTUA 4IJAA 3P83D 2AA4A 4BR2A 4YOYA 3A0IX 4KH6A 4E7HA 4FJLA 2KFZA 3T7ZA 4CW7B 4LF5K 2OZSA 2BGGA 4JI3K 3HZ6A 1G15A 2GELA 4KHUA 1WSHA 3KK7A 4DFPA 3SI6A 1N5YA 1UOCA 2HNDA 2FBXA 2QWNA 3HSTB 4H0VB 3N4PA 4BR5A 4CEAA 3T69A 3CJ7A 4LFAK 1BIUA 3NF7A 1JL2A 1ATSA 4YNQA 3LDOA 2QEXN 4H5RA 5AZIA 2PYJA 3UE5A 4DR5K 1SKRA 3VQ6A 1J9AA 3SJHA 3K59A 3H45C 3HJFA 4NB4A 2Z1JA 3NAEA 1RDBA 5C12A 4UY8O 3M8SA 4FLWA 1LAVA 3F9KA 4FWRA 4RW4A 3SMPA 4DLGA 4L3QA 3K5MA 4I6MB 2VG5A 4I2PA 1HMVA 4A61A 2E6MA 4ILGB 3KLEA 3BZCA 3Q7CA 2FF3B 4H0PA 5BRHA 4NYNA 2KZZA 3T19A 4IZ9A 4K25A 4OX9K 4DV7K 4PWDA 3P5JA 3CJ9A 1RCHA 4K8XA 1N6QA 2BH1A 3K5NA 5BR9A 2Z1HA 4DSFA 3LP1A 1TGOA 1HUXA 1B9DA 3VERA 4DTRA 3VQCA 3CG7A 3IKMA 4LFBK 2CH5A 5I9EB 1NM1A 3ZEUA 1D4XA 3W0LA 2GX9A 1LW2A 1TK8A 4AF1A 1HYZA 2ITMA 2RF2A 4BWJA 3R1XA 2VG7A 3V81A 2OPSA 4KH4A 4O4GA 1HKCA 1TKXA 4KHYA 4FXDA 1J6ZA 2P9PB 4KHQA 1WBDA 3CC4N 3AARA 1L3VA 1VQ9N 3E01A 4J2EA 4H0XB 1T6CA 4JKGA 4AQYK 4KBOA 2H3GX 3DWLA 4FJ5A 1C1BA 3KHYA 2P9UA 4Z4HA 3VEYA 1E3MA 3RRGA 3EKUA 5AQIA 3L2WA 4JKBA 5MLCQ 2P5OA 1JLGA 3P1GA 3V9ZA 4M3ZA 3O3FA 3TR8A 3CM5A 1CZAN 2ZJRL 3TSPA 4BRAA 3AO5A 3LL3A 2X6NA 2GEMA 1VAZA 4IWVA 4DLEA 2FBTA 5FPMA 1BCOA 4DTPA 4HVJA 5AZJB 3TSQA 1DTQA 2OPRA 4YHHK 3SUQA 1WSFA 2FBYA 4JKEA 4CGFA 3NCIA 3WXMB 1S22A 4B9TA 1KD1O 1RTJA 4NO7A 3AGRA 2JLEA 1S1XA 3MN9A 4EZ9A 3KLIA 2V7YA 5AQJA 3DOKA 4H4OA 5HRSA 4LF7K 3VETA 1NK8A 2NRXA 3EE9A 5K14A 5HP1A 2E20A 1S5JA 2P9IB 1Q9XA 4EP5A 4JI6K 1TUUA 4OPJA 4ZTJA 5C42A 3O1WA 3OBWA 4DUYK 3NE6A 3JS6A 4CZHA 1DGKN 4N56A 1EO1A 1QSYA 2FSJA 5HRPA 1XNQK 1A5VA 4E3SA 1WBBA 1H1VA 3U3GA 4H5VA 2P9SA 2NUBA 4KB1A 4JYAK 2OPPA 1HQUA 2YNGA 3LALA 3OYDA 3M6GA 4I6MA 2VWBA 3DLEA 4FWQA 3VGKA 2P9NA 3U9ZA 4K42A 3HP9A 4DR7K 2YKMA 1CZBA 1ATRA 4N41A 2D0CA 3ITHA 1NJWA 1YJWN 1KSPA 3CC7N 2YKNA 3ZX0A 1S1TA 1EWRA 3A5OC 3PSFA 1VSKA 3OBYA 4DMNA 3TANA 3ZSQA 5GAGP 1NK0A 1K8KA 1JJ2M 1YHQN 4EFHA 2NRRA 1MDUB 2G8VA 1TK5A 4GV9A 1RNHA 1EKEA 4XH1A 1YF5L 3SK3A 2O8FB 3PUFA 2BDPA 4DUZK 4FLTA 4OLAA 3QIPA 1LCUA 4CJ5A 1NGIA 5CYMA 3LAMA 3MEDA 4JI0K 4GKKK 1IBLK 1NGEA 4CJTA 3V4IA 1ZYQA 1VSEA 3KWGA 2HF3A 4IEIA 5SZTA 1QQNA 4IXCA 3G25A 2F9WA 4BVOA 2FBVA 1XNRK 4WYBA 1YI2N 4KHPK 1BI4B 4OPKA 2JGUA 5AQKA 4BG9A 4B3MK 2QWLA 1TKZA 2OPQA 3DXMA 5ELZA 1UA1A 4FZZA 2ZJQL 4WFAL 1ZBIA 4C8NA 5E84A 4PL7A 4YY3K 3DLKA 4FPAA 5FPNA 5KQ8A 4DQRA 3EZ5A 4O5FA 2UU9K 4B3RK 3HK2A 5GINA 3HPOA 5F0XA 4M7YA 1G99A 3OYLA 3SUPA 2O8CB 3CCSN 4ELTA 2W40A 5HBMA 3O4WA 2IAJA 1NK5A 4JRQA 3O8MA 2GUPA 2Q31A 4DU4A 2VYPA 1FK9A 3PO5A 1XHZA 3QESA 3D2FB 4Z94A 1NJXA 3CCMN 3IFRA 4IFEA 1HJRA 4ISEA 5EXWA 4QAGA 2P9IA 3GG4A 1Z25A 1NNEA 2P9LB 4CEQA 3CCVN 1YVUA 4A59A 3BF3A 2W41A 3V1QA 3AVCA 2YHBA 4BQZA 1BO5O 4JKDA 4IBNA 1A5XA 4CZFA 5JICA 4CJ4A 2BUPA 2B6AA 2I7NA 2BE2A 2X74A 3MXJA 5DM6L 1CLQA 3VA3A 3DLBA 3O9RA 2O8EA 2CGLA 4ISFA 4BC2A 1DKGD 3VF6A 1KAZA 4E7LA 3J7YP 1UAXA 4FWNA 4YOXA 3FZLA 3OJUA 3V9XA 4E19A 4PKHA 2D4WA 3JAMO 4JI4K 3CCUN 2BTFA 2HHQA 1P8ZA 2EWSA 2HHHK 1QSSA 5LJWA 4YORA 5EVZA 3AVFA 3ATVA 4QS7A 3KVGA 3O9TA 3AVMA 1GOBA 4IEEA 5AJ3K 5FDLA 1IG8A 4CZLA 3SAFA 5J2PA 3J81O 3DYAA 3L3VA 3E1YA 1TAQA 2O8FA 2QM1A 3O3HA 2G8KA 1D9FA 1NOYA 3O3GA 4K8ZA 3CIPA 2Q97A 3ZSZA 3IS9A 2F9TA 3C6TA 2JWKA 3UKUB 2QWQA 4AHTA 3IDHA 2A41A 4B9SA 1NJYA 2WOMA 1X9WA 3O4QA 4H5WA 1FW6A 4IG3A 4KTWA 4YFUA 3WNFA 3C6AA 1KRPA 3UB5A 5I42A 3K5LA 4CBXA 3P4IA 4FJ8A 1S9GA 4K43A 2UYTA 4JKHA 3BF1A 3KKSA 3PX6A 2IGIA 3T1YK 1MWMA 3WQUA 2DTUA 1BA0A 3BEXA 3VESA 4CFAA 3CCJN 3RRHA 3D45A 4F2SA 3ZLJA 3E9OA 4KTQA 2O8CA 3TTDA 4HTLA 4X62K 2HHVA 1GOCA 3O80A 4CZEA 3PX4A 3TAPA 1OH5A 3SQ4A 4CHZA 2O4GA 3NGZA 3HOSA 3TAMA 1VQ5N 3DRPA 2GUIA 2E8AA 1X9SA 4DV2K 4CGJA 3D2FA 3SCXA 2ETJA 2EHGA 3OW2M 3EE8A 4J8FA 4FLUA 1JXBA 2WUSA 3KD5E 1OVYA 2IDOA 4LY7A 5KRTA 4B1YB 2RHKA 1EXQA 4A2AA 1V4TA 3MWPA 1NKCA 4GV3A 3N4QA 1VSIA 2D0OA 4RTFD 5A2QO 5M1OA 3OYHA 4FW1A 1U4BA 2HHSA 3DI6A 2D1KA 4KFBA 1ASVA 2NRHA 5FRNA 4J2DA 2O8BA 4FWMA 1LOTB 4ISGA 3MMVA 2W6LA 1IG9A 2HHUA 4B1ZA 3ZT2A 5FPEA 3OJSA 1O13A 3WUHA 4KREA 3AVLA 4W5NA 3SPZA 2QWOA 4QOZB 2WFBA 3THYA 3VEWA 1ASWA 3DLGA 3I55N 3O9QA 1KLNA 3P38A 4NXNK 3E9LA 2A40A 1L3UA 5J2NA 3RMDA 2GBZA 1XMQK 3CCEN 3NH0A 5KQDA 1HNWK 5AQRA 4DTSA 3ZEUB 3MN5A 4BRLA 1F21A 5M1NA 3LANA 4B3TK 1RBVA 3FLCO 4CBUA 3THWA 2A6AA 1REVA 3M5RA 3AO2A 1QHAA 1Y97A 2F96A 3H6EA 3M1FA 3AAQA 4OVLA 4G1QA 4BQLA 4LF8K 3LDQA 4CHOA 3PIPL 4M3WA 4ELUA 2GTDA 3OHRA 4DF8A 1QE1A 4LSLA 3ZSVA 3L0QA 4JKCA 1RBTA 2KQ2A 4KO0A 3UKUA 3VA0A 3AVJA 2P9UB 5FRMA 4DKWA 2ZD1A 5KI6A 2YHXA 3U6FA 3DOLA 3FZHA 3V9WA 1U45A 1C0TA 1C0MA 4KB0A 1VQ4N 4EHUA 4CERA 4CFCA 1VQMN 1HJOA 4NCAA 3B6PA 3T3FA 4DV6K 4FVUA 4LF4K 5DMRA 2XRIA 3AVNA 1BGXT 4GNIA 1KC8O 4CI6A 5LMNK 1KFSA 3ZT3A 2Z1GA 4KRFA 2WBNA 3F73A 5BRDA 3WNGA 2FSKA 1SL1A 4GMJB 4FZYA 1JLCA 3NGYA 4PA1A 2VWKA 5IT9O 4HTUA 1Q86O 4CJLA 3TABA 4YOUA 2VWJA 3C6UA 3SBTA 2A5XA 4CJWA 3MEGA 3PX0A 4JV5K 3DAWA 5CE3A 3NMUA 5AQWA 1FJGK 4CHQA 5JVHL 3KIOA 3QIOA 4FSVA 1JLFA 3NF6A 4J2BA 3K5OA 4JI8K 3AA5X 4OJRA 4JI7K 3OS0A 3G71N 3M8RA 4ICLA 1Q8IA 1RTIA 4PQUA 1C0FA 5KRSA 2HBJA 2KHOA 2P9SB 3OS2A 4H03B 4W5QA 3QICA 4DTOA 1XMOK 3HPGA 1EETA 3K58A 2AJQA 1GLJO 1LWCA 2QI2A 4I9LA 1JKHA 1KAXA 2P9NB 3MCAB 4A5AA 1VQON 5KTQA 4BGAA 4R5PA 3MAQA 3AAPA 4U67L 2DFHA 4F9OA 3BGRA 1NOZA 4DQ8A 1CXQA 1VSJA 3AV9A 2Y1JA 4CD3A 4AILC 3WEEB 4JS4A 4TSXA 3MX5A 4B9QA 3R6MA 4RWTA 4O44A 3LPUA 2YX6A 4JD2A 5AQHA 1J5EK 4CEEA 3ATUA 3I0RA 4GKJK 1K8KB 4R79A 4FK4A 5BPMA 4CK1A 1KVCA 2KKZA 3L4IA 1MWKA 3DLLL 4XH5A 3EYZA 3RR8A 5KPRA 1FKPA 3QETA 3RR7A 2ITGA 3ZSXA 4QCLA 4JNEA 4MFBA 3MN7A 4BWMA 4KHNA 4FJJA 3LP2A 3KK3A 3HT3A 2Q0UA 5GAEP 3ALYA 3ENBA 1T6DA 4RW8A 1K9MO 5JS2A 1NMDA 4CF9A 1A5WA 4CFBA 4F4KA 2PBDA 2HHXA 2Y1IA 5J1EA 3DXMB 1RDDA 3V1OA 3DLHA 3O9UA 4BRPA 3H3OB 3AVBA 3TTFA 3KD1E 3K57A 3G10A 2GWKA 2ZF5O 4DFJA 3TAGA 4KV8A 3TARA 4Z4CA 3CFRA 1RDWX 3CYMA 1R59O 2I7PA 1O1WA 2RN2A 4IOXA 5AQOA 2ASMA 3CCLN 1D9DA 4FJNA 3K9KA 4AHCA 1X3NA 3JYTA 4JN4A 4DV3K 1R0AA 4B3SK 2OTLN 2O4IA 5HL7L 1VSHA 3MCPA 3SQ1A 3ZT1A 2UXBK 3NHGA 2D0AA 3AVKA 3S41A 3RMCA 1M1KO 1VQ7N 3IRXA 4AHVA 3RMAA 4O8KA 4OKEA 3LP0A 4B9UA 1YIJN 5AQVA 3LZIA 3WQTA 4CJSA 3D2EB 3KTQA 3BP8A 4M3UA 1ESVA 4LC9B 1X9JA 1VHXA 3J7ZO 3PLAA 1BU6O 1SZ2A 4BVPA 5FROA 3TAFA 3KK2A 3PY8A 2E4LA 5M1PA 3C6HA 3OS1A 1S1VA 3CM6A 4JK9A 3QEXA 3RMBA 3TAQA 5LY3A 2V7ZA 1WSEA 4L8RB 3QFUA 2O8EB 4C1NI 4CJPA 4LH5A 4MLEA 1U2VB 2VG6A 4C23A 1S9EA 2YNHA 2RE2A 4A5BA 2HSTA 1NGHA 2YI1A 2WTUA 4AH9A 4FOEA 1NGDA 3WEEA 3GE1A 3J7AP 1MU2A 1HLUA 1DTTA 4DTXA 2YHAA 4K0KK 4ELVA 4FWSA 2HF4A 2PAVA 2NZTA 4C8LA 3C0BA 4YDUA 3ISNC 4FL9A 1XQSC 4E1NA 4BRQA 3C94A 1WSJA 2CH6A 3PV8A 1NGCA 3M3ZA 5AQMA 1YJ9N 1I39A 1BCMA 1RTHA 4RW7A 1J53A 1Q18A 4GVEA 3C95A 4YOWA 2IC3A 2RPIA 1P90A 5AQZA 3S3OA 1KQSM 5F1XA 4CGGA 4C8KA 3NF8A 4H8KA 4E7KA 5AR0A 2XY6A 4J2AA 3NF9A 3CFOA 1BIZA 5BPNA 4Q0BA 3QNOA 5KGWA 5AFUH 4CBWA 2A42A 4DF4A 3BY5A 1I94K 4FOIA 4BDPA 4FWLA 4DQQA 2FF6A 2F8SA 4DR1K 1DEJA 3IAYA 3O4NA 1LWFA 3D7EO 2ZGZA 4FVMA 3GDQA 3QMLA 4OKKA 4M3YA 4BROA 3SZ2A 4CJEA 1TVRA 2G8IA 1VQPN 5GIOA 4BGBA 2B5JA 4LF6K 1XHXA 5H1SQ 2X6SA 4EHTA 4FLZA 3V9UA 1UWBA 4IO8A 3HI0A 4M7XA 5EY4A 2ZGYA 3EZWA 4M3TA 4EP4A 1T8EA 1RDAA 1QZ5A 3D2EA 1FKOA 5CZ1A 1TL3A 1NJIO 1TL1A 4O5BA 3NDKA 1V4SA 3QBXA 3SV3A 3I33A 2F7TA 2EX3A 2O8DB 3QB0A 4AHSA 2HW3A 2B4JA 3IMXA 3MX2A 2O8BB 4FJ9A 4IFVA 1QS4A 1KXPA 3SV4A 3AO1A 1Z6RA 3LPTA 5EU7A 5AQYA 1IJJA 1SKSA 1M90O 1EX4A 1U2VA 3QEWA 1JLQA 4W5RA 3AO3A 3DXKB 3OYFA 3THYB 4DSJA 2XY8A 2J4RA 4XIUA 3CJCA 1RTDA 1VRUA 3H46O 3OYKA 1HR0K 3L2RA 1NGFA 3KWIA 4M3RA 4DU3A 4YOTA 4FLXA 1TYQB 2E2QA 3PO4A 3HL8A 4LF9K 5CY4A 2ZJPL 2QK9A 3VF2A 2DFFA 3RWUA 1HPZA 3QLHA 4K41A 3THWB 2HVIA 1GLBG 4NCBA 3RSEB 4OGEA 4E7JA 3VEOA 1VSDA 4DG1A 1QHTA 2YNIA 1WSIA 4OLBA 3L8BA 3FFIA 3NH2A 3OYEA 4DQPA 1S1UA 1ZBHA 4OGCA 3L6QA 4OPAA 2FC0A 2QKKA 5HRRA 4E0DA 1I3AA 4JLHA 2IOCA 5ADXA 3AVGA 2E1YA 3LP3A 3KKRA 4MO5A 1U49A 1BA1A 4AHUA 3CMEN 4B3OA 4X65K 1TV6A 3H3NO 4IOAL 3NFAA 4DSKA 4MLHA 4BE2A 4Q5VA 3FFKB 3SUNA 4V19S 5IWAK 2KTQA 4AM7A 4NXMK 5HROA 5JVGL 5GAHP 3U9DA 1W7AA 1HQEA 3K0SA 2HB5A 4CF8A 2VCPA 2NRWA 5AQQA 5AFUA 4ID5A 4JK8A 4CF1A 2QWPA 4HUFA 3VQBA 4C8OA 3EO3A 4C8MA 2UUBK 3GL1A 1VQLN 3VTHA 2R7YA 4ZTFA 1RDCA 2IVOA 3LWLA 1YUWA 2WONA 3FE1A 1SAZA 1K6YA 1Z26A 1NMNA 5HLFA 1UA0A 4NLBA 4Y1DA 1VRTA 4FM2A 4H0YB 5BN8A 3D6RA 4ZHRA 4NLCA 4CJQA 1ZBSA 2XO7A 4IDKA 4WFNL 3K2PA 3CJBA 3SLCA 4QS8A 2Q1NA 2WC9A 1JCGA 2V51B 3SUOA 3S3MA 2G8HA 4C1NK 3VTIA 1JLBA 4RG8A 4M63C 2P9KB 3QEVA 3CQYA 2O8DA 2KW4A 3VQAA 4Y0WA 4WQ5A 5BN9A 3O5BA 1NGJA 2HHTA 3QEIA 1U48A 1LAWA 5BPLA 1VK0A 3B6OA 4KHWA 3VGLA 3GBTA 2OA8A 4X64K 2NRTA 4GW6A 3DXKA 4X66K 4E1JA 1IH7A 1RILA 3CPEA 4JD2B 4DSLA 4WQ5C 4BR0A 2YV0X 3TU5A 4GVMA 4H5NA 3VOVA 3HOTA 1TYQA 4CIEA 2W42A 3U8XA 4CK3A 4B9LA 1HNVA 3HM8A 5FPDA 3M8PA 3PSIA 3I8BA 3CETA 3RSEA 5AQSA 5AQPA 4JKAA 1RT2A 1RBRA 2D5RA 1BOTO 1T44A 2E5LK 3S9HA 1QQMA 1YITN 3AA4A 5JLFA 3CXCM 1BISA 3I0SA 1WAJA 4OPHA 1N8RO 2AP1A 3H1QA 4GY2B 2YJEA 3PIOL 3ENOA 2HNZA 4DV0K 3H1VX 5C15A 2NLXA 3V9SA 3LDNA 3VQDA 4B9MA 5AQFA 4CEZA 3LWMA 4O0JA 3VEVA 4CCHA 1U47A 3O1BA
chains in the Genus database with same CATH topology
4FW2A 4Z4CA 3ZCMA 3CFRA 1ZBIA 4C8NA 3CYMA 1CXUA 1VSLA 2QXFA 1O1WA 2RN2A 3H08A 3DLKA 3AA2A 3VQ8A 4CHNA 4DQRA 3EZ5A 1D9DA 1FXXA 2XY5A 4FJNA 3HK2A 4AHCA 3JYTA 1R0AA 4HHTA 3HPOA 2BANA 2O4IA 1U04A 1VSHA 4CESA 2OZMA 3SQ1A 3ZT1A 3OYLA 4I2QA 1SKWA 1CZ9A 3SUPA 2Z1IA 4ELTA 4PUOA 3A2FA 3CFPA 1VSFA 3NHGA 2D0AA 3OVNA 4F2RA 3AVKA 5HBMA 3RMCA 2IAJA 3TWHA 1NK5A 4Y1CA 2KFNA 3IRXA 4JRQA 1JLAA 4AHVA 4KAZA 3RMAA 4DU4A 4OKEA 3LP0A 4B9UA 3ZSRA 4CJUA 4FLVA 1RBSA 1FK9A 1RT3A 3PO5A 5JS1A 1XHZA 3LZIA 4B8AB 3QESA 4N76A 1C1CA 2QKBA 4CIFA 4CJSA 3EY1A 4CEOA 1LW0A 1ZBLA 1J54A 4DQIA 1NJXA 4FJGA 4W5OA 3KTQA 4CEFA 1HJRA 4CGHA 2G8WA 2HVHA 3KLHA 4IFYA 4M3UA 3RTVA 4QAGA 3VQ7A 1J5OA 1SL2A 3NH1A 5HRNA 3HVTA 2P51A 1Z25A 4M45A 1D5AA 1JL1A 5FROA 3QERA 4DS5A 3TAFA 3NGIA 1JLEA 4CECA 4CEQA 3KK2A 3PY8A 1HRHA 1YVUA 3MECA 4HUEA 1RT7A 5KGXA 2XHBA 3HYFA 1HYSA 3V1QA 3AVCA 2E4LA 2YHBA 3OS1A 4KPYA 1S1VA 4B9VA 3CM6A 4IBNA 1A5XA 4CHYA 1B9FA 3QEXA 3RMBA 3TAQA 1L3TA 2HNYA 2G8FA 1WSEA 4CJ4A 4L8RB 2B6AA 1D8YA 1ITGA 4F3TA 4CJPA 4CFDA 2BE2A 4LSNA 4LH5A 2XY7A 2ZE2A 3WNHA 3OYJA 2X74A 3MXJA 1CLQA 2VG6A 1S9EA 2YNHA 3VA3A 3SPYA 2ATQA 3DLBA 1LWEA 4Z0UA 2DFEA 1JXEA 3MEEA 1W0HA 4E7LA 4HCCA 1IKVA 2LSNA 1TKDA 4AH9A 1ASUA 1UAXA 4DU1A 1T05A 2A1RA 4DSEA 5D3GA 4CK2A 3DLRA 4MQ3A 1MU2A 4KTZA 3THVA 1YTAA 5CYQA 3QO9A 1DTTA 4FK2A 3OJUA 3V9XA 4E19A 4B8CA 4DTXA 1ZBUA 4O55A 1NK4A 2YHAA 1SV5A 5CZ2A 4ELVA 2HHQA 4KI4A 3L2UA 3ZSWA 3TAEA 1RT1A 1QSSA 3QEPA 4C8LA 3AVFA 1BQNA 1WLJA 4JS5A 4BE0A 4PY5A 3ISNC 3AVMA 4E1NA 1GOBA 3JSMA 5FDLA 3C94A 1WSJA 4KI6A 5J2PA 3VQEA 2F8TA 3DYAA 2P1JA 3L3VA 1TAQA 3PV8A 3SNNA 3IG1A 5C24A 3O3HA 3VQPA 3TI0A 2G8KA 1D9FA 1I39A 4IG0A 1NOYA 1BCMA 3O3GA 3AO4A 3M8QA 4K8ZA 3ZSZA 1RTHA 1SL0A 4RW7A 4KHSA 1J53A 3IS9A 3AVHA 3C6TA 5J2MA 3C95A 4AHTA 3HVRA 2IC3A 2RPIA 4B9SA 1IKYA 1NJYA 1RT5A 2WOMA 4F8RA 4FJXA 1XWLA 3ZSOA 3S3OA 1X9WA 3KLFA 3OYIA 3O4QA 3MXMA 4BDYA 5E41A 4M42A 2IS3A 4WE1A 1NJZA 1KFDA 4CGGA 4BDZA 3NF8A 4H8KA 4CJKA 4FM0A 2G8UA 4C8KA 4IG3A 3D0PA 3HXMA 4KTWA 4YFUA 3AA3A 4NCGA 3WNFA 4E7KA 2XY6A 3I8DA 3HM9A 3AVIA 4DWIA 2HHUA 1KRPA 4J2AA 1DLOA 4CEDA 3NF9A 5I42A 1NKEA 4CE9A 1HNIA 1WNSA 3CFOA 3K5LA 1BIZA 3QINA 2PYLA 1XC9A 1S6PA 2D0BA 4FJ8A 4Q0BA 3QNOA 5KGWA 1S9GA 4DF4A 4BACA 3KJVA 3KKSA 4DTUA 3PX6A 2IGIA 4BDPA 3VQ5A 4DQQA 2F8SA 3P83D 1W9HA 3IAYA 1KVAA 2DTUA 4FJIA 3O4NA 2P5GA 1LWFA 4FVMA 4OKKA 4E7HA 4M3YA 4FYDA 4CFAA 3SZ2A 4FJLA 4CGIA 3RRHA 2KFZA 4CJEA 3D45A 4F2SA 1TVRA 3AVAA 2OZSA 3V1RA 2G8IA 2BGGA 2B5JA 4KTQA 4Z4EA 1XHXA 1G15A 4CEBA 3ZSYA 2X6SA 1WSHA 4O0IA 3SJJA 4FLZA 4DFPA 3SI6A 1N5YA 4B9NA 1UOCA 2HHVA 1GOCA 2HNDA 3V9UA 2DY4A 4FJMA 1UWBA 2FBXA 3VQ9A 3PX4A 3TAPA 1WN7A 3SQ4A 4CHZA 3HSTB 2O4GA 3NGZA 3TAMA 5I3UA 3DRPA 2GUIA 4CEAA 4M3TA 1VSMA 1BIUA 3NF7A 1JL2A 4EP4A 1T8EA 1RDAA 1X9SA 4CGJA 4E7IA 3SCXA 4YNQA 2ETJA 1FKOA 3HP6A 5CZ1A 1S6QA 2EHGA 3G0ZA 3CQ8A 4FZZA 2A1SA 1BHLA 4FLUA 1JXBA 2PYJA 1L5UA 1TL3A 3KD5E 1SKRA 3OYAA 2IDOA 4LY7A 1TL1A 3VQ6A 5KRTA 2ZQBA 4O5BA 3NDKA 1J9AA 3K59A 3SV3A 3HJFA 1EXQA 2Z1JA 3NAEA 3DM2A 2PZSA 2EX3A 1NKCA 1VSIA 1RDBA 4AHSA 1TKTA 2HW3A 2B4JA 3L2QA 4DSIA 1IKWA 3OYHA 4FW1A 3M8SA 1U4BA 4FJ9A 4IFVA 2HHSA 4FLWA 3SQ0A 1LAVA 3F9KA 3DI6A 4RW4A 4KFBA 4DLGA 2KZMA 3K5MA 1QS4A 3SV4A 1ASVA 4B08A 3AO1A 4AHRA 2VG5A 5FRNA 4J2DA 3LPTA 5EU7A 4I2PA 1HMVA 3L2VA 3LZJA 1SKSA 4EZ6A 1EX4A 2E6MA 1IG9A 3QEWA 1S1WA 1JLQA 4W5RA 3AO3A 3KLEA 3KK1A 1Q9YA 4KKOA 3ZT2A 3OYFA 4DSJA 2XY8A 4BE1A 4XIUA 3OJSA 3LAKA 3OYCA 1RTDA 4NYNA 1VRUA 4KREA 4F3OA 3T19A 4CHPA 3AVLA 2KZZA 3OYKA 4W5NA 3SPZA 4QOZB 3BDPA 3L2RA 4JRPA 1NK6A 1ASWA 4M3RA 4E89A 4DU3A 4PWDA 3DLGA 3P5JA 1RCHA 1C6VA 4FLXA 3U3YA 1KLNA 3PO4A 3HPHA 3OYGA 4K8XA 1L3UA 1N6QA 4UQGA 5J2NA 2GBZA 3RMDA 3HL8A 4DQSA 3K5NA 3NH0A 5CY4A 2QK9A 2Z1HA 2DFFA 4DSFA 3RWUA 3LP1A 1TGOA 1HPZA 3QLHA 4OKJA 4DTSA 2HVIA 1B9DA 4NCBA 4N5SA 4OGEA 4E7JA 4DTRA 1VSDA 4DG1A 1QHTA 2YNIA 1WSIA 3VQCA 4OLBA 3CG7A 3L8BA 1F21A 3FFIA 3NH2A 3LANA 3OYEA 4DTMA 1RBVA 4DQPA 1T03A 1S1UA 1ZBHA 4OGCA 4Z4GA 1KLMA 4FJ7A 1REVA 2FC0A 4FK0A 3AO2A 2QKKA 1RT4A 5HRRA 3ZT4A 4E0DA 1I3AA 1LW2A 1TK8A 3SYZA 5SWMA 1HYZA 4JLHA 1Y97A 2F96A 2RF2A 2IOCA 2VG7A 4BWJA 4OVLA 4G1QA 3V81A 1BL3A 1HYVA 3AVGA 3WNEA 4CHOA 4M3WA 2OPSA 1YTUA 4O4GA 4FCYA 4ELUA 1TKXA 3LP3A 4DF8A 3KKRA 1XI1A 1U49A 1QE1A 4LSLA 4AHUA 3ZSVA 4KHYA 4FXDA 4B3OA 4KHQA 2Q3SA 1RBTA 2KQ2A 4KO0A 1TV6A 3VA0A 1X9MA 3AVJA 5FRMA 2ZD1A 5KI6A 3NFAA 4CF2A 4FLYA 1L3VA 4BE2A 3E01A 4DSKA 4J2EA 3U6FA 3DOLA 4Q5VA 3V9WA 1U45A 3VQQA 3SUNA 1C0TA 1C0MA 4FJ5A 4KB0A 1NKBA 1C1BA 1KVBA 1IO2A 4Z4HA 2KTQA 5HROA 1QQCA 4CERA 4CJVA 3RRGA 4LD0A 4CFCA 4NCAA 3L2WA 3B6PA 4HCBA 4CJ3A 3T3FA 2P5OA 1JLGA 3P1GA 1BQMA 3OY9A 3V9ZA 3V6DA 4M3ZA 1HQEA 3O3FA 2HB5A 4CF8A 3TR8A 3CM5A 5DMRA 4RW9A 4DTJA 2XRIA 3AVNA 4ID5A 4CF1A 5T7BA 1BGXT 1C1AA 4HUFA 3AO5A 2X6NA 4M3XA 1QSLA 1KFSA 3VQBA 3ZT3A 2Z1GA 4C8OA 4DLEA 4C8MA 2FBTA 4KRFA 1BCOA 4DTPA 4HVJA 3F73A 3WNGA 2OYQA 1DTQA 2R7YA 4ZTFA 2OPRA 4KHUA 1SL1A 1RDCA 3SUQA 4GMJB 1EP4A 4FZYA 1WSFA 1JLCA 2FBYA 3LWLA 3NGYA 4CGFA 2WONA 1QTMA 1K6YA 1Z26A 1T7PA 3NCIA 5HLFA 1UA0A 3DRSA 4PA1A 3T1AA 4Y1DA 1B92A 1GOAA 1VRTA 2VWKA 4FM2A 4B9TA 4HTUA 1RTJA 4CJLA 4ZHRA 3TABA 5C25A 2VWJA 4CJQA 2JLEA 1S1XA 3C6UA 2XO7A 4IDKA 4EZ9A 4CJWA 3MEGA 3KLIA 4CJRA 3PX0A 3DOKA 3K2PA 3VQ4A 4H4OA 5HRSA 4CHQA 1NK8A 3KIOA 3QIOA 1JLFA 3NF6A 4J2BA 5K14A 3S3MA 3SUOA 5HP1A 2G8HA 3K5OA 4N47A 1S5JA 3LDSA 3AA5X 4OJRA 1Q9XA 4EP5A 3OS0A 3M8RA 4ICLA 1Q8IA 1RTIA 4PQUA 1JLBA 4RG8A 5KRSA 4OPJA 4ZTJA 4RW6A 5C42A 1X1PA 1KCFA 3NE6A 3QEVA 4LH4A 3OS2A 4N56A 2KW4A 1QSYA 4W5QA 4DTOA 5HRPA 3HPGA 4ID1A 3VQAA 1A5VA 1EETA 3K58A 1RBUA 4E3SA 1ZBFA 3U3GA 2AJQA 1LWCA 3SQ2A 3MXIA 4FJHA 4I9LA 1JKHA 2NUBA 3OYMA 1KTQA 4KB1A 2HHTA 3QEIA 2OPPA 4E1MA 3S3NA 1LAWA 4H4MA 5KTQA 1HQUA 4CIGA 2YNGA 4R5PA 3MAQA 1U48A 1VK0A 2DFHA 3B6OA 3LALA 3OYDA 4KHWA 3HO1A 2HHWA 1IKXA 3BGRA 3DLEA 3ULDA 1NOZA 2OA8A 4GW6A 1LV5A 1CXQA 1VSJA 3AV9A 3HP9A 2Y1JA 1IH7A 2X78A 1RILA 4AILC 4DSLA 3L3UA 2YKMA 1CZBA 4JS4A 4HUGA 4TSXA 4FM1A 2YV0X 2D0CA 4N41A 3ITHA 5DK5A 4O44A 3DRRA 3LPUA 4GVMA 1NJWA 2PY5A 1KSPA 2HMIA 4CEEA 1TK0A 3DMJA 3I0RA 1RT6A 4CIEA 2YKNA 4NYFA 2W42A 4FK4A 4CK3A 4B9LA 3ASMA 1HNVA 1TAUA 4CK1A 1S1TA 1KVCA 3QNNA 3KLGA 3M8PA 1VSKA 4DMNA 3TANA 3ZSQA 2E6LA 1NK0A 1RT2A 4Z4FA 1RBRA 2D5RA 1WAFA 2G8VA 2YNFA 1TK5A 1NK9A 1RNHA 1EKEA 3EYZA 2I5JA 3RR8A 3S9HA 1FKPA 4DS4A 3QETA 3RR7A 1WSGA 2ITGA 2RKIA 3ZSXA 3PUFA 4FZXC 3AA4A 2BDPA 4M41A 4FLTA 3OYNA 4QCLA 1BISA 1YT3A 4MFBA 4OLAA 3I0SA 4BWMA 4DFMA 4KHNA 4FJJA 3VN5A 1WAJA 3LP2A 3QIPA 4CJ5A 2GV9A 4DTNA 1C0UA 3KK3A 1NK7A 4I9QA 3HT3A 5CYMA 3LAMA 3MEDA 3ALYA 4DFKA 4CJTA 3V4IA 1ZYQA 1VSEA 4RW8A 3ZT0A 4CF0A 5JS2A 4CGDA 5SZTA 4CF9A 3NBPA 1A5WA 2HNZA 4CFBA 3UIQA 3OYBA 4Z4IA 2FBVA 4F4KA 4IKFA 3V9SA 2HHXA 2Y1IA 5J1EA 3VQDA 1RDDA 3V1OA 3DLHA 1BI4B 4B9MA 4CEZA 4OPKA 1SUQA 2JGUA 4I7FA 3LWMA 4O0JA 4W5TA 4FJKA 3AVBA 4CJFA 1TKZA 3KD1E 2OPQA 3K57A 3G10A 3TAGA 4CCHA 4DFJA 1BI4A 1UA1A 4KV8A 1U47A 5J2QA 3TARA 1L3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FW2 A;  4Z4C A;  3ZCM A;  3CFR A;  1ZBI A;  4C8N A;  3CYM A;  1CXU A;  1VSL A;  2QXF A;  1O1W A;  2RN2 A;  3H08 A;  3DLK A;  3AA2 A;  3VQ8 A;  4CHN A;  4DQR A;  3EZ5 A;  1D9D A;  1FXX A;  2XY5 A;  4FJN A;  3HK2 A;  4AHC A;  3JYT A;  1R0A A;  4HHT A;  3HPO A;  2BAN A;  2O4I A;  1U04 A;  1VSH A;  4CES A;  2OZM A;  3SQ1 A;  3ZT1 A;  3OYL A;  4I2Q A;  1SKW A;  1CZ9 A;  3SUP A;  2Z1I A;  4ELT A;  4PUO A;  3A2F A;  3CFP A;  1VSF A;  3NHG A;  2D0A A;  3OVN A;  4F2R A;  3AVK A;  5HBM A;  3RMC A;  2IAJ A;  3TWH A;  1NK5 A;  4Y1C A;  2KFN A;  3IRX A;  4JRQ A;  1JLA A;  4AHV A;  4KAZ A;  3RMA A;  4DU4 A;  4OKE A;  3LP0 A;  4B9U A;  3ZSR A;  4CJU A;  4FLV A;  1RBS A;  1FK9 A;  1RT3 A;  3PO5 A;  5JS1 A;  1XHZ A;  3LZI A;  4B8A B;  3QES A;  4N76 A;  1C1C A;  2QKB A;  4CIF A;  4CJS A;  3EY1 A;  4CEO A;  1LW0 A;  1ZBL A;  1J54 A;  4DQI A;  1NJX A;  4FJG A;  4W5O A;  3KTQ A;  4CEF A;  1HJR A;  4CGH A;  2G8W A;  2HVH A;  3KLH A;  4IFY A;  4M3U A;  3RTV A;  4QAG A;  3VQ7 A;  1J5O A;  1SL2 A;  3NH1 A;  5HRN A;  3HVT A;  2P51 A;  1Z25 A;  4M45 A;  1D5A A;  1JL1 A;  5FRO A;  3QER A;  4DS5 A;  3TAF A;  3NGI A;  1JLE A;  4CEC A;  4CEQ A;  3KK2 A;  3PY8 A;  1HRH A;  1YVU A;  3MEC A;  4HUE A;  1RT7 A;  5KGX A;  2XHB A;  3HYF A;  1HYS A;  3V1Q A;  3AVC A;  2E4L A;  2YHB A;  3OS1 A;  4KPY A;  1S1V A;  4B9V A;  3CM6 A;  4IBN A;  1A5X A;  4CHY A;  1B9F A;  3QEX A;  3RMB A;  3TAQ A;  1L3T A;  2HNY A;  2G8F A;  1WSE A;  4CJ4 A;  4L8R B;  2B6A A;  1D8Y A;  1ITG A;  4F3T A;  4CJP A;  4CFD A;  2BE2 A;  4LSN A;  4LH5 A;  2XY7 A;  2ZE2 A;  3WNH A;  3OYJ A;  2X74 A;  3MXJ A;  1CLQ A;  2VG6 A;  1S9E A;  2YNH A;  3VA3 A;  3SPY A;  2ATQ A;  3DLB A;  1LWE A;  4Z0U A;  2DFE A;  1JXE A;  3MEE A;  1W0H A;  4E7L A;  4HCC A;  1IKV A;  2LSN A;  1TKD A;  4AH9 A;  1ASU A;  1UAX A;  4DU1 A;  1T05 A;  2A1R A;  4DSE A;  5D3G A;  4CK2 A;  3DLR A;  4MQ3 A;  1MU2 A;  4KTZ A;  3THV A;  1YTA A;  5CYQ A;  3QO9 A;  1DTT A;  4FK2 A;  3OJU A;  3V9X A;  4E19 A;  4B8C A;  4DTX A;  1ZBU A;  4O55 A;  1NK4 A;  2YHA A;  1SV5 A;  5CZ2 A;  4ELV A;  2HHQ A;  4KI4 A;  3L2U A;  3ZSW A;  3TAE A;  1RT1 A;  1QSS A;  3QEP A;  4C8L A;  3AVF A;  1BQN A;  1WLJ A;  4JS5 A;  4BE0 A;  4PY5 A;  3ISN C;  3AVM A;  4E1N A;  1GOB A;  3JSM A;  5FDL A;  3C94 A;  1WSJ A;  4KI6 A;  5J2P A;  3VQE A;  2F8T A;  3DYA A;  2P1J A;  3L3V A;  1TAQ A;  3PV8 A;  3SNN A;  3IG1 A;  5C24 A;  3O3H A;  3VQP A;  3TI0 A;  2G8K A;  1D9F A;  1I39 A;  4IG0 A;  1NOY A;  1BCM A;  3O3G A;  3AO4 A;  3M8Q A;  4K8Z A;  3ZSZ A;  1RTH A;  1SL0 A;  4RW7 A;  4KHS A;  1J53 A;  3IS9 A;  3AVH A;  3C6T A;  5J2M A;  3C95 A;  4AHT A;  3HVR A;  2IC3 A;  2RPI A;  4B9S A;  1IKY A;  1NJY A;  1RT5 A;  2WOM A;  4F8R A;  4FJX A;  1XWL A;  3ZSO A;  3S3O A;  1X9W A;  3KLF A;  3OYI A;  3O4Q A;  3MXM A;  4BDY A;  5E41 A;  4M42 A;  2IS3 A;  4WE1 A;  1NJZ A;  1KFD A;  4CGG A;  4BDZ A;  3NF8 A;  4H8K A;  4CJK A;  4FM0 A;  2G8U A;  4C8K A;  4IG3 A;  3D0P A;  3HXM A;  4KTW A;  4YFU A;  3AA3 A;  4NCG A;  3WNF A;  4E7K A;  2XY6 A;  3I8D A;  3HM9 A;  3AVI A;  4DWI A;  2HHU A;  1KRP A;  4J2A A;  1DLO A;  4CED A;  3NF9 A;  5I42 A;  1NKE A;  4CE9 A;  1HNI A;  1WNS A;  3CFO A;  3K5L A;  1BIZ A;  3QIN A;  2PYL A;  1XC9 A;  1S6P A;  2D0B A;  4FJ8 A;  4Q0B A;  3QNO A;  5KGW A;  1S9G A;  4DF4 A;  4BAC A;  3KJV A;  3KKS A;  4DTU A;  3PX6 A;  2IGI A;  4BDP A;  3VQ5 A;  4DQQ A;  2F8S A;  3P83 D;  1W9H A;  3IAY A;  1KVA A;  2DTU A;  4FJI A;  3O4N A;  2P5G A;  1LWF A;  4FVM A;  4OKK A;  4E7H A;  4M3Y A;  4FYD A;  4CFA A;  3SZ2 A;  4FJL A;  4CGI A;  3RRH A;  2KFZ A;  4CJE A;  3D45 A;  4F2S A;  1TVR A;  3AVA A;  2OZS A;  3V1R A;  2G8I A;  2BGG A;  2B5J A;  4KTQ A;  4Z4E A;  1XHX A;  1G15 A;  4CEB A;  3ZSY A;  2X6S A;  1WSH A;  4O0I A;  3SJJ A;  4FLZ A;  4DFP A;  3SI6 A;  1N5Y A;  4B9N A;  1UOC A;  2HHV A;  1GOC A;  2HND A;  3V9U A;  2DY4 A;  4FJM A;  1UWB A;  2FBX A;  3VQ9 A;  3PX4 A;  3TAP A;  1WN7 A;  3SQ4 A;  4CHZ A;  3HST B;  2O4G A;  3NGZ A;  3TAM A;  5I3U A;  3DRP A;  2GUI A;  4CEA A;  4M3T A;  1VSM A;  1BIU A;  3NF7 A;  1JL2 A;  4EP4 A;  1T8E A;  1RDA A;  1X9S A;  4CGJ A;  4E7I A;  3SCX A;  4YNQ A;  2ETJ A;  1FKO A;  3HP6 A;  5CZ1 A;  1S6Q A;  2EHG A;  3G0Z A;  3CQ8 A;  4FZZ A;  2A1S A;  1BHL A;  4FLU A;  1JXB A;  2PYJ A;  1L5U A;  1TL3 A;  3KD5 E;  1SKR A;  3OYA A;  2IDO A;  4LY7 A;  1TL1 A;  3VQ6 A;  5KRT A;  2ZQB A;  4O5B A;  3NDK A;  1J9A A;  3K59 A;  3SV3 A;  3HJF A;  1EXQ A;  2Z1J A;  3NAE A;  3DM2 A;  2PZS A;  2EX3 A;  1NKC A;  1VSI A;  1RDB A;  4AHS A;  1TKT A;  2HW3 A;  2B4J A;  3L2Q A;  4DSI A;  1IKW A;  3OYH A;  4FW1 A;  3M8S A;  1U4B A;  4FJ9 A;  4IFV A;  2HHS A;  4FLW A;  3SQ0 A;  1LAV A;  3F9K A;  3DI6 A;  4RW4 A;  4KFB A;  4DLG A;  2KZM A;  3K5M A;  1QS4 A;  3SV4 A;  1ASV A;  4B08 A;  3AO1 A;  4AHR A;  2VG5 A;  5FRN A;  4J2D A;  3LPT A;  5EU7 A;  4I2P A;  1HMV A;  3L2V A;  3LZJ A;  1SKS A;  4EZ6 A;  1EX4 A;  2E6M A;  1IG9 A;  3QEW A;  1S1W A;  1JLQ A;  4W5R A;  3AO3 A;  3KLE A;  3KK1 A;  1Q9Y A;  4KKO A;  3ZT2 A;  3OYF A;  4DSJ A;  2XY8 A;  4BE1 A;  4XIU A;  3OJS A;  3LAK A;  3OYC A;  1RTD A;  4NYN A;  1VRU A;  4KRE A;  4F3O A;  3T19 A;  4CHP A;  3AVL A;  2KZZ A;  3OYK A;  4W5N A;  3SPZ A;  4QOZ B;  3BDP A;  3L2R A;  4JRP A;  1NK6 A;  1ASW A;  4M3R A;  4E89 A;  4DU3 A;  4PWD A;  3DLG A;  3P5J A;  1RCH A;  1C6V A;  4FLX A;  3U3Y A;  1KLN A;  3PO4 A;  3HPH A;  3OYG A;  4K8X A;  1L3U A;  1N6Q A;  4UQG A;  5J2N A;  2GBZ A;  3RMD A;  3HL8 A;  4DQS A;  3K5N A;  3NH0 A;  5CY4 A;  2QK9 A;  2Z1H A;  2DFF A;  4DSF A;  3RWU A;  3LP1 A;  1TGO A;  1HPZ A;  3QLH A;  4OKJ A;  4DTS A;  2HVI A;  1B9D A;  4NCB A;  4N5S A;  4OGE A;  4E7J A;  4DTR A;  1VSD A;  4DG1 A;  1QHT A;  2YNI A;  1WSI A;  3VQC A;  4OLB A;  3CG7 A;  3L8B A;  1F21 A;  3FFI A;  3NH2 A;  3LAN A;  3OYE A;  4DTM A;  1RBV A;  4DQP A;  1T03 A;  1S1U A;  1ZBH A;  4OGC A;  4Z4G A;  1KLM A;  4FJ7 A;  1REV A;  2FC0 A;  4FK0 A;  3AO2 A;  2QKK A;  1RT4 A;  5HRR A;  3ZT4 A;  4E0D A;  1I3A A;  1LW2 A;  1TK8 A;  3SYZ A;  5SWM A;  1HYZ A;  4JLH A;  1Y97 A;  2F96 A;  2RF2 A;  2IOC A;  2VG7 A;  4BWJ A;  4OVL A;  4G1Q A;  3V81 A;  1BL3 A;  1HYV A;  3AVG A;  3WNE A;  4CHO A;  4M3W A;  2OPS A;  1YTU A;  4O4G A;  4FCY A;  4ELU A;  1TKX A;  3LP3 A;  4DF8 A;  3KKR A;  1XI1 A;  1U49 A;  1QE1 A;  4LSL A;  4AHU A;  3ZSV A;  4KHY A;  4FXD A;  4B3O A;  4KHQ A;  2Q3S A;  1RBT A;  2KQ2 A;  4KO0 A;  1TV6 A;  3VA0 A;  1X9M A;  3AVJ A;  5FRM A;  2ZD1 A;  5KI6 A;  3NFA A;  4CF2 A;  4FLY A;  1L3V A;  4BE2 A;  3E01 A;  4DSK A;  4J2E A;  3U6F A;  3DOL A;  4Q5V A;  3V9W A;  1U45 A;  3VQQ A;  3SUN A;  1C0T A;  1C0M A;  4FJ5 A;  4KB0 A;  1NKB A;  1C1B A;  1KVB A;  1IO2 A;  4Z4H A;  2KTQ A;  5HRO A;  1QQC A;  4CER A;  4CJV A;  3RRG A;  4LD0 A;  4CFC A;  4NCA A;  3L2W A;  3B6P A;  4HCB A;  4CJ3 A;  3T3F A;  2P5O A;  1JLG A;  3P1G A;  1BQM A;  3OY9 A;  3V9Z A;  3V6D A;  4M3Z A;  1HQE A;  3O3F A;  2HB5 A;  4CF8 A;  3TR8 A;  3CM5 A;  5DMR A;  4RW9 A;  4DTJ A;  2XRI A;  3AVN A;  4ID5 A;  4CF1 A;  5T7B A;  1BGX T;  1C1A A;  4HUF A;  3AO5 A;  2X6N A;  4M3X A;  1QSL A;  1KFS A;  3VQB A;  3ZT3 A;  2Z1G A;  4C8O A;  4DLE A;  4C8M A;  2FBT A;  4KRF A;  1BCO A;  4DTP A;  4HVJ A;  3F73 A;  3WNG A;  2OYQ A;  1DTQ A;  2R7Y A;  4ZTF A;  2OPR A;  4KHU A;  1SL1 A;  1RDC A;  3SUQ A;  4GMJ B;  1EP4 A;  4FZY A;  1WSF A;  1JLC A;  2FBY A;  3LWL A;  3NGY A;  4CGF A;  2WON A;  1QTM A;  1K6Y A;  1Z26 A;  1T7P A;  3NCI A;  5HLF A;  1UA0 A;  3DRS A;  4PA1 A;  3T1A A;  4Y1D A;  1B92 A;  1GOA A;  1VRT A;  2VWK A;  4FM2 A;  4B9T A;  4HTU A;  1RTJ A;  4CJL A;  4ZHR A;  3TAB A;  5C25 A;  2VWJ A;  4CJQ A;  2JLE A;  1S1X A;  3C6U A;  2XO7 A;  4IDK A;  4EZ9 A;  4CJW A;  3MEG A;  3KLI A;  4CJR A;  3PX0 A;  3DOK A;  3K2P A;  3VQ4 A;  4H4O A;  5HRS A;  4CHQ A;  1NK8 A;  3KIO A;  3QIO A;  1JLF A;  3NF6 A;  4J2B A;  5K14 A;  3S3M A;  3SUO A;  5HP1 A;  2G8H A;  3K5O A;  4N47 A;  1S5J A;  3LDS A;  3AA5 X;  4OJR A;  1Q9X A;  4EP5 A;  3OS0 A;  3M8R A;  4ICL A;  1Q8I A;  1RTI A;  4PQU A;  1JLB A;  4RG8 A;  5KRS A;  4OPJ A;  4ZTJ A;  4RW6 A;  5C42 A;  1X1P A;  1KCF A;  3NE6 A;  3QEV A;  4LH4 A;  3OS2 A;  4N56 A;  2KW4 A;  1QSY A;  4W5Q A;  4DTO A;  5HRP A;  3HPG A;  4ID1 A;  3VQA A;  1A5V A;  1EET A;  3K58 A;  1RBU A;  4E3S A;  1ZBF A;  3U3G A;  2AJQ A;  1LWC A;  3SQ2 A;  3MXI A;  4FJH A;  4I9L A;  1JKH A;  2NUB A;  3OYM A;  1KTQ A;  4KB1 A;  2HHT A;  3QEI A;  2OPP A;  4E1M A;  3S3N A;  1LAW A;  4H4M A;  5KTQ A;  1HQU A;  4CIG A;  2YNG A;  4R5P A;  3MAQ A;  1U48 A;  1VK0 A;  2DFH A;  3B6O A;  3LAL A;  3OYD A;  4KHW A;  3HO1 A;  2HHW A;  1IKX A;  3BGR A;  3DLE A;  3ULD A;  1NOZ A;  2OA8 A;  4GW6 A;  1LV5 A;  1CXQ A;  1VSJ A;  3AV9 A;  3HP9 A;  2Y1J A;  1IH7 A;  2X78 A;  1RIL A;  4AIL C;  4DSL A;  3L3U A;  2YKM A;  1CZB A;  4JS4 A;  4HUG A;  4TSX A;  4FM1 A;  2YV0 X;  2D0C A;  4N41 A;  3ITH A;  5DK5 A;  4O44 A;  3DRR A;  3LPU A;  4GVM A;  1NJW A;  2PY5 A;  1KSP A;  2HMI A;  4CEE A;  1TK0 A;  3DMJ A;  3I0R A;  1RT6 A;  4CIE A;  2YKN A;  4NYF A;  2W42 A;  4FK4 A;  4CK3 A;  4B9L A;  3ASM A;  1HNV A;  1TAU A;  4CK1 A;  1S1T A;  1KVC A;  3QNN A;  3KLG A;  3M8P A;  1VSK A;  4DMN A;  3TAN A;  3ZSQ A;  2E6L A;  1NK0 A;  1RT2 A;  4Z4F A;  1RBR A;  2D5R A;  1WAF A;  2G8V A;  2YNF A;  1TK5 A;  1NK9 A;  1RNH A;  1EKE A;  3EYZ A;  2I5J A;  3RR8 A;  3S9H A;  1FKP A;  4DS4 A;  3QET A;  3RR7 A;  1WSG A;  2ITG A;  2RKI A;  3ZSX A;  3PUF A;  4FZX C;  3AA4 A;  2BDP A;  4M41 A;  4FLT A;  3OYN A;  4QCL A;  1BIS A;  1YT3 A;  4MFB A;  4OLA A;  3I0S A;  4BWM A;  4DFM A;  4KHN A;  4FJJ A;  3VN5 A;  1WAJ A;  3LP2 A;  3QIP A;  4CJ5 A;  2GV9 A;  4DTN A;  1C0U A;  3KK3 A;  1NK7 A;  4I9Q A;  3HT3 A;  5CYM A;  3LAM A;  3MED A;  3ALY A;  4DFK A;  4CJT A;  3V4I A;  1ZYQ A;  1VSE A;  4RW8 A;  3ZT0 A;  4CF0 A;  5JS2 A;  4CGD A;  5SZT A;  4CF9 A;  3NBP A;  1A5W A;  2HNZ A;  4CFB A;  3UIQ A;  3OYB A;  4Z4I A;  2FBV A;  4F4K A;  4IKF A;  3V9S A;  2HHX A;  2Y1I A;  5J1E A;  3VQD A;  1RDD A;  3V1O A;  3DLH A;  1BI4 B;  4B9M A;  4CEZ A;  4OPK A;  1SUQ A;  2JGU A;  4I7F A;  3LWM A;  4O0J A;  4W5T A;  4FJK A;  3AVB A;  4CJF A;  1TKZ A;  3KD1 E;  2OPQ A;  3K57 A;  3G10 A;  3TAG A;  4CCH A;  4DFJ A;  1BI4 A;  1UA1 A;  4KV8 A;  1U47 A;  5J2Q A;  3TAR A;  1L3S A; 
#chains in the Genus database with same CATH topology
 4BRE A;  1VSL A;  3R9P A;  2QXF A;  3VQ8 A;  1S72 N;  2E1Z A;  1FXX A;  4XEI A;  3F5T A;  2BAN A;  1OKJ A;  1U04 A;  4I2Q A;  1SKW A;  1CZ9 A;  5CR4 A;  3CFP A;  4F2R A;  1XC3 A;  3TWH A;  2KFN A;  4U7B A;  1JLA A;  4KAZ A;  4EIA A;  3G6E N;  1N33 K;  1BWF O;  3ZSR A;  4FLV A;  1RT3 A;  1NGG A;  4B8A B;  4N76 A;  4CIF A;  4H0T B;  4DQI A;  5LL6 Z;  4B1V A;  4W5O A;  4CEF A;  2HVH A;  3HSC A;  3KLH A;  3F9M A;  1SL2 A;  3NH1 A;  1OVQ A;  5HRN A;  3HVT A;  2P51 A;  3QER A;  4DS5 A;  1HX1 A;  1HRH A;  4HUE A;  1YJN N;  1RT7 A;  2JWL A;  3HYF A;  1HYS A;  2P9K A;  4KPY A;  2QTD A;  4CHY A;  1B9F A;  2G8F A;  5KPZ A;  3SAG A;  4ILH A;  1OH6 A;  2XY7 A;  3OYJ A;  3WNH A;  4FPB A;  3SPY A;  1N36 K;  2ATQ A;  4IO9 L;  3CCR N;  4Z0U A;  1YAG A;  4HCC A;  1IKV A;  2LSN A;  4DCH A;  1ASU A;  4CZM A;  1T05 A;  1QVG M;  2A1R A;  3G4S N;  4CK2 A;  3DLR A;  4CZI A;  4KTZ A;  1VQK N;  3THV A;  3QO9 A;  5F2R A;  3DJC A;  1X3M A;  3CER A;  1ZBU A;  1QQO A;  1NK4 A;  1SV5 A;  2ZM6 K;  4WFB L;  3L2U A;  3ZSW A;  1RT1 A;  5HOO A;  3QEP A;  1WLJ A;  5M1Q A;  4JS5 A;  3SBG A;  1YVN A;  3JSM A;  1BG3 A;  2Q0R A;  5E26 A;  4KI6 A;  2F8T A;  3VQE A;  2YJF A;  3SNN A;  3IG1 A;  3VQP A;  1JCF A;  2DPN A;  4CJ7 A;  3M8Q A;  3FZK A;  1S3X A;  3AVH A;  1NWK A;  5J2M A;  1NU0 A;  3HVR A;  3C7N B;  4JHD A;  4DV1 K;  1RT5 A;  1XWL A;  3EN9 A;  3ZSO A;  3MXM A;  4BDY A;  2F4V K;  5E41 A;  4M42 A;  4WE1 A;  1KFD A;  4BDZ A;  4FM0 A;  2G8U A;  4WCE L;  4MDB A;  4F8R A;  3HXM A;  3AA3 A;  4WF9 L;  2CGJ A;  3I8D A;  2D0P A;  1C0G A;  1WB9 A;  3QIN A;  2D0B A;  5GIP A;  3KJV A;  5DM7 L;  2E88 A;  3VQ5 A;  1ILY A;  1W9H A;  1KVA A;  3ID6 A;  4FJI A;  2P5G A;  1K73 O;  4FYD A;  4CGI A;  3THX B;  3AVA A;  3V1R A;  3O9S A;  2OAN A;  3CJ1 A;  5LJV A;  4Z4E A;  4CEB A;  1VQ6 N;  3AGK A;  3ZSY A;  4O0I A;  3SJJ A;  2UUA K;  4B9N A;  2VQE K;  1WUA A;  2ASO A;  2HBL A;  4WQ4 A;  1HNX K;  3EEQ A;  2DY4 A;  1NLV A;  4FJM A;  3VQ9 A;  3HBT A;  3ZX2 A;  5M1K A;  1WN7 A;  5I3U A;  3Q7B A;  1VSM A;  3R8E A;  3W3D A;  5BRE A;  4E7I A;  3HP6 A;  1S6Q A;  3G0Z A;  3CQ8 A;  2A1S A;  1BHL A;  4CZG A;  1NGB A;  4WQ4 C;  1L5U A;  3FGU A;  3OYA A;  1QZ6 A;  2ZQB A;  1HNZ K;  3CQX A;  3DM2 A;  3RVC A;  2PZS A;  3A8Y A;  3LDL A;  2IVN A;  4DHY A;  3T1H K;  1TKT A;  3OA9 A;  3L2Q A;  4DSI A;  1IKW A;  3A5L C;  3SQ0 A;  5C2F A;  3WXK A;  1HKB A;  1Q7Y O;  2UXD K;  2KZM A;  4B08 A;  4AHR A;  3CMA N;  1GLA G;  2QWR A;  2IVP A;  3GOI A;  3L2V A;  3LZJ A;  2VQF K;  4EZ6 A;  3I56 N;  5FLX O;  1IBM K;  1U6Z A;  4JEP A;  1S1W A;  1Q9Y A;  3KK1 A;  3CI5 A;  4KKO A;  1GLE G;  1GLF O;  4BE1 A;  2ASP A;  3CF5 L;  3LAK A;  3OYC A;  2FSN A;  4CHP A;  4F3O A;  4DR3 K;  3MDQ A;  5AQN A;  4BY9 C;  3BDP A;  4JRP A;  1NK6 A;  2A3Z A;  4BR4 A;  4E89 A;  3EKS A;  2QA4 N;  1C6V A;  2YHY A;  3U3Y A;  3HPH A;  3OYG A;  3E9P A;  1E4F T;  4UQG A;  4DQS A;  4FO0 A;  3FZF A;  5AQL A;  4OKJ A;  1RFQ A;  4N5S A;  5C0Y A;  2E2O A;  5BRF A;  4YOV A;  4DTM A;  1ZC6 A;  1T03 A;  3LM9 A;  2QW9 A;  5ADX H;  1KAY A;  4Z4G A;  1KLM A;  5TKW A;  4FJ7 A;  4FK0 A;  3MK6 A;  1RT4 A;  3LM2 A;  3ZT4 A;  4YDU C;  3SYZ A;  5SWM A;  2GWJ A;  4B1X B;  1BL3 A;  1HYV A;  3WNE A;  1YTU A;  4FCY A;  1XI1 A;  3O6W A;  5EOY A;  2Q3S A;  2HMP A;  4XH4 A;  3C7N A;  1X9M A;  4EAH D;  2UXC K;  4CF2 A;  1TUY A;  4FLY A;  4DV4 K;  1GLL O;  5EX5 A;  5JMV A;  3VQQ A;  2P9P A;  1NG9 A;  2UUC K;  4AM6 A;  3CC2 N;  1NKB A;  1KVB A;  1IO2 A;  1QQC A;  5LMU K;  4CJV A;  4LD0 A;  2IIR A;  2NNW A;  1K8A O;  4JI5 K;  4HCB A;  4PKG A;  4CJ3 A;  1BQM A;  3OY9 A;  3V6D A;  3C65 A;  3ZYY X;  1QVF M;  4RW9 A;  4DTJ A;  4GV6 A;  3VEX A;  5T7B A;  1ZXO A;  1C1A A;  1E4G T;  4M3X A;  1QSL A;  5B8H A;  2OYQ A;  3BUZ B;  1GLD G;  1EP4 A;  3THX A;  4BRG A;  5CHI A;  5JLH A;  3P31 A;  1QTM A;  2KLA A;  1T7P A;  4CD1 A;  5AZJ A;  3DRS A;  3T1A A;  1B92 A;  1GOA A;  2W6K A;  5C25 A;  2YCH A;  3QDK A;  2ZWH A;  3CHW A;  1N32 K;  3IUC A;  1XUP O;  4CJR A;  3U4L A;  3VQ4 A;  3ZET B;  4BRN A;  4B1U B;  4BRM A;  4RCH A;  4N47 A;  1BUP A;  3LDS A;  3VGM A;  4RW6 A;  1X1P A;  2HBM A;  1KCF A;  5AQX A;  3ZX3 A;  1WOQ A;  4LH4 A;  3UKR B;  4BRF A;  4ID1 A;  1RBU A;  1OH7 A;  1ZBF A;  3SQ2 A;  3MXI A;  4FJH A;  1Q82 O;  3OYM A;  1KTQ A;  3VPZ A;  4E1M A;  3S3N A;  4H4M A;  3SAH A;  1YXQ A;  4CIG A;  1BDG A;  3LDP A;  3TTC A;  3HO1 A;  2HHW A;  1IKX A;  3ULE B;  3ULD A;  1LV5 A;  1SQK A;  2X78 A;  5AQG A;  1Q81 O;  3L3U A;  4HUG A;  4BR9 A;  4PL8 A;  4B1W B;  5AQU A;  4FM1 A;  4H5T A;  5DK5 A;  3HRG A;  3DRR A;  2PY5 A;  2HMI A;  4JI1 K;  4BRC A;  3DMJ A;  1TK0 A;  1RT6 A;  2QXL A;  4IJN A;  4NYF A;  1JCE A;  3ASM A;  2OCE A;  1TAU A;  2HBK A;  3QNN A;  3KLG A;  4FWP A;  3HTV A;  4IDH A;  3AY9 A;  4BRH A;  2E6L A;  5C2D A;  3J80 O;  1MA9 B;  4Z4F A;  2CGK A;  5AQT A;  1WAF A;  2YNF A;  1NK9 A;  3K9J A;  1OH8 A;  2I5J A;  4DS4 A;  1WSG A;  2RKI A;  2E2N A;  1RGI A;  4FZX C;  4FWK A;  4M41 A;  3OYN A;  3R3L A;  1YT3 A;  2VGM A;  3NVK A;  4DFM A;  3VN5 A;  4I9Q A;  4DTN A;  2GV9 A;  1C0U A;  1NK7 A;  3SMS A;  3VF4 A;  4DFK A;  4JKF A;  3ZT0 A;  4CF0 A;  4A62 A;  4JAX A;  4CGD A;  4CVN E;  3NBP A;  3UIQ A;  3OYB A;  4Z4I A;  4IKF A;  3JXU A;  4G9Z A;  3OTO K;  2V52 B;  3QBW A;  3P39 A;  1SUQ A;  4I7F A;  4W5T A;  4HWI A;  4FJK A;  4CJF A;  1BI4 A;  3EL2 A;  5GAD P;  4JK7 A;  5J2Q A;  1ATN A;  1L3S A;  4FW2 A;  3ZCM A;  4DR4 K;  1CXU A;  4JI2 K;  5BR8 K;  1VQ8 N;  3H08 A;  3AA2 A;  1RDU A;  3O08 A;  3VEZ A;  4CHN A;  2PFU A;  2XY5 A;  4HHT A;  4CES A;  2OZM A;  4FWO A;  4O8U A;  2FXU A;  2Z1I A;  4MDA A;  4PUO A;  3A2F A;  1VSF A;  3CJA A;  3OVN A;  1T3V A;  4Y1C A;  2E2P A;  4QS9 A;  3A5N C;  2HOE A;  3MWT A;  2QWM A;  4BC4 A;  4CJU A;  1RBS A;  4DR2 K;  5JS1 A;  4F3T A;  1C1C A;  2QKB A;  3EY1 A;  2FLO A;  1LW0 A;  4CEO A;  1J54 A;  1ZBL A;  4FJG A;  3ZET A;  2NRZ A;  2YHW A;  5AZI B;  1NGA A;  3WXL A;  4ILJ A;  4CGH A;  2G8W A;  4IFY A;  3RTV A;  1SS6 A;  3VEN A;  3VQ7 A;  1J5O A;  4M45 A;  1D5A A;  1JL1 A;  3NGI A;  1JLE A;  4CEC A;  3MEC A;  4IOC L;  1Y64 A;  5KGX A;  2XHB A;  3CD6 N;  4B9V A;  3VMF B;  4BC5 A;  3ID8 A;  3UKR A;  2P9L A;  1L3T A;  2HNY A;  1Z05 A;  4CZK A;  1ITG A;  3L4Q A;  1D8Y A;  4CFD A;  4LSN A;  2ZE2 A;  2NRV A;  4H0O A;  4OO1 J;  3CCQ N;  1LWE A;  3ULE A;  4BG8 A;  2DFE A;  1JXE A;  3MEE A;  4PKI A;  3TPQ A;  5KPT A;  1W0H A;  1TKD A;  1DT9 A;  4DU1 A;  4DSE A;  5D3G A;  4BRK A;  5M1F A;  1HPM A;  4DV5 K;  1HKG A;  4MQ3 A;  3CPW M;  1YTA A;  4MO4 A;  5CYQ A;  4FK2 A;  3NVM A;  5C10 A;  3KZB A;  4A2B A;  4B8C A;  3F2K A;  4O55 A;  5CZ2 A;  2Q36 A;  4KI4 A;  3TAE A;  3FR0 A;  4A57 A;  1BQN A;  4BRD A;  4BE0 A;  4PY5 A;  1IV0 A;  1N34 K;  3WT0 A;  3B8A X;  1IBK K;  4DB3 A;  3E66 A;  2P1J A;  1VQN N;  1NBW A;  5C24 A;  5TKY A;  3TI0 A;  4JHD B;  4IG0 A;  3WXJ A;  4BC3 A;  2OTJ N;  3AO4 A;  1SL0 A;  4KHS A;  3TSU A;  3MN6 A;  4KH5 A;  4BR7 A;  1IKY A;  3QFP A;  4LFC K;  4CZJ A;  4FJX A;  4JKG B;  3KLF A;  3OYI A;  2IS3 A;  1W97 L;  3ENH A;  1NJZ A;  4CJK A;  1W2B M;  4PHT X;  3D0P A;  1EQY A;  4NCG A;  3HM9 A;  3AVI A;  3FZM A;  3J8A A;  4BRI A;  4DWI A;  3WXI A;  1DLO A;  4CED A;  2Q2R A;  1NKE A;  4CE9 A;  1HNI A;  1WNS A;  2VGN A;  2PYL A;  3BZK A;  1XC9 A;  1S6P A;  4DR6 K;  3A5M C;  4BAC A;  1GLC G;  1EWQ A;  4DTU A;  4IJA A;  3P83 D;  2AA4 A;  4BR2 A;  4YOY A;  3A0I X;  4KH6 A;  4E7H A;  4FJL A;  2KFZ A;  3T7Z A;  4CW7 B;  4LF5 K;  2OZS A;  2BGG A;  4JI3 K;  3HZ6 A;  1G15 A;  2GEL A;  4KHU A;  1WSH A;  3KK7 A;  4DFP A;  3SI6 A;  1N5Y A;  1UOC A;  2HND A;  2FBX A;  2QWN A;  3HST B;  4H0V B;  3N4P A;  4BR5 A;  4CEA A;  3T69 A;  3CJ7 A;  4LFA K;  1BIU A;  3NF7 A;  1JL2 A;  1ATS A;  4YNQ A;  3LDO A;  2QEX N;  4H5R A;  5AZI A;  2PYJ A;  3UE5 A;  4DR5 K;  1SKR A;  3VQ6 A;  1J9A A;  3SJH A;  3K59 A;  3H45 C;  3HJF A;  4NB4 A;  2Z1J A;  3NAE A;  1RDB A;  5C12 A;  4UY8 O;  3M8S A;  4FLW A;  1LAV A;  3F9K A;  4FWR A;  4RW4 A;  3SMP A;  4DLG A;  4L3Q A;  3K5M A;  4I6M B;  2VG5 A;  4I2P A;  1HMV A;  4A61 A;  2E6M A;  4ILG B;  3KLE A;  3BZC A;  3Q7C A;  2FF3 B;  4H0P A;  5BRH A;  4NYN A;  2KZZ A;  3T19 A;  4IZ9 A;  4K25 A;  4OX9 K;  4DV7 K;  4PWD A;  3P5J A;  3CJ9 A;  1RCH A;  4K8X A;  1N6Q A;  2BH1 A;  3K5N A;  5BR9 A;  2Z1H A;  4DSF A;  3LP1 A;  1TGO A;  1HUX A;  1B9D A;  3VER A;  4DTR A;  3VQC A;  3CG7 A;  3IKM A;  4LFB K;  2CH5 A;  5I9E B;  1NM1 A;  3ZEU A;  1D4X A;  3W0L A;  2GX9 A;  1LW2 A;  1TK8 A;  4AF1 A;  1HYZ A;  2ITM A;  2RF2 A;  4BWJ A;  3R1X A;  2VG7 A;  3V81 A;  2OPS A;  4KH4 A;  4O4G A;  1HKC A;  1TKX A;  4KHY A;  4FXD A;  1J6Z A;  2P9P B;  4KHQ A;  1WBD A;  3CC4 N;  3AAR A;  1L3V A;  1VQ9 N;  3E01 A;  4J2E A;  4H0X B;  1T6C A;  4JKG A;  4AQY K;  4KBO A;  2H3G X;  3DWL A;  4FJ5 A;  1C1B A;  3KHY A;  2P9U A;  4Z4H A;  3VEY A;  1E3M A;  3RRG A;  3EKU A;  5AQI A;  3L2W A;  4JKB A;  5MLC Q;  2P5O A;  1JLG A;  3P1G A;  3V9Z A;  4M3Z A;  3O3F A;  3TR8 A;  3CM5 A;  1CZA N;  2ZJR L;  3TSP A;  4BRA A;  3AO5 A;  3LL3 A;  2X6N A;  2GEM A;  1VAZ A;  4IWV A;  4DLE A;  2FBT A;  5FPM A;  1BCO A;  4DTP A;  4HVJ A;  5AZJ B;  3TSQ A;  1DTQ A;  2OPR A;  4YHH K;  3SUQ A;  1WSF A;  2FBY A;  4JKE A;  4CGF A;  3NCI A;  3WXM B;  1S22 A;  4B9T A;  1KD1 O;  1RTJ A;  4NO7 A;  3AGR A;  2JLE A;  1S1X A;  3MN9 A;  4EZ9 A;  3KLI A;  2V7Y A;  5AQJ A;  3DOK A;  4H4O A;  5HRS A;  4LF7 K;  3VET A;  1NK8 A;  2NRX A;  3EE9 A;  5K14 A;  5HP1 A;  2E20 A;  1S5J A;  2P9I B;  1Q9X A;  4EP5 A;  4JI6 K;  1TUU A;  4OPJ A;  4ZTJ A;  5C42 A;  3O1W A;  3OBW A;  4DUY K;  3NE6 A;  3JS6 A;  4CZH A;  1DGK N;  4N56 A;  1EO1 A;  1QSY A;  2FSJ A;  5HRP A;  1XNQ K;  1A5V A;  4E3S A;  1WBB A;  1H1V A;  3U3G A;  4H5V A;  2P9S A;  2NUB A;  4KB1 A;  4JYA K;  2OPP A;  1HQU A;  2YNG A;  3LAL A;  3OYD A;  3M6G A;  4I6M A;  2VWB A;  3DLE A;  4FWQ A;  3VGK A;  2P9N A;  3U9Z A;  4K42 A;  3HP9 A;  4DR7 K;  2YKM A;  1CZB A;  1ATR A;  4N41 A;  2D0C A;  3ITH A;  1NJW A;  1YJW N;  1KSP A;  3CC7 N;  2YKN A;  3ZX0 A;  1S1T A;  1EWR A;  3A5O C;  3PSF A;  1VSK A;  3OBY A;  4DMN A;  3TAN A;  3ZSQ A;  5GAG P;  1NK0 A;  1K8K A;  1JJ2 M;  1YHQ N;  4EFH A;  2NRR A;  1MDU B;  2G8V A;  1TK5 A;  4GV9 A;  1RNH A;  1EKE A;  4XH1 A;  1YF5 L;  3SK3 A;  2O8F B;  3PUF A;  2BDP A;  4DUZ K;  4FLT A;  4OLA A;  3QIP A;  1LCU A;  4CJ5 A;  1NGI A;  5CYM A;  3LAM A;  3MED A;  4JI0 K;  4GKK K;  1IBL K;  1NGE A;  4CJT A;  3V4I A;  1ZYQ A;  1VSE A;  3KWG A;  2HF3 A;  4IEI A;  5SZT A;  1QQN A;  4IXC A;  3G25 A;  2F9W A;  4BVO A;  2FBV A;  1XNR K;  4WYB A;  1YI2 N;  4KHP K;  1BI4 B;  4OPK A;  2JGU A;  5AQK A;  4BG9 A;  4B3M K;  2QWL A;  1TKZ A;  2OPQ A;  3DXM A;  5ELZ A;  1UA1 A;  4FZZ A;  2ZJQ L;  4WFA L;  1ZBI A;  4C8N A;  5E84 A;  4PL7 A;  4YY3 K;  3DLK A;  4FPA A;  5FPN A;  5KQ8 A;  4DQR A;  3EZ5 A;  4O5F A;  2UU9 K;  4B3R K;  3HK2 A;  5GIN A;  3HPO A;  5F0X A;  4M7Y A;  1G99 A;  3OYL A;  3SUP A;  2O8C B;  3CCS N;  4ELT A;  2W40 A;  5HBM A;  3O4W A;  2IAJ A;  1NK5 A;  4JRQ A;  3O8M A;  2GUP A;  2Q31 A;  4DU4 A;  2VYP A;  1FK9 A;  3PO5 A;  1XHZ A;  3QES A;  3D2F B;  4Z94 A;  1NJX A;  3CCM N;  3IFR A;  4IFE A;  1HJR A;  4ISE A;  5EXW A;  4QAG A;  2P9I A;  3GG4 A;  1Z25 A;  1NNE A;  2P9L B;  4CEQ A;  3CCV N;  1YVU A;  4A59 A;  3BF3 A;  2W41 A;  3V1Q A;  3AVC A;  2YHB A;  4BQZ A;  1BO5 O;  4JKD A;  4IBN A;  1A5X A;  4CZF A;  5JIC A;  4CJ4 A;  2BUP A;  2B6A A;  2I7N A;  2BE2 A;  2X74 A;  3MXJ A;  5DM6 L;  1CLQ A;  3VA3 A;  3DLB A;  3O9R A;  2O8E A;  2CGL A;  4ISF A;  4BC2 A;  1DKG D;  3VF6 A;  1KAZ A;  4E7L A;  3J7Y P;  1UAX A;  4FWN A;  4YOX A;  3FZL A;  3OJU A;  3V9X A;  4E19 A;  4PKH A;  2D4W A;  3JAM O;  4JI4 K;  3CCU N;  2BTF A;  2HHQ A;  1P8Z A;  2EWS A;  2HHH K;  1QSS A;  5LJW A;  4YOR A;  5EVZ A;  3AVF A;  3ATV A;  4QS7 A;  3KVG A;  3O9T A;  3AVM A;  1GOB A;  4IEE A;  5AJ3 K;  5FDL A;  1IG8 A;  4CZL A;  3SAF A;  5J2P A;  3J81 O;  3DYA A;  3L3V A;  3E1Y A;  1TAQ A;  2O8F A;  2QM1 A;  3O3H A;  2G8K A;  1D9F A;  1NOY A;  3O3G A;  4K8Z A;  3CIP A;  2Q97 A;  3ZSZ A;  3IS9 A;  2F9T A;  3C6T A;  2JWK A;  3UKU B;  2QWQ A;  4AHT A;  3IDH A;  2A41 A;  4B9S A;  1NJY A;  2WOM A;  1X9W A;  3O4Q A;  4H5W A;  1FW6 A;  4IG3 A;  4KTW A;  4YFU A;  3WNF A;  3C6A A;  1KRP A;  3UB5 A;  5I42 A;  3K5L A;  4CBX A;  3P4I A;  4FJ8 A;  1S9G A;  4K43 A;  2UYT A;  4JKH A;  3BF1 A;  3KKS A;  3PX6 A;  2IGI A;  3T1Y K;  1MWM A;  3WQU A;  2DTU A;  1BA0 A;  3BEX A;  3VES A;  4CFA A;  3CCJ N;  3RRH A;  3D45 A;  4F2S A;  3ZLJ A;  3E9O A;  4KTQ A;  2O8C A;  3TTD A;  4HTL A;  4X62 K;  2HHV A;  1GOC A;  3O80 A;  4CZE A;  3PX4 A;  3TAP A;  1OH5 A;  3SQ4 A;  4CHZ A;  2O4G A;  3NGZ A;  3HOS A;  3TAM A;  1VQ5 N;  3DRP A;  2GUI A;  2E8A A;  1X9S A;  4DV2 K;  4CGJ A;  3D2F A;  3SCX A;  2ETJ A;  2EHG A;  3OW2 M;  3EE8 A;  4J8F A;  4FLU A;  1JXB A;  2WUS A;  3KD5 E;  1OVY A;  2IDO A;  4LY7 A;  5KRT A;  4B1Y B;  2RHK A;  1EXQ A;  4A2A A;  1V4T A;  3MWP A;  1NKC A;  4GV3 A;  3N4Q A;  1VSI A;  2D0O A;  4RTF D;  5A2Q O;  5M1O A;  3OYH A;  4FW1 A;  1U4B A;  2HHS A;  3DI6 A;  2D1K A;  4KFB A;  1ASV A;  2NRH A;  5FRN A;  4J2D A;  2O8B A;  4FWM A;  1LOT B;  4ISG A;  3MMV A;  2W6L A;  1IG9 A;  2HHU A;  4B1Z A;  3ZT2 A;  5FPE A;  3OJS A;  1O13 A;  3WUH A;  4KRE A;  3AVL A;  4W5N A;  3SPZ A;  2QWO A;  4QOZ B;  2WFB A;  3THY A;  3VEW A;  1ASW A;  3DLG A;  3I55 N;  3O9Q A;  1KLN A;  3P38 A;  4NXN K;  3E9L A;  2A40 A;  1L3U A;  5J2N A;  3RMD A;  2GBZ A;  1XMQ K;  3CCE N;  3NH0 A;  5KQD A;  1HNW K;  5AQR A;  4DTS A;  3ZEU B;  3MN5 A;  4BRL A;  1F21 A;  5M1N A;  3LAN A;  4B3T K;  1RBV A;  3FLC O;  4CBU A;  3THW A;  2A6A A;  1REV A;  3M5R A;  3AO2 A;  1QHA A;  1Y97 A;  2F96 A;  3H6E A;  3M1F A;  3AAQ A;  4OVL A;  4G1Q A;  4BQL A;  4LF8 K;  3LDQ A;  4CHO A;  3PIP L;  4M3W A;  4ELU A;  2GTD A;  3OHR A;  4DF8 A;  1QE1 A;  4LSL A;  3ZSV A;  3L0Q A;  4JKC A;  1RBT A;  2KQ2 A;  4KO0 A;  3UKU A;  3VA0 A;  3AVJ A;  2P9U B;  5FRM A;  4DKW A;  2ZD1 A;  5KI6 A;  2YHX A;  3U6F A;  3DOL A;  3FZH A;  3V9W A;  1U45 A;  1C0T A;  1C0M A;  4KB0 A;  1VQ4 N;  4EHU A;  4CER A;  4CFC A;  1VQM N;  1HJO A;  4NCA A;  3B6P A;  3T3F A;  4DV6 K;  4FVU A;  4LF4 K;  5DMR A;  2XRI A;  3AVN A;  1BGX T;  4GNI A;  1KC8 O;  4CI6 A;  5LMN K;  1KFS A;  3ZT3 A;  2Z1G A;  4KRF A;  2WBN A;  3F73 A;  5BRD A;  3WNG A;  2FSK A;  1SL1 A;  4GMJ B;  4FZY A;  1JLC A;  3NGY A;  4PA1 A;  2VWK A;  5IT9 O;  4HTU A;  1Q86 O;  4CJL A;  3TAB A;  4YOU A;  2VWJ A;  3C6U A;  3SBT A;  2A5X A;  4CJW A;  3MEG A;  3PX0 A;  4JV5 K;  3DAW A;  5CE3 A;  3NMU A;  5AQW A;  1FJG K;  4CHQ A;  5JVH L;  3KIO A;  3QIO A;  4FSV A;  1JLF A;  3NF6 A;  4J2B A;  3K5O A;  4JI8 K;  3AA5 X;  4OJR A;  4JI7 K;  3OS0 A;  3G71 N;  3M8R A;  4ICL A;  1Q8I A;  1RTI A;  4PQU A;  1C0F A;  5KRS A;  2HBJ A;  2KHO A;  2P9S B;  3OS2 A;  4H03 B;  4W5Q A;  3QIC A;  4DTO A;  1XMO K;  3HPG A;  1EET A;  3K58 A;  2AJQ A;  1GLJ O;  1LWC A;  2QI2 A;  4I9L A;  1JKH A;  1KAX A;  2P9N B;  3MCA B;  4A5A A;  1VQO N;  5KTQ A;  4BGA A;  4R5P A;  3MAQ A;  3AAP A;  4U67 L;  2DFH A;  4F9O A;  3BGR A;  1NOZ A;  4DQ8 A;  1CXQ A;  1VSJ A;  3AV9 A;  2Y1J A;  4CD3 A;  4AIL C;  3WEE B;  4JS4 A;  4TSX A;  3MX5 A;  4B9Q A;  3R6M A;  4RWT A;  4O44 A;  3LPU A;  2YX6 A;  4JD2 A;  5AQH A;  1J5E K;  4CEE A;  3ATU A;  3I0R A;  4GKJ K;  1K8K B;  4R79 A;  4FK4 A;  5BPM A;  4CK1 A;  1KVC A;  2KKZ A;  3L4I A;  1MWK A;  3DLL L;  4XH5 A;  3EYZ A;  3RR8 A;  5KPR A;  1FKP A;  3QET A;  3RR7 A;  2ITG A;  3ZSX A;  4QCL A;  4JNE A;  4MFB A;  3MN7 A;  4BWM A;  4KHN A;  4FJJ A;  3LP2 A;  3KK3 A;  3HT3 A;  2Q0U A;  5GAE P;  3ALY A;  3ENB A;  1T6D A;  4RW8 A;  1K9M O;  5JS2 A;  1NMD A;  4CF9 A;  1A5W A;  4CFB A;  4F4K A;  2PBD A;  2HHX A;  2Y1I A;  5J1E A;  3DXM B;  1RDD A;  3V1O A;  3DLH A;  3O9U A;  4BRP A;  3H3O B;  3AVB A;  3TTF A;  3KD1 E;  3K57 A;  3G10 A;  2GWK A;  2ZF5 O;  4DFJ A;  3TAG A;  4KV8 A;  3TAR A;  4Z4C A;  3CFR A;  1RDW X;  3CYM A;  1R59 O;  2I7P A;  1O1W A;  2RN2 A;  4IOX A;  5AQO A;  2ASM A;  3CCL N;  1D9D A;  4FJN A;  3K9K A;  4AHC A;  1X3N A;  3JYT A;  4JN4 A;  4DV3 K;  1R0A A;  4B3S K;  2OTL N;  2O4I A;  5HL7 L;  1VSH A;  3MCP A;  3SQ1 A;  3ZT1 A;  2UXB K;  3NHG A;  2D0A A;  3AVK A;  3S41 A;  3RMC A;  1M1K O;  1VQ7 N;  3IRX A;  4AHV A;  3RMA A;  4O8K A;  4OKE A;  3LP0 A;  4B9U A;  1YIJ N;  5AQV A;  3LZI A;  3WQT A;  4CJS A;  3D2E B;  3KTQ A;  3BP8 A;  4M3U A;  1ESV A;  4LC9 B;  1X9J A;  1VHX A;  3J7Z O;  3PLA A;  1BU6 O;  1SZ2 A;  4BVP A;  5FRO A;  3TAF A;  3KK2 A;  3PY8 A;  2E4L A;  5M1P A;  3C6H A;  3OS1 A;  1S1V A;  3CM6 A;  4JK9 A;  3QEX A;  3RMB A;  3TAQ A;  5LY3 A;  2V7Z A;  1WSE A;  4L8R B;  3QFU A;  2O8E B;  4C1N I;  4CJP A;  4LH5 A;  4MLE A;  1U2V B;  2VG6 A;  4C23 A;  1S9E A;  2YNH A;  2RE2 A;  4A5B A;  2HST A;  1NGH A;  2YI1 A;  2WTU A;  4AH9 A;  4FOE A;  1NGD A;  3WEE A;  3GE1 A;  3J7A P;  1MU2 A;  1HLU A;  1DTT A;  4DTX A;  2YHA A;  4K0K K;  4ELV A;  4FWS A;  2HF4 A;  2PAV A;  2NZT A;  4C8L A;  3C0B A;  4YDU A;  3ISN C;  4FL9 A;  1XQS C;  4E1N A;  4BRQ A;  3C94 A;  1WSJ A;  2CH6 A;  3PV8 A;  1NGC A;  3M3Z A;  5AQM A;  1YJ9 N;  1I39 A;  1BCM A;  1RTH A;  4RW7 A;  1J53 A;  1Q18 A;  4GVE A;  3C95 A;  4YOW A;  2IC3 A;  2RPI A;  1P90 A;  5AQZ A;  3S3O A;  1KQS M;  5F1X A;  4CGG A;  4C8K A;  3NF8 A;  4H8K A;  4E7K A;  5AR0 A;  2XY6 A;  4J2A A;  3NF9 A;  3CFO A;  1BIZ A;  5BPN A;  4Q0B A;  3QNO A;  5KGW A;  5AFU H;  4CBW A;  2A42 A;  4DF4 A;  3BY5 A;  1I94 K;  4FOI A;  4BDP A;  4FWL A;  4DQQ A;  2FF6 A;  2F8S A;  4DR1 K;  1DEJ A;  3IAY A;  3O4N A;  1LWF A;  3D7E O;  2ZGZ A;  4FVM A;  3GDQ A;  3QML A;  4OKK A;  4M3Y A;  4BRO A;  3SZ2 A;  4CJE A;  1TVR A;  2G8I A;  1VQP N;  5GIO A;  4BGB A;  2B5J A;  4LF6 K;  1XHX A;  5H1S Q;  2X6S A;  4EHT A;  4FLZ A;  3V9U A;  1UWB A;  4IO8 A;  3HI0 A;  4M7X A;  5EY4 A;  2ZGY A;  3EZW A;  4M3T A;  4EP4 A;  1T8E A;  1RDA A;  1QZ5 A;  3D2E A;  1FKO A;  5CZ1 A;  1TL3 A;  1NJI O;  1TL1 A;  4O5B A;  3NDK A;  1V4S A;  3QBX A;  3SV3 A;  3I33 A;  2F7T A;  2EX3 A;  2O8D B;  3QB0 A;  4AHS A;  2HW3 A;  2B4J A;  3IMX A;  3MX2 A;  2O8B B;  4FJ9 A;  4IFV A;  1QS4 A;  1KXP A;  3SV4 A;  3AO1 A;  1Z6R A;  3LPT A;  5EU7 A;  5AQY A;  1IJJ A;  1SKS A;  1M90 O;  1EX4 A;  1U2V A;  3QEW A;  1JLQ A;  4W5R A;  3AO3 A;  3DXK B;  3OYF A;  3THY B;  4DSJ A;  2XY8 A;  2J4R A;  4XIU A;  3CJC A;  1RTD A;  1VRU A;  3H46 O;  3OYK A;  1HR0 K;  3L2R A;  1NGF A;  3KWI A;  4M3R A;  4DU3 A;  4YOT A;  4FLX A;  1TYQ B;  2E2Q A;  3PO4 A;  3HL8 A;  4LF9 K;  5CY4 A;  2ZJP L;  2QK9 A;  3VF2 A;  2DFF A;  3RWU A;  1HPZ A;  3QLH A;  4K41 A;  3THW B;  2HVI A;  1GLB G;  4NCB A;  3RSE B;  4OGE A;  4E7J A;  3VEO A;  1VSD A;  4DG1 A;  1QHT A;  2YNI A;  1WSI A;  4OLB A;  3L8B A;  3FFI A;  3NH2 A;  3OYE A;  4DQP A;  1S1U A;  1ZBH A;  4OGC A;  3L6Q A;  4OPA A;  2FC0 A;  2QKK A;  5HRR A;  4E0D A;  1I3A A;  4JLH A;  2IOC A;  5ADX A;  3AVG A;  2E1Y A;  3LP3 A;  3KKR A;  4MO5 A;  1U49 A;  1BA1 A;  4AHU A;  3CME N;  4B3O A;  4X65 K;  1TV6 A;  3H3N O;  4IOA L;  3NFA A;  4DSK A;  4MLH A;  4BE2 A;  4Q5V A;  3FFK B;  3SUN A;  4V19 S;  5IWA K;  2KTQ A;  4AM7 A;  4NXM K;  5HRO A;  5JVG L;  5GAH P;  3U9D A;  1W7A A;  1HQE A;  3K0S A;  2HB5 A;  4CF8 A;  2VCP A;  2NRW A;  5AQQ A;  5AFU A;  4ID5 A;  4JK8 A;  4CF1 A;  2QWP A;  4HUF A;  3VQB A;  4C8O A;  3EO3 A;  4C8M A;  2UUB K;  3GL1 A;  1VQL N;  3VTH A;  2R7Y A;  4ZTF A;  1RDC A;  2IVO A;  3LWL A;  1YUW A;  2WON A;  3FE1 A;  1SAZ A;  1K6Y A;  1Z26 A;  1NMN A;  5HLF A;  1UA0 A;  4NLB A;  4Y1D A;  1VRT A;  4FM2 A;  4H0Y B;  5BN8 A;  3D6R A;  4ZHR A;  4NLC A;  4CJQ A;  1ZBS A;  2XO7 A;  4IDK A;  4WFN L;  3K2P A;  3CJB A;  3SLC A;  4QS8 A;  2Q1N A;  2WC9 A;  1JCG A;  2V51 B;  3SUO A;  3S3M A;  2G8H A;  4C1N K;  3VTI A;  1JLB A;  4RG8 A;  4M63 C;  2P9K B;  3QEV A;  3CQY A;  2O8D A;  2KW4 A;  3VQA A;  4Y0W A;  4WQ5 A;  5BN9 A;  3O5B A;  1NGJ A;  2HHT A;  3QEI A;  1U48 A;  1LAW A;  5BPL A;  1VK0 A;  3B6O A;  4KHW A;  3VGL A;  3GBT A;  2OA8 A;  4X64 K;  2NRT A;  4GW6 A;  3DXK A;  4X66 K;  4E1J A;  1IH7 A;  1RIL A;  3CPE A;  4JD2 B;  4DSL A;  4WQ5 C;  4BR0 A;  2YV0 X;  3TU5 A;  4GVM A;  4H5N A;  3VOV A;  3HOT A;  1TYQ A;  4CIE A;  2W42 A;  3U8X A;  4CK3 A;  4B9L A;  1HNV A;  3HM8 A;  5FPD A;  3M8P A;  3PSI A;  3I8B A;  3CET A;  3RSE A;  5AQS A;  5AQP A;  4JKA A;  1RT2 A;  1RBR A;  2D5R A;  1BOT O;  1T44 A;  2E5L K;  3S9H A;  1QQM A;  1YIT N;  3AA4 A;  5JLF A;  3CXC M;  1BIS A;  3I0S A;  1WAJ A;  4OPH A;  1N8R O;  2AP1 A;  3H1Q A;  4GY2 B;  2YJE A;  3PIO L;  3ENO A;  2HNZ A;  4DV0 K;  3H1V X;  5C15 A;  2NLX A;  3V9S A;  3LDN A;  3VQD A;  4B9M A;  5AQF A;  4CEZ A;  3LWM A;  4O0J A;  3VEV A;  4CCH A;  1U47 A;  3O1B A; 
#chains in the Genus database with same CATH homology
 4FW2 A;  4Z4C A;  3ZCM A;  3CFR A;  1ZBI A;  4C8N A;  3CYM A;  1CXU A;  1VSL A;  2QXF A;  1O1W A;  2RN2 A;  3H08 A;  3DLK A;  3AA2 A;  3VQ8 A;  4CHN A;  4DQR A;  3EZ5 A;  1D9D A;  1FXX A;  2XY5 A;  4FJN A;  3HK2 A;  4AHC A;  3JYT A;  1R0A A;  4HHT A;  3HPO A;  2BAN A;  2O4I A;  1U04 A;  1VSH A;  4CES A;  2OZM A;  3SQ1 A;  3ZT1 A;  3OYL A;  4I2Q A;  1SKW A;  1CZ9 A;  3SUP A;  2Z1I A;  4ELT A;  4PUO A;  3A2F A;  3CFP A;  1VSF A;  3NHG A;  2D0A A;  3OVN A;  4F2R A;  3AVK A;  5HBM A;  3RMC A;  2IAJ A;  3TWH A;  1NK5 A;  4Y1C A;  2KFN A;  3IRX A;  4JRQ A;  1JLA A;  4AHV A;  4KAZ A;  3RMA A;  4DU4 A;  4OKE A;  3LP0 A;  4B9U A;  3ZSR A;  4CJU A;  4FLV A;  1RBS A;  1FK9 A;  1RT3 A;  3PO5 A;  5JS1 A;  1XHZ A;  3LZI A;  4B8A B;  3QES A;  4N76 A;  1C1C A;  2QKB A;  4CIF A;  4CJS A;  3EY1 A;  4CEO A;  1LW0 A;  1ZBL A;  1J54 A;  4DQI A;  1NJX A;  4FJG A;  4W5O A;  3KTQ A;  4CEF A;  1HJR A;  4CGH A;  2G8W A;  2HVH A;  3KLH A;  4IFY A;  4M3U A;  3RTV A;  4QAG A;  3VQ7 A;  1J5O A;  1SL2 A;  3NH1 A;  5HRN A;  3HVT A;  2P51 A;  1Z25 A;  4M45 A;  1D5A A;  1JL1 A;  5FRO A;  3QER A;  4DS5 A;  3TAF A;  3NGI A;  1JLE A;  4CEC A;  4CEQ A;  3KK2 A;  3PY8 A;  1HRH A;  1YVU A;  3MEC A;  4HUE A;  1RT7 A;  5KGX A;  2XHB A;  3HYF A;  1HYS A;  3V1Q A;  3AVC A;  2E4L A;  2YHB A;  3OS1 A;  4KPY A;  1S1V A;  4B9V A;  3CM6 A;  4IBN A;  1A5X A;  4CHY A;  1B9F A;  3QEX A;  3RMB A;  3TAQ A;  1L3T A;  2HNY A;  2G8F A;  1WSE A;  4CJ4 A;  4L8R B;  2B6A A;  1D8Y A;  1ITG A;  4F3T A;  4CJP A;  4CFD A;  2BE2 A;  4LSN A;  4LH5 A;  2XY7 A;  2ZE2 A;  3WNH A;  3OYJ A;  2X74 A;  3MXJ A;  1CLQ A;  2VG6 A;  1S9E A;  2YNH A;  3VA3 A;  3SPY A;  2ATQ A;  3DLB A;  1LWE A;  4Z0U A;  2DFE A;  1JXE A;  3MEE A;  1W0H A;  4E7L A;  4HCC A;  1IKV A;  2LSN A;  1TKD A;  4AH9 A;  1ASU A;  1UAX A;  4DU1 A;  1T05 A;  2A1R A;  4DSE A;  5D3G A;  4CK2 A;  3DLR A;  4MQ3 A;  1MU2 A;  4KTZ A;  3THV A;  1YTA A;  5CYQ A;  3QO9 A;  1DTT A;  4FK2 A;  3OJU A;  3V9X A;  4E19 A;  4B8C A;  4DTX A;  1ZBU A;  4O55 A;  1NK4 A;  2YHA A;  1SV5 A;  5CZ2 A;  4ELV A;  2HHQ A;  4KI4 A;  3L2U A;  3ZSW A;  3TAE A;  1RT1 A;  1QSS A;  3QEP A;  4C8L A;  3AVF A;  1BQN A;  1WLJ A;  4JS5 A;  4BE0 A;  4PY5 A;  3ISN C;  3AVM A;  4E1N A;  1GOB A;  3JSM A;  5FDL A;  3C94 A;  1WSJ A;  4KI6 A;  5J2P A;  3VQE A;  2F8T A;  3DYA A;  2P1J A;  3L3V A;  1TAQ A;  3PV8 A;  3SNN A;  3IG1 A;  5C24 A;  3O3H A;  3VQP A;  3TI0 A;  2G8K A;  1D9F A;  1I39 A;  4IG0 A;  1NOY A;  1BCM A;  3O3G A;  3AO4 A;  3M8Q A;  4K8Z A;  3ZSZ A;  1RTH A;  1SL0 A;  4RW7 A;  4KHS A;  1J53 A;  3IS9 A;  3AVH A;  3C6T A;  5J2M A;  3C95 A;  4AHT A;  3HVR A;  2IC3 A;  2RPI A;  4B9S A;  1IKY A;  1NJY A;  1RT5 A;  2WOM A;  4F8R A;  4FJX A;  1XWL A;  3ZSO A;  3S3O A;  1X9W A;  3KLF A;  3OYI A;  3O4Q A;  3MXM A;  4BDY A;  5E41 A;  4M42 A;  2IS3 A;  4WE1 A;  1NJZ A;  1KFD A;  4CGG A;  4BDZ A;  3NF8 A;  4H8K A;  4CJK A;  4FM0 A;  2G8U A;  4C8K A;  4IG3 A;  3D0P A;  3HXM A;  4KTW A;  4YFU A;  3AA3 A;  4NCG A;  3WNF A;  4E7K A;  2XY6 A;  3I8D A;  3HM9 A;  3AVI A;  4DWI A;  2HHU A;  1KRP A;  4J2A A;  1DLO A;  4CED A;  3NF9 A;  5I42 A;  1NKE A;  4CE9 A;  1HNI A;  1WNS A;  3CFO A;  3K5L A;  1BIZ A;  3QIN A;  2PYL A;  1XC9 A;  1S6P A;  2D0B A;  4FJ8 A;  4Q0B A;  3QNO A;  5KGW A;  1S9G A;  4DF4 A;  4BAC A;  3KJV A;  3KKS A;  4DTU A;  3PX6 A;  2IGI A;  4BDP A;  3VQ5 A;  4DQQ A;  2F8S A;  3P83 D;  1W9H A;  3IAY A;  1KVA A;  2DTU A;  4FJI A;  3O4N A;  2P5G A;  1LWF A;  4FVM A;  4OKK A;  4E7H A;  4M3Y A;  4FYD A;  4CFA A;  3SZ2 A;  4FJL A;  4CGI A;  3RRH A;  2KFZ A;  4CJE A;  3D45 A;  4F2S A;  1TVR A;  3AVA A;  2OZS A;  3V1R A;  2G8I A;  2BGG A;  2B5J A;  4KTQ A;  4Z4E A;  1XHX A;  1G15 A;  4CEB A;  3ZSY A;  2X6S A;  1WSH A;  4O0I A;  3SJJ A;  4FLZ A;  4DFP A;  3SI6 A;  1N5Y A;  4B9N A;  1UOC A;  2HHV A;  1GOC A;  2HND A;  3V9U A;  2DY4 A;  4FJM A;  1UWB A;  2FBX A;  3VQ9 A;  3PX4 A;  3TAP A;  1WN7 A;  3SQ4 A;  4CHZ A;  3HST B;  2O4G A;  3NGZ A;  3TAM A;  5I3U A;  3DRP A;  2GUI A;  4CEA A;  4M3T A;  1VSM A;  1BIU A;  3NF7 A;  1JL2 A;  4EP4 A;  1T8E A;  1RDA A;  1X9S A;  4CGJ A;  4E7I A;  3SCX A;  4YNQ A;  2ETJ A;  1FKO A;  3HP6 A;  5CZ1 A;  1S6Q A;  2EHG A;  3G0Z A;  3CQ8 A;  4FZZ A;  2A1S A;  1BHL A;  4FLU A;  1JXB A;  2PYJ A;  1L5U A;  1TL3 A;  3KD5 E;  1SKR A;  3OYA A;  2IDO A;  4LY7 A;  1TL1 A;  3VQ6 A;  5KRT A;  2ZQB A;  4O5B A;  3NDK A;  1J9A A;  3K59 A;  3SV3 A;  3HJF A;  1EXQ A;  2Z1J A;  3NAE A;  3DM2 A;  2PZS A;  2EX3 A;  1NKC A;  1VSI A;  1RDB A;  4AHS A;  1TKT A;  2HW3 A;  2B4J A;  3L2Q A;  4DSI A;  1IKW A;  3OYH A;  4FW1 A;  3M8S A;  1U4B A;  4FJ9 A;  4IFV A;  2HHS A;  4FLW A;  3SQ0 A;  1LAV A;  3F9K A;  3DI6 A;  4RW4 A;  4KFB A;  4DLG A;  2KZM A;  3K5M A;  1QS4 A;  3SV4 A;  1ASV A;  4B08 A;  3AO1 A;  4AHR A;  2VG5 A;  5FRN A;  4J2D A;  3LPT A;  5EU7 A;  4I2P A;  1HMV A;  3L2V A;  3LZJ A;  1SKS A;  4EZ6 A;  1EX4 A;  2E6M A;  1IG9 A;  3QEW A;  1S1W A;  1JLQ A;  4W5R A;  3AO3 A;  3KLE A;  3KK1 A;  1Q9Y A;  4KKO A;  3ZT2 A;  3OYF A;  4DSJ A;  2XY8 A;  4BE1 A;  4XIU A;  3OJS A;  3LAK A;  3OYC A;  1RTD A;  4NYN A;  1VRU A;  4KRE A;  4F3O A;  3T19 A;  4CHP A;  3AVL A;  2KZZ A;  3OYK A;  4W5N A;  3SPZ A;  4QOZ B;  3BDP A;  3L2R A;  4JRP A;  1NK6 A;  1ASW A;  4M3R A;  4E89 A;  4DU3 A;  4PWD A;  3DLG A;  3P5J A;  1RCH A;  1C6V A;  4FLX A;  3U3Y A;  1KLN A;  3PO4 A;  3HPH A;  3OYG A;  4K8X A;  1L3U A;  1N6Q A;  4UQG A;  5J2N A;  2GBZ A;  3RMD A;  3HL8 A;  4DQS A;  3K5N A;  3NH0 A;  5CY4 A;  2QK9 A;  2Z1H A;  2DFF A;  4DSF A;  3RWU A;  3LP1 A;  1TGO A;  1HPZ A;  3QLH A;  4OKJ A;  4DTS A;  2HVI A;  1B9D A;  4NCB A;  4N5S A;  4OGE A;  4E7J A;  4DTR A;  1VSD A;  4DG1 A;  1QHT A;  2YNI A;  1WSI A;  3VQC A;  4OLB A;  3CG7 A;  3L8B A;  1F21 A;  3FFI A;  3NH2 A;  3LAN A;  3OYE A;  4DTM A;  1RBV A;  4DQP A;  1T03 A;  1S1U A;  1ZBH A;  4OGC A;  4Z4G A;  1KLM A;  4FJ7 A;  1REV A;  2FC0 A;  4FK0 A;  3AO2 A;  2QKK A;  1RT4 A;  5HRR A;  3ZT4 A;  4E0D A;  1I3A A;  1LW2 A;  1TK8 A;  3SYZ A;  5SWM A;  1HYZ A;  4JLH A;  1Y97 A;  2F96 A;  2RF2 A;  2IOC A;  2VG7 A;  4BWJ A;  4OVL A;  4G1Q A;  3V81 A;  1BL3 A;  1HYV A;  3AVG A;  3WNE A;  4CHO A;  4M3W A;  2OPS A;  1YTU A;  4O4G A;  4FCY A;  4ELU A;  1TKX A;  3LP3 A;  4DF8 A;  3KKR A;  1XI1 A;  1U49 A;  1QE1 A;  4LSL A;  4AHU A;  3ZSV A;  4KHY A;  4FXD A;  4B3O A;  4KHQ A;  2Q3S A;  1RBT A;  2KQ2 A;  4KO0 A;  1TV6 A;  3VA0 A;  1X9M A;  3AVJ A;  5FRM A;  2ZD1 A;  5KI6 A;  3NFA A;  4CF2 A;  4FLY A;  1L3V A;  4BE2 A;  3E01 A;  4DSK A;  4J2E A;  3U6F A;  3DOL A;  4Q5V A;  3V9W A;  1U45 A;  3VQQ A;  3SUN A;  1C0T A;  1C0M A;  4FJ5 A;  4KB0 A;  1NKB A;  1C1B A;  1KVB A;  1IO2 A;  4Z4H A;  2KTQ A;  5HRO A;  1QQC A;  4CER A;  4CJV A;  3RRG A;  4LD0 A;  4CFC A;  4NCA A;  3L2W A;  3B6P A;  4HCB A;  4CJ3 A;  3T3F A;  2P5O A;  1JLG A;  3P1G A;  1BQM A;  3OY9 A;  3V9Z A;  3V6D A;  4M3Z A;  1HQE A;  3O3F A;  2HB5 A;  4CF8 A;  3TR8 A;  3CM5 A;  5DMR A;  4RW9 A;  4DTJ A;  2XRI A;  3AVN A;  4ID5 A;  4CF1 A;  5T7B A;  1BGX T;  1C1A A;  4HUF A;  3AO5 A;  2X6N A;  4M3X A;  1QSL A;  1KFS A;  3VQB A;  3ZT3 A;  2Z1G A;  4C8O A;  4DLE A;  4C8M A;  2FBT A;  4KRF A;  1BCO A;  4DTP A;  4HVJ A;  3F73 A;  3WNG A;  2OYQ A;  1DTQ A;  2R7Y A;  4ZTF A;  2OPR A;  4KHU A;  1SL1 A;  1RDC A;  3SUQ A;  4GMJ B;  1EP4 A;  4FZY A;  1WSF A;  1JLC A;  2FBY A;  3LWL A;  3NGY A;  4CGF A;  2WON A;  1QTM A;  1K6Y A;  1Z26 A;  1T7P A;  3NCI A;  5HLF A;  1UA0 A;  3DRS A;  4PA1 A;  3T1A A;  4Y1D A;  1B92 A;  1GOA A;  1VRT A;  2VWK A;  4FM2 A;  4B9T A;  4HTU A;  1RTJ A;  4CJL A;  4ZHR A;  3TAB A;  5C25 A;  2VWJ A;  4CJQ A;  2JLE A;  1S1X A;  3C6U A;  2XO7 A;  4IDK A;  4EZ9 A;  4CJW A;  3MEG A;  3KLI A;  4CJR A;  3PX0 A;  3DOK A;  3K2P A;  3VQ4 A;  4H4O A;  5HRS A;  4CHQ A;  1NK8 A;  3KIO A;  3QIO A;  1JLF A;  3NF6 A;  4J2B A;  5K14 A;  3S3M A;  3SUO A;  5HP1 A;  2G8H A;  3K5O A;  4N47 A;  1S5J A;  3LDS A;  3AA5 X;  4OJR A;  1Q9X A;  4EP5 A;  3OS0 A;  3M8R A;  4ICL A;  1Q8I A;  1RTI A;  4PQU A;  1JLB A;  4RG8 A;  5KRS A;  4OPJ A;  4ZTJ A;  4RW6 A;  5C42 A;  1X1P A;  1KCF A;  3NE6 A;  3QEV A;  4LH4 A;  3OS2 A;  4N56 A;  2KW4 A;  1QSY A;  4W5Q A;  4DTO A;  5HRP A;  3HPG A;  4ID1 A;  3VQA A;  1A5V A;  1EET A;  3K58 A;  1RBU A;  4E3S A;  1ZBF A;  3U3G A;  2AJQ A;  1LWC A;  3SQ2 A;  3MXI A;  4FJH A;  4I9L A;  1JKH A;  2NUB A;  3OYM A;  1KTQ A;  4KB1 A;  2HHT A;  3QEI A;  2OPP A;  4E1M A;  3S3N A;  1LAW A;  4H4M A;  5KTQ A;  1HQU A;  4CIG A;  2YNG A;  4R5P A;  3MAQ A;  1U48 A;  1VK0 A;  2DFH A;  3B6O A;  3LAL A;  3OYD A;  4KHW A;  3HO1 A;  2HHW A;  1IKX A;  3BGR A;  3DLE A;  3ULD A;  1NOZ A;  2OA8 A;  4GW6 A;  1LV5 A;  1CXQ A;  1VSJ A;  3AV9 A;  3HP9 A;  2Y1J A;  1IH7 A;  2X78 A;  1RIL A;  4AIL C;  4DSL A;  3L3U A;  2YKM A;  1CZB A;  4JS4 A;  4HUG A;  4TSX A;  4FM1 A;  2YV0 X;  2D0C A;  4N41 A;  3ITH A;  5DK5 A;  4O44 A;  3DRR A;  3LPU A;  4GVM A;  1NJW A;  2PY5 A;  1KSP A;  2HMI A;  4CEE A;  1TK0 A;  3DMJ A;  3I0R A;  1RT6 A;  4CIE A;  2YKN A;  4NYF A;  2W42 A;  4FK4 A;  4CK3 A;  4B9L A;  3ASM A;  1HNV A;  1TAU A;  4CK1 A;  1S1T A;  1KVC A;  3QNN A;  3KLG A;  3M8P A;  1VSK A;  4DMN A;  3TAN A;  3ZSQ A;  2E6L A;  1NK0 A;  1RT2 A;  4Z4F A;  1RBR A;  2D5R A;  1WAF A;  2G8V A;  2YNF A;  1TK5 A;  1NK9 A;  1RNH A;  1EKE A;  3EYZ A;  2I5J A;  3RR8 A;  3S9H A;  1FKP A;  4DS4 A;  3QET A;  3RR7 A;  1WSG A;  2ITG A;  2RKI A;  3ZSX A;  3PUF A;  4FZX C;  3AA4 A;  2BDP A;  4M41 A;  4FLT A;  3OYN A;  4QCL A;  1BIS A;  1YT3 A;  4MFB A;  4OLA A;  3I0S A;  4BWM A;  4DFM A;  4KHN A;  4FJJ A;  3VN5 A;  1WAJ A;  3LP2 A;  3QIP A;  4CJ5 A;  2GV9 A;  4DTN A;  1C0U A;  3KK3 A;  1NK7 A;  4I9Q A;  3HT3 A;  5CYM A;  3LAM A;  3MED A;  3ALY A;  4DFK A;  4CJT A;  3V4I A;  1ZYQ A;  1VSE A;  4RW8 A;  3ZT0 A;  4CF0 A;  5JS2 A;  4CGD A;  5SZT A;  4CF9 A;  3NBP A;  1A5W A;  2HNZ A;  4CFB A;  3UIQ A;  3OYB A;  4Z4I A;  2FBV A;  4F4K A;  4IKF A;  3V9S A;  2HHX A;  2Y1I A;  5J1E A;  3VQD A;  1RDD A;  3V1O A;  3DLH A;  1BI4 B;  4B9M A;  4CEZ A;  4OPK A;  1SUQ A;  2JGU A;  4I7F A;  3LWM A;  4O0J A;  4W5T A;  4FJK A;  3AVB A;  4CJF A;  1TKZ A;  3KD1 E;  2OPQ A;  3K57 A;  3G10 A;  3TAG A;  4CCH A;  4DFJ A;  1BI4 A;  1UA1 A;  4KV8 A;  1U47 A;  5J2Q A;  3TAR A;  1L3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...