1LAWA

Stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYIRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Stabilization of Escherichia coli ribonuclease HI by cavity-filling mutations within a hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lawA00
4I2PA 1UA0A 2ETJA 4E7IA 2VG7A 2YHBA 4M41A 3TABA 4FLUA 3VQ6A 2AJQA 4CF2A 2Z1JA 3K5NA 5FROA 2I5JA 1KTQA 3OJUA 5HRSA 2E6LA 2LSNA 3M8RA 3WNEA 4PUOA 2YNGA 1YTAA 4OJRA 4HUEA 3L3VA 1Q8IA 4JLHA 1NK7A 2RF2A 4CF9A 1WLJA 3HVRA 3OYIA 5CY4A 4CGJA 3K57A 3NF6A 3VA0A 5HRRA 5HP1A 3KD1E 1RCHA 3AA4A 1X9SA 1L5UA 3NE6A 4ELUA 3C94A 4B9LA 3HSTB 4B9TA 1BI4A 4YFUA 3OYEA 1DTQA 3NH2A 3O4NA 3ZT4A 3JYTA 4FCYA 1SKSA 3KJVA 3RMBA 1U48A 3HJFA 3I0RA 3OYGA 2IC3A 2ZE2A 3WNFA 1S1UA 4RW4A 1TKXA 2EX3A 2FBXA 4FW2A 2VG5A 2OYQA 3T19A 4J2EA 2B5JA 3M8QA 1RT3A 1Z25A 4CIEA 1JLAA 1HJRA 3KLFA 1U45A 1JLCA 2FBVA 2XRIA 1RDDA 3OVNA 1TAQA 2VWKA 3VQ9A 4M3WA 3G10A 3MEEA 4DQRA 1ASVA 3WNHA 4LH5A 4CK2A 3E01A 1TVRA 1D5AA 1IKYA 1WAJA 4CHYA 1KLMA 5K14A 4XIUA 1T7PA 3LWMA 3KKRA 3U6FA 1U49A 3ZT0A 3D0PA 3O3GA 1XHZA 4FM1A 1BI4B 3L8BA 4FJKA 1KFSA 1HRHA 1U47A 1QS4A 4Z4IA 4QCLA 3VQBA 2YHAA 4DU1A 3SQ1A 4LSLA 4HUFA 1VSEA 4FJLA 2QKBA 1NK4A 1BIUA 4WE1A 3VQDA 1R0AA 3LPUA 4CJEA 2HHVA 1NOZA 2HNDA 3DLRA 3OYKA 3TAPA 4B9NA 4OKKA 4N76A 1UWBA 3OYAA 1KVAA 3RMCA 5HBMA 1N5YA 1L3TA 2Q3SA 1IO2A 4CGDA 4OPKA 4CF8A 4KKOA 3VQ4A 4HVJA 3SQ2A 4EZ6A 1KLNA 3THVA 1T8EA 2P5GA 1WN7A 1LWEA 2ATQA 3DOKA 4FJ7A 4E7KA 1RDBA 2G8WA 2YV0X 3LP3A 3V9SA 1B9FA 1S5JA 4CF0A 4FK4A 2A1RA 3HP9A 4CJ3A 2BE2A 2FBYA 4DLEA 4I9LA 5CZ1A 3O4QA 1S1VA 4KO0A 3OYJA 3C95A 1ZYQA 4E0DA 3AVIA 3I8DA 3L2RA 4Z4FA 4DTMA 4CF1A 3C6TA 1KRPA 1IG9A 4M3YA 5C42A 4F8RA 1KSPA 3ZT3A 4CFAA 1HQEA 3AVNA 4E3SA 4MFBA 1W0HA 4W5RA 2YNFA 3AO5A 4N56A 2OPRA 3K5OA 2O4IA 3VQAA 3DLGA 1TAUA 4O5BA 3ZSQA 1UAXA 1EX4A 1O1WA 1JL1A 1GOCA 1QQCA 3DYAA 4B8CA 1TV6A 2X78A 3SUPA 3CFRA 1DTTA 4CJLA 4PWDA 3RRHA 1VSKA 3V1QA 3QESA 2BGGA 2NUBA 3NH0A 3OYFA 1CXQA 3D45A 1JL2A 4CEQA 4FJJA 1YT3A 5J2MA 4GW6A 4CEOA 1RTIA 3C6UA 2HHWA 2YNHA 4DTSA 2Y1JA 2Z1IA 3HYFA 4KTZA 1D9DA 1SKRA 3OYDA 5J2PA 4AHRA 4CEDA 3MAQA 1LWFA 4HCCA 3TAFA 3B6OA 3MEGA 3HO1A 4DSKA 3HPOA 2DFFA 3KLHA 2DFHA 3TAQA 2F96A 1ZBIA 3KD5E 3DLKA 3VN5A 1Z26A 4G1QA 3SCXA 3RTVA 3ZCMA 5I42A 2E4LA 3ZSZA 3IAYA 2HHUA 1EP4A 3V1OA 4DU3A 4CGIA 2P51A 3P1GA 1JXBA 4I2QA 3CM6A 3PX0A 4Y1CA 4KHWA 4CJKA 5C24A 1REVA 1RT2A 3SQ4A 3ZSXA 3FFIA 3LAMA 3VA3A 4DFPA 3CG7A 2VWJA 1T05A 4FJGA 3AA5X 1SL2A 4I7FA 1HPZA 4B8AB 4KB0A 2HNZA 4KTQA 4HUGA 1EXQA 4M45A 4AH9A 3KK1A 4OKJA 3DRPA 3SUQA 3QERA 1HYSA 2KTQA 3OYNA 4Q0BA 3HM9A 3SUOA 2B4JA 3K5LA 4KHQA 4E1NA 4CK1A 3U3YA 3EY1A 2X74A 3DLEA 4CFBA 3TAMA 4C8NA 3SZ2A 1NKBA 4CJUA 3SQ0A 3F9KA 5HRNA 1VRUA 4FLTA 1RDCA 3HPHA 4F4KA 4ZHRA 2DFEA 4KV8A 4OVLA 4F3OA 3VQ8A 4FLXA 1TKZA 3V6DA 3L2UA 2IDOA 2D0BA 4C8OA 1ZBFA 4W5QA 1J9AA 3ZSWA 4CGGA 3OYBA 4FLYA 3BDPA 4C8KA 1IH7A 4DSFA 4FZXC 1I39A 1QE1A 1C1BA 2IOCA 5KRSA 2ZQBA 3LDSA 4M3XA 4KI6A 3RR7A 1L3UA 3NF7A 3PX6A 1RILA 3AVCA 1BQNA 4LSNA 2ZD1A 4E7LA 4DTXA 1VSLA 3KK3A 3RRGA 3I0SA 3SPZA 2DY4A 4DMNA 4CHOA 1BIZA 1X1PA 2OZSA 3S3NA 4CECA 5C25A 3VQEA 2XY5A 1S9GA 1KFDA 1D8YA 4KHSA 4F3TA 1UA1A 1TKTA 1VK0A 3VQQA 3NDKA 1C0TA 4DU4A 3OYHA 1JKHA 3K58A 2BDPA 5SZTA 1WSJA 2F8SA 4QOZB 1ASUA 3VQ5A 4CJ4A 4E7HA 4B08A 2WONA 4MQ3A 1LV5A 1NOYA 2D0AA 1JLGA 3TAGA 3MXIA 4NCGA 3ZSVA 2BANA 2X6NA 3QO9A 1C0MA 1IKVA 1TL3A 4ZTFA 1TKDA 1W9HA 5J1EA 3NBPA 1RTHA 4O44A 3T1AA 3KLGA 4BE2A 2KFZA 5KI6A 4N5SA 3F73A 3U3GA 4DFJA 3ISNC 1WAFA 2G8HA 1RDAA 1S1TA 3KTQA 1IKWA 3KLEA 2G8UA 5CYMA 3ULDA 3NGZA 3NAEA 1RT1A 3PX4A 4PY5A 4CIGA 3OYLA 3QNNA 1QSYA 1HQUA 4AHVA 3M8SA 3MECA 5T7BA 4E1MA 4FZYA 3P83D 1QSSA 2O4GA 3AVKA 1G15A 3CQ8A 4N41A 1S1WA 3IS9A 3QINA 1WSFA 3LANA 3L2QA 3AO3A 3VQCA 1J5OA 4DFKA 1NJWA 2JLEA 5CYQA 4O0IA 4DTOA 3TI0A 2HHTA 4DS4A 3HL8A 1WSEA 2HB5A 2QXFA 4BWMA 3TARA 2KZZA 1YVUA 2D0CA 3B6PA 3LAKA 4JRPA 5KGWA 2HHXA 4EZ9A 5J2NA 1EETA 3EZ5A 4GMJB 3S3OA 1NK8A 4J2DA 5HRPA 4FJ9A 2XO7A 1WSHA 3RWUA 1NK5A 1RTJA 1CZBA 3KKSA 2Z1GA 4RW8A 4CK3A 3JSMA 4NCAA 2PY5A 3AA3A 4KFBA 1EKEA 2Z1HA 4IBNA 4M42A 1LW0A 1RNHA 4PA1A 4FM2A 3OS0A 2W42A 4B3OA 4RW6A 4IDKA 3NGIA 3QLHA 1VSJA 2ITGA 3NFAA 2XHBA 3CFOA 1U4BA 3O3FA 1X9MA 4CGFA 3T3FA 2HVHA 1KCFA 3PV8A 4FJ5A 4Z4GA 4NYNA 4DTUA 1RT7A 3DRSA 3L3UA 4AHCA 2F8TA 4HCBA 2IAJA 2HVIA 2PZSA 1B9DA 2VG6A 2KFNA 4CHZA 3QEWA 3UIQA 1FK9A 4KPYA 4KHYA 3SPYA 3TANA 3AO1A 1KVCA 3IRXA 1J53A 1HYVA 2P1JA 4GVMA 3QIPA 4H4OA 1XHXA 3LP0A 3IG1A 4DG1A 4IKFA 2JGUA 3CYMA 3QEIA 2DTUA 4CJFA 3KK2A 1HNVA 3KLIA 3KIOA 4CEFA 3LZIA 4BDZA 3G0ZA 2YKNA 4FYDA 3LZJA 4FLWA 2G8FA 1LWCA 2GBZA 2KZMA 1JLFA 4F2RA 4K8ZA 3HVTA 1SKWA 1CZ9A 3NHGA 4DS5A 5E41A 2GV9A 4R5PA 1N6QA 3EYZA 2WOMA 4DTJA 1BGXT 4FXDA 1BQMA 4E89A 3NF9A 4ICLA 3MEDA 4DFMA 3L2VA 3OYCA 1TK8A 2QK9A 4IG0A 1FXXA 5D3GA 4KRFA 3V81A 3AVAA 3QETA 3V9UA 1ZBHA 4IFVA 1S1XA 5I3UA 1TK5A 3V4IA 4HHTA 2X6SA 3ZSYA 4M3RA 1Q9YA 4FJ8A 1HYZA 4CJPA 2IS3A 4B9MA 3LP2A 4DLGA 1XC9A 4FVMA 1NK0A 2QKKA 4OGEA 4KHUA 3ITHA 3LP1A 4CHPA 3ZSOA 4W5OA 4CCHA 1A5XA 2KQ2A 2A1SA 4OLBA 4C8MA 3VQ7A 4KAZA 4H8KA 1QSLA 3AVFA 4Q5VA 4YNQA 1NKCA 3AO2A 4CERA 2FC0A 4O0JA 4C8LA 1HMVA 4OGCA 4BDYA 3ASMA 1S6PA 3AV9A 4O55A 4CFDA 4Z4CA 3O3HA 4W5TA 4E19A 1A5WA 4ELTA 4FLZA 1RBSA 1ZBUA 3WNGA 1WSIA 1TL1A 4CE9A 4RW9A 1CXUA 4F2SA 1GOBA 1WNSA 2Y1IA 4K8XA 3SUNA 1C0UA 4CGHA 2HW3A 1Y97A 4J2AA 1SL0A 2OPSA 4UQGA 4JS4A 1QHTA 4JRQA 3V1RA 5HROA 4KREA 2XY8A 3RMDA 1J54A 3RMAA 2RPIA 4NCBA 3AVHA 3MXJA 4LH4A 2E6MA 1FKPA 1QTMA 2G8IA 1KVBA 1I3AA 4DTPA 4IG3A 1VSFA 3MXMA 4EP5A 3HXMA 3K5MA 1SL1A 1LAWA 1JLEA 1RBTA 2EHGA 3SV3A 4CIFA 5FDLA 3S3MA 1TK0A 1FKOA 3DMJA 4KTWA 2YKMA 4AILC 2OA8A 1VRTA 5KGXA 4DF8A 3SV4A 3PY8A 4DSLA 3A2FA 1RBRA 3AO4A 1RT6A 2G8KA 4FM0A 3OS2A 4TSXA 4JS5A 4DQIA 1BL3A 3DLBA 3LWLA 2B6AA 3LPTA 3DLHA 4DQPA 4AHUA 4OLAA 3AVBA 4BWJA 2XY7A 3HT3A 4KHNA 4FK2A 1NJZA 1CLQA 3AVLA 1RT4A 4CJ5A 3DM2A 4DTRA 4IFYA 1C1CA 1XWLA 1BHLA 4FJIA 4Z4EA 3AA2A 3OS1A 1ZBLA 2RN2A 3L2WA 4CEEA 3PO5A 3HP6A 3P5JA 3DI6A 3CM5A 3QIOA 2HNYA 4DQQA 4KB1A 3NF8A 1YTUA 2XY6A 1ITGA 4DSIA 2GUIA 4EP4A 3VQPA 5JS2A 5EU7A 3BGRA 4DF4A 3PUFA 4Z4HA 3NH1A 4FJMA 3NGYA 4J2BA 4O4GA 1RBVA 3K2PA 3CFPA 5SWMA 1VSDA 3QEXA 4DQSA 2PYLA 4OKEA 4I9QA 4CHNA 1XI1A 4H4MA 1JLQA 4FJHA 1L3SA 4FLVA 1JXEA 3SJJA 3AVMA 4FW1A 1IKXA 1U04A 3ALYA 1NK9A 4CJVA 1VSMA 3S9HA 5DMRA 4Z0UA 3OY9A 4B9SA 4DWIA 5FRNA 4DTNA 3LALA 4DSEA 5J2QA 2HHSA 1DLOA 1X9WA 1NKEA 3QEVA 2PYJA 1A5VA 1NJXA 3M8PA 1S6QA 4CHQA 1Q9XA 1K6YA 4AHTA 2HHQA 4BE1A 5HLFA 1SUQA 4FJXA 3HPGA 1L3VA 1ASWA 3AVJA 2OZMA 1D9FA 4ELVA 1BCOA 3ZT1A 3DRRA 1S9EA 4Y1DA 4LD0A 4HTUA 4RW7A 2P5OA 4AHSA 3V9XA 4FJNA 2FBTA 4CJWA 3V9ZA 3RR8A 3SNNA 2RKIA 4CESA 4RG8A 3SI6A 4LY7A 1NK6A 3OJSA 1UOCA 4W5NA 4BDPA 3H08A 3ZT2A 4B9VA 1JLBA 4ID5A 5CZ2A 4CEAA 4M3UA 1TGOA 2D5RA 3ZSRA 1NJYA 4M3ZA 3DOLA 4KI4A 3NCIA 1RT5A 1LW2A 1BCMA 5KTQA 4DSJA 5FRMA 2OPQA 1VSIA 4E7JA 4CJRA 2HMIA 4M3TA 4ZTJA 1WSGA 3TR8A 4BACA 2OPPA 4B9UA 4L8RB 5DK5A 4FZZA 3AVGA 2R7YA 2G8VA 4CEBA 3V9WA 1RTDA 3TAEA 4CJSA 4CEZA 4CFCA 1C6VA 3K59A 4N47A 1RBUA 3QNOA 4OPJA 3HK2A 1B92A 2IGIA 2KW4A 3SYZA 1LAVA 3PO4A 4CJQA 4PQUA 4BE0A 1F21A 1T03A 1MU2A 4NYFA 4QAGA 3OYMA 4CJTA 3TWHA 1HNIA 4ID1A 1GOAA 4FK0A 5KRTA 1C1AA 5JS1A 3QEPA 1SV5A 2YNIA 1BISA 1VSHA
chains in the Genus database with same CATH superfamily
4I2PA 1Z6RA 2H3GX 2ETJA 3TABA 5GAHP 5AQHA 2AJQA 4CF2A 3MN6A 3K5NA 5BRDA 5JLHA 3CJCA 1NM1A 2LSNA 5HRSA 1YTAA 4HUEA 1Q8IA 4JLHA 5JVGL 5AZIA 4LFBK 4GV3A 3K57A 2QA4N 5HRRA 5HP1A 4JHDA 3M1FA 3H46O 3NE6A 4ELUA 1U6ZA 3C94A 3DXMA 1C0FA 1DTQA 4FCYA 4H0VB 3A5NC 3RMBA 3I0RA 2F4VK 3R3LA 5E26A 4RW4A 3WQUA 3EE8A 5AQJA 3U8XA 1HJOA 3M8QA 1BG3A 3THXA 1HJRA 3IMXA 1U45A 1TAQA 1ASVA 4BRNA 5HOOA 1TVRA 4JKAA 1IKYA 4Z94A 4IEEA 3O9SA 2QWMA 3H1VX 4FJKA 2QI2A 1N33K 2ZM6K 1QS4A 4Z4IA 1XUPO 5KPZA 4BY9C 4FJLA 4HUFA 1ATSA 3VQDA 5M1OA 1NOZA 2HHVA 3OYKA 3TAPA 4B9NA 4OKKA 4N76A 2F7TA 1N5YA 4CF8A 1KXPA 1NWKA 3VQ4A 4EZ6A 1KLNA 3FZLA 2P9IA 1YJNN 1LWEA 3DOKA 1Q86O 1ZBSA 4FJ7A 3CCMN 4C23A 3IFRA 3LP3A 3O8MA 1S5JA 4OX9K 2FBYA 4DLEA 2UXBK 4I9LA 5CZ1A 4X62K 3EKUA 4IO8A 4FWOA 3WXLA 3DXKB 3TSUA 4DTMA 4CF1A 4M3YA 1N32K 1IG9A 3UKUB 2O8EA 1NGHA 4W5RA 2OPRA 3K5OA 1TAUA 1NMNA 2P9IB 1VQ6N 1EX4A 1O1WA 1GOCA 1TV6A 4PWDA 4QS8A 2BTFA 2NUBA 3D45A 1JL2A 5EXWA 5J2MA 4GW6A 2YNHA 4KTZA 1D9DA 3C6HA 3P38A 4EIAA 1VQ7N 3MAQA 4HCCA 3TAFA 1WB9A 3LDNA 4BRIA 3TAQA 1MWKA 5C2DA 1ZBIA 3VN5A 5BPMA 3SCXA 3RTVA 3ZCMA 3IAYA 2HHUA 4OO1J 1JXBA 3CM6A 3PX0A 1NGAA 5A2QO 1REVA 3CJAA 1RT2A 3H3OB 1MA9B 4DUYK 3FFIA 3SQ4A 4NO7A 4DFPA 3CG7A 1T05A 4FJGA 1T3VA 4B8AB 4KTQA 3SBGA 2GUPA 4HUGA 1EXQA 5JLFA 3SUQA 1W2BM 5GAEP 5FLXO 1BA1A 5AQOA 4E1NA 3U3YA 3EY1A 3E1YA 1NKBA 4JKFA 3HPHA 4KV8A 3SK3A 4FLXA 4LF7K 4BR4A 2IDOA 3TTDA 3ZSWA 4B3SK 3O5BA 1IH7A 3J8AA 4FZXC 4A5AA 1C1BA 5LY3A 3LDSA 3CMEN 4KI6A 1EWRA 2YHYA 3LM9A 2HOEA 1VSLA 2HBJA 4H0PA 4Y0WA 3I0SA 2HMPA 4CHOA 1X1PA 3S3NA 5C25A 2XY5A 3TSQA 1S9GA 1TKTA 1VK0A 3NDKA 2ASPA 3QDKA 5SZTA 2A41A 4M63C 4B08A 1NOYA 3TAGA 1QZ5A 4NCGA 3ZSVA 1TL3A 1TKDA 4ZTFA 1NGIA 5J1EA 3D2FA 3NBPA 1RTHA 3KLGA 1RDAA 3J7AP 4H5NA 2FSNA 3KLEA 5CYMA 3PX4A 2G8UA 1RT1A 4PY5A 4CIGA 3OYLA 4JYAK 3SAFA 2QXLA 3CQ8A 3IS9A 3L2QA 3QBXA 3TI0A 1YF5L 3HL8A 3TARA 1OH5A 2HHXA 4EZ9A 3HTVA 1EETA 3EZ5A 5J2NA 3SJHA 5HRPA 4K0KK 4CZJA 2XO7A 3VEZA 3D2FB 3KKSA 2O8CA 5AQLA 3BF3A 4IBNA 3OS0A 3MCAB 4RW6A 4CZIA 1DKGD 3NGIA 2ITGA 2XHBA 1GLJO 5GADP 5F0XA 4XH1A 2HVHA 1GLDG 2QWNA 1K8KA 3CJ9A 2IAJA 1NG9A 5CE3A 5H1SQ 3UIQA 3TANA 3UE5A 3AO1A 1KVCA 3NVMA 1J53A 2P1JA 5GIPA 3IG1A 3QEIA 2DTUA 4IJAA 2O8CB 1HNVA 3KIOA 4CEFA 3LZIA 4FYDA 2CGLA 2GBZA 3HVTA 3NHGA 5M1PA 5ADXH 2GV9A 3THWA 4DTJA 1K8KB 1NGEA 4E89A 3MEDA 3L2VA 1FXXA 5FPEA 3ZETA 4DHYA 4HHTA 3J80O 3ZSYA 1Q9YA 4KHPK 1HYZA 4A2AA 3ZSOA 5AQPA 1A5XA 4OLBA 3W3DA 4C8MA 1QSLA 2AP1A 4CBXA 3AO2A 4O0JA 1HMVA 3THWB 4BDYA 3AV9A 1NGCA 2Q36A 4Z4CA 1WSIA 1TL1A 5AQGA 4YOTA 3WUHA 1CXUA 3VMFB 1GOBA 4K8XA 3R1XA 3TTCA 4IDHA 1C0UA 1E4FT 4CGHA 2HW3A 1J54A 3F5TA 3AVHA 4PKIA 4PHTX 4JKCA 3SMPA 5LMUK 1QTMA 2HHHK 3ID6A 4DB3A 4KBOA 4IG3A 3LDPA 3J81O 3HXMA 3PO5A 4M3TA 3UKRA 4DR6K 4DQ8A 2P9PB 3DMJA 4BRGA 4AILC 4PL8A 4FWKA 1RBRA 2P9NA 3CCEN 4DQIA 1BL3A 4OLAA 3AAPA 3AVBA 4BWJA 2XY7A 5KQ8A 3KK7A 3S41A 4CJ5A 1N34K 1C1CA 4B3RK 4FJIA 4Z4EA 3AA2A 3OS1A 2UXCK 3HP6A 1QZ6A 4FWPA 4DV2K 2GUIA 2RE2A 4FJMA 4HTLA 2YHWA 4J2BA 3K2PA 1VSDA 3QEXA 4DQSA 4BREA 4CHNA 1QHAA 1L3SA 4FLVA 3THYA 3BP8A 3AVMA 4FW1A 2VWBA 3S9HA 4DWIA 3R8EA 4DSEA 2PYJA 2J4RA 1A5VA 1YIJN 1SUQA 1L3VA 1ZC6A 1BCOA 4FWMA 3ZT1A 1SS6A 2P5OA 4FJNA 3ULEA 2KKZA 4FWNA 4H0XB 3O9RA 4LY7A 3OJSA 1FW6A 3QFPA 3THYB 4M3UA 3DOLA 5AZJB 4A59A 4KI4A 1RT5A 1LW2A 5KTQA 5FRMA 4DSJA 2Q1NA 3QBWA 5EY4A 4E7JA 1K8AO 3ATVA 3TR8A 4BACA 2ZGYA 4B9UA 2KHOA 3HOSA 3E66A 2G8VA 2HBLA 3V9WA 4BRPA 4CJSA 1C6VA 3K59A 2GX9A 2FSJA 3O6WA 4CZLA 4CBUA 5F2RA 1T03A 3QMLA 1CZAN 3OYMA 1HNIA 4ID1A 4JI3K 2Q31A 1GLLO 3DAWA 1C1AA 4PL7A 5JS1A 1X3NA 3VEYA 2VG7A 4M41A 4K25A 2I5JA 3MK6A 3CJ1A 3H1QA 4JKDA 1NJIO 3E9LA 3WNEA 4BVOA 3T1HK 3BY5A 1NK7A 1TUUA 2RF2A 1RFQA 4CF9A 3NF6A 4BG9A 3AA4A 1X9SA 1L5UA 3HSTB 1BI4A 4YFUA 3OYEA 3NH2A 3C7NA 1SKSA 3KJVA 1U48A 3C0BA 3I55N 3HJFA 3VTIA 2ZE2A 4JKGA 1S1UA 1TKXA 2EX3A 4DR1K 4J2EA 4MDBA 3T19A 1RT3A 1Z25A 2BUPA 4CIEA 1JLCA 2XRIA 2VWKA 4M3WA 1IBMK 1VQKN 4CZKA 3B8AX 4FL9A 2OCEA 2YCHA 1KLMA 1T7PA 3FZHA 3FZMA 5I9EB 3ZT0A 3O3GA 1XHZA 4FM1A 5F1XA 5LL6Z 1BI4B 2QWPA 3EZWA 1U47A 4QCLA 3VQBA 2YHAA 3Q7CA 3SQ1A 1VSEA 3CCRN 3SMSA 1NK4A 4JKGB 4WE1A 1X9JA 1YVNA 1S72N 2HNDA 3DLRA 4YDUA 3OYAA 1NGGA 1VQ9N 1KVAA 3RMCA 5HBMA 1L3TA 5BPLA 2Q3SA 4M7YA 5BREA 2NRWA 3SQ2A 4HVJA 3MWTA 1JCFA 4MLEA 1WN7A 5AQQA 2E2OA 2G8WA 1B9FA 4FK4A 3HP9A 4E0DA 4LFCK 3OYJA 3C95A 5AQKA 3AVIA 4AF1A 3DWLA 4Z4FA 1KRPA 3C6AA 1ESVA 4F8RA 3F2KA 1YAGA 1HQEA 4G9ZA 4KH6A 2VQFK 2YNFA 2O4IA 1UAXA 1QQCA 1DTTA 3V1QA 3TPQA 3A5LC 4FJJA 2Z1IA 5J2PA 3R9PA 1LWFA 3B6OA 3FFKB 3MEGA 4BRDA 4JI0K 3FZFA 2DFHA 3KD5E 3CJ7A 1HNXK 1JCEA 3ZSZA 2O8FB 3D2EA 4O5FA 4DU3A 4CGIA 3P1GA 4GY2B 4CD1A 5C24A 3LAMA 3VA3A 1BOTO 1G99A 1SL2A 3SAHA 3HM8A 4M45A 4BRHA 1HNWK 3CETA 4Q0BA 3HM9A 4DR3K 3SUOA 4BRAA 2X74A 4C8NA 2FSKA 2HBMA 3SQ0A 2IVPA 3F9KA 4ILHA 4C1NI 5KPTA 4C8OA 3MN9A 4CGGA 3OYBA 4M7XA 4JI5K 1QE1A 2D4WA 3RSEA 1XNQK 1NU0A 4GNIA 4E7LA 3KK3A 3RRGA 3O1BA 1BIZA 4BVPA 1BDGA 2OZSA 4CECA 5AZIB 2CH6A 3O9QA 4KHSA 4F3TA 1UA1A 3VQQA 4DU4A 1C0TA 4JHDB 2I7PA 3OYHA 3K58A 3P4IA 2BDPA 3DXMB 3VEXA 4QOZB 2F8SA 1ASUA 3VQ5A 4WQ4A 2WONA 2V51B 2YJFA 4CBWA 5GAGP 1W9HA 2OANA 1W7AA 4LF9K 2KFZA 3T1AA 1LCUA 1XNRK 5KI6A 3THXB 4YOXA 3ISNC 2G8HA 1MWMA 3CC4N 1IKWA 3NGZA 2NRRA 3QNNA 1QSYA 2QWRA 1HQUA 3M8SA 3MECA 5T7BA 4E1MA 5BR9A 3WQTA 3AVKA 4N41A 3LANA 1J5OA 4FVUA 2QWLA 1NJWA 2JLEA 2Q2RA 2A6AA 5CYQA 4DV6K 2QXFA 4IJNA 4JRPA 3B6PA 5KGWA 4JI2K 4YY3K 3VEVA 1I94K 3RWUA 2QWOA 2Z1GA 4CK3A 4NCAA 4IWVA 4KFBA 3ZX3A 4XEIA 2Z1HA 3CC2N 2YHXA 1RNHA 4E1JA 3U9ZA 4IDKA 3QLHA 3ZYYX 1VSJA 1X9MA 3O80A 4NYNA 2E88A 4KH4A 2F8TA 5BRFA 2PZSA 1Z05A 3QEWA 1YXQA 4KPYA 4KHYA 5AFUH 3SPYA 5M1FA 3WXIA 2NRXA 3IRXA 1HYVA 1XHXA 3LP0A 4EHUA 3KK2A 1JCGA 4BDZA 4DR5K 2O8EB 2YKNA 2G8FA 1LWCA 2KZMA 4F2RA 1SKWA 4EHTA 1CZ9A 1GLEG 4R5PA 4IOCL 3EYZA 5C12A 4FXDA 1BQMA 4K43A 4WCEL 4DFMA 4DKWA 1YUWA 1TK8A 5AQIA 5D3GA 2W6LA 1T6CA 3V81A 1ZBHA 3V9UA 4CJ7A 5I3UA 2X6SA 1SQKA 4CJPA 1YITN 3A0IX 4MLHA 3GBTA 4JK8A 4DLGA 1XC9A 4FVMA 1NK0A 2QKKA 4OGEA 3H3NO 4W5OA 4I6MA 4AM7A 4H8KA 2CH5A 3AVFA 4YNQA 1NKCA 1V4SA 4C8LA 3CMAN 4MDAA 3GOIA 4BRQA 4CFDA 3O3HA 4O55A 3O1WA 4W5TA 3WNGA 1HKBA 2O8BA 2YJEA 3BUZB 3U4LA 2GWJA 4J2AA 5B8HA 4JS4A 2XY8A 2E5LK 1OKJA 1KQSM 3RMAA 2RPIA 2V7YA 1VQ4N 4A2BA 2G8IA 3AARA 1XMQK 4A61A 1JLEA 3S3MA 5FDLA 4KTWA 2YKMA 4DSLA 2ZWHA 3N4QA 2G8KA 3AO4A 1RT6A 3KWGA 4WFBL 3OS2A 5M1NA 3LPTA 3HT3A 1NJZA 3EEQA 3TU5A 4IFYA 1NNEA 1XWLA 1BHLA 3ZX0A 3L2WA 3WT0A 4BG8A 4CZGA 5EX5A 2PBDA 1YJWN 4JN4A 3EN9A 5AQNA 5JS2A 3PUFA 3I8BA 3NGYA 1RBVA 3P31A 1P8ZA 2A40A 5AFUA 1M1KO 4FJHA 3J7YP 2JWLA 1NK9A 3ALYA 4CJVA 1VSMA 5DMRA 5FRNA 4DTNA 3LALA 3GG4A 2HHSA 3QEVA 4GKKK 1NJXA 4BQLA 1K6YA 4AHTA 4X65K 2HHQA 5HLFA 1ILYA 2WBNA 4GVEA 2E20A 4ELVA 1D4XA 4LD0A 4HTUA 4AHSA 3V9ZA 3RR8A 4RG8A 3VEOA 3SI6A 1NK6A 2YX6A 4NLBA 1UOCA 4W5NA 4BDPA 5DM7L 3ZSRA 4M3ZA 5E84A 1BCMA 1VSIA 4CJRA 3VF4A 2OPPA 2V7ZA 1YJ9N 4FZZA 1IBLK 1RTDA 2WFBA 4B1VA 1N36K 4N47A 3QNOA 4OPJA 3PO4A 3SYZA 4BE0A 1F21A 1MU2A 4PKGA 2YNIA 3ZT4A 4DQQA 4H0TB 1HNZK 4CW7B 1UA0A 1VQPN 3VQ6A 4O8KA 5FROA 3OJUA 3M8RA 4PUOA 4YOUA 3ZETB 4ISFA 1WLJA 4CGJA 3ZX2A 3VA0A 2W40A 4IEIA 2OTJN 4B9LA 3KZBA 3BZCA 3AAQA 3JYTA 3OYGA 4B3TK 4J8FA 3WNFA 4GV6A 4FW2A 2FBXA 2OYQA 2VG5A 3M3ZA 1NBWA 4BR7A 5IT9O 1IJJA 3KLFA 2VCPA 1BUPA 3OVNA 3MMVA 3G10A 4JI4K 4LH5A 3E01A 1D5AA 4OPHA 4XIUA 3KKRA 1U49A 2JWKA 4DCHA 3D0PA 2V52B 1ATNA 3OBYA 4GKJK 1KFSA 3VETA 1HRHA 4BC3A 4DU1A 4LSLA 1R0AA 3LPUA 4C1NK 3K0SA 3UKRB 1E3MA 1UWBA 5FPMA 2Q97A 4BRFA 4H5TA 1VQLN 4H03B 4CGDA 1IO2A 4OPKA 2P9NB 4QS7A 4KKOA 4JI7K 1T8EA 2P5GA 2WC9A 5BR8K 4JKHA 4L3QA 3VF2A 3PIOL 5AQWA 5ADXA 3V9SA 2A1RA 2BE2A 1S1VA 1ZYQA 2E1ZA 3ID8A 2NRTA 3C6TA 3VGKA 5C42A 2AA4A 1KSPA 3LM2A 3ZT3A 4CFAA 3LL3A 3AVNA 1W0HA 2PFUA 3J7ZO 3AO5A 3VQAA 1QQNA 3DLGA 4O5BA 3ZSQA 3HBTA 3DYAA 4BROA 4B8CA 1IBKK 3CFRA 4CJLA 4WFNL 1CXQA 2P9LA 4AQYK 4DTSA 5TKYA 1K73O 1SKRA 3OYDA 4AHRA 4CEDA 3ULEB 3HO1A 4DSKA 5LMNK 3KLHA 2F96A 3DLKA 3G4SN 4RTFD 1SZ2A 1NGFA 4GV9A 1EO1A 1DEJA 2P51A 4KHWA 4Y1CA 3SBTA 4CJKA 3ATUA 3ZSXA 2GTDA 1HKGA 1VQNN 1KAYA 3AA5X 4KB0A 2HNZA 4NLCA 4AH9A 3KK1A 3DRPA 2P9LB 2KTQA 3WEEA 3OYNA 4BC5A 4KHQA 3DLEA 2GELA 3TAMA 5AQXA 1RDCA 5MLCQ 3VGLA 4F3OA 2UUBK 1QVFM 3V6DA 3VERA 2D0BA 1ZBFA 4W5QA 4FLYA 4IZ9A 1I39A 5KRSA 2NLXA 1LOTB 2ZQBA 1L3UA 4ISEA 3CCJN 3AVCA 1BQNA 2P9KA 2ZD1A 1N8RO 4DTXA 3WEEB 3SPZA 2DY4A 4JD2A 2WTUA 3A5OC 1XC3A 3IUCA 3E9PA 3VQEA 4IXCA 1GLAG 1Q7YO 1KFDA 3RVCA 1QQMA 1JKHA 2ZJPL 5AQSA 4E7HA 3VGMA 4MQ3A 3C7NB 1JLGA 3CPEA 3MXIA 3EE9A 2BANA 1C0MA 4JKEA 4BE2A 5JICA 4DFJA 3O4WA 3KTQA 3ULDA 4H0YB 4FZYA 1QSSA 2O4GA 1G15A 3IDHA 1S1WA 3QINA 1WSFA 3AO3A 2W6KA 4O0IA 1WSEA 2HB5A 4X66K 4BWMA 2UYTA 3VESA 4JKBA 4J2DA 1Q82O 3S3OA 1NK8A 3CIPA 4ILGB 4WFAL 1EWQA 5C2FA 2VGMA 1WSHA 1HPMA 1NK5A 4RW8A 1CZBA 3CXCM 3QICA 3CI5A 1EKEA 4M42A 1TYQA 4PA1A 4FM2A 1EQYA 4B3OA 3CJBA 5AQTA 1K9MO 1HUXA 3L0QA 2Q0UA 4FSVA 4DV5K 3NFAA 4BR5A 1U4BA 3O3FA 1KCFA 4Z4GA 4AHCA 4HCBA 2HVIA 2BH1A 1B9DA 2VG6A 4CHZA 3N4PA 1WUAA 4DV7K 5AQRA 3KWIA 4GVMA 3QIPA 4H4OA 4IKFA 5C15A 4FLWA 1DGKN 1JLFA 1FJGK 2P9UA 3Q7BA 4DS5A 2WOMA 3I56N 3NF9A 4IG0A 4H0OA 3CD6N 3ENOA 3AVAA 3QETA 1GLFO 1NLVA 1TK5A 3V4IA 1VHXA 2NRHA 4CHPA 4WYBA 4CCHA 2KQ2A 2A1SA 3FLCO 3MWPA 3D2EB 2FC0A 5KPRA 4OGCA 4CD3A 4MO5A 3ASMA 4DV4K 4E19A 1A5WA 5IWAK 2CGJA 4FLZA 2UUAK 1ZBUA 1IG8A 4CE9A 4RW9A 4F2SA 1RDUA 4EAHD 3SUNA 1SL0A 4BC2A 4MO4A 3CCLN 2KLAA 1BWFO 5JVHL 4NCBA 3VOVA 2P9SA 4JI8K 2IIRA 4DUZK 1KVBA 1I3AA 4DTPA 1KD1O 1VSFA 4YOWA 4EP5A 3BEXA 3K5MA 4LF4K 1LAWA 1OVQA 2EHGA 3SAGA 1FKOA 1KC8O 5KGXA 3I33A 3RSEB 4FM0A 4TSXA 4JS5A 3KVGA 2B6AA 3LWLA 4DQPA 3T7ZA 4JK9A 2ZJRL 4BGAA 1CLQA 3AVLA 3DM2A 3LDOA 3O08A 4DTRA 4JI6K 3U9DA 1ZBLA 2RN2A 1WBDA 4CEEA 4F9OA 3T1YK 3HI0A 3P5JA 3CM5A 3QIOA 4YHHK 3KHYA 4KB1A 3NF8A 4JI1K 5BRHA 2P9SB 1YTUA 3FE1A 2XY6A 1HX1A 3VQPA 1TUYA 5EU7A 4NXMK 3CPWM 4DF4A 4Z4HA 3DXKA 4O4GA 3GDQA 4JAXA 3CFPA 1W97L 2E2NA 5SWMA 2PYLA 3UKUA 4OKEA 4I9QA 1Y64A 4H4MA 1JLQA 1JXEA 3SJJA 1IKXA 4B9SA 1R59O 3FR0A 5J2QA 3L4IA 1S6QA 3M8PA 4CHQA 1Q9XA 1WOQA 4BE1A 1NGJA 3PSFA 4FJXA 3H45C 1ASWA 1NMDA 3AVJA 4ISGA 4AM6A 3DRRA 1OH8A 4RW7A 2ASMA 2NZTA 2FBTA 4CJWA 4XH4A 2RKIA 3H08A 1JLBA 4FO0A 2WUSA 5AQZA 2F9WA 4DR7K 2HMIA 2EWSA 1QQOA 1ZXOA 3M6GA 4L8RB 4YDUC 4B1XB 3D6RA 2R7YA 4ILJA 4FOIA 4WQ5A 4BRMA 2UUCK 4CEBA 3ENHA 5GIOA 1RBUA 3HK2A 1B92A 2KW4A 4R79A 2FF3B 3CERA 2UXDK 4A57A 3TWHA 1GOAA 5JMVA 5KRTA 1BISA 1VSHA 3BF1A 4E7IA 3AY9A 3QB0A 2YHBA 4FLUA 2Z1JA 1KTQA 2I7NA 5AQFA 2E6LA 2ZJQL 4LF8K 2YNGA 4OJRA 3L3VA 3FGUA 4BRKA 1V4TA 3HVRA 4DR2K 3OYIA 5CY4A 4A62A 3KD1E 1RCHA 1QVGM 3W0LA 4B9TA 2HF3A 3BZKA 4I6MB 3O4NA 4V19S 1OH6A 2IC3A 3MN7A 2QEXN 3R6MA 2B5JA 2FF6A 1YHQN 5AQUA 1JLAA 2FBVA 1RDDA 3VQ9A 2O8BB 3MEEA 4DQRA 3WNHA 4CK2A 1WAJA 4CHYA 1ATRA 5K14A 3PLAA 1H1VA 3LWMA 3U6FA 2Q0RA 1VQMN 2HSTA 3DLLL 3MDQA 2ITMA 3L8BA 4BRCA 3WXJA 3HRGA 2QKBA 1BIUA 4CJEA 3NMUA 3CCVN 1GLCG 3MN5A 4B1WB 2D1KA 5HL7L 1S22A 1M90O 4BR9A 2VYPA 1HLUA 3THVA 1VAZA 5CR4A 3PIPL 1GLBG 2ATQA 4LF6K 3CHWA 4E7KA 1RDBA 2YV0X 3OA9A 1XMOK 3GL1A 4CF0A 3HOTA 1RDWX 4CJ3A 3O4QA 4KO0A 3EO3A 3I8DA 3L2RA 4BC4A 2QWQA 5DM6L 1NGDA 4E3SA 4MFBA 5TKWA 4N56A 5BPNA 1NGBA 1JL1A 1HKCA 3OW2M 3HZ6A 2X78A 4WQ4C 3SUPA 1IV0A 3RRHA 1VSKA 2BGGA 3QESA 1Q18A 3NH0A 3OYFA 3DJCA 4CEQA 5M1QA 4LFAK 1YT3A 4CEOA 2FXUA 3TTFA 1RTIA 3C6UA 2HHWA 2Y1JA 2VQEK 3HYFA 1T44A 1T6DA 1E4GT 4CZEA 2QW9A 4A5BA 3E9OA 3O9TA 5AQMA 5LJVA 2E2QA 3HPOA 2DFFA 1S3XA 2NNWA 1BU6O 1Z26A 2ZF5O 4G1QA 5I42A 2E4LA 2A3ZA 1EP4A 3V1OA 4B9QA 2GEMA 4I2QA 3G6EN 5CHIA 2VWJA 4I7FA 1HPZA 1KAZA 4OKJA 1HYSA 4B1UB 3QERA 2B4JA 3K5LA 3F9MA 4CK1A 5C0YA 2HF4A 3AGKA 4CFBA 3SZ2A 4FOEA 4CJUA 5HRNA 1OVYA 1VRUA 4FLTA 4KH5A 5AR0A 4F4KA 4ZHRA 2DFEA 4OVLA 4JK7A 2QTDA 3VQ8A 1TKZA 3L2UA 1J9AA 3JXUA 3BDPA 1YI2N 2P9PA 4C8KA 3L4QA 4DSFA 3WXKA 2IOCA 3M5RA 2ZGZA 1BO5O 4YOVA 4M3XA 3RR7A 1U2VA 3ZLJA 3NF7A 3PX6A 3NVKA 1RILA 4LSNA 1DT9A 4DMNA 1D8YA 3LDLA 2E8AA 3O9UA 3FZKA 4RWTA 4U7BA 1XQSC 3H6EA 1WSJA 3PSIA 4CJ4A 1LV5A 2D0AA 2FLOA 4PKHA 4XH5A 3UB5A 2X6NA 3QO9A 4WQ5C 3TSPA 4BRLA 1IKVA 1MDUB 1U2VB 4O44A 5ELZA 4N5SA 3F73A 4B1ZA 5FPNA 3U3GA 1WAFA 3VF6A 1S1TA 4DV0K 2O8DA 4UY8O 3NAEA 5BN9A 4BR2A 1Q81O 4AHVA 4EFHA 2DPNA 2PAVA 3P83D 1OH7A 1WBBA 4K42A 5C10A 3C65A 3VQCA 4DFKA 4JV5K 4DTOA 1SAZA 2HHTA 4LF5K 4DS4A 2KZZA 1YVUA 2D0CA 3LAKA 1VQON 4H5RA 5EOYA 4GMJB 5EVZA 2NRZA 4FJ9A 3JS6A 2GWKA 1RTJA 4CZFA 3JSMA 2PY5A 3AA3A 5AZJA 1LW0A 3JAMO 2W42A 2O8DB 4CZHA 3EL2A 3CFOA 3MX5A 4CGFA 3T3FA 3PV8A 4FJ5A 4DTUA 1RT7A 3DRSA 3L3UA 4B1YB 3ZEUA 2KFNA 3L6QA 4IOAL 3CQYA 1FK9A 2YI1A 2IVOA 4FWSA 1J6ZA 4YOYA 3G71N 4DG1A 2ASOA 3GE1A 2JGUA 3CYMA 4CJFA 3KLIA 3OHRA 3G0ZA 3VPZA 5M1KA 3LZJA 4NXNK 4K8ZA 4CI6A 4QS9A 5E41A 1N6QA 3D7EO 2QM1A 4JEPA 2E1YA 2D0PA 4U67L 1BGXT 5AJ3K 4ICLA 3EKSA 2QK9A 3OYCA 4KRFA 3ZEUB 4DV1K 3MCPA 4HWIA 4BQZA 4IFVA 1S1XA 3CF5L 4FJ8A 3MX2A 4M3RA 2IS3A 3LP2A 4O8UA 3CCUN 4KHUA 3ITHA 4IFEA 3K9KA 3LP1A 3SLCA 3T69A 4BGBA 3VQ7A 4KAZA 4FPAA 4Q5VA 4CERA 3CQXA 4WF9L 1S6PA 2CGKA 4ELTA 1RBSA 3LDQA 1O13A 1P90A 1WNSA 2Y1IA 3CCSN 3IKMA 1Y97A 2OPSA 4UQGA 3A5MC 1QHTA 4JRQA 3V1RA 3K9JA 5HROA 4KREA 5AQYA 4DV3K 3RMDA 3MXJA 4RCHA 4LH4A 2E6MA 1FKPA 2F9TA 5GINA 3CCQN 1SL1A 3MXMA 2HBKA 5FPDA 3CC7N 1RBTA 3SV3A 4B9MA 4CIFA 1RGIA 1TK0A 2OA8A 1VRTA 4DF8A 3SV4A 3PY8A 1J5EK 1VQ8N 3A2FA 4CZMA 4K41A 3DLBA 3DLHA 4AHUA 4KHNA 4IO9L 2P9KB 4FK2A 3A8YA 1RT4A 4JD2B 1KAXA 4OPAA 4FWQA 3DI6A 2HNYA 4CVNE 1BA0A 1ITGA 4DSIA 2W41A 4IOXA 4EP4A 3BGRA 3OBWA 2RHKA 3NH1A 4FPBA 4NB4A 1XI1A 1U04A 2UU9K 4X64K 4Z0UA 3OY9A 3AGRA 3ENBA 3VEWA 1DLOA 1X9WA 1NKEA 2A5XA 2A42A 2D0OA 3HPGA 5BN8A 2OZMA 1D9FA 1S9EA 3WXMB 4Y1DA 1VQ5N 3V9XA 3G25A 4FWRA 3SNNA 4CESA 1C0GA 3P39A 3VTHA 3ZT2A 4B9VA 2O8FA 4ID5A 5CZ2A 4CEAA 4YORA 1TGOA 2D5RA 1NJYA 4H5WA 1X3MA 5LJWA 4H5VA 1JJ2M 3NCIA 1TYQB 2OPQA 4JNEA 1WSGA 4ZTJA 4DR4K 3QFUA 3VENA 4FWLA 1HR0K 5KQDA 4LC9B 5DK5A 3AVGA 5AQVA 2IVNA 3OTOK 3TAEA 2VGNA 4CEZA 4CFCA 4B3MK 3HSCA 2IGIA 1LAVA 4CJQA 2NRVA 2E2PA 4PQUA 4NYFA 4BR0A 4QAGA 4CJTA 4FK0A 2P9UB 2OTLN 3QEPA 1SV5A
chains in the Genus database with same CATH topology
4I2PA 1UA0A 2ETJA 4E7IA 2VG7A 2YHBA 4M41A 3TABA 4FLUA 3VQ6A 2AJQA 4CF2A 2Z1JA 3K5NA 5FROA 2I5JA 1KTQA 3OJUA 5HRSA 2E6LA 2LSNA 3M8RA 3WNEA 4PUOA 2YNGA 1YTAA 4OJRA 4HUEA 3L3VA 1Q8IA 4JLHA 1NK7A 2RF2A 4CF9A 1WLJA 3HVRA 3OYIA 5CY4A 4CGJA 3K57A 3NF6A 3VA0A 5HRRA 5HP1A 3KD1E 1RCHA 3AA4A 1X9SA 1L5UA 3NE6A 4ELUA 3C94A 4B9LA 3HSTB 4B9TA 1BI4A 4YFUA 3OYEA 1DTQA 3NH2A 3O4NA 3ZT4A 3JYTA 4FCYA 1SKSA 3KJVA 3RMBA 1U48A 3HJFA 3I0RA 3OYGA 2IC3A 2ZE2A 3WNFA 1S1UA 4RW4A 1TKXA 2EX3A 2FBXA 4FW2A 2VG5A 2OYQA 3T19A 4J2EA 2B5JA 3M8QA 1RT3A 1Z25A 4CIEA 1JLAA 1HJRA 3KLFA 1U45A 1JLCA 2FBVA 2XRIA 1RDDA 3OVNA 1TAQA 2VWKA 3VQ9A 4M3WA 3G10A 3MEEA 4DQRA 1ASVA 3WNHA 4LH5A 4CK2A 3E01A 1TVRA 1D5AA 1IKYA 1WAJA 4CHYA 1KLMA 5K14A 4XIUA 1T7PA 3LWMA 3KKRA 3U6FA 1U49A 3ZT0A 3D0PA 3O3GA 1XHZA 4FM1A 1BI4B 3L8BA 4FJKA 1KFSA 1HRHA 1U47A 1QS4A 4Z4IA 4QCLA 3VQBA 2YHAA 4DU1A 3SQ1A 4LSLA 4HUFA 1VSEA 4FJLA 2QKBA 1NK4A 1BIUA 4WE1A 3VQDA 1R0AA 3LPUA 4CJEA 2HHVA 1NOZA 2HNDA 3DLRA 3OYKA 3TAPA 4B9NA 4OKKA 4N76A 1UWBA 3OYAA 1KVAA 3RMCA 5HBMA 1N5YA 1L3TA 2Q3SA 1IO2A 4CGDA 4OPKA 4CF8A 4KKOA 3VQ4A 4HVJA 3SQ2A 4EZ6A 1KLNA 3THVA 1T8EA 2P5GA 1WN7A 1LWEA 2ATQA 3DOKA 4FJ7A 4E7KA 1RDBA 2G8WA 2YV0X 3LP3A 3V9SA 1B9FA 1S5JA 4CF0A 4FK4A 2A1RA 3HP9A 4CJ3A 2BE2A 2FBYA 4DLEA 4I9LA 5CZ1A 3O4QA 1S1VA 4KO0A 3OYJA 3C95A 1ZYQA 4E0DA 3AVIA 3I8DA 3L2RA 4Z4FA 4DTMA 4CF1A 3C6TA 1KRPA 1IG9A 4M3YA 5C42A 4F8RA 1KSPA 3ZT3A 4CFAA 1HQEA 3AVNA 4E3SA 4MFBA 1W0HA 4W5RA 2YNFA 3AO5A 4N56A 2OPRA 3K5OA 2O4IA 3VQAA 3DLGA 1TAUA 4O5BA 3ZSQA 1UAXA 1EX4A 1O1WA 1JL1A 1GOCA 1QQCA 3DYAA 4B8CA 1TV6A 2X78A 3SUPA 3CFRA 1DTTA 4CJLA 4PWDA 3RRHA 1VSKA 3V1QA 3QESA 2BGGA 2NUBA 3NH0A 3OYFA 1CXQA 3D45A 1JL2A 4CEQA 4FJJA 1YT3A 5J2MA 4GW6A 4CEOA 1RTIA 3C6UA 2HHWA 2YNHA 4DTSA 2Y1JA 2Z1IA 3HYFA 4KTZA 1D9DA 1SKRA 3OYDA 5J2PA 4AHRA 4CEDA 3MAQA 1LWFA 4HCCA 3TAFA 3B6OA 3MEGA 3HO1A 4DSKA 3HPOA 2DFFA 3KLHA 2DFHA 3TAQA 2F96A 1ZBIA 3KD5E 3DLKA 3VN5A 1Z26A 4G1QA 3SCXA 3RTVA 3ZCMA 5I42A 2E4LA 3ZSZA 3IAYA 2HHUA 1EP4A 3V1OA 4DU3A 4CGIA 2P51A 3P1GA 1JXBA 4I2QA 3CM6A 3PX0A 4Y1CA 4KHWA 4CJKA 5C24A 1REVA 1RT2A 3SQ4A 3ZSXA 3FFIA 3LAMA 3VA3A 4DFPA 3CG7A 2VWJA 1T05A 4FJGA 3AA5X 1SL2A 4I7FA 1HPZA 4B8AB 4KB0A 2HNZA 4KTQA 4HUGA 1EXQA 4M45A 4AH9A 3KK1A 4OKJA 3DRPA 3SUQA 3QERA 1HYSA 2KTQA 3OYNA 4Q0BA 3HM9A 3SUOA 2B4JA 3K5LA 4KHQA 4E1NA 4CK1A 3U3YA 3EY1A 2X74A 3DLEA 4CFBA 3TAMA 4C8NA 3SZ2A 1NKBA 4CJUA 3SQ0A 3F9KA 5HRNA 1VRUA 4FLTA 1RDCA 3HPHA 4F4KA 4ZHRA 2DFEA 4KV8A 4OVLA 4F3OA 3VQ8A 4FLXA 1TKZA 3V6DA 3L2UA 2IDOA 2D0BA 4C8OA 1ZBFA 4W5QA 1J9AA 3ZSWA 4CGGA 3OYBA 4FLYA 3BDPA 4C8KA 1IH7A 4DSFA 4FZXC 1I39A 1QE1A 1C1BA 2IOCA 5KRSA 2ZQBA 3LDSA 4M3XA 4KI6A 3RR7A 1L3UA 3NF7A 3PX6A 1RILA 3AVCA 1BQNA 4LSNA 2ZD1A 4E7LA 4DTXA 1VSLA 3KK3A 3RRGA 3I0SA 3SPZA 2DY4A 4DMNA 4CHOA 1BIZA 1X1PA 2OZSA 3S3NA 4CECA 5C25A 3VQEA 2XY5A 1S9GA 1KFDA 1D8YA 4KHSA 4F3TA 1UA1A 1TKTA 1VK0A 3VQQA 3NDKA 1C0TA 4DU4A 3OYHA 1JKHA 3K58A 2BDPA 5SZTA 1WSJA 2F8SA 4QOZB 1ASUA 3VQ5A 4CJ4A 4E7HA 4B08A 2WONA 4MQ3A 1LV5A 1NOYA 2D0AA 1JLGA 3TAGA 3MXIA 4NCGA 3ZSVA 2BANA 2X6NA 3QO9A 1C0MA 1IKVA 1TL3A 4ZTFA 1TKDA 1W9HA 5J1EA 3NBPA 1RTHA 4O44A 3T1AA 3KLGA 4BE2A 2KFZA 5KI6A 4N5SA 3F73A 3U3GA 4DFJA 3ISNC 1WAFA 2G8HA 1RDAA 1S1TA 3KTQA 1IKWA 3KLEA 2G8UA 5CYMA 3ULDA 3NGZA 3NAEA 1RT1A 3PX4A 4PY5A 4CIGA 3OYLA 3QNNA 1QSYA 1HQUA 4AHVA 3M8SA 3MECA 5T7BA 4E1MA 4FZYA 3P83D 1QSSA 2O4GA 3AVKA 1G15A 3CQ8A 4N41A 1S1WA 3IS9A 3QINA 1WSFA 3LANA 3L2QA 3AO3A 3VQCA 1J5OA 4DFKA 1NJWA 2JLEA 5CYQA 4O0IA 4DTOA 3TI0A 2HHTA 4DS4A 3HL8A 1WSEA 2HB5A 2QXFA 4BWMA 3TARA 2KZZA 1YVUA 2D0CA 3B6PA 3LAKA 4JRPA 5KGWA 2HHXA 4EZ9A 5J2NA 1EETA 3EZ5A 4GMJB 3S3OA 1NK8A 4J2DA 5HRPA 4FJ9A 2XO7A 1WSHA 3RWUA 1NK5A 1RTJA 1CZBA 3KKSA 2Z1GA 4RW8A 4CK3A 3JSMA 4NCAA 2PY5A 3AA3A 4KFBA 1EKEA 2Z1HA 4IBNA 4M42A 1LW0A 1RNHA 4PA1A 4FM2A 3OS0A 2W42A 4B3OA 4RW6A 4IDKA 3NGIA 3QLHA 1VSJA 2ITGA 3NFAA 2XHBA 3CFOA 1U4BA 3O3FA 1X9MA 4CGFA 3T3FA 2HVHA 1KCFA 3PV8A 4FJ5A 4Z4GA 4NYNA 4DTUA 1RT7A 3DRSA 3L3UA 4AHCA 2F8TA 4HCBA 2IAJA 2HVIA 2PZSA 1B9DA 2VG6A 2KFNA 4CHZA 3QEWA 3UIQA 1FK9A 4KPYA 4KHYA 3SPYA 3TANA 3AO1A 1KVCA 3IRXA 1J53A 1HYVA 2P1JA 4GVMA 3QIPA 4H4OA 1XHXA 3LP0A 3IG1A 4DG1A 4IKFA 2JGUA 3CYMA 3QEIA 2DTUA 4CJFA 3KK2A 1HNVA 3KLIA 3KIOA 4CEFA 3LZIA 4BDZA 3G0ZA 2YKNA 4FYDA 3LZJA 4FLWA 2G8FA 1LWCA 2GBZA 2KZMA 1JLFA 4F2RA 4K8ZA 3HVTA 1SKWA 1CZ9A 3NHGA 4DS5A 5E41A 2GV9A 4R5PA 1N6QA 3EYZA 2WOMA 4DTJA 1BGXT 4FXDA 1BQMA 4E89A 3NF9A 4ICLA 3MEDA 4DFMA 3L2VA 3OYCA 1TK8A 2QK9A 4IG0A 1FXXA 5D3GA 4KRFA 3V81A 3AVAA 3QETA 3V9UA 1ZBHA 4IFVA 1S1XA 5I3UA 1TK5A 3V4IA 4HHTA 2X6SA 3ZSYA 4M3RA 1Q9YA 4FJ8A 1HYZA 4CJPA 2IS3A 4B9MA 3LP2A 4DLGA 1XC9A 4FVMA 1NK0A 2QKKA 4OGEA 4KHUA 3ITHA 3LP1A 4CHPA 3ZSOA 4W5OA 4CCHA 1A5XA 2KQ2A 2A1SA 4OLBA 4C8MA 3VQ7A 4KAZA 4H8KA 1QSLA 3AVFA 4Q5VA 4YNQA 1NKCA 3AO2A 4CERA 2FC0A 4O0JA 4C8LA 1HMVA 4OGCA 4BDYA 3ASMA 1S6PA 3AV9A 4O55A 4CFDA 4Z4CA 3O3HA 4W5TA 4E19A 1A5WA 4ELTA 4FLZA 1RBSA 1ZBUA 3WNGA 1WSIA 1TL1A 4CE9A 4RW9A 1CXUA 4F2SA 1GOBA 1WNSA 2Y1IA 4K8XA 3SUNA 1C0UA 4CGHA 2HW3A 1Y97A 4J2AA 1SL0A 2OPSA 4UQGA 4JS4A 1QHTA 4JRQA 3V1RA 5HROA 4KREA 2XY8A 3RMDA 1J54A 3RMAA 2RPIA 4NCBA 3AVHA 3MXJA 4LH4A 2E6MA 1FKPA 1QTMA 2G8IA 1KVBA 1I3AA 4DTPA 4IG3A 1VSFA 3MXMA 4EP5A 3HXMA 3K5MA 1SL1A 1LAWA 1JLEA 1RBTA 2EHGA 3SV3A 4CIFA 5FDLA 3S3MA 1TK0A 1FKOA 3DMJA 4KTWA 2YKMA 4AILC 2OA8A 1VRTA 5KGXA 4DF8A 3SV4A 3PY8A 4DSLA 3A2FA 1RBRA 3AO4A 1RT6A 2G8KA 4FM0A 3OS2A 4TSXA 4JS5A 4DQIA 1BL3A 3DLBA 3LWLA 2B6AA 3LPTA 3DLHA 4DQPA 4AHUA 4OLAA 3AVBA 4BWJA 2XY7A 3HT3A 4KHNA 4FK2A 1NJZA 1CLQA 3AVLA 1RT4A 4CJ5A 3DM2A 4DTRA 4IFYA 1C1CA 1XWLA 1BHLA 4FJIA 4Z4EA 3AA2A 3OS1A 1ZBLA 2RN2A 3L2WA 4CEEA 3PO5A 3HP6A 3P5JA 3DI6A 3CM5A 3QIOA 2HNYA 4DQQA 4KB1A 3NF8A 1YTUA 2XY6A 1ITGA 4DSIA 2GUIA 4EP4A 3VQPA 5JS2A 5EU7A 3BGRA 4DF4A 3PUFA 4Z4HA 3NH1A 4FJMA 3NGYA 4J2BA 4O4GA 1RBVA 3K2PA 3CFPA 5SWMA 1VSDA 3QEXA 4DQSA 2PYLA 4OKEA 4I9QA 4CHNA 1XI1A 4H4MA 1JLQA 4FJHA 1L3SA 4FLVA 1JXEA 3SJJA 3AVMA 4FW1A 1IKXA 1U04A 3ALYA 1NK9A 4CJVA 1VSMA 3S9HA 5DMRA 4Z0UA 3OY9A 4B9SA 4DWIA 5FRNA 4DTNA 3LALA 4DSEA 5J2QA 2HHSA 1DLOA 1X9WA 1NKEA 3QEVA 2PYJA 1A5VA 1NJXA 3M8PA 1S6QA 4CHQA 1Q9XA 1K6YA 4AHTA 2HHQA 4BE1A 5HLFA 1SUQA 4FJXA 3HPGA 1L3VA 1ASWA 3AVJA 2OZMA 1D9FA 4ELVA 1BCOA 3ZT1A 3DRRA 1S9EA 4Y1DA 4LD0A 4HTUA 4RW7A 2P5OA 4AHSA 3V9XA 4FJNA 2FBTA 4CJWA 3V9ZA 3RR8A 3SNNA 2RKIA 4CESA 4RG8A 3SI6A 4LY7A 1NK6A 3OJSA 1UOCA 4W5NA 4BDPA 3H08A 3ZT2A 4B9VA 1JLBA 4ID5A 5CZ2A 4CEAA 4M3UA 1TGOA 2D5RA 3ZSRA 1NJYA 4M3ZA 3DOLA 4KI4A 3NCIA 1RT5A 1LW2A 1BCMA 5KTQA 4DSJA 5FRMA 2OPQA 1VSIA 4E7JA 4CJRA 2HMIA 4M3TA 4ZTJA 1WSGA 3TR8A 4BACA 2OPPA 4B9UA 4L8RB 5DK5A 4FZZA 3AVGA 2R7YA 2G8VA 4CEBA 3V9WA 1RTDA 3TAEA 4CJSA 4CEZA 4CFCA 1C6VA 3K59A 4N47A 1RBUA 3QNOA 4OPJA 3HK2A 1B92A 2IGIA 2KW4A 3SYZA 1LAVA 3PO4A 4CJQA 4PQUA 4BE0A 1F21A 1T03A 1MU2A 4NYFA 4QAGA 3OYMA 4CJTA 3TWHA 1HNIA 4ID1A 1GOAA 4FK0A 5KRTA 1C1AA 5JS1A 3QEPA 1SV5A 2YNIA 1BISA 1VSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2P A;  1UA0 A;  2ETJ A;  4E7I A;  2VG7 A;  2YHB A;  4M41 A;  3TAB A;  4FLU A;  3VQ6 A;  2AJQ A;  4CF2 A;  2Z1J A;  3K5N A;  5FRO A;  2I5J A;  1KTQ A;  3OJU A;  5HRS A;  2E6L A;  2LSN A;  3M8R A;  3WNE A;  4PUO A;  2YNG A;  1YTA A;  4OJR A;  4HUE A;  3L3V A;  1Q8I A;  4JLH A;  1NK7 A;  2RF2 A;  4CF9 A;  1WLJ A;  3HVR A;  3OYI A;  5CY4 A;  4CGJ A;  3K57 A;  3NF6 A;  3VA0 A;  5HRR A;  5HP1 A;  3KD1 E;  1RCH A;  3AA4 A;  1X9S A;  1L5U A;  3NE6 A;  4ELU A;  3C94 A;  4B9L A;  3HST B;  4B9T A;  1BI4 A;  4YFU A;  3OYE A;  1DTQ A;  3NH2 A;  3O4N A;  3ZT4 A;  3JYT A;  4FCY A;  1SKS A;  3KJV A;  3RMB A;  1U48 A;  3HJF A;  3I0R A;  3OYG A;  2IC3 A;  2ZE2 A;  3WNF A;  1S1U A;  4RW4 A;  1TKX A;  2EX3 A;  2FBX A;  4FW2 A;  2VG5 A;  2OYQ A;  3T19 A;  4J2E A;  2B5J A;  3M8Q A;  1RT3 A;  1Z25 A;  4CIE A;  1JLA A;  1HJR A;  3KLF A;  1U45 A;  1JLC A;  2FBV A;  2XRI A;  1RDD A;  3OVN A;  1TAQ A;  2VWK A;  3VQ9 A;  4M3W A;  3G10 A;  3MEE A;  4DQR A;  1ASV A;  3WNH A;  4LH5 A;  4CK2 A;  3E01 A;  1TVR A;  1D5A A;  1IKY A;  1WAJ A;  4CHY A;  1KLM A;  5K14 A;  4XIU A;  1T7P A;  3LWM A;  3KKR A;  3U6F A;  1U49 A;  3ZT0 A;  3D0P A;  3O3G A;  1XHZ A;  4FM1 A;  1BI4 B;  3L8B A;  4FJK A;  1KFS A;  1HRH A;  1U47 A;  1QS4 A;  4Z4I A;  4QCL A;  3VQB A;  2YHA A;  4DU1 A;  3SQ1 A;  4LSL A;  4HUF A;  1VSE A;  4FJL A;  2QKB A;  1NK4 A;  1BIU A;  4WE1 A;  3VQD A;  1R0A A;  3LPU A;  4CJE A;  2HHV A;  1NOZ A;  2HND A;  3DLR A;  3OYK A;  3TAP A;  4B9N A;  4OKK A;  4N76 A;  1UWB A;  3OYA A;  1KVA A;  3RMC A;  5HBM A;  1N5Y A;  1L3T A;  2Q3S A;  1IO2 A;  4CGD A;  4OPK A;  4CF8 A;  4KKO A;  3VQ4 A;  4HVJ A;  3SQ2 A;  4EZ6 A;  1KLN A;  3THV A;  1T8E A;  2P5G A;  1WN7 A;  1LWE A;  2ATQ A;  3DOK A;  4FJ7 A;  4E7K A;  1RDB A;  2G8W A;  2YV0 X;  3LP3 A;  3V9S A;  1B9F A;  1S5J A;  4CF0 A;  4FK4 A;  2A1R A;  3HP9 A;  4CJ3 A;  2BE2 A;  2FBY A;  4DLE A;  4I9L A;  5CZ1 A;  3O4Q A;  1S1V A;  4KO0 A;  3OYJ A;  3C95 A;  1ZYQ A;  4E0D A;  3AVI A;  3I8D A;  3L2R A;  4Z4F A;  4DTM A;  4CF1 A;  3C6T A;  1KRP A;  1IG9 A;  4M3Y A;  5C42 A;  4F8R A;  1KSP A;  3ZT3 A;  4CFA A;  1HQE A;  3AVN A;  4E3S A;  4MFB A;  1W0H A;  4W5R A;  2YNF A;  3AO5 A;  4N56 A;  2OPR A;  3K5O A;  2O4I A;  3VQA A;  3DLG A;  1TAU A;  4O5B A;  3ZSQ A;  1UAX A;  1EX4 A;  1O1W A;  1JL1 A;  1GOC A;  1QQC A;  3DYA A;  4B8C A;  1TV6 A;  2X78 A;  3SUP A;  3CFR A;  1DTT A;  4CJL A;  4PWD A;  3RRH A;  1VSK A;  3V1Q A;  3QES A;  2BGG A;  2NUB A;  3NH0 A;  3OYF A;  1CXQ A;  3D45 A;  1JL2 A;  4CEQ A;  4FJJ A;  1YT3 A;  5J2M A;  4GW6 A;  4CEO A;  1RTI A;  3C6U A;  2HHW A;  2YNH A;  4DTS A;  2Y1J A;  2Z1I A;  3HYF A;  4KTZ A;  1D9D A;  1SKR A;  3OYD A;  5J2P A;  4AHR A;  4CED A;  3MAQ A;  1LWF A;  4HCC A;  3TAF A;  3B6O A;  3MEG A;  3HO1 A;  4DSK A;  3HPO A;  2DFF A;  3KLH A;  2DFH A;  3TAQ A;  2F96 A;  1ZBI A;  3KD5 E;  3DLK A;  3VN5 A;  1Z26 A;  4G1Q A;  3SCX A;  3RTV A;  3ZCM A;  5I42 A;  2E4L A;  3ZSZ A;  3IAY A;  2HHU A;  1EP4 A;  3V1O A;  4DU3 A;  4CGI A;  2P51 A;  3P1G A;  1JXB A;  4I2Q A;  3CM6 A;  3PX0 A;  4Y1C A;  4KHW A;  4CJK A;  5C24 A;  1REV A;  1RT2 A;  3SQ4 A;  3ZSX A;  3FFI A;  3LAM A;  3VA3 A;  4DFP A;  3CG7 A;  2VWJ A;  1T05 A;  4FJG A;  3AA5 X;  1SL2 A;  4I7F A;  1HPZ A;  4B8A B;  4KB0 A;  2HNZ A;  4KTQ A;  4HUG A;  1EXQ A;  4M45 A;  4AH9 A;  3KK1 A;  4OKJ A;  3DRP A;  3SUQ A;  3QER A;  1HYS A;  2KTQ A;  3OYN A;  4Q0B A;  3HM9 A;  3SUO A;  2B4J A;  3K5L A;  4KHQ A;  4E1N A;  4CK1 A;  3U3Y A;  3EY1 A;  2X74 A;  3DLE A;  4CFB A;  3TAM A;  4C8N A;  3SZ2 A;  1NKB A;  4CJU A;  3SQ0 A;  3F9K A;  5HRN A;  1VRU A;  4FLT A;  1RDC A;  3HPH A;  4F4K A;  4ZHR A;  2DFE A;  4KV8 A;  4OVL A;  4F3O A;  3VQ8 A;  4FLX A;  1TKZ A;  3V6D A;  3L2U A;  2IDO A;  2D0B A;  4C8O A;  1ZBF A;  4W5Q A;  1J9A A;  3ZSW A;  4CGG A;  3OYB A;  4FLY A;  3BDP A;  4C8K A;  1IH7 A;  4DSF A;  4FZX C;  1I39 A;  1QE1 A;  1C1B A;  2IOC A;  5KRS A;  2ZQB A;  3LDS A;  4M3X A;  4KI6 A;  3RR7 A;  1L3U A;  3NF7 A;  3PX6 A;  1RIL A;  3AVC A;  1BQN A;  4LSN A;  2ZD1 A;  4E7L A;  4DTX A;  1VSL A;  3KK3 A;  3RRG A;  3I0S A;  3SPZ A;  2DY4 A;  4DMN A;  4CHO A;  1BIZ A;  1X1P A;  2OZS A;  3S3N A;  4CEC A;  5C25 A;  3VQE A;  2XY5 A;  1S9G A;  1KFD A;  1D8Y A;  4KHS A;  4F3T A;  1UA1 A;  1TKT A;  1VK0 A;  3VQQ A;  3NDK A;  1C0T A;  4DU4 A;  3OYH A;  1JKH A;  3K58 A;  2BDP A;  5SZT A;  1WSJ A;  2F8S A;  4QOZ B;  1ASU A;  3VQ5 A;  4CJ4 A;  4E7H A;  4B08 A;  2WON A;  4MQ3 A;  1LV5 A;  1NOY A;  2D0A A;  1JLG A;  3TAG A;  3MXI A;  4NCG A;  3ZSV A;  2BAN A;  2X6N A;  3QO9 A;  1C0M A;  1IKV A;  1TL3 A;  4ZTF A;  1TKD A;  1W9H A;  5J1E A;  3NBP A;  1RTH A;  4O44 A;  3T1A A;  3KLG A;  4BE2 A;  2KFZ A;  5KI6 A;  4N5S A;  3F73 A;  3U3G A;  4DFJ A;  3ISN C;  1WAF A;  2G8H A;  1RDA A;  1S1T A;  3KTQ A;  1IKW A;  3KLE A;  2G8U A;  5CYM A;  3ULD A;  3NGZ A;  3NAE A;  1RT1 A;  3PX4 A;  4PY5 A;  4CIG A;  3OYL A;  3QNN A;  1QSY A;  1HQU A;  4AHV A;  3M8S A;  3MEC A;  5T7B A;  4E1M A;  4FZY A;  3P83 D;  1QSS A;  2O4G A;  3AVK A;  1G15 A;  3CQ8 A;  4N41 A;  1S1W A;  3IS9 A;  3QIN A;  1WSF A;  3LAN A;  3L2Q A;  3AO3 A;  3VQC A;  1J5O A;  4DFK A;  1NJW A;  2JLE A;  5CYQ A;  4O0I A;  4DTO A;  3TI0 A;  2HHT A;  4DS4 A;  3HL8 A;  1WSE A;  2HB5 A;  2QXF A;  4BWM A;  3TAR A;  2KZZ A;  1YVU A;  2D0C A;  3B6P A;  3LAK A;  4JRP A;  5KGW A;  2HHX A;  4EZ9 A;  5J2N A;  1EET A;  3EZ5 A;  4GMJ B;  3S3O A;  1NK8 A;  4J2D A;  5HRP A;  4FJ9 A;  2XO7 A;  1WSH A;  3RWU A;  1NK5 A;  1RTJ A;  1CZB A;  3KKS A;  2Z1G A;  4RW8 A;  4CK3 A;  3JSM A;  4NCA A;  2PY5 A;  3AA3 A;  4KFB A;  1EKE A;  2Z1H A;  4IBN A;  4M42 A;  1LW0 A;  1RNH A;  4PA1 A;  4FM2 A;  3OS0 A;  2W42 A;  4B3O A;  4RW6 A;  4IDK A;  3NGI A;  3QLH A;  1VSJ A;  2ITG A;  3NFA A;  2XHB A;  3CFO A;  1U4B A;  3O3F A;  1X9M A;  4CGF A;  3T3F A;  2HVH A;  1KCF A;  3PV8 A;  4FJ5 A;  4Z4G A;  4NYN A;  4DTU A;  1RT7 A;  3DRS A;  3L3U A;  4AHC A;  2F8T A;  4HCB A;  2IAJ A;  2HVI A;  2PZS A;  1B9D A;  2VG6 A;  2KFN A;  4CHZ A;  3QEW A;  3UIQ A;  1FK9 A;  4KPY A;  4KHY A;  3SPY A;  3TAN A;  3AO1 A;  1KVC A;  3IRX A;  1J53 A;  1HYV A;  2P1J A;  4GVM A;  3QIP A;  4H4O A;  1XHX A;  3LP0 A;  3IG1 A;  4DG1 A;  4IKF A;  2JGU A;  3CYM A;  3QEI A;  2DTU A;  4CJF A;  3KK2 A;  1HNV A;  3KLI A;  3KIO A;  4CEF A;  3LZI A;  4BDZ A;  3G0Z A;  2YKN A;  4FYD A;  3LZJ A;  4FLW A;  2G8F A;  1LWC A;  2GBZ A;  2KZM A;  1JLF A;  4F2R A;  4K8Z A;  3HVT A;  1SKW A;  1CZ9 A;  3NHG A;  4DS5 A;  5E41 A;  2GV9 A;  4R5P A;  1N6Q A;  3EYZ A;  2WOM A;  4DTJ A;  1BGX T;  4FXD A;  1BQM A;  4E89 A;  3NF9 A;  4ICL A;  3MED A;  4DFM A;  3L2V A;  3OYC A;  1TK8 A;  2QK9 A;  4IG0 A;  1FXX A;  5D3G A;  4KRF A;  3V81 A;  3AVA A;  3QET A;  3V9U A;  1ZBH A;  4IFV A;  1S1X A;  5I3U A;  1TK5 A;  3V4I A;  4HHT A;  2X6S A;  3ZSY A;  4M3R A;  1Q9Y A;  4FJ8 A;  1HYZ A;  4CJP A;  2IS3 A;  4B9M A;  3LP2 A;  4DLG A;  1XC9 A;  4FVM A;  1NK0 A;  2QKK A;  4OGE A;  4KHU A;  3ITH A;  3LP1 A;  4CHP A;  3ZSO A;  4W5O A;  4CCH A;  1A5X A;  2KQ2 A;  2A1S A;  4OLB A;  4C8M A;  3VQ7 A;  4KAZ A;  4H8K A;  1QSL A;  3AVF A;  4Q5V A;  4YNQ A;  1NKC A;  3AO2 A;  4CER A;  2FC0 A;  4O0J A;  4C8L A;  1HMV A;  4OGC A;  4BDY A;  3ASM A;  1S6P A;  3AV9 A;  4O55 A;  4CFD A;  4Z4C A;  3O3H A;  4W5T A;  4E19 A;  1A5W A;  4ELT A;  4FLZ A;  1RBS A;  1ZBU A;  3WNG A;  1WSI A;  1TL1 A;  4CE9 A;  4RW9 A;  1CXU A;  4F2S A;  1GOB A;  1WNS A;  2Y1I A;  4K8X A;  3SUN A;  1C0U A;  4CGH A;  2HW3 A;  1Y97 A;  4J2A A;  1SL0 A;  2OPS A;  4UQG A;  4JS4 A;  1QHT A;  4JRQ A;  3V1R A;  5HRO A;  4KRE A;  2XY8 A;  3RMD A;  1J54 A;  3RMA A;  2RPI A;  4NCB A;  3AVH A;  3MXJ A;  4LH4 A;  2E6M A;  1FKP A;  1QTM A;  2G8I A;  1KVB A;  1I3A A;  4DTP A;  4IG3 A;  1VSF A;  3MXM A;  4EP5 A;  3HXM A;  3K5M A;  1SL1 A;  1LAW A;  1JLE A;  1RBT A;  2EHG A;  3SV3 A;  4CIF A;  5FDL A;  3S3M A;  1TK0 A;  1FKO A;  3DMJ A;  4KTW A;  2YKM A;  4AIL C;  2OA8 A;  1VRT A;  5KGX A;  4DF8 A;  3SV4 A;  3PY8 A;  4DSL A;  3A2F A;  1RBR A;  3AO4 A;  1RT6 A;  2G8K A;  4FM0 A;  3OS2 A;  4TSX A;  4JS5 A;  4DQI A;  1BL3 A;  3DLB A;  3LWL A;  2B6A A;  3LPT A;  3DLH A;  4DQP A;  4AHU A;  4OLA A;  3AVB A;  4BWJ A;  2XY7 A;  3HT3 A;  4KHN A;  4FK2 A;  1NJZ A;  1CLQ A;  3AVL A;  1RT4 A;  4CJ5 A;  3DM2 A;  4DTR A;  4IFY A;  1C1C A;  1XWL A;  1BHL A;  4FJI A;  4Z4E A;  3AA2 A;  3OS1 A;  1ZBL A;  2RN2 A;  3L2W A;  4CEE A;  3PO5 A;  3HP6 A;  3P5J A;  3DI6 A;  3CM5 A;  3QIO A;  2HNY A;  4DQQ A;  4KB1 A;  3NF8 A;  1YTU A;  2XY6 A;  1ITG A;  4DSI A;  2GUI A;  4EP4 A;  3VQP A;  5JS2 A;  5EU7 A;  3BGR A;  4DF4 A;  3PUF A;  4Z4H A;  3NH1 A;  4FJM A;  3NGY A;  4J2B A;  4O4G A;  1RBV A;  3K2P A;  3CFP A;  5SWM A;  1VSD A;  3QEX A;  4DQS A;  2PYL A;  4OKE A;  4I9Q A;  4CHN A;  1XI1 A;  4H4M A;  1JLQ A;  4FJH A;  1L3S A;  4FLV A;  1JXE A;  3SJJ A;  3AVM A;  4FW1 A;  1IKX A;  1U04 A;  3ALY A;  1NK9 A;  4CJV A;  1VSM A;  3S9H A;  5DMR A;  4Z0U A;  3OY9 A;  4B9S A;  4DWI A;  5FRN A;  4DTN A;  3LAL A;  4DSE A;  5J2Q A;  2HHS A;  1DLO A;  1X9W A;  1NKE A;  3QEV A;  2PYJ A;  1A5V A;  1NJX A;  3M8P A;  1S6Q A;  4CHQ A;  1Q9X A;  1K6Y A;  4AHT A;  2HHQ A;  4BE1 A;  5HLF A;  1SUQ A;  4FJX A;  3HPG A;  1L3V A;  1ASW A;  3AVJ A;  2OZM A;  1D9F A;  4ELV A;  1BCO A;  3ZT1 A;  3DRR A;  1S9E A;  4Y1D A;  4LD0 A;  4HTU A;  4RW7 A;  2P5O A;  4AHS A;  3V9X A;  4FJN A;  2FBT A;  4CJW A;  3V9Z A;  3RR8 A;  3SNN A;  2RKI A;  4CES A;  4RG8 A;  3SI6 A;  4LY7 A;  1NK6 A;  3OJS A;  1UOC A;  4W5N A;  4BDP A;  3H08 A;  3ZT2 A;  4B9V A;  1JLB A;  4ID5 A;  5CZ2 A;  4CEA A;  4M3U A;  1TGO A;  2D5R A;  3ZSR A;  1NJY A;  4M3Z A;  3DOL A;  4KI4 A;  3NCI A;  1RT5 A;  1LW2 A;  1BCM A;  5KTQ A;  4DSJ A;  5FRM A;  2OPQ A;  1VSI A;  4E7J A;  4CJR A;  2HMI A;  4M3T A;  4ZTJ A;  1WSG A;  3TR8 A;  4BAC A;  2OPP A;  4B9U A;  4L8R B;  5DK5 A;  4FZZ A;  3AVG A;  2R7Y A;  2G8V A;  4CEB A;  3V9W A;  1RTD A;  3TAE A;  4CJS A;  4CEZ A;  4CFC A;  1C6V A;  3K59 A;  4N47 A;  1RBU A;  3QNO A;  4OPJ A;  3HK2 A;  1B92 A;  2IGI A;  2KW4 A;  3SYZ A;  1LAV A;  3PO4 A;  4CJQ A;  4PQU A;  4BE0 A;  1F21 A;  1T03 A;  1MU2 A;  4NYF A;  4QAG A;  3OYM A;  4CJT A;  3TWH A;  1HNI A;  4ID1 A;  1GOA A;  4FK0 A;  5KRT A;  1C1A A;  5JS1 A;  3QEP A;  1SV5 A;  2YNI A;  1BIS A;  1VSH A; 
#chains in the Genus database with same CATH topology
 4I2P A;  1Z6R A;  2H3G X;  2ETJ A;  3TAB A;  5GAH P;  5AQH A;  2AJQ A;  4CF2 A;  3MN6 A;  3K5N A;  5BRD A;  5JLH A;  3CJC A;  1NM1 A;  2LSN A;  5HRS A;  1YTA A;  4HUE A;  1Q8I A;  4JLH A;  5JVG L;  5AZI A;  4LFB K;  4GV3 A;  3K57 A;  2QA4 N;  5HRR A;  5HP1 A;  4JHD A;  3M1F A;  3H46 O;  3NE6 A;  4ELU A;  1U6Z A;  3C94 A;  3DXM A;  1C0F A;  1DTQ A;  4FCY A;  4H0V B;  3A5N C;  3RMB A;  3I0R A;  2F4V K;  3R3L A;  5E26 A;  4RW4 A;  3WQU A;  3EE8 A;  5AQJ A;  3U8X A;  1HJO A;  3M8Q A;  1BG3 A;  3THX A;  1HJR A;  3IMX A;  1U45 A;  1TAQ A;  1ASV A;  4BRN A;  5HOO A;  1TVR A;  4JKA A;  1IKY A;  4Z94 A;  4IEE A;  3O9S A;  2QWM A;  3H1V X;  4FJK A;  2QI2 A;  1N33 K;  2ZM6 K;  1QS4 A;  4Z4I A;  1XUP O;  5KPZ A;  4BY9 C;  4FJL A;  4HUF A;  1ATS A;  3VQD A;  5M1O A;  1NOZ A;  2HHV A;  3OYK A;  3TAP A;  4B9N A;  4OKK A;  4N76 A;  2F7T A;  1N5Y A;  4CF8 A;  1KXP A;  1NWK A;  3VQ4 A;  4EZ6 A;  1KLN A;  3FZL A;  2P9I A;  1YJN N;  1LWE A;  3DOK A;  1Q86 O;  1ZBS A;  4FJ7 A;  3CCM N;  4C23 A;  3IFR A;  3LP3 A;  3O8M A;  1S5J A;  4OX9 K;  2FBY A;  4DLE A;  2UXB K;  4I9L A;  5CZ1 A;  4X62 K;  3EKU A;  4IO8 A;  4FWO A;  3WXL A;  3DXK B;  3TSU A;  4DTM A;  4CF1 A;  4M3Y A;  1N32 K;  1IG9 A;  3UKU B;  2O8E A;  1NGH A;  4W5R A;  2OPR A;  3K5O A;  1TAU A;  1NMN A;  2P9I B;  1VQ6 N;  1EX4 A;  1O1W A;  1GOC A;  1TV6 A;  4PWD A;  4QS8 A;  2BTF A;  2NUB A;  3D45 A;  1JL2 A;  5EXW A;  5J2M A;  4GW6 A;  2YNH A;  4KTZ A;  1D9D A;  3C6H A;  3P38 A;  4EIA A;  1VQ7 N;  3MAQ A;  4HCC A;  3TAF A;  1WB9 A;  3LDN A;  4BRI A;  3TAQ A;  1MWK A;  5C2D A;  1ZBI A;  3VN5 A;  5BPM A;  3SCX A;  3RTV A;  3ZCM A;  3IAY A;  2HHU A;  4OO1 J;  1JXB A;  3CM6 A;  3PX0 A;  1NGA A;  5A2Q O;  1REV A;  3CJA A;  1RT2 A;  3H3O B;  1MA9 B;  4DUY K;  3FFI A;  3SQ4 A;  4NO7 A;  4DFP A;  3CG7 A;  1T05 A;  4FJG A;  1T3V A;  4B8A B;  4KTQ A;  3SBG A;  2GUP A;  4HUG A;  1EXQ A;  5JLF A;  3SUQ A;  1W2B M;  5GAE P;  5FLX O;  1BA1 A;  5AQO A;  4E1N A;  3U3Y A;  3EY1 A;  3E1Y A;  1NKB A;  4JKF A;  3HPH A;  4KV8 A;  3SK3 A;  4FLX A;  4LF7 K;  4BR4 A;  2IDO A;  3TTD A;  3ZSW A;  4B3S K;  3O5B A;  1IH7 A;  3J8A A;  4FZX C;  4A5A A;  1C1B A;  5LY3 A;  3LDS A;  3CME N;  4KI6 A;  1EWR A;  2YHY A;  3LM9 A;  2HOE A;  1VSL A;  2HBJ A;  4H0P A;  4Y0W A;  3I0S A;  2HMP A;  4CHO A;  1X1P A;  3S3N A;  5C25 A;  2XY5 A;  3TSQ A;  1S9G A;  1TKT A;  1VK0 A;  3NDK A;  2ASP A;  3QDK A;  5SZT A;  2A41 A;  4M63 C;  4B08 A;  1NOY A;  3TAG A;  1QZ5 A;  4NCG A;  3ZSV A;  1TL3 A;  1TKD A;  4ZTF A;  1NGI A;  5J1E A;  3D2F A;  3NBP A;  1RTH A;  3KLG A;  1RDA A;  3J7A P;  4H5N A;  2FSN A;  3KLE A;  5CYM A;  3PX4 A;  2G8U A;  1RT1 A;  4PY5 A;  4CIG A;  3OYL A;  4JYA K;  3SAF A;  2QXL A;  3CQ8 A;  3IS9 A;  3L2Q A;  3QBX A;  3TI0 A;  1YF5 L;  3HL8 A;  3TAR A;  1OH5 A;  2HHX A;  4EZ9 A;  3HTV A;  1EET A;  3EZ5 A;  5J2N A;  3SJH A;  5HRP A;  4K0K K;  4CZJ A;  2XO7 A;  3VEZ A;  3D2F B;  3KKS A;  2O8C A;  5AQL A;  3BF3 A;  4IBN A;  3OS0 A;  3MCA B;  4RW6 A;  4CZI A;  1DKG D;  3NGI A;  2ITG A;  2XHB A;  1GLJ O;  5GAD P;  5F0X A;  4XH1 A;  2HVH A;  1GLD G;  2QWN A;  1K8K A;  3CJ9 A;  2IAJ A;  1NG9 A;  5CE3 A;  5H1S Q;  3UIQ A;  3TAN A;  3UE5 A;  3AO1 A;  1KVC A;  3NVM A;  1J53 A;  2P1J A;  5GIP A;  3IG1 A;  3QEI A;  2DTU A;  4IJA A;  2O8C B;  1HNV A;  3KIO A;  4CEF A;  3LZI A;  4FYD A;  2CGL A;  2GBZ A;  3HVT A;  3NHG A;  5M1P A;  5ADX H;  2GV9 A;  3THW A;  4DTJ A;  1K8K B;  1NGE A;  4E89 A;  3MED A;  3L2V A;  1FXX A;  5FPE A;  3ZET A;  4DHY A;  4HHT A;  3J80 O;  3ZSY A;  1Q9Y A;  4KHP K;  1HYZ A;  4A2A A;  3ZSO A;  5AQP A;  1A5X A;  4OLB A;  3W3D A;  4C8M A;  1QSL A;  2AP1 A;  4CBX A;  3AO2 A;  4O0J A;  1HMV A;  3THW B;  4BDY A;  3AV9 A;  1NGC A;  2Q36 A;  4Z4C A;  1WSI A;  1TL1 A;  5AQG A;  4YOT A;  3WUH A;  1CXU A;  3VMF B;  1GOB A;  4K8X A;  3R1X A;  3TTC A;  4IDH A;  1C0U A;  1E4F T;  4CGH A;  2HW3 A;  1J54 A;  3F5T A;  3AVH A;  4PKI A;  4PHT X;  4JKC A;  3SMP A;  5LMU K;  1QTM A;  2HHH K;  3ID6 A;  4DB3 A;  4KBO A;  4IG3 A;  3LDP A;  3J81 O;  3HXM A;  3PO5 A;  4M3T A;  3UKR A;  4DR6 K;  4DQ8 A;  2P9P B;  3DMJ A;  4BRG A;  4AIL C;  4PL8 A;  4FWK A;  1RBR A;  2P9N A;  3CCE N;  4DQI A;  1BL3 A;  4OLA A;  3AAP A;  3AVB A;  4BWJ A;  2XY7 A;  5KQ8 A;  3KK7 A;  3S41 A;  4CJ5 A;  1N34 K;  1C1C A;  4B3R K;  4FJI A;  4Z4E A;  3AA2 A;  3OS1 A;  2UXC K;  3HP6 A;  1QZ6 A;  4FWP A;  4DV2 K;  2GUI A;  2RE2 A;  4FJM A;  4HTL A;  2YHW A;  4J2B A;  3K2P A;  1VSD A;  3QEX A;  4DQS A;  4BRE A;  4CHN A;  1QHA A;  1L3S A;  4FLV A;  3THY A;  3BP8 A;  3AVM A;  4FW1 A;  2VWB A;  3S9H A;  4DWI A;  3R8E A;  4DSE A;  2PYJ A;  2J4R A;  1A5V A;  1YIJ N;  1SUQ A;  1L3V A;  1ZC6 A;  1BCO A;  4FWM A;  3ZT1 A;  1SS6 A;  2P5O A;  4FJN A;  3ULE A;  2KKZ A;  4FWN A;  4H0X B;  3O9R A;  4LY7 A;  3OJS A;  1FW6 A;  3QFP A;  3THY B;  4M3U A;  3DOL A;  5AZJ B;  4A59 A;  4KI4 A;  1RT5 A;  1LW2 A;  5KTQ A;  5FRM A;  4DSJ A;  2Q1N A;  3QBW A;  5EY4 A;  4E7J A;  1K8A O;  3ATV A;  3TR8 A;  4BAC A;  2ZGY A;  4B9U A;  2KHO A;  3HOS A;  3E66 A;  2G8V A;  2HBL A;  3V9W A;  4BRP A;  4CJS A;  1C6V A;  3K59 A;  2GX9 A;  2FSJ A;  3O6W A;  4CZL A;  4CBU A;  5F2R A;  1T03 A;  3QML A;  1CZA N;  3OYM A;  1HNI A;  4ID1 A;  4JI3 K;  2Q31 A;  1GLL O;  3DAW A;  1C1A A;  4PL7 A;  5JS1 A;  1X3N A;  3VEY A;  2VG7 A;  4M41 A;  4K25 A;  2I5J A;  3MK6 A;  3CJ1 A;  3H1Q A;  4JKD A;  1NJI O;  3E9L A;  3WNE A;  4BVO A;  3T1H K;  3BY5 A;  1NK7 A;  1TUU A;  2RF2 A;  1RFQ A;  4CF9 A;  3NF6 A;  4BG9 A;  3AA4 A;  1X9S A;  1L5U A;  3HST B;  1BI4 A;  4YFU A;  3OYE A;  3NH2 A;  3C7N A;  1SKS A;  3KJV A;  1U48 A;  3C0B A;  3I55 N;  3HJF A;  3VTI A;  2ZE2 A;  4JKG A;  1S1U A;  1TKX A;  2EX3 A;  4DR1 K;  4J2E A;  4MDB A;  3T19 A;  1RT3 A;  1Z25 A;  2BUP A;  4CIE A;  1JLC A;  2XRI A;  2VWK A;  4M3W A;  1IBM K;  1VQK N;  4CZK A;  3B8A X;  4FL9 A;  2OCE A;  2YCH A;  1KLM A;  1T7P A;  3FZH A;  3FZM A;  5I9E B;  3ZT0 A;  3O3G A;  1XHZ A;  4FM1 A;  5F1X A;  5LL6 Z;  1BI4 B;  2QWP A;  3EZW A;  1U47 A;  4QCL A;  3VQB A;  2YHA A;  3Q7C A;  3SQ1 A;  1VSE A;  3CCR N;  3SMS A;  1NK4 A;  4JKG B;  4WE1 A;  1X9J A;  1YVN A;  1S72 N;  2HND A;  3DLR A;  4YDU A;  3OYA A;  1NGG A;  1VQ9 N;  1KVA A;  3RMC A;  5HBM A;  1L3T A;  5BPL A;  2Q3S A;  4M7Y A;  5BRE A;  2NRW A;  3SQ2 A;  4HVJ A;  3MWT A;  1JCF A;  4MLE A;  1WN7 A;  5AQQ A;  2E2O A;  2G8W A;  1B9F A;  4FK4 A;  3HP9 A;  4E0D A;  4LFC K;  3OYJ A;  3C95 A;  5AQK A;  3AVI A;  4AF1 A;  3DWL A;  4Z4F A;  1KRP A;  3C6A A;  1ESV A;  4F8R A;  3F2K A;  1YAG A;  1HQE A;  4G9Z A;  4KH6 A;  2VQF K;  2YNF A;  2O4I A;  1UAX A;  1QQC A;  1DTT A;  3V1Q A;  3TPQ A;  3A5L C;  4FJJ A;  2Z1I A;  5J2P A;  3R9P A;  1LWF A;  3B6O A;  3FFK B;  3MEG A;  4BRD A;  4JI0 K;  3FZF A;  2DFH A;  3KD5 E;  3CJ7 A;  1HNX K;  1JCE A;  3ZSZ A;  2O8F B;  3D2E A;  4O5F A;  4DU3 A;  4CGI A;  3P1G A;  4GY2 B;  4CD1 A;  5C24 A;  3LAM A;  3VA3 A;  1BOT O;  1G99 A;  1SL2 A;  3SAH A;  3HM8 A;  4M45 A;  4BRH A;  1HNW K;  3CET A;  4Q0B A;  3HM9 A;  4DR3 K;  3SUO A;  4BRA A;  2X74 A;  4C8N A;  2FSK A;  2HBM A;  3SQ0 A;  2IVP A;  3F9K A;  4ILH A;  4C1N I;  5KPT A;  4C8O A;  3MN9 A;  4CGG A;  3OYB A;  4M7X A;  4JI5 K;  1QE1 A;  2D4W A;  3RSE A;  1XNQ K;  1NU0 A;  4GNI A;  4E7L A;  3KK3 A;  3RRG A;  3O1B A;  1BIZ A;  4BVP A;  1BDG A;  2OZS A;  4CEC A;  5AZI B;  2CH6 A;  3O9Q A;  4KHS A;  4F3T A;  1UA1 A;  3VQQ A;  4DU4 A;  1C0T A;  4JHD B;  2I7P A;  3OYH A;  3K58 A;  3P4I A;  2BDP A;  3DXM B;  3VEX A;  4QOZ B;  2F8S A;  1ASU A;  3VQ5 A;  4WQ4 A;  2WON A;  2V51 B;  2YJF A;  4CBW A;  5GAG P;  1W9H A;  2OAN A;  1W7A A;  4LF9 K;  2KFZ A;  3T1A A;  1LCU A;  1XNR K;  5KI6 A;  3THX B;  4YOX A;  3ISN C;  2G8H A;  1MWM A;  3CC4 N;  1IKW A;  3NGZ A;  2NRR A;  3QNN A;  1QSY A;  2QWR A;  1HQU A;  3M8S A;  3MEC A;  5T7B A;  4E1M A;  5BR9 A;  3WQT A;  3AVK A;  4N41 A;  3LAN A;  1J5O A;  4FVU A;  2QWL A;  1NJW A;  2JLE A;  2Q2R A;  2A6A A;  5CYQ A;  4DV6 K;  2QXF A;  4IJN A;  4JRP A;  3B6P A;  5KGW A;  4JI2 K;  4YY3 K;  3VEV A;  1I94 K;  3RWU A;  2QWO A;  2Z1G A;  4CK3 A;  4NCA A;  4IWV A;  4KFB A;  3ZX3 A;  4XEI A;  2Z1H A;  3CC2 N;  2YHX A;  1RNH A;  4E1J A;  3U9Z A;  4IDK A;  3QLH A;  3ZYY X;  1VSJ A;  1X9M A;  3O80 A;  4NYN A;  2E88 A;  4KH4 A;  2F8T A;  5BRF A;  2PZS A;  1Z05 A;  3QEW A;  1YXQ A;  4KPY A;  4KHY A;  5AFU H;  3SPY A;  5M1F A;  3WXI A;  2NRX A;  3IRX A;  1HYV A;  1XHX A;  3LP0 A;  4EHU A;  3KK2 A;  1JCG A;  4BDZ A;  4DR5 K;  2O8E B;  2YKN A;  2G8F A;  1LWC A;  2KZM A;  4F2R A;  1SKW A;  4EHT A;  1CZ9 A;  1GLE G;  4R5P A;  4IOC L;  3EYZ A;  5C12 A;  4FXD A;  1BQM A;  4K43 A;  4WCE L;  4DFM A;  4DKW A;  1YUW A;  1TK8 A;  5AQI A;  5D3G A;  2W6L A;  1T6C A;  3V81 A;  1ZBH A;  3V9U A;  4CJ7 A;  5I3U A;  2X6S A;  1SQK A;  4CJP A;  1YIT N;  3A0I X;  4MLH A;  3GBT A;  4JK8 A;  4DLG A;  1XC9 A;  4FVM A;  1NK0 A;  2QKK A;  4OGE A;  3H3N O;  4W5O A;  4I6M A;  4AM7 A;  4H8K A;  2CH5 A;  3AVF A;  4YNQ A;  1NKC A;  1V4S A;  4C8L A;  3CMA N;  4MDA A;  3GOI A;  4BRQ A;  4CFD A;  3O3H A;  4O55 A;  3O1W A;  4W5T A;  3WNG A;  1HKB A;  2O8B A;  2YJE A;  3BUZ B;  3U4L A;  2GWJ A;  4J2A A;  5B8H A;  4JS4 A;  2XY8 A;  2E5L K;  1OKJ A;  1KQS M;  3RMA A;  2RPI A;  2V7Y A;  1VQ4 N;  4A2B A;  2G8I A;  3AAR A;  1XMQ K;  4A61 A;  1JLE A;  3S3M A;  5FDL A;  4KTW A;  2YKM A;  4DSL A;  2ZWH A;  3N4Q A;  2G8K A;  3AO4 A;  1RT6 A;  3KWG A;  4WFB L;  3OS2 A;  5M1N A;  3LPT A;  3HT3 A;  1NJZ A;  3EEQ A;  3TU5 A;  4IFY A;  1NNE A;  1XWL A;  1BHL A;  3ZX0 A;  3L2W A;  3WT0 A;  4BG8 A;  4CZG A;  5EX5 A;  2PBD A;  1YJW N;  4JN4 A;  3EN9 A;  5AQN A;  5JS2 A;  3PUF A;  3I8B A;  3NGY A;  1RBV A;  3P31 A;  1P8Z A;  2A40 A;  5AFU A;  1M1K O;  4FJH A;  3J7Y P;  2JWL A;  1NK9 A;  3ALY A;  4CJV A;  1VSM A;  5DMR A;  5FRN A;  4DTN A;  3LAL A;  3GG4 A;  2HHS A;  3QEV A;  4GKK K;  1NJX A;  4BQL A;  1K6Y A;  4AHT A;  4X65 K;  2HHQ A;  5HLF A;  1ILY A;  2WBN A;  4GVE A;  2E20 A;  4ELV A;  1D4X A;  4LD0 A;  4HTU A;  4AHS A;  3V9Z A;  3RR8 A;  4RG8 A;  3VEO A;  3SI6 A;  1NK6 A;  2YX6 A;  4NLB A;  1UOC A;  4W5N A;  4BDP A;  5DM7 L;  3ZSR A;  4M3Z A;  5E84 A;  1BCM A;  1VSI A;  4CJR A;  3VF4 A;  2OPP A;  2V7Z A;  1YJ9 N;  4FZZ A;  1IBL K;  1RTD A;  2WFB A;  4B1V A;  1N36 K;  4N47 A;  3QNO A;  4OPJ A;  3PO4 A;  3SYZ A;  4BE0 A;  1F21 A;  1MU2 A;  4PKG A;  2YNI A;  3ZT4 A;  4DQQ A;  4H0T B;  1HNZ K;  4CW7 B;  1UA0 A;  1VQP N;  3VQ6 A;  4O8K A;  5FRO A;  3OJU A;  3M8R A;  4PUO A;  4YOU A;  3ZET B;  4ISF A;  1WLJ A;  4CGJ A;  3ZX2 A;  3VA0 A;  2W40 A;  4IEI A;  2OTJ N;  4B9L A;  3KZB A;  3BZC A;  3AAQ A;  3JYT A;  3OYG A;  4B3T K;  4J8F A;  3WNF A;  4GV6 A;  4FW2 A;  2FBX A;  2OYQ A;  2VG5 A;  3M3Z A;  1NBW A;  4BR7 A;  5IT9 O;  1IJJ A;  3KLF A;  2VCP A;  1BUP A;  3OVN A;  3MMV A;  3G10 A;  4JI4 K;  4LH5 A;  3E01 A;  1D5A A;  4OPH A;  4XIU A;  3KKR A;  1U49 A;  2JWK A;  4DCH A;  3D0P A;  2V52 B;  1ATN A;  3OBY A;  4GKJ K;  1KFS A;  3VET A;  1HRH A;  4BC3 A;  4DU1 A;  4LSL A;  1R0A A;  3LPU A;  4C1N K;  3K0S A;  3UKR B;  1E3M A;  1UWB A;  5FPM A;  2Q97 A;  4BRF A;  4H5T A;  1VQL N;  4H03 B;  4CGD A;  1IO2 A;  4OPK A;  2P9N B;  4QS7 A;  4KKO A;  4JI7 K;  1T8E A;  2P5G A;  2WC9 A;  5BR8 K;  4JKH A;  4L3Q A;  3VF2 A;  3PIO L;  5AQW A;  5ADX A;  3V9S A;  2A1R A;  2BE2 A;  1S1V A;  1ZYQ A;  2E1Z A;  3ID8 A;  2NRT A;  3C6T A;  3VGK A;  5C42 A;  2AA4 A;  1KSP A;  3LM2 A;  3ZT3 A;  4CFA A;  3LL3 A;  3AVN A;  1W0H A;  2PFU A;  3J7Z O;  3AO5 A;  3VQA A;  1QQN A;  3DLG A;  4O5B A;  3ZSQ A;  3HBT A;  3DYA A;  4BRO A;  4B8C A;  1IBK K;  3CFR A;  4CJL A;  4WFN L;  1CXQ A;  2P9L A;  4AQY K;  4DTS A;  5TKY A;  1K73 O;  1SKR A;  3OYD A;  4AHR A;  4CED A;  3ULE B;  3HO1 A;  4DSK A;  5LMN K;  3KLH A;  2F96 A;  3DLK A;  3G4S N;  4RTF D;  1SZ2 A;  1NGF A;  4GV9 A;  1EO1 A;  1DEJ A;  2P51 A;  4KHW A;  4Y1C A;  3SBT A;  4CJK A;  3ATU A;  3ZSX A;  2GTD A;  1HKG A;  1VQN N;  1KAY A;  3AA5 X;  4KB0 A;  2HNZ A;  4NLC A;  4AH9 A;  3KK1 A;  3DRP A;  2P9L B;  2KTQ A;  3WEE A;  3OYN A;  4BC5 A;  4KHQ A;  3DLE A;  2GEL A;  3TAM A;  5AQX A;  1RDC A;  5MLC Q;  3VGL A;  4F3O A;  2UUB K;  1QVF M;  3V6D A;  3VER A;  2D0B A;  1ZBF A;  4W5Q A;  4FLY A;  4IZ9 A;  1I39 A;  5KRS A;  2NLX A;  1LOT B;  2ZQB A;  1L3U A;  4ISE A;  3CCJ N;  3AVC A;  1BQN A;  2P9K A;  2ZD1 A;  1N8R O;  4DTX A;  3WEE B;  3SPZ A;  2DY4 A;  4JD2 A;  2WTU A;  3A5O C;  1XC3 A;  3IUC A;  3E9P A;  3VQE A;  4IXC A;  1GLA G;  1Q7Y O;  1KFD A;  3RVC A;  1QQM A;  1JKH A;  2ZJP L;  5AQS A;  4E7H A;  3VGM A;  4MQ3 A;  3C7N B;  1JLG A;  3CPE A;  3MXI A;  3EE9 A;  2BAN A;  1C0M A;  4JKE A;  4BE2 A;  5JIC A;  4DFJ A;  3O4W A;  3KTQ A;  3ULD A;  4H0Y B;  4FZY A;  1QSS A;  2O4G A;  1G15 A;  3IDH A;  1S1W A;  3QIN A;  1WSF A;  3AO3 A;  2W6K A;  4O0I A;  1WSE A;  2HB5 A;  4X66 K;  4BWM A;  2UYT A;  3VES A;  4JKB A;  4J2D A;  1Q82 O;  3S3O A;  1NK8 A;  3CIP A;  4ILG B;  4WFA L;  1EWQ A;  5C2F A;  2VGM A;  1WSH A;  1HPM A;  1NK5 A;  4RW8 A;  1CZB A;  3CXC M;  3QIC A;  3CI5 A;  1EKE A;  4M42 A;  1TYQ A;  4PA1 A;  4FM2 A;  1EQY A;  4B3O A;  3CJB A;  5AQT A;  1K9M O;  1HUX A;  3L0Q A;  2Q0U A;  4FSV A;  4DV5 K;  3NFA A;  4BR5 A;  1U4B A;  3O3F A;  1KCF A;  4Z4G A;  4AHC A;  4HCB A;  2HVI A;  2BH1 A;  1B9D A;  2VG6 A;  4CHZ A;  3N4P A;  1WUA A;  4DV7 K;  5AQR A;  3KWI A;  4GVM A;  3QIP A;  4H4O A;  4IKF A;  5C15 A;  4FLW A;  1DGK N;  1JLF A;  1FJG K;  2P9U A;  3Q7B A;  4DS5 A;  2WOM A;  3I56 N;  3NF9 A;  4IG0 A;  4H0O A;  3CD6 N;  3ENO A;  3AVA A;  3QET A;  1GLF O;  1NLV A;  1TK5 A;  3V4I A;  1VHX A;  2NRH A;  4CHP A;  4WYB A;  4CCH A;  2KQ2 A;  2A1S A;  3FLC O;  3MWP A;  3D2E B;  2FC0 A;  5KPR A;  4OGC A;  4CD3 A;  4MO5 A;  3ASM A;  4DV4 K;  4E19 A;  1A5W A;  5IWA K;  2CGJ A;  4FLZ A;  2UUA K;  1ZBU A;  1IG8 A;  4CE9 A;  4RW9 A;  4F2S A;  1RDU A;  4EAH D;  3SUN A;  1SL0 A;  4BC2 A;  4MO4 A;  3CCL N;  2KLA A;  1BWF O;  5JVH L;  4NCB A;  3VOV A;  2P9S A;  4JI8 K;  2IIR A;  4DUZ K;  1KVB A;  1I3A A;  4DTP A;  1KD1 O;  1VSF A;  4YOW A;  4EP5 A;  3BEX A;  3K5M A;  4LF4 K;  1LAW A;  1OVQ A;  2EHG A;  3SAG A;  1FKO A;  1KC8 O;  5KGX A;  3I33 A;  3RSE B;  4FM0 A;  4TSX A;  4JS5 A;  3KVG A;  2B6A A;  3LWL A;  4DQP A;  3T7Z A;  4JK9 A;  2ZJR L;  4BGA A;  1CLQ A;  3AVL A;  3DM2 A;  3LDO A;  3O08 A;  4DTR A;  4JI6 K;  3U9D A;  1ZBL A;  2RN2 A;  1WBD A;  4CEE A;  4F9O A;  3T1Y K;  3HI0 A;  3P5J A;  3CM5 A;  3QIO A;  4YHH K;  3KHY A;  4KB1 A;  3NF8 A;  4JI1 K;  5BRH A;  2P9S B;  1YTU A;  3FE1 A;  2XY6 A;  1HX1 A;  3VQP A;  1TUY A;  5EU7 A;  4NXM K;  3CPW M;  4DF4 A;  4Z4H A;  3DXK A;  4O4G A;  3GDQ A;  4JAX A;  3CFP A;  1W97 L;  2E2N A;  5SWM A;  2PYL A;  3UKU A;  4OKE A;  4I9Q A;  1Y64 A;  4H4M A;  1JLQ A;  1JXE A;  3SJJ A;  1IKX A;  4B9S A;  1R59 O;  3FR0 A;  5J2Q A;  3L4I A;  1S6Q A;  3M8P A;  4CHQ A;  1Q9X A;  1WOQ A;  4BE1 A;  1NGJ A;  3PSF A;  4FJX A;  3H45 C;  1ASW A;  1NMD A;  3AVJ A;  4ISG A;  4AM6 A;  3DRR A;  1OH8 A;  4RW7 A;  2ASM A;  2NZT A;  2FBT A;  4CJW A;  4XH4 A;  2RKI A;  3H08 A;  1JLB A;  4FO0 A;  2WUS A;  5AQZ A;  2F9W A;  4DR7 K;  2HMI A;  2EWS A;  1QQO A;  1ZXO A;  3M6G A;  4L8R B;  4YDU C;  4B1X B;  3D6R A;  2R7Y A;  4ILJ A;  4FOI A;  4WQ5 A;  4BRM A;  2UUC K;  4CEB A;  3ENH A;  5GIO A;  1RBU A;  3HK2 A;  1B92 A;  2KW4 A;  4R79 A;  2FF3 B;  3CER A;  2UXD K;  4A57 A;  3TWH A;  1GOA A;  5JMV A;  5KRT A;  1BIS A;  1VSH A;  3BF1 A;  4E7I A;  3AY9 A;  3QB0 A;  2YHB A;  4FLU A;  2Z1J A;  1KTQ A;  2I7N A;  5AQF A;  2E6L A;  2ZJQ L;  4LF8 K;  2YNG A;  4OJR A;  3L3V A;  3FGU A;  4BRK A;  1V4T A;  3HVR A;  4DR2 K;  3OYI A;  5CY4 A;  4A62 A;  3KD1 E;  1RCH A;  1QVG M;  3W0L A;  4B9T A;  2HF3 A;  3BZK A;  4I6M B;  3O4N A;  4V19 S;  1OH6 A;  2IC3 A;  3MN7 A;  2QEX N;  3R6M A;  2B5J A;  2FF6 A;  1YHQ N;  5AQU A;  1JLA A;  2FBV A;  1RDD A;  3VQ9 A;  2O8B B;  3MEE A;  4DQR A;  3WNH A;  4CK2 A;  1WAJ A;  4CHY A;  1ATR A;  5K14 A;  3PLA A;  1H1V A;  3LWM A;  3U6F A;  2Q0R A;  1VQM N;  2HST A;  3DLL L;  3MDQ A;  2ITM A;  3L8B A;  4BRC A;  3WXJ A;  3HRG A;  2QKB A;  1BIU A;  4CJE A;  3NMU A;  3CCV N;  1GLC G;  3MN5 A;  4B1W B;  2D1K A;  5HL7 L;  1S22 A;  1M90 O;  4BR9 A;  2VYP A;  1HLU A;  3THV A;  1VAZ A;  5CR4 A;  3PIP L;  1GLB G;  2ATQ A;  4LF6 K;  3CHW A;  4E7K A;  1RDB A;  2YV0 X;  3OA9 A;  1XMO K;  3GL1 A;  4CF0 A;  3HOT A;  1RDW X;  4CJ3 A;  3O4Q A;  4KO0 A;  3EO3 A;  3I8D A;  3L2R A;  4BC4 A;  2QWQ A;  5DM6 L;  1NGD A;  4E3S A;  4MFB A;  5TKW A;  4N56 A;  5BPN A;  1NGB A;  1JL1 A;  1HKC A;  3OW2 M;  3HZ6 A;  2X78 A;  4WQ4 C;  3SUP A;  1IV0 A;  3RRH A;  1VSK A;  2BGG A;  3QES A;  1Q18 A;  3NH0 A;  3OYF A;  3DJC A;  4CEQ A;  5M1Q A;  4LFA K;  1YT3 A;  4CEO A;  2FXU A;  3TTF A;  1RTI A;  3C6U A;  2HHW A;  2Y1J A;  2VQE K;  3HYF A;  1T44 A;  1T6D A;  1E4G T;  4CZE A;  2QW9 A;  4A5B A;  3E9O A;  3O9T A;  5AQM A;  5LJV A;  2E2Q A;  3HPO A;  2DFF A;  1S3X A;  2NNW A;  1BU6 O;  1Z26 A;  2ZF5 O;  4G1Q A;  5I42 A;  2E4L A;  2A3Z A;  1EP4 A;  3V1O A;  4B9Q A;  2GEM A;  4I2Q A;  3G6E N;  5CHI A;  2VWJ A;  4I7F A;  1HPZ A;  1KAZ A;  4OKJ A;  1HYS A;  4B1U B;  3QER A;  2B4J A;  3K5L A;  3F9M A;  4CK1 A;  5C0Y A;  2HF4 A;  3AGK A;  4CFB A;  3SZ2 A;  4FOE A;  4CJU A;  5HRN A;  1OVY A;  1VRU A;  4FLT A;  4KH5 A;  5AR0 A;  4F4K A;  4ZHR A;  2DFE A;  4OVL A;  4JK7 A;  2QTD A;  3VQ8 A;  1TKZ A;  3L2U A;  1J9A A;  3JXU A;  3BDP A;  1YI2 N;  2P9P A;  4C8K A;  3L4Q A;  4DSF A;  3WXK A;  2IOC A;  3M5R A;  2ZGZ A;  1BO5 O;  4YOV A;  4M3X A;  3RR7 A;  1U2V A;  3ZLJ A;  3NF7 A;  3PX6 A;  3NVK A;  1RIL A;  4LSN A;  1DT9 A;  4DMN A;  1D8Y A;  3LDL A;  2E8A A;  3O9U A;  3FZK A;  4RWT A;  4U7B A;  1XQS C;  3H6E A;  1WSJ A;  3PSI A;  4CJ4 A;  1LV5 A;  2D0A A;  2FLO A;  4PKH A;  4XH5 A;  3UB5 A;  2X6N A;  3QO9 A;  4WQ5 C;  3TSP A;  4BRL A;  1IKV A;  1MDU B;  1U2V B;  4O44 A;  5ELZ A;  4N5S A;  3F73 A;  4B1Z A;  5FPN A;  3U3G A;  1WAF A;  3VF6 A;  1S1T A;  4DV0 K;  2O8D A;  4UY8 O;  3NAE A;  5BN9 A;  4BR2 A;  1Q81 O;  4AHV A;  4EFH A;  2DPN A;  2PAV A;  3P83 D;  1OH7 A;  1WBB A;  4K42 A;  5C10 A;  3C65 A;  3VQC A;  4DFK A;  4JV5 K;  4DTO A;  1SAZ A;  2HHT A;  4LF5 K;  4DS4 A;  2KZZ A;  1YVU A;  2D0C A;  3LAK A;  1VQO N;  4H5R A;  5EOY A;  4GMJ B;  5EVZ A;  2NRZ A;  4FJ9 A;  3JS6 A;  2GWK A;  1RTJ A;  4CZF A;  3JSM A;  2PY5 A;  3AA3 A;  5AZJ A;  1LW0 A;  3JAM O;  2W42 A;  2O8D B;  4CZH A;  3EL2 A;  3CFO A;  3MX5 A;  4CGF A;  3T3F A;  3PV8 A;  4FJ5 A;  4DTU A;  1RT7 A;  3DRS A;  3L3U A;  4B1Y B;  3ZEU A;  2KFN A;  3L6Q A;  4IOA L;  3CQY A;  1FK9 A;  2YI1 A;  2IVO A;  4FWS A;  1J6Z A;  4YOY A;  3G71 N;  4DG1 A;  2ASO A;  3GE1 A;  2JGU A;  3CYM A;  4CJF A;  3KLI A;  3OHR A;  3G0Z A;  3VPZ A;  5M1K A;  3LZJ A;  4NXN K;  4K8Z A;  4CI6 A;  4QS9 A;  5E41 A;  1N6Q A;  3D7E O;  2QM1 A;  4JEP A;  2E1Y A;  2D0P A;  4U67 L;  1BGX T;  5AJ3 K;  4ICL A;  3EKS A;  2QK9 A;  3OYC A;  4KRF A;  3ZEU B;  4DV1 K;  3MCP A;  4HWI A;  4BQZ A;  4IFV A;  1S1X A;  3CF5 L;  4FJ8 A;  3MX2 A;  4M3R A;  2IS3 A;  3LP2 A;  4O8U A;  3CCU N;  4KHU A;  3ITH A;  4IFE A;  3K9K A;  3LP1 A;  3SLC A;  3T69 A;  4BGB A;  3VQ7 A;  4KAZ A;  4FPA A;  4Q5V A;  4CER A;  3CQX A;  4WF9 L;  1S6P A;  2CGK A;  4ELT A;  1RBS A;  3LDQ A;  1O13 A;  1P90 A;  1WNS A;  2Y1I A;  3CCS N;  3IKM A;  1Y97 A;  2OPS A;  4UQG A;  3A5M C;  1QHT A;  4JRQ A;  3V1R A;  3K9J A;  5HRO A;  4KRE A;  5AQY A;  4DV3 K;  3RMD A;  3MXJ A;  4RCH A;  4LH4 A;  2E6M A;  1FKP A;  2F9T A;  5GIN A;  3CCQ N;  1SL1 A;  3MXM A;  2HBK A;  5FPD A;  3CC7 N;  1RBT A;  3SV3 A;  4B9M A;  4CIF A;  1RGI A;  1TK0 A;  2OA8 A;  1VRT A;  4DF8 A;  3SV4 A;  3PY8 A;  1J5E K;  1VQ8 N;  3A2F A;  4CZM A;  4K41 A;  3DLB A;  3DLH A;  4AHU A;  4KHN A;  4IO9 L;  2P9K B;  4FK2 A;  3A8Y A;  1RT4 A;  4JD2 B;  1KAX A;  4OPA A;  4FWQ A;  3DI6 A;  2HNY A;  4CVN E;  1BA0 A;  1ITG A;  4DSI A;  2W41 A;  4IOX A;  4EP4 A;  3BGR A;  3OBW A;  2RHK A;  3NH1 A;  4FPB A;  4NB4 A;  1XI1 A;  1U04 A;  2UU9 K;  4X64 K;  4Z0U A;  3OY9 A;  3AGR A;  3ENB A;  3VEW A;  1DLO A;  1X9W A;  1NKE A;  2A5X A;  2A42 A;  2D0O A;  3HPG A;  5BN8 A;  2OZM A;  1D9F A;  1S9E A;  3WXM B;  4Y1D A;  1VQ5 N;  3V9X A;  3G25 A;  4FWR A;  3SNN A;  4CES A;  1C0G A;  3P39 A;  3VTH A;  3ZT2 A;  4B9V A;  2O8F A;  4ID5 A;  5CZ2 A;  4CEA A;  4YOR A;  1TGO A;  2D5R A;  1NJY A;  4H5W A;  1X3M A;  5LJW A;  4H5V A;  1JJ2 M;  3NCI A;  1TYQ B;  2OPQ A;  4JNE A;  1WSG A;  4ZTJ A;  4DR4 K;  3QFU A;  3VEN A;  4FWL A;  1HR0 K;  5KQD A;  4LC9 B;  5DK5 A;  3AVG A;  5AQV A;  2IVN A;  3OTO K;  3TAE A;  2VGN A;  4CEZ A;  4CFC A;  4B3M K;  3HSC A;  2IGI A;  1LAV A;  4CJQ A;  2NRV A;  2E2P A;  4PQU A;  4NYF A;  4BR0 A;  4QAG A;  4CJT A;  4FK0 A;  2P9U B;  2OTL N;  3QEP A;  1SV5 A; 
#chains in the Genus database with same CATH homology
 4I2P A;  1UA0 A;  2ETJ A;  4E7I A;  2VG7 A;  2YHB A;  4M41 A;  3TAB A;  4FLU A;  3VQ6 A;  2AJQ A;  4CF2 A;  2Z1J A;  3K5N A;  5FRO A;  2I5J A;  1KTQ A;  3OJU A;  5HRS A;  2E6L A;  2LSN A;  3M8R A;  3WNE A;  4PUO A;  2YNG A;  1YTA A;  4OJR A;  4HUE A;  3L3V A;  1Q8I A;  4JLH A;  1NK7 A;  2RF2 A;  4CF9 A;  1WLJ A;  3HVR A;  3OYI A;  5CY4 A;  4CGJ A;  3K57 A;  3NF6 A;  3VA0 A;  5HRR A;  5HP1 A;  3KD1 E;  1RCH A;  3AA4 A;  1X9S A;  1L5U A;  3NE6 A;  4ELU A;  3C94 A;  4B9L A;  3HST B;  4B9T A;  1BI4 A;  4YFU A;  3OYE A;  1DTQ A;  3NH2 A;  3O4N A;  3ZT4 A;  3JYT A;  4FCY A;  1SKS A;  3KJV A;  3RMB A;  1U48 A;  3HJF A;  3I0R A;  3OYG A;  2IC3 A;  2ZE2 A;  3WNF A;  1S1U A;  4RW4 A;  1TKX A;  2EX3 A;  2FBX A;  4FW2 A;  2VG5 A;  2OYQ A;  3T19 A;  4J2E A;  2B5J A;  3M8Q A;  1RT3 A;  1Z25 A;  4CIE A;  1JLA A;  1HJR A;  3KLF A;  1U45 A;  1JLC A;  2FBV A;  2XRI A;  1RDD A;  3OVN A;  1TAQ A;  2VWK A;  3VQ9 A;  4M3W A;  3G10 A;  3MEE A;  4DQR A;  1ASV A;  3WNH A;  4LH5 A;  4CK2 A;  3E01 A;  1TVR A;  1D5A A;  1IKY A;  1WAJ A;  4CHY A;  1KLM A;  5K14 A;  4XIU A;  1T7P A;  3LWM A;  3KKR A;  3U6F A;  1U49 A;  3ZT0 A;  3D0P A;  3O3G A;  1XHZ A;  4FM1 A;  1BI4 B;  3L8B A;  4FJK A;  1KFS A;  1HRH A;  1U47 A;  1QS4 A;  4Z4I A;  4QCL A;  3VQB A;  2YHA A;  4DU1 A;  3SQ1 A;  4LSL A;  4HUF A;  1VSE A;  4FJL A;  2QKB A;  1NK4 A;  1BIU A;  4WE1 A;  3VQD A;  1R0A A;  3LPU A;  4CJE A;  2HHV A;  1NOZ A;  2HND A;  3DLR A;  3OYK A;  3TAP A;  4B9N A;  4OKK A;  4N76 A;  1UWB A;  3OYA A;  1KVA A;  3RMC A;  5HBM A;  1N5Y A;  1L3T A;  2Q3S A;  1IO2 A;  4CGD A;  4OPK A;  4CF8 A;  4KKO A;  3VQ4 A;  4HVJ A;  3SQ2 A;  4EZ6 A;  1KLN A;  3THV A;  1T8E A;  2P5G A;  1WN7 A;  1LWE A;  2ATQ A;  3DOK A;  4FJ7 A;  4E7K A;  1RDB A;  2G8W A;  2YV0 X;  3LP3 A;  3V9S A;  1B9F A;  1S5J A;  4CF0 A;  4FK4 A;  2A1R A;  3HP9 A;  4CJ3 A;  2BE2 A;  2FBY A;  4DLE A;  4I9L A;  5CZ1 A;  3O4Q A;  1S1V A;  4KO0 A;  3OYJ A;  3C95 A;  1ZYQ A;  4E0D A;  3AVI A;  3I8D A;  3L2R A;  4Z4F A;  4DTM A;  4CF1 A;  3C6T A;  1KRP A;  1IG9 A;  4M3Y A;  5C42 A;  4F8R A;  1KSP A;  3ZT3 A;  4CFA A;  1HQE A;  3AVN A;  4E3S A;  4MFB A;  1W0H A;  4W5R A;  2YNF A;  3AO5 A;  4N56 A;  2OPR A;  3K5O A;  2O4I A;  3VQA A;  3DLG A;  1TAU A;  4O5B A;  3ZSQ A;  1UAX A;  1EX4 A;  1O1W A;  1JL1 A;  1GOC A;  1QQC A;  3DYA A;  4B8C A;  1TV6 A;  2X78 A;  3SUP A;  3CFR A;  1DTT A;  4CJL A;  4PWD A;  3RRH A;  1VSK A;  3V1Q A;  3QES A;  2BGG A;  2NUB A;  3NH0 A;  3OYF A;  1CXQ A;  3D45 A;  1JL2 A;  4CEQ A;  4FJJ A;  1YT3 A;  5J2M A;  4GW6 A;  4CEO A;  1RTI A;  3C6U A;  2HHW A;  2YNH A;  4DTS A;  2Y1J A;  2Z1I A;  3HYF A;  4KTZ A;  1D9D A;  1SKR A;  3OYD A;  5J2P A;  4AHR A;  4CED A;  3MAQ A;  1LWF A;  4HCC A;  3TAF A;  3B6O A;  3MEG A;  3HO1 A;  4DSK A;  3HPO A;  2DFF A;  3KLH A;  2DFH A;  3TAQ A;  2F96 A;  1ZBI A;  3KD5 E;  3DLK A;  3VN5 A;  1Z26 A;  4G1Q A;  3SCX A;  3RTV A;  3ZCM A;  5I42 A;  2E4L A;  3ZSZ A;  3IAY A;  2HHU A;  1EP4 A;  3V1O A;  4DU3 A;  4CGI A;  2P51 A;  3P1G A;  1JXB A;  4I2Q A;  3CM6 A;  3PX0 A;  4Y1C A;  4KHW A;  4CJK A;  5C24 A;  1REV A;  1RT2 A;  3SQ4 A;  3ZSX A;  3FFI A;  3LAM A;  3VA3 A;  4DFP A;  3CG7 A;  2VWJ A;  1T05 A;  4FJG A;  3AA5 X;  1SL2 A;  4I7F A;  1HPZ A;  4B8A B;  4KB0 A;  2HNZ A;  4KTQ A;  4HUG A;  1EXQ A;  4M45 A;  4AH9 A;  3KK1 A;  4OKJ A;  3DRP A;  3SUQ A;  3QER A;  1HYS A;  2KTQ A;  3OYN A;  4Q0B A;  3HM9 A;  3SUO A;  2B4J A;  3K5L A;  4KHQ A;  4E1N A;  4CK1 A;  3U3Y A;  3EY1 A;  2X74 A;  3DLE A;  4CFB A;  3TAM A;  4C8N A;  3SZ2 A;  1NKB A;  4CJU A;  3SQ0 A;  3F9K A;  5HRN A;  1VRU A;  4FLT A;  1RDC A;  3HPH A;  4F4K A;  4ZHR A;  2DFE A;  4KV8 A;  4OVL A;  4F3O A;  3VQ8 A;  4FLX A;  1TKZ A;  3V6D A;  3L2U A;  2IDO A;  2D0B A;  4C8O A;  1ZBF A;  4W5Q A;  1J9A A;  3ZSW A;  4CGG A;  3OYB A;  4FLY A;  3BDP A;  4C8K A;  1IH7 A;  4DSF A;  4FZX C;  1I39 A;  1QE1 A;  1C1B A;  2IOC A;  5KRS A;  2ZQB A;  3LDS A;  4M3X A;  4KI6 A;  3RR7 A;  1L3U A;  3NF7 A;  3PX6 A;  1RIL A;  3AVC A;  1BQN A;  4LSN A;  2ZD1 A;  4E7L A;  4DTX A;  1VSL A;  3KK3 A;  3RRG A;  3I0S A;  3SPZ A;  2DY4 A;  4DMN A;  4CHO A;  1BIZ A;  1X1P A;  2OZS A;  3S3N A;  4CEC A;  5C25 A;  3VQE A;  2XY5 A;  1S9G A;  1KFD A;  1D8Y A;  4KHS A;  4F3T A;  1UA1 A;  1TKT A;  1VK0 A;  3VQQ A;  3NDK A;  1C0T A;  4DU4 A;  3OYH A;  1JKH A;  3K58 A;  2BDP A;  5SZT A;  1WSJ A;  2F8S A;  4QOZ B;  1ASU A;  3VQ5 A;  4CJ4 A;  4E7H A;  4B08 A;  2WON A;  4MQ3 A;  1LV5 A;  1NOY A;  2D0A A;  1JLG A;  3TAG A;  3MXI A;  4NCG A;  3ZSV A;  2BAN A;  2X6N A;  3QO9 A;  1C0M A;  1IKV A;  1TL3 A;  4ZTF A;  1TKD A;  1W9H A;  5J1E A;  3NBP A;  1RTH A;  4O44 A;  3T1A A;  3KLG A;  4BE2 A;  2KFZ A;  5KI6 A;  4N5S A;  3F73 A;  3U3G A;  4DFJ A;  3ISN C;  1WAF A;  2G8H A;  1RDA A;  1S1T A;  3KTQ A;  1IKW A;  3KLE A;  2G8U A;  5CYM A;  3ULD A;  3NGZ A;  3NAE A;  1RT1 A;  3PX4 A;  4PY5 A;  4CIG A;  3OYL A;  3QNN A;  1QSY A;  1HQU A;  4AHV A;  3M8S A;  3MEC A;  5T7B A;  4E1M A;  4FZY A;  3P83 D;  1QSS A;  2O4G A;  3AVK A;  1G15 A;  3CQ8 A;  4N41 A;  1S1W A;  3IS9 A;  3QIN A;  1WSF A;  3LAN A;  3L2Q A;  3AO3 A;  3VQC A;  1J5O A;  4DFK A;  1NJW A;  2JLE A;  5CYQ A;  4O0I A;  4DTO A;  3TI0 A;  2HHT A;  4DS4 A;  3HL8 A;  1WSE A;  2HB5 A;  2QXF A;  4BWM A;  3TAR A;  2KZZ A;  1YVU A;  2D0C A;  3B6P A;  3LAK A;  4JRP A;  5KGW A;  2HHX A;  4EZ9 A;  5J2N A;  1EET A;  3EZ5 A;  4GMJ B;  3S3O A;  1NK8 A;  4J2D A;  5HRP A;  4FJ9 A;  2XO7 A;  1WSH A;  3RWU A;  1NK5 A;  1RTJ A;  1CZB A;  3KKS A;  2Z1G A;  4RW8 A;  4CK3 A;  3JSM A;  4NCA A;  2PY5 A;  3AA3 A;  4KFB A;  1EKE A;  2Z1H A;  4IBN A;  4M42 A;  1LW0 A;  1RNH A;  4PA1 A;  4FM2 A;  3OS0 A;  2W42 A;  4B3O A;  4RW6 A;  4IDK A;  3NGI A;  3QLH A;  1VSJ A;  2ITG A;  3NFA A;  2XHB A;  3CFO A;  1U4B A;  3O3F A;  1X9M A;  4CGF A;  3T3F A;  2HVH A;  1KCF A;  3PV8 A;  4FJ5 A;  4Z4G A;  4NYN A;  4DTU A;  1RT7 A;  3DRS A;  3L3U A;  4AHC A;  2F8T A;  4HCB A;  2IAJ A;  2HVI A;  2PZS A;  1B9D A;  2VG6 A;  2KFN A;  4CHZ A;  3QEW A;  3UIQ A;  1FK9 A;  4KPY A;  4KHY A;  3SPY A;  3TAN A;  3AO1 A;  1KVC A;  3IRX A;  1J53 A;  1HYV A;  2P1J A;  4GVM A;  3QIP A;  4H4O A;  1XHX A;  3LP0 A;  3IG1 A;  4DG1 A;  4IKF A;  2JGU A;  3CYM A;  3QEI A;  2DTU A;  4CJF A;  3KK2 A;  1HNV A;  3KLI A;  3KIO A;  4CEF A;  3LZI A;  4BDZ A;  3G0Z A;  2YKN A;  4FYD A;  3LZJ A;  4FLW A;  2G8F A;  1LWC A;  2GBZ A;  2KZM A;  1JLF A;  4F2R A;  4K8Z A;  3HVT A;  1SKW A;  1CZ9 A;  3NHG A;  4DS5 A;  5E41 A;  2GV9 A;  4R5P A;  1N6Q A;  3EYZ A;  2WOM A;  4DTJ A;  1BGX T;  4FXD A;  1BQM A;  4E89 A;  3NF9 A;  4ICL A;  3MED A;  4DFM A;  3L2V A;  3OYC A;  1TK8 A;  2QK9 A;  4IG0 A;  1FXX A;  5D3G A;  4KRF A;  3V81 A;  3AVA A;  3QET A;  3V9U A;  1ZBH A;  4IFV A;  1S1X A;  5I3U A;  1TK5 A;  3V4I A;  4HHT A;  2X6S A;  3ZSY A;  4M3R A;  1Q9Y A;  4FJ8 A;  1HYZ A;  4CJP A;  2IS3 A;  4B9M A;  3LP2 A;  4DLG A;  1XC9 A;  4FVM A;  1NK0 A;  2QKK A;  4OGE A;  4KHU A;  3ITH A;  3LP1 A;  4CHP A;  3ZSO A;  4W5O A;  4CCH A;  1A5X A;  2KQ2 A;  2A1S A;  4OLB A;  4C8M A;  3VQ7 A;  4KAZ A;  4H8K A;  1QSL A;  3AVF A;  4Q5V A;  4YNQ A;  1NKC A;  3AO2 A;  4CER A;  2FC0 A;  4O0J A;  4C8L A;  1HMV A;  4OGC A;  4BDY A;  3ASM A;  1S6P A;  3AV9 A;  4O55 A;  4CFD A;  4Z4C A;  3O3H A;  4W5T A;  4E19 A;  1A5W A;  4ELT A;  4FLZ A;  1RBS A;  1ZBU A;  3WNG A;  1WSI A;  1TL1 A;  4CE9 A;  4RW9 A;  1CXU A;  4F2S A;  1GOB A;  1WNS A;  2Y1I A;  4K8X A;  3SUN A;  1C0U A;  4CGH A;  2HW3 A;  1Y97 A;  4J2A A;  1SL0 A;  2OPS A;  4UQG A;  4JS4 A;  1QHT A;  4JRQ A;  3V1R A;  5HRO A;  4KRE A;  2XY8 A;  3RMD A;  1J54 A;  3RMA A;  2RPI A;  4NCB A;  3AVH A;  3MXJ A;  4LH4 A;  2E6M A;  1FKP A;  1QTM A;  2G8I A;  1KVB A;  1I3A A;  4DTP A;  4IG3 A;  1VSF A;  3MXM A;  4EP5 A;  3HXM A;  3K5M A;  1SL1 A;  1LAW A;  1JLE A;  1RBT A;  2EHG A;  3SV3 A;  4CIF A;  5FDL A;  3S3M A;  1TK0 A;  1FKO A;  3DMJ A;  4KTW A;  2YKM A;  4AIL C;  2OA8 A;  1VRT A;  5KGX A;  4DF8 A;  3SV4 A;  3PY8 A;  4DSL A;  3A2F A;  1RBR A;  3AO4 A;  1RT6 A;  2G8K A;  4FM0 A;  3OS2 A;  4TSX A;  4JS5 A;  4DQI A;  1BL3 A;  3DLB A;  3LWL A;  2B6A A;  3LPT A;  3DLH A;  4DQP A;  4AHU A;  4OLA A;  3AVB A;  4BWJ A;  2XY7 A;  3HT3 A;  4KHN A;  4FK2 A;  1NJZ A;  1CLQ A;  3AVL A;  1RT4 A;  4CJ5 A;  3DM2 A;  4DTR A;  4IFY A;  1C1C A;  1XWL A;  1BHL A;  4FJI A;  4Z4E A;  3AA2 A;  3OS1 A;  1ZBL A;  2RN2 A;  3L2W A;  4CEE A;  3PO5 A;  3HP6 A;  3P5J A;  3DI6 A;  3CM5 A;  3QIO A;  2HNY A;  4DQQ A;  4KB1 A;  3NF8 A;  1YTU A;  2XY6 A;  1ITG A;  4DSI A;  2GUI A;  4EP4 A;  3VQP A;  5JS2 A;  5EU7 A;  3BGR A;  4DF4 A;  3PUF A;  4Z4H A;  3NH1 A;  4FJM A;  3NGY A;  4J2B A;  4O4G A;  1RBV A;  3K2P A;  3CFP A;  5SWM A;  1VSD A;  3QEX A;  4DQS A;  2PYL A;  4OKE A;  4I9Q A;  4CHN A;  1XI1 A;  4H4M A;  1JLQ A;  4FJH A;  1L3S A;  4FLV A;  1JXE A;  3SJJ A;  3AVM A;  4FW1 A;  1IKX A;  1U04 A;  3ALY A;  1NK9 A;  4CJV A;  1VSM A;  3S9H A;  5DMR A;  4Z0U A;  3OY9 A;  4B9S A;  4DWI A;  5FRN A;  4DTN A;  3LAL A;  4DSE A;  5J2Q A;  2HHS A;  1DLO A;  1X9W A;  1NKE A;  3QEV A;  2PYJ A;  1A5V A;  1NJX A;  3M8P A;  1S6Q A;  4CHQ A;  1Q9X A;  1K6Y A;  4AHT A;  2HHQ A;  4BE1 A;  5HLF A;  1SUQ A;  4FJX A;  3HPG A;  1L3V A;  1ASW A;  3AVJ A;  2OZM A;  1D9F A;  4ELV A;  1BCO A;  3ZT1 A;  3DRR A;  1S9E A;  4Y1D A;  4LD0 A;  4HTU A;  4RW7 A;  2P5O A;  4AHS A;  3V9X A;  4FJN A;  2FBT A;  4CJW A;  3V9Z A;  3RR8 A;  3SNN A;  2RKI A;  4CES A;  4RG8 A;  3SI6 A;  4LY7 A;  1NK6 A;  3OJS A;  1UOC A;  4W5N A;  4BDP A;  3H08 A;  3ZT2 A;  4B9V A;  1JLB A;  4ID5 A;  5CZ2 A;  4CEA A;  4M3U A;  1TGO A;  2D5R A;  3ZSR A;  1NJY A;  4M3Z A;  3DOL A;  4KI4 A;  3NCI A;  1RT5 A;  1LW2 A;  1BCM A;  5KTQ A;  4DSJ A;  5FRM A;  2OPQ A;  1VSI A;  4E7J A;  4CJR A;  2HMI A;  4M3T A;  4ZTJ A;  1WSG A;  3TR8 A;  4BAC A;  2OPP A;  4B9U A;  4L8R B;  5DK5 A;  4FZZ A;  3AVG A;  2R7Y A;  2G8V A;  4CEB A;  3V9W A;  1RTD A;  3TAE A;  4CJS A;  4CEZ A;  4CFC A;  1C6V A;  3K59 A;  4N47 A;  1RBU A;  3QNO A;  4OPJ A;  3HK2 A;  1B92 A;  2IGI A;  2KW4 A;  3SYZ A;  1LAV A;  3PO4 A;  4CJQ A;  4PQU A;  4BE0 A;  1F21 A;  1T03 A;  1MU2 A;  4NYF A;  4QAG A;  3OYM A;  4CJT A;  3TWH A;  1HNI A;  4ID1 A;  1GOA A;  4FK0 A;  5KRT A;  1C1A A;  5JS1 A;  3QEP A;  1SV5 A;  2YNI A;  1BIS A;  1VSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...