1LAWA

Stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYIRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization of Escherichia coli ribonuclease HI by cavity-filling mutations within a hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords RIBONUCLEASE H
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lawA00
1QSYA 3OYEA 3AVFA 4JLHA 3OYGA 2OYQA 1VSDA 4WE1A 4LD0A 4M3XA 3AA5X 4DMNA 1TKXA 3NF6A 2Y1IA 4Q5VA 4EP4A 4DU3A 1NK4A 4FLXA 1R0AA 4UQGA 3SYZA 4OPKA 3ZSZA 3KLFA 2OZMA 4KB0A 5FRMA 1UAXA 1W0HA 5J1EA 4CECA 1BCOA 1L3UA 1C1AA 4CJSA 1L5UA 2PZSA 1VSKA 4E7LA 4F4KA 2X6SA 4CEBA 1VSMA 4M3UA 4CGDA 5EU7A 3AA2A 3DLEA 1RBSA 1NOYA 4B9VA 1U45A 3ZT4A 2G8HA 4J2AA 1JLCA 3V6DA 4Z4FA 2JLEA 4DSKA 4LH4A 2HHUA 4KFBA 4DQIA 3WNHA 3V9UA 3B6PA 3OYJA 2IOCA 1ASWA 1TKDA 3KK2A 4RW4A 5I3UA 3ZSWA 3F9KA 4N41A 4F2RA 2HVIA 1W9HA 3OYBA 1HJRA 5SWMA 2RKIA 2OZSA 1C6VA 1NK0A 1L3TA 1F21A 3SQ1A 1D9DA 4HTUA 4DTRA 1RDCA 4HCCA 4O0IA 4E7JA 1S1XA 1HMVA 4OKEA 3TWHA 3PX0A 1N6QA 4FJNA 3KKSA 4ZTJA 4H4MA 3SUNA 1IO2A 3SV4A 3KD1E 2VG5A 3ITHA 4M42A 4RG8A 4CJQA 3HJFA 1WN7A 4E7IA 1NK7A 1L3SA 4OGCA 4FJLA 3K57A 1NK8A 3DM2A 1CXUA 1UWBA 3OYAA 4FM2A 3OJUA 3L2RA 3MXMA 3S3MA 1YVUA 3ZSQA 1T05A 1ASUA 1NJWA 3HPHA 1LV5A 2YNHA 4ICLA 1WSEA 3NH0A 3ZSVA 4CJ3A 3SQ0A 1SKRA 2ZE2A 2Q3SA 3T1AA 4PWDA 4BE1A 1RBRA 3RR8A 4RW9A 1VSLA 4DTUA 3QEVA 1WSHA 3L3UA 4BDYA 3SUOA 4E0DA 1HNIA 2E4LA 4GW6A 4CF0A 2FC0A 4KHNA 1LW2A 1ZBIA 3PV8A 4IFVA 4CF9A 3K5MA 1IKVA 3IG1A 3P83D 1RT7A 1IH7A 5D3GA 5T7BA 4HUGA 1B9FA 2A1SA 3F73A 4O44A 3SUQA 3L2UA 1S1VA 3KLIA 4CGFA 2BE2A 4K8ZA 1S6QA 3RR7A 4AHVA 3AO4A 4CGHA 4CJ5A 3V9WA 3VN5A 2E6LA 2RPIA 1DTTA 4CERA 4DLEA 3U6FA 4DQPA 5FROA 2HHSA 3AVMA 1BGXT 4JRQA 1VSJA 2XY8A 4JS4A 4MFBA 1I3AA 1DLOA 3U3YA 1RCHA 3TAGA 3M8SA 4O5BA 1T03A 2RN2A 3IS9A 1G15A 2G8UA 4KKOA 4OJRA 3VQ7A 4M41A 3ULDA 2OPPA 4N47A 3I0SA 2OPQA 4BACA 4QOZB 2ITGA 3AO3A 3IRXA 1N5YA 3RMCA 1X9WA 4CEOA 2KFNA 3KLEA 3VQDA 3S9HA 3QETA 2XY5A 2E6MA 4EZ9A 1JL1A 1RBUA 4FVMA 4DQSA 3KIOA 1WSIA 3OS1A 4DG1A 3QERA 1UOCA 1HPZA 4O55A 1J5OA 3AVAA 1MU2A 4OGEA 4CJKA 4HCBA 1C1BA 3HSTB 3NAEA 2IDOA 3LANA 4YNQA 2YKNA 2FBYA 4F2SA 4KAZA 4CJ4A 1S1WA 3ZSOA 1LAVA 4O4GA 4CFAA 4FLZA 4O0JA 4FXDA 3VQBA 5C24A 3AO5A 4M3RA 2Z1JA 1ITGA 4FJHA 3TAMA 2F8TA 2GV9A 3CFPA 2XO7A 1LWCA 3C95A 1RT5A 1C0TA 3OYDA 4FM0A 1L3VA 3OYKA 4KREA 1BCMA 3DLGA 1D8YA 5J2NA 4KO0A 2A1RA 1VSFA 2YHAA 4DFMA 3V1OA 4W5TA 4G1QA 4DU1A 2QKBA 3PUFA 4CEDA 3CFRA 3DOLA 5HBMA 3B6OA 4CHNA 3O4NA 3PX4A 1TAQA 4KHSA 3KJVA 1KVAA 4AHCA 4CJRA 1Q9XA 4ID5A 4JS5A 4E1NA 2OPRA 2HHXA 1REVA 3WNGA 4Z4CA 2R7YA 4DU4A 1Q9YA 3SNNA 4DSFA 3QESA 3VQ5A 4F3TA 4CFDA 3KK3A 3SV3A 3NH2A 1JL2A 4FLWA 2XY6A 5KI6A 3O4QA 4CESA 1TKTA 4Z0UA 4KHQA 1BI4A 1LAWA 1QSSA 5HP1A 1JLEA 3FFIA 4DWIA 4NCBA 1LWFA 4IBNA 3AA4A 3OVNA 3QEIA 2IAJA 3TABA 2DY4A 3P1GA 3AVBA 4KHWA 3JYTA 5CYQA 4FJJA 1HYVA 1S6PA 4R5PA 4CJFA 3OYIA 1ZBLA 4N5SA 4DFJA 4FW2A 5CY4A 4I9LA 1HQUA 4B9MA 5HRNA 4CGGA 3MXIA 1BIZA 5CZ2A 3QNNA 2OA8A 3DI6A 1TL3A 4FCYA 4J2EA 3RMDA 3LP0A 3P5JA 4EZ6A 4Z4GA 3OS0A 2DFFA 2HNYA 3A2FA 3MEEA 4NYFA 4BE2A 4FK2A 1QTMA 4FJ8A 3K5NA 3HM9A 1VSIA 4KRFA 1U04A 4AHUA 2RF2A 4B9LA 2HMIA 3CYMA 3V9SA 3QLHA 4NCGA 2EHGA 4JRPA 2LSNA 4FLTA 1WSGA 2O4IA 5J2MA 2P1JA 3U3GA 5E41A 1Z25A 3BGRA 4Z4HA 1BL3A 2P51A 3M8QA 1VK0A 4PQUA 1S1TA 2PYJA 2WONA 2FBTA 1NJXA 1EKEA 1RT2A 1ZBFA 3VQEA 3ZT0A 4FZYA 4CK3A 3EY1A 3AVLA 3AV9A 1D9FA 4CIGA 2X78A 4CEQA 1CZBA 1TK5A 4XIUA 4DSLA 1TGOA 3WNEA 1BI4B 4FJKA 1U48A 4KI6A 5HRRA 3ZT1A 3O3HA 3AVJA 5CYMA 4FW1A 4CEZA 1QSLA 3OYLA 3LZIA 1U49A 4FJ7A 3VQ9A 3DLRA 4CGIA 3NF9A 5HROA 5KGWA 3T19A 3SQ2A 1UA0A 3LP2A 4FLUA 1TK0A 3TR8A 3SQ4A 4FZXC 1TAUA 3OYMA 3DMJA 2FBVA 3HYFA 3CFOA 1RT4A 4DSEA 1GOCA 3LP1A 3OJSA 4M3TA 3NGYA 2XRIA 3BDPA 2KTQA 2KQ2A 2Z1HA 3L2QA 4E7HA 2HB5A 5I42A 3VQ6A 1NK9A 1FKOA 3NF8A 3QIPA 2Y1JA 4B9TA 2O4GA 1NK6A 4B8AB 3OY9A 4HHTA 1NJZA 1C0MA 3D45A 2VG6A 4CJWA 1IKXA 3EYZA 1JXBA 1XWLA 4I2QA 3K5OA 3M8RA 3TAEA 4DTPA 3UIQA 3LALA 4DLGA 2QXFA 4YFUA 3VQAA 4N56A 1RDBA 4KTWA 4ELVA 2YNGA 2ATQA 3RRGA 2VWKA 1QE1A 5DMRA 5K14A 3ZSYA 4CHOA 3LWMA 4KPYA 4AHTA 2KZMA 1ASVA 4KV8A 4L8RB 4FJ9A 2BGGA 2KZZA 3AO2A 4FJXA 1A5WA 4ZTFA 3V1RA 1RBTA 3V81A 1JLQA 3C6TA 1JLAA 2HHWA 3K58A 1YTAA 4DTJA 3RRHA 3JSMA 2GBZA 1EXQA 4C8LA 1JLBA 3LAMA 3VQCA 5SZTA 4DF4A 1BQMA 3AA3A 3AVGA 4NCAA 2Z1IA 2DFEA 3PO4A 1JLFA 4B9UA 4F3OA 4FK4A 1JLGA 3MEGA 5C42A 2D0CA 2WOMA 4HUFA 1VSHA 3NE6A 3S3OA 3T3FA 4PY5A 4ELTA 1CXQA 1XC9A 1KTQA 4RW8A 1BISA 3ASMA 4AHSA 5C25A 3E01A 4QCLA 4CFBA 2BANA 1U47A 3G10A 4GVMA 3MEDA 1S9EA 4CF2A 3EZ5A 1YTUA 3KLGA 2VWJA 4KB1A 4FLVA 1RTJA 1EP4A 1TKZA 3HO1A 1SUQA 3SI6A 3TAQA 3QIOA 4CHZA 4DTOA 3O3GA 4I9QA 2HVHA 2HW3A 4QAGA 4KI4A 3HVRA 4IDKA 5KRSA 3NCIA 1HRHA 3QEXA 3CM6A 3HK2A 2HNDA 4PUOA 1LWEA 1LW0A 4Y1DA 4W5OA 3KTQA 4E19A 4HUEA 3HP9A 1KFDA 3DYAA 3I8DA 1WSJA 4BE0A 3MECA 1IKYA 4CE9A 3NF7A 1FK9A 4Z4IA 5JS1A 3SJJA 4FJMA 1WAJA 3K2PA 3LP3A 3L2VA 4CHYA 4ZHRA 4CJEA 3IAYA 4M3WA 2D5RA 2ZD1A 1T7PA 3KKRA 4CF1A 3NH1A 3HXMA 2W42A 1RTDA 4E89A 4OKJA 4J2BA 3AVNA 4DFKA 2B6AA 1HNVA 1Q8IA 3LPTA 3QINA 1NKCA 4B3OA 4MQ3A 3SCXA 2G8VA 4OLBA 1JXEA 5HRPA 4C8MA 4N76A 2HHVA 1KSPA 1K6YA 2PY5A 3DRRA 4IG3A 1XHXA 4CJTA 3KLHA 4RW6A 1A5VA 1VRUA 1RDAA 1HYSA 4F8RA 2XHBA 3SZ2A 4DS4A 3CG7A 4CF8A 4W5NA 4FLYA 5JS2A 4M3ZA 4KHYA 1TL1A 1QQCA 2OPSA 4E3SA 1ZBUA 3ZT2A 2IGIA 3HP6A 3RMBA 1NKEA 3HL8A 1RT6A 1KCFA 3RTVA 1B92A 3QNOA 2HHQA 4DQQA 2KFZA 3H08A 1NOZA 4AILC 3OYNA 3ALYA 4CEFA 4CIFA 3DRPA 1TV6A 2ZQBA 2YNIA 4H4OA 4CEAA 4OPJA 1IG9A 3AVIA 4BDPA 2G8IA 5FDLA 3ISNC 3ZT3A 2KW4A 5KRTA 1NK5A 1B9DA 1YT3A 3DLHA 2AJQA 3LPUA 3PX6A 1S5JA 4DF8A 5HLFA 3C94A 2G8FA 4CHPA 4W5RA 4H8KA 3MXJA 1VSEA 3L3VA 1KVBA 1T8EA 3LAKA 2DFHA 5KTQA 4B9SA 3PY8A 1ZYQA 4CJUA 1QHTA 3DLKA 1BHLA 4CK2A 2G8KA 3NFAA 1A5XA 1I39A 2IS3A 3VQPA 4W5QA 2VG7A 1WAFA 2F8SA 4E1MA 2X74A 1C1CA 3LWLA 4DQRA 4C8KA 3HT3A 4CJVA 3PO5A 1SKWA 4HVJA 3SUPA 1IKWA 4I7FA 3TAFA 1S1UA 3KD5E 4M45A 2X6NA 2B5JA 3QO9A 1RDDA 3DRSA 4DTXA 1SKSA 4FJIA 4E7KA 2YHBA 3G0ZA 2D0BA 3SPYA 1NKBA 3VA3A 3RWUA 2QK9A 1X1PA 4IFYA 4LH5A 3MAQA 4FZZA 3AVHA 1D5AA 1EETA 1CLQA 3L2WA 2NUBA 2ETJA 4J2DA 3VA0A 2BDPA 1KFSA 3V4IA 1BQNA 1KLMA 4Q0BA 4GMJB 1O1WA 3NHGA 1UA1A 1VRTA 4RW7A 1EX4A 3WNFA 1KLNA 3LZJA 1SL0A 3ZSXA 5J2PA 1BIUA 1FKPA 1JKHA 1SL1A 2B4JA 1C0UA 4FJ5A 4KTQA 3CM5A 3VQ8A 1U4BA 1XI1A 1FXXA 4BWJA 4KHUA 4CHQA 4DTNA 1ZBHA 4AH9A 4K8XA 1XHZA 4PA1A 4DSJA 2IC3A 3V9ZA 1HQEA 3QEWA 4B9NA 4FM1A 4I2PA 3RMAA 4IG0A 4CEEA 3HVTA 4EP5A 2QKKA 2EX3A 4DS5A 3D0PA 1WLJA 3LDSA 4DTMA 5J2QA 3THVA 1RTIA 4Y1CA 4CFCA 3AVKA 3ZCMA 3OYHA 3SPZA 4OVLA 3AO1A 5CZ1A 3VQ4A 1X9MA 3NDKA 2I5JA 2FBXA 1X9SA 1RBVA 1SL2A 1RILA 4FYDA 4DFPA 1RT1A 2XY7A 1SV5A 4LSLA 1TVRA 1Z26A 3DOKA 3VQQA 2YNFA 3HPOA 4FJGA 4B8CA 3K5LA 1WNSA 3S3NA 4CJPA 2PYLA 3CQ8A 2HHTA 3KK1A 1KRPA 4DSIA 2YV0X 2Z1GA 1GOAA 3K59A 1RNHA 1Y97A 2HNZA 1TK8A 1J54A 2YKMA 3NGZA 3L8BA 4CK1A 3TANA 1J53A 3V1QA 4CCHA 1RTHA 2D0AA 2G8WA 3QEPA 2DTUA 3V9XA 4BWMA 3C6UA 2GUIA 4DTSA 3M8PA 4LY7A 4C8OA 4M3YA 2F96A 5DK5A 3NBPA 4AHRA 5HRSA 2P5OA 4FK0A 1WSFA 5FRNA 4CIEA 2P5GA 4LSNA 4B08A 4C8NA 3O3FA 1QS4A 4Z4EA 4OLAA 4ELUA 5KGXA 3NGIA 3TAPA 3DLBA 3OYCA 4IKFA 1S9GA 3I0RA 3TARA 1RT3A 4TSXA 4NYNA 3ZSRA 1DTQA 4ID1A 1J9AA 3HPGA 2JGUA 4OKKA 3TI0A 1HYZA 1GOBA 3OYFA 1NJYA 1CZ9A 4BDZA 4KTZA 3AVCA 3OS2A 4CGJA 1KVCA 4CJLA
chains in the Genus database with same CATH superfamily
4JLHA 3M1FA 1VSDA 1U2VA 1K8KA 3AA5X 3U4LA 4FLXA 4IZ9A 4OPKA 4U7BA 1UAXA 5J1EA 4U67L 1C1AA 2O8BA 4F4KA 1IBLK 4CGDA 4OX9K 2P9NA 5EU7A 1V4SA 3DLEA 1NOYA 4FVUA 3ZT4A 4DSKA 3J81O 1YJNN 2WC9A 3WNHA 3B6PA 4DR1K 1ASWA 3SMPA 2O8CA 3KK2A 4RW4A 3D6RA 2RHKA 1W9HA 5M1NA 2PBDA 5SWMA 4BRCA 3WEEA 4DTRA 2QWOA 3TWHA 3PX0A 4GVEA 4ZTJA 3SUNA 3ITHA 4RG8A 4CJQA 3HJFA 5C2FA 4OGCA 3TSPA 3ZEUB 3DM2A 3EZWA 3L2RA 1YVUA 3VGLA 1WSEA 4ILJA 4CZIA 5AQSA 3PLAA 3AGKA 2Q3SA 4BE1A 1NU0A 2ZJPL 1VQPN 3L3UA 2E4LA 4CF0A 1N33K 4CF9A 1IKVA 3IG1A 3FLCO 1VQ8N 1IH7A 5D3GA 5T7BA 4HUGA 3A5NC 1S1VA 3KLIA 4KH6A 1Y64A 1S6QA 4B1VA 4RCHA 4BGAA 4JRQA 2J4RA 2VQEK 4JK7A 1I3AA 3TAGA 4BRNA 3NVKA 2RN2A 1NGFA 4OJRA 3TSUA 3I0SA 4HTLA 1W7AA 1XUPO 2OPQA 3SAGA 4QOZB 2ITGA 5EX5A 2P9IB 1N5YA 3I8BA 3VGMA 3OTOK 1SQKA 5MLCQ 4NXMK 2E6MA 1RBUA 3THXA 3OS1A 1J5OA 4OGEA 1KAXA 1J5EK 2YKNA 2FBYA 4CJ4A 4JI2K 4FXDA 2WBNA 2Q0RA 3VQBA 4GV6A 4B9QA 3TAMA 5LY3A 2XO7A 3ENBA 1NGEA 2ZJRL 3TSQA 3FR0A 1ZC6A 3DOLA 4CHNA 3O4NA 4DV6K 2HHXA 4Z4CA 3QESA 4CFDA 3KK3A 3SV3A 4YHHK 4O8KA 3SK3A 1BI4A 1LAWA 1QSSA 4NCBA 4DWIA 4IBNA 3PIOL 3QEIA 3TABA 3HRGA 4ISFA 5CE3A 1ZBLA 5CY4A 1HQUA 4CGGA 3MXIA 2QTDA 3DI6A 1TL3A 3VESA 4FCYA 4J2EA 4RTFD 3THYA 3EEQA 2HNYA 3MEEA 4FK2A 4NYFA 4BE2A 3ID6A 4FJ8A 3K5NA 5GIPA 4AHUA 2RF2A 4B9LA 4JKFA 3VGKA 3CYMA 1NGJA 4FLTA 1WSGA 5J2MA 3U3GA 5E41A 1EQYA 4Z4HA 1BL3A 4LF8K 2OCEA 1GLBG 4PQUA 2PYJA 1EKEA 3O1BA 1NJIO 4ISEA 1BA1A 5ELZA 1D9FA 2X78A 4XIUA 3FE1A 3WNEA 1BI4B 4OPHA 1OH6A 1JCFA 3O3HA 1S72N 2OTJN 4CEZA 1QSLA 1U49A 4FJ7A 3VQ9A 3NF9A 5KGWA 5IWAK 3LP2A 4FZXC 3WXMB 1VQNN 5AQNA 4BVOA 3OYMA 1TAUA 3CFOA 4DSEA 5JVGL 1Z05A 3OJSA 3IUCA 3THYB 4CBWA 5AZIB 5DM7L 3ZEUA 4NLBA 5I42A 1NK9A 5C0YA 3NF8A 4B9TA 1M90O 4BG9A 3OY9A 3HSCA 3MWTA 1C0MA 5BRHA 4CJWA 3K5OA 2NRTA 1YVNA 3LALA 4DLGA 3OHRA 1VAZA 4JI5K 2YNGA 2ATQA 1Q86O 3RRGA 2VWKA 5DMRA 2NRRA 2Q31A 3NMUA 2QI2A 3WXIA 4ZTFA 1SAZA 2ASPA 1JLAA 3RRHA 4FL9A 1EXQA 3VQCA 2ZGZA 3AVGA 3BZCA 2ZM6K 3PO4A 4ISGA 5AR0A 4B9UA 3MEGA 2D0CA 4K0KK 4ELTA 1XC9A 4RW8A 4XH4A 5DM6L 4CF2A 1YTUA 3KLGA 4KB1A 4JKGB 1RTJA 5AQUA 4CZLA 3O3GA 1DT9A 3D2FB 3M5RA 4B1YB 2HW3A 3CM6A 2HNDA 4CJ7A 5BRFA 3HP9A 4BRGA 3NF7A 3SJJA 3K2PA 4CHYA 3ZX3A 4K42A 5LL6Z 2ZD1A 1N32K 5AFUH 2W42A 1TYQA 3CIPA 1NKCA 2O8EA 2G8VA 4BC5A 4H03B 5HRPA 4DCHA 3WEEB 4CJTA 5LMNK 3PSFA 3KLHA 4RW6A 1VRUA 4GKJK 4OO1J 4F8RA 1HYSA 3CG7A 4W5NA 4M3ZA 2FSKA 2YHYA 4E3SA 1ZBUA 4H5NA 2O8DB 2IGIA 4NB4A 1KCFA 3RTVA 3QNOA 4DQQA 3OA9A 2KFZA 3Q7BA 3EKUA 4FWQA 4WQ4C 4F9OA 4BR2A 4CEAA 2P9UB 5FDLA 3ISNC 5JMVA 3C7NA 5AQYA 4Z94A 1S5JA 3C94A 4CHPA 4W5RA 3MK6A 5AZIA 3W0LA 2FSJA 3ENOA 3WUHA 3PY8A 3QICA 3D2EA 2G8KA 3BY5A 1I39A 4IWVA 4MDBA 1ATNA 3HBTA 5BPNA 1VQ6N 4EHTA 3SUPA 1IKWA 4I7FA 4IOAL 1S1UA 5F1XA 4IFEA 2B5JA 4DTXA 4CZMA 3G0ZA 1X9JA 2WFBA 2QK9A 3UKRB 1W2BM 4IFYA 3MAQA 3IDHA 4JN4A 5F0XA 2NUBA 3DXMB 2BDPA 3V4IA 1KLMA 3CF5L 3E9OA 2W6KA 4RWTA 1D4XA 2FF6A 2QM1A 1UA1A 4YOWA 1KLNA 2IVPA 4WFBL 3ZSXA 3LZJA 1C0UA 4KTQA 3CM5A 1U4BA 1GLEG 2HBJA 2PFUA 1ZBHA 2P9KB 3CETA 3J7YP 4CZFA 1Z6RA 5AQTA 4FM1A 4CEEA 4EP5A 3CPWM 4DS5A 3D0PA 1WLJA 3CCVN 1OH7A 3LDQA 4IEIA 4CFCA 4IOXA 1TUUA 4OVLA 3VQ4A 5CZ1A 4BRPA 2JWKA 3NDKA 1GLJO 2ASOA 1Z26A 4DV5K 2FLOA 4CBXA 4A57A 2YKMA 4JNEA 2UU9K 4DUZK 3V9XA 3CXCM 2GUIA 3BUZB 4M3YA 4C8OA 3BF3A 3MMVA 2P5GA 4B08A 4GY2B 2VGNA 3RVCA 1S9GA 4KHPK 5F2RA 1RT3A 4TSXA 5LMUK 4NYNA 3ULEB 4FWMA 1DTQA 4JI8K 1J9AA 3HPGA 3LL3A 4LF9K 4V19S 4PL8A 3BP8A 3AVCA 4CGJA 3F2KA 4CJLA 1QSYA 2F7TA 3MDQA 1Q81O 2BTFA 4WE1A 2OYQA 4M3XA 3P39A 3C6AA 3RSEB 2Y1IA 4Q5VA 2OANA 4EP4A 4DU3A 4FOEA 1NK4A 5FRMA 3KLFA 1QQMA 1XMQK 3ZX2A 1W0HA 5EY4A 4NLCA 4DR2K 3FZFA 1OH5A 4I6MB 3WXLA 2CGJA 1RBSA 5LJWA 1U45A 3V6DA 3EE8A 2CGKA 2HHUA 4KFBA 2UXDK 3O8MA 1ATRA 3V9UA 3EKSA 4LFCK 4N41A 1IV0A 5GINA 4I6MA 3WQUA 1F21A 3SQ1A 1D9DA 3CCRN 1KD1O 1RDCA 1S1XA 4OKEA 1N6QA 3KKSA 3CC7N 1NG9A 5AQJA 4BC3A 3KD1E 1NK7A 3GBTA 4CD1A 2GX9A 1CXUA 3OYAA 4FM2A 2A6AA 2A41A 2QEXN 1ASUA 1NJWA 1LV5A 1SKRA 2ZE2A 4IJAA 3T1AA 1RBRA 1BWFO 3CMAN 2E8AA 3O9SA 3SUOA 2FC0A 4JAXA 5EXWA 2A1SA 4O44A 3SUQA 3L2UA 4BC4A 4JK8A 5AQWA 3RR7A 3C65A 1NGDA 3V9WA 4PL7A 4YDUA 2E6LA 2RPIA 1DTTA 5FROA 1VSJA 4JS4A 1EO1A 1U2VB 3J8AA 4MFBA 3U3YA 2DPNA 4O5BA 1T03A 3IS9A 3MX5A 1YI2N 3SLCA 3ULDA 3P38A 2OPPA 1WBBA 1T6DA 2UXBK 3AAPA 3AO3A 3RMCA 2F9TA 4UY8O 2KFNA 2AP1A 2P9UA 4JV5K 3QETA 3Q7CA 3R6MA 4EZ9A 2UYTA 5JLHA 4DQSA 3I56N 1GLLO 4O55A 1MU2A 2IDOA 4M7XA 4WQ4A 4F2SA 4KAZA 3A0IX 3G6EN 4FLZA 1LAVA 4O4GA 4CFAA 4O0JA 5C24A 3AO5A 1RGIA 1C0TA 3OYDA 1L3VA 1K8AO 3DLGA 2Q1NA 2V52B 3G25A 2YHAA 4DFMA 1NNEA 4G1QA 1VQ4N 2NRVA 3PUFA 1KQSM 1TAQA 4KHSA 4CJRA 4ID5A 4B1WB 2OPRA 1REVA 1JJ2M 1OVQA 2QXLA 4DSFA 3G4SN 4FLWA 3E66A 4CESA 1TKTA 4IXCA 3WXJA 3H45C 3J7AP 1MDUB 4FWNA 3OVNA 1BU6O 3P1GA 3AVBA 3PSIA 4EHUA 5H1SQ 1HYVA 3I33A 1YUWA 4N5SA 4DFJA 4I9LA 4B9MA 5HRNA 2H3GX 3QNNA 2AA4A 3P5JA 1NM1A 4Z4GA 3E9LA 3A2FA 2E1ZA 2D0OA 2EHGA 4JD2A 1BOTO 3F9MA 1YJWN 3M8QA 1VK0A 1QHAA 1RT2A 4FZYA 3VQEA 3L0QA 3VEWA 1CZBA 1SZ2A 1JCEA 4KI6A 4BR7A 5HRRA 2NNWA 4JKCA 5JICA 4AQYK 5BR9A 1WBDA 3M6GA 3LZIA 3DLRA 4CGIA 1LCUA 5AQZA 3T19A 4FLUA 3TR8A 4JKDA 5KQDA 3SQ4A 3DMJA 3HYFA 5AQVA 3NGYA 2KTQA 1IG8A 3HTVA 3L2QA 2UUCK 3EO3A 4HHTA 1NJZA 3D45A 2VG6A 5JLFA 2NRWA 1OKJA 5I9EB 3M8RA 2QWMA 3BEXA 1RDBA 4KTWA 3OW2M 4KPYA 1QE1A 3ZSYA 4CHOA 4AM6A 2KZMA 4FJ9A 2YHWA 4WFAL 4L8RB 3GL1A 1A5WA 3B8AX 2WUSA 4A2AA 4DTJA 3JSMA 4GKKK 1ILYA 5BPMA 1ZXOA 3LAMA 5SZTA 4DF4A 2GELA 2Z1IA 2DFEA 1HR0K 4F3OA 4BQZA 4FK4A 1JLGA 4HUFA 1E3MA 3NE6A 4YOVA 3D7EO 1BISA 3ASMA 4FO0A 1DKGD 4QCLA 4GVMA 3MEDA 1S3XA 2VWJA 2QWLA 4FLVA 1TKZA 1XMOK 2Q36A 3QIOA 2W40A 2YHXA 4JI4K 1BUPA 4L3QA 4QAGA 4KI4A 3SAFA 3QEXA 4Y1DA 2P9IA 4W5OA 3P31A 3AY9A 1KFDA 3DYAA 3ZETA 3MECA 1IKYA 4CE9A 1YJ9N 4FJMA 4JKGA 3LP3A 4XH1A 1X3NA 4CJEA 3ID8A 1T7PA 3KKRA 2D4WA 4PKGA 4CF1A 1RTDA 3AVNA 2B6AA 4B3OA 5KQ8A 3SCXA 1NMNA 4DR3K 4N76A 4IG3A 1XHXA 1BDGA 1RDAA 3CJCA 3SZ2A 4X66K 4DS4A 4DR5K 2E2NA 4KHYA 1NGGA 2NRZA 3ZT2A 1QZ6A 3UKRA 4CVNE 3HL8A 4WF9L 1NWKA 5C10A 3K9KA 3H08A 4DV0K 1NOZA 4AILC 2O8BB 3DRPA 4H4OA 1YXQA 1IG9A 5KRTA 4J8FA 1B9DA 1N8RO 1KC8O 2AJQA 3VERA 2G8FA 4DF8A 3O6WA 3LAKA 2DFHA 3KZBA 2D1KA 1ZYQA 1H1VA 1BHLA 2O8FB 3NFAA 4R79A 2F8SA 1NMDA 4E1MA 1HNXK 2X74A 1C1CA 4DQRA 4C8KA 3PO5A 3C7NB 4BRFA 2E88A 3OBYA 1BO5O 3KD5E 1SKSA 3DRSA 1VHXA 1NKBA 3RWUA 1X1PA 5E84A 1YAGA 3CJAA 4LH5A 1D5AA 3CJ7A 1CLQA 4NO7A 2ETJA 4J2DA 4FWPA 1BQNA 4PKIA 1Q82O 2QWRA 4MO4A 1SL0A 1BIUA 1JKHA 3CCSN 4KH4A 1T3VA 4QS7A 5FLXO 2W41A 1XI1A 4X64K 4KHUA 4CHQA 2QWNA 4K8XA 1XHZA 3EE9A 4PA1A 4DSJA 2IC3A 4KH5A 3RMAA 4I2PA 2QKKA 1RFQA 3AVKA 3OYHA 5GAGP 4A61A 5EOYA 2FBXA 1X9SA 1RILA 4JI3K 1CZAN 4JI1K 2YNFA 3HPOA 5KPZA 4FJGA 3D2FA 4B8CA 4CJPA 3VEVA 1LOTB 4FPAA 3SAHA 3VENA 3L4IA 1TK8A 1J54A 3L8BA 4BRLA 5TKWA 4CK1A 3MCPA 1WOQA 3V1QA 3K0SA 2D0AA 3QEPA 4BWMA 3C6UA 2CGLA 2P9LB 4DTSA 2F96A 5HRSA 2P5OA 1MWKA 1WSFA 2Q0UA 4Z4EA 4C8NA 3QFPA 4OLAA 3TAPA 3OYCA 1HLUA 5AQQA 3TPQA 4ID1A 4FWOA 2A40A 3TI0A 3H3NO 1CZ9A 4BDZA 4KTZA 1EWRA 3L4QA 3OS2A 3A5OC 2ZGYA 1NGCA 3DXKB 4DB3A 4LFAK 1VQLN 4LD0A 1HX1A 2KLAA 4DMNA 5AQOA 1TKXA 1R0AA 4KB0A 4UQGA 3SYZA 3ZSZA 1E4GT 4A5AA 1L3UA 4CJSA 4B3TK 4WYBA 2GTDA 1VSMA 2QW9A 3LDPA 3AA2A 3I55N 2G8HA 3O1WA 4H0YB 4Z4FA 1GLDG 4DQIA 4LF4K 3FZMA 3OYJA 2IOCA 1TKDA 3QMLA 1JCGA 5I3UA 4H5WA 3F9KA 4FWRA 4F2RA 2QWPA 4GNIA 4C23A 2RKIA 2OZSA 1NK0A 1E4FT 4HTUA 4X62K 4JYAK 4JKHA 4HCCA 4YOXA 4FJNA 4E7JA 1HMVA 1K73O 1IO2A 3O9RA 3SV4A 4M42A 2VG5A 5FPNA 4E7IA 4FJLA 3K57A 1NK8A 3MXMA 1T05A 3S3MA 3ZSQA 4B1XB 3HPHA 2YNHA 3NH0A 2HOEA 3CHWA 3SMSA 3RR8A 3PIPL 1VSLA 3QEVA 1C0FA 1WSHA 4E0DA 5C12A 3WXKA 1HNIA 1LW2A 5BN9A 1YITN 3K5MA 1B9FA 3F73A 3CCMN 1S22A 2HMPA 4YDUC 4CGFA 2BE2A 4AHVA 3AO4A 4CJ5A 4DQPA 1BGXT 2XY8A 3VTHA 3VEXA 3VEZA 4H0VB 2BUPA 5GIOA 3VOVA 2G8UA 5E26A 3VF4A 4N47A 2W6LA 2GWKA 3ZX0A 3IRXA 3KLEA 3VQDA 4H5VA 3AAQA 3KHYA 3ZYYX 3S9HA 4LF6K 4BG8A 1JL1A 3KIOA 1WSIA 5AQGA 5HL7L 4DG1A 1UOCA 3A5LC 4C1NK 4HCBA 4CJKA 1C1BA 2E5LK 3HSTB 3NAEA 2E2QA 1P90A 4YNQA 3G71N 4IEEA 1IBMK 2V7ZA 2P9KA 4M3RA 1ITGA 2GEMA 2GV9A 3CCEN 5IT9O 1NBWA 1RT5A 3DLLL 4KREA 5LJVA 3O9QA 2A1RA 1VSFA 3V1OA 4W5TA 1W97L 4DU1A 2QKBA 4CEDA 2KKZA 5HBMA 4CZGA 3PX4A 3KJVA 1KVAA 4DUYK 4QS8A 2VYPA 4JS5A 3ENHA 3JS6A 2R7YA 3CJBA 4DU4A 1YHQN 3SNNA 3MWPA 3VQ5A 5ADXA 3NH2A 1JL2A 2XY6A 2ZJQL 3L6QA 5KI6A 4PHTX 4KHQA 1JLEA 1LWFA 3AA4A 1RDWX 2IAJA 2FSNA 5JVHL 2DY4A 3GE1A 5CYQA 1S6PA 5AFUA 4R5PA 4A5BA 3OYIA 3A5MC 4CZKA 4CZJA 4OPAA 4BRMA 3MN5A 2IVOA 3RMDA 3LP0A 2Q97A 4EZ6A 3OS0A 1QTMA 4KRFA 3HM9A 1VSIA 2HMIA 3V9SA 3P4IA 3QLHA 4JRPA 2LSNA 2P1JA 1Z25A 2FBTA 4B3RK 3ZT0A 4DR4K 3EY1A 3AVLA 4WFNL 4DV2K 4DSLA 4A62A 1TK5A 1TGOA 3O80A 4FJKA 3QBWA 3U9ZA 3MCAB 3ZT1A 5CYMA 3OYLA 1VQON 5HROA 1UA0A 3H46O 3SQ2A 4FOIA 3SJHA 1N36K 5AQLA 2FBVA 4YOYA 1RT4A 1GOCA 3LP1A 4M3TA 4JKEA 2XRIA 3BDPA 2GWJA 2KQ2A 2Z1HA 4E7HA 3CQXA 2HB5A 1NLVA 5M1KA 3QIPA 4BREA 1NK6A 2E1YA 3M3ZA 4B8AB 5BN8A 4X65K 2PAVA 3HM8A 1VQKN 1JXBA 4I2QA 2A42A 4DTPA 3UIQA 1BA0A 1IJJA 2JWLA 4FWSA 2QXFA 4YFUA 3VQAA 4N56A 3OBWA 4ELVA 3ZETB 5AQMA 1NGAA 4KV8A 3AO2A 4FJXA 3V1RA 1RBTA 4KBOA 3C6TA 3K58A 1YTAA 4AF1A 5FPMA 3AA3A 2VGMA 1T44A 3K9JA 1JLFA 3S3OA 5C42A 2WOMA 3UB5A 3T3FA 1CXQA 4AHSA 3VTIA 3E01A 4CFBA 2BANA 1U47A 3G10A 3H6EA 3VEYA 1VQ5N 3H3OB 4ILHA 2V51B 3DXKA 4EFHA 3VETA 3SI6A 3TAQA 4WCEL 4B3MK 4JKBA 4I9QA 4BROA 4CZEA 5B8HA 3T1YK 1ZBSA 4K25A 4O8UA 4IDKA 3NCIA 2VQFK 3CCUN 1LWEA 1LW0A 2QA4N 4E19A 4HUEA 3I8DA 1WSJA 2A3ZA 2VWBA 4Z4IA 5JS1A 1U6ZA 4Y0WA 4FPBA 3MN7A 4ZHRA 4IO9L 5AQIA 2D5RA 4OKJA 4DV7K 1WUAA 1HNVA 1Q8IA 5C15A 5C2DA 1JXEA 3CC2N 2PY5A 3IFRA 4H5RA 3U9DA 1N34K 2OTLN 2XHBA 4CF8A 4JI6K 5JS2A 4DQ8A 2OPSA 3RMBA 3HP6A 1NKEA 1RT6A 3C6HA 1B92A 1O13A 3UE5A 3OYNA 1TV6A 4OPJA 2G8IA 4BDPA 4BY9C 4JK9A 2KW4A 3ZT3A 1NK5A 1YT3A 5FPDA 3DLHA 5HLFA 3VEOA 1FJGK 3MXJA 1ATSA 1VSEA 3L3VA 1KVBA 1T8EA 4MO5A 4B9SA 2HBKA 2FXUA 1QQOA 5KPTA 4A2BA 3T1HK 2IS3A 3VQPA 4W5QA 2VG7A 1WAFA 5FPEA 5BR8K 4CJVA 3ULEA 4HVJA 3FZKA 4DR7K 3E1YA 4GV9A 4E7KA 2YHBA 4QS9A 2D0BA 3SPYA 3CC4N 3W3DA 3QDKA 3LM9A 4JHDB 3SBGA 3LM2A 2I7NA 2EWSA 1KFSA 1K9MO 4GMJB 3O4WA 3NHGA 1VRTA 1EX4A 4JI7K 3DAWA 4NXNK 1FKPA 2B4JA 4XEIA 4JEPA 1V4TA 3VQ8A 3TU5A 5M1FA 1FXXA 4DTNA 1GLFO 3CD6N 1M1KO 3V9ZA 1HQEA 2IIRA 3THVA 3LDSA 5AJ3K 4Y1CA 1Q7YO 1FW6A 4FYDA 3BZKA 4DFPA 4CZHA 4CBUA 2ITMA 1SV5A 1TVRA 1EWQA 3F5TA 3DOKA 5AZJA 1DEJA 3T69A 4IJNA 3S3NA 3CQ8A 1KRPA 4DSIA 4DV1K 4BR4A 3DWLA 1GOAA 3K59A 1RNHA 3NGZA 1TYQB 1RTHA 2DTUA 2E20A 4LY7A 3NBPA 4FK0A 4WQ5A 5FRNA 3CJ1A 4LSNA 3O3FA 4BQLA 1QS4A 1RDUA 4IKFA 1QQNA 3I0RA 3TARA 3ZSRA 4CI6A 5GAHP 3QFUA 3CMEN 2BH1A 3KWIA 1NJYA 1HNWK 4H5TA 1KVCA 3R8EA 4M7YA 3OYEA 3AVFA 1HKBA 5GADP 3OYGA 4YORA 2YX6A 3LDOA 5GAEP 4BR5A 1T6CA 3NF6A 4DHYA 4BR0A 2OZMA 4CECA 1BCOA 3H1VX 3WQTA 1DGKN 1VSKA 1L5UA 4E7LA 2PZSA 2X6SA 4CEBA 2ASMA 4M3UA 4IO8A 2V7YA 4B9VA 3HI0A 4J2AA 1JLCA 2JLEA 1IBKK 4LH4A 4FWLA 2F9WA 4IOCL 3ZSWA 2HVIA 3OYBA 2D0PA 1HJRA 3BF1A 1C6VA 1L3TA 5BRDA 2VCPA 4O0IA 3CERA 4YOTA 2P9SA 3GG4A 4YOUA 4H4MA 2YJFA 1WN7A 4HWIA 3VPZA 3ZLJA 1L3SA 3FZLA 3R3LA 1UWBA 3J7ZO 4H0PA 3OJUA 2NRHA 4ICLA 3VF2A 3ZSVA 4CJ3A 3SQ0A 2HBLA 3MN6A 4PWDA 4RW9A 1VQ7N 4JKAA 4DTUA 4BDYA 1QVFM 3QB0A 4GW6A 4KHNA 1ZBIA 3PV8A 4IFVA 3P83D 1RT7A 1VQMN 4DV4K 4BRDA 4MLHA 4LC9B 3MN9A 4K8ZA 4MLEA 1KAZA 4CGHA 1I94K 3J80O 3VN5A 4DLEA 4CERA 2HHSA 3U6FA 3AVMA 1OVYA 1DLOA 1RCHA 3M8SA 5AQKA 1G15A 4KKOA 3VQ7A 4M41A 2KHOA 3T7ZA 4BACA 4IDHA 4AM7A 1X9WA 4CEOA 2YCHA 2XY5A 4FVMA 3QERA 1HPZA 3AVAA 4B3SK 4LF7K 3LANA 2E2OA 2NRXA 1S1WA 3ZSOA 1TUYA 2Z1JA 4FJHA 4H0TB 2F8TA 3CFPA 1LWCA 3C95A 4FM0A 3OYKA 1BCMA 1HNZK 1D8YA 5J2NA 1Q18A 4KO0A 3THWB 3TTDA 1HPMA 2CH5A 3CFRA 4YY3K 3B6OA 3SBTA 3HOSA 1Q9XA 4AHCA 4DKWA 4E1NA 3WNGA 1Q9YA 3JAMO 4DR6K 4F3TA 5CR4A 4BRAA 3O4QA 3GOIA 4Z0UA 5HP1A 1QZ5A 3FFIA 3N4QA 5AQXA 3EL2A 4KHWA 3JYTA 4FJJA 4CJFA 4FW2A 5AQHA 5CHIA 1BIZA 5CZ2A 4JD2B 3U8XA 2OA8A 1K8KB 2A5XA 3TTCA 2O8FA 1XNQK 5A2QO 3D2EB 5AQRA 3FFKB 2DFFA 1U04A 4NCGA 1NGIA 2O4IA 2YJEA 4LF5K 1XNRK 3BGRA 2P51A 1S1TA 2WONA 4C1NI 1NJXA 1ZBFA 2HF4A 4BC2A 4CK3A 3AV9A 4CIGA 4CEQA 1U48A 1NGHA 4PKHA 3AVJA 5M1PA 2ZWHA 3FGUA 4FW1A 3CQYA 3CCQN 3IKMA 3A8YA 1TK0A 4BVPA 3CI5A 3NVMA 4BR9A 4M63C 3LDLA 5AQFA 1J6ZA 3VQ6A 1FKOA 2Y1JA 2O4GA 2WTUA 2UUAK 1IKXA 3WT0A 1XWLA 3EYZA 3TAEA 3C0BA 4B1ZA 3AARA 1MA9B 4E1JA 3LWMA 5K14A 4AHTA 1ASVA 2O8CB 2BGGA 2KZZA 2I7PA 1JLQA 3V81A 2HHWA 1XC3A 3KWGA 2GBZA 4C8LA 1JLBA 1NGBA 1BQMA 3N4PA 2P9PB 4NCAA 4GV3A 2P9LA 2GUPA 5AQPA 1VSHA 3RSEA 4PY5A 1KTQA 3FZHA 4BGBA 4EAHD 5C25A 4MDAA 3EZ5A 1S9EA 3UKUB 2P9PA 5M1OA 1ESVA 1EP4A 3CPEA 3HO1A 1SUQA 4CHZA 4DTOA 3KVGA 3THXB 2HVHA 3HVRA 4H0XB 5EVZA 5KRSA 1HRHA 4DV3K 3HK2A 4BRIA 3EN9A 5ADXH 4PUOA 3CCJN 3KTQA 2HBMA 2QWQA 4H0OA 5BREA 4BE0A 2UUBK 1FK9A 3MX2A 1WAJA 3L2VA 2NZTA 4CD3A 2HF3A 3IAYA 4M3WA 3NH1A 3HXMA 4E89A 2YI1A 4J2BA 4DFKA 3O5BA 3LPTA 3QINA 3TTFA 4MQ3A 2UXCK 4OLBA 2P9SB 3JXUA 3H1QA 4C8MA 2HHVA 1KSPA 1K6YA 3DRRA 1A5VA 4BRQA 1QVGM 3DXMA 5KPRA 4FLYA 3ATUA 3R9PA 1TL1A 1QQCA 2Q2RA 4K43A 4BRKA 2HHQA 4BRHA 2FF3B 3HOTA 4K41A 3ALYA 4LFBK 4CEFA 4CIFA 2ZQBA 2YNIA 3AGRA 3AVIA 5TKYA 3LPUA 3PX6A 4CW7B 4H8KA 2NLXA 3VMFB 3GDQA 1MWMA 5KTQA 3S41A 4CJUA 1QHTA 3DLKA 4CK2A 1A5XA 5HOOA 2F4VK 2CH6A 3LWLA 4JI0K 2IVNA 3HT3A 3DJCA 1SKWA 1HKGA 3LDNA 1G99A 5M1QA 1R59O 3TAFA 1C0GA 2P9NB 4M45A 2X6NA 2ZF5O 1SS6A 3QO9A 1RDDA 3IMXA 4FJIA 4EIAA 1GLAG 3VA3A 2HSTA 3O9UA 2O8DA 1KAYA 4FZZA 3AVHA 3O9TA 1EETA 1XQSC 3L2WA 1VQ9N 3VA0A 1GLCG 4Q0BA 1O1WA 1OH8A 1X3MA 4RW7A 3WNFA 5J2PA 1SL1A 4FJ5A 4A59A 5AZJB 2O8EB 4BWJA 1HUXA 3QBXA 4AH9A 2HHHK 3QEWA 4IG0A 3HVTA 2EX3A 5J2QA 4DTMA 1RTIA 3SPZA 3ZCMA 1YIJN 3VF6A 3AO1A 1X9MA 2I5JA 1SL2A 1RBVA 1RT1A 4B1UB 2XY7A 4LSLA 1YF5L 3VQQA 1HJOA 3ATVA 3K5LA 1WNSA 2PYLA 4O5FA 2HHTA 3THWA 3KK1A 2YV0X 2Z1GA 1Y97A 4WQ5C 2HNZA 3UKUA 3TANA 4JHDA 1J53A 4CCHA 3R1XA 1KXPA 2G8WA 4G9ZA 1P8ZA 3M8PA 5DK5A 4AHRA 3O08A 3CJ9A 4XH5A 2RE2A 4CIEA 2E2PA 3E9PA 4ELUA 5KGXA 3NGIA 3DLBA 4FWKA 1BG3A 1HKCA 5BPLA 4ILGB 1WB9A 3CCLN 2JGUA 3KK7A 4OKKA 1HYZA 1GOBA 3OYFA 3HZ6A 4FSVA 4B9NA
chains in the Genus database with same CATH topology
1QSYA 3OYEA 3AVFA 4JLHA 3OYGA 2OYQA 1VSDA 4WE1A 4LD0A 4M3XA 3AA5X 4DMNA 1TKXA 3NF6A 2Y1IA 4Q5VA 4EP4A 4DU3A 1NK4A 4FLXA 1R0AA 4UQGA 3SYZA 4OPKA 3ZSZA 3KLFA 2OZMA 4KB0A 5FRMA 1UAXA 1W0HA 5J1EA 4CECA 1BCOA 1L3UA 1C1AA 4CJSA 1L5UA 2PZSA 1VSKA 4E7LA 4F4KA 2X6SA 4CEBA 1VSMA 4M3UA 4CGDA 5EU7A 3AA2A 3DLEA 1RBSA 1NOYA 4B9VA 1U45A 3ZT4A 2G8HA 4J2AA 1JLCA 3V6DA 4Z4FA 2JLEA 4DSKA 4LH4A 2HHUA 4KFBA 4DQIA 3WNHA 3V9UA 3B6PA 3OYJA 2IOCA 1ASWA 1TKDA 3KK2A 4RW4A 5I3UA 3ZSWA 3F9KA 4N41A 4F2RA 2HVIA 1W9HA 3OYBA 1HJRA 5SWMA 2RKIA 2OZSA 1C6VA 1NK0A 1L3TA 1F21A 3SQ1A 1D9DA 4HTUA 4DTRA 1RDCA 4HCCA 4O0IA 4E7JA 1S1XA 1HMVA 4OKEA 3TWHA 3PX0A 1N6QA 4FJNA 3KKSA 4ZTJA 4H4MA 3SUNA 1IO2A 3SV4A 3KD1E 2VG5A 3ITHA 4M42A 4RG8A 4CJQA 3HJFA 1WN7A 4E7IA 1NK7A 1L3SA 4OGCA 4FJLA 3K57A 1NK8A 3DM2A 1CXUA 1UWBA 3OYAA 4FM2A 3OJUA 3L2RA 3MXMA 3S3MA 1YVUA 3ZSQA 1T05A 1ASUA 1NJWA 3HPHA 1LV5A 2YNHA 4ICLA 1WSEA 3NH0A 3ZSVA 4CJ3A 3SQ0A 1SKRA 2ZE2A 2Q3SA 3T1AA 4PWDA 4BE1A 1RBRA 3RR8A 4RW9A 1VSLA 4DTUA 3QEVA 1WSHA 3L3UA 4BDYA 3SUOA 4E0DA 1HNIA 2E4LA 4GW6A 4CF0A 2FC0A 4KHNA 1LW2A 1ZBIA 3PV8A 4IFVA 4CF9A 3K5MA 1IKVA 3IG1A 3P83D 1RT7A 1IH7A 5D3GA 5T7BA 4HUGA 1B9FA 2A1SA 3F73A 4O44A 3SUQA 3L2UA 1S1VA 3KLIA 4CGFA 2BE2A 4K8ZA 1S6QA 3RR7A 4AHVA 3AO4A 4CGHA 4CJ5A 3V9WA 3VN5A 2E6LA 2RPIA 1DTTA 4CERA 4DLEA 3U6FA 4DQPA 5FROA 2HHSA 3AVMA 1BGXT 4JRQA 1VSJA 2XY8A 4JS4A 4MFBA 1I3AA 1DLOA 3U3YA 1RCHA 3TAGA 3M8SA 4O5BA 1T03A 2RN2A 3IS9A 1G15A 2G8UA 4KKOA 4OJRA 3VQ7A 4M41A 3ULDA 2OPPA 4N47A 3I0SA 2OPQA 4BACA 4QOZB 2ITGA 3AO3A 3IRXA 1N5YA 3RMCA 1X9WA 4CEOA 2KFNA 3KLEA 3VQDA 3S9HA 3QETA 2XY5A 2E6MA 4EZ9A 1JL1A 1RBUA 4FVMA 4DQSA 3KIOA 1WSIA 3OS1A 4DG1A 3QERA 1UOCA 1HPZA 4O55A 1J5OA 3AVAA 1MU2A 4OGEA 4CJKA 4HCBA 1C1BA 3HSTB 3NAEA 2IDOA 3LANA 4YNQA 2YKNA 2FBYA 4F2SA 4KAZA 4CJ4A 1S1WA 3ZSOA 1LAVA 4O4GA 4CFAA 4FLZA 4O0JA 4FXDA 3VQBA 5C24A 3AO5A 4M3RA 2Z1JA 1ITGA 4FJHA 3TAMA 2F8TA 2GV9A 3CFPA 2XO7A 1LWCA 3C95A 1RT5A 1C0TA 3OYDA 4FM0A 1L3VA 3OYKA 4KREA 1BCMA 3DLGA 1D8YA 5J2NA 4KO0A 2A1RA 1VSFA 2YHAA 4DFMA 3V1OA 4W5TA 4G1QA 4DU1A 2QKBA 3PUFA 4CEDA 3CFRA 3DOLA 5HBMA 3B6OA 4CHNA 3O4NA 3PX4A 1TAQA 4KHSA 3KJVA 1KVAA 4AHCA 4CJRA 1Q9XA 4ID5A 4JS5A 4E1NA 2OPRA 2HHXA 1REVA 3WNGA 4Z4CA 2R7YA 4DU4A 1Q9YA 3SNNA 4DSFA 3QESA 3VQ5A 4F3TA 4CFDA 3KK3A 3SV3A 3NH2A 1JL2A 4FLWA 2XY6A 5KI6A 3O4QA 4CESA 1TKTA 4Z0UA 4KHQA 1BI4A 1LAWA 1QSSA 5HP1A 1JLEA 3FFIA 4DWIA 4NCBA 1LWFA 4IBNA 3AA4A 3OVNA 3QEIA 2IAJA 3TABA 2DY4A 3P1GA 3AVBA 4KHWA 3JYTA 5CYQA 4FJJA 1HYVA 1S6PA 4R5PA 4CJFA 3OYIA 1ZBLA 4N5SA 4DFJA 4FW2A 5CY4A 4I9LA 1HQUA 4B9MA 5HRNA 4CGGA 3MXIA 1BIZA 5CZ2A 3QNNA 2OA8A 3DI6A 1TL3A 4FCYA 4J2EA 3RMDA 3LP0A 3P5JA 4EZ6A 4Z4GA 3OS0A 2DFFA 2HNYA 3A2FA 3MEEA 4NYFA 4BE2A 4FK2A 1QTMA 4FJ8A 3K5NA 3HM9A 1VSIA 4KRFA 1U04A 4AHUA 2RF2A 4B9LA 2HMIA 3CYMA 3V9SA 3QLHA 4NCGA 2EHGA 4JRPA 2LSNA 4FLTA 1WSGA 2O4IA 5J2MA 2P1JA 3U3GA 5E41A 1Z25A 3BGRA 4Z4HA 1BL3A 2P51A 3M8QA 1VK0A 4PQUA 1S1TA 2PYJA 2WONA 2FBTA 1NJXA 1EKEA 1RT2A 1ZBFA 3VQEA 3ZT0A 4FZYA 4CK3A 3EY1A 3AVLA 3AV9A 1D9FA 4CIGA 2X78A 4CEQA 1CZBA 1TK5A 4XIUA 4DSLA 1TGOA 3WNEA 1BI4B 4FJKA 1U48A 4KI6A 5HRRA 3ZT1A 3O3HA 3AVJA 5CYMA 4FW1A 4CEZA 1QSLA 3OYLA 3LZIA 1U49A 4FJ7A 3VQ9A 3DLRA 4CGIA 3NF9A 5HROA 5KGWA 3T19A 3SQ2A 1UA0A 3LP2A 4FLUA 1TK0A 3TR8A 3SQ4A 4FZXC 1TAUA 3OYMA 3DMJA 2FBVA 3HYFA 3CFOA 1RT4A 4DSEA 1GOCA 3LP1A 3OJSA 4M3TA 3NGYA 2XRIA 3BDPA 2KTQA 2KQ2A 2Z1HA 3L2QA 4E7HA 2HB5A 5I42A 3VQ6A 1NK9A 1FKOA 3NF8A 3QIPA 2Y1JA 4B9TA 2O4GA 1NK6A 4B8AB 3OY9A 4HHTA 1NJZA 1C0MA 3D45A 2VG6A 4CJWA 1IKXA 3EYZA 1JXBA 1XWLA 4I2QA 3K5OA 3M8RA 3TAEA 4DTPA 3UIQA 3LALA 4DLGA 2QXFA 4YFUA 3VQAA 4N56A 1RDBA 4KTWA 4ELVA 2YNGA 2ATQA 3RRGA 2VWKA 1QE1A 5DMRA 5K14A 3ZSYA 4CHOA 3LWMA 4KPYA 4AHTA 2KZMA 1ASVA 4KV8A 4L8RB 4FJ9A 2BGGA 2KZZA 3AO2A 4FJXA 1A5WA 4ZTFA 3V1RA 1RBTA 3V81A 1JLQA 3C6TA 1JLAA 2HHWA 3K58A 1YTAA 4DTJA 3RRHA 3JSMA 2GBZA 1EXQA 4C8LA 1JLBA 3LAMA 3VQCA 5SZTA 4DF4A 1BQMA 3AA3A 3AVGA 4NCAA 2Z1IA 2DFEA 3PO4A 1JLFA 4B9UA 4F3OA 4FK4A 1JLGA 3MEGA 5C42A 2D0CA 2WOMA 4HUFA 1VSHA 3NE6A 3S3OA 3T3FA 4PY5A 4ELTA 1CXQA 1XC9A 1KTQA 4RW8A 1BISA 3ASMA 4AHSA 5C25A 3E01A 4QCLA 4CFBA 2BANA 1U47A 3G10A 4GVMA 3MEDA 1S9EA 4CF2A 3EZ5A 1YTUA 3KLGA 2VWJA 4KB1A 4FLVA 1RTJA 1EP4A 1TKZA 3HO1A 1SUQA 3SI6A 3TAQA 3QIOA 4CHZA 4DTOA 3O3GA 4I9QA 2HVHA 2HW3A 4QAGA 4KI4A 3HVRA 4IDKA 5KRSA 3NCIA 1HRHA 3QEXA 3CM6A 3HK2A 2HNDA 4PUOA 1LWEA 1LW0A 4Y1DA 4W5OA 3KTQA 4E19A 4HUEA 3HP9A 1KFDA 3DYAA 3I8DA 1WSJA 4BE0A 3MECA 1IKYA 4CE9A 3NF7A 1FK9A 4Z4IA 5JS1A 3SJJA 4FJMA 1WAJA 3K2PA 3LP3A 3L2VA 4CHYA 4ZHRA 4CJEA 3IAYA 4M3WA 2D5RA 2ZD1A 1T7PA 3KKRA 4CF1A 3NH1A 3HXMA 2W42A 1RTDA 4E89A 4OKJA 4J2BA 3AVNA 4DFKA 2B6AA 1HNVA 1Q8IA 3LPTA 3QINA 1NKCA 4B3OA 4MQ3A 3SCXA 2G8VA 4OLBA 1JXEA 5HRPA 4C8MA 4N76A 2HHVA 1KSPA 1K6YA 2PY5A 3DRRA 4IG3A 1XHXA 4CJTA 3KLHA 4RW6A 1A5VA 1VRUA 1RDAA 1HYSA 4F8RA 2XHBA 3SZ2A 4DS4A 3CG7A 4CF8A 4W5NA 4FLYA 5JS2A 4M3ZA 4KHYA 1TL1A 1QQCA 2OPSA 4E3SA 1ZBUA 3ZT2A 2IGIA 3HP6A 3RMBA 1NKEA 3HL8A 1RT6A 1KCFA 3RTVA 1B92A 3QNOA 2HHQA 4DQQA 2KFZA 3H08A 1NOZA 4AILC 3OYNA 3ALYA 4CEFA 4CIFA 3DRPA 1TV6A 2ZQBA 2YNIA 4H4OA 4CEAA 4OPJA 1IG9A 3AVIA 4BDPA 2G8IA 5FDLA 3ISNC 3ZT3A 2KW4A 5KRTA 1NK5A 1B9DA 1YT3A 3DLHA 2AJQA 3LPUA 3PX6A 1S5JA 4DF8A 5HLFA 3C94A 2G8FA 4CHPA 4W5RA 4H8KA 3MXJA 1VSEA 3L3VA 1KVBA 1T8EA 3LAKA 2DFHA 5KTQA 4B9SA 3PY8A 1ZYQA 4CJUA 1QHTA 3DLKA 1BHLA 4CK2A 2G8KA 3NFAA 1A5XA 1I39A 2IS3A 3VQPA 4W5QA 2VG7A 1WAFA 2F8SA 4E1MA 2X74A 1C1CA 3LWLA 4DQRA 4C8KA 3HT3A 4CJVA 3PO5A 1SKWA 4HVJA 3SUPA 1IKWA 4I7FA 3TAFA 1S1UA 3KD5E 4M45A 2X6NA 2B5JA 3QO9A 1RDDA 3DRSA 4DTXA 1SKSA 4FJIA 4E7KA 2YHBA 3G0ZA 2D0BA 3SPYA 1NKBA 3VA3A 3RWUA 2QK9A 1X1PA 4IFYA 4LH5A 3MAQA 4FZZA 3AVHA 1D5AA 1EETA 1CLQA 3L2WA 2NUBA 2ETJA 4J2DA 3VA0A 2BDPA 1KFSA 3V4IA 1BQNA 1KLMA 4Q0BA 4GMJB 1O1WA 3NHGA 1UA1A 1VRTA 4RW7A 1EX4A 3WNFA 1KLNA 3LZJA 1SL0A 3ZSXA 5J2PA 1BIUA 1FKPA 1JKHA 1SL1A 2B4JA 1C0UA 4FJ5A 4KTQA 3CM5A 3VQ8A 1U4BA 1XI1A 1FXXA 4BWJA 4KHUA 4CHQA 4DTNA 1ZBHA 4AH9A 4K8XA 1XHZA 4PA1A 4DSJA 2IC3A 3V9ZA 1HQEA 3QEWA 4B9NA 4FM1A 4I2PA 3RMAA 4IG0A 4CEEA 3HVTA 4EP5A 2QKKA 2EX3A 4DS5A 3D0PA 1WLJA 3LDSA 4DTMA 5J2QA 3THVA 1RTIA 4Y1CA 4CFCA 3AVKA 3ZCMA 3OYHA 3SPZA 4OVLA 3AO1A 5CZ1A 3VQ4A 1X9MA 3NDKA 2I5JA 2FBXA 1X9SA 1RBVA 1SL2A 1RILA 4FYDA 4DFPA 1RT1A 2XY7A 1SV5A 4LSLA 1TVRA 1Z26A 3DOKA 3VQQA 2YNFA 3HPOA 4FJGA 4B8CA 3K5LA 1WNSA 3S3NA 4CJPA 2PYLA 3CQ8A 2HHTA 3KK1A 1KRPA 4DSIA 2YV0X 2Z1GA 1GOAA 3K59A 1RNHA 1Y97A 2HNZA 1TK8A 1J54A 2YKMA 3NGZA 3L8BA 4CK1A 3TANA 1J53A 3V1QA 4CCHA 1RTHA 2D0AA 2G8WA 3QEPA 2DTUA 3V9XA 4BWMA 3C6UA 2GUIA 4DTSA 3M8PA 4LY7A 4C8OA 4M3YA 2F96A 5DK5A 3NBPA 4AHRA 5HRSA 2P5OA 4FK0A 1WSFA 5FRNA 4CIEA 2P5GA 4LSNA 4B08A 4C8NA 3O3FA 1QS4A 4Z4EA 4OLAA 4ELUA 5KGXA 3NGIA 3TAPA 3DLBA 3OYCA 4IKFA 1S9GA 3I0RA 3TARA 1RT3A 4TSXA 4NYNA 3ZSRA 1DTQA 4ID1A 1J9AA 3HPGA 2JGUA 4OKKA 3TI0A 1HYZA 1GOBA 3OYFA 1NJYA 1CZ9A 4BDZA 4KTZA 3AVCA 3OS2A 4CGJA 1KVCA 4CJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSY A;  3OYE A;  3AVF A;  4JLH A;  3OYG A;  2OYQ A;  1VSD A;  4WE1 A;  4LD0 A;  4M3X A;  3AA5 X;  4DMN A;  1TKX A;  3NF6 A;  2Y1I A;  4Q5V A;  4EP4 A;  4DU3 A;  1NK4 A;  4FLX A;  1R0A A;  4UQG A;  3SYZ A;  4OPK A;  3ZSZ A;  3KLF A;  2OZM A;  4KB0 A;  5FRM A;  1UAX A;  1W0H A;  5J1E A;  4CEC A;  1BCO A;  1L3U A;  1C1A A;  4CJS A;  1L5U A;  2PZS A;  1VSK A;  4E7L A;  4F4K A;  2X6S A;  4CEB A;  1VSM A;  4M3U A;  4CGD A;  5EU7 A;  3AA2 A;  3DLE A;  1RBS A;  1NOY A;  4B9V A;  1U45 A;  3ZT4 A;  2G8H A;  4J2A A;  1JLC A;  3V6D A;  4Z4F A;  2JLE A;  4DSK A;  4LH4 A;  2HHU A;  4KFB A;  4DQI A;  3WNH A;  3V9U A;  3B6P A;  3OYJ A;  2IOC A;  1ASW A;  1TKD A;  3KK2 A;  4RW4 A;  5I3U A;  3ZSW A;  3F9K A;  4N41 A;  4F2R A;  2HVI A;  1W9H A;  3OYB A;  1HJR A;  5SWM A;  2RKI A;  2OZS A;  1C6V A;  1NK0 A;  1L3T A;  1F21 A;  3SQ1 A;  1D9D A;  4HTU A;  4DTR A;  1RDC A;  4HCC A;  4O0I A;  4E7J A;  1S1X A;  1HMV A;  4OKE A;  3TWH A;  3PX0 A;  1N6Q A;  4FJN A;  3KKS A;  4ZTJ A;  4H4M A;  3SUN A;  1IO2 A;  3SV4 A;  3KD1 E;  2VG5 A;  3ITH A;  4M42 A;  4RG8 A;  4CJQ A;  3HJF A;  1WN7 A;  4E7I A;  1NK7 A;  1L3S A;  4OGC A;  4FJL A;  3K57 A;  1NK8 A;  3DM2 A;  1CXU A;  1UWB A;  3OYA A;  4FM2 A;  3OJU A;  3L2R A;  3MXM A;  3S3M A;  1YVU A;  3ZSQ A;  1T05 A;  1ASU A;  1NJW A;  3HPH A;  1LV5 A;  2YNH A;  4ICL A;  1WSE A;  3NH0 A;  3ZSV A;  4CJ3 A;  3SQ0 A;  1SKR A;  2ZE2 A;  2Q3S A;  3T1A A;  4PWD A;  4BE1 A;  1RBR A;  3RR8 A;  4RW9 A;  1VSL A;  4DTU A;  3QEV A;  1WSH A;  3L3U A;  4BDY A;  3SUO A;  4E0D A;  1HNI A;  2E4L A;  4GW6 A;  4CF0 A;  2FC0 A;  4KHN A;  1LW2 A;  1ZBI A;  3PV8 A;  4IFV A;  4CF9 A;  3K5M A;  1IKV A;  3IG1 A;  3P83 D;  1RT7 A;  1IH7 A;  5D3G A;  5T7B A;  4HUG A;  1B9F A;  2A1S A;  3F73 A;  4O44 A;  3SUQ A;  3L2U A;  1S1V A;  3KLI A;  4CGF A;  2BE2 A;  4K8Z A;  1S6Q A;  3RR7 A;  4AHV A;  3AO4 A;  4CGH A;  4CJ5 A;  3V9W A;  3VN5 A;  2E6L A;  2RPI A;  1DTT A;  4CER A;  4DLE A;  3U6F A;  4DQP A;  5FRO A;  2HHS A;  3AVM A;  1BGX T;  4JRQ A;  1VSJ A;  2XY8 A;  4JS4 A;  4MFB A;  1I3A A;  1DLO A;  3U3Y A;  1RCH A;  3TAG A;  3M8S A;  4O5B A;  1T03 A;  2RN2 A;  3IS9 A;  1G15 A;  2G8U A;  4KKO A;  4OJR A;  3VQ7 A;  4M41 A;  3ULD A;  2OPP A;  4N47 A;  3I0S A;  2OPQ A;  4BAC A;  4QOZ B;  2ITG A;  3AO3 A;  3IRX A;  1N5Y A;  3RMC A;  1X9W A;  4CEO A;  2KFN A;  3KLE A;  3VQD A;  3S9H A;  3QET A;  2XY5 A;  2E6M A;  4EZ9 A;  1JL1 A;  1RBU A;  4FVM A;  4DQS A;  3KIO A;  1WSI A;  3OS1 A;  4DG1 A;  3QER A;  1UOC A;  1HPZ A;  4O55 A;  1J5O A;  3AVA A;  1MU2 A;  4OGE A;  4CJK A;  4HCB A;  1C1B A;  3HST B;  3NAE A;  2IDO A;  3LAN A;  4YNQ A;  2YKN A;  2FBY A;  4F2S A;  4KAZ A;  4CJ4 A;  1S1W A;  3ZSO A;  1LAV A;  4O4G A;  4CFA A;  4FLZ A;  4O0J A;  4FXD A;  3VQB A;  5C24 A;  3AO5 A;  4M3R A;  2Z1J A;  1ITG A;  4FJH A;  3TAM A;  2F8T A;  2GV9 A;  3CFP A;  2XO7 A;  1LWC A;  3C95 A;  1RT5 A;  1C0T A;  3OYD A;  4FM0 A;  1L3V A;  3OYK A;  4KRE A;  1BCM A;  3DLG A;  1D8Y A;  5J2N A;  4KO0 A;  2A1R A;  1VSF A;  2YHA A;  4DFM A;  3V1O A;  4W5T A;  4G1Q A;  4DU1 A;  2QKB A;  3PUF A;  4CED A;  3CFR A;  3DOL A;  5HBM A;  3B6O A;  4CHN A;  3O4N A;  3PX4 A;  1TAQ A;  4KHS A;  3KJV A;  1KVA A;  4AHC A;  4CJR A;  1Q9X A;  4ID5 A;  4JS5 A;  4E1N A;  2OPR A;  2HHX A;  1REV A;  3WNG A;  4Z4C A;  2R7Y A;  4DU4 A;  1Q9Y A;  3SNN A;  4DSF A;  3QES A;  3VQ5 A;  4F3T A;  4CFD A;  3KK3 A;  3SV3 A;  3NH2 A;  1JL2 A;  4FLW A;  2XY6 A;  5KI6 A;  3O4Q A;  4CES A;  1TKT A;  4Z0U A;  4KHQ A;  1BI4 A;  1LAW A;  1QSS A;  5HP1 A;  1JLE A;  3FFI A;  4DWI A;  4NCB A;  1LWF A;  4IBN A;  3AA4 A;  3OVN A;  3QEI A;  2IAJ A;  3TAB A;  2DY4 A;  3P1G A;  3AVB A;  4KHW A;  3JYT A;  5CYQ A;  4FJJ A;  1HYV A;  1S6P A;  4R5P A;  4CJF A;  3OYI A;  1ZBL A;  4N5S A;  4DFJ A;  4FW2 A;  5CY4 A;  4I9L A;  1HQU A;  4B9M A;  5HRN A;  4CGG A;  3MXI A;  1BIZ A;  5CZ2 A;  3QNN A;  2OA8 A;  3DI6 A;  1TL3 A;  4FCY A;  4J2E A;  3RMD A;  3LP0 A;  3P5J A;  4EZ6 A;  4Z4G A;  3OS0 A;  2DFF A;  2HNY A;  3A2F A;  3MEE A;  4NYF A;  4BE2 A;  4FK2 A;  1QTM A;  4FJ8 A;  3K5N A;  3HM9 A;  1VSI A;  4KRF A;  1U04 A;  4AHU A;  2RF2 A;  4B9L A;  2HMI A;  3CYM A;  3V9S A;  3QLH A;  4NCG A;  2EHG A;  4JRP A;  2LSN A;  4FLT A;  1WSG A;  2O4I A;  5J2M A;  2P1J A;  3U3G A;  5E41 A;  1Z25 A;  3BGR A;  4Z4H A;  1BL3 A;  2P51 A;  3M8Q A;  1VK0 A;  4PQU A;  1S1T A;  2PYJ A;  2WON A;  2FBT A;  1NJX A;  1EKE A;  1RT2 A;  1ZBF A;  3VQE A;  3ZT0 A;  4FZY A;  4CK3 A;  3EY1 A;  3AVL A;  3AV9 A;  1D9F A;  4CIG A;  2X78 A;  4CEQ A;  1CZB A;  1TK5 A;  4XIU A;  4DSL A;  1TGO A;  3WNE A;  1BI4 B;  4FJK A;  1U48 A;  4KI6 A;  5HRR A;  3ZT1 A;  3O3H A;  3AVJ A;  5CYM A;  4FW1 A;  4CEZ A;  1QSL A;  3OYL A;  3LZI A;  1U49 A;  4FJ7 A;  3VQ9 A;  3DLR A;  4CGI A;  3NF9 A;  5HRO A;  5KGW A;  3T19 A;  3SQ2 A;  1UA0 A;  3LP2 A;  4FLU A;  1TK0 A;  3TR8 A;  3SQ4 A;  4FZX C;  1TAU A;  3OYM A;  3DMJ A;  2FBV A;  3HYF A;  3CFO A;  1RT4 A;  4DSE A;  1GOC A;  3LP1 A;  3OJS A;  4M3T A;  3NGY A;  2XRI A;  3BDP A;  2KTQ A;  2KQ2 A;  2Z1H A;  3L2Q A;  4E7H A;  2HB5 A;  5I42 A;  3VQ6 A;  1NK9 A;  1FKO A;  3NF8 A;  3QIP A;  2Y1J A;  4B9T A;  2O4G A;  1NK6 A;  4B8A B;  3OY9 A;  4HHT A;  1NJZ A;  1C0M A;  3D45 A;  2VG6 A;  4CJW A;  1IKX A;  3EYZ A;  1JXB A;  1XWL A;  4I2Q A;  3K5O A;  3M8R A;  3TAE A;  4DTP A;  3UIQ A;  3LAL A;  4DLG A;  2QXF A;  4YFU A;  3VQA A;  4N56 A;  1RDB A;  4KTW A;  4ELV A;  2YNG A;  2ATQ A;  3RRG A;  2VWK A;  1QE1 A;  5DMR A;  5K14 A;  3ZSY A;  4CHO A;  3LWM A;  4KPY A;  4AHT A;  2KZM A;  1ASV A;  4KV8 A;  4L8R B;  4FJ9 A;  2BGG A;  2KZZ A;  3AO2 A;  4FJX A;  1A5W A;  4ZTF A;  3V1R A;  1RBT A;  3V81 A;  1JLQ A;  3C6T A;  1JLA A;  2HHW A;  3K58 A;  1YTA A;  4DTJ A;  3RRH A;  3JSM A;  2GBZ A;  1EXQ A;  4C8L A;  1JLB A;  3LAM A;  3VQC A;  5SZT A;  4DF4 A;  1BQM A;  3AA3 A;  3AVG A;  4NCA A;  2Z1I A;  2DFE A;  3PO4 A;  1JLF A;  4B9U A;  4F3O A;  4FK4 A;  1JLG A;  3MEG A;  5C42 A;  2D0C A;  2WOM A;  4HUF A;  1VSH A;  3NE6 A;  3S3O A;  3T3F A;  4PY5 A;  4ELT A;  1CXQ A;  1XC9 A;  1KTQ A;  4RW8 A;  1BIS A;  3ASM A;  4AHS A;  5C25 A;  3E01 A;  4QCL A;  4CFB A;  2BAN A;  1U47 A;  3G10 A;  4GVM A;  3MED A;  1S9E A;  4CF2 A;  3EZ5 A;  1YTU A;  3KLG A;  2VWJ A;  4KB1 A;  4FLV A;  1RTJ A;  1EP4 A;  1TKZ A;  3HO1 A;  1SUQ A;  3SI6 A;  3TAQ A;  3QIO A;  4CHZ A;  4DTO A;  3O3G A;  4I9Q A;  2HVH A;  2HW3 A;  4QAG A;  4KI4 A;  3HVR A;  4IDK A;  5KRS A;  3NCI A;  1HRH A;  3QEX A;  3CM6 A;  3HK2 A;  2HND A;  4PUO A;  1LWE A;  1LW0 A;  4Y1D A;  4W5O A;  3KTQ A;  4E19 A;  4HUE A;  3HP9 A;  1KFD A;  3DYA A;  3I8D A;  1WSJ A;  4BE0 A;  3MEC A;  1IKY A;  4CE9 A;  3NF7 A;  1FK9 A;  4Z4I A;  5JS1 A;  3SJJ A;  4FJM A;  1WAJ A;  3K2P A;  3LP3 A;  3L2V A;  4CHY A;  4ZHR A;  4CJE A;  3IAY A;  4M3W A;  2D5R A;  2ZD1 A;  1T7P A;  3KKR A;  4CF1 A;  3NH1 A;  3HXM A;  2W42 A;  1RTD A;  4E89 A;  4OKJ A;  4J2B A;  3AVN A;  4DFK A;  2B6A A;  1HNV A;  1Q8I A;  3LPT A;  3QIN A;  1NKC A;  4B3O A;  4MQ3 A;  3SCX A;  2G8V A;  4OLB A;  1JXE A;  5HRP A;  4C8M A;  4N76 A;  2HHV A;  1KSP A;  1K6Y A;  2PY5 A;  3DRR A;  4IG3 A;  1XHX A;  4CJT A;  3KLH A;  4RW6 A;  1A5V A;  1VRU A;  1RDA A;  1HYS A;  4F8R A;  2XHB A;  3SZ2 A;  4DS4 A;  3CG7 A;  4CF8 A;  4W5N A;  4FLY A;  5JS2 A;  4M3Z A;  4KHY A;  1TL1 A;  1QQC A;  2OPS A;  4E3S A;  1ZBU A;  3ZT2 A;  2IGI A;  3HP6 A;  3RMB A;  1NKE A;  3HL8 A;  1RT6 A;  1KCF A;  3RTV A;  1B92 A;  3QNO A;  2HHQ A;  4DQQ A;  2KFZ A;  3H08 A;  1NOZ A;  4AIL C;  3OYN A;  3ALY A;  4CEF A;  4CIF A;  3DRP A;  1TV6 A;  2ZQB A;  2YNI A;  4H4O A;  4CEA A;  4OPJ A;  1IG9 A;  3AVI A;  4BDP A;  2G8I A;  5FDL A;  3ISN C;  3ZT3 A;  2KW4 A;  5KRT A;  1NK5 A;  1B9D A;  1YT3 A;  3DLH A;  2AJQ A;  3LPU A;  3PX6 A;  1S5J A;  4DF8 A;  5HLF A;  3C94 A;  2G8F A;  4CHP A;  4W5R A;  4H8K A;  3MXJ A;  1VSE A;  3L3V A;  1KVB A;  1T8E A;  3LAK A;  2DFH A;  5KTQ A;  4B9S A;  3PY8 A;  1ZYQ A;  4CJU A;  1QHT A;  3DLK A;  1BHL A;  4CK2 A;  2G8K A;  3NFA A;  1A5X A;  1I39 A;  2IS3 A;  3VQP A;  4W5Q A;  2VG7 A;  1WAF A;  2F8S A;  4E1M A;  2X74 A;  1C1C A;  3LWL A;  4DQR A;  4C8K A;  3HT3 A;  4CJV A;  3PO5 A;  1SKW A;  4HVJ A;  3SUP A;  1IKW A;  4I7F A;  3TAF A;  1S1U A;  3KD5 E;  4M45 A;  2X6N A;  2B5J A;  3QO9 A;  1RDD A;  3DRS A;  4DTX A;  1SKS A;  4FJI A;  4E7K A;  2YHB A;  3G0Z A;  2D0B A;  3SPY A;  1NKB A;  3VA3 A;  3RWU A;  2QK9 A;  1X1P A;  4IFY A;  4LH5 A;  3MAQ A;  4FZZ A;  3AVH A;  1D5A A;  1EET A;  1CLQ A;  3L2W A;  2NUB A;  2ETJ A;  4J2D A;  3VA0 A;  2BDP A;  1KFS A;  3V4I A;  1BQN A;  1KLM A;  4Q0B A;  4GMJ B;  1O1W A;  3NHG A;  1UA1 A;  1VRT A;  4RW7 A;  1EX4 A;  3WNF A;  1KLN A;  3LZJ A;  1SL0 A;  3ZSX A;  5J2P A;  1BIU A;  1FKP A;  1JKH A;  1SL1 A;  2B4J A;  1C0U A;  4FJ5 A;  4KTQ A;  3CM5 A;  3VQ8 A;  1U4B A;  1XI1 A;  1FXX A;  4BWJ A;  4KHU A;  4CHQ A;  4DTN A;  1ZBH A;  4AH9 A;  4K8X A;  1XHZ A;  4PA1 A;  4DSJ A;  2IC3 A;  3V9Z A;  1HQE A;  3QEW A;  4B9N A;  4FM1 A;  4I2P A;  3RMA A;  4IG0 A;  4CEE A;  3HVT A;  4EP5 A;  2QKK A;  2EX3 A;  4DS5 A;  3D0P A;  1WLJ A;  3LDS A;  4DTM A;  5J2Q A;  3THV A;  1RTI A;  4Y1C A;  4CFC A;  3AVK A;  3ZCM A;  3OYH A;  3SPZ A;  4OVL A;  3AO1 A;  5CZ1 A;  3VQ4 A;  1X9M A;  3NDK A;  2I5J A;  2FBX A;  1X9S A;  1RBV A;  1SL2 A;  1RIL A;  4FYD A;  4DFP A;  1RT1 A;  2XY7 A;  1SV5 A;  4LSL A;  1TVR A;  1Z26 A;  3DOK A;  3VQQ A;  2YNF A;  3HPO A;  4FJG A;  4B8C A;  3K5L A;  1WNS A;  3S3N A;  4CJP A;  2PYL A;  3CQ8 A;  2HHT A;  3KK1 A;  1KRP A;  4DSI A;  2YV0 X;  2Z1G A;  1GOA A;  3K59 A;  1RNH A;  1Y97 A;  2HNZ A;  1TK8 A;  1J54 A;  2YKM A;  3NGZ A;  3L8B A;  4CK1 A;  3TAN A;  1J53 A;  3V1Q A;  4CCH A;  1RTH A;  2D0A A;  2G8W A;  3QEP A;  2DTU A;  3V9X A;  4BWM A;  3C6U A;  2GUI A;  4DTS A;  3M8P A;  4LY7 A;  4C8O A;  4M3Y A;  2F96 A;  5DK5 A;  3NBP A;  4AHR A;  5HRS A;  2P5O A;  4FK0 A;  1WSF A;  5FRN A;  4CIE A;  2P5G A;  4LSN A;  4B08 A;  4C8N A;  3O3F A;  1QS4 A;  4Z4E A;  4OLA A;  4ELU A;  5KGX A;  3NGI A;  3TAP A;  3DLB A;  3OYC A;  4IKF A;  1S9G A;  3I0R A;  3TAR A;  1RT3 A;  4TSX A;  4NYN A;  3ZSR A;  1DTQ A;  4ID1 A;  1J9A A;  3HPG A;  2JGU A;  4OKK A;  3TI0 A;  1HYZ A;  1GOB A;  3OYF A;  1NJY A;  1CZ9 A;  4BDZ A;  4KTZ A;  3AVC A;  3OS2 A;  4CGJ A;  1KVC A;  4CJL A; 
#chains in the Genus database with same CATH topology
 4JLH A;  3M1F A;  1VSD A;  1U2V A;  1K8K A;  3AA5 X;  3U4L A;  4FLX A;  4IZ9 A;  4OPK A;  4U7B A;  1UAX A;  5J1E A;  4U67 L;  1C1A A;  2O8B A;  4F4K A;  1IBL K;  4CGD A;  4OX9 K;  2P9N A;  5EU7 A;  1V4S A;  3DLE A;  1NOY A;  4FVU A;  3ZT4 A;  4DSK A;  3J81 O;  1YJN N;  2WC9 A;  3WNH A;  3B6P A;  4DR1 K;  1ASW A;  3SMP A;  2O8C A;  3KK2 A;  4RW4 A;  3D6R A;  2RHK A;  1W9H A;  5M1N A;  2PBD A;  5SWM A;  4BRC A;  3WEE A;  4DTR A;  2QWO A;  3TWH A;  3PX0 A;  4GVE A;  4ZTJ A;  3SUN A;  3ITH A;  4RG8 A;  4CJQ A;  3HJF A;  5C2F A;  4OGC A;  3TSP A;  3ZEU B;  3DM2 A;  3EZW A;  3L2R A;  1YVU A;  3VGL A;  1WSE A;  4ILJ A;  4CZI A;  5AQS A;  3PLA A;  3AGK A;  2Q3S A;  4BE1 A;  1NU0 A;  2ZJP L;  1VQP N;  3L3U A;  2E4L A;  4CF0 A;  1N33 K;  4CF9 A;  1IKV A;  3IG1 A;  3FLC O;  1VQ8 N;  1IH7 A;  5D3G A;  5T7B A;  4HUG A;  3A5N C;  1S1V A;  3KLI A;  4KH6 A;  1Y64 A;  1S6Q A;  4B1V A;  4RCH A;  4BGA A;  4JRQ A;  2J4R A;  2VQE K;  4JK7 A;  1I3A A;  3TAG A;  4BRN A;  3NVK A;  2RN2 A;  1NGF A;  4OJR A;  3TSU A;  3I0S A;  4HTL A;  1W7A A;  1XUP O;  2OPQ A;  3SAG A;  4QOZ B;  2ITG A;  5EX5 A;  2P9I B;  1N5Y A;  3I8B A;  3VGM A;  3OTO K;  1SQK A;  5MLC Q;  4NXM K;  2E6M A;  1RBU A;  3THX A;  3OS1 A;  1J5O A;  4OGE A;  1KAX A;  1J5E K;  2YKN A;  2FBY A;  4CJ4 A;  4JI2 K;  4FXD A;  2WBN A;  2Q0R A;  3VQB A;  4GV6 A;  4B9Q A;  3TAM A;  5LY3 A;  2XO7 A;  3ENB A;  1NGE A;  2ZJR L;  3TSQ A;  3FR0 A;  1ZC6 A;  3DOL A;  4CHN A;  3O4N A;  4DV6 K;  2HHX A;  4Z4C A;  3QES A;  4CFD A;  3KK3 A;  3SV3 A;  4YHH K;  4O8K A;  3SK3 A;  1BI4 A;  1LAW A;  1QSS A;  4NCB A;  4DWI A;  4IBN A;  3PIO L;  3QEI A;  3TAB A;  3HRG A;  4ISF A;  5CE3 A;  1ZBL A;  5CY4 A;  1HQU A;  4CGG A;  3MXI A;  2QTD A;  3DI6 A;  1TL3 A;  3VES A;  4FCY A;  4J2E A;  4RTF D;  3THY A;  3EEQ A;  2HNY A;  3MEE A;  4FK2 A;  4NYF A;  4BE2 A;  3ID6 A;  4FJ8 A;  3K5N A;  5GIP A;  4AHU A;  2RF2 A;  4B9L A;  4JKF A;  3VGK A;  3CYM A;  1NGJ A;  4FLT A;  1WSG A;  5J2M A;  3U3G A;  5E41 A;  1EQY A;  4Z4H A;  1BL3 A;  4LF8 K;  2OCE A;  1GLB G;  4PQU A;  2PYJ A;  1EKE A;  3O1B A;  1NJI O;  4ISE A;  1BA1 A;  5ELZ A;  1D9F A;  2X78 A;  4XIU A;  3FE1 A;  3WNE A;  1BI4 B;  4OPH A;  1OH6 A;  1JCF A;  3O3H A;  1S72 N;  2OTJ N;  4CEZ A;  1QSL A;  1U49 A;  4FJ7 A;  3VQ9 A;  3NF9 A;  5KGW A;  5IWA K;  3LP2 A;  4FZX C;  3WXM B;  1VQN N;  5AQN A;  4BVO A;  3OYM A;  1TAU A;  3CFO A;  4DSE A;  5JVG L;  1Z05 A;  3OJS A;  3IUC A;  3THY B;  4CBW A;  5AZI B;  5DM7 L;  3ZEU A;  4NLB A;  5I42 A;  1NK9 A;  5C0Y A;  3NF8 A;  4B9T A;  1M90 O;  4BG9 A;  3OY9 A;  3HSC A;  3MWT A;  1C0M A;  5BRH A;  4CJW A;  3K5O A;  2NRT A;  1YVN A;  3LAL A;  4DLG A;  3OHR A;  1VAZ A;  4JI5 K;  2YNG A;  2ATQ A;  1Q86 O;  3RRG A;  2VWK A;  5DMR A;  2NRR A;  2Q31 A;  3NMU A;  2QI2 A;  3WXI A;  4ZTF A;  1SAZ A;  2ASP A;  1JLA A;  3RRH A;  4FL9 A;  1EXQ A;  3VQC A;  2ZGZ A;  3AVG A;  3BZC A;  2ZM6 K;  3PO4 A;  4ISG A;  5AR0 A;  4B9U A;  3MEG A;  2D0C A;  4K0K K;  4ELT A;  1XC9 A;  4RW8 A;  4XH4 A;  5DM6 L;  4CF2 A;  1YTU A;  3KLG A;  4KB1 A;  4JKG B;  1RTJ A;  5AQU A;  4CZL A;  3O3G A;  1DT9 A;  3D2F B;  3M5R A;  4B1Y B;  2HW3 A;  3CM6 A;  2HND A;  4CJ7 A;  5BRF A;  3HP9 A;  4BRG A;  3NF7 A;  3SJJ A;  3K2P A;  4CHY A;  3ZX3 A;  4K42 A;  5LL6 Z;  2ZD1 A;  1N32 K;  5AFU H;  2W42 A;  1TYQ A;  3CIP A;  1NKC A;  2O8E A;  2G8V A;  4BC5 A;  4H03 B;  5HRP A;  4DCH A;  3WEE B;  4CJT A;  5LMN K;  3PSF A;  3KLH A;  4RW6 A;  1VRU A;  4GKJ K;  4OO1 J;  4F8R A;  1HYS A;  3CG7 A;  4W5N A;  4M3Z A;  2FSK A;  2YHY A;  4E3S A;  1ZBU A;  4H5N A;  2O8D B;  2IGI A;  4NB4 A;  1KCF A;  3RTV A;  3QNO A;  4DQQ A;  3OA9 A;  2KFZ A;  3Q7B A;  3EKU A;  4FWQ A;  4WQ4 C;  4F9O A;  4BR2 A;  4CEA A;  2P9U B;  5FDL A;  3ISN C;  5JMV A;  3C7N A;  5AQY A;  4Z94 A;  1S5J A;  3C94 A;  4CHP A;  4W5R A;  3MK6 A;  5AZI A;  3W0L A;  2FSJ A;  3ENO A;  3WUH A;  3PY8 A;  3QIC A;  3D2E A;  2G8K A;  3BY5 A;  1I39 A;  4IWV A;  4MDB A;  1ATN A;  3HBT A;  5BPN A;  1VQ6 N;  4EHT A;  3SUP A;  1IKW A;  4I7F A;  4IOA L;  1S1U A;  5F1X A;  4IFE A;  2B5J A;  4DTX A;  4CZM A;  3G0Z A;  1X9J A;  2WFB A;  2QK9 A;  3UKR B;  1W2B M;  4IFY A;  3MAQ A;  3IDH A;  4JN4 A;  5F0X A;  2NUB A;  3DXM B;  2BDP A;  3V4I A;  1KLM A;  3CF5 L;  3E9O A;  2W6K A;  4RWT A;  1D4X A;  2FF6 A;  2QM1 A;  1UA1 A;  4YOW A;  1KLN A;  2IVP A;  4WFB L;  3ZSX A;  3LZJ A;  1C0U A;  4KTQ A;  3CM5 A;  1U4B A;  1GLE G;  2HBJ A;  2PFU A;  1ZBH A;  2P9K B;  3CET A;  3J7Y P;  4CZF A;  1Z6R A;  5AQT A;  4FM1 A;  4CEE A;  4EP5 A;  3CPW M;  4DS5 A;  3D0P A;  1WLJ A;  3CCV N;  1OH7 A;  3LDQ A;  4IEI A;  4CFC A;  4IOX A;  1TUU A;  4OVL A;  3VQ4 A;  5CZ1 A;  4BRP A;  2JWK A;  3NDK A;  1GLJ O;  2ASO A;  1Z26 A;  4DV5 K;  2FLO A;  4CBX A;  4A57 A;  2YKM A;  4JNE A;  2UU9 K;  4DUZ K;  3V9X A;  3CXC M;  2GUI A;  3BUZ B;  4M3Y A;  4C8O A;  3BF3 A;  3MMV A;  2P5G A;  4B08 A;  4GY2 B;  2VGN A;  3RVC A;  1S9G A;  4KHP K;  5F2R A;  1RT3 A;  4TSX A;  5LMU K;  4NYN A;  3ULE B;  4FWM A;  1DTQ A;  4JI8 K;  1J9A A;  3HPG A;  3LL3 A;  4LF9 K;  4V19 S;  4PL8 A;  3BP8 A;  3AVC A;  4CGJ A;  3F2K A;  4CJL A;  1QSY A;  2F7T A;  3MDQ A;  1Q81 O;  2BTF A;  4WE1 A;  2OYQ A;  4M3X A;  3P39 A;  3C6A A;  3RSE B;  2Y1I A;  4Q5V A;  2OAN A;  4EP4 A;  4DU3 A;  4FOE A;  1NK4 A;  5FRM A;  3KLF A;  1QQM A;  1XMQ K;  3ZX2 A;  1W0H A;  5EY4 A;  4NLC A;  4DR2 K;  3FZF A;  1OH5 A;  4I6M B;  3WXL A;  2CGJ A;  1RBS A;  5LJW A;  1U45 A;  3V6D A;  3EE8 A;  2CGK A;  2HHU A;  4KFB A;  2UXD K;  3O8M A;  1ATR A;  3V9U A;  3EKS A;  4LFC K;  4N41 A;  1IV0 A;  5GIN A;  4I6M A;  3WQU A;  1F21 A;  3SQ1 A;  1D9D A;  3CCR N;  1KD1 O;  1RDC A;  1S1X A;  4OKE A;  1N6Q A;  3KKS A;  3CC7 N;  1NG9 A;  5AQJ A;  4BC3 A;  3KD1 E;  1NK7 A;  3GBT A;  4CD1 A;  2GX9 A;  1CXU A;  3OYA A;  4FM2 A;  2A6A A;  2A41 A;  2QEX N;  1ASU A;  1NJW A;  1LV5 A;  1SKR A;  2ZE2 A;  4IJA A;  3T1A A;  1RBR A;  1BWF O;  3CMA N;  2E8A A;  3O9S A;  3SUO A;  2FC0 A;  4JAX A;  5EXW A;  2A1S A;  4O44 A;  3SUQ A;  3L2U A;  4BC4 A;  4JK8 A;  5AQW A;  3RR7 A;  3C65 A;  1NGD A;  3V9W A;  4PL7 A;  4YDU A;  2E6L A;  2RPI A;  1DTT A;  5FRO A;  1VSJ A;  4JS4 A;  1EO1 A;  1U2V B;  3J8A A;  4MFB A;  3U3Y A;  2DPN A;  4O5B A;  1T03 A;  3IS9 A;  3MX5 A;  1YI2 N;  3SLC A;  3ULD A;  3P38 A;  2OPP A;  1WBB A;  1T6D A;  2UXB K;  3AAP A;  3AO3 A;  3RMC A;  2F9T A;  4UY8 O;  2KFN A;  2AP1 A;  2P9U A;  4JV5 K;  3QET A;  3Q7C A;  3R6M A;  4EZ9 A;  2UYT A;  5JLH A;  4DQS A;  3I56 N;  1GLL O;  4O55 A;  1MU2 A;  2IDO A;  4M7X A;  4WQ4 A;  4F2S A;  4KAZ A;  3A0I X;  3G6E N;  4FLZ A;  1LAV A;  4O4G A;  4CFA A;  4O0J A;  5C24 A;  3AO5 A;  1RGI A;  1C0T A;  3OYD A;  1L3V A;  1K8A O;  3DLG A;  2Q1N A;  2V52 B;  3G25 A;  2YHA A;  4DFM A;  1NNE A;  4G1Q A;  1VQ4 N;  2NRV A;  3PUF A;  1KQS M;  1TAQ A;  4KHS A;  4CJR A;  4ID5 A;  4B1W B;  2OPR A;  1REV A;  1JJ2 M;  1OVQ A;  2QXL A;  4DSF A;  3G4S N;  4FLW A;  3E66 A;  4CES A;  1TKT A;  4IXC A;  3WXJ A;  3H45 C;  3J7A P;  1MDU B;  4FWN A;  3OVN A;  1BU6 O;  3P1G A;  3AVB A;  3PSI A;  4EHU A;  5H1S Q;  1HYV A;  3I33 A;  1YUW A;  4N5S A;  4DFJ A;  4I9L A;  4B9M A;  5HRN A;  2H3G X;  3QNN A;  2AA4 A;  3P5J A;  1NM1 A;  4Z4G A;  3E9L A;  3A2F A;  2E1Z A;  2D0O A;  2EHG A;  4JD2 A;  1BOT O;  3F9M A;  1YJW N;  3M8Q A;  1VK0 A;  1QHA A;  1RT2 A;  4FZY A;  3VQE A;  3L0Q A;  3VEW A;  1CZB A;  1SZ2 A;  1JCE A;  4KI6 A;  4BR7 A;  5HRR A;  2NNW A;  4JKC A;  5JIC A;  4AQY K;  5BR9 A;  1WBD A;  3M6G A;  3LZI A;  3DLR A;  4CGI A;  1LCU A;  5AQZ A;  3T19 A;  4FLU A;  3TR8 A;  4JKD A;  5KQD A;  3SQ4 A;  3DMJ A;  3HYF A;  5AQV A;  3NGY A;  2KTQ A;  1IG8 A;  3HTV A;  3L2Q A;  2UUC K;  3EO3 A;  4HHT A;  1NJZ A;  3D45 A;  2VG6 A;  5JLF A;  2NRW A;  1OKJ A;  5I9E B;  3M8R A;  2QWM A;  3BEX A;  1RDB A;  4KTW A;  3OW2 M;  4KPY A;  1QE1 A;  3ZSY A;  4CHO A;  4AM6 A;  2KZM A;  4FJ9 A;  2YHW A;  4WFA L;  4L8R B;  3GL1 A;  1A5W A;  3B8A X;  2WUS A;  4A2A A;  4DTJ A;  3JSM A;  4GKK K;  1ILY A;  5BPM A;  1ZXO A;  3LAM A;  5SZT A;  4DF4 A;  2GEL A;  2Z1I A;  2DFE A;  1HR0 K;  4F3O A;  4BQZ A;  4FK4 A;  1JLG A;  4HUF A;  1E3M A;  3NE6 A;  4YOV A;  3D7E O;  1BIS A;  3ASM A;  4FO0 A;  1DKG D;  4QCL A;  4GVM A;  3MED A;  1S3X A;  2VWJ A;  2QWL A;  4FLV A;  1TKZ A;  1XMO K;  2Q36 A;  3QIO A;  2W40 A;  2YHX A;  4JI4 K;  1BUP A;  4L3Q A;  4QAG A;  4KI4 A;  3SAF A;  3QEX A;  4Y1D A;  2P9I A;  4W5O A;  3P31 A;  3AY9 A;  1KFD A;  3DYA A;  3ZET A;  3MEC A;  1IKY A;  4CE9 A;  1YJ9 N;  4FJM A;  4JKG A;  3LP3 A;  4XH1 A;  1X3N A;  4CJE A;  3ID8 A;  1T7P A;  3KKR A;  2D4W A;  4PKG A;  4CF1 A;  1RTD A;  3AVN A;  2B6A A;  4B3O A;  5KQ8 A;  3SCX A;  1NMN A;  4DR3 K;  4N76 A;  4IG3 A;  1XHX A;  1BDG A;  1RDA A;  3CJC A;  3SZ2 A;  4X66 K;  4DS4 A;  4DR5 K;  2E2N A;  4KHY A;  1NGG A;  2NRZ A;  3ZT2 A;  1QZ6 A;  3UKR A;  4CVN E;  3HL8 A;  4WF9 L;  1NWK A;  5C10 A;  3K9K A;  3H08 A;  4DV0 K;  1NOZ A;  4AIL C;  2O8B B;  3DRP A;  4H4O A;  1YXQ A;  1IG9 A;  5KRT A;  4J8F A;  1B9D A;  1N8R O;  1KC8 O;  2AJQ A;  3VER A;  2G8F A;  4DF8 A;  3O6W A;  3LAK A;  2DFH A;  3KZB A;  2D1K A;  1ZYQ A;  1H1V A;  1BHL A;  2O8F B;  3NFA A;  4R79 A;  2F8S A;  1NMD A;  4E1M A;  1HNX K;  2X74 A;  1C1C A;  4DQR A;  4C8K A;  3PO5 A;  3C7N B;  4BRF A;  2E88 A;  3OBY A;  1BO5 O;  3KD5 E;  1SKS A;  3DRS A;  1VHX A;  1NKB A;  3RWU A;  1X1P A;  5E84 A;  1YAG A;  3CJA A;  4LH5 A;  1D5A A;  3CJ7 A;  1CLQ A;  4NO7 A;  2ETJ A;  4J2D A;  4FWP A;  1BQN A;  4PKI A;  1Q82 O;  2QWR A;  4MO4 A;  1SL0 A;  1BIU A;  1JKH A;  3CCS N;  4KH4 A;  1T3V A;  4QS7 A;  5FLX O;  2W41 A;  1XI1 A;  4X64 K;  4KHU A;  4CHQ A;  2QWN A;  4K8X A;  1XHZ A;  3EE9 A;  4PA1 A;  4DSJ A;  2IC3 A;  4KH5 A;  3RMA A;  4I2P A;  2QKK A;  1RFQ A;  3AVK A;  3OYH A;  5GAG P;  4A61 A;  5EOY A;  2FBX A;  1X9S A;  1RIL A;  4JI3 K;  1CZA N;  4JI1 K;  2YNF A;  3HPO A;  5KPZ A;  4FJG A;  3D2F A;  4B8C A;  4CJP A;  3VEV A;  1LOT B;  4FPA A;  3SAH A;  3VEN A;  3L4I A;  1TK8 A;  1J54 A;  3L8B A;  4BRL A;  5TKW A;  4CK1 A;  3MCP A;  1WOQ A;  3V1Q A;  3K0S A;  2D0A A;  3QEP A;  4BWM A;  3C6U A;  2CGL A;  2P9L B;  4DTS A;  2F96 A;  5HRS A;  2P5O A;  1MWK A;  1WSF A;  2Q0U A;  4Z4E A;  4C8N A;  3QFP A;  4OLA A;  3TAP A;  3OYC A;  1HLU A;  5AQQ A;  3TPQ A;  4ID1 A;  4FWO A;  2A40 A;  3TI0 A;  3H3N O;  1CZ9 A;  4BDZ A;  4KTZ A;  1EWR A;  3L4Q A;  3OS2 A;  3A5O C;  2ZGY A;  1NGC A;  3DXK B;  4DB3 A;  4LFA K;  1VQL N;  4LD0 A;  1HX1 A;  2KLA A;  4DMN A;  5AQO A;  1TKX A;  1R0A A;  4KB0 A;  4UQG A;  3SYZ A;  3ZSZ A;  1E4G T;  4A5A A;  1L3U A;  4CJS A;  4B3T K;  4WYB A;  2GTD A;  1VSM A;  2QW9 A;  3LDP A;  3AA2 A;  3I55 N;  2G8H A;  3O1W A;  4H0Y B;  4Z4F A;  1GLD G;  4DQI A;  4LF4 K;  3FZM A;  3OYJ A;  2IOC A;  1TKD A;  3QML A;  1JCG A;  5I3U A;  4H5W A;  3F9K A;  4FWR A;  4F2R A;  2QWP A;  4GNI A;  4C23 A;  2RKI A;  2OZS A;  1NK0 A;  1E4F T;  4HTU A;  4X62 K;  4JYA K;  4JKH A;  4HCC A;  4YOX A;  4FJN A;  4E7J A;  1HMV A;  1K73 O;  1IO2 A;  3O9R A;  3SV4 A;  4M42 A;  2VG5 A;  5FPN A;  4E7I A;  4FJL A;  3K57 A;  1NK8 A;  3MXM A;  1T05 A;  3S3M A;  3ZSQ A;  4B1X B;  3HPH A;  2YNH A;  3NH0 A;  2HOE A;  3CHW A;  3SMS A;  3RR8 A;  3PIP L;  1VSL A;  3QEV A;  1C0F A;  1WSH A;  4E0D A;  5C12 A;  3WXK A;  1HNI A;  1LW2 A;  5BN9 A;  1YIT N;  3K5M A;  1B9F A;  3F73 A;  3CCM N;  1S22 A;  2HMP A;  4YDU C;  4CGF A;  2BE2 A;  4AHV A;  3AO4 A;  4CJ5 A;  4DQP A;  1BGX T;  2XY8 A;  3VTH A;  3VEX A;  3VEZ A;  4H0V B;  2BUP A;  5GIO A;  3VOV A;  2G8U A;  5E26 A;  3VF4 A;  4N47 A;  2W6L A;  2GWK A;  3ZX0 A;  3IRX A;  3KLE A;  3VQD A;  4H5V A;  3AAQ A;  3KHY A;  3ZYY X;  3S9H A;  4LF6 K;  4BG8 A;  1JL1 A;  3KIO A;  1WSI A;  5AQG A;  5HL7 L;  4DG1 A;  1UOC A;  3A5L C;  4C1N K;  4HCB A;  4CJK A;  1C1B A;  2E5L K;  3HST B;  3NAE A;  2E2Q A;  1P90 A;  4YNQ A;  3G71 N;  4IEE A;  1IBM K;  2V7Z A;  2P9K A;  4M3R A;  1ITG A;  2GEM A;  2GV9 A;  3CCE N;  5IT9 O;  1NBW A;  1RT5 A;  3DLL L;  4KRE A;  5LJV A;  3O9Q A;  2A1R A;  1VSF A;  3V1O A;  4W5T A;  1W97 L;  4DU1 A;  2QKB A;  4CED A;  2KKZ A;  5HBM A;  4CZG A;  3PX4 A;  3KJV A;  1KVA A;  4DUY K;  4QS8 A;  2VYP A;  4JS5 A;  3ENH A;  3JS6 A;  2R7Y A;  3CJB A;  4DU4 A;  1YHQ N;  3SNN A;  3MWP A;  3VQ5 A;  5ADX A;  3NH2 A;  1JL2 A;  2XY6 A;  2ZJQ L;  3L6Q A;  5KI6 A;  4PHT X;  4KHQ A;  1JLE A;  1LWF A;  3AA4 A;  1RDW X;  2IAJ A;  2FSN A;  5JVH L;  2DY4 A;  3GE1 A;  5CYQ A;  1S6P A;  5AFU A;  4R5P A;  4A5B A;  3OYI A;  3A5M C;  4CZK A;  4CZJ A;  4OPA A;  4BRM A;  3MN5 A;  2IVO A;  3RMD A;  3LP0 A;  2Q97 A;  4EZ6 A;  3OS0 A;  1QTM A;  4KRF A;  3HM9 A;  1VSI A;  2HMI A;  3V9S A;  3P4I A;  3QLH A;  4JRP A;  2LSN A;  2P1J A;  1Z25 A;  2FBT A;  4B3R K;  3ZT0 A;  4DR4 K;  3EY1 A;  3AVL A;  4WFN L;  4DV2 K;  4DSL A;  4A62 A;  1TK5 A;  1TGO A;  3O80 A;  4FJK A;  3QBW A;  3U9Z A;  3MCA B;  3ZT1 A;  5CYM A;  3OYL A;  1VQO N;  5HRO A;  1UA0 A;  3H46 O;  3SQ2 A;  4FOI A;  3SJH A;  1N36 K;  5AQL A;  2FBV A;  4YOY A;  1RT4 A;  1GOC A;  3LP1 A;  4M3T A;  4JKE A;  2XRI A;  3BDP A;  2GWJ A;  2KQ2 A;  2Z1H A;  4E7H A;  3CQX A;  2HB5 A;  1NLV A;  5M1K A;  3QIP A;  4BRE A;  1NK6 A;  2E1Y A;  3M3Z A;  4B8A B;  5BN8 A;  4X65 K;  2PAV A;  3HM8 A;  1VQK N;  1JXB A;  4I2Q A;  2A42 A;  4DTP A;  3UIQ A;  1BA0 A;  1IJJ A;  2JWL A;  4FWS A;  2QXF A;  4YFU A;  3VQA A;  4N56 A;  3OBW A;  4ELV A;  3ZET B;  5AQM A;  1NGA A;  4KV8 A;  3AO2 A;  4FJX A;  3V1R A;  1RBT A;  4KBO A;  3C6T A;  3K58 A;  1YTA A;  4AF1 A;  5FPM A;  3AA3 A;  2VGM A;  1T44 A;  3K9J A;  1JLF A;  3S3O A;  5C42 A;  2WOM A;  3UB5 A;  3T3F A;  1CXQ A;  4AHS A;  3VTI A;  3E01 A;  4CFB A;  2BAN A;  1U47 A;  3G10 A;  3H6E A;  3VEY A;  1VQ5 N;  3H3O B;  4ILH A;  2V51 B;  3DXK A;  4EFH A;  3VET A;  3SI6 A;  3TAQ A;  4WCE L;  4B3M K;  4JKB A;  4I9Q A;  4BRO A;  4CZE A;  5B8H A;  3T1Y K;  1ZBS A;  4K25 A;  4O8U A;  4IDK A;  3NCI A;  2VQF K;  3CCU N;  1LWE A;  1LW0 A;  2QA4 N;  4E19 A;  4HUE A;  3I8D A;  1WSJ A;  2A3Z A;  2VWB A;  4Z4I A;  5JS1 A;  1U6Z A;  4Y0W A;  4FPB A;  3MN7 A;  4ZHR A;  4IO9 L;  5AQI A;  2D5R A;  4OKJ A;  4DV7 K;  1WUA A;  1HNV A;  1Q8I A;  5C15 A;  5C2D A;  1JXE A;  3CC2 N;  2PY5 A;  3IFR A;  4H5R A;  3U9D A;  1N34 K;  2OTL N;  2XHB A;  4CF8 A;  4JI6 K;  5JS2 A;  4DQ8 A;  2OPS A;  3RMB A;  3HP6 A;  1NKE A;  1RT6 A;  3C6H A;  1B92 A;  1O13 A;  3UE5 A;  3OYN A;  1TV6 A;  4OPJ A;  2G8I A;  4BDP A;  4BY9 C;  4JK9 A;  2KW4 A;  3ZT3 A;  1NK5 A;  1YT3 A;  5FPD A;  3DLH A;  5HLF A;  3VEO A;  1FJG K;  3MXJ A;  1ATS A;  1VSE A;  3L3V A;  1KVB A;  1T8E A;  4MO5 A;  4B9S A;  2HBK A;  2FXU A;  1QQO A;  5KPT A;  4A2B A;  3T1H K;  2IS3 A;  3VQP A;  4W5Q A;  2VG7 A;  1WAF A;  5FPE A;  5BR8 K;  4CJV A;  3ULE A;  4HVJ A;  3FZK A;  4DR7 K;  3E1Y A;  4GV9 A;  4E7K A;  2YHB A;  4QS9 A;  2D0B A;  3SPY A;  3CC4 N;  3W3D A;  3QDK A;  3LM9 A;  4JHD B;  3SBG A;  3LM2 A;  2I7N A;  2EWS A;  1KFS A;  1K9M O;  4GMJ B;  3O4W A;  3NHG A;  1VRT A;  1EX4 A;  4JI7 K;  3DAW A;  4NXN K;  1FKP A;  2B4J A;  4XEI A;  4JEP A;  1V4T A;  3VQ8 A;  3TU5 A;  5M1F A;  1FXX A;  4DTN A;  1GLF O;  3CD6 N;  1M1K O;  3V9Z A;  1HQE A;  2IIR A;  3THV A;  3LDS A;  5AJ3 K;  4Y1C A;  1Q7Y O;  1FW6 A;  4FYD A;  3BZK A;  4DFP A;  4CZH A;  4CBU A;  2ITM A;  1SV5 A;  1TVR A;  1EWQ A;  3F5T A;  3DOK A;  5AZJ A;  1DEJ A;  3T69 A;  4IJN A;  3S3N A;  3CQ8 A;  1KRP A;  4DSI A;  4DV1 K;  4BR4 A;  3DWL A;  1GOA A;  3K59 A;  1RNH A;  3NGZ A;  1TYQ B;  1RTH A;  2DTU A;  2E20 A;  4LY7 A;  3NBP A;  4FK0 A;  4WQ5 A;  5FRN A;  3CJ1 A;  4LSN A;  3O3F A;  4BQL A;  1QS4 A;  1RDU A;  4IKF A;  1QQN A;  3I0R A;  3TAR A;  3ZSR A;  4CI6 A;  5GAH P;  3QFU A;  3CME N;  2BH1 A;  3KWI A;  1NJY A;  1HNW K;  4H5T A;  1KVC A;  3R8E A;  4M7Y A;  3OYE A;  3AVF A;  1HKB A;  5GAD P;  3OYG A;  4YOR A;  2YX6 A;  3LDO A;  5GAE P;  4BR5 A;  1T6C A;  3NF6 A;  4DHY A;  4BR0 A;  2OZM A;  4CEC A;  1BCO A;  3H1V X;  3WQT A;  1DGK N;  1VSK A;  1L5U A;  4E7L A;  2PZS A;  2X6S A;  4CEB A;  2ASM A;  4M3U A;  4IO8 A;  2V7Y A;  4B9V A;  3HI0 A;  4J2A A;  1JLC A;  2JLE A;  1IBK K;  4LH4 A;  4FWL A;  2F9W A;  4IOC L;  3ZSW A;  2HVI A;  3OYB A;  2D0P A;  1HJR A;  3BF1 A;  1C6V A;  1L3T A;  5BRD A;  2VCP A;  4O0I A;  3CER A;  4YOT A;  2P9S A;  3GG4 A;  4YOU A;  4H4M A;  2YJF A;  1WN7 A;  4HWI A;  3VPZ A;  3ZLJ A;  1L3S A;  3FZL A;  3R3L A;  1UWB A;  3J7Z O;  4H0P A;  3OJU A;  2NRH A;  4ICL A;  3VF2 A;  3ZSV A;  4CJ3 A;  3SQ0 A;  2HBL A;  3MN6 A;  4PWD A;  4RW9 A;  1VQ7 N;  4JKA A;  4DTU A;  4BDY A;  1QVF M;  3QB0 A;  4GW6 A;  4KHN A;  1ZBI A;  3PV8 A;  4IFV A;  3P83 D;  1RT7 A;  1VQM N;  4DV4 K;  4BRD A;  4MLH A;  4LC9 B;  3MN9 A;  4K8Z A;  4MLE A;  1KAZ A;  4CGH A;  1I94 K;  3J80 O;  3VN5 A;  4DLE A;  4CER A;  2HHS A;  3U6F A;  3AVM A;  1OVY A;  1DLO A;  1RCH A;  3M8S A;  5AQK A;  1G15 A;  4KKO A;  3VQ7 A;  4M41 A;  2KHO A;  3T7Z A;  4BAC A;  4IDH A;  4AM7 A;  1X9W A;  4CEO A;  2YCH A;  2XY5 A;  4FVM A;  3QER A;  1HPZ A;  3AVA A;  4B3S K;  4LF7 K;  3LAN A;  2E2O A;  2NRX A;  1S1W A;  3ZSO A;  1TUY A;  2Z1J A;  4FJH A;  4H0T B;  2F8T A;  3CFP A;  1LWC A;  3C95 A;  4FM0 A;  3OYK A;  1BCM A;  1HNZ K;  1D8Y A;  5J2N A;  1Q18 A;  4KO0 A;  3THW B;  3TTD A;  1HPM A;  2CH5 A;  3CFR A;  4YY3 K;  3B6O A;  3SBT A;  3HOS A;  1Q9X A;  4AHC A;  4DKW A;  4E1N A;  3WNG A;  1Q9Y A;  3JAM O;  4DR6 K;  4F3T A;  5CR4 A;  4BRA A;  3O4Q A;  3GOI A;  4Z0U A;  5HP1 A;  1QZ5 A;  3FFI A;  3N4Q A;  5AQX A;  3EL2 A;  4KHW A;  3JYT A;  4FJJ A;  4CJF A;  4FW2 A;  5AQH A;  5CHI A;  1BIZ A;  5CZ2 A;  4JD2 B;  3U8X A;  2OA8 A;  1K8K B;  2A5X A;  3TTC A;  2O8F A;  1XNQ K;  5A2Q O;  3D2E B;  5AQR A;  3FFK B;  2DFF A;  1U04 A;  4NCG A;  1NGI A;  2O4I A;  2YJE A;  4LF5 K;  1XNR K;  3BGR A;  2P51 A;  1S1T A;  2WON A;  4C1N I;  1NJX A;  1ZBF A;  2HF4 A;  4BC2 A;  4CK3 A;  3AV9 A;  4CIG A;  4CEQ A;  1U48 A;  1NGH A;  4PKH A;  3AVJ A;  5M1P A;  2ZWH A;  3FGU A;  4FW1 A;  3CQY A;  3CCQ N;  3IKM A;  3A8Y A;  1TK0 A;  4BVP A;  3CI5 A;  3NVM A;  4BR9 A;  4M63 C;  3LDL A;  5AQF A;  1J6Z A;  3VQ6 A;  1FKO A;  2Y1J A;  2O4G A;  2WTU A;  2UUA K;  1IKX A;  3WT0 A;  1XWL A;  3EYZ A;  3TAE A;  3C0B A;  4B1Z A;  3AAR A;  1MA9 B;  4E1J A;  3LWM A;  5K14 A;  4AHT A;  1ASV A;  2O8C B;  2BGG A;  2KZZ A;  2I7P A;  1JLQ A;  3V81 A;  2HHW A;  1XC3 A;  3KWG A;  2GBZ A;  4C8L A;  1JLB A;  1NGB A;  1BQM A;  3N4P A;  2P9P B;  4NCA A;  4GV3 A;  2P9L A;  2GUP A;  5AQP A;  1VSH A;  3RSE A;  4PY5 A;  1KTQ A;  3FZH A;  4BGB A;  4EAH D;  5C25 A;  4MDA A;  3EZ5 A;  1S9E A;  3UKU B;  2P9P A;  5M1O A;  1ESV A;  1EP4 A;  3CPE A;  3HO1 A;  1SUQ A;  4CHZ A;  4DTO A;  3KVG A;  3THX B;  2HVH A;  3HVR A;  4H0X B;  5EVZ A;  5KRS A;  1HRH A;  4DV3 K;  3HK2 A;  4BRI A;  3EN9 A;  5ADX H;  4PUO A;  3CCJ N;  3KTQ A;  2HBM A;  2QWQ A;  4H0O A;  5BRE A;  4BE0 A;  2UUB K;  1FK9 A;  3MX2 A;  1WAJ A;  3L2V A;  2NZT A;  4CD3 A;  2HF3 A;  3IAY A;  4M3W A;  3NH1 A;  3HXM A;  4E89 A;  2YI1 A;  4J2B A;  4DFK A;  3O5B A;  3LPT A;  3QIN A;  3TTF A;  4MQ3 A;  2UXC K;  4OLB A;  2P9S B;  3JXU A;  3H1Q A;  4C8M A;  2HHV A;  1KSP A;  1K6Y A;  3DRR A;  1A5V A;  4BRQ A;  1QVG M;  3DXM A;  5KPR A;  4FLY A;  3ATU A;  3R9P A;  1TL1 A;  1QQC A;  2Q2R A;  4K43 A;  4BRK A;  2HHQ A;  4BRH A;  2FF3 B;  3HOT A;  4K41 A;  3ALY A;  4LFB K;  4CEF A;  4CIF A;  2ZQB A;  2YNI A;  3AGR A;  3AVI A;  5TKY A;  3LPU A;  3PX6 A;  4CW7 B;  4H8K A;  2NLX A;  3VMF B;  3GDQ A;  1MWM A;  5KTQ A;  3S41 A;  4CJU A;  1QHT A;  3DLK A;  4CK2 A;  1A5X A;  5HOO A;  2F4V K;  2CH6 A;  3LWL A;  4JI0 K;  2IVN A;  3HT3 A;  3DJC A;  1SKW A;  1HKG A;  3LDN A;  1G99 A;  5M1Q A;  1R59 O;  3TAF A;  1C0G A;  2P9N B;  4M45 A;  2X6N A;  2ZF5 O;  1SS6 A;  3QO9 A;  1RDD A;  3IMX A;  4FJI A;  4EIA A;  1GLA G;  3VA3 A;  2HST A;  3O9U A;  2O8D A;  1KAY A;  4FZZ A;  3AVH A;  3O9T A;  1EET A;  1XQS C;  3L2W A;  1VQ9 N;  3VA0 A;  1GLC G;  4Q0B A;  1O1W A;  1OH8 A;  1X3M A;  4RW7 A;  3WNF A;  5J2P A;  1SL1 A;  4FJ5 A;  4A59 A;  5AZJ B;  2O8E B;  4BWJ A;  1HUX A;  3QBX A;  4AH9 A;  2HHH K;  3QEW A;  4IG0 A;  3HVT A;  2EX3 A;  5J2Q A;  4DTM A;  1RTI A;  3SPZ A;  3ZCM A;  1YIJ N;  3VF6 A;  3AO1 A;  1X9M A;  2I5J A;  1SL2 A;  1RBV A;  1RT1 A;  4B1U B;  2XY7 A;  4LSL A;  1YF5 L;  3VQQ A;  1HJO A;  3ATV A;  3K5L A;  1WNS A;  2PYL A;  4O5F A;  2HHT A;  3THW A;  3KK1 A;  2YV0 X;  2Z1G A;  1Y97 A;  4WQ5 C;  2HNZ A;  3UKU A;  3TAN A;  4JHD A;  1J53 A;  4CCH A;  3R1X A;  1KXP A;  2G8W A;  4G9Z A;  1P8Z A;  3M8P A;  5DK5 A;  4AHR A;  3O08 A;  3CJ9 A;  4XH5 A;  2RE2 A;  4CIE A;  2E2P A;  3E9P A;  4ELU A;  5KGX A;  3NGI A;  3DLB A;  4FWK A;  1BG3 A;  1HKC A;  5BPL A;  4ILG B;  1WB9 A;  3CCL N;  2JGU A;  3KK7 A;  4OKK A;  1HYZ A;  1GOB A;  3OYF A;  3HZ6 A;  4FSV A;  4B9N A; 
#chains in the Genus database with same CATH homology
 1QSY A;  3OYE A;  3AVF A;  4JLH A;  3OYG A;  2OYQ A;  1VSD A;  4WE1 A;  4LD0 A;  4M3X A;  3AA5 X;  4DMN A;  1TKX A;  3NF6 A;  2Y1I A;  4Q5V A;  4EP4 A;  4DU3 A;  1NK4 A;  4FLX A;  1R0A A;  4UQG A;  3SYZ A;  4OPK A;  3ZSZ A;  3KLF A;  2OZM A;  4KB0 A;  5FRM A;  1UAX A;  1W0H A;  5J1E A;  4CEC A;  1BCO A;  1L3U A;  1C1A A;  4CJS A;  1L5U A;  2PZS A;  1VSK A;  4E7L A;  4F4K A;  2X6S A;  4CEB A;  1VSM A;  4M3U A;  4CGD A;  5EU7 A;  3AA2 A;  3DLE A;  1RBS A;  1NOY A;  4B9V A;  1U45 A;  3ZT4 A;  2G8H A;  4J2A A;  1JLC A;  3V6D A;  4Z4F A;  2JLE A;  4DSK A;  4LH4 A;  2HHU A;  4KFB A;  4DQI A;  3WNH A;  3V9U A;  3B6P A;  3OYJ A;  2IOC A;  1ASW A;  1TKD A;  3KK2 A;  4RW4 A;  5I3U A;  3ZSW A;  3F9K A;  4N41 A;  4F2R A;  2HVI A;  1W9H A;  3OYB A;  1HJR A;  5SWM A;  2RKI A;  2OZS A;  1C6V A;  1NK0 A;  1L3T A;  1F21 A;  3SQ1 A;  1D9D A;  4HTU A;  4DTR A;  1RDC A;  4HCC A;  4O0I A;  4E7J A;  1S1X A;  1HMV A;  4OKE A;  3TWH A;  3PX0 A;  1N6Q A;  4FJN A;  3KKS A;  4ZTJ A;  4H4M A;  3SUN A;  1IO2 A;  3SV4 A;  3KD1 E;  2VG5 A;  3ITH A;  4M42 A;  4RG8 A;  4CJQ A;  3HJF A;  1WN7 A;  4E7I A;  1NK7 A;  1L3S A;  4OGC A;  4FJL A;  3K57 A;  1NK8 A;  3DM2 A;  1CXU A;  1UWB A;  3OYA A;  4FM2 A;  3OJU A;  3L2R A;  3MXM A;  3S3M A;  1YVU A;  3ZSQ A;  1T05 A;  1ASU A;  1NJW A;  3HPH A;  1LV5 A;  2YNH A;  4ICL A;  1WSE A;  3NH0 A;  3ZSV A;  4CJ3 A;  3SQ0 A;  1SKR A;  2ZE2 A;  2Q3S A;  3T1A A;  4PWD A;  4BE1 A;  1RBR A;  3RR8 A;  4RW9 A;  1VSL A;  4DTU A;  3QEV A;  1WSH A;  3L3U A;  4BDY A;  3SUO A;  4E0D A;  1HNI A;  2E4L A;  4GW6 A;  4CF0 A;  2FC0 A;  4KHN A;  1LW2 A;  1ZBI A;  3PV8 A;  4IFV A;  4CF9 A;  3K5M A;  1IKV A;  3IG1 A;  3P83 D;  1RT7 A;  1IH7 A;  5D3G A;  5T7B A;  4HUG A;  1B9F A;  2A1S A;  3F73 A;  4O44 A;  3SUQ A;  3L2U A;  1S1V A;  3KLI A;  4CGF A;  2BE2 A;  4K8Z A;  1S6Q A;  3RR7 A;  4AHV A;  3AO4 A;  4CGH A;  4CJ5 A;  3V9W A;  3VN5 A;  2E6L A;  2RPI A;  1DTT A;  4CER A;  4DLE A;  3U6F A;  4DQP A;  5FRO A;  2HHS A;  3AVM A;  1BGX T;  4JRQ A;  1VSJ A;  2XY8 A;  4JS4 A;  4MFB A;  1I3A A;  1DLO A;  3U3Y A;  1RCH A;  3TAG A;  3M8S A;  4O5B A;  1T03 A;  2RN2 A;  3IS9 A;  1G15 A;  2G8U A;  4KKO A;  4OJR A;  3VQ7 A;  4M41 A;  3ULD A;  2OPP A;  4N47 A;  3I0S A;  2OPQ A;  4BAC A;  4QOZ B;  2ITG A;  3AO3 A;  3IRX A;  1N5Y A;  3RMC A;  1X9W A;  4CEO A;  2KFN A;  3KLE A;  3VQD A;  3S9H A;  3QET A;  2XY5 A;  2E6M A;  4EZ9 A;  1JL1 A;  1RBU A;  4FVM A;  4DQS A;  3KIO A;  1WSI A;  3OS1 A;  4DG1 A;  3QER A;  1UOC A;  1HPZ A;  4O55 A;  1J5O A;  3AVA A;  1MU2 A;  4OGE A;  4CJK A;  4HCB A;  1C1B A;  3HST B;  3NAE A;  2IDO A;  3LAN A;  4YNQ A;  2YKN A;  2FBY A;  4F2S A;  4KAZ A;  4CJ4 A;  1S1W A;  3ZSO A;  1LAV A;  4O4G A;  4CFA A;  4FLZ A;  4O0J A;  4FXD A;  3VQB A;  5C24 A;  3AO5 A;  4M3R A;  2Z1J A;  1ITG A;  4FJH A;  3TAM A;  2F8T A;  2GV9 A;  3CFP A;  2XO7 A;  1LWC A;  3C95 A;  1RT5 A;  1C0T A;  3OYD A;  4FM0 A;  1L3V A;  3OYK A;  4KRE A;  1BCM A;  3DLG A;  1D8Y A;  5J2N A;  4KO0 A;  2A1R A;  1VSF A;  2YHA A;  4DFM A;  3V1O A;  4W5T A;  4G1Q A;  4DU1 A;  2QKB A;  3PUF A;  4CED A;  3CFR A;  3DOL A;  5HBM A;  3B6O A;  4CHN A;  3O4N A;  3PX4 A;  1TAQ A;  4KHS A;  3KJV A;  1KVA A;  4AHC A;  4CJR A;  1Q9X A;  4ID5 A;  4JS5 A;  4E1N A;  2OPR A;  2HHX A;  1REV A;  3WNG A;  4Z4C A;  2R7Y A;  4DU4 A;  1Q9Y A;  3SNN A;  4DSF A;  3QES A;  3VQ5 A;  4F3T A;  4CFD A;  3KK3 A;  3SV3 A;  3NH2 A;  1JL2 A;  4FLW A;  2XY6 A;  5KI6 A;  3O4Q A;  4CES A;  1TKT A;  4Z0U A;  4KHQ A;  1BI4 A;  1LAW A;  1QSS A;  5HP1 A;  1JLE A;  3FFI A;  4DWI A;  4NCB A;  1LWF A;  4IBN A;  3AA4 A;  3OVN A;  3QEI A;  2IAJ A;  3TAB A;  2DY4 A;  3P1G A;  3AVB A;  4KHW A;  3JYT A;  5CYQ A;  4FJJ A;  1HYV A;  1S6P A;  4R5P A;  4CJF A;  3OYI A;  1ZBL A;  4N5S A;  4DFJ A;  4FW2 A;  5CY4 A;  4I9L A;  1HQU A;  4B9M A;  5HRN A;  4CGG A;  3MXI A;  1BIZ A;  5CZ2 A;  3QNN A;  2OA8 A;  3DI6 A;  1TL3 A;  4FCY A;  4J2E A;  3RMD A;  3LP0 A;  3P5J A;  4EZ6 A;  4Z4G A;  3OS0 A;  2DFF A;  2HNY A;  3A2F A;  3MEE A;  4NYF A;  4BE2 A;  4FK2 A;  1QTM A;  4FJ8 A;  3K5N A;  3HM9 A;  1VSI A;  4KRF A;  1U04 A;  4AHU A;  2RF2 A;  4B9L A;  2HMI A;  3CYM A;  3V9S A;  3QLH A;  4NCG A;  2EHG A;  4JRP A;  2LSN A;  4FLT A;  1WSG A;  2O4I A;  5J2M A;  2P1J A;  3U3G A;  5E41 A;  1Z25 A;  3BGR A;  4Z4H A;  1BL3 A;  2P51 A;  3M8Q A;  1VK0 A;  4PQU A;  1S1T A;  2PYJ A;  2WON A;  2FBT A;  1NJX A;  1EKE A;  1RT2 A;  1ZBF A;  3VQE A;  3ZT0 A;  4FZY A;  4CK3 A;  3EY1 A;  3AVL A;  3AV9 A;  1D9F A;  4CIG A;  2X78 A;  4CEQ A;  1CZB A;  1TK5 A;  4XIU A;  4DSL A;  1TGO A;  3WNE A;  1BI4 B;  4FJK A;  1U48 A;  4KI6 A;  5HRR A;  3ZT1 A;  3O3H A;  3AVJ A;  5CYM A;  4FW1 A;  4CEZ A;  1QSL A;  3OYL A;  3LZI A;  1U49 A;  4FJ7 A;  3VQ9 A;  3DLR A;  4CGI A;  3NF9 A;  5HRO A;  5KGW A;  3T19 A;  3SQ2 A;  1UA0 A;  3LP2 A;  4FLU A;  1TK0 A;  3TR8 A;  3SQ4 A;  4FZX C;  1TAU A;  3OYM A;  3DMJ A;  2FBV A;  3HYF A;  3CFO A;  1RT4 A;  4DSE A;  1GOC A;  3LP1 A;  3OJS A;  4M3T A;  3NGY A;  2XRI A;  3BDP A;  2KTQ A;  2KQ2 A;  2Z1H A;  3L2Q A;  4E7H A;  2HB5 A;  5I42 A;  3VQ6 A;  1NK9 A;  1FKO A;  3NF8 A;  3QIP A;  2Y1J A;  4B9T A;  2O4G A;  1NK6 A;  4B8A B;  3OY9 A;  4HHT A;  1NJZ A;  1C0M A;  3D45 A;  2VG6 A;  4CJW A;  1IKX A;  3EYZ A;  1JXB A;  1XWL A;  4I2Q A;  3K5O A;  3M8R A;  3TAE A;  4DTP A;  3UIQ A;  3LAL A;  4DLG A;  2QXF A;  4YFU A;  3VQA A;  4N56 A;  1RDB A;  4KTW A;  4ELV A;  2YNG A;  2ATQ A;  3RRG A;  2VWK A;  1QE1 A;  5DMR A;  5K14 A;  3ZSY A;  4CHO A;  3LWM A;  4KPY A;  4AHT A;  2KZM A;  1ASV A;  4KV8 A;  4L8R B;  4FJ9 A;  2BGG A;  2KZZ A;  3AO2 A;  4FJX A;  1A5W A;  4ZTF A;  3V1R A;  1RBT A;  3V81 A;  1JLQ A;  3C6T A;  1JLA A;  2HHW A;  3K58 A;  1YTA A;  4DTJ A;  3RRH A;  3JSM A;  2GBZ A;  1EXQ A;  4C8L A;  1JLB A;  3LAM A;  3VQC A;  5SZT A;  4DF4 A;  1BQM A;  3AA3 A;  3AVG A;  4NCA A;  2Z1I A;  2DFE A;  3PO4 A;  1JLF A;  4B9U A;  4F3O A;  4FK4 A;  1JLG A;  3MEG A;  5C42 A;  2D0C A;  2WOM A;  4HUF A;  1VSH A;  3NE6 A;  3S3O A;  3T3F A;  4PY5 A;  4ELT A;  1CXQ A;  1XC9 A;  1KTQ A;  4RW8 A;  1BIS A;  3ASM A;  4AHS A;  5C25 A;  3E01 A;  4QCL A;  4CFB A;  2BAN A;  1U47 A;  3G10 A;  4GVM A;  3MED A;  1S9E A;  4CF2 A;  3EZ5 A;  1YTU A;  3KLG A;  2VWJ A;  4KB1 A;  4FLV A;  1RTJ A;  1EP4 A;  1TKZ A;  3HO1 A;  1SUQ A;  3SI6 A;  3TAQ A;  3QIO A;  4CHZ A;  4DTO A;  3O3G A;  4I9Q A;  2HVH A;  2HW3 A;  4QAG A;  4KI4 A;  3HVR A;  4IDK A;  5KRS A;  3NCI A;  1HRH A;  3QEX A;  3CM6 A;  3HK2 A;  2HND A;  4PUO A;  1LWE A;  1LW0 A;  4Y1D A;  4W5O A;  3KTQ A;  4E19 A;  4HUE A;  3HP9 A;  1KFD A;  3DYA A;  3I8D A;  1WSJ A;  4BE0 A;  3MEC A;  1IKY A;  4CE9 A;  3NF7 A;  1FK9 A;  4Z4I A;  5JS1 A;  3SJJ A;  4FJM A;  1WAJ A;  3K2P A;  3LP3 A;  3L2V A;  4CHY A;  4ZHR A;  4CJE A;  3IAY A;  4M3W A;  2D5R A;  2ZD1 A;  1T7P A;  3KKR A;  4CF1 A;  3NH1 A;  3HXM A;  2W42 A;  1RTD A;  4E89 A;  4OKJ A;  4J2B A;  3AVN A;  4DFK A;  2B6A A;  1HNV A;  1Q8I A;  3LPT A;  3QIN A;  1NKC A;  4B3O A;  4MQ3 A;  3SCX A;  2G8V A;  4OLB A;  1JXE A;  5HRP A;  4C8M A;  4N76 A;  2HHV A;  1KSP A;  1K6Y A;  2PY5 A;  3DRR A;  4IG3 A;  1XHX A;  4CJT A;  3KLH A;  4RW6 A;  1A5V A;  1VRU A;  1RDA A;  1HYS A;  4F8R A;  2XHB A;  3SZ2 A;  4DS4 A;  3CG7 A;  4CF8 A;  4W5N A;  4FLY A;  5JS2 A;  4M3Z A;  4KHY A;  1TL1 A;  1QQC A;  2OPS A;  4E3S A;  1ZBU A;  3ZT2 A;  2IGI A;  3HP6 A;  3RMB A;  1NKE A;  3HL8 A;  1RT6 A;  1KCF A;  3RTV A;  1B92 A;  3QNO A;  2HHQ A;  4DQQ A;  2KFZ A;  3H08 A;  1NOZ A;  4AIL C;  3OYN A;  3ALY A;  4CEF A;  4CIF A;  3DRP A;  1TV6 A;  2ZQB A;  2YNI A;  4H4O A;  4CEA A;  4OPJ A;  1IG9 A;  3AVI A;  4BDP A;  2G8I A;  5FDL A;  3ISN C;  3ZT3 A;  2KW4 A;  5KRT A;  1NK5 A;  1B9D A;  1YT3 A;  3DLH A;  2AJQ A;  3LPU A;  3PX6 A;  1S5J A;  4DF8 A;  5HLF A;  3C94 A;  2G8F A;  4CHP A;  4W5R A;  4H8K A;  3MXJ A;  1VSE A;  3L3V A;  1KVB A;  1T8E A;  3LAK A;  2DFH A;  5KTQ A;  4B9S A;  3PY8 A;  1ZYQ A;  4CJU A;  1QHT A;  3DLK A;  1BHL A;  4CK2 A;  2G8K A;  3NFA A;  1A5X A;  1I39 A;  2IS3 A;  3VQP A;  4W5Q A;  2VG7 A;  1WAF A;  2F8S A;  4E1M A;  2X74 A;  1C1C A;  3LWL A;  4DQR A;  4C8K A;  3HT3 A;  4CJV A;  3PO5 A;  1SKW A;  4HVJ A;  3SUP A;  1IKW A;  4I7F A;  3TAF A;  1S1U A;  3KD5 E;  4M45 A;  2X6N A;  2B5J A;  3QO9 A;  1RDD A;  3DRS A;  4DTX A;  1SKS A;  4FJI A;  4E7K A;  2YHB A;  3G0Z A;  2D0B A;  3SPY A;  1NKB A;  3VA3 A;  3RWU A;  2QK9 A;  1X1P A;  4IFY A;  4LH5 A;  3MAQ A;  4FZZ A;  3AVH A;  1D5A A;  1EET A;  1CLQ A;  3L2W A;  2NUB A;  2ETJ A;  4J2D A;  3VA0 A;  2BDP A;  1KFS A;  3V4I A;  1BQN A;  1KLM A;  4Q0B A;  4GMJ B;  1O1W A;  3NHG A;  1UA1 A;  1VRT A;  4RW7 A;  1EX4 A;  3WNF A;  1KLN A;  3LZJ A;  1SL0 A;  3ZSX A;  5J2P A;  1BIU A;  1FKP A;  1JKH A;  1SL1 A;  2B4J A;  1C0U A;  4FJ5 A;  4KTQ A;  3CM5 A;  3VQ8 A;  1U4B A;  1XI1 A;  1FXX A;  4BWJ A;  4KHU A;  4CHQ A;  4DTN A;  1ZBH A;  4AH9 A;  4K8X A;  1XHZ A;  4PA1 A;  4DSJ A;  2IC3 A;  3V9Z A;  1HQE A;  3QEW A;  4B9N A;  4FM1 A;  4I2P A;  3RMA A;  4IG0 A;  4CEE A;  3HVT A;  4EP5 A;  2QKK A;  2EX3 A;  4DS5 A;  3D0P A;  1WLJ A;  3LDS A;  4DTM A;  5J2Q A;  3THV A;  1RTI A;  4Y1C A;  4CFC A;  3AVK A;  3ZCM A;  3OYH A;  3SPZ A;  4OVL A;  3AO1 A;  5CZ1 A;  3VQ4 A;  1X9M A;  3NDK A;  2I5J A;  2FBX A;  1X9S A;  1RBV A;  1SL2 A;  1RIL A;  4FYD A;  4DFP A;  1RT1 A;  2XY7 A;  1SV5 A;  4LSL A;  1TVR A;  1Z26 A;  3DOK A;  3VQQ A;  2YNF A;  3HPO A;  4FJG A;  4B8C A;  3K5L A;  1WNS A;  3S3N A;  4CJP A;  2PYL A;  3CQ8 A;  2HHT A;  3KK1 A;  1KRP A;  4DSI A;  2YV0 X;  2Z1G A;  1GOA A;  3K59 A;  1RNH A;  1Y97 A;  2HNZ A;  1TK8 A;  1J54 A;  2YKM A;  3NGZ A;  3L8B A;  4CK1 A;  3TAN A;  1J53 A;  3V1Q A;  4CCH A;  1RTH A;  2D0A A;  2G8W A;  3QEP A;  2DTU A;  3V9X A;  4BWM A;  3C6U A;  2GUI A;  4DTS A;  3M8P A;  4LY7 A;  4C8O A;  4M3Y A;  2F96 A;  5DK5 A;  3NBP A;  4AHR A;  5HRS A;  2P5O A;  4FK0 A;  1WSF A;  5FRN A;  4CIE A;  2P5G A;  4LSN A;  4B08 A;  4C8N A;  3O3F A;  1QS4 A;  4Z4E A;  4OLA A;  4ELU A;  5KGX A;  3NGI A;  3TAP A;  3DLB A;  3OYC A;  4IKF A;  1S9G A;  3I0R A;  3TAR A;  1RT3 A;  4TSX A;  4NYN A;  3ZSR A;  1DTQ A;  4ID1 A;  1J9A A;  3HPG A;  2JGU A;  4OKK A;  3TI0 A;  1HYZ A;  1GOB A;  3OYF A;  1NJY A;  1CZ9 A;  4BDZ A;  4KTZ A;  3AVC A;  3OS2 A;  4CGJ A;  1KVC A;  4CJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...