1LAWA

Stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
b'MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYIRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Stabilization of Escherichia coli ribonuclease HI by cavity-filling mutations within a hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lawA00
3QNOA 4QAGA 1ZBLA 4BE1A 3OYLA 4H4OA 3DRPA 4ELUA 3CFRA 4B9SA 1O1WA 4OGEA 4Z4FA 1VSDA 3QINA 1BL3A 1UAXA 4N56A 4O5BA 3DM2A 3L2VA 3CQ8A 1NK8A 4FJMA 3OVNA 2ATQA 3NF6A 2QK9A 3KK3A 3VQ4A 4CGDA 3KKSA 4CGIA 4RW8A 4CEOA 5C42A 3HPOA 1XHXA 1TAUA 3QIPA 3T1AA 4I9LA 4O0IA 4O44A 4BE0A 1ZBHA 4LD0A 2RKIA 3HP6A 4J2EA 3EZ5A 4Z0UA 3DMJA 3SUQA 3ITHA 1RT1A 3M8SA 3C94A 3LDSA 3SPYA 2G8WA 1S1VA 3H08A 4E7JA 3MXMA 2VWJA 3VQPA 1RDCA 3RMAA 3U6FA 4OKJA 3ASMA 3QNNA 3VQ9A 4HCBA 4RW6A 1Y97A 2VG5A 1RT2A 1YTAA 3AVAA 3NFAA 4CJLA 3OYHA 4JS4A 4DTPA 3LPUA 4FJLA 3QIOA 4CGJA 3PX0A 1J5OA 2D5RA 2EHGA 1QSSA 3QERA 3T19A 1BI4B 4EP5A 4DFKA 1J9AA 1HRHA 3AA5X 1WAJA 3DRRA 4CJQA 4O55A 4PA1A 2YNIA 1WSHA 2OPPA 3LPTA 4Q5VA 2P5OA 4B9VA 4M45A 5HRPA 1TAQA 3OYAA 1TK5A 3KTQA 3IS9A 4N41A 4FJIA 3HPHA 1IKVA 4CF1A 2E4LA 4FK0A 4CJVA 2HVHA 1TL3A 1CXQA 1CXUA 1HQEA 3ZT0A 1CLQA 1FKOA 1U49A 3JSMA 4ELTA 1EKEA 2XHBA 1X9SA 4KTQA 4GMJB 5CZ1A 1RDBA 1BI4A 3MXJA 2HHWA 3HPGA 4AHRA 1T7PA 1VSFA 4W5TA 1RBSA 3OYBA 3DLBA 1X9MA 4DWIA 3QO9A 4I9QA 3C6TA 5JS1A 3OYDA 1T05A 3NH1A 1NJYA 4N5SA 3SV4A 3MEDA 3DLGA 3HM9A 3TAFA 1WAFA 3K58A 3THVA 1Z25A 4B9TA 3O3FA 4JLHA 3B6PA 3HL8A 4E1NA 4KHWA 1QE1A 1BISA 1LWFA 1U48A 4KPYA 2FBVA 1QHTA 1D9FA 1JLQA 3HT3A 2F8SA 4BDYA 1L3TA 4Z4IA 4IDKA 2YKNA 5CYQA 4CHPA 4DF4A 4L8RB 1QQCA 4CIFA 4OLBA 2D0BA 3KD5E 3K5OA 3DLHA 4E0DA 3AVGA 4AHVA 1S5JA 2DFHA 2YHAA 3QEXA 3AVIA 3OJUA 3TABA 2GBZA 3DYAA 4M3RA 2HHQA 4CJKA 4EZ6A 3V81A 3LZJA 2FBXA 1VRTA 2YNGA 5EU7A 4CHNA 3K57A 2YHBA 4JRQA 1U4BA 4DFPA 4W5RA 2P1JA 1BCOA 1JLGA 4CJ3A 4NCGA 4FLWA 1Z26A 2X6SA 4CEBA 1RNHA 2G8HA 4FYDA 2GUIA 4OKEA 4CFAA 5J2NA 3PO5A 3QLHA 4RW7A 5KRSA 3M8QA 1ZBIA 1C1AA 1XWLA 3U3GA 3AVFA 3G0ZA 3LP1A 4CEEA 3TR8A 4ZTJA 3EYZA 3DRSA 4KKOA 1BCMA 5KRTA 4PWDA 3OYCA 1ZBFA 1C1BA 4Y1DA 4B08A 2OPQA 2YKMA 3MEGA 3WNFA 3OYEA 1UOCA 1VSLA 2Z1IA 1JLEA 1S6QA 3AVNA 3PV8A 2XRIA 3RR7A 3OYMA 3SZ2A 2Y1JA 5C24A 2HW3A 4HCCA 1RT5A 4DSKA 4IG0A 5FRNA 3LALA 4KB0A 4AHUA 3L2WA 3DLEA 4YNQA 3NHGA 3TWHA 1NKBA 1NK0A 4B3OA 5J2QA 4DTMA 1JL2A 1NJXA 2ZD1A 1FKPA 1KVAA 3IAYA 3RRHA 4ELVA 3VN5A 4MQ3A 2OYQA 4FM0A 4E7IA 3KJVA 4DTRA 1Q8IA 3EY1A 1WSIA 3FFIA 5E41A 3LWMA 4DFJA 1XC9A 4F3TA 1QSLA 4FK2A 1KLNA 1R0AA 3K2PA 4JS5A 4J2AA 4KI6A 3L2UA 1EX4A 4DMNA 3V9UA 1J54A 2P51A 2DFFA 2JLEA 4B8AB 4CJ4A 1ASUA 1S1XA 2BDPA 4M3YA 4KHYA 3CYMA 4CJSA 3RR8A 1LAVA 1S1WA 4KV8A 3KKRA 3VQDA 3ZCMA 2Z1HA 4CGHA 4CJTA 4CK1A 3KD1E 2GV9A 4HHTA 4DG1A 2E6MA 4E89A 1NK9A 1RBRA 1IKWA 3NDKA 3MECA 1NK7A 1S1UA 1RTDA 4CEQA 3TARA 4DTSA 1HPZA 3AVMA 4B9LA 3OS2A 1RT7A 2QXFA 1T03A 2ZQBA 2E6LA 3F9KA 5J1EA 2EX3A 4FLVA 3O4NA 3QEWA 3AO5A 1XI1A 4F2RA 3VQEA 3UIQA 1RILA 3VQ6A 4KFBA 3VQCA 3NH0A 4IBNA 1QTMA 2AJQA 2XY5A 4DLGA 4PUOA 3VA0A 1UWBA 3SQ0A 2KTQA 3LP2A 1WSJA 4WE1A 4H4MA 3L3VA 3K5MA 3CFPA 4CGGA 1D9DA 4IFYA 2G8KA 4J2DA 4BDPA 1NKCA 2DY4A 1JLFA 3RTVA 3PY8A 2I5JA 3K5NA 4HUEA 1N5YA 4CF0A 3AVBA 3I0RA 4J2BA 2HMIA 3ALYA 4FW2A 3F73A 3E01A 1VSHA 4BACA 3G10A 4HUFA 1MU2A 4KRFA 4E1MA 1LW0A 1RTHA 4RW4A 4M3UA 4O4GA 3NE6A 3ZT4A 1KCFA 1QS4A 2OA8A 5FRMA 4FM1A 1U04A 1YT3A 3PX6A 4CJWA 1IH7A 1FK9A 2ETJA 1I39A 2ITGA 3BDPA 5T7BA 4W5NA 4XIUA 1JLAA 1HQUA 3TI0A 3ZSVA 3QESA 4B9NA 3V1OA 1D5AA 1VSEA 3V1QA 3ZSQA 1IKYA 1SV5A 4RG8A 3OYFA 3NCIA 4KHSA 2G8IA 1CZBA 4OPJA 5HRRA 4BE2A 1VRUA 2FC0A 3ISNC 4C8NA 4FLUA 5I42A 4Z4GA 2FBTA 1CZ9A 3LP0A 1NOYA 4C8KA 4FJ5A 3OYKA 4DU4A 2IC3A 4BWJA 3QETA 5FROA 1X1PA 4W5OA 3KLIA 1RBVA 5HP1A 2P5GA 2DFEA 2F96A 3ZSZA 1IO2A 2HHSA 3NF9A 4OVLA 2HNZA 1YVUA 4GW6A 1VSKA 4KO0A 4FJNA 3HO1A 2KFNA 3L2RA 3IRXA 4NCAA 4I2QA 3D45A 4M3ZA 2KFZA 1C0TA 2O4GA 3TAPA 4FW1A 2VG6A 3VA3A 4FZYA 2Z1GA 4DQPA 4QOZB 3DOLA 1KSPA 2OZSA 2X6NA 4CIEA 3SUPA 2W42A 4CHQA 3VQ8A 1TKZA 2KZMA 4FCYA 5JS2A 1RDAA 2VG7A 3SQ4A 1S9EA 2Q3SA 4ZHRA 3M8RA 4K8ZA 3LAMA 2KQ2A 2OPSA 3OYJA 4JRPA 4FK4A 4AILC 1W0HA 3V9SA 1JL1A 3TAMA 4CJRA 1EETA 1ASWA 1K6YA 1YTUA 1RBUA 4DF8A 4EZ9A 5HBMA 1SUQA 3V9XA 3WNEA 3NGIA 2KZZA 2HHTA 1ASVA 3HP9A 4OPKA 4CFBA 4GVMA 4DS4A 1SKSA 4B9UA 3P5JA 2IS3A 2OPRA 5FDLA 1S1TA 1ITGA 4G1QA 4CEFA 1JXBA 1REVA 4KB1A 2YV0X 3HK2A 4DTNA 3OY9A 1LV5A 2XY7A 3OS0A 4CK2A 3D0PA 2PY5A 4NCBA 1DTTA 1GOCA 1JKHA 2G8UA 1BQMA 4LH4A 1BGXT 5CY4A 3ULDA 1EXQA 1TK0A 2RF2A 1G15A 3AA2A 2PYJA 4E19A 1UA1A 4KHNA 3OYGA 1BIZA 2NUBA 3HXMA 4F2SA 3HJFA 1KLMA 3LAKA 1X9WA 3AO3A 2OZMA 4DQIA 3HSTB 3TAQA 1L5UA 4FJ8A 1L3UA 3ZT1A 3KK2A 4FZXC 4IG3A 5KI6A 1DLOA 2KW4A 3S3MA 4C8MA 4DSEA 1RT3A 4FJHA 4M3WA 3QEPA 2FBYA 3C95A 1TK8A 3T3FA 4CGFA 2G8FA 1HYZA 3OYIA 1TVRA 4FJ7A 1KVCA 3KLHA 4N47A 3P83D 5D3GA 2X78A 4F3OA 4M41A 3L3UA 4R5PA 1RDDA 4DTUA 5CZ2A 1TKDA 1WNSA 2R7YA 3V9ZA 3KLEA 3RRGA 4ZTFA 2YNHA 1FXXA 4CEAA 4NYNA 5HROA 2IOCA 4PY5A 3V9WA 4M3XA 3RMCA 4I2PA 4MFBA 1Q9XA 4BDZA 3HYFA 1HMVA 2HB5A 3BGRA 4AHSA 4Z4CA 1JLCA 3SV3A 2HVIA 2ZE2A 3TANA 2VWKA 3LP3A 1RT6A 1JLBA 4CJFA 5HRSA 2X74A 1GOBA 4CJEA 3ZSRA 1NK5A 2B4JA 3MAQA 2F8TA 4CEZA 1VSJA 2HHXA 3DI6A 3HVRA 4LSLA 1SL0A 1A5VA 1J53A 1HJRA 4HVJA 2QKKA 3NBPA 4KAZA 2QKBA 1RTJA 4CF2A 3O4QA 2D0AA 4DQQA 4KTWA 2XY8A 3SNNA 4CHZA 4C8LA 5SWMA 2IGIA 3KLFA 1N6QA 4K8XA 1B92A 3ZT2A 3CM6A 1BHLA 4HUGA 4DQSA 1IG9A 4FXDA 4DS5A 3L2QA 1HNIA 3AVKA 4E3SA 1L3SA 4OJRA 4AH9A 3SCXA 4E7KA 2XY6A 3WNHA 1C0MA 1B9FA 3DLKA 4CFCA 4DU1A 1HYSA 1HNVA 3SYZA 4M3TA 2HNYA 5HRNA 2B5JA 1BQNA 3AV9A 1EP4A 2BANA 1C6VA 3U3YA 2HNDA 4FLZA 4Y1CA 3AVLA 4LY7A 3SPZA 1WSFA 3B6OA 2Y1IA 3SQ1A 3VQAA 1LWEA 3PX4A 4CIGA 3KLGA 4DSFA 4FJXA 4EP4A 1GOAA 1C0UA 5J2MA 1NOZA 4Z4HA 3PO4A 3NF8A 4B9MA 3AVJA 1UA0A 3MEEA 4CE9A 4RW9A 3CFOA 2WOMA 1TKTA 3I0SA 2LSNA 3NF7A 3LANA 4ID5A 3S9HA 3VQ7A 3AVHA 4CERA 4CECA 4FLYA 5KTQA 4PQUA 4DSLA 4H8KA 4CF8A 2G8VA 4CHOA 1JXEA 1RBTA 1A5WA 4CFDA 4W5QA 1NKEA 5KGWA 4FJ9A 1DTQA 1RCHA 4N76A 1WN7A 3V6DA 3O3HA 1ZYQA 3KIOA 5DMRA 2A1RA 1SKWA 3AO2A 3CM5A 1D8YA 2PZSA 2HHVA 1A5XA 3A2FA 1SKRA 5C25A 4KHUA 1IKXA 2A1SA 3QEIA 2D0CA 3IG1A 4B8CA 2DTUA 4Q0BA 4TSXA 3ZSOA 3PUFA 3K5LA 3LZIA 1I3AA 1VSIA 1TGOA 3LWLA 3MXIA 1T8EA 4Z4EA 1TL1A 3RMDA 3O3GA 4M42A 2PYLA 5DK5A 1XHZA 1SL2A 4LSNA 3NAEA 1QSYA 4IFVA 4UQGA 1NK6A 4FJJA 1WLJA 3S3OA 5KGXA 4DFMA 1NJWA 4YFUA 1SL1A 3K59A 3VQBA 1KTQA 1TV6A 3V4IA 1HYVA 1LW2A 3SI6A 1WSEA 3AO1A 1ZBUA 1S9GA 3V1RA 4FM2A 4FJGA 3CG7A 4CESA 4C8OA 2WONA 4E7LA 4FVMA 1NJZA 4CF9A 4CJPA 4I7FA 3VQ5A 4FLXA 4DQRA 3TAEA 3OYNA 4KHQA 4KTZA 3NH2A 2IDOA 4OKKA 2BE2A 1KFDA 4AHTA 4CHYA 4CJ5A 3OS1A 3L8BA 4F8RA 1BIUA 1TKXA 3AA3A 2RPIA 3NGYA 3VQQA 3SJJA 3AVCA 1LAWA 4ICLA 4DTOA 3KK1A 3SUOA 3AA4A 4DTXA 3S3NA 3ZSYA 1KRPA 4FJKA 4ID1A 1U45A 2JGUA 5SZTA 5K14A 1RT4A 3AO4A 3P1GA 3WNGA 4FLTA 5I3UA 1KVBA 4CJUA 3I8DA 1WSGA 4E7HA 3QEVA 2RN2A 1RTIA 3DOKA 4CCHA 4DLEA 5HLFA 3OJSA 3ZSWA 3ZT3A 4CK3A 4HTUA 3JYTA 3SQ2A 2B6AA 3C6UA 4BWMA 1B9DA 3SUNA 1W9HA 4DSIA 2BGGA 2HHUA 5CYMA 2IAJA 3NGZA 3TAGA 3RMBA 4KI4A 1KFSA 4LH5A 1U47A 4F4KA 4FZZA 1L3VA 1Q9YA 3M8PA 4OGCA 4KREA 4CEDA 1NK4A 4NYFA 4O0JA 2O4IA 3DLRA 1VSMA 4AHCA 4DTJA 4QCLA 2XO7A 4IKFA 1F21A 3HVTA 4OLAA 1LWCA 1S6PA 1VK0A 2Z1JA 1C1CA 4DU3A 4DSJA 3RWUA 5J2PA 2YNFA 3ZSXA
chains in the Genus database with same CATH superfamily
3QNOA 4B3MK 4BE1A 4Z4FA 3QINA 4C23A 4N56A 3CQ8A 4FJMA 3NF6A 2QK9A 3KK3A 3EE8A 3VQ4A 3HPOA 3KKSA 1VQ8N 4BE0A 4LD0A 3HP6A 3T7ZA 3ITHA 3WT0A 4X65K 3FZHA 3CCSN 3MXMA 2P9PB 2VWJA 1RDCA 5EOYA 5AQXA 4H5NA 3O9RA 3SLCA 3QNNA 4RW6A 1YIJN 4C1NK 1ESVA 4JHDA 2ASMA 2VG5A 3MK6A 1L3VA 3OYHA 3LPUA 1QQNA 1J5OA 2D5RA 4KH4A 1ATNA 1R59O 3DRRA 4CJQA 4PA1A 2WC9A 2P9KB 3LPTA 2QI2A 3KTQA 3GE1A 3IS9A 3DXKB 3HPHA 3EO3A 2HVHA 1TL3A 1CXQA 4BR9A 1U49A 1Q82O 1X9SA 3MCPA 1BI4A 1T7PA 1X9MA 1GLJO 3NH1A 1XNQK 5ADXA 4XH5A 3OHRA 4UY8O 3TAFA 3VEVA 5C0YA 3B6PA 3HL8A 4H0OA 2UXDK 1QE1A 1T6CA 3ENBA 4KPYA 3AY9A 5FPEA 1L3TA 4O8UA 3C7NA 2YKNA 2FXUA 2YJEA 4DF4A 4L8RB 3THYA 5AQOA 4ILGB 4B9QA 4NXMK 3QEXA 3T69A 3AVIA 3TABA 4BRPA 3MX5A 1ZBSA 3LZJA 3MDQA 2HF4A 2YNGA 4JRQA 2P1JA 4NCGA 4X62K 3LL3A 3BY5A 4FYDA 3ATUA 3VMFB 4O5FA 4HWIA 4RW7A 1ZBIA 2PFUA 3JXUA 4CEEA 4EIAA 1M90O 3TR8A 4ZTJA 4KKOA 1MA9B 3OYCA 2OPQA 3MEGA 5AQFA 4CJ7A 3PV8A 1O13A 3OYMA 3SZ2A 1VQMN 5AQZA 2HW3A 4HCCA 2D0OA 3L2WA 3TWHA 1NK0A 2P9NA 3EEQA 4B3OA 4DTMA 1NJXA 1FKPA 4IOCL 4ILJA 2OYQA 3EY1A 1WSIA 3LWMA 3BZCA 3O9TA 4J2AA 1EX4A 2E20A 3V9UA 4LF8K 3EE9A 2DFFA 4CJ4A 4M3YA 2BDPA 3QDKA 3CYMA 4CJSA 1LAVA 4DV6K 4JI7K 2Z1HA 4BRDA 4CJTA 4O8KA 2ZF5O 2Q36A 3NDKA 1RTDA 4DTSA 1HPZA 1YUWA 1CZAN 4GVEA 3B8AX 3QEWA 4YHHK 3AO5A 1VQ4N 3VQCA 4BRNA 4B3RK 4LC9B 1UWBA 5ELZA 4H4MA 2G8KA 4J2DA 4WFBL 4GV6A 1JLFA 2ZGZA 5BPLA 3I0RA 4BRAA 2HMIA 3M6GA 1VSHA 2HBMA 4BROA 4HUFA 3G4SN 4KRFA 1RTHA 3CIPA 3EL2A 4M3UA 4DR6K 3NE6A 3ZT4A 1YT3A 2UXBK 2UXCK 4I6MA 1JLAA 2QM1A 3V1OA 1D5AA 1IKYA 4RG8A 1WUAA 1QVGM 1CZBA 4FLUA 3IUCA 5HRRA 2E1ZA 2FC0A 1XMQK 2E5LK 2FBTA 3LP0A 1W7AA 4FJ5A 3OYKA 3PIOL 2O8EA 5FROA 3KLIA 1RBVA 4U7BA 1IG8A 2F96A 5EY4A 3ZSZA 1IO2A 3NF9A 4OVLA 2KFNA 1YVUA 4CBWA 2QXLA 4KO0A 4FJNA 4NCAA 3D45A 5HOOA 3K9JA 1Z05A 4FW1A 3PIPL 4DQPA 3DOLA 1KSPA 2OZSA 5AQRA 3SUPA 2NRZA 5JS2A 4ZHRA 3CCMN 4K8ZA 3O9QA 2OPSA 4FK4A 1EWQA 1JL1A 4H0YB 1EETA 1ASWA 4DF8A 5LY3A 4BR5A 2KZZA 3LDNA 2HHTA 3P38A 4JD2A 4B3TK 3P5JA 3TSUA 2IS3A 2OPRA 4K25A 1S1TA 1ITGA 4YY3K 3WXMB 3RSEB 2YV0X 4CBUA 3OS0A 4NLCA 4NCBA 1DTTA 1BGXT 4R79A 1EXQA 1QZ5A 1TK0A 3DWLA 1G15A 1BIZA 4F2SA 1Q86O 4DR2K 3HJFA 1KLMA 1X9WA 3CCUN 2OZMA 3ZX2A 3I33A 1L3UA 2YI1A 4H03B 3VETA 3ENHA 3CI5A 3EN9A 4IWVA 3A5OC 3C95A 3I55N 2QWRA 1TVRA 1SAZA 4N47A 2FLOA 3P83D 2F4VK 4DR7K 1Z6RA 3CCQN 3U9DA 3E9LA 3KLEA 2BUPA 5BN9A 1E4GT 4MFBA 1HMVA 2FF6A 1K8KA 1SZ2A 2ZE2A 3LP3A 1RT6A 3N4PA 4GKJK 1NGEA 3THWA 5KPRA 3ZSRA 2B4JA 3NVKA 3BF3A 1WBDA 1VSJA 2DPNA 1A5VA 1J53A 4HVJA 4K42A 3NBPA 1RTJA 3VOVA 3HI0A 3G25A 1B92A 3CM6A 4DQSA 4DUYK 4E3SA 4AM6A 4OJRA 4E7KA 4FL9A 4YOVA 1HYSA 4JV5K 3SYZA 2D1KA 2HNYA 4BVOA 1BQNA 2BANA 3O6WA 5FPMA 4Y1CA 3SPZA 2Y1IA 1WBBA 3VQAA 3PX4A 4CZHA 4LF5K 1EQYA 2HHHK 1C0UA 4BQZA 3W3DA 3T1HK 3MEEA 4RW9A 5F1XA 3VESA 3LANA 3VQ7A 5KTQA 4PQUA 5IWAK 4CF8A 2G8VA 2NZTA 5F0XA 4CFDA 1NKEA 4FJ9A 1WN7A 2YCHA 3V6DA 3KIOA 3CM5A 1K8AO 3CJ1A 1A5XA 4B8CA 3ZSOA 2YX6A 3K5LA 1I3AA 4Z4EA 3O8MA 1TL1A 3ULEB 3HOSA 2F7TA 3GOIA 4FJJA 5KGXA 1SL1A 5AZJA 1MWMA 1NJIO 4QS8A 4K41A 4B1WB 4FM2A 4A5BA 3CG7A 2UUAK 1QQOA 4CBXA 2WONA 4E7LA 5AFUA 4CF9A 4CJPA 4DQRA 4KTZA 4JKHA 4OKKA 3W0LA 2BE2A 3NH2A 1NU0A 4F8RA 1TKXA 3THXB 1HR0K 2RPIA 3NGYA 3VQQA 1NGFA 3SJJA 4ICLA 3NMUA 3AO4A 4BG8A 4FLTA 2CGJA 4RCHA 5HLFA 2B6AA 2IVNA 3SUNA 2BGGA 5CYMA 5FPDA 4FWQA 4OGCA 4KREA 4O0JA 1YHQN 1EO1A 4M7YA 5BPMA 4IKFA 2Q0RA 3HVTA 5J2PA 1IBLK 2KLAA 4ELUA 4B1VA 4B9SA 4OGEA 3L2VA 4O5BA 2ATQA 3WEEA 4CGDA 5C42A 4RW8A 4KBOA 3QIPA 2OCEA 4I9LA 4O0IA 3HTVA 1XMOK 4J2EA 3A5NC 3QFPA 4U67L 1RT1A 2NRXA 2W41A 4HTLA 4H5RA 2QA4N 5M1NA 1W2BM 3VQ9A 1Y64A 3VEYA 3AVAA 3NFAA 1KD1O 4PL7A 3PX0A 2QWOA 2Q31A 3WXJA 4EP5A 3O1BA 4DFKA 1J9AA 1HRHA 3UB5A 3L0QA 1WAJA 1GLFO 4B9VA 4M45A 1TK5A 3CJCA 1YI2N 4FJIA 4FO0A 1YAGA 3CC2N 1CXUA 2GEMA 3ZT0A 4OPAA 3JSMA 2E2QA 3C0BA 1RDBA 2HHWA 5JMVA 4AHRA 4W5TA 1NLVA 5LJVA 3QO9A 4JAXA 4DWIA 3C6TA 3EKUA 1T05A 4MO4A 4NO7A 4JI3K 3SV4A 3R1XA 3DXKA 3HM9A 3CC4N 1WAFA 3K58A 4B9TA 3O3FA 3L6QA 4JLHA 4KHPK 4E1NA 4YOWA 4KHWA 1BWFO 1V4TA 4JI2K 1U48A 2F8SA 2P9LB 4IDKA 4A2BA 5CYQA 2QWNA 4CIFA 3K5OA 4CZIA 3DLHA 1P90A 4E0DA 3MWTA 1S5JA 3OJUA 2GBZA 2HHQA 1HKGA 4EZ6A 3BEXA 2FBXA 3K57A 3H1QA 4JKAA 3MWPA 2E2OA 4RWTA 1JCFA 1BCOA 1JLGA 4CJ3A 2GTDA 2ZM6K 2G8HA 2GUIA 2QWLA 5J2NA 3PO5A 3GG4A 3QLHA 3J7AP 4LFCK 2HSTA 3U3GA 3AVFA 1N33K 2OTJN 5FPNA 2YKMA 1UOCA 3AVNA 3LDPA 3R6MA 5C24A 2FSNA 4IG0A 4AHUA 3DLEA 3DJCA 5J2QA 1JL2A 2F9TA 3PSIA 3RRHA 5I9EB 4FM0A 3FFIA 5E41A 4NXNK 4Y0WA 4FK2A 1R0AA 4BRFA 3K2PA 1J54A 2D0PA 2JLEA 1S1XA 1IBMK 2V7YA 3VQDA 1S1WA 3ZCMA 3M1FA 2CGKA 4CGHA 5AQTA 2E6MA 3P4IA 4E89A 3I56N 1NK7A 4IJAA 1S1UA 4B9LA 3MCAB 1T03A 2ZQBA 2E6LA 2EX3A 1XI1A 2O8DB 5AZIB 2P9SB 5JLHA 5KQ8A 1QTMA 1JCGA 3VA0A 3SQ0A 3LP2A 1WSJA 4WE1A 3K5MA 4KH6A 4CGGA 1YJWN 4BDPA 1NKCA 2DY4A 3RTVA 4CZKA 4HUEA 3ALYA 4FW2A 4WYBA 4J8FA 1BA1A 2V52B 4LF9K 4BACA 3TPQA 1MU2A 3HOTA 4E1MA 4JKGB 1XUPO 3QFUA 4O4GA 1KCFA 2OA8A 1D4XA 5FRMA 3K0SA 1IH7A 2ETJA 3BDPA 2ITGA 4EFHA 4MLEA 1HQUA 2E1YA 3TI0A 3ZSVA 4AQYK 4YDUC 3CJAA 5KPZA 3QESA 4B9NA 3ZSQA 2G8IA 3NCIA 4BE2A 4OPJA 3FZMA 4EAHD 4DU4A 2IC3A 4DR1K 4BWJA 3QETA 1HKBA 3LDOA 1VQLN 3VF2A 3GL1A 5HP1A 3OW2M 2HHSA 3HO1A 4GW6A 3I8BA 3CCVN 3LDLA 1BOTO 4M3ZA 1C0TA 2O4GA 3TAPA 3FLCO 3VA3A 2BH1A 4FZYA 3AAPA 4BGAA 4FPBA 1NGAA 2X6NA 2W42A 3AGKA 1TKZA 2VG7A 4A61A 3SAHA 3OYJA 1W0HA 2QTDA 3QBWA 3KHYA 3V9SA 3TAMA 1K6YA 4EZ9A 4X64K 3GDQA 3NGIA 3L4QA 4OPKA 4CFBA 1P8ZA 4FSVA 4G1QA 1K73O 1JXBA 4CZGA 4DTNA 1LV5A 4FWKA 3PSFA 4CK2A 1JKHA 1BQMA 4LH4A 3ULDA 4JEPA 4BR0A 5JLFA 1UA1A 3OYGA 3HXMA 1GLBG 3HSTB 4FJ8A 2O8CA 2GELA 3VEXA 3ZT1A 3KK2A 5AQYA 1YJ9N 1XQSC 3RSEA 2IVOA 4NLBA 1RT3A 4H0XB 1TK8A 4OO1J 1N36K 3OYIA 1KVCA 3KLHA 1WB9A 4M41A 2Q97A 3L3UA 3P39A 5CZ2A 3FGUA 4K43A 3J7YP 4NYNA 3SK3A 4FWMA 4PY5A 3RMCA 1IBKK 2HB5A 4Z4CA 4B3SK 4JK9A 3MN7A 1JLBA 4CJFA 3D6RA 3TTDA 2X74A 1GOBA 2QW9A 2F8TA 4K0KK 2ASOA 2HHXA 3DI6A 5M1KA 4LSLA 4WCEL 1SL0A 1HJRA 4KAZA 1ZC6A 2D0AA 3SNNA 4CHZA 1IV0A 4FXDA 3L2QA 1L3SA 1DT9A 2XY6A 1OVYA 2KKZA 5GIPA 4DV5K 1C0MA 1B9FA 3DLKA 4H5VA 4CFCA 2A5XA 3QICA 1BUPA 4FLZA 4DV7K 4DSFA 4FJXA 4EP4A 4JI8K 5J2MA 1NOZA 4Z4HA 3ZLJA 4A2AA 3NF8A 1VQON 2WOMA 4PHTX 4DV3K 4ID5A 3S9HA 4CERA 4DSLA 4H8KA 3CCLN 4CHOA 1JXEA 2ZWHA 3THYB 4JYAK 1A5WA 4W5QA 5KGWA 2VYPA 2YHYA 1DTQA 3WXIA 4N76A 1SKWA 5DMRA 3AO2A 1D8YA 1HNWK 1SKRA 4KHUA 2D0CA 3PUFA 1VSIA 3MXIA 1TGOA 1T8EA 3RMDA 3ZX3A 4DV1K 4LSNA 3NAEA 1WLJA 1NJWA 3K59A 1KTQA 1HYVA 1WSEA 1ZBUA 2FSJA 3CCJN 1S9GA 3CJ9A 3V1RA 1X3NA 4WFNL 4FJGA 3DLLL 1OH5A 3CMAN 4I7FA 1S72N 3UKUA 2IDOA 3ULEA 1ILYA 4CHYA 4A59A 5LMUK 1KAZA 3AVCA 4DTOA 3KK1A 3SUOA 1KRPA 4ID1A 3WNGA 3AARA 1VQPN 4QS9A 5E84A 2RN2A 4CCHA 4DLEA 4MDAA 3OJSA 3ZSWA 3ZT3A 3AGRA 3HRGA 3VF6A 4CK3A 3THXA 1NM1A 1Q9YA 4CEDA 4LFAK 4WQ5C 2RE2A 2RHKA 3BZKA 5M1OA 1YJNN 2GWKA 4OLAA 1LWCA 1NG9A 3CD6N 4DSJA 3RWUA 2YNFA 3ZSXA 4QAGA 3OYLA 4H4OA 3DRPA 1O1WA 4JKFA 1BL3A 1UAXA 3FZLA 1NK8A 4DB3A 3OVNA 3TTCA 4CGIA 3H3NO 3PLAA 1TAUA 4JK7A 3DXMB 4O44A 1X3MA 2RKIA 3SUQA 3SAGA 3EKSA 4YORA 2G8WA 3RVCA 3H08A 4E7JA 4DR4K 2BTFA 2I7NA 3RMAA 4OKJA 3KK7A 1HNZK 4BG9A 4BVPA 1RT2A 1YTAA 4JS4A 3D2EA 3QIOA 4BGBA 1YVNA 3F9MA 4I6MB 3AA5X 4CZEA 3ZETB 1Q81O 4O55A 2OPPA 4Q5VA 3CC7N 2IIRA 3OYAA 1H1VA 4N41A 4CF1A 4FK0A 4CJVA 1HQEA 3F2KA 1DEJA 1CLQA 4NB4A 1FKOA 3ZEUA 1MWKA 1EKEA 1OVQA 2VGNA 2XHBA 4KTQA 4GMJB 3MXJA 3U8XA 5A2QO 3DLBA 4I9QA 1N32K 4N5SA 2PBDA 3MN5A 3THVA 3J8AA 4Z94A 3CCEN 3H1VX 4BR4A 1LWFA 2FBVA 3HT3A 2HBJA 3G6EN 4AF1A 4Z4IA 2NNWA 4CZJA 4CHPA 1VQKN 1NGHA 1QQCA 4OLBA 3KD5E 2DFHA 2YHAA 3WUHA 3DYAA 4M3RA 2WTUA 1U2VA 2Q2RA 4JD2B 4CJKA 3V81A 1VRTA 4CHNA 3ZX0A 4DFPA 4W5RA 2X6SA 2P9UB 1YXQA 5M1QA 4B1YB 4OX9K 2AA4A 3M8QA 4JN4A 4BQLA 2A41A 3EYZA 1BCMA 1NGJA 1WOQA 4CI6A 1C1BA 1ZBFA 4Y1DA 4PWDA 4B08A 3WNFA 1BO5O 3OYEA 3R3LA 2Z1IA 3UKRB 2Y1JA 1LCUA 4BR2A 5BR8K 1RT5A 4DSKA 3LDQA 4FWRA 3QB0A 4CZLA 3HBTA 1KVAA 1T3VA 4ELVA 3VN5A 4MQ3A 3D2FA 4DTRA 1Q8IA 4DFJA 2QWMA 4MDBA 4JS5A 4KI6A 3C6HA 2HMPA 2P51A 4B8AB 5GADP 1KC8O 4B1UB 4KV8A 4CK1A 3KD1E 4HHTA 3T1YK 1NK9A 1RBRA 1NNEA 1IKWA 3THWB 4CEQA 3TARA 4DKWA 3F9KA 1K9MO 5J1EA 2FSKA 4F2RA 1RILA 2A3ZA 3VQ6A 5GIOA 3NH0A 4FVUA 1RDWX 1S22A 2XY5A 4JKDA 5GAGP 4DLGA 4PUOA 4WQ4C 1HUXA 3PY8A 3IDHA 2I5JA 3K5NA 5C2FA 4J2BA 3F73A 1HX1A 2VCPA 2P9IB 5AZIA 2P9PA 2P9SA 3G10A 1LW0A 3M5RA 5CE3A 3FZKA 3G71N 1DKGD 1TUYA 5TKWA 1U04A 4MO5A 3MN6A 4DR3K 3PX6A 5T7BA 4W5NA 1FW6A 2O8FB 2P9KA 2O8BB 3OYFA 1SS6A 4DHYA 1CZ9A 4EHUA 4C8KA 3E66A 3VERA 1X1PA 3TSPA 3A8YA 1S3XA 2E88A 3VENA 2HNZA 4IO9L 1VSKA 1OH6A 1KAXA 3IRXA 4IXCA 3C65A 5AZJB 3CF5L 4CIEA 4H5WA 4CHQA 3VQ8A 2KZMA 1RDAA 1S9EA 2Q3SA 4IZ9A 3M8RA 3LAMA 4AILC 1HKCA 2F9WA 2V7ZA 4CJRA 4LF4K 3SJHA 1YTUA 4BC3A 5HBMA 2ASPA 3A0IX 3V9XA 3WNEA 1ASVA 1TYQB 4GVMA 3ID8A 4DS4A 3LM9A 4CEFA 5FDLA 2ZGYA 5GINA 3IFRA 5EVZA 1REVA 3HK2A 1VQ7N 3OY9A 3S41A 4IFEA 2YHXA 2G8UA 3O4WA 3AA2A 3GBTA 4FPAA 2QEXN 4KHNA 2NUBA 1OH7A 4XH1A 3AO3A 3TAQA 5AQPA 5KI6A 2KW4A 4C8MA 5BR9A 1RDUA 4M3WA 2FBYA 3QBXA 4QS7A 3T3FA 4CGFA 1HYZA 4ISGA 3CXCM 1KQSM 1IJJA 2X78A 3WQTA 4R5PA 2J4RA 4DTUA 1TKDA 2R7YA 2NRWA 3RRGA 4ZTFA 5AQUA 2YNHA 4PKHA 5HROA 1Q9XA 5AQSA 3HYFA 1GLCG 4CD3A 4G9ZA 1W97L 3SV3A 2HVIA 1BDGA 3TANA 2VWKA 4RTFD 5CR4A 4FOEA 5AQMA 1NK5A 3N4QA 3MAQA 3O80A 4ISEA 3HVRA 4E1JA 5DM6L 4CF2A 1ATRA 3O4QA 4FOIA 4C8LA 2XY8A 2IGIA 1N6QA 3HZ6A 3FE1A 4DS5A 3AVKA 4BC4A 5EXWA 3ID6A 4AH9A 4ILHA 4WFAL 3WNHA 3VEZA 3MMVA 3KVGA 3VF4A 2B5JA 1NBWA 4M63C 3U3YA 1EP4A 1C6VA 2Q1NA 5DM7L 5IT9O 1WSFA 3B6OA 3SQ1A 1BU6O 4DQ8A 1VQ6N 3KLGA 3CPEA 4LF7K 1GOAA 3WXLA 4B9MA 1UA0A 4CE9A 4JKEA 3CFOA 1TKTA 2LSNA 3NF7A 4IDHA 5CHIA 3LM2A 3AVHA 4XEIA 4CECA 5AQJA 5M1PA 2OTLN 1RBTA 3CCRN 1ZYQA 2HHVA 3OA9A 3UE5A 5E26A 3IG1A 2DTUA 4Q0BA 2OANA 3LZIA 4DCHA 1QHAA 3O3GA 5DK5A 1XHZA 1Q7YO 3U9ZA 3H6EA 4IFVA 4UQGA 1NK6A 4FWOA 5BRFA 1TV6A 3HM8A 3V4IA 1SQKA 1U6ZA 2D4WA 4GY2B 4X66K 4FVMA 4FLXA 4YDUA 4AHTA 3L8BA 4CJ5A 1BIUA 4A62A 1VHXA 2ZJQL 2W6KA 3AA4A 4DTXA 3S3NA 3ZSYA 1NMNA 4IO8A 5SZTA 3ATVA 5K14A 2JWLA 3P1GA 1OKJA 1KVBA 4CJUA 4JKBA 3I8DA 4E7HA 3QEVA 1RTIA 3DOKA 2WBNA 2WUSA 4HTUA 2CH6A 4DSIA 1W9HA 4KI4A 1KFSA 4F4KA 3E9PA 4JNEA 3J81O 1NGGA 4H0PA 3F5TA 3DLRA 3NVMA 3MX2A 3ZYYX 4AHCA 4BRMA 4DTJA 4M7XA 3O9SA 2W40A 2HF3A 3K9KA 5AQWA 5B8HA 3OTOK 3CJ7A 4DU3A 1ZBLA 2HOEA 3CFRA 5AQGA 4YOUA 1VSDA 3DM2A 3FR0A 3Q7CA 4WF9L 4CEOA 4JHDB 1XHXA 5AR0A 3T1AA 1BG3A 1ZBHA 3EZ5A 4Z0UA 3DMJA 3O9UA 5AQLA 3VGMA 5AJ3K 3M8SA 1KAYA 3C94A 3LDSA 1EWRA 3SPYA 1S1VA 3VQPA 1QQMA 3U6FA 3P31A 3VTIA 3ASMA 4V19S 1I94K 5ADXH 4HCBA 4CZFA 1Y97A 3R8EA 4DTPA 3DXMA 4CJLA 4FJLA 2VQEK 4CGJA 2EHGA 1QSSA 3QERA 3T19A 1BI4B 3TSQA 1BA0A 1WSHA 2YNIA 3CQXA 2P5OA 3JS6A 1HLUA 1VQNN 1T6DA 1TAQA 5HRPA 5TKYA 1IKVA 2E4LA 3JAMO 4ELTA 2NRVA 5CZ1A 4GV9A 3HPGA 1VSFA 3ZETA 1RBSA 3OYBA 1GLAG 3C7NB 3A5MC 5JS1A 3OYDA 1JJ2M 4GV3A 1NJYA 3MEDA 4B1ZA 1E4FT 3DLGA 1Z25A 3CJBA 1OH8A 4A5AA 5EX5A 1BISA 1HNXK 1QHTA 1D9FA 1JLQA 1QZ6A 4BDYA 1LOTB 3AAQA 2D0BA 4PKGA 2GWJA 3AVGA 4AHVA 3M3ZA 4YOYA 3Q7BA 4B1XB 4H0VB 2ITMA 4BRQA 4IOAL 5EU7A 2YHBA 1U4BA 3O08A 4FLWA 1Z26A 1ATSA 3WQUA 4CEBA 2GX9A 4JI1K 1RNHA 4F9OA 4OKEA 4CFAA 2HBLA 5FLXO 5KRSA 4DR5K 4BY9C 2P9NB 3CPWM 1C1AA 1XWLA 3G0ZA 3LP1A 3DRSA 5KRTA 3ENOA 3VGLA 3SMSA 1M1KO 1C0FA 4CD1A 5JVHL 2O8CB 1VSLA 1JLEA 1S6QA 3RR7A 2XRIA 1GLEG 1YITN 1ZXOA 3SBTA 5BN8A 5FRNA 2P9UA 3LALA 3HSCA 4KB0A 5AQKA 3SBGA 4YNQA 3NHGA 1NKBA 3KWGA 2CGLA 2ZD1A 3A5LC 3IAYA 4E7IA 3KJVA 1XC9A 4F3TA 1QSLA 3VTHA 3UKRA 1KLNA 3L2UA 4DMNA 5LMNK 4KHYA 1ASUA 3TU5A 4JI4K 4PKIA 3RR8A 2VQFK 3KKRA 3U4LA 2GV9A 3SMPA 4DG1A 2A6AA 3CQYA 3MECA 5C10A 3AVMA 4GNIA 3OS2A 2NRRA 1RT7A 2QXFA 2VWBA 4FLVA 4BRLA 3O4NA 3VQEA 3UIQA 4KFBA 1J6ZA 4IBNA 2AJQA 2KTQA 1X9JA 2AP1A 3L3VA 3CFPA 1D9DA 4IFYA 4DV0K 1N8RO 4BC2A 3VPZA 1N5YA 4CF0A 3AVBA 1NGIA 3E01A 4JK8A 5AQNA 4RW4A 5AQHA 4WQ5A 1QS4A 4FM1A 2KHOA 4BRCA 3J7ZO 4L3QA 2NRHA 4JI6K 4CJWA 2O8EB 4JKCA 2YHWA 1FK9A 1I39A 2ZJRL 5BRDA 4XIUA 2P9IA 1VSEA 4OPHA 3V1QA 1SV5A 4JI5K 4KHSA 1NGBA 1VRUA 3ISNC 4C8NA 5I42A 4Z4GA 2UYTA 1NOYA 3VGKA 2UUBK 4W5OA 2P5GA 2EWSA 2DFEA 3IMXA 4LF6K 2O8FA 2O8BA 4JI0K 1NGCA 1T44A 3MN9A 3OBWA 1QVFM 3CMEN 3L2RA 1E3MA 4I2QA 2KFZA 5GAEP 1HJOA 4IEIA 3KWIA 2VG6A 4BC5A 2Z1GA 4IEEA 4YOTA 4QOZB 3IKMA 5GAHP 2UU9K 4FCYA 5KPTA 3SQ4A 2P9LA 2YJFA 2KQ2A 4JRPA 4BREA 3UKUB 2CH5A 4FWNA 1RBUA 1C0GA 1SUQA 5MLCQ 3VEOA 3HP9A 3WXKA 2V51B 1SKSA 4B9UA 5AQVA 5BREA 4KB1A 3BF1A 2XY7A 3D0PA 2PY5A 4ISFA 1GOCA 5CY4A 2RF2A 3R9PA 2PYJA 1TYQA 4E19A 4EHTA 1NWKA 3LAKA 4DQIA 1L5UA 4FZXC 4IG3A 1DLOA 3S3MA 3O1WA 4DSEA 4IOXA 1VQ5N 1GLDG 4FJHA 3QEPA 4KH5A 1G99A 4BRIA 1NGDA 3BUZB 3C6AA 1K8KB 2Q0UA 5HL7L 2G8FA 1Q18A 4FJ7A 2E2NA 3BP8A 3QMLA 5D3GA 4F3OA 3J80O 1RDDA 2QWQA 1WNSA 3V9ZA 2PAVA 5AQIA 1FXXA 2E8AA 4CEAA 4DUZK 2IOCA 3V9WA 4M3XA 4IJNA 4I2PA 4BDZA 2GUPA 3BGRA 2QWPA 4AHSA 1JLCA 2UUCK 2WFBA 5HRSA 1RFQA 3FZFA 4CJEA 3EZWA 4CEZA 3D2EB 1TUUA 3E1YA 2O8DA 2QKKA 2QKBA 4DQQA 4KTWA 5JICA 2NRTA 5SWMA 3KLFA 4K8XA 3ZT2A 1BHLA 4HUGA 1IG9A 4DV2K 4AM7A 1HNIA 2ZJPL 3SCXA 4MLHA 3ZEUB 1YF5L 4FWPA 4BRKA 4A57A 4DU1A 1HNVA 4M3TA 5HRNA 2I7PA 3AV9A 2HNDA 4JKGA 3AVLA 2H3GX 4LY7A 3VEWA 2HBKA 1DGKN 1KXPA 4BRHA 1LWEA 2E2PA 3H46O 3E9OA 4CIGA 5C12A 4CVNE 3H45C 4GKKK 3PO4A 3AVJA 4H0TB 3I0SA 5F2RA 4DV4K 4LFBK 4FLYA 1N34K 3DAWA 1J5EK 5AFUH 3CETA 5JVGL 5C15A 3O5BA 4H5TA 5KQDA 3KZBA 1RCHA 3H3OB 4WQ4A 1FJGK 3O3HA 2A1RA 2PZSA 5BRHA 3A2FA 1NMDA 1U2VB 5C25A 1IKXA 2A1SA 2IVPA 3QEIA 1XNRK 4TSXA 3LWLA 1V4SA 4M42A 4C1NI 2PYLA 1SL2A 5C2DA 1VQ9N 1QSYA 3S3OA 4DFMA 4YFUA 3VQBA 5M1FA 1LW2A 3SI6A 3AO1A 1GLLO 4CESA 4C8OA 3D7EO 5AQQA 1NJZA 3OBYA 3VQ5A 3TAEA 5LL6Z 3OYNA 4KHQA 1KFDA 3OS1A 1VAZA 3AA3A 4PL8A 4BR7A 2FF3B 1LAWA 2JWKA 4YOXA 4FJKA 4XH4A 4CZMA 4FWSA 1U45A 2JGUA 4CW7B 1RT4A 2VGMA 5I3UA 1XC3A 2A40A 3D2FB 1WSGA 5BPNA 1HPMA 5LJWA 1MDUB 2NLXA 5H1SQ 3JYTA 4BRGA 3SQ2A 3C6UA 4BWMA 1B9DA 2HHUA 3TAGA 2IAJA 3NGZA 2W6LA 3RMBA 4LH5A 1U47A 4FZZA 3TTFA 3M8PA 1NK4A 4NYFA 2O4IA 1VSMA 3CERA 3WEEB 3FFKB 4QCLA 2XO7A 1F21A 1JCEA 1RGIA 1S6PA 1VK0A 2Z1JA 4FWLA 3SAFA 2A42A 1C1CA 3CHWA 3L4IA
chains in the Genus database with same CATH topology
3QNOA 4QAGA 1ZBLA 4BE1A 3OYLA 4H4OA 3DRPA 4ELUA 3CFRA 4B9SA 1O1WA 4OGEA 4Z4FA 1VSDA 3QINA 1BL3A 1UAXA 4N56A 4O5BA 3DM2A 3L2VA 3CQ8A 1NK8A 4FJMA 3OVNA 2ATQA 3NF6A 2QK9A 3KK3A 3VQ4A 4CGDA 3KKSA 4CGIA 4RW8A 4CEOA 5C42A 3HPOA 1XHXA 1TAUA 3QIPA 3T1AA 4I9LA 4O0IA 4O44A 4BE0A 1ZBHA 4LD0A 2RKIA 3HP6A 4J2EA 3EZ5A 4Z0UA 3DMJA 3SUQA 3ITHA 1RT1A 3M8SA 3C94A 3LDSA 3SPYA 2G8WA 1S1VA 3H08A 4E7JA 3MXMA 2VWJA 3VQPA 1RDCA 3RMAA 3U6FA 4OKJA 3ASMA 3QNNA 3VQ9A 4HCBA 4RW6A 1Y97A 2VG5A 1RT2A 1YTAA 3AVAA 3NFAA 4CJLA 3OYHA 4JS4A 4DTPA 3LPUA 4FJLA 3QIOA 4CGJA 3PX0A 1J5OA 2D5RA 2EHGA 1QSSA 3QERA 3T19A 1BI4B 4EP5A 4DFKA 1J9AA 1HRHA 3AA5X 1WAJA 3DRRA 4CJQA 4O55A 4PA1A 2YNIA 1WSHA 2OPPA 3LPTA 4Q5VA 2P5OA 4B9VA 4M45A 5HRPA 1TAQA 3OYAA 1TK5A 3KTQA 3IS9A 4N41A 4FJIA 3HPHA 1IKVA 4CF1A 2E4LA 4FK0A 4CJVA 2HVHA 1TL3A 1CXQA 1CXUA 1HQEA 3ZT0A 1CLQA 1FKOA 1U49A 3JSMA 4ELTA 1EKEA 2XHBA 1X9SA 4KTQA 4GMJB 5CZ1A 1RDBA 1BI4A 3MXJA 2HHWA 3HPGA 4AHRA 1T7PA 1VSFA 4W5TA 1RBSA 3OYBA 3DLBA 1X9MA 4DWIA 3QO9A 4I9QA 3C6TA 5JS1A 3OYDA 1T05A 3NH1A 1NJYA 4N5SA 3SV4A 3MEDA 3DLGA 3HM9A 3TAFA 1WAFA 3K58A 3THVA 1Z25A 4B9TA 3O3FA 4JLHA 3B6PA 3HL8A 4E1NA 4KHWA 1QE1A 1BISA 1LWFA 1U48A 4KPYA 2FBVA 1QHTA 1D9FA 1JLQA 3HT3A 2F8SA 4BDYA 1L3TA 4Z4IA 4IDKA 2YKNA 5CYQA 4CHPA 4DF4A 4L8RB 1QQCA 4CIFA 4OLBA 2D0BA 3KD5E 3K5OA 3DLHA 4E0DA 3AVGA 4AHVA 1S5JA 2DFHA 2YHAA 3QEXA 3AVIA 3OJUA 3TABA 2GBZA 3DYAA 4M3RA 2HHQA 4CJKA 4EZ6A 3V81A 3LZJA 2FBXA 1VRTA 2YNGA 5EU7A 4CHNA 3K57A 2YHBA 4JRQA 1U4BA 4DFPA 4W5RA 2P1JA 1BCOA 1JLGA 4CJ3A 4NCGA 4FLWA 1Z26A 2X6SA 4CEBA 1RNHA 2G8HA 4FYDA 2GUIA 4OKEA 4CFAA 5J2NA 3PO5A 3QLHA 4RW7A 5KRSA 3M8QA 1ZBIA 1C1AA 1XWLA 3U3GA 3AVFA 3G0ZA 3LP1A 4CEEA 3TR8A 4ZTJA 3EYZA 3DRSA 4KKOA 1BCMA 5KRTA 4PWDA 3OYCA 1ZBFA 1C1BA 4Y1DA 4B08A 2OPQA 2YKMA 3MEGA 3WNFA 3OYEA 1UOCA 1VSLA 2Z1IA 1JLEA 1S6QA 3AVNA 3PV8A 2XRIA 3RR7A 3OYMA 3SZ2A 2Y1JA 5C24A 2HW3A 4HCCA 1RT5A 4DSKA 4IG0A 5FRNA 3LALA 4KB0A 4AHUA 3L2WA 3DLEA 4YNQA 3NHGA 3TWHA 1NKBA 1NK0A 4B3OA 5J2QA 4DTMA 1JL2A 1NJXA 2ZD1A 1FKPA 1KVAA 3IAYA 3RRHA 4ELVA 3VN5A 4MQ3A 2OYQA 4FM0A 4E7IA 3KJVA 4DTRA 1Q8IA 3EY1A 1WSIA 3FFIA 5E41A 3LWMA 4DFJA 1XC9A 4F3TA 1QSLA 4FK2A 1KLNA 1R0AA 3K2PA 4JS5A 4J2AA 4KI6A 3L2UA 1EX4A 4DMNA 3V9UA 1J54A 2P51A 2DFFA 2JLEA 4B8AB 4CJ4A 1ASUA 1S1XA 2BDPA 4M3YA 4KHYA 3CYMA 4CJSA 3RR8A 1LAVA 1S1WA 4KV8A 3KKRA 3VQDA 3ZCMA 2Z1HA 4CGHA 4CJTA 4CK1A 3KD1E 2GV9A 4HHTA 4DG1A 2E6MA 4E89A 1NK9A 1RBRA 1IKWA 3NDKA 3MECA 1NK7A 1S1UA 1RTDA 4CEQA 3TARA 4DTSA 1HPZA 3AVMA 4B9LA 3OS2A 1RT7A 2QXFA 1T03A 2ZQBA 2E6LA 3F9KA 5J1EA 2EX3A 4FLVA 3O4NA 3QEWA 3AO5A 1XI1A 4F2RA 3VQEA 3UIQA 1RILA 3VQ6A 4KFBA 3VQCA 3NH0A 4IBNA 1QTMA 2AJQA 2XY5A 4DLGA 4PUOA 3VA0A 1UWBA 3SQ0A 2KTQA 3LP2A 1WSJA 4WE1A 4H4MA 3L3VA 3K5MA 3CFPA 4CGGA 1D9DA 4IFYA 2G8KA 4J2DA 4BDPA 1NKCA 2DY4A 1JLFA 3RTVA 3PY8A 2I5JA 3K5NA 4HUEA 1N5YA 4CF0A 3AVBA 3I0RA 4J2BA 2HMIA 3ALYA 4FW2A 3F73A 3E01A 1VSHA 4BACA 3G10A 4HUFA 1MU2A 4KRFA 4E1MA 1LW0A 1RTHA 4RW4A 4M3UA 4O4GA 3NE6A 3ZT4A 1KCFA 1QS4A 2OA8A 5FRMA 4FM1A 1U04A 1YT3A 3PX6A 4CJWA 1IH7A 1FK9A 2ETJA 1I39A 2ITGA 3BDPA 5T7BA 4W5NA 4XIUA 1JLAA 1HQUA 3TI0A 3ZSVA 3QESA 4B9NA 3V1OA 1D5AA 1VSEA 3V1QA 3ZSQA 1IKYA 1SV5A 4RG8A 3OYFA 3NCIA 4KHSA 2G8IA 1CZBA 4OPJA 5HRRA 4BE2A 1VRUA 2FC0A 3ISNC 4C8NA 4FLUA 5I42A 4Z4GA 2FBTA 1CZ9A 3LP0A 1NOYA 4C8KA 4FJ5A 3OYKA 4DU4A 2IC3A 4BWJA 3QETA 5FROA 1X1PA 4W5OA 3KLIA 1RBVA 5HP1A 2P5GA 2DFEA 2F96A 3ZSZA 1IO2A 2HHSA 3NF9A 4OVLA 2HNZA 1YVUA 4GW6A 1VSKA 4KO0A 4FJNA 3HO1A 2KFNA 3L2RA 3IRXA 4NCAA 4I2QA 3D45A 4M3ZA 2KFZA 1C0TA 2O4GA 3TAPA 4FW1A 2VG6A 3VA3A 4FZYA 2Z1GA 4DQPA 4QOZB 3DOLA 1KSPA 2OZSA 2X6NA 4CIEA 3SUPA 2W42A 4CHQA 3VQ8A 1TKZA 2KZMA 4FCYA 5JS2A 1RDAA 2VG7A 3SQ4A 1S9EA 2Q3SA 4ZHRA 3M8RA 4K8ZA 3LAMA 2KQ2A 2OPSA 3OYJA 4JRPA 4FK4A 4AILC 1W0HA 3V9SA 1JL1A 3TAMA 4CJRA 1EETA 1ASWA 1K6YA 1YTUA 1RBUA 4DF8A 4EZ9A 5HBMA 1SUQA 3V9XA 3WNEA 3NGIA 2KZZA 2HHTA 1ASVA 3HP9A 4OPKA 4CFBA 4GVMA 4DS4A 1SKSA 4B9UA 3P5JA 2IS3A 2OPRA 5FDLA 1S1TA 1ITGA 4G1QA 4CEFA 1JXBA 1REVA 4KB1A 2YV0X 3HK2A 4DTNA 3OY9A 1LV5A 2XY7A 3OS0A 4CK2A 3D0PA 2PY5A 4NCBA 1DTTA 1GOCA 1JKHA 2G8UA 1BQMA 4LH4A 1BGXT 5CY4A 3ULDA 1EXQA 1TK0A 2RF2A 1G15A 3AA2A 2PYJA 4E19A 1UA1A 4KHNA 3OYGA 1BIZA 2NUBA 3HXMA 4F2SA 3HJFA 1KLMA 3LAKA 1X9WA 3AO3A 2OZMA 4DQIA 3HSTB 3TAQA 1L5UA 4FJ8A 1L3UA 3ZT1A 3KK2A 4FZXC 4IG3A 5KI6A 1DLOA 2KW4A 3S3MA 4C8MA 4DSEA 1RT3A 4FJHA 4M3WA 3QEPA 2FBYA 3C95A 1TK8A 3T3FA 4CGFA 2G8FA 1HYZA 3OYIA 1TVRA 4FJ7A 1KVCA 3KLHA 4N47A 3P83D 5D3GA 2X78A 4F3OA 4M41A 3L3UA 4R5PA 1RDDA 4DTUA 5CZ2A 1TKDA 1WNSA 2R7YA 3V9ZA 3KLEA 3RRGA 4ZTFA 2YNHA 1FXXA 4CEAA 4NYNA 5HROA 2IOCA 4PY5A 3V9WA 4M3XA 3RMCA 4I2PA 4MFBA 1Q9XA 4BDZA 3HYFA 1HMVA 2HB5A 3BGRA 4AHSA 4Z4CA 1JLCA 3SV3A 2HVIA 2ZE2A 3TANA 2VWKA 3LP3A 1RT6A 1JLBA 4CJFA 5HRSA 2X74A 1GOBA 4CJEA 3ZSRA 1NK5A 2B4JA 3MAQA 2F8TA 4CEZA 1VSJA 2HHXA 3DI6A 3HVRA 4LSLA 1SL0A 1A5VA 1J53A 1HJRA 4HVJA 2QKKA 3NBPA 4KAZA 2QKBA 1RTJA 4CF2A 3O4QA 2D0AA 4DQQA 4KTWA 2XY8A 3SNNA 4CHZA 4C8LA 5SWMA 2IGIA 3KLFA 1N6QA 4K8XA 1B92A 3ZT2A 3CM6A 1BHLA 4HUGA 4DQSA 1IG9A 4FXDA 4DS5A 3L2QA 1HNIA 3AVKA 4E3SA 1L3SA 4OJRA 4AH9A 3SCXA 4E7KA 2XY6A 3WNHA 1C0MA 1B9FA 3DLKA 4CFCA 4DU1A 1HYSA 1HNVA 3SYZA 4M3TA 2HNYA 5HRNA 2B5JA 1BQNA 3AV9A 1EP4A 2BANA 1C6VA 3U3YA 2HNDA 4FLZA 4Y1CA 3AVLA 4LY7A 3SPZA 1WSFA 3B6OA 2Y1IA 3SQ1A 3VQAA 1LWEA 3PX4A 4CIGA 3KLGA 4DSFA 4FJXA 4EP4A 1GOAA 1C0UA 5J2MA 1NOZA 4Z4HA 3PO4A 3NF8A 4B9MA 3AVJA 1UA0A 3MEEA 4CE9A 4RW9A 3CFOA 2WOMA 1TKTA 3I0SA 2LSNA 3NF7A 3LANA 4ID5A 3S9HA 3VQ7A 3AVHA 4CERA 4CECA 4FLYA 5KTQA 4PQUA 4DSLA 4H8KA 4CF8A 2G8VA 4CHOA 1JXEA 1RBTA 1A5WA 4CFDA 4W5QA 1NKEA 5KGWA 4FJ9A 1DTQA 1RCHA 4N76A 1WN7A 3V6DA 3O3HA 1ZYQA 3KIOA 5DMRA 2A1RA 1SKWA 3AO2A 3CM5A 1D8YA 2PZSA 2HHVA 1A5XA 3A2FA 1SKRA 5C25A 4KHUA 1IKXA 2A1SA 3QEIA 2D0CA 3IG1A 4B8CA 2DTUA 4Q0BA 4TSXA 3ZSOA 3PUFA 3K5LA 3LZIA 1I3AA 1VSIA 1TGOA 3LWLA 3MXIA 1T8EA 4Z4EA 1TL1A 3RMDA 3O3GA 4M42A 2PYLA 5DK5A 1XHZA 1SL2A 4LSNA 3NAEA 1QSYA 4IFVA 4UQGA 1NK6A 4FJJA 1WLJA 3S3OA 5KGXA 4DFMA 1NJWA 4YFUA 1SL1A 3K59A 3VQBA 1KTQA 1TV6A 3V4IA 1HYVA 1LW2A 3SI6A 1WSEA 3AO1A 1ZBUA 1S9GA 3V1RA 4FM2A 4FJGA 3CG7A 4CESA 4C8OA 2WONA 4E7LA 4FVMA 1NJZA 4CF9A 4CJPA 4I7FA 3VQ5A 4FLXA 4DQRA 3TAEA 3OYNA 4KHQA 4KTZA 3NH2A 2IDOA 4OKKA 2BE2A 1KFDA 4AHTA 4CHYA 4CJ5A 3OS1A 3L8BA 4F8RA 1BIUA 1TKXA 3AA3A 2RPIA 3NGYA 3VQQA 3SJJA 3AVCA 1LAWA 4ICLA 4DTOA 3KK1A 3SUOA 3AA4A 4DTXA 3S3NA 3ZSYA 1KRPA 4FJKA 4ID1A 1U45A 2JGUA 5SZTA 5K14A 1RT4A 3AO4A 3P1GA 3WNGA 4FLTA 5I3UA 1KVBA 4CJUA 3I8DA 1WSGA 4E7HA 3QEVA 2RN2A 1RTIA 3DOKA 4CCHA 4DLEA 5HLFA 3OJSA 3ZSWA 3ZT3A 4CK3A 4HTUA 3JYTA 3SQ2A 2B6AA 3C6UA 4BWMA 1B9DA 3SUNA 1W9HA 4DSIA 2BGGA 2HHUA 5CYMA 2IAJA 3NGZA 3TAGA 3RMBA 4KI4A 1KFSA 4LH5A 1U47A 4F4KA 4FZZA 1L3VA 1Q9YA 3M8PA 4OGCA 4KREA 4CEDA 1NK4A 4NYFA 4O0JA 2O4IA 3DLRA 1VSMA 4AHCA 4DTJA 4QCLA 2XO7A 4IKFA 1F21A 3HVTA 4OLAA 1LWCA 1S6PA 1VK0A 2Z1JA 1C1CA 4DU3A 4DSJA 3RWUA 5J2PA 2YNFA 3ZSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNO A;  4QAG A;  1ZBL A;  4BE1 A;  3OYL A;  4H4O A;  3DRP A;  4ELU A;  3CFR A;  4B9S A;  1O1W A;  4OGE A;  4Z4F A;  1VSD A;  3QIN A;  1BL3 A;  1UAX A;  4N56 A;  4O5B A;  3DM2 A;  3L2V A;  3CQ8 A;  1NK8 A;  4FJM A;  3OVN A;  2ATQ A;  3NF6 A;  2QK9 A;  3KK3 A;  3VQ4 A;  4CGD A;  3KKS A;  4CGI A;  4RW8 A;  4CEO A;  5C42 A;  3HPO A;  1XHX A;  1TAU A;  3QIP A;  3T1A A;  4I9L A;  4O0I A;  4O44 A;  4BE0 A;  1ZBH A;  4LD0 A;  2RKI A;  3HP6 A;  4J2E A;  3EZ5 A;  4Z0U A;  3DMJ A;  3SUQ A;  3ITH A;  1RT1 A;  3M8S A;  3C94 A;  3LDS A;  3SPY A;  2G8W A;  1S1V A;  3H08 A;  4E7J A;  3MXM A;  2VWJ A;  3VQP A;  1RDC A;  3RMA A;  3U6F A;  4OKJ A;  3ASM A;  3QNN A;  3VQ9 A;  4HCB A;  4RW6 A;  1Y97 A;  2VG5 A;  1RT2 A;  1YTA A;  3AVA A;  3NFA A;  4CJL A;  3OYH A;  4JS4 A;  4DTP A;  3LPU A;  4FJL A;  3QIO A;  4CGJ A;  3PX0 A;  1J5O A;  2D5R A;  2EHG A;  1QSS A;  3QER A;  3T19 A;  1BI4 B;  4EP5 A;  4DFK A;  1J9A A;  1HRH A;  3AA5 X;  1WAJ A;  3DRR A;  4CJQ A;  4O55 A;  4PA1 A;  2YNI A;  1WSH A;  2OPP A;  3LPT A;  4Q5V A;  2P5O A;  4B9V A;  4M45 A;  5HRP A;  1TAQ A;  3OYA A;  1TK5 A;  3KTQ A;  3IS9 A;  4N41 A;  4FJI A;  3HPH A;  1IKV A;  4CF1 A;  2E4L A;  4FK0 A;  4CJV A;  2HVH A;  1TL3 A;  1CXQ A;  1CXU A;  1HQE A;  3ZT0 A;  1CLQ A;  1FKO A;  1U49 A;  3JSM A;  4ELT A;  1EKE A;  2XHB A;  1X9S A;  4KTQ A;  4GMJ B;  5CZ1 A;  1RDB A;  1BI4 A;  3MXJ A;  2HHW A;  3HPG A;  4AHR A;  1T7P A;  1VSF A;  4W5T A;  1RBS A;  3OYB A;  3DLB A;  1X9M A;  4DWI A;  3QO9 A;  4I9Q A;  3C6T A;  5JS1 A;  3OYD A;  1T05 A;  3NH1 A;  1NJY A;  4N5S A;  3SV4 A;  3MED A;  3DLG A;  3HM9 A;  3TAF A;  1WAF A;  3K58 A;  3THV A;  1Z25 A;  4B9T A;  3O3F A;  4JLH A;  3B6P A;  3HL8 A;  4E1N A;  4KHW A;  1QE1 A;  1BIS A;  1LWF A;  1U48 A;  4KPY A;  2FBV A;  1QHT A;  1D9F A;  1JLQ A;  3HT3 A;  2F8S A;  4BDY A;  1L3T A;  4Z4I A;  4IDK A;  2YKN A;  5CYQ A;  4CHP A;  4DF4 A;  4L8R B;  1QQC A;  4CIF A;  4OLB A;  2D0B A;  3KD5 E;  3K5O A;  3DLH A;  4E0D A;  3AVG A;  4AHV A;  1S5J A;  2DFH A;  2YHA A;  3QEX A;  3AVI A;  3OJU A;  3TAB A;  2GBZ A;  3DYA A;  4M3R A;  2HHQ A;  4CJK A;  4EZ6 A;  3V81 A;  3LZJ A;  2FBX A;  1VRT A;  2YNG A;  5EU7 A;  4CHN A;  3K57 A;  2YHB A;  4JRQ A;  1U4B A;  4DFP A;  4W5R A;  2P1J A;  1BCO A;  1JLG A;  4CJ3 A;  4NCG A;  4FLW A;  1Z26 A;  2X6S A;  4CEB A;  1RNH A;  2G8H A;  4FYD A;  2GUI A;  4OKE A;  4CFA A;  5J2N A;  3PO5 A;  3QLH A;  4RW7 A;  5KRS A;  3M8Q A;  1ZBI A;  1C1A A;  1XWL A;  3U3G A;  3AVF A;  3G0Z A;  3LP1 A;  4CEE A;  3TR8 A;  4ZTJ A;  3EYZ A;  3DRS A;  4KKO A;  1BCM A;  5KRT A;  4PWD A;  3OYC A;  1ZBF A;  1C1B A;  4Y1D A;  4B08 A;  2OPQ A;  2YKM A;  3MEG A;  3WNF A;  3OYE A;  1UOC A;  1VSL A;  2Z1I A;  1JLE A;  1S6Q A;  3AVN A;  3PV8 A;  2XRI A;  3RR7 A;  3OYM A;  3SZ2 A;  2Y1J A;  5C24 A;  2HW3 A;  4HCC A;  1RT5 A;  4DSK A;  4IG0 A;  5FRN A;  3LAL A;  4KB0 A;  4AHU A;  3L2W A;  3DLE A;  4YNQ A;  3NHG A;  3TWH A;  1NKB A;  1NK0 A;  4B3O A;  5J2Q A;  4DTM A;  1JL2 A;  1NJX A;  2ZD1 A;  1FKP A;  1KVA A;  3IAY A;  3RRH A;  4ELV A;  3VN5 A;  4MQ3 A;  2OYQ A;  4FM0 A;  4E7I A;  3KJV A;  4DTR A;  1Q8I A;  3EY1 A;  1WSI A;  3FFI A;  5E41 A;  3LWM A;  4DFJ A;  1XC9 A;  4F3T A;  1QSL A;  4FK2 A;  1KLN A;  1R0A A;  3K2P A;  4JS5 A;  4J2A A;  4KI6 A;  3L2U A;  1EX4 A;  4DMN A;  3V9U A;  1J54 A;  2P51 A;  2DFF A;  2JLE A;  4B8A B;  4CJ4 A;  1ASU A;  1S1X A;  2BDP A;  4M3Y A;  4KHY A;  3CYM A;  4CJS A;  3RR8 A;  1LAV A;  1S1W A;  4KV8 A;  3KKR A;  3VQD A;  3ZCM A;  2Z1H A;  4CGH A;  4CJT A;  4CK1 A;  3KD1 E;  2GV9 A;  4HHT A;  4DG1 A;  2E6M A;  4E89 A;  1NK9 A;  1RBR A;  1IKW A;  3NDK A;  3MEC A;  1NK7 A;  1S1U A;  1RTD A;  4CEQ A;  3TAR A;  4DTS A;  1HPZ A;  3AVM A;  4B9L A;  3OS2 A;  1RT7 A;  2QXF A;  1T03 A;  2ZQB A;  2E6L A;  3F9K A;  5J1E A;  2EX3 A;  4FLV A;  3O4N A;  3QEW A;  3AO5 A;  1XI1 A;  4F2R A;  3VQE A;  3UIQ A;  1RIL A;  3VQ6 A;  4KFB A;  3VQC A;  3NH0 A;  4IBN A;  1QTM A;  2AJQ A;  2XY5 A;  4DLG A;  4PUO A;  3VA0 A;  1UWB A;  3SQ0 A;  2KTQ A;  3LP2 A;  1WSJ A;  4WE1 A;  4H4M A;  3L3V A;  3K5M A;  3CFP A;  4CGG A;  1D9D A;  4IFY A;  2G8K A;  4J2D A;  4BDP A;  1NKC A;  2DY4 A;  1JLF A;  3RTV A;  3PY8 A;  2I5J A;  3K5N A;  4HUE A;  1N5Y A;  4CF0 A;  3AVB A;  3I0R A;  4J2B A;  2HMI A;  3ALY A;  4FW2 A;  3F73 A;  3E01 A;  1VSH A;  4BAC A;  3G10 A;  4HUF A;  1MU2 A;  4KRF A;  4E1M A;  1LW0 A;  1RTH A;  4RW4 A;  4M3U A;  4O4G A;  3NE6 A;  3ZT4 A;  1KCF A;  1QS4 A;  2OA8 A;  5FRM A;  4FM1 A;  1U04 A;  1YT3 A;  3PX6 A;  4CJW A;  1IH7 A;  1FK9 A;  2ETJ A;  1I39 A;  2ITG A;  3BDP A;  5T7B A;  4W5N A;  4XIU A;  1JLA A;  1HQU A;  3TI0 A;  3ZSV A;  3QES A;  4B9N A;  3V1O A;  1D5A A;  1VSE A;  3V1Q A;  3ZSQ A;  1IKY A;  1SV5 A;  4RG8 A;  3OYF A;  3NCI A;  4KHS A;  2G8I A;  1CZB A;  4OPJ A;  5HRR A;  4BE2 A;  1VRU A;  2FC0 A;  3ISN C;  4C8N A;  4FLU A;  5I42 A;  4Z4G A;  2FBT A;  1CZ9 A;  3LP0 A;  1NOY A;  4C8K A;  4FJ5 A;  3OYK A;  4DU4 A;  2IC3 A;  4BWJ A;  3QET A;  5FRO A;  1X1P A;  4W5O A;  3KLI A;  1RBV A;  5HP1 A;  2P5G A;  2DFE A;  2F96 A;  3ZSZ A;  1IO2 A;  2HHS A;  3NF9 A;  4OVL A;  2HNZ A;  1YVU A;  4GW6 A;  1VSK A;  4KO0 A;  4FJN A;  3HO1 A;  2KFN A;  3L2R A;  3IRX A;  4NCA A;  4I2Q A;  3D45 A;  4M3Z A;  2KFZ A;  1C0T A;  2O4G A;  3TAP A;  4FW1 A;  2VG6 A;  3VA3 A;  4FZY A;  2Z1G A;  4DQP A;  4QOZ B;  3DOL A;  1KSP A;  2OZS A;  2X6N A;  4CIE A;  3SUP A;  2W42 A;  4CHQ A;  3VQ8 A;  1TKZ A;  2KZM A;  4FCY A;  5JS2 A;  1RDA A;  2VG7 A;  3SQ4 A;  1S9E A;  2Q3S A;  4ZHR A;  3M8R A;  4K8Z A;  3LAM A;  2KQ2 A;  2OPS A;  3OYJ A;  4JRP A;  4FK4 A;  4AIL C;  1W0H A;  3V9S A;  1JL1 A;  3TAM A;  4CJR A;  1EET A;  1ASW A;  1K6Y A;  1YTU A;  1RBU A;  4DF8 A;  4EZ9 A;  5HBM A;  1SUQ A;  3V9X A;  3WNE A;  3NGI A;  2KZZ A;  2HHT A;  1ASV A;  3HP9 A;  4OPK A;  4CFB A;  4GVM A;  4DS4 A;  1SKS A;  4B9U A;  3P5J A;  2IS3 A;  2OPR A;  5FDL A;  1S1T A;  1ITG A;  4G1Q A;  4CEF A;  1JXB A;  1REV A;  4KB1 A;  2YV0 X;  3HK2 A;  4DTN A;  3OY9 A;  1LV5 A;  2XY7 A;  3OS0 A;  4CK2 A;  3D0P A;  2PY5 A;  4NCB A;  1DTT A;  1GOC A;  1JKH A;  2G8U A;  1BQM A;  4LH4 A;  1BGX T;  5CY4 A;  3ULD A;  1EXQ A;  1TK0 A;  2RF2 A;  1G15 A;  3AA2 A;  2PYJ A;  4E19 A;  1UA1 A;  4KHN A;  3OYG A;  1BIZ A;  2NUB A;  3HXM A;  4F2S A;  3HJF A;  1KLM A;  3LAK A;  1X9W A;  3AO3 A;  2OZM A;  4DQI A;  3HST B;  3TAQ A;  1L5U A;  4FJ8 A;  1L3U A;  3ZT1 A;  3KK2 A;  4FZX C;  4IG3 A;  5KI6 A;  1DLO A;  2KW4 A;  3S3M A;  4C8M A;  4DSE A;  1RT3 A;  4FJH A;  4M3W A;  3QEP A;  2FBY A;  3C95 A;  1TK8 A;  3T3F A;  4CGF A;  2G8F A;  1HYZ A;  3OYI A;  1TVR A;  4FJ7 A;  1KVC A;  3KLH A;  4N47 A;  3P83 D;  5D3G A;  2X78 A;  4F3O A;  4M41 A;  3L3U A;  4R5P A;  1RDD A;  4DTU A;  5CZ2 A;  1TKD A;  1WNS A;  2R7Y A;  3V9Z A;  3KLE A;  3RRG A;  4ZTF A;  2YNH A;  1FXX A;  4CEA A;  4NYN A;  5HRO A;  2IOC A;  4PY5 A;  3V9W A;  4M3X A;  3RMC A;  4I2P A;  4MFB A;  1Q9X A;  4BDZ A;  3HYF A;  1HMV A;  2HB5 A;  3BGR A;  4AHS A;  4Z4C A;  1JLC A;  3SV3 A;  2HVI A;  2ZE2 A;  3TAN A;  2VWK A;  3LP3 A;  1RT6 A;  1JLB A;  4CJF A;  5HRS A;  2X74 A;  1GOB A;  4CJE A;  3ZSR A;  1NK5 A;  2B4J A;  3MAQ A;  2F8T A;  4CEZ A;  1VSJ A;  2HHX A;  3DI6 A;  3HVR A;  4LSL A;  1SL0 A;  1A5V A;  1J53 A;  1HJR A;  4HVJ A;  2QKK A;  3NBP A;  4KAZ A;  2QKB A;  1RTJ A;  4CF2 A;  3O4Q A;  2D0A A;  4DQQ A;  4KTW A;  2XY8 A;  3SNN A;  4CHZ A;  4C8L A;  5SWM A;  2IGI A;  3KLF A;  1N6Q A;  4K8X A;  1B92 A;  3ZT2 A;  3CM6 A;  1BHL A;  4HUG A;  4DQS A;  1IG9 A;  4FXD A;  4DS5 A;  3L2Q A;  1HNI A;  3AVK A;  4E3S A;  1L3S A;  4OJR A;  4AH9 A;  3SCX A;  4E7K A;  2XY6 A;  3WNH A;  1C0M A;  1B9F A;  3DLK A;  4CFC A;  4DU1 A;  1HYS A;  1HNV A;  3SYZ A;  4M3T A;  2HNY A;  5HRN A;  2B5J A;  1BQN A;  3AV9 A;  1EP4 A;  2BAN A;  1C6V A;  3U3Y A;  2HND A;  4FLZ A;  4Y1C A;  3AVL A;  4LY7 A;  3SPZ A;  1WSF A;  3B6O A;  2Y1I A;  3SQ1 A;  3VQA A;  1LWE A;  3PX4 A;  4CIG A;  3KLG A;  4DSF A;  4FJX A;  4EP4 A;  1GOA A;  1C0U A;  5J2M A;  1NOZ A;  4Z4H A;  3PO4 A;  3NF8 A;  4B9M A;  3AVJ A;  1UA0 A;  3MEE A;  4CE9 A;  4RW9 A;  3CFO A;  2WOM A;  1TKT A;  3I0S A;  2LSN A;  3NF7 A;  3LAN A;  4ID5 A;  3S9H A;  3VQ7 A;  3AVH A;  4CER A;  4CEC A;  4FLY A;  5KTQ A;  4PQU A;  4DSL A;  4H8K A;  4CF8 A;  2G8V A;  4CHO A;  1JXE A;  1RBT A;  1A5W A;  4CFD A;  4W5Q A;  1NKE A;  5KGW A;  4FJ9 A;  1DTQ A;  1RCH A;  4N76 A;  1WN7 A;  3V6D A;  3O3H A;  1ZYQ A;  3KIO A;  5DMR A;  2A1R A;  1SKW A;  3AO2 A;  3CM5 A;  1D8Y A;  2PZS A;  2HHV A;  1A5X A;  3A2F A;  1SKR A;  5C25 A;  4KHU A;  1IKX A;  2A1S A;  3QEI A;  2D0C A;  3IG1 A;  4B8C A;  2DTU A;  4Q0B A;  4TSX A;  3ZSO A;  3PUF A;  3K5L A;  3LZI A;  1I3A A;  1VSI A;  1TGO A;  3LWL A;  3MXI A;  1T8E A;  4Z4E A;  1TL1 A;  3RMD A;  3O3G A;  4M42 A;  2PYL A;  5DK5 A;  1XHZ A;  1SL2 A;  4LSN A;  3NAE A;  1QSY A;  4IFV A;  4UQG A;  1NK6 A;  4FJJ A;  1WLJ A;  3S3O A;  5KGX A;  4DFM A;  1NJW A;  4YFU A;  1SL1 A;  3K59 A;  3VQB A;  1KTQ A;  1TV6 A;  3V4I A;  1HYV A;  1LW2 A;  3SI6 A;  1WSE A;  3AO1 A;  1ZBU A;  1S9G A;  3V1R A;  4FM2 A;  4FJG A;  3CG7 A;  4CES A;  4C8O A;  2WON A;  4E7L A;  4FVM A;  1NJZ A;  4CF9 A;  4CJP A;  4I7F A;  3VQ5 A;  4FLX A;  4DQR A;  3TAE A;  3OYN A;  4KHQ A;  4KTZ A;  3NH2 A;  2IDO A;  4OKK A;  2BE2 A;  1KFD A;  4AHT A;  4CHY A;  4CJ5 A;  3OS1 A;  3L8B A;  4F8R A;  1BIU A;  1TKX A;  3AA3 A;  2RPI A;  3NGY A;  3VQQ A;  3SJJ A;  3AVC A;  1LAW A;  4ICL A;  4DTO A;  3KK1 A;  3SUO A;  3AA4 A;  4DTX A;  3S3N A;  3ZSY A;  1KRP A;  4FJK A;  4ID1 A;  1U45 A;  2JGU A;  5SZT A;  5K14 A;  1RT4 A;  3AO4 A;  3P1G A;  3WNG A;  4FLT A;  5I3U A;  1KVB A;  4CJU A;  3I8D A;  1WSG A;  4E7H A;  3QEV A;  2RN2 A;  1RTI A;  3DOK A;  4CCH A;  4DLE A;  5HLF A;  3OJS A;  3ZSW A;  3ZT3 A;  4CK3 A;  4HTU A;  3JYT A;  3SQ2 A;  2B6A A;  3C6U A;  4BWM A;  1B9D A;  3SUN A;  1W9H A;  4DSI A;  2BGG A;  2HHU A;  5CYM A;  2IAJ A;  3NGZ A;  3TAG A;  3RMB A;  4KI4 A;  1KFS A;  4LH5 A;  1U47 A;  4F4K A;  4FZZ A;  1L3V A;  1Q9Y A;  3M8P A;  4OGC A;  4KRE A;  4CED A;  1NK4 A;  4NYF A;  4O0J A;  2O4I A;  3DLR A;  1VSM A;  4AHC A;  4DTJ A;  4QCL A;  2XO7 A;  4IKF A;  1F21 A;  3HVT A;  4OLA A;  1LWC A;  1S6P A;  1VK0 A;  2Z1J A;  1C1C A;  4DU3 A;  4DSJ A;  3RWU A;  5J2P A;  2YNF A;  3ZSX A; 
#chains in the Genus database with same CATH topology
 3QNO A;  4B3M K;  4BE1 A;  4Z4F A;  3QIN A;  4C23 A;  4N56 A;  3CQ8 A;  4FJM A;  3NF6 A;  2QK9 A;  3KK3 A;  3EE8 A;  3VQ4 A;  3HPO A;  3KKS A;  1VQ8 N;  4BE0 A;  4LD0 A;  3HP6 A;  3T7Z A;  3ITH A;  3WT0 A;  4X65 K;  3FZH A;  3CCS N;  3MXM A;  2P9P B;  2VWJ A;  1RDC A;  5EOY A;  5AQX A;  4H5N A;  3O9R A;  3SLC A;  3QNN A;  4RW6 A;  1YIJ N;  4C1N K;  1ESV A;  4JHD A;  2ASM A;  2VG5 A;  3MK6 A;  1L3V A;  3OYH A;  3LPU A;  1QQN A;  1J5O A;  2D5R A;  4KH4 A;  1ATN A;  1R59 O;  3DRR A;  4CJQ A;  4PA1 A;  2WC9 A;  2P9K B;  3LPT A;  2QI2 A;  3KTQ A;  3GE1 A;  3IS9 A;  3DXK B;  3HPH A;  3EO3 A;  2HVH A;  1TL3 A;  1CXQ A;  4BR9 A;  1U49 A;  1Q82 O;  1X9S A;  3MCP A;  1BI4 A;  1T7P A;  1X9M A;  1GLJ O;  3NH1 A;  1XNQ K;  5ADX A;  4XH5 A;  3OHR A;  4UY8 O;  3TAF A;  3VEV A;  5C0Y A;  3B6P A;  3HL8 A;  4H0O A;  2UXD K;  1QE1 A;  1T6C A;  3ENB A;  4KPY A;  3AY9 A;  5FPE A;  1L3T A;  4O8U A;  3C7N A;  2YKN A;  2FXU A;  2YJE A;  4DF4 A;  4L8R B;  3THY A;  5AQO A;  4ILG B;  4B9Q A;  4NXM K;  3QEX A;  3T69 A;  3AVI A;  3TAB A;  4BRP A;  3MX5 A;  1ZBS A;  3LZJ A;  3MDQ A;  2HF4 A;  2YNG A;  4JRQ A;  2P1J A;  4NCG A;  4X62 K;  3LL3 A;  3BY5 A;  4FYD A;  3ATU A;  3VMF B;  4O5F A;  4HWI A;  4RW7 A;  1ZBI A;  2PFU A;  3JXU A;  4CEE A;  4EIA A;  1M90 O;  3TR8 A;  4ZTJ A;  4KKO A;  1MA9 B;  3OYC A;  2OPQ A;  3MEG A;  5AQF A;  4CJ7 A;  3PV8 A;  1O13 A;  3OYM A;  3SZ2 A;  1VQM N;  5AQZ A;  2HW3 A;  4HCC A;  2D0O A;  3L2W A;  3TWH A;  1NK0 A;  2P9N A;  3EEQ A;  4B3O A;  4DTM A;  1NJX A;  1FKP A;  4IOC L;  4ILJ A;  2OYQ A;  3EY1 A;  1WSI A;  3LWM A;  3BZC A;  3O9T A;  4J2A A;  1EX4 A;  2E20 A;  3V9U A;  4LF8 K;  3EE9 A;  2DFF A;  4CJ4 A;  4M3Y A;  2BDP A;  3QDK A;  3CYM A;  4CJS A;  1LAV A;  4DV6 K;  4JI7 K;  2Z1H A;  4BRD A;  4CJT A;  4O8K A;  2ZF5 O;  2Q36 A;  3NDK A;  1RTD A;  4DTS A;  1HPZ A;  1YUW A;  1CZA N;  4GVE A;  3B8A X;  3QEW A;  4YHH K;  3AO5 A;  1VQ4 N;  3VQC A;  4BRN A;  4B3R K;  4LC9 B;  1UWB A;  5ELZ A;  4H4M A;  2G8K A;  4J2D A;  4WFB L;  4GV6 A;  1JLF A;  2ZGZ A;  5BPL A;  3I0R A;  4BRA A;  2HMI A;  3M6G A;  1VSH A;  2HBM A;  4BRO A;  4HUF A;  3G4S N;  4KRF A;  1RTH A;  3CIP A;  3EL2 A;  4M3U A;  4DR6 K;  3NE6 A;  3ZT4 A;  1YT3 A;  2UXB K;  2UXC K;  4I6M A;  1JLA A;  2QM1 A;  3V1O A;  1D5A A;  1IKY A;  4RG8 A;  1WUA A;  1QVG M;  1CZB A;  4FLU A;  3IUC A;  5HRR A;  2E1Z A;  2FC0 A;  1XMQ K;  2E5L K;  2FBT A;  3LP0 A;  1W7A A;  4FJ5 A;  3OYK A;  3PIO L;  2O8E A;  5FRO A;  3KLI A;  1RBV A;  4U7B A;  1IG8 A;  2F96 A;  5EY4 A;  3ZSZ A;  1IO2 A;  3NF9 A;  4OVL A;  2KFN A;  1YVU A;  4CBW A;  2QXL A;  4KO0 A;  4FJN A;  4NCA A;  3D45 A;  5HOO A;  3K9J A;  1Z05 A;  4FW1 A;  3PIP L;  4DQP A;  3DOL A;  1KSP A;  2OZS A;  5AQR A;  3SUP A;  2NRZ A;  5JS2 A;  4ZHR A;  3CCM N;  4K8Z A;  3O9Q A;  2OPS A;  4FK4 A;  1EWQ A;  1JL1 A;  4H0Y B;  1EET A;  1ASW A;  4DF8 A;  5LY3 A;  4BR5 A;  2KZZ A;  3LDN A;  2HHT A;  3P38 A;  4JD2 A;  4B3T K;  3P5J A;  3TSU A;  2IS3 A;  2OPR A;  4K25 A;  1S1T A;  1ITG A;  4YY3 K;  3WXM B;  3RSE B;  2YV0 X;  4CBU A;  3OS0 A;  4NLC A;  4NCB A;  1DTT A;  1BGX T;  4R79 A;  1EXQ A;  1QZ5 A;  1TK0 A;  3DWL A;  1G15 A;  1BIZ A;  4F2S A;  1Q86 O;  4DR2 K;  3HJF A;  1KLM A;  1X9W A;  3CCU N;  2OZM A;  3ZX2 A;  3I33 A;  1L3U A;  2YI1 A;  4H03 B;  3VET A;  3ENH A;  3CI5 A;  3EN9 A;  4IWV A;  3A5O C;  3C95 A;  3I55 N;  2QWR A;  1TVR A;  1SAZ A;  4N47 A;  2FLO A;  3P83 D;  2F4V K;  4DR7 K;  1Z6R A;  3CCQ N;  3U9D A;  3E9L A;  3KLE A;  2BUP A;  5BN9 A;  1E4G T;  4MFB A;  1HMV A;  2FF6 A;  1K8K A;  1SZ2 A;  2ZE2 A;  3LP3 A;  1RT6 A;  3N4P A;  4GKJ K;  1NGE A;  3THW A;  5KPR A;  3ZSR A;  2B4J A;  3NVK A;  3BF3 A;  1WBD A;  1VSJ A;  2DPN A;  1A5V A;  1J53 A;  4HVJ A;  4K42 A;  3NBP A;  1RTJ A;  3VOV A;  3HI0 A;  3G25 A;  1B92 A;  3CM6 A;  4DQS A;  4DUY K;  4E3S A;  4AM6 A;  4OJR A;  4E7K A;  4FL9 A;  4YOV A;  1HYS A;  4JV5 K;  3SYZ A;  2D1K A;  2HNY A;  4BVO A;  1BQN A;  2BAN A;  3O6W A;  5FPM A;  4Y1C A;  3SPZ A;  2Y1I A;  1WBB A;  3VQA A;  3PX4 A;  4CZH A;  4LF5 K;  1EQY A;  2HHH K;  1C0U A;  4BQZ A;  3W3D A;  3T1H K;  3MEE A;  4RW9 A;  5F1X A;  3VES A;  3LAN A;  3VQ7 A;  5KTQ A;  4PQU A;  5IWA K;  4CF8 A;  2G8V A;  2NZT A;  5F0X A;  4CFD A;  1NKE A;  4FJ9 A;  1WN7 A;  2YCH A;  3V6D A;  3KIO A;  3CM5 A;  1K8A O;  3CJ1 A;  1A5X A;  4B8C A;  3ZSO A;  2YX6 A;  3K5L A;  1I3A A;  4Z4E A;  3O8M A;  1TL1 A;  3ULE B;  3HOS A;  2F7T A;  3GOI A;  4FJJ A;  5KGX A;  1SL1 A;  5AZJ A;  1MWM A;  1NJI O;  4QS8 A;  4K41 A;  4B1W B;  4FM2 A;  4A5B A;  3CG7 A;  2UUA K;  1QQO A;  4CBX A;  2WON A;  4E7L A;  5AFU A;  4CF9 A;  4CJP A;  4DQR A;  4KTZ A;  4JKH A;  4OKK A;  3W0L A;  2BE2 A;  3NH2 A;  1NU0 A;  4F8R A;  1TKX A;  3THX B;  1HR0 K;  2RPI A;  3NGY A;  3VQQ A;  1NGF A;  3SJJ A;  4ICL A;  3NMU A;  3AO4 A;  4BG8 A;  4FLT A;  2CGJ A;  4RCH A;  5HLF A;  2B6A A;  2IVN A;  3SUN A;  2BGG A;  5CYM A;  5FPD A;  4FWQ A;  4OGC A;  4KRE A;  4O0J A;  1YHQ N;  1EO1 A;  4M7Y A;  5BPM A;  4IKF A;  2Q0R A;  3HVT A;  5J2P A;  1IBL K;  2KLA A;  4ELU A;  4B1V A;  4B9S A;  4OGE A;  3L2V A;  4O5B A;  2ATQ A;  3WEE A;  4CGD A;  5C42 A;  4RW8 A;  4KBO A;  3QIP A;  2OCE A;  4I9L A;  4O0I A;  3HTV A;  1XMO K;  4J2E A;  3A5N C;  3QFP A;  4U67 L;  1RT1 A;  2NRX A;  2W41 A;  4HTL A;  4H5R A;  2QA4 N;  5M1N A;  1W2B M;  3VQ9 A;  1Y64 A;  3VEY A;  3AVA A;  3NFA A;  1KD1 O;  4PL7 A;  3PX0 A;  2QWO A;  2Q31 A;  3WXJ A;  4EP5 A;  3O1B A;  4DFK A;  1J9A A;  1HRH A;  3UB5 A;  3L0Q A;  1WAJ A;  1GLF O;  4B9V A;  4M45 A;  1TK5 A;  3CJC A;  1YI2 N;  4FJI A;  4FO0 A;  1YAG A;  3CC2 N;  1CXU A;  2GEM A;  3ZT0 A;  4OPA A;  3JSM A;  2E2Q A;  3C0B A;  1RDB A;  2HHW A;  5JMV A;  4AHR A;  4W5T A;  1NLV A;  5LJV A;  3QO9 A;  4JAX A;  4DWI A;  3C6T A;  3EKU A;  1T05 A;  4MO4 A;  4NO7 A;  4JI3 K;  3SV4 A;  3R1X A;  3DXK A;  3HM9 A;  3CC4 N;  1WAF A;  3K58 A;  4B9T A;  3O3F A;  3L6Q A;  4JLH A;  4KHP K;  4E1N A;  4YOW A;  4KHW A;  1BWF O;  1V4T A;  4JI2 K;  1U48 A;  2F8S A;  2P9L B;  4IDK A;  4A2B A;  5CYQ A;  2QWN A;  4CIF A;  3K5O A;  4CZI A;  3DLH A;  1P90 A;  4E0D A;  3MWT A;  1S5J A;  3OJU A;  2GBZ A;  2HHQ A;  1HKG A;  4EZ6 A;  3BEX A;  2FBX A;  3K57 A;  3H1Q A;  4JKA A;  3MWP A;  2E2O A;  4RWT A;  1JCF A;  1BCO A;  1JLG A;  4CJ3 A;  2GTD A;  2ZM6 K;  2G8H A;  2GUI A;  2QWL A;  5J2N A;  3PO5 A;  3GG4 A;  3QLH A;  3J7A P;  4LFC K;  2HST A;  3U3G A;  3AVF A;  1N33 K;  2OTJ N;  5FPN A;  2YKM A;  1UOC A;  3AVN A;  3LDP A;  3R6M A;  5C24 A;  2FSN A;  4IG0 A;  4AHU A;  3DLE A;  3DJC A;  5J2Q A;  1JL2 A;  2F9T A;  3PSI A;  3RRH A;  5I9E B;  4FM0 A;  3FFI A;  5E41 A;  4NXN K;  4Y0W A;  4FK2 A;  1R0A A;  4BRF A;  3K2P A;  1J54 A;  2D0P A;  2JLE A;  1S1X A;  1IBM K;  2V7Y A;  3VQD A;  1S1W A;  3ZCM A;  3M1F A;  2CGK A;  4CGH A;  5AQT A;  2E6M A;  3P4I A;  4E89 A;  3I56 N;  1NK7 A;  4IJA A;  1S1U A;  4B9L A;  3MCA B;  1T03 A;  2ZQB A;  2E6L A;  2EX3 A;  1XI1 A;  2O8D B;  5AZI B;  2P9S B;  5JLH A;  5KQ8 A;  1QTM A;  1JCG A;  3VA0 A;  3SQ0 A;  3LP2 A;  1WSJ A;  4WE1 A;  3K5M A;  4KH6 A;  4CGG A;  1YJW N;  4BDP A;  1NKC A;  2DY4 A;  3RTV A;  4CZK A;  4HUE A;  3ALY A;  4FW2 A;  4WYB A;  4J8F A;  1BA1 A;  2V52 B;  4LF9 K;  4BAC A;  3TPQ A;  1MU2 A;  3HOT A;  4E1M A;  4JKG B;  1XUP O;  3QFU A;  4O4G A;  1KCF A;  2OA8 A;  1D4X A;  5FRM A;  3K0S A;  1IH7 A;  2ETJ A;  3BDP A;  2ITG A;  4EFH A;  4MLE A;  1HQU A;  2E1Y A;  3TI0 A;  3ZSV A;  4AQY K;  4YDU C;  3CJA A;  5KPZ A;  3QES A;  4B9N A;  3ZSQ A;  2G8I A;  3NCI A;  4BE2 A;  4OPJ A;  3FZM A;  4EAH D;  4DU4 A;  2IC3 A;  4DR1 K;  4BWJ A;  3QET A;  1HKB A;  3LDO A;  1VQL N;  3VF2 A;  3GL1 A;  5HP1 A;  3OW2 M;  2HHS A;  3HO1 A;  4GW6 A;  3I8B A;  3CCV N;  3LDL A;  1BOT O;  4M3Z A;  1C0T A;  2O4G A;  3TAP A;  3FLC O;  3VA3 A;  2BH1 A;  4FZY A;  3AAP A;  4BGA A;  4FPB A;  1NGA A;  2X6N A;  2W42 A;  3AGK A;  1TKZ A;  2VG7 A;  4A61 A;  3SAH A;  3OYJ A;  1W0H A;  2QTD A;  3QBW A;  3KHY A;  3V9S A;  3TAM A;  1K6Y A;  4EZ9 A;  4X64 K;  3GDQ A;  3NGI A;  3L4Q A;  4OPK A;  4CFB A;  1P8Z A;  4FSV A;  4G1Q A;  1K73 O;  1JXB A;  4CZG A;  4DTN A;  1LV5 A;  4FWK A;  3PSF A;  4CK2 A;  1JKH A;  1BQM A;  4LH4 A;  3ULD A;  4JEP A;  4BR0 A;  5JLF A;  1UA1 A;  3OYG A;  3HXM A;  1GLB G;  3HST B;  4FJ8 A;  2O8C A;  2GEL A;  3VEX A;  3ZT1 A;  3KK2 A;  5AQY A;  1YJ9 N;  1XQS C;  3RSE A;  2IVO A;  4NLB A;  1RT3 A;  4H0X B;  1TK8 A;  4OO1 J;  1N36 K;  3OYI A;  1KVC A;  3KLH A;  1WB9 A;  4M41 A;  2Q97 A;  3L3U A;  3P39 A;  5CZ2 A;  3FGU A;  4K43 A;  3J7Y P;  4NYN A;  3SK3 A;  4FWM A;  4PY5 A;  3RMC A;  1IBK K;  2HB5 A;  4Z4C A;  4B3S K;  4JK9 A;  3MN7 A;  1JLB A;  4CJF A;  3D6R A;  3TTD A;  2X74 A;  1GOB A;  2QW9 A;  2F8T A;  4K0K K;  2ASO A;  2HHX A;  3DI6 A;  5M1K A;  4LSL A;  4WCE L;  1SL0 A;  1HJR A;  4KAZ A;  1ZC6 A;  2D0A A;  3SNN A;  4CHZ A;  1IV0 A;  4FXD A;  3L2Q A;  1L3S A;  1DT9 A;  2XY6 A;  1OVY A;  2KKZ A;  5GIP A;  4DV5 K;  1C0M A;  1B9F A;  3DLK A;  4H5V A;  4CFC A;  2A5X A;  3QIC A;  1BUP A;  4FLZ A;  4DV7 K;  4DSF A;  4FJX A;  4EP4 A;  4JI8 K;  5J2M A;  1NOZ A;  4Z4H A;  3ZLJ A;  4A2A A;  3NF8 A;  1VQO N;  2WOM A;  4PHT X;  4DV3 K;  4ID5 A;  3S9H A;  4CER A;  4DSL A;  4H8K A;  3CCL N;  4CHO A;  1JXE A;  2ZWH A;  3THY B;  4JYA K;  1A5W A;  4W5Q A;  5KGW A;  2VYP A;  2YHY A;  1DTQ A;  3WXI A;  4N76 A;  1SKW A;  5DMR A;  3AO2 A;  1D8Y A;  1HNW K;  1SKR A;  4KHU A;  2D0C A;  3PUF A;  1VSI A;  3MXI A;  1TGO A;  1T8E A;  3RMD A;  3ZX3 A;  4DV1 K;  4LSN A;  3NAE A;  1WLJ A;  1NJW A;  3K59 A;  1KTQ A;  1HYV A;  1WSE A;  1ZBU A;  2FSJ A;  3CCJ N;  1S9G A;  3CJ9 A;  3V1R A;  1X3N A;  4WFN L;  4FJG A;  3DLL L;  1OH5 A;  3CMA N;  4I7F A;  1S72 N;  3UKU A;  2IDO A;  3ULE A;  1ILY A;  4CHY A;  4A59 A;  5LMU K;  1KAZ A;  3AVC A;  4DTO A;  3KK1 A;  3SUO A;  1KRP A;  4ID1 A;  3WNG A;  3AAR A;  1VQP N;  4QS9 A;  5E84 A;  2RN2 A;  4CCH A;  4DLE A;  4MDA A;  3OJS A;  3ZSW A;  3ZT3 A;  3AGR A;  3HRG A;  3VF6 A;  4CK3 A;  3THX A;  1NM1 A;  1Q9Y A;  4CED A;  4LFA K;  4WQ5 C;  2RE2 A;  2RHK A;  3BZK A;  5M1O A;  1YJN N;  2GWK A;  4OLA A;  1LWC A;  1NG9 A;  3CD6 N;  4DSJ A;  3RWU A;  2YNF A;  3ZSX A;  4QAG A;  3OYL A;  4H4O A;  3DRP A;  1O1W A;  4JKF A;  1BL3 A;  1UAX A;  3FZL A;  1NK8 A;  4DB3 A;  3OVN A;  3TTC A;  4CGI A;  3H3N O;  3PLA A;  1TAU A;  4JK7 A;  3DXM B;  4O44 A;  1X3M A;  2RKI A;  3SUQ A;  3SAG A;  3EKS A;  4YOR A;  2G8W A;  3RVC A;  3H08 A;  4E7J A;  4DR4 K;  2BTF A;  2I7N A;  3RMA A;  4OKJ A;  3KK7 A;  1HNZ K;  4BG9 A;  4BVP A;  1RT2 A;  1YTA A;  4JS4 A;  3D2E A;  3QIO A;  4BGB A;  1YVN A;  3F9M A;  4I6M B;  3AA5 X;  4CZE A;  3ZET B;  1Q81 O;  4O55 A;  2OPP A;  4Q5V A;  3CC7 N;  2IIR A;  3OYA A;  1H1V A;  4N41 A;  4CF1 A;  4FK0 A;  4CJV A;  1HQE A;  3F2K A;  1DEJ A;  1CLQ A;  4NB4 A;  1FKO A;  3ZEU A;  1MWK A;  1EKE A;  1OVQ A;  2VGN A;  2XHB A;  4KTQ A;  4GMJ B;  3MXJ A;  3U8X A;  5A2Q O;  3DLB A;  4I9Q A;  1N32 K;  4N5S A;  2PBD A;  3MN5 A;  3THV A;  3J8A A;  4Z94 A;  3CCE N;  3H1V X;  4BR4 A;  1LWF A;  2FBV A;  3HT3 A;  2HBJ A;  3G6E N;  4AF1 A;  4Z4I A;  2NNW A;  4CZJ A;  4CHP A;  1VQK N;  1NGH A;  1QQC A;  4OLB A;  3KD5 E;  2DFH A;  2YHA A;  3WUH A;  3DYA A;  4M3R A;  2WTU A;  1U2V A;  2Q2R A;  4JD2 B;  4CJK A;  3V81 A;  1VRT A;  4CHN A;  3ZX0 A;  4DFP A;  4W5R A;  2X6S A;  2P9U B;  1YXQ A;  5M1Q A;  4B1Y B;  4OX9 K;  2AA4 A;  3M8Q A;  4JN4 A;  4BQL A;  2A41 A;  3EYZ A;  1BCM A;  1NGJ A;  1WOQ A;  4CI6 A;  1C1B A;  1ZBF A;  4Y1D A;  4PWD A;  4B08 A;  3WNF A;  1BO5 O;  3OYE A;  3R3L A;  2Z1I A;  3UKR B;  2Y1J A;  1LCU A;  4BR2 A;  5BR8 K;  1RT5 A;  4DSK A;  3LDQ A;  4FWR A;  3QB0 A;  4CZL A;  3HBT A;  1KVA A;  1T3V A;  4ELV A;  3VN5 A;  4MQ3 A;  3D2F A;  4DTR A;  1Q8I A;  4DFJ A;  2QWM A;  4MDB A;  4JS5 A;  4KI6 A;  3C6H A;  2HMP A;  2P51 A;  4B8A B;  5GAD P;  1KC8 O;  4B1U B;  4KV8 A;  4CK1 A;  3KD1 E;  4HHT A;  3T1Y K;  1NK9 A;  1RBR A;  1NNE A;  1IKW A;  3THW B;  4CEQ A;  3TAR A;  4DKW A;  3F9K A;  1K9M O;  5J1E A;  2FSK A;  4F2R A;  1RIL A;  2A3Z A;  3VQ6 A;  5GIO A;  3NH0 A;  4FVU A;  1RDW X;  1S22 A;  2XY5 A;  4JKD A;  5GAG P;  4DLG A;  4PUO A;  4WQ4 C;  1HUX A;  3PY8 A;  3IDH A;  2I5J A;  3K5N A;  5C2F A;  4J2B A;  3F73 A;  1HX1 A;  2VCP A;  2P9I B;  5AZI A;  2P9P A;  2P9S A;  3G10 A;  1LW0 A;  3M5R A;  5CE3 A;  3FZK A;  3G71 N;  1DKG D;  1TUY A;  5TKW A;  1U04 A;  4MO5 A;  3MN6 A;  4DR3 K;  3PX6 A;  5T7B A;  4W5N A;  1FW6 A;  2O8F B;  2P9K A;  2O8B B;  3OYF A;  1SS6 A;  4DHY A;  1CZ9 A;  4EHU A;  4C8K A;  3E66 A;  3VER A;  1X1P A;  3TSP A;  3A8Y A;  1S3X A;  2E88 A;  3VEN A;  2HNZ A;  4IO9 L;  1VSK A;  1OH6 A;  1KAX A;  3IRX A;  4IXC A;  3C65 A;  5AZJ B;  3CF5 L;  4CIE A;  4H5W A;  4CHQ A;  3VQ8 A;  2KZM A;  1RDA A;  1S9E A;  2Q3S A;  4IZ9 A;  3M8R A;  3LAM A;  4AIL C;  1HKC A;  2F9W A;  2V7Z A;  4CJR A;  4LF4 K;  3SJH A;  1YTU A;  4BC3 A;  5HBM A;  2ASP A;  3A0I X;  3V9X A;  3WNE A;  1ASV A;  1TYQ B;  4GVM A;  3ID8 A;  4DS4 A;  3LM9 A;  4CEF A;  5FDL A;  2ZGY A;  5GIN A;  3IFR A;  5EVZ A;  1REV A;  3HK2 A;  1VQ7 N;  3OY9 A;  3S41 A;  4IFE A;  2YHX A;  2G8U A;  3O4W A;  3AA2 A;  3GBT A;  4FPA A;  2QEX N;  4KHN A;  2NUB A;  1OH7 A;  4XH1 A;  3AO3 A;  3TAQ A;  5AQP A;  5KI6 A;  2KW4 A;  4C8M A;  5BR9 A;  1RDU A;  4M3W A;  2FBY A;  3QBX A;  4QS7 A;  3T3F A;  4CGF A;  1HYZ A;  4ISG A;  3CXC M;  1KQS M;  1IJJ A;  2X78 A;  3WQT A;  4R5P A;  2J4R A;  4DTU A;  1TKD A;  2R7Y A;  2NRW A;  3RRG A;  4ZTF A;  5AQU A;  2YNH A;  4PKH A;  5HRO A;  1Q9X A;  5AQS A;  3HYF A;  1GLC G;  4CD3 A;  4G9Z A;  1W97 L;  3SV3 A;  2HVI A;  1BDG A;  3TAN A;  2VWK A;  4RTF D;  5CR4 A;  4FOE A;  5AQM A;  1NK5 A;  3N4Q A;  3MAQ A;  3O80 A;  4ISE A;  3HVR A;  4E1J A;  5DM6 L;  4CF2 A;  1ATR A;  3O4Q A;  4FOI A;  4C8L A;  2XY8 A;  2IGI A;  1N6Q A;  3HZ6 A;  3FE1 A;  4DS5 A;  3AVK A;  4BC4 A;  5EXW A;  3ID6 A;  4AH9 A;  4ILH A;  4WFA L;  3WNH A;  3VEZ A;  3MMV A;  3KVG A;  3VF4 A;  2B5J A;  1NBW A;  4M63 C;  3U3Y A;  1EP4 A;  1C6V A;  2Q1N A;  5DM7 L;  5IT9 O;  1WSF A;  3B6O A;  3SQ1 A;  1BU6 O;  4DQ8 A;  1VQ6 N;  3KLG A;  3CPE A;  4LF7 K;  1GOA A;  3WXL A;  4B9M A;  1UA0 A;  4CE9 A;  4JKE A;  3CFO A;  1TKT A;  2LSN A;  3NF7 A;  4IDH A;  5CHI A;  3LM2 A;  3AVH A;  4XEI A;  4CEC A;  5AQJ A;  5M1P A;  2OTL N;  1RBT A;  3CCR N;  1ZYQ A;  2HHV A;  3OA9 A;  3UE5 A;  5E26 A;  3IG1 A;  2DTU A;  4Q0B A;  2OAN A;  3LZI A;  4DCH A;  1QHA A;  3O3G A;  5DK5 A;  1XHZ A;  1Q7Y O;  3U9Z A;  3H6E A;  4IFV A;  4UQG A;  1NK6 A;  4FWO A;  5BRF A;  1TV6 A;  3HM8 A;  3V4I A;  1SQK A;  1U6Z A;  2D4W A;  4GY2 B;  4X66 K;  4FVM A;  4FLX A;  4YDU A;  4AHT A;  3L8B A;  4CJ5 A;  1BIU A;  4A62 A;  1VHX A;  2ZJQ L;  2W6K A;  3AA4 A;  4DTX A;  3S3N A;  3ZSY A;  1NMN A;  4IO8 A;  5SZT A;  3ATV A;  5K14 A;  2JWL A;  3P1G A;  1OKJ A;  1KVB A;  4CJU A;  4JKB A;  3I8D A;  4E7H A;  3QEV A;  1RTI A;  3DOK A;  2WBN A;  2WUS A;  4HTU A;  2CH6 A;  4DSI A;  1W9H A;  4KI4 A;  1KFS A;  4F4K A;  3E9P A;  4JNE A;  3J81 O;  1NGG A;  4H0P A;  3F5T A;  3DLR A;  3NVM A;  3MX2 A;  3ZYY X;  4AHC A;  4BRM A;  4DTJ A;  4M7X A;  3O9S A;  2W40 A;  2HF3 A;  3K9K A;  5AQW A;  5B8H A;  3OTO K;  3CJ7 A;  4DU3 A;  1ZBL A;  2HOE A;  3CFR A;  5AQG A;  4YOU A;  1VSD A;  3DM2 A;  3FR0 A;  3Q7C A;  4WF9 L;  4CEO A;  4JHD B;  1XHX A;  5AR0 A;  3T1A A;  1BG3 A;  1ZBH A;  3EZ5 A;  4Z0U A;  3DMJ A;  3O9U A;  5AQL A;  3VGM A;  5AJ3 K;  3M8S A;  1KAY A;  3C94 A;  3LDS A;  1EWR A;  3SPY A;  1S1V A;  3VQP A;  1QQM A;  3U6F A;  3P31 A;  3VTI A;  3ASM A;  4V19 S;  1I94 K;  5ADX H;  4HCB A;  4CZF A;  1Y97 A;  3R8E A;  4DTP A;  3DXM A;  4CJL A;  4FJL A;  2VQE K;  4CGJ A;  2EHG A;  1QSS A;  3QER A;  3T19 A;  1BI4 B;  3TSQ A;  1BA0 A;  1WSH A;  2YNI A;  3CQX A;  2P5O A;  3JS6 A;  1HLU A;  1VQN N;  1T6D A;  1TAQ A;  5HRP A;  5TKY A;  1IKV A;  2E4L A;  3JAM O;  4ELT A;  2NRV A;  5CZ1 A;  4GV9 A;  3HPG A;  1VSF A;  3ZET A;  1RBS A;  3OYB A;  1GLA G;  3C7N B;  3A5M C;  5JS1 A;  3OYD A;  1JJ2 M;  4GV3 A;  1NJY A;  3MED A;  4B1Z A;  1E4F T;  3DLG A;  1Z25 A;  3CJB A;  1OH8 A;  4A5A A;  5EX5 A;  1BIS A;  1HNX K;  1QHT A;  1D9F A;  1JLQ A;  1QZ6 A;  4BDY A;  1LOT B;  3AAQ A;  2D0B A;  4PKG A;  2GWJ A;  3AVG A;  4AHV A;  3M3Z A;  4YOY A;  3Q7B A;  4B1X B;  4H0V B;  2ITM A;  4BRQ A;  4IOA L;  5EU7 A;  2YHB A;  1U4B A;  3O08 A;  4FLW A;  1Z26 A;  1ATS A;  3WQU A;  4CEB A;  2GX9 A;  4JI1 K;  1RNH A;  4F9O A;  4OKE A;  4CFA A;  2HBL A;  5FLX O;  5KRS A;  4DR5 K;  4BY9 C;  2P9N B;  3CPW M;  1C1A A;  1XWL A;  3G0Z A;  3LP1 A;  3DRS A;  5KRT A;  3ENO A;  3VGL A;  3SMS A;  1M1K O;  1C0F A;  4CD1 A;  5JVH L;  2O8C B;  1VSL A;  1JLE A;  1S6Q A;  3RR7 A;  2XRI A;  1GLE G;  1YIT N;  1ZXO A;  3SBT A;  5BN8 A;  5FRN A;  2P9U A;  3LAL A;  3HSC A;  4KB0 A;  5AQK A;  3SBG A;  4YNQ A;  3NHG A;  1NKB A;  3KWG A;  2CGL A;  2ZD1 A;  3A5L C;  3IAY A;  4E7I A;  3KJV A;  1XC9 A;  4F3T A;  1QSL A;  3VTH A;  3UKR A;  1KLN A;  3L2U A;  4DMN A;  5LMN K;  4KHY A;  1ASU A;  3TU5 A;  4JI4 K;  4PKI A;  3RR8 A;  2VQF K;  3KKR A;  3U4L A;  2GV9 A;  3SMP A;  4DG1 A;  2A6A A;  3CQY A;  3MEC A;  5C10 A;  3AVM A;  4GNI A;  3OS2 A;  2NRR A;  1RT7 A;  2QXF A;  2VWB A;  4FLV A;  4BRL A;  3O4N A;  3VQE A;  3UIQ A;  4KFB A;  1J6Z A;  4IBN A;  2AJQ A;  2KTQ A;  1X9J A;  2AP1 A;  3L3V A;  3CFP A;  1D9D A;  4IFY A;  4DV0 K;  1N8R O;  4BC2 A;  3VPZ A;  1N5Y A;  4CF0 A;  3AVB A;  1NGI A;  3E01 A;  4JK8 A;  5AQN A;  4RW4 A;  5AQH A;  4WQ5 A;  1QS4 A;  4FM1 A;  2KHO A;  4BRC A;  3J7Z O;  4L3Q A;  2NRH A;  4JI6 K;  4CJW A;  2O8E B;  4JKC A;  2YHW A;  1FK9 A;  1I39 A;  2ZJR L;  5BRD A;  4XIU A;  2P9I A;  1VSE A;  4OPH A;  3V1Q A;  1SV5 A;  4JI5 K;  4KHS A;  1NGB A;  1VRU A;  3ISN C;  4C8N A;  5I42 A;  4Z4G A;  2UYT A;  1NOY A;  3VGK A;  2UUB K;  4W5O A;  2P5G A;  2EWS A;  2DFE A;  3IMX A;  4LF6 K;  2O8F A;  2O8B A;  4JI0 K;  1NGC A;  1T44 A;  3MN9 A;  3OBW A;  1QVF M;  3CME N;  3L2R A;  1E3M A;  4I2Q A;  2KFZ A;  5GAE P;  1HJO A;  4IEI A;  3KWI A;  2VG6 A;  4BC5 A;  2Z1G A;  4IEE A;  4YOT A;  4QOZ B;  3IKM A;  5GAH P;  2UU9 K;  4FCY A;  5KPT A;  3SQ4 A;  2P9L A;  2YJF A;  2KQ2 A;  4JRP A;  4BRE A;  3UKU B;  2CH5 A;  4FWN A;  1RBU A;  1C0G A;  1SUQ A;  5MLC Q;  3VEO A;  3HP9 A;  3WXK A;  2V51 B;  1SKS A;  4B9U A;  5AQV A;  5BRE A;  4KB1 A;  3BF1 A;  2XY7 A;  3D0P A;  2PY5 A;  4ISF A;  1GOC A;  5CY4 A;  2RF2 A;  3R9P A;  2PYJ A;  1TYQ A;  4E19 A;  4EHT A;  1NWK A;  3LAK A;  4DQI A;  1L5U A;  4FZX C;  4IG3 A;  1DLO A;  3S3M A;  3O1W A;  4DSE A;  4IOX A;  1VQ5 N;  1GLD G;  4FJH A;  3QEP A;  4KH5 A;  1G99 A;  4BRI A;  1NGD A;  3BUZ B;  3C6A A;  1K8K B;  2Q0U A;  5HL7 L;  2G8F A;  1Q18 A;  4FJ7 A;  2E2N A;  3BP8 A;  3QML A;  5D3G A;  4F3O A;  3J80 O;  1RDD A;  2QWQ A;  1WNS A;  3V9Z A;  2PAV A;  5AQI A;  1FXX A;  2E8A A;  4CEA A;  4DUZ K;  2IOC A;  3V9W A;  4M3X A;  4IJN A;  4I2P A;  4BDZ A;  2GUP A;  3BGR A;  2QWP A;  4AHS A;  1JLC A;  2UUC K;  2WFB A;  5HRS A;  1RFQ A;  3FZF A;  4CJE A;  3EZW A;  4CEZ A;  3D2E B;  1TUU A;  3E1Y A;  2O8D A;  2QKK A;  2QKB A;  4DQQ A;  4KTW A;  5JIC A;  2NRT A;  5SWM A;  3KLF A;  4K8X A;  3ZT2 A;  1BHL A;  4HUG A;  1IG9 A;  4DV2 K;  4AM7 A;  1HNI A;  2ZJP L;  3SCX A;  4MLH A;  3ZEU B;  1YF5 L;  4FWP A;  4BRK A;  4A57 A;  4DU1 A;  1HNV A;  4M3T A;  5HRN A;  2I7P A;  3AV9 A;  2HND A;  4JKG A;  3AVL A;  2H3G X;  4LY7 A;  3VEW A;  2HBK A;  1DGK N;  1KXP A;  4BRH A;  1LWE A;  2E2P A;  3H46 O;  3E9O A;  4CIG A;  5C12 A;  4CVN E;  3H45 C;  4GKK K;  3PO4 A;  3AVJ A;  4H0T B;  3I0S A;  5F2R A;  4DV4 K;  4LFB K;  4FLY A;  1N34 K;  3DAW A;  1J5E K;  5AFU H;  3CET A;  5JVG L;  5C15 A;  3O5B A;  4H5T A;  5KQD A;  3KZB A;  1RCH A;  3H3O B;  4WQ4 A;  1FJG K;  3O3H A;  2A1R A;  2PZS A;  5BRH A;  3A2F A;  1NMD A;  1U2V B;  5C25 A;  1IKX A;  2A1S A;  2IVP A;  3QEI A;  1XNR K;  4TSX A;  3LWL A;  1V4S A;  4M42 A;  4C1N I;  2PYL A;  1SL2 A;  5C2D A;  1VQ9 N;  1QSY A;  3S3O A;  4DFM A;  4YFU A;  3VQB A;  5M1F A;  1LW2 A;  3SI6 A;  3AO1 A;  1GLL O;  4CES A;  4C8O A;  3D7E O;  5AQQ A;  1NJZ A;  3OBY A;  3VQ5 A;  3TAE A;  5LL6 Z;  3OYN A;  4KHQ A;  1KFD A;  3OS1 A;  1VAZ A;  3AA3 A;  4PL8 A;  4BR7 A;  2FF3 B;  1LAW A;  2JWK A;  4YOX A;  4FJK A;  4XH4 A;  4CZM A;  4FWS A;  1U45 A;  2JGU A;  4CW7 B;  1RT4 A;  2VGM A;  5I3U A;  1XC3 A;  2A40 A;  3D2F B;  1WSG A;  5BPN A;  1HPM A;  5LJW A;  1MDU B;  2NLX A;  5H1S Q;  3JYT A;  4BRG A;  3SQ2 A;  3C6U A;  4BWM A;  1B9D A;  2HHU A;  3TAG A;  2IAJ A;  3NGZ A;  2W6L A;  3RMB A;  4LH5 A;  1U47 A;  4FZZ A;  3TTF A;  3M8P A;  1NK4 A;  4NYF A;  2O4I A;  1VSM A;  3CER A;  3WEE B;  3FFK B;  4QCL A;  2XO7 A;  1F21 A;  1JCE A;  1RGI A;  1S6P A;  1VK0 A;  2Z1J A;  4FWL A;  3SAF A;  2A42 A;  1C1C A;  3CHW A;  3L4I A; 
#chains in the Genus database with same CATH homology
 3QNO A;  4QAG A;  1ZBL A;  4BE1 A;  3OYL A;  4H4O A;  3DRP A;  4ELU A;  3CFR A;  4B9S A;  1O1W A;  4OGE A;  4Z4F A;  1VSD A;  3QIN A;  1BL3 A;  1UAX A;  4N56 A;  4O5B A;  3DM2 A;  3L2V A;  3CQ8 A;  1NK8 A;  4FJM A;  3OVN A;  2ATQ A;  3NF6 A;  2QK9 A;  3KK3 A;  3VQ4 A;  4CGD A;  3KKS A;  4CGI A;  4RW8 A;  4CEO A;  5C42 A;  3HPO A;  1XHX A;  1TAU A;  3QIP A;  3T1A A;  4I9L A;  4O0I A;  4O44 A;  4BE0 A;  1ZBH A;  4LD0 A;  2RKI A;  3HP6 A;  4J2E A;  3EZ5 A;  4Z0U A;  3DMJ A;  3SUQ A;  3ITH A;  1RT1 A;  3M8S A;  3C94 A;  3LDS A;  3SPY A;  2G8W A;  1S1V A;  3H08 A;  4E7J A;  3MXM A;  2VWJ A;  3VQP A;  1RDC A;  3RMA A;  3U6F A;  4OKJ A;  3ASM A;  3QNN A;  3VQ9 A;  4HCB A;  4RW6 A;  1Y97 A;  2VG5 A;  1RT2 A;  1YTA A;  3AVA A;  3NFA A;  4CJL A;  3OYH A;  4JS4 A;  4DTP A;  3LPU A;  4FJL A;  3QIO A;  4CGJ A;  3PX0 A;  1J5O A;  2D5R A;  2EHG A;  1QSS A;  3QER A;  3T19 A;  1BI4 B;  4EP5 A;  4DFK A;  1J9A A;  1HRH A;  3AA5 X;  1WAJ A;  3DRR A;  4CJQ A;  4O55 A;  4PA1 A;  2YNI A;  1WSH A;  2OPP A;  3LPT A;  4Q5V A;  2P5O A;  4B9V A;  4M45 A;  5HRP A;  1TAQ A;  3OYA A;  1TK5 A;  3KTQ A;  3IS9 A;  4N41 A;  4FJI A;  3HPH A;  1IKV A;  4CF1 A;  2E4L A;  4FK0 A;  4CJV A;  2HVH A;  1TL3 A;  1CXQ A;  1CXU A;  1HQE A;  3ZT0 A;  1CLQ A;  1FKO A;  1U49 A;  3JSM A;  4ELT A;  1EKE A;  2XHB A;  1X9S A;  4KTQ A;  4GMJ B;  5CZ1 A;  1RDB A;  1BI4 A;  3MXJ A;  2HHW A;  3HPG A;  4AHR A;  1T7P A;  1VSF A;  4W5T A;  1RBS A;  3OYB A;  3DLB A;  1X9M A;  4DWI A;  3QO9 A;  4I9Q A;  3C6T A;  5JS1 A;  3OYD A;  1T05 A;  3NH1 A;  1NJY A;  4N5S A;  3SV4 A;  3MED A;  3DLG A;  3HM9 A;  3TAF A;  1WAF A;  3K58 A;  3THV A;  1Z25 A;  4B9T A;  3O3F A;  4JLH A;  3B6P A;  3HL8 A;  4E1N A;  4KHW A;  1QE1 A;  1BIS A;  1LWF A;  1U48 A;  4KPY A;  2FBV A;  1QHT A;  1D9F A;  1JLQ A;  3HT3 A;  2F8S A;  4BDY A;  1L3T A;  4Z4I A;  4IDK A;  2YKN A;  5CYQ A;  4CHP A;  4DF4 A;  4L8R B;  1QQC A;  4CIF A;  4OLB A;  2D0B A;  3KD5 E;  3K5O A;  3DLH A;  4E0D A;  3AVG A;  4AHV A;  1S5J A;  2DFH A;  2YHA A;  3QEX A;  3AVI A;  3OJU A;  3TAB A;  2GBZ A;  3DYA A;  4M3R A;  2HHQ A;  4CJK A;  4EZ6 A;  3V81 A;  3LZJ A;  2FBX A;  1VRT A;  2YNG A;  5EU7 A;  4CHN A;  3K57 A;  2YHB A;  4JRQ A;  1U4B A;  4DFP A;  4W5R A;  2P1J A;  1BCO A;  1JLG A;  4CJ3 A;  4NCG A;  4FLW A;  1Z26 A;  2X6S A;  4CEB A;  1RNH A;  2G8H A;  4FYD A;  2GUI A;  4OKE A;  4CFA A;  5J2N A;  3PO5 A;  3QLH A;  4RW7 A;  5KRS A;  3M8Q A;  1ZBI A;  1C1A A;  1XWL A;  3U3G A;  3AVF A;  3G0Z A;  3LP1 A;  4CEE A;  3TR8 A;  4ZTJ A;  3EYZ A;  3DRS A;  4KKO A;  1BCM A;  5KRT A;  4PWD A;  3OYC A;  1ZBF A;  1C1B A;  4Y1D A;  4B08 A;  2OPQ A;  2YKM A;  3MEG A;  3WNF A;  3OYE A;  1UOC A;  1VSL A;  2Z1I A;  1JLE A;  1S6Q A;  3AVN A;  3PV8 A;  2XRI A;  3RR7 A;  3OYM A;  3SZ2 A;  2Y1J A;  5C24 A;  2HW3 A;  4HCC A;  1RT5 A;  4DSK A;  4IG0 A;  5FRN A;  3LAL A;  4KB0 A;  4AHU A;  3L2W A;  3DLE A;  4YNQ A;  3NHG A;  3TWH A;  1NKB A;  1NK0 A;  4B3O A;  5J2Q A;  4DTM A;  1JL2 A;  1NJX A;  2ZD1 A;  1FKP A;  1KVA A;  3IAY A;  3RRH A;  4ELV A;  3VN5 A;  4MQ3 A;  2OYQ A;  4FM0 A;  4E7I A;  3KJV A;  4DTR A;  1Q8I A;  3EY1 A;  1WSI A;  3FFI A;  5E41 A;  3LWM A;  4DFJ A;  1XC9 A;  4F3T A;  1QSL A;  4FK2 A;  1KLN A;  1R0A A;  3K2P A;  4JS5 A;  4J2A A;  4KI6 A;  3L2U A;  1EX4 A;  4DMN A;  3V9U A;  1J54 A;  2P51 A;  2DFF A;  2JLE A;  4B8A B;  4CJ4 A;  1ASU A;  1S1X A;  2BDP A;  4M3Y A;  4KHY A;  3CYM A;  4CJS A;  3RR8 A;  1LAV A;  1S1W A;  4KV8 A;  3KKR A;  3VQD A;  3ZCM A;  2Z1H A;  4CGH A;  4CJT A;  4CK1 A;  3KD1 E;  2GV9 A;  4HHT A;  4DG1 A;  2E6M A;  4E89 A;  1NK9 A;  1RBR A;  1IKW A;  3NDK A;  3MEC A;  1NK7 A;  1S1U A;  1RTD A;  4CEQ A;  3TAR A;  4DTS A;  1HPZ A;  3AVM A;  4B9L A;  3OS2 A;  1RT7 A;  2QXF A;  1T03 A;  2ZQB A;  2E6L A;  3F9K A;  5J1E A;  2EX3 A;  4FLV A;  3O4N A;  3QEW A;  3AO5 A;  1XI1 A;  4F2R A;  3VQE A;  3UIQ A;  1RIL A;  3VQ6 A;  4KFB A;  3VQC A;  3NH0 A;  4IBN A;  1QTM A;  2AJQ A;  2XY5 A;  4DLG A;  4PUO A;  3VA0 A;  1UWB A;  3SQ0 A;  2KTQ A;  3LP2 A;  1WSJ A;  4WE1 A;  4H4M A;  3L3V A;  3K5M A;  3CFP A;  4CGG A;  1D9D A;  4IFY A;  2G8K A;  4J2D A;  4BDP A;  1NKC A;  2DY4 A;  1JLF A;  3RTV A;  3PY8 A;  2I5J A;  3K5N A;  4HUE A;  1N5Y A;  4CF0 A;  3AVB A;  3I0R A;  4J2B A;  2HMI A;  3ALY A;  4FW2 A;  3F73 A;  3E01 A;  1VSH A;  4BAC A;  3G10 A;  4HUF A;  1MU2 A;  4KRF A;  4E1M A;  1LW0 A;  1RTH A;  4RW4 A;  4M3U A;  4O4G A;  3NE6 A;  3ZT4 A;  1KCF A;  1QS4 A;  2OA8 A;  5FRM A;  4FM1 A;  1U04 A;  1YT3 A;  3PX6 A;  4CJW A;  1IH7 A;  1FK9 A;  2ETJ A;  1I39 A;  2ITG A;  3BDP A;  5T7B A;  4W5N A;  4XIU A;  1JLA A;  1HQU A;  3TI0 A;  3ZSV A;  3QES A;  4B9N A;  3V1O A;  1D5A A;  1VSE A;  3V1Q A;  3ZSQ A;  1IKY A;  1SV5 A;  4RG8 A;  3OYF A;  3NCI A;  4KHS A;  2G8I A;  1CZB A;  4OPJ A;  5HRR A;  4BE2 A;  1VRU A;  2FC0 A;  3ISN C;  4C8N A;  4FLU A;  5I42 A;  4Z4G A;  2FBT A;  1CZ9 A;  3LP0 A;  1NOY A;  4C8K A;  4FJ5 A;  3OYK A;  4DU4 A;  2IC3 A;  4BWJ A;  3QET A;  5FRO A;  1X1P A;  4W5O A;  3KLI A;  1RBV A;  5HP1 A;  2P5G A;  2DFE A;  2F96 A;  3ZSZ A;  1IO2 A;  2HHS A;  3NF9 A;  4OVL A;  2HNZ A;  1YVU A;  4GW6 A;  1VSK A;  4KO0 A;  4FJN A;  3HO1 A;  2KFN A;  3L2R A;  3IRX A;  4NCA A;  4I2Q A;  3D45 A;  4M3Z A;  2KFZ A;  1C0T A;  2O4G A;  3TAP A;  4FW1 A;  2VG6 A;  3VA3 A;  4FZY A;  2Z1G A;  4DQP A;  4QOZ B;  3DOL A;  1KSP A;  2OZS A;  2X6N A;  4CIE A;  3SUP A;  2W42 A;  4CHQ A;  3VQ8 A;  1TKZ A;  2KZM A;  4FCY A;  5JS2 A;  1RDA A;  2VG7 A;  3SQ4 A;  1S9E A;  2Q3S A;  4ZHR A;  3M8R A;  4K8Z A;  3LAM A;  2KQ2 A;  2OPS A;  3OYJ A;  4JRP A;  4FK4 A;  4AIL C;  1W0H A;  3V9S A;  1JL1 A;  3TAM A;  4CJR A;  1EET A;  1ASW A;  1K6Y A;  1YTU A;  1RBU A;  4DF8 A;  4EZ9 A;  5HBM A;  1SUQ A;  3V9X A;  3WNE A;  3NGI A;  2KZZ A;  2HHT A;  1ASV A;  3HP9 A;  4OPK A;  4CFB A;  4GVM A;  4DS4 A;  1SKS A;  4B9U A;  3P5J A;  2IS3 A;  2OPR A;  5FDL A;  1S1T A;  1ITG A;  4G1Q A;  4CEF A;  1JXB A;  1REV A;  4KB1 A;  2YV0 X;  3HK2 A;  4DTN A;  3OY9 A;  1LV5 A;  2XY7 A;  3OS0 A;  4CK2 A;  3D0P A;  2PY5 A;  4NCB A;  1DTT A;  1GOC A;  1JKH A;  2G8U A;  1BQM A;  4LH4 A;  1BGX T;  5CY4 A;  3ULD A;  1EXQ A;  1TK0 A;  2RF2 A;  1G15 A;  3AA2 A;  2PYJ A;  4E19 A;  1UA1 A;  4KHN A;  3OYG A;  1BIZ A;  2NUB A;  3HXM A;  4F2S A;  3HJF A;  1KLM A;  3LAK A;  1X9W A;  3AO3 A;  2OZM A;  4DQI A;  3HST B;  3TAQ A;  1L5U A;  4FJ8 A;  1L3U A;  3ZT1 A;  3KK2 A;  4FZX C;  4IG3 A;  5KI6 A;  1DLO A;  2KW4 A;  3S3M A;  4C8M A;  4DSE A;  1RT3 A;  4FJH A;  4M3W A;  3QEP A;  2FBY A;  3C95 A;  1TK8 A;  3T3F A;  4CGF A;  2G8F A;  1HYZ A;  3OYI A;  1TVR A;  4FJ7 A;  1KVC A;  3KLH A;  4N47 A;  3P83 D;  5D3G A;  2X78 A;  4F3O A;  4M41 A;  3L3U A;  4R5P A;  1RDD A;  4DTU A;  5CZ2 A;  1TKD A;  1WNS A;  2R7Y A;  3V9Z A;  3KLE A;  3RRG A;  4ZTF A;  2YNH A;  1FXX A;  4CEA A;  4NYN A;  5HRO A;  2IOC A;  4PY5 A;  3V9W A;  4M3X A;  3RMC A;  4I2P A;  4MFB A;  1Q9X A;  4BDZ A;  3HYF A;  1HMV A;  2HB5 A;  3BGR A;  4AHS A;  4Z4C A;  1JLC A;  3SV3 A;  2HVI A;  2ZE2 A;  3TAN A;  2VWK A;  3LP3 A;  1RT6 A;  1JLB A;  4CJF A;  5HRS A;  2X74 A;  1GOB A;  4CJE A;  3ZSR A;  1NK5 A;  2B4J A;  3MAQ A;  2F8T A;  4CEZ A;  1VSJ A;  2HHX A;  3DI6 A;  3HVR A;  4LSL A;  1SL0 A;  1A5V A;  1J53 A;  1HJR A;  4HVJ A;  2QKK A;  3NBP A;  4KAZ A;  2QKB A;  1RTJ A;  4CF2 A;  3O4Q A;  2D0A A;  4DQQ A;  4KTW A;  2XY8 A;  3SNN A;  4CHZ A;  4C8L A;  5SWM A;  2IGI A;  3KLF A;  1N6Q A;  4K8X A;  1B92 A;  3ZT2 A;  3CM6 A;  1BHL A;  4HUG A;  4DQS A;  1IG9 A;  4FXD A;  4DS5 A;  3L2Q A;  1HNI A;  3AVK A;  4E3S A;  1L3S A;  4OJR A;  4AH9 A;  3SCX A;  4E7K A;  2XY6 A;  3WNH A;  1C0M A;  1B9F A;  3DLK A;  4CFC A;  4DU1 A;  1HYS A;  1HNV A;  3SYZ A;  4M3T A;  2HNY A;  5HRN A;  2B5J A;  1BQN A;  3AV9 A;  1EP4 A;  2BAN A;  1C6V A;  3U3Y A;  2HND A;  4FLZ A;  4Y1C A;  3AVL A;  4LY7 A;  3SPZ A;  1WSF A;  3B6O A;  2Y1I A;  3SQ1 A;  3VQA A;  1LWE A;  3PX4 A;  4CIG A;  3KLG A;  4DSF A;  4FJX A;  4EP4 A;  1GOA A;  1C0U A;  5J2M A;  1NOZ A;  4Z4H A;  3PO4 A;  3NF8 A;  4B9M A;  3AVJ A;  1UA0 A;  3MEE A;  4CE9 A;  4RW9 A;  3CFO A;  2WOM A;  1TKT A;  3I0S A;  2LSN A;  3NF7 A;  3LAN A;  4ID5 A;  3S9H A;  3VQ7 A;  3AVH A;  4CER A;  4CEC A;  4FLY A;  5KTQ A;  4PQU A;  4DSL A;  4H8K A;  4CF8 A;  2G8V A;  4CHO A;  1JXE A;  1RBT A;  1A5W A;  4CFD A;  4W5Q A;  1NKE A;  5KGW A;  4FJ9 A;  1DTQ A;  1RCH A;  4N76 A;  1WN7 A;  3V6D A;  3O3H A;  1ZYQ A;  3KIO A;  5DMR A;  2A1R A;  1SKW A;  3AO2 A;  3CM5 A;  1D8Y A;  2PZS A;  2HHV A;  1A5X A;  3A2F A;  1SKR A;  5C25 A;  4KHU A;  1IKX A;  2A1S A;  3QEI A;  2D0C A;  3IG1 A;  4B8C A;  2DTU A;  4Q0B A;  4TSX A;  3ZSO A;  3PUF A;  3K5L A;  3LZI A;  1I3A A;  1VSI A;  1TGO A;  3LWL A;  3MXI A;  1T8E A;  4Z4E A;  1TL1 A;  3RMD A;  3O3G A;  4M42 A;  2PYL A;  5DK5 A;  1XHZ A;  1SL2 A;  4LSN A;  3NAE A;  1QSY A;  4IFV A;  4UQG A;  1NK6 A;  4FJJ A;  1WLJ A;  3S3O A;  5KGX A;  4DFM A;  1NJW A;  4YFU A;  1SL1 A;  3K59 A;  3VQB A;  1KTQ A;  1TV6 A;  3V4I A;  1HYV A;  1LW2 A;  3SI6 A;  1WSE A;  3AO1 A;  1ZBU A;  1S9G A;  3V1R A;  4FM2 A;  4FJG A;  3CG7 A;  4CES A;  4C8O A;  2WON A;  4E7L A;  4FVM A;  1NJZ A;  4CF9 A;  4CJP A;  4I7F A;  3VQ5 A;  4FLX A;  4DQR A;  3TAE A;  3OYN A;  4KHQ A;  4KTZ A;  3NH2 A;  2IDO A;  4OKK A;  2BE2 A;  1KFD A;  4AHT A;  4CHY A;  4CJ5 A;  3OS1 A;  3L8B A;  4F8R A;  1BIU A;  1TKX A;  3AA3 A;  2RPI A;  3NGY A;  3VQQ A;  3SJJ A;  3AVC A;  1LAW A;  4ICL A;  4DTO A;  3KK1 A;  3SUO A;  3AA4 A;  4DTX A;  3S3N A;  3ZSY A;  1KRP A;  4FJK A;  4ID1 A;  1U45 A;  2JGU A;  5SZT A;  5K14 A;  1RT4 A;  3AO4 A;  3P1G A;  3WNG A;  4FLT A;  5I3U A;  1KVB A;  4CJU A;  3I8D A;  1WSG A;  4E7H A;  3QEV A;  2RN2 A;  1RTI A;  3DOK A;  4CCH A;  4DLE A;  5HLF A;  3OJS A;  3ZSW A;  3ZT3 A;  4CK3 A;  4HTU A;  3JYT A;  3SQ2 A;  2B6A A;  3C6U A;  4BWM A;  1B9D A;  3SUN A;  1W9H A;  4DSI A;  2BGG A;  2HHU A;  5CYM A;  2IAJ A;  3NGZ A;  3TAG A;  3RMB A;  4KI4 A;  1KFS A;  4LH5 A;  1U47 A;  4F4K A;  4FZZ A;  1L3V A;  1Q9Y A;  3M8P A;  4OGC A;  4KRE A;  4CED A;  1NK4 A;  4NYF A;  4O0J A;  2O4I A;  3DLR A;  1VSM A;  4AHC A;  4DTJ A;  4QCL A;  2XO7 A;  4IKF A;  1F21 A;  3HVT A;  4OLA A;  1LWC A;  1S6P A;  1VK0 A;  2Z1J A;  1C1C A;  4DU3 A;  4DSJ A;  3RWU A;  5J2P A;  2YNF A;  3ZSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...