1LAWA

Stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYIRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE H
publication title Stabilization of Escherichia coli ribonuclease HI by cavity-filling mutations within a hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lawA00
2KFNA 1IKWA 4J2DA 1NK8A 2BANA 4AHVA 4CJWA 3DI6A 3NAEA 3RR7A 3DYAA 4AHSA 4CFCA 4PQUA 1DTTA 3CFPA 4FM2A 4Y1DA 3S3MA 3NDKA 3ULDA 3QEXA 4DQPA 3TI0A 3HK2A 3K59A 1RBRA 1N6QA 4O0JA 1FXXA 3HP9A 1BGXT 1ZBUA 2IAJA 3NF9A 2XO7A 4ELVA 3V81A 1QQCA 1CZ9A 1U45A 3AVGA 1KTQA 1S1UA 4KHYA 3AVLA 3SQ1A 2E6MA 2HHUA 3V1OA 1RTIA 1F21A 2XRIA 4E3SA 1NJXA 1JL1A 1S6PA 3O4NA 4W5RA 1NK5A 1T7PA 4QAGA 3I0RA 4AHTA 3AA5X 3OYKA 5HRNA 3ZSWA 4FLUA 3QERA 1UA1A 3ZSZA 4DTXA 1G15A 4H4MA 3AVKA 1J5OA 3OYDA 3C94A 4KHWA 3AA4A 4FYDA 1HMVA 1ASUA 2D0CA 1BQNA 2XY7A 2P5GA 2FC0A 1ZBHA 1QSYA 1TGOA 1IKXA 3JSMA 2OYQA 4DQIA 3BGRA 3KLGA 4ZTFA 4I7FA 3CFOA 4KAZA 4FZZA 1WSJA 3I0SA 3ZSQA 1C6VA 1Y97A 3NFAA 3OVNA 4CHPA 3K5LA 5CYMA 2LSNA 3CFRA 4NYFA 2BGGA 1TK8A 3SQ4A 1NK7A 4CEBA 4HVJA 1DTQA 3ZSRA 3LPUA 3OYHA 3TANA 4KTWA 4DLGA 3RMAA 3WNFA 1EXQA 1EETA 1D9FA 1YT3A 1Z26A 3G10A 4EP4A 4DF8A 1I39A 4KI6A 4AILC 2E6LA 3AO3A 3RMCA 1SKRA 3O3HA 1RT4A 3QNNA 3DLEA 3OYMA 3VN5A 1L3SA 3ASMA 3OS2A 1L5UA 2HHSA 1DLOA 1GOBA 4RW8A 4OKJA 4FJXA 4DQQA 4BE2A 1S5JA 4DS4A 4B08A 4N41A 1T03A 2PYJA 4C8MA 3BDPA 3VQ8A 3QETA 3HYFA 2D0BA 4Z4EA 4FLWA 1XWLA 4FCYA 3AO2A 4CJ5A 3ISNC 5CYQA 4CEEA 4FM0A 1EP4A 1S1VA 3F9KA 4LH5A 3T3FA 4DFJA 4B9NA 1SL0A 4FJHA 1JLFA 4FJ8A 5HP1A 1KLMA 2P51A 2Y1JA 4XIUA 3L2VA 2D5RA 1FK9A 3DLBA 4O0IA 3PX4A 4L8RB 5SWMA 1KVCA 4GMJB 2G8VA 4FJMA 1RTJA 4OGCA 1BHLA 4FK0A 2HB5A 5SZTA 5C25A 4FJ9A 4B9UA 4QOZB 3ZT4A 1WNSA 3MEEA 1TKZA 2Z1HA 1A5XA 1LWFA 3MECA 4RG8A 3KJVA 2EX3A 4EP5A 4OPJA 2A1RA 3OYAA 4OKKA 4CJEA 4OPKA 4DLEA 3MXIA 1WSFA 3ZT3A 4O5BA 1UAXA 2PYLA 1SKWA 3LDSA 4FK4A 4IBNA 3SV4A 3KLHA 4B8CA 3HPOA 2VWJA 3D45A 4MFBA 3EYZA 2DTUA 3VQBA 2OA8A 1LAWA 4FJLA 1Q8IA 2I5JA 3QEPA 3WNGA 4CJTA 4HHTA 3CM6A 3HPGA 4TSXA 1Q9XA 3E01A 4E1NA 4DTMA 3TAFA 3NHGA 4RW4A 3MEGA 1U49A 1WLJA 4DQRA 3LP0A 3OYBA 5J2NA 2GV9A 4DWIA 1X9MA 4CJKA 3SYZA 1R0AA 4FK2A 3JYTA 4M3WA 4JS4A 3DRRA 3OYGA 4KI4A 3ZSOA 4YFUA 1BISA 1HPZA 3MXMA 4CHZA 3VQ5A 4N5SA 3OYIA 3B6OA 4FJ5A 1YVUA 4M3YA 4K8XA 4F2SA 1BI4B 5CZ1A 3O3FA 3ALYA 1S1TA 3OYNA 3V9SA 4DG1A 4I2PA 3AVBA 3QEVA 4K8ZA 1RCHA 4Z4GA 1KSPA 3TABA 4YNQA 4NYNA 1QHTA 3KLEA 1BIUA 3KK3A 4BACA 1QTMA 3OYCA 4FXDA 3SPZA 2RPIA 4IDKA 2FBTA 4GVMA 2Y1IA 4KB1A 4F2RA 3HSTB 3V9ZA 1K6YA 4CGJA 3K57A 4DSFA 2P5OA 1ASVA 1IH7A 2EHGA 3HT3A 2BDPA 3S3OA 3K5NA 1D8YA 5FRNA 3NF8A 1XHXA 4CHNA 2IS3A 4FJJA 2IOCA 2VG7A 3L2RA 1BQMA 4CIEA 4M42A 1CXUA 1RDAA 4B9VA 2OPPA 1JL2A 3NE6A 2P1JA 3PY8A 1Q9YA 2ETJA 1A5WA 4KTZA 3TWHA 1LWCA 4KFBA 1KRPA 1HNVA 4LD0A 4CCHA 4RW9A 4CIFA 4OJRA 4DTPA 4CJ4A 3B6PA 1VRTA 5HRRA 4DTSA 3KIOA 1KFDA 1RT1A 1VSKA 3LANA 4R5PA 4DS5A 1SL1A 1TKDA 4B9LA 3DM2A 1FKOA 3TAEA 3LAKA 1NK0A 1LAVA 3K2PA 3K5OA 1U47A 2ZD1A 2PY5A 2DY4A 3DRPA 3NF6A 4PWDA 1RTDA 3ZT0A 1ZYQA 3CYMA 2F96A 4GW6A 4FJNA 3AA2A 2OZSA 4C8KA 4DSLA 4I9LA 2YNHA 3AV9A 2X6NA 3TAPA 4KHSA 3KD5E 3QESA 2XY8A 3OYLA 4JRPA 4DU4A 1JLQA 1S1WA 1HYZA 3RWUA 3F73A 3RRGA 3O4QA 1HQEA 1X9WA 1RT6A 4DSIA 3P1GA 4CEDA 1VK0A 1HYVA 2F8TA 5JS1A 3KLIA 5C42A 2XHBA 4DFMA 4ELUA 3EZ5A 4M3ZA 4FJKA 3CQ8A 4Y1CA 3HM9A 4KPYA 2G8UA 3OY9A 2JLEA 5D3GA 1TK0A 1EX4A 1HQUA 3AO4A 2B4JA 4OGEA 4AHCA 3SCXA 4KHUA 1TAUA 1NJYA 4CFBA 2YV0X 1WSGA 4IKFA 1RDDA 1O1WA 3FFIA 4FLZA 4LY7A 2AJQA 1NJWA 3O3GA 5E41A 3VQQA 1CXQA 2OPQA 2R7YA 4BDYA 4FJ7A 3IAYA 2RF2A 2YNFA 2F8SA 3NGYA 1ITGA 4OVLA 1X9SA 2YKMA 2XY6A 3SJJA 1GOAA 4J2EA 1TKTA 4Q0BA 4W5OA 5J2QA 3S3NA 2FBXA 3ZCMA 4CJLA 4HUGA 1RBSA 1QS4A 1UWBA 2IGIA 3L2QA 4J2BA 3LZJA 2ITGA 3OJUA 3T1AA 3HJFA 4PUOA 2QKBA 5T7BA 3PO4A 3VQCA 3IRXA 1WSIA 3KTQA 2B6AA 4M3TA 4DSJA 3AA3A 1XI1A 1SV5A 1JLAA 3SQ0A 3KD1E 1C1CA 1BCMA 3M8PA 4RW7A 4LSLA 3MXJA 4FW2A 5K14A 3L8BA 1ZBLA 1IO2A 3TAGA 2DFEA 1LWEA 5HLFA 3QIPA 1BL3A 3SPYA 1SKSA 4F3OA 1C0UA 4E0DA 1HNIA 1LW2A 3PX0A 1TVRA 2HW3A 1C1BA 3K5MA 3VQ7A 3IG1A 5FROA 1RT2A 1S6QA 1WAFA 2OZMA 2YNGA 5J2PA 3KK2A 5J2MA 3SUOA 3AO1A 1JLBA 5C24A 4M41A 3OJSA 1SL2A 4I9QA 4O44A 4CJ3A 1LW0A 1C0MA 3NBPA 1RT3A 1VSIA 4IG3A 4B9TA 2KFZA 1UOCA 3QNOA 3VQ9A 4FLYA 4CK3A 4CE9A 1JLGA 2HNZA 2ATQA 3ZSYA 4CGHA 1U04A 5I42A 1NKCA 4H8KA 4Z4FA 4CHOA 2HHQA 1TV6A 2VG5A 2RKIA 4HUFA 4QCLA 3RMDA 1S9EA 4FLVA 2DFHA 3AVMA 4Z0UA 3ZT1A 3DOLA 4B3OA 3HO1A 4OLAA 3L2WA 4IFVA 1L3UA 1BCOA 2Q3SA 1A5VA 3RR8A 4LSNA 1L3VA 3TARA 4E7IA 4UQGA 3DRSA 2E4LA 3WNEA 3LP2A 3QINA 4M3RA 3L3VA 3LWLA 4CJRA 4CF9A 3ZT2A 1T05A 2QK9A 3THVA 3QO9A 1VSLA 3VA0A 3TR8A 2OPRA 3EY1A 4KHQA 2X78A 1XC9A 5JS2A 4CJVA 2O4IA 4FW1A 1ASWA 4CK1A 3AVJA 1VSMA 3HVRA 1RTHA 4CGDA 1YTAA 1CZBA 1WSEA 3DLGA 5HRSA 4E7JA 1KVAA 2BE2A 2ZQBA 3L2UA 2ZE2A 1RT5A 1U48A 4E1MA 3ZSVA 2Z1GA 1NKEA 4FLXA 4FZXC 4FJGA 1VSFA 3NCIA 2HHWA 4ZTJA 2KZZA 2X6SA 4BWMA 4BDPA 3SNNA 2NUBA 4CHYA 1KFSA 5KRTA 3TAMA 4Q5VA 4DFKA 2G8HA 3CM5A 4DTOA 4CEFA 3U3YA 4O4GA 3HP6A 1WAJA 3OYFA 3LZIA 4CEQA 4NCAA 1JLCA 3M8QA 3VQ4A 3MAQA 2O4GA 4F4KA 2RN2A 4E7LA 3RTVA 4B9MA 1VRUA 4LH4A 1MU2A 5HROA 2KQ2A 3DLHA 4FJIA 5CZ2A 1KVBA 2B5JA 3DOKA 1NK9A 1TK5A 4KREA 2FBYA 1HRHA 4W5QA 3SUQA 1RBTA 3WNHA 4G1QA 3VQEA 4CF0A 4BDZA 5CY4A 3SZ2A 3U6FA 1RBVA 3SUPA 3C6TA 5EU7A 4CEZA 4W5TA 2HHTA 1W9HA 4CJPA 1REVA 1D9DA 4KTQA 5FDLA 3C95A 1WSHA 4KRFA 4Z4CA 4CF1A 4DSEA 4NCBA 4CGIA 4ICLA 2IC3A 1S9GA 4CHQA 4RW6A 3H08A 1B9DA 4M45A 2G8FA 4CGFA 2HHXA 1RDBA 2FBVA 4HUEA 4FM1A 4JRQA 1QE1A 1C1AA 1SUQA 1KLNA 3AO5A 3SQ2A 1I3AA 1VSDA 3AVFA 3DMJA 1LV5A 3QLHA 2Z1JA 4JLHA 4EZ6A 4CJFA 3KLFA 4ID5A 4CESA 4DQSA 2WONA 4W5NA 1D5AA 4CECA 2G8WA 1FKPA 3MEDA 1ZBIA 3P5JA 2JGUA 1QSLA 2GBZA 4F8RA 2QXFA 1NJZA 3K58A 3SUNA 2QKKA 4DF4A 3PO5A 1NK6A 1NOYA 4C8LA 1JKHA 4E7HA 2IDOA 4HCBA 4Z4HA 2Z1IA 2WOMA 4CK2A 3QEIA 4M3UA 2G8IA 5I3UA 4CERA 2X74A 3V1RA 3V9XA 1U4BA 4EZ9A 3HXMA 5KRSA 2DFFA 3AVAA 4C8NA 2KTQA 1Z25A 3T19A 3NGZA 3V4IA 3OYJA 2HMIA 3QEWA 1VSHA 4FZYA 2PZSA 3KKSA 1TAQA 4DU1A 1RNHA 3G0ZA 3VA3A 1HJRA 1BIZA 4CF8A 1WN7A 3NH2A 2YHBA 4ID1A 1NKBA 3VQDA 2A1SA 1NOZA 3HVTA 1TL1A 1J54A 3L3UA 1RBUA 2HNYA 4KKOA 3V1QA 2D0AA 4CJSA 4B8AB 1J9AA 5FRMA 1JXBA 3AVIA 1T8EA 3LALA 4IFYA 4DTNA 2OPSA 5KGWA 4ELTA 4CFAA 4DMNA 3RRHA 2G8KA 4MQ3A 4BWJA 3ZSXA 5HBMA 4ZHRA 4DTUA 3TAQA 1NK4A 3LP3A 4F3TA 4IG0A 3I8DA 4HCCA 4KV8A 3VQPA 3OS1A 4CEOA 1VSJA 4BE0A 4CFDA 4AHUA 4DSKA 4PY5A 3VQAA 3HL8A 4DTRA 2HVIA 2HHVA 1J53A 3PX6A 4O55A 3M8RA 2XY5A 4PA1A 1XHZA 3C6UA 1YTUA 1B9FA 3NH0A 3LAMA 1B92A 1RDCA 4I2QA 4N56A 1EKEA 3OS0A 4M3XA 1GOCA 4C8OA 3AVHA 1L3TA 4WE1A 1QSSA 3ITHA 4BE1A 4OLBA 5J1EA 2VG6A 1JXEA 3DLKA 3U3GA 4KHNA 4CEAA 4HTUA 4CJQA 1IG9A 2HNDA 4B9SA 1X1PA 4H4OA 3NF7A 4N76A 5DMRA 4E89A 4OKEA 2YHAA 1UA0A 2YNIA 1TL3A 2YKNA 1W0HA 1IKYA 4AH9A 1CLQA 5KTQA 1RILA 1TKXA 1C0TA 1N5YA 3PUFA 3NGIA 3UIQA 2GUIA 4CIGA 1IKVA 3HPHA 3P83D 3VQ6A 3SV3A 3RMBA 1KCFA 3NH1A 3PV8A 3SI6A 3LWMA 3KK1A 1VSEA 1BI4A 4DTJA 4FVMA 4CJUA 3DLRA 4FLTA 4Z4IA 4KB0A 1S1XA 4J2AA 2W42A 4CGGA 3KKRA 4DU3A 3V9WA 1JLEA 3AVCA 3IS9A 5DK5A 3LP1A 3D0PA 2KZMA 3S9HA 4NCGA 1RT7A 2KW4A 4N47A 5KI6A 3CG7A 3A2FA 5KGXA 3AVNA 1HYSA 4AHRA 2VWKA 5HRPA 1ZBFA 3OYEA 3V9UA 4E7KA 4DFPA 3QIOA 4JS5A 3M8SA 3LPTA 4E19A 4CF2A 2HVHA 3V6DA 4KO0A
chains in the Genus database with same CATH superfamily
4J2DA 2Q36A 2BANA 4JI2K 4AHVA 4EAHD 4CJWA 1GLDG 3NAEA 1GLJO 2A6AA 3TSPA 2QWNA 4CFCA 4PQUA 1YVNA 3S3MA 3ULDA 3T7ZA 3TI0A 3HP9A 1BGXT 4ELVA 3V81A 3PLAA 3JAMO 3AVGA 1KTQA 1RDUA 1U45A 3UE5A 3VPZA 3SQ1A 4CBUA 1NJXA 1RTIA 4E3SA 1T7PA 1NGJA 3CETA 3I0RA 4AHTA 3AA5X 3OYKA 5HRNA 3H1QA 3ZSWA 4JKDA 3OBYA 3CCEN 4BG9A 3DJCA 5BPLA 4JD2A 3AA4A 2GWJA 2D0CA 2XY7A 1QSYA 4BRGA 1TGOA 4DQIA 4ILJA 1SZ2A 3PIOL 3KWIA 4BQLA 1EWQA 1WSJA 3OVNA 5JVGL 1QZ6A 3CJ9A 3G4SN 1VQLN 5E84A 1NK7A 4CEBA 1DTQA 3ZSRA 1NM1A 4DLGA 5HOOA 3RMAA 1EXQA 2I7PA 3M5RA 1S3XA 4BC5A 3J8AA 1I39A 4KH6A 3O3HA 1RT4A 5LY3A 3DLEA 3VN5A 1L3SA 4H0OA 3GDQA 3CC7N 1Q82O 4FJXA 4BE2A 2JWKA 4DB3A 3FLCO 4H0VB 2ZJPL 3VEZA 4FLWA 1XWLA 5AZJA 4FCYA 3AO2A 4CJ5A 4BRPA 4FM0A 3A5NC 4B9NA 4FJHA 4H0XB 4CZJA 3D2EB 5LMNK 3DLBA 5TKYA 4O0IA 5FPDA 4GMJB 5SWMA 3QBWA 2NLXA 2Q1NA 2BH1A 4OGCA 1BHLA 5SZTA 5GAGP 3K9KA 4LF6K 1NG9A 4WQ4C 4DV1K 3MECA 2EX3A 4EP5A 2A1RA 4LF4K 4IFEA 4DLEA 1WSFA 5AQYA 4O5BA 5LL6Z 3QBXA 1UAXA 2PYLA 3EYZA 1BOTO 3VQBA 2UXBK 2I5JA 1YXQA 1IBKK 4HHTA 3CM6A 3HPGA 5H1SQ 4TSXA 3E01A 3TAFA 5AQGA 1WLJA 2P9UB 4NLCA 3LP0A 3OYBA 4DWIA 3JS6A 3E66A 1P90A 3DRRA 1S72N 1HPZA 3WXMB 3OYIA 3B6OA 1YVUA 2YJEA 3THXB 4M3YA 3E9OA 1U2VB 4LFBK 4I2PA 2O8CB 3TABA 4JI1K 3T1YK 1BIUA 4IOCL 4BACA 1OVYA 2Y1IA 4AQYK 3I56N 3V9ZA 3K57A 4O5FA 2P5OA 2F4VK 1IH7A 2EHGA 5M1KA 4C1NI 3S3OA 3EEQA 3K5NA 2OTJN 2NZTA 3NF8A 4R79A 4CHNA 2VG7A 3L2RA 1NGAA 3VF2A 1RDAA 3R9PA 3PY8A 1OH5A 2ETJA 3C7NB 4A5AA 1LWCA 2NRZA 5JLHA 4NB4A 4LD0A 1SQKA 5HRRA 1KFDA 1RT1A 1VSKA 4DS5A 4B9LA 2E1YA 3DM2A 3TAEA 3K2PA 1U47A 3VETA 2ZD1A 2DY4A 4PWDA 3OHRA 3O9TA 1MWKA 3AV9A 2X6NA 4DR4K 3TAPA 3JXUA 4HTLA 3O4QA 1HQEA 1V4SA 1VK0A 1HYVA 5B8HA 3VOVA 5C42A 2XHBA 3CQ8A 3MDQA 2JLEA 1VQ8N 1HKGA 3MWTA 3CI5A 1EX4A 1HQUA 4KHUA 4CFBA 2RHKA 4BR7A 4IKFA 2O8DB 3SAHA 4BDYA 1CXQA 2OPQA 3DXMB 2YNFA 3VEVA 4ILGB 5J2QA 2IVPA 2FBXA 3S3NA 3O9SA 5AQJA 3OJUA 4KH4A 3EO3A 3VEYA 2QKBA 1BUPA 3RSEA 3SAFA 3O08A 5KPTA 3VQCA 1WSIA 4DSJA 3AA3A 1JLAA 3KD1E 1C1CA 4YOYA 4RW7A 5K14A 2Q31A 3SPYA 2FSKA 2FSNA 2GELA 3K5MA 3IG1A 4B1WB 1WAFA 1P8ZA 4PL7A 3KK2A 3AO1A 1GLBG 3OJSA 4CJ3A 1C0MA 1S22A 4IO8A 3MK6A 1K8AO 3VQ9A 4CK3A 1NKCA 4FWRA 3WXIA 4FWQA 3LDNA 2HHQA 1YJNN 1S9EA 2QTDA 2DFHA 4C23A 1HKCA 4U7BA 4LF9K 5GIPA 4J8FA 2F9WA 4E7IA 4UQGA 3LP2A 3MN5A 4M3RA 1T05A 1EO1A 2QK9A 3ZT2A 3TR8A 2O4IA 5JS2A 2OCEA 4CJVA 5BN8A 1ASWA 3LDLA 4YOUA 1YTAA 1TUUA 4DUZK 5AZIA 5HRSA 1KVAA 2ZE2A 4E1MA 4NLBA 1OH7A 4FLXA 3P39A 2KZZA 3TTDA 4BWMA 3R1XA 3SNNA 4BDPA 2NUBA 4CHYA 1KFSA 5IT9O 3HI0A 1E3MA 4O4GA 4BR9A 4CZMA 3HP6A 4BRFA 3OYFA 4CEQA 4NCAA 1JLCA 3VQ4A 1T3VA 5AQFA 4B9MA 3DLHA 5AQPA 3SMSA 4C1NK 3DOKA 4KREA 1HRHA 5AFUH 2Q97A 4G1QA 4CF0A 3ENHA 3C6TA 3O1WA 4FPAA 4HWIA 1W9HA 4BG8A 1REVA 4ISFA 1DGKN 5EOYA 4BREA 4IJAA 3C95A 5IWAK 1U6ZA 4Z4CA 4CF1A 2ZJQL 5M1OA 4CZHA 1S9GA 3H08A 2PBDA 2HF3A 3D6RA 3U9DA 2G8FA 1JCGA 2HHXA 1Y64A 5GADP 4HUEA 1C1AA 1VSDA 1LV5A 4CJFA 4CESA 3OA9A 3W3DA 4CECA 2GEMA 3FE1A 4A57A 1QSLA 3CCUN 2D0PA 4HCBA 5C12A 1NOYA 4Z4HA 4GV6A 4CK2A 4M3UA 4DV7K 4CERA 4EZ9A 3DXKA 5AQIA 2E2OA 3K9JA 3NGZA 3V4IA 3OYJA 4A62A 4FZYA 2VWBA 3KKSA 4DU1A 3VA3A 1WN7A 4BQZA 3SMPA 1NKBA 3A8YA 4JKGA 1QQMA 4CD3A 4A2BA 2HNYA 4KKOA 2D0AA 1JXBA 3AVIA 1T8EA 4DTNA 4E1JA 4CFAA 2YHXA 3GOIA 4MQ3A 1T44A 4Y0WA 1J6ZA 3TAQA 1NK4A 3LP3A 4PKGA 4DSKA 4BE0A 4CEOA 4PY5A 3VQAA 2HBJA 3HL8A 4DTRA 2HVIA 2XY5A 3C6UA 1VQ4N 4O8KA 3NH0A 1B92A 3OS0A 4C8OA 3AVHA 1L3TA 1QSSA 3ITHA 5EVZA 5J1EA 3DLKA 3U3GA 1IJJA 1X1PA 5DMRA 4E89A 4OKEA 3ID8A 4AH9A 1IKYA 4BROA 1TKXA 3AY9A 2GUIA 1IKVA 3P83D 4YDUA 4A5BA 3PV8A 4DTJA 4FVMA 4CJUA 3BF1A 4FLTA 4WQ5A 3V9WA 3IS9A 4NCGA 3A2FA 3AVNA 4GV3A 1HYSA 1ZBFA 1VQON 2E20A 5FPMA 4JEPA 4E19A 4CF2A 2NRRA 3HOSA 1GLAG 2KFNA 1X9JA 3THWB 1ATNA 2I7NA 4LC9B 3KK7A 4YOTA 4AHSA 3G6EN 1Q7YO 3CFPA 1NGIA 3HK2A 4H5TA 1N6QA 1RBRA 1FXXA 3VGKA 1ZBUA 4IDHA 1S1UA 2XRIA 1F21A 1S6PA 4X64K 4I6MB 1HNXK 3QERA 2D4WA 3ZSZA 1HR0K 2IVNA 3VENA 4H4MA 4RTFD 2H3GX 3OYDA 5BRFA 4BRIA 4FYDA 1BQNA 5BRDA 1ZBHA 2FC0A 3CD6N 4JI8K 3BGRA 5CR4A 3KLGA 4I7FA 1FW6A 4KAZA 3BF3A 3D2FA 1C6VA 3CFRA 1K8KB 1TK8A 1QQNA 2FLOA 3SQ4A 4NXMK 4KTWA 3PIPL 3WNFA 1EETA 3C65A 1D9FA 3SBGA 3CPWM 4BR0A 1LOTB 3AO3A 1SKRA 2YJFA 3QNNA 3G71N 3OYMA 4B3SK 1DLOA 1QVGM 3O6WA 4OKJA 4DQQA 4JN4A 3I33A 4C8MA 3VQ8A 3QETA 3HYFA 2D0BA 3U9ZA 1N8RO 3PSIA 1NGGA 1EP4A 4AM7A 1BWFO 1JLFA 2CH6A 5HP1A 2P9SB 3L2VA 2D5RA 1FK9A 3AGKA 3GBTA 2A40A 1RTJA 3C0BA 4CBXA 3WUHA 4FK0A 3KVGA 1GLLO 4JKCA 4GKKK 4JK7A 1WNSA 3HZ6A 4FOEA 1LWFA 3T1HK 4OPJA 2P9NA 4G9ZA 4OPKA 1SKWA 5EY4A 4BR4A 4IBNA 4B8CA 3D45A 4GNIA 3DAWA 1Q8IA 3WNGA 3BZCA 1Q9XA 4DR6K 4E1NA 4DTMA 2O8FB 3MEGA 2P9KB 5BREA 3O9QA 2GV9A 5AJ3K 4FK2A 1VQMN 3JYTA 4KI4A 3MXMA 1BISA 3VQ5A 3WEEB 4F2SA 1BI4B 5CZ1A 2UUCK 4A61A 3O3FA 4BVPA 3OYNA 3V9SA 3QEVA 1KSPA 3FZLA 2F9TA 4YNQA 3KWGA 4NYNA 2O8EB 3SPZA 2RPIA 1Q18A 4IDKA 4KB1A 2O8BB 4DSFA 4CGJA 3G25A 3CCQN 1M90O 3HT3A 1YJWN 5FRNA 1YAGA 4YOWA 5HL7L 4CD1A 2IS3A 4AM6A 5KQDA 4H5WA 4CIEA 1CXUA 4B9VA 4BRMA 4ILHA 3NE6A 5JICA 4KTZA 3ID6A 1BA0A 4WQ4A 3C6AA 4CIFA 4EHTA 4DTPA 1CZAN 1VRTA 3KIOA 3LAKA 1E4GT 1NK0A 3K5OA 2PY5A 4BC4A 4CZGA 3DRPA 5LMUK 4OO1J 4JD2B 1ZYQA 2YX6A 3GL1A 4FJNA 1YF5L 3O9UA 4I9LA 4KHSA 3ENBA 3QESA 4JRPA 1N33K 1NLVA 2E88A 1VHXA 4DSIA 5JS1A 3CCVN 3KLIA 4DFMA 4ELUA 4FOIA 4H0YB 1YHQN 4Y1CA 4BRDA 4KPYA 4OGEA 4XH1A 1M1KO 4AHCA 1NJYA 2YV0X 1WSGA 1RDDA 4LY7A 2E8AA 2AJQA 2P9PA 5BPNA 3Q7BA 4OVLA 3E1YA 2HHTA 4CJLA 1RBSA 1QS4A 1UWBA 4JHDA 3L2QA 4J2BA 2ITGA 4JKAA 5T7BA 5AZJB 3PO4A 2D1KA 1NNEA 5AQMA 2PFUA 2GX9A 4JKEA 5BRHA 1K9MO 4KBOA 1ZBLA 3TAGA 3D2EA 5HLFA 4F3OA 3O1BA 3WT0A 4GVEA 1LW2A 2UUBK 3H45C 3UKUA 3VQ7A 4A2AA 2YNGA 5J2PA 3SUOA 5C24A 1XC3A 4O44A 3VEOA 4I9QA 4V19S 3ZLJA 1GLFO 1VSIA 4IG3A 2KFZA 1UOCA 4XH4A 3BP8A 2HNZA 3ZSYA 4Z4FA 3CC4N 3WXLA 1TV6A 2VG5A 2RKIA 4QCLA 2W6KA 4YOVA 3FR0A 3AVMA 4Z0UA 3HO1A 3L2WA 1L3UA 2Q3SA 4LSNA 1L3VA 3TARA 3DRSA 2E4LA 3QINA 3L3VA 4CF9A 3MCPA 3LM9A 2P9UA 3THVA 4LFAK 5KQ8A 2OPRA 3EY1A 1J5EK 2FF3B 1XC9A 3ZETA 4FW1A 3HVRA 1NGBA 4CGDA 2QA4N 2O8CA 2BE2A 2ZQBA 1NWKA 1U48A 3ZSVA 2AA4A 5F2RA 3CQXA 4ZTJA 4X66K 3TAMA 4Q5VA 5ADXH 2G8HA 4QS8A 4CEFA 4DTOA 4BGBA 3ULEA 3M1FA 3MAQA 2O4GA 5MLCQ 1C0FA 2FF6A 5C15A 5CE3A 5HROA 4IXCA 5CZ2A 3SJHA 3C7NA 1NK9A 4FWSA 3VQEA 5CY4A 3U6FA 1VAZA 4CEZA 1TAUA 4W5TA 1D9DA 2A5XA 5FDLA 4K42A 1WSHA 4KRFA 1QHAA 2KHOA 5F0XA 1N32K 1XMOK 5KPZA 1B9DA 4M45A 2E2QA 2FBVA 4FM1A 1SUQA 3U4LA 1I3AA 3SQ2A 3M6GA 2Z1JA 4JLHA 1GLEG 2WONA 4W5NA 3CJBA 2G8WA 1FKPA 1NGEA 3H3OB 1ZBIA 1R59O 2QXFA 4CZLA 3SUNA 2QKKA 4C8LA 4E7HA 2IDOA 1ZBSA 3VGMA 3QEIA 2G8IA 2ASPA 2QWLA 3AARA 1WOQA 2KLAA 2ASOA 5EX5A 4C8NA 5GAHP 2WBNA 3T19A 2PZSA 1TAQA 1RNHA 3E9PA 3RSEB 4BRAA 2YHBA 4H5RA 2A1SA 3HVTA 1K73O 1J54A 3L3UA 3FZFA 4B8AB 1ATRA 4YORA 4WF9L 4ELTA 1YI2N 4F3TA 4IG0A 4RCHA 1EWRA 1VSJA 5JVHL 4AHUA 3PX6A 1BO5O 3M8RA 1VQ6N 1YTUA 1NJIO 1B9FA 1ESVA 4WE1A 3ZEUA 1SS6A 2VG6A 1JXEA 4KHNA 4CEAA 1IG9A 4B9SA 2HNDA 3CCLN 4DR7K 3BUZB 1IV0A 3N4QA 1VQKN 3SI6A 1KCFA 2JWLA 3LWMA 3H1VX 4Z4IA 5BR8K 3CCRN 4DU3A 1LCUA 3AVCA 2KZMA 3LP1A 3QB0A 3J7ZO 1TYQA 2KW4A 2P9IA 5AZIB 3EKUA 2VWKA 4E7KA 1BDGA 3SAGA 3QIOA 3LDOA 3P31A 4K43A 1HLUA 1KC8O 1VQNN 1NK8A 3F2KA 3OBWA 3EZWA 1NMNA 4JAXA 4IZ9A 3DYAA 2VGMA 1DTTA 3VESA 4FM2A 4DQPA 1OH6A 3K59A 4O0JA 2XO7A 2IAJA 3NF9A 3R6MA 1H1VA 2UUAK 4KHYA 2WTUA 2E6MA 1NK5A 4W5RA 3O4NA 2AP1A 3QDKA 4QAGA 4CW7B 4BR5A 1UA1A 4JI0K 3AVKA 4XH5A 1MDUB 3C94A 4KHWA 1ASUA 3CJ1A 2P5GA 3HM8A 1IKXA 3JSMA 2OYQA 1N34K 1OKJA 1W2BM 4ZTFA 3CFOA 4FZZA 2GTDA 1Y97A 3K5LA 2LSNA 4NYFA 2BGGA 3TTFA 3TU5A 1HX1A 2BTFA 1JCFA 2V7ZA 2CGLA 1YT3A 3G10A 4EP4A 3K0SA 3ENOA 1KXPA 3P38A 5DM7L 5M1QA 4DR1K 1JJ2M 1ILYA 4IEIA 3HSCA 1GOBA 2NNWA 4RW8A 4DS4A 2CGKA 4B08A 4N41A 1T03A 2PYJA 3BDPA 4M7YA 4B1UB 3R8EA 2P9LA 3ISNC 4CEEA 4PHTX 4RWTA 2HBKA 3SLCA 4F9OA 1S1VA 4DFJA 4JKGB 4FJ8A 1E4FT 3IDHA 1KLMA 2Y1JA 4XIUA 5C10A 2G8VA 1KVCA 5C2DA 2HB5A 3ATUA 5C25A 4FJ9A 4B9UA 3L0QA 2Z1HA 4DR5K 4XEIA 3ZT3A 3J81O 3LDSA 4FK4A 3SV4A 4O8UA 3HPOA 1XMQK 2DTUA 3QEPA 4CJTA 2QW9A 3VEXA 1NU0A 2D0OA 3FGUA 2CGJA 3H3NO 4DQRA 4CJKA 3SYZA 1R0AA 1WBBA 4M3WA 2QI2A 4YFUA 4N5SA 2ZJRL 4BRLA 4K8XA 1VQ5N 1DT9A 1KAXA 2Q0RA 1I94K 4Z4GA 4DG1A 4K8ZA 1RCHA 2Q0UA 3MN6A 1QHTA 3KLEA 4CZEA 1QTMA 4FXDA 3UKRA 4GVMA 4F2RA 3HSTB 1G99A 3FZKA 1ASVA 3FZMA 2NRWA 4IEEA 3PSFA 4JKBA 1D8YA 5AQKA 1XHXA 2NRTA 2HHHK 2OPPA 2P1JA 4FO0A 3WQUA 3TWHA 2VQEK 4KFBA 4FL9A 3CPEA 1KRPA 4CCHA 4OJRA 4FWOA 4CJ4A 4GV9A 4DTSA 4R5PA 3LANA 1TKDA 1SL1A 5JMVA 4M7XA 1FKOA 3CERA 1LAVA 3NF6A 3ZT0A 5ELZA 3LM2A 3Q7CA 2F96A 4GW6A 3AA2A 3FFKB 2OZSA 3J7AP 4DSLA 2XY8A 4DU4A 1S1WA 1HYZA 3RWUA 3D2FB 1X9WA 1RT6A 4CEDA 2F8TA 1NGDA 4OPHA 1QQOA 1T6DA 5I9EB 3HM9A 5BR9A 2G8UA 1T6CA 1TK0A 1W97L 3AO4A 2B4JA 4JI6K 3EL2A 2RE2A 4DV2K 1O1WA 3FFIA 5AQQA 1NJWA 3O3GA 5E41A 2F8SA 2QWRA 2RF2A 3ZYYX 3IAYA 3NGYA 1ITGA 2YKMA 4Q0BA 3SJJA 1GOAA 4W5OA 3C6HA 3ZCMA 4HUGA 2IGIA 3LZJA 3T1AA 4DQ8A 3HJFA 1DEJA 4PUOA 1KAZA 4EIAA 4DV5K 3IRXA 3KTQA 4GY2B 4M3TA 4KH5A 4MLEA 4BC2A 1XI1A 1SV5A 3SQ0A 5C0YA 4FWMA 1BCMA 3M8PA 4CI6A 3L8BA 3D7EO 4NXNK 2ZGYA 1LWEA 2P9SA 3QIPA 4CVNE 4E0DA 3B8AX 3HOTA 3PX0A 2OTLN 5LJWA 5AQVA 3O9RA 2P9NB 5J2MA 1JLBA 4FVUA 2ITMA 1LW0A 3NBPA 5AQZA 4B9TA 3NVMA 3THYA 3QNOA 1U04A 4H8KA 3WXJA 4HUFA 5M1NA 4B3OA 2ZGZA 4IFVA 3W0LA 1BCOA 5AQUA 1OVQA 4PL8A 2FXUA 4OX9K 3WNEA 3LWLA 5AQSA 2O8FA 2VCPA 1V4TA 4CJRA 2P9KA 3DLLL 3QO9A 1VSLA 3VA0A 4CK1A 1YJ9N 5KPRA 4DV0K 1VSMA 3WEEA 4H03B 2Q2RA 4DV6K 3LDQA 1WSEA 2IIRA 1KQSM 4E7JA 3L2UA 1RT5A 1ATSA 2Z1GA 1NKEA 4FZXC 2QXLA 3IKMA 1VSFA 2HHWA 2X6SA 2W40A 2O8BA 5KRTA 3HTVA 4DFKA 3CM5A 3EKSA 1WAJA 5GAEP 3LZIA 4F4KA 2RN2A 3QFPA 4PKHA 1VRUA 4LH4A 1MU2A 2KQ2A 5AFUA 1KVBA 3IMXA 1TK5A 2FBYA 3CXCM 3SUQA 1RBTA 3O80A 3SZ2A 1IBLK 3SUPA 2WC9A 5EU7A 2WUSA 3IUCA 3VGLA 1NGFA 5EXWA 1X3MA 4NCBA 2IC3A 2QWOA 4CHQA 2UYTA 2HBMA 1RDBA 4K25A 2HW3A 4JRQA 1QE1A 3M3ZA 4WFNL 1KLNA 3QLHA 4ID5A 3MCAB 4DQSA 4H5NA 1D5AA 4MO5A 3P5JA 4QS9A 2GBZA 3A5OC 4F8RA 4U67L 2YHWA 5BPMA 1Q86O 2WOMA 3S41A 1RDWX 2P9PB 1U4BA 5KRSA 2DFFA 5AQXA 4JI4K 5FLXO 4JHDB 3CCSN 1XNQK 1BIZA 1BG3A 2W41A 3H46O 4JNEA 4JK8A 4YOXA 5M1FA 1RBUA 5A2QO 3V1QA 4LF5K 4IFYA 4DCHA 1Q81O 2OPSA 5KGWA 4BWJA 2J4RA 3ZSXA 2IVOA 3UKUB 4X65K 5DM6L 3I8DA 4YY3K 4HCCA 4KV8A 1EQYA 3OS1A 1RFQA 1QZ5A 5GIOA 4O55A 3L6QA 4AF1A 1XHZA 1VQ7N 2EWSA 4CJ7A 3LAMA 4K41A 1RDCA 1EKEA 3KHYA 1GOCA 4M3XA 4BE1A 1XQSC 3WXKA 3CJ7A 4HTUA 4H4OA 4BC3A 3AGRA 1CLQA 3F9MA 1RILA 1C0TA 1N5YA 4BRCA 3NGIA 2V52B 4CIGA 4IWVA 1Z6RA 3HPHA 3NH1A 3THXA 1VSEA 3GE1A 4X62K 3DLRA 1U2VA 2E5LK 1S1XA 4J2AA 4CGGA 3ZETB 3OW2M 3MMVA 1MWMA 5DK5A 3UB5A 5CHIA 3CIPA 5KI6A 1RT7A 4N47A 5KGXA 1HNWK 4AHRA 4BRQA 5HRPA 3V9UA 5E26A 4JS5A 3LPTA 3V6DA 4KO0A 1IKWA 3L4QA 3DI6A 2V7YA 4QS7A 3RR7A 2OANA 2HSTA 4Y1DA 3NDKA 3QEXA 3ULEB 3O5BA 4LFCK 1XNRK 1QQCA 1CZ9A 4FSVA 4MDBA 1FJGK 3AVLA 4KHPK 2HHUA 2VYPA 3V1OA 5AQLA 1JL1A 4B3MK 3EN9A 3OTOK 4FLUA 4DTXA 1G15A 1J5OA 3TPQA 1HMVA 3E9LA 5AQRA 4BRNA 4LF8K 3AAQA 4UY8O 3I0SA 3ZSQA 3NFAA 4CHPA 4FWLA 5CYMA 4B3RK 3AAPA 2ASMA 4HVJA 3OYHA 3TANA 3LPUA 4JI5K 4BR2A 4CZIA 1Z26A 4YHHK 4DF8A 3U8XA 4KI6A 4AILC 2E6LA 3RMCA 3NVKA 2QWQA 2O8DA 3TTCA 3VF6A 3ASMA 3OS2A 1HJOA 1L5UA 2E2NA 3DXMA 2HHSA 4LF7K 4NO7A 3IFRA 1ZC6A 1S5JA 1YITN 4Z4EA 4WFAL 5AQNA 4JK9A 5CYQA 1N36K 5BN9A 4BRHA 3F9KA 4LH5A 5GINA 3T3FA 1SL0A 4JKFA 2P51A 5AQWA 4B9QA 1HPMA 4MLHA 3PX4A 4L8RB 4FJMA 3EE9A 1ZXOA 1GLCG 2YHYA 1NGHA 3ZT4A 4QOZB 3MEEA 4K0KK 1TKZA 2HOEA 2NRHA 1A5XA 1NBWA 4RG8A 3KJVA 3OYAA 4OKKA 4CJEA 3MXIA 4PKIA 3HRGA 3CJAA 4WFBL 4JI7K 3KLHA 2VWJA 4MFBA 2OA8A 1LAWA 4FJLA 3ZEUB 1YUWA 4MDAA 5JLFA 3NHGA 4RW4A 1U49A 2YI1A 3WQTA 5J2NA 1Z05A 1X9MA 4JS4A 3OYGA 3A5LC 3ZSOA 1XUPO 4CHZA 3FZHA 4IOAL 4FJ5A 2VQFK 3ALYA 1S1TA 3AVBA 3ZX3A 3MX2A 2QM1A 4H0PA 3KK3A 2W6LA 2FSJA 1O13A 3OYCA 1TYQB 3ATVA 4JYAK 2P9IB 2VGNA 2FBTA 3F5TA 3GG4A 1K6YA 2BDPA 4H5VA 2QWMA 1YIJN 2PAVA 4FJJA 2IOCA 3TSUA 4M42A 1BQMA 4M63C 1JL2A 1DKGD 1Q9YA 1A5WA 3I55N 3CF5L 2A41A 3KZBA 1HNVA 5M1PA 4RW9A 3SBTA 4BRKA 4EFHA 4JI3K 3BEXA 2E2PA 3B6PA 3QMLA 4GKJK 5AQOA 1RTDA 2HF4A 3L4IA 3CYMA 4C8KA 2YNHA 5LJVA 3KD5E 4B1XB 2HMPA 3OYLA 2HBLA 3MWPA 1JLQA 3F73A 3RRGA 3P1GA 3A0IX 4M3ZA 3EZ5A 4FJKA 3VTHA 3OY9A 5D3GA 2UU9K 3SCXA 4ISEA 3DXKB 4IJNA 3MN7A 4FLZA 1HNZK 2R7YA 3VQQA 4FJ7A 3O4WA 1X9SA 1BU6O 2XY6A 4J2EA 1TKTA 3QFUA 3CHWA 1JCEA 2UXDK 1HKBA 1KAYA 3LDPA 2P9LB 2B6AA 1WB9A 4CZKA 3VEWA 4DV3K 1OH8A 4LSLA 3MXJA 4FW2A 4DR2K 3EE8A 1IO2A 4B1YB 2DFEA 1SKSA 1BL3A 1C0UA 3VF4A 1HNIA 4ISGA 2NRXA 4B1VA 1TVRA 1C1BA 2A42A 3DWLA 5FROA 1RT2A 1S6QA 2OZMA 4M41A 1SL2A 5AQTA 1RT3A 2A3ZA 4FLYA 4CE9A 1JLGA 4CGHA 2ATQA 5I42A 2KKZA 4BY9C 4CHOA 3RMDA 2ZM6K 4FLVA 3ZX2A 3ZT1A 3DOLA 4OLAA 1RGIA 1KD1O 1A5VA 3QICA 3RR8A 1TUYA 4BGAA 3BY5A 4CZFA 2ZWHA 4B1ZA 4BVOA 4KHQA 2X78A 1IG8A 3AVJA 3VMFB 1RTHA 1CZBA 3DLGA 1VQPN 2DPNA 3J80O 3UKRB 2QWPA 3CMEN 4WCEL 1QVFM 2YCHA 4FJGA 5ADXA 4CBWA 3NCIA 3THWA 4JV5K 4B3TK 3J7YP 1NMDA 3U3YA 1WBDA 3ZX0A 1SAZA 4Z94A 3M8QA 4E7LA 3RTVA 4FJIA 2B5JA 2E1ZA 4W5QA 3WNHA 3HBTA 4I6MA 4BDZA 4IOXA 5C2FA 1RBVA 3MN9A 4WYBA 4CJPA 4KTQA 3CCMN 3P4IA 3VERA 2GUPA 3N4PA 4DSEA 4CGIA 4ICLA 3CMAN 1X3NA 4RW6A 3H6EA 4CGFA 3MX5A 1K8KA 1W7AA 3AO5A 5TKWA 3LL3A 3AVFA 3DMJA 3T69A 4EZ6A 2UXCK 3KLFA 3MEDA 1NGCA 5F1XA 2JGUA 1NJZA 3K58A 5FPEA 4DF4A 3PO5A 1NK6A 1JKHA 4YDUC 3CJCA 4DR3K 2Z1IA 1HUXA 1WUAA 5I3UA 4WQ5C 2X74A 3O8MA 3V1RA 2BUPA 3V9XA 4DV4K 3HXMA 3AVAA 2KTQA 1Z25A 2HMIA 3QEWA 1VSHA 1C0GA 3G0ZA 1HJRA 2WFBA 3I8BA 4CF8A 3VTIA 2V51B 3NH2A 4OPAA 4ID1A 3VQDA 1NOZA 2ZF5O 1TL1A 4IO9L 4FPBA 3TSQA 3SK3A 4H0TB 3NMUA 4CJSA 1J9AA 5FRMA 3BZKA 3LALA 5AQHA 4DMNA 3RRHA 2G8KA 5HBMA 4ZHRA 4DTUA 3VQPA 4FWKA 4CFDA 2HHVA 1J53A 1BA1A 5AR0A 4PA1A 4L3QA 3THYB 4FWPA 4N56A 4I2QA 4DKWA 4MO4A 4OLBA 4A59A 4JKHA 4FWNA 4CJQA 4N76A 2QEXN 3NF7A 3CC2N 2YHAA 1UA0A 2YNIA 1TL3A 2CH5A 2YKNA 1W0HA 1IBMK 4EHUA 5KTQA 3PUFA 1MA9B 3UIQA 3CQYA 3VQ6A 3SV3A 3RMBA 3KK1A 4DUYK 1BI4A 3RVCA 4KB0A 2W42A 3KKRA 2GWKA 1JLEA 3D0PA 1D4XA 3R3LA 3S9HA 2O8EA 3CCJN 3CG7A 3A5MC 2NRVA 3OYEA 4DFPA 1VQ9N 2F7TA 4DHYA 3M8SA 2HVHA 5FPNA
chains in the Genus database with same CATH topology
2KFNA 1IKWA 4J2DA 1NK8A 2BANA 4AHVA 4CJWA 3DI6A 3NAEA 3RR7A 3DYAA 4AHSA 4CFCA 4PQUA 1DTTA 3CFPA 4FM2A 4Y1DA 3S3MA 3NDKA 3ULDA 3QEXA 4DQPA 3TI0A 3HK2A 3K59A 1RBRA 1N6QA 4O0JA 1FXXA 3HP9A 1BGXT 1ZBUA 2IAJA 3NF9A 2XO7A 4ELVA 3V81A 1QQCA 1CZ9A 1U45A 3AVGA 1KTQA 1S1UA 4KHYA 3AVLA 3SQ1A 2E6MA 2HHUA 3V1OA 1RTIA 1F21A 2XRIA 4E3SA 1NJXA 1JL1A 1S6PA 3O4NA 4W5RA 1NK5A 1T7PA 4QAGA 3I0RA 4AHTA 3AA5X 3OYKA 5HRNA 3ZSWA 4FLUA 3QERA 1UA1A 3ZSZA 4DTXA 1G15A 4H4MA 3AVKA 1J5OA 3OYDA 3C94A 4KHWA 3AA4A 4FYDA 1HMVA 1ASUA 2D0CA 1BQNA 2XY7A 2P5GA 2FC0A 1ZBHA 1QSYA 1TGOA 1IKXA 3JSMA 2OYQA 4DQIA 3BGRA 3KLGA 4ZTFA 4I7FA 3CFOA 4KAZA 4FZZA 1WSJA 3I0SA 3ZSQA 1C6VA 1Y97A 3NFAA 3OVNA 4CHPA 3K5LA 5CYMA 2LSNA 3CFRA 4NYFA 2BGGA 1TK8A 3SQ4A 1NK7A 4CEBA 4HVJA 1DTQA 3ZSRA 3LPUA 3OYHA 3TANA 4KTWA 4DLGA 3RMAA 3WNFA 1EXQA 1EETA 1D9FA 1YT3A 1Z26A 3G10A 4EP4A 4DF8A 1I39A 4KI6A 4AILC 2E6LA 3AO3A 3RMCA 1SKRA 3O3HA 1RT4A 3QNNA 3DLEA 3OYMA 3VN5A 1L3SA 3ASMA 3OS2A 1L5UA 2HHSA 1DLOA 1GOBA 4RW8A 4OKJA 4FJXA 4DQQA 4BE2A 1S5JA 4DS4A 4B08A 4N41A 1T03A 2PYJA 4C8MA 3BDPA 3VQ8A 3QETA 3HYFA 2D0BA 4Z4EA 4FLWA 1XWLA 4FCYA 3AO2A 4CJ5A 3ISNC 5CYQA 4CEEA 4FM0A 1EP4A 1S1VA 3F9KA 4LH5A 3T3FA 4DFJA 4B9NA 1SL0A 4FJHA 1JLFA 4FJ8A 5HP1A 1KLMA 2P51A 2Y1JA 4XIUA 3L2VA 2D5RA 1FK9A 3DLBA 4O0IA 3PX4A 4L8RB 5SWMA 1KVCA 4GMJB 2G8VA 4FJMA 1RTJA 4OGCA 1BHLA 4FK0A 2HB5A 5SZTA 5C25A 4FJ9A 4B9UA 4QOZB 3ZT4A 1WNSA 3MEEA 1TKZA 2Z1HA 1A5XA 1LWFA 3MECA 4RG8A 3KJVA 2EX3A 4EP5A 4OPJA 2A1RA 3OYAA 4OKKA 4CJEA 4OPKA 4DLEA 3MXIA 1WSFA 3ZT3A 4O5BA 1UAXA 2PYLA 1SKWA 3LDSA 4FK4A 4IBNA 3SV4A 3KLHA 4B8CA 3HPOA 2VWJA 3D45A 4MFBA 3EYZA 2DTUA 3VQBA 2OA8A 1LAWA 4FJLA 1Q8IA 2I5JA 3QEPA 3WNGA 4CJTA 4HHTA 3CM6A 3HPGA 4TSXA 1Q9XA 3E01A 4E1NA 4DTMA 3TAFA 3NHGA 4RW4A 3MEGA 1U49A 1WLJA 4DQRA 3LP0A 3OYBA 5J2NA 2GV9A 4DWIA 1X9MA 4CJKA 3SYZA 1R0AA 4FK2A 3JYTA 4M3WA 4JS4A 3DRRA 3OYGA 4KI4A 3ZSOA 4YFUA 1BISA 1HPZA 3MXMA 4CHZA 3VQ5A 4N5SA 3OYIA 3B6OA 4FJ5A 1YVUA 4M3YA 4K8XA 4F2SA 1BI4B 5CZ1A 3O3FA 3ALYA 1S1TA 3OYNA 3V9SA 4DG1A 4I2PA 3AVBA 3QEVA 4K8ZA 1RCHA 4Z4GA 1KSPA 3TABA 4YNQA 4NYNA 1QHTA 3KLEA 1BIUA 3KK3A 4BACA 1QTMA 3OYCA 4FXDA 3SPZA 2RPIA 4IDKA 2FBTA 4GVMA 2Y1IA 4KB1A 4F2RA 3HSTB 3V9ZA 1K6YA 4CGJA 3K57A 4DSFA 2P5OA 1ASVA 1IH7A 2EHGA 3HT3A 2BDPA 3S3OA 3K5NA 1D8YA 5FRNA 3NF8A 1XHXA 4CHNA 2IS3A 4FJJA 2IOCA 2VG7A 3L2RA 1BQMA 4CIEA 4M42A 1CXUA 1RDAA 4B9VA 2OPPA 1JL2A 3NE6A 2P1JA 3PY8A 1Q9YA 2ETJA 1A5WA 4KTZA 3TWHA 1LWCA 4KFBA 1KRPA 1HNVA 4LD0A 4CCHA 4RW9A 4CIFA 4OJRA 4DTPA 4CJ4A 3B6PA 1VRTA 5HRRA 4DTSA 3KIOA 1KFDA 1RT1A 1VSKA 3LANA 4R5PA 4DS5A 1SL1A 1TKDA 4B9LA 3DM2A 1FKOA 3TAEA 3LAKA 1NK0A 1LAVA 3K2PA 3K5OA 1U47A 2ZD1A 2PY5A 2DY4A 3DRPA 3NF6A 4PWDA 1RTDA 3ZT0A 1ZYQA 3CYMA 2F96A 4GW6A 4FJNA 3AA2A 2OZSA 4C8KA 4DSLA 4I9LA 2YNHA 3AV9A 2X6NA 3TAPA 4KHSA 3KD5E 3QESA 2XY8A 3OYLA 4JRPA 4DU4A 1JLQA 1S1WA 1HYZA 3RWUA 3F73A 3RRGA 3O4QA 1HQEA 1X9WA 1RT6A 4DSIA 3P1GA 4CEDA 1VK0A 1HYVA 2F8TA 5JS1A 3KLIA 5C42A 2XHBA 4DFMA 4ELUA 3EZ5A 4M3ZA 4FJKA 3CQ8A 4Y1CA 3HM9A 4KPYA 2G8UA 3OY9A 2JLEA 5D3GA 1TK0A 1EX4A 1HQUA 3AO4A 2B4JA 4OGEA 4AHCA 3SCXA 4KHUA 1TAUA 1NJYA 4CFBA 2YV0X 1WSGA 4IKFA 1RDDA 1O1WA 3FFIA 4FLZA 4LY7A 2AJQA 1NJWA 3O3GA 5E41A 3VQQA 1CXQA 2OPQA 2R7YA 4BDYA 4FJ7A 3IAYA 2RF2A 2YNFA 2F8SA 3NGYA 1ITGA 4OVLA 1X9SA 2YKMA 2XY6A 3SJJA 1GOAA 4J2EA 1TKTA 4Q0BA 4W5OA 5J2QA 3S3NA 2FBXA 3ZCMA 4CJLA 4HUGA 1RBSA 1QS4A 1UWBA 2IGIA 3L2QA 4J2BA 3LZJA 2ITGA 3OJUA 3T1AA 3HJFA 4PUOA 2QKBA 5T7BA 3PO4A 3VQCA 3IRXA 1WSIA 3KTQA 2B6AA 4M3TA 4DSJA 3AA3A 1XI1A 1SV5A 1JLAA 3SQ0A 3KD1E 1C1CA 1BCMA 3M8PA 4RW7A 4LSLA 3MXJA 4FW2A 5K14A 3L8BA 1ZBLA 1IO2A 3TAGA 2DFEA 1LWEA 5HLFA 3QIPA 1BL3A 3SPYA 1SKSA 4F3OA 1C0UA 4E0DA 1HNIA 1LW2A 3PX0A 1TVRA 2HW3A 1C1BA 3K5MA 3VQ7A 3IG1A 5FROA 1RT2A 1S6QA 1WAFA 2OZMA 2YNGA 5J2PA 3KK2A 5J2MA 3SUOA 3AO1A 1JLBA 5C24A 4M41A 3OJSA 1SL2A 4I9QA 4O44A 4CJ3A 1LW0A 1C0MA 3NBPA 1RT3A 1VSIA 4IG3A 4B9TA 2KFZA 1UOCA 3QNOA 3VQ9A 4FLYA 4CK3A 4CE9A 1JLGA 2HNZA 2ATQA 3ZSYA 4CGHA 1U04A 5I42A 1NKCA 4H8KA 4Z4FA 4CHOA 2HHQA 1TV6A 2VG5A 2RKIA 4HUFA 4QCLA 3RMDA 1S9EA 4FLVA 2DFHA 3AVMA 4Z0UA 3ZT1A 3DOLA 4B3OA 3HO1A 4OLAA 3L2WA 4IFVA 1L3UA 1BCOA 2Q3SA 1A5VA 3RR8A 4LSNA 1L3VA 3TARA 4E7IA 4UQGA 3DRSA 2E4LA 3WNEA 3LP2A 3QINA 4M3RA 3L3VA 3LWLA 4CJRA 4CF9A 3ZT2A 1T05A 2QK9A 3THVA 3QO9A 1VSLA 3VA0A 3TR8A 2OPRA 3EY1A 4KHQA 2X78A 1XC9A 5JS2A 4CJVA 2O4IA 4FW1A 1ASWA 4CK1A 3AVJA 1VSMA 3HVRA 1RTHA 4CGDA 1YTAA 1CZBA 1WSEA 3DLGA 5HRSA 4E7JA 1KVAA 2BE2A 2ZQBA 3L2UA 2ZE2A 1RT5A 1U48A 4E1MA 3ZSVA 2Z1GA 1NKEA 4FLXA 4FZXC 4FJGA 1VSFA 3NCIA 2HHWA 4ZTJA 2KZZA 2X6SA 4BWMA 4BDPA 3SNNA 2NUBA 4CHYA 1KFSA 5KRTA 3TAMA 4Q5VA 4DFKA 2G8HA 3CM5A 4DTOA 4CEFA 3U3YA 4O4GA 3HP6A 1WAJA 3OYFA 3LZIA 4CEQA 4NCAA 1JLCA 3M8QA 3VQ4A 3MAQA 2O4GA 4F4KA 2RN2A 4E7LA 3RTVA 4B9MA 1VRUA 4LH4A 1MU2A 5HROA 2KQ2A 3DLHA 4FJIA 5CZ2A 1KVBA 2B5JA 3DOKA 1NK9A 1TK5A 4KREA 2FBYA 1HRHA 4W5QA 3SUQA 1RBTA 3WNHA 4G1QA 3VQEA 4CF0A 4BDZA 5CY4A 3SZ2A 3U6FA 1RBVA 3SUPA 3C6TA 5EU7A 4CEZA 4W5TA 2HHTA 1W9HA 4CJPA 1REVA 1D9DA 4KTQA 5FDLA 3C95A 1WSHA 4KRFA 4Z4CA 4CF1A 4DSEA 4NCBA 4CGIA 4ICLA 2IC3A 1S9GA 4CHQA 4RW6A 3H08A 1B9DA 4M45A 2G8FA 4CGFA 2HHXA 1RDBA 2FBVA 4HUEA 4FM1A 4JRQA 1QE1A 1C1AA 1SUQA 1KLNA 3AO5A 3SQ2A 1I3AA 1VSDA 3AVFA 3DMJA 1LV5A 3QLHA 2Z1JA 4JLHA 4EZ6A 4CJFA 3KLFA 4ID5A 4CESA 4DQSA 2WONA 4W5NA 1D5AA 4CECA 2G8WA 1FKPA 3MEDA 1ZBIA 3P5JA 2JGUA 1QSLA 2GBZA 4F8RA 2QXFA 1NJZA 3K58A 3SUNA 2QKKA 4DF4A 3PO5A 1NK6A 1NOYA 4C8LA 1JKHA 4E7HA 2IDOA 4HCBA 4Z4HA 2Z1IA 2WOMA 4CK2A 3QEIA 4M3UA 2G8IA 5I3UA 4CERA 2X74A 3V1RA 3V9XA 1U4BA 4EZ9A 3HXMA 5KRSA 2DFFA 3AVAA 4C8NA 2KTQA 1Z25A 3T19A 3NGZA 3V4IA 3OYJA 2HMIA 3QEWA 1VSHA 4FZYA 2PZSA 3KKSA 1TAQA 4DU1A 1RNHA 3G0ZA 3VA3A 1HJRA 1BIZA 4CF8A 1WN7A 3NH2A 2YHBA 4ID1A 1NKBA 3VQDA 2A1SA 1NOZA 3HVTA 1TL1A 1J54A 3L3UA 1RBUA 2HNYA 4KKOA 3V1QA 2D0AA 4CJSA 4B8AB 1J9AA 5FRMA 1JXBA 3AVIA 1T8EA 3LALA 4IFYA 4DTNA 2OPSA 5KGWA 4ELTA 4CFAA 4DMNA 3RRHA 2G8KA 4MQ3A 4BWJA 3ZSXA 5HBMA 4ZHRA 4DTUA 3TAQA 1NK4A 3LP3A 4F3TA 4IG0A 3I8DA 4HCCA 4KV8A 3VQPA 3OS1A 4CEOA 1VSJA 4BE0A 4CFDA 4AHUA 4DSKA 4PY5A 3VQAA 3HL8A 4DTRA 2HVIA 2HHVA 1J53A 3PX6A 4O55A 3M8RA 2XY5A 4PA1A 1XHZA 3C6UA 1YTUA 1B9FA 3NH0A 3LAMA 1B92A 1RDCA 4I2QA 4N56A 1EKEA 3OS0A 4M3XA 1GOCA 4C8OA 3AVHA 1L3TA 4WE1A 1QSSA 3ITHA 4BE1A 4OLBA 5J1EA 2VG6A 1JXEA 3DLKA 3U3GA 4KHNA 4CEAA 4HTUA 4CJQA 1IG9A 2HNDA 4B9SA 1X1PA 4H4OA 3NF7A 4N76A 5DMRA 4E89A 4OKEA 2YHAA 1UA0A 2YNIA 1TL3A 2YKNA 1W0HA 1IKYA 4AH9A 1CLQA 5KTQA 1RILA 1TKXA 1C0TA 1N5YA 3PUFA 3NGIA 3UIQA 2GUIA 4CIGA 1IKVA 3HPHA 3P83D 3VQ6A 3SV3A 3RMBA 1KCFA 3NH1A 3PV8A 3SI6A 3LWMA 3KK1A 1VSEA 1BI4A 4DTJA 4FVMA 4CJUA 3DLRA 4FLTA 4Z4IA 4KB0A 1S1XA 4J2AA 2W42A 4CGGA 3KKRA 4DU3A 3V9WA 1JLEA 3AVCA 3IS9A 5DK5A 3LP1A 3D0PA 2KZMA 3S9HA 4NCGA 1RT7A 2KW4A 4N47A 5KI6A 3CG7A 3A2FA 5KGXA 3AVNA 1HYSA 4AHRA 2VWKA 5HRPA 1ZBFA 3OYEA 3V9UA 4E7KA 4DFPA 3QIOA 4JS5A 3M8SA 3LPTA 4E19A 4CF2A 2HVHA 3V6DA 4KO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFN A;  1IKW A;  4J2D A;  1NK8 A;  2BAN A;  4AHV A;  4CJW A;  3DI6 A;  3NAE A;  3RR7 A;  3DYA A;  4AHS A;  4CFC A;  4PQU A;  1DTT A;  3CFP A;  4FM2 A;  4Y1D A;  3S3M A;  3NDK A;  3ULD A;  3QEX A;  4DQP A;  3TI0 A;  3HK2 A;  3K59 A;  1RBR A;  1N6Q A;  4O0J A;  1FXX A;  3HP9 A;  1BGX T;  1ZBU A;  2IAJ A;  3NF9 A;  2XO7 A;  4ELV A;  3V81 A;  1QQC A;  1CZ9 A;  1U45 A;  3AVG A;  1KTQ A;  1S1U A;  4KHY A;  3AVL A;  3SQ1 A;  2E6M A;  2HHU A;  3V1O A;  1RTI A;  1F21 A;  2XRI A;  4E3S A;  1NJX A;  1JL1 A;  1S6P A;  3O4N A;  4W5R A;  1NK5 A;  1T7P A;  4QAG A;  3I0R A;  4AHT A;  3AA5 X;  3OYK A;  5HRN A;  3ZSW A;  4FLU A;  3QER A;  1UA1 A;  3ZSZ A;  4DTX A;  1G15 A;  4H4M A;  3AVK A;  1J5O A;  3OYD A;  3C94 A;  4KHW A;  3AA4 A;  4FYD A;  1HMV A;  1ASU A;  2D0C A;  1BQN A;  2XY7 A;  2P5G A;  2FC0 A;  1ZBH A;  1QSY A;  1TGO A;  1IKX A;  3JSM A;  2OYQ A;  4DQI A;  3BGR A;  3KLG A;  4ZTF A;  4I7F A;  3CFO A;  4KAZ A;  4FZZ A;  1WSJ A;  3I0S A;  3ZSQ A;  1C6V A;  1Y97 A;  3NFA A;  3OVN A;  4CHP A;  3K5L A;  5CYM A;  2LSN A;  3CFR A;  4NYF A;  2BGG A;  1TK8 A;  3SQ4 A;  1NK7 A;  4CEB A;  4HVJ A;  1DTQ A;  3ZSR A;  3LPU A;  3OYH A;  3TAN A;  4KTW A;  4DLG A;  3RMA A;  3WNF A;  1EXQ A;  1EET A;  1D9F A;  1YT3 A;  1Z26 A;  3G10 A;  4EP4 A;  4DF8 A;  1I39 A;  4KI6 A;  4AIL C;  2E6L A;  3AO3 A;  3RMC A;  1SKR A;  3O3H A;  1RT4 A;  3QNN A;  3DLE A;  3OYM A;  3VN5 A;  1L3S A;  3ASM A;  3OS2 A;  1L5U A;  2HHS A;  1DLO A;  1GOB A;  4RW8 A;  4OKJ A;  4FJX A;  4DQQ A;  4BE2 A;  1S5J A;  4DS4 A;  4B08 A;  4N41 A;  1T03 A;  2PYJ A;  4C8M A;  3BDP A;  3VQ8 A;  3QET A;  3HYF A;  2D0B A;  4Z4E A;  4FLW A;  1XWL A;  4FCY A;  3AO2 A;  4CJ5 A;  3ISN C;  5CYQ A;  4CEE A;  4FM0 A;  1EP4 A;  1S1V A;  3F9K A;  4LH5 A;  3T3F A;  4DFJ A;  4B9N A;  1SL0 A;  4FJH A;  1JLF A;  4FJ8 A;  5HP1 A;  1KLM A;  2P51 A;  2Y1J A;  4XIU A;  3L2V A;  2D5R A;  1FK9 A;  3DLB A;  4O0I A;  3PX4 A;  4L8R B;  5SWM A;  1KVC A;  4GMJ B;  2G8V A;  4FJM A;  1RTJ A;  4OGC A;  1BHL A;  4FK0 A;  2HB5 A;  5SZT A;  5C25 A;  4FJ9 A;  4B9U A;  4QOZ B;  3ZT4 A;  1WNS A;  3MEE A;  1TKZ A;  2Z1H A;  1A5X A;  1LWF A;  3MEC A;  4RG8 A;  3KJV A;  2EX3 A;  4EP5 A;  4OPJ A;  2A1R A;  3OYA A;  4OKK A;  4CJE A;  4OPK A;  4DLE A;  3MXI A;  1WSF A;  3ZT3 A;  4O5B A;  1UAX A;  2PYL A;  1SKW A;  3LDS A;  4FK4 A;  4IBN A;  3SV4 A;  3KLH A;  4B8C A;  3HPO A;  2VWJ A;  3D45 A;  4MFB A;  3EYZ A;  2DTU A;  3VQB A;  2OA8 A;  1LAW A;  4FJL A;  1Q8I A;  2I5J A;  3QEP A;  3WNG A;  4CJT A;  4HHT A;  3CM6 A;  3HPG A;  4TSX A;  1Q9X A;  3E01 A;  4E1N A;  4DTM A;  3TAF A;  3NHG A;  4RW4 A;  3MEG A;  1U49 A;  1WLJ A;  4DQR A;  3LP0 A;  3OYB A;  5J2N A;  2GV9 A;  4DWI A;  1X9M A;  4CJK A;  3SYZ A;  1R0A A;  4FK2 A;  3JYT A;  4M3W A;  4JS4 A;  3DRR A;  3OYG A;  4KI4 A;  3ZSO A;  4YFU A;  1BIS A;  1HPZ A;  3MXM A;  4CHZ A;  3VQ5 A;  4N5S A;  3OYI A;  3B6O A;  4FJ5 A;  1YVU A;  4M3Y A;  4K8X A;  4F2S A;  1BI4 B;  5CZ1 A;  3O3F A;  3ALY A;  1S1T A;  3OYN A;  3V9S A;  4DG1 A;  4I2P A;  3AVB A;  3QEV A;  4K8Z A;  1RCH A;  4Z4G A;  1KSP A;  3TAB A;  4YNQ A;  4NYN A;  1QHT A;  3KLE A;  1BIU A;  3KK3 A;  4BAC A;  1QTM A;  3OYC A;  4FXD A;  3SPZ A;  2RPI A;  4IDK A;  2FBT A;  4GVM A;  2Y1I A;  4KB1 A;  4F2R A;  3HST B;  3V9Z A;  1K6Y A;  4CGJ A;  3K57 A;  4DSF A;  2P5O A;  1ASV A;  1IH7 A;  2EHG A;  3HT3 A;  2BDP A;  3S3O A;  3K5N A;  1D8Y A;  5FRN A;  3NF8 A;  1XHX A;  4CHN A;  2IS3 A;  4FJJ A;  2IOC A;  2VG7 A;  3L2R A;  1BQM A;  4CIE A;  4M42 A;  1CXU A;  1RDA A;  4B9V A;  2OPP A;  1JL2 A;  3NE6 A;  2P1J A;  3PY8 A;  1Q9Y A;  2ETJ A;  1A5W A;  4KTZ A;  3TWH A;  1LWC A;  4KFB A;  1KRP A;  1HNV A;  4LD0 A;  4CCH A;  4RW9 A;  4CIF A;  4OJR A;  4DTP A;  4CJ4 A;  3B6P A;  1VRT A;  5HRR A;  4DTS A;  3KIO A;  1KFD A;  1RT1 A;  1VSK A;  3LAN A;  4R5P A;  4DS5 A;  1SL1 A;  1TKD A;  4B9L A;  3DM2 A;  1FKO A;  3TAE A;  3LAK A;  1NK0 A;  1LAV A;  3K2P A;  3K5O A;  1U47 A;  2ZD1 A;  2PY5 A;  2DY4 A;  3DRP A;  3NF6 A;  4PWD A;  1RTD A;  3ZT0 A;  1ZYQ A;  3CYM A;  2F96 A;  4GW6 A;  4FJN A;  3AA2 A;  2OZS A;  4C8K A;  4DSL A;  4I9L A;  2YNH A;  3AV9 A;  2X6N A;  3TAP A;  4KHS A;  3KD5 E;  3QES A;  2XY8 A;  3OYL A;  4JRP A;  4DU4 A;  1JLQ A;  1S1W A;  1HYZ A;  3RWU A;  3F73 A;  3RRG A;  3O4Q A;  1HQE A;  1X9W A;  1RT6 A;  4DSI A;  3P1G A;  4CED A;  1VK0 A;  1HYV A;  2F8T A;  5JS1 A;  3KLI A;  5C42 A;  2XHB A;  4DFM A;  4ELU A;  3EZ5 A;  4M3Z A;  4FJK A;  3CQ8 A;  4Y1C A;  3HM9 A;  4KPY A;  2G8U A;  3OY9 A;  2JLE A;  5D3G A;  1TK0 A;  1EX4 A;  1HQU A;  3AO4 A;  2B4J A;  4OGE A;  4AHC A;  3SCX A;  4KHU A;  1TAU A;  1NJY A;  4CFB A;  2YV0 X;  1WSG A;  4IKF A;  1RDD A;  1O1W A;  3FFI A;  4FLZ A;  4LY7 A;  2AJQ A;  1NJW A;  3O3G A;  5E41 A;  3VQQ A;  1CXQ A;  2OPQ A;  2R7Y A;  4BDY A;  4FJ7 A;  3IAY A;  2RF2 A;  2YNF A;  2F8S A;  3NGY A;  1ITG A;  4OVL A;  1X9S A;  2YKM A;  2XY6 A;  3SJJ A;  1GOA A;  4J2E A;  1TKT A;  4Q0B A;  4W5O A;  5J2Q A;  3S3N A;  2FBX A;  3ZCM A;  4CJL A;  4HUG A;  1RBS A;  1QS4 A;  1UWB A;  2IGI A;  3L2Q A;  4J2B A;  3LZJ A;  2ITG A;  3OJU A;  3T1A A;  3HJF A;  4PUO A;  2QKB A;  5T7B A;  3PO4 A;  3VQC A;  3IRX A;  1WSI A;  3KTQ A;  2B6A A;  4M3T A;  4DSJ A;  3AA3 A;  1XI1 A;  1SV5 A;  1JLA A;  3SQ0 A;  3KD1 E;  1C1C A;  1BCM A;  3M8P A;  4RW7 A;  4LSL A;  3MXJ A;  4FW2 A;  5K14 A;  3L8B A;  1ZBL A;  1IO2 A;  3TAG A;  2DFE A;  1LWE A;  5HLF A;  3QIP A;  1BL3 A;  3SPY A;  1SKS A;  4F3O A;  1C0U A;  4E0D A;  1HNI A;  1LW2 A;  3PX0 A;  1TVR A;  2HW3 A;  1C1B A;  3K5M A;  3VQ7 A;  3IG1 A;  5FRO A;  1RT2 A;  1S6Q A;  1WAF A;  2OZM A;  2YNG A;  5J2P A;  3KK2 A;  5J2M A;  3SUO A;  3AO1 A;  1JLB A;  5C24 A;  4M41 A;  3OJS A;  1SL2 A;  4I9Q A;  4O44 A;  4CJ3 A;  1LW0 A;  1C0M A;  3NBP A;  1RT3 A;  1VSI A;  4IG3 A;  4B9T A;  2KFZ A;  1UOC A;  3QNO A;  3VQ9 A;  4FLY A;  4CK3 A;  4CE9 A;  1JLG A;  2HNZ A;  2ATQ A;  3ZSY A;  4CGH A;  1U04 A;  5I42 A;  1NKC A;  4H8K A;  4Z4F A;  4CHO A;  2HHQ A;  1TV6 A;  2VG5 A;  2RKI A;  4HUF A;  4QCL A;  3RMD A;  1S9E A;  4FLV A;  2DFH A;  3AVM A;  4Z0U A;  3ZT1 A;  3DOL A;  4B3O A;  3HO1 A;  4OLA A;  3L2W A;  4IFV A;  1L3U A;  1BCO A;  2Q3S A;  1A5V A;  3RR8 A;  4LSN A;  1L3V A;  3TAR A;  4E7I A;  4UQG A;  3DRS A;  2E4L A;  3WNE A;  3LP2 A;  3QIN A;  4M3R A;  3L3V A;  3LWL A;  4CJR A;  4CF9 A;  3ZT2 A;  1T05 A;  2QK9 A;  3THV A;  3QO9 A;  1VSL A;  3VA0 A;  3TR8 A;  2OPR A;  3EY1 A;  4KHQ A;  2X78 A;  1XC9 A;  5JS2 A;  4CJV A;  2O4I A;  4FW1 A;  1ASW A;  4CK1 A;  3AVJ A;  1VSM A;  3HVR A;  1RTH A;  4CGD A;  1YTA A;  1CZB A;  1WSE A;  3DLG A;  5HRS A;  4E7J A;  1KVA A;  2BE2 A;  2ZQB A;  3L2U A;  2ZE2 A;  1RT5 A;  1U48 A;  4E1M A;  3ZSV A;  2Z1G A;  1NKE A;  4FLX A;  4FZX C;  4FJG A;  1VSF A;  3NCI A;  2HHW A;  4ZTJ A;  2KZZ A;  2X6S A;  4BWM A;  4BDP A;  3SNN A;  2NUB A;  4CHY A;  1KFS A;  5KRT A;  3TAM A;  4Q5V A;  4DFK A;  2G8H A;  3CM5 A;  4DTO A;  4CEF A;  3U3Y A;  4O4G A;  3HP6 A;  1WAJ A;  3OYF A;  3LZI A;  4CEQ A;  4NCA A;  1JLC A;  3M8Q A;  3VQ4 A;  3MAQ A;  2O4G A;  4F4K A;  2RN2 A;  4E7L A;  3RTV A;  4B9M A;  1VRU A;  4LH4 A;  1MU2 A;  5HRO A;  2KQ2 A;  3DLH A;  4FJI A;  5CZ2 A;  1KVB A;  2B5J A;  3DOK A;  1NK9 A;  1TK5 A;  4KRE A;  2FBY A;  1HRH A;  4W5Q A;  3SUQ A;  1RBT A;  3WNH A;  4G1Q A;  3VQE A;  4CF0 A;  4BDZ A;  5CY4 A;  3SZ2 A;  3U6F A;  1RBV A;  3SUP A;  3C6T A;  5EU7 A;  4CEZ A;  4W5T A;  2HHT A;  1W9H A;  4CJP A;  1REV A;  1D9D A;  4KTQ A;  5FDL A;  3C95 A;  1WSH A;  4KRF A;  4Z4C A;  4CF1 A;  4DSE A;  4NCB A;  4CGI A;  4ICL A;  2IC3 A;  1S9G A;  4CHQ A;  4RW6 A;  3H08 A;  1B9D A;  4M45 A;  2G8F A;  4CGF A;  2HHX A;  1RDB A;  2FBV A;  4HUE A;  4FM1 A;  4JRQ A;  1QE1 A;  1C1A A;  1SUQ A;  1KLN A;  3AO5 A;  3SQ2 A;  1I3A A;  1VSD A;  3AVF A;  3DMJ A;  1LV5 A;  3QLH A;  2Z1J A;  4JLH A;  4EZ6 A;  4CJF A;  3KLF A;  4ID5 A;  4CES A;  4DQS A;  2WON A;  4W5N A;  1D5A A;  4CEC A;  2G8W A;  1FKP A;  3MED A;  1ZBI A;  3P5J A;  2JGU A;  1QSL A;  2GBZ A;  4F8R A;  2QXF A;  1NJZ A;  3K58 A;  3SUN A;  2QKK A;  4DF4 A;  3PO5 A;  1NK6 A;  1NOY A;  4C8L A;  1JKH A;  4E7H A;  2IDO A;  4HCB A;  4Z4H A;  2Z1I A;  2WOM A;  4CK2 A;  3QEI A;  4M3U A;  2G8I A;  5I3U A;  4CER A;  2X74 A;  3V1R A;  3V9X A;  1U4B A;  4EZ9 A;  3HXM A;  5KRS A;  2DFF A;  3AVA A;  4C8N A;  2KTQ A;  1Z25 A;  3T19 A;  3NGZ A;  3V4I A;  3OYJ A;  2HMI A;  3QEW A;  1VSH A;  4FZY A;  2PZS A;  3KKS A;  1TAQ A;  4DU1 A;  1RNH A;  3G0Z A;  3VA3 A;  1HJR A;  1BIZ A;  4CF8 A;  1WN7 A;  3NH2 A;  2YHB A;  4ID1 A;  1NKB A;  3VQD A;  2A1S A;  1NOZ A;  3HVT A;  1TL1 A;  1J54 A;  3L3U A;  1RBU A;  2HNY A;  4KKO A;  3V1Q A;  2D0A A;  4CJS A;  4B8A B;  1J9A A;  5FRM A;  1JXB A;  3AVI A;  1T8E A;  3LAL A;  4IFY A;  4DTN A;  2OPS A;  5KGW A;  4ELT A;  4CFA A;  4DMN A;  3RRH A;  2G8K A;  4MQ3 A;  4BWJ A;  3ZSX A;  5HBM A;  4ZHR A;  4DTU A;  3TAQ A;  1NK4 A;  3LP3 A;  4F3T A;  4IG0 A;  3I8D A;  4HCC A;  4KV8 A;  3VQP A;  3OS1 A;  4CEO A;  1VSJ A;  4BE0 A;  4CFD A;  4AHU A;  4DSK A;  4PY5 A;  3VQA A;  3HL8 A;  4DTR A;  2HVI A;  2HHV A;  1J53 A;  3PX6 A;  4O55 A;  3M8R A;  2XY5 A;  4PA1 A;  1XHZ A;  3C6U A;  1YTU A;  1B9F A;  3NH0 A;  3LAM A;  1B92 A;  1RDC A;  4I2Q A;  4N56 A;  1EKE A;  3OS0 A;  4M3X A;  1GOC A;  4C8O A;  3AVH A;  1L3T A;  4WE1 A;  1QSS A;  3ITH A;  4BE1 A;  4OLB A;  5J1E A;  2VG6 A;  1JXE A;  3DLK A;  3U3G A;  4KHN A;  4CEA A;  4HTU A;  4CJQ A;  1IG9 A;  2HND A;  4B9S A;  1X1P A;  4H4O A;  3NF7 A;  4N76 A;  5DMR A;  4E89 A;  4OKE A;  2YHA A;  1UA0 A;  2YNI A;  1TL3 A;  2YKN A;  1W0H A;  1IKY A;  4AH9 A;  1CLQ A;  5KTQ A;  1RIL A;  1TKX A;  1C0T A;  1N5Y A;  3PUF A;  3NGI A;  3UIQ A;  2GUI A;  4CIG A;  1IKV A;  3HPH A;  3P83 D;  3VQ6 A;  3SV3 A;  3RMB A;  1KCF A;  3NH1 A;  3PV8 A;  3SI6 A;  3LWM A;  3KK1 A;  1VSE A;  1BI4 A;  4DTJ A;  4FVM A;  4CJU A;  3DLR A;  4FLT A;  4Z4I A;  4KB0 A;  1S1X A;  4J2A A;  2W42 A;  4CGG A;  3KKR A;  4DU3 A;  3V9W A;  1JLE A;  3AVC A;  3IS9 A;  5DK5 A;  3LP1 A;  3D0P A;  2KZM A;  3S9H A;  4NCG A;  1RT7 A;  2KW4 A;  4N47 A;  5KI6 A;  3CG7 A;  3A2F A;  5KGX A;  3AVN A;  1HYS A;  4AHR A;  2VWK A;  5HRP A;  1ZBF A;  3OYE A;  3V9U A;  4E7K A;  4DFP A;  3QIO A;  4JS5 A;  3M8S A;  3LPT A;  4E19 A;  4CF2 A;  2HVH A;  3V6D A;  4KO0 A; 
#chains in the Genus database with same CATH topology
 4J2D A;  2Q36 A;  2BAN A;  4JI2 K;  4AHV A;  4EAH D;  4CJW A;  1GLD G;  3NAE A;  1GLJ O;  2A6A A;  3TSP A;  2QWN A;  4CFC A;  4PQU A;  1YVN A;  3S3M A;  3ULD A;  3T7Z A;  3TI0 A;  3HP9 A;  1BGX T;  4ELV A;  3V81 A;  3PLA A;  3JAM O;  3AVG A;  1KTQ A;  1RDU A;  1U45 A;  3UE5 A;  3VPZ A;  3SQ1 A;  4CBU A;  1NJX A;  1RTI A;  4E3S A;  1T7P A;  1NGJ A;  3CET A;  3I0R A;  4AHT A;  3AA5 X;  3OYK A;  5HRN A;  3H1Q A;  3ZSW A;  4JKD A;  3OBY A;  3CCE N;  4BG9 A;  3DJC A;  5BPL A;  4JD2 A;  3AA4 A;  2GWJ A;  2D0C A;  2XY7 A;  1QSY A;  4BRG A;  1TGO A;  4DQI A;  4ILJ A;  1SZ2 A;  3PIO L;  3KWI A;  4BQL A;  1EWQ A;  1WSJ A;  3OVN A;  5JVG L;  1QZ6 A;  3CJ9 A;  3G4S N;  1VQL N;  5E84 A;  1NK7 A;  4CEB A;  1DTQ A;  3ZSR A;  1NM1 A;  4DLG A;  5HOO A;  3RMA A;  1EXQ A;  2I7P A;  3M5R A;  1S3X A;  4BC5 A;  3J8A A;  1I39 A;  4KH6 A;  3O3H A;  1RT4 A;  5LY3 A;  3DLE A;  3VN5 A;  1L3S A;  4H0O A;  3GDQ A;  3CC7 N;  1Q82 O;  4FJX A;  4BE2 A;  2JWK A;  4DB3 A;  3FLC O;  4H0V B;  2ZJP L;  3VEZ A;  4FLW A;  1XWL A;  5AZJ A;  4FCY A;  3AO2 A;  4CJ5 A;  4BRP A;  4FM0 A;  3A5N C;  4B9N A;  4FJH A;  4H0X B;  4CZJ A;  3D2E B;  5LMN K;  3DLB A;  5TKY A;  4O0I A;  5FPD A;  4GMJ B;  5SWM A;  3QBW A;  2NLX A;  2Q1N A;  2BH1 A;  4OGC A;  1BHL A;  5SZT A;  5GAG P;  3K9K A;  4LF6 K;  1NG9 A;  4WQ4 C;  4DV1 K;  3MEC A;  2EX3 A;  4EP5 A;  2A1R A;  4LF4 K;  4IFE A;  4DLE A;  1WSF A;  5AQY A;  4O5B A;  5LL6 Z;  3QBX A;  1UAX A;  2PYL A;  3EYZ A;  1BOT O;  3VQB A;  2UXB K;  2I5J A;  1YXQ A;  1IBK K;  4HHT A;  3CM6 A;  3HPG A;  5H1S Q;  4TSX A;  3E01 A;  3TAF A;  5AQG A;  1WLJ A;  2P9U B;  4NLC A;  3LP0 A;  3OYB A;  4DWI A;  3JS6 A;  3E66 A;  1P90 A;  3DRR A;  1S72 N;  1HPZ A;  3WXM B;  3OYI A;  3B6O A;  1YVU A;  2YJE A;  3THX B;  4M3Y A;  3E9O A;  1U2V B;  4LFB K;  4I2P A;  2O8C B;  3TAB A;  4JI1 K;  3T1Y K;  1BIU A;  4IOC L;  4BAC A;  1OVY A;  2Y1I A;  4AQY K;  3I56 N;  3V9Z A;  3K57 A;  4O5F A;  2P5O A;  2F4V K;  1IH7 A;  2EHG A;  5M1K A;  4C1N I;  3S3O A;  3EEQ A;  3K5N A;  2OTJ N;  2NZT A;  3NF8 A;  4R79 A;  4CHN A;  2VG7 A;  3L2R A;  1NGA A;  3VF2 A;  1RDA A;  3R9P A;  3PY8 A;  1OH5 A;  2ETJ A;  3C7N B;  4A5A A;  1LWC A;  2NRZ A;  5JLH A;  4NB4 A;  4LD0 A;  1SQK A;  5HRR A;  1KFD A;  1RT1 A;  1VSK A;  4DS5 A;  4B9L A;  2E1Y A;  3DM2 A;  3TAE A;  3K2P A;  1U47 A;  3VET A;  2ZD1 A;  2DY4 A;  4PWD A;  3OHR A;  3O9T A;  1MWK A;  3AV9 A;  2X6N A;  4DR4 K;  3TAP A;  3JXU A;  4HTL A;  3O4Q A;  1HQE A;  1V4S A;  1VK0 A;  1HYV A;  5B8H A;  3VOV A;  5C42 A;  2XHB A;  3CQ8 A;  3MDQ A;  2JLE A;  1VQ8 N;  1HKG A;  3MWT A;  3CI5 A;  1EX4 A;  1HQU A;  4KHU A;  4CFB A;  2RHK A;  4BR7 A;  4IKF A;  2O8D B;  3SAH A;  4BDY A;  1CXQ A;  2OPQ A;  3DXM B;  2YNF A;  3VEV A;  4ILG B;  5J2Q A;  2IVP A;  2FBX A;  3S3N A;  3O9S A;  5AQJ A;  3OJU A;  4KH4 A;  3EO3 A;  3VEY A;  2QKB A;  1BUP A;  3RSE A;  3SAF A;  3O08 A;  5KPT A;  3VQC A;  1WSI A;  4DSJ A;  3AA3 A;  1JLA A;  3KD1 E;  1C1C A;  4YOY A;  4RW7 A;  5K14 A;  2Q31 A;  3SPY A;  2FSK A;  2FSN A;  2GEL A;  3K5M A;  3IG1 A;  4B1W B;  1WAF A;  1P8Z A;  4PL7 A;  3KK2 A;  3AO1 A;  1GLB G;  3OJS A;  4CJ3 A;  1C0M A;  1S22 A;  4IO8 A;  3MK6 A;  1K8A O;  3VQ9 A;  4CK3 A;  1NKC A;  4FWR A;  3WXI A;  4FWQ A;  3LDN A;  2HHQ A;  1YJN N;  1S9E A;  2QTD A;  2DFH A;  4C23 A;  1HKC A;  4U7B A;  4LF9 K;  5GIP A;  4J8F A;  2F9W A;  4E7I A;  4UQG A;  3LP2 A;  3MN5 A;  4M3R A;  1T05 A;  1EO1 A;  2QK9 A;  3ZT2 A;  3TR8 A;  2O4I A;  5JS2 A;  2OCE A;  4CJV A;  5BN8 A;  1ASW A;  3LDL A;  4YOU A;  1YTA A;  1TUU A;  4DUZ K;  5AZI A;  5HRS A;  1KVA A;  2ZE2 A;  4E1M A;  4NLB A;  1OH7 A;  4FLX A;  3P39 A;  2KZZ A;  3TTD A;  4BWM A;  3R1X A;  3SNN A;  4BDP A;  2NUB A;  4CHY A;  1KFS A;  5IT9 O;  3HI0 A;  1E3M A;  4O4G A;  4BR9 A;  4CZM A;  3HP6 A;  4BRF A;  3OYF A;  4CEQ A;  4NCA A;  1JLC A;  3VQ4 A;  1T3V A;  5AQF A;  4B9M A;  3DLH A;  5AQP A;  3SMS A;  4C1N K;  3DOK A;  4KRE A;  1HRH A;  5AFU H;  2Q97 A;  4G1Q A;  4CF0 A;  3ENH A;  3C6T A;  3O1W A;  4FPA A;  4HWI A;  1W9H A;  4BG8 A;  1REV A;  4ISF A;  1DGK N;  5EOY A;  4BRE A;  4IJA A;  3C95 A;  5IWA K;  1U6Z A;  4Z4C A;  4CF1 A;  2ZJQ L;  5M1O A;  4CZH A;  1S9G A;  3H08 A;  2PBD A;  2HF3 A;  3D6R A;  3U9D A;  2G8F A;  1JCG A;  2HHX A;  1Y64 A;  5GAD P;  4HUE A;  1C1A A;  1VSD A;  1LV5 A;  4CJF A;  4CES A;  3OA9 A;  3W3D A;  4CEC A;  2GEM A;  3FE1 A;  4A57 A;  1QSL A;  3CCU N;  2D0P A;  4HCB A;  5C12 A;  1NOY A;  4Z4H A;  4GV6 A;  4CK2 A;  4M3U A;  4DV7 K;  4CER A;  4EZ9 A;  3DXK A;  5AQI A;  2E2O A;  3K9J A;  3NGZ A;  3V4I A;  3OYJ A;  4A62 A;  4FZY A;  2VWB A;  3KKS A;  4DU1 A;  3VA3 A;  1WN7 A;  4BQZ A;  3SMP A;  1NKB A;  3A8Y A;  4JKG A;  1QQM A;  4CD3 A;  4A2B A;  2HNY A;  4KKO A;  2D0A A;  1JXB A;  3AVI A;  1T8E A;  4DTN A;  4E1J A;  4CFA A;  2YHX A;  3GOI A;  4MQ3 A;  1T44 A;  4Y0W A;  1J6Z A;  3TAQ A;  1NK4 A;  3LP3 A;  4PKG A;  4DSK A;  4BE0 A;  4CEO A;  4PY5 A;  3VQA A;  2HBJ A;  3HL8 A;  4DTR A;  2HVI A;  2XY5 A;  3C6U A;  1VQ4 N;  4O8K A;  3NH0 A;  1B92 A;  3OS0 A;  4C8O A;  3AVH A;  1L3T A;  1QSS A;  3ITH A;  5EVZ A;  5J1E A;  3DLK A;  3U3G A;  1IJJ A;  1X1P A;  5DMR A;  4E89 A;  4OKE A;  3ID8 A;  4AH9 A;  1IKY A;  4BRO A;  1TKX A;  3AY9 A;  2GUI A;  1IKV A;  3P83 D;  4YDU A;  4A5B A;  3PV8 A;  4DTJ A;  4FVM A;  4CJU A;  3BF1 A;  4FLT A;  4WQ5 A;  3V9W A;  3IS9 A;  4NCG A;  3A2F A;  3AVN A;  4GV3 A;  1HYS A;  1ZBF A;  1VQO N;  2E20 A;  5FPM A;  4JEP A;  4E19 A;  4CF2 A;  2NRR A;  3HOS A;  1GLA G;  2KFN A;  1X9J A;  3THW B;  1ATN A;  2I7N A;  4LC9 B;  3KK7 A;  4YOT A;  4AHS A;  3G6E N;  1Q7Y O;  3CFP A;  1NGI A;  3HK2 A;  4H5T A;  1N6Q A;  1RBR A;  1FXX A;  3VGK A;  1ZBU A;  4IDH A;  1S1U A;  2XRI A;  1F21 A;  1S6P A;  4X64 K;  4I6M B;  1HNX K;  3QER A;  2D4W A;  3ZSZ A;  1HR0 K;  2IVN A;  3VEN A;  4H4M A;  4RTF D;  2H3G X;  3OYD A;  5BRF A;  4BRI A;  4FYD A;  1BQN A;  5BRD A;  1ZBH A;  2FC0 A;  3CD6 N;  4JI8 K;  3BGR A;  5CR4 A;  3KLG A;  4I7F A;  1FW6 A;  4KAZ A;  3BF3 A;  3D2F A;  1C6V A;  3CFR A;  1K8K B;  1TK8 A;  1QQN A;  2FLO A;  3SQ4 A;  4NXM K;  4KTW A;  3PIP L;  3WNF A;  1EET A;  3C65 A;  1D9F A;  3SBG A;  3CPW M;  4BR0 A;  1LOT B;  3AO3 A;  1SKR A;  2YJF A;  3QNN A;  3G71 N;  3OYM A;  4B3S K;  1DLO A;  1QVG M;  3O6W A;  4OKJ A;  4DQQ A;  4JN4 A;  3I33 A;  4C8M A;  3VQ8 A;  3QET A;  3HYF A;  2D0B A;  3U9Z A;  1N8R O;  3PSI A;  1NGG A;  1EP4 A;  4AM7 A;  1BWF O;  1JLF A;  2CH6 A;  5HP1 A;  2P9S B;  3L2V A;  2D5R A;  1FK9 A;  3AGK A;  3GBT A;  2A40 A;  1RTJ A;  3C0B A;  4CBX A;  3WUH A;  4FK0 A;  3KVG A;  1GLL O;  4JKC A;  4GKK K;  4JK7 A;  1WNS A;  3HZ6 A;  4FOE A;  1LWF A;  3T1H K;  4OPJ A;  2P9N A;  4G9Z A;  4OPK A;  1SKW A;  5EY4 A;  4BR4 A;  4IBN A;  4B8C A;  3D45 A;  4GNI A;  3DAW A;  1Q8I A;  3WNG A;  3BZC A;  1Q9X A;  4DR6 K;  4E1N A;  4DTM A;  2O8F B;  3MEG A;  2P9K B;  5BRE A;  3O9Q A;  2GV9 A;  5AJ3 K;  4FK2 A;  1VQM N;  3JYT A;  4KI4 A;  3MXM A;  1BIS A;  3VQ5 A;  3WEE B;  4F2S A;  1BI4 B;  5CZ1 A;  2UUC K;  4A61 A;  3O3F A;  4BVP A;  3OYN A;  3V9S A;  3QEV A;  1KSP A;  3FZL A;  2F9T A;  4YNQ A;  3KWG A;  4NYN A;  2O8E B;  3SPZ A;  2RPI A;  1Q18 A;  4IDK A;  4KB1 A;  2O8B B;  4DSF A;  4CGJ A;  3G25 A;  3CCQ N;  1M90 O;  3HT3 A;  1YJW N;  5FRN A;  1YAG A;  4YOW A;  5HL7 L;  4CD1 A;  2IS3 A;  4AM6 A;  5KQD A;  4H5W A;  4CIE A;  1CXU A;  4B9V A;  4BRM A;  4ILH A;  3NE6 A;  5JIC A;  4KTZ A;  3ID6 A;  1BA0 A;  4WQ4 A;  3C6A A;  4CIF A;  4EHT A;  4DTP A;  1CZA N;  1VRT A;  3KIO A;  3LAK A;  1E4G T;  1NK0 A;  3K5O A;  2PY5 A;  4BC4 A;  4CZG A;  3DRP A;  5LMU K;  4OO1 J;  4JD2 B;  1ZYQ A;  2YX6 A;  3GL1 A;  4FJN A;  1YF5 L;  3O9U A;  4I9L A;  4KHS A;  3ENB A;  3QES A;  4JRP A;  1N33 K;  1NLV A;  2E88 A;  1VHX A;  4DSI A;  5JS1 A;  3CCV N;  3KLI A;  4DFM A;  4ELU A;  4FOI A;  4H0Y B;  1YHQ N;  4Y1C A;  4BRD A;  4KPY A;  4OGE A;  4XH1 A;  1M1K O;  4AHC A;  1NJY A;  2YV0 X;  1WSG A;  1RDD A;  4LY7 A;  2E8A A;  2AJQ A;  2P9P A;  5BPN A;  3Q7B A;  4OVL A;  3E1Y A;  2HHT A;  4CJL A;  1RBS A;  1QS4 A;  1UWB A;  4JHD A;  3L2Q A;  4J2B A;  2ITG A;  4JKA A;  5T7B A;  5AZJ B;  3PO4 A;  2D1K A;  1NNE A;  5AQM A;  2PFU A;  2GX9 A;  4JKE A;  5BRH A;  1K9M O;  4KBO A;  1ZBL A;  3TAG A;  3D2E A;  5HLF A;  4F3O A;  3O1B A;  3WT0 A;  4GVE A;  1LW2 A;  2UUB K;  3H45 C;  3UKU A;  3VQ7 A;  4A2A A;  2YNG A;  5J2P A;  3SUO A;  5C24 A;  1XC3 A;  4O44 A;  3VEO A;  4I9Q A;  4V19 S;  3ZLJ A;  1GLF O;  1VSI A;  4IG3 A;  2KFZ A;  1UOC A;  4XH4 A;  3BP8 A;  2HNZ A;  3ZSY A;  4Z4F A;  3CC4 N;  3WXL A;  1TV6 A;  2VG5 A;  2RKI A;  4QCL A;  2W6K A;  4YOV A;  3FR0 A;  3AVM A;  4Z0U A;  3HO1 A;  3L2W A;  1L3U A;  2Q3S A;  4LSN A;  1L3V A;  3TAR A;  3DRS A;  2E4L A;  3QIN A;  3L3V A;  4CF9 A;  3MCP A;  3LM9 A;  2P9U A;  3THV A;  4LFA K;  5KQ8 A;  2OPR A;  3EY1 A;  1J5E K;  2FF3 B;  1XC9 A;  3ZET A;  4FW1 A;  3HVR A;  1NGB A;  4CGD A;  2QA4 N;  2O8C A;  2BE2 A;  2ZQB A;  1NWK A;  1U48 A;  3ZSV A;  2AA4 A;  5F2R A;  3CQX A;  4ZTJ A;  4X66 K;  3TAM A;  4Q5V A;  5ADX H;  2G8H A;  4QS8 A;  4CEF A;  4DTO A;  4BGB A;  3ULE A;  3M1F A;  3MAQ A;  2O4G A;  5MLC Q;  1C0F A;  2FF6 A;  5C15 A;  5CE3 A;  5HRO A;  4IXC A;  5CZ2 A;  3SJH A;  3C7N A;  1NK9 A;  4FWS A;  3VQE A;  5CY4 A;  3U6F A;  1VAZ A;  4CEZ A;  1TAU A;  4W5T A;  1D9D A;  2A5X A;  5FDL A;  4K42 A;  1WSH A;  4KRF A;  1QHA A;  2KHO A;  5F0X A;  1N32 K;  1XMO K;  5KPZ A;  1B9D A;  4M45 A;  2E2Q A;  2FBV A;  4FM1 A;  1SUQ A;  3U4L A;  1I3A A;  3SQ2 A;  3M6G A;  2Z1J A;  4JLH A;  1GLE G;  2WON A;  4W5N A;  3CJB A;  2G8W A;  1FKP A;  1NGE A;  3H3O B;  1ZBI A;  1R59 O;  2QXF A;  4CZL A;  3SUN A;  2QKK A;  4C8L A;  4E7H A;  2IDO A;  1ZBS A;  3VGM A;  3QEI A;  2G8I A;  2ASP A;  2QWL A;  3AAR A;  1WOQ A;  2KLA A;  2ASO A;  5EX5 A;  4C8N A;  5GAH P;  2WBN A;  3T19 A;  2PZS A;  1TAQ A;  1RNH A;  3E9P A;  3RSE B;  4BRA A;  2YHB A;  4H5R A;  2A1S A;  3HVT A;  1K73 O;  1J54 A;  3L3U A;  3FZF A;  4B8A B;  1ATR A;  4YOR A;  4WF9 L;  4ELT A;  1YI2 N;  4F3T A;  4IG0 A;  4RCH A;  1EWR A;  1VSJ A;  5JVH L;  4AHU A;  3PX6 A;  1BO5 O;  3M8R A;  1VQ6 N;  1YTU A;  1NJI O;  1B9F A;  1ESV A;  4WE1 A;  3ZEU A;  1SS6 A;  2VG6 A;  1JXE A;  4KHN A;  4CEA A;  1IG9 A;  4B9S A;  2HND A;  3CCL N;  4DR7 K;  3BUZ B;  1IV0 A;  3N4Q A;  1VQK N;  3SI6 A;  1KCF A;  2JWL A;  3LWM A;  3H1V X;  4Z4I A;  5BR8 K;  3CCR N;  4DU3 A;  1LCU A;  3AVC A;  2KZM A;  3LP1 A;  3QB0 A;  3J7Z O;  1TYQ A;  2KW4 A;  2P9I A;  5AZI B;  3EKU A;  2VWK A;  4E7K A;  1BDG A;  3SAG A;  3QIO A;  3LDO A;  3P31 A;  4K43 A;  1HLU A;  1KC8 O;  1VQN N;  1NK8 A;  3F2K A;  3OBW A;  3EZW A;  1NMN A;  4JAX A;  4IZ9 A;  3DYA A;  2VGM A;  1DTT A;  3VES A;  4FM2 A;  4DQP A;  1OH6 A;  3K59 A;  4O0J A;  2XO7 A;  2IAJ A;  3NF9 A;  3R6M A;  1H1V A;  2UUA K;  4KHY A;  2WTU A;  2E6M A;  1NK5 A;  4W5R A;  3O4N A;  2AP1 A;  3QDK A;  4QAG A;  4CW7 B;  4BR5 A;  1UA1 A;  4JI0 K;  3AVK A;  4XH5 A;  1MDU B;  3C94 A;  4KHW A;  1ASU A;  3CJ1 A;  2P5G A;  3HM8 A;  1IKX A;  3JSM A;  2OYQ A;  1N34 K;  1OKJ A;  1W2B M;  4ZTF A;  3CFO A;  4FZZ A;  2GTD A;  1Y97 A;  3K5L A;  2LSN A;  4NYF A;  2BGG A;  3TTF A;  3TU5 A;  1HX1 A;  2BTF A;  1JCF A;  2V7Z A;  2CGL A;  1YT3 A;  3G10 A;  4EP4 A;  3K0S A;  3ENO A;  1KXP A;  3P38 A;  5DM7 L;  5M1Q A;  4DR1 K;  1JJ2 M;  1ILY A;  4IEI A;  3HSC A;  1GOB A;  2NNW A;  4RW8 A;  4DS4 A;  2CGK A;  4B08 A;  4N41 A;  1T03 A;  2PYJ A;  3BDP A;  4M7Y A;  4B1U B;  3R8E A;  2P9L A;  3ISN C;  4CEE A;  4PHT X;  4RWT A;  2HBK A;  3SLC A;  4F9O A;  1S1V A;  4DFJ A;  4JKG B;  4FJ8 A;  1E4F T;  3IDH A;  1KLM A;  2Y1J A;  4XIU A;  5C10 A;  2G8V A;  1KVC A;  5C2D A;  2HB5 A;  3ATU A;  5C25 A;  4FJ9 A;  4B9U A;  3L0Q A;  2Z1H A;  4DR5 K;  4XEI A;  3ZT3 A;  3J81 O;  3LDS A;  4FK4 A;  3SV4 A;  4O8U A;  3HPO A;  1XMQ K;  2DTU A;  3QEP A;  4CJT A;  2QW9 A;  3VEX A;  1NU0 A;  2D0O A;  3FGU A;  2CGJ A;  3H3N O;  4DQR A;  4CJK A;  3SYZ A;  1R0A A;  1WBB A;  4M3W A;  2QI2 A;  4YFU A;  4N5S A;  2ZJR L;  4BRL A;  4K8X A;  1VQ5 N;  1DT9 A;  1KAX A;  2Q0R A;  1I94 K;  4Z4G A;  4DG1 A;  4K8Z A;  1RCH A;  2Q0U A;  3MN6 A;  1QHT A;  3KLE A;  4CZE A;  1QTM A;  4FXD A;  3UKR A;  4GVM A;  4F2R A;  3HST B;  1G99 A;  3FZK A;  1ASV A;  3FZM A;  2NRW A;  4IEE A;  3PSF A;  4JKB A;  1D8Y A;  5AQK A;  1XHX A;  2NRT A;  2HHH K;  2OPP A;  2P1J A;  4FO0 A;  3WQU A;  3TWH A;  2VQE K;  4KFB A;  4FL9 A;  3CPE A;  1KRP A;  4CCH A;  4OJR A;  4FWO A;  4CJ4 A;  4GV9 A;  4DTS A;  4R5P A;  3LAN A;  1TKD A;  1SL1 A;  5JMV A;  4M7X A;  1FKO A;  3CER A;  1LAV A;  3NF6 A;  3ZT0 A;  5ELZ A;  3LM2 A;  3Q7C A;  2F96 A;  4GW6 A;  3AA2 A;  3FFK B;  2OZS A;  3J7A P;  4DSL A;  2XY8 A;  4DU4 A;  1S1W A;  1HYZ A;  3RWU A;  3D2F B;  1X9W A;  1RT6 A;  4CED A;  2F8T A;  1NGD A;  4OPH A;  1QQO A;  1T6D A;  5I9E B;  3HM9 A;  5BR9 A;  2G8U A;  1T6C A;  1TK0 A;  1W97 L;  3AO4 A;  2B4J A;  4JI6 K;  3EL2 A;  2RE2 A;  4DV2 K;  1O1W A;  3FFI A;  5AQQ A;  1NJW A;  3O3G A;  5E41 A;  2F8S A;  2QWR A;  2RF2 A;  3ZYY X;  3IAY A;  3NGY A;  1ITG A;  2YKM A;  4Q0B A;  3SJJ A;  1GOA A;  4W5O A;  3C6H A;  3ZCM A;  4HUG A;  2IGI A;  3LZJ A;  3T1A A;  4DQ8 A;  3HJF A;  1DEJ A;  4PUO A;  1KAZ A;  4EIA A;  4DV5 K;  3IRX A;  3KTQ A;  4GY2 B;  4M3T A;  4KH5 A;  4MLE A;  4BC2 A;  1XI1 A;  1SV5 A;  3SQ0 A;  5C0Y A;  4FWM A;  1BCM A;  3M8P A;  4CI6 A;  3L8B A;  3D7E O;  4NXN K;  2ZGY A;  1LWE A;  2P9S A;  3QIP A;  4CVN E;  4E0D A;  3B8A X;  3HOT A;  3PX0 A;  2OTL N;  5LJW A;  5AQV A;  3O9R A;  2P9N B;  5J2M A;  1JLB A;  4FVU A;  2ITM A;  1LW0 A;  3NBP A;  5AQZ A;  4B9T A;  3NVM A;  3THY A;  3QNO A;  1U04 A;  4H8K A;  3WXJ A;  4HUF A;  5M1N A;  4B3O A;  2ZGZ A;  4IFV A;  3W0L A;  1BCO A;  5AQU A;  1OVQ A;  4PL8 A;  2FXU A;  4OX9 K;  3WNE A;  3LWL A;  5AQS A;  2O8F A;  2VCP A;  1V4T A;  4CJR A;  2P9K A;  3DLL L;  3QO9 A;  1VSL A;  3VA0 A;  4CK1 A;  1YJ9 N;  5KPR A;  4DV0 K;  1VSM A;  3WEE A;  4H03 B;  2Q2R A;  4DV6 K;  3LDQ A;  1WSE A;  2IIR A;  1KQS M;  4E7J A;  3L2U A;  1RT5 A;  1ATS A;  2Z1G A;  1NKE A;  4FZX C;  2QXL A;  3IKM A;  1VSF A;  2HHW A;  2X6S A;  2W40 A;  2O8B A;  5KRT A;  3HTV A;  4DFK A;  3CM5 A;  3EKS A;  1WAJ A;  5GAE P;  3LZI A;  4F4K A;  2RN2 A;  3QFP A;  4PKH A;  1VRU A;  4LH4 A;  1MU2 A;  2KQ2 A;  5AFU A;  1KVB A;  3IMX A;  1TK5 A;  2FBY A;  3CXC M;  3SUQ A;  1RBT A;  3O80 A;  3SZ2 A;  1IBL K;  3SUP A;  2WC9 A;  5EU7 A;  2WUS A;  3IUC A;  3VGL A;  1NGF A;  5EXW A;  1X3M A;  4NCB A;  2IC3 A;  2QWO A;  4CHQ A;  2UYT A;  2HBM A;  1RDB A;  4K25 A;  2HW3 A;  4JRQ A;  1QE1 A;  3M3Z A;  4WFN L;  1KLN A;  3QLH A;  4ID5 A;  3MCA B;  4DQS A;  4H5N A;  1D5A A;  4MO5 A;  3P5J A;  4QS9 A;  2GBZ A;  3A5O C;  4F8R A;  4U67 L;  2YHW A;  5BPM A;  1Q86 O;  2WOM A;  3S41 A;  1RDW X;  2P9P B;  1U4B A;  5KRS A;  2DFF A;  5AQX A;  4JI4 K;  5FLX O;  4JHD B;  3CCS N;  1XNQ K;  1BIZ A;  1BG3 A;  2W41 A;  3H46 O;  4JNE A;  4JK8 A;  4YOX A;  5M1F A;  1RBU A;  5A2Q O;  3V1Q A;  4LF5 K;  4IFY A;  4DCH A;  1Q81 O;  2OPS A;  5KGW A;  4BWJ A;  2J4R A;  3ZSX A;  2IVO A;  3UKU B;  4X65 K;  5DM6 L;  3I8D A;  4YY3 K;  4HCC A;  4KV8 A;  1EQY A;  3OS1 A;  1RFQ A;  1QZ5 A;  5GIO A;  4O55 A;  3L6Q A;  4AF1 A;  1XHZ A;  1VQ7 N;  2EWS A;  4CJ7 A;  3LAM A;  4K41 A;  1RDC A;  1EKE A;  3KHY A;  1GOC A;  4M3X A;  4BE1 A;  1XQS C;  3WXK A;  3CJ7 A;  4HTU A;  4H4O A;  4BC3 A;  3AGR A;  1CLQ A;  3F9M A;  1RIL A;  1C0T A;  1N5Y A;  4BRC A;  3NGI A;  2V52 B;  4CIG A;  4IWV A;  1Z6R A;  3HPH A;  3NH1 A;  3THX A;  1VSE A;  3GE1 A;  4X62 K;  3DLR A;  1U2V A;  2E5L K;  1S1X A;  4J2A A;  4CGG A;  3ZET B;  3OW2 M;  3MMV A;  1MWM A;  5DK5 A;  3UB5 A;  5CHI A;  3CIP A;  5KI6 A;  1RT7 A;  4N47 A;  5KGX A;  1HNW K;  4AHR A;  4BRQ A;  5HRP A;  3V9U A;  5E26 A;  4JS5 A;  3LPT A;  3V6D A;  4KO0 A;  1IKW A;  3L4Q A;  3DI6 A;  2V7Y A;  4QS7 A;  3RR7 A;  2OAN A;  2HST A;  4Y1D A;  3NDK A;  3QEX A;  3ULE B;  3O5B A;  4LFC K;  1XNR K;  1QQC A;  1CZ9 A;  4FSV A;  4MDB A;  1FJG K;  3AVL A;  4KHP K;  2HHU A;  2VYP A;  3V1O A;  5AQL A;  1JL1 A;  4B3M K;  3EN9 A;  3OTO K;  4FLU A;  4DTX A;  1G15 A;  1J5O A;  3TPQ A;  1HMV A;  3E9L A;  5AQR A;  4BRN A;  4LF8 K;  3AAQ A;  4UY8 O;  3I0S A;  3ZSQ A;  3NFA A;  4CHP A;  4FWL A;  5CYM A;  4B3R K;  3AAP A;  2ASM A;  4HVJ A;  3OYH A;  3TAN A;  3LPU A;  4JI5 K;  4BR2 A;  4CZI A;  1Z26 A;  4YHH K;  4DF8 A;  3U8X A;  4KI6 A;  4AIL C;  2E6L A;  3RMC A;  3NVK A;  2QWQ A;  2O8D A;  3TTC A;  3VF6 A;  3ASM A;  3OS2 A;  1HJO A;  1L5U A;  2E2N A;  3DXM A;  2HHS A;  4LF7 K;  4NO7 A;  3IFR A;  1ZC6 A;  1S5J A;  1YIT N;  4Z4E A;  4WFA L;  5AQN A;  4JK9 A;  5CYQ A;  1N36 K;  5BN9 A;  4BRH A;  3F9K A;  4LH5 A;  5GIN A;  3T3F A;  1SL0 A;  4JKF A;  2P51 A;  5AQW A;  4B9Q A;  1HPM A;  4MLH A;  3PX4 A;  4L8R B;  4FJM A;  3EE9 A;  1ZXO A;  1GLC G;  2YHY A;  1NGH A;  3ZT4 A;  4QOZ B;  3MEE A;  4K0K K;  1TKZ A;  2HOE A;  2NRH A;  1A5X A;  1NBW A;  4RG8 A;  3KJV A;  3OYA A;  4OKK A;  4CJE A;  3MXI A;  4PKI A;  3HRG A;  3CJA A;  4WFB L;  4JI7 K;  3KLH A;  2VWJ A;  4MFB A;  2OA8 A;  1LAW A;  4FJL A;  3ZEU B;  1YUW A;  4MDA A;  5JLF A;  3NHG A;  4RW4 A;  1U49 A;  2YI1 A;  3WQT A;  5J2N A;  1Z05 A;  1X9M A;  4JS4 A;  3OYG A;  3A5L C;  3ZSO A;  1XUP O;  4CHZ A;  3FZH A;  4IOA L;  4FJ5 A;  2VQF K;  3ALY A;  1S1T A;  3AVB A;  3ZX3 A;  3MX2 A;  2QM1 A;  4H0P A;  3KK3 A;  2W6L A;  2FSJ A;  1O13 A;  3OYC A;  1TYQ B;  3ATV A;  4JYA K;  2P9I B;  2VGN A;  2FBT A;  3F5T A;  3GG4 A;  1K6Y A;  2BDP A;  4H5V A;  2QWM A;  1YIJ N;  2PAV A;  4FJJ A;  2IOC A;  3TSU A;  4M42 A;  1BQM A;  4M63 C;  1JL2 A;  1DKG D;  1Q9Y A;  1A5W A;  3I55 N;  3CF5 L;  2A41 A;  3KZB A;  1HNV A;  5M1P A;  4RW9 A;  3SBT A;  4BRK A;  4EFH A;  4JI3 K;  3BEX A;  2E2P A;  3B6P A;  3QML A;  4GKJ K;  5AQO A;  1RTD A;  2HF4 A;  3L4I A;  3CYM A;  4C8K A;  2YNH A;  5LJV A;  3KD5 E;  4B1X B;  2HMP A;  3OYL A;  2HBL A;  3MWP A;  1JLQ A;  3F73 A;  3RRG A;  3P1G A;  3A0I X;  4M3Z A;  3EZ5 A;  4FJK A;  3VTH A;  3OY9 A;  5D3G A;  2UU9 K;  3SCX A;  4ISE A;  3DXK B;  4IJN A;  3MN7 A;  4FLZ A;  1HNZ K;  2R7Y A;  3VQQ A;  4FJ7 A;  3O4W A;  1X9S A;  1BU6 O;  2XY6 A;  4J2E A;  1TKT A;  3QFU A;  3CHW A;  1JCE A;  2UXD K;  1HKB A;  1KAY A;  3LDP A;  2P9L B;  2B6A A;  1WB9 A;  4CZK A;  3VEW A;  4DV3 K;  1OH8 A;  4LSL A;  3MXJ A;  4FW2 A;  4DR2 K;  3EE8 A;  1IO2 A;  4B1Y B;  2DFE A;  1SKS A;  1BL3 A;  1C0U A;  3VF4 A;  1HNI A;  4ISG A;  2NRX A;  4B1V A;  1TVR A;  1C1B A;  2A42 A;  3DWL A;  5FRO A;  1RT2 A;  1S6Q A;  2OZM A;  4M41 A;  1SL2 A;  5AQT A;  1RT3 A;  2A3Z A;  4FLY A;  4CE9 A;  1JLG A;  4CGH A;  2ATQ A;  5I42 A;  2KKZ A;  4BY9 C;  4CHO A;  3RMD A;  2ZM6 K;  4FLV A;  3ZX2 A;  3ZT1 A;  3DOL A;  4OLA A;  1RGI A;  1KD1 O;  1A5V A;  3QIC A;  3RR8 A;  1TUY A;  4BGA A;  3BY5 A;  4CZF A;  2ZWH A;  4B1Z A;  4BVO A;  4KHQ A;  2X78 A;  1IG8 A;  3AVJ A;  3VMF B;  1RTH A;  1CZB A;  3DLG A;  1VQP N;  2DPN A;  3J80 O;  3UKR B;  2QWP A;  3CME N;  4WCE L;  1QVF M;  2YCH A;  4FJG A;  5ADX A;  4CBW A;  3NCI A;  3THW A;  4JV5 K;  4B3T K;  3J7Y P;  1NMD A;  3U3Y A;  1WBD A;  3ZX0 A;  1SAZ A;  4Z94 A;  3M8Q A;  4E7L A;  3RTV A;  4FJI A;  2B5J A;  2E1Z A;  4W5Q A;  3WNH A;  3HBT A;  4I6M A;  4BDZ A;  4IOX A;  5C2F A;  1RBV A;  3MN9 A;  4WYB A;  4CJP A;  4KTQ A;  3CCM N;  3P4I A;  3VER A;  2GUP A;  3N4P A;  4DSE A;  4CGI A;  4ICL A;  3CMA N;  1X3N A;  4RW6 A;  3H6E A;  4CGF A;  3MX5 A;  1K8K A;  1W7A A;  3AO5 A;  5TKW A;  3LL3 A;  3AVF A;  3DMJ A;  3T69 A;  4EZ6 A;  2UXC K;  3KLF A;  3MED A;  1NGC A;  5F1X A;  2JGU A;  1NJZ A;  3K58 A;  5FPE A;  4DF4 A;  3PO5 A;  1NK6 A;  1JKH A;  4YDU C;  3CJC A;  4DR3 K;  2Z1I A;  1HUX A;  1WUA A;  5I3U A;  4WQ5 C;  2X74 A;  3O8M A;  3V1R A;  2BUP A;  3V9X A;  4DV4 K;  3HXM A;  3AVA A;  2KTQ A;  1Z25 A;  2HMI A;  3QEW A;  1VSH A;  1C0G A;  3G0Z A;  1HJR A;  2WFB A;  3I8B A;  4CF8 A;  3VTI A;  2V51 B;  3NH2 A;  4OPA A;  4ID1 A;  3VQD A;  1NOZ A;  2ZF5 O;  1TL1 A;  4IO9 L;  4FPB A;  3TSQ A;  3SK3 A;  4H0T B;  3NMU A;  4CJS A;  1J9A A;  5FRM A;  3BZK A;  3LAL A;  5AQH A;  4DMN A;  3RRH A;  2G8K A;  5HBM A;  4ZHR A;  4DTU A;  3VQP A;  4FWK A;  4CFD A;  2HHV A;  1J53 A;  1BA1 A;  5AR0 A;  4PA1 A;  4L3Q A;  3THY B;  4FWP A;  4N56 A;  4I2Q A;  4DKW A;  4MO4 A;  4OLB A;  4A59 A;  4JKH A;  4FWN A;  4CJQ A;  4N76 A;  2QEX N;  3NF7 A;  3CC2 N;  2YHA A;  1UA0 A;  2YNI A;  1TL3 A;  2CH5 A;  2YKN A;  1W0H A;  1IBM K;  4EHU A;  5KTQ A;  3PUF A;  1MA9 B;  3UIQ A;  3CQY A;  3VQ6 A;  3SV3 A;  3RMB A;  3KK1 A;  4DUY K;  1BI4 A;  3RVC A;  4KB0 A;  2W42 A;  3KKR A;  2GWK A;  1JLE A;  3D0P A;  1D4X A;  3R3L A;  3S9H A;  2O8E A;  3CCJ N;  3CG7 A;  3A5M C;  2NRV A;  3OYE A;  4DFP A;  1VQ9 N;  2F7T A;  4DHY A;  3M8S A;  2HVH A;  5FPN A; 
#chains in the Genus database with same CATH homology
 2KFN A;  1IKW A;  4J2D A;  1NK8 A;  2BAN A;  4AHV A;  4CJW A;  3DI6 A;  3NAE A;  3RR7 A;  3DYA A;  4AHS A;  4CFC A;  4PQU A;  1DTT A;  3CFP A;  4FM2 A;  4Y1D A;  3S3M A;  3NDK A;  3ULD A;  3QEX A;  4DQP A;  3TI0 A;  3HK2 A;  3K59 A;  1RBR A;  1N6Q A;  4O0J A;  1FXX A;  3HP9 A;  1BGX T;  1ZBU A;  2IAJ A;  3NF9 A;  2XO7 A;  4ELV A;  3V81 A;  1QQC A;  1CZ9 A;  1U45 A;  3AVG A;  1KTQ A;  1S1U A;  4KHY A;  3AVL A;  3SQ1 A;  2E6M A;  2HHU A;  3V1O A;  1RTI A;  1F21 A;  2XRI A;  4E3S A;  1NJX A;  1JL1 A;  1S6P A;  3O4N A;  4W5R A;  1NK5 A;  1T7P A;  4QAG A;  3I0R A;  4AHT A;  3AA5 X;  3OYK A;  5HRN A;  3ZSW A;  4FLU A;  3QER A;  1UA1 A;  3ZSZ A;  4DTX A;  1G15 A;  4H4M A;  3AVK A;  1J5O A;  3OYD A;  3C94 A;  4KHW A;  3AA4 A;  4FYD A;  1HMV A;  1ASU A;  2D0C A;  1BQN A;  2XY7 A;  2P5G A;  2FC0 A;  1ZBH A;  1QSY A;  1TGO A;  1IKX A;  3JSM A;  2OYQ A;  4DQI A;  3BGR A;  3KLG A;  4ZTF A;  4I7F A;  3CFO A;  4KAZ A;  4FZZ A;  1WSJ A;  3I0S A;  3ZSQ A;  1C6V A;  1Y97 A;  3NFA A;  3OVN A;  4CHP A;  3K5L A;  5CYM A;  2LSN A;  3CFR A;  4NYF A;  2BGG A;  1TK8 A;  3SQ4 A;  1NK7 A;  4CEB A;  4HVJ A;  1DTQ A;  3ZSR A;  3LPU A;  3OYH A;  3TAN A;  4KTW A;  4DLG A;  3RMA A;  3WNF A;  1EXQ A;  1EET A;  1D9F A;  1YT3 A;  1Z26 A;  3G10 A;  4EP4 A;  4DF8 A;  1I39 A;  4KI6 A;  4AIL C;  2E6L A;  3AO3 A;  3RMC A;  1SKR A;  3O3H A;  1RT4 A;  3QNN A;  3DLE A;  3OYM A;  3VN5 A;  1L3S A;  3ASM A;  3OS2 A;  1L5U A;  2HHS A;  1DLO A;  1GOB A;  4RW8 A;  4OKJ A;  4FJX A;  4DQQ A;  4BE2 A;  1S5J A;  4DS4 A;  4B08 A;  4N41 A;  1T03 A;  2PYJ A;  4C8M A;  3BDP A;  3VQ8 A;  3QET A;  3HYF A;  2D0B A;  4Z4E A;  4FLW A;  1XWL A;  4FCY A;  3AO2 A;  4CJ5 A;  3ISN C;  5CYQ A;  4CEE A;  4FM0 A;  1EP4 A;  1S1V A;  3F9K A;  4LH5 A;  3T3F A;  4DFJ A;  4B9N A;  1SL0 A;  4FJH A;  1JLF A;  4FJ8 A;  5HP1 A;  1KLM A;  2P51 A;  2Y1J A;  4XIU A;  3L2V A;  2D5R A;  1FK9 A;  3DLB A;  4O0I A;  3PX4 A;  4L8R B;  5SWM A;  1KVC A;  4GMJ B;  2G8V A;  4FJM A;  1RTJ A;  4OGC A;  1BHL A;  4FK0 A;  2HB5 A;  5SZT A;  5C25 A;  4FJ9 A;  4B9U A;  4QOZ B;  3ZT4 A;  1WNS A;  3MEE A;  1TKZ A;  2Z1H A;  1A5X A;  1LWF A;  3MEC A;  4RG8 A;  3KJV A;  2EX3 A;  4EP5 A;  4OPJ A;  2A1R A;  3OYA A;  4OKK A;  4CJE A;  4OPK A;  4DLE A;  3MXI A;  1WSF A;  3ZT3 A;  4O5B A;  1UAX A;  2PYL A;  1SKW A;  3LDS A;  4FK4 A;  4IBN A;  3SV4 A;  3KLH A;  4B8C A;  3HPO A;  2VWJ A;  3D45 A;  4MFB A;  3EYZ A;  2DTU A;  3VQB A;  2OA8 A;  1LAW A;  4FJL A;  1Q8I A;  2I5J A;  3QEP A;  3WNG A;  4CJT A;  4HHT A;  3CM6 A;  3HPG A;  4TSX A;  1Q9X A;  3E01 A;  4E1N A;  4DTM A;  3TAF A;  3NHG A;  4RW4 A;  3MEG A;  1U49 A;  1WLJ A;  4DQR A;  3LP0 A;  3OYB A;  5J2N A;  2GV9 A;  4DWI A;  1X9M A;  4CJK A;  3SYZ A;  1R0A A;  4FK2 A;  3JYT A;  4M3W A;  4JS4 A;  3DRR A;  3OYG A;  4KI4 A;  3ZSO A;  4YFU A;  1BIS A;  1HPZ A;  3MXM A;  4CHZ A;  3VQ5 A;  4N5S A;  3OYI A;  3B6O A;  4FJ5 A;  1YVU A;  4M3Y A;  4K8X A;  4F2S A;  1BI4 B;  5CZ1 A;  3O3F A;  3ALY A;  1S1T A;  3OYN A;  3V9S A;  4DG1 A;  4I2P A;  3AVB A;  3QEV A;  4K8Z A;  1RCH A;  4Z4G A;  1KSP A;  3TAB A;  4YNQ A;  4NYN A;  1QHT A;  3KLE A;  1BIU A;  3KK3 A;  4BAC A;  1QTM A;  3OYC A;  4FXD A;  3SPZ A;  2RPI A;  4IDK A;  2FBT A;  4GVM A;  2Y1I A;  4KB1 A;  4F2R A;  3HST B;  3V9Z A;  1K6Y A;  4CGJ A;  3K57 A;  4DSF A;  2P5O A;  1ASV A;  1IH7 A;  2EHG A;  3HT3 A;  2BDP A;  3S3O A;  3K5N A;  1D8Y A;  5FRN A;  3NF8 A;  1XHX A;  4CHN A;  2IS3 A;  4FJJ A;  2IOC A;  2VG7 A;  3L2R A;  1BQM A;  4CIE A;  4M42 A;  1CXU A;  1RDA A;  4B9V A;  2OPP A;  1JL2 A;  3NE6 A;  2P1J A;  3PY8 A;  1Q9Y A;  2ETJ A;  1A5W A;  4KTZ A;  3TWH A;  1LWC A;  4KFB A;  1KRP A;  1HNV A;  4LD0 A;  4CCH A;  4RW9 A;  4CIF A;  4OJR A;  4DTP A;  4CJ4 A;  3B6P A;  1VRT A;  5HRR A;  4DTS A;  3KIO A;  1KFD A;  1RT1 A;  1VSK A;  3LAN A;  4R5P A;  4DS5 A;  1SL1 A;  1TKD A;  4B9L A;  3DM2 A;  1FKO A;  3TAE A;  3LAK A;  1NK0 A;  1LAV A;  3K2P A;  3K5O A;  1U47 A;  2ZD1 A;  2PY5 A;  2DY4 A;  3DRP A;  3NF6 A;  4PWD A;  1RTD A;  3ZT0 A;  1ZYQ A;  3CYM A;  2F96 A;  4GW6 A;  4FJN A;  3AA2 A;  2OZS A;  4C8K A;  4DSL A;  4I9L A;  2YNH A;  3AV9 A;  2X6N A;  3TAP A;  4KHS A;  3KD5 E;  3QES A;  2XY8 A;  3OYL A;  4JRP A;  4DU4 A;  1JLQ A;  1S1W A;  1HYZ A;  3RWU A;  3F73 A;  3RRG A;  3O4Q A;  1HQE A;  1X9W A;  1RT6 A;  4DSI A;  3P1G A;  4CED A;  1VK0 A;  1HYV A;  2F8T A;  5JS1 A;  3KLI A;  5C42 A;  2XHB A;  4DFM A;  4ELU A;  3EZ5 A;  4M3Z A;  4FJK A;  3CQ8 A;  4Y1C A;  3HM9 A;  4KPY A;  2G8U A;  3OY9 A;  2JLE A;  5D3G A;  1TK0 A;  1EX4 A;  1HQU A;  3AO4 A;  2B4J A;  4OGE A;  4AHC A;  3SCX A;  4KHU A;  1TAU A;  1NJY A;  4CFB A;  2YV0 X;  1WSG A;  4IKF A;  1RDD A;  1O1W A;  3FFI A;  4FLZ A;  4LY7 A;  2AJQ A;  1NJW A;  3O3G A;  5E41 A;  3VQQ A;  1CXQ A;  2OPQ A;  2R7Y A;  4BDY A;  4FJ7 A;  3IAY A;  2RF2 A;  2YNF A;  2F8S A;  3NGY A;  1ITG A;  4OVL A;  1X9S A;  2YKM A;  2XY6 A;  3SJJ A;  1GOA A;  4J2E A;  1TKT A;  4Q0B A;  4W5O A;  5J2Q A;  3S3N A;  2FBX A;  3ZCM A;  4CJL A;  4HUG A;  1RBS A;  1QS4 A;  1UWB A;  2IGI A;  3L2Q A;  4J2B A;  3LZJ A;  2ITG A;  3OJU A;  3T1A A;  3HJF A;  4PUO A;  2QKB A;  5T7B A;  3PO4 A;  3VQC A;  3IRX A;  1WSI A;  3KTQ A;  2B6A A;  4M3T A;  4DSJ A;  3AA3 A;  1XI1 A;  1SV5 A;  1JLA A;  3SQ0 A;  3KD1 E;  1C1C A;  1BCM A;  3M8P A;  4RW7 A;  4LSL A;  3MXJ A;  4FW2 A;  5K14 A;  3L8B A;  1ZBL A;  1IO2 A;  3TAG A;  2DFE A;  1LWE A;  5HLF A;  3QIP A;  1BL3 A;  3SPY A;  1SKS A;  4F3O A;  1C0U A;  4E0D A;  1HNI A;  1LW2 A;  3PX0 A;  1TVR A;  2HW3 A;  1C1B A;  3K5M A;  3VQ7 A;  3IG1 A;  5FRO A;  1RT2 A;  1S6Q A;  1WAF A;  2OZM A;  2YNG A;  5J2P A;  3KK2 A;  5J2M A;  3SUO A;  3AO1 A;  1JLB A;  5C24 A;  4M41 A;  3OJS A;  1SL2 A;  4I9Q A;  4O44 A;  4CJ3 A;  1LW0 A;  1C0M A;  3NBP A;  1RT3 A;  1VSI A;  4IG3 A;  4B9T A;  2KFZ A;  1UOC A;  3QNO A;  3VQ9 A;  4FLY A;  4CK3 A;  4CE9 A;  1JLG A;  2HNZ A;  2ATQ A;  3ZSY A;  4CGH A;  1U04 A;  5I42 A;  1NKC A;  4H8K A;  4Z4F A;  4CHO A;  2HHQ A;  1TV6 A;  2VG5 A;  2RKI A;  4HUF A;  4QCL A;  3RMD A;  1S9E A;  4FLV A;  2DFH A;  3AVM A;  4Z0U A;  3ZT1 A;  3DOL A;  4B3O A;  3HO1 A;  4OLA A;  3L2W A;  4IFV A;  1L3U A;  1BCO A;  2Q3S A;  1A5V A;  3RR8 A;  4LSN A;  1L3V A;  3TAR A;  4E7I A;  4UQG A;  3DRS A;  2E4L A;  3WNE A;  3LP2 A;  3QIN A;  4M3R A;  3L3V A;  3LWL A;  4CJR A;  4CF9 A;  3ZT2 A;  1T05 A;  2QK9 A;  3THV A;  3QO9 A;  1VSL A;  3VA0 A;  3TR8 A;  2OPR A;  3EY1 A;  4KHQ A;  2X78 A;  1XC9 A;  5JS2 A;  4CJV A;  2O4I A;  4FW1 A;  1ASW A;  4CK1 A;  3AVJ A;  1VSM A;  3HVR A;  1RTH A;  4CGD A;  1YTA A;  1CZB A;  1WSE A;  3DLG A;  5HRS A;  4E7J A;  1KVA A;  2BE2 A;  2ZQB A;  3L2U A;  2ZE2 A;  1RT5 A;  1U48 A;  4E1M A;  3ZSV A;  2Z1G A;  1NKE A;  4FLX A;  4FZX C;  4FJG A;  1VSF A;  3NCI A;  2HHW A;  4ZTJ A;  2KZZ A;  2X6S A;  4BWM A;  4BDP A;  3SNN A;  2NUB A;  4CHY A;  1KFS A;  5KRT A;  3TAM A;  4Q5V A;  4DFK A;  2G8H A;  3CM5 A;  4DTO A;  4CEF A;  3U3Y A;  4O4G A;  3HP6 A;  1WAJ A;  3OYF A;  3LZI A;  4CEQ A;  4NCA A;  1JLC A;  3M8Q A;  3VQ4 A;  3MAQ A;  2O4G A;  4F4K A;  2RN2 A;  4E7L A;  3RTV A;  4B9M A;  1VRU A;  4LH4 A;  1MU2 A;  5HRO A;  2KQ2 A;  3DLH A;  4FJI A;  5CZ2 A;  1KVB A;  2B5J A;  3DOK A;  1NK9 A;  1TK5 A;  4KRE A;  2FBY A;  1HRH A;  4W5Q A;  3SUQ A;  1RBT A;  3WNH A;  4G1Q A;  3VQE A;  4CF0 A;  4BDZ A;  5CY4 A;  3SZ2 A;  3U6F A;  1RBV A;  3SUP A;  3C6T A;  5EU7 A;  4CEZ A;  4W5T A;  2HHT A;  1W9H A;  4CJP A;  1REV A;  1D9D A;  4KTQ A;  5FDL A;  3C95 A;  1WSH A;  4KRF A;  4Z4C A;  4CF1 A;  4DSE A;  4NCB A;  4CGI A;  4ICL A;  2IC3 A;  1S9G A;  4CHQ A;  4RW6 A;  3H08 A;  1B9D A;  4M45 A;  2G8F A;  4CGF A;  2HHX A;  1RDB A;  2FBV A;  4HUE A;  4FM1 A;  4JRQ A;  1QE1 A;  1C1A A;  1SUQ A;  1KLN A;  3AO5 A;  3SQ2 A;  1I3A A;  1VSD A;  3AVF A;  3DMJ A;  1LV5 A;  3QLH A;  2Z1J A;  4JLH A;  4EZ6 A;  4CJF A;  3KLF A;  4ID5 A;  4CES A;  4DQS A;  2WON A;  4W5N A;  1D5A A;  4CEC A;  2G8W A;  1FKP A;  3MED A;  1ZBI A;  3P5J A;  2JGU A;  1QSL A;  2GBZ A;  4F8R A;  2QXF A;  1NJZ A;  3K58 A;  3SUN A;  2QKK A;  4DF4 A;  3PO5 A;  1NK6 A;  1NOY A;  4C8L A;  1JKH A;  4E7H A;  2IDO A;  4HCB A;  4Z4H A;  2Z1I A;  2WOM A;  4CK2 A;  3QEI A;  4M3U A;  2G8I A;  5I3U A;  4CER A;  2X74 A;  3V1R A;  3V9X A;  1U4B A;  4EZ9 A;  3HXM A;  5KRS A;  2DFF A;  3AVA A;  4C8N A;  2KTQ A;  1Z25 A;  3T19 A;  3NGZ A;  3V4I A;  3OYJ A;  2HMI A;  3QEW A;  1VSH A;  4FZY A;  2PZS A;  3KKS A;  1TAQ A;  4DU1 A;  1RNH A;  3G0Z A;  3VA3 A;  1HJR A;  1BIZ A;  4CF8 A;  1WN7 A;  3NH2 A;  2YHB A;  4ID1 A;  1NKB A;  3VQD A;  2A1S A;  1NOZ A;  3HVT A;  1TL1 A;  1J54 A;  3L3U A;  1RBU A;  2HNY A;  4KKO A;  3V1Q A;  2D0A A;  4CJS A;  4B8A B;  1J9A A;  5FRM A;  1JXB A;  3AVI A;  1T8E A;  3LAL A;  4IFY A;  4DTN A;  2OPS A;  5KGW A;  4ELT A;  4CFA A;  4DMN A;  3RRH A;  2G8K A;  4MQ3 A;  4BWJ A;  3ZSX A;  5HBM A;  4ZHR A;  4DTU A;  3TAQ A;  1NK4 A;  3LP3 A;  4F3T A;  4IG0 A;  3I8D A;  4HCC A;  4KV8 A;  3VQP A;  3OS1 A;  4CEO A;  1VSJ A;  4BE0 A;  4CFD A;  4AHU A;  4DSK A;  4PY5 A;  3VQA A;  3HL8 A;  4DTR A;  2HVI A;  2HHV A;  1J53 A;  3PX6 A;  4O55 A;  3M8R A;  2XY5 A;  4PA1 A;  1XHZ A;  3C6U A;  1YTU A;  1B9F A;  3NH0 A;  3LAM A;  1B92 A;  1RDC A;  4I2Q A;  4N56 A;  1EKE A;  3OS0 A;  4M3X A;  1GOC A;  4C8O A;  3AVH A;  1L3T A;  4WE1 A;  1QSS A;  3ITH A;  4BE1 A;  4OLB A;  5J1E A;  2VG6 A;  1JXE A;  3DLK A;  3U3G A;  4KHN A;  4CEA A;  4HTU A;  4CJQ A;  1IG9 A;  2HND A;  4B9S A;  1X1P A;  4H4O A;  3NF7 A;  4N76 A;  5DMR A;  4E89 A;  4OKE A;  2YHA A;  1UA0 A;  2YNI A;  1TL3 A;  2YKN A;  1W0H A;  1IKY A;  4AH9 A;  1CLQ A;  5KTQ A;  1RIL A;  1TKX A;  1C0T A;  1N5Y A;  3PUF A;  3NGI A;  3UIQ A;  2GUI A;  4CIG A;  1IKV A;  3HPH A;  3P83 D;  3VQ6 A;  3SV3 A;  3RMB A;  1KCF A;  3NH1 A;  3PV8 A;  3SI6 A;  3LWM A;  3KK1 A;  1VSE A;  1BI4 A;  4DTJ A;  4FVM A;  4CJU A;  3DLR A;  4FLT A;  4Z4I A;  4KB0 A;  1S1X A;  4J2A A;  2W42 A;  4CGG A;  3KKR A;  4DU3 A;  3V9W A;  1JLE A;  3AVC A;  3IS9 A;  5DK5 A;  3LP1 A;  3D0P A;  2KZM A;  3S9H A;  4NCG A;  1RT7 A;  2KW4 A;  4N47 A;  5KI6 A;  3CG7 A;  3A2F A;  5KGX A;  3AVN A;  1HYS A;  4AHR A;  2VWK A;  5HRP A;  1ZBF A;  3OYE A;  3V9U A;  4E7K A;  4DFP A;  3QIO A;  4JS5 A;  3M8S A;  3LPT A;  4E19 A;  4CF2 A;  2HVH A;  3V6D A;  4KO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...