2UXCK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxcK00
1J5EK 4CW7B 2E5LK 5AJ3K 4DR3K 4JI2K 4GKKK 1FJGK 2UUCK 4YY3K 1IBKK 4B3TK 4DV7K 4K0KK 1XMQK 5A2QO 2UUAK 1N36K 4X66K 4V19S 1N32K 2UXCK 4X64K 4DR1K 4X65K 2ZM6K 4JI4K 4OX9K 4B3RK 2UU9K 4DV3K 4NXMK 3J7AP 4KHPK 4JI5K 2HHHK 2UXBK 4NXNK 4LF6K 4LF4K 5BR8K 4LFAK 2VQEK 4DUYK 4JI7K 2UUBK 4DUZK 4JI1K 4DV6K 2F4VK 1HNXK 1XMOK 4DV5K 4DV4K 5LMUK 4DR4K 4DR2K 4DV0K 3JAMO 5IT9O 5LMNK 4AQYK 4X62K 4LF8K 1XNRK 4LF5K 4B3MK 4JI3K 1I94K 4YHHK 1HR0K 4DV2K 4LF9K 4JI8K 1N34K 4LFBK 4DR5K 2VQFK 3J80O 1HNWK 4JI0K 4CVNE 4B3SK 1HNZK 5FLXO 4DR7K 3J81O 4GKJK 4JYAK 3J7YP 2UXDK 1N33K 1IBMK 1XNQK 3T1HK 4DV1K 4DR6K 4JV5K 3OTOK 4JI6K 3T1YK 5IWAK 4LFCK 1IBLK 4LF7K 5LL6Z
chains in the Genus database with same CATH superfamily
5AZJB 2H3GX 4CW7B 1ZBFA 3L4IA 4JHDB 4CJTA 3L2RA 3GDQA 3U3GA 4FK2A 1NKBA 1FJGK 1VQON 4Y1DA 4JAXA 4H0YB 4UQGA 2NRTA 3EKUA 4F2SA 3UE5A 1NK5A 2CGKA 1T05A 4E1JA 4F3OA 2VG7A 3L8BA 1LWFA 3RTVA 1GOCA 4IFVA 4I7FA 4LSNA 1J54A 3CFRA 1WUAA 4DTRA 4FJGA 4QCLA 3U9ZA 4CZLA 4ISEA 4FJLA 1EQYA 1Z25A 2QWPA 3VOVA 4M45A 1JLBA 1NBWA 1L3TA 3TTFA 1RCHA 5EU7A 5CE3A 3MCPA 3O4NA 3K5MA 4DTMA 1WNSA 1SS6A 1Y64A 4FLTA 1EO1A 5AQXA 1A5XA 3PX0A 3SQ0A 3MDQA 4KI4A 1W2BM 3SBGA 1LAWA 1NWKA 3NHGA 1CZ9A 2GELA 4FLZA 3CM5A 2QKBA 3WXIA 3SV4A 3ZEUA 4YNQA 1RBVA 3I33A 4JNEA 4RWTA 3A5MC 3OJUA 2B6AA 1FXXA 2QXLA 4K42A 3AVFA 1WBDA 3A2FA 3MX5A 5TKYA 3K5LA 4RW9A 1NGGA 1RT2A 2HBKA 4OKKA 5DK5A 1U4BA 3ZSOA 4CJVA 3SJHA 1SL1A 4JI8K 1QE1A 3V9XA 3C6HA 1HKGA 3TSPA 3HTVA 2YHYA 5JVGL 4WQ5C 2FSKA 5EVZA 2XY5A 4CGJA 1S1TA 1JLFA 2IOCA 4PA1A 3ZX2A 4CGIA 3WNFA 4CEQA 3I0SA 1IBMK 5AQTA 2HHSA 1S9GA 3MEEA 3LM9A 1TKTA 3R9PA 3SUOA 5FRMA 4JV5K 3R8EA 3OYNA 4DU4A 3VGLA 4AILC 2WFBA 5GAHP 3KZBA 3OA9A 2HW3A 4FYDA 1NK7A 3DLHA 4FZYA 2O8BA 3G10A 1RDDA 3T3FA 1GLEG 1IBKK 4FZXC 1QQMA 1WN7A 2X74A 5J2NA 3CG7A 4KI6A 4LY7A 2UUAK 1S9EA 3AVCA 4DSFA 4KHQA 2KW4A 3WEEB 3SI6A 4DSIA 3MN9A 3NFAA 4DR1K 2YNHA 2OPRA 4BDPA 2P9IB 4EHTA 1QVFM 2UU9K 1RBRA 2QWNA 3ENOA 1NGAA 4F3TA 1RBTA 3U6FA 3M5RA 4LF6K 1KCFA 5DMRA 3SAHA 4ISFA 1ATNA 1HKCA 4CCHA 4W5OA 4CJLA 2RKIA 3SUNA 3CCRN 4N41A 4IOCL 3J8AA 5KQDA 4OO1J 4DTNA 1BI4A 4FLWA 5BRFA 4FJ9A 2KTQA 4DV4K 3L6QA 4QS9A 3CQ8A 3PIOL 2ZJRL 3AVJA 1RBUA 4YOVA 3O4QA 1KXPA 1XC3A 4LF8K 3K57A 5J2PA 2NRRA 2Y1JA 2I5JA 4KTZA 3ZX3A 4K25A 4B1ZA 3ULEA 4BR2A 4FZZA 3CCEN 1HR0K 1GLFO 5KPTA 2KKZA 1SKRA 5M1NA 3AO2A 3OYCA 3THYA 4A57A 4M7XA 1MA9B 3DXKA 4DQ8A 1IJJA 4FJ5A 1BUPA 3BZKA 5I9EB 2CGLA 1G15A 4PHTX 2HF4A 5DM6L 3KTQA 3O9UA 4IWVA 3VPZA 4BRGA 5C24A 3OTOK 3NH2A 2A1RA 3T1YK 4JK9A 1VQ8N 5GAGP 5EOYA 3C7NB 3V9SA 1IKXA 3QB0A 4FWNA 4CF9A 5BN9A 2J4RA 3GOIA 2GWJA 1BQMA 4Z4HA 3K0SA 1XMQK 4CJEA 4A2BA 2IS3A 4RW8A 4CEFA 4Z4FA 4X66K 4H4MA 4EAHD 2ZWHA 1RDCA 2QEXN 2E6LA 4N56A 1TL1A 3HP9A 3I8BA 1XI1A 1RT5A 3O9RA 3UIQA 3QBXA 2DFFA 3V9UA 1RNHA 2QWMA 3AO3A 3NCIA 2EWSA 4KFBA 1DTTA 3O80A 5GINA 4LF4K 4PL7A 3O4WA 5KGXA 5GADP 3EZWA 4PWDA 2QI2A 3T7ZA 5BR9A 4B3OA 1OH6A 4B9MA 1S72N 1CZAN 1ZC6A 1X3NA 4KB0A 3LDPA 3WXJA 4DV5K 1L3VA 1CZBA 5AQLA 3UB5A 4GV3A 3RWUA 2F7TA 2NLXA 3ZETA 2QM1A 4FM1A 3EYZA 3C94A 5ELZA 4DWIA 1QQNA 1IKYA 1UWBA 4BQZA 4U67L 1RDAA 3O08A 3TABA 2O4IA 4Z4IA 1X3MA 1RT4A 4CHNA 4KHUA 1FKPA 5EXWA 2PZSA 4BROA 1HLUA 2QWRA 4WYBA 3THXB 1LV5A 3DOKA 3AVMA 3RMDA 3C0BA 1E4GT 5BREA 2IVNA 4GNIA 4YORA 2P9SB 2Q36A 2YHXA 4KRFA 3F9MA 2BH1A 4DQSA 5FDLA 5MLCQ 2HB5A 3T1HK 4AM7A 1VQ9N 2CH5A 4E19A 1K8AO 1ATSA 1J9AA 3CHWA 5AQYA 5BPMA 1VSDA 1RDBA 3OVNA 3HZ6A 4BRPA 2UYTA 3RSEB 3BGRA 1BHLA 2V7ZA 3IRXA 1IKWA 4PY5A 4YY3K 4DMNA 3CXCM 3LPTA 1FW6A 4M3WA 4BWMA 1C1AA 1N36K 4CBUA 1T3VA 4CJSA 5AQSA 4MQ3A 1QTMA 2ZF5O 2E2PA 4X65K 4OX9K 3S3OA 4B9SA 3AVNA 3SCXA 1LWCA 3D2EB 1WSEA 3L2VA 3H08A 3VQAA 3WUHA 1ASWA 4BACA 3OYDA 1TL3A 3SYZA 4E1MA 3ZSVA 3SNNA 3DLBA 3NVMA 1BU6O 1NK8A 1OH8A 3H6EA 3E66A 2R7YA 1TYQB 1R0AA 1K6YA 4YOTA 2P1JA 5LY3A 3QDKA 3O3FA 3GG4A 2LSNA 3MMVA 1YJWN 1U47A 2JGUA 4NLBA 1BDGA 1SUQA 1LCUA 3UKRB 3THWA 1D9FA 3VF4A 2Z1HA 3EO3A 1O13A 1HKBA 4N5SA 3EL2A 3S3NA 3OYBA 4LF5K 1QHAA 4DQRA 1Q9XA 4JI3K 1D4XA 5C25A 5J1EA 1YHQN 4J2BA 1DGKN 3CPWM 2YX6A 5EY4A 2D0CA 3TR8A 3J80O 4H0OA 3H3NO 4IOXA 3ZSXA 2IC3A 3UKUA 3MX2A 1ATRA 2A42A 3FFKB 1HNZK 1NK6A 3KWIA 3G0ZA 3DRPA 4CZEA 3NMUA 4H5NA 2A6AA 1JLCA 3E1YA 4FJKA 2RPIA 2FF6A 4CJPA 5AZIA 4BDYA 1BISA 1W9HA 1OKJA 1P8ZA 1TGOA 3LDNA 3VENA 4PKIA 3VN5A 3GBTA 3NF9A 3E9PA 4DKWA 4H0VB 3O9SA 1TK8A 4CZHA 3CCLN 1MDUB 4KV8A 2P9KB 4YOUA 2ZE2A 2YJEA 3MK6A 2ZD1A 2F9WA 4JN4A 3N4QA 3MXJA 3HSTB 3CJ1A 3SK3A 1KVCA 3VF2A 2F9TA 4N76A 5FPDA 4M3UA 2OZMA 3D45A 1U2VA 2FF3B 1XHZA 4QS7A 4GW6A 3ENBA 2V51B 3I0RA 4JKCA 4JKAA 2HHUA 1BGXT 4CF1A 1TKXA 1M90O 4AHUA 4FCYA 1NGDA 3HK2A 1VSEA 1KAZA 5LJWA 4BDZA 1BA1A 4DTOA 3CIPA 3CFOA 4BRQA 1D5AA 1DLOA 4IJAA 5HRRA 2FXUA 4BR7A 3L0QA 3C6UA 5FPEA 1YUWA 3JAMO 3MEDA 4OPHA 2VWKA 5IT9O 3KD1E 4CE9A 4U7BA 2AA4A 4O5BA 4ID1A 2HVIA 5EX5A 1ZBHA 3CJBA 3AA2A 1OVYA 1YT3A 1SL0A 1K9MO 1BIUA 4CFBA 4MFBA 2Q0RA 1ZBIA 2Q3SA 4WQ5A 2XY8A 3AA3A 2O8EB 4QOZB 4CI6A 4CIGA 2XRIA 5M1QA 4A5AA 1EXQA 1ZBUA 3AVHA 3K59A 4JKGB 2NRXA 2HHQA 4C8LA 1I3AA 1NJXA 3CMEN 2PY5A 1VSIA 3FE1A 3LDSA 3J81O 4DU3A 4CHPA 4GKJK 1R59O 4A2AA 4CD3A 4BR5A 1T6CA 1XNQK 2V7YA 3R3LA 3MN6A 1YITN 3LP3A 4Y0WA 4JKDA 4E1NA 2XY7A 4M42A 4I6MB 4FWMA 1JL2A 1QS4A 4RW4A 4ID5A 3CD6N 1EP4A 1CLQA 3HSCA 3AGKA 1Q8IA 4AHCA 3A0IX 3F9KA 4FVUA 4E7KA 2KFZA 1TK0A 4V19S 2IVOA 5AQNA 1S1VA 3NE6A 5AQHA 2QA4N 4TSXA 3P4IA 1MWKA 1YJNN 3V4IA 4IBNA 4BRCA 5F0XA 3TSUA 1KAXA 4FOIA 1Q9YA 3PX6A 2P9UB 3D2FA 3BEXA 4GVEA 3IG1A 3HVTA 3K9KA 3EE9A 1HMVA 3SQ2A 5AQFA 2FSNA 4ILHA 3BZCA 4E7IA 2I7NA 3CI5A 2KQ2A 1WSGA 3CC2N 2AJQA 4F4KA 4ELVA 1MU2A 3O5BA 3O9TA 5JS1A 3CETA 3TPQA 4H03B 3RRGA 1LOTB 4CHYA 1VQMN 4ZTJA 5AQQA 3NF8A 5I42A 2OA8A 3V9WA 3TARA 3V1QA 4M3RA 4H4OA 2FLOA 2GUIA 1QSLA 1BA0A 4KPYA 4BC3A 1UAXA 4OPKA 1QZ6A 4M3TA 3MEGA 4BG9A 3VQ5A 3DXMB 4AH9A 3LL3A 4DTPA 4KKOA 1RT1A 1S6QA 4XH4A 3SUPA 4B3SK 2E8AA 2UXDK 1WSIA 2QW9A 3L2QA 1ASUA 3HVRA 3P5JA 5M1FA 3WQUA 4CZFA 4I9LA 3AA4A 5IWAK 1YTAA 3LWLA 2GEMA 2WBNA 4DHYA 1S1UA 2Q0UA 4H0TB 4FSVA 4LH5A 4I2PA 3CF5L 4M41A 3WNEA 4KHWA 4HVJA 3RMCA 1T03A 1VQ6N 3LPUA 3O8MA 2VWBA 4B9UA 3OYFA 4C8MA 4ILGB 3SV3A 4PKHA 3DLRA 4IXCA 5K14A 3HM8A 4BY9C 4H5VA 4OGCA 2GUPA 4LD0A 3MCAB 1UA0A 5KTQA 2E2OA 4CZMA 4FJ7A 5GIOA 4CJ4A 4NYNA 4JI7K 5FROA 2UUBK 4DSJA 1HNIA 4WE1A 2IDOA 2VYPA 1O1WA 3KLGA 2EX3A 1HNXK 1T6DA 2B5JA 5E26A 1X9WA 3CC4N 3ZT3A 4JD2B 3TTDA 1GLJO 4CFAA 2HF3A 2HNDA 3QO9A 4FWRA 4NLCA 3CYMA 3M8SA 4JLHA 2E6MA 3N4PA 4OLBA 1EKEA 3W0LA 2I7PA 1XNRK 3VQCA 1HUXA 1OH7A 1TKDA 4CHQA 1SL2A 4CJKA 5AQRA 4R5PA 2D0AA 1BIZA 2ASPA 3RRHA 4KTQA 2F96A 3OHRA 4Z4CA 3ITHA 2P9PB 1N6QA 4CVNE 4YOXA 3LALA 2O8DA 1T44A 2PYLA 2NNWA 3FZLA 3JXUA 2QWOA 4BC5A 1ESVA 4O5FA 2A3ZA 4WF9L 4GMJB 4NCAA 3K5OA 2W6LA 4UY8O 3C95A 3SPYA 1Z6RA 1KAYA 1SQKA 3H1QA 5E41A 1A5WA 1KVAA 1IG8A 4I9QA 1EETA 4JI2K 1KTQA 4CJQA 4EIAA 3ZYYX 3RR8A 4R79A 5HRSA 4B3TK 4L3QA 1NNEA 4CK3A 4H5WA 3PY8A 4K0KK 3OYMA 3DLGA 3NGYA 5A2QO 3PV8A 4FJJA 4FPAA 4FWQA 1GLBG 1NGBA 4C23A 5ADXA 1WBBA 1N32K 3ISNC 1XWLA 1KVBA 3ZX0A 1B9FA 4K8XA 3S3MA 4JI4K 3KLEA 4DV3K 2F8TA 3U3YA 5GAEP 1JKHA 4FJIA 4GV9A 5M1OA 4O0JA 2YCHA 4IEIA 3ZLJA 3MWTA 5SWMA 1RFQA 1TVRA 4OGEA 3VQDA 3QETA 3D7EO 4KHSA 3HPGA 4FXDA 5AQIA 1SKWA 2W42A 5AZJA 1NMNA 4JHDA 5C15A 3FZKA 3CJ9A 3KLFA 4PL8A 3NAEA 2W41A 3CMAN 4EZ9A 1S6PA 4CZKA 1X1PA 3KLHA 4IO9L 5LMNK 3R1XA 4GV6A 3LP2A 3KD5E 2KZZA 1C6VA 4MO5A 3TAQA 3AV9A 3LDOA 4C1NI 1V4SA 3ATVA 4DTUA 3LAMA 2O8CB 1QVGM 1W0HA 4WQ4A 3CCSN 4BWJA 2WONA 2P5OA 2D5RA 3G71N 4CEOA 4EP5A 4LF9K 4RG8A 3VA3A 3SUQA 5C2FA 2ZJQL 5LJVA 3FZMA 1ASVA 2VGMA 3VESA 3QEIA 2P51A 1VK0A 2G8KA 4WFBL 3KJVA 5J2QA 1S5JA 5KQ8A 2G8VA 5FLXO 2PBDA 2XY6A 4DR7K 4IDHA 1BG3A 4OKEA 1U49A 2D0OA 1J5OA 3NF6A 1J6ZA 3JSMA 1NGFA 3RMBA 3KK3A 3L3UA 4DR6K 4CEAA 1EX4A 2BUPA 5JMVA 1DEJA 3OW2M 1GOAA 5GIPA 4LF7K 4B1XB 4CHOA 4BE2A 4B9LA 2PYJA 4DR3K 4B1UB 3HO1A 2HSTA 4AHTA 4PQUA 1YI2N 2E88A 3VGMA 3G4SN 3TAEA 1NU0A 1KLMA 3HPHA 4CZJA 4IJNA 3VQ9A 2OPPA 3A8YA 4X64K 3I56N 4DSEA 2YKNA 1RBSA 1A5VA 4M7YA 3S9HA 1HPZA 3J7AP 5C42A 2E2NA 4IFYA 3DYAA 1WSHA 4IKFA 4NXNK 3WXMB 3B6PA 1K73O 3KIOA 4FM2A 1MWMA 4NCBA 1NOYA 3MXMA 3WT0A 1NOZA 3VQQA 4BGAA 1ZBSA 5CY4A 1NGIA 1TK5A 1T7PA 1U6ZA 4M3ZA 1JLEA 3HBTA 3HL8A 4JS4A 3ATUA 5BRDA 1LW2A 2YJFA 4A5BA 1TV6A 4LSLA 3QBWA 3WEEA 3DRRA 2XHBA 2P9IA 3FFIA 1XC9A 4IOAL 4YHHK 3CCJN 4KH6A 1DTQA 2W40A 4HHTA 1YJ9N 4XH1A 1N34K 3SMSA 1NGHA 1V4TA 3CCMN 3U8XA 2VQFK 4CIEA 5AQZA 3IDHA 3QLHA 1KRPA 4BREA 4QS8A 4OVLA 4BE1A 3CCQN 4CFCA 1W7AA 4Y1CA 3ZSZA 3NH0A 4E7JA 5KPRA 1QZ5A 1N33K 4FJNA 1VSMA 1RTJA 4DV1K 4B08A 3CJ7A 4FO0A 4BQLA 3HXMA 2JLEA 3AVLA 4E7HA 4LFCK 5F1XA 3HOTA 1TUUA 2D0PA 3FR0A 4FW1A 2GTDA 1REVA 4JKBA 4JRQA 4CEDA 4GKKK 4WQ4C 3C6TA 3BUZB 2HVHA 4DV7K 3QEVA 1T8EA 3ZEUB 2OANA 3TWHA 1BCMA 3AGRA 3B6OA 3U4LA 1JCGA 4CGGA 3H3OB 1WSFA 3HPOA 2YI1A 3WXKA 1JXBA 1KD1O 1VQ7N 3FZHA 2HBLA 2ZGYA 2ZM6K 2IAJA 4M3XA 4JKHA 4KHPK 1Q81O 4GVMA 4BE0A 4O0IA 4A62A 3NDKA 2UXBK 3VQ6A 4FK0A 4F9OA 3VQ4A 5C12A 3QNOA 3L3VA 4C8NA 4CD1A 2G8FA 4CF2A 3LP0A 2KFNA 1NK4A 2ASOA 4W5TA 2DY4A 3CPEA 1RT3A 4HTUA 3AVBA 3C7NA 4MDAA 1C0TA 2ITGA 4DV0K 1NJWA 4DTJA 2GBZA 4Z4EA 1HQUA 4FWLA 4J2EA 1X9SA 1EWQA 2Q2RA 4HUGA 1E4FT 3V1OA 4FPBA 5BN8A 4H0XB 1G99A 5HOOA 4DU1A 1VQ5N 4FWOA 3RMAA 2NUBA 4CEEA 5TKWA 4DFMA 3P1GA 4FWKA 4ELTA 4H8KA 2WC9A 5AQGA 3IMXA 5KGWA 3SJJA 3QIPA 1VQLN 4DFJA 2Q31A 2X6NA 4O4GA 4DQIA 4F8RA 4EZ6A 4JI0K 4CECA 1NG9A 2YNIA 2QXFA 5KRTA 4ELUA 3AA5X 1JCEA 1YF5L 2D0BA 2BGGA 3DLEA 4JKEA 4G9ZA 2B4JA 4DFKA 5AQJA 1IBLK 5LL6Z 1J5EK 3BF3A 1BI4B 4CEBA 2A5XA 2YKMA 4H5RA 3VQ8A 2IGIA 3U9DA 1BOTO 4FWSA 4B9VA 2PFUA 5HL7L 3HT3A 1C0FA 1TUYA 2DFEA 3KK7A 3NGZA 3QEXA 5JICA 1ZYQA 4HUFA 1S22A 4BRFA 3SQ4A 5F2RA 2QWQA 3THXA 1VHXA 1FK9A 3ASMA 4MLHA 2IVPA 2P9SA 3MN5A 1N8RO 3KKSA 4CZGA 3SQ1A 3QICA 4ZHRA 2YHAA 5AR0A 4E0DA 4CIFA 3THYB 4LFAK 4DB3A 1HQEA 4FM0A 4DUYK 4CGFA 1RTIA 3H46O 4J8FA 4JK7A 4WCEL 4DUZK 3AVAA 4MDBA 2E2QA 5FPNA 4BR0A 3O6WA 1IH7A 4DF8A 1GLAG 5C0YA 1DT9A 4IO8A 3RSEA 4AF1A 3IS9A 4PKGA 5AQPA 4B9QA 4J2AA 4CF0A 4DS4A 3PO5A 5H1SQ 4RW6A 5AQVA 4NO7A 3TSQA 4YDUA 3VQ7A 4E89A 5ADXH 1D8YA 4DQPA 4CZIA 3A5NC 3W3DA 4A59A 3IFRA 3IKMA 1LW0A 3ZCMA 3MAQA 3OY9A 5AQOA 2IIRA 1YVUA 3D2EA 4FLYA 2OPQA 4LFBK 4CEZA 4CJWA 2OTLN 4Q5VA 1RILA 3O9QA 5KRSA 1NKEA 3BY5A 3MWPA 4KAZA 5BRHA 5I3UA 1TYQA 1ITGA 4IDKA 1C1BA 1VRTA 3DJCA 3VEWA 1N5YA 3KLIA 4BRHA 4O8KA 3L2UA 1HYZA 3M8PA 2FBYA 2P9NB 3IUCA 4HUEA 3QNNA 4HCCA 3UKRA 4DLGA 3P38A 2ASMA 1XHXA 5AJ3K 3E9OA 2P5GA 3IAYA 1KQSM 3VQPA 4K43A 4W5RA 3ZETB 2DTUA 3MXIA 1GOBA 4AHRA 4RCHA 3D6RA 5DM7L 3E9LA 2QKKA 4CGHA 5D3GA 1Q18A 3K2PA 4CBXA 2PAVA 1IO2A 4A61A 4BRMA 1HJRA 3ID8A 2GWKA 3S41A 4FLXA 3AVKA 3FLCO 3CCUN 3QERA 2GV9A 2OYQA 4O8UA 4RW7A 2VQEK 3VQEA 1VSKA 3GE1A 3NGIA 4LC9B 2G8UA 5BPLA 3PLAA 4WFAL 3I55N 1NGCA 4JK8A 4DR2K 3V9ZA 1QQCA 3LZIA 3LDQA 3DMJA 3O1WA 3TAMA 2XO7A 1U48A 2P9KA 4AQYK 4BGBA 3R6MA 3VERA 3VMFB 3ULDA 4I2QA 3PUFA 3AARA 4KBOA 3DAWA 3SAFA 4B3MK 4FW2A 5HLFA 2YV0X 2O8FB 3CERA 4CJ5A 4H0PA 4C8KA 2QTDA 4DR5K 4H5TA 3OYHA 1JLQA 3CJAA 4AM6A 4DF4A 1HNWK 3KKRA 4ILJA 3PO4A 3OS0A 4CESA 3HRGA 3CQYA 4CK2A 2O4GA 3I8DA 2YHWA 1U04A 4BC2A 3AO1A 4JYAK 3C65A 3JYTA 4Z94A 1D9DA 4ICLA 2NRZA 5AFUA 4M3YA 2JWLA 5M1KA 3OJSA 3VEVA 5SZTA 1NLVA 1L3SA 4CJRA 5B8HA 4YDUC 1HYSA 1VRUA 5CYQA 3HM9A 1FKOA 4IZ9A 3SLCA 3J7ZO 1BQNA 4FL9A 1IV0A 3M1FA 3B8AX 3AVGA 1JLGA 1GLCG 2V52B 3V1RA 1SZ2A 5HBMA 3OYAA 2BDPA 2VG6A 2UUCK 2BE2A 1GLLO 4B9NA 4DCHA 2O8EA 1GLDG 3F5TA 3THWB 4DTSA 1RT7A 2X6SA 3LDLA 1TAQA 3KHYA 3OS2A 4JKGA 4FOEA 3K58A 4YOYA 1YAGA 4JI5K 3BF1A 1C1CA 4O44A 4FJ8A 1ZBLA 5CZ1A 5HRPA 1RTHA 4YFUA 5CHIA 1WB9A 1I39A 4OKJA 3PSIA 4NCGA 4DFPA 2GX9A 2KHOA 2HHVA 3AY9A 4JI1K 3UKUB 4DV6K 4E3SA 4I6MA 4CJ7A 2Q97A 1XMOK 2RHKA 3LM2A 1K8KB 5AZIB 3JS6A 2YNGA 1HYVA 2HNZA 3SMPA 4E7LA 4HTLA 4KTWA 3ZT2A 4EP4A 5BPNA 4FWPA 1ZXOA 3DWLA 3A5LC 3CC7N 4LH4A 1WAFA 1W97L 4QAGA 1HRHA 2QK9A 4HCBA 3TI0A 1RGIA 1S3XA 4XIUA 1UA1A 1I94K 1TKZA 3CCVN 5C2DA 1KC8O 3T1AA 4EHUA 3PX4A 3DI6A 3KK2A 3OYGA 1Y97A 2YHBA 1B92A 3LAKA 1BL3A 5AQWA 4CHZA 2Q1NA 2P9UA 2NZTA 1QSSA 5JLHA 1WSJA 1KFSA 1J53A 4B8AB 2E1ZA 3PSFA 4ISGA 1BO5O 2HBMA 1KSPA 3PIPL 2HNYA 1YTUA 1U2VB 1VSFA 4JEPA 4CJUA 1H1VA 2G8IA 2FBTA 3H45C 3EZ5A 3AO4A 3QIOA 4KH4A 4MO4A 4NYFA 1XQSC 2Z1JA 4JI6K 3VQBA 4KHNA 3F73A 1YXQA 2E5LK 3F2KA 3NBPA 3EKSA 3ZT0A 3LZJA 4OPJA 2ITMA 4OJRA 2KLAA 1OH5A 1ILYA 3ZT4A 2CGJA 4B1VA 4B1YB 3ALYA 3P39A 3ZSRA 2DFHA 2P9NA 1NJYA 2Z1IA 3VTHA 3OYLA 1RTDA 3ENHA 2G8HA 4Z0UA 3ZT1A 2UXCK 3DXMA 4OPAA 2FSJA 1VSLA 3M8RA 5T7BA 4FJHA 1VSJA 2BTFA 3D0PA 5AQMA 3OBYA 2A41A 4O55A 2P9LB 1U45A 1C0UA 1NM1A 3NF7A 1HPMA 4Q0BA 3DLLL 3SAGA 3VETA 1L5UA 1QHTA 2E20A 2VG5A 4NB4A 3EEQA 4IG3A 1QSYA 2ZJPL 2Z1GA 3HJFA 3G25A 3T69A 3OYEA 2AP1A 3O3GA 4PUOA 3VF6A 4FJMA 2OPSA 4DTXA 4CJ3A 2EHGA 5M1PA 2ZQBA 4CK1A 2NRWA 3FZFA 3AO5A 1CXQA 2E1YA 5C10A 4BR9A 4C8OA 1Q86O 1JCFA 1VQ4N 4FVMA 2YNFA 1L3UA 5AQUA 1WOQA 3KWGA 5HP1A 4AHVA 3HOSA 1YVNA 4B8CA 4CF8A 5CYMA 1DKGD 1NKCA 1CXUA 3VEZA 3K5NA 2HOEA 1SKSA 1HX1A 2HMIA 1JXEA 2A1SA 3AAPA 3WXLA 2KZMA 2O8FA 2X78A 4YOWA 3BP8A 3ID6A 4DG1A 3HI0A 4BRDA 5HROA 4JD2A 3D2FB 3ZSQA 1NK0A 1VSHA 4G1QA 1KLNA 1XUPO 5J2MA 3TU5A 3VTIA 2E4LA 1WAJA 1F21A 4M63C 1NGJA 1Z05A 4K8ZA 5JVHL 1C0MA 2OCEA 3ZSYA 3TTCA 3QEPA 3QEWA 2D4WA 1X9MA 1HNVA 3L2WA 3MECA 1VAZA 4FLUA 3G6EN 1LWEA 4WFNL 3M3ZA 3LANA 2OTJN 3MN7A 4W5NA 3OS1A 4IFEA 2P9PA 4DSKA 4FJXA 4B3RK 2FBXA 3WNHA 3WNGA 2ATQA 4NXMK 3QINA 1NJZA 5JLFA 1NJIO 3NVKA 2VGNA 1VQNN 3KK1A 4BG8A 1VQPN 1IG9A 3TAPA 3BDPA 4DLEA 2A40A 4Z4GA 3FGUA 3WQTA 3VEYA 1JJ2M 3DLKA 4J2DA 4B9TA 2F4VK 4BRLA 4JKFA 4DR4K 2FC0A 3SZ2A 3ZSWA 3CM6A 4KHYA 3VA0A 2Y1IA 4N47A 3M6GA 2RN2A 2WUSA 2G8WA 1X9JA 1EWRA 2HBJA 4BR4A 4B1WB 2W6KA 1K8KA 3RVCA 3OYKA 3CQXA 2FBVA 4DSLA 3DRSA 3LWMA 5KI6A 4DV2K 3M8QA 3Q7CA 4KH5A 4HWIA 4F2RA 3K9JA 1NGEA 2JWKA 2QWLA 4CFDA 4KO0A 4DS5A 1QQOA 3L4QA 4BRAA 4AHSA 3DM2A 2HMPA 3AVIA 2VWJA 3J7YP 1P90A 3QMLA 3T19A 4RTFD 3THVA 2O8BB 1OVQA 4BVPA 1BWFO 1C0GA 5CR4A 2HHWA 2D1KA 3CJCA 3QFUA 1S1WA 1WLJA 2HHTA 2CH6A 5HRNA 1RT6A 5E84A 3NH1A 1S1XA 4IEEA 1Q7YO 3HYFA 2ETJA 2ZGZA 1IKVA 3OYIA 4BRNA 2O8CA 4K41A 1NK9A 1VQKN 4MLEA 4FLVA 3E01A 2NRHA 4KB1A 3GL1A 4L8RB 4ZTFA 4JS5A 3LP1A 2VCPA 1HJOA 1LAVA 1UOCA 2OZSA 2HHHK 5AFUH 1M1KO 5JS2A 3CFPA 3VEOA 1Q82O 3TAFA 5BR8K 4KREA 3C6AA 3DOLA 1BCOA 1RDUA 3SBTA 3P31A 2O8DB 1Z26A 3VGKA 5AQKA 3A5OC 5LMUK 2F8SA 1RDWX 1YIJN 3O1BA 3ULEB 2P9LA 3EE8A 5KPZA 1TAUA 3EY1A 3AAQA 4BRIA 4IG0A 3QESA 3SPZA 2HHXA 1E3MA 4X62K 1KFDA 4OLAA 4BRKA 3Q7BA 1SAZA 2RF2A 3OBWA 4W5QA 1SV5A 4BVOA 5FPMA 1JLAA 2DPNA 2WTUA 4CJFA 2NRVA 1B9DA 3H1VX 3QFPA 3DXKB 3O3HA 3EN9A 4CGDA 4XEIA 4FK4A 4GY2B 3RR7A 4EFHA 3TANA 3V6DA 2RE2A 2BANA 3OYJA 3V81A 3TAGA 4JRPA 4DQQA 4C1NK 3HP6A 4BC4A 5CZ2A 1NMDA 5FRNA 4XH5A 3KVGA 3VEXA 3P83D 4CBWA 4CERA 2WOMA 1JL1A
chains in the Genus database with same CATH topology
1J5EK 4CW7B 2E5LK 5AJ3K 4DR3K 4JI2K 4GKKK 1FJGK 2UUCK 4YY3K 1IBKK 4B3TK 4DV7K 4K0KK 1XMQK 5A2QO 2UUAK 1N36K 4X66K 4V19S 1N32K 2UXCK 4X64K 4DR1K 4X65K 2ZM6K 4JI4K 4OX9K 4B3RK 2UU9K 4DV3K 4NXMK 3J7AP 4KHPK 4JI5K 2HHHK 2UXBK 4NXNK 4LF6K 4LF4K 5BR8K 4LFAK 2VQEK 4DUYK 4JI7K 2UUBK 4DUZK 4JI1K 4DV6K 2F4VK 1HNXK 1XMOK 4DV5K 4DV4K 5LMUK 4DR4K 4DR2K 4DV0K 3JAMO 5IT9O 5LMNK 4AQYK 4X62K 4LF8K 1XNRK 4LF5K 4B3MK 4JI3K 1I94K 4YHHK 1HR0K 4DV2K 4LF9K 4JI8K 1N34K 4LFBK 4DR5K 2VQFK 3J80O 1HNWK 4JI0K 4CVNE 4B3SK 1HNZK 5FLXO 4DR7K 3J81O 4GKJK 4JYAK 3J7YP 2UXDK 1N33K 1IBMK 1XNQK 3T1HK 4DV1K 4DR6K 4JV5K 3OTOK 4JI6K 3T1YK 5IWAK 4LFCK 1IBLK 4LF7K 5LL6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E K;  4CW7 B;  2E5L K;  5AJ3 K;  4DR3 K;  4JI2 K;  4GKK K;  1FJG K;  2UUC K;  4YY3 K;  1IBK K;  4B3T K;  4DV7 K;  4K0K K;  1XMQ K;  5A2Q O;  2UUA K;  1N36 K;  4X66 K;  4V19 S;  1N32 K;  2UXC K;  4X64 K;  4DR1 K;  4X65 K;  2ZM6 K;  4JI4 K;  4OX9 K;  4B3R K;  2UU9 K;  4DV3 K;  4NXM K;  3J7A P;  4KHP K;  4JI5 K;  2HHH K;  2UXB K;  4NXN K;  4LF6 K;  4LF4 K;  5BR8 K;  4LFA K;  2VQE K;  4DUY K;  4JI7 K;  2UUB K;  4DUZ K;  4JI1 K;  4DV6 K;  2F4V K;  1HNX K;  1XMO K;  4DV5 K;  4DV4 K;  5LMU K;  4DR4 K;  4DR2 K;  4DV0 K;  3JAM O;  5IT9 O;  5LMN K;  4AQY K;  4X62 K;  4LF8 K;  1XNR K;  4LF5 K;  4B3M K;  4JI3 K;  1I94 K;  4YHH K;  1HR0 K;  4DV2 K;  4LF9 K;  4JI8 K;  1N34 K;  4LFB K;  4DR5 K;  2VQF K;  3J80 O;  1HNW K;  4JI0 K;  4CVN E;  4B3S K;  1HNZ K;  5FLX O;  4DR7 K;  3J81 O;  4GKJ K;  4JYA K;  3J7Y P;  2UXD K;  1N33 K;  1IBM K;  1XNQ K;  3T1H K;  4DV1 K;  4DR6 K;  4JV5 K;  3OTO K;  4JI6 K;  3T1Y K;  5IWA K;  4LFC K;  1IBL K;  4LF7 K;  5LL6 Z; 
#chains in the Genus database with same CATH topology
 5AZJ B;  2H3G X;  4CW7 B;  1ZBF A;  3L4I A;  4JHD B;  4CJT A;  3L2R A;  3GDQ A;  3U3G A;  4FK2 A;  1NKB A;  1FJG K;  1VQO N;  4Y1D A;  4JAX A;  4H0Y B;  4UQG A;  2NRT A;  3EKU A;  4F2S A;  3UE5 A;  1NK5 A;  2CGK A;  1T05 A;  4E1J A;  4F3O A;  2VG7 A;  3L8B A;  1LWF A;  3RTV A;  1GOC A;  4IFV A;  4I7F A;  4LSN A;  1J54 A;  3CFR A;  1WUA A;  4DTR A;  4FJG A;  4QCL A;  3U9Z A;  4CZL A;  4ISE A;  4FJL A;  1EQY A;  1Z25 A;  2QWP A;  3VOV A;  4M45 A;  1JLB A;  1NBW A;  1L3T A;  3TTF A;  1RCH A;  5EU7 A;  5CE3 A;  3MCP A;  3O4N A;  3K5M A;  4DTM A;  1WNS A;  1SS6 A;  1Y64 A;  4FLT A;  1EO1 A;  5AQX A;  1A5X A;  3PX0 A;  3SQ0 A;  3MDQ A;  4KI4 A;  1W2B M;  3SBG A;  1LAW A;  1NWK A;  3NHG A;  1CZ9 A;  2GEL A;  4FLZ A;  3CM5 A;  2QKB A;  3WXI A;  3SV4 A;  3ZEU A;  4YNQ A;  1RBV A;  3I33 A;  4JNE A;  4RWT A;  3A5M C;  3OJU A;  2B6A A;  1FXX A;  2QXL A;  4K42 A;  3AVF A;  1WBD A;  3A2F A;  3MX5 A;  5TKY A;  3K5L A;  4RW9 A;  1NGG A;  1RT2 A;  2HBK A;  4OKK A;  5DK5 A;  1U4B A;  3ZSO A;  4CJV A;  3SJH A;  1SL1 A;  4JI8 K;  1QE1 A;  3V9X A;  3C6H A;  1HKG A;  3TSP A;  3HTV A;  2YHY A;  5JVG L;  4WQ5 C;  2FSK A;  5EVZ A;  2XY5 A;  4CGJ A;  1S1T A;  1JLF A;  2IOC A;  4PA1 A;  3ZX2 A;  4CGI A;  3WNF A;  4CEQ A;  3I0S A;  1IBM K;  5AQT A;  2HHS A;  1S9G A;  3MEE A;  3LM9 A;  1TKT A;  3R9P A;  3SUO A;  5FRM A;  4JV5 K;  3R8E A;  3OYN A;  4DU4 A;  3VGL A;  4AIL C;  2WFB A;  5GAH P;  3KZB A;  3OA9 A;  2HW3 A;  4FYD A;  1NK7 A;  3DLH A;  4FZY A;  2O8B A;  3G10 A;  1RDD A;  3T3F A;  1GLE G;  1IBK K;  4FZX C;  1QQM A;  1WN7 A;  2X74 A;  5J2N A;  3CG7 A;  4KI6 A;  4LY7 A;  2UUA K;  1S9E A;  3AVC A;  4DSF A;  4KHQ A;  2KW4 A;  3WEE B;  3SI6 A;  4DSI A;  3MN9 A;  3NFA A;  4DR1 K;  2YNH A;  2OPR A;  4BDP A;  2P9I B;  4EHT A;  1QVF M;  2UU9 K;  1RBR A;  2QWN A;  3ENO A;  1NGA A;  4F3T A;  1RBT A;  3U6F A;  3M5R A;  4LF6 K;  1KCF A;  5DMR A;  3SAH A;  4ISF A;  1ATN A;  1HKC A;  4CCH A;  4W5O A;  4CJL A;  2RKI A;  3SUN A;  3CCR N;  4N41 A;  4IOC L;  3J8A A;  5KQD A;  4OO1 J;  4DTN A;  1BI4 A;  4FLW A;  5BRF A;  4FJ9 A;  2KTQ A;  4DV4 K;  3L6Q A;  4QS9 A;  3CQ8 A;  3PIO L;  2ZJR L;  3AVJ A;  1RBU A;  4YOV A;  3O4Q A;  1KXP A;  1XC3 A;  4LF8 K;  3K57 A;  5J2P A;  2NRR A;  2Y1J A;  2I5J A;  4KTZ A;  3ZX3 A;  4K25 A;  4B1Z A;  3ULE A;  4BR2 A;  4FZZ A;  3CCE N;  1HR0 K;  1GLF O;  5KPT A;  2KKZ A;  1SKR A;  5M1N A;  3AO2 A;  3OYC A;  3THY A;  4A57 A;  4M7X A;  1MA9 B;  3DXK A;  4DQ8 A;  1IJJ A;  4FJ5 A;  1BUP A;  3BZK A;  5I9E B;  2CGL A;  1G15 A;  4PHT X;  2HF4 A;  5DM6 L;  3KTQ A;  3O9U A;  4IWV A;  3VPZ A;  4BRG A;  5C24 A;  3OTO K;  3NH2 A;  2A1R A;  3T1Y K;  4JK9 A;  1VQ8 N;  5GAG P;  5EOY A;  3C7N B;  3V9S A;  1IKX A;  3QB0 A;  4FWN A;  4CF9 A;  5BN9 A;  2J4R A;  3GOI A;  2GWJ A;  1BQM A;  4Z4H A;  3K0S A;  1XMQ K;  4CJE A;  4A2B A;  2IS3 A;  4RW8 A;  4CEF A;  4Z4F A;  4X66 K;  4H4M A;  4EAH D;  2ZWH A;  1RDC A;  2QEX N;  2E6L A;  4N56 A;  1TL1 A;  3HP9 A;  3I8B A;  1XI1 A;  1RT5 A;  3O9R A;  3UIQ A;  3QBX A;  2DFF A;  3V9U A;  1RNH A;  2QWM A;  3AO3 A;  3NCI A;  2EWS A;  4KFB A;  1DTT A;  3O80 A;  5GIN A;  4LF4 K;  4PL7 A;  3O4W A;  5KGX A;  5GAD P;  3EZW A;  4PWD A;  2QI2 A;  3T7Z A;  5BR9 A;  4B3O A;  1OH6 A;  4B9M A;  1S72 N;  1CZA N;  1ZC6 A;  1X3N A;  4KB0 A;  3LDP A;  3WXJ A;  4DV5 K;  1L3V A;  1CZB A;  5AQL A;  3UB5 A;  4GV3 A;  3RWU A;  2F7T A;  2NLX A;  3ZET A;  2QM1 A;  4FM1 A;  3EYZ A;  3C94 A;  5ELZ A;  4DWI A;  1QQN A;  1IKY A;  1UWB A;  4BQZ A;  4U67 L;  1RDA A;  3O08 A;  3TAB A;  2O4I A;  4Z4I A;  1X3M A;  1RT4 A;  4CHN A;  4KHU A;  1FKP A;  5EXW A;  2PZS A;  4BRO A;  1HLU A;  2QWR A;  4WYB A;  3THX B;  1LV5 A;  3DOK A;  3AVM A;  3RMD A;  3C0B A;  1E4G T;  5BRE A;  2IVN A;  4GNI A;  4YOR A;  2P9S B;  2Q36 A;  2YHX A;  4KRF A;  3F9M A;  2BH1 A;  4DQS A;  5FDL A;  5MLC Q;  2HB5 A;  3T1H K;  4AM7 A;  1VQ9 N;  2CH5 A;  4E19 A;  1K8A O;  1ATS A;  1J9A A;  3CHW A;  5AQY A;  5BPM A;  1VSD A;  1RDB A;  3OVN A;  3HZ6 A;  4BRP A;  2UYT A;  3RSE B;  3BGR A;  1BHL A;  2V7Z A;  3IRX A;  1IKW A;  4PY5 A;  4YY3 K;  4DMN A;  3CXC M;  3LPT A;  1FW6 A;  4M3W A;  4BWM A;  1C1A A;  1N36 K;  4CBU A;  1T3V A;  4CJS A;  5AQS A;  4MQ3 A;  1QTM A;  2ZF5 O;  2E2P A;  4X65 K;  4OX9 K;  3S3O A;  4B9S A;  3AVN A;  3SCX A;  1LWC A;  3D2E B;  1WSE A;  3L2V A;  3H08 A;  3VQA A;  3WUH A;  1ASW A;  4BAC A;  3OYD A;  1TL3 A;  3SYZ A;  4E1M A;  3ZSV A;  3SNN A;  3DLB A;  3NVM A;  1BU6 O;  1NK8 A;  1OH8 A;  3H6E A;  3E66 A;  2R7Y A;  1TYQ B;  1R0A A;  1K6Y A;  4YOT A;  2P1J A;  5LY3 A;  3QDK A;  3O3F A;  3GG4 A;  2LSN A;  3MMV A;  1YJW N;  1U47 A;  2JGU A;  4NLB A;  1BDG A;  1SUQ A;  1LCU A;  3UKR B;  3THW A;  1D9F A;  3VF4 A;  2Z1H A;  3EO3 A;  1O13 A;  1HKB A;  4N5S A;  3EL2 A;  3S3N A;  3OYB A;  4LF5 K;  1QHA A;  4DQR A;  1Q9X A;  4JI3 K;  1D4X A;  5C25 A;  5J1E A;  1YHQ N;  4J2B A;  1DGK N;  3CPW M;  2YX6 A;  5EY4 A;  2D0C A;  3TR8 A;  3J80 O;  4H0O A;  3H3N O;  4IOX A;  3ZSX A;  2IC3 A;  3UKU A;  3MX2 A;  1ATR A;  2A42 A;  3FFK B;  1HNZ K;  1NK6 A;  3KWI A;  3G0Z A;  3DRP A;  4CZE A;  3NMU A;  4H5N A;  2A6A A;  1JLC A;  3E1Y A;  4FJK A;  2RPI A;  2FF6 A;  4CJP A;  5AZI A;  4BDY A;  1BIS A;  1W9H A;  1OKJ A;  1P8Z A;  1TGO A;  3LDN A;  3VEN A;  4PKI A;  3VN5 A;  3GBT A;  3NF9 A;  3E9P A;  4DKW A;  4H0V B;  3O9S A;  1TK8 A;  4CZH A;  3CCL N;  1MDU B;  4KV8 A;  2P9K B;  4YOU A;  2ZE2 A;  2YJE A;  3MK6 A;  2ZD1 A;  2F9W A;  4JN4 A;  3N4Q A;  3MXJ A;  3HST B;  3CJ1 A;  3SK3 A;  1KVC A;  3VF2 A;  2F9T A;  4N76 A;  5FPD A;  4M3U A;  2OZM A;  3D45 A;  1U2V A;  2FF3 B;  1XHZ A;  4QS7 A;  4GW6 A;  3ENB A;  2V51 B;  3I0R A;  4JKC A;  4JKA A;  2HHU A;  1BGX T;  4CF1 A;  1TKX A;  1M90 O;  4AHU A;  4FCY A;  1NGD A;  3HK2 A;  1VSE A;  1KAZ A;  5LJW A;  4BDZ A;  1BA1 A;  4DTO A;  3CIP A;  3CFO A;  4BRQ A;  1D5A A;  1DLO A;  4IJA A;  5HRR A;  2FXU A;  4BR7 A;  3L0Q A;  3C6U A;  5FPE A;  1YUW A;  3JAM O;  3MED A;  4OPH A;  2VWK A;  5IT9 O;  3KD1 E;  4CE9 A;  4U7B A;  2AA4 A;  4O5B A;  4ID1 A;  2HVI A;  5EX5 A;  1ZBH A;  3CJB A;  3AA2 A;  1OVY A;  1YT3 A;  1SL0 A;  1K9M O;  1BIU A;  4CFB A;  4MFB A;  2Q0R A;  1ZBI A;  2Q3S A;  4WQ5 A;  2XY8 A;  3AA3 A;  2O8E B;  4QOZ B;  4CI6 A;  4CIG A;  2XRI A;  5M1Q A;  4A5A A;  1EXQ A;  1ZBU A;  3AVH A;  3K59 A;  4JKG B;  2NRX A;  2HHQ A;  4C8L A;  1I3A A;  1NJX A;  3CME N;  2PY5 A;  1VSI A;  3FE1 A;  3LDS A;  3J81 O;  4DU3 A;  4CHP A;  4GKJ K;  1R59 O;  4A2A A;  4CD3 A;  4BR5 A;  1T6C A;  1XNQ K;  2V7Y A;  3R3L A;  3MN6 A;  1YIT N;  3LP3 A;  4Y0W A;  4JKD A;  4E1N A;  2XY7 A;  4M42 A;  4I6M B;  4FWM A;  1JL2 A;  1QS4 A;  4RW4 A;  4ID5 A;  3CD6 N;  1EP4 A;  1CLQ A;  3HSC A;  3AGK A;  1Q8I A;  4AHC A;  3A0I X;  3F9K A;  4FVU A;  4E7K A;  2KFZ A;  1TK0 A;  4V19 S;  2IVO A;  5AQN A;  1S1V A;  3NE6 A;  5AQH A;  2QA4 N;  4TSX A;  3P4I A;  1MWK A;  1YJN N;  3V4I A;  4IBN A;  4BRC A;  5F0X A;  3TSU A;  1KAX A;  4FOI A;  1Q9Y A;  3PX6 A;  2P9U B;  3D2F A;  3BEX A;  4GVE A;  3IG1 A;  3HVT A;  3K9K A;  3EE9 A;  1HMV A;  3SQ2 A;  5AQF A;  2FSN A;  4ILH A;  3BZC A;  4E7I A;  2I7N A;  3CI5 A;  2KQ2 A;  1WSG A;  3CC2 N;  2AJQ A;  4F4K A;  4ELV A;  1MU2 A;  3O5B A;  3O9T A;  5JS1 A;  3CET A;  3TPQ A;  4H03 B;  3RRG A;  1LOT B;  4CHY A;  1VQM N;  4ZTJ A;  5AQQ A;  3NF8 A;  5I42 A;  2OA8 A;  3V9W A;  3TAR A;  3V1Q A;  4M3R A;  4H4O A;  2FLO A;  2GUI A;  1QSL A;  1BA0 A;  4KPY A;  4BC3 A;  1UAX A;  4OPK A;  1QZ6 A;  4M3T A;  3MEG A;  4BG9 A;  3VQ5 A;  3DXM B;  4AH9 A;  3LL3 A;  4DTP A;  4KKO A;  1RT1 A;  1S6Q A;  4XH4 A;  3SUP A;  4B3S K;  2E8A A;  2UXD K;  1WSI A;  2QW9 A;  3L2Q A;  1ASU A;  3HVR A;  3P5J A;  5M1F A;  3WQU A;  4CZF A;  4I9L A;  3AA4 A;  5IWA K;  1YTA A;  3LWL A;  2GEM A;  2WBN A;  4DHY A;  1S1U A;  2Q0U A;  4H0T B;  4FSV A;  4LH5 A;  4I2P A;  3CF5 L;  4M41 A;  3WNE A;  4KHW A;  4HVJ A;  3RMC A;  1T03 A;  1VQ6 N;  3LPU A;  3O8M A;  2VWB A;  4B9U A;  3OYF A;  4C8M A;  4ILG B;  3SV3 A;  4PKH A;  3DLR A;  4IXC A;  5K14 A;  3HM8 A;  4BY9 C;  4H5V A;  4OGC A;  2GUP A;  4LD0 A;  3MCA B;  1UA0 A;  5KTQ A;  2E2O A;  4CZM A;  4FJ7 A;  5GIO A;  4CJ4 A;  4NYN A;  4JI7 K;  5FRO A;  2UUB K;  4DSJ A;  1HNI A;  4WE1 A;  2IDO A;  2VYP A;  1O1W A;  3KLG A;  2EX3 A;  1HNX K;  1T6D A;  2B5J A;  5E26 A;  1X9W A;  3CC4 N;  3ZT3 A;  4JD2 B;  3TTD A;  1GLJ O;  4CFA A;  2HF3 A;  2HND A;  3QO9 A;  4FWR A;  4NLC A;  3CYM A;  3M8S A;  4JLH A;  2E6M A;  3N4P A;  4OLB A;  1EKE A;  3W0L A;  2I7P A;  1XNR K;  3VQC A;  1HUX A;  1OH7 A;  1TKD A;  4CHQ A;  1SL2 A;  4CJK A;  5AQR A;  4R5P A;  2D0A A;  1BIZ A;  2ASP A;  3RRH A;  4KTQ A;  2F96 A;  3OHR A;  4Z4C A;  3ITH A;  2P9P B;  1N6Q A;  4CVN E;  4YOX A;  3LAL A;  2O8D A;  1T44 A;  2PYL A;  2NNW A;  3FZL A;  3JXU A;  2QWO A;  4BC5 A;  1ESV A;  4O5F A;  2A3Z A;  4WF9 L;  4GMJ B;  4NCA A;  3K5O A;  2W6L A;  4UY8 O;  3C95 A;  3SPY A;  1Z6R A;  1KAY A;  1SQK A;  3H1Q A;  5E41 A;  1A5W A;  1KVA A;  1IG8 A;  4I9Q A;  1EET A;  4JI2 K;  1KTQ A;  4CJQ A;  4EIA A;  3ZYY X;  3RR8 A;  4R79 A;  5HRS A;  4B3T K;  4L3Q A;  1NNE A;  4CK3 A;  4H5W A;  3PY8 A;  4K0K K;  3OYM A;  3DLG A;  3NGY A;  5A2Q O;  3PV8 A;  4FJJ A;  4FPA A;  4FWQ A;  1GLB G;  1NGB A;  4C23 A;  5ADX A;  1WBB A;  1N32 K;  3ISN C;  1XWL A;  1KVB A;  3ZX0 A;  1B9F A;  4K8X A;  3S3M A;  4JI4 K;  3KLE A;  4DV3 K;  2F8T A;  3U3Y A;  5GAE P;  1JKH A;  4FJI A;  4GV9 A;  5M1O A;  4O0J A;  2YCH A;  4IEI A;  3ZLJ A;  3MWT A;  5SWM A;  1RFQ A;  1TVR A;  4OGE A;  3VQD A;  3QET A;  3D7E O;  4KHS A;  3HPG A;  4FXD A;  5AQI A;  1SKW A;  2W42 A;  5AZJ A;  1NMN A;  4JHD A;  5C15 A;  3FZK A;  3CJ9 A;  3KLF A;  4PL8 A;  3NAE A;  2W41 A;  3CMA N;  4EZ9 A;  1S6P A;  4CZK A;  1X1P A;  3KLH A;  4IO9 L;  5LMN K;  3R1X A;  4GV6 A;  3LP2 A;  3KD5 E;  2KZZ A;  1C6V A;  4MO5 A;  3TAQ A;  3AV9 A;  3LDO A;  4C1N I;  1V4S A;  3ATV A;  4DTU A;  3LAM A;  2O8C B;  1QVG M;  1W0H A;  4WQ4 A;  3CCS N;  4BWJ A;  2WON A;  2P5O A;  2D5R A;  3G71 N;  4CEO A;  4EP5 A;  4LF9 K;  4RG8 A;  3VA3 A;  3SUQ A;  5C2F A;  2ZJQ L;  5LJV A;  3FZM A;  1ASV A;  2VGM A;  3VES A;  3QEI A;  2P51 A;  1VK0 A;  2G8K A;  4WFB L;  3KJV A;  5J2Q A;  1S5J A;  5KQ8 A;  2G8V A;  5FLX O;  2PBD A;  2XY6 A;  4DR7 K;  4IDH A;  1BG3 A;  4OKE A;  1U49 A;  2D0O A;  1J5O A;  3NF6 A;  1J6Z A;  3JSM A;  1NGF A;  3RMB A;  3KK3 A;  3L3U A;  4DR6 K;  4CEA A;  1EX4 A;  2BUP A;  5JMV A;  1DEJ A;  3OW2 M;  1GOA A;  5GIP A;  4LF7 K;  4B1X B;  4CHO A;  4BE2 A;  4B9L A;  2PYJ A;  4DR3 K;  4B1U B;  3HO1 A;  2HST A;  4AHT A;  4PQU A;  1YI2 N;  2E88 A;  3VGM A;  3G4S N;  3TAE A;  1NU0 A;  1KLM A;  3HPH A;  4CZJ A;  4IJN A;  3VQ9 A;  2OPP A;  3A8Y A;  4X64 K;  3I56 N;  4DSE A;  2YKN A;  1RBS A;  1A5V A;  4M7Y A;  3S9H A;  1HPZ A;  3J7A P;  5C42 A;  2E2N A;  4IFY A;  3DYA A;  1WSH A;  4IKF A;  4NXN K;  3WXM B;  3B6P A;  1K73 O;  3KIO A;  4FM2 A;  1MWM A;  4NCB A;  1NOY A;  3MXM A;  3WT0 A;  1NOZ A;  3VQQ A;  4BGA A;  1ZBS A;  5CY4 A;  1NGI A;  1TK5 A;  1T7P A;  1U6Z A;  4M3Z A;  1JLE A;  3HBT A;  3HL8 A;  4JS4 A;  3ATU A;  5BRD A;  1LW2 A;  2YJF A;  4A5B A;  1TV6 A;  4LSL A;  3QBW A;  3WEE A;  3DRR A;  2XHB A;  2P9I A;  3FFI A;  1XC9 A;  4IOA L;  4YHH K;  3CCJ N;  4KH6 A;  1DTQ A;  2W40 A;  4HHT A;  1YJ9 N;  4XH1 A;  1N34 K;  3SMS A;  1NGH A;  1V4T A;  3CCM N;  3U8X A;  2VQF K;  4CIE A;  5AQZ A;  3IDH A;  3QLH A;  1KRP A;  4BRE A;  4QS8 A;  4OVL A;  4BE1 A;  3CCQ N;  4CFC A;  1W7A A;  4Y1C A;  3ZSZ A;  3NH0 A;  4E7J A;  5KPR A;  1QZ5 A;  1N33 K;  4FJN A;  1VSM A;  1RTJ A;  4DV1 K;  4B08 A;  3CJ7 A;  4FO0 A;  4BQL A;  3HXM A;  2JLE A;  3AVL A;  4E7H A;  4LFC K;  5F1X A;  3HOT A;  1TUU A;  2D0P A;  3FR0 A;  4FW1 A;  2GTD A;  1REV A;  4JKB A;  4JRQ A;  4CED A;  4GKK K;  4WQ4 C;  3C6T A;  3BUZ B;  2HVH A;  4DV7 K;  3QEV A;  1T8E A;  3ZEU B;  2OAN A;  3TWH A;  1BCM A;  3AGR A;  3B6O A;  3U4L A;  1JCG A;  4CGG A;  3H3O B;  1WSF A;  3HPO A;  2YI1 A;  3WXK A;  1JXB A;  1KD1 O;  1VQ7 N;  3FZH A;  2HBL A;  2ZGY A;  2ZM6 K;  2IAJ A;  4M3X A;  4JKH A;  4KHP K;  1Q81 O;  4GVM A;  4BE0 A;  4O0I A;  4A62 A;  3NDK A;  2UXB K;  3VQ6 A;  4FK0 A;  4F9O A;  3VQ4 A;  5C12 A;  3QNO A;  3L3V A;  4C8N A;  4CD1 A;  2G8F A;  4CF2 A;  3LP0 A;  2KFN A;  1NK4 A;  2ASO A;  4W5T A;  2DY4 A;  3CPE A;  1RT3 A;  4HTU A;  3AVB A;  3C7N A;  4MDA A;  1C0T A;  2ITG A;  4DV0 K;  1NJW A;  4DTJ A;  2GBZ A;  4Z4E A;  1HQU A;  4FWL A;  4J2E A;  1X9S A;  1EWQ A;  2Q2R A;  4HUG A;  1E4F T;  3V1O A;  4FPB A;  5BN8 A;  4H0X B;  1G99 A;  5HOO A;  4DU1 A;  1VQ5 N;  4FWO A;  3RMA A;  2NUB A;  4CEE A;  5TKW A;  4DFM A;  3P1G A;  4FWK A;  4ELT A;  4H8K A;  2WC9 A;  5AQG A;  3IMX A;  5KGW A;  3SJJ A;  3QIP A;  1VQL N;  4DFJ A;  2Q31 A;  2X6N A;  4O4G A;  4DQI A;  4F8R A;  4EZ6 A;  4JI0 K;  4CEC A;  1NG9 A;  2YNI A;  2QXF A;  5KRT A;  4ELU A;  3AA5 X;  1JCE A;  1YF5 L;  2D0B A;  2BGG A;  3DLE A;  4JKE A;  4G9Z A;  2B4J A;  4DFK A;  5AQJ A;  1IBL K;  5LL6 Z;  1J5E K;  3BF3 A;  1BI4 B;  4CEB A;  2A5X A;  2YKM A;  4H5R A;  3VQ8 A;  2IGI A;  3U9D A;  1BOT O;  4FWS A;  4B9V A;  2PFU A;  5HL7 L;  3HT3 A;  1C0F A;  1TUY A;  2DFE A;  3KK7 A;  3NGZ A;  3QEX A;  5JIC A;  1ZYQ A;  4HUF A;  1S22 A;  4BRF A;  3SQ4 A;  5F2R A;  2QWQ A;  3THX A;  1VHX A;  1FK9 A;  3ASM A;  4MLH A;  2IVP A;  2P9S A;  3MN5 A;  1N8R O;  3KKS A;  4CZG A;  3SQ1 A;  3QIC A;  4ZHR A;  2YHA A;  5AR0 A;  4E0D A;  4CIF A;  3THY B;  4LFA K;  4DB3 A;  1HQE A;  4FM0 A;  4DUY K;  4CGF A;  1RTI A;  3H46 O;  4J8F A;  4JK7 A;  4WCE L;  4DUZ K;  3AVA A;  4MDB A;  2E2Q A;  5FPN A;  4BR0 A;  3O6W A;  1IH7 A;  4DF8 A;  1GLA G;  5C0Y A;  1DT9 A;  4IO8 A;  3RSE A;  4AF1 A;  3IS9 A;  4PKG A;  5AQP A;  4B9Q A;  4J2A A;  4CF0 A;  4DS4 A;  3PO5 A;  5H1S Q;  4RW6 A;  5AQV A;  4NO7 A;  3TSQ A;  4YDU A;  3VQ7 A;  4E89 A;  5ADX H;  1D8Y A;  4DQP A;  4CZI A;  3A5N C;  3W3D A;  4A59 A;  3IFR A;  3IKM A;  1LW0 A;  3ZCM A;  3MAQ A;  3OY9 A;  5AQO A;  2IIR A;  1YVU A;  3D2E A;  4FLY A;  2OPQ A;  4LFB K;  4CEZ A;  4CJW A;  2OTL N;  4Q5V A;  1RIL A;  3O9Q A;  5KRS A;  1NKE A;  3BY5 A;  3MWP A;  4KAZ A;  5BRH A;  5I3U A;  1TYQ A;  1ITG A;  4IDK A;  1C1B A;  1VRT A;  3DJC A;  3VEW A;  1N5Y A;  3KLI A;  4BRH A;  4O8K A;  3L2U A;  1HYZ A;  3M8P A;  2FBY A;  2P9N B;  3IUC A;  4HUE A;  3QNN A;  4HCC A;  3UKR A;  4DLG A;  3P38 A;  2ASM A;  1XHX A;  5AJ3 K;  3E9O A;  2P5G A;  3IAY A;  1KQS M;  3VQP A;  4K43 A;  4W5R A;  3ZET B;  2DTU A;  3MXI A;  1GOB A;  4AHR A;  4RCH A;  3D6R A;  5DM7 L;  3E9L A;  2QKK A;  4CGH A;  5D3G A;  1Q18 A;  3K2P A;  4CBX A;  2PAV A;  1IO2 A;  4A61 A;  4BRM A;  1HJR A;  3ID8 A;  2GWK A;  3S41 A;  4FLX A;  3AVK A;  3FLC O;  3CCU N;  3QER A;  2GV9 A;  2OYQ A;  4O8U A;  4RW7 A;  2VQE K;  3VQE A;  1VSK A;  3GE1 A;  3NGI A;  4LC9 B;  2G8U A;  5BPL A;  3PLA A;  4WFA L;  3I55 N;  1NGC A;  4JK8 A;  4DR2 K;  3V9Z A;  1QQC A;  3LZI A;  3LDQ A;  3DMJ A;  3O1W A;  3TAM A;  2XO7 A;  1U48 A;  2P9K A;  4AQY K;  4BGB A;  3R6M A;  3VER A;  3VMF B;  3ULD A;  4I2Q A;  3PUF A;  3AAR A;  4KBO A;  3DAW A;  3SAF A;  4B3M K;  4FW2 A;  5HLF A;  2YV0 X;  2O8F B;  3CER A;  4CJ5 A;  4H0P A;  4C8K A;  2QTD A;  4DR5 K;  4H5T A;  3OYH A;  1JLQ A;  3CJA A;  4AM6 A;  4DF4 A;  1HNW K;  3KKR A;  4ILJ A;  3PO4 A;  3OS0 A;  4CES A;  3HRG A;  3CQY A;  4CK2 A;  2O4G A;  3I8D A;  2YHW A;  1U04 A;  4BC2 A;  3AO1 A;  4JYA K;  3C65 A;  3JYT A;  4Z94 A;  1D9D A;  4ICL A;  2NRZ A;  5AFU A;  4M3Y A;  2JWL A;  5M1K A;  3OJS A;  3VEV A;  5SZT A;  1NLV A;  1L3S A;  4CJR A;  5B8H A;  4YDU C;  1HYS A;  1VRU A;  5CYQ A;  3HM9 A;  1FKO A;  4IZ9 A;  3SLC A;  3J7Z O;  1BQN A;  4FL9 A;  1IV0 A;  3M1F A;  3B8A X;  3AVG A;  1JLG A;  1GLC G;  2V52 B;  3V1R A;  1SZ2 A;  5HBM A;  3OYA A;  2BDP A;  2VG6 A;  2UUC K;  2BE2 A;  1GLL O;  4B9N A;  4DCH A;  2O8E A;  1GLD G;  3F5T A;  3THW B;  4DTS A;  1RT7 A;  2X6S A;  3LDL A;  1TAQ A;  3KHY A;  3OS2 A;  4JKG A;  4FOE A;  3K58 A;  4YOY A;  1YAG A;  4JI5 K;  3BF1 A;  1C1C A;  4O44 A;  4FJ8 A;  1ZBL A;  5CZ1 A;  5HRP A;  1RTH A;  4YFU A;  5CHI A;  1WB9 A;  1I39 A;  4OKJ A;  3PSI A;  4NCG A;  4DFP A;  2GX9 A;  2KHO A;  2HHV A;  3AY9 A;  4JI1 K;  3UKU B;  4DV6 K;  4E3S A;  4I6M A;  4CJ7 A;  2Q97 A;  1XMO K;  2RHK A;  3LM2 A;  1K8K B;  5AZI B;  3JS6 A;  2YNG A;  1HYV A;  2HNZ A;  3SMP A;  4E7L A;  4HTL A;  4KTW A;  3ZT2 A;  4EP4 A;  5BPN A;  4FWP A;  1ZXO A;  3DWL A;  3A5L C;  3CC7 N;  4LH4 A;  1WAF A;  1W97 L;  4QAG A;  1HRH A;  2QK9 A;  4HCB A;  3TI0 A;  1RGI A;  1S3X A;  4XIU A;  1UA1 A;  1I94 K;  1TKZ A;  3CCV N;  5C2D A;  1KC8 O;  3T1A A;  4EHU A;  3PX4 A;  3DI6 A;  3KK2 A;  3OYG A;  1Y97 A;  2YHB A;  1B92 A;  3LAK A;  1BL3 A;  5AQW A;  4CHZ A;  2Q1N A;  2P9U A;  2NZT A;  1QSS A;  5JLH A;  1WSJ A;  1KFS A;  1J53 A;  4B8A B;  2E1Z A;  3PSF A;  4ISG A;  1BO5 O;  2HBM A;  1KSP A;  3PIP L;  2HNY A;  1YTU A;  1U2V B;  1VSF A;  4JEP A;  4CJU A;  1H1V A;  2G8I A;  2FBT A;  3H45 C;  3EZ5 A;  3AO4 A;  3QIO A;  4KH4 A;  4MO4 A;  4NYF A;  1XQS C;  2Z1J A;  4JI6 K;  3VQB A;  4KHN A;  3F73 A;  1YXQ A;  2E5L K;  3F2K A;  3NBP A;  3EKS A;  3ZT0 A;  3LZJ A;  4OPJ A;  2ITM A;  4OJR A;  2KLA A;  1OH5 A;  1ILY A;  3ZT4 A;  2CGJ A;  4B1V A;  4B1Y B;  3ALY A;  3P39 A;  3ZSR A;  2DFH A;  2P9N A;  1NJY A;  2Z1I A;  3VTH A;  3OYL A;  1RTD A;  3ENH A;  2G8H A;  4Z0U A;  3ZT1 A;  2UXC K;  3DXM A;  4OPA A;  2FSJ A;  1VSL A;  3M8R A;  5T7B A;  4FJH A;  1VSJ A;  2BTF A;  3D0P A;  5AQM A;  3OBY A;  2A41 A;  4O55 A;  2P9L B;  1U45 A;  1C0U A;  1NM1 A;  3NF7 A;  1HPM A;  4Q0B A;  3DLL L;  3SAG A;  3VET A;  1L5U A;  1QHT A;  2E20 A;  2VG5 A;  4NB4 A;  3EEQ A;  4IG3 A;  1QSY A;  2ZJP L;  2Z1G A;  3HJF A;  3G25 A;  3T69 A;  3OYE A;  2AP1 A;  3O3G A;  4PUO A;  3VF6 A;  4FJM A;  2OPS A;  4DTX A;  4CJ3 A;  2EHG A;  5M1P A;  2ZQB A;  4CK1 A;  2NRW A;  3FZF A;  3AO5 A;  1CXQ A;  2E1Y A;  5C10 A;  4BR9 A;  4C8O A;  1Q86 O;  1JCF A;  1VQ4 N;  4FVM A;  2YNF A;  1L3U A;  5AQU A;  1WOQ A;  3KWG A;  5HP1 A;  4AHV A;  3HOS A;  1YVN A;  4B8C A;  4CF8 A;  5CYM A;  1DKG D;  1NKC A;  1CXU A;  3VEZ A;  3K5N A;  2HOE A;  1SKS A;  1HX1 A;  2HMI A;  1JXE A;  2A1S A;  3AAP A;  3WXL A;  2KZM A;  2O8F A;  2X78 A;  4YOW A;  3BP8 A;  3ID6 A;  4DG1 A;  3HI0 A;  4BRD A;  5HRO A;  4JD2 A;  3D2F B;  3ZSQ A;  1NK0 A;  1VSH A;  4G1Q A;  1KLN A;  1XUP O;  5J2M A;  3TU5 A;  3VTI A;  2E4L A;  1WAJ A;  1F21 A;  4M63 C;  1NGJ A;  1Z05 A;  4K8Z A;  5JVH L;  1C0M A;  2OCE A;  3ZSY A;  3TTC A;  3QEP A;  3QEW A;  2D4W A;  1X9M A;  1HNV A;  3L2W A;  3MEC A;  1VAZ A;  4FLU A;  3G6E N;  1LWE A;  4WFN L;  3M3Z A;  3LAN A;  2OTJ N;  3MN7 A;  4W5N A;  3OS1 A;  4IFE A;  2P9P A;  4DSK A;  4FJX A;  4B3R K;  2FBX A;  3WNH A;  3WNG A;  2ATQ A;  4NXM K;  3QIN A;  1NJZ A;  5JLF A;  1NJI O;  3NVK A;  2VGN A;  1VQN N;  3KK1 A;  4BG8 A;  1VQP N;  1IG9 A;  3TAP A;  3BDP A;  4DLE A;  2A40 A;  4Z4G A;  3FGU A;  3WQT A;  3VEY A;  1JJ2 M;  3DLK A;  4J2D A;  4B9T A;  2F4V K;  4BRL A;  4JKF A;  4DR4 K;  2FC0 A;  3SZ2 A;  3ZSW A;  3CM6 A;  4KHY A;  3VA0 A;  2Y1I A;  4N47 A;  3M6G A;  2RN2 A;  2WUS A;  2G8W A;  1X9J A;  1EWR A;  2HBJ A;  4BR4 A;  4B1W B;  2W6K A;  1K8K A;  3RVC A;  3OYK A;  3CQX A;  2FBV A;  4DSL A;  3DRS A;  3LWM A;  5KI6 A;  4DV2 K;  3M8Q A;  3Q7C A;  4KH5 A;  4HWI A;  4F2R A;  3K9J A;  1NGE A;  2JWK A;  2QWL A;  4CFD A;  4KO0 A;  4DS5 A;  1QQO A;  3L4Q A;  4BRA A;  4AHS A;  3DM2 A;  2HMP A;  3AVI A;  2VWJ A;  3J7Y P;  1P90 A;  3QML A;  3T19 A;  4RTF D;  3THV A;  2O8B B;  1OVQ A;  4BVP A;  1BWF O;  1C0G A;  5CR4 A;  2HHW A;  2D1K A;  3CJC A;  3QFU A;  1S1W A;  1WLJ A;  2HHT A;  2CH6 A;  5HRN A;  1RT6 A;  5E84 A;  3NH1 A;  1S1X A;  4IEE A;  1Q7Y O;  3HYF A;  2ETJ A;  2ZGZ A;  1IKV A;  3OYI A;  4BRN A;  2O8C A;  4K41 A;  1NK9 A;  1VQK N;  4MLE A;  4FLV A;  3E01 A;  2NRH A;  4KB1 A;  3GL1 A;  4L8R B;  4ZTF A;  4JS5 A;  3LP1 A;  2VCP A;  1HJO A;  1LAV A;  1UOC A;  2OZS A;  2HHH K;  5AFU H;  1M1K O;  5JS2 A;  3CFP A;  3VEO A;  1Q82 O;  3TAF A;  5BR8 K;  4KRE A;  3C6A A;  3DOL A;  1BCO A;  1RDU A;  3SBT A;  3P31 A;  2O8D B;  1Z26 A;  3VGK A;  5AQK A;  3A5O C;  5LMU K;  2F8S A;  1RDW X;  1YIJ N;  3O1B A;  3ULE B;  2P9L A;  3EE8 A;  5KPZ A;  1TAU A;  3EY1 A;  3AAQ A;  4BRI A;  4IG0 A;  3QES A;  3SPZ A;  2HHX A;  1E3M A;  4X62 K;  1KFD A;  4OLA A;  4BRK A;  3Q7B A;  1SAZ A;  2RF2 A;  3OBW A;  4W5Q A;  1SV5 A;  4BVO A;  5FPM A;  1JLA A;  2DPN A;  2WTU A;  4CJF A;  2NRV A;  1B9D A;  3H1V X;  3QFP A;  3DXK B;  3O3H A;  3EN9 A;  4CGD A;  4XEI A;  4FK4 A;  4GY2 B;  3RR7 A;  4EFH A;  3TAN A;  3V6D A;  2RE2 A;  2BAN A;  3OYJ A;  3V81 A;  3TAG A;  4JRP A;  4DQQ A;  4C1N K;  3HP6 A;  4BC4 A;  5CZ2 A;  1NMD A;  5FRN A;  4XH5 A;  3KVG A;  3VEX A;  3P83 D;  4CBW A;  4CER A;  2WOM A;  1JL1 A; 
#chains in the Genus database with same CATH homology
 1J5E K;  4CW7 B;  2E5L K;  5AJ3 K;  4DR3 K;  4JI2 K;  4GKK K;  1FJG K;  2UUC K;  4YY3 K;  1IBK K;  4B3T K;  4DV7 K;  4K0K K;  1XMQ K;  5A2Q O;  2UUA K;  1N36 K;  4X66 K;  4V19 S;  1N32 K;  2UXC K;  4X64 K;  4DR1 K;  4X65 K;  2ZM6 K;  4JI4 K;  4OX9 K;  4B3R K;  2UU9 K;  4DV3 K;  4NXM K;  3J7A P;  4KHP K;  4JI5 K;  2HHH K;  2UXB K;  4NXN K;  4LF6 K;  4LF4 K;  5BR8 K;  4LFA K;  2VQE K;  4DUY K;  4JI7 K;  2UUB K;  4DUZ K;  4JI1 K;  4DV6 K;  2F4V K;  1HNX K;  1XMO K;  4DV5 K;  4DV4 K;  5LMU K;  4DR4 K;  4DR2 K;  4DV0 K;  3JAM O;  5IT9 O;  5LMN K;  4AQY K;  4X62 K;  4LF8 K;  1XNR K;  4LF5 K;  4B3M K;  4JI3 K;  1I94 K;  4YHH K;  1HR0 K;  4DV2 K;  4LF9 K;  4JI8 K;  1N34 K;  4LFB K;  4DR5 K;  2VQF K;  3J80 O;  1HNW K;  4JI0 K;  4CVN E;  4B3S K;  1HNZ K;  5FLX O;  4DR7 K;  3J81 O;  4GKJ K;  4JYA K;  3J7Y P;  2UXD K;  1N33 K;  1IBM K;  1XNQ K;  3T1H K;  4DV1 K;  4DR6 K;  4JV5 K;  3OTO K;  4JI6 K;  3T1Y K;  5IWA K;  4LFC K;  1IBL K;  4LF7 K;  5LL6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...