2UXCK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxcK00
4DR6K 4DUZK 5IT9O 4JI6K 4X64K 2VQEK 4DR1K 4DR2K 4GKKK 1N36K 5AJ3K 4B3MK 4DR4K 4NXNK 3JAMO 4X66K 4DR5K 4LFCK 4DV6K 4DV7K 4LF8K 4JYAK 2ZM6K 2VQFK 5LMUK 3J7YP 4LF5K 5LL6Z 4YY3K 5IWAK 4JI7K 1XNRK 5LMNK 3J80O 1HNWK 1HR0K 5BR8K 1J5EK 1XMOK 1IBMK 5A2QO 4V19S 4B3RK 2UUBK 2UU9K 2F4VK 4GKJK 2UUAK 4DV3K 4YHHK 3OTOK 1XMQK 4X62K 1IBLK 1I94K 2UXDK 1N33K 1HNZK 2UXCK 3J81O 2HHHK 4CVNE 3J7AP 4LFBK 1N34K 1FJGK 3T1YK 5FLXO 4NXMK 4LF4K 4OX9K 2E5LK 4KHPK 4DV0K 4JI1K 4JI0K 4DV1K 4JI5K 4LF9K 4CW7B 4DR7K 2UXBK 4X65K 4LF7K 4JI8K 4DV2K 4K0KK 4DR3K 1HNXK 4B3TK 4JI4K 3T1HK 4DV5K 1XNQK 2UUCK 4LF6K 4DV4K 4JV5K 4AQYK 1IBKK 1N32K 4DUYK 4LFAK 4JI3K 4B3SK 4JI2K
chains in the Genus database with same CATH superfamily
2BTFA 1ASUA 3ZT0A 3CMEN 2V7ZA 3P31A 1C0GA 2IOCA 3HSCA 4K41A 5BPLA 1KSPA 2QKBA 3JAMO 2KZZA 2E2OA 2HNDA 4DV6K 1NGDA 1GLEG 2Q2RA 4H5RA 3NH1A 3LWMA 2ZM6K 3AA2A 4DCHA 4LH5A 4CJLA 4E1MA 4DTJA 4CHPA 3L2WA 2QWOA 1UOCA 1L3SA 2I7NA 1NLVA 4NLBA 1XUPO 4DSIA 4EP5A 2BH1A 2WFBA 3B6OA 2O8FB 2E6MA 3R8EA 5EY4A 4CJSA 3HVRA 1KTQA 1VSMA 4CESA 3UKUB 3VF4A 3TTFA 3M8PA 1QVFM 3G71N 3V1QA 4DU3A 3E9PA 3WXJA 5EVZA 3V9ZA 2NNWA 3TSPA 5JVGL 1N33K 3FR0A 2BANA 1KVBA 3IUCA 4IXCA 3WT0A 1REVA 2Q0UA 2O8BB 4N47A 3CCRN 5C2DA 4DFMA 1WAJA 2F9TA 1X9MA 4FJHA 4QCLA 1T05A 1XC3A 3AO1A 1NGEA 2OZSA 3NF6A 2E6LA 2YX6A 4CBXA 5C2FA 3CQ8A 3NVKA 4DV1K 4I7FA 3K2PA 1GOCA 2DFHA 3F2KA 4NYFA 4Z4GA 3QEPA 1B9DA 4YOYA 3T1HK 4YOXA 3KD1E 3CERA 4BR0A 4RG8A 3QMLA 2P9SB 4JKCA 1BL3A 4Z4CA 5BN9A 4MFBA 5C15A 1A5XA 4M41A 4EFHA 3NDKA 3PX0A 3DLHA 3VQ7A 4CFAA 4FLWA 1K8AO 5F2RA 1W9HA 4IG0A 4FO0A 2YKMA 2B6AA 4IJAA 3THXB 2PYLA 4DSJA 3V1OA 1MWMA 1TAUA 2HNYA 1KFSA 4IEIA 2VGMA 4BC2A 3G6EN 1NJIO 3P4IA 4B3MK 4M3WA 5ADXH 4BRIA 4PQUA 1BWFO 3PSFA 2CH6A 4O44A 4CK3A 4W5OA 3AA5X 3PV8A 2O4IA 3K0SA 3U9DA 1HQEA 3MXJA 4DTUA 3CCSN 3KWIA 1QVGM 2VQFK 1M1KO 4F2RA 3M8SA 4C8OA 3DRRA 1RFQA 3SQ4A 1QHTA 2E20A 1CZBA 3DOKA 2E8AA 2BDPA 1S1UA 3J80O 1X9SA 4BGBA 4FXDA 1VSEA 1NK4A 4DQPA 3CC7N 4FJMA 3LZJA 2YHYA 1ZXOA 4B08A 4B1VA 3PO4A 2A1SA 1RTHA 4KI4A 4OGCA 5AR0A 1SS6A 4OKJA 4TSXA 4B8AB 1DTTA 2QA4N 3VQ9A 4CHYA 1QZ5A 4BWJA 5BRDA 3EY1A 1FW6A 1T3VA 2AP1A 3MN7A 1A5VA 1LV5A 4JS5A 2KTQA 5GINA 3D2FA 1GOAA 1N8RO 4CJEA 3VQDA 3CCEN 5FLXO 3K5OA 3O1BA 3A8YA 3TAEA 4GNIA 4GMJB 4W5NA 1KD1O 1VSFA 4JKBA 3HYFA 5LY3A 2NRRA 4DTPA 5ELZA 4BVPA 2KW4A 3NAEA 1HNXK 4B3TK 4JK9A 4DF4A 4IJNA 2NLXA 4KTWA 4K8ZA 1YTUA 2V7YA 4OGEA 1IG8A 4BWMA 4LFAK 3KJVA 3AO5A 4H5NA 3JXUA 3AAQA 1NKCA 1YHQN 4DR6K 3K5LA 1J53A 4DUZK 5DK5A 4Z4EA 2WUSA 2ITMA 1BQMA 1S1TA 2IVOA 4M3RA 5FRNA 3HK2A 4K8XA 4ELVA 1RBUA 1KRPA 1SUQA 2E4LA 3U3YA 2ZQBA 5AQFA 1YAGA 5I42A 5AQRA 2GTDA 3OJUA 4CJ3A 1M90O 2QWRA 1ZYQA 4G1QA 3ULDA 1Z26A 1SL0A 1QS4A 2G8WA 3M5RA 2GEMA 2Q97A 1TGOA 1FKPA 4ISFA 5LL6Z 4HUFA 2IC3A 3L8BA 4NCGA 3IMXA 1X9WA 3IG1A 4OVLA 5BR9A 1HR0K 2RE2A 4IG3A 4V19S 4FWQA 4EHUA 1F21A 2HHQA 4NLCA 2ZWHA 3D0PA 2IS3A 1YI2N 4CEBA 3DXMA 3KLIA 3TARA 3QEVA 1QQCA 1CXQA 4CK2A 1JLGA 2ZGZA 1RBRA 1Q82O 4CF9A 2HVIA 2GV9A 2P9SA 3TABA 4O5BA 3VEOA 4E7KA 3HPHA 4FZZA 1U4BA 1QZ6A 4IO9L 3KVGA 1RGIA 1RBSA 4AHSA 4U67L 3P5JA 1BISA 2KFZA 4BR4A 4DV0K 4H0TB 2B4JA 4LF7K 2P9LA 3TTDA 4WFBL 1R0AA 1LCUA 4FVMA 4LF6K 4DV4K 4M3YA 1H1VA 3TPQA 1HMVA 3A2FA 2RHKA 1DLOA 2HBLA 2W6KA 3QIPA 1U45A 4M3XA 1WSJA 1XWLA 2YNIA 1ASWA 4XH4A 1QSSA 3EZ5A 3AVKA 2O8CB 4M7YA 1YJ9N 4I6MB 3CQYA 1K8KB 3DI6A 4OLBA 2DFEA 4CZIA 4DR2K 2GBZA 3L0QA 5HRNA 2GWJA 3AGKA 4FLUA 3OJSA 3LZIA 4ELTA 1NK5A 4JKDA 1YUWA 1TKZA 3K9JA 1ZBUA 2G8IA 3DMJA 2H3GX 3AA3A 4MDBA 1U6ZA 1VQON 2JWLA 1TL1A 3ZSWA 5MLCQ 4OPKA 4JI7K 2Y1JA 4BRNA 1EETA 3CG7A 3C6TA 4BRLA 4I6MA 4H4MA 4DQRA 2E2NA 2UUBK 4JNEA 4KREA 4R79A 2KLAA 4CIEA 1T6DA 1OH8A 1SKSA 3AO4A 4H0OA 1K9MO 3OYBA 3GOIA 3TAMA 4X62K 3U8XA 3VQAA 4LD0A 1IBLK 1RT3A 2DY4A 3KTQA 3R9PA 1NGCA 1KLMA 3SK3A 3OS2A 2FSJA 4ISEA 3CXCM 2ASMA 4KTQA 1S5JA 4BVOA 2P51A 4CHOA 4HVJA 3LP0A 4B9UA 3H45C 3GL1A 5J2MA 1UAXA 2P5GA 1LWFA 4BG8A 3AVJA 2ATQA 4LF4K 4CJ7A 4AILC 2GX9A 2PAVA 1RT7A 5KQ8A 5F0XA 4DG1A 4LF9K 4A57A 4FWLA 4NB4A 3VMFB 2YI1A 3D7EO 4IOXA 4CZJA 1Q9XA 1VQ4N 4O55A 4Q5VA 3PY8A 4FK4A 1LW0A 1QE1A 2QXFA 1XHZA 4GV9A 1KLNA 3LAMA 5AQGA 4DS4A 2QW9A 4E0DA 1S6PA 4DTNA 1NJYA 4KHUA 3ZYYX 1Z6RA 1QHAA 2JWKA 3SYZA 1Q8IA 3DLRA 1Q18A 4DR1K 5GIPA 5I3UA 3EN9A 3NF8A 4N5SA 4NCBA 1N36K 4M7XA 4ZTFA 5AQIA 4WQ4C 3ZSYA 4E3SA 4FWSA 2E1YA 4CJVA 2HMIA 2O8CA 1YVNA 5AQZA 4BACA 3W3DA 3M1FA 4E1NA 3CJCA 3SNNA 1VQ9N 3VGLA 1HUXA 4DSFA 1VQKN 1WAFA 1GLBG 1QQNA 3HI0A 3J7YP 1ZBSA 3KHYA 3NGZA 3HVTA 1BCMA 3KK2A 3QINA 1T44A 4B1ZA 4IBNA 3FE1A 4FJLA 5ADXA 4H5VA 4JKFA 4FZXC 4O0JA 1VSDA 4QAGA 5AFUH 4JN4A 2NRWA 4E7HA 4J2AA 4KH6A 5AQTA 3B8AX 2P9KA 2BGGA 3FZKA 1BIUA 3HL8A 5HRRA 1VAZA 4BRPA 1BIZA 4CVNE 5AQMA 3SCXA 1BA1A 3LDSA 1EQYA 1VRTA 5HROA 3M3ZA 3CMAN 2PZSA 4M45A 4RWTA 3C7NB 3K5NA 3SQ2A 4DF8A 2CH5A 3QIOA 1BO5O 2E5LK 2NRZA 4KHPK 1OKJA 3BZCA 2O8DA 3SV4A 1U2VB 4AHRA 4BRCA 3CC2N 4CW7B 5AQLA 1ASVA 1KVAA 5CYQA 1L3TA 4B9QA 3AGRA 3K9KA 3VGKA 1C1BA 1X3MA 4K25A 3AVBA 3ZETA 4F4KA 3CM5A 1BU6O 2E1ZA 3CYMA 4N56A 4FJNA 3O6WA 2VWKA 3OS1A 3VA3A 3OW2M 4E7LA 4BRQA 2GELA 4M63C 1BDGA 4I2QA 1S1WA 1JKHA 4WFNL 3V4IA 1JJ2M 1NK6A 2YHXA 3VERA 1B92A 3TAQA 1HKBA 4MO5A 3F5TA 1TYQB 4LSNA 3SZ2A 4FVUA 4A5BA 4I9LA 3CPWM 3DLKA 4BDZA 2HF3A 3SAGA 3ZEUA 4JRQA 3L4QA 3U4LA 1BOTO 3AV9A 4RW8A 4HTLA 5HBMA 5C42A 4JK7A 3L2UA 4HCCA 3LANA 5GAHP 3VESA 3WXIA 4FJIA 5GIOA 4JKGB 4CFDA 3OY9A 3S3MA 2UU9K 3VQBA 3VQ6A 3P1GA 1P8ZA 4XH5A 3CJAA 5FDLA 3MK6A 3SPYA 3ZEUB 4LSLA 2HHWA 5FROA 2VWBA 3MX5A 1KXPA 1VQ5N 2O8BA 1I94K 1DT9A 3SBTA 3VEYA 4IZ9A 4CZGA 3MWTA 4N76A 1NMDA 3QETA 3EKUA 4ELUA 3AVMA 4DTOA 3RR7A 2HW3A 2ZF5O 4DTMA 2FBTA 4OPAA 2Z1JA 3TANA 3HPOA 3A5NC 3L4IA 3PO5A 4DQSA 3WQUA 3VGMA 5FPMA 4L3QA 3V9UA 1KFDA 3JS6A 4IFEA 2OANA 3CF5L 1NGAA 4JRPA 3IKMA 3ZETB 5FPDA 2F8SA 5M1NA 3CJBA 2YCHA 3SMSA 3RSEA 1X3NA 4GW6A 1ATSA 1NGBA 3ZX0A 1XQSC 3G0ZA 4CZFA 3AVNA 3LP2A 4E19A 2YJFA 3ZT1A 4IOAL 2QI2A 1ATNA 4YOWA 3NH2A 3KIOA 5KRTA 1ILYA 3M8RA 4CGGA 4I9QA 2O4GA 4BRAA 2KFNA 4DR4K 4WYBA 1HRHA 1RBTA 1U49A 2KQ2A 4RW6A 3IFRA 4AHVA 1QQOA 4DQIA 2B5JA 2HF4A 1QTMA 3SMPA 2FBVA 4K42A 1VSKA 5GAEP 5KPRA 4B1WB 4FLVA 1A5WA 1N5YA 1CLQA 5AQUA 2WONA 5AQNA 1EKEA 1YXQA 4CGJA 3OYJA 1XI1A 2HBMA 1W7AA 1WUAA 3DAWA 3A5OC 3KLHA 1FKOA 4BQLA 4KHWA 1TAQA 3M8QA 3QB0A 5BRFA 4EAHD 5SZTA 1BI4B 2P1JA 3VENA 3ALYA 1XMQK 4CF8A 1LW2A 4B3OA 2ASPA 3D6RA 3O8MA 4C1NK 2HHHK 4BE0A 2IVPA 4M3UA 4RW7A 5TKWA 4H4OA 5CHIA 2QWMA 4XIUA 2P5OA 4LFBK 2QXLA 4Y0WA 3THWA 4IKFA 3VPZA 1JLEA 2RF2A 4JS4A 3L2RA 1NJXA 3PIOL 4O5FA 3UKUA 2QM1A 1D9DA 3DYAA 4KV8A 4NXMK 4Z94A 4FWMA 3R6MA 4DFPA 4CEEA 4W5TA 4BE1A 1IKWA 2A5XA 3ZSXA 2XY5A 4CGIA 4RCHA 4FJ9A 4C8KA 3D45A 1RT2A 5AQYA 2P9UA 3UKRB 1VQLN 5EXWA 3LWLA 3U9ZA 3FFIA 3K58A 3I33A 3O3HA 3MWPA 2IIRA 3RWUA 4A2AA 3ENOA 5GAGP 3EE8A 4XEIA 3HOSA 4CD3A 5J2NA 4DU1A 2OPQA 3PLAA 3O4NA 2X6SA 3CQXA 3CFRA 3NBPA 3O9UA 4CERA 4AM6A 3KWGA 3KK7A 1J54A 2VQEK 5JICA 2YHWA 3LM2A 5CE3A 2OTLN 3H3NO 2OPRA 5AZJB 1SKWA 3SQ0A 4JYAK 4CJKA 5H1SQ 5C12A 1NGHA 2ITGA 3SLCA 4WE1A 4W5QA 3ZSRA 4JD2A 2A41A 4YY3K 1VSLA 4YOUA 3MX2A 4CEDA 2Y1IA 3QERA 4JAXA 3J8AA 2CGKA 5AZIA 2XRIA 5JLHA 2ZJPL 3VQ8A 3THVA 3AVIA 2ZD1A 4CGFA 4C23A 1JLFA 1JL2A 4FM1A 4A61A 5AQHA 4OLAA 2UUAK 3SAHA 1BHLA 3ZSZA 4H03B 3OYDA 3NGIA 3GBTA 1T03A 2YKNA 3WXKA 4PL7A 3K59A 2BUPA 1WBDA 1E4GT 4BRHA 5BRHA 3CC4N 1C6VA 1VSJA 4AF1A 1NM1A 1WNSA 1Y64A 1NK7A 4AHUA 3HM9A 1VQ8N 4HCBA 4DWIA 2EX3A 4CZHA 3FLCO 3CFPA 1CZ9A 4KHYA 3O9TA 4JI5K 4CJ5A 3OYCA 2F7TA 3MMVA 1OH6A 4PUOA 5AQVA 2YNHA 1TK8A 4E1JA 2P9NA 3B6PA 3ID8A 5HL7L 1IKXA 1BUPA 3LP1A 3GG4A 3DOLA 4F8RA 3E9LA 4BDPA 5CYMA 4CIFA 2RKIA 5EOYA 1QQMA 1SZ2A 2Q36A 3BY5A 3I55N 1LAWA 4E89A 3SBGA 4FK0A 3O9QA 4BROA 3KD5E 1J5OA 3VQPA 2YV0X 4ZHRA 4CJWA 3GE1A 4GV6A 3DLBA 3OYGA 4IFVA 3PX6A 1N6QA 2QK9A 3SUQA 3THYA 4M3ZA 2LSNA 4LF5K 1JCEA 1WSEA 1V4SA 4CZEA 3IS9A 5C10A 5AFUA 2HHSA 3DRPA 3AVFA 3VQCA 1IH7A 1NK0A 4YNQA 3AAPA 4FPBA 3D2EB 4CFCA 3LDQA 4QS8A 4KHSA 3O80A 3QLHA 4CIGA 5M1PA 5J1EA 3V9WA 4FJKA 5CZ1A 3TR8A 3RMAA 4F9OA 4Q0BA 4CZKA 1MA9B 3O3FA 1JLAA 1D9FA 4KO0A 4HUEA 3TSQA 1D5AA 3SAFA 1BI4A 1C0MA 1K8KA 3RMDA 1L5UA 1YITN 3THWB 3AVLA 3FZLA 4FLZA 3CPEA 1YIJN 3J81O 1CZAN 4OKEA 1TKDA 3ITHA 4KTZA 2HB5A 2NRHA 4CJFA 2E2PA 4NYNA 5TKYA 4LH4A 4FWOA 4E7IA 5CY4A 5AQQA 5HLFA 1UA1A 1LWCA 3MCPA 2P9LB 3VEVA 2HBKA 3R3LA 1L3UA 4W5RA 3C6UA 1YT3A 3THXA 3HP6A 4EIAA 1NGIA 5M1QA 2Z1HA 3CM6A 2VGNA 5HOOA 3AARA 4IDKA 3SUPA 1TK5A 1UA0A 1XNQK 2OTJN 2UUCK 2PFUA 5AQJA 4ISGA 3CD6N 4CJUA 1NMNA 5AQOA 1ZBLA 1DTQA 3AVHA 3CCUN 4C1NI 4CCHA 4KH5A 5BPNA 4WQ4A 2E88A 1NKEA 1BA0A 3KKSA 3VF2A 3DXMB 3BZKA 3H6EA 1VSIA 2HNZA 4FLYA 3MEGA 3KK3A 3HOTA 3HPGA 1NBWA 4BR2A 4DR5K 4X66K 2NZTA 3ZT3A 3PUFA 4DV7K 3HJFA 4YDUA 3I0RA 1RCHA 4KBOA 4LY7A 3NF7A 3I8DA 3V1RA 1TL3A 1GLFO 3LDPA 2YNFA 3O4WA 1S72N 3BF3A 4CE9A 3L3VA 4FPAA 3RTVA 3J7ZO 3I0SA 3HSTB 3OHRA 1XNRK 2G8VA 1HJOA 3HTVA 2A1RA 1NOYA 4B1UB 4CHQA 1LOTB 1KQSM 2NRTA 3N4QA 1KCFA 1W97L 2Z1IA 2JLEA 5C25A 1C0TA 3EEQA 2EHGA 2FSNA 1WSHA 2D1KA 4RW4A 4CJPA 2NRVA 2O8EA 4A5AA 4WCEL 1WB9A 5FPNA 3OYAA 1HNZK 3V81A 3SV3A 5FPEA 2FLOA 4DKWA 3TAPA 5E41A 3A0IX 2ETJA 2I7PA 2V52B 4CEQA 1ESVA 3PIPL 5AQXA 1J9AA 4BC5A 3T1YK 4OO1J 3PSIA 4FJJA 3ULEB 4BREA 3U6FA 1TK0A 2GUIA 1TYQA 2HHUA 1HKCA 3OA9A 1VQPN 5C0YA 2ZJQL 4KB1A 5JS1A 3CI5A 1G99A 4JHDA 2KKZA 2CGLA 1TKTA 3QNOA 2UXBK 4K43A 2D4WA 3H1VX 3TAGA 4FL9A 3EO3A 4B9LA 3QESA 3RR8A 3NCIA 1G15A 3ZT4A 4DV5K 2P9IA 1N32K 1NWKA 4OJRA 4DUYK 3Q7CA 3OYHA 2P9NB 4YORA 3VQ4A 2KZMA 3FFKB 4FOEA 4B8CA 1W0HA 5AQWA 1QSYA 4EZ9A 1NJWA 1W2BM 4WFAL 4DMNA 5KTQA 4LFCK 2FF6A 3C65A 2AA4A 4JKHA 4B9MA 4O0IA 3RRHA 2RPIA 3T69A 4PKIA 1UWBA 5HP1A 2Q3SA 2QEXN 1HLUA 4EHTA 4DHYA 3AO3A 1LAVA 1ZBIA 3CJ9A 1HNWK 3QO9A 4JKEA 3VA0A 4CBWA 3ENBA 3KK1A 3TU5A 2IDOA 4M3TA 3WQTA 2GWKA 3VOVA 3WXMB 3O4QA 4AHCA 3EZWA 2PBDA 3DLLL 4DFKA 5E84A 2W40A 3IRXA 4HWIA 4DV3K 2WC9A 5KGXA 2QWQA 1KAYA 1Q86O 2A40A 4HHTA 4MO4A 3M6GA 2XY7A 1XC9A 3A5LC 3J7AP 2WOMA 3ZCMA 3SUOA 3CIPA 1N34K 4BRMA 3KZBA 4Z0UA 1RTJA 4H5TA 2ZE2A 4OPJA 3I56N 3CCMN 3BUZB 4KB0A 3FZFA 3T1AA 3QDKA 4PKHA 1X9JA 1HX1A 3HO1A 2D0AA 1J6ZA 2E2QA 3OYMA 3U3GA 2G8KA 4WQ5A 3BDPA 1IJJA 3O3GA 3FZHA 4BDYA 1RT5A 3UE5A 3EL2A 1C0UA 1WLJA 4DR7K 3KLEA 4IFYA 3R1XA 4X65K 3VEXA 3LDNA 1SAZA 5I9EB 4FK2A 3G25A 3H3OB 2YJEA 4J8FA 1E3MA 3L2VA 4FCYA 1IO2A 3MAQA 2HHXA 2FF3B 1SQKA 3MN5A 3V9SA 4JI3K 1YJNN 2HHTA 1EXQA 5B8HA 3T3FA 1RDAA 4CJTA 4F2SA 3LDOA 5IT9O 3VQQA 5EX5A 4BRFA 5E26A 4DLEA 4FM0A 4J2BA 4CZLA 3HZ6A 3O5BA 1ATRA 3HP9A 3OVNA 2DPNA 4PY5A 3WNEA 2O8FA 4CJ4A 4FW2A 3E66A 2R7YA 4DSKA 3RMBA 2WBNA 3LPUA 3VEZA 4C8MA 1HYVA 1S1XA 3MEDA 1Q9YA 3OYFA 3V9XA 3IDHA 5BPMA 3JSMA 5IWAK 3ZX2A 3CCQN 4DLGA 1NGGA 5A2QO 4BE2A 4KI6A 1HYSA 1RDWX 1HYZA 3TWHA 3S9HA 2QWLA 1SL2A 5AQPA 3KLFA 4L8RB 4GVEA 4GVMA 1YVUA 3C0BA 1NU0A 4N41A 5CR4A 2PYJA 4DSLA 3SQ1A 1ITGA 3HBTA 3QEIA 2W42A 1OVYA 1K6YA 3BGRA 4O4GA 2A6AA 4H8KA 3SUNA 3T19A 2IGIA 3E1YA 4KFBA 1GOBA 3P83D 1FK9A 1KVCA 2QTDA 2X74A 2XHBA 3QNNA 2G8UA 1DKGD 5KRSA 1O13A 3S3NA 1TUUA 4JLHA 1SL1A 4FJ8A 1JLCA 5CZ2A 2QKKA 4CHNA 5BREA 4K0KK 1CXUA 5GADP 2YNGA 3FZMA 3N4PA 1WOQA 2CGJA 3SI6A 2OPSA 4WQ5C 2VWJA 2V51B 5JLFA 4JI4K 3HXMA 1WBBA 3EYZA 5KI6A 2XY8A 3OYNA 4CF1A 1IBKK 4IWVA 5DMRA 1S9EA 5LJVA 1U47A 2FC0A 1Z05A 4B1YB 1MU2A 1BG3A 4Y1CA 1R59O 1DGKN 3S3OA 4X64K 1NNEA 4GKKK 2FSKA 5JMVA 4Z4IA 2KHOA 1JXEA 4CI6A 4NXNK 3PX4A 4BY9C 2IVNA 1L3VA 3QEXA 3IAYA 4NCAA 4KHQA 1Q7YO 1C1AA 1C1CA 4AHTA 4R5PA 4FYDA 2AJQA 2I5JA 2D5RA 4CJQA 1VHXA 4A2BA 3NMUA 4FJ7A 1KAZA 4BC3A 2HSTA 1P90A 3VTIA 3O1WA 3VF6A 4YOTA 2GUPA 3O9SA 1NOZA 3ZSOA 1Y97A 3VQEA 1D8YA 5M1FA 5BN8A 3NGYA 1HPZA 1XMOK 5AZJA 3P39A 3CCLN 1T8EA 1NG9A 4B3RK 4JHDB 4CHZA 2NUBA 4CF2A 1U04A 1V4TA 4OPHA 5F1XA 4YHHK 2PY5A 2DFFA 1JL1A 1T7PA 3O08A 2UXCK 3DJCA 2J4RA 4UY8O 1TV6A 4YDUC 3A5MC 4PL8A 1JLQA 4CZMA 2RN2A 1RILA 3K57A 4MLEA 1S3XA 3DLGA 3SPZA 3RVCA 1FJGK 3RSEB 3QFUA 1HNVA 3EKSA 4FWRA 2QWNA 4KAZA 3ATVA 3H08A 4ICLA 2P9UB 3UKRA 4CECA 4EP4A 4CJRA 3AA4A 3WEEA 4F3TA 3D2FB 4NO7A 1NGJA 4G9ZA 4MDAA 2DTUA 1GLLO 1JCGA 3S41A 1OH5A 1I3AA 3ATUA 2XO7A 4DTRA 5LJWA 1EWQA 2HBJA 4BR7A 4AQYK 4DTXA 3VEWA 3NHGA 1JCFA 2O8EB 3TAFA 1HPMA 4FZYA 3ZT2A 1RBVA 4F3OA 4JI2K 3QBWA 3F9MA 4FSVA 1GLAG 3OS0A 3MDQA 3KKRA 4C8NA 3DWLA 1U2VA 1VRUA 2IAJA 4H5WA 1K73O 3UIQA 1HKGA 3F73A 1RTDA 4CK1A 3AO2A 3BEXA 4PA1A 3LDLA 3MXIA 1NGFA 4BGAA 4JKGA 5T7BA 4IOCL 2OPPA 3L3UA 2HMPA 1FXXA 1RT1A 3DLEA 3ULEA 4FWPA 3AVAA 4BR5A 4HTUA 1EO1A 3MECA 4CEAA 5EU7A 4IDHA 4BQZA 4DSEA 5DM6L 5LMNK 1S6QA 2VG5A 1EP4A 2XY6A 1S22A 5BR8K 3HRGA 3Q7BA 3WNFA 4DB3A 3K5MA 3QFPA 4U7BA 5FRMA 4KRFA 3CJ1A 3VQ5A 5HRPA 4GKJK 4Y1DA 3MXMA 3OBYA 4DQQA 4YOVA 3UB5A 3L6QA 1YJWN 3ZLJA 3E01A 3ZSQA 2UXDK 3P38A 3LL3A 4MQ3A 2ASOA 3I8BA 5J2PA 5J2QA 3LAKA 3LP3A 1IG9A 1VSHA 1DEJA 4QOZB 4E7JA 3VETA 3F9KA 1RDCA 3LPTA 3T7ZA 5DM7L 4FLXA 1SKRA 4DQ8A 3MEEA 1S9GA 3MN9A 2W41A 2W6LA 5JVHL 3C95A 3QICA 2O8DB 3AVCA 2FBYA 4PWDA 4DV2K 4H0YB 3G4SN 4DR3K 4DU4A 1BQNA 3QEWA 1GLCG 3VN5A 1I39A 2VCPA 2WTUA 4JK8A 4IEEA 3W0LA 4BG9A 3CCJN 1HQUA 5M1OA 4CBUA 1O1WA 3ZX3A 2D0BA 2D0CA 3CHWA 1RT6A 4C8LA 1MWKA 5M1KA 1MDUB 3RRGA 3ISNC 3OYLA 2ZGYA 1VQ6N 3C6AA 3D2EA 4XH1A 1SV5A 2NRXA 4RW9A 4GY2B 4GV3A 3OYEA 3C6HA 1VQ7N 1ZBFA 2Q1NA 4B9NA 2A42A 3E9OA 3OYIA 2UYTA 1RDBA 4QS9A 1JLBA 1WN7A 4ILHA 2Q31A 4FM2A 4B9SA 2D0PA 4AM7A 2FBXA 3TTCA 4ILJA 4ID5A 2HHVA 1BGXT 3LALA 4J2EA 2YHAA 2P9KB 3DRSA 3WUHA 3ASMA 2OCEA 4MLHA 3HM8A 5C24A 4PHTX 2D0OA 3L2QA 1IKVA 2QWPA 3NE6A 4FOIA 2VG6A 1E4FT 1JXBA 3O9RA 4H0PA 4DS5A 2F4VK 3NFAA 1KC8O 2OYQA 3C94A 4JEPA 5KQDA 3RMCA 1WSFA 1TKXA 4FWNA 3SJHA 3AVGA 4O8KA 4RTFD 3MN6A 1HJRA 4B1XB 2G8FA 5KPTA 1TUYA 1RDDA 4Z4HA 4FJ5A 1KAXA 1YF5L 3NVMA 1Z25A 3THYB 4BRGA 1U48A 4FWKA 3CJ7A 4I2PA 1NK8A 1QSLA 4CEFA 5AQKA 2OA8A 4OX9K 4EZ6A 4ID1A 1ZBHA 1IKYA 4FJXA 4CGDA 1IV0A 3GDQA 4WF9L 4JI8K 3WEEB 4CD1A 2YHBA 2JGUA 3TI0A 3C7NA 1Q81O 3LM9A 1VQNN 4JV5K 1BCOA 3NH0A 4HUGA 3ID6A 4CFBA 4B3SK 4CEZA 3WNGA 2X78A 3DXKB 1VQMN 4QS7A 4ZTJA 1GLDG 3OBWA 1ZC6A 5AZIB 4JI6K 3KLGA 1TVRA 4OKKA 2VG7A 5AJ3K 3G10A 1WSGA 1X1PA 4YFUA 1C0FA 4H0VB 3CETA 2VYPA 2FXUA 3TSUA 3HT3A 4LF8K 1B9FA 4CEOA 4JD2B 1NKBA 4H0XB 1T6CA 1EWRA 4KHNA 4KH4A 2F8TA 1XHXA 4FLTA 4A62A 5LMUK 4LC9B 4A59A 4IO8A 5D3GA 3MCAB 5HRSA 1GLJO 3VTHA 2G8HA 4J2DA 1OVQA 1YTAA 3ZSVA 2P9PA 4DFJA 1J5EK 1D4XA 1RTIA 5K14A 1WSIA 1IBMK 3JYTA 4UQGA 4B9TA 4BRKA 3NF9A 2ZJRL 3H46O 2Z1GA 3OTOK 1OH7A 1LWEA 1RT4A 4O8UA 2P9PB 4BC4A 5SWMA 2F96A 5AQSA 5JS2A 2Q0RA 4ILGB 2F9WA 4M42A 2HOEA 4KKOA 4BRDA 2BE2A 2EWSA 4Z4FA 2X6NA 3OYKA 1EX4A 1HNIA 2OZMA 4JI1K 1NJZA 4JI0K 2HVHA 3AY9A 4KPYA 4DTSA 5KPZA 3V6DA 3WNHA 3ENHA 4FJGA 3H1QA 5KGWA 1S1VA 1RDUA 1RNHA 1VK0A 3BF1A 1NK9A 4B9VA 4CF0A 3SJJA 3CFOA 4CGHA 2A3ZA 4AH9A 3BP8A 2P9IB 4BR9A 3EE9A 3CCVN 3DXKA 3WXLA 3FGUA 3DM2A 4JKAA 3QBXA 4PKGA 4FW1A
chains in the Genus database with same CATH topology
4DR6K 4DUZK 5IT9O 4JI6K 4X64K 2VQEK 4DR1K 4DR2K 4GKKK 1N36K 5AJ3K 4B3MK 4DR4K 4NXNK 3JAMO 4X66K 4DR5K 4LFCK 4DV6K 4DV7K 4LF8K 4JYAK 2ZM6K 2VQFK 5LMUK 3J7YP 4LF5K 5LL6Z 4YY3K 5IWAK 4JI7K 1XNRK 5LMNK 3J80O 1HNWK 1HR0K 5BR8K 1J5EK 1XMOK 1IBMK 5A2QO 4V19S 4B3RK 2UUBK 2UU9K 2F4VK 4GKJK 2UUAK 4DV3K 4YHHK 3OTOK 1XMQK 4X62K 1IBLK 1I94K 2UXDK 1N33K 1HNZK 2UXCK 3J81O 2HHHK 4CVNE 3J7AP 4LFBK 1N34K 1FJGK 3T1YK 5FLXO 4NXMK 4LF4K 4OX9K 2E5LK 4KHPK 4DV0K 4JI1K 4JI0K 4DV1K 4JI5K 4LF9K 4CW7B 4DR7K 2UXBK 4X65K 4LF7K 4JI8K 4DV2K 4K0KK 4DR3K 1HNXK 4B3TK 4JI4K 3T1HK 4DV5K 1XNQK 2UUCK 4LF6K 4DV4K 4JV5K 4AQYK 1IBKK 1N32K 4DUYK 4LFAK 4JI3K 4B3SK 4JI2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 K;  4DUZ K;  5IT9 O;  4JI6 K;  4X64 K;  2VQE K;  4DR1 K;  4DR2 K;  4GKK K;  1N36 K;  5AJ3 K;  4B3M K;  4DR4 K;  4NXN K;  3JAM O;  4X66 K;  4DR5 K;  4LFC K;  4DV6 K;  4DV7 K;  4LF8 K;  4JYA K;  2ZM6 K;  2VQF K;  5LMU K;  3J7Y P;  4LF5 K;  5LL6 Z;  4YY3 K;  5IWA K;  4JI7 K;  1XNR K;  5LMN K;  3J80 O;  1HNW K;  1HR0 K;  5BR8 K;  1J5E K;  1XMO K;  1IBM K;  5A2Q O;  4V19 S;  4B3R K;  2UUB K;  2UU9 K;  2F4V K;  4GKJ K;  2UUA K;  4DV3 K;  4YHH K;  3OTO K;  1XMQ K;  4X62 K;  1IBL K;  1I94 K;  2UXD K;  1N33 K;  1HNZ K;  2UXC K;  3J81 O;  2HHH K;  4CVN E;  3J7A P;  4LFB K;  1N34 K;  1FJG K;  3T1Y K;  5FLX O;  4NXM K;  4LF4 K;  4OX9 K;  2E5L K;  4KHP K;  4DV0 K;  4JI1 K;  4JI0 K;  4DV1 K;  4JI5 K;  4LF9 K;  4CW7 B;  4DR7 K;  2UXB K;  4X65 K;  4LF7 K;  4JI8 K;  4DV2 K;  4K0K K;  4DR3 K;  1HNX K;  4B3T K;  4JI4 K;  3T1H K;  4DV5 K;  1XNQ K;  2UUC K;  4LF6 K;  4DV4 K;  4JV5 K;  4AQY K;  1IBK K;  1N32 K;  4DUY K;  4LFA K;  4JI3 K;  4B3S K;  4JI2 K; 
#chains in the Genus database with same CATH topology
 2BTF A;  1ASU A;  3ZT0 A;  3CME N;  2V7Z A;  3P31 A;  1C0G A;  2IOC A;  3HSC A;  4K41 A;  5BPL A;  1KSP A;  2QKB A;  3JAM O;  2KZZ A;  2E2O A;  2HND A;  4DV6 K;  1NGD A;  1GLE G;  2Q2R A;  4H5R A;  3NH1 A;  3LWM A;  2ZM6 K;  3AA2 A;  4DCH A;  4LH5 A;  4CJL A;  4E1M A;  4DTJ A;  4CHP A;  3L2W A;  2QWO A;  1UOC A;  1L3S A;  2I7N A;  1NLV A;  4NLB A;  1XUP O;  4DSI A;  4EP5 A;  2BH1 A;  2WFB A;  3B6O A;  2O8F B;  2E6M A;  3R8E A;  5EY4 A;  4CJS A;  3HVR A;  1KTQ A;  1VSM A;  4CES A;  3UKU B;  3VF4 A;  3TTF A;  3M8P A;  1QVF M;  3G71 N;  3V1Q A;  4DU3 A;  3E9P A;  3WXJ A;  5EVZ A;  3V9Z A;  2NNW A;  3TSP A;  5JVG L;  1N33 K;  3FR0 A;  2BAN A;  1KVB A;  3IUC A;  4IXC A;  3WT0 A;  1REV A;  2Q0U A;  2O8B B;  4N47 A;  3CCR N;  5C2D A;  4DFM A;  1WAJ A;  2F9T A;  1X9M A;  4FJH A;  4QCL A;  1T05 A;  1XC3 A;  3AO1 A;  1NGE A;  2OZS A;  3NF6 A;  2E6L A;  2YX6 A;  4CBX A;  5C2F A;  3CQ8 A;  3NVK A;  4DV1 K;  4I7F A;  3K2P A;  1GOC A;  2DFH A;  3F2K A;  4NYF A;  4Z4G A;  3QEP A;  1B9D A;  4YOY A;  3T1H K;  4YOX A;  3KD1 E;  3CER A;  4BR0 A;  4RG8 A;  3QML A;  2P9S B;  4JKC A;  1BL3 A;  4Z4C A;  5BN9 A;  4MFB A;  5C15 A;  1A5X A;  4M41 A;  4EFH A;  3NDK A;  3PX0 A;  3DLH A;  3VQ7 A;  4CFA A;  4FLW A;  1K8A O;  5F2R A;  1W9H A;  4IG0 A;  4FO0 A;  2YKM A;  2B6A A;  4IJA A;  3THX B;  2PYL A;  4DSJ A;  3V1O A;  1MWM A;  1TAU A;  2HNY A;  1KFS A;  4IEI A;  2VGM A;  4BC2 A;  3G6E N;  1NJI O;  3P4I A;  4B3M K;  4M3W A;  5ADX H;  4BRI A;  4PQU A;  1BWF O;  3PSF A;  2CH6 A;  4O44 A;  4CK3 A;  4W5O A;  3AA5 X;  3PV8 A;  2O4I A;  3K0S A;  3U9D A;  1HQE A;  3MXJ A;  4DTU A;  3CCS N;  3KWI A;  1QVG M;  2VQF K;  1M1K O;  4F2R A;  3M8S A;  4C8O A;  3DRR A;  1RFQ A;  3SQ4 A;  1QHT A;  2E20 A;  1CZB A;  3DOK A;  2E8A A;  2BDP A;  1S1U A;  3J80 O;  1X9S A;  4BGB A;  4FXD A;  1VSE A;  1NK4 A;  4DQP A;  3CC7 N;  4FJM A;  3LZJ A;  2YHY A;  1ZXO A;  4B08 A;  4B1V A;  3PO4 A;  2A1S A;  1RTH A;  4KI4 A;  4OGC A;  5AR0 A;  1SS6 A;  4OKJ A;  4TSX A;  4B8A B;  1DTT A;  2QA4 N;  3VQ9 A;  4CHY A;  1QZ5 A;  4BWJ A;  5BRD A;  3EY1 A;  1FW6 A;  1T3V A;  2AP1 A;  3MN7 A;  1A5V A;  1LV5 A;  4JS5 A;  2KTQ A;  5GIN A;  3D2F A;  1GOA A;  1N8R O;  4CJE A;  3VQD A;  3CCE N;  5FLX O;  3K5O A;  3O1B A;  3A8Y A;  3TAE A;  4GNI A;  4GMJ B;  4W5N A;  1KD1 O;  1VSF A;  4JKB A;  3HYF A;  5LY3 A;  2NRR A;  4DTP A;  5ELZ A;  4BVP A;  2KW4 A;  3NAE A;  1HNX K;  4B3T K;  4JK9 A;  4DF4 A;  4IJN A;  2NLX A;  4KTW A;  4K8Z A;  1YTU A;  2V7Y A;  4OGE A;  1IG8 A;  4BWM A;  4LFA K;  3KJV A;  3AO5 A;  4H5N A;  3JXU A;  3AAQ A;  1NKC A;  1YHQ N;  4DR6 K;  3K5L A;  1J53 A;  4DUZ K;  5DK5 A;  4Z4E A;  2WUS A;  2ITM A;  1BQM A;  1S1T A;  2IVO A;  4M3R A;  5FRN A;  3HK2 A;  4K8X A;  4ELV A;  1RBU A;  1KRP A;  1SUQ A;  2E4L A;  3U3Y A;  2ZQB A;  5AQF A;  1YAG A;  5I42 A;  5AQR A;  2GTD A;  3OJU A;  4CJ3 A;  1M90 O;  2QWR A;  1ZYQ A;  4G1Q A;  3ULD A;  1Z26 A;  1SL0 A;  1QS4 A;  2G8W A;  3M5R A;  2GEM A;  2Q97 A;  1TGO A;  1FKP A;  4ISF A;  5LL6 Z;  4HUF A;  2IC3 A;  3L8B A;  4NCG A;  3IMX A;  1X9W A;  3IG1 A;  4OVL A;  5BR9 A;  1HR0 K;  2RE2 A;  4IG3 A;  4V19 S;  4FWQ A;  4EHU A;  1F21 A;  2HHQ A;  4NLC A;  2ZWH A;  3D0P A;  2IS3 A;  1YI2 N;  4CEB A;  3DXM A;  3KLI A;  3TAR A;  3QEV A;  1QQC A;  1CXQ A;  4CK2 A;  1JLG A;  2ZGZ A;  1RBR A;  1Q82 O;  4CF9 A;  2HVI A;  2GV9 A;  2P9S A;  3TAB A;  4O5B A;  3VEO A;  4E7K A;  3HPH A;  4FZZ A;  1U4B A;  1QZ6 A;  4IO9 L;  3KVG A;  1RGI A;  1RBS A;  4AHS A;  4U67 L;  3P5J A;  1BIS A;  2KFZ A;  4BR4 A;  4DV0 K;  4H0T B;  2B4J A;  4LF7 K;  2P9L A;  3TTD A;  4WFB L;  1R0A A;  1LCU A;  4FVM A;  4LF6 K;  4DV4 K;  4M3Y A;  1H1V A;  3TPQ A;  1HMV A;  3A2F A;  2RHK A;  1DLO A;  2HBL A;  2W6K A;  3QIP A;  1U45 A;  4M3X A;  1WSJ A;  1XWL A;  2YNI A;  1ASW A;  4XH4 A;  1QSS A;  3EZ5 A;  3AVK A;  2O8C B;  4M7Y A;  1YJ9 N;  4I6M B;  3CQY A;  1K8K B;  3DI6 A;  4OLB A;  2DFE A;  4CZI A;  4DR2 K;  2GBZ A;  3L0Q A;  5HRN A;  2GWJ A;  3AGK A;  4FLU A;  3OJS A;  3LZI A;  4ELT A;  1NK5 A;  4JKD A;  1YUW A;  1TKZ A;  3K9J A;  1ZBU A;  2G8I A;  3DMJ A;  2H3G X;  3AA3 A;  4MDB A;  1U6Z A;  1VQO N;  2JWL A;  1TL1 A;  3ZSW A;  5MLC Q;  4OPK A;  4JI7 K;  2Y1J A;  4BRN A;  1EET A;  3CG7 A;  3C6T A;  4BRL A;  4I6M A;  4H4M A;  4DQR A;  2E2N A;  2UUB K;  4JNE A;  4KRE A;  4R79 A;  2KLA A;  4CIE A;  1T6D A;  1OH8 A;  1SKS A;  3AO4 A;  4H0O A;  1K9M O;  3OYB A;  3GOI A;  3TAM A;  4X62 K;  3U8X A;  3VQA A;  4LD0 A;  1IBL K;  1RT3 A;  2DY4 A;  3KTQ A;  3R9P A;  1NGC A;  1KLM A;  3SK3 A;  3OS2 A;  2FSJ A;  4ISE A;  3CXC M;  2ASM A;  4KTQ A;  1S5J A;  4BVO A;  2P51 A;  4CHO A;  4HVJ A;  3LP0 A;  4B9U A;  3H45 C;  3GL1 A;  5J2M A;  1UAX A;  2P5G A;  1LWF A;  4BG8 A;  3AVJ A;  2ATQ A;  4LF4 K;  4CJ7 A;  4AIL C;  2GX9 A;  2PAV A;  1RT7 A;  5KQ8 A;  5F0X A;  4DG1 A;  4LF9 K;  4A57 A;  4FWL A;  4NB4 A;  3VMF B;  2YI1 A;  3D7E O;  4IOX A;  4CZJ A;  1Q9X A;  1VQ4 N;  4O55 A;  4Q5V A;  3PY8 A;  4FK4 A;  1LW0 A;  1QE1 A;  2QXF A;  1XHZ A;  4GV9 A;  1KLN A;  3LAM A;  5AQG A;  4DS4 A;  2QW9 A;  4E0D A;  1S6P A;  4DTN A;  1NJY A;  4KHU A;  3ZYY X;  1Z6R A;  1QHA A;  2JWK A;  3SYZ A;  1Q8I A;  3DLR A;  1Q18 A;  4DR1 K;  5GIP A;  5I3U A;  3EN9 A;  3NF8 A;  4N5S A;  4NCB A;  1N36 K;  4M7X A;  4ZTF A;  5AQI A;  4WQ4 C;  3ZSY A;  4E3S A;  4FWS A;  2E1Y A;  4CJV A;  2HMI A;  2O8C A;  1YVN A;  5AQZ A;  4BAC A;  3W3D A;  3M1F A;  4E1N A;  3CJC A;  3SNN A;  1VQ9 N;  3VGL A;  1HUX A;  4DSF A;  1VQK N;  1WAF A;  1GLB G;  1QQN A;  3HI0 A;  3J7Y P;  1ZBS A;  3KHY A;  3NGZ A;  3HVT A;  1BCM A;  3KK2 A;  3QIN A;  1T44 A;  4B1Z A;  4IBN A;  3FE1 A;  4FJL A;  5ADX A;  4H5V A;  4JKF A;  4FZX C;  4O0J A;  1VSD A;  4QAG A;  5AFU H;  4JN4 A;  2NRW A;  4E7H A;  4J2A A;  4KH6 A;  5AQT A;  3B8A X;  2P9K A;  2BGG A;  3FZK A;  1BIU A;  3HL8 A;  5HRR A;  1VAZ A;  4BRP A;  1BIZ A;  4CVN E;  5AQM A;  3SCX A;  1BA1 A;  3LDS A;  1EQY A;  1VRT A;  5HRO A;  3M3Z A;  3CMA N;  2PZS A;  4M45 A;  4RWT A;  3C7N B;  3K5N A;  3SQ2 A;  4DF8 A;  2CH5 A;  3QIO A;  1BO5 O;  2E5L K;  2NRZ A;  4KHP K;  1OKJ A;  3BZC A;  2O8D A;  3SV4 A;  1U2V B;  4AHR A;  4BRC A;  3CC2 N;  4CW7 B;  5AQL A;  1ASV A;  1KVA A;  5CYQ A;  1L3T A;  4B9Q A;  3AGR A;  3K9K A;  3VGK A;  1C1B A;  1X3M A;  4K25 A;  3AVB A;  3ZET A;  4F4K A;  3CM5 A;  1BU6 O;  2E1Z A;  3CYM A;  4N56 A;  4FJN A;  3O6W A;  2VWK A;  3OS1 A;  3VA3 A;  3OW2 M;  4E7L A;  4BRQ A;  2GEL A;  4M63 C;  1BDG A;  4I2Q A;  1S1W A;  1JKH A;  4WFN L;  3V4I A;  1JJ2 M;  1NK6 A;  2YHX A;  3VER A;  1B92 A;  3TAQ A;  1HKB A;  4MO5 A;  3F5T A;  1TYQ B;  4LSN A;  3SZ2 A;  4FVU A;  4A5B A;  4I9L A;  3CPW M;  3DLK A;  4BDZ A;  2HF3 A;  3SAG A;  3ZEU A;  4JRQ A;  3L4Q A;  3U4L A;  1BOT O;  3AV9 A;  4RW8 A;  4HTL A;  5HBM A;  5C42 A;  4JK7 A;  3L2U A;  4HCC A;  3LAN A;  5GAH P;  3VES A;  3WXI A;  4FJI A;  5GIO A;  4JKG B;  4CFD A;  3OY9 A;  3S3M A;  2UU9 K;  3VQB A;  3VQ6 A;  3P1G A;  1P8Z A;  4XH5 A;  3CJA A;  5FDL A;  3MK6 A;  3SPY A;  3ZEU B;  4LSL A;  2HHW A;  5FRO A;  2VWB A;  3MX5 A;  1KXP A;  1VQ5 N;  2O8B A;  1I94 K;  1DT9 A;  3SBT A;  3VEY A;  4IZ9 A;  4CZG A;  3MWT A;  4N76 A;  1NMD A;  3QET A;  3EKU A;  4ELU A;  3AVM A;  4DTO A;  3RR7 A;  2HW3 A;  2ZF5 O;  4DTM A;  2FBT A;  4OPA A;  2Z1J A;  3TAN A;  3HPO A;  3A5N C;  3L4I A;  3PO5 A;  4DQS A;  3WQU A;  3VGM A;  5FPM A;  4L3Q A;  3V9U A;  1KFD A;  3JS6 A;  4IFE A;  2OAN A;  3CF5 L;  1NGA A;  4JRP A;  3IKM A;  3ZET B;  5FPD A;  2F8S A;  5M1N A;  3CJB A;  2YCH A;  3SMS A;  3RSE A;  1X3N A;  4GW6 A;  1ATS A;  1NGB A;  3ZX0 A;  1XQS C;  3G0Z A;  4CZF A;  3AVN A;  3LP2 A;  4E19 A;  2YJF A;  3ZT1 A;  4IOA L;  2QI2 A;  1ATN A;  4YOW A;  3NH2 A;  3KIO A;  5KRT A;  1ILY A;  3M8R A;  4CGG A;  4I9Q A;  2O4G A;  4BRA A;  2KFN A;  4DR4 K;  4WYB A;  1HRH A;  1RBT A;  1U49 A;  2KQ2 A;  4RW6 A;  3IFR A;  4AHV A;  1QQO A;  4DQI A;  2B5J A;  2HF4 A;  1QTM A;  3SMP A;  2FBV A;  4K42 A;  1VSK A;  5GAE P;  5KPR A;  4B1W B;  4FLV A;  1A5W A;  1N5Y A;  1CLQ A;  5AQU A;  2WON A;  5AQN A;  1EKE A;  1YXQ A;  4CGJ A;  3OYJ A;  1XI1 A;  2HBM A;  1W7A A;  1WUA A;  3DAW A;  3A5O C;  3KLH A;  1FKO A;  4BQL A;  4KHW A;  1TAQ A;  3M8Q A;  3QB0 A;  5BRF A;  4EAH D;  5SZT A;  1BI4 B;  2P1J A;  3VEN A;  3ALY A;  1XMQ K;  4CF8 A;  1LW2 A;  4B3O A;  2ASP A;  3D6R A;  3O8M A;  4C1N K;  2HHH K;  4BE0 A;  2IVP A;  4M3U A;  4RW7 A;  5TKW A;  4H4O A;  5CHI A;  2QWM A;  4XIU A;  2P5O A;  4LFB K;  2QXL A;  4Y0W A;  3THW A;  4IKF A;  3VPZ A;  1JLE A;  2RF2 A;  4JS4 A;  3L2R A;  1NJX A;  3PIO L;  4O5F A;  3UKU A;  2QM1 A;  1D9D A;  3DYA A;  4KV8 A;  4NXM K;  4Z94 A;  4FWM A;  3R6M A;  4DFP A;  4CEE A;  4W5T A;  4BE1 A;  1IKW A;  2A5X A;  3ZSX A;  2XY5 A;  4CGI A;  4RCH A;  4FJ9 A;  4C8K A;  3D45 A;  1RT2 A;  5AQY A;  2P9U A;  3UKR B;  1VQL N;  5EXW A;  3LWL A;  3U9Z A;  3FFI A;  3K58 A;  3I33 A;  3O3H A;  3MWP A;  2IIR A;  3RWU A;  4A2A A;  3ENO A;  5GAG P;  3EE8 A;  4XEI A;  3HOS A;  4CD3 A;  5J2N A;  4DU1 A;  2OPQ A;  3PLA A;  3O4N A;  2X6S A;  3CQX A;  3CFR A;  3NBP A;  3O9U A;  4CER A;  4AM6 A;  3KWG A;  3KK7 A;  1J54 A;  2VQE K;  5JIC A;  2YHW A;  3LM2 A;  5CE3 A;  2OTL N;  3H3N O;  2OPR A;  5AZJ B;  1SKW A;  3SQ0 A;  4JYA K;  4CJK A;  5H1S Q;  5C12 A;  1NGH A;  2ITG A;  3SLC A;  4WE1 A;  4W5Q A;  3ZSR A;  4JD2 A;  2A41 A;  4YY3 K;  1VSL A;  4YOU A;  3MX2 A;  4CED A;  2Y1I A;  3QER A;  4JAX A;  3J8A A;  2CGK A;  5AZI A;  2XRI A;  5JLH A;  2ZJP L;  3VQ8 A;  3THV A;  3AVI A;  2ZD1 A;  4CGF A;  4C23 A;  1JLF A;  1JL2 A;  4FM1 A;  4A61 A;  5AQH A;  4OLA A;  2UUA K;  3SAH A;  1BHL A;  3ZSZ A;  4H03 B;  3OYD A;  3NGI A;  3GBT A;  1T03 A;  2YKN A;  3WXK A;  4PL7 A;  3K59 A;  2BUP A;  1WBD A;  1E4G T;  4BRH A;  5BRH A;  3CC4 N;  1C6V A;  1VSJ A;  4AF1 A;  1NM1 A;  1WNS A;  1Y64 A;  1NK7 A;  4AHU A;  3HM9 A;  1VQ8 N;  4HCB A;  4DWI A;  2EX3 A;  4CZH A;  3FLC O;  3CFP A;  1CZ9 A;  4KHY A;  3O9T A;  4JI5 K;  4CJ5 A;  3OYC A;  2F7T A;  3MMV A;  1OH6 A;  4PUO A;  5AQV A;  2YNH A;  1TK8 A;  4E1J A;  2P9N A;  3B6P A;  3ID8 A;  5HL7 L;  1IKX A;  1BUP A;  3LP1 A;  3GG4 A;  3DOL A;  4F8R A;  3E9L A;  4BDP A;  5CYM A;  4CIF A;  2RKI A;  5EOY A;  1QQM A;  1SZ2 A;  2Q36 A;  3BY5 A;  3I55 N;  1LAW A;  4E89 A;  3SBG A;  4FK0 A;  3O9Q A;  4BRO A;  3KD5 E;  1J5O A;  3VQP A;  2YV0 X;  4ZHR A;  4CJW A;  3GE1 A;  4GV6 A;  3DLB A;  3OYG A;  4IFV A;  3PX6 A;  1N6Q A;  2QK9 A;  3SUQ A;  3THY A;  4M3Z A;  2LSN A;  4LF5 K;  1JCE A;  1WSE A;  1V4S A;  4CZE A;  3IS9 A;  5C10 A;  5AFU A;  2HHS A;  3DRP A;  3AVF A;  3VQC A;  1IH7 A;  1NK0 A;  4YNQ A;  3AAP A;  4FPB A;  3D2E B;  4CFC A;  3LDQ A;  4QS8 A;  4KHS A;  3O80 A;  3QLH A;  4CIG A;  5M1P A;  5J1E A;  3V9W A;  4FJK A;  5CZ1 A;  3TR8 A;  3RMA A;  4F9O A;  4Q0B A;  4CZK A;  1MA9 B;  3O3F A;  1JLA A;  1D9F A;  4KO0 A;  4HUE A;  3TSQ A;  1D5A A;  3SAF A;  1BI4 A;  1C0M A;  1K8K A;  3RMD A;  1L5U A;  1YIT N;  3THW B;  3AVL A;  3FZL A;  4FLZ A;  3CPE A;  1YIJ N;  3J81 O;  1CZA N;  4OKE A;  1TKD A;  3ITH A;  4KTZ A;  2HB5 A;  2NRH A;  4CJF A;  2E2P A;  4NYN A;  5TKY A;  4LH4 A;  4FWO A;  4E7I A;  5CY4 A;  5AQQ A;  5HLF A;  1UA1 A;  1LWC A;  3MCP A;  2P9L B;  3VEV A;  2HBK A;  3R3L A;  1L3U A;  4W5R A;  3C6U A;  1YT3 A;  3THX A;  3HP6 A;  4EIA A;  1NGI A;  5M1Q A;  2Z1H A;  3CM6 A;  2VGN A;  5HOO A;  3AAR A;  4IDK A;  3SUP A;  1TK5 A;  1UA0 A;  1XNQ K;  2OTJ N;  2UUC K;  2PFU A;  5AQJ A;  4ISG A;  3CD6 N;  4CJU A;  1NMN A;  5AQO A;  1ZBL A;  1DTQ A;  3AVH A;  3CCU N;  4C1N I;  4CCH A;  4KH5 A;  5BPN A;  4WQ4 A;  2E88 A;  1NKE A;  1BA0 A;  3KKS A;  3VF2 A;  3DXM B;  3BZK A;  3H6E A;  1VSI A;  2HNZ A;  4FLY A;  3MEG A;  3KK3 A;  3HOT A;  3HPG A;  1NBW A;  4BR2 A;  4DR5 K;  4X66 K;  2NZT A;  3ZT3 A;  3PUF A;  4DV7 K;  3HJF A;  4YDU A;  3I0R A;  1RCH A;  4KBO A;  4LY7 A;  3NF7 A;  3I8D A;  3V1R A;  1TL3 A;  1GLF O;  3LDP A;  2YNF A;  3O4W A;  1S72 N;  3BF3 A;  4CE9 A;  3L3V A;  4FPA A;  3RTV A;  3J7Z O;  3I0S A;  3HST B;  3OHR A;  1XNR K;  2G8V A;  1HJO A;  3HTV A;  2A1R A;  1NOY A;  4B1U B;  4CHQ A;  1LOT B;  1KQS M;  2NRT A;  3N4Q A;  1KCF A;  1W97 L;  2Z1I A;  2JLE A;  5C25 A;  1C0T A;  3EEQ A;  2EHG A;  2FSN A;  1WSH A;  2D1K A;  4RW4 A;  4CJP A;  2NRV A;  2O8E A;  4A5A A;  4WCE L;  1WB9 A;  5FPN A;  3OYA A;  1HNZ K;  3V81 A;  3SV3 A;  5FPE A;  2FLO A;  4DKW A;  3TAP A;  5E41 A;  3A0I X;  2ETJ A;  2I7P A;  2V52 B;  4CEQ A;  1ESV A;  3PIP L;  5AQX A;  1J9A A;  4BC5 A;  3T1Y K;  4OO1 J;  3PSI A;  4FJJ A;  3ULE B;  4BRE A;  3U6F A;  1TK0 A;  2GUI A;  1TYQ A;  2HHU A;  1HKC A;  3OA9 A;  1VQP N;  5C0Y A;  2ZJQ L;  4KB1 A;  5JS1 A;  3CI5 A;  1G99 A;  4JHD A;  2KKZ A;  2CGL A;  1TKT A;  3QNO A;  2UXB K;  4K43 A;  2D4W A;  3H1V X;  3TAG A;  4FL9 A;  3EO3 A;  4B9L A;  3QES A;  3RR8 A;  3NCI A;  1G15 A;  3ZT4 A;  4DV5 K;  2P9I A;  1N32 K;  1NWK A;  4OJR A;  4DUY K;  3Q7C A;  3OYH A;  2P9N B;  4YOR A;  3VQ4 A;  2KZM A;  3FFK B;  4FOE A;  4B8C A;  1W0H A;  5AQW A;  1QSY A;  4EZ9 A;  1NJW A;  1W2B M;  4WFA L;  4DMN A;  5KTQ A;  4LFC K;  2FF6 A;  3C65 A;  2AA4 A;  4JKH A;  4B9M A;  4O0I A;  3RRH A;  2RPI A;  3T69 A;  4PKI A;  1UWB A;  5HP1 A;  2Q3S A;  2QEX N;  1HLU A;  4EHT A;  4DHY A;  3AO3 A;  1LAV A;  1ZBI A;  3CJ9 A;  1HNW K;  3QO9 A;  4JKE A;  3VA0 A;  4CBW A;  3ENB A;  3KK1 A;  3TU5 A;  2IDO A;  4M3T A;  3WQT A;  2GWK A;  3VOV A;  3WXM B;  3O4Q A;  4AHC A;  3EZW A;  2PBD A;  3DLL L;  4DFK A;  5E84 A;  2W40 A;  3IRX A;  4HWI A;  4DV3 K;  2WC9 A;  5KGX A;  2QWQ A;  1KAY A;  1Q86 O;  2A40 A;  4HHT A;  4MO4 A;  3M6G A;  2XY7 A;  1XC9 A;  3A5L C;  3J7A P;  2WOM A;  3ZCM A;  3SUO A;  3CIP A;  1N34 K;  4BRM A;  3KZB A;  4Z0U A;  1RTJ A;  4H5T A;  2ZE2 A;  4OPJ A;  3I56 N;  3CCM N;  3BUZ B;  4KB0 A;  3FZF A;  3T1A A;  3QDK A;  4PKH A;  1X9J A;  1HX1 A;  3HO1 A;  2D0A A;  1J6Z A;  2E2Q A;  3OYM A;  3U3G A;  2G8K A;  4WQ5 A;  3BDP A;  1IJJ A;  3O3G A;  3FZH A;  4BDY A;  1RT5 A;  3UE5 A;  3EL2 A;  1C0U A;  1WLJ A;  4DR7 K;  3KLE A;  4IFY A;  3R1X A;  4X65 K;  3VEX A;  3LDN A;  1SAZ A;  5I9E B;  4FK2 A;  3G25 A;  3H3O B;  2YJE A;  4J8F A;  1E3M A;  3L2V A;  4FCY A;  1IO2 A;  3MAQ A;  2HHX A;  2FF3 B;  1SQK A;  3MN5 A;  3V9S A;  4JI3 K;  1YJN N;  2HHT A;  1EXQ A;  5B8H A;  3T3F A;  1RDA A;  4CJT A;  4F2S A;  3LDO A;  5IT9 O;  3VQQ A;  5EX5 A;  4BRF A;  5E26 A;  4DLE A;  4FM0 A;  4J2B A;  4CZL A;  3HZ6 A;  3O5B A;  1ATR A;  3HP9 A;  3OVN A;  2DPN A;  4PY5 A;  3WNE A;  2O8F A;  4CJ4 A;  4FW2 A;  3E66 A;  2R7Y A;  4DSK A;  3RMB A;  2WBN A;  3LPU A;  3VEZ A;  4C8M A;  1HYV A;  1S1X A;  3MED A;  1Q9Y A;  3OYF A;  3V9X A;  3IDH A;  5BPM A;  3JSM A;  5IWA K;  3ZX2 A;  3CCQ N;  4DLG A;  1NGG A;  5A2Q O;  4BE2 A;  4KI6 A;  1HYS A;  1RDW X;  1HYZ A;  3TWH A;  3S9H A;  2QWL A;  1SL2 A;  5AQP A;  3KLF A;  4L8R B;  4GVE A;  4GVM A;  1YVU A;  3C0B A;  1NU0 A;  4N41 A;  5CR4 A;  2PYJ A;  4DSL A;  3SQ1 A;  1ITG A;  3HBT A;  3QEI A;  2W42 A;  1OVY A;  1K6Y A;  3BGR A;  4O4G A;  2A6A A;  4H8K A;  3SUN A;  3T19 A;  2IGI A;  3E1Y A;  4KFB A;  1GOB A;  3P83 D;  1FK9 A;  1KVC A;  2QTD A;  2X74 A;  2XHB A;  3QNN A;  2G8U A;  1DKG D;  5KRS A;  1O13 A;  3S3N A;  1TUU A;  4JLH A;  1SL1 A;  4FJ8 A;  1JLC A;  5CZ2 A;  2QKK A;  4CHN A;  5BRE A;  4K0K K;  1CXU A;  5GAD P;  2YNG A;  3FZM A;  3N4P A;  1WOQ A;  2CGJ A;  3SI6 A;  2OPS A;  4WQ5 C;  2VWJ A;  2V51 B;  5JLF A;  4JI4 K;  3HXM A;  1WBB A;  3EYZ A;  5KI6 A;  2XY8 A;  3OYN A;  4CF1 A;  1IBK K;  4IWV A;  5DMR A;  1S9E A;  5LJV A;  1U47 A;  2FC0 A;  1Z05 A;  4B1Y B;  1MU2 A;  1BG3 A;  4Y1C A;  1R59 O;  1DGK N;  3S3O A;  4X64 K;  1NNE A;  4GKK K;  2FSK A;  5JMV A;  4Z4I A;  2KHO A;  1JXE A;  4CI6 A;  4NXN K;  3PX4 A;  4BY9 C;  2IVN A;  1L3V A;  3QEX A;  3IAY A;  4NCA A;  4KHQ A;  1Q7Y O;  1C1A A;  1C1C A;  4AHT A;  4R5P A;  4FYD A;  2AJQ A;  2I5J A;  2D5R A;  4CJQ A;  1VHX A;  4A2B A;  3NMU A;  4FJ7 A;  1KAZ A;  4BC3 A;  2HST A;  1P90 A;  3VTI A;  3O1W A;  3VF6 A;  4YOT A;  2GUP A;  3O9S A;  1NOZ A;  3ZSO A;  1Y97 A;  3VQE A;  1D8Y A;  5M1F A;  5BN8 A;  3NGY A;  1HPZ A;  1XMO K;  5AZJ A;  3P39 A;  3CCL N;  1T8E A;  1NG9 A;  4B3R K;  4JHD B;  4CHZ A;  2NUB A;  4CF2 A;  1U04 A;  1V4T A;  4OPH A;  5F1X A;  4YHH K;  2PY5 A;  2DFF A;  1JL1 A;  1T7P A;  3O08 A;  2UXC K;  3DJC A;  2J4R A;  4UY8 O;  1TV6 A;  4YDU C;  3A5M C;  4PL8 A;  1JLQ A;  4CZM A;  2RN2 A;  1RIL A;  3K57 A;  4MLE A;  1S3X A;  3DLG A;  3SPZ A;  3RVC A;  1FJG K;  3RSE B;  3QFU A;  1HNV A;  3EKS A;  4FWR A;  2QWN A;  4KAZ A;  3ATV A;  3H08 A;  4ICL A;  2P9U B;  3UKR A;  4CEC A;  4EP4 A;  4CJR A;  3AA4 A;  3WEE A;  4F3T A;  3D2F B;  4NO7 A;  1NGJ A;  4G9Z A;  4MDA A;  2DTU A;  1GLL O;  1JCG A;  3S41 A;  1OH5 A;  1I3A A;  3ATU A;  2XO7 A;  4DTR A;  5LJW A;  1EWQ A;  2HBJ A;  4BR7 A;  4AQY K;  4DTX A;  3VEW A;  3NHG A;  1JCF A;  2O8E B;  3TAF A;  1HPM A;  4FZY A;  3ZT2 A;  1RBV A;  4F3O A;  4JI2 K;  3QBW A;  3F9M A;  4FSV A;  1GLA G;  3OS0 A;  3MDQ A;  3KKR A;  4C8N A;  3DWL A;  1U2V A;  1VRU A;  2IAJ A;  4H5W A;  1K73 O;  3UIQ A;  1HKG A;  3F73 A;  1RTD A;  4CK1 A;  3AO2 A;  3BEX A;  4PA1 A;  3LDL A;  3MXI A;  1NGF A;  4BGA A;  4JKG A;  5T7B A;  4IOC L;  2OPP A;  3L3U A;  2HMP A;  1FXX A;  1RT1 A;  3DLE A;  3ULE A;  4FWP A;  3AVA A;  4BR5 A;  4HTU A;  1EO1 A;  3MEC A;  4CEA A;  5EU7 A;  4IDH A;  4BQZ A;  4DSE A;  5DM6 L;  5LMN K;  1S6Q A;  2VG5 A;  1EP4 A;  2XY6 A;  1S22 A;  5BR8 K;  3HRG A;  3Q7B A;  3WNF A;  4DB3 A;  3K5M A;  3QFP A;  4U7B A;  5FRM A;  4KRF A;  3CJ1 A;  3VQ5 A;  5HRP A;  4GKJ K;  4Y1D A;  3MXM A;  3OBY A;  4DQQ A;  4YOV A;  3UB5 A;  3L6Q A;  1YJW N;  3ZLJ A;  3E01 A;  3ZSQ A;  2UXD K;  3P38 A;  3LL3 A;  4MQ3 A;  2ASO A;  3I8B A;  5J2P A;  5J2Q A;  3LAK A;  3LP3 A;  1IG9 A;  1VSH A;  1DEJ A;  4QOZ B;  4E7J A;  3VET A;  3F9K A;  1RDC A;  3LPT A;  3T7Z A;  5DM7 L;  4FLX A;  1SKR A;  4DQ8 A;  3MEE A;  1S9G A;  3MN9 A;  2W41 A;  2W6L A;  5JVH L;  3C95 A;  3QIC A;  2O8D B;  3AVC A;  2FBY A;  4PWD A;  4DV2 K;  4H0Y B;  3G4S N;  4DR3 K;  4DU4 A;  1BQN A;  3QEW A;  1GLC G;  3VN5 A;  1I39 A;  2VCP A;  2WTU A;  4JK8 A;  4IEE A;  3W0L A;  4BG9 A;  3CCJ N;  1HQU A;  5M1O A;  4CBU A;  1O1W A;  3ZX3 A;  2D0B A;  2D0C A;  3CHW A;  1RT6 A;  4C8L A;  1MWK A;  5M1K A;  1MDU B;  3RRG A;  3ISN C;  3OYL A;  2ZGY A;  1VQ6 N;  3C6A A;  3D2E A;  4XH1 A;  1SV5 A;  2NRX A;  4RW9 A;  4GY2 B;  4GV3 A;  3OYE A;  3C6H A;  1VQ7 N;  1ZBF A;  2Q1N A;  4B9N A;  2A42 A;  3E9O A;  3OYI A;  2UYT A;  1RDB A;  4QS9 A;  1JLB A;  1WN7 A;  4ILH A;  2Q31 A;  4FM2 A;  4B9S A;  2D0P A;  4AM7 A;  2FBX A;  3TTC A;  4ILJ A;  4ID5 A;  2HHV A;  1BGX T;  3LAL A;  4J2E A;  2YHA A;  2P9K B;  3DRS A;  3WUH A;  3ASM A;  2OCE A;  4MLH A;  3HM8 A;  5C24 A;  4PHT X;  2D0O A;  3L2Q A;  1IKV A;  2QWP A;  3NE6 A;  4FOI A;  2VG6 A;  1E4F T;  1JXB A;  3O9R A;  4H0P A;  4DS5 A;  2F4V K;  3NFA A;  1KC8 O;  2OYQ A;  3C94 A;  4JEP A;  5KQD A;  3RMC A;  1WSF A;  1TKX A;  4FWN A;  3SJH A;  3AVG A;  4O8K A;  4RTF D;  3MN6 A;  1HJR A;  4B1X B;  2G8F A;  5KPT A;  1TUY A;  1RDD A;  4Z4H A;  4FJ5 A;  1KAX A;  1YF5 L;  3NVM A;  1Z25 A;  3THY B;  4BRG A;  1U48 A;  4FWK A;  3CJ7 A;  4I2P A;  1NK8 A;  1QSL A;  4CEF A;  5AQK A;  2OA8 A;  4OX9 K;  4EZ6 A;  4ID1 A;  1ZBH A;  1IKY A;  4FJX A;  4CGD A;  1IV0 A;  3GDQ A;  4WF9 L;  4JI8 K;  3WEE B;  4CD1 A;  2YHB A;  2JGU A;  3TI0 A;  3C7N A;  1Q81 O;  3LM9 A;  1VQN N;  4JV5 K;  1BCO A;  3NH0 A;  4HUG A;  3ID6 A;  4CFB A;  4B3S K;  4CEZ A;  3WNG A;  2X78 A;  3DXK B;  1VQM N;  4QS7 A;  4ZTJ A;  1GLD G;  3OBW A;  1ZC6 A;  5AZI B;  4JI6 K;  3KLG A;  1TVR A;  4OKK A;  2VG7 A;  5AJ3 K;  3G10 A;  1WSG A;  1X1P A;  4YFU A;  1C0F A;  4H0V B;  3CET A;  2VYP A;  2FXU A;  3TSU A;  3HT3 A;  4LF8 K;  1B9F A;  4CEO A;  4JD2 B;  1NKB A;  4H0X B;  1T6C A;  1EWR A;  4KHN A;  4KH4 A;  2F8T A;  1XHX A;  4FLT A;  4A62 A;  5LMU K;  4LC9 B;  4A59 A;  4IO8 A;  5D3G A;  3MCA B;  5HRS A;  1GLJ O;  3VTH A;  2G8H A;  4J2D A;  1OVQ A;  1YTA A;  3ZSV A;  2P9P A;  4DFJ A;  1J5E K;  1D4X A;  1RTI A;  5K14 A;  1WSI A;  1IBM K;  3JYT A;  4UQG A;  4B9T A;  4BRK A;  3NF9 A;  2ZJR L;  3H46 O;  2Z1G A;  3OTO K;  1OH7 A;  1LWE A;  1RT4 A;  4O8U A;  2P9P B;  4BC4 A;  5SWM A;  2F96 A;  5AQS A;  5JS2 A;  2Q0R A;  4ILG B;  2F9W A;  4M42 A;  2HOE A;  4KKO A;  4BRD A;  2BE2 A;  2EWS A;  4Z4F A;  2X6N A;  3OYK A;  1EX4 A;  1HNI A;  2OZM A;  4JI1 K;  1NJZ A;  4JI0 K;  2HVH A;  3AY9 A;  4KPY A;  4DTS A;  5KPZ A;  3V6D A;  3WNH A;  3ENH A;  4FJG A;  3H1Q A;  5KGW A;  1S1V A;  1RDU A;  1RNH A;  1VK0 A;  3BF1 A;  1NK9 A;  4B9V A;  4CF0 A;  3SJJ A;  3CFO A;  4CGH A;  2A3Z A;  4AH9 A;  3BP8 A;  2P9I B;  4BR9 A;  3EE9 A;  3CCV N;  3DXK A;  3WXL A;  3FGU A;  3DM2 A;  4JKA A;  3QBX A;  4PKG A;  4FW1 A; 
#chains in the Genus database with same CATH homology
 4DR6 K;  4DUZ K;  5IT9 O;  4JI6 K;  4X64 K;  2VQE K;  4DR1 K;  4DR2 K;  4GKK K;  1N36 K;  5AJ3 K;  4B3M K;  4DR4 K;  4NXN K;  3JAM O;  4X66 K;  4DR5 K;  4LFC K;  4DV6 K;  4DV7 K;  4LF8 K;  4JYA K;  2ZM6 K;  2VQF K;  5LMU K;  3J7Y P;  4LF5 K;  5LL6 Z;  4YY3 K;  5IWA K;  4JI7 K;  1XNR K;  5LMN K;  3J80 O;  1HNW K;  1HR0 K;  5BR8 K;  1J5E K;  1XMO K;  1IBM K;  5A2Q O;  4V19 S;  4B3R K;  2UUB K;  2UU9 K;  2F4V K;  4GKJ K;  2UUA K;  4DV3 K;  4YHH K;  3OTO K;  1XMQ K;  4X62 K;  1IBL K;  1I94 K;  2UXD K;  1N33 K;  1HNZ K;  2UXC K;  3J81 O;  2HHH K;  4CVN E;  3J7A P;  4LFB K;  1N34 K;  1FJG K;  3T1Y K;  5FLX O;  4NXM K;  4LF4 K;  4OX9 K;  2E5L K;  4KHP K;  4DV0 K;  4JI1 K;  4JI0 K;  4DV1 K;  4JI5 K;  4LF9 K;  4CW7 B;  4DR7 K;  2UXB K;  4X65 K;  4LF7 K;  4JI8 K;  4DV2 K;  4K0K K;  4DR3 K;  1HNX K;  4B3T K;  4JI4 K;  3T1H K;  4DV5 K;  1XNQ K;  2UUC K;  4LF6 K;  4DV4 K;  4JV5 K;  4AQY K;  1IBK K;  1N32 K;  4DUY K;  4LFA K;  4JI3 K;  4B3S K;  4JI2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...