2UXCK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxcK00
4NXMK 5AJ3K 5LMNK 4B3MK 4JI0K 1N33K 4JV5K 4GKJK 5A2QO 4JI3K 4JI7K 4LFCK 4DV3K 2UU9K 4DR2K 4KHPK 4X66K 3J7AP 4B3SK 4DV5K 3J81O 4DUYK 4DV7K 1XMQK 2E5LK 4YY3K 4CW7B 4CVNE 4B3TK 3T1HK 1IBMK 4DR5K 4LF4K 4B3RK 4DR7K 5IT9O 1I94K 4JI4K 4YHHK 5FLXO 2HHHK 4DR3K 4NXNK 4AQYK 1J5EK 1HR0K 4K0KK 2UXBK 4LF8K 4DR6K 4OX9K 4DR1K 4JI5K 4JYAK 4LF9K 4JI8K 4LF7K 4V19S 3T1YK 4LFBK 4DV1K 5LMUK 3JAMO 4X65K 1IBKK 4JI2K 4JI6K 4X62K 2UUAK 1XNRK 2VQEK 1IBLK 4LFAK 5IWAK 3OTOK 4LF6K 4JI1K 2UXDK 2F4VK 4DV4K 1N36K 3J7YP 1HNXK 4X64K 1XNQK 1HNZK 2VQFK 2UXCK 1HNWK 1FJGK 4LF5K 4DV2K 4DUZK 4GKKK 3J80O 5BR8K 1N32K 2UUBK 4DV0K 1XMOK 2ZM6K 4DV6K 1N34K 5LL6Z 2UUCK 4DR4K
chains in the Genus database with same CATH superfamily
5CE3A 4CJEA 2DFHA 1RDCA 2D0BA 4E7JA 3TAEA 4LFCK 4FJXA 4CK3A 4DF4A 3OYEA 3CJ7A 4CF8A 5LJWA 1HKCA 3RR8A 4ZTJA 4BRNA 4B3TK 1HPMA 3THWA 3MMVA 1ZYQA 1KQSM 3DYAA 5SZTA 2XY8A 5AZJB 4YHHK 3O3HA 3LALA 4NXNK 3SK3A 1W7AA 1WAFA 3K0SA 1HKGA 4K0KK 4PKHA 4C1NI 1BCOA 5KQ8A 3K57A 4ELVA 1NMNA 2FF3B 1JCFA 4PKIA 3DM2A 2IIRA 3K5NA 4O5BA 3CCUN 5CYMA 1P90A 4ELTA 3MX5A 1G99A 3WQTA 1BL3A 4H0PA 4H5NA 4H0TB 4DKWA 5FDLA 4KREA 1VSMA 3DLKA 2WUSA 3LP3A 1WLJA 5F2RA 3LP0A 3VGMA 1TK8A 4B08A 3VA0A 4F9OA 2W40A 4KH5A 2A5XA 2X74A 3QERA 2IC3A 1HNZK 5EVZA 4OO1J 4OJRA 3L2WA 1U2VB 4I2QA 1NM1A 1DKGD 4R5PA 2QA4N 3Q7CA 2ASPA 3AO5A 4BRLA 4WF9L 4Q5VA 1NGCA 3KJVA 3E9OA 1WSGA 3GOIA 3ZETA 3A2FA 4CJ4A 4YNQA 4E7HA 3OBYA 2W42A 4B9NA 4FWMA 3RVCA 3PUFA 2O8DA 3GL1A 3DRRA 4IJNA 4CEAA 3HP9A 3EKSA 1XC9A 4FWNA 3GE1A 5AJ3K 4JI0K 4N41A 4F2SA 3HP6A 5HRPA 3AO2A 4OKJA 4FLTA 1X9MA 3MEGA 4PL7A 4J2BA 4HVJA 4G9ZA 3VERA 1R59O 5KQDA 4CHPA 1S1XA 1L3SA 5EXWA 3O80A 5BN9A 3VQAA 4K8XA 2JLEA 2G8VA 2FBTA 2Q1NA 4JI4K 2HHHK 5HLFA 2P9LA 3TAPA 2QWRA 2HMPA 3OS2A 3V9UA 4NCBA 2YKMA 2O8EA 3SQ0A 4FJ9A 5GAGP 1S5JA 2YJFA 4MFBA 4LF8K 1ATNA 3H46O 5AQYA 3HYFA 3MEDA 3P39A 4B8AB 1RT6A 3WQUA 4FPBA 4KFBA 1VSFA 3QIOA 1REVA 3WEEA 4CCHA 1NWKA 1L3VA 4H0YB 4NB4A 2DPNA 1K8KA 4FVUA 2G8FA 1X9WA 1ZBFA 1NOYA 4CJFA 1NK5A 3CFOA 2VQEK 1QVGM 1KAXA 3IS9A 4FM2A 3KK7A 3VF6A 3L6QA 4W5RA 1KC8O 4IFEA 4CF0A 1X9JA 4W5OA 3J7YP 2IS3A 1L5UA 5C0YA 3KD5E 1Q8IA 3TTDA 4JRQA 4B8CA 4M3XA 4I2PA 1TKXA 4LF5K 1BCMA 2Y1IA 3CCRN 3ZSZA 4DUZK 5AQJA 1YAGA 1BA1A 3CC4N 4CEFA 1NGFA 4CF1A 2X78A 4GV9A 4EHUA 4JEPA 5JLHA 4YDUA 4FWKA 1NU0A 1J5OA 5JS2A 3I0RA 2HBLA 3F9MA 3MCAB 3BZKA 1M90O 3C6AA 4JKAA 4DTJA 3FZKA 4FM0A 3VTIA 3C0BA 2QTDA 2V51B 4E7LA 1QTMA 3A5OC 3VQ4A 1U04A 3J7AP 3JXUA 2IDOA 1JLBA 3CF5L 4BGAA 3DOKA 4IBNA 5BPMA 1A5VA 4CVNE 3NGIA 3BP8A 3O1BA 4I9LA 4IXCA 4FWRA 4B3RK 3UB5A 4A5AA 1JLCA 3ZSWA 3OW2M 2NRWA 2NUBA 3SPZA 4J2EA 1R0AA 3KLFA 3RRGA 3KVGA 1QQMA 1KTQA 3UE5A 3L3UA 4FK4A 4DTSA 3G0ZA 3M3ZA 2HVHA 3EE8A 3EKUA 1LAVA 3B6OA 4DG1A 1JLGA 3SJJA 3WUHA 4BC2A 3T19A 4DQSA 2RPIA 2XHBA 4OKEA 3NAEA 2O4IA 2KZMA 3SV4A 3CQ8A 5JLFA 3HJFA 2P9NA 1NNEA 4WQ5C 2FXUA 1XNRK 2CGLA 4LC9B 1TYQA 3HM8A 4FLVA 2GX9A 3FR0A 1EX4A 2OYQA 2F4VK 4DF8A 1NGHA 3AA4A 4Z4IA 2UYTA 4PQUA 2QEXN 1FJGK 1QVFM 4BG9A 4JD2B 1RT2A 4OKKA 4RW6A 4L8RB 1RBUA 5TKWA 1QHTA 2JWKA 2Z1GA 3ID6A 3WXLA 4WFNL 3VEVA 4OPAA 1ZC6A 3VQDA 1BQNA 2YNGA 3C6HA 1DEJA 4BQLA 3QEVA 5KPTA 1N8RO 1LAWA 1BWFO 4DR4K 4KRFA 5HP1A 1J9AA 4CJ5A 3ZX3A 3H08A 3KLEA 3TAMA 1S22A 2RHKA 1I39A 2KLAA 1GLJO 3SYZA 4X66K 2HSTA 3VA3A 3H3NO 3H6EA 4IDKA 5AQXA 4IEIA 1T05A 1HJOA 4H0XB 1NMDA 3HSCA 3KIOA 4MQ3A 5CHIA 4FZXC 4KI4A 4B9UA 3MN9A 1VQLN 1DLOA 4BR7A 2AJQA 4FJ5A 3O08A 4BRQA 4ZHRA 3MN7A 3CIPA 5DM6L 1NKCA 1DTQA 3PO4A 4FJMA 5KTQA 2Q0UA 1OH7A 4AHUA 1UOCA 4DS5A 4DSLA 3S41A 1TVRA 2FSNA 1EETA 2XRIA 3AVFA 2UXBK 3KZBA 1S3XA 4DQQA 1TKTA 1YTAA 4BRIA 4CBWA 1TK0A 1OH6A 2I7PA 3VEXA 2IVOA 4KHQA 3T1AA 2IAJA 3G25A 5E26A 2ITMA 5AZJA 1YVUA 1BG3A 3NF7A 4K8ZA 3NE6A 4R79A 1GOBA 3CI5A 1IBKK 4ISGA 1GLDG 3QNNA 4CZHA 1VHXA 1CZ9A 1E3MA 5C2FA 5T7BA 3ZCMA 1NBWA 4A2AA 4E1NA 1VQ5N 4O8KA 2R7YA 2BDPA 4BWJA 4HCBA 2P9UB 3AVKA 1RDBA 3OTOK 4LF6K 4N76A 1S9EA 2IGIA 3CC7N 3ZSOA 4M3YA 1BISA 2BTFA 3K9JA 2NRVA 2D1KA 3D2EA 1HNWK 3TAQA 3I55N 3CETA 2HBKA 5ADXA 2KHOA 4K42A 4N47A 2NLXA 3NH1A 4JHDB 1BU6O 2QWMA 1XUPO 2X6SA 3E01A 4I6MB 1CZBA 3QESA 3W3DA 1VSDA 1XMOK 4F2RA 4IZ9A 1HNIA 4DQIA 4YOTA 4MLHA 1SL2A 4CEEA 3KHYA 4BRMA 1U2VA 3LM2A 3T7ZA 4GKJK 1RDWX 3U8XA 4MDAA 3OHRA 3AVBA 1I3AA 4C8MA 4WQ4A 1XC3A 3AVJA 4ILHA 4GV6A 2GV9A 5HROA 4PKGA 1BQMA 1UAXA 2HHWA 4DTPA 4DFJA 4E1JA 2HNYA 1LV5A 3CYMA 3HL8A 5AQVA 3GG4A 4YDUC 1T3VA 4A62A 3P38A 5SWMA 3TABA 2AA4A 2NNWA 3EE9A 3VPZA 4DLEA 3JS6A 2P9PB 3VQ5A 4DSKA 1WB9A 4BDPA 4Z0UA 2YKNA 5C25A 3S3MA 3TPQA 4OX9K 5HOOA 4LF9K 2JWLA 3ZT1A 1VK0A 3QINA 1C0MA 4XH1A 5BR9A 4N5SA 2FSKA 5AQPA 3AVIA 3OJSA 3ZEUB 3PLAA 3HPOA 3CPWM 5C24A 1X1PA 1VQ4N 4OGCA 2D0PA 4AHVA 4O0JA 2I7NA 3D7EO 3VQ8A 4KKOA 4FCYA 1TKDA 4BRFA 3O5BA 1EQYA 3V9WA 4JI1K 3DXMB 4A5BA 4EP5A 1NKBA 1N6QA 5CYQA 3GBTA 4FWLA 2Q97A 4E7KA 4EFHA 2VGMA 1C0TA 3CM5A 2HBMA 4Q0BA 2ZD1A 3OYAA 5I9EB 4CD1A 3TR8A 1CXUA 2OA8A 4EZ6A 1V4SA 5KGXA 1E4GT 4CF2A 1RDAA 2G8UA 3PV8A 3L2RA 1RDUA 4DSIA 2KTQA 2UUCK 1Q9XA 3KLHA 2GELA 4KTQA 5LJVA 1K9MO 3HZ6A 4FJ7A 4EHTA 3HVTA 3KKRA 4WE1A 4B9SA 1IKYA 5J2QA 4KPYA 3AVCA 3IMXA 4FW1A 3TSPA 4B9MA 3G6EN 4YFUA 2E6MA 3PSFA 4ISEA 4CW7B 4E0DA 3L2UA 1KXPA 3GDQA 2OANA 2QWLA 4DR5K 1RFQA 1IJJA 3OYMA 3TU5A 5IT9O 4CZFA 5AQSA 2D0CA 1NJWA 3ITHA 1Q82O 4QOZB 4CGIA 3SAGA 1VRUA 1KSPA 2BANA 4FOIA 4PY5A 5C15A 4OVLA 5C42A 1IKWA 3CC2N 3IG1A 4DR6K 1YJWN 4CZMA 3M8QA 1S6PA 2YX6A 3CCEN 4CJTA 4QCLA 3SMPA 4PWDA 2G8KA 4F3TA 1IG8A 3RMCA 2P9KB 4BRCA 1NK0A 3F73A 4LFBK 2OPPA 3NMUA 2E2NA 4GW6A 4U7BA 3SNNA 2HMIA 2GUIA 2CH5A 1KRPA 5KPZA 2HHQA 3WXJA 4E3SA 2H3GX 3S9HA 4X62K 1RT1A 4NLBA 4WQ5A 4AHSA 1C1BA 1XQSC 1B92A 3R3LA 3TSUA 4KHYA 4H5TA 1KCFA 4C8NA 4O55A 2P9IB 4WFBL 1DGKN 2HOEA 1RCHA 1RBRA 5FRNA 4BRAA 3UKUA 4FL9A 4B1XB 1LCUA 4DV2K 1NGAA 3AO3A 3O8MA 2YNFA 3VF2A 4CFDA 3ZT2A 3L3VA 5F0XA 4N56A 4FJJA 3NHGA 2UUBK 4H5VA 3DLLL 4GVEA 1N34K 4H0OA 4DU1A 5AQMA 4DS4A 1VQON 4CJWA 5JVHL 3O9RA 4NXMK 2PAVA 3AGRA 4KH4A 4FJLA 3O9UA 3VESA 3THYB 4B9TA 1TUYA 1W2BM 2O8BB 4JK7A 3BY5A 4C8OA 4KHPK 3VF4A 3LDQA 5FPEA 5DM7L 5EY4A 4B3SK 4DUYK 2EHGA 3PX6A 4FXDA 3HPGA 3I0SA 1T44A 4YOXA 4OGEA 1ESVA 3VTHA 1VSJA 4F3OA 3AGKA 3ULEA 5ADXH 2HW3A 4IFYA 2WONA 4FLZA 4KTWA 2O8FB 5KGWA 3WXIA 4XH5A 2HB5A 3M5RA 4OPKA 4ISFA 1LW2A 2ZGYA 4KAZA 2Q3SA 3PIPL 3KK2A 3TAGA 1C0GA 4WQ4C 1TKZA 1S1TA 1JLEA 3ZSYA 3W0LA 1O13A 4AQYK 3DLBA 4Y0WA 3O1WA 3BEXA 1GLFO 4CZGA 4E89A 4WFAL 3JSMA 2Z1HA 1YIJN 4GNIA 4DWIA 3P5JA 3EN9A 3LAMA 3EL2A 3CFRA 4BVPA 4KV8A 2DFFA 1S9GA 4V19S 4HCCA 1NGEA 3D2FA 2P9SA 1NGIA 4CGGA 3SPYA 2E6LA 4M3UA 1VSIA 5CY4A 5KRSA 2W41A 3CCJN 1NGBA 1KVCA 4NCGA 1QHAA 1YITN 1GLLO 3SAHA 1NOZA 3DMJA 1IBLK 1WSJA 4B1YB 3L2VA 3VN5A 1N36K 4Z4GA 2G8IA 4ILGB 4X64K 5AR0A 4G1QA 4JKHA 3R8EA 3MECA 2GTDA 1VSEA 1U4BA 3HVRA 4GMJB 1ZBIA 2CGJA 2QI2A 1IG9A 4A57A 2YHWA 2QKKA 2CH6A 4IG3A 1RTJA 2HHXA 5BR8K 2IVPA 4PL8A 4BRPA 5BREA 3A5NC 3NH0A 3ZT0A 4KB0A 1BGXT 1JLAA 3TI0A 2ETJA 4KI6A 2HF4A 2ZE2A 2YHYA 3I8DA 3TWHA 4RW4A 2NRHA 4E19A 4CEZA 5E41A 4JKFA 4CZLA 3ZT4A 3H1VX 4O44A 4CJKA 3O3GA 3E9LA 1TL3A 4YOUA 3LZJA 4AILC 3QFUA 4RTFD 4J2AA 1J53A 4MO5A 3QEWA 4I6MA 1JCGA 1UA1A 5AQGA 3AVMA 4J8FA 1NK4A 4RW7A 2E5LK 1VRTA 3T1HK 1RGIA 3LM9A 4CK2A 1BI4A 1LWCA 2OTJN 2OPRA 1YXQA 1ZBLA 3DLEA 4CJ7A 4CHNA 3VMFB 1B9FA 3MXJA 3WNFA 1VQPN 3R9PA 1W0HA 1JJ2M 4DR3K 1UWBA 4WYBA 3K58A 3M6GA 3RSEA 3OYNA 4FJ8A 3QEPA 4KB1A 4DTRA 5AQFA 2RKIA 1U45A 3RRHA 5AFUA 2VG7A 3CQXA 4E1MA 1SAZA 3BF3A 1QSLA 4DV1K 2PBDA 1EP4A 5AQIA 4H03B 3F2KA 3UKRB 4A59A 2YHBA 3MN5A 3WNHA 2VGNA 2DTUA 4MLEA 4DTMA 3NBPA 2YI1A 4C8KA 3AA5X 4JN4A 3MN6A 3VGLA 4LFAK 1NLVA 1WBBA 1FXXA 1B9DA 2VG5A 2Y1JA 1KAYA 3DRPA 3SV3A 2BE2A 1DT9A 3QFPA 3THWB 1TGOA 3ZEUA 5K14A 1Z26A 3K5OA 4Y1CA 4C8LA 1C6VA 1IV0A 3J8AA 5MLCQ 3DRSA 3AO1A 3TTFA 4BC4A 4GKKK 1MWMA 3D0PA 4BRDA 1N32K 4H4OA 4BE1A 1NJZA 3AVNA 3I8BA 3CG7A 1OH5A 1SKRA 5I3UA 2PYJA 5LL6Z 2WC9A 1ASUA 3IRXA 1KAZA 5GAEP 4W5QA 2G8HA 3AVLA 3LDNA 2A41A 2VG6A 3R1XA 1HNVA 1BA0A 3KLIA 4K43A 3THVA 5EX5A 4FWOA 3SBGA 5KRTA 3LPUA 5M1OA 4PA1A 4BRKA 4BRHA 4CBXA 3RMDA 5C2DA 2PY5A 2B4JA 4Z4CA 4CFAA 3K59A 3LL3A 3NF6A 1QE1A 1U48A 5M1NA 1IKVA 4RW8A 3DLGA 4WCEL 4DTXA 4H0VB 1NK7A 3SUPA 3VENA 3K2PA 2A42A 2A3ZA 2J4RA 4BREA 4KH6A 1ZBSA 2X6NA 4CK1A 1SKWA 5AQNA 3U3GA 3V1RA 4CFCA 3V81A 3SCXA 3K5LA 1UA0A 2Z1JA 3RTVA 4IO9L 4DR1K 5M1KA 2XO7A 3RWUA 1A5WA 4B1ZA 3CCVN 2O8DB 3RMAA 4CGDA 5AZIB 4JKGB 4M41A 1C1CA 3KLGA 1YJ9N 3MK6A 4M3ZA 1TUUA 4ILJA 1IKXA 2NRZA 4FWPA 3ZX0A 5C10A 3BDPA 1D8YA 4EZ9A 1HKBA 1A5XA 3C6TA 4JK8A 4MDBA 4OPJA 3QLHA 4DCHA 3VEZA 3PSIA 2B6AA 3VEOA 4AHRA 2WBNA 3OYBA 3SQ1A 4JNEA 4BG8A 4O8UA 1Y64A 1YF5L 3F5TA 2F9TA 3BUZB 2P9LB 4M63C 3FZMA 3G71N 4JLHA 1LOTB 1Z25A 3P4IA 5AQLA 3CCMN 2O4GA 4CFBA 3LANA 4XH4A 3M1FA 3SZ2A 1GOAA 2P9IA 3VETA 1Y97A 4K25A 3DI6A 4HTLA 4HHTA 4CJQA 3L8BA 2E4LA 3O4NA 5LY3A 4B3MK 3SUNA 3CD6N 4JV5K 4HTUA 3O9SA 5DK5A 3U3YA 3NF8A 4CI6A 1K73O 1J54A 4JI7K 5BRDA 1K8KB 3TTCA 4CERA 3K5MA 4QS8A 3CHWA 2GWJA 3J81O 3LDOA 2KZZA 4DV7K 5AQZA 3DJCA 1WNSA 4CD3A 4KHNA 3NGYA 5JS1A 1HUXA 3I56N 4NCAA 3NFAA 3FZFA 3KWIA 2P5GA 1EXQA 4YORA 4LF4K 3LDPA 3U4LA 3HK2A 3THYA 2P5OA 3KTQA 1I94K 1GOCA 5GADP 4I7FA 5FLXO 5J2MA 4OLAA 1MWKA 5M1PA 2Q0RA 1M1KO 3ZSQA 3WNGA 3QIPA 3HOTA 2BGGA 4W5TA 3ALYA 1WOQA 1C0FA 3HSTB 2GBZA 5B8HA 1VQNN 3CXCM 3QETA 4M3TA 3KWGA 2BUPA 5AQRA 2OZMA 3T1YK 3BZCA 3M8SA 5E84A 3WXKA 5FPMA 4CECA 1YUWA 2KFZA 4JI2K 4CZKA 4Z4FA 4CZJA 1KLMA 1X3NA 2B5JA 4CEOA 3ZLJA 4CJLA 2XY5A 5GAHP 4BE0A 4KHSA 3SLCA 4ID1A 1H1VA 1SUQA 3OY9A 1X9SA 3OS1A 2D4WA 4B3OA 2VCPA 3THXB 2NRRA 1BIUA 3EYZA 3CFPA 2A1SA 5AFUH 3DXKB 3ZSRA 2KFNA 1WAJA 2ZJRL 1Q9YA 4DMNA 2ZM6K 3VQBA 3V9XA 4DV6K 1G15A 1NK9A 3V9ZA 3OA9A 1RT7A 3C7NB 4FLXA 4ZTFA 4B9QA 3FLCO 5A2QO 2WTUA 3LDSA 3SI6A 2P1JA 4CGFA 3KD1E 2P9NB 4IOAL 4PHTX 4C1NK 1QZ6A 5JMVA 1XMQK 4FK2A 1TYQB 3O3FA 2D5RA 4AM7A 4JS4A 3RMBA 3AARA 1TAUA 3C94A 4B1VA 4CJSA 1YHQN 3LP2A 2WOMA 1F21A 4ELUA 3P1GA 1DTTA 1GLEG 5AQWA 1D4XA 3A5LC 4RWTA 4AM6A 1TK5A 1U6ZA 1V4TA 3IFRA 3QBXA 3AVGA 4FVMA 3LDLA 3CQYA 4JI5K 3TAFA 3O4QA 2HNDA 4O5FA 3VQQA 4DQRA 3AO4A 3HPHA 2I5JA 1T7PA 2Q36A 4BVOA 4CEDA 2QWNA 1WUAA 2O8CB 3DOLA 2QWOA 3NVMA 1Q86O 3V9SA 2UUAK 1Q18A 4B1WB 4LH4A 4CEQA 4JKCA 1JKHA 1W9HA 1E4FT 3ZT3A 2Q31A 4F8RA 1KVAA 4CGJA 4FW2A 3CJCA 1RTDA 3IKMA 1NJXA 2NRXA 5M1QA 4O0IA 1WSHA 3ATUA 3DLHA 3OYJA 3EZWA 3FFKB 3CPEA 3UKRA 4M3WA 3MXIA 3M8RA 3MWTA 5HRRA 1TL1A 2V7ZA 4W5NA 3OYGA 3F9KA 3KKSA 1JL1A 1QSYA 1HYSA 4FZZA 1TV6A 4RCHA 4FWQA 1WN7A 2YHAA 2IOCA 1VSLA 1FKPA 1Z6RA 2YJEA 4YOVA 5LMNK 1N33K 1HLUA 1Q7YO 4LD0A 1SKSA 2D0AA 4AHTA 2ITGA 4BR5A 3D6RA 3H45C 3KK3A 2G8WA 2UU9K 4JKDA 2OCEA 4DTUA 3V1OA 2HF3A 5ELZA 3E9PA 3L4QA 2E88A 4B1UB 2FBVA 3BGRA 2KQ2A 4DB3A 4A2BA 1HPZA 2ASOA 3CCSN 4DR7K 4HUEA 1VAZA 3D2EB 4Z4HA 1KD1O 2HVIA 1S1VA 1KLNA 4JD2A 5BPNA 3QICA 1LW0A 1QZ5A 3CERA 5AQTA 3QO9A 2E20A 3QB0A 3E66A 5GIOA 3CM6A 1FW6A 1RBTA 4NLCA 3ISNC 4JI8K 3LWLA 2OZSA 4IKFA 3FZHA 1D9FA 5D3GA 3WNEA 1GLCG 5LMUK 4A61A 2GUPA 3MCPA 3OYCA 3LWMA 3LPTA 4NO7A 4KBOA 3ID8A 5C12A 3Q7BA 2HBJA 3IDHA 4EIAA 4EP4A 5AZIA 3OYIA 4JKGA 4M45A 1HNXK 3MXMA 4OLBA 3QMLA 1WSFA 3FFIA 4RG8A 2UXCK 4OPHA 2RN2A 2PFUA 2NZTA 4DSFA 4JAXA 4JS5A 3RR7A 4XIUA 1EWQA 2E1ZA 1KFSA 2KW4A 1K6YA 2YNIA 3KK1A 1NG9A 4CZEA 1ZBHA 3U6FA 1JL2A 5FPNA 1D5AA 5JICA 3V6DA 3CJ1A 3FGUA 1VSHA 1EO1A 1NGDA 4KHWA 1X3MA 1YJNN 3S3OA 2D0OA 2QXFA 3O9QA 3OYLA 2NRTA 4UY8O 4IWVA 2HHUA 5GINA 3SUQA 4DTOA 3C95A 1JXBA 3AA2A 2P9UA 3ASMA 5AQKA 3TARA 1OH8A 1HJRA 3VQ7A 2ATQA 1IBMK 3A5MC 3B6PA 4FO0A 2F8SA 3HTVA 3QEXA 3FZLA 3ZYYX 1HX1A 3SMSA 1FK9A 1T6CA 5EOYA 1RBSA 3CJ9A 4JHDA 5CZ2A 1J5EK 2E2PA 3QDKA 2YHXA 4BWMA 4Z94A 2FBYA 4BDYA 1FKOA 4CEBA 3HM9A 4JYAK 2HNZA 3OYHA 1GLAG 2QM1A 2QWQA 3C6UA 4CGHA 3V4IA 4DU4A 1S6QA 4DHYA 4KTZA 2QXLA 2XY7A 4X65K 4CHZA 1ILYA 3VEYA 4CJRA 4FZYA 3SAFA 3P83D 4HUFA 4B9LA 4GV3A 4C23A 3IUCA 2RE2A 5IWAK 2W6LA 3ULDA 2ZF5O 3U9DA 3EZ5A 1CXQA 1NJYA 1NK8A 3NVKA 1JCEA 3OVNA 1C1AA 2Q2RA 1KVBA 2QKBA 1MU2A 4FJKA 1XNQK 3L4IA 2A40A 1D9DA 3AAQA 2P9PA 2ZJQL 2PYLA 1XHZA 4NYFA 4IDHA 3OBWA 3QNOA 1ZXOA 2HHTA 5J2NA 4XEIA 5GIPA 4DQPA 4AH9A 4M3RA 4FK0A 3DLRA 3S3NA 1QS4A 2ZJPL 4BR0A 2ZGZA 3AVAA 2A1RA 4JRPA 4DLGA 4FLUA 3VQEA 5HL7L 2OPSA 3THXA 4IOXA 3MX2A 1VQ9N 1RT5A 4DV3K 4BROA 3AA3A 1SL0A 1BHLA 3C65A 3DXKA 4CJUA 4DV5K 4TSXA 4LY7A 4GVMA 4BDZA 5TKYA 4E7IA 3FE1A 5BRHA 2GEMA 4DQ8A 3DXMA 1XHXA 3U9ZA 1LWFA 3CJBA 4LSLA 1L3UA 3C7NA 3A8YA 1RT4A 5FPDA 4QAGA 3ZSVA 4BR2A 1HYZA 1NKEA 3D45A 4H8KA 2VWJA 4BE2A 4O4GA 3UKUB 2ASMA 1QQNA 1MA9B 2E1YA 1YT3A 5FRMA 3PX4A 1ASVA 4KO0A 1CLQA 2WFBA 4FLYA 1XWLA 3ENHA 3LP1A 1IH7A 3SBTA 4JKBA 2YV0X 2E2QA 2QK9A 4FWSA 4DFMA 2EWSA 4IEEA 1JLFA 1U49A 3E1YA 1Q81O 1ATRA 2VWBA 4CJ3A 3JAMO 3MDQA 3EEQA 3HRGA 4JK9A 3VQCA 3TSQA 1O1WA 1N5YA 4IO8A 3DAWA 3NF9A 5FROA 2CGKA 3NDKA 4CHOA 3WT0A 2FF6A 3N4PA 3G4SN 4M7YA 3K9KA 1BIZA 4CJPA 2OPQA 1GLBG 1RTHA 3ZETB 4CIFA 3PIOL 3HBTA 5HRSA 3QEIA 4DSEA 2QWPA 4Z4EA 4DFPA 2VQFK 3ULEB 2O8CA 1VQMN 3DWLA 2FBXA 2BH1A 2YNHA 4CJVA 1Z05A 2A6AA 4BR4A 5KPRA 4HUGA 3WXMB 3PY8A 1QQOA 4AF1A 2FC0A 3T3FA 2HHSA 1TAQA 3IAYA 2DY4A 3ENBA 3AAPA 2V52B 4BQZA 2Z1IA 2YCHA 3VOVA 3OYFA 2P9KA 2ZQBA 1RNHA 3EY1A 4K41A 4DU3A 3D2FB 1C0UA 1J6ZA 2P9SB 1OKJA 5AQHA 4FYDA 1BO5O 1P8ZA 4IG0A 3H1QA 2LSNA 4FJGA 4DR2K 3H3OB 3AVHA 3MEEA 2O8EB 3BF1A 2AP1A 1T8EA 4H5RA 3VQ9A 4JKEA 5EU7A 4YY3K 5DMRA 3V1QA 4H4MA 3ZX2A 3CCLN 4GY2B 4CESA 1BOTO 5HRNA 3SUOA 4L3QA 5J1EA 2XY6A 1WSEA 2E8AA 1K8AO 3WEEB 4DSJA 2P51A 4BC5A 3ZSXA 4BGBA 1RBVA 1LWEA 1KFDA 1RILA 1RTIA 1CZAN 4IFVA 1HRHA 5BN8A 3UIQA 3G10A 1SL1A 2QW9A 2FSJA 1SQKA 4ICLA 5BPLA 3HO1A 2F96A 3EO3A 3VGKA 2GWKA 4QS9A 4LF7K 3ATVA 4NYNA 2E2OA 2O8BA 3L0QA 4ID5A 2KKZA 4YOYA 3MAQA 1XI1A 4JI6K 1EKEA 3MWPA 3P31A 4LH5A 4FJNA 1VSKA 4M7XA 1S72N 4RW9A 3O9TA 4FLWA 1ASWA 3CJAA 1VQ6N 3I33A 4CIEA 5HBMA 4BR9A 1VQKN 3CMEN 1YTUA 4YOWA 4IJAA 1BI4B 1VQ7N 2F7TA 3A0IX 4FJHA 4CBUA 5I42A 5CR4A 1HMVA 2O8FA 3LAKA 3ENOA 5KI6A 3CCQN 1YI2N 5AQQA 1MDUB 5JVGL 3RSEB 4FPAA 1OVYA 1ZBUA 4F4KA 1SV5A 4DV0K 4I9QA 4PUOA 1ITGA 1WSIA 3QBWA 3NGZA 5AQOA 1BDGA 2F8TA 3M8PA 1S1WA 1ATSA 1HQUA 4KHUA 3VEWA 3TANA 4JI3K 5J2PA 1HYVA 1SS6A 4FJIA 3LZIA 3HXMA 4FM1A 4HWIA 1NGJA 3PX0A 1HQEA 3OYKA 3SQ4A 1T03A 1JXEA 2PZSA 4FOEA 1EWRA 1OVQA 1BUPA 4IOCL 3NH2A 4BC3A 4DTNA 4LSNA 4EAHD 3HI0A 3AY9A 5CZ1A 1S1UA 5BRFA 4H5WA 4BRGA 2ZWHA 2V7YA 3OS0A 4CE9A 4Y1DA 1HR0K 2FLOA 2VWKA 4MO4A 2VYPA 1SZ2A 3NCIA 5M1FA 4CF9A 4U67L 3J7ZO 1NK6A 2OTLN 4CZIA 4J2DA 1RDDA 3L2QA 4DFKA 1RT3A 2W6KA 3AV9A 2EX3A 2RF2A 3B8AX 4AHCA 2F9WA 3N4QA 3SQ2A 1W97L 2JGUA 1JLQA 3SJHA 3T69A 1VQ8N 1WBDA 2UXDK 4DV4K 4UQGA 3CMAN 1QSSA 4CHQA 3HOSA 3O4WA 3JYTA 3O6WA 3VQPA 4M42A 5H1SQ 3HT3A 3PO5A 3R6MA 1YVNA 5AQUA 4BY9C 2IVNA 1U47A 4B9VA 3J80O 4BACA 3OYDA 1IO2A 1T6DA 4CIGA 1NGGA 4CHYA 1NJIO 3OJUA 1QQCA 4FSVA 4QS7A 3VQ6A 2DFEA 1L3TA 2HHVA 5F1XA
chains in the Genus database with same CATH topology
4NXMK 5AJ3K 5LMNK 4B3MK 4JI0K 1N33K 4JV5K 4GKJK 5A2QO 4JI3K 4JI7K 4LFCK 4DV3K 2UU9K 4DR2K 4KHPK 4X66K 3J7AP 4B3SK 4DV5K 3J81O 4DUYK 4DV7K 1XMQK 2E5LK 4YY3K 4CW7B 4CVNE 4B3TK 3T1HK 1IBMK 4DR5K 4LF4K 4B3RK 4DR7K 5IT9O 1I94K 4JI4K 4YHHK 5FLXO 2HHHK 4DR3K 4NXNK 4AQYK 1J5EK 1HR0K 4K0KK 2UXBK 4LF8K 4DR6K 4OX9K 4DR1K 4JI5K 4JYAK 4LF9K 4JI8K 4LF7K 4V19S 3T1YK 4LFBK 4DV1K 5LMUK 3JAMO 4X65K 1IBKK 4JI2K 4JI6K 4X62K 2UUAK 1XNRK 2VQEK 1IBLK 4LFAK 5IWAK 3OTOK 4LF6K 4JI1K 2UXDK 2F4VK 4DV4K 1N36K 3J7YP 1HNXK 4X64K 1XNQK 1HNZK 2VQFK 2UXCK 1HNWK 1FJGK 4LF5K 4DV2K 4DUZK 4GKKK 3J80O 5BR8K 1N32K 2UUBK 4DV0K 1XMOK 2ZM6K 4DV6K 1N34K 5LL6Z 2UUCK 4DR4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM K;  5AJ3 K;  5LMN K;  4B3M K;  4JI0 K;  1N33 K;  4JV5 K;  4GKJ K;  5A2Q O;  4JI3 K;  4JI7 K;  4LFC K;  4DV3 K;  2UU9 K;  4DR2 K;  4KHP K;  4X66 K;  3J7A P;  4B3S K;  4DV5 K;  3J81 O;  4DUY K;  4DV7 K;  1XMQ K;  2E5L K;  4YY3 K;  4CW7 B;  4CVN E;  4B3T K;  3T1H K;  1IBM K;  4DR5 K;  4LF4 K;  4B3R K;  4DR7 K;  5IT9 O;  1I94 K;  4JI4 K;  4YHH K;  5FLX O;  2HHH K;  4DR3 K;  4NXN K;  4AQY K;  1J5E K;  1HR0 K;  4K0K K;  2UXB K;  4LF8 K;  4DR6 K;  4OX9 K;  4DR1 K;  4JI5 K;  4JYA K;  4LF9 K;  4JI8 K;  4LF7 K;  4V19 S;  3T1Y K;  4LFB K;  4DV1 K;  5LMU K;  3JAM O;  4X65 K;  1IBK K;  4JI2 K;  4JI6 K;  4X62 K;  2UUA K;  1XNR K;  2VQE K;  1IBL K;  4LFA K;  5IWA K;  3OTO K;  4LF6 K;  4JI1 K;  2UXD K;  2F4V K;  4DV4 K;  1N36 K;  3J7Y P;  1HNX K;  4X64 K;  1XNQ K;  1HNZ K;  2VQF K;  2UXC K;  1HNW K;  1FJG K;  4LF5 K;  4DV2 K;  4DUZ K;  4GKK K;  3J80 O;  5BR8 K;  1N32 K;  2UUB K;  4DV0 K;  1XMO K;  2ZM6 K;  4DV6 K;  1N34 K;  5LL6 Z;  2UUC K;  4DR4 K; 
#chains in the Genus database with same CATH topology
 5CE3 A;  4CJE A;  2DFH A;  1RDC A;  2D0B A;  4E7J A;  3TAE A;  4LFC K;  4FJX A;  4CK3 A;  4DF4 A;  3OYE A;  3CJ7 A;  4CF8 A;  5LJW A;  1HKC A;  3RR8 A;  4ZTJ A;  4BRN A;  4B3T K;  1HPM A;  3THW A;  3MMV A;  1ZYQ A;  1KQS M;  3DYA A;  5SZT A;  2XY8 A;  5AZJ B;  4YHH K;  3O3H A;  3LAL A;  4NXN K;  3SK3 A;  1W7A A;  1WAF A;  3K0S A;  1HKG A;  4K0K K;  4PKH A;  4C1N I;  1BCO A;  5KQ8 A;  3K57 A;  4ELV A;  1NMN A;  2FF3 B;  1JCF A;  4PKI A;  3DM2 A;  2IIR A;  3K5N A;  4O5B A;  3CCU N;  5CYM A;  1P90 A;  4ELT A;  3MX5 A;  1G99 A;  3WQT A;  1BL3 A;  4H0P A;  4H5N A;  4H0T B;  4DKW A;  5FDL A;  4KRE A;  1VSM A;  3DLK A;  2WUS A;  3LP3 A;  1WLJ A;  5F2R A;  3LP0 A;  3VGM A;  1TK8 A;  4B08 A;  3VA0 A;  4F9O A;  2W40 A;  4KH5 A;  2A5X A;  2X74 A;  3QER A;  2IC3 A;  1HNZ K;  5EVZ A;  4OO1 J;  4OJR A;  3L2W A;  1U2V B;  4I2Q A;  1NM1 A;  1DKG D;  4R5P A;  2QA4 N;  3Q7C A;  2ASP A;  3AO5 A;  4BRL A;  4WF9 L;  4Q5V A;  1NGC A;  3KJV A;  3E9O A;  1WSG A;  3GOI A;  3ZET A;  3A2F A;  4CJ4 A;  4YNQ A;  4E7H A;  3OBY A;  2W42 A;  4B9N A;  4FWM A;  3RVC A;  3PUF A;  2O8D A;  3GL1 A;  3DRR A;  4IJN A;  4CEA A;  3HP9 A;  3EKS A;  1XC9 A;  4FWN A;  3GE1 A;  5AJ3 K;  4JI0 K;  4N41 A;  4F2S A;  3HP6 A;  5HRP A;  3AO2 A;  4OKJ A;  4FLT A;  1X9M A;  3MEG A;  4PL7 A;  4J2B A;  4HVJ A;  4G9Z A;  3VER A;  1R59 O;  5KQD A;  4CHP A;  1S1X A;  1L3S A;  5EXW A;  3O80 A;  5BN9 A;  3VQA A;  4K8X A;  2JLE A;  2G8V A;  2FBT A;  2Q1N A;  4JI4 K;  2HHH K;  5HLF A;  2P9L A;  3TAP A;  2QWR A;  2HMP A;  3OS2 A;  3V9U A;  4NCB A;  2YKM A;  2O8E A;  3SQ0 A;  4FJ9 A;  5GAG P;  1S5J A;  2YJF A;  4MFB A;  4LF8 K;  1ATN A;  3H46 O;  5AQY A;  3HYF A;  3MED A;  3P39 A;  4B8A B;  1RT6 A;  3WQU A;  4FPB A;  4KFB A;  1VSF A;  3QIO A;  1REV A;  3WEE A;  4CCH A;  1NWK A;  1L3V A;  4H0Y B;  4NB4 A;  2DPN A;  1K8K A;  4FVU A;  2G8F A;  1X9W A;  1ZBF A;  1NOY A;  4CJF A;  1NK5 A;  3CFO A;  2VQE K;  1QVG M;  1KAX A;  3IS9 A;  4FM2 A;  3KK7 A;  3VF6 A;  3L6Q A;  4W5R A;  1KC8 O;  4IFE A;  4CF0 A;  1X9J A;  4W5O A;  3J7Y P;  2IS3 A;  1L5U A;  5C0Y A;  3KD5 E;  1Q8I A;  3TTD A;  4JRQ A;  4B8C A;  4M3X A;  4I2P A;  1TKX A;  4LF5 K;  1BCM A;  2Y1I A;  3CCR N;  3ZSZ A;  4DUZ K;  5AQJ A;  1YAG A;  1BA1 A;  3CC4 N;  4CEF A;  1NGF A;  4CF1 A;  2X78 A;  4GV9 A;  4EHU A;  4JEP A;  5JLH A;  4YDU A;  4FWK A;  1NU0 A;  1J5O A;  5JS2 A;  3I0R A;  2HBL A;  3F9M A;  3MCA B;  3BZK A;  1M90 O;  3C6A A;  4JKA A;  4DTJ A;  3FZK A;  4FM0 A;  3VTI A;  3C0B A;  2QTD A;  2V51 B;  4E7L A;  1QTM A;  3A5O C;  3VQ4 A;  1U04 A;  3J7A P;  3JXU A;  2IDO A;  1JLB A;  3CF5 L;  4BGA A;  3DOK A;  4IBN A;  5BPM A;  1A5V A;  4CVN E;  3NGI A;  3BP8 A;  3O1B A;  4I9L A;  4IXC A;  4FWR A;  4B3R K;  3UB5 A;  4A5A A;  1JLC A;  3ZSW A;  3OW2 M;  2NRW A;  2NUB A;  3SPZ A;  4J2E A;  1R0A A;  3KLF A;  3RRG A;  3KVG A;  1QQM A;  1KTQ A;  3UE5 A;  3L3U A;  4FK4 A;  4DTS A;  3G0Z A;  3M3Z A;  2HVH A;  3EE8 A;  3EKU A;  1LAV A;  3B6O A;  4DG1 A;  1JLG A;  3SJJ A;  3WUH A;  4BC2 A;  3T19 A;  4DQS A;  2RPI A;  2XHB A;  4OKE A;  3NAE A;  2O4I A;  2KZM A;  3SV4 A;  3CQ8 A;  5JLF A;  3HJF A;  2P9N A;  1NNE A;  4WQ5 C;  2FXU A;  1XNR K;  2CGL A;  4LC9 B;  1TYQ A;  3HM8 A;  4FLV A;  2GX9 A;  3FR0 A;  1EX4 A;  2OYQ A;  2F4V K;  4DF8 A;  1NGH A;  3AA4 A;  4Z4I A;  2UYT A;  4PQU A;  2QEX N;  1FJG K;  1QVF M;  4BG9 A;  4JD2 B;  1RT2 A;  4OKK A;  4RW6 A;  4L8R B;  1RBU A;  5TKW A;  1QHT A;  2JWK A;  2Z1G A;  3ID6 A;  3WXL A;  4WFN L;  3VEV A;  4OPA A;  1ZC6 A;  3VQD A;  1BQN A;  2YNG A;  3C6H A;  1DEJ A;  4BQL A;  3QEV A;  5KPT A;  1N8R O;  1LAW A;  1BWF O;  4DR4 K;  4KRF A;  5HP1 A;  1J9A A;  4CJ5 A;  3ZX3 A;  3H08 A;  3KLE A;  3TAM A;  1S22 A;  2RHK A;  1I39 A;  2KLA A;  1GLJ O;  3SYZ A;  4X66 K;  2HST A;  3VA3 A;  3H3N O;  3H6E A;  4IDK A;  5AQX A;  4IEI A;  1T05 A;  1HJO A;  4H0X B;  1NMD A;  3HSC A;  3KIO A;  4MQ3 A;  5CHI A;  4FZX C;  4KI4 A;  4B9U A;  3MN9 A;  1VQL N;  1DLO A;  4BR7 A;  2AJQ A;  4FJ5 A;  3O08 A;  4BRQ A;  4ZHR A;  3MN7 A;  3CIP A;  5DM6 L;  1NKC A;  1DTQ A;  3PO4 A;  4FJM A;  5KTQ A;  2Q0U A;  1OH7 A;  4AHU A;  1UOC A;  4DS5 A;  4DSL A;  3S41 A;  1TVR A;  2FSN A;  1EET A;  2XRI A;  3AVF A;  2UXB K;  3KZB A;  1S3X A;  4DQQ A;  1TKT A;  1YTA A;  4BRI A;  4CBW A;  1TK0 A;  1OH6 A;  2I7P A;  3VEX A;  2IVO A;  4KHQ A;  3T1A A;  2IAJ A;  3G25 A;  5E26 A;  2ITM A;  5AZJ A;  1YVU A;  1BG3 A;  3NF7 A;  4K8Z A;  3NE6 A;  4R79 A;  1GOB A;  3CI5 A;  1IBK K;  4ISG A;  1GLD G;  3QNN A;  4CZH A;  1VHX A;  1CZ9 A;  1E3M A;  5C2F A;  5T7B A;  3ZCM A;  1NBW A;  4A2A A;  4E1N A;  1VQ5 N;  4O8K A;  2R7Y A;  2BDP A;  4BWJ A;  4HCB A;  2P9U B;  3AVK A;  1RDB A;  3OTO K;  4LF6 K;  4N76 A;  1S9E A;  2IGI A;  3CC7 N;  3ZSO A;  4M3Y A;  1BIS A;  2BTF A;  3K9J A;  2NRV A;  2D1K A;  3D2E A;  1HNW K;  3TAQ A;  3I55 N;  3CET A;  2HBK A;  5ADX A;  2KHO A;  4K42 A;  4N47 A;  2NLX A;  3NH1 A;  4JHD B;  1BU6 O;  2QWM A;  1XUP O;  2X6S A;  3E01 A;  4I6M B;  1CZB A;  3QES A;  3W3D A;  1VSD A;  1XMO K;  4F2R A;  4IZ9 A;  1HNI A;  4DQI A;  4YOT A;  4MLH A;  1SL2 A;  4CEE A;  3KHY A;  4BRM A;  1U2V A;  3LM2 A;  3T7Z A;  4GKJ K;  1RDW X;  3U8X A;  4MDA A;  3OHR A;  3AVB A;  1I3A A;  4C8M A;  4WQ4 A;  1XC3 A;  3AVJ A;  4ILH A;  4GV6 A;  2GV9 A;  5HRO A;  4PKG A;  1BQM A;  1UAX A;  2HHW A;  4DTP A;  4DFJ A;  4E1J A;  2HNY A;  1LV5 A;  3CYM A;  3HL8 A;  5AQV A;  3GG4 A;  4YDU C;  1T3V A;  4A62 A;  3P38 A;  5SWM A;  3TAB A;  2AA4 A;  2NNW A;  3EE9 A;  3VPZ A;  4DLE A;  3JS6 A;  2P9P B;  3VQ5 A;  4DSK A;  1WB9 A;  4BDP A;  4Z0U A;  2YKN A;  5C25 A;  3S3M A;  3TPQ A;  4OX9 K;  5HOO A;  4LF9 K;  2JWL A;  3ZT1 A;  1VK0 A;  3QIN A;  1C0M A;  4XH1 A;  5BR9 A;  4N5S A;  2FSK A;  5AQP A;  3AVI A;  3OJS A;  3ZEU B;  3PLA A;  3HPO A;  3CPW M;  5C24 A;  1X1P A;  1VQ4 N;  4OGC A;  2D0P A;  4AHV A;  4O0J A;  2I7N A;  3D7E O;  3VQ8 A;  4KKO A;  4FCY A;  1TKD A;  4BRF A;  3O5B A;  1EQY A;  3V9W A;  4JI1 K;  3DXM B;  4A5B A;  4EP5 A;  1NKB A;  1N6Q A;  5CYQ A;  3GBT A;  4FWL A;  2Q97 A;  4E7K A;  4EFH A;  2VGM A;  1C0T A;  3CM5 A;  2HBM A;  4Q0B A;  2ZD1 A;  3OYA A;  5I9E B;  4CD1 A;  3TR8 A;  1CXU A;  2OA8 A;  4EZ6 A;  1V4S A;  5KGX A;  1E4G T;  4CF2 A;  1RDA A;  2G8U A;  3PV8 A;  3L2R A;  1RDU A;  4DSI A;  2KTQ A;  2UUC K;  1Q9X A;  3KLH A;  2GEL A;  4KTQ A;  5LJV A;  1K9M O;  3HZ6 A;  4FJ7 A;  4EHT A;  3HVT A;  3KKR A;  4WE1 A;  4B9S A;  1IKY A;  5J2Q A;  4KPY A;  3AVC A;  3IMX A;  4FW1 A;  3TSP A;  4B9M A;  3G6E N;  4YFU A;  2E6M A;  3PSF A;  4ISE A;  4CW7 B;  4E0D A;  3L2U A;  1KXP A;  3GDQ A;  2OAN A;  2QWL A;  4DR5 K;  1RFQ A;  1IJJ A;  3OYM A;  3TU5 A;  5IT9 O;  4CZF A;  5AQS A;  2D0C A;  1NJW A;  3ITH A;  1Q82 O;  4QOZ B;  4CGI A;  3SAG A;  1VRU A;  1KSP A;  2BAN A;  4FOI A;  4PY5 A;  5C15 A;  4OVL A;  5C42 A;  1IKW A;  3CC2 N;  3IG1 A;  4DR6 K;  1YJW N;  4CZM A;  3M8Q A;  1S6P A;  2YX6 A;  3CCE N;  4CJT A;  4QCL A;  3SMP A;  4PWD A;  2G8K A;  4F3T A;  1IG8 A;  3RMC A;  2P9K B;  4BRC A;  1NK0 A;  3F73 A;  4LFB K;  2OPP A;  3NMU A;  2E2N A;  4GW6 A;  4U7B A;  3SNN A;  2HMI A;  2GUI A;  2CH5 A;  1KRP A;  5KPZ A;  2HHQ A;  3WXJ A;  4E3S A;  2H3G X;  3S9H A;  4X62 K;  1RT1 A;  4NLB A;  4WQ5 A;  4AHS A;  1C1B A;  1XQS C;  1B92 A;  3R3L A;  3TSU A;  4KHY A;  4H5T A;  1KCF A;  4C8N A;  4O55 A;  2P9I B;  4WFB L;  1DGK N;  2HOE A;  1RCH A;  1RBR A;  5FRN A;  4BRA A;  3UKU A;  4FL9 A;  4B1X B;  1LCU A;  4DV2 K;  1NGA A;  3AO3 A;  3O8M A;  2YNF A;  3VF2 A;  4CFD A;  3ZT2 A;  3L3V A;  5F0X A;  4N56 A;  4FJJ A;  3NHG A;  2UUB K;  4H5V A;  3DLL L;  4GVE A;  1N34 K;  4H0O A;  4DU1 A;  5AQM A;  4DS4 A;  1VQO N;  4CJW A;  5JVH L;  3O9R A;  4NXM K;  2PAV A;  3AGR A;  4KH4 A;  4FJL A;  3O9U A;  3VES A;  3THY B;  4B9T A;  1TUY A;  1W2B M;  2O8B B;  4JK7 A;  3BY5 A;  4C8O A;  4KHP K;  3VF4 A;  3LDQ A;  5FPE A;  5DM7 L;  5EY4 A;  4B3S K;  4DUY K;  2EHG A;  3PX6 A;  4FXD A;  3HPG A;  3I0S A;  1T44 A;  4YOX A;  4OGE A;  1ESV A;  3VTH A;  1VSJ A;  4F3O A;  3AGK A;  3ULE A;  5ADX H;  2HW3 A;  4IFY A;  2WON A;  4FLZ A;  4KTW A;  2O8F B;  5KGW A;  3WXI A;  4XH5 A;  2HB5 A;  3M5R A;  4OPK A;  4ISF A;  1LW2 A;  2ZGY A;  4KAZ A;  2Q3S A;  3PIP L;  3KK2 A;  3TAG A;  1C0G A;  4WQ4 C;  1TKZ A;  1S1T A;  1JLE A;  3ZSY A;  3W0L A;  1O13 A;  4AQY K;  3DLB A;  4Y0W A;  3O1W A;  3BEX A;  1GLF O;  4CZG A;  4E89 A;  4WFA L;  3JSM A;  2Z1H A;  1YIJ N;  4GNI A;  4DWI A;  3P5J A;  3EN9 A;  3LAM A;  3EL2 A;  3CFR A;  4BVP A;  4KV8 A;  2DFF A;  1S9G A;  4V19 S;  4HCC A;  1NGE A;  3D2F A;  2P9S A;  1NGI A;  4CGG A;  3SPY A;  2E6L A;  4M3U A;  1VSI A;  5CY4 A;  5KRS A;  2W41 A;  3CCJ N;  1NGB A;  1KVC A;  4NCG A;  1QHA A;  1YIT N;  1GLL O;  3SAH A;  1NOZ A;  3DMJ A;  1IBL K;  1WSJ A;  4B1Y B;  3L2V A;  3VN5 A;  1N36 K;  4Z4G A;  2G8I A;  4ILG B;  4X64 K;  5AR0 A;  4G1Q A;  4JKH A;  3R8E A;  3MEC A;  2GTD A;  1VSE A;  1U4B A;  3HVR A;  4GMJ B;  1ZBI A;  2CGJ A;  2QI2 A;  1IG9 A;  4A57 A;  2YHW A;  2QKK A;  2CH6 A;  4IG3 A;  1RTJ A;  2HHX A;  5BR8 K;  2IVP A;  4PL8 A;  4BRP A;  5BRE A;  3A5N C;  3NH0 A;  3ZT0 A;  4KB0 A;  1BGX T;  1JLA A;  3TI0 A;  2ETJ A;  4KI6 A;  2HF4 A;  2ZE2 A;  2YHY A;  3I8D A;  3TWH A;  4RW4 A;  2NRH A;  4E19 A;  4CEZ A;  5E41 A;  4JKF A;  4CZL A;  3ZT4 A;  3H1V X;  4O44 A;  4CJK A;  3O3G A;  3E9L A;  1TL3 A;  4YOU A;  3LZJ A;  4AIL C;  3QFU A;  4RTF D;  4J2A A;  1J53 A;  4MO5 A;  3QEW A;  4I6M A;  1JCG A;  1UA1 A;  5AQG A;  3AVM A;  4J8F A;  1NK4 A;  4RW7 A;  2E5L K;  1VRT A;  3T1H K;  1RGI A;  3LM9 A;  4CK2 A;  1BI4 A;  1LWC A;  2OTJ N;  2OPR A;  1YXQ A;  1ZBL A;  3DLE A;  4CJ7 A;  4CHN A;  3VMF B;  1B9F A;  3MXJ A;  3WNF A;  1VQP N;  3R9P A;  1W0H A;  1JJ2 M;  4DR3 K;  1UWB A;  4WYB A;  3K58 A;  3M6G A;  3RSE A;  3OYN A;  4FJ8 A;  3QEP A;  4KB1 A;  4DTR A;  5AQF A;  2RKI A;  1U45 A;  3RRH A;  5AFU A;  2VG7 A;  3CQX A;  4E1M A;  1SAZ A;  3BF3 A;  1QSL A;  4DV1 K;  2PBD A;  1EP4 A;  5AQI A;  4H03 B;  3F2K A;  3UKR B;  4A59 A;  2YHB A;  3MN5 A;  3WNH A;  2VGN A;  2DTU A;  4MLE A;  4DTM A;  3NBP A;  2YI1 A;  4C8K A;  3AA5 X;  4JN4 A;  3MN6 A;  3VGL A;  4LFA K;  1NLV A;  1WBB A;  1FXX A;  1B9D A;  2VG5 A;  2Y1J A;  1KAY A;  3DRP A;  3SV3 A;  2BE2 A;  1DT9 A;  3QFP A;  3THW B;  1TGO A;  3ZEU A;  5K14 A;  1Z26 A;  3K5O A;  4Y1C A;  4C8L A;  1C6V A;  1IV0 A;  3J8A A;  5MLC Q;  3DRS A;  3AO1 A;  3TTF A;  4BC4 A;  4GKK K;  1MWM A;  3D0P A;  4BRD A;  1N32 K;  4H4O A;  4BE1 A;  1NJZ A;  3AVN A;  3I8B A;  3CG7 A;  1OH5 A;  1SKR A;  5I3U A;  2PYJ A;  5LL6 Z;  2WC9 A;  1ASU A;  3IRX A;  1KAZ A;  5GAE P;  4W5Q A;  2G8H A;  3AVL A;  3LDN A;  2A41 A;  2VG6 A;  3R1X A;  1HNV A;  1BA0 A;  3KLI A;  4K43 A;  3THV A;  5EX5 A;  4FWO A;  3SBG A;  5KRT A;  3LPU A;  5M1O A;  4PA1 A;  4BRK A;  4BRH A;  4CBX A;  3RMD A;  5C2D A;  2PY5 A;  2B4J A;  4Z4C A;  4CFA A;  3K59 A;  3LL3 A;  3NF6 A;  1QE1 A;  1U48 A;  5M1N A;  1IKV A;  4RW8 A;  3DLG A;  4WCE L;  4DTX A;  4H0V B;  1NK7 A;  3SUP A;  3VEN A;  3K2P A;  2A42 A;  2A3Z A;  2J4R A;  4BRE A;  4KH6 A;  1ZBS A;  2X6N A;  4CK1 A;  1SKW A;  5AQN A;  3U3G A;  3V1R A;  4CFC A;  3V81 A;  3SCX A;  3K5L A;  1UA0 A;  2Z1J A;  3RTV A;  4IO9 L;  4DR1 K;  5M1K A;  2XO7 A;  3RWU A;  1A5W A;  4B1Z A;  3CCV N;  2O8D B;  3RMA A;  4CGD A;  5AZI B;  4JKG B;  4M41 A;  1C1C A;  3KLG A;  1YJ9 N;  3MK6 A;  4M3Z A;  1TUU A;  4ILJ A;  1IKX A;  2NRZ A;  4FWP A;  3ZX0 A;  5C10 A;  3BDP A;  1D8Y A;  4EZ9 A;  1HKB A;  1A5X A;  3C6T A;  4JK8 A;  4MDB A;  4OPJ A;  3QLH A;  4DCH A;  3VEZ A;  3PSI A;  2B6A A;  3VEO A;  4AHR A;  2WBN A;  3OYB A;  3SQ1 A;  4JNE A;  4BG8 A;  4O8U A;  1Y64 A;  1YF5 L;  3F5T A;  2F9T A;  3BUZ B;  2P9L B;  4M63 C;  3FZM A;  3G71 N;  4JLH A;  1LOT B;  1Z25 A;  3P4I A;  5AQL A;  3CCM N;  2O4G A;  4CFB A;  3LAN A;  4XH4 A;  3M1F A;  3SZ2 A;  1GOA A;  2P9I A;  3VET A;  1Y97 A;  4K25 A;  3DI6 A;  4HTL A;  4HHT A;  4CJQ A;  3L8B A;  2E4L A;  3O4N A;  5LY3 A;  4B3M K;  3SUN A;  3CD6 N;  4JV5 K;  4HTU A;  3O9S A;  5DK5 A;  3U3Y A;  3NF8 A;  4CI6 A;  1K73 O;  1J54 A;  4JI7 K;  5BRD A;  1K8K B;  3TTC A;  4CER A;  3K5M A;  4QS8 A;  3CHW A;  2GWJ A;  3J81 O;  3LDO A;  2KZZ A;  4DV7 K;  5AQZ A;  3DJC A;  1WNS A;  4CD3 A;  4KHN A;  3NGY A;  5JS1 A;  1HUX A;  3I56 N;  4NCA A;  3NFA A;  3FZF A;  3KWI A;  2P5G A;  1EXQ A;  4YOR A;  4LF4 K;  3LDP A;  3U4L A;  3HK2 A;  3THY A;  2P5O A;  3KTQ A;  1I94 K;  1GOC A;  5GAD P;  4I7F A;  5FLX O;  5J2M A;  4OLA A;  1MWK A;  5M1P A;  2Q0R A;  1M1K O;  3ZSQ A;  3WNG A;  3QIP A;  3HOT A;  2BGG A;  4W5T A;  3ALY A;  1WOQ A;  1C0F A;  3HST B;  2GBZ A;  5B8H A;  1VQN N;  3CXC M;  3QET A;  4M3T A;  3KWG A;  2BUP A;  5AQR A;  2OZM A;  3T1Y K;  3BZC A;  3M8S A;  5E84 A;  3WXK A;  5FPM A;  4CEC A;  1YUW A;  2KFZ A;  4JI2 K;  4CZK A;  4Z4F A;  4CZJ A;  1KLM A;  1X3N A;  2B5J A;  4CEO A;  3ZLJ A;  4CJL A;  2XY5 A;  5GAH P;  4BE0 A;  4KHS A;  3SLC A;  4ID1 A;  1H1V A;  1SUQ A;  3OY9 A;  1X9S A;  3OS1 A;  2D4W A;  4B3O A;  2VCP A;  3THX B;  2NRR A;  1BIU A;  3EYZ A;  3CFP A;  2A1S A;  5AFU H;  3DXK B;  3ZSR A;  2KFN A;  1WAJ A;  2ZJR L;  1Q9Y A;  4DMN A;  2ZM6 K;  3VQB A;  3V9X A;  4DV6 K;  1G15 A;  1NK9 A;  3V9Z A;  3OA9 A;  1RT7 A;  3C7N B;  4FLX A;  4ZTF A;  4B9Q A;  3FLC O;  5A2Q O;  2WTU A;  3LDS A;  3SI6 A;  2P1J A;  4CGF A;  3KD1 E;  2P9N B;  4IOA L;  4PHT X;  4C1N K;  1QZ6 A;  5JMV A;  1XMQ K;  4FK2 A;  1TYQ B;  3O3F A;  2D5R A;  4AM7 A;  4JS4 A;  3RMB A;  3AAR A;  1TAU A;  3C94 A;  4B1V A;  4CJS A;  1YHQ N;  3LP2 A;  2WOM A;  1F21 A;  4ELU A;  3P1G A;  1DTT A;  1GLE G;  5AQW A;  1D4X A;  3A5L C;  4RWT A;  4AM6 A;  1TK5 A;  1U6Z A;  1V4T A;  3IFR A;  3QBX A;  3AVG A;  4FVM A;  3LDL A;  3CQY A;  4JI5 K;  3TAF A;  3O4Q A;  2HND A;  4O5F A;  3VQQ A;  4DQR A;  3AO4 A;  3HPH A;  2I5J A;  1T7P A;  2Q36 A;  4BVO A;  4CED A;  2QWN A;  1WUA A;  2O8C B;  3DOL A;  2QWO A;  3NVM A;  1Q86 O;  3V9S A;  2UUA K;  1Q18 A;  4B1W B;  4LH4 A;  4CEQ A;  4JKC A;  1JKH A;  1W9H A;  1E4F T;  3ZT3 A;  2Q31 A;  4F8R A;  1KVA A;  4CGJ A;  4FW2 A;  3CJC A;  1RTD A;  3IKM A;  1NJX A;  2NRX A;  5M1Q A;  4O0I A;  1WSH A;  3ATU A;  3DLH A;  3OYJ A;  3EZW A;  3FFK B;  3CPE A;  3UKR A;  4M3W A;  3MXI A;  3M8R A;  3MWT A;  5HRR A;  1TL1 A;  2V7Z A;  4W5N A;  3OYG A;  3F9K A;  3KKS A;  1JL1 A;  1QSY A;  1HYS A;  4FZZ A;  1TV6 A;  4RCH A;  4FWQ A;  1WN7 A;  2YHA A;  2IOC A;  1VSL A;  1FKP A;  1Z6R A;  2YJE A;  4YOV A;  5LMN K;  1N33 K;  1HLU A;  1Q7Y O;  4LD0 A;  1SKS A;  2D0A A;  4AHT A;  2ITG A;  4BR5 A;  3D6R A;  3H45 C;  3KK3 A;  2G8W A;  2UU9 K;  4JKD A;  2OCE A;  4DTU A;  3V1O A;  2HF3 A;  5ELZ A;  3E9P A;  3L4Q A;  2E88 A;  4B1U B;  2FBV A;  3BGR A;  2KQ2 A;  4DB3 A;  4A2B A;  1HPZ A;  2ASO A;  3CCS N;  4DR7 K;  4HUE A;  1VAZ A;  3D2E B;  4Z4H A;  1KD1 O;  2HVI A;  1S1V A;  1KLN A;  4JD2 A;  5BPN A;  3QIC A;  1LW0 A;  1QZ5 A;  3CER A;  5AQT A;  3QO9 A;  2E20 A;  3QB0 A;  3E66 A;  5GIO A;  3CM6 A;  1FW6 A;  1RBT A;  4NLC A;  3ISN C;  4JI8 K;  3LWL A;  2OZS A;  4IKF A;  3FZH A;  1D9F A;  5D3G A;  3WNE A;  1GLC G;  5LMU K;  4A61 A;  2GUP A;  3MCP A;  3OYC A;  3LWM A;  3LPT A;  4NO7 A;  4KBO A;  3ID8 A;  5C12 A;  3Q7B A;  2HBJ A;  3IDH A;  4EIA A;  4EP4 A;  5AZI A;  3OYI A;  4JKG A;  4M45 A;  1HNX K;  3MXM A;  4OLB A;  3QML A;  1WSF A;  3FFI A;  4RG8 A;  2UXC K;  4OPH A;  2RN2 A;  2PFU A;  2NZT A;  4DSF A;  4JAX A;  4JS5 A;  3RR7 A;  4XIU A;  1EWQ A;  2E1Z A;  1KFS A;  2KW4 A;  1K6Y A;  2YNI A;  3KK1 A;  1NG9 A;  4CZE A;  1ZBH A;  3U6F A;  1JL2 A;  5FPN A;  1D5A A;  5JIC A;  3V6D A;  3CJ1 A;  3FGU A;  1VSH A;  1EO1 A;  1NGD A;  4KHW A;  1X3M A;  1YJN N;  3S3O A;  2D0O A;  2QXF A;  3O9Q A;  3OYL A;  2NRT A;  4UY8 O;  4IWV A;  2HHU A;  5GIN A;  3SUQ A;  4DTO A;  3C95 A;  1JXB A;  3AA2 A;  2P9U A;  3ASM A;  5AQK A;  3TAR A;  1OH8 A;  1HJR A;  3VQ7 A;  2ATQ A;  1IBM K;  3A5M C;  3B6P A;  4FO0 A;  2F8S A;  3HTV A;  3QEX A;  3FZL A;  3ZYY X;  1HX1 A;  3SMS A;  1FK9 A;  1T6C A;  5EOY A;  1RBS A;  3CJ9 A;  4JHD A;  5CZ2 A;  1J5E K;  2E2P A;  3QDK A;  2YHX A;  4BWM A;  4Z94 A;  2FBY A;  4BDY A;  1FKO A;  4CEB A;  3HM9 A;  4JYA K;  2HNZ A;  3OYH A;  1GLA G;  2QM1 A;  2QWQ A;  3C6U A;  4CGH A;  3V4I A;  4DU4 A;  1S6Q A;  4DHY A;  4KTZ A;  2QXL A;  2XY7 A;  4X65 K;  4CHZ A;  1ILY A;  3VEY A;  4CJR A;  4FZY A;  3SAF A;  3P83 D;  4HUF A;  4B9L A;  4GV3 A;  4C23 A;  3IUC A;  2RE2 A;  5IWA K;  2W6L A;  3ULD A;  2ZF5 O;  3U9D A;  3EZ5 A;  1CXQ A;  1NJY A;  1NK8 A;  3NVK A;  1JCE A;  3OVN A;  1C1A A;  2Q2R A;  1KVB A;  2QKB A;  1MU2 A;  4FJK A;  1XNQ K;  3L4I A;  2A40 A;  1D9D A;  3AAQ A;  2P9P A;  2ZJQ L;  2PYL A;  1XHZ A;  4NYF A;  4IDH A;  3OBW A;  3QNO A;  1ZXO A;  2HHT A;  5J2N A;  4XEI A;  5GIP A;  4DQP A;  4AH9 A;  4M3R A;  4FK0 A;  3DLR A;  3S3N A;  1QS4 A;  2ZJP L;  4BR0 A;  2ZGZ A;  3AVA A;  2A1R A;  4JRP A;  4DLG A;  4FLU A;  3VQE A;  5HL7 L;  2OPS A;  3THX A;  4IOX A;  3MX2 A;  1VQ9 N;  1RT5 A;  4DV3 K;  4BRO A;  3AA3 A;  1SL0 A;  1BHL A;  3C65 A;  3DXK A;  4CJU A;  4DV5 K;  4TSX A;  4LY7 A;  4GVM A;  4BDZ A;  5TKY A;  4E7I A;  3FE1 A;  5BRH A;  2GEM A;  4DQ8 A;  3DXM A;  1XHX A;  3U9Z A;  1LWF A;  3CJB A;  4LSL A;  1L3U A;  3C7N A;  3A8Y A;  1RT4 A;  5FPD A;  4QAG A;  3ZSV A;  4BR2 A;  1HYZ A;  1NKE A;  3D45 A;  4H8K A;  2VWJ A;  4BE2 A;  4O4G A;  3UKU B;  2ASM A;  1QQN A;  1MA9 B;  2E1Y A;  1YT3 A;  5FRM A;  3PX4 A;  1ASV A;  4KO0 A;  1CLQ A;  2WFB A;  4FLY A;  1XWL A;  3ENH A;  3LP1 A;  1IH7 A;  3SBT A;  4JKB A;  2YV0 X;  2E2Q A;  2QK9 A;  4FWS A;  4DFM A;  2EWS A;  4IEE A;  1JLF A;  1U49 A;  3E1Y A;  1Q81 O;  1ATR A;  2VWB A;  4CJ3 A;  3JAM O;  3MDQ A;  3EEQ A;  3HRG A;  4JK9 A;  3VQC A;  3TSQ A;  1O1W A;  1N5Y A;  4IO8 A;  3DAW A;  3NF9 A;  5FRO A;  2CGK A;  3NDK A;  4CHO A;  3WT0 A;  2FF6 A;  3N4P A;  3G4S N;  4M7Y A;  3K9K A;  1BIZ A;  4CJP A;  2OPQ A;  1GLB G;  1RTH A;  3ZET B;  4CIF A;  3PIO L;  3HBT A;  5HRS A;  3QEI A;  4DSE A;  2QWP A;  4Z4E A;  4DFP A;  2VQF K;  3ULE B;  2O8C A;  1VQM N;  3DWL A;  2FBX A;  2BH1 A;  2YNH A;  4CJV A;  1Z05 A;  2A6A A;  4BR4 A;  5KPR A;  4HUG A;  3WXM B;  3PY8 A;  1QQO A;  4AF1 A;  2FC0 A;  3T3F A;  2HHS A;  1TAQ A;  3IAY A;  2DY4 A;  3ENB A;  3AAP A;  2V52 B;  4BQZ A;  2Z1I A;  2YCH A;  3VOV A;  3OYF A;  2P9K A;  2ZQB A;  1RNH A;  3EY1 A;  4K41 A;  4DU3 A;  3D2F B;  1C0U A;  1J6Z A;  2P9S B;  1OKJ A;  5AQH A;  4FYD A;  1BO5 O;  1P8Z A;  4IG0 A;  3H1Q A;  2LSN A;  4FJG A;  4DR2 K;  3H3O B;  3AVH A;  3MEE A;  2O8E B;  3BF1 A;  2AP1 A;  1T8E A;  4H5R A;  3VQ9 A;  4JKE A;  5EU7 A;  4YY3 K;  5DMR A;  3V1Q A;  4H4M A;  3ZX2 A;  3CCL N;  4GY2 B;  4CES A;  1BOT O;  5HRN A;  3SUO A;  4L3Q A;  5J1E A;  2XY6 A;  1WSE A;  2E8A A;  1K8A O;  3WEE B;  4DSJ A;  2P51 A;  4BC5 A;  3ZSX A;  4BGB A;  1RBV A;  1LWE A;  1KFD A;  1RIL A;  1RTI A;  1CZA N;  4IFV A;  1HRH A;  5BN8 A;  3UIQ A;  3G10 A;  1SL1 A;  2QW9 A;  2FSJ A;  1SQK A;  4ICL A;  5BPL A;  3HO1 A;  2F96 A;  3EO3 A;  3VGK A;  2GWK A;  4QS9 A;  4LF7 K;  3ATV A;  4NYN A;  2E2O A;  2O8B A;  3L0Q A;  4ID5 A;  2KKZ A;  4YOY A;  3MAQ A;  1XI1 A;  4JI6 K;  1EKE A;  3MWP A;  3P31 A;  4LH5 A;  4FJN A;  1VSK A;  4M7X A;  1S72 N;  4RW9 A;  3O9T A;  4FLW A;  1ASW A;  3CJA A;  1VQ6 N;  3I33 A;  4CIE A;  5HBM A;  4BR9 A;  1VQK N;  3CME N;  1YTU A;  4YOW A;  4IJA A;  1BI4 B;  1VQ7 N;  2F7T A;  3A0I X;  4FJH A;  4CBU A;  5I42 A;  5CR4 A;  1HMV A;  2O8F A;  3LAK A;  3ENO A;  5KI6 A;  3CCQ N;  1YI2 N;  5AQQ A;  1MDU B;  5JVG L;  3RSE B;  4FPA A;  1OVY A;  1ZBU A;  4F4K A;  1SV5 A;  4DV0 K;  4I9Q A;  4PUO A;  1ITG A;  1WSI A;  3QBW A;  3NGZ A;  5AQO A;  1BDG A;  2F8T A;  3M8P A;  1S1W A;  1ATS A;  1HQU A;  4KHU A;  3VEW A;  3TAN A;  4JI3 K;  5J2P A;  1HYV A;  1SS6 A;  4FJI A;  3LZI A;  3HXM A;  4FM1 A;  4HWI A;  1NGJ A;  3PX0 A;  1HQE A;  3OYK A;  3SQ4 A;  1T03 A;  1JXE A;  2PZS A;  4FOE A;  1EWR A;  1OVQ A;  1BUP A;  4IOC L;  3NH2 A;  4BC3 A;  4DTN A;  4LSN A;  4EAH D;  3HI0 A;  3AY9 A;  5CZ1 A;  1S1U A;  5BRF A;  4H5W A;  4BRG A;  2ZWH A;  2V7Y A;  3OS0 A;  4CE9 A;  4Y1D A;  1HR0 K;  2FLO A;  2VWK A;  4MO4 A;  2VYP A;  1SZ2 A;  3NCI A;  5M1F A;  4CF9 A;  4U67 L;  3J7Z O;  1NK6 A;  2OTL N;  4CZI A;  4J2D A;  1RDD A;  3L2Q A;  4DFK A;  1RT3 A;  2W6K A;  3AV9 A;  2EX3 A;  2RF2 A;  3B8A X;  4AHC A;  2F9W A;  3N4Q A;  3SQ2 A;  1W97 L;  2JGU A;  1JLQ A;  3SJH A;  3T69 A;  1VQ8 N;  1WBD A;  2UXD K;  4DV4 K;  4UQG A;  3CMA N;  1QSS A;  4CHQ A;  3HOS A;  3O4W A;  3JYT A;  3O6W A;  3VQP A;  4M42 A;  5H1S Q;  3HT3 A;  3PO5 A;  3R6M A;  1YVN A;  5AQU A;  4BY9 C;  2IVN A;  1U47 A;  4B9V A;  3J80 O;  4BAC A;  3OYD A;  1IO2 A;  1T6D A;  4CIG A;  1NGG A;  4CHY A;  1NJI O;  3OJU A;  1QQC A;  4FSV A;  4QS7 A;  3VQ6 A;  2DFE A;  1L3T A;  2HHV A;  5F1X A; 
#chains in the Genus database with same CATH homology
 4NXM K;  5AJ3 K;  5LMN K;  4B3M K;  4JI0 K;  1N33 K;  4JV5 K;  4GKJ K;  5A2Q O;  4JI3 K;  4JI7 K;  4LFC K;  4DV3 K;  2UU9 K;  4DR2 K;  4KHP K;  4X66 K;  3J7A P;  4B3S K;  4DV5 K;  3J81 O;  4DUY K;  4DV7 K;  1XMQ K;  2E5L K;  4YY3 K;  4CW7 B;  4CVN E;  4B3T K;  3T1H K;  1IBM K;  4DR5 K;  4LF4 K;  4B3R K;  4DR7 K;  5IT9 O;  1I94 K;  4JI4 K;  4YHH K;  5FLX O;  2HHH K;  4DR3 K;  4NXN K;  4AQY K;  1J5E K;  1HR0 K;  4K0K K;  2UXB K;  4LF8 K;  4DR6 K;  4OX9 K;  4DR1 K;  4JI5 K;  4JYA K;  4LF9 K;  4JI8 K;  4LF7 K;  4V19 S;  3T1Y K;  4LFB K;  4DV1 K;  5LMU K;  3JAM O;  4X65 K;  1IBK K;  4JI2 K;  4JI6 K;  4X62 K;  2UUA K;  1XNR K;  2VQE K;  1IBL K;  4LFA K;  5IWA K;  3OTO K;  4LF6 K;  4JI1 K;  2UXD K;  2F4V K;  4DV4 K;  1N36 K;  3J7Y P;  1HNX K;  4X64 K;  1XNQ K;  1HNZ K;  2VQF K;  2UXC K;  1HNW K;  1FJG K;  4LF5 K;  4DV2 K;  4DUZ K;  4GKK K;  3J80 O;  5BR8 K;  1N32 K;  2UUB K;  4DV0 K;  1XMO K;  2ZM6 K;  4DV6 K;  1N34 K;  5LL6 Z;  2UUC K;  4DR4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...