2UXCK

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 2uxcK00
2HHHK 4X64K 4DUYK 1HNXK 4DV3K 4X66K 2UUCK 5IT9O 4JI1K 4CVNE 2UUBK 1N32K 2E5LK 4NXNK 4K0KK 3T1HK 3J81O 4YHHK 4DV0K 4DV4K 1J5EK 1IBLK 4DR4K 2UXBK 2UXDK 4LF7K 4DR6K 5IWAK 1IBKK 4LF5K 2VQEK 4B3TK 4JI7K 4LFBK 4JI3K 4LFAK 2ZM6K 4LF4K 3OTOK 5BR8K 4YY3K 1HNZK 4CW7B 4B3RK 4DR5K 4NXMK 4AQYK 2UXCK 3JAMO 3J7AP 5FLXO 4GKJK 1IBMK 1N33K 5A2QO 5LMNK 4KHPK 2VQFK 4OX9K 1XMOK 4JI5K 4LFCK 4JYAK 5AJ3K 4DV1K 4X65K 4DV7K 4DV6K 4DV5K 4LF9K 4GKKK 4DR2K 4X62K 4B3MK 4LF6K 1XMQK 4JV5K 1N36K 3T1YK 2UU9K 4DR7K 4JI6K 4DR1K 1N34K 1HR0K 4DR3K 3J80O 4DV2K 4JI4K 2UUAK 1XNQK 4JI2K 1I94K 4JI0K 1FJGK 5LMUK 1XNRK 2F4VK 1HNWK 5LL6Z 4DUZK 4JI8K 4LF8K 4V19S 4B3SK 3J7YP
chains in the Genus database with same CATH superfamily
1J54A 1TK0A 3L3VA 4CF1A 3A5MC 3QNNA 2YNFA 5M1KA 3AVBA 3KLHA 4BRDA 1ATSA 2QXFA 4DU4A 4PKIA 5T7BA 1XC3A 1JLEA 4N5SA 4B9VA 4PKHA 3FZLA 5HRRA 4AHSA 2KQ2A 1TYQB 4DV0K 2ZF5O 4DR4K 4B9QA 4E89A 1S1WA 1JCEA 3SAFA 3HM8A 3F5TA 3LZIA 1W9HA 3CG7A 4FJ8A 4JKHA 3PLAA 1JLGA 4BRNA 1ZC6A 2X6NA 4Z4HA 3OTOK 5BR8K 3VEWA 4CW7B 3W3DA 5E84A 4KB1A 1S3XA 2O8EA 3QEIA 4DG1A 3E1YA 3H08A 5AFUA 2YJFA 3TAEA 1UWBA 2PAVA 3LP3A 4M3UA 1WNSA 5J2MA 4BRKA 3EO3A 2I7PA 1S72N 4JYAK 1DT9A 3AO5A 4HWIA 3VERA 1BI4A 3ZSQA 1D8YA 2XY7A 2P9NA 5LY3A 5AQRA 3HPHA 3NH0A 1IKYA 1QSSA 1SUQA 3VQ8A 4C1NI 1VQ7N 4FJGA 4LF6K 4FK0A 1RDCA 4FK2A 4F3TA 3D0PA 1V4TA 3AVGA 3S9HA 1BI4B 5AQHA 4OLBA 2PY5A 1QHAA 2FSNA 1VSDA 4DV2K 1OH6A 4CFAA 1TK8A 2YKMA 3JS6A 3E9OA 4JRQA 5HRSA 2KKZA 4RW4A 1HKBA 3CJ1A 2YKNA 1GLEG 1RBRA 3H3NO 2VG7A 3RR8A 5AQKA 1W97L 3SQ0A 5AQLA 1VSHA 3OS2A 1HPMA 1NGAA 4J2EA 4FL9A 4KFBA 2VG6A 2W40A 3PO5A 5KTQA 2RKIA 3ZX3A 1C6VA 4N76A 3NVMA 4FJ9A 4JKEA 3SI6A 3SUOA 1N5YA 4AILC 4BRLA 3FR0A 4OPKA 4O44A 3O3HA 4OKKA 2XO7A 4GW6A 3AARA 3CCUN 3U8XA 3VEZA 2AA4A 1SV5A 1M90O 3MEGA 1W7AA 3VTHA 3AA2A 1VQLN 5I42A 5KQ8A 4GVEA 4H03B 3DLLL 1Q81O 1NMNA 2E2OA 1TL3A 4KHWA 4LC9B 4KV8A 4JKGA 4ILGB 4CEFA 4M3TA 4QCLA 3QETA 3N4PA 4B3RK 3L2UA 4E1MA 4YNQA 3QEVA 3QO9A 1XQSC 2WTUA 3HYFA 4H5NA 2OPPA 2Q2RA 3C7NA 1XI1A 3KLGA 4FXDA 3AV9A 3B6OA 3CC2N 3FFKB 1M1KO 3UKUA 4CHNA 1X9JA 3JSMA 4X65K 2RF2A 3T1AA 4B1UB 3FE1A 1EQYA 4B1WB 4BROA 1L3TA 2CGJA 2IVOA 1Z05A 3B8AX 2IOCA 3C7NB 3CM6A 4DTPA 3RWUA 4B1ZA 1WBBA 3HZ6A 3SV3A 2DPNA 3MXJA 1GLLO 2FF6A 4CBWA 3AA3A 3H45C 1HYVA 5BPNA 4Y1CA 3K9JA 1SZ2A 1BISA 4IKFA 4CEQA 3ZSYA 2D0OA 2ZQBA 4DQRA 3CCSN 1NG9A 4FJHA 2F8TA 3UKRB 3WQTA 1VQ5N 5HL7L 1NMDA 4FCYA 1P90A 1RT2A 1RBVA 4B3SK 3KZBA 4B9MA 4CZIA 4DTRA 3HP9A 3OYHA 5J1EA 2GUIA 3TAPA 1DTTA 1VK0A 3OYLA 2B5JA 2P5GA 2WC9A 2HB5A 3WEEA 2VCPA 3CIPA 4K0KK 4H0OA 3UB5A 3J81O 4CEDA 3O4QA 1NK5A 3VQ7A 4FM1A 4DV4K 4AHRA 4FVUA 4C8KA 3U9ZA 3CYMA 1UA0A 3BZCA 3EEQA 4LF5K 1NM1A 3VA3A 1NKEA 3NF6A 3L4IA 4H5TA 2OZSA 1KVAA 3WEEB 3KKSA 4CZMA 3OY9A 3SNNA 3C6UA 4IO8A 4CFDA 3HOTA 3JAMO 4C8NA 3ATVA 1IG8A 4O55A 4F2SA 5FPNA 3D7EO 4CJTA 4KTQA 3O3GA 1UAXA 4E1NA 4F8RA 1DTQA 3CF5L 1QE1A 4A2BA 3K5MA 3EE9A 4IZ9A 3UE5A 1TAUA 1X3MA 4FLUA 2ITMA 4CGGA 4F2RA 3K59A 3VQBA 2XRIA 3TARA 5JLFA 3P31A 3D45A 3OW2M 3A8YA 4HTLA 2JGUA 3M1FA 4X62K 4HHTA 3ULDA 1SKSA 2E1YA 2NRXA 1GLAG 3CETA 4FWOA 3ZT3A 4O8UA 5ADXH 4B8CA 3VF4A 4BY9C 4JAXA 4JLHA 3GL1A 4CF0A 5CYMA 3CC4N 2YNGA 3G71N 1ZBFA 3OVNA 3MN9A 4C8LA 4BE1A 2GV9A 3OJSA 1ZBSA 4A57A 4DTOA 1Z26A 1R0AA 5M1QA 1XNRK 4IFEA 4B1XB 2JWLA 4DUZK 1WBDA 4DSKA 3O9QA 2YNIA 4FJLA 1WOQA 3ZETB 1WSEA 4M42A 2QKBA 4X64K 4Z4FA 1UOCA 2YHAA 1C1BA 3DXMA 2P51A 2D1KA 1NJYA 1SL0A 1U04A 4KI4A 4CEAA 4I9QA 4FWMA 1HJOA 2FBYA 1DEJA 1RBUA 2P9SA 3BP8A 1FKOA 2KTQA 3RRGA 2RPIA 4I2QA 2PBDA 3QLHA 2ETJA 2NRWA 1NJZA 2CH5A 3TTCA 3W0LA 1GOBA 3KLEA 4DU3A 1GLFO 2RN2A 3K9KA 3NGYA 3QMLA 4IDHA 1Q82O 2X74A 3L8BA 4FLTA 3LP2A 5FPDA 2P9LA 4LY7A 3TU5A 3ZT2A 3L4QA 4CJFA 4DF8A 2UXCK 2P9SB 1IKVA 1X9MA 2F9TA 1U4BA 1RBTA 4FVMA 3UIQA 3I55N 3RSEA 1YJ9N 4YOYA 1ASWA 1RCHA 3SQ2A 3QEWA 1Q7YO 2HHTA 3K5LA 1EX4A 1YJNN 2HMIA 5D3GA 1BCOA 4FWKA 1FXXA 4DV1K 1HPZA 1T7PA 5AZIA 3V1RA 1KQSM 4BWJA 4GKKK 1KSPA 1KAXA 4AHVA 4DCHA 4JHDA 4KTWA 3RSEB 4ZHRA 4J2BA 2W41A 1OH7A 5GAHP 1BOTO 5H1SQ 3RMCA 4ID5A 1KCFA 2Q31A 4RCHA 3VEOA 3G10A 5AZIB 4DFPA 1KLMA 1S6QA 1WAFA 3GG4A 3OYCA 4G9ZA 2PYLA 3SPZA 1YTUA 1QQOA 4DQSA 1YHQN 3AVFA 3DMJA 4DTSA 5SZTA 4JI8K 4LF8K 1RGIA 3CJ9A 5J2NA 4BDYA 3T3FA 2Y1JA 1SS6A 2GUPA 2YV0X 3U3GA 1BL3A 3VA0A 5JS2A 3CM5A 4OPAA 3SJHA 3QEPA 2IC3A 3MCAB 5BPLA 3IS9A 1EWQA 5JVHL 5GIPA 5GIOA 4CJLA 1Q18A 2ZD1A 1YI2N 1NGBA 3O6WA 3D2EA 2JWKA 4CERA 3VF6A 3LDSA 4CGFA 4KKOA 5C0YA 3OYAA 5KPRA 3O9UA 3PV8A 1JLQA 2EX3A 3LM9A 3I56N 5AQUA 4J2AA 1NGCA 5AQZA 2QI2A 3HP6A 3R8EA 3MAQA 4EP5A 2G8IA 3A2FA 4JNEA 1QVGM 1RNHA 1OVQA 3LP0A 5C2FA 4WFNL 3MECA 2D0CA 4LSLA 1RT5A 1S1VA 3MEDA 1WAJA 4DB3A 2QWLA 2X6SA 3ISNC 3E9PA 1YXQA 3CJBA 3WUHA 5LJWA 1T6DA 4H0TB 4LH5A 4CEEA 1K73O 2LSNA 3CQ8A 3CMEN 2I5JA 3GOIA 4RTFD 4O5FA 1VQNN 1G15A 4CHOA 2HNDA 4CJ5A 1VSMA 2ZJRL 3HPOA 2GX9A 2YHBA 4DR3K 3O5BA 2G8HA 3J80O 3FZMA 1XNQK 3VENA 1A5WA 1REVA 3EZ5A 1S1TA 2D4WA 1XHXA 1NWKA 1XC9A 2NRHA 4LH4A 4AHTA 1NGHA 4H5RA 3VQCA 3K5OA 3VOVA 2E2PA 4BE2A 1HJRA 1XWLA 3EZWA 4IJAA 3KWGA 4F9OA 3THVA 2P1JA 3VQAA 1MU2A 1CZAN 2F96A 5KI6A 3FLCO 4Q5VA 2OA8A 5AZJB 2GTDA 4GVMA 1J5OA 4HVJA 1O1WA 5FRNA 3NVKA 4JKFA 3IRXA 1VSFA 4M41A 4FWNA 4CJ4A 4JS4A 4FZXC 1P8ZA 4Z4GA 1IKXA 3BZKA 4M63C 4BRCA 2HBMA 3L2QA 4HUGA 4CECA 3QICA 5AQWA 3NBPA 3L2VA 4WF9L 3QNOA 2Z1GA 4BRFA 4E7JA 1Q9XA 5DMRA 3EY1A 3SBGA 4JKCA 3ZCMA 1NK4A 1GOAA 3ID6A 4AHCA 3TAGA 4L8RB 4DQ8A 2PZSA 4FWPA 1BUPA 1VSLA 3LDLA 3J7AP 4E7IA 3FGUA 4BRIA 5KPTA 1HNIA 1F21A 3HBTA 4AHUA 1XMOK 5HLFA 4KHNA 4KBOA 4CK1A 4CJ3A 4CEZA 3DAWA 5DM6L 3LWMA 3CERA 3RMDA 1BU6O 4ELUA 2QWNA 3LDOA 1G99A 3AGRA 4BREA 5I3UA 4RW8A 4GV9A 3ZX0A 1TUUA 4IOAL 3FZFA 5AQVA 3TANA 4WQ4A 1JXEA 4FYDA 3AGKA 5GAGP 3L2RA 1RDWX 1TVRA 3MWTA 2Z1IA 4MO4A 3AAPA 5BRHA 4MLHA 4JD2A 1JCGA 1L5UA 1YVNA 3BF1A 2F4VK 1X9SA 1HNWK 4DSLA 2O8EB 5CE3A 1VHXA 3H46O 2YHWA 3CCRN 4IXCA 3K57A 3VEXA 3MCPA 2P9NB 4DV3K 3QBXA 4PQUA 3VQEA 3AVMA 4JD2B 5IT9O 2O8DA 3AA4A 3SZ2A 2V7YA 4C23A 1HRHA 1N6QA 1KC8O 1ATRA 5HRNA 3ID8A 4H8KA 1YT3A 2EHGA 1VQMN 3VQ6A 1IBLK 3HO1A 1TKXA 3O9RA 3KVGA 1OVYA 5IWAK 3C6HA 4H0VB 4OGEA 3WT0A 4CHQA 3EYZA 4F3OA 1VAZA 4EFHA 4U67L 4FM2A 3LPUA 4K8XA 4K41A 3FZHA 3KLIA 4AM7A 1HNZK 4XEIA 1NGJA 4PHTX 4W5NA 3EE8A 2A40A 4CIEA 5M1FA 3OS0A 1UA1A 4KREA 2O8BA 3NE6A 1QQNA 4MDAA 3CQXA 4YOWA 5KRSA 4KHPK 4HTUA 1QSLA 4Z94A 3VGKA 3QEXA 5M1NA 5AJ3K 1U49A 5AQPA 5AQMA 3HL8A 3LDNA 3VPZA 4E1JA 1L3SA 3QB0A 1WSJA 4CJ7A 4AF1A 2O8BB 2NNWA 4CGJA 3K2PA 1I39A 4A2AA 2HHWA 2O4GA 1N36K 3JYTA 3KD1E 4KHQA 1ZBIA 1C0FA 3KK3A 4DHYA 1NGGA 4JKGB 1NOZA 4ILHA 4CZLA 4W5TA 1Z6RA 3HOSA 1NK9A 2G8WA 2YHYA 3WXIA 1JLAA 2GELA 2VGNA 4MDBA 1BQNA 4RG8A 1LWCA 3OYIA 1IJJA 3OHRA 2BDPA 3WXMB 3NHGA 2ZGYA 4CJPA 1DKGD 3HXMA 4M45A 3AVKA 2OCEA 1Y97A 4V19S 4DTMA 1B92A 4KH5A 1JLFA 3TSQA 3CFRA 4FJ7A 1KD1O 1QTMA 3AVLA 2Q1NA 3U4LA 3NGIA 3UKUB 2O8CA 4BRGA 3VQ9A 1GOCA 4B8AB 3LAKA 5F1XA 4IG0A 4OJRA 4BVOA 2OPRA 3D2FA 1NJWA 3SUPA 3P83D 2YI1A 1N32K 4NXNK 1B9DA 1D9DA 1EP4A 1TKTA 3LPTA 2QWRA 1W0HA 5BN9A 3BDPA 4CHYA 2UXDK 3CMAN 4QS7A 1IV0A 1EKEA 3FZKA 1IBKK 2UYTA 1VSEA 1N8RO 3CJAA 1ILYA 5FPMA 3R3LA 2ZM6K 4ELVA 4FLVA 4O8KA 3P4IA 4YY3K 3IAYA 5FPEA 1LOTB 3D2FB 4A61A 1BA1A 3C6TA 3OYFA 3S3NA 3DYAA 1X9WA 3AY9A 4U7BA 3WNHA 3WXJA 4C1NK 1B9FA 3SQ4A 4FJKA 2GBZA 4KHSA 3OYNA 3HI0A 1O13A 1IBMK 3KTQA 4CGIA 3P1GA 3V1OA 3O4NA 4CFCA 3HPGA 4H5WA 3PIPL 1S9EA 4JI5K 4CZEA 2HF3A 5E26A 4FJIA 2FSKA 4IBNA 3ASMA 2Z1HA 3M3ZA 3CCEN 1BA0A 3THXA 5E41A 3VF2A 4DSJA 2IVPA 4A59A 1BGXT 2NRTA 1K9MO 3I33A 2YJEA 1E4FT 5JS1A 1VRTA 4FJNA 3M8QA 3QIPA 1OKJA 3S41A 3C0BA 1U2VA 4E7HA 4MFBA 2YX6A 5FRMA 5M1PA 2E4LA 3R9PA 4DMNA 3THXB 3DOLA 5CYQA 4BGBA 1S9GA 4YDUA 4W5RA 1LWFA 4WQ5A 2FXUA 4FSVA 1XHZA 3HK2A 4IJNA 4Y0WA 3ZSXA 3BF3A 3QESA 1KRPA 3T69A 1C1AA 1VSIA 4CGHA 3ZX2A 4KPYA 4CD3A 1JKHA 3KLFA 1VRUA 4IG3A 5CHIA 1IH7A 3F73A 4ILJA 5CZ2A 4IO9L 4EP4A 1K8AO 3SYZA 2QXLA 1D4XA 1R59O 1J6ZA 1C0GA 4BVPA 4FLYA 3WNGA 1FW6A 3H3OB 4NYFA 2G8VA 2QWQA 4KH6A 2D5RA 1VQ4N 4BR4A 4LF7K 4CFBA 3MXIA 3CCMN 4JI7K 4O4GA 4CIFA 4AH9A 5AQFA 3THWA 4IEEA 2NRZA 3QINA 3C6AA 4WYBA 2HSTA 4M3WA 4Z0UA 3OYJA 1W2BM 2P9KA 1BG3A 2CGKA 3EN9A 3ZSOA 4GMJB 4FWRA 1S5JA 2ZJPL 1NBWA 2HBLA 4FOIA 3I0SA 4DFJA 3CCVN 5EOYA 3T19A 2X78A 2E2QA 3TSUA 3DXMB 1LWEA 3ZSVA 1ZYQA 1EO1A 2P9KB 4IOXA 4DWIA 2WONA 1C0TA 2G8UA 1K8KA 2G8FA 4O0IA 4OLAA 3NH2A 4CESA 4I2PA 3ITHA 4CZJA 2F7TA 5AQOA 2HHVA 4A62A 3CHWA 3R1XA 4CK3A 2HF4A 4DSEA 3HTVA 3DOKA 5HP1A 4M3XA 2P9LB 3DM2A 1YVUA 1TK5A 1VSJA 5AQQA 4CJKA 1K8KB 3ZSRA 3V6DA 4PY5A 3DLRA 4JRPA 1NGIA 1HLUA 4K43A 3U6FA 4BGAA 1KAYA 2ZE2A 4FPBA 1RDDA 4M3ZA 4YOTA 1T03A 1Q9YA 4HUFA 2E20A 3J7YP 4K42A 2P9IA 4CJUA 5MLCQ 3KK2A 3MMVA 4FJMA 4ELTA 1QSYA 4N41A 2OZMA 3PO4A 4BR7A 4NLCA 2KFZA 1RFQA 3MK6A 3V1QA 4YOVA 4DTNA 1RT3A 3NAEA 3T1HK 1LCUA 5AFUH 2FBVA 2NRVA 4JHDB 1T8EA 3AO1A 2Q3SA 1J5EK 3G4SN 3PUFA 3QFUA 4MO5A 1NJIO 2P9IB 4B1VA 1C0MA 4CF2A 3VEYA 4JI3K 4QS9A 3CJCA 4KH4A 1YIJN 3LDQA 3MX2A 4LF4K 4B9SA 2NUBA 4DSFA 3CC7N 2JLEA 5KRTA 1QZ5A 2IIRA 2IGIA 2P9PA 5HBMA 4FJJA 5FLXO 3WNFA 2ASOA 1JCFA 3PX6A 4CEOA 2OANA 3IUCA 1NK0A 4LFCK 1I3AA 4CBXA 1QS4A 2RHKA 3AO2A 2ASMA 1VQON 2QKKA 4DV5K 1RTJA 2P9PB 5F0XA 4LF9K 1Q86O 3AVNA 3V9ZA 1CXQA 2WOMA 4DR2K 2IVNA 4YOUA 2XY8A 4H0PA 2ZJQL 3QDKA 4ICLA 1XUPO 3ZSZA 3C65A 3OBYA 1X1PA 4TSXA 3CD6N 3SUNA 2VWKA 3DJCA 3I0RA 3D2EB 3IKMA 3M6GA 1WB9A 5GINA 4PA1A 3G6EN 4E7KA 4FWLA 3ZLJA 4IFYA 4XH4A 3A5LC 3TWHA 1SL2A 1SKRA 2OPSA 5BN8A 4WFAL 2FBTA 4NYNA 2VGMA 3RMAA 2QEXN 2EWSA 3TAMA 4CJQA 1HUXA 4B9LA 5AQSA 4A5AA 5ADXA 2ATQA 2V52B 1U6ZA 2D0BA 4OPHA 1C1CA 3OYDA 1JJ2M 1HNXK 1HQUA 4JI1K 4F4KA 5BREA 3PY8A 3AVHA 2W6KA 3IFRA 1BQMA 2QWOA 3AVCA 3K5NA 3VETA 3B6PA 2H3GX 4JEPA 4CZKA 1CLQA 4QAGA 3RVCA 1KVBA 4KO0A 3VQQA 3CI5A 4DS5A 3ZSWA 4DSIA 2Y1IA 3DLEA 4JS5A 1L3UA 1RDAA 1ZBUA 5EXWA 2AP1A 3WXKA 4KB0A 3CCJN 1LW0A 5EY4A 2HHSA 1NLVA 2PYJA 4I7FA 3S3OA 4BRAA 1WLJA 2BTFA 4BG8A 2E8AA 1N33K 4ISGA 1QHTA 5A2QO 3NF9A 2VQFK 1YITN 1CZ9A 2F8SA 2QWMA 4FO0A 3M5RA 1KTQA 1NK6A 1ESVA 4UY8O 1T44A 1YUWA 4B1YB 4NCAA 4DV6K 1S6PA 4DTXA 4BC3A 1ZXOA 4OKJA 3ENHA 4KHUA 1TYQA 1OH8A 4H5VA 3CPEA 2BANA 3HT3A 1RILA 1E3MA 4H4OA 1A5XA 1S22A 4BE0A 3CPWM 2UU9K 3O08A 2GEMA 4XH5A 3T7ZA 5BRDA 1Y64A 3GDQA 3MN6A 4DR1K 2ASPA 1MWKA 2A1SA 3HJFA 4EIAA 5J2PA 3FFIA 3LWLA 1NK7A 3I8BA 3NFAA 2O4IA 3KJVA 3LDPA 4CJSA 5LL6Z 5GADP 4WFBL 3V9SA 2R7YA 4DS4A 3HSCA 2BH1A 3RR7A 5BRFA 4B9UA 2BUPA 1RT1A 4IEIA 2D0AA 5F2RA 4A5BA 4IWVA 3U9DA 4M3YA 1BCMA 3Q7BA 5KPZA 1NOYA 1KVCA 5AQIA 4ISEA 1K6YA 1TV6A 2UUBK 3MXMA 4H0YB 2XY6A 4YFUA 4QS8A 2A3ZA 4M3RA 1VQPN 2B6AA 4PWDA 3VQPA 3K0SA 3KD5E 5I9EB 3RRHA 2UXBK 4GY2B 3GBTA 4AM6A 3DRRA 4HUEA 4M7XA 4Q0BA 4DFMA 4XIUA 4LFBK 3DLKA 4DLGA 4YOXA 4NCGA 3M8SA 4K8ZA 2W42A 4BR0A 1MWMA 2Q0UA 1EXQA 1HYZA 3M8RA 4FLZA 4RWTA 5AQYA 3EKSA 1BWFO 2FBXA 3TI0A 4FJ5A 2HVIA 3CXCM 5K14A 3BUZB 1HMVA 4GKJK 4CK2A 4DQIA 3HM9A 3AVIA 5AQTA 1T3VA 3OYGA 2QW9A 3OYKA 1LAWA 5CR4A 4BG9A 4CJEA 1LAVA 3SUQA 4BACA 3I8DA 2O8DB 2E6LA 1T6CA 3WXLA 2FF3B 3SMPA 3RMBA 5FDLA 3NGZA 2QM1A 3WQUA 3V4IA 3OYBA 5JVGL 2HBKA 3QBWA 1L3VA 3CCLN 1ASUA 1CXUA 1VQ6N 5TKWA 1NK8A 4ZTFA 2HW3A 4CD1A 2BGGA 4KI6A 4BR9A 2HOEA 4BQZA 2HHXA 3L6QA 4JI6K 1HR0K 2ZWHA 2UUAK 4BC4A 4KTZA 4DKWA 3WNEA 3HVRA 3MEEA 1BDGA 5C24A 4CE9A 4ZTJA 1GLJO 3E66A 5LMUK 3E01A 4CI6A 2DTUA 1E4GT 3RTVA 1HNVA 4EHUA 5J2QA 3VMFB 2NRRA 3TTFA 2Q36A 2HHHK 4R5PA 3MWPA 3AO4A 1S1XA 4JK9A 1BHLA 2NZTA 4L3QA 4DFKA 4FK4A 2KHOA 1ZBHA 4PL7A 3OJUA 1GLBG 4K25A 3NMUA 3KK1A 1RT6A 3L3UA 1DLOA 3QIOA 3O9TA 1YAGA 3L0QA 5JLHA 4FZYA 4Z4EA 3ZEUA 3AA5X 1NGDA 3MX5A 3AVAA 3N4QA 2Q97A 3KIOA 2VQEK 3VN5A 3OBWA 3THYA 3EKUA 3SMSA 4E19A 3IDHA 4DF4A 3VQ4A 2I7NA 4NB4A 3E9LA 4DR5K 4NXMK 2A1RA 4OVLA 5AQJA 1QQMA 3UKRA 1RTDA 2YHXA 2WUSA 1SL1A 4PKGA 3ZEUB 3DLGA 4O5BA 3CJ7A 4FLWA 4OX9K 1H1VA 4BC5A 3THYB 3AVJA 1WSIA 3KWIA 3HVTA 4BWMA 3K58A 1SAZA 2CH6A 2O8CB 5C42A 1TKDA 2ITGA 4OPJA 3SK3A 3SAHA 4JKAA 1HKGA 4B3OA 4BR2A 5AQXA 2WBNA 1KAZA 2HVHA 1U47A 1HKCA 3BY5A 2E6MA 4JK8A 4CZGA 3T1YK 3LP1A 2QWPA 4ISFA 4GV6A 3CFPA 3O1BA 5AR0A 1Q8IA 4BRPA 5BR9A 4CHPA 4DR7K 5HOOA 1N34K 1WSGA 4WQ4C 4Z4IA 4FWQA 3HSTB 1ATNA 4JI4K 4BDZA 4FM0A 4BRHA 4DQQA 4CJRA 4CHZA 1FJGK 3ENOA 1NGEA 3SQ1A 1NNEA 3ZYYX 2HBJA 4KHYA 3TABA 3AAQA 3U3YA 2HNZA 5KGXA 4MLEA 3G25A 3PX4A 5JMVA 4CBUA 3SV4A 5SWMA 4DUYK 2XY5A 4IDKA 2E2NA 2J4RA 2AJQA 2VWBA 1JXBA 3DRPA 4J8FA 1ZBLA 4YORA 1RDBA 2E1ZA 4M7YA 2QK9A 4RW6A 3NCIA 3VGLA 2KW4A 4YHHK 3LZJA 3V9UA 1A5VA 4XH1A 2V51B 1WN7A 3O4WA 3NH1A 4B9NA 1WSFA 2KZZA 1NGFA 1KLNA 1QVFM 1YTAA 4JKDA 1U2VB 2V7ZA 4B9TA 1RTIA 1WSHA 3SJJA 1LW2A 4NCBA 1NKBA 1LV5A 5EU7A 1HYSA 3LM2A 1HQEA 1TGOA 3SLCA 4AQYK 4LSNA 4W5OA 3DXKA 5HROA 3J8AA 3GE1A 4NO7A 3OYEA 2YNHA 2P5OA 3VEVA 4LD0A 2HMPA 3ZETA 5LJVA 1JLBA 1C0UA 1GLDG 2IS3A 3KK7A 4CF9A 3TTDA 3CFOA 4FOEA 3TR8A 1JL2A 5DK5A 4I9LA 3MDQA 4EHTA 2O8FA 1D5AA 3H1VX 4Z4CA 2QA4N 5CY4A 2QTDA 1QZ6A 2W6LA 3DXKB 4B3MK 1BIZA 4OGCA 3F2KA 4JK7A 3DLBA 4CGDA 4JV5K 3P5JA 3AO3A 2HHQA 5C12A 4UQGA 3THWB 3TAQA 3OS1A 4EZ9A 2O8FB 1TAQA 3EL2A 4E0DA 2KFNA 4JI2K 1I94K 2KLAA 4JI0K 1WUAA 3BGRA 5C10A 1DGKN 1YF5L 4IFVA 1NKCA 3MN5A 3DWLA 2FSJA 3VQDA 5BPMA 3IG1A 4CZHA 3TPQA 5C25A 1ASVA 1NJXA 4DU1A 4N56A 1RTHA 1T05A 1EWRA 4BDPA 2Z1JA 5TKYA 3P39A 2XHBA 2PFUA 1FKPA 3V81A 3C94A 3KHYA 2GWKA 2DFFA 2E5LK 3V9XA 1IG9A 4QOZB 1RT7A 1U48A 5EVZA 5DM7L 2BE2A 3SPYA 4KRFA 3ALYA 3Q7CA 3DI6A 1S1UA 5C2DA 3F9KA 1TL1A 2P9UA 4PL8A 4DTUA 3A5OC 3QFPA 4CF8A 3O80A 2GWJA 3PIOL 4RW9A 3ZT0A 2B4JA 3D6RA 4R79A 1IO2A 4OKEA 4GNIA 1ITGA 1D9FA 3O8MA 4H0XB 1EETA 4I6MA 2G8KA 2IAJA 4MQ3A 4IOCL 1JLCA 4B08A 5LMNK 4HCBA 2P9UB 1GLCG 5FROA 1HX1A 2WFBA 3DLHA 4FWSA 1Z25A 1SQKA 3CCQN 3LAMA 4I6MB 4CJVA 4BRQA 4E3SA 4J2DA 1J9AA 2HHUA 3VTIA 3H6EA 1MA9B 2Q0RA 3SAGA 5B8HA 1U45A 4FPAA 3OA9A 3IMXA 4BRMA 2OYQA 2CGLA 5KGWA 4DLEA 4GV3A 3G0ZA 2A5XA 1BIUA 3R6MA 1SKWA 4NLBA 2VWJA 2OPQA 3ENBA 3MN7A 2DY4A 4W5QA 1VQ9N 4DQPA 3O9SA 1JL1A 4EAHD 3O3FA 4BR5A 4YDUC 4WQ5C 4BC2A 4N47A 1VQ8N 1TKZA 3ATUA 4X66K 3PX0A 2UUCK 3BEXA 3TSPA 1RT4A 3F9MA 4CVNE 4CIGA 3J7ZO 3PSFA 3M8PA 5EX5A 2OTLN 3VESA 2A42A 3CQYA 4RW7A 4DR6K 3A0IX 3NF7A 4FJXA 2VYPA 4B3TK 1RBSA 2KZMA 2IDOA 4LFAK 4OO1J 1MDUB 5HRPA 1NU0A 2NLXA 5KQDA 4HCCA 2A41A 4FW1A 1VQKN 4DTJA 1X3NA 1YJWN 4JKBA 3P38A 3A5NC 1IKWA 3DRSA 3ZT1A 4CCHA 2F9WA 3LALA 1TUYA 4Y1DA 2D0PA 2E88A 4CZFA 2RE2A 3L2WA 4WCEL 4G1QA 2VG5A 3PSIA 1CZBA 3HRGA 5AZJA 1RDUA 3VGMA 5C15A 4BQLA 3KKRA 1KFSA 4DV7K 3QERA 2OTJN 3OYMA 3SCXA 5GAEP 3VQ5A 4ID1A 3TAFA 3JXUA 3NDKA 4C8MA 1XMQK 4FW2A 5JICA 4E7LA 3V9WA 3ULEA 5M1OA 4JN4A 4FLXA 2A6AA 5AQNA 3ZT4A 3C95A 2HNYA 3NF8A 3H1QA 4CEBA 1OH5A 1KFDA 2DFEA 2DFHA 4EZ6A 2YCHA 4KAZA 3LANA 1FK9A 1BO5O 3LL3A 3O1WA 5AQGA 2FC0A 5CZ1A 4H4MA 4CJWA 4PUOA 3SBTA 1QQCA 2ZGZA 4O0JA 1VSKA 3S3MA 4C8OA 4WE1A 1V4SA 2FLOA 1KXPA 1J53A 3ULEB 5ELZA 4FZZA
chains in the Genus database with same CATH topology
2HHHK 4X64K 4DUYK 1HNXK 4DV3K 4X66K 2UUCK 5IT9O 4JI1K 4CVNE 2UUBK 1N32K 2E5LK 4NXNK 4K0KK 3T1HK 3J81O 4YHHK 4DV0K 4DV4K 1J5EK 1IBLK 4DR4K 2UXBK 2UXDK 4LF7K 4DR6K 5IWAK 1IBKK 4LF5K 2VQEK 4B3TK 4JI7K 4LFBK 4JI3K 4LFAK 2ZM6K 4LF4K 3OTOK 5BR8K 4YY3K 1HNZK 4CW7B 4B3RK 4DR5K 4NXMK 4AQYK 2UXCK 3JAMO 3J7AP 5FLXO 4GKJK 1IBMK 1N33K 5A2QO 5LMNK 4KHPK 2VQFK 4OX9K 1XMOK 4JI5K 4LFCK 4JYAK 5AJ3K 4DV1K 4X65K 4DV7K 4DV6K 4DV5K 4LF9K 4GKKK 4DR2K 4X62K 4B3MK 4LF6K 1XMQK 4JV5K 1N36K 3T1YK 2UU9K 4DR7K 4JI6K 4DR1K 1N34K 1HR0K 4DR3K 3J80O 4DV2K 4JI4K 2UUAK 1XNQK 4JI2K 1I94K 4JI0K 1FJGK 5LMUK 1XNRK 2F4VK 1HNWK 5LL6Z 4DUZK 4JI8K 4LF8K 4V19S 4B3SK 3J7YP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH K;  4X64 K;  4DUY K;  1HNX K;  4DV3 K;  4X66 K;  2UUC K;  5IT9 O;  4JI1 K;  4CVN E;  2UUB K;  1N32 K;  2E5L K;  4NXN K;  4K0K K;  3T1H K;  3J81 O;  4YHH K;  4DV0 K;  4DV4 K;  1J5E K;  1IBL K;  4DR4 K;  2UXB K;  2UXD K;  4LF7 K;  4DR6 K;  5IWA K;  1IBK K;  4LF5 K;  2VQE K;  4B3T K;  4JI7 K;  4LFB K;  4JI3 K;  4LFA K;  2ZM6 K;  4LF4 K;  3OTO K;  5BR8 K;  4YY3 K;  1HNZ K;  4CW7 B;  4B3R K;  4DR5 K;  4NXM K;  4AQY K;  2UXC K;  3JAM O;  3J7A P;  5FLX O;  4GKJ K;  1IBM K;  1N33 K;  5A2Q O;  5LMN K;  4KHP K;  2VQF K;  4OX9 K;  1XMO K;  4JI5 K;  4LFC K;  4JYA K;  5AJ3 K;  4DV1 K;  4X65 K;  4DV7 K;  4DV6 K;  4DV5 K;  4LF9 K;  4GKK K;  4DR2 K;  4X62 K;  4B3M K;  4LF6 K;  1XMQ K;  4JV5 K;  1N36 K;  3T1Y K;  2UU9 K;  4DR7 K;  4JI6 K;  4DR1 K;  1N34 K;  1HR0 K;  4DR3 K;  3J80 O;  4DV2 K;  4JI4 K;  2UUA K;  1XNQ K;  4JI2 K;  1I94 K;  4JI0 K;  1FJG K;  5LMU K;  1XNR K;  2F4V K;  1HNW K;  5LL6 Z;  4DUZ K;  4JI8 K;  4LF8 K;  4V19 S;  4B3S K;  3J7Y P; 
#chains in the Genus database with same CATH topology
 1J54 A;  1TK0 A;  3L3V A;  4CF1 A;  3A5M C;  3QNN A;  2YNF A;  5M1K A;  3AVB A;  3KLH A;  4BRD A;  1ATS A;  2QXF A;  4DU4 A;  4PKI A;  5T7B A;  1XC3 A;  1JLE A;  4N5S A;  4B9V A;  4PKH A;  3FZL A;  5HRR A;  4AHS A;  2KQ2 A;  1TYQ B;  4DV0 K;  2ZF5 O;  4DR4 K;  4B9Q A;  4E89 A;  1S1W A;  1JCE A;  3SAF A;  3HM8 A;  3F5T A;  3LZI A;  1W9H A;  3CG7 A;  4FJ8 A;  4JKH A;  3PLA A;  1JLG A;  4BRN A;  1ZC6 A;  2X6N A;  4Z4H A;  3OTO K;  5BR8 K;  3VEW A;  4CW7 B;  3W3D A;  5E84 A;  4KB1 A;  1S3X A;  2O8E A;  3QEI A;  4DG1 A;  3E1Y A;  3H08 A;  5AFU A;  2YJF A;  3TAE A;  1UWB A;  2PAV A;  3LP3 A;  4M3U A;  1WNS A;  5J2M A;  4BRK A;  3EO3 A;  2I7P A;  1S72 N;  4JYA K;  1DT9 A;  3AO5 A;  4HWI A;  3VER A;  1BI4 A;  3ZSQ A;  1D8Y A;  2XY7 A;  2P9N A;  5LY3 A;  5AQR A;  3HPH A;  3NH0 A;  1IKY A;  1QSS A;  1SUQ A;  3VQ8 A;  4C1N I;  1VQ7 N;  4FJG A;  4LF6 K;  4FK0 A;  1RDC A;  4FK2 A;  4F3T A;  3D0P A;  1V4T A;  3AVG A;  3S9H A;  1BI4 B;  5AQH A;  4OLB A;  2PY5 A;  1QHA A;  2FSN A;  1VSD A;  4DV2 K;  1OH6 A;  4CFA A;  1TK8 A;  2YKM A;  3JS6 A;  3E9O A;  4JRQ A;  5HRS A;  2KKZ A;  4RW4 A;  1HKB A;  3CJ1 A;  2YKN A;  1GLE G;  1RBR A;  3H3N O;  2VG7 A;  3RR8 A;  5AQK A;  1W97 L;  3SQ0 A;  5AQL A;  1VSH A;  3OS2 A;  1HPM A;  1NGA A;  4J2E A;  4FL9 A;  4KFB A;  2VG6 A;  2W40 A;  3PO5 A;  5KTQ A;  2RKI A;  3ZX3 A;  1C6V A;  4N76 A;  3NVM A;  4FJ9 A;  4JKE A;  3SI6 A;  3SUO A;  1N5Y A;  4AIL C;  4BRL A;  3FR0 A;  4OPK A;  4O44 A;  3O3H A;  4OKK A;  2XO7 A;  4GW6 A;  3AAR A;  3CCU N;  3U8X A;  3VEZ A;  2AA4 A;  1SV5 A;  1M90 O;  3MEG A;  1W7A A;  3VTH A;  3AA2 A;  1VQL N;  5I42 A;  5KQ8 A;  4GVE A;  4H03 B;  3DLL L;  1Q81 O;  1NMN A;  2E2O A;  1TL3 A;  4KHW A;  4LC9 B;  4KV8 A;  4JKG A;  4ILG B;  4CEF A;  4M3T A;  4QCL A;  3QET A;  3N4P A;  4B3R K;  3L2U A;  4E1M A;  4YNQ A;  3QEV A;  3QO9 A;  1XQS C;  2WTU A;  3HYF A;  4H5N A;  2OPP A;  2Q2R A;  3C7N A;  1XI1 A;  3KLG A;  4FXD A;  3AV9 A;  3B6O A;  3CC2 N;  3FFK B;  1M1K O;  3UKU A;  4CHN A;  1X9J A;  3JSM A;  4X65 K;  2RF2 A;  3T1A A;  4B1U B;  3FE1 A;  1EQY A;  4B1W B;  4BRO A;  1L3T A;  2CGJ A;  2IVO A;  1Z05 A;  3B8A X;  2IOC A;  3C7N B;  3CM6 A;  4DTP A;  3RWU A;  4B1Z A;  1WBB A;  3HZ6 A;  3SV3 A;  2DPN A;  3MXJ A;  1GLL O;  2FF6 A;  4CBW A;  3AA3 A;  3H45 C;  1HYV A;  5BPN A;  4Y1C A;  3K9J A;  1SZ2 A;  1BIS A;  4IKF A;  4CEQ A;  3ZSY A;  2D0O A;  2ZQB A;  4DQR A;  3CCS N;  1NG9 A;  4FJH A;  2F8T A;  3UKR B;  3WQT A;  1VQ5 N;  5HL7 L;  1NMD A;  4FCY A;  1P90 A;  1RT2 A;  1RBV A;  4B3S K;  3KZB A;  4B9M A;  4CZI A;  4DTR A;  3HP9 A;  3OYH A;  5J1E A;  2GUI A;  3TAP A;  1DTT A;  1VK0 A;  3OYL A;  2B5J A;  2P5G A;  2WC9 A;  2HB5 A;  3WEE A;  2VCP A;  3CIP A;  4K0K K;  4H0O A;  3UB5 A;  3J81 O;  4CED A;  3O4Q A;  1NK5 A;  3VQ7 A;  4FM1 A;  4DV4 K;  4AHR A;  4FVU A;  4C8K A;  3U9Z A;  3CYM A;  1UA0 A;  3BZC A;  3EEQ A;  4LF5 K;  1NM1 A;  3VA3 A;  1NKE A;  3NF6 A;  3L4I A;  4H5T A;  2OZS A;  1KVA A;  3WEE B;  3KKS A;  4CZM A;  3OY9 A;  3SNN A;  3C6U A;  4IO8 A;  4CFD A;  3HOT A;  3JAM O;  4C8N A;  3ATV A;  1IG8 A;  4O55 A;  4F2S A;  5FPN A;  3D7E O;  4CJT A;  4KTQ A;  3O3G A;  1UAX A;  4E1N A;  4F8R A;  1DTQ A;  3CF5 L;  1QE1 A;  4A2B A;  3K5M A;  3EE9 A;  4IZ9 A;  3UE5 A;  1TAU A;  1X3M A;  4FLU A;  2ITM A;  4CGG A;  4F2R A;  3K59 A;  3VQB A;  2XRI A;  3TAR A;  5JLF A;  3P31 A;  3D45 A;  3OW2 M;  3A8Y A;  4HTL A;  2JGU A;  3M1F A;  4X62 K;  4HHT A;  3ULD A;  1SKS A;  2E1Y A;  2NRX A;  1GLA G;  3CET A;  4FWO A;  3ZT3 A;  4O8U A;  5ADX H;  4B8C A;  3VF4 A;  4BY9 C;  4JAX A;  4JLH A;  3GL1 A;  4CF0 A;  5CYM A;  3CC4 N;  2YNG A;  3G71 N;  1ZBF A;  3OVN A;  3MN9 A;  4C8L A;  4BE1 A;  2GV9 A;  3OJS A;  1ZBS A;  4A57 A;  4DTO A;  1Z26 A;  1R0A A;  5M1Q A;  1XNR K;  4IFE A;  4B1X B;  2JWL A;  4DUZ K;  1WBD A;  4DSK A;  3O9Q A;  2YNI A;  4FJL A;  1WOQ A;  3ZET B;  1WSE A;  4M42 A;  2QKB A;  4X64 K;  4Z4F A;  1UOC A;  2YHA A;  1C1B A;  3DXM A;  2P51 A;  2D1K A;  1NJY A;  1SL0 A;  1U04 A;  4KI4 A;  4CEA A;  4I9Q A;  4FWM A;  1HJO A;  2FBY A;  1DEJ A;  1RBU A;  2P9S A;  3BP8 A;  1FKO A;  2KTQ A;  3RRG A;  2RPI A;  4I2Q A;  2PBD A;  3QLH A;  2ETJ A;  2NRW A;  1NJZ A;  2CH5 A;  3TTC A;  3W0L A;  1GOB A;  3KLE A;  4DU3 A;  1GLF O;  2RN2 A;  3K9K A;  3NGY A;  3QML A;  4IDH A;  1Q82 O;  2X74 A;  3L8B A;  4FLT A;  3LP2 A;  5FPD A;  2P9L A;  4LY7 A;  3TU5 A;  3ZT2 A;  3L4Q A;  4CJF A;  4DF8 A;  2UXC K;  2P9S B;  1IKV A;  1X9M A;  2F9T A;  1U4B A;  1RBT A;  4FVM A;  3UIQ A;  3I55 N;  3RSE A;  1YJ9 N;  4YOY A;  1ASW A;  1RCH A;  3SQ2 A;  3QEW A;  1Q7Y O;  2HHT A;  3K5L A;  1EX4 A;  1YJN N;  2HMI A;  5D3G A;  1BCO A;  4FWK A;  1FXX A;  4DV1 K;  1HPZ A;  1T7P A;  5AZI A;  3V1R A;  1KQS M;  4BWJ A;  4GKK K;  1KSP A;  1KAX A;  4AHV A;  4DCH A;  4JHD A;  4KTW A;  3RSE B;  4ZHR A;  4J2B A;  2W41 A;  1OH7 A;  5GAH P;  1BOT O;  5H1S Q;  3RMC A;  4ID5 A;  1KCF A;  2Q31 A;  4RCH A;  3VEO A;  3G10 A;  5AZI B;  4DFP A;  1KLM A;  1S6Q A;  1WAF A;  3GG4 A;  3OYC A;  4G9Z A;  2PYL A;  3SPZ A;  1YTU A;  1QQO A;  4DQS A;  1YHQ N;  3AVF A;  3DMJ A;  4DTS A;  5SZT A;  4JI8 K;  4LF8 K;  1RGI A;  3CJ9 A;  5J2N A;  4BDY A;  3T3F A;  2Y1J A;  1SS6 A;  2GUP A;  2YV0 X;  3U3G A;  1BL3 A;  3VA0 A;  5JS2 A;  3CM5 A;  4OPA A;  3SJH A;  3QEP A;  2IC3 A;  3MCA B;  5BPL A;  3IS9 A;  1EWQ A;  5JVH L;  5GIP A;  5GIO A;  4CJL A;  1Q18 A;  2ZD1 A;  1YI2 N;  1NGB A;  3O6W A;  3D2E A;  2JWK A;  4CER A;  3VF6 A;  3LDS A;  4CGF A;  4KKO A;  5C0Y A;  3OYA A;  5KPR A;  3O9U A;  3PV8 A;  1JLQ A;  2EX3 A;  3LM9 A;  3I56 N;  5AQU A;  4J2A A;  1NGC A;  5AQZ A;  2QI2 A;  3HP6 A;  3R8E A;  3MAQ A;  4EP5 A;  2G8I A;  3A2F A;  4JNE A;  1QVG M;  1RNH A;  1OVQ A;  3LP0 A;  5C2F A;  4WFN L;  3MEC A;  2D0C A;  4LSL A;  1RT5 A;  1S1V A;  3MED A;  1WAJ A;  4DB3 A;  2QWL A;  2X6S A;  3ISN C;  3E9P A;  1YXQ A;  3CJB A;  3WUH A;  5LJW A;  1T6D A;  4H0T B;  4LH5 A;  4CEE A;  1K73 O;  2LSN A;  3CQ8 A;  3CME N;  2I5J A;  3GOI A;  4RTF D;  4O5F A;  1VQN N;  1G15 A;  4CHO A;  2HND A;  4CJ5 A;  1VSM A;  2ZJR L;  3HPO A;  2GX9 A;  2YHB A;  4DR3 K;  3O5B A;  2G8H A;  3J80 O;  3FZM A;  1XNQ K;  3VEN A;  1A5W A;  1REV A;  3EZ5 A;  1S1T A;  2D4W A;  1XHX A;  1NWK A;  1XC9 A;  2NRH A;  4LH4 A;  4AHT A;  1NGH A;  4H5R A;  3VQC A;  3K5O A;  3VOV A;  2E2P A;  4BE2 A;  1HJR A;  1XWL A;  3EZW A;  4IJA A;  3KWG A;  4F9O A;  3THV A;  2P1J A;  3VQA A;  1MU2 A;  1CZA N;  2F96 A;  5KI6 A;  3FLC O;  4Q5V A;  2OA8 A;  5AZJ B;  2GTD A;  4GVM A;  1J5O A;  4HVJ A;  1O1W A;  5FRN A;  3NVK A;  4JKF A;  3IRX A;  1VSF A;  4M41 A;  4FWN A;  4CJ4 A;  4JS4 A;  4FZX C;  1P8Z A;  4Z4G A;  1IKX A;  3BZK A;  4M63 C;  4BRC A;  2HBM A;  3L2Q A;  4HUG A;  4CEC A;  3QIC A;  5AQW A;  3NBP A;  3L2V A;  4WF9 L;  3QNO A;  2Z1G A;  4BRF A;  4E7J A;  1Q9X A;  5DMR A;  3EY1 A;  3SBG A;  4JKC A;  3ZCM A;  1NK4 A;  1GOA A;  3ID6 A;  4AHC A;  3TAG A;  4L8R B;  4DQ8 A;  2PZS A;  4FWP A;  1BUP A;  1VSL A;  3LDL A;  3J7A P;  4E7I A;  3FGU A;  4BRI A;  5KPT A;  1HNI A;  1F21 A;  3HBT A;  4AHU A;  1XMO K;  5HLF A;  4KHN A;  4KBO A;  4CK1 A;  4CJ3 A;  4CEZ A;  3DAW A;  5DM6 L;  3LWM A;  3CER A;  3RMD A;  1BU6 O;  4ELU A;  2QWN A;  3LDO A;  1G99 A;  3AGR A;  4BRE A;  5I3U A;  4RW8 A;  4GV9 A;  3ZX0 A;  1TUU A;  4IOA L;  3FZF A;  5AQV A;  3TAN A;  4WQ4 A;  1JXE A;  4FYD A;  3AGK A;  5GAG P;  3L2R A;  1RDW X;  1TVR A;  3MWT A;  2Z1I A;  4MO4 A;  3AAP A;  5BRH A;  4MLH A;  4JD2 A;  1JCG A;  1L5U A;  1YVN A;  3BF1 A;  2F4V K;  1X9S A;  1HNW K;  4DSL A;  2O8E B;  5CE3 A;  1VHX A;  3H46 O;  2YHW A;  3CCR N;  4IXC A;  3K57 A;  3VEX A;  3MCP A;  2P9N B;  4DV3 K;  3QBX A;  4PQU A;  3VQE A;  3AVM A;  4JD2 B;  5IT9 O;  2O8D A;  3AA4 A;  3SZ2 A;  2V7Y A;  4C23 A;  1HRH A;  1N6Q A;  1KC8 O;  1ATR A;  5HRN A;  3ID8 A;  4H8K A;  1YT3 A;  2EHG A;  1VQM N;  3VQ6 A;  1IBL K;  3HO1 A;  1TKX A;  3O9R A;  3KVG A;  1OVY A;  5IWA K;  3C6H A;  4H0V B;  4OGE A;  3WT0 A;  4CHQ A;  3EYZ A;  4F3O A;  1VAZ A;  4EFH A;  4U67 L;  4FM2 A;  3LPU A;  4K8X A;  4K41 A;  3FZH A;  3KLI A;  4AM7 A;  1HNZ K;  4XEI A;  1NGJ A;  4PHT X;  4W5N A;  3EE8 A;  2A40 A;  4CIE A;  5M1F A;  3OS0 A;  1UA1 A;  4KRE A;  2O8B A;  3NE6 A;  1QQN A;  4MDA A;  3CQX A;  4YOW A;  5KRS A;  4KHP K;  4HTU A;  1QSL A;  4Z94 A;  3VGK A;  3QEX A;  5M1N A;  5AJ3 K;  1U49 A;  5AQP A;  5AQM A;  3HL8 A;  3LDN A;  3VPZ A;  4E1J A;  1L3S A;  3QB0 A;  1WSJ A;  4CJ7 A;  4AF1 A;  2O8B B;  2NNW A;  4CGJ A;  3K2P A;  1I39 A;  4A2A A;  2HHW A;  2O4G A;  1N36 K;  3JYT A;  3KD1 E;  4KHQ A;  1ZBI A;  1C0F A;  3KK3 A;  4DHY A;  1NGG A;  4JKG B;  1NOZ A;  4ILH A;  4CZL A;  4W5T A;  1Z6R A;  3HOS A;  1NK9 A;  2G8W A;  2YHY A;  3WXI A;  1JLA A;  2GEL A;  2VGN A;  4MDB A;  1BQN A;  4RG8 A;  1LWC A;  3OYI A;  1IJJ A;  3OHR A;  2BDP A;  3WXM B;  3NHG A;  2ZGY A;  4CJP A;  1DKG D;  3HXM A;  4M45 A;  3AVK A;  2OCE A;  1Y97 A;  4V19 S;  4DTM A;  1B92 A;  4KH5 A;  1JLF A;  3TSQ A;  3CFR A;  4FJ7 A;  1KD1 O;  1QTM A;  3AVL A;  2Q1N A;  3U4L A;  3NGI A;  3UKU B;  2O8C A;  4BRG A;  3VQ9 A;  1GOC A;  4B8A B;  3LAK A;  5F1X A;  4IG0 A;  4OJR A;  4BVO A;  2OPR A;  3D2F A;  1NJW A;  3SUP A;  3P83 D;  2YI1 A;  1N32 K;  4NXN K;  1B9D A;  1D9D A;  1EP4 A;  1TKT A;  3LPT A;  2QWR A;  1W0H A;  5BN9 A;  3BDP A;  4CHY A;  2UXD K;  3CMA N;  4QS7 A;  1IV0 A;  1EKE A;  3FZK A;  1IBK K;  2UYT A;  1VSE A;  1N8R O;  3CJA A;  1ILY A;  5FPM A;  3R3L A;  2ZM6 K;  4ELV A;  4FLV A;  4O8K A;  3P4I A;  4YY3 K;  3IAY A;  5FPE A;  1LOT B;  3D2F B;  4A61 A;  1BA1 A;  3C6T A;  3OYF A;  3S3N A;  3DYA A;  1X9W A;  3AY9 A;  4U7B A;  3WNH A;  3WXJ A;  4C1N K;  1B9F A;  3SQ4 A;  4FJK A;  2GBZ A;  4KHS A;  3OYN A;  3HI0 A;  1O13 A;  1IBM K;  3KTQ A;  4CGI A;  3P1G A;  3V1O A;  3O4N A;  4CFC A;  3HPG A;  4H5W A;  3PIP L;  1S9E A;  4JI5 K;  4CZE A;  2HF3 A;  5E26 A;  4FJI A;  2FSK A;  4IBN A;  3ASM A;  2Z1H A;  3M3Z A;  3CCE N;  1BA0 A;  3THX A;  5E41 A;  3VF2 A;  4DSJ A;  2IVP A;  4A59 A;  1BGX T;  2NRT A;  1K9M O;  3I33 A;  2YJE A;  1E4F T;  5JS1 A;  1VRT A;  4FJN A;  3M8Q A;  3QIP A;  1OKJ A;  3S41 A;  3C0B A;  1U2V A;  4E7H A;  4MFB A;  2YX6 A;  5FRM A;  5M1P A;  2E4L A;  3R9P A;  4DMN A;  3THX B;  3DOL A;  5CYQ A;  4BGB A;  1S9G A;  4YDU A;  4W5R A;  1LWF A;  4WQ5 A;  2FXU A;  4FSV A;  1XHZ A;  3HK2 A;  4IJN A;  4Y0W A;  3ZSX A;  3BF3 A;  3QES A;  1KRP A;  3T69 A;  1C1A A;  1VSI A;  4CGH A;  3ZX2 A;  4KPY A;  4CD3 A;  1JKH A;  3KLF A;  1VRU A;  4IG3 A;  5CHI A;  1IH7 A;  3F73 A;  4ILJ A;  5CZ2 A;  4IO9 L;  4EP4 A;  1K8A O;  3SYZ A;  2QXL A;  1D4X A;  1R59 O;  1J6Z A;  1C0G A;  4BVP A;  4FLY A;  3WNG A;  1FW6 A;  3H3O B;  4NYF A;  2G8V A;  2QWQ A;  4KH6 A;  2D5R A;  1VQ4 N;  4BR4 A;  4LF7 K;  4CFB A;  3MXI A;  3CCM N;  4JI7 K;  4O4G A;  4CIF A;  4AH9 A;  5AQF A;  3THW A;  4IEE A;  2NRZ A;  3QIN A;  3C6A A;  4WYB A;  2HST A;  4M3W A;  4Z0U A;  3OYJ A;  1W2B M;  2P9K A;  1BG3 A;  2CGK A;  3EN9 A;  3ZSO A;  4GMJ B;  4FWR A;  1S5J A;  2ZJP L;  1NBW A;  2HBL A;  4FOI A;  3I0S A;  4DFJ A;  3CCV N;  5EOY A;  3T19 A;  2X78 A;  2E2Q A;  3TSU A;  3DXM B;  1LWE A;  3ZSV A;  1ZYQ A;  1EO1 A;  2P9K B;  4IOX A;  4DWI A;  2WON A;  1C0T A;  2G8U A;  1K8K A;  2G8F A;  4O0I A;  4OLA A;  3NH2 A;  4CES A;  4I2P A;  3ITH A;  4CZJ A;  2F7T A;  5AQO A;  2HHV A;  4A62 A;  3CHW A;  3R1X A;  4CK3 A;  2HF4 A;  4DSE A;  3HTV A;  3DOK A;  5HP1 A;  4M3X A;  2P9L B;  3DM2 A;  1YVU A;  1TK5 A;  1VSJ A;  5AQQ A;  4CJK A;  1K8K B;  3ZSR A;  3V6D A;  4PY5 A;  3DLR A;  4JRP A;  1NGI A;  1HLU A;  4K43 A;  3U6F A;  4BGA A;  1KAY A;  2ZE2 A;  4FPB A;  1RDD A;  4M3Z A;  4YOT A;  1T03 A;  1Q9Y A;  4HUF A;  2E20 A;  3J7Y P;  4K42 A;  2P9I A;  4CJU A;  5MLC Q;  3KK2 A;  3MMV A;  4FJM A;  4ELT A;  1QSY A;  4N41 A;  2OZM A;  3PO4 A;  4BR7 A;  4NLC A;  2KFZ A;  1RFQ A;  3MK6 A;  3V1Q A;  4YOV A;  4DTN A;  1RT3 A;  3NAE A;  3T1H K;  1LCU A;  5AFU H;  2FBV A;  2NRV A;  4JHD B;  1T8E A;  3AO1 A;  2Q3S A;  1J5E K;  3G4S N;  3PUF A;  3QFU A;  4MO5 A;  1NJI O;  2P9I B;  4B1V A;  1C0M A;  4CF2 A;  3VEY A;  4JI3 K;  4QS9 A;  3CJC A;  4KH4 A;  1YIJ N;  3LDQ A;  3MX2 A;  4LF4 K;  4B9S A;  2NUB A;  4DSF A;  3CC7 N;  2JLE A;  5KRT A;  1QZ5 A;  2IIR A;  2IGI A;  2P9P A;  5HBM A;  4FJJ A;  5FLX O;  3WNF A;  2ASO A;  1JCF A;  3PX6 A;  4CEO A;  2OAN A;  3IUC A;  1NK0 A;  4LFC K;  1I3A A;  4CBX A;  1QS4 A;  2RHK A;  3AO2 A;  2ASM A;  1VQO N;  2QKK A;  4DV5 K;  1RTJ A;  2P9P B;  5F0X A;  4LF9 K;  1Q86 O;  3AVN A;  3V9Z A;  1CXQ A;  2WOM A;  4DR2 K;  2IVN A;  4YOU A;  2XY8 A;  4H0P A;  2ZJQ L;  3QDK A;  4ICL A;  1XUP O;  3ZSZ A;  3C65 A;  3OBY A;  1X1P A;  4TSX A;  3CD6 N;  3SUN A;  2VWK A;  3DJC A;  3I0R A;  3D2E B;  3IKM A;  3M6G A;  1WB9 A;  5GIN A;  4PA1 A;  3G6E N;  4E7K A;  4FWL A;  3ZLJ A;  4IFY A;  4XH4 A;  3A5L C;  3TWH A;  1SL2 A;  1SKR A;  2OPS A;  5BN8 A;  4WFA L;  2FBT A;  4NYN A;  2VGM A;  3RMA A;  2QEX N;  2EWS A;  3TAM A;  4CJQ A;  1HUX A;  4B9L A;  5AQS A;  4A5A A;  5ADX A;  2ATQ A;  2V52 B;  1U6Z A;  2D0B A;  4OPH A;  1C1C A;  3OYD A;  1JJ2 M;  1HNX K;  1HQU A;  4JI1 K;  4F4K A;  5BRE A;  3PY8 A;  3AVH A;  2W6K A;  3IFR A;  1BQM A;  2QWO A;  3AVC A;  3K5N A;  3VET A;  3B6P A;  2H3G X;  4JEP A;  4CZK A;  1CLQ A;  4QAG A;  3RVC A;  1KVB A;  4KO0 A;  3VQQ A;  3CI5 A;  4DS5 A;  3ZSW A;  4DSI A;  2Y1I A;  3DLE A;  4JS5 A;  1L3U A;  1RDA A;  1ZBU A;  5EXW A;  2AP1 A;  3WXK A;  4KB0 A;  3CCJ N;  1LW0 A;  5EY4 A;  2HHS A;  1NLV A;  2PYJ A;  4I7F A;  3S3O A;  4BRA A;  1WLJ A;  2BTF A;  4BG8 A;  2E8A A;  1N33 K;  4ISG A;  1QHT A;  5A2Q O;  3NF9 A;  2VQF K;  1YIT N;  1CZ9 A;  2F8S A;  2QWM A;  4FO0 A;  3M5R A;  1KTQ A;  1NK6 A;  1ESV A;  4UY8 O;  1T44 A;  1YUW A;  4B1Y B;  4NCA A;  4DV6 K;  1S6P A;  4DTX A;  4BC3 A;  1ZXO A;  4OKJ A;  3ENH A;  4KHU A;  1TYQ A;  1OH8 A;  4H5V A;  3CPE A;  2BAN A;  3HT3 A;  1RIL A;  1E3M A;  4H4O A;  1A5X A;  1S22 A;  4BE0 A;  3CPW M;  2UU9 K;  3O08 A;  2GEM A;  4XH5 A;  3T7Z A;  5BRD A;  1Y64 A;  3GDQ A;  3MN6 A;  4DR1 K;  2ASP A;  1MWK A;  2A1S A;  3HJF A;  4EIA A;  5J2P A;  3FFI A;  3LWL A;  1NK7 A;  3I8B A;  3NFA A;  2O4I A;  3KJV A;  3LDP A;  4CJS A;  5LL6 Z;  5GAD P;  4WFB L;  3V9S A;  2R7Y A;  4DS4 A;  3HSC A;  2BH1 A;  3RR7 A;  5BRF A;  4B9U A;  2BUP A;  1RT1 A;  4IEI A;  2D0A A;  5F2R A;  4A5B A;  4IWV A;  3U9D A;  4M3Y A;  1BCM A;  3Q7B A;  5KPZ A;  1NOY A;  1KVC A;  5AQI A;  4ISE A;  1K6Y A;  1TV6 A;  2UUB K;  3MXM A;  4H0Y B;  2XY6 A;  4YFU A;  4QS8 A;  2A3Z A;  4M3R A;  1VQP N;  2B6A A;  4PWD A;  3VQP A;  3K0S A;  3KD5 E;  5I9E B;  3RRH A;  2UXB K;  4GY2 B;  3GBT A;  4AM6 A;  3DRR A;  4HUE A;  4M7X A;  4Q0B A;  4DFM A;  4XIU A;  4LFB K;  3DLK A;  4DLG A;  4YOX A;  4NCG A;  3M8S A;  4K8Z A;  2W42 A;  4BR0 A;  1MWM A;  2Q0U A;  1EXQ A;  1HYZ A;  3M8R A;  4FLZ A;  4RWT A;  5AQY A;  3EKS A;  1BWF O;  2FBX A;  3TI0 A;  4FJ5 A;  2HVI A;  3CXC M;  5K14 A;  3BUZ B;  1HMV A;  4GKJ K;  4CK2 A;  4DQI A;  3HM9 A;  3AVI A;  5AQT A;  1T3V A;  3OYG A;  2QW9 A;  3OYK A;  1LAW A;  5CR4 A;  4BG9 A;  4CJE A;  1LAV A;  3SUQ A;  4BAC A;  3I8D A;  2O8D B;  2E6L A;  1T6C A;  3WXL A;  2FF3 B;  3SMP A;  3RMB A;  5FDL A;  3NGZ A;  2QM1 A;  3WQU A;  3V4I A;  3OYB A;  5JVG L;  2HBK A;  3QBW A;  1L3V A;  3CCL N;  1ASU A;  1CXU A;  1VQ6 N;  5TKW A;  1NK8 A;  4ZTF A;  2HW3 A;  4CD1 A;  2BGG A;  4KI6 A;  4BR9 A;  2HOE A;  4BQZ A;  2HHX A;  3L6Q A;  4JI6 K;  1HR0 K;  2ZWH A;  2UUA K;  4BC4 A;  4KTZ A;  4DKW A;  3WNE A;  3HVR A;  3MEE A;  1BDG A;  5C24 A;  4CE9 A;  4ZTJ A;  1GLJ O;  3E66 A;  5LMU K;  3E01 A;  4CI6 A;  2DTU A;  1E4G T;  3RTV A;  1HNV A;  4EHU A;  5J2Q A;  3VMF B;  2NRR A;  3TTF A;  2Q36 A;  2HHH K;  4R5P A;  3MWP A;  3AO4 A;  1S1X A;  4JK9 A;  1BHL A;  2NZT A;  4L3Q A;  4DFK A;  4FK4 A;  2KHO A;  1ZBH A;  4PL7 A;  3OJU A;  1GLB G;  4K25 A;  3NMU A;  3KK1 A;  1RT6 A;  3L3U A;  1DLO A;  3QIO A;  3O9T A;  1YAG A;  3L0Q A;  5JLH A;  4FZY A;  4Z4E A;  3ZEU A;  3AA5 X;  1NGD A;  3MX5 A;  3AVA A;  3N4Q A;  2Q97 A;  3KIO A;  2VQE K;  3VN5 A;  3OBW A;  3THY A;  3EKU A;  3SMS A;  4E19 A;  3IDH A;  4DF4 A;  3VQ4 A;  2I7N A;  4NB4 A;  3E9L A;  4DR5 K;  4NXM K;  2A1R A;  4OVL A;  5AQJ A;  1QQM A;  3UKR A;  1RTD A;  2YHX A;  2WUS A;  1SL1 A;  4PKG A;  3ZEU B;  3DLG A;  4O5B A;  3CJ7 A;  4FLW A;  4OX9 K;  1H1V A;  4BC5 A;  3THY B;  3AVJ A;  1WSI A;  3KWI A;  3HVT A;  4BWM A;  3K58 A;  1SAZ A;  2CH6 A;  2O8C B;  5C42 A;  1TKD A;  2ITG A;  4OPJ A;  3SK3 A;  3SAH A;  4JKA A;  1HKG A;  4B3O A;  4BR2 A;  5AQX A;  2WBN A;  1KAZ A;  2HVH A;  1U47 A;  1HKC A;  3BY5 A;  2E6M A;  4JK8 A;  4CZG A;  3T1Y K;  3LP1 A;  2QWP A;  4ISF A;  4GV6 A;  3CFP A;  3O1B A;  5AR0 A;  1Q8I A;  4BRP A;  5BR9 A;  4CHP A;  4DR7 K;  5HOO A;  1N34 K;  1WSG A;  4WQ4 C;  4Z4I A;  4FWQ A;  3HST B;  1ATN A;  4JI4 K;  4BDZ A;  4FM0 A;  4BRH A;  4DQQ A;  4CJR A;  4CHZ A;  1FJG K;  3ENO A;  1NGE A;  3SQ1 A;  1NNE A;  3ZYY X;  2HBJ A;  4KHY A;  3TAB A;  3AAQ A;  3U3Y A;  2HNZ A;  5KGX A;  4MLE A;  3G25 A;  3PX4 A;  5JMV A;  4CBU A;  3SV4 A;  5SWM A;  4DUY K;  2XY5 A;  4IDK A;  2E2N A;  2J4R A;  2AJQ A;  2VWB A;  1JXB A;  3DRP A;  4J8F A;  1ZBL A;  4YOR A;  1RDB A;  2E1Z A;  4M7Y A;  2QK9 A;  4RW6 A;  3NCI A;  3VGL A;  2KW4 A;  4YHH K;  3LZJ A;  3V9U A;  1A5V A;  4XH1 A;  2V51 B;  1WN7 A;  3O4W A;  3NH1 A;  4B9N A;  1WSF A;  2KZZ A;  1NGF A;  1KLN A;  1QVF M;  1YTA A;  4JKD A;  1U2V B;  2V7Z A;  4B9T A;  1RTI A;  1WSH A;  3SJJ A;  1LW2 A;  4NCB A;  1NKB A;  1LV5 A;  5EU7 A;  1HYS A;  3LM2 A;  1HQE A;  1TGO A;  3SLC A;  4AQY K;  4LSN A;  4W5O A;  3DXK A;  5HRO A;  3J8A A;  3GE1 A;  4NO7 A;  3OYE A;  2YNH A;  2P5O A;  3VEV A;  4LD0 A;  2HMP A;  3ZET A;  5LJV A;  1JLB A;  1C0U A;  1GLD G;  2IS3 A;  3KK7 A;  4CF9 A;  3TTD A;  3CFO A;  4FOE A;  3TR8 A;  1JL2 A;  5DK5 A;  4I9L A;  3MDQ A;  4EHT A;  2O8F A;  1D5A A;  3H1V X;  4Z4C A;  2QA4 N;  5CY4 A;  2QTD A;  1QZ6 A;  2W6L A;  3DXK B;  4B3M K;  1BIZ A;  4OGC A;  3F2K A;  4JK7 A;  3DLB A;  4CGD A;  4JV5 K;  3P5J A;  3AO3 A;  2HHQ A;  5C12 A;  4UQG A;  3THW B;  3TAQ A;  3OS1 A;  4EZ9 A;  2O8F B;  1TAQ A;  3EL2 A;  4E0D A;  2KFN A;  4JI2 K;  1I94 K;  2KLA A;  4JI0 K;  1WUA A;  3BGR A;  5C10 A;  1DGK N;  1YF5 L;  4IFV A;  1NKC A;  3MN5 A;  3DWL A;  2FSJ A;  3VQD A;  5BPM A;  3IG1 A;  4CZH A;  3TPQ A;  5C25 A;  1ASV A;  1NJX A;  4DU1 A;  4N56 A;  1RTH A;  1T05 A;  1EWR A;  4BDP A;  2Z1J A;  5TKY A;  3P39 A;  2XHB A;  2PFU A;  1FKP A;  3V81 A;  3C94 A;  3KHY A;  2GWK A;  2DFF A;  2E5L K;  3V9X A;  1IG9 A;  4QOZ B;  1RT7 A;  1U48 A;  5EVZ A;  5DM7 L;  2BE2 A;  3SPY A;  4KRF A;  3ALY A;  3Q7C A;  3DI6 A;  1S1U A;  5C2D A;  3F9K A;  1TL1 A;  2P9U A;  4PL8 A;  4DTU A;  3A5O C;  3QFP A;  4CF8 A;  3O80 A;  2GWJ A;  3PIO L;  4RW9 A;  3ZT0 A;  2B4J A;  3D6R A;  4R79 A;  1IO2 A;  4OKE A;  4GNI A;  1ITG A;  1D9F A;  3O8M A;  4H0X B;  1EET A;  4I6M A;  2G8K A;  2IAJ A;  4MQ3 A;  4IOC L;  1JLC A;  4B08 A;  5LMN K;  4HCB A;  2P9U B;  1GLC G;  5FRO A;  1HX1 A;  2WFB A;  3DLH A;  4FWS A;  1Z25 A;  1SQK A;  3CCQ N;  3LAM A;  4I6M B;  4CJV A;  4BRQ A;  4E3S A;  4J2D A;  1J9A A;  2HHU A;  3VTI A;  3H6E A;  1MA9 B;  2Q0R A;  3SAG A;  5B8H A;  1U45 A;  4FPA A;  3OA9 A;  3IMX A;  4BRM A;  2OYQ A;  2CGL A;  5KGW A;  4DLE A;  4GV3 A;  3G0Z A;  2A5X A;  1BIU A;  3R6M A;  1SKW A;  4NLB A;  2VWJ A;  2OPQ A;  3ENB A;  3MN7 A;  2DY4 A;  4W5Q A;  1VQ9 N;  4DQP A;  3O9S A;  1JL1 A;  4EAH D;  3O3F A;  4BR5 A;  4YDU C;  4WQ5 C;  4BC2 A;  4N47 A;  1VQ8 N;  1TKZ A;  3ATU A;  4X66 K;  3PX0 A;  2UUC K;  3BEX A;  3TSP A;  1RT4 A;  3F9M A;  4CVN E;  4CIG A;  3J7Z O;  3PSF A;  3M8P A;  5EX5 A;  2OTL N;  3VES A;  2A42 A;  3CQY A;  4RW7 A;  4DR6 K;  3A0I X;  3NF7 A;  4FJX A;  2VYP A;  4B3T K;  1RBS A;  2KZM A;  2IDO A;  4LFA K;  4OO1 J;  1MDU B;  5HRP A;  1NU0 A;  2NLX A;  5KQD A;  4HCC A;  2A41 A;  4FW1 A;  1VQK N;  4DTJ A;  1X3N A;  1YJW N;  4JKB A;  3P38 A;  3A5N C;  1IKW A;  3DRS A;  3ZT1 A;  4CCH A;  2F9W A;  3LAL A;  1TUY A;  4Y1D A;  2D0P A;  2E88 A;  4CZF A;  2RE2 A;  3L2W A;  4WCE L;  4G1Q A;  2VG5 A;  3PSI A;  1CZB A;  3HRG A;  5AZJ A;  1RDU A;  3VGM A;  5C15 A;  4BQL A;  3KKR A;  1KFS A;  4DV7 K;  3QER A;  2OTJ N;  3OYM A;  3SCX A;  5GAE P;  3VQ5 A;  4ID1 A;  3TAF A;  3JXU A;  3NDK A;  4C8M A;  1XMQ K;  4FW2 A;  5JIC A;  4E7L A;  3V9W A;  3ULE A;  5M1O A;  4JN4 A;  4FLX A;  2A6A A;  5AQN A;  3ZT4 A;  3C95 A;  2HNY A;  3NF8 A;  3H1Q A;  4CEB A;  1OH5 A;  1KFD A;  2DFE A;  2DFH A;  4EZ6 A;  2YCH A;  4KAZ A;  3LAN A;  1FK9 A;  1BO5 O;  3LL3 A;  3O1W A;  5AQG A;  2FC0 A;  5CZ1 A;  4H4M A;  4CJW A;  4PUO A;  3SBT A;  1QQC A;  2ZGZ A;  4O0J A;  1VSK A;  3S3M A;  4C8O A;  4WE1 A;  1V4S A;  2FLO A;  1KXP A;  1J53 A;  3ULE B;  5ELZ A;  4FZZ A; 
#chains in the Genus database with same CATH homology
 2HHH K;  4X64 K;  4DUY K;  1HNX K;  4DV3 K;  4X66 K;  2UUC K;  5IT9 O;  4JI1 K;  4CVN E;  2UUB K;  1N32 K;  2E5L K;  4NXN K;  4K0K K;  3T1H K;  3J81 O;  4YHH K;  4DV0 K;  4DV4 K;  1J5E K;  1IBL K;  4DR4 K;  2UXB K;  2UXD K;  4LF7 K;  4DR6 K;  5IWA K;  1IBK K;  4LF5 K;  2VQE K;  4B3T K;  4JI7 K;  4LFB K;  4JI3 K;  4LFA K;  2ZM6 K;  4LF4 K;  3OTO K;  5BR8 K;  4YY3 K;  1HNZ K;  4CW7 B;  4B3R K;  4DR5 K;  4NXM K;  4AQY K;  2UXC K;  3JAM O;  3J7A P;  5FLX O;  4GKJ K;  1IBM K;  1N33 K;  5A2Q O;  5LMN K;  4KHP K;  2VQF K;  4OX9 K;  1XMO K;  4JI5 K;  4LFC K;  4JYA K;  5AJ3 K;  4DV1 K;  4X65 K;  4DV7 K;  4DV6 K;  4DV5 K;  4LF9 K;  4GKK K;  4DR2 K;  4X62 K;  4B3M K;  4LF6 K;  1XMQ K;  4JV5 K;  1N36 K;  3T1Y K;  2UU9 K;  4DR7 K;  4JI6 K;  4DR1 K;  1N34 K;  1HR0 K;  4DR3 K;  3J80 O;  4DV2 K;  4JI4 K;  2UUA K;  1XNQ K;  4JI2 K;  1I94 K;  4JI0 K;  1FJG K;  5LMU K;  1XNR K;  2F4V K;  1HNW K;  5LL6 Z;  4DUZ K;  4JI8 K;  4LF8 K;  4V19 S;  4B3S K;  3J7Y P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...