4JI1K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji1K00
4JI6K 2ZM6K 4LF6K 4GKKK 4X65K 4AQYK 1N32K 1IBMK 3J7AP 4JV5K 4YHHK 5IWAK 5LL6Z 4CW7B 4JI2K 4DR6K 1N34K 2HHHK 3JAMO 4DR3K 4DV7K 2UU9K 4LF4K 1IBLK 4B3SK 4DR1K 5LMUK 4JI4K 1J5EK 5AJ3K 3OTOK 1XNQK 5FLXO 4DUZK 2UUCK 1I94K 2UXCK 5A2QO 2F4VK 4DV0K 5IT9O 4B3RK 4LF8K 4LF7K 2UXDK 4LFCK 1IBKK 4DV3K 4DR5K 3T1HK 4JYAK 4JI7K 4X64K 4LF5K 2E5LK 4DR7K 4GKJK 2VQFK 1XMQK 2UUAK 4DV1K 4JI3K 4DV4K 4JI0K 3J81O 1HR0K 4X62K 2UXBK 4JI1K 2VQEK 1XNRK 1HNZK 4K0KK 4LFAK 4DV5K 3T1YK 4NXNK 3J7YP 4LFBK 5LMNK 4JI5K 4DV6K 5BR8K 4B3TK 4DUYK 4DV2K 4NXMK 2UUBK 4B3MK 1HNXK 4CVNE 4DR2K 4YY3K 4OX9K 3J80O 4KHPK 4DR4K 4V19S 1N36K 1FJGK 4LF9K 1N33K 4JI8K 1XMOK 4X66K 1HNWK
chains in the Genus database with same CATH superfamily
4E7KA 4ILGB 1L5UA 4ICLA 1VAZA 3O4WA 1YF5L 2NRHA 5AQFA 4KH6A 3CCJN 4M3WA 3MEEA 4DSLA 5EU7A 3SMPA 3JS6A 1N34K 2I5JA 3MN9A 3TTDA 3OJUA 1TYQB 5HRNA 2P9SB 1QZ6A 3PX6A 5F1XA 4JI4K 3CPWM 4WE1A 4M3ZA 2UUCK 3NAEA 1WSEA 3O4NA 3FZKA 2YHAA 3CCEN 4O55A 1MU2A 1VQLN 3E1YA 3HVRA 4DQPA 3NH0A 5CR4A 4WQ5A 3GDQA 3LWLA 1NK7A 3CG7A 1OH8A 4QCLA 3CCRN 1XQSC 3LDSA 5AR0A 1I39A 2ASMA 3DI6A 3EO3A 4CJWA 4DR7K 3P4IA 3QLHA 3F73A 4CI6A 3NMUA 3AAPA 4BR5A 1FKPA 4N76A 3H45C 3VA3A 4BRDA 4QOZB 4RCHA 3G4SN 3SUPA 4RW7A 4BRLA 1K8AO 4XH1A 4O5BA 3VQPA 1A5XA 1M90O 2P9NB 3VQCA 5KPTA 1E3MA 1RBTA 3C6UA 3CQ8A 1VK0A 1JLGA 4DTXA 1WSIA 4AHSA 3CFPA 1SUQA 5TKWA 5FPMA 3O3HA 1KVBA 1IJJA 1IH7A 3CC4N 2IDOA 4BE1A 3CCMN 3KD1E 4K8ZA 3DXKA 5BRFA 2VG7A 1T6CA 3HO1A 5JLFA 1N33K 4FM1A 2QKKA 1XWLA 1XMOK 2YHYA 3TI0A 2Z1IA 1Q9XA 5ADXA 4ID5A 5J2PA 4H5VA 1JLCA 3O3FA 1LAWA 4M63C 1QTMA 4CD3A 5DK5A 4KHSA 2O8CB 3MXJA 3O1BA 4ID1A 4BRIA 1HX1A 3T1AA 1X9SA 4KAZA 4BGBA 1ATRA 3I0SA 3Q7CA 3OY9A 1QHTA 4CEFA 4OPHA 1EXQA 4AF1A 4IO8A 4CBWA 3SZ2A 2XRIA 2CH6A 1XNQK 1RT1A 3AA2A 4CHZA 2UXCK 3OYHA 1TUYA 5GIOA 1RTIA 1BO5O 1N6QA 3V1QA 3NF9A 4KB1A 1C0TA 4C8MA 4YORA 4B9LA 2OA8A 3U6FA 1Y97A 4BWJA 1WSHA 4K8XA 1D4XA 4FL9A 1WSJA 1Q8IA 1RT6A 1CXUA 5DM6L 3VGMA 4F2SA 1R59O 4CD1A 4JKFA 3OYDA 4BVOA 3OVNA 4FK2A 4O4GA 2A41A 2GWKA 3VQ7A 1GLLO 4CJVA 3FE1A 4MDAA 4IBNA 2QTDA 4FJ5A 4CFCA 1G99A 1WUAA 3BF3A 3J7ZO 3E66A 5SWMA 1HUXA 5KTQA 3TAEA 3CD6N 1Z05A 3A5NC 4M7YA 3ZSOA 5BR8K 3CF5L 1KAXA 3FR0A 3MX2A 4J2BA 4CJTA 3CC2N 2Z1HA 4CK2A 5AZIA 4CHNA 2W6LA 3ULDA 2FSNA 3ZSZA 3SUOA 3OA9A 3DLHA 4I6MB 1D9DA 4DU1A 3TABA 5AQUA 3L3VA 1T03A 4FLXA 2D4WA 3CPEA 2R7YA 4H4OA 2FXUA 5T7BA 3RMDA 1KTQA 4DSFA 3P1GA 3O8MA 5SZTA 4EAHD 3ZSVA 1LCUA 4BRNA 3LDNA 1BL3A 5HOOA 3UB5A 3KWIA 2Q0RA 4AH9A 2FSJA 5AZJB 2FBVA 4WFAL 4JAXA 3WT0A 1VSFA 3M6GA 3SJHA 3OYJA 1K9MO 1SL2A 3WXLA 4ISFA 1UA0A 4CGDA 3OYBA 3VMFB 3THXA 4WQ4C 4H0YB 3S41A 3OBWA 1EO1A 4CIEA 1F21A 3NVKA 4FJNA 4DU4A 4FZZA 1JCEA 3BDPA 4Y1CA 3O9UA 3THYA 2D0PA 5I3UA 1U45A 4QS8A 5IT9O 2HHVA 3ZSQA 3NBPA 3MCAB 4Z4CA 2A40A 3DLGA 1B92A 1NOZA 3JSMA 2E5LK 4C1NK 2CH5A 3G0ZA 1DTTA 1RT3A 4FWMA 3I55N 1NKCA 2Q31A 3AY9A 4HHTA 4Q0BA 4CGFA 3T7ZA 3RRHA 2FBYA 3VQ8A 4B1WB 3V9UA 3OYFA 1SAZA 1Z26A 3HBTA 3WNEA 1U2VA 3RTVA 4LFAK 4B9SA 2O8BA 2FBTA 3KTQA 1O13A 3CJBA 3SPYA 3I56N 4JS4A 4B9UA 3KK1A 3K2PA 1CZAN 4DLGA 3AARA 4N5SA 2P9PA 3P31A 2HHUA 1TAUA 4KH5A 1KCFA 4CHQA 2PBDA 4DUYK 3R8EA 2WUSA 4DV2K 5C2FA 4RW6A 2P9UB 4I7FA 2V52B 4IZ9A 1HNXK 2QWRA 3HPOA 3KLHA 4IEEA 2QWPA 1A5WA 4W5NA 3F2KA 3KHYA 1BI4B 1E4FT 4KHPK 3VN5A 1QE1A 5AQVA 1NGHA 1NGIA 5M1KA 1N36K 4BY9C 1T8EA 4KTWA 2ZE2A 1WB9A 2BH1A 3H6EA 3L4IA 2RPIA 2E1YA 4AM6A 5J2NA 1X3NA 4FLUA 2QEXN 1C1BA 5KQ8A 1YI2N 3HP9A 1VSMA 2G8HA 3MN6A 1VRUA 1TUUA 1NGGA 4RG8A 5AQSA 2HHHK 4CJSA 3SAHA 2UYTA 1NK6A 4DV7K 3EZ5A 3KLIA 5AFUA 1D9FA 5FROA 2EWSA 1S6PA 4J2DA 3ZEUA 1IKWA 3AGRA 3CCVN 1K73O 4FLVA 4CGHA 1GLCG 4R79A 1OVYA 5A2QO 4LSLA 3O1WA 1HQEA 4H03B 2ZJQL 1XUPO 4M3XA 4FWPA 4LFCK 1V4TA 5FPNA 4BDZA 5BPNA 2QWMA 4FWKA 3CFOA 1RT4A 4BE0A 1QHAA 1XMQK 3ZLJA 3ZT0A 1R0AA 2YCHA 3QB0A 2P5OA 2GUPA 5ELZA 1S9GA 3TWHA 4CJLA 2HF4A 5C10A 1SZ2A 4X62K 2OANA 3LANA 4K0KK 4CEOA 3EN9A 3TARA 4CESA 3EZWA 4M45A 2KQ2A 2JGUA 1KLMA 2FF3B 3LDOA 4ELUA 1HMVA 4CZKA 4I9LA 4CEBA 3VEYA 2QWLA 4WQ4A 5J2QA 5B8HA 3VGKA 1QZ5A 4NXMK 3P39A 3TTFA 3KK2A 4KTZA 3ID8A 1HNVA 1MA9B 3WXKA 3RWUA 2E88A 1Q18A 1G15A 3QINA 4JHDB 3SBGA 4A62A 2XO7A 5EXWA 2HHQA 4HUEA 4AHCA 3ATVA 1OVQA 4CZHA 4C8KA 3EEQA 1SKSA 4RW9A 1X9MA 1ZBHA 4DS5A 1XC3A 3L2RA 5LL6Z 3JAMO 2HNZA 4PKIA 2RF2A 3LALA 5EY4A 4LF4K 1H1VA 1BHLA 4B3SK 3FLCO 2P9LA 1KC8O 3O6WA 4G9ZA 2YNFA 3O9TA 4FWLA 3VEVA 5LMUK 2IVPA 3DRRA 1HYZA 1NGJA 4OKKA 1NLVA 1X3MA 4O0IA 1T7PA 3I33A 4B1VA 3FZFA 3DLLL 2KW4A 5HP1A 4IO9L 2V7ZA 1GOBA 2X6SA 1RDCA 2WTUA 3AAQA 1HLUA 1YJNN 3N4PA 4PKGA 4KI4A 2YV0X 1W97L 5BREA 3PY8A 3ZCMA 4Z4HA 4JKCA 4NYNA 3G6EN 2A6AA 1LOTB 4YOVA 1NG9A 2XY7A 3KZBA 4EFHA 1UAXA 3V6DA 1U04A 4KI6A 4XEIA 4ELVA 1TVRA 1U6ZA 3MECA 4BC3A 1LW2A 2HB5A 4A2AA 3DXKB 4KH4A 4CZJA 3CHWA 4LFBK 5LMNK 5JVGL 3O80A 4KBOA 3PX0A 3PO5A 1BQMA 1X1PA 1UWBA 3MXMA 3S3MA 1BCOA 4DKWA 3PV8A 4NYFA 2AA4A 1NGDA 5CE3A 2J4RA 1SV5A 3D2FB 3OHRA 4MLEA 2E2PA 4J8FA 1RT7A 2WBNA 2WONA 4F8RA 4DQIA 3NF7A 2FF6A 1ILYA 5KGWA 4FW2A 3LWMA 2ZM6K 5I42A 3M5RA 3TPQA 4MLHA 4JKDA 2NRZA 4B9TA 1T44A 3M8QA 4FK4A 1NJYA 1YUWA 4CERA 2ETJA 3O9SA 3WNGA 1NWKA 4KHWA 2F8TA 4CHPA 4CGJA 4BR9A 2YX6A 3L8BA 1A5VA 4NLCA 4FZYA 3LDLA 2NRXA 3BZCA 3KVGA 3MEGA 2HF3A 5K14A 2YNHA 1K8KB 4Z4FA 4BC2A 3QESA 4DV0K 3O9QA 4M3RA 4LF7K 2E20A 3HM9A 2ATQA 4DTMA 2HBLA 3AGKA 2Q1NA 1RCHA 1D5AA 1UA1A 4E7HA 4Y1DA 4CJUA 3AVLA 2QWNA 2Q97A 4RTFD 4CGIA 1ASWA 4FLYA 5AFUH 3K58A 1EX4A 2ZGYA 4N47A 2YKNA 3IUCA 2BDPA 3B8AX 5D3GA 4DF4A 1NM1A 3U3GA 3ZT4A 2KFNA 4EP5A 2DY4A 2F9TA 3QICA 2WFBA 3Q7BA 3U9DA 1U49A 4BR4A 5AZIB 4CZEA 2XY5A 3OYAA 4RW4A 3VTIA 3NE6A 1RT2A 3ENOA 4FJ8A 3H08A 3L4QA 2V7YA 4OX9K 2IC3A 4FOIA 2Q3SA 4B3OA 2AJQA 2OZMA 3LAMA 3ALYA 3KK3A 4O8UA 2NRRA 4IDHA 1SS6A 1GOCA 4X66K 3ULEB 5AQHA 2Q36A 1Q9YA 3QEXA 2GWJA 4CECA 1YXQA 4E3SA 3THXB 5CZ2A 4OPAA 5LJVA 5DM7L 4J2EA 1TAQA 3D2EA 3SAFA 4PUOA 2OYQA 3BEXA 3THYB 4HTLA 3TTCA 3B6PA 1FW6A 4B08A 4JN4A 3VEOA 2P1JA 3IS9A 5J2MA 4CFBA 5FLXO 1U47A 4L8RB 1RTDA 1NJZA 1YHQN 5EVZA 1J53A 5M1OA 4HUFA 1OKJA 1VQMN 1VSKA 3R3LA 3G25A 3CERA 3D7EO 3VA0A 3W3DA 4E0DA 1GLFO 3DXMA 3VF6A 1XI1A 1WNSA 1YAGA 4DF8A 3U8XA 2O8DA 3GG4A 4JI7K 4ISGA 1U2VB 5AQTA 3P83D 2O8BB 3HSCA 1DT9A 3ATUA 3RMAA 1ESVA 4BRHA 2Q2RA 4U67L 3TR8A 4FVUA 4DV1K 2P9PB 2HOEA 2DFHA 3WXMB 2P9KA 4JK9A 4E7LA 1YT3A 4YOUA 3QERA 3T69A 1T6DA 3A5OC 2YHBA 1IKXA 3HOSA 3O5BA 4PKHA 2KTQA 1TGOA 4GV9A 4KFBA 3ID6A 2XY8A 1ZBSA 1L3SA 2XY6A 3AO5A 3WNFA 3SQ4A 4I9QA 3DOKA 3AO2A 3AVNA 1RDWX 2ITGA 5M1PA 3OS2A 2F7TA 2IGIA 4B3MK 2KLAA 3C7NA 3OYCA 3DMJA 3M3ZA 4IFEA 5CYQA 3LDQA 4YY3K 1ATSA 4BG9A 3ITHA 5AQWA 2ASPA 3VTHA 2IIRA 4DHYA 2ZGZA 4NCGA 3WXIA 2AP1A 4DTJA 3SBTA 5AQQA 3KKRA 2GUIA 3EKSA 3V9WA 1LAVA 4JI6K 2G8KA 5FPDA 5AQZA 2W40A 4CHOA 3A8YA 3ZEUB 3L2VA 1TYQA 4KB0A 3DYAA 3L6QA 2HHXA 1CZ9A 2GELA 4Z4GA 2G8VA 4OKEA 2IS3A 3VQ4A 3OYLA 5FRNA 4Z0UA 1MWMA 1IO2A 4UY8O 1WSGA 4OLBA 4FJHA 2D0AA 1C1CA 1NU0A 3VQEA 1J9AA 3ZETA 4OVLA 4WCEL 1KFDA 4FW1A 4A61A 4M3YA 4K25A 1NJWA 3LP3A 4DU3A 2YI1A 3K9KA 1Y64A 1BIZA 1IBKK 2ZD1A 3T1HK 2RHKA 2NLXA 4CHYA 4DSIA 4I2QA 1IG8A 5EX5A 1RBRA 1L3VA 1JL2A 3HVTA 4H8KA 3CETA 3CM6A 1N5YA 2VWKA 3R1XA 4BRAA 1KQSM 5BN8A 3J81O 3TSQA 5HROA 4HCCA 1XNRK 1RDDA 3DLEA 4YOYA 3NH2A 4JKHA 1VRTA 1WAFA 3MDQA 2P9IA 4OGEA 3U4LA 2PFUA 4B3TK 3MWPA 2A3ZA 4I2PA 1WBDA 3LZJA 4DFJA 3QBWA 1QQOA 1DTQA 5DMRA 1YTAA 1NMNA 4K43A 4YNQA 1Q7YO 5BPLA 4FWRA 3NGIA 3J80O 1KFSA 3W0LA 5JS2A 1GLEG 4DWIA 1VQ9N 3SUNA 1C1AA 1ZBIA 4ELTA 4DSKA 1O1WA 2ZWHA 5BRHA 2EX3A 1ASUA 1BA0A 1JLAA 3MN5A 4GKKK 2FLOA 2P9LB 1KVCA 3ZSWA 1DEJA 3R9PA 4YHHK 3E9LA 3VQ6A 1NGEA 4W5OA 4B1UB 5C12A 5E26A 1NGCA 4B1YB 3VQDA 3EKUA 1SKWA 3IRXA 4O5FA 1Q86O 5GAEP 2B5JA 5AQXA 1I94K 1NKBA 2F4VK 1ASVA 4IFVA 1B9FA 3AVGA 3UKRA 3CIPA 4DSEA 1P8ZA 4CBUA 1J6ZA 4LF8K 3C95A 3S3NA 3AO1A 3L0QA 5HL7L 1E4GT 3RRGA 4A59A 2PAVA 3SK3A 3HYFA 4WF9L 3RSEA 4DB3A 4B9VA 1S3XA 3KLEA 1JKHA 3VQ9A 3AVKA 3N4QA 3MCPA 5LJWA 1W0HA 2FSKA 3HPHA 1NK5A 3AO3A 3D45A 4BG8A 4FCYA 3H3OB 3CMAN 4IEIA 5KGXA 3LPUA 1VQON 1HKGA 4R5PA 3KLFA 3DLBA 3OBYA 3ZX0A 5ADXH 1VSJA 4C8LA 2NNWA 3K9JA 1IG9A 4BDYA 1S6QA 1HRHA 4K42A 4ZTJA 3TU5A 3QEPA 3CYMA 3KD5E 2BGGA 4LY7A 3E9PA 3SLCA 2ITMA 5AQGA 1B9DA 3QFUA 3ZYYX 1YJWN 4FYDA 3E9OA 2GBZA 1S1XA 2G8FA 1BQNA 4CJFA 1NBWA 1TKTA 1VQNN 1JJ2M 3C0BA 1RNHA 3BZKA 3ZT1A 4IOCL 3CJAA 4FJMA 3FGUA 4CZFA 3F9MA 2QW9A 1GLBG 1X9WA 1IBMK 3PUFA 4NCBA 4EHTA 3CXCM 1BGXT 3GOIA 4JKGA 1NK0A 3VF2A 3V9SA 1ATNA 1FKOA 4J2AA 5JLHA 2W42A 2XHBA 4FM0A 1NKEA 4HUGA 2B4JA 4JK8A 3RMCA 1HPZA 2OCEA 2Y1JA 3JYTA 3OTOK 4BACA 3SQ1A 3KKSA 5AQOA 3C6TA 3ZSRA 5KQDA 1S22A 4BRPA 4B3RK 1Z6RA 4GV6A 5CZ1A 2E2NA 2OPSA 1KXPA 1WLJA 4DV3K 2B6AA 3TAGA 3T19A 2LSNA 4FXDA 4MO5A 5AQJA 4FVMA 3VQBA 4C8NA 2ASOA 2A42A 1YITN 4BRKA 5KI6A 4M42A 3HM8A 3L3UA 3H3NO 3A5LC 4JI3K 4AILC 5FRMA 4O44A 3HOTA 4WQ5C 4JD2A 3WEEA 3CJ1A 4IKFA 1JLBA 2VQEK 1NGAA 1KAYA 4FK0A 4Z94A 5HRSA 3EE8A 3T1YK 2A5XA 2NRWA 2QXLA 5MLCQ 4MFBA 4FM2A 3LM2A 4HVJA 1VSEA 1IV0A 1RBSA 4GW6A 1EWRA 1Q81O 5AQIA 5HRRA 1QSSA 1ZXOA 2W41A 4CVNE 3DRPA 3MXIA 1QVFM 1S1VA 4CZGA 4W5RA 4BDPA 2FC0A 2OPQA 4FLWA 3D2EB 4PL7A 4WFBL 2HNDA 2BE2A 1TL1A 4BR0A 1GLJO 1MWKA 5BRDA 2D5RA 3IAYA 3F9KA 4CEZA 3EE9A 4FWOA 3J7AP 1VQPN 1HNIA 1K6YA 3QIPA 4HTUA 4DFPA 3AVIA 1BWFO 5BN9A 3VERA 5AQPA 4DS4A 3FZLA 5M1FA 4BE2A 3PO4A 2QK9A 2RN2A 3DXMB 3K0SA 3GL1A 4N56A 4FPBA 5CYMA 3AO4A 1S1WA 2QXFA 4ISEA 1QQNA 5AJ3K 4FJ9A 3M8PA 4KHQA 4C8OA 1JL1A 3LAKA 1X9JA 4W5TA 1S5JA 3ISNC 1LWFA 4W5QA 1Z25A 3D0PA 4E89A 3THVA 1LV5A 4CIGA 4KTQA 3SMSA 2D0BA 3OYKA 4DQSA 1NJXA 1VSLA 4CJ7A 4M7XA 3V1OA 4F9OA 5TKYA 4IG3A 1RT5A 3FZHA 3LP1A 4CF1A 1DGKN 3O08A 3S3OA 4JNEA 3AVHA 2UUAK 3VETA 3H1QA 1NK4A 1I3AA 1JXEA 4DV4K 3OW2M 2G8UA 3ASMA 1HR0K 2VGNA 2UXBK 4JI1K 3AVMA 3KLGA 3AVBA 3UE5A 4DV5K 4NO7A 3C7NB 4YOWA 2VCPA 3L2WA 3A2FA 5M1NA 3K57A 3ZSXA 3K5NA 2PZSA 2HHWA 3NF8A 4JI5K 2NRVA 4E7IA 4HCBA 3SAGA 1ZBFA 1HYSA 4BREA 1ITGA 5I9EB 5FDLA 1RFQA 1C6VA 1NK8A 1U48A 1NGFA 2KHOA 4NLBA 3CJ7A 4JHDA 3QEVA 3CJCA 3M1FA 1XHZA 3UKUA 1EETA 4CZMA 4BQLA 4H5WA 4V19S 4DQ8A 1T05A 4L3QA 1BU6O 3IG1A 3C94A 4GMJB 2E1ZA 4H0OA 1SL0A 5C0YA 4DCHA 2ZJPL 1TKZA 3AVAA 4CJPA 3MK6A 4LF6K 3OJSA 4DQQA 3QFPA 2ZQBA 2X78A 4JEPA 2E6LA 4JV5K 4H0PA 2V51B 4F2RA 4JRPA 2H3GX 2GEMA 4BC5A 3ZETB 1S1TA 1VHXA 2X6NA 1P90A 3P5JA 1VQ4N 3BF1A 3P38A 3SNNA 3C6AA 1FK9A 2UU9K 1BUPA 4DQRA 3AA4A 4XIUA 3F5TA 4B9MA 4BRQA 1KAZA 3VOVA 4A2BA 1J5EK 3TSPA 4UQGA 3OS0A 2QM1A 4CGGA 3V1RA 4RW8A 2IVOA 3D6RA 2YNGA 5AQRA 1MDUB 2G8IA 4KRFA 3RMBA 4CEDA 3OYNA 4CK3A 4DLEA 2O4IA 4EP4A 2UXDK 2F8SA 4PQUA 4DR5K 3WXJA 5JICA 4JKBA 3VQQA 4GNIA 3WNHA 3CQXA 1GOAA 3THWA 3QEIA 4YOXA 2O8EA 3CCLN 3M8RA 4GKJK 3NH1A 3DWLA 4ZHRA 5HLFA 1L3UA 4CJQA 3GBTA 2CGJA 2E2QA 2VQFK 4KHYA 2P9IB 2HBMA 4K41A 3SPZA 1BG3A 4A5BA 3VF4A 2HW3A 5BR9A 3SUQA 4OGCA 4FWNA 4CEAA 4GY2B 2X74A 3PSIA 1VQ6N 4IJNA 2YKMA 3NFAA 1BOTO 2E2OA 4B8CA 4M41A 3ZSYA 1NNEA 4AHVA 4XH5A 3EL2A 3ENBA 2BUPA 2O8FA 4FJGA 2A1SA 3CCQN 2GV9A 3D2FA 4CJ4A 1DLOA 5M1QA 3NF6A 4QS7A 4YOTA 2RKIA 3B6OA 3AA3A 3CMEN 1D8YA 3MEDA 4E1JA 2KFZA 4DR4K 2GTDA 3DOLA 4B9NA 5FPEA 1J54A 1ZBLA 4LF9K 1TK5A 3O4QA 3VGLA 3CCUN 1HNWK 4CZLA 1C0UA 3VENA 4YFUA 2DPNA 4X65K 3LZIA 2YHWA 4JKAA 1QSYA 3KK7A 2QA4N 4FJLA 4DMNA 4YDUC 4BGAA 3CI5A 3FFKB 4E19A 3SV4A 4DR6K 3CM5A 3UKRB 2HVIA 1U4BA 3HJFA 4OO1J 4DR3K 3G10A 2HHSA 1K8KA 4FLTA 4DR1K 4Z4IA 3IMXA 1TK8A 4CJKA 5C24A 3LM9A 3C6HA 2D0CA 1SL1A 1WSFA 4NCAA 3SJJA 1RTHA 3RSEB 4N41A 3BUZB 1XHXA 1NK9A 4AM7A 1XC9A 4KHUA 2HVHA 3WQTA 4PWDA 2BTFA 3L2QA 2P9SA 1ZC6A 1KSPA 2W6KA 3IDHA 4KHNA 2PYLA 2OZSA 1JXBA 2VG5A 4PL8A 1HJOA 4IOAL 5AQYA 3E01A 3DJCA 1M1KO 4F3TA 3H46O 2Y1IA 3OYIA 4KPYA 5GINA 4BC4A 1RILA 2O4GA 3DAWA 4WYBA 4E1NA 2QWOA 5GAGP 4IWVA 1QVGM 4AHUA 1QQMA 2E6MA 3BGRA 1RDAA 2KKZA 3ZT2A 1KRPA 3KWGA 4DV6K 2VG6A 3M8SA 1RTJA 4RWTA 5KRTA 4MDBA 1BA1A 1T3VA 1YVUA 4CEEA 2P9NA 1ZBUA 1TKDA 1RDUA 1HQUA 1WBBA 3DLRA 2F9WA 4BRFA 3SQ2A 3ULEA 4JKGB 1IKVA 1DKGD 4EZ9A 4M3UA 4CF8A 3AA5X 2BANA 2YJFA 4WFNL 5HRPA 4Y0WA 4CJ5A 4CFDA 1EKEA 4G1QA 4ILHA 3PLAA 4OPJA 4MO4A 3QNOA 1KD1O 1JCFA 2CGLA 4AHTA 1KLNA 3SQ0A 2FBXA 4KKOA 1JLFA 1NMDA 2GX9A 1EQYA 1J5OA 1CXQA 3SV3A 4CBXA 4KV8A 3JXUA 4FJJA 2JLEA 3KIOA 4Q5VA 1IBLK 4DG1A 1WOQA 3ZX2A 4PHTX 4DUZK 4CEQA 3WUHA 4JRQA 2O8CA 5KRSA 3IFRA 2WC9A 5E41A 3QNNA 1OH5A 1VQ8N 3V9ZA 3K5LA 2G8WA 4TSXA 1GLDG 3HI0A 1VQ7N 4ILJA 2IVNA 4GVMA 3IKMA 3CFRA 1YVNA 4JYAK 3I8BA 3MN7A 4IJAA 4JD2B 3WEEB 3QETA 3ZX3A 5AQKA 4LF5K 1OH6A 1C0GA 1SKRA 3L2UA 4DTSA 1QSLA 5BPMA 4CZIA 3MWTA 3RR7A 1KVAA 4EZ6A 4YDUA 4CIFA 3U9ZA 3HL8A 4O8KA 4CF9A 3AVJA 3V9XA 4NXNK 4C23A 4NB4A 1LW0A 1VQKN 1IKYA 1BISA 1UOCA 4OJRA 4A5AA 5HBMA 4F4KA 3PSFA 3I8DA 1FXXA 1YJ9N 2NUBA 4Z4EA 4LH5A 3VEWA 4GV3A 2OTLN 2HHTA 2IOCA 4E1MA 3PIOL 2A1RA 2QWQA 3AVCA 3ENHA 1BCMA 3VQ5A 3O9RA 4LSNA 3VESA 1RDBA 4BR7A 4H5NA 4H0XB 3GE1A 3CC7N 4AQYK 3NHGA 3O3GA 1N32K 1BDGA 2ZJRL 1V4SA 2DFFA 3RR8A 3BP8A 3UIQA 1GLAG 3J8AA 3NGYA 3DRSA 3I0RA 4LH4A 5IWAK 4CW7B 1HYVA 1RBVA 4I6MA 3V4IA 3C65A 2D1KA 2OTJN 4IG0A 2I7NA 1VSHA 5JS1A 3CQYA 1W9HA 4M3TA 2HMPA 3SYZA 1HKCA 3QDKA 4JS5A 3QO9A 3FFIA 1N8RO 2QKBA 1EP4A 2VWJA 1RBUA 5KPZA 4OLAA 4A57A 3A0IX 2Z1GA 5AZJA 1NJIO 4BRGA 1TKXA 3OYGA 3BY5A 5F2RA 4OPKA 4FLZA 4DTNA 1LWCA 1HJRA 4FJXA 2OPRA 4X64K 5CHIA 3QEWA 1YIJN 1TV6A 4HWIA 1OH7A 3RVCA 4FJIA 3SCXA 5GADP 1BIUA 4DTPA 1REVA 5C15A 2YNIA 3AV9A 1CLQA 4IXCA 3HXMA 4JI0K 1JCGA 2KZZA 4CE9A 2NRTA 4GVEA 1JLEA 3PIPL 3A5MC 1YTUA 1ZYQA 4BROA 1NOYA 5LY3A 3DM2A 3H1VX 3UKUB 5AQNA 4BRMA 3J7YP 4JKEA 1SQKA 4CF0A 3OYEA 2P51A 3MMVA 1W2BM 4FWSA 3OS1A 4B1XB 4XH4A 1LWEA 1S1UA 1CZBA 3HRGA 3EY1A 4CJEA 3U3YA 4JLHA 1C0FA 3TSUA 3HSTB 2YJEA 1NGBA 4CFAA 5J1EA 2F96A 3HZ6A 3K5OA 4ZTFA 4CF2A 2JWKA 1S72N 3QIOA 2HBKA 3G71N 3HK2A 3LL3A 5KPRA 3HT3A 3V81A 4FPAA 4KO0A 2VYPA 1Q82O 2P9UA 5C42A 3WQUA 3LP2A 3VEZA 4CJ3A 3QMLA 2VGMA 4EIAA 2NZTA 3VQAA 5AQLA 4CCHA 2VWBA 4KREA 1BI4A 3LDPA 4IOXA 4LC9B 3PX4A 1WAJA 4U7BA 4H5RA 2OPPA 4DTRA 4H4MA 2DTUA 1VSIA 4F3OA 4JI2K 2HSTA 4FO0A 5GIPA 3SI6A 5E84A 1QS4A 5CY4A 4QAGA 1EWQA 5JMVA 5C2DA 3LPTA 4BR2A 3TANA 2DFEA 1L3TA 3QBXA 2EHGA 4PA1A 3THWB 3TAPA 1VQ5N 2O8EB 3MAQA 2KZMA 1HKBA 4C1NI 4O0JA 3K5MA 3T3FA 3VPZA 1W7AA 4OKJA 1JLQA 2PY5A 2HNYA 3HPGA 1RGIA 2WOMA 5AQMA 4LD0A 3OYMA 3KJVA 4DFMA 4FJKA 4AHRA 3HP6A 3EYZA 2HMIA 4PY5A 2ZF5O 5H1SQ 3MX5A 4BQZA 1VSDA 4DTOA 4B1ZA 4JK7A 2O8DB 1S9EA 2RE2A 2CGKA 4H0TB 4B9QA 2O8FB 3CCSN 4DSJA 3NDKA 2E8AA 4FZXC 4FWQA 2Z1JA 3S9HA 1HNZK 4CJRA 5JVHL 2P9KB 2YHXA 2E4LA 3ZT3A 3HTVA 2JWLA 3CJ9A 3TAMA 1TL3A 5F0XA 3NCIA 3TAFA 2P5GA 3LP0A 4H0VB 4E7JA 3NVMA 4DTUA 2QI2A 4IDKA 1WN7A 4DFKA 2HBJA 5EOYA 2PYJA 1QQCA 3DLKA 3NGZA 4CK1A 2UUBK 4MQ3A 2D0OA 3AVFA 4EHUA 4FJ7A 3R6MA 5C25A 3VEXA 4DR2K 2I7PA 3K59A 4BRCA 4FOEA 4B8AB 4IFYA 4BVPA 1C0MA 3FZMA 1FJGK 1HPMA 4FSVA 2Q0UA 4JI8K 3TAQA 4H5TA 4QS9A 1TK0A 5GAHP 4BWMA 2IAJA
chains in the Genus database with same CATH topology
4JI6K 2ZM6K 4LF6K 4GKKK 4X65K 4AQYK 1N32K 1IBMK 3J7AP 4JV5K 4YHHK 5IWAK 5LL6Z 4CW7B 4JI2K 4DR6K 1N34K 2HHHK 3JAMO 4DR3K 4DV7K 2UU9K 4LF4K 1IBLK 4B3SK 4DR1K 5LMUK 4JI4K 1J5EK 5AJ3K 3OTOK 1XNQK 5FLXO 4DUZK 2UUCK 1I94K 2UXCK 5A2QO 2F4VK 4DV0K 5IT9O 4B3RK 4LF8K 4LF7K 2UXDK 4LFCK 1IBKK 4DV3K 4DR5K 3T1HK 4JYAK 4JI7K 4X64K 4LF5K 2E5LK 4DR7K 4GKJK 2VQFK 1XMQK 2UUAK 4DV1K 4JI3K 4DV4K 4JI0K 3J81O 1HR0K 4X62K 2UXBK 4JI1K 2VQEK 1XNRK 1HNZK 4K0KK 4LFAK 4DV5K 3T1YK 4NXNK 3J7YP 4LFBK 5LMNK 4JI5K 4DV6K 5BR8K 4B3TK 4DUYK 4DV2K 4NXMK 2UUBK 4B3MK 1HNXK 4CVNE 4DR2K 4YY3K 4OX9K 3J80O 4KHPK 4DR4K 4V19S 1N36K 1FJGK 4LF9K 1N33K 4JI8K 1XMOK 4X66K 1HNWK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 K;  2ZM6 K;  4LF6 K;  4GKK K;  4X65 K;  4AQY K;  1N32 K;  1IBM K;  3J7A P;  4JV5 K;  4YHH K;  5IWA K;  5LL6 Z;  4CW7 B;  4JI2 K;  4DR6 K;  1N34 K;  2HHH K;  3JAM O;  4DR3 K;  4DV7 K;  2UU9 K;  4LF4 K;  1IBL K;  4B3S K;  4DR1 K;  5LMU K;  4JI4 K;  1J5E K;  5AJ3 K;  3OTO K;  1XNQ K;  5FLX O;  4DUZ K;  2UUC K;  1I94 K;  2UXC K;  5A2Q O;  2F4V K;  4DV0 K;  5IT9 O;  4B3R K;  4LF8 K;  4LF7 K;  2UXD K;  4LFC K;  1IBK K;  4DV3 K;  4DR5 K;  3T1H K;  4JYA K;  4JI7 K;  4X64 K;  4LF5 K;  2E5L K;  4DR7 K;  4GKJ K;  2VQF K;  1XMQ K;  2UUA K;  4DV1 K;  4JI3 K;  4DV4 K;  4JI0 K;  3J81 O;  1HR0 K;  4X62 K;  2UXB K;  4JI1 K;  2VQE K;  1XNR K;  1HNZ K;  4K0K K;  4LFA K;  4DV5 K;  3T1Y K;  4NXN K;  3J7Y P;  4LFB K;  5LMN K;  4JI5 K;  4DV6 K;  5BR8 K;  4B3T K;  4DUY K;  4DV2 K;  4NXM K;  2UUB K;  4B3M K;  1HNX K;  4CVN E;  4DR2 K;  4YY3 K;  4OX9 K;  3J80 O;  4KHP K;  4DR4 K;  4V19 S;  1N36 K;  1FJG K;  4LF9 K;  1N33 K;  4JI8 K;  1XMO K;  4X66 K;  1HNW K; 
#chains in the Genus database with same CATH topology
 4E7K A;  4ILG B;  1L5U A;  4ICL A;  1VAZ A;  3O4W A;  1YF5 L;  2NRH A;  5AQF A;  4KH6 A;  3CCJ N;  4M3W A;  3MEE A;  4DSL A;  5EU7 A;  3SMP A;  3JS6 A;  1N34 K;  2I5J A;  3MN9 A;  3TTD A;  3OJU A;  1TYQ B;  5HRN A;  2P9S B;  1QZ6 A;  3PX6 A;  5F1X A;  4JI4 K;  3CPW M;  4WE1 A;  4M3Z A;  2UUC K;  3NAE A;  1WSE A;  3O4N A;  3FZK A;  2YHA A;  3CCE N;  4O55 A;  1MU2 A;  1VQL N;  3E1Y A;  3HVR A;  4DQP A;  3NH0 A;  5CR4 A;  4WQ5 A;  3GDQ A;  3LWL A;  1NK7 A;  3CG7 A;  1OH8 A;  4QCL A;  3CCR N;  1XQS C;  3LDS A;  5AR0 A;  1I39 A;  2ASM A;  3DI6 A;  3EO3 A;  4CJW A;  4DR7 K;  3P4I A;  3QLH A;  3F73 A;  4CI6 A;  3NMU A;  3AAP A;  4BR5 A;  1FKP A;  4N76 A;  3H45 C;  3VA3 A;  4BRD A;  4QOZ B;  4RCH A;  3G4S N;  3SUP A;  4RW7 A;  4BRL A;  1K8A O;  4XH1 A;  4O5B A;  3VQP A;  1A5X A;  1M90 O;  2P9N B;  3VQC A;  5KPT A;  1E3M A;  1RBT A;  3C6U A;  3CQ8 A;  1VK0 A;  1JLG A;  4DTX A;  1WSI A;  4AHS A;  3CFP A;  1SUQ A;  5TKW A;  5FPM A;  3O3H A;  1KVB A;  1IJJ A;  1IH7 A;  3CC4 N;  2IDO A;  4BE1 A;  3CCM N;  3KD1 E;  4K8Z A;  3DXK A;  5BRF A;  2VG7 A;  1T6C A;  3HO1 A;  5JLF A;  1N33 K;  4FM1 A;  2QKK A;  1XWL A;  1XMO K;  2YHY A;  3TI0 A;  2Z1I A;  1Q9X A;  5ADX A;  4ID5 A;  5J2P A;  4H5V A;  1JLC A;  3O3F A;  1LAW A;  4M63 C;  1QTM A;  4CD3 A;  5DK5 A;  4KHS A;  2O8C B;  3MXJ A;  3O1B A;  4ID1 A;  4BRI A;  1HX1 A;  3T1A A;  1X9S A;  4KAZ A;  4BGB A;  1ATR A;  3I0S A;  3Q7C A;  3OY9 A;  1QHT A;  4CEF A;  4OPH A;  1EXQ A;  4AF1 A;  4IO8 A;  4CBW A;  3SZ2 A;  2XRI A;  2CH6 A;  1XNQ K;  1RT1 A;  3AA2 A;  4CHZ A;  2UXC K;  3OYH A;  1TUY A;  5GIO A;  1RTI A;  1BO5 O;  1N6Q A;  3V1Q A;  3NF9 A;  4KB1 A;  1C0T A;  4C8M A;  4YOR A;  4B9L A;  2OA8 A;  3U6F A;  1Y97 A;  4BWJ A;  1WSH A;  4K8X A;  1D4X A;  4FL9 A;  1WSJ A;  1Q8I A;  1RT6 A;  1CXU A;  5DM6 L;  3VGM A;  4F2S A;  1R59 O;  4CD1 A;  4JKF A;  3OYD A;  4BVO A;  3OVN A;  4FK2 A;  4O4G A;  2A41 A;  2GWK A;  3VQ7 A;  1GLL O;  4CJV A;  3FE1 A;  4MDA A;  4IBN A;  2QTD A;  4FJ5 A;  4CFC A;  1G99 A;  1WUA A;  3BF3 A;  3J7Z O;  3E66 A;  5SWM A;  1HUX A;  5KTQ A;  3TAE A;  3CD6 N;  1Z05 A;  3A5N C;  4M7Y A;  3ZSO A;  5BR8 K;  3CF5 L;  1KAX A;  3FR0 A;  3MX2 A;  4J2B A;  4CJT A;  3CC2 N;  2Z1H A;  4CK2 A;  5AZI A;  4CHN A;  2W6L A;  3ULD A;  2FSN A;  3ZSZ A;  3SUO A;  3OA9 A;  3DLH A;  4I6M B;  1D9D A;  4DU1 A;  3TAB A;  5AQU A;  3L3V A;  1T03 A;  4FLX A;  2D4W A;  3CPE A;  2R7Y A;  4H4O A;  2FXU A;  5T7B A;  3RMD A;  1KTQ A;  4DSF A;  3P1G A;  3O8M A;  5SZT A;  4EAH D;  3ZSV A;  1LCU A;  4BRN A;  3LDN A;  1BL3 A;  5HOO A;  3UB5 A;  3KWI A;  2Q0R A;  4AH9 A;  2FSJ A;  5AZJ B;  2FBV A;  4WFA L;  4JAX A;  3WT0 A;  1VSF A;  3M6G A;  3SJH A;  3OYJ A;  1K9M O;  1SL2 A;  3WXL A;  4ISF A;  1UA0 A;  4CGD A;  3OYB A;  3VMF B;  3THX A;  4WQ4 C;  4H0Y B;  3S41 A;  3OBW A;  1EO1 A;  4CIE A;  1F21 A;  3NVK A;  4FJN A;  4DU4 A;  4FZZ A;  1JCE A;  3BDP A;  4Y1C A;  3O9U A;  3THY A;  2D0P A;  5I3U A;  1U45 A;  4QS8 A;  5IT9 O;  2HHV A;  3ZSQ A;  3NBP A;  3MCA B;  4Z4C A;  2A40 A;  3DLG A;  1B92 A;  1NOZ A;  3JSM A;  2E5L K;  4C1N K;  2CH5 A;  3G0Z A;  1DTT A;  1RT3 A;  4FWM A;  3I55 N;  1NKC A;  2Q31 A;  3AY9 A;  4HHT A;  4Q0B A;  4CGF A;  3T7Z A;  3RRH A;  2FBY A;  3VQ8 A;  4B1W B;  3V9U A;  3OYF A;  1SAZ A;  1Z26 A;  3HBT A;  3WNE A;  1U2V A;  3RTV A;  4LFA K;  4B9S A;  2O8B A;  2FBT A;  3KTQ A;  1O13 A;  3CJB A;  3SPY A;  3I56 N;  4JS4 A;  4B9U A;  3KK1 A;  3K2P A;  1CZA N;  4DLG A;  3AAR A;  4N5S A;  2P9P A;  3P31 A;  2HHU A;  1TAU A;  4KH5 A;  1KCF A;  4CHQ A;  2PBD A;  4DUY K;  3R8E A;  2WUS A;  4DV2 K;  5C2F A;  4RW6 A;  2P9U B;  4I7F A;  2V52 B;  4IZ9 A;  1HNX K;  2QWR A;  3HPO A;  3KLH A;  4IEE A;  2QWP A;  1A5W A;  4W5N A;  3F2K A;  3KHY A;  1BI4 B;  1E4F T;  4KHP K;  3VN5 A;  1QE1 A;  5AQV A;  1NGH A;  1NGI A;  5M1K A;  1N36 K;  4BY9 C;  1T8E A;  4KTW A;  2ZE2 A;  1WB9 A;  2BH1 A;  3H6E A;  3L4I A;  2RPI A;  2E1Y A;  4AM6 A;  5J2N A;  1X3N A;  4FLU A;  2QEX N;  1C1B A;  5KQ8 A;  1YI2 N;  3HP9 A;  1VSM A;  2G8H A;  3MN6 A;  1VRU A;  1TUU A;  1NGG A;  4RG8 A;  5AQS A;  2HHH K;  4CJS A;  3SAH A;  2UYT A;  1NK6 A;  4DV7 K;  3EZ5 A;  3KLI A;  5AFU A;  1D9F A;  5FRO A;  2EWS A;  1S6P A;  4J2D A;  3ZEU A;  1IKW A;  3AGR A;  3CCV N;  1K73 O;  4FLV A;  4CGH A;  1GLC G;  4R79 A;  1OVY A;  5A2Q O;  4LSL A;  3O1W A;  1HQE A;  4H03 B;  2ZJQ L;  1XUP O;  4M3X A;  4FWP A;  4LFC K;  1V4T A;  5FPN A;  4BDZ A;  5BPN A;  2QWM A;  4FWK A;  3CFO A;  1RT4 A;  4BE0 A;  1QHA A;  1XMQ K;  3ZLJ A;  3ZT0 A;  1R0A A;  2YCH A;  3QB0 A;  2P5O A;  2GUP A;  5ELZ A;  1S9G A;  3TWH A;  4CJL A;  2HF4 A;  5C10 A;  1SZ2 A;  4X62 K;  2OAN A;  3LAN A;  4K0K K;  4CEO A;  3EN9 A;  3TAR A;  4CES A;  3EZW A;  4M45 A;  2KQ2 A;  2JGU A;  1KLM A;  2FF3 B;  3LDO A;  4ELU A;  1HMV A;  4CZK A;  4I9L A;  4CEB A;  3VEY A;  2QWL A;  4WQ4 A;  5J2Q A;  5B8H A;  3VGK A;  1QZ5 A;  4NXM K;  3P39 A;  3TTF A;  3KK2 A;  4KTZ A;  3ID8 A;  1HNV A;  1MA9 B;  3WXK A;  3RWU A;  2E88 A;  1Q18 A;  1G15 A;  3QIN A;  4JHD B;  3SBG A;  4A62 A;  2XO7 A;  5EXW A;  2HHQ A;  4HUE A;  4AHC A;  3ATV A;  1OVQ A;  4CZH A;  4C8K A;  3EEQ A;  1SKS A;  4RW9 A;  1X9M A;  1ZBH A;  4DS5 A;  1XC3 A;  3L2R A;  5LL6 Z;  3JAM O;  2HNZ A;  4PKI A;  2RF2 A;  3LAL A;  5EY4 A;  4LF4 K;  1H1V A;  1BHL A;  4B3S K;  3FLC O;  2P9L A;  1KC8 O;  3O6W A;  4G9Z A;  2YNF A;  3O9T A;  4FWL A;  3VEV A;  5LMU K;  2IVP A;  3DRR A;  1HYZ A;  1NGJ A;  4OKK A;  1NLV A;  1X3M A;  4O0I A;  1T7P A;  3I33 A;  4B1V A;  3FZF A;  3DLL L;  2KW4 A;  5HP1 A;  4IO9 L;  2V7Z A;  1GOB A;  2X6S A;  1RDC A;  2WTU A;  3AAQ A;  1HLU A;  1YJN N;  3N4P A;  4PKG A;  4KI4 A;  2YV0 X;  1W97 L;  5BRE A;  3PY8 A;  3ZCM A;  4Z4H A;  4JKC A;  4NYN A;  3G6E N;  2A6A A;  1LOT B;  4YOV A;  1NG9 A;  2XY7 A;  3KZB A;  4EFH A;  1UAX A;  3V6D A;  1U04 A;  4KI6 A;  4XEI A;  4ELV A;  1TVR A;  1U6Z A;  3MEC A;  4BC3 A;  1LW2 A;  2HB5 A;  4A2A A;  3DXK B;  4KH4 A;  4CZJ A;  3CHW A;  4LFB K;  5LMN K;  5JVG L;  3O80 A;  4KBO A;  3PX0 A;  3PO5 A;  1BQM A;  1X1P A;  1UWB A;  3MXM A;  3S3M A;  1BCO A;  4DKW A;  3PV8 A;  4NYF A;  2AA4 A;  1NGD A;  5CE3 A;  2J4R A;  1SV5 A;  3D2F B;  3OHR A;  4MLE A;  2E2P A;  4J8F A;  1RT7 A;  2WBN A;  2WON A;  4F8R A;  4DQI A;  3NF7 A;  2FF6 A;  1ILY A;  5KGW A;  4FW2 A;  3LWM A;  2ZM6 K;  5I42 A;  3M5R A;  3TPQ A;  4MLH A;  4JKD A;  2NRZ A;  4B9T A;  1T44 A;  3M8Q A;  4FK4 A;  1NJY A;  1YUW A;  4CER A;  2ETJ A;  3O9S A;  3WNG A;  1NWK A;  4KHW A;  2F8T A;  4CHP A;  4CGJ A;  4BR9 A;  2YX6 A;  3L8B A;  1A5V A;  4NLC A;  4FZY A;  3LDL A;  2NRX A;  3BZC A;  3KVG A;  3MEG A;  2HF3 A;  5K14 A;  2YNH A;  1K8K B;  4Z4F A;  4BC2 A;  3QES A;  4DV0 K;  3O9Q A;  4M3R A;  4LF7 K;  2E20 A;  3HM9 A;  2ATQ A;  4DTM A;  2HBL A;  3AGK A;  2Q1N A;  1RCH A;  1D5A A;  1UA1 A;  4E7H A;  4Y1D A;  4CJU A;  3AVL A;  2QWN A;  2Q97 A;  4RTF D;  4CGI A;  1ASW A;  4FLY A;  5AFU H;  3K58 A;  1EX4 A;  2ZGY A;  4N47 A;  2YKN A;  3IUC A;  2BDP A;  3B8A X;  5D3G A;  4DF4 A;  1NM1 A;  3U3G A;  3ZT4 A;  2KFN A;  4EP5 A;  2DY4 A;  2F9T A;  3QIC A;  2WFB A;  3Q7B A;  3U9D A;  1U49 A;  4BR4 A;  5AZI B;  4CZE A;  2XY5 A;  3OYA A;  4RW4 A;  3VTI A;  3NE6 A;  1RT2 A;  3ENO A;  4FJ8 A;  3H08 A;  3L4Q A;  2V7Y A;  4OX9 K;  2IC3 A;  4FOI A;  2Q3S A;  4B3O A;  2AJQ A;  2OZM A;  3LAM A;  3ALY A;  3KK3 A;  4O8U A;  2NRR A;  4IDH A;  1SS6 A;  1GOC A;  4X66 K;  3ULE B;  5AQH A;  2Q36 A;  1Q9Y A;  3QEX A;  2GWJ A;  4CEC A;  1YXQ A;  4E3S A;  3THX B;  5CZ2 A;  4OPA A;  5LJV A;  5DM7 L;  4J2E A;  1TAQ A;  3D2E A;  3SAF A;  4PUO A;  2OYQ A;  3BEX A;  3THY B;  4HTL A;  3TTC A;  3B6P A;  1FW6 A;  4B08 A;  4JN4 A;  3VEO A;  2P1J A;  3IS9 A;  5J2M A;  4CFB A;  5FLX O;  1U47 A;  4L8R B;  1RTD A;  1NJZ A;  1YHQ N;  5EVZ A;  1J53 A;  5M1O A;  4HUF A;  1OKJ A;  1VQM N;  1VSK A;  3R3L A;  3G25 A;  3CER A;  3D7E O;  3VA0 A;  3W3D A;  4E0D A;  1GLF O;  3DXM A;  3VF6 A;  1XI1 A;  1WNS A;  1YAG A;  4DF8 A;  3U8X A;  2O8D A;  3GG4 A;  4JI7 K;  4ISG A;  1U2V B;  5AQT A;  3P83 D;  2O8B B;  3HSC A;  1DT9 A;  3ATU A;  3RMA A;  1ESV A;  4BRH A;  2Q2R A;  4U67 L;  3TR8 A;  4FVU A;  4DV1 K;  2P9P B;  2HOE A;  2DFH A;  3WXM B;  2P9K A;  4JK9 A;  4E7L A;  1YT3 A;  4YOU A;  3QER A;  3T69 A;  1T6D A;  3A5O C;  2YHB A;  1IKX A;  3HOS A;  3O5B A;  4PKH A;  2KTQ A;  1TGO A;  4GV9 A;  4KFB A;  3ID6 A;  2XY8 A;  1ZBS A;  1L3S A;  2XY6 A;  3AO5 A;  3WNF A;  3SQ4 A;  4I9Q A;  3DOK A;  3AO2 A;  3AVN A;  1RDW X;  2ITG A;  5M1P A;  3OS2 A;  2F7T A;  2IGI A;  4B3M K;  2KLA A;  3C7N A;  3OYC A;  3DMJ A;  3M3Z A;  4IFE A;  5CYQ A;  3LDQ A;  4YY3 K;  1ATS A;  4BG9 A;  3ITH A;  5AQW A;  2ASP A;  3VTH A;  2IIR A;  4DHY A;  2ZGZ A;  4NCG A;  3WXI A;  2AP1 A;  4DTJ A;  3SBT A;  5AQQ A;  3KKR A;  2GUI A;  3EKS A;  3V9W A;  1LAV A;  4JI6 K;  2G8K A;  5FPD A;  5AQZ A;  2W40 A;  4CHO A;  3A8Y A;  3ZEU B;  3L2V A;  1TYQ A;  4KB0 A;  3DYA A;  3L6Q A;  2HHX A;  1CZ9 A;  2GEL A;  4Z4G A;  2G8V A;  4OKE A;  2IS3 A;  3VQ4 A;  3OYL A;  5FRN A;  4Z0U A;  1MWM A;  1IO2 A;  4UY8 O;  1WSG A;  4OLB A;  4FJH A;  2D0A A;  1C1C A;  1NU0 A;  3VQE A;  1J9A A;  3ZET A;  4OVL A;  4WCE L;  1KFD A;  4FW1 A;  4A61 A;  4M3Y A;  4K25 A;  1NJW A;  3LP3 A;  4DU3 A;  2YI1 A;  3K9K A;  1Y64 A;  1BIZ A;  1IBK K;  2ZD1 A;  3T1H K;  2RHK A;  2NLX A;  4CHY A;  4DSI A;  4I2Q A;  1IG8 A;  5EX5 A;  1RBR A;  1L3V A;  1JL2 A;  3HVT A;  4H8K A;  3CET A;  3CM6 A;  1N5Y A;  2VWK A;  3R1X A;  4BRA A;  1KQS M;  5BN8 A;  3J81 O;  3TSQ A;  5HRO A;  4HCC A;  1XNR K;  1RDD A;  3DLE A;  4YOY A;  3NH2 A;  4JKH A;  1VRT A;  1WAF A;  3MDQ A;  2P9I A;  4OGE A;  3U4L A;  2PFU A;  4B3T K;  3MWP A;  2A3Z A;  4I2P A;  1WBD A;  3LZJ A;  4DFJ A;  3QBW A;  1QQO A;  1DTQ A;  5DMR A;  1YTA A;  1NMN A;  4K43 A;  4YNQ A;  1Q7Y O;  5BPL A;  4FWR A;  3NGI A;  3J80 O;  1KFS A;  3W0L A;  5JS2 A;  1GLE G;  4DWI A;  1VQ9 N;  3SUN A;  1C1A A;  1ZBI A;  4ELT A;  4DSK A;  1O1W A;  2ZWH A;  5BRH A;  2EX3 A;  1ASU A;  1BA0 A;  1JLA A;  3MN5 A;  4GKK K;  2FLO A;  2P9L B;  1KVC A;  3ZSW A;  1DEJ A;  3R9P A;  4YHH K;  3E9L A;  3VQ6 A;  1NGE A;  4W5O A;  4B1U B;  5C12 A;  5E26 A;  1NGC A;  4B1Y B;  3VQD A;  3EKU A;  1SKW A;  3IRX A;  4O5F A;  1Q86 O;  5GAE P;  2B5J A;  5AQX A;  1I94 K;  1NKB A;  2F4V K;  1ASV A;  4IFV A;  1B9F A;  3AVG A;  3UKR A;  3CIP A;  4DSE A;  1P8Z A;  4CBU A;  1J6Z A;  4LF8 K;  3C95 A;  3S3N A;  3AO1 A;  3L0Q A;  5HL7 L;  1E4G T;  3RRG A;  4A59 A;  2PAV A;  3SK3 A;  3HYF A;  4WF9 L;  3RSE A;  4DB3 A;  4B9V A;  1S3X A;  3KLE A;  1JKH A;  3VQ9 A;  3AVK A;  3N4Q A;  3MCP A;  5LJW A;  1W0H A;  2FSK A;  3HPH A;  1NK5 A;  3AO3 A;  3D45 A;  4BG8 A;  4FCY A;  3H3O B;  3CMA N;  4IEI A;  5KGX A;  3LPU A;  1VQO N;  1HKG A;  4R5P A;  3KLF A;  3DLB A;  3OBY A;  3ZX0 A;  5ADX H;  1VSJ A;  4C8L A;  2NNW A;  3K9J A;  1IG9 A;  4BDY A;  1S6Q A;  1HRH A;  4K42 A;  4ZTJ A;  3TU5 A;  3QEP A;  3CYM A;  3KD5 E;  2BGG A;  4LY7 A;  3E9P A;  3SLC A;  2ITM A;  5AQG A;  1B9D A;  3QFU A;  3ZYY X;  1YJW N;  4FYD A;  3E9O A;  2GBZ A;  1S1X A;  2G8F A;  1BQN A;  4CJF A;  1NBW A;  1TKT A;  1VQN N;  1JJ2 M;  3C0B A;  1RNH A;  3BZK A;  3ZT1 A;  4IOC L;  3CJA A;  4FJM A;  3FGU A;  4CZF A;  3F9M A;  2QW9 A;  1GLB G;  1X9W A;  1IBM K;  3PUF A;  4NCB A;  4EHT A;  3CXC M;  1BGX T;  3GOI A;  4JKG A;  1NK0 A;  3VF2 A;  3V9S A;  1ATN A;  1FKO A;  4J2A A;  5JLH A;  2W42 A;  2XHB A;  4FM0 A;  1NKE A;  4HUG A;  2B4J A;  4JK8 A;  3RMC A;  1HPZ A;  2OCE A;  2Y1J A;  3JYT A;  3OTO K;  4BAC A;  3SQ1 A;  3KKS A;  5AQO A;  3C6T A;  3ZSR A;  5KQD A;  1S22 A;  4BRP A;  4B3R K;  1Z6R A;  4GV6 A;  5CZ1 A;  2E2N A;  2OPS A;  1KXP A;  1WLJ A;  4DV3 K;  2B6A A;  3TAG A;  3T19 A;  2LSN A;  4FXD A;  4MO5 A;  5AQJ A;  4FVM A;  3VQB A;  4C8N A;  2ASO A;  2A42 A;  1YIT N;  4BRK A;  5KI6 A;  4M42 A;  3HM8 A;  3L3U A;  3H3N O;  3A5L C;  4JI3 K;  4AIL C;  5FRM A;  4O44 A;  3HOT A;  4WQ5 C;  4JD2 A;  3WEE A;  3CJ1 A;  4IKF A;  1JLB A;  2VQE K;  1NGA A;  1KAY A;  4FK0 A;  4Z94 A;  5HRS A;  3EE8 A;  3T1Y K;  2A5X A;  2NRW A;  2QXL A;  5MLC Q;  4MFB A;  4FM2 A;  3LM2 A;  4HVJ A;  1VSE A;  1IV0 A;  1RBS A;  4GW6 A;  1EWR A;  1Q81 O;  5AQI A;  5HRR A;  1QSS A;  1ZXO A;  2W41 A;  4CVN E;  3DRP A;  3MXI A;  1QVF M;  1S1V A;  4CZG A;  4W5R A;  4BDP A;  2FC0 A;  2OPQ A;  4FLW A;  3D2E B;  4PL7 A;  4WFB L;  2HND A;  2BE2 A;  1TL1 A;  4BR0 A;  1GLJ O;  1MWK A;  5BRD A;  2D5R A;  3IAY A;  3F9K A;  4CEZ A;  3EE9 A;  4FWO A;  3J7A P;  1VQP N;  1HNI A;  1K6Y A;  3QIP A;  4HTU A;  4DFP A;  3AVI A;  1BWF O;  5BN9 A;  3VER A;  5AQP A;  4DS4 A;  3FZL A;  5M1F A;  4BE2 A;  3PO4 A;  2QK9 A;  2RN2 A;  3DXM B;  3K0S A;  3GL1 A;  4N56 A;  4FPB A;  5CYM A;  3AO4 A;  1S1W A;  2QXF A;  4ISE A;  1QQN A;  5AJ3 K;  4FJ9 A;  3M8P A;  4KHQ A;  4C8O A;  1JL1 A;  3LAK A;  1X9J A;  4W5T A;  1S5J A;  3ISN C;  1LWF A;  4W5Q A;  1Z25 A;  3D0P A;  4E89 A;  3THV A;  1LV5 A;  4CIG A;  4KTQ A;  3SMS A;  2D0B A;  3OYK A;  4DQS A;  1NJX A;  1VSL A;  4CJ7 A;  4M7X A;  3V1O A;  4F9O A;  5TKY A;  4IG3 A;  1RT5 A;  3FZH A;  3LP1 A;  4CF1 A;  1DGK N;  3O08 A;  3S3O A;  4JNE A;  3AVH A;  2UUA K;  3VET A;  3H1Q A;  1NK4 A;  1I3A A;  1JXE A;  4DV4 K;  3OW2 M;  2G8U A;  3ASM A;  1HR0 K;  2VGN A;  2UXB K;  4JI1 K;  3AVM A;  3KLG A;  3AVB A;  3UE5 A;  4DV5 K;  4NO7 A;  3C7N B;  4YOW A;  2VCP A;  3L2W A;  3A2F A;  5M1N A;  3K57 A;  3ZSX A;  3K5N A;  2PZS A;  2HHW A;  3NF8 A;  4JI5 K;  2NRV A;  4E7I A;  4HCB A;  3SAG A;  1ZBF A;  1HYS A;  4BRE A;  1ITG A;  5I9E B;  5FDL A;  1RFQ A;  1C6V A;  1NK8 A;  1U48 A;  1NGF A;  2KHO A;  4NLB A;  3CJ7 A;  4JHD A;  3QEV A;  3CJC A;  3M1F A;  1XHZ A;  3UKU A;  1EET A;  4CZM A;  4BQL A;  4H5W A;  4V19 S;  4DQ8 A;  1T05 A;  4L3Q A;  1BU6 O;  3IG1 A;  3C94 A;  4GMJ B;  2E1Z A;  4H0O A;  1SL0 A;  5C0Y A;  4DCH A;  2ZJP L;  1TKZ A;  3AVA A;  4CJP A;  3MK6 A;  4LF6 K;  3OJS A;  4DQQ A;  3QFP A;  2ZQB A;  2X78 A;  4JEP A;  2E6L A;  4JV5 K;  4H0P A;  2V51 B;  4F2R A;  4JRP A;  2H3G X;  2GEM A;  4BC5 A;  3ZET B;  1S1T A;  1VHX A;  2X6N A;  1P90 A;  3P5J A;  1VQ4 N;  3BF1 A;  3P38 A;  3SNN A;  3C6A A;  1FK9 A;  2UU9 K;  1BUP A;  4DQR A;  3AA4 A;  4XIU A;  3F5T A;  4B9M A;  4BRQ A;  1KAZ A;  3VOV A;  4A2B A;  1J5E K;  3TSP A;  4UQG A;  3OS0 A;  2QM1 A;  4CGG A;  3V1R A;  4RW8 A;  2IVO A;  3D6R A;  2YNG A;  5AQR A;  1MDU B;  2G8I A;  4KRF A;  3RMB A;  4CED A;  3OYN A;  4CK3 A;  4DLE A;  2O4I A;  4EP4 A;  2UXD K;  2F8S A;  4PQU A;  4DR5 K;  3WXJ A;  5JIC A;  4JKB A;  3VQQ A;  4GNI A;  3WNH A;  3CQX A;  1GOA A;  3THW A;  3QEI A;  4YOX A;  2O8E A;  3CCL N;  3M8R A;  4GKJ K;  3NH1 A;  3DWL A;  4ZHR A;  5HLF A;  1L3U A;  4CJQ A;  3GBT A;  2CGJ A;  2E2Q A;  2VQF K;  4KHY A;  2P9I B;  2HBM A;  4K41 A;  3SPZ A;  1BG3 A;  4A5B A;  3VF4 A;  2HW3 A;  5BR9 A;  3SUQ A;  4OGC A;  4FWN A;  4CEA A;  4GY2 B;  2X74 A;  3PSI A;  1VQ6 N;  4IJN A;  2YKM A;  3NFA A;  1BOT O;  2E2O A;  4B8C A;  4M41 A;  3ZSY A;  1NNE A;  4AHV A;  4XH5 A;  3EL2 A;  3ENB A;  2BUP A;  2O8F A;  4FJG A;  2A1S A;  3CCQ N;  2GV9 A;  3D2F A;  4CJ4 A;  1DLO A;  5M1Q A;  3NF6 A;  4QS7 A;  4YOT A;  2RKI A;  3B6O A;  3AA3 A;  3CME N;  1D8Y A;  3MED A;  4E1J A;  2KFZ A;  4DR4 K;  2GTD A;  3DOL A;  4B9N A;  5FPE A;  1J54 A;  1ZBL A;  4LF9 K;  1TK5 A;  3O4Q A;  3VGL A;  3CCU N;  1HNW K;  4CZL A;  1C0U A;  3VEN A;  4YFU A;  2DPN A;  4X65 K;  3LZI A;  2YHW A;  4JKA A;  1QSY A;  3KK7 A;  2QA4 N;  4FJL A;  4DMN A;  4YDU C;  4BGA A;  3CI5 A;  3FFK B;  4E19 A;  3SV4 A;  4DR6 K;  3CM5 A;  3UKR B;  2HVI A;  1U4B A;  3HJF A;  4OO1 J;  4DR3 K;  3G10 A;  2HHS A;  1K8K A;  4FLT A;  4DR1 K;  4Z4I A;  3IMX A;  1TK8 A;  4CJK A;  5C24 A;  3LM9 A;  3C6H A;  2D0C A;  1SL1 A;  1WSF A;  4NCA A;  3SJJ A;  1RTH A;  3RSE B;  4N41 A;  3BUZ B;  1XHX A;  1NK9 A;  4AM7 A;  1XC9 A;  4KHU A;  2HVH A;  3WQT A;  4PWD A;  2BTF A;  3L2Q A;  2P9S A;  1ZC6 A;  1KSP A;  2W6K A;  3IDH A;  4KHN A;  2PYL A;  2OZS A;  1JXB A;  2VG5 A;  4PL8 A;  1HJO A;  4IOA L;  5AQY A;  3E01 A;  3DJC A;  1M1K O;  4F3T A;  3H46 O;  2Y1I A;  3OYI A;  4KPY A;  5GIN A;  4BC4 A;  1RIL A;  2O4G A;  3DAW A;  4WYB A;  4E1N A;  2QWO A;  5GAG P;  4IWV A;  1QVG M;  4AHU A;  1QQM A;  2E6M A;  3BGR A;  1RDA A;  2KKZ A;  3ZT2 A;  1KRP A;  3KWG A;  4DV6 K;  2VG6 A;  3M8S A;  1RTJ A;  4RWT A;  5KRT A;  4MDB A;  1BA1 A;  1T3V A;  1YVU A;  4CEE A;  2P9N A;  1ZBU A;  1TKD A;  1RDU A;  1HQU A;  1WBB A;  3DLR A;  2F9W A;  4BRF A;  3SQ2 A;  3ULE A;  4JKG B;  1IKV A;  1DKG D;  4EZ9 A;  4M3U A;  4CF8 A;  3AA5 X;  2BAN A;  2YJF A;  4WFN L;  5HRP A;  4Y0W A;  4CJ5 A;  4CFD A;  1EKE A;  4G1Q A;  4ILH A;  3PLA A;  4OPJ A;  4MO4 A;  3QNO A;  1KD1 O;  1JCF A;  2CGL A;  4AHT A;  1KLN A;  3SQ0 A;  2FBX A;  4KKO A;  1JLF A;  1NMD A;  2GX9 A;  1EQY A;  1J5O A;  1CXQ A;  3SV3 A;  4CBX A;  4KV8 A;  3JXU A;  4FJJ A;  2JLE A;  3KIO A;  4Q5V A;  1IBL K;  4DG1 A;  1WOQ A;  3ZX2 A;  4PHT X;  4DUZ K;  4CEQ A;  3WUH A;  4JRQ A;  2O8C A;  5KRS A;  3IFR A;  2WC9 A;  5E41 A;  3QNN A;  1OH5 A;  1VQ8 N;  3V9Z A;  3K5L A;  2G8W A;  4TSX A;  1GLD G;  3HI0 A;  1VQ7 N;  4ILJ A;  2IVN A;  4GVM A;  3IKM A;  3CFR A;  1YVN A;  4JYA K;  3I8B A;  3MN7 A;  4IJA A;  4JD2 B;  3WEE B;  3QET A;  3ZX3 A;  5AQK A;  4LF5 K;  1OH6 A;  1C0G A;  1SKR A;  3L2U A;  4DTS A;  1QSL A;  5BPM A;  4CZI A;  3MWT A;  3RR7 A;  1KVA A;  4EZ6 A;  4YDU A;  4CIF A;  3U9Z A;  3HL8 A;  4O8K A;  4CF9 A;  3AVJ A;  3V9X A;  4NXN K;  4C23 A;  4NB4 A;  1LW0 A;  1VQK N;  1IKY A;  1BIS A;  1UOC A;  4OJR A;  4A5A A;  5HBM A;  4F4K A;  3PSF A;  3I8D A;  1FXX A;  1YJ9 N;  2NUB A;  4Z4E A;  4LH5 A;  3VEW A;  4GV3 A;  2OTL N;  2HHT A;  2IOC A;  4E1M A;  3PIO L;  2A1R A;  2QWQ A;  3AVC A;  3ENH A;  1BCM A;  3VQ5 A;  3O9R A;  4LSN A;  3VES A;  1RDB A;  4BR7 A;  4H5N A;  4H0X B;  3GE1 A;  3CC7 N;  4AQY K;  3NHG A;  3O3G A;  1N32 K;  1BDG A;  2ZJR L;  1V4S A;  2DFF A;  3RR8 A;  3BP8 A;  3UIQ A;  1GLA G;  3J8A A;  3NGY A;  3DRS A;  3I0R A;  4LH4 A;  5IWA K;  4CW7 B;  1HYV A;  1RBV A;  4I6M A;  3V4I A;  3C65 A;  2D1K A;  2OTJ N;  4IG0 A;  2I7N A;  1VSH A;  5JS1 A;  3CQY A;  1W9H A;  4M3T A;  2HMP A;  3SYZ A;  1HKC A;  3QDK A;  4JS5 A;  3QO9 A;  3FFI A;  1N8R O;  2QKB A;  1EP4 A;  2VWJ A;  1RBU A;  5KPZ A;  4OLA A;  4A57 A;  3A0I X;  2Z1G A;  5AZJ A;  1NJI O;  4BRG A;  1TKX A;  3OYG A;  3BY5 A;  5F2R A;  4OPK A;  4FLZ A;  4DTN A;  1LWC A;  1HJR A;  4FJX A;  2OPR A;  4X64 K;  5CHI A;  3QEW A;  1YIJ N;  1TV6 A;  4HWI A;  1OH7 A;  3RVC A;  4FJI A;  3SCX A;  5GAD P;  1BIU A;  4DTP A;  1REV A;  5C15 A;  2YNI A;  3AV9 A;  1CLQ A;  4IXC A;  3HXM A;  4JI0 K;  1JCG A;  2KZZ A;  4CE9 A;  2NRT A;  4GVE A;  1JLE A;  3PIP L;  3A5M C;  1YTU A;  1ZYQ A;  4BRO A;  1NOY A;  5LY3 A;  3DM2 A;  3H1V X;  3UKU B;  5AQN A;  4BRM A;  3J7Y P;  4JKE A;  1SQK A;  4CF0 A;  3OYE A;  2P51 A;  3MMV A;  1W2B M;  4FWS A;  3OS1 A;  4B1X B;  4XH4 A;  1LWE A;  1S1U A;  1CZB A;  3HRG A;  3EY1 A;  4CJE A;  3U3Y A;  4JLH A;  1C0F A;  3TSU A;  3HST B;  2YJE A;  1NGB A;  4CFA A;  5J1E A;  2F96 A;  3HZ6 A;  3K5O A;  4ZTF A;  4CF2 A;  2JWK A;  1S72 N;  3QIO A;  2HBK A;  3G71 N;  3HK2 A;  3LL3 A;  5KPR A;  3HT3 A;  3V81 A;  4FPA A;  4KO0 A;  2VYP A;  1Q82 O;  2P9U A;  5C42 A;  3WQU A;  3LP2 A;  3VEZ A;  4CJ3 A;  3QML A;  2VGM A;  4EIA A;  2NZT A;  3VQA A;  5AQL A;  4CCH A;  2VWB A;  4KRE A;  1BI4 A;  3LDP A;  4IOX A;  4LC9 B;  3PX4 A;  1WAJ A;  4U7B A;  4H5R A;  2OPP A;  4DTR A;  4H4M A;  2DTU A;  1VSI A;  4F3O A;  4JI2 K;  2HST A;  4FO0 A;  5GIP A;  3SI6 A;  5E84 A;  1QS4 A;  5CY4 A;  4QAG A;  1EWQ A;  5JMV A;  5C2D A;  3LPT A;  4BR2 A;  3TAN A;  2DFE A;  1L3T A;  3QBX A;  2EHG A;  4PA1 A;  3THW B;  3TAP A;  1VQ5 N;  2O8E B;  3MAQ A;  2KZM A;  1HKB A;  4C1N I;  4O0J A;  3K5M A;  3T3F A;  3VPZ A;  1W7A A;  4OKJ A;  1JLQ A;  2PY5 A;  2HNY A;  3HPG A;  1RGI A;  2WOM A;  5AQM A;  4LD0 A;  3OYM A;  3KJV A;  4DFM A;  4FJK A;  4AHR A;  3HP6 A;  3EYZ A;  2HMI A;  4PY5 A;  2ZF5 O;  5H1S Q;  3MX5 A;  4BQZ A;  1VSD A;  4DTO A;  4B1Z A;  4JK7 A;  2O8D B;  1S9E A;  2RE2 A;  2CGK A;  4H0T B;  4B9Q A;  2O8F B;  3CCS N;  4DSJ A;  3NDK A;  2E8A A;  4FZX C;  4FWQ A;  2Z1J A;  3S9H A;  1HNZ K;  4CJR A;  5JVH L;  2P9K B;  2YHX A;  2E4L A;  3ZT3 A;  3HTV A;  2JWL A;  3CJ9 A;  3TAM A;  1TL3 A;  5F0X A;  3NCI A;  3TAF A;  2P5G A;  3LP0 A;  4H0V B;  4E7J A;  3NVM A;  4DTU A;  2QI2 A;  4IDK A;  1WN7 A;  4DFK A;  2HBJ A;  5EOY A;  2PYJ A;  1QQC A;  3DLK A;  3NGZ A;  4CK1 A;  2UUB K;  4MQ3 A;  2D0O A;  3AVF A;  4EHU A;  4FJ7 A;  3R6M A;  5C25 A;  3VEX A;  4DR2 K;  2I7P A;  3K59 A;  4BRC A;  4FOE A;  4B8A B;  4IFY A;  4BVP A;  1C0M A;  3FZM A;  1FJG K;  1HPM A;  4FSV A;  2Q0U A;  4JI8 K;  3TAQ A;  4H5T A;  4QS9 A;  1TK0 A;  5GAH P;  4BWM A;  2IAJ A; 
#chains in the Genus database with same CATH homology
 4JI6 K;  2ZM6 K;  4LF6 K;  4GKK K;  4X65 K;  4AQY K;  1N32 K;  1IBM K;  3J7A P;  4JV5 K;  4YHH K;  5IWA K;  5LL6 Z;  4CW7 B;  4JI2 K;  4DR6 K;  1N34 K;  2HHH K;  3JAM O;  4DR3 K;  4DV7 K;  2UU9 K;  4LF4 K;  1IBL K;  4B3S K;  4DR1 K;  5LMU K;  4JI4 K;  1J5E K;  5AJ3 K;  3OTO K;  1XNQ K;  5FLX O;  4DUZ K;  2UUC K;  1I94 K;  2UXC K;  5A2Q O;  2F4V K;  4DV0 K;  5IT9 O;  4B3R K;  4LF8 K;  4LF7 K;  2UXD K;  4LFC K;  1IBK K;  4DV3 K;  4DR5 K;  3T1H K;  4JYA K;  4JI7 K;  4X64 K;  4LF5 K;  2E5L K;  4DR7 K;  4GKJ K;  2VQF K;  1XMQ K;  2UUA K;  4DV1 K;  4JI3 K;  4DV4 K;  4JI0 K;  3J81 O;  1HR0 K;  4X62 K;  2UXB K;  4JI1 K;  2VQE K;  1XNR K;  1HNZ K;  4K0K K;  4LFA K;  4DV5 K;  3T1Y K;  4NXN K;  3J7Y P;  4LFB K;  5LMN K;  4JI5 K;  4DV6 K;  5BR8 K;  4B3T K;  4DUY K;  4DV2 K;  4NXM K;  2UUB K;  4B3M K;  1HNX K;  4CVN E;  4DR2 K;  4YY3 K;  4OX9 K;  3J80 O;  4KHP K;  4DR4 K;  4V19 S;  1N36 K;  1FJG K;  4LF9 K;  1N33 K;  4JI8 K;  1XMO K;  4X66 K;  1HNW K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...