4JI1K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji1K00
1I94K 1XMOK 1J5EK 5IWAK 4OX9K 4JI8K 2UXCK 4X66K 4LF8K 1HR0K 4LFAK 4DR2K 1IBKK 4JI6K 2UU9K 2F4VK 5IT9O 4JI1K 4DR5K 4DV5K 4DUZK 5AJ3K 4LFBK 4NXMK 1HNXK 4DUYK 1HNWK 4CW7B 2UXDK 4DV6K 4DV7K 2VQEK 4V19S 4B3TK 4LF9K 2ZM6K 3J80O 2UUCK 4DV3K 1XNRK 1IBLK 2UUAK 1N34K 4DV2K 4KHPK 4DV4K 2UXBK 4AQYK 1N32K 3JAMO 4JI0K 4LF7K 1XNQK 3T1YK 1FJGK 4DV0K 4B3SK 4CVNE 1N36K 4DR6K 4JV5K 4JI3K 2E5LK 3OTOK 4JYAK 4YHHK 4DR4K 4X64K 4DR1K 4DR3K 4GKJK 5A2QO 2HHHK 4NXNK 5FLXO 4LF5K 5LMNK 1HNZK 4B3MK 4X65K 2VQFK 3T1HK 5BR8K 4YY3K 4GKKK 3J7YP 4LF4K 4LFCK 4B3RK 5LMUK 3J7AP 1IBMK 4DV1K 1XMQK 4JI7K 4X62K 4K0KK 4JI4K 5LL6Z 4LF6K 3J81O 2UUBK 4JI5K 4DR7K 1N33K 4JI2K
chains in the Genus database with same CATH superfamily
4BE1A 1QS4A 2YHXA 1IKYA 3RMAA 2ZWHA 1SL1A 2HSTA 2E2OA 3SJHA 1Q9XA 1GLCG 2OTJN 1W9HA 4BR9A 5HRPA 1KVCA 1HLUA 3UKRA 4EP5A 2I7NA 2RE2A 3DLEA 4ISGA 5AQSA 3W3DA 3T3FA 1KLNA 1G15A 3RR7A 4FOEA 4I9QA 4CFAA 5HROA 3QEIA 4LFBK 2DFEA 1KCFA 4DTPA 1TKZA 2ETJA 4E0DA 3DJCA 3TANA 2QA4N 4CIEA 1NKCA 4B3OA 2KFNA 5LY3A 1SZ2A 1NJIO 5FRNA 5KPZA 5HBMA 3L4QA 4WFAL 2OANA 4DV2K 5TKYA 3NDKA 4AF1A 3U6FA 4PL7A 5CHIA 3NF6A 2P5OA 2YX6A 3ZT0A 3KWGA 4BE0A 4J2BA 1IKWA 4PA1A 3OTOK 2HNDA 4M42A 5AQZA 4PY5A 3HL8A 2IOCA 2GV9A 1A5VA 3L2WA 4FWOA 1C0TA 4J2AA 2I5JA 4Z4IA 3LPUA 5A2QO 3SMSA 4KH4A 3SBTA 1HNZK 4DTRA 4KB0A 3KK1A 4O5FA 3QO9A 4BE2A 3NH2A 3K9JA 2ASPA 4YY3K 1VQPN 1FKPA 3VGKA 2RN2A 4CJ4A 3QIOA 3HTVA 2G8WA 3LDNA 4CZJA 4FWMA 2AP1A 3LM9A 4DTSA 1YI2N 3S9HA 1VSLA 4WQ5A 4WFNL 4Z4HA 4JS5A 3EL2A 3VQ9A 3A8YA 3G10A 4CBXA 3WT0A 3IAYA 5C24A 4CHPA 4HTLA 3V81A 2LSNA 5H1SQ 1X9MA 3HSCA 1DTQA 3V6DA 1VAZA 4JK8A 2A5XA 2F9WA 5HP1A 3H6EA 4ISFA 1EO1A 1KD1O 4FJJA 3DMJA 4NCBA 3AVLA 1JXEA 4RW7A 4KRFA 4X66K 3NH0A 3CFPA 5GIOA 1GLJO 1VQ8N 2W41A 1ZBLA 3DOLA 3WNHA 4DF4A 3MX2A 3QEVA 3HK2A 3NMUA 4EP4A 1GLBG 2OCEA 3DXMB 1ZBHA 3VQCA 5HRSA 3G0ZA 1VSHA 1R59O 5ADXH 5GAHP 3V1OA 2NRVA 3CMEN 3AY9A 3S41A 1OKJA 1RBRA 2VYPA 3B8AX 1VQMN 3LP0A 3IMXA 4KHUA 3E01A 4GV3A 4Y1DA 1OH5A 1ZBFA 2VWJA 4BWJA 5FPEA 2O8BA 4M3UA 4DSKA 5GAGP 1N36K 4JEPA 1NM1A 4KHSA 3O9QA 1EWRA 3SPZA 2GX9A 4BRKA 3PO5A 2P9LA 4X64K 2GWKA 5M1FA 4L3QA 4GKJK 5BPMA 1QTMA 4H0YB 2ZJPL 3SPYA 4C8OA 2IVOA 2QI2A 5LMNK 2KFZA 4AHCA 3PO4A 1QSYA 2OYQA 3O08A 4OPHA 5JLFA 3CD6N 2HVHA 1GOCA 2FC0A 1S1WA 4JKHA 4B08A 2ZGZA 1LAWA 4IJAA 3MXMA 2FLOA 1T03A 3O6WA 5AQXA 3AA5X 3ZSYA 1K73O 4BDPA 3ZT2A 3FGUA 1RBVA 3PUFA 2HF3A 1C1CA 1LWEA 4IFEA 4DR7K 2Q3SA 4BG8A 1XWLA 3O8MA 3WNGA 4CI6A 1U04A 2IGIA 5JLHA 1HJRA 4K41A 1WLJA 4EHUA 3D6RA 4DSJA 4LFAK 2BE2A 5FPDA 4I7FA 3CXCM 4BR2A 3A5OC 4CZLA 2XY6A 2PZSA 5KI6A 1XC9A 4JI6K 3HPGA 3AO3A 3MCAB 2GWJA 3VQQA 3E66A 3PX6A 1E4GT 4ILJA 2HHWA 4I9LA 3ZT1A 4CZHA 4BQZA 1TL3A 4AHUA 3QB0A 1BHLA 3AA3A 4LH4A 3A5LC 2W6LA 3NCIA 1NGIA 2YKNA 4CEAA 3BEXA 3VMFB 2HMPA 3HI0A 1P8ZA 1T6DA 3HXMA 4YDUA 1OVYA 1IBLK 1BI4B 3RMCA 3QEWA 3H46O 4CZKA 5GINA 2UXBK 3AA2A 4IDKA 1NJXA 2VG5A 3T1YK 1WSGA 2ZJRL 1L3SA 1T05A 4A59A 4JYAK 2JWLA 4JK7A 1SUQA 4W5QA 3WEEB 4CERA 3MN9A 4CGDA 3R9PA 1BQNA 1NGFA 3OYAA 3NF7A 3DLKA 3WXMB 3VQ8A 3MECA 5M1OA 3QEPA 4C8NA 1QQNA 4Z4FA 2NRZA 1WAJA 5KRTA 2O4IA 2E2PA 3RSEB 3FR0A 2O8EA 3FZHA 2HHTA 3ZSQA 4BRQA 1A5XA 3K59A 4WF9L 1NK4A 1QVGM 1VQ4N 1ASWA 1KFDA 5JICA 4CJLA 4O0IA 3SUNA 2G8HA 4O5BA 4OKJA 4Y1CA 1LAVA 1DT9A 2E1YA 3LDLA 1QZ5A 4BG9A 1RTJA 3ZSOA 2NRWA 5AQQA 2FBTA 2GUPA 3M6GA 4QS8A 3IRXA 4QS7A 3AAPA 3B6PA 3U3GA 4CFBA 4Z94A 3UKRB 1HNVA 4FK2A 4PUOA 4E1JA 4BVPA 5BPNA 3HOSA 4PKGA 4N41A 2R7YA 2KZZA 4CD3A 4KHYA 1NK8A 4KHQA 2A41A 4M3XA 1HR0K 3O3HA 2Q0UA 1ZXOA 3VGLA 4QS9A 5KPTA 3I56N 3LDQA 1FKOA 5HOOA 4F3OA 3O1BA 4CHQA 4DU1A 4FW1A 4QAGA 5BN8A 4DKWA 3EY1A 3TI0A 2ZJQL 5I9EB 5AFUA 3LWMA 2E2NA 3MXJA 4DFPA 2D4WA 4EHTA 2DFHA 1YXQA 5KQDA 3DM2A 2H3GX 4IOXA 4LF7K 1C6VA 1NOYA 4H5VA 1J5OA 5BRFA 4KB1A 3O1WA 1GLEG 4I2QA 3CIPA 4YOXA 4JI3K 1VSIA 3KK2A 1YUWA 5KGXA 1ITGA 4IEEA 3P38A 1WNSA 1YF5L 4RWTA 4AILC 3NVMA 2JWKA 5HL7L 1RT6A 1UA0A 1WAFA 1CLQA 2P9NA 1IV0A 4OVLA 1YVNA 2G8UA 1RDWX 4LF4K 3AO2A 3OBWA 4ID5A 1JCEA 4W5OA 4LFCK 3CFOA 3HT3A 4FZXC 2F7TA 4MFBA 1U2VA 3O9UA 5CYMA 4FJNA 4B9QA 3KHYA 2E6LA 4FLYA 1ASUA 2KQ2A 3O4QA 2HBJA 3C0BA 3CC4N 3ULDA 2Z1GA 4R79A 4U67L 2KHOA 1HMVA 2ATQA 1JKHA 2Y1JA 3F9KA 1WN7A 1HRHA 3S3MA 2P9UA 2CH5A 2QKBA 3LZIA 4FPBA 1K8AO 5AQPA 2Q2RA 3CETA 3SK3A 5T7BA 4AM7A 4XH5A 1MU2A 4BACA 1D9DA 2HF4A 3VEWA 3V9WA 2YNIA 4O4GA 4HCBA 3JS6A 5AQJA 4A62A 2QTDA 2XY8A 4DR5K 2O4GA 2P9KB 3M8QA 1ZC6A 5AJ3K 3PX0A 4Z4GA 4AHRA 4CIFA 3A0IX 5EXWA 2UXDK 1W0HA 1TVRA 1SKRA 1EKEA 2QM1A 3MMVA 1VHXA 2O8BB 4LF9K 4DHYA 2ZM6K 4JD2A 3MEEA 3S3OA 3JSMA 3NE6A 1HQUA 3VQDA 5C12A 1JXBA 1TUUA 4JKFA 2OTLN 2G8IA 1KAXA 3ID8A 1N32K 3NF8A 4DQ8A 4FJXA 4FJGA 3U9ZA 2YHBA 3RR8A 4K8XA 1NGEA 3K5NA 3IKMA 5KTQA 4CJ7A 4JKCA 4CJEA 2WUSA 1WSEA 3VA3A 4AHSA 3VF6A 4M3ZA 1KFSA 2AJQA 1Q8IA 1K8KA 1T6CA 5E84A 3RVCA 3L2QA 5ADXA 4FYDA 4LSLA 1Q82O 5AZJA 1QQMA 3HBTA 4DQSA 3PLAA 2UYTA 3VOVA 1N6QA 3P4IA 4OGEA 3OY9A 5KQ8A 2FSNA 2ZGYA 1RILA 3KK3A 1FW6A 1NGGA 1JLFA 1F21A 3C95A 2Z1IA 3OS1A 1NK0A 4H5WA 4RTFD 3D2EB 3AVKA 4LF6K 3ENBA 3KLFA 1YITN 3IDHA 4UY8O 4O55A 3G71N 2Z1JA 3F5TA 3HPOA 4BRNA 2FBVA 4CJ5A 3KLGA 2XY7A 3AVIA 1BA1A 3LPTA 1SQKA 2CGKA 3HP6A 2O8FA 2VG7A 2XY5A 2OA8A 4J2EA 4OLAA 3WUHA 3EEQA 1REVA 3GE1A 4FK0A 5B8HA 3M8PA 5BR9A 3AAQA 5JMVA 3AGKA 4CGHA 3RMBA 3TAMA 2EX3A 3OYLA 5AZIA 2OPSA 4YDUC 4RW4A 5AFUH 4B8CA 1TV6A 4BRMA 4BVOA 2G8FA 3OYDA 3M3ZA 4RW8A 1VRTA 3J80O 3I8BA 3SUPA 4CJTA 3THWA 3I0RA 4KTWA 3ATVA 4OJRA 3MAQA 4OGCA 4AQYK 3PIPL 4F3TA 4KKOA 4CJPA 3O4NA 3HYFA 1RDCA 2Q31A 4EAHD 3WXIA 1W2BM 1LW0A 4BDYA 2NRTA 4CIGA 2X78A 5GIPA 5DMRA 4CF2A 2O8EB 2QWMA 1BU6O 5FLXO 1NJYA 2ZQBA 3ENOA 3ALYA 1C0FA 2FF6A 2A1SA 2P9IA 4PKIA 1I3AA 3M1FA 3IG1A 4EIAA 1SS6A 1NNEA 3SV3A 4CJQA 3O3GA 1D5AA 2OPRA 2WC9A 4B1WB 4E7IA 4DSFA 3K9KA 2FF3B 3QMLA 3NF9A 4E7HA 4CZGA 4JI4K 1X9JA 1HQEA 2ASMA 1GLAG 1C1AA 3CQYA 3L6QA 3J81O 1X3NA 1IH7A 4EZ9A 2O8DA 3DXKA 3LP2A 2NNWA 4A61A 3OYKA 1OVQA 3M8SA 2ZE2A 1YT3A 1JLQA 3BZCA 4RW6A 3H3NO 1TGOA 3NH1A 4DSEA 2ASOA 1TKXA 4FZZA 3V9UA 2HVIA 4IWVA 1RBUA 1IBKK 1GLFO 3L2VA 5FRMA 1S5JA 3LM2A 4B1YB 4B1VA 4YOVA 2HNZA 1JJ2M 4ZTFA 4DV5K 4ISEA 4C8KA 3CPEA 1J54A 4DUYK 5DM6L 4FO0A 3D2FB 5M1PA 3VQ6A 4H0PA 1EWQA 4NYFA 1GOBA 1J9AA 2P9SB 3TR8A 4CFCA 2RKIA 2EWSA 3PX4A 3BZKA 1M90O 4FWSA 3TTDA 2UUAK 4M45A 1TKTA 1Z25A 4DTUA 1B92A 1EETA 4BY9C 1GLDG 1VSMA 2AA4A 4M7XA 2E8AA 1IJJA 4BRGA 3IS9A 3CCMN 1JLAA 1RDUA 2P9NB 2E88A 4LY7A 3EZWA 4JN4A 5AQHA 2E6MA 4O8KA 5C42A 1ATSA 3MK6A 4FJIA 2PAVA 1YJWN 3VEXA 1W7AA 3LP1A 1U2VB 3HPHA 1WSIA 1VRUA 3G6EN 4H0OA 3VQPA 3Q7BA 3OYCA 2VGMA 4L8RB 1HX1A 3KLIA 3CFRA 3AVJA 1C0MA 1BUPA 1V4SA 1XMQK 3CMAN 4IOAL 2HBKA 3HM8A 2DFFA 3HVTA 1YHQN 5LL6Z 1N5YA 4CHZA 2UUBK 1GLLO 4MO4A 3AV9A 3ZX2A 5F0XA 5BREA 1SL2A 2VG6A 3AVBA 1D9FA 3THYA 4H8KA 4KI6A 3SYZA 3CC2N 4Q0BA 2O8CA 1CXQA 2DPNA 4DTOA 4CEDA 3HP9A 1LV5A 3LWLA 3TAGA 4KI4A 4DTNA 1L3VA 4HHTA 3C94A 4YOTA 1IKVA 4MDAA 4FWNA 1O1WA 2UU9K 3VEOA 1J6ZA 4B9NA 4GY2B 3M8RA 3HM9A 4ZTJA 3ZYYX 1S6PA 4JD2B 4NXMK 3DRSA 3K58A 2PY5A 1ILYA 4BRPA 4YOWA 1EX4A 4LSNA 1VQ7N 4FWRA 5J2NA 2P9PA 4KFBA 5C2FA 3GG4A 1T3VA 4CJWA 4A57A 2A1RA 4XH4A 1X9SA 4HVJA 2KTQA 1N34K 3WXJA 4JKAA 4KAZA 1TL1A 1NGAA 2KLAA 3JXUA 3JAMO 1U6ZA 1Y97A 5JS1A 1OH6A 1W97L 3GL1A 4JV5K 2E5LK 3KWIA 3A5MC 3MXIA 3KLEA 3FZFA 3H1VX 4N47A 4FJKA 3VTHA 3TAQA 5M1NA 4EZ6A 3TABA 4PWDA 2X74A 1BA0A 2GUIA 4X65K 1QHAA 2VQFK 3CERA 4DSIA 4IXCA 4JAXA 3FFIA 4DWIA 4GKKK 1Q86O 4GV9A 4JKEA 3WQTA 1NGJA 3CJCA 3VENA 4DS5A 2YNFA 2YNHA 5AQRA 3AVFA 4FSVA 1K6YA 4I2PA 3KD1E 4BR7A 4JI7K 3UB5A 3WQUA 2PYJA 5AQGA 3VA0A 3QESA 1WUAA 4KV8A 1BL3A 1UWBA 2OZSA 4DFMA 2VWKA 4FJHA 2A6AA 4GW6A 4H0XB 3HO1A 4H5RA 1JLCA 3RMDA 3WXKA 2QXFA 3NGZA 4DFJA 4BC5A 3EYZA 4BC4A 3P1GA 1I94K 3SV4A 1J5EK 5IWAK 4NLCA 5AQKA 4JKGA 2Q36A 1S1XA 4A2BA 1SKSA 4LF8K 4ELUA 1TUYA 1JL2A 1WBDA 5EOYA 3QICA 2G8VA 4B1ZA 3R3LA 3L4IA 3Q7CA 2IVPA 3SMPA 3KLHA 3SNNA 4CBWA 3KJVA 1U47A 4DU4A 1KTQA 1CZ9A 3CCUN 1HJOA 3THWB 1EP4A 4QCLA 3C7NA 4A5AA 3CHWA 5MLCQ 3O4WA 3HZ6A 3BF3A 2D0AA 4B3TK 4JKDA 1GOAA 4NCGA 3QLHA 2F96A 5J2PA 4CK3A 2Y1IA 5F1XA 4NB4A 4CECA 4FM2A 3E9LA 1KC8O 4JI0K 5AQVA 1XNQK 1Q81O 2DTUA 4YOYA 2B6AA 3V9XA 3TSUA 1KRPA 3I55N 1DEJA 1C0GA 4A5BA 4CEBA 1QSLA 5M1QA 3VQEA 3NFAA 5FPMA 3ULEA 1BQMA 4E19A 4CEEA 3KK7A 5I3UA 2QK9A 4ELTA 3TTCA 1Q9YA 3BP8A 4ZHRA 2BTFA 1NBWA 2D0CA 2RHKA 4C1NI 2ITGA 2YHAA 4OKEA 1C1BA 3DOKA 1J53A 3LAKA 1KVAA 3F2KA 4FWKA 4BRHA 3P31A 4B3RK 3ENHA 1T8EA 2KW4A 3CCLN 4OO1J 5AQUA 4FVUA 3L2UA 1VQ9N 3SZ2A 3T69A 4HUEA 3WNFA 1QQOA 3DXKB 5GADP 3K5LA 3N4QA 1R0AA 3ZSVA 2BDPA 4JK9A 1X1PA 4F2RA 3FE1A 4FM1A 4WQ5C 2CGJA 3G25A 4KH5A 2IS3A 1S1VA 4FOIA 4IO8A 3L2RA 5FROA 4BQLA 1NLVA 2YCHA 2JLEA 2BH1A 4K43A 1P90A 4GMJB 4IEIA 2GBZA 1IG8A 3VF2A 3IUCA 3QETA 1ATRA 3RRGA 3L3VA 3O9RA 3ASMA 3DWLA 4FLXA 1TAQA 4EFHA 3VQ7A 2GELA 2A40A 1Z26A 2E1ZA 3T7ZA 3M5RA 3DLBA 2OZMA 4CW7B 1VK0A 4DV7K 4OLBA 4KHNA 3F73A 1BG3A 1UAXA 4CGGA 4JLHA 3QDKA 4DV3K 1TK8A 2HHVA 1LWFA 1K9MO 1FXXA 1HKGA 4FJ5A 1VSDA 3G4SN 3NVKA 3DLGA 2NRRA 4MO5A 4DV0K 5JVHL 4M3TA 4OPJA 1XUPO 5DK5A 4JKBA 3SQ4A 3C6HA 3DLLL 4DTJA 4CF8A 4CCHA 3LL3A 2FBYA 4I6MA 4BGAA 5AQWA 4FLZA 3SQ2A 1NKEA 1WSHA 2HHQA 5JS2A 5BR8K 2A3ZA 2P9LB 4KHWA 3ZX3A 2GEMA 1JL1A 2YV0X 2HBLA 5M1KA 1YIJN 2J4RA 4BREA 3N4PA 3O80A 5LJVA 1KQSM 1RT5A 1A5WA 4DLEA 3THYB 2HMIA 4CF1A 3BF1A 3MDQA 3PSIA 1JLEA 4O8UA 3SBGA 2V7ZA 5EX5A 3AVNA 3A5NC 3O9SA 3SQ1A 1N33K 3O5BA 1KAZA 2WTUA 3CPWM 2CH6A 1S9GA 3P39A 4E7KA 2NZTA 2QWOA 3OJUA 1HPZA 2VWBA 2UXCK 3L3UA 3HVRA 4CK2A 5C15A 4CHNA 5BRDA 4HUGA 4DTMA 5CZ1A 1EXQA 1UOCA 1S9EA 5BPLA 1MDUB 5AQLA 4JI1K 2P9PB 4PKHA 5E41A 4HUFA 3C6AA 5AQTA 1HNXK 4FLWA 4YFUA 3QEXA 2EHGA 1BI4A 4GVMA 1RDBA 3VPZA 4CJFA 3ZT3A 2QWLA 5BRHA 3K57A 4Y0WA 3K0SA 1G99A 3EKSA 3UE5A 3DRPA 3BDPA 3ZSWA 2UUCK 4XH1A 5GAEP 1RFQA 3SI6A 4IO9L 3W0LA 4JHDA 1SV5A 3OYGA 4MQ3A 1BIUA 3QERA 2D5RA 3B6OA 3LANA 1LW2A 4DR6K 4IFVA 4KBOA 2GTDA 3ID6A 1XI1A 4UQGA 3BY5A 1BIZA 1WSJA 4XEIA 1SKWA 1NWKA 3RSEA 3EE9A 3NGYA 2W42A 3L8BA 2X6SA 4IZ9A 3P5JA 1RT4A 1OH7A 1ZYQA 1VQ5N 4AHVA 3V1RA 3AGRA 2IVNA 4F2SA 3SAGA 4N56A 3VGMA 3J7YP 4WE1A 4GV6A 3TU5A 4CHOA 3VEYA 1D8YA 2RPIA 3V4IA 1MWKA 3T19A 3ZX0A 5J1EA 4NLBA 3J7AP 3TARA 2FXUA 3I33A 2NUBA 4FCYA 3AVGA 3GOIA 3ZSRA 3TAFA 4H5NA 3TSPA 4JKGB 2PFUA 1VSJA 4IBNA 2WBNA 4E1MA 3V9ZA 3AA4A 2VCPA 2PBDA 2I7PA 3KD5E 1TYQA 4JI2K 2QWNA 4ICLA 3QNNA 4CEOA 4OX9K 3THXA 4M63C 2YI1A 3CF5L 1JLGA 3OYIA 4JI8K 3DLRA 4O0JA 3EN9A 2RF2A 1RBTA 4BRIA 4DR2K 4K8ZA 4BRAA 2PYLA 2OPPA 3TWHA 4RW9A 4C8LA 3V1QA 4DQQA 1TK5A 3C7NB 3KTQA 3HJFA 3OS2A 3U9DA 3MCPA 4B9SA 4E3SA 5AR0A 3DYAA 3LAMA 1U45A 1E3MA 2QXLA 1NK9A 4WQ4A 3D45A 4BRFA 3OYFA 4DSLA 5CZ2A 1JLBA 5J2MA 2HBMA 4AHTA 5E26A 3ZEUA 1HKCA 4H4OA 3ISNC 1RNHA 4XIUA 1TAUA 3OYNA 3ULEB 3MEDA 1D4XA 4BC3A 3WNEA 5I42A 1U49A 1BGXT 5AQYA 4CVNE 5C0YA 3LDPA 1WOQA 2HNYA 2QW9A 1QVFM 3CCRN 2F8SA 1YJ9N 4DTXA 1YJNN 4DQRA 3ZLJA 4W5NA 1BWFO 3OS0A 3O3FA 4B1XB 2E20A 4CJ3A 4DR3K 3VQBA 3RTVA 3OYEA 4LC9B 3GBTA 3CYMA 3QFUA 4IJNA 4KTZA 3TSQA 4M3YA 3AO1A 4CE9A 1SAZA 2XHBA 2Q0RA 3RRHA 4OPKA 3TAEA 4YORA 4RCHA 3VTIA 1IBMK 1KXPA 4CGJA 4CFDA 1IO2A 3CQXA 1LOTB 3LALA 4RG8A 4FWQA 4B9MA 4H0VB 1DLOA 4J8FA 3P83D 3UKUA 1B9FA 4FM0A 1X9WA 1NOZA 1S1UA 5CR4A 3R1XA 2IAJA 1VSFA 1ATNA 1JCFA 1DKGD 4CK1A 3H45C 2HOEA 1N8RO 3J8AA 1YTUA 5AQFA 1XMOK 2G8KA 3E1YA 4NCAA 1RTIA 1L5UA 1XHXA 3SJJA 5SZTA 1NGHA 3GDQA 2P9KA 1CZBA 3MN6A 2ZD1A 2BUPA 2P9UB 5AQMA 1T7PA 2KKZA 4KH6A 5J2QA 5IT9O 4DS4A 5CYQA 2B4JA 1NG9A 4JRPA 1CZAN 3MN7A 1VQ6N 4CHYA 3A2FA 4FPAA 3VQAA 1S22A 4DV6K 1RT7A 2JGUA 3KIOA 2VQEK 3PY8A 5SWMA 4IKFA 4N5SA 1VSKA 1VQON 4CBUA 3OYHA 3VN5A 2P1JA 1X3MA 3AVAA 4M3RA 3ZSZA 4H4MA 3OA9A 1QSSA 1NJWA 4B3SK 4QOZB 4I6MB 3NGIA 1BDGA 4CZIA 3LZJA 5EU7A 4H0TB 5HLFA 5KRSA 3CJAA 4FL9A 3SUQA 4BGBA 4DU3A 2A42A 2E2QA 3BUZB 4DQPA 3OBYA 2D0OA 4LD0A 4DR1K 1VSEA 4IG3A 3U8XA 3C6UA 1NKBA 4B3MK 3ZETA 4C23A 3T1HK 5DM7L 1Q18A 3CI5A 3PIOL 1K8KB 3MEGA 3QINA 4W5TA 3D7EO 3DRRA 4FJLA 5LMUK 2BANA 3WXLA 3D2EA 1UA1A 4KPYA 5AZJB 3R8EA 3MN5A 4DV1K 2D1KA 2V7YA 2V52B 1RT1A 4M41A 4E7LA 3C6TA 4TSXA 3LDSA 4ELVA 1S1TA 1RGIA 3FZMA 2IC3A 1XHZA 4PQUA 2X6NA 3SUOA 5CE3A 4JNEA 5AQOA 3CJ9A 4FWPA 4Z0UA 4CEFA 4FK4A 3VEZA 4F9OA 4WYBA 2V51B 4BC2A 4IDHA 3TPQA 4BWMA 1Z6RA 1RDAA 1FK9A 1RTHA 3H1QA 4PHTX 2HHUA 4FLVA 4BR4A 4DQIA 3CG7A 5HRNA 4CEQA 1Q7YO 2BGGA 5EVZA 1ASVA 4DMNA 3U3YA 1YTAA 4JHDB 2O8FB 1S72N 1KLMA 1LWCA 4CGIA 3MWPA 4CZMA 1BO5O 4DCHA 3S3NA 1HYZA 4R5PA 3C65A 4E89A 3LDOA 4HTUA 1HPMA 4NYNA 4BRDA 5AZIB 1XNRK 4FXDA 3AVMA 2QWPA 3H08A 1VQKN 3R6MA 2FSJA 4PL8A 4G1QA 3CCQN 1FJGK 3SAHA 5K14A 4U7BA 1NJZA 1RT3A 2YHYA 1WBBA 2F8TA 3CCSN 4WFBL 3J7ZO 3AVCA 4DR4K 4E1NA 4F8RA 3UIQA 4NXNK 1WB9A 2ZF5O 3L0QA 2KZMA 4A2AA 4JS4A 3D0PA 2Q1NA 5KGWA 1KAYA 1KSPA 1HUXA 1NGBA 1MA9B 3VF4A 1ZBIA 4CZEA 3AO4A 4CJKA 3CJBA 4IFYA 3QFPA 2ITMA 4B9UA 1RT2A 3VETA 2P5GA 3ATUA 3IFRA 4B9VA 1OH8A 3DLHA 1TYQB 2P9IB 4FWLA 3HOTA 4FVMA 3AARA 1QHTA 5TKWA 4CJUA 3THXB 2YHWA 1O13A 1NGDA 3HSTB 3FZKA 3VEVA 4GNIA 3MWTA 1HYSA 2WOMA 3EO3A 1ZBUA 3CM5A 2YJEA 2HHSA 4ILHA 2CGLA 5C2DA 4YOUA 3VQ5A 2IDOA 2O8DB 3EKUA 3D2FA 3NAEA 3FLCO 2HB5A 2P9SA 2QKKA 3RWUA 4WQ4C 1B9DA 2QEXN 4CGFA 4W5RA 3OVNA 1QQCA 3F9MA 4H5TA 3CJ7A 1V4TA 4ILGB 4DUZK 2HW3A 4BR0A 3NHGA 1HNWK 1T44A 3ZEUB 3NBPA 4CEZA 1YAGA 2W6KA 5C10A 4Z4CA 3CCJN 4BROA 1H1VA 4FJ9A 1HYVA 3DAWA 4CJRA 1U4BA 4IG0A 5ELZA 4CJVA 3DXMA 4E7JA 4OKKA 1U48A 1SL0A 4Z4EA 1ZBSA 3CC7N 4JRQA 4B8AB 2NRXA 3V9SA 4WCEL 4CF9A 3OW2M 3OYMA 4Q5VA 3QBWA 2QWQA 3PSFA 3QIPA 1RDDA 4YHHK 4MLEA 3VQ4A 5KPRA 4N76A 1M1KO 4KO0A 4AH9A 2B5JA 1MWMA 4C8MA 3ZCMA 1XQSC 4GVEA 1IKXA 3OJSA 3OHRA 2E4LA 5HRRA 4C1NK 3K5OA 4BRLA 1QE1A 1HKBA 3OYBA 1L3UA 3QNOA 1VQLN 1BISA 4DF8A 5LJWA 4G9ZA 1TK0A 3UKUB 1RTDA 3I0SA 4DLGA 3T1AA 5BN9A 1DGKN 3THVA 3E9OA 3EZ5A 2VGNA 3K2PA 3CQ8A 4BDZA 5C25A 2YNGA 4DB3A 4X62K 3CCEN 1NK6A 2XRIA 4HCCA 4FJ7A 4FLTA 4KTQA 3LP3A 1Z05A 3EE8A 1NGCA 1NMDA 3SAFA 4B1UB 3ZSXA 4MLHA 2HHXA 5JVGL 2IIRA 3CJ1A 5AQNA 2YJFA 3U4LA 2WFBA 4M3WA 3SCXA 2DY4A 2W40A 4AM6A 3DI6A 4M7YA 3VERA 2XO7A 3KZBA 3PV8A 1E4FT 4FZYA 3HRGA 2YKMA 1BOTO 1S6QA 3E9PA 1BCMA 4BRCA 1BCOA 2F4VK 1YVUA 2O8CB 3KKRA 4YNQA 4H03B 4B9LA 1RCHA 4K42A 4BR5A 5FPNA 1KVBA 3ITHA 3MX5A 1QZ6A 5D3GA 2D0BA 1JCGA 3K5MA 4V19S 1TKDA 4O44A 1LCUA 1NU0A 1NK7A 2QWRA 3VESA 2D0PA 2P51A 4CJSA 2Q97A 3I8DA 2WONA 2FBXA 4MDBA 4CESA 3OYJA 1C0UA 4KHPK 1IG9A 4DV4K 4OPAA 3KKSA 1CXUA 3BGRA 4HWIA 3FZLA 5F2RA 4K25A 4FJ8A 1NMNA 3SQ0A 3TAPA 3ZETB 4CZFA 4FJMA 2FSKA 5CY4A 3AO5A 2NRHA 1XC3A 4DFKA 2F9TA 3SLCA 5FDLA 1ESVA 2OPQA 3AVHA 4DG1A 2HHHK 1HNIA 3JYTA 4LF5K 3O9TA 4NO7A 3CCVN 4B9TA 1L3TA 4FW2A 4IOCL 3WEEA 3CM6A 3ZT4A 1VQNN 1RBSA 1WSFA 3H3OB 1EQYA 3TTFA 4CD1A 1DTTA 5EY4A 1Y64A 3FFKB 4KREA 3KVGA 4ID1A 1NK5A 1I39A 4CF0A 2NLXA 3QBXA 4J2DA 5AQIA 4K0KK 4F4KA 4FLUA 2Z1HA 4JI5K 4LH5A 1S3XA
chains in the Genus database with same CATH topology
1I94K 1XMOK 1J5EK 5IWAK 4OX9K 4JI8K 2UXCK 4X66K 4LF8K 1HR0K 4LFAK 4DR2K 1IBKK 4JI6K 2UU9K 2F4VK 5IT9O 4JI1K 4DR5K 4DV5K 4DUZK 5AJ3K 4LFBK 4NXMK 1HNXK 4DUYK 1HNWK 4CW7B 2UXDK 4DV6K 4DV7K 2VQEK 4V19S 4B3TK 4LF9K 2ZM6K 3J80O 2UUCK 4DV3K 1XNRK 1IBLK 2UUAK 1N34K 4DV2K 4KHPK 4DV4K 2UXBK 4AQYK 1N32K 3JAMO 4JI0K 4LF7K 1XNQK 3T1YK 1FJGK 4DV0K 4B3SK 4CVNE 1N36K 4DR6K 4JV5K 4JI3K 2E5LK 3OTOK 4JYAK 4YHHK 4DR4K 4X64K 4DR1K 4DR3K 4GKJK 5A2QO 2HHHK 4NXNK 5FLXO 4LF5K 5LMNK 1HNZK 4B3MK 4X65K 2VQFK 3T1HK 5BR8K 4YY3K 4GKKK 3J7YP 4LF4K 4LFCK 4B3RK 5LMUK 3J7AP 1IBMK 4DV1K 1XMQK 4JI7K 4X62K 4K0KK 4JI4K 5LL6Z 4LF6K 3J81O 2UUBK 4JI5K 4DR7K 1N33K 4JI2K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 K;  1XMO K;  1J5E K;  5IWA K;  4OX9 K;  4JI8 K;  2UXC K;  4X66 K;  4LF8 K;  1HR0 K;  4LFA K;  4DR2 K;  1IBK K;  4JI6 K;  2UU9 K;  2F4V K;  5IT9 O;  4JI1 K;  4DR5 K;  4DV5 K;  4DUZ K;  5AJ3 K;  4LFB K;  4NXM K;  1HNX K;  4DUY K;  1HNW K;  4CW7 B;  2UXD K;  4DV6 K;  4DV7 K;  2VQE K;  4V19 S;  4B3T K;  4LF9 K;  2ZM6 K;  3J80 O;  2UUC K;  4DV3 K;  1XNR K;  1IBL K;  2UUA K;  1N34 K;  4DV2 K;  4KHP K;  4DV4 K;  2UXB K;  4AQY K;  1N32 K;  3JAM O;  4JI0 K;  4LF7 K;  1XNQ K;  3T1Y K;  1FJG K;  4DV0 K;  4B3S K;  4CVN E;  1N36 K;  4DR6 K;  4JV5 K;  4JI3 K;  2E5L K;  3OTO K;  4JYA K;  4YHH K;  4DR4 K;  4X64 K;  4DR1 K;  4DR3 K;  4GKJ K;  5A2Q O;  2HHH K;  4NXN K;  5FLX O;  4LF5 K;  5LMN K;  1HNZ K;  4B3M K;  4X65 K;  2VQF K;  3T1H K;  5BR8 K;  4YY3 K;  4GKK K;  3J7Y P;  4LF4 K;  4LFC K;  4B3R K;  5LMU K;  3J7A P;  1IBM K;  4DV1 K;  1XMQ K;  4JI7 K;  4X62 K;  4K0K K;  4JI4 K;  5LL6 Z;  4LF6 K;  3J81 O;  2UUB K;  4JI5 K;  4DR7 K;  1N33 K;  4JI2 K; 
#chains in the Genus database with same CATH topology
 4BE1 A;  1QS4 A;  2YHX A;  1IKY A;  3RMA A;  2ZWH A;  1SL1 A;  2HST A;  2E2O A;  3SJH A;  1Q9X A;  1GLC G;  2OTJ N;  1W9H A;  4BR9 A;  5HRP A;  1KVC A;  1HLU A;  3UKR A;  4EP5 A;  2I7N A;  2RE2 A;  3DLE A;  4ISG A;  5AQS A;  3W3D A;  3T3F A;  1KLN A;  1G15 A;  3RR7 A;  4FOE A;  4I9Q A;  4CFA A;  5HRO A;  3QEI A;  4LFB K;  2DFE A;  1KCF A;  4DTP A;  1TKZ A;  2ETJ A;  4E0D A;  3DJC A;  3TAN A;  2QA4 N;  4CIE A;  1NKC A;  4B3O A;  2KFN A;  5LY3 A;  1SZ2 A;  1NJI O;  5FRN A;  5KPZ A;  5HBM A;  3L4Q A;  4WFA L;  2OAN A;  4DV2 K;  5TKY A;  3NDK A;  4AF1 A;  3U6F A;  4PL7 A;  5CHI A;  3NF6 A;  2P5O A;  2YX6 A;  3ZT0 A;  3KWG A;  4BE0 A;  4J2B A;  1IKW A;  4PA1 A;  3OTO K;  2HND A;  4M42 A;  5AQZ A;  4PY5 A;  3HL8 A;  2IOC A;  2GV9 A;  1A5V A;  3L2W A;  4FWO A;  1C0T A;  4J2A A;  2I5J A;  4Z4I A;  3LPU A;  5A2Q O;  3SMS A;  4KH4 A;  3SBT A;  1HNZ K;  4DTR A;  4KB0 A;  3KK1 A;  4O5F A;  3QO9 A;  4BE2 A;  3NH2 A;  3K9J A;  2ASP A;  4YY3 K;  1VQP N;  1FKP A;  3VGK A;  2RN2 A;  4CJ4 A;  3QIO A;  3HTV A;  2G8W A;  3LDN A;  4CZJ A;  4FWM A;  2AP1 A;  3LM9 A;  4DTS A;  1YI2 N;  3S9H A;  1VSL A;  4WQ5 A;  4WFN L;  4Z4H A;  4JS5 A;  3EL2 A;  3VQ9 A;  3A8Y A;  3G10 A;  4CBX A;  3WT0 A;  3IAY A;  5C24 A;  4CHP A;  4HTL A;  3V81 A;  2LSN A;  5H1S Q;  1X9M A;  3HSC A;  1DTQ A;  3V6D A;  1VAZ A;  4JK8 A;  2A5X A;  2F9W A;  5HP1 A;  3H6E A;  4ISF A;  1EO1 A;  1KD1 O;  4FJJ A;  3DMJ A;  4NCB A;  3AVL A;  1JXE A;  4RW7 A;  4KRF A;  4X66 K;  3NH0 A;  3CFP A;  5GIO A;  1GLJ O;  1VQ8 N;  2W41 A;  1ZBL A;  3DOL A;  3WNH A;  4DF4 A;  3MX2 A;  3QEV A;  3HK2 A;  3NMU A;  4EP4 A;  1GLB G;  2OCE A;  3DXM B;  1ZBH A;  3VQC A;  5HRS A;  3G0Z A;  1VSH A;  1R59 O;  5ADX H;  5GAH P;  3V1O A;  2NRV A;  3CME N;  3AY9 A;  3S41 A;  1OKJ A;  1RBR A;  2VYP A;  3B8A X;  1VQM N;  3LP0 A;  3IMX A;  4KHU A;  3E01 A;  4GV3 A;  4Y1D A;  1OH5 A;  1ZBF A;  2VWJ A;  4BWJ A;  5FPE A;  2O8B A;  4M3U A;  4DSK A;  5GAG P;  1N36 K;  4JEP A;  1NM1 A;  4KHS A;  3O9Q A;  1EWR A;  3SPZ A;  2GX9 A;  4BRK A;  3PO5 A;  2P9L A;  4X64 K;  2GWK A;  5M1F A;  4L3Q A;  4GKJ K;  5BPM A;  1QTM A;  4H0Y B;  2ZJP L;  3SPY A;  4C8O A;  2IVO A;  2QI2 A;  5LMN K;  2KFZ A;  4AHC A;  3PO4 A;  1QSY A;  2OYQ A;  3O08 A;  4OPH A;  5JLF A;  3CD6 N;  2HVH A;  1GOC A;  2FC0 A;  1S1W A;  4JKH A;  4B08 A;  2ZGZ A;  1LAW A;  4IJA A;  3MXM A;  2FLO A;  1T03 A;  3O6W A;  5AQX A;  3AA5 X;  3ZSY A;  1K73 O;  4BDP A;  3ZT2 A;  3FGU A;  1RBV A;  3PUF A;  2HF3 A;  1C1C A;  1LWE A;  4IFE A;  4DR7 K;  2Q3S A;  4BG8 A;  1XWL A;  3O8M A;  3WNG A;  4CI6 A;  1U04 A;  2IGI A;  5JLH A;  1HJR A;  4K41 A;  1WLJ A;  4EHU A;  3D6R A;  4DSJ A;  4LFA K;  2BE2 A;  5FPD A;  4I7F A;  3CXC M;  4BR2 A;  3A5O C;  4CZL A;  2XY6 A;  2PZS A;  5KI6 A;  1XC9 A;  4JI6 K;  3HPG A;  3AO3 A;  3MCA B;  2GWJ A;  3VQQ A;  3E66 A;  3PX6 A;  1E4G T;  4ILJ A;  2HHW A;  4I9L A;  3ZT1 A;  4CZH A;  4BQZ A;  1TL3 A;  4AHU A;  3QB0 A;  1BHL A;  3AA3 A;  4LH4 A;  3A5L C;  2W6L A;  3NCI A;  1NGI A;  2YKN A;  4CEA A;  3BEX A;  3VMF B;  2HMP A;  3HI0 A;  1P8Z A;  1T6D A;  3HXM A;  4YDU A;  1OVY A;  1IBL K;  1BI4 B;  3RMC A;  3QEW A;  3H46 O;  4CZK A;  5GIN A;  2UXB K;  3AA2 A;  4IDK A;  1NJX A;  2VG5 A;  3T1Y K;  1WSG A;  2ZJR L;  1L3S A;  1T05 A;  4A59 A;  4JYA K;  2JWL A;  4JK7 A;  1SUQ A;  4W5Q A;  3WEE B;  4CER A;  3MN9 A;  4CGD A;  3R9P A;  1BQN A;  1NGF A;  3OYA A;  3NF7 A;  3DLK A;  3WXM B;  3VQ8 A;  3MEC A;  5M1O A;  3QEP A;  4C8N A;  1QQN A;  4Z4F A;  2NRZ A;  1WAJ A;  5KRT A;  2O4I A;  2E2P A;  3RSE B;  3FR0 A;  2O8E A;  3FZH A;  2HHT A;  3ZSQ A;  4BRQ A;  1A5X A;  3K59 A;  4WF9 L;  1NK4 A;  1QVG M;  1VQ4 N;  1ASW A;  1KFD A;  5JIC A;  4CJL A;  4O0I A;  3SUN A;  2G8H A;  4O5B A;  4OKJ A;  4Y1C A;  1LAV A;  1DT9 A;  2E1Y A;  3LDL A;  1QZ5 A;  4BG9 A;  1RTJ A;  3ZSO A;  2NRW A;  5AQQ A;  2FBT A;  2GUP A;  3M6G A;  4QS8 A;  3IRX A;  4QS7 A;  3AAP A;  3B6P A;  3U3G A;  4CFB A;  4Z94 A;  3UKR B;  1HNV A;  4FK2 A;  4PUO A;  4E1J A;  4BVP A;  5BPN A;  3HOS A;  4PKG A;  4N41 A;  2R7Y A;  2KZZ A;  4CD3 A;  4KHY A;  1NK8 A;  4KHQ A;  2A41 A;  4M3X A;  1HR0 K;  3O3H A;  2Q0U A;  1ZXO A;  3VGL A;  4QS9 A;  5KPT A;  3I56 N;  3LDQ A;  1FKO A;  5HOO A;  4F3O A;  3O1B A;  4CHQ A;  4DU1 A;  4FW1 A;  4QAG A;  5BN8 A;  4DKW A;  3EY1 A;  3TI0 A;  2ZJQ L;  5I9E B;  5AFU A;  3LWM A;  2E2N A;  3MXJ A;  4DFP A;  2D4W A;  4EHT A;  2DFH A;  1YXQ A;  5KQD A;  3DM2 A;  2H3G X;  4IOX A;  4LF7 K;  1C6V A;  1NOY A;  4H5V A;  1J5O A;  5BRF A;  4KB1 A;  3O1W A;  1GLE G;  4I2Q A;  3CIP A;  4YOX A;  4JI3 K;  1VSI A;  3KK2 A;  1YUW A;  5KGX A;  1ITG A;  4IEE A;  3P38 A;  1WNS A;  1YF5 L;  4RWT A;  4AIL C;  3NVM A;  2JWK A;  5HL7 L;  1RT6 A;  1UA0 A;  1WAF A;  1CLQ A;  2P9N A;  1IV0 A;  4OVL A;  1YVN A;  2G8U A;  1RDW X;  4LF4 K;  3AO2 A;  3OBW A;  4ID5 A;  1JCE A;  4W5O A;  4LFC K;  3CFO A;  3HT3 A;  4FZX C;  2F7T A;  4MFB A;  1U2V A;  3O9U A;  5CYM A;  4FJN A;  4B9Q A;  3KHY A;  2E6L A;  4FLY A;  1ASU A;  2KQ2 A;  3O4Q A;  2HBJ A;  3C0B A;  3CC4 N;  3ULD A;  2Z1G A;  4R79 A;  4U67 L;  2KHO A;  1HMV A;  2ATQ A;  1JKH A;  2Y1J A;  3F9K A;  1WN7 A;  1HRH A;  3S3M A;  2P9U A;  2CH5 A;  2QKB A;  3LZI A;  4FPB A;  1K8A O;  5AQP A;  2Q2R A;  3CET A;  3SK3 A;  5T7B A;  4AM7 A;  4XH5 A;  1MU2 A;  4BAC A;  1D9D A;  2HF4 A;  3VEW A;  3V9W A;  2YNI A;  4O4G A;  4HCB A;  3JS6 A;  5AQJ A;  4A62 A;  2QTD A;  2XY8 A;  4DR5 K;  2O4G A;  2P9K B;  3M8Q A;  1ZC6 A;  5AJ3 K;  3PX0 A;  4Z4G A;  4AHR A;  4CIF A;  3A0I X;  5EXW A;  2UXD K;  1W0H A;  1TVR A;  1SKR A;  1EKE A;  2QM1 A;  3MMV A;  1VHX A;  2O8B B;  4LF9 K;  4DHY A;  2ZM6 K;  4JD2 A;  3MEE A;  3S3O A;  3JSM A;  3NE6 A;  1HQU A;  3VQD A;  5C12 A;  1JXB A;  1TUU A;  4JKF A;  2OTL N;  2G8I A;  1KAX A;  3ID8 A;  1N32 K;  3NF8 A;  4DQ8 A;  4FJX A;  4FJG A;  3U9Z A;  2YHB A;  3RR8 A;  4K8X A;  1NGE A;  3K5N A;  3IKM A;  5KTQ A;  4CJ7 A;  4JKC A;  4CJE A;  2WUS A;  1WSE A;  3VA3 A;  4AHS A;  3VF6 A;  4M3Z A;  1KFS A;  2AJQ A;  1Q8I A;  1K8K A;  1T6C A;  5E84 A;  3RVC A;  3L2Q A;  5ADX A;  4FYD A;  4LSL A;  1Q82 O;  5AZJ A;  1QQM A;  3HBT A;  4DQS A;  3PLA A;  2UYT A;  3VOV A;  1N6Q A;  3P4I A;  4OGE A;  3OY9 A;  5KQ8 A;  2FSN A;  2ZGY A;  1RIL A;  3KK3 A;  1FW6 A;  1NGG A;  1JLF A;  1F21 A;  3C95 A;  2Z1I A;  3OS1 A;  1NK0 A;  4H5W A;  4RTF D;  3D2E B;  3AVK A;  4LF6 K;  3ENB A;  3KLF A;  1YIT N;  3IDH A;  4UY8 O;  4O55 A;  3G71 N;  2Z1J A;  3F5T A;  3HPO A;  4BRN A;  2FBV A;  4CJ5 A;  3KLG A;  2XY7 A;  3AVI A;  1BA1 A;  3LPT A;  1SQK A;  2CGK A;  3HP6 A;  2O8F A;  2VG7 A;  2XY5 A;  2OA8 A;  4J2E A;  4OLA A;  3WUH A;  3EEQ A;  1REV A;  3GE1 A;  4FK0 A;  5B8H A;  3M8P A;  5BR9 A;  3AAQ A;  5JMV A;  3AGK A;  4CGH A;  3RMB A;  3TAM A;  2EX3 A;  3OYL A;  5AZI A;  2OPS A;  4YDU C;  4RW4 A;  5AFU H;  4B8C A;  1TV6 A;  4BRM A;  4BVO A;  2G8F A;  3OYD A;  3M3Z A;  4RW8 A;  1VRT A;  3J80 O;  3I8B A;  3SUP A;  4CJT A;  3THW A;  3I0R A;  4KTW A;  3ATV A;  4OJR A;  3MAQ A;  4OGC A;  4AQY K;  3PIP L;  4F3T A;  4KKO A;  4CJP A;  3O4N A;  3HYF A;  1RDC A;  2Q31 A;  4EAH D;  3WXI A;  1W2B M;  1LW0 A;  4BDY A;  2NRT A;  4CIG A;  2X78 A;  5GIP A;  5DMR A;  4CF2 A;  2O8E B;  2QWM A;  1BU6 O;  5FLX O;  1NJY A;  2ZQB A;  3ENO A;  3ALY A;  1C0F A;  2FF6 A;  2A1S A;  2P9I A;  4PKI A;  1I3A A;  3M1F A;  3IG1 A;  4EIA A;  1SS6 A;  1NNE A;  3SV3 A;  4CJQ A;  3O3G A;  1D5A A;  2OPR A;  2WC9 A;  4B1W B;  4E7I A;  4DSF A;  3K9K A;  2FF3 B;  3QML A;  3NF9 A;  4E7H A;  4CZG A;  4JI4 K;  1X9J A;  1HQE A;  2ASM A;  1GLA G;  1C1A A;  3CQY A;  3L6Q A;  3J81 O;  1X3N A;  1IH7 A;  4EZ9 A;  2O8D A;  3DXK A;  3LP2 A;  2NNW A;  4A61 A;  3OYK A;  1OVQ A;  3M8S A;  2ZE2 A;  1YT3 A;  1JLQ A;  3BZC A;  4RW6 A;  3H3N O;  1TGO A;  3NH1 A;  4DSE A;  2ASO A;  1TKX A;  4FZZ A;  3V9U A;  2HVI A;  4IWV A;  1RBU A;  1IBK K;  1GLF O;  3L2V A;  5FRM A;  1S5J A;  3LM2 A;  4B1Y B;  4B1V A;  4YOV A;  2HNZ A;  1JJ2 M;  4ZTF A;  4DV5 K;  4ISE A;  4C8K A;  3CPE A;  1J54 A;  4DUY K;  5DM6 L;  4FO0 A;  3D2F B;  5M1P A;  3VQ6 A;  4H0P A;  1EWQ A;  4NYF A;  1GOB A;  1J9A A;  2P9S B;  3TR8 A;  4CFC A;  2RKI A;  2EWS A;  3PX4 A;  3BZK A;  1M90 O;  4FWS A;  3TTD A;  2UUA K;  4M45 A;  1TKT A;  1Z25 A;  4DTU A;  1B92 A;  1EET A;  4BY9 C;  1GLD G;  1VSM A;  2AA4 A;  4M7X A;  2E8A A;  1IJJ A;  4BRG A;  3IS9 A;  3CCM N;  1JLA A;  1RDU A;  2P9N B;  2E88 A;  4LY7 A;  3EZW A;  4JN4 A;  5AQH A;  2E6M A;  4O8K A;  5C42 A;  1ATS A;  3MK6 A;  4FJI A;  2PAV A;  1YJW N;  3VEX A;  1W7A A;  3LP1 A;  1U2V B;  3HPH A;  1WSI A;  1VRU A;  3G6E N;  4H0O A;  3VQP A;  3Q7B A;  3OYC A;  2VGM A;  4L8R B;  1HX1 A;  3KLI A;  3CFR A;  3AVJ A;  1C0M A;  1BUP A;  1V4S A;  1XMQ K;  3CMA N;  4IOA L;  2HBK A;  3HM8 A;  2DFF A;  3HVT A;  1YHQ N;  5LL6 Z;  1N5Y A;  4CHZ A;  2UUB K;  1GLL O;  4MO4 A;  3AV9 A;  3ZX2 A;  5F0X A;  5BRE A;  1SL2 A;  2VG6 A;  3AVB A;  1D9F A;  3THY A;  4H8K A;  4KI6 A;  3SYZ A;  3CC2 N;  4Q0B A;  2O8C A;  1CXQ A;  2DPN A;  4DTO A;  4CED A;  3HP9 A;  1LV5 A;  3LWL A;  3TAG A;  4KI4 A;  4DTN A;  1L3V A;  4HHT A;  3C94 A;  4YOT A;  1IKV A;  4MDA A;  4FWN A;  1O1W A;  2UU9 K;  3VEO A;  1J6Z A;  4B9N A;  4GY2 B;  3M8R A;  3HM9 A;  4ZTJ A;  3ZYY X;  1S6P A;  4JD2 B;  4NXM K;  3DRS A;  3K58 A;  2PY5 A;  1ILY A;  4BRP A;  4YOW A;  1EX4 A;  4LSN A;  1VQ7 N;  4FWR A;  5J2N A;  2P9P A;  4KFB A;  5C2F A;  3GG4 A;  1T3V A;  4CJW A;  4A57 A;  2A1R A;  4XH4 A;  1X9S A;  4HVJ A;  2KTQ A;  1N34 K;  3WXJ A;  4JKA A;  4KAZ A;  1TL1 A;  1NGA A;  2KLA A;  3JXU A;  3JAM O;  1U6Z A;  1Y97 A;  5JS1 A;  1OH6 A;  1W97 L;  3GL1 A;  4JV5 K;  2E5L K;  3KWI A;  3A5M C;  3MXI A;  3KLE A;  3FZF A;  3H1V X;  4N47 A;  4FJK A;  3VTH A;  3TAQ A;  5M1N A;  4EZ6 A;  3TAB A;  4PWD A;  2X74 A;  1BA0 A;  2GUI A;  4X65 K;  1QHA A;  2VQF K;  3CER A;  4DSI A;  4IXC A;  4JAX A;  3FFI A;  4DWI A;  4GKK K;  1Q86 O;  4GV9 A;  4JKE A;  3WQT A;  1NGJ A;  3CJC A;  3VEN A;  4DS5 A;  2YNF A;  2YNH A;  5AQR A;  3AVF A;  4FSV A;  1K6Y A;  4I2P A;  3KD1 E;  4BR7 A;  4JI7 K;  3UB5 A;  3WQU A;  2PYJ A;  5AQG A;  3VA0 A;  3QES A;  1WUA A;  4KV8 A;  1BL3 A;  1UWB A;  2OZS A;  4DFM A;  2VWK A;  4FJH A;  2A6A A;  4GW6 A;  4H0X B;  3HO1 A;  4H5R A;  1JLC A;  3RMD A;  3WXK A;  2QXF A;  3NGZ A;  4DFJ A;  4BC5 A;  3EYZ A;  4BC4 A;  3P1G A;  1I94 K;  3SV4 A;  1J5E K;  5IWA K;  4NLC A;  5AQK A;  4JKG A;  2Q36 A;  1S1X A;  4A2B A;  1SKS A;  4LF8 K;  4ELU A;  1TUY A;  1JL2 A;  1WBD A;  5EOY A;  3QIC A;  2G8V A;  4B1Z A;  3R3L A;  3L4I A;  3Q7C A;  2IVP A;  3SMP A;  3KLH A;  3SNN A;  4CBW A;  3KJV A;  1U47 A;  4DU4 A;  1KTQ A;  1CZ9 A;  3CCU N;  1HJO A;  3THW B;  1EP4 A;  4QCL A;  3C7N A;  4A5A A;  3CHW A;  5MLC Q;  3O4W A;  3HZ6 A;  3BF3 A;  2D0A A;  4B3T K;  4JKD A;  1GOA A;  4NCG A;  3QLH A;  2F96 A;  5J2P A;  4CK3 A;  2Y1I A;  5F1X A;  4NB4 A;  4CEC A;  4FM2 A;  3E9L A;  1KC8 O;  4JI0 K;  5AQV A;  1XNQ K;  1Q81 O;  2DTU A;  4YOY A;  2B6A A;  3V9X A;  3TSU A;  1KRP A;  3I55 N;  1DEJ A;  1C0G A;  4A5B A;  4CEB A;  1QSL A;  5M1Q A;  3VQE A;  3NFA A;  5FPM A;  3ULE A;  1BQM A;  4E19 A;  4CEE A;  3KK7 A;  5I3U A;  2QK9 A;  4ELT A;  3TTC A;  1Q9Y A;  3BP8 A;  4ZHR A;  2BTF A;  1NBW A;  2D0C A;  2RHK A;  4C1N I;  2ITG A;  2YHA A;  4OKE A;  1C1B A;  3DOK A;  1J53 A;  3LAK A;  1KVA A;  3F2K A;  4FWK A;  4BRH A;  3P31 A;  4B3R K;  3ENH A;  1T8E A;  2KW4 A;  3CCL N;  4OO1 J;  5AQU A;  4FVU A;  3L2U A;  1VQ9 N;  3SZ2 A;  3T69 A;  4HUE A;  3WNF A;  1QQO A;  3DXK B;  5GAD P;  3K5L A;  3N4Q A;  1R0A A;  3ZSV A;  2BDP A;  4JK9 A;  1X1P A;  4F2R A;  3FE1 A;  4FM1 A;  4WQ5 C;  2CGJ A;  3G25 A;  4KH5 A;  2IS3 A;  1S1V A;  4FOI A;  4IO8 A;  3L2R A;  5FRO A;  4BQL A;  1NLV A;  2YCH A;  2JLE A;  2BH1 A;  4K43 A;  1P90 A;  4GMJ B;  4IEI A;  2GBZ A;  1IG8 A;  3VF2 A;  3IUC A;  3QET A;  1ATR A;  3RRG A;  3L3V A;  3O9R A;  3ASM A;  3DWL A;  4FLX A;  1TAQ A;  4EFH A;  3VQ7 A;  2GEL A;  2A40 A;  1Z26 A;  2E1Z A;  3T7Z A;  3M5R A;  3DLB A;  2OZM A;  4CW7 B;  1VK0 A;  4DV7 K;  4OLB A;  4KHN A;  3F73 A;  1BG3 A;  1UAX A;  4CGG A;  4JLH A;  3QDK A;  4DV3 K;  1TK8 A;  2HHV A;  1LWF A;  1K9M O;  1FXX A;  1HKG A;  4FJ5 A;  1VSD A;  3G4S N;  3NVK A;  3DLG A;  2NRR A;  4MO5 A;  4DV0 K;  5JVH L;  4M3T A;  4OPJ A;  1XUP O;  5DK5 A;  4JKB A;  3SQ4 A;  3C6H A;  3DLL L;  4DTJ A;  4CF8 A;  4CCH A;  3LL3 A;  2FBY A;  4I6M A;  4BGA A;  5AQW A;  4FLZ A;  3SQ2 A;  1NKE A;  1WSH A;  2HHQ A;  5JS2 A;  5BR8 K;  2A3Z A;  2P9L B;  4KHW A;  3ZX3 A;  2GEM A;  1JL1 A;  2YV0 X;  2HBL A;  5M1K A;  1YIJ N;  2J4R A;  4BRE A;  3N4P A;  3O80 A;  5LJV A;  1KQS M;  1RT5 A;  1A5W A;  4DLE A;  3THY B;  2HMI A;  4CF1 A;  3BF1 A;  3MDQ A;  3PSI A;  1JLE A;  4O8U A;  3SBG A;  2V7Z A;  5EX5 A;  3AVN A;  3A5N C;  3O9S A;  3SQ1 A;  1N33 K;  3O5B A;  1KAZ A;  2WTU A;  3CPW M;  2CH6 A;  1S9G A;  3P39 A;  4E7K A;  2NZT A;  2QWO A;  3OJU A;  1HPZ A;  2VWB A;  2UXC K;  3L3U A;  3HVR A;  4CK2 A;  5C15 A;  4CHN A;  5BRD A;  4HUG A;  4DTM A;  5CZ1 A;  1EXQ A;  1UOC A;  1S9E A;  5BPL A;  1MDU B;  5AQL A;  4JI1 K;  2P9P B;  4PKH A;  5E41 A;  4HUF A;  3C6A A;  5AQT A;  1HNX K;  4FLW A;  4YFU A;  3QEX A;  2EHG A;  1BI4 A;  4GVM A;  1RDB A;  3VPZ A;  4CJF A;  3ZT3 A;  2QWL A;  5BRH A;  3K57 A;  4Y0W A;  3K0S A;  1G99 A;  3EKS A;  3UE5 A;  3DRP A;  3BDP A;  3ZSW A;  2UUC K;  4XH1 A;  5GAE P;  1RFQ A;  3SI6 A;  4IO9 L;  3W0L A;  4JHD A;  1SV5 A;  3OYG A;  4MQ3 A;  1BIU A;  3QER A;  2D5R A;  3B6O A;  3LAN A;  1LW2 A;  4DR6 K;  4IFV A;  4KBO A;  2GTD A;  3ID6 A;  1XI1 A;  4UQG A;  3BY5 A;  1BIZ A;  1WSJ A;  4XEI A;  1SKW A;  1NWK A;  3RSE A;  3EE9 A;  3NGY A;  2W42 A;  3L8B A;  2X6S A;  4IZ9 A;  3P5J A;  1RT4 A;  1OH7 A;  1ZYQ A;  1VQ5 N;  4AHV A;  3V1R A;  3AGR A;  2IVN A;  4F2S A;  3SAG A;  4N56 A;  3VGM A;  3J7Y P;  4WE1 A;  4GV6 A;  3TU5 A;  4CHO A;  3VEY A;  1D8Y A;  2RPI A;  3V4I A;  1MWK A;  3T19 A;  3ZX0 A;  5J1E A;  4NLB A;  3J7A P;  3TAR A;  2FXU A;  3I33 A;  2NUB A;  4FCY A;  3AVG A;  3GOI A;  3ZSR A;  3TAF A;  4H5N A;  3TSP A;  4JKG B;  2PFU A;  1VSJ A;  4IBN A;  2WBN A;  4E1M A;  3V9Z A;  3AA4 A;  2VCP A;  2PBD A;  2I7P A;  3KD5 E;  1TYQ A;  4JI2 K;  2QWN A;  4ICL A;  3QNN A;  4CEO A;  4OX9 K;  3THX A;  4M63 C;  2YI1 A;  3CF5 L;  1JLG A;  3OYI A;  4JI8 K;  3DLR A;  4O0J A;  3EN9 A;  2RF2 A;  1RBT A;  4BRI A;  4DR2 K;  4K8Z A;  4BRA A;  2PYL A;  2OPP A;  3TWH A;  4RW9 A;  4C8L A;  3V1Q A;  4DQQ A;  1TK5 A;  3C7N B;  3KTQ A;  3HJF A;  3OS2 A;  3U9D A;  3MCP A;  4B9S A;  4E3S A;  5AR0 A;  3DYA A;  3LAM A;  1U45 A;  1E3M A;  2QXL A;  1NK9 A;  4WQ4 A;  3D45 A;  4BRF A;  3OYF A;  4DSL A;  5CZ2 A;  1JLB A;  5J2M A;  2HBM A;  4AHT A;  5E26 A;  3ZEU A;  1HKC A;  4H4O A;  3ISN C;  1RNH A;  4XIU A;  1TAU A;  3OYN A;  3ULE B;  3MED A;  1D4X A;  4BC3 A;  3WNE A;  5I42 A;  1U49 A;  1BGX T;  5AQY A;  4CVN E;  5C0Y A;  3LDP A;  1WOQ A;  2HNY A;  2QW9 A;  1QVF M;  3CCR N;  2F8S A;  1YJ9 N;  4DTX A;  1YJN N;  4DQR A;  3ZLJ A;  4W5N A;  1BWF O;  3OS0 A;  3O3F A;  4B1X B;  2E20 A;  4CJ3 A;  4DR3 K;  3VQB A;  3RTV A;  3OYE A;  4LC9 B;  3GBT A;  3CYM A;  3QFU A;  4IJN A;  4KTZ A;  3TSQ A;  4M3Y A;  3AO1 A;  4CE9 A;  1SAZ A;  2XHB A;  2Q0R A;  3RRH A;  4OPK A;  3TAE A;  4YOR A;  4RCH A;  3VTI A;  1IBM K;  1KXP A;  4CGJ A;  4CFD A;  1IO2 A;  3CQX A;  1LOT B;  3LAL A;  4RG8 A;  4FWQ A;  4B9M A;  4H0V B;  1DLO A;  4J8F A;  3P83 D;  3UKU A;  1B9F A;  4FM0 A;  1X9W A;  1NOZ A;  1S1U A;  5CR4 A;  3R1X A;  2IAJ A;  1VSF A;  1ATN A;  1JCF A;  1DKG D;  4CK1 A;  3H45 C;  2HOE A;  1N8R O;  3J8A A;  1YTU A;  5AQF A;  1XMO K;  2G8K A;  3E1Y A;  4NCA A;  1RTI A;  1L5U A;  1XHX A;  3SJJ A;  5SZT A;  1NGH A;  3GDQ A;  2P9K A;  1CZB A;  3MN6 A;  2ZD1 A;  2BUP A;  2P9U B;  5AQM A;  1T7P A;  2KKZ A;  4KH6 A;  5J2Q A;  5IT9 O;  4DS4 A;  5CYQ A;  2B4J A;  1NG9 A;  4JRP A;  1CZA N;  3MN7 A;  1VQ6 N;  4CHY A;  3A2F A;  4FPA A;  3VQA A;  1S22 A;  4DV6 K;  1RT7 A;  2JGU A;  3KIO A;  2VQE K;  3PY8 A;  5SWM A;  4IKF A;  4N5S A;  1VSK A;  1VQO N;  4CBU A;  3OYH A;  3VN5 A;  2P1J A;  1X3M A;  3AVA A;  4M3R A;  3ZSZ A;  4H4M A;  3OA9 A;  1QSS A;  1NJW A;  4B3S K;  4QOZ B;  4I6M B;  3NGI A;  1BDG A;  4CZI A;  3LZJ A;  5EU7 A;  4H0T B;  5HLF A;  5KRS A;  3CJA A;  4FL9 A;  3SUQ A;  4BGB A;  4DU3 A;  2A42 A;  2E2Q A;  3BUZ B;  4DQP A;  3OBY A;  2D0O A;  4LD0 A;  4DR1 K;  1VSE A;  4IG3 A;  3U8X A;  3C6U A;  1NKB A;  4B3M K;  3ZET A;  4C23 A;  3T1H K;  5DM7 L;  1Q18 A;  3CI5 A;  3PIO L;  1K8K B;  3MEG A;  3QIN A;  4W5T A;  3D7E O;  3DRR A;  4FJL A;  5LMU K;  2BAN A;  3WXL A;  3D2E A;  1UA1 A;  4KPY A;  5AZJ B;  3R8E A;  3MN5 A;  4DV1 K;  2D1K A;  2V7Y A;  2V52 B;  1RT1 A;  4M41 A;  4E7L A;  3C6T A;  4TSX A;  3LDS A;  4ELV A;  1S1T A;  1RGI A;  3FZM A;  2IC3 A;  1XHZ A;  4PQU A;  2X6N A;  3SUO A;  5CE3 A;  4JNE A;  5AQO A;  3CJ9 A;  4FWP A;  4Z0U A;  4CEF A;  4FK4 A;  3VEZ A;  4F9O A;  4WYB A;  2V51 B;  4BC2 A;  4IDH A;  3TPQ A;  4BWM A;  1Z6R A;  1RDA A;  1FK9 A;  1RTH A;  3H1Q A;  4PHT X;  2HHU A;  4FLV A;  4BR4 A;  4DQI A;  3CG7 A;  5HRN A;  4CEQ A;  1Q7Y O;  2BGG A;  5EVZ A;  1ASV A;  4DMN A;  3U3Y A;  1YTA A;  4JHD B;  2O8F B;  1S72 N;  1KLM A;  1LWC A;  4CGI A;  3MWP A;  4CZM A;  1BO5 O;  4DCH A;  3S3N A;  1HYZ A;  4R5P A;  3C65 A;  4E89 A;  3LDO A;  4HTU A;  1HPM A;  4NYN A;  4BRD A;  5AZI B;  1XNR K;  4FXD A;  3AVM A;  2QWP A;  3H08 A;  1VQK N;  3R6M A;  2FSJ A;  4PL8 A;  4G1Q A;  3CCQ N;  1FJG K;  3SAH A;  5K14 A;  4U7B A;  1NJZ A;  1RT3 A;  2YHY A;  1WBB A;  2F8T A;  3CCS N;  4WFB L;  3J7Z O;  3AVC A;  4DR4 K;  4E1N A;  4F8R A;  3UIQ A;  4NXN K;  1WB9 A;  2ZF5 O;  3L0Q A;  2KZM A;  4A2A A;  4JS4 A;  3D0P A;  2Q1N A;  5KGW A;  1KAY A;  1KSP A;  1HUX A;  1NGB A;  1MA9 B;  3VF4 A;  1ZBI A;  4CZE A;  3AO4 A;  4CJK A;  3CJB A;  4IFY A;  3QFP A;  2ITM A;  4B9U A;  1RT2 A;  3VET A;  2P5G A;  3ATU A;  3IFR A;  4B9V A;  1OH8 A;  3DLH A;  1TYQ B;  2P9I B;  4FWL A;  3HOT A;  4FVM A;  3AAR A;  1QHT A;  5TKW A;  4CJU A;  3THX B;  2YHW A;  1O13 A;  1NGD A;  3HST B;  3FZK A;  3VEV A;  4GNI A;  3MWT A;  1HYS A;  2WOM A;  3EO3 A;  1ZBU A;  3CM5 A;  2YJE A;  2HHS A;  4ILH A;  2CGL A;  5C2D A;  4YOU A;  3VQ5 A;  2IDO A;  2O8D B;  3EKU A;  3D2F A;  3NAE A;  3FLC O;  2HB5 A;  2P9S A;  2QKK A;  3RWU A;  4WQ4 C;  1B9D A;  2QEX N;  4CGF A;  4W5R A;  3OVN A;  1QQC A;  3F9M A;  4H5T A;  3CJ7 A;  1V4T A;  4ILG B;  4DUZ K;  2HW3 A;  4BR0 A;  3NHG A;  1HNW K;  1T44 A;  3ZEU B;  3NBP A;  4CEZ A;  1YAG A;  2W6K A;  5C10 A;  4Z4C A;  3CCJ N;  4BRO A;  1H1V A;  4FJ9 A;  1HYV A;  3DAW A;  4CJR A;  1U4B A;  4IG0 A;  5ELZ A;  4CJV A;  3DXM A;  4E7J A;  4OKK A;  1U48 A;  1SL0 A;  4Z4E A;  1ZBS A;  3CC7 N;  4JRQ A;  4B8A B;  2NRX A;  3V9S A;  4WCE L;  4CF9 A;  3OW2 M;  3OYM A;  4Q5V A;  3QBW A;  2QWQ A;  3PSF A;  3QIP A;  1RDD A;  4YHH K;  4MLE A;  3VQ4 A;  5KPR A;  4N76 A;  1M1K O;  4KO0 A;  4AH9 A;  2B5J A;  1MWM A;  4C8M A;  3ZCM A;  1XQS C;  4GVE A;  1IKX A;  3OJS A;  3OHR A;  2E4L A;  5HRR A;  4C1N K;  3K5O A;  4BRL A;  1QE1 A;  1HKB A;  3OYB A;  1L3U A;  3QNO A;  1VQL N;  1BIS A;  4DF8 A;  5LJW A;  4G9Z A;  1TK0 A;  3UKU B;  1RTD A;  3I0S A;  4DLG A;  3T1A A;  5BN9 A;  1DGK N;  3THV A;  3E9O A;  3EZ5 A;  2VGN A;  3K2P A;  3CQ8 A;  4BDZ A;  5C25 A;  2YNG A;  4DB3 A;  4X62 K;  3CCE N;  1NK6 A;  2XRI A;  4HCC A;  4FJ7 A;  4FLT A;  4KTQ A;  3LP3 A;  1Z05 A;  3EE8 A;  1NGC A;  1NMD A;  3SAF A;  4B1U B;  3ZSX A;  4MLH A;  2HHX A;  5JVG L;  2IIR A;  3CJ1 A;  5AQN A;  2YJF A;  3U4L A;  2WFB A;  4M3W A;  3SCX A;  2DY4 A;  2W40 A;  4AM6 A;  3DI6 A;  4M7Y A;  3VER A;  2XO7 A;  3KZB A;  3PV8 A;  1E4F T;  4FZY A;  3HRG A;  2YKM A;  1BOT O;  1S6Q A;  3E9P A;  1BCM A;  4BRC A;  1BCO A;  2F4V K;  1YVU A;  2O8C B;  3KKR A;  4YNQ A;  4H03 B;  4B9L A;  1RCH A;  4K42 A;  4BR5 A;  5FPN A;  1KVB A;  3ITH A;  3MX5 A;  1QZ6 A;  5D3G A;  2D0B A;  1JCG A;  3K5M A;  4V19 S;  1TKD A;  4O44 A;  1LCU A;  1NU0 A;  1NK7 A;  2QWR A;  3VES A;  2D0P A;  2P51 A;  4CJS A;  2Q97 A;  3I8D A;  2WON A;  2FBX A;  4MDB A;  4CES A;  3OYJ A;  1C0U A;  4KHP K;  1IG9 A;  4DV4 K;  4OPA A;  3KKS A;  1CXU A;  3BGR A;  4HWI A;  3FZL A;  5F2R A;  4K25 A;  4FJ8 A;  1NMN A;  3SQ0 A;  3TAP A;  3ZET B;  4CZF A;  4FJM A;  2FSK A;  5CY4 A;  3AO5 A;  2NRH A;  1XC3 A;  4DFK A;  2F9T A;  3SLC A;  5FDL A;  1ESV A;  2OPQ A;  3AVH A;  4DG1 A;  2HHH K;  1HNI A;  3JYT A;  4LF5 K;  3O9T A;  4NO7 A;  3CCV N;  4B9T A;  1L3T A;  4FW2 A;  4IOC L;  3WEE A;  3CM6 A;  3ZT4 A;  1VQN N;  1RBS A;  1WSF A;  3H3O B;  1EQY A;  3TTF A;  4CD1 A;  1DTT A;  5EY4 A;  1Y64 A;  3FFK B;  4KRE A;  3KVG A;  4ID1 A;  1NK5 A;  1I39 A;  4CF0 A;  2NLX A;  3QBX A;  4J2D A;  5AQI A;  4K0K K;  4F4K A;  4FLU A;  2Z1H A;  4JI5 K;  4LH5 A;  1S3X A; 
#chains in the Genus database with same CATH homology
 1I94 K;  1XMO K;  1J5E K;  5IWA K;  4OX9 K;  4JI8 K;  2UXC K;  4X66 K;  4LF8 K;  1HR0 K;  4LFA K;  4DR2 K;  1IBK K;  4JI6 K;  2UU9 K;  2F4V K;  5IT9 O;  4JI1 K;  4DR5 K;  4DV5 K;  4DUZ K;  5AJ3 K;  4LFB K;  4NXM K;  1HNX K;  4DUY K;  1HNW K;  4CW7 B;  2UXD K;  4DV6 K;  4DV7 K;  2VQE K;  4V19 S;  4B3T K;  4LF9 K;  2ZM6 K;  3J80 O;  2UUC K;  4DV3 K;  1XNR K;  1IBL K;  2UUA K;  1N34 K;  4DV2 K;  4KHP K;  4DV4 K;  2UXB K;  4AQY K;  1N32 K;  3JAM O;  4JI0 K;  4LF7 K;  1XNQ K;  3T1Y K;  1FJG K;  4DV0 K;  4B3S K;  4CVN E;  1N36 K;  4DR6 K;  4JV5 K;  4JI3 K;  2E5L K;  3OTO K;  4JYA K;  4YHH K;  4DR4 K;  4X64 K;  4DR1 K;  4DR3 K;  4GKJ K;  5A2Q O;  2HHH K;  4NXN K;  5FLX O;  4LF5 K;  5LMN K;  1HNZ K;  4B3M K;  4X65 K;  2VQF K;  3T1H K;  5BR8 K;  4YY3 K;  4GKK K;  3J7Y P;  4LF4 K;  4LFC K;  4B3R K;  5LMU K;  3J7A P;  1IBM K;  4DV1 K;  1XMQ K;  4JI7 K;  4X62 K;  4K0K K;  4JI4 K;  5LL6 Z;  4LF6 K;  3J81 O;  2UUB K;  4JI5 K;  4DR7 K;  1N33 K;  4JI2 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...