4JI1K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji1K00
4B3SK 3J81O 4KHPK 2UUBK 4LF9K 4X65K 2E5LK 4JI5K 4V19S 4JV5K 2VQFK 5FLXO 4LF8K 4X66K 4X62K 1IBLK 4DV6K 1J5EK 2F4VK 4GKKK 2UXCK 5LMUK 2UUAK 4DR1K 4B3TK 4JI4K 4DV5K 4JYAK 4DUYK 1XNRK 2HHHK 4LF7K 5AJ3K 2UUCK 4LF4K 3T1YK 4LF5K 4OX9K 3JAMO 3OTOK 4LFBK 1N32K 3J7YP 1N33K 1XMQK 1N36K 4DR3K 4DR4K 4NXNK 4B3RK 1HR0K 1IBMK 4DR6K 2UXBK 4JI1K 4LFAK 1IBKK 4B3MK 5A2QO 2UU9K 4JI3K 4JI6K 4CVNE 1FJGK 4JI8K 4DUZK 4LF6K 4DV4K 2UXDK 1HNZK 3J7AP 1HNWK 1HNXK 4DR7K 4DV3K 5IT9O 4DV2K 2ZM6K 2VQEK 4AQYK 4X64K 4DV0K 1I94K 3T1HK 4NXMK 4JI0K 4LFCK 4DV7K 5IWAK 1XMOK 5BR8K 4GKJK 4YY3K 4DR5K 4JI7K 1XNQK 5LMNK 1N34K 4CW7B 3J80O 4DV1K 4DR2K 4JI2K 5LL6Z 4YHHK 4K0KK
chains in the Genus database with same CATH superfamily
3H1QA 4KRFA 4F3OA 2QK9A 1RBTA 3HI0A 2E88A 4YFUA 4JK7A 4CEZA 2DPNA 1C1CA 4PUOA 3NVMA 4I6MB 2A5XA 4M42A 5SWMA 5H1SQ 1X9JA 4BR2A 1TL1A 5T7BA 1RT7A 4GV6A 4CK1A 3T3FA 5LMUK 2E6LA 4HCBA 1QE1A 3SPZA 1HYSA 3CFOA 3V9UA 2QWPA 4FSVA 5EU7A 1TK5A 4BROA 4DV5K 4OGEA 4DUYK 1NBWA 1GLBG 2OZMA 3AGKA 3L4QA 3SMPA 3VEXA 4KI6A 4B1VA 3D2EA 1D9DA 2Q0UA 3TPQA 4B1XB 4BC2A 1XWLA 3NF8A 2D0CA 4C8LA 4M3TA 1LWFA 4FJ5A 5M1QA 1O1WA 1RDCA 1N36K 3T19A 1LW2A 4B3RK 4BR0A 3CJ7A 4I6MA 4FCYA 3AAQA 3DXMB 4OPHA 3VESA 3HK2A 4W5QA 3QFUA 3HPOA 3TARA 3QB0A 4A2BA 2NRTA 4HUEA 5HP1A 1L3UA 3PX0A 4LF6K 5HBMA 4AF1A 2RKIA 3SNNA 1YJWN 2E20A 3CC7N 3QDKA 2ITGA 2ZM6K 3GDQA 4A62A 4FLWA 2BTFA 3PLAA 4A57A 3LPUA 2VYPA 3G0ZA 3G71N 3HZ6A 4ISFA 1ATRA 4RCHA 3B6OA 4JKHA 4WFNL 3OYDA 4DU3A 2Q36A 4BRNA 5FPEA 4IEEA 1LOTB 1YXQA 3S9HA 2QEXN 1OH6A 4CZGA 4Y1CA 3CM6A 2A42A 1RT1A 3DXMA 4CZLA 4PWDA 5GADP 3DRPA 3O3GA 3OS2A 4CIGA 4Q5VA 4KO0A 1VSKA 4WF9L 4KREA 4JI5K 1S22A 2CH6A 3NVKA 2F7TA 2V7YA 4CJLA 3E01A 4EHUA 1D4XA 4KB0A 1C0UA 4BRMA 1LV5A 2RHKA 3K5LA 3GOIA 3VERA 2ZJQL 4JYAK 2HHQA 2OTJN 4IFVA 3DLRA 4Z4FA 4I9LA 4H03B 4B9UA 2QWMA 1S5JA 3TTDA 2CGLA 3F9KA 2HF3A 2I5JA 1H1VA 4JRPA 1GLAG 4E1NA 1K8KB 2X6SA 3PX6A 4FWLA 3OHRA 4Z4IA 3A2FA 4CJSA 1TK0A 2KZMA 3MN5A 1Q81O 3THYB 3E9LA 4DHYA 3C6TA 4C8MA 4CJKA 2YI1A 1S1TA 3OYJA 1IBMK 4O5FA 3OYKA 2Z1HA 3ISNC 3DLLL 4DSJA 4EZ9A 2KHOA 3OYMA 3VQ6A 5F0XA 3VA3A 5EOYA 2HHXA 1S1UA 2ZE2A 1XQSC 2Q0RA 5AQQA 3HBTA 4DF8A 5DK5A 4Z0UA 4L8RB 1NLVA 4DU1A 1NK5A 1G15A 1IG8A 1RTJA 2WFBA 5GINA 1WAFA 2FXUA 4JKCA 2O8DB 3S3MA 5HLFA 3AO2A 1K8KA 1EQYA 4IWVA 3CERA 5BN8A 4N5SA 1RDUA 4KAZA 3THYA 3QEVA 5ADXA 3SAGA 4KH5A 4GNIA 5F2RA 4AM6A 1MWKA 4DF4A 4PY5A 1N8RO 3M5RA 3AAPA 1VK0A 3CJAA 1Q86O 4RW6A 4C8NA 4QS8A 3SUOA 3J7ZO 1NK9A 1VRTA 4BR9A 4EP4A 2GX9A 3V81A 3AVCA 1FK9A 3K59A 3QO9A 2OCEA 5AQUA 2F4VK 4GKKK 3CM5A 1GLJO 2F9WA 4CJRA 4B08A 4DR1K 5BRFA 2IDOA 2FF6A 4RG8A 3A0IX 4C23A 4LC9B 3CCQN 1ZBHA 1NGDA 1UWBA 3ULDA 1Z05A 2OZSA 1BUPA 2O8DA 5MLCQ 1UAXA 1YUWA 1BO5O 5HRRA 5LY3A 1NJXA 3U9DA 3N4QA 3P4IA 4KI4A 1NGEA 3CG7A 4CBUA 1YVNA 4DQRA 4AHRA 5AFUA 3RTVA 2ZGZA 3AVIA 2ATQA 3IFRA 1IV0A 3EZ5A 3CCUN 4QAGA 3GL1A 1NGHA 2HBJA 2GEMA 4NLCA 4NCBA 1ZBIA 4DR3K 1QZ5A 3VEWA 3AARA 4DTJA 2YHBA 3M1FA 5AQOA 3QETA 4LFAK 4YOTA 5HOOA 3CCJN 1BHLA 4IJAA 1S1XA 4FOIA 3VGKA 3CCLN 2IVPA 2E1YA 4JS4A 2ZJPL 3C6AA 3BDPA 4IFEA 4FLYA 3DOKA 4B8AB 4JK9A 1GOAA 4CJ7A 2HHTA 2ASPA 4DFJA 5JVGL 4E7KA 1HUXA 4YDUC 1WNSA 1BISA 3MWTA 5AQRA 4NXMK 4JI0K 4H0YB 4HUFA 4J2BA 2E6MA 1DKGD 4ZTJA 3LM9A 2Q31A 3O1BA 4IDKA 3DJCA 3KWIA 4H8KA 1P8ZA 3VA0A 3NGIA 4NYFA 2FSJA 3H3OB 1L3TA 1VQ9N 1HJOA 5LL6Z 4ZHRA 2Z1IA 5KGWA 1QSSA 3ZT4A 5CY4A 4CD3A 4CGDA 3RSEB 2UUBK 4OKKA 3CF5L 4K41A 3O9QA 4DFPA 2P51A 3MECA 3NF7A 5LJWA 4JS5A 1KTQA 2NRHA 2YNGA 2XY5A 1YVUA 4BE0A 2AA4A 3S41A 4CF2A 1NGJA 1IBLK 3VEVA 1S1VA 1EKEA 1T3VA 1MWMA 1RNHA 3L3VA 4JKBA 3T69A 3AA2A 3O3HA 1XI1A 1ILYA 4WQ4A 4HUGA 3CCRN 1NWKA 2I7NA 4I7FA 3CJ1A 4J2AA 3EE9A 5AQTA 1C0TA 4LSLA 4H4OA 1XNRK 1RBSA 3EY1A 4MDBA 4LF7K 2DTUA 2DFEA 3ZT3A 3SUQA 3CCSN 3Q7BA 4BDPA 3U3YA 2KLAA 5ADXH 3CETA 4FOEA 5HRSA 4CESA 2YHWA 3OW2M 4OLAA 2A1SA 5M1NA 3LAMA 5HRPA 3TR8A 2ITMA 1GLEG 3ZLJA 3FGUA 3RSEA 1XC9A 2RPIA 1X1PA 1HR0K 3A5NC 1NK6A 1GOCA 2VWJA 3LP2A 1N6QA 3O6WA 3THVA 4J2DA 4BRDA 4JI8K 5AQIA 5KPZA 3UKUB 4KPYA 1NMDA 1SAZA 4JAXA 2BH1A 1WSFA 4WCEL 1EWRA 3T7ZA 4JEPA 2FF3B 4DTSA 4CJTA 3VQEA 4DWIA 4Z4CA 3SQ0A 4DQPA 3NF6A 5IWAK 3CQXA 4MLEA 2FC0A 3MXJA 1W97L 3S3NA 4KV8A 1RFQA 4A5BA 1MDUB 5LMNK 2A40A 4DS5A 4CW7B 1NJYA 4RTFD 5CZ2A 4A59A 5KTQA 3SJHA 3DYAA 3JSMA 2RN2A 1KCFA 1TL3A 3H3NO 3CPEA 2HBMA 3SYZA 4KHPK 4PKIA 1Z25A 4DQQA 5FRMA 3FE1A 3TAGA 4CF0A 3UKUA 1Q18A 3HSCA 3VPZA 5GIOA 3TSUA 3U4LA 4KH6A 2PYLA 3KLFA 3KK3A 1KC8O 4B3TK 2XY7A 4FWNA 4DCHA 3DLHA 1DT9A 2E2NA 4CF8A 2ZJRL 4BC4A 4RW4A 3FZHA 4H0XB 4DTNA 4BVOA 3M8SA 4EHTA 1RT3A 3CD6N 4FJLA 1TKDA 4IO9L 1VQ6N 1QZ6A 3OYLA 5KQ8A 1LCUA 1HKBA 5B8HA 1ATSA 2G8IA 3D45A 4U67L 4BC3A 3LWLA 1CLQA 5F1XA 4DR6K 1BQMA 3HM8A 3WXKA 4CEAA 4B3MK 4RW9A 3V1QA 1VAZA 2GWKA 4JD2B 3SAHA 2UXDK 1OH7A 3W3DA 1B92A 3TU5A 1D8YA 3ZETB 1JLAA 1HKCA 5IT9O 1LWEA 1JL2A 1RGIA 1NKEA 3VF2A 4DKWA 4BGBA 2OA8A 3R6MA 5AQGA 1SQKA 1I94K 4YOXA 3MEEA 2QW9A 5HL7L 1C0FA 3AO3A 3PIOL 3AVHA 1I3AA 2E2QA 4GV3A 1U48A 3ZT2A 1VQ4N 1NJIO 4R5PA 3PV8A 4BE1A 3LDPA 4GV9A 4C8KA 1RDAA 4AHSA 3O8MA 3ZSQA 1WOQA 1CXQA 3D0PA 4FWMA 4E7JA 4HVJA 3LZIA 3MCPA 5AQKA 4BVPA 4E0DA 1HQUA 1NNEA 4LF9K 3JYTA 4JD2A 5KQDA 3HTVA 1ASUA 5GAHP 4ZTFA 3ZETA 1RTHA 4C8OA 3DLBA 4N41A 1BOTO 3QEWA 2ZWHA 1U45A 3OYNA 3L6QA 1BQNA 3WUHA 3CQ8A 1HNVA 4NB4A 3OY9A 1REVA 3DRSA 3LZJA 1X9SA 2PFUA 4CIEA 3FZMA 4C1NK 4CJPA 4DTOA 1VSLA 4J2EA 3F2KA 3HO1A 4E7LA 1XHZA 3MN7A 1NOYA 4B3OA 1DGKN 4FO0A 1JLGA 3GE1A 1SL0A 1NM1A 4H5RA 3VQBA 3M8RA 4B8CA 3OTOK 4PL8A 1KAXA 1YITN 4FK4A 1OH5A 4BACA 3PSIA 2ZF5O 4BRQA 2UXBK 4CCHA 1HX1A 2D0AA 5AQFA 4B9TA 4Y0WA 1QQCA 4J8FA 4JI3K 2P9IB 4A5AA 2GUIA 3IAYA 3FZFA 1Y97A 3U6FA 4DLEA 4JN4A 4DUZK 2QWLA 3WNHA 2HW3A 2X6NA 4DQ8A 4FLUA 3SUNA 5C15A 3HJFA 1JJ2M 3AVJA 1TAUA 3BZKA 1GLLO 1RTDA 3NDKA 3TAQA 2VGMA 3AO1A 4OJRA 4LFCK 1RTIA 4FJ7A 4CZMA 3K5NA 4CJ3A 2JWKA 1ZBUA 2XY6A 2O8FB 4H0PA 2VWKA 4YY3K 3QMLA 5BPMA 3VQ9A 1R59O 1WB9A 4ILGB 2HHSA 3A5MC 2G8WA 4M41A 1HJRA 3SBTA 4MLHA 2PZSA 4CZHA 4JKFA 3RRHA 3LWMA 2FSKA 4M3UA 1BG3A 2P9IA 1VQLN 1VSEA 3PX4A 4BRAA 1KVCA 4DU4A 5FLXO 3U3GA 2NNWA 1YTAA 1KFDA 1OH8A 2ETJA 4W5RA 1M90O 4MO4A 1Z6RA 4IBNA 4DQSA 1J5EK 3O9UA 4JKDA 2HOEA 1HYVA 3QEXA 4Q0BA 1BDGA 3HRGA 2Y1IA 2YNHA 5AQLA 2KFZA 3LDNA 4CJQA 4CECA 4ICLA 3TWHA 1NJWA 5AJ3K 1RCHA 2O8FA 4M3ZA 2O4IA 4UY8O 5J1EA 5GIPA 1JLCA 4OX9K 1QS4A 3HPGA 3VQ8A 3O9SA 5GAEP 2YHYA 5C10A 1W0HA 3AA4A 4DB3A 4B1YB 1W2BM 1N33K 3VEZA 1YF5L 1NGBA 2W6KA 4AHVA 1EO1A 3KLIA 1VQ5N 3ALYA 2HB5A 3V9SA 3C7NB 4FPBA 3KD1E 1J6ZA 4DTUA 1WN7A 1BWFO 1BL3A 2BE2A 2WUSA 4HWIA 3CCMN 4YOWA 3TANA 1X3NA 1TGOA 1X9WA 4BR5A 3HT3A 1FKOA 1HYZA 1C1BA 3H08A 1Y64A 3I0RA 4BE2A 3WXIA 4NLBA 5J2PA 1J53A 3ZX3A 4FJ9A 5CE3A 3SAFA 3AVMA 5FPMA 4DSIA 3BF1A 3HYFA 4RWTA 2Q1NA 4YOUA 1BIZA 5AQXA 4CD1A 2O8EB 4E1MA 4CF9A 1YI2N 1IG9A 1EETA 2V7ZA 2KW4A 3K5OA 2KFNA 5JS1A 3IDHA 4JLHA 1TKZA 2QXFA 3C7NA 3H6EA 4O5BA 2DFHA 3AVBA 4DSEA 4EAHD 3ATVA 4JK8A 1NJZA 4FM1A 1WUAA 5CHIA 1HPZA 2GWJA 5AQNA 4IDHA 5JLFA 3V1RA 4PL7A 3DI6A 5EY4A 3D2FB 5J2QA 1QQOA 3H1VX 5C12A 3SJJA 4B9QA 4OPAA 1GOBA 2A41A 3CXCM 2P5OA 4QOZB 1BI4B 3DAWA 3HP9A 4HHTA 4I2PA 4MQ3A 3QEIA 1ZC6A 5C24A 4LH4A 4OVLA 3THWB 4QS9A 2Q2RA 3MEGA 3K5MA 3CYMA 2O8EA 4L3QA 4B9LA 2BUPA 3NHGA 5HROA 4NO7A 2ASMA 4RW7A 3C65A 4ELVA 2X78A 4BG8A 2NRZA 2WOMA 1RT2A 1NK7A 1S6PA 1BU6O 4FJKA 4WE1A 1TK8A 3F9MA 1VSMA 1VQMN 3CI5A 1JXBA 3D2FA 2NZTA 3ZT0A 3OYBA 2HHUA 2NRVA 2PBDA 4M63C 2QKKA 3G25A 1S1WA 4PKHA 3G10A 1BI4A 4DV3K 1SL1A 3UIQA 4M3WA 2WONA 3E1YA 1KVBA 3SCXA 3THWA 4KBOA 3TTCA 4CF1A 5AZJB 2FSNA 3QIOA 4BRFA 4CHZA 2IAJA 4CJ5A 3O9TA 3RMBA 3KHYA 2BDPA 4KHUA 2V51B 4DG1A 3CMEN 4YDUA 2FBTA 3AY9A 3UE5A 1TAQA 3VQCA 2OPRA 3GBTA 2Y1JA 3OJSA 4DSKA 3SPYA 2XRIA 3PUFA 3QFPA 4CZEA 2G8KA 3BP8A 4FWKA 4IFYA 3ZX0A 4OKEA 1N5YA 4F4KA 1OVYA 3DLGA 1ASVA 2IOCA 3HVRA 3TTFA 1RBRA 4CJVA 3LM2A 2HNZA 3ZSYA 4I9QA 1BGXT 4Z4HA 3AO5A 4BR7A 4AM7A 3CMAN 1JLEA 3O1WA 5AZJA 4R79A 2E2OA 4NCAA 4IJNA 3SLCA 3EN9A 3ATUA 4B9NA 3GG4A 5CR4A 4C1NI 3I8BA 3IG1A 3DLEA 3VQPA 1RT4A 2V52B 3BY5A 5AQJA 4OPKA 4YOVA 3EEQA 1N32K 1S9GA 5EVZA 4HTLA 2OPSA 1XMQK 3ENOA 1MU2A 3SZ2A 1ITGA 4CJ4A 4FJNA 3L2QA 4XH1A 3S3OA 4CJUA 4CFBA 1U4BA 1TUUA 2BGGA 2QKBA 3CCEN 1RT6A 3LL3A 4XIUA 1IBKK 5A2QO 3AVAA 1QQNA 4KHWA 4CVNE 3ZCMA 3VQQA 1FJGK 4AHCA 3NBPA 4E7IA 3J7AP 4IOAL 2ZQBA 3TAFA 3VTIA 3HPHA 3O9RA 2ZD1A 3DLKA 4O0IA 1T03A 5M1PA 1QQMA 2IVOA 2D5RA 3PIPL 3NAEA 4EIAA 3QERA 3PO4A 3MN9A 4ISEA 3KKRA 2CGJA 4BWJA 4YORA 3A5OC 3A8YA 3KWGA 4CJEA 5JLHA 3O3FA 4DMNA 5JMVA 4K43A 4IOCL 3SI6A 2F8TA 2UYTA 4BRGA 2FBVA 1IJJA 2QWNA 3NH0A 1TKTA 2R7YA 1FW6A 2QWOA 1L3VA 2HF4A 2WC9A 4O44A 1IKYA 5AQHA 3WXJA 3LDOA 3KK1A 3EZWA 4CGFA 2E5LK 1IH7A 2RE2A 3MAQA 1VQNN 1TUYA 4BRPA 4EFHA 1C0MA 5DM7L 4W5TA 4BG9A 3FLCO 2W42A 3WNFA 3SK3A 1L3SA 1KXPA 1WSJA 4ILJA 3OS1A 4KKOA 3HVTA 5C2FA 2G8FA 1IKVA 3RR8A 3KVGA 5M1FA 1QSLA 1VSDA 2JLEA 4PA1A 2HNYA 1K6YA 2YJEA 5AR0A 4BWMA 3SV4A 4FLTA 2HHHK 4CJFA 1V4SA 1U04A 1UA1A 1VQKN 3VTHA 4ILHA 3QNNA 3EO3A 4I2QA 4HTUA 2HVIA 4LFBK 1JLFA 4DS4A 2P1JA 5FPDA 4CERA 4CGHA 4KHSA 3H45C 3CJBA 3FFKB 4DSLA 1RILA 3FZKA 3QIPA 4FLXA 4E89A 1I39A 2UU9K 2F8SA 4FM0A 4HCCA 3W0LA 2KKZA 3OBYA 1WSIA 4YNQA 3B6PA 1HNWK 1WSEA 4UQGA 4JRQA 1CZ9A 1BCMA 4AQYK 1YJNN 5C2DA 3L8BA 2XHBA 1JCGA 5M1OA 3EKSA 3L3UA 3L2VA 3T1HK 4DV7K 3M6GA 1EP4A 2GTDA 3MWPA 3TAMA 4WYBA 1RBUA 1DTTA 2G8UA 2D1KA 3O4NA 5FROA 4CFAA 4B9VA 1R0AA 1RBVA 4CEQA 4FPAA 3DXKB 3SQ4A 3AVLA 1WSGA 3E66A 3NH1A 3P5JA 4CE9A 5ELZA 4AHTA 2DY4A 1VSJA 4BDZA 3KD5E 3KIOA 1D5AA 4X65K 1S3XA 4LF8K 1Q9YA 2F96A 3VOVA 2Q3SA 4X66K 2YHAA 4CI6A 4TSXA 4EZ6A 3QLHA 2UUAK 1HKGA 2WBNA 3SQ1A 4OPJA 2QWRA 2HBLA 4FJIA 3CQYA 4F2SA 4FLZA 3M8QA 3NFAA 2IGIA 3R9PA 2UUCK 3M3ZA 4Z94A 4AH9A 1JLQA 3VF4A 3TAEA 3RVCA 5CZ1A 1HQEA 2Z1GA 4LF5K 4CZIA 4BY9C 2O8BB 3VEOA 3DXKA 1GLCG 4XEIA 1U47A 3TI0A 1Q7YO 1U6ZA 2DFFA 4DFMA 4CK3A 3VGLA 3M8PA 1TV6A 3AVNA 5TKWA 3OJUA 1T6CA 3ZSWA 2A1RA 1JL1A 3RMAA 3C0BA 4ELUA 3G4SN 1JKHA 4CBWA 2KTQA 4CZKA 4FWQA 1J9AA 4FJHA 4FW1A 4CEDA 2VG6A 3CJCA 4CFCA 5I9EB 5KRTA 3QBXA 1HNZK 4QS7A 1HNXK 3K58A 1IKXA 4Z4EA 3AGRA 4DV2K 2E4LA 3LALA 1G99A 1NK4A 3VF6A 3ASMA 2P9UB 3V6DA 5KI6A 1RDDA 1V4TA 1NGCA 4GMJB 3L4IA 3I55N 5KPRA 1HMVA 2NUBA 4GKJK 3HM9A 3WEEB 2O8BA 1NU0A 4DR5K 1XNQK 4Y1DA 2NRWA 4DV1K 5E26A 1NK8A 4FXDA 2FLOA 3VQ5A 1K9MO 4DR2K 3U9ZA 1UA0A 1NGAA 1L5UA 1WAJA 4CJWA 3J8AA 3VQDA 3J81O 3ZEUB 4E3SA 1VSHA 3SUPA 2E2PA 2QA4N 4FWRA 4FL9A 3DM2A 4V19S 4JV5K 4DTMA 2CH5A 3HSTB 5HRNA 2X74A 2G8HA 3HP6A 4DLGA 5CYMA 4CHQA 4H5NA 3VEYA 4ISGA 1ZBFA 2P9UA 1VQ8N 2Q97A 3NE6A 3ZSVA 4CHOA 1WBDA 1OKJA 4BR4A 3QEPA 3WEEA 2YKNA 4OKJA 1J5OA 1QVFM 1LAWA 4LF4K 1QVGM 2OTLN 5FRNA 2EWSA 1BA1A 2HHWA 5C0YA 2W40A 1OVQA 4WFBL 4WFAL 3O5BA 2IVNA 1X9MA 3CFPA 1JLBA 1XC3A 3ZEUA 1KLNA 3PY8A 3K2PA 3UKRB 3MX2A 4CEBA 4N47A 3CPWM 2QTDA 4LH5A 3MXIA 4AILC 1QTMA 4QCLA 1MA9B 4KTZA 2JWLA 1IKWA 1Q82O 4U7BA 1E4FT 1SV5A 1W9HA 4JI6K 1W7AA 3MDQA 3D7EO 4NYNA 1ZXOA 3IS9A 3VMFB 2XY8A 4DV4K 4H5WA 1HNIA 4IXCA 5JICA 4FK2A 1E4GT 4PKGA 2P5GA 4H4MA 3B8AX 3P39A 4CZFA 1NGIA 4ID5A 1WLJA 2XO7A 4ID1A 1BIUA 3QNOA 4O8UA 3E9OA 2RF2A 3T1AA 2GBZA 4B1UB 5E84A 4BRCA 2CGKA 3UKRA 4IEIA 3J80O 3L2RA 2VG7A 3RMCA 2P9SB 1B9FA 5EXWA 3OA9A 2D4WA 4K0KK 3MN6A 2D0OA 2KZZA 1J54A 3LAKA 3LDSA 3DOLA 3ITHA 3LP3A 2IC3A 2F9TA 2WTUA 1RT5A 3DRRA 1IO2A 3WT0A 2ASOA 3OYIA 2HHVA 1FXXA 3AVKA 2YNFA 4DV6K 4DSFA 3R3LA 3QICA 4KTQA 3V9ZA 4O8KA 1RDWX 4M3YA 2OPPA 3N4PA 1VRUA 2JGUA 3KTQA 2YV0X 1EXQA 3MCAB 3ID8A 1TVRA 4FJ8A 4F2RA 2P9NB 4M3XA 2GUPA 2PYJA 3T1YK 5BRHA 2H3GX 4FLVA 4FW2A 1KSPA 2HBKA 2P9LB 2P9SA 4AHUA 4RW8A 3KLEA 3HL8A 4PHTX 3WXMB 4CGIA 4KHQA 1BCOA 1EX4A 1ASWA 5AQMA 1ZYQA 3OS0A 1VHXA 3ID6A 5E41A 3G6EN 5CYQA 1D9FA 4BRLA 2NLXA 1KD1O 3WQTA 4IG3A 4JKGB 4JNEA 2VGNA 4CIFA 3LDLA 2B6AA 4DR7K 5I3UA 4H0VB 3VETA 4BQLA 1T7PA 3R8EA 4JKEA 3CCVN 1HLUA 1ESVA 1ZBLA 1YJ9N 4GW6A 4FWPA 1JCFA 2P9NA 1JXEA 4JKAA 2VWBA 3WNEA 5BREA 4H0OA 4B1ZA 2P9LA 1XMOK 5AQVA 1VQON 2W6LA 3WQUA 3D6RA 3CHWA 4NCGA 1NGGA 1XUPO 5AQWA 3LPTA 5BR9A 3PSFA 3ZSRA 3SBGA 4JI2K 3CIPA 3KK2A 2Z1JA 3PO5A 3V4IA 1CZBA 1KAZA 3QINA 3LANA 3AO4A 3BZCA 2OYQA 1JCEA 1NOZA 5LJVA 1VQPN 4OGCA 3BEXA 2ZGYA 4H0TB 4JKGA 3DMJA 4PQUA 1A5XA 2IS3A 1SKSA 1B9DA 3V9WA 3RR7A 5AQYA 4MFBA 3FZLA 3ZSZA 2GELA 4CHYA 3AV9A 4IO8A 3IRXA 1C6VA 5FPNA 4KHYA 5BRDA 4BQZA 1K73O 1VQ7N 3KK7A 3V9XA 5BPNA 4FWSA 5JS2A 1C0GA 3MXMA 2OANA 4FM2A 1KQSM 3MK6A 5D3GA 3ULEB 3EE8A 1BA0A 1YAGA 3UB5A 3AVGA 3K9JA 2EHGA 1S72N 3J7YP 2QM1A 4FJMA 4K42A 1EWQA 1KAYA 1CZAN 1SUQA 4M7YA 5BPLA 1VSIA 1YT3A 3TSPA 3OYGA 4BC5A 3KZBA 4JI1K 3F73A 2PY5A 1TYQB 4IG0A 3THXB 5BN9A 1T44A 3ZT1A 1E3MA 4B9MA 4ELTA 3SV3A 2NRXA 3I8DA 5J2NA 3TABA 4A2AA 3VQ4A 5C42A 1DLOA 2A3ZA 4O55A 4IOXA 3O08A 1KRPA 3WXLA 1LAVA 2VG5A 3ULEA 3NH2A 4BRKA 5SZTA 4YOYA 1HPMA 5KPTA 4W5OA 4FK0A 1GLFO 4LY7A 3TSQA 3P31A 1XHXA 1N34K 2P9PB 4FZZA 1DEJA 4FZYA 3SQ2A 1Q9XA 2HVHA 1CXUA 2G8VA 3FR0A 4BRIA 4B3SK 4IZ9A 1UOCA 2OPQA 4CHNA 2B5JA 3ZX2A 3HOTA 4K8ZA 2HNDA 1TYQA 1WSHA 3CC2N 3THXA 1S9EA 4F3TA 1DTQA 2AP1A 2VQFK 4WQ4C 4X62K 4K8XA 4B1WB 4H5TA 4N76A 1X3MA 5I42A 4CBXA 5AQSA 2UXCK 1NKCA 4XH4A 3E9PA 3VQ7A 4JI4K 2P9KB 2AJQA 4F8RA 5AZIB 3VENA 1SS6A 3EL2A 3RWUA 5M1KA 1HRHA 1SKWA 5DMRA 3ZSXA 4OO1J 2YKMA 4DFKA 1SZ2A 3H46O 3HOSA 2P9PA 2YHXA 2J4RA 4F9OA 3P1GA 5K14A 2A6AA 4KFBA 2QI2A 4LD0A 3OYFA 4FWOA 3K57A 4K25A 1GLDG 3LDQA 4BREA 3QESA 5GAGP 3IUCA 1T6DA 1M1KO 4W5NA 2NRRA 3HXMA 3A5LC 3CC4N 4A61A 3QBWA 2LSNA 1SKRA 4B9SA 4GVMA 3SMSA 3ZYYX 4CZJA 3O80A 5AFUH 3R1XA 5KGXA 3ENBA 4O0JA 1U2VB 1O13A 3EKUA 2P9KA 5AZIA 3L2UA 2W41A 3AA3A 2QXLA 3I0SA 1C1AA 3K0SA 2HSTA 4MO5A 4X64K 3MX5A 3NF9A 3MMVA 3O4WA 4N56A 1ZBSA 3L2WA 2KQ2A 1Z26A 3IMXA 3FFIA 1YHQN 4IKFA 5JVHL 3LP0A 3MEDA 4KH4A 2D0BA 4BRHA 1NKBA 5AQZA 3DWLA 3NGYA 2VCPA 1ATNA 2FBXA 4FVMA 1NK0A 3KLGA 4YHHK 3WNGA 2E8AA 4JHDB 1QHAA 3VN5A 5AQPA 4OLBA 4KB1A 3AA5X 2B4JA 4XH5A 1KFSA 1YTUA 3VGMA 3RRGA 3OYHA 2O4GA 1LW0A 1FKPA 4FJGA 1U2VA 1A5WA 1WBBA 2O8CB 3V1OA 3K9KA 2HMIA 4KHNA 2BANA 1A5VA 4BGAA 3JXUA 1QHTA 3O4QA 2E1ZA 1T8EA 4CEEA 3LP1A 5DM6L 1NGFA 3AVFA 4FJXA 3P83D 2QWQA 1NMNA 2YNIA 3I56N 4FJJA 2FBYA 5TKYA 1QSYA 3C95A 3TAPA 1KVAA 3P38A 3EYZA 3NCIA 3RMDA 4G9ZA 4MDAA 3VQAA 4G1QA 4M7XA 1LWCA 2YJFA 2GV9A 2HMPA 3OYCA 1RDBA 3JAMO 4GY2B 2IIRA 4H5VA 4WQ5A 1KLMA 4CEFA 4JHDA 1F21A 2PAVA 3Q7CA 4E1JA 3KJVA 4GVEA 1TKXA 2YCHA 1VSFA 4DR4K 4NXNK 3C94A 3OBWA 4LSNA 4M45A 4DTRA 4CEOA 4CK2A 4FZXC 2D0PA 4WQ5C 1K8AO 2O8CA 3OYEA 5FDLA 4EP5A 3OYAA 3C6HA 2YX6A 3C6UA 4M3RA 3NGZA 4E7HA 3OVNA 3U8XA 4DQIA 3F5TA 4CGJA 2VQEK 4E19A 2I7PA 5J2MA 3NMUA 4FVUA 1S6QA 4O4GA 4DV0K 4DTPA 3ENHA 3L0QA 5KRSA 4DTXA 1NG9A 3IKMA 3CJ9A 4Z4GA 3KKSA 1U49A 1Q8IA 3BF3A 3KLHA 4CHPA 3JS6A 5BR8K 1P90A 3D2EB 4JI7K 5C25A 4CFDA 4CGGA 2EX3A 3I33A 3CFRA 3BGRA 1YIJN 1SL2A 4FYDA 4BDYA 3BUZB 3ZSOA 4KTWA 5EX5A 1T05A
chains in the Genus database with same CATH topology
4B3SK 3J81O 4KHPK 2UUBK 4LF9K 4X65K 2E5LK 4JI5K 4V19S 4JV5K 2VQFK 5FLXO 4LF8K 4X66K 4X62K 1IBLK 4DV6K 1J5EK 2F4VK 4GKKK 2UXCK 5LMUK 2UUAK 4DR1K 4B3TK 4JI4K 4DV5K 4JYAK 4DUYK 1XNRK 2HHHK 4LF7K 5AJ3K 2UUCK 4LF4K 3T1YK 4LF5K 4OX9K 3JAMO 3OTOK 4LFBK 1N32K 3J7YP 1N33K 1XMQK 1N36K 4DR3K 4DR4K 4NXNK 4B3RK 1HR0K 1IBMK 4DR6K 2UXBK 4JI1K 4LFAK 1IBKK 4B3MK 5A2QO 2UU9K 4JI3K 4JI6K 4CVNE 1FJGK 4JI8K 4DUZK 4LF6K 4DV4K 2UXDK 1HNZK 3J7AP 1HNWK 1HNXK 4DR7K 4DV3K 5IT9O 4DV2K 2ZM6K 2VQEK 4AQYK 4X64K 4DV0K 1I94K 3T1HK 4NXMK 4JI0K 4LFCK 4DV7K 5IWAK 1XMOK 5BR8K 4GKJK 4YY3K 4DR5K 4JI7K 1XNQK 5LMNK 1N34K 4CW7B 3J80O 4DV1K 4DR2K 4JI2K 5LL6Z 4YHHK 4K0KK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S K;  3J81 O;  4KHP K;  2UUB K;  4LF9 K;  4X65 K;  2E5L K;  4JI5 K;  4V19 S;  4JV5 K;  2VQF K;  5FLX O;  4LF8 K;  4X66 K;  4X62 K;  1IBL K;  4DV6 K;  1J5E K;  2F4V K;  4GKK K;  2UXC K;  5LMU K;  2UUA K;  4DR1 K;  4B3T K;  4JI4 K;  4DV5 K;  4JYA K;  4DUY K;  1XNR K;  2HHH K;  4LF7 K;  5AJ3 K;  2UUC K;  4LF4 K;  3T1Y K;  4LF5 K;  4OX9 K;  3JAM O;  3OTO K;  4LFB K;  1N32 K;  3J7Y P;  1N33 K;  1XMQ K;  1N36 K;  4DR3 K;  4DR4 K;  4NXN K;  4B3R K;  1HR0 K;  1IBM K;  4DR6 K;  2UXB K;  4JI1 K;  4LFA K;  1IBK K;  4B3M K;  5A2Q O;  2UU9 K;  4JI3 K;  4JI6 K;  4CVN E;  1FJG K;  4JI8 K;  4DUZ K;  4LF6 K;  4DV4 K;  2UXD K;  1HNZ K;  3J7A P;  1HNW K;  1HNX K;  4DR7 K;  4DV3 K;  5IT9 O;  4DV2 K;  2ZM6 K;  2VQE K;  4AQY K;  4X64 K;  4DV0 K;  1I94 K;  3T1H K;  4NXM K;  4JI0 K;  4LFC K;  4DV7 K;  5IWA K;  1XMO K;  5BR8 K;  4GKJ K;  4YY3 K;  4DR5 K;  4JI7 K;  1XNQ K;  5LMN K;  1N34 K;  4CW7 B;  3J80 O;  4DV1 K;  4DR2 K;  4JI2 K;  5LL6 Z;  4YHH K;  4K0K K; 
#chains in the Genus database with same CATH topology
 3H1Q A;  4KRF A;  4F3O A;  2QK9 A;  1RBT A;  3HI0 A;  2E88 A;  4YFU A;  4JK7 A;  4CEZ A;  2DPN A;  1C1C A;  4PUO A;  3NVM A;  4I6M B;  2A5X A;  4M42 A;  5SWM A;  5H1S Q;  1X9J A;  4BR2 A;  1TL1 A;  5T7B A;  1RT7 A;  4GV6 A;  4CK1 A;  3T3F A;  5LMU K;  2E6L A;  4HCB A;  1QE1 A;  3SPZ A;  1HYS A;  3CFO A;  3V9U A;  2QWP A;  4FSV A;  5EU7 A;  1TK5 A;  4BRO A;  4DV5 K;  4OGE A;  4DUY K;  1NBW A;  1GLB G;  2OZM A;  3AGK A;  3L4Q A;  3SMP A;  3VEX A;  4KI6 A;  4B1V A;  3D2E A;  1D9D A;  2Q0U A;  3TPQ A;  4B1X B;  4BC2 A;  1XWL A;  3NF8 A;  2D0C A;  4C8L A;  4M3T A;  1LWF A;  4FJ5 A;  5M1Q A;  1O1W A;  1RDC A;  1N36 K;  3T19 A;  1LW2 A;  4B3R K;  4BR0 A;  3CJ7 A;  4I6M A;  4FCY A;  3AAQ A;  3DXM B;  4OPH A;  3VES A;  3HK2 A;  4W5Q A;  3QFU A;  3HPO A;  3TAR A;  3QB0 A;  4A2B A;  2NRT A;  4HUE A;  5HP1 A;  1L3U A;  3PX0 A;  4LF6 K;  5HBM A;  4AF1 A;  2RKI A;  3SNN A;  1YJW N;  2E20 A;  3CC7 N;  3QDK A;  2ITG A;  2ZM6 K;  3GDQ A;  4A62 A;  4FLW A;  2BTF A;  3PLA A;  4A57 A;  3LPU A;  2VYP A;  3G0Z A;  3G71 N;  3HZ6 A;  4ISF A;  1ATR A;  4RCH A;  3B6O A;  4JKH A;  4WFN L;  3OYD A;  4DU3 A;  2Q36 A;  4BRN A;  5FPE A;  4IEE A;  1LOT B;  1YXQ A;  3S9H A;  2QEX N;  1OH6 A;  4CZG A;  4Y1C A;  3CM6 A;  2A42 A;  1RT1 A;  3DXM A;  4CZL A;  4PWD A;  5GAD P;  3DRP A;  3O3G A;  3OS2 A;  4CIG A;  4Q5V A;  4KO0 A;  1VSK A;  4WF9 L;  4KRE A;  4JI5 K;  1S22 A;  2CH6 A;  3NVK A;  2F7T A;  2V7Y A;  4CJL A;  3E01 A;  4EHU A;  1D4X A;  4KB0 A;  1C0U A;  4BRM A;  1LV5 A;  2RHK A;  3K5L A;  3GOI A;  3VER A;  2ZJQ L;  4JYA K;  2HHQ A;  2OTJ N;  4IFV A;  3DLR A;  4Z4F A;  4I9L A;  4H03 B;  4B9U A;  2QWM A;  1S5J A;  3TTD A;  2CGL A;  3F9K A;  2HF3 A;  2I5J A;  1H1V A;  4JRP A;  1GLA G;  4E1N A;  1K8K B;  2X6S A;  3PX6 A;  4FWL A;  3OHR A;  4Z4I A;  3A2F A;  4CJS A;  1TK0 A;  2KZM A;  3MN5 A;  1Q81 O;  3THY B;  3E9L A;  4DHY A;  3C6T A;  4C8M A;  4CJK A;  2YI1 A;  1S1T A;  3OYJ A;  1IBM K;  4O5F A;  3OYK A;  2Z1H A;  3ISN C;  3DLL L;  4DSJ A;  4EZ9 A;  2KHO A;  3OYM A;  3VQ6 A;  5F0X A;  3VA3 A;  5EOY A;  2HHX A;  1S1U A;  2ZE2 A;  1XQS C;  2Q0R A;  5AQQ A;  3HBT A;  4DF8 A;  5DK5 A;  4Z0U A;  4L8R B;  1NLV A;  4DU1 A;  1NK5 A;  1G15 A;  1IG8 A;  1RTJ A;  2WFB A;  5GIN A;  1WAF A;  2FXU A;  4JKC A;  2O8D B;  3S3M A;  5HLF A;  3AO2 A;  1K8K A;  1EQY A;  4IWV A;  3CER A;  5BN8 A;  4N5S A;  1RDU A;  4KAZ A;  3THY A;  3QEV A;  5ADX A;  3SAG A;  4KH5 A;  4GNI A;  5F2R A;  4AM6 A;  1MWK A;  4DF4 A;  4PY5 A;  1N8R O;  3M5R A;  3AAP A;  1VK0 A;  3CJA A;  1Q86 O;  4RW6 A;  4C8N A;  4QS8 A;  3SUO A;  3J7Z O;  1NK9 A;  1VRT A;  4BR9 A;  4EP4 A;  2GX9 A;  3V81 A;  3AVC A;  1FK9 A;  3K59 A;  3QO9 A;  2OCE A;  5AQU A;  2F4V K;  4GKK K;  3CM5 A;  1GLJ O;  2F9W A;  4CJR A;  4B08 A;  4DR1 K;  5BRF A;  2IDO A;  2FF6 A;  4RG8 A;  3A0I X;  4C23 A;  4LC9 B;  3CCQ N;  1ZBH A;  1NGD A;  1UWB A;  3ULD A;  1Z05 A;  2OZS A;  1BUP A;  2O8D A;  5MLC Q;  1UAX A;  1YUW A;  1BO5 O;  5HRR A;  5LY3 A;  1NJX A;  3U9D A;  3N4Q A;  3P4I A;  4KI4 A;  1NGE A;  3CG7 A;  4CBU A;  1YVN A;  4DQR A;  4AHR A;  5AFU A;  3RTV A;  2ZGZ A;  3AVI A;  2ATQ A;  3IFR A;  1IV0 A;  3EZ5 A;  3CCU N;  4QAG A;  3GL1 A;  1NGH A;  2HBJ A;  2GEM A;  4NLC A;  4NCB A;  1ZBI A;  4DR3 K;  1QZ5 A;  3VEW A;  3AAR A;  4DTJ A;  2YHB A;  3M1F A;  5AQO A;  3QET A;  4LFA K;  4YOT A;  5HOO A;  3CCJ N;  1BHL A;  4IJA A;  1S1X A;  4FOI A;  3VGK A;  3CCL N;  2IVP A;  2E1Y A;  4JS4 A;  2ZJP L;  3C6A A;  3BDP A;  4IFE A;  4FLY A;  3DOK A;  4B8A B;  4JK9 A;  1GOA A;  4CJ7 A;  2HHT A;  2ASP A;  4DFJ A;  5JVG L;  4E7K A;  1HUX A;  4YDU C;  1WNS A;  1BIS A;  3MWT A;  5AQR A;  4NXM K;  4JI0 K;  4H0Y B;  4HUF A;  4J2B A;  2E6M A;  1DKG D;  4ZTJ A;  3LM9 A;  2Q31 A;  3O1B A;  4IDK A;  3DJC A;  3KWI A;  4H8K A;  1P8Z A;  3VA0 A;  3NGI A;  4NYF A;  2FSJ A;  3H3O B;  1L3T A;  1VQ9 N;  1HJO A;  5LL6 Z;  4ZHR A;  2Z1I A;  5KGW A;  1QSS A;  3ZT4 A;  5CY4 A;  4CD3 A;  4CGD A;  3RSE B;  2UUB K;  4OKK A;  3CF5 L;  4K41 A;  3O9Q A;  4DFP A;  2P51 A;  3MEC A;  3NF7 A;  5LJW A;  4JS5 A;  1KTQ A;  2NRH A;  2YNG A;  2XY5 A;  1YVU A;  4BE0 A;  2AA4 A;  3S41 A;  4CF2 A;  1NGJ A;  1IBL K;  3VEV A;  1S1V A;  1EKE A;  1T3V A;  1MWM A;  1RNH A;  3L3V A;  4JKB A;  3T69 A;  3AA2 A;  3O3H A;  1XI1 A;  1ILY A;  4WQ4 A;  4HUG A;  3CCR N;  1NWK A;  2I7N A;  4I7F A;  3CJ1 A;  4J2A A;  3EE9 A;  5AQT A;  1C0T A;  4LSL A;  4H4O A;  1XNR K;  1RBS A;  3EY1 A;  4MDB A;  4LF7 K;  2DTU A;  2DFE A;  3ZT3 A;  3SUQ A;  3CCS N;  3Q7B A;  4BDP A;  3U3Y A;  2KLA A;  5ADX H;  3CET A;  4FOE A;  5HRS A;  4CES A;  2YHW A;  3OW2 M;  4OLA A;  2A1S A;  5M1N A;  3LAM A;  5HRP A;  3TR8 A;  2ITM A;  1GLE G;  3ZLJ A;  3FGU A;  3RSE A;  1XC9 A;  2RPI A;  1X1P A;  1HR0 K;  3A5N C;  1NK6 A;  1GOC A;  2VWJ A;  3LP2 A;  1N6Q A;  3O6W A;  3THV A;  4J2D A;  4BRD A;  4JI8 K;  5AQI A;  5KPZ A;  3UKU B;  4KPY A;  1NMD A;  1SAZ A;  4JAX A;  2BH1 A;  1WSF A;  4WCE L;  1EWR A;  3T7Z A;  4JEP A;  2FF3 B;  4DTS A;  4CJT A;  3VQE A;  4DWI A;  4Z4C A;  3SQ0 A;  4DQP A;  3NF6 A;  5IWA K;  3CQX A;  4MLE A;  2FC0 A;  3MXJ A;  1W97 L;  3S3N A;  4KV8 A;  1RFQ A;  4A5B A;  1MDU B;  5LMN K;  2A40 A;  4DS5 A;  4CW7 B;  1NJY A;  4RTF D;  5CZ2 A;  4A59 A;  5KTQ A;  3SJH A;  3DYA A;  3JSM A;  2RN2 A;  1KCF A;  1TL3 A;  3H3N O;  3CPE A;  2HBM A;  3SYZ A;  4KHP K;  4PKI A;  1Z25 A;  4DQQ A;  5FRM A;  3FE1 A;  3TAG A;  4CF0 A;  3UKU A;  1Q18 A;  3HSC A;  3VPZ A;  5GIO A;  3TSU A;  3U4L A;  4KH6 A;  2PYL A;  3KLF A;  3KK3 A;  1KC8 O;  4B3T K;  2XY7 A;  4FWN A;  4DCH A;  3DLH A;  1DT9 A;  2E2N A;  4CF8 A;  2ZJR L;  4BC4 A;  4RW4 A;  3FZH A;  4H0X B;  4DTN A;  4BVO A;  3M8S A;  4EHT A;  1RT3 A;  3CD6 N;  4FJL A;  1TKD A;  4IO9 L;  1VQ6 N;  1QZ6 A;  3OYL A;  5KQ8 A;  1LCU A;  1HKB A;  5B8H A;  1ATS A;  2G8I A;  3D45 A;  4U67 L;  4BC3 A;  3LWL A;  1CLQ A;  5F1X A;  4DR6 K;  1BQM A;  3HM8 A;  3WXK A;  4CEA A;  4B3M K;  4RW9 A;  3V1Q A;  1VAZ A;  2GWK A;  4JD2 B;  3SAH A;  2UXD K;  1OH7 A;  3W3D A;  1B92 A;  3TU5 A;  1D8Y A;  3ZET B;  1JLA A;  1HKC A;  5IT9 O;  1LWE A;  1JL2 A;  1RGI A;  1NKE A;  3VF2 A;  4DKW A;  4BGB A;  2OA8 A;  3R6M A;  5AQG A;  1SQK A;  1I94 K;  4YOX A;  3MEE A;  2QW9 A;  5HL7 L;  1C0F A;  3AO3 A;  3PIO L;  3AVH A;  1I3A A;  2E2Q A;  4GV3 A;  1U48 A;  3ZT2 A;  1VQ4 N;  1NJI O;  4R5P A;  3PV8 A;  4BE1 A;  3LDP A;  4GV9 A;  4C8K A;  1RDA A;  4AHS A;  3O8M A;  3ZSQ A;  1WOQ A;  1CXQ A;  3D0P A;  4FWM A;  4E7J A;  4HVJ A;  3LZI A;  3MCP A;  5AQK A;  4BVP A;  4E0D A;  1HQU A;  1NNE A;  4LF9 K;  3JYT A;  4JD2 A;  5KQD A;  3HTV A;  1ASU A;  5GAH P;  4ZTF A;  3ZET A;  1RTH A;  4C8O A;  3DLB A;  4N41 A;  1BOT O;  3QEW A;  2ZWH A;  1U45 A;  3OYN A;  3L6Q A;  1BQN A;  3WUH A;  3CQ8 A;  1HNV A;  4NB4 A;  3OY9 A;  1REV A;  3DRS A;  3LZJ A;  1X9S A;  2PFU A;  4CIE A;  3FZM A;  4C1N K;  4CJP A;  4DTO A;  1VSL A;  4J2E A;  3F2K A;  3HO1 A;  4E7L A;  1XHZ A;  3MN7 A;  1NOY A;  4B3O A;  1DGK N;  4FO0 A;  1JLG A;  3GE1 A;  1SL0 A;  1NM1 A;  4H5R A;  3VQB A;  3M8R A;  4B8C A;  3OTO K;  4PL8 A;  1KAX A;  1YIT N;  4FK4 A;  1OH5 A;  4BAC A;  3PSI A;  2ZF5 O;  4BRQ A;  2UXB K;  4CCH A;  1HX1 A;  2D0A A;  5AQF A;  4B9T A;  4Y0W A;  1QQC A;  4J8F A;  4JI3 K;  2P9I B;  4A5A A;  2GUI A;  3IAY A;  3FZF A;  1Y97 A;  3U6F A;  4DLE A;  4JN4 A;  4DUZ K;  2QWL A;  3WNH A;  2HW3 A;  2X6N A;  4DQ8 A;  4FLU A;  3SUN A;  5C15 A;  3HJF A;  1JJ2 M;  3AVJ A;  1TAU A;  3BZK A;  1GLL O;  1RTD A;  3NDK A;  3TAQ A;  2VGM A;  3AO1 A;  4OJR A;  4LFC K;  1RTI A;  4FJ7 A;  4CZM A;  3K5N A;  4CJ3 A;  2JWK A;  1ZBU A;  2XY6 A;  2O8F B;  4H0P A;  2VWK A;  4YY3 K;  3QML A;  5BPM A;  3VQ9 A;  1R59 O;  1WB9 A;  4ILG B;  2HHS A;  3A5M C;  2G8W A;  4M41 A;  1HJR A;  3SBT A;  4MLH A;  2PZS A;  4CZH A;  4JKF A;  3RRH A;  3LWM A;  2FSK A;  4M3U A;  1BG3 A;  2P9I A;  1VQL N;  1VSE A;  3PX4 A;  4BRA A;  1KVC A;  4DU4 A;  5FLX O;  3U3G A;  2NNW A;  1YTA A;  1KFD A;  1OH8 A;  2ETJ A;  4W5R A;  1M90 O;  4MO4 A;  1Z6R A;  4IBN A;  4DQS A;  1J5E K;  3O9U A;  4JKD A;  2HOE A;  1HYV A;  3QEX A;  4Q0B A;  1BDG A;  3HRG A;  2Y1I A;  2YNH A;  5AQL A;  2KFZ A;  3LDN A;  4CJQ A;  4CEC A;  4ICL A;  3TWH A;  1NJW A;  5AJ3 K;  1RCH A;  2O8F A;  4M3Z A;  2O4I A;  4UY8 O;  5J1E A;  5GIP A;  1JLC A;  4OX9 K;  1QS4 A;  3HPG A;  3VQ8 A;  3O9S A;  5GAE P;  2YHY A;  5C10 A;  1W0H A;  3AA4 A;  4DB3 A;  4B1Y B;  1W2B M;  1N33 K;  3VEZ A;  1YF5 L;  1NGB A;  2W6K A;  4AHV A;  1EO1 A;  3KLI A;  1VQ5 N;  3ALY A;  2HB5 A;  3V9S A;  3C7N B;  4FPB A;  3KD1 E;  1J6Z A;  4DTU A;  1WN7 A;  1BWF O;  1BL3 A;  2BE2 A;  2WUS A;  4HWI A;  3CCM N;  4YOW A;  3TAN A;  1X3N A;  1TGO A;  1X9W A;  4BR5 A;  3HT3 A;  1FKO A;  1HYZ A;  1C1B A;  3H08 A;  1Y64 A;  3I0R A;  4BE2 A;  3WXI A;  4NLB A;  5J2P A;  1J53 A;  3ZX3 A;  4FJ9 A;  5CE3 A;  3SAF A;  3AVM A;  5FPM A;  4DSI A;  3BF1 A;  3HYF A;  4RWT A;  2Q1N A;  4YOU A;  1BIZ A;  5AQX A;  4CD1 A;  2O8E B;  4E1M A;  4CF9 A;  1YI2 N;  1IG9 A;  1EET A;  2V7Z A;  2KW4 A;  3K5O A;  2KFN A;  5JS1 A;  3IDH A;  4JLH A;  1TKZ A;  2QXF A;  3C7N A;  3H6E A;  4O5B A;  2DFH A;  3AVB A;  4DSE A;  4EAH D;  3ATV A;  4JK8 A;  1NJZ A;  4FM1 A;  1WUA A;  5CHI A;  1HPZ A;  2GWJ A;  5AQN A;  4IDH A;  5JLF A;  3V1R A;  4PL7 A;  3DI6 A;  5EY4 A;  3D2F B;  5J2Q A;  1QQO A;  3H1V X;  5C12 A;  3SJJ A;  4B9Q A;  4OPA A;  1GOB A;  2A41 A;  3CXC M;  2P5O A;  4QOZ B;  1BI4 B;  3DAW A;  3HP9 A;  4HHT A;  4I2P A;  4MQ3 A;  3QEI A;  1ZC6 A;  5C24 A;  4LH4 A;  4OVL A;  3THW B;  4QS9 A;  2Q2R A;  3MEG A;  3K5M A;  3CYM A;  2O8E A;  4L3Q A;  4B9L A;  2BUP A;  3NHG A;  5HRO A;  4NO7 A;  2ASM A;  4RW7 A;  3C65 A;  4ELV A;  2X78 A;  4BG8 A;  2NRZ A;  2WOM A;  1RT2 A;  1NK7 A;  1S6P A;  1BU6 O;  4FJK A;  4WE1 A;  1TK8 A;  3F9M A;  1VSM A;  1VQM N;  3CI5 A;  1JXB A;  3D2F A;  2NZT A;  3ZT0 A;  3OYB A;  2HHU A;  2NRV A;  2PBD A;  4M63 C;  2QKK A;  3G25 A;  1S1W A;  4PKH A;  3G10 A;  1BI4 A;  4DV3 K;  1SL1 A;  3UIQ A;  4M3W A;  2WON A;  3E1Y A;  1KVB A;  3SCX A;  3THW A;  4KBO A;  3TTC A;  4CF1 A;  5AZJ B;  2FSN A;  3QIO A;  4BRF A;  4CHZ A;  2IAJ A;  4CJ5 A;  3O9T A;  3RMB A;  3KHY A;  2BDP A;  4KHU A;  2V51 B;  4DG1 A;  3CME N;  4YDU A;  2FBT A;  3AY9 A;  3UE5 A;  1TAQ A;  3VQC A;  2OPR A;  3GBT A;  2Y1J A;  3OJS A;  4DSK A;  3SPY A;  2XRI A;  3PUF A;  3QFP A;  4CZE A;  2G8K A;  3BP8 A;  4FWK A;  4IFY A;  3ZX0 A;  4OKE A;  1N5Y A;  4F4K A;  1OVY A;  3DLG A;  1ASV A;  2IOC A;  3HVR A;  3TTF A;  1RBR A;  4CJV A;  3LM2 A;  2HNZ A;  3ZSY A;  4I9Q A;  1BGX T;  4Z4H A;  3AO5 A;  4BR7 A;  4AM7 A;  3CMA N;  1JLE A;  3O1W A;  5AZJ A;  4R79 A;  2E2O A;  4NCA A;  4IJN A;  3SLC A;  3EN9 A;  3ATU A;  4B9N A;  3GG4 A;  5CR4 A;  4C1N I;  3I8B A;  3IG1 A;  3DLE A;  3VQP A;  1RT4 A;  2V52 B;  3BY5 A;  5AQJ A;  4OPK A;  4YOV A;  3EEQ A;  1N32 K;  1S9G A;  5EVZ A;  4HTL A;  2OPS A;  1XMQ K;  3ENO A;  1MU2 A;  3SZ2 A;  1ITG A;  4CJ4 A;  4FJN A;  3L2Q A;  4XH1 A;  3S3O A;  4CJU A;  4CFB A;  1U4B A;  1TUU A;  2BGG A;  2QKB A;  3CCE N;  1RT6 A;  3LL3 A;  4XIU A;  1IBK K;  5A2Q O;  3AVA A;  1QQN A;  4KHW A;  4CVN E;  3ZCM A;  3VQQ A;  1FJG K;  4AHC A;  3NBP A;  4E7I A;  3J7A P;  4IOA L;  2ZQB A;  3TAF A;  3VTI A;  3HPH A;  3O9R A;  2ZD1 A;  3DLK A;  4O0I A;  1T03 A;  5M1P A;  1QQM A;  2IVO A;  2D5R A;  3PIP L;  3NAE A;  4EIA A;  3QER A;  3PO4 A;  3MN9 A;  4ISE A;  3KKR A;  2CGJ A;  4BWJ A;  4YOR A;  3A5O C;  3A8Y A;  3KWG A;  4CJE A;  5JLH A;  3O3F A;  4DMN A;  5JMV A;  4K43 A;  4IOC L;  3SI6 A;  2F8T A;  2UYT A;  4BRG A;  2FBV A;  1IJJ A;  2QWN A;  3NH0 A;  1TKT A;  2R7Y A;  1FW6 A;  2QWO A;  1L3V A;  2HF4 A;  2WC9 A;  4O44 A;  1IKY A;  5AQH A;  3WXJ A;  3LDO A;  3KK1 A;  3EZW A;  4CGF A;  2E5L K;  1IH7 A;  2RE2 A;  3MAQ A;  1VQN N;  1TUY A;  4BRP A;  4EFH A;  1C0M A;  5DM7 L;  4W5T A;  4BG9 A;  3FLC O;  2W42 A;  3WNF A;  3SK3 A;  1L3S A;  1KXP A;  1WSJ A;  4ILJ A;  3OS1 A;  4KKO A;  3HVT A;  5C2F A;  2G8F A;  1IKV A;  3RR8 A;  3KVG A;  5M1F A;  1QSL A;  1VSD A;  2JLE A;  4PA1 A;  2HNY A;  1K6Y A;  2YJE A;  5AR0 A;  4BWM A;  3SV4 A;  4FLT A;  2HHH K;  4CJF A;  1V4S A;  1U04 A;  1UA1 A;  1VQK N;  3VTH A;  4ILH A;  3QNN A;  3EO3 A;  4I2Q A;  4HTU A;  2HVI A;  4LFB K;  1JLF A;  4DS4 A;  2P1J A;  5FPD A;  4CER A;  4CGH A;  4KHS A;  3H45 C;  3CJB A;  3FFK B;  4DSL A;  1RIL A;  3FZK A;  3QIP A;  4FLX A;  4E89 A;  1I39 A;  2UU9 K;  2F8S A;  4FM0 A;  4HCC A;  3W0L A;  2KKZ A;  3OBY A;  1WSI A;  4YNQ A;  3B6P A;  1HNW K;  1WSE A;  4UQG A;  4JRQ A;  1CZ9 A;  1BCM A;  4AQY K;  1YJN N;  5C2D A;  3L8B A;  2XHB A;  1JCG A;  5M1O A;  3EKS A;  3L3U A;  3L2V A;  3T1H K;  4DV7 K;  3M6G A;  1EP4 A;  2GTD A;  3MWP A;  3TAM A;  4WYB A;  1RBU A;  1DTT A;  2G8U A;  2D1K A;  3O4N A;  5FRO A;  4CFA A;  4B9V A;  1R0A A;  1RBV A;  4CEQ A;  4FPA A;  3DXK B;  3SQ4 A;  3AVL A;  1WSG A;  3E66 A;  3NH1 A;  3P5J A;  4CE9 A;  5ELZ A;  4AHT A;  2DY4 A;  1VSJ A;  4BDZ A;  3KD5 E;  3KIO A;  1D5A A;  4X65 K;  1S3X A;  4LF8 K;  1Q9Y A;  2F96 A;  3VOV A;  2Q3S A;  4X66 K;  2YHA A;  4CI6 A;  4TSX A;  4EZ6 A;  3QLH A;  2UUA K;  1HKG A;  2WBN A;  3SQ1 A;  4OPJ A;  2QWR A;  2HBL A;  4FJI A;  3CQY A;  4F2S A;  4FLZ A;  3M8Q A;  3NFA A;  2IGI A;  3R9P A;  2UUC K;  3M3Z A;  4Z94 A;  4AH9 A;  1JLQ A;  3VF4 A;  3TAE A;  3RVC A;  5CZ1 A;  1HQE A;  2Z1G A;  4LF5 K;  4CZI A;  4BY9 C;  2O8B B;  3VEO A;  3DXK A;  1GLC G;  4XEI A;  1U47 A;  3TI0 A;  1Q7Y O;  1U6Z A;  2DFF A;  4DFM A;  4CK3 A;  3VGL A;  3M8P A;  1TV6 A;  3AVN A;  5TKW A;  3OJU A;  1T6C A;  3ZSW A;  2A1R A;  1JL1 A;  3RMA A;  3C0B A;  4ELU A;  3G4S N;  1JKH A;  4CBW A;  2KTQ A;  4CZK A;  4FWQ A;  1J9A A;  4FJH A;  4FW1 A;  4CED A;  2VG6 A;  3CJC A;  4CFC A;  5I9E B;  5KRT A;  3QBX A;  1HNZ K;  4QS7 A;  1HNX K;  3K58 A;  1IKX A;  4Z4E A;  3AGR A;  4DV2 K;  2E4L A;  3LAL A;  1G99 A;  1NK4 A;  3VF6 A;  3ASM A;  2P9U B;  3V6D A;  5KI6 A;  1RDD A;  1V4T A;  1NGC A;  4GMJ B;  3L4I A;  3I55 N;  5KPR A;  1HMV A;  2NUB A;  4GKJ K;  3HM9 A;  3WEE B;  2O8B A;  1NU0 A;  4DR5 K;  1XNQ K;  4Y1D A;  2NRW A;  4DV1 K;  5E26 A;  1NK8 A;  4FXD A;  2FLO A;  3VQ5 A;  1K9M O;  4DR2 K;  3U9Z A;  1UA0 A;  1NGA A;  1L5U A;  1WAJ A;  4CJW A;  3J8A A;  3VQD A;  3J81 O;  3ZEU B;  4E3S A;  1VSH A;  3SUP A;  2E2P A;  2QA4 N;  4FWR A;  4FL9 A;  3DM2 A;  4V19 S;  4JV5 K;  4DTM A;  2CH5 A;  3HST B;  5HRN A;  2X74 A;  2G8H A;  3HP6 A;  4DLG A;  5CYM A;  4CHQ A;  4H5N A;  3VEY A;  4ISG A;  1ZBF A;  2P9U A;  1VQ8 N;  2Q97 A;  3NE6 A;  3ZSV A;  4CHO A;  1WBD A;  1OKJ A;  4BR4 A;  3QEP A;  3WEE A;  2YKN A;  4OKJ A;  1J5O A;  1QVF M;  1LAW A;  4LF4 K;  1QVG M;  2OTL N;  5FRN A;  2EWS A;  1BA1 A;  2HHW A;  5C0Y A;  2W40 A;  1OVQ A;  4WFB L;  4WFA L;  3O5B A;  2IVN A;  1X9M A;  3CFP A;  1JLB A;  1XC3 A;  3ZEU A;  1KLN A;  3PY8 A;  3K2P A;  3UKR B;  3MX2 A;  4CEB A;  4N47 A;  3CPW M;  2QTD A;  4LH5 A;  3MXI A;  4AIL C;  1QTM A;  4QCL A;  1MA9 B;  4KTZ A;  2JWL A;  1IKW A;  1Q82 O;  4U7B A;  1E4F T;  1SV5 A;  1W9H A;  4JI6 K;  1W7A A;  3MDQ A;  3D7E O;  4NYN A;  1ZXO A;  3IS9 A;  3VMF B;  2XY8 A;  4DV4 K;  4H5W A;  1HNI A;  4IXC A;  5JIC A;  4FK2 A;  1E4G T;  4PKG A;  2P5G A;  4H4M A;  3B8A X;  3P39 A;  4CZF A;  1NGI A;  4ID5 A;  1WLJ A;  2XO7 A;  4ID1 A;  1BIU A;  3QNO A;  4O8U A;  3E9O A;  2RF2 A;  3T1A A;  2GBZ A;  4B1U B;  5E84 A;  4BRC A;  2CGK A;  3UKR A;  4IEI A;  3J80 O;  3L2R A;  2VG7 A;  3RMC A;  2P9S B;  1B9F A;  5EXW A;  3OA9 A;  2D4W A;  4K0K K;  3MN6 A;  2D0O A;  2KZZ A;  1J54 A;  3LAK A;  3LDS A;  3DOL A;  3ITH A;  3LP3 A;  2IC3 A;  2F9T A;  2WTU A;  1RT5 A;  3DRR A;  1IO2 A;  3WT0 A;  2ASO A;  3OYI A;  2HHV A;  1FXX A;  3AVK A;  2YNF A;  4DV6 K;  4DSF A;  3R3L A;  3QIC A;  4KTQ A;  3V9Z A;  4O8K A;  1RDW X;  4M3Y A;  2OPP A;  3N4P A;  1VRU A;  2JGU A;  3KTQ A;  2YV0 X;  1EXQ A;  3MCA B;  3ID8 A;  1TVR A;  4FJ8 A;  4F2R A;  2P9N B;  4M3X A;  2GUP A;  2PYJ A;  3T1Y K;  5BRH A;  2H3G X;  4FLV A;  4FW2 A;  1KSP A;  2HBK A;  2P9L B;  2P9S A;  4AHU A;  4RW8 A;  3KLE A;  3HL8 A;  4PHT X;  3WXM B;  4CGI A;  4KHQ A;  1BCO A;  1EX4 A;  1ASW A;  5AQM A;  1ZYQ A;  3OS0 A;  1VHX A;  3ID6 A;  5E41 A;  3G6E N;  5CYQ A;  1D9F A;  4BRL A;  2NLX A;  1KD1 O;  3WQT A;  4IG3 A;  4JKG B;  4JNE A;  2VGN A;  4CIF A;  3LDL A;  2B6A A;  4DR7 K;  5I3U A;  4H0V B;  3VET A;  4BQL A;  1T7P A;  3R8E A;  4JKE A;  3CCV N;  1HLU A;  1ESV A;  1ZBL A;  1YJ9 N;  4GW6 A;  4FWP A;  1JCF A;  2P9N A;  1JXE A;  4JKA A;  2VWB A;  3WNE A;  5BRE A;  4H0O A;  4B1Z A;  2P9L A;  1XMO K;  5AQV A;  1VQO N;  2W6L A;  3WQU A;  3D6R A;  3CHW A;  4NCG A;  1NGG A;  1XUP O;  5AQW A;  3LPT A;  5BR9 A;  3PSF A;  3ZSR A;  3SBG A;  4JI2 K;  3CIP A;  3KK2 A;  2Z1J A;  3PO5 A;  3V4I A;  1CZB A;  1KAZ A;  3QIN A;  3LAN A;  3AO4 A;  3BZC A;  2OYQ A;  1JCE A;  1NOZ A;  5LJV A;  1VQP N;  4OGC A;  3BEX A;  2ZGY A;  4H0T B;  4JKG A;  3DMJ A;  4PQU A;  1A5X A;  2IS3 A;  1SKS A;  1B9D A;  3V9W A;  3RR7 A;  5AQY A;  4MFB A;  3FZL A;  3ZSZ A;  2GEL A;  4CHY A;  3AV9 A;  4IO8 A;  3IRX A;  1C6V A;  5FPN A;  4KHY A;  5BRD A;  4BQZ A;  1K73 O;  1VQ7 N;  3KK7 A;  3V9X A;  5BPN A;  4FWS A;  5JS2 A;  1C0G A;  3MXM A;  2OAN A;  4FM2 A;  1KQS M;  3MK6 A;  5D3G A;  3ULE B;  3EE8 A;  1BA0 A;  1YAG A;  3UB5 A;  3AVG A;  3K9J A;  2EHG A;  1S72 N;  3J7Y P;  2QM1 A;  4FJM A;  4K42 A;  1EWQ A;  1KAY A;  1CZA N;  1SUQ A;  4M7Y A;  5BPL A;  1VSI A;  1YT3 A;  3TSP A;  3OYG A;  4BC5 A;  3KZB A;  4JI1 K;  3F73 A;  2PY5 A;  1TYQ B;  4IG0 A;  3THX B;  5BN9 A;  1T44 A;  3ZT1 A;  1E3M A;  4B9M A;  4ELT A;  3SV3 A;  2NRX A;  3I8D A;  5J2N A;  3TAB A;  4A2A A;  3VQ4 A;  5C42 A;  1DLO A;  2A3Z A;  4O55 A;  4IOX A;  3O08 A;  1KRP A;  3WXL A;  1LAV A;  2VG5 A;  3ULE A;  3NH2 A;  4BRK A;  5SZT A;  4YOY A;  1HPM A;  5KPT A;  4W5O A;  4FK0 A;  1GLF O;  4LY7 A;  3TSQ A;  3P31 A;  1XHX A;  1N34 K;  2P9P B;  4FZZ A;  1DEJ A;  4FZY A;  3SQ2 A;  1Q9X A;  2HVH A;  1CXU A;  2G8V A;  3FR0 A;  4BRI A;  4B3S K;  4IZ9 A;  1UOC A;  2OPQ A;  4CHN A;  2B5J A;  3ZX2 A;  3HOT A;  4K8Z A;  2HND A;  1TYQ A;  1WSH A;  3CC2 N;  3THX A;  1S9E A;  4F3T A;  1DTQ A;  2AP1 A;  2VQF K;  4WQ4 C;  4X62 K;  4K8X A;  4B1W B;  4H5T A;  4N76 A;  1X3M A;  5I42 A;  4CBX A;  5AQS A;  2UXC K;  1NKC A;  4XH4 A;  3E9P A;  3VQ7 A;  4JI4 K;  2P9K B;  2AJQ A;  4F8R A;  5AZI B;  3VEN A;  1SS6 A;  3EL2 A;  3RWU A;  5M1K A;  1HRH A;  1SKW A;  5DMR A;  3ZSX A;  4OO1 J;  2YKM A;  4DFK A;  1SZ2 A;  3H46 O;  3HOS A;  2P9P A;  2YHX A;  2J4R A;  4F9O A;  3P1G A;  5K14 A;  2A6A A;  4KFB A;  2QI2 A;  4LD0 A;  3OYF A;  4FWO A;  3K57 A;  4K25 A;  1GLD G;  3LDQ A;  4BRE A;  3QES A;  5GAG P;  3IUC A;  1T6D A;  1M1K O;  4W5N A;  2NRR A;  3HXM A;  3A5L C;  3CC4 N;  4A61 A;  3QBW A;  2LSN A;  1SKR A;  4B9S A;  4GVM A;  3SMS A;  3ZYY X;  4CZJ A;  3O80 A;  5AFU H;  3R1X A;  5KGX A;  3ENB A;  4O0J A;  1U2V B;  1O13 A;  3EKU A;  2P9K A;  5AZI A;  3L2U A;  2W41 A;  3AA3 A;  2QXL A;  3I0S A;  1C1A A;  3K0S A;  2HST A;  4MO5 A;  4X64 K;  3MX5 A;  3NF9 A;  3MMV A;  3O4W A;  4N56 A;  1ZBS A;  3L2W A;  2KQ2 A;  1Z26 A;  3IMX A;  3FFI A;  1YHQ N;  4IKF A;  5JVH L;  3LP0 A;  3MED A;  4KH4 A;  2D0B A;  4BRH A;  1NKB A;  5AQZ A;  3DWL A;  3NGY A;  2VCP A;  1ATN A;  2FBX A;  4FVM A;  1NK0 A;  3KLG A;  4YHH K;  3WNG A;  2E8A A;  4JHD B;  1QHA A;  3VN5 A;  5AQP A;  4OLB A;  4KB1 A;  3AA5 X;  2B4J A;  4XH5 A;  1KFS A;  1YTU A;  3VGM A;  3RRG A;  3OYH A;  2O4G A;  1LW0 A;  1FKP A;  4FJG A;  1U2V A;  1A5W A;  1WBB A;  2O8C B;  3V1O A;  3K9K A;  2HMI A;  4KHN A;  2BAN A;  1A5V A;  4BGA A;  3JXU A;  1QHT A;  3O4Q A;  2E1Z A;  1T8E A;  4CEE A;  3LP1 A;  5DM6 L;  1NGF A;  3AVF A;  4FJX A;  3P83 D;  2QWQ A;  1NMN A;  2YNI A;  3I56 N;  4FJJ A;  2FBY A;  5TKY A;  1QSY A;  3C95 A;  3TAP A;  1KVA A;  3P38 A;  3EYZ A;  3NCI A;  3RMD A;  4G9Z A;  4MDA A;  3VQA A;  4G1Q A;  4M7X A;  1LWC A;  2YJF A;  2GV9 A;  2HMP A;  3OYC A;  1RDB A;  3JAM O;  4GY2 B;  2IIR A;  4H5V A;  4WQ5 A;  1KLM A;  4CEF A;  4JHD A;  1F21 A;  2PAV A;  3Q7C A;  4E1J A;  3KJV A;  4GVE A;  1TKX A;  2YCH A;  1VSF A;  4DR4 K;  4NXN K;  3C94 A;  3OBW A;  4LSN A;  4M45 A;  4DTR A;  4CEO A;  4CK2 A;  4FZX C;  2D0P A;  4WQ5 C;  1K8A O;  2O8C A;  3OYE A;  5FDL A;  4EP5 A;  3OYA A;  3C6H A;  2YX6 A;  3C6U A;  4M3R A;  3NGZ A;  4E7H A;  3OVN A;  3U8X A;  4DQI A;  3F5T A;  4CGJ A;  2VQE K;  4E19 A;  2I7P A;  5J2M A;  3NMU A;  4FVU A;  1S6Q A;  4O4G A;  4DV0 K;  4DTP A;  3ENH A;  3L0Q A;  5KRS A;  4DTX A;  1NG9 A;  3IKM A;  3CJ9 A;  4Z4G A;  3KKS A;  1U49 A;  1Q8I A;  3BF3 A;  3KLH A;  4CHP A;  3JS6 A;  5BR8 K;  1P90 A;  3D2E B;  4JI7 K;  5C25 A;  4CFD A;  4CGG A;  2EX3 A;  3I33 A;  3CFR A;  3BGR A;  1YIJ N;  1SL2 A;  4FYD A;  4BDY A;  3BUZ B;  3ZSO A;  4KTW A;  5EX5 A;  1T05 A; 
#chains in the Genus database with same CATH homology
 4B3S K;  3J81 O;  4KHP K;  2UUB K;  4LF9 K;  4X65 K;  2E5L K;  4JI5 K;  4V19 S;  4JV5 K;  2VQF K;  5FLX O;  4LF8 K;  4X66 K;  4X62 K;  1IBL K;  4DV6 K;  1J5E K;  2F4V K;  4GKK K;  2UXC K;  5LMU K;  2UUA K;  4DR1 K;  4B3T K;  4JI4 K;  4DV5 K;  4JYA K;  4DUY K;  1XNR K;  2HHH K;  4LF7 K;  5AJ3 K;  2UUC K;  4LF4 K;  3T1Y K;  4LF5 K;  4OX9 K;  3JAM O;  3OTO K;  4LFB K;  1N32 K;  3J7Y P;  1N33 K;  1XMQ K;  1N36 K;  4DR3 K;  4DR4 K;  4NXN K;  4B3R K;  1HR0 K;  1IBM K;  4DR6 K;  2UXB K;  4JI1 K;  4LFA K;  1IBK K;  4B3M K;  5A2Q O;  2UU9 K;  4JI3 K;  4JI6 K;  4CVN E;  1FJG K;  4JI8 K;  4DUZ K;  4LF6 K;  4DV4 K;  2UXD K;  1HNZ K;  3J7A P;  1HNW K;  1HNX K;  4DR7 K;  4DV3 K;  5IT9 O;  4DV2 K;  2ZM6 K;  2VQE K;  4AQY K;  4X64 K;  4DV0 K;  1I94 K;  3T1H K;  4NXM K;  4JI0 K;  4LFC K;  4DV7 K;  5IWA K;  1XMO K;  5BR8 K;  4GKJ K;  4YY3 K;  4DR5 K;  4JI7 K;  1XNQ K;  5LMN K;  1N34 K;  4CW7 B;  3J80 O;  4DV1 K;  4DR2 K;  4JI2 K;  5LL6 Z;  4YHH K;  4K0K K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...