4JI1K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji1K00
4JI8K 1IBLK 5A2QO 4X64K 2HHHK 4DR2K 4JI0K 2UUCK 4LF6K 3J80O 3T1HK 2F4VK 4NXNK 1XMOK 4DR4K 2VQFK 2UXBK 4CW7B 4DV0K 4LFAK 4LFBK 1HNZK 5IWAK 4DR6K 1IBMK 1XNRK 1FJGK 1N32K 1HR0K 2UXDK 4CVNE 2UUAK 3J7YP 5BR8K 5FLXO 3J7AP 4JV5K 2E5LK 4DUZK 4LF7K 3JAMO 4DUYK 4DV1K 4X62K 4JI7K 4LFCK 5LMUK 1HNWK 4JI5K 4GKKK 4JI3K 1N34K 2UU9K 4LF8K 4LF5K 2UUBK 4B3TK 1XMQK 4X66K 5AJ3K 1J5EK 5LMNK 4NXMK 4OX9K 1HNXK 4YY3K 4AQYK 1N33K 4JI6K 2UXCK 4B3SK 1N36K 3T1YK 4DV7K 4DV4K 1I94K 4V19S 4DV5K 2VQEK 4YHHK 1IBKK 4KHPK 4DV6K 4DV3K 4DR3K 4GKJK 4JI2K 2ZM6K 4JYAK 4JI1K 3J81O 4X65K 4DV2K 4B3MK 4LF9K 4B3RK 4LF4K 1XNQK 4K0KK 4DR1K 4DR7K 4JI4K 5LL6Z 4DR5K 5IT9O 3OTOK
chains in the Genus database with same CATH superfamily
4C8KA 3G4SN 1Y97A 3DXKB 4IOAL 1S1XA 1BA1A 3PIOL 5C12A 1T7PA 3A5LC 5CY4A 3EKUA 3VMFB 2IAJA 2RKIA 5KPRA 1VQMN 4LH5A 1WSJA 4H4MA 1D4XA 1NK7A 3ISNC 4WFBL 4E1JA 2HHXA 3DLLL 4IJNA 5I42A 3TSUA 3C6AA 4DR6K 1YIJN 3EO3A 4CJKA 1IKYA 3TTFA 4CZFA 3G0ZA 3O5BA 2QA4N 4OLAA 3VQ4A 4WQ5C 2QWMA 2E5LK 1LOTB 1S22A 2RN2A 4CBWA 2WFBA 1NWKA 2F7TA 3I56N 4E7KA 3VENA 3DRSA 2P9KB 3AAPA 2I7NA 3KWGA 4IO9L 3LP0A 5KPTA 3QEVA 4DHYA 4BRDA 3SQ1A 3ENOA 1I39A 2VWJA 1IH7A 3ZSQA 1U4BA 1QE1A 3BZCA 3QICA 4H0TB 1LAVA 3H3OB 2Q0RA 3HZ6A 4IFYA 3O1BA 1NM1A 4H5RA 4KHUA 4KHSA 3AVKA 1JCGA 4DCHA 3CJAA 4YNQA 3RSEB 3ZCMA 4Z4IA 1T05A 1T3VA 3MCPA 1EP4A 4DV5K 4F2SA 4BWMA 5GIOA 3LDNA 1TK8A 2Y1IA 5FPMA 4DV6K 3NVMA 2VG7A 2OPPA 3F2KA 4BRGA 4A2AA 5B8HA 3OYNA 1K8KA 3O6WA 3AA5X 3OS2A 1GLDG 4F8RA 4JD2B 2V51B 4H5TA 3WEEB 4GVMA 3M5RA 5E41A 3TWHA 3L2WA 1TAQA 2A1SA 2CGJA 2GWJA 1WBDA 3RRGA 1RT4A 3CCJN 4Q5VA 2LSNA 3AA2A 3S3MA 1YJNN 3F9MA 3KKSA 2GTDA 1NBWA 4PY5A 4PL8A 3WT0A 1GLEG 3SV3A 4Z4GA 2E4LA 2VGMA 4BRQA 4M3XA 3VA0A 3KK1A 3O9TA 4B3OA 3NAEA 3AVNA 3O08A 3QEIA 2QKBA 4EZ6A 1FW6A 1VSKA 4FWNA 2YNIA 3CMAN 4FM1A 3CCLN 2ASOA 3ID6A 1R59O 3V9ZA 3RMDA 3HVTA 4DTSA 1NGFA 1K8KB 4OO1J 1P90A 1L5UA 1HNIA 5AQWA 5F1XA 3C7NA 4DF8A 4KH5A 1BOTO 4IDHA 4HUFA 4CZJA 3LZJA 3IRXA 3QB0A 4CEDA 3CF5L 1Q81O 1N6QA 1DT9A 3P1GA 2DFEA 3DOKA 4FWKA 1VQ4N 4C23A 1LWCA 1T03A 3RVCA 3V81A 3VQ9A 3KLGA 3TAGA 4FJ8A 1YVUA 2FXUA 5HLFA 1W9HA 3K5MA 4NLCA 5C2DA 4J2BA 1UA0A 2BE2A 1BISA 4DR3K 2HOEA 1S1VA 2D0OA 1HJOA 4JI1K 4IWVA 1LWFA 3LWMA 4Z4EA 3SK3A 1NG9A 3ZT0A 1C1BA 4W5OA 2GV9A 4WCEL 3CC2N 1WUAA 4E0DA 2VG5A 1BO5O 4OVLA 4CJSA 5A2QO 4IXCA 3RMCA 1SKRA 2A41A 3QERA 2UUCK 5I9EB 4KRFA 4CGHA 2I7PA 3ULEB 5AZJB 3KD5E 2GWKA 1N8RO 3PO4A 4CW7B 2H3GX 1I3AA 5CZ2A 4PHTX 1JJ2M 4M3TA 2PZSA 2E6LA 5GAGP 4HCBA 1XUPO 3AO5A 3DXMB 1ZYQA 5GADP 2HMPA 2V7YA 3B6PA 1QQOA 3FFKB 5AQIA 2HVIA 1KLMA 4DKWA 4KBOA 3UIQA 2P9NB 5J1EA 4N5SA 4BE2A 4CD3A 2KZMA 3SJJA 1VRTA 5E26A 4FLUA 1OH6A 4LFCK 2XY8A 4JLHA 3P31A 2QK9A 3F5TA 2O4IA 3SCXA 3CERA 3B8AX 3ZSYA 2NRTA 4CJEA 4M7XA 1GLCG 1OKJA 1S1WA 3EYZA 5HROA 4DFJA 4CD1A 5HRSA 1D9DA 1NGIA 5ADXA 3LDSA 1FK9A 5C25A 3H45C 4UQGA 4DWIA 1VSJA 1VQON 4CBUA 1KSPA 3THXA 1JLQA 2Q97A 3OBYA 2G8KA 3NF9A 3AY9A 1Z26A 4E1MA 4H0OA 1T8EA 3EKSA 4ZHRA 3QBWA 3BZKA 3OYMA 4DV7K 4EFHA 1BL3A 4EIAA 2WBNA 1VSLA 3HSTB 5C24A 3I33A 4OPJA 3HP9A 1HPZA 4KHQA 1VQNN 1Z25A 1YAGA 4B1XB 3KWIA 3QEWA 3DMJA 4CIFA 4O5FA 4JI2K 2ZM6K 4F9OA 2Q2RA 2RHKA 2QI2A 1NKCA 4E7HA 5BRFA 4I2PA 4AM7A 4U7BA 1QS4A 3VEOA 1RBSA 2QWLA 4OKEA 2WUSA 4FK2A 5AR0A 2IVOA 5IT9O 3OTOK 1E4GT 4GNIA 4JHDA 1CZ9A 4W5TA 3GL1A 4DSFA 1OH7A 4B08A 3PLAA 4K43A 4B1VA 1YHQN 2D1KA 1RBUA 3CPWM 1GLFO 4LFBK 4FZYA 2GUIA 3O4WA 2VGNA 1U45A 2F9WA 5LJWA 5FRMA 5IWAK 3SNNA 2QEXN 4KTQA 3C94A 3BY5A 2HW3A 1XNRK 4O44A 1NJXA 2UXDK 3QFPA 1EWQA 5BR8K 5C42A 3CC7N 4DFMA 4CCHA 2FF6A 3G10A 4WYBA 2ZWHA 4C8NA 5AQYA 2FBYA 2P9SA 3T69A 2ZE2A 1Q86O 4FLTA 3NHGA 1X3NA 3VEWA 3F9KA 2D4WA 4AH9A 1NGBA 2V7ZA 4YORA 3VA3A 3C6UA 3G25A 3NE6A 4LF8K 2CH5A 3S9HA 5AQMA 4HUEA 4DLGA 4WE1A 3M8PA 4FJMA 3OW2M 2O8DA 3NBPA 4M42A 5DM7L 1LWEA 4AQYK 4CGJA 1U6ZA 2YX6A 3A2FA 3TSPA 2HB5A 4CF2A 1J53A 1IV0A 3DAWA 4MDAA 3PX6A 5EY4A 5ELZA 4FZXC 3ULDA 2G8FA 1T44A 1XWLA 2KLAA 4QS9A 3B6OA 1WOQA 2ITMA 1X1PA 2VQEK 1C0GA 1C6VA 1KVBA 3ZEUB 1RILA 5EX5A 2OYQA 3EN9A 1VQLN 3ZT1A 4WQ4C 2RPIA 3CCUN 4PUOA 2QWQA 4QCLA 4CGDA 3TTCA 1R0AA 3HJFA 4JHDB 2JWLA 1U47A 4DTRA 3OY9A 5HP1A 3HT3A 2BANA 1IJJA 4E19A 4JKEA 4B9SA 1JLGA 4CHOA 3T1HK 3CCSN 2A3ZA 1DGKN 5M1QA 1ZBLA 4JKGB 2O8CA 3CXCM 4YOTA 2IDOA 1B9FA 1DLOA 1IKWA 5AQKA 4Q0BA 4ZTJA 3THWB 3ZSOA 1IO2A 3THVA 1T6DA 4HCCA 2PY5A 2ZGYA 3AVMA 3OYCA 1IBMK 4DLEA 3CIPA 5F0XA 1WB9A 4AHSA 5AZIB 4O4GA 1TK5A 3DRPA 2DY4A 3U3YA 3GG4A 4BRPA 1S6QA 2F9TA 4BR7A 3NH1A 2D0CA 4HWIA 4CJRA 4K8XA 4BR5A 5LMUK 3CG7A 5TKYA 1QQCA 4JI5K 3OHRA 2P9LB 2YJFA 3WUHA 2KZZA 3EY1A 3QBXA 3ZX0A 1EXQA 5CZ1A 1HQEA 3IAYA 1DTQA 2UU9K 2E2QA 3D45A 3ZSZA 1C0MA 3LPTA 1L3TA 2F8TA 5AJ3K 2VWBA 1WSFA 3WXLA 3MXMA 4Y0WA 1SKWA 2OPQA 4DSEA 3V9UA 3M6GA 5FDLA 3T7ZA 3BDPA 4C8MA 3VETA 3SYZA 1F21A 1KC8O 1VSIA 3L8BA 1TK0A 2QM1A 1VQ9N 2Q31A 4DS5A 4OLBA 5AQHA 1VRUA 1UAXA 4GW6A 3J81O 5AQRA 4B9LA 4BR0A 3C6TA 3C0BA 5AZIA 4JKAA 3HM9A 3HRGA 1ASVA 3V1RA 2YNHA 4OKJA 2IVPA 4KHWA 4A61A 4DV0K 5J2PA 1RDBA 4AF1A 4LD0A 4CERA 2HBLA 3HK2A 1O13A 2KQ2A 4CZHA 4CJLA 1NGEA 1XMOK 2P9SB 2RE2A 4C8OA 3CD6N 4DFKA 4CZGA 4I7FA 3A0IX 5HRPA 2XY7A 4G9ZA 3PSFA 4PKGA 2HHVA 1ATNA 4OKKA 3FZMA 4MLHA 4Z94A 4AHCA 1FJGK 1U49A 1NK9A 1J54A 1NK4A 1V4TA 4RW6A 1VAZA 2YNGA 4M7YA 2BDPA 4ISGA 4BREA 3M3ZA 2KFNA 1TYQA 2CGLA 4LF7K 4BC4A 1BI4A 3V9SA 4FWMA 4DV1K 4FWSA 4E7IA 1KRPA 4E7JA 3FZKA 4BRLA 1S5JA 2O8BB 2IVNA 3IS9A 1HUXA 2O8EA 3HP6A 2W40A 5HL7L 3RR8A 3SUNA 1YXQA 3NF7A 5AQNA 5SWMA 3VPZA 1KAXA 3LDQA 2WONA 4CHQA 3VOVA 2E88A 5M1OA 1V4SA 4LH4A 4FOIA 1ZBSA 4DQQA 1C1AA 2AJQA 1X3MA 5HRNA 4AHRA 2VWKA 1I94K 2W41A 3O9RA 3H08A 4FLZA 1O1WA 4CEQA 5AQPA 2E1YA 3ZYYX 3S3NA 3L2QA 3UB5A 2P9IA 1MWMA 3L3UA 4A62A 3I8DA 4IOCL 4C1NK 4DSIA 4CIEA 3JSMA 4DMNA 5AQLA 4JS5A 4K25A 4A2BA 2E2NA 1LAWA 4N41A 1NU0A 4ELVA 3DXMA 4DR5K 3HO1A 4NYFA 4X64K 3AVBA 3E9LA 3DI6A 4OPHA 3FZHA 5AQTA 1NGJA 2D0AA 2E20A 3J80O 3OYGA 2W42A 4KO0A 4KKOA 1ESVA 5AQFA 4FJ7A 2OANA 2IGIA 1S1UA 3ITHA 3MXIA 1NK8A 1C0TA 1ITGA 4BQLA 2HHUA 2X6SA 3LAMA 2AP1A 2PBDA 3QEXA 2I5JA 5GAHP 1ZXOA 3MDQA 1LV5A 4DQSA 1C0FA 4M3UA 2QXLA 3RSEA 3D0PA 1NOZA 2ZF5O 4PL7A 3CCRN 1SQKA 5AQJA 4UY8O 2ATQA 2PYLA 4FCYA 3ZT2A 3J7YP 3MN5A 1JXEA 4ISEA 5KTQA 3PIPL 3CCQN 3SUPA 3A8YA 3CCEN 5AZJA 3OYEA 4FJHA 3L2VA 4F4KA 3OYFA 1WSEA 1EX4A 2E2PA 3HPHA 1NGCA 3QLHA 3W0LA 4FW1A 4GV9A 1MU2A 2HNYA 1SV5A 3QESA 3TAMA 2ASMA 3CMEN 3F73A 3CFOA 4NCBA 4IZ9A 1RNHA 4JD2A 3P39A 3THWA 1ASUA 3SJHA 4WFNL 3CHWA 4QOZB 3D7EO 4FWPA 4BC5A 4FLVA 1U48A 1QHAA 2P9UB 1BDGA 5HBMA 3BGRA 1Q7YO 4BC2A 1HPMA 4IG0A 2X6NA 4BWJA 1IG9A 2HSTA 3QO9A 3ASMA 1ILYA 1DEJA 1SL1A 1JKHA 2KKZA 2Q0UA 2BH1A 3O4QA 3AA4A 5KGWA 1A5XA 4DTNA 1GLJO 5JLHA 1L3SA 1YVNA 3LZIA 3G71N 5BN9A 4LF4K 2KW4A 1BHLA 4DR1K 1S1TA 4CZLA 3AA3A 1S3XA 4ELTA 5C10A 1WSIA 5AQUA 3ENHA 5ADXH 3SQ4A 4H5NA 4LF6K 4I9QA 2BTFA 2F4VK 4NXNK 5EXWA 4FJXA 3I0RA 3WQUA 4M41A 3R9PA 5EOYA 1KFDA 3O3FA 4HTUA 1HRHA 2Q1NA 3VQ8A 1QZ6A 4E89A 4FL9A 2QXFA 3GE1A 3L2RA 3VQEA 5AQZA 4O0JA 1NKEA 1W7AA 2FLOA 3CJ1A 4RW9A 3CFPA 1TKTA 2DPNA 3CI5A 4YOXA 4FJ9A 3DRRA 3OYDA 4ELUA 4WFAL 3CETA 1SS6A 4C8LA 1LCUA 5JLFA 4IKFA 2D5RA 4OJRA 3ZX2A 5BR9A 1SL0A 3NVKA 1RDDA 4CJ7A 3JS6A 3L3VA 4A5BA 5CYQA 3O9QA 5LY3A 3V6DA 1OH5A 3Q7CA 1QZ5A 1RT5A 3FZLA 3TAEA 4BRKA 3PX4A 2GX9A 4H0VB 3N4PA 5CHIA 4MO4A 3HVRA 1S6PA 2A1RA 1BUPA 2YJEA 3OS0A 3W3DA 4B3TK 3NGYA 3LP1A 4PWDA 1OH8A 3MN6A 4BRHA 4OX9K 2NRRA 4BRMA 4IBNA 1CLQA 3OBWA 1CZBA 4FJ5A 4DTMA 1IKVA 4M3ZA 2Q3SA 4M63C 2FBTA 4CZKA 3THYB 4TSXA 3SI6A 1WN7A 3HI0A 3LDLA 4YHHK 2FC0A 4HTLA 4DB3A 2YHAA 4IDKA 4KV8A 2ETJA 4CHNA 1QHTA 3I0SA 1P8ZA 3C7NB 4X65K 3OJSA 3RMBA 3CC4N 3SMPA 2ZJRL 4K41A 1VQ8N 3AGKA 3ATUA 2OA8A 2YHWA 3D2FA 4N56A 3FR0A 4CZMA 3SPYA 3V4IA 5LL6Z 1Q9XA 1Y64A 3FZFA 3QFUA 1GLAG 3E66A 4G1QA 2E6MA 1X9WA 3DLBA 4DR4K 3UKRA 3VQDA 3V9XA 1OVQA 4PQUA 2WTUA 3THYA 2G8IA 2B6AA 4FM2A 3E01A 4FJLA 4MDBA 2HVHA 1VQKN 2ZJPL 2P9NA 1IG8A 3CJBA 2BUPA 1VSFA 1RTIA 3ZETA 1TL3A 1EWRA 4CVNE 2G8HA 2P51A 1Z05A 5DK5A 2Y1JA 1M1KO 3O4NA 1BI4B 3IFRA 4I6MA 1JLCA 1NMNA 4DUZK 1FKOA 4O8KA 1QQMA 4DUYK 4BGAA 3R1XA 1L3VA 4CF0A 4JN4A 4RTFD 4KH4A 2X78A 4GKKK 3ZT3A 2G8UA 4OGCA 3HBTA 5T7BA 4YDUA 1N34K 3DLKA 3OYKA 1WNSA 4FWRA 3QIPA 2P9KA 4LC9B 3T19A 4CJ3A 3O80A 3VF4A 4CF1A 4ZTFA 2AA4A 4H5VA 3IG1A 3OYHA 5HRRA 3ZSXA 3CFRA 3SQ0A 1RBVA 4CIGA 3DLRA 4BACA 2ITGA 4DV4K 1QQNA 4R79A 4WQ4A 1HMVA 4KREA 1VSHA 1BQMA 3KLFA 5FPNA 4DQRA 2KHOA 1KD1O 2IOCA 2VG6A 5GAEP 3G6EN 4FLXA 3OYAA 3D2FB 1QSSA 4B3RK 5TKWA 4CESA 3SQ2A 4B9TA 1XNQK 4B9QA 5AQXA 3THXB 1LW0A 3OYJA 4JI4K 3DLHA 1UWBA 1IBLK 4E7LA 2QWPA 4FWQA 1OVYA 1E4FT 3VF6A 4ILJA 3VQ5A 3NCIA 3VQBA 2Z1GA 3J8AA 2XO7A 1BQNA 1HYZA 4JKGA 2O8CB 3LP3A 2WOMA 4Z4CA 3K9KA 1WAJA 4MQ3A 4Z4FA 4FJGA 4JK8A 1L3UA 4FOEA 2Z1JA 1RDAA 1DTTA 4OPKA 4F3TA 5JVGL 2KFZA 1EKEA 4F2RA 3E9OA 3LALA 4LY7A 1XI1A 3LM9A 4YOUA 1YTAA 2FSJA 5M1KA 4KAZA 5BPMA 3ZSWA 2R7YA 3QIOA 3CQYA 2O8FA 1NGAA 3SUQA 1T6CA 4HUGA 3FE1A 3SLCA 1YITN 3U9ZA 5EU7A 4DSJA 3M8QA 4JI3K 1W97L 3U3GA 2FSNA 4CZIA 1SZ2A 3SZ2A 3OA9A 2UUBK 4LF5K 3Q7BA 4DTJA 2XY5A 2O8FB 4A5AA 4DTOA 4OGEA 4KPYA 5BPNA 3AVCA 4YOWA 1XMQK 5C0YA 4KTZA 1RDUA 3TARA 1TKDA 3BF3A 2YHXA 4EZ9A 4BY9C 2OPRA 4H0YB 4YOYA 4DF4A 3CM6A 4CJTA 1HKBA 5AQSA 1U2VA 3AV9A 5H1SQ 4KI4A 5KI6A 3QETA 1FXXA 1XHZA 2NNWA 1ZBFA 2HNDA 2E8AA 1WBBA 2O4GA 3SUOA 3HM8A 1K8AO 2O8BA 2IC3A 3AVIA 3LM2A 1UOCA 3R8EA 3VQQA 4BROA 3O3GA 3DLEA 3BP8A 3CQXA 4KHPK 3E1YA 3FFIA 1QVGM 1SAZA 3K57A 3KZBA 4ILGB 1BIUA 4XEIA 4HHTA 1YJ9N 1RTDA 4J2EA 1D9FA 2Q36A 2F96A 3LDPA 3P5JA 4I9LA 3ATVA 5AFUH 1WAFA 5KQ8A 4YFUA 4IO8A 4FJJA 4IOXA 4CK3A 3I8BA 3KD1E 4A57A 1MA9B 1SL2A 3KLIA 4YOVA 4GV6A 2OTLN 4CFDA 5E84A 4CJQA 1B92A 4JS4A 5C2FA 4EP4A 1NJWA 3QMLA 3RMAA 3AVGA 4GMJB 5KRSA 4WQ5A 1HLUA 2JGUA 2P1JA 5BREA 4BRCA 1VQPN 1REVA 3QDKA 5CR4A 3FGUA 1N32K 3WQTA 4L8RB 3K5LA 5KGXA 5DM6L 3VGKA 4CGGA 3LANA 1S9GA 3U8XA 2NRVA 4JV5K 1KVAA 2YHBA 3S41A 1U04A 1LW2A 3L4QA 4NO7A 5CYMA 4I2QA 3WXMB 3KHYA 1QVFM 4JI7K 4M45A 1A5VA 4CF9A 4BE0A 1NLVA 4BE1A 3P38A 2YNFA 3IKMA 4B9NA 4Z0UA 5M1PA 1UA1A 4NB4A 1Z6RA 1G15A 2YCHA 4CJ5A 3MEGA 1KXPA 3AVLA 3SBGA 4CFAA 4IJAA 2A6AA 3VTIA 3KK3A 5K14A 5JS1A 2DFFA 3VQ6A 3K0SA 3A5MC 1JLFA 3PY8A 2NRZA 3AO4A 1YI2N 3KJVA 2P9LA 3ALYA 5BN8A 4FLYA 5JVHL 2FSKA 5KQDA 2QKKA 3VGMA 1X9MA 1BG3A 3ZLJA 4FPBA 5HOOA 4CBXA 5AQOA 4CECA 3CJ9A 3SAGA 3U9DA 4K0KK 3VQPA 2HMIA 2G8VA 4FK4A 4DQIA 4JAXA 1Q82O 5BRDA 1JLAA 1H1VA 1HYVA 5CE3A 4BQZA 3HPGA 3EL2A 3NFAA 3K59A 2FBVA 4PA1A 3AO3A 2VQFK 1QTMA 3O1WA 4KI6A 4LSLA 3C95A 4CJWA 3HOSA 5BRHA 3ZT4A 4H5WA 3A5OC 1TUYA 3MXJA 4O55A 4GV3A 3R3LA 1D8YA 4QS8A 1NGHA 3VQCA 4CHPA 3HOTA 3SBTA 2XRIA 4KB1A 2HHSA 4N47A 2UYTA 1ATRA 4CJFA 4DG1A 4CJ4A 4B9VA 4CE9A 5FLXO 3D6RA 3K9JA 1ZC6A 2PAVA 4BR4A 4CEAA 1U2VB 4FO0A 3HYFA 4RW8A 2HBMA 3CCVN 1BGXT 1X9SA 3CM5A 3AVAA 2W6LA 4FPAA 5AFUA 2XY6A 2Z1HA 1NGGA 5JMVA 2XHBA 4H4OA 3VN5A 3EEQA 4H0PA 3WXJA 2GELA 4ISFA 3VERA 3OYIA 1JL2A 1RT3A 4ID5A 4OPAA 1HNXK 3K58A 4O5BA 1VSEA 1HJRA 2QW9A 1BIZA 3NF6A 4A59A 2OPSA 4H03B 1YUWA 4RW7A 5FROA 4B9UA 4CJPA 4K42A 2GEMA 3SAHA 3L2UA 4AILC 4B9MA 1RFQA 2EHGA 3MWPA 4DS4A 3V1OA 4DQPA 1W2BM 2GBZA 4W5NA 3TR8A 4CGFA 3TSQA 4F3OA 3DLGA 4BG8A 3BEXA 4JYAK 3NH0A 1KQSM 2E1ZA 3IMXA 4KHNA 4L3QA 4B8AB 4DSLA 4KB0A 4GVEA 1BU6O 3M8SA 3PUFA 1YJWN 1RGIA 3UE5A 3P83D 4FJNA 5M1FA 4JKFA 3VEZA 4M3RA 4IFEA 1ZBIA 4YDUC 1WSHA 3TPQA 5KPZA 5FRNA 3MCAB 2FBXA 4JRPA 3TANA 2KTQA 2HF4A 4BVOA 4LFAK 1CXQA 4FK0A 1Q8IA 2P9UA 2GUPA 2OCEA 2HF3A 2O8DB 1HNZK 2ZQBA 3CQ8A 4RCHA 3O3HA 1YT3A 4FVUA 3PX0A 1GLBG 1JLEA 2UUAK 1KTQA 1ATSA 3MK6A 1RBTA 1EQYA 1WLJA 3VGLA 1N5YA 3KLEA 5GINA 4BRFA 3SPZA 1GOCA 1HNWK 4CJUA 2P9IB 2NUBA 1NK0A 1BCOA 4CJVA 3UKUB 1YTUA 4AM6A 4NLBA 1TV6A 2ZJQL 3EZ5A 4CFCA 1EETA 1J5EK 4W5RA 4QS7A 3WXIA 4NXMK 1RT7A 3AAQA 3NF8A 3MMVA 1N33K 4BGBA 2YKNA 2UXCK 4U67L 1E3MA 4KFBA 1NGDA 3OVNA 3T1YK 2WC9A 1NMDA 3WEEA 3AGRA 2NZTA 2DFHA 4JEPA 2P5OA 3LAKA 4FWOA 3DXKA 2D0PA 3LL3A 5F2RA 4DV3K 2X74A 2ZGZA 2DTUA 4CZEA 5J2QA 4BDZA 3UKUA 4JKDA 1K6YA 1BCMA 3GOIA 4LF9K 1HYSA 2O8EB 1RCHA 4PKHA 4N76A 1GOAA 2ZD1A 4JKBA 5J2MA 4J2AA 2D0BA 3CYMA 1QSYA 3DJCA 1QSLA 1MDUB 5KRTA 5M1NA 1EO1A 4AHVA 3I55N 4CF8A 3BF1A 4JK7A 2HHHK 4DR2K 4JI0K 4CEEA 4B1WB 3DOLA 1JXBA 3AO2A 5FPDA 5FPEA 1RDCA 3NH2A 2P9PA 4C1NI 3QINA 1CXUA 1KVCA 4DU4A 3M1FA 1NNEA 3N4QA 1A5WA 3L4IA 5LJVA 3D2EB 1Q9YA 3WNFA 3U6FA 4AHUA 1JCFA 4FW2A 4W5QA 4NYNA 2W6KA 4IG3A 3QNNA 3C6HA 3DYAA 1YF5L 4Z4HA 2JWKA 2PFUA 4X62K 3L6QA 4JNEA 1BWFO 1C1CA 4DSKA 2P9PB 1RDWX 5JS2A 1HX1A 1W0HA 4ICLA 1NK5A 1TYQB 1HNVA 1HKCA 4H8KA 3RRHA 2V52B 2B4JA 3H46O 4FM0A 3KK2A 3JXUA 1XC9A 3H6EA 2NRXA 4WF9L 4FJIA 4FJKA 4JKCA 1VK0A 2VYPA 1KFSA 4JI6K 4FXDA 2HHTA 2OZMA 4XH1A 3ZSVA 1RT6A 4V19S 3RR7A 3VTHA 3HXMA 4BVPA 4NCGA 3MEEA 3NGZA 3OYBA 4MFBA 3EZWA 1TKZA 1J9AA 2EWSA 4XIUA 3LWLA 2YHYA 4CK1A 3NGIA 4BR9A 3GDQA 3K5OA 1RBRA 2HBJA 3QNOA 3HSCA 4B3MK 5JICA 3H1QA 2OTJN 1G99A 4CFBA 4XH5A 4JK9A 3MN9A 1SUQA 4MO5A 4H0XB 1NOYA 5AQQA 3K2PA 4J2DA 1NJIO 2NLXA 4E1NA 2P5GA 4CEZA 4FZZA 3EE9A 3S3OA 1JLBA 3AVJA 4KH6A 4MLEA 4CK2A 4BG9A 3ID8A 4CGIA 2Z1IA 1TAUA 2QWNA 2QWRA 5MLCQ 3KK7A 3IDHA 2HHQA 4I6MB 1XQSC 4DQ8A 3VEYA 4PKIA 4BR2A 1Q18A 4KHYA 1TKXA 1HR0K 4GY2B 3KVGA 3PSIA 3AO1A 3OS1A 4IEEA 3J7AP 1J6ZA 4BRNA 4FWLA 4RG8A 4J8FA 3VQAA 3WNEA 2VCPA 1XC3A 1SKSA 4Y1CA 4ID1A 3JAMO 1TVRA 3AVFA 3H3NO 4EAHD 3AARA 4ILHA 4JRQA 3MAQA 4DTXA 4EHUA 2RF2A 2QTDA 3VF2A 3OJUA 2NRHA 2HBKA 2PYJA 3ZX3A 3RWUA 3SAFA 1JL1A 3O9SA 3P4IA 5EVZA 3KIOA 4JKHA 1ZBHA 3TAPA 1B9DA 2QWOA 3L0QA 4B1YB 3T3FA 3LP2A 3MX2A 2YKMA 3FLCO 4BRIA 1VSDA 1RTJA 2HNZA 3V9WA 3TABA 2CGKA 4B3SK 3WXKA 3TAQA 1N36K 1RTHA 1X9JA 4CHZA 3HTVA 3OYLA 4RWTA 1TGOA 4EP5A 4B1ZA 4O0IA 3KTQA 3TI0A 4EHTA 3ENBA 1HQUA 1HKGA 5DMRA 3E9PA 2A5XA 5AQVA 3MWTA 2YI1A 1BA0A 3TAFA 3DWLA 4IEIA 2A40A 3ZSRA 3NMUA 4FVMA 4DR7K 1NJYA 3D2EA 1TUUA 4JI8K 4RW4A 4BC3A 3QEPA 3H1VX 5GIPA 3ZEUA 4XH4A 1ZBUA 1NJZA 1J5OA 1KAZA 4O8UA 4CHYA 2UXBK 1VHXA 4B1UB 2F8SA 2HHWA 1VQ6N 3BUZB 1FKPA 4BDYA 3RTVA 4FSVA 3PV8A 3J7ZO 3O9UA 3SV4A 1JCEA 4K8ZA 3CPEA 4E3SA 2G8WA 1D5AA 1WSGA 1GOBA 4CEBA 1K73O 3TTDA 1TL1A 3KKRA 3KLHA 3MECA 2IS3A 3CJ7A 1KAYA 3JYTA 1VQ5N 3R6MA 3U4LA 5C15A 3NDKA 3CCMN 1NK6A 1KCFA 2E2OA 1MWKA 3LDOA 4AHTA 1S72N 3PO5A 1M90O 3AVHA 4M3WA 5J2NA 3M8RA 1RT2A 2IIRA 4DU1A 3UKRB 4KTWA 4BRAA 2EX3A 5BPLA 4Y1DA 3VESA 4CEOA 1NKBA 3WNGA 2A42A 4R5PA 3V1QA 3HPOA 1VSMA 2J4RA 3HL8A 3LPUA 3TU5A 4X66K 2NRWA 1VQ7N 1XHXA 3K5NA 3ULEA 5LMNK 4CEFA 1ASWA 4YY3K 2YV0X 4BDPA 3O8MA 1CZAN 1RT1A 4LSNA 3C65A 4DFPA 5AQGA 5I3UA 1DKGD 3GBTA 2ASPA 4DU3A 4B8CA 3EE8A 4IFVA 2FF3B 4M3YA 3VEXA 1GLLO 2BGGA 3DM2A 3SMSA 3MX5A 1KLNA 4DTPA 3CJCA 1IKXA 2JLEA 5SZTA 1C0UA 4DTUA 1IBKK 3T1AA 4HVJA 3A5NC 3WNHA 4GKJK 3MEDA 2CH6A 4CI6A 4NCAA 2B5JA 4QAGA 5D3GA 3IUCA 4DV2K 4FLWA 3VQ7A 3MN7A 2OZSA 3ZETB 1K9MO 1S9EA 3VEVA 4FYDA
chains in the Genus database with same CATH topology
4JI8K 1IBLK 5A2QO 4X64K 2HHHK 4DR2K 4JI0K 2UUCK 4LF6K 3J80O 3T1HK 2F4VK 4NXNK 1XMOK 4DR4K 2VQFK 2UXBK 4CW7B 4DV0K 4LFAK 4LFBK 1HNZK 5IWAK 4DR6K 1IBMK 1XNRK 1FJGK 1N32K 1HR0K 2UXDK 4CVNE 2UUAK 3J7YP 5BR8K 5FLXO 3J7AP 4JV5K 2E5LK 4DUZK 4LF7K 3JAMO 4DUYK 4DV1K 4X62K 4JI7K 4LFCK 5LMUK 1HNWK 4JI5K 4GKKK 4JI3K 1N34K 2UU9K 4LF8K 4LF5K 2UUBK 4B3TK 1XMQK 4X66K 5AJ3K 1J5EK 5LMNK 4NXMK 4OX9K 1HNXK 4YY3K 4AQYK 1N33K 4JI6K 2UXCK 4B3SK 1N36K 3T1YK 4DV7K 4DV4K 1I94K 4V19S 4DV5K 2VQEK 4YHHK 1IBKK 4KHPK 4DV6K 4DV3K 4DR3K 4GKJK 4JI2K 2ZM6K 4JYAK 4JI1K 3J81O 4X65K 4DV2K 4B3MK 4LF9K 4B3RK 4LF4K 1XNQK 4K0KK 4DR1K 4DR7K 4JI4K 5LL6Z 4DR5K 5IT9O 3OTOK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 K;  1IBL K;  5A2Q O;  4X64 K;  2HHH K;  4DR2 K;  4JI0 K;  2UUC K;  4LF6 K;  3J80 O;  3T1H K;  2F4V K;  4NXN K;  1XMO K;  4DR4 K;  2VQF K;  2UXB K;  4CW7 B;  4DV0 K;  4LFA K;  4LFB K;  1HNZ K;  5IWA K;  4DR6 K;  1IBM K;  1XNR K;  1FJG K;  1N32 K;  1HR0 K;  2UXD K;  4CVN E;  2UUA K;  3J7Y P;  5BR8 K;  5FLX O;  3J7A P;  4JV5 K;  2E5L K;  4DUZ K;  4LF7 K;  3JAM O;  4DUY K;  4DV1 K;  4X62 K;  4JI7 K;  4LFC K;  5LMU K;  1HNW K;  4JI5 K;  4GKK K;  4JI3 K;  1N34 K;  2UU9 K;  4LF8 K;  4LF5 K;  2UUB K;  4B3T K;  1XMQ K;  4X66 K;  5AJ3 K;  1J5E K;  5LMN K;  4NXM K;  4OX9 K;  1HNX K;  4YY3 K;  4AQY K;  1N33 K;  4JI6 K;  2UXC K;  4B3S K;  1N36 K;  3T1Y K;  4DV7 K;  4DV4 K;  1I94 K;  4V19 S;  4DV5 K;  2VQE K;  4YHH K;  1IBK K;  4KHP K;  4DV6 K;  4DV3 K;  4DR3 K;  4GKJ K;  4JI2 K;  2ZM6 K;  4JYA K;  4JI1 K;  3J81 O;  4X65 K;  4DV2 K;  4B3M K;  4LF9 K;  4B3R K;  4LF4 K;  1XNQ K;  4K0K K;  4DR1 K;  4DR7 K;  4JI4 K;  5LL6 Z;  4DR5 K;  5IT9 O;  3OTO K; 
#chains in the Genus database with same CATH topology
 4C8K A;  3G4S N;  1Y97 A;  3DXK B;  4IOA L;  1S1X A;  1BA1 A;  3PIO L;  5C12 A;  1T7P A;  3A5L C;  5CY4 A;  3EKU A;  3VMF B;  2IAJ A;  2RKI A;  5KPR A;  1VQM N;  4LH5 A;  1WSJ A;  4H4M A;  1D4X A;  1NK7 A;  3ISN C;  4WFB L;  4E1J A;  2HHX A;  3DLL L;  4IJN A;  5I42 A;  3TSU A;  3C6A A;  4DR6 K;  1YIJ N;  3EO3 A;  4CJK A;  1IKY A;  3TTF A;  4CZF A;  3G0Z A;  3O5B A;  2QA4 N;  4OLA A;  3VQ4 A;  4WQ5 C;  2QWM A;  2E5L K;  1LOT B;  1S22 A;  2RN2 A;  4CBW A;  2WFB A;  1NWK A;  2F7T A;  3I56 N;  4E7K A;  3VEN A;  3DRS A;  2P9K B;  3AAP A;  2I7N A;  3KWG A;  4IO9 L;  3LP0 A;  5KPT A;  3QEV A;  4DHY A;  4BRD A;  3SQ1 A;  3ENO A;  1I39 A;  2VWJ A;  1IH7 A;  3ZSQ A;  1U4B A;  1QE1 A;  3BZC A;  3QIC A;  4H0T B;  1LAV A;  3H3O B;  2Q0R A;  3HZ6 A;  4IFY A;  3O1B A;  1NM1 A;  4H5R A;  4KHU A;  4KHS A;  3AVK A;  1JCG A;  4DCH A;  3CJA A;  4YNQ A;  3RSE B;  3ZCM A;  4Z4I A;  1T05 A;  1T3V A;  3MCP A;  1EP4 A;  4DV5 K;  4F2S A;  4BWM A;  5GIO A;  3LDN A;  1TK8 A;  2Y1I A;  5FPM A;  4DV6 K;  3NVM A;  2VG7 A;  2OPP A;  3F2K A;  4BRG A;  4A2A A;  5B8H A;  3OYN A;  1K8K A;  3O6W A;  3AA5 X;  3OS2 A;  1GLD G;  4F8R A;  4JD2 B;  2V51 B;  4H5T A;  3WEE B;  4GVM A;  3M5R A;  5E41 A;  3TWH A;  3L2W A;  1TAQ A;  2A1S A;  2CGJ A;  2GWJ A;  1WBD A;  3RRG A;  1RT4 A;  3CCJ N;  4Q5V A;  2LSN A;  3AA2 A;  3S3M A;  1YJN N;  3F9M A;  3KKS A;  2GTD A;  1NBW A;  4PY5 A;  4PL8 A;  3WT0 A;  1GLE G;  3SV3 A;  4Z4G A;  2E4L A;  2VGM A;  4BRQ A;  4M3X A;  3VA0 A;  3KK1 A;  3O9T A;  4B3O A;  3NAE A;  3AVN A;  3O08 A;  3QEI A;  2QKB A;  4EZ6 A;  1FW6 A;  1VSK A;  4FWN A;  2YNI A;  3CMA N;  4FM1 A;  3CCL N;  2ASO A;  3ID6 A;  1R59 O;  3V9Z A;  3RMD A;  3HVT A;  4DTS A;  1NGF A;  1K8K B;  4OO1 J;  1P90 A;  1L5U A;  1HNI A;  5AQW A;  5F1X A;  3C7N A;  4DF8 A;  4KH5 A;  1BOT O;  4IDH A;  4HUF A;  4CZJ A;  3LZJ A;  3IRX A;  3QB0 A;  4CED A;  3CF5 L;  1Q81 O;  1N6Q A;  1DT9 A;  3P1G A;  2DFE A;  3DOK A;  4FWK A;  1VQ4 N;  4C23 A;  1LWC A;  1T03 A;  3RVC A;  3V81 A;  3VQ9 A;  3KLG A;  3TAG A;  4FJ8 A;  1YVU A;  2FXU A;  5HLF A;  1W9H A;  3K5M A;  4NLC A;  5C2D A;  4J2B A;  1UA0 A;  2BE2 A;  1BIS A;  4DR3 K;  2HOE A;  1S1V A;  2D0O A;  1HJO A;  4JI1 K;  4IWV A;  1LWF A;  3LWM A;  4Z4E A;  3SK3 A;  1NG9 A;  3ZT0 A;  1C1B A;  4W5O A;  2GV9 A;  4WCE L;  3CC2 N;  1WUA A;  4E0D A;  2VG5 A;  1BO5 O;  4OVL A;  4CJS A;  5A2Q O;  4IXC A;  3RMC A;  1SKR A;  2A41 A;  3QER A;  2UUC K;  5I9E B;  4KRF A;  4CGH A;  2I7P A;  3ULE B;  5AZJ B;  3KD5 E;  2GWK A;  1N8R O;  3PO4 A;  4CW7 B;  2H3G X;  1I3A A;  5CZ2 A;  4PHT X;  1JJ2 M;  4M3T A;  2PZS A;  2E6L A;  5GAG P;  4HCB A;  1XUP O;  3AO5 A;  3DXM B;  1ZYQ A;  5GAD P;  2HMP A;  2V7Y A;  3B6P A;  1QQO A;  3FFK B;  5AQI A;  2HVI A;  1KLM A;  4DKW A;  4KBO A;  3UIQ A;  2P9N B;  5J1E A;  4N5S A;  4BE2 A;  4CD3 A;  2KZM A;  3SJJ A;  1VRT A;  5E26 A;  4FLU A;  1OH6 A;  4LFC K;  2XY8 A;  4JLH A;  3P31 A;  2QK9 A;  3F5T A;  2O4I A;  3SCX A;  3CER A;  3B8A X;  3ZSY A;  2NRT A;  4CJE A;  4M7X A;  1GLC G;  1OKJ A;  1S1W A;  3EYZ A;  5HRO A;  4DFJ A;  4CD1 A;  5HRS A;  1D9D A;  1NGI A;  5ADX A;  3LDS A;  1FK9 A;  5C25 A;  3H45 C;  4UQG A;  4DWI A;  1VSJ A;  1VQO N;  4CBU A;  1KSP A;  3THX A;  1JLQ A;  2Q97 A;  3OBY A;  2G8K A;  3NF9 A;  3AY9 A;  1Z26 A;  4E1M A;  4H0O A;  1T8E A;  3EKS A;  4ZHR A;  3QBW A;  3BZK A;  3OYM A;  4DV7 K;  4EFH A;  1BL3 A;  4EIA A;  2WBN A;  1VSL A;  3HST B;  5C24 A;  3I33 A;  4OPJ A;  3HP9 A;  1HPZ A;  4KHQ A;  1VQN N;  1Z25 A;  1YAG A;  4B1X B;  3KWI A;  3QEW A;  3DMJ A;  4CIF A;  4O5F A;  4JI2 K;  2ZM6 K;  4F9O A;  2Q2R A;  2RHK A;  2QI2 A;  1NKC A;  4E7H A;  5BRF A;  4I2P A;  4AM7 A;  4U7B A;  1QS4 A;  3VEO A;  1RBS A;  2QWL A;  4OKE A;  2WUS A;  4FK2 A;  5AR0 A;  2IVO A;  5IT9 O;  3OTO K;  1E4G T;  4GNI A;  4JHD A;  1CZ9 A;  4W5T A;  3GL1 A;  4DSF A;  1OH7 A;  4B08 A;  3PLA A;  4K43 A;  4B1V A;  1YHQ N;  2D1K A;  1RBU A;  3CPW M;  1GLF O;  4LFB K;  4FZY A;  2GUI A;  3O4W A;  2VGN A;  1U45 A;  2F9W A;  5LJW A;  5FRM A;  5IWA K;  3SNN A;  2QEX N;  4KTQ A;  3C94 A;  3BY5 A;  2HW3 A;  1XNR K;  4O44 A;  1NJX A;  2UXD K;  3QFP A;  1EWQ A;  5BR8 K;  5C42 A;  3CC7 N;  4DFM A;  4CCH A;  2FF6 A;  3G10 A;  4WYB A;  2ZWH A;  4C8N A;  5AQY A;  2FBY A;  2P9S A;  3T69 A;  2ZE2 A;  1Q86 O;  4FLT A;  3NHG A;  1X3N A;  3VEW A;  3F9K A;  2D4W A;  4AH9 A;  1NGB A;  2V7Z A;  4YOR A;  3VA3 A;  3C6U A;  3G25 A;  3NE6 A;  4LF8 K;  2CH5 A;  3S9H A;  5AQM A;  4HUE A;  4DLG A;  4WE1 A;  3M8P A;  4FJM A;  3OW2 M;  2O8D A;  3NBP A;  4M42 A;  5DM7 L;  1LWE A;  4AQY K;  4CGJ A;  1U6Z A;  2YX6 A;  3A2F A;  3TSP A;  2HB5 A;  4CF2 A;  1J53 A;  1IV0 A;  3DAW A;  4MDA A;  3PX6 A;  5EY4 A;  5ELZ A;  4FZX C;  3ULD A;  2G8F A;  1T44 A;  1XWL A;  2KLA A;  4QS9 A;  3B6O A;  1WOQ A;  2ITM A;  1X1P A;  2VQE K;  1C0G A;  1C6V A;  1KVB A;  3ZEU B;  1RIL A;  5EX5 A;  2OYQ A;  3EN9 A;  1VQL N;  3ZT1 A;  4WQ4 C;  2RPI A;  3CCU N;  4PUO A;  2QWQ A;  4QCL A;  4CGD A;  3TTC A;  1R0A A;  3HJF A;  4JHD B;  2JWL A;  1U47 A;  4DTR A;  3OY9 A;  5HP1 A;  3HT3 A;  2BAN A;  1IJJ A;  4E19 A;  4JKE A;  4B9S A;  1JLG A;  4CHO A;  3T1H K;  3CCS N;  2A3Z A;  1DGK N;  5M1Q A;  1ZBL A;  4JKG B;  2O8C A;  3CXC M;  4YOT A;  2IDO A;  1B9F A;  1DLO A;  1IKW A;  5AQK A;  4Q0B A;  4ZTJ A;  3THW B;  3ZSO A;  1IO2 A;  3THV A;  1T6D A;  4HCC A;  2PY5 A;  2ZGY A;  3AVM A;  3OYC A;  1IBM K;  4DLE A;  3CIP A;  5F0X A;  1WB9 A;  4AHS A;  5AZI B;  4O4G A;  1TK5 A;  3DRP A;  2DY4 A;  3U3Y A;  3GG4 A;  4BRP A;  1S6Q A;  2F9T A;  4BR7 A;  3NH1 A;  2D0C A;  4HWI A;  4CJR A;  4K8X A;  4BR5 A;  5LMU K;  3CG7 A;  5TKY A;  1QQC A;  4JI5 K;  3OHR A;  2P9L B;  2YJF A;  3WUH A;  2KZZ A;  3EY1 A;  3QBX A;  3ZX0 A;  1EXQ A;  5CZ1 A;  1HQE A;  3IAY A;  1DTQ A;  2UU9 K;  2E2Q A;  3D45 A;  3ZSZ A;  1C0M A;  3LPT A;  1L3T A;  2F8T A;  5AJ3 K;  2VWB A;  1WSF A;  3WXL A;  3MXM A;  4Y0W A;  1SKW A;  2OPQ A;  4DSE A;  3V9U A;  3M6G A;  5FDL A;  3T7Z A;  3BDP A;  4C8M A;  3VET A;  3SYZ A;  1F21 A;  1KC8 O;  1VSI A;  3L8B A;  1TK0 A;  2QM1 A;  1VQ9 N;  2Q31 A;  4DS5 A;  4OLB A;  5AQH A;  1VRU A;  1UAX A;  4GW6 A;  3J81 O;  5AQR A;  4B9L A;  4BR0 A;  3C6T A;  3C0B A;  5AZI A;  4JKA A;  3HM9 A;  3HRG A;  1ASV A;  3V1R A;  2YNH A;  4OKJ A;  2IVP A;  4KHW A;  4A61 A;  4DV0 K;  5J2P A;  1RDB A;  4AF1 A;  4LD0 A;  4CER A;  2HBL A;  3HK2 A;  1O13 A;  2KQ2 A;  4CZH A;  4CJL A;  1NGE A;  1XMO K;  2P9S B;  2RE2 A;  4C8O A;  3CD6 N;  4DFK A;  4CZG A;  4I7F A;  3A0I X;  5HRP A;  2XY7 A;  4G9Z A;  3PSF A;  4PKG A;  2HHV A;  1ATN A;  4OKK A;  3FZM A;  4MLH A;  4Z94 A;  4AHC A;  1FJG K;  1U49 A;  1NK9 A;  1J54 A;  1NK4 A;  1V4T A;  4RW6 A;  1VAZ A;  2YNG A;  4M7Y A;  2BDP A;  4ISG A;  4BRE A;  3M3Z A;  2KFN A;  1TYQ A;  2CGL A;  4LF7 K;  4BC4 A;  1BI4 A;  3V9S A;  4FWM A;  4DV1 K;  4FWS A;  4E7I A;  1KRP A;  4E7J A;  3FZK A;  4BRL A;  1S5J A;  2O8B B;  2IVN A;  3IS9 A;  1HUX A;  2O8E A;  3HP6 A;  2W40 A;  5HL7 L;  3RR8 A;  3SUN A;  1YXQ A;  3NF7 A;  5AQN A;  5SWM A;  3VPZ A;  1KAX A;  3LDQ A;  2WON A;  4CHQ A;  3VOV A;  2E88 A;  5M1O A;  1V4S A;  4LH4 A;  4FOI A;  1ZBS A;  4DQQ A;  1C1A A;  2AJQ A;  1X3M A;  5HRN A;  4AHR A;  2VWK A;  1I94 K;  2W41 A;  3O9R A;  3H08 A;  4FLZ A;  1O1W A;  4CEQ A;  5AQP A;  2E1Y A;  3ZYY X;  3S3N A;  3L2Q A;  3UB5 A;  2P9I A;  1MWM A;  3L3U A;  4A62 A;  3I8D A;  4IOC L;  4C1N K;  4DSI A;  4CIE A;  3JSM A;  4DMN A;  5AQL A;  4JS5 A;  4K25 A;  4A2B A;  2E2N A;  1LAW A;  4N41 A;  1NU0 A;  4ELV A;  3DXM A;  4DR5 K;  3HO1 A;  4NYF A;  4X64 K;  3AVB A;  3E9L A;  3DI6 A;  4OPH A;  3FZH A;  5AQT A;  1NGJ A;  2D0A A;  2E20 A;  3J80 O;  3OYG A;  2W42 A;  4KO0 A;  4KKO A;  1ESV A;  5AQF A;  4FJ7 A;  2OAN A;  2IGI A;  1S1U A;  3ITH A;  3MXI A;  1NK8 A;  1C0T A;  1ITG A;  4BQL A;  2HHU A;  2X6S A;  3LAM A;  2AP1 A;  2PBD A;  3QEX A;  2I5J A;  5GAH P;  1ZXO A;  3MDQ A;  1LV5 A;  4DQS A;  1C0F A;  4M3U A;  2QXL A;  3RSE A;  3D0P A;  1NOZ A;  2ZF5 O;  4PL7 A;  3CCR N;  1SQK A;  5AQJ A;  4UY8 O;  2ATQ A;  2PYL A;  4FCY A;  3ZT2 A;  3J7Y P;  3MN5 A;  1JXE A;  4ISE A;  5KTQ A;  3PIP L;  3CCQ N;  3SUP A;  3A8Y A;  3CCE N;  5AZJ A;  3OYE A;  4FJH A;  3L2V A;  4F4K A;  3OYF A;  1WSE A;  1EX4 A;  2E2P A;  3HPH A;  1NGC A;  3QLH A;  3W0L A;  4FW1 A;  4GV9 A;  1MU2 A;  2HNY A;  1SV5 A;  3QES A;  3TAM A;  2ASM A;  3CME N;  3F73 A;  3CFO A;  4NCB A;  4IZ9 A;  1RNH A;  4JD2 A;  3P39 A;  3THW A;  1ASU A;  3SJH A;  4WFN L;  3CHW A;  4QOZ B;  3D7E O;  4FWP A;  4BC5 A;  4FLV A;  1U48 A;  1QHA A;  2P9U B;  1BDG A;  5HBM A;  3BGR A;  1Q7Y O;  4BC2 A;  1HPM A;  4IG0 A;  2X6N A;  4BWJ A;  1IG9 A;  2HST A;  3QO9 A;  3ASM A;  1ILY A;  1DEJ A;  1SL1 A;  1JKH A;  2KKZ A;  2Q0U A;  2BH1 A;  3O4Q A;  3AA4 A;  5KGW A;  1A5X A;  4DTN A;  1GLJ O;  5JLH A;  1L3S A;  1YVN A;  3LZI A;  3G71 N;  5BN9 A;  4LF4 K;  2KW4 A;  1BHL A;  4DR1 K;  1S1T A;  4CZL A;  3AA3 A;  1S3X A;  4ELT A;  5C10 A;  1WSI A;  5AQU A;  3ENH A;  5ADX H;  3SQ4 A;  4H5N A;  4LF6 K;  4I9Q A;  2BTF A;  2F4V K;  4NXN K;  5EXW A;  4FJX A;  3I0R A;  3WQU A;  4M41 A;  3R9P A;  5EOY A;  1KFD A;  3O3F A;  4HTU A;  1HRH A;  2Q1N A;  3VQ8 A;  1QZ6 A;  4E89 A;  4FL9 A;  2QXF A;  3GE1 A;  3L2R A;  3VQE A;  5AQZ A;  4O0J A;  1NKE A;  1W7A A;  2FLO A;  3CJ1 A;  4RW9 A;  3CFP A;  1TKT A;  2DPN A;  3CI5 A;  4YOX A;  4FJ9 A;  3DRR A;  3OYD A;  4ELU A;  4WFA L;  3CET A;  1SS6 A;  4C8L A;  1LCU A;  5JLF A;  4IKF A;  2D5R A;  4OJR A;  3ZX2 A;  5BR9 A;  1SL0 A;  3NVK A;  1RDD A;  4CJ7 A;  3JS6 A;  3L3V A;  4A5B A;  5CYQ A;  3O9Q A;  5LY3 A;  3V6D A;  1OH5 A;  3Q7C A;  1QZ5 A;  1RT5 A;  3FZL A;  3TAE A;  4BRK A;  3PX4 A;  2GX9 A;  4H0V B;  3N4P A;  5CHI A;  4MO4 A;  3HVR A;  1S6P A;  2A1R A;  1BUP A;  2YJE A;  3OS0 A;  3W3D A;  4B3T K;  3NGY A;  3LP1 A;  4PWD A;  1OH8 A;  3MN6 A;  4BRH A;  4OX9 K;  2NRR A;  4BRM A;  4IBN A;  1CLQ A;  3OBW A;  1CZB A;  4FJ5 A;  4DTM A;  1IKV A;  4M3Z A;  2Q3S A;  4M63 C;  2FBT A;  4CZK A;  3THY B;  4TSX A;  3SI6 A;  1WN7 A;  3HI0 A;  3LDL A;  4YHH K;  2FC0 A;  4HTL A;  4DB3 A;  2YHA A;  4IDK A;  4KV8 A;  2ETJ A;  4CHN A;  1QHT A;  3I0S A;  1P8Z A;  3C7N B;  4X65 K;  3OJS A;  3RMB A;  3CC4 N;  3SMP A;  2ZJR L;  4K41 A;  1VQ8 N;  3AGK A;  3ATU A;  2OA8 A;  2YHW A;  3D2F A;  4N56 A;  3FR0 A;  4CZM A;  3SPY A;  3V4I A;  5LL6 Z;  1Q9X A;  1Y64 A;  3FZF A;  3QFU A;  1GLA G;  3E66 A;  4G1Q A;  2E6M A;  1X9W A;  3DLB A;  4DR4 K;  3UKR A;  3VQD A;  3V9X A;  1OVQ A;  4PQU A;  2WTU A;  3THY A;  2G8I A;  2B6A A;  4FM2 A;  3E01 A;  4FJL A;  4MDB A;  2HVH A;  1VQK N;  2ZJP L;  2P9N A;  1IG8 A;  3CJB A;  2BUP A;  1VSF A;  1RTI A;  3ZET A;  1TL3 A;  1EWR A;  4CVN E;  2G8H A;  2P51 A;  1Z05 A;  5DK5 A;  2Y1J A;  1M1K O;  3O4N A;  1BI4 B;  3IFR A;  4I6M A;  1JLC A;  1NMN A;  4DUZ K;  1FKO A;  4O8K A;  1QQM A;  4DUY K;  4BGA A;  3R1X A;  1L3V A;  4CF0 A;  4JN4 A;  4RTF D;  4KH4 A;  2X78 A;  4GKK K;  3ZT3 A;  2G8U A;  4OGC A;  3HBT A;  5T7B A;  4YDU A;  1N34 K;  3DLK A;  3OYK A;  1WNS A;  4FWR A;  3QIP A;  2P9K A;  4LC9 B;  3T19 A;  4CJ3 A;  3O80 A;  3VF4 A;  4CF1 A;  4ZTF A;  2AA4 A;  4H5V A;  3IG1 A;  3OYH A;  5HRR A;  3ZSX A;  3CFR A;  3SQ0 A;  1RBV A;  4CIG A;  3DLR A;  4BAC A;  2ITG A;  4DV4 K;  1QQN A;  4R79 A;  4WQ4 A;  1HMV A;  4KRE A;  1VSH A;  1BQM A;  3KLF A;  5FPN A;  4DQR A;  2KHO A;  1KD1 O;  2IOC A;  2VG6 A;  5GAE P;  3G6E N;  4FLX A;  3OYA A;  3D2F B;  1QSS A;  4B3R K;  5TKW A;  4CES A;  3SQ2 A;  4B9T A;  1XNQ K;  4B9Q A;  5AQX A;  3THX B;  1LW0 A;  3OYJ A;  4JI4 K;  3DLH A;  1UWB A;  1IBL K;  4E7L A;  2QWP A;  4FWQ A;  1OVY A;  1E4F T;  3VF6 A;  4ILJ A;  3VQ5 A;  3NCI A;  3VQB A;  2Z1G A;  3J8A A;  2XO7 A;  1BQN A;  1HYZ A;  4JKG A;  2O8C B;  3LP3 A;  2WOM A;  4Z4C A;  3K9K A;  1WAJ A;  4MQ3 A;  4Z4F A;  4FJG A;  4JK8 A;  1L3U A;  4FOE A;  2Z1J A;  1RDA A;  1DTT A;  4OPK A;  4F3T A;  5JVG L;  2KFZ A;  1EKE A;  4F2R A;  3E9O A;  3LAL A;  4LY7 A;  1XI1 A;  3LM9 A;  4YOU A;  1YTA A;  2FSJ A;  5M1K A;  4KAZ A;  5BPM A;  3ZSW A;  2R7Y A;  3QIO A;  3CQY A;  2O8F A;  1NGA A;  3SUQ A;  1T6C A;  4HUG A;  3FE1 A;  3SLC A;  1YIT N;  3U9Z A;  5EU7 A;  4DSJ A;  3M8Q A;  4JI3 K;  1W97 L;  3U3G A;  2FSN A;  4CZI A;  1SZ2 A;  3SZ2 A;  3OA9 A;  2UUB K;  4LF5 K;  3Q7B A;  4DTJ A;  2XY5 A;  2O8F B;  4A5A A;  4DTO A;  4OGE A;  4KPY A;  5BPN A;  3AVC A;  4YOW A;  1XMQ K;  5C0Y A;  4KTZ A;  1RDU A;  3TAR A;  1TKD A;  3BF3 A;  2YHX A;  4EZ9 A;  4BY9 C;  2OPR A;  4H0Y B;  4YOY A;  4DF4 A;  3CM6 A;  4CJT A;  1HKB A;  5AQS A;  1U2V A;  3AV9 A;  5H1S Q;  4KI4 A;  5KI6 A;  3QET A;  1FXX A;  1XHZ A;  2NNW A;  1ZBF A;  2HND A;  2E8A A;  1WBB A;  2O4G A;  3SUO A;  3HM8 A;  1K8A O;  2O8B A;  2IC3 A;  3AVI A;  3LM2 A;  1UOC A;  3R8E A;  3VQQ A;  4BRO A;  3O3G A;  3DLE A;  3BP8 A;  3CQX A;  4KHP K;  3E1Y A;  3FFI A;  1QVG M;  1SAZ A;  3K57 A;  3KZB A;  4ILG B;  1BIU A;  4XEI A;  4HHT A;  1YJ9 N;  1RTD A;  4J2E A;  1D9F A;  2Q36 A;  2F96 A;  3LDP A;  3P5J A;  4I9L A;  3ATV A;  5AFU H;  1WAF A;  5KQ8 A;  4YFU A;  4IO8 A;  4FJJ A;  4IOX A;  4CK3 A;  3I8B A;  3KD1 E;  4A57 A;  1MA9 B;  1SL2 A;  3KLI A;  4YOV A;  4GV6 A;  2OTL N;  4CFD A;  5E84 A;  4CJQ A;  1B92 A;  4JS4 A;  5C2F A;  4EP4 A;  1NJW A;  3QML A;  3RMA A;  3AVG A;  4GMJ B;  5KRS A;  4WQ5 A;  1HLU A;  2JGU A;  2P1J A;  5BRE A;  4BRC A;  1VQP N;  1REV A;  3QDK A;  5CR4 A;  3FGU A;  1N32 K;  3WQT A;  4L8R B;  3K5L A;  5KGX A;  5DM6 L;  3VGK A;  4CGG A;  3LAN A;  1S9G A;  3U8X A;  2NRV A;  4JV5 K;  1KVA A;  2YHB A;  3S41 A;  1U04 A;  1LW2 A;  3L4Q A;  4NO7 A;  5CYM A;  4I2Q A;  3WXM B;  3KHY A;  1QVF M;  4JI7 K;  4M45 A;  1A5V A;  4CF9 A;  4BE0 A;  1NLV A;  4BE1 A;  3P38 A;  2YNF A;  3IKM A;  4B9N A;  4Z0U A;  5M1P A;  1UA1 A;  4NB4 A;  1Z6R A;  1G15 A;  2YCH A;  4CJ5 A;  3MEG A;  1KXP A;  3AVL A;  3SBG A;  4CFA A;  4IJA A;  2A6A A;  3VTI A;  3KK3 A;  5K14 A;  5JS1 A;  2DFF A;  3VQ6 A;  3K0S A;  3A5M C;  1JLF A;  3PY8 A;  2NRZ A;  3AO4 A;  1YI2 N;  3KJV A;  2P9L A;  3ALY A;  5BN8 A;  4FLY A;  5JVH L;  2FSK A;  5KQD A;  2QKK A;  3VGM A;  1X9M A;  1BG3 A;  3ZLJ A;  4FPB A;  5HOO A;  4CBX A;  5AQO A;  4CEC A;  3CJ9 A;  3SAG A;  3U9D A;  4K0K K;  3VQP A;  2HMI A;  2G8V A;  4FK4 A;  4DQI A;  4JAX A;  1Q82 O;  5BRD A;  1JLA A;  1H1V A;  1HYV A;  5CE3 A;  4BQZ A;  3HPG A;  3EL2 A;  3NFA A;  3K59 A;  2FBV A;  4PA1 A;  3AO3 A;  2VQF K;  1QTM A;  3O1W A;  4KI6 A;  4LSL A;  3C95 A;  4CJW A;  3HOS A;  5BRH A;  3ZT4 A;  4H5W A;  3A5O C;  1TUY A;  3MXJ A;  4O55 A;  4GV3 A;  3R3L A;  1D8Y A;  4QS8 A;  1NGH A;  3VQC A;  4CHP A;  3HOT A;  3SBT A;  2XRI A;  4KB1 A;  2HHS A;  4N47 A;  2UYT A;  1ATR A;  4CJF A;  4DG1 A;  4CJ4 A;  4B9V A;  4CE9 A;  5FLX O;  3D6R A;  3K9J A;  1ZC6 A;  2PAV A;  4BR4 A;  4CEA A;  1U2V B;  4FO0 A;  3HYF A;  4RW8 A;  2HBM A;  3CCV N;  1BGX T;  1X9S A;  3CM5 A;  3AVA A;  2W6L A;  4FPA A;  5AFU A;  2XY6 A;  2Z1H A;  1NGG A;  5JMV A;  2XHB A;  4H4O A;  3VN5 A;  3EEQ A;  4H0P A;  3WXJ A;  2GEL A;  4ISF A;  3VER A;  3OYI A;  1JL2 A;  1RT3 A;  4ID5 A;  4OPA A;  1HNX K;  3K58 A;  4O5B A;  1VSE A;  1HJR A;  2QW9 A;  1BIZ A;  3NF6 A;  4A59 A;  2OPS A;  4H03 B;  1YUW A;  4RW7 A;  5FRO A;  4B9U A;  4CJP A;  4K42 A;  2GEM A;  3SAH A;  3L2U A;  4AIL C;  4B9M A;  1RFQ A;  2EHG A;  3MWP A;  4DS4 A;  3V1O A;  4DQP A;  1W2B M;  2GBZ A;  4W5N A;  3TR8 A;  4CGF A;  3TSQ A;  4F3O A;  3DLG A;  4BG8 A;  3BEX A;  4JYA K;  3NH0 A;  1KQS M;  2E1Z A;  3IMX A;  4KHN A;  4L3Q A;  4B8A B;  4DSL A;  4KB0 A;  4GVE A;  1BU6 O;  3M8S A;  3PUF A;  1YJW N;  1RGI A;  3UE5 A;  3P83 D;  4FJN A;  5M1F A;  4JKF A;  3VEZ A;  4M3R A;  4IFE A;  1ZBI A;  4YDU C;  1WSH A;  3TPQ A;  5KPZ A;  5FRN A;  3MCA B;  2FBX A;  4JRP A;  3TAN A;  2KTQ A;  2HF4 A;  4BVO A;  4LFA K;  1CXQ A;  4FK0 A;  1Q8I A;  2P9U A;  2GUP A;  2OCE A;  2HF3 A;  2O8D B;  1HNZ K;  2ZQB A;  3CQ8 A;  4RCH A;  3O3H A;  1YT3 A;  4FVU A;  3PX0 A;  1GLB G;  1JLE A;  2UUA K;  1KTQ A;  1ATS A;  3MK6 A;  1RBT A;  1EQY A;  1WLJ A;  3VGL A;  1N5Y A;  3KLE A;  5GIN A;  4BRF A;  3SPZ A;  1GOC A;  1HNW K;  4CJU A;  2P9I B;  2NUB A;  1NK0 A;  1BCO A;  4CJV A;  3UKU B;  1YTU A;  4AM6 A;  4NLB A;  1TV6 A;  2ZJQ L;  3EZ5 A;  4CFC A;  1EET A;  1J5E K;  4W5R A;  4QS7 A;  3WXI A;  4NXM K;  1RT7 A;  3AAQ A;  3NF8 A;  3MMV A;  1N33 K;  4BGB A;  2YKN A;  2UXC K;  4U67 L;  1E3M A;  4KFB A;  1NGD A;  3OVN A;  3T1Y K;  2WC9 A;  1NMD A;  3WEE A;  3AGR A;  2NZT A;  2DFH A;  4JEP A;  2P5O A;  3LAK A;  4FWO A;  3DXK A;  2D0P A;  3LL3 A;  5F2R A;  4DV3 K;  2X74 A;  2ZGZ A;  2DTU A;  4CZE A;  5J2Q A;  4BDZ A;  3UKU A;  4JKD A;  1K6Y A;  1BCM A;  3GOI A;  4LF9 K;  1HYS A;  2O8E B;  1RCH A;  4PKH A;  4N76 A;  1GOA A;  2ZD1 A;  4JKB A;  5J2M A;  4J2A A;  2D0B A;  3CYM A;  1QSY A;  3DJC A;  1QSL A;  1MDU B;  5KRT A;  5M1N A;  1EO1 A;  4AHV A;  3I55 N;  4CF8 A;  3BF1 A;  4JK7 A;  2HHH K;  4DR2 K;  4JI0 K;  4CEE A;  4B1W B;  3DOL A;  1JXB A;  3AO2 A;  5FPD A;  5FPE A;  1RDC A;  3NH2 A;  2P9P A;  4C1N I;  3QIN A;  1CXU A;  1KVC A;  4DU4 A;  3M1F A;  1NNE A;  3N4Q A;  1A5W A;  3L4I A;  5LJV A;  3D2E B;  1Q9Y A;  3WNF A;  3U6F A;  4AHU A;  1JCF A;  4FW2 A;  4W5Q A;  4NYN A;  2W6K A;  4IG3 A;  3QNN A;  3C6H A;  3DYA A;  1YF5 L;  4Z4H A;  2JWK A;  2PFU A;  4X62 K;  3L6Q A;  4JNE A;  1BWF O;  1C1C A;  4DSK A;  2P9P B;  1RDW X;  5JS2 A;  1HX1 A;  1W0H A;  4ICL A;  1NK5 A;  1TYQ B;  1HNV A;  1HKC A;  4H8K A;  3RRH A;  2V52 B;  2B4J A;  3H46 O;  4FM0 A;  3KK2 A;  3JXU A;  1XC9 A;  3H6E A;  2NRX A;  4WF9 L;  4FJI A;  4FJK A;  4JKC A;  1VK0 A;  2VYP A;  1KFS A;  4JI6 K;  4FXD A;  2HHT A;  2OZM A;  4XH1 A;  3ZSV A;  1RT6 A;  4V19 S;  3RR7 A;  3VTH A;  3HXM A;  4BVP A;  4NCG A;  3MEE A;  3NGZ A;  3OYB A;  4MFB A;  3EZW A;  1TKZ A;  1J9A A;  2EWS A;  4XIU A;  3LWL A;  2YHY A;  4CK1 A;  3NGI A;  4BR9 A;  3GDQ A;  3K5O A;  1RBR A;  2HBJ A;  3QNO A;  3HSC A;  4B3M K;  5JIC A;  3H1Q A;  2OTJ N;  1G99 A;  4CFB A;  4XH5 A;  4JK9 A;  3MN9 A;  1SUQ A;  4MO5 A;  4H0X B;  1NOY A;  5AQQ A;  3K2P A;  4J2D A;  1NJI O;  2NLX A;  4E1N A;  2P5G A;  4CEZ A;  4FZZ A;  3EE9 A;  3S3O A;  1JLB A;  3AVJ A;  4KH6 A;  4MLE A;  4CK2 A;  4BG9 A;  3ID8 A;  4CGI A;  2Z1I A;  1TAU A;  2QWN A;  2QWR A;  5MLC Q;  3KK7 A;  3IDH A;  2HHQ A;  4I6M B;  1XQS C;  4DQ8 A;  3VEY A;  4PKI A;  4BR2 A;  1Q18 A;  4KHY A;  1TKX A;  1HR0 K;  4GY2 B;  3KVG A;  3PSI A;  3AO1 A;  3OS1 A;  4IEE A;  3J7A P;  1J6Z A;  4BRN A;  4FWL A;  4RG8 A;  4J8F A;  3VQA A;  3WNE A;  2VCP A;  1XC3 A;  1SKS A;  4Y1C A;  4ID1 A;  3JAM O;  1TVR A;  3AVF A;  3H3N O;  4EAH D;  3AAR A;  4ILH A;  4JRQ A;  3MAQ A;  4DTX A;  4EHU A;  2RF2 A;  2QTD A;  3VF2 A;  3OJU A;  2NRH A;  2HBK A;  2PYJ A;  3ZX3 A;  3RWU A;  3SAF A;  1JL1 A;  3O9S A;  3P4I A;  5EVZ A;  3KIO A;  4JKH A;  1ZBH A;  3TAP A;  1B9D A;  2QWO A;  3L0Q A;  4B1Y B;  3T3F A;  3LP2 A;  3MX2 A;  2YKM A;  3FLC O;  4BRI A;  1VSD A;  1RTJ A;  2HNZ A;  3V9W A;  3TAB A;  2CGK A;  4B3S K;  3WXK A;  3TAQ A;  1N36 K;  1RTH A;  1X9J A;  4CHZ A;  3HTV A;  3OYL A;  4RWT A;  1TGO A;  4EP5 A;  4B1Z A;  4O0I A;  3KTQ A;  3TI0 A;  4EHT A;  3ENB A;  1HQU A;  1HKG A;  5DMR A;  3E9P A;  2A5X A;  5AQV A;  3MWT A;  2YI1 A;  1BA0 A;  3TAF A;  3DWL A;  4IEI A;  2A40 A;  3ZSR A;  3NMU A;  4FVM A;  4DR7 K;  1NJY A;  3D2E A;  1TUU A;  4JI8 K;  4RW4 A;  4BC3 A;  3QEP A;  3H1V X;  5GIP A;  3ZEU A;  4XH4 A;  1ZBU A;  1NJZ A;  1J5O A;  1KAZ A;  4O8U A;  4CHY A;  2UXB K;  1VHX A;  4B1U B;  2F8S A;  2HHW A;  1VQ6 N;  3BUZ B;  1FKP A;  4BDY A;  3RTV A;  4FSV A;  3PV8 A;  3J7Z O;  3O9U A;  3SV4 A;  1JCE A;  4K8Z A;  3CPE A;  4E3S A;  2G8W A;  1D5A A;  1WSG A;  1GOB A;  4CEB A;  1K73 O;  3TTD A;  1TL1 A;  3KKR A;  3KLH A;  3MEC A;  2IS3 A;  3CJ7 A;  1KAY A;  3JYT A;  1VQ5 N;  3R6M A;  3U4L A;  5C15 A;  3NDK A;  3CCM N;  1NK6 A;  1KCF A;  2E2O A;  1MWK A;  3LDO A;  4AHT A;  1S72 N;  3PO5 A;  1M90 O;  3AVH A;  4M3W A;  5J2N A;  3M8R A;  1RT2 A;  2IIR A;  4DU1 A;  3UKR B;  4KTW A;  4BRA A;  2EX3 A;  5BPL A;  4Y1D A;  3VES A;  4CEO A;  1NKB A;  3WNG A;  2A42 A;  4R5P A;  3V1Q A;  3HPO A;  1VSM A;  2J4R A;  3HL8 A;  3LPU A;  3TU5 A;  4X66 K;  2NRW A;  1VQ7 N;  1XHX A;  3K5N A;  3ULE A;  5LMN K;  4CEF A;  1ASW A;  4YY3 K;  2YV0 X;  4BDP A;  3O8M A;  1CZA N;  1RT1 A;  4LSN A;  3C65 A;  4DFP A;  5AQG A;  5I3U A;  1DKG D;  3GBT A;  2ASP A;  4DU3 A;  4B8C A;  3EE8 A;  4IFV A;  2FF3 B;  4M3Y A;  3VEX A;  1GLL O;  2BGG A;  3DM2 A;  3SMS A;  3MX5 A;  1KLN A;  4DTP A;  3CJC A;  1IKX A;  2JLE A;  5SZT A;  1C0U A;  4DTU A;  1IBK K;  3T1A A;  4HVJ A;  3A5N C;  3WNH A;  4GKJ K;  3MED A;  2CH6 A;  4CI6 A;  4NCA A;  2B5J A;  4QAG A;  5D3G A;  3IUC A;  4DV2 K;  4FLW A;  3VQ7 A;  3MN7 A;  2OZS A;  3ZET B;  1K9M O;  1S9E A;  3VEV A;  4FYD A; 
#chains in the Genus database with same CATH homology
 4JI8 K;  1IBL K;  5A2Q O;  4X64 K;  2HHH K;  4DR2 K;  4JI0 K;  2UUC K;  4LF6 K;  3J80 O;  3T1H K;  2F4V K;  4NXN K;  1XMO K;  4DR4 K;  2VQF K;  2UXB K;  4CW7 B;  4DV0 K;  4LFA K;  4LFB K;  1HNZ K;  5IWA K;  4DR6 K;  1IBM K;  1XNR K;  1FJG K;  1N32 K;  1HR0 K;  2UXD K;  4CVN E;  2UUA K;  3J7Y P;  5BR8 K;  5FLX O;  3J7A P;  4JV5 K;  2E5L K;  4DUZ K;  4LF7 K;  3JAM O;  4DUY K;  4DV1 K;  4X62 K;  4JI7 K;  4LFC K;  5LMU K;  1HNW K;  4JI5 K;  4GKK K;  4JI3 K;  1N34 K;  2UU9 K;  4LF8 K;  4LF5 K;  2UUB K;  4B3T K;  1XMQ K;  4X66 K;  5AJ3 K;  1J5E K;  5LMN K;  4NXM K;  4OX9 K;  1HNX K;  4YY3 K;  4AQY K;  1N33 K;  4JI6 K;  2UXC K;  4B3S K;  1N36 K;  3T1Y K;  4DV7 K;  4DV4 K;  1I94 K;  4V19 S;  4DV5 K;  2VQE K;  4YHH K;  1IBK K;  4KHP K;  4DV6 K;  4DV3 K;  4DR3 K;  4GKJ K;  4JI2 K;  2ZM6 K;  4JYA K;  4JI1 K;  3J81 O;  4X65 K;  4DV2 K;  4B3M K;  4LF9 K;  4B3R K;  4LF4 K;  1XNQ K;  4K0K K;  4DR1 K;  4DR7 K;  4JI4 K;  5LL6 Z;  4DR5 K;  5IT9 O;  3OTO K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...