4JI1K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji1K00
2HHHK 4JI6K 2UUBK 2VQEK 1XNQK 2E5LK 2UXDK 4JI7K 4B3SK 4LFCK 1HNZK 4B3TK 5LMUK 3J7AP 1N32K 4LFAK 4NXNK 2VQFK 1N36K 4AQYK 4DR1K 2UU9K 4LF5K 4YHHK 4DV1K 4JI8K 4X62K 4KHPK 3J81O 3JAMO 5IT9O 4GKJK 4B3RK 3T1HK 4JI1K 2UXBK 4DR4K 3J7YP 1N34K 2ZM6K 4V19S 1XMQK 4X66K 1HNXK 4DUYK 5IWAK 2UUAK 4JI3K 4DR6K 2F4VK 4B3MK 4LF8K 4JYAK 4DV5K 4K0KK 4JI2K 4JI5K 1FJGK 4JI0K 4NXMK 4DV3K 1HR0K 1I94K 4CW7B 4DV0K 1HNWK 5BR8K 5FLXO 1IBLK 5AJ3K 4X64K 5LMNK 4X65K 3T1YK 1N33K 4OX9K 5LL6Z 4LF6K 4DR3K 4DV7K 4DR7K 1J5EK 4LFBK 4CVNE 4GKKK 2UXCK 2UUCK 4DV4K 3J80O 4LF9K 4DUZK 4LF7K 4DV6K 1XNRK 4JI4K 5A2QO 4LF4K 1IBMK 4DR2K 4JV5K 4DV2K 1XMOK 3OTOK 4DR5K 1IBKK 4YY3K
chains in the Genus database with same CATH superfamily
1GOCA 4EIAA 5DM7L 1YIJN 2HHHK 2D1KA 3SYZA 4BDYA 3FLCO 4IJAA 1QQNA 4QS8A 4LFCK 1KAYA 4JN4A 4R79A 1EXQA 4B08A 3HM8A 2O8CA 4CJPA 1RDUA 3O9RA 5AZJA 3J81O 3CFRA 4DFKA 4W5RA 2ZD1A 4XEIA 3T7ZA 4LH4A 3P38A 3LDNA 1BA1A 4CFCA 4OJRA 1YT3A 3S3OA 3VETA 1JXEA 1HYZA 1SL2A 3M6GA 4BGBA 3TAFA 3KD5E 3SJJA 3ZSRA 1SS6A 1T44A 4ELTA 3FFKB 3R6MA 3DLRA 4BE0A 1RDWX 3CYMA 2YHYA 3K57A 4DV5K 3TAMA 5BREA 2QEXN 5M1PA 5AQSA 3ATUA 1HR0K 3PX4A 4EZ6A 3K5MA 1DEJA 3VQCA 3AY9A 4LF6K 4DV7K 3ZT0A 4BR4A 2F9WA 1VQNN 1QVGM 5KGWA 1W0HA 2FBVA 4CE9A 3VENA 1RBTA 1IG8A 4J2DA 3LDSA 4W5TA 4Q0BA 3PSFA 1DTQA 1EWQA 2ZF5O 1ZYQA 3BDPA 2FBXA 1LAWA 4CEOA 3EY1A 4IO9L 4C8KA 4DTSA 4CJUA 4DSLA 5AR0A 4WFNL 3O5BA 5AQTA 3VGKA 3CM5A 3VEVA 3BP8A 4YNQA 4M7YA 3CHWA 3FFIA 4B1VA 5GAHP 1XMOK 3GE1A 4DR5K 3LP1A 2FLOA 1YI2N 4N47A 3CC7N 3LZJA 3EZ5A 3IG1A 1U6ZA 5AFUA 1WSGA 3Q7CA 1TK5A 3VTIA 4CEAA 4N41A 3RMCA 4DG1A 3THXA 1ZBIA 2Z1GA 3ATVA 4FYDA 4EZ9A 4GVEA 2RE2A 1HNZK 4B9NA 1Z25A 3C0BA 4ILGB 4DU1A 4B1UB 5E41A 1DLOA 1S6PA 4JKEA 4O8KA 1BDGA 1JLFA 1NGCA 2O8BB 3TTCA 4IFEA 1QQCA 3JAMO 4JKGA 2XY7A 2NRTA 2DPNA 2P9PB 3TSPA 2YHBA 4CF0A 1KCFA 5I3UA 3HI0A 3VQ6A 3EEQA 1C0MA 2F96A 2VG6A 3DM2A 4Z4EA 2D0BA 1GLEG 3FZHA 3MWTA 1TGOA 3ZETB 4BE1A 1W9HA 3WNGA 1NMDA 1X9JA 3NMUA 3DLBA 2DFFA 1KVCA 2F4VK 4H0VB 3ZX2A 4DSIA 1CXQA 2GELA 3VQ7A 2GUPA 2P9PA 1HKGA 2P9IA 4DV0K 5FLXO 5SWMA 4X64K 3VQBA 1N33K 4CECA 3ZETA 1UA0A 1L3TA 3DLEA 4DTMA 1T7PA 3HP9A 3O9UA 3LM2A 2E2QA 4RG8A 3CXCM 3W3DA 5F2RA 4FM1A 5AQYA 5BPMA 4JNEA 4M7XA 1C1BA 3DI6A 4PL8A 1QS4A 2IC3A 3GG4A 5CYQA 1Q9YA 4W5NA 4AM6A 3OJSA 1XHZA 3M8SA 4YDUA 1XNRK 4H5NA 1J6ZA 2B4JA 3KLGA 2WBNA 4WE1A 4CBXA 3NBPA 1D5AA 2DFHA 4OPAA 2KFNA 3K5OA 4AH9A 3CD6N 3IAYA 1RDAA 2Z1HA 1LWFA 1NGAA 4JI6K 3RTVA 4JK8A 5C2FA 4KHUA 2P9LB 1WSJA 5JS1A 4MDAA 1U2VA 4CJLA 3MWPA 4JEPA 2RF2A 1N32K 1ASUA 2A1RA 5KI6A 2Z1JA 1OH8A 4JRQA 2KTQA 3O4QA 2HHTA 1LWEA 3P31A 1JCFA 2V52B 3PO4A 4CF9A 4JI8K 3AVJA 2FXUA 4CEFA 1MA9B 5KQ8A 4K42A 3TABA 3SPZA 4KH4A 3D2FA 1MDUB 4NYNA 3ZT2A 3I56N 3C65A 4JS5A 3QMLA 3H1QA 2ZM6K 4FJGA 4CZHA 3VESA 4M3WA 4M3XA 3D0PA 3O6WA 4K8ZA 1Z05A 1JCEA 2YNGA 5IWAK 5AQMA 1S5JA 1QQOA 4FJ9A 3QBXA 4B3MK 4DTXA 4M63C 5ADXA 4EP5A 3ZSZA 4O5FA 3IS9A 4DFMA 2W41A 5M1FA 4DFPA 4BRIA 5AQUA 4JRPA 3CI5A 1KLNA 1P8ZA 3TSUA 4CESA 3SMSA 3V9UA 4KRFA 4WQ5A 3MN9A 2WUSA 4BR9A 5J2QA 2YI1A 4HTLA 2X6NA 3C7NB 3D2EA 4Y0WA 1ATNA 2JGUA 3O3FA 1J5EK 5MLCQ 4WQ4A 1X9MA 1C1AA 4DQPA 4OPHA 3CFOA 4BE2A 5H1SQ 1BGXT 3ZT3A 4IFYA 3KK3A 5JLHA 1VSIA 4LF9K 2E1YA 3HYFA 3MMVA 4JKCA 4CFAA 4CK1A 4DB3A 3HOTA 4DV6K 3A8YA 4AF1A 4Z94A 1TKZA 4CHYA 1S72N 1BQNA 4AHUA 1QHAA 3IKMA 1VSJA 4BREA 3KD1E 4H5WA 2AA4A 4IOAL 3FZKA 3VA0A 3KTQA 1VQLN 4H0PA 4RW6A 1GLAG 3IUCA 1NM1A 1RT4A 1TYQA 1RBRA 3QINA 3NH0A 3KK1A 3HM9A 5GINA 1KVAA 1TUYA 5HBMA 3TANA 4I6MB 4Y1CA 2YNIA 1B92A 2UU9K 2BH1A 2H3GX 1NU0A 2PY5A 4LD0A 5F0XA 5AQIA 3F2KA 1VQON 1Q7YO 2FC0A 3VQAA 3NVKA 4GKJK 3R9PA 4JD2B 4A5AA 5GADP 4U7BA 3OS1A 3IFRA 2O4IA 3B6PA 2UXBK 3E9LA 1LV5A 3A5OC 2OPQA 4PHTX 4CJ4A 1NKBA 4CJ3A 3H45C 1LCUA 5AFUH 4E7HA 3I0SA 4CGFA 3HK2A 3OYFA 4E89A 4E1NA 4DTNA 2BTFA 2P5GA 3THYA 2YV0X 1J54A 3HPOA 3VMFB 1VSHA 3CFPA 2Z1IA 4JI0K 4LSLA 2O8EA 3V1QA 4N76A 4B9MA 3L2WA 1HNWK 1BWFO 4OKKA 3K58A 1N8RO 4B9UA 1U04A 3C6TA 2HOEA 4ZTFA 3RRHA 1VQ7N 2P5OA 3K5NA 4MLEA 3ZSOA 5C12A 3S41A 3CQ8A 5BN8A 3U3YA 1QZ5A 3J7ZO 4DV4K 1ATSA 5AQRA 3GDQA 3L2UA 3TAQA 3HP6A 3QDKA 5C10A 1XQSC 3SJHA 4CHOA 4KKOA 5TKWA 1TAUA 4BG9A 3SV4A 3ZCMA 3MECA 1O1WA 1S1UA 1SQKA 3P83D 2X6SA 3WUHA 4YOWA 1D9FA 1TK8A 1LOTB 1NK4A 4RTFD 2EWSA 2HHUA 3CM6A 5JVHL 3WNEA 3SQ4A 3T69A 2A41A 4WQ5C 1RFQA 1V4TA 3K59A 3LP0A 2VWKA 4NXNK 1EX4A 1ZBHA 4ID1A 2HF3A 1NJYA 3OYIA 1OH6A 4DQRA 4DS5A 1KQSM 2UYTA 2ASPA 3LPUA 1WBDA 4PQUA 4IDKA 3VQ4A 1UOCA 3L2VA 4JS4A 3TU5A 3L6QA 4FSVA 4KHNA 3LP3A 2YNHA 1V4SA 4WYBA 4IOXA 3BZCA 4E7IA 1GLJO 4BACA 4PKHA 1FK9A 3V9XA 4LY7A 1YJ9N 1QE1A 4CD3A 4K43A 4K0KK 4BRDA 1WSEA 3D6RA 1FJGK 3M3ZA 2NNWA 4B1YB 5BR8K 3WXMB 3AVKA 4C1NI 3T1YK 1EKEA 4A5BA 1C6VA 3VF2A 4NLBA 1WAFA 4RWTA 2O8DB 1KVBA 2Q1NA 2CH6A 1I39A 3KWIA 4IOCL 3R3LA 3KHYA 3CMEN 2OPRA 1LW2A 2Y1JA 3MEDA 4DLGA 1JKHA 5KRTA 2VWJA 5ADXH 3I55N 2FBYA 3AVHA 3OA9A 3TSQA 1S3XA 5FDLA 2O8DA 2E6LA 5HRNA 5EU7A 1EP4A 3SUNA 3H3NO 4DU3A 3PY8A 1BIUA 2E88A 4GMJB 2PAVA 4DCHA 2D0CA 3E9PA 1VSLA 4DQ8A 1VRTA 4FW1A 1A5WA 1FW6A 1WSIA 3DOLA 4CJ7A 1YJNN 1NK9A 3VEYA 3WQUA 1NGBA 4IEIA 4YFUA 2PBDA 1WBBA 3O4WA 2G8WA 1KFSA 4CGDA 4NCAA 4ICLA 1YXQA 4QS7A 4FJ7A 4KPYA 4GVMA 3LWMA 1WLJA 3TTDA 4FJ8A 4DR1K 3LAKA 4IO8A 4KAZA 3HPHA 3JS6A 3CCUN 3CCRN 3VERA 5AQWA 3RMBA 1FXXA 1O13A 1NOZA 1RBUA 4N5SA 1IJJA 5GIPA 2P9KB 2W40A 3O1BA 3ENBA 4NB4A 5BPLA 4EFHA 4OLAA 4C8NA 1NK8A 5AQVA 3UKUA 1BISA 4O0IA 1EQYA 4K25A 3CCVN 3NF6A 2NZTA 1WN7A 3NAEA 2P9SA 4W5OA 4GY2B 4DMNA 3E01A 2QTDA 5FRNA 4DV3K 2GX9A 3SBGA 3K9KA 3SV3A 2PYLA 3BGRA 2Q0RA 1L3UA 3U8XA 5DM6L 1BA0A 4CHZA 5I42A 3AVNA 1BG3A 1GLFO 3C6HA 3SLCA 4YOXA 2A6AA 2VGMA 4B9VA 4FXDA 4FVUA 4CI6A 4CVNE 4FOIA 4DQIA 4BVOA 1YHQN 2DTUA 4CEZA 3CJ9A 3AA5X 2QWRA 3RR8A 4CJVA 4IZ9A 3E66A 3AVBA 4LF4K 3OYKA 4CEDA 4ELUA 1BCOA 2Q0UA 4CGHA 4DQSA 3QIPA 4PY5A 4BDPA 3DMJA 2XY6A 1Q82O 5C25A 1VQ5N 3DAWA 3DYAA 4A59A 4JAXA 3FZLA 2XY5A 3T19A 4FM0A 2OPPA 3M8PA 1KFDA 1VAZA 3AVCA 3U9ZA 2OTLN 5DMRA 4JI7K 4BRNA 4LH5A 2ZJQL 1GOAA 1N6QA 4FWOA 2OANA 5GIOA 1HYVA 2QWNA 4O8UA 3WEEB 4FPAA 3LDLA 4FLUA 4BWJA 1D9DA 1L3SA 3SPYA 3U6FA 3MAQA 3MXIA 2G8IA 3BUZB 3SAHA 1YTUA 4V19S 2QW9A 1W97L 1SZ2A 5J2PA 4X66K 4K8XA 2D4WA 4F8RA 2GTDA 1K8AO 3QEIA 1IH7A 3WXJA 2HMIA 1ATRA 1REVA 4CERA 1VQ9N 3RMDA 4GV6A 3VQQA 4CJEA 3A5MC 4JK7A 3KKRA 3HOSA 4OPKA 4F2SA 1KC8O 3PLAA 4DSEA 1XC9A 2HSTA 5E84A 4DR3K 2X78A 1TV6A 3CF5L 3TAEA 1KXPA 4E1JA 3QB0A 3O9QA 5LY3A 3AO4A 2O8BA 3MXJA 5K14A 2ZWHA 1R59O 1QVFM 4RW9A 2HBJA 4CGIA 2VG7A 4LC9B 5J2MA 5HP1A 4M3YA 3RWUA 3SBTA 1R0AA 2E20A 4JKHA 3EL2A 5C2DA 4BQZA 4EP4A 4ISEA 3O3GA 3VGMA 3NGZA 4EAHD 3ALYA 3L4QA 2BGGA 3VA3A 2HVIA 4BVPA 1C1CA 1T6DA 2HBKA 1QSSA 1FKPA 1J9AA 2YHXA 4XH1A 1RTDA 1HJRA 4AHTA 1A5VA 4CJSA 3NF9A 2NRVA 3CCMN 4L3QA 3K0SA 3SMPA 4IXCA 4MLHA 2FBTA 1RT5A 2D0OA 3SQ1A 4HUEA 5AQXA 4E19A 1P90A 2IVOA 3NH1A 4LFAK 2VCPA 2VQFK 3ZEUB 2B5JA 1HLUA 1VQMN 2CGLA 4RW4A 2YKMA 4KHPK 1VHXA 1K9MO 3GL1A 3VN5A 1OH5A 1GLLO 3RMAA 1NG9A 3OS2A 3RSEB 2UUAK 1RT3A 2AJQA 3G4SN 2GV9A 4BROA 1HKBA 2AP1A 2NRHA 2G8FA 4CZGA 3HT3A 2RN2A 5BN9A 4F2RA 3OYAA 2XY8A 3EZWA 1N5YA 3K5LA 2KHOA 3HPGA 3NF7A 2V7ZA 3DRSA 5AQPA 4AHVA 2P9LA 4M45A 2WFBA 5FPDA 1TKXA 3V9WA 2HF4A 2Q3SA 2ASOA 3LANA 1D8YA 4JHDB 1ZBUA 3QBWA 4B1XB 4CEEA 4YOVA 4I7FA 2BANA 2UXCK 3CCEN 3HTVA 4OGCA 5AQQA 1OKJA 2QKKA 1VQPN 3P1GA 4U67L 4KB1A 3SUQA 3UIQA 1RTHA 1Y64A 3CJ7A 3DXMB 3O9TA 4DUZK 1NNEA 3VQEA 3G10A 4A2AA 1DTTA 3THWB 2VGNA 4BRCA 2A3ZA 4YORA 4DR2K 5C15A 4B1ZA 2FSNA 4FJIA 2FF3B 3UKRB 5FPMA 3OTOK 3SI6A 2J4RA 5J1EA 1TKTA 3ULEB 3K9JA 3CJBA 4CIGA 3OHRA 5AQLA 4DTPA 3HXMA 2KW4A 4F3OA 3OW2M 2NRZA 1XNQK 1BU6O 1UAXA 4FOEA 4I2PA 1BUPA 4MO4A 4KI4A 4OPJA 1RDDA 1NGIA 5FPEA 4BR7A 5JS2A 5HRSA 3L2QA 1XC3A 3HSTB 1EO1A 1VQ4N 1WAJA 1KRPA 2YJFA 2R7YA 4DTUA 1BO5O 3C7NA 2RKIA 3QLHA 2PZSA 5AZIB 3RVCA 2HHXA 4IBNA 2YJEA 4BRAA 5CE3A 2P9NB 3D45A 2E4LA 1YF5L 3S3MA 4DHYA 2QWPA 5HRPA 3HSCA 1D4XA 4XH5A 5DK5A 3AVLA 1JL1A 4JI1K 3C95A 1G99A 1MWMA 4PKGA 4YOUA 1LW0A 2Y1IA 1S6QA 3CJAA 2OPSA 3SZ2A 3ZSVA 3QIOA 1K73O 2ZJPL 3DXKB 3DOKA 5AZIA 4BRGA 4LF8K 3G0ZA 4E7JA 3AAPA 2YHWA 3WQTA 5AQNA 2YKNA 3FE1A 3V9ZA 3VQPA 2DY4A 4YOTA 4BC3A 3EE9A 3SUOA 3QNOA 4CW7B 2HB5A 3V1RA 3NF8A 3EE8A 5AJ3K 4DFJA 4A57A 4FWMA 5BR9A 1NJIO 4FZYA 1ZBSA 4FVMA 3DXKA 5HOOA 4I6MA 3KK2A 4AHCA 4PL7A 3ZLJA 4DR7K 1T03A 4J8FA 1VQ8N 1S9GA 2XHBA 3VF6A 3VPZA 2NRXA 4JD2A 2BUPA 5AQFA 1KD1O 4HHTA 4YOYA 4KTQA 4AHRA 3C94A 3KKSA 3OYEA 3BF1A 4RW8A 3CPWM 2W6LA 2YHAA 1NGDA 2QWLA 4I9LA 1QTMA 3KVGA 2F8SA 2P9UB 1NJZA 3PX0A 5C24A 2D0AA 2ETJA 1YVNA 4H5VA 2BE2A 1OVYA 4I2QA 5FPNA 1RTJA 5AQJA 2UUBK 4FPBA 2E1ZA 4QS9A 3JYTA 3TAPA 3CCJN 1HJOA 3BF3A 1X1PA 3HBTA 4BRMA 1NBWA 4KTWA 3E1YA 2ZJRL 4KB0A 2KQ2A 3NFAA 4G1QA 3NH2A 1KAXA 4MFBA 3I8DA 4E7KA 1WUAA 2GWKA 2BDPA 2ITGA 3KLHA 3J7AP 4BC5A 2G8HA 4A62A 2IAJA 3OYNA 2QM1A 3LL3A 4PUOA 4B9LA 4MO5A 5AQZA 4DQQA 5HROA 4AQYK 2OYQA 3IMXA 1SUQA 3MCAB 1J5OA 3AGKA 1ILYA 2YNFA 1K8KB 2IS3A 3FGUA 3OYLA 3VEWA 3AO2A 4KTZA 4ID5A 2FSKA 4CFDA 2GWJA 1HQUA 2HVHA 3ZT1A 3IRXA 1XMQK 3DRRA 1HNXK 5EX5A 1CZ9A 3I33A 1IKYA 1VK0A 1NKEA 1TUUA 3THVA 1RBVA 2GUIA 2IOCA 3KLFA 4JI2K 3QO9A 4ISGA 5AQHA 1G15A 4KHYA 3L3UA 2YX6A 3A0IX 3H46O 5KRSA 1DKGD 3O3HA 3VOVA 5LMNK 4OX9K 4M3ZA 1GOBA 2HBLA 4KI6A 5T7BA 4BY9C 4KHSA 1I3AA 5M1KA 3AVAA 1VSKA 3CC4N 5B8HA 4CHNA 4QCLA 3FZFA 1RT2A 2CH5A 4Y1DA 4KHQA 1MWKA 1KLMA 1MU2A 4Z4CA 4NYFA 2WONA 3SQ0A 5BPNA 1RT1A 1S1VA 1ZBLA 4MQ3A 3OYDA 4B9SA 4CCHA 3ZSYA 1X3MA 4BR0A 4CF8A 4DTOA 4M42A 3ZYYX 3WXLA 4FLZA 1NJWA 1Q8IA 5BRDA 5D3GA 4C23A 4AILC 3V81A 2ZGZA 3K2PA 4DTJA 1RCHA 2E6MA 3WT0A 1C0TA 1VQKN 4DSFA 2VQEK 3ENOA 2OCEA 1CZAN 3PV8A 4CHQA 1BOTO 5JICA 4DTRA 5KPTA 2JWLA 2VWBA 3VQ9A 4M3TA 3PSIA 4FJXA 2HNDA 1ZC6A 3KZBA 3TTFA 1N36K 3U9DA 1S1XA 1RBSA 4Q5VA 3ZX0A 5C0YA 4LF5K 4A2BA 1BI4B 1NJXA 4H5RA 5KGXA 1XHXA 1JLEA 4CZKA 1DGKN 2QA4N 3T1HK 4KH5A 1NGJA 3C6UA 3HVRA 3LPTA 3MX5A 4IJNA 4O4GA 3VQDA 3QNNA 5J2NA 3QEXA 2HHVA 4G9ZA 4DUYK 5LJVA 3WXIA 4OKJA 1NGFA 5M1OA 4UY8O 4FK0A 3CCQN 3JXUA 3AARA 4GW6A 3C6AA 1NMNA 4BR5A 3JSMA 4B9QA 3S3NA 4ISFA 3OYBA 2E8AA 3LM9A 2RPIA 3T3FA 4WFAL 4CZJA 3EN9A 4NXMK 3OYHA 3VEOA 1DT9A 1I94K 4CZLA 5M1QA 1IBLK 3PUFA 4CZFA 4X65K 3UB5A 2A1SA 3AA3A 4IDHA 3AA4A 2O8CB 4BRQA 3KLEA 1NKCA 1TVRA 3TARA 4ZHRA 4LFBK 4F9OA 4J2EA 4CZMA 1ITGA 3DLGA 4NLCA 5AZJB 1SKWA 4OO1J 3AA2A 3NVMA 4GNIA 2W42A 3J80O 1ZXOA 4CJQA 3OYJA 3F73A 4FLVA 2G8KA 3G71N 3LDOA 4N56A 2P9KA 4JI4K 1TKDA 3KK7A 2QXFA 4JV5K 5CZ2A 4PA1A 3CQXA 4CJWA 3L3VA 4F4KA 3HL8A 4B9TA 3BY5A 3OYGA 2OZSA 1VQ6N 2V51B 4RCHA 1IV0A 4CGJA 3V6DA 1BIZA 2A40A 2HBMA 2IVPA 1YVUA 3M8RA 2E5LK 2VG5A 3ZSXA 1IKXA 4Z4IA 4B3SK 4WFBL 1SL1A 1RT7A 3F5TA 3PO5A 3T1AA 3V9SA 3ZSQA 1KAZA 1TAQA 4CJ5A 1Q18A 3CERA 3O80A 4FL9A 3MX2A 4CF2A 1NK0A 2KFZA 1U49A 2QXLA 1S1TA 4FWPA 1NK5A 4CK2A 4Z4FA 2D5RA 4CEQA 2OTJN 4KBOA 1HUXA 3D7EO 4C8OA 4B3RK 3E9OA 3GOIA 5TKYA 2GEMA 4B8AB 2A42A 5JLFA 3HRGA 3AVGA 1JLAA 1HNVA 3DLKA 1X9WA 1ZBFA 1NWKA 2O4GA 1TL3A 4JK9A 2YCHA 5CY4A 1XUPO 5FROA 1SL0A 2HHQA 1JL2A 5JVGL 2PFUA 2QWOA 2CGJA 5HL7L 2GBZA 3WXKA 5JMVA 4CJKA 3KLIA 4DLEA 4GV3A 2Q2RA 3HJFA 1NGGA 2QWMA 3THXB 5FRMA 1F21A 3V1OA 5SZTA 1J53A 4CFBA 3ENHA 2W6KA 5KQDA 4WCEL 2QWQA 3ZX3A 4B1WB 4FWKA 3B6OA 3WEEA 2FSJA 4GKKK 3PIPL 3HO1A 4JKGB 3DLHA 3NHGA 3LALA 4H0OA 2XO7A 3PX6A 4DKWA 4LF7K 3FZMA 1JLCA 2A5XA 2B6AA 1WNSA 1VSMA 1YITN 4XH4A 4CBUA 4H0XB 4DV2K 3F9KA 3QEPA 3EO3A 5EOYA 2NUBA 4OVLA 2F9TA 3CETA 1NGEA 3U3GA 3OYMA 4CZEA 2QK9A 1L5UA 2P9IB 4KHWA 1NGHA 2UXDK 4FWLA 4JLHA 4FJLA 2E2NA 1CLQA 3TR8A 3NDKA 4CZIA 3CCSN 4HTUA 3OJUA 1KSPA 4E3SA 3AVMA 2WC9A 3V4IA 4AM7A 3DWLA 4BRHA 3M1FA 1HKCA 3OVNA 4CF1A 3QESA 1BHLA 4OGEA 3L0QA 3G25A 2E2OA 1S9EA 5GAGP 4YHHK 4RW7A 1W7AA 4CIEA 3KJVA 3O1WA 1C0GA 3P4IA 1B9FA 1VSEA 1Q86O 4BRKA 5C42A 4BC2A 2LSNA 1RGIA 2HNZA 2F7TA 1JLGA 3MEEA 1KTQA 1TK0A 3ZSWA 4FWQA 3M5RA 1XI1A 1WOQA 2KZMA 3DLLL 1E4FT 5CYMA 3A2FA 3U4LA 4A61A 4FJKA 3TAGA 4JKAA 3TPQA 4JYAK 3FR0A 1SAZA 2WOMA 4PKIA 4F3TA 1TL1A 3HVTA 1HPMA 3AO5A 4KH6A 2ITMA 4BRLA 3OS0A 4FJJA 1U2VB 3A5NC 5GAEP 1QSLA 3SK3A 2O8FB 3CJCA 4FZZA 3J8AA 2RHKA 2V7YA 4WF9L 3ZEUA 5CHIA 1B9DA 3NE6A 2EHGA 4E7LA 1NLVA 3QEWA 4FJMA 3H3OB 3R8EA 3KIOA 5AQOA 2IVNA 1BCMA 1H1VA 2NRWA 2UUCK 3D2FB 1ESVA 3MK6A 3ID6A 4H5TA 1HX1A 2Q31A 1JXBA 5M1NA 2I5JA 5A2QO 1YJWN 3RSEA 1SKRA 3AO1A 3CMAN 2O8FA 3QFPA 4CK3A 5EVZA 2WTUA 3MXMA 2IGIA 3G6EN 5ELZA 3VEZA 2G8UA 1IBKK 4NCBA 4YY3K 4JKBA 5BRFA 3MEGA 2ZGYA 4HUGA 3LWLA 3EKUA 5LJWA 4FM2A 1VSDA 1S22A 1HQEA 2KLAA 1WSFA 3D2EB 4MDBA 1HYSA 3QICA 3CC2N 4JHDA 4KREA 1LWCA 3SQ2A 1IO2A 4FW2A 1HNIA 4W5QA 3QEVA 5IT9O 2OZMA 1QHTA 4DR4K 3DXMA 4FWRA 3J7YP 4KV8A 3THWA 3DRPA 2I7NA 4J2BA 4BC4A 1Q9XA 3MN6A 2G8VA 4BR2A 4GV9A 3UKRA 4B8CA 4HVJA 1FKOA 3ISNC 3ULEA 4HUFA 4FK2A 4H4OA 2DFEA 4H03B 2NLXA 4FLWA 3A5LC 2OA8A 4R5PA 1TYQB 4BRPA 1VRUA 3NGYA 2CGKA 2XRIA 3TI0A 3QETA 3H08A 5F1XA 1OVQA 3R1XA 3MN7A 1YUWA 3HZ6A 3WNHA 3ID8A 4JKDA 3VGLA 1T05A 5EXWA 2HHWA 3LZIA 4JKFA 1C0FA 3O4NA 4ELVA 3H6EA 4AHSA 2P9NA 4Z0UA 3ITHA 3MN5A 1M90O 1QZ6A 4M3UA 2KZZA 4H0TB 1T6CA 4CGGA 3OY9A 4EHTA 4UQGA 3RR7A 2ATQA 4KO0A 1VSFA 1OH7A 4K41A 3ZT4A 3THYB 1Q81O 3CQYA 3MDQA 5KPRA 1L3VA 4M41A 2O8EB 3NCIA 4C1NK 4YDUC 1UWBA 4EHUA 3SNNA 4O5BA 1Z26A 5CZ1A 4DSJA 5AQKA 3N4QA 3CG7A 4B3TK 4FJNA 4CEBA 4IWVA 4TSXA 4IKFA 5AQGA 3B8AX 4DV1K 3QERA 4X62K 1IKVA 1RTIA 4FWSA 4E1MA 2X74A 1X3NA 1ASWA 1N34K 4IG0A 1JLBA 2FF6A 4FLXA 5HRRA 4L8RB 4OKEA 4DU4A 1GLBG 1W2BM 4JI3K 3AVFA 3SUPA 3IDHA 2P9UA 5I9EB 1RDCA 3OYCA 3MCPA 3O08A 1HMVA 3AO3A 2PYJA 3CJ1A 4IEEA 5KPZA 4FLTA 1YAGA 4JI5K 1CXUA 1U45A 1K6YA 4H0YB 3W0LA 3L2RA 2QKBA 3I0RA 4FCYA 1BQMA 4LSNA 3M8QA 3BZKA 2F8TA 5LL6Z 1JLQA 4C8MA 1T3VA 4IG3A 4B3OA 4DF8A 1WSHA 1E4GT 3VQ8A 3AV9A 2P51A 4HCBA 1EWRA 2ASMA 2P1JA 1K8KA 3S9HA 3DJCA 3CCLN 3H1VX 3NGIA 1RT6A 4M3RA 2VYPA 3EYZA 4DS4A 4CJFA 1C0UA 3PIOL 1E3MA 1IBMK 4O0JA 4J2AA 3L4IA 4WQ4C 3OBWA 1XWLA 4NCGA 2KKZA 5HLFA 4I9QA 1WB9A 3AGRA 1HRHA 4FJ5A 2IDOA 4NO7A 1RDBA 3OBYA 1UA1A 4DSKA 1U4BA 1GLDG 3CPEA 3Q7BA 3UE5A 1HPZA 2ZE2A 5LMUK 2IIRA 2I7PA 1ASVA 1YTAA 4H8KA 5EY4A 4ZTJA 3GBTA 3ULDA 4PWDA 2E2PA 1JJ2M 2Q36A 1CZBA 4FK4A 4FWNA 1Y97A 2Q97A 3VF4A 5CR4A 4CJRA 2QI2A 3BEXA 3VQ5A 4XIUA 1LAVA 1JCGA 3LDQA 4DWIA 3LP2A 3QFUA 2JWKA 5KTQA 1T8EA 2NRRA 3LDPA 4ILJA 2EX3A 3AAQA 2HMPA 2JLEA 3ASMA 1Z6RA 4DR6K 4FJHA 1NK6A 3P39A 4E0DA 2HHSA 3AVIA 1QSYA 4BWMA 3RRGA 3L8BA 3SCXA 4IFVA 4KFBA 1S1WA 3WNFA 3CIPA 1RILA 3O9SA 4FO0A 4BQLA 1NK7A 1U48A 4FZXC 3P5JA 2HNYA 1U47A 4DF4A 4BGAA 4CJTA 1IG9A 4C8LA 4HCCA 1NOYA 3I8BA 2HW3A 4CHPA 3TWHA 1BI4A 1GLCG 1SKSA 1M1KO 1RNHA 3EKSA 4OLBA 4CIFA 4H4MA 4QAGA 4BG8A 5E26A 3SAFA 1X9SA 3VTHA 3SAGA 3KWGA 2ZQBA 3N4PA 4CD1A 4Z4HA 1IKWA 4BRFA 5BRHA 4FLYA 2D0PA 3O8MA 1EETA 4QOZB 4BDZA 3LAMA 4CBWA 4Z4GA 4O44A 3UKUB 1SV5A 1QQMA 4HWIA 4ILHA 3VEXA 1BL3A 1A5XA 4O55A 2P9SB 3F9MA
chains in the Genus database with same CATH topology
2HHHK 4JI6K 2UUBK 2VQEK 1XNQK 2E5LK 2UXDK 4JI7K 4B3SK 4LFCK 1HNZK 4B3TK 5LMUK 3J7AP 1N32K 4LFAK 4NXNK 2VQFK 1N36K 4AQYK 4DR1K 2UU9K 4LF5K 4YHHK 4DV1K 4JI8K 4X62K 4KHPK 3J81O 3JAMO 5IT9O 4GKJK 4B3RK 3T1HK 4JI1K 2UXBK 4DR4K 3J7YP 1N34K 2ZM6K 4V19S 1XMQK 4X66K 1HNXK 4DUYK 5IWAK 2UUAK 4JI3K 4DR6K 2F4VK 4B3MK 4LF8K 4JYAK 4DV5K 4K0KK 4JI2K 4JI5K 1FJGK 4JI0K 4NXMK 4DV3K 1HR0K 1I94K 4CW7B 4DV0K 1HNWK 5BR8K 5FLXO 1IBLK 5AJ3K 4X64K 5LMNK 4X65K 3T1YK 1N33K 4OX9K 5LL6Z 4LF6K 4DR3K 4DV7K 4DR7K 1J5EK 4LFBK 4CVNE 4GKKK 2UXCK 2UUCK 4DV4K 3J80O 4LF9K 4DUZK 4LF7K 4DV6K 1XNRK 4JI4K 5A2QO 4LF4K 1IBMK 4DR2K 4JV5K 4DV2K 1XMOK 3OTOK 4DR5K 1IBKK 4YY3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH K;  4JI6 K;  2UUB K;  2VQE K;  1XNQ K;  2E5L K;  2UXD K;  4JI7 K;  4B3S K;  4LFC K;  1HNZ K;  4B3T K;  5LMU K;  3J7A P;  1N32 K;  4LFA K;  4NXN K;  2VQF K;  1N36 K;  4AQY K;  4DR1 K;  2UU9 K;  4LF5 K;  4YHH K;  4DV1 K;  4JI8 K;  4X62 K;  4KHP K;  3J81 O;  3JAM O;  5IT9 O;  4GKJ K;  4B3R K;  3T1H K;  4JI1 K;  2UXB K;  4DR4 K;  3J7Y P;  1N34 K;  2ZM6 K;  4V19 S;  1XMQ K;  4X66 K;  1HNX K;  4DUY K;  5IWA K;  2UUA K;  4JI3 K;  4DR6 K;  2F4V K;  4B3M K;  4LF8 K;  4JYA K;  4DV5 K;  4K0K K;  4JI2 K;  4JI5 K;  1FJG K;  4JI0 K;  4NXM K;  4DV3 K;  1HR0 K;  1I94 K;  4CW7 B;  4DV0 K;  1HNW K;  5BR8 K;  5FLX O;  1IBL K;  5AJ3 K;  4X64 K;  5LMN K;  4X65 K;  3T1Y K;  1N33 K;  4OX9 K;  5LL6 Z;  4LF6 K;  4DR3 K;  4DV7 K;  4DR7 K;  1J5E K;  4LFB K;  4CVN E;  4GKK K;  2UXC K;  2UUC K;  4DV4 K;  3J80 O;  4LF9 K;  4DUZ K;  4LF7 K;  4DV6 K;  1XNR K;  4JI4 K;  5A2Q O;  4LF4 K;  1IBM K;  4DR2 K;  4JV5 K;  4DV2 K;  1XMO K;  3OTO K;  4DR5 K;  1IBK K;  4YY3 K; 
#chains in the Genus database with same CATH topology
 1GOC A;  4EIA A;  5DM7 L;  1YIJ N;  2HHH K;  2D1K A;  3SYZ A;  4BDY A;  3FLC O;  4IJA A;  1QQN A;  4QS8 A;  4LFC K;  1KAY A;  4JN4 A;  4R79 A;  1EXQ A;  4B08 A;  3HM8 A;  2O8C A;  4CJP A;  1RDU A;  3O9R A;  5AZJ A;  3J81 O;  3CFR A;  4DFK A;  4W5R A;  2ZD1 A;  4XEI A;  3T7Z A;  4LH4 A;  3P38 A;  3LDN A;  1BA1 A;  4CFC A;  4OJR A;  1YT3 A;  3S3O A;  3VET A;  1JXE A;  1HYZ A;  1SL2 A;  3M6G A;  4BGB A;  3TAF A;  3KD5 E;  3SJJ A;  3ZSR A;  1SS6 A;  1T44 A;  4ELT A;  3FFK B;  3R6M A;  3DLR A;  4BE0 A;  1RDW X;  3CYM A;  2YHY A;  3K57 A;  4DV5 K;  3TAM A;  5BRE A;  2QEX N;  5M1P A;  5AQS A;  3ATU A;  1HR0 K;  3PX4 A;  4EZ6 A;  3K5M A;  1DEJ A;  3VQC A;  3AY9 A;  4LF6 K;  4DV7 K;  3ZT0 A;  4BR4 A;  2F9W A;  1VQN N;  1QVG M;  5KGW A;  1W0H A;  2FBV A;  4CE9 A;  3VEN A;  1RBT A;  1IG8 A;  4J2D A;  3LDS A;  4W5T A;  4Q0B A;  3PSF A;  1DTQ A;  1EWQ A;  2ZF5 O;  1ZYQ A;  3BDP A;  2FBX A;  1LAW A;  4CEO A;  3EY1 A;  4IO9 L;  4C8K A;  4DTS A;  4CJU A;  4DSL A;  5AR0 A;  4WFN L;  3O5B A;  5AQT A;  3VGK A;  3CM5 A;  3VEV A;  3BP8 A;  4YNQ A;  4M7Y A;  3CHW A;  3FFI A;  4B1V A;  5GAH P;  1XMO K;  3GE1 A;  4DR5 K;  3LP1 A;  2FLO A;  1YI2 N;  4N47 A;  3CC7 N;  3LZJ A;  3EZ5 A;  3IG1 A;  1U6Z A;  5AFU A;  1WSG A;  3Q7C A;  1TK5 A;  3VTI A;  4CEA A;  4N41 A;  3RMC A;  4DG1 A;  3THX A;  1ZBI A;  2Z1G A;  3ATV A;  4FYD A;  4EZ9 A;  4GVE A;  2RE2 A;  1HNZ K;  4B9N A;  1Z25 A;  3C0B A;  4ILG B;  4DU1 A;  4B1U B;  5E41 A;  1DLO A;  1S6P A;  4JKE A;  4O8K A;  1BDG A;  1JLF A;  1NGC A;  2O8B B;  3TTC A;  4IFE A;  1QQC A;  3JAM O;  4JKG A;  2XY7 A;  2NRT A;  2DPN A;  2P9P B;  3TSP A;  2YHB A;  4CF0 A;  1KCF A;  5I3U A;  3HI0 A;  3VQ6 A;  3EEQ A;  1C0M A;  2F96 A;  2VG6 A;  3DM2 A;  4Z4E A;  2D0B A;  1GLE G;  3FZH A;  3MWT A;  1TGO A;  3ZET B;  4BE1 A;  1W9H A;  3WNG A;  1NMD A;  1X9J A;  3NMU A;  3DLB A;  2DFF A;  1KVC A;  2F4V K;  4H0V B;  3ZX2 A;  4DSI A;  1CXQ A;  2GEL A;  3VQ7 A;  2GUP A;  2P9P A;  1HKG A;  2P9I A;  4DV0 K;  5FLX O;  5SWM A;  4X64 K;  3VQB A;  1N33 K;  4CEC A;  3ZET A;  1UA0 A;  1L3T A;  3DLE A;  4DTM A;  1T7P A;  3HP9 A;  3O9U A;  3LM2 A;  2E2Q A;  4RG8 A;  3CXC M;  3W3D A;  5F2R A;  4FM1 A;  5AQY A;  5BPM A;  4JNE A;  4M7X A;  1C1B A;  3DI6 A;  4PL8 A;  1QS4 A;  2IC3 A;  3GG4 A;  5CYQ A;  1Q9Y A;  4W5N A;  4AM6 A;  3OJS A;  1XHZ A;  3M8S A;  4YDU A;  1XNR K;  4H5N A;  1J6Z A;  2B4J A;  3KLG A;  2WBN A;  4WE1 A;  4CBX A;  3NBP A;  1D5A A;  2DFH A;  4OPA A;  2KFN A;  3K5O A;  4AH9 A;  3CD6 N;  3IAY A;  1RDA A;  2Z1H A;  1LWF A;  1NGA A;  4JI6 K;  3RTV A;  4JK8 A;  5C2F A;  4KHU A;  2P9L B;  1WSJ A;  5JS1 A;  4MDA A;  1U2V A;  4CJL A;  3MWP A;  4JEP A;  2RF2 A;  1N32 K;  1ASU A;  2A1R A;  5KI6 A;  2Z1J A;  1OH8 A;  4JRQ A;  2KTQ A;  3O4Q A;  2HHT A;  1LWE A;  3P31 A;  1JCF A;  2V52 B;  3PO4 A;  4CF9 A;  4JI8 K;  3AVJ A;  2FXU A;  4CEF A;  1MA9 B;  5KQ8 A;  4K42 A;  3TAB A;  3SPZ A;  4KH4 A;  3D2F A;  1MDU B;  4NYN A;  3ZT2 A;  3I56 N;  3C65 A;  4JS5 A;  3QML A;  3H1Q A;  2ZM6 K;  4FJG A;  4CZH A;  3VES A;  4M3W A;  4M3X A;  3D0P A;  3O6W A;  4K8Z A;  1Z05 A;  1JCE A;  2YNG A;  5IWA K;  5AQM A;  1S5J A;  1QQO A;  4FJ9 A;  3QBX A;  4B3M K;  4DTX A;  4M63 C;  5ADX A;  4EP5 A;  3ZSZ A;  4O5F A;  3IS9 A;  4DFM A;  2W41 A;  5M1F A;  4DFP A;  4BRI A;  5AQU A;  4JRP A;  3CI5 A;  1KLN A;  1P8Z A;  3TSU A;  4CES A;  3SMS A;  3V9U A;  4KRF A;  4WQ5 A;  3MN9 A;  2WUS A;  4BR9 A;  5J2Q A;  2YI1 A;  4HTL A;  2X6N A;  3C7N B;  3D2E A;  4Y0W A;  1ATN A;  2JGU A;  3O3F A;  1J5E K;  5MLC Q;  4WQ4 A;  1X9M A;  1C1A A;  4DQP A;  4OPH A;  3CFO A;  4BE2 A;  5H1S Q;  1BGX T;  3ZT3 A;  4IFY A;  3KK3 A;  5JLH A;  1VSI A;  4LF9 K;  2E1Y A;  3HYF A;  3MMV A;  4JKC A;  4CFA A;  4CK1 A;  4DB3 A;  3HOT A;  4DV6 K;  3A8Y A;  4AF1 A;  4Z94 A;  1TKZ A;  4CHY A;  1S72 N;  1BQN A;  4AHU A;  1QHA A;  3IKM A;  1VSJ A;  4BRE A;  3KD1 E;  4H5W A;  2AA4 A;  4IOA L;  3FZK A;  3VA0 A;  3KTQ A;  1VQL N;  4H0P A;  4RW6 A;  1GLA G;  3IUC A;  1NM1 A;  1RT4 A;  1TYQ A;  1RBR A;  3QIN A;  3NH0 A;  3KK1 A;  3HM9 A;  5GIN A;  1KVA A;  1TUY A;  5HBM A;  3TAN A;  4I6M B;  4Y1C A;  2YNI A;  1B92 A;  2UU9 K;  2BH1 A;  2H3G X;  1NU0 A;  2PY5 A;  4LD0 A;  5F0X A;  5AQI A;  3F2K A;  1VQO N;  1Q7Y O;  2FC0 A;  3VQA A;  3NVK A;  4GKJ K;  3R9P A;  4JD2 B;  4A5A A;  5GAD P;  4U7B A;  3OS1 A;  3IFR A;  2O4I A;  3B6P A;  2UXB K;  3E9L A;  1LV5 A;  3A5O C;  2OPQ A;  4PHT X;  4CJ4 A;  1NKB A;  4CJ3 A;  3H45 C;  1LCU A;  5AFU H;  4E7H A;  3I0S A;  4CGF A;  3HK2 A;  3OYF A;  4E89 A;  4E1N A;  4DTN A;  2BTF A;  2P5G A;  3THY A;  2YV0 X;  1J54 A;  3HPO A;  3VMF B;  1VSH A;  3CFP A;  2Z1I A;  4JI0 K;  4LSL A;  2O8E A;  3V1Q A;  4N76 A;  4B9M A;  3L2W A;  1HNW K;  1BWF O;  4OKK A;  3K58 A;  1N8R O;  4B9U A;  1U04 A;  3C6T A;  2HOE A;  4ZTF A;  3RRH A;  1VQ7 N;  2P5O A;  3K5N A;  4MLE A;  3ZSO A;  5C12 A;  3S41 A;  3CQ8 A;  5BN8 A;  3U3Y A;  1QZ5 A;  3J7Z O;  4DV4 K;  1ATS A;  5AQR A;  3GDQ A;  3L2U A;  3TAQ A;  3HP6 A;  3QDK A;  5C10 A;  1XQS C;  3SJH A;  4CHO A;  4KKO A;  5TKW A;  1TAU A;  4BG9 A;  3SV4 A;  3ZCM A;  3MEC A;  1O1W A;  1S1U A;  1SQK A;  3P83 D;  2X6S A;  3WUH A;  4YOW A;  1D9F A;  1TK8 A;  1LOT B;  1NK4 A;  4RTF D;  2EWS A;  2HHU A;  3CM6 A;  5JVH L;  3WNE A;  3SQ4 A;  3T69 A;  2A41 A;  4WQ5 C;  1RFQ A;  1V4T A;  3K59 A;  3LP0 A;  2VWK A;  4NXN K;  1EX4 A;  1ZBH A;  4ID1 A;  2HF3 A;  1NJY A;  3OYI A;  1OH6 A;  4DQR A;  4DS5 A;  1KQS M;  2UYT A;  2ASP A;  3LPU A;  1WBD A;  4PQU A;  4IDK A;  3VQ4 A;  1UOC A;  3L2V A;  4JS4 A;  3TU5 A;  3L6Q A;  4FSV A;  4KHN A;  3LP3 A;  2YNH A;  1V4S A;  4WYB A;  4IOX A;  3BZC A;  4E7I A;  1GLJ O;  4BAC A;  4PKH A;  1FK9 A;  3V9X A;  4LY7 A;  1YJ9 N;  1QE1 A;  4CD3 A;  4K43 A;  4K0K K;  4BRD A;  1WSE A;  3D6R A;  1FJG K;  3M3Z A;  2NNW A;  4B1Y B;  5BR8 K;  3WXM B;  3AVK A;  4C1N I;  3T1Y K;  1EKE A;  4A5B A;  1C6V A;  3VF2 A;  4NLB A;  1WAF A;  4RWT A;  2O8D B;  1KVB A;  2Q1N A;  2CH6 A;  1I39 A;  3KWI A;  4IOC L;  3R3L A;  3KHY A;  3CME N;  2OPR A;  1LW2 A;  2Y1J A;  3MED A;  4DLG A;  1JKH A;  5KRT A;  2VWJ A;  5ADX H;  3I55 N;  2FBY A;  3AVH A;  3OA9 A;  3TSQ A;  1S3X A;  5FDL A;  2O8D A;  2E6L A;  5HRN A;  5EU7 A;  1EP4 A;  3SUN A;  3H3N O;  4DU3 A;  3PY8 A;  1BIU A;  2E88 A;  4GMJ B;  2PAV A;  4DCH A;  2D0C A;  3E9P A;  1VSL A;  4DQ8 A;  1VRT A;  4FW1 A;  1A5W A;  1FW6 A;  1WSI A;  3DOL A;  4CJ7 A;  1YJN N;  1NK9 A;  3VEY A;  3WQU A;  1NGB A;  4IEI A;  4YFU A;  2PBD A;  1WBB A;  3O4W A;  2G8W A;  1KFS A;  4CGD A;  4NCA A;  4ICL A;  1YXQ A;  4QS7 A;  4FJ7 A;  4KPY A;  4GVM A;  3LWM A;  1WLJ A;  3TTD A;  4FJ8 A;  4DR1 K;  3LAK A;  4IO8 A;  4KAZ A;  3HPH A;  3JS6 A;  3CCU N;  3CCR N;  3VER A;  5AQW A;  3RMB A;  1FXX A;  1O13 A;  1NOZ A;  1RBU A;  4N5S A;  1IJJ A;  5GIP A;  2P9K B;  2W40 A;  3O1B A;  3ENB A;  4NB4 A;  5BPL A;  4EFH A;  4OLA A;  4C8N A;  1NK8 A;  5AQV A;  3UKU A;  1BIS A;  4O0I A;  1EQY A;  4K25 A;  3CCV N;  3NF6 A;  2NZT A;  1WN7 A;  3NAE A;  2P9S A;  4W5O A;  4GY2 B;  4DMN A;  3E01 A;  2QTD A;  5FRN A;  4DV3 K;  2GX9 A;  3SBG A;  3K9K A;  3SV3 A;  2PYL A;  3BGR A;  2Q0R A;  1L3U A;  3U8X A;  5DM6 L;  1BA0 A;  4CHZ A;  5I42 A;  3AVN A;  1BG3 A;  1GLF O;  3C6H A;  3SLC A;  4YOX A;  2A6A A;  2VGM A;  4B9V A;  4FXD A;  4FVU A;  4CI6 A;  4CVN E;  4FOI A;  4DQI A;  4BVO A;  1YHQ N;  2DTU A;  4CEZ A;  3CJ9 A;  3AA5 X;  2QWR A;  3RR8 A;  4CJV A;  4IZ9 A;  3E66 A;  3AVB A;  4LF4 K;  3OYK A;  4CED A;  4ELU A;  1BCO A;  2Q0U A;  4CGH A;  4DQS A;  3QIP A;  4PY5 A;  4BDP A;  3DMJ A;  2XY6 A;  1Q82 O;  5C25 A;  1VQ5 N;  3DAW A;  3DYA A;  4A59 A;  4JAX A;  3FZL A;  2XY5 A;  3T19 A;  4FM0 A;  2OPP A;  3M8P A;  1KFD A;  1VAZ A;  3AVC A;  3U9Z A;  2OTL N;  5DMR A;  4JI7 K;  4BRN A;  4LH5 A;  2ZJQ L;  1GOA A;  1N6Q A;  4FWO A;  2OAN A;  5GIO A;  1HYV A;  2QWN A;  4O8U A;  3WEE B;  4FPA A;  3LDL A;  4FLU A;  4BWJ A;  1D9D A;  1L3S A;  3SPY A;  3U6F A;  3MAQ A;  3MXI A;  2G8I A;  3BUZ B;  3SAH A;  1YTU A;  4V19 S;  2QW9 A;  1W97 L;  1SZ2 A;  5J2P A;  4X66 K;  4K8X A;  2D4W A;  4F8R A;  2GTD A;  1K8A O;  3QEI A;  1IH7 A;  3WXJ A;  2HMI A;  1ATR A;  1REV A;  4CER A;  1VQ9 N;  3RMD A;  4GV6 A;  3VQQ A;  4CJE A;  3A5M C;  4JK7 A;  3KKR A;  3HOS A;  4OPK A;  4F2S A;  1KC8 O;  3PLA A;  4DSE A;  1XC9 A;  2HST A;  5E84 A;  4DR3 K;  2X78 A;  1TV6 A;  3CF5 L;  3TAE A;  1KXP A;  4E1J A;  3QB0 A;  3O9Q A;  5LY3 A;  3AO4 A;  2O8B A;  3MXJ A;  5K14 A;  2ZWH A;  1R59 O;  1QVF M;  4RW9 A;  2HBJ A;  4CGI A;  2VG7 A;  4LC9 B;  5J2M A;  5HP1 A;  4M3Y A;  3RWU A;  3SBT A;  1R0A A;  2E20 A;  4JKH A;  3EL2 A;  5C2D A;  4BQZ A;  4EP4 A;  4ISE A;  3O3G A;  3VGM A;  3NGZ A;  4EAH D;  3ALY A;  3L4Q A;  2BGG A;  3VA3 A;  2HVI A;  4BVP A;  1C1C A;  1T6D A;  2HBK A;  1QSS A;  1FKP A;  1J9A A;  2YHX A;  4XH1 A;  1RTD A;  1HJR A;  4AHT A;  1A5V A;  4CJS A;  3NF9 A;  2NRV A;  3CCM N;  4L3Q A;  3K0S A;  3SMP A;  4IXC A;  4MLH A;  2FBT A;  1RT5 A;  2D0O A;  3SQ1 A;  4HUE A;  5AQX A;  4E19 A;  1P90 A;  2IVO A;  3NH1 A;  4LFA K;  2VCP A;  2VQF K;  3ZEU B;  2B5J A;  1HLU A;  1VQM N;  2CGL A;  4RW4 A;  2YKM A;  4KHP K;  1VHX A;  1K9M O;  3GL1 A;  3VN5 A;  1OH5 A;  1GLL O;  3RMA A;  1NG9 A;  3OS2 A;  3RSE B;  2UUA K;  1RT3 A;  2AJQ A;  3G4S N;  2GV9 A;  4BRO A;  1HKB A;  2AP1 A;  2NRH A;  2G8F A;  4CZG A;  3HT3 A;  2RN2 A;  5BN9 A;  4F2R A;  3OYA A;  2XY8 A;  3EZW A;  1N5Y A;  3K5L A;  2KHO A;  3HPG A;  3NF7 A;  2V7Z A;  3DRS A;  5AQP A;  4AHV A;  2P9L A;  4M45 A;  2WFB A;  5FPD A;  1TKX A;  3V9W A;  2HF4 A;  2Q3S A;  2ASO A;  3LAN A;  1D8Y A;  4JHD B;  1ZBU A;  3QBW A;  4B1X B;  4CEE A;  4YOV A;  4I7F A;  2BAN A;  2UXC K;  3CCE N;  3HTV A;  4OGC A;  5AQQ A;  1OKJ A;  2QKK A;  1VQP N;  3P1G A;  4U67 L;  4KB1 A;  3SUQ A;  3UIQ A;  1RTH A;  1Y64 A;  3CJ7 A;  3DXM B;  3O9T A;  4DUZ K;  1NNE A;  3VQE A;  3G10 A;  4A2A A;  1DTT A;  3THW B;  2VGN A;  4BRC A;  2A3Z A;  4YOR A;  4DR2 K;  5C15 A;  4B1Z A;  2FSN A;  4FJI A;  2FF3 B;  3UKR B;  5FPM A;  3OTO K;  3SI6 A;  2J4R A;  5J1E A;  1TKT A;  3ULE B;  3K9J A;  3CJB A;  4CIG A;  3OHR A;  5AQL A;  4DTP A;  3HXM A;  2KW4 A;  4F3O A;  3OW2 M;  2NRZ A;  1XNQ K;  1BU6 O;  1UAX A;  4FOE A;  4I2P A;  1BUP A;  4MO4 A;  4KI4 A;  4OPJ A;  1RDD A;  1NGI A;  5FPE A;  4BR7 A;  5JS2 A;  5HRS A;  3L2Q A;  1XC3 A;  3HST B;  1EO1 A;  1VQ4 N;  1WAJ A;  1KRP A;  2YJF A;  2R7Y A;  4DTU A;  1BO5 O;  3C7N A;  2RKI A;  3QLH A;  2PZS A;  5AZI B;  3RVC A;  2HHX A;  4IBN A;  2YJE A;  4BRA A;  5CE3 A;  2P9N B;  3D45 A;  2E4L A;  1YF5 L;  3S3M A;  4DHY A;  2QWP A;  5HRP A;  3HSC A;  1D4X A;  4XH5 A;  5DK5 A;  3AVL A;  1JL1 A;  4JI1 K;  3C95 A;  1G99 A;  1MWM A;  4PKG A;  4YOU A;  1LW0 A;  2Y1I A;  1S6Q A;  3CJA A;  2OPS A;  3SZ2 A;  3ZSV A;  3QIO A;  1K73 O;  2ZJP L;  3DXK B;  3DOK A;  5AZI A;  4BRG A;  4LF8 K;  3G0Z A;  4E7J A;  3AAP A;  2YHW A;  3WQT A;  5AQN A;  2YKN A;  3FE1 A;  3V9Z A;  3VQP A;  2DY4 A;  4YOT A;  4BC3 A;  3EE9 A;  3SUO A;  3QNO A;  4CW7 B;  2HB5 A;  3V1R A;  3NF8 A;  3EE8 A;  5AJ3 K;  4DFJ A;  4A57 A;  4FWM A;  5BR9 A;  1NJI O;  4FZY A;  1ZBS A;  4FVM A;  3DXK A;  5HOO A;  4I6M A;  3KK2 A;  4AHC A;  4PL7 A;  3ZLJ A;  4DR7 K;  1T03 A;  4J8F A;  1VQ8 N;  1S9G A;  2XHB A;  3VF6 A;  3VPZ A;  2NRX A;  4JD2 A;  2BUP A;  5AQF A;  1KD1 O;  4HHT A;  4YOY A;  4KTQ A;  4AHR A;  3C94 A;  3KKS A;  3OYE A;  3BF1 A;  4RW8 A;  3CPW M;  2W6L A;  2YHA A;  1NGD A;  2QWL A;  4I9L A;  1QTM A;  3KVG A;  2F8S A;  2P9U B;  1NJZ A;  3PX0 A;  5C24 A;  2D0A A;  2ETJ A;  1YVN A;  4H5V A;  2BE2 A;  1OVY A;  4I2Q A;  5FPN A;  1RTJ A;  5AQJ A;  2UUB K;  4FPB A;  2E1Z A;  4QS9 A;  3JYT A;  3TAP A;  3CCJ N;  1HJO A;  3BF3 A;  1X1P A;  3HBT A;  4BRM A;  1NBW A;  4KTW A;  3E1Y A;  2ZJR L;  4KB0 A;  2KQ2 A;  3NFA A;  4G1Q A;  3NH2 A;  1KAX A;  4MFB A;  3I8D A;  4E7K A;  1WUA A;  2GWK A;  2BDP A;  2ITG A;  3KLH A;  3J7A P;  4BC5 A;  2G8H A;  4A62 A;  2IAJ A;  3OYN A;  2QM1 A;  3LL3 A;  4PUO A;  4B9L A;  4MO5 A;  5AQZ A;  4DQQ A;  5HRO A;  4AQY K;  2OYQ A;  3IMX A;  1SUQ A;  3MCA B;  1J5O A;  3AGK A;  1ILY A;  2YNF A;  1K8K B;  2IS3 A;  3FGU A;  3OYL A;  3VEW A;  3AO2 A;  4KTZ A;  4ID5 A;  2FSK A;  4CFD A;  2GWJ A;  1HQU A;  2HVH A;  3ZT1 A;  3IRX A;  1XMQ K;  3DRR A;  1HNX K;  5EX5 A;  1CZ9 A;  3I33 A;  1IKY A;  1VK0 A;  1NKE A;  1TUU A;  3THV A;  1RBV A;  2GUI A;  2IOC A;  3KLF A;  4JI2 K;  3QO9 A;  4ISG A;  5AQH A;  1G15 A;  4KHY A;  3L3U A;  2YX6 A;  3A0I X;  3H46 O;  5KRS A;  1DKG D;  3O3H A;  3VOV A;  5LMN K;  4OX9 K;  4M3Z A;  1GOB A;  2HBL A;  4KI6 A;  5T7B A;  4BY9 C;  4KHS A;  1I3A A;  5M1K A;  3AVA A;  1VSK A;  3CC4 N;  5B8H A;  4CHN A;  4QCL A;  3FZF A;  1RT2 A;  2CH5 A;  4Y1D A;  4KHQ A;  1MWK A;  1KLM A;  1MU2 A;  4Z4C A;  4NYF A;  2WON A;  3SQ0 A;  5BPN A;  1RT1 A;  1S1V A;  1ZBL A;  4MQ3 A;  3OYD A;  4B9S A;  4CCH A;  3ZSY A;  1X3M A;  4BR0 A;  4CF8 A;  4DTO A;  4M42 A;  3ZYY X;  3WXL A;  4FLZ A;  1NJW A;  1Q8I A;  5BRD A;  5D3G A;  4C23 A;  4AIL C;  3V81 A;  2ZGZ A;  3K2P A;  4DTJ A;  1RCH A;  2E6M A;  3WT0 A;  1C0T A;  1VQK N;  4DSF A;  2VQE K;  3ENO A;  2OCE A;  1CZA N;  3PV8 A;  4CHQ A;  1BOT O;  5JIC A;  4DTR A;  5KPT A;  2JWL A;  2VWB A;  3VQ9 A;  4M3T A;  3PSI A;  4FJX A;  2HND A;  1ZC6 A;  3KZB A;  3TTF A;  1N36 K;  3U9D A;  1S1X A;  1RBS A;  4Q5V A;  3ZX0 A;  5C0Y A;  4LF5 K;  4A2B A;  1BI4 B;  1NJX A;  4H5R A;  5KGX A;  1XHX A;  1JLE A;  4CZK A;  1DGK N;  2QA4 N;  3T1H K;  4KH5 A;  1NGJ A;  3C6U A;  3HVR A;  3LPT A;  3MX5 A;  4IJN A;  4O4G A;  3VQD A;  3QNN A;  5J2N A;  3QEX A;  2HHV A;  4G9Z A;  4DUY K;  5LJV A;  3WXI A;  4OKJ A;  1NGF A;  5M1O A;  4UY8 O;  4FK0 A;  3CCQ N;  3JXU A;  3AAR A;  4GW6 A;  3C6A A;  1NMN A;  4BR5 A;  3JSM A;  4B9Q A;  3S3N A;  4ISF A;  3OYB A;  2E8A A;  3LM9 A;  2RPI A;  3T3F A;  4WFA L;  4CZJ A;  3EN9 A;  4NXM K;  3OYH A;  3VEO A;  1DT9 A;  1I94 K;  4CZL A;  5M1Q A;  1IBL K;  3PUF A;  4CZF A;  4X65 K;  3UB5 A;  2A1S A;  3AA3 A;  4IDH A;  3AA4 A;  2O8C B;  4BRQ A;  3KLE A;  1NKC A;  1TVR A;  3TAR A;  4ZHR A;  4LFB K;  4F9O A;  4J2E A;  4CZM A;  1ITG A;  3DLG A;  4NLC A;  5AZJ B;  1SKW A;  4OO1 J;  3AA2 A;  3NVM A;  4GNI A;  2W42 A;  3J80 O;  1ZXO A;  4CJQ A;  3OYJ A;  3F73 A;  4FLV A;  2G8K A;  3G71 N;  3LDO A;  4N56 A;  2P9K A;  4JI4 K;  1TKD A;  3KK7 A;  2QXF A;  4JV5 K;  5CZ2 A;  4PA1 A;  3CQX A;  4CJW A;  3L3V A;  4F4K A;  3HL8 A;  4B9T A;  3BY5 A;  3OYG A;  2OZS A;  1VQ6 N;  2V51 B;  4RCH A;  1IV0 A;  4CGJ A;  3V6D A;  1BIZ A;  2A40 A;  2HBM A;  2IVP A;  1YVU A;  3M8R A;  2E5L K;  2VG5 A;  3ZSX A;  1IKX A;  4Z4I A;  4B3S K;  4WFB L;  1SL1 A;  1RT7 A;  3F5T A;  3PO5 A;  3T1A A;  3V9S A;  3ZSQ A;  1KAZ A;  1TAQ A;  4CJ5 A;  1Q18 A;  3CER A;  3O80 A;  4FL9 A;  3MX2 A;  4CF2 A;  1NK0 A;  2KFZ A;  1U49 A;  2QXL A;  1S1T A;  4FWP A;  1NK5 A;  4CK2 A;  4Z4F A;  2D5R A;  4CEQ A;  2OTJ N;  4KBO A;  1HUX A;  3D7E O;  4C8O A;  4B3R K;  3E9O A;  3GOI A;  5TKY A;  2GEM A;  4B8A B;  2A42 A;  5JLF A;  3HRG A;  3AVG A;  1JLA A;  1HNV A;  3DLK A;  1X9W A;  1ZBF A;  1NWK A;  2O4G A;  1TL3 A;  4JK9 A;  2YCH A;  5CY4 A;  1XUP O;  5FRO A;  1SL0 A;  2HHQ A;  1JL2 A;  5JVG L;  2PFU A;  2QWO A;  2CGJ A;  5HL7 L;  2GBZ A;  3WXK A;  5JMV A;  4CJK A;  3KLI A;  4DLE A;  4GV3 A;  2Q2R A;  3HJF A;  1NGG A;  2QWM A;  3THX B;  5FRM A;  1F21 A;  3V1O A;  5SZT A;  1J53 A;  4CFB A;  3ENH A;  2W6K A;  5KQD A;  4WCE L;  2QWQ A;  3ZX3 A;  4B1W B;  4FWK A;  3B6O A;  3WEE A;  2FSJ A;  4GKK K;  3PIP L;  3HO1 A;  4JKG B;  3DLH A;  3NHG A;  3LAL A;  4H0O A;  2XO7 A;  3PX6 A;  4DKW A;  4LF7 K;  3FZM A;  1JLC A;  2A5X A;  2B6A A;  1WNS A;  1VSM A;  1YIT N;  4XH4 A;  4CBU A;  4H0X B;  4DV2 K;  3F9K A;  3QEP A;  3EO3 A;  5EOY A;  2NUB A;  4OVL A;  2F9T A;  3CET A;  1NGE A;  3U3G A;  3OYM A;  4CZE A;  2QK9 A;  1L5U A;  2P9I B;  4KHW A;  1NGH A;  2UXD K;  4FWL A;  4JLH A;  4FJL A;  2E2N A;  1CLQ A;  3TR8 A;  3NDK A;  4CZI A;  3CCS N;  4HTU A;  3OJU A;  1KSP A;  4E3S A;  3AVM A;  2WC9 A;  3V4I A;  4AM7 A;  3DWL A;  4BRH A;  3M1F A;  1HKC A;  3OVN A;  4CF1 A;  3QES A;  1BHL A;  4OGE A;  3L0Q A;  3G25 A;  2E2O A;  1S9E A;  5GAG P;  4YHH K;  4RW7 A;  1W7A A;  4CIE A;  3KJV A;  3O1W A;  1C0G A;  3P4I A;  1B9F A;  1VSE A;  1Q86 O;  4BRK A;  5C42 A;  4BC2 A;  2LSN A;  1RGI A;  2HNZ A;  2F7T A;  1JLG A;  3MEE A;  1KTQ A;  1TK0 A;  3ZSW A;  4FWQ A;  3M5R A;  1XI1 A;  1WOQ A;  2KZM A;  3DLL L;  1E4F T;  5CYM A;  3A2F A;  3U4L A;  4A61 A;  4FJK A;  3TAG A;  4JKA A;  3TPQ A;  4JYA K;  3FR0 A;  1SAZ A;  2WOM A;  4PKI A;  4F3T A;  1TL1 A;  3HVT A;  1HPM A;  3AO5 A;  4KH6 A;  2ITM A;  4BRL A;  3OS0 A;  4FJJ A;  1U2V B;  3A5N C;  5GAE P;  1QSL A;  3SK3 A;  2O8F B;  3CJC A;  4FZZ A;  3J8A A;  2RHK A;  2V7Y A;  4WF9 L;  3ZEU A;  5CHI A;  1B9D A;  3NE6 A;  2EHG A;  4E7L A;  1NLV A;  3QEW A;  4FJM A;  3H3O B;  3R8E A;  3KIO A;  5AQO A;  2IVN A;  1BCM A;  1H1V A;  2NRW A;  2UUC K;  3D2F B;  1ESV A;  3MK6 A;  3ID6 A;  4H5T A;  1HX1 A;  2Q31 A;  1JXB A;  5M1N A;  2I5J A;  5A2Q O;  1YJW N;  3RSE A;  1SKR A;  3AO1 A;  3CMA N;  2O8F A;  3QFP A;  4CK3 A;  5EVZ A;  2WTU A;  3MXM A;  2IGI A;  3G6E N;  5ELZ A;  3VEZ A;  2G8U A;  1IBK K;  4NCB A;  4YY3 K;  4JKB A;  5BRF A;  3MEG A;  2ZGY A;  4HUG A;  3LWL A;  3EKU A;  5LJW A;  4FM2 A;  1VSD A;  1S22 A;  1HQE A;  2KLA A;  1WSF A;  3D2E B;  4MDB A;  1HYS A;  3QIC A;  3CC2 N;  4JHD A;  4KRE A;  1LWC A;  3SQ2 A;  1IO2 A;  4FW2 A;  1HNI A;  4W5Q A;  3QEV A;  5IT9 O;  2OZM A;  1QHT A;  4DR4 K;  3DXM A;  4FWR A;  3J7Y P;  4KV8 A;  3THW A;  3DRP A;  2I7N A;  4J2B A;  4BC4 A;  1Q9X A;  3MN6 A;  2G8V A;  4BR2 A;  4GV9 A;  3UKR A;  4B8C A;  4HVJ A;  1FKO A;  3ISN C;  3ULE A;  4HUF A;  4FK2 A;  4H4O A;  2DFE A;  4H03 B;  2NLX A;  4FLW A;  3A5L C;  2OA8 A;  4R5P A;  1TYQ B;  4BRP A;  1VRU A;  3NGY A;  2CGK A;  2XRI A;  3TI0 A;  3QET A;  3H08 A;  5F1X A;  1OVQ A;  3R1X A;  3MN7 A;  1YUW A;  3HZ6 A;  3WNH A;  3ID8 A;  4JKD A;  3VGL A;  1T05 A;  5EXW A;  2HHW A;  3LZI A;  4JKF A;  1C0F A;  3O4N A;  4ELV A;  3H6E A;  4AHS A;  2P9N A;  4Z0U A;  3ITH A;  3MN5 A;  1M90 O;  1QZ6 A;  4M3U A;  2KZZ A;  4H0T B;  1T6C A;  4CGG A;  3OY9 A;  4EHT A;  4UQG A;  3RR7 A;  2ATQ A;  4KO0 A;  1VSF A;  1OH7 A;  4K41 A;  3ZT4 A;  3THY B;  1Q81 O;  3CQY A;  3MDQ A;  5KPR A;  1L3V A;  4M41 A;  2O8E B;  3NCI A;  4C1N K;  4YDU C;  1UWB A;  4EHU A;  3SNN A;  4O5B A;  1Z26 A;  5CZ1 A;  4DSJ A;  5AQK A;  3N4Q A;  3CG7 A;  4B3T K;  4FJN A;  4CEB A;  4IWV A;  4TSX A;  4IKF A;  5AQG A;  3B8A X;  4DV1 K;  3QER A;  4X62 K;  1IKV A;  1RTI A;  4FWS A;  4E1M A;  2X74 A;  1X3N A;  1ASW A;  1N34 K;  4IG0 A;  1JLB A;  2FF6 A;  4FLX A;  5HRR A;  4L8R B;  4OKE A;  4DU4 A;  1GLB G;  1W2B M;  4JI3 K;  3AVF A;  3SUP A;  3IDH A;  2P9U A;  5I9E B;  1RDC A;  3OYC A;  3MCP A;  3O08 A;  1HMV A;  3AO3 A;  2PYJ A;  3CJ1 A;  4IEE A;  5KPZ A;  4FLT A;  1YAG A;  4JI5 K;  1CXU A;  1U45 A;  1K6Y A;  4H0Y B;  3W0L A;  3L2R A;  2QKB A;  3I0R A;  4FCY A;  1BQM A;  4LSN A;  3M8Q A;  3BZK A;  2F8T A;  5LL6 Z;  1JLQ A;  4C8M A;  1T3V A;  4IG3 A;  4B3O A;  4DF8 A;  1WSH A;  1E4G T;  3VQ8 A;  3AV9 A;  2P51 A;  4HCB A;  1EWR A;  2ASM A;  2P1J A;  1K8K A;  3S9H A;  3DJC A;  3CCL N;  3H1V X;  3NGI A;  1RT6 A;  4M3R A;  2VYP A;  3EYZ A;  4DS4 A;  4CJF A;  1C0U A;  3PIO L;  1E3M A;  1IBM K;  4O0J A;  4J2A A;  3L4I A;  4WQ4 C;  3OBW A;  1XWL A;  4NCG A;  2KKZ A;  5HLF A;  4I9Q A;  1WB9 A;  3AGR A;  1HRH A;  4FJ5 A;  2IDO A;  4NO7 A;  1RDB A;  3OBY A;  1UA1 A;  4DSK A;  1U4B A;  1GLD G;  3CPE A;  3Q7B A;  3UE5 A;  1HPZ A;  2ZE2 A;  5LMU K;  2IIR A;  2I7P A;  1ASV A;  1YTA A;  4H8K A;  5EY4 A;  4ZTJ A;  3GBT A;  3ULD A;  4PWD A;  2E2P A;  1JJ2 M;  2Q36 A;  1CZB A;  4FK4 A;  4FWN A;  1Y97 A;  2Q97 A;  3VF4 A;  5CR4 A;  4CJR A;  2QI2 A;  3BEX A;  3VQ5 A;  4XIU A;  1LAV A;  1JCG A;  3LDQ A;  4DWI A;  3LP2 A;  3QFU A;  2JWK A;  5KTQ A;  1T8E A;  2NRR A;  3LDP A;  4ILJ A;  2EX3 A;  3AAQ A;  2HMP A;  2JLE A;  3ASM A;  1Z6R A;  4DR6 K;  4FJH A;  1NK6 A;  3P39 A;  4E0D A;  2HHS A;  3AVI A;  1QSY A;  4BWM A;  3RRG A;  3L8B A;  3SCX A;  4IFV A;  4KFB A;  1S1W A;  3WNF A;  3CIP A;  1RIL A;  3O9S A;  4FO0 A;  4BQL A;  1NK7 A;  1U48 A;  4FZX C;  3P5J A;  2HNY A;  1U47 A;  4DF4 A;  4BGA A;  4CJT A;  1IG9 A;  4C8L A;  4HCC A;  1NOY A;  3I8B A;  2HW3 A;  4CHP A;  3TWH A;  1BI4 A;  1GLC G;  1SKS A;  1M1K O;  1RNH A;  3EKS A;  4OLB A;  4CIF A;  4H4M A;  4QAG A;  4BG8 A;  5E26 A;  3SAF A;  1X9S A;  3VTH A;  3SAG A;  3KWG A;  2ZQB A;  3N4P A;  4CD1 A;  4Z4H A;  1IKW A;  4BRF A;  5BRH A;  4FLY A;  2D0P A;  3O8M A;  1EET A;  4QOZ B;  4BDZ A;  3LAM A;  4CBW A;  4Z4G A;  4O44 A;  3UKU B;  1SV5 A;  1QQM A;  4HWI A;  4ILH A;  3VEX A;  1BL3 A;  1A5X A;  4O55 A;  2P9S B;  3F9M A; 
#chains in the Genus database with same CATH homology
 2HHH K;  4JI6 K;  2UUB K;  2VQE K;  1XNQ K;  2E5L K;  2UXD K;  4JI7 K;  4B3S K;  4LFC K;  1HNZ K;  4B3T K;  5LMU K;  3J7A P;  1N32 K;  4LFA K;  4NXN K;  2VQF K;  1N36 K;  4AQY K;  4DR1 K;  2UU9 K;  4LF5 K;  4YHH K;  4DV1 K;  4JI8 K;  4X62 K;  4KHP K;  3J81 O;  3JAM O;  5IT9 O;  4GKJ K;  4B3R K;  3T1H K;  4JI1 K;  2UXB K;  4DR4 K;  3J7Y P;  1N34 K;  2ZM6 K;  4V19 S;  1XMQ K;  4X66 K;  1HNX K;  4DUY K;  5IWA K;  2UUA K;  4JI3 K;  4DR6 K;  2F4V K;  4B3M K;  4LF8 K;  4JYA K;  4DV5 K;  4K0K K;  4JI2 K;  4JI5 K;  1FJG K;  4JI0 K;  4NXM K;  4DV3 K;  1HR0 K;  1I94 K;  4CW7 B;  4DV0 K;  1HNW K;  5BR8 K;  5FLX O;  1IBL K;  5AJ3 K;  4X64 K;  5LMN K;  4X65 K;  3T1Y K;  1N33 K;  4OX9 K;  5LL6 Z;  4LF6 K;  4DR3 K;  4DV7 K;  4DR7 K;  1J5E K;  4LFB K;  4CVN E;  4GKK K;  2UXC K;  2UUC K;  4DV4 K;  3J80 O;  4LF9 K;  4DUZ K;  4LF7 K;  4DV6 K;  1XNR K;  4JI4 K;  5A2Q O;  4LF4 K;  1IBM K;  4DR2 K;  4JV5 K;  4DV2 K;  1XMO K;  3OTO K;  4DR5 K;  1IBK K;  4YY3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...