2X74A

Human foamy virus integrase - catalytic core.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
187
Chain Sequence
RPQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein
total genus 55
structure length 187
sequence length 189
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x74A00
3HXMA 1JL2A 1DLOA 3KD5E 1TKZA 3AVHA 1NOZA 2OPRA 4KV8A 4FJ9A 3VN5A 1BQNA 4CIGA 1ZBFA 4C8NA 5KRSA 1LWCA 2B5JA 1ZBUA 3V1OA 4E1MA 1NK6A 3FFIA 2XRIA 1RTJA 1RT5A 1B9FA 3LP1A 1QS4A 3ULDA 1NK8A 4FJKA 2G8IA 3VQ4A 4FM1A 4BE0A 4DTXA 1BCMA 4RW9A 3TAQA 1NJXA 3IG1A 1KSPA 4CGFA 3V9SA 3NBPA 2P1JA 4PWDA 4DU4A 1RTIA 4ID5A 3V9WA 3DRRA 3I0SA 2YHAA 4E7IA 1BISA 1KRPA 3VQ5A 1CXUA 3VQ8A 1BL3A 4FXDA 5HRSA 4JRQA 4PQUA 1BHLA 3I0RA 3AO3A 4FZYA 2FBXA 4WE1A 2KFNA 2HNZA 1JXBA 3VQQA 1UA0A 4M3ZA 4KRFA 2HHSA 3H08A 3CG7A 2KTQA 1C0UA 4IFYA 1CLQA 1QQCA 4DMNA 4I7FA 4O55A 2KQ2A 3OJUA 1C1BA 1KLMA 4CIFA 3NDKA 4CESA 3NE6A 1U49A 1Z25A 4DTNA 1Q9XA 1K6YA 3JYTA 3HL8A 1RT4A 1WN7A 4E19A 3AA2A 4YNQA 4B9UA 1UOCA 4H8KA 4M45A 1LAWA 3KK2A 4CIEA 4R5PA 3OYMA 1RBVA 1VSJA 3AVNA 1XWLA 3OVNA 3HVRA 3HM9A 1T8EA 1SKWA 1TGOA 1Q8IA 2KW4A 4KTZA 2EX3A 4CGJA 3QEPA 3DLRA 3EY1A 2Z1HA 3HJFA 1S5JA 3ZSQA 2HMIA 4RW8A 4Y1CA 1U48A 4RG8A 1TAUA 3L2RA 2ZD1A 2RPIA 4CHQA 3TAEA 1IKVA 1C1CA 2B4JA 4F2SA 4BDPA 1JLAA 1ZBHA 1IO2A 2GV9A 2YKNA 3LP3A 4IG3A 4OVLA 3OYNA 3OYKA 1HMVA 4Y1DA 4DWIA 1NOYA 3KLGA 3V6DA 3RTVA 3T19A 3SUNA 1D5AA 4JRPA 5KTQA 2YKMA 4NYFA 2VWKA 4DFJA 3THVA 2HHUA 4BE2A 2KZMA 4W5NA 4HUGA 3SPYA 3DLHA 1GOAA 1L3UA 1QHTA 2D0BA 3C6TA 3AA5X 4DSKA 1XC9A 1FK9A 3QERA 1L3VA 5FRMA 3P5JA 4DFPA 2HHWA 4Z4CA 1NK5A 4E0DA 4E3SA 3P83D 3LAKA 1KFDA 3KK1A 2Z1JA 3KKRA 4H4OA 4KHSA 1TK0A 3K59A 3TAFA 4CE9A 3AV9A 2WOMA 5I3UA 1EP4A 4FLZA 1S6QA 5C24A 3QINA 4H4MA 3LWMA 4CJEA 1JXEA 4AHCA 1NKCA 4DQQA 3ITHA 2YNHA 4CGDA 1HQEA 5KRTA 3ZCMA 4CJVA 1TKTA 5SZTA 3L8BA 3U3YA 3L2WA 1SKRA 2OA8A 2PZSA 4BE1A 3MEDA 4ELUA 1WAJA 3WNHA 4FLWA 2Q3SA 4GVMA 2FBYA 1KVAA 4CJ5A 1WLJA 4DLGA 4B9TA 4E89A 4DTPA 3KIOA 4M3RA 3HP6A 4FCYA 1RDBA 3AO5A 3U3GA 4DTJA 4MQ3A 1W9HA 3ZT1A 4CHPA 4CEOA 3OS0A 3LALA 5J1EA 4FM2A 5HROA 3TAPA 4CHZA 4ELVA 3ZSYA 4KHUA 2GBZA 2IC3A 3TAGA 1N6QA 1WSEA 3SV4A 1RT7A 5J2QA 3S3NA 2QKKA 4OKEA 3LDSA 3SYZA 4DSEA 3DMJA 4AHSA 1SL1A 4OKJA 1GOCA 3LANA 3MXMA 4FK4A 4HTUA 4CJQA 2FC0A 4CEFA 1S9EA 2XHBA 3F73A 3KTQA 1ZBLA 2EHGA 2ZE2A 3VQ6A 3QESA 3PV8A 2Z1GA 5EU7A 4M41A 2Y1JA 3HO1A 4O5BA 1Z26A 4CEAA 3LZJA 3PO5A 3NF8A 1BI4A 3MXJA 2X78A 1EKEA 1W0HA 4CF2A 4FLUA 2XY6A 4B9LA 4M3WA 3OS2A 4PA1A 2GUIA 3V1RA 1NJZA 3HPGA 3A2FA 2G8KA 4Z4EA 2Z1IA 1UA1A 4DS4A 2R7YA 3OYBA 3S3MA 4FJ7A 4K8XA 5K14A 3ISNC 3OYLA 1VSHA 3ALYA 3S9HA 2NUBA 3EYZA 4I9QA 3SQ0A 3SPZA 3M8SA 1NKBA 2G8VA 4KI6A 1XHZA 2OPSA 1T05A 4I9LA 3RRHA 1JKHA 2G8UA 3L2UA 1ASWA 1BQMA 3K58A 4FLVA 4F4KA 3AO2A 1VSEA 5CYQA 4W5OA 3WNEA 4Z4FA 3D45A 4ICLA 1D9FA 4DG1A 2HHXA 3T1AA 3RRGA 4DTRA 2JGUA 5C42A 4RW7A 3WNGA 2YNIA 1VSKA 4CF0A 3KKSA 3VQCA 2XY7A 3QEXA 3VA3A 1CZ9A 1JLCA 3OS1A 1S1XA 1J53A 2FBVA 3O4NA 1ASVA 3M8RA 3CQ8A 3ZT4A 2P5GA 5CZ2A 1VSLA 3TWHA 4G1QA 4RW6A 2DFFA 2RKIA 4JS4A 5FRNA 4DTMA 3V1QA 3VQBA 4AHRA 1TKDA 2G8HA 4DTOA 4CJUA 3QLHA 3TABA 3CFRA 3SI6A 1KFSA 4DTUA 4RW4A 1TL1A 1UAXA 2VG7A 1RT2A 3ZSRA 4E7LA 4BDZA 3AA4A 4N41A 3AVFA 1B92A 4KHWA 3V4IA 1HYVA 4OLAA 2E4LA 4YFUA 4EZ9A 4DSIA 3V9ZA 4HUEA 4DF8A 1HRHA 4W5QA 3CM5A 4CK3A 4C8KA 3O3GA 4EZ6A 4FK0A 3NH1A 4IKFA 4IBNA 3OY9A 4DQRA 1A5WA 1HJRA 2WONA 4N5SA 4CF9A 3VQAA 4HVJA 3IRXA 4CF8A 3NAEA 4FJXA 3O4QA 3CFOA 2YNGA 1REVA 2VG5A 4AHTA 3OYDA 2RN2A 3LWLA 1TK5A 4IFVA 1RCHA 2I5JA 4O0IA 3AVIA 2ITGA 2QKBA 4CEEA 4DSFA 4LY7A 4CGHA 4FLTA 4OPKA 4CJRA 3NH0A 3LP2A 3NGIA 4FVMA 3G10A 1SL0A 1A5XA 1J9AA 2A1RA 4KO0A 1LV5A 3DRPA 4CHOA 5CZ1A 1RT6A 1QSSA 3AVBA 5FROA 4O4GA 4N56A 3QIPA 4DFKA 4FJMA 1D8YA 1YT3A 1KLNA 1HNVA 3NFAA 3QEVA 3QNOA 1F21A 1L3TA 1JLFA 3F9KA 3ZT2A 3V9UA 3RWUA 2KZZA 4UQGA 1U4BA 3NCIA 2HNDA 1XHXA 4IDKA 4CEBA 1IG9A 3ZSVA 4E7JA 3V81A 1FXXA 2BE2A 1JLEA 1N5YA 2IAJA 4C8MA 4HUFA 3AVCA 3NGZA 4CF1A 1NKEA 4FJJA 1TAQA 1TV6A 4KFBA 5C25A 4OPJA 1RTDA 4OLBA 5HP1A 3M8QA 4CJKA 4QOZB 3TAMA 1KTQA 3KJVA 4BACA 3I8DA 3SUQA 2OYQA 2X6NA 4BWMA 4TSXA 1ZYQA 2OZSA 3QIOA 4CFBA 4CEDA 1U45A 1IKWA 3VQDA 3ZSWA 2F8SA 1A5VA 3QNNA 4J2BA 1WSJA 3DI6A 3AO1A 2RF2A 1UWBA 3NF9A 5J2PA 3TI0A 2D5RA 1BGXT 4O0JA 1FKOA 2HNYA 3DYAA 4L8RB 4MFBA 1C0TA 3HK2A 3TANA 3RMBA 2F8TA 3PX6A 1KCFA 2AJQA 4EP5A 4BDYA 4Z4GA 4DS5A 4B8CA 1EX4A 5JS2A 4FJHA 5J2MA 4FZXC 1NK0A 4DQIA 4OJRA 3DLGA 4OGCA 4NCGA 2YNFA 4LH4A 3NHGA 1SUQA 3DM2A 4KKOA 4IG0A 3VQ7A 2G8WA 1JLBA 3D0PA 4CCHA 4J2AA 3C6UA 3PY8A 4DQPA 1S6PA 3TR8A 4NCAA 4LSNA 4E7KA 1HYSA 2X6SA 3CFPA 1D9DA 5CYMA 3MEEA 2XY5A 4B9MA 1SV5A 1RT1A 1Y97A 4AHUA 4F3OA 3OYEA 4I2PA 2XO7A 1NK4A 1QE1A 4FJNA 2DFEA 1RILA 1J5OA 4B9NA 1LAVA 3MXIA 1VK0A 4AH9A 2BDPA 3VQEA 3B6PA 1X9SA 4ELTA 1RNHA 4ID1A 4NYNA 3SQ2A 4Z4HA 5HRNA 3ZSZA 4CJLA 3OYHA 4NCBA 4M42A 2BGGA 1EXQA 1LW2A 3AO4A 3NGYA 4ZHRA 2IOCA 1HNIA 4B08A 4FJLA 3AVJA 3SCXA 1O1WA 3OYCA 1NK9A 1WSGA 4E7HA 1RBTA 4E1NA 3DLBA 1VRUA 3KLEA 1FKPA 1DTTA 4CFCA 4HCCA 3NH2A 2E6LA 1SKSA 1VRTA 4F8RA 1RDCA 4J2EA 2LSNA 4C8LA 3ZT0A 1RDDA 3AVKA 3NF6A 1CZBA 3HYFA 3K5OA 3KK3A 1YTUA 3SUOA 3ZSOA 4FJGA 1RBUA 2JLEA 4DSJA 1Q9YA 3RMAA 3IS9A 4CHYA 2HW3A 3KLFA 4F3TA 4DF4A 3OYFA 3S3OA 4W5TA 2BANA 4CFDA 3C95A 1L5UA 1C0MA 3O3FA 3HT3A 3SUPA 2OZMA 1YTAA 4Q5VA 1TKXA 1VSFA 3ZT3A 4F2RA 2A1SA 4KHYA 4Q0BA 2B6AA 3PX4A 2DTUA 3OYGA 2VWJA 1BI4B 2HHQA 3K5LA 1X9WA 2G8FA 1U04A 4JLHA 2QXFA 4Z4IA 3KD1E 4PUOA 1S1UA 5KGWA 4CFAA 4CJFA 4PY5A 5HBMA 1I39A 1S1VA 4FLYA 3RR7A 5J2NA 4FJ8A 4B8AB 1IKXA 5SWMA 3OYJA 3IAYA 3PX0A 1HPZA 1J54A 3K2PA 4DFMA 1LWFA 1TVRA 1S1TA 3B6OA 4BWJA 3SQ1A 4FJ5A 1IH7A 4M3UA 1KVBA 4KHQA 4O44A 3ASMA 4GMJB 3HP9A 1LWEA 2O4IA 2PYJA 3LP0A 1S1WA 1NJWA 3L3VA 2ATQA 4B9VA 4B3OA 2IDOA 3LPUA 4FM0A 3HPOA 4K8ZA 3U6FA 2Y1IA 4QCLA 5CY4A 3WNFA 2QK9A 3O3HA 3K5MA 3DLKA 3PUFA 5E41A 4ZTFA 1EETA 3EZ5A 4DLEA 4CJPA 3QETA 3V9XA 3BDPA 4N47A 1B9DA 1C1AA 4KREA 1RBSA 4CJ3A 4M3YA 3AVGA 1T7PA 3ZSXA 1WSHA 2P5OA 3JSMA 3LPTA 3AA3A 1TL3A 1VSIA 4CK2A 4DSLA 3QEWA 1RTHA 5KGXA 4FK2A 4KHNA 3QEIA 1IKYA 3HVTA 1QSLA 5KI6A 4CGIA 1I3AA 5FDLA 1ITGA 4KPYA 4FLXA 1XI1A 4I2QA 4HHTA 3SV3A 4DQSA 2E6MA 1YVUA 3LAMA 4CJWA 4FZZA 2D0AA 3MECA 3L2QA 1TK8A 1BIUA 1WSIA 2KFZA 2IS3A 4CERA 2PYLA 1L3SA 1QSYA 3VA0A 4CEQA 1RBRA 4FJIA 2OPQA 1X9MA 1VSDA 4OKKA 3SJJA 1U47A 3RR8A 4M3TA 2XY8A 3E01A 1JL1A 2HHVA 3LZIA 4KAZA 3G0ZA 3K5NA 4EP4A 3HSTB 2VG6A 1G15A 4XIUA 2X74A 5T7BA 4CECA 2DFHA 1CXQA 3M8PA 3SQ4A 2ETJA 1WNSA 1ASUA 1RT3A 1BCOA 5HRPA 4JS5A 5HLFA 4N76A 3MEGA 3NF7A 3VQPA 2HVIA 2IGIA 5HRRA 1X1PA 2HVHA 3DOKA 3T3FA 4C8OA 2D0CA 3BGRA 4CJ4A 1HQUA 2OPPA 4QAGA 1HYZA 2HB5A 3DLEA 4GW6A 4CHNA 3SZ2A 1R0AA 3TARA 4HCBA 4KI4A 2O4GA 2P51A 2YV0X 3UIQA 3KLIA 2W42A 3HPHA 1T03A 3C94A 1C6VA 3DRSA 1JLQA 5DMRA 2F96A 1NJYA 3K57A 3SNNA 4LSLA 3MAQA 4Z0UA 3RMCA 4ZTJA 2ZQBA 3CYMA 1RDAA 4FW1A 3OYIA 5D3GA 5DK5A 5JS1A 4KTQA 4DU1A 4FYDA 3QO9A 4CK1A 3DOLA 1GOBA 2PY5A 1WAFA 4CGGA 1KVCA 3L3UA 3CM6A 4LH5A 4KB0A 2DY4A 2HHTA 4OGEA 4LD0A 3VQ9A 3AVLA 3L2VA 5I42A 1MU2A 1VSMA 1WSFA 3P1GA 4CJTA 3RMDA 4DU3A 4CEZA 4KB1A 1ZBIA 1S9GA 4KTWA 4J2DA 1QTMA 4DTSA 4M3XA 3AVMA 4FW2A 3KLHA 1DTQA 3OJSA 1JLGA 4AHVA 2YHBA 2FBTA 3OYAA 4CJSA 1NK7A 3AVAA 4W5RA 4AILC 3PO4A 1LW0A 4B9SA 1BIZA 1SL2A
chains in the Genus database with same CATH superfamily
1JL2A 1QQOA 3VGLA 3ZYYX 4FJ9A 3BY5A 3H6EA 3DWLA 3J7AP 3VF4A 3MN5A 3V1OA 3H3NO 4BRFA 4FM1A 5TKYA 3H46O 4BE0A 4A59A 1BCMA 3RSEA 4A5AA 3THWA 3NBPA 4DU4A 1RTIA 5EX5A 3V9WA 4E7IA 1KRPA 4IOCL 3MDQA 3P38A 3VQ8A 3C6AA 1BL3A 1NGEA 1BHLA 5KPRA 4H0YB 3A5LC 1Q86O 3O9TA 3OW2M 1QQNA 3C7NB 1UA0A 2ZGZA 2HHSA 2P9PA 1C0UA 1CLQA 3KK7A 2FLOA 3NDKA 1W2BM 1U49A 4DTNA 3CC4N 4HWIA 3AA2A 3TU5A 4YNQA 3SMPA 1XWLA 3OVNA 4J2AA 2HHTA 1TGOA 2O8BA 4KTZA 5HL7L 3DLRA 3EY1A 3ATUA 4BGBA 3TAEA 1IKVA 1C1CA 5AR0A 4C1NK 4FWSA 4CZGA 4HTLA 1ILYA 2GV9A 3EKSA 2QA4N 4DUZK 4BQLA 4BE2A 4HUGA 2D0BA 1VQ5N 4H5TA 1VQMN 5FRMA 2GWJA 4E0DA 1NGGA 3CMEN 1P90A 5C24A 3QINA 4H4MA 4AHCA 3H3OB 4CGDA 2OTJN 3VPZA 3U3YA 3L8BA 4BE1A 1WAJA 4FLWA 2FBYA 3W3DA 3VOVA 4M3RA 2WBNA 3HP6A 1RDBA 4DTJA 1W9HA 4CHPA 4CEOA 1ESVA 3LALA 4ISFA 2GBZA 1N6QA 4J8FA 3S3NA 2QKKA 3ENHA 3C0BA 1OVYA 4OKJA 1GOCA 4EFHA 2FC0A 4CEFA 2VQFK 1NGAA 2XHBA 3ENOA 3A0IX 4M41A 4JD2B 5BPNA 3AGRA 3MXJA 2X78A 4CF2A 4FLUA 4X64K 3WXJA 4PA1A 3GBTA 2GUIA 3V1RA 1GLJO 4Z4EA 4BRQA 3QBWA 3E9OA 4X65K 3OYBA 3CQYA 3O5BA 2ITMA 3EE9A 4FWLA 3ALYA 3S9HA 4FPAA 4LF8K 4I9QA 3KWGA 2QWNA 3FGUA 1BQMA 5E26A 2P9KA 4F4KA 5CYQA 1VSEA 1FJGK 3BF1A 4ICLA 1BG3A 2HHXA 2JGUA 1VSKA 2XY7A 3VQCA 4PKIA 4CBUA 1CZ9A 2NRXA 3O1BA 2FBVA 1VSLA 4JS4A 2RKIA 4DTMA 3V1QA 4JI1K 2G8HA 4YOUA 4CJUA 5JMVA 4RW4A 4E7LA 4BDZA 3ZETA 2A6AA 1VHXA 3A5MC 3JAMO 4IEEA 3VEYA 4B9QA 1KAXA 2JWKA 4C8KA 4IKFA 5CHIA 4BG9A 2D4WA 2UUBK 3D7EO 1U2VB 3K9KA 4JI5K 3OYDA 3ULEA 5GADP 4LFAK 4BREA 5AQMA 1RCHA 1M90O 4O0IA 4O5FA 2ITGA 1NGDA 4CGHA 1LOTB 4H0OA 4CJRA 3NGIA 4FVMA 4O8KA 4A57A 4CHOA 1QSSA 3AVBA 4N56A 5M1QA 5AJ3K 1YT3A 1KLNA 1JLFA 2KKZA 3NCIA 2HNDA 4CEBA 1GLAG 3ZSVA 1DEJA 2ZJPL 1MWMA 3THYB 2BE2A 1BU6O 1SAZA 1YJWN 2E1ZA 4JEPA 4CF1A 1NKEA 5GAHP 1TV6A 4ILGB 3CCLN 1RTDA 1SQKA 1KTQA 4BACA 3UE5A 4BG8A 3QIOA 4CFBA 4CEDA 2UXBK 3VQDA 4Z94A 1A5VA 2WC9A 2BH1A 3TI0A 2D5RA 1FKOA 1DKGD 4V19S 1BWFO 3RMBA 1T6DA 3CCMN 4DS5A 1OVQA 4DQIA 4OJRA 4NCGA 3BEXA 3NHGA 4DV0K 4KKOA 1JLBA 3D0PA 1S6PA 4NCAA 3WXKA 4AM6A 2HBMA 5CYMA 2XY5A 1RT1A 3SAHA 4B9NA 1KAZA 1X9SA 4FWOA 1W7AA 1RNHA 1NGHA 5AZJB 4ID1A 2P9UA 4FWMA 3C7NA 1OKJA 4MDAA 1HNIA 4X66K 3AVJA 3SCXA 1O1WA 3A8YA 1HJOA 3N4PA 1DTTA 4CFCA 3MCAB 4FPBA 4IOXA 4C8LA 3TTFA 5AQTA 3AVKA 5A2QO 4BC4A 5JICA 3SJHA 5B8HA 3IS9A 3D2FA 3R6MA 4NLCA 1JJ2M 3CHWA 4F9OA 4W5TA 1DGKN 4CFDA 5M1NA 3HT3A 2ZJQL 3CETA 1TKXA 3ZT3A 2A1SA 3PX4A 2VWJA 5LJWA 2ASPA 2DPNA 2Q0RA 1NMNA 1U04A 4Z4IA 2QXFA 4M63C 1S1UA 1O13A 4CJFA 1OH8A 4FLYA 1S1VA 4IEIA 3IAYA 3O1WA 3K2PA 4ISGA 4M3UA 3D2EB 4O44A 1MDUB 1Q82O 4GMJB 5IWAK 4JK7A 3L3VA 2IDOA 3LPUA 3HPOA 4YDUA 3U6FA 4CD3A 2QK9A 3PUFA 1NLVA 4WF9L 3QETA 1B9DA 1NJIO 4OX9K 2P5OA 3AA3A 1VSIA 4CK2A 3QEWA 2IVPA 3QEIA 5KI6A 1I3AA 5FDLA 4B1UB 3O4WA 3C65A 4I2QA 2D0PA 3GL1A 5LJVA 4JD2A 1TK8A 4GKKK 5FPDA 3EN9A 3O9UA 1GLFO 5AQVA 4NB4A 3VEZA 2A40A 4OKKA 3MWPA 2HHVA 3G0ZA 3K5NA 2VG6A 3QMLA 4XIUA 2W40A 5T7BA 4CECA 4DR2K 3DLLL 1WNSA 1ASUA 3VQPA 2HVIA 4YOYA 3DOKA 2YJFA 4CJ4A 4QAGA 1C0GA 4JKCA 1R0AA 4XEIA 3WEEA 4IOAL 3HPHA 4GNIA 3C94A 4WYBA 3DRSA 3MAQA 4Z0UA 1XUPO 5AQKA 1N36K 1RDAA 1Z6RA 4PL8A 4DU1A 4FYDA 2ASOA 3QO9A 3T69A 3L3UA 3GE1A 1NNEA 4YORA 4CBWA 3L2VA 5I42A 4K0KK 3RMDA 5GINA 4DU3A 3ZX3A 1S9GA 2A41A 4DTSA 4M3XA 4FOEA 1OH5A 3FFKB 5LL6Z 3OJSA 1JLGA 4CW7B 3VGMA 4AILC 3VERA 3G71N 4JKDA 5KQ8A 3FZFA 4JKGB 2NRVA 2OPRA 3VTIA 3L6QA 1BQNA 4DV2K 1N34K 2HBKA 1ZBFA 4C8NA 3ZLJA 2B5JA 2O8CB 3FFIA 4IZ9A 1RTJA 1RT5A 2UXDK 1NK8A 3SBGA 2RE2A 4QS7A 1NJXA 4CGFA 3V9SA 2P1JA 1EWRA 3BZKA 2VYPA 3CMAN 3AAPA 3VQ5A 1CXUA 3CJBA 4KH4A 4PQUA 3THYA 3I0RA 1JCGA 5C15A 4JI3K 2YHWA 3J7YP 3OTOK 3KVGA 4WFBL 2FF6A 4H0PA 4I7FA 3OJUA 4CESA 3NE6A 1Z25A 1RT4A 4E19A 4M45A 1WOQA 1X3NA 4CIEA 4BC5A 3OYMA 4RTFD 3AVNA 3FZMA 4BRHA 3HVRA 3HOTA 4H03B 3EKUA 3WQTA 3L2RA 5AQZA 2ZD1A 2RPIA 4JV5K 3WXLA 4PKGA 4XH1A 3LP3A 4RWTA 4Y1DA 1NOYA 3T19A 1IBLK 1D5AA 5KTQA 4NYFA 4DFJA 1YIJN 3THVA 3DLHA 2V52B 3CQXA 4CZEA 1QHTA 4DSKA 5GIOA 1FK9A 2F4VK 4FOIA 1J5EK 4BRMA 4EHUA 2EWSA 3O80A 4DR4K 3HI0A 4CE9A 5I3UA 1EP4A 4FLZA 1S6QA 5JLHA 4DV4K 1HQEA 4PY5A 2PZSA 4JKHA 4EIAA 2FF3B 3WNHA 4DLGA 4E89A 1V4TA 3KIOA 4FVUA 3AO5A 3M1FA 3KHYA 4FL9A 3OS0A 5J1EA 4H0XB 3TAPA 4ELVA 1C0FA 5AQYA 2IC3A 3O08A 3SV4A 2VGMA 4B3RK 3LDSA 2I7NA 4FK4A 3MXMA 4CJQA 1QZ5A 3I55N 4K42A 3F73A 3K0SA 1Q7YO 1N32K 1ZBLA 2O8EA 1D4XA 3LZJA 4CEAA 4BRCA 2E2OA 4PHTX 3A2FA 4BC3A 2G8KA 1NG9A 4K8XA 4LF7K 3ISNC 1OH6A 4WFNL 2UUAK 2HBLA 3D2EA 4JK9A 1TUUA 3SPZA 1NKBA 3JXUA 1M1KO 3WT0A 3P4IA 1JKHA 1ASWA 1FW6A 1TYQB 3MK6A 3WNEA 3D45A 1D9FA 3RRGA 5GAGP 3AGKA 5C42A 2QEXN 4AF1A 3O9RA 3VA3A 1XNRK 1JLCA 1S1XA 3IFRA 4MO5A 1ASVA 2IIRA 3TWHA 4RW6A 5FRNA 2DFFA 3NMUA 3PIPL 3DJCA 5AQSA 3QLHA 3SI6A 1RT2A 3ZSRA 3VEVA 4U67L 4N41A 4JI7K 3V4IA 4YFUA 3V9ZA 4BRPA 4YOVA 4DV1K 4HUEA 5CR4A 1NGCA 3CM5A 4CK3A 3NVMA 5AQQA 1KQSM 4FK0A 4MO4A 4IBNA 3OY9A 1A5WA 1HJRA 4BRKA 4CF9A 3IRXA 4CF8A 3FZLA 3O4QA 2D0OA 2YNGA 3C6HA 2VG5A 4AHTA 2RN2A 4A5BA 3LWLA 3WXIA 5JLFA 3J7ZO 1RDWX 4DSFA 4LY7A 3CCJN 4DV6K 4OPKA 2OANA 1SL0A 1A5XA 2P9IB 3L0QA 3QB0A 3DRPA 4BR5A 4O4GA 2KLAA 3PLAA 3NFAA 3U8XA 3QNOA 1F21A 3ZEUA 3F9KA 3ZT2A 3V9UA 3LDLA 3RWUA 4UQGA 1U4BA 1XHXA 2HBJA 1N33K 3RVCA 4LF5K 2NNWA 4H5NA 1JLEA 1N5YA 2FSKA 1YVNA 1NGIA 4OPJA 4OLBA 4JI4K 3UKUA 5LMUK 4OPAA 1GLCG 2X6NA 4TSXA 2E2PA 2OZSA 1ZC6A 5AQGA 1U45A 3ZSWA 3SK3A 5BR9A 1WSJA 4YOXA 3AO1A 1UWBA 2QWLA 3NF9A 5J2PA 3DYAA 4L8RB 4MFBA 3MWTA 3OBYA 2F9TA 4WFAL 3PX6A 4MDBA 1MA9B 4B8CA 2GUPA 4FZXC 3DLGA 2O8CA 1SUQA 4H5RA 2G8WA 4IG0A 3VQ7A 1N8RO 5ADXH 3KZBA 3C6UA 1QVFM 2NRWA 5AQUA 2X6SA 4BQZA 3FE1A 2NZTA 2QWOA 3MEEA 1SV5A 1Y97A 4AHUA 4LC9B 4I2PA 1HKCA 1GLDG 1J5OA 3MXIA 1VK0A 3CPEA 2BDPA 3VQEA 4NYNA 3SQ2A 4NCBA 2Q0UA 3ZSZA 4CJLA 3G25A 1K8AO 4ZHRA 4JKFA 4B08A 1NK9A 1WSGA 4E7HA 3DLBA 4E1NA 2P9SA 3NH2A 4F8RA 1VRTA 1RDCA 1JCEA 4YY3K 4M7YA 3ZT0A 4JK8A 3HYFA 3KK3A 1YTUA 3SUOA 3O8MA 3ZSOA 4FJGA 3T1YK 4DSJA 3RMAA 3OYFA 3S3OA 5IT9O 4GKJK 2Q2RA 3SUPA 2OZMA 1YTAA 1VSFA 4F2RA 4EHTA 1IBKK 2A5XA 1BI4B 2HHQA 2G8FA 4JLHA 4CZMA 3KD1E 2BTFA 2QI2A 2QWRA 3O9SA 3CIPA 5HBMA 1I39A 5J2NA 1IKXA 5SWMA 3PX0A 1LWFA 2UYTA 1IH7A 1X3MA 3ASMA 2VGNA 2YX6A 3LP0A 1S1WA 4H0TB 4QCLA 5CY4A 3WNFA 5HOOA 2WFBA 3O3HA 3DLKA 1EETA 1C1AA 3U9DA 1RBSA 2O8DB 1WSHA 3LPTA 1TL3A 1RTHA 4G9ZA 4JI0K 4CGIA 4LFCK 1VQ9N 1ITGA 3CC2N 4HHTA 3SV3A 4BRNA 2QW9A 2E6MA 1YJNN 2VWBA 5LY3A 1WSIA 2KFZA 4CERA 2PYLA 3VA0A 3R9PA 1XC3A 4FSVA 4JHDA 1X9MA 3SJJA 4M3TA 2XY8A 5BR8K 3E01A 2E88A 2UU9K 3HSTB 2X74A 3M8PA 1NM1A 5AQNA 3CPWM 3LDOA 5AQRA 2ETJA 1RT3A 4DKWA 5HRPA 4CZHA 5HLFA 3MEGA 1NGBA 5HRRA 2HVHA 3IKMA 4C8OA 4B1XB 3BGRA 3J8AA 4K41A 1HQUA 2OPPA 1HNXK 4GW6A 3SZ2A 4KI4A 3TARA 2O4GA 3KLIA 1ZBSA 2YCHA 5AFUA 2KHOA 2AP1A 3F5TA 1NJYA 3VENA 3SNNA 3RMCA 2GEMA 2ZQBA 1QZ6A 3CYMA 4FW1A 5DK5A 4NO7A 3UKRB 4KTQA 2PY5A 4CK1A 3DOLA 5AFUH 4CGGA 5AQLA 4KB0A 2DY4A 4LD0A 5BPMA 3VQ9A 4B1WB 4O8UA 4CJTA 4BRAA 2YJEA 4CEZA 4KB1A 2ASMA 3EL2A 3AVMA 4ISEA 1WB9A 4AHVA 3OYAA 1NK7A 1S3XA 4B9SA 1SL2A 4JI6K 1DLOA 4JI2K 1TKZA 4GY2B 1NOZA 3VN5A 4CIGA 4QS9A 5KRSA 3LP1A 3PSFA 1B9FA 2G8IA 2P9IA 4BR2A 4BVPA 1KC8O 3CJCA 5DM7L 4A61A 4B3SK 1KSPA 3IMXA 3FR0A 4ID5A 2PFUA 3DRRA 3I0SA 2YHAA 1NBWA 1BISA 1NMDA 3LM9A 4IXCA 4CD1A 2GELA 2D1KA 4BRGA 4WQ5A 4BR4A 3VQQA 4CJ7A 2YHYA 4A62A 4KRFA 3D6RA 2KTQA 3A5OC 4JAXA 1QQCA 2E20A 2P9NB 4CIFA 1K6YA 4IFEA 3JYTA 3HBTA 2QM1A 1GLLO 4IWVA 4B9UA 4H8KA 4R5PA 5KQDA 1SKWA 1Q8IA 3HJFA 2EX3A 2O8FB 1S5JA 4PL7A 4Y1CA 4JKAA 1TAUA 4BC2A 2P9LB 4B1ZA 4A2AA 2B4JA 1JLAA 2QWMA 3OYKA 2YKNA 4IG3A 4DWIA 3KLGA 1KAYA 3E9PA 4FWPA 4JRPA 2HHUA 3P39A 4CBXA 1ZXOA 2VWKA 3RSEB 2KZMA 3SPYA 3THWB 2IVOA 2W6KA 3C6TA 1XC9A 4I6MB 3QERA 1L3VA 3P5JA 4DFPA 2HHWA 4Z4CA 4E3SA 3KK1A 2Z1JA 1TK0A 3K59A 3TAFA 2CH6A 2WOMA 2P9PB 2GX9A 3QFPA 3LWMA 4CJEA 2CGKA 1NKCA 4DQQA 3ITHA 3ZCMA 1VQ4N 1TKTA 3L2WA 1SKRA 3MEDA 1T7PA 2Q3SA 4B9TA 1KVAA 1X9JA 3ENBA 4C1NI 4DTPA 3U3GA 4MQ3A 3ZT1A 5C2FA 5HROA 4KHPK 1HR0K 4CHZA 4DB3A 4OKEA 4DSEA 3DMJA 4WQ5C 1SL1A 3CCUN 1S9EA 3DXKB 3KTQA 2EHGA 2ZE2A 1ATRA 3HM8A 5DM6L 3QESA 5EU7A 1Z26A 3TPQA 3NF8A 1BI4A 3T7ZA 1EKEA 1W0HA 1NJZA 1BDGA 3HPGA 2Z1IA 1UA1A 2W6LA 4DS4A 3VETA 2R7YA 3S3MA 3FZKA 1U2VA 5AQWA 1Q18A 3OYLA 1VSHA 4BRDA 3SQ0A 3M8SA 1BO5O 2OPSA 4I9LA 4FLVA 3AO2A 4Z4FA 2HF4A 4DTRA 3E9LA 3WNGA 2YNIA 4CF0A 3CERA 3KKSA 3CJAA 3OS1A 3NVKA 3O4NA 5BRFA 3CQ8A 2P5GA 5CZ2A 4G1QA 3PIOL 2O8DA 4AHRA 4DTOA 4PKHA 3CFRA 4DTUA 1TL1A 3AA4A 1HYVA 4EZ9A 2VQEK 1HRHA 4EZ6A 1BA0A 2Q97A 2Q36A 4DQRA 2WONA 4N5SA 3VGKA 3VQAA 3VEWA 4HVJA 3EO3A 3NAEA 4FJXA 3CCQN 3MN9A 3SAGA 4JI8K 3AVIA 4CEEA 2UXCK 3H45C 2P9KB 1VQKN 1J9AA 2A1RA 1BOTO 4KO0A 1RT6A 5FROA 3L4QA 1D8YA 1HNVA 3THXB 1L3TA 2KZZA 3U9ZA 2ZF5O 3FZHA 3H1QA 1IG9A 5H1SQ 4WQ4A 4E7JA 3V81A 1FXXA 4R79A 3CD6N 2IAJA 1YAGA 4CZJA 4HUFA 3ID8A 3NGZA 4FJJA 4DCHA 3ZETB 4CZLA 5AZJA 3UKRA 5C25A 4DR3K 3M8QA 3LDPA 3J80O 4QOZB 4CZFA 1YUWA 2OYQA 4LF6K 1RFQA 3VESA 1IKWA 2CGJA 3CCVN 3DI6A 2RF2A 4O0JA 3ULEB 2HNYA 3A5NC 2F8TA 1KCFA 2AJQA 4EP5A 4GV6A 1OH7A 4Z4GA 5JS2A 4FJHA 4KH6A 3GDQA 1QHAA 4LH4A 4CCHA 4ILJA 1ATSA 3PY8A 3TR8A 2HF3A 1MWKA 4E7KA 1HYSA 3CFPA 4BR7A 4F3OA 4B9MA 3LL3A 4DR7K 3OYEA 1XMOK 1QE1A 2DFEA 5EY4A 1I94K 3B6PA 2HHHK 3EZWA 4QS8A 1VQNN 4Z4HA 3OYHA 2BGGA 1EXQA 3AO4A 3NGYA 4BR9A 4FO0A 4H5VA 3OYCA 1RBTA 1VRUA 4HCCA 1FKPA 4DR1K 1SKSA 5C12A 4J2EA 3F9MA 1RDDA 2O8FA 2FXUA 1CZBA 3K5OA 1YXQA 4WQ4C 3N4QA 2JLEA 3OHRA 3VEXA 5JVHL 1YHQN 1Q9YA 2HW3A 4CHYA 4DF4A 3TTCA 2P9LA 2NRHA 3ID6A 3SLCA 4BVOA 1L5UA 1C0MA 4NXMK 4Q5VA 4Q0BA 2DTUA 2B6AA 3OYGA 1RGIA 3BUZB 2A3ZA 1X9WA 3MCPA 3I8BA 2ZJRL 4CFAA 4I6MA 5FPMA 3OA9A 4FJ8A 4IJNA 1HPZA 1J54A 1TVRA 3SQ1A 1S1TA 1TUYA 4C23A 2P9UB 3BF3A 1EWQA 2O4IA 3CCSN 4M7XA 1NJWA 2ATQA 5BN9A 4B9VA 4B3OA 4LFBK 4FM0A 2YI1A 4K8ZA 3P31A 2FSNA 3MX5A 4CVNE 2NRRA 4DUYK 4DQ8A 3DXMB 2HSTA 4JNEA 2VCPA 4N47A 4KREA 1E3MA 3M3ZA 4M3YA 3VF2A 4DR5K 2Q1NA 3D2FB 5BPLA 3JSMA 3CCRN 3LM2A 4FK2A 4KHNA 1IKYA 3HVTA 4KPYA 3DXKA 4FLXA 4DQSA 4IO9L 1YVUA 3LAMA 4LF4K 4CJWA 5F0XA 1VQLN 3SBTA 2AA4A 1BIUA 5C2DA 1QSYA 5BN8A 4CEQA 2QWQA 3FLCO 4BRLA 3SAFA 3EE8A 3JS6A 3LZIA 4EP4A 5ADXA 4JKGA 1BA1A 4OPHA 4CZKA 3BZCA 1H1VA 4JS5A 4N76A 1BCOA 3NF7A 4IO8A 1QVGM 2IGIA 3KWIA 1HNWK 3IDHA 2D0CA 4H5WA 1T44A 4HCBA 1JCFA 5EOYA 1T03A 2OCEA 1Q81O 1JLQA 1W97L 2V51B 2F96A 2W41A 3K57A 3ATVA 1BUPA 3R8EA 4LSLA 4ZTJA 4MLHA 1GOBA 1KVCA 4OGEA 3MN6A 1MU2A 1WSFA 1VSMA 3P1GA 3PSIA 3ZX2A 2GWKA 1ZBIA 2WUSA 3QFUA 2RHKA 4E1JA 3KLHA 2E5LK 3PO4A 2FBTA 3R3LA 4X62K 3AVAA 4W5RA 2QKBA 3LP2A 1BIZA 3HXMA 1NGFA 5AZIB 3KD5E 3VMFB 3AVHA 4KV8A 2A42A 1HUXA 1T6CA 1LWCA 4BR0A 1ZBUA 4E1MA 1NK6A 3QDKA 2XRIA 4FJKA 1U6ZA 1QS4A 3ULDA 1SS6A 3VQ4A 2PAVA 4DTXA 4RW9A 3TAQA 3IG1A 3WEEB 1WUAA 3THXA 4PWDA 1SZ2A 4JN4A 4Y0WA 4K25A 3MN7A 2QXLA 5ELZA 4FXDA 5HRSA 4JRQA 1IBMK 3M5RA 3AO3A 4FZYA 2FBXA 3H1VX 4WE1A 2KFNA 2HNZA 1JXBA 4M3ZA 3H08A 3CG7A 4IFYA 5AQIA 4DMNA 4O55A 4BGAA 2KQ2A 4GV3A 1C1BA 1KLMA 3TSQA 1Q9XA 3HL8A 5F1XA 5M1FA 1WN7A 4FWNA 1UOCA 4FWKA 3KK2A 1LAWA 3W0LA 1YITN 1RBVA 1VSJA 1T8EA 2KW4A 4CGJA 3QEPA 2Z1HA 5BRHA 1HNZK 3ZSQA 2HMIA 4RW8A 4A2BA 2E2QA 1U48A 2CGLA 4RG8A 4CHQA 4F2SA 4BDPA 1ZBHA 1IO2A 4OVLA 4KI6A 5I9EB 3OYNA 1HMVA 5KPTA 1EO1A 3V6DA 3RTVA 2PBDA 3SUNA 2NRZA 3MX2A 2YKMA 4W5NA 4DV3K 3T1HK 1GOAA 1J6ZA 1L3UA 3CF5L 4B1VA 3AA5X 3HOSA 1CZAN 3TSUA 4DV5K 3VEOA 1NK5A 1IV0A 3P83D 3LAKA 1KFDA 4KHSA 3KKRA 4H4OA 3AV9A 4NLBA 5BRDA 1JXEA 2YNHA 5KRTA 4CJVA 5SZTA 2OA8A 1K9MO 1VAZA 3HSCA 4ELUA 1RDUA 4GVMA 1E4FT 4CJ5A 1TYQA 1WLJA 2ZGYA 4JYAK 1Y64A 3CJ1A 4FCYA 3BP8A 2I7PA 3U4LA 4FM2A 4OO1J 1GLBG 3ZSYA 5C0YA 4KHUA 3TAGA 1WSEA 1RT7A 5J2QA 3O6WA 3SYZA 4AHSA 3LANA 4HTUA 1K8KB 3HZ6A 2OTLN 3VQ6A 3PV8A 2Z1GA 2CH5A 1YI2N 2Y1JA 3HO1A 4O5BA 3PO5A 5KPZA 2F7TA 1HPMA 2UUCK 2XY6A 4B9LA 4M3WA 3OS2A 4CI6A 5CE3A 4FJ7A 5K14A 3GOIA 4DHYA 4CZIA 2HOEA 4DR6K 4H0VB 2NUBA 3EYZA 2G8VA 3AY9A 1GLEG 1XHZA 1T05A 3RRHA 2G8UA 3GG4A 3L2UA 4WCEL 3K58A 3Q7CA 4W5OA 2E2NA 2ZM6K 5AQXA 2H3GX 4DG1A 3T1AA 4IDHA 5GIPA 4RW7A 3DXMA 3QEXA 1J53A 3M8RA 3ZT4A 3VQBA 1TKDA 3TABA 1KFSA 1UAXA 2BUPA 2VG7A 3TSPA 2O8EB 3CC7N 3AVFA 1B92A 4KHWA 1Z05A 3S41A 4OLAA 2E4LA 4DSIA 4DF8A 3DAWA 4W5QA 3O3GA 3HTVA 1XQSC 3NH1A 1VQPN 3VTHA 3CFOA 2V7YA 1REVA 4BRIA 5FPNA 1TK5A 1S22A 5GAEP 4IFVA 2I5JA 4FLTA 1KXPA 1HLUA 5AQPA 3NH0A 1LCUA 1YF5L 4U7BA 3G10A 1S72N 1LV5A 5CZ1A 1G99A 3QIPA 4DFKA 4FJMA 3QEVA 1WBDA 5AQFA 4IDKA 1EQYA 1V4SA 3LDNA 3CJ9A 4KBOA 3IUCA 4C8MA 4MLEA 3AVCA 1TAQA 3M6GA 4KFBA 3E1YA 2Q31A 5HP1A 4CJKA 3TAMA 3KJVA 3I8DA 4DV7K 3SUQA 4BWMA 4YOTA 1KD1O 1ZYQA 4B3TK 2F8SA 3O9QA 3QNNA 1XMQK 4J2BA 3LDQA 2O8BB 4YHHK 1BGXT 5C10A 1C0TA 3HK2A 3TANA 5AZIA 5BREA 5AQHA 4BDYA 5E84A 1EX4A 1R59O 4YOWA 5J2MA 1NK0A 3AARA 1P8ZA 4OGCA 3Q7BA 4K43A 2YNFA 4KH5A 3DM2A 5M1KA 4DQPA 4XH5A 4LSNA 3ZEUB 1YJ9N 3R1XA 1D9DA 5F2RA 5FPEA 2V7ZA 2IVNA 2XO7A 1NK4A 2NLXA 3VF6A 4FJNA 1QQMA 1RILA 1LAVA 4AH9A 4ELTA 2F9WA 3CJ7A 3UKUB 5HRNA 4M42A 1XNQK 1LW2A 1DT9A 2IOCA 1WBBA 4FJLA 3CCEN 2E8AA 4YDUC 3KLEA 5D3GA 2E6LA 5M1OA 2LSNA 2GTDA 4IJAA 3NF6A 2WTUA 1RBUA 2YHXA 3TTDA 3KLFA 4F3TA 2ZWHA 3WXMB 2BANA 1NU0A 3C95A 3O3FA 3EEQA 1VQ6N 4KHYA 1NGJA 3K5LA 3UB5A 3B8AX 2QTDA 3HRGA 4PUOA 5KGWA 4FWQA 3I56N 3RR7A 4B8AB 4FWRA 3F2KA 3OYJA 4GVEA 4B1YB 3WQUA 4DFMA 3B6OA 4FJ5A 4BWJA 1KVBA 4KHQA 3HP9A 1LWEA 1NWKA 1VQ8N 1HKGA 1IG8A 2PYJA 1K73O 2QWPA 2J4RA 1E4GT 5AQOA 2NRTA 4NXNK 2Y1IA 2P9SB 3MMVA 3K5MA 3K9JA 5E41A 4ZTFA 4DLEA 3EZ5A 4LF9K 3OBWA 4CJPA 3V9XA 3BDPA 3G4SN 3CI5A 1ATNA 4CJ3A 3QBXA 3AVGA 3J81O 3ZSXA 4GV9A 4DSLA 5KGXA 1QSLA 4ILHA 1K8KA 1XI1A 1T3VA 1HKBA 4FZZA 2D0AA 3MECA 3L2QA 3L4IA 4B3MK 4XH4A 2IS3A 1L3SA 1RBRA 3I33A 4FJIA 2OPQA 5MLCQ 1VQON 1VSDA 5EXWA 1U47A 5AQJA 3RR8A 1JL1A 4KAZA 3E66A 4UY8O 1G15A 4JKBA 2DFHA 3AAQA 1CXQA 3SQ4A 4EAHD 4AM7A 1HX1A 1IJJA 4L3QA 4AQYK 1X1PA 4RCHA 3T3FA 1HYZA 2HB5A 3DLEA 4CHNA 3CXCM 2P51A 2YV0X 5EVZA 3UIQA 2W42A 3G6EN 4JKEA 1C6VA 5DMRA 3ZX0A 1VQ7N 3QICA 2JWLA 3WUHA 5JS1A 3OYIA 2HMPA 5JVGL 4BROA 1WAFA 5LMNK 3CM6A 4LH5A 2FSJA 5M1PA 4BY9C 3AVLA 2P9NA 5TKWA 2E1YA 4KTWA 3SMSA 4J2DA 1QTMA 4FW2A 1DTQA 5FLXO 4JHDB 2YHBA 4CJSA 1LW0A 3HM9A
chains in the Genus database with same CATH topology
3HXMA 1JL2A 1DLOA 3KD5E 1TKZA 3AVHA 1NOZA 2OPRA 4KV8A 4FJ9A 3VN5A 1BQNA 4CIGA 1ZBFA 4C8NA 5KRSA 1LWCA 2B5JA 1ZBUA 3V1OA 4E1MA 1NK6A 3FFIA 2XRIA 1RTJA 1RT5A 1B9FA 3LP1A 1QS4A 3ULDA 1NK8A 4FJKA 2G8IA 3VQ4A 4FM1A 4BE0A 4DTXA 1BCMA 4RW9A 3TAQA 1NJXA 3IG1A 1KSPA 4CGFA 3V9SA 3NBPA 2P1JA 4PWDA 4DU4A 1RTIA 4ID5A 3V9WA 3DRRA 3I0SA 2YHAA 4E7IA 1BISA 1KRPA 3VQ5A 1CXUA 3VQ8A 1BL3A 4FXDA 5HRSA 4JRQA 4PQUA 1BHLA 3I0RA 3AO3A 4FZYA 2FBXA 4WE1A 2KFNA 2HNZA 1JXBA 3VQQA 1UA0A 4M3ZA 4KRFA 2HHSA 3H08A 3CG7A 2KTQA 1C0UA 4IFYA 1CLQA 1QQCA 4DMNA 4I7FA 4O55A 2KQ2A 3OJUA 1C1BA 1KLMA 4CIFA 3NDKA 4CESA 3NE6A 1U49A 1Z25A 4DTNA 1Q9XA 1K6YA 3JYTA 3HL8A 1RT4A 1WN7A 4E19A 3AA2A 4YNQA 4B9UA 1UOCA 4H8KA 4M45A 1LAWA 3KK2A 4CIEA 4R5PA 3OYMA 1RBVA 1VSJA 3AVNA 1XWLA 3OVNA 3HVRA 3HM9A 1T8EA 1SKWA 1TGOA 1Q8IA 2KW4A 4KTZA 2EX3A 4CGJA 3QEPA 3DLRA 3EY1A 2Z1HA 3HJFA 1S5JA 3ZSQA 2HMIA 4RW8A 4Y1CA 1U48A 4RG8A 1TAUA 3L2RA 2ZD1A 2RPIA 4CHQA 3TAEA 1IKVA 1C1CA 2B4JA 4F2SA 4BDPA 1JLAA 1ZBHA 1IO2A 2GV9A 2YKNA 3LP3A 4IG3A 4OVLA 3OYNA 3OYKA 1HMVA 4Y1DA 4DWIA 1NOYA 3KLGA 3V6DA 3RTVA 3T19A 3SUNA 1D5AA 4JRPA 5KTQA 2YKMA 4NYFA 2VWKA 4DFJA 3THVA 2HHUA 4BE2A 2KZMA 4W5NA 4HUGA 3SPYA 3DLHA 1GOAA 1L3UA 1QHTA 2D0BA 3C6TA 3AA5X 4DSKA 1XC9A 1FK9A 3QERA 1L3VA 5FRMA 3P5JA 4DFPA 2HHWA 4Z4CA 1NK5A 4E0DA 4E3SA 3P83D 3LAKA 1KFDA 3KK1A 2Z1JA 3KKRA 4H4OA 4KHSA 1TK0A 3K59A 3TAFA 4CE9A 3AV9A 2WOMA 5I3UA 1EP4A 4FLZA 1S6QA 5C24A 3QINA 4H4MA 3LWMA 4CJEA 1JXEA 4AHCA 1NKCA 4DQQA 3ITHA 2YNHA 4CGDA 1HQEA 5KRTA 3ZCMA 4CJVA 1TKTA 5SZTA 3L8BA 3U3YA 3L2WA 1SKRA 2OA8A 2PZSA 4BE1A 3MEDA 4ELUA 1WAJA 3WNHA 4FLWA 2Q3SA 4GVMA 2FBYA 1KVAA 4CJ5A 1WLJA 4DLGA 4B9TA 4E89A 4DTPA 3KIOA 4M3RA 3HP6A 4FCYA 1RDBA 3AO5A 3U3GA 4DTJA 4MQ3A 1W9HA 3ZT1A 4CHPA 4CEOA 3OS0A 3LALA 5J1EA 4FM2A 5HROA 3TAPA 4CHZA 4ELVA 3ZSYA 4KHUA 2GBZA 2IC3A 3TAGA 1N6QA 1WSEA 3SV4A 1RT7A 5J2QA 3S3NA 2QKKA 4OKEA 3LDSA 3SYZA 4DSEA 3DMJA 4AHSA 1SL1A 4OKJA 1GOCA 3LANA 3MXMA 4FK4A 4HTUA 4CJQA 2FC0A 4CEFA 1S9EA 2XHBA 3F73A 3KTQA 1ZBLA 2EHGA 2ZE2A 3VQ6A 3QESA 3PV8A 2Z1GA 5EU7A 4M41A 2Y1JA 3HO1A 4O5BA 1Z26A 4CEAA 3LZJA 3PO5A 3NF8A 1BI4A 3MXJA 2X78A 1EKEA 1W0HA 4CF2A 4FLUA 2XY6A 4B9LA 4M3WA 3OS2A 4PA1A 2GUIA 3V1RA 1NJZA 3HPGA 3A2FA 2G8KA 4Z4EA 2Z1IA 1UA1A 4DS4A 2R7YA 3OYBA 3S3MA 4FJ7A 4K8XA 5K14A 3ISNC 3OYLA 1VSHA 3ALYA 3S9HA 2NUBA 3EYZA 4I9QA 3SQ0A 3SPZA 3M8SA 1NKBA 2G8VA 4KI6A 1XHZA 2OPSA 1T05A 4I9LA 3RRHA 1JKHA 2G8UA 3L2UA 1ASWA 1BQMA 3K58A 4FLVA 4F4KA 3AO2A 1VSEA 5CYQA 4W5OA 3WNEA 4Z4FA 3D45A 4ICLA 1D9FA 4DG1A 2HHXA 3T1AA 3RRGA 4DTRA 2JGUA 5C42A 4RW7A 3WNGA 2YNIA 1VSKA 4CF0A 3KKSA 3VQCA 2XY7A 3QEXA 3VA3A 1CZ9A 1JLCA 3OS1A 1S1XA 1J53A 2FBVA 3O4NA 1ASVA 3M8RA 3CQ8A 3ZT4A 2P5GA 5CZ2A 1VSLA 3TWHA 4G1QA 4RW6A 2DFFA 2RKIA 4JS4A 5FRNA 4DTMA 3V1QA 3VQBA 4AHRA 1TKDA 2G8HA 4DTOA 4CJUA 3QLHA 3TABA 3CFRA 3SI6A 1KFSA 4DTUA 4RW4A 1TL1A 1UAXA 2VG7A 1RT2A 3ZSRA 4E7LA 4BDZA 3AA4A 4N41A 3AVFA 1B92A 4KHWA 3V4IA 1HYVA 4OLAA 2E4LA 4YFUA 4EZ9A 4DSIA 3V9ZA 4HUEA 4DF8A 1HRHA 4W5QA 3CM5A 4CK3A 4C8KA 3O3GA 4EZ6A 4FK0A 3NH1A 4IKFA 4IBNA 3OY9A 4DQRA 1A5WA 1HJRA 2WONA 4N5SA 4CF9A 3VQAA 4HVJA 3IRXA 4CF8A 3NAEA 4FJXA 3O4QA 3CFOA 2YNGA 1REVA 2VG5A 4AHTA 3OYDA 2RN2A 3LWLA 1TK5A 4IFVA 1RCHA 2I5JA 4O0IA 3AVIA 2ITGA 2QKBA 4CEEA 4DSFA 4LY7A 4CGHA 4FLTA 4OPKA 4CJRA 3NH0A 3LP2A 3NGIA 4FVMA 3G10A 1SL0A 1A5XA 1J9AA 2A1RA 4KO0A 1LV5A 3DRPA 4CHOA 5CZ1A 1RT6A 1QSSA 3AVBA 5FROA 4O4GA 4N56A 3QIPA 4DFKA 4FJMA 1D8YA 1YT3A 1KLNA 1HNVA 3NFAA 3QEVA 3QNOA 1F21A 1L3TA 1JLFA 3F9KA 3ZT2A 3V9UA 3RWUA 2KZZA 4UQGA 1U4BA 3NCIA 2HNDA 1XHXA 4IDKA 4CEBA 1IG9A 3ZSVA 4E7JA 3V81A 1FXXA 2BE2A 1JLEA 1N5YA 2IAJA 4C8MA 4HUFA 3AVCA 3NGZA 4CF1A 1NKEA 4FJJA 1TAQA 1TV6A 4KFBA 5C25A 4OPJA 1RTDA 4OLBA 5HP1A 3M8QA 4CJKA 4QOZB 3TAMA 1KTQA 3KJVA 4BACA 3I8DA 3SUQA 2OYQA 2X6NA 4BWMA 4TSXA 1ZYQA 2OZSA 3QIOA 4CFBA 4CEDA 1U45A 1IKWA 3VQDA 3ZSWA 2F8SA 1A5VA 3QNNA 4J2BA 1WSJA 3DI6A 3AO1A 2RF2A 1UWBA 3NF9A 5J2PA 3TI0A 2D5RA 1BGXT 4O0JA 1FKOA 2HNYA 3DYAA 4L8RB 4MFBA 1C0TA 3HK2A 3TANA 3RMBA 2F8TA 3PX6A 1KCFA 2AJQA 4EP5A 4BDYA 4Z4GA 4DS5A 4B8CA 1EX4A 5JS2A 4FJHA 5J2MA 4FZXC 1NK0A 4DQIA 4OJRA 3DLGA 4OGCA 4NCGA 2YNFA 4LH4A 3NHGA 1SUQA 3DM2A 4KKOA 4IG0A 3VQ7A 2G8WA 1JLBA 3D0PA 4CCHA 4J2AA 3C6UA 3PY8A 4DQPA 1S6PA 3TR8A 4NCAA 4LSNA 4E7KA 1HYSA 2X6SA 3CFPA 1D9DA 5CYMA 3MEEA 2XY5A 4B9MA 1SV5A 1RT1A 1Y97A 4AHUA 4F3OA 3OYEA 4I2PA 2XO7A 1NK4A 1QE1A 4FJNA 2DFEA 1RILA 1J5OA 4B9NA 1LAVA 3MXIA 1VK0A 4AH9A 2BDPA 3VQEA 3B6PA 1X9SA 4ELTA 1RNHA 4ID1A 4NYNA 3SQ2A 4Z4HA 5HRNA 3ZSZA 4CJLA 3OYHA 4NCBA 4M42A 2BGGA 1EXQA 1LW2A 3AO4A 3NGYA 4ZHRA 2IOCA 1HNIA 4B08A 4FJLA 3AVJA 3SCXA 1O1WA 3OYCA 1NK9A 1WSGA 4E7HA 1RBTA 4E1NA 3DLBA 1VRUA 3KLEA 1FKPA 1DTTA 4CFCA 4HCCA 3NH2A 2E6LA 1SKSA 1VRTA 4F8RA 1RDCA 4J2EA 2LSNA 4C8LA 3ZT0A 1RDDA 3AVKA 3NF6A 1CZBA 3HYFA 3K5OA 3KK3A 1YTUA 3SUOA 3ZSOA 4FJGA 1RBUA 2JLEA 4DSJA 1Q9YA 3RMAA 3IS9A 4CHYA 2HW3A 3KLFA 4F3TA 4DF4A 3OYFA 3S3OA 4W5TA 2BANA 4CFDA 3C95A 1L5UA 1C0MA 3O3FA 3HT3A 3SUPA 2OZMA 1YTAA 4Q5VA 1TKXA 1VSFA 3ZT3A 4F2RA 2A1SA 4KHYA 4Q0BA 2B6AA 3PX4A 2DTUA 3OYGA 2VWJA 1BI4B 2HHQA 3K5LA 1X9WA 2G8FA 1U04A 4JLHA 2QXFA 4Z4IA 3KD1E 4PUOA 1S1UA 5KGWA 4CFAA 4CJFA 4PY5A 5HBMA 1I39A 1S1VA 4FLYA 3RR7A 5J2NA 4FJ8A 4B8AB 1IKXA 5SWMA 3OYJA 3IAYA 3PX0A 1HPZA 1J54A 3K2PA 4DFMA 1LWFA 1TVRA 1S1TA 3B6OA 4BWJA 3SQ1A 4FJ5A 1IH7A 4M3UA 1KVBA 4KHQA 4O44A 3ASMA 4GMJB 3HP9A 1LWEA 2O4IA 2PYJA 3LP0A 1S1WA 1NJWA 3L3VA 2ATQA 4B9VA 4B3OA 2IDOA 3LPUA 4FM0A 3HPOA 4K8ZA 3U6FA 2Y1IA 4QCLA 5CY4A 3WNFA 2QK9A 3O3HA 3K5MA 3DLKA 3PUFA 5E41A 4ZTFA 1EETA 3EZ5A 4DLEA 4CJPA 3QETA 3V9XA 3BDPA 4N47A 1B9DA 1C1AA 4KREA 1RBSA 4CJ3A 4M3YA 3AVGA 1T7PA 3ZSXA 1WSHA 2P5OA 3JSMA 3LPTA 3AA3A 1TL3A 1VSIA 4CK2A 4DSLA 3QEWA 1RTHA 5KGXA 4FK2A 4KHNA 3QEIA 1IKYA 3HVTA 1QSLA 5KI6A 4CGIA 1I3AA 5FDLA 1ITGA 4KPYA 4FLXA 1XI1A 4I2QA 4HHTA 3SV3A 4DQSA 2E6MA 1YVUA 3LAMA 4CJWA 4FZZA 2D0AA 3MECA 3L2QA 1TK8A 1BIUA 1WSIA 2KFZA 2IS3A 4CERA 2PYLA 1L3SA 1QSYA 3VA0A 4CEQA 1RBRA 4FJIA 2OPQA 1X9MA 1VSDA 4OKKA 3SJJA 1U47A 3RR8A 4M3TA 2XY8A 3E01A 1JL1A 2HHVA 3LZIA 4KAZA 3G0ZA 3K5NA 4EP4A 3HSTB 2VG6A 1G15A 4XIUA 2X74A 5T7BA 4CECA 2DFHA 1CXQA 3M8PA 3SQ4A 2ETJA 1WNSA 1ASUA 1RT3A 1BCOA 5HRPA 4JS5A 5HLFA 4N76A 3MEGA 3NF7A 3VQPA 2HVIA 2IGIA 5HRRA 1X1PA 2HVHA 3DOKA 3T3FA 4C8OA 2D0CA 3BGRA 4CJ4A 1HQUA 2OPPA 4QAGA 1HYZA 2HB5A 3DLEA 4GW6A 4CHNA 3SZ2A 1R0AA 3TARA 4HCBA 4KI4A 2O4GA 2P51A 2YV0X 3UIQA 3KLIA 2W42A 3HPHA 1T03A 3C94A 1C6VA 3DRSA 1JLQA 5DMRA 2F96A 1NJYA 3K57A 3SNNA 4LSLA 3MAQA 4Z0UA 3RMCA 4ZTJA 2ZQBA 3CYMA 1RDAA 4FW1A 3OYIA 5D3GA 5DK5A 5JS1A 4KTQA 4DU1A 4FYDA 3QO9A 4CK1A 3DOLA 1GOBA 2PY5A 1WAFA 4CGGA 1KVCA 3L3UA 3CM6A 4LH5A 4KB0A 2DY4A 2HHTA 4OGEA 4LD0A 3VQ9A 3AVLA 3L2VA 5I42A 1MU2A 1VSMA 1WSFA 3P1GA 4CJTA 3RMDA 4DU3A 4CEZA 4KB1A 1ZBIA 1S9GA 4KTWA 4J2DA 1QTMA 4DTSA 4M3XA 3AVMA 4FW2A 3KLHA 1DTQA 3OJSA 1JLGA 4AHVA 2YHBA 2FBTA 3OYAA 4CJSA 1NK7A 3AVAA 4W5RA 4AILC 3PO4A 1LW0A 4B9SA 1BIZA 1SL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXM A;  1JL2 A;  1DLO A;  3KD5 E;  1TKZ A;  3AVH A;  1NOZ A;  2OPR A;  4KV8 A;  4FJ9 A;  3VN5 A;  1BQN A;  4CIG A;  1ZBF A;  4C8N A;  5KRS A;  1LWC A;  2B5J A;  1ZBU A;  3V1O A;  4E1M A;  1NK6 A;  3FFI A;  2XRI A;  1RTJ A;  1RT5 A;  1B9F A;  3LP1 A;  1QS4 A;  3ULD A;  1NK8 A;  4FJK A;  2G8I A;  3VQ4 A;  4FM1 A;  4BE0 A;  4DTX A;  1BCM A;  4RW9 A;  3TAQ A;  1NJX A;  3IG1 A;  1KSP A;  4CGF A;  3V9S A;  3NBP A;  2P1J A;  4PWD A;  4DU4 A;  1RTI A;  4ID5 A;  3V9W A;  3DRR A;  3I0S A;  2YHA A;  4E7I A;  1BIS A;  1KRP A;  3VQ5 A;  1CXU A;  3VQ8 A;  1BL3 A;  4FXD A;  5HRS A;  4JRQ A;  4PQU A;  1BHL A;  3I0R A;  3AO3 A;  4FZY A;  2FBX A;  4WE1 A;  2KFN A;  2HNZ A;  1JXB A;  3VQQ A;  1UA0 A;  4M3Z A;  4KRF A;  2HHS A;  3H08 A;  3CG7 A;  2KTQ A;  1C0U A;  4IFY A;  1CLQ A;  1QQC A;  4DMN A;  4I7F A;  4O55 A;  2KQ2 A;  3OJU A;  1C1B A;  1KLM A;  4CIF A;  3NDK A;  4CES A;  3NE6 A;  1U49 A;  1Z25 A;  4DTN A;  1Q9X A;  1K6Y A;  3JYT A;  3HL8 A;  1RT4 A;  1WN7 A;  4E19 A;  3AA2 A;  4YNQ A;  4B9U A;  1UOC A;  4H8K A;  4M45 A;  1LAW A;  3KK2 A;  4CIE A;  4R5P A;  3OYM A;  1RBV A;  1VSJ A;  3AVN A;  1XWL A;  3OVN A;  3HVR A;  3HM9 A;  1T8E A;  1SKW A;  1TGO A;  1Q8I A;  2KW4 A;  4KTZ A;  2EX3 A;  4CGJ A;  3QEP A;  3DLR A;  3EY1 A;  2Z1H A;  3HJF A;  1S5J A;  3ZSQ A;  2HMI A;  4RW8 A;  4Y1C A;  1U48 A;  4RG8 A;  1TAU A;  3L2R A;  2ZD1 A;  2RPI A;  4CHQ A;  3TAE A;  1IKV A;  1C1C A;  2B4J A;  4F2S A;  4BDP A;  1JLA A;  1ZBH A;  1IO2 A;  2GV9 A;  2YKN A;  3LP3 A;  4IG3 A;  4OVL A;  3OYN A;  3OYK A;  1HMV A;  4Y1D A;  4DWI A;  1NOY A;  3KLG A;  3V6D A;  3RTV A;  3T19 A;  3SUN A;  1D5A A;  4JRP A;  5KTQ A;  2YKM A;  4NYF A;  2VWK A;  4DFJ A;  3THV A;  2HHU A;  4BE2 A;  2KZM A;  4W5N A;  4HUG A;  3SPY A;  3DLH A;  1GOA A;  1L3U A;  1QHT A;  2D0B A;  3C6T A;  3AA5 X;  4DSK A;  1XC9 A;  1FK9 A;  3QER A;  1L3V A;  5FRM A;  3P5J A;  4DFP A;  2HHW A;  4Z4C A;  1NK5 A;  4E0D A;  4E3S A;  3P83 D;  3LAK A;  1KFD A;  3KK1 A;  2Z1J A;  3KKR A;  4H4O A;  4KHS A;  1TK0 A;  3K59 A;  3TAF A;  4CE9 A;  3AV9 A;  2WOM A;  5I3U A;  1EP4 A;  4FLZ A;  1S6Q A;  5C24 A;  3QIN A;  4H4M A;  3LWM A;  4CJE A;  1JXE A;  4AHC A;  1NKC A;  4DQQ A;  3ITH A;  2YNH A;  4CGD A;  1HQE A;  5KRT A;  3ZCM A;  4CJV A;  1TKT A;  5SZT A;  3L8B A;  3U3Y A;  3L2W A;  1SKR A;  2OA8 A;  2PZS A;  4BE1 A;  3MED A;  4ELU A;  1WAJ A;  3WNH A;  4FLW A;  2Q3S A;  4GVM A;  2FBY A;  1KVA A;  4CJ5 A;  1WLJ A;  4DLG A;  4B9T A;  4E89 A;  4DTP A;  3KIO A;  4M3R A;  3HP6 A;  4FCY A;  1RDB A;  3AO5 A;  3U3G A;  4DTJ A;  4MQ3 A;  1W9H A;  3ZT1 A;  4CHP A;  4CEO A;  3OS0 A;  3LAL A;  5J1E A;  4FM2 A;  5HRO A;  3TAP A;  4CHZ A;  4ELV A;  3ZSY A;  4KHU A;  2GBZ A;  2IC3 A;  3TAG A;  1N6Q A;  1WSE A;  3SV4 A;  1RT7 A;  5J2Q A;  3S3N A;  2QKK A;  4OKE A;  3LDS A;  3SYZ A;  4DSE A;  3DMJ A;  4AHS A;  1SL1 A;  4OKJ A;  1GOC A;  3LAN A;  3MXM A;  4FK4 A;  4HTU A;  4CJQ A;  2FC0 A;  4CEF A;  1S9E A;  2XHB A;  3F73 A;  3KTQ A;  1ZBL A;  2EHG A;  2ZE2 A;  3VQ6 A;  3QES A;  3PV8 A;  2Z1G A;  5EU7 A;  4M41 A;  2Y1J A;  3HO1 A;  4O5B A;  1Z26 A;  4CEA A;  3LZJ A;  3PO5 A;  3NF8 A;  1BI4 A;  3MXJ A;  2X78 A;  1EKE A;  1W0H A;  4CF2 A;  4FLU A;  2XY6 A;  4B9L A;  4M3W A;  3OS2 A;  4PA1 A;  2GUI A;  3V1R A;  1NJZ A;  3HPG A;  3A2F A;  2G8K A;  4Z4E A;  2Z1I A;  1UA1 A;  4DS4 A;  2R7Y A;  3OYB A;  3S3M A;  4FJ7 A;  4K8X A;  5K14 A;  3ISN C;  3OYL A;  1VSH A;  3ALY A;  3S9H A;  2NUB A;  3EYZ A;  4I9Q A;  3SQ0 A;  3SPZ A;  3M8S A;  1NKB A;  2G8V A;  4KI6 A;  1XHZ A;  2OPS A;  1T05 A;  4I9L A;  3RRH A;  1JKH A;  2G8U A;  3L2U A;  1ASW A;  1BQM A;  3K58 A;  4FLV A;  4F4K A;  3AO2 A;  1VSE A;  5CYQ A;  4W5O A;  3WNE A;  4Z4F A;  3D45 A;  4ICL A;  1D9F A;  4DG1 A;  2HHX A;  3T1A A;  3RRG A;  4DTR A;  2JGU A;  5C42 A;  4RW7 A;  3WNG A;  2YNI A;  1VSK A;  4CF0 A;  3KKS A;  3VQC A;  2XY7 A;  3QEX A;  3VA3 A;  1CZ9 A;  1JLC A;  3OS1 A;  1S1X A;  1J53 A;  2FBV A;  3O4N A;  1ASV A;  3M8R A;  3CQ8 A;  3ZT4 A;  2P5G A;  5CZ2 A;  1VSL A;  3TWH A;  4G1Q A;  4RW6 A;  2DFF A;  2RKI A;  4JS4 A;  5FRN A;  4DTM A;  3V1Q A;  3VQB A;  4AHR A;  1TKD A;  2G8H A;  4DTO A;  4CJU A;  3QLH A;  3TAB A;  3CFR A;  3SI6 A;  1KFS A;  4DTU A;  4RW4 A;  1TL1 A;  1UAX A;  2VG7 A;  1RT2 A;  3ZSR A;  4E7L A;  4BDZ A;  3AA4 A;  4N41 A;  3AVF A;  1B92 A;  4KHW A;  3V4I A;  1HYV A;  4OLA A;  2E4L A;  4YFU A;  4EZ9 A;  4DSI A;  3V9Z A;  4HUE A;  4DF8 A;  1HRH A;  4W5Q A;  3CM5 A;  4CK3 A;  4C8K A;  3O3G A;  4EZ6 A;  4FK0 A;  3NH1 A;  4IKF A;  4IBN A;  3OY9 A;  4DQR A;  1A5W A;  1HJR A;  2WON A;  4N5S A;  4CF9 A;  3VQA A;  4HVJ A;  3IRX A;  4CF8 A;  3NAE A;  4FJX A;  3O4Q A;  3CFO A;  2YNG A;  1REV A;  2VG5 A;  4AHT A;  3OYD A;  2RN2 A;  3LWL A;  1TK5 A;  4IFV A;  1RCH A;  2I5J A;  4O0I A;  3AVI A;  2ITG A;  2QKB A;  4CEE A;  4DSF A;  4LY7 A;  4CGH A;  4FLT A;  4OPK A;  4CJR A;  3NH0 A;  3LP2 A;  3NGI A;  4FVM A;  3G10 A;  1SL0 A;  1A5X A;  1J9A A;  2A1R A;  4KO0 A;  1LV5 A;  3DRP A;  4CHO A;  5CZ1 A;  1RT6 A;  1QSS A;  3AVB A;  5FRO A;  4O4G A;  4N56 A;  3QIP A;  4DFK A;  4FJM A;  1D8Y A;  1YT3 A;  1KLN A;  1HNV A;  3NFA A;  3QEV A;  3QNO A;  1F21 A;  1L3T A;  1JLF A;  3F9K A;  3ZT2 A;  3V9U A;  3RWU A;  2KZZ A;  4UQG A;  1U4B A;  3NCI A;  2HND A;  1XHX A;  4IDK A;  4CEB A;  1IG9 A;  3ZSV A;  4E7J A;  3V81 A;  1FXX A;  2BE2 A;  1JLE A;  1N5Y A;  2IAJ A;  4C8M A;  4HUF A;  3AVC A;  3NGZ A;  4CF1 A;  1NKE A;  4FJJ A;  1TAQ A;  1TV6 A;  4KFB A;  5C25 A;  4OPJ A;  1RTD A;  4OLB A;  5HP1 A;  3M8Q A;  4CJK A;  4QOZ B;  3TAM A;  1KTQ A;  3KJV A;  4BAC A;  3I8D A;  3SUQ A;  2OYQ A;  2X6N A;  4BWM A;  4TSX A;  1ZYQ A;  2OZS A;  3QIO A;  4CFB A;  4CED A;  1U45 A;  1IKW A;  3VQD A;  3ZSW A;  2F8S A;  1A5V A;  3QNN A;  4J2B A;  1WSJ A;  3DI6 A;  3AO1 A;  2RF2 A;  1UWB A;  3NF9 A;  5J2P A;  3TI0 A;  2D5R A;  1BGX T;  4O0J A;  1FKO A;  2HNY A;  3DYA A;  4L8R B;  4MFB A;  1C0T A;  3HK2 A;  3TAN A;  3RMB A;  2F8T A;  3PX6 A;  1KCF A;  2AJQ A;  4EP5 A;  4BDY A;  4Z4G A;  4DS5 A;  4B8C A;  1EX4 A;  5JS2 A;  4FJH A;  5J2M A;  4FZX C;  1NK0 A;  4DQI A;  4OJR A;  3DLG A;  4OGC A;  4NCG A;  2YNF A;  4LH4 A;  3NHG A;  1SUQ A;  3DM2 A;  4KKO A;  4IG0 A;  3VQ7 A;  2G8W A;  1JLB A;  3D0P A;  4CCH A;  4J2A A;  3C6U A;  3PY8 A;  4DQP A;  1S6P A;  3TR8 A;  4NCA A;  4LSN A;  4E7K A;  1HYS A;  2X6S A;  3CFP A;  1D9D A;  5CYM A;  3MEE A;  2XY5 A;  4B9M A;  1SV5 A;  1RT1 A;  1Y97 A;  4AHU A;  4F3O A;  3OYE A;  4I2P A;  2XO7 A;  1NK4 A;  1QE1 A;  4FJN A;  2DFE A;  1RIL A;  1J5O A;  4B9N A;  1LAV A;  3MXI A;  1VK0 A;  4AH9 A;  2BDP A;  3VQE A;  3B6P A;  1X9S A;  4ELT A;  1RNH A;  4ID1 A;  4NYN A;  3SQ2 A;  4Z4H A;  5HRN A;  3ZSZ A;  4CJL A;  3OYH A;  4NCB A;  4M42 A;  2BGG A;  1EXQ A;  1LW2 A;  3AO4 A;  3NGY A;  4ZHR A;  2IOC A;  1HNI A;  4B08 A;  4FJL A;  3AVJ A;  3SCX A;  1O1W A;  3OYC A;  1NK9 A;  1WSG A;  4E7H A;  1RBT A;  4E1N A;  3DLB A;  1VRU A;  3KLE A;  1FKP A;  1DTT A;  4CFC A;  4HCC A;  3NH2 A;  2E6L A;  1SKS A;  1VRT A;  4F8R A;  1RDC A;  4J2E A;  2LSN A;  4C8L A;  3ZT0 A;  1RDD A;  3AVK A;  3NF6 A;  1CZB A;  3HYF A;  3K5O A;  3KK3 A;  1YTU A;  3SUO A;  3ZSO A;  4FJG A;  1RBU A;  2JLE A;  4DSJ A;  1Q9Y A;  3RMA A;  3IS9 A;  4CHY A;  2HW3 A;  3KLF A;  4F3T A;  4DF4 A;  3OYF A;  3S3O A;  4W5T A;  2BAN A;  4CFD A;  3C95 A;  1L5U A;  1C0M A;  3O3F A;  3HT3 A;  3SUP A;  2OZM A;  1YTA A;  4Q5V A;  1TKX A;  1VSF A;  3ZT3 A;  4F2R A;  2A1S A;  4KHY A;  4Q0B A;  2B6A A;  3PX4 A;  2DTU A;  3OYG A;  2VWJ A;  1BI4 B;  2HHQ A;  3K5L A;  1X9W A;  2G8F A;  1U04 A;  4JLH A;  2QXF A;  4Z4I A;  3KD1 E;  4PUO A;  1S1U A;  5KGW A;  4CFA A;  4CJF A;  4PY5 A;  5HBM A;  1I39 A;  1S1V A;  4FLY A;  3RR7 A;  5J2N A;  4FJ8 A;  4B8A B;  1IKX A;  5SWM A;  3OYJ A;  3IAY A;  3PX0 A;  1HPZ A;  1J54 A;  3K2P A;  4DFM A;  1LWF A;  1TVR A;  1S1T A;  3B6O A;  4BWJ A;  3SQ1 A;  4FJ5 A;  1IH7 A;  4M3U A;  1KVB A;  4KHQ A;  4O44 A;  3ASM A;  4GMJ B;  3HP9 A;  1LWE A;  2O4I A;  2PYJ A;  3LP0 A;  1S1W A;  1NJW A;  3L3V A;  2ATQ A;  4B9V A;  4B3O A;  2IDO A;  3LPU A;  4FM0 A;  3HPO A;  4K8Z A;  3U6F A;  2Y1I A;  4QCL A;  5CY4 A;  3WNF A;  2QK9 A;  3O3H A;  3K5M A;  3DLK A;  3PUF A;  5E41 A;  4ZTF A;  1EET A;  3EZ5 A;  4DLE A;  4CJP A;  3QET A;  3V9X A;  3BDP A;  4N47 A;  1B9D A;  1C1A A;  4KRE A;  1RBS A;  4CJ3 A;  4M3Y A;  3AVG A;  1T7P A;  3ZSX A;  1WSH A;  2P5O A;  3JSM A;  3LPT A;  3AA3 A;  1TL3 A;  1VSI A;  4CK2 A;  4DSL A;  3QEW A;  1RTH A;  5KGX A;  4FK2 A;  4KHN A;  3QEI A;  1IKY A;  3HVT A;  1QSL A;  5KI6 A;  4CGI A;  1I3A A;  5FDL A;  1ITG A;  4KPY A;  4FLX A;  1XI1 A;  4I2Q A;  4HHT A;  3SV3 A;  4DQS A;  2E6M A;  1YVU A;  3LAM A;  4CJW A;  4FZZ A;  2D0A A;  3MEC A;  3L2Q A;  1TK8 A;  1BIU A;  1WSI A;  2KFZ A;  2IS3 A;  4CER A;  2PYL A;  1L3S A;  1QSY A;  3VA0 A;  4CEQ A;  1RBR A;  4FJI A;  2OPQ A;  1X9M A;  1VSD A;  4OKK A;  3SJJ A;  1U47 A;  3RR8 A;  4M3T A;  2XY8 A;  3E01 A;  1JL1 A;  2HHV A;  3LZI A;  4KAZ A;  3G0Z A;  3K5N A;  4EP4 A;  3HST B;  2VG6 A;  1G15 A;  4XIU A;  2X74 A;  5T7B A;  4CEC A;  2DFH A;  1CXQ A;  3M8P A;  3SQ4 A;  2ETJ A;  1WNS A;  1ASU A;  1RT3 A;  1BCO A;  5HRP A;  4JS5 A;  5HLF A;  4N76 A;  3MEG A;  3NF7 A;  3VQP A;  2HVI A;  2IGI A;  5HRR A;  1X1P A;  2HVH A;  3DOK A;  3T3F A;  4C8O A;  2D0C A;  3BGR A;  4CJ4 A;  1HQU A;  2OPP A;  4QAG A;  1HYZ A;  2HB5 A;  3DLE A;  4GW6 A;  4CHN A;  3SZ2 A;  1R0A A;  3TAR A;  4HCB A;  4KI4 A;  2O4G A;  2P51 A;  2YV0 X;  3UIQ A;  3KLI A;  2W42 A;  3HPH A;  1T03 A;  3C94 A;  1C6V A;  3DRS A;  1JLQ A;  5DMR A;  2F96 A;  1NJY A;  3K57 A;  3SNN A;  4LSL A;  3MAQ A;  4Z0U A;  3RMC A;  4ZTJ A;  2ZQB A;  3CYM A;  1RDA A;  4FW1 A;  3OYI A;  5D3G A;  5DK5 A;  5JS1 A;  4KTQ A;  4DU1 A;  4FYD A;  3QO9 A;  4CK1 A;  3DOL A;  1GOB A;  2PY5 A;  1WAF A;  4CGG A;  1KVC A;  3L3U A;  3CM6 A;  4LH5 A;  4KB0 A;  2DY4 A;  2HHT A;  4OGE A;  4LD0 A;  3VQ9 A;  3AVL A;  3L2V A;  5I42 A;  1MU2 A;  1VSM A;  1WSF A;  3P1G A;  4CJT A;  3RMD A;  4DU3 A;  4CEZ A;  4KB1 A;  1ZBI A;  1S9G A;  4KTW A;  4J2D A;  1QTM A;  4DTS A;  4M3X A;  3AVM A;  4FW2 A;  3KLH A;  1DTQ A;  3OJS A;  1JLG A;  4AHV A;  2YHB A;  2FBT A;  3OYA A;  4CJS A;  1NK7 A;  3AVA A;  4W5R A;  4AIL C;  3PO4 A;  1LW0 A;  4B9S A;  1BIZ A;  1SL2 A; 
#chains in the Genus database with same CATH topology
 1JL2 A;  1QQO A;  3VGL A;  3ZYY X;  4FJ9 A;  3BY5 A;  3H6E A;  3DWL A;  3J7A P;  3VF4 A;  3MN5 A;  3V1O A;  3H3N O;  4BRF A;  4FM1 A;  5TKY A;  3H46 O;  4BE0 A;  4A59 A;  1BCM A;  3RSE A;  4A5A A;  3THW A;  3NBP A;  4DU4 A;  1RTI A;  5EX5 A;  3V9W A;  4E7I A;  1KRP A;  4IOC L;  3MDQ A;  3P38 A;  3VQ8 A;  3C6A A;  1BL3 A;  1NGE A;  1BHL A;  5KPR A;  4H0Y B;  3A5L C;  1Q86 O;  3O9T A;  3OW2 M;  1QQN A;  3C7N B;  1UA0 A;  2ZGZ A;  2HHS A;  2P9P A;  1C0U A;  1CLQ A;  3KK7 A;  2FLO A;  3NDK A;  1W2B M;  1U49 A;  4DTN A;  3CC4 N;  4HWI A;  3AA2 A;  3TU5 A;  4YNQ A;  3SMP A;  1XWL A;  3OVN A;  4J2A A;  2HHT A;  1TGO A;  2O8B A;  4KTZ A;  5HL7 L;  3DLR A;  3EY1 A;  3ATU A;  4BGB A;  3TAE A;  1IKV A;  1C1C A;  5AR0 A;  4C1N K;  4FWS A;  4CZG A;  4HTL A;  1ILY A;  2GV9 A;  3EKS A;  2QA4 N;  4DUZ K;  4BQL A;  4BE2 A;  4HUG A;  2D0B A;  1VQ5 N;  4H5T A;  1VQM N;  5FRM A;  2GWJ A;  4E0D A;  1NGG A;  3CME N;  1P90 A;  5C24 A;  3QIN A;  4H4M A;  4AHC A;  3H3O B;  4CGD A;  2OTJ N;  3VPZ A;  3U3Y A;  3L8B A;  4BE1 A;  1WAJ A;  4FLW A;  2FBY A;  3W3D A;  3VOV A;  4M3R A;  2WBN A;  3HP6 A;  1RDB A;  4DTJ A;  1W9H A;  4CHP A;  4CEO A;  1ESV A;  3LAL A;  4ISF A;  2GBZ A;  1N6Q A;  4J8F A;  3S3N A;  2QKK A;  3ENH A;  3C0B A;  1OVY A;  4OKJ A;  1GOC A;  4EFH A;  2FC0 A;  4CEF A;  2VQF K;  1NGA A;  2XHB A;  3ENO A;  3A0I X;  4M41 A;  4JD2 B;  5BPN A;  3AGR A;  3MXJ A;  2X78 A;  4CF2 A;  4FLU A;  4X64 K;  3WXJ A;  4PA1 A;  3GBT A;  2GUI A;  3V1R A;  1GLJ O;  4Z4E A;  4BRQ A;  3QBW A;  3E9O A;  4X65 K;  3OYB A;  3CQY A;  3O5B A;  2ITM A;  3EE9 A;  4FWL A;  3ALY A;  3S9H A;  4FPA A;  4LF8 K;  4I9Q A;  3KWG A;  2QWN A;  3FGU A;  1BQM A;  5E26 A;  2P9K A;  4F4K A;  5CYQ A;  1VSE A;  1FJG K;  3BF1 A;  4ICL A;  1BG3 A;  2HHX A;  2JGU A;  1VSK A;  2XY7 A;  3VQC A;  4PKI A;  4CBU A;  1CZ9 A;  2NRX A;  3O1B A;  2FBV A;  1VSL A;  4JS4 A;  2RKI A;  4DTM A;  3V1Q A;  4JI1 K;  2G8H A;  4YOU A;  4CJU A;  5JMV A;  4RW4 A;  4E7L A;  4BDZ A;  3ZET A;  2A6A A;  1VHX A;  3A5M C;  3JAM O;  4IEE A;  3VEY A;  4B9Q A;  1KAX A;  2JWK A;  4C8K A;  4IKF A;  5CHI A;  4BG9 A;  2D4W A;  2UUB K;  3D7E O;  1U2V B;  3K9K A;  4JI5 K;  3OYD A;  3ULE A;  5GAD P;  4LFA K;  4BRE A;  5AQM A;  1RCH A;  1M90 O;  4O0I A;  4O5F A;  2ITG A;  1NGD A;  4CGH A;  1LOT B;  4H0O A;  4CJR A;  3NGI A;  4FVM A;  4O8K A;  4A57 A;  4CHO A;  1QSS A;  3AVB A;  4N56 A;  5M1Q A;  5AJ3 K;  1YT3 A;  1KLN A;  1JLF A;  2KKZ A;  3NCI A;  2HND A;  4CEB A;  1GLA G;  3ZSV A;  1DEJ A;  2ZJP L;  1MWM A;  3THY B;  2BE2 A;  1BU6 O;  1SAZ A;  1YJW N;  2E1Z A;  4JEP A;  4CF1 A;  1NKE A;  5GAH P;  1TV6 A;  4ILG B;  3CCL N;  1RTD A;  1SQK A;  1KTQ A;  4BAC A;  3UE5 A;  4BG8 A;  3QIO A;  4CFB A;  4CED A;  2UXB K;  3VQD A;  4Z94 A;  1A5V A;  2WC9 A;  2BH1 A;  3TI0 A;  2D5R A;  1FKO A;  1DKG D;  4V19 S;  1BWF O;  3RMB A;  1T6D A;  3CCM N;  4DS5 A;  1OVQ A;  4DQI A;  4OJR A;  4NCG A;  3BEX A;  3NHG A;  4DV0 K;  4KKO A;  1JLB A;  3D0P A;  1S6P A;  4NCA A;  3WXK A;  4AM6 A;  2HBM A;  5CYM A;  2XY5 A;  1RT1 A;  3SAH A;  4B9N A;  1KAZ A;  1X9S A;  4FWO A;  1W7A A;  1RNH A;  1NGH A;  5AZJ B;  4ID1 A;  2P9U A;  4FWM A;  3C7N A;  1OKJ A;  4MDA A;  1HNI A;  4X66 K;  3AVJ A;  3SCX A;  1O1W A;  3A8Y A;  1HJO A;  3N4P A;  1DTT A;  4CFC A;  3MCA B;  4FPB A;  4IOX A;  4C8L A;  3TTF A;  5AQT A;  3AVK A;  5A2Q O;  4BC4 A;  5JIC A;  3SJH A;  5B8H A;  3IS9 A;  3D2F A;  3R6M A;  4NLC A;  1JJ2 M;  3CHW A;  4F9O A;  4W5T A;  1DGK N;  4CFD A;  5M1N A;  3HT3 A;  2ZJQ L;  3CET A;  1TKX A;  3ZT3 A;  2A1S A;  3PX4 A;  2VWJ A;  5LJW A;  2ASP A;  2DPN A;  2Q0R A;  1NMN A;  1U04 A;  4Z4I A;  2QXF A;  4M63 C;  1S1U A;  1O13 A;  4CJF A;  1OH8 A;  4FLY A;  1S1V A;  4IEI A;  3IAY A;  3O1W A;  3K2P A;  4ISG A;  4M3U A;  3D2E B;  4O44 A;  1MDU B;  1Q82 O;  4GMJ B;  5IWA K;  4JK7 A;  3L3V A;  2IDO A;  3LPU A;  3HPO A;  4YDU A;  3U6F A;  4CD3 A;  2QK9 A;  3PUF A;  1NLV A;  4WF9 L;  3QET A;  1B9D A;  1NJI O;  4OX9 K;  2P5O A;  3AA3 A;  1VSI A;  4CK2 A;  3QEW A;  2IVP A;  3QEI A;  5KI6 A;  1I3A A;  5FDL A;  4B1U B;  3O4W A;  3C65 A;  4I2Q A;  2D0P A;  3GL1 A;  5LJV A;  4JD2 A;  1TK8 A;  4GKK K;  5FPD A;  3EN9 A;  3O9U A;  1GLF O;  5AQV A;  4NB4 A;  3VEZ A;  2A40 A;  4OKK A;  3MWP A;  2HHV A;  3G0Z A;  3K5N A;  2VG6 A;  3QML A;  4XIU A;  2W40 A;  5T7B A;  4CEC A;  4DR2 K;  3DLL L;  1WNS A;  1ASU A;  3VQP A;  2HVI A;  4YOY A;  3DOK A;  2YJF A;  4CJ4 A;  4QAG A;  1C0G A;  4JKC A;  1R0A A;  4XEI A;  3WEE A;  4IOA L;  3HPH A;  4GNI A;  3C94 A;  4WYB A;  3DRS A;  3MAQ A;  4Z0U A;  1XUP O;  5AQK A;  1N36 K;  1RDA A;  1Z6R A;  4PL8 A;  4DU1 A;  4FYD A;  2ASO A;  3QO9 A;  3T69 A;  3L3U A;  3GE1 A;  1NNE A;  4YOR A;  4CBW A;  3L2V A;  5I42 A;  4K0K K;  3RMD A;  5GIN A;  4DU3 A;  3ZX3 A;  1S9G A;  2A41 A;  4DTS A;  4M3X A;  4FOE A;  1OH5 A;  3FFK B;  5LL6 Z;  3OJS A;  1JLG A;  4CW7 B;  3VGM A;  4AIL C;  3VER A;  3G71 N;  4JKD A;  5KQ8 A;  3FZF A;  4JKG B;  2NRV A;  2OPR A;  3VTI A;  3L6Q A;  1BQN A;  4DV2 K;  1N34 K;  2HBK A;  1ZBF A;  4C8N A;  3ZLJ A;  2B5J A;  2O8C B;  3FFI A;  4IZ9 A;  1RTJ A;  1RT5 A;  2UXD K;  1NK8 A;  3SBG A;  2RE2 A;  4QS7 A;  1NJX A;  4CGF A;  3V9S A;  2P1J A;  1EWR A;  3BZK A;  2VYP A;  3CMA N;  3AAP A;  3VQ5 A;  1CXU A;  3CJB A;  4KH4 A;  4PQU A;  3THY A;  3I0R A;  1JCG A;  5C15 A;  4JI3 K;  2YHW A;  3J7Y P;  3OTO K;  3KVG A;  4WFB L;  2FF6 A;  4H0P A;  4I7F A;  3OJU A;  4CES A;  3NE6 A;  1Z25 A;  1RT4 A;  4E19 A;  4M45 A;  1WOQ A;  1X3N A;  4CIE A;  4BC5 A;  3OYM A;  4RTF D;  3AVN A;  3FZM A;  4BRH A;  3HVR A;  3HOT A;  4H03 B;  3EKU A;  3WQT A;  3L2R A;  5AQZ A;  2ZD1 A;  2RPI A;  4JV5 K;  3WXL A;  4PKG A;  4XH1 A;  3LP3 A;  4RWT A;  4Y1D A;  1NOY A;  3T19 A;  1IBL K;  1D5A A;  5KTQ A;  4NYF A;  4DFJ A;  1YIJ N;  3THV A;  3DLH A;  2V52 B;  3CQX A;  4CZE A;  1QHT A;  4DSK A;  5GIO A;  1FK9 A;  2F4V K;  4FOI A;  1J5E K;  4BRM A;  4EHU A;  2EWS A;  3O80 A;  4DR4 K;  3HI0 A;  4CE9 A;  5I3U A;  1EP4 A;  4FLZ A;  1S6Q A;  5JLH A;  4DV4 K;  1HQE A;  4PY5 A;  2PZS A;  4JKH A;  4EIA A;  2FF3 B;  3WNH A;  4DLG A;  4E89 A;  1V4T A;  3KIO A;  4FVU A;  3AO5 A;  3M1F A;  3KHY A;  4FL9 A;  3OS0 A;  5J1E A;  4H0X B;  3TAP A;  4ELV A;  1C0F A;  5AQY A;  2IC3 A;  3O08 A;  3SV4 A;  2VGM A;  4B3R K;  3LDS A;  2I7N A;  4FK4 A;  3MXM A;  4CJQ A;  1QZ5 A;  3I55 N;  4K42 A;  3F73 A;  3K0S A;  1Q7Y O;  1N32 K;  1ZBL A;  2O8E A;  1D4X A;  3LZJ A;  4CEA A;  4BRC A;  2E2O A;  4PHT X;  3A2F A;  4BC3 A;  2G8K A;  1NG9 A;  4K8X A;  4LF7 K;  3ISN C;  1OH6 A;  4WFN L;  2UUA K;  2HBL A;  3D2E A;  4JK9 A;  1TUU A;  3SPZ A;  1NKB A;  3JXU A;  1M1K O;  3WT0 A;  3P4I A;  1JKH A;  1ASW A;  1FW6 A;  1TYQ B;  3MK6 A;  3WNE A;  3D45 A;  1D9F A;  3RRG A;  5GAG P;  3AGK A;  5C42 A;  2QEX N;  4AF1 A;  3O9R A;  3VA3 A;  1XNR K;  1JLC A;  1S1X A;  3IFR A;  4MO5 A;  1ASV A;  2IIR A;  3TWH A;  4RW6 A;  5FRN A;  2DFF A;  3NMU A;  3PIP L;  3DJC A;  5AQS A;  3QLH A;  3SI6 A;  1RT2 A;  3ZSR A;  3VEV A;  4U67 L;  4N41 A;  4JI7 K;  3V4I A;  4YFU A;  3V9Z A;  4BRP A;  4YOV A;  4DV1 K;  4HUE A;  5CR4 A;  1NGC A;  3CM5 A;  4CK3 A;  3NVM A;  5AQQ A;  1KQS M;  4FK0 A;  4MO4 A;  4IBN A;  3OY9 A;  1A5W A;  1HJR A;  4BRK A;  4CF9 A;  3IRX A;  4CF8 A;  3FZL A;  3O4Q A;  2D0O A;  2YNG A;  3C6H A;  2VG5 A;  4AHT A;  2RN2 A;  4A5B A;  3LWL A;  3WXI A;  5JLF A;  3J7Z O;  1RDW X;  4DSF A;  4LY7 A;  3CCJ N;  4DV6 K;  4OPK A;  2OAN A;  1SL0 A;  1A5X A;  2P9I B;  3L0Q A;  3QB0 A;  3DRP A;  4BR5 A;  4O4G A;  2KLA A;  3PLA A;  3NFA A;  3U8X A;  3QNO A;  1F21 A;  3ZEU A;  3F9K A;  3ZT2 A;  3V9U A;  3LDL A;  3RWU A;  4UQG A;  1U4B A;  1XHX A;  2HBJ A;  1N33 K;  3RVC A;  4LF5 K;  2NNW A;  4H5N A;  1JLE A;  1N5Y A;  2FSK A;  1YVN A;  1NGI A;  4OPJ A;  4OLB A;  4JI4 K;  3UKU A;  5LMU K;  4OPA A;  1GLC G;  2X6N A;  4TSX A;  2E2P A;  2OZS A;  1ZC6 A;  5AQG A;  1U45 A;  3ZSW A;  3SK3 A;  5BR9 A;  1WSJ A;  4YOX A;  3AO1 A;  1UWB A;  2QWL A;  3NF9 A;  5J2P A;  3DYA A;  4L8R B;  4MFB A;  3MWT A;  3OBY A;  2F9T A;  4WFA L;  3PX6 A;  4MDB A;  1MA9 B;  4B8C A;  2GUP A;  4FZX C;  3DLG A;  2O8C A;  1SUQ A;  4H5R A;  2G8W A;  4IG0 A;  3VQ7 A;  1N8R O;  5ADX H;  3KZB A;  3C6U A;  1QVF M;  2NRW A;  5AQU A;  2X6S A;  4BQZ A;  3FE1 A;  2NZT A;  2QWO A;  3MEE A;  1SV5 A;  1Y97 A;  4AHU A;  4LC9 B;  4I2P A;  1HKC A;  1GLD G;  1J5O A;  3MXI A;  1VK0 A;  3CPE A;  2BDP A;  3VQE A;  4NYN A;  3SQ2 A;  4NCB A;  2Q0U A;  3ZSZ A;  4CJL A;  3G25 A;  1K8A O;  4ZHR A;  4JKF A;  4B08 A;  1NK9 A;  1WSG A;  4E7H A;  3DLB A;  4E1N A;  2P9S A;  3NH2 A;  4F8R A;  1VRT A;  1RDC A;  1JCE A;  4YY3 K;  4M7Y A;  3ZT0 A;  4JK8 A;  3HYF A;  3KK3 A;  1YTU A;  3SUO A;  3O8M A;  3ZSO A;  4FJG A;  3T1Y K;  4DSJ A;  3RMA A;  3OYF A;  3S3O A;  5IT9 O;  4GKJ K;  2Q2R A;  3SUP A;  2OZM A;  1YTA A;  1VSF A;  4F2R A;  4EHT A;  1IBK K;  2A5X A;  1BI4 B;  2HHQ A;  2G8F A;  4JLH A;  4CZM A;  3KD1 E;  2BTF A;  2QI2 A;  2QWR A;  3O9S A;  3CIP A;  5HBM A;  1I39 A;  5J2N A;  1IKX A;  5SWM A;  3PX0 A;  1LWF A;  2UYT A;  1IH7 A;  1X3M A;  3ASM A;  2VGN A;  2YX6 A;  3LP0 A;  1S1W A;  4H0T B;  4QCL A;  5CY4 A;  3WNF A;  5HOO A;  2WFB A;  3O3H A;  3DLK A;  1EET A;  1C1A A;  3U9D A;  1RBS A;  2O8D B;  1WSH A;  3LPT A;  1TL3 A;  1RTH A;  4G9Z A;  4JI0 K;  4CGI A;  4LFC K;  1VQ9 N;  1ITG A;  3CC2 N;  4HHT A;  3SV3 A;  4BRN A;  2QW9 A;  2E6M A;  1YJN N;  2VWB A;  5LY3 A;  1WSI A;  2KFZ A;  4CER A;  2PYL A;  3VA0 A;  3R9P A;  1XC3 A;  4FSV A;  4JHD A;  1X9M A;  3SJJ A;  4M3T A;  2XY8 A;  5BR8 K;  3E01 A;  2E88 A;  2UU9 K;  3HST B;  2X74 A;  3M8P A;  1NM1 A;  5AQN A;  3CPW M;  3LDO A;  5AQR A;  2ETJ A;  1RT3 A;  4DKW A;  5HRP A;  4CZH A;  5HLF A;  3MEG A;  1NGB A;  5HRR A;  2HVH A;  3IKM A;  4C8O A;  4B1X B;  3BGR A;  3J8A A;  4K41 A;  1HQU A;  2OPP A;  1HNX K;  4GW6 A;  3SZ2 A;  4KI4 A;  3TAR A;  2O4G A;  3KLI A;  1ZBS A;  2YCH A;  5AFU A;  2KHO A;  2AP1 A;  3F5T A;  1NJY A;  3VEN A;  3SNN A;  3RMC A;  2GEM A;  2ZQB A;  1QZ6 A;  3CYM A;  4FW1 A;  5DK5 A;  4NO7 A;  3UKR B;  4KTQ A;  2PY5 A;  4CK1 A;  3DOL A;  5AFU H;  4CGG A;  5AQL A;  4KB0 A;  2DY4 A;  4LD0 A;  5BPM A;  3VQ9 A;  4B1W B;  4O8U A;  4CJT A;  4BRA A;  2YJE A;  4CEZ A;  4KB1 A;  2ASM A;  3EL2 A;  3AVM A;  4ISE A;  1WB9 A;  4AHV A;  3OYA A;  1NK7 A;  1S3X A;  4B9S A;  1SL2 A;  4JI6 K;  1DLO A;  4JI2 K;  1TKZ A;  4GY2 B;  1NOZ A;  3VN5 A;  4CIG A;  4QS9 A;  5KRS A;  3LP1 A;  3PSF A;  1B9F A;  2G8I A;  2P9I A;  4BR2 A;  4BVP A;  1KC8 O;  3CJC A;  5DM7 L;  4A61 A;  4B3S K;  1KSP A;  3IMX A;  3FR0 A;  4ID5 A;  2PFU A;  3DRR A;  3I0S A;  2YHA A;  1NBW A;  1BIS A;  1NMD A;  3LM9 A;  4IXC A;  4CD1 A;  2GEL A;  2D1K A;  4BRG A;  4WQ5 A;  4BR4 A;  3VQQ A;  4CJ7 A;  2YHY A;  4A62 A;  4KRF A;  3D6R A;  2KTQ A;  3A5O C;  4JAX A;  1QQC A;  2E20 A;  2P9N B;  4CIF A;  1K6Y A;  4IFE A;  3JYT A;  3HBT A;  2QM1 A;  1GLL O;  4IWV A;  4B9U A;  4H8K A;  4R5P A;  5KQD A;  1SKW A;  1Q8I A;  3HJF A;  2EX3 A;  2O8F B;  1S5J A;  4PL7 A;  4Y1C A;  4JKA A;  1TAU A;  4BC2 A;  2P9L B;  4B1Z A;  4A2A A;  2B4J A;  1JLA A;  2QWM A;  3OYK A;  2YKN A;  4IG3 A;  4DWI A;  3KLG A;  1KAY A;  3E9P A;  4FWP A;  4JRP A;  2HHU A;  3P39 A;  4CBX A;  1ZXO A;  2VWK A;  3RSE B;  2KZM A;  3SPY A;  3THW B;  2IVO A;  2W6K A;  3C6T A;  1XC9 A;  4I6M B;  3QER A;  1L3V A;  3P5J A;  4DFP A;  2HHW A;  4Z4C A;  4E3S A;  3KK1 A;  2Z1J A;  1TK0 A;  3K59 A;  3TAF A;  2CH6 A;  2WOM A;  2P9P B;  2GX9 A;  3QFP A;  3LWM A;  4CJE A;  2CGK A;  1NKC A;  4DQQ A;  3ITH A;  3ZCM A;  1VQ4 N;  1TKT A;  3L2W A;  1SKR A;  3MED A;  1T7P A;  2Q3S A;  4B9T A;  1KVA A;  1X9J A;  3ENB A;  4C1N I;  4DTP A;  3U3G A;  4MQ3 A;  3ZT1 A;  5C2F A;  5HRO A;  4KHP K;  1HR0 K;  4CHZ A;  4DB3 A;  4OKE A;  4DSE A;  3DMJ A;  4WQ5 C;  1SL1 A;  3CCU N;  1S9E A;  3DXK B;  3KTQ A;  2EHG A;  2ZE2 A;  1ATR A;  3HM8 A;  5DM6 L;  3QES A;  5EU7 A;  1Z26 A;  3TPQ A;  3NF8 A;  1BI4 A;  3T7Z A;  1EKE A;  1W0H A;  1NJZ A;  1BDG A;  3HPG A;  2Z1I A;  1UA1 A;  2W6L A;  4DS4 A;  3VET A;  2R7Y A;  3S3M A;  3FZK A;  1U2V A;  5AQW A;  1Q18 A;  3OYL A;  1VSH A;  4BRD A;  3SQ0 A;  3M8S A;  1BO5 O;  2OPS A;  4I9L A;  4FLV A;  3AO2 A;  4Z4F A;  2HF4 A;  4DTR A;  3E9L A;  3WNG A;  2YNI A;  4CF0 A;  3CER A;  3KKS A;  3CJA A;  3OS1 A;  3NVK A;  3O4N A;  5BRF A;  3CQ8 A;  2P5G A;  5CZ2 A;  4G1Q A;  3PIO L;  2O8D A;  4AHR A;  4DTO A;  4PKH A;  3CFR A;  4DTU A;  1TL1 A;  3AA4 A;  1HYV A;  4EZ9 A;  2VQE K;  1HRH A;  4EZ6 A;  1BA0 A;  2Q97 A;  2Q36 A;  4DQR A;  2WON A;  4N5S A;  3VGK A;  3VQA A;  3VEW A;  4HVJ A;  3EO3 A;  3NAE A;  4FJX A;  3CCQ N;  3MN9 A;  3SAG A;  4JI8 K;  3AVI A;  4CEE A;  2UXC K;  3H45 C;  2P9K B;  1VQK N;  1J9A A;  2A1R A;  1BOT O;  4KO0 A;  1RT6 A;  5FRO A;  3L4Q A;  1D8Y A;  1HNV A;  3THX B;  1L3T A;  2KZZ A;  3U9Z A;  2ZF5 O;  3FZH A;  3H1Q A;  1IG9 A;  5H1S Q;  4WQ4 A;  4E7J A;  3V81 A;  1FXX A;  4R79 A;  3CD6 N;  2IAJ A;  1YAG A;  4CZJ A;  4HUF A;  3ID8 A;  3NGZ A;  4FJJ A;  4DCH A;  3ZET B;  4CZL A;  5AZJ A;  3UKR A;  5C25 A;  4DR3 K;  3M8Q A;  3LDP A;  3J80 O;  4QOZ B;  4CZF A;  1YUW A;  2OYQ A;  4LF6 K;  1RFQ A;  3VES A;  1IKW A;  2CGJ A;  3CCV N;  3DI6 A;  2RF2 A;  4O0J A;  3ULE B;  2HNY A;  3A5N C;  2F8T A;  1KCF A;  2AJQ A;  4EP5 A;  4GV6 A;  1OH7 A;  4Z4G A;  5JS2 A;  4FJH A;  4KH6 A;  3GDQ A;  1QHA A;  4LH4 A;  4CCH A;  4ILJ A;  1ATS A;  3PY8 A;  3TR8 A;  2HF3 A;  1MWK A;  4E7K A;  1HYS A;  3CFP A;  4BR7 A;  4F3O A;  4B9M A;  3LL3 A;  4DR7 K;  3OYE A;  1XMO K;  1QE1 A;  2DFE A;  5EY4 A;  1I94 K;  3B6P A;  2HHH K;  3EZW A;  4QS8 A;  1VQN N;  4Z4H A;  3OYH A;  2BGG A;  1EXQ A;  3AO4 A;  3NGY A;  4BR9 A;  4FO0 A;  4H5V A;  3OYC A;  1RBT A;  1VRU A;  4HCC A;  1FKP A;  4DR1 K;  1SKS A;  5C12 A;  4J2E A;  3F9M A;  1RDD A;  2O8F A;  2FXU A;  1CZB A;  3K5O A;  1YXQ A;  4WQ4 C;  3N4Q A;  2JLE A;  3OHR A;  3VEX A;  5JVH L;  1YHQ N;  1Q9Y A;  2HW3 A;  4CHY A;  4DF4 A;  3TTC A;  2P9L A;  2NRH A;  3ID6 A;  3SLC A;  4BVO A;  1L5U A;  1C0M A;  4NXM K;  4Q5V A;  4Q0B A;  2DTU A;  2B6A A;  3OYG A;  1RGI A;  3BUZ B;  2A3Z A;  1X9W A;  3MCP A;  3I8B A;  2ZJR L;  4CFA A;  4I6M A;  5FPM A;  3OA9 A;  4FJ8 A;  4IJN A;  1HPZ A;  1J54 A;  1TVR A;  3SQ1 A;  1S1T A;  1TUY A;  4C23 A;  2P9U B;  3BF3 A;  1EWQ A;  2O4I A;  3CCS N;  4M7X A;  1NJW A;  2ATQ A;  5BN9 A;  4B9V A;  4B3O A;  4LFB K;  4FM0 A;  2YI1 A;  4K8Z A;  3P31 A;  2FSN A;  3MX5 A;  4CVN E;  2NRR A;  4DUY K;  4DQ8 A;  3DXM B;  2HST A;  4JNE A;  2VCP A;  4N47 A;  4KRE A;  1E3M A;  3M3Z A;  4M3Y A;  3VF2 A;  4DR5 K;  2Q1N A;  3D2F B;  5BPL A;  3JSM A;  3CCR N;  3LM2 A;  4FK2 A;  4KHN A;  1IKY A;  3HVT A;  4KPY A;  3DXK A;  4FLX A;  4DQS A;  4IO9 L;  1YVU A;  3LAM A;  4LF4 K;  4CJW A;  5F0X A;  1VQL N;  3SBT A;  2AA4 A;  1BIU A;  5C2D A;  1QSY A;  5BN8 A;  4CEQ A;  2QWQ A;  3FLC O;  4BRL A;  3SAF A;  3EE8 A;  3JS6 A;  3LZI A;  4EP4 A;  5ADX A;  4JKG A;  1BA1 A;  4OPH A;  4CZK A;  3BZC A;  1H1V A;  4JS5 A;  4N76 A;  1BCO A;  3NF7 A;  4IO8 A;  1QVG M;  2IGI A;  3KWI A;  1HNW K;  3IDH A;  2D0C A;  4H5W A;  1T44 A;  4HCB A;  1JCF A;  5EOY A;  1T03 A;  2OCE A;  1Q81 O;  1JLQ A;  1W97 L;  2V51 B;  2F96 A;  2W41 A;  3K57 A;  3ATV A;  1BUP A;  3R8E A;  4LSL A;  4ZTJ A;  4MLH A;  1GOB A;  1KVC A;  4OGE A;  3MN6 A;  1MU2 A;  1WSF A;  1VSM A;  3P1G A;  3PSI A;  3ZX2 A;  2GWK A;  1ZBI A;  2WUS A;  3QFU A;  2RHK A;  4E1J A;  3KLH A;  2E5L K;  3PO4 A;  2FBT A;  3R3L A;  4X62 K;  3AVA A;  4W5R A;  2QKB A;  3LP2 A;  1BIZ A;  3HXM A;  1NGF A;  5AZI B;  3KD5 E;  3VMF B;  3AVH A;  4KV8 A;  2A42 A;  1HUX A;  1T6C A;  1LWC A;  4BR0 A;  1ZBU A;  4E1M A;  1NK6 A;  3QDK A;  2XRI A;  4FJK A;  1U6Z A;  1QS4 A;  3ULD A;  1SS6 A;  3VQ4 A;  2PAV A;  4DTX A;  4RW9 A;  3TAQ A;  3IG1 A;  3WEE B;  1WUA A;  3THX A;  4PWD A;  1SZ2 A;  4JN4 A;  4Y0W A;  4K25 A;  3MN7 A;  2QXL A;  5ELZ A;  4FXD A;  5HRS A;  4JRQ A;  1IBM K;  3M5R A;  3AO3 A;  4FZY A;  2FBX A;  3H1V X;  4WE1 A;  2KFN A;  2HNZ A;  1JXB A;  4M3Z A;  3H08 A;  3CG7 A;  4IFY A;  5AQI A;  4DMN A;  4O55 A;  4BGA A;  2KQ2 A;  4GV3 A;  1C1B A;  1KLM A;  3TSQ A;  1Q9X A;  3HL8 A;  5F1X A;  5M1F A;  1WN7 A;  4FWN A;  1UOC A;  4FWK A;  3KK2 A;  1LAW A;  3W0L A;  1YIT N;  1RBV A;  1VSJ A;  1T8E A;  2KW4 A;  4CGJ A;  3QEP A;  2Z1H A;  5BRH A;  1HNZ K;  3ZSQ A;  2HMI A;  4RW8 A;  4A2B A;  2E2Q A;  1U48 A;  2CGL A;  4RG8 A;  4CHQ A;  4F2S A;  4BDP A;  1ZBH A;  1IO2 A;  4OVL A;  4KI6 A;  5I9E B;  3OYN A;  1HMV A;  5KPT A;  1EO1 A;  3V6D A;  3RTV A;  2PBD A;  3SUN A;  2NRZ A;  3MX2 A;  2YKM A;  4W5N A;  4DV3 K;  3T1H K;  1GOA A;  1J6Z A;  1L3U A;  3CF5 L;  4B1V A;  3AA5 X;  3HOS A;  1CZA N;  3TSU A;  4DV5 K;  3VEO A;  1NK5 A;  1IV0 A;  3P83 D;  3LAK A;  1KFD A;  4KHS A;  3KKR A;  4H4O A;  3AV9 A;  4NLB A;  5BRD A;  1JXE A;  2YNH A;  5KRT A;  4CJV A;  5SZT A;  2OA8 A;  1K9M O;  1VAZ A;  3HSC A;  4ELU A;  1RDU A;  4GVM A;  1E4F T;  4CJ5 A;  1TYQ A;  1WLJ A;  2ZGY A;  4JYA K;  1Y64 A;  3CJ1 A;  4FCY A;  3BP8 A;  2I7P A;  3U4L A;  4FM2 A;  4OO1 J;  1GLB G;  3ZSY A;  5C0Y A;  4KHU A;  3TAG A;  1WSE A;  1RT7 A;  5J2Q A;  3O6W A;  3SYZ A;  4AHS A;  3LAN A;  4HTU A;  1K8K B;  3HZ6 A;  2OTL N;  3VQ6 A;  3PV8 A;  2Z1G A;  2CH5 A;  1YI2 N;  2Y1J A;  3HO1 A;  4O5B A;  3PO5 A;  5KPZ A;  2F7T A;  1HPM A;  2UUC K;  2XY6 A;  4B9L A;  4M3W A;  3OS2 A;  4CI6 A;  5CE3 A;  4FJ7 A;  5K14 A;  3GOI A;  4DHY A;  4CZI A;  2HOE A;  4DR6 K;  4H0V B;  2NUB A;  3EYZ A;  2G8V A;  3AY9 A;  1GLE G;  1XHZ A;  1T05 A;  3RRH A;  2G8U A;  3GG4 A;  3L2U A;  4WCE L;  3K58 A;  3Q7C A;  4W5O A;  2E2N A;  2ZM6 K;  5AQX A;  2H3G X;  4DG1 A;  3T1A A;  4IDH A;  5GIP A;  4RW7 A;  3DXM A;  3QEX A;  1J53 A;  3M8R A;  3ZT4 A;  3VQB A;  1TKD A;  3TAB A;  1KFS A;  1UAX A;  2BUP A;  2VG7 A;  3TSP A;  2O8E B;  3CC7 N;  3AVF A;  1B92 A;  4KHW A;  1Z05 A;  3S41 A;  4OLA A;  2E4L A;  4DSI A;  4DF8 A;  3DAW A;  4W5Q A;  3O3G A;  3HTV A;  1XQS C;  3NH1 A;  1VQP N;  3VTH A;  3CFO A;  2V7Y A;  1REV A;  4BRI A;  5FPN A;  1TK5 A;  1S22 A;  5GAE P;  4IFV A;  2I5J A;  4FLT A;  1KXP A;  1HLU A;  5AQP A;  3NH0 A;  1LCU A;  1YF5 L;  4U7B A;  3G10 A;  1S72 N;  1LV5 A;  5CZ1 A;  1G99 A;  3QIP A;  4DFK A;  4FJM A;  3QEV A;  1WBD A;  5AQF A;  4IDK A;  1EQY A;  1V4S A;  3LDN A;  3CJ9 A;  4KBO A;  3IUC A;  4C8M A;  4MLE A;  3AVC A;  1TAQ A;  3M6G A;  4KFB A;  3E1Y A;  2Q31 A;  5HP1 A;  4CJK A;  3TAM A;  3KJV A;  3I8D A;  4DV7 K;  3SUQ A;  4BWM A;  4YOT A;  1KD1 O;  1ZYQ A;  4B3T K;  2F8S A;  3O9Q A;  3QNN A;  1XMQ K;  4J2B A;  3LDQ A;  2O8B B;  4YHH K;  1BGX T;  5C10 A;  1C0T A;  3HK2 A;  3TAN A;  5AZI A;  5BRE A;  5AQH A;  4BDY A;  5E84 A;  1EX4 A;  1R59 O;  4YOW A;  5J2M A;  1NK0 A;  3AAR A;  1P8Z A;  4OGC A;  3Q7B A;  4K43 A;  2YNF A;  4KH5 A;  3DM2 A;  5M1K A;  4DQP A;  4XH5 A;  4LSN A;  3ZEU B;  1YJ9 N;  3R1X A;  1D9D A;  5F2R A;  5FPE A;  2V7Z A;  2IVN A;  2XO7 A;  1NK4 A;  2NLX A;  3VF6 A;  4FJN A;  1QQM A;  1RIL A;  1LAV A;  4AH9 A;  4ELT A;  2F9W A;  3CJ7 A;  3UKU B;  5HRN A;  4M42 A;  1XNQ K;  1LW2 A;  1DT9 A;  2IOC A;  1WBB A;  4FJL A;  3CCE N;  2E8A A;  4YDU C;  3KLE A;  5D3G A;  2E6L A;  5M1O A;  2LSN A;  2GTD A;  4IJA A;  3NF6 A;  2WTU A;  1RBU A;  2YHX A;  3TTD A;  3KLF A;  4F3T A;  2ZWH A;  3WXM B;  2BAN A;  1NU0 A;  3C95 A;  3O3F A;  3EEQ A;  1VQ6 N;  4KHY A;  1NGJ A;  3K5L A;  3UB5 A;  3B8A X;  2QTD A;  3HRG A;  4PUO A;  5KGW A;  4FWQ A;  3I56 N;  3RR7 A;  4B8A B;  4FWR A;  3F2K A;  3OYJ A;  4GVE A;  4B1Y B;  3WQU A;  4DFM A;  3B6O A;  4FJ5 A;  4BWJ A;  1KVB A;  4KHQ A;  3HP9 A;  1LWE A;  1NWK A;  1VQ8 N;  1HKG A;  1IG8 A;  2PYJ A;  1K73 O;  2QWP A;  2J4R A;  1E4G T;  5AQO A;  2NRT A;  4NXN K;  2Y1I A;  2P9S B;  3MMV A;  3K5M A;  3K9J A;  5E41 A;  4ZTF A;  4DLE A;  3EZ5 A;  4LF9 K;  3OBW A;  4CJP A;  3V9X A;  3BDP A;  3G4S N;  3CI5 A;  1ATN A;  4CJ3 A;  3QBX A;  3AVG A;  3J81 O;  3ZSX A;  4GV9 A;  4DSL A;  5KGX A;  1QSL A;  4ILH A;  1K8K A;  1XI1 A;  1T3V A;  1HKB A;  4FZZ A;  2D0A A;  3MEC A;  3L2Q A;  3L4I A;  4B3M K;  4XH4 A;  2IS3 A;  1L3S A;  1RBR A;  3I33 A;  4FJI A;  2OPQ A;  5MLC Q;  1VQO N;  1VSD A;  5EXW A;  1U47 A;  5AQJ A;  3RR8 A;  1JL1 A;  4KAZ A;  3E66 A;  4UY8 O;  1G15 A;  4JKB A;  2DFH A;  3AAQ A;  1CXQ A;  3SQ4 A;  4EAH D;  4AM7 A;  1HX1 A;  1IJJ A;  4L3Q A;  4AQY K;  1X1P A;  4RCH A;  3T3F A;  1HYZ A;  2HB5 A;  3DLE A;  4CHN A;  3CXC M;  2P51 A;  2YV0 X;  5EVZ A;  3UIQ A;  2W42 A;  3G6E N;  4JKE A;  1C6V A;  5DMR A;  3ZX0 A;  1VQ7 N;  3QIC A;  2JWL A;  3WUH A;  5JS1 A;  3OYI A;  2HMP A;  5JVG L;  4BRO A;  1WAF A;  5LMN K;  3CM6 A;  4LH5 A;  2FSJ A;  5M1P A;  4BY9 C;  3AVL A;  2P9N A;  5TKW A;  2E1Y A;  4KTW A;  3SMS A;  4J2D A;  1QTM A;  4FW2 A;  1DTQ A;  5FLX O;  4JHD B;  2YHB A;  4CJS A;  1LW0 A;  3HM9 A; 
#chains in the Genus database with same CATH homology
 3HXM A;  1JL2 A;  1DLO A;  3KD5 E;  1TKZ A;  3AVH A;  1NOZ A;  2OPR A;  4KV8 A;  4FJ9 A;  3VN5 A;  1BQN A;  4CIG A;  1ZBF A;  4C8N A;  5KRS A;  1LWC A;  2B5J A;  1ZBU A;  3V1O A;  4E1M A;  1NK6 A;  3FFI A;  2XRI A;  1RTJ A;  1RT5 A;  1B9F A;  3LP1 A;  1QS4 A;  3ULD A;  1NK8 A;  4FJK A;  2G8I A;  3VQ4 A;  4FM1 A;  4BE0 A;  4DTX A;  1BCM A;  4RW9 A;  3TAQ A;  1NJX A;  3IG1 A;  1KSP A;  4CGF A;  3V9S A;  3NBP A;  2P1J A;  4PWD A;  4DU4 A;  1RTI A;  4ID5 A;  3V9W A;  3DRR A;  3I0S A;  2YHA A;  4E7I A;  1BIS A;  1KRP A;  3VQ5 A;  1CXU A;  3VQ8 A;  1BL3 A;  4FXD A;  5HRS A;  4JRQ A;  4PQU A;  1BHL A;  3I0R A;  3AO3 A;  4FZY A;  2FBX A;  4WE1 A;  2KFN A;  2HNZ A;  1JXB A;  3VQQ A;  1UA0 A;  4M3Z A;  4KRF A;  2HHS A;  3H08 A;  3CG7 A;  2KTQ A;  1C0U A;  4IFY A;  1CLQ A;  1QQC A;  4DMN A;  4I7F A;  4O55 A;  2KQ2 A;  3OJU A;  1C1B A;  1KLM A;  4CIF A;  3NDK A;  4CES A;  3NE6 A;  1U49 A;  1Z25 A;  4DTN A;  1Q9X A;  1K6Y A;  3JYT A;  3HL8 A;  1RT4 A;  1WN7 A;  4E19 A;  3AA2 A;  4YNQ A;  4B9U A;  1UOC A;  4H8K A;  4M45 A;  1LAW A;  3KK2 A;  4CIE A;  4R5P A;  3OYM A;  1RBV A;  1VSJ A;  3AVN A;  1XWL A;  3OVN A;  3HVR A;  3HM9 A;  1T8E A;  1SKW A;  1TGO A;  1Q8I A;  2KW4 A;  4KTZ A;  2EX3 A;  4CGJ A;  3QEP A;  3DLR A;  3EY1 A;  2Z1H A;  3HJF A;  1S5J A;  3ZSQ A;  2HMI A;  4RW8 A;  4Y1C A;  1U48 A;  4RG8 A;  1TAU A;  3L2R A;  2ZD1 A;  2RPI A;  4CHQ A;  3TAE A;  1IKV A;  1C1C A;  2B4J A;  4F2S A;  4BDP A;  1JLA A;  1ZBH A;  1IO2 A;  2GV9 A;  2YKN A;  3LP3 A;  4IG3 A;  4OVL A;  3OYN A;  3OYK A;  1HMV A;  4Y1D A;  4DWI A;  1NOY A;  3KLG A;  3V6D A;  3RTV A;  3T19 A;  3SUN A;  1D5A A;  4JRP A;  5KTQ A;  2YKM A;  4NYF A;  2VWK A;  4DFJ A;  3THV A;  2HHU A;  4BE2 A;  2KZM A;  4W5N A;  4HUG A;  3SPY A;  3DLH A;  1GOA A;  1L3U A;  1QHT A;  2D0B A;  3C6T A;  3AA5 X;  4DSK A;  1XC9 A;  1FK9 A;  3QER A;  1L3V A;  5FRM A;  3P5J A;  4DFP A;  2HHW A;  4Z4C A;  1NK5 A;  4E0D A;  4E3S A;  3P83 D;  3LAK A;  1KFD A;  3KK1 A;  2Z1J A;  3KKR A;  4H4O A;  4KHS A;  1TK0 A;  3K59 A;  3TAF A;  4CE9 A;  3AV9 A;  2WOM A;  5I3U A;  1EP4 A;  4FLZ A;  1S6Q A;  5C24 A;  3QIN A;  4H4M A;  3LWM A;  4CJE A;  1JXE A;  4AHC A;  1NKC A;  4DQQ A;  3ITH A;  2YNH A;  4CGD A;  1HQE A;  5KRT A;  3ZCM A;  4CJV A;  1TKT A;  5SZT A;  3L8B A;  3U3Y A;  3L2W A;  1SKR A;  2OA8 A;  2PZS A;  4BE1 A;  3MED A;  4ELU A;  1WAJ A;  3WNH A;  4FLW A;  2Q3S A;  4GVM A;  2FBY A;  1KVA A;  4CJ5 A;  1WLJ A;  4DLG A;  4B9T A;  4E89 A;  4DTP A;  3KIO A;  4M3R A;  3HP6 A;  4FCY A;  1RDB A;  3AO5 A;  3U3G A;  4DTJ A;  4MQ3 A;  1W9H A;  3ZT1 A;  4CHP A;  4CEO A;  3OS0 A;  3LAL A;  5J1E A;  4FM2 A;  5HRO A;  3TAP A;  4CHZ A;  4ELV A;  3ZSY A;  4KHU A;  2GBZ A;  2IC3 A;  3TAG A;  1N6Q A;  1WSE A;  3SV4 A;  1RT7 A;  5J2Q A;  3S3N A;  2QKK A;  4OKE A;  3LDS A;  3SYZ A;  4DSE A;  3DMJ A;  4AHS A;  1SL1 A;  4OKJ A;  1GOC A;  3LAN A;  3MXM A;  4FK4 A;  4HTU A;  4CJQ A;  2FC0 A;  4CEF A;  1S9E A;  2XHB A;  3F73 A;  3KTQ A;  1ZBL A;  2EHG A;  2ZE2 A;  3VQ6 A;  3QES A;  3PV8 A;  2Z1G A;  5EU7 A;  4M41 A;  2Y1J A;  3HO1 A;  4O5B A;  1Z26 A;  4CEA A;  3LZJ A;  3PO5 A;  3NF8 A;  1BI4 A;  3MXJ A;  2X78 A;  1EKE A;  1W0H A;  4CF2 A;  4FLU A;  2XY6 A;  4B9L A;  4M3W A;  3OS2 A;  4PA1 A;  2GUI A;  3V1R A;  1NJZ A;  3HPG A;  3A2F A;  2G8K A;  4Z4E A;  2Z1I A;  1UA1 A;  4DS4 A;  2R7Y A;  3OYB A;  3S3M A;  4FJ7 A;  4K8X A;  5K14 A;  3ISN C;  3OYL A;  1VSH A;  3ALY A;  3S9H A;  2NUB A;  3EYZ A;  4I9Q A;  3SQ0 A;  3SPZ A;  3M8S A;  1NKB A;  2G8V A;  4KI6 A;  1XHZ A;  2OPS A;  1T05 A;  4I9L A;  3RRH A;  1JKH A;  2G8U A;  3L2U A;  1ASW A;  1BQM A;  3K58 A;  4FLV A;  4F4K A;  3AO2 A;  1VSE A;  5CYQ A;  4W5O A;  3WNE A;  4Z4F A;  3D45 A;  4ICL A;  1D9F A;  4DG1 A;  2HHX A;  3T1A A;  3RRG A;  4DTR A;  2JGU A;  5C42 A;  4RW7 A;  3WNG A;  2YNI A;  1VSK A;  4CF0 A;  3KKS A;  3VQC A;  2XY7 A;  3QEX A;  3VA3 A;  1CZ9 A;  1JLC A;  3OS1 A;  1S1X A;  1J53 A;  2FBV A;  3O4N A;  1ASV A;  3M8R A;  3CQ8 A;  3ZT4 A;  2P5G A;  5CZ2 A;  1VSL A;  3TWH A;  4G1Q A;  4RW6 A;  2DFF A;  2RKI A;  4JS4 A;  5FRN A;  4DTM A;  3V1Q A;  3VQB A;  4AHR A;  1TKD A;  2G8H A;  4DTO A;  4CJU A;  3QLH A;  3TAB A;  3CFR A;  3SI6 A;  1KFS A;  4DTU A;  4RW4 A;  1TL1 A;  1UAX A;  2VG7 A;  1RT2 A;  3ZSR A;  4E7L A;  4BDZ A;  3AA4 A;  4N41 A;  3AVF A;  1B92 A;  4KHW A;  3V4I A;  1HYV A;  4OLA A;  2E4L A;  4YFU A;  4EZ9 A;  4DSI A;  3V9Z A;  4HUE A;  4DF8 A;  1HRH A;  4W5Q A;  3CM5 A;  4CK3 A;  4C8K A;  3O3G A;  4EZ6 A;  4FK0 A;  3NH1 A;  4IKF A;  4IBN A;  3OY9 A;  4DQR A;  1A5W A;  1HJR A;  2WON A;  4N5S A;  4CF9 A;  3VQA A;  4HVJ A;  3IRX A;  4CF8 A;  3NAE A;  4FJX A;  3O4Q A;  3CFO A;  2YNG A;  1REV A;  2VG5 A;  4AHT A;  3OYD A;  2RN2 A;  3LWL A;  1TK5 A;  4IFV A;  1RCH A;  2I5J A;  4O0I A;  3AVI A;  2ITG A;  2QKB A;  4CEE A;  4DSF A;  4LY7 A;  4CGH A;  4FLT A;  4OPK A;  4CJR A;  3NH0 A;  3LP2 A;  3NGI A;  4FVM A;  3G10 A;  1SL0 A;  1A5X A;  1J9A A;  2A1R A;  4KO0 A;  1LV5 A;  3DRP A;  4CHO A;  5CZ1 A;  1RT6 A;  1QSS A;  3AVB A;  5FRO A;  4O4G A;  4N56 A;  3QIP A;  4DFK A;  4FJM A;  1D8Y A;  1YT3 A;  1KLN A;  1HNV A;  3NFA A;  3QEV A;  3QNO A;  1F21 A;  1L3T A;  1JLF A;  3F9K A;  3ZT2 A;  3V9U A;  3RWU A;  2KZZ A;  4UQG A;  1U4B A;  3NCI A;  2HND A;  1XHX A;  4IDK A;  4CEB A;  1IG9 A;  3ZSV A;  4E7J A;  3V81 A;  1FXX A;  2BE2 A;  1JLE A;  1N5Y A;  2IAJ A;  4C8M A;  4HUF A;  3AVC A;  3NGZ A;  4CF1 A;  1NKE A;  4FJJ A;  1TAQ A;  1TV6 A;  4KFB A;  5C25 A;  4OPJ A;  1RTD A;  4OLB A;  5HP1 A;  3M8Q A;  4CJK A;  4QOZ B;  3TAM A;  1KTQ A;  3KJV A;  4BAC A;  3I8D A;  3SUQ A;  2OYQ A;  2X6N A;  4BWM A;  4TSX A;  1ZYQ A;  2OZS A;  3QIO A;  4CFB A;  4CED A;  1U45 A;  1IKW A;  3VQD A;  3ZSW A;  2F8S A;  1A5V A;  3QNN A;  4J2B A;  1WSJ A;  3DI6 A;  3AO1 A;  2RF2 A;  1UWB A;  3NF9 A;  5J2P A;  3TI0 A;  2D5R A;  1BGX T;  4O0J A;  1FKO A;  2HNY A;  3DYA A;  4L8R B;  4MFB A;  1C0T A;  3HK2 A;  3TAN A;  3RMB A;  2F8T A;  3PX6 A;  1KCF A;  2AJQ A;  4EP5 A;  4BDY A;  4Z4G A;  4DS5 A;  4B8C A;  1EX4 A;  5JS2 A;  4FJH A;  5J2M A;  4FZX C;  1NK0 A;  4DQI A;  4OJR A;  3DLG A;  4OGC A;  4NCG A;  2YNF A;  4LH4 A;  3NHG A;  1SUQ A;  3DM2 A;  4KKO A;  4IG0 A;  3VQ7 A;  2G8W A;  1JLB A;  3D0P A;  4CCH A;  4J2A A;  3C6U A;  3PY8 A;  4DQP A;  1S6P A;  3TR8 A;  4NCA A;  4LSN A;  4E7K A;  1HYS A;  2X6S A;  3CFP A;  1D9D A;  5CYM A;  3MEE A;  2XY5 A;  4B9M A;  1SV5 A;  1RT1 A;  1Y97 A;  4AHU A;  4F3O A;  3OYE A;  4I2P A;  2XO7 A;  1NK4 A;  1QE1 A;  4FJN A;  2DFE A;  1RIL A;  1J5O A;  4B9N A;  1LAV A;  3MXI A;  1VK0 A;  4AH9 A;  2BDP A;  3VQE A;  3B6P A;  1X9S A;  4ELT A;  1RNH A;  4ID1 A;  4NYN A;  3SQ2 A;  4Z4H A;  5HRN A;  3ZSZ A;  4CJL A;  3OYH A;  4NCB A;  4M42 A;  2BGG A;  1EXQ A;  1LW2 A;  3AO4 A;  3NGY A;  4ZHR A;  2IOC A;  1HNI A;  4B08 A;  4FJL A;  3AVJ A;  3SCX A;  1O1W A;  3OYC A;  1NK9 A;  1WSG A;  4E7H A;  1RBT A;  4E1N A;  3DLB A;  1VRU A;  3KLE A;  1FKP A;  1DTT A;  4CFC A;  4HCC A;  3NH2 A;  2E6L A;  1SKS A;  1VRT A;  4F8R A;  1RDC A;  4J2E A;  2LSN A;  4C8L A;  3ZT0 A;  1RDD A;  3AVK A;  3NF6 A;  1CZB A;  3HYF A;  3K5O A;  3KK3 A;  1YTU A;  3SUO A;  3ZSO A;  4FJG A;  1RBU A;  2JLE A;  4DSJ A;  1Q9Y A;  3RMA A;  3IS9 A;  4CHY A;  2HW3 A;  3KLF A;  4F3T A;  4DF4 A;  3OYF A;  3S3O A;  4W5T A;  2BAN A;  4CFD A;  3C95 A;  1L5U A;  1C0M A;  3O3F A;  3HT3 A;  3SUP A;  2OZM A;  1YTA A;  4Q5V A;  1TKX A;  1VSF A;  3ZT3 A;  4F2R A;  2A1S A;  4KHY A;  4Q0B A;  2B6A A;  3PX4 A;  2DTU A;  3OYG A;  2VWJ A;  1BI4 B;  2HHQ A;  3K5L A;  1X9W A;  2G8F A;  1U04 A;  4JLH A;  2QXF A;  4Z4I A;  3KD1 E;  4PUO A;  1S1U A;  5KGW A;  4CFA A;  4CJF A;  4PY5 A;  5HBM A;  1I39 A;  1S1V A;  4FLY A;  3RR7 A;  5J2N A;  4FJ8 A;  4B8A B;  1IKX A;  5SWM A;  3OYJ A;  3IAY A;  3PX0 A;  1HPZ A;  1J54 A;  3K2P A;  4DFM A;  1LWF A;  1TVR A;  1S1T A;  3B6O A;  4BWJ A;  3SQ1 A;  4FJ5 A;  1IH7 A;  4M3U A;  1KVB A;  4KHQ A;  4O44 A;  3ASM A;  4GMJ B;  3HP9 A;  1LWE A;  2O4I A;  2PYJ A;  3LP0 A;  1S1W A;  1NJW A;  3L3V A;  2ATQ A;  4B9V A;  4B3O A;  2IDO A;  3LPU A;  4FM0 A;  3HPO A;  4K8Z A;  3U6F A;  2Y1I A;  4QCL A;  5CY4 A;  3WNF A;  2QK9 A;  3O3H A;  3K5M A;  3DLK A;  3PUF A;  5E41 A;  4ZTF A;  1EET A;  3EZ5 A;  4DLE A;  4CJP A;  3QET A;  3V9X A;  3BDP A;  4N47 A;  1B9D A;  1C1A A;  4KRE A;  1RBS A;  4CJ3 A;  4M3Y A;  3AVG A;  1T7P A;  3ZSX A;  1WSH A;  2P5O A;  3JSM A;  3LPT A;  3AA3 A;  1TL3 A;  1VSI A;  4CK2 A;  4DSL A;  3QEW A;  1RTH A;  5KGX A;  4FK2 A;  4KHN A;  3QEI A;  1IKY A;  3HVT A;  1QSL A;  5KI6 A;  4CGI A;  1I3A A;  5FDL A;  1ITG A;  4KPY A;  4FLX A;  1XI1 A;  4I2Q A;  4HHT A;  3SV3 A;  4DQS A;  2E6M A;  1YVU A;  3LAM A;  4CJW A;  4FZZ A;  2D0A A;  3MEC A;  3L2Q A;  1TK8 A;  1BIU A;  1WSI A;  2KFZ A;  2IS3 A;  4CER A;  2PYL A;  1L3S A;  1QSY A;  3VA0 A;  4CEQ A;  1RBR A;  4FJI A;  2OPQ A;  1X9M A;  1VSD A;  4OKK A;  3SJJ A;  1U47 A;  3RR8 A;  4M3T A;  2XY8 A;  3E01 A;  1JL1 A;  2HHV A;  3LZI A;  4KAZ A;  3G0Z A;  3K5N A;  4EP4 A;  3HST B;  2VG6 A;  1G15 A;  4XIU A;  2X74 A;  5T7B A;  4CEC A;  2DFH A;  1CXQ A;  3M8P A;  3SQ4 A;  2ETJ A;  1WNS A;  1ASU A;  1RT3 A;  1BCO A;  5HRP A;  4JS5 A;  5HLF A;  4N76 A;  3MEG A;  3NF7 A;  3VQP A;  2HVI A;  2IGI A;  5HRR A;  1X1P A;  2HVH A;  3DOK A;  3T3F A;  4C8O A;  2D0C A;  3BGR A;  4CJ4 A;  1HQU A;  2OPP A;  4QAG A;  1HYZ A;  2HB5 A;  3DLE A;  4GW6 A;  4CHN A;  3SZ2 A;  1R0A A;  3TAR A;  4HCB A;  4KI4 A;  2O4G A;  2P51 A;  2YV0 X;  3UIQ A;  3KLI A;  2W42 A;  3HPH A;  1T03 A;  3C94 A;  1C6V A;  3DRS A;  1JLQ A;  5DMR A;  2F96 A;  1NJY A;  3K57 A;  3SNN A;  4LSL A;  3MAQ A;  4Z0U A;  3RMC A;  4ZTJ A;  2ZQB A;  3CYM A;  1RDA A;  4FW1 A;  3OYI A;  5D3G A;  5DK5 A;  5JS1 A;  4KTQ A;  4DU1 A;  4FYD A;  3QO9 A;  4CK1 A;  3DOL A;  1GOB A;  2PY5 A;  1WAF A;  4CGG A;  1KVC A;  3L3U A;  3CM6 A;  4LH5 A;  4KB0 A;  2DY4 A;  2HHT A;  4OGE A;  4LD0 A;  3VQ9 A;  3AVL A;  3L2V A;  5I42 A;  1MU2 A;  1VSM A;  1WSF A;  3P1G A;  4CJT A;  3RMD A;  4DU3 A;  4CEZ A;  4KB1 A;  1ZBI A;  1S9G A;  4KTW A;  4J2D A;  1QTM A;  4DTS A;  4M3X A;  3AVM A;  4FW2 A;  3KLH A;  1DTQ A;  3OJS A;  1JLG A;  4AHV A;  2YHB A;  2FBT A;  3OYA A;  4CJS A;  1NK7 A;  3AVA A;  4W5R A;  4AIL C;  3PO4 A;  1LW0 A;  4B9S A;  1BIZ A;  1SL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...