2X74A

Human foamy virus integrase - catalytic core.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
187
Chain Sequence
RPQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords INTEGRASE
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
total genus 55
structure length 187
sequence length 189
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x74A00
1L3UA 1ASWA 5J2QA 3QESA 3AA2A 1JL1A 1DLOA 2G8VA 4FLUA 4DQSA 4M41A 3OYEA 5CY4A 4CJEA 1QQCA 2Z1HA 2VG6A 2HHXA 4KO0A 1KLNA 4F3TA 1FXXA 1XC9A 1SL0A 2OZMA 1U48A 3U3YA 3RR8A 3IAYA 3VQ8A 1FKPA 3AO4A 2EHGA 1HMVA 1MU2A 1RDBA 4CHOA 4Z4CA 3KKSA 4B9UA 4J2AA 1NK4A 5KTQA 5JS2A 4CFCA 3OYJA 4F2SA 4FJ8A 1RBUA 2OYQA 1VSJA 2E4LA 2ZE2A 3AO2A 1WSIA 4W5OA 2BDPA 2Y1JA 4OVLA 4LH5A 3V9ZA 1JLFA 1C1AA 3NF6A 3K59A 3LZIA 2Y1IA 1KVCA 3PV8A 3ZSWA 1D8YA 1S1XA 4CEZA 3MXMA 1HPZA 1NOYA 4F3OA 1B92A 4CHYA 1WSEA 4J2EA 4Z4GA 4AHVA 2KW4A 3ITHA 1S9EA 1VSHA 4E89A 3SNNA 1Z26A 1CZBA 1L5UA 4ZTJA 4UQGA 4B08A 4CIFA 4DF4A 4K8XA 1I3AA 1TAUA 4O0IA 3QIPA 3HPHA 3AVBA 3IG1A 2QXFA 4K8ZA 1UA1A 1NJZA 3L2VA 1X1PA 1VSIA 4Q0BA 2OA8A 4KAZA 4FYDA 3LDSA 4G1QA 1NOZA 3HJFA 1TL3A 3S3OA 1Q9YA 1SKRA 1HRHA 3CFRA 1TKZA 1WSHA 3NE6A 4IDKA 1WLJA 1VSLA 4KTZA 4ELUA 3L3UA 1ASUA 2I5JA 1YVUA 1RTDA 2YHAA 1EETA 3V4IA 4CJ3A 2WONA 1JLBA 1RT5A 4I2PA 4HCBA 4KB1A 1HYSA 1RT1A 3ZT1A 3OYAA 1ZBIA 3E01A 4FJIA 3KLFA 3I0SA 4CIGA 4DTNA 2OZSA 4IKFA 1X9SA 2HHQA 3OYCA 3RRGA 3NH1A 2P5OA 3OYBA 5C25A 3DLHA 4CF2A 2DFFA 1RDCA 3ZSQA 5I3UA 4N47A 3AVMA 4DTPA 2G8HA 1CXUA 1BIZA 1HQEA 4CFAA 4CGIA 1S6PA 3EY1A 3HK2A 3PX4A 3PY8A 5FRMA 3TR8A 3SUPA 4CHQA 3MEDA 3V9XA 1FKOA 2HHTA 1TGOA 2RPIA 3HM9A 1J9AA 2ZQBA 1KFDA 4RW6A 3ZT3A 3NH0A 4OLBA 2GBZA 4YNQA 4MFBA 4HHTA 4FCYA 1KSPA 3PUFA 3V9WA 2G8UA 3KK2A 2E6MA 3VQ6A 2BE2A 2FBVA 3LWLA 3ZT0A 4DS4A 4DSFA 4B8CA 1JLGA 3RTVA 1NK6A 5DMRA 4KFBA 3QNNA 3V6DA 4KHSA 1WSFA 4OKEA 5C24A 1CZ9A 3ISNC 4FLYA 4R5PA 3RMDA 1XI1A 3U3GA 1QHTA 4C8KA 3QNOA 4M3TA 4FLXA 2OPRA 4NYFA 4CCHA 3OJSA 4FM0A 4CJUA 4FW2A 3VA3A 4EZ6A 1LAVA 3LP2A 1BCMA 3OYGA 3TAMA 3KK3A 4CF1A 1J5OA 4DFKA 1BI4A 3K57A 4H4MA 1SV5A 4FZYA 4GW6A 3L2RA 1TK5A 3V9UA 3NCIA 3SUNA 4Z4IA 4C8NA 3VQEA 3DRRA 2KQ2A 3CYMA 3LANA 1RNHA 3SQ0A 4DSIA 4IFYA 4CJTA 4FK0A 4Z4EA 4CFBA 5K14A 4CJRA 3K5MA 4FM2A 1X9MA 3T1AA 1T7PA 3QEPA 4CEDA 3V9SA 4E7KA 1NJYA 3PO5A 4CJ4A 1CXQA 2GUIA 5JS1A 1BQNA 3LP1A 4CK3A 1A5WA 5J2NA 1L3SA 4B9TA 4FJJA 4DTXA 4Z4FA 1U04A 5KGWA 4CEEA 1JLCA 1RT2A 1NKEA 1QS4A 1IKVA 3WNGA 2D0AA 4CGGA 1N6QA 3MECA 5HRPA 1K6YA 3RWUA 4TSXA 4BDYA 3RRHA 1NJXA 1EXQA 1A5VA 2YV0X 3QEWA 1ITGA 4CE9A 2F8TA 3P1GA 3NHGA 4DQQA 4CFDA 1ZYQA 1QTMA 3ZSXA 1VSFA 4KKOA 4B9SA 1IKXA 4HCCA 1RBTA 3C6UA 3ZSVA 4N41A 4FJ9A 1C1BA 3TI0A 3LAKA 4FJGA 4PA1A 1IH7A 1KFSA 4BDZA 2D0BA 3AVGA 3OS0A 3RMBA 1C6VA 4EP4A 3OYLA 1GOAA 4CECA 1ZBHA 2Z1GA 3TWHA 2IS3A 3MAQA 3NGYA 3VQ5A 4DTMA 3CG7A 1BHLA 3M8PA 1RBVA 1JLAA 4I7FA 4O44A 1JLQA 3K2PA 4RW7A 3ZT2A 3QEIA 2KZMA 4W5QA 1NK7A 2YKMA 2E6LA 4N56A 4CF8A 4AHSA 3O3HA 3OY9A 4IG0A 1TKDA 4JS5A 3L2UA 4DTJA 4ZTFA 4FZXC 4PWDA 2F8SA 3HSTB 3L2WA 1GOCA 1KRPA 1QSYA 3AA5X 3HL8A 3NF7A 4LSLA 3AO1A 2PYLA 4DWIA 1NK5A 1LV5A 4FJKA 4M3UA 2FBTA 4CF0A 4LY7A 4OKJA 3TABA 2OPQA 4JS4A 5KRSA 3F73A 4FLVA 2HW3A 1QSSA 4LD0A 4FK2A 1C0TA 2ITGA 2VG5A 4DFJA 3U6FA 1ASVA 2NUBA 4DU4A 4DLGA 1JXBA 1LWCA 3VN5A 5EU7A 4M3RA 1RBSA 3DLEA 1YTUA 4E3SA 1HQUA 4DU1A 1B9DA 3HT3A 3DYAA 1BI4B 3M8RA 1Q8IA 2AJQA 4ELVA 4E19A 2Q3SA 1JXEA 3NF9A 1RT4A 4H4OA 1NK8A 2RKIA 4DTOA 3TARA 4CIEA 4B9MA 3ZT4A 1KVBA 4OKKA 4KREA 1YTAA 4AHCA 4AHRA 3AVKA 3DOKA 3OJUA 3D0PA 3HP9A 1IKYA 2HNDA 3HPGA 3BDPA 2B6AA 1TVRA 3K5LA 4DU3A 4KRFA 3WNEA 2KZZA 4RW4A 3NGIA 3AVLA 5J1EA 4Q5VA 2X78A 3AVHA 2DY4A 3RMCA 1RTJA 3H08A 4DFMA 4E7JA 2QKBA 2F96A 2IDOA 2YKNA 4FVMA 1QE1A 3OVNA 2KTQA 1EKEA 4Y1DA 5HLFA 4EP5A 3O3FA 3VQDA 4OGCA 4AHUA 1HNIA 3SUQA 4DTUA 2P5GA 1L3VA 1WSJA 2ZD1A 4W5TA 4PQUA 3LP3A 3CM5A 5D3GA 3LP0A 3B6PA 5HROA 4NCBA 3KD1E 4DTSA 5SWMA 3T19A 4N76A 3CFOA 2YHBA 4ID5A 4CERA 1KCFA 2XO7A 2D5RA 1L3TA 4FJHA 3DOLA 4E1NA 4O4GA 1ZBLA 1LAWA 4B3OA 1RBRA 3K5NA 1S1TA 1TV6A 1TKXA 4CESA 3MEEA 2YNGA 3SUOA 1RILA 2IC3A 4BE1A 1YT3A 4CJSA 1W0HA 3TANA 1JKHA 4HTUA 2O4GA 1LWEA 3KLHA 1D9FA 4F8RA 4M3XA 2IOCA 2YNIA 3AA4A 3B6OA 4C8OA 4CJVA 1DTTA 4CK2A 4CEQA 3AO3A 1BIUA 1I39A 1BL3A 3EZ5A 3C95A 3O3GA 4HUEA 2XY5A 4I9QA 4DQPA 1D9DA 4LH4A 2XY8A 4ZHRA 1UA0A 1KLMA 1KTQA 3G10A 1Z25A 4GVMA 3THVA 4O5BA 5HP1A 1EP4A 4KTQA 3D45A 3HYFA 2DFEA 3FFIA 2ATQA 1SL1A 2W42A 5CZ2A 5E41A 4CEOA 2D0CA 3DLBA 3NBPA 1GOBA 1RT7A 1BCOA 3DRSA 1VRTA 1Q9XA 4KTWA 2LSNA 1LWFA 4Z0UA 3RR7A 2JLEA 1BQMA 2GV9A 5HBMA 1RT6A 2P51A 4CJ5A 4FM1A 3C94A 3QIOA 2VWJA 5J2MA 1SUQA 4DMNA 3KJVA 4L8RB 2B4JA 2KFNA 1REVA 4N5SA 3UIQA 4XIUA 2G8WA 1LW2A 5FRNA 4YFUA 2HHSA 4C8MA 3OYIA 4AHTA 1S9GA 4OPKA 3S3NA 4KV8A 1C1CA 4OGEA 1C0UA 1S1VA 3S3MA 1C0MA 1DTQA 1S6QA 4DG1A 3KLGA 3JSMA 2XY7A 3TAPA 4CK1A 1D5AA 2XHBA 2VG7A 4DSEA 3QO9A 4FJXA 1BISA 3SQ2A 1A5XA 1UWBA 2HHVA 1S5JA 4J2BA 2RN2A 4CEFA 3SJJA 1IO2A 4CHPA 4RW8A 3LPTA 3CQ8A 4KHYA 3WNFA 3SCXA 5SZTA 4M3ZA 4KB0A 1VSKA 2X74A 3TAGA 1X9WA 1HJRA 3L8BA 4RW9A 4DS5A 4E7IA 1U47A 4B8AB 4MQ3A 5HRSA 3OYMA 1TK8A 4CEBA 3NH2A 1WAJA 2RF2A 3HP6A 4C8LA 1O1WA 2FBXA 3EYZA 2A1RA 1S1WA 2YNFA 3O4QA 4KHUA 3DLRA 5KI6A 3PX6A 4JRPA 1S1UA 4FLWA 2DFHA 3AVAA 4KHWA 3LPUA 3L2QA 1HNVA 3MXIA 2B5JA 4QOZB 2O4IA 4ID1A 3OYDA 4JRQA 3V81A 2QKKA 4CGHA 4KHNA 4CHZA 3ALYA 3DM2A 4W5RA 3TAQA 3AVNA 3CM6A 3K58A 2P1JA 1UAXA 4CJPA 2IAJA 3SV3A 4B9LA 3M8QA 1B9FA 2Z1JA 3WNHA 5HRRA 4E1MA 1NKCA 1Y97A 1XHXA 1VSMA 4NCAA 3NGZA 3PX0A 1FK9A 5CYMA 1NKBA 4CJQA 4JLHA 1NK0A 4PY5A 3L3VA 4IG3A 4IFVA 4QAGA 3NDKA 3I0RA 2R7YA 4CJWA 2XY6A 2PYJA 1U4BA 4LSNA 1T03A 4CF9A 3KTQA 4O0JA 4KI6A 2HB5A 5KGXA 4DLEA 4FLTA 4BE2A 2Z1IA 4H8KA 3TAFA 1J54A 3ZSRA 3LZJA 4F2RA 1JLEA 3OYKA 3KIOA 1NK9A 2G8FA 4W5NA 1QSLA 5I42A 4DQRA 4NYNA 5T7BA 4BWMA 2HVIA 3QERA 4AILC 1WSGA 1RTIA 3VQBA 1HYZA 2DTUA 3DI6A 3VQPA 2EX3A 3IRXA 3QLHA 4DFPA 3HVRA 1RCHA 4RG8A 3KK1A 4BWJA 2PZSA 4FJ5A 3C6TA 3VA0A 3KD5E 3VQ7A 4FXDA 1VSDA 5HRNA 3NFAA 3SPYA 4ICLA 3M8SA 3OYNA 3JYTA 4I2QA 3V1RA 5CZ1A 3CFPA 1TK0A 4WE1A 3ZSOA 5KRTA 3P5JA 2OPPA 2XRIA 1G15A 1TL1A 4HUFA 4FJMA 5CYQA 3SQ4A 2PY5A 4E0DA 1SL2A 3QEXA 4DSLA 5FROA 1LW0A 4M42A 2QK9A 3I8DA 2YNHA 3DLGA 4Z4HA 1RDAA 2JGUA 4KPYA 4CJKA 2VWKA 2OPSA 3ASMA 4E7LA 3AVJA 4CJLA 4CGDA 1SKWA 4DSKA 3OS1A 4OPJA 3TAEA 4B9VA 4PUOA 5J2PA 3AVFA 4FW1A 4DF8A 4KI4A 3VQAA 3O4NA 4I9LA 4FJ7A 3NF8A 1SKSA 3QINA 2HHWA 4EZ9A 1W9HA 4CGJA 3VQ9A 3VQ4A 5FDLA 3PO4A 4FJLA 1IKWA 3P83D 4DQIA 3LAMA 3VQQA 4FJNA 4ELTA 1RDDA 3AVCA 3V1OA 1TAQA 3KLIA 1R0AA 1WAFA 2X6SA 4AH9A 4CJFA 3ZCMA 4Y1CA 4CEAA 1ZBUA 3A2FA 1XHZA 4M3WA 4QCLA 1NJWA 1HYVA 3F9KA 4O55A 3BGRA 3VQCA 3G0ZA 3OYHA 4GMJB 4E7HA 3OS2A 3ZSZA 2HNYA 3QETA 2G8IA 1KVAA 4BE0A 4KHQA 4FK4A 1U45A 3KKRA 1XWLA 3OYFA 1UOCA 2X6NA 5DK5A 2KFZA 3HVTA 1RT3A 1WN7A 3SQ1A 4B9NA 2G8KA 2BANA 4IBNA 4DSJA 4FZZA 5C42A 2HMIA 3AO5A 4BACA 3AA3A 3NAEA 3QEVA 4M3YA 3SI6A 2IGIA 1EX4A 4NCGA 3SZ2A 3LALA 3SV4A 1VK0A 3IS9A 1U49A 3ZSYA 3HO1A 4F4KA 1WNSA 3MEGA 3MXJA 3LWMA 2HHUA 4BDPA 3HPOA 4FLZA 3SPZA 3DLKA 1VRUA 4CGFA 2WOMA 2FBYA 1CLQA 3SYZA 1RTHA 1TKTA 2FC0A 3AV9A 1N5YA 4DTRA 1F21A 1J53A 3DMJA 4OJRA 3KLEA 2A1SA 3K5OA 2BGGA 1BGXT 4M45A 1JL2A 3S9HA 1T05A 1IG9A 1T8EA 3ULDA 4CHNA 3RMAA 4OLAA 4HUGA 3T3FA 3DRPA 3AVIA 1ZBFA 2HVHA 2HNZA 3V1QA 3HXMA 4J2DA 2ETJA 4HVJA 1VSEA
chains in the Genus database with same CATH superfamily
4YOXA 3AAQA 3AA2A 2G8VA 2E2QA 2HHXA 3IFRA 2E5LK 3SMPA 1MU2A 3O9SA 4CHOA 4J2AA 1NK4A 5AZJB 5JS2A 2VQFK 4F2SA 1QZ6A 4DV6K 2O8BA 2ZJRL 4BR9A 3NF6A 3LZIA 5TKYA 3PV8A 4F3OA 1NOYA 3SNNA 1S9EA 3OA9A 4B1ZA 4K8XA 1TAUA 4O0IA 4B1UB 5BPNA 4B1WB 1Q86O 3WXMB 1NOZA 5AQVA 4JKGB 4X65K 1SKRA 1HRHA 2Q2RA 1WSHA 4IDKA 3VETA 1ASUA 2CH5A 1K8KA 1HYSA 1RDWX 2WONA 3SAHA 1ATNA 3CIPA 3CJ1A 3ZT1A 1ZBIA 4FJIA 3KLFA 2FF6A 1QQOA 4DR5K 3OYCA 2UUBK 2DFFA 1RDCA 5C2FA 4DUYK 1WBDA 1BIZA 1HQEA 3EY1A 1S6PA 1ZXOA 4L3QA 2NRZA 3WXLA 1HJOA 1TGOA 2RPIA 3HM9A 2WFBA 4CBWA 2YHWA 3V9WA 3KK2A 2E6MA 2QA4N 4JK9A 5LJVA 1JLGA 3RTVA 1NK6A 5DMRA 3QNNA 1WSFA 1CZ9A 2CGJA 1MDUB 4JKDA 3C7NA 3FZFA 1XI1A 1MWMA 1VQ5N 1BG3A 1DT9A 4NYFA 1HX1A 4FM0A 1U2VA 1GLLO 4K41A 4DR1K 5F1XA 4FW2A 3MN5A 4BRAA 4QS8A 1BOTO 2QI2A 4DFKA 4DUZK 5EXWA 1GLDG 5EVZA 3NCIA 3SUNA 4ISFA 4Z4IA 4IEIA 2KQ2A 1Q18A 4JD2A 1X9MA 1T7PA 1CXQA 1BQNA 3ZETB 4CK3A 1L3SA 4Z4FA 4B9TA 4DTXA 3I56N 4FWRA 1JLCA 1QS4A 4X62K 5HRPA 3SAGA 3RRHA 3VTIA 4CE9A 4BR2A 4B3SK 3O1BA 3ZSXA 1VSFA 3SAFA 3TTFA 1SZ2A 2QWNA 4B9SA 4HCCA 3C6UA 2E2OA 3W0LA 3ZSVA 4FJGA 1Z05A 2FF3B 1KFSA 2P9IA 2D0BA 3AVGA 3OS0A 3O9UA 4JI4K 3LL3A 3TWHA 1WB9A 3TTCA 3MAQA 3F2KA 4DTMA 3CG7A 2NRWA 1RBVA 3EO3A 4I7FA 3ZT2A 2YKMA 1TKDA 4IG0A 3EE8A 4ZTFA 5JLFA 3L2WA 1GOCA 5CR4A 1KRPA 1I94K 4BQZA 3NF7A 1E4GT 1IG8A 3CCQN 4BC5A 3A5MC 1NK5A 4FJKA 2F7TA 2HW3A 5GAHP 3HZ6A 4LD0A 4FK2A 3CCMN 2ITGA 4CD1A 2P9KB 1NGEA 5LJWA 4DHYA 4DLGA 1LWCA 3VN5A 2UXCK 1RBSA 1B9DA 3UB5A 4BRLA 3HT3A 3M8RA 2O8FB 3THYB 4ELVA 4E19A 1NK8A 3TARA 5AQJA 4CIEA 4B1YB 2HHWA 2UUAK 3HP9A 3C65A 3K9KA 4FWMA 4KRFA 3WNEA 2I7PA 2KZZA 4A61A 3AVHA 5M1KA 3RMCA 5C15A 1K73O 4FVMA 4Y1DA 2IVPA 4JV5K 2QTDA 3MN6A 3EEQA 3SUQA 2P9SB 3QB0A 3CCRN 4PQUA 1ATRA 1WSJA 2ZD1A 1BUPA 4ILGB 4EIAA 3B6PA 3DXKA 4CZMA 3T19A 3MX2A 2XO7A 3ID8A 1KCFA 1L3TA 4FJHA 3L6QA 4E1NA 4O4GA 1ZBLA 1NGFA 3O9QA 3A5OC 3UKUB 3K5NA 2AA4A 3SUOA 2YNGA 2GELA 3TANA 4DV5K 3O5BA 4F8RA 2YNIA 3AA4A 4CZLA 3P4IA 4CEQA 4B3TK 3TU5A 2QWPA 2XY5A 1LCUA 4HWIA 1NGDA 4BRCA 4O5BA 1KC8O 3TTDA 1EP4A 4JI7K 2UXBK 2ATQA 4IFEA 3OBYA 2D0OA 2NZTA 3QBWA 4DB3A 1RT7A 3DRSA 2LSNA 4Z0UA 4FWLA 1BQMA 2GV9A 3G71N 3CJBA 3KK7A 2VWJA 3WT0A 5BPLA 4XIUA 2G8WA 1TYQA 3T7ZA 2ASPA 3S3NA 1C1CA 1S1VA 4JI6K 1C0MA 3O9RA 3TAPA 4DG1A 3T1HK 1D5AA 2XHBA 3CMEN 4DSEA 3FZKA 4CBUA 1A5XA 4C23A 1S5JA 4CEFA 3FZLA 3SJJA 1IO2A 2W41A 4CHPA 4RW8A 2E88A 3VEVA 3WNFA 2P9LB 3TAGA 1X9WA 5JVGL 3L8BA 4RW9A 4DS5A 4E7IA 5M1FA 4PKGA 2O8EA 3EYZA 4KHUA 4O8KA 3ENOA 4JEPA 3VTHA 2DFHA 1XMOK 4QOZB 1X3NA 2O4IA 5M1PA 2QKKA 4CHZA 3ALYA 3DM2A 4W5RA 3TAQA 1T6CA 2P1JA 3SLCA 4B9LA 4B9QA 1Y97A 4NCAA 3PX0A 4PY5A 3L3VA 2XY6A 4IFVA 4IEEA 4QAGA 5AJ3K 3MWPA 2PYJA 2RE2A 3CXCM 3TAFA 3DLLL 4F2RA 1JLEA 2Q97A 3KIOA 5GIOA 3OYKA 2G8FA 4W5NA 5I42A 4DQRA 5T7BA 4GNIA 4GKJK 4J8FA 4ISGA 3QLHA 4DFPA 3N4QA 4RG8A 3VA0A 4FXDA 5HRNA 2GWKA 3M8SA 3V1RA 3CFPA 3A5LC 3HM8A 3ZSOA 1U6ZA 1TL1A 3SQ4A 5HOOA 3M6GA 1BO5O 2JGUA 4KPYA 3ENHA 4CJKA 2VWKA 4OPJA 5TKWA 4PUOA 5FPNA 4FW1A 1JCEA 4FJ7A 4FSVA 1XC3A 4K0KK 4FJLA 1IKWA 4FJNA 4ELTA 3THXA 4PKHA 5KPRA 3V1OA 1R0AA 1VQ6N 3CD6N 4CEAA 4M3WA 3OYHA 4GMJB 2EWSA 3VERA 3QETA 3HI0A 4JAXA 1NGIA 1XWLA 4NXNK 1UOCA 5LY3A 1WN7A 1ZBSA 4FOEA 4IBNA 4CZJA 3NAEA 2IVNA 4NCGA 1VK0A 1VQMN 1U49A 3WQUA 5JLHA 2HHUA 3AARA 3I33A 2W40A 1TKTA 3AV9A 3J7AP 1Q81O 4G9ZA 3I55N 2W6LA 1Q7YO 3LDQA 1BGXT 4M45A 2P9PB 3VMFB 3B8AX 3LDPA 4HUGA 3T3FA 2YI1A 5IT9O 3VGLA 2ETJA 4CZGA 1U48A 1L3UA 3T69A 1JL1A 1DLOA 5EOYA 4KH6A 3FFKB 4BRQA 4CJEA 3OYEA 2Z1HA 2VG6A 4GV3A 1XC9A 3RR8A 2QWOA 1Q82O 3AO4A 4H03B 3KKSA 4B9UA 1FW6A 4CFCA 5F2RA 4WCEL 4FJ8A 1QQNA 3DAWA 4OVLA 3I8BA 3V9ZA 1C1AA 3K59A 2Y1IA 1KVCA 5AQIA 4CZHA 1HPZA 1YAGA 1B92A 2ITMA 3UKRB 3ITHA 4E89A 1Z26A 4CBXA 1L5UA 3E1YA 4B08A 5CHIA 4FOIA 1I3AA 5AZIB 2FSJA 2QXFA 4LF6K 3L2VA 4MLEA 1X1PA 1OH6A 4BRIA 2WTUA 2CGKA 1OH5A 3CC4N 3HJFA 3D2EB 3EZWA 3PIOL 5AQHA 3CFRA 1TKZA 4H5WA 3VPZA 1WBBA 1YI2N 1YVUA 1RTDA 1O13A 3V4IA 4CJ3A 1RT5A 1YJWN 4DTNA 1X9SA 2HHQA 3NH1A 2P9NA 3DLHA 4CF2A 3Q7BA 2FSNA 5GADP 2ZJQL 2G8HA 1CXUA 4CFAA 3MN7A 3PX4A 4GKKK 3AY9A 4CHQA 3V9XA 5BRHA 1HKBA 3NH0A 5AQSA 1KFDA 4RW6A 4OLBA 4IO8A 4A2AA 2GBZA 2HF4A 2PBDA 1KSPA 5DM7L 3O80A 3U9ZA 3VQ6A 3KWGA 4BGBA 4DSFA 4KFBA 3SJHA 4KHSA 4OKEA 2YHXA 4M7XA 5C24A 3ISNC 4FLYA 3RMDA 1VQLN 4C8KA 3QNOA 4M3TA 4FLXA 3E9PA 3MK6A 3OJSA 2J4RA 5AFUA 5AQGA 3ZX2A 4EZ6A 2O8BB 1BCMA 4H0XB 3TAMA 4CF1A 4EFHA 1BI4A 1XMQK 3T1YK 1TK5A 1VAZA 5B8HA 3K0SA 3SQ0A 3ZX0A 4FK0A 2BTFA 5K14A 2WUSA 3QEPA 3LM9A 4BRMA 5JS1A 1XQSC 4FJJA 3IUCA 1U04A 5KGWA 3WNGA 2D0AA 4JKFA 1N6QA 1K6YA 4TSXA 4B3MK 1EXQA 3L4QA 3QEWA 3MX5A 1IJJA 1K8KB 4KKOA 1IKXA 1RBTA 1V4TA 3WEEB 1IH7A 4BDZA 3RMBA 1C6VA 2NNWA 1N34K 1VQPN 4XH1A 1VQ8N 3VQ5A 2RHKA 1BHLA 3QEIA 1JLAA 1JLQA 2KZMA 3O3HA 2NRVA 4CF8A 5AQLA 4PWDA 3C6AA 1TUYA 2HMPA 3H3OB 4LSLA 2PYLA 4H5TA 4BQLA 3F73A 1QSSA 3C7NB 4H5NA 4DFJA 4NLBA 2NUBA 3LDOA 1BA0A 3KZBA 2E2NA 1NGCA 1KXPA 4DU1A 2A41A 3H46O 3DYAA 2O8CA 1Q8IA 4LF8K 2AJQA 2UYTA 2ZGZA 4KREA 4JD2B 3CPWM 3HPGA 1TVRA 3AVLA 3WXKA 2QKBA 2ZF5O 1QE1A 1YJNN 3MDQA 3OVNA 1VQON 2KTQA 1EKEA 4BC4A 5HLFA 1HKCA 4EP5A 3VQDA 1HNIA 4B3RK 1VQ9N 4K25A 4DTUA 4W5TA 4ILHA 3VF4A 3CM5A 3LP0A 4FPAA 3CPEA 4DTSA 3EL2A 2YHBA 5EY4A 3BF3A 4DV1K 2P9IB 4IOCL 5AQNA 4B3OA 2VGNA 1OVQA 3PSFA 3M3ZA 2HBMA 4H5VA 4HTUA 1LWEA 4FWPA 1DTTA 4CK2A 5M1QA 3C95A 1S72N 4I9QA 2XY8A 4JK7A 2KKZA 1XUPO 4RWTA 2DFEA 3VEOA 2W42A 3DJCA 5CZ2A 5E41A 2D0CA 5C10A 3DLBA 1BCOA 1VRTA 2QEXN 3RR7A 1KAZA 2JLEA 5AQPA 5HBMA 1T3VA 4BRKA 1RT6A 2P51A 3R9PA 4CJ5A 3C94A 3QIOA 2OANA 5J2MA 3M1FA 4YOWA 2KFNA 1REVA 3UIQA 3C0BA 4YFUA 2HHSA 4C8MA 4OPKA 4KV8A 1C0UA 1S6QA 3KLGA 3JSMA 2XY7A 2HHVA 4AF1A 3W3DA 4KHYA 3SCXA 4KB0A 1HJRA 5F0XA 1U47A 4MQ3A 4CEBA 3NH2A 3ZX3A 2ZWHA 5AQOA 1BDGA 2CH6A 2A1RA 3DLRA 3VOVA 4MDBA 1S1UA 4BR0A 3AVAA 4YORA 5BN8A 3MXIA 2B5JA 3DXMB 3V81A 1D4XA 4MDAA 4CGHA 3HTVA 5C12A 3AVNA 3CM6A 5LMUK 3M8QA 2Z1JA 4IZ9A 1VSMA 3NGZA 5CYMA 1NKBA 1RFQA 4JLHA 4CJQA 3IDHA 3EKSA 4IG3A 1JJ2M 3I0RA 4CJWA 3D2FB 1DKGD 1T03A 4O0JA 1X9JA 4KI6A 1HNWK 4BE2A 1J54A 2QWLA 3LZJA 1NK9A 2BH1A 2GEMA 4JK8A 3SBGA 3M5RA 1NBWA 2EX3A 5KQ8A 5E84A 1RCHA 1C0GA 1YXQA 4BROA 3C6TA 1GLEG 4JKAA 3GG4A 2JWKA 3SPYA 1S22A 3L0QA 1K9MO 3N4PA 1TK0A 4WE1A 1G15A 1TYQB 4HUFA 2YCHA 4FJMA 4E0DA 1OH8A 3QEXA 4DSLA 5FROA 2YNHA 1YHQN 4E7LA 1SKWA 2OPSA 3AVJA 3TAEA 3AVFA 4DF8A 4KI4A 3CQXA 3KHYA 3NF8A 4ISEA 4M63C 1VQ4N 4YDUA 4CGJA 3VQ4A 2HHHK 3PO4A 1J6ZA 3CMAN 4HTLA 1RDDA 3AGKA 4WFNL 1TAQA 3KLIA 3RVCA 4CJFA 3GE1A 4Y1CA 3ZCMA 3JAMO 2O8EB 5FPDA 1NJWA 2Q0UA 3H6EA 3BGRA 4ILJA 4E7HA 3OS2A 3ZSZA 3CJ7A 2G8IA 5BR8K 4FK4A 1U45A 1T6DA 1ESVA 3K9JA 3HVTA 4H5RA 3CCEN 2G8KA 4LC9B 4DSJA 3AO5A 5AQRA 5C0YA 2IGIA 1EX4A 3CCUN 1WNSA 4LFBK 2GUPA 3MEGA 3MXJA 4DR6K 5KPZA 4BDPA 4DV4K 3SYZA 1CLQA 1QZ5A 2BGGA 3CCVN 3C6HA 1JL2A 1T05A 3FE1A 4B1VA 4CHNA 2I7NA 4M7YA 1IV0A 1P8ZA 3AVIA 1ZBFA 4O5FA 4CW7B 3V1QA 3MCAB 5E26A 1ASWA 3CCJN 5J2QA 3QESA 2Q31A 4FLUA 4DQSA 4LF7K 4M41A 5AQTA 1NU0A 5CY4A 1KLNA 1MA9B 5CE3A 1FXXA 1SL0A 3U3YA 1FKPA 2EHGA 1HMVA 3UKUA 5M1NA 3CCSN 5KTQA 2H3GX 4NO7A 2OYQA 2E4LA 3HOSA 2DPNA 4OPHA 2BDPA 1HLUA 2Y1JA 4BREA 3THXB 3ZSWA 4CZIA 1S1XA 1S3XA 3MXMA 1EO1A 4BR7A 3U9DA 5AQXA 4J2EA 2KW4A 1VSHA 1CZBA 1QHAA 4UQGA 4CIFA 1NMNA 3QIPA 3HPHA 3AVBA 2F4VK 1NJZA 4GV9A 1VSIA 4KAZA 4FYDA 3LDSA 4IDHA 4JN4A 4UY8O 1HNZK 3LDNA 2IIRA 3S3OA 3QMLA 1VHXA 2VYPA 1Q9YA 2HOEA 3FGUA 1VSLA 1W2BM 4KTZA 2I5JA 2YHAA 1MWKA 4CD3A 4I2PA 2Q36A 4KB1A 4YOVA 3E01A 5AQYA 3I0SA 3R1XA 4IKFA 3RRGA 2E20A 4A5BA 5KPTA 3OYBA 4JI1K 4CI6A 2YHYA 5I3UA 4N47A 4DTPA 4OPAA 4DR4K 3HK2A 3QFUA 4OX9K 3ULEA 4BRHA 5EX5A 3PY8A 5FRMA 3TR8A 1N8RO 1JCGA 4H0TB 3THWA 3MEDA 2HHTA 1Y64A 3QBXA 4X66K 3FZMA 3GOIA 3ZT3A 4A5AA 4YNQA 4HHTA 4A62A 4U7BA 3HOTA 3PUFA 5AQWA 2E1YA 2BE2A 2FBVA 5H1SQ 3LWLA 3ZT0A 4B8CA 2V7ZA 3V6DA 1EWQA 4LFCK 4BG8A 5AQQA 4R5PA 3RSEA 3NVKA 1KAYA 3VESA 3ENBA 4CCHA 1WOQA 4AM6A 4CJUA 3AAPA 3VA3A 4K43A 3OYGA 3KK3A 1J5OA 1GLJO 4H4MA 4FZYA 4GW6A 3LDLA 3V9UA 2QWQA 4U67L 4C8NA 2WC9A 5BPMA 4F9OA 3LANA 4CZEA 1H1VA 1RNHA 4DSIA 1XNRK 4Z4EA 4CFBA 1NGGA 4CJRA 3K5MA 4FM2A 3T1AA 3V9SA 4E7KA 4GY2B 4CJ4A 1A5WA 2HF3A 1YUWA 2OCEA 1NM1A 3GL1A 3QICA 4MLHA 1IKVA 4CGGA 5IWAK 3RWUA 4BDYA 2PFUA 2YV0X 3P1GA 4A2BA 5FLXO 3NHGA 4BC2A 4DQQA 1HPMA 1ZYQA 1QTMA 1OVYA 5BRFA 1NWKA 3J8AA 3ZEUB 4N41A 4FJ9A 4BR5A 3LAKA 4YDUC 1QVGM 3HRGA 2P9NB 4EP4A 1GOAA 2Z1GA 1W97L 4PHTX 4DCHA 3NGYA 3D6RA 3M8PA 1IBKK 1KQSM 4WYBA 4QS9A 4W5QA 4N56A 3OY9A 3IKMA 2VWBA 5AQZA 3L2UA 4JS5A 1P90A 1VQKN 2F8SA 3HSTB 1QSYA 3AA5X 3HL8A 4KBOA 1LV5A 1GLCG 2FBTA 4CF0A 4OKJA 3F9MA 3TABA 4JS4A 4FLVA 1ASVA 3E66A 5AQFA 4DU4A 4M3RA 2QXLA 3DLEA 3LM2A 2E8AA 1BI4B 1HR0K 5JVHL 1DEJA 3NF9A 1RT4A 4H4OA 1FJGK 2RKIA 1KVBA 1JCFA 4OKKA 4AHRA 1IKYA 4O8UA 3CJCA 4DV2K 3K5LA 4DU3A 4RW4A 1YVNA 3GBTA 5J1EA 4Q5VA 2X78A 1RTJA 3H08A 2F96A 2IDOA 5ADXH 3O3FA 4H0YB 4OGCA 4FL9A 2HBJA 1L3VA 4PKIA 3LP3A 1N33K 5MLCQ 5HROA 2P9UA 4NB4A 3CFOA 4ID5A 1LAWA 1RBRA 2D0PA 1S1TA 4NLCA 3MEEA 4JKHA 1RILA 4BE1A 3BEXA 1W0HA 4M3XA 1JKHA 1D9FA 2O4GA 3B6OA 4C8OA 4CJVA 3AO3A 3EZ5A 1BL3A 4XEIA 4DQPA 1D9DA 2V52B 4FWNA 4ZHRA 1UA0A 1KLMA 3G10A 1Z25A 4GVMA 3THVA 2F9TA 5HP1A 3NMUA 3FFIA 4KH4A 1SS6A 1SL1A 3P31A 4LF9K 1N36K 1GOBA 1Q9XA 2WBNA 1GLFO 3A5NC 4FM1A 4DMNA 1V4SA 1C0FA 5FRNA 1BA1A 3L4IA 3OYIA 2O8CB 4MO5A 3S3MA 3CQYA 2JWLA 1YITN 4CK1A 1IBMK 2VG7A 2OTJN 3QO9A 1BISA 4J2BA 4DR2K 2E2PA 1EWRA 1OKJA 3O8MA 3G6EN 1VSKA 2X74A 4JI5K 4K42A 4B8AB 2V51B 5HRSA 1TK8A 3OYMA 1WAJA 2RF2A 2FBXA 2A42A 3ZLJA 3TPQA 3LPUA 3L2QA 2OTLN 4KHWA 3OYDA 1M1KO 5ELZA 4AQYK 4A59A 2QWRA 4CJPA 3BP8A 2O8DA 3WNHA 5HRRA 4E1MA 1NKCA 1XHXA 1FK9A 3OW2M 2QWMA 1U2VB 4I6MA 2BUPA 2PAVA 1U4BA 1WUAA 4LSNA 4CF9A 5KGXA 4DLEA 3OBWA 4H8KA 3H45C 4MO4A 1QSLA 2HVIA 4BWMA 3QERA 4JHDA 3TSPA 3VQBA 1RTIA 4YHHK 4AILC 3DWLA 1HYZA 4NXMK 4YOYA 2DTUA 2W6KA 3VQPA 3TSUA 3IRXA 2NRTA 3A0IX 1Z6RA 2PZSA 4FJ5A 3NVMA 3G4SN 1VSDA 3NFAA 3CCLN 3ATUA 4I2QA 5CZ1A 5KRTA 3P5JA 2OPPA 2XRIA 5CYQA 2PY5A 3MN9A 1SL2A 1LW0A 3WEEA 4M42A 4C1NI 3I8DA 3ATVA 3ASMA 4CJLA 4CGDA 3OS1A 4B9VA 5J2PA 5KQDA 5BREA 5AZJA 4V19S 3O4NA 4I9LA 1RGIA 1QVFM 3BZKA 5FDLA 1SAZA 3P83D 1RDUA 4DQIA 1K8AO 1NJIO 5AR0A 2X6SA 4AH9A 3CERA 3QDKA 4LF5K 4CJ7A 1XHZA 3UE5A 2ZM6K 3WXJA 4O55A 3G0ZA 5GAEP 1EQYA 4WF9L 1KVAA 1NGAA 3OYFA 4BG9A 2X6NA 3VF2A 1NG9A 3SQ1A 4FWSA 3BF1A 3QFPA 3FZHA 5C42A 2HMIA 3QEVA 4M3YA 3IMXA 3SZ2A 4JKGA 3LALA 3HO1A 4F4KA 3R3LA 3LWMA 3VEXA 2UUCK 4EAHD 3SPZA 1X3MA 4H0PA 3DLKA 2FBYA 1RTHA 2FC0A 1N5YA 1F21A 3DMJA 4OJRA 2A1SA 3CJ9A 3K5OA 5BRDA 1BWFO 3S9HA 2QM1A 2KLAA 4DR7K 3JS6A 3RMAA 2F9WA 1YF5L 4E1JA 1NMDA 3DRPA 2HVHA 3VF6A 4J2DA 2YX6A 4HVJA 3J80O 1VSEA 5C2DA 3JXUA 4YY3K 2A40A 4YOTA 4BVPA 3A8YA 5I9EB 3J81O 1QQCA 4KO0A 4F3TA 2OZMA 3IAYA 3VQ8A 3DXKB 1RDBA 4Z4CA 4GVEA 3OYJA 1RBUA 1VSJA 4BRFA 2ZE2A 3AO2A 4GV6A 1WSIA 4W5OA 2NLXA 1ILYA 1YJ9N 4LH5A 4X64K 1JLFA 1D8YA 4JI3K 4CEZA 3HSCA 2E1ZA 4BRGA 4CHYA 1WSEA 4Z4GA 4AHVA 1NGJA 4ZTJA 4BY9C 1TUUA 4DF4A 3IG1A 4K8ZA 1UA1A 4Q0BA 2OA8A 3ZETA 4G1QA 1TL3A 4JI8K 5M1OA 4XH4A 3NE6A 1WLJA 4XH5A 4FWKA 4ELUA 3L3UA 3VGMA 1EETA 4BVOA 5JMVA 1NNEA 1JLBA 4HCBA 5GIPA 1RT1A 3OYAA 4LFAK 4WFAL 4CIGA 2OZSA 4IOXA 4AM7A 4WQ4C 1SQKA 2P5OA 4Y0WA 5C25A 3ZSQA 1LOTB 3AVMA 4C1NK 4CGIA 3FLCO 4KHPK 1CZAN 3SUPA 1FKOA 1J9AA 2ZQBA 1E3MA 3ZYYX 4MFBA 4FCYA 1HUXA 2G8UA 4FWOA 4IO9L 3DXMA 2A6AA 2AP1A 4DS4A 2FXUA 1GLBG 3U3GA 1QHTA 1QQMA 2P9KA 3BUZB 3GDQA 2OPRA 3D2FA 2ASMA 1LAVA 4WQ5A 3LP2A 2D1KA 3K57A 2O8FA 3R6MA 3MMVA 3O9TA 1SV5A 3THYA 3L2RA 4EHTA 3KWIA 3VQEA 3DRRA 3CYMA 4YOUA 4IFYA 3ID6A 4CJTA 5GAGP 1KD1O 3SK3A 1N32K 1NJYA 4CEDA 3OHRA 3S41A 3PO5A 2GUIA 3LP1A 5J2NA 4CEEA 1RT2A 1NKEA 2Q1NA 3MECA 2UU9K 1NJXA 1A5VA 1ITGA 3Q7CA 2P9SA 2F8TA 4CFDA 4OO1J 4RCHA 3MCPA 4DV7K 4BGAA 2NRHA 1C1BA 3TI0A 4PA1A 3PLAA 1ATSA 3PIPL 3OYLA 1J5EK 4CECA 3BY5A 3U8XA 1ZBHA 3P38A 2IS3A 3ULEB 4O44A 4RTFD 4CZKA 5A2QO 4RW7A 3VEYA 3K2PA 3O1WA 3THWB 1NLVA 1NK7A 2E6LA 4AHSA 4DTJA 4FZXC 1GLAG 3O6WA 4H0VB 4JKBA 2NRXA 3AO1A 4DWIA 4M3UA 4LY7A 2OPQA 5KRSA 4JKCA 4BR4A 3O4WA 1C0TA 2VG5A 3CHWA 3RSEB 3U6FA 1JXBA 2NRRA 5EU7A 1YTUA 3E9LA 4E3SA 1HQUA 3H1VX 5AQUA 3SMSA 3OTOK 3U4LA 2Q3SA 1JXEA 4DTOA 4B9MA 3ZT4A 4KH5A 1YTAA 4AHCA 3OJUA 3AVKA 3DOKA 3D0PA 3BDPA 2HNDA 2B6AA 4IWVA 3PSIA 3NGIA 2DY4A 3MWTA 2P9LA 5AQKA 4DFMA 4E7JA 2ZJPL 2YKNA 3CC2N 4AHUA 2VCPA 2P5GA 5D3GA 5FPMA 1HNXK 4NCBA 1YIJN 3TSQA 3KD1E 5SWMA 5JICA 4N76A 4CERA 3FR0A 2D5RA 2FLOA 3G25A 3DOLA 1TV6A 1TKXA 4CESA 1M90O 4JI2K 2IC3A 4DR3K 1YT3A 4CJSA 5BR9A 3KLHA 2IOCA 4CZFA 1BIUA 3R8EA 3HBTA 5DM6L 1HKGA 1I39A 3O3GA 4HUEA 5GINA 2Q0RA 1DGKN 4LH4A 1KTQA 4Z94A 3WUHA 4KTQA 3D45A 3HYFA 2VQEK 3O08A 1VQ7N 4CEOA 3NBPA 4DV0K 2HBLA 4KTWA 2ZGYA 1LWFA 5HL7L 2UXDK 3KVGA 3CI5A 1SUQA 3KJVA 4L8RB 2B4JA 4N5SA 5LMNK 1LW2A 2A3ZA 4EHUA 4IOAL 4AHTA 1S9GA 4OGEA 1DTQA 4FJXA 3SQ2A 4FWQA 1UWBA 4BRPA 4DKWA 1IBLK 2RN2A 2IVOA 3LPTA 3CQ8A 3J7ZO 5SZTA 4M3ZA 4JNEA 3WXIA 3HP6A 4C8LA 1O1WA 2FSKA 1ZC6A 1S1WA 2YNFA 3O4QA 3E9OA 5KI6A 3PX6A 1G99A 4JRPA 5BN9A 4FLWA 3CC7N 1HNVA 4BRDA 2P9UB 4ID1A 4JRQA 4KHNA 4WQ5C 3BZCA 3K58A 1UAXA 2IAJA 3SV3A 3EN9A 4WFBL 3WQTA 1B9FA 2KHOA 2YJEA 1R59O 4IJAA 1NK0A 3H3NO 3NDKA 2R7YA 3VGKA 3D7EO 3KTQA 2HB5A 2V7YA 4FLTA 2Z1IA 2YJFA 3ZSRA 2P9PA 4NYNA 4QS7A 1WSGA 3DI6A 3CF5L 3HVRA 3KK1A 4BWJA 1VQNN 3KD5E 3VQ7A 4ICLA 3JYTA 3OYNA 4IJNA 3CETA 3ZEUA 4JI0K 2QK9A 3DLGA 4Z4HA 1RDAA 1T44A 3J7YP 4DSKA 3H1QA 2VGMA 3CJAA 1W7AA 3VQAA 1BU6O 1SKSA 2A5XA 3QINA 4PL8A 4EZ9A 1W9HA 5ADXA 3VQ9A 4DV3K 3LAMA 5AFUH 3VQQA 1XNQK 2HSTA 4FVUA 3AVCA 1WAFA 3UKRA 1OH7A 1ZBUA 3A2FA 4QCLA 1HYVA 3F9KA 3SBTA 3VQCA 5AZIA 2HNYA 1E4FT 4KHQA 4BE0A 2QW9A 3KKRA 4BC3A 4R79A 5DK5A 2KFZA 1RT3A 4FPBA 4B9NA 1KAXA 2ASOA 3P39A 4JYAK 2BANA 3D2EA 4FZZA 4BACA 3AA3A 4A57A 4BRNA 3SI6A 2O8DB 4B1XB 3SV4A 5LL6Z 3IS9A 3ZSYA 4DQ8A 2HBKA 4CVNE 2D4WA 5AQMA 3HPOA 4FLZA 3EE9A 4JKEA 4I6MB 3VENA 1VRUA 4CGFA 2WOMA 3EKUA 3VEZA 4PL7A 4DTRA 1NGHA 1J53A 3KLEA 5FPEA 1NGBA 4FO0A 2GTDA 2GWJA 1IG9A 1T8EA 2CGLA 3ULDA 4JHDB 4OLAA 3F5TA 2GX9A 4LF4K 4H0OA 3VEWA 3AGRA 4WQ4A 2HNZA 3HXMA 4IXCA
chains in the Genus database with same CATH topology
1L3UA 1ASWA 5J2QA 3QESA 3AA2A 1JL1A 1DLOA 2G8VA 4FLUA 4DQSA 4M41A 3OYEA 5CY4A 4CJEA 1QQCA 2Z1HA 2VG6A 2HHXA 4KO0A 1KLNA 4F3TA 1FXXA 1XC9A 1SL0A 2OZMA 1U48A 3U3YA 3RR8A 3IAYA 3VQ8A 1FKPA 3AO4A 2EHGA 1HMVA 1MU2A 1RDBA 4CHOA 4Z4CA 3KKSA 4B9UA 4J2AA 1NK4A 5KTQA 5JS2A 4CFCA 3OYJA 4F2SA 4FJ8A 1RBUA 2OYQA 1VSJA 2E4LA 2ZE2A 3AO2A 1WSIA 4W5OA 2BDPA 2Y1JA 4OVLA 4LH5A 3V9ZA 1JLFA 1C1AA 3NF6A 3K59A 3LZIA 2Y1IA 1KVCA 3PV8A 3ZSWA 1D8YA 1S1XA 4CEZA 3MXMA 1HPZA 1NOYA 4F3OA 1B92A 4CHYA 1WSEA 4J2EA 4Z4GA 4AHVA 2KW4A 3ITHA 1S9EA 1VSHA 4E89A 3SNNA 1Z26A 1CZBA 1L5UA 4ZTJA 4UQGA 4B08A 4CIFA 4DF4A 4K8XA 1I3AA 1TAUA 4O0IA 3QIPA 3HPHA 3AVBA 3IG1A 2QXFA 4K8ZA 1UA1A 1NJZA 3L2VA 1X1PA 1VSIA 4Q0BA 2OA8A 4KAZA 4FYDA 3LDSA 4G1QA 1NOZA 3HJFA 1TL3A 3S3OA 1Q9YA 1SKRA 1HRHA 3CFRA 1TKZA 1WSHA 3NE6A 4IDKA 1WLJA 1VSLA 4KTZA 4ELUA 3L3UA 1ASUA 2I5JA 1YVUA 1RTDA 2YHAA 1EETA 3V4IA 4CJ3A 2WONA 1JLBA 1RT5A 4I2PA 4HCBA 4KB1A 1HYSA 1RT1A 3ZT1A 3OYAA 1ZBIA 3E01A 4FJIA 3KLFA 3I0SA 4CIGA 4DTNA 2OZSA 4IKFA 1X9SA 2HHQA 3OYCA 3RRGA 3NH1A 2P5OA 3OYBA 5C25A 3DLHA 4CF2A 2DFFA 1RDCA 3ZSQA 5I3UA 4N47A 3AVMA 4DTPA 2G8HA 1CXUA 1BIZA 1HQEA 4CFAA 4CGIA 1S6PA 3EY1A 3HK2A 3PX4A 3PY8A 5FRMA 3TR8A 3SUPA 4CHQA 3MEDA 3V9XA 1FKOA 2HHTA 1TGOA 2RPIA 3HM9A 1J9AA 2ZQBA 1KFDA 4RW6A 3ZT3A 3NH0A 4OLBA 2GBZA 4YNQA 4MFBA 4HHTA 4FCYA 1KSPA 3PUFA 3V9WA 2G8UA 3KK2A 2E6MA 3VQ6A 2BE2A 2FBVA 3LWLA 3ZT0A 4DS4A 4DSFA 4B8CA 1JLGA 3RTVA 1NK6A 5DMRA 4KFBA 3QNNA 3V6DA 4KHSA 1WSFA 4OKEA 5C24A 1CZ9A 3ISNC 4FLYA 4R5PA 3RMDA 1XI1A 3U3GA 1QHTA 4C8KA 3QNOA 4M3TA 4FLXA 2OPRA 4NYFA 4CCHA 3OJSA 4FM0A 4CJUA 4FW2A 3VA3A 4EZ6A 1LAVA 3LP2A 1BCMA 3OYGA 3TAMA 3KK3A 4CF1A 1J5OA 4DFKA 1BI4A 3K57A 4H4MA 1SV5A 4FZYA 4GW6A 3L2RA 1TK5A 3V9UA 3NCIA 3SUNA 4Z4IA 4C8NA 3VQEA 3DRRA 2KQ2A 3CYMA 3LANA 1RNHA 3SQ0A 4DSIA 4IFYA 4CJTA 4FK0A 4Z4EA 4CFBA 5K14A 4CJRA 3K5MA 4FM2A 1X9MA 3T1AA 1T7PA 3QEPA 4CEDA 3V9SA 4E7KA 1NJYA 3PO5A 4CJ4A 1CXQA 2GUIA 5JS1A 1BQNA 3LP1A 4CK3A 1A5WA 5J2NA 1L3SA 4B9TA 4FJJA 4DTXA 4Z4FA 1U04A 5KGWA 4CEEA 1JLCA 1RT2A 1NKEA 1QS4A 1IKVA 3WNGA 2D0AA 4CGGA 1N6QA 3MECA 5HRPA 1K6YA 3RWUA 4TSXA 4BDYA 3RRHA 1NJXA 1EXQA 1A5VA 2YV0X 3QEWA 1ITGA 4CE9A 2F8TA 3P1GA 3NHGA 4DQQA 4CFDA 1ZYQA 1QTMA 3ZSXA 1VSFA 4KKOA 4B9SA 1IKXA 4HCCA 1RBTA 3C6UA 3ZSVA 4N41A 4FJ9A 1C1BA 3TI0A 3LAKA 4FJGA 4PA1A 1IH7A 1KFSA 4BDZA 2D0BA 3AVGA 3OS0A 3RMBA 1C6VA 4EP4A 3OYLA 1GOAA 4CECA 1ZBHA 2Z1GA 3TWHA 2IS3A 3MAQA 3NGYA 3VQ5A 4DTMA 3CG7A 1BHLA 3M8PA 1RBVA 1JLAA 4I7FA 4O44A 1JLQA 3K2PA 4RW7A 3ZT2A 3QEIA 2KZMA 4W5QA 1NK7A 2YKMA 2E6LA 4N56A 4CF8A 4AHSA 3O3HA 3OY9A 4IG0A 1TKDA 4JS5A 3L2UA 4DTJA 4ZTFA 4FZXC 4PWDA 2F8SA 3HSTB 3L2WA 1GOCA 1KRPA 1QSYA 3AA5X 3HL8A 3NF7A 4LSLA 3AO1A 2PYLA 4DWIA 1NK5A 1LV5A 4FJKA 4M3UA 2FBTA 4CF0A 4LY7A 4OKJA 3TABA 2OPQA 4JS4A 5KRSA 3F73A 4FLVA 2HW3A 1QSSA 4LD0A 4FK2A 1C0TA 2ITGA 2VG5A 4DFJA 3U6FA 1ASVA 2NUBA 4DU4A 4DLGA 1JXBA 1LWCA 3VN5A 5EU7A 4M3RA 1RBSA 3DLEA 1YTUA 4E3SA 1HQUA 4DU1A 1B9DA 3HT3A 3DYAA 1BI4B 3M8RA 1Q8IA 2AJQA 4ELVA 4E19A 2Q3SA 1JXEA 3NF9A 1RT4A 4H4OA 1NK8A 2RKIA 4DTOA 3TARA 4CIEA 4B9MA 3ZT4A 1KVBA 4OKKA 4KREA 1YTAA 4AHCA 4AHRA 3AVKA 3DOKA 3OJUA 3D0PA 3HP9A 1IKYA 2HNDA 3HPGA 3BDPA 2B6AA 1TVRA 3K5LA 4DU3A 4KRFA 3WNEA 2KZZA 4RW4A 3NGIA 3AVLA 5J1EA 4Q5VA 2X78A 3AVHA 2DY4A 3RMCA 1RTJA 3H08A 4DFMA 4E7JA 2QKBA 2F96A 2IDOA 2YKNA 4FVMA 1QE1A 3OVNA 2KTQA 1EKEA 4Y1DA 5HLFA 4EP5A 3O3FA 3VQDA 4OGCA 4AHUA 1HNIA 3SUQA 4DTUA 2P5GA 1L3VA 1WSJA 2ZD1A 4W5TA 4PQUA 3LP3A 3CM5A 5D3GA 3LP0A 3B6PA 5HROA 4NCBA 3KD1E 4DTSA 5SWMA 3T19A 4N76A 3CFOA 2YHBA 4ID5A 4CERA 1KCFA 2XO7A 2D5RA 1L3TA 4FJHA 3DOLA 4E1NA 4O4GA 1ZBLA 1LAWA 4B3OA 1RBRA 3K5NA 1S1TA 1TV6A 1TKXA 4CESA 3MEEA 2YNGA 3SUOA 1RILA 2IC3A 4BE1A 1YT3A 4CJSA 1W0HA 3TANA 1JKHA 4HTUA 2O4GA 1LWEA 3KLHA 1D9FA 4F8RA 4M3XA 2IOCA 2YNIA 3AA4A 3B6OA 4C8OA 4CJVA 1DTTA 4CK2A 4CEQA 3AO3A 1BIUA 1I39A 1BL3A 3EZ5A 3C95A 3O3GA 4HUEA 2XY5A 4I9QA 4DQPA 1D9DA 4LH4A 2XY8A 4ZHRA 1UA0A 1KLMA 1KTQA 3G10A 1Z25A 4GVMA 3THVA 4O5BA 5HP1A 1EP4A 4KTQA 3D45A 3HYFA 2DFEA 3FFIA 2ATQA 1SL1A 2W42A 5CZ2A 5E41A 4CEOA 2D0CA 3DLBA 3NBPA 1GOBA 1RT7A 1BCOA 3DRSA 1VRTA 1Q9XA 4KTWA 2LSNA 1LWFA 4Z0UA 3RR7A 2JLEA 1BQMA 2GV9A 5HBMA 1RT6A 2P51A 4CJ5A 4FM1A 3C94A 3QIOA 2VWJA 5J2MA 1SUQA 4DMNA 3KJVA 4L8RB 2B4JA 2KFNA 1REVA 4N5SA 3UIQA 4XIUA 2G8WA 1LW2A 5FRNA 4YFUA 2HHSA 4C8MA 3OYIA 4AHTA 1S9GA 4OPKA 3S3NA 4KV8A 1C1CA 4OGEA 1C0UA 1S1VA 3S3MA 1C0MA 1DTQA 1S6QA 4DG1A 3KLGA 3JSMA 2XY7A 3TAPA 4CK1A 1D5AA 2XHBA 2VG7A 4DSEA 3QO9A 4FJXA 1BISA 3SQ2A 1A5XA 1UWBA 2HHVA 1S5JA 4J2BA 2RN2A 4CEFA 3SJJA 1IO2A 4CHPA 4RW8A 3LPTA 3CQ8A 4KHYA 3WNFA 3SCXA 5SZTA 4M3ZA 4KB0A 1VSKA 2X74A 3TAGA 1X9WA 1HJRA 3L8BA 4RW9A 4DS5A 4E7IA 1U47A 4B8AB 4MQ3A 5HRSA 3OYMA 1TK8A 4CEBA 3NH2A 1WAJA 2RF2A 3HP6A 4C8LA 1O1WA 2FBXA 3EYZA 2A1RA 1S1WA 2YNFA 3O4QA 4KHUA 3DLRA 5KI6A 3PX6A 4JRPA 1S1UA 4FLWA 2DFHA 3AVAA 4KHWA 3LPUA 3L2QA 1HNVA 3MXIA 2B5JA 4QOZB 2O4IA 4ID1A 3OYDA 4JRQA 3V81A 2QKKA 4CGHA 4KHNA 4CHZA 3ALYA 3DM2A 4W5RA 3TAQA 3AVNA 3CM6A 3K58A 2P1JA 1UAXA 4CJPA 2IAJA 3SV3A 4B9LA 3M8QA 1B9FA 2Z1JA 3WNHA 5HRRA 4E1MA 1NKCA 1Y97A 1XHXA 1VSMA 4NCAA 3NGZA 3PX0A 1FK9A 5CYMA 1NKBA 4CJQA 4JLHA 1NK0A 4PY5A 3L3VA 4IG3A 4IFVA 4QAGA 3NDKA 3I0RA 2R7YA 4CJWA 2XY6A 2PYJA 1U4BA 4LSNA 1T03A 4CF9A 3KTQA 4O0JA 4KI6A 2HB5A 5KGXA 4DLEA 4FLTA 4BE2A 2Z1IA 4H8KA 3TAFA 1J54A 3ZSRA 3LZJA 4F2RA 1JLEA 3OYKA 3KIOA 1NK9A 2G8FA 4W5NA 1QSLA 5I42A 4DQRA 4NYNA 5T7BA 4BWMA 2HVIA 3QERA 4AILC 1WSGA 1RTIA 3VQBA 1HYZA 2DTUA 3DI6A 3VQPA 2EX3A 3IRXA 3QLHA 4DFPA 3HVRA 1RCHA 4RG8A 3KK1A 4BWJA 2PZSA 4FJ5A 3C6TA 3VA0A 3KD5E 3VQ7A 4FXDA 1VSDA 5HRNA 3NFAA 3SPYA 4ICLA 3M8SA 3OYNA 3JYTA 4I2QA 3V1RA 5CZ1A 3CFPA 1TK0A 4WE1A 3ZSOA 5KRTA 3P5JA 2OPPA 2XRIA 1G15A 1TL1A 4HUFA 4FJMA 5CYQA 3SQ4A 2PY5A 4E0DA 1SL2A 3QEXA 4DSLA 5FROA 1LW0A 4M42A 2QK9A 3I8DA 2YNHA 3DLGA 4Z4HA 1RDAA 2JGUA 4KPYA 4CJKA 2VWKA 2OPSA 3ASMA 4E7LA 3AVJA 4CJLA 4CGDA 1SKWA 4DSKA 3OS1A 4OPJA 3TAEA 4B9VA 4PUOA 5J2PA 3AVFA 4FW1A 4DF8A 4KI4A 3VQAA 3O4NA 4I9LA 4FJ7A 3NF8A 1SKSA 3QINA 2HHWA 4EZ9A 1W9HA 4CGJA 3VQ9A 3VQ4A 5FDLA 3PO4A 4FJLA 1IKWA 3P83D 4DQIA 3LAMA 3VQQA 4FJNA 4ELTA 1RDDA 3AVCA 3V1OA 1TAQA 3KLIA 1R0AA 1WAFA 2X6SA 4AH9A 4CJFA 3ZCMA 4Y1CA 4CEAA 1ZBUA 3A2FA 1XHZA 4M3WA 4QCLA 1NJWA 1HYVA 3F9KA 4O55A 3BGRA 3VQCA 3G0ZA 3OYHA 4GMJB 4E7HA 3OS2A 3ZSZA 2HNYA 3QETA 2G8IA 1KVAA 4BE0A 4KHQA 4FK4A 1U45A 3KKRA 1XWLA 3OYFA 1UOCA 2X6NA 5DK5A 2KFZA 3HVTA 1RT3A 1WN7A 3SQ1A 4B9NA 2G8KA 2BANA 4IBNA 4DSJA 4FZZA 5C42A 2HMIA 3AO5A 4BACA 3AA3A 3NAEA 3QEVA 4M3YA 3SI6A 2IGIA 1EX4A 4NCGA 3SZ2A 3LALA 3SV4A 1VK0A 3IS9A 1U49A 3ZSYA 3HO1A 4F4KA 1WNSA 3MEGA 3MXJA 3LWMA 2HHUA 4BDPA 3HPOA 4FLZA 3SPZA 3DLKA 1VRUA 4CGFA 2WOMA 2FBYA 1CLQA 3SYZA 1RTHA 1TKTA 2FC0A 3AV9A 1N5YA 4DTRA 1F21A 1J53A 3DMJA 4OJRA 3KLEA 2A1SA 3K5OA 2BGGA 1BGXT 4M45A 1JL2A 3S9HA 1T05A 1IG9A 1T8EA 3ULDA 4CHNA 3RMAA 4OLAA 4HUGA 3T3FA 3DRPA 3AVIA 1ZBFA 2HVHA 2HNZA 3V1QA 3HXMA 4J2DA 2ETJA 4HVJA 1VSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3U A;  1ASW A;  5J2Q A;  3QES A;  3AA2 A;  1JL1 A;  1DLO A;  2G8V A;  4FLU A;  4DQS A;  4M41 A;  3OYE A;  5CY4 A;  4CJE A;  1QQC A;  2Z1H A;  2VG6 A;  2HHX A;  4KO0 A;  1KLN A;  4F3T A;  1FXX A;  1XC9 A;  1SL0 A;  2OZM A;  1U48 A;  3U3Y A;  3RR8 A;  3IAY A;  3VQ8 A;  1FKP A;  3AO4 A;  2EHG A;  1HMV A;  1MU2 A;  1RDB A;  4CHO A;  4Z4C A;  3KKS A;  4B9U A;  4J2A A;  1NK4 A;  5KTQ A;  5JS2 A;  4CFC A;  3OYJ A;  4F2S A;  4FJ8 A;  1RBU A;  2OYQ A;  1VSJ A;  2E4L A;  2ZE2 A;  3AO2 A;  1WSI A;  4W5O A;  2BDP A;  2Y1J A;  4OVL A;  4LH5 A;  3V9Z A;  1JLF A;  1C1A A;  3NF6 A;  3K59 A;  3LZI A;  2Y1I A;  1KVC A;  3PV8 A;  3ZSW A;  1D8Y A;  1S1X A;  4CEZ A;  3MXM A;  1HPZ A;  1NOY A;  4F3O A;  1B92 A;  4CHY A;  1WSE A;  4J2E A;  4Z4G A;  4AHV A;  2KW4 A;  3ITH A;  1S9E A;  1VSH A;  4E89 A;  3SNN A;  1Z26 A;  1CZB A;  1L5U A;  4ZTJ A;  4UQG A;  4B08 A;  4CIF A;  4DF4 A;  4K8X A;  1I3A A;  1TAU A;  4O0I A;  3QIP A;  3HPH A;  3AVB A;  3IG1 A;  2QXF A;  4K8Z A;  1UA1 A;  1NJZ A;  3L2V A;  1X1P A;  1VSI A;  4Q0B A;  2OA8 A;  4KAZ A;  4FYD A;  3LDS A;  4G1Q A;  1NOZ A;  3HJF A;  1TL3 A;  3S3O A;  1Q9Y A;  1SKR A;  1HRH A;  3CFR A;  1TKZ A;  1WSH A;  3NE6 A;  4IDK A;  1WLJ A;  1VSL A;  4KTZ A;  4ELU A;  3L3U A;  1ASU A;  2I5J A;  1YVU A;  1RTD A;  2YHA A;  1EET A;  3V4I A;  4CJ3 A;  2WON A;  1JLB A;  1RT5 A;  4I2P A;  4HCB A;  4KB1 A;  1HYS A;  1RT1 A;  3ZT1 A;  3OYA A;  1ZBI A;  3E01 A;  4FJI A;  3KLF A;  3I0S A;  4CIG A;  4DTN A;  2OZS A;  4IKF A;  1X9S A;  2HHQ A;  3OYC A;  3RRG A;  3NH1 A;  2P5O A;  3OYB A;  5C25 A;  3DLH A;  4CF2 A;  2DFF A;  1RDC A;  3ZSQ A;  5I3U A;  4N47 A;  3AVM A;  4DTP A;  2G8H A;  1CXU A;  1BIZ A;  1HQE A;  4CFA A;  4CGI A;  1S6P A;  3EY1 A;  3HK2 A;  3PX4 A;  3PY8 A;  5FRM A;  3TR8 A;  3SUP A;  4CHQ A;  3MED A;  3V9X A;  1FKO A;  2HHT A;  1TGO A;  2RPI A;  3HM9 A;  1J9A A;  2ZQB A;  1KFD A;  4RW6 A;  3ZT3 A;  3NH0 A;  4OLB A;  2GBZ A;  4YNQ A;  4MFB A;  4HHT A;  4FCY A;  1KSP A;  3PUF A;  3V9W A;  2G8U A;  3KK2 A;  2E6M A;  3VQ6 A;  2BE2 A;  2FBV A;  3LWL A;  3ZT0 A;  4DS4 A;  4DSF A;  4B8C A;  1JLG A;  3RTV A;  1NK6 A;  5DMR A;  4KFB A;  3QNN A;  3V6D A;  4KHS A;  1WSF A;  4OKE A;  5C24 A;  1CZ9 A;  3ISN C;  4FLY A;  4R5P A;  3RMD A;  1XI1 A;  3U3G A;  1QHT A;  4C8K A;  3QNO A;  4M3T A;  4FLX A;  2OPR A;  4NYF A;  4CCH A;  3OJS A;  4FM0 A;  4CJU A;  4FW2 A;  3VA3 A;  4EZ6 A;  1LAV A;  3LP2 A;  1BCM A;  3OYG A;  3TAM A;  3KK3 A;  4CF1 A;  1J5O A;  4DFK A;  1BI4 A;  3K57 A;  4H4M A;  1SV5 A;  4FZY A;  4GW6 A;  3L2R A;  1TK5 A;  3V9U A;  3NCI A;  3SUN A;  4Z4I A;  4C8N A;  3VQE A;  3DRR A;  2KQ2 A;  3CYM A;  3LAN A;  1RNH A;  3SQ0 A;  4DSI A;  4IFY A;  4CJT A;  4FK0 A;  4Z4E A;  4CFB A;  5K14 A;  4CJR A;  3K5M A;  4FM2 A;  1X9M A;  3T1A A;  1T7P A;  3QEP A;  4CED A;  3V9S A;  4E7K A;  1NJY A;  3PO5 A;  4CJ4 A;  1CXQ A;  2GUI A;  5JS1 A;  1BQN A;  3LP1 A;  4CK3 A;  1A5W A;  5J2N A;  1L3S A;  4B9T A;  4FJJ A;  4DTX A;  4Z4F A;  1U04 A;  5KGW A;  4CEE A;  1JLC A;  1RT2 A;  1NKE A;  1QS4 A;  1IKV A;  3WNG A;  2D0A A;  4CGG A;  1N6Q A;  3MEC A;  5HRP A;  1K6Y A;  3RWU A;  4TSX A;  4BDY A;  3RRH A;  1NJX A;  1EXQ A;  1A5V A;  2YV0 X;  3QEW A;  1ITG A;  4CE9 A;  2F8T A;  3P1G A;  3NHG A;  4DQQ A;  4CFD A;  1ZYQ A;  1QTM A;  3ZSX A;  1VSF A;  4KKO A;  4B9S A;  1IKX A;  4HCC A;  1RBT A;  3C6U A;  3ZSV A;  4N41 A;  4FJ9 A;  1C1B A;  3TI0 A;  3LAK A;  4FJG A;  4PA1 A;  1IH7 A;  1KFS A;  4BDZ A;  2D0B A;  3AVG A;  3OS0 A;  3RMB A;  1C6V A;  4EP4 A;  3OYL A;  1GOA A;  4CEC A;  1ZBH A;  2Z1G A;  3TWH A;  2IS3 A;  3MAQ A;  3NGY A;  3VQ5 A;  4DTM A;  3CG7 A;  1BHL A;  3M8P A;  1RBV A;  1JLA A;  4I7F A;  4O44 A;  1JLQ A;  3K2P A;  4RW7 A;  3ZT2 A;  3QEI A;  2KZM A;  4W5Q A;  1NK7 A;  2YKM A;  2E6L A;  4N56 A;  4CF8 A;  4AHS A;  3O3H A;  3OY9 A;  4IG0 A;  1TKD A;  4JS5 A;  3L2U A;  4DTJ A;  4ZTF A;  4FZX C;  4PWD A;  2F8S A;  3HST B;  3L2W A;  1GOC A;  1KRP A;  1QSY A;  3AA5 X;  3HL8 A;  3NF7 A;  4LSL A;  3AO1 A;  2PYL A;  4DWI A;  1NK5 A;  1LV5 A;  4FJK A;  4M3U A;  2FBT A;  4CF0 A;  4LY7 A;  4OKJ A;  3TAB A;  2OPQ A;  4JS4 A;  5KRS A;  3F73 A;  4FLV A;  2HW3 A;  1QSS A;  4LD0 A;  4FK2 A;  1C0T A;  2ITG A;  2VG5 A;  4DFJ A;  3U6F A;  1ASV A;  2NUB A;  4DU4 A;  4DLG A;  1JXB A;  1LWC A;  3VN5 A;  5EU7 A;  4M3R A;  1RBS A;  3DLE A;  1YTU A;  4E3S A;  1HQU A;  4DU1 A;  1B9D A;  3HT3 A;  3DYA A;  1BI4 B;  3M8R A;  1Q8I A;  2AJQ A;  4ELV A;  4E19 A;  2Q3S A;  1JXE A;  3NF9 A;  1RT4 A;  4H4O A;  1NK8 A;  2RKI A;  4DTO A;  3TAR A;  4CIE A;  4B9M A;  3ZT4 A;  1KVB A;  4OKK A;  4KRE A;  1YTA A;  4AHC A;  4AHR A;  3AVK A;  3DOK A;  3OJU A;  3D0P A;  3HP9 A;  1IKY A;  2HND A;  3HPG A;  3BDP A;  2B6A A;  1TVR A;  3K5L A;  4DU3 A;  4KRF A;  3WNE A;  2KZZ A;  4RW4 A;  3NGI A;  3AVL A;  5J1E A;  4Q5V A;  2X78 A;  3AVH A;  2DY4 A;  3RMC A;  1RTJ A;  3H08 A;  4DFM A;  4E7J A;  2QKB A;  2F96 A;  2IDO A;  2YKN A;  4FVM A;  1QE1 A;  3OVN A;  2KTQ A;  1EKE A;  4Y1D A;  5HLF A;  4EP5 A;  3O3F A;  3VQD A;  4OGC A;  4AHU A;  1HNI A;  3SUQ A;  4DTU A;  2P5G A;  1L3V A;  1WSJ A;  2ZD1 A;  4W5T A;  4PQU A;  3LP3 A;  3CM5 A;  5D3G A;  3LP0 A;  3B6P A;  5HRO A;  4NCB A;  3KD1 E;  4DTS A;  5SWM A;  3T19 A;  4N76 A;  3CFO A;  2YHB A;  4ID5 A;  4CER A;  1KCF A;  2XO7 A;  2D5R A;  1L3T A;  4FJH A;  3DOL A;  4E1N A;  4O4G A;  1ZBL A;  1LAW A;  4B3O A;  1RBR A;  3K5N A;  1S1T A;  1TV6 A;  1TKX A;  4CES A;  3MEE A;  2YNG A;  3SUO A;  1RIL A;  2IC3 A;  4BE1 A;  1YT3 A;  4CJS A;  1W0H A;  3TAN A;  1JKH A;  4HTU A;  2O4G A;  1LWE A;  3KLH A;  1D9F A;  4F8R A;  4M3X A;  2IOC A;  2YNI A;  3AA4 A;  3B6O A;  4C8O A;  4CJV A;  1DTT A;  4CK2 A;  4CEQ A;  3AO3 A;  1BIU A;  1I39 A;  1BL3 A;  3EZ5 A;  3C95 A;  3O3G A;  4HUE A;  2XY5 A;  4I9Q A;  4DQP A;  1D9D A;  4LH4 A;  2XY8 A;  4ZHR A;  1UA0 A;  1KLM A;  1KTQ A;  3G10 A;  1Z25 A;  4GVM A;  3THV A;  4O5B A;  5HP1 A;  1EP4 A;  4KTQ A;  3D45 A;  3HYF A;  2DFE A;  3FFI A;  2ATQ A;  1SL1 A;  2W42 A;  5CZ2 A;  5E41 A;  4CEO A;  2D0C A;  3DLB A;  3NBP A;  1GOB A;  1RT7 A;  1BCO A;  3DRS A;  1VRT A;  1Q9X A;  4KTW A;  2LSN A;  1LWF A;  4Z0U A;  3RR7 A;  2JLE A;  1BQM A;  2GV9 A;  5HBM A;  1RT6 A;  2P51 A;  4CJ5 A;  4FM1 A;  3C94 A;  3QIO A;  2VWJ A;  5J2M A;  1SUQ A;  4DMN A;  3KJV A;  4L8R B;  2B4J A;  2KFN A;  1REV A;  4N5S A;  3UIQ A;  4XIU A;  2G8W A;  1LW2 A;  5FRN A;  4YFU A;  2HHS A;  4C8M A;  3OYI A;  4AHT A;  1S9G A;  4OPK A;  3S3N A;  4KV8 A;  1C1C A;  4OGE A;  1C0U A;  1S1V A;  3S3M A;  1C0M A;  1DTQ A;  1S6Q A;  4DG1 A;  3KLG A;  3JSM A;  2XY7 A;  3TAP A;  4CK1 A;  1D5A A;  2XHB A;  2VG7 A;  4DSE A;  3QO9 A;  4FJX A;  1BIS A;  3SQ2 A;  1A5X A;  1UWB A;  2HHV A;  1S5J A;  4J2B A;  2RN2 A;  4CEF A;  3SJJ A;  1IO2 A;  4CHP A;  4RW8 A;  3LPT A;  3CQ8 A;  4KHY A;  3WNF A;  3SCX A;  5SZT A;  4M3Z A;  4KB0 A;  1VSK A;  2X74 A;  3TAG A;  1X9W A;  1HJR A;  3L8B A;  4RW9 A;  4DS5 A;  4E7I A;  1U47 A;  4B8A B;  4MQ3 A;  5HRS A;  3OYM A;  1TK8 A;  4CEB A;  3NH2 A;  1WAJ A;  2RF2 A;  3HP6 A;  4C8L A;  1O1W A;  2FBX A;  3EYZ A;  2A1R A;  1S1W A;  2YNF A;  3O4Q A;  4KHU A;  3DLR A;  5KI6 A;  3PX6 A;  4JRP A;  1S1U A;  4FLW A;  2DFH A;  3AVA A;  4KHW A;  3LPU A;  3L2Q A;  1HNV A;  3MXI A;  2B5J A;  4QOZ B;  2O4I A;  4ID1 A;  3OYD A;  4JRQ A;  3V81 A;  2QKK A;  4CGH A;  4KHN A;  4CHZ A;  3ALY A;  3DM2 A;  4W5R A;  3TAQ A;  3AVN A;  3CM6 A;  3K58 A;  2P1J A;  1UAX A;  4CJP A;  2IAJ A;  3SV3 A;  4B9L A;  3M8Q A;  1B9F A;  2Z1J A;  3WNH A;  5HRR A;  4E1M A;  1NKC A;  1Y97 A;  1XHX A;  1VSM A;  4NCA A;  3NGZ A;  3PX0 A;  1FK9 A;  5CYM A;  1NKB A;  4CJQ A;  4JLH A;  1NK0 A;  4PY5 A;  3L3V A;  4IG3 A;  4IFV A;  4QAG A;  3NDK A;  3I0R A;  2R7Y A;  4CJW A;  2XY6 A;  2PYJ A;  1U4B A;  4LSN A;  1T03 A;  4CF9 A;  3KTQ A;  4O0J A;  4KI6 A;  2HB5 A;  5KGX A;  4DLE A;  4FLT A;  4BE2 A;  2Z1I A;  4H8K A;  3TAF A;  1J54 A;  3ZSR A;  3LZJ A;  4F2R A;  1JLE A;  3OYK A;  3KIO A;  1NK9 A;  2G8F A;  4W5N A;  1QSL A;  5I42 A;  4DQR A;  4NYN A;  5T7B A;  4BWM A;  2HVI A;  3QER A;  4AIL C;  1WSG A;  1RTI A;  3VQB A;  1HYZ A;  2DTU A;  3DI6 A;  3VQP A;  2EX3 A;  3IRX A;  3QLH A;  4DFP A;  3HVR A;  1RCH A;  4RG8 A;  3KK1 A;  4BWJ A;  2PZS A;  4FJ5 A;  3C6T A;  3VA0 A;  3KD5 E;  3VQ7 A;  4FXD A;  1VSD A;  5HRN A;  3NFA A;  3SPY A;  4ICL A;  3M8S A;  3OYN A;  3JYT A;  4I2Q A;  3V1R A;  5CZ1 A;  3CFP A;  1TK0 A;  4WE1 A;  3ZSO A;  5KRT A;  3P5J A;  2OPP A;  2XRI A;  1G15 A;  1TL1 A;  4HUF A;  4FJM A;  5CYQ A;  3SQ4 A;  2PY5 A;  4E0D A;  1SL2 A;  3QEX A;  4DSL A;  5FRO A;  1LW0 A;  4M42 A;  2QK9 A;  3I8D A;  2YNH A;  3DLG A;  4Z4H A;  1RDA A;  2JGU A;  4KPY A;  4CJK A;  2VWK A;  2OPS A;  3ASM A;  4E7L A;  3AVJ A;  4CJL A;  4CGD A;  1SKW A;  4DSK A;  3OS1 A;  4OPJ A;  3TAE A;  4B9V A;  4PUO A;  5J2P A;  3AVF A;  4FW1 A;  4DF8 A;  4KI4 A;  3VQA A;  3O4N A;  4I9L A;  4FJ7 A;  3NF8 A;  1SKS A;  3QIN A;  2HHW A;  4EZ9 A;  1W9H A;  4CGJ A;  3VQ9 A;  3VQ4 A;  5FDL A;  3PO4 A;  4FJL A;  1IKW A;  3P83 D;  4DQI A;  3LAM A;  3VQQ A;  4FJN A;  4ELT A;  1RDD A;  3AVC A;  3V1O A;  1TAQ A;  3KLI A;  1R0A A;  1WAF A;  2X6S A;  4AH9 A;  4CJF A;  3ZCM A;  4Y1C A;  4CEA A;  1ZBU A;  3A2F A;  1XHZ A;  4M3W A;  4QCL A;  1NJW A;  1HYV A;  3F9K A;  4O55 A;  3BGR A;  3VQC A;  3G0Z A;  3OYH A;  4GMJ B;  4E7H A;  3OS2 A;  3ZSZ A;  2HNY A;  3QET A;  2G8I A;  1KVA A;  4BE0 A;  4KHQ A;  4FK4 A;  1U45 A;  3KKR A;  1XWL A;  3OYF A;  1UOC A;  2X6N A;  5DK5 A;  2KFZ A;  3HVT A;  1RT3 A;  1WN7 A;  3SQ1 A;  4B9N A;  2G8K A;  2BAN A;  4IBN A;  4DSJ A;  4FZZ A;  5C42 A;  2HMI A;  3AO5 A;  4BAC A;  3AA3 A;  3NAE A;  3QEV A;  4M3Y A;  3SI6 A;  2IGI A;  1EX4 A;  4NCG A;  3SZ2 A;  3LAL A;  3SV4 A;  1VK0 A;  3IS9 A;  1U49 A;  3ZSY A;  3HO1 A;  4F4K A;  1WNS A;  3MEG A;  3MXJ A;  3LWM A;  2HHU A;  4BDP A;  3HPO A;  4FLZ A;  3SPZ A;  3DLK A;  1VRU A;  4CGF A;  2WOM A;  2FBY A;  1CLQ A;  3SYZ A;  1RTH A;  1TKT A;  2FC0 A;  3AV9 A;  1N5Y A;  4DTR A;  1F21 A;  1J53 A;  3DMJ A;  4OJR A;  3KLE A;  2A1S A;  3K5O A;  2BGG A;  1BGX T;  4M45 A;  1JL2 A;  3S9H A;  1T05 A;  1IG9 A;  1T8E A;  3ULD A;  4CHN A;  3RMA A;  4OLA A;  4HUG A;  3T3F A;  3DRP A;  3AVI A;  1ZBF A;  2HVH A;  2HNZ A;  3V1Q A;  3HXM A;  4J2D A;  2ETJ A;  4HVJ A;  1VSE A; 
#chains in the Genus database with same CATH topology
 4YOX A;  3AAQ A;  3AA2 A;  2G8V A;  2E2Q A;  2HHX A;  3IFR A;  2E5L K;  3SMP A;  1MU2 A;  3O9S A;  4CHO A;  4J2A A;  1NK4 A;  5AZJ B;  5JS2 A;  2VQF K;  4F2S A;  1QZ6 A;  4DV6 K;  2O8B A;  2ZJR L;  4BR9 A;  3NF6 A;  3LZI A;  5TKY A;  3PV8 A;  4F3O A;  1NOY A;  3SNN A;  1S9E A;  3OA9 A;  4B1Z A;  4K8X A;  1TAU A;  4O0I A;  4B1U B;  5BPN A;  4B1W B;  1Q86 O;  3WXM B;  1NOZ A;  5AQV A;  4JKG B;  4X65 K;  1SKR A;  1HRH A;  2Q2R A;  1WSH A;  4IDK A;  3VET A;  1ASU A;  2CH5 A;  1K8K A;  1HYS A;  1RDW X;  2WON A;  3SAH A;  1ATN A;  3CIP A;  3CJ1 A;  3ZT1 A;  1ZBI A;  4FJI A;  3KLF A;  2FF6 A;  1QQO A;  4DR5 K;  3OYC A;  2UUB K;  2DFF A;  1RDC A;  5C2F A;  4DUY K;  1WBD A;  1BIZ A;  1HQE A;  3EY1 A;  1S6P A;  1ZXO A;  4L3Q A;  2NRZ A;  3WXL A;  1HJO A;  1TGO A;  2RPI A;  3HM9 A;  2WFB A;  4CBW A;  2YHW A;  3V9W A;  3KK2 A;  2E6M A;  2QA4 N;  4JK9 A;  5LJV A;  1JLG A;  3RTV A;  1NK6 A;  5DMR A;  3QNN A;  1WSF A;  1CZ9 A;  2CGJ A;  1MDU B;  4JKD A;  3C7N A;  3FZF A;  1XI1 A;  1MWM A;  1VQ5 N;  1BG3 A;  1DT9 A;  4NYF A;  1HX1 A;  4FM0 A;  1U2V A;  1GLL O;  4K41 A;  4DR1 K;  5F1X A;  4FW2 A;  3MN5 A;  4BRA A;  4QS8 A;  1BOT O;  2QI2 A;  4DFK A;  4DUZ K;  5EXW A;  1GLD G;  5EVZ A;  3NCI A;  3SUN A;  4ISF A;  4Z4I A;  4IEI A;  2KQ2 A;  1Q18 A;  4JD2 A;  1X9M A;  1T7P A;  1CXQ A;  1BQN A;  3ZET B;  4CK3 A;  1L3S A;  4Z4F A;  4B9T A;  4DTX A;  3I56 N;  4FWR A;  1JLC A;  1QS4 A;  4X62 K;  5HRP A;  3SAG A;  3RRH A;  3VTI A;  4CE9 A;  4BR2 A;  4B3S K;  3O1B A;  3ZSX A;  1VSF A;  3SAF A;  3TTF A;  1SZ2 A;  2QWN A;  4B9S A;  4HCC A;  3C6U A;  2E2O A;  3W0L A;  3ZSV A;  4FJG A;  1Z05 A;  2FF3 B;  1KFS A;  2P9I A;  2D0B A;  3AVG A;  3OS0 A;  3O9U A;  4JI4 K;  3LL3 A;  3TWH A;  1WB9 A;  3TTC A;  3MAQ A;  3F2K A;  4DTM A;  3CG7 A;  2NRW A;  1RBV A;  3EO3 A;  4I7F A;  3ZT2 A;  2YKM A;  1TKD A;  4IG0 A;  3EE8 A;  4ZTF A;  5JLF A;  3L2W A;  1GOC A;  5CR4 A;  1KRP A;  1I94 K;  4BQZ A;  3NF7 A;  1E4G T;  1IG8 A;  3CCQ N;  4BC5 A;  3A5M C;  1NK5 A;  4FJK A;  2F7T A;  2HW3 A;  5GAH P;  3HZ6 A;  4LD0 A;  4FK2 A;  3CCM N;  2ITG A;  4CD1 A;  2P9K B;  1NGE A;  5LJW A;  4DHY A;  4DLG A;  1LWC A;  3VN5 A;  2UXC K;  1RBS A;  1B9D A;  3UB5 A;  4BRL A;  3HT3 A;  3M8R A;  2O8F B;  3THY B;  4ELV A;  4E19 A;  1NK8 A;  3TAR A;  5AQJ A;  4CIE A;  4B1Y B;  2HHW A;  2UUA K;  3HP9 A;  3C65 A;  3K9K A;  4FWM A;  4KRF A;  3WNE A;  2I7P A;  2KZZ A;  4A61 A;  3AVH A;  5M1K A;  3RMC A;  5C15 A;  1K73 O;  4FVM A;  4Y1D A;  2IVP A;  4JV5 K;  2QTD A;  3MN6 A;  3EEQ A;  3SUQ A;  2P9S B;  3QB0 A;  3CCR N;  4PQU A;  1ATR A;  1WSJ A;  2ZD1 A;  1BUP A;  4ILG B;  4EIA A;  3B6P A;  3DXK A;  4CZM A;  3T19 A;  3MX2 A;  2XO7 A;  3ID8 A;  1KCF A;  1L3T A;  4FJH A;  3L6Q A;  4E1N A;  4O4G A;  1ZBL A;  1NGF A;  3O9Q A;  3A5O C;  3UKU B;  3K5N A;  2AA4 A;  3SUO A;  2YNG A;  2GEL A;  3TAN A;  4DV5 K;  3O5B A;  4F8R A;  2YNI A;  3AA4 A;  4CZL A;  3P4I A;  4CEQ A;  4B3T K;  3TU5 A;  2QWP A;  2XY5 A;  1LCU A;  4HWI A;  1NGD A;  4BRC A;  4O5B A;  1KC8 O;  3TTD A;  1EP4 A;  4JI7 K;  2UXB K;  2ATQ A;  4IFE A;  3OBY A;  2D0O A;  2NZT A;  3QBW A;  4DB3 A;  1RT7 A;  3DRS A;  2LSN A;  4Z0U A;  4FWL A;  1BQM A;  2GV9 A;  3G71 N;  3CJB A;  3KK7 A;  2VWJ A;  3WT0 A;  5BPL A;  4XIU A;  2G8W A;  1TYQ A;  3T7Z A;  2ASP A;  3S3N A;  1C1C A;  1S1V A;  4JI6 K;  1C0M A;  3O9R A;  3TAP A;  4DG1 A;  3T1H K;  1D5A A;  2XHB A;  3CME N;  4DSE A;  3FZK A;  4CBU A;  1A5X A;  4C23 A;  1S5J A;  4CEF A;  3FZL A;  3SJJ A;  1IO2 A;  2W41 A;  4CHP A;  4RW8 A;  2E88 A;  3VEV A;  3WNF A;  2P9L B;  3TAG A;  1X9W A;  5JVG L;  3L8B A;  4RW9 A;  4DS5 A;  4E7I A;  5M1F A;  4PKG A;  2O8E A;  3EYZ A;  4KHU A;  4O8K A;  3ENO A;  4JEP A;  3VTH A;  2DFH A;  1XMO K;  4QOZ B;  1X3N A;  2O4I A;  5M1P A;  2QKK A;  4CHZ A;  3ALY A;  3DM2 A;  4W5R A;  3TAQ A;  1T6C A;  2P1J A;  3SLC A;  4B9L A;  4B9Q A;  1Y97 A;  4NCA A;  3PX0 A;  4PY5 A;  3L3V A;  2XY6 A;  4IFV A;  4IEE A;  4QAG A;  5AJ3 K;  3MWP A;  2PYJ A;  2RE2 A;  3CXC M;  3TAF A;  3DLL L;  4F2R A;  1JLE A;  2Q97 A;  3KIO A;  5GIO A;  3OYK A;  2G8F A;  4W5N A;  5I42 A;  4DQR A;  5T7B A;  4GNI A;  4GKJ K;  4J8F A;  4ISG A;  3QLH A;  4DFP A;  3N4Q A;  4RG8 A;  3VA0 A;  4FXD A;  5HRN A;  2GWK A;  3M8S A;  3V1R A;  3CFP A;  3A5L C;  3HM8 A;  3ZSO A;  1U6Z A;  1TL1 A;  3SQ4 A;  5HOO A;  3M6G A;  1BO5 O;  2JGU A;  4KPY A;  3ENH A;  4CJK A;  2VWK A;  4OPJ A;  5TKW A;  4PUO A;  5FPN A;  4FW1 A;  1JCE A;  4FJ7 A;  4FSV A;  1XC3 A;  4K0K K;  4FJL A;  1IKW A;  4FJN A;  4ELT A;  3THX A;  4PKH A;  5KPR A;  3V1O A;  1R0A A;  1VQ6 N;  3CD6 N;  4CEA A;  4M3W A;  3OYH A;  4GMJ B;  2EWS A;  3VER A;  3QET A;  3HI0 A;  4JAX A;  1NGI A;  1XWL A;  4NXN K;  1UOC A;  5LY3 A;  1WN7 A;  1ZBS A;  4FOE A;  4IBN A;  4CZJ A;  3NAE A;  2IVN A;  4NCG A;  1VK0 A;  1VQM N;  1U49 A;  3WQU A;  5JLH A;  2HHU A;  3AAR A;  3I33 A;  2W40 A;  1TKT A;  3AV9 A;  3J7A P;  1Q81 O;  4G9Z A;  3I55 N;  2W6L A;  1Q7Y O;  3LDQ A;  1BGX T;  4M45 A;  2P9P B;  3VMF B;  3B8A X;  3LDP A;  4HUG A;  3T3F A;  2YI1 A;  5IT9 O;  3VGL A;  2ETJ A;  4CZG A;  1U48 A;  1L3U A;  3T69 A;  1JL1 A;  1DLO A;  5EOY A;  4KH6 A;  3FFK B;  4BRQ A;  4CJE A;  3OYE A;  2Z1H A;  2VG6 A;  4GV3 A;  1XC9 A;  3RR8 A;  2QWO A;  1Q82 O;  3AO4 A;  4H03 B;  3KKS A;  4B9U A;  1FW6 A;  4CFC A;  5F2R A;  4WCE L;  4FJ8 A;  1QQN A;  3DAW A;  4OVL A;  3I8B A;  3V9Z A;  1C1A A;  3K59 A;  2Y1I A;  1KVC A;  5AQI A;  4CZH A;  1HPZ A;  1YAG A;  1B92 A;  2ITM A;  3UKR B;  3ITH A;  4E89 A;  1Z26 A;  4CBX A;  1L5U A;  3E1Y A;  4B08 A;  5CHI A;  4FOI A;  1I3A A;  5AZI B;  2FSJ A;  2QXF A;  4LF6 K;  3L2V A;  4MLE A;  1X1P A;  1OH6 A;  4BRI A;  2WTU A;  2CGK A;  1OH5 A;  3CC4 N;  3HJF A;  3D2E B;  3EZW A;  3PIO L;  5AQH A;  3CFR A;  1TKZ A;  4H5W A;  3VPZ A;  1WBB A;  1YI2 N;  1YVU A;  1RTD A;  1O13 A;  3V4I A;  4CJ3 A;  1RT5 A;  1YJW N;  4DTN A;  1X9S A;  2HHQ A;  3NH1 A;  2P9N A;  3DLH A;  4CF2 A;  3Q7B A;  2FSN A;  5GAD P;  2ZJQ L;  2G8H A;  1CXU A;  4CFA A;  3MN7 A;  3PX4 A;  4GKK K;  3AY9 A;  4CHQ A;  3V9X A;  5BRH A;  1HKB A;  3NH0 A;  5AQS A;  1KFD A;  4RW6 A;  4OLB A;  4IO8 A;  4A2A A;  2GBZ A;  2HF4 A;  2PBD A;  1KSP A;  5DM7 L;  3O80 A;  3U9Z A;  3VQ6 A;  3KWG A;  4BGB A;  4DSF A;  4KFB A;  3SJH A;  4KHS A;  4OKE A;  2YHX A;  4M7X A;  5C24 A;  3ISN C;  4FLY A;  3RMD A;  1VQL N;  4C8K A;  3QNO A;  4M3T A;  4FLX A;  3E9P A;  3MK6 A;  3OJS A;  2J4R A;  5AFU A;  5AQG A;  3ZX2 A;  4EZ6 A;  2O8B B;  1BCM A;  4H0X B;  3TAM A;  4CF1 A;  4EFH A;  1BI4 A;  1XMQ K;  3T1Y K;  1TK5 A;  1VAZ A;  5B8H A;  3K0S A;  3SQ0 A;  3ZX0 A;  4FK0 A;  2BTF A;  5K14 A;  2WUS A;  3QEP A;  3LM9 A;  4BRM A;  5JS1 A;  1XQS C;  4FJJ A;  3IUC A;  1U04 A;  5KGW A;  3WNG A;  2D0A A;  4JKF A;  1N6Q A;  1K6Y A;  4TSX A;  4B3M K;  1EXQ A;  3L4Q A;  3QEW A;  3MX5 A;  1IJJ A;  1K8K B;  4KKO A;  1IKX A;  1RBT A;  1V4T A;  3WEE B;  1IH7 A;  4BDZ A;  3RMB A;  1C6V A;  2NNW A;  1N34 K;  1VQP N;  4XH1 A;  1VQ8 N;  3VQ5 A;  2RHK A;  1BHL A;  3QEI A;  1JLA A;  1JLQ A;  2KZM A;  3O3H A;  2NRV A;  4CF8 A;  5AQL A;  4PWD A;  3C6A A;  1TUY A;  2HMP A;  3H3O B;  4LSL A;  2PYL A;  4H5T A;  4BQL A;  3F73 A;  1QSS A;  3C7N B;  4H5N A;  4DFJ A;  4NLB A;  2NUB A;  3LDO A;  1BA0 A;  3KZB A;  2E2N A;  1NGC A;  1KXP A;  4DU1 A;  2A41 A;  3H46 O;  3DYA A;  2O8C A;  1Q8I A;  4LF8 K;  2AJQ A;  2UYT A;  2ZGZ A;  4KRE A;  4JD2 B;  3CPW M;  3HPG A;  1TVR A;  3AVL A;  3WXK A;  2QKB A;  2ZF5 O;  1QE1 A;  1YJN N;  3MDQ A;  3OVN A;  1VQO N;  2KTQ A;  1EKE A;  4BC4 A;  5HLF A;  1HKC A;  4EP5 A;  3VQD A;  1HNI A;  4B3R K;  1VQ9 N;  4K25 A;  4DTU A;  4W5T A;  4ILH A;  3VF4 A;  3CM5 A;  3LP0 A;  4FPA A;  3CPE A;  4DTS A;  3EL2 A;  2YHB A;  5EY4 A;  3BF3 A;  4DV1 K;  2P9I B;  4IOC L;  5AQN A;  4B3O A;  2VGN A;  1OVQ A;  3PSF A;  3M3Z A;  2HBM A;  4H5V A;  4HTU A;  1LWE A;  4FWP A;  1DTT A;  4CK2 A;  5M1Q A;  3C95 A;  1S72 N;  4I9Q A;  2XY8 A;  4JK7 A;  2KKZ A;  1XUP O;  4RWT A;  2DFE A;  3VEO A;  2W42 A;  3DJC A;  5CZ2 A;  5E41 A;  2D0C A;  5C10 A;  3DLB A;  1BCO A;  1VRT A;  2QEX N;  3RR7 A;  1KAZ A;  2JLE A;  5AQP A;  5HBM A;  1T3V A;  4BRK A;  1RT6 A;  2P51 A;  3R9P A;  4CJ5 A;  3C94 A;  3QIO A;  2OAN A;  5J2M A;  3M1F A;  4YOW A;  2KFN A;  1REV A;  3UIQ A;  3C0B A;  4YFU A;  2HHS A;  4C8M A;  4OPK A;  4KV8 A;  1C0U A;  1S6Q A;  3KLG A;  3JSM A;  2XY7 A;  2HHV A;  4AF1 A;  3W3D A;  4KHY A;  3SCX A;  4KB0 A;  1HJR A;  5F0X A;  1U47 A;  4MQ3 A;  4CEB A;  3NH2 A;  3ZX3 A;  2ZWH A;  5AQO A;  1BDG A;  2CH6 A;  2A1R A;  3DLR A;  3VOV A;  4MDB A;  1S1U A;  4BR0 A;  3AVA A;  4YOR A;  5BN8 A;  3MXI A;  2B5J A;  3DXM B;  3V81 A;  1D4X A;  4MDA A;  4CGH A;  3HTV A;  5C12 A;  3AVN A;  3CM6 A;  5LMU K;  3M8Q A;  2Z1J A;  4IZ9 A;  1VSM A;  3NGZ A;  5CYM A;  1NKB A;  1RFQ A;  4JLH A;  4CJQ A;  3IDH A;  3EKS A;  4IG3 A;  1JJ2 M;  3I0R A;  4CJW A;  3D2F B;  1DKG D;  1T03 A;  4O0J A;  1X9J A;  4KI6 A;  1HNW K;  4BE2 A;  1J54 A;  2QWL A;  3LZJ A;  1NK9 A;  2BH1 A;  2GEM A;  4JK8 A;  3SBG A;  3M5R A;  1NBW A;  2EX3 A;  5KQ8 A;  5E84 A;  1RCH A;  1C0G A;  1YXQ A;  4BRO A;  3C6T A;  1GLE G;  4JKA A;  3GG4 A;  2JWK A;  3SPY A;  1S22 A;  3L0Q A;  1K9M O;  3N4P A;  1TK0 A;  4WE1 A;  1G15 A;  1TYQ B;  4HUF A;  2YCH A;  4FJM A;  4E0D A;  1OH8 A;  3QEX A;  4DSL A;  5FRO A;  2YNH A;  1YHQ N;  4E7L A;  1SKW A;  2OPS A;  3AVJ A;  3TAE A;  3AVF A;  4DF8 A;  4KI4 A;  3CQX A;  3KHY A;  3NF8 A;  4ISE A;  4M63 C;  1VQ4 N;  4YDU A;  4CGJ A;  3VQ4 A;  2HHH K;  3PO4 A;  1J6Z A;  3CMA N;  4HTL A;  1RDD A;  3AGK A;  4WFN L;  1TAQ A;  3KLI A;  3RVC A;  4CJF A;  3GE1 A;  4Y1C A;  3ZCM A;  3JAM O;  2O8E B;  5FPD A;  1NJW A;  2Q0U A;  3H6E A;  3BGR A;  4ILJ A;  4E7H A;  3OS2 A;  3ZSZ A;  3CJ7 A;  2G8I A;  5BR8 K;  4FK4 A;  1U45 A;  1T6D A;  1ESV A;  3K9J A;  3HVT A;  4H5R A;  3CCE N;  2G8K A;  4LC9 B;  4DSJ A;  3AO5 A;  5AQR A;  5C0Y A;  2IGI A;  1EX4 A;  3CCU N;  1WNS A;  4LFB K;  2GUP A;  3MEG A;  3MXJ A;  4DR6 K;  5KPZ A;  4BDP A;  4DV4 K;  3SYZ A;  1CLQ A;  1QZ5 A;  2BGG A;  3CCV N;  3C6H A;  1JL2 A;  1T05 A;  3FE1 A;  4B1V A;  4CHN A;  2I7N A;  4M7Y A;  1IV0 A;  1P8Z A;  3AVI A;  1ZBF A;  4O5F A;  4CW7 B;  3V1Q A;  3MCA B;  5E26 A;  1ASW A;  3CCJ N;  5J2Q A;  3QES A;  2Q31 A;  4FLU A;  4DQS A;  4LF7 K;  4M41 A;  5AQT A;  1NU0 A;  5CY4 A;  1KLN A;  1MA9 B;  5CE3 A;  1FXX A;  1SL0 A;  3U3Y A;  1FKP A;  2EHG A;  1HMV A;  3UKU A;  5M1N A;  3CCS N;  5KTQ A;  2H3G X;  4NO7 A;  2OYQ A;  2E4L A;  3HOS A;  2DPN A;  4OPH A;  2BDP A;  1HLU A;  2Y1J A;  4BRE A;  3THX B;  3ZSW A;  4CZI A;  1S1X A;  1S3X A;  3MXM A;  1EO1 A;  4BR7 A;  3U9D A;  5AQX A;  4J2E A;  2KW4 A;  1VSH A;  1CZB A;  1QHA A;  4UQG A;  4CIF A;  1NMN A;  3QIP A;  3HPH A;  3AVB A;  2F4V K;  1NJZ A;  4GV9 A;  1VSI A;  4KAZ A;  4FYD A;  3LDS A;  4IDH A;  4JN4 A;  4UY8 O;  1HNZ K;  3LDN A;  2IIR A;  3S3O A;  3QML A;  1VHX A;  2VYP A;  1Q9Y A;  2HOE A;  3FGU A;  1VSL A;  1W2B M;  4KTZ A;  2I5J A;  2YHA A;  1MWK A;  4CD3 A;  4I2P A;  2Q36 A;  4KB1 A;  4YOV A;  3E01 A;  5AQY A;  3I0S A;  3R1X A;  4IKF A;  3RRG A;  2E20 A;  4A5B A;  5KPT A;  3OYB A;  4JI1 K;  4CI6 A;  2YHY A;  5I3U A;  4N47 A;  4DTP A;  4OPA A;  4DR4 K;  3HK2 A;  3QFU A;  4OX9 K;  3ULE A;  4BRH A;  5EX5 A;  3PY8 A;  5FRM A;  3TR8 A;  1N8R O;  1JCG A;  4H0T B;  3THW A;  3MED A;  2HHT A;  1Y64 A;  3QBX A;  4X66 K;  3FZM A;  3GOI A;  3ZT3 A;  4A5A A;  4YNQ A;  4HHT A;  4A62 A;  4U7B A;  3HOT A;  3PUF A;  5AQW A;  2E1Y A;  2BE2 A;  2FBV A;  5H1S Q;  3LWL A;  3ZT0 A;  4B8C A;  2V7Z A;  3V6D A;  1EWQ A;  4LFC K;  4BG8 A;  5AQQ A;  4R5P A;  3RSE A;  3NVK A;  1KAY A;  3VES A;  3ENB A;  4CCH A;  1WOQ A;  4AM6 A;  4CJU A;  3AAP A;  3VA3 A;  4K43 A;  3OYG A;  3KK3 A;  1J5O A;  1GLJ O;  4H4M A;  4FZY A;  4GW6 A;  3LDL A;  3V9U A;  2QWQ A;  4U67 L;  4C8N A;  2WC9 A;  5BPM A;  4F9O A;  3LAN A;  4CZE A;  1H1V A;  1RNH A;  4DSI A;  1XNR K;  4Z4E A;  4CFB A;  1NGG A;  4CJR A;  3K5M A;  4FM2 A;  3T1A A;  3V9S A;  4E7K A;  4GY2 B;  4CJ4 A;  1A5W A;  2HF3 A;  1YUW A;  2OCE A;  1NM1 A;  3GL1 A;  3QIC A;  4MLH A;  1IKV A;  4CGG A;  5IWA K;  3RWU A;  4BDY A;  2PFU A;  2YV0 X;  3P1G A;  4A2B A;  5FLX O;  3NHG A;  4BC2 A;  4DQQ A;  1HPM A;  1ZYQ A;  1QTM A;  1OVY A;  5BRF A;  1NWK A;  3J8A A;  3ZEU B;  4N41 A;  4FJ9 A;  4BR5 A;  3LAK A;  4YDU C;  1QVG M;  3HRG A;  2P9N B;  4EP4 A;  1GOA A;  2Z1G A;  1W97 L;  4PHT X;  4DCH A;  3NGY A;  3D6R A;  3M8P A;  1IBK K;  1KQS M;  4WYB A;  4QS9 A;  4W5Q A;  4N56 A;  3OY9 A;  3IKM A;  2VWB A;  5AQZ A;  3L2U A;  4JS5 A;  1P90 A;  1VQK N;  2F8S A;  3HST B;  1QSY A;  3AA5 X;  3HL8 A;  4KBO A;  1LV5 A;  1GLC G;  2FBT A;  4CF0 A;  4OKJ A;  3F9M A;  3TAB A;  4JS4 A;  4FLV A;  1ASV A;  3E66 A;  5AQF A;  4DU4 A;  4M3R A;  2QXL A;  3DLE A;  3LM2 A;  2E8A A;  1BI4 B;  1HR0 K;  5JVH L;  1DEJ A;  3NF9 A;  1RT4 A;  4H4O A;  1FJG K;  2RKI A;  1KVB A;  1JCF A;  4OKK A;  4AHR A;  1IKY A;  4O8U A;  3CJC A;  4DV2 K;  3K5L A;  4DU3 A;  4RW4 A;  1YVN A;  3GBT A;  5J1E A;  4Q5V A;  2X78 A;  1RTJ A;  3H08 A;  2F96 A;  2IDO A;  5ADX H;  3O3F A;  4H0Y B;  4OGC A;  4FL9 A;  2HBJ A;  1L3V A;  4PKI A;  3LP3 A;  1N33 K;  5MLC Q;  5HRO A;  2P9U A;  4NB4 A;  3CFO A;  4ID5 A;  1LAW A;  1RBR A;  2D0P A;  1S1T A;  4NLC A;  3MEE A;  4JKH A;  1RIL A;  4BE1 A;  3BEX A;  1W0H A;  4M3X A;  1JKH A;  1D9F A;  2O4G A;  3B6O A;  4C8O A;  4CJV A;  3AO3 A;  3EZ5 A;  1BL3 A;  4XEI A;  4DQP A;  1D9D A;  2V52 B;  4FWN A;  4ZHR A;  1UA0 A;  1KLM A;  3G10 A;  1Z25 A;  4GVM A;  3THV A;  2F9T A;  5HP1 A;  3NMU A;  3FFI A;  4KH4 A;  1SS6 A;  1SL1 A;  3P31 A;  4LF9 K;  1N36 K;  1GOB A;  1Q9X A;  2WBN A;  1GLF O;  3A5N C;  4FM1 A;  4DMN A;  1V4S A;  1C0F A;  5FRN A;  1BA1 A;  3L4I A;  3OYI A;  2O8C B;  4MO5 A;  3S3M A;  3CQY A;  2JWL A;  1YIT N;  4CK1 A;  1IBM K;  2VG7 A;  2OTJ N;  3QO9 A;  1BIS A;  4J2B A;  4DR2 K;  2E2P A;  1EWR A;  1OKJ A;  3O8M A;  3G6E N;  1VSK A;  2X74 A;  4JI5 K;  4K42 A;  4B8A B;  2V51 B;  5HRS A;  1TK8 A;  3OYM A;  1WAJ A;  2RF2 A;  2FBX A;  2A42 A;  3ZLJ A;  3TPQ A;  3LPU A;  3L2Q A;  2OTL N;  4KHW A;  3OYD A;  1M1K O;  5ELZ A;  4AQY K;  4A59 A;  2QWR A;  4CJP A;  3BP8 A;  2O8D A;  3WNH A;  5HRR A;  4E1M A;  1NKC A;  1XHX A;  1FK9 A;  3OW2 M;  2QWM A;  1U2V B;  4I6M A;  2BUP A;  2PAV A;  1U4B A;  1WUA A;  4LSN A;  4CF9 A;  5KGX A;  4DLE A;  3OBW A;  4H8K A;  3H45 C;  4MO4 A;  1QSL A;  2HVI A;  4BWM A;  3QER A;  4JHD A;  3TSP A;  3VQB A;  1RTI A;  4YHH K;  4AIL C;  3DWL A;  1HYZ A;  4NXM K;  4YOY A;  2DTU A;  2W6K A;  3VQP A;  3TSU A;  3IRX A;  2NRT A;  3A0I X;  1Z6R A;  2PZS A;  4FJ5 A;  3NVM A;  3G4S N;  1VSD A;  3NFA A;  3CCL N;  3ATU A;  4I2Q A;  5CZ1 A;  5KRT A;  3P5J A;  2OPP A;  2XRI A;  5CYQ A;  2PY5 A;  3MN9 A;  1SL2 A;  1LW0 A;  3WEE A;  4M42 A;  4C1N I;  3I8D A;  3ATV A;  3ASM A;  4CJL A;  4CGD A;  3OS1 A;  4B9V A;  5J2P A;  5KQD A;  5BRE A;  5AZJ A;  4V19 S;  3O4N A;  4I9L A;  1RGI A;  1QVF M;  3BZK A;  5FDL A;  1SAZ A;  3P83 D;  1RDU A;  4DQI A;  1K8A O;  1NJI O;  5AR0 A;  2X6S A;  4AH9 A;  3CER A;  3QDK A;  4LF5 K;  4CJ7 A;  1XHZ A;  3UE5 A;  2ZM6 K;  3WXJ A;  4O55 A;  3G0Z A;  5GAE P;  1EQY A;  4WF9 L;  1KVA A;  1NGA A;  3OYF A;  4BG9 A;  2X6N A;  3VF2 A;  1NG9 A;  3SQ1 A;  4FWS A;  3BF1 A;  3QFP A;  3FZH A;  5C42 A;  2HMI A;  3QEV A;  4M3Y A;  3IMX A;  3SZ2 A;  4JKG A;  3LAL A;  3HO1 A;  4F4K A;  3R3L A;  3LWM A;  3VEX A;  2UUC K;  4EAH D;  3SPZ A;  1X3M A;  4H0P A;  3DLK A;  2FBY A;  1RTH A;  2FC0 A;  1N5Y A;  1F21 A;  3DMJ A;  4OJR A;  2A1S A;  3CJ9 A;  3K5O A;  5BRD A;  1BWF O;  3S9H A;  2QM1 A;  2KLA A;  4DR7 K;  3JS6 A;  3RMA A;  2F9W A;  1YF5 L;  4E1J A;  1NMD A;  3DRP A;  2HVH A;  3VF6 A;  4J2D A;  2YX6 A;  4HVJ A;  3J80 O;  1VSE A;  5C2D A;  3JXU A;  4YY3 K;  2A40 A;  4YOT A;  4BVP A;  3A8Y A;  5I9E B;  3J81 O;  1QQC A;  4KO0 A;  4F3T A;  2OZM A;  3IAY A;  3VQ8 A;  3DXK B;  1RDB A;  4Z4C A;  4GVE A;  3OYJ A;  1RBU A;  1VSJ A;  4BRF A;  2ZE2 A;  3AO2 A;  4GV6 A;  1WSI A;  4W5O A;  2NLX A;  1ILY A;  1YJ9 N;  4LH5 A;  4X64 K;  1JLF A;  1D8Y A;  4JI3 K;  4CEZ A;  3HSC A;  2E1Z A;  4BRG A;  4CHY A;  1WSE A;  4Z4G A;  4AHV A;  1NGJ A;  4ZTJ A;  4BY9 C;  1TUU A;  4DF4 A;  3IG1 A;  4K8Z A;  1UA1 A;  4Q0B A;  2OA8 A;  3ZET A;  4G1Q A;  1TL3 A;  4JI8 K;  5M1O A;  4XH4 A;  3NE6 A;  1WLJ A;  4XH5 A;  4FWK A;  4ELU A;  3L3U A;  3VGM A;  1EET A;  4BVO A;  5JMV A;  1NNE A;  1JLB A;  4HCB A;  5GIP A;  1RT1 A;  3OYA A;  4LFA K;  4WFA L;  4CIG A;  2OZS A;  4IOX A;  4AM7 A;  4WQ4 C;  1SQK A;  2P5O A;  4Y0W A;  5C25 A;  3ZSQ A;  1LOT B;  3AVM A;  4C1N K;  4CGI A;  3FLC O;  4KHP K;  1CZA N;  3SUP A;  1FKO A;  1J9A A;  2ZQB A;  1E3M A;  3ZYY X;  4MFB A;  4FCY A;  1HUX A;  2G8U A;  4FWO A;  4IO9 L;  3DXM A;  2A6A A;  2AP1 A;  4DS4 A;  2FXU A;  1GLB G;  3U3G A;  1QHT A;  1QQM A;  2P9K A;  3BUZ B;  3GDQ A;  2OPR A;  3D2F A;  2ASM A;  1LAV A;  4WQ5 A;  3LP2 A;  2D1K A;  3K57 A;  2O8F A;  3R6M A;  3MMV A;  3O9T A;  1SV5 A;  3THY A;  3L2R A;  4EHT A;  3KWI A;  3VQE A;  3DRR A;  3CYM A;  4YOU A;  4IFY A;  3ID6 A;  4CJT A;  5GAG P;  1KD1 O;  3SK3 A;  1N32 K;  1NJY A;  4CED A;  3OHR A;  3S41 A;  3PO5 A;  2GUI A;  3LP1 A;  5J2N A;  4CEE A;  1RT2 A;  1NKE A;  2Q1N A;  3MEC A;  2UU9 K;  1NJX A;  1A5V A;  1ITG A;  3Q7C A;  2P9S A;  2F8T A;  4CFD A;  4OO1 J;  4RCH A;  3MCP A;  4DV7 K;  4BGA A;  2NRH A;  1C1B A;  3TI0 A;  4PA1 A;  3PLA A;  1ATS A;  3PIP L;  3OYL A;  1J5E K;  4CEC A;  3BY5 A;  3U8X A;  1ZBH A;  3P38 A;  2IS3 A;  3ULE B;  4O44 A;  4RTF D;  4CZK A;  5A2Q O;  4RW7 A;  3VEY A;  3K2P A;  3O1W A;  3THW B;  1NLV A;  1NK7 A;  2E6L A;  4AHS A;  4DTJ A;  4FZX C;  1GLA G;  3O6W A;  4H0V B;  4JKB A;  2NRX A;  3AO1 A;  4DWI A;  4M3U A;  4LY7 A;  2OPQ A;  5KRS A;  4JKC A;  4BR4 A;  3O4W A;  1C0T A;  2VG5 A;  3CHW A;  3RSE B;  3U6F A;  1JXB A;  2NRR A;  5EU7 A;  1YTU A;  3E9L A;  4E3S A;  1HQU A;  3H1V X;  5AQU A;  3SMS A;  3OTO K;  3U4L A;  2Q3S A;  1JXE A;  4DTO A;  4B9M A;  3ZT4 A;  4KH5 A;  1YTA A;  4AHC A;  3OJU A;  3AVK A;  3DOK A;  3D0P A;  3BDP A;  2HND A;  2B6A A;  4IWV A;  3PSI A;  3NGI A;  2DY4 A;  3MWT A;  2P9L A;  5AQK A;  4DFM A;  4E7J A;  2ZJP L;  2YKN A;  3CC2 N;  4AHU A;  2VCP A;  2P5G A;  5D3G A;  5FPM A;  1HNX K;  4NCB A;  1YIJ N;  3TSQ A;  3KD1 E;  5SWM A;  5JIC A;  4N76 A;  4CER A;  3FR0 A;  2D5R A;  2FLO A;  3G25 A;  3DOL A;  1TV6 A;  1TKX A;  4CES A;  1M90 O;  4JI2 K;  2IC3 A;  4DR3 K;  1YT3 A;  4CJS A;  5BR9 A;  3KLH A;  2IOC A;  4CZF A;  1BIU A;  3R8E A;  3HBT A;  5DM6 L;  1HKG A;  1I39 A;  3O3G A;  4HUE A;  5GIN A;  2Q0R A;  1DGK N;  4LH4 A;  1KTQ A;  4Z94 A;  3WUH A;  4KTQ A;  3D45 A;  3HYF A;  2VQE K;  3O08 A;  1VQ7 N;  4CEO A;  3NBP A;  4DV0 K;  2HBL A;  4KTW A;  2ZGY A;  1LWF A;  5HL7 L;  2UXD K;  3KVG A;  3CI5 A;  1SUQ A;  3KJV A;  4L8R B;  2B4J A;  4N5S A;  5LMN K;  1LW2 A;  2A3Z A;  4EHU A;  4IOA L;  4AHT A;  1S9G A;  4OGE A;  1DTQ A;  4FJX A;  3SQ2 A;  4FWQ A;  1UWB A;  4BRP A;  4DKW A;  1IBL K;  2RN2 A;  2IVO A;  3LPT A;  3CQ8 A;  3J7Z O;  5SZT A;  4M3Z A;  4JNE A;  3WXI A;  3HP6 A;  4C8L A;  1O1W A;  2FSK A;  1ZC6 A;  1S1W A;  2YNF A;  3O4Q A;  3E9O A;  5KI6 A;  3PX6 A;  1G99 A;  4JRP A;  5BN9 A;  4FLW A;  3CC7 N;  1HNV A;  4BRD A;  2P9U B;  4ID1 A;  4JRQ A;  4KHN A;  4WQ5 C;  3BZC A;  3K58 A;  1UAX A;  2IAJ A;  3SV3 A;  3EN9 A;  4WFB L;  3WQT A;  1B9F A;  2KHO A;  2YJE A;  1R59 O;  4IJA A;  1NK0 A;  3H3N O;  3NDK A;  2R7Y A;  3VGK A;  3D7E O;  3KTQ A;  2HB5 A;  2V7Y A;  4FLT A;  2Z1I A;  2YJF A;  3ZSR A;  2P9P A;  4NYN A;  4QS7 A;  1WSG A;  3DI6 A;  3CF5 L;  3HVR A;  3KK1 A;  4BWJ A;  1VQN N;  3KD5 E;  3VQ7 A;  4ICL A;  3JYT A;  3OYN A;  4IJN A;  3CET A;  3ZEU A;  4JI0 K;  2QK9 A;  3DLG A;  4Z4H A;  1RDA A;  1T44 A;  3J7Y P;  4DSK A;  3H1Q A;  2VGM A;  3CJA A;  1W7A A;  3VQA A;  1BU6 O;  1SKS A;  2A5X A;  3QIN A;  4PL8 A;  4EZ9 A;  1W9H A;  5ADX A;  3VQ9 A;  4DV3 K;  3LAM A;  5AFU H;  3VQQ A;  1XNQ K;  2HST A;  4FVU A;  3AVC A;  1WAF A;  3UKR A;  1OH7 A;  1ZBU A;  3A2F A;  4QCL A;  1HYV A;  3F9K A;  3SBT A;  3VQC A;  5AZI A;  2HNY A;  1E4F T;  4KHQ A;  4BE0 A;  2QW9 A;  3KKR A;  4BC3 A;  4R79 A;  5DK5 A;  2KFZ A;  1RT3 A;  4FPB A;  4B9N A;  1KAX A;  2ASO A;  3P39 A;  4JYA K;  2BAN A;  3D2E A;  4FZZ A;  4BAC A;  3AA3 A;  4A57 A;  4BRN A;  3SI6 A;  2O8D B;  4B1X B;  3SV4 A;  5LL6 Z;  3IS9 A;  3ZSY A;  4DQ8 A;  2HBK A;  4CVN E;  2D4W A;  5AQM A;  3HPO A;  4FLZ A;  3EE9 A;  4JKE A;  4I6M B;  3VEN A;  1VRU A;  4CGF A;  2WOM A;  3EKU A;  3VEZ A;  4PL7 A;  4DTR A;  1NGH A;  1J53 A;  3KLE A;  5FPE A;  1NGB A;  4FO0 A;  2GTD A;  2GWJ A;  1IG9 A;  1T8E A;  2CGL A;  3ULD A;  4JHD B;  4OLA A;  3F5T A;  2GX9 A;  4LF4 K;  4H0O A;  3VEW A;  3AGR A;  4WQ4 A;  2HNZ A;  3HXM A;  4IXC A; 
#chains in the Genus database with same CATH homology
 1L3U A;  1ASW A;  5J2Q A;  3QES A;  3AA2 A;  1JL1 A;  1DLO A;  2G8V A;  4FLU A;  4DQS A;  4M41 A;  3OYE A;  5CY4 A;  4CJE A;  1QQC A;  2Z1H A;  2VG6 A;  2HHX A;  4KO0 A;  1KLN A;  4F3T A;  1FXX A;  1XC9 A;  1SL0 A;  2OZM A;  1U48 A;  3U3Y A;  3RR8 A;  3IAY A;  3VQ8 A;  1FKP A;  3AO4 A;  2EHG A;  1HMV A;  1MU2 A;  1RDB A;  4CHO A;  4Z4C A;  3KKS A;  4B9U A;  4J2A A;  1NK4 A;  5KTQ A;  5JS2 A;  4CFC A;  3OYJ A;  4F2S A;  4FJ8 A;  1RBU A;  2OYQ A;  1VSJ A;  2E4L A;  2ZE2 A;  3AO2 A;  1WSI A;  4W5O A;  2BDP A;  2Y1J A;  4OVL A;  4LH5 A;  3V9Z A;  1JLF A;  1C1A A;  3NF6 A;  3K59 A;  3LZI A;  2Y1I A;  1KVC A;  3PV8 A;  3ZSW A;  1D8Y A;  1S1X A;  4CEZ A;  3MXM A;  1HPZ A;  1NOY A;  4F3O A;  1B92 A;  4CHY A;  1WSE A;  4J2E A;  4Z4G A;  4AHV A;  2KW4 A;  3ITH A;  1S9E A;  1VSH A;  4E89 A;  3SNN A;  1Z26 A;  1CZB A;  1L5U A;  4ZTJ A;  4UQG A;  4B08 A;  4CIF A;  4DF4 A;  4K8X A;  1I3A A;  1TAU A;  4O0I A;  3QIP A;  3HPH A;  3AVB A;  3IG1 A;  2QXF A;  4K8Z A;  1UA1 A;  1NJZ A;  3L2V A;  1X1P A;  1VSI A;  4Q0B A;  2OA8 A;  4KAZ A;  4FYD A;  3LDS A;  4G1Q A;  1NOZ A;  3HJF A;  1TL3 A;  3S3O A;  1Q9Y A;  1SKR A;  1HRH A;  3CFR A;  1TKZ A;  1WSH A;  3NE6 A;  4IDK A;  1WLJ A;  1VSL A;  4KTZ A;  4ELU A;  3L3U A;  1ASU A;  2I5J A;  1YVU A;  1RTD A;  2YHA A;  1EET A;  3V4I A;  4CJ3 A;  2WON A;  1JLB A;  1RT5 A;  4I2P A;  4HCB A;  4KB1 A;  1HYS A;  1RT1 A;  3ZT1 A;  3OYA A;  1ZBI A;  3E01 A;  4FJI A;  3KLF A;  3I0S A;  4CIG A;  4DTN A;  2OZS A;  4IKF A;  1X9S A;  2HHQ A;  3OYC A;  3RRG A;  3NH1 A;  2P5O A;  3OYB A;  5C25 A;  3DLH A;  4CF2 A;  2DFF A;  1RDC A;  3ZSQ A;  5I3U A;  4N47 A;  3AVM A;  4DTP A;  2G8H A;  1CXU A;  1BIZ A;  1HQE A;  4CFA A;  4CGI A;  1S6P A;  3EY1 A;  3HK2 A;  3PX4 A;  3PY8 A;  5FRM A;  3TR8 A;  3SUP A;  4CHQ A;  3MED A;  3V9X A;  1FKO A;  2HHT A;  1TGO A;  2RPI A;  3HM9 A;  1J9A A;  2ZQB A;  1KFD A;  4RW6 A;  3ZT3 A;  3NH0 A;  4OLB A;  2GBZ A;  4YNQ A;  4MFB A;  4HHT A;  4FCY A;  1KSP A;  3PUF A;  3V9W A;  2G8U A;  3KK2 A;  2E6M A;  3VQ6 A;  2BE2 A;  2FBV A;  3LWL A;  3ZT0 A;  4DS4 A;  4DSF A;  4B8C A;  1JLG A;  3RTV A;  1NK6 A;  5DMR A;  4KFB A;  3QNN A;  3V6D A;  4KHS A;  1WSF A;  4OKE A;  5C24 A;  1CZ9 A;  3ISN C;  4FLY A;  4R5P A;  3RMD A;  1XI1 A;  3U3G A;  1QHT A;  4C8K A;  3QNO A;  4M3T A;  4FLX A;  2OPR A;  4NYF A;  4CCH A;  3OJS A;  4FM0 A;  4CJU A;  4FW2 A;  3VA3 A;  4EZ6 A;  1LAV A;  3LP2 A;  1BCM A;  3OYG A;  3TAM A;  3KK3 A;  4CF1 A;  1J5O A;  4DFK A;  1BI4 A;  3K57 A;  4H4M A;  1SV5 A;  4FZY A;  4GW6 A;  3L2R A;  1TK5 A;  3V9U A;  3NCI A;  3SUN A;  4Z4I A;  4C8N A;  3VQE A;  3DRR A;  2KQ2 A;  3CYM A;  3LAN A;  1RNH A;  3SQ0 A;  4DSI A;  4IFY A;  4CJT A;  4FK0 A;  4Z4E A;  4CFB A;  5K14 A;  4CJR A;  3K5M A;  4FM2 A;  1X9M A;  3T1A A;  1T7P A;  3QEP A;  4CED A;  3V9S A;  4E7K A;  1NJY A;  3PO5 A;  4CJ4 A;  1CXQ A;  2GUI A;  5JS1 A;  1BQN A;  3LP1 A;  4CK3 A;  1A5W A;  5J2N A;  1L3S A;  4B9T A;  4FJJ A;  4DTX A;  4Z4F A;  1U04 A;  5KGW A;  4CEE A;  1JLC A;  1RT2 A;  1NKE A;  1QS4 A;  1IKV A;  3WNG A;  2D0A A;  4CGG A;  1N6Q A;  3MEC A;  5HRP A;  1K6Y A;  3RWU A;  4TSX A;  4BDY A;  3RRH A;  1NJX A;  1EXQ A;  1A5V A;  2YV0 X;  3QEW A;  1ITG A;  4CE9 A;  2F8T A;  3P1G A;  3NHG A;  4DQQ A;  4CFD A;  1ZYQ A;  1QTM A;  3ZSX A;  1VSF A;  4KKO A;  4B9S A;  1IKX A;  4HCC A;  1RBT A;  3C6U A;  3ZSV A;  4N41 A;  4FJ9 A;  1C1B A;  3TI0 A;  3LAK A;  4FJG A;  4PA1 A;  1IH7 A;  1KFS A;  4BDZ A;  2D0B A;  3AVG A;  3OS0 A;  3RMB A;  1C6V A;  4EP4 A;  3OYL A;  1GOA A;  4CEC A;  1ZBH A;  2Z1G A;  3TWH A;  2IS3 A;  3MAQ A;  3NGY A;  3VQ5 A;  4DTM A;  3CG7 A;  1BHL A;  3M8P A;  1RBV A;  1JLA A;  4I7F A;  4O44 A;  1JLQ A;  3K2P A;  4RW7 A;  3ZT2 A;  3QEI A;  2KZM A;  4W5Q A;  1NK7 A;  2YKM A;  2E6L A;  4N56 A;  4CF8 A;  4AHS A;  3O3H A;  3OY9 A;  4IG0 A;  1TKD A;  4JS5 A;  3L2U A;  4DTJ A;  4ZTF A;  4FZX C;  4PWD A;  2F8S A;  3HST B;  3L2W A;  1GOC A;  1KRP A;  1QSY A;  3AA5 X;  3HL8 A;  3NF7 A;  4LSL A;  3AO1 A;  2PYL A;  4DWI A;  1NK5 A;  1LV5 A;  4FJK A;  4M3U A;  2FBT A;  4CF0 A;  4LY7 A;  4OKJ A;  3TAB A;  2OPQ A;  4JS4 A;  5KRS A;  3F73 A;  4FLV A;  2HW3 A;  1QSS A;  4LD0 A;  4FK2 A;  1C0T A;  2ITG A;  2VG5 A;  4DFJ A;  3U6F A;  1ASV A;  2NUB A;  4DU4 A;  4DLG A;  1JXB A;  1LWC A;  3VN5 A;  5EU7 A;  4M3R A;  1RBS A;  3DLE A;  1YTU A;  4E3S A;  1HQU A;  4DU1 A;  1B9D A;  3HT3 A;  3DYA A;  1BI4 B;  3M8R A;  1Q8I A;  2AJQ A;  4ELV A;  4E19 A;  2Q3S A;  1JXE A;  3NF9 A;  1RT4 A;  4H4O A;  1NK8 A;  2RKI A;  4DTO A;  3TAR A;  4CIE A;  4B9M A;  3ZT4 A;  1KVB A;  4OKK A;  4KRE A;  1YTA A;  4AHC A;  4AHR A;  3AVK A;  3DOK A;  3OJU A;  3D0P A;  3HP9 A;  1IKY A;  2HND A;  3HPG A;  3BDP A;  2B6A A;  1TVR A;  3K5L A;  4DU3 A;  4KRF A;  3WNE A;  2KZZ A;  4RW4 A;  3NGI A;  3AVL A;  5J1E A;  4Q5V A;  2X78 A;  3AVH A;  2DY4 A;  3RMC A;  1RTJ A;  3H08 A;  4DFM A;  4E7J A;  2QKB A;  2F96 A;  2IDO A;  2YKN A;  4FVM A;  1QE1 A;  3OVN A;  2KTQ A;  1EKE A;  4Y1D A;  5HLF A;  4EP5 A;  3O3F A;  3VQD A;  4OGC A;  4AHU A;  1HNI A;  3SUQ A;  4DTU A;  2P5G A;  1L3V A;  1WSJ A;  2ZD1 A;  4W5T A;  4PQU A;  3LP3 A;  3CM5 A;  5D3G A;  3LP0 A;  3B6P A;  5HRO A;  4NCB A;  3KD1 E;  4DTS A;  5SWM A;  3T19 A;  4N76 A;  3CFO A;  2YHB A;  4ID5 A;  4CER A;  1KCF A;  2XO7 A;  2D5R A;  1L3T A;  4FJH A;  3DOL A;  4E1N A;  4O4G A;  1ZBL A;  1LAW A;  4B3O A;  1RBR A;  3K5N A;  1S1T A;  1TV6 A;  1TKX A;  4CES A;  3MEE A;  2YNG A;  3SUO A;  1RIL A;  2IC3 A;  4BE1 A;  1YT3 A;  4CJS A;  1W0H A;  3TAN A;  1JKH A;  4HTU A;  2O4G A;  1LWE A;  3KLH A;  1D9F A;  4F8R A;  4M3X A;  2IOC A;  2YNI A;  3AA4 A;  3B6O A;  4C8O A;  4CJV A;  1DTT A;  4CK2 A;  4CEQ A;  3AO3 A;  1BIU A;  1I39 A;  1BL3 A;  3EZ5 A;  3C95 A;  3O3G A;  4HUE A;  2XY5 A;  4I9Q A;  4DQP A;  1D9D A;  4LH4 A;  2XY8 A;  4ZHR A;  1UA0 A;  1KLM A;  1KTQ A;  3G10 A;  1Z25 A;  4GVM A;  3THV A;  4O5B A;  5HP1 A;  1EP4 A;  4KTQ A;  3D45 A;  3HYF A;  2DFE A;  3FFI A;  2ATQ A;  1SL1 A;  2W42 A;  5CZ2 A;  5E41 A;  4CEO A;  2D0C A;  3DLB A;  3NBP A;  1GOB A;  1RT7 A;  1BCO A;  3DRS A;  1VRT A;  1Q9X A;  4KTW A;  2LSN A;  1LWF A;  4Z0U A;  3RR7 A;  2JLE A;  1BQM A;  2GV9 A;  5HBM A;  1RT6 A;  2P51 A;  4CJ5 A;  4FM1 A;  3C94 A;  3QIO A;  2VWJ A;  5J2M A;  1SUQ A;  4DMN A;  3KJV A;  4L8R B;  2B4J A;  2KFN A;  1REV A;  4N5S A;  3UIQ A;  4XIU A;  2G8W A;  1LW2 A;  5FRN A;  4YFU A;  2HHS A;  4C8M A;  3OYI A;  4AHT A;  1S9G A;  4OPK A;  3S3N A;  4KV8 A;  1C1C A;  4OGE A;  1C0U A;  1S1V A;  3S3M A;  1C0M A;  1DTQ A;  1S6Q A;  4DG1 A;  3KLG A;  3JSM A;  2XY7 A;  3TAP A;  4CK1 A;  1D5A A;  2XHB A;  2VG7 A;  4DSE A;  3QO9 A;  4FJX A;  1BIS A;  3SQ2 A;  1A5X A;  1UWB A;  2HHV A;  1S5J A;  4J2B A;  2RN2 A;  4CEF A;  3SJJ A;  1IO2 A;  4CHP A;  4RW8 A;  3LPT A;  3CQ8 A;  4KHY A;  3WNF A;  3SCX A;  5SZT A;  4M3Z A;  4KB0 A;  1VSK A;  2X74 A;  3TAG A;  1X9W A;  1HJR A;  3L8B A;  4RW9 A;  4DS5 A;  4E7I A;  1U47 A;  4B8A B;  4MQ3 A;  5HRS A;  3OYM A;  1TK8 A;  4CEB A;  3NH2 A;  1WAJ A;  2RF2 A;  3HP6 A;  4C8L A;  1O1W A;  2FBX A;  3EYZ A;  2A1R A;  1S1W A;  2YNF A;  3O4Q A;  4KHU A;  3DLR A;  5KI6 A;  3PX6 A;  4JRP A;  1S1U A;  4FLW A;  2DFH A;  3AVA A;  4KHW A;  3LPU A;  3L2Q A;  1HNV A;  3MXI A;  2B5J A;  4QOZ B;  2O4I A;  4ID1 A;  3OYD A;  4JRQ A;  3V81 A;  2QKK A;  4CGH A;  4KHN A;  4CHZ A;  3ALY A;  3DM2 A;  4W5R A;  3TAQ A;  3AVN A;  3CM6 A;  3K58 A;  2P1J A;  1UAX A;  4CJP A;  2IAJ A;  3SV3 A;  4B9L A;  3M8Q A;  1B9F A;  2Z1J A;  3WNH A;  5HRR A;  4E1M A;  1NKC A;  1Y97 A;  1XHX A;  1VSM A;  4NCA A;  3NGZ A;  3PX0 A;  1FK9 A;  5CYM A;  1NKB A;  4CJQ A;  4JLH A;  1NK0 A;  4PY5 A;  3L3V A;  4IG3 A;  4IFV A;  4QAG A;  3NDK A;  3I0R A;  2R7Y A;  4CJW A;  2XY6 A;  2PYJ A;  1U4B A;  4LSN A;  1T03 A;  4CF9 A;  3KTQ A;  4O0J A;  4KI6 A;  2HB5 A;  5KGX A;  4DLE A;  4FLT A;  4BE2 A;  2Z1I A;  4H8K A;  3TAF A;  1J54 A;  3ZSR A;  3LZJ A;  4F2R A;  1JLE A;  3OYK A;  3KIO A;  1NK9 A;  2G8F A;  4W5N A;  1QSL A;  5I42 A;  4DQR A;  4NYN A;  5T7B A;  4BWM A;  2HVI A;  3QER A;  4AIL C;  1WSG A;  1RTI A;  3VQB A;  1HYZ A;  2DTU A;  3DI6 A;  3VQP A;  2EX3 A;  3IRX A;  3QLH A;  4DFP A;  3HVR A;  1RCH A;  4RG8 A;  3KK1 A;  4BWJ A;  2PZS A;  4FJ5 A;  3C6T A;  3VA0 A;  3KD5 E;  3VQ7 A;  4FXD A;  1VSD A;  5HRN A;  3NFA A;  3SPY A;  4ICL A;  3M8S A;  3OYN A;  3JYT A;  4I2Q A;  3V1R A;  5CZ1 A;  3CFP A;  1TK0 A;  4WE1 A;  3ZSO A;  5KRT A;  3P5J A;  2OPP A;  2XRI A;  1G15 A;  1TL1 A;  4HUF A;  4FJM A;  5CYQ A;  3SQ4 A;  2PY5 A;  4E0D A;  1SL2 A;  3QEX A;  4DSL A;  5FRO A;  1LW0 A;  4M42 A;  2QK9 A;  3I8D A;  2YNH A;  3DLG A;  4Z4H A;  1RDA A;  2JGU A;  4KPY A;  4CJK A;  2VWK A;  2OPS A;  3ASM A;  4E7L A;  3AVJ A;  4CJL A;  4CGD A;  1SKW A;  4DSK A;  3OS1 A;  4OPJ A;  3TAE A;  4B9V A;  4PUO A;  5J2P A;  3AVF A;  4FW1 A;  4DF8 A;  4KI4 A;  3VQA A;  3O4N A;  4I9L A;  4FJ7 A;  3NF8 A;  1SKS A;  3QIN A;  2HHW A;  4EZ9 A;  1W9H A;  4CGJ A;  3VQ9 A;  3VQ4 A;  5FDL A;  3PO4 A;  4FJL A;  1IKW A;  3P83 D;  4DQI A;  3LAM A;  3VQQ A;  4FJN A;  4ELT A;  1RDD A;  3AVC A;  3V1O A;  1TAQ A;  3KLI A;  1R0A A;  1WAF A;  2X6S A;  4AH9 A;  4CJF A;  3ZCM A;  4Y1C A;  4CEA A;  1ZBU A;  3A2F A;  1XHZ A;  4M3W A;  4QCL A;  1NJW A;  1HYV A;  3F9K A;  4O55 A;  3BGR A;  3VQC A;  3G0Z A;  3OYH A;  4GMJ B;  4E7H A;  3OS2 A;  3ZSZ A;  2HNY A;  3QET A;  2G8I A;  1KVA A;  4BE0 A;  4KHQ A;  4FK4 A;  1U45 A;  3KKR A;  1XWL A;  3OYF A;  1UOC A;  2X6N A;  5DK5 A;  2KFZ A;  3HVT A;  1RT3 A;  1WN7 A;  3SQ1 A;  4B9N A;  2G8K A;  2BAN A;  4IBN A;  4DSJ A;  4FZZ A;  5C42 A;  2HMI A;  3AO5 A;  4BAC A;  3AA3 A;  3NAE A;  3QEV A;  4M3Y A;  3SI6 A;  2IGI A;  1EX4 A;  4NCG A;  3SZ2 A;  3LAL A;  3SV4 A;  1VK0 A;  3IS9 A;  1U49 A;  3ZSY A;  3HO1 A;  4F4K A;  1WNS A;  3MEG A;  3MXJ A;  3LWM A;  2HHU A;  4BDP A;  3HPO A;  4FLZ A;  3SPZ A;  3DLK A;  1VRU A;  4CGF A;  2WOM A;  2FBY A;  1CLQ A;  3SYZ A;  1RTH A;  1TKT A;  2FC0 A;  3AV9 A;  1N5Y A;  4DTR A;  1F21 A;  1J53 A;  3DMJ A;  4OJR A;  3KLE A;  2A1S A;  3K5O A;  2BGG A;  1BGX T;  4M45 A;  1JL2 A;  3S9H A;  1T05 A;  1IG9 A;  1T8E A;  3ULD A;  4CHN A;  3RMA A;  4OLA A;  4HUG A;  3T3F A;  3DRP A;  3AVI A;  1ZBF A;  2HVH A;  2HNZ A;  3V1Q A;  3HXM A;  4J2D A;  2ETJ A;  4HVJ A;  1VSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...