2X74A

Human foamy virus integrase - catalytic core.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
187
Chain Sequence
b'RPQKPFDKFFMDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSKVERKNSDMKRLLTKLLVGRPTKWYDLLPVVQLAMNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Structural Studies of the Catalytic Core of the Primate Foamy Virus (Pfv-1) Integrase
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Viral protein
total genus 55
structure length 187
sequence length 189
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2x74A00
4FJJA 4CERA 4Q0BA 1L3TA 1T03A 1UAXA 3KD5E 1U4BA 4OKEA 4OJRA 3L2QA 2KZZA 1T8EA 3RMAA 4KRFA 3QIPA 2Z1GA 3V6DA 1IKXA 4DF4A 4B8AB 4B9NA 2KZMA 1QSLA 1TKXA 5CY4A 2B6AA 4KHYA 4FJXA 1XI1A 4TSXA 4Z4EA 1TKDA 3ZSYA 3VQPA 3S9HA 1LWEA 3OYFA 1CLQA 4F3TA 3ALYA 4CE9A 5J2NA 4LH5A 4O0JA 1NK6A 4O55A 1XC9A 2G8FA 3PV8A 4CJTA 1JLFA 3VQQA 3UIQA 5D3GA 1RT4A 1B9DA 2YNFA 4DFPA 4OLBA 3A2FA 3DRSA 2QKBA 4E7JA 4AHCA 4JRQA 4KHWA 4FYDA 4CHPA 2XY8A 1MU2A 3DOKA 1YT3A 4DS4A 1XHXA 4IG0A 5KGWA 3NCIA 4BDZA 4DTRA 3TAFA 3SQ0A 4K8ZA 3K5NA 3HM9A 4CF8A 1RT5A 1J9AA 3QEVA 1NKCA 3DLEA 5KI6A 5SZTA 3P1GA 3HK2A 3K5LA 3SCXA 4CGHA 4CIGA 3LAKA 2XRIA 2DFEA 5CYQA 1BCMA 1VK0A 1WSGA 4DQRA 5J2QA 2VWKA 4C8NA 3VQ4A 2E6MA 4UQGA 3SUNA 2F8SA 4DTMA 3AVJA 4F8RA 2JGUA 3KTQA 1G15A 1W9HA 4FJKA 2D0AA 1B92A 2XY7A 3QIOA 3JYTA 1I39A 3L3VA 1SKWA 1FXXA 1TL3A 4CEAA 4CEOA 4CK2A 3O3HA 2ZE2A 4DF8A 4ELUA 1VSEA 4K8XA 3L8BA 4M3WA 4CECA 4EP5A 3LP0A 3NGYA 4F4KA 1RDCA 4Z4FA 4FXDA 1ZBHA 4YFUA 2YNIA 3DI6A 4CF0A 2YNHA 4O5BA 1C1BA 4R5PA 3EYZA 3VQ7A 2A1RA 4FW1A 1NK9A 1L3SA 3AVMA 4DFJA 4KV8A 5FDLA 1WAJA 3VQDA 4HUFA 5KGXA 2E4LA 4ZHRA 3RWUA 1JL2A 1REVA 4JRPA 1C6VA 5FRMA 4CESA 1HPZA 2A1SA 3ZT4A 4E3SA 4DSIA 2DFHA 2D5RA 2W42A 1VSFA 3DOLA 1BCOA 1DLOA 4GW6A 2OPQA 3T1AA 4AHVA 1U49A 4AILC 1T7PA 1QQCA 3ZT3A 2HHTA 3DM2A 3VQ9A 5KRSA 3KLFA 3NGIA 4KTZA 1CZBA 3MECA 4CJFA 4HUGA 2WONA 3AV9A 2XY5A 3THVA 3LZJA 3ULDA 1NK0A 1RDBA 1Y97A 4HCBA 5KRTA 3IS9A 3SNNA 3NFAA 5DMRA 3KLIA 1VSDA 4E19A 4KHUA 3SZ2A 1J5OA 4KHNA 3M8PA 2YV0X 2YKNA 3OVNA 4KO0A 3HT3A 4KTWA 1ASVA 4EP4A 1DTTA 3HJFA 3KK3A 2IS3A 4FJNA 2DTUA 3OJUA 4FM1A 3AA2A 4FJLA 5HRRA 4N47A 4BE1A 3DLHA 3F73A 4J2DA 4M42A 1Z25A 4I2PA 3VQ8A 1RBSA 3MEDA 1NK4A 2YHBA 4FZXC 1SKRA 2FBXA 2BDPA 2Z1IA 3TWHA 4AHRA 1IKWA 1YTAA 4CFDA 3NH2A 3LDSA 3ZCMA 2LSNA 3OYNA 4DTNA 1RTJA 3AVHA 3WNEA 3OYJA 3I8DA 4OPJA 1GOBA 2HHWA 1ZBIA 1S1VA 2RN2A 4M3UA 4OKKA 4Z4CA 3VQAA 4B9SA 1LAVA 4CF9A 1VSMA 3SYZA 4BWJA 1K6YA 4J2AA 2BANA 2B4JA 4LY7A 3VQCA 4BE2A 4E0DA 3V9UA 3P5JA 3AVBA 2KW4A 4OGEA 5J2PA 2HMIA 2HVHA 4CJEA 1RDAA 2YHAA 3U3GA 1JXEA 3CQ8A 1IH7A 4DS5A 3KKSA 1Q8IA 4DFKA 4CEFA 4I2QA 1HYSA 1C0TA 2D0CA 1NK8A 4QOZB 4FLWA 3LP3A 3TI0A 1WN7A 4KPYA 3K5MA 1TL1A 3S3OA 1ZBUA 1EP4A 2FBVA 3K59A 4OLAA 4I7FA 4FCYA 1RT1A 1A5WA 4PY5A 3ZSVA 3HVTA 4CHZA 4ELTA 3VQEA 1RBUA 4LD0A 3HL8A 3VN5A 4CHYA 3OS0A 4BDYA 4KB1A 3SUQA 3NF7A 1LW0A 4CJUA 3BDPA 4B9VA 3LALA 1RT6A 4DQPA 4J2BA 4FJ7A 3OYDA 4Y1CA 1JLBA 5T7BA 4M45A 4CGFA 1S9EA 2XO7A 4F2RA 3V1OA 1GOAA 2XY6A 2VG7A 1QSYA 4E7LA 2GUIA 1U48A 1TK0A 3QEWA 2Q3SA 1LAWA 1KTQA 3TAPA 1YTUA 3K2PA 1TK8A 3K5OA 4CFAA 3NH1A 1BQMA 1RTDA 2O4IA 1IO2A 4DTUA 3ZSOA 1YVUA 2OPPA 1VRUA 4DFMA 2OA8A 4NCAA 1ASUA 1SL1A 3NHGA 3G10A 4ZTJA 4CJ4A 1Q9YA 1N6QA 4N76A 1TAUA 4CF1A 4DTXA 3OYIA 4PUOA 4FZZA 4KI6A 1HQEA 1BI4A 1RTIA 3AA5X 4KI4A 4CJQA 5EU7A 4DG1A 1RTHA 4IBNA 4C8MA 3V9XA 1FKPA 4KB0A 3AO4A 4Z0UA 3KIOA 3V9WA 3RMCA 3F9KA 3LAMA 4FJ8A 2E6LA 1RT7A 3C94A 4CJSA 4CJKA 4CK3A 4F2SA 1VSLA 2HHSA 1BQNA 2G8VA 1NJYA 2IC3A 3AVGA 3KK1A 1HYZA 5HLFA 3V9SA 4DQSA 1KLMA 3IRXA 3MEGA 4DSKA 4DWIA 4FM2A 2YNGA 4CJRA 4FJHA 3M8RA 1BGXT 4FK2A 4FJIA 1BISA 1BIUA 1TAQA 1I3AA 3HPOA 2IAJA 2ATQA 1RNHA 3HSTB 3ZSQA 4CK1A 3OS2A 3AO5A 1X9WA 2VG6A 5HRSA 3P83D 4CEQA 2QXFA 4I9LA 4GVMA 4AHTA 3AVKA 1RT2A 5CZ2A 4W5OA 3QESA 4NCBA 4IDKA 3K57A 4C8LA 3B6PA 3DMJA 2X74A 1IG9A 3U3YA 3AO3A 4KHSA 4FK4A 2HHQA 2HNYA 3ASMA 3NF6A 3HXMA 2R7YA 2QK9A 1LWCA 4W5TA 1S9GA 2GV9A 3AVAA 1S1XA 3DRRA 3C6TA 4N5SA 3O3GA 4FK0A 4HHTA 4CEZA 1RBVA 2ETJA 1RBTA 2ITGA 4CHQA 3DLRA 3NF8A 2X6NA 3LPTA 1LWFA 3VA3A 2PYJA 2BGGA 1JLAA 3L2RA 1KSPA 3HPGA 4Z4IA 3QETA 1C1CA 1QTMA 1SKSA 4DMNA 1JXBA 4CGIA 1D5AA 3AVIA 4LSLA 3ZT1A 4Z4GA 1S1WA 4JS5A 1C1AA 4OGCA 1L3UA 4NYNA 3S3MA 1WAFA 2OZMA 2HB5A 3QO9A 4DQIA 3KD1E 3KK2A 3M8SA 4MFBA 4B9UA 1TKZA 4H4OA 2X78A 3OYKA 5I42A 4M3ZA 1SUQA 3HP9A 4CJLA 1CZ9A 3L2WA 3QEIA 1NJWA 4N41A 1JL1A 3SPYA 4CIEA 2OZSA 3MAQA 4H8KA 4PA1A 1JLCA 4CGJA 4CJ3A 5C25A 4G1QA 3V4IA 1ZYQA 1GOCA 3VQ6A 3DLGA 4DSLA 1QHTA 4RW7A 1HJRA 3SJJA 3IAYA 3SUOA 3NAEA 3OJSA 4BACA 3QLHA 1S6PA 1CXUA 1KVBA 3DLBA 1S1UA 1WSEA 5C24A 4I9QA 3B6OA 4KTQA 3CM5A 4FLXA 1IKYA 5CZ1A 4FJ5A 4KFBA 4CF2A 3PUFA 4FLYA 1NOZA 1FKOA 3ZT2A 1HYVA 3BGRA 3NDKA 4DU3A 4KAZA 4ID1A 3CM6A 4O4GA 4XIUA 5CYMA 3O3FA 4JS4A 4DSEA 5HP1A 4C8KA 3DLKA 3G0ZA 1TKTA 4CFCA 1X9MA 2IOCA 1EX4A 3RMDA 3LP1A 3OYEA 1KVAA 1TVRA 3HPHA 4L8RB 1RILA 4WE1A 4FZYA 4W5QA 5FRNA 5HRPA 2FBYA 3JSMA 1LV5A 1HNIA 2RF2A 4M3XA 4OKJA 3FFIA 1WNSA 3AO1A 3OYMA 3K58A 3TAQA 1J53A 3VQ5A 1U47A 3HVRA 3LANA 2OPRA 2G8UA 3PO4A 1UOCA 3MEEA 3AVNA 4DLEA 1EETA 1VSJA 4AHSA 3U6FA 4LSNA 1X9SA 4CEBA 3ISNC 3SQ2A 4C8OA 1RBRA 2HHXA 3NE6A 3OYLA 3LWLA 3I0SA 4EZ9A 1RT3A 3VQBA 3I0RA 1ASWA 4CGDA 3EY1A 1F21A 2ZQBA 4CHNA 2PYLA 2F96A 3KLHA 1W0HA 3WNHA 1WSIA 2DFFA 3QINA 4BE0A 3SV4A 3RR7A 1TV6A 1TK5A 3PX0A 3SQ4A 4QCLA 2FC0A 1NOYA 2IGIA 2G8HA 2G8IA 4O44A 2Z1JA 1UWBA 1VRTA 2DY4A 4E7IA 4DLGA 4ICLA 1X1PA 3V1RA 2JLEA 3KJVA 1KVCA 1XWLA 5K14A 4HCCA 1JLGA 1CXQA 5I3UA 2NUBA 3OY9A 4B9TA 4B9MA 3OYAA 2HHVA 4NYFA 3T19A 1WSHA 4PWDA 3V9ZA 2HHUA 3D0PA 2QKKA 3L2VA 4FLZA 1A5VA 3QEPA 1L5UA 1J54A 3V1QA 4DU1A 3HP6A 3L3UA 1C0MA 3ITHA 4DQQA 4OPKA 3AVFA 5SWMA 4MQ3A 3KLGA 4PQUA 1HQUA 2WOMA 1KRPA 1SV5A 1U04A 4AHUA 3T3FA 4B8CA 3SUPA 3NH0A 3OYCA 3NBPA 4BDPA 1HNVA 4FM0A 4O0IA 2P1JA 3C6UA 2KFNA 4CIFA 3CFPA 3RMBA 4FW2A 4F3OA 2EHGA 3CFOA 1NK5A 3NGZA 4RW6A 5FROA 2KTQA 3TAGA 1FK9A 4M41A 4B3OA 4RW8A 3O4QA 1NKEA 4B08A 2HW3A 3D45A 4OVLA 3TR8A 1JLEA 3MXJA 1WSFA 4E1MA 3WNGA 3NF9A 1U45A 5HRNA 2HNZA 1RCHA 3KKRA 4DTSA 1KFSA 3AA3A 1S1TA 2IDOA 4YNQA 3ZSXA 4IG3A 3L2UA 3TABA 1T05A 3RR8A 1BHLA 4HTUA 4E7KA 2D0BA 1D9DA 4H4MA 1EXQA 1KFDA 4W5RA 3TAMA 2Y1IA 5E41A 1XHZA 4LH4A 1NJZA 1A5XA 1Q9XA 4EZ6A 4ZTFA 3PY8A 3HO1A 4Z4HA 4FLVA 3E01A 3RTVA 4DTPA 4CEDA 2P5OA 4AH9A 2GBZA 3DRPA 5KTQA 1ZBLA 1D8YA 4B9LA 3SI6A 2KFZA 3CYMA 4FVMA 3O4NA 4FJGA 3RRGA 3LZIA 2RPIA 1NKBA 3AVCA 1JKHA 5HROA 3TAEA 4E1NA 2PY5A 1RDDA 3WNFA 1QE1A 2P5GA 4M3RA 1S6QA 3SPZA 4FJ9A 3AVLA 3DYAA 5JS1A 1VSHA 4FLUA 4DSFA 4Y1DA 2P51A 4JLHA 2EX3A 1UA0A 4FLTA 4N56A 2XHBA 1UA1A 1DTQA 2AJQA 1HRHA 1EKEA 3ZSZA 2VG5A 1KLNA 2Z1HA 2Y1JA 4E89A 2ZD1A 4CFBA 1D9FA 4ID5A 3ZT0A 3PO5A 2VWJA 3PX6A 4CJ5A 4BWMA 1BIZA 2G8KA 4ELVA 1QS4A 4DU4A 1VSKA 3LP2A 4QAGA 4DTJA 4DSJA 4CGGA 1N5YA 1QSSA 5DK5A 3LPUA 1WSJA 4HUEA 3C95A 3ZSWA 3TANA 3QNOA 3CG7A 3HYFA 1ITGA 1C0UA 4J2EA 5JS2A 4HVJA 1HMVA 2HNDA 5J2MA 4CEEA 2O4GA 3EZ5A 4CHOA 3AA4A 4FJMA 3SV3A 4RG8A 3H08A 4DTOA 3QEXA 3QERA 3TARA 2FBTA 4RW9A 4CJVA 4E7HA 3MXMA 1SL0A 1NJXA 2YKMA 2RKIA 4CJPA 3V81A 1SL2A 1IKVA 1BL3A 3KLEA 3OYBA 1O1WA 1TGOA 3LWMA 3IG1A 2I5JA 2PZSA 1ZBFA 3QNNA 2KQ2A 3AO2A 3M8QA 3RRHA 3MXIA 1L3VA 4W5NA 1R0AA 1BI4B 2F8TA 4IKFA 2X6SA 1VSIA 4RW4A 4M3TA 1KCFA 1S5JA 1WLJA 3ZSRA 4Q5VA 2HVIA 2OYQA 4IFYA 5J1EA 3VA0A 3OYGA 2G8WA 3CFRA 3SQ1A 2OPSA 1LW2A 2BE2A 3OYHA 2B5JA 1Z26A 1JLQA 4NCGA 4KREA 4GMJB 1B9FA 4CJWA 3OS1A 3PX4A 3S3NA 1NK7A 4CCHA 5C42A 4KHQA 4M3YA 4IFVA 5HBMA 4KKOA
chains in the Genus database with same CATH superfamily
4FJJA 1UAXA 4OKEA 2P9PA 1N34K 3L2QA 4BGAA 3O1WA 1JCEA 3V6DA 2OCEA 4KHYA 3K9KA 4JI1K 4TSXA 4K42A 3VTHA 1TKDA 1LWEA 5AQSA 1NGFA 3E9OA 5J2NA 2FSJA 1O13A 4O0JA 1NK6A 1ZC6A 1XC9A 4JK8A 3IDHA 1JLFA 3MX5A 1ATRA 3ZETB 3BEXA 2BUPA 2FXUA 3DRSA 2YHXA 4JRQA 4DTRA 1KAXA 2E1YA 3HM9A 1J9AA 1NKCA 3DLEA 5KI6A 4CIGA 1NJIO 2W41A 1WSGA 2VWKA 2E6MA 3C6HA 2D0PA 4F8RA 1G15A 3VESA 3VEVA 2VWBA 3JYTA 2XY7A 3NMUA 1I39A 3L3VA 1YJ9N 3OBWA 1SKWA 1TL3A 3ID8A 3K9JA 1X3NA 4DF8A 3L8BA 4YY3K 4BROA 4EP5A 1WBDA 2KLAA 1WB9A 4FXDA 2YNIA 2E2NA 2YNHA 4XH4A 3VQ7A 1GLEG 4H5RA 3VQDA 4HUFA 1JL2A 1REVA 4JRPA 1C6VA 4CESA 1YJWN 5F1XA 2OPQA 5AQUA 3T1AA 4AILC 5KRSA 4K41A 3KLFA 4DSJA 3GOIA 3LZJA 1XC3A 4GNIA 4HCBA 4FOIA 5KRTA 1Q82O 5AQWA 4YOUA 5DMRA 1VSDA 4E19A 1J5OA 2YV0X 2YKNA 3CCSN 1C0FA 5JVGL 3OJUA 5HRRA 3DLHA 3F73A 4IEIA 4YOYA 2Z1IA 3CC2N 2HBMA 4AHRA 1IKWA 1YTAA 2NRWA 4CFDA 3F9MA 5LMUK 3ZCMA 1RTJA 3WNEA 3I8DA 3FE1A 2HHWA 2RN2A 4OKKA 4CZEA 1DT9A 1BA1A 4C1NK 4CF9A 3P38A 1K6YA 4Z94A 4LY7A 3VQCA 4BE2A 4U67L 4E0DA 3CJCA 3TU5A 3Q7BA 1JXEA 2YX6A 1WBBA 3SLCA 3KKSA 3QDKA 2P9IA 1S22A 4G9ZA 1NK8A 4MDBA 3CCRN 3B8AX 1IG8A 1GLLO 3ULEB 2FLOA 3KWGA 3VN5A 2KZMA 3BDPA 4JKHA 4JN4A 3LALA 1RT6A 1GLBG 4BRKA 2NRXA 4IWVA 3V1OA 4FL9A 1N8RO 4OX9K 1U48A 3A5MC 3W3DA 5CHIA 4JI0K 1KTQA 4EHTA 1YHQN 3O6WA 1HKGA 5AQQA 4NCAA 4LF6K 4CD3A 4DV3K 4NXMK 4N76A 3G10A 4ZTJA 4O5FA 1BWFO 4CJ4A 1Q9YA 4DTXA 2F9TA 3OYIA 4FZZA 5C0YA 1RTIA 2WUSA 4LF9K 4DG1A 3V9XA 1NBWA 4KB0A 5GAHP 2ZGYA 5CE3A 3C94A 4CJSA 2VQEK 4E1JA 5FPEA 3AVGA 3KK1A 2HBJA 5AQIA 2YNGA 4CJRA 2UYTA 1ATSA 1TAQA 1XNQK 1I3AA 3HPOA 3OS2A 4CK1A 4BRAA 2VG6A 3SAHA 5HRSA 3L4QA 4W5OA 4GVMA 1RT2A 3CPWM 4NCBA 3AY9A 5MLCQ 3B6PA 3NF6A 1JCFA 3FZLA 3AVAA 4N5SA 2QWOA 4FK0A 4JKBA 4CEZA 2ASMA 3BF3A 2ETJA 3J81O 1RBTA 5M1OA 3NF8A 2X6NA 3LPTA 3EKUA 3VA3A 3AGRA 1QQMA 5AZJB 4GV6A 1QTMA 1SKSA 1OVYA 4JKDA 1K8KA 4B1ZA 4OGCA 1ATNA 1WAFA 2OZMA 1LCUA 3KD1E 4DV6K 4GV9A 3R9PA 3D2FA 4H0XB 3CCJN 4H4OA 4B9UA 3OYKA 2E88A 1SUQA 3QEIA 2FF6A 3MAQA 3V4IA 4CJ3A 5BRFA 2UXDK 1ZYQA 3DLGA 1QHTA 4FWPA 3SUOA 3NAEA 1MWKA 3QLHA 2UU9K 1VQ4N 4I9QA 4KTQA 4FLXA 4RWTA 2QA4N 4DV2K 3LM9A 4H0YB 3NDKA 3CM6A 3O3FA 1EX4A 1P8ZA 2ZJRL 4FZYA 1TYQA 4A2BA 3IMXA 4OKJA 3FFIA 1WNSA 3TAQA 3JAMO 3K58A 2G8HA 1J53A 3PO4A 3LANA 1EO1A 1UOCA 3MEEA 2E2PA 3U4LA 1NGIA 1S72N 3IFRA 3BZCA 3DXMA 1RBRA 4QS7A 2ZJPL 2HHXA 3FZFA 4EZ9A 3I0SA 4LF8K 4A5AA 3I0RA 1ASWA 3CJ1A 3A5OC 2F96A 5FRMA 3WNHA 1WSIA 4BE0A 1TV6A 4GKJK 3PX0A 3CETA 1NOYA 4BRCA 3FZHA 4DV1K 3NVKA 3OHRA 1YAGA 1XWLA 4BRIA 4JI5K 2GWJA 2CGKA 3OY9A 4B9TA 4BR7A 3SMPA 5ELZA 5DM7L 1BO5O 4FLZA 1A5VA 4B1YB 1S3XA 4BREA 3L3UA 1C0MA 3ITHA 4DQQA 4YHHK 3KLGA 1KXPA 1SV5A 3H45C 3NBPA 3EEQA 3WEEB 5GADP 4JI3K 3A5NC 4CIFA 4XH1A 4DR2K 2KTQA 3TAGA 1FK9A 3IUCA 4M41A 1YJNN 3O4QA 2IIRA 4E1MA 2ZJQL 1U45A 3LDOA 3C65A 2IDOA 4YNQA 3KHYA 1T05A 2NZTA 1BHLA 1KAYA 4BVOA 1Q9XA 3PY8A 3RTVA 3EZWA 3DRPA 1ZBLA 2KFZA 3GE1A 4X64K 5BR8K 4FJGA 2CH6A 1JKHA 4E1NA 1RDDA 3SPZA 3DYAA 1R59O 1UA0A 3SMSA 2AJQA 4YDUA 3VERA 4E89A 1W2BM 1N33K 4BRLA 3R6MA 1EWRA 1BU6O 4ELVA 3CD6N 4QAGA 1E3MA 1QSSA 4DR6K 3C95A 2P9NA 3ZSWA 1OH7A 4YORA 4JHDA 1C0UA 3GDQA 4CEEA 3HBTA 5AZIA 3SV3A 4KHPK 3H08A 2VQFK 4JD2A 4YOTA 4LF4K 2RKIA 3HSCA 2ASPA 3HRGA 2PZSA 4BG9A 4DQ8A 1BI4B 2F8TA 2X6SA 1I94K 2FF3B 2W40A 5C2FA 4QS9A 3QICA 3UKRA 2OYQA 3PLAA 1IBKK 3SQ1A 1LW2A 3OYHA 2B5JA 1JLQA 4OPAA 4KREA 4WFAL 1IBLK 3CFPA 2V51B 2P9KB 3HOSA 1VQKN 3L0QA 3KD5E 2KZZA 4BRHA 3QIPA 4CBWA 1QSLA 1TKXA 3C7NA 2YJEA 4FJXA 4BR5A 4Z4EA 2A6AA 4BRFA 3S9HA 4FO0A 2AA4A 1P90A 3PV8A 3VQQA 3UIQA 5D3GA 1XMQK 1RT4A 1B9DA 4B3MK 4BR9A 2QKBA 4FYDA 4CHPA 4WCEL 3DOKA 4CZIA 1YT3A 3SQ0A 3NCIA 4BDZA 2O8FA 4CF8A 3SCXA 2Q36A 2XRIA 1BCMA 1VK0A 1NM1A 2OANA 4DTMA 4M7XA 3KTQA 2D0AA 3VEOA 1IV0A 1SS6A 4CEOA 4K43A 3O9SA 2ZE2A 3QBWA 3CMEN 3E9LA 4ELUA 2P9SA 3NGYA 1RDCA 5C10A 1ZBHA 3ZX0A 4CF0A 1NGBA 4FW1A 1NK9A 3AVMA 3TTFA 5FDLA 5KGXA 3CF5L 5KQ8A 3T1HK 1NMDA 3WQUA 3LDPA 2D5RA 3NVMA 3VPZA 3DOLA 1KC8O 5JLHA 4GW6A 1T7PA 3ZT3A 3VGKA 4HUGA 3MECA 3MK6A 3AV9A 1YI2N 3E9PA 4O8UA 1Y97A 2ZGZA 3KLIA 4NLBA 1Y64A 4DKWA 3M8PA 3OVNA 4KO0A 3HT3A 4KTWA 1ASVA 1H1VA 4FJNA 1QZ6A 4IFEA 3AA2A 4N47A 4BE1A 5A2QO 4IXCA 1Z25A 4I2PA 4M42A 3MEDA 2YHBA 2FBXA 3TWHA 3THYA 3EE8A 1BG3A 2LSNA 3OYJA 1T6CA 3WXLA 1ZBIA 4B3RK 3BF1A 2NRRA 4Z4CA 1LAVA 3D2EB 1NMNA 4BWJA 4J2AA 5LJWA 3ZX2A 4OGEA 4HTLA 3CC4N 4CJEA 3FZKA 1EQYA 3CQ8A 1IH7A 4DS5A 1Q8IA 1U2VA 4EHUA 2O8EA 1C0TA 4FLWA 1EWQA 4I6MA 4FWLA 3MCPA 4CZFA 3TI0A 1X9JA 1ZBUA 2FBVA 3QMLA 4I7FA 4FCYA 4MO4A 3ZSVA 4ELTA 3SJHA 1RBUA 4LD0A 4CHYA 3OS0A 4M3ZA 4KB1A 1LW0A 3QBXA 4A2AA 3OYDA 4X65K 3LM2A 5T7BA 4CGFA 5JICA 4E7LA 4M63C 3VETA 1Q18A 4AM7A 3K5OA 4CFAA 1RTDA 3HZ6A 4DTUA 4H0PA 3ZSOA 3T1YK 3NHGA 1N6QA 4CF1A 1VQLN 4PUOA 4FSVA 4KI6A 1HQEA 2QI2A 3AA5X 1HLUA 1XQSC 4C8MA 4IBNA 5BREA 3AO4A 5F0XA 3RMCA 2KKZA 1Q7YO 4FJ8A 4F2SA 4CJKA 2Q0UA 5M1NA 1VSLA 1BQNA 2IC3A 4DR3K 3R3LA 1HYZA 5HLFA 3SBGA 4JK7A 4DQSA 1HKBA 3IRXA 1RFQA 3O80A 3VENA 3ENBA 1BISA 4CZKA 2IAJA 3HSTB 1RNHA 1X9WA 2IVNA 3P83D 1J6ZA 4FWOA 4AHTA 5CZ2A 3A8YA 3K57A 3WXMB 2X74A 1IG9A 3U3YA 2WBNA 2HHQA 2HNYA 4WYBA 3VGLA 4WQ5C 4W5TA 5I9EB 1S9GA 2GV9A 4K25A 4KH6A 5HL7L 1S1XA 4EAHD 1RBVA 2ITGA 1OH6A 2O8DB 2BGGA 1NGGA 1JLAA 1MDUB 3HPGA 4Z4IA 2BTFA 4BC2A 1VQMN 4DMNA 4A62A 4LSLA 1C1AA 2FSNA 3UE5A 4NYNA 2A40A 2HB5A 3FLCO 2ITMA 3G6EN 2X78A 3L2WA 2HF3A 5AQTA 3VEXA 5ADXA 4N41A 3SPYA 2OZSA 1JLCA 1GOCA 4RW7A 3JXUA 2P9UB 3CCUN 5JMVA 1HPMA 2QWNA 1S6PA 2NRHA 3U8XA 1S1UA 1XUPO 4H0VB 4JKEA 3CM5A 1IKYA 5H1SQ 4JKAA 3PUFA 4FLYA 1FKOA 3ZT2A 4KAZA 3M3ZA 4XIUA 5HP1A 4JS4A 4C8KA 2I7NA 4L8RB 4Y0WA 4DUYK 4IOAL 2V7ZA 1RILA 4WE1A 3TSQA 1GLAG 5HRPA 2FBYA 1LV5A 1HNIA 2RF2A 4M3XA 1W7AA 3AO1A 1U47A 3VQ5A 2OPRA 3AVNA 1NGCA 4BG8A 3CPEA 3NE6A 2Q2RA 3OYLA 3LWLA 1RT3A 3VQBA 5AFUH 2PYLA 5AQKA 1W0HA 1BUPA 3EKSA 2UUCK 2G8IA 4O44A 4JK9A 3D6RA 3QFUA 4JKCA 4CVNE 4DLGA 4GY2B 4A57A 4DV7K 2ASOA 2HSTA 1LOTB 4HCCA 1CXQA 5DM6L 1FJGK 4IO8A 3C6AA 2YI1A 3D0PA 2QKKA 3THWA 4AF1A 1RDUA 3ULEA 2GELA 3CHWA 1VAZA 1HQUA 1KRPA 1U04A 1ZBSA 3VMFB 4B8CA 3I55N 4BDPA 4FM0A 3LDQA 2P1JA 3C6UA 4F3OA 3NGZA 4RW6A 5FROA 1K8KB 4B3OA 5BPLA 4H03B 4B08A 3TR8A 1JLEA 1QHAA 2W6LA 5HRNA 2HNZA 3D2FB 3TTCA 3CCLN 3ZSXA 4IG3A 3RR8A 4H4MA 1EXQA 4JAXA 1KFDA 2Y1IA 3TAMA 4EZ6A 1A5XA 3SBTA 5HOOA 4C1NI 4BY9C 3CJ9A 5EVZA 5TKYA 5KTQA 2QWQA 3CYMA 3AVCA 3WNFA 1VQON 1QE1A 2P5GA 2QTDA 5JS1A 3AVLA 4JKFA 4FLUA 4DSFA 2H3GX 4Y1DA 3A5LC 2XHBA 1HRHA 2Z1HA 2ZM6K 2Y1JA 4UY8O 1SQKA 4ID5A 4CJ5A 1VQNN 2G8KA 3N4QA 1QS4A 4DU4A 1VSKA 4CZGA 4CGGA 2W6KA 5DK5A 3MWTA 4JKGB 3QNOA 3CG7A 3L4IA 1SZ2A 1ITGA 3MMVA 3DXKB 4A5BA 2HNDA 5J2MA 1E4GT 2O4GA 4NB4A 4R79A 5BPNA 4RG8A 3TARA 4CJVA 4E7HA 1SL0A 1NJXA 1GLJO 4CJPA 3V81A 3KLEA 3T69A 3IG1A 2I5JA 1ZBFA 4HWIA 3U9ZA 3RRHA 3VF4A 1R0AA 4MLEA 4IKFA 1VSIA 4M3TA 1KCFA 4JYAK 4LFCK 3WT0A 4BQLA 4Q5VA 5J1EA 3OYGA 1YF5L 3CFRA 5AQHA 2BE2A 3MCAB 1Z26A 2WTUA 4GMJB 3PX4A 3S3NA 1NK7A 5C42A 5AQXA 4IFVA 1QVFM 4IEEA 4CERA 1OKJA 1L3TA 4Q0BA 1U4BA 1T8EA 3RMAA 2P9LA 4KRFA 3HM8A 1YIJN 1IKXA 4BRPA 4B8AB 4DF4A 4B9NA 4CBUA 3ZSYA 3VQPA 1CLQA 3ALYA 3M1FA 3SAGA 1OH5A 4JV5K 2F4VK 1X3MA 4YDUC 4XEIA 4DFPA 3A2FA 3CXCM 4AHCA 2D0OA 3TAFA 4IG0A 5KGWA 5GIOA 3P4IA 3G4SN 4K8ZA 5BRDA 4OPHA 3J80O 4H5NA 1BA0A 4FWMA 4CGHA 5CYQA 5J2QA 4DQRA 3VQ4A 1YVNA 4C8NA 3SUNA 1NWKA 4BC3A 2F8SA 4CW7B 3AVJA 2JWKA 3QIOA 1ILYA 1FXXA 3GG4A 4CEAA 3O3HA 5IT9O 1VSEA 4M3WA 4JNEA 3CC7N 3LP0A 4Z4FA 4RTFD 4YFUA 4LF5K 1C1BA 3EYZA 1L3SA 3MWPA 2CH5A 5FPMA 4DFJA 4KV8A 2E4LA 4LFAK 3RWUA 2P9NB 1HPZA 2A1SA 2VGMA 1K9MO 4DSIA 1U6ZA 4JHDB 1BCOA 2AP1A 1U49A 4AHVA 3E1YA 3U9DA 3DM2A 3VQ9A 4C23A 3NGIA 4CJFA 1CZBA 4H5VA 1RGIA 3FR0A 2XY5A 1NK0A 5EX5A 1TUYA 4JEPA 3ULDA 1QVGM 3UKUB 3NFAA 3SZ2A 3SK3A 4DR5K 3H6EA 1XMOK 1DTTA 2DTUA 1BDGA 4FWRA 2Q31A 4FJLA 4BR4A 2E20A 3VQ8A 1RBSA 1NK4A 1HNZK 1SKRA 2BDPA 3UKRB 3O9RA 4ILGB 3LDSA 3OYNA 4DTNA 1GOBA 3ENOA 4IOXA 3THXB 2YHWA 4M3UA 4FWSA 4B9SA 4BGBA 1VSMA 3K0SA 2BANA 4L3QA 2B4JA 3BY5A 2NRVA 4RCHA 2HVHA 3V9UA 2KW4A 3I56N 2A41A 1RDAA 2YHAA 2UUAK 3CI5A 4DFKA 2KHOA 5AQFA 1HNXK 1VQ8N 3LP3A 3DWLA 5AR0A 3S3OA 1EP4A 4OLAA 1RT1A 1A5WA 3HVTA 5LL6Z 5GINA 5C15A 4KHUA 3HL8A 3HJFA 4DQPA 2YHYA 4CJUA 4B9VA 4FJ7A 2O8FB 3VGMA 1GLCG 2XO7A 1GOAA 4WQ4C 1QSYA 2GUIA 4FVUA 1TK0A 3QEWA 3TPQA 1LAWA 3EO3A 3TAPA 3MN9A 3K2PA 1TK8A 2HHHK 2O4IA 1YVUA 2CGLA 2OPPA 4DFMA 1KAZA 1NNEA 1TAUA 3CCVN 3A0IX 1BI4A 1WOQA 4CZHA 2QWLA 3KIOA 3LAMA 5EXWA 3BP8A 2G8VA 1NJYA 2JWLA 1KLMA 3O9TA 4DWIA 5JLFA 3ZSQA 3VEZA 2OTLN 2QXFA 3AVKA 4DCHA 3ZX3A 4C8LA 1T3VA 3AO3A 4FK4A 3O1BA 3HXMA 2R7YA 2QK9A 1LWCA 3MN7A 3DRRA 3C6TA 2O8BA 2VGNA 1KQSM 3DLRA 5LJVA 2PYJA 1KSPA 1C1CA 4FPBA 1ZXOA 1JXBA 1D5AA 3AVIA 4NLCA 3ZEUB 3S41A 3ZT1A 1S1WA 4JS5A 5AQGA 3QO9A 3KK2A 1VQ5N 4MFBA 1TKZA 3RSEB 2NLXA 5LMNK 5I42A 3DLLL 3HP9A 1VQ7N 1JL1A 4CIEA 4CZJA 4BR0A 4H8KA 4PA1A 4CGJA 5C25A 4G1QA 3SJJA 4EIAA 1KVBA 2OTJN 1WSEA 4YOVA 2P9PB 5C24A 2QW9A 3B6OA 4KFBA 4IJNA 1NOZA 1IJJA 5FPNA 3CMAN 3BGRA 3WQTA 1E4FT 5CYMA 4DSEA 3DLKA 3G0ZA 1TKTA 4CFCA 4H0TB 2IOCA 4B1VA 3OYEA 1KVAA 3JSMA 5GAGP 3EE9A 3OYMA 3UB5A 3HVRA 1VQ9N 2HBLA 4X66K 1EETA 4KBOA 1VSJA 3H1VX 4AHSA 1X9SA 4CEBA 3SQ2A 2O8CA 2UXCK 3OA9A 4CGDA 3EY1A 1F21A 4CHNA 3KLHA 2DFFA 4PKIA 1TK5A 3SQ4A 3D2EA 1MA9B 2IGIA 4PKHA 5EOYA 1QZ5A 1VRTA 4WFNL 2DY4A 4E7IA 4IJAA 3V1RA 2JLEA 1KVCA 3H3NO 1NGAA 5I3UA 2NUBA 3T19A 1WSHA 4F9OA 2HHUA 3QEPA 2DPNA 4IO9L 1J54A 3PIOL 1ESVA 2IVOA 1DEJA 4DU1A 3HP6A 2BH1A 4DB3A 3AVFA 4MQ3A 3SUPA 5C2DA 3T3FA 1C0GA 4BRMA 1HNVA 1Z6RA 2KFNA 2EHGA 3CFOA 5CR4A 1NK5A 4DR1K 2HW3A 3D45A 4OVLA 1V4SA 1WSFA 3NF9A 1RCHA 2GUPA 3ZETA 4BVPA 1KFSA 4DUZK 1S1TA 3R1XA 3TABA 4HTUA 4JI8K 1XHZA 1NJZA 4BRNA 5E41A 3N4PA 4Z4HA 4FLVA 5BPMA 4DTPA 4CEDA 5KPZA 4AH9A 2GBZA 4B9LA 3SI6A 3RRGA 3LZIA 1NKBA 1K73O 5AQNA 4BR2A 3TAEA 2PY5A 1N32K 4M3RA 1S6QA 4FJ9A 4MLHA 3BZKA 1VSHA 3G25A 3O08A 2P9IB 4JLHA 1DTQA 1EKEA 3M6GA 1KLNA 4CFBA 3ZT0A 3PX6A 4BWMA 1BIZA 2YCHA 1OVQA 3LP2A 2PFUA 3EL2A 4DTJA 3ZLJA 3LPUA 1VHXA 4HUEA 4LFBK 2EWSA 4DR4K 4J2EA 5JS2A 4HVJA 3EZ5A 2RHKA 3AA4A 4FJMA 1VQPN 1IBMK 4DTOA 4U7BA 3J7ZO 2FBTA 4RW9A 2O8DA 3MXMA 3TSPA 2PAVA 3G71N 1IKVA 3OYBA 1O1WA 3LWMA 1SAZA 3VTIA 3QNNA 3MDQA 5AQLA 4B3SK 3M8QA 2UUBK 3ATVA 1L3VA 3SAFA 3FFKB 5AQPA 4RW4A 2NNWA 1S5JA 5M1PA 1WLJA 5LY3A 2HVIA 3VA0A 3EN9A 3CQYA 2G8WA 2OPSA 4WQ5A 4NCGA 4ISGA 1B9FA 4DV5K 3THWB 2P9UA 1JCGA 5KPTA 5GIPA 1T03A 4OJRA 1NGEA 2A5XA 2Z1GA 5CY4A 2B6AA 1XI1A 4PHTX 1W97L 3OYFA 4ILJA 3VEYA 3ZYYX 4F3TA 4CE9A 2GTDA 4LH5A 3QFPA 4O55A 2G8FA 4B3TK 4CJTA 4YOXA 4JI4K 3TSUA 4OLBA 2YNFA 4FPAA 4E7JA 4KHWA 4ISFA 2XY8A 1MU2A 4DS4A 1XHXA 1CZAN 4MO5A 3K5NA 3QEVA 1RT5A 5SZTA 3P1GA 3HK2A 3K5LA 2HBKA 3LAKA 2DFEA 4UQGA 2JGUA 1W9HA 4KH4A 4FJKA 4B1WB 4CZLA 1B92A 4CK2A 3OW2M 5M1KA 3VF2A 5FLXO 5E26A 4K8XA 4CECA 2HF4A 4F4KA 3W0LA 3DI6A 4CJ7A 4O5BA 4R5PA 2A1RA 1WAJA 2QXLA 3TTDA 4ZHRA 3AGKA 4E3SA 2YJFA 3ZT4A 2DFHA 2W42A 1VSFA 3PIPL 1DLOA 3CIPA 1QQCA 4A61A 2HHTA 4KTZA 4DV4K 2WONA 3THVA 1RDBA 3SNNA 3IS9A 1TYQB 2QWPA 5C12A 4KHNA 4EP4A 3KK3A 2IS3A 1YITN 2E2QA 3M5RA 4FM1A 3H46O 4J2DA 4FZXC 3HOTA 3DXMB 4MDAA 3D7EO 3NH2A 3AVHA 3CERA 4OPJA 1KD1O 4LF7K 1NU0A 5AQMA 5AZJA 1S1VA 1T44A 1YUWA 4BC4A 3VQAA 3SYZA 2E5LK 2P9LB 1Q86O 3P5JA 2GWKA 3AVBA 2HMIA 5J2PA 3U3GA 3GBTA 4BRQA 4CEFA 4I2QA 1HYSA 4IOCL 2D0CA 4QOZB 5M1QA 1WN7A 4KPYA 3K5MA 1TL1A 1K8AO 3K59A 4GVEA 2D1KA 3LDNA 4PY5A 3OBYA 4CHZA 4JI6K 2NRTA 3VQEA 1GLFO 5AQVA 4BDYA 4JKGA 3SUQA 3NF7A 4J2BA 4O8KA 4Y1CA 1JLBA 3DXKA 3QB0A 4M45A 1S9EA 1JJ2M 5GAEP 4EFHA 3L6QA 4F2RA 2XY6A 2A3ZA 2VG7A 2HMPA 3F5TA 2Q3SA 4GV3A 3CJBA 1YTUA 2UXBK 3NH1A 1BQMA 4BRDA 1IO2A 1QQNA 2OA8A 1VRUA 4NO7A 5M1FA 4PL7A 1ASUA 1SL1A 4B1XB 1J5EK 3AAQA 5B8HA 3CJ7A 4KI4A 4CJQA 5EU7A 1NLVA 1RTHA 4CI6A 4AM6A 1FKPA 4Z0UA 5AQZA 3AARA 3V9WA 3F9KA 2E6LA 1RT7A 3AAPA 4CK3A 2HHSA 4FWKA 3CCMN 2E1ZA 3V9SA 3MEGA 4DSKA 4FM2A 4FJHA 3M8RA 1BGXT 4FK2A 2HOEA 4FJIA 1BIUA 4X62K 2ATQA 3AO5A 2WFBA 1HUXA 4CEQA 3ID6A 4I9LA 2QWMA 3FZMA 3HTVA 1OH8A 5AJ3K 4H0OA 3QESA 4IDKA 5F2RA 1M1KO 3DMJA 4KHSA 3O5BA 3ASMA 3WXIA 3CQXA 5AQOA 1M90O 3DAWA 3O3GA 4HHTA 1HJOA 5TKWA 5AZIB 3ENHA 3IKMA 4CZMA 4CHQA 4JD2B 1VQ6N 1LWFA 3WEEA 5AQRA 3L2RA 1NGJA 3QETA 4CGIA 4Z4GA 3KK7A 2VCPA 1L3UA 3S3MA 4DQIA 3O8MA 4B1UB 2V52B 3M8SA 4J8FA 5ADXH 3VOVA 4CJLA 4DV0K 1CZ9A 1NJWA 3OTOK 3KVGA 2F9WA 3VQ6A 2D4WA 4DSLA 4H5TA 1HJRA 3IAYA 4BACA 3OJSA 1CXUA 3CCQN 3DLBA 4IDHA 1N36K 5BN9A 3WXJA 3Q7CA 5CZ1A 4FJ5A 4CF2A 4WFBL 1HR0K 3C7NB 1NG9A 5FPDA 1HYVA 4DU3A 4ID1A 3WUHA 4O4GA 3R8EA 1X9MA 5BR9A 1T6DA 3RMDA 3LP1A 1TVRA 3HPHA 4LC9B 3UKUA 4W5QA 3O9QA 5FRNA 3ATUA 2VYPA 4QS8A 4KH5A 2I7PA 2G8UA 4DLEA 3I33A 3U6FA 4LSNA 4C8OA 3ISNC 5BN8A 1GLDG 1RDWX 2ZQBA 5AFUA 2A42A 3QINA 3SV4A 3THXA 3RR7A 2CGJA 4ISEA 4NXNK 1NGHA 4QCLA 2FC0A 4A59A 2FSKA 4DHYA 2Z1JA 1UWBA 2ZF5O 2P9SB 5BRHA 3PSIA 5IWAK 4ICLA 1X1PA 3MN5A 3KJVA 4YOWA 5K14A 2QWRA 1JLGA 2GEMA 3O4WA 4B9MA 3BUZB 3OYAA 3DJCA 4NYFA 4PWDA 2HHVA 3V9ZA 2GX9A 3L2VA 1L5UA 2Q0RA 4BC5A 1HNWK 4M7YA 3V1QA 1DGKN 4FWNA 2P9KA 4GKKK 2O8BB 5JVHL 4OPKA 5SWMA 2Q97A 4PQUA 2WOMA 4AHUA 3NH0A 2RE2A 3OYCA 4O0IA 2QM1A 3LDLA 4FW2A 3RMBA 4RW8A 2J4RA 1NKEA 1WUAA 2E2OA 4IZ9A 3P31A 3MXJA 3WNGA 1G99A 2ZWHA 1DKGD 3KKRA 4DTSA 3AA3A 3J7YP 3L2UA 2WC9A 2PBDA 3THYB 3CJAA 4FWQA 4E7KA 2D0BA 1D9DA 2E8AA 1HKCA 1V4TA 4W5RA 4PKGA 4LH4A 3J8AA 1MWMA 2NRZA 4ZTFA 5AQJA 3KWIA 4FOEA 3HO1A 4JI2K 3E01A 3RVCA 2P5OA 4XH5A 1HX1A 4B9QA 3GL1A 4BRGA 1D8YA 4FVMA 3O4NA 2RPIA 3VEWA 3MX2A 5HROA 4CBXA 1YXQA 4H5WA 3H1QA 3H3OB 4WQ4A 3JS6A 3I8BA 2V7YA 1U2VB 2P51A 2EX3A 3VF6A 4FLTA 4N56A 4ILHA 1UA1A 2O8EB 4BQZA 3J7AP 3ZSZA 2VG5A 2ZD1A 1D9FA 4I6MB 3PO5A 2VWJA 3E66A 3KZBA 1N5YA 3C0BA 1WSJA 4CD1A 3CCEN 4V19S 3TANA 4OO1J 3HYFA 3HI0A 1Z05A 1HMVA 1NGDA 5KPRA 4DR7K 1TUUA 4PL8A 4CHOA 2O8CB 3O9UA 1BOTO 3QERA 3QEXA 3PSFA 2YKMA 5AQYA 1SL2A 1BL3A 1TGOA 5EY4A 2QEXN 5E84A 4JI7K 3MN6A 3ZEUA 4WF9L 3P39A 3F2KA 3T7ZA 2IVPA 2KQ2A 3AO2A 3MXIA 4W5NA 4AQYK 1Q81O 3FGUA 3RSEA 3WXKA 1FW6A 2Q1NA 3ZSRA 4IFYA 1QQOA 1XNRK 5KQDA 2F7TA 3LL3A 3OS1A 4CJWA 1D4XA 4CCHA 4KHQA 4M3YA 4K0KK 5HBMA 4KKOA
chains in the Genus database with same CATH topology
4FJJA 4CERA 4Q0BA 1L3TA 1T03A 1UAXA 3KD5E 1U4BA 4OKEA 4OJRA 3L2QA 2KZZA 1T8EA 3RMAA 4KRFA 3QIPA 2Z1GA 3V6DA 1IKXA 4DF4A 4B8AB 4B9NA 2KZMA 1QSLA 1TKXA 5CY4A 2B6AA 4KHYA 4FJXA 1XI1A 4TSXA 4Z4EA 1TKDA 3ZSYA 3VQPA 3S9HA 1LWEA 3OYFA 1CLQA 4F3TA 3ALYA 4CE9A 5J2NA 4LH5A 4O0JA 1NK6A 4O55A 1XC9A 2G8FA 3PV8A 4CJTA 1JLFA 3VQQA 3UIQA 5D3GA 1RT4A 1B9DA 2YNFA 4DFPA 4OLBA 3A2FA 3DRSA 2QKBA 4E7JA 4AHCA 4JRQA 4KHWA 4FYDA 4CHPA 2XY8A 1MU2A 3DOKA 1YT3A 4DS4A 1XHXA 4IG0A 5KGWA 3NCIA 4BDZA 4DTRA 3TAFA 3SQ0A 4K8ZA 3K5NA 3HM9A 4CF8A 1RT5A 1J9AA 3QEVA 1NKCA 3DLEA 5KI6A 5SZTA 3P1GA 3HK2A 3K5LA 3SCXA 4CGHA 4CIGA 3LAKA 2XRIA 2DFEA 5CYQA 1BCMA 1VK0A 1WSGA 4DQRA 5J2QA 2VWKA 4C8NA 3VQ4A 2E6MA 4UQGA 3SUNA 2F8SA 4DTMA 3AVJA 4F8RA 2JGUA 3KTQA 1G15A 1W9HA 4FJKA 2D0AA 1B92A 2XY7A 3QIOA 3JYTA 1I39A 3L3VA 1SKWA 1FXXA 1TL3A 4CEAA 4CEOA 4CK2A 3O3HA 2ZE2A 4DF8A 4ELUA 1VSEA 4K8XA 3L8BA 4M3WA 4CECA 4EP5A 3LP0A 3NGYA 4F4KA 1RDCA 4Z4FA 4FXDA 1ZBHA 4YFUA 2YNIA 3DI6A 4CF0A 2YNHA 4O5BA 1C1BA 4R5PA 3EYZA 3VQ7A 2A1RA 4FW1A 1NK9A 1L3SA 3AVMA 4DFJA 4KV8A 5FDLA 1WAJA 3VQDA 4HUFA 5KGXA 2E4LA 4ZHRA 3RWUA 1JL2A 1REVA 4JRPA 1C6VA 5FRMA 4CESA 1HPZA 2A1SA 3ZT4A 4E3SA 4DSIA 2DFHA 2D5RA 2W42A 1VSFA 3DOLA 1BCOA 1DLOA 4GW6A 2OPQA 3T1AA 4AHVA 1U49A 4AILC 1T7PA 1QQCA 3ZT3A 2HHTA 3DM2A 3VQ9A 5KRSA 3KLFA 3NGIA 4KTZA 1CZBA 3MECA 4CJFA 4HUGA 2WONA 3AV9A 2XY5A 3THVA 3LZJA 3ULDA 1NK0A 1RDBA 1Y97A 4HCBA 5KRTA 3IS9A 3SNNA 3NFAA 5DMRA 3KLIA 1VSDA 4E19A 4KHUA 3SZ2A 1J5OA 4KHNA 3M8PA 2YV0X 2YKNA 3OVNA 4KO0A 3HT3A 4KTWA 1ASVA 4EP4A 1DTTA 3HJFA 3KK3A 2IS3A 4FJNA 2DTUA 3OJUA 4FM1A 3AA2A 4FJLA 5HRRA 4N47A 4BE1A 3DLHA 3F73A 4J2DA 4M42A 1Z25A 4I2PA 3VQ8A 1RBSA 3MEDA 1NK4A 2YHBA 4FZXC 1SKRA 2FBXA 2BDPA 2Z1IA 3TWHA 4AHRA 1IKWA 1YTAA 4CFDA 3NH2A 3LDSA 3ZCMA 2LSNA 3OYNA 4DTNA 1RTJA 3AVHA 3WNEA 3OYJA 3I8DA 4OPJA 1GOBA 2HHWA 1ZBIA 1S1VA 2RN2A 4M3UA 4OKKA 4Z4CA 3VQAA 4B9SA 1LAVA 4CF9A 1VSMA 3SYZA 4BWJA 1K6YA 4J2AA 2BANA 2B4JA 4LY7A 3VQCA 4BE2A 4E0DA 3V9UA 3P5JA 3AVBA 2KW4A 4OGEA 5J2PA 2HMIA 2HVHA 4CJEA 1RDAA 2YHAA 3U3GA 1JXEA 3CQ8A 1IH7A 4DS5A 3KKSA 1Q8IA 4DFKA 4CEFA 4I2QA 1HYSA 1C0TA 2D0CA 1NK8A 4QOZB 4FLWA 3LP3A 3TI0A 1WN7A 4KPYA 3K5MA 1TL1A 3S3OA 1ZBUA 1EP4A 2FBVA 3K59A 4OLAA 4I7FA 4FCYA 1RT1A 1A5WA 4PY5A 3ZSVA 3HVTA 4CHZA 4ELTA 3VQEA 1RBUA 4LD0A 3HL8A 3VN5A 4CHYA 3OS0A 4BDYA 4KB1A 3SUQA 3NF7A 1LW0A 4CJUA 3BDPA 4B9VA 3LALA 1RT6A 4DQPA 4J2BA 4FJ7A 3OYDA 4Y1CA 1JLBA 5T7BA 4M45A 4CGFA 1S9EA 2XO7A 4F2RA 3V1OA 1GOAA 2XY6A 2VG7A 1QSYA 4E7LA 2GUIA 1U48A 1TK0A 3QEWA 2Q3SA 1LAWA 1KTQA 3TAPA 1YTUA 3K2PA 1TK8A 3K5OA 4CFAA 3NH1A 1BQMA 1RTDA 2O4IA 1IO2A 4DTUA 3ZSOA 1YVUA 2OPPA 1VRUA 4DFMA 2OA8A 4NCAA 1ASUA 1SL1A 3NHGA 3G10A 4ZTJA 4CJ4A 1Q9YA 1N6QA 4N76A 1TAUA 4CF1A 4DTXA 3OYIA 4PUOA 4FZZA 4KI6A 1HQEA 1BI4A 1RTIA 3AA5X 4KI4A 4CJQA 5EU7A 4DG1A 1RTHA 4IBNA 4C8MA 3V9XA 1FKPA 4KB0A 3AO4A 4Z0UA 3KIOA 3V9WA 3RMCA 3F9KA 3LAMA 4FJ8A 2E6LA 1RT7A 3C94A 4CJSA 4CJKA 4CK3A 4F2SA 1VSLA 2HHSA 1BQNA 2G8VA 1NJYA 2IC3A 3AVGA 3KK1A 1HYZA 5HLFA 3V9SA 4DQSA 1KLMA 3IRXA 3MEGA 4DSKA 4DWIA 4FM2A 2YNGA 4CJRA 4FJHA 3M8RA 1BGXT 4FK2A 4FJIA 1BISA 1BIUA 1TAQA 1I3AA 3HPOA 2IAJA 2ATQA 1RNHA 3HSTB 3ZSQA 4CK1A 3OS2A 3AO5A 1X9WA 2VG6A 5HRSA 3P83D 4CEQA 2QXFA 4I9LA 4GVMA 4AHTA 3AVKA 1RT2A 5CZ2A 4W5OA 3QESA 4NCBA 4IDKA 3K57A 4C8LA 3B6PA 3DMJA 2X74A 1IG9A 3U3YA 3AO3A 4KHSA 4FK4A 2HHQA 2HNYA 3ASMA 3NF6A 3HXMA 2R7YA 2QK9A 1LWCA 4W5TA 1S9GA 2GV9A 3AVAA 1S1XA 3DRRA 3C6TA 4N5SA 3O3GA 4FK0A 4HHTA 4CEZA 1RBVA 2ETJA 1RBTA 2ITGA 4CHQA 3DLRA 3NF8A 2X6NA 3LPTA 1LWFA 3VA3A 2PYJA 2BGGA 1JLAA 3L2RA 1KSPA 3HPGA 4Z4IA 3QETA 1C1CA 1QTMA 1SKSA 4DMNA 1JXBA 4CGIA 1D5AA 3AVIA 4LSLA 3ZT1A 4Z4GA 1S1WA 4JS5A 1C1AA 4OGCA 1L3UA 4NYNA 3S3MA 1WAFA 2OZMA 2HB5A 3QO9A 4DQIA 3KD1E 3KK2A 3M8SA 4MFBA 4B9UA 1TKZA 4H4OA 2X78A 3OYKA 5I42A 4M3ZA 1SUQA 3HP9A 4CJLA 1CZ9A 3L2WA 3QEIA 1NJWA 4N41A 1JL1A 3SPYA 4CIEA 2OZSA 3MAQA 4H8KA 4PA1A 1JLCA 4CGJA 4CJ3A 5C25A 4G1QA 3V4IA 1ZYQA 1GOCA 3VQ6A 3DLGA 4DSLA 1QHTA 4RW7A 1HJRA 3SJJA 3IAYA 3SUOA 3NAEA 3OJSA 4BACA 3QLHA 1S6PA 1CXUA 1KVBA 3DLBA 1S1UA 1WSEA 5C24A 4I9QA 3B6OA 4KTQA 3CM5A 4FLXA 1IKYA 5CZ1A 4FJ5A 4KFBA 4CF2A 3PUFA 4FLYA 1NOZA 1FKOA 3ZT2A 1HYVA 3BGRA 3NDKA 4DU3A 4KAZA 4ID1A 3CM6A 4O4GA 4XIUA 5CYMA 3O3FA 4JS4A 4DSEA 5HP1A 4C8KA 3DLKA 3G0ZA 1TKTA 4CFCA 1X9MA 2IOCA 1EX4A 3RMDA 3LP1A 3OYEA 1KVAA 1TVRA 3HPHA 4L8RB 1RILA 4WE1A 4FZYA 4W5QA 5FRNA 5HRPA 2FBYA 3JSMA 1LV5A 1HNIA 2RF2A 4M3XA 4OKJA 3FFIA 1WNSA 3AO1A 3OYMA 3K58A 3TAQA 1J53A 3VQ5A 1U47A 3HVRA 3LANA 2OPRA 2G8UA 3PO4A 1UOCA 3MEEA 3AVNA 4DLEA 1EETA 1VSJA 4AHSA 3U6FA 4LSNA 1X9SA 4CEBA 3ISNC 3SQ2A 4C8OA 1RBRA 2HHXA 3NE6A 3OYLA 3LWLA 3I0SA 4EZ9A 1RT3A 3VQBA 3I0RA 1ASWA 4CGDA 3EY1A 1F21A 2ZQBA 4CHNA 2PYLA 2F96A 3KLHA 1W0HA 3WNHA 1WSIA 2DFFA 3QINA 4BE0A 3SV4A 3RR7A 1TV6A 1TK5A 3PX0A 3SQ4A 4QCLA 2FC0A 1NOYA 2IGIA 2G8HA 2G8IA 4O44A 2Z1JA 1UWBA 1VRTA 2DY4A 4E7IA 4DLGA 4ICLA 1X1PA 3V1RA 2JLEA 3KJVA 1KVCA 1XWLA 5K14A 4HCCA 1JLGA 1CXQA 5I3UA 2NUBA 3OY9A 4B9TA 4B9MA 3OYAA 2HHVA 4NYFA 3T19A 1WSHA 4PWDA 3V9ZA 2HHUA 3D0PA 2QKKA 3L2VA 4FLZA 1A5VA 3QEPA 1L5UA 1J54A 3V1QA 4DU1A 3HP6A 3L3UA 1C0MA 3ITHA 4DQQA 4OPKA 3AVFA 5SWMA 4MQ3A 3KLGA 4PQUA 1HQUA 2WOMA 1KRPA 1SV5A 1U04A 4AHUA 3T3FA 4B8CA 3SUPA 3NH0A 3OYCA 3NBPA 4BDPA 1HNVA 4FM0A 4O0IA 2P1JA 3C6UA 2KFNA 4CIFA 3CFPA 3RMBA 4FW2A 4F3OA 2EHGA 3CFOA 1NK5A 3NGZA 4RW6A 5FROA 2KTQA 3TAGA 1FK9A 4M41A 4B3OA 4RW8A 3O4QA 1NKEA 4B08A 2HW3A 3D45A 4OVLA 3TR8A 1JLEA 3MXJA 1WSFA 4E1MA 3WNGA 3NF9A 1U45A 5HRNA 2HNZA 1RCHA 3KKRA 4DTSA 1KFSA 3AA3A 1S1TA 2IDOA 4YNQA 3ZSXA 4IG3A 3L2UA 3TABA 1T05A 3RR8A 1BHLA 4HTUA 4E7KA 2D0BA 1D9DA 4H4MA 1EXQA 1KFDA 4W5RA 3TAMA 2Y1IA 5E41A 1XHZA 4LH4A 1NJZA 1A5XA 1Q9XA 4EZ6A 4ZTFA 3PY8A 3HO1A 4Z4HA 4FLVA 3E01A 3RTVA 4DTPA 4CEDA 2P5OA 4AH9A 2GBZA 3DRPA 5KTQA 1ZBLA 1D8YA 4B9LA 3SI6A 2KFZA 3CYMA 4FVMA 3O4NA 4FJGA 3RRGA 3LZIA 2RPIA 1NKBA 3AVCA 1JKHA 5HROA 3TAEA 4E1NA 2PY5A 1RDDA 3WNFA 1QE1A 2P5GA 4M3RA 1S6QA 3SPZA 4FJ9A 3AVLA 3DYAA 5JS1A 1VSHA 4FLUA 4DSFA 4Y1DA 2P51A 4JLHA 2EX3A 1UA0A 4FLTA 4N56A 2XHBA 1UA1A 1DTQA 2AJQA 1HRHA 1EKEA 3ZSZA 2VG5A 1KLNA 2Z1HA 2Y1JA 4E89A 2ZD1A 4CFBA 1D9FA 4ID5A 3ZT0A 3PO5A 2VWJA 3PX6A 4CJ5A 4BWMA 1BIZA 2G8KA 4ELVA 1QS4A 4DU4A 1VSKA 3LP2A 4QAGA 4DTJA 4DSJA 4CGGA 1N5YA 1QSSA 5DK5A 3LPUA 1WSJA 4HUEA 3C95A 3ZSWA 3TANA 3QNOA 3CG7A 3HYFA 1ITGA 1C0UA 4J2EA 5JS2A 4HVJA 1HMVA 2HNDA 5J2MA 4CEEA 2O4GA 3EZ5A 4CHOA 3AA4A 4FJMA 3SV3A 4RG8A 3H08A 4DTOA 3QEXA 3QERA 3TARA 2FBTA 4RW9A 4CJVA 4E7HA 3MXMA 1SL0A 1NJXA 2YKMA 2RKIA 4CJPA 3V81A 1SL2A 1IKVA 1BL3A 3KLEA 3OYBA 1O1WA 1TGOA 3LWMA 3IG1A 2I5JA 2PZSA 1ZBFA 3QNNA 2KQ2A 3AO2A 3M8QA 3RRHA 3MXIA 1L3VA 4W5NA 1R0AA 1BI4B 2F8TA 4IKFA 2X6SA 1VSIA 4RW4A 4M3TA 1KCFA 1S5JA 1WLJA 3ZSRA 4Q5VA 2HVIA 2OYQA 4IFYA 5J1EA 3VA0A 3OYGA 2G8WA 3CFRA 3SQ1A 2OPSA 1LW2A 2BE2A 3OYHA 2B5JA 1Z26A 1JLQA 4NCGA 4KREA 4GMJB 1B9FA 4CJWA 3OS1A 3PX4A 3S3NA 1NK7A 4CCHA 5C42A 4KHQA 4M3YA 4IFVA 5HBMA 4KKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FJJ A;  4CER A;  4Q0B A;  1L3T A;  1T03 A;  1UAX A;  3KD5 E;  1U4B A;  4OKE A;  4OJR A;  3L2Q A;  2KZZ A;  1T8E A;  3RMA A;  4KRF A;  3QIP A;  2Z1G A;  3V6D A;  1IKX A;  4DF4 A;  4B8A B;  4B9N A;  2KZM A;  1QSL A;  1TKX A;  5CY4 A;  2B6A A;  4KHY A;  4FJX A;  1XI1 A;  4TSX A;  4Z4E A;  1TKD A;  3ZSY A;  3VQP A;  3S9H A;  1LWE A;  3OYF A;  1CLQ A;  4F3T A;  3ALY A;  4CE9 A;  5J2N A;  4LH5 A;  4O0J A;  1NK6 A;  4O55 A;  1XC9 A;  2G8F A;  3PV8 A;  4CJT A;  1JLF A;  3VQQ A;  3UIQ A;  5D3G A;  1RT4 A;  1B9D A;  2YNF A;  4DFP A;  4OLB A;  3A2F A;  3DRS A;  2QKB A;  4E7J A;  4AHC A;  4JRQ A;  4KHW A;  4FYD A;  4CHP A;  2XY8 A;  1MU2 A;  3DOK A;  1YT3 A;  4DS4 A;  1XHX A;  4IG0 A;  5KGW A;  3NCI A;  4BDZ A;  4DTR A;  3TAF A;  3SQ0 A;  4K8Z A;  3K5N A;  3HM9 A;  4CF8 A;  1RT5 A;  1J9A A;  3QEV A;  1NKC A;  3DLE A;  5KI6 A;  5SZT A;  3P1G A;  3HK2 A;  3K5L A;  3SCX A;  4CGH A;  4CIG A;  3LAK A;  2XRI A;  2DFE A;  5CYQ A;  1BCM A;  1VK0 A;  1WSG A;  4DQR A;  5J2Q A;  2VWK A;  4C8N A;  3VQ4 A;  2E6M A;  4UQG A;  3SUN A;  2F8S A;  4DTM A;  3AVJ A;  4F8R A;  2JGU A;  3KTQ A;  1G15 A;  1W9H A;  4FJK A;  2D0A A;  1B92 A;  2XY7 A;  3QIO A;  3JYT A;  1I39 A;  3L3V A;  1SKW A;  1FXX A;  1TL3 A;  4CEA A;  4CEO A;  4CK2 A;  3O3H A;  2ZE2 A;  4DF8 A;  4ELU A;  1VSE A;  4K8X A;  3L8B A;  4M3W A;  4CEC A;  4EP5 A;  3LP0 A;  3NGY A;  4F4K A;  1RDC A;  4Z4F A;  4FXD A;  1ZBH A;  4YFU A;  2YNI A;  3DI6 A;  4CF0 A;  2YNH A;  4O5B A;  1C1B A;  4R5P A;  3EYZ A;  3VQ7 A;  2A1R A;  4FW1 A;  1NK9 A;  1L3S A;  3AVM A;  4DFJ A;  4KV8 A;  5FDL A;  1WAJ A;  3VQD A;  4HUF A;  5KGX A;  2E4L A;  4ZHR A;  3RWU A;  1JL2 A;  1REV A;  4JRP A;  1C6V A;  5FRM A;  4CES A;  1HPZ A;  2A1S A;  3ZT4 A;  4E3S A;  4DSI A;  2DFH A;  2D5R A;  2W42 A;  1VSF A;  3DOL A;  1BCO A;  1DLO A;  4GW6 A;  2OPQ A;  3T1A A;  4AHV A;  1U49 A;  4AIL C;  1T7P A;  1QQC A;  3ZT3 A;  2HHT A;  3DM2 A;  3VQ9 A;  5KRS A;  3KLF A;  3NGI A;  4KTZ A;  1CZB A;  3MEC A;  4CJF A;  4HUG A;  2WON A;  3AV9 A;  2XY5 A;  3THV A;  3LZJ A;  3ULD A;  1NK0 A;  1RDB A;  1Y97 A;  4HCB A;  5KRT A;  3IS9 A;  3SNN A;  3NFA A;  5DMR A;  3KLI A;  1VSD A;  4E19 A;  4KHU A;  3SZ2 A;  1J5O A;  4KHN A;  3M8P A;  2YV0 X;  2YKN A;  3OVN A;  4KO0 A;  3HT3 A;  4KTW A;  1ASV A;  4EP4 A;  1DTT A;  3HJF A;  3KK3 A;  2IS3 A;  4FJN A;  2DTU A;  3OJU A;  4FM1 A;  3AA2 A;  4FJL A;  5HRR A;  4N47 A;  4BE1 A;  3DLH A;  3F73 A;  4J2D A;  4M42 A;  1Z25 A;  4I2P A;  3VQ8 A;  1RBS A;  3MED A;  1NK4 A;  2YHB A;  4FZX C;  1SKR A;  2FBX A;  2BDP A;  2Z1I A;  3TWH A;  4AHR A;  1IKW A;  1YTA A;  4CFD A;  3NH2 A;  3LDS A;  3ZCM A;  2LSN A;  3OYN A;  4DTN A;  1RTJ A;  3AVH A;  3WNE A;  3OYJ A;  3I8D A;  4OPJ A;  1GOB A;  2HHW A;  1ZBI A;  1S1V A;  2RN2 A;  4M3U A;  4OKK A;  4Z4C A;  3VQA A;  4B9S A;  1LAV A;  4CF9 A;  1VSM A;  3SYZ A;  4BWJ A;  1K6Y A;  4J2A A;  2BAN A;  2B4J A;  4LY7 A;  3VQC A;  4BE2 A;  4E0D A;  3V9U A;  3P5J A;  3AVB A;  2KW4 A;  4OGE A;  5J2P A;  2HMI A;  2HVH A;  4CJE A;  1RDA A;  2YHA A;  3U3G A;  1JXE A;  3CQ8 A;  1IH7 A;  4DS5 A;  3KKS A;  1Q8I A;  4DFK A;  4CEF A;  4I2Q A;  1HYS A;  1C0T A;  2D0C A;  1NK8 A;  4QOZ B;  4FLW A;  3LP3 A;  3TI0 A;  1WN7 A;  4KPY A;  3K5M A;  1TL1 A;  3S3O A;  1ZBU A;  1EP4 A;  2FBV A;  3K59 A;  4OLA A;  4I7F A;  4FCY A;  1RT1 A;  1A5W A;  4PY5 A;  3ZSV A;  3HVT A;  4CHZ A;  4ELT A;  3VQE A;  1RBU A;  4LD0 A;  3HL8 A;  3VN5 A;  4CHY A;  3OS0 A;  4BDY A;  4KB1 A;  3SUQ A;  3NF7 A;  1LW0 A;  4CJU A;  3BDP A;  4B9V A;  3LAL A;  1RT6 A;  4DQP A;  4J2B A;  4FJ7 A;  3OYD A;  4Y1C A;  1JLB A;  5T7B A;  4M45 A;  4CGF A;  1S9E A;  2XO7 A;  4F2R A;  3V1O A;  1GOA A;  2XY6 A;  2VG7 A;  1QSY A;  4E7L A;  2GUI A;  1U48 A;  1TK0 A;  3QEW A;  2Q3S A;  1LAW A;  1KTQ A;  3TAP A;  1YTU A;  3K2P A;  1TK8 A;  3K5O A;  4CFA A;  3NH1 A;  1BQM A;  1RTD A;  2O4I A;  1IO2 A;  4DTU A;  3ZSO A;  1YVU A;  2OPP A;  1VRU A;  4DFM A;  2OA8 A;  4NCA A;  1ASU A;  1SL1 A;  3NHG A;  3G10 A;  4ZTJ A;  4CJ4 A;  1Q9Y A;  1N6Q A;  4N76 A;  1TAU A;  4CF1 A;  4DTX A;  3OYI A;  4PUO A;  4FZZ A;  4KI6 A;  1HQE A;  1BI4 A;  1RTI A;  3AA5 X;  4KI4 A;  4CJQ A;  5EU7 A;  4DG1 A;  1RTH A;  4IBN A;  4C8M A;  3V9X A;  1FKP A;  4KB0 A;  3AO4 A;  4Z0U A;  3KIO A;  3V9W A;  3RMC A;  3F9K A;  3LAM A;  4FJ8 A;  2E6L A;  1RT7 A;  3C94 A;  4CJS A;  4CJK A;  4CK3 A;  4F2S A;  1VSL A;  2HHS A;  1BQN A;  2G8V A;  1NJY A;  2IC3 A;  3AVG A;  3KK1 A;  1HYZ A;  5HLF A;  3V9S A;  4DQS A;  1KLM A;  3IRX A;  3MEG A;  4DSK A;  4DWI A;  4FM2 A;  2YNG A;  4CJR A;  4FJH A;  3M8R A;  1BGX T;  4FK2 A;  4FJI A;  1BIS A;  1BIU A;  1TAQ A;  1I3A A;  3HPO A;  2IAJ A;  2ATQ A;  1RNH A;  3HST B;  3ZSQ A;  4CK1 A;  3OS2 A;  3AO5 A;  1X9W A;  2VG6 A;  5HRS A;  3P83 D;  4CEQ A;  2QXF A;  4I9L A;  4GVM A;  4AHT A;  3AVK A;  1RT2 A;  5CZ2 A;  4W5O A;  3QES A;  4NCB A;  4IDK A;  3K57 A;  4C8L A;  3B6P A;  3DMJ A;  2X74 A;  1IG9 A;  3U3Y A;  3AO3 A;  4KHS A;  4FK4 A;  2HHQ A;  2HNY A;  3ASM A;  3NF6 A;  3HXM A;  2R7Y A;  2QK9 A;  1LWC A;  4W5T A;  1S9G A;  2GV9 A;  3AVA A;  1S1X A;  3DRR A;  3C6T A;  4N5S A;  3O3G A;  4FK0 A;  4HHT A;  4CEZ A;  1RBV A;  2ETJ A;  1RBT A;  2ITG A;  4CHQ A;  3DLR A;  3NF8 A;  2X6N A;  3LPT A;  1LWF A;  3VA3 A;  2PYJ A;  2BGG A;  1JLA A;  3L2R A;  1KSP A;  3HPG A;  4Z4I A;  3QET A;  1C1C A;  1QTM A;  1SKS A;  4DMN A;  1JXB A;  4CGI A;  1D5A A;  3AVI A;  4LSL A;  3ZT1 A;  4Z4G A;  1S1W A;  4JS5 A;  1C1A A;  4OGC A;  1L3U A;  4NYN A;  3S3M A;  1WAF A;  2OZM A;  2HB5 A;  3QO9 A;  4DQI A;  3KD1 E;  3KK2 A;  3M8S A;  4MFB A;  4B9U A;  1TKZ A;  4H4O A;  2X78 A;  3OYK A;  5I42 A;  4M3Z A;  1SUQ A;  3HP9 A;  4CJL A;  1CZ9 A;  3L2W A;  3QEI A;  1NJW A;  4N41 A;  1JL1 A;  3SPY A;  4CIE A;  2OZS A;  3MAQ A;  4H8K A;  4PA1 A;  1JLC A;  4CGJ A;  4CJ3 A;  5C25 A;  4G1Q A;  3V4I A;  1ZYQ A;  1GOC A;  3VQ6 A;  3DLG A;  4DSL A;  1QHT A;  4RW7 A;  1HJR A;  3SJJ A;  3IAY A;  3SUO A;  3NAE A;  3OJS A;  4BAC A;  3QLH A;  1S6P A;  1CXU A;  1KVB A;  3DLB A;  1S1U A;  1WSE A;  5C24 A;  4I9Q A;  3B6O A;  4KTQ A;  3CM5 A;  4FLX A;  1IKY A;  5CZ1 A;  4FJ5 A;  4KFB A;  4CF2 A;  3PUF A;  4FLY A;  1NOZ A;  1FKO A;  3ZT2 A;  1HYV A;  3BGR A;  3NDK A;  4DU3 A;  4KAZ A;  4ID1 A;  3CM6 A;  4O4G A;  4XIU A;  5CYM A;  3O3F A;  4JS4 A;  4DSE A;  5HP1 A;  4C8K A;  3DLK A;  3G0Z A;  1TKT A;  4CFC A;  1X9M A;  2IOC A;  1EX4 A;  3RMD A;  3LP1 A;  3OYE A;  1KVA A;  1TVR A;  3HPH A;  4L8R B;  1RIL A;  4WE1 A;  4FZY A;  4W5Q A;  5FRN A;  5HRP A;  2FBY A;  3JSM A;  1LV5 A;  1HNI A;  2RF2 A;  4M3X A;  4OKJ A;  3FFI A;  1WNS A;  3AO1 A;  3OYM A;  3K58 A;  3TAQ A;  1J53 A;  3VQ5 A;  1U47 A;  3HVR A;  3LAN A;  2OPR A;  2G8U A;  3PO4 A;  1UOC A;  3MEE A;  3AVN A;  4DLE A;  1EET A;  1VSJ A;  4AHS A;  3U6F A;  4LSN A;  1X9S A;  4CEB A;  3ISN C;  3SQ2 A;  4C8O A;  1RBR A;  2HHX A;  3NE6 A;  3OYL A;  3LWL A;  3I0S A;  4EZ9 A;  1RT3 A;  3VQB A;  3I0R A;  1ASW A;  4CGD A;  3EY1 A;  1F21 A;  2ZQB A;  4CHN A;  2PYL A;  2F96 A;  3KLH A;  1W0H A;  3WNH A;  1WSI A;  2DFF A;  3QIN A;  4BE0 A;  3SV4 A;  3RR7 A;  1TV6 A;  1TK5 A;  3PX0 A;  3SQ4 A;  4QCL A;  2FC0 A;  1NOY A;  2IGI A;  2G8H A;  2G8I A;  4O44 A;  2Z1J A;  1UWB A;  1VRT A;  2DY4 A;  4E7I A;  4DLG A;  4ICL A;  1X1P A;  3V1R A;  2JLE A;  3KJV A;  1KVC A;  1XWL A;  5K14 A;  4HCC A;  1JLG A;  1CXQ A;  5I3U A;  2NUB A;  3OY9 A;  4B9T A;  4B9M A;  3OYA A;  2HHV A;  4NYF A;  3T19 A;  1WSH A;  4PWD A;  3V9Z A;  2HHU A;  3D0P A;  2QKK A;  3L2V A;  4FLZ A;  1A5V A;  3QEP A;  1L5U A;  1J54 A;  3V1Q A;  4DU1 A;  3HP6 A;  3L3U A;  1C0M A;  3ITH A;  4DQQ A;  4OPK A;  3AVF A;  5SWM A;  4MQ3 A;  3KLG A;  4PQU A;  1HQU A;  2WOM A;  1KRP A;  1SV5 A;  1U04 A;  4AHU A;  3T3F A;  4B8C A;  3SUP A;  3NH0 A;  3OYC A;  3NBP A;  4BDP A;  1HNV A;  4FM0 A;  4O0I A;  2P1J A;  3C6U A;  2KFN A;  4CIF A;  3CFP A;  3RMB A;  4FW2 A;  4F3O A;  2EHG A;  3CFO A;  1NK5 A;  3NGZ A;  4RW6 A;  5FRO A;  2KTQ A;  3TAG A;  1FK9 A;  4M41 A;  4B3O A;  4RW8 A;  3O4Q A;  1NKE A;  4B08 A;  2HW3 A;  3D45 A;  4OVL A;  3TR8 A;  1JLE A;  3MXJ A;  1WSF A;  4E1M A;  3WNG A;  3NF9 A;  1U45 A;  5HRN A;  2HNZ A;  1RCH A;  3KKR A;  4DTS A;  1KFS A;  3AA3 A;  1S1T A;  2IDO A;  4YNQ A;  3ZSX A;  4IG3 A;  3L2U A;  3TAB A;  1T05 A;  3RR8 A;  1BHL A;  4HTU A;  4E7K A;  2D0B A;  1D9D A;  4H4M A;  1EXQ A;  1KFD A;  4W5R A;  3TAM A;  2Y1I A;  5E41 A;  1XHZ A;  4LH4 A;  1NJZ A;  1A5X A;  1Q9X A;  4EZ6 A;  4ZTF A;  3PY8 A;  3HO1 A;  4Z4H A;  4FLV A;  3E01 A;  3RTV A;  4DTP A;  4CED A;  2P5O A;  4AH9 A;  2GBZ A;  3DRP A;  5KTQ A;  1ZBL A;  1D8Y A;  4B9L A;  3SI6 A;  2KFZ A;  3CYM A;  4FVM A;  3O4N A;  4FJG A;  3RRG A;  3LZI A;  2RPI A;  1NKB A;  3AVC A;  1JKH A;  5HRO A;  3TAE A;  4E1N A;  2PY5 A;  1RDD A;  3WNF A;  1QE1 A;  2P5G A;  4M3R A;  1S6Q A;  3SPZ A;  4FJ9 A;  3AVL A;  3DYA A;  5JS1 A;  1VSH A;  4FLU A;  4DSF A;  4Y1D A;  2P51 A;  4JLH A;  2EX3 A;  1UA0 A;  4FLT A;  4N56 A;  2XHB A;  1UA1 A;  1DTQ A;  2AJQ A;  1HRH A;  1EKE A;  3ZSZ A;  2VG5 A;  1KLN A;  2Z1H A;  2Y1J A;  4E89 A;  2ZD1 A;  4CFB A;  1D9F A;  4ID5 A;  3ZT0 A;  3PO5 A;  2VWJ A;  3PX6 A;  4CJ5 A;  4BWM A;  1BIZ A;  2G8K A;  4ELV A;  1QS4 A;  4DU4 A;  1VSK A;  3LP2 A;  4QAG A;  4DTJ A;  4DSJ A;  4CGG A;  1N5Y A;  1QSS A;  5DK5 A;  3LPU A;  1WSJ A;  4HUE A;  3C95 A;  3ZSW A;  3TAN A;  3QNO A;  3CG7 A;  3HYF A;  1ITG A;  1C0U A;  4J2E A;  5JS2 A;  4HVJ A;  1HMV A;  2HND A;  5J2M A;  4CEE A;  2O4G A;  3EZ5 A;  4CHO A;  3AA4 A;  4FJM A;  3SV3 A;  4RG8 A;  3H08 A;  4DTO A;  3QEX A;  3QER A;  3TAR A;  2FBT A;  4RW9 A;  4CJV A;  4E7H A;  3MXM A;  1SL0 A;  1NJX A;  2YKM A;  2RKI A;  4CJP A;  3V81 A;  1SL2 A;  1IKV A;  1BL3 A;  3KLE A;  3OYB A;  1O1W A;  1TGO A;  3LWM A;  3IG1 A;  2I5J A;  2PZS A;  1ZBF A;  3QNN A;  2KQ2 A;  3AO2 A;  3M8Q A;  3RRH A;  3MXI A;  1L3V A;  4W5N A;  1R0A A;  1BI4 B;  2F8T A;  4IKF A;  2X6S A;  1VSI A;  4RW4 A;  4M3T A;  1KCF A;  1S5J A;  1WLJ A;  3ZSR A;  4Q5V A;  2HVI A;  2OYQ A;  4IFY A;  5J1E A;  3VA0 A;  3OYG A;  2G8W A;  3CFR A;  3SQ1 A;  2OPS A;  1LW2 A;  2BE2 A;  3OYH A;  2B5J A;  1Z26 A;  1JLQ A;  4NCG A;  4KRE A;  4GMJ B;  1B9F A;  4CJW A;  3OS1 A;  3PX4 A;  3S3N A;  1NK7 A;  4CCH A;  5C42 A;  4KHQ A;  4M3Y A;  4IFV A;  5HBM A;  4KKO A; 
#chains in the Genus database with same CATH topology
 4FJJ A;  1UAX A;  4OKE A;  2P9P A;  1N34 K;  3L2Q A;  4BGA A;  3O1W A;  1JCE A;  3V6D A;  2OCE A;  4KHY A;  3K9K A;  4JI1 K;  4TSX A;  4K42 A;  3VTH A;  1TKD A;  1LWE A;  5AQS A;  1NGF A;  3E9O A;  5J2N A;  2FSJ A;  1O13 A;  4O0J A;  1NK6 A;  1ZC6 A;  1XC9 A;  4JK8 A;  3IDH A;  1JLF A;  3MX5 A;  1ATR A;  3ZET B;  3BEX A;  2BUP A;  2FXU A;  3DRS A;  2YHX A;  4JRQ A;  4DTR A;  1KAX A;  2E1Y A;  3HM9 A;  1J9A A;  1NKC A;  3DLE A;  5KI6 A;  4CIG A;  1NJI O;  2W41 A;  1WSG A;  2VWK A;  2E6M A;  3C6H A;  2D0P A;  4F8R A;  1G15 A;  3VES A;  3VEV A;  2VWB A;  3JYT A;  2XY7 A;  3NMU A;  1I39 A;  3L3V A;  1YJ9 N;  3OBW A;  1SKW A;  1TL3 A;  3ID8 A;  3K9J A;  1X3N A;  4DF8 A;  3L8B A;  4YY3 K;  4BRO A;  4EP5 A;  1WBD A;  2KLA A;  1WB9 A;  4FXD A;  2YNI A;  2E2N A;  2YNH A;  4XH4 A;  3VQ7 A;  1GLE G;  4H5R A;  3VQD A;  4HUF A;  1JL2 A;  1REV A;  4JRP A;  1C6V A;  4CES A;  1YJW N;  5F1X A;  2OPQ A;  5AQU A;  3T1A A;  4AIL C;  5KRS A;  4K41 A;  3KLF A;  4DSJ A;  3GOI A;  3LZJ A;  1XC3 A;  4GNI A;  4HCB A;  4FOI A;  5KRT A;  1Q82 O;  5AQW A;  4YOU A;  5DMR A;  1VSD A;  4E19 A;  1J5O A;  2YV0 X;  2YKN A;  3CCS N;  1C0F A;  5JVG L;  3OJU A;  5HRR A;  3DLH A;  3F73 A;  4IEI A;  4YOY A;  2Z1I A;  3CC2 N;  2HBM A;  4AHR A;  1IKW A;  1YTA A;  2NRW A;  4CFD A;  3F9M A;  5LMU K;  3ZCM A;  1RTJ A;  3WNE A;  3I8D A;  3FE1 A;  2HHW A;  2RN2 A;  4OKK A;  4CZE A;  1DT9 A;  1BA1 A;  4C1N K;  4CF9 A;  3P38 A;  1K6Y A;  4Z94 A;  4LY7 A;  3VQC A;  4BE2 A;  4U67 L;  4E0D A;  3CJC A;  3TU5 A;  3Q7B A;  1JXE A;  2YX6 A;  1WBB A;  3SLC A;  3KKS A;  3QDK A;  2P9I A;  1S22 A;  4G9Z A;  1NK8 A;  4MDB A;  3CCR N;  3B8A X;  1IG8 A;  1GLL O;  3ULE B;  2FLO A;  3KWG A;  3VN5 A;  2KZM A;  3BDP A;  4JKH A;  4JN4 A;  3LAL A;  1RT6 A;  1GLB G;  4BRK A;  2NRX A;  4IWV A;  3V1O A;  4FL9 A;  1N8R O;  4OX9 K;  1U48 A;  3A5M C;  3W3D A;  5CHI A;  4JI0 K;  1KTQ A;  4EHT A;  1YHQ N;  3O6W A;  1HKG A;  5AQQ A;  4NCA A;  4LF6 K;  4CD3 A;  4DV3 K;  4NXM K;  4N76 A;  3G10 A;  4ZTJ A;  4O5F A;  1BWF O;  4CJ4 A;  1Q9Y A;  4DTX A;  2F9T A;  3OYI A;  4FZZ A;  5C0Y A;  1RTI A;  2WUS A;  4LF9 K;  4DG1 A;  3V9X A;  1NBW A;  4KB0 A;  5GAH P;  2ZGY A;  5CE3 A;  3C94 A;  4CJS A;  2VQE K;  4E1J A;  5FPE A;  3AVG A;  3KK1 A;  2HBJ A;  5AQI A;  2YNG A;  4CJR A;  2UYT A;  1ATS A;  1TAQ A;  1XNQ K;  1I3A A;  3HPO A;  3OS2 A;  4CK1 A;  4BRA A;  2VG6 A;  3SAH A;  5HRS A;  3L4Q A;  4W5O A;  4GVM A;  1RT2 A;  3CPW M;  4NCB A;  3AY9 A;  5MLC Q;  3B6P A;  3NF6 A;  1JCF A;  3FZL A;  3AVA A;  4N5S A;  2QWO A;  4FK0 A;  4JKB A;  4CEZ A;  2ASM A;  3BF3 A;  2ETJ A;  3J81 O;  1RBT A;  5M1O A;  3NF8 A;  2X6N A;  3LPT A;  3EKU A;  3VA3 A;  3AGR A;  1QQM A;  5AZJ B;  4GV6 A;  1QTM A;  1SKS A;  1OVY A;  4JKD A;  1K8K A;  4B1Z A;  4OGC A;  1ATN A;  1WAF A;  2OZM A;  1LCU A;  3KD1 E;  4DV6 K;  4GV9 A;  3R9P A;  3D2F A;  4H0X B;  3CCJ N;  4H4O A;  4B9U A;  3OYK A;  2E88 A;  1SUQ A;  3QEI A;  2FF6 A;  3MAQ A;  3V4I A;  4CJ3 A;  5BRF A;  2UXD K;  1ZYQ A;  3DLG A;  1QHT A;  4FWP A;  3SUO A;  3NAE A;  1MWK A;  3QLH A;  2UU9 K;  1VQ4 N;  4I9Q A;  4KTQ A;  4FLX A;  4RWT A;  2QA4 N;  4DV2 K;  3LM9 A;  4H0Y B;  3NDK A;  3CM6 A;  3O3F A;  1EX4 A;  1P8Z A;  2ZJR L;  4FZY A;  1TYQ A;  4A2B A;  3IMX A;  4OKJ A;  3FFI A;  1WNS A;  3TAQ A;  3JAM O;  3K58 A;  2G8H A;  1J53 A;  3PO4 A;  3LAN A;  1EO1 A;  1UOC A;  3MEE A;  2E2P A;  3U4L A;  1NGI A;  1S72 N;  3IFR A;  3BZC A;  3DXM A;  1RBR A;  4QS7 A;  2ZJP L;  2HHX A;  3FZF A;  4EZ9 A;  3I0S A;  4LF8 K;  4A5A A;  3I0R A;  1ASW A;  3CJ1 A;  3A5O C;  2F96 A;  5FRM A;  3WNH A;  1WSI A;  4BE0 A;  1TV6 A;  4GKJ K;  3PX0 A;  3CET A;  1NOY A;  4BRC A;  3FZH A;  4DV1 K;  3NVK A;  3OHR A;  1YAG A;  1XWL A;  4BRI A;  4JI5 K;  2GWJ A;  2CGK A;  3OY9 A;  4B9T A;  4BR7 A;  3SMP A;  5ELZ A;  5DM7 L;  1BO5 O;  4FLZ A;  1A5V A;  4B1Y B;  1S3X A;  4BRE A;  3L3U A;  1C0M A;  3ITH A;  4DQQ A;  4YHH K;  3KLG A;  1KXP A;  1SV5 A;  3H45 C;  3NBP A;  3EEQ A;  3WEE B;  5GAD P;  4JI3 K;  3A5N C;  4CIF A;  4XH1 A;  4DR2 K;  2KTQ A;  3TAG A;  1FK9 A;  3IUC A;  4M41 A;  1YJN N;  3O4Q A;  2IIR A;  4E1M A;  2ZJQ L;  1U45 A;  3LDO A;  3C65 A;  2IDO A;  4YNQ A;  3KHY A;  1T05 A;  2NZT A;  1BHL A;  1KAY A;  4BVO A;  1Q9X A;  3PY8 A;  3RTV A;  3EZW A;  3DRP A;  1ZBL A;  2KFZ A;  3GE1 A;  4X64 K;  5BR8 K;  4FJG A;  2CH6 A;  1JKH A;  4E1N A;  1RDD A;  3SPZ A;  3DYA A;  1R59 O;  1UA0 A;  3SMS A;  2AJQ A;  4YDU A;  3VER A;  4E89 A;  1W2B M;  1N33 K;  4BRL A;  3R6M A;  1EWR A;  1BU6 O;  4ELV A;  3CD6 N;  4QAG A;  1E3M A;  1QSS A;  4DR6 K;  3C95 A;  2P9N A;  3ZSW A;  1OH7 A;  4YOR A;  4JHD A;  1C0U A;  3GDQ A;  4CEE A;  3HBT A;  5AZI A;  3SV3 A;  4KHP K;  3H08 A;  2VQF K;  4JD2 A;  4YOT A;  4LF4 K;  2RKI A;  3HSC A;  2ASP A;  3HRG A;  2PZS A;  4BG9 A;  4DQ8 A;  1BI4 B;  2F8T A;  2X6S A;  1I94 K;  2FF3 B;  2W40 A;  5C2F A;  4QS9 A;  3QIC A;  3UKR A;  2OYQ A;  3PLA A;  1IBK K;  3SQ1 A;  1LW2 A;  3OYH A;  2B5J A;  1JLQ A;  4OPA A;  4KRE A;  4WFA L;  1IBL K;  3CFP A;  2V51 B;  2P9K B;  3HOS A;  1VQK N;  3L0Q A;  3KD5 E;  2KZZ A;  4BRH A;  3QIP A;  4CBW A;  1QSL A;  1TKX A;  3C7N A;  2YJE A;  4FJX A;  4BR5 A;  4Z4E A;  2A6A A;  4BRF A;  3S9H A;  4FO0 A;  2AA4 A;  1P90 A;  3PV8 A;  3VQQ A;  3UIQ A;  5D3G A;  1XMQ K;  1RT4 A;  1B9D A;  4B3M K;  4BR9 A;  2QKB A;  4FYD A;  4CHP A;  4WCE L;  3DOK A;  4CZI A;  1YT3 A;  3SQ0 A;  3NCI A;  4BDZ A;  2O8F A;  4CF8 A;  3SCX A;  2Q36 A;  2XRI A;  1BCM A;  1VK0 A;  1NM1 A;  2OAN A;  4DTM A;  4M7X A;  3KTQ A;  2D0A A;  3VEO A;  1IV0 A;  1SS6 A;  4CEO A;  4K43 A;  3O9S A;  2ZE2 A;  3QBW A;  3CME N;  3E9L A;  4ELU A;  2P9S A;  3NGY A;  1RDC A;  5C10 A;  1ZBH A;  3ZX0 A;  4CF0 A;  1NGB A;  4FW1 A;  1NK9 A;  3AVM A;  3TTF A;  5FDL A;  5KGX A;  3CF5 L;  5KQ8 A;  3T1H K;  1NMD A;  3WQU A;  3LDP A;  2D5R A;  3NVM A;  3VPZ A;  3DOL A;  1KC8 O;  5JLH A;  4GW6 A;  1T7P A;  3ZT3 A;  3VGK A;  4HUG A;  3MEC A;  3MK6 A;  3AV9 A;  1YI2 N;  3E9P A;  4O8U A;  1Y97 A;  2ZGZ A;  3KLI A;  4NLB A;  1Y64 A;  4DKW A;  3M8P A;  3OVN A;  4KO0 A;  3HT3 A;  4KTW A;  1ASV A;  1H1V A;  4FJN A;  1QZ6 A;  4IFE A;  3AA2 A;  4N47 A;  4BE1 A;  5A2Q O;  4IXC A;  1Z25 A;  4I2P A;  4M42 A;  3MED A;  2YHB A;  2FBX A;  3TWH A;  3THY A;  3EE8 A;  1BG3 A;  2LSN A;  3OYJ A;  1T6C A;  3WXL A;  1ZBI A;  4B3R K;  3BF1 A;  2NRR A;  4Z4C A;  1LAV A;  3D2E B;  1NMN A;  4BWJ A;  4J2A A;  5LJW A;  3ZX2 A;  4OGE A;  4HTL A;  3CC4 N;  4CJE A;  3FZK A;  1EQY A;  3CQ8 A;  1IH7 A;  4DS5 A;  1Q8I A;  1U2V A;  4EHU A;  2O8E A;  1C0T A;  4FLW A;  1EWQ A;  4I6M A;  4FWL A;  3MCP A;  4CZF A;  3TI0 A;  1X9J A;  1ZBU A;  2FBV A;  3QML A;  4I7F A;  4FCY A;  4MO4 A;  3ZSV A;  4ELT A;  3SJH A;  1RBU A;  4LD0 A;  4CHY A;  3OS0 A;  4M3Z A;  4KB1 A;  1LW0 A;  3QBX A;  4A2A A;  3OYD A;  4X65 K;  3LM2 A;  5T7B A;  4CGF A;  5JIC A;  4E7L A;  4M63 C;  3VET A;  1Q18 A;  4AM7 A;  3K5O A;  4CFA A;  1RTD A;  3HZ6 A;  4DTU A;  4H0P A;  3ZSO A;  3T1Y K;  3NHG A;  1N6Q A;  4CF1 A;  1VQL N;  4PUO A;  4FSV A;  4KI6 A;  1HQE A;  2QI2 A;  3AA5 X;  1HLU A;  1XQS C;  4C8M A;  4IBN A;  5BRE A;  3AO4 A;  5F0X A;  3RMC A;  2KKZ A;  1Q7Y O;  4FJ8 A;  4F2S A;  4CJK A;  2Q0U A;  5M1N A;  1VSL A;  1BQN A;  2IC3 A;  4DR3 K;  3R3L A;  1HYZ A;  5HLF A;  3SBG A;  4JK7 A;  4DQS A;  1HKB A;  3IRX A;  1RFQ A;  3O80 A;  3VEN A;  3ENB A;  1BIS A;  4CZK A;  2IAJ A;  3HST B;  1RNH A;  1X9W A;  2IVN A;  3P83 D;  1J6Z A;  4FWO A;  4AHT A;  5CZ2 A;  3A8Y A;  3K57 A;  3WXM B;  2X74 A;  1IG9 A;  3U3Y A;  2WBN A;  2HHQ A;  2HNY A;  4WYB A;  3VGL A;  4WQ5 C;  4W5T A;  5I9E B;  1S9G A;  2GV9 A;  4K25 A;  4KH6 A;  5HL7 L;  1S1X A;  4EAH D;  1RBV A;  2ITG A;  1OH6 A;  2O8D B;  2BGG A;  1NGG A;  1JLA A;  1MDU B;  3HPG A;  4Z4I A;  2BTF A;  4BC2 A;  1VQM N;  4DMN A;  4A62 A;  4LSL A;  1C1A A;  2FSN A;  3UE5 A;  4NYN A;  2A40 A;  2HB5 A;  3FLC O;  2ITM A;  3G6E N;  2X78 A;  3L2W A;  2HF3 A;  5AQT A;  3VEX A;  5ADX A;  4N41 A;  3SPY A;  2OZS A;  1JLC A;  1GOC A;  4RW7 A;  3JXU A;  2P9U B;  3CCU N;  5JMV A;  1HPM A;  2QWN A;  1S6P A;  2NRH A;  3U8X A;  1S1U A;  1XUP O;  4H0V B;  4JKE A;  3CM5 A;  1IKY A;  5H1S Q;  4JKA A;  3PUF A;  4FLY A;  1FKO A;  3ZT2 A;  4KAZ A;  3M3Z A;  4XIU A;  5HP1 A;  4JS4 A;  4C8K A;  2I7N A;  4L8R B;  4Y0W A;  4DUY K;  4IOA L;  2V7Z A;  1RIL A;  4WE1 A;  3TSQ A;  1GLA G;  5HRP A;  2FBY A;  1LV5 A;  1HNI A;  2RF2 A;  4M3X A;  1W7A A;  3AO1 A;  1U47 A;  3VQ5 A;  2OPR A;  3AVN A;  1NGC A;  4BG8 A;  3CPE A;  3NE6 A;  2Q2R A;  3OYL A;  3LWL A;  1RT3 A;  3VQB A;  5AFU H;  2PYL A;  5AQK A;  1W0H A;  1BUP A;  3EKS A;  2UUC K;  2G8I A;  4O44 A;  4JK9 A;  3D6R A;  3QFU A;  4JKC A;  4CVN E;  4DLG A;  4GY2 B;  4A57 A;  4DV7 K;  2ASO A;  2HST A;  1LOT B;  4HCC A;  1CXQ A;  5DM6 L;  1FJG K;  4IO8 A;  3C6A A;  2YI1 A;  3D0P A;  2QKK A;  3THW A;  4AF1 A;  1RDU A;  3ULE A;  2GEL A;  3CHW A;  1VAZ A;  1HQU A;  1KRP A;  1U04 A;  1ZBS A;  3VMF B;  4B8C A;  3I55 N;  4BDP A;  4FM0 A;  3LDQ A;  2P1J A;  3C6U A;  4F3O A;  3NGZ A;  4RW6 A;  5FRO A;  1K8K B;  4B3O A;  5BPL A;  4H03 B;  4B08 A;  3TR8 A;  1JLE A;  1QHA A;  2W6L A;  5HRN A;  2HNZ A;  3D2F B;  3TTC A;  3CCL N;  3ZSX A;  4IG3 A;  3RR8 A;  4H4M A;  1EXQ A;  4JAX A;  1KFD A;  2Y1I A;  3TAM A;  4EZ6 A;  1A5X A;  3SBT A;  5HOO A;  4C1N I;  4BY9 C;  3CJ9 A;  5EVZ A;  5TKY A;  5KTQ A;  2QWQ A;  3CYM A;  3AVC A;  3WNF A;  1VQO N;  1QE1 A;  2P5G A;  2QTD A;  5JS1 A;  3AVL A;  4JKF A;  4FLU A;  4DSF A;  2H3G X;  4Y1D A;  3A5L C;  2XHB A;  1HRH A;  2Z1H A;  2ZM6 K;  2Y1J A;  4UY8 O;  1SQK A;  4ID5 A;  4CJ5 A;  1VQN N;  2G8K A;  3N4Q A;  1QS4 A;  4DU4 A;  1VSK A;  4CZG A;  4CGG A;  2W6K A;  5DK5 A;  3MWT A;  4JKG B;  3QNO A;  3CG7 A;  3L4I A;  1SZ2 A;  1ITG A;  3MMV A;  3DXK B;  4A5B A;  2HND A;  5J2M A;  1E4G T;  2O4G A;  4NB4 A;  4R79 A;  5BPN A;  4RG8 A;  3TAR A;  4CJV A;  4E7H A;  1SL0 A;  1NJX A;  1GLJ O;  4CJP A;  3V81 A;  3KLE A;  3T69 A;  3IG1 A;  2I5J A;  1ZBF A;  4HWI A;  3U9Z A;  3RRH A;  3VF4 A;  1R0A A;  4MLE A;  4IKF A;  1VSI A;  4M3T A;  1KCF A;  4JYA K;  4LFC K;  3WT0 A;  4BQL A;  4Q5V A;  5J1E A;  3OYG A;  1YF5 L;  3CFR A;  5AQH A;  2BE2 A;  3MCA B;  1Z26 A;  2WTU A;  4GMJ B;  3PX4 A;  3S3N A;  1NK7 A;  5C42 A;  5AQX A;  4IFV A;  1QVF M;  4IEE A;  4CER A;  1OKJ A;  1L3T A;  4Q0B A;  1U4B A;  1T8E A;  3RMA A;  2P9L A;  4KRF A;  3HM8 A;  1YIJ N;  1IKX A;  4BRP A;  4B8A B;  4DF4 A;  4B9N A;  4CBU A;  3ZSY A;  3VQP A;  1CLQ A;  3ALY A;  3M1F A;  3SAG A;  1OH5 A;  4JV5 K;  2F4V K;  1X3M A;  4YDU C;  4XEI A;  4DFP A;  3A2F A;  3CXC M;  4AHC A;  2D0O A;  3TAF A;  4IG0 A;  5KGW A;  5GIO A;  3P4I A;  3G4S N;  4K8Z A;  5BRD A;  4OPH A;  3J80 O;  4H5N A;  1BA0 A;  4FWM A;  4CGH A;  5CYQ A;  5J2Q A;  4DQR A;  3VQ4 A;  1YVN A;  4C8N A;  3SUN A;  1NWK A;  4BC3 A;  2F8S A;  4CW7 B;  3AVJ A;  2JWK A;  3QIO A;  1ILY A;  1FXX A;  3GG4 A;  4CEA A;  3O3H A;  5IT9 O;  1VSE A;  4M3W A;  4JNE A;  3CC7 N;  3LP0 A;  4Z4F A;  4RTF D;  4YFU A;  4LF5 K;  1C1B A;  3EYZ A;  1L3S A;  3MWP A;  2CH5 A;  5FPM A;  4DFJ A;  4KV8 A;  2E4L A;  4LFA K;  3RWU A;  2P9N B;  1HPZ A;  2A1S A;  2VGM A;  1K9M O;  4DSI A;  1U6Z A;  4JHD B;  1BCO A;  2AP1 A;  1U49 A;  4AHV A;  3E1Y A;  3U9D A;  3DM2 A;  3VQ9 A;  4C23 A;  3NGI A;  4CJF A;  1CZB A;  4H5V A;  1RGI A;  3FR0 A;  2XY5 A;  1NK0 A;  5EX5 A;  1TUY A;  4JEP A;  3ULD A;  1QVG M;  3UKU B;  3NFA A;  3SZ2 A;  3SK3 A;  4DR5 K;  3H6E A;  1XMO K;  1DTT A;  2DTU A;  1BDG A;  4FWR A;  2Q31 A;  4FJL A;  4BR4 A;  2E20 A;  3VQ8 A;  1RBS A;  1NK4 A;  1HNZ K;  1SKR A;  2BDP A;  3UKR B;  3O9R A;  4ILG B;  3LDS A;  3OYN A;  4DTN A;  1GOB A;  3ENO A;  4IOX A;  3THX B;  2YHW A;  4M3U A;  4FWS A;  4B9S A;  4BGB A;  1VSM A;  3K0S A;  2BAN A;  4L3Q A;  2B4J A;  3BY5 A;  2NRV A;  4RCH A;  2HVH A;  3V9U A;  2KW4 A;  3I56 N;  2A41 A;  1RDA A;  2YHA A;  2UUA K;  3CI5 A;  4DFK A;  2KHO A;  5AQF A;  1HNX K;  1VQ8 N;  3LP3 A;  3DWL A;  5AR0 A;  3S3O A;  1EP4 A;  4OLA A;  1RT1 A;  1A5W A;  3HVT A;  5LL6 Z;  5GIN A;  5C15 A;  4KHU A;  3HL8 A;  3HJF A;  4DQP A;  2YHY A;  4CJU A;  4B9V A;  4FJ7 A;  2O8F B;  3VGM A;  1GLC G;  2XO7 A;  1GOA A;  4WQ4 C;  1QSY A;  2GUI A;  4FVU A;  1TK0 A;  3QEW A;  3TPQ A;  1LAW A;  3EO3 A;  3TAP A;  3MN9 A;  3K2P A;  1TK8 A;  2HHH K;  2O4I A;  1YVU A;  2CGL A;  2OPP A;  4DFM A;  1KAZ A;  1NNE A;  1TAU A;  3CCV N;  3A0I X;  1BI4 A;  1WOQ A;  4CZH A;  2QWL A;  3KIO A;  3LAM A;  5EXW A;  3BP8 A;  2G8V A;  1NJY A;  2JWL A;  1KLM A;  3O9T A;  4DWI A;  5JLF A;  3ZSQ A;  3VEZ A;  2OTL N;  2QXF A;  3AVK A;  4DCH A;  3ZX3 A;  4C8L A;  1T3V A;  3AO3 A;  4FK4 A;  3O1B A;  3HXM A;  2R7Y A;  2QK9 A;  1LWC A;  3MN7 A;  3DRR A;  3C6T A;  2O8B A;  2VGN A;  1KQS M;  3DLR A;  5LJV A;  2PYJ A;  1KSP A;  1C1C A;  4FPB A;  1ZXO A;  1JXB A;  1D5A A;  3AVI A;  4NLC A;  3ZEU B;  3S41 A;  3ZT1 A;  1S1W A;  4JS5 A;  5AQG A;  3QO9 A;  3KK2 A;  1VQ5 N;  4MFB A;  1TKZ A;  3RSE B;  2NLX A;  5LMN K;  5I42 A;  3DLL L;  3HP9 A;  1VQ7 N;  1JL1 A;  4CIE A;  4CZJ A;  4BR0 A;  4H8K A;  4PA1 A;  4CGJ A;  5C25 A;  4G1Q A;  3SJJ A;  4EIA A;  1KVB A;  2OTJ N;  1WSE A;  4YOV A;  2P9P B;  5C24 A;  2QW9 A;  3B6O A;  4KFB A;  4IJN A;  1NOZ A;  1IJJ A;  5FPN A;  3CMA N;  3BGR A;  3WQT A;  1E4F T;  5CYM A;  4DSE A;  3DLK A;  3G0Z A;  1TKT A;  4CFC A;  4H0T B;  2IOC A;  4B1V A;  3OYE A;  1KVA A;  3JSM A;  5GAG P;  3EE9 A;  3OYM A;  3UB5 A;  3HVR A;  1VQ9 N;  2HBL A;  4X66 K;  1EET A;  4KBO A;  1VSJ A;  3H1V X;  4AHS A;  1X9S A;  4CEB A;  3SQ2 A;  2O8C A;  2UXC K;  3OA9 A;  4CGD A;  3EY1 A;  1F21 A;  4CHN A;  3KLH A;  2DFF A;  4PKI A;  1TK5 A;  3SQ4 A;  3D2E A;  1MA9 B;  2IGI A;  4PKH A;  5EOY A;  1QZ5 A;  1VRT A;  4WFN L;  2DY4 A;  4E7I A;  4IJA A;  3V1R A;  2JLE A;  1KVC A;  3H3N O;  1NGA A;  5I3U A;  2NUB A;  3T19 A;  1WSH A;  4F9O A;  2HHU A;  3QEP A;  2DPN A;  4IO9 L;  1J54 A;  3PIO L;  1ESV A;  2IVO A;  1DEJ A;  4DU1 A;  3HP6 A;  2BH1 A;  4DB3 A;  3AVF A;  4MQ3 A;  3SUP A;  5C2D A;  3T3F A;  1C0G A;  4BRM A;  1HNV A;  1Z6R A;  2KFN A;  2EHG A;  3CFO A;  5CR4 A;  1NK5 A;  4DR1 K;  2HW3 A;  3D45 A;  4OVL A;  1V4S A;  1WSF A;  3NF9 A;  1RCH A;  2GUP A;  3ZET A;  4BVP A;  1KFS A;  4DUZ K;  1S1T A;  3R1X A;  3TAB A;  4HTU A;  4JI8 K;  1XHZ A;  1NJZ A;  4BRN A;  5E41 A;  3N4P A;  4Z4H A;  4FLV A;  5BPM A;  4DTP A;  4CED A;  5KPZ A;  4AH9 A;  2GBZ A;  4B9L A;  3SI6 A;  3RRG A;  3LZI A;  1NKB A;  1K73 O;  5AQN A;  4BR2 A;  3TAE A;  2PY5 A;  1N32 K;  4M3R A;  1S6Q A;  4FJ9 A;  4MLH A;  3BZK A;  1VSH A;  3G25 A;  3O08 A;  2P9I B;  4JLH A;  1DTQ A;  1EKE A;  3M6G A;  1KLN A;  4CFB A;  3ZT0 A;  3PX6 A;  4BWM A;  1BIZ A;  2YCH A;  1OVQ A;  3LP2 A;  2PFU A;  3EL2 A;  4DTJ A;  3ZLJ A;  3LPU A;  1VHX A;  4HUE A;  4LFB K;  2EWS A;  4DR4 K;  4J2E A;  5JS2 A;  4HVJ A;  3EZ5 A;  2RHK A;  3AA4 A;  4FJM A;  1VQP N;  1IBM K;  4DTO A;  4U7B A;  3J7Z O;  2FBT A;  4RW9 A;  2O8D A;  3MXM A;  3TSP A;  2PAV A;  3G71 N;  1IKV A;  3OYB A;  1O1W A;  3LWM A;  1SAZ A;  3VTI A;  3QNN A;  3MDQ A;  5AQL A;  4B3S K;  3M8Q A;  2UUB K;  3ATV A;  1L3V A;  3SAF A;  3FFK B;  5AQP A;  4RW4 A;  2NNW A;  1S5J A;  5M1P A;  1WLJ A;  5LY3 A;  2HVI A;  3VA0 A;  3EN9 A;  3CQY A;  2G8W A;  2OPS A;  4WQ5 A;  4NCG A;  4ISG A;  1B9F A;  4DV5 K;  3THW B;  2P9U A;  1JCG A;  5KPT A;  5GIP A;  1T03 A;  4OJR A;  1NGE A;  2A5X A;  2Z1G A;  5CY4 A;  2B6A A;  1XI1 A;  4PHT X;  1W97 L;  3OYF A;  4ILJ A;  3VEY A;  3ZYY X;  4F3T A;  4CE9 A;  2GTD A;  4LH5 A;  3QFP A;  4O55 A;  2G8F A;  4B3T K;  4CJT A;  4YOX A;  4JI4 K;  3TSU A;  4OLB A;  2YNF A;  4FPA A;  4E7J A;  4KHW A;  4ISF A;  2XY8 A;  1MU2 A;  4DS4 A;  1XHX A;  1CZA N;  4MO5 A;  3K5N A;  3QEV A;  1RT5 A;  5SZT A;  3P1G A;  3HK2 A;  3K5L A;  2HBK A;  3LAK A;  2DFE A;  4UQG A;  2JGU A;  1W9H A;  4KH4 A;  4FJK A;  4B1W B;  4CZL A;  1B92 A;  4CK2 A;  3OW2 M;  5M1K A;  3VF2 A;  5FLX O;  5E26 A;  4K8X A;  4CEC A;  2HF4 A;  4F4K A;  3W0L A;  3DI6 A;  4CJ7 A;  4O5B A;  4R5P A;  2A1R A;  1WAJ A;  2QXL A;  3TTD A;  4ZHR A;  3AGK A;  4E3S A;  2YJF A;  3ZT4 A;  2DFH A;  2W42 A;  1VSF A;  3PIP L;  1DLO A;  3CIP A;  1QQC A;  4A61 A;  2HHT A;  4KTZ A;  4DV4 K;  2WON A;  3THV A;  1RDB A;  3SNN A;  3IS9 A;  1TYQ B;  2QWP A;  5C12 A;  4KHN A;  4EP4 A;  3KK3 A;  2IS3 A;  1YIT N;  2E2Q A;  3M5R A;  4FM1 A;  3H46 O;  4J2D A;  4FZX C;  3HOT A;  3DXM B;  4MDA A;  3D7E O;  3NH2 A;  3AVH A;  3CER A;  4OPJ A;  1KD1 O;  4LF7 K;  1NU0 A;  5AQM A;  5AZJ A;  1S1V A;  1T44 A;  1YUW A;  4BC4 A;  3VQA A;  3SYZ A;  2E5L K;  2P9L B;  1Q86 O;  3P5J A;  2GWK A;  3AVB A;  2HMI A;  5J2P A;  3U3G A;  3GBT A;  4BRQ A;  4CEF A;  4I2Q A;  1HYS A;  4IOC L;  2D0C A;  4QOZ B;  5M1Q A;  1WN7 A;  4KPY A;  3K5M A;  1TL1 A;  1K8A O;  3K59 A;  4GVE A;  2D1K A;  3LDN A;  4PY5 A;  3OBY A;  4CHZ A;  4JI6 K;  2NRT A;  3VQE A;  1GLF O;  5AQV A;  4BDY A;  4JKG A;  3SUQ A;  3NF7 A;  4J2B A;  4O8K A;  4Y1C A;  1JLB A;  3DXK A;  3QB0 A;  4M45 A;  1S9E A;  1JJ2 M;  5GAE P;  4EFH A;  3L6Q A;  4F2R A;  2XY6 A;  2A3Z A;  2VG7 A;  2HMP A;  3F5T A;  2Q3S A;  4GV3 A;  3CJB A;  1YTU A;  2UXB K;  3NH1 A;  1BQM A;  4BRD A;  1IO2 A;  1QQN A;  2OA8 A;  1VRU A;  4NO7 A;  5M1F A;  4PL7 A;  1ASU A;  1SL1 A;  4B1X B;  1J5E K;  3AAQ A;  5B8H A;  3CJ7 A;  4KI4 A;  4CJQ A;  5EU7 A;  1NLV A;  1RTH A;  4CI6 A;  4AM6 A;  1FKP A;  4Z0U A;  5AQZ A;  3AAR A;  3V9W A;  3F9K A;  2E6L A;  1RT7 A;  3AAP A;  4CK3 A;  2HHS A;  4FWK A;  3CCM N;  2E1Z A;  3V9S A;  3MEG A;  4DSK A;  4FM2 A;  4FJH A;  3M8R A;  1BGX T;  4FK2 A;  2HOE A;  4FJI A;  1BIU A;  4X62 K;  2ATQ A;  3AO5 A;  2WFB A;  1HUX A;  4CEQ A;  3ID6 A;  4I9L A;  2QWM A;  3FZM A;  3HTV A;  1OH8 A;  5AJ3 K;  4H0O A;  3QES A;  4IDK A;  5F2R A;  1M1K O;  3DMJ A;  4KHS A;  3O5B A;  3ASM A;  3WXI A;  3CQX A;  5AQO A;  1M90 O;  3DAW A;  3O3G A;  4HHT A;  1HJO A;  5TKW A;  5AZI B;  3ENH A;  3IKM A;  4CZM A;  4CHQ A;  4JD2 B;  1VQ6 N;  1LWF A;  3WEE A;  5AQR A;  3L2R A;  1NGJ A;  3QET A;  4CGI A;  4Z4G A;  3KK7 A;  2VCP A;  1L3U A;  3S3M A;  4DQI A;  3O8M A;  4B1U B;  2V52 B;  3M8S A;  4J8F A;  5ADX H;  3VOV A;  4CJL A;  4DV0 K;  1CZ9 A;  1NJW A;  3OTO K;  3KVG A;  2F9W A;  3VQ6 A;  2D4W A;  4DSL A;  4H5T A;  1HJR A;  3IAY A;  4BAC A;  3OJS A;  1CXU A;  3CCQ N;  3DLB A;  4IDH A;  1N36 K;  5BN9 A;  3WXJ A;  3Q7C A;  5CZ1 A;  4FJ5 A;  4CF2 A;  4WFB L;  1HR0 K;  3C7N B;  1NG9 A;  5FPD A;  1HYV A;  4DU3 A;  4ID1 A;  3WUH A;  4O4G A;  3R8E A;  1X9M A;  5BR9 A;  1T6D A;  3RMD A;  3LP1 A;  1TVR A;  3HPH A;  4LC9 B;  3UKU A;  4W5Q A;  3O9Q A;  5FRN A;  3ATU A;  2VYP A;  4QS8 A;  4KH5 A;  2I7P A;  2G8U A;  4DLE A;  3I33 A;  3U6F A;  4LSN A;  4C8O A;  3ISN C;  5BN8 A;  1GLD G;  1RDW X;  2ZQB A;  5AFU A;  2A42 A;  3QIN A;  3SV4 A;  3THX A;  3RR7 A;  2CGJ A;  4ISE A;  4NXN K;  1NGH A;  4QCL A;  2FC0 A;  4A59 A;  2FSK A;  4DHY A;  2Z1J A;  1UWB A;  2ZF5 O;  2P9S B;  5BRH A;  3PSI A;  5IWA K;  4ICL A;  1X1P A;  3MN5 A;  3KJV A;  4YOW A;  5K14 A;  2QWR A;  1JLG A;  2GEM A;  3O4W A;  4B9M A;  3BUZ B;  3OYA A;  3DJC A;  4NYF A;  4PWD A;  2HHV A;  3V9Z A;  2GX9 A;  3L2V A;  1L5U A;  2Q0R A;  4BC5 A;  1HNW K;  4M7Y A;  3V1Q A;  1DGK N;  4FWN A;  2P9K A;  4GKK K;  2O8B B;  5JVH L;  4OPK A;  5SWM A;  2Q97 A;  4PQU A;  2WOM A;  4AHU A;  3NH0 A;  2RE2 A;  3OYC A;  4O0I A;  2QM1 A;  3LDL A;  4FW2 A;  3RMB A;  4RW8 A;  2J4R A;  1NKE A;  1WUA A;  2E2O A;  4IZ9 A;  3P31 A;  3MXJ A;  3WNG A;  1G99 A;  2ZWH A;  1DKG D;  3KKR A;  4DTS A;  3AA3 A;  3J7Y P;  3L2U A;  2WC9 A;  2PBD A;  3THY B;  3CJA A;  4FWQ A;  4E7K A;  2D0B A;  1D9D A;  2E8A A;  1HKC A;  1V4T A;  4W5R A;  4PKG A;  4LH4 A;  3J8A A;  1MWM A;  2NRZ A;  4ZTF A;  5AQJ A;  3KWI A;  4FOE A;  3HO1 A;  4JI2 K;  3E01 A;  3RVC A;  2P5O A;  4XH5 A;  1HX1 A;  4B9Q A;  3GL1 A;  4BRG A;  1D8Y A;  4FVM A;  3O4N A;  2RPI A;  3VEW A;  3MX2 A;  5HRO A;  4CBX A;  1YXQ A;  4H5W A;  3H1Q A;  3H3O B;  4WQ4 A;  3JS6 A;  3I8B A;  2V7Y A;  1U2V B;  2P51 A;  2EX3 A;  3VF6 A;  4FLT A;  4N56 A;  4ILH A;  1UA1 A;  2O8E B;  4BQZ A;  3J7A P;  3ZSZ A;  2VG5 A;  2ZD1 A;  1D9F A;  4I6M B;  3PO5 A;  2VWJ A;  3E66 A;  3KZB A;  1N5Y A;  3C0B A;  1WSJ A;  4CD1 A;  3CCE N;  4V19 S;  3TAN A;  4OO1 J;  3HYF A;  3HI0 A;  1Z05 A;  1HMV A;  1NGD A;  5KPR A;  4DR7 K;  1TUU A;  4PL8 A;  4CHO A;  2O8C B;  3O9U A;  1BOT O;  3QER A;  3QEX A;  3PSF A;  2YKM A;  5AQY A;  1SL2 A;  1BL3 A;  1TGO A;  5EY4 A;  2QEX N;  5E84 A;  4JI7 K;  3MN6 A;  3ZEU A;  4WF9 L;  3P39 A;  3F2K A;  3T7Z A;  2IVP A;  2KQ2 A;  3AO2 A;  3MXI A;  4W5N A;  4AQY K;  1Q81 O;  3FGU A;  3RSE A;  3WXK A;  1FW6 A;  2Q1N A;  3ZSR A;  4IFY A;  1QQO A;  1XNR K;  5KQD A;  2F7T A;  3LL3 A;  3OS1 A;  4CJW A;  1D4X A;  4CCH A;  4KHQ A;  4M3Y A;  4K0K K;  5HBM A;  4KKO A; 
#chains in the Genus database with same CATH homology
 4FJJ A;  4CER A;  4Q0B A;  1L3T A;  1T03 A;  1UAX A;  3KD5 E;  1U4B A;  4OKE A;  4OJR A;  3L2Q A;  2KZZ A;  1T8E A;  3RMA A;  4KRF A;  3QIP A;  2Z1G A;  3V6D A;  1IKX A;  4DF4 A;  4B8A B;  4B9N A;  2KZM A;  1QSL A;  1TKX A;  5CY4 A;  2B6A A;  4KHY A;  4FJX A;  1XI1 A;  4TSX A;  4Z4E A;  1TKD A;  3ZSY A;  3VQP A;  3S9H A;  1LWE A;  3OYF A;  1CLQ A;  4F3T A;  3ALY A;  4CE9 A;  5J2N A;  4LH5 A;  4O0J A;  1NK6 A;  4O55 A;  1XC9 A;  2G8F A;  3PV8 A;  4CJT A;  1JLF A;  3VQQ A;  3UIQ A;  5D3G A;  1RT4 A;  1B9D A;  2YNF A;  4DFP A;  4OLB A;  3A2F A;  3DRS A;  2QKB A;  4E7J A;  4AHC A;  4JRQ A;  4KHW A;  4FYD A;  4CHP A;  2XY8 A;  1MU2 A;  3DOK A;  1YT3 A;  4DS4 A;  1XHX A;  4IG0 A;  5KGW A;  3NCI A;  4BDZ A;  4DTR A;  3TAF A;  3SQ0 A;  4K8Z A;  3K5N A;  3HM9 A;  4CF8 A;  1RT5 A;  1J9A A;  3QEV A;  1NKC A;  3DLE A;  5KI6 A;  5SZT A;  3P1G A;  3HK2 A;  3K5L A;  3SCX A;  4CGH A;  4CIG A;  3LAK A;  2XRI A;  2DFE A;  5CYQ A;  1BCM A;  1VK0 A;  1WSG A;  4DQR A;  5J2Q A;  2VWK A;  4C8N A;  3VQ4 A;  2E6M A;  4UQG A;  3SUN A;  2F8S A;  4DTM A;  3AVJ A;  4F8R A;  2JGU A;  3KTQ A;  1G15 A;  1W9H A;  4FJK A;  2D0A A;  1B92 A;  2XY7 A;  3QIO A;  3JYT A;  1I39 A;  3L3V A;  1SKW A;  1FXX A;  1TL3 A;  4CEA A;  4CEO A;  4CK2 A;  3O3H A;  2ZE2 A;  4DF8 A;  4ELU A;  1VSE A;  4K8X A;  3L8B A;  4M3W A;  4CEC A;  4EP5 A;  3LP0 A;  3NGY A;  4F4K A;  1RDC A;  4Z4F A;  4FXD A;  1ZBH A;  4YFU A;  2YNI A;  3DI6 A;  4CF0 A;  2YNH A;  4O5B A;  1C1B A;  4R5P A;  3EYZ A;  3VQ7 A;  2A1R A;  4FW1 A;  1NK9 A;  1L3S A;  3AVM A;  4DFJ A;  4KV8 A;  5FDL A;  1WAJ A;  3VQD A;  4HUF A;  5KGX A;  2E4L A;  4ZHR A;  3RWU A;  1JL2 A;  1REV A;  4JRP A;  1C6V A;  5FRM A;  4CES A;  1HPZ A;  2A1S A;  3ZT4 A;  4E3S A;  4DSI A;  2DFH A;  2D5R A;  2W42 A;  1VSF A;  3DOL A;  1BCO A;  1DLO A;  4GW6 A;  2OPQ A;  3T1A A;  4AHV A;  1U49 A;  4AIL C;  1T7P A;  1QQC A;  3ZT3 A;  2HHT A;  3DM2 A;  3VQ9 A;  5KRS A;  3KLF A;  3NGI A;  4KTZ A;  1CZB A;  3MEC A;  4CJF A;  4HUG A;  2WON A;  3AV9 A;  2XY5 A;  3THV A;  3LZJ A;  3ULD A;  1NK0 A;  1RDB A;  1Y97 A;  4HCB A;  5KRT A;  3IS9 A;  3SNN A;  3NFA A;  5DMR A;  3KLI A;  1VSD A;  4E19 A;  4KHU A;  3SZ2 A;  1J5O A;  4KHN A;  3M8P A;  2YV0 X;  2YKN A;  3OVN A;  4KO0 A;  3HT3 A;  4KTW A;  1ASV A;  4EP4 A;  1DTT A;  3HJF A;  3KK3 A;  2IS3 A;  4FJN A;  2DTU A;  3OJU A;  4FM1 A;  3AA2 A;  4FJL A;  5HRR A;  4N47 A;  4BE1 A;  3DLH A;  3F73 A;  4J2D A;  4M42 A;  1Z25 A;  4I2P A;  3VQ8 A;  1RBS A;  3MED A;  1NK4 A;  2YHB A;  4FZX C;  1SKR A;  2FBX A;  2BDP A;  2Z1I A;  3TWH A;  4AHR A;  1IKW A;  1YTA A;  4CFD A;  3NH2 A;  3LDS A;  3ZCM A;  2LSN A;  3OYN A;  4DTN A;  1RTJ A;  3AVH A;  3WNE A;  3OYJ A;  3I8D A;  4OPJ A;  1GOB A;  2HHW A;  1ZBI A;  1S1V A;  2RN2 A;  4M3U A;  4OKK A;  4Z4C A;  3VQA A;  4B9S A;  1LAV A;  4CF9 A;  1VSM A;  3SYZ A;  4BWJ A;  1K6Y A;  4J2A A;  2BAN A;  2B4J A;  4LY7 A;  3VQC A;  4BE2 A;  4E0D A;  3V9U A;  3P5J A;  3AVB A;  2KW4 A;  4OGE A;  5J2P A;  2HMI A;  2HVH A;  4CJE A;  1RDA A;  2YHA A;  3U3G A;  1JXE A;  3CQ8 A;  1IH7 A;  4DS5 A;  3KKS A;  1Q8I A;  4DFK A;  4CEF A;  4I2Q A;  1HYS A;  1C0T A;  2D0C A;  1NK8 A;  4QOZ B;  4FLW A;  3LP3 A;  3TI0 A;  1WN7 A;  4KPY A;  3K5M A;  1TL1 A;  3S3O A;  1ZBU A;  1EP4 A;  2FBV A;  3K59 A;  4OLA A;  4I7F A;  4FCY A;  1RT1 A;  1A5W A;  4PY5 A;  3ZSV A;  3HVT A;  4CHZ A;  4ELT A;  3VQE A;  1RBU A;  4LD0 A;  3HL8 A;  3VN5 A;  4CHY A;  3OS0 A;  4BDY A;  4KB1 A;  3SUQ A;  3NF7 A;  1LW0 A;  4CJU A;  3BDP A;  4B9V A;  3LAL A;  1RT6 A;  4DQP A;  4J2B A;  4FJ7 A;  3OYD A;  4Y1C A;  1JLB A;  5T7B A;  4M45 A;  4CGF A;  1S9E A;  2XO7 A;  4F2R A;  3V1O A;  1GOA A;  2XY6 A;  2VG7 A;  1QSY A;  4E7L A;  2GUI A;  1U48 A;  1TK0 A;  3QEW A;  2Q3S A;  1LAW A;  1KTQ A;  3TAP A;  1YTU A;  3K2P A;  1TK8 A;  3K5O A;  4CFA A;  3NH1 A;  1BQM A;  1RTD A;  2O4I A;  1IO2 A;  4DTU A;  3ZSO A;  1YVU A;  2OPP A;  1VRU A;  4DFM A;  2OA8 A;  4NCA A;  1ASU A;  1SL1 A;  3NHG A;  3G10 A;  4ZTJ A;  4CJ4 A;  1Q9Y A;  1N6Q A;  4N76 A;  1TAU A;  4CF1 A;  4DTX A;  3OYI A;  4PUO A;  4FZZ A;  4KI6 A;  1HQE A;  1BI4 A;  1RTI A;  3AA5 X;  4KI4 A;  4CJQ A;  5EU7 A;  4DG1 A;  1RTH A;  4IBN A;  4C8M A;  3V9X A;  1FKP A;  4KB0 A;  3AO4 A;  4Z0U A;  3KIO A;  3V9W A;  3RMC A;  3F9K A;  3LAM A;  4FJ8 A;  2E6L A;  1RT7 A;  3C94 A;  4CJS A;  4CJK A;  4CK3 A;  4F2S A;  1VSL A;  2HHS A;  1BQN A;  2G8V A;  1NJY A;  2IC3 A;  3AVG A;  3KK1 A;  1HYZ A;  5HLF A;  3V9S A;  4DQS A;  1KLM A;  3IRX A;  3MEG A;  4DSK A;  4DWI A;  4FM2 A;  2YNG A;  4CJR A;  4FJH A;  3M8R A;  1BGX T;  4FK2 A;  4FJI A;  1BIS A;  1BIU A;  1TAQ A;  1I3A A;  3HPO A;  2IAJ A;  2ATQ A;  1RNH A;  3HST B;  3ZSQ A;  4CK1 A;  3OS2 A;  3AO5 A;  1X9W A;  2VG6 A;  5HRS A;  3P83 D;  4CEQ A;  2QXF A;  4I9L A;  4GVM A;  4AHT A;  3AVK A;  1RT2 A;  5CZ2 A;  4W5O A;  3QES A;  4NCB A;  4IDK A;  3K57 A;  4C8L A;  3B6P A;  3DMJ A;  2X74 A;  1IG9 A;  3U3Y A;  3AO3 A;  4KHS A;  4FK4 A;  2HHQ A;  2HNY A;  3ASM A;  3NF6 A;  3HXM A;  2R7Y A;  2QK9 A;  1LWC A;  4W5T A;  1S9G A;  2GV9 A;  3AVA A;  1S1X A;  3DRR A;  3C6T A;  4N5S A;  3O3G A;  4FK0 A;  4HHT A;  4CEZ A;  1RBV A;  2ETJ A;  1RBT A;  2ITG A;  4CHQ A;  3DLR A;  3NF8 A;  2X6N A;  3LPT A;  1LWF A;  3VA3 A;  2PYJ A;  2BGG A;  1JLA A;  3L2R A;  1KSP A;  3HPG A;  4Z4I A;  3QET A;  1C1C A;  1QTM A;  1SKS A;  4DMN A;  1JXB A;  4CGI A;  1D5A A;  3AVI A;  4LSL A;  3ZT1 A;  4Z4G A;  1S1W A;  4JS5 A;  1C1A A;  4OGC A;  1L3U A;  4NYN A;  3S3M A;  1WAF A;  2OZM A;  2HB5 A;  3QO9 A;  4DQI A;  3KD1 E;  3KK2 A;  3M8S A;  4MFB A;  4B9U A;  1TKZ A;  4H4O A;  2X78 A;  3OYK A;  5I42 A;  4M3Z A;  1SUQ A;  3HP9 A;  4CJL A;  1CZ9 A;  3L2W A;  3QEI A;  1NJW A;  4N41 A;  1JL1 A;  3SPY A;  4CIE A;  2OZS A;  3MAQ A;  4H8K A;  4PA1 A;  1JLC A;  4CGJ A;  4CJ3 A;  5C25 A;  4G1Q A;  3V4I A;  1ZYQ A;  1GOC A;  3VQ6 A;  3DLG A;  4DSL A;  1QHT A;  4RW7 A;  1HJR A;  3SJJ A;  3IAY A;  3SUO A;  3NAE A;  3OJS A;  4BAC A;  3QLH A;  1S6P A;  1CXU A;  1KVB A;  3DLB A;  1S1U A;  1WSE A;  5C24 A;  4I9Q A;  3B6O A;  4KTQ A;  3CM5 A;  4FLX A;  1IKY A;  5CZ1 A;  4FJ5 A;  4KFB A;  4CF2 A;  3PUF A;  4FLY A;  1NOZ A;  1FKO A;  3ZT2 A;  1HYV A;  3BGR A;  3NDK A;  4DU3 A;  4KAZ A;  4ID1 A;  3CM6 A;  4O4G A;  4XIU A;  5CYM A;  3O3F A;  4JS4 A;  4DSE A;  5HP1 A;  4C8K A;  3DLK A;  3G0Z A;  1TKT A;  4CFC A;  1X9M A;  2IOC A;  1EX4 A;  3RMD A;  3LP1 A;  3OYE A;  1KVA A;  1TVR A;  3HPH A;  4L8R B;  1RIL A;  4WE1 A;  4FZY A;  4W5Q A;  5FRN A;  5HRP A;  2FBY A;  3JSM A;  1LV5 A;  1HNI A;  2RF2 A;  4M3X A;  4OKJ A;  3FFI A;  1WNS A;  3AO1 A;  3OYM A;  3K58 A;  3TAQ A;  1J53 A;  3VQ5 A;  1U47 A;  3HVR A;  3LAN A;  2OPR A;  2G8U A;  3PO4 A;  1UOC A;  3MEE A;  3AVN A;  4DLE A;  1EET A;  1VSJ A;  4AHS A;  3U6F A;  4LSN A;  1X9S A;  4CEB A;  3ISN C;  3SQ2 A;  4C8O A;  1RBR A;  2HHX A;  3NE6 A;  3OYL A;  3LWL A;  3I0S A;  4EZ9 A;  1RT3 A;  3VQB A;  3I0R A;  1ASW A;  4CGD A;  3EY1 A;  1F21 A;  2ZQB A;  4CHN A;  2PYL A;  2F96 A;  3KLH A;  1W0H A;  3WNH A;  1WSI A;  2DFF A;  3QIN A;  4BE0 A;  3SV4 A;  3RR7 A;  1TV6 A;  1TK5 A;  3PX0 A;  3SQ4 A;  4QCL A;  2FC0 A;  1NOY A;  2IGI A;  2G8H A;  2G8I A;  4O44 A;  2Z1J A;  1UWB A;  1VRT A;  2DY4 A;  4E7I A;  4DLG A;  4ICL A;  1X1P A;  3V1R A;  2JLE A;  3KJV A;  1KVC A;  1XWL A;  5K14 A;  4HCC A;  1JLG A;  1CXQ A;  5I3U A;  2NUB A;  3OY9 A;  4B9T A;  4B9M A;  3OYA A;  2HHV A;  4NYF A;  3T19 A;  1WSH A;  4PWD A;  3V9Z A;  2HHU A;  3D0P A;  2QKK A;  3L2V A;  4FLZ A;  1A5V A;  3QEP A;  1L5U A;  1J54 A;  3V1Q A;  4DU1 A;  3HP6 A;  3L3U A;  1C0M A;  3ITH A;  4DQQ A;  4OPK A;  3AVF A;  5SWM A;  4MQ3 A;  3KLG A;  4PQU A;  1HQU A;  2WOM A;  1KRP A;  1SV5 A;  1U04 A;  4AHU A;  3T3F A;  4B8C A;  3SUP A;  3NH0 A;  3OYC A;  3NBP A;  4BDP A;  1HNV A;  4FM0 A;  4O0I A;  2P1J A;  3C6U A;  2KFN A;  4CIF A;  3CFP A;  3RMB A;  4FW2 A;  4F3O A;  2EHG A;  3CFO A;  1NK5 A;  3NGZ A;  4RW6 A;  5FRO A;  2KTQ A;  3TAG A;  1FK9 A;  4M41 A;  4B3O A;  4RW8 A;  3O4Q A;  1NKE A;  4B08 A;  2HW3 A;  3D45 A;  4OVL A;  3TR8 A;  1JLE A;  3MXJ A;  1WSF A;  4E1M A;  3WNG A;  3NF9 A;  1U45 A;  5HRN A;  2HNZ A;  1RCH A;  3KKR A;  4DTS A;  1KFS A;  3AA3 A;  1S1T A;  2IDO A;  4YNQ A;  3ZSX A;  4IG3 A;  3L2U A;  3TAB A;  1T05 A;  3RR8 A;  1BHL A;  4HTU A;  4E7K A;  2D0B A;  1D9D A;  4H4M A;  1EXQ A;  1KFD A;  4W5R A;  3TAM A;  2Y1I A;  5E41 A;  1XHZ A;  4LH4 A;  1NJZ A;  1A5X A;  1Q9X A;  4EZ6 A;  4ZTF A;  3PY8 A;  3HO1 A;  4Z4H A;  4FLV A;  3E01 A;  3RTV A;  4DTP A;  4CED A;  2P5O A;  4AH9 A;  2GBZ A;  3DRP A;  5KTQ A;  1ZBL A;  1D8Y A;  4B9L A;  3SI6 A;  2KFZ A;  3CYM A;  4FVM A;  3O4N A;  4FJG A;  3RRG A;  3LZI A;  2RPI A;  1NKB A;  3AVC A;  1JKH A;  5HRO A;  3TAE A;  4E1N A;  2PY5 A;  1RDD A;  3WNF A;  1QE1 A;  2P5G A;  4M3R A;  1S6Q A;  3SPZ A;  4FJ9 A;  3AVL A;  3DYA A;  5JS1 A;  1VSH A;  4FLU A;  4DSF A;  4Y1D A;  2P51 A;  4JLH A;  2EX3 A;  1UA0 A;  4FLT A;  4N56 A;  2XHB A;  1UA1 A;  1DTQ A;  2AJQ A;  1HRH A;  1EKE A;  3ZSZ A;  2VG5 A;  1KLN A;  2Z1H A;  2Y1J A;  4E89 A;  2ZD1 A;  4CFB A;  1D9F A;  4ID5 A;  3ZT0 A;  3PO5 A;  2VWJ A;  3PX6 A;  4CJ5 A;  4BWM A;  1BIZ A;  2G8K A;  4ELV A;  1QS4 A;  4DU4 A;  1VSK A;  3LP2 A;  4QAG A;  4DTJ A;  4DSJ A;  4CGG A;  1N5Y A;  1QSS A;  5DK5 A;  3LPU A;  1WSJ A;  4HUE A;  3C95 A;  3ZSW A;  3TAN A;  3QNO A;  3CG7 A;  3HYF A;  1ITG A;  1C0U A;  4J2E A;  5JS2 A;  4HVJ A;  1HMV A;  2HND A;  5J2M A;  4CEE A;  2O4G A;  3EZ5 A;  4CHO A;  3AA4 A;  4FJM A;  3SV3 A;  4RG8 A;  3H08 A;  4DTO A;  3QEX A;  3QER A;  3TAR A;  2FBT A;  4RW9 A;  4CJV A;  4E7H A;  3MXM A;  1SL0 A;  1NJX A;  2YKM A;  2RKI A;  4CJP A;  3V81 A;  1SL2 A;  1IKV A;  1BL3 A;  3KLE A;  3OYB A;  1O1W A;  1TGO A;  3LWM A;  3IG1 A;  2I5J A;  2PZS A;  1ZBF A;  3QNN A;  2KQ2 A;  3AO2 A;  3M8Q A;  3RRH A;  3MXI A;  1L3V A;  4W5N A;  1R0A A;  1BI4 B;  2F8T A;  4IKF A;  2X6S A;  1VSI A;  4RW4 A;  4M3T A;  1KCF A;  1S5J A;  1WLJ A;  3ZSR A;  4Q5V A;  2HVI A;  2OYQ A;  4IFY A;  5J1E A;  3VA0 A;  3OYG A;  2G8W A;  3CFR A;  3SQ1 A;  2OPS A;  1LW2 A;  2BE2 A;  3OYH A;  2B5J A;  1Z26 A;  1JLQ A;  4NCG A;  4KRE A;  4GMJ B;  1B9F A;  4CJW A;  3OS1 A;  3PX4 A;  3S3N A;  1NK7 A;  4CCH A;  5C42 A;  4KHQ A;  4M3Y A;  4IFV A;  5HBM A;  4KKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...