1IBLK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1iblK00
2UXDK 1HNWK 1FJGK 1HR0K 1N36K 4DR4K 4LF8K 2UU9K 1XMQK 1HNXK 4CW7B 5BR8K 3T1YK 1N32K 4K0KK 3J81O 4YY3K 4DV5K 5A2QO 4JI5K 4AQYK 4B3SK 4DV7K 4JI3K 1J5EK 2UXBK 4DV1K 4OX9K 2UXCK 4DUYK 5IT9O 5FLXO 4DUZK 4DR7K 4CVNE 4DV2K 4LF9K 1N34K 1I94K 2ZM6K 4KHPK 5LMUK 1XNQK 4B3TK 3JAMO 2F4VK 4JI1K 4JI4K 4B3MK 3J7AP 5LMNK 4LF4K 4LFAK 4GKJK 5AJ3K 4X65K 4JV5K 1IBLK 2VQEK 2UUBK 4DR3K 4JI0K 3OTOK 4DR1K 2UUCK 4LF6K 4X66K 4JI6K 4DV6K 1HNZK 1IBMK 4X62K 2E5LK 5LL6Z 4LFCK 4JI8K 3J7YP 4GKKK 4YHHK 3T1HK 4DV0K 5IWAK 4LF7K 4JYAK 4B3RK 3J80O 4DR6K 4V19S 1XMOK 4NXMK 4LF5K 1XNRK 1N33K 1IBKK 4JI7K 4DV4K 4LFBK 2VQFK 4DV3K 4DR2K 4NXNK 4X64K 4DR5K 4JI2K 2UUAK 2HHHK
chains in the Genus database with same CATH superfamily
1M90O 4CD3A 2O8DB 4N76A 2HNYA 3KJVA 2PZSA 1HKBA 1NGFA 3PO4A 4R5PA 4DG1A 3OYMA 5AQRA 3QINA 2W6LA 3EO3A 3WQUA 1VHXA 1WSFA 4IJNA 4FJGA 4Z94A 3O8MA 4DHYA 3M8QA 1YI2N 5AQKA 5HBMA 4A57A 3OYBA 1WUAA 4CHYA 4JN4A 4DV5K 1F21A 2YKMA 4CIFA 4H4OA 1RT1A 2DPNA 1NK7A 2HSTA 3O9TA 1IO2A 4XH5A 2V7YA 1Y97A 2G8IA 2P9IA 1TKDA 3VESA 1SKWA 3TAFA 4NLCA 5ADXA 4FWSA 2FSJA 3V81A 5AJ3K 4B9NA 1Q9XA 3GG4A 4DLEA 3MK6A 1YJWN 1IBLK 3ZT3A 3O6WA 4IEEA 4BC3A 1NKEA 2A40A 4OPHA 4DR1K 2A6AA 3MECA 1NJXA 4JI6K 4DV6K 2YHWA 2A1RA 3WQTA 3HBTA 2V7ZA 4GNIA 2QWLA 4FOEA 4YHHK 5HRPA 4CEAA 3T1HK 4KHYA 3HJFA 3ZSYA 4F3OA 1Y64A 1NM1A 2FBXA 1NBWA 4O5BA 1NNEA 3O3FA 1VQ9N 4H4MA 4PWDA 3SQ1A 3V1OA 1TVRA 4NCAA 2Z1IA 4H0YB 1ATSA 3ZX2A 4GMJB 1TAQA 3LDQA 3WEEB 4YOXA 3JYTA 3TTDA 3GOIA 3VTIA 4PUOA 4CIGA 1BGXT 2ZGYA 3G4SN 3SJJA 2Z1HA 4JKDA 2Q0RA 3H6EA 1NMDA 1NGDA 2HHHK 5AQUA 2HB5A 1GLLO 4IBNA 1NK4A 2UXDK 3TU5A 1SAZA 3VEVA 1ZXOA 3NH0A 4ILHA 1NG9A 1JLFA 1N32K 3E9OA 2P5OA 3B6PA 5C42A 4IDKA 3DJCA 3I0RA 3SMPA 2G8FA 3SYZA 3AVJA 4EFHA 3NVKA 4H5VA 2PAVA 2QWNA 3FFIA 3C6UA 3R1XA 2P51A 1M1KO 3ULEB 1JKHA 4DV7K 2NRVA 1CZAN 3DXKB 1OH6A 1J9AA 1NGIA 1NGAA 3KD1E 3DWLA 4MLEA 2OPPA 4K43A 1KAXA 5KQDA 3HOTA 2PBDA 5AQPA 1K8KB 4CECA 2GEMA 3FZHA 2E6MA 5FROA 1QE1A 1JCGA 4BR2A 2VCPA 1O13A 5E41A 3WXIA 3K5MA 2HVIA 4K42A 4K8ZA 3CJ7A 4JI0K 3OTOK 4M3WA 3G6EN 1UOCA 5AZIA 2HHXA 4YOWA 1NK8A 2O8EA 4KKOA 2J4RA 5E84A 4Z0UA 3HP6A 3CI5A 1XQSC 5J2PA 4DTJA 4RW8A 1KRPA 3M1FA 4DSIA 4CGFA 1DEJA 4EP4A 4OLBA 1RT3A 3CIPA 3U9ZA 3J80O 4PY5A 3AAPA 4BRMA 3L4QA 1HMVA 4RCHA 4W5QA 2OZSA 4CBWA 3FZFA 2VQFK 4B9LA 2YV0X 4FLTA 4AHVA 4ISEA 3OYKA 4FK4A 4JHDB 4CJ7A 1TGOA 1S1WA 2Q31A 5C12A 3QBXA 4DR2K 3TI0A 4IXCA 4FLWA 2QXFA 2DTUA 4QS9A 1MDUB 1YIJN 1NGGA 4BRIA 4ID5A 4NYFA 4PQUA 2YCHA 2RHKA 2HHTA 1K8AO 1CZBA 3OVNA 3R3LA 2VG7A 1Q86O 5FPNA 2O4IA 1HYSA 1TK5A 2HHUA 3VQAA 3J7ZO 4HUFA 3HXMA 1HKGA 2OANA 4CW7B 5JS1A 4CEQA 3LDOA 2JGUA 4E19A 1U45A 2FC0A 2P9LA 1CXUA 5JVHL 3S9HA 4IJAA 2GV9A 5C10A 3RMBA 2W6KA 1XC3A 4TSXA 5EVZA 2VWJA 4Z4IA 1QHTA 2HBKA 4M42A 1HYZA 1EX4A 3LPTA 5M1PA 1QQNA 1XHZA 1WN7A 2HOEA 5J2MA 1HQEA 1SUQA 1RBRA 3THYB 4B3TK 4DSKA 3ENBA 4F3TA 1TL3A 4B1ZA 4IFYA 1BCMA 4LF4K 1GLAG 3HVTA 1BA0A 1E4FT 4DFMA 3KK1A 2F9WA 3IFRA 1W97L 4BRCA 3I0SA 1O1WA 5AQJA 3ZETA 4UQGA 1H1VA 4CFCA 1HNZK 1FKOA 2E5LK 3D0PA 5HLFA 5AQZA 4QOZB 1MA9B 2A3ZA 1KTQA 5AQQA 4DWIA 2YNHA 3ZT0A 1BG3A 2D0PA 3L0QA 3NBPA 4FW1A 2HW3A 1K73O 3TSQA 4KREA 2ZF5O 1T05A 2CGKA 2NNWA 2CGLA 3ZT2A 1VQ4N 5C0YA 1BQMA 5EXWA 4BVPA 3CCLN 4JI2K 5M1QA 4PA1A 1GLBG 4C8OA 4FWOA 3QIOA 4GVMA 4ZTFA 1YITN 4GVEA 3VETA 1XUPO 2O8BA 3K2PA 4BDYA 4Z4EA 5AQOA 3LZIA 2ZQBA 1WBBA 4A61A 1ESVA 3EZWA 1JXBA 4B8CA 1SS6A 1WB9A 2Y1JA 2WOMA 4FWQA 2YHAA 5FPDA 4FWPA 5AQXA 1NLVA 3P38A 3G71N 4OKEA 5HRNA 3LWLA 4CEBA 4MQ3A 4DCHA 1J5OA 1HJRA 3OBYA 2YKNA 5FLXO 4ID1A 3SQ4A 1P8ZA 1VSEA 2O8CA 1NKCA 3ID6A 4A59A 4FLXA 3F73A 2Q97A 2BE2A 3OW2M 1Q82O 3VF4A 4CJ4A 2HNZA 1EWRA 3C7NB 1VQKN 4LFAK 4GKJK 3KWIA 1LCUA 5DK5A 1ASVA 1QSSA 3F5TA 5JS2A 5BRDA 4Z4HA 2E20A 1R59O 4WQ5A 2NUBA 1S1XA 3R9PA 1IKVA 3TABA 1JLGA 1IBMK 1QHAA 3MEDA 4DTXA 1QSLA 4Z4GA 1XWLA 2E1ZA 3M8SA 4K8XA 4CD1A 4W5RA 1VSIA 3WXMB 4YDUA 2FBVA 3QEPA 2W42A 4M3UA 3UKUB 4DLGA 3VEWA 3CQXA 4FWKA 2E1YA 2GX9A 1D9DA 4DU3A 3CM6A 1VSLA 2CGJA 1HPZA 1S6PA 4KHWA 3TARA 2RE2A 1D5AA 3SBTA 1J53A 4AHUA 4XIUA 1JJ2M 1RT6A 1IBKK 1HKCA 2P9KA 5AZJA 3CJ1A 3ATUA 4W5NA 1S1VA 5LY3A 1ZBUA 2O8DA 4B08A 3ATVA 2E2PA 3KWGA 3QBWA 5EOYA 4KTWA 1C0UA 3BUZB 3QLHA 4JRPA 2E6LA 4CJUA 3FLCO 1P90A 5AQGA 4BWJA 3I55N 2BGGA 1BWFO 1JCFA 2R7YA 4JD2B 3OS1A 3NH2A 1FK9A 3ZSRA 3AARA 3UE5A 1KSPA 4LF8K 3VGMA 4CGIA 3DM2A 5BRFA 3FFKB 5EU7A 1WBDA 4RTFD 4CJSA 4H0VB 2E2QA 4ISGA 3J81O 3MCAB 3MN5A 3RRGA 2Q1NA 1RT4A 4H5RA 1A5XA 1Q18A 2VGMA 3ENOA 2NRHA 2QA4N 4OX9K 4DUYK 1NJZA 4DSFA 4IFVA 3BP8A 4DR7K 3CCMN 4FJMA 4EHTA 3C94A 5AQFA 4JEPA 3KLEA 3CFOA 4B3MK 4N41A 4H5TA 3ZSXA 5CY4A 3RSEB 3O1BA 2OPQA 1X9MA 1WAJA 2Q0UA 3BY5A 4H5WA 2QWPA 1LV5A 3SAHA 4KH4A 5C2FA 2YI1A 1L3VA 3MN6A 4O8KA 4DR3K 3ZT4A 5HRSA 5EY4A 4ELVA 5HOOA 4BG8A 4NCBA 3TPQA 1EP4A 3QETA 3MX5A 1KQSM 4BR7A 1QS4A 3HPHA 3ZSQA 4CZFA 3DRRA 2B5JA 3RTVA 4DV0K 4E3SA 1U47A 4CE9A 3CJCA 3T1AA 4LH5A 4MFBA 1X9WA 3WEEA 5EX5A 3MN9A 1BO5O 4DSEA 3HM8A 2HBMA 2HNDA 2ITGA 3SZ2A 4FWLA 5AQNA 4E7JA 4DMNA 3T69A 1EWQA 5CE3A 2KW4A 3HO1A 2UYTA 3THVA 1VRTA 3KHYA 1W2BM 2QXLA 3SQ0A 1ZC6A 3HSCA 2FLOA 1HRHA 4PL7A 2NRZA 4PL8A 2QEXN 4Y1DA 3KLGA 4BRQA 5GIOA 3PV8A 1YJNN 1NMNA 4FPAA 1HNWK 4GV3A 1YVNA 1NOZA 3ENHA 4BRGA 4KI6A 4EZ6A 2UU9K 2G8UA 1XMQK 3RMAA 3ASMA 2HVHA 3A2FA 3GDQA 4CEOA 3O80A 1V4SA 2Z1GA 3ULEA 4MDBA 4B3OA 1KVCA 2E4LA 3DXKA 4CJWA 1EO1A 4I6MB 4MDAA 4UY8O 3VENA 4BE0A 1GLCG 1YVUA 2QTDA 4CERA 1KFSA 4ILGB 2HHQA 3PX4A 2KZMA 1J54A 5CYQA 3NH1A 3V9XA 4O0JA 3AO4A 2PYJA 1JL2A 5JLFA 3AA3A 1K8KA 5E26A 1X9JA 5AQVA 1W7AA 4AHRA 3DLBA 1DKGD 4H03B 3V4IA 3P83D 5AQLA 1S72N 4U67L 1GOAA 3SQ2A 1Q81O 3VEOA 4DFPA 4FJLA 4CFDA 5AQWA 4N56A 1B9DA 2D0AA 4F9OA 4CGJA 3ZEUB 3IAYA 1BISA 3MEEA 2Q2RA 3HM9A 1D8YA 2IVPA 3CFRA 1FXXA 1Q8IA 2XHBA 4B9QA 3THWB 1U6ZA 3OYGA 4LFCK 4NB4A 1TUYA 4CJ5A 2QWMA 4JRQA 3VQ9A 3GE1A 1RT7A 4FCYA 4BC2A 5IWAK 4DTNA 3CCUN 3AA2A 4CJRA 5FRNA 1JL1A 4WYBA 1RDWX 2FF3B 3A5LC 4DTOA 4JHDA 4OGCA 1DT9A 3OYLA 4ICLA 3LL3A 3E1YA 1XNRK 3CHWA 3D6RA 1HNVA 3QFPA 1T8EA 5JICA 4AHSA 2F96A 3VQ4A 3QB0A 3D2FB 4CHPA 2E2OA 1HJOA 3VQ8A 2JWKA 2NRRA 2A5XA 1OVYA 5M1KA 3NF8A 3KTQA 3TAGA 2Q3SA 1I39A 4DU4A 4OPKA 4Z4CA 3EEQA 1VQPN 4ELTA 2HF3A 3EZ5A 3W0LA 4XH1A 1X9SA 1SL2A 5KPRA 5AQTA 2ZJQL 1X1PA 3BF1A 5I9EB 1NGJA 3ID8A 4LSNA 4K0KK 4WQ5C 2YHBA 1CZ9A 3CQYA 5BN9A 1JCEA 3IMXA 3CCQN 4Y1CA 3THYA 1J6ZA 2BTFA 1I3AA 3M8PA 4DV1K 2ATQA 4KHNA 4YDUC 3NHGA 1S1UA 1LW2A 3EE8A 2ITMA 4EP5A 2QKBA 3VERA 1N34K 3L2RA 2NLXA 3DLLL 1ZBHA 1GOCA 1T44A 3MMVA 1VAZA 5LMNK 2FSKA 4B1YB 4BG9A 5LJVA 3KK2A 5GAEP 1YTAA 4JKBA 4BRDA 3ZSWA 4CEEA 3O4QA 3KKSA 4FVMA 3B6OA 4LF6K 5HL7L 2NRTA 5LL6Z 4BRHA 3SV3A 2O4GA 4BRLA 3LP2A 2AA4A 3AO3A 4EAHD 2W41A 4JS4A 5SZTA 4J2AA 4I9QA 3LANA 3CETA 4LF7K 3AVHA 3RR8A 1T03A 1L3UA 4OKJA 4M7YA 4CF2A 4A5BA 2GTDA 2D4WA 1JLAA 3KZBA 3V1QA 4BWMA 3D2EB 4CF9A 4LFBK 3CYMA 4DQSA 3HI0A 1SL0A 4AM6A 3T7ZA 4KTZA 3CMEN 2D0BA 3L3VA 4NLBA 4DR5K 3SCXA 4FK0A 2RPIA 3SPYA 2YHYA 2HMPA 4CJTA 1VRUA 2NRWA 3I8DA 1NKBA 1WOQA 1HR0K 3OYDA 3LDPA 1U48A 2OPRA 1RTJA 3QNNA 4DR4K 5AQYA 2Z1JA 4RG8A 1YTUA 3T1YK 3OYHA 3V9SA 4C8MA 1JLCA 5M1FA 4EIAA 2WTUA 1WSGA 1NOYA 2YJFA 1WSHA 4ZHRA 4CBUA 4FJXA 5KI6A 3O9RA 4MLHA 1FKPA 3LPUA 3EKUA 2UXBK 1J5EK 2G8VA 4G1QA 4LY7A 3CC7N 1ZYQA 5IT9O 1CXQA 3TAMA 2EX3A 3C7NA 3LAKA 4CK2A 4CVNE 3EE9A 3VQPA 4H0OA 3KK7A 4H0TB 3CCVN 3O9UA 3PSFA 5LMUK 2D5RA 3WXLA 3JAMO 3CQ8A 3P31A 4IDHA 1T6DA 4BR4A 1VQ5N 1BI4B 4BRNA 1SQKA 5TKYA 3L8BA 3PIOL 4JV5K 3SK3A 2QW9A 4F8RA 2WUSA 4DTSA 1HNIA 1ASUA 2KKZA 3LM9A 1MU2A 4JNEA 4FJ8A 1ZBIA 3UKRB 3CCJN 4E7KA 1EXQA 1OKJA 3W3DA 2F8TA 1QQMA 3TANA 3K5OA 1C1CA 1X3NA 5AQSA 1BA1A 4CJEA 3G0ZA 1RILA 4CZIA 2P9PB 1X3MA 3MWPA 4B8AB 3QESA 1KAYA 2QWRA 4NXMK 3AVLA 1QSYA 1REVA 3AVAA 3NGZA 4DQ8A 4BR9A 4DV3K 4BY9C 2FSNA 4FM2A 1S9EA 4DB3A 4LC9B 3PX0A 1NGEA 5BPNA 4Y0WA 4JD2A 4X64K 1RGIA 3FGUA 2P5GA 1RT5A 3VPZA 2O8FB 1ITGA 5ELZA 3ZSOA 4FL9A 3OY9A 1VSDA 3KVGA 4CJFA 4N47A 3TAEA 3H45C 2P9UB 3OA9A 4KPYA 3LP3A 3R8EA 3VF6A 4MO4A 1MWKA 4DS4A 1NK9A 4FLUA 2GELA 4KO0A 3QFUA 1RFQA 3VQ6A 3C6AA 4B1XB 5F2RA 4BRKA 1YF5L 3MX2A 4AQYK 3OJSA 1L3TA 3DXMB 1RTHA 4H0PA 3EN9A 3VN5A 2I7NA 4CZJA 3CC2N 3RSEA 3A0IX 3CPEA 3T19A 2NZTA 1EKEA 5DM7L 4KHPK 3THXB 3OYCA 3BZCA 3NAEA 3R6MA 1VQ6N 3GBTA 3GL1A 3O3HA 4BQLA 3NMUA 1JLQA 3M3ZA 4CFAA 4C1NI 4NO7A 3WUHA 1RTIA 2OTJN 3CJ9A 3NE6A 2P1JA 4B1VA 1IH7A 3FR0A 4FLYA 4B9SA 3DLEA 4KH5A 4CZHA 3VQ7A 4YOTA 4O44A 2ZE2A 3K9JA 4I2QA 2WONA 3U3YA 1R0AA 2FF6A 1LW0A 4CZEA 2JLEA 3IKMA 1KD1O 3FE1A 1TKZA 4IG0A 4CI6A 1RBTA 2VGNA 3ISNC 3ITHA 2OZMA 4BRPA 4DKWA 3LZJA 4PKHA 2I5JA 5C15A 5KTQA 3KIOA 4O4GA 1N33K 4JI7K 3AO2A 1Z25A 4CZLA 1TK8A 2B4JA 1XC9A 5AFUH 3DLHA 3BDPA 1NK5A 2KTQA 1WAFA 4DFJA 1TUUA 1RDCA 2F7TA 4GW6A 4M3ZA 3OYJA 5BR9A 4M41A 4CZGA 3HYFA 2UUAK 3O4WA 4AILC 3DLRA 3AA5X 4B1WB 3BGRA 2GUPA 1QVFM 3PY8A 1KXPA 1YXQA 3C65A 4W5OA 2IIRA 3DYAA 4I6MA 4OO1J 4CFBA 4CEZA 3O08A 1ASWA 1C0FA 5M1OA 4BC4A 1TAUA 1VQ7N 2D0OA 2VWBA 3BF3A 3LP1A 1JXEA 3VGKA 3WNHA 3IUCA 1ILYA 4DQRA 4B3SK 2E2NA 3RVCA 1MWMA 4FWRA 3EYZA 3UIQA 4K41A 2ASPA 4WF9L 4OLAA 4CJQA 3KD5E 1BUPA 2F9TA 1I94K 1BIZA 4CGGA 1DGKN 3CG7A 3CC4N 1C0MA 3SUPA 3ZEUA 3V6DA 2P9SB 1VSFA 3ZCMA 3THWA 1BU6O 2EHGA 5BREA 4CK1A 4JK8A 2OYQA 4DF4A 3EL2A 1TYQB 3CCEN 3PX6A 4RW7A 3P4IA 2OCEA 4OPJA 5HROA 1RDBA 3TAQA 3OYNA 4AH9A 4BQZA 4FVUA 2XO7A 3VQ5A 4FJ5A 4GKKK 5F1XA 3NVMA 4KHQA 4KB1A 1WNSA 3O9SA 3DOLA 3DAWA 4E7LA 4H5NA 3D2FA 3CMAN 4DR6K 4HCCA 4J8FA 4C8KA 4EZ9A 1YAGA 5I42A 3O9QA 2XRIA 1E3MA 1HX1A 2E88A 4C8NA 3CERA 1QVGM 2P9NB 3S3MA 5JLHA 1KFDA 4JKCA 1KAZA 2ASMA 3SBGA 4JS5A 5M1NA 3LDNA 1OH8A 3CJAA 5FRMA 4NXNK 1C0GA 3OS2A 1VQ8N 2NRXA 3P5JA 1QQCA 1GLEG 1RDUA 3DRSA 3E9LA 4CJ3A 1BIUA 1S1TA 2DFHA 4IG3A 1FJGK 3QEVA 2VYPA 3LAMA 4HTUA 3HT3A 1LWEA 2CH5A 4OKKA 4E89A 3NGIA 1IJJA 3K9KA 2IDOA 3U8XA 3AVBA 1T7PA 4QAGA 1NGHA 4IO8A 4M63C 2KFNA 4YY3K 5A2QO 3SUQA 3NF9A 3CJBA 5MLCQ 2V52B 3OJUA 3L2QA 1JLBA 3D7EO 4DUZK 2ZGZA 4DV2K 4FYDA 1NU0A 1SKRA 1NWKA 4FW2A 3VQCA 4JI1K 4JI4K 4M3YA 4BDPA 4FSVA 3D45A 4N5SA 1VK0A 1YHQN 3OYAA 2X6SA 3SNNA 3F9KA 1BCOA 5KPZA 5AQIA 3VQEA 1RDAA 2GUIA 3VEZA 4OGEA 3V9UA 1UWBA 2GWJA 1Q7YO 3H3OB 2W40A 4BRFA 4I7FA 1ZBFA 4CF1A 4YORA 1KLNA 4BVOA 3N4PA 1VQNN 3NDKA 4KI4A 3VA3A 2QWOA 5T7BA 4JYAK 3D2EA 5CYMA 3SV4A 2BH1A 3L2WA 4Q5VA 2QK9A 5FPEA 3K0SA 4WQ4A 3P1GA 1VSMA 4CHNA 3CCSN 2XY8A 1XMOK 3IG1A 1A5WA 4KHUA 4JKEA 4DV4K 2HHVA 3WXKA 2HBJA 5CHIA 2DFEA 1NJWA 4YOYA 1FW6A 4BGAA 3AVIA 2OA8A 4E0DA 3ALYA 3AY9A 1KC8O 3AO5A 1IG8A 4MO5A 3TSPA 5KPTA 1D4XA 3VEXA 1EQYA 5SWMA 4RW6A 4CCHA 4HVJA 4JKAA 3HP9A 1N36K 1B9FA 3RR7A 4F2SA 3A5MC 3H46O 1L3SA 2KFZA 1C0TA 1QTMA 2HMIA 3ZSZA 1ATRA 2IGIA 4FJHA 2D0CA 3HL8A 3SPZA 5FPMA 2XY7A 4BREA 3A5OC 1N8RO 3JSMA 1VSKA 3FZMA 3FZLA 5J1EA 4IOXA 1BI4A 3ZT1A 3AVKA 3PLAA 3S3NA 3S41A 4HUGA 4A2BA 1WSEA 2YX6A 3TTCA 2AJQA 1XNQK 3ZX0A 4F4KA 2FBTA 3VEYA 4C8LA 1Z6RA 4B9VA 2QM1A 4DFKA 3UKRA 4WFNL 3O4NA 1U2VB 4JK9A 1XI1A 4KRFA 4CHQA 3E66A 3QEIA 2VQEK 4FZYA 4YNQA 2UUBK 4HCBA 2GWKA 4M45A 2WC9A 3QMLA 2YNFA 4X66K 4JKGB 3C6TA 1TKXA 4GV9A 3VA0A 4QS8A 4JI8K 2P9PA 1B92A 1ATNA 3C95A 1HYVA 1ZBLA 2VG6A 5CR4A 5C24A 1VQON 2G8WA 4PKIA 4DTRA 1GLFO 5KGWA 3CXCM 4V19S 1NGBA 2IOCA 1QZ5A 4FM1A 3MWTA 4IWVA 3ZLJA 2O8FA 2QI2A 5AQMA 2KQ2A 2IC3A 4O5FA 4FJ7A 3PO5A 1LOTB 1SKSA 4E7IA 4G9ZA 3BZKA 4WFAL 1VQLN 4IKFA 1QQOA 1RBSA 2ETJA 2P9UA 2PFUA 2GBZA 3O3GA 3SAFA 1W0HA 4ELUA 1Q9YA 5C25A 4AM7A 3QEWA 5KRSA 5JVGL 1IKWA 4RWTA 5BR8K 4IFEA 3DXMA 3HOSA 4OJRA 1S5JA 1WSJA 1BOTO 4FJNA 4I9LA 2Q36A 1NJIO 3NF6A 4RW4A 1OH7A 3JXUA 4JI5K 5DMRA 5CZ1A 4DQIA 2V51B 3MXMA 1TV6A 2A42A 3THXA 4JI3K 2DFFA 2ASOA 2YNIA 3IS9A 4A2AA 1KCFA 4J2DA 3U3GA 4L3QA 4LF9K 4CIEA 1T6CA 1S22A 3K58A 3O5BA 4BRAA 4BDZA 3L2UA 4CHZA 1QZ6A 3OBWA 2WBNA 4JKHA 5ADXH 3LDSA 4CF8A 3J7AP 3L6QA 3T3FA 2ZJPL 1C6VA 3VQQA 4A5AA 1DTQA 4X65K 2RKIA 3AVMA 2P9IB 2H3GX 3Q7CA 3NGYA 3QICA 4CEFA 3WNGA 3M8RA 1UA1A 1RNHA 4E1MA 5C2DA 5GAGP 3M6GA 1KLMA 3U9DA 1OVQA 4KB0A 4PHTX 5LJWA 4ZTJA 1VQMN 1RBUA 1U49A 3QNOA 3AV9A 4BR5A 3K5LA 3KLIA 3OYEA 5AR0A 4BACA 3O1WA 4I2PA 3V9ZA 4YOVA 3IDHA 4QS7A 4B3RK 3TSUA 3I8BA 1LAWA 3UKUA 4FM0A 5J2NA 2X6NA 5K14A 4A62A 4M3XA 4FOIA 5AFUA 1HPMA 1KVBA 5DM6L 1S9GA 3VF2A 2HF4A 1G99A 1A5VA 4JKFA 3H3NO 4B1UB 4HHTA 3MCPA 3HTVA 4LD0A 3SUNA 3I56N 4FLZA 2WFBA 4U7BA 1UA0A 3HSTB 1SL1A 4FZZA 4NYNA 3V9WA 4WE1A 3P39A 3RWUA 4E7HA 4FLVA 4M3RA 4CGHA 1HNXK 4FK2A 3U4LA 4BROA 3QEXA 1IG9A 3SMSA 2RF2A 2XY5A 3AVNA 3N4QA 4BE2A 1U04A 2X74A 4GY2B 2Y1IA 5BPMA 4DS5A 3TR8A 3F9MA 1GOBA 1D9FA 1GLJO 1L5UA 4FWMA 3WNFA 3OYFA 3JS6A 4KV8A 4GV6A 4CHOA 2IVOA 2P9SA 3Q7BA 1RDDA 4KH6A 3ZSVA 1TYQA 2KHOA 3CFPA 1JLEA 1IKXA 3TTFA 4WQ4C 5CZ2A 1TL1A 1WLJA 3VQBA 3AA4A 4DTPA 1C1BA 2UUCK 2JWLA 1BQNA 3FZKA 4FO0A 3MAQA 3ZX3A 3QO9A 4HUEA 2D1KA 5HRRA 3TAPA 4F2RA 5JMVA 3E9PA 4CESA 3AGKA 4XH4A 5AZIB 2E8AA 5GIPA 2BDPA 2O8EB 2HHWA 3KLFA 4DTUA 2P9NA 4EHUA 3A5NC 3LDLA 3PIPL 3I33A 4JK7A 5TKWA 4WCEL 3HVRA 1RBVA 3PUFA 1BHLA 1W9HA 2EWSA 2G8KA 4KTQA 1UAXA 1K6YA 2RN2A 3L4IA 1NGCA 2F8SA 3BEXA 5AQHA 4CZKA 3NFAA 3SJHA 3DRPA 3K59A 3VMFB 1LWCA 3LM2A 5BRHA 1NJYA 1SZ2A 3LP0A 3VGLA 4ILJA 4Q0BA 2IS3A 4ISFA 1V4TA 4YFUA 3MDQA 4DSJA 4DQPA 3ZYYX 4AF1A 3HPOA 2KLAA 1U4BA 4DU1A 3PSIA 2CH6A 1HQUA 3C6HA 5D3GA 3B8AX 2A1SA 4CJVA 5GAHP 4R79A 3H1VX 3DOKA 4IO9L 3A8YA 3MN7A 3F2KA 1N5YA 3E01A 4FXDA 3WXJA 3VQDA 4FJ9A 2UXCK 1OH5A 3IRXA 4WFBL 3K57A 4C23A 2P9LB 4FWNA 4CJKA 5BN8A 5F0XA 3J8AA 2ZM6K 4L8RB 1G15A 3AGRA 4FJJA 4O55A 1RCHA 4BC5A 3HZ6A 3K5NA 3WNEA 2VWKA 4HWIA 3M5RA 5KQ8A 3SUOA 4XEIA 3UB5A 3CCRN 1RT2A 4FZXC 2IAJA 1K9MO 3V1RA 1YUWA 5KRTA 1NK6A 2FBYA 4KFBA 2ZD1A 1Z26A 2XY6A 3NF7A 4CZMA 4LSLA 1BL3A 2VG5A 2B6AA 2BUPA 4KBOA 1LAVA 3J7YP 2QKKA 1GLDG 4JLHA 1EETA 1T3VA 1ZBSA 1BDGA 3KKRA 3ZETB 4BR0A 2OPSA 2HHSA 3S3OA 3HRGA 1LWFA 4DTMA 2BANA 5GADP 4CBXA 2KZZA 1KVAA 3CM5A 4DF8A 2OTLN 2QWQA 4CJPA 3LWMA 3DMJA 4KHSA 4JAXA 3OHRA 3L3UA 4H0XB 2PY5A 3C0BA 2LSNA 2X78A 4HTLA 1TKTA 1HLUA 4AHTA 4B9MA 3NCIA 1RTDA 2YHXA 1NK0A 4B9TA 2DY4A 1XHXA 3DLKA 3HK2A 4W5TA 4FJIA 2I7PA 4IZ9A 1DTTA 3ULDA 3KK3A 1E4GT 3MEGA 2FXUA 4OPAA 5FDLA 1IKYA 2HBLA 5J2QA 4Z4FA 2A41A 4C1NK 3LALA 4E1JA 4FPBA 3L2VA 4LH4A 2YJEA 3H1QA 1SV5A 3AAQA 3QDKA 2ZJRL 3AVGA 2O8BB 3KLHA 3U6FA 5KGXA 4M7XA 1S3XA 4NCGA 3OS0A 3SAGA 1HUXA 1VSHA 3MXIA 2IVNA 3RRHA 2G8HA 1IV0A 3VOVA 1U2VA 5I3UA 3CD6N 2PYLA 4AHCA 3EY1A 2F4VK 4CJLA 4KAZA 2AP1A 3SLCA 3G10A 1N6QA 2O8CB 4E1NA 1TK0A 4JKGA 3VTHA 4BGBA 1DLOA 5BPLA 4B9UA 4FJKA 3G25A 4QCLA 4BE1A 3H08A 4YOUA 3AVFA 3SI6A 1C1AA 4M3TA 4PKGA 3DI6A 1Z05A 4X62K 4DSLA 4DQQA 1WSIA 5GINA 3DLGA 5HP1A 3OYIA 4J2BA 4J2EA 3AVCA 1YT3A 3RMDA 3HPGA 1YJ9N 3RMCA 1VSJA 3CPWM 4CF0A 3TWHA 4CEDA 4O8UA 4CK3A 3QIPA 4H8KA 5H1SQ 2YNGA 4LF5K 4RW9A 3QERA 3MXJA 4CGDA 4O0IA 4IOCL 4OVLA 2ZWHA 1CLQA 4IOAL 4IEIA 1S6QA 3EKSA 5B8HA 4K25A 2P9KB 3AO1A 5AZJB 3WT0A 3CF5L
chains in the Genus database with same CATH topology
2UXDK 1HNWK 1FJGK 1HR0K 1N36K 4DR4K 4LF8K 2UU9K 1XMQK 1HNXK 4CW7B 5BR8K 3T1YK 1N32K 4K0KK 3J81O 4YY3K 4DV5K 5A2QO 4JI5K 4AQYK 4B3SK 4DV7K 4JI3K 1J5EK 2UXBK 4DV1K 4OX9K 2UXCK 4DUYK 5IT9O 5FLXO 4DUZK 4DR7K 4CVNE 4DV2K 4LF9K 1N34K 1I94K 2ZM6K 4KHPK 5LMUK 1XNQK 4B3TK 3JAMO 2F4VK 4JI1K 4JI4K 4B3MK 3J7AP 5LMNK 4LF4K 4LFAK 4GKJK 5AJ3K 4X65K 4JV5K 1IBLK 2VQEK 2UUBK 4DR3K 4JI0K 3OTOK 4DR1K 2UUCK 4LF6K 4X66K 4JI6K 4DV6K 1HNZK 1IBMK 4X62K 2E5LK 5LL6Z 4LFCK 4JI8K 3J7YP 4GKKK 4YHHK 3T1HK 4DV0K 5IWAK 4LF7K 4JYAK 4B3RK 3J80O 4DR6K 4V19S 1XMOK 4NXMK 4LF5K 1XNRK 1N33K 1IBKK 4JI7K 4DV4K 4LFBK 2VQFK 4DV3K 4DR2K 4NXNK 4X64K 4DR5K 4JI2K 2UUAK 2HHHK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD K;  1HNW K;  1FJG K;  1HR0 K;  1N36 K;  4DR4 K;  4LF8 K;  2UU9 K;  1XMQ K;  1HNX K;  4CW7 B;  5BR8 K;  3T1Y K;  1N32 K;  4K0K K;  3J81 O;  4YY3 K;  4DV5 K;  5A2Q O;  4JI5 K;  4AQY K;  4B3S K;  4DV7 K;  4JI3 K;  1J5E K;  2UXB K;  4DV1 K;  4OX9 K;  2UXC K;  4DUY K;  5IT9 O;  5FLX O;  4DUZ K;  4DR7 K;  4CVN E;  4DV2 K;  4LF9 K;  1N34 K;  1I94 K;  2ZM6 K;  4KHP K;  5LMU K;  1XNQ K;  4B3T K;  3JAM O;  2F4V K;  4JI1 K;  4JI4 K;  4B3M K;  3J7A P;  5LMN K;  4LF4 K;  4LFA K;  4GKJ K;  5AJ3 K;  4X65 K;  4JV5 K;  1IBL K;  2VQE K;  2UUB K;  4DR3 K;  4JI0 K;  3OTO K;  4DR1 K;  2UUC K;  4LF6 K;  4X66 K;  4JI6 K;  4DV6 K;  1HNZ K;  1IBM K;  4X62 K;  2E5L K;  5LL6 Z;  4LFC K;  4JI8 K;  3J7Y P;  4GKK K;  4YHH K;  3T1H K;  4DV0 K;  5IWA K;  4LF7 K;  4JYA K;  4B3R K;  3J80 O;  4DR6 K;  4V19 S;  1XMO K;  4NXM K;  4LF5 K;  1XNR K;  1N33 K;  1IBK K;  4JI7 K;  4DV4 K;  4LFB K;  2VQF K;  4DV3 K;  4DR2 K;  4NXN K;  4X64 K;  4DR5 K;  4JI2 K;  2UUA K;  2HHH K; 
#chains in the Genus database with same CATH topology
 1M90 O;  4CD3 A;  2O8D B;  4N76 A;  2HNY A;  3KJV A;  2PZS A;  1HKB A;  1NGF A;  3PO4 A;  4R5P A;  4DG1 A;  3OYM A;  5AQR A;  3QIN A;  2W6L A;  3EO3 A;  3WQU A;  1VHX A;  1WSF A;  4IJN A;  4FJG A;  4Z94 A;  3O8M A;  4DHY A;  3M8Q A;  1YI2 N;  5AQK A;  5HBM A;  4A57 A;  3OYB A;  1WUA A;  4CHY A;  4JN4 A;  4DV5 K;  1F21 A;  2YKM A;  4CIF A;  4H4O A;  1RT1 A;  2DPN A;  1NK7 A;  2HST A;  3O9T A;  1IO2 A;  4XH5 A;  2V7Y A;  1Y97 A;  2G8I A;  2P9I A;  1TKD A;  3VES A;  1SKW A;  3TAF A;  4NLC A;  5ADX A;  4FWS A;  2FSJ A;  3V81 A;  5AJ3 K;  4B9N A;  1Q9X A;  3GG4 A;  4DLE A;  3MK6 A;  1YJW N;  1IBL K;  3ZT3 A;  3O6W A;  4IEE A;  4BC3 A;  1NKE A;  2A40 A;  4OPH A;  4DR1 K;  2A6A A;  3MEC A;  1NJX A;  4JI6 K;  4DV6 K;  2YHW A;  2A1R A;  3WQT A;  3HBT A;  2V7Z A;  4GNI A;  2QWL A;  4FOE A;  4YHH K;  5HRP A;  4CEA A;  3T1H K;  4KHY A;  3HJF A;  3ZSY A;  4F3O A;  1Y64 A;  1NM1 A;  2FBX A;  1NBW A;  4O5B A;  1NNE A;  3O3F A;  1VQ9 N;  4H4M A;  4PWD A;  3SQ1 A;  3V1O A;  1TVR A;  4NCA A;  2Z1I A;  4H0Y B;  1ATS A;  3ZX2 A;  4GMJ B;  1TAQ A;  3LDQ A;  3WEE B;  4YOX A;  3JYT A;  3TTD A;  3GOI A;  3VTI A;  4PUO A;  4CIG A;  1BGX T;  2ZGY A;  3G4S N;  3SJJ A;  2Z1H A;  4JKD A;  2Q0R A;  3H6E A;  1NMD A;  1NGD A;  2HHH K;  5AQU A;  2HB5 A;  1GLL O;  4IBN A;  1NK4 A;  2UXD K;  3TU5 A;  1SAZ A;  3VEV A;  1ZXO A;  3NH0 A;  4ILH A;  1NG9 A;  1JLF A;  1N32 K;  3E9O A;  2P5O A;  3B6P A;  5C42 A;  4IDK A;  3DJC A;  3I0R A;  3SMP A;  2G8F A;  3SYZ A;  3AVJ A;  4EFH A;  3NVK A;  4H5V A;  2PAV A;  2QWN A;  3FFI A;  3C6U A;  3R1X A;  2P51 A;  1M1K O;  3ULE B;  1JKH A;  4DV7 K;  2NRV A;  1CZA N;  3DXK B;  1OH6 A;  1J9A A;  1NGI A;  1NGA A;  3KD1 E;  3DWL A;  4MLE A;  2OPP A;  4K43 A;  1KAX A;  5KQD A;  3HOT A;  2PBD A;  5AQP A;  1K8K B;  4CEC A;  2GEM A;  3FZH A;  2E6M A;  5FRO A;  1QE1 A;  1JCG A;  4BR2 A;  2VCP A;  1O13 A;  5E41 A;  3WXI A;  3K5M A;  2HVI A;  4K42 A;  4K8Z A;  3CJ7 A;  4JI0 K;  3OTO K;  4M3W A;  3G6E N;  1UOC A;  5AZI A;  2HHX A;  4YOW A;  1NK8 A;  2O8E A;  4KKO A;  2J4R A;  5E84 A;  4Z0U A;  3HP6 A;  3CI5 A;  1XQS C;  5J2P A;  4DTJ A;  4RW8 A;  1KRP A;  3M1F A;  4DSI A;  4CGF A;  1DEJ A;  4EP4 A;  4OLB A;  1RT3 A;  3CIP A;  3U9Z A;  3J80 O;  4PY5 A;  3AAP A;  4BRM A;  3L4Q A;  1HMV A;  4RCH A;  4W5Q A;  2OZS A;  4CBW A;  3FZF A;  2VQF K;  4B9L A;  2YV0 X;  4FLT A;  4AHV A;  4ISE A;  3OYK A;  4FK4 A;  4JHD B;  4CJ7 A;  1TGO A;  1S1W A;  2Q31 A;  5C12 A;  3QBX A;  4DR2 K;  3TI0 A;  4IXC A;  4FLW A;  2QXF A;  2DTU A;  4QS9 A;  1MDU B;  1YIJ N;  1NGG A;  4BRI A;  4ID5 A;  4NYF A;  4PQU A;  2YCH A;  2RHK A;  2HHT A;  1K8A O;  1CZB A;  3OVN A;  3R3L A;  2VG7 A;  1Q86 O;  5FPN A;  2O4I A;  1HYS A;  1TK5 A;  2HHU A;  3VQA A;  3J7Z O;  4HUF A;  3HXM A;  1HKG A;  2OAN A;  4CW7 B;  5JS1 A;  4CEQ A;  3LDO A;  2JGU A;  4E19 A;  1U45 A;  2FC0 A;  2P9L A;  1CXU A;  5JVH L;  3S9H A;  4IJA A;  2GV9 A;  5C10 A;  3RMB A;  2W6K A;  1XC3 A;  4TSX A;  5EVZ A;  2VWJ A;  4Z4I A;  1QHT A;  2HBK A;  4M42 A;  1HYZ A;  1EX4 A;  3LPT A;  5M1P A;  1QQN A;  1XHZ A;  1WN7 A;  2HOE A;  5J2M A;  1HQE A;  1SUQ A;  1RBR A;  3THY B;  4B3T K;  4DSK A;  3ENB A;  4F3T A;  1TL3 A;  4B1Z A;  4IFY A;  1BCM A;  4LF4 K;  1GLA G;  3HVT A;  1BA0 A;  1E4F T;  4DFM A;  3KK1 A;  2F9W A;  3IFR A;  1W97 L;  4BRC A;  3I0S A;  1O1W A;  5AQJ A;  3ZET A;  4UQG A;  1H1V A;  4CFC A;  1HNZ K;  1FKO A;  2E5L K;  3D0P A;  5HLF A;  5AQZ A;  4QOZ B;  1MA9 B;  2A3Z A;  1KTQ A;  5AQQ A;  4DWI A;  2YNH A;  3ZT0 A;  1BG3 A;  2D0P A;  3L0Q A;  3NBP A;  4FW1 A;  2HW3 A;  1K73 O;  3TSQ A;  4KRE A;  2ZF5 O;  1T05 A;  2CGK A;  2NNW A;  2CGL A;  3ZT2 A;  1VQ4 N;  5C0Y A;  1BQM A;  5EXW A;  4BVP A;  3CCL N;  4JI2 K;  5M1Q A;  4PA1 A;  1GLB G;  4C8O A;  4FWO A;  3QIO A;  4GVM A;  4ZTF A;  1YIT N;  4GVE A;  3VET A;  1XUP O;  2O8B A;  3K2P A;  4BDY A;  4Z4E A;  5AQO A;  3LZI A;  2ZQB A;  1WBB A;  4A61 A;  1ESV A;  3EZW A;  1JXB A;  4B8C A;  1SS6 A;  1WB9 A;  2Y1J A;  2WOM A;  4FWQ A;  2YHA A;  5FPD A;  4FWP A;  5AQX A;  1NLV A;  3P38 A;  3G71 N;  4OKE A;  5HRN A;  3LWL A;  4CEB A;  4MQ3 A;  4DCH A;  1J5O A;  1HJR A;  3OBY A;  2YKN A;  5FLX O;  4ID1 A;  3SQ4 A;  1P8Z A;  1VSE A;  2O8C A;  1NKC A;  3ID6 A;  4A59 A;  4FLX A;  3F73 A;  2Q97 A;  2BE2 A;  3OW2 M;  1Q82 O;  3VF4 A;  4CJ4 A;  2HNZ A;  1EWR A;  3C7N B;  1VQK N;  4LFA K;  4GKJ K;  3KWI A;  1LCU A;  5DK5 A;  1ASV A;  1QSS A;  3F5T A;  5JS2 A;  5BRD A;  4Z4H A;  2E20 A;  1R59 O;  4WQ5 A;  2NUB A;  1S1X A;  3R9P A;  1IKV A;  3TAB A;  1JLG A;  1IBM K;  1QHA A;  3MED A;  4DTX A;  1QSL A;  4Z4G A;  1XWL A;  2E1Z A;  3M8S A;  4K8X A;  4CD1 A;  4W5R A;  1VSI A;  3WXM B;  4YDU A;  2FBV A;  3QEP A;  2W42 A;  4M3U A;  3UKU B;  4DLG A;  3VEW A;  3CQX A;  4FWK A;  2E1Y A;  2GX9 A;  1D9D A;  4DU3 A;  3CM6 A;  1VSL A;  2CGJ A;  1HPZ A;  1S6P A;  4KHW A;  3TAR A;  2RE2 A;  1D5A A;  3SBT A;  1J53 A;  4AHU A;  4XIU A;  1JJ2 M;  1RT6 A;  1IBK K;  1HKC A;  2P9K A;  5AZJ A;  3CJ1 A;  3ATU A;  4W5N A;  1S1V A;  5LY3 A;  1ZBU A;  2O8D A;  4B08 A;  3ATV A;  2E2P A;  3KWG A;  3QBW A;  5EOY A;  4KTW A;  1C0U A;  3BUZ B;  3QLH A;  4JRP A;  2E6L A;  4CJU A;  3FLC O;  1P90 A;  5AQG A;  4BWJ A;  3I55 N;  2BGG A;  1BWF O;  1JCF A;  2R7Y A;  4JD2 B;  3OS1 A;  3NH2 A;  1FK9 A;  3ZSR A;  3AAR A;  3UE5 A;  1KSP A;  4LF8 K;  3VGM A;  4CGI A;  3DM2 A;  5BRF A;  3FFK B;  5EU7 A;  1WBD A;  4RTF D;  4CJS A;  4H0V B;  2E2Q A;  4ISG A;  3J81 O;  3MCA B;  3MN5 A;  3RRG A;  2Q1N A;  1RT4 A;  4H5R A;  1A5X A;  1Q18 A;  2VGM A;  3ENO A;  2NRH A;  2QA4 N;  4OX9 K;  4DUY K;  1NJZ A;  4DSF A;  4IFV A;  3BP8 A;  4DR7 K;  3CCM N;  4FJM A;  4EHT A;  3C94 A;  5AQF A;  4JEP A;  3KLE A;  3CFO A;  4B3M K;  4N41 A;  4H5T A;  3ZSX A;  5CY4 A;  3RSE B;  3O1B A;  2OPQ A;  1X9M A;  1WAJ A;  2Q0U A;  3BY5 A;  4H5W A;  2QWP A;  1LV5 A;  3SAH A;  4KH4 A;  5C2F A;  2YI1 A;  1L3V A;  3MN6 A;  4O8K A;  4DR3 K;  3ZT4 A;  5HRS A;  5EY4 A;  4ELV A;  5HOO A;  4BG8 A;  4NCB A;  3TPQ A;  1EP4 A;  3QET A;  3MX5 A;  1KQS M;  4BR7 A;  1QS4 A;  3HPH A;  3ZSQ A;  4CZF A;  3DRR A;  2B5J A;  3RTV A;  4DV0 K;  4E3S A;  1U47 A;  4CE9 A;  3CJC A;  3T1A A;  4LH5 A;  4MFB A;  1X9W A;  3WEE A;  5EX5 A;  3MN9 A;  1BO5 O;  4DSE A;  3HM8 A;  2HBM A;  2HND A;  2ITG A;  3SZ2 A;  4FWL A;  5AQN A;  4E7J A;  4DMN A;  3T69 A;  1EWQ A;  5CE3 A;  2KW4 A;  3HO1 A;  2UYT A;  3THV A;  1VRT A;  3KHY A;  1W2B M;  2QXL A;  3SQ0 A;  1ZC6 A;  3HSC A;  2FLO A;  1HRH A;  4PL7 A;  2NRZ A;  4PL8 A;  2QEX N;  4Y1D A;  3KLG A;  4BRQ A;  5GIO A;  3PV8 A;  1YJN N;  1NMN A;  4FPA A;  1HNW K;  4GV3 A;  1YVN A;  1NOZ A;  3ENH A;  4BRG A;  4KI6 A;  4EZ6 A;  2UU9 K;  2G8U A;  1XMQ K;  3RMA A;  3ASM A;  2HVH A;  3A2F A;  3GDQ A;  4CEO A;  3O80 A;  1V4S A;  2Z1G A;  3ULE A;  4MDB A;  4B3O A;  1KVC A;  2E4L A;  3DXK A;  4CJW A;  1EO1 A;  4I6M B;  4MDA A;  4UY8 O;  3VEN A;  4BE0 A;  1GLC G;  1YVU A;  2QTD A;  4CER A;  1KFS A;  4ILG B;  2HHQ A;  3PX4 A;  2KZM A;  1J54 A;  5CYQ A;  3NH1 A;  3V9X A;  4O0J A;  3AO4 A;  2PYJ A;  1JL2 A;  5JLF A;  3AA3 A;  1K8K A;  5E26 A;  1X9J A;  5AQV A;  1W7A A;  4AHR A;  3DLB A;  1DKG D;  4H03 B;  3V4I A;  3P83 D;  5AQL A;  1S72 N;  4U67 L;  1GOA A;  3SQ2 A;  1Q81 O;  3VEO A;  4DFP A;  4FJL A;  4CFD A;  5AQW A;  4N56 A;  1B9D A;  2D0A A;  4F9O A;  4CGJ A;  3ZEU B;  3IAY A;  1BIS A;  3MEE A;  2Q2R A;  3HM9 A;  1D8Y A;  2IVP A;  3CFR A;  1FXX A;  1Q8I A;  2XHB A;  4B9Q A;  3THW B;  1U6Z A;  3OYG A;  4LFC K;  4NB4 A;  1TUY A;  4CJ5 A;  2QWM A;  4JRQ A;  3VQ9 A;  3GE1 A;  1RT7 A;  4FCY A;  4BC2 A;  5IWA K;  4DTN A;  3CCU N;  3AA2 A;  4CJR A;  5FRN A;  1JL1 A;  4WYB A;  1RDW X;  2FF3 B;  3A5L C;  4DTO A;  4JHD A;  4OGC A;  1DT9 A;  3OYL A;  4ICL A;  3LL3 A;  3E1Y A;  1XNR K;  3CHW A;  3D6R A;  1HNV A;  3QFP A;  1T8E A;  5JIC A;  4AHS A;  2F96 A;  3VQ4 A;  3QB0 A;  3D2F B;  4CHP A;  2E2O A;  1HJO A;  3VQ8 A;  2JWK A;  2NRR A;  2A5X A;  1OVY A;  5M1K A;  3NF8 A;  3KTQ A;  3TAG A;  2Q3S A;  1I39 A;  4DU4 A;  4OPK A;  4Z4C A;  3EEQ A;  1VQP N;  4ELT A;  2HF3 A;  3EZ5 A;  3W0L A;  4XH1 A;  1X9S A;  1SL2 A;  5KPR A;  5AQT A;  2ZJQ L;  1X1P A;  3BF1 A;  5I9E B;  1NGJ A;  3ID8 A;  4LSN A;  4K0K K;  4WQ5 C;  2YHB A;  1CZ9 A;  3CQY A;  5BN9 A;  1JCE A;  3IMX A;  3CCQ N;  4Y1C A;  3THY A;  1J6Z A;  2BTF A;  1I3A A;  3M8P A;  4DV1 K;  2ATQ A;  4KHN A;  4YDU C;  3NHG A;  1S1U A;  1LW2 A;  3EE8 A;  2ITM A;  4EP5 A;  2QKB A;  3VER A;  1N34 K;  3L2R A;  2NLX A;  3DLL L;  1ZBH A;  1GOC A;  1T44 A;  3MMV A;  1VAZ A;  5LMN K;  2FSK A;  4B1Y B;  4BG9 A;  5LJV A;  3KK2 A;  5GAE P;  1YTA A;  4JKB A;  4BRD A;  3ZSW A;  4CEE A;  3O4Q A;  3KKS A;  4FVM A;  3B6O A;  4LF6 K;  5HL7 L;  2NRT A;  5LL6 Z;  4BRH A;  3SV3 A;  2O4G A;  4BRL A;  3LP2 A;  2AA4 A;  3AO3 A;  4EAH D;  2W41 A;  4JS4 A;  5SZT A;  4J2A A;  4I9Q A;  3LAN A;  3CET A;  4LF7 K;  3AVH A;  3RR8 A;  1T03 A;  1L3U A;  4OKJ A;  4M7Y A;  4CF2 A;  4A5B A;  2GTD A;  2D4W A;  1JLA A;  3KZB A;  3V1Q A;  4BWM A;  3D2E B;  4CF9 A;  4LFB K;  3CYM A;  4DQS A;  3HI0 A;  1SL0 A;  4AM6 A;  3T7Z A;  4KTZ A;  3CME N;  2D0B A;  3L3V A;  4NLB A;  4DR5 K;  3SCX A;  4FK0 A;  2RPI A;  3SPY A;  2YHY A;  2HMP A;  4CJT A;  1VRU A;  2NRW A;  3I8D A;  1NKB A;  1WOQ A;  1HR0 K;  3OYD A;  3LDP A;  1U48 A;  2OPR A;  1RTJ A;  3QNN A;  4DR4 K;  5AQY A;  2Z1J A;  4RG8 A;  1YTU A;  3T1Y K;  3OYH A;  3V9S A;  4C8M A;  1JLC A;  5M1F A;  4EIA A;  2WTU A;  1WSG A;  1NOY A;  2YJF A;  1WSH A;  4ZHR A;  4CBU A;  4FJX A;  5KI6 A;  3O9R A;  4MLH A;  1FKP A;  3LPU A;  3EKU A;  2UXB K;  1J5E K;  2G8V A;  4G1Q A;  4LY7 A;  3CC7 N;  1ZYQ A;  5IT9 O;  1CXQ A;  3TAM A;  2EX3 A;  3C7N A;  3LAK A;  4CK2 A;  4CVN E;  3EE9 A;  3VQP A;  4H0O A;  3KK7 A;  4H0T B;  3CCV N;  3O9U A;  3PSF A;  5LMU K;  2D5R A;  3WXL A;  3JAM O;  3CQ8 A;  3P31 A;  4IDH A;  1T6D A;  4BR4 A;  1VQ5 N;  1BI4 B;  4BRN A;  1SQK A;  5TKY A;  3L8B A;  3PIO L;  4JV5 K;  3SK3 A;  2QW9 A;  4F8R A;  2WUS A;  4DTS A;  1HNI A;  1ASU A;  2KKZ A;  3LM9 A;  1MU2 A;  4JNE A;  4FJ8 A;  1ZBI A;  3UKR B;  3CCJ N;  4E7K A;  1EXQ A;  1OKJ A;  3W3D A;  2F8T A;  1QQM A;  3TAN A;  3K5O A;  1C1C A;  1X3N A;  5AQS A;  1BA1 A;  4CJE A;  3G0Z A;  1RIL A;  4CZI A;  2P9P B;  1X3M A;  3MWP A;  4B8A B;  3QES A;  1KAY A;  2QWR A;  4NXM K;  3AVL A;  1QSY A;  1REV A;  3AVA A;  3NGZ A;  4DQ8 A;  4BR9 A;  4DV3 K;  4BY9 C;  2FSN A;  4FM2 A;  1S9E A;  4DB3 A;  4LC9 B;  3PX0 A;  1NGE A;  5BPN A;  4Y0W A;  4JD2 A;  4X64 K;  1RGI A;  3FGU A;  2P5G A;  1RT5 A;  3VPZ A;  2O8F B;  1ITG A;  5ELZ A;  3ZSO A;  4FL9 A;  3OY9 A;  1VSD A;  3KVG A;  4CJF A;  4N47 A;  3TAE A;  3H45 C;  2P9U B;  3OA9 A;  4KPY A;  3LP3 A;  3R8E A;  3VF6 A;  4MO4 A;  1MWK A;  4DS4 A;  1NK9 A;  4FLU A;  2GEL A;  4KO0 A;  3QFU A;  1RFQ A;  3VQ6 A;  3C6A A;  4B1X B;  5F2R A;  4BRK A;  1YF5 L;  3MX2 A;  4AQY K;  3OJS A;  1L3T A;  3DXM B;  1RTH A;  4H0P A;  3EN9 A;  3VN5 A;  2I7N A;  4CZJ A;  3CC2 N;  3RSE A;  3A0I X;  3CPE A;  3T19 A;  2NZT A;  1EKE A;  5DM7 L;  4KHP K;  3THX B;  3OYC A;  3BZC A;  3NAE A;  3R6M A;  1VQ6 N;  3GBT A;  3GL1 A;  3O3H A;  4BQL A;  3NMU A;  1JLQ A;  3M3Z A;  4CFA A;  4C1N I;  4NO7 A;  3WUH A;  1RTI A;  2OTJ N;  3CJ9 A;  3NE6 A;  2P1J A;  4B1V A;  1IH7 A;  3FR0 A;  4FLY A;  4B9S A;  3DLE A;  4KH5 A;  4CZH A;  3VQ7 A;  4YOT A;  4O44 A;  2ZE2 A;  3K9J A;  4I2Q A;  2WON A;  3U3Y A;  1R0A A;  2FF6 A;  1LW0 A;  4CZE A;  2JLE A;  3IKM A;  1KD1 O;  3FE1 A;  1TKZ A;  4IG0 A;  4CI6 A;  1RBT A;  2VGN A;  3ISN C;  3ITH A;  2OZM A;  4BRP A;  4DKW A;  3LZJ A;  4PKH A;  2I5J A;  5C15 A;  5KTQ A;  3KIO A;  4O4G A;  1N33 K;  4JI7 K;  3AO2 A;  1Z25 A;  4CZL A;  1TK8 A;  2B4J A;  1XC9 A;  5AFU H;  3DLH A;  3BDP A;  1NK5 A;  2KTQ A;  1WAF A;  4DFJ A;  1TUU A;  1RDC A;  2F7T A;  4GW6 A;  4M3Z A;  3OYJ A;  5BR9 A;  4M41 A;  4CZG A;  3HYF A;  2UUA K;  3O4W A;  4AIL C;  3DLR A;  3AA5 X;  4B1W B;  3BGR A;  2GUP A;  1QVF M;  3PY8 A;  1KXP A;  1YXQ A;  3C65 A;  4W5O A;  2IIR A;  3DYA A;  4I6M A;  4OO1 J;  4CFB A;  4CEZ A;  3O08 A;  1ASW A;  1C0F A;  5M1O A;  4BC4 A;  1TAU A;  1VQ7 N;  2D0O A;  2VWB A;  3BF3 A;  3LP1 A;  1JXE A;  3VGK A;  3WNH A;  3IUC A;  1ILY A;  4DQR A;  4B3S K;  2E2N A;  3RVC A;  1MWM A;  4FWR A;  3EYZ A;  3UIQ A;  4K41 A;  2ASP A;  4WF9 L;  4OLA A;  4CJQ A;  3KD5 E;  1BUP A;  2F9T A;  1I94 K;  1BIZ A;  4CGG A;  1DGK N;  3CG7 A;  3CC4 N;  1C0M A;  3SUP A;  3ZEU A;  3V6D A;  2P9S B;  1VSF A;  3ZCM A;  3THW A;  1BU6 O;  2EHG A;  5BRE A;  4CK1 A;  4JK8 A;  2OYQ A;  4DF4 A;  3EL2 A;  1TYQ B;  3CCE N;  3PX6 A;  4RW7 A;  3P4I A;  2OCE A;  4OPJ A;  5HRO A;  1RDB A;  3TAQ A;  3OYN A;  4AH9 A;  4BQZ A;  4FVU A;  2XO7 A;  3VQ5 A;  4FJ5 A;  4GKK K;  5F1X A;  3NVM A;  4KHQ A;  4KB1 A;  1WNS A;  3O9S A;  3DOL A;  3DAW A;  4E7L A;  4H5N A;  3D2F A;  3CMA N;  4DR6 K;  4HCC A;  4J8F A;  4C8K A;  4EZ9 A;  1YAG A;  5I42 A;  3O9Q A;  2XRI A;  1E3M A;  1HX1 A;  2E88 A;  4C8N A;  3CER A;  1QVG M;  2P9N B;  3S3M A;  5JLH A;  1KFD A;  4JKC A;  1KAZ A;  2ASM A;  3SBG A;  4JS5 A;  5M1N A;  3LDN A;  1OH8 A;  3CJA A;  5FRM A;  4NXN K;  1C0G A;  3OS2 A;  1VQ8 N;  2NRX A;  3P5J A;  1QQC A;  1GLE G;  1RDU A;  3DRS A;  3E9L A;  4CJ3 A;  1BIU A;  1S1T A;  2DFH A;  4IG3 A;  1FJG K;  3QEV A;  2VYP A;  3LAM A;  4HTU A;  3HT3 A;  1LWE A;  2CH5 A;  4OKK A;  4E89 A;  3NGI A;  1IJJ A;  3K9K A;  2IDO A;  3U8X A;  3AVB A;  1T7P A;  4QAG A;  1NGH A;  4IO8 A;  4M63 C;  2KFN A;  4YY3 K;  5A2Q O;  3SUQ A;  3NF9 A;  3CJB A;  5MLC Q;  2V52 B;  3OJU A;  3L2Q A;  1JLB A;  3D7E O;  4DUZ K;  2ZGZ A;  4DV2 K;  4FYD A;  1NU0 A;  1SKR A;  1NWK A;  4FW2 A;  3VQC A;  4JI1 K;  4JI4 K;  4M3Y A;  4BDP A;  4FSV A;  3D45 A;  4N5S A;  1VK0 A;  1YHQ N;  3OYA A;  2X6S A;  3SNN A;  3F9K A;  1BCO A;  5KPZ A;  5AQI A;  3VQE A;  1RDA A;  2GUI A;  3VEZ A;  4OGE A;  3V9U A;  1UWB A;  2GWJ A;  1Q7Y O;  3H3O B;  2W40 A;  4BRF A;  4I7F A;  1ZBF A;  4CF1 A;  4YOR A;  1KLN A;  4BVO A;  3N4P A;  1VQN N;  3NDK A;  4KI4 A;  3VA3 A;  2QWO A;  5T7B A;  4JYA K;  3D2E A;  5CYM A;  3SV4 A;  2BH1 A;  3L2W A;  4Q5V A;  2QK9 A;  5FPE A;  3K0S A;  4WQ4 A;  3P1G A;  1VSM A;  4CHN A;  3CCS N;  2XY8 A;  1XMO K;  3IG1 A;  1A5W A;  4KHU A;  4JKE A;  4DV4 K;  2HHV A;  3WXK A;  2HBJ A;  5CHI A;  2DFE A;  1NJW A;  4YOY A;  1FW6 A;  4BGA A;  3AVI A;  2OA8 A;  4E0D A;  3ALY A;  3AY9 A;  1KC8 O;  3AO5 A;  1IG8 A;  4MO5 A;  3TSP A;  5KPT A;  1D4X A;  3VEX A;  1EQY A;  5SWM A;  4RW6 A;  4CCH A;  4HVJ A;  4JKA A;  3HP9 A;  1N36 K;  1B9F A;  3RR7 A;  4F2S A;  3A5M C;  3H46 O;  1L3S A;  2KFZ A;  1C0T A;  1QTM A;  2HMI A;  3ZSZ A;  1ATR A;  2IGI A;  4FJH A;  2D0C A;  3HL8 A;  3SPZ A;  5FPM A;  2XY7 A;  4BRE A;  3A5O C;  1N8R O;  3JSM A;  1VSK A;  3FZM A;  3FZL A;  5J1E A;  4IOX A;  1BI4 A;  3ZT1 A;  3AVK A;  3PLA A;  3S3N A;  3S41 A;  4HUG A;  4A2B A;  1WSE A;  2YX6 A;  3TTC A;  2AJQ A;  1XNQ K;  3ZX0 A;  4F4K A;  2FBT A;  3VEY A;  4C8L A;  1Z6R A;  4B9V A;  2QM1 A;  4DFK A;  3UKR A;  4WFN L;  3O4N A;  1U2V B;  4JK9 A;  1XI1 A;  4KRF A;  4CHQ A;  3E66 A;  3QEI A;  2VQE K;  4FZY A;  4YNQ A;  2UUB K;  4HCB A;  2GWK A;  4M45 A;  2WC9 A;  3QML A;  2YNF A;  4X66 K;  4JKG B;  3C6T A;  1TKX A;  4GV9 A;  3VA0 A;  4QS8 A;  4JI8 K;  2P9P A;  1B92 A;  1ATN A;  3C95 A;  1HYV A;  1ZBL A;  2VG6 A;  5CR4 A;  5C24 A;  1VQO N;  2G8W A;  4PKI A;  4DTR A;  1GLF O;  5KGW A;  3CXC M;  4V19 S;  1NGB A;  2IOC A;  1QZ5 A;  4FM1 A;  3MWT A;  4IWV A;  3ZLJ A;  2O8F A;  2QI2 A;  5AQM A;  2KQ2 A;  2IC3 A;  4O5F A;  4FJ7 A;  3PO5 A;  1LOT B;  1SKS A;  4E7I A;  4G9Z A;  3BZK A;  4WFA L;  1VQL N;  4IKF A;  1QQO A;  1RBS A;  2ETJ A;  2P9U A;  2PFU A;  2GBZ A;  3O3G A;  3SAF A;  1W0H A;  4ELU A;  1Q9Y A;  5C25 A;  4AM7 A;  3QEW A;  5KRS A;  5JVG L;  1IKW A;  4RWT A;  5BR8 K;  4IFE A;  3DXM A;  3HOS A;  4OJR A;  1S5J A;  1WSJ A;  1BOT O;  4FJN A;  4I9L A;  2Q36 A;  1NJI O;  3NF6 A;  4RW4 A;  1OH7 A;  3JXU A;  4JI5 K;  5DMR A;  5CZ1 A;  4DQI A;  2V51 B;  3MXM A;  1TV6 A;  2A42 A;  3THX A;  4JI3 K;  2DFF A;  2ASO A;  2YNI A;  3IS9 A;  4A2A A;  1KCF A;  4J2D A;  3U3G A;  4L3Q A;  4LF9 K;  4CIE A;  1T6C A;  1S22 A;  3K58 A;  3O5B A;  4BRA A;  4BDZ A;  3L2U A;  4CHZ A;  1QZ6 A;  3OBW A;  2WBN A;  4JKH A;  5ADX H;  3LDS A;  4CF8 A;  3J7A P;  3L6Q A;  3T3F A;  2ZJP L;  1C6V A;  3VQQ A;  4A5A A;  1DTQ A;  4X65 K;  2RKI A;  3AVM A;  2P9I B;  2H3G X;  3Q7C A;  3NGY A;  3QIC A;  4CEF A;  3WNG A;  3M8R A;  1UA1 A;  1RNH A;  4E1M A;  5C2D A;  5GAG P;  3M6G A;  1KLM A;  3U9D A;  1OVQ A;  4KB0 A;  4PHT X;  5LJW A;  4ZTJ A;  1VQM N;  1RBU A;  1U49 A;  3QNO A;  3AV9 A;  4BR5 A;  3K5L A;  3KLI A;  3OYE A;  5AR0 A;  4BAC A;  3O1W A;  4I2P A;  3V9Z A;  4YOV A;  3IDH A;  4QS7 A;  4B3R K;  3TSU A;  3I8B A;  1LAW A;  3UKU A;  4FM0 A;  5J2N A;  2X6N A;  5K14 A;  4A62 A;  4M3X A;  4FOI A;  5AFU A;  1HPM A;  1KVB A;  5DM6 L;  1S9G A;  3VF2 A;  2HF4 A;  1G99 A;  1A5V A;  4JKF A;  3H3N O;  4B1U B;  4HHT A;  3MCP A;  3HTV A;  4LD0 A;  3SUN A;  3I56 N;  4FLZ A;  2WFB A;  4U7B A;  1UA0 A;  3HST B;  1SL1 A;  4FZZ A;  4NYN A;  3V9W A;  4WE1 A;  3P39 A;  3RWU A;  4E7H A;  4FLV A;  4M3R A;  4CGH A;  1HNX K;  4FK2 A;  3U4L A;  4BRO A;  3QEX A;  1IG9 A;  3SMS A;  2RF2 A;  2XY5 A;  3AVN A;  3N4Q A;  4BE2 A;  1U04 A;  2X74 A;  4GY2 B;  2Y1I A;  5BPM A;  4DS5 A;  3TR8 A;  3F9M A;  1GOB A;  1D9F A;  1GLJ O;  1L5U A;  4FWM A;  3WNF A;  3OYF A;  3JS6 A;  4KV8 A;  4GV6 A;  4CHO A;  2IVO A;  2P9S A;  3Q7B A;  1RDD A;  4KH6 A;  3ZSV A;  1TYQ A;  2KHO A;  3CFP A;  1JLE A;  1IKX A;  3TTF A;  4WQ4 C;  5CZ2 A;  1TL1 A;  1WLJ A;  3VQB A;  3AA4 A;  4DTP A;  1C1B A;  2UUC K;  2JWL A;  1BQN A;  3FZK A;  4FO0 A;  3MAQ A;  3ZX3 A;  3QO9 A;  4HUE A;  2D1K A;  5HRR A;  3TAP A;  4F2R A;  5JMV A;  3E9P A;  4CES A;  3AGK A;  4XH4 A;  5AZI B;  2E8A A;  5GIP A;  2BDP A;  2O8E B;  2HHW A;  3KLF A;  4DTU A;  2P9N A;  4EHU A;  3A5N C;  3LDL A;  3PIP L;  3I33 A;  4JK7 A;  5TKW A;  4WCE L;  3HVR A;  1RBV A;  3PUF A;  1BHL A;  1W9H A;  2EWS A;  2G8K A;  4KTQ A;  1UAX A;  1K6Y A;  2RN2 A;  3L4I A;  1NGC A;  2F8S A;  3BEX A;  5AQH A;  4CZK A;  3NFA A;  3SJH A;  3DRP A;  3K59 A;  3VMF B;  1LWC A;  3LM2 A;  5BRH A;  1NJY A;  1SZ2 A;  3LP0 A;  3VGL A;  4ILJ A;  4Q0B A;  2IS3 A;  4ISF A;  1V4T A;  4YFU A;  3MDQ A;  4DSJ A;  4DQP A;  3ZYY X;  4AF1 A;  3HPO A;  2KLA A;  1U4B A;  4DU1 A;  3PSI A;  2CH6 A;  1HQU A;  3C6H A;  5D3G A;  3B8A X;  2A1S A;  4CJV A;  5GAH P;  4R79 A;  3H1V X;  3DOK A;  4IO9 L;  3A8Y A;  3MN7 A;  3F2K A;  1N5Y A;  3E01 A;  4FXD A;  3WXJ A;  3VQD A;  4FJ9 A;  2UXC K;  1OH5 A;  3IRX A;  4WFB L;  3K57 A;  4C23 A;  2P9L B;  4FWN A;  4CJK A;  5BN8 A;  5F0X A;  3J8A A;  2ZM6 K;  4L8R B;  1G15 A;  3AGR A;  4FJJ A;  4O55 A;  1RCH A;  4BC5 A;  3HZ6 A;  3K5N A;  3WNE A;  2VWK A;  4HWI A;  3M5R A;  5KQ8 A;  3SUO A;  4XEI A;  3UB5 A;  3CCR N;  1RT2 A;  4FZX C;  2IAJ A;  1K9M O;  3V1R A;  1YUW A;  5KRT A;  1NK6 A;  2FBY A;  4KFB A;  2ZD1 A;  1Z26 A;  2XY6 A;  3NF7 A;  4CZM A;  4LSL A;  1BL3 A;  2VG5 A;  2B6A A;  2BUP A;  4KBO A;  1LAV A;  3J7Y P;  2QKK A;  1GLD G;  4JLH A;  1EET A;  1T3V A;  1ZBS A;  1BDG A;  3KKR A;  3ZET B;  4BR0 A;  2OPS A;  2HHS A;  3S3O A;  3HRG A;  1LWF A;  4DTM A;  2BAN A;  5GAD P;  4CBX A;  2KZZ A;  1KVA A;  3CM5 A;  4DF8 A;  2OTL N;  2QWQ A;  4CJP A;  3LWM A;  3DMJ A;  4KHS A;  4JAX A;  3OHR A;  3L3U A;  4H0X B;  2PY5 A;  3C0B A;  2LSN A;  2X78 A;  4HTL A;  1TKT A;  1HLU A;  4AHT A;  4B9M A;  3NCI A;  1RTD A;  2YHX A;  1NK0 A;  4B9T A;  2DY4 A;  1XHX A;  3DLK A;  3HK2 A;  4W5T A;  4FJI A;  2I7P A;  4IZ9 A;  1DTT A;  3ULD A;  3KK3 A;  1E4G T;  3MEG A;  2FXU A;  4OPA A;  5FDL A;  1IKY A;  2HBL A;  5J2Q A;  4Z4F A;  2A41 A;  4C1N K;  3LAL A;  4E1J A;  4FPB A;  3L2V A;  4LH4 A;  2YJE A;  3H1Q A;  1SV5 A;  3AAQ A;  3QDK A;  2ZJR L;  3AVG A;  2O8B B;  3KLH A;  3U6F A;  5KGX A;  4M7X A;  1S3X A;  4NCG A;  3OS0 A;  3SAG A;  1HUX A;  1VSH A;  3MXI A;  2IVN A;  3RRH A;  2G8H A;  1IV0 A;  3VOV A;  1U2V A;  5I3U A;  3CD6 N;  2PYL A;  4AHC A;  3EY1 A;  2F4V K;  4CJL A;  4KAZ A;  2AP1 A;  3SLC A;  3G10 A;  1N6Q A;  2O8C B;  4E1N A;  1TK0 A;  4JKG A;  3VTH A;  4BGB A;  1DLO A;  5BPL A;  4B9U A;  4FJK A;  3G25 A;  4QCL A;  4BE1 A;  3H08 A;  4YOU A;  3AVF A;  3SI6 A;  1C1A A;  4M3T A;  4PKG A;  3DI6 A;  1Z05 A;  4X62 K;  4DSL A;  4DQQ A;  1WSI A;  5GIN A;  3DLG A;  5HP1 A;  3OYI A;  4J2B A;  4J2E A;  3AVC A;  1YT3 A;  3RMD A;  3HPG A;  1YJ9 N;  3RMC A;  1VSJ A;  3CPW M;  4CF0 A;  3TWH A;  4CED A;  4O8U A;  4CK3 A;  3QIP A;  4H8K A;  5H1S Q;  2YNG A;  4LF5 K;  4RW9 A;  3QER A;  3MXJ A;  4CGD A;  4O0I A;  4IOC L;  4OVL A;  2ZWH A;  1CLQ A;  4IOA L;  4IEI A;  1S6Q A;  3EKS A;  5B8H A;  4K25 A;  2P9K B;  3AO1 A;  5AZJ B;  3WT0 A;  3CF5 L; 
#chains in the Genus database with same CATH homology
 2UXD K;  1HNW K;  1FJG K;  1HR0 K;  1N36 K;  4DR4 K;  4LF8 K;  2UU9 K;  1XMQ K;  1HNX K;  4CW7 B;  5BR8 K;  3T1Y K;  1N32 K;  4K0K K;  3J81 O;  4YY3 K;  4DV5 K;  5A2Q O;  4JI5 K;  4AQY K;  4B3S K;  4DV7 K;  4JI3 K;  1J5E K;  2UXB K;  4DV1 K;  4OX9 K;  2UXC K;  4DUY K;  5IT9 O;  5FLX O;  4DUZ K;  4DR7 K;  4CVN E;  4DV2 K;  4LF9 K;  1N34 K;  1I94 K;  2ZM6 K;  4KHP K;  5LMU K;  1XNQ K;  4B3T K;  3JAM O;  2F4V K;  4JI1 K;  4JI4 K;  4B3M K;  3J7A P;  5LMN K;  4LF4 K;  4LFA K;  4GKJ K;  5AJ3 K;  4X65 K;  4JV5 K;  1IBL K;  2VQE K;  2UUB K;  4DR3 K;  4JI0 K;  3OTO K;  4DR1 K;  2UUC K;  4LF6 K;  4X66 K;  4JI6 K;  4DV6 K;  1HNZ K;  1IBM K;  4X62 K;  2E5L K;  5LL6 Z;  4LFC K;  4JI8 K;  3J7Y P;  4GKK K;  4YHH K;  3T1H K;  4DV0 K;  5IWA K;  4LF7 K;  4JYA K;  4B3R K;  3J80 O;  4DR6 K;  4V19 S;  1XMO K;  4NXM K;  4LF5 K;  1XNR K;  1N33 K;  1IBK K;  4JI7 K;  4DV4 K;  4LFB K;  2VQF K;  4DV3 K;  4DR2 K;  4NXN K;  4X64 K;  4DR5 K;  4JI2 K;  2UUA K;  2HHH K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...