1IBLK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1iblK00
4JI5K 4JI4K 1N34K 4X65K 4NXMK 3J7AP 4AQYK 4GKKK 4YHHK 4LFAK 4LF7K 5FLXO 3T1HK 4JI0K 2VQFK 4JI7K 4DV6K 4DR2K 2ZM6K 2UXDK 4DV7K 5IT9O 4K0KK 2UUCK 4X66K 2UXBK 1IBMK 4LF8K 5BR8K 4LF4K 1J5EK 4JYAK 1XNQK 1IBKK 1XNRK 4DR1K 4JI2K 4JV5K 4DUYK 4B3RK 4DR7K 2UUBK 4B3TK 4DR4K 3J81O 4CVNE 4KHPK 4JI1K 5LL6Z 1HNZK 5LMUK 4DV2K 1HNWK 3OTOK 3JAMO 4GKJK 4B3SK 1N36K 2HHHK 3J80O 1XMQK 4DUZK 4DR5K 4JI3K 1N33K 3T1YK 1I94K 4DV0K 1IBLK 4DV1K 2F4VK 4JI6K 4DV5K 4DV4K 2UXCK 4V19S 3J7YP 4X62K 4LF6K 1XMOK 4LF5K 4CW7B 4B3MK 5A2QO 5LMNK 4LFBK 2E5LK 4DV3K 4OX9K 4NXNK 1FJGK 4LF9K 4JI8K 1N32K 1HR0K 5IWAK 2VQEK 2UUAK 2UU9K 4DR6K 4YY3K 4DR3K 4X64K 1HNXK 4LFCK 5AJ3K
chains in the Genus database with same CATH superfamily
4JN4A 4Z4GA 1B9DA 4DQSA 3NE6A 5JS2A 1HMVA 4JKFA 2G8UA 3M3ZA 2FBYA 1D4XA 2ZQBA 1IJJA 2P9UA 4DTSA 4IO8A 1QQMA 3IG1A 3M1FA 1DT9A 4FK4A 1G99A 1YJNN 1YUWA 3THYA 4NLCA 3LL3A 4JKDA 2ZM6K 1BISA 4I2PA 1BDGA 1JXBA 1C0GA 4X66K 3FZKA 4GV6A 3GG4A 4GY2B 1JLCA 2D0AA 4JHDA 3ZSYA 4O44A 1YI2N 2WONA 5LJWA 2GEMA 4DTMA 1XC9A 4CEOA 1RBTA 3VETA 3BP8A 2NRZA 5KPRA 1D5AA 4CJSA 2CGJA 1WSFA 1HYVA 2NRTA 3AVJA 4B9MA 4KHPK 3OYFA 3KZBA 1TVRA 4FLTA 2VG7A 4GW6A 4A5AA 3QEVA 2GBZA 5K14A 4FWKA 4KHWA 3KJVA 4Q5VA 4BR4A 3VESA 1BO5O 3OYJA 3SQ4A 4CHOA 4BC2A 3RMAA 3O9UA 4Q0BA 5GIOA 4FJ9A 1A5WA 3H45C 1U4BA 1T44A 3AV9A 1VRTA 3QBWA 3MXJA 5AQQA 5JMVA 1LWCA 1RDBA 2HF4A 5AQHA 3K9JA 3MX2A 3OBWA 3NDKA 4DV5K 2NRHA 2YHXA 1NGAA 4CEDA 2FSJA 2HHUA 2QTDA 4X62K 3TPQA 4A59A 1NK6A 2YKNA 2A5XA 3WXIA 2E5LK 4O4GA 4M3ZA 3MECA 3I0RA 3O1BA 4BRCA 1IKVA 3O6WA 5HLFA 5CR4A 4ELTA 3FE1A 4LF9K 4FJIA 2YI1A 1VQMN 4AILC 1QSYA 2P9SB 1TYQA 1ZBUA 2QWMA 4N41A 3F9MA 2D0OA 3VMFB 4PQUA 1EWRA 3CJAA 2G8IA 4H0PA 1NLVA 3SBGA 3FZLA 3QNOA 1JKHA 1J9AA 1OKJA 5ELZA 3J8AA 3V4IA 3A5NC 3AO4A 1JCEA 1J54A 4PL8A 1BIUA 3AA3A 1QQOA 1RDWX 3AVAA 3THWA 1CXUA 2P51A 5HROA 3ZSVA 4BRPA 3TI0A 1DKGD 4E1JA 1HJOA 4YNQA 1JLQA 3K5LA 4KAZA 2FSKA 3WQUA 4H0YB 5F1XA 1IBMK 2I5JA 3AVHA 5AFUH 3SK3A 3ENHA 4DF4A 1X3MA 1HKBA 3C65A 1QZ6A 1IBKK 3OS1A 3S41A 4CJUA 4RTFD 2O8BB 2QA4N 3G25A 1NG9A 1E4FT 5FROA 3SV4A 2O8FB 5J2NA 3GL1A 3LANA 2ZF5O 1YVNA 5AQRA 1M90O 3J7ZO 1SAZA 2A42A 3LDQA 3SUOA 3VGKA 4FSVA 3L2VA 3LALA 1E3MA 3OYBA 2P9KA 4E7HA 1JLEA 5BN8A 1WNSA 5AQXA 2YV0X 5BRHA 2YNHA 4DHYA 3RMCA 2E2NA 1KVBA 3SQ2A 1GOAA 3U6FA 5AZJB 1NNEA 3CJ1A 5HP1A 4ELVA 1RT7A 5JVGL 3OYEA 3T3FA 1VQPN 1ZXOA 5AQWA 3D2EA 4JI8K 4BRDA 1Q18A 3LDPA 3CJCA 4KB0A 3CXCM 4BACA 3U3YA 2NRWA 3L6QA 3MN5A 1NJWA 4CJ3A 2UYTA 4DFJA 1VQLN 4CGDA 4F8RA 3CPEA 3WNHA 4CGIA 3HYFA 3CETA 3WT0A 4X65K 3L2QA 3VEOA 4HUGA 2E20A 4KHSA 3T1HK 1S1WA 1NMDA 1B9FA 4BY9C 1T6DA 5AZIB 2QWRA 3CC2N 3VQ8A 3AA4A 1MWMA 1VHXA 4FLXA 4CZGA 4DV7K 3BEXA 4B3OA 4EAHD 5FPDA 2CGKA 3LDNA 1X9MA 4MO4A 1A5VA 2OZMA 1Z25A 3VENA 2P1JA 5CZ2A 3CMAN 3C7NA 2A41A 3V1RA 4WQ5A 2GWKA 1SL1A 3OYCA 3AAPA 2E88A 1YTAA 3NBPA 1GLAG 1CZAN 3V9ZA 4E0DA 2KQ2A 4A62A 4N76A 3KK1A 2OPSA 3GOIA 4BDPA 4BRHA 3IDHA 3VPZA 2HHHK 1TKXA 3VQAA 1U04A 4AHCA 1HJRA 1U2VA 3AO3A 3VGLA 4FM1A 4HCCA 3PIPL 2XY5A 5SZTA 4CZEA 4BRFA 1D9DA 2ATQA 3VOVA 4FJXA 2A40A 3HZ6A 3O8MA 4EZ6A 4DFMA 2ETJA 4FWOA 3RSEA 2GUPA 1BA0A 3ULEB 1VSFA 2HNZA 1EP4A 1IKWA 4ILGB 4BWJA 3SNNA 4BQZA 4UQGA 4OX9K 2OANA 2OTJN 1EKEA 4B1VA 2VWJA 1GLDG 2BUPA 3VQ5A 4PKHA 3PUFA 1NJYA 3LZIA 2KFZA 4LFCK 1LAVA 4B9VA 2Q3SA 1TGOA 5E84A 2I7PA 4FWQA 4BE1A 3QBXA 4H0TB 4CI6A 4PKGA 1YAGA 4FJHA 3JS6A 3PO5A 4Y1DA 4JKHA 4IJAA 1RBVA 3T7ZA 3RTVA 1ZC6A 2Q2RA 4QS8A 2HMIA 3CJBA 3CFOA 4Z4HA 3O9SA 2F9WA 3FR0A 4M7YA 1VSJA 2HNYA 1R59O 3NF9A 2YKMA 1TUUA 2XO7A 2ZJQL 2HHTA 3U9DA 3SUNA 4IDHA 5MLCQ 3LP3A 5E26A 1RT5A 2P9PA 4FLYA 4CHPA 1GLCG 4GVMA 5LL6Z 3KLGA 3OTOK 4JK9A 2BGGA 1X9SA 1IO2A 1ATNA 4OPAA 1WSHA 4FPAA 4DU3A 4Z4EA 4KREA 1K8AO 4BR0A 4FOIA 5AQNA 1IG9A 5ADXA 2QWLA 3L3VA 1J5OA 4W5RA 2CH5A 1NK7A 3TR8A 4CGGA 1NGJA 3ZSXA 4CEEA 4HTUA 4LF6K 1X1PA 3PIOL 2WOMA 4QAGA 2IDOA 5KQDA 4CESA 2O8BA 3VEYA 2ZJPL 5C25A 3HI0A 3MEEA 1KXPA 1IG8A 1VQ7N 4L8RB 4JKGB 4IOCL 5IWAK 4CJVA 5AQIA 4B1UB 1WN7A 5KGXA 5JS1A 1NK5A 4LY7A 4OKEA 1JCGA 1MDUB 4OKKA 4AH9A 4OVLA 1T05A 1D9FA 1EX4A 2OTLN 2KFNA 3WXMB 1S1VA 3T69A 3J7AP 4AQYK 4K8XA 4CECA 4ILJA 5GINA 3AVKA 3HBTA 3T19A 3AA5X 2DTUA 2JWKA 4E1MA 1KVCA 4E7LA 5KPZA 2YCHA 3QLHA 4RCHA 4ID1A 3D2FB 4OPHA 4BE2A 4DTJA 4FJMA 2BE2A 2O8CB 1NKBA 2UUCK 2E2QA 2ZGYA 5AZJA 2WC9A 1LV5A 4BR7A 3RMBA 3VQEA 4XH4A 3QO9A 5HRPA 3HPOA 2ZJRL 1OVQA 5J2QA 2HNDA 3V6DA 5KGWA 2KW4A 3HPGA 4IG0A 3THVA 4MQ3A 2P9NA 4DR1K 4ZHRA 1VQ4N 4JV5K 1KQSM 3KIOA 5KRTA 4DF8A 3LDOA 2GV9A 3EYZA 3KD5E 4BR5A 4DQ8A 1IKXA 3L2WA 2FBVA 1D8YA 1L3VA 1K73O 5HRSA 3OYAA 1XHXA 1VQKN 3O3GA 2D5RA 1RDUA 4EIAA 2OPRA 5AZIA 4YOWA 3BZKA 1UOCA 4HWIA 4YFUA 1C1CA 4DS5A 4JKEA 4MLHA 3VGMA 1IKYA 4NB4A 4W5OA 2YNFA 4B08A 4BDYA 3RMDA 3JXUA 3GE1A 3QFUA 3VEWA 4YOYA 3DLRA 3P39A 3CMEN 1XMOK 3FZHA 4CW7B 3SUQA 4H5RA 3TAQA 1ZBFA 2J4RA 1HNVA 3ZLJA 5TKYA 5FPMA 4I7FA 5DM7L 2RE2A 5C0YA 4WE1A 3KK2A 4RW7A 4KHNA 1K6YA 1KAZA 4Z4IA 2DFHA 4KFBA 1TK0A 3EY1A 1FW6A 2UU9K 4LD0A 4AM6A 4R79A 3QERA 1QE1A 3ZX2A 1TK8A 1VQ5N 3EN9A 1RT3A 4BG8A 2O8DB 1SKSA 4FJ8A 2OCEA 5AQPA 3W0LA 3I8DA 1WUAA 1RBRA 4DS4A 4ISEA 4C8KA 4DR2K 3JYTA 5GADP 2HBLA 4CBXA 5I9EB 4KBOA 3W3DA 1GLEG 2QWOA 1TUYA 2NRXA 4JRPA 4FWSA 3C6HA 1EWQA 2AP1A 3ZETB 4FCYA 3I8BA 4JKBA 1WSEA 2O4GA 4PL7A 3S3MA 3VQBA 4CZJA 3L8BA 4CERA 1LCUA 3A5OC 4YOXA 3V81A 5AQFA 4B3RK 2VCPA 4MLEA 5J1EA 2O8EB 2DY4A 1YIJN 4KTQA 1NJIO 2P9IB 1NBWA 5BRDA 2IIRA 2NUBA 1HQEA 3MN9A 4DG1A 4FWPA 1RTDA 1VRUA 4O8UA 4Z4FA 5AQLA 3HOTA 1WOQA 4CEFA 5M1KA 3ITHA 5F0XA 3NGYA 5EY4A 2OPPA 1X3NA 3LPUA 4MDAA 1RILA 4FJGA 2ZWHA 3S9HA 4M45A 4U7BA 1SS6A 3FGUA 3IAYA 4F2RA 1ATSA 5BREA 1JL2A 3P4IA 4M41A 3RR7A 4CHQA 4E7JA 4HTLA 4LF5K 1FKOA 3CQYA 3CM5A 3CCJN 3TTCA 4N47A 1FJGK 1BL3A 1SKRA 1SZ2A 4LSNA 3HVRA 3LM9A 4JNEA 1YVUA 2FF3B 2X74A 1JLGA 3OS2A 3ZEUB 4I6MB 1W9HA 3WXKA 1Y64A 4BREA 1BI4B 3OYLA 2OZSA 1RTJA 4KI6A 3VQPA 4DQPA 1N34K 3TSUA 3OJSA 4F3OA 3SPZA 3VF4A 3CCLN 2HHSA 2Q36A 1NOZA 4ILHA 4Y1CA 4DFKA 2QWPA 3CERA 1KLNA 4JI7K 4KRFA 2VQFK 2EWSA 1Q9YA 4CFBA 4YORA 1QVGM 3L2UA 2QXFA 3HVTA 2PYLA 5BN9A 2QEXN 2KKZA 3KTQA 3ZT2A 3VQCA 1QVFM 1EXQA 5C10A 3O08A 2Q31A 4DSJA 3HRGA 3U9ZA 4ICLA 4FK2A 4IEIA 3CCRN 5HL7L 3H3NO 2ASMA 1L5UA 3A0IX 3BF3A 2R7YA 1NGHA 1NGBA 4CJLA 4CJTA 3SQ1A 4CF1A 3SUPA 3SMSA 1NM1A 2UUBK 1UA1A 5M1OA 2G8WA 4CVNE 1KSPA 3F9KA 3ZT4A 2ZD1A 3C0BA 5LMUK 3HT3A 3M8SA 3C95A 1NJXA 4RW9A 2F96A 1RT2A 3FZFA 3M6GA 1W2BM 5AQUA 3V9XA 3SJHA 3LAKA 1QQCA 1MWKA 3DLEA 2YNGA 4AF1A 1N5YA 1KAXA 1RT6A 2VGMA 5C2FA 2XY6A 2PY5A 1TKZA 3O3HA 1XHZA 1IBLK 4ZTFA 3RRGA 3DXMB 5AQVA 4B9LA 3PV8A 3MK6A 3DLBA 4KH4A 4O8KA 3R8EA 4OPJA 2QWQA 2P9LB 4CGHA 4WCEL 3SAGA 3O1WA 5AQZA 3EO3A 1Q81O 3ZSWA 1N32K 1HLUA 4QS9A 4H8KA 1F21A 1GLLO 3K5MA 3NVMA 1MU2A 2GUIA 4PHTX 3ZT1A 4BRAA 1S9EA 4NYNA 3DLKA 3SJJA 1RGIA 3TABA 3QMLA 4AHSA 3CCSN 1HPZA 4GKKK 4WFBL 2OPQA 4C1NI 1K8KA 4OLBA 1W0HA 3ZCMA 1DEJA 1YITN 5BPMA 2D0BA 5CE3A 4M3RA 5KI6A 3OHRA 1VQ9N 1L3SA 1Q86O 3B6OA 3TSQA 4F3TA 2Z1GA 1JJ2M 4K42A 5BPNA 4JRQA 5B8HA 2KHOA 1ZBHA 1OH7A 1BCOA 5ADXH 3UKRB 3O5BA 5BR8K 4LF4K 5AQJA 3CPWM 4E19A 3ZT3A 2XRIA 3CCEN 1ASWA 4ELUA 3LP2A 4JD2B 4DUYK 1SQKA 1KC8O 2DPNA 4IFEA 1BCMA 2WFBA 5GIPA 2CGLA 3BDPA 1TAUA 4QCLA 5M1PA 1N6QA 3O4WA 2V7ZA 1HNWK 2ASPA 1S1XA 1X9JA 3MWTA 3HSTB 3IUCA 3AY9A 4B8CA 3I33A 4GKJK 3D7EO 1HX1A 4DQIA 4C23A 3MEDA 2HHVA 4IWVA 2JGUA 2VWKA 4BC5A 5AQYA 3PY8A 4DUZK 3Q7CA 1UA0A 2E4LA 1YTUA 4HHTA 1KCFA 2F7TA 4C8LA 4DSIA 4MO5A 3TTDA 3VEXA 2Q1NA 5CHIA 2F9TA 3PO4A 3G6EN 2XY8A 3ATUA 3OBYA 3LM2A 5EXWA 1JXEA 1BGXT 3MAQA 4IO9L 1NJZA 3RVCA 1FXXA 3CIPA 3OYHA 3K9KA 3V9SA 2O4IA 3MX5A 4IEEA 3TSPA 1BA1A 5C12A 3TAPA 3DI6A 4KB1A 2VG5A 3MWPA 1YJ9N 5DK5A 4E3SA 4KPYA 3ZSQA 3OY9A 2E2PA 3BGRA 3CFRA 3PSIA 4H5VA 4DSFA 3MCAB 1N8RO 3I56N 4C8OA 2QK9A 3CI5A 4K41A 4BWMA 3ALYA 4K25A 3WXJA 4O55A 4KHUA 3KLHA 2D0CA 4DV6K 4DTPA 2E2OA 4O5BA 3AVBA 4B1YB 3THXB 3EE8A 5DM6L 2CH6A 3DOKA 3LAMA 1WSJA 2PFUA 1UAXA 3TWHA 3VF2A 3P1GA 3E66A 1Z26A 3NH1A 4CIFA 4WF9L 3V1QA 4JKCA 5AFUA 1L3TA 3THYB 1BI4A 1NKCA 5C42A 2DFFA 2D0PA 1HNZK 5LY3A 4MDBA 3TAGA 1HUXA 1C0MA 4WQ4A 1N36K 4JHDB 4CCHA 3G4SN 2FXUA 2XHBA 3D45A 4IKFA 1HQUA 3AVGA 3PX6A 1XMQK 2RPIA 3EZ5A 3OYDA 3RRHA 3ENBA 4CF2A 2WTUA 1Y97A 2P9SA 1NWKA 5E41A 4O5FA 4GV9A 3VQDA 1RTIA 4IFYA 5GAGP 4WYBA 3VQQA 1NK9A 4IOXA 3DWLA 5AR0A 1T6CA 1JL1A 1S72N 2A1RA 5JLHA 3K0SA 3EE9A 1S9GA 3CJ7A 3CYMA 1G15A 2HHXA 5CYQA 5HRNA 1NK8A 4KKOA 4CJKA 2RN2A 1QZ5A 4JS4A 1U45A 2IAJA 1QQNA 4M3WA 4FO0A 1WSIA 3MDQA 3HJFA 3I0SA 3H3OB 1BOTO 3SI6A 2HBKA 4FZYA 2YHBA 4NXMK 5JICA 3P83D 3KWIA 3DLHA 4L3QA 1NGCA 1WSGA 2O8FA 1VQ8N 4EHUA 1Q9XA 2HF3A 3OYKA 5EVZA 4JKAA 3VQ7A 5D3GA 4WQ4C 4M42A 2P9LA 3TANA 5GAHP 1RBSA 1QTMA 3DM2A 4LC9B 4IOAL 1TYQB 4GNIA 4DWIA 5DMRA 4ID5A 4FWMA 3TU5A 3NGIA 4DTXA 2OYQA 3A2FA 4E89A 2IGIA 2Y1JA 4JYAK 3KVGA 4FLUA 4ZTJA 3O3FA 4CF9A 2KZMA 3MMVA 2VGNA 1VK0A 3K58A 3THWB 3AVIA 4DTRA 1KVAA 1KLMA 4CEBA 3NFAA 4FVMA 2YJFA 4N5SA 3H46O 2EHGA 3OS0A 4JI1K 2NLXA 1VSDA 4CFCA 3CG7A 1TKDA 1SV5A 2Z1HA 3ATVA 2G8FA 3WNGA 2FBXA 4BVOA 3J80O 5I3UA 2G8KA 3Q7BA 3N4PA 1S22A 1BWFO 2HHWA 3ID6A 4CJ5A 1WAJA 4DV0K 2X6NA 1DTQA 3WXLA 3VF6A 3V1OA 3ZSOA 3KKSA 4BC4A 5AQOA 3AARA 2NZTA 3TAEA 3QICA 3NMUA 2NRRA 1LOTB 4H5NA 4J2DA 4CF0A 3VA0A 2P5OA 2HVHA 1SKWA 5A2QO 4BRKA 5KPTA 3SZ2A 4DSEA 4DV3K 4JLHA 1J6ZA 2V51B 1VSHA 2P9KB 4NXNK 3O80A 3H1VX 1TL1A 3P31A 1GLJO 3WEEB 1ZBIA 2HHQA 3QETA 3UB5A 3SAFA 4K8ZA 3VTHA 4DR3K 1WBBA 4PY5A 3DOLA 2IVOA 1ZBSA 3CCMN 1S6PA 4CEAA 5FDLA 2HMPA 3AO5A 2HSTA 3KK3A 4YHHK 4W5TA 5I42A 1HPMA 4JI0K 3U8XA 4CJRA 3R9PA 3HO1A 3D2EB 4FYDA 1NGDA 4BRIA 3RR8A 1O13A 3VN5A 1ESVA 4IFVA 4BRMA 1S5JA 4LF8K 4FW1A 2RF2A 3VEVA 4DCHA 3SQ0A 4EP4A 2F8TA 4H4OA 3FFKB 4I2QA 4BR2A 2A1SA 2Q97A 1UWBA 3OW2M 2PYJA 4OGCA 4JI2K 1NK4A 3ZX3A 1W97L 3KKRA 3K5OA 4IG3A 4NCBA 3OYMA 5TKWA 4KTZA 4B8AB 3LPTA 3ULEA 3WNFA 4FWRA 5JLFA 4E1NA 1OH5A 2DFEA 4BRGA 4H5TA 5C15A 3D6RA 3DLLL 4OGEA 3QEXA 1T7PA 1GOBA 1RFQA 4RW4A 4B1WB 1N33K 1H1VA 3EEQA 3L0QA 3UKUB 3C7NB 1I94K 1U48A 3HK2A 1IV0A 2FSNA 3NH0A 3SYZA 4FPBA 2VWBA 1SL0A 3EL2A 5LJVA 3N4QA 2GX9A 3QDKA 4U67L 1BQMA 3ZSRA 3L2RA 5AQTA 3M8QA 3CQXA 2D4WA 4DFPA 1BQNA 1GOCA 4CJ4A 3OA9A 2AJQA 3I55N 1XWLA 1ILYA 2Q0RA 5HRRA 1KTQA 1U2VB 4CJQA 3ZT0A 1U49A 1JCFA 4OKJA 4CZMA 1HR0K 2B5JA 3FZMA 4RWTA 1R0AA 4DR6K 2BH1A 1CZBA 4A61A 3O9RA 4H0VB 5M1NA 1QS4A 3V9UA 3RSEB 4BGBA 4AHUA 5BPLA 1Z6RA 3LWLA 3O4NA 4KO0A 5KQ8A 1RDDA 4BC3A 2YX6A 3FLCO 2RHKA 4XEIA 3LZJA 2QKKA 1S1UA 3CD6N 2B4JA 1RNHA 3E9OA 4CEZA 1O1WA 3NCIA 2WUSA 4FW2A 5EU7A 2YHAA 2UXDK 1S1TA 1EETA 3NF8A 4GMJB 1KFSA 2V7YA 4QS7A 1RT4A 2ZE2A 3HPHA 2UXBK 5HBMA 3GBTA 3MXIA 4EZ9A 4R5PA 5J2PA 1BU6O 1VQ6N 3L4QA 3WQTA 2Z1IA 4CK3A 4CD1A 3B8AX 4A2AA 4YOVA 3SAHA 3SPYA 3E1YA 4NYFA 4OO1J 3G71N 3DAWA 4CHZA 3G0ZA 4PWDA 3JSMA 3K2PA 1TL3A 1P90A 3SLCA 2V52B 2LSNA 1TAQA 2QI2A 1RCHA 4A2BA 3QEPA 3DMJA 1C0FA 2GWJA 3DRRA 3LP1A 4DV2K 1JLBA 3GDQA 3CCUN 1ATRA 4DSLA 4IDKA 3L4IA 4BGAA 4OLAA 1HRHA 2ITMA 3ENOA 4O0IA 5AQSA 3R6MA 1ASUA 3E01A 3SMPA 4JKGA 4DR5K 4W5NA 4F2SA 4CJWA 3A5MC 1WB9A 2XY7A 3LP0A 1XC3A 3BY5A 3CC7N 2P9PB 3BUZB 2UXCK 3A8YA 1HYZA 4FVUA 2IOCA 3CCVN 3BZCA 3SBTA 3OYNA 4CK1A 4RW6A 3O9TA 1REVA 1KAYA 3D2FA 3ZSZA 4AHRA 3O9QA 4TSXA 4H0XB 4DU4A 2UUAK 2O8CA 3M8RA 3UE5A 2G8VA 1CLQA 4CBUA 1HNXK 3K5NA 2ZGZA 4GV3A 2VG6A 2YHWA 3VA3A 4JI4K 4XH1A 1WLJA 4YDUA 4FL9A 1QHAA 1NGGA 2IC3A 3C94A 4DMNA 1CXQA 5FLXO 1ZBLA 1C1AA 1TV6A 3QB0A 4DTOA 2HOEA 3B6PA 4H03B 1KD1O 3ISNC 2A3ZA 3WNEA 4M3XA 3ULDA 3CCQN 4XH5A 5IT9O 3NF7A 1IH7A 1HYSA 3QEWA 3NH2A 4DKWA 5M1FA 4FWLA 1FKPA 2QM1A 4CE9A 1YHQN 1ASVA 4C1NK 1LWEA 1NU0A 4C8MA 3WEEA 1FK9A 2W42A 3E9PA 4M3TA 4FOEA 3OJUA 2FF6A 1NK0A 1SL2A 4DQQA 3OYIA 1GLFO 1RDCA 3U4LA 3NF6A 1SUQA 3NAEA 4PA1A 4E7KA 3QINA 4BVPA 3AVMA 4CFDA 4J2BA 4YOUA 3NGZA 3NHGA 2Q0UA 2OA8A 4HCBA 1VSLA 3DXKB 4KV8A 3CM6A 3O4QA 3TAFA 3PLAA 1U6ZA 1L3UA 3QFPA 2QW9A 4H0OA 3AGKA 5FPEA 4IBNA 2P9NB 2FC0A 2Z1JA 3CFPA 4DU1A 2B6AA 1NGIA 2F8SA 1HNIA 4KH5A 4BRQA 3TARA 4YDUC 2NRVA 1NGEA 3IMXA 4FM2A 1I39A 1ZYQA 4CF8A 3P38A 3VQ6A 2O8DA 4CGJA 4Z0UA 1P8ZA 2E6LA 4CZHA 4IJNA 4FK0A 4BR9A 2E1ZA 5F2RA 1S6QA 4DB3A 3FFIA 2KTQA 4JI5K 2E6MA 3ZETA 4BRNA 1YXQA 4XIUA 4JAXA 5EOYA 5SWMA 4AM7A 5AQKA 3ASMA 3AVNA 2Y1IA 4AHVA 5BRFA 4LF7K 3UKUA 4DSKA 4WFNL 2PAVA 1M1KO 2O8EA 3SCXA 4H5WA 3OVNA 5JVHL 4CZLA 4Y0WA 3VEZA 2P9IA 3AA2A 2NNWA 3KK7A 3TTFA 1RT1A 4CK2A 1NOYA 3SV3A 2X6SA 2YNIA 4A57A 2YJEA 4FM0A 1T3VA 4EP5A 1J5EK 3R3LA 1NKEA 3HTVA 4CZKA 1BHLA 1X9WA 1VAZA 3VTIA 4DR4K 2E8AA 3MN7A 2W6KA 1VSKA 2G8HA 4YOTA 3KLEA 1OH8A 3HM9A 3H1QA 4O0JA 4NLBA 2GELA 1WBDA 4HUFA 2QKBA 1J53A 3PX4A 2P9UB 3OYGA 4K43A 2KLAA 1V4TA 4FJLA 1TK5A 2JWLA 2PBDA 4DV1K 3ZEUA 2F4VK 4I6MA 3VQ9A 3HP6A 4DV4K 4F9OA 1Q7YO 3QIOA 3ZYYX 3CHWA 1ITGA 4LH5A 4AHTA 5GAEP 4CJEA 4RG8A 4WQ5C 1OVYA 3A5LC 3QESA 3HM8A 4B9NA 5LMNK 4CJPA 5KTQA 2EX3A 5FPNA 4IXCA 3K59A 5M1QA 2D1KA 3DRPA 1LW2A 3LDLA 4FZXC 1A5XA 4Z94A 4M3UA 3TAMA 3KLFA 4DTUA 4KI4A 3AO2A 3C6AA 1C1BA 3AAQA 4A5BA 3F73A 3VQ4A 4B9TA 2P5GA 3UIQA 4LFAK 2W41A 4CGFA 3AO1A 4JEPA 4CZFA 4CHYA 2BDPA 3H6EA 4ISFA 4DTNA 4FZZA 3BF1A 1K9MO 4JK7A 4OPKA 4M63C 1C0TA 1YJWN 5HOOA 1BIZA 2I7NA 2YHYA 1DGKN 2H3GX 1QSLA 1KFDA 3RWUA 1HKGA 4FWNA 3F2KA 4EFHA 1C6VA 2ASOA 5CY4A 4DLEA 1RDAA 3DRSA 3AVLA 4B1ZA 3KD1E 1DLOA 1XNRK 3ID8A 4CZIA 4DR7K 3DXMA 1E4GT 4B3TK 4CJFA 4CHNA 4BDZA 3KLIA 3V9WA 1XUPO 2PZSA 1JLFA 3MEGA 3T1AA 2W6LA 3P5JA 1LAWA 4J2EA 4CBWA 3IRXA 3DJCA 4B1XB 4BE0A 3KWGA 1Q82O 1EQYA 1YF5L 5EX5A 1XI1A 4KHQA 4UY8O 4PUOA 4WFAL 2BANA 2KZZA 3MCPA 3QIPA 4EHTA 2HBJA 5BR9A 2QWNA 4LSLA 1C0UA 3M8PA 4LH4A 5FRNA 3S3NA 3K57A 1LWFA 3QEIA 3H08A 3HOSA 4FXDA 3LWMA 4FJJA 1JLAA 5AQGA 4BRLA 3L3UA 4BG9A 3D0PA 2HBMA 4BQLA 3HXMA 4J8FA 4LFBK 1XQSC 1DTTA 4G9ZA 4FJNA 3CC4N 4CFAA 4F4KA 1B92A 4KH6A 2VQEK 4FJ5A 4DQRA 3ZX0A 3C6TA 3CQ8A 4B9UA 4RW8A 4X64K 2HW3A 3DLGA 1HKCA 5AJ3K 3DXKA 4FLWA 1MA9B 3UKRA 4CIEA 1Z05A 3MN6A 2WBNA 5CZ1A 2AA4A 1NGFA 3VERA 4HUEA 1YT3A 3CJ9A 4CIGA 3EZWA 5KRSA 2FLOA 4B9SA 2GTDA 4PKIA 1W7AA 3M5RA 1RBUA 4G1QA 2FBTA 2IVNA 3EKSA 4JD2A 3S3OA 3PSFA 3F5TA 1Q8IA 4FLVA 4GVEA 3HP9A 1KRPA 4KTWA 3G10A 4K0KK 3CF5L 1CZ9A 3AVCA 1VSMA 4FJ7A 4I9QA 1TKTA 4E7IA 1U47A 1QHTA 1RTHA 3PX0A 1XNQK 4N56A 4JS5A 1K8KB 1BG3A 2ITGA 2W40A 3C6UA 1OH6A 3EKUA 3J81O 5C24A 1I3AA 1BUPA 3AGRA 4KHYA 2A6AA 4NCAA 4M3YA 4NCGA 3R1XA 1LW0A 2X78A 4C8NA 3JAMO 1GLBG 4OJRA 4B3SK 5J2MA 3KHYA 3QNNA 1EO1A 4NO7A 4CJ7A 5AQMA 3IFRA 4ISGA 4FJKA 1T8EA 2E1YA 2HVIA 3HL8A 4JI3K 3U3GA 4IZ9A 3HSCA 3T1YK 5FRMA 2BTFA 1QSSA 3DYAA 1T03A 2QXLA 4I9LA 2IVPA 4JI6K 3LDSA 5H1SQ 1WAFA 4DLGA 2IS3A 1NMNA 1VQON 4MFBA 4J2AA 2HB5A 3AVFA 4V19S 4B9QA 4H4MA 3J7YP 1VQNN 3NVKA 1S3XA 4CEQA 4B3MK 3MXMA 1V4SA 2VYPA 2RKIA 4M7XA 3E9LA 4CD3A 3IKMA 1VSEA 4BROA 4JK8A 5C2DA 5T7BA 4Z4CA 3WUHA 4YY3K 3THXA 4FLZA 4W5QA 4HVJA 1VSIA 5CYMA 4QOZB 2JLEA 3IS9A
chains in the Genus database with same CATH topology
4JI5K 4JI4K 1N34K 4X65K 4NXMK 3J7AP 4AQYK 4GKKK 4YHHK 4LFAK 4LF7K 5FLXO 3T1HK 4JI0K 2VQFK 4JI7K 4DV6K 4DR2K 2ZM6K 2UXDK 4DV7K 5IT9O 4K0KK 2UUCK 4X66K 2UXBK 1IBMK 4LF8K 5BR8K 4LF4K 1J5EK 4JYAK 1XNQK 1IBKK 1XNRK 4DR1K 4JI2K 4JV5K 4DUYK 4B3RK 4DR7K 2UUBK 4B3TK 4DR4K 3J81O 4CVNE 4KHPK 4JI1K 5LL6Z 1HNZK 5LMUK 4DV2K 1HNWK 3OTOK 3JAMO 4GKJK 4B3SK 1N36K 2HHHK 3J80O 1XMQK 4DUZK 4DR5K 4JI3K 1N33K 3T1YK 1I94K 4DV0K 1IBLK 4DV1K 2F4VK 4JI6K 4DV5K 4DV4K 2UXCK 4V19S 3J7YP 4X62K 4LF6K 1XMOK 4LF5K 4CW7B 4B3MK 5A2QO 5LMNK 4LFBK 2E5LK 4DV3K 4OX9K 4NXNK 1FJGK 4LF9K 4JI8K 1N32K 1HR0K 5IWAK 2VQEK 2UUAK 2UU9K 4DR6K 4YY3K 4DR3K 4X64K 1HNXK 4LFCK 5AJ3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 K;  4JI4 K;  1N34 K;  4X65 K;  4NXM K;  3J7A P;  4AQY K;  4GKK K;  4YHH K;  4LFA K;  4LF7 K;  5FLX O;  3T1H K;  4JI0 K;  2VQF K;  4JI7 K;  4DV6 K;  4DR2 K;  2ZM6 K;  2UXD K;  4DV7 K;  5IT9 O;  4K0K K;  2UUC K;  4X66 K;  2UXB K;  1IBM K;  4LF8 K;  5BR8 K;  4LF4 K;  1J5E K;  4JYA K;  1XNQ K;  1IBK K;  1XNR K;  4DR1 K;  4JI2 K;  4JV5 K;  4DUY K;  4B3R K;  4DR7 K;  2UUB K;  4B3T K;  4DR4 K;  3J81 O;  4CVN E;  4KHP K;  4JI1 K;  5LL6 Z;  1HNZ K;  5LMU K;  4DV2 K;  1HNW K;  3OTO K;  3JAM O;  4GKJ K;  4B3S K;  1N36 K;  2HHH K;  3J80 O;  1XMQ K;  4DUZ K;  4DR5 K;  4JI3 K;  1N33 K;  3T1Y K;  1I94 K;  4DV0 K;  1IBL K;  4DV1 K;  2F4V K;  4JI6 K;  4DV5 K;  4DV4 K;  2UXC K;  4V19 S;  3J7Y P;  4X62 K;  4LF6 K;  1XMO K;  4LF5 K;  4CW7 B;  4B3M K;  5A2Q O;  5LMN K;  4LFB K;  2E5L K;  4DV3 K;  4OX9 K;  4NXN K;  1FJG K;  4LF9 K;  4JI8 K;  1N32 K;  1HR0 K;  5IWA K;  2VQE K;  2UUA K;  2UU9 K;  4DR6 K;  4YY3 K;  4DR3 K;  4X64 K;  1HNX K;  4LFC K;  5AJ3 K; 
#chains in the Genus database with same CATH topology
 4JN4 A;  4Z4G A;  1B9D A;  4DQS A;  3NE6 A;  5JS2 A;  1HMV A;  4JKF A;  2G8U A;  3M3Z A;  2FBY A;  1D4X A;  2ZQB A;  1IJJ A;  2P9U A;  4DTS A;  4IO8 A;  1QQM A;  3IG1 A;  3M1F A;  1DT9 A;  4FK4 A;  1G99 A;  1YJN N;  1YUW A;  3THY A;  4NLC A;  3LL3 A;  4JKD A;  2ZM6 K;  1BIS A;  4I2P A;  1BDG A;  1JXB A;  1C0G A;  4X66 K;  3FZK A;  4GV6 A;  3GG4 A;  4GY2 B;  1JLC A;  2D0A A;  4JHD A;  3ZSY A;  4O44 A;  1YI2 N;  2WON A;  5LJW A;  2GEM A;  4DTM A;  1XC9 A;  4CEO A;  1RBT A;  3VET A;  3BP8 A;  2NRZ A;  5KPR A;  1D5A A;  4CJS A;  2CGJ A;  1WSF A;  1HYV A;  2NRT A;  3AVJ A;  4B9M A;  4KHP K;  3OYF A;  3KZB A;  1TVR A;  4FLT A;  2VG7 A;  4GW6 A;  4A5A A;  3QEV A;  2GBZ A;  5K14 A;  4FWK A;  4KHW A;  3KJV A;  4Q5V A;  4BR4 A;  3VES A;  1BO5 O;  3OYJ A;  3SQ4 A;  4CHO A;  4BC2 A;  3RMA A;  3O9U A;  4Q0B A;  5GIO A;  4FJ9 A;  1A5W A;  3H45 C;  1U4B A;  1T44 A;  3AV9 A;  1VRT A;  3QBW A;  3MXJ A;  5AQQ A;  5JMV A;  1LWC A;  1RDB A;  2HF4 A;  5AQH A;  3K9J A;  3MX2 A;  3OBW A;  3NDK A;  4DV5 K;  2NRH A;  2YHX A;  1NGA A;  4CED A;  2FSJ A;  2HHU A;  2QTD A;  4X62 K;  3TPQ A;  4A59 A;  1NK6 A;  2YKN A;  2A5X A;  3WXI A;  2E5L K;  4O4G A;  4M3Z A;  3MEC A;  3I0R A;  3O1B A;  4BRC A;  1IKV A;  3O6W A;  5HLF A;  5CR4 A;  4ELT A;  3FE1 A;  4LF9 K;  4FJI A;  2YI1 A;  1VQM N;  4AIL C;  1QSY A;  2P9S B;  1TYQ A;  1ZBU A;  2QWM A;  4N41 A;  3F9M A;  2D0O A;  3VMF B;  4PQU A;  1EWR A;  3CJA A;  2G8I A;  4H0P A;  1NLV A;  3SBG A;  3FZL A;  3QNO A;  1JKH A;  1J9A A;  1OKJ A;  5ELZ A;  3J8A A;  3V4I A;  3A5N C;  3AO4 A;  1JCE A;  1J54 A;  4PL8 A;  1BIU A;  3AA3 A;  1QQO A;  1RDW X;  3AVA A;  3THW A;  1CXU A;  2P51 A;  5HRO A;  3ZSV A;  4BRP A;  3TI0 A;  1DKG D;  4E1J A;  1HJO A;  4YNQ A;  1JLQ A;  3K5L A;  4KAZ A;  2FSK A;  3WQU A;  4H0Y B;  5F1X A;  1IBM K;  2I5J A;  3AVH A;  5AFU H;  3SK3 A;  3ENH A;  4DF4 A;  1X3M A;  1HKB A;  3C65 A;  1QZ6 A;  1IBK K;  3OS1 A;  3S41 A;  4CJU A;  4RTF D;  2O8B B;  2QA4 N;  3G25 A;  1NG9 A;  1E4F T;  5FRO A;  3SV4 A;  2O8F B;  5J2N A;  3GL1 A;  3LAN A;  2ZF5 O;  1YVN A;  5AQR A;  1M90 O;  3J7Z O;  1SAZ A;  2A42 A;  3LDQ A;  3SUO A;  3VGK A;  4FSV A;  3L2V A;  3LAL A;  1E3M A;  3OYB A;  2P9K A;  4E7H A;  1JLE A;  5BN8 A;  1WNS A;  5AQX A;  2YV0 X;  5BRH A;  2YNH A;  4DHY A;  3RMC A;  2E2N A;  1KVB A;  3SQ2 A;  1GOA A;  3U6F A;  5AZJ B;  1NNE A;  3CJ1 A;  5HP1 A;  4ELV A;  1RT7 A;  5JVG L;  3OYE A;  3T3F A;  1VQP N;  1ZXO A;  5AQW A;  3D2E A;  4JI8 K;  4BRD A;  1Q18 A;  3LDP A;  3CJC A;  4KB0 A;  3CXC M;  4BAC A;  3U3Y A;  2NRW A;  3L6Q A;  3MN5 A;  1NJW A;  4CJ3 A;  2UYT A;  4DFJ A;  1VQL N;  4CGD A;  4F8R A;  3CPE A;  3WNH A;  4CGI A;  3HYF A;  3CET A;  3WT0 A;  4X65 K;  3L2Q A;  3VEO A;  4HUG A;  2E20 A;  4KHS A;  3T1H K;  1S1W A;  1NMD A;  1B9F A;  4BY9 C;  1T6D A;  5AZI B;  2QWR A;  3CC2 N;  3VQ8 A;  3AA4 A;  1MWM A;  1VHX A;  4FLX A;  4CZG A;  4DV7 K;  3BEX A;  4B3O A;  4EAH D;  5FPD A;  2CGK A;  3LDN A;  1X9M A;  4MO4 A;  1A5V A;  2OZM A;  1Z25 A;  3VEN A;  2P1J A;  5CZ2 A;  3CMA N;  3C7N A;  2A41 A;  3V1R A;  4WQ5 A;  2GWK A;  1SL1 A;  3OYC A;  3AAP A;  2E88 A;  1YTA A;  3NBP A;  1GLA G;  1CZA N;  3V9Z A;  4E0D A;  2KQ2 A;  4A62 A;  4N76 A;  3KK1 A;  2OPS A;  3GOI A;  4BDP A;  4BRH A;  3IDH A;  3VPZ A;  2HHH K;  1TKX A;  3VQA A;  1U04 A;  4AHC A;  1HJR A;  1U2V A;  3AO3 A;  3VGL A;  4FM1 A;  4HCC A;  3PIP L;  2XY5 A;  5SZT A;  4CZE A;  4BRF A;  1D9D A;  2ATQ A;  3VOV A;  4FJX A;  2A40 A;  3HZ6 A;  3O8M A;  4EZ6 A;  4DFM A;  2ETJ A;  4FWO A;  3RSE A;  2GUP A;  1BA0 A;  3ULE B;  1VSF A;  2HNZ A;  1EP4 A;  1IKW A;  4ILG B;  4BWJ A;  3SNN A;  4BQZ A;  4UQG A;  4OX9 K;  2OAN A;  2OTJ N;  1EKE A;  4B1V A;  2VWJ A;  1GLD G;  2BUP A;  3VQ5 A;  4PKH A;  3PUF A;  1NJY A;  3LZI A;  2KFZ A;  4LFC K;  1LAV A;  4B9V A;  2Q3S A;  1TGO A;  5E84 A;  2I7P A;  4FWQ A;  4BE1 A;  3QBX A;  4H0T B;  4CI6 A;  4PKG A;  1YAG A;  4FJH A;  3JS6 A;  3PO5 A;  4Y1D A;  4JKH A;  4IJA A;  1RBV A;  3T7Z A;  3RTV A;  1ZC6 A;  2Q2R A;  4QS8 A;  2HMI A;  3CJB A;  3CFO A;  4Z4H A;  3O9S A;  2F9W A;  3FR0 A;  4M7Y A;  1VSJ A;  2HNY A;  1R59 O;  3NF9 A;  2YKM A;  1TUU A;  2XO7 A;  2ZJQ L;  2HHT A;  3U9D A;  3SUN A;  4IDH A;  5MLC Q;  3LP3 A;  5E26 A;  1RT5 A;  2P9P A;  4FLY A;  4CHP A;  1GLC G;  4GVM A;  5LL6 Z;  3KLG A;  3OTO K;  4JK9 A;  2BGG A;  1X9S A;  1IO2 A;  1ATN A;  4OPA A;  1WSH A;  4FPA A;  4DU3 A;  4Z4E A;  4KRE A;  1K8A O;  4BR0 A;  4FOI A;  5AQN A;  1IG9 A;  5ADX A;  2QWL A;  3L3V A;  1J5O A;  4W5R A;  2CH5 A;  1NK7 A;  3TR8 A;  4CGG A;  1NGJ A;  3ZSX A;  4CEE A;  4HTU A;  4LF6 K;  1X1P A;  3PIO L;  2WOM A;  4QAG A;  2IDO A;  5KQD A;  4CES A;  2O8B A;  3VEY A;  2ZJP L;  5C25 A;  3HI0 A;  3MEE A;  1KXP A;  1IG8 A;  1VQ7 N;  4L8R B;  4JKG B;  4IOC L;  5IWA K;  4CJV A;  5AQI A;  4B1U B;  1WN7 A;  5KGX A;  5JS1 A;  1NK5 A;  4LY7 A;  4OKE A;  1JCG A;  1MDU B;  4OKK A;  4AH9 A;  4OVL A;  1T05 A;  1D9F A;  1EX4 A;  2OTL N;  2KFN A;  3WXM B;  1S1V A;  3T69 A;  3J7A P;  4AQY K;  4K8X A;  4CEC A;  4ILJ A;  5GIN A;  3AVK A;  3HBT A;  3T19 A;  3AA5 X;  2DTU A;  2JWK A;  4E1M A;  1KVC A;  4E7L A;  5KPZ A;  2YCH A;  3QLH A;  4RCH A;  4ID1 A;  3D2F B;  4OPH A;  4BE2 A;  4DTJ A;  4FJM A;  2BE2 A;  2O8C B;  1NKB A;  2UUC K;  2E2Q A;  2ZGY A;  5AZJ A;  2WC9 A;  1LV5 A;  4BR7 A;  3RMB A;  3VQE A;  4XH4 A;  3QO9 A;  5HRP A;  3HPO A;  2ZJR L;  1OVQ A;  5J2Q A;  2HND A;  3V6D A;  5KGW A;  2KW4 A;  3HPG A;  4IG0 A;  3THV A;  4MQ3 A;  2P9N A;  4DR1 K;  4ZHR A;  1VQ4 N;  4JV5 K;  1KQS M;  3KIO A;  5KRT A;  4DF8 A;  3LDO A;  2GV9 A;  3EYZ A;  3KD5 E;  4BR5 A;  4DQ8 A;  1IKX A;  3L2W A;  2FBV A;  1D8Y A;  1L3V A;  1K73 O;  5HRS A;  3OYA A;  1XHX A;  1VQK N;  3O3G A;  2D5R A;  1RDU A;  4EIA A;  2OPR A;  5AZI A;  4YOW A;  3BZK A;  1UOC A;  4HWI A;  4YFU A;  1C1C A;  4DS5 A;  4JKE A;  4MLH A;  3VGM A;  1IKY A;  4NB4 A;  4W5O A;  2YNF A;  4B08 A;  4BDY A;  3RMD A;  3JXU A;  3GE1 A;  3QFU A;  3VEW A;  4YOY A;  3DLR A;  3P39 A;  3CME N;  1XMO K;  3FZH A;  4CW7 B;  3SUQ A;  4H5R A;  3TAQ A;  1ZBF A;  2J4R A;  1HNV A;  3ZLJ A;  5TKY A;  5FPM A;  4I7F A;  5DM7 L;  2RE2 A;  5C0Y A;  4WE1 A;  3KK2 A;  4RW7 A;  4KHN A;  1K6Y A;  1KAZ A;  4Z4I A;  2DFH A;  4KFB A;  1TK0 A;  3EY1 A;  1FW6 A;  2UU9 K;  4LD0 A;  4AM6 A;  4R79 A;  3QER A;  1QE1 A;  3ZX2 A;  1TK8 A;  1VQ5 N;  3EN9 A;  1RT3 A;  4BG8 A;  2O8D B;  1SKS A;  4FJ8 A;  2OCE A;  5AQP A;  3W0L A;  3I8D A;  1WUA A;  1RBR A;  4DS4 A;  4ISE A;  4C8K A;  4DR2 K;  3JYT A;  5GAD P;  2HBL A;  4CBX A;  5I9E B;  4KBO A;  3W3D A;  1GLE G;  2QWO A;  1TUY A;  2NRX A;  4JRP A;  4FWS A;  3C6H A;  1EWQ A;  2AP1 A;  3ZET B;  4FCY A;  3I8B A;  4JKB A;  1WSE A;  2O4G A;  4PL7 A;  3S3M A;  3VQB A;  4CZJ A;  3L8B A;  4CER A;  1LCU A;  3A5O C;  4YOX A;  3V81 A;  5AQF A;  4B3R K;  2VCP A;  4MLE A;  5J1E A;  2O8E B;  2DY4 A;  1YIJ N;  4KTQ A;  1NJI O;  2P9I B;  1NBW A;  5BRD A;  2IIR A;  2NUB A;  1HQE A;  3MN9 A;  4DG1 A;  4FWP A;  1RTD A;  1VRU A;  4O8U A;  4Z4F A;  5AQL A;  3HOT A;  1WOQ A;  4CEF A;  5M1K A;  3ITH A;  5F0X A;  3NGY A;  5EY4 A;  2OPP A;  1X3N A;  3LPU A;  4MDA A;  1RIL A;  4FJG A;  2ZWH A;  3S9H A;  4M45 A;  4U7B A;  1SS6 A;  3FGU A;  3IAY A;  4F2R A;  1ATS A;  5BRE A;  1JL2 A;  3P4I A;  4M41 A;  3RR7 A;  4CHQ A;  4E7J A;  4HTL A;  4LF5 K;  1FKO A;  3CQY A;  3CM5 A;  3CCJ N;  3TTC A;  4N47 A;  1FJG K;  1BL3 A;  1SKR A;  1SZ2 A;  4LSN A;  3HVR A;  3LM9 A;  4JNE A;  1YVU A;  2FF3 B;  2X74 A;  1JLG A;  3OS2 A;  3ZEU B;  4I6M B;  1W9H A;  3WXK A;  1Y64 A;  4BRE A;  1BI4 B;  3OYL A;  2OZS A;  1RTJ A;  4KI6 A;  3VQP A;  4DQP A;  1N34 K;  3TSU A;  3OJS A;  4F3O A;  3SPZ A;  3VF4 A;  3CCL N;  2HHS A;  2Q36 A;  1NOZ A;  4ILH A;  4Y1C A;  4DFK A;  2QWP A;  3CER A;  1KLN A;  4JI7 K;  4KRF A;  2VQF K;  2EWS A;  1Q9Y A;  4CFB A;  4YOR A;  1QVG M;  3L2U A;  2QXF A;  3HVT A;  2PYL A;  5BN9 A;  2QEX N;  2KKZ A;  3KTQ A;  3ZT2 A;  3VQC A;  1QVF M;  1EXQ A;  5C10 A;  3O08 A;  2Q31 A;  4DSJ A;  3HRG A;  3U9Z A;  4ICL A;  4FK2 A;  4IEI A;  3CCR N;  5HL7 L;  3H3N O;  2ASM A;  1L5U A;  3A0I X;  3BF3 A;  2R7Y A;  1NGH A;  1NGB A;  4CJL A;  4CJT A;  3SQ1 A;  4CF1 A;  3SUP A;  3SMS A;  1NM1 A;  2UUB K;  1UA1 A;  5M1O A;  2G8W A;  4CVN E;  1KSP A;  3F9K A;  3ZT4 A;  2ZD1 A;  3C0B A;  5LMU K;  3HT3 A;  3M8S A;  3C95 A;  1NJX A;  4RW9 A;  2F96 A;  1RT2 A;  3FZF A;  3M6G A;  1W2B M;  5AQU A;  3V9X A;  3SJH A;  3LAK A;  1QQC A;  1MWK A;  3DLE A;  2YNG A;  4AF1 A;  1N5Y A;  1KAX A;  1RT6 A;  2VGM A;  5C2F A;  2XY6 A;  2PY5 A;  1TKZ A;  3O3H A;  1XHZ A;  1IBL K;  4ZTF A;  3RRG A;  3DXM B;  5AQV A;  4B9L A;  3PV8 A;  3MK6 A;  3DLB A;  4KH4 A;  4O8K A;  3R8E A;  4OPJ A;  2QWQ A;  2P9L B;  4CGH A;  4WCE L;  3SAG A;  3O1W A;  5AQZ A;  3EO3 A;  1Q81 O;  3ZSW A;  1N32 K;  1HLU A;  4QS9 A;  4H8K A;  1F21 A;  1GLL O;  3K5M A;  3NVM A;  1MU2 A;  2GUI A;  4PHT X;  3ZT1 A;  4BRA A;  1S9E A;  4NYN A;  3DLK A;  3SJJ A;  1RGI A;  3TAB A;  3QML A;  4AHS A;  3CCS N;  1HPZ A;  4GKK K;  4WFB L;  2OPQ A;  4C1N I;  1K8K A;  4OLB A;  1W0H A;  3ZCM A;  1DEJ A;  1YIT N;  5BPM A;  2D0B A;  5CE3 A;  4M3R A;  5KI6 A;  3OHR A;  1VQ9 N;  1L3S A;  1Q86 O;  3B6O A;  3TSQ A;  4F3T A;  2Z1G A;  1JJ2 M;  4K42 A;  5BPN A;  4JRQ A;  5B8H A;  2KHO A;  1ZBH A;  1OH7 A;  1BCO A;  5ADX H;  3UKR B;  3O5B A;  5BR8 K;  4LF4 K;  5AQJ A;  3CPW M;  4E19 A;  3ZT3 A;  2XRI A;  3CCE N;  1ASW A;  4ELU A;  3LP2 A;  4JD2 B;  4DUY K;  1SQK A;  1KC8 O;  2DPN A;  4IFE A;  1BCM A;  2WFB A;  5GIP A;  2CGL A;  3BDP A;  1TAU A;  4QCL A;  5M1P A;  1N6Q A;  3O4W A;  2V7Z A;  1HNW K;  2ASP A;  1S1X A;  1X9J A;  3MWT A;  3HST B;  3IUC A;  3AY9 A;  4B8C A;  3I33 A;  4GKJ K;  3D7E O;  1HX1 A;  4DQI A;  4C23 A;  3MED A;  2HHV A;  4IWV A;  2JGU A;  2VWK A;  4BC5 A;  5AQY A;  3PY8 A;  4DUZ K;  3Q7C A;  1UA0 A;  2E4L A;  1YTU A;  4HHT A;  1KCF A;  2F7T A;  4C8L A;  4DSI A;  4MO5 A;  3TTD A;  3VEX A;  2Q1N A;  5CHI A;  2F9T A;  3PO4 A;  3G6E N;  2XY8 A;  3ATU A;  3OBY A;  3LM2 A;  5EXW A;  1JXE A;  1BGX T;  3MAQ A;  4IO9 L;  1NJZ A;  3RVC A;  1FXX A;  3CIP A;  3OYH A;  3K9K A;  3V9S A;  2O4I A;  3MX5 A;  4IEE A;  3TSP A;  1BA1 A;  5C12 A;  3TAP A;  3DI6 A;  4KB1 A;  2VG5 A;  3MWP A;  1YJ9 N;  5DK5 A;  4E3S A;  4KPY A;  3ZSQ A;  3OY9 A;  2E2P A;  3BGR A;  3CFR A;  3PSI A;  4H5V A;  4DSF A;  3MCA B;  1N8R O;  3I56 N;  4C8O A;  2QK9 A;  3CI5 A;  4K41 A;  4BWM A;  3ALY A;  4K25 A;  3WXJ A;  4O55 A;  4KHU A;  3KLH A;  2D0C A;  4DV6 K;  4DTP A;  2E2O A;  4O5B A;  3AVB A;  4B1Y B;  3THX B;  3EE8 A;  5DM6 L;  2CH6 A;  3DOK A;  3LAM A;  1WSJ A;  2PFU A;  1UAX A;  3TWH A;  3VF2 A;  3P1G A;  3E66 A;  1Z26 A;  3NH1 A;  4CIF A;  4WF9 L;  3V1Q A;  4JKC A;  5AFU A;  1L3T A;  3THY B;  1BI4 A;  1NKC A;  5C42 A;  2DFF A;  2D0P A;  1HNZ K;  5LY3 A;  4MDB A;  3TAG A;  1HUX A;  1C0M A;  4WQ4 A;  1N36 K;  4JHD B;  4CCH A;  3G4S N;  2FXU A;  2XHB A;  3D45 A;  4IKF A;  1HQU A;  3AVG A;  3PX6 A;  1XMQ K;  2RPI A;  3EZ5 A;  3OYD A;  3RRH A;  3ENB A;  4CF2 A;  2WTU A;  1Y97 A;  2P9S A;  1NWK A;  5E41 A;  4O5F A;  4GV9 A;  3VQD A;  1RTI A;  4IFY A;  5GAG P;  4WYB A;  3VQQ A;  1NK9 A;  4IOX A;  3DWL A;  5AR0 A;  1T6C A;  1JL1 A;  1S72 N;  2A1R A;  5JLH A;  3K0S A;  3EE9 A;  1S9G A;  3CJ7 A;  3CYM A;  1G15 A;  2HHX A;  5CYQ A;  5HRN A;  1NK8 A;  4KKO A;  4CJK A;  2RN2 A;  1QZ5 A;  4JS4 A;  1U45 A;  2IAJ A;  1QQN A;  4M3W A;  4FO0 A;  1WSI A;  3MDQ A;  3HJF A;  3I0S A;  3H3O B;  1BOT O;  3SI6 A;  2HBK A;  4FZY A;  2YHB A;  4NXM K;  5JIC A;  3P83 D;  3KWI A;  3DLH A;  4L3Q A;  1NGC A;  1WSG A;  2O8F A;  1VQ8 N;  4EHU A;  1Q9X A;  2HF3 A;  3OYK A;  5EVZ A;  4JKA A;  3VQ7 A;  5D3G A;  4WQ4 C;  4M42 A;  2P9L A;  3TAN A;  5GAH P;  1RBS A;  1QTM A;  3DM2 A;  4LC9 B;  4IOA L;  1TYQ B;  4GNI A;  4DWI A;  5DMR A;  4ID5 A;  4FWM A;  3TU5 A;  3NGI A;  4DTX A;  2OYQ A;  3A2F A;  4E89 A;  2IGI A;  2Y1J A;  4JYA K;  3KVG A;  4FLU A;  4ZTJ A;  3O3F A;  4CF9 A;  2KZM A;  3MMV A;  2VGN A;  1VK0 A;  3K58 A;  3THW B;  3AVI A;  4DTR A;  1KVA A;  1KLM A;  4CEB A;  3NFA A;  4FVM A;  2YJF A;  4N5S A;  3H46 O;  2EHG A;  3OS0 A;  4JI1 K;  2NLX A;  1VSD A;  4CFC A;  3CG7 A;  1TKD A;  1SV5 A;  2Z1H A;  3ATV A;  2G8F A;  3WNG A;  2FBX A;  4BVO A;  3J80 O;  5I3U A;  2G8K A;  3Q7B A;  3N4P A;  1S22 A;  1BWF O;  2HHW A;  3ID6 A;  4CJ5 A;  1WAJ A;  4DV0 K;  2X6N A;  1DTQ A;  3WXL A;  3VF6 A;  3V1O A;  3ZSO A;  3KKS A;  4BC4 A;  5AQO A;  3AAR A;  2NZT A;  3TAE A;  3QIC A;  3NMU A;  2NRR A;  1LOT B;  4H5N A;  4J2D A;  4CF0 A;  3VA0 A;  2P5O A;  2HVH A;  1SKW A;  5A2Q O;  4BRK A;  5KPT A;  3SZ2 A;  4DSE A;  4DV3 K;  4JLH A;  1J6Z A;  2V51 B;  1VSH A;  2P9K B;  4NXN K;  3O80 A;  3H1V X;  1TL1 A;  3P31 A;  1GLJ O;  3WEE B;  1ZBI A;  2HHQ A;  3QET A;  3UB5 A;  3SAF A;  4K8Z A;  3VTH A;  4DR3 K;  1WBB A;  4PY5 A;  3DOL A;  2IVO A;  1ZBS A;  3CCM N;  1S6P A;  4CEA A;  5FDL A;  2HMP A;  3AO5 A;  2HST A;  3KK3 A;  4YHH K;  4W5T A;  5I42 A;  1HPM A;  4JI0 K;  3U8X A;  4CJR A;  3R9P A;  3HO1 A;  3D2E B;  4FYD A;  1NGD A;  4BRI A;  3RR8 A;  1O13 A;  3VN5 A;  1ESV A;  4IFV A;  4BRM A;  1S5J A;  4LF8 K;  4FW1 A;  2RF2 A;  3VEV A;  4DCH A;  3SQ0 A;  4EP4 A;  2F8T A;  4H4O A;  3FFK B;  4I2Q A;  4BR2 A;  2A1S A;  2Q97 A;  1UWB A;  3OW2 M;  2PYJ A;  4OGC A;  4JI2 K;  1NK4 A;  3ZX3 A;  1W97 L;  3KKR A;  3K5O A;  4IG3 A;  4NCB A;  3OYM A;  5TKW A;  4KTZ A;  4B8A B;  3LPT A;  3ULE A;  3WNF A;  4FWR A;  5JLF A;  4E1N A;  1OH5 A;  2DFE A;  4BRG A;  4H5T A;  5C15 A;  3D6R A;  3DLL L;  4OGE A;  3QEX A;  1T7P A;  1GOB A;  1RFQ A;  4RW4 A;  4B1W B;  1N33 K;  1H1V A;  3EEQ A;  3L0Q A;  3UKU B;  3C7N B;  1I94 K;  1U48 A;  3HK2 A;  1IV0 A;  2FSN A;  3NH0 A;  3SYZ A;  4FPB A;  2VWB A;  1SL0 A;  3EL2 A;  5LJV A;  3N4Q A;  2GX9 A;  3QDK A;  4U67 L;  1BQM A;  3ZSR A;  3L2R A;  5AQT A;  3M8Q A;  3CQX A;  2D4W A;  4DFP A;  1BQN A;  1GOC A;  4CJ4 A;  3OA9 A;  2AJQ A;  3I55 N;  1XWL A;  1ILY A;  2Q0R A;  5HRR A;  1KTQ A;  1U2V B;  4CJQ A;  3ZT0 A;  1U49 A;  1JCF A;  4OKJ A;  4CZM A;  1HR0 K;  2B5J A;  3FZM A;  4RWT A;  1R0A A;  4DR6 K;  2BH1 A;  1CZB A;  4A61 A;  3O9R A;  4H0V B;  5M1N A;  1QS4 A;  3V9U A;  3RSE B;  4BGB A;  4AHU A;  5BPL A;  1Z6R A;  3LWL A;  3O4N A;  4KO0 A;  5KQ8 A;  1RDD A;  4BC3 A;  2YX6 A;  3FLC O;  2RHK A;  4XEI A;  3LZJ A;  2QKK A;  1S1U A;  3CD6 N;  2B4J A;  1RNH A;  3E9O A;  4CEZ A;  1O1W A;  3NCI A;  2WUS A;  4FW2 A;  5EU7 A;  2YHA A;  2UXD K;  1S1T A;  1EET A;  3NF8 A;  4GMJ B;  1KFS A;  2V7Y A;  4QS7 A;  1RT4 A;  2ZE2 A;  3HPH A;  2UXB K;  5HBM A;  3GBT A;  3MXI A;  4EZ9 A;  4R5P A;  5J2P A;  1BU6 O;  1VQ6 N;  3L4Q A;  3WQT A;  2Z1I A;  4CK3 A;  4CD1 A;  3B8A X;  4A2A A;  4YOV A;  3SAH A;  3SPY A;  3E1Y A;  4NYF A;  4OO1 J;  3G71 N;  3DAW A;  4CHZ A;  3G0Z A;  4PWD A;  3JSM A;  3K2P A;  1TL3 A;  1P90 A;  3SLC A;  2V52 B;  2LSN A;  1TAQ A;  2QI2 A;  1RCH A;  4A2B A;  3QEP A;  3DMJ A;  1C0F A;  2GWJ A;  3DRR A;  3LP1 A;  4DV2 K;  1JLB A;  3GDQ A;  3CCU N;  1ATR A;  4DSL A;  4IDK A;  3L4I A;  4BGA A;  4OLA A;  1HRH A;  2ITM A;  3ENO A;  4O0I A;  5AQS A;  3R6M A;  1ASU A;  3E01 A;  3SMP A;  4JKG A;  4DR5 K;  4W5N A;  4F2S A;  4CJW A;  3A5M C;  1WB9 A;  2XY7 A;  3LP0 A;  1XC3 A;  3BY5 A;  3CC7 N;  2P9P B;  3BUZ B;  2UXC K;  3A8Y A;  1HYZ A;  4FVU A;  2IOC A;  3CCV N;  3BZC A;  3SBT A;  3OYN A;  4CK1 A;  4RW6 A;  3O9T A;  1REV A;  1KAY A;  3D2F A;  3ZSZ A;  4AHR A;  3O9Q A;  4TSX A;  4H0X B;  4DU4 A;  2UUA K;  2O8C A;  3M8R A;  3UE5 A;  2G8V A;  1CLQ A;  4CBU A;  1HNX K;  3K5N A;  2ZGZ A;  4GV3 A;  2VG6 A;  2YHW A;  3VA3 A;  4JI4 K;  4XH1 A;  1WLJ A;  4YDU A;  4FL9 A;  1QHA A;  1NGG A;  2IC3 A;  3C94 A;  4DMN A;  1CXQ A;  5FLX O;  1ZBL A;  1C1A A;  1TV6 A;  3QB0 A;  4DTO A;  2HOE A;  3B6P A;  4H03 B;  1KD1 O;  3ISN C;  2A3Z A;  3WNE A;  4M3X A;  3ULD A;  3CCQ N;  4XH5 A;  5IT9 O;  3NF7 A;  1IH7 A;  1HYS A;  3QEW A;  3NH2 A;  4DKW A;  5M1F A;  4FWL A;  1FKP A;  2QM1 A;  4CE9 A;  1YHQ N;  1ASV A;  4C1N K;  1LWE A;  1NU0 A;  4C8M A;  3WEE A;  1FK9 A;  2W42 A;  3E9P A;  4M3T A;  4FOE A;  3OJU A;  2FF6 A;  1NK0 A;  1SL2 A;  4DQQ A;  3OYI A;  1GLF O;  1RDC A;  3U4L A;  3NF6 A;  1SUQ A;  3NAE A;  4PA1 A;  4E7K A;  3QIN A;  4BVP A;  3AVM A;  4CFD A;  4J2B A;  4YOU A;  3NGZ A;  3NHG A;  2Q0U A;  2OA8 A;  4HCB A;  1VSL A;  3DXK B;  4KV8 A;  3CM6 A;  3O4Q A;  3TAF A;  3PLA A;  1U6Z A;  1L3U A;  3QFP A;  2QW9 A;  4H0O A;  3AGK A;  5FPE A;  4IBN A;  2P9N B;  2FC0 A;  2Z1J A;  3CFP A;  4DU1 A;  2B6A A;  1NGI A;  2F8S A;  1HNI A;  4KH5 A;  4BRQ A;  3TAR A;  4YDU C;  2NRV A;  1NGE A;  3IMX A;  4FM2 A;  1I39 A;  1ZYQ A;  4CF8 A;  3P38 A;  3VQ6 A;  2O8D A;  4CGJ A;  4Z0U A;  1P8Z A;  2E6L A;  4CZH A;  4IJN A;  4FK0 A;  4BR9 A;  2E1Z A;  5F2R A;  1S6Q A;  4DB3 A;  3FFI A;  2KTQ A;  4JI5 K;  2E6M A;  3ZET A;  4BRN A;  1YXQ A;  4XIU A;  4JAX A;  5EOY A;  5SWM A;  4AM7 A;  5AQK A;  3ASM A;  3AVN A;  2Y1I A;  4AHV A;  5BRF A;  4LF7 K;  3UKU A;  4DSK A;  4WFN L;  2PAV A;  1M1K O;  2O8E A;  3SCX A;  4H5W A;  3OVN A;  5JVH L;  4CZL A;  4Y0W A;  3VEZ A;  2P9I A;  3AA2 A;  2NNW A;  3KK7 A;  3TTF A;  1RT1 A;  4CK2 A;  1NOY A;  3SV3 A;  2X6S A;  2YNI A;  4A57 A;  2YJE A;  4FM0 A;  1T3V A;  4EP5 A;  1J5E K;  3R3L A;  1NKE A;  3HTV A;  4CZK A;  1BHL A;  1X9W A;  1VAZ A;  3VTI A;  4DR4 K;  2E8A A;  3MN7 A;  2W6K A;  1VSK A;  2G8H A;  4YOT A;  3KLE A;  1OH8 A;  3HM9 A;  3H1Q A;  4O0J A;  4NLB A;  2GEL A;  1WBD A;  4HUF A;  2QKB A;  1J53 A;  3PX4 A;  2P9U B;  3OYG A;  4K43 A;  2KLA A;  1V4T A;  4FJL A;  1TK5 A;  2JWL A;  2PBD A;  4DV1 K;  3ZEU A;  2F4V K;  4I6M A;  3VQ9 A;  3HP6 A;  4DV4 K;  4F9O A;  1Q7Y O;  3QIO A;  3ZYY X;  3CHW A;  1ITG A;  4LH5 A;  4AHT A;  5GAE P;  4CJE A;  4RG8 A;  4WQ5 C;  1OVY A;  3A5L C;  3QES A;  3HM8 A;  4B9N A;  5LMN K;  4CJP A;  5KTQ A;  2EX3 A;  5FPN A;  4IXC A;  3K59 A;  5M1Q A;  2D1K A;  3DRP A;  1LW2 A;  3LDL A;  4FZX C;  1A5X A;  4Z94 A;  4M3U A;  3TAM A;  3KLF A;  4DTU A;  4KI4 A;  3AO2 A;  3C6A A;  1C1B A;  3AAQ A;  4A5B A;  3F73 A;  3VQ4 A;  4B9T A;  2P5G A;  3UIQ A;  4LFA K;  2W41 A;  4CGF A;  3AO1 A;  4JEP A;  4CZF A;  4CHY A;  2BDP A;  3H6E A;  4ISF A;  4DTN A;  4FZZ A;  3BF1 A;  1K9M O;  4JK7 A;  4OPK A;  4M63 C;  1C0T A;  1YJW N;  5HOO A;  1BIZ A;  2I7N A;  2YHY A;  1DGK N;  2H3G X;  1QSL A;  1KFD A;  3RWU A;  1HKG A;  4FWN A;  3F2K A;  4EFH A;  1C6V A;  2ASO A;  5CY4 A;  4DLE A;  1RDA A;  3DRS A;  3AVL A;  4B1Z A;  3KD1 E;  1DLO A;  1XNR K;  3ID8 A;  4CZI A;  4DR7 K;  3DXM A;  1E4G T;  4B3T K;  4CJF A;  4CHN A;  4BDZ A;  3KLI A;  3V9W A;  1XUP O;  2PZS A;  1JLF A;  3MEG A;  3T1A A;  2W6L A;  3P5J A;  1LAW A;  4J2E A;  4CBW A;  3IRX A;  3DJC A;  4B1X B;  4BE0 A;  3KWG A;  1Q82 O;  1EQY A;  1YF5 L;  5EX5 A;  1XI1 A;  4KHQ A;  4UY8 O;  4PUO A;  4WFA L;  2BAN A;  2KZZ A;  3MCP A;  3QIP A;  4EHT A;  2HBJ A;  5BR9 A;  2QWN A;  4LSL A;  1C0U A;  3M8P A;  4LH4 A;  5FRN A;  3S3N A;  3K57 A;  1LWF A;  3QEI A;  3H08 A;  3HOS A;  4FXD A;  3LWM A;  4FJJ A;  1JLA A;  5AQG A;  4BRL A;  3L3U A;  4BG9 A;  3D0P A;  2HBM A;  4BQL A;  3HXM A;  4J8F A;  4LFB K;  1XQS C;  1DTT A;  4G9Z A;  4FJN A;  3CC4 N;  4CFA A;  4F4K A;  1B92 A;  4KH6 A;  2VQE K;  4FJ5 A;  4DQR A;  3ZX0 A;  3C6T A;  3CQ8 A;  4B9U A;  4RW8 A;  4X64 K;  2HW3 A;  3DLG A;  1HKC A;  5AJ3 K;  3DXK A;  4FLW A;  1MA9 B;  3UKR A;  4CIE A;  1Z05 A;  3MN6 A;  2WBN A;  5CZ1 A;  2AA4 A;  1NGF A;  3VER A;  4HUE A;  1YT3 A;  3CJ9 A;  4CIG A;  3EZW A;  5KRS A;  2FLO A;  4B9S A;  2GTD A;  4PKI A;  1W7A A;  3M5R A;  1RBU A;  4G1Q A;  2FBT A;  2IVN A;  3EKS A;  4JD2 A;  3S3O A;  3PSF A;  3F5T A;  1Q8I A;  4FLV A;  4GVE A;  3HP9 A;  1KRP A;  4KTW A;  3G10 A;  4K0K K;  3CF5 L;  1CZ9 A;  3AVC A;  1VSM A;  4FJ7 A;  4I9Q A;  1TKT A;  4E7I A;  1U47 A;  1QHT A;  1RTH A;  3PX0 A;  1XNQ K;  4N56 A;  4JS5 A;  1K8K B;  1BG3 A;  2ITG A;  2W40 A;  3C6U A;  1OH6 A;  3EKU A;  3J81 O;  5C24 A;  1I3A A;  1BUP A;  3AGR A;  4KHY A;  2A6A A;  4NCA A;  4M3Y A;  4NCG A;  3R1X A;  1LW0 A;  2X78 A;  4C8N A;  3JAM O;  1GLB G;  4OJR A;  4B3S K;  5J2M A;  3KHY A;  3QNN A;  1EO1 A;  4NO7 A;  4CJ7 A;  5AQM A;  3IFR A;  4ISG A;  4FJK A;  1T8E A;  2E1Y A;  2HVI A;  3HL8 A;  4JI3 K;  3U3G A;  4IZ9 A;  3HSC A;  3T1Y K;  5FRM A;  2BTF A;  1QSS A;  3DYA A;  1T03 A;  2QXL A;  4I9L A;  2IVP A;  4JI6 K;  3LDS A;  5H1S Q;  1WAF A;  4DLG A;  2IS3 A;  1NMN A;  1VQO N;  4MFB A;  4J2A A;  2HB5 A;  3AVF A;  4V19 S;  4B9Q A;  4H4M A;  3J7Y P;  1VQN N;  3NVK A;  1S3X A;  4CEQ A;  4B3M K;  3MXM A;  1V4S A;  2VYP A;  2RKI A;  4M7X A;  3E9L A;  4CD3 A;  3IKM A;  1VSE A;  4BRO A;  4JK8 A;  5C2D A;  5T7B A;  4Z4C A;  3WUH A;  4YY3 K;  3THX A;  4FLZ A;  4W5Q A;  4HVJ A;  1VSI A;  5CYM A;  4QOZ B;  2JLE A;  3IS9 A; 
#chains in the Genus database with same CATH homology
 4JI5 K;  4JI4 K;  1N34 K;  4X65 K;  4NXM K;  3J7A P;  4AQY K;  4GKK K;  4YHH K;  4LFA K;  4LF7 K;  5FLX O;  3T1H K;  4JI0 K;  2VQF K;  4JI7 K;  4DV6 K;  4DR2 K;  2ZM6 K;  2UXD K;  4DV7 K;  5IT9 O;  4K0K K;  2UUC K;  4X66 K;  2UXB K;  1IBM K;  4LF8 K;  5BR8 K;  4LF4 K;  1J5E K;  4JYA K;  1XNQ K;  1IBK K;  1XNR K;  4DR1 K;  4JI2 K;  4JV5 K;  4DUY K;  4B3R K;  4DR7 K;  2UUB K;  4B3T K;  4DR4 K;  3J81 O;  4CVN E;  4KHP K;  4JI1 K;  5LL6 Z;  1HNZ K;  5LMU K;  4DV2 K;  1HNW K;  3OTO K;  3JAM O;  4GKJ K;  4B3S K;  1N36 K;  2HHH K;  3J80 O;  1XMQ K;  4DUZ K;  4DR5 K;  4JI3 K;  1N33 K;  3T1Y K;  1I94 K;  4DV0 K;  1IBL K;  4DV1 K;  2F4V K;  4JI6 K;  4DV5 K;  4DV4 K;  2UXC K;  4V19 S;  3J7Y P;  4X62 K;  4LF6 K;  1XMO K;  4LF5 K;  4CW7 B;  4B3M K;  5A2Q O;  5LMN K;  4LFB K;  2E5L K;  4DV3 K;  4OX9 K;  4NXN K;  1FJG K;  4LF9 K;  4JI8 K;  1N32 K;  1HR0 K;  5IWA K;  2VQE K;  2UUA K;  2UU9 K;  4DR6 K;  4YY3 K;  4DR3 K;  4X64 K;  1HNX K;  4LFC K;  5AJ3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...