1IBLK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1iblK00
2UXCK 4K0KK 2UU9K 4LF4K 4DR3K 1XNQK 5IWAK 4B3SK 4AQYK 5FLXO 4LFBK 4DV2K 4B3MK 3J80O 1XMQK 4JI6K 4DUYK 4X66K 4LFCK 4JI5K 4X62K 4JI0K 1HNWK 4KHPK 1HNXK 4LFAK 4DR7K 5AJ3K 5A2QO 4DV4K 1XMOK 4JI1K 2UUAK 4JI7K 5IT9O 4V19S 3T1HK 2HHHK 1IBLK 1N34K 4JYAK 4YHHK 2UXBK 4GKJK 4DR2K 3T1YK 2F4VK 1XNRK 4GKKK 1IBKK 2ZM6K 1N32K 4DR5K 1IBMK 4NXNK 4CW7B 4B3TK 4X64K 4LF7K 4CVNE 4DUZK 2VQEK 4LF9K 3J7YP 4OX9K 2UUCK 4JI2K 5BR8K 4LF5K 4B3RK 1HR0K 4NXMK 5LMUK 2UUBK 4DV0K 1FJGK 3OTOK 5LL6Z 1I94K 5LMNK 3J7AP 3J81O 4JI8K 4DV6K 2VQFK 4DR4K 4DR6K 4DR1K 2E5LK 4LF8K 4DV1K 4LF6K 4YY3K 3JAMO 4DV5K 1N33K 1HNZK 4JI4K 4DV3K 4JV5K 1J5EK 2UXDK 4X65K 4JI3K 1N36K 4DV7K
chains in the Genus database with same CATH superfamily
3KLFA 1K8AO 4DR3K 1RDBA 3MX2A 3S3OA 1L5UA 4DSIA 3C0BA 4JNEA 3HI0A 3PY8A 4CEAA 1XHZA 1JXBA 4CESA 3DRRA 1S1WA 4FO0A 1HJRA 4L3QA 4X66K 4CFAA 1K6YA 5KQDA 3PO5A 4PA1A 3VQ6A 3SV3A 4X62K 3T1AA 3WXMB 4CBWA 1HNXK 4FJ8A 5ADXA 1GLCG 3ZETA 4CJVA 4ZTJA 1NKEA 1KFSA 3E9LA 5HBMA 5J2QA 4JI7K 1WOQA 5JS2A 1D5AA 4CF1A 3CC4N 1EQYA 3HO1A 4NLBA 4O5BA 5EY4A 4RW4A 4IOXA 1IG8A 4CD3A 2G8IA 3F5TA 4RW6A 2HNZA 5JLFA 3DLEA 2ZM6K 1JLGA 3EL2A 3QINA 4FLWA 2H3GX 1HMVA 1S1XA 4X64K 4JS5A 3RWUA 4HVJA 3J7YP 3U9ZA 3ZT0A 4IOCL 4B9SA 4W5TA 4FZYA 4Q5VA 3O3GA 1J6ZA 2IDOA 1FJGK 4GV9A 1MA9B 3LDOA 3H3OB 4IDKA 3IMXA 4BG9A 3TSPA 2O8CB 4A5BA 4DV6K 4DLGA 1NMNA 3CCUN 3O9RA 1IKVA 3A8YA 1FW6A 1FKOA 4LSLA 3BF1A 4HWIA 3HYFA 5KGXA 1TKTA 1J5OA 3OYAA 4DWIA 1U6ZA 2XY6A 3O1WA 2ITMA 3NGIA 1DT9A 3H1QA 4JKDA 3TTFA 4FJ7A 4CZEA 4M3RA 3JS6A 4FJKA 2YNIA 3SQ1A 2YI1A 5JS1A 4DV7K 3KD5E 4EZ6A 1EWQA 1YVUA 1REVA 3I0RA 4JAXA 4BC4A 4HCBA 3C6AA 4LFBK 3I0SA 4CJEA 1NGAA 1V4SA 2KLAA 3QFUA 4ID5A 2HBLA 3J7ZO 4IBNA 1NGIA 3D2EB 4Z4HA 4DHYA 1VRUA 3VQCA 3RVCA 3TWHA 3R3LA 1SKSA 1NJYA 4E7LA 4DV4K 5SZTA 2NRZA 3BUZB 3K5OA 4FWNA 4ELUA 4G9ZA 2HHVA 4CJFA 1QVFM 3WT0A 4KFBA 4JKAA 3C65A 3OVNA 1KCFA 3RMDA 4C8NA 4W5QA 3NH0A 3V1QA 3BF3A 2RN2A 4C8OA 2JGUA 2ZQBA 2OYQA 3H46O 4YDUA 4YORA 3ZYYX 5JVHL 3BP8A 1Q8IA 3AO3A 5C12A 4CZGA 5CR4A 4Y1CA 3VQEA 3PX6A 4CHNA 4BWMA 1U4BA 1WLJA 1TYQA 1X3MA 2CGLA 4ISFA 1XQSC 4LY7A 4KTQA 1S6PA 3FZFA 1LCUA 4CJWA 1IKYA 4XH5A 1CZAN 4E3SA 3VOVA 4DS5A 3VEYA 4NCGA 4FWMA 4WQ4A 1WSIA 4FVMA 4H4MA 1HYVA 1YAGA 3J81O 5AQHA 5TKWA 4YOYA 3OYIA 3LANA 1WSHA 4KHYA 1RBRA 4WQ5C 3AVMA 1HPMA 4AM6A 3R1XA 1NBWA 1S1TA 2A6AA 4WF9L 3CIPA 4E7JA 5BN8A 2PYJA 3CQYA 4PKGA 2NRHA 4OVLA 1OH8A 1ZBSA 4X65K 1WBBA 2P9SA 2QWPA 3NE6A 4B3OA 5JMVA 1J9AA 3I56N 2IGIA 5GAHP 1XNQK 1T03A 3KK1A 3SMPA 4JLHA 2YNHA 1VSDA 3EEQA 1YHQN 1TKZA 3ULDA 2ZJPL 1NGCA 4W5OA 1VSHA 1YJWN 1HPZA 1VRTA 2OPSA 3V1OA 2HBKA 5AZJA 3DOKA 4CHOA 1HNWK 4CCHA 5DK5A 2KZMA 3C6HA 3D2EA 1ITGA 4QOZB 4AF1A 4FJHA 1VQNN 2IS3A 4DB3A 3QFPA 1C6VA 4FJ5A 2RKIA 2GV9A 4IWVA 4M41A 3V6DA 2P51A 4JHDB 1W7AA 3ZSVA 4B9NA 1QE1A 1ASUA 2CH5A 2QWOA 2WFBA 5B8HA 5AQQA 3EO3A 3P4IA 2QWMA 2CGKA 3PIOL 5KRTA 3KLHA 2XY5A 2FF6A 3KZBA 2OZMA 5FPEA 2WTUA 1XC3A 1IBMK 4IKFA 1BL3A 4NXNK 3AO2A 4BRDA 4Y1DA 2KFZA 3NH2A 1C0UA 2VQEK 1EKEA 5HLFA 3CYMA 3I8BA 2F96A 5AQJA 3ZX2A 3AVFA 3A2FA 3C95A 5CZ1A 3MK6A 3MWPA 4DV0K 1HJOA 1UOCA 2V51B 1ZC6A 3AA3A 5LMNK 3IS9A 1VSMA 3MN7A 4LH5A 2G8HA 2QI2A 4DS4A 4FJXA 1EX4A 3KK2A 3QEPA 2GWJA 4CHPA 5TKYA 2JWKA 3FZKA 2P9IB 1BG3A 1W97L 1HQUA 4DV5K 5HROA 4CIFA 1HNZK 1TUYA 1Q7YO 1JCFA 5AQTA 1B9FA 4DFMA 3RSEA 4B9QA 2UXDK 3G71N 4B1ZA 4CEOA 4NCBA 4Z0UA 1X9SA 1WN7A 1RDWX 3NF9A 1NWKA 3KVGA 1WB9A 4IO8A 1FKPA 2AJQA 2WOMA 5FLXO 1VSIA 1EP4A 3EKSA 2XO7A 3A5NC 5AFUH 1W0HA 2E8AA 2W6KA 1JLQA 4BRPA 4BR9A 3LDNA 2HHSA 4RW8A 2P9PA 3VQAA 3AVLA 3AVCA 4BREA 3NMUA 1SS6A 4JHDA 1YITN 2E20A 3GE1A 4BR0A 3QNOA 1WNSA 4C8MA 4IEEA 3PIPL 4DSEA 1MWKA 1R59O 2P9UA 3M8RA 2E1YA 1QSLA 3ITHA 3VQ5A 3B8AX 3CJ7A 2P9NB 4B1VA 1KD1O 1UWBA 3BDPA 4YHHK 1KAYA 4DTNA 5AZIB 5BN9A 4ZTFA 1XNRK 4F9OA 3A5LC 3WNFA 4OLBA 3OYCA 2HOEA 3FLCO 4AH9A 1N32K 3VEOA 1JJ2M 3QO9A 2ZGYA 3EN9A 1BU6O 4DU1A 1Q86O 1RTHA 3E66A 4EHUA 4U67L 2UUCK 1N6QA 4KB0A 4L8RB 1VSJA 3G10A 1Q9YA 3SNNA 4E19A 5KRSA 1XI1A 5C42A 2OPRA 4F3OA 2ZWHA 4IFEA 4BQZA 4E7IA 2B4JA 4G1QA 3SQ2A 4DMNA 2QWLA 1DGKN 1YTAA 4BRLA 4C1NK 2W42A 1HYSA 3RR8A 3CFRA 3TU5A 3DLKA 3HOSA 3H3NO 4KRFA 1JCGA 3O80A 1JXEA 1KAZA 4GMJB 1BDGA 2XY7A 1T44A 1NK4A 3M5RA 3VA3A 3AA2A 3VERA 3IDHA 3LAKA 1U04A 1EETA 1IO2A 3K59A 3MXIA 2YKNA 1U45A 4CF9A 2Q97A 2HHWA 2UXCK 1X9WA 2VWJA 1NJWA 4PUOA 2E6MA 4B3SK 1VQON 4DFKA 3RMCA 3ZSYA 3TAGA 1KRPA 5AQGA 2B6AA 1HRHA 2YHBA 4XIUA 3KKRA 3VMFB 3M8PA 3WXJA 4GNIA 3MEDA 4JI5K 4BE2A 3CC2N 4CJTA 2XRIA 4BRKA 5GAGP 1JLAA 2HHQA 3QERA 1NGGA 5T7BA 5AQZA 1IKXA 2FBXA 2HNDA 5CY4A 1E3MA 3K58A 5AQLA 3THYB 3OJSA 1NOYA 4KO0A 3DXMA 3CMEN 3E01A 1U47A 2VG5A 1RTJA 3D0PA 1GLDG 3QNNA 4B9UA 1RT5A 2FSJA 1RBUA 4JKCA 1GLFO 3P38A 2ASPA 3SUNA 3O5BA 4HTUA 4WFAL 1Q18A 2GUPA 3LZIA 1YT3A 1P90A 3TARA 3AA4A 1RGIA 4DSJA 2DY4A 4IOAL 4DQRA 4JKBA 1NK6A 4RG8A 1VSKA 4K8ZA 1SKWA 3ENOA 3SJHA 3NGZA 4DLEA 4FJ9A 1M1KO 1KAXA 5FRNA 1Q82O 1GOAA 1NKBA 4PHTX 2UYTA 4DR4K 1NU0A 4WFNL 4AHCA 3THWA 1HUXA 1UA0A 4DTSA 2KHOA 3D2FB 4WFBL 4JD2B 3BEXA 2O4GA 2CGJA 4OGCA 3DMJA 4JI4K 2Q31A 4FW1A 4CF8A 3NH1A 1P8ZA 2E6LA 3DWLA 2NNWA 4FJNA 4N5SA 3GBTA 1N36K 4JD2A 1BCOA 3EZ5A 5HRPA 2QKBA 3VN5A 4J2DA 5M1QA 4CBUA 4AQYK 1KC8O 3VEZA 1W9HA 4JRPA 4ILHA 1QZ5A 5M1FA 2O8BB 2HNYA 4BE1A 2E2NA 3WQTA 1KTQA 4KHPK 3HVTA 5AZJB 4FCYA 2O8CA 2IC3A 1A5WA 3CETA 3SBTA 3CCMN 3THVA 3MXMA 4N76A 1QQNA 4JI1K 3GG4A 1S1VA 5BR9A 4K8XA 1FXXA 4JKEA 4BRQA 4H5RA 1TYQB 4OKEA 2OTLN 4QAGA 5HRNA 3NF7A 3VESA 3AVJA 4H5TA 3ID8A 1J54A 4JKHA 4F8RA 3VQBA 1Z05A 4TSXA 4JKFA 1VSEA 4GKKK 4FLZA 1WSJA 3RSEB 1QSYA 2ATQA 4DF8A 4CF2A 2G8UA 2BGGA 4BWJA 1VSLA 2GX9A 2VCPA 3LDLA 3B6OA 3VENA 3UKUB 1SZ2A 4F4KA 4PKIA 2Q1NA 4LF5K 3OYDA 3DRSA 5ADXH 4B3RK 3CCQN 1ZBUA 4FLVA 1GLJO 1QHAA 3B6PA 1HX1A 2FSKA 4E1NA 2XHBA 1RTIA 4I6MA 1ZBFA 1I94K 3QBXA 1E4FT 5KPTA 1TV6A 4BRMA 3OYJA 4H03B 4NO7A 3PV8A 3I33A 3DAWA 1QQOA 2YNGA 2P5OA 1X3NA 2P9PB 3JYTA 2GELA 4IJNA 1S6QA 4I6MB 3AVGA 3ENBA 4EP4A 4FOEA 4HUGA 3MN5A 3U3YA 4LF8K 1YJ9N 3V9UA 2NUBA 3M8SA 3IAYA 2BH1A 1SV5A 3O9SA 3EZWA 2X6SA 3NFAA 1ESVA 4RW9A 1QS4A 1TKXA 4PL8A 4MDAA 3OYEA 3M1FA 1VK0A 3WXKA 3DLBA 2PYLA 1S9EA 2YHAA 3IFRA 4MLEA 4CGDA 4IDHA 2E2PA 5F1XA 1RDAA 5JVGL 4K43A 3QICA 4YDUC 3OJUA 3WUHA 3VEVA 3TABA 1Y97A 1NKCA 3WNEA 3KD1E 2HBJA 4H0XB 5D3GA 2QXLA 1KLMA 4M45A 3GDQA 4W5NA 1BO5O 4H0YB 3NDKA 2KW4A 1B9DA 1C1BA 4DTMA 4CIEA 1J53A 3PX4A 3HPHA 3ZETB 3MDQA 2P1JA 3K9KA 3MN9A 1V4TA 4N56A 4DTJA 4MQ3A 3CMAN 1TAQA 3G0ZA 4CGIA 5CE3A 2F4VK 1BA1A 3ZLJA 3CERA 1SAZA 1D9DA 3UKRB 3DM2A 3L3UA 1XUPO 4DQPA 1L3TA 4Q0BA 3MX5A 2A5XA 3DLRA 3S3NA 4BRNA 4FSVA 3VQ9A 2E4LA 4B3TK 1RDCA 4CEDA 3D7EO 2OCEA 4I2PA 4JI2K 2QEXN 3M8QA 1OH6A 2LSNA 1RILA 2X74A 1VQPN 1JLCA 4FOIA 4OPKA 3KIOA 4YFUA 3CCRN 1NGFA 3J7AP 4CBXA 3CQXA 3R6MA 4MO5A 3AARA 4BR2A 1K9MO 2G8WA 4I9QA 3KKSA 3WNHA 2Q0RA 4CEQA 5AQUA 1NGJA 4E7KA 4DFJA 3TAMA 4F2RA 4ZHRA 4DU3A 2D1KA 4M7YA 3ZSQA 1KSPA 4C1NI 4Z4CA 4YY3K 4I2QA 2QK9A 3ZSOA 4OJRA 3C7NB 1H1VA 4DSLA 3PSIA 3IUCA 3HSTB 4AHSA 4CEBA 3FZMA 3ZSWA 4BACA 3WNGA 3FZLA 4KHNA 2BE2A 3BY5A 3MCPA 5JICA 3CXCM 3F9KA 4MDBA 2E2OA 4BRIA 1EO1A 3G6EN 2BUPA 1NK7A 4FK0A 3WXIA 3CFPA 3S9HA 3HJFA 1RCHA 3ZT2A 4CIGA 1T6DA 3O3FA 1ATSA 2E1ZA 1MWMA 1UAXA 4HUFA 4IFYA 1XMOK 4J2EA 3TAFA 3LZJA 1JCEA 5J1EA 2A3ZA 3OYBA 4FJJA 1KVCA 3T1HK 3AAPA 3QEWA 1NGEA 3AVHA 4DTPA 4KI4A 2YV0X 2HHUA 4XH4A 2O4IA 2OPPA 3LDPA 4W5RA 4M3ZA 1S72N 4EZ9A 2X78A 4WQ5A 4DR2K 1TK5A 1RBVA 3ULEB 1YXQA 4OO1J 1BCMA 5C15A 2Q0UA 4IO9L 3P83D 1G15A 3KHYA 4O55A 2IVNA 3K2PA 3ZSRA 3R9PA 1BI4A 4RCHA 3C7NA 4LF7K 4A57A 1RBSA 3ATVA 4FJMA 1O1WA 2O8DB 3TPQA 4CGFA 2ZGZA 5GIOA 4M3YA 3CI5A 3L0QA 3O8MA 3ZT3A 3HM9A 1GOBA 3FR0A 3QIOA 5C2FA 3MECA 4WE1A 4KH5A 3HSCA 2VWBA 4B8CA 2FBVA 4ID1A 3V4IA 3ZT4A 2BDPA 4DQ8A 3VF2A 3LM2A 3BZCA 2A1RA 1LWEA 1VQ5N 4BVPA 5KTQA 1L3UA 4MO4A 5AFUA 4M63C 2D0BA 2DFFA 3H6EA 4E0DA 5AQYA 4KHQA 2UU9K 4AM7A 5F2RA 3CJ9A 3AVIA 3SUPA 2NRXA 5E26A 5IWAK 1RT6A 2DPNA 4FWLA 1DTTA 5BPLA 3EE8A 3LWLA 3UIQA 4CEZA 3CC7N 4KV8A 4LD0A 3U4LA 5AQRA 5EX5A 3H45C 4FZXC 1WUAA 4NCAA 3VGLA 4UQGA 2G8KA 1VQ4N 1NJXA 3OY9A 3BGRA 3QIPA 4DCHA 2R7YA 3SQ4A 3THWB 4CJ3A 3T19A 2HB5A 2I5JA 1QTMA 4KI6A 3QETA 4FJLA 3WQUA 1NOZA 3O3HA 3V9ZA 1L3VA 2WC9A 4FK2A 3CG7A 4CJRA 3VQPA 1X9MA 3L2WA 1W2BM 4DR5K 4C8KA 4CZJA 1LW2A 5HRRA 3TSUA 1SL1A 3EE9A 4E89A 4Z4IA 4H4OA 5DM6L 4BE0A 3PX0A 4K25A 4CHZA 3V9WA 2RPIA 3KK7A 3HPGA 3WXLA 2KTQA 2WONA 3SAGA 5DM7L 3LWMA 3HXMA 4K42A 2QTDA 4OPAA 4PL7A 1XWLA 3R8EA 4CFCA 3K5MA 4BGAA 2ASOA 3IRXA 3OYNA 4J2BA 2VQFK 3RRHA 2NRWA 1S22A 1WSGA 4DR6K 3MAQA 3KK3A 3OHRA 4EAHD 3JXUA 1CZ9A 3U8XA 3MEEA 2E5LK 3CD6N 3M6GA 4DV1K 4CJLA 4LF6K 2NRTA 3JAMO 4BC3A 3O6WA 2FXUA 4FJGA 3AV9A 4FVUA 3DYAA 3I55N 2Q2RA 4NB4A 3O4WA 3CF5L 4U7BA 2HF3A 2EWSA 3AA5X 3V9SA 3DOLA 3OA9A 3QLHA 4YNQA 3ASMA 1RT7A 2IVOA 1RTDA 1LAWA 1SL0A 3QBWA 3DXKA 5M1OA 1GLAG 4CJKA 5EVZA 4C23A 2EHGA 2PFUA 1XMQK 4CF0A 4CZLA 5FDLA 4JI6K 4XEIA 4H0OA 3DI6A 4RWTA 1KLNA 4FL9A 4QS8A 4CJ4A 4LFAK 3QESA 5AJ3K 1LAVA 5AQMA 1ASVA 4CI6A 2Y1JA 2HHHK 4CHYA 4Z4EA 3O4QA 2GUIA 4IZ9A 4BRHA 4QS7A 3HTVA 3H1VX 1JLBA 4C8LA 1K73O 4B08A 2P9LA 5HL7L 2GEMA 3G25A 3U3GA 3BZKA 1X1PA 5HRSA 3QEXA 2RE2A 2P9IA 3L2UA 4YOTA 2YHYA 4DTXA 5AQFA 1T05A 3SBGA 1QQMA 3D45A 3PSFA 4BR7A 2NRRA 4B9MA 3KTQA 4OX9K 4YOUA 5AQOA 1YF5L 2O8EB 1GLBG 5MLCQ 1QQCA 1HKCA 4KHWA 1EXQA 1KVAA 4A59A 3OTOK 1I3AA 3Q7BA 4FJIA 3CJAA 2O8DA 2FC0A 1D4XA 1CZBA 3A5MC 4B9LA 3UE5A 1HKGA 4QS9A 2D0CA 3L4QA 3CPWM 5M1KA 3NHGA 3ZX3A 3QEIA 2HBMA 4DTOA 3NGYA 1MU2A 4BG8A 1C1AA 4CZKA 1LV5A 2RHKA 4Z94A 1BIZA 2W6LA 3LL3A 3HT3A 4JV5K 1U2VA 2EX3A 3D2FA 1L3SA 1NGDA 3TSQA 2KQ2A 1RDUA 2D0PA 2P9LB 4FLTA 2V52B 1QHTA 4DKWA 4PQUA 3TAPA 3C6UA 4BGBA 5I42A 3I8DA 2HF4A 2YX6A 1CXUA 3QDKA 3DXMB 1TL1A 3E9PA 1RBTA 1Z26A 4YOXA 5KPRA 3F73A 2QA4N 3HBTA 4LFCK 4M3UA 2GWKA 4DG1A 3ID6A 1NMDA 4IG3A 2P9KA 3P39A 4KH4A 2X6NA 5A2QO 3AO5A 1JLFA 3OYGA 3AVNA 3SCXA 5IT9O 4NYFA 2DTUA 4GV3A 1KFDA 3O9QA 2QWQA 4H5NA 5FROA 3O4NA 3VEWA 2O8FA 2I7PA 1NJIO 1WSFA 2JWLA 3VGKA 3VQ4A 1R0AA 4CFBA 1BQNA 3NVMA 2QKKA 3V81A 2ZD1A 3W0LA 5C10A 5DMRA 4CZMA 1JL2A 2P9NA 1TKDA 2D5RA 1IBKK 4FPBA 5AZIA 1NK8A 4I7FA 2P9UB 4M3XA 3OYMA 2Q36A 4AILC 5BR8K 1YIJN 5K14A 3HP9A 5GINA 2VGMA 1LWCA 1ZBIA 4EFHA 3OYHA 1HNVA 4BR4A 3L2RA 1JLEA 3HM8A 4JI8K 2HSTA 3OYFA 4DQQA 4IJAA 5C24A 4E1MA 4B8AB 3O9TA 1RDDA 4IFVA 3SAFA 3AGKA 1N5YA 4HTLA 2A1SA 1ILYA 3EKUA 2HMIA 4PWDA 5KGWA 4FK4A 1C0FA 5BREA 3OYKA 4FM1A 4J2AA 4FW2A 3LP3A 5M1PA 5LJWA 1QVGM 4CGJA 3GL1A 2HVHA 2YKMA 2D0AA 1J5EK 4MLHA 3ENHA 3HP6A 4QCLA 2Y1IA 5BPNA 4DF4A 4GVEA 4RTFD 2ZJQL 4J8FA 5C0YA 1BI4B 1CXQA 2J4RA 1LWFA 2YCHA 1XHXA 3A5OC 4JN4A 3HZ6A 2P9KB 4B3MK 3KJVA 3J80O 2IIRA 4O8KA 5KQ8A 4M3TA 4FWSA 2ITGA 3F9MA 1B92A 4B9TA 4DUYK 4OKJA 5J2MA 3HOTA 3DJCA 1OVYA 3NF8A 4CD1A 3PO4A 3L2QA 3SUOA 1Z25A 1S3XA 4JI0K 3L6QA 3CCVN 1OKJA 4FWRA 1BQMA 4OPHA 2NRVA 3OBYA 3LALA 3CCLN 4JRQA 1VSFA 3THXB 3PUFA 1CLQA 1OH7A 1HKBA 3TAQA 2GTDA 4KHUA 4KPYA 1ATRA 2ZE2A 3O9UA 2P9SB 1Q9XA 3L8BA 5I9EB 4CEFA 3TAEA 3SLCA 3AVBA 2OTJN 3T1YK 1NM1A 4GVMA 3SPYA 3G4SN 1YI2N 4M3WA 3FZHA 5F0XA 2QWRA 5GAEP 5EOYA 4CK1A 1RT4A 4LH4A 3RMAA 1D8YA 1NG9A 4O44A 4A5AA 4CJ7A 2FBYA 4DTRA 4CZFA 4AHVA 1YTUA 2DFEA 2A41A 4BDZA 1GLEG 2ZF5O 1TVRA 2G8FA 3TTDA 4JK7A 4CK3A 4B1UB 2Q3SA 1YUWA 3ZEUB 4WYBA 3CJCA 3CCJN 2KKZA 2PY5A 4JEPA 1BUPA 2FLOA 1OH5A 5H1SQ 2O8BA 5BRFA 3LP1A 3ZEUA 4B1XB 1NK0A 5BRDA 3FFIA 4IEIA 1NK5A 3DXKB 1NGHA 3T3FA 1RNHA 4N47A 4BRGA 3LPUA 4DV3K 4FM0A 3ULEA 3VQ7A 4GW6A 4FWPA 1T7PA 2F8TA 4CERA 3CJBA 4BROA 5FPNA 3VGMA 1NK9A 4FWOA 1GOCA 1K8KB 4CGHA 4M7XA 1IV0A 3LPTA 3KWGA 4DFPA 4BC2A 3VQ8A 5AQXA 3VF4A 1VQLN 4WQ4C 3DLLL 3KLEA 4H5WA 3SZ2A 5KI6A 2F8SA 1SQKA 2HHTA 2QW9A 3RTVA 4FXDA 1VQ7N 4CK2A 5I3UA 4KTWA 5EU7A 3SUQA 3VA0A 3K9JA 3MWTA 3O08A 4RW7A 3ATUA 3TTCA 3CCSN 4HHTA 4JYAK 4ILJA 4LC9B 5C2DA 2XY8A 2Z1GA 4B1YB 4ELTA 3MMVA 3SI6A 3F2KA 4B1WB 1JL1A 3ZSXA 1WAJA 1TK8A 3P31A 3TANA 2OZSA 2WUSA 3K5LA 2I7NA 2D0OA 4OPJA 1VQKN 3LP2A 1VQMN 4BDPA 4JKGA 3ISNC 5CHIA 2F9TA 2HHXA 3TR8A 5CYMA 3ZSZA 1HR0K 4BQLA 2KZZA 4DTUA 1C0MA 4ISGA 4BRAA 2UUBK 3DRPA 4YOWA 4E1JA 3ALYA 3AVAA 4XH1A 1YJNN 4JK8A 4H0TB 2F9WA 1HYZA 4HUEA 3VETA 4JKGB 4CHQA 2YHXA 3W3DA 3OYLA 3SYZA 2CH6A 3J8AA 2ZJRL 2YJFA 4DR1K 1IJJA 1D9FA 4H0PA 2AP1A 3SJJA 5SWMA 5AQPA 2NZTA 4OKKA 4KREA 4NLCA 2NLXA 3WEEB 2W40A 2B5JA 2E2QA 1NGBA 4Z4GA 4ISEA 5E84A 3FGUA 5AQIA 4YOVA 3THYA 1ZBHA 4I9LA 3RMBA 4AHRA 4CJ5A 1O13A 4K0KK 3VEXA 4LF4K 4A2AA 3LDQA 3U9DA 4F2SA 4EHTA 4DV2K 3IKMA 1I39A 3QEVA 4O0JA 1RFQA 1ZYQA 4H5VA 1Z6RA 4KHSA 4KTZA 4DSFA 4NYNA 3D6RA 1ZBLA 3LM9A 4DR7K 1QZ6A 5FPMA 2BTFA 1TL3A 3CM6A 4CZIA 2OPQA 3NCIA 4KKOA 4N41A 1WSEA 1BIUA 4A61A 3P5JA 3SPZA 1F21A 1SL2A 1N34K 4O4GA 4O0IA 3CFOA 1IG9A 4FWKA 4GV6A 3ZX0A 4CGGA 4ELVA 4EP5A 3VF6A 1RT2A 4A2BA 1HLUA 1IKWA 3T7ZA 1RT1A 5HP1A 3HPOA 5FRMA 2HMPA 2Z1JA 4LF9K 1G99A 2D4WA 3OS0A 3TI0A 1JKHA 3E9OA 3RRGA 3LAMA 2YJEA 3AVKA 3GOIA 3AY9A 4Z4FA 1WAFA 2ASMA 1NJZA 4DSKA 4JS4A 3WEEA 1ATNA 3K57A 3KLGA 4FLUA 3FFKB 2Z1IA 3RR7A 4BY9C 3V9XA 5LJVA 2AA4A 3CM5A 1BWFO 1OVQA 2O8EA 2F7TA 1HQEA 2IOCA 1S9GA 1N33K 3QB0A 3MN6A 3CCEN 1S1UA 4IXCA 2DFHA 4O8UA 4CZHA 2WBNA 3UB5A 1VQ6N 4KH6A 3CJ1A 5C25A 3THXA 4CEEA 5J2NA 5ELZA 3VQQA 1X9JA 3MEGA 3SV4A 5BRHA 3L4IA 3HRGA 2BANA 3CPEA 5AQKA 2FBTA 3HVRA 2VG6A 5AQSA 1WBDA 1ASWA 3VTHA 3CQ8A 2V7YA 1LW0A 3MCAB 2E88A 1NNEA 4V19S 3DLHA 1TK0A 4K41A 1Y64A 1KQSM 1SKRA 2FSNA 5M1NA 2QM1A 5CZ2A 4EIAA 3VPZA 2OA8A 1T3VA 4ILGB 2OANA 1FK9A 3UKUA 1U48A 5GIPA 1BOTO 2YHWA 1C1CA 4OLAA 1KXPA 2PZSA 1E4GT 2VGNA 4AHUA 5JLHA 4KAZA 5AQNA 4CVNE 3C6TA 4DUZK 4Y0WA 3U6FA 2ETJA 3K5NA 3S3MA 1A5VA 3AAQA 1N8RO 4FPAA 4CECA 4R5PA 3OS1A 5LMUK 5AQVA 3EYZA 4HCCA 5LL6Z 1RT3A 4GY2B 1ZXOA 2A42A 4FLXA 3NAEA 4BR5A 1XC9A 3SAHA 4R79A 1K8KA 2RF2A 3K0SA 1LOTB 3SQ0A 1QSSA 3ZCMA 1VAZA 3T69A 1T8EA 4WCEL 2KFNA 4LSNA 1IH7A 4UY8O 5BPMA 1C0GA 5HOOA 4M42A 3NF6A 4JK9A 4BC5A 1YVNA 4CJQA 1MDUB 3OBWA 3A0IX 4BRFA 1TGOA 1U2VB 3EY1A 1VQ8N 1VQ9N 3P1GA 2YNFA 4F3TA 4FLYA 3O1BA 1DTQA 2PAVA 1HNIA 2P5GA 4O5FA 4DQSA 2W41A 3NBPA 2VWKA 3S41A 1U49A 1BHLA 3AO1A 1T6CA 2GBZA 3QMLA 1TAUA 1Q81O 3LDSA 2QXFA 2IVPA 2Z1HA 1TUUA 1KVBA 1SUQA 2JLEA 4MFBA 3SMSA 5EXWA 2UUAK 2FF3B 3L3VA 2QWNA 4FYDA 4AHTA 4DQIA 2A40A 2IAJA 3MXJA 2VG7A 1IBLK 2G8VA 3UKRA 2V7ZA 3C94A 4BDYA 2VYPA 5AQWA 5J2PA 4A62A 4B9VA 2UXBK 4GKJK 1M90O 3SK3A 1VHXA 4CJSA 5LY3A 2PBDA 3NVKA 4PKHA 4ICLA 4H8KA 3ZT1A 4BVOA 3HL8A 3E1YA 4CJPA 1UA1A 5E41A 1A5XA 1C0TA 4PY5A 1GLLO 3N4PA 4CW7B 4FWQA 3IG1A 4H0VB 4E7HA 1DLOA 2O8FB 3DLGA 5AR0A 5GADP 4CJUA 4NXMK 5KPZA 3H08A 1BGXT 2HVIA 3VTIA 1BISA 5FPDA 1DEJA 4CFDA 3KLIA 3LP0A 3HK2A 1BA0A 4KB1A 3AO4A 1NLVA 4BRCA 3Q7CA 3OS2A 3N4QA 1DKGD 3AGRA 3VQDA 3JSMA 3V1RA 4IG0A 4FZZA 4KBOA 4DU4A 3FE1A 3PLAA 3KWIA 4OGEA 1S5JA 1EWRA 4CE9A 2HW3A 4FM2A 4JI3K 3CHWA 3OW2M 5CYQA 3M3ZA 3L2VA
chains in the Genus database with same CATH topology
2UXCK 4K0KK 2UU9K 4LF4K 4DR3K 1XNQK 5IWAK 4B3SK 4AQYK 5FLXO 4LFBK 4DV2K 4B3MK 3J80O 1XMQK 4JI6K 4DUYK 4X66K 4LFCK 4JI5K 4X62K 4JI0K 1HNWK 4KHPK 1HNXK 4LFAK 4DR7K 5AJ3K 5A2QO 4DV4K 1XMOK 4JI1K 2UUAK 4JI7K 5IT9O 4V19S 3T1HK 2HHHK 1IBLK 1N34K 4JYAK 4YHHK 2UXBK 4GKJK 4DR2K 3T1YK 2F4VK 1XNRK 4GKKK 1IBKK 2ZM6K 1N32K 4DR5K 1IBMK 4NXNK 4CW7B 4B3TK 4X64K 4LF7K 4CVNE 4DUZK 2VQEK 4LF9K 3J7YP 4OX9K 2UUCK 4JI2K 5BR8K 4LF5K 4B3RK 1HR0K 4NXMK 5LMUK 2UUBK 4DV0K 1FJGK 3OTOK 5LL6Z 1I94K 5LMNK 3J7AP 3J81O 4JI8K 4DV6K 2VQFK 4DR4K 4DR6K 4DR1K 2E5LK 4LF8K 4DV1K 4LF6K 4YY3K 3JAMO 4DV5K 1N33K 1HNZK 4JI4K 4DV3K 4JV5K 1J5EK 2UXDK 4X65K 4JI3K 1N36K 4DV7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC K;  4K0K K;  2UU9 K;  4LF4 K;  4DR3 K;  1XNQ K;  5IWA K;  4B3S K;  4AQY K;  5FLX O;  4LFB K;  4DV2 K;  4B3M K;  3J80 O;  1XMQ K;  4JI6 K;  4DUY K;  4X66 K;  4LFC K;  4JI5 K;  4X62 K;  4JI0 K;  1HNW K;  4KHP K;  1HNX K;  4LFA K;  4DR7 K;  5AJ3 K;  5A2Q O;  4DV4 K;  1XMO K;  4JI1 K;  2UUA K;  4JI7 K;  5IT9 O;  4V19 S;  3T1H K;  2HHH K;  1IBL K;  1N34 K;  4JYA K;  4YHH K;  2UXB K;  4GKJ K;  4DR2 K;  3T1Y K;  2F4V K;  1XNR K;  4GKK K;  1IBK K;  2ZM6 K;  1N32 K;  4DR5 K;  1IBM K;  4NXN K;  4CW7 B;  4B3T K;  4X64 K;  4LF7 K;  4CVN E;  4DUZ K;  2VQE K;  4LF9 K;  3J7Y P;  4OX9 K;  2UUC K;  4JI2 K;  5BR8 K;  4LF5 K;  4B3R K;  1HR0 K;  4NXM K;  5LMU K;  2UUB K;  4DV0 K;  1FJG K;  3OTO K;  5LL6 Z;  1I94 K;  5LMN K;  3J7A P;  3J81 O;  4JI8 K;  4DV6 K;  2VQF K;  4DR4 K;  4DR6 K;  4DR1 K;  2E5L K;  4LF8 K;  4DV1 K;  4LF6 K;  4YY3 K;  3JAM O;  4DV5 K;  1N33 K;  1HNZ K;  4JI4 K;  4DV3 K;  4JV5 K;  1J5E K;  2UXD K;  4X65 K;  4JI3 K;  1N36 K;  4DV7 K; 
#chains in the Genus database with same CATH topology
 3KLF A;  1K8A O;  4DR3 K;  1RDB A;  3MX2 A;  3S3O A;  1L5U A;  4DSI A;  3C0B A;  4JNE A;  3HI0 A;  3PY8 A;  4CEA A;  1XHZ A;  1JXB A;  4CES A;  3DRR A;  1S1W A;  4FO0 A;  1HJR A;  4L3Q A;  4X66 K;  4CFA A;  1K6Y A;  5KQD A;  3PO5 A;  4PA1 A;  3VQ6 A;  3SV3 A;  4X62 K;  3T1A A;  3WXM B;  4CBW A;  1HNX K;  4FJ8 A;  5ADX A;  1GLC G;  3ZET A;  4CJV A;  4ZTJ A;  1NKE A;  1KFS A;  3E9L A;  5HBM A;  5J2Q A;  4JI7 K;  1WOQ A;  5JS2 A;  1D5A A;  4CF1 A;  3CC4 N;  1EQY A;  3HO1 A;  4NLB A;  4O5B A;  5EY4 A;  4RW4 A;  4IOX A;  1IG8 A;  4CD3 A;  2G8I A;  3F5T A;  4RW6 A;  2HNZ A;  5JLF A;  3DLE A;  2ZM6 K;  1JLG A;  3EL2 A;  3QIN A;  4FLW A;  2H3G X;  1HMV A;  1S1X A;  4X64 K;  4JS5 A;  3RWU A;  4HVJ A;  3J7Y P;  3U9Z A;  3ZT0 A;  4IOC L;  4B9S A;  4W5T A;  4FZY A;  4Q5V A;  3O3G A;  1J6Z A;  2IDO A;  1FJG K;  4GV9 A;  1MA9 B;  3LDO A;  3H3O B;  4IDK A;  3IMX A;  4BG9 A;  3TSP A;  2O8C B;  4A5B A;  4DV6 K;  4DLG A;  1NMN A;  3CCU N;  3O9R A;  1IKV A;  3A8Y A;  1FW6 A;  1FKO A;  4LSL A;  3BF1 A;  4HWI A;  3HYF A;  5KGX A;  1TKT A;  1J5O A;  3OYA A;  4DWI A;  1U6Z A;  2XY6 A;  3O1W A;  2ITM A;  3NGI A;  1DT9 A;  3H1Q A;  4JKD A;  3TTF A;  4FJ7 A;  4CZE A;  4M3R A;  3JS6 A;  4FJK A;  2YNI A;  3SQ1 A;  2YI1 A;  5JS1 A;  4DV7 K;  3KD5 E;  4EZ6 A;  1EWQ A;  1YVU A;  1REV A;  3I0R A;  4JAX A;  4BC4 A;  4HCB A;  3C6A A;  4LFB K;  3I0S A;  4CJE A;  1NGA A;  1V4S A;  2KLA A;  3QFU A;  4ID5 A;  2HBL A;  3J7Z O;  4IBN A;  1NGI A;  3D2E B;  4Z4H A;  4DHY A;  1VRU A;  3VQC A;  3RVC A;  3TWH A;  3R3L A;  1SKS A;  1NJY A;  4E7L A;  4DV4 K;  5SZT A;  2NRZ A;  3BUZ B;  3K5O A;  4FWN A;  4ELU A;  4G9Z A;  2HHV A;  4CJF A;  1QVF M;  3WT0 A;  4KFB A;  4JKA A;  3C65 A;  3OVN A;  1KCF A;  3RMD A;  4C8N A;  4W5Q A;  3NH0 A;  3V1Q A;  3BF3 A;  2RN2 A;  4C8O A;  2JGU A;  2ZQB A;  2OYQ A;  3H46 O;  4YDU A;  4YOR A;  3ZYY X;  5JVH L;  3BP8 A;  1Q8I A;  3AO3 A;  5C12 A;  4CZG A;  5CR4 A;  4Y1C A;  3VQE A;  3PX6 A;  4CHN A;  4BWM A;  1U4B A;  1WLJ A;  1TYQ A;  1X3M A;  2CGL A;  4ISF A;  1XQS C;  4LY7 A;  4KTQ A;  1S6P A;  3FZF A;  1LCU A;  4CJW A;  1IKY A;  4XH5 A;  1CZA N;  4E3S A;  3VOV A;  4DS5 A;  3VEY A;  4NCG A;  4FWM A;  4WQ4 A;  1WSI A;  4FVM A;  4H4M A;  1HYV A;  1YAG A;  3J81 O;  5AQH A;  5TKW A;  4YOY A;  3OYI A;  3LAN A;  1WSH A;  4KHY A;  1RBR A;  4WQ5 C;  3AVM A;  1HPM A;  4AM6 A;  3R1X A;  1NBW A;  1S1T A;  2A6A A;  4WF9 L;  3CIP A;  4E7J A;  5BN8 A;  2PYJ A;  3CQY A;  4PKG A;  2NRH A;  4OVL A;  1OH8 A;  1ZBS A;  4X65 K;  1WBB A;  2P9S A;  2QWP A;  3NE6 A;  4B3O A;  5JMV A;  1J9A A;  3I56 N;  2IGI A;  5GAH P;  1XNQ K;  1T03 A;  3KK1 A;  3SMP A;  4JLH A;  2YNH A;  1VSD A;  3EEQ A;  1YHQ N;  1TKZ A;  3ULD A;  2ZJP L;  1NGC A;  4W5O A;  1VSH A;  1YJW N;  1HPZ A;  1VRT A;  2OPS A;  3V1O A;  2HBK A;  5AZJ A;  3DOK A;  4CHO A;  1HNW K;  4CCH A;  5DK5 A;  2KZM A;  3C6H A;  3D2E A;  1ITG A;  4QOZ B;  4AF1 A;  4FJH A;  1VQN N;  2IS3 A;  4DB3 A;  3QFP A;  1C6V A;  4FJ5 A;  2RKI A;  2GV9 A;  4IWV A;  4M41 A;  3V6D A;  2P51 A;  4JHD B;  1W7A A;  3ZSV A;  4B9N A;  1QE1 A;  1ASU A;  2CH5 A;  2QWO A;  2WFB A;  5B8H A;  5AQQ A;  3EO3 A;  3P4I A;  2QWM A;  2CGK A;  3PIO L;  5KRT A;  3KLH A;  2XY5 A;  2FF6 A;  3KZB A;  2OZM A;  5FPE A;  2WTU A;  1XC3 A;  1IBM K;  4IKF A;  1BL3 A;  4NXN K;  3AO2 A;  4BRD A;  4Y1D A;  2KFZ A;  3NH2 A;  1C0U A;  2VQE K;  1EKE A;  5HLF A;  3CYM A;  3I8B A;  2F96 A;  5AQJ A;  3ZX2 A;  3AVF A;  3A2F A;  3C95 A;  5CZ1 A;  3MK6 A;  3MWP A;  4DV0 K;  1HJO A;  1UOC A;  2V51 B;  1ZC6 A;  3AA3 A;  5LMN K;  3IS9 A;  1VSM A;  3MN7 A;  4LH5 A;  2G8H A;  2QI2 A;  4DS4 A;  4FJX A;  1EX4 A;  3KK2 A;  3QEP A;  2GWJ A;  4CHP A;  5TKY A;  2JWK A;  3FZK A;  2P9I B;  1BG3 A;  1W97 L;  1HQU A;  4DV5 K;  5HRO A;  4CIF A;  1HNZ K;  1TUY A;  1Q7Y O;  1JCF A;  5AQT A;  1B9F A;  4DFM A;  3RSE A;  4B9Q A;  2UXD K;  3G71 N;  4B1Z A;  4CEO A;  4NCB A;  4Z0U A;  1X9S A;  1WN7 A;  1RDW X;  3NF9 A;  1NWK A;  3KVG A;  1WB9 A;  4IO8 A;  1FKP A;  2AJQ A;  2WOM A;  5FLX O;  1VSI A;  1EP4 A;  3EKS A;  2XO7 A;  3A5N C;  5AFU H;  1W0H A;  2E8A A;  2W6K A;  1JLQ A;  4BRP A;  4BR9 A;  3LDN A;  2HHS A;  4RW8 A;  2P9P A;  3VQA A;  3AVL A;  3AVC A;  4BRE A;  3NMU A;  1SS6 A;  4JHD A;  1YIT N;  2E20 A;  3GE1 A;  4BR0 A;  3QNO A;  1WNS A;  4C8M A;  4IEE A;  3PIP L;  4DSE A;  1MWK A;  1R59 O;  2P9U A;  3M8R A;  2E1Y A;  1QSL A;  3ITH A;  3VQ5 A;  3B8A X;  3CJ7 A;  2P9N B;  4B1V A;  1KD1 O;  1UWB A;  3BDP A;  4YHH K;  1KAY A;  4DTN A;  5AZI B;  5BN9 A;  4ZTF A;  1XNR K;  4F9O A;  3A5L C;  3WNF A;  4OLB A;  3OYC A;  2HOE A;  3FLC O;  4AH9 A;  1N32 K;  3VEO A;  1JJ2 M;  3QO9 A;  2ZGY A;  3EN9 A;  1BU6 O;  4DU1 A;  1Q86 O;  1RTH A;  3E66 A;  4EHU A;  4U67 L;  2UUC K;  1N6Q A;  4KB0 A;  4L8R B;  1VSJ A;  3G10 A;  1Q9Y A;  3SNN A;  4E19 A;  5KRS A;  1XI1 A;  5C42 A;  2OPR A;  4F3O A;  2ZWH A;  4IFE A;  4BQZ A;  4E7I A;  2B4J A;  4G1Q A;  3SQ2 A;  4DMN A;  2QWL A;  1DGK N;  1YTA A;  4BRL A;  4C1N K;  2W42 A;  1HYS A;  3RR8 A;  3CFR A;  3TU5 A;  3DLK A;  3HOS A;  3H3N O;  4KRF A;  1JCG A;  3O80 A;  1JXE A;  1KAZ A;  4GMJ B;  1BDG A;  2XY7 A;  1T44 A;  1NK4 A;  3M5R A;  3VA3 A;  3AA2 A;  3VER A;  3IDH A;  3LAK A;  1U04 A;  1EET A;  1IO2 A;  3K59 A;  3MXI A;  2YKN A;  1U45 A;  4CF9 A;  2Q97 A;  2HHW A;  2UXC K;  1X9W A;  2VWJ A;  1NJW A;  4PUO A;  2E6M A;  4B3S K;  1VQO N;  4DFK A;  3RMC A;  3ZSY A;  3TAG A;  1KRP A;  5AQG A;  2B6A A;  1HRH A;  2YHB A;  4XIU A;  3KKR A;  3VMF B;  3M8P A;  3WXJ A;  4GNI A;  3MED A;  4JI5 K;  4BE2 A;  3CC2 N;  4CJT A;  2XRI A;  4BRK A;  5GAG P;  1JLA A;  2HHQ A;  3QER A;  1NGG A;  5T7B A;  5AQZ A;  1IKX A;  2FBX A;  2HND A;  5CY4 A;  1E3M A;  3K58 A;  5AQL A;  3THY B;  3OJS A;  1NOY A;  4KO0 A;  3DXM A;  3CME N;  3E01 A;  1U47 A;  2VG5 A;  1RTJ A;  3D0P A;  1GLD G;  3QNN A;  4B9U A;  1RT5 A;  2FSJ A;  1RBU A;  4JKC A;  1GLF O;  3P38 A;  2ASP A;  3SUN A;  3O5B A;  4HTU A;  4WFA L;  1Q18 A;  2GUP A;  3LZI A;  1YT3 A;  1P90 A;  3TAR A;  3AA4 A;  1RGI A;  4DSJ A;  2DY4 A;  4IOA L;  4DQR A;  4JKB A;  1NK6 A;  4RG8 A;  1VSK A;  4K8Z A;  1SKW A;  3ENO A;  3SJH A;  3NGZ A;  4DLE A;  4FJ9 A;  1M1K O;  1KAX A;  5FRN A;  1Q82 O;  1GOA A;  1NKB A;  4PHT X;  2UYT A;  4DR4 K;  1NU0 A;  4WFN L;  4AHC A;  3THW A;  1HUX A;  1UA0 A;  4DTS A;  2KHO A;  3D2F B;  4WFB L;  4JD2 B;  3BEX A;  2O4G A;  2CGJ A;  4OGC A;  3DMJ A;  4JI4 K;  2Q31 A;  4FW1 A;  4CF8 A;  3NH1 A;  1P8Z A;  2E6L A;  3DWL A;  2NNW A;  4FJN A;  4N5S A;  3GBT A;  1N36 K;  4JD2 A;  1BCO A;  3EZ5 A;  5HRP A;  2QKB A;  3VN5 A;  4J2D A;  5M1Q A;  4CBU A;  4AQY K;  1KC8 O;  3VEZ A;  1W9H A;  4JRP A;  4ILH A;  1QZ5 A;  5M1F A;  2O8B B;  2HNY A;  4BE1 A;  2E2N A;  3WQT A;  1KTQ A;  4KHP K;  3HVT A;  5AZJ B;  4FCY A;  2O8C A;  2IC3 A;  1A5W A;  3CET A;  3SBT A;  3CCM N;  3THV A;  3MXM A;  4N76 A;  1QQN A;  4JI1 K;  3GG4 A;  1S1V A;  5BR9 A;  4K8X A;  1FXX A;  4JKE A;  4BRQ A;  4H5R A;  1TYQ B;  4OKE A;  2OTL N;  4QAG A;  5HRN A;  3NF7 A;  3VES A;  3AVJ A;  4H5T A;  3ID8 A;  1J54 A;  4JKH A;  4F8R A;  3VQB A;  1Z05 A;  4TSX A;  4JKF A;  1VSE A;  4GKK K;  4FLZ A;  1WSJ A;  3RSE B;  1QSY A;  2ATQ A;  4DF8 A;  4CF2 A;  2G8U A;  2BGG A;  4BWJ A;  1VSL A;  2GX9 A;  2VCP A;  3LDL A;  3B6O A;  3VEN A;  3UKU B;  1SZ2 A;  4F4K A;  4PKI A;  2Q1N A;  4LF5 K;  3OYD A;  3DRS A;  5ADX H;  4B3R K;  3CCQ N;  1ZBU A;  4FLV A;  1GLJ O;  1QHA A;  3B6P A;  1HX1 A;  2FSK A;  4E1N A;  2XHB A;  1RTI A;  4I6M A;  1ZBF A;  1I94 K;  3QBX A;  1E4F T;  5KPT A;  1TV6 A;  4BRM A;  3OYJ A;  4H03 B;  4NO7 A;  3PV8 A;  3I33 A;  3DAW A;  1QQO A;  2YNG A;  2P5O A;  1X3N A;  2P9P B;  3JYT A;  2GEL A;  4IJN A;  1S6Q A;  4I6M B;  3AVG A;  3ENB A;  4EP4 A;  4FOE A;  4HUG A;  3MN5 A;  3U3Y A;  4LF8 K;  1YJ9 N;  3V9U A;  2NUB A;  3M8S A;  3IAY A;  2BH1 A;  1SV5 A;  3O9S A;  3EZW A;  2X6S A;  3NFA A;  1ESV A;  4RW9 A;  1QS4 A;  1TKX A;  4PL8 A;  4MDA A;  3OYE A;  3M1F A;  1VK0 A;  3WXK A;  3DLB A;  2PYL A;  1S9E A;  2YHA A;  3IFR A;  4MLE A;  4CGD A;  4IDH A;  2E2P A;  5F1X A;  1RDA A;  5JVG L;  4K43 A;  3QIC A;  4YDU C;  3OJU A;  3WUH A;  3VEV A;  3TAB A;  1Y97 A;  1NKC A;  3WNE A;  3KD1 E;  2HBJ A;  4H0X B;  5D3G A;  2QXL A;  1KLM A;  4M45 A;  3GDQ A;  4W5N A;  1BO5 O;  4H0Y B;  3NDK A;  2KW4 A;  1B9D A;  1C1B A;  4DTM A;  4CIE A;  1J53 A;  3PX4 A;  3HPH A;  3ZET B;  3MDQ A;  2P1J A;  3K9K A;  3MN9 A;  1V4T A;  4N56 A;  4DTJ A;  4MQ3 A;  3CMA N;  1TAQ A;  3G0Z A;  4CGI A;  5CE3 A;  2F4V K;  1BA1 A;  3ZLJ A;  3CER A;  1SAZ A;  1D9D A;  3UKR B;  3DM2 A;  3L3U A;  1XUP O;  4DQP A;  1L3T A;  4Q0B A;  3MX5 A;  2A5X A;  3DLR A;  3S3N A;  4BRN A;  4FSV A;  3VQ9 A;  2E4L A;  4B3T K;  1RDC A;  4CED A;  3D7E O;  2OCE A;  4I2P A;  4JI2 K;  2QEX N;  3M8Q A;  1OH6 A;  2LSN A;  1RIL A;  2X74 A;  1VQP N;  1JLC A;  4FOI A;  4OPK A;  3KIO A;  4YFU A;  3CCR N;  1NGF A;  3J7A P;  4CBX A;  3CQX A;  3R6M A;  4MO5 A;  3AAR A;  4BR2 A;  1K9M O;  2G8W A;  4I9Q A;  3KKS A;  3WNH A;  2Q0R A;  4CEQ A;  5AQU A;  1NGJ A;  4E7K A;  4DFJ A;  3TAM A;  4F2R A;  4ZHR A;  4DU3 A;  2D1K A;  4M7Y A;  3ZSQ A;  1KSP A;  4C1N I;  4Z4C A;  4YY3 K;  4I2Q A;  2QK9 A;  3ZSO A;  4OJR A;  3C7N B;  1H1V A;  4DSL A;  3PSI A;  3IUC A;  3HST B;  4AHS A;  4CEB A;  3FZM A;  3ZSW A;  4BAC A;  3WNG A;  3FZL A;  4KHN A;  2BE2 A;  3BY5 A;  3MCP A;  5JIC A;  3CXC M;  3F9K A;  4MDB A;  2E2O A;  4BRI A;  1EO1 A;  3G6E N;  2BUP A;  1NK7 A;  4FK0 A;  3WXI A;  3CFP A;  3S9H A;  3HJF A;  1RCH A;  3ZT2 A;  4CIG A;  1T6D A;  3O3F A;  1ATS A;  2E1Z A;  1MWM A;  1UAX A;  4HUF A;  4IFY A;  1XMO K;  4J2E A;  3TAF A;  3LZJ A;  1JCE A;  5J1E A;  2A3Z A;  3OYB A;  4FJJ A;  1KVC A;  3T1H K;  3AAP A;  3QEW A;  1NGE A;  3AVH A;  4DTP A;  4KI4 A;  2YV0 X;  2HHU A;  4XH4 A;  2O4I A;  2OPP A;  3LDP A;  4W5R A;  4M3Z A;  1S72 N;  4EZ9 A;  2X78 A;  4WQ5 A;  4DR2 K;  1TK5 A;  1RBV A;  3ULE B;  1YXQ A;  4OO1 J;  1BCM A;  5C15 A;  2Q0U A;  4IO9 L;  3P83 D;  1G15 A;  3KHY A;  4O55 A;  2IVN A;  3K2P A;  3ZSR A;  3R9P A;  1BI4 A;  4RCH A;  3C7N A;  4LF7 K;  4A57 A;  1RBS A;  3ATV A;  4FJM A;  1O1W A;  2O8D B;  3TPQ A;  4CGF A;  2ZGZ A;  5GIO A;  4M3Y A;  3CI5 A;  3L0Q A;  3O8M A;  3ZT3 A;  3HM9 A;  1GOB A;  3FR0 A;  3QIO A;  5C2F A;  3MEC A;  4WE1 A;  4KH5 A;  3HSC A;  2VWB A;  4B8C A;  2FBV A;  4ID1 A;  3V4I A;  3ZT4 A;  2BDP A;  4DQ8 A;  3VF2 A;  3LM2 A;  3BZC A;  2A1R A;  1LWE A;  1VQ5 N;  4BVP A;  5KTQ A;  1L3U A;  4MO4 A;  5AFU A;  4M63 C;  2D0B A;  2DFF A;  3H6E A;  4E0D A;  5AQY A;  4KHQ A;  2UU9 K;  4AM7 A;  5F2R A;  3CJ9 A;  3AVI A;  3SUP A;  2NRX A;  5E26 A;  5IWA K;  1RT6 A;  2DPN A;  4FWL A;  1DTT A;  5BPL A;  3EE8 A;  3LWL A;  3UIQ A;  4CEZ A;  3CC7 N;  4KV8 A;  4LD0 A;  3U4L A;  5AQR A;  5EX5 A;  3H45 C;  4FZX C;  1WUA A;  4NCA A;  3VGL A;  4UQG A;  2G8K A;  1VQ4 N;  1NJX A;  3OY9 A;  3BGR A;  3QIP A;  4DCH A;  2R7Y A;  3SQ4 A;  3THW B;  4CJ3 A;  3T19 A;  2HB5 A;  2I5J A;  1QTM A;  4KI6 A;  3QET A;  4FJL A;  3WQU A;  1NOZ A;  3O3H A;  3V9Z A;  1L3V A;  2WC9 A;  4FK2 A;  3CG7 A;  4CJR A;  3VQP A;  1X9M A;  3L2W A;  1W2B M;  4DR5 K;  4C8K A;  4CZJ A;  1LW2 A;  5HRR A;  3TSU A;  1SL1 A;  3EE9 A;  4E89 A;  4Z4I A;  4H4O A;  5DM6 L;  4BE0 A;  3PX0 A;  4K25 A;  4CHZ A;  3V9W A;  2RPI A;  3KK7 A;  3HPG A;  3WXL A;  2KTQ A;  2WON A;  3SAG A;  5DM7 L;  3LWM A;  3HXM A;  4K42 A;  2QTD A;  4OPA A;  4PL7 A;  1XWL A;  3R8E A;  4CFC A;  3K5M A;  4BGA A;  2ASO A;  3IRX A;  3OYN A;  4J2B A;  2VQF K;  3RRH A;  2NRW A;  1S22 A;  1WSG A;  4DR6 K;  3MAQ A;  3KK3 A;  3OHR A;  4EAH D;  3JXU A;  1CZ9 A;  3U8X A;  3MEE A;  2E5L K;  3CD6 N;  3M6G A;  4DV1 K;  4CJL A;  4LF6 K;  2NRT A;  3JAM O;  4BC3 A;  3O6W A;  2FXU A;  4FJG A;  3AV9 A;  4FVU A;  3DYA A;  3I55 N;  2Q2R A;  4NB4 A;  3O4W A;  3CF5 L;  4U7B A;  2HF3 A;  2EWS A;  3AA5 X;  3V9S A;  3DOL A;  3OA9 A;  3QLH A;  4YNQ A;  3ASM A;  1RT7 A;  2IVO A;  1RTD A;  1LAW A;  1SL0 A;  3QBW A;  3DXK A;  5M1O A;  1GLA G;  4CJK A;  5EVZ A;  4C23 A;  2EHG A;  2PFU A;  1XMQ K;  4CF0 A;  4CZL A;  5FDL A;  4JI6 K;  4XEI A;  4H0O A;  3DI6 A;  4RWT A;  1KLN A;  4FL9 A;  4QS8 A;  4CJ4 A;  4LFA K;  3QES A;  5AJ3 K;  1LAV A;  5AQM A;  1ASV A;  4CI6 A;  2Y1J A;  2HHH K;  4CHY A;  4Z4E A;  3O4Q A;  2GUI A;  4IZ9 A;  4BRH A;  4QS7 A;  3HTV A;  3H1V X;  1JLB A;  4C8L A;  1K73 O;  4B08 A;  2P9L A;  5HL7 L;  2GEM A;  3G25 A;  3U3G A;  3BZK A;  1X1P A;  5HRS A;  3QEX A;  2RE2 A;  2P9I A;  3L2U A;  4YOT A;  2YHY A;  4DTX A;  5AQF A;  1T05 A;  3SBG A;  1QQM A;  3D45 A;  3PSF A;  4BR7 A;  2NRR A;  4B9M A;  3KTQ A;  4OX9 K;  4YOU A;  5AQO A;  1YF5 L;  2O8E B;  1GLB G;  5MLC Q;  1QQC A;  1HKC A;  4KHW A;  1EXQ A;  1KVA A;  4A59 A;  3OTO K;  1I3A A;  3Q7B A;  4FJI A;  3CJA A;  2O8D A;  2FC0 A;  1D4X A;  1CZB A;  3A5M C;  4B9L A;  3UE5 A;  1HKG A;  4QS9 A;  2D0C A;  3L4Q A;  3CPW M;  5M1K A;  3NHG A;  3ZX3 A;  3QEI A;  2HBM A;  4DTO A;  3NGY A;  1MU2 A;  4BG8 A;  1C1A A;  4CZK A;  1LV5 A;  2RHK A;  4Z94 A;  1BIZ A;  2W6L A;  3LL3 A;  3HT3 A;  4JV5 K;  1U2V A;  2EX3 A;  3D2F A;  1L3S A;  1NGD A;  3TSQ A;  2KQ2 A;  1RDU A;  2D0P A;  2P9L B;  4FLT A;  2V52 B;  1QHT A;  4DKW A;  4PQU A;  3TAP A;  3C6U A;  4BGB A;  5I42 A;  3I8D A;  2HF4 A;  2YX6 A;  1CXU A;  3QDK A;  3DXM B;  1TL1 A;  3E9P A;  1RBT A;  1Z26 A;  4YOX A;  5KPR A;  3F73 A;  2QA4 N;  3HBT A;  4LFC K;  4M3U A;  2GWK A;  4DG1 A;  3ID6 A;  1NMD A;  4IG3 A;  2P9K A;  3P39 A;  4KH4 A;  2X6N A;  5A2Q O;  3AO5 A;  1JLF A;  3OYG A;  3AVN A;  3SCX A;  5IT9 O;  4NYF A;  2DTU A;  4GV3 A;  1KFD A;  3O9Q A;  2QWQ A;  4H5N A;  5FRO A;  3O4N A;  3VEW A;  2O8F A;  2I7P A;  1NJI O;  1WSF A;  2JWL A;  3VGK A;  3VQ4 A;  1R0A A;  4CFB A;  1BQN A;  3NVM A;  2QKK A;  3V81 A;  2ZD1 A;  3W0L A;  5C10 A;  5DMR A;  4CZM A;  1JL2 A;  2P9N A;  1TKD A;  2D5R A;  1IBK K;  4FPB A;  5AZI A;  1NK8 A;  4I7F A;  2P9U B;  4M3X A;  3OYM A;  2Q36 A;  4AIL C;  5BR8 K;  1YIJ N;  5K14 A;  3HP9 A;  5GIN A;  2VGM A;  1LWC A;  1ZBI A;  4EFH A;  3OYH A;  1HNV A;  4BR4 A;  3L2R A;  1JLE A;  3HM8 A;  4JI8 K;  2HST A;  3OYF A;  4DQQ A;  4IJA A;  5C24 A;  4E1M A;  4B8A B;  3O9T A;  1RDD A;  4IFV A;  3SAF A;  3AGK A;  1N5Y A;  4HTL A;  2A1S A;  1ILY A;  3EKU A;  2HMI A;  4PWD A;  5KGW A;  4FK4 A;  1C0F A;  5BRE A;  3OYK A;  4FM1 A;  4J2A A;  4FW2 A;  3LP3 A;  5M1P A;  5LJW A;  1QVG M;  4CGJ A;  3GL1 A;  2HVH A;  2YKM A;  2D0A A;  1J5E K;  4MLH A;  3ENH A;  3HP6 A;  4QCL A;  2Y1I A;  5BPN A;  4DF4 A;  4GVE A;  4RTF D;  2ZJQ L;  4J8F A;  5C0Y A;  1BI4 B;  1CXQ A;  2J4R A;  1LWF A;  2YCH A;  1XHX A;  3A5O C;  4JN4 A;  3HZ6 A;  2P9K B;  4B3M K;  3KJV A;  3J80 O;  2IIR A;  4O8K A;  5KQ8 A;  4M3T A;  4FWS A;  2ITG A;  3F9M A;  1B92 A;  4B9T A;  4DUY K;  4OKJ A;  5J2M A;  3HOT A;  3DJC A;  1OVY A;  3NF8 A;  4CD1 A;  3PO4 A;  3L2Q A;  3SUO A;  1Z25 A;  1S3X A;  4JI0 K;  3L6Q A;  3CCV N;  1OKJ A;  4FWR A;  1BQM A;  4OPH A;  2NRV A;  3OBY A;  3LAL A;  3CCL N;  4JRQ A;  1VSF A;  3THX B;  3PUF A;  1CLQ A;  1OH7 A;  1HKB A;  3TAQ A;  2GTD A;  4KHU A;  4KPY A;  1ATR A;  2ZE2 A;  3O9U A;  2P9S B;  1Q9X A;  3L8B A;  5I9E B;  4CEF A;  3TAE A;  3SLC A;  3AVB A;  2OTJ N;  3T1Y K;  1NM1 A;  4GVM A;  3SPY A;  3G4S N;  1YI2 N;  4M3W A;  3FZH A;  5F0X A;  2QWR A;  5GAE P;  5EOY A;  4CK1 A;  1RT4 A;  4LH4 A;  3RMA A;  1D8Y A;  1NG9 A;  4O44 A;  4A5A A;  4CJ7 A;  2FBY A;  4DTR A;  4CZF A;  4AHV A;  1YTU A;  2DFE A;  2A41 A;  4BDZ A;  1GLE G;  2ZF5 O;  1TVR A;  2G8F A;  3TTD A;  4JK7 A;  4CK3 A;  4B1U B;  2Q3S A;  1YUW A;  3ZEU B;  4WYB A;  3CJC A;  3CCJ N;  2KKZ A;  2PY5 A;  4JEP A;  1BUP A;  2FLO A;  1OH5 A;  5H1S Q;  2O8B A;  5BRF A;  3LP1 A;  3ZEU A;  4B1X B;  1NK0 A;  5BRD A;  3FFI A;  4IEI A;  1NK5 A;  3DXK B;  1NGH A;  3T3F A;  1RNH A;  4N47 A;  4BRG A;  3LPU A;  4DV3 K;  4FM0 A;  3ULE A;  3VQ7 A;  4GW6 A;  4FWP A;  1T7P A;  2F8T A;  4CER A;  3CJB A;  4BRO A;  5FPN A;  3VGM A;  1NK9 A;  4FWO A;  1GOC A;  1K8K B;  4CGH A;  4M7X A;  1IV0 A;  3LPT A;  3KWG A;  4DFP A;  4BC2 A;  3VQ8 A;  5AQX A;  3VF4 A;  1VQL N;  4WQ4 C;  3DLL L;  3KLE A;  4H5W A;  3SZ2 A;  5KI6 A;  2F8S A;  1SQK A;  2HHT A;  2QW9 A;  3RTV A;  4FXD A;  1VQ7 N;  4CK2 A;  5I3U A;  4KTW A;  5EU7 A;  3SUQ A;  3VA0 A;  3K9J A;  3MWT A;  3O08 A;  4RW7 A;  3ATU A;  3TTC A;  3CCS N;  4HHT A;  4JYA K;  4ILJ A;  4LC9 B;  5C2D A;  2XY8 A;  2Z1G A;  4B1Y B;  4ELT A;  3MMV A;  3SI6 A;  3F2K A;  4B1W B;  1JL1 A;  3ZSX A;  1WAJ A;  1TK8 A;  3P31 A;  3TAN A;  2OZS A;  2WUS A;  3K5L A;  2I7N A;  2D0O A;  4OPJ A;  1VQK N;  3LP2 A;  1VQM N;  4BDP A;  4JKG A;  3ISN C;  5CHI A;  2F9T A;  2HHX A;  3TR8 A;  5CYM A;  3ZSZ A;  1HR0 K;  4BQL A;  2KZZ A;  4DTU A;  1C0M A;  4ISG A;  4BRA A;  2UUB K;  3DRP A;  4YOW A;  4E1J A;  3ALY A;  3AVA A;  4XH1 A;  1YJN N;  4JK8 A;  4H0T B;  2F9W A;  1HYZ A;  4HUE A;  3VET A;  4JKG B;  4CHQ A;  2YHX A;  3W3D A;  3OYL A;  3SYZ A;  2CH6 A;  3J8A A;  2ZJR L;  2YJF A;  4DR1 K;  1IJJ A;  1D9F A;  4H0P A;  2AP1 A;  3SJJ A;  5SWM A;  5AQP A;  2NZT A;  4OKK A;  4KRE A;  4NLC A;  2NLX A;  3WEE B;  2W40 A;  2B5J A;  2E2Q A;  1NGB A;  4Z4G A;  4ISE A;  5E84 A;  3FGU A;  5AQI A;  4YOV A;  3THY A;  1ZBH A;  4I9L A;  3RMB A;  4AHR A;  4CJ5 A;  1O13 A;  4K0K K;  3VEX A;  4LF4 K;  4A2A A;  3LDQ A;  3U9D A;  4F2S A;  4EHT A;  4DV2 K;  3IKM A;  1I39 A;  3QEV A;  4O0J A;  1RFQ A;  1ZYQ A;  4H5V A;  1Z6R A;  4KHS A;  4KTZ A;  4DSF A;  4NYN A;  3D6R A;  1ZBL A;  3LM9 A;  4DR7 K;  1QZ6 A;  5FPM A;  2BTF A;  1TL3 A;  3CM6 A;  4CZI A;  2OPQ A;  3NCI A;  4KKO A;  4N41 A;  1WSE A;  1BIU A;  4A61 A;  3P5J A;  3SPZ A;  1F21 A;  1SL2 A;  1N34 K;  4O4G A;  4O0I A;  3CFO A;  1IG9 A;  4FWK A;  4GV6 A;  3ZX0 A;  4CGG A;  4ELV A;  4EP5 A;  3VF6 A;  1RT2 A;  4A2B A;  1HLU A;  1IKW A;  3T7Z A;  1RT1 A;  5HP1 A;  3HPO A;  5FRM A;  2HMP A;  2Z1J A;  4LF9 K;  1G99 A;  2D4W A;  3OS0 A;  3TI0 A;  1JKH A;  3E9O A;  3RRG A;  3LAM A;  2YJE A;  3AVK A;  3GOI A;  3AY9 A;  4Z4F A;  1WAF A;  2ASM A;  1NJZ A;  4DSK A;  4JS4 A;  3WEE A;  1ATN A;  3K57 A;  3KLG A;  4FLU A;  3FFK B;  2Z1I A;  3RR7 A;  4BY9 C;  3V9X A;  5LJV A;  2AA4 A;  3CM5 A;  1BWF O;  1OVQ A;  2O8E A;  2F7T A;  1HQE A;  2IOC A;  1S9G A;  1N33 K;  3QB0 A;  3MN6 A;  3CCE N;  1S1U A;  4IXC A;  2DFH A;  4O8U A;  4CZH A;  2WBN A;  3UB5 A;  1VQ6 N;  4KH6 A;  3CJ1 A;  5C25 A;  3THX A;  4CEE A;  5J2N A;  5ELZ A;  3VQQ A;  1X9J A;  3MEG A;  3SV4 A;  5BRH A;  3L4I A;  3HRG A;  2BAN A;  3CPE A;  5AQK A;  2FBT A;  3HVR A;  2VG6 A;  5AQS A;  1WBD A;  1ASW A;  3VTH A;  3CQ8 A;  2V7Y A;  1LW0 A;  3MCA B;  2E88 A;  1NNE A;  4V19 S;  3DLH A;  1TK0 A;  4K41 A;  1Y64 A;  1KQS M;  1SKR A;  2FSN A;  5M1N A;  2QM1 A;  5CZ2 A;  4EIA A;  3VPZ A;  2OA8 A;  1T3V A;  4ILG B;  2OAN A;  1FK9 A;  3UKU A;  1U48 A;  5GIP A;  1BOT O;  2YHW A;  1C1C A;  4OLA A;  1KXP A;  2PZS A;  1E4G T;  2VGN A;  4AHU A;  5JLH A;  4KAZ A;  5AQN A;  4CVN E;  3C6T A;  4DUZ K;  4Y0W A;  3U6F A;  2ETJ A;  3K5N A;  3S3M A;  1A5V A;  3AAQ A;  1N8R O;  4FPA A;  4CEC A;  4R5P A;  3OS1 A;  5LMU K;  5AQV A;  3EYZ A;  4HCC A;  5LL6 Z;  1RT3 A;  4GY2 B;  1ZXO A;  2A42 A;  4FLX A;  3NAE A;  4BR5 A;  1XC9 A;  3SAH A;  4R79 A;  1K8K A;  2RF2 A;  3K0S A;  1LOT B;  3SQ0 A;  1QSS A;  3ZCM A;  1VAZ A;  3T69 A;  1T8E A;  4WCE L;  2KFN A;  4LSN A;  1IH7 A;  4UY8 O;  5BPM A;  1C0G A;  5HOO A;  4M42 A;  3NF6 A;  4JK9 A;  4BC5 A;  1YVN A;  4CJQ A;  1MDU B;  3OBW A;  3A0I X;  4BRF A;  1TGO A;  1U2V B;  3EY1 A;  1VQ8 N;  1VQ9 N;  3P1G A;  2YNF A;  4F3T A;  4FLY A;  3O1B A;  1DTQ A;  2PAV A;  1HNI A;  2P5G A;  4O5F A;  4DQS A;  2W41 A;  3NBP A;  2VWK A;  3S41 A;  1U49 A;  1BHL A;  3AO1 A;  1T6C A;  2GBZ A;  3QML A;  1TAU A;  1Q81 O;  3LDS A;  2QXF A;  2IVP A;  2Z1H A;  1TUU A;  1KVB A;  1SUQ A;  2JLE A;  4MFB A;  3SMS A;  5EXW A;  2UUA K;  2FF3 B;  3L3V A;  2QWN A;  4FYD A;  4AHT A;  4DQI A;  2A40 A;  2IAJ A;  3MXJ A;  2VG7 A;  1IBL K;  2G8V A;  3UKR A;  2V7Z A;  3C94 A;  4BDY A;  2VYP A;  5AQW A;  5J2P A;  4A62 A;  4B9V A;  2UXB K;  4GKJ K;  1M90 O;  3SK3 A;  1VHX A;  4CJS A;  5LY3 A;  2PBD A;  3NVK A;  4PKH A;  4ICL A;  4H8K A;  3ZT1 A;  4BVO A;  3HL8 A;  3E1Y A;  4CJP A;  1UA1 A;  5E41 A;  1A5X A;  1C0T A;  4PY5 A;  1GLL O;  3N4P A;  4CW7 B;  4FWQ A;  3IG1 A;  4H0V B;  4E7H A;  1DLO A;  2O8F B;  3DLG A;  5AR0 A;  5GAD P;  4CJU A;  4NXM K;  5KPZ A;  3H08 A;  1BGX T;  2HVI A;  3VTI A;  1BIS A;  5FPD A;  1DEJ A;  4CFD A;  3KLI A;  3LP0 A;  3HK2 A;  1BA0 A;  4KB1 A;  3AO4 A;  1NLV A;  4BRC A;  3Q7C A;  3OS2 A;  3N4Q A;  1DKG D;  3AGR A;  3VQD A;  3JSM A;  3V1R A;  4IG0 A;  4FZZ A;  4KBO A;  4DU4 A;  3FE1 A;  3PLA A;  3KWI A;  4OGE A;  1S5J A;  1EWR A;  4CE9 A;  2HW3 A;  4FM2 A;  4JI3 K;  3CHW A;  3OW2 M;  5CYQ A;  3M3Z A;  3L2V A; 
#chains in the Genus database with same CATH homology
 2UXC K;  4K0K K;  2UU9 K;  4LF4 K;  4DR3 K;  1XNQ K;  5IWA K;  4B3S K;  4AQY K;  5FLX O;  4LFB K;  4DV2 K;  4B3M K;  3J80 O;  1XMQ K;  4JI6 K;  4DUY K;  4X66 K;  4LFC K;  4JI5 K;  4X62 K;  4JI0 K;  1HNW K;  4KHP K;  1HNX K;  4LFA K;  4DR7 K;  5AJ3 K;  5A2Q O;  4DV4 K;  1XMO K;  4JI1 K;  2UUA K;  4JI7 K;  5IT9 O;  4V19 S;  3T1H K;  2HHH K;  1IBL K;  1N34 K;  4JYA K;  4YHH K;  2UXB K;  4GKJ K;  4DR2 K;  3T1Y K;  2F4V K;  1XNR K;  4GKK K;  1IBK K;  2ZM6 K;  1N32 K;  4DR5 K;  1IBM K;  4NXN K;  4CW7 B;  4B3T K;  4X64 K;  4LF7 K;  4CVN E;  4DUZ K;  2VQE K;  4LF9 K;  3J7Y P;  4OX9 K;  2UUC K;  4JI2 K;  5BR8 K;  4LF5 K;  4B3R K;  1HR0 K;  4NXM K;  5LMU K;  2UUB K;  4DV0 K;  1FJG K;  3OTO K;  5LL6 Z;  1I94 K;  5LMN K;  3J7A P;  3J81 O;  4JI8 K;  4DV6 K;  2VQF K;  4DR4 K;  4DR6 K;  4DR1 K;  2E5L K;  4LF8 K;  4DV1 K;  4LF6 K;  4YY3 K;  3JAM O;  4DV5 K;  1N33 K;  1HNZ K;  4JI4 K;  4DV3 K;  4JV5 K;  1J5E K;  2UXD K;  4X65 K;  4JI3 K;  1N36 K;  4DV7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...