1IBLK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1iblK00
2UUBK 4X62K 1IBMK 5IT9O 4LFBK 4JI7K 1HNXK 4DUYK 4LF4K 4DV4K 4V19S 5IWAK 4DV1K 4JYAK 4JI0K 4B3SK 4GKKK 2VQFK 4JI4K 4KHPK 4NXNK 1IBKK 4DR4K 4OX9K 1IBLK 4DR2K 2E5LK 4DR3K 4YHHK 4DR1K 1N34K 4LFCK 2UXCK 1HNWK 5LL6Z 4DV7K 4DR6K 1XNQK 1I94K 3J7AP 1XMQK 4CW7B 5A2QO 3J81O 1N33K 3J7YP 3OTOK 1XMOK 5AJ3K 4LF8K 5LMUK 4DR5K 2UXDK 2UU9K 4X66K 4JI8K 4DR7K 4DV5K 4K0KK 4YY3K 2UUCK 2UXBK 4LFAK 4X65K 4LF9K 5BR8K 4B3MK 4LF7K 1N36K 4JI1K 4JI6K 4DV6K 1J5EK 3T1YK 4DV0K 1HNZK 4B3RK 4JV5K 4X64K 2UUAK 4NXMK 5FLXO 4GKJK 4DUZK 3T1HK 4JI3K 4JI5K 4LF5K 4LF6K 4DV3K 3J80O 1XNRK 1FJGK 3JAMO 4AQYK 4CVNE 1N32K 2HHHK 4DV2K 2ZM6K 5LMNK 1HR0K 4B3TK 2VQEK 4JI2K 2F4VK
chains in the Genus database with same CATH superfamily
3EKSA 1OH7A 3NGZA 1RTDA 2V51B 3P39A 1TVRA 2NLXA 1WUAA 4B9VA 4YOTA 2GWJA 4BROA 3RWUA 2O8DB 4KHNA 1VRUA 1QHAA 3HM9A 1TYQA 4BACA 2P9UB 1NGIA 4DTSA 1EKEA 3H08A 2WTUA 4IFVA 1U47A 1RGIA 2YNHA 3EKUA 5J1EA 1WB9A 2PAVA 1MDUB 3KWIA 4OKEA 2D1KA 3IG1A 1KQSM 3OYFA 1YHQN 1T44A 3WXLA 4CK2A 4AILC 2HHQA 4LFCK 3HTVA 3WXJA 1HPMA 5AQUA 2KTQA 3FE1A 1SKSA 3ZT3A 3R1XA 1E3MA 1ATSA 3CPWM 2RHKA 4B08A 4JK7A 5ELZA 3DRSA 3GG4A 3HVRA 2DTUA 5JVHL 1S72N 2VYPA 3A0IX 4FJ9A 1C1BA 3WXMB 5F1XA 3F9KA 4CJPA 4DV5K 1KTQA 4OGCA 1NJXA 3NMUA 4BC2A 3LP0A 4M7XA 2E1YA 3AVFA 1ZBSA 2F9WA 2PFUA 1C0FA 3WNEA 3V9WA 4JAXA 1VSIA 3O4QA 4BGAA 2ZGYA 3J7ZO 4JD2B 3O9QA 4JI1K 4M3ZA 5GADP 2ZWHA 4ISFA 1EETA 3CJCA 3VEWA 4JD2A 4ISGA 4GY2B 1REVA 1Y64A 5FROA 1L5UA 3ZSRA 2P9PB 4RW9A 1RT5A 4B9NA 1VSEA 2HSTA 1NMDA 4LF5K 3U4LA 2E88A 3LM2A 3NGYA 4GNIA 3THYA 1NK7A 1XC9A 4BRFA 3VQCA 2BGGA 5AR0A 4CFBA 3NE6A 3CFPA 2F4VK 4AM7A 1XQSC 3AV9A 3C65A 3JXUA 3O3GA 1ATRA 3AO5A 4DSIA 3M3ZA 3QNNA 3ZT0A 1RDDA 3NVKA 4IFEA 4EHTA 1KCFA 5HOOA 4ILHA 5JICA 2Q31A 1ITGA 2H3GX 1D9FA 4FJIA 3E9OA 4BE0A 4KTQA 3FR0A 3ISNC 4A62A 4JNEA 4BDPA 4DHYA 3ZX0A 5SZTA 1KVCA 3LPUA 4A5AA 3PUFA 4K25A 1A5VA 2GUIA 1IG9A 1Q82O 2ZJRL 3O1BA 2RE2A 4FJ8A 5HL7L 2E8AA 3CFOA 4F3TA 1LWFA 3OA9A 1YT3A 2J4RA 2F8TA 1W2BM 2QWMA 4OLBA 2GEMA 5AZIB 4EP4A 3VQBA 2EWSA 2IVNA 3AO4A 4FJMA 1NK6A 2D0AA 2F8SA 4DQSA 4YY3K 5HBMA 2KW4A 3F2KA 4CF8A 3D2FA 4AHCA 1NOZA 1LW0A 4PKIA 3L4IA 4FWMA 4CZIA 4Z4GA 3MXMA 2FBXA 3NF8A 5AQVA 4CHZA 2KZZA 3TAFA 2I5JA 3GE1A 3U9ZA 4FM2A 4DV6K 4CIEA 1JXBA 3V1QA 1QSSA 3SK3A 2YHWA 3ID6A 4BRCA 2ZQBA 3AO3A 4O8KA 4OPKA 4A61A 4JK9A 3T1HK 4JI5K 4KHUA 1Q81O 4JKHA 1VSLA 3TSUA 1QTMA 1RFQA 1X1PA 3SBGA 2QA4N 3SZ2A 2IS3A 4BR4A 1GLAG 4CBUA 4CJFA 2QWQA 3QNOA 1D5AA 4FLWA 4F2SA 4CBWA 1J6ZA 4BRKA 1HKBA 3O08A 3E9PA 4TSXA 1Z6RA 3MX5A 1Z25A 1FK9A 1GLCG 3PX4A 3ZX2A 2E20A 1C1CA 1K8KA 3NF9A 2DY4A 3ENHA 3P4IA 4FVUA 4Y1DA 4CK3A 3TWHA 3DXKB 2P9KA 1RT3A 5C2FA 1VQ8N 4CJ7A 2G8FA 4KPYA 1X9SA 3SAFA 4CJTA 3AA2A 4FJGA 2NRHA 2A1SA 2G8IA 3AVAA 4KHPK 3TANA 3PX0A 1QZ5A 5KGWA 4EHUA 1TAQA 3K9KA 4KH6A 1CXQA 2Q36A 4B1YB 2GWKA 3WNGA 3OYAA 4WQ5C 1NGEA 3C6TA 4DR6K 3LWLA 4CGFA 3D2FB 4I6MB 4DSJA 3C95A 3BZCA 1T8EA 4LF8K 1NGFA 1NJWA 4FVMA 4A59A 3QEWA 2O4IA 4PL8A 5EXWA 1BA0A 3AGKA 2A5XA 2P5GA 2R7YA 4O8UA 1S9EA 3TPQA 4HTLA 1RBSA 2JWLA 1BCOA 4XH5A 5JLHA 4CHPA 3BP8A 4BR5A 5BPMA 3QBXA 3QESA 1E4FT 3QEXA 1VQON 4B3MK 3OYHA 3OYKA 1QS4A 3S3MA 4CJLA 5AFUA 2XO7A 2E6LA 3OYDA 1UA0A 4KREA 1HMVA 4FK0A 2FXUA 2HBKA 2E4LA 3CXCM 4CGJA 1YF5L 3CM6A 3DLGA 3K59A 5FPEA 4DFMA 1NK9A 3FZFA 4C1NI 1BG3A 3PSFA 1XNRK 4BWMA 4DSEA 3JAMO 3F9MA 2ZD1A 4CEDA 4CI6A 4CEBA 3J8AA 5C42A 1ZBIA 4AH9A 4FJ7A 3FGUA 2Y1JA 3AGRA 4DV2K 4Z0UA 2ZM6K 5M1FA 3KZBA 1A5WA 3I0RA 1BL3A 3HPOA 3F5TA 4JKCA 3ATUA 1BGXT 3CMEN 4B9QA 1SZ2A 3OY9A 4EP5A 4O0JA 3H3OB 3QFUA 5I9EB 4DV4K 3LP3A 4MLEA 1BIUA 3O4NA 3OS1A 4GV9A 1S1WA 2P9NB 4CHNA 2BE2A 3OVNA 1Z05A 2CGKA 5E41A 1KLNA 1HNVA 2DFEA 1JLBA 4K41A 4I2PA 2RKIA 4CGGA 1L3SA 1QQNA 4IO8A 2QWPA 4BC3A 3WEEB 4H4MA 3WT0A 3KWGA 4DKWA 3H45C 4PQUA 1GLLO 3RR7A 3SUOA 5KTQA 4B1WB 4H5RA 1LAVA 2FBTA 3E1YA 3UIQA 1HQEA 1CZAN 1VQNN 4IJAA 3B6PA 3M8PA 4NCAA 3CQ8A 3LDLA 4DTOA 1SUQA 2UUCK 3DOLA 4HWIA 5KI6A 1RT7A 5GIOA 1LV5A 1JLGA 3ZEUA 2QXFA 3LPTA 1BISA 5AZJB 4B9LA 4JRQA 3UKUA 3CMAN 3ENBA 2WONA 1N36K 3GOIA 2O8DA 2ITGA 1GLFO 3DOKA 2CGJA 4CERA 1VAZA 1VQ5N 4NXMK 2P9UA 3M5RA 5FLXO 4GKJK 4YOUA 4Z4FA 5HRRA 2YHYA 2XY7A 4BDYA 3NF6A 2ZJPL 3THXB 3V81A 4DLEA 3CCSN 4MDBA 4FK2A 4CZHA 3TI0A 3AY9A 4YOVA 4KH5A 4H0XB 5JMVA 4HUFA 3H46O 4B9TA 4K43A 1GLBG 4DU4A 4FLZA 1NGBA 1IBMK 1ASUA 4E1NA 4A2BA 4CEFA 1NGJA 1J53A 2HB5A 5AQFA 4H4OA 3HK2A 4BC5A 2HVIA 2G8WA 1U04A 3BDPA 1RDCA 1M1KO 1NLVA 2VQFK 4GV6A 2O8CA 3OYIA 1WNSA 4U67L 5LJWA 1W7AA 1QVFM 5HROA 1T03A 2ASPA 4H5TA 1IBKK 2ASMA 4BRMA 1BUPA 3AARA 3ZSQA 1U49A 3HXMA 2QK9A 3DLEA 3KD1E 3D7EO 3CCUN 3RMCA 1LW2A 3NVMA 3OYNA 4OGEA 1TYQB 4DV7K 1RT4A 1TUUA 5AQTA 2HOEA 2NUBA 3VA0A 3PO4A 4CEEA 3O5BA 4IBNA 2W6LA 3TSQA 4H0VB 1UWBA 3PIPL 1H1VA 3L2VA 4I9QA 4FXDA 4DTRA 3QDKA 1NGAA 1S1UA 1WSEA 2HHTA 4B3OA 1XHZA 3O80A 1S1VA 3ULEA 3CCLN 3HT3A 3FFKB 3VEZA 3E01A 2BH1A 2LSNA 4K42A 4K8XA 3RRHA 2KKZA 1T6DA 1L3TA 4B9SA 2F96A 4KTZA 2Q1NA 4LH4A 3JSMA 5CY4A 2XY6A 3L2QA 4MLHA 4IJNA 1RBVA 3B8AX 4H0YB 5AQZA 4DQ8A 3OS2A 1NJYA 3DXMB 4B1UB 2ZE2A 4CJEA 3AO2A 3GL1A 4DFKA 3AVKA 1RBTA 3DXKA 1BQNA 4BRGA 3UKRB 1DLOA 1XC3A 5GIPA 1K73O 4PA1A 4RW6A 3ZT1A 4YDUC 3L8BA 5M1PA 5C12A 2D0OA 2OZSA 2KFNA 1NKEA 5CZ1A 4FK4A 4DF4A 4YOXA 5EU7A 1GOBA 3L2WA 1TK0A 4DTPA 1T6CA 4I7FA 4O5BA 4RW7A 1ZXOA 1W97L 3EL2A 1NGHA 1P8ZA 3QMLA 4FJJA 4E19A 3VQ9A 1RTHA 4DUYK 2F9TA 3KLEA 3CG7A 4OKKA 3AA5X 5AFUH 4W5RA 3C6AA 4DV1K 1S6PA 2P9SA 3V1RA 3K5LA 3NHGA 5ADXH 3JYTA 4NO7A 5BPNA 3UKUB 1SKRA 2GBZA 2D0BA 1EX4A 3SMSA 3VQ4A 3ZEUB 3ZT2A 1TL1A 1KAZA 4IDKA 4FPBA 4CD3A 4JHDB 3OYJA 1YJNN 1NK5A 3DRPA 1KLMA 2W42A 3SV3A 3ALYA 1NK8A 3SUPA 1GOAA 5FPNA 3F73A 3FLCO 3DYAA 5LMUK 4BGBA 2VWKA 3EYZA 4E7IA 4FLXA 4ISEA 2UXDK 2KHOA 2Q0UA 3T7ZA 1SL1A 2NRWA 4WFNL 3THYB 3LZJA 3O9SA 3VA3A 4PY5A 3AVMA 1Q9XA 4Y0WA 1RNHA 4G1QA 5HP1A 2WOMA 1WAFA 4FCYA 2ASOA 4CE9A 1YTUA 4CCHA 4F8RA 4KBOA 2HBJA 3L3VA 4CFDA 4O4GA 2ATQA 4QS8A 1DT9A 3C6UA 3HZ6A 2FLOA 4FWKA 4J2EA 1YVNA 3DI6A 3U3YA 2AJQA 1QQOA 1TAUA 4IOAL 4B8AB 1NOYA 1VK0A 3QBWA 1IG8A 4Q5VA 4DQRA 4B3TK 2HBMA 4E0DA 4B1XB 2PYJA 4DTNA 3K9JA 4PUOA 4N56A 3CC7N 1TKZA 1HNXK 3SCXA 1YJWN 4LF4K 2ETJA 1OKJA 3M6GA 4DS4A 2Y1IA 1P90A 4B9UA 1UAXA 1D4XA 1JLEA 1WLJA 3L3UA 4QS7A 4ELUA 2O8EB 4NYFA 4J2BA 3ZETA 5M1KA 4FSVA 3QICA 3ZETB 1NKBA 4JKBA 4IFYA 1N34K 5AQNA 4WE1A 3SQ2A 3TR8A 3SJJA 4G9ZA 1NG9A 3D0PA 5BREA 2FF6A 3G4SN 3HBTA 1C0TA 5A2QO 2IC3A 3K57A 5AQLA 5AQOA 4I6MA 1VQ9N 3ENOA 2Z1HA 4X66K 4HCCA 4H5VA 3PX6A 4IDHA 5HRSA 4KHWA 4YORA 3LP2A 3O9TA 3T3FA 4XH1A 3CI5A 1HJOA 4RTFD 1HX1A 2QWRA 4O55A 3KJVA 3L0QA 2Z1JA 1KC8O 2YHAA 4JHDA 4I9LA 4DCHA 2OTJN 2KQ2A 4YOYA 5C25A 2Z1GA 5T7BA 1LAWA 1TUYA 4WQ4C 1J5EK 5EVZA 1IKXA 4JK8A 4DTMA 5AQGA 3DM2A 3MEGA 3SV4A 1RDBA 3N4QA 3DLRA 3CIPA 1OVYA 1DEJA 3EN9A 2A3ZA 4E89A 4BG8A 1JCEA 1B9FA 4BR2A 1KD1O 3VF4A 2FBVA 3HRGA 2G8VA 1HRHA 5HRNA 1NKCA 1S1TA 4BRDA 2O8BA 3SBTA 1NGCA 3VF2A 2GUPA 1TV6A 4Z4HA 2G8KA 1NM1A 5DMRA 4FWOA 4IO9L 2A42A 3TAGA 3CC4N 5TKWA 1EWQA 2Q3SA 1NJZA 3CJAA 2ITMA 1TKDA 4X62K 4F2RA 3EY1A 4FYDA 3LDNA 2NRZA 2B4JA 1JKHA 4JEPA 4DS5A 3DXMA 4CIGA 4EAHD 3EEQA 3A5LC 3HPGA 4ZTJA 3U9DA 2HHXA 3UKRA 5D3GA 3ZSYA 1LOTB 3HYFA 1JJ2M 2IGIA 4BRHA 4FJNA 3HOTA 4AHUA 1IJJA 1GLEG 3M8SA 5GINA 3ZSVA 2RPIA 4FJ5A 4NCBA 2IVPA 1XHXA 2IIRA 5AQKA 4CJ4A 2PYLA 1R0AA 2D0CA 3VQ7A 1I94K 1VSMA 5M1QA 2HMIA 4MO4A 3OYEA 5JS2A 3RSEA 5C15A 1N33K 4FJKA 4HUGA 3KK7A 3R6MA 1IKYA 1NU0A 4KRFA 3VTHA 4DQPA 4BE2A 3PIOL 1U2VA 3A5OC 2A1RA 4CEOA 3VGMA 1W0HA 3VMFB 4BVOA 4LFAK 2X6SA 4BREA 3M8QA 1TKTA 4FO0A 5AQHA 3TTDA 1JCFA 3RMBA 3OJUA 1NK4A 3VEYA 3KTQA 2GTDA 2O8CB 1IO2A 3TSPA 2ZF5O 5DM7L 3LDSA 2VWJA 4FZXC 4Z4EA 1Y97A 4KTWA 4HHTA 1LCUA 2EHGA 1HPZA 5HLFA 4CFCA 3O1WA 1Q8IA 1M90O 4JLHA 4FW2A 2HNDA 2WBNA 5EX5A 2QWLA 1SAZA 2F7TA 5JLFA 2WUSA 4F4KA 5LJVA 4HVJA 3HP9A 5KRTA 1K9MO 4F3OA 1S6QA 3ULEB 2W41A 1HR0K 5DM6L 3T69A 3HO1A 1TGOA 3SUQA 3WXKA 3NDKA 3WNFA 5BN8A 4DFJA 1JLFA 2FF3B 3NCIA 3LM9A 4ELTA 3CF5L 3HVTA 3ZX3A 3CC2N 3NH0A 3SYZA 2B6AA 1T3VA 4IKFA 3V1OA 4OKJA 3DLLL 4O44A 4AHRA 1BU6O 3MEDA 4AM6A 3TU5A 3VOVA 1IKVA 3LL3A 2HMPA 3Q7CA 2O8FA 5AQPA 4DR2K 2RF2A 3W3DA 3ZT4A 2E5LK 4CZJA 3MCAB 1KAYA 3CJ7A 4EZ9A 1BIZA 2E2PA 4JKGA 3G6EN 3BZKA 1FW6A 1U4BA 3OBWA 3VQ5A 1BI4B 5BPLA 5FPMA 1NBWA 4BG9A 5GAEP 3HOSA 2QWNA 4BDZA 4DWIA 4L3QA 4BRIA 3THWA 3D2EB 3CERA 4JI8K 3WEEA 3A5NC 2I7PA 1NJIO 1X9WA 4WYBA 3AVHA 3IRXA 2O8FB 2OCEA 1WSJA 5KPRA 4MDAA 3CYMA 4E7LA 4LF7K 3MN7A 4MFBA 1OVQA 1V4TA 3VESA 2HHWA 4HUEA 1JL1A 5C10A 3A8YA 1WAJA 3NAEA 1ASWA 2FSKA 3LZIA 3V9UA 5C0YA 4GVMA 1HUXA 4DSLA 3CETA 4Z4IA 5MLCQ 1TK5A 4E3SA 4KKOA 4UQGA 4DV3K 5E84A 4CZGA 1T7PA 1VSJA 4DMNA 4IZ9A 4CVNE 3UB5A 3M8RA 4CFAA 3L2RA 4KHYA 3CPEA 3ZLJA 3NFAA 3KLGA 3NBPA 4NLBA 4FLYA 3THWB 1C0GA 1SL2A 2HHSA 3K5NA 3RMDA 2E1ZA 4CZLA 3O3FA 2GV9A 1KVAA 3K58A 2YNFA 3D2EA 3QEIA 4BRAA 4CJ5A 5F2RA 1S22A 1KFSA 1HQUA 3B6OA 3MMVA 2AA4A 5M1OA 3SPYA 3LWMA 4C8KA 1BHLA 1RILA 5E26A 3VN5A 3HP6A 4CJRA 3VERA 4FWLA 1QQCA 3AA3A 4H5NA 4IWVA 1JCGA 5LL6Z 3TAEA 2P9LA 1HLUA 2WC9A 2W40A 1RCHA 3NH1A 4ILGB 4FW1A 4CEQA 4FZYA 1XWLA 4DTXA 3J7YP 4PKHA 5CE3A 3E66A 3OTOK 3EE8A 1NGGA 5FRNA 1UA1A 1JLQA 1WSHA 1HYVA 3N4PA 4GVEA 3ZCMA 1HKGA 2A41A 5AQYA 1HNIA 3MEEA 2E2OA 4M3YA 1BCMA 1CZBA 1JLCA 1X9JA 3HM8A 4M42A 3OJSA 1BA1A 4FM0A 4KFBA 3AAPA 3MXIA 2E6MA 4DSKA 2IOCA 2NZTA 1UOCA 4HTUA 2VGMA 3LAKA 4CJWA 4JI6K 4M3UA 3TAQA 5J2MA 1Q18A 5DK5A 1R59O 3I0SA 3ZYYX 5HRPA 4B8CA 1HKCA 4JV5K 5JS1A 2G8HA 4KB1A 4H0OA 2QKKA 1XI1A 2HNZA 3VENA 2GX9A 4DU1A 5KPTA 1A5XA 3VGKA 3OYLA 3K5OA 4W5OA 3KK1A 1FJGK 2HF3A 3H3NO 3IAYA 1G99A 3Q7BA 3LALA 3PSIA 4OVLA 2YV0X 5LMNK 4JKFA 2V7ZA 3THVA 2VQEK 4L8RB 4EZ6A 1TL3A 3RSEB 4PKGA 2D4WA 3G25A 3H1QA 4WFBL 2YJFA 2P9IA 5BRDA 1X3NA 5J2PA 1FXXA 1D9DA 4J2AA 3VQDA 3O6WA 2QI2A 4N5SA 4GKKK 4ILJA 4LY7A 1C6VA 3SLCA 2G8UA 3V9ZA 4GV3A 1QSYA 4M3XA 3UE5A 1VSDA 4CF1A 2HHUA 4OX9K 3IMXA 4ELVA 4FOIA 2A6AA 1U45A 2YCHA 1CLQA 2BTFA 2E2QA 5F0XA 4WQ5A 3BGRA 1NNEA 1XNQK 4JS5A 3PLAA 2OPRA 3CD6N 3C6HA 3O9RA 3H6EA 3VQPA 3T19A 2O8BB 4OO1J 3MWPA 3LAMA 4FWRA 1DKGD 5AQJA 3OBYA 1LWCA 4IG0A 4Z94A 4FLUA 1RBUA 3SI6A 2VG6A 1IV0A 4LF9K 5BR8K 2O8EA 4FWQA 3P5JA 4C8LA 4FJXA 3WQUA 2KFZA 3T1YK 1HNZK 2Q0RA 3IDHA 4RG8A 3TTFA 3P31A 4X64K 4GW6A 2HW3A 3O4WA 2GELA 3G0ZA 3RVCA 3QEVA 4YDUA 4ID5A 3DMJA 4JKEA 4FZZA 4KI4A 1VRTA 4CECA 3C7NA 5KQDA 3AVIA 2KLAA 3CQXA 3MXJA 2P51A 4QAGA 1K6YA 5SWMA 4OJRA 2OZMA 1BO5O 3KHYA 3LDPA 2O4GA 3FFIA 3VQ6A 4DF8A 3BEXA 1QSLA 1TK8A 3SAGA 1X3MA 2UUBK 1WBDA 5AZIA 1Q86O 1Q7YO 3DJCA 4CESA 3WQTA 4M3TA 3VPZA 2P9PA 4CZEA 5IWAK 3QO9A 4ICLA 5AQIA 3M1FA 1I3AA 4IOXA 1FKPA 3VTIA 3LANA 3DLKA 5C2DA 4KO0A 3P38A 3BF1A 4A2AA 1YAGA 3FZMA 3QETA 4DR3K 4OPJA 4DR1K 3CCQN 1T05A 4YOWA 4DU3A 1QZ6A 3J7AP 2YI1A 2PBDA 4CW7B 3DLHA 3IFRA 1J54A 2OPQA 4R5PA 4E7KA 5J2QA 3VQ8A 4BRNA 4CZKA 3SQ4A 1KFDA 1RBRA 1C0MA 3QERA 2RN2A 1I39A 3ZSZA 3P1GA 3C94A 2IVOA 3MDQA 1MU2A 1VQMN 4B1VA 1BDGA 3AVGA 3EO3A 4BR9A 3VETA 1C0UA 5FPDA 1E4GT 5AQMA 2OPSA 3O9UA 4CZFA 1V4SA 4E7JA 1DTQA 4GMJB 1RT6A 3OYCA 1BWFO 1ESVA 3K5MA 3RMAA 2YNIA 3ZSXA 3KKRA 2QW9A 2XHBA 4IEEA 4CK1A 4W5NA 4IG3A 3WUHA 5AQQA 5I42A 3MN6A 4YFUA 2FSJA 4WCEL 3C0BA 3A2FA 1BQMA 4H8KA 2B5JA 1OH5A 2HHHK 2BANA 3GDQA 4JI2K 5CHIA 3VF6A 4AF1A 4CGDA 3CCMN 1VSHA 3P83D 4MQ3A 4JI7K 5CR4A 5KRSA 4AHVA 5GAHP 4N76A 4FLVA 3OYMA 4V19S 1N6QA 1CZ9A 3CCVN 1U6ZA 1N5YA 3VQQA 3CCEN 3HI0A 4JYAK 3WXIA 4JI0K 1ZBUA 4C1NK 1X9MA 4B3SK 2D0PA 3VQAA 4BR0A 3NH2A 4FPAA 2OA8A 1Z26A 4PL7A 4BRQA 4DTUA 4J8FA 2CGLA 4NXNK 3U3GA 4BVPA 3I55N 1YVUA 4DR4K 4JS4A 3CCRN 4NLCA 2FC0A 3CJ1A 2YHXA 3NF7A 2NRTA 3SNNA 1HNWK 3ULDA 1YXQA 2P9SB 3AVJA 1F21A 1JLAA 5J2NA 3KIOA 4FL9A 1XUPO 3VEVA 4UY8O 3SAHA 4RCHA 4C8NA 1EP4A 3LDOA 3VGLA 4DR5K 5KQ8A 3R9PA 4KHQA 5C24A 1W9HA 1RTJA 3TAMA 1B9DA 3W0LA 1U48A 3D45A 1EXQA 3U8XA 3KK3A 3TABA 2DFHA 3O3HA 1ZBLA 1YTAA 1QHTA 4FWNA 4C8MA 4H03B 3L6QA 4MO5A 4R79A 4DFPA 4J2DA 1FKOA 5GAGP 1S3XA 4U7BA 1KSPA 1EQYA 3DWLA 1QVGM 3QIOA 3RRGA 1YIJN 4DQIA 5TKYA 3JS6A 4KV8A 1VSFA 3QINA 4LF6K 5K14A 5BR9A 4BR7A 4CF0A 2QKBA 1K8KB 1VQPN 4M63C 3ZSWA 3QLHA 5AQWA 1S5JA 4I2QA 3ATVA 4LD0A 4DLGA 3EE9A 3CCJN 1J9AA 3GBTA 3KK2A 2YHBA 4LSLA 4CD1A 2VGNA 1VQ7N 4M3WA 4W5TA 3OHRA 1NGDA 2E2NA 3ID8A 3OW2M 3O8MA 5BRFA 5H1SQ 2YNGA 5BN9A 3R3LA 4JI4K 5M1NA 3I8DA 1MA9B 2NNWA 2HF4A 3I33A 3KD5E 1RDWX 2X78A 5AQXA 4PHTX 3CJBA 2ZGZA 3I8BA 5ADXA 1Q9YA 3OYGA 4DQQA 3G71N 1SL0A 3OYBA 4XIUA 1XMQK 2ZJQL 3AVBA 1WBBA 2OYQA 3J81O 2HVHA 3MCPA 2WFBA 3KLFA 2JWKA 3MX2A 4H0TB 2Q2RA 4CEZA 5LY3A 5CYQA 4FWPA 5AJ3K 1XMOK 1IKWA 4CGIA 4NYNA 2XRIA 1WSFA 2UU9K 3E9LA 4CEAA 2XY8A 4IEIA 4H5WA 4DB3A 4YNQA 4IOCL 4N41A 5KPZA 4CJKA 3S3NA 2QEXN 1VHXA 3HJFA 3SMPA 4Q0BA 5AQRA 2P9LB 3PV8A 1IH7A 4QOZB 3AVLA 3L4QA 1RDAA 4BQLA 2VG7A 4Y1CA 4JKDA 4CIFA 3TTCA 4JRPA 4M7YA 3MN9A 3VEXA 2YKNA 3HSCA 1QQMA 4F9OA 1L3UA 4DSFA 2JGUA 4PWDA 4B3RK 4E1JA 3VEOA 3LDQA 4KH4A 2D5RA 1ATNA 4DUZK 1KAXA 4B1ZA 2W6KA 4OPHA 4NB4A 4LC9B 1YJ9N 3CQYA 4O0IA 5FDLA 4BRPA 5AZJA 3S9HA 4EFHA 2NRRA 1L3VA 2DPNA 3BY5A 3H1VX 3C7NB 4CGHA 4E1MA 2EX3A 1SQKA 3AAQA 5IT9O 1JXEA 4ZTFA 1LWEA 1BI4A 5I3UA 1NK0A 4KHSA 1GLJO 2VCPA 4AHTA 4C23A 1B92A 4C8OA 2I7NA 2FBYA 4RWTA 2VG5A 2PY5A 4E7HA 1SS6A 4BC4A 2CH6A 2OPPA 2HHVA 4NCGA 2YJEA 4RW8A 2IAJA 1N8RO 2HNYA 3HSTB 4CJQA 1HJRA 1VQKN 2OANA 4YHHK 1DGKN 2UXCK 1RDUA 2P9NA 4Z4CA 4CHQA 1RT1A 3ZSOA 3FZKA 3PY8A 1HYSA 3CM5A 4EIAA 4M41A 2QWOA 4CJVA 3MWTA 4CF9A 4WFAL 1G15A 3U6FA 3IKMA 4M3RA 4HCBA 3KLIA 4IXCA 3ASMA 4FJLA 3KVGA 4BY9C 4K0KK 3CFRA 1S9GA 4KAZA 2V7YA 3AVNA 3V6DA 2X6NA 1OH8A 2P1JA 2P5OA 4H0PA 1D8YA 4CJUA 4CF2A 2AP1A 3KLHA 4JKGB 1BOTO 1ILYA 2PZSA 4WF9L 4DV0K 4WQ4A 4KI6A 2UYTA 3S3OA 3QEPA 1EWRA 3K2PA 4JI3K 4LSNA 3SQ0A 2P9IB 3SPZA 5EOYA 2FSNA 1VSKA 3K0SA 3T1AA 4DTJA 3QB0A 4B9MA 1TKXA 2YX6A 1VQ4N 1YITN 1U2VB 5EY4A 3RTVA 1HYZA 3D6RA 3SQ1A 4JN4A 3CJ9A 4OPAA 4AHSA 2NRVA 4CJ3A 4A5BA 4ZHRA 3R8EA 1WOQA 2VWBA 1C1AA 1O1WA 3A5MC 4K8ZA 3KKSA 2QM1A 2A40A 1YI2N 4LFBK 4XH4A 1SKWA 5CZ2A 4FLTA 3S41A 5B8HA 2HBLA 3G10A 4W5QA 3AVCA 2BDPA 2QTDA 4CHYA 1KRPA 1DTTA 3MN5A 2Z1IA 4XEIA 3VQEA 4FJHA 1JL2A 1SV5A 5KGXA 4CJSA 4A57A 3MECA 3BUZB 1J5OA 4BWJA 4O5FA 3ITHA 3TARA 1ASVA 3EZ5A 3HL8A 4BQZA 3DLBA 1IBLK 2Q97A 1MWKA 1ZC6A 1ZBHA 4CHOA 2JLEA 1O13A 3EZWA 1MWMA 4OLAA 4BE1A 2P9KB 2V52B 5FRMA 1KVBA 3HPHA 1VQ6N 2YKMA 1VQLN 3DRRA 4QS9A 3L2UA 5AQSA 3SJHA 4ID1A 3NGIA 3QIPA 4DG1A 3AO1A 2KZMA 4FWSA 3QFPA 1K8AO 4DR7K 5BRHA 1RTIA 2NRXA 2UXBK 2BUPA 1EO1A 3IUCA 4JKAA 3FZHA 1GLDG 3MK6A 4X65K 3PO5A 1NWKA 2OTLN 1YUWA 2X74A 1NMNA 3LP1A 2QXLA 4QCLA 3IS9A 5CYMA 4FM1A 4KB0A 3WNHA 4N47A 1ZBFA 1WN7A 2XY5A 4LH5A 3SUNA 4FOEA 2UUAK 1CXUA 3BF3A 1GOCA 1QE1A 4CZMA 3V9XA 3MAQA 4CBXA 3TAPA 1OH6A 1KXPA 5JVGL 1ZYQA 3J80O 3DAWA 3V9SA 3CHWA 1RT2A 4AQYK 1WSIA 1WSGA 3I56N 3RR8A 3AA4A 2CH5A 4RW4A 1S1XA 1N32K 3V4IA 4BRLA 2DFFA 3OS0A 4M45A 2IDOA 3THXA 3FZLA
chains in the Genus database with same CATH topology
2UUBK 4X62K 1IBMK 5IT9O 4LFBK 4JI7K 1HNXK 4DUYK 4LF4K 4DV4K 4V19S 5IWAK 4DV1K 4JYAK 4JI0K 4B3SK 4GKKK 2VQFK 4JI4K 4KHPK 4NXNK 1IBKK 4DR4K 4OX9K 1IBLK 4DR2K 2E5LK 4DR3K 4YHHK 4DR1K 1N34K 4LFCK 2UXCK 1HNWK 5LL6Z 4DV7K 4DR6K 1XNQK 1I94K 3J7AP 1XMQK 4CW7B 5A2QO 3J81O 1N33K 3J7YP 3OTOK 1XMOK 5AJ3K 4LF8K 5LMUK 4DR5K 2UXDK 2UU9K 4X66K 4JI8K 4DR7K 4DV5K 4K0KK 4YY3K 2UUCK 2UXBK 4LFAK 4X65K 4LF9K 5BR8K 4B3MK 4LF7K 1N36K 4JI1K 4JI6K 4DV6K 1J5EK 3T1YK 4DV0K 1HNZK 4B3RK 4JV5K 4X64K 2UUAK 4NXMK 5FLXO 4GKJK 4DUZK 3T1HK 4JI3K 4JI5K 4LF5K 4LF6K 4DV3K 3J80O 1XNRK 1FJGK 3JAMO 4AQYK 4CVNE 1N32K 2HHHK 4DV2K 2ZM6K 5LMNK 1HR0K 4B3TK 2VQEK 4JI2K 2F4VK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB K;  4X62 K;  1IBM K;  5IT9 O;  4LFB K;  4JI7 K;  1HNX K;  4DUY K;  4LF4 K;  4DV4 K;  4V19 S;  5IWA K;  4DV1 K;  4JYA K;  4JI0 K;  4B3S K;  4GKK K;  2VQF K;  4JI4 K;  4KHP K;  4NXN K;  1IBK K;  4DR4 K;  4OX9 K;  1IBL K;  4DR2 K;  2E5L K;  4DR3 K;  4YHH K;  4DR1 K;  1N34 K;  4LFC K;  2UXC K;  1HNW K;  5LL6 Z;  4DV7 K;  4DR6 K;  1XNQ K;  1I94 K;  3J7A P;  1XMQ K;  4CW7 B;  5A2Q O;  3J81 O;  1N33 K;  3J7Y P;  3OTO K;  1XMO K;  5AJ3 K;  4LF8 K;  5LMU K;  4DR5 K;  2UXD K;  2UU9 K;  4X66 K;  4JI8 K;  4DR7 K;  4DV5 K;  4K0K K;  4YY3 K;  2UUC K;  2UXB K;  4LFA K;  4X65 K;  4LF9 K;  5BR8 K;  4B3M K;  4LF7 K;  1N36 K;  4JI1 K;  4JI6 K;  4DV6 K;  1J5E K;  3T1Y K;  4DV0 K;  1HNZ K;  4B3R K;  4JV5 K;  4X64 K;  2UUA K;  4NXM K;  5FLX O;  4GKJ K;  4DUZ K;  3T1H K;  4JI3 K;  4JI5 K;  4LF5 K;  4LF6 K;  4DV3 K;  3J80 O;  1XNR K;  1FJG K;  3JAM O;  4AQY K;  4CVN E;  1N32 K;  2HHH K;  4DV2 K;  2ZM6 K;  5LMN K;  1HR0 K;  4B3T K;  2VQE K;  4JI2 K;  2F4V K; 
#chains in the Genus database with same CATH topology
 3EKS A;  1OH7 A;  3NGZ A;  1RTD A;  2V51 B;  3P39 A;  1TVR A;  2NLX A;  1WUA A;  4B9V A;  4YOT A;  2GWJ A;  4BRO A;  3RWU A;  2O8D B;  4KHN A;  1VRU A;  1QHA A;  3HM9 A;  1TYQ A;  4BAC A;  2P9U B;  1NGI A;  4DTS A;  1EKE A;  3H08 A;  2WTU A;  4IFV A;  1U47 A;  1RGI A;  2YNH A;  3EKU A;  5J1E A;  1WB9 A;  2PAV A;  1MDU B;  3KWI A;  4OKE A;  2D1K A;  3IG1 A;  1KQS M;  3OYF A;  1YHQ N;  1T44 A;  3WXL A;  4CK2 A;  4AIL C;  2HHQ A;  4LFC K;  3HTV A;  3WXJ A;  1HPM A;  5AQU A;  2KTQ A;  3FE1 A;  1SKS A;  3ZT3 A;  3R1X A;  1E3M A;  1ATS A;  3CPW M;  2RHK A;  4B08 A;  4JK7 A;  5ELZ A;  3DRS A;  3GG4 A;  3HVR A;  2DTU A;  5JVH L;  1S72 N;  2VYP A;  3A0I X;  4FJ9 A;  1C1B A;  3WXM B;  5F1X A;  3F9K A;  4CJP A;  4DV5 K;  1KTQ A;  4OGC A;  1NJX A;  3NMU A;  4BC2 A;  3LP0 A;  4M7X A;  2E1Y A;  3AVF A;  1ZBS A;  2F9W A;  2PFU A;  1C0F A;  3WNE A;  3V9W A;  4JAX A;  1VSI A;  3O4Q A;  4BGA A;  2ZGY A;  3J7Z O;  4JD2 B;  3O9Q A;  4JI1 K;  4M3Z A;  5GAD P;  2ZWH A;  4ISF A;  1EET A;  3CJC A;  3VEW A;  4JD2 A;  4ISG A;  4GY2 B;  1REV A;  1Y64 A;  5FRO A;  1L5U A;  3ZSR A;  2P9P B;  4RW9 A;  1RT5 A;  4B9N A;  1VSE A;  2HST A;  1NMD A;  4LF5 K;  3U4L A;  2E88 A;  3LM2 A;  3NGY A;  4GNI A;  3THY A;  1NK7 A;  1XC9 A;  4BRF A;  3VQC A;  2BGG A;  5AR0 A;  4CFB A;  3NE6 A;  3CFP A;  2F4V K;  4AM7 A;  1XQS C;  3AV9 A;  3C65 A;  3JXU A;  3O3G A;  1ATR A;  3AO5 A;  4DSI A;  3M3Z A;  3QNN A;  3ZT0 A;  1RDD A;  3NVK A;  4IFE A;  4EHT A;  1KCF A;  5HOO A;  4ILH A;  5JIC A;  2Q31 A;  1ITG A;  2H3G X;  1D9F A;  4FJI A;  3E9O A;  4BE0 A;  4KTQ A;  3FR0 A;  3ISN C;  4A62 A;  4JNE A;  4BDP A;  4DHY A;  3ZX0 A;  5SZT A;  1KVC A;  3LPU A;  4A5A A;  3PUF A;  4K25 A;  1A5V A;  2GUI A;  1IG9 A;  1Q82 O;  2ZJR L;  3O1B A;  2RE2 A;  4FJ8 A;  5HL7 L;  2E8A A;  3CFO A;  4F3T A;  1LWF A;  3OA9 A;  1YT3 A;  2J4R A;  2F8T A;  1W2B M;  2QWM A;  4OLB A;  2GEM A;  5AZI B;  4EP4 A;  3VQB A;  2EWS A;  2IVN A;  3AO4 A;  4FJM A;  1NK6 A;  2D0A A;  2F8S A;  4DQS A;  4YY3 K;  5HBM A;  2KW4 A;  3F2K A;  4CF8 A;  3D2F A;  4AHC A;  1NOZ A;  1LW0 A;  4PKI A;  3L4I A;  4FWM A;  4CZI A;  4Z4G A;  3MXM A;  2FBX A;  3NF8 A;  5AQV A;  4CHZ A;  2KZZ A;  3TAF A;  2I5J A;  3GE1 A;  3U9Z A;  4FM2 A;  4DV6 K;  4CIE A;  1JXB A;  3V1Q A;  1QSS A;  3SK3 A;  2YHW A;  3ID6 A;  4BRC A;  2ZQB A;  3AO3 A;  4O8K A;  4OPK A;  4A61 A;  4JK9 A;  3T1H K;  4JI5 K;  4KHU A;  1Q81 O;  4JKH A;  1VSL A;  3TSU A;  1QTM A;  1RFQ A;  1X1P A;  3SBG A;  2QA4 N;  3SZ2 A;  2IS3 A;  4BR4 A;  1GLA G;  4CBU A;  4CJF A;  2QWQ A;  3QNO A;  1D5A A;  4FLW A;  4F2S A;  4CBW A;  1J6Z A;  4BRK A;  1HKB A;  3O08 A;  3E9P A;  4TSX A;  1Z6R A;  3MX5 A;  1Z25 A;  1FK9 A;  1GLC G;  3PX4 A;  3ZX2 A;  2E20 A;  1C1C A;  1K8K A;  3NF9 A;  2DY4 A;  3ENH A;  3P4I A;  4FVU A;  4Y1D A;  4CK3 A;  3TWH A;  3DXK B;  2P9K A;  1RT3 A;  5C2F A;  1VQ8 N;  4CJ7 A;  2G8F A;  4KPY A;  1X9S A;  3SAF A;  4CJT A;  3AA2 A;  4FJG A;  2NRH A;  2A1S A;  2G8I A;  3AVA A;  4KHP K;  3TAN A;  3PX0 A;  1QZ5 A;  5KGW A;  4EHU A;  1TAQ A;  3K9K A;  4KH6 A;  1CXQ A;  2Q36 A;  4B1Y B;  2GWK A;  3WNG A;  3OYA A;  4WQ5 C;  1NGE A;  3C6T A;  4DR6 K;  3LWL A;  4CGF A;  3D2F B;  4I6M B;  4DSJ A;  3C95 A;  3BZC A;  1T8E A;  4LF8 K;  1NGF A;  1NJW A;  4FVM A;  4A59 A;  3QEW A;  2O4I A;  4PL8 A;  5EXW A;  1BA0 A;  3AGK A;  2A5X A;  2P5G A;  2R7Y A;  4O8U A;  1S9E A;  3TPQ A;  4HTL A;  1RBS A;  2JWL A;  1BCO A;  4XH5 A;  5JLH A;  4CHP A;  3BP8 A;  4BR5 A;  5BPM A;  3QBX A;  3QES A;  1E4F T;  3QEX A;  1VQO N;  4B3M K;  3OYH A;  3OYK A;  1QS4 A;  3S3M A;  4CJL A;  5AFU A;  2XO7 A;  2E6L A;  3OYD A;  1UA0 A;  4KRE A;  1HMV A;  4FK0 A;  2FXU A;  2HBK A;  2E4L A;  3CXC M;  4CGJ A;  1YF5 L;  3CM6 A;  3DLG A;  3K59 A;  5FPE A;  4DFM A;  1NK9 A;  3FZF A;  4C1N I;  1BG3 A;  3PSF A;  1XNR K;  4BWM A;  4DSE A;  3JAM O;  3F9M A;  2ZD1 A;  4CED A;  4CI6 A;  4CEB A;  3J8A A;  5C42 A;  1ZBI A;  4AH9 A;  4FJ7 A;  3FGU A;  2Y1J A;  3AGR A;  4DV2 K;  4Z0U A;  2ZM6 K;  5M1F A;  3KZB A;  1A5W A;  3I0R A;  1BL3 A;  3HPO A;  3F5T A;  4JKC A;  3ATU A;  1BGX T;  3CME N;  4B9Q A;  1SZ2 A;  3OY9 A;  4EP5 A;  4O0J A;  3H3O B;  3QFU A;  5I9E B;  4DV4 K;  3LP3 A;  4MLE A;  1BIU A;  3O4N A;  3OS1 A;  4GV9 A;  1S1W A;  2P9N B;  4CHN A;  2BE2 A;  3OVN A;  1Z05 A;  2CGK A;  5E41 A;  1KLN A;  1HNV A;  2DFE A;  1JLB A;  4K41 A;  4I2P A;  2RKI A;  4CGG A;  1L3S A;  1QQN A;  4IO8 A;  2QWP A;  4BC3 A;  3WEE B;  4H4M A;  3WT0 A;  3KWG A;  4DKW A;  3H45 C;  4PQU A;  1GLL O;  3RR7 A;  3SUO A;  5KTQ A;  4B1W B;  4H5R A;  1LAV A;  2FBT A;  3E1Y A;  3UIQ A;  1HQE A;  1CZA N;  1VQN N;  4IJA A;  3B6P A;  3M8P A;  4NCA A;  3CQ8 A;  3LDL A;  4DTO A;  1SUQ A;  2UUC K;  3DOL A;  4HWI A;  5KI6 A;  1RT7 A;  5GIO A;  1LV5 A;  1JLG A;  3ZEU A;  2QXF A;  3LPT A;  1BIS A;  5AZJ B;  4B9L A;  4JRQ A;  3UKU A;  3CMA N;  3ENB A;  2WON A;  1N36 K;  3GOI A;  2O8D A;  2ITG A;  1GLF O;  3DOK A;  2CGJ A;  4CER A;  1VAZ A;  1VQ5 N;  4NXM K;  2P9U A;  3M5R A;  5FLX O;  4GKJ K;  4YOU A;  4Z4F A;  5HRR A;  2YHY A;  2XY7 A;  4BDY A;  3NF6 A;  2ZJP L;  3THX B;  3V81 A;  4DLE A;  3CCS N;  4MDB A;  4FK2 A;  4CZH A;  3TI0 A;  3AY9 A;  4YOV A;  4KH5 A;  4H0X B;  5JMV A;  4HUF A;  3H46 O;  4B9T A;  4K43 A;  1GLB G;  4DU4 A;  4FLZ A;  1NGB A;  1IBM K;  1ASU A;  4E1N A;  4A2B A;  4CEF A;  1NGJ A;  1J53 A;  2HB5 A;  5AQF A;  4H4O A;  3HK2 A;  4BC5 A;  2HVI A;  2G8W A;  1U04 A;  3BDP A;  1RDC A;  1M1K O;  1NLV A;  2VQF K;  4GV6 A;  2O8C A;  3OYI A;  1WNS A;  4U67 L;  5LJW A;  1W7A A;  1QVF M;  5HRO A;  1T03 A;  2ASP A;  4H5T A;  1IBK K;  2ASM A;  4BRM A;  1BUP A;  3AAR A;  3ZSQ A;  1U49 A;  3HXM A;  2QK9 A;  3DLE A;  3KD1 E;  3D7E O;  3CCU N;  3RMC A;  1LW2 A;  3NVM A;  3OYN A;  4OGE A;  1TYQ B;  4DV7 K;  1RT4 A;  1TUU A;  5AQT A;  2HOE A;  2NUB A;  3VA0 A;  3PO4 A;  4CEE A;  3O5B A;  4IBN A;  2W6L A;  3TSQ A;  4H0V B;  1UWB A;  3PIP L;  1H1V A;  3L2V A;  4I9Q A;  4FXD A;  4DTR A;  3QDK A;  1NGA A;  1S1U A;  1WSE A;  2HHT A;  4B3O A;  1XHZ A;  3O80 A;  1S1V A;  3ULE A;  3CCL N;  3HT3 A;  3FFK B;  3VEZ A;  3E01 A;  2BH1 A;  2LSN A;  4K42 A;  4K8X A;  3RRH A;  2KKZ A;  1T6D A;  1L3T A;  4B9S A;  2F96 A;  4KTZ A;  2Q1N A;  4LH4 A;  3JSM A;  5CY4 A;  2XY6 A;  3L2Q A;  4MLH A;  4IJN A;  1RBV A;  3B8A X;  4H0Y B;  5AQZ A;  4DQ8 A;  3OS2 A;  1NJY A;  3DXM B;  4B1U B;  2ZE2 A;  4CJE A;  3AO2 A;  3GL1 A;  4DFK A;  3AVK A;  1RBT A;  3DXK A;  1BQN A;  4BRG A;  3UKR B;  1DLO A;  1XC3 A;  5GIP A;  1K73 O;  4PA1 A;  4RW6 A;  3ZT1 A;  4YDU C;  3L8B A;  5M1P A;  5C12 A;  2D0O A;  2OZS A;  2KFN A;  1NKE A;  5CZ1 A;  4FK4 A;  4DF4 A;  4YOX A;  5EU7 A;  1GOB A;  3L2W A;  1TK0 A;  4DTP A;  1T6C A;  4I7F A;  4O5B A;  4RW7 A;  1ZXO A;  1W97 L;  3EL2 A;  1NGH A;  1P8Z A;  3QML A;  4FJJ A;  4E19 A;  3VQ9 A;  1RTH A;  4DUY K;  2F9T A;  3KLE A;  3CG7 A;  4OKK A;  3AA5 X;  5AFU H;  4W5R A;  3C6A A;  4DV1 K;  1S6P A;  2P9S A;  3V1R A;  3K5L A;  3NHG A;  5ADX H;  3JYT A;  4NO7 A;  5BPN A;  3UKU B;  1SKR A;  2GBZ A;  2D0B A;  1EX4 A;  3SMS A;  3VQ4 A;  3ZEU B;  3ZT2 A;  1TL1 A;  1KAZ A;  4IDK A;  4FPB A;  4CD3 A;  4JHD B;  3OYJ A;  1YJN N;  1NK5 A;  3DRP A;  1KLM A;  2W42 A;  3SV3 A;  3ALY A;  1NK8 A;  3SUP A;  1GOA A;  5FPN A;  3F73 A;  3FLC O;  3DYA A;  5LMU K;  4BGB A;  2VWK A;  3EYZ A;  4E7I A;  4FLX A;  4ISE A;  2UXD K;  2KHO A;  2Q0U A;  3T7Z A;  1SL1 A;  2NRW A;  4WFN L;  3THY B;  3LZJ A;  3O9S A;  3VA3 A;  4PY5 A;  3AVM A;  1Q9X A;  4Y0W A;  1RNH A;  4G1Q A;  5HP1 A;  2WOM A;  1WAF A;  4FCY A;  2ASO A;  4CE9 A;  1YTU A;  4CCH A;  4F8R A;  4KBO A;  2HBJ A;  3L3V A;  4CFD A;  4O4G A;  2ATQ A;  4QS8 A;  1DT9 A;  3C6U A;  3HZ6 A;  2FLO A;  4FWK A;  4J2E A;  1YVN A;  3DI6 A;  3U3Y A;  2AJQ A;  1QQO A;  1TAU A;  4IOA L;  4B8A B;  1NOY A;  1VK0 A;  3QBW A;  1IG8 A;  4Q5V A;  4DQR A;  4B3T K;  2HBM A;  4E0D A;  4B1X B;  2PYJ A;  4DTN A;  3K9J A;  4PUO A;  4N56 A;  3CC7 N;  1TKZ A;  1HNX K;  3SCX A;  1YJW N;  4LF4 K;  2ETJ A;  1OKJ A;  3M6G A;  4DS4 A;  2Y1I A;  1P90 A;  4B9U A;  1UAX A;  1D4X A;  1JLE A;  1WLJ A;  3L3U A;  4QS7 A;  4ELU A;  2O8E B;  4NYF A;  4J2B A;  3ZET A;  5M1K A;  4FSV A;  3QIC A;  3ZET B;  1NKB A;  4JKB A;  4IFY A;  1N34 K;  5AQN A;  4WE1 A;  3SQ2 A;  3TR8 A;  3SJJ A;  4G9Z A;  1NG9 A;  3D0P A;  5BRE A;  2FF6 A;  3G4S N;  3HBT A;  1C0T A;  5A2Q O;  2IC3 A;  3K57 A;  5AQL A;  5AQO A;  4I6M A;  1VQ9 N;  3ENO A;  2Z1H A;  4X66 K;  4HCC A;  4H5V A;  3PX6 A;  4IDH A;  5HRS A;  4KHW A;  4YOR A;  3LP2 A;  3O9T A;  3T3F A;  4XH1 A;  3CI5 A;  1HJO A;  4RTF D;  1HX1 A;  2QWR A;  4O55 A;  3KJV A;  3L0Q A;  2Z1J A;  1KC8 O;  2YHA A;  4JHD A;  4I9L A;  4DCH A;  2OTJ N;  2KQ2 A;  4YOY A;  5C25 A;  2Z1G A;  5T7B A;  1LAW A;  1TUY A;  4WQ4 C;  1J5E K;  5EVZ A;  1IKX A;  4JK8 A;  4DTM A;  5AQG A;  3DM2 A;  3MEG A;  3SV4 A;  1RDB A;  3N4Q A;  3DLR A;  3CIP A;  1OVY A;  1DEJ A;  3EN9 A;  2A3Z A;  4E89 A;  4BG8 A;  1JCE A;  1B9F A;  4BR2 A;  1KD1 O;  3VF4 A;  2FBV A;  3HRG A;  2G8V A;  1HRH A;  5HRN A;  1NKC A;  1S1T A;  4BRD A;  2O8B A;  3SBT A;  1NGC A;  3VF2 A;  2GUP A;  1TV6 A;  4Z4H A;  2G8K A;  1NM1 A;  5DMR A;  4FWO A;  4IO9 L;  2A42 A;  3TAG A;  3CC4 N;  5TKW A;  1EWQ A;  2Q3S A;  1NJZ A;  3CJA A;  2ITM A;  1TKD A;  4X62 K;  4F2R A;  3EY1 A;  4FYD A;  3LDN A;  2NRZ A;  2B4J A;  1JKH A;  4JEP A;  4DS5 A;  3DXM A;  4CIG A;  4EAH D;  3EEQ A;  3A5L C;  3HPG A;  4ZTJ A;  3U9D A;  2HHX A;  3UKR A;  5D3G A;  3ZSY A;  1LOT B;  3HYF A;  1JJ2 M;  2IGI A;  4BRH A;  4FJN A;  3HOT A;  4AHU A;  1IJJ A;  1GLE G;  3M8S A;  5GIN A;  3ZSV A;  2RPI A;  4FJ5 A;  4NCB A;  2IVP A;  1XHX A;  2IIR A;  5AQK A;  4CJ4 A;  2PYL A;  1R0A A;  2D0C A;  3VQ7 A;  1I94 K;  1VSM A;  5M1Q A;  2HMI A;  4MO4 A;  3OYE A;  5JS2 A;  3RSE A;  5C15 A;  1N33 K;  4FJK A;  4HUG A;  3KK7 A;  3R6M A;  1IKY A;  1NU0 A;  4KRF A;  3VTH A;  4DQP A;  4BE2 A;  3PIO L;  1U2V A;  3A5O C;  2A1R A;  4CEO A;  3VGM A;  1W0H A;  3VMF B;  4BVO A;  4LFA K;  2X6S A;  4BRE A;  3M8Q A;  1TKT A;  4FO0 A;  5AQH A;  3TTD A;  1JCF A;  3RMB A;  3OJU A;  1NK4 A;  3VEY A;  3KTQ A;  2GTD A;  2O8C B;  1IO2 A;  3TSP A;  2ZF5 O;  5DM7 L;  3LDS A;  2VWJ A;  4FZX C;  4Z4E A;  1Y97 A;  4KTW A;  4HHT A;  1LCU A;  2EHG A;  1HPZ A;  5HLF A;  4CFC A;  3O1W A;  1Q8I A;  1M90 O;  4JLH A;  4FW2 A;  2HND A;  2WBN A;  5EX5 A;  2QWL A;  1SAZ A;  2F7T A;  5JLF A;  2WUS A;  4F4K A;  5LJV A;  4HVJ A;  3HP9 A;  5KRT A;  1K9M O;  4F3O A;  1S6Q A;  3ULE B;  2W41 A;  1HR0 K;  5DM6 L;  3T69 A;  3HO1 A;  1TGO A;  3SUQ A;  3WXK A;  3NDK A;  3WNF A;  5BN8 A;  4DFJ A;  1JLF A;  2FF3 B;  3NCI A;  3LM9 A;  4ELT A;  3CF5 L;  3HVT A;  3ZX3 A;  3CC2 N;  3NH0 A;  3SYZ A;  2B6A A;  1T3V A;  4IKF A;  3V1O A;  4OKJ A;  3DLL L;  4O44 A;  4AHR A;  1BU6 O;  3MED A;  4AM6 A;  3TU5 A;  3VOV A;  1IKV A;  3LL3 A;  2HMP A;  3Q7C A;  2O8F A;  5AQP A;  4DR2 K;  2RF2 A;  3W3D A;  3ZT4 A;  2E5L K;  4CZJ A;  3MCA B;  1KAY A;  3CJ7 A;  4EZ9 A;  1BIZ A;  2E2P A;  4JKG A;  3G6E N;  3BZK A;  1FW6 A;  1U4B A;  3OBW A;  3VQ5 A;  1BI4 B;  5BPL A;  5FPM A;  1NBW A;  4BG9 A;  5GAE P;  3HOS A;  2QWN A;  4BDZ A;  4DWI A;  4L3Q A;  4BRI A;  3THW A;  3D2E B;  3CER A;  4JI8 K;  3WEE A;  3A5N C;  2I7P A;  1NJI O;  1X9W A;  4WYB A;  3AVH A;  3IRX A;  2O8F B;  2OCE A;  1WSJ A;  5KPR A;  4MDA A;  3CYM A;  4E7L A;  4LF7 K;  3MN7 A;  4MFB A;  1OVQ A;  1V4T A;  3VES A;  2HHW A;  4HUE A;  1JL1 A;  5C10 A;  3A8Y A;  1WAJ A;  3NAE A;  1ASW A;  2FSK A;  3LZI A;  3V9U A;  5C0Y A;  4GVM A;  1HUX A;  4DSL A;  3CET A;  4Z4I A;  5MLC Q;  1TK5 A;  4E3S A;  4KKO A;  4UQG A;  4DV3 K;  5E84 A;  4CZG A;  1T7P A;  1VSJ A;  4DMN A;  4IZ9 A;  4CVN E;  3UB5 A;  3M8R A;  4CFA A;  3L2R A;  4KHY A;  3CPE A;  3ZLJ A;  3NFA A;  3KLG A;  3NBP A;  4NLB A;  4FLY A;  3THW B;  1C0G A;  1SL2 A;  2HHS A;  3K5N A;  3RMD A;  2E1Z A;  4CZL A;  3O3F A;  2GV9 A;  1KVA A;  3K58 A;  2YNF A;  3D2E A;  3QEI A;  4BRA A;  4CJ5 A;  5F2R A;  1S22 A;  1KFS A;  1HQU A;  3B6O A;  3MMV A;  2AA4 A;  5M1O A;  3SPY A;  3LWM A;  4C8K A;  1BHL A;  1RIL A;  5E26 A;  3VN5 A;  3HP6 A;  4CJR A;  3VER A;  4FWL A;  1QQC A;  3AA3 A;  4H5N A;  4IWV A;  1JCG A;  5LL6 Z;  3TAE A;  2P9L A;  1HLU A;  2WC9 A;  2W40 A;  1RCH A;  3NH1 A;  4ILG B;  4FW1 A;  4CEQ A;  4FZY A;  1XWL A;  4DTX A;  3J7Y P;  4PKH A;  5CE3 A;  3E66 A;  3OTO K;  3EE8 A;  1NGG A;  5FRN A;  1UA1 A;  1JLQ A;  1WSH A;  1HYV A;  3N4P A;  4GVE A;  3ZCM A;  1HKG A;  2A41 A;  5AQY A;  1HNI A;  3MEE A;  2E2O A;  4M3Y A;  1BCM A;  1CZB A;  1JLC A;  1X9J A;  3HM8 A;  4M42 A;  3OJS A;  1BA1 A;  4FM0 A;  4KFB A;  3AAP A;  3MXI A;  2E6M A;  4DSK A;  2IOC A;  2NZT A;  1UOC A;  4HTU A;  2VGM A;  3LAK A;  4CJW A;  4JI6 K;  4M3U A;  3TAQ A;  5J2M A;  1Q18 A;  5DK5 A;  1R59 O;  3I0S A;  3ZYY X;  5HRP A;  4B8C A;  1HKC A;  4JV5 K;  5JS1 A;  2G8H A;  4KB1 A;  4H0O A;  2QKK A;  1XI1 A;  2HNZ A;  3VEN A;  2GX9 A;  4DU1 A;  5KPT A;  1A5X A;  3VGK A;  3OYL A;  3K5O A;  4W5O A;  3KK1 A;  1FJG K;  2HF3 A;  3H3N O;  3IAY A;  1G99 A;  3Q7B A;  3LAL A;  3PSI A;  4OVL A;  2YV0 X;  5LMN K;  4JKF A;  2V7Z A;  3THV A;  2VQE K;  4L8R B;  4EZ6 A;  1TL3 A;  3RSE B;  4PKG A;  2D4W A;  3G25 A;  3H1Q A;  4WFB L;  2YJF A;  2P9I A;  5BRD A;  1X3N A;  5J2P A;  1FXX A;  1D9D A;  4J2A A;  3VQD A;  3O6W A;  2QI2 A;  4N5S A;  4GKK K;  4ILJ A;  4LY7 A;  1C6V A;  3SLC A;  2G8U A;  3V9Z A;  4GV3 A;  1QSY A;  4M3X A;  3UE5 A;  1VSD A;  4CF1 A;  2HHU A;  4OX9 K;  3IMX A;  4ELV A;  4FOI A;  2A6A A;  1U45 A;  2YCH A;  1CLQ A;  2BTF A;  2E2Q A;  5F0X A;  4WQ5 A;  3BGR A;  1NNE A;  1XNQ K;  4JS5 A;  3PLA A;  2OPR A;  3CD6 N;  3C6H A;  3O9R A;  3H6E A;  3VQP A;  3T19 A;  2O8B B;  4OO1 J;  3MWP A;  3LAM A;  4FWR A;  1DKG D;  5AQJ A;  3OBY A;  1LWC A;  4IG0 A;  4Z94 A;  4FLU A;  1RBU A;  3SI6 A;  2VG6 A;  1IV0 A;  4LF9 K;  5BR8 K;  2O8E A;  4FWQ A;  3P5J A;  4C8L A;  4FJX A;  3WQU A;  2KFZ A;  3T1Y K;  1HNZ K;  2Q0R A;  3IDH A;  4RG8 A;  3TTF A;  3P31 A;  4X64 K;  4GW6 A;  2HW3 A;  3O4W A;  2GEL A;  3G0Z A;  3RVC A;  3QEV A;  4YDU A;  4ID5 A;  3DMJ A;  4JKE A;  4FZZ A;  4KI4 A;  1VRT A;  4CEC A;  3C7N A;  5KQD A;  3AVI A;  2KLA A;  3CQX A;  3MXJ A;  2P51 A;  4QAG A;  1K6Y A;  5SWM A;  4OJR A;  2OZM A;  1BO5 O;  3KHY A;  3LDP A;  2O4G A;  3FFI A;  3VQ6 A;  4DF8 A;  3BEX A;  1QSL A;  1TK8 A;  3SAG A;  1X3M A;  2UUB K;  1WBD A;  5AZI A;  1Q86 O;  1Q7Y O;  3DJC A;  4CES A;  3WQT A;  4M3T A;  3VPZ A;  2P9P A;  4CZE A;  5IWA K;  3QO9 A;  4ICL A;  5AQI A;  3M1F A;  1I3A A;  4IOX A;  1FKP A;  3VTI A;  3LAN A;  3DLK A;  5C2D A;  4KO0 A;  3P38 A;  3BF1 A;  4A2A A;  1YAG A;  3FZM A;  3QET A;  4DR3 K;  4OPJ A;  4DR1 K;  3CCQ N;  1T05 A;  4YOW A;  4DU3 A;  1QZ6 A;  3J7A P;  2YI1 A;  2PBD A;  4CW7 B;  3DLH A;  3IFR A;  1J54 A;  2OPQ A;  4R5P A;  4E7K A;  5J2Q A;  3VQ8 A;  4BRN A;  4CZK A;  3SQ4 A;  1KFD A;  1RBR A;  1C0M A;  3QER A;  2RN2 A;  1I39 A;  3ZSZ A;  3P1G A;  3C94 A;  2IVO A;  3MDQ A;  1MU2 A;  1VQM N;  4B1V A;  1BDG A;  3AVG A;  3EO3 A;  4BR9 A;  3VET A;  1C0U A;  5FPD A;  1E4G T;  5AQM A;  2OPS A;  3O9U A;  4CZF A;  1V4S A;  4E7J A;  1DTQ A;  4GMJ B;  1RT6 A;  3OYC A;  1BWF O;  1ESV A;  3K5M A;  3RMA A;  2YNI A;  3ZSX A;  3KKR A;  2QW9 A;  2XHB A;  4IEE A;  4CK1 A;  4W5N A;  4IG3 A;  3WUH A;  5AQQ A;  5I42 A;  3MN6 A;  4YFU A;  2FSJ A;  4WCE L;  3C0B A;  3A2F A;  1BQM A;  4H8K A;  2B5J A;  1OH5 A;  2HHH K;  2BAN A;  3GDQ A;  4JI2 K;  5CHI A;  3VF6 A;  4AF1 A;  4CGD A;  3CCM N;  1VSH A;  3P83 D;  4MQ3 A;  4JI7 K;  5CR4 A;  5KRS A;  4AHV A;  5GAH P;  4N76 A;  4FLV A;  3OYM A;  4V19 S;  1N6Q A;  1CZ9 A;  3CCV N;  1U6Z A;  1N5Y A;  3VQQ A;  3CCE N;  3HI0 A;  4JYA K;  3WXI A;  4JI0 K;  1ZBU A;  4C1N K;  1X9M A;  4B3S K;  2D0P A;  3VQA A;  4BR0 A;  3NH2 A;  4FPA A;  2OA8 A;  1Z26 A;  4PL7 A;  4BRQ A;  4DTU A;  4J8F A;  2CGL A;  4NXN K;  3U3G A;  4BVP A;  3I55 N;  1YVU A;  4DR4 K;  4JS4 A;  3CCR N;  4NLC A;  2FC0 A;  3CJ1 A;  2YHX A;  3NF7 A;  2NRT A;  3SNN A;  1HNW K;  3ULD A;  1YXQ A;  2P9S B;  3AVJ A;  1F21 A;  1JLA A;  5J2N A;  3KIO A;  4FL9 A;  1XUP O;  3VEV A;  4UY8 O;  3SAH A;  4RCH A;  4C8N A;  1EP4 A;  3LDO A;  3VGL A;  4DR5 K;  5KQ8 A;  3R9P A;  4KHQ A;  5C24 A;  1W9H A;  1RTJ A;  3TAM A;  1B9D A;  3W0L A;  1U48 A;  3D45 A;  1EXQ A;  3U8X A;  3KK3 A;  3TAB A;  2DFH A;  3O3H A;  1ZBL A;  1YTA A;  1QHT A;  4FWN A;  4C8M A;  4H03 B;  3L6Q A;  4MO5 A;  4R79 A;  4DFP A;  4J2D A;  1FKO A;  5GAG P;  1S3X A;  4U7B A;  1KSP A;  1EQY A;  3DWL A;  1QVG M;  3QIO A;  3RRG A;  1YIJ N;  4DQI A;  5TKY A;  3JS6 A;  4KV8 A;  1VSF A;  3QIN A;  4LF6 K;  5K14 A;  5BR9 A;  4BR7 A;  4CF0 A;  2QKB A;  1K8K B;  1VQP N;  4M63 C;  3ZSW A;  3QLH A;  5AQW A;  1S5J A;  4I2Q A;  3ATV A;  4LD0 A;  4DLG A;  3EE9 A;  3CCJ N;  1J9A A;  3GBT A;  3KK2 A;  2YHB A;  4LSL A;  4CD1 A;  2VGN A;  1VQ7 N;  4M3W A;  4W5T A;  3OHR A;  1NGD A;  2E2N A;  3ID8 A;  3OW2 M;  3O8M A;  5BRF A;  5H1S Q;  2YNG A;  5BN9 A;  3R3L A;  4JI4 K;  5M1N A;  3I8D A;  1MA9 B;  2NNW A;  2HF4 A;  3I33 A;  3KD5 E;  1RDW X;  2X78 A;  5AQX A;  4PHT X;  3CJB A;  2ZGZ A;  3I8B A;  5ADX A;  1Q9Y A;  3OYG A;  4DQQ A;  3G71 N;  1SL0 A;  3OYB A;  4XIU A;  1XMQ K;  2ZJQ L;  3AVB A;  1WBB A;  2OYQ A;  3J81 O;  2HVH A;  3MCP A;  2WFB A;  3KLF A;  2JWK A;  3MX2 A;  4H0T B;  2Q2R A;  4CEZ A;  5LY3 A;  5CYQ A;  4FWP A;  5AJ3 K;  1XMO K;  1IKW A;  4CGI A;  4NYN A;  2XRI A;  1WSF A;  2UU9 K;  3E9L A;  4CEA A;  2XY8 A;  4IEI A;  4H5W A;  4DB3 A;  4YNQ A;  4IOC L;  4N41 A;  5KPZ A;  4CJK A;  3S3N A;  2QEX N;  1VHX A;  3HJF A;  3SMP A;  4Q0B A;  5AQR A;  2P9L B;  3PV8 A;  1IH7 A;  4QOZ B;  3AVL A;  3L4Q A;  1RDA A;  4BQL A;  2VG7 A;  4Y1C A;  4JKD A;  4CIF A;  3TTC A;  4JRP A;  4M7Y A;  3MN9 A;  3VEX A;  2YKN A;  3HSC A;  1QQM A;  4F9O A;  1L3U A;  4DSF A;  2JGU A;  4PWD A;  4B3R K;  4E1J A;  3VEO A;  3LDQ A;  4KH4 A;  2D5R A;  1ATN A;  4DUZ K;  1KAX A;  4B1Z A;  2W6K A;  4OPH A;  4NB4 A;  4LC9 B;  1YJ9 N;  3CQY A;  4O0I A;  5FDL A;  4BRP A;  5AZJ A;  3S9H A;  4EFH A;  2NRR A;  1L3V A;  2DPN A;  3BY5 A;  3H1V X;  3C7N B;  4CGH A;  4E1M A;  2EX3 A;  1SQK A;  3AAQ A;  5IT9 O;  1JXE A;  4ZTF A;  1LWE A;  1BI4 A;  5I3U A;  1NK0 A;  4KHS A;  1GLJ O;  2VCP A;  4AHT A;  4C23 A;  1B92 A;  4C8O A;  2I7N A;  2FBY A;  4RWT A;  2VG5 A;  2PY5 A;  4E7H A;  1SS6 A;  4BC4 A;  2CH6 A;  2OPP A;  2HHV A;  4NCG A;  2YJE A;  4RW8 A;  2IAJ A;  1N8R O;  2HNY A;  3HST B;  4CJQ A;  1HJR A;  1VQK N;  2OAN A;  4YHH K;  1DGK N;  2UXC K;  1RDU A;  2P9N A;  4Z4C A;  4CHQ A;  1RT1 A;  3ZSO A;  3FZK A;  3PY8 A;  1HYS A;  3CM5 A;  4EIA A;  4M41 A;  2QWO A;  4CJV A;  3MWT A;  4CF9 A;  4WFA L;  1G15 A;  3U6F A;  3IKM A;  4M3R A;  4HCB A;  3KLI A;  4IXC A;  3ASM A;  4FJL A;  3KVG A;  4BY9 C;  4K0K K;  3CFR A;  1S9G A;  4KAZ A;  2V7Y A;  3AVN A;  3V6D A;  2X6N A;  1OH8 A;  2P1J A;  2P5O A;  4H0P A;  1D8Y A;  4CJU A;  4CF2 A;  2AP1 A;  3KLH A;  4JKG B;  1BOT O;  1ILY A;  2PZS A;  4WF9 L;  4DV0 K;  4WQ4 A;  4KI6 A;  2UYT A;  3S3O A;  3QEP A;  1EWR A;  3K2P A;  4JI3 K;  4LSN A;  3SQ0 A;  2P9I B;  3SPZ A;  5EOY A;  2FSN A;  1VSK A;  3K0S A;  3T1A A;  4DTJ A;  3QB0 A;  4B9M A;  1TKX A;  2YX6 A;  1VQ4 N;  1YIT N;  1U2V B;  5EY4 A;  3RTV A;  1HYZ A;  3D6R A;  3SQ1 A;  4JN4 A;  3CJ9 A;  4OPA A;  4AHS A;  2NRV A;  4CJ3 A;  4A5B A;  4ZHR A;  3R8E A;  1WOQ A;  2VWB A;  1C1A A;  1O1W A;  3A5M C;  4K8Z A;  3KKS A;  2QM1 A;  2A40 A;  1YI2 N;  4LFB K;  4XH4 A;  1SKW A;  5CZ2 A;  4FLT A;  3S41 A;  5B8H A;  2HBL A;  3G10 A;  4W5Q A;  3AVC A;  2BDP A;  2QTD A;  4CHY A;  1KRP A;  1DTT A;  3MN5 A;  2Z1I A;  4XEI A;  3VQE A;  4FJH A;  1JL2 A;  1SV5 A;  5KGX A;  4CJS A;  4A57 A;  3MEC A;  3BUZ B;  1J5O A;  4BWJ A;  4O5F A;  3ITH A;  3TAR A;  1ASV A;  3EZ5 A;  3HL8 A;  4BQZ A;  3DLB A;  1IBL K;  2Q97 A;  1MWK A;  1ZC6 A;  1ZBH A;  4CHO A;  2JLE A;  1O13 A;  3EZW A;  1MWM A;  4OLA A;  4BE1 A;  2P9K B;  2V52 B;  5FRM A;  1KVB A;  3HPH A;  1VQ6 N;  2YKM A;  1VQL N;  3DRR A;  4QS9 A;  3L2U A;  5AQS A;  3SJH A;  4ID1 A;  3NGI A;  3QIP A;  4DG1 A;  3AO1 A;  2KZM A;  4FWS A;  3QFP A;  1K8A O;  4DR7 K;  5BRH A;  1RTI A;  2NRX A;  2UXB K;  2BUP A;  1EO1 A;  3IUC A;  4JKA A;  3FZH A;  1GLD G;  3MK6 A;  4X65 K;  3PO5 A;  1NWK A;  2OTL N;  1YUW A;  2X74 A;  1NMN A;  3LP1 A;  2QXL A;  4QCL A;  3IS9 A;  5CYM A;  4FM1 A;  4KB0 A;  3WNH A;  4N47 A;  1ZBF A;  1WN7 A;  2XY5 A;  4LH5 A;  3SUN A;  4FOE A;  2UUA K;  1CXU A;  3BF3 A;  1GOC A;  1QE1 A;  4CZM A;  3V9X A;  3MAQ A;  4CBX A;  3TAP A;  1OH6 A;  1KXP A;  5JVG L;  1ZYQ A;  3J80 O;  3DAW A;  3V9S A;  3CHW A;  1RT2 A;  4AQY K;  1WSI A;  1WSG A;  3I56 N;  3RR8 A;  3AA4 A;  2CH5 A;  4RW4 A;  1S1X A;  1N32 K;  3V4I A;  4BRL A;  2DFF A;  3OS0 A;  4M45 A;  2IDO A;  3THX A;  3FZL A; 
#chains in the Genus database with same CATH homology
 2UUB K;  4X62 K;  1IBM K;  5IT9 O;  4LFB K;  4JI7 K;  1HNX K;  4DUY K;  4LF4 K;  4DV4 K;  4V19 S;  5IWA K;  4DV1 K;  4JYA K;  4JI0 K;  4B3S K;  4GKK K;  2VQF K;  4JI4 K;  4KHP K;  4NXN K;  1IBK K;  4DR4 K;  4OX9 K;  1IBL K;  4DR2 K;  2E5L K;  4DR3 K;  4YHH K;  4DR1 K;  1N34 K;  4LFC K;  2UXC K;  1HNW K;  5LL6 Z;  4DV7 K;  4DR6 K;  1XNQ K;  1I94 K;  3J7A P;  1XMQ K;  4CW7 B;  5A2Q O;  3J81 O;  1N33 K;  3J7Y P;  3OTO K;  1XMO K;  5AJ3 K;  4LF8 K;  5LMU K;  4DR5 K;  2UXD K;  2UU9 K;  4X66 K;  4JI8 K;  4DR7 K;  4DV5 K;  4K0K K;  4YY3 K;  2UUC K;  2UXB K;  4LFA K;  4X65 K;  4LF9 K;  5BR8 K;  4B3M K;  4LF7 K;  1N36 K;  4JI1 K;  4JI6 K;  4DV6 K;  1J5E K;  3T1Y K;  4DV0 K;  1HNZ K;  4B3R K;  4JV5 K;  4X64 K;  2UUA K;  4NXM K;  5FLX O;  4GKJ K;  4DUZ K;  3T1H K;  4JI3 K;  4JI5 K;  4LF5 K;  4LF6 K;  4DV3 K;  3J80 O;  1XNR K;  1FJG K;  3JAM O;  4AQY K;  4CVN E;  1N32 K;  2HHH K;  4DV2 K;  2ZM6 K;  5LMN K;  1HR0 K;  4B3T K;  2VQE K;  4JI2 K;  2F4V K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...