1IBLK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1iblK00
4JI3K 4NXMK 2UXBK 5A2QO 2HHHK 3T1HK 4LF8K 5AJ3K 5IT9O 1HNXK 2UXCK 3J7YP 2F4VK 4DV3K 4B3TK 4JI8K 2VQEK 4JI4K 4LFCK 4V19S 4X66K 4X65K 2ZM6K 4CW7B 3J80O 4LF4K 4LF7K 2UXDK 5BR8K 4DUZK 1XMOK 1HNZK 2UUAK 1IBLK 4DV5K 4GKJK 4JV5K 5IWAK 4OX9K 4LF5K 1HNWK 4JI2K 1IBMK 4B3RK 2E5LK 5LMNK 3JAMO 4X64K 5LMUK 2VQFK 4DV1K 1IBKK 4LF9K 3J81O 1I94K 4JI1K 4YHHK 2UU9K 4DR3K 4B3MK 4JI5K 4DR6K 4GKKK 4B3SK 4JYAK 5FLXO 1XNQK 1N36K 4DR7K 4DR5K 4AQYK 1J5EK 4LFAK 1N33K 4YY3K 1N32K 4JI0K 4DR4K 4DV4K 1FJGK 3T1YK 3OTOK 1XMQK 4NXNK 4DV2K 4DR2K 4DR1K 4JI7K 4LF6K 4DUYK 2UUCK 4DV0K 1N34K 1XNRK 4X62K 4DV6K 4CVNE 1HR0K 4JI6K 4DV7K 5LL6Z 2UUBK 3J7AP 4KHPK 4LFBK 4K0KK
chains in the Genus database with same CATH superfamily
5CZ2A 2DPNA 4EIAA 5FPEA 3P83D 4BGBA 3CF5L 3VA3A 3QBWA 4QOZB 1TK5A 4HCBA 1J54A 3CCUN 1SL2A 1T6DA 4B1UB 2QXFA 5C10A 1V4TA 1WBDA 3TPQA 3DMJA 4BR2A 1RT6A 5EX5A 1WAFA 3ZSYA 4DU4A 2ZM6K 3CJ1A 3HOSA 4LF7K 4M7YA 3OYJA 2P9UB 1RBTA 4H5NA 3D45A 2OPQA 3SUPA 4BR5A 3OS2A 1W2BM 3MWPA 2VYPA 4OX9K 3ZETA 1HNWK 3EZWA 4FJNA 3A5MC 4MDAA 4AHVA 4BRHA 3TSQA 4DFKA 2YHXA 5E26A 1VHXA 5C15A 4GW6A 3RSEB 5LY3A 4CE9A 3VEXA 4B1YB 4GNIA 4KTZA 3EZ5A 4DR6K 4BQZA 1A5XA 3SMPA 4FLXA 3PX0A 1X9WA 5CYMA 3IKMA 3ID8A 4K25A 3CERA 2ZQBA 1QVFM 4EP4A 5FPNA 3CC4N 4BRQA 1KAYA 3NF8A 1O13A 2OYQA 1G99A 1YXQA 3VQDA 3R8EA 4EP5A 4CF0A 2LSNA 4H5VA 1EKEA 4WCEL 3ULEA 3THWA 1LW2A 3AV9A 3O9UA 2R7YA 4DS5A 4X62K 3BGRA 1XI1A 4DSFA 1DTTA 3HVRA 1WSIA 4BRLA 3GDQA 2KHOA 3ZYYX 4FLUA 4JI6K 4E7JA 3KD5E 2Q97A 1ZBHA 2HF4A 5FRNA 4K0KK 2W6LA 4WE1A 3LP2A 1K8AO 3LPTA 4C8NA 3O3GA 4BE1A 3FE1A 3KWGA 3V9WA 1LWEA 1NBWA 2ASMA 4B1VA 4YNQA 3PX6A 3AVIA 4JK9A 3OYMA 3ZT0A 4MO5A 4G9ZA 3ID6A 3S9HA 4DV3K 3PX4A 1LW0A 4IFVA 3KLEA 2BGGA 4YORA 1NMNA 4DLGA 4HWIA 1NGFA 1RBUA 3DRSA 3ZT2A 3HP9A 4B9QA 4JKAA 1HLUA 4DUZK 4CGFA 5AQSA 2RPIA 5IWAK 4FLZA 4EZ9A 3V4IA 3MN5A 4FWLA 3D2FB 3S3MA 3DRRA 4DTPA 3LP0A 4X64K 3NCIA 1U48A 1D4XA 3PLAA 4CHZA 3M8QA 3TTFA 4KH4A 2KQ2A 3N4QA 4OLBA 2FXUA 4BY9C 4RW9A 1C0MA 3VGLA 2A40A 4FM2A 4JYAK 1P8ZA 2A1SA 1VQ7N 3WXKA 5EVZA 1NJXA 2YJEA 1Q81O 3CCLN 1H1VA 1NGBA 1TYQA 1YVNA 3HTVA 4M3WA 4NYNA 1SKWA 2FF3B 5C12A 2Q0RA 2O8BA 3MECA 4F8RA 1HKCA 3SV4A 5AZIA 3ATVA 1S1VA 4C8LA 1ATSA 4CBWA 4I6MA 3F5TA 4YOUA 4C8MA 4DR1K 3HYFA 3LL3A 3AA2A 4JKGA 5AQOA 5JVHL 3S3NA 4HVJA 1Z25A 3AARA 3OYEA 4RW6A 5GADP 4N47A 4MO4A 4DWIA 2CGJA 3R1XA 3ZSVA 3ZSQA 3QNNA 3CC2N 2V7YA 2OA8A 2E4LA 1Q86O 1HKGA 1S6PA 3ENHA 4CECA 1IKVA 1TL1A 4BWJA 5AQPA 3E9OA 1KVCA 4I6MB 3VENA 4L8RB 4JHDA 1M90O 2OZMA 3HZ6A 4KPYA 1C0UA 3E01A 3LDNA 1IV0A 5HBMA 3OJUA 4QCLA 1KLNA 4FOEA 3VOVA 3B6PA 1W0HA 1VQON 1C0GA 4EAHD 3QICA 1YJWN 4CZJA 2IVOA 4A2AA 3O80A 3DLEA 3RR7A 1BQNA 4NB4A 1ATNA 3O9RA 1S1XA 3R9PA 5I42A 3FZLA 4PKHA 3PV8A 3MEEA 4BC4A 3QEXA 4B1ZA 1XWLA 3C0BA 3SCXA 4DS4A 4M3ZA 4KBOA 5AQIA 3JS6A 5HROA 2KFNA 3VEOA 3HXMA 1WN7A 3SLCA 3C7NA 3WEEA 3ZSRA 5EU7A 4DU1A 1TUUA 3LALA 1NK5A 4BE2A 4DR3K 3AO5A 3TTDA 2HNDA 4LSLA 4CF1A 1VSIA 5C2DA 1MWKA 5FRMA 3TABA 1XNQK 3HPHA 3AGRA 1BOTO 3MX5A 3SK3A 1J5EK 2QWNA 1XHXA 2HW3A 4CGJA 4UQGA 3OS0A 3O4QA 1J9AA 3THYB 1WSEA 3QESA 3GOIA 1B9DA 4DV2K 3W3DA 3L2VA 3MDQA 4FWPA 5BR9A 3MXJA 4B8CA 5JS1A 3NVMA 2HHUA 1EX4A 3WEEB 4DUYK 2ZGZA 2IVPA 3CCRN 3FLCO 4KO0A 5AQFA 1L3VA 4FJ8A 4M63C 2YNFA 3CM5A 3DLLL 4DV6K 2BDPA 1E4FT 2A41A 1U6ZA 4DV7K 3V81A 1BI4A 4O0IA 1KFSA 4E1MA 4JD2A 3I33A 1HYSA 4C8KA 3LDLA 2QWMA 5HLFA 4B9LA 1OVQA 4FW2A 3A8YA 3JSMA 4JI3K 2OANA 5AJ3K 4Z94A 1OVYA 2OZSA 5IT9O 4DCHA 1RDWX 3CFOA 3MWTA 5J2PA 2AJQA 3MEGA 2HHXA 2YKNA 2EHGA 3DOLA 3S41A 3VF2A 1RTHA 1SUQA 4CJ7A 2VQEK 3NGZA 3L2WA 4Z4CA 3A5OC 4IWVA 4I7FA 1YITN 2FSKA 1VRTA 1TAQA 3NVKA 2RF2A 2E20A 3DLGA 4JEPA 4DFPA 1BGXT 2X78A 4H0XB 2PZSA 4LF5K 3A5LC 5CHIA 2XO7A 4Z4IA 4BWMA 1K8KA 3VN5A 3RMDA 4BACA 1NGHA 4FK4A 3AVAA 2VQFK 4WQ5C 4DQQA 3CHWA 4O55A 2NZTA 1UOCA 3IRXA 3M3ZA 1D8YA 4W5RA 3A0IX 1UA1A 2G8WA 1EO1A 2UU9K 4JKBA 3CMEN 4KHQA 5DMRA 4FJJA 1X9JA 3E9PA 3FGUA 4ISFA 5AQTA 4KTQA 3H3NO 4OKJA 3QERA 3OYAA 4BRMA 2KW4A 3VQ4A 4CJQA 1BCMA 4KH6A 3VEYA 3N4PA 3BF1A 4YOWA 4CFCA 4CGHA 3SNNA 4K8XA 3WT0A 2I5JA 4AHRA 3AO2A 3OS1A 3WNGA 3QETA 1OH5A 5AQZA 4LF6K 1SAZA 1QS4A 2GV9A 1L3UA 1S9GA 2HOEA 1X9SA 4DLEA 1QSLA 1C1CA 1YF5L 2ZE2A 2IOCA 4AH9A 5KPRA 2PY5A 2WBNA 3MCPA 4YDUC 3BDPA 2FBXA 3OYKA 5M1KA 4I2PA 3O4NA 1HX1A 1S1WA 5AFUH 4CJWA 1QZ6A 4AILC 4CIFA 3SZ2A 2WOMA 3M5RA 2VGMA 1VK0A 2XY8A 2ASPA 1GOCA 2D4WA 3O1BA 4OGCA 2FSNA 4YDUA 2HBLA 4JKFA 3AGKA 3HL8A 1REVA 2HHVA 4J8FA 3FZMA 3RWUA 5AQJA 4DTRA 4FOIA 3LZJA 3H6EA 4C1NI 2D5RA 4IO9L 2PYLA 3RMBA 1K6YA 4DFMA 5AQNA 3OA9A 3ZLJA 1NG9A 1JLCA 2HSTA 4E0DA 3DOKA 1HNZK 3TR8A 1R0AA 1BDGA 1NGEA 4GY2B 2NRXA 3EN9A 3NDKA 2QWRA 2YX6A 5LMNK 3ZSWA 3O9SA 4CJ4A 3Q7BA 3UKRA 1N8RO 4RW7A 4DV1K 3LDSA 4ZTFA 1HQEA 2V52B 4CEFA 2GEMA 4FLVA 4CZIA 3TI0A 2ASOA 4DQ8A 3UKUA 3CJ7A 3OYIA 3QEPA 4ELVA 5C25A 3FZFA 1GLFO 3SUQA 5HOOA 1M1KO 1IJJA 1VSEA 2H3GX 3IS9A 4LY7A 3HSTB 4Q0BA 4WFNL 3CCJN 4H0VB 4CF2A 1I3AA 1TK0A 2GUPA 4PHTX 2QXLA 1BIUA 1XQSC 3K2PA 2DFEA 4GVEA 3D0PA 4BDYA 3QINA 2AP1A 1U45A 1IG8A 3HJFA 4DTMA 4CJUA 1HPMA 4CIEA 2OTLN 1TKDA 4H4OA 5ELZA 1UWBA 2HF3A 1NMDA 3HM8A 2WTUA 1CZAN 1BHLA 3IFRA 2ITGA 4FPBA 4KHNA 1VSJA 4IFEA 1WSFA 3TSPA 2B4JA 5HRPA 3VQBA 3SMSA 5E84A 3HPGA 3TAEA 2UXBK 1FKOA 3WXMB 2VWKA 4FJGA 5J2QA 3L2RA 1GLDG 3HRGA 4CJTA 4OKEA 4XH1A 1JXBA 1WSHA 3CJBA 2GX9A 4B9SA 1HRHA 3ZSOA 1S5JA 2P9UA 4AM6A 1HQUA 4EFHA 2KZMA 5J2MA 2P9SB 4YOVA 5BPNA 3I0SA 3CCMN 1VSMA 2QM1A 3PO5A 4LF4K 1RTJA 3R3LA 4JKHA 4NCBA 2PBDA 3DXKA 3VESA 1B92A 1RTIA 1KTQA 3BF3A 3OBWA 4DHYA 1RT7A 2OPRA 2HVIA 4W5QA 4AHTA 3DRPA 1WUAA 4B3RK 1BCOA 4NLBA 3RSEA 1SS6A 3CETA 2E88A 4GV3A 2Q1NA 1ESVA 2KLAA 1RT4A 1VQPN 4NCGA 1DLOA 1VSFA 2Y1JA 1C6VA 1I39A 4J2DA 3ASMA 2FBTA 4Z4FA 3SQ4A 3VQPA 3WUHA 3MX2A 4E7KA 4DR7K 2O8FB 4ZTJA 3EYZA 1NWKA 4OO1J 4H5TA 4FJMA 1X3NA 2NRRA 1VQLN 3DXKB 4I9QA 3EKSA 2Z1HA 1N32K 4JI0K 2QEXN 3OTOK 1XMQK 3SPZA 1C0TA 3KLHA 2OCEA 1BIZA 1NK9A 3CPWM 1HPZA 4BE0A 4ISGA 3AA3A 1D5AA 3BUZB 2G8VA 2VG7A 5SZTA 1NK8A 3SQ1A 2G8IA 3FFIA 4O0JA 4B1WB 2X74A 4JK7A 5C0YA 4AHCA 3A2FA 2IDOA 2EX3A 3VQ6A 3J7AP 4KHWA 2NUBA 4ICLA 5JMVA 4DTXA 2B5JA 2D1KA 3D6RA 4JN4A 2QKKA 2G8FA 2QWOA 3CMAN 5CYQA 3ZSXA 1NGDA 4CFBA 2BTFA 5C24A 3QEIA 1BWFO 4FLYA 1EXQA 3NH0A 4M3UA 1FXXA 1LAWA 4IJNA 2XY6A 2P9IB 2O8DA 1JLQA 1NGJA 4X66K 4DSIA 3CFPA 4DTOA 1D9FA 4Q5VA 3L6QA 4O8UA 1KVAA 2Q0UA 1TVRA 3BZKA 4FL9A 3K58A 1SKSA 3TANA 3FZHA 3AA4A 4CEOA 4KB1A 4CBXA 5C2FA 5DM6L 4NCAA 3D2FA 4GKJK 3KHYA 5AFUA 4JV5K 3O08A 5BRFA 5CR4A 3KVGA 3PIOL 4CEEA 1WBBA 4RG8A 1X1PA 3AO1A 3V9ZA 2D0BA 3VQ9A 3VMFB 3PUFA 4KTWA 4E7HA 2O8DB 2Q36A 3KZBA 5AQKA 2OPPA 1WNSA 4BVPA 4BG8A 1DTQA 1JXEA 1QQNA 3TAMA 4QS7A 2VWJA 1DKGD 3SYZA 1FKPA 3T69A 3SJJA 1F21A 1SKRA 1WSGA 4ELTA 1ZBUA 3C6AA 3KK7A 3U8XA 4BC3A 1JJ2M 3O4WA 3EL2A 4YOTA 5KI6A 4DR4K 3ZT4A 4O5FA 4OPKA 3NAEA 3LM2A 1T7PA 1ITGA 4KH5A 4A61A 4A57A 3F9KA 4CBUA 4JKCA 4EHTA 4DR2K 3M8PA 2YHBA 4N41A 4H0YB 4A2BA 1ILYA 4CHPA 3DXMA 2JWLA 2VCPA 3AVFA 1NKBA 3L0QA 4BRFA 4ISEA 1X9MA 1D9DA 3Q7CA 3CQXA 3GE1A 4FJ9A 5BPMA 5HRSA 2P9PA 1RBRA 2YNHA 4NXMK 5A2QO 2HHHK 2BE2A 4LF8K 4PL7A 3CFRA 3M8SA 1L3SA 3D2EA 3MN7A 3SUOA 4FCYA 1NJIO 4CI6A 5GIPA 3NF6A 1RT2A 3WQTA 4FYDA 3T19A 2HB5A 3DXMB 4V19S 1Z26A 2YNGA 3WNFA 4WFAL 3AY9A 2Q31A 1HUXA 3LP1A 3VTIA 2I7PA 4U7BA 1RTDA 2YV0X 4CJSA 2UUAK 4KHYA 1UA0A 1Q18A 2P9PB 1QSYA 1GOAA 4LH5A 1T8EA 3MMVA 3G4SN 3PY8A 4N76A 2O8CB 3TU5A 3L3UA 3ZX3A 4E3SA 3O9TA 3CG7A 5DM7L 1QZ5A 1B9FA 2HHSA 2XRIA 3D2EB 5CY4A 4FWRA 5LMUK 1QQOA 4FVMA 4JI1K 5EOYA 4CFAA 3KD1E 2GTDA 3P4IA 5LJVA 4FXDA 4FWKA 3VGKA 1IKXA 2EWSA 4OPJA 3H3OB 1KAZA 4YOXA 1LAVA 4XEIA 4QS9A 3KKSA 3L8BA 3THYA 1JCGA 3SJHA 3I8BA 1KC8O 4IFYA 4CESA 3KLGA 1LOTB 2A6AA 4DMNA 1QSSA 2D0CA 4FJLA 1ZXOA 1XC9A 3O9QA 4DV4K 2Z1IA 4G1QA 2YI1A 5KQDA 4LH4A 4R5PA 1OH8A 1VQKN 2ZD1A 2BANA 3QLHA 3ZEUB 1L5UA 1U2VB 5SWMA 3BY5A 3OBYA 4CEQA 4BRNA 5JLFA 4DF4A 3U9ZA 4CJRA 4M7XA 5BRDA 3U3GA 4O5BA 4FJ5A 4FM1A 2NNWA 4IXCA 2RE2A 1O1WA 3ZSZA 2UUBK 2E6LA 1NKCA 4HUEA 3NE6A 1MDUB 1CXUA 2IVNA 3TTCA 1RT5A 4AHUA 4B1XB 3NBPA 4IEEA 4CD3A 1BU6O 1ASUA 3DM2A 1VSDA 3EO3A 1HNXK 5KGXA 5I9EB 1S72N 3KTQA 1NGIA 3C6UA 1X3MA 1EQYA 1VQ4N 1SL1A 2BH1A 2P9NB 3AO3A 4IDHA 3MEDA 4DTNA 3K59A 3AVMA 2WUSA 3V1QA 4CZGA 4DSEA 3O8MA 1ZBLA 4LSNA 2DY4A 5JLHA 3R6MA 4E1NA 3LDQA 3PO4A 4OVLA 3TARA 4OKKA 3G25A 1JL2A 3ALYA 4ID1A 1TAUA 3K5MA 3SAHA 3G71N 4AHSA 4AM7A 1VQMN 4A5AA 4OLAA 4LF9K 4K42A 1I94K 3OYHA 3HK2A 3RVCA 4RCHA 3MXMA 2YHWA 1GLBG 4PKGA 2CH6A 3F2KA 3RTVA 3VQEA 3H1QA 4HTUA 2ZWHA 1KSPA 2IIRA 5AQXA 1TKXA 2YNIA 1S6QA 4CZLA 3QO9A 2G8UA 2QK9A 2WC9A 1GLAG 3ZX0A 1T44A 1RILA 2KKZA 4BR9A 4CK1A 1YAGA 3U3YA 3UIQA 2OPSA 5JICA 5K14A 4CD1A 1YT3A 2HHQA 3HI0A 3H46O 3HP6A 5ADXH 3AA5X 4IBNA 3WXJA 3MXIA 4M3YA 1SV5A 3CM6A 1C1BA 1QHTA 1RBVA 3P39A 4CJLA 5FPDA 3E66A 2NRVA 4CERA 4CZEA 4K8ZA 2VWBA 4KKOA 3U6FA 3QEWA 3J7ZO 4QAGA 4PY5A 3ISNC 3L4QA 4B8AB 1KXPA 1XC3A 4CGGA 3SBTA 4Z4EA 3DYAA 3P31A 4BRPA 1BQMA 4U67L 5AQRA 5KGWA 4CZHA 2YKMA 4IDKA 1Z6RA 1GOBA 5D3GA 4DQPA 3P5JA 4BRDA 3BP8A 2O4IA 1YHQN 4CF9A 3VF4A 1QTMA 1T03A 4FZXC 2WFBA 1RCHA 2GUIA 2VG6A 4CGDA 5AQQA 3J8AA 2XY5A 3IUCA 4IKFA 1NM1A 3KWIA 4FWNA 2UXDK 5AZJB 1MA9B 2IGIA 3WXIA 3CCQN 1BA1A 4GV6A 4DV5K 3G0ZA 3VQ5A 2HHWA 4LD0A 3H08A 3JXUA 4TSXA 2GWKA 4JRQA 1T6CA 4F2RA 1VSHA 2E5LK 3JAMO 3VTHA 4PQUA 4DTJA 1HYVA 3ZX2A 4GV9A 1GLEG 1WAJA 4ELUA 2I7NA 4N56A 1NU0A 4M3TA 1NOZA 2HNZA 3K9JA 3VEVA 4A59A 1YIJN 4H5WA 2A42A 3B6OA 3T7ZA 1QHAA 3NHGA 1CZBA 1VQ8N 1EETA 1N36K 4FJKA 4YFUA 4CEAA 4M42A 3CJCA 3NF7A 2D0AA 3ATUA 3OYLA 4CGIA 2YHAA 1HKBA 1ZYQA 1OH7A 4CJKA 3KK1A 5T7BA 1TKZA 4WYBA 4NXNK 3HT3A 1RDAA 4YOYA 2WONA 4PWDA 2P9LB 4UY8O 3DJCA 2J4RA 2HHTA 1YVUA 3H45C 1K73O 4QS8A 3OYBA 3QFPA 4WF9L 1TUYA 1RFQA 1N5YA 2FLOA 2ZJQL 3T3FA 1U4BA 2IAJA 1IG9A 1J6ZA 5LL6Z 5E41A 3GL1A 4KHPK 2P9KB 4KI4A 4LFBK 4FJHA 2NRHA 3OYCA 2KTQA 3HBTA 3MN9A 1K9MO 2A1RA 4FLWA 1XHZA 3SBGA 4HUFA 4BVOA 4CFDA 1EP4A 4CZKA 4JS5A 3EE8A 2P9SA 4FM0A 3HPOA 2X6NA 4K41A 5FROA 1KFDA 4WQ4A 5CZ1A 2Q2RA 5BREA 4C23A 4FPAA 1ZBSA 4CJEA 3V9XA 3ITHA 2E2QA 1XMOK 1KLMA 1YUWA 1MU2A 4Z4HA 4Z4GA 4DSJA 2JWKA 1HJOA 4CEBA 3EKUA 1E4GT 4JKEA 5AQLA 4E7LA 4FK0A 4DG1A 1RT3A 4KREA 4HHTA 4H0OA 3U9DA 4DTSA 3P1GA 5I3UA 2E2OA 2IC3A 1HJRA 1S22A 2O4GA 2A3ZA 4DU3A 2W6KA 1QQCA 4DTUA 2O8FA 3CXCM 2PAVA 4BR0A 4CJPA 1YTUA 5FLXO 1BISA 4J2EA 4FSVA 4NLCA 1E3MA 4CK3A 5M1OA 1RDUA 4HTLA 3SUNA 4YY3K 4KV8A 3DWLA 4BQLA 1JKHA 1FJGK 3MK6A 3HSCA 4DQIA 3B8AX 5LJWA 2GBZA 3QIPA 5KTQA 2RHKA 4JLHA 1RBSA 1NK7A 2ZGYA 3T1AA 2NLXA 4MLHA 1IO2A 2Y1IA 2UUCK 3LZIA 1TGOA 1NNEA 4NO7A 2OTJN 1OH6A 3VQ8A 1DT9A 4W5TA 4OJRA 2O8EB 1WOQA 1HR0K 1CLQA 1RDBA 3THXB 1MWMA 3CQ8A 3AAQA 4IG3A 3UE5A 3CCEN 1QQMA 5TKWA 3HVTA 1NJWA 1BG3A 3OY9A 4E89A 2P9IA 4BDPA 2QWQA 2HBKA 4F9OA 3VGMA 4IO8A 4W5OA 1DEJA 4CJ5A 5DK5A 3UB5A 1ZC6A 2F4VK 4KAZA 1G15A 4KI6A 4Z0UA 5EXWA 4B3TK 3OYGA 3BEXA 4B3OA 2QA4N 4GMJB 3M6GA 2DFFA 1KCFA 2DFHA 5ADXA 4F3OA 3J80O 3K5OA 2ZF5O 2QWLA 3WNEA 5BR8K 3O3HA 3BZCA 3RMCA 3LDPA 4KHUA 2KZZA 2D0OA 4JI2K 4CK2A 3V9UA 4FWQA 3P38A 3QIOA 1BL3A 3ZETB 3PSFA 2HBMA 4CJFA 1VAZA 1GLLO 2XY7A 4DF8A 4B9VA 4MQ3A 3J81O 4M45A 1T05A 4OPHA 2YHYA 1R59O 2NRZA 3F9MA 4I9LA 1LV5A 4IEIA 1ZBIA 1V4SA 3H1VX 4HUGA 1J5OA 4MLEA 2V51B 1WLJA 4AQYK 2W41A 5KRTA 3HM9A 3D7EO 4BRAA 3DLKA 1Y97A 4ID5A 3VEWA 4C8OA 3KK2A 3LWMA 1VQ5N 3QEVA 5J2NA 1Q7YO 2F8SA 3SAGA 4ZHRA 3QNOA 3VQAA 3I8DA 1NGGA 4WFBL 3ULEB 3THWB 1NKEA 3AVKA 4FK2A 5B8HA 3QFUA 5JVGL 2FBVA 3LANA 1KVBA 1W9HA 5M1PA 4O44A 4DFJA 1W97L 3LAKA 3IDHA 2FC0A 1KQSM 3KIOA 4BRKA 3O1WA 4H0TB 2JGUA 5FDLA 2Q3SA 4Y1DA 3HOTA 3NFAA 4C1NK 3CC7N 3G10A 1FW6A 2UXCK 4BDZA 1KAXA 2E6MA 2NRTA 2P1JA 3NMUA 3KJVA 3AVBA 3CCVN 4JI8K 2FBYA 4JI4K 2BUPA 4CZMA 1WSJA 5GIOA 4B9NA 2QKBA 4CW7B 1VSKA 1W7AA 3OYDA 3AVJA 3L3VA 3CYMA 5EY4A 4BROA 5AQUA 3TAGA 2O8CA 3AO4A 3LDOA 1TK8A 4M3XA 1IBMK 4IZ9A 3S3OA 2QWPA 5GAGP 3OYNA 1ASWA 3LWLA 4DSLA 4NYFA 4YHHK 4EZ6A 3AVGA 4B3MK 3O6WA 4BRCA 5C42A 4KHSA 4B3SK 5AQHA 3U4LA 4E1JA 5TKYA 3CPEA 4I2QA 3ULDA 1JLFA 1S1UA 1UAXA 1TYQB 2HMPA 3AVCA 1RDCA 3ZEUA 3T1YK 1U2VA 4KB0A 3TSUA 3FFKB 2O8BB 3AVLA 4CHYA 3VQCA 1U47A 1S3XA 5AZIB 3LP3A 4E19A 4IOAL 3CQYA 2FF6A 1IH7A 3MN6A 1NOYA 1VQNN 5HL7L 5GAEP 1TL3A 3ZCMA 3WQUA 5J1EA 4JKGB 1KRPA 3I56N 3VEZA 3QB0A 4FJIA 4FWMA 5BPLA 4H03B 3JYTA 4H0PA 3FZKA 3LPUA 3AVHA 3GBTA 3M1FA 5AR0A 5F2RA 2HMIA 4CJ3A 4B9UA 4W5NA 3ENBA 1Z05A 1YTAA 3T1HK 2ITMA 4M41A 3K5LA 1YI2N 4FZZA 1NJYA 1Q9XA 3O3FA 3NGYA 3V1OA 3SQ0A 4JHDB 1JCFA 2HNYA 3RRHA 2P9NA 2ETJA 4M3RA 3V9SA 4JS4A 1SQKA 4ILJA 4IJAA 5AQYA 1S9EA 2JLEA 1A5VA 3KKRA 4FVUA 2ZJPL 2PFUA 4IG0A 3OHRA 3QMLA 4JNEA 2IS3A 1NJZA 4JK8A 3OJSA 3TAFA 3IMXA 2UYTA 3MCAB 1L3TA 2E2PA 4AF1A 1ZBFA 4MFBA 2F9TA 3L4IA 4H4MA 1IKWA 1RDDA 2CH5A 3I0RA 2KFZA 4GKKK 4J2BA 1CZ9A 4BREA 3C7NB 1U49A 4FWOA 2E8AA 1DGKN 3ENOA 4CCHA 4R79A 4ILGB 3K57A 4RTFD 5GAHP 1OKJA 4CZFA 4DR5K 4DKWA 1YJNN 4LFAK 1VQ6N 4JKDA 2W40A 5AQGA 3KLFA 3K0SA 3NF9A 4A5BA 1HMVA 1Q82O 4OGEA 3RRGA 1GLCG 1Y64A 3TAPA 3DLBA 3SAFA 3IG1A 1JL1A 3KK3A 2P5GA 5M1NA 4DV0K 1JLBA 1IKYA 1HNIA 4O4GA 1HYZA 2CGKA 1LCUA 4A62A 1RGIA 3CJ9A 4Y1CA 2DTUA 1NGAA 5F0XA 4BC5A 3V1RA 3NGIA 3C94A 5H1SQ 5KPZA 1NK6A 3F73A 5KPTA 1BI4B 4JD2B 4XH4A 5M1FA 3VERA 3OVNA 3EEQA 3EY1A 4ILHA 3J7YP 1NK0A 4FLTA 4FW1A 3EE9A 1QE1A 3VA0A 1TKTA 3PIPL 5MLCQ 1VSLA 4HCCA 4LFCK 3TWHA 5AZJA 4N5SA 2Z1JA 3SV3A 4O8KA 4BRGA 3THVA 3VF6A 2ATQA 3KLIA 3PSIA 2P5OA 3WNHA 1GLJO 3CCSN 3SPYA 4PA1A 5BN9A 4KFBA 3AVNA 3RMAA 2YJFA 3C65A 3C6TA 2GWJA 3AAPA 3HO1A 4JAXA 4WQ5A 1NGCA 4CJVA 4KRFA 1CXQA 1ASVA 3MAQA 1VRUA 3G6EN 4FJXA 5KQ8A 2Z1GA 1HNVA 1RNHA 1K8KB 4JI5K 3M8RA 4RWTA 5BN8A 3K5NA 4L3QA 4PL8A 4RW8A 4FO0A 1NK4A 2XHBA 4CF8A 2E1ZA 1LWFA 5JS2A 1BUPA 4H5RA 4BR7A 5BRHA 4GVMA 1C1AA 4CEDA 4CHNA 3NH1A 1P90A 4LC9B 4F3TA 2HBJA 3FR0A 2P9LA 4DB3A 1VQ9N 3LAMA 4IOXA 3ZT3A 1BO5O 3OW2M 1NLVA 2YCHA 1EWRA 4JI7K 4H8KA 2E2NA 4PKIA 5AQVA 1Q8IA 1QVGM 3LM9A 2HVHA 3VQQA 5CE3A 3IAYA 5KRSA 1XUPO 4EHUA 2P9KA 3C95A 2F9WA 5AQMA 3RR8A 3SQ2A 3DI6A 4CVNE 2RKIA 1JLEA 3DLHA 3L2QA 1JCEA 3DAWA 3DLRA 1S1TA 4CHOA 2V7ZA 3GG4A 4BGAA 4B9MA 5HP1A 2G8HA 2FSJA 5M1QA 4CEZA 2QI2A 4DSKA 1EWQA 4MDBA 4BR4A 4XIUA 5GINA 2A5XA 3I55N 2VG5A 3C6HA 4FWSA 3O5BA 3SI6A 2W42A 2PYJA 4RW4A 4B08A 4X65K 1T3VA 1J53A 2AA4A 3A5NC 1YJ9N 1A5WA 3TAQA 1JLGA 4WQ4C 3NH2A 2F96A 4DQSA 3VPZA 4E7IA 4B9TA 2E1YA 4BG9A 4JRPA 1IBLK 1C0FA 4FZYA 3W0LA 2GELA 2QW9A 3CIPA 1WB9A 3ZT1A 1U04A 1KD1O 3E9LA 4F2SA 1JLAA 5AQWA 1IBKK 4OPAA 1Q9YA 4PUOA 3QBXA 3UKRB 2QTDA 4F4KA 4J2AA 3UKUB 1FK9A 2F8TA 1ATRA 3OYFA 1LWCA 3V6DA 4BC2A 5FPMA 2RN2A 1N33K 1N6QA 2F7TA 4IOCL 5F1XA 3WXLA 2VGNA 4FJ7A 1BA0A 2CGLA 2G8KA 2ZJRL 2NRWA 4Y0WA 4BRIA 4DQRA 2D0PA 3VQ7A 3QDKA 2X6SA 4XH5A 1N34K 1XNRK 2O8EA 3E1YA 5HRRA 1RT1A 3THXA 3CI5A 4CHQA 2B6AA 3VETA 3L2UA 4K43A 3K9KA 3CJAA 1SL0A 2P51A 4CIGA 3CD6N 1SZ2A 1TV6A 5HRNA
chains in the Genus database with same CATH topology
4JI3K 4NXMK 2UXBK 5A2QO 2HHHK 3T1HK 4LF8K 5AJ3K 5IT9O 1HNXK 2UXCK 3J7YP 2F4VK 4DV3K 4B3TK 4JI8K 2VQEK 4JI4K 4LFCK 4V19S 4X66K 4X65K 2ZM6K 4CW7B 3J80O 4LF4K 4LF7K 2UXDK 5BR8K 4DUZK 1XMOK 1HNZK 2UUAK 1IBLK 4DV5K 4GKJK 4JV5K 5IWAK 4OX9K 4LF5K 1HNWK 4JI2K 1IBMK 4B3RK 2E5LK 5LMNK 3JAMO 4X64K 5LMUK 2VQFK 4DV1K 1IBKK 4LF9K 3J81O 1I94K 4JI1K 4YHHK 2UU9K 4DR3K 4B3MK 4JI5K 4DR6K 4GKKK 4B3SK 4JYAK 5FLXO 1XNQK 1N36K 4DR7K 4DR5K 4AQYK 1J5EK 4LFAK 1N33K 4YY3K 1N32K 4JI0K 4DR4K 4DV4K 1FJGK 3T1YK 3OTOK 1XMQK 4NXNK 4DV2K 4DR2K 4DR1K 4JI7K 4LF6K 4DUYK 2UUCK 4DV0K 1N34K 1XNRK 4X62K 4DV6K 4CVNE 1HR0K 4JI6K 4DV7K 5LL6Z 2UUBK 3J7AP 4KHPK 4LFBK 4K0KK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 K;  4NXM K;  2UXB K;  5A2Q O;  2HHH K;  3T1H K;  4LF8 K;  5AJ3 K;  5IT9 O;  1HNX K;  2UXC K;  3J7Y P;  2F4V K;  4DV3 K;  4B3T K;  4JI8 K;  2VQE K;  4JI4 K;  4LFC K;  4V19 S;  4X66 K;  4X65 K;  2ZM6 K;  4CW7 B;  3J80 O;  4LF4 K;  4LF7 K;  2UXD K;  5BR8 K;  4DUZ K;  1XMO K;  1HNZ K;  2UUA K;  1IBL K;  4DV5 K;  4GKJ K;  4JV5 K;  5IWA K;  4OX9 K;  4LF5 K;  1HNW K;  4JI2 K;  1IBM K;  4B3R K;  2E5L K;  5LMN K;  3JAM O;  4X64 K;  5LMU K;  2VQF K;  4DV1 K;  1IBK K;  4LF9 K;  3J81 O;  1I94 K;  4JI1 K;  4YHH K;  2UU9 K;  4DR3 K;  4B3M K;  4JI5 K;  4DR6 K;  4GKK K;  4B3S K;  4JYA K;  5FLX O;  1XNQ K;  1N36 K;  4DR7 K;  4DR5 K;  4AQY K;  1J5E K;  4LFA K;  1N33 K;  4YY3 K;  1N32 K;  4JI0 K;  4DR4 K;  4DV4 K;  1FJG K;  3T1Y K;  3OTO K;  1XMQ K;  4NXN K;  4DV2 K;  4DR2 K;  4DR1 K;  4JI7 K;  4LF6 K;  4DUY K;  2UUC K;  4DV0 K;  1N34 K;  1XNR K;  4X62 K;  4DV6 K;  4CVN E;  1HR0 K;  4JI6 K;  4DV7 K;  5LL6 Z;  2UUB K;  3J7A P;  4KHP K;  4LFB K;  4K0K K; 
#chains in the Genus database with same CATH topology
 5CZ2 A;  2DPN A;  4EIA A;  5FPE A;  3P83 D;  4BGB A;  3CF5 L;  3VA3 A;  3QBW A;  4QOZ B;  1TK5 A;  4HCB A;  1J54 A;  3CCU N;  1SL2 A;  1T6D A;  4B1U B;  2QXF A;  5C10 A;  1V4T A;  1WBD A;  3TPQ A;  3DMJ A;  4BR2 A;  1RT6 A;  5EX5 A;  1WAF A;  3ZSY A;  4DU4 A;  2ZM6 K;  3CJ1 A;  3HOS A;  4LF7 K;  4M7Y A;  3OYJ A;  2P9U B;  1RBT A;  4H5N A;  3D45 A;  2OPQ A;  3SUP A;  4BR5 A;  3OS2 A;  1W2B M;  3MWP A;  2VYP A;  4OX9 K;  3ZET A;  1HNW K;  3EZW A;  4FJN A;  3A5M C;  4MDA A;  4AHV A;  4BRH A;  3TSQ A;  4DFK A;  2YHX A;  5E26 A;  1VHX A;  5C15 A;  4GW6 A;  3RSE B;  5LY3 A;  4CE9 A;  3VEX A;  4B1Y B;  4GNI A;  4KTZ A;  3EZ5 A;  4DR6 K;  4BQZ A;  1A5X A;  3SMP A;  4FLX A;  3PX0 A;  1X9W A;  5CYM A;  3IKM A;  3ID8 A;  4K25 A;  3CER A;  2ZQB A;  1QVF M;  4EP4 A;  5FPN A;  3CC4 N;  4BRQ A;  1KAY A;  3NF8 A;  1O13 A;  2OYQ A;  1G99 A;  1YXQ A;  3VQD A;  3R8E A;  4EP5 A;  4CF0 A;  2LSN A;  4H5V A;  1EKE A;  4WCE L;  3ULE A;  3THW A;  1LW2 A;  3AV9 A;  3O9U A;  2R7Y A;  4DS5 A;  4X62 K;  3BGR A;  1XI1 A;  4DSF A;  1DTT A;  3HVR A;  1WSI A;  4BRL A;  3GDQ A;  2KHO A;  3ZYY X;  4FLU A;  4JI6 K;  4E7J A;  3KD5 E;  2Q97 A;  1ZBH A;  2HF4 A;  5FRN A;  4K0K K;  2W6L A;  4WE1 A;  3LP2 A;  1K8A O;  3LPT A;  4C8N A;  3O3G A;  4BE1 A;  3FE1 A;  3KWG A;  3V9W A;  1LWE A;  1NBW A;  2ASM A;  4B1V A;  4YNQ A;  3PX6 A;  3AVI A;  4JK9 A;  3OYM A;  3ZT0 A;  4MO5 A;  4G9Z A;  3ID6 A;  3S9H A;  4DV3 K;  3PX4 A;  1LW0 A;  4IFV A;  3KLE A;  2BGG A;  4YOR A;  1NMN A;  4DLG A;  4HWI A;  1NGF A;  1RBU A;  3DRS A;  3ZT2 A;  3HP9 A;  4B9Q A;  4JKA A;  1HLU A;  4DUZ K;  4CGF A;  5AQS A;  2RPI A;  5IWA K;  4FLZ A;  4EZ9 A;  3V4I A;  3MN5 A;  4FWL A;  3D2F B;  3S3M A;  3DRR A;  4DTP A;  3LP0 A;  4X64 K;  3NCI A;  1U48 A;  1D4X A;  3PLA A;  4CHZ A;  3M8Q A;  3TTF A;  4KH4 A;  2KQ2 A;  3N4Q A;  4OLB A;  2FXU A;  4BY9 C;  4RW9 A;  1C0M A;  3VGL A;  2A40 A;  4FM2 A;  4JYA K;  1P8Z A;  2A1S A;  1VQ7 N;  3WXK A;  5EVZ A;  1NJX A;  2YJE A;  1Q81 O;  3CCL N;  1H1V A;  1NGB A;  1TYQ A;  1YVN A;  3HTV A;  4M3W A;  4NYN A;  1SKW A;  2FF3 B;  5C12 A;  2Q0R A;  2O8B A;  3MEC A;  4F8R A;  1HKC A;  3SV4 A;  5AZI A;  3ATV A;  1S1V A;  4C8L A;  1ATS A;  4CBW A;  4I6M A;  3F5T A;  4YOU A;  4C8M A;  4DR1 K;  3HYF A;  3LL3 A;  3AA2 A;  4JKG A;  5AQO A;  5JVH L;  3S3N A;  4HVJ A;  1Z25 A;  3AAR A;  3OYE A;  4RW6 A;  5GAD P;  4N47 A;  4MO4 A;  4DWI A;  2CGJ A;  3R1X A;  3ZSV A;  3ZSQ A;  3QNN A;  3CC2 N;  2V7Y A;  2OA8 A;  2E4L A;  1Q86 O;  1HKG A;  1S6P A;  3ENH A;  4CEC A;  1IKV A;  1TL1 A;  4BWJ A;  5AQP A;  3E9O A;  1KVC A;  4I6M B;  3VEN A;  4L8R B;  4JHD A;  1M90 O;  2OZM A;  3HZ6 A;  4KPY A;  1C0U A;  3E01 A;  3LDN A;  1IV0 A;  5HBM A;  3OJU A;  4QCL A;  1KLN A;  4FOE A;  3VOV A;  3B6P A;  1W0H A;  1VQO N;  1C0G A;  4EAH D;  3QIC A;  1YJW N;  4CZJ A;  2IVO A;  4A2A A;  3O80 A;  3DLE A;  3RR7 A;  1BQN A;  4NB4 A;  1ATN A;  3O9R A;  1S1X A;  3R9P A;  5I42 A;  3FZL A;  4PKH A;  3PV8 A;  3MEE A;  4BC4 A;  3QEX A;  4B1Z A;  1XWL A;  3C0B A;  3SCX A;  4DS4 A;  4M3Z A;  4KBO A;  5AQI A;  3JS6 A;  5HRO A;  2KFN A;  3VEO A;  3HXM A;  1WN7 A;  3SLC A;  3C7N A;  3WEE A;  3ZSR A;  5EU7 A;  4DU1 A;  1TUU A;  3LAL A;  1NK5 A;  4BE2 A;  4DR3 K;  3AO5 A;  3TTD A;  2HND A;  4LSL A;  4CF1 A;  1VSI A;  5C2D A;  1MWK A;  5FRM A;  3TAB A;  1XNQ K;  3HPH A;  3AGR A;  1BOT O;  3MX5 A;  3SK3 A;  1J5E K;  2QWN A;  1XHX A;  2HW3 A;  4CGJ A;  4UQG A;  3OS0 A;  3O4Q A;  1J9A A;  3THY B;  1WSE A;  3QES A;  3GOI A;  1B9D A;  4DV2 K;  3W3D A;  3L2V A;  3MDQ A;  4FWP A;  5BR9 A;  3MXJ A;  4B8C A;  5JS1 A;  3NVM A;  2HHU A;  1EX4 A;  3WEE B;  4DUY K;  2ZGZ A;  2IVP A;  3CCR N;  3FLC O;  4KO0 A;  5AQF A;  1L3V A;  4FJ8 A;  4M63 C;  2YNF A;  3CM5 A;  3DLL L;  4DV6 K;  2BDP A;  1E4F T;  2A41 A;  1U6Z A;  4DV7 K;  3V81 A;  1BI4 A;  4O0I A;  1KFS A;  4E1M A;  4JD2 A;  3I33 A;  1HYS A;  4C8K A;  3LDL A;  2QWM A;  5HLF A;  4B9L A;  1OVQ A;  4FW2 A;  3A8Y A;  3JSM A;  4JI3 K;  2OAN A;  5AJ3 K;  4Z94 A;  1OVY A;  2OZS A;  5IT9 O;  4DCH A;  1RDW X;  3CFO A;  3MWT A;  5J2P A;  2AJQ A;  3MEG A;  2HHX A;  2YKN A;  2EHG A;  3DOL A;  3S41 A;  3VF2 A;  1RTH A;  1SUQ A;  4CJ7 A;  2VQE K;  3NGZ A;  3L2W A;  4Z4C A;  3A5O C;  4IWV A;  4I7F A;  1YIT N;  2FSK A;  1VRT A;  1TAQ A;  3NVK A;  2RF2 A;  2E20 A;  3DLG A;  4JEP A;  4DFP A;  1BGX T;  2X78 A;  4H0X B;  2PZS A;  4LF5 K;  3A5L C;  5CHI A;  2XO7 A;  4Z4I A;  4BWM A;  1K8K A;  3VN5 A;  3RMD A;  4BAC A;  1NGH A;  4FK4 A;  3AVA A;  2VQF K;  4WQ5 C;  4DQQ A;  3CHW A;  4O55 A;  2NZT A;  1UOC A;  3IRX A;  3M3Z A;  1D8Y A;  4W5R A;  3A0I X;  1UA1 A;  2G8W A;  1EO1 A;  2UU9 K;  4JKB A;  3CME N;  4KHQ A;  5DMR A;  4FJJ A;  1X9J A;  3E9P A;  3FGU A;  4ISF A;  5AQT A;  4KTQ A;  3H3N O;  4OKJ A;  3QER A;  3OYA A;  4BRM A;  2KW4 A;  3VQ4 A;  4CJQ A;  1BCM A;  4KH6 A;  3VEY A;  3N4P A;  3BF1 A;  4YOW A;  4CFC A;  4CGH A;  3SNN A;  4K8X A;  3WT0 A;  2I5J A;  4AHR A;  3AO2 A;  3OS1 A;  3WNG A;  3QET A;  1OH5 A;  5AQZ A;  4LF6 K;  1SAZ A;  1QS4 A;  2GV9 A;  1L3U A;  1S9G A;  2HOE A;  1X9S A;  4DLE A;  1QSL A;  1C1C A;  1YF5 L;  2ZE2 A;  2IOC A;  4AH9 A;  5KPR A;  2PY5 A;  2WBN A;  3MCP A;  4YDU C;  3BDP A;  2FBX A;  3OYK A;  5M1K A;  4I2P A;  3O4N A;  1HX1 A;  1S1W A;  5AFU H;  4CJW A;  1QZ6 A;  4AIL C;  4CIF A;  3SZ2 A;  2WOM A;  3M5R A;  2VGM A;  1VK0 A;  2XY8 A;  2ASP A;  1GOC A;  2D4W A;  3O1B A;  4OGC A;  2FSN A;  4YDU A;  2HBL A;  4JKF A;  3AGK A;  3HL8 A;  1REV A;  2HHV A;  4J8F A;  3FZM A;  3RWU A;  5AQJ A;  4DTR A;  4FOI A;  3LZJ A;  3H6E A;  4C1N I;  2D5R A;  4IO9 L;  2PYL A;  3RMB A;  1K6Y A;  4DFM A;  5AQN A;  3OA9 A;  3ZLJ A;  1NG9 A;  1JLC A;  2HST A;  4E0D A;  3DOK A;  1HNZ K;  3TR8 A;  1R0A A;  1BDG A;  1NGE A;  4GY2 B;  2NRX A;  3EN9 A;  3NDK A;  2QWR A;  2YX6 A;  5LMN K;  3ZSW A;  3O9S A;  4CJ4 A;  3Q7B A;  3UKR A;  1N8R O;  4RW7 A;  4DV1 K;  3LDS A;  4ZTF A;  1HQE A;  2V52 B;  4CEF A;  2GEM A;  4FLV A;  4CZI A;  3TI0 A;  2ASO A;  4DQ8 A;  3UKU A;  3CJ7 A;  3OYI A;  3QEP A;  4ELV A;  5C25 A;  3FZF A;  1GLF O;  3SUQ A;  5HOO A;  1M1K O;  1IJJ A;  1VSE A;  2H3G X;  3IS9 A;  4LY7 A;  3HST B;  4Q0B A;  4WFN L;  3CCJ N;  4H0V B;  4CF2 A;  1I3A A;  1TK0 A;  2GUP A;  4PHT X;  2QXL A;  1BIU A;  1XQS C;  3K2P A;  2DFE A;  4GVE A;  3D0P A;  4BDY A;  3QIN A;  2AP1 A;  1U45 A;  1IG8 A;  3HJF A;  4DTM A;  4CJU A;  1HPM A;  4CIE A;  2OTL N;  1TKD A;  4H4O A;  5ELZ A;  1UWB A;  2HF3 A;  1NMD A;  3HM8 A;  2WTU A;  1CZA N;  1BHL A;  3IFR A;  2ITG A;  4FPB A;  4KHN A;  1VSJ A;  4IFE A;  1WSF A;  3TSP A;  2B4J A;  5HRP A;  3VQB A;  3SMS A;  5E84 A;  3HPG A;  3TAE A;  2UXB K;  1FKO A;  3WXM B;  2VWK A;  4FJG A;  5J2Q A;  3L2R A;  1GLD G;  3HRG A;  4CJT A;  4OKE A;  4XH1 A;  1JXB A;  1WSH A;  3CJB A;  2GX9 A;  4B9S A;  1HRH A;  3ZSO A;  1S5J A;  2P9U A;  4AM6 A;  1HQU A;  4EFH A;  2KZM A;  5J2M A;  2P9S B;  4YOV A;  5BPN A;  3I0S A;  3CCM N;  1VSM A;  2QM1 A;  3PO5 A;  4LF4 K;  1RTJ A;  3R3L A;  4JKH A;  4NCB A;  2PBD A;  3DXK A;  3VES A;  1B92 A;  1RTI A;  1KTQ A;  3BF3 A;  3OBW A;  4DHY A;  1RT7 A;  2OPR A;  2HVI A;  4W5Q A;  4AHT A;  3DRP A;  1WUA A;  4B3R K;  1BCO A;  4NLB A;  3RSE A;  1SS6 A;  3CET A;  2E88 A;  4GV3 A;  2Q1N A;  1ESV A;  2KLA A;  1RT4 A;  1VQP N;  4NCG A;  1DLO A;  1VSF A;  2Y1J A;  1C6V A;  1I39 A;  4J2D A;  3ASM A;  2FBT A;  4Z4F A;  3SQ4 A;  3VQP A;  3WUH A;  3MX2 A;  4E7K A;  4DR7 K;  2O8F B;  4ZTJ A;  3EYZ A;  1NWK A;  4OO1 J;  4H5T A;  4FJM A;  1X3N A;  2NRR A;  1VQL N;  3DXK B;  4I9Q A;  3EKS A;  2Z1H A;  1N32 K;  4JI0 K;  2QEX N;  3OTO K;  1XMQ K;  3SPZ A;  1C0T A;  3KLH A;  2OCE A;  1BIZ A;  1NK9 A;  3CPW M;  1HPZ A;  4BE0 A;  4ISG A;  3AA3 A;  1D5A A;  3BUZ B;  2G8V A;  2VG7 A;  5SZT A;  1NK8 A;  3SQ1 A;  2G8I A;  3FFI A;  4O0J A;  4B1W B;  2X74 A;  4JK7 A;  5C0Y A;  4AHC A;  3A2F A;  2IDO A;  2EX3 A;  3VQ6 A;  3J7A P;  4KHW A;  2NUB A;  4ICL A;  5JMV A;  4DTX A;  2B5J A;  2D1K A;  3D6R A;  4JN4 A;  2QKK A;  2G8F A;  2QWO A;  3CMA N;  5CYQ A;  3ZSX A;  1NGD A;  4CFB A;  2BTF A;  5C24 A;  3QEI A;  1BWF O;  4FLY A;  1EXQ A;  3NH0 A;  4M3U A;  1FXX A;  1LAW A;  4IJN A;  2XY6 A;  2P9I B;  2O8D A;  1JLQ A;  1NGJ A;  4X66 K;  4DSI A;  3CFP A;  4DTO A;  1D9F A;  4Q5V A;  3L6Q A;  4O8U A;  1KVA A;  2Q0U A;  1TVR A;  3BZK A;  4FL9 A;  3K58 A;  1SKS A;  3TAN A;  3FZH A;  3AA4 A;  4CEO A;  4KB1 A;  4CBX A;  5C2F A;  5DM6 L;  4NCA A;  3D2F A;  4GKJ K;  3KHY A;  5AFU A;  4JV5 K;  3O08 A;  5BRF A;  5CR4 A;  3KVG A;  3PIO L;  4CEE A;  1WBB A;  4RG8 A;  1X1P A;  3AO1 A;  3V9Z A;  2D0B A;  3VQ9 A;  3VMF B;  3PUF A;  4KTW A;  4E7H A;  2O8D B;  2Q36 A;  3KZB A;  5AQK A;  2OPP A;  1WNS A;  4BVP A;  4BG8 A;  1DTQ A;  1JXE A;  1QQN A;  3TAM A;  4QS7 A;  2VWJ A;  1DKG D;  3SYZ A;  1FKP A;  3T69 A;  3SJJ A;  1F21 A;  1SKR A;  1WSG A;  4ELT A;  1ZBU A;  3C6A A;  3KK7 A;  3U8X A;  4BC3 A;  1JJ2 M;  3O4W A;  3EL2 A;  4YOT A;  5KI6 A;  4DR4 K;  3ZT4 A;  4O5F A;  4OPK A;  3NAE A;  3LM2 A;  1T7P A;  1ITG A;  4KH5 A;  4A61 A;  4A57 A;  3F9K A;  4CBU A;  4JKC A;  4EHT A;  4DR2 K;  3M8P A;  2YHB A;  4N41 A;  4H0Y B;  4A2B A;  1ILY A;  4CHP A;  3DXM A;  2JWL A;  2VCP A;  3AVF A;  1NKB A;  3L0Q A;  4BRF A;  4ISE A;  1X9M A;  1D9D A;  3Q7C A;  3CQX A;  3GE1 A;  4FJ9 A;  5BPM A;  5HRS A;  2P9P A;  1RBR A;  2YNH A;  4NXM K;  5A2Q O;  2HHH K;  2BE2 A;  4LF8 K;  4PL7 A;  3CFR A;  3M8S A;  1L3S A;  3D2E A;  3MN7 A;  3SUO A;  4FCY A;  1NJI O;  4CI6 A;  5GIP A;  3NF6 A;  1RT2 A;  3WQT A;  4FYD A;  3T19 A;  2HB5 A;  3DXM B;  4V19 S;  1Z26 A;  2YNG A;  3WNF A;  4WFA L;  3AY9 A;  2Q31 A;  1HUX A;  3LP1 A;  3VTI A;  2I7P A;  4U7B A;  1RTD A;  2YV0 X;  4CJS A;  2UUA K;  4KHY A;  1UA0 A;  1Q18 A;  2P9P B;  1QSY A;  1GOA A;  4LH5 A;  1T8E A;  3MMV A;  3G4S N;  3PY8 A;  4N76 A;  2O8C B;  3TU5 A;  3L3U A;  3ZX3 A;  4E3S A;  3O9T A;  3CG7 A;  5DM7 L;  1QZ5 A;  1B9F A;  2HHS A;  2XRI A;  3D2E B;  5CY4 A;  4FWR A;  5LMU K;  1QQO A;  4FVM A;  4JI1 K;  5EOY A;  4CFA A;  3KD1 E;  2GTD A;  3P4I A;  5LJV A;  4FXD A;  4FWK A;  3VGK A;  1IKX A;  2EWS A;  4OPJ A;  3H3O B;  1KAZ A;  4YOX A;  1LAV A;  4XEI A;  4QS9 A;  3KKS A;  3L8B A;  3THY A;  1JCG A;  3SJH A;  3I8B A;  1KC8 O;  4IFY A;  4CES A;  3KLG A;  1LOT B;  2A6A A;  4DMN A;  1QSS A;  2D0C A;  4FJL A;  1ZXO A;  1XC9 A;  3O9Q A;  4DV4 K;  2Z1I A;  4G1Q A;  2YI1 A;  5KQD A;  4LH4 A;  4R5P A;  1OH8 A;  1VQK N;  2ZD1 A;  2BAN A;  3QLH A;  3ZEU B;  1L5U A;  1U2V B;  5SWM A;  3BY5 A;  3OBY A;  4CEQ A;  4BRN A;  5JLF A;  4DF4 A;  3U9Z A;  4CJR A;  4M7X A;  5BRD A;  3U3G A;  4O5B A;  4FJ5 A;  4FM1 A;  2NNW A;  4IXC A;  2RE2 A;  1O1W A;  3ZSZ A;  2UUB K;  2E6L A;  1NKC A;  4HUE A;  3NE6 A;  1MDU B;  1CXU A;  2IVN A;  3TTC A;  1RT5 A;  4AHU A;  4B1X B;  3NBP A;  4IEE A;  4CD3 A;  1BU6 O;  1ASU A;  3DM2 A;  1VSD A;  3EO3 A;  1HNX K;  5KGX A;  5I9E B;  1S72 N;  3KTQ A;  1NGI A;  3C6U A;  1X3M A;  1EQY A;  1VQ4 N;  1SL1 A;  2BH1 A;  2P9N B;  3AO3 A;  4IDH A;  3MED A;  4DTN A;  3K59 A;  3AVM A;  2WUS A;  3V1Q A;  4CZG A;  4DSE A;  3O8M A;  1ZBL A;  4LSN A;  2DY4 A;  5JLH A;  3R6M A;  4E1N A;  3LDQ A;  3PO4 A;  4OVL A;  3TAR A;  4OKK A;  3G25 A;  1JL2 A;  3ALY A;  4ID1 A;  1TAU A;  3K5M A;  3SAH A;  3G71 N;  4AHS A;  4AM7 A;  1VQM N;  4A5A A;  4OLA A;  4LF9 K;  4K42 A;  1I94 K;  3OYH A;  3HK2 A;  3RVC A;  4RCH A;  3MXM A;  2YHW A;  1GLB G;  4PKG A;  2CH6 A;  3F2K A;  3RTV A;  3VQE A;  3H1Q A;  4HTU A;  2ZWH A;  1KSP A;  2IIR A;  5AQX A;  1TKX A;  2YNI A;  1S6Q A;  4CZL A;  3QO9 A;  2G8U A;  2QK9 A;  2WC9 A;  1GLA G;  3ZX0 A;  1T44 A;  1RIL A;  2KKZ A;  4BR9 A;  4CK1 A;  1YAG A;  3U3Y A;  3UIQ A;  2OPS A;  5JIC A;  5K14 A;  4CD1 A;  1YT3 A;  2HHQ A;  3HI0 A;  3H46 O;  3HP6 A;  5ADX H;  3AA5 X;  4IBN A;  3WXJ A;  3MXI A;  4M3Y A;  1SV5 A;  3CM6 A;  1C1B A;  1QHT A;  1RBV A;  3P39 A;  4CJL A;  5FPD A;  3E66 A;  2NRV A;  4CER A;  4CZE A;  4K8Z A;  2VWB A;  4KKO A;  3U6F A;  3QEW A;  3J7Z O;  4QAG A;  4PY5 A;  3ISN C;  3L4Q A;  4B8A B;  1KXP A;  1XC3 A;  4CGG A;  3SBT A;  4Z4E A;  3DYA A;  3P31 A;  4BRP A;  1BQM A;  4U67 L;  5AQR A;  5KGW A;  4CZH A;  2YKM A;  4IDK A;  1Z6R A;  1GOB A;  5D3G A;  4DQP A;  3P5J A;  4BRD A;  3BP8 A;  2O4I A;  1YHQ N;  4CF9 A;  3VF4 A;  1QTM A;  1T03 A;  4FZX C;  2WFB A;  1RCH A;  2GUI A;  2VG6 A;  4CGD A;  5AQQ A;  3J8A A;  2XY5 A;  3IUC A;  4IKF A;  1NM1 A;  3KWI A;  4FWN A;  2UXD K;  5AZJ B;  1MA9 B;  2IGI A;  3WXI A;  3CCQ N;  1BA1 A;  4GV6 A;  4DV5 K;  3G0Z A;  3VQ5 A;  2HHW A;  4LD0 A;  3H08 A;  3JXU A;  4TSX A;  2GWK A;  4JRQ A;  1T6C A;  4F2R A;  1VSH A;  2E5L K;  3JAM O;  3VTH A;  4PQU A;  4DTJ A;  1HYV A;  3ZX2 A;  4GV9 A;  1GLE G;  1WAJ A;  4ELU A;  2I7N A;  4N56 A;  1NU0 A;  4M3T A;  1NOZ A;  2HNZ A;  3K9J A;  3VEV A;  4A59 A;  1YIJ N;  4H5W A;  2A42 A;  3B6O A;  3T7Z A;  1QHA A;  3NHG A;  1CZB A;  1VQ8 N;  1EET A;  1N36 K;  4FJK A;  4YFU A;  4CEA A;  4M42 A;  3CJC A;  3NF7 A;  2D0A A;  3ATU A;  3OYL A;  4CGI A;  2YHA A;  1HKB A;  1ZYQ A;  1OH7 A;  4CJK A;  3KK1 A;  5T7B A;  1TKZ A;  4WYB A;  4NXN K;  3HT3 A;  1RDA A;  4YOY A;  2WON A;  4PWD A;  2P9L B;  4UY8 O;  3DJC A;  2J4R A;  2HHT A;  1YVU A;  3H45 C;  1K73 O;  4QS8 A;  3OYB A;  3QFP A;  4WF9 L;  1TUY A;  1RFQ A;  1N5Y A;  2FLO A;  2ZJQ L;  3T3F A;  1U4B A;  2IAJ A;  1IG9 A;  1J6Z A;  5LL6 Z;  5E41 A;  3GL1 A;  4KHP K;  2P9K B;  4KI4 A;  4LFB K;  4FJH A;  2NRH A;  3OYC A;  2KTQ A;  3HBT A;  3MN9 A;  1K9M O;  2A1R A;  4FLW A;  1XHZ A;  3SBG A;  4HUF A;  4BVO A;  4CFD A;  1EP4 A;  4CZK A;  4JS5 A;  3EE8 A;  2P9S A;  4FM0 A;  3HPO A;  2X6N A;  4K41 A;  5FRO A;  1KFD A;  4WQ4 A;  5CZ1 A;  2Q2R A;  5BRE A;  4C23 A;  4FPA A;  1ZBS A;  4CJE A;  3V9X A;  3ITH A;  2E2Q A;  1XMO K;  1KLM A;  1YUW A;  1MU2 A;  4Z4H A;  4Z4G A;  4DSJ A;  2JWK A;  1HJO A;  4CEB A;  3EKU A;  1E4G T;  4JKE A;  5AQL A;  4E7L A;  4FK0 A;  4DG1 A;  1RT3 A;  4KRE A;  4HHT A;  4H0O A;  3U9D A;  4DTS A;  3P1G A;  5I3U A;  2E2O A;  2IC3 A;  1HJR A;  1S22 A;  2O4G A;  2A3Z A;  4DU3 A;  2W6K A;  1QQC A;  4DTU A;  2O8F A;  3CXC M;  2PAV A;  4BR0 A;  4CJP A;  1YTU A;  5FLX O;  1BIS A;  4J2E A;  4FSV A;  4NLC A;  1E3M A;  4CK3 A;  5M1O A;  1RDU A;  4HTL A;  3SUN A;  4YY3 K;  4KV8 A;  3DWL A;  4BQL A;  1JKH A;  1FJG K;  3MK6 A;  3HSC A;  4DQI A;  3B8A X;  5LJW A;  2GBZ A;  3QIP A;  5KTQ A;  2RHK A;  4JLH A;  1RBS A;  1NK7 A;  2ZGY A;  3T1A A;  2NLX A;  4MLH A;  1IO2 A;  2Y1I A;  2UUC K;  3LZI A;  1TGO A;  1NNE A;  4NO7 A;  2OTJ N;  1OH6 A;  3VQ8 A;  1DT9 A;  4W5T A;  4OJR A;  2O8E B;  1WOQ A;  1HR0 K;  1CLQ A;  1RDB A;  3THX B;  1MWM A;  3CQ8 A;  3AAQ A;  4IG3 A;  3UE5 A;  3CCE N;  1QQM A;  5TKW A;  3HVT A;  1NJW A;  1BG3 A;  3OY9 A;  4E89 A;  2P9I A;  4BDP A;  2QWQ A;  2HBK A;  4F9O A;  3VGM A;  4IO8 A;  4W5O A;  1DEJ A;  4CJ5 A;  5DK5 A;  3UB5 A;  1ZC6 A;  2F4V K;  4KAZ A;  1G15 A;  4KI6 A;  4Z0U A;  5EXW A;  4B3T K;  3OYG A;  3BEX A;  4B3O A;  2QA4 N;  4GMJ B;  3M6G A;  2DFF A;  1KCF A;  2DFH A;  5ADX A;  4F3O A;  3J80 O;  3K5O A;  2ZF5 O;  2QWL A;  3WNE A;  5BR8 K;  3O3H A;  3BZC A;  3RMC A;  3LDP A;  4KHU A;  2KZZ A;  2D0O A;  4JI2 K;  4CK2 A;  3V9U A;  4FWQ A;  3P38 A;  3QIO A;  1BL3 A;  3ZET B;  3PSF A;  2HBM A;  4CJF A;  1VAZ A;  1GLL O;  2XY7 A;  4DF8 A;  4B9V A;  4MQ3 A;  3J81 O;  4M45 A;  1T05 A;  4OPH A;  2YHY A;  1R59 O;  2NRZ A;  3F9M A;  4I9L A;  1LV5 A;  4IEI A;  1ZBI A;  1V4S A;  3H1V X;  4HUG A;  1J5O A;  4MLE A;  2V51 B;  1WLJ A;  4AQY K;  2W41 A;  5KRT A;  3HM9 A;  3D7E O;  4BRA A;  3DLK A;  1Y97 A;  4ID5 A;  3VEW A;  4C8O A;  3KK2 A;  3LWM A;  1VQ5 N;  3QEV A;  5J2N A;  1Q7Y O;  2F8S A;  3SAG A;  4ZHR A;  3QNO A;  3VQA A;  3I8D A;  1NGG A;  4WFB L;  3ULE B;  3THW B;  1NKE A;  3AVK A;  4FK2 A;  5B8H A;  3QFU A;  5JVG L;  2FBV A;  3LAN A;  1KVB A;  1W9H A;  5M1P A;  4O44 A;  4DFJ A;  1W97 L;  3LAK A;  3IDH A;  2FC0 A;  1KQS M;  3KIO A;  4BRK A;  3O1W A;  4H0T B;  2JGU A;  5FDL A;  2Q3S A;  4Y1D A;  3HOT A;  3NFA A;  4C1N K;  3CC7 N;  3G10 A;  1FW6 A;  2UXC K;  4BDZ A;  1KAX A;  2E6M A;  2NRT A;  2P1J A;  3NMU A;  3KJV A;  3AVB A;  3CCV N;  4JI8 K;  2FBY A;  4JI4 K;  2BUP A;  4CZM A;  1WSJ A;  5GIO A;  4B9N A;  2QKB A;  4CW7 B;  1VSK A;  1W7A A;  3OYD A;  3AVJ A;  3L3V A;  3CYM A;  5EY4 A;  4BRO A;  5AQU A;  3TAG A;  2O8C A;  3AO4 A;  3LDO A;  1TK8 A;  4M3X A;  1IBM K;  4IZ9 A;  3S3O A;  2QWP A;  5GAG P;  3OYN A;  1ASW A;  3LWL A;  4DSL A;  4NYF A;  4YHH K;  4EZ6 A;  3AVG A;  4B3M K;  3O6W A;  4BRC A;  5C42 A;  4KHS A;  4B3S K;  5AQH A;  3U4L A;  4E1J A;  5TKY A;  3CPE A;  4I2Q A;  3ULD A;  1JLF A;  1S1U A;  1UAX A;  1TYQ B;  2HMP A;  3AVC A;  1RDC A;  3ZEU A;  3T1Y K;  1U2V A;  4KB0 A;  3TSU A;  3FFK B;  2O8B B;  3AVL A;  4CHY A;  3VQC A;  1U47 A;  1S3X A;  5AZI B;  3LP3 A;  4E19 A;  4IOA L;  3CQY A;  2FF6 A;  1IH7 A;  3MN6 A;  1NOY A;  1VQN N;  5HL7 L;  5GAE P;  1TL3 A;  3ZCM A;  3WQU A;  5J1E A;  4JKG B;  1KRP A;  3I56 N;  3VEZ A;  3QB0 A;  4FJI A;  4FWM A;  5BPL A;  4H03 B;  3JYT A;  4H0P A;  3FZK A;  3LPU A;  3AVH A;  3GBT A;  3M1F A;  5AR0 A;  5F2R A;  2HMI A;  4CJ3 A;  4B9U A;  4W5N A;  3ENB A;  1Z05 A;  1YTA A;  3T1H K;  2ITM A;  4M41 A;  3K5L A;  1YI2 N;  4FZZ A;  1NJY A;  1Q9X A;  3O3F A;  3NGY A;  3V1O A;  3SQ0 A;  4JHD B;  1JCF A;  2HNY A;  3RRH A;  2P9N A;  2ETJ A;  4M3R A;  3V9S A;  4JS4 A;  1SQK A;  4ILJ A;  4IJA A;  5AQY A;  1S9E A;  2JLE A;  1A5V A;  3KKR A;  4FVU A;  2ZJP L;  2PFU A;  4IG0 A;  3OHR A;  3QML A;  4JNE A;  2IS3 A;  1NJZ A;  4JK8 A;  3OJS A;  3TAF A;  3IMX A;  2UYT A;  3MCA B;  1L3T A;  2E2P A;  4AF1 A;  1ZBF A;  4MFB A;  2F9T A;  3L4I A;  4H4M A;  1IKW A;  1RDD A;  2CH5 A;  3I0R A;  2KFZ A;  4GKK K;  4J2B A;  1CZ9 A;  4BRE A;  3C7N B;  1U49 A;  4FWO A;  2E8A A;  1DGK N;  3ENO A;  4CCH A;  4R79 A;  4ILG B;  3K57 A;  4RTF D;  5GAH P;  1OKJ A;  4CZF A;  4DR5 K;  4DKW A;  1YJN N;  4LFA K;  1VQ6 N;  4JKD A;  2W40 A;  5AQG A;  3KLF A;  3K0S A;  3NF9 A;  4A5B A;  1HMV A;  1Q82 O;  4OGE A;  3RRG A;  1GLC G;  1Y64 A;  3TAP A;  3DLB A;  3SAF A;  3IG1 A;  1JL1 A;  3KK3 A;  2P5G A;  5M1N A;  4DV0 K;  1JLB A;  1IKY A;  1HNI A;  4O4G A;  1HYZ A;  2CGK A;  1LCU A;  4A62 A;  1RGI A;  3CJ9 A;  4Y1C A;  2DTU A;  1NGA A;  5F0X A;  4BC5 A;  3V1R A;  3NGI A;  3C94 A;  5H1S Q;  5KPZ A;  1NK6 A;  3F73 A;  5KPT A;  1BI4 B;  4JD2 B;  4XH4 A;  5M1F A;  3VER A;  3OVN A;  3EEQ A;  3EY1 A;  4ILH A;  3J7Y P;  1NK0 A;  4FLT A;  4FW1 A;  3EE9 A;  1QE1 A;  3VA0 A;  1TKT A;  3PIP L;  5MLC Q;  1VSL A;  4HCC A;  4LFC K;  3TWH A;  5AZJ A;  4N5S A;  2Z1J A;  3SV3 A;  4O8K A;  4BRG A;  3THV A;  3VF6 A;  2ATQ A;  3KLI A;  3PSI A;  2P5O A;  3WNH A;  1GLJ O;  3CCS N;  3SPY A;  4PA1 A;  5BN9 A;  4KFB A;  3AVN A;  3RMA A;  2YJF A;  3C65 A;  3C6T A;  2GWJ A;  3AAP A;  3HO1 A;  4JAX A;  4WQ5 A;  1NGC A;  4CJV A;  4KRF A;  1CXQ A;  1ASV A;  3MAQ A;  1VRU A;  3G6E N;  4FJX A;  5KQ8 A;  2Z1G A;  1HNV A;  1RNH A;  1K8K B;  4JI5 K;  3M8R A;  4RWT A;  5BN8 A;  3K5N A;  4L3Q A;  4PL8 A;  4RW8 A;  4FO0 A;  1NK4 A;  2XHB A;  4CF8 A;  2E1Z A;  1LWF A;  5JS2 A;  1BUP A;  4H5R A;  4BR7 A;  5BRH A;  4GVM A;  1C1A A;  4CED A;  4CHN A;  3NH1 A;  1P90 A;  4LC9 B;  4F3T A;  2HBJ A;  3FR0 A;  2P9L A;  4DB3 A;  1VQ9 N;  3LAM A;  4IOX A;  3ZT3 A;  1BO5 O;  3OW2 M;  1NLV A;  2YCH A;  1EWR A;  4JI7 K;  4H8K A;  2E2N A;  4PKI A;  5AQV A;  1Q8I A;  1QVG M;  3LM9 A;  2HVH A;  3VQQ A;  5CE3 A;  3IAY A;  5KRS A;  1XUP O;  4EHU A;  2P9K A;  3C95 A;  2F9W A;  5AQM A;  3RR8 A;  3SQ2 A;  3DI6 A;  4CVN E;  2RKI A;  1JLE A;  3DLH A;  3L2Q A;  1JCE A;  3DAW A;  3DLR A;  1S1T A;  4CHO A;  2V7Z A;  3GG4 A;  4BGA A;  4B9M A;  5HP1 A;  2G8H A;  2FSJ A;  5M1Q A;  4CEZ A;  2QI2 A;  4DSK A;  1EWQ A;  4MDB A;  4BR4 A;  4XIU A;  5GIN A;  2A5X A;  3I55 N;  2VG5 A;  3C6H A;  4FWS A;  3O5B A;  3SI6 A;  2W42 A;  2PYJ A;  4RW4 A;  4B08 A;  4X65 K;  1T3V A;  1J53 A;  2AA4 A;  3A5N C;  1YJ9 N;  1A5W A;  3TAQ A;  1JLG A;  4WQ4 C;  3NH2 A;  2F96 A;  4DQS A;  3VPZ A;  4E7I A;  4B9T A;  2E1Y A;  4BG9 A;  4JRP A;  1IBL K;  1C0F A;  4FZY A;  3W0L A;  2GEL A;  2QW9 A;  3CIP A;  1WB9 A;  3ZT1 A;  1U04 A;  1KD1 O;  3E9L A;  4F2S A;  1JLA A;  5AQW A;  1IBK K;  4OPA A;  1Q9Y A;  4PUO A;  3QBX A;  3UKR B;  2QTD A;  4F4K A;  4J2A A;  3UKU B;  1FK9 A;  2F8T A;  1ATR A;  3OYF A;  1LWC A;  3V6D A;  4BC2 A;  5FPM A;  2RN2 A;  1N33 K;  1N6Q A;  2F7T A;  4IOC L;  5F1X A;  3WXL A;  2VGN A;  4FJ7 A;  1BA0 A;  2CGL A;  2G8K A;  2ZJR L;  2NRW A;  4Y0W A;  4BRI A;  4DQR A;  2D0P A;  3VQ7 A;  3QDK A;  2X6S A;  4XH5 A;  1N34 K;  1XNR K;  2O8E A;  3E1Y A;  5HRR A;  1RT1 A;  3THX A;  3CI5 A;  4CHQ A;  2B6A A;  3VET A;  3L2U A;  4K43 A;  3K9K A;  3CJA A;  1SL0 A;  2P51 A;  4CIG A;  3CD6 N;  1SZ2 A;  1TV6 A;  5HRN A; 
#chains in the Genus database with same CATH homology
 4JI3 K;  4NXM K;  2UXB K;  5A2Q O;  2HHH K;  3T1H K;  4LF8 K;  5AJ3 K;  5IT9 O;  1HNX K;  2UXC K;  3J7Y P;  2F4V K;  4DV3 K;  4B3T K;  4JI8 K;  2VQE K;  4JI4 K;  4LFC K;  4V19 S;  4X66 K;  4X65 K;  2ZM6 K;  4CW7 B;  3J80 O;  4LF4 K;  4LF7 K;  2UXD K;  5BR8 K;  4DUZ K;  1XMO K;  1HNZ K;  2UUA K;  1IBL K;  4DV5 K;  4GKJ K;  4JV5 K;  5IWA K;  4OX9 K;  4LF5 K;  1HNW K;  4JI2 K;  1IBM K;  4B3R K;  2E5L K;  5LMN K;  3JAM O;  4X64 K;  5LMU K;  2VQF K;  4DV1 K;  1IBK K;  4LF9 K;  3J81 O;  1I94 K;  4JI1 K;  4YHH K;  2UU9 K;  4DR3 K;  4B3M K;  4JI5 K;  4DR6 K;  4GKK K;  4B3S K;  4JYA K;  5FLX O;  1XNQ K;  1N36 K;  4DR7 K;  4DR5 K;  4AQY K;  1J5E K;  4LFA K;  1N33 K;  4YY3 K;  1N32 K;  4JI0 K;  4DR4 K;  4DV4 K;  1FJG K;  3T1Y K;  3OTO K;  1XMQ K;  4NXN K;  4DV2 K;  4DR2 K;  4DR1 K;  4JI7 K;  4LF6 K;  4DUY K;  2UUC K;  4DV0 K;  1N34 K;  1XNR K;  4X62 K;  4DV6 K;  4CVN E;  1HR0 K;  4JI6 K;  4DV7 K;  5LL6 Z;  2UUB K;  3J7A P;  4KHP K;  4LFB K;  4K0K K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...