2E4LA

Thermodynamic and structural analysis of thermolabile rnase hi from shewanella oneidensis mr-1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
LKLIHIFTDGSCLGNPGPGGYGIVMNYKGHTKEMSDGFSLTTNNRMELLAPIVALEALKEPCKIILTSDSQYMRQGIMTWIHGWKKKGWMTSNRTPVKNVDLWKRLDKAAQLHQIDWRWVKGHAGHAENERCDQLARAAAEANPTQIDTGYQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Structural, thermodynamic, and mutational analyses of a psychrotrophic RNase HI.
pubmed doi rcsb
source organism Shewanella oneidensis
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2e4lA00
4B9TA 4O44A 5KGXA 3OYBA 2G8KA 3SCXA 4KHSA 3HL8A 3RR8A 3TAGA 3HP6A 3EYZA 5J1EA 3I0RA 3QETA 2JGUA 3MEEA 3PO5A 2DTUA 3NF6A 4BE1A 1KVCA 1VSMA 5KTQA 4OKJA 3OJSA 3CFRA 3TARA 4E7IA 4E0DA 3V9XA 4O0JA 1U4BA 4B9LA 3OYIA 1XWLA 3KLIA 4QAGA 3KD5E 3K2PA 4PY5A 4HCCA 3VQAA 5JS1A 2D5RA 2OA8A 3PX0A 4E3SA 1HQEA 3P83D 1NK6A 1L3TA 3HO1A 4NCGA 4KTZA 2KQ2A 4CESA 4GMJB 3ZSZA 1RT6A 1BCOA 4IG3A 2A1SA 4EP4A 2IS3A 4DU3A 4G1QA 4E1NA 4E7LA 4LSNA 3LWLA 4TSXA 5I3UA 2E4LA 4QCLA 5DK5A 3KK2A 1QQCA 5CYQA 3ULDA 3I8DA 1QTMA 1RILA 2OPPA 1IKVA 4UQGA 4ELUA 3JYTA 3TANA 2XHBA 1NOZA 2DY4A 3AVGA 1EX4A 2Z1GA 4E89A 3SPZA 3HP9A 4LY7A 4N41A 3V9WA 1X9WA 1RBSA 1QSLA 5K14A 5KI6A 4PUOA 3AO4A 4PQUA 1S6QA 1U47A 1NKCA 3LP1A 3OYHA 2KTQA 3S3OA 2XY8A 3NFAA 3V4IA 1VSIA 3PY8A 1RDBA 1ZYQA 4M3WA 4DQIA 2RPIA 4PWDA 3AVNA 4RW8A 3L2RA 4DFKA 1J5OA 4FJGA 5C25A 1RDCA 3QERA 4B8CA 4CHQA 2RN2A 1NK9A 3LZJA 4DU1A 3ZT0A 3OS0A 2XY5A 3SUPA 3AA3A 3AO1A 4CEQA 4C8LA 4FW1A 3KIOA 3QIOA 5DMRA 1XHZA 3NGZA 5FRNA 2G8IA 2PY5A 1S5JA 4E7KA 4KPYA 1TKXA 4M45A 4CERA 1JLFA 3V6DA 5KGWA 1HMVA 4DSFA 4E7HA 3F73A 4H4MA 4Y1CA 3M8RA 3DLBA 3DM2A 1VSLA 2LSNA 1C6VA 3IRXA 1U04A 4DFJA 1NK7A 4KTQA 5CZ1A 4O55A 4EZ6A 4M41A 2O4GA 3VQ7A 4OGCA 4I2PA 3ZSQA 1JXBA 3KKSA 1NJWA 4FK2A 1HNIA 4Z4GA 3LANA 1LW2A 1KRPA 1BIUA 1TKTA 2D0CA 3RR7A 4RG8A 3MEGA 3EZ5A 1WSGA 4RW7A 3KJVA 2QKKA 3WNEA 1HYVA 5FDLA 3O4QA 3OYEA 2GUIA 2VG6A 3OYKA 1KSPA 3DI6A 4IFYA 4KHYA 3LPTA 4FJNA 1TAUA 5HRPA 3NH1A 1FXXA 3VN5A 3KK1A 2IAJA 2YNIA 3P1GA 3K5LA 4DWIA 2HNZA 4CEOA 1Q8IA 4ID1A 4FLUA 2FBVA 3LZIA 3HVRA 4FJ9A 4KTWA 4BDYA 4I7FA 4FLXA 5KRSA 4DTXA 3WNGA 2W42A 4DTSA 1WAJA 2F8SA 4CIFA 4CHPA 3OYMA 2IC3A 3NH0A 2B4JA 1RT2A 3NBPA 4O0IA 3QINA 2DFFA 1RNHA 2DFHA 2HHQA 2YNFA 1IKWA 4DTMA 4CEDA 3DYAA 1B92A 4CJQA 4FLVA 2F96A 4Z4FA 4FZZA 4KKOA 4K8ZA 4C8MA 3AVCA 3K59A 3QEVA 2BGGA 1S9EA 4DS5A 3K58A 1I3AA 3CG7A 1N5YA 3LAKA 3K57A 4DTNA 4NYFA 1NJXA 1L3SA 4FJ8A 3ZSYA 2YV0X 1GOAA 4DMNA 4HUFA 5E41A 3LWMA 1Z25A 4KAZA 4DSLA 4FLWA 3ZSXA 1VK0A 1O1WA 4F8RA 2BE2A 1A5XA 3O4NA 4DLGA 3S3MA 4W5RA 1J54A 4CGHA 4DTUA 1BQMA 1S1TA 2RKIA 2WOMA 2X74A 1WSIA 2Z1IA 4OPJA 3VQ8A 4JRPA 3TI0A 3LAMA 3E01A 1MU2A 3LP3A 2A1RA 1JL1A 5FRMA 4M3XA 3TAFA 2YKMA 3DLEA 2YNHA 1L3VA 1L3UA 4CJ3A 4N47A 1T03A 1CZBA 4RW6A 1BL3A 2IGIA 3VQ9A 3VQPA 5CZ2A 4CIEA 4DFMA 3SQ1A 1SKSA 1IKXA 4FK4A 4HUEA 2HMIA 3U6FA 1TV6A 3OVNA 2ATQA 1Z26A 3CQ8A 1TK5A 1WSFA 4HHTA 3T3FA 4CFBA 2OZSA 2HHWA 3VA0A 1JLCA 4MFBA 1NOYA 2G8VA 2OYQA 4DFPA 4BE2A 4FYDA 1RTJA 4EZ9A 4CGDA 1HYZA 2Z1JA 2P5OA 4CHNA 1I39A 1HJRA 2VWJA 4KI6A 3ZT3A 4HVJA 3WNHA 4I9QA 4DTOA 1RT1A 3NH2A 3HVTA 1G15A 3OS2A 2F8TA 4FXDA 2O4IA 1D8YA 1GOBA 3QEPA 2HHTA 3L2VA 4Q0BA 4M3YA 3SPYA 1D5AA 3IG1A 4HCBA 1VSFA 4YNQA 4CHOA 3MECA 2FBYA 3DLKA 4Z4HA 4DU4A 4M3UA 5KRTA 2GV9A 3NDKA 4DTJA 4F2SA 4JRQA 4CFDA 1NK8A 4IBNA 4DTPA 3PX6A 4DQRA 1JLAA 1VRTA 3QEIA 1QE1A 1ZBUA 1FKPA 1KLMA 4Q5VA 1BISA 4JS5A 3F9KA 3O3FA 1X9SA 2PYLA 1S1XA 3D0PA 3T19A 4CK1A 3CFPA 3AO3A 1WSHA 4Z4CA 4KHQA 3NF7A 3OS1A 1NJZA 3C94A 3RMDA 4FZXC 3RRGA 1LW0A 4F2RA 4FJ5A 3MXMA 4OKEA 3ZT1A 5HROA 1IG9A 4LD0A 1CZ9A 3AV9A 4N76A 2PYJA 3KLGA 1VSKA 2I5JA 3KLEA 2KFZA 3KD1E 1IKYA 4KREA 2P1JA 3ZSWA 4NCBA 1YTUA 2AJQA 4W5NA 2FC0A 3L3UA 3NF9A 2HVIA 4IFVA 4CGIA 1RBTA 5C42A 3L2WA 3DLHA 3QNOA 4CF0A 1D9DA 2ETJA 3L2UA 4NYNA 1BIZA 3HJFA 4FM1A 4IKFA 3NGIA 1WSEA 4FLYA 2P5GA 1JLBA 3A2FA 1Q9XA 2PZSA 4AHVA 4J2BA 4AHSA 4M3TA 3QO9A 3G0ZA 1JLGA 4KB1A 4J2DA 3AVKA 1RT4A 4KB0A 1VSHA 4R5PA 3AA5X 4DLEA 1A5WA 4JLHA 3ZSOA 2IOCA 3UIQA 4FJHA 3NAEA 3RTVA 3KLHA 3C6UA 5EU7A 1QSSA 3IS9A 1XHXA 1C1AA 3U3YA 1JL2A 1J53A 3B6OA 1UOCA 4CGFA 2OZMA 4M3ZA 3RWUA 3SV4A 2G8UA 4KO0A 3V81A 2XY6A 4OLAA 1S6PA 1C1CA 3ALYA 4LH5A 4DSIA 1C0TA 4ZHRA 5I42A 1IH7A 3QEXA 1XC9A 2X6NA 1WSJA 1HYSA 5J2NA 3RMBA 3AA2A 2OPSA 3G10A 4O4GA 4M42A 4XIUA 3AVJA 1NK0A 2E6MA 5HLFA 1RDDA 3LPUA 1RT7A 1VSEA 4AHUA 3SQ2A 3SI6A 3OYCA 1U45A 4MQ3A 1T7PA 4B3OA 4CJKA 3TABA 1S9GA 1YT3A 4DSKA 2IDOA 4CJVA 3L2QA 2VG5A 3VQ4A 4CEEA 4CJTA 3SV3A 1HQUA 3AVIA 4E7JA 1RDAA 3AVFA 4BWJA 1BHLA 5HBMA 4CJUA 3OYGA 3VQCA 2ZD1A 4M3RA 4DTRA 3MXIA 4L8RB 4BDPA 4C8NA 1QHTA 2YKNA 4AHCA 1SL1A 4KV8A 4NCAA 3VQDA 1SKWA 3THVA 3BDPA 3ASMA 3TWHA 3M8QA 4E1MA 1YVUA 3OYNA 1KCFA 3VQ5A 3AO2A 4C8OA 1K6YA 1TGOA 1ZBHA 2HVHA 2B5JA 3H08A 4CGJA 3PX4A 3SUOA 1TKZA 1T8EA 3TAQA 4B8AB 1RT3A 4O5BA 4BE0A 1DTQA 2RF2A 2YHAA 4I2QA 3VQQA 3AA4A 4YFUA 1EP4A 1W9HA 1NK5A 1SL0A 3DLGA 4PA1A 2QK9A 4W5TA 1ZBIA 1NKEA 3LP0A 1ZBLA 1JKHA 4FM2A 1F21A 4HUGA 1BI4A 4FJMA 4F3TA 4IG0A 1LAVA 1UAXA 1KTQA 4CFCA 3C95A 3V1QA 4CGGA 1LAWA 1RT5A 3PUFA 4Y1DA 3V9SA 3SQ4A 3SNNA 2QKBA 2KZZA 3BGRA 4GVMA 1BI4B 5HP1A 4Z4IA 4CJLA 4FZYA 4CK3A 3K5OA 4E19A 1RBUA 4DF8A 3HPGA 1RTHA 3AVMA 5J2MA 3SJJA 2HHVA 2Z1HA 4CJ4A 3SQ0A 4B08A 4CF9A 4OLBA 2XO7A 2Q3SA 2FBTA 4CHZA 3ITHA 3OYAA 1VRUA 3HXMA 2X78A 3L3VA 2D0AA 3NCIA 1EETA 4ICLA 4FJKA 3HPHA 3QESA 4LH4A 3S9HA 4CJPA 4H4OA 2HHXA 3TR8A 1NJYA 4DQPA 3NE6A 3M8SA 1EKEA 2QXFA 2Y1IA 3C6TA 4KHNA 3T1AA 1VSJA 1S1UA 4Z0UA 5HRRA 3ZSRA 3QLHA 4B9MA 4CHYA 1J9AA 4OVLA 3DOLA 3EY1A 3P5JA 4LSLA 3D45A 4F4KA 2KFNA 1WAFA 2P51A 1TKDA 1LWEA 1IO2A 2DFEA 1VSDA 3ZSVA 3AVBA 3LDSA 1RBRA 3CM5A 1FK9A 1U48A 4CEAA 4Z4EA 3KTQA 1SV5A 3KKRA 1HNVA 3DMJA 3RMCA 4AHTA 3AVAA 3OY9A 5J2QA 3V9UA 1LV5A 3ISNC 4DG1A 2ITGA 4CJWA 1KVAA 5CY4A 1QSYA 4ELVA 2HW3A 5C24A 4RW9A 1GOCA 1KFSA 4I9LA 4GW6A 3OJUA 1RTDA 2XRIA 3HPOA 3K5MA 4CE9A 1A5VA 3I0SA 3IAYA 3B6PA 1L5UA 1RCHA 4KRFA 3HM9A 1QS4A 4DSJA 3L8BA 1UWBA 4OKKA 3NGYA 4HTUA 4J2EA 4DSEA 4CEZA 3OYFA 2HHSA 3RMAA 5SWMA 2HB5A 4FJLA 4CF1A 1ITGA 3LALA 4CF8A 4CJ5A 4IDKA 2G8WA 3MEDA 1KFDA 2OPRA 3DLRA 1EXQA 5J2PA 1UA1A 1Y97A 3O3HA 4FLTA 3DRPA 3ZT4A 1C0MA 4CEBA 4B9UA 1TVRA 3DRSA 3NHGA 2BANA 3S3NA 4BWMA 2R7YA 3V1OA 1XI1A 2KW4A 4N56A 1X9MA 2ZQBA 1TL1A 5JS2A 1C0UA 2VWKA 4F3OA 4C8KA 1X1PA 4W5OA 1RTIA 3CYMA 1B9FA 4B9NA 3QEWA 3HSTB 4CFAA 3MAQA 5D3GA 2VG7A 2G8HA 1WN7A 1DLOA 1SL2A 2YNGA 3VQ6A 4AILC 3OYLA 4J2AA 3V9ZA 1TK8A 3NF8A 4BDZA 3SZ2A 2NUBA 1T05A 1YTAA 4QOZB 1FKOA 1ASUA 4ZTJA 3OYDA 4B9VA 4FJJA 3DRRA 4FJXA 1UA0A 1JLEA 2BDPA 1WNSA 3SYZA 1BQNA 3PV8A 3AVHA 4CF2A 1CLQA 2XY7A 3MXJA 3LP2A 1KVBA 4DQQA 3SUQA 3HT3A 4N5SA 3PO4A 3O3GA 4FK0A 1LWCA 4ELTA 1HRHA 4WE1A 2GBZA 4B9SA 3OYJA 3WNFA 2HNDA 1ASVA 4CIGA 5T7BA 4BACA 2KZMA 4FM0A 3HK2A 1ASWA 4FJIA 2ZE2A 3TAPA 2WONA 2YHBA 4OPKA 3HYFA 4CK2A 1N6QA 4OJRA 1DTTA 3ZCMA 1NK4A 4H8KA 3DOKA 4FCYA 4CJEA 1REVA 3SUNA 1BCMA 4KFBA 1JLQA 2HHUA 1S1VA 3M8PA 1NKBA 3CM6A 1TL3A 1TAQA 3TAMA 4KHUA 2HNYA 4CJFA 4RW4A 3KK3A 4FLZA 1KLNA 4AH9A 2G8FA 1TK0A 3ZT2A 3VQBA 2JLEA 3KLFA 2Y1JA 3RRHA 1WLJA 1BGXT 4CJSA 4DF4A 2EX3A 1R0AA 1U49A 1D9FA 3VQEA 1W0HA 1RBVA 4JS4A 5HRNA 2E6LA 2FBXA 3VA3A 5SZTA 1CXQA 4W5QA 1S1WA 4FW2A 4EP5A 4CJRA 1B9DA 1Q9YA 2OPQA 1JXEA 2X6SA 5CYMA 3QIPA 3U3GA 5HRSA 4DS4A 3CFOA 3TAEA 4FJ7A 1ZBFA 2B6AA 4CEFA 4KI4A 4AHRA 4FVMA 3AO5A 3QNNA 4K8XA 2D0BA 4DQSA 5FROA 1HPZA 3K5NA 4ID5A 4ZTFA 4CCHA 1CXUA 4KHWA 2EHGA 3V1RA 3JSMA 1SUQA 1LWFA 3AVLA 1C1BA 4OGEA 4CECA 3FFIA 1SKRA
chains in the Genus database with same CATH superfamily
5E84A 3GBTA 3SCXA 2IVNA 3E9PA 4KHSA 3WT0A 3EYZA 5J1EA 3I0RA 2JGUA 4JKGA 4BE1A 1DGKN 4OKJA 2CH6A 2FF6A 4A2BA 4WYBA 1U4BA 1VQ5N 3FR0A 4DB3A 5AQZA 5C0YA 1IBLK 4KTZA 2KQ2A 3MN5A 1RT6A 1BCOA 3PSFA 4G1QA 3OBYA 4LSNA 4H5NA 2E4LA 1QQCA 2FLOA 1IKVA 4O8KA 2XHBA 3AAQA 2YX6A 4FWMA 4PQUA 2P9KB 1S6QA 3C7NA 3DXMB 1U47A 3CERA 3NFAA 3V4IA 3PY8A 4CD1A 4JI7K 2OTJN 3QFUA 4BVPA 2ITMA 4CHQA 5CR4A 4FWNA 3QBWA 3OS0A 4FPAA 3NGZA 1HPMA 4R79A 3J80O 3F73A 4H4MA 3DM2A 2LSNA 1T44A 4M41A 4KH6A 5AQIA 1NJWA 3ZSQA 1JXBA 3BP8A 3ZETB 4LF6K 4Z4GA 1KRPA 1BIUA 1KAXA 3ULEA 2O8BA 2VQEK 2QEXN 3CC2N 2E2NA 2QWRA 1HYVA 2Q0UA 2GUIA 1HR0K 1KSPA 3DI6A 1FXXA 4FOEA 3VN5A 3KK1A 5AJ3K 2RE2A 4FJ9A 4KTWA 4FLXA 4CZFA 2W42A 4CIFA 2IC3A 4A5AA 2NNWA 3NBPA 2HHQA 2YNFA 2VYPA 3DYAA 3ID8A 1VQNN 3K59A 1QVFM 1S9EA 3MN6A 1YUWA 1N5YA 3LAKA 1NJXA 4DMNA 4HUFA 4U7BA 5E41A 1Z25A 4DSLA 1VK0A 5BR9A 1KXPA 4F8RA 2BE2A 4DLGA 3MCPA 1J54A 3A5LC 4BC4A 1S1TA 2X74A 2Z1IA 4OPJA 2A1RA 3QMLA 3WUHA 1JL1A 3U9DA 1YVNA 1Q7YO 2YNHA 4CJ3A 5CE3A 5CZ2A 4B1WB 3SQ1A 5BR8K 2ATQA 2CGLA 1TK5A 4JKCA 3T3FA 3P39A 2OZSA 1NOYA 4DFPA 4BGBA 3J7YP 4EZ9A 4CGDA 4H0VB 2ZF5O 3IUCA 1I39A 4AQYK 3EE9A 3WNHA 4I9QA 1RT1A 3OS2A 3HVTA 1G15A 3KZBA 2O4IA 2HHTA 3QEPA 4DV2K 3CF5L 1NGGA 3MECA 4LF5K 4M3UA 5GAEP 4DUZK 4F2SA 1NK8A 4IZ9A 2NRTA 4JS5A 5A2QO 4Z4CA 1NJZA 3RRGA 2O8CA 1LW0A 4F2RA 4WFBL 4OKEA 2NRVA 4LD0A 1Z6RA 3KLGA 4LFCK 4HTLA 1J5EK 3KD1E 2A40A 4KREA 3ZSWA 4IEIA 5BN9A 2E1YA 4CGIA 4M63C 1XUPO 4ILGB 1NGAA 3RVCA 2D0OA 1D9DA 2ASMA 4NYNA 3HJFA 3WEEB 2O8DA 3LM2A 2P5GA 1U6ZA 1Q9XA 4AHVA 4AHSA 2YHYA 4M3TA 3G0ZA 4J2DA 3AVKA 2HSTA 1KD1O 2IOCA 3UIQA 2JWKA 5AQPA 1VQ7N 5EU7A 1N33K 4BRDA 4CGFA 1J53A 1UOCA 2OZMA 3O9SA 3SV4A 2V7YA 5LMNK 3O6WA 1WBBA 3AVJA 5HL7L 3LPUA 1S3XA 2NZTA 3DXKB 3OYCA 4FOIA 4JI4K 2VG5A 3THYA 5FPNA 3AVIA 3VQCA 4BRIA 4M3RA 4DTRA 1GLFO 4BDPA 1QHTA 3VPZA 2A41A 4AHCA 1K8KA 4MLEA 3M8QA 4JEPA 4X66K 3R1XA 3OYNA 3VQ5A 3TSUA 1RFQA 3TSPA 4OPAA 1W7AA 2B5JA 3BY5A 4Z94A 2UUCK 4O5BA 1DTQA 3DLGA 4PA1A 5LJVA 2YCHA 4H03B 1NKEA 3LP0A 4FM2A 1GLCG 1BI4A 3OA9A 1LAVA 1UAXA 4BR7A 3C95A 4CGGA 3SNNA 3L4QA 3S41A 3V9SA 4CD3A 2QKBA 5HP1A 4CK3A 4JI2K 3HPGA 4CJ4A 3ENOA 4AF1A 3B8AX 4B08A 2Q3SA 2FBTA 4JK9A 4OPHA 4CHZA 3D7EO 2X78A 3L3VA 5HOOA 2D0AA 3NCIA 1EETA 4ICLA 3GE1A 3HI0A 5EVZA 3S9HA 1HNXK 5AQOA 3CI5A 4FL9A 1NJYA 3OBWA 3NE6A 1YITN 1EKEA 5HRRA 3ZSRA 3P5JA 5F0XA 4K41A 4BQZA 2VWBA 3AARA 2P51A 1TKDA 3RSEA 1NWKA 1VSDA 2DFEA 1VQMN 4KBOA 3AVBA 2CGKA 2P9IA 3CJ7A 3CM5A 3G6EN 3LDSA 1FK9A 1U48A 5KPRA 3KTQA 1HNVA 3DMJA 3AVAA 3R9PA 3V9UA 3THXB 4KHPK 3ATUA 1QSYA 3O5BA 2HW3A 3EKSA 3FZLA 3HPOA 1A5VA 3IAYA 3B6PA 1L5UA 1RCHA 3E9OA 2NRHA 5EY4A 4DSEA 3EN9A 5SWMA 2HB5A 3CJ1A 4CF1A 2OPRA 1EXQA 2IIRA 3BF1A 4BR4A 1HJOA 3ZT4A 5LMUK 4B9UA 3CIPA 1BU6O 1WBDA 3S3NA 5AZIA 1TL1A 3VEYA 4DV6K 4A5BA 1X3NA 1X1PA 1RTIA 3CYMA 4CFAA 4AILC 4FWRA 5ADXA 2UXCK 3EE8A 4JN4A 4F9OA 1T05A 4FJJA 1ASUA 3ZX0A 4B9VA 4CZMA 1UA0A 2QXLA 1JLEA 2BDPA 1WNSA 4CF2A 5AQHA 2XY7A 2P9NB 3VF2A 3SUQA 3I8BA 2WTUA 4FK0A 2I7NA 4B9SA 2KZMA 2Q36A 3HOTA 4FJIA 3WQTA 2ZE2A 3TAPA 4MDBA 3R3LA 1EO1A 4FWPA 1DKGD 2HHUA 1S1VA 2VQFK 3M8PA 4LF8K 4I6MB 2HNYA 4RW4A 2G8FA 1OKJA 1TK0A 2E5LK 1WLJA 5ADXH 4DF4A 1SS6A 1R0AA 1U49A 4NLBA 2QM1A 3VQEA 4JS4A 5SZTA 4EP5A 2DPNA 5MLCQ 2OPQA 2X6SA 3U3GA 3P38A 4FJ7A 3MX5A 2AA4A 4KI4A 4AHRA 1VQ6N 4DQSA 1CXUA 1FW6A 4KHWA 3F5TA 3AVLA 4BRMA 1C0FA 3FFIA 3THWB 1SKRA 4IOAL 5KGXA 3OYBA 2G8KA 1RGIA 3WXKA 1VQ8N 3HL8A 3MEEA 1Q82O 5I9EB 4E0DA 5KTQA 3VGMA 4E7IA 5JMVA 2GX9A 3KLIA 4DHYA 4JKAA 3VQAA 3CPEA 4BVOA 3EZWA 4CW7B 4H0PA 1SZ2A 4YOYA 1V4TA 2A1SA 4JKEA 4BRHA 2IS3A 4DU3A 4E1NA 3LWLA 2ZGYA 3KK2A 3HOSA 1W2BM 3VMFB 3FLCO 4UQGA 1K73O 2DY4A 1MDUB 4E89A 4LY7A 3K0SA 3V9WA 1X9WA 1RBSA 5F2RA 4Y0WA 4LFBK 1YJ9N 1NGHA 1YXQA 1NKCA 2F4VK 2NRZA 2XY8A 1VSIA 4WFAL 2JWLA 4M3WA 3Q7BA 3AVNA 4DR7K 1J5OA 1RDCA 1S22A 4JKDA 5KQ8A 3ZT0A 2XY5A 1XQSC 3SUPA 3KIOA 1K9MO 1XHZA 1M90O 4E7KA 4KPYA 1JLFA 3V6DA 5KGWA 4E7HA 3O80A 3ZETA 3M8RA 1VSLA 3IRXA 5CZ1A 2FF3B 4O55A 2O4GA 2P9UB 1BA0A 3LDOA 4OGCA 4FK2A 1HNIA 3P31A 1TKTA 2CGJA 5EX5A 3EZ5A 1WSGA 3ZEUB 1NGDA 3KJVA 3WNEA 4BC2A 3OYEA 4Z4FA 1TAUA 3LPTA 2D4WA 2Q0RA 1GLLO 3K5LA 2HNZA 1Q8IA 1MWKA 5KRSA 3WNGA 2F8SA 1WAJA 3NH0A 2B4JA 3I55N 4O0IA 3QINA 1RNHA 1IKWA 4DTMA 4FSVA 4YDUC 4QS8A 2O8FA 2O8EB 3ZYYX 4K8ZA 4C8MA 4QS9A 3AVCA 5C2DA 1I3AA 3K57A 2PAVA 4DTNA 2A3ZA 4NYFA 3ZSYA 3CCQN 4IO9L 4FLWA 1GLEG 1HLUA 1A5XA 1ZBSA 3S3MA 4W5RA 4B3MK 4CGHA 1IBKK 2WC9A 1WSIA 3VQ8A 3HRGA 3CJCA 3LAMA 1DEJA 1MU2A 3LP3A 4BR2A 4EAHD 2D0PA 1JJ2M 4CZGA 2YHXA 3TAFA 2YKMA 4ISFA 5ELZA 1BL3A 4CIEA 4HUEA 3A5MC 1Z26A 3CQ8A 3SBTA 2HHWA 5AR0A 2G8VA 1GLBG 4BE2A 1RTJA 4YDUA 2Z1JA 2P5OA 1HJRA 2VWJA 5AQKA 3NH2A 4FXDA 3TTFA 4CBWA 4BREA 4M3YA 4OO1J 1XNQK 1D5AA 1ATNA 2FBYA 5KRTA 2GV9A 5GIOA 4JRQA 3AGRA 4CFDA 4IBNA 4DTPA 3PX6A 4BRCA 1JLAA 1VRTA 1QE1A 1ZBUA 3MCAB 2BUPA 3F9KA 4IJNA 3CD6N 1S1XA 3CFPA 1TUUA 3H1VX 3RMDA 3VTIA 4FJ5A 3QDKA 4BY9C 1CZ9A 3CCRN 2UXDK 2PYJA 4L3QA 4DR1K 2E88A 3SJHA 2UUAK 3H6EA 1IKYA 1OH5A 2P1JA 1NGFA 4W5NA 2FC0A 4C23A 3WEEA 3NF9A 4IFVA 5C42A 3K9JA 3DLHA 1VQ4N 2ETJA 3NVMA 3L2UA 1QHAA 4FWOA 3CQXA 1JLBA 3C0BA 1JLGA 1RT4A 4R5PA 3AA5X 1A5WA 3FZKA 3ZSOA 4FJHA 1TYQB 3C6UA 2YI1A 4FVUA 3IS9A 4CZEA 4WFNL 2Q31A 3UKRB 3WXMB 3V81A 2XY6A 4OLAA 3OW2M 3ALYA 5EOYA 1BWFO 4LH5A 2D1KA 2X6NA 1KC8O 3DXKA 4KH5A 2OPSA 3SAHA 4O4GA 4M42A 4XIUA 4G9ZA 1NK0A 1RDDA 4XEIA 1RT7A 4AHUA 4BRGA 4X64K 3UB5A 1S9GA 1YT3A 2IDOA 4CJVA 3PLAA 3VQ4A 4ILJA 4CEEA 1E4FT 5AQYA 4DV0K 3H1QA 3MXIA 4L8RB 2WBNA 1SL1A 4DKWA 3UKUB 2HBMA 2V51B 3TWHA 4DCHA 4XH5A 1YVUA 1KCFA 3AO2A 1Q81O 4DR4K 3PX4A 1TKZA 3TAQA 4BE0A 3IDHA 3TTCA 3VQQA 3AA4A 1W9HA 4W5TA 4FJMA 4F3TA 3L0QA 1KTQA 1J6ZA 3PUFA 2KZZA 3VEVA 1ATSA 5AQNA 3GOIA 4CJLA 4DR2K 4FZYA 4BG9A 1RBUA 4DF8A 5J2MA 1RTHA 3AVMA 1K8AO 3G25A 4CF9A 3CCLN 4O5FA 1WUAA 4JKFA 1VRUA 2E8AA 3HXMA 4UY8O 3JXUA 4IOCL 4FJKA 3QESA 4H4OA 2HHXA 1ESVA 3TR8A 3MN9A 1D4XA 4KHNA 1VSJA 3O9QA 4CHYA 1J9AA 3DOLA 3EY1A 3D45A 1WAFA 4CJ7A 5KPZA 1IO2A 3VF4A 4BG8A 3THXA 2OANA 4CEAA 1QQMA 1W97L 2NRXA 4GVEA 4DUYK 1LV5A 3TTDA 2ITGA 4CJWA 1NGCA 4IDHA 5IWAK 2CH5A 2P9LA 3K5MA 3FZFA 3H45C 3HM9A 1UWBA 3NGYA 2HHSA 3BF3A 2W40A 4MLHA 1ITGA 4CF8A 4C1NI 4IDKA 3MEDA 3DLRA 1MA9B 1UA1A 3DRPA 4CEBA 2HOEA 4C1NK 4BWMA 3V1OA 2KW4A 1YI2N 1C0UA 1T3VA 1LOTB 4K25A 4W5OA 4YOXA 1B9FA 1Q18A 1SAZA 3HSTB 4JKHA 1WN7A 1SL2A 5M1KA 2YNGA 2KKZA 3T69A 3A5NC 4EHUA 3FZMA 1QZ6A 4NB4A 1TK8A 3NF8A 4JK7A 3SZ2A 1OH6A 2NUBA 4H5WA 1YTAA 2P9NA 4CZIA 4ZTJA 3OYDA 4FJXA 3CXCM 3CCVN 4JV5K 3PV8A 3SYZA 2P9SB 1KVBA 3HT3A 1LWCA 4H5VA 1HRHA 3OYJA 4CIGA 5T7BA 4HWIA 3N4PA 4FM0A 4YOWA 1N32K 4OPKA 3HYFA 4CK2A 1N6QA 4OJRA 4BRNA 4H8KA 4I6MA 4FCYA 4FWQA 4CJEA 3SUNA 4BQLA 2ZM6K 5M1QA 1JLQA 3VOVA 1NKBA 3CM6A 3TAMA 3C6AA 4CJFA 4AH9A 2KHOA 2JLEA 3KLFA 3RRHA 1NG9A 3KWIA 5AQVA 3OHRA 1RBVA 1CXQA 4FW2A 4CJRA 5BRDA 1Q9YA 4DS4A 1N8RO 1M1KO 4JYAK 2GEMA 3CPWM 4FVMA 3QNNA 3THWA 2D0BA 5FROA 4ZTFA 4JNEA 4JI6K 3TSQA 1LWFA 2ZJPL 5KQDA 5TKYA 4CECA 1L3VA 4B9TA 4O44A 1IJJA 3TAGA 1BOTO 3E9LA 3NF6A 1KVCA 2QWOA 3CFRA 4AM7A 4GKJK 5GAGP 3V9XA 3KK7A 5C2FA 3OYIA 1XWLA 2HBKA 4HCCA 5JS1A 3OTOK 3Q7CA 1HQEA 3P83D 3HO1A 3T7ZA 2W6KA 4WQ4C 4CESA 4GMJB 4IG3A 2GELA 2IVOA 3KWGA 4E7LA 5I3UA 4QCLA 3ULDA 3I8DA 2UXBK 1RILA 2OPPA 3TANA 4B3RK 3IFRA 1N36K 5EXWA 3AVGA 4N41A 1QSLA 4PUOA 3AO4A 3LP1A 1XMQK 4BR0A 1ZYQA 4PWDA 5M1OA 4RW8A 3L2RA 1E3MA 1EWRA 4FJGA 4B8CA 3BEXA 4A59A 3LZJA 4DV7K 2OTLN 3O8MA 3AA3A 1S72N 4WQ5C 4CEQA 4C8LA 2A6AA 4JD2B 5FRNA 3PIPL 3DLLL 4BRKA 4YHHK 4CERA 1HMVA 4DSFA 2P9UA 4NLCA 2P9PB 3DLBA 4DFJA 2YJEA 3GG4A 1U04A 1XC3A 4EZ6A 4I2PA 3ZEUA 3MMVA 3KVGA 2GWJA 1WB9A 4DR3K 3M6GA 4RWTA 4MO4A 4M7YA 5FDLA 1NBWA 3O4QA 2VG6A 3CJ9A 1OH7A 4KHYA 3AGKA 4FJNA 2FSKA 3QB0A 5HRPA 3NH1A 3LDPA 2IAJA 3I33A 3P1GA 3VEOA 4CEOA 4ID1A 4FLUA 1NLVA 2HF4A 3M5RA 4JI5K 4I7FA 3R6MA 3MX2A 4DTXA 3O9RA 3OYMA 4CHPA 1RT2A 2DFFA 1VAZA 3A5OC 5AQJA 4B1VA 4CEDA 4FWSA 4FLVA 4CJQA 2F96A 2UUBK 4FZZA 4KKOA 2GWKA 4X62K 3QEVA 4IEEA 5AQSA 4CZJA 4FJ8A 2NRRA 2YV0X 1GOAA 3ZSXA 2RHKA 1O1WA 4CBXA 5C12A 1K8KB 3O4NA 4BRLA 3D2EA 2PBDA 4PHTX 5DM7L 1VQ9N 1BQMA 2WOMA 4JRPA 2ASOA 3TI0A 4O8UA 3LL3A 2I7PA 5FRMA 3DLEA 1L3UA 2NRWA 2VGMA 1T03A 3VETA 3VQPA 2IGIA 3VQ9A 4DFMA 1IKXA 3KHYA 3VEZA 1TV6A 2UU9K 3O1WA 3AY9A 3HSCA 4HHTA 4CFBA 3VA0A 4MFBA 4FYDA 4CZLA 4PKIA 2A42A 2ZGZA 4A61A 1HYZA 3ENBA 1CZAN 4KI6A 3ZT3A 4DTOA 4FPBA 3O1BA 1D8YA 5H1SQ 4GV9A 3L2VA 3CCEN 4X65K 3SPYA 1VSFA 1QQNA 5LJWA 4CHOA 4Z4HA 3DLKA 4DU4A 1X9JA 1QZ5A 4BC3A 3NDKA 1Z05A 3J81O 4DQRA 3QEIA 4YORA 1BA1A 2EWSA 4Q5VA 1BISA 3LDQA 4IOXA 3O3FA 1X9SA 2P9KA 3D0PA 3DXMA 3GL1A 3AO3A 1WSHA 4KHQA 3NF7A 3C94A 3C65A 4A57A 4PKGA 4BROA 2YJFA 4M7XA 3ENHA 1H1VA 2FSNA 1IG9A 3D2FB 5AFUA 5AQTA 3W0LA 2E20A 1VSKA 2BTFA 2I5JA 3KLEA 2P9IB 3C6HA 1YTUA 2AJQA 3L3UA 4IXCA 1RBTA 4FWLA 3QNOA 4CF0A 4LFAK 1KAYA 4IKFA 1BDGA 1WSEA 2PZSA 2J4RA 4H0XB 1TYQA 3QO9A 3U9ZA 1X3MA 5C10A 2VCPA 5FLXO 4DLEA 3VGKA 4RTFD 3RTVA 3KLHA 4JI0K 1QSSA 3J7ZO 3U3YA 1JL2A 2G8UA 4KO0A 1BG3A 1C1CA 4DSIA 1C0TA 1IH7A 4LC9B 1WSJA 3G10A 5AFUH 2Q2RA 4DV1K 2E6MA 5HLFA 4B3OA 4CJKA 3TABA 2ASPA 2F9WA 3SBGA 4GV3A 3L2QA 3EO3A 4CJTA 1HQUA 1RDAA 3CHWA 1BHLA 2ZD1A 3JAMO 2YKNA 4OX9K 4NCAA 3VQDA 1SKWA 3THVA 3G71N 3O08A 3ASMA 3EKUA 5FPDA 4C8OA 1TGOA 4DR6K 2HVHA 4BR9A 1NU0A 1RT3A 1SL0A 4I2QA 3FE1A 1NM1A 1JCGA 1JKHA 1ZBLA 2H3GX 4IG0A 4XH1A 3JS6A 3V1QA 1LAWA 3SQ4A 1IV0A 4AM6A 3BGRA 4GVMA 2WUSA 4Z4IA 1YJWN 4E19A 3HBTA 2HHVA 3SJJA 2Z1HA 4DV4K 4J8FA 5AQFA 3SQ0A 4OLBA 5M1PA 2XO7A 4BRPA 3ITHA 3OYAA 2FXUA 4BRQA 4FWKA 2HMPA 4CJPA 3M1FA 1LCUA 4DQPA 3M8SA 2QXFA 3C6TA 3T1AA 4B9MA 3QLHA 4JKBA 4F4KA 4LSLA 5F1XA 3A0IX 3PIOL 1NGEA 3EL2A 1RBRA 4Z4EA 3KKRA 3VERA 3IKMA 3OY9A 5GINA 3BUZB 3ISNC 4ELVA 1KVAA 3QFPA 5CY4A 5AQWA 3CMEN 5C24A 3LDNA 3TU5A 4RW9A 1GOCA 5AQUA 3BZKA 2ZWHA 3VESA 5AQGA 2XRIA 4B1UB 3MWTA 4CE9A 5LL6Z 3L8BA 4HTUA 4OKKA 2OCEA 5FPEA 5LY3A 2G8WA 1FJGK 1HX1A 1QQOA 1Y97A 2QWNA 1O13A 1EQYA 1TVRA 3DRSA 3NHGA 2VGNA 2R7YA 1HKBA 3WXJA 4K42A 4N56A 1XI1A 1X9MA 2ZQBA 5JS2A 5JVGL 1JCEA 3GDQA 5D3GA 2VG7A 3MK6A 3MWPA 4J2AA 3BZCA 5TKWA 3SAFA 4BDZA 3NMUA 4ILHA 2P9SA 4B1XB 2E2OA 4JK8A 3DRRA 1ZC6A 5BRFA 2HHHK 1BQNA 5AZJB 1P90A 3MXJA 3LP2A 4ISGA 2W6LA 3CJAA 4BACA 3HK2A 2YHBA 1YJNN 4H5TA 4GV6A 1DTTA 3ZCMA 3DOKA 4KFBA 1YAGA 3CMAN 1TAQA 4KHUA 1NGJA 4IJAA 4FLZA 2QA4N 2QWMA 1KLNA 3ZT2A 2O8FB 4CJSA 4B3TK 2EX3A 1C0GA 1QVGM 4BRFA 3QICA 2FBXA 3I56N 4W5QA 1B9DA 1JXEA 5CYMA 3TAEA 4QS7A 3DJCA 4JHDB 4ID5A 1V4SA 1BUPA 3V1RA 1SUQA 4OGEA 1C1BA 5BN8A 1U2VB 4B3SK 3HZ6A 3RR8A 3HP6A 3QETA 3PO5A 2DTUA 1HKGA 3TARA 1VSMA 3OJSA 1ZXOA 1RDUA 3ZX2A 4O0JA 4B9LA 5AQQA 3NVKA 4QAGA 3KD5E 3K2PA 4JKGB 4BGAA 4PY5A 4BRAA 2D5RA 2OA8A 3PX0A 4E3SA 1NK6A 1L3TA 4NCGA 3ZSZA 2Q1NA 5M1FA 1DT9A 4EP4A 4TSXA 5AQRA 3SAGA 3O4WA 5DK5A 1QTMA 5CYQA 3VGLA 3CCUN 3A8YA 4ELUA 3JYTA 3CCJN 3WXLA 1NOZA 3SMPA 4EHTA 1EX4A 2Z1GA 3SPZA 3HP9A 4V19S 2F7TA 5K14A 5KI6A 4LF9K 3OYHA 2KTQA 3S3OA 4H0OA 3AAPA 1RDBA 2KLAA 4DQIA 2RPIA 4DFKA 3C7NB 4JD2A 5C25A 3QERA 1NK9A 2RN2A 3W3DA 4DU1A 3O9TA 4LF7K 1T6DA 3AO1A 4FW1A 4NO7A 3QIOA 1HUXA 5DMRA 2P9PA 5JICA 2G8IA 2PY5A 1S5JA 1NGIA 1JCFA 5IT9O 1TKXA 4M45A 4Y1CA 4KTQA 1C6VA 3J8AA 3CC7N 2ZJQL 3VQ7A 4YOVA 3KKSA 3LANA 3CCMN 1LW2A 4YOUA 1ILYA 2AP1A 2D0CA 3RR7A 3SMSA 4RG8A 3MEGA 4RW7A 2QKKA 3ATVA 3OYKA 4IFYA 4PL7A 3ULEB 2O8BB 4YY3K 4FO0A 2YNIA 4DWIA 4CZKA 2FBVA 3LZIA 3HVRA 4BDYA 1N34K 4H5RA 3F9MA 4DTSA 2DFHA 3FGUA 3FFKB 5CHIA 5BPMA 1B92A 1Q86O 2BGGA 4K0KK 3E1YA 4DS5A 3K58A 1IBMK 3CG7A 1L3SA 3LWMA 2Q97A 4KAZA 5GIPA 1HNWK 4CZHA 4NXMK 4GY2B 4IO8A 4DTUA 4A2AA 2RKIA 1NK7A 4JI8K 3MXMA 3E01A 4M3XA 4NXNK 4N47A 1CZBA 4RW6A 4FZXC 1SKSA 4FK4A 2HMIA 3U6FA 3OVNA 1WSFA 3CQYA 4B1ZA 1JLCA 2OYQA 2V7ZA 5AQXA 5C15A 3K9KA 3VEWA 2BH1A 2V52B 4CHNA 4CBUA 2QWPA 3T1HK 4HVJA 4MO5A 3MDQA 2F8TA 5JVHL 1GOBA 1SQKA 5JLFA 4Q0BA 4B9QA 3IG1A 4HCBA 4YNQA 1YIJN 4DTJA 1FKPA 1KLMA 3F2KA 2PYLA 1NGBA 3L6QA 3T19A 4CK1A 1P8ZA 3D2FA 4WF9L 2GUPA 3OS1A 3ZT1A 5HROA 4N76A 3AV9A 3ID6A 5KPTA 2O8CB 1KAZA 4LF4K 2KFZA 4NCBA 3ZX3A 2E1ZA 2HVIA 3L2WA 2QWLA 1T6CA 1BIZA 2P9LB 4FM1A 4WQ4A 3MN7A 3PSIA 3NGIA 4FLYA 3A2FA 4J2BA 4KB1A 4KB0A 2O8DB 1VSHA 4JLHA 4B1YB 2F9TA 2IVPA 3NAEA 1BO5O 3L4IA 3CCSN 1XHXA 1C1AA 3B6OA 4M3ZA 3RWUA 3LDLA 3SLCA 4DV5K 1S6PA 3VTHA 5JLHA 2ZJRL 4ZHRA 5I42A 4PL8A 3QEXA 1XC9A 3N4QA 1HYSA 1VQPN 5J2NA 3RMBA 3AA2A 5FPMA 4BR5A 1G99A 3E66A 1VSEA 3P4IA 3SQ2A 5BREA 3SI6A 2QWQA 2O8EA 3U8XA 4MQ3A 1U45A 1T7PA 4WQ5A 4DSKA 2E2PA 4K43A 4EFHA 3SV3A 1VQKN 4E7JA 3AVFA 4BWJA 4E1JA 5HBMA 4CJUA 3OYGA 3J7AP 4C8NA 3THYB 4KV8A 2GTDA 3BDPA 5GADP 4H0TB 4E1MA 4BC5A 5DM6L 1K6YA 1ZBHA 1MWMA 3H08A 4CGJA 3SUOA 1T8EA 4B8AB 2RF2A 2YHAA 4YFUA 1NK5A 2E2QA 1EP4A 4PKHA 1EWQA 3CJBA 1ZBIA 2QK9A 1I94K 3T1YK 1F21A 4HUGA 3H46O 2WFBA 4CFCA 3G4SN 5B8HA 1RT5A 4Y1DA 1HNZK 2FSJA 3VF6A 1BI4B 1TUYA 1ATRA 1NJIO 3K5OA 1OVYA 3LM9A 1RDWX 3FZHA 4DQ8A 3TPQA 3UE5A 3H3NO 1NMNA 3HPHA 4LH4A 1Y64A 1HKCA 1E4GT 3WXIA 2Y1IA 4CI6A 4EIAA 1S1UA 4Z0UA 4OVLA 2NLXA 2KFNA 1NMDA 4RCHA 1LWEA 3ZSVA 4DV3K 4GKKK 1SV5A 4IWVA 5AQLA 3RSEB 3RMCA 4AHTA 5J2QA 3D6RA 4DG1A 4MDAA 5BPLA 1KFSA 1OVQA 4GW6A 4I9LA 3OJUA 1RTDA 4JI3K 3I0SA 1VQON 1YF5L 4KRFA 1QS4A 4DSJA 5GAHP 3VEXA 4J2EA 4CEZA 3HTVA 3OYFA 3RMAA 4FJLA 4XH4A 3DAWA 3LALA 4CJ5A 1KFDA 3CETA 5J2PA 3O3HA 4FLTA 2UYTA 1XMOK 3UKRA 1C0MA 5AQMA 3CC4N 4DR5K 1GLAG 2BANA 4GNIA 2VWKA 4F3OA 4C8KA 3ZLJA 4B9NA 4JAXA 3QEWA 1GLJO 5AZIB 2HF3A 3R8EA 3MAQA 2G8HA 1DLOA 3VQ6A 3O9UA 3OYLA 3IMXA 3U4LA 3V9ZA 5BRHA 5E26A 1VHXA 1KQSM 5AZJA 4YOTA 1OH8A 4QOZB 1FKOA 4WCEL 1IG8A 3AVHA 1CLQA 4DQQA 2QTDA 5BPNA 4N5SA 3PO4A 3UKUA 3O3GA 4ELTA 1NNEA 4WE1A 2GBZA 3M3ZA 5M1NA 2QW9A 3WNFA 2HNDA 1ASVA 4IFEA 4ISEA 3WQUA 1ASWA 1GLDG 2WONA 1VQLN 1R59O 1NK4A 2A5XA 4U67L 4CVNE 1REVA 1BCMA 4H0YB 1XNRK 1TL3A 3QBXA 3KK3A 3VQBA 3DWLA 2Y1JA 1YHQN 2HBLA 1BGXT 4A62A 3SK3A 2QI2A 1D9FA 1W0HA 4KH4A 3EEQA 2E6LA 5HRNA 3VA3A 4JHDA 1S1WA 2PFUA 2W41A 3QIPA 4JI1K 5HRSA 3CFOA 1ZBFA 2B6AA 1WOQA 4CEFA 3HM8A 3D2EB 3AO5A 2HBJA 2YHWA 4K8XA 1HPZA 3H3OB 3K5NA 3VENA 4CCHA 2EHGA 1U2VA 3JSMA
chains in the Genus database with same CATH topology
4B9TA 4O44A 5KGXA 3OYBA 2G8KA 3SCXA 4KHSA 3HL8A 3RR8A 3TAGA 3HP6A 3EYZA 5J1EA 3I0RA 3QETA 2JGUA 3MEEA 3PO5A 2DTUA 3NF6A 4BE1A 1KVCA 1VSMA 5KTQA 4OKJA 3OJSA 3CFRA 3TARA 4E7IA 4E0DA 3V9XA 4O0JA 1U4BA 4B9LA 3OYIA 1XWLA 3KLIA 4QAGA 3KD5E 3K2PA 4PY5A 4HCCA 3VQAA 5JS1A 2D5RA 2OA8A 3PX0A 4E3SA 1HQEA 3P83D 1NK6A 1L3TA 3HO1A 4NCGA 4KTZA 2KQ2A 4CESA 4GMJB 3ZSZA 1RT6A 1BCOA 4IG3A 2A1SA 4EP4A 2IS3A 4DU3A 4G1QA 4E1NA 4E7LA 4LSNA 3LWLA 4TSXA 5I3UA 2E4LA 4QCLA 5DK5A 3KK2A 1QQCA 5CYQA 3ULDA 3I8DA 1QTMA 1RILA 2OPPA 1IKVA 4UQGA 4ELUA 3JYTA 3TANA 2XHBA 1NOZA 2DY4A 3AVGA 1EX4A 2Z1GA 4E89A 3SPZA 3HP9A 4LY7A 4N41A 3V9WA 1X9WA 1RBSA 1QSLA 5K14A 5KI6A 4PUOA 3AO4A 4PQUA 1S6QA 1U47A 1NKCA 3LP1A 3OYHA 2KTQA 3S3OA 2XY8A 3NFAA 3V4IA 1VSIA 3PY8A 1RDBA 1ZYQA 4M3WA 4DQIA 2RPIA 4PWDA 3AVNA 4RW8A 3L2RA 4DFKA 1J5OA 4FJGA 5C25A 1RDCA 3QERA 4B8CA 4CHQA 2RN2A 1NK9A 3LZJA 4DU1A 3ZT0A 3OS0A 2XY5A 3SUPA 3AA3A 3AO1A 4CEQA 4C8LA 4FW1A 3KIOA 3QIOA 5DMRA 1XHZA 3NGZA 5FRNA 2G8IA 2PY5A 1S5JA 4E7KA 4KPYA 1TKXA 4M45A 4CERA 1JLFA 3V6DA 5KGWA 1HMVA 4DSFA 4E7HA 3F73A 4H4MA 4Y1CA 3M8RA 3DLBA 3DM2A 1VSLA 2LSNA 1C6VA 3IRXA 1U04A 4DFJA 1NK7A 4KTQA 5CZ1A 4O55A 4EZ6A 4M41A 2O4GA 3VQ7A 4OGCA 4I2PA 3ZSQA 1JXBA 3KKSA 1NJWA 4FK2A 1HNIA 4Z4GA 3LANA 1LW2A 1KRPA 1BIUA 1TKTA 2D0CA 3RR7A 4RG8A 3MEGA 3EZ5A 1WSGA 4RW7A 3KJVA 2QKKA 3WNEA 1HYVA 5FDLA 3O4QA 3OYEA 2GUIA 2VG6A 3OYKA 1KSPA 3DI6A 4IFYA 4KHYA 3LPTA 4FJNA 1TAUA 5HRPA 3NH1A 1FXXA 3VN5A 3KK1A 2IAJA 2YNIA 3P1GA 3K5LA 4DWIA 2HNZA 4CEOA 1Q8IA 4ID1A 4FLUA 2FBVA 3LZIA 3HVRA 4FJ9A 4KTWA 4BDYA 4I7FA 4FLXA 5KRSA 4DTXA 3WNGA 2W42A 4DTSA 1WAJA 2F8SA 4CIFA 4CHPA 3OYMA 2IC3A 3NH0A 2B4JA 1RT2A 3NBPA 4O0IA 3QINA 2DFFA 1RNHA 2DFHA 2HHQA 2YNFA 1IKWA 4DTMA 4CEDA 3DYAA 1B92A 4CJQA 4FLVA 2F96A 4Z4FA 4FZZA 4KKOA 4K8ZA 4C8MA 3AVCA 3K59A 3QEVA 2BGGA 1S9EA 4DS5A 3K58A 1I3AA 3CG7A 1N5YA 3LAKA 3K57A 4DTNA 4NYFA 1NJXA 1L3SA 4FJ8A 3ZSYA 2YV0X 1GOAA 4DMNA 4HUFA 5E41A 3LWMA 1Z25A 4KAZA 4DSLA 4FLWA 3ZSXA 1VK0A 1O1WA 4F8RA 2BE2A 1A5XA 3O4NA 4DLGA 3S3MA 4W5RA 1J54A 4CGHA 4DTUA 1BQMA 1S1TA 2RKIA 2WOMA 2X74A 1WSIA 2Z1IA 4OPJA 3VQ8A 4JRPA 3TI0A 3LAMA 3E01A 1MU2A 3LP3A 2A1RA 1JL1A 5FRMA 4M3XA 3TAFA 2YKMA 3DLEA 2YNHA 1L3VA 1L3UA 4CJ3A 4N47A 1T03A 1CZBA 4RW6A 1BL3A 2IGIA 3VQ9A 3VQPA 5CZ2A 4CIEA 4DFMA 3SQ1A 1SKSA 1IKXA 4FK4A 4HUEA 2HMIA 3U6FA 1TV6A 3OVNA 2ATQA 1Z26A 3CQ8A 1TK5A 1WSFA 4HHTA 3T3FA 4CFBA 2OZSA 2HHWA 3VA0A 1JLCA 4MFBA 1NOYA 2G8VA 2OYQA 4DFPA 4BE2A 4FYDA 1RTJA 4EZ9A 4CGDA 1HYZA 2Z1JA 2P5OA 4CHNA 1I39A 1HJRA 2VWJA 4KI6A 3ZT3A 4HVJA 3WNHA 4I9QA 4DTOA 1RT1A 3NH2A 3HVTA 1G15A 3OS2A 2F8TA 4FXDA 2O4IA 1D8YA 1GOBA 3QEPA 2HHTA 3L2VA 4Q0BA 4M3YA 3SPYA 1D5AA 3IG1A 4HCBA 1VSFA 4YNQA 4CHOA 3MECA 2FBYA 3DLKA 4Z4HA 4DU4A 4M3UA 5KRTA 2GV9A 3NDKA 4DTJA 4F2SA 4JRQA 4CFDA 1NK8A 4IBNA 4DTPA 3PX6A 4DQRA 1JLAA 1VRTA 3QEIA 1QE1A 1ZBUA 1FKPA 1KLMA 4Q5VA 1BISA 4JS5A 3F9KA 3O3FA 1X9SA 2PYLA 1S1XA 3D0PA 3T19A 4CK1A 3CFPA 3AO3A 1WSHA 4Z4CA 4KHQA 3NF7A 3OS1A 1NJZA 3C94A 3RMDA 4FZXC 3RRGA 1LW0A 4F2RA 4FJ5A 3MXMA 4OKEA 3ZT1A 5HROA 1IG9A 4LD0A 1CZ9A 3AV9A 4N76A 2PYJA 3KLGA 1VSKA 2I5JA 3KLEA 2KFZA 3KD1E 1IKYA 4KREA 2P1JA 3ZSWA 4NCBA 1YTUA 2AJQA 4W5NA 2FC0A 3L3UA 3NF9A 2HVIA 4IFVA 4CGIA 1RBTA 5C42A 3L2WA 3DLHA 3QNOA 4CF0A 1D9DA 2ETJA 3L2UA 4NYNA 1BIZA 3HJFA 4FM1A 4IKFA 3NGIA 1WSEA 4FLYA 2P5GA 1JLBA 3A2FA 1Q9XA 2PZSA 4AHVA 4J2BA 4AHSA 4M3TA 3QO9A 3G0ZA 1JLGA 4KB1A 4J2DA 3AVKA 1RT4A 4KB0A 1VSHA 4R5PA 3AA5X 4DLEA 1A5WA 4JLHA 3ZSOA 2IOCA 3UIQA 4FJHA 3NAEA 3RTVA 3KLHA 3C6UA 5EU7A 1QSSA 3IS9A 1XHXA 1C1AA 3U3YA 1JL2A 1J53A 3B6OA 1UOCA 4CGFA 2OZMA 4M3ZA 3RWUA 3SV4A 2G8UA 4KO0A 3V81A 2XY6A 4OLAA 1S6PA 1C1CA 3ALYA 4LH5A 4DSIA 1C0TA 4ZHRA 5I42A 1IH7A 3QEXA 1XC9A 2X6NA 1WSJA 1HYSA 5J2NA 3RMBA 3AA2A 2OPSA 3G10A 4O4GA 4M42A 4XIUA 3AVJA 1NK0A 2E6MA 5HLFA 1RDDA 3LPUA 1RT7A 1VSEA 4AHUA 3SQ2A 3SI6A 3OYCA 1U45A 4MQ3A 1T7PA 4B3OA 4CJKA 3TABA 1S9GA 1YT3A 4DSKA 2IDOA 4CJVA 3L2QA 2VG5A 3VQ4A 4CEEA 4CJTA 3SV3A 1HQUA 3AVIA 4E7JA 1RDAA 3AVFA 4BWJA 1BHLA 5HBMA 4CJUA 3OYGA 3VQCA 2ZD1A 4M3RA 4DTRA 3MXIA 4L8RB 4BDPA 4C8NA 1QHTA 2YKNA 4AHCA 1SL1A 4KV8A 4NCAA 3VQDA 1SKWA 3THVA 3BDPA 3ASMA 3TWHA 3M8QA 4E1MA 1YVUA 3OYNA 1KCFA 3VQ5A 3AO2A 4C8OA 1K6YA 1TGOA 1ZBHA 2HVHA 2B5JA 3H08A 4CGJA 3PX4A 3SUOA 1TKZA 1T8EA 3TAQA 4B8AB 1RT3A 4O5BA 4BE0A 1DTQA 2RF2A 2YHAA 4I2QA 3VQQA 3AA4A 4YFUA 1EP4A 1W9HA 1NK5A 1SL0A 3DLGA 4PA1A 2QK9A 4W5TA 1ZBIA 1NKEA 3LP0A 1ZBLA 1JKHA 4FM2A 1F21A 4HUGA 1BI4A 4FJMA 4F3TA 4IG0A 1LAVA 1UAXA 1KTQA 4CFCA 3C95A 3V1QA 4CGGA 1LAWA 1RT5A 3PUFA 4Y1DA 3V9SA 3SQ4A 3SNNA 2QKBA 2KZZA 3BGRA 4GVMA 1BI4B 5HP1A 4Z4IA 4CJLA 4FZYA 4CK3A 3K5OA 4E19A 1RBUA 4DF8A 3HPGA 1RTHA 3AVMA 5J2MA 3SJJA 2HHVA 2Z1HA 4CJ4A 3SQ0A 4B08A 4CF9A 4OLBA 2XO7A 2Q3SA 2FBTA 4CHZA 3ITHA 3OYAA 1VRUA 3HXMA 2X78A 3L3VA 2D0AA 3NCIA 1EETA 4ICLA 4FJKA 3HPHA 3QESA 4LH4A 3S9HA 4CJPA 4H4OA 2HHXA 3TR8A 1NJYA 4DQPA 3NE6A 3M8SA 1EKEA 2QXFA 2Y1IA 3C6TA 4KHNA 3T1AA 1VSJA 1S1UA 4Z0UA 5HRRA 3ZSRA 3QLHA 4B9MA 4CHYA 1J9AA 4OVLA 3DOLA 3EY1A 3P5JA 4LSLA 3D45A 4F4KA 2KFNA 1WAFA 2P51A 1TKDA 1LWEA 1IO2A 2DFEA 1VSDA 3ZSVA 3AVBA 3LDSA 1RBRA 3CM5A 1FK9A 1U48A 4CEAA 4Z4EA 3KTQA 1SV5A 3KKRA 1HNVA 3DMJA 3RMCA 4AHTA 3AVAA 3OY9A 5J2QA 3V9UA 1LV5A 3ISNC 4DG1A 2ITGA 4CJWA 1KVAA 5CY4A 1QSYA 4ELVA 2HW3A 5C24A 4RW9A 1GOCA 1KFSA 4I9LA 4GW6A 3OJUA 1RTDA 2XRIA 3HPOA 3K5MA 4CE9A 1A5VA 3I0SA 3IAYA 3B6PA 1L5UA 1RCHA 4KRFA 3HM9A 1QS4A 4DSJA 3L8BA 1UWBA 4OKKA 3NGYA 4HTUA 4J2EA 4DSEA 4CEZA 3OYFA 2HHSA 3RMAA 5SWMA 2HB5A 4FJLA 4CF1A 1ITGA 3LALA 4CF8A 4CJ5A 4IDKA 2G8WA 3MEDA 1KFDA 2OPRA 3DLRA 1EXQA 5J2PA 1UA1A 1Y97A 3O3HA 4FLTA 3DRPA 3ZT4A 1C0MA 4CEBA 4B9UA 1TVRA 3DRSA 3NHGA 2BANA 3S3NA 4BWMA 2R7YA 3V1OA 1XI1A 2KW4A 4N56A 1X9MA 2ZQBA 1TL1A 5JS2A 1C0UA 2VWKA 4F3OA 4C8KA 1X1PA 4W5OA 1RTIA 3CYMA 1B9FA 4B9NA 3QEWA 3HSTB 4CFAA 3MAQA 5D3GA 2VG7A 2G8HA 1WN7A 1DLOA 1SL2A 2YNGA 3VQ6A 4AILC 3OYLA 4J2AA 3V9ZA 1TK8A 3NF8A 4BDZA 3SZ2A 2NUBA 1T05A 1YTAA 4QOZB 1FKOA 1ASUA 4ZTJA 3OYDA 4B9VA 4FJJA 3DRRA 4FJXA 1UA0A 1JLEA 2BDPA 1WNSA 3SYZA 1BQNA 3PV8A 3AVHA 4CF2A 1CLQA 2XY7A 3MXJA 3LP2A 1KVBA 4DQQA 3SUQA 3HT3A 4N5SA 3PO4A 3O3GA 4FK0A 1LWCA 4ELTA 1HRHA 4WE1A 2GBZA 4B9SA 3OYJA 3WNFA 2HNDA 1ASVA 4CIGA 5T7BA 4BACA 2KZMA 4FM0A 3HK2A 1ASWA 4FJIA 2ZE2A 3TAPA 2WONA 2YHBA 4OPKA 3HYFA 4CK2A 1N6QA 4OJRA 1DTTA 3ZCMA 1NK4A 4H8KA 3DOKA 4FCYA 4CJEA 1REVA 3SUNA 1BCMA 4KFBA 1JLQA 2HHUA 1S1VA 3M8PA 1NKBA 3CM6A 1TL3A 1TAQA 3TAMA 4KHUA 2HNYA 4CJFA 4RW4A 3KK3A 4FLZA 1KLNA 4AH9A 2G8FA 1TK0A 3ZT2A 3VQBA 2JLEA 3KLFA 2Y1JA 3RRHA 1WLJA 1BGXT 4CJSA 4DF4A 2EX3A 1R0AA 1U49A 1D9FA 3VQEA 1W0HA 1RBVA 4JS4A 5HRNA 2E6LA 2FBXA 3VA3A 5SZTA 1CXQA 4W5QA 1S1WA 4FW2A 4EP5A 4CJRA 1B9DA 1Q9YA 2OPQA 1JXEA 2X6SA 5CYMA 3QIPA 3U3GA 5HRSA 4DS4A 3CFOA 3TAEA 4FJ7A 1ZBFA 2B6AA 4CEFA 4KI4A 4AHRA 4FVMA 3AO5A 3QNNA 4K8XA 2D0BA 4DQSA 5FROA 1HPZA 3K5NA 4ID5A 4ZTFA 4CCHA 1CXUA 4KHWA 2EHGA 3V1RA 3JSMA 1SUQA 1LWFA 3AVLA 1C1BA 4OGEA 4CECA 3FFIA 1SKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B9T A;  4O44 A;  5KGX A;  3OYB A;  2G8K A;  3SCX A;  4KHS A;  3HL8 A;  3RR8 A;  3TAG A;  3HP6 A;  3EYZ A;  5J1E A;  3I0R A;  3QET A;  2JGU A;  3MEE A;  3PO5 A;  2DTU A;  3NF6 A;  4BE1 A;  1KVC A;  1VSM A;  5KTQ A;  4OKJ A;  3OJS A;  3CFR A;  3TAR A;  4E7I A;  4E0D A;  3V9X A;  4O0J A;  1U4B A;  4B9L A;  3OYI A;  1XWL A;  3KLI A;  4QAG A;  3KD5 E;  3K2P A;  4PY5 A;  4HCC A;  3VQA A;  5JS1 A;  2D5R A;  2OA8 A;  3PX0 A;  4E3S A;  1HQE A;  3P83 D;  1NK6 A;  1L3T A;  3HO1 A;  4NCG A;  4KTZ A;  2KQ2 A;  4CES A;  4GMJ B;  3ZSZ A;  1RT6 A;  1BCO A;  4IG3 A;  2A1S A;  4EP4 A;  2IS3 A;  4DU3 A;  4G1Q A;  4E1N A;  4E7L A;  4LSN A;  3LWL A;  4TSX A;  5I3U A;  2E4L A;  4QCL A;  5DK5 A;  3KK2 A;  1QQC A;  5CYQ A;  3ULD A;  3I8D A;  1QTM A;  1RIL A;  2OPP A;  1IKV A;  4UQG A;  4ELU A;  3JYT A;  3TAN A;  2XHB A;  1NOZ A;  2DY4 A;  3AVG A;  1EX4 A;  2Z1G A;  4E89 A;  3SPZ A;  3HP9 A;  4LY7 A;  4N41 A;  3V9W A;  1X9W A;  1RBS A;  1QSL A;  5K14 A;  5KI6 A;  4PUO A;  3AO4 A;  4PQU A;  1S6Q A;  1U47 A;  1NKC A;  3LP1 A;  3OYH A;  2KTQ A;  3S3O A;  2XY8 A;  3NFA A;  3V4I A;  1VSI A;  3PY8 A;  1RDB A;  1ZYQ A;  4M3W A;  4DQI A;  2RPI A;  4PWD A;  3AVN A;  4RW8 A;  3L2R A;  4DFK A;  1J5O A;  4FJG A;  5C25 A;  1RDC A;  3QER A;  4B8C A;  4CHQ A;  2RN2 A;  1NK9 A;  3LZJ A;  4DU1 A;  3ZT0 A;  3OS0 A;  2XY5 A;  3SUP A;  3AA3 A;  3AO1 A;  4CEQ A;  4C8L A;  4FW1 A;  3KIO A;  3QIO A;  5DMR A;  1XHZ A;  3NGZ A;  5FRN A;  2G8I A;  2PY5 A;  1S5J A;  4E7K A;  4KPY A;  1TKX A;  4M45 A;  4CER A;  1JLF A;  3V6D A;  5KGW A;  1HMV A;  4DSF A;  4E7H A;  3F73 A;  4H4M A;  4Y1C A;  3M8R A;  3DLB A;  3DM2 A;  1VSL A;  2LSN A;  1C6V A;  3IRX A;  1U04 A;  4DFJ A;  1NK7 A;  4KTQ A;  5CZ1 A;  4O55 A;  4EZ6 A;  4M41 A;  2O4G A;  3VQ7 A;  4OGC A;  4I2P A;  3ZSQ A;  1JXB A;  3KKS A;  1NJW A;  4FK2 A;  1HNI A;  4Z4G A;  3LAN A;  1LW2 A;  1KRP A;  1BIU A;  1TKT A;  2D0C A;  3RR7 A;  4RG8 A;  3MEG A;  3EZ5 A;  1WSG A;  4RW7 A;  3KJV A;  2QKK A;  3WNE A;  1HYV A;  5FDL A;  3O4Q A;  3OYE A;  2GUI A;  2VG6 A;  3OYK A;  1KSP A;  3DI6 A;  4IFY A;  4KHY A;  3LPT A;  4FJN A;  1TAU A;  5HRP A;  3NH1 A;  1FXX A;  3VN5 A;  3KK1 A;  2IAJ A;  2YNI A;  3P1G A;  3K5L A;  4DWI A;  2HNZ A;  4CEO A;  1Q8I A;  4ID1 A;  4FLU A;  2FBV A;  3LZI A;  3HVR A;  4FJ9 A;  4KTW A;  4BDY A;  4I7F A;  4FLX A;  5KRS A;  4DTX A;  3WNG A;  2W42 A;  4DTS A;  1WAJ A;  2F8S A;  4CIF A;  4CHP A;  3OYM A;  2IC3 A;  3NH0 A;  2B4J A;  1RT2 A;  3NBP A;  4O0I A;  3QIN A;  2DFF A;  1RNH A;  2DFH A;  2HHQ A;  2YNF A;  1IKW A;  4DTM A;  4CED A;  3DYA A;  1B92 A;  4CJQ A;  4FLV A;  2F96 A;  4Z4F A;  4FZZ A;  4KKO A;  4K8Z A;  4C8M A;  3AVC A;  3K59 A;  3QEV A;  2BGG A;  1S9E A;  4DS5 A;  3K58 A;  1I3A A;  3CG7 A;  1N5Y A;  3LAK A;  3K57 A;  4DTN A;  4NYF A;  1NJX A;  1L3S A;  4FJ8 A;  3ZSY A;  2YV0 X;  1GOA A;  4DMN A;  4HUF A;  5E41 A;  3LWM A;  1Z25 A;  4KAZ A;  4DSL A;  4FLW A;  3ZSX A;  1VK0 A;  1O1W A;  4F8R A;  2BE2 A;  1A5X A;  3O4N A;  4DLG A;  3S3M A;  4W5R A;  1J54 A;  4CGH A;  4DTU A;  1BQM A;  1S1T A;  2RKI A;  2WOM A;  2X74 A;  1WSI A;  2Z1I A;  4OPJ A;  3VQ8 A;  4JRP A;  3TI0 A;  3LAM A;  3E01 A;  1MU2 A;  3LP3 A;  2A1R A;  1JL1 A;  5FRM A;  4M3X A;  3TAF A;  2YKM A;  3DLE A;  2YNH A;  1L3V A;  1L3U A;  4CJ3 A;  4N47 A;  1T03 A;  1CZB A;  4RW6 A;  1BL3 A;  2IGI A;  3VQ9 A;  3VQP A;  5CZ2 A;  4CIE A;  4DFM A;  3SQ1 A;  1SKS A;  1IKX A;  4FK4 A;  4HUE A;  2HMI A;  3U6F A;  1TV6 A;  3OVN A;  2ATQ A;  1Z26 A;  3CQ8 A;  1TK5 A;  1WSF A;  4HHT A;  3T3F A;  4CFB A;  2OZS A;  2HHW A;  3VA0 A;  1JLC A;  4MFB A;  1NOY A;  2G8V A;  2OYQ A;  4DFP A;  4BE2 A;  4FYD A;  1RTJ A;  4EZ9 A;  4CGD A;  1HYZ A;  2Z1J A;  2P5O A;  4CHN A;  1I39 A;  1HJR A;  2VWJ A;  4KI6 A;  3ZT3 A;  4HVJ A;  3WNH A;  4I9Q A;  4DTO A;  1RT1 A;  3NH2 A;  3HVT A;  1G15 A;  3OS2 A;  2F8T A;  4FXD A;  2O4I A;  1D8Y A;  1GOB A;  3QEP A;  2HHT A;  3L2V A;  4Q0B A;  4M3Y A;  3SPY A;  1D5A A;  3IG1 A;  4HCB A;  1VSF A;  4YNQ A;  4CHO A;  3MEC A;  2FBY A;  3DLK A;  4Z4H A;  4DU4 A;  4M3U A;  5KRT A;  2GV9 A;  3NDK A;  4DTJ A;  4F2S A;  4JRQ A;  4CFD A;  1NK8 A;  4IBN A;  4DTP A;  3PX6 A;  4DQR A;  1JLA A;  1VRT A;  3QEI A;  1QE1 A;  1ZBU A;  1FKP A;  1KLM A;  4Q5V A;  1BIS A;  4JS5 A;  3F9K A;  3O3F A;  1X9S A;  2PYL A;  1S1X A;  3D0P A;  3T19 A;  4CK1 A;  3CFP A;  3AO3 A;  1WSH A;  4Z4C A;  4KHQ A;  3NF7 A;  3OS1 A;  1NJZ A;  3C94 A;  3RMD A;  4FZX C;  3RRG A;  1LW0 A;  4F2R A;  4FJ5 A;  3MXM A;  4OKE A;  3ZT1 A;  5HRO A;  1IG9 A;  4LD0 A;  1CZ9 A;  3AV9 A;  4N76 A;  2PYJ A;  3KLG A;  1VSK A;  2I5J A;  3KLE A;  2KFZ A;  3KD1 E;  1IKY A;  4KRE A;  2P1J A;  3ZSW A;  4NCB A;  1YTU A;  2AJQ A;  4W5N A;  2FC0 A;  3L3U A;  3NF9 A;  2HVI A;  4IFV A;  4CGI A;  1RBT A;  5C42 A;  3L2W A;  3DLH A;  3QNO A;  4CF0 A;  1D9D A;  2ETJ A;  3L2U A;  4NYN A;  1BIZ A;  3HJF A;  4FM1 A;  4IKF A;  3NGI A;  1WSE A;  4FLY A;  2P5G A;  1JLB A;  3A2F A;  1Q9X A;  2PZS A;  4AHV A;  4J2B A;  4AHS A;  4M3T A;  3QO9 A;  3G0Z A;  1JLG A;  4KB1 A;  4J2D A;  3AVK A;  1RT4 A;  4KB0 A;  1VSH A;  4R5P A;  3AA5 X;  4DLE A;  1A5W A;  4JLH A;  3ZSO A;  2IOC A;  3UIQ A;  4FJH A;  3NAE A;  3RTV A;  3KLH A;  3C6U A;  5EU7 A;  1QSS A;  3IS9 A;  1XHX A;  1C1A A;  3U3Y A;  1JL2 A;  1J53 A;  3B6O A;  1UOC A;  4CGF A;  2OZM A;  4M3Z A;  3RWU A;  3SV4 A;  2G8U A;  4KO0 A;  3V81 A;  2XY6 A;  4OLA A;  1S6P A;  1C1C A;  3ALY A;  4LH5 A;  4DSI A;  1C0T A;  4ZHR A;  5I42 A;  1IH7 A;  3QEX A;  1XC9 A;  2X6N A;  1WSJ A;  1HYS A;  5J2N A;  3RMB A;  3AA2 A;  2OPS A;  3G10 A;  4O4G A;  4M42 A;  4XIU A;  3AVJ A;  1NK0 A;  2E6M A;  5HLF A;  1RDD A;  3LPU A;  1RT7 A;  1VSE A;  4AHU A;  3SQ2 A;  3SI6 A;  3OYC A;  1U45 A;  4MQ3 A;  1T7P A;  4B3O A;  4CJK A;  3TAB A;  1S9G A;  1YT3 A;  4DSK A;  2IDO A;  4CJV A;  3L2Q A;  2VG5 A;  3VQ4 A;  4CEE A;  4CJT A;  3SV3 A;  1HQU A;  3AVI A;  4E7J A;  1RDA A;  3AVF A;  4BWJ A;  1BHL A;  5HBM A;  4CJU A;  3OYG A;  3VQC A;  2ZD1 A;  4M3R A;  4DTR A;  3MXI A;  4L8R B;  4BDP A;  4C8N A;  1QHT A;  2YKN A;  4AHC A;  1SL1 A;  4KV8 A;  4NCA A;  3VQD A;  1SKW A;  3THV A;  3BDP A;  3ASM A;  3TWH A;  3M8Q A;  4E1M A;  1YVU A;  3OYN A;  1KCF A;  3VQ5 A;  3AO2 A;  4C8O A;  1K6Y A;  1TGO A;  1ZBH A;  2HVH A;  2B5J A;  3H08 A;  4CGJ A;  3PX4 A;  3SUO A;  1TKZ A;  1T8E A;  3TAQ A;  4B8A B;  1RT3 A;  4O5B A;  4BE0 A;  1DTQ A;  2RF2 A;  2YHA A;  4I2Q A;  3VQQ A;  3AA4 A;  4YFU A;  1EP4 A;  1W9H A;  1NK5 A;  1SL0 A;  3DLG A;  4PA1 A;  2QK9 A;  4W5T A;  1ZBI A;  1NKE A;  3LP0 A;  1ZBL A;  1JKH A;  4FM2 A;  1F21 A;  4HUG A;  1BI4 A;  4FJM A;  4F3T A;  4IG0 A;  1LAV A;  1UAX A;  1KTQ A;  4CFC A;  3C95 A;  3V1Q A;  4CGG A;  1LAW A;  1RT5 A;  3PUF A;  4Y1D A;  3V9S A;  3SQ4 A;  3SNN A;  2QKB A;  2KZZ A;  3BGR A;  4GVM A;  1BI4 B;  5HP1 A;  4Z4I A;  4CJL A;  4FZY A;  4CK3 A;  3K5O A;  4E19 A;  1RBU A;  4DF8 A;  3HPG A;  1RTH A;  3AVM A;  5J2M A;  3SJJ A;  2HHV A;  2Z1H A;  4CJ4 A;  3SQ0 A;  4B08 A;  4CF9 A;  4OLB A;  2XO7 A;  2Q3S A;  2FBT A;  4CHZ A;  3ITH A;  3OYA A;  1VRU A;  3HXM A;  2X78 A;  3L3V A;  2D0A A;  3NCI A;  1EET A;  4ICL A;  4FJK A;  3HPH A;  3QES A;  4LH4 A;  3S9H A;  4CJP A;  4H4O A;  2HHX A;  3TR8 A;  1NJY A;  4DQP A;  3NE6 A;  3M8S A;  1EKE A;  2QXF A;  2Y1I A;  3C6T A;  4KHN A;  3T1A A;  1VSJ A;  1S1U A;  4Z0U A;  5HRR A;  3ZSR A;  3QLH A;  4B9M A;  4CHY A;  1J9A A;  4OVL A;  3DOL A;  3EY1 A;  3P5J A;  4LSL A;  3D45 A;  4F4K A;  2KFN A;  1WAF A;  2P51 A;  1TKD A;  1LWE A;  1IO2 A;  2DFE A;  1VSD A;  3ZSV A;  3AVB A;  3LDS A;  1RBR A;  3CM5 A;  1FK9 A;  1U48 A;  4CEA A;  4Z4E A;  3KTQ A;  1SV5 A;  3KKR A;  1HNV A;  3DMJ A;  3RMC A;  4AHT A;  3AVA A;  3OY9 A;  5J2Q A;  3V9U A;  1LV5 A;  3ISN C;  4DG1 A;  2ITG A;  4CJW A;  1KVA A;  5CY4 A;  1QSY A;  4ELV A;  2HW3 A;  5C24 A;  4RW9 A;  1GOC A;  1KFS A;  4I9L A;  4GW6 A;  3OJU A;  1RTD A;  2XRI A;  3HPO A;  3K5M A;  4CE9 A;  1A5V A;  3I0S A;  3IAY A;  3B6P A;  1L5U A;  1RCH A;  4KRF A;  3HM9 A;  1QS4 A;  4DSJ A;  3L8B A;  1UWB A;  4OKK A;  3NGY A;  4HTU A;  4J2E A;  4DSE A;  4CEZ A;  3OYF A;  2HHS A;  3RMA A;  5SWM A;  2HB5 A;  4FJL A;  4CF1 A;  1ITG A;  3LAL A;  4CF8 A;  4CJ5 A;  4IDK A;  2G8W A;  3MED A;  1KFD A;  2OPR A;  3DLR A;  1EXQ A;  5J2P A;  1UA1 A;  1Y97 A;  3O3H A;  4FLT A;  3DRP A;  3ZT4 A;  1C0M A;  4CEB A;  4B9U A;  1TVR A;  3DRS A;  3NHG A;  2BAN A;  3S3N A;  4BWM A;  2R7Y A;  3V1O A;  1XI1 A;  2KW4 A;  4N56 A;  1X9M A;  2ZQB A;  1TL1 A;  5JS2 A;  1C0U A;  2VWK A;  4F3O A;  4C8K A;  1X1P A;  4W5O A;  1RTI A;  3CYM A;  1B9F A;  4B9N A;  3QEW A;  3HST B;  4CFA A;  3MAQ A;  5D3G A;  2VG7 A;  2G8H A;  1WN7 A;  1DLO A;  1SL2 A;  2YNG A;  3VQ6 A;  4AIL C;  3OYL A;  4J2A A;  3V9Z A;  1TK8 A;  3NF8 A;  4BDZ A;  3SZ2 A;  2NUB A;  1T05 A;  1YTA A;  4QOZ B;  1FKO A;  1ASU A;  4ZTJ A;  3OYD A;  4B9V A;  4FJJ A;  3DRR A;  4FJX A;  1UA0 A;  1JLE A;  2BDP A;  1WNS A;  3SYZ A;  1BQN A;  3PV8 A;  3AVH A;  4CF2 A;  1CLQ A;  2XY7 A;  3MXJ A;  3LP2 A;  1KVB A;  4DQQ A;  3SUQ A;  3HT3 A;  4N5S A;  3PO4 A;  3O3G A;  4FK0 A;  1LWC A;  4ELT A;  1HRH A;  4WE1 A;  2GBZ A;  4B9S A;  3OYJ A;  3WNF A;  2HND A;  1ASV A;  4CIG A;  5T7B A;  4BAC A;  2KZM A;  4FM0 A;  3HK2 A;  1ASW A;  4FJI A;  2ZE2 A;  3TAP A;  2WON A;  2YHB A;  4OPK A;  3HYF A;  4CK2 A;  1N6Q A;  4OJR A;  1DTT A;  3ZCM A;  1NK4 A;  4H8K A;  3DOK A;  4FCY A;  4CJE A;  1REV A;  3SUN A;  1BCM A;  4KFB A;  1JLQ A;  2HHU A;  1S1V A;  3M8P A;  1NKB A;  3CM6 A;  1TL3 A;  1TAQ A;  3TAM A;  4KHU A;  2HNY A;  4CJF A;  4RW4 A;  3KK3 A;  4FLZ A;  1KLN A;  4AH9 A;  2G8F A;  1TK0 A;  3ZT2 A;  3VQB A;  2JLE A;  3KLF A;  2Y1J A;  3RRH A;  1WLJ A;  1BGX T;  4CJS A;  4DF4 A;  2EX3 A;  1R0A A;  1U49 A;  1D9F A;  3VQE A;  1W0H A;  1RBV A;  4JS4 A;  5HRN A;  2E6L A;  2FBX A;  3VA3 A;  5SZT A;  1CXQ A;  4W5Q A;  1S1W A;  4FW2 A;  4EP5 A;  4CJR A;  1B9D A;  1Q9Y A;  2OPQ A;  1JXE A;  2X6S A;  5CYM A;  3QIP A;  3U3G A;  5HRS A;  4DS4 A;  3CFO A;  3TAE A;  4FJ7 A;  1ZBF A;  2B6A A;  4CEF A;  4KI4 A;  4AHR A;  4FVM A;  3AO5 A;  3QNN A;  4K8X A;  2D0B A;  4DQS A;  5FRO A;  1HPZ A;  3K5N A;  4ID5 A;  4ZTF A;  4CCH A;  1CXU A;  4KHW A;  2EHG A;  3V1R A;  3JSM A;  1SUQ A;  1LWF A;  3AVL A;  1C1B A;  4OGE A;  4CEC A;  3FFI A;  1SKR A; 
#chains in the Genus database with same CATH topology
 5E84 A;  3GBT A;  3SCX A;  2IVN A;  3E9P A;  4KHS A;  3WT0 A;  3EYZ A;  5J1E A;  3I0R A;  2JGU A;  4JKG A;  4BE1 A;  1DGK N;  4OKJ A;  2CH6 A;  2FF6 A;  4A2B A;  4WYB A;  1U4B A;  1VQ5 N;  3FR0 A;  4DB3 A;  5AQZ A;  5C0Y A;  1IBL K;  4KTZ A;  2KQ2 A;  3MN5 A;  1RT6 A;  1BCO A;  3PSF A;  4G1Q A;  3OBY A;  4LSN A;  4H5N A;  2E4L A;  1QQC A;  2FLO A;  1IKV A;  4O8K A;  2XHB A;  3AAQ A;  2YX6 A;  4FWM A;  4PQU A;  2P9K B;  1S6Q A;  3C7N A;  3DXM B;  1U47 A;  3CER A;  3NFA A;  3V4I A;  3PY8 A;  4CD1 A;  4JI7 K;  2OTJ N;  3QFU A;  4BVP A;  2ITM A;  4CHQ A;  5CR4 A;  4FWN A;  3QBW A;  3OS0 A;  4FPA A;  3NGZ A;  1HPM A;  4R79 A;  3J80 O;  3F73 A;  4H4M A;  3DM2 A;  2LSN A;  1T44 A;  4M41 A;  4KH6 A;  5AQI A;  1NJW A;  3ZSQ A;  1JXB A;  3BP8 A;  3ZET B;  4LF6 K;  4Z4G A;  1KRP A;  1BIU A;  1KAX A;  3ULE A;  2O8B A;  2VQE K;  2QEX N;  3CC2 N;  2E2N A;  2QWR A;  1HYV A;  2Q0U A;  2GUI A;  1HR0 K;  1KSP A;  3DI6 A;  1FXX A;  4FOE A;  3VN5 A;  3KK1 A;  5AJ3 K;  2RE2 A;  4FJ9 A;  4KTW A;  4FLX A;  4CZF A;  2W42 A;  4CIF A;  2IC3 A;  4A5A A;  2NNW A;  3NBP A;  2HHQ A;  2YNF A;  2VYP A;  3DYA A;  3ID8 A;  1VQN N;  3K59 A;  1QVF M;  1S9E A;  3MN6 A;  1YUW A;  1N5Y A;  3LAK A;  1NJX A;  4DMN A;  4HUF A;  4U7B A;  5E41 A;  1Z25 A;  4DSL A;  1VK0 A;  5BR9 A;  1KXP A;  4F8R A;  2BE2 A;  4DLG A;  3MCP A;  1J54 A;  3A5L C;  4BC4 A;  1S1T A;  2X74 A;  2Z1I A;  4OPJ A;  2A1R A;  3QML A;  3WUH A;  1JL1 A;  3U9D A;  1YVN A;  1Q7Y O;  2YNH A;  4CJ3 A;  5CE3 A;  5CZ2 A;  4B1W B;  3SQ1 A;  5BR8 K;  2ATQ A;  2CGL A;  1TK5 A;  4JKC A;  3T3F A;  3P39 A;  2OZS A;  1NOY A;  4DFP A;  4BGB A;  3J7Y P;  4EZ9 A;  4CGD A;  4H0V B;  2ZF5 O;  3IUC A;  1I39 A;  4AQY K;  3EE9 A;  3WNH A;  4I9Q A;  1RT1 A;  3OS2 A;  3HVT A;  1G15 A;  3KZB A;  2O4I A;  2HHT A;  3QEP A;  4DV2 K;  3CF5 L;  1NGG A;  3MEC A;  4LF5 K;  4M3U A;  5GAE P;  4DUZ K;  4F2S A;  1NK8 A;  4IZ9 A;  2NRT A;  4JS5 A;  5A2Q O;  4Z4C A;  1NJZ A;  3RRG A;  2O8C A;  1LW0 A;  4F2R A;  4WFB L;  4OKE A;  2NRV A;  4LD0 A;  1Z6R A;  3KLG A;  4LFC K;  4HTL A;  1J5E K;  3KD1 E;  2A40 A;  4KRE A;  3ZSW A;  4IEI A;  5BN9 A;  2E1Y A;  4CGI A;  4M63 C;  1XUP O;  4ILG B;  1NGA A;  3RVC A;  2D0O A;  1D9D A;  2ASM A;  4NYN A;  3HJF A;  3WEE B;  2O8D A;  3LM2 A;  2P5G A;  1U6Z A;  1Q9X A;  4AHV A;  4AHS A;  2YHY A;  4M3T A;  3G0Z A;  4J2D A;  3AVK A;  2HST A;  1KD1 O;  2IOC A;  3UIQ A;  2JWK A;  5AQP A;  1VQ7 N;  5EU7 A;  1N33 K;  4BRD A;  4CGF A;  1J53 A;  1UOC A;  2OZM A;  3O9S A;  3SV4 A;  2V7Y A;  5LMN K;  3O6W A;  1WBB A;  3AVJ A;  5HL7 L;  3LPU A;  1S3X A;  2NZT A;  3DXK B;  3OYC A;  4FOI A;  4JI4 K;  2VG5 A;  3THY A;  5FPN A;  3AVI A;  3VQC A;  4BRI A;  4M3R A;  4DTR A;  1GLF O;  4BDP A;  1QHT A;  3VPZ A;  2A41 A;  4AHC A;  1K8K A;  4MLE A;  3M8Q A;  4JEP A;  4X66 K;  3R1X A;  3OYN A;  3VQ5 A;  3TSU A;  1RFQ A;  3TSP A;  4OPA A;  1W7A A;  2B5J A;  3BY5 A;  4Z94 A;  2UUC K;  4O5B A;  1DTQ A;  3DLG A;  4PA1 A;  5LJV A;  2YCH A;  4H03 B;  1NKE A;  3LP0 A;  4FM2 A;  1GLC G;  1BI4 A;  3OA9 A;  1LAV A;  1UAX A;  4BR7 A;  3C95 A;  4CGG A;  3SNN A;  3L4Q A;  3S41 A;  3V9S A;  4CD3 A;  2QKB A;  5HP1 A;  4CK3 A;  4JI2 K;  3HPG A;  4CJ4 A;  3ENO A;  4AF1 A;  3B8A X;  4B08 A;  2Q3S A;  2FBT A;  4JK9 A;  4OPH A;  4CHZ A;  3D7E O;  2X78 A;  3L3V A;  5HOO A;  2D0A A;  3NCI A;  1EET A;  4ICL A;  3GE1 A;  3HI0 A;  5EVZ A;  3S9H A;  1HNX K;  5AQO A;  3CI5 A;  4FL9 A;  1NJY A;  3OBW A;  3NE6 A;  1YIT N;  1EKE A;  5HRR A;  3ZSR A;  3P5J A;  5F0X A;  4K41 A;  4BQZ A;  2VWB A;  3AAR A;  2P51 A;  1TKD A;  3RSE A;  1NWK A;  1VSD A;  2DFE A;  1VQM N;  4KBO A;  3AVB A;  2CGK A;  2P9I A;  3CJ7 A;  3CM5 A;  3G6E N;  3LDS A;  1FK9 A;  1U48 A;  5KPR A;  3KTQ A;  1HNV A;  3DMJ A;  3AVA A;  3R9P A;  3V9U A;  3THX B;  4KHP K;  3ATU A;  1QSY A;  3O5B A;  2HW3 A;  3EKS A;  3FZL A;  3HPO A;  1A5V A;  3IAY A;  3B6P A;  1L5U A;  1RCH A;  3E9O A;  2NRH A;  5EY4 A;  4DSE A;  3EN9 A;  5SWM A;  2HB5 A;  3CJ1 A;  4CF1 A;  2OPR A;  1EXQ A;  2IIR A;  3BF1 A;  4BR4 A;  1HJO A;  3ZT4 A;  5LMU K;  4B9U A;  3CIP A;  1BU6 O;  1WBD A;  3S3N A;  5AZI A;  1TL1 A;  3VEY A;  4DV6 K;  4A5B A;  1X3N A;  1X1P A;  1RTI A;  3CYM A;  4CFA A;  4AIL C;  4FWR A;  5ADX A;  2UXC K;  3EE8 A;  4JN4 A;  4F9O A;  1T05 A;  4FJJ A;  1ASU A;  3ZX0 A;  4B9V A;  4CZM A;  1UA0 A;  2QXL A;  1JLE A;  2BDP A;  1WNS A;  4CF2 A;  5AQH A;  2XY7 A;  2P9N B;  3VF2 A;  3SUQ A;  3I8B A;  2WTU A;  4FK0 A;  2I7N A;  4B9S A;  2KZM A;  2Q36 A;  3HOT A;  4FJI A;  3WQT A;  2ZE2 A;  3TAP A;  4MDB A;  3R3L A;  1EO1 A;  4FWP A;  1DKG D;  2HHU A;  1S1V A;  2VQF K;  3M8P A;  4LF8 K;  4I6M B;  2HNY A;  4RW4 A;  2G8F A;  1OKJ A;  1TK0 A;  2E5L K;  1WLJ A;  5ADX H;  4DF4 A;  1SS6 A;  1R0A A;  1U49 A;  4NLB A;  2QM1 A;  3VQE A;  4JS4 A;  5SZT A;  4EP5 A;  2DPN A;  5MLC Q;  2OPQ A;  2X6S A;  3U3G A;  3P38 A;  4FJ7 A;  3MX5 A;  2AA4 A;  4KI4 A;  4AHR A;  1VQ6 N;  4DQS A;  1CXU A;  1FW6 A;  4KHW A;  3F5T A;  3AVL A;  4BRM A;  1C0F A;  3FFI A;  3THW B;  1SKR A;  4IOA L;  5KGX A;  3OYB A;  2G8K A;  1RGI A;  3WXK A;  1VQ8 N;  3HL8 A;  3MEE A;  1Q82 O;  5I9E B;  4E0D A;  5KTQ A;  3VGM A;  4E7I A;  5JMV A;  2GX9 A;  3KLI A;  4DHY A;  4JKA A;  3VQA A;  3CPE A;  4BVO A;  3EZW A;  4CW7 B;  4H0P A;  1SZ2 A;  4YOY A;  1V4T A;  2A1S A;  4JKE A;  4BRH A;  2IS3 A;  4DU3 A;  4E1N A;  3LWL A;  2ZGY A;  3KK2 A;  3HOS A;  1W2B M;  3VMF B;  3FLC O;  4UQG A;  1K73 O;  2DY4 A;  1MDU B;  4E89 A;  4LY7 A;  3K0S A;  3V9W A;  1X9W A;  1RBS A;  5F2R A;  4Y0W A;  4LFB K;  1YJ9 N;  1NGH A;  1YXQ A;  1NKC A;  2F4V K;  2NRZ A;  2XY8 A;  1VSI A;  4WFA L;  2JWL A;  4M3W A;  3Q7B A;  3AVN A;  4DR7 K;  1J5O A;  1RDC A;  1S22 A;  4JKD A;  5KQ8 A;  3ZT0 A;  2XY5 A;  1XQS C;  3SUP A;  3KIO A;  1K9M O;  1XHZ A;  1M90 O;  4E7K A;  4KPY A;  1JLF A;  3V6D A;  5KGW A;  4E7H A;  3O80 A;  3ZET A;  3M8R A;  1VSL A;  3IRX A;  5CZ1 A;  2FF3 B;  4O55 A;  2O4G A;  2P9U B;  1BA0 A;  3LDO A;  4OGC A;  4FK2 A;  1HNI A;  3P31 A;  1TKT A;  2CGJ A;  5EX5 A;  3EZ5 A;  1WSG A;  3ZEU B;  1NGD A;  3KJV A;  3WNE A;  4BC2 A;  3OYE A;  4Z4F A;  1TAU A;  3LPT A;  2D4W A;  2Q0R A;  1GLL O;  3K5L A;  2HNZ A;  1Q8I A;  1MWK A;  5KRS A;  3WNG A;  2F8S A;  1WAJ A;  3NH0 A;  2B4J A;  3I55 N;  4O0I A;  3QIN A;  1RNH A;  1IKW A;  4DTM A;  4FSV A;  4YDU C;  4QS8 A;  2O8F A;  2O8E B;  3ZYY X;  4K8Z A;  4C8M A;  4QS9 A;  3AVC A;  5C2D A;  1I3A A;  3K57 A;  2PAV A;  4DTN A;  2A3Z A;  4NYF A;  3ZSY A;  3CCQ N;  4IO9 L;  4FLW A;  1GLE G;  1HLU A;  1A5X A;  1ZBS A;  3S3M A;  4W5R A;  4B3M K;  4CGH A;  1IBK K;  2WC9 A;  1WSI A;  3VQ8 A;  3HRG A;  3CJC A;  3LAM A;  1DEJ A;  1MU2 A;  3LP3 A;  4BR2 A;  4EAH D;  2D0P A;  1JJ2 M;  4CZG A;  2YHX A;  3TAF A;  2YKM A;  4ISF A;  5ELZ A;  1BL3 A;  4CIE A;  4HUE A;  3A5M C;  1Z26 A;  3CQ8 A;  3SBT A;  2HHW A;  5AR0 A;  2G8V A;  1GLB G;  4BE2 A;  1RTJ A;  4YDU A;  2Z1J A;  2P5O A;  1HJR A;  2VWJ A;  5AQK A;  3NH2 A;  4FXD A;  3TTF A;  4CBW A;  4BRE A;  4M3Y A;  4OO1 J;  1XNQ K;  1D5A A;  1ATN A;  2FBY A;  5KRT A;  2GV9 A;  5GIO A;  4JRQ A;  3AGR A;  4CFD A;  4IBN A;  4DTP A;  3PX6 A;  4BRC A;  1JLA A;  1VRT A;  1QE1 A;  1ZBU A;  3MCA B;  2BUP A;  3F9K A;  4IJN A;  3CD6 N;  1S1X A;  3CFP A;  1TUU A;  3H1V X;  3RMD A;  3VTI A;  4FJ5 A;  3QDK A;  4BY9 C;  1CZ9 A;  3CCR N;  2UXD K;  2PYJ A;  4L3Q A;  4DR1 K;  2E88 A;  3SJH A;  2UUA K;  3H6E A;  1IKY A;  1OH5 A;  2P1J A;  1NGF A;  4W5N A;  2FC0 A;  4C23 A;  3WEE A;  3NF9 A;  4IFV A;  5C42 A;  3K9J A;  3DLH A;  1VQ4 N;  2ETJ A;  3NVM A;  3L2U A;  1QHA A;  4FWO A;  3CQX A;  1JLB A;  3C0B A;  1JLG A;  1RT4 A;  4R5P A;  3AA5 X;  1A5W A;  3FZK A;  3ZSO A;  4FJH A;  1TYQ B;  3C6U A;  2YI1 A;  4FVU A;  3IS9 A;  4CZE A;  4WFN L;  2Q31 A;  3UKR B;  3WXM B;  3V81 A;  2XY6 A;  4OLA A;  3OW2 M;  3ALY A;  5EOY A;  1BWF O;  4LH5 A;  2D1K A;  2X6N A;  1KC8 O;  3DXK A;  4KH5 A;  2OPS A;  3SAH A;  4O4G A;  4M42 A;  4XIU A;  4G9Z A;  1NK0 A;  1RDD A;  4XEI A;  1RT7 A;  4AHU A;  4BRG A;  4X64 K;  3UB5 A;  1S9G A;  1YT3 A;  2IDO A;  4CJV A;  3PLA A;  3VQ4 A;  4ILJ A;  4CEE A;  1E4F T;  5AQY A;  4DV0 K;  3H1Q A;  3MXI A;  4L8R B;  2WBN A;  1SL1 A;  4DKW A;  3UKU B;  2HBM A;  2V51 B;  3TWH A;  4DCH A;  4XH5 A;  1YVU A;  1KCF A;  3AO2 A;  1Q81 O;  4DR4 K;  3PX4 A;  1TKZ A;  3TAQ A;  4BE0 A;  3IDH A;  3TTC A;  3VQQ A;  3AA4 A;  1W9H A;  4W5T A;  4FJM A;  4F3T A;  3L0Q A;  1KTQ A;  1J6Z A;  3PUF A;  2KZZ A;  3VEV A;  1ATS A;  5AQN A;  3GOI A;  4CJL A;  4DR2 K;  4FZY A;  4BG9 A;  1RBU A;  4DF8 A;  5J2M A;  1RTH A;  3AVM A;  1K8A O;  3G25 A;  4CF9 A;  3CCL N;  4O5F A;  1WUA A;  4JKF A;  1VRU A;  2E8A A;  3HXM A;  4UY8 O;  3JXU A;  4IOC L;  4FJK A;  3QES A;  4H4O A;  2HHX A;  1ESV A;  3TR8 A;  3MN9 A;  1D4X A;  4KHN A;  1VSJ A;  3O9Q A;  4CHY A;  1J9A A;  3DOL A;  3EY1 A;  3D45 A;  1WAF A;  4CJ7 A;  5KPZ A;  1IO2 A;  3VF4 A;  4BG8 A;  3THX A;  2OAN A;  4CEA A;  1QQM A;  1W97 L;  2NRX A;  4GVE A;  4DUY K;  1LV5 A;  3TTD A;  2ITG A;  4CJW A;  1NGC A;  4IDH A;  5IWA K;  2CH5 A;  2P9L A;  3K5M A;  3FZF A;  3H45 C;  3HM9 A;  1UWB A;  3NGY A;  2HHS A;  3BF3 A;  2W40 A;  4MLH A;  1ITG A;  4CF8 A;  4C1N I;  4IDK A;  3MED A;  3DLR A;  1MA9 B;  1UA1 A;  3DRP A;  4CEB A;  2HOE A;  4C1N K;  4BWM A;  3V1O A;  2KW4 A;  1YI2 N;  1C0U A;  1T3V A;  1LOT B;  4K25 A;  4W5O A;  4YOX A;  1B9F A;  1Q18 A;  1SAZ A;  3HST B;  4JKH A;  1WN7 A;  1SL2 A;  5M1K A;  2YNG A;  2KKZ A;  3T69 A;  3A5N C;  4EHU A;  3FZM A;  1QZ6 A;  4NB4 A;  1TK8 A;  3NF8 A;  4JK7 A;  3SZ2 A;  1OH6 A;  2NUB A;  4H5W A;  1YTA A;  2P9N A;  4CZI A;  4ZTJ A;  3OYD A;  4FJX A;  3CXC M;  3CCV N;  4JV5 K;  3PV8 A;  3SYZ A;  2P9S B;  1KVB A;  3HT3 A;  1LWC A;  4H5V A;  1HRH A;  3OYJ A;  4CIG A;  5T7B A;  4HWI A;  3N4P A;  4FM0 A;  4YOW A;  1N32 K;  4OPK A;  3HYF A;  4CK2 A;  1N6Q A;  4OJR A;  4BRN A;  4H8K A;  4I6M A;  4FCY A;  4FWQ A;  4CJE A;  3SUN A;  4BQL A;  2ZM6 K;  5M1Q A;  1JLQ A;  3VOV A;  1NKB A;  3CM6 A;  3TAM A;  3C6A A;  4CJF A;  4AH9 A;  2KHO A;  2JLE A;  3KLF A;  3RRH A;  1NG9 A;  3KWI A;  5AQV A;  3OHR A;  1RBV A;  1CXQ A;  4FW2 A;  4CJR A;  5BRD A;  1Q9Y A;  4DS4 A;  1N8R O;  1M1K O;  4JYA K;  2GEM A;  3CPW M;  4FVM A;  3QNN A;  3THW A;  2D0B A;  5FRO A;  4ZTF A;  4JNE A;  4JI6 K;  3TSQ A;  1LWF A;  2ZJP L;  5KQD A;  5TKY A;  4CEC A;  1L3V A;  4B9T A;  4O44 A;  1IJJ A;  3TAG A;  1BOT O;  3E9L A;  3NF6 A;  1KVC A;  2QWO A;  3CFR A;  4AM7 A;  4GKJ K;  5GAG P;  3V9X A;  3KK7 A;  5C2F A;  3OYI A;  1XWL A;  2HBK A;  4HCC A;  5JS1 A;  3OTO K;  3Q7C A;  1HQE A;  3P83 D;  3HO1 A;  3T7Z A;  2W6K A;  4WQ4 C;  4CES A;  4GMJ B;  4IG3 A;  2GEL A;  2IVO A;  3KWG A;  4E7L A;  5I3U A;  4QCL A;  3ULD A;  3I8D A;  2UXB K;  1RIL A;  2OPP A;  3TAN A;  4B3R K;  3IFR A;  1N36 K;  5EXW A;  3AVG A;  4N41 A;  1QSL A;  4PUO A;  3AO4 A;  3LP1 A;  1XMQ K;  4BR0 A;  1ZYQ A;  4PWD A;  5M1O A;  4RW8 A;  3L2R A;  1E3M A;  1EWR A;  4FJG A;  4B8C A;  3BEX A;  4A59 A;  3LZJ A;  4DV7 K;  2OTL N;  3O8M A;  3AA3 A;  1S72 N;  4WQ5 C;  4CEQ A;  4C8L A;  2A6A A;  4JD2 B;  5FRN A;  3PIP L;  3DLL L;  4BRK A;  4YHH K;  4CER A;  1HMV A;  4DSF A;  2P9U A;  4NLC A;  2P9P B;  3DLB A;  4DFJ A;  2YJE A;  3GG4 A;  1U04 A;  1XC3 A;  4EZ6 A;  4I2P A;  3ZEU A;  3MMV A;  3KVG A;  2GWJ A;  1WB9 A;  4DR3 K;  3M6G A;  4RWT A;  4MO4 A;  4M7Y A;  5FDL A;  1NBW A;  3O4Q A;  2VG6 A;  3CJ9 A;  1OH7 A;  4KHY A;  3AGK A;  4FJN A;  2FSK A;  3QB0 A;  5HRP A;  3NH1 A;  3LDP A;  2IAJ A;  3I33 A;  3P1G A;  3VEO A;  4CEO A;  4ID1 A;  4FLU A;  1NLV A;  2HF4 A;  3M5R A;  4JI5 K;  4I7F A;  3R6M A;  3MX2 A;  4DTX A;  3O9R A;  3OYM A;  4CHP A;  1RT2 A;  2DFF A;  1VAZ A;  3A5O C;  5AQJ A;  4B1V A;  4CED A;  4FWS A;  4FLV A;  4CJQ A;  2F96 A;  2UUB K;  4FZZ A;  4KKO A;  2GWK A;  4X62 K;  3QEV A;  4IEE A;  5AQS A;  4CZJ A;  4FJ8 A;  2NRR A;  2YV0 X;  1GOA A;  3ZSX A;  2RHK A;  1O1W A;  4CBX A;  5C12 A;  1K8K B;  3O4N A;  4BRL A;  3D2E A;  2PBD A;  4PHT X;  5DM7 L;  1VQ9 N;  1BQM A;  2WOM A;  4JRP A;  2ASO A;  3TI0 A;  4O8U A;  3LL3 A;  2I7P A;  5FRM A;  3DLE A;  1L3U A;  2NRW A;  2VGM A;  1T03 A;  3VET A;  3VQP A;  2IGI A;  3VQ9 A;  4DFM A;  1IKX A;  3KHY A;  3VEZ A;  1TV6 A;  2UU9 K;  3O1W A;  3AY9 A;  3HSC A;  4HHT A;  4CFB A;  3VA0 A;  4MFB A;  4FYD A;  4CZL A;  4PKI A;  2A42 A;  2ZGZ A;  4A61 A;  1HYZ A;  3ENB A;  1CZA N;  4KI6 A;  3ZT3 A;  4DTO A;  4FPB A;  3O1B A;  1D8Y A;  5H1S Q;  4GV9 A;  3L2V A;  3CCE N;  4X65 K;  3SPY A;  1VSF A;  1QQN A;  5LJW A;  4CHO A;  4Z4H A;  3DLK A;  4DU4 A;  1X9J A;  1QZ5 A;  4BC3 A;  3NDK A;  1Z05 A;  3J81 O;  4DQR A;  3QEI A;  4YOR A;  1BA1 A;  2EWS A;  4Q5V A;  1BIS A;  3LDQ A;  4IOX A;  3O3F A;  1X9S A;  2P9K A;  3D0P A;  3DXM A;  3GL1 A;  3AO3 A;  1WSH A;  4KHQ A;  3NF7 A;  3C94 A;  3C65 A;  4A57 A;  4PKG A;  4BRO A;  2YJF A;  4M7X A;  3ENH A;  1H1V A;  2FSN A;  1IG9 A;  3D2F B;  5AFU A;  5AQT A;  3W0L A;  2E20 A;  1VSK A;  2BTF A;  2I5J A;  3KLE A;  2P9I B;  3C6H A;  1YTU A;  2AJQ A;  3L3U A;  4IXC A;  1RBT A;  4FWL A;  3QNO A;  4CF0 A;  4LFA K;  1KAY A;  4IKF A;  1BDG A;  1WSE A;  2PZS A;  2J4R A;  4H0X B;  1TYQ A;  3QO9 A;  3U9Z A;  1X3M A;  5C10 A;  2VCP A;  5FLX O;  4DLE A;  3VGK A;  4RTF D;  3RTV A;  3KLH A;  4JI0 K;  1QSS A;  3J7Z O;  3U3Y A;  1JL2 A;  2G8U A;  4KO0 A;  1BG3 A;  1C1C A;  4DSI A;  1C0T A;  1IH7 A;  4LC9 B;  1WSJ A;  3G10 A;  5AFU H;  2Q2R A;  4DV1 K;  2E6M A;  5HLF A;  4B3O A;  4CJK A;  3TAB A;  2ASP A;  2F9W A;  3SBG A;  4GV3 A;  3L2Q A;  3EO3 A;  4CJT A;  1HQU A;  1RDA A;  3CHW A;  1BHL A;  2ZD1 A;  3JAM O;  2YKN A;  4OX9 K;  4NCA A;  3VQD A;  1SKW A;  3THV A;  3G71 N;  3O08 A;  3ASM A;  3EKU A;  5FPD A;  4C8O A;  1TGO A;  4DR6 K;  2HVH A;  4BR9 A;  1NU0 A;  1RT3 A;  1SL0 A;  4I2Q A;  3FE1 A;  1NM1 A;  1JCG A;  1JKH A;  1ZBL A;  2H3G X;  4IG0 A;  4XH1 A;  3JS6 A;  3V1Q A;  1LAW A;  3SQ4 A;  1IV0 A;  4AM6 A;  3BGR A;  4GVM A;  2WUS A;  4Z4I A;  1YJW N;  4E19 A;  3HBT A;  2HHV A;  3SJJ A;  2Z1H A;  4DV4 K;  4J8F A;  5AQF A;  3SQ0 A;  4OLB A;  5M1P A;  2XO7 A;  4BRP A;  3ITH A;  3OYA A;  2FXU A;  4BRQ A;  4FWK A;  2HMP A;  4CJP A;  3M1F A;  1LCU A;  4DQP A;  3M8S A;  2QXF A;  3C6T A;  3T1A A;  4B9M A;  3QLH A;  4JKB A;  4F4K A;  4LSL A;  5F1X A;  3A0I X;  3PIO L;  1NGE A;  3EL2 A;  1RBR A;  4Z4E A;  3KKR A;  3VER A;  3IKM A;  3OY9 A;  5GIN A;  3BUZ B;  3ISN C;  4ELV A;  1KVA A;  3QFP A;  5CY4 A;  5AQW A;  3CME N;  5C24 A;  3LDN A;  3TU5 A;  4RW9 A;  1GOC A;  5AQU A;  3BZK A;  2ZWH A;  3VES A;  5AQG A;  2XRI A;  4B1U B;  3MWT A;  4CE9 A;  5LL6 Z;  3L8B A;  4HTU A;  4OKK A;  2OCE A;  5FPE A;  5LY3 A;  2G8W A;  1FJG K;  1HX1 A;  1QQO A;  1Y97 A;  2QWN A;  1O13 A;  1EQY A;  1TVR A;  3DRS A;  3NHG A;  2VGN A;  2R7Y A;  1HKB A;  3WXJ A;  4K42 A;  4N56 A;  1XI1 A;  1X9M A;  2ZQB A;  5JS2 A;  5JVG L;  1JCE A;  3GDQ A;  5D3G A;  2VG7 A;  3MK6 A;  3MWP A;  4J2A A;  3BZC A;  5TKW A;  3SAF A;  4BDZ A;  3NMU A;  4ILH A;  2P9S A;  4B1X B;  2E2O A;  4JK8 A;  3DRR A;  1ZC6 A;  5BRF A;  2HHH K;  1BQN A;  5AZJ B;  1P90 A;  3MXJ A;  3LP2 A;  4ISG A;  2W6L A;  3CJA A;  4BAC A;  3HK2 A;  2YHB A;  1YJN N;  4H5T A;  4GV6 A;  1DTT A;  3ZCM A;  3DOK A;  4KFB A;  1YAG A;  3CMA N;  1TAQ A;  4KHU A;  1NGJ A;  4IJA A;  4FLZ A;  2QA4 N;  2QWM A;  1KLN A;  3ZT2 A;  2O8F B;  4CJS A;  4B3T K;  2EX3 A;  1C0G A;  1QVG M;  4BRF A;  3QIC A;  2FBX A;  3I56 N;  4W5Q A;  1B9D A;  1JXE A;  5CYM A;  3TAE A;  4QS7 A;  3DJC A;  4JHD B;  4ID5 A;  1V4S A;  1BUP A;  3V1R A;  1SUQ A;  4OGE A;  1C1B A;  5BN8 A;  1U2V B;  4B3S K;  3HZ6 A;  3RR8 A;  3HP6 A;  3QET A;  3PO5 A;  2DTU A;  1HKG A;  3TAR A;  1VSM A;  3OJS A;  1ZXO A;  1RDU A;  3ZX2 A;  4O0J A;  4B9L A;  5AQQ A;  3NVK A;  4QAG A;  3KD5 E;  3K2P A;  4JKG B;  4BGA A;  4PY5 A;  4BRA A;  2D5R A;  2OA8 A;  3PX0 A;  4E3S A;  1NK6 A;  1L3T A;  4NCG A;  3ZSZ A;  2Q1N A;  5M1F A;  1DT9 A;  4EP4 A;  4TSX A;  5AQR A;  3SAG A;  3O4W A;  5DK5 A;  1QTM A;  5CYQ A;  3VGL A;  3CCU N;  3A8Y A;  4ELU A;  3JYT A;  3CCJ N;  3WXL A;  1NOZ A;  3SMP A;  4EHT A;  1EX4 A;  2Z1G A;  3SPZ A;  3HP9 A;  4V19 S;  2F7T A;  5K14 A;  5KI6 A;  4LF9 K;  3OYH A;  2KTQ A;  3S3O A;  4H0O A;  3AAP A;  1RDB A;  2KLA A;  4DQI A;  2RPI A;  4DFK A;  3C7N B;  4JD2 A;  5C25 A;  3QER A;  1NK9 A;  2RN2 A;  3W3D A;  4DU1 A;  3O9T A;  4LF7 K;  1T6D A;  3AO1 A;  4FW1 A;  4NO7 A;  3QIO A;  1HUX A;  5DMR A;  2P9P A;  5JIC A;  2G8I A;  2PY5 A;  1S5J A;  1NGI A;  1JCF A;  5IT9 O;  1TKX A;  4M45 A;  4Y1C A;  4KTQ A;  1C6V A;  3J8A A;  3CC7 N;  2ZJQ L;  3VQ7 A;  4YOV A;  3KKS A;  3LAN A;  3CCM N;  1LW2 A;  4YOU A;  1ILY A;  2AP1 A;  2D0C A;  3RR7 A;  3SMS A;  4RG8 A;  3MEG A;  4RW7 A;  2QKK A;  3ATV A;  3OYK A;  4IFY A;  4PL7 A;  3ULE B;  2O8B B;  4YY3 K;  4FO0 A;  2YNI A;  4DWI A;  4CZK A;  2FBV A;  3LZI A;  3HVR A;  4BDY A;  1N34 K;  4H5R A;  3F9M A;  4DTS A;  2DFH A;  3FGU A;  3FFK B;  5CHI A;  5BPM A;  1B92 A;  1Q86 O;  2BGG A;  4K0K K;  3E1Y A;  4DS5 A;  3K58 A;  1IBM K;  3CG7 A;  1L3S A;  3LWM A;  2Q97 A;  4KAZ A;  5GIP A;  1HNW K;  4CZH A;  4NXM K;  4GY2 B;  4IO8 A;  4DTU A;  4A2A A;  2RKI A;  1NK7 A;  4JI8 K;  3MXM A;  3E01 A;  4M3X A;  4NXN K;  4N47 A;  1CZB A;  4RW6 A;  4FZX C;  1SKS A;  4FK4 A;  2HMI A;  3U6F A;  3OVN A;  1WSF A;  3CQY A;  4B1Z A;  1JLC A;  2OYQ A;  2V7Z A;  5AQX A;  5C15 A;  3K9K A;  3VEW A;  2BH1 A;  2V52 B;  4CHN A;  4CBU A;  2QWP A;  3T1H K;  4HVJ A;  4MO5 A;  3MDQ A;  2F8T A;  5JVH L;  1GOB A;  1SQK A;  5JLF A;  4Q0B A;  4B9Q A;  3IG1 A;  4HCB A;  4YNQ A;  1YIJ N;  4DTJ A;  1FKP A;  1KLM A;  3F2K A;  2PYL A;  1NGB A;  3L6Q A;  3T19 A;  4CK1 A;  1P8Z A;  3D2F A;  4WF9 L;  2GUP A;  3OS1 A;  3ZT1 A;  5HRO A;  4N76 A;  3AV9 A;  3ID6 A;  5KPT A;  2O8C B;  1KAZ A;  4LF4 K;  2KFZ A;  4NCB A;  3ZX3 A;  2E1Z A;  2HVI A;  3L2W A;  2QWL A;  1T6C A;  1BIZ A;  2P9L B;  4FM1 A;  4WQ4 A;  3MN7 A;  3PSI A;  3NGI A;  4FLY A;  3A2F A;  4J2B A;  4KB1 A;  4KB0 A;  2O8D B;  1VSH A;  4JLH A;  4B1Y B;  2F9T A;  2IVP A;  3NAE A;  1BO5 O;  3L4I A;  3CCS N;  1XHX A;  1C1A A;  3B6O A;  4M3Z A;  3RWU A;  3LDL A;  3SLC A;  4DV5 K;  1S6P A;  3VTH A;  5JLH A;  2ZJR L;  4ZHR A;  5I42 A;  4PL8 A;  3QEX A;  1XC9 A;  3N4Q A;  1HYS A;  1VQP N;  5J2N A;  3RMB A;  3AA2 A;  5FPM A;  4BR5 A;  1G99 A;  3E66 A;  1VSE A;  3P4I A;  3SQ2 A;  5BRE A;  3SI6 A;  2QWQ A;  2O8E A;  3U8X A;  4MQ3 A;  1U45 A;  1T7P A;  4WQ5 A;  4DSK A;  2E2P A;  4K43 A;  4EFH A;  3SV3 A;  1VQK N;  4E7J A;  3AVF A;  4BWJ A;  4E1J A;  5HBM A;  4CJU A;  3OYG A;  3J7A P;  4C8N A;  3THY B;  4KV8 A;  2GTD A;  3BDP A;  5GAD P;  4H0T B;  4E1M A;  4BC5 A;  5DM6 L;  1K6Y A;  1ZBH A;  1MWM A;  3H08 A;  4CGJ A;  3SUO A;  1T8E A;  4B8A B;  2RF2 A;  2YHA A;  4YFU A;  1NK5 A;  2E2Q A;  1EP4 A;  4PKH A;  1EWQ A;  3CJB A;  1ZBI A;  2QK9 A;  1I94 K;  3T1Y K;  1F21 A;  4HUG A;  3H46 O;  2WFB A;  4CFC A;  3G4S N;  5B8H A;  1RT5 A;  4Y1D A;  1HNZ K;  2FSJ A;  3VF6 A;  1BI4 B;  1TUY A;  1ATR A;  1NJI O;  3K5O A;  1OVY A;  3LM9 A;  1RDW X;  3FZH A;  4DQ8 A;  3TPQ A;  3UE5 A;  3H3N O;  1NMN A;  3HPH A;  4LH4 A;  1Y64 A;  1HKC A;  1E4G T;  3WXI A;  2Y1I A;  4CI6 A;  4EIA A;  1S1U A;  4Z0U A;  4OVL A;  2NLX A;  2KFN A;  1NMD A;  4RCH A;  1LWE A;  3ZSV A;  4DV3 K;  4GKK K;  1SV5 A;  4IWV A;  5AQL A;  3RSE B;  3RMC A;  4AHT A;  5J2Q A;  3D6R A;  4DG1 A;  4MDA A;  5BPL A;  1KFS A;  1OVQ A;  4GW6 A;  4I9L A;  3OJU A;  1RTD A;  4JI3 K;  3I0S A;  1VQO N;  1YF5 L;  4KRF A;  1QS4 A;  4DSJ A;  5GAH P;  3VEX A;  4J2E A;  4CEZ A;  3HTV A;  3OYF A;  3RMA A;  4FJL A;  4XH4 A;  3DAW A;  3LAL A;  4CJ5 A;  1KFD A;  3CET A;  5J2P A;  3O3H A;  4FLT A;  2UYT A;  1XMO K;  3UKR A;  1C0M A;  5AQM A;  3CC4 N;  4DR5 K;  1GLA G;  2BAN A;  4GNI A;  2VWK A;  4F3O A;  4C8K A;  3ZLJ A;  4B9N A;  4JAX A;  3QEW A;  1GLJ O;  5AZI B;  2HF3 A;  3R8E A;  3MAQ A;  2G8H A;  1DLO A;  3VQ6 A;  3O9U A;  3OYL A;  3IMX A;  3U4L A;  3V9Z A;  5BRH A;  5E26 A;  1VHX A;  1KQS M;  5AZJ A;  4YOT A;  1OH8 A;  4QOZ B;  1FKO A;  4WCE L;  1IG8 A;  3AVH A;  1CLQ A;  4DQQ A;  2QTD A;  5BPN A;  4N5S A;  3PO4 A;  3UKU A;  3O3G A;  4ELT A;  1NNE A;  4WE1 A;  2GBZ A;  3M3Z A;  5M1N A;  2QW9 A;  3WNF A;  2HND A;  1ASV A;  4IFE A;  4ISE A;  3WQU A;  1ASW A;  1GLD G;  2WON A;  1VQL N;  1R59 O;  1NK4 A;  2A5X A;  4U67 L;  4CVN E;  1REV A;  1BCM A;  4H0Y B;  1XNR K;  1TL3 A;  3QBX A;  3KK3 A;  3VQB A;  3DWL A;  2Y1J A;  1YHQ N;  2HBL A;  1BGX T;  4A62 A;  3SK3 A;  2QI2 A;  1D9F A;  1W0H A;  4KH4 A;  3EEQ A;  2E6L A;  5HRN A;  3VA3 A;  4JHD A;  1S1W A;  2PFU A;  2W41 A;  3QIP A;  4JI1 K;  5HRS A;  3CFO A;  1ZBF A;  2B6A A;  1WOQ A;  4CEF A;  3HM8 A;  3D2E B;  3AO5 A;  2HBJ A;  2YHW A;  4K8X A;  1HPZ A;  3H3O B;  3K5N A;  3VEN A;  4CCH A;  2EHG A;  1U2V A;  3JSM A; 
#chains in the Genus database with same CATH homology
 4B9T A;  4O44 A;  5KGX A;  3OYB A;  2G8K A;  3SCX A;  4KHS A;  3HL8 A;  3RR8 A;  3TAG A;  3HP6 A;  3EYZ A;  5J1E A;  3I0R A;  3QET A;  2JGU A;  3MEE A;  3PO5 A;  2DTU A;  3NF6 A;  4BE1 A;  1KVC A;  1VSM A;  5KTQ A;  4OKJ A;  3OJS A;  3CFR A;  3TAR A;  4E7I A;  4E0D A;  3V9X A;  4O0J A;  1U4B A;  4B9L A;  3OYI A;  1XWL A;  3KLI A;  4QAG A;  3KD5 E;  3K2P A;  4PY5 A;  4HCC A;  3VQA A;  5JS1 A;  2D5R A;  2OA8 A;  3PX0 A;  4E3S A;  1HQE A;  3P83 D;  1NK6 A;  1L3T A;  3HO1 A;  4NCG A;  4KTZ A;  2KQ2 A;  4CES A;  4GMJ B;  3ZSZ A;  1RT6 A;  1BCO A;  4IG3 A;  2A1S A;  4EP4 A;  2IS3 A;  4DU3 A;  4G1Q A;  4E1N A;  4E7L A;  4LSN A;  3LWL A;  4TSX A;  5I3U A;  2E4L A;  4QCL A;  5DK5 A;  3KK2 A;  1QQC A;  5CYQ A;  3ULD A;  3I8D A;  1QTM A;  1RIL A;  2OPP A;  1IKV A;  4UQG A;  4ELU A;  3JYT A;  3TAN A;  2XHB A;  1NOZ A;  2DY4 A;  3AVG A;  1EX4 A;  2Z1G A;  4E89 A;  3SPZ A;  3HP9 A;  4LY7 A;  4N41 A;  3V9W A;  1X9W A;  1RBS A;  1QSL A;  5K14 A;  5KI6 A;  4PUO A;  3AO4 A;  4PQU A;  1S6Q A;  1U47 A;  1NKC A;  3LP1 A;  3OYH A;  2KTQ A;  3S3O A;  2XY8 A;  3NFA A;  3V4I A;  1VSI A;  3PY8 A;  1RDB A;  1ZYQ A;  4M3W A;  4DQI A;  2RPI A;  4PWD A;  3AVN A;  4RW8 A;  3L2R A;  4DFK A;  1J5O A;  4FJG A;  5C25 A;  1RDC A;  3QER A;  4B8C A;  4CHQ A;  2RN2 A;  1NK9 A;  3LZJ A;  4DU1 A;  3ZT0 A;  3OS0 A;  2XY5 A;  3SUP A;  3AA3 A;  3AO1 A;  4CEQ A;  4C8L A;  4FW1 A;  3KIO A;  3QIO A;  5DMR A;  1XHZ A;  3NGZ A;  5FRN A;  2G8I A;  2PY5 A;  1S5J A;  4E7K A;  4KPY A;  1TKX A;  4M45 A;  4CER A;  1JLF A;  3V6D A;  5KGW A;  1HMV A;  4DSF A;  4E7H A;  3F73 A;  4H4M A;  4Y1C A;  3M8R A;  3DLB A;  3DM2 A;  1VSL A;  2LSN A;  1C6V A;  3IRX A;  1U04 A;  4DFJ A;  1NK7 A;  4KTQ A;  5CZ1 A;  4O55 A;  4EZ6 A;  4M41 A;  2O4G A;  3VQ7 A;  4OGC A;  4I2P A;  3ZSQ A;  1JXB A;  3KKS A;  1NJW A;  4FK2 A;  1HNI A;  4Z4G A;  3LAN A;  1LW2 A;  1KRP A;  1BIU A;  1TKT A;  2D0C A;  3RR7 A;  4RG8 A;  3MEG A;  3EZ5 A;  1WSG A;  4RW7 A;  3KJV A;  2QKK A;  3WNE A;  1HYV A;  5FDL A;  3O4Q A;  3OYE A;  2GUI A;  2VG6 A;  3OYK A;  1KSP A;  3DI6 A;  4IFY A;  4KHY A;  3LPT A;  4FJN A;  1TAU A;  5HRP A;  3NH1 A;  1FXX A;  3VN5 A;  3KK1 A;  2IAJ A;  2YNI A;  3P1G A;  3K5L A;  4DWI A;  2HNZ A;  4CEO A;  1Q8I A;  4ID1 A;  4FLU A;  2FBV A;  3LZI A;  3HVR A;  4FJ9 A;  4KTW A;  4BDY A;  4I7F A;  4FLX A;  5KRS A;  4DTX A;  3WNG A;  2W42 A;  4DTS A;  1WAJ A;  2F8S A;  4CIF A;  4CHP A;  3OYM A;  2IC3 A;  3NH0 A;  2B4J A;  1RT2 A;  3NBP A;  4O0I A;  3QIN A;  2DFF A;  1RNH A;  2DFH A;  2HHQ A;  2YNF A;  1IKW A;  4DTM A;  4CED A;  3DYA A;  1B92 A;  4CJQ A;  4FLV A;  2F96 A;  4Z4F A;  4FZZ A;  4KKO A;  4K8Z A;  4C8M A;  3AVC A;  3K59 A;  3QEV A;  2BGG A;  1S9E A;  4DS5 A;  3K58 A;  1I3A A;  3CG7 A;  1N5Y A;  3LAK A;  3K57 A;  4DTN A;  4NYF A;  1NJX A;  1L3S A;  4FJ8 A;  3ZSY A;  2YV0 X;  1GOA A;  4DMN A;  4HUF A;  5E41 A;  3LWM A;  1Z25 A;  4KAZ A;  4DSL A;  4FLW A;  3ZSX A;  1VK0 A;  1O1W A;  4F8R A;  2BE2 A;  1A5X A;  3O4N A;  4DLG A;  3S3M A;  4W5R A;  1J54 A;  4CGH A;  4DTU A;  1BQM A;  1S1T A;  2RKI A;  2WOM A;  2X74 A;  1WSI A;  2Z1I A;  4OPJ A;  3VQ8 A;  4JRP A;  3TI0 A;  3LAM A;  3E01 A;  1MU2 A;  3LP3 A;  2A1R A;  1JL1 A;  5FRM A;  4M3X A;  3TAF A;  2YKM A;  3DLE A;  2YNH A;  1L3V A;  1L3U A;  4CJ3 A;  4N47 A;  1T03 A;  1CZB A;  4RW6 A;  1BL3 A;  2IGI A;  3VQ9 A;  3VQP A;  5CZ2 A;  4CIE A;  4DFM A;  3SQ1 A;  1SKS A;  1IKX A;  4FK4 A;  4HUE A;  2HMI A;  3U6F A;  1TV6 A;  3OVN A;  2ATQ A;  1Z26 A;  3CQ8 A;  1TK5 A;  1WSF A;  4HHT A;  3T3F A;  4CFB A;  2OZS A;  2HHW A;  3VA0 A;  1JLC A;  4MFB A;  1NOY A;  2G8V A;  2OYQ A;  4DFP A;  4BE2 A;  4FYD A;  1RTJ A;  4EZ9 A;  4CGD A;  1HYZ A;  2Z1J A;  2P5O A;  4CHN A;  1I39 A;  1HJR A;  2VWJ A;  4KI6 A;  3ZT3 A;  4HVJ A;  3WNH A;  4I9Q A;  4DTO A;  1RT1 A;  3NH2 A;  3HVT A;  1G15 A;  3OS2 A;  2F8T A;  4FXD A;  2O4I A;  1D8Y A;  1GOB A;  3QEP A;  2HHT A;  3L2V A;  4Q0B A;  4M3Y A;  3SPY A;  1D5A A;  3IG1 A;  4HCB A;  1VSF A;  4YNQ A;  4CHO A;  3MEC A;  2FBY A;  3DLK A;  4Z4H A;  4DU4 A;  4M3U A;  5KRT A;  2GV9 A;  3NDK A;  4DTJ A;  4F2S A;  4JRQ A;  4CFD A;  1NK8 A;  4IBN A;  4DTP A;  3PX6 A;  4DQR A;  1JLA A;  1VRT A;  3QEI A;  1QE1 A;  1ZBU A;  1FKP A;  1KLM A;  4Q5V A;  1BIS A;  4JS5 A;  3F9K A;  3O3F A;  1X9S A;  2PYL A;  1S1X A;  3D0P A;  3T19 A;  4CK1 A;  3CFP A;  3AO3 A;  1WSH A;  4Z4C A;  4KHQ A;  3NF7 A;  3OS1 A;  1NJZ A;  3C94 A;  3RMD A;  4FZX C;  3RRG A;  1LW0 A;  4F2R A;  4FJ5 A;  3MXM A;  4OKE A;  3ZT1 A;  5HRO A;  1IG9 A;  4LD0 A;  1CZ9 A;  3AV9 A;  4N76 A;  2PYJ A;  3KLG A;  1VSK A;  2I5J A;  3KLE A;  2KFZ A;  3KD1 E;  1IKY A;  4KRE A;  2P1J A;  3ZSW A;  4NCB A;  1YTU A;  2AJQ A;  4W5N A;  2FC0 A;  3L3U A;  3NF9 A;  2HVI A;  4IFV A;  4CGI A;  1RBT A;  5C42 A;  3L2W A;  3DLH A;  3QNO A;  4CF0 A;  1D9D A;  2ETJ A;  3L2U A;  4NYN A;  1BIZ A;  3HJF A;  4FM1 A;  4IKF A;  3NGI A;  1WSE A;  4FLY A;  2P5G A;  1JLB A;  3A2F A;  1Q9X A;  2PZS A;  4AHV A;  4J2B A;  4AHS A;  4M3T A;  3QO9 A;  3G0Z A;  1JLG A;  4KB1 A;  4J2D A;  3AVK A;  1RT4 A;  4KB0 A;  1VSH A;  4R5P A;  3AA5 X;  4DLE A;  1A5W A;  4JLH A;  3ZSO A;  2IOC A;  3UIQ A;  4FJH A;  3NAE A;  3RTV A;  3KLH A;  3C6U A;  5EU7 A;  1QSS A;  3IS9 A;  1XHX A;  1C1A A;  3U3Y A;  1JL2 A;  1J53 A;  3B6O A;  1UOC A;  4CGF A;  2OZM A;  4M3Z A;  3RWU A;  3SV4 A;  2G8U A;  4KO0 A;  3V81 A;  2XY6 A;  4OLA A;  1S6P A;  1C1C A;  3ALY A;  4LH5 A;  4DSI A;  1C0T A;  4ZHR A;  5I42 A;  1IH7 A;  3QEX A;  1XC9 A;  2X6N A;  1WSJ A;  1HYS A;  5J2N A;  3RMB A;  3AA2 A;  2OPS A;  3G10 A;  4O4G A;  4M42 A;  4XIU A;  3AVJ A;  1NK0 A;  2E6M A;  5HLF A;  1RDD A;  3LPU A;  1RT7 A;  1VSE A;  4AHU A;  3SQ2 A;  3SI6 A;  3OYC A;  1U45 A;  4MQ3 A;  1T7P A;  4B3O A;  4CJK A;  3TAB A;  1S9G A;  1YT3 A;  4DSK A;  2IDO A;  4CJV A;  3L2Q A;  2VG5 A;  3VQ4 A;  4CEE A;  4CJT A;  3SV3 A;  1HQU A;  3AVI A;  4E7J A;  1RDA A;  3AVF A;  4BWJ A;  1BHL A;  5HBM A;  4CJU A;  3OYG A;  3VQC A;  2ZD1 A;  4M3R A;  4DTR A;  3MXI A;  4L8R B;  4BDP A;  4C8N A;  1QHT A;  2YKN A;  4AHC A;  1SL1 A;  4KV8 A;  4NCA A;  3VQD A;  1SKW A;  3THV A;  3BDP A;  3ASM A;  3TWH A;  3M8Q A;  4E1M A;  1YVU A;  3OYN A;  1KCF A;  3VQ5 A;  3AO2 A;  4C8O A;  1K6Y A;  1TGO A;  1ZBH A;  2HVH A;  2B5J A;  3H08 A;  4CGJ A;  3PX4 A;  3SUO A;  1TKZ A;  1T8E A;  3TAQ A;  4B8A B;  1RT3 A;  4O5B A;  4BE0 A;  1DTQ A;  2RF2 A;  2YHA A;  4I2Q A;  3VQQ A;  3AA4 A;  4YFU A;  1EP4 A;  1W9H A;  1NK5 A;  1SL0 A;  3DLG A;  4PA1 A;  2QK9 A;  4W5T A;  1ZBI A;  1NKE A;  3LP0 A;  1ZBL A;  1JKH A;  4FM2 A;  1F21 A;  4HUG A;  1BI4 A;  4FJM A;  4F3T A;  4IG0 A;  1LAV A;  1UAX A;  1KTQ A;  4CFC A;  3C95 A;  3V1Q A;  4CGG A;  1LAW A;  1RT5 A;  3PUF A;  4Y1D A;  3V9S A;  3SQ4 A;  3SNN A;  2QKB A;  2KZZ A;  3BGR A;  4GVM A;  1BI4 B;  5HP1 A;  4Z4I A;  4CJL A;  4FZY A;  4CK3 A;  3K5O A;  4E19 A;  1RBU A;  4DF8 A;  3HPG A;  1RTH A;  3AVM A;  5J2M A;  3SJJ A;  2HHV A;  2Z1H A;  4CJ4 A;  3SQ0 A;  4B08 A;  4CF9 A;  4OLB A;  2XO7 A;  2Q3S A;  2FBT A;  4CHZ A;  3ITH A;  3OYA A;  1VRU A;  3HXM A;  2X78 A;  3L3V A;  2D0A A;  3NCI A;  1EET A;  4ICL A;  4FJK A;  3HPH A;  3QES A;  4LH4 A;  3S9H A;  4CJP A;  4H4O A;  2HHX A;  3TR8 A;  1NJY A;  4DQP A;  3NE6 A;  3M8S A;  1EKE A;  2QXF A;  2Y1I A;  3C6T A;  4KHN A;  3T1A A;  1VSJ A;  1S1U A;  4Z0U A;  5HRR A;  3ZSR A;  3QLH A;  4B9M A;  4CHY A;  1J9A A;  4OVL A;  3DOL A;  3EY1 A;  3P5J A;  4LSL A;  3D45 A;  4F4K A;  2KFN A;  1WAF A;  2P51 A;  1TKD A;  1LWE A;  1IO2 A;  2DFE A;  1VSD A;  3ZSV A;  3AVB A;  3LDS A;  1RBR A;  3CM5 A;  1FK9 A;  1U48 A;  4CEA A;  4Z4E A;  3KTQ A;  1SV5 A;  3KKR A;  1HNV A;  3DMJ A;  3RMC A;  4AHT A;  3AVA A;  3OY9 A;  5J2Q A;  3V9U A;  1LV5 A;  3ISN C;  4DG1 A;  2ITG A;  4CJW A;  1KVA A;  5CY4 A;  1QSY A;  4ELV A;  2HW3 A;  5C24 A;  4RW9 A;  1GOC A;  1KFS A;  4I9L A;  4GW6 A;  3OJU A;  1RTD A;  2XRI A;  3HPO A;  3K5M A;  4CE9 A;  1A5V A;  3I0S A;  3IAY A;  3B6P A;  1L5U A;  1RCH A;  4KRF A;  3HM9 A;  1QS4 A;  4DSJ A;  3L8B A;  1UWB A;  4OKK A;  3NGY A;  4HTU A;  4J2E A;  4DSE A;  4CEZ A;  3OYF A;  2HHS A;  3RMA A;  5SWM A;  2HB5 A;  4FJL A;  4CF1 A;  1ITG A;  3LAL A;  4CF8 A;  4CJ5 A;  4IDK A;  2G8W A;  3MED A;  1KFD A;  2OPR A;  3DLR A;  1EXQ A;  5J2P A;  1UA1 A;  1Y97 A;  3O3H A;  4FLT A;  3DRP A;  3ZT4 A;  1C0M A;  4CEB A;  4B9U A;  1TVR A;  3DRS A;  3NHG A;  2BAN A;  3S3N A;  4BWM A;  2R7Y A;  3V1O A;  1XI1 A;  2KW4 A;  4N56 A;  1X9M A;  2ZQB A;  1TL1 A;  5JS2 A;  1C0U A;  2VWK A;  4F3O A;  4C8K A;  1X1P A;  4W5O A;  1RTI A;  3CYM A;  1B9F A;  4B9N A;  3QEW A;  3HST B;  4CFA A;  3MAQ A;  5D3G A;  2VG7 A;  2G8H A;  1WN7 A;  1DLO A;  1SL2 A;  2YNG A;  3VQ6 A;  4AIL C;  3OYL A;  4J2A A;  3V9Z A;  1TK8 A;  3NF8 A;  4BDZ A;  3SZ2 A;  2NUB A;  1T05 A;  1YTA A;  4QOZ B;  1FKO A;  1ASU A;  4ZTJ A;  3OYD A;  4B9V A;  4FJJ A;  3DRR A;  4FJX A;  1UA0 A;  1JLE A;  2BDP A;  1WNS A;  3SYZ A;  1BQN A;  3PV8 A;  3AVH A;  4CF2 A;  1CLQ A;  2XY7 A;  3MXJ A;  3LP2 A;  1KVB A;  4DQQ A;  3SUQ A;  3HT3 A;  4N5S A;  3PO4 A;  3O3G A;  4FK0 A;  1LWC A;  4ELT A;  1HRH A;  4WE1 A;  2GBZ A;  4B9S A;  3OYJ A;  3WNF A;  2HND A;  1ASV A;  4CIG A;  5T7B A;  4BAC A;  2KZM A;  4FM0 A;  3HK2 A;  1ASW A;  4FJI A;  2ZE2 A;  3TAP A;  2WON A;  2YHB A;  4OPK A;  3HYF A;  4CK2 A;  1N6Q A;  4OJR A;  1DTT A;  3ZCM A;  1NK4 A;  4H8K A;  3DOK A;  4FCY A;  4CJE A;  1REV A;  3SUN A;  1BCM A;  4KFB A;  1JLQ A;  2HHU A;  1S1V A;  3M8P A;  1NKB A;  3CM6 A;  1TL3 A;  1TAQ A;  3TAM A;  4KHU A;  2HNY A;  4CJF A;  4RW4 A;  3KK3 A;  4FLZ A;  1KLN A;  4AH9 A;  2G8F A;  1TK0 A;  3ZT2 A;  3VQB A;  2JLE A;  3KLF A;  2Y1J A;  3RRH A;  1WLJ A;  1BGX T;  4CJS A;  4DF4 A;  2EX3 A;  1R0A A;  1U49 A;  1D9F A;  3VQE A;  1W0H A;  1RBV A;  4JS4 A;  5HRN A;  2E6L A;  2FBX A;  3VA3 A;  5SZT A;  1CXQ A;  4W5Q A;  1S1W A;  4FW2 A;  4EP5 A;  4CJR A;  1B9D A;  1Q9Y A;  2OPQ A;  1JXE A;  2X6S A;  5CYM A;  3QIP A;  3U3G A;  5HRS A;  4DS4 A;  3CFO A;  3TAE A;  4FJ7 A;  1ZBF A;  2B6A A;  4CEF A;  4KI4 A;  4AHR A;  4FVM A;  3AO5 A;  3QNN A;  4K8X A;  2D0B A;  4DQS A;  5FRO A;  1HPZ A;  3K5N A;  4ID5 A;  4ZTF A;  4CCH A;  1CXU A;  4KHW A;  2EHG A;  3V1R A;  3JSM A;  1SUQ A;  1LWF A;  3AVL A;  1C1B A;  4OGE A;  4CEC A;  3FFI A;  1SKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...