2E4LA

Thermodynamic and structural analysis of thermolabile rnase hi from shewanella oneidensis mr-1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
b'LKLIHIFTDGSCLGNPGPGGYGIVMNYKGHTKEMSDGFSLTTNNRMELLAPIVALEALKEPCKIILTSDSQYMRQGIMTWIHGWKKKGWMTSNRTPVKNVDLWKRLDKAAQLHQIDWRWVKGHAGHAENERCDQLARAAAEANPTQIDTGYQAES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Structural, thermodynamic, and mutational analyses of a psychrotrophic RNase HI.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2e4lA00
4QCLA 4E1MA 1EX4A 1S6QA 3NHGA 4JS4A 5T7BA 4BDYA 3NF9A 1F21A 3VA0A 4M3WA 1QTMA 4B9VA 4CF9A 1ASWA 4MFBA 3V9ZA 4KHUA 4EP4A 3L2QA 2P5GA 5SWMA 3S3OA 3QEXA 1L5UA 4Z4FA 4CCHA 1ZBIA 3SQ0A 1BQMA 4CEBA 4O4GA 5HRRA 1C0UA 1RDDA 4FW1A 4RW6A 4CF8A 1XHZA 2KZZA 1S1TA 3AVKA 2IAJA 4CFDA 4FJIA 1X9WA 3BGRA 4KHWA 3KIOA 4CJRA 1G15A 3KTQA 3LAKA 4CERA 3P83D 3IS9A 1BHLA 4CHPA 1C0TA 4CGJA 3MAQA 4DTSA 3BDPA 4FK0A 2VG5A 1YT3A 3CYMA 4M45A 3NGZA 4N41A 4J2BA 3L3VA 3OYMA 4E7JA 1NJYA 5FDLA 4H4OA 1TAUA 1UA1A 3PUFA 4CK3A 3O3FA 1QSYA 4KPYA 4ELVA 4AHVA 3AO4A 5I42A 2G8VA 2YNIA 3C94A 1JXEA 2B5JA 2LSNA 3ZT4A 2I5JA 3KLHA 4J2AA 4N47A 1B92A 1BISA 1ITGA 1MU2A 2PZSA 2IGIA 2X78A 4E7LA 1JKHA 4H4MA 4KFBA 1EP4A 4AHTA 4CK2A 4ELUA 1TAQA 4CJPA 3VQQA 3OYIA 1HMVA 4DTOA 3OYLA 3SQ1A 2RKIA 2YHBA 3ZT0A 1TGOA 1CLQA 3HYFA 1ZBFA 1SL2A 1VSJA 4DQSA 3TAEA 5HRNA 3SUQA 1HRHA 4FLWA 1RBRA 4F2RA 2HNDA 3ZSXA 1D8YA 4J2EA 4M42A 3DYAA 1J9AA 3LP0A 1NK9A 4OGCA 4CIGA 4IKFA 1DTQA 1VSFA 4KB0A 4KTZA 3RMCA 4DTMA 4O44A 3AVJA 3DRRA 1LWEA 4B9SA 4LH5A 2WOMA 1KVCA 3LDSA 3AVAA 3HSTB 4RW8A 1U47A 4CE9A 1B9FA 1BGXT 4K8ZA 1KTQA 3IRXA 5SZTA 1FK9A 1XWLA 1LW2A 4KTWA 4DSFA 1JL2A 4DFJA 2Z1GA 4I9QA 3K57A 4PUOA 3SV4A 1BI4B 4GW6A 3O3GA 1UOCA 4Y1CA 4J2DA 3NF6A 3NF8A 5DMRA 1SUQA 4DTPA 1LW0A 2QXFA 4CJKA 4HHTA 3KKRA 3AVHA 4OJRA 4DG1A 2B4JA 4AHRA 4ICLA 4ZHRA 4CHYA 1RILA 3ZT2A 1WSGA 4W5QA 1VSKA 4E89A 1UA0A 4IBNA 2Z1JA 4AHCA 2ITGA 5EU7A 2G8IA 1VRUA 2G8HA 2PYLA 3ZT3A 4DSLA 2YHAA 3VQAA 4B9LA 3D45A 4M3ZA 1IKYA 4IFVA 2VG7A 3TAGA 3S9HA 1BQNA 4DFKA 4I7FA 2VWJA 3OYDA 5J2PA 1ZYQA 2P5OA 4FJ9A 4CHZA 3OYEA 3HT3A 3RTVA 3QEVA 4C8LA 4KAZA 3HPOA 4KKOA 3CFRA 1BI4A 1IKXA 4FLTA 3SV3A 1NOZA 5J2QA 1D9FA 3RRHA 4B9MA 4LD0A 1HNVA 1WSJA 2DFEA 4CEQA 1VSMA 1RTJA 4RW9A 3TI0A 3QO9A 4EP5A 1TL3A 3OYBA 4KHYA 3MXMA 1CZ9A 1IKVA 1W9HA 4I2QA 3T19A 4CFAA 3SJJA 3S3NA 4JRQA 2HNZA 3F73A 3AVCA 4C8KA 4FLZA 4CEDA 3JYTA 3LZIA 4BDPA 2D0CA 4CJUA 3QEWA 3THVA 4DF8A 4DLGA 3NE6A 2RPIA 1XHXA 4DTNA 1S9GA 4OKEA 4BE1A 3DOLA 4N56A 4N5SA 3RRGA 3EZ5A 2HHSA 1LAVA 5KI6A 3L8BA 3CFPA 4E7KA 1B9DA 1REVA 4CJQA 2YNFA 1RTHA 3RR8A 3VQEA 4KREA 2AJQA 3QERA 4FZZA 1D5AA 1T03A 2RF2A 3MEDA 4ZTJA 1RTIA 4IDKA 1N5YA 1UAXA 4FJJA 5E41A 2X74A 3MXIA 4OLBA 4HCBA 4B9TA 4DU1A 3H08A 3O4QA 1NK6A 3NBPA 1JXBA 1L3VA 3OYGA 1WSEA 3WNEA 3K5MA 3AA5X 3QLHA 3OYAA 4DTUA 3TANA 2OA8A 4FJ7A 2Z1HA 1J54A 4N76A 5KRSA 3QIPA 3OVNA 3KK1A 3HVTA 4FJ5A 4CEOA 2X6SA 4QOZB 2BE2A 4JS5A 1Q9YA 3NH1A 1QQCA 1WAFA 4FZXC 1RDCA 4DS5A 1SV5A 4OPKA 3CQ8A 4CJ4A 2FBXA 1NK0A 4M3YA 3V1OA 3OY9A 2FBVA 3VQ8A 3ZSRA 1TVRA 1HJRA 2YV0X 4M3TA 4CJTA 2X6NA 2XY6A 1FKPA 3V1QA 2OYQA 3ULDA 2F8SA 3B6OA 4DU4A 3SUOA 2QKBA 1QE1A 1RNHA 3VQ6A 4DMNA 2HW3A 1I3AA 4CF0A 5CZ2A 4CIFA 5KTQA 2XO7A 1KFDA 5K14A 1TK0A 1BIZA 3VQPA 4DWIA 4LH4A 4CGDA 5C25A 4BE2A 3C95A 3RMBA 4B9NA 4C8MA 1KCFA 3LPTA 3SUPA 2G8FA 4FZYA 1D9DA 3VQ5A 1RT4A 4BDZA 4DS4A 2HHVA 2Y1JA 3I8DA 1SKRA 4XIUA 4F3TA 4FLVA 4B3OA 1VSIA 1VSDA 1TL1A 2EHGA 4FCYA 3PY8A 2BANA 4Z4GA 4HUGA 1Z25A 1C6VA 3SCXA 4OPJA 4B8AB 3SNNA 1IH7A 3NFAA 3DLHA 1DLOA 3ASMA 1S6PA 1UWBA 3QNOA 5FRNA 2GBZA 4CJFA 3K5OA 4CEZA 4DU3A 4Y1DA 3VQDA 5HRSA 2E6LA 1NKCA 4PA1A 1RBTA 4DTXA 3PO5A 3DLRA 2OPSA 4HUFA 4M3UA 3HVRA 4LSNA 4B9UA 4CJVA 5HROA 4M3RA 4DLEA 1Q9XA 4KRFA 2D0BA 1LV5A 2HHWA 3IAYA 1T8EA 5I3UA 4CGHA 2F8TA 3TAMA 3WNGA 1GOCA 3AVLA 4AH9A 4CIEA 3ZSVA 4OLAA 4O0JA 1RBUA 2YKMA 4BWMA 1R0AA 3AA3A 3V4IA 3HL8A 3OYNA 3PX6A 1IG9A 5J2MA 1A5VA 1VSLA 3NAEA 3LZJA 1XC9A 3CM5A 4DQRA 4FJ8A 3QIOA 1ASUA 3OJUA 3DLKA 3OS2A 2XHBA 1KVBA 2WONA 3K58A 1BCMA 3AA4A 2RN2A 2HHTA 3P5JA 4M41A 3SQ4A 4Z4EA 1CXUA 1C0MA 3U3GA 2YKNA 3OJSA 4E7IA 1RBVA 3KK3A 2FC0A 2BDPA 2HVHA 4FM0A 2FBTA 2KFNA 2NUBA 1A5XA 1JLFA 1LWCA 4LSLA 4NCGA 3T1AA 3ZT1A 3AO5A 1NJWA 2ZD1A 1KRPA 4K8XA 3DI6A 4FK2A 3TWHA 3DM2A 1BL3A 1J53A 2IC3A 1KLNA 5KRTA 1Y97A 4WE1A 4F2SA 4HTUA 1HPZA 4Q5VA 3QEPA 4OKJA 2D5RA 4EZ9A 1RT1A 3KLGA 3MECA 5CY4A 3U3YA 1KLMA 3AA2A 3VQBA 4M3XA 1EXQA 3V6DA 1O1WA 1T05A 3M8PA 4DFMA 4FJKA 1JL1A 4CF2A 4CEAA 1FXXA 4CJSA 4DTJA 4FLYA 1TV6A 3AV9A 1HYSA 4CHOA 4CEEA 1HYVA 3HM9A 4AILC 3OS1A 1YTAA 1ASVA 2GUIA 3F9KA 4O5BA 4JLHA 1L3SA 4NYFA 2JLEA 2Q3SA 3ALYA 2HMIA 5FROA 1U45A 4FXDA 1U48A 3LAMA 3KLEA 2KFZA 5C24A 3D0PA 2EX3A 4FM1A 2VWKA 3T3FA 4CGGA 2ETJA 3HP6A 4O0IA 4GMJB 4KHSA 3HK2A 4FVMA 4KO0A 3ZSOA 4CFCA 1NK4A 5FRMA 4ID5A 3C6UA 4CGIA 3ZSQA 3QETA 1SL1A 4DTRA 4KB1A 3ISNC 3SUNA 1HQUA 3HJFA 3AVGA 3NF7A 2KTQA 2DFFA 3DLGA 1QS4A 1I39A 2E6MA 4Z0UA 1NKEA 4DQIA 1S9EA 4O55A 3SPZA 3V9SA 1RT6A 3TAFA 3LP2A 3DRPA 4CESA 4FJNA 3LP1A 3TR8A 4W5TA 3AO2A 3B6PA 3FFIA 4DSKA 4W5RA 1LAWA 4NYNA 2OZSA 3PX4A 1EKEA 5D3GA 2IOCA 3K2PA 1SKSA 1ZBUA 2XY8A 3K5NA 3PX0A 3LP3A 3ZSYA 4B8CA 4E3SA 4CHNA 2DFHA 3CG7A 1SL0A 4PQUA 1GOAA 1EETA 3VQCA 2B6AA 1YTUA 3OYCA 2KW4A 1U49A 3KD1E 3NGIA 3KD5E 1WAJA 3M8QA 1WNSA 3DMJA 4TSXA 1VSHA 3EYZA 2OPPA 2XRIA 3RR7A 1RT2A 3HPGA 2XY7A 3ITHA 3HXMA 4CECA 1TKZA 1LWFA 1WSIA 3WNHA 2DTUA 1CXQA 2HNYA 3VQ7A 3CM6A 5KGXA 4Z4IA 4KTQA 1C1BA 4CK1A 4HUEA 2KZMA 1JLGA 3O3HA 2VG6A 4B08A 3AVMA 2OZMA 1S5JA 1X1PA 3U6FA 4NCAA 3DOKA 4G1QA 3NDKA 4CJEA 3OYJA 4QAGA 4RG8A 2HHXA 1NJZA 4FW2A 1RBSA 3L2VA 2IDOA 3M8SA 1KSPA 2O4GA 1N6QA 4FJHA 2G8KA 1HQEA 1S1UA 3C6TA 2ATQA 2HB5A 2GV9A 4KV8A 4DF4A 4KI4A 3LPUA 3E01A 3AVNA 3V1RA 3KLFA 3NCIA 3S3MA 1J5OA 3G0ZA 1XI1A 1IO2A 1U04A 3QEIA 1Q8IA 4L8RB 4I2PA 4PWDA 3NH2A 3I0RA 4FLUA 3WNFA 4EZ6A 1TKTA 3CFOA 3LALA 3K59A 4H8KA 3SQ2A 4KHNA 1YVUA 4CJ5A 3KKSA 2JGUA 2P51A 1C1AA 2IS3A 3AVFA 5J1EA 4F8RA 1S1VA 5JS1A 5HRPA 4BACA 1NKBA 2QK9A 1RCHA 3I0SA 1TK8A 4YNQA 4LY7A 5DK5A 4CEFA 3QINA 1NK8A 1RDBA 1VRTA 3TAQA 4DQPA 3EY1A 4F3OA 1Z26A 3L3UA 4OKKA 3ZSWA 1QHTA 2G8WA 5HP1A 3TAPA 2YNGA 3O4NA 4E19A 4JRPA 1A5WA 4OVLA 1WN7A 1JLBA 1RT3A 3V9WA 4UQGA 1L3TA 4FJMA 3LANA 5CZ1A 4HCCA 2HVIA 4CFBA 1WSFA 3L2UA 4Z4CA 4W5OA 3AO1A 3ZSZA 3HO1A 2YNHA 3OYKA 1KFSA 3VA3A 1HYZA 1WLJA 1GOBA 3DLEA 3OYHA 3LWLA 3JSMA 3SYZA 3L2WA 4RW4A 2XY5A 3HPHA 4FM2A 3SI6A 2OPRA 4Z4HA 1JLEA 2FBYA 3VQ4A 3QESA 1ZBLA 1NK7A 3IG1A 4ID1A 1NJXA 3PV8A 4NCBA 2ZQBA 1NK5A 4I9LA 4CF1A 1S1WA 3TARA 1CZBA 4BE0A 3A2FA 2A1SA 2DY4A 4GVMA 1JLQA 2F96A 4DQQA 3TABA 3RMAA 3ZCMA 1RTDA 3UIQA 1WSHA 4E7HA 2Z1IA 1TKXA 3KJVA 1X9SA 1K6YA 4RW7A 4CGFA 2G8UA 4F4KA 4OGEA 3KK2A 4DSIA 4CHQA 2OPQA 3NGYA 4FJXA 1RDAA 2D0AA 1T7PA 1S1XA 5J2NA 4KHQA 2KQ2A 3KLIA 3V9UA 3VQ9A 1QSSA 3MEEA 2P1JA 3V9XA 2W42A 5HBMA 5HLFA 3V81A 2HHUA 1C1CA 4BWJA 4FJGA 4MQ3A 1BIUA 4AHSA 3OS0A 2O4IA 4CJ3A 3AO3A 3AVBA 1KVAA 4DFPA 1TK5A 1L3UA 4PY5A 4FK4A 4ZTFA 5CYQA 3QNNA 4E0DA 4FYDA 3SPYA 5CYMA 1JLCA 2Y1IA 4ELTA 1TKDA 3DRSA 4KI6A 1VK0A 2R7YA 4IG3A 3LWMA 1FKOA 3MXJA 5KGWA 5C42A 3RWUA 4FLXA 3L2RA 1NOYA 1BCOA 2E4LA 1RT7A 3M8RA 1HNIA 3PO4A 3SZ2A 2QKKA 2ZE2A 3NH0A 1U4BA 1RT5A 4E1NA 4C8OA 1X9MA 4FJLA 3G10A 3HP9A 4CJWA 3VN5A 1QSLA 1DTTA 4YFUA 1JLAA 4IFYA 1W0HA 2PY5A 4HVJA 1SKWA 4AHUA 4R5PA 3RMDA 2HHQA 3K5LA 1VSEA 4DSEA 3OYFA 4IG0A 3P1GA 4Q0BA 4DSJA 4W5NA 1ZBHA 3AVIA 3MEGA 2BGGA 2A1RA 3DLBA 5JS2A 2PYJA 4CJLA 4C8NA 1IKWA
chains in the Genus database with same CATH superfamily
4QCLA 4E1MA 1EX4A 4L3QA 1F21A 2PFUA 2GWKA 1P90A 1ASWA 4CF9A 3V9ZA 2QTDA 4KHUA 3L2QA 2P5GA 4BC5A 4CCHA 2IVOA 2NRXA 3EE9A 1SAZA 4JHDB 3BEXA 3MN5A 1S1TA 1J6ZA 3AVKA 4FJIA 4KHWA 3BGRA 1IBLK 2E1YA 3KTQA 3P83D 4IEIA 1C0TA 2ZGZA 4FK0A 5LJWA 3WXKA 4HTLA 4A2BA 3HM8A 3HSCA 4J2BA 1WUAA 3L3VA 4E7JA 3MN7A 1UA1A 4KPYA 4AF1A 4DV1K 2OTLN 5LJVA 3KLHA 4JHDA 1BISA 1MU2A 2IGIA 3A5OC 1JKHA 3PSFA 4CK2A 3AY9A 2P9KA 3VQQA 1N8RO 5C15A 2RKIA 3ZT0A 1TGOA 4XEIA 1XNRK 1SL2A 1VSJA 1RBRA 2HNDA 3GBTA 1NK9A 4IKFA 4OGCA 3O9UA 3F9MA 1KVCA 4WQ5A 4K8ZA 1DEJA 4KTWA 4DSFA 4DFJA 1UOCA 5DMRA 5KPTA 1K73O 4LF6K 2QXFA 4HHTA 4DG1A 2B4JA 4ZHRA 2VYPA 1VQ8N 1NMDA 2ITGA 1VRUA 4DSLA 1IBKK 1IKYA 1KAXA 4I7FA 3THWA 5J2PA 1QZ5A 2UXCK 3QEVA 4KAZA 4QS9A 3HPOA 1IKXA 4FLTA 1NOZA 4LD0A 1WSJA 2O8BA 5CR4A 3UKUB 3E9LA 1VSMA 3OYBA 4KHYA 3DXMB 1IKVA 2HF4A 3SJJA 4CFAA 2JWKA 4LFCK 1NWKA 2RPIA 3C7NB 1XHXA 3W0LA 4DTNA 1S9GA 4BE1A 2GX9A 3U8XA 4IJNA 3VPZA 4U7BA 4N5SA 2HHSA 1RFQA 1REVA 4AM7A 4BREA 2YNFA 1RTHA 2Q97A 4FZZA 2A5XA 2RF2A 3MEDA 3UKUA 3WEEA 4DU1A 1JXBA 3WUHA 4FJ7A 3TANA 4U67L 2OA8A 1NM1A 4DKWA 4N76A 5KRSA 3OVNA 3KK1A 3HVTA 4CEOA 4BRHA 1Q9YA 1Q7YO 3NH1A 1WAFA 2CH5A 5AQKA 1E4FT 5AQGA 3VQ8A 1FKPA 2P9PA 3ULDA 3ZETA 1QQOA 2QKBA 5H1SQ 2WUSA 4CF0A 5CZ2A 5KTQA 5C25A 4BE2A 3C95A 4B9NA 2P9SB 3SUPA 2G8FA 3SAGA 2HHVA 4DS4A 3LM2A 3M3ZA 3I8DA 1SKRA 4FWQA 2BANA 4Z4GA 1Z25A 3TU5A 4X64K 3SCXA 2P9IA 3SMPA 4BC4A 3NFAA 3L0QA 1DLOA 1UWBA 3QNOA 4IWVA 3K5OA 4CEZA 5B8HA 4Y1DA 2QWLA 4GV9A 1RBTA 3HTVA 3PO5A 2OPSA 3M1FA 3HVRA 4B9UA 4M3RA 3MCAB 4DLEA 1VAZA 1M1KO 3FZKA 1BA1A 5I3UA 4CIEA 2VWBA 5CHIA 4O0JA 1R0AA 3AA3A 3V4IA 5AQVA 3HL8A 1KD1O 1A5VA 2A40A 3LZJA 4FO0A 2E88A 4JAXA 4FJ8A 3SBGA 3DLKA 3OS2A 2XHBA 4YDUA 3FGUA 2YJFA 1U6ZA 1OVQA 3IUCA 1MWMA 1C0MA 1I94K 3OJSA 5FPDA 1OKJA 3KK3A 2FC0A 4DV7K 4E7IA 1LWCA 4NCGA 3ZT1A 1KRPA 3WXLA 3CQXA 3DM2A 1M90O 5FLXO 3T69A 4Q5VA 2QI2A 1Q81O 3KLGA 2NRZA 3U3YA 4M3XA 1EXQA 3L4IA 3O80A 4M7YA 4ILJA 4CF2A 4FLYA 3QBXA 1HYSA 4CD3A 2O8FB 4CZLA 3OS1A 1YTAA 3ALYA 4XH4A 3ZEUB 5FROA 4FWOA 1U45A 3ULEB 2KFZA 5C24A 3D0PA 4FM1A 3T3FA 2ZJRL 3WXJA 4JN4A 4LFAK 1KAZA 3ZX3A 4K41A 3HJFA 1I39A 4OPHA 1RT6A 4CESA 4KH4A 3LP1A 3ZEUA 1HNWK 3AAQA 2OZSA 1EKEA 3MMVA 2FSKA 2IOCA 2QWPA 1ZBUA 3SMSA 3ENOA 3PX0A 1VQ7N 2QWRA 1QVFM 4PQUA 1GOAA 3D2EA 2B6AA 1KC8O 2QWMA 4LF4K 4ILGB 1WNSA 3DMJA 1QHAA 1WSIA 4ILHA 4BRQA 3O5BA 2VQEK 2IVPA 4CK1A 4HUEA 2KZMA 2QXLA 4B08A 3AVMA 4A62A 3U6FA 3QFPA 3CERA 4G1QA 1X3NA 3OYJA 4IJAA 4B1VA 2IDOA 3D7EO 1N6QA 4KV8A 2GV9A 3LPUA 3E01A 4LF7K 5KQ8A 2WFBA 3K9JA 3NCIA 3DJCA 5AQRA 1U04A 4NB4A 1TYQB 3OW2M 4PWDA 3E9OA 3I0RA 4B1ZA 1EWQA 3BF3A 3LALA 3SQ2A 4H5RA 4H8KA 4CJ5A 1S1VA 1J5EK 5HRPA 3HI0A 4LFBK 1TK8A 1T6CA 4CEFA 4IO9L 3QINA 1XMOK 1NK8A 4DQPA 4JI7K 3ZSWA 4OKKA 4PL8A 1QHTA 3TAPA 3O4NA 4JRPA 3MX5A 1YVNA 3THYB 1HR0K 4BRPA 1RT3A 3V9WA 2P9LB 3BF1A 3LANA 4BRIA 1WSFA 4C1NK 4I6MB 2YNHA 3OYKA 1HYZA 1GOBA 4RWTA 3HPHA 3SI6A 4Z4HA 3VQ4A 1NK7A 4NCBA 2ZQBA 2NRTA 3THYA 3FZHA 5AQMA 1JLQA 3RSEB 4DQQA 3RMAA 4A57A 4WYBA 2G8UA 4F4KA 1GLEG 3BZKA 1YAGA 3G25A 1NGDA 3R8EA 3K0SA 1GLCG 4I6MA 2YHYA 4JD2A 1V4SA 1NGBA 1T7PA 1HX1A 2KQ2A 4LF5K 3KLIA 2E2QA 3V9XA 1GLDG 1C1CA 4BWJA 4MQ3A 3AO3A 4ZTFA 4FYDA 2OTJN 3SPYA 4WQ4C 5E26A 3R9PA 2Y1IA 3H6EA 5AQZA 1NGHA 2KHOA 1BCOA 3W3DA 3M8RA 2E2NA 2ZE2A 4FWKA 1LOTB 1QSLA 4YFUA 2GWJA 1OH7A 5EVZA 3K5LA 2ZJQL 4IG0A 4DR2K 4W5NA 3AVIA 3MEGA 2BGGA 3IKMA 2PYJA 4O8KA 2Y1JA 4C8NA 3NHGA 1ATNA 1CZAN 5T7BA 2P9NB 1QTMA 4B9VA 4K25A 3O6WA 1QQMA 4IOCL 4EP4A 2F9WA 3CQYA 5BREA 5SWMA 3S3OA 1BDGA 4Z4FA 2BH1A 2D0OA 4BRLA 5F2RA 4MDAA 4O4GA 2QWNA 5HRRA 1RDDA 1XHZA 1ATRA 2IAJA 3GOIA 1V4TA 4CJRA 1G15A 3LAKA 4CERA 3BDPA 3IS9A 4DTSA 1KQSM 1YT3A 2P9NA 3NGZA 1N36K 4DV0K 3OYMA 5ADXA 5FDLA 4H4OA 2CGLA 3O3FA 4KHPK 2IIRA 2G8VA 3C94A 5EXWA 1VQLN 2B5JA 4N47A 4H4MA 1OH6A 1TAQA 3ZX0A 4CJPA 1HMVA 2O8DB 3WQTA 3OYLA 3SQ1A 2YHBA 5LY3A 3HYFA 5HRNA 4BR7A 4F2RA 3ZSXA 1D8YA 4BRNA 4J2EA 1N32K 1XMQK 1DTQA 1VSFA 3RMCA 3CCSN 4DTMA 5JICA 4YHHK 2H3GX 1U47A 4CE9A 1B9FA 1BGXT 3CCVN 3IRXA 5SZTA 1LW2A 4JEPA 1JL2A 4I9QA 3K57A 1NBWA 3O3GA 3SAHA 4J2DA 4JI0K 3NF6A 2VCPA 3AVHA 4BVOA 3GL1A 3O9SA 3THXA 4ICLA 3U4LA 4PHTX 4CHYA 1DGKN 4FPAA 4E89A 4IBNA 2Z1JA 3DAWA 2BTFA 2G8HA 1WB9A 3E1YA 3VQAA 4B9LA 5AZJB 2VG7A 3QDKA 1BQNA 5M1FA 3IMXA 3PSIA 4CHZA 2V52B 2GELA 3HOSA 4H0XB 1FJGK 1HNVA 4JKAA 1RTJA 4BY9C 3P38A 3MXMA 1W9HA 3K9KA 5BRHA 3LZIA 2YJEA 1JCGA 2D0CA 4CJUA 3QEWA 3THVA 1KXPA 5TKWA 3NE6A 4H5TA 5KI6A 4H03B 4CJQA 4ZTJA 1RTIA 5E41A 3LDLA 2X74A 2HMPA 3DWLA 3H08A 3O4QA 1NK6A 3NBPA 4A2AA 3OYGA 1WSEA 3WNEA 3K5MA 2E5LK 3QLHA 3OYAA 4KHNA 1J54A 1ATSA 4JS5A 2W41A 3VMFB 4FZXC 5M1KA 3CJ7A 1SV5A 4YOXA 1HNZK 3V1OA 4DV4K 2YV0X 2XY6A 2X6NA 1BWFO 2F8SA 3B6OA 4EAHD 5AQFA 3SUOA 4DMNA 3VQ6A 4BQLA 1MA9B 5K14A 1VQKN 1BIZA 4CGDA 1Y64A 3RMBA 3JXUA 4GVEA 4FLVA 4B3OA 4H0OA 1VSDA 3HZ6A 1TL1A 4FCYA 5JLFA 4B8AB 3A5LC 3DLHA 2F9TA 4GY2B 3ASMA 3O1BA 4X62K 4DU3A 4FPBA 4MO4A 4NLBA 4EHTA 4DR3K 3CJBA 2A3ZA 3T7ZA 4M3UA 1NGJA 4CJVA 4KRFA 3ZYYX 1LV5A 3IAYA 2F8TA 3TAMA 3AVLA 3ZSVA 4IO8A 4BWMA 1MWKA 3OYNA 5J2MA 5AFUH 3O8MA 5IWAK 3QIOA 3OJUA 1BCMA 4J8FA 5JLHA 1YXQA 2NNWA 3P5JA 1WBDA 3O9QA 4BC2A 2HBLA 3U3GA 5C2DA 4DV3K 1RBVA 2UUAK 4FM0A 1A5XA 1JLFA 3KK7A 1RDWX 2GUPA 4LSLA 1VQMN 3AO5A 2ZD1A 4WQ5C 3DI6A 4K8XA 4CZGA 1J53A 2IC3A 3LDQA 1KLNA 5KRTA 4F2SA 2Q31A 4HTUA 1HPZA 3QEPA 4EZ9A 3C0BA 3RVCA 1RT1A 4BRFA 2D4WA 1KLMA 3AA2A 3V6DA 4OPAA 4K0KK 1XNQK 3GDQA 4JKGB 1XQSC 4CJSA 1TV6A 3AV9A 4C23A 4CEEA 4BRAA 3J81O 4FXDA 2ASPA 4H5NA 1U48A 3LAMA 3CCJN 2V7ZA 3P39A 3GG4A 1Q18A 3HP6A 1X9JA 3CCRN 3HK2A 4FVMA 4KO0A 4ID5A 2QW9A 3ZSQA 1SL1A 4H0YB 3ISNC 1HQUA 3AVGA 2KTQA 3DLGA 4PKGA 1NKEA 4DQIA 4B1UB 3DXMA 3TAFA 3LP2A 4NLCA 3VTIA 3TSUA 5BN9A 3QMLA 4W5TA 2V51B 3AO2A 2HHHK 4FWMA 2ZGYA 4JKHA 3H3OB 3C7NA 3VEZA 3CETA 1SKSA 2O8EB 3M6GA 4CHNA 1QZ6A 1NGFA 1HJOA 2UYTA 5F1XA 1YTUA 2KW4A 3CF5L 3NGIA 3KD5E 5GINA 3M8QA 4H5VA 5MLCQ 2OPPA 3UKRB 4CBUA 1RT2A 2XY7A 3ITHA 3CC7N 3HXMA 3EZWA 4JKBA 1K8KB 2FLOA 4BROA 4G9ZA 3BP8A 1S5JA 3NDKA 4CZIA 4CJEA 2ZWHA 1W7AA 3VEOA 2ZJPL 4RG8A 1NJZA 3L2VA 4JI1K 4CD1A 2G8KA 1S1UA 3J7YP 4KI4A 3KLFA 2KKZA 3S3MA 1J5OA 2P9SA 4B3TK 1Q8IA 4H0VB 2DPNA 4YOWA 3K59A 3CCEN 3KKSA 4IZ9A 4BR0A 2IS3A 5J1EA 3I8BA 4BACA 1RCHA 2UXBK 4IXCA 4LY7A 3TTFA 1RDBA 3H3NO 1Z26A 1IJJA 5AQNA 5AQTA 1A5WA 3WQUA 1WN7A 1EQYA 3MX2A 4LC9B 4Z94A 2QWOA 2HVIA 3P31A 3L2UA 1XC3A 2A41A 5C12A 5GAHP 1BO5O 3BZCA 1D4XA 3JSMA 3SYZA 4B1WB 4RCHA 3FLCO 1ZBLA 4JKDA 4CF1A 1CZBA 2DY4A 4YDUC 2Q0UA 2F96A 3CPEA 4CZHA 3TABA 2W6KA 1RTDA 4E1JA 1TKXA 1X9SA 2AP1A 3KK2A 3ATUA 4QS8A 2FF3B 2D0AA 5HOOA 1S1XA 2W40A 4KHQA 4B9QA 3EN9A 2W42A 3MDQA 2E2PA 4FL9A 3V81A 3VGLA 4FJGA 5M1NA 2O4IA 3AVBA 1L3UA 3CC2N 4ISFA 4FK4A 4MLEA 5CYQA 1JLCA 4ELTA 1TKDA 3DRSA 3IFRA 2FSNA 4KBOA 4IG3A 2R7YA 3RWUA 4FLXA 3L2RA 2O8FA 1NOYA 1NLVA 1R59O 5BR8K 4GNIA 3VESA 1RT5A 3OHRA 4C8OA 4JNEA 3ULEA 2VGNA 5I9EB 1JLAA 1VQ6N 4DR6K 3GE1A 4AHUA 2HBJA 5EX5A 2WTUA 4GKJK 4DSJA 5AR0A 3WXMB 2A1RA 3O9RA 2F4VK 3CJCA 4JS4A 1EO1A 3MN9A 3NF9A 3AGRA 4BDYA 2ASOA 3VA0A 2QWQA 4MFBA 3VF4A 2E2OA 3JAMO 1L5UA 3EO3A 3QEXA 4WFNL 1ZBIA 4JI3K 3VETA 4DR1K 2NRHA 5LL6Z 1C0UA 4GV6A 2KZZA 4RW6A 4CF8A 2EWSA 3H1VX 5GIPA 3CC4N 5LMNK 3JS6A 1BHLA 3MAQA 4MO5A 2VG5A 2NRWA 3CYMA 4R79A 4M45A 4N41A 2PBDA 3A8YA 3EKSA 3U9ZA 5BPLA 3CCUN 1QSYA 3PUFA 4CK3A 2Q2RA 3DXKB 1SS6A 5I42A 2YNIA 4J2AA 4PKIA 2E20A 1ITGA 2PZSA 4ELUA 4KFBA 3ENHA 1EP4A 1OH8A 4JK8A 3OYIA 4DTOA 2PAVA 3UE5A 1CLQA 1ZBFA 1MDUB 3SUQA 1HRHA 4M42A 1J9AA 3LP0A 1TYQA 4FWRA 3VOVA 3DXKA 3DRRA 3CCMN 4LF8K 1LWEA 4B9SA 4LH5A 3VEXA 4O5FA 3LDSA 1T3VA 3CJAA 4BGBA 3HSTB 1KTQA 5JVHL 2Z1GA 2IVNA 2RHKA 1BI4B 3NF8A 1LW0A 4CJKA 3KKRA 2P9LA 4DB3A 3ZT2A 4DR5K 1WSGA 4W5QA 1VSKA 4AHCA 5FPMA 5EU7A 2G8IA 1N34K 4DQ8A 3ZT3A 2YHAA 3D45A 4BRCA 4IFVA 1LCUA 3TAGA 4DFKA 1ZYQA 1OVYA 4FJ9A 2QM1A 4C8LA 3OYEA 3RTVA 2W6LA 1BI4A 2Q0RA 4FWNA 1T6DA 1ZC6A 5J2QA 1D9FA 3RSEA 2CGKA 2HBMA 4CEQA 4WQ4A 3TI0A 3SAFA 2E8AA 1CZ9A 4I2QA 2HNZA 3AVCA 4C8KA 4FLZA 4BDPA 4K43A 3JYTA 4BG9A 4DF8A 3C6HA 1Q82O 3D6RA 4F9OA 3DOLA 3RRGA 1HKCA 3T1HK 4KREA 3RR8A 3VQEA 1D5AA 1T03A 4IDKA 4PL7A 4WCEL 4OLBA 4B9TA 1L3VA 5BR9A 4DTUA 4A59A 2D0PA 3QIPA 4EIAA 4YOVA 5M1PA 4FJ5A 4Y0WA 2X6SA 4IFEA 2BE2A 2NZTA 1K9MO 4DS5A 4CJ4A 2FBXA 1TUUA 4M3YA 4M3TA 4CJTA 3J7ZO 3V1QA 2OYQA 2F7TA 4YOUA 4DU4A 1QE1A 3NMUA 3WXIA 2HW3A 1I3AA 4DV6K 4CIFA 1KFDA 1KAYA 4C8MA 4X66K 1KCFA 4CZMA 3EKUA 3LPTA 4ISEA 4FZYA 1D9DA 1RT4A 3MWTA 3PY8A 1YI2N 4HUGA 1C6VA 4OPJA 3SNNA 3B8AX 1QQNA 1S6PA 4JYAK 4CJFA 1NGEA 2VGMA 3VQDA 5HRSA 1NKCA 1Q86O 4HUFA 4LSNA 3D2FB 5HROA 1BA0A 4UY8O 2HHWA 1T8EA 3PLAA 2NRVA 3WNGA 4AH9A 2FXUA 3PX6A 1VSLA 4K42A 2O8DA 1KVBA 2WONA 4C1NI 1Z6RA 4A61A 2RN2A 2HHTA 4KH6A 3ZX2A 4M41A 4AQYK 3O1WA 1CXUA 2YHXA 3VEYA 2YKNA 2KFNA 1NNEA 2FBTA 3FE1A 2NUBA 1TUYA 1NJWA 2ZM6K 4JI4K 1BL3A 1Y97A 4WE1A 1E3MA 4RTFD 1U2VB 4OKJA 3VTHA 2D5RA 4A5AA 2QEXN 4MLHA 1O1WA 4WFAL 3M8PA 4DFMA 1FXXA 5M1OA 4DTJA 4BR5A 2WBNA 4CHOA 1HYVA 3HM9A 1ASVA 3F9KA 2HMIA 2OZMA 4JLHA 5AZJA 3OBYA 2EX3A 3TPQA 1U2VA 2ETJA 3TTCA 4GMJB 4HWIA 4M7XA 1ILYA 4BC3A 3VF2A 3ZSOA 3G4SN 3QETA 4DTRA 3OTOK 5C2FA 1QS4A 4Z0UA 5ADXH 1VQPN 3SPZA 3AGKA 3TR8A 2V7YA 3B6PA 4GV3A 3FFIA 4CJ7A 4W5RA 1LAWA 4NYNA 4DR7K 3PX4A 5D3GA 3K2PA 3LP3A 3EL2A 1O13A 3ZSYA 3VERA 4NO7A 3CG7A 5AQIA 1EETA 3CCLN 2AA4A 3VQCA 3OYCA 3EE8A 1U49A 4OO1J 1WAJA 5C10A 4B3RK 2XRIA 5FPEA 1BU6O 5ELZA 1OH5A 2YCHA 3MWPA 1CXQA 2HNYA 3CM6A 4BRGA 3DLLL 5KGXA 4Z4IA 3LM9A 2VG6A 4XH5A 3VEWA 3O3HA 4BQZA 1ZBSA 4QAGA 2P9KB 3J8AA 1RBSA 2UUCK 3M8SA 4X65K 3C6TA 2ATQA 2HB5A 4CBWA 4DF4A 5AQJA 4PKHA 3TSPA 3G0ZA 4BG8A 3QEIA 4BRMA 3NH2A 4FLUA 3WNFA 3CFOA 4A5BA 1YVUA 4M3ZA 3O4WA 3G71N 3I33A 1NKBA 1GLBG 1VRTA 4F3OA 3F2KA 3EY1A 4JK7A 2G8WA 3L3UA 5HP1A 2YNGA 1JLBA 2YX6A 3OA9A 5AJ3K 4UQGA 1L3TA 4FJMA 5CZ1A 4HCCA 4CFBA 3FR0A 4W5OA 4QS7A 3ZSZA 4WFBL 3VA3A 5E84A 3LWLA 2XY5A 3THWB 4FM2A 1IV0A 4H5WA 1W2BM 4IOAL 1NGIA 3KVGA 3IG1A 1NJXA 1NG9A 2OCEA 4IOXA 4CBXA 3TARA 1VQON 1YJ9N 3QB0A 2O8BB 3ZCMA 3UIQA 1C0FA 1WSHA 4E7HA 1VQ9N 4B3MK 4CGFA 4DSIA 2OPQA 3NGYA 4FJXA 3R3LA 3A5MC 5HL7L 3PIPL 3CPWM 1S3XA 3ATVA 4CW7B 3V9UA 3VQ9A 1QSSA 5AQUA 5GIOA 3ID8A 5HLFA 5JMVA 1JJ2M 1IG8A 2HHUA 3HRGA 3OS0A 1BIUA 2GEMA 1TK5A 1KVAA 2Q36A 2ZF5O 4DFPA 4PY5A 4H0PA 3QNNA 4E0DA 2NLXA 3R6MA 4JKGA 5AQWA 4KI6A 3L4QA 3QBWA 3WEEB 1VHXA 4DV5K 3LWMA 1FKOA 5KGWA 2E4LA 4BVPA 1HNIA 3NH0A 1X9MA 4CJWA 1DTTA 4IFYA 1W0HA 2PY5A 4HVJA 1SKWA 3ZLJA 4H0TB 3M5RA 4R5PA 4YOTA 2HHQA 1BG3A 4DSEA 3OYFA 4WF9L 4Q0BA 2P9PB 1S72N 1NJIO 1ZBHA 4NXMK 3ZETB 3DLBA 2UXDK 5AQXA 1S6QA 3E9PA 2CGJA 3KZBA 4M3WA 3CMAN 3BY5A 1NMNA 3SQ0A 2O8EA 1BQMA 4CEBA 2P9UB 2P9IB 4FW1A 1HNXK 5IT9O 4CFDA 1X9WA 3KIOA 3LDPA 5BPMA 4CHPA 4CGJA 3UKRA 1P8ZA 3MK6A 2WC9A 1S22A 4DR4K 3QICA 1NJYA 1TAUA 4ELVA 1GLLO 4AHVA 5AQYA 3AO4A 1K8KA 1VQ5N 2P9UA 1JXEA 2LSNA 3ID6A 3ZT4A 2I5JA 1B92A 2X78A 2RE2A 4YORA 2ITMA 4AHTA 4E7LA 1YJNN 3H1QA 5DM7L 3SK3A 1ESVA 1NGAA 3SBTA 4XH1A 4DQSA 3TAEA 1YHQN 4FLWA 1IBMK 3DYAA 4CZKA 4CIGA 4CVNE 3IDHA 4V19S 4AM6A 4KB0A 4KTZA 4O44A 3AVJA 3NVMA 2WOMA 5BPNA 4O8UA 3AAPA 5AQLA 3AVAA 4RW8A 4CI6A 3CIPA 1FK9A 1XWLA 3P4IA 4PUOA 3SV4A 1NU0A 4GW6A 2CH6A 4Y1CA 1N33K 1SUQA 4DTPA 4OJRA 4JI5K 4AHRA 1RILA 4JKEA 3S41A 1UA0A 4DCHA 3N4QA 2PYLA 3QFUA 3J7AP 3S9HA 2VWJA 3OYDA 2P5OA 3TTDA 4FVUA 3HT3A 4JKFA 4KKOA 3CFRA 1HUXA 3T1YK 3SV3A 1JCEA 3RRHA 4JKCA 4B9MA 1RDUA 3CI5A 2DFEA 4FSVA 4RW9A 3QO9A 4EP5A 1TL3A 4JV5K 1X3MA 1GLFO 1WBBA 3T19A 3S3NA 4JRQA 3F73A 1E4GT 4CEDA 3G6EN 4JI2K 4DLGA 4OKEA 2A42A 4BRDA 2UUBK 5M1QA 4N56A 3EZ5A 1LAVA 3L8BA 3CFPA 4E7KA 1B9DA 4JI6K 4FOIA 3D2EB 4YY3K 5LMUK 2AJQA 3QERA 4FJJA 1N5YA 1UAXA 3MXIA 1SZ2A 4HCBA 4EHUA 4BGAA 3AA5X 2Z1HA 4KH5A 4QOZB 3VF6A 1QQCA 1C0GA 1RDCA 3VEVA 4OPKA 3CQ8A 1Z05A 1NK0A 3H46O 3OY9A 2FBVA 3ZSRA 5GAEP 1TVRA 1HJRA 3I56N 1YITN 1RNHA 3FZLA 2XO7A 1TK0A 5AQQA 3VQPA 1K8AO 4DWIA 4LH4A 3VQ5A 4BDZA 4F3TA 4XIUA 1VSIA 2EHGA 1NGCA 5JVGL 1IH7A 2GTDA 3UB5A 5FRNA 4MDBA 2GBZA 3Q7CA 1XUPO 4BR9A 2JWLA 5F0XA 4BRKA 2E6LA 4PA1A 4DTXA 3DLRA 3O9TA 4B3SK 1Q9XA 2D0BA 1HLUA 4CGHA 4FOEA 1GOCA 2HF3A 4OLAA 1RBUA 2YKMA 5AQHA 4CZEA 2QA4N 1IG9A 3HBTA 3NAEA 1XC9A 3CM5A 4DQRA 1ASUA 3F5TA 4IEEA 2FF6A 2HBKA 3K58A 3SLCA 3AA4A 4BR2A 3ENBA 2Q1NA 3SQ4A 4Z4EA 1JCFA 4FWPA 4CZJA 2ASMA 2BDPA 1BUPA 4JD2B 2HVHA 4GKKK 3T1AA 5BRFA 5AZIB 4DUYK 4M63C 4FK2A 3TWHA 1YIJN 3VGMA 3N4PA 5BRDA 5TKYA 2O8CB 3MECA 5CY4A 3VQBA 1H1VA 1QVGM 1T05A 2YHWA 4FJKA 1EWRA 1JL1A 4ISGA 4CEAA 2I7PA 1ZXOA 3MCPA 4AILC 4YOYA 2GUIA 4O5BA 3A0IX 1NGGA 4IDHA 4NYFA 2JLEA 2Q3SA 2HOEA 3BUZB 5AZIA 1L3SA 3KLEA 2VWKA 3EEQA 4CGGA 5GADP 4O0IA 2O8CA 3CHWA 4KHSA 5GAGP 3AARA 5FPNA 4DHYA 4CFCA 1NK4A 5FRMA 3C6UA 4CGIA 2D1KA 4KB1A 3SUNA 5EOYA 3WT0A 3NF7A 2DFFA 2KLAA 2E6MA 1S9EA 4O55A 5KPZA 3V9SA 3DRPA 4FJNA 3O08A 3FZMA 4DSKA 1VQ4N 4B1XB 4LF9K 1YUWA 2A6AA 1BOTO 2XY8A 3FZFA 3Q7BA 3K5NA 5AQPA 4B8CA 3E66A 4E3SA 2DFHA 1SL0A 1G99A 1HPMA 2OANA 1WOQA 2E1ZA 3LDNA 3KD1E 4TSXA 5KPRA 1FW6A 1VSHA 3EYZA 3RR7A 4DUZK 3HPGA 4CECA 3NVKA 5EY4A 1TKZA 1LWFA 1DT9A 3LL3A 2I7NA 3WNHA 2DTUA 1HKBA 3VQ7A 2YI1A 3I55N 4KTQA 1C1BA 4CZFA 3CMEN 5C0YA 1JLGA 5KQDA 1YJWN 3CD6N 1X1PA 4NCAA 3DOKA 5CE3A 2HHXA 4FWLA 4FW2A 3KWGA 1KSPA 2O4GA 4FJHA 1HQEA 3C65A 3PIOL 5DM6L 3AVNA 2BUPA 3V1RA 3CJ1A 1SQKA 1XI1A 1IO2A 4L8RB 4I2PA 4EZ6A 1TKTA 2JGUA 2P51A 1C1AA 3AVFA 4F8RA 4OX9K 5JS1A 5BN8A 2QK9A 3I0SA 4YNQA 5DK5A 3VENA 3FFKB 3TAQA 4E19A 3CXCM 3KWIA 3R1XA 4OVLA 3D2FA 3THXB 4Z4CA 4FWSA 3AO1A 3HOTA 2NRRA 3HO1A 1KFSA 1HKGA 3LDOA 1WLJA 2HSTA 3DLEA 3OYHA 3L2WA 4RW4A 2OPRA 1GLJO 1JLEA 2FBYA 3QESA 3C6AA 3CCQN 1W97L 4ID1A 2UU9K 3PV8A 1NK5A 4I9LA 1S1WA 4BE0A 3A2FA 2A1SA 4GVMA 1DKGD 3TSQA 2Z1IA 3KJVA 1K6YA 4RW7A 5AQOA 4OGEA 4CHQA 1YF5L 1RDAA 4EFHA 4JK9A 3VGKA 5J2NA 4B1YB 3MEEA 2P1JA 5A2QO 5HBMA 4NXNK 3H45C 4AHSA 4CJ3A 3CJ9A 4BR4A 3SJHA 5CYMA 5AFUA 1RGIA 1VK0A 3MXJA 5C42A 1T44A 1RT7A 3PO4A 3SZ2A 2J4RA 2QKKA 1U4BA 3OBWA 4E1NA 5AQSA 4FJLA 3G10A 3HP9A 3U9DA 3VN5A 3A5NC 4DV2K 3MN6A 3L6QA 3RMDA 1GLAG 3J80O 3KHYA 1VSEA 3P1GA 2FSJA 2VQFK 1VQNN 5JS2A 4CJLA 4JI8K 1IKWA
chains in the Genus database with same CATH topology
4QCLA 4E1MA 1EX4A 1S6QA 3NHGA 4JS4A 5T7BA 4BDYA 3NF9A 1F21A 3VA0A 4M3WA 1QTMA 4B9VA 4CF9A 1ASWA 4MFBA 3V9ZA 4KHUA 4EP4A 3L2QA 2P5GA 5SWMA 3S3OA 3QEXA 1L5UA 4Z4FA 4CCHA 1ZBIA 3SQ0A 1BQMA 4CEBA 4O4GA 5HRRA 1C0UA 1RDDA 4FW1A 4RW6A 4CF8A 1XHZA 2KZZA 1S1TA 3AVKA 2IAJA 4CFDA 4FJIA 1X9WA 3BGRA 4KHWA 3KIOA 4CJRA 1G15A 3KTQA 3LAKA 4CERA 3P83D 3IS9A 1BHLA 4CHPA 1C0TA 4CGJA 3MAQA 4DTSA 3BDPA 4FK0A 2VG5A 1YT3A 3CYMA 4M45A 3NGZA 4N41A 4J2BA 3L3VA 3OYMA 4E7JA 1NJYA 5FDLA 4H4OA 1TAUA 1UA1A 3PUFA 4CK3A 3O3FA 1QSYA 4KPYA 4ELVA 4AHVA 3AO4A 5I42A 2G8VA 2YNIA 3C94A 1JXEA 2B5JA 2LSNA 3ZT4A 2I5JA 3KLHA 4J2AA 4N47A 1B92A 1BISA 1ITGA 1MU2A 2PZSA 2IGIA 2X78A 4E7LA 1JKHA 4H4MA 4KFBA 1EP4A 4AHTA 4CK2A 4ELUA 1TAQA 4CJPA 3VQQA 3OYIA 1HMVA 4DTOA 3OYLA 3SQ1A 2RKIA 2YHBA 3ZT0A 1TGOA 1CLQA 3HYFA 1ZBFA 1SL2A 1VSJA 4DQSA 3TAEA 5HRNA 3SUQA 1HRHA 4FLWA 1RBRA 4F2RA 2HNDA 3ZSXA 1D8YA 4J2EA 4M42A 3DYAA 1J9AA 3LP0A 1NK9A 4OGCA 4CIGA 4IKFA 1DTQA 1VSFA 4KB0A 4KTZA 3RMCA 4DTMA 4O44A 3AVJA 3DRRA 1LWEA 4B9SA 4LH5A 2WOMA 1KVCA 3LDSA 3AVAA 3HSTB 4RW8A 1U47A 4CE9A 1B9FA 1BGXT 4K8ZA 1KTQA 3IRXA 5SZTA 1FK9A 1XWLA 1LW2A 4KTWA 4DSFA 1JL2A 4DFJA 2Z1GA 4I9QA 3K57A 4PUOA 3SV4A 1BI4B 4GW6A 3O3GA 1UOCA 4Y1CA 4J2DA 3NF6A 3NF8A 5DMRA 1SUQA 4DTPA 1LW0A 2QXFA 4CJKA 4HHTA 3KKRA 3AVHA 4OJRA 4DG1A 2B4JA 4AHRA 4ICLA 4ZHRA 4CHYA 1RILA 3ZT2A 1WSGA 4W5QA 1VSKA 4E89A 1UA0A 4IBNA 2Z1JA 4AHCA 2ITGA 5EU7A 2G8IA 1VRUA 2G8HA 2PYLA 3ZT3A 4DSLA 2YHAA 3VQAA 4B9LA 3D45A 4M3ZA 1IKYA 4IFVA 2VG7A 3TAGA 3S9HA 1BQNA 4DFKA 4I7FA 2VWJA 3OYDA 5J2PA 1ZYQA 2P5OA 4FJ9A 4CHZA 3OYEA 3HT3A 3RTVA 3QEVA 4C8LA 4KAZA 3HPOA 4KKOA 3CFRA 1BI4A 1IKXA 4FLTA 3SV3A 1NOZA 5J2QA 1D9FA 3RRHA 4B9MA 4LD0A 1HNVA 1WSJA 2DFEA 4CEQA 1VSMA 1RTJA 4RW9A 3TI0A 3QO9A 4EP5A 1TL3A 3OYBA 4KHYA 3MXMA 1CZ9A 1IKVA 1W9HA 4I2QA 3T19A 4CFAA 3SJJA 3S3NA 4JRQA 2HNZA 3F73A 3AVCA 4C8KA 4FLZA 4CEDA 3JYTA 3LZIA 4BDPA 2D0CA 4CJUA 3QEWA 3THVA 4DF8A 4DLGA 3NE6A 2RPIA 1XHXA 4DTNA 1S9GA 4OKEA 4BE1A 3DOLA 4N56A 4N5SA 3RRGA 3EZ5A 2HHSA 1LAVA 5KI6A 3L8BA 3CFPA 4E7KA 1B9DA 1REVA 4CJQA 2YNFA 1RTHA 3RR8A 3VQEA 4KREA 2AJQA 3QERA 4FZZA 1D5AA 1T03A 2RF2A 3MEDA 4ZTJA 1RTIA 4IDKA 1N5YA 1UAXA 4FJJA 5E41A 2X74A 3MXIA 4OLBA 4HCBA 4B9TA 4DU1A 3H08A 3O4QA 1NK6A 3NBPA 1JXBA 1L3VA 3OYGA 1WSEA 3WNEA 3K5MA 3AA5X 3QLHA 3OYAA 4DTUA 3TANA 2OA8A 4FJ7A 2Z1HA 1J54A 4N76A 5KRSA 3QIPA 3OVNA 3KK1A 3HVTA 4FJ5A 4CEOA 2X6SA 4QOZB 2BE2A 4JS5A 1Q9YA 3NH1A 1QQCA 1WAFA 4FZXC 1RDCA 4DS5A 1SV5A 4OPKA 3CQ8A 4CJ4A 2FBXA 1NK0A 4M3YA 3V1OA 3OY9A 2FBVA 3VQ8A 3ZSRA 1TVRA 1HJRA 2YV0X 4M3TA 4CJTA 2X6NA 2XY6A 1FKPA 3V1QA 2OYQA 3ULDA 2F8SA 3B6OA 4DU4A 3SUOA 2QKBA 1QE1A 1RNHA 3VQ6A 4DMNA 2HW3A 1I3AA 4CF0A 5CZ2A 4CIFA 5KTQA 2XO7A 1KFDA 5K14A 1TK0A 1BIZA 3VQPA 4DWIA 4LH4A 4CGDA 5C25A 4BE2A 3C95A 3RMBA 4B9NA 4C8MA 1KCFA 3LPTA 3SUPA 2G8FA 4FZYA 1D9DA 3VQ5A 1RT4A 4BDZA 4DS4A 2HHVA 2Y1JA 3I8DA 1SKRA 4XIUA 4F3TA 4FLVA 4B3OA 1VSIA 1VSDA 1TL1A 2EHGA 4FCYA 3PY8A 2BANA 4Z4GA 4HUGA 1Z25A 1C6VA 3SCXA 4OPJA 4B8AB 3SNNA 1IH7A 3NFAA 3DLHA 1DLOA 3ASMA 1S6PA 1UWBA 3QNOA 5FRNA 2GBZA 4CJFA 3K5OA 4CEZA 4DU3A 4Y1DA 3VQDA 5HRSA 2E6LA 1NKCA 4PA1A 1RBTA 4DTXA 3PO5A 3DLRA 2OPSA 4HUFA 4M3UA 3HVRA 4LSNA 4B9UA 4CJVA 5HROA 4M3RA 4DLEA 1Q9XA 4KRFA 2D0BA 1LV5A 2HHWA 3IAYA 1T8EA 5I3UA 4CGHA 2F8TA 3TAMA 3WNGA 1GOCA 3AVLA 4AH9A 4CIEA 3ZSVA 4OLAA 4O0JA 1RBUA 2YKMA 4BWMA 1R0AA 3AA3A 3V4IA 3HL8A 3OYNA 3PX6A 1IG9A 5J2MA 1A5VA 1VSLA 3NAEA 3LZJA 1XC9A 3CM5A 4DQRA 4FJ8A 3QIOA 1ASUA 3OJUA 3DLKA 3OS2A 2XHBA 1KVBA 2WONA 3K58A 1BCMA 3AA4A 2RN2A 2HHTA 3P5JA 4M41A 3SQ4A 4Z4EA 1CXUA 1C0MA 3U3GA 2YKNA 3OJSA 4E7IA 1RBVA 3KK3A 2FC0A 2BDPA 2HVHA 4FM0A 2FBTA 2KFNA 2NUBA 1A5XA 1JLFA 1LWCA 4LSLA 4NCGA 3T1AA 3ZT1A 3AO5A 1NJWA 2ZD1A 1KRPA 4K8XA 3DI6A 4FK2A 3TWHA 3DM2A 1BL3A 1J53A 2IC3A 1KLNA 5KRTA 1Y97A 4WE1A 4F2SA 4HTUA 1HPZA 4Q5VA 3QEPA 4OKJA 2D5RA 4EZ9A 1RT1A 3KLGA 3MECA 5CY4A 3U3YA 1KLMA 3AA2A 3VQBA 4M3XA 1EXQA 3V6DA 1O1WA 1T05A 3M8PA 4DFMA 4FJKA 1JL1A 4CF2A 4CEAA 1FXXA 4CJSA 4DTJA 4FLYA 1TV6A 3AV9A 1HYSA 4CHOA 4CEEA 1HYVA 3HM9A 4AILC 3OS1A 1YTAA 1ASVA 2GUIA 3F9KA 4O5BA 4JLHA 1L3SA 4NYFA 2JLEA 2Q3SA 3ALYA 2HMIA 5FROA 1U45A 4FXDA 1U48A 3LAMA 3KLEA 2KFZA 5C24A 3D0PA 2EX3A 4FM1A 2VWKA 3T3FA 4CGGA 2ETJA 3HP6A 4O0IA 4GMJB 4KHSA 3HK2A 4FVMA 4KO0A 3ZSOA 4CFCA 1NK4A 5FRMA 4ID5A 3C6UA 4CGIA 3ZSQA 3QETA 1SL1A 4DTRA 4KB1A 3ISNC 3SUNA 1HQUA 3HJFA 3AVGA 3NF7A 2KTQA 2DFFA 3DLGA 1QS4A 1I39A 2E6MA 4Z0UA 1NKEA 4DQIA 1S9EA 4O55A 3SPZA 3V9SA 1RT6A 3TAFA 3LP2A 3DRPA 4CESA 4FJNA 3LP1A 3TR8A 4W5TA 3AO2A 3B6PA 3FFIA 4DSKA 4W5RA 1LAWA 4NYNA 2OZSA 3PX4A 1EKEA 5D3GA 2IOCA 3K2PA 1SKSA 1ZBUA 2XY8A 3K5NA 3PX0A 3LP3A 3ZSYA 4B8CA 4E3SA 4CHNA 2DFHA 3CG7A 1SL0A 4PQUA 1GOAA 1EETA 3VQCA 2B6AA 1YTUA 3OYCA 2KW4A 1U49A 3KD1E 3NGIA 3KD5E 1WAJA 3M8QA 1WNSA 3DMJA 4TSXA 1VSHA 3EYZA 2OPPA 2XRIA 3RR7A 1RT2A 3HPGA 2XY7A 3ITHA 3HXMA 4CECA 1TKZA 1LWFA 1WSIA 3WNHA 2DTUA 1CXQA 2HNYA 3VQ7A 3CM6A 5KGXA 4Z4IA 4KTQA 1C1BA 4CK1A 4HUEA 2KZMA 1JLGA 3O3HA 2VG6A 4B08A 3AVMA 2OZMA 1S5JA 1X1PA 3U6FA 4NCAA 3DOKA 4G1QA 3NDKA 4CJEA 3OYJA 4QAGA 4RG8A 2HHXA 1NJZA 4FW2A 1RBSA 3L2VA 2IDOA 3M8SA 1KSPA 2O4GA 1N6QA 4FJHA 2G8KA 1HQEA 1S1UA 3C6TA 2ATQA 2HB5A 2GV9A 4KV8A 4DF4A 4KI4A 3LPUA 3E01A 3AVNA 3V1RA 3KLFA 3NCIA 3S3MA 1J5OA 3G0ZA 1XI1A 1IO2A 1U04A 3QEIA 1Q8IA 4L8RB 4I2PA 4PWDA 3NH2A 3I0RA 4FLUA 3WNFA 4EZ6A 1TKTA 3CFOA 3LALA 3K59A 4H8KA 3SQ2A 4KHNA 1YVUA 4CJ5A 3KKSA 2JGUA 2P51A 1C1AA 2IS3A 3AVFA 5J1EA 4F8RA 1S1VA 5JS1A 5HRPA 4BACA 1NKBA 2QK9A 1RCHA 3I0SA 1TK8A 4YNQA 4LY7A 5DK5A 4CEFA 3QINA 1NK8A 1RDBA 1VRTA 3TAQA 4DQPA 3EY1A 4F3OA 1Z26A 3L3UA 4OKKA 3ZSWA 1QHTA 2G8WA 5HP1A 3TAPA 2YNGA 3O4NA 4E19A 4JRPA 1A5WA 4OVLA 1WN7A 1JLBA 1RT3A 3V9WA 4UQGA 1L3TA 4FJMA 3LANA 5CZ1A 4HCCA 2HVIA 4CFBA 1WSFA 3L2UA 4Z4CA 4W5OA 3AO1A 3ZSZA 3HO1A 2YNHA 3OYKA 1KFSA 3VA3A 1HYZA 1WLJA 1GOBA 3DLEA 3OYHA 3LWLA 3JSMA 3SYZA 3L2WA 4RW4A 2XY5A 3HPHA 4FM2A 3SI6A 2OPRA 4Z4HA 1JLEA 2FBYA 3VQ4A 3QESA 1ZBLA 1NK7A 3IG1A 4ID1A 1NJXA 3PV8A 4NCBA 2ZQBA 1NK5A 4I9LA 4CF1A 1S1WA 3TARA 1CZBA 4BE0A 3A2FA 2A1SA 2DY4A 4GVMA 1JLQA 2F96A 4DQQA 3TABA 3RMAA 3ZCMA 1RTDA 3UIQA 1WSHA 4E7HA 2Z1IA 1TKXA 3KJVA 1X9SA 1K6YA 4RW7A 4CGFA 2G8UA 4F4KA 4OGEA 3KK2A 4DSIA 4CHQA 2OPQA 3NGYA 4FJXA 1RDAA 2D0AA 1T7PA 1S1XA 5J2NA 4KHQA 2KQ2A 3KLIA 3V9UA 3VQ9A 1QSSA 3MEEA 2P1JA 3V9XA 2W42A 5HBMA 5HLFA 3V81A 2HHUA 1C1CA 4BWJA 4FJGA 4MQ3A 1BIUA 4AHSA 3OS0A 2O4IA 4CJ3A 3AO3A 3AVBA 1KVAA 4DFPA 1TK5A 1L3UA 4PY5A 4FK4A 4ZTFA 5CYQA 3QNNA 4E0DA 4FYDA 3SPYA 5CYMA 1JLCA 2Y1IA 4ELTA 1TKDA 3DRSA 4KI6A 1VK0A 2R7YA 4IG3A 3LWMA 1FKOA 3MXJA 5KGWA 5C42A 3RWUA 4FLXA 3L2RA 1NOYA 1BCOA 2E4LA 1RT7A 3M8RA 1HNIA 3PO4A 3SZ2A 2QKKA 2ZE2A 3NH0A 1U4BA 1RT5A 4E1NA 4C8OA 1X9MA 4FJLA 3G10A 3HP9A 4CJWA 3VN5A 1QSLA 1DTTA 4YFUA 1JLAA 4IFYA 1W0HA 2PY5A 4HVJA 1SKWA 4AHUA 4R5PA 3RMDA 2HHQA 3K5LA 1VSEA 4DSEA 3OYFA 4IG0A 3P1GA 4Q0BA 4DSJA 4W5NA 1ZBHA 3AVIA 3MEGA 2BGGA 2A1RA 3DLBA 5JS2A 2PYJA 4CJLA 4C8NA 1IKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QCL A;  4E1M A;  1EX4 A;  1S6Q A;  3NHG A;  4JS4 A;  5T7B A;  4BDY A;  3NF9 A;  1F21 A;  3VA0 A;  4M3W A;  1QTM A;  4B9V A;  4CF9 A;  1ASW A;  4MFB A;  3V9Z A;  4KHU A;  4EP4 A;  3L2Q A;  2P5G A;  5SWM A;  3S3O A;  3QEX A;  1L5U A;  4Z4F A;  4CCH A;  1ZBI A;  3SQ0 A;  1BQM A;  4CEB A;  4O4G A;  5HRR A;  1C0U A;  1RDD A;  4FW1 A;  4RW6 A;  4CF8 A;  1XHZ A;  2KZZ A;  1S1T A;  3AVK A;  2IAJ A;  4CFD A;  4FJI A;  1X9W A;  3BGR A;  4KHW A;  3KIO A;  4CJR A;  1G15 A;  3KTQ A;  3LAK A;  4CER A;  3P83 D;  3IS9 A;  1BHL A;  4CHP A;  1C0T A;  4CGJ A;  3MAQ A;  4DTS A;  3BDP A;  4FK0 A;  2VG5 A;  1YT3 A;  3CYM A;  4M45 A;  3NGZ A;  4N41 A;  4J2B A;  3L3V A;  3OYM A;  4E7J A;  1NJY A;  5FDL A;  4H4O A;  1TAU A;  1UA1 A;  3PUF A;  4CK3 A;  3O3F A;  1QSY A;  4KPY A;  4ELV A;  4AHV A;  3AO4 A;  5I42 A;  2G8V A;  2YNI A;  3C94 A;  1JXE A;  2B5J A;  2LSN A;  3ZT4 A;  2I5J A;  3KLH A;  4J2A A;  4N47 A;  1B92 A;  1BIS A;  1ITG A;  1MU2 A;  2PZS A;  2IGI A;  2X78 A;  4E7L A;  1JKH A;  4H4M A;  4KFB A;  1EP4 A;  4AHT A;  4CK2 A;  4ELU A;  1TAQ A;  4CJP A;  3VQQ A;  3OYI A;  1HMV A;  4DTO A;  3OYL A;  3SQ1 A;  2RKI A;  2YHB A;  3ZT0 A;  1TGO A;  1CLQ A;  3HYF A;  1ZBF A;  1SL2 A;  1VSJ A;  4DQS A;  3TAE A;  5HRN A;  3SUQ A;  1HRH A;  4FLW A;  1RBR A;  4F2R A;  2HND A;  3ZSX A;  1D8Y A;  4J2E A;  4M42 A;  3DYA A;  1J9A A;  3LP0 A;  1NK9 A;  4OGC A;  4CIG A;  4IKF A;  1DTQ A;  1VSF A;  4KB0 A;  4KTZ A;  3RMC A;  4DTM A;  4O44 A;  3AVJ A;  3DRR A;  1LWE A;  4B9S A;  4LH5 A;  2WOM A;  1KVC A;  3LDS A;  3AVA A;  3HST B;  4RW8 A;  1U47 A;  4CE9 A;  1B9F A;  1BGX T;  4K8Z A;  1KTQ A;  3IRX A;  5SZT A;  1FK9 A;  1XWL A;  1LW2 A;  4KTW A;  4DSF A;  1JL2 A;  4DFJ A;  2Z1G A;  4I9Q A;  3K57 A;  4PUO A;  3SV4 A;  1BI4 B;  4GW6 A;  3O3G A;  1UOC A;  4Y1C A;  4J2D A;  3NF6 A;  3NF8 A;  5DMR A;  1SUQ A;  4DTP A;  1LW0 A;  2QXF A;  4CJK A;  4HHT A;  3KKR A;  3AVH A;  4OJR A;  4DG1 A;  2B4J A;  4AHR A;  4ICL A;  4ZHR A;  4CHY A;  1RIL A;  3ZT2 A;  1WSG A;  4W5Q A;  1VSK A;  4E89 A;  1UA0 A;  4IBN A;  2Z1J A;  4AHC A;  2ITG A;  5EU7 A;  2G8I A;  1VRU A;  2G8H A;  2PYL A;  3ZT3 A;  4DSL A;  2YHA A;  3VQA A;  4B9L A;  3D45 A;  4M3Z A;  1IKY A;  4IFV A;  2VG7 A;  3TAG A;  3S9H A;  1BQN A;  4DFK A;  4I7F A;  2VWJ A;  3OYD A;  5J2P A;  1ZYQ A;  2P5O A;  4FJ9 A;  4CHZ A;  3OYE A;  3HT3 A;  3RTV A;  3QEV A;  4C8L A;  4KAZ A;  3HPO A;  4KKO A;  3CFR A;  1BI4 A;  1IKX A;  4FLT A;  3SV3 A;  1NOZ A;  5J2Q A;  1D9F A;  3RRH A;  4B9M A;  4LD0 A;  1HNV A;  1WSJ A;  2DFE A;  4CEQ A;  1VSM A;  1RTJ A;  4RW9 A;  3TI0 A;  3QO9 A;  4EP5 A;  1TL3 A;  3OYB A;  4KHY A;  3MXM A;  1CZ9 A;  1IKV A;  1W9H A;  4I2Q A;  3T19 A;  4CFA A;  3SJJ A;  3S3N A;  4JRQ A;  2HNZ A;  3F73 A;  3AVC A;  4C8K A;  4FLZ A;  4CED A;  3JYT A;  3LZI A;  4BDP A;  2D0C A;  4CJU A;  3QEW A;  3THV A;  4DF8 A;  4DLG A;  3NE6 A;  2RPI A;  1XHX A;  4DTN A;  1S9G A;  4OKE A;  4BE1 A;  3DOL A;  4N56 A;  4N5S A;  3RRG A;  3EZ5 A;  2HHS A;  1LAV A;  5KI6 A;  3L8B A;  3CFP A;  4E7K A;  1B9D A;  1REV A;  4CJQ A;  2YNF A;  1RTH A;  3RR8 A;  3VQE A;  4KRE A;  2AJQ A;  3QER A;  4FZZ A;  1D5A A;  1T03 A;  2RF2 A;  3MED A;  4ZTJ A;  1RTI A;  4IDK A;  1N5Y A;  1UAX A;  4FJJ A;  5E41 A;  2X74 A;  3MXI A;  4OLB A;  4HCB A;  4B9T A;  4DU1 A;  3H08 A;  3O4Q A;  1NK6 A;  3NBP A;  1JXB A;  1L3V A;  3OYG A;  1WSE A;  3WNE A;  3K5M A;  3AA5 X;  3QLH A;  3OYA A;  4DTU A;  3TAN A;  2OA8 A;  4FJ7 A;  2Z1H A;  1J54 A;  4N76 A;  5KRS A;  3QIP A;  3OVN A;  3KK1 A;  3HVT A;  4FJ5 A;  4CEO A;  2X6S A;  4QOZ B;  2BE2 A;  4JS5 A;  1Q9Y A;  3NH1 A;  1QQC A;  1WAF A;  4FZX C;  1RDC A;  4DS5 A;  1SV5 A;  4OPK A;  3CQ8 A;  4CJ4 A;  2FBX A;  1NK0 A;  4M3Y A;  3V1O A;  3OY9 A;  2FBV A;  3VQ8 A;  3ZSR A;  1TVR A;  1HJR A;  2YV0 X;  4M3T A;  4CJT A;  2X6N A;  2XY6 A;  1FKP A;  3V1Q A;  2OYQ A;  3ULD A;  2F8S A;  3B6O A;  4DU4 A;  3SUO A;  2QKB A;  1QE1 A;  1RNH A;  3VQ6 A;  4DMN A;  2HW3 A;  1I3A A;  4CF0 A;  5CZ2 A;  4CIF A;  5KTQ A;  2XO7 A;  1KFD A;  5K14 A;  1TK0 A;  1BIZ A;  3VQP A;  4DWI A;  4LH4 A;  4CGD A;  5C25 A;  4BE2 A;  3C95 A;  3RMB A;  4B9N A;  4C8M A;  1KCF A;  3LPT A;  3SUP A;  2G8F A;  4FZY A;  1D9D A;  3VQ5 A;  1RT4 A;  4BDZ A;  4DS4 A;  2HHV A;  2Y1J A;  3I8D A;  1SKR A;  4XIU A;  4F3T A;  4FLV A;  4B3O A;  1VSI A;  1VSD A;  1TL1 A;  2EHG A;  4FCY A;  3PY8 A;  2BAN A;  4Z4G A;  4HUG A;  1Z25 A;  1C6V A;  3SCX A;  4OPJ A;  4B8A B;  3SNN A;  1IH7 A;  3NFA A;  3DLH A;  1DLO A;  3ASM A;  1S6P A;  1UWB A;  3QNO A;  5FRN A;  2GBZ A;  4CJF A;  3K5O A;  4CEZ A;  4DU3 A;  4Y1D A;  3VQD A;  5HRS A;  2E6L A;  1NKC A;  4PA1 A;  1RBT A;  4DTX A;  3PO5 A;  3DLR A;  2OPS A;  4HUF A;  4M3U A;  3HVR A;  4LSN A;  4B9U A;  4CJV A;  5HRO A;  4M3R A;  4DLE A;  1Q9X A;  4KRF A;  2D0B A;  1LV5 A;  2HHW A;  3IAY A;  1T8E A;  5I3U A;  4CGH A;  2F8T A;  3TAM A;  3WNG A;  1GOC A;  3AVL A;  4AH9 A;  4CIE A;  3ZSV A;  4OLA A;  4O0J A;  1RBU A;  2YKM A;  4BWM A;  1R0A A;  3AA3 A;  3V4I A;  3HL8 A;  3OYN A;  3PX6 A;  1IG9 A;  5J2M A;  1A5V A;  1VSL A;  3NAE A;  3LZJ A;  1XC9 A;  3CM5 A;  4DQR A;  4FJ8 A;  3QIO A;  1ASU A;  3OJU A;  3DLK A;  3OS2 A;  2XHB A;  1KVB A;  2WON A;  3K58 A;  1BCM A;  3AA4 A;  2RN2 A;  2HHT A;  3P5J A;  4M41 A;  3SQ4 A;  4Z4E A;  1CXU A;  1C0M A;  3U3G A;  2YKN A;  3OJS A;  4E7I A;  1RBV A;  3KK3 A;  2FC0 A;  2BDP A;  2HVH A;  4FM0 A;  2FBT A;  2KFN A;  2NUB A;  1A5X A;  1JLF A;  1LWC A;  4LSL A;  4NCG A;  3T1A A;  3ZT1 A;  3AO5 A;  1NJW A;  2ZD1 A;  1KRP A;  4K8X A;  3DI6 A;  4FK2 A;  3TWH A;  3DM2 A;  1BL3 A;  1J53 A;  2IC3 A;  1KLN A;  5KRT A;  1Y97 A;  4WE1 A;  4F2S A;  4HTU A;  1HPZ A;  4Q5V A;  3QEP A;  4OKJ A;  2D5R A;  4EZ9 A;  1RT1 A;  3KLG A;  3MEC A;  5CY4 A;  3U3Y A;  1KLM A;  3AA2 A;  3VQB A;  4M3X A;  1EXQ A;  3V6D A;  1O1W A;  1T05 A;  3M8P A;  4DFM A;  4FJK A;  1JL1 A;  4CF2 A;  4CEA A;  1FXX A;  4CJS A;  4DTJ A;  4FLY A;  1TV6 A;  3AV9 A;  1HYS A;  4CHO A;  4CEE A;  1HYV A;  3HM9 A;  4AIL C;  3OS1 A;  1YTA A;  1ASV A;  2GUI A;  3F9K A;  4O5B A;  4JLH A;  1L3S A;  4NYF A;  2JLE A;  2Q3S A;  3ALY A;  2HMI A;  5FRO A;  1U45 A;  4FXD A;  1U48 A;  3LAM A;  3KLE A;  2KFZ A;  5C24 A;  3D0P A;  2EX3 A;  4FM1 A;  2VWK A;  3T3F A;  4CGG A;  2ETJ A;  3HP6 A;  4O0I A;  4GMJ B;  4KHS A;  3HK2 A;  4FVM A;  4KO0 A;  3ZSO A;  4CFC A;  1NK4 A;  5FRM A;  4ID5 A;  3C6U A;  4CGI A;  3ZSQ A;  3QET A;  1SL1 A;  4DTR A;  4KB1 A;  3ISN C;  3SUN A;  1HQU A;  3HJF A;  3AVG A;  3NF7 A;  2KTQ A;  2DFF A;  3DLG A;  1QS4 A;  1I39 A;  2E6M A;  4Z0U A;  1NKE A;  4DQI A;  1S9E A;  4O55 A;  3SPZ A;  3V9S A;  1RT6 A;  3TAF A;  3LP2 A;  3DRP A;  4CES A;  4FJN A;  3LP1 A;  3TR8 A;  4W5T A;  3AO2 A;  3B6P A;  3FFI A;  4DSK A;  4W5R A;  1LAW A;  4NYN A;  2OZS A;  3PX4 A;  1EKE A;  5D3G A;  2IOC A;  3K2P A;  1SKS A;  1ZBU A;  2XY8 A;  3K5N A;  3PX0 A;  3LP3 A;  3ZSY A;  4B8C A;  4E3S A;  4CHN A;  2DFH A;  3CG7 A;  1SL0 A;  4PQU A;  1GOA A;  1EET A;  3VQC A;  2B6A A;  1YTU A;  3OYC A;  2KW4 A;  1U49 A;  3KD1 E;  3NGI A;  3KD5 E;  1WAJ A;  3M8Q A;  1WNS A;  3DMJ A;  4TSX A;  1VSH A;  3EYZ A;  2OPP A;  2XRI A;  3RR7 A;  1RT2 A;  3HPG A;  2XY7 A;  3ITH A;  3HXM A;  4CEC A;  1TKZ A;  1LWF A;  1WSI A;  3WNH A;  2DTU A;  1CXQ A;  2HNY A;  3VQ7 A;  3CM6 A;  5KGX A;  4Z4I A;  4KTQ A;  1C1B A;  4CK1 A;  4HUE A;  2KZM A;  1JLG A;  3O3H A;  2VG6 A;  4B08 A;  3AVM A;  2OZM A;  1S5J A;  1X1P A;  3U6F A;  4NCA A;  3DOK A;  4G1Q A;  3NDK A;  4CJE A;  3OYJ A;  4QAG A;  4RG8 A;  2HHX A;  1NJZ A;  4FW2 A;  1RBS A;  3L2V A;  2IDO A;  3M8S A;  1KSP A;  2O4G A;  1N6Q A;  4FJH A;  2G8K A;  1HQE A;  1S1U A;  3C6T A;  2ATQ A;  2HB5 A;  2GV9 A;  4KV8 A;  4DF4 A;  4KI4 A;  3LPU A;  3E01 A;  3AVN A;  3V1R A;  3KLF A;  3NCI A;  3S3M A;  1J5O A;  3G0Z A;  1XI1 A;  1IO2 A;  1U04 A;  3QEI A;  1Q8I A;  4L8R B;  4I2P A;  4PWD A;  3NH2 A;  3I0R A;  4FLU A;  3WNF A;  4EZ6 A;  1TKT A;  3CFO A;  3LAL A;  3K59 A;  4H8K A;  3SQ2 A;  4KHN A;  1YVU A;  4CJ5 A;  3KKS A;  2JGU A;  2P51 A;  1C1A A;  2IS3 A;  3AVF A;  5J1E A;  4F8R A;  1S1V A;  5JS1 A;  5HRP A;  4BAC A;  1NKB A;  2QK9 A;  1RCH A;  3I0S A;  1TK8 A;  4YNQ A;  4LY7 A;  5DK5 A;  4CEF A;  3QIN A;  1NK8 A;  1RDB A;  1VRT A;  3TAQ A;  4DQP A;  3EY1 A;  4F3O A;  1Z26 A;  3L3U A;  4OKK A;  3ZSW A;  1QHT A;  2G8W A;  5HP1 A;  3TAP A;  2YNG A;  3O4N A;  4E19 A;  4JRP A;  1A5W A;  4OVL A;  1WN7 A;  1JLB A;  1RT3 A;  3V9W A;  4UQG A;  1L3T A;  4FJM A;  3LAN A;  5CZ1 A;  4HCC A;  2HVI A;  4CFB A;  1WSF A;  3L2U A;  4Z4C A;  4W5O A;  3AO1 A;  3ZSZ A;  3HO1 A;  2YNH A;  3OYK A;  1KFS A;  3VA3 A;  1HYZ A;  1WLJ A;  1GOB A;  3DLE A;  3OYH A;  3LWL A;  3JSM A;  3SYZ A;  3L2W A;  4RW4 A;  2XY5 A;  3HPH A;  4FM2 A;  3SI6 A;  2OPR A;  4Z4H A;  1JLE A;  2FBY A;  3VQ4 A;  3QES A;  1ZBL A;  1NK7 A;  3IG1 A;  4ID1 A;  1NJX A;  3PV8 A;  4NCB A;  2ZQB A;  1NK5 A;  4I9L A;  4CF1 A;  1S1W A;  3TAR A;  1CZB A;  4BE0 A;  3A2F A;  2A1S A;  2DY4 A;  4GVM A;  1JLQ A;  2F96 A;  4DQQ A;  3TAB A;  3RMA A;  3ZCM A;  1RTD A;  3UIQ A;  1WSH A;  4E7H A;  2Z1I A;  1TKX A;  3KJV A;  1X9S A;  1K6Y A;  4RW7 A;  4CGF A;  2G8U A;  4F4K A;  4OGE A;  3KK2 A;  4DSI A;  4CHQ A;  2OPQ A;  3NGY A;  4FJX A;  1RDA A;  2D0A A;  1T7P A;  1S1X A;  5J2N A;  4KHQ A;  2KQ2 A;  3KLI A;  3V9U A;  3VQ9 A;  1QSS A;  3MEE A;  2P1J A;  3V9X A;  2W42 A;  5HBM A;  5HLF A;  3V81 A;  2HHU A;  1C1C A;  4BWJ A;  4FJG A;  4MQ3 A;  1BIU A;  4AHS A;  3OS0 A;  2O4I A;  4CJ3 A;  3AO3 A;  3AVB A;  1KVA A;  4DFP A;  1TK5 A;  1L3U A;  4PY5 A;  4FK4 A;  4ZTF A;  5CYQ A;  3QNN A;  4E0D A;  4FYD A;  3SPY A;  5CYM A;  1JLC A;  2Y1I A;  4ELT A;  1TKD A;  3DRS A;  4KI6 A;  1VK0 A;  2R7Y A;  4IG3 A;  3LWM A;  1FKO A;  3MXJ A;  5KGW A;  5C42 A;  3RWU A;  4FLX A;  3L2R A;  1NOY A;  1BCO A;  2E4L A;  1RT7 A;  3M8R A;  1HNI A;  3PO4 A;  3SZ2 A;  2QKK A;  2ZE2 A;  3NH0 A;  1U4B A;  1RT5 A;  4E1N A;  4C8O A;  1X9M A;  4FJL A;  3G10 A;  3HP9 A;  4CJW A;  3VN5 A;  1QSL A;  1DTT A;  4YFU A;  1JLA A;  4IFY A;  1W0H A;  2PY5 A;  4HVJ A;  1SKW A;  4AHU A;  4R5P A;  3RMD A;  2HHQ A;  3K5L A;  1VSE A;  4DSE A;  3OYF A;  4IG0 A;  3P1G A;  4Q0B A;  4DSJ A;  4W5N A;  1ZBH A;  3AVI A;  3MEG A;  2BGG A;  2A1R A;  3DLB A;  5JS2 A;  2PYJ A;  4CJL A;  4C8N A;  1IKW A; 
#chains in the Genus database with same CATH topology
 4QCL A;  4E1M A;  1EX4 A;  4L3Q A;  1F21 A;  2PFU A;  2GWK A;  1P90 A;  1ASW A;  4CF9 A;  3V9Z A;  2QTD A;  4KHU A;  3L2Q A;  2P5G A;  4BC5 A;  4CCH A;  2IVO A;  2NRX A;  3EE9 A;  1SAZ A;  4JHD B;  3BEX A;  3MN5 A;  1S1T A;  1J6Z A;  3AVK A;  4FJI A;  4KHW A;  3BGR A;  1IBL K;  2E1Y A;  3KTQ A;  3P83 D;  4IEI A;  1C0T A;  2ZGZ A;  4FK0 A;  5LJW A;  3WXK A;  4HTL A;  4A2B A;  3HM8 A;  3HSC A;  4J2B A;  1WUA A;  3L3V A;  4E7J A;  3MN7 A;  1UA1 A;  4KPY A;  4AF1 A;  4DV1 K;  2OTL N;  5LJV A;  3KLH A;  4JHD A;  1BIS A;  1MU2 A;  2IGI A;  3A5O C;  1JKH A;  3PSF A;  4CK2 A;  3AY9 A;  2P9K A;  3VQQ A;  1N8R O;  5C15 A;  2RKI A;  3ZT0 A;  1TGO A;  4XEI A;  1XNR K;  1SL2 A;  1VSJ A;  1RBR A;  2HND A;  3GBT A;  1NK9 A;  4IKF A;  4OGC A;  3O9U A;  3F9M A;  1KVC A;  4WQ5 A;  4K8Z A;  1DEJ A;  4KTW A;  4DSF A;  4DFJ A;  1UOC A;  5DMR A;  5KPT A;  1K73 O;  4LF6 K;  2QXF A;  4HHT A;  4DG1 A;  2B4J A;  4ZHR A;  2VYP A;  1VQ8 N;  1NMD A;  2ITG A;  1VRU A;  4DSL A;  1IBK K;  1IKY A;  1KAX A;  4I7F A;  3THW A;  5J2P A;  1QZ5 A;  2UXC K;  3QEV A;  4KAZ A;  4QS9 A;  3HPO A;  1IKX A;  4FLT A;  1NOZ A;  4LD0 A;  1WSJ A;  2O8B A;  5CR4 A;  3UKU B;  3E9L A;  1VSM A;  3OYB A;  4KHY A;  3DXM B;  1IKV A;  2HF4 A;  3SJJ A;  4CFA A;  2JWK A;  4LFC K;  1NWK A;  2RPI A;  3C7N B;  1XHX A;  3W0L A;  4DTN A;  1S9G A;  4BE1 A;  2GX9 A;  3U8X A;  4IJN A;  3VPZ A;  4U7B A;  4N5S A;  2HHS A;  1RFQ A;  1REV A;  4AM7 A;  4BRE A;  2YNF A;  1RTH A;  2Q97 A;  4FZZ A;  2A5X A;  2RF2 A;  3MED A;  3UKU A;  3WEE A;  4DU1 A;  1JXB A;  3WUH A;  4FJ7 A;  3TAN A;  4U67 L;  2OA8 A;  1NM1 A;  4DKW A;  4N76 A;  5KRS A;  3OVN A;  3KK1 A;  3HVT A;  4CEO A;  4BRH A;  1Q9Y A;  1Q7Y O;  3NH1 A;  1WAF A;  2CH5 A;  5AQK A;  1E4F T;  5AQG A;  3VQ8 A;  1FKP A;  2P9P A;  3ULD A;  3ZET A;  1QQO A;  2QKB A;  5H1S Q;  2WUS A;  4CF0 A;  5CZ2 A;  5KTQ A;  5C25 A;  4BE2 A;  3C95 A;  4B9N A;  2P9S B;  3SUP A;  2G8F A;  3SAG A;  2HHV A;  4DS4 A;  3LM2 A;  3M3Z A;  3I8D A;  1SKR A;  4FWQ A;  2BAN A;  4Z4G A;  1Z25 A;  3TU5 A;  4X64 K;  3SCX A;  2P9I A;  3SMP A;  4BC4 A;  3NFA A;  3L0Q A;  1DLO A;  1UWB A;  3QNO A;  4IWV A;  3K5O A;  4CEZ A;  5B8H A;  4Y1D A;  2QWL A;  4GV9 A;  1RBT A;  3HTV A;  3PO5 A;  2OPS A;  3M1F A;  3HVR A;  4B9U A;  4M3R A;  3MCA B;  4DLE A;  1VAZ A;  1M1K O;  3FZK A;  1BA1 A;  5I3U A;  4CIE A;  2VWB A;  5CHI A;  4O0J A;  1R0A A;  3AA3 A;  3V4I A;  5AQV A;  3HL8 A;  1KD1 O;  1A5V A;  2A40 A;  3LZJ A;  4FO0 A;  2E88 A;  4JAX A;  4FJ8 A;  3SBG A;  3DLK A;  3OS2 A;  2XHB A;  4YDU A;  3FGU A;  2YJF A;  1U6Z A;  1OVQ A;  3IUC A;  1MWM A;  1C0M A;  1I94 K;  3OJS A;  5FPD A;  1OKJ A;  3KK3 A;  2FC0 A;  4DV7 K;  4E7I A;  1LWC A;  4NCG A;  3ZT1 A;  1KRP A;  3WXL A;  3CQX A;  3DM2 A;  1M90 O;  5FLX O;  3T69 A;  4Q5V A;  2QI2 A;  1Q81 O;  3KLG A;  2NRZ A;  3U3Y A;  4M3X A;  1EXQ A;  3L4I A;  3O80 A;  4M7Y A;  4ILJ A;  4CF2 A;  4FLY A;  3QBX A;  1HYS A;  4CD3 A;  2O8F B;  4CZL A;  3OS1 A;  1YTA A;  3ALY A;  4XH4 A;  3ZEU B;  5FRO A;  4FWO A;  1U45 A;  3ULE B;  2KFZ A;  5C24 A;  3D0P A;  4FM1 A;  3T3F A;  2ZJR L;  3WXJ A;  4JN4 A;  4LFA K;  1KAZ A;  3ZX3 A;  4K41 A;  3HJF A;  1I39 A;  4OPH A;  1RT6 A;  4CES A;  4KH4 A;  3LP1 A;  3ZEU A;  1HNW K;  3AAQ A;  2OZS A;  1EKE A;  3MMV A;  2FSK A;  2IOC A;  2QWP A;  1ZBU A;  3SMS A;  3ENO A;  3PX0 A;  1VQ7 N;  2QWR A;  1QVF M;  4PQU A;  1GOA A;  3D2E A;  2B6A A;  1KC8 O;  2QWM A;  4LF4 K;  4ILG B;  1WNS A;  3DMJ A;  1QHA A;  1WSI A;  4ILH A;  4BRQ A;  3O5B A;  2VQE K;  2IVP A;  4CK1 A;  4HUE A;  2KZM A;  2QXL A;  4B08 A;  3AVM A;  4A62 A;  3U6F A;  3QFP A;  3CER A;  4G1Q A;  1X3N A;  3OYJ A;  4IJA A;  4B1V A;  2IDO A;  3D7E O;  1N6Q A;  4KV8 A;  2GV9 A;  3LPU A;  3E01 A;  4LF7 K;  5KQ8 A;  2WFB A;  3K9J A;  3NCI A;  3DJC A;  5AQR A;  1U04 A;  4NB4 A;  1TYQ B;  3OW2 M;  4PWD A;  3E9O A;  3I0R A;  4B1Z A;  1EWQ A;  3BF3 A;  3LAL A;  3SQ2 A;  4H5R A;  4H8K A;  4CJ5 A;  1S1V A;  1J5E K;  5HRP A;  3HI0 A;  4LFB K;  1TK8 A;  1T6C A;  4CEF A;  4IO9 L;  3QIN A;  1XMO K;  1NK8 A;  4DQP A;  4JI7 K;  3ZSW A;  4OKK A;  4PL8 A;  1QHT A;  3TAP A;  3O4N A;  4JRP A;  3MX5 A;  1YVN A;  3THY B;  1HR0 K;  4BRP A;  1RT3 A;  3V9W A;  2P9L B;  3BF1 A;  3LAN A;  4BRI A;  1WSF A;  4C1N K;  4I6M B;  2YNH A;  3OYK A;  1HYZ A;  1GOB A;  4RWT A;  3HPH A;  3SI6 A;  4Z4H A;  3VQ4 A;  1NK7 A;  4NCB A;  2ZQB A;  2NRT A;  3THY A;  3FZH A;  5AQM A;  1JLQ A;  3RSE B;  4DQQ A;  3RMA A;  4A57 A;  4WYB A;  2G8U A;  4F4K A;  1GLE G;  3BZK A;  1YAG A;  3G25 A;  1NGD A;  3R8E A;  3K0S A;  1GLC G;  4I6M A;  2YHY A;  4JD2 A;  1V4S A;  1NGB A;  1T7P A;  1HX1 A;  2KQ2 A;  4LF5 K;  3KLI A;  2E2Q A;  3V9X A;  1GLD G;  1C1C A;  4BWJ A;  4MQ3 A;  3AO3 A;  4ZTF A;  4FYD A;  2OTJ N;  3SPY A;  4WQ4 C;  5E26 A;  3R9P A;  2Y1I A;  3H6E A;  5AQZ A;  1NGH A;  2KHO A;  1BCO A;  3W3D A;  3M8R A;  2E2N A;  2ZE2 A;  4FWK A;  1LOT B;  1QSL A;  4YFU A;  2GWJ A;  1OH7 A;  5EVZ A;  3K5L A;  2ZJQ L;  4IG0 A;  4DR2 K;  4W5N A;  3AVI A;  3MEG A;  2BGG A;  3IKM A;  2PYJ A;  4O8K A;  2Y1J A;  4C8N A;  3NHG A;  1ATN A;  1CZA N;  5T7B A;  2P9N B;  1QTM A;  4B9V A;  4K25 A;  3O6W A;  1QQM A;  4IOC L;  4EP4 A;  2F9W A;  3CQY A;  5BRE A;  5SWM A;  3S3O A;  1BDG A;  4Z4F A;  2BH1 A;  2D0O A;  4BRL A;  5F2R A;  4MDA A;  4O4G A;  2QWN A;  5HRR A;  1RDD A;  1XHZ A;  1ATR A;  2IAJ A;  3GOI A;  1V4T A;  4CJR A;  1G15 A;  3LAK A;  4CER A;  3BDP A;  3IS9 A;  4DTS A;  1KQS M;  1YT3 A;  2P9N A;  3NGZ A;  1N36 K;  4DV0 K;  3OYM A;  5ADX A;  5FDL A;  4H4O A;  2CGL A;  3O3F A;  4KHP K;  2IIR A;  2G8V A;  3C94 A;  5EXW A;  1VQL N;  2B5J A;  4N47 A;  4H4M A;  1OH6 A;  1TAQ A;  3ZX0 A;  4CJP A;  1HMV A;  2O8D B;  3WQT A;  3OYL A;  3SQ1 A;  2YHB A;  5LY3 A;  3HYF A;  5HRN A;  4BR7 A;  4F2R A;  3ZSX A;  1D8Y A;  4BRN A;  4J2E A;  1N32 K;  1XMQ K;  1DTQ A;  1VSF A;  3RMC A;  3CCS N;  4DTM A;  5JIC A;  4YHH K;  2H3G X;  1U47 A;  4CE9 A;  1B9F A;  1BGX T;  3CCV N;  3IRX A;  5SZT A;  1LW2 A;  4JEP A;  1JL2 A;  4I9Q A;  3K57 A;  1NBW A;  3O3G A;  3SAH A;  4J2D A;  4JI0 K;  3NF6 A;  2VCP A;  3AVH A;  4BVO A;  3GL1 A;  3O9S A;  3THX A;  4ICL A;  3U4L A;  4PHT X;  4CHY A;  1DGK N;  4FPA A;  4E89 A;  4IBN A;  2Z1J A;  3DAW A;  2BTF A;  2G8H A;  1WB9 A;  3E1Y A;  3VQA A;  4B9L A;  5AZJ B;  2VG7 A;  3QDK A;  1BQN A;  5M1F A;  3IMX A;  3PSI A;  4CHZ A;  2V52 B;  2GEL A;  3HOS A;  4H0X B;  1FJG K;  1HNV A;  4JKA A;  1RTJ A;  4BY9 C;  3P38 A;  3MXM A;  1W9H A;  3K9K A;  5BRH A;  3LZI A;  2YJE A;  1JCG A;  2D0C A;  4CJU A;  3QEW A;  3THV A;  1KXP A;  5TKW A;  3NE6 A;  4H5T A;  5KI6 A;  4H03 B;  4CJQ A;  4ZTJ A;  1RTI A;  5E41 A;  3LDL A;  2X74 A;  2HMP A;  3DWL A;  3H08 A;  3O4Q A;  1NK6 A;  3NBP A;  4A2A A;  3OYG A;  1WSE A;  3WNE A;  3K5M A;  2E5L K;  3QLH A;  3OYA A;  4KHN A;  1J54 A;  1ATS A;  4JS5 A;  2W41 A;  3VMF B;  4FZX C;  5M1K A;  3CJ7 A;  1SV5 A;  4YOX A;  1HNZ K;  3V1O A;  4DV4 K;  2YV0 X;  2XY6 A;  2X6N A;  1BWF O;  2F8S A;  3B6O A;  4EAH D;  5AQF A;  3SUO A;  4DMN A;  3VQ6 A;  4BQL A;  1MA9 B;  5K14 A;  1VQK N;  1BIZ A;  4CGD A;  1Y64 A;  3RMB A;  3JXU A;  4GVE A;  4FLV A;  4B3O A;  4H0O A;  1VSD A;  3HZ6 A;  1TL1 A;  4FCY A;  5JLF A;  4B8A B;  3A5L C;  3DLH A;  2F9T A;  4GY2 B;  3ASM A;  3O1B A;  4X62 K;  4DU3 A;  4FPB A;  4MO4 A;  4NLB A;  4EHT A;  4DR3 K;  3CJB A;  2A3Z A;  3T7Z A;  4M3U A;  1NGJ A;  4CJV A;  4KRF A;  3ZYY X;  1LV5 A;  3IAY A;  2F8T A;  3TAM A;  3AVL A;  3ZSV A;  4IO8 A;  4BWM A;  1MWK A;  3OYN A;  5J2M A;  5AFU H;  3O8M A;  5IWA K;  3QIO A;  3OJU A;  1BCM A;  4J8F A;  5JLH A;  1YXQ A;  2NNW A;  3P5J A;  1WBD A;  3O9Q A;  4BC2 A;  2HBL A;  3U3G A;  5C2D A;  4DV3 K;  1RBV A;  2UUA K;  4FM0 A;  1A5X A;  1JLF A;  3KK7 A;  1RDW X;  2GUP A;  4LSL A;  1VQM N;  3AO5 A;  2ZD1 A;  4WQ5 C;  3DI6 A;  4K8X A;  4CZG A;  1J53 A;  2IC3 A;  3LDQ A;  1KLN A;  5KRT A;  4F2S A;  2Q31 A;  4HTU A;  1HPZ A;  3QEP A;  4EZ9 A;  3C0B A;  3RVC A;  1RT1 A;  4BRF A;  2D4W A;  1KLM A;  3AA2 A;  3V6D A;  4OPA A;  4K0K K;  1XNQ K;  3GDQ A;  4JKG B;  1XQS C;  4CJS A;  1TV6 A;  3AV9 A;  4C23 A;  4CEE A;  4BRA A;  3J81 O;  4FXD A;  2ASP A;  4H5N A;  1U48 A;  3LAM A;  3CCJ N;  2V7Z A;  3P39 A;  3GG4 A;  1Q18 A;  3HP6 A;  1X9J A;  3CCR N;  3HK2 A;  4FVM A;  4KO0 A;  4ID5 A;  2QW9 A;  3ZSQ A;  1SL1 A;  4H0Y B;  3ISN C;  1HQU A;  3AVG A;  2KTQ A;  3DLG A;  4PKG A;  1NKE A;  4DQI A;  4B1U B;  3DXM A;  3TAF A;  3LP2 A;  4NLC A;  3VTI A;  3TSU A;  5BN9 A;  3QML A;  4W5T A;  2V51 B;  3AO2 A;  2HHH K;  4FWM A;  2ZGY A;  4JKH A;  3H3O B;  3C7N A;  3VEZ A;  3CET A;  1SKS A;  2O8E B;  3M6G A;  4CHN A;  1QZ6 A;  1NGF A;  1HJO A;  2UYT A;  5F1X A;  1YTU A;  2KW4 A;  3CF5 L;  3NGI A;  3KD5 E;  5GIN A;  3M8Q A;  4H5V A;  5MLC Q;  2OPP A;  3UKR B;  4CBU A;  1RT2 A;  2XY7 A;  3ITH A;  3CC7 N;  3HXM A;  3EZW A;  4JKB A;  1K8K B;  2FLO A;  4BRO A;  4G9Z A;  3BP8 A;  1S5J A;  3NDK A;  4CZI A;  4CJE A;  2ZWH A;  1W7A A;  3VEO A;  2ZJP L;  4RG8 A;  1NJZ A;  3L2V A;  4JI1 K;  4CD1 A;  2G8K A;  1S1U A;  3J7Y P;  4KI4 A;  3KLF A;  2KKZ A;  3S3M A;  1J5O A;  2P9S A;  4B3T K;  1Q8I A;  4H0V B;  2DPN A;  4YOW A;  3K59 A;  3CCE N;  3KKS A;  4IZ9 A;  4BR0 A;  2IS3 A;  5J1E A;  3I8B A;  4BAC A;  1RCH A;  2UXB K;  4IXC A;  4LY7 A;  3TTF A;  1RDB A;  3H3N O;  1Z26 A;  1IJJ A;  5AQN A;  5AQT A;  1A5W A;  3WQU A;  1WN7 A;  1EQY A;  3MX2 A;  4LC9 B;  4Z94 A;  2QWO A;  2HVI A;  3P31 A;  3L2U A;  1XC3 A;  2A41 A;  5C12 A;  5GAH P;  1BO5 O;  3BZC A;  1D4X A;  3JSM A;  3SYZ A;  4B1W B;  4RCH A;  3FLC O;  1ZBL A;  4JKD A;  4CF1 A;  1CZB A;  2DY4 A;  4YDU C;  2Q0U A;  2F96 A;  3CPE A;  4CZH A;  3TAB A;  2W6K A;  1RTD A;  4E1J A;  1TKX A;  1X9S A;  2AP1 A;  3KK2 A;  3ATU A;  4QS8 A;  2FF3 B;  2D0A A;  5HOO A;  1S1X A;  2W40 A;  4KHQ A;  4B9Q A;  3EN9 A;  2W42 A;  3MDQ A;  2E2P A;  4FL9 A;  3V81 A;  3VGL A;  4FJG A;  5M1N A;  2O4I A;  3AVB A;  1L3U A;  3CC2 N;  4ISF A;  4FK4 A;  4MLE A;  5CYQ A;  1JLC A;  4ELT A;  1TKD A;  3DRS A;  3IFR A;  2FSN A;  4KBO A;  4IG3 A;  2R7Y A;  3RWU A;  4FLX A;  3L2R A;  2O8F A;  1NOY A;  1NLV A;  1R59 O;  5BR8 K;  4GNI A;  3VES A;  1RT5 A;  3OHR A;  4C8O A;  4JNE A;  3ULE A;  2VGN A;  5I9E B;  1JLA A;  1VQ6 N;  4DR6 K;  3GE1 A;  4AHU A;  2HBJ A;  5EX5 A;  2WTU A;  4GKJ K;  4DSJ A;  5AR0 A;  3WXM B;  2A1R A;  3O9R A;  2F4V K;  3CJC A;  4JS4 A;  1EO1 A;  3MN9 A;  3NF9 A;  3AGR A;  4BDY A;  2ASO A;  3VA0 A;  2QWQ A;  4MFB A;  3VF4 A;  2E2O A;  3JAM O;  1L5U A;  3EO3 A;  3QEX A;  4WFN L;  1ZBI A;  4JI3 K;  3VET A;  4DR1 K;  2NRH A;  5LL6 Z;  1C0U A;  4GV6 A;  2KZZ A;  4RW6 A;  4CF8 A;  2EWS A;  3H1V X;  5GIP A;  3CC4 N;  5LMN K;  3JS6 A;  1BHL A;  3MAQ A;  4MO5 A;  2VG5 A;  2NRW A;  3CYM A;  4R79 A;  4M45 A;  4N41 A;  2PBD A;  3A8Y A;  3EKS A;  3U9Z A;  5BPL A;  3CCU N;  1QSY A;  3PUF A;  4CK3 A;  2Q2R A;  3DXK B;  1SS6 A;  5I42 A;  2YNI A;  4J2A A;  4PKI A;  2E20 A;  1ITG A;  2PZS A;  4ELU A;  4KFB A;  3ENH A;  1EP4 A;  1OH8 A;  4JK8 A;  3OYI A;  4DTO A;  2PAV A;  3UE5 A;  1CLQ A;  1ZBF A;  1MDU B;  3SUQ A;  1HRH A;  4M42 A;  1J9A A;  3LP0 A;  1TYQ A;  4FWR A;  3VOV A;  3DXK A;  3DRR A;  3CCM N;  4LF8 K;  1LWE A;  4B9S A;  4LH5 A;  3VEX A;  4O5F A;  3LDS A;  1T3V A;  3CJA A;  4BGB A;  3HST B;  1KTQ A;  5JVH L;  2Z1G A;  2IVN A;  2RHK A;  1BI4 B;  3NF8 A;  1LW0 A;  4CJK A;  3KKR A;  2P9L A;  4DB3 A;  3ZT2 A;  4DR5 K;  1WSG A;  4W5Q A;  1VSK A;  4AHC A;  5FPM A;  5EU7 A;  2G8I A;  1N34 K;  4DQ8 A;  3ZT3 A;  2YHA A;  3D45 A;  4BRC A;  4IFV A;  1LCU A;  3TAG A;  4DFK A;  1ZYQ A;  1OVY A;  4FJ9 A;  2QM1 A;  4C8L A;  3OYE A;  3RTV A;  2W6L A;  1BI4 A;  2Q0R A;  4FWN A;  1T6D A;  1ZC6 A;  5J2Q A;  1D9F A;  3RSE A;  2CGK A;  2HBM A;  4CEQ A;  4WQ4 A;  3TI0 A;  3SAF A;  2E8A A;  1CZ9 A;  4I2Q A;  2HNZ A;  3AVC A;  4C8K A;  4FLZ A;  4BDP A;  4K43 A;  3JYT A;  4BG9 A;  4DF8 A;  3C6H A;  1Q82 O;  3D6R A;  4F9O A;  3DOL A;  3RRG A;  1HKC A;  3T1H K;  4KRE A;  3RR8 A;  3VQE A;  1D5A A;  1T03 A;  4IDK A;  4PL7 A;  4WCE L;  4OLB A;  4B9T A;  1L3V A;  5BR9 A;  4DTU A;  4A59 A;  2D0P A;  3QIP A;  4EIA A;  4YOV A;  5M1P A;  4FJ5 A;  4Y0W A;  2X6S A;  4IFE A;  2BE2 A;  2NZT A;  1K9M O;  4DS5 A;  4CJ4 A;  2FBX A;  1TUU A;  4M3Y A;  4M3T A;  4CJT A;  3J7Z O;  3V1Q A;  2OYQ A;  2F7T A;  4YOU A;  4DU4 A;  1QE1 A;  3NMU A;  3WXI A;  2HW3 A;  1I3A A;  4DV6 K;  4CIF A;  1KFD A;  1KAY A;  4C8M A;  4X66 K;  1KCF A;  4CZM A;  3EKU A;  3LPT A;  4ISE A;  4FZY A;  1D9D A;  1RT4 A;  3MWT A;  3PY8 A;  1YI2 N;  4HUG A;  1C6V A;  4OPJ A;  3SNN A;  3B8A X;  1QQN A;  1S6P A;  4JYA K;  4CJF A;  1NGE A;  2VGM A;  3VQD A;  5HRS A;  1NKC A;  1Q86 O;  4HUF A;  4LSN A;  3D2F B;  5HRO A;  1BA0 A;  4UY8 O;  2HHW A;  1T8E A;  3PLA A;  2NRV A;  3WNG A;  4AH9 A;  2FXU A;  3PX6 A;  1VSL A;  4K42 A;  2O8D A;  1KVB A;  2WON A;  4C1N I;  1Z6R A;  4A61 A;  2RN2 A;  2HHT A;  4KH6 A;  3ZX2 A;  4M41 A;  4AQY K;  3O1W A;  1CXU A;  2YHX A;  3VEY A;  2YKN A;  2KFN A;  1NNE A;  2FBT A;  3FE1 A;  2NUB A;  1TUY A;  1NJW A;  2ZM6 K;  4JI4 K;  1BL3 A;  1Y97 A;  4WE1 A;  1E3M A;  4RTF D;  1U2V B;  4OKJ A;  3VTH A;  2D5R A;  4A5A A;  2QEX N;  4MLH A;  1O1W A;  4WFA L;  3M8P A;  4DFM A;  1FXX A;  5M1O A;  4DTJ A;  4BR5 A;  2WBN A;  4CHO A;  1HYV A;  3HM9 A;  1ASV A;  3F9K A;  2HMI A;  2OZM A;  4JLH A;  5AZJ A;  3OBY A;  2EX3 A;  3TPQ A;  1U2V A;  2ETJ A;  3TTC A;  4GMJ B;  4HWI A;  4M7X A;  1ILY A;  4BC3 A;  3VF2 A;  3ZSO A;  3G4S N;  3QET A;  4DTR A;  3OTO K;  5C2F A;  1QS4 A;  4Z0U A;  5ADX H;  1VQP N;  3SPZ A;  3AGK A;  3TR8 A;  2V7Y A;  3B6P A;  4GV3 A;  3FFI A;  4CJ7 A;  4W5R A;  1LAW A;  4NYN A;  4DR7 K;  3PX4 A;  5D3G A;  3K2P A;  3LP3 A;  3EL2 A;  1O13 A;  3ZSY A;  3VER A;  4NO7 A;  3CG7 A;  5AQI A;  1EET A;  3CCL N;  2AA4 A;  3VQC A;  3OYC A;  3EE8 A;  1U49 A;  4OO1 J;  1WAJ A;  5C10 A;  4B3R K;  2XRI A;  5FPE A;  1BU6 O;  5ELZ A;  1OH5 A;  2YCH A;  3MWP A;  1CXQ A;  2HNY A;  3CM6 A;  4BRG A;  3DLL L;  5KGX A;  4Z4I A;  3LM9 A;  2VG6 A;  4XH5 A;  3VEW A;  3O3H A;  4BQZ A;  1ZBS A;  4QAG A;  2P9K B;  3J8A A;  1RBS A;  2UUC K;  3M8S A;  4X65 K;  3C6T A;  2ATQ A;  2HB5 A;  4CBW A;  4DF4 A;  5AQJ A;  4PKH A;  3TSP A;  3G0Z A;  4BG8 A;  3QEI A;  4BRM A;  3NH2 A;  4FLU A;  3WNF A;  3CFO A;  4A5B A;  1YVU A;  4M3Z A;  3O4W A;  3G71 N;  3I33 A;  1NKB A;  1GLB G;  1VRT A;  4F3O A;  3F2K A;  3EY1 A;  4JK7 A;  2G8W A;  3L3U A;  5HP1 A;  2YNG A;  1JLB A;  2YX6 A;  3OA9 A;  5AJ3 K;  4UQG A;  1L3T A;  4FJM A;  5CZ1 A;  4HCC A;  4CFB A;  3FR0 A;  4W5O A;  4QS7 A;  3ZSZ A;  4WFB L;  3VA3 A;  5E84 A;  3LWL A;  2XY5 A;  3THW B;  4FM2 A;  1IV0 A;  4H5W A;  1W2B M;  4IOA L;  1NGI A;  3KVG A;  3IG1 A;  1NJX A;  1NG9 A;  2OCE A;  4IOX A;  4CBX A;  3TAR A;  1VQO N;  1YJ9 N;  3QB0 A;  2O8B B;  3ZCM A;  3UIQ A;  1C0F A;  1WSH A;  4E7H A;  1VQ9 N;  4B3M K;  4CGF A;  4DSI A;  2OPQ A;  3NGY A;  4FJX A;  3R3L A;  3A5M C;  5HL7 L;  3PIP L;  3CPW M;  1S3X A;  3ATV A;  4CW7 B;  3V9U A;  3VQ9 A;  1QSS A;  5AQU A;  5GIO A;  3ID8 A;  5HLF A;  5JMV A;  1JJ2 M;  1IG8 A;  2HHU A;  3HRG A;  3OS0 A;  1BIU A;  2GEM A;  1TK5 A;  1KVA A;  2Q36 A;  2ZF5 O;  4DFP A;  4PY5 A;  4H0P A;  3QNN A;  4E0D A;  2NLX A;  3R6M A;  4JKG A;  5AQW A;  4KI6 A;  3L4Q A;  3QBW A;  3WEE B;  1VHX A;  4DV5 K;  3LWM A;  1FKO A;  5KGW A;  2E4L A;  4BVP A;  1HNI A;  3NH0 A;  1X9M A;  4CJW A;  1DTT A;  4IFY A;  1W0H A;  2PY5 A;  4HVJ A;  1SKW A;  3ZLJ A;  4H0T B;  3M5R A;  4R5P A;  4YOT A;  2HHQ A;  1BG3 A;  4DSE A;  3OYF A;  4WF9 L;  4Q0B A;  2P9P B;  1S72 N;  1NJI O;  1ZBH A;  4NXM K;  3ZET B;  3DLB A;  2UXD K;  5AQX A;  1S6Q A;  3E9P A;  2CGJ A;  3KZB A;  4M3W A;  3CMA N;  3BY5 A;  1NMN A;  3SQ0 A;  2O8E A;  1BQM A;  4CEB A;  2P9U B;  2P9I B;  4FW1 A;  1HNX K;  5IT9 O;  4CFD A;  1X9W A;  3KIO A;  3LDP A;  5BPM A;  4CHP A;  4CGJ A;  3UKR A;  1P8Z A;  3MK6 A;  2WC9 A;  1S22 A;  4DR4 K;  3QIC A;  1NJY A;  1TAU A;  4ELV A;  1GLL O;  4AHV A;  5AQY A;  3AO4 A;  1K8K A;  1VQ5 N;  2P9U A;  1JXE A;  2LSN A;  3ID6 A;  3ZT4 A;  2I5J A;  1B92 A;  2X78 A;  2RE2 A;  4YOR A;  2ITM A;  4AHT A;  4E7L A;  1YJN N;  3H1Q A;  5DM7 L;  3SK3 A;  1ESV A;  1NGA A;  3SBT A;  4XH1 A;  4DQS A;  3TAE A;  1YHQ N;  4FLW A;  1IBM K;  3DYA A;  4CZK A;  4CIG A;  4CVN E;  3IDH A;  4V19 S;  4AM6 A;  4KB0 A;  4KTZ A;  4O44 A;  3AVJ A;  3NVM A;  2WOM A;  5BPN A;  4O8U A;  3AAP A;  5AQL A;  3AVA A;  4RW8 A;  4CI6 A;  3CIP A;  1FK9 A;  1XWL A;  3P4I A;  4PUO A;  3SV4 A;  1NU0 A;  4GW6 A;  2CH6 A;  4Y1C A;  1N33 K;  1SUQ A;  4DTP A;  4OJR A;  4JI5 K;  4AHR A;  1RIL A;  4JKE A;  3S41 A;  1UA0 A;  4DCH A;  3N4Q A;  2PYL A;  3QFU A;  3J7A P;  3S9H A;  2VWJ A;  3OYD A;  2P5O A;  3TTD A;  4FVU A;  3HT3 A;  4JKF A;  4KKO A;  3CFR A;  1HUX A;  3T1Y K;  3SV3 A;  1JCE A;  3RRH A;  4JKC A;  4B9M A;  1RDU A;  3CI5 A;  2DFE A;  4FSV A;  4RW9 A;  3QO9 A;  4EP5 A;  1TL3 A;  4JV5 K;  1X3M A;  1GLF O;  1WBB A;  3T19 A;  3S3N A;  4JRQ A;  3F73 A;  1E4G T;  4CED A;  3G6E N;  4JI2 K;  4DLG A;  4OKE A;  2A42 A;  4BRD A;  2UUB K;  5M1Q A;  4N56 A;  3EZ5 A;  1LAV A;  3L8B A;  3CFP A;  4E7K A;  1B9D A;  4JI6 K;  4FOI A;  3D2E B;  4YY3 K;  5LMU K;  2AJQ A;  3QER A;  4FJJ A;  1N5Y A;  1UAX A;  3MXI A;  1SZ2 A;  4HCB A;  4EHU A;  4BGA A;  3AA5 X;  2Z1H A;  4KH5 A;  4QOZ B;  3VF6 A;  1QQC A;  1C0G A;  1RDC A;  3VEV A;  4OPK A;  3CQ8 A;  1Z05 A;  1NK0 A;  3H46 O;  3OY9 A;  2FBV A;  3ZSR A;  5GAE P;  1TVR A;  1HJR A;  3I56 N;  1YIT N;  1RNH A;  3FZL A;  2XO7 A;  1TK0 A;  5AQQ A;  3VQP A;  1K8A O;  4DWI A;  4LH4 A;  3VQ5 A;  4BDZ A;  4F3T A;  4XIU A;  1VSI A;  2EHG A;  1NGC A;  5JVG L;  1IH7 A;  2GTD A;  3UB5 A;  5FRN A;  4MDB A;  2GBZ A;  3Q7C A;  1XUP O;  4BR9 A;  2JWL A;  5F0X A;  4BRK A;  2E6L A;  4PA1 A;  4DTX A;  3DLR A;  3O9T A;  4B3S K;  1Q9X A;  2D0B A;  1HLU A;  4CGH A;  4FOE A;  1GOC A;  2HF3 A;  4OLA A;  1RBU A;  2YKM A;  5AQH A;  4CZE A;  2QA4 N;  1IG9 A;  3HBT A;  3NAE A;  1XC9 A;  3CM5 A;  4DQR A;  1ASU A;  3F5T A;  4IEE A;  2FF6 A;  2HBK A;  3K58 A;  3SLC A;  3AA4 A;  4BR2 A;  3ENB A;  2Q1N A;  3SQ4 A;  4Z4E A;  1JCF A;  4FWP A;  4CZJ A;  2ASM A;  2BDP A;  1BUP A;  4JD2 B;  2HVH A;  4GKK K;  3T1A A;  5BRF A;  5AZI B;  4DUY K;  4M63 C;  4FK2 A;  3TWH A;  1YIJ N;  3VGM A;  3N4P A;  5BRD A;  5TKY A;  2O8C B;  3MEC A;  5CY4 A;  3VQB A;  1H1V A;  1QVG M;  1T05 A;  2YHW A;  4FJK A;  1EWR A;  1JL1 A;  4ISG A;  4CEA A;  2I7P A;  1ZXO A;  3MCP A;  4AIL C;  4YOY A;  2GUI A;  4O5B A;  3A0I X;  1NGG A;  4IDH A;  4NYF A;  2JLE A;  2Q3S A;  2HOE A;  3BUZ B;  5AZI A;  1L3S A;  3KLE A;  2VWK A;  3EEQ A;  4CGG A;  5GAD P;  4O0I A;  2O8C A;  3CHW A;  4KHS A;  5GAG P;  3AAR A;  5FPN A;  4DHY A;  4CFC A;  1NK4 A;  5FRM A;  3C6U A;  4CGI A;  2D1K A;  4KB1 A;  3SUN A;  5EOY A;  3WT0 A;  3NF7 A;  2DFF A;  2KLA A;  2E6M A;  1S9E A;  4O55 A;  5KPZ A;  3V9S A;  3DRP A;  4FJN A;  3O08 A;  3FZM A;  4DSK A;  1VQ4 N;  4B1X B;  4LF9 K;  1YUW A;  2A6A A;  1BOT O;  2XY8 A;  3FZF A;  3Q7B A;  3K5N A;  5AQP A;  4B8C A;  3E66 A;  4E3S A;  2DFH A;  1SL0 A;  1G99 A;  1HPM A;  2OAN A;  1WOQ A;  2E1Z A;  3LDN A;  3KD1 E;  4TSX A;  5KPR A;  1FW6 A;  1VSH A;  3EYZ A;  3RR7 A;  4DUZ K;  3HPG A;  4CEC A;  3NVK A;  5EY4 A;  1TKZ A;  1LWF A;  1DT9 A;  3LL3 A;  2I7N A;  3WNH A;  2DTU A;  1HKB A;  3VQ7 A;  2YI1 A;  3I55 N;  4KTQ A;  1C1B A;  4CZF A;  3CME N;  5C0Y A;  1JLG A;  5KQD A;  1YJW N;  3CD6 N;  1X1P A;  4NCA A;  3DOK A;  5CE3 A;  2HHX A;  4FWL A;  4FW2 A;  3KWG A;  1KSP A;  2O4G A;  4FJH A;  1HQE A;  3C65 A;  3PIO L;  5DM6 L;  3AVN A;  2BUP A;  3V1R A;  3CJ1 A;  1SQK A;  1XI1 A;  1IO2 A;  4L8R B;  4I2P A;  4EZ6 A;  1TKT A;  2JGU A;  2P51 A;  1C1A A;  3AVF A;  4F8R A;  4OX9 K;  5JS1 A;  5BN8 A;  2QK9 A;  3I0S A;  4YNQ A;  5DK5 A;  3VEN A;  3FFK B;  3TAQ A;  4E19 A;  3CXC M;  3KWI A;  3R1X A;  4OVL A;  3D2F A;  3THX B;  4Z4C A;  4FWS A;  3AO1 A;  3HOT A;  2NRR A;  3HO1 A;  1KFS A;  1HKG A;  3LDO A;  1WLJ A;  2HST A;  3DLE A;  3OYH A;  3L2W A;  4RW4 A;  2OPR A;  1GLJ O;  1JLE A;  2FBY A;  3QES A;  3C6A A;  3CCQ N;  1W97 L;  4ID1 A;  2UU9 K;  3PV8 A;  1NK5 A;  4I9L A;  1S1W A;  4BE0 A;  3A2F A;  2A1S A;  4GVM A;  1DKG D;  3TSQ A;  2Z1I A;  3KJV A;  1K6Y A;  4RW7 A;  5AQO A;  4OGE A;  4CHQ A;  1YF5 L;  1RDA A;  4EFH A;  4JK9 A;  3VGK A;  5J2N A;  4B1Y B;  3MEE A;  2P1J A;  5A2Q O;  5HBM A;  4NXN K;  3H45 C;  4AHS A;  4CJ3 A;  3CJ9 A;  4BR4 A;  3SJH A;  5CYM A;  5AFU A;  1RGI A;  1VK0 A;  3MXJ A;  5C42 A;  1T44 A;  1RT7 A;  3PO4 A;  3SZ2 A;  2J4R A;  2QKK A;  1U4B A;  3OBW A;  4E1N A;  5AQS A;  4FJL A;  3G10 A;  3HP9 A;  3U9D A;  3VN5 A;  3A5N C;  4DV2 K;  3MN6 A;  3L6Q A;  3RMD A;  1GLA G;  3J80 O;  3KHY A;  1VSE A;  3P1G A;  2FSJ A;  2VQF K;  1VQN N;  5JS2 A;  4CJL A;  4JI8 K;  1IKW A; 
#chains in the Genus database with same CATH homology
 4QCL A;  4E1M A;  1EX4 A;  1S6Q A;  3NHG A;  4JS4 A;  5T7B A;  4BDY A;  3NF9 A;  1F21 A;  3VA0 A;  4M3W A;  1QTM A;  4B9V A;  4CF9 A;  1ASW A;  4MFB A;  3V9Z A;  4KHU A;  4EP4 A;  3L2Q A;  2P5G A;  5SWM A;  3S3O A;  3QEX A;  1L5U A;  4Z4F A;  4CCH A;  1ZBI A;  3SQ0 A;  1BQM A;  4CEB A;  4O4G A;  5HRR A;  1C0U A;  1RDD A;  4FW1 A;  4RW6 A;  4CF8 A;  1XHZ A;  2KZZ A;  1S1T A;  3AVK A;  2IAJ A;  4CFD A;  4FJI A;  1X9W A;  3BGR A;  4KHW A;  3KIO A;  4CJR A;  1G15 A;  3KTQ A;  3LAK A;  4CER A;  3P83 D;  3IS9 A;  1BHL A;  4CHP A;  1C0T A;  4CGJ A;  3MAQ A;  4DTS A;  3BDP A;  4FK0 A;  2VG5 A;  1YT3 A;  3CYM A;  4M45 A;  3NGZ A;  4N41 A;  4J2B A;  3L3V A;  3OYM A;  4E7J A;  1NJY A;  5FDL A;  4H4O A;  1TAU A;  1UA1 A;  3PUF A;  4CK3 A;  3O3F A;  1QSY A;  4KPY A;  4ELV A;  4AHV A;  3AO4 A;  5I42 A;  2G8V A;  2YNI A;  3C94 A;  1JXE A;  2B5J A;  2LSN A;  3ZT4 A;  2I5J A;  3KLH A;  4J2A A;  4N47 A;  1B92 A;  1BIS A;  1ITG A;  1MU2 A;  2PZS A;  2IGI A;  2X78 A;  4E7L A;  1JKH A;  4H4M A;  4KFB A;  1EP4 A;  4AHT A;  4CK2 A;  4ELU A;  1TAQ A;  4CJP A;  3VQQ A;  3OYI A;  1HMV A;  4DTO A;  3OYL A;  3SQ1 A;  2RKI A;  2YHB A;  3ZT0 A;  1TGO A;  1CLQ A;  3HYF A;  1ZBF A;  1SL2 A;  1VSJ A;  4DQS A;  3TAE A;  5HRN A;  3SUQ A;  1HRH A;  4FLW A;  1RBR A;  4F2R A;  2HND A;  3ZSX A;  1D8Y A;  4J2E A;  4M42 A;  3DYA A;  1J9A A;  3LP0 A;  1NK9 A;  4OGC A;  4CIG A;  4IKF A;  1DTQ A;  1VSF A;  4KB0 A;  4KTZ A;  3RMC A;  4DTM A;  4O44 A;  3AVJ A;  3DRR A;  1LWE A;  4B9S A;  4LH5 A;  2WOM A;  1KVC A;  3LDS A;  3AVA A;  3HST B;  4RW8 A;  1U47 A;  4CE9 A;  1B9F A;  1BGX T;  4K8Z A;  1KTQ A;  3IRX A;  5SZT A;  1FK9 A;  1XWL A;  1LW2 A;  4KTW A;  4DSF A;  1JL2 A;  4DFJ A;  2Z1G A;  4I9Q A;  3K57 A;  4PUO A;  3SV4 A;  1BI4 B;  4GW6 A;  3O3G A;  1UOC A;  4Y1C A;  4J2D A;  3NF6 A;  3NF8 A;  5DMR A;  1SUQ A;  4DTP A;  1LW0 A;  2QXF A;  4CJK A;  4HHT A;  3KKR A;  3AVH A;  4OJR A;  4DG1 A;  2B4J A;  4AHR A;  4ICL A;  4ZHR A;  4CHY A;  1RIL A;  3ZT2 A;  1WSG A;  4W5Q A;  1VSK A;  4E89 A;  1UA0 A;  4IBN A;  2Z1J A;  4AHC A;  2ITG A;  5EU7 A;  2G8I A;  1VRU A;  2G8H A;  2PYL A;  3ZT3 A;  4DSL A;  2YHA A;  3VQA A;  4B9L A;  3D45 A;  4M3Z A;  1IKY A;  4IFV A;  2VG7 A;  3TAG A;  3S9H A;  1BQN A;  4DFK A;  4I7F A;  2VWJ A;  3OYD A;  5J2P A;  1ZYQ A;  2P5O A;  4FJ9 A;  4CHZ A;  3OYE A;  3HT3 A;  3RTV A;  3QEV A;  4C8L A;  4KAZ A;  3HPO A;  4KKO A;  3CFR A;  1BI4 A;  1IKX A;  4FLT A;  3SV3 A;  1NOZ A;  5J2Q A;  1D9F A;  3RRH A;  4B9M A;  4LD0 A;  1HNV A;  1WSJ A;  2DFE A;  4CEQ A;  1VSM A;  1RTJ A;  4RW9 A;  3TI0 A;  3QO9 A;  4EP5 A;  1TL3 A;  3OYB A;  4KHY A;  3MXM A;  1CZ9 A;  1IKV A;  1W9H A;  4I2Q A;  3T19 A;  4CFA A;  3SJJ A;  3S3N A;  4JRQ A;  2HNZ A;  3F73 A;  3AVC A;  4C8K A;  4FLZ A;  4CED A;  3JYT A;  3LZI A;  4BDP A;  2D0C A;  4CJU A;  3QEW A;  3THV A;  4DF8 A;  4DLG A;  3NE6 A;  2RPI A;  1XHX A;  4DTN A;  1S9G A;  4OKE A;  4BE1 A;  3DOL A;  4N56 A;  4N5S A;  3RRG A;  3EZ5 A;  2HHS A;  1LAV A;  5KI6 A;  3L8B A;  3CFP A;  4E7K A;  1B9D A;  1REV A;  4CJQ A;  2YNF A;  1RTH A;  3RR8 A;  3VQE A;  4KRE A;  2AJQ A;  3QER A;  4FZZ A;  1D5A A;  1T03 A;  2RF2 A;  3MED A;  4ZTJ A;  1RTI A;  4IDK A;  1N5Y A;  1UAX A;  4FJJ A;  5E41 A;  2X74 A;  3MXI A;  4OLB A;  4HCB A;  4B9T A;  4DU1 A;  3H08 A;  3O4Q A;  1NK6 A;  3NBP A;  1JXB A;  1L3V A;  3OYG A;  1WSE A;  3WNE A;  3K5M A;  3AA5 X;  3QLH A;  3OYA A;  4DTU A;  3TAN A;  2OA8 A;  4FJ7 A;  2Z1H A;  1J54 A;  4N76 A;  5KRS A;  3QIP A;  3OVN A;  3KK1 A;  3HVT A;  4FJ5 A;  4CEO A;  2X6S A;  4QOZ B;  2BE2 A;  4JS5 A;  1Q9Y A;  3NH1 A;  1QQC A;  1WAF A;  4FZX C;  1RDC A;  4DS5 A;  1SV5 A;  4OPK A;  3CQ8 A;  4CJ4 A;  2FBX A;  1NK0 A;  4M3Y A;  3V1O A;  3OY9 A;  2FBV A;  3VQ8 A;  3ZSR A;  1TVR A;  1HJR A;  2YV0 X;  4M3T A;  4CJT A;  2X6N A;  2XY6 A;  1FKP A;  3V1Q A;  2OYQ A;  3ULD A;  2F8S A;  3B6O A;  4DU4 A;  3SUO A;  2QKB A;  1QE1 A;  1RNH A;  3VQ6 A;  4DMN A;  2HW3 A;  1I3A A;  4CF0 A;  5CZ2 A;  4CIF A;  5KTQ A;  2XO7 A;  1KFD A;  5K14 A;  1TK0 A;  1BIZ A;  3VQP A;  4DWI A;  4LH4 A;  4CGD A;  5C25 A;  4BE2 A;  3C95 A;  3RMB A;  4B9N A;  4C8M A;  1KCF A;  3LPT A;  3SUP A;  2G8F A;  4FZY A;  1D9D A;  3VQ5 A;  1RT4 A;  4BDZ A;  4DS4 A;  2HHV A;  2Y1J A;  3I8D A;  1SKR A;  4XIU A;  4F3T A;  4FLV A;  4B3O A;  1VSI A;  1VSD A;  1TL1 A;  2EHG A;  4FCY A;  3PY8 A;  2BAN A;  4Z4G A;  4HUG A;  1Z25 A;  1C6V A;  3SCX A;  4OPJ A;  4B8A B;  3SNN A;  1IH7 A;  3NFA A;  3DLH A;  1DLO A;  3ASM A;  1S6P A;  1UWB A;  3QNO A;  5FRN A;  2GBZ A;  4CJF A;  3K5O A;  4CEZ A;  4DU3 A;  4Y1D A;  3VQD A;  5HRS A;  2E6L A;  1NKC A;  4PA1 A;  1RBT A;  4DTX A;  3PO5 A;  3DLR A;  2OPS A;  4HUF A;  4M3U A;  3HVR A;  4LSN A;  4B9U A;  4CJV A;  5HRO A;  4M3R A;  4DLE A;  1Q9X A;  4KRF A;  2D0B A;  1LV5 A;  2HHW A;  3IAY A;  1T8E A;  5I3U A;  4CGH A;  2F8T A;  3TAM A;  3WNG A;  1GOC A;  3AVL A;  4AH9 A;  4CIE A;  3ZSV A;  4OLA A;  4O0J A;  1RBU A;  2YKM A;  4BWM A;  1R0A A;  3AA3 A;  3V4I A;  3HL8 A;  3OYN A;  3PX6 A;  1IG9 A;  5J2M A;  1A5V A;  1VSL A;  3NAE A;  3LZJ A;  1XC9 A;  3CM5 A;  4DQR A;  4FJ8 A;  3QIO A;  1ASU A;  3OJU A;  3DLK A;  3OS2 A;  2XHB A;  1KVB A;  2WON A;  3K58 A;  1BCM A;  3AA4 A;  2RN2 A;  2HHT A;  3P5J A;  4M41 A;  3SQ4 A;  4Z4E A;  1CXU A;  1C0M A;  3U3G A;  2YKN A;  3OJS A;  4E7I A;  1RBV A;  3KK3 A;  2FC0 A;  2BDP A;  2HVH A;  4FM0 A;  2FBT A;  2KFN A;  2NUB A;  1A5X A;  1JLF A;  1LWC A;  4LSL A;  4NCG A;  3T1A A;  3ZT1 A;  3AO5 A;  1NJW A;  2ZD1 A;  1KRP A;  4K8X A;  3DI6 A;  4FK2 A;  3TWH A;  3DM2 A;  1BL3 A;  1J53 A;  2IC3 A;  1KLN A;  5KRT A;  1Y97 A;  4WE1 A;  4F2S A;  4HTU A;  1HPZ A;  4Q5V A;  3QEP A;  4OKJ A;  2D5R A;  4EZ9 A;  1RT1 A;  3KLG A;  3MEC A;  5CY4 A;  3U3Y A;  1KLM A;  3AA2 A;  3VQB A;  4M3X A;  1EXQ A;  3V6D A;  1O1W A;  1T05 A;  3M8P A;  4DFM A;  4FJK A;  1JL1 A;  4CF2 A;  4CEA A;  1FXX A;  4CJS A;  4DTJ A;  4FLY A;  1TV6 A;  3AV9 A;  1HYS A;  4CHO A;  4CEE A;  1HYV A;  3HM9 A;  4AIL C;  3OS1 A;  1YTA A;  1ASV A;  2GUI A;  3F9K A;  4O5B A;  4JLH A;  1L3S A;  4NYF A;  2JLE A;  2Q3S A;  3ALY A;  2HMI A;  5FRO A;  1U45 A;  4FXD A;  1U48 A;  3LAM A;  3KLE A;  2KFZ A;  5C24 A;  3D0P A;  2EX3 A;  4FM1 A;  2VWK A;  3T3F A;  4CGG A;  2ETJ A;  3HP6 A;  4O0I A;  4GMJ B;  4KHS A;  3HK2 A;  4FVM A;  4KO0 A;  3ZSO A;  4CFC A;  1NK4 A;  5FRM A;  4ID5 A;  3C6U A;  4CGI A;  3ZSQ A;  3QET A;  1SL1 A;  4DTR A;  4KB1 A;  3ISN C;  3SUN A;  1HQU A;  3HJF A;  3AVG A;  3NF7 A;  2KTQ A;  2DFF A;  3DLG A;  1QS4 A;  1I39 A;  2E6M A;  4Z0U A;  1NKE A;  4DQI A;  1S9E A;  4O55 A;  3SPZ A;  3V9S A;  1RT6 A;  3TAF A;  3LP2 A;  3DRP A;  4CES A;  4FJN A;  3LP1 A;  3TR8 A;  4W5T A;  3AO2 A;  3B6P A;  3FFI A;  4DSK A;  4W5R A;  1LAW A;  4NYN A;  2OZS A;  3PX4 A;  1EKE A;  5D3G A;  2IOC A;  3K2P A;  1SKS A;  1ZBU A;  2XY8 A;  3K5N A;  3PX0 A;  3LP3 A;  3ZSY A;  4B8C A;  4E3S A;  4CHN A;  2DFH A;  3CG7 A;  1SL0 A;  4PQU A;  1GOA A;  1EET A;  3VQC A;  2B6A A;  1YTU A;  3OYC A;  2KW4 A;  1U49 A;  3KD1 E;  3NGI A;  3KD5 E;  1WAJ A;  3M8Q A;  1WNS A;  3DMJ A;  4TSX A;  1VSH A;  3EYZ A;  2OPP A;  2XRI A;  3RR7 A;  1RT2 A;  3HPG A;  2XY7 A;  3ITH A;  3HXM A;  4CEC A;  1TKZ A;  1LWF A;  1WSI A;  3WNH A;  2DTU A;  1CXQ A;  2HNY A;  3VQ7 A;  3CM6 A;  5KGX A;  4Z4I A;  4KTQ A;  1C1B A;  4CK1 A;  4HUE A;  2KZM A;  1JLG A;  3O3H A;  2VG6 A;  4B08 A;  3AVM A;  2OZM A;  1S5J A;  1X1P A;  3U6F A;  4NCA A;  3DOK A;  4G1Q A;  3NDK A;  4CJE A;  3OYJ A;  4QAG A;  4RG8 A;  2HHX A;  1NJZ A;  4FW2 A;  1RBS A;  3L2V A;  2IDO A;  3M8S A;  1KSP A;  2O4G A;  1N6Q A;  4FJH A;  2G8K A;  1HQE A;  1S1U A;  3C6T A;  2ATQ A;  2HB5 A;  2GV9 A;  4KV8 A;  4DF4 A;  4KI4 A;  3LPU A;  3E01 A;  3AVN A;  3V1R A;  3KLF A;  3NCI A;  3S3M A;  1J5O A;  3G0Z A;  1XI1 A;  1IO2 A;  1U04 A;  3QEI A;  1Q8I A;  4L8R B;  4I2P A;  4PWD A;  3NH2 A;  3I0R A;  4FLU A;  3WNF A;  4EZ6 A;  1TKT A;  3CFO A;  3LAL A;  3K59 A;  4H8K A;  3SQ2 A;  4KHN A;  1YVU A;  4CJ5 A;  3KKS A;  2JGU A;  2P51 A;  1C1A A;  2IS3 A;  3AVF A;  5J1E A;  4F8R A;  1S1V A;  5JS1 A;  5HRP A;  4BAC A;  1NKB A;  2QK9 A;  1RCH A;  3I0S A;  1TK8 A;  4YNQ A;  4LY7 A;  5DK5 A;  4CEF A;  3QIN A;  1NK8 A;  1RDB A;  1VRT A;  3TAQ A;  4DQP A;  3EY1 A;  4F3O A;  1Z26 A;  3L3U A;  4OKK A;  3ZSW A;  1QHT A;  2G8W A;  5HP1 A;  3TAP A;  2YNG A;  3O4N A;  4E19 A;  4JRP A;  1A5W A;  4OVL A;  1WN7 A;  1JLB A;  1RT3 A;  3V9W A;  4UQG A;  1L3T A;  4FJM A;  3LAN A;  5CZ1 A;  4HCC A;  2HVI A;  4CFB A;  1WSF A;  3L2U A;  4Z4C A;  4W5O A;  3AO1 A;  3ZSZ A;  3HO1 A;  2YNH A;  3OYK A;  1KFS A;  3VA3 A;  1HYZ A;  1WLJ A;  1GOB A;  3DLE A;  3OYH A;  3LWL A;  3JSM A;  3SYZ A;  3L2W A;  4RW4 A;  2XY5 A;  3HPH A;  4FM2 A;  3SI6 A;  2OPR A;  4Z4H A;  1JLE A;  2FBY A;  3VQ4 A;  3QES A;  1ZBL A;  1NK7 A;  3IG1 A;  4ID1 A;  1NJX A;  3PV8 A;  4NCB A;  2ZQB A;  1NK5 A;  4I9L A;  4CF1 A;  1S1W A;  3TAR A;  1CZB A;  4BE0 A;  3A2F A;  2A1S A;  2DY4 A;  4GVM A;  1JLQ A;  2F96 A;  4DQQ A;  3TAB A;  3RMA A;  3ZCM A;  1RTD A;  3UIQ A;  1WSH A;  4E7H A;  2Z1I A;  1TKX A;  3KJV A;  1X9S A;  1K6Y A;  4RW7 A;  4CGF A;  2G8U A;  4F4K A;  4OGE A;  3KK2 A;  4DSI A;  4CHQ A;  2OPQ A;  3NGY A;  4FJX A;  1RDA A;  2D0A A;  1T7P A;  1S1X A;  5J2N A;  4KHQ A;  2KQ2 A;  3KLI A;  3V9U A;  3VQ9 A;  1QSS A;  3MEE A;  2P1J A;  3V9X A;  2W42 A;  5HBM A;  5HLF A;  3V81 A;  2HHU A;  1C1C A;  4BWJ A;  4FJG A;  4MQ3 A;  1BIU A;  4AHS A;  3OS0 A;  2O4I A;  4CJ3 A;  3AO3 A;  3AVB A;  1KVA A;  4DFP A;  1TK5 A;  1L3U A;  4PY5 A;  4FK4 A;  4ZTF A;  5CYQ A;  3QNN A;  4E0D A;  4FYD A;  3SPY A;  5CYM A;  1JLC A;  2Y1I A;  4ELT A;  1TKD A;  3DRS A;  4KI6 A;  1VK0 A;  2R7Y A;  4IG3 A;  3LWM A;  1FKO A;  3MXJ A;  5KGW A;  5C42 A;  3RWU A;  4FLX A;  3L2R A;  1NOY A;  1BCO A;  2E4L A;  1RT7 A;  3M8R A;  1HNI A;  3PO4 A;  3SZ2 A;  2QKK A;  2ZE2 A;  3NH0 A;  1U4B A;  1RT5 A;  4E1N A;  4C8O A;  1X9M A;  4FJL A;  3G10 A;  3HP9 A;  4CJW A;  3VN5 A;  1QSL A;  1DTT A;  4YFU A;  1JLA A;  4IFY A;  1W0H A;  2PY5 A;  4HVJ A;  1SKW A;  4AHU A;  4R5P A;  3RMD A;  2HHQ A;  3K5L A;  1VSE A;  4DSE A;  3OYF A;  4IG0 A;  3P1G A;  4Q0B A;  4DSJ A;  4W5N A;  1ZBH A;  3AVI A;  3MEG A;  2BGG A;  2A1R A;  3DLB A;  5JS2 A;  2PYJ A;  4CJL A;  4C8N A;  1IKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...