2E4LA

Thermodynamic and structural analysis of thermolabile rnase hi from shewanella oneidensis mr-1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
LKLIHIFTDGSCLGNPGPGGYGIVMNYKGHTKEMSDGFSLTTNNRMELLAPIVALEALKEPCKIILTSDSQYMRQGIMTWIHGWKKKGWMTSNRTPVKNVDLWKRLDKAAQLHQIDWRWVKGHAGHAENERCDQLARAAAEANPTQIDTGYQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Structural, thermodynamic, and mutational analyses of a psychrotrophic RNase HI.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2e4lA00
4CF2A 4GVMA 3KK3A 3BDPA 1BI4B 2NUBA 2FBTA 3EY1A 1LW2A 2FC0A 2O4GA 2IDOA 4KV8A 3VQBA 4AHSA 4W5RA 4IDKA 4FLZA 5J2QA 4B9LA 4LSNA 1RNHA 1JXEA 4AHTA 1VSHA 4ID1A 4CJEA 3ALYA 1U47A 4CJ3A 3SV4A 1VSKA 1UA0A 3SQ2A 4AHRA 1C0UA 3VQ4A 4Q5VA 4DSIA 3ZCMA 1CXQA 4DSFA 5SWMA 4DTJA 5J2MA 2E4LA 1BISA 1I3AA 4O44A 4B9VA 1VSMA 4CHOA 4CK3A 1HPZA 1ZBLA 1SKWA 5HRPA 2DFFA 1EKEA 4EZ6A 5E41A 2XY5A 3QIPA 3TI0A 1D9DA 4DF4A 1RTJA 1NJZA 3AO1A 4JS5A 3SPZA 1Z26A 1WNSA 3NHGA 4LSLA 4OLBA 4TSXA 4FVMA 3WNEA 3PX0A 3DLRA 3PUFA 2A1RA 4W5TA 2Z1IA 1EP4A 3TAGA 1C0MA 1XI1A 4PY5A 4KRFA 3LALA 1ASUA 4KI6A 3LPTA 3F9KA 1RBVA 4IG3A 3DLHA 3PV8A 3AVKA 1X9SA 1TGOA 3CFPA 1S1UA 3IS9A 3OYLA 3K5MA 4DWIA 1BCOA 3NCIA 3RRGA 1HRHA 3L8BA 3MEEA 1RT7A 3SJJA 3OYGA 2GV9A 1D5AA 3DRPA 3DMJA 3P5JA 4DFMA 2FBYA 3AVNA 1J54A 2HHTA 4DSKA 3AVBA 1YTAA 1TK5A 3MEDA 3OS2A 4FJJA 5I3UA 3C6TA 3DYAA 4CESA 4QOZB 1WN7A 3KKSA 4CF1A 4DS4A 4CJ4A 4KHWA 3OYIA 3HO1A 1K6YA 1FXXA 2YKNA 1W0HA 3ITHA 2X78A 1TK8A 4K8XA 3TABA 1KRPA 3QINA 4I2QA 3LDSA 1J53A 4JS4A 4CF9A 4DTUA 2QKKA 4KHSA 1NJXA 4WE1A 3QNNA 4IFVA 3RTVA 4O5BA 3NF9A 1RT6A 4CEOA 5HLFA 2Z1GA 2YNFA 1S1XA 4ZHRA 4KAZA 1KLMA 4CE9A 4CJSA 4FXDA 1S6PA 5I42A 3ISNC 4RW4A 4FJGA 3NGYA 4C8NA 1JL2A 3ZSWA 3OYEA 3MAQA 2RPIA 4OKKA 3RMAA 1KLNA 4LH5A 4DU1A 4J2DA 5JS2A 3QIOA 4CJQA 2PY5A 1J5OA 4B9UA 4HCBA 3RR7A 2PZSA 2ZQBA 2P1JA 4CGIA 5EU7A 2KW4A 1XHZA 4E7KA 4AHVA 2FBVA 3QEXA 1CZ9A 2DFEA 2IAJA 3M8PA 4M3XA 1ASWA 1HJRA 2HHSA 3QESA 2YV0X 4OGCA 4C8MA 3LP1A 4I7FA 3ZT0A 2XRIA 1T8EA 4F2RA 2BDPA 2VWKA 4BDPA 3RRHA 3QO9A 3ASMA 3DRRA 3NE6A 4FLXA 3SUNA 5HROA 1QSYA 2D5RA 2G8HA 3VA3A 3V81A 3KK2A 3IRXA 3SQ0A 3TAQA 1Q9XA 1ZBHA 4CGJA 1YTUA 1N6QA 1EETA 4AH9A 1JLGA 4CJKA 3NDKA 4FJLA 3OVNA 4CFBA 4B08A 3PY8A 1KVAA 4DU3A 2YHBA 3HT3A 4NCBA 4Q0BA 4GW6A 1TKZA 3G0ZA 4OPKA 1NK9A 4BDYA 4FCYA 1C0TA 3DLKA 4O55A 1WSFA 4DTNA 3V6DA 3P83D 1NOYA 3L3VA 3K57A 1CXUA 2IC3A 4IFYA 1RDCA 4KHYA 1S1WA 4FM2A 3HSTB 3C6UA 3AVHA 2WOMA 4CIFA 4ZTJA 4DG1A 3DLBA 4KHUA 1SL1A 2X6SA 4MQ3A 1LAWA 4W5OA 4UQGA 2O4IA 3M8SA 3OJUA 1U48A 2YNIA 4Z4GA 3ZSXA 2DFHA 1TVRA 4CGDA 1VSFA 3OS0A 3I0SA 4FLTA 4FJ9A 3S3OA 1CZBA 4ID5A 4GMJB 4NCGA 1IO2A 1IH7A 1TK0A 4FZYA 4FK2A 2QK9A 1KCFA 3EZ5A 4OKJA 3E01A 1CLQA 1QSLA 5FROA 5HBMA 4CJUA 3MXJA 3T3FA 1L3SA 1DTQA 2HMIA 1S6QA 1FK9A 1TKTA 3OYJA 3OYAA 4FYDA 3LAKA 3HK2A 1Q8IA 3LAMA 1L3UA 4I9QA 4AILC 1RDAA 1NKBA 4KB1A 1VSDA 4CIEA 2RF2A 3T1AA 3NF8A 1D8YA 4QCLA 3KLFA 4CHQA 2KFNA 3VQ9A 1NJWA 2E6MA 3KTQA 2B5JA 3IG1A 3V1RA 4DS5A 3LWLA 3TANA 4Z4HA 3AVLA 4CERA 3NFAA 2OPPA 3OYFA 1TKDA 2B6AA 3NBPA 1UA1A 1SV5A 2ATQA 2DTUA 4KI4A 1KVCA 1VSIA 4B9SA 1LWFA 3AVFA 3ULDA 2IOCA 3RMCA 3KK1A 4B9TA 3AV9A 2PYJA 3K2PA 3ZSZA 2HVHA 2Y1JA 3V1QA 3HM9A 2HW3A 1WAJA 4E7JA 2BE2A 4KTZA 2P51A 3AA2A 1TL3A 3NH2A 1BHLA 4CF8A 4OGEA 3RMBA 3MEGA 3V4IA 4N47A 3NF7A 4DMNA 3LZJA 4BWJA 4FJ5A 2KFZA 5C25A 2HVIA 2VG7A 4N5SA 4EZ9A 2F96A 4DQQA 3DI6A 1VRTA 4FLWA 1Q9YA 3SI6A 4ZTFA 3KD5E 3QEIA 1WLJA 1NK0A 3VQ8A 1FKOA 2Y1IA 5DK5A 4CEQA 4PA1A 2OZMA 4CFDA 4CECA 1C1AA 1LW0A 3H08A 3KLHA 4B9NA 3AVIA 4CK2A 3OYCA 1KFSA 4DSJA 4JLHA 4H4OA 1S5JA 1T03A 4FJHA 4BWMA 4PUOA 4HHTA 2G8UA 4HCCA 3HPHA 4N41A 3OYBA 3HYFA 4I9LA 3V9SA 4F4KA 1G15A 3TAEA 4FJMA 1QTMA 1DTTA 4Z4CA 4Z4IA 2KZMA 1DLOA 3VQEA 4KTWA 3ZSQA 5KRTA 4HUEA 4BE2A 4BE0A 1A5VA 2A1SA 5C24A 1SL0A 3TWHA 2OA8A 3SQ4A 3LZIA 1SUQA 4DFKA 2XY7A 3O4QA 1JLEA 1RBSA 3CM6A 5D3GA 3CYMA 3LP2A 1IG9A 3VN5A 1RT3A 1TKXA 3K58A 1L5UA 3AA4A 1ITGA 1EX4A 5HRRA 2OPSA 4FJKA 3VQDA 4DQSA 1KVBA 3SPYA 3HVRA 4E7IA 3L2VA 3WNHA 3CFRA 2YNGA 4DLEA 4FW2A 3CG7A 1QSSA 4Z4EA 3L3UA 3F73A 2G8WA 4FK0A 1I39A 3SV3A 1BIZA 1X9WA 2OPRA 1BIUA 3QERA 4AHUA 3ZT3A 4F8RA 4RW9A 3K59A 3K5OA 4E7LA 2HHWA 3TR8A 4MFBA 4B9MA 1C6VA 1C1BA 1O1WA 4HUGA 2LSNA 1EXQA 1ASVA 3NH1A 1S9EA 4CJVA 4J2BA 4Y1CA 2E6LA 4IBNA 4E19A 4CHYA 3THVA 4C8LA 1RTHA 3MECA 4O4GA 4FZZA 1SKRA 2HHUA 1XHXA 1RBTA 4OLAA 1REVA 4HUFA 3AO3A 4DQPA 3V9ZA 1HNIA 4FLUA 1WSIA 5K14A 3K5NA 3WNGA 4F3OA 1X1PA 3OYDA 1KSPA 2OYQA 3WNFA 3V9WA 3RMDA 1NK8A 4ELUA 4YNQA 5J2NA 5KRSA 1L3TA 3ZSOA 1B92A 4CGHA 1NK6A 1GOBA 1B9FA 1HYZA 3O4NA 3LWMA 3QEWA 4CIGA 1UWBA 5HRSA 1N5YA 1KFDA 3U3GA 4NYFA 2WONA 1C1CA 3VQ6A 1LWEA 4G1QA 4OVLA 1HQUA 4DFPA 1J9AA 4RW7A 5HP1A 5CZ2A 5KGWA 1NKEA 1U49A 4CJFA 3AVJA 3HP9A 4KHQA 1A5WA 2VG5A 4E7HA 2D0BA 3LANA 4FW1A 3KKRA 1QHTA 1VRUA 1NK7A 3QNOA 1UOCA 4M3YA 1JXBA 4IG0A 4DFJA 5FRMA 3PX6A 1TL1A 4BDZA 4RW6A 4Z4FA 4PQUA 1IKVA 1HNVA 1D9FA 1YVUA 4CJRA 3I0RA 1XWLA 3DOKA 3JYTA 1SKSA 2KTQA 1TAQA 3QEVA 4FJNA 4FK4A 3AVAA 3OJSA 1BGXT 4CEDA 5HRNA 3OS1A 3HVTA 4R5PA 2FBXA 3M8RA 3MXIA 2PYLA 4B3OA 1RTDA 1X9MA 1IKXA 2HNDA 3V9UA 4W5NA 1TV6A 2KQ2A 3FFIA 3TAPA 4KO0A 5SZTA 4CGGA 4F3TA 1IKWA 4RG8A 3SZ2A 2VWJA 1RT2A 2I5JA 3NH0A 4XIUA 2G8VA 3D0PA 1L3VA 3DLEA 2P5GA 3HP6A 4M3TA 1GOAA 1RBRA 3ZSYA 4EP5A 4DLGA 3TARA 3PX4A 3PO4A 4CCHA 1RDDA 2ITGA 2JGUA 3OY9A 3PO5A 4M3ZA 2GUIA 4CEEA 4FLYA 4DTXA 1JL1A 4KHNA 4I2PA 1NJYA 3KJVA 4M42A 4CHNA 1JLAA 2GBZA 5KI6A 3AO4A 1WSEA 1T7PA 3V9XA 2YKMA 3OYKA 1WSJA 2HHVA 2QXFA 3S3MA 1F21A 4KKOA 5KGXA 2Q3SA 3OYNA 2XY6A 4PWDA 1RT4A 4B8CA 1YT3A 1ZYQA 5JS1A 1JLBA 5DMRA 4CEZA 4JRPA 1VSEA 3L2RA 2HHXA 1HYVA 4M45A 4BACA 1FKPA 1BQMA 1RCHA 1ZBFA 4J2EA 4AHCA 3SCXA 2KZZA 1S9GA 2ZE2A 3B6OA 1U45A 3HPOA 4CJTA 2F8SA 2ZD1A 4RW8A 1VSJA 2OPQA 4O0IA 4DU4A 1A5XA 4EP4A 1BL3A 3L2WA 4CJLA 4KREA 1JKHA 1HQEA 3AA5X 3ZT2A 4CJWA 1BI4A 2HHQA 2D0AA 2X74A 4L8RB 2D0CA 3VQ7A 2B4JA 3DOLA 3KLEA 3KLIA 5T7BA 3TAMA 5J1EA 2JLEA 3HXMA 4LY7A 4BE1A 4FJIA 4DTSA 2HNYA 4CK1A 3HL8A 4FJXA 1B9DA 1Y97A 3G10A 1R0AA 2IGIA 1VK0A 5CY4A 3VQ5A 3OYMA 4N76A 2BGGA 3JSMA 3MXMA 1LAVA 1GOCA 4OPJA 3TAFA 3KD1E 4E0DA 4W5QA 2VG6A 1RT5A 1RTIA 4E3SA 1T05A 4FZXC 4Y1DA 5CZ1A 1ZBIA 1NK5A 3VQPA 3L2UA 3HJFA 3AA3A 3C95A 1BCMA 3I8DA 2BANA 1QS4A 4FJ8A 3SUPA 1JLQA 4O0JA 4J2AA 3P1GA 1VSLA 1W9HA 4DSLA 4NCAA 4HVJA 2EHGA 4LD0A 4H8KA 2IS3A 2G8IA 2G8FA 4M3UA 1JLCA 1QQCA 2RKIA 4N56A 2DY4A 3B6PA 3S9HA 1RT1A 2QKBA 5J2PA 4ELTA 4QAGA 3BGRA 1WSGA 3ZSRA 2G8KA 3CQ8A 2YNHA 3AVCA 4CEBA 4CHZA 3DRSA 3S3NA 4KTQA 4B8AB 2HNZA 4CJPA 1NOZA 1RBUA 2HB5A 3M8QA 1WAFA 3NF6A 4Z0UA 4CJ5A 2XO7A 3QEPA 4HTUA 4KPYA 3EYZA 3O3GA 1LV5A 2RN2A 1ZBUA 3RWUA 1TAUA 2XHBA 4DQIA 4CEFA 2OZSA 2ETJA 4FM1A 2R7YA 4NYNA 4FLVA 1RILA 5CYMA 3NGIA 4K8ZA 1JLFA 4LH4A 3A2FA 3VQCA 3RR8A 4E1MA 4CEAA 4CHPA 2Z1JA 3K5LA 3LPUA 5KTQA 4CFAA 3SYZA 3DLGA 4KFBA 3AO2A 3AVMA 3C94A 3KLGA 4DSEA 3SNNA 4F2SA 3NGZA 2F8TA 3QLHA 2AJQA 4DTPA 3DM2A 3VA0A 3ZT4A 1MU2A 3CM5A 3T19A 1QE1A 4DTRA 1SL2A 1HYSA 5FDLA 4H4MA 4OJRA 3CFOA 5CYQA 1Z25A 4E89A 3ZT1A 3LP3A 3LP0A 4M3RA 1U04A 4ICLA 3QETA 1NK4A 3VQQA 3HPGA 3KIOA 4M41A 2Z1HA 3VQAA 2XY8A 4DTOA 1NKCA 1WSHA 4M3WA 3U3YA 3SQ1A 1RDBA 1LWCA 3D45A 1HMVA 1S1TA 2EX3A 2YHAA 4DF8A 3U6FA 1BQNA 3IAYA 5FRNA 4CFCA 4YFUA 2P5OA 4DQRA 4JRQA 4C8OA 2W42A 2X6NA 1S1VA 4FJ7A 5C42A 3L2QA 3ZSVA 3AVGA 3OYHA 4FM0A 3O3FA 4KB0A 4DTMA 3AO5A 1UAXA 4E1NA 3SUOA 4IKFA 1KTQA 4OKEA 3O3HA 4C8KA 4ELVA 1IKYA 3UIQA 1U4BA 3SUQA 1XC9A 3V1OA 3NAEA 4CGFA 4CF0A
chains in the Genus database with same CATH superfamily
5JVGL 3P4IA 4UY8O 1LW2A 3VQBA 4IDHA 5AQNA 3D7EO 5J2QA 1VSHA 1DKGD 4HWIA 3SQ2A 4Q5VA 2E2OA 2E4LA 3R1XA 2P9IB 1BISA 4YOTA 3JAMO 1NGEA 3D6RA 3C6AA 1SKWA 3C7NA 1EKEA 3ZX2A 4EZ6A 3QIPA 3TI0A 2IVOA 4OLBA 1C0FA 3NHGA 3QB0A 4FWMA 3DLRA 1EP4A 4KRFA 3LALA 5AQZA 1TGOA 3IS9A 3OYLA 1BCOA 3DRPA 1JCFA 4EHUA 2HHTA 4M7XA 1ATNA 1HJOA 3GL1A 3M1FA 3C6TA 4JI7K 3MN6A 4CJ4A 3OYIA 1FXXA 4JK7A 1TK8A 3QINA 4JS4A 1J53A 4GVEA 4O5BA 5BRFA 4FXDA 4Z4GA 4FJGA 4C8NA 1NNEA 2RPIA 3THYA 4LH5A 4DU1A 5JS2A 4CJQA 3ID6A 2GTDA 2PY5A 2QWPA 3A5OC 4B9UA 1XQSC 4HCBA 2PZSA 5AQRA 2GELA 2KW4A 5AQTA 1BO5O 1IJJA 1CZ9A 2DFEA 5AFUA 1ASWA 2YV0X 3VEWA 3LP1A 1VQON 3SUNA 2A42A 2D5RA 4LFCK 3SQ0A 3P39A 1Q9XA 3AAPA 1ZBHA 1N6QA 1ATSA 1JLGA 4FWOA 4B08A 3PY8A 3G0ZA 1NK9A 4FCYA 1C0TA 3P83D 4IFYA 4FM2A 3HSTB 4WFAL 3O4WA 3WXLA 3FZMA 4ZTJA 3DLBA 1J6ZA 1XUPO 4MQ3A 1BA1A 4YOXA 1U48A 1KAZA 2UUBK 2YNIA 5JMVA 3ZSXA 4CGDA 3HZ6A 3T7ZA 3S3OA 1YJNN 1IO2A 1BWFO 3L0QA 1KCFA 3EZ5A 1CLQA 1QSLA 1L3SA 2UXBK 1S6QA 1XNQK 4FYDA 3LAKA 4GV3A 3HK2A 1Q8IA 4I9QA 3NF8A 4WQ5A 4CHQA 3VQ9A 1K8KB 3EKSA 2VQFK 2B5JA 3IG1A 4DS5A 3QFPA 3TANA 4CERA 5FPEA 3NFAA 5AQYA 2B6AA 4KI4A 4B9SA 1LWFA 1MA9B 3ULDA 3WT0A 3KWIA 3AV9A 3VEVA 1ATRA 2OCEA 4CZLA 5DM6L 1WAJA 4KTZA 3WEEA 3CC2N 3RMBA 3MWTA 3CJ9A 2H3GX 3VF2A 1GLAG 3NF7A 2HVIA 2VG7A 4N5SA 4AQYK 2F96A 4BVOA 1Q9YA 4FLWA 3BZCA 3KD5E 3QEIA 2JWLA 3VQ8A 5DK5A 4CEQA 2OZMA 5TKYA 4H0VB 4CW7B 1I94K 4XEIA 2ZWHA 3KLHA 4B9NA 4A61A 4BRPA 3BEXA 3ZEUA 4PUOA 2Q0UA 3HPHA 3TSQA 2FSNA 3V9SA 3TAEA 1QTMA 1DTTA 4Z4CA 2ASMA 1DLOA 3JS6A 1U2VB 4BR5A 3RSEB 1SL0A 3CCEN 3TWHA 3CXCM 3CC7N 4U67L 3SQ4A 3CD6N 3U9DA 5D3GA 3LP2A 3UE5A 3K58A 3MMVA 3AA4A 1ITGA 1EX4A 4DQSA 4JKCA 3WNHA 3L2VA 4DLEA 1QSSA 4JI2K 5AJ3K 2YCHA 4BRKA 1BIUA 3OTOK 3K59A 4MFBA 1EXQA 1ASVA 5AR0A 4E19A 2E6LA 4IBNA 4CHYA 3THVA 1RTHA 5KPZA 3U9ZA 2P9NB 5M1KA 3HBTA 2P9UA 3AO3A 4YDUC 5HL7L 3CJ1A 1X1PA 2AA4A 3V9WA 2CGLA 5KRSA 1B92A 1GOBA 4DHYA 3E9LA 3CCLN 4C1NI 4WQ4C 4CZJA 5HRSA 4DR6K 4BGAA 4NYFA 3D2FB 1C1CA 3SMSA 4G1QA 1HQUA 4A59A 1J9AA 4XH1A 3VEXA 5HP1A 1U49A 4CJFA 4DUYK 4H5RA 3HI0A 1QHTA 1VRUA 3DXMA 3QNOA 1UOCA 4M3YA 5FRMA 4KHPK 4KH6A 4RW6A 4PQUA 1NWKA 1XC3A 3CJAA 1XWLA 4FK4A 3AVAA 1T3VA 1BGXT 5E26A 3VTHA 2PYLA 2P9LA 2FBXA 5KQDA 1X9MA 2ASPA 4W5NA 3FFIA 1YUWA 1HKCA 5SZTA 4CGGA 2RHKA 1NG9A 4CI6A 3CJCA 1SZ2A 1RT2A 2YJEA 2G8VA 4M3TA 1YHQN 1L3VA 3DLEA 4BRLA 2WBNA 4WFBL 4IO8A 3PX4A 2OTLN 3PO5A 4M3ZA 2GUIA 4IOAL 3B8AX 1OVYA 4M63C 1T7PA 2QA4N 3VETA 2HHVA 2FLOA 5KGXA 2Q3SA 4CZKA 3OYNA 2XY6A 2A40A 1RT4A 4JKFA 5JS1A 5DMRA 4IWVA 1HYVA 1IBLK 4BROA 2Q0RA 4B1ZA 1ZC6A 3J80O 3SCXA 1GLBG 4NXMK 2O8BA 4CJTA 2E2NA 1VSJA 4FWQA 2YX6A 2V7YA 4EP4A 4JNEA 4BR9A 4CJLA 4KREA 1JKHA 1HQEA 2X74A 2BUPA 5AQUA 3S41A 2D0CA 2B4JA 3DOLA 3ENOA 1JJ2M 2UUCK 3TAMA 3HXMA 4LY7A 3ULEB 5HOOA 4FJIA 3HL8A 4BC5A 1OH5A 1VK0A 4YOVA 4N76A 1GOCA 4OPJA 2WTUA 3VEZA 4W5QA 4E3SA 1RT5A 1T05A 4GKKK 5CZ1A 2VCPA 3HJFA 3I8DA 4FJ8A 4O0JA 1W9HA 2WFBA 4JI0K 4LD0A 4H8KA 1VQPN 1QQCA 2RKIA 4N56A 3B6PA 3S9HA 3BUZB 4BRAA 1WSGA 2G8KA 2YNHA 4JHDA 2Q2RA 1GLLO 4CJPA 1NOZA 2HB5A 2XO7A 3NF6A 2O8CB 4HTUA 3FGUA 3O3GA 2QWLA 1LV5A 1ZBUA 4B3RK 1NLVA 4EFHA 2R7YA 1QZ6A 4NYNA 3U8XA 3NGIA 4BREA 4CHPA 4JI3K 4CFAA 4JKEA 4KFBA 3C94A 1E4FT 4IFEA 3KLGA 4DSEA 3NGZA 2AJQA 4DTPA 2OANA 4IJNA 4OPAA 1MU2A 3VA0A 5FDLA 1Z25A 1XMQK 3ZT1A 3LP3A 4DR4K 4M3RA 4ICLA 4BRDA 3QETA 3KIOA 2XY8A 4PL8A 4M3WA 1IBMK 3D2EB 3U3YA 3SQ1A 1LWCA 1HMVA 2EX3A 2P9SA 1N36K 4CFCA 4YFUA 4DQRA 3QMLA 2W42A 3THXA 1MWKA 1RGIA 5C42A 3L2QA 4ISFA 3AO5A 2QWNA 4CBUA 4E1NA 3SUOA 4OKEA 4IKFA 4C8KA 3UIQA 1U4BA 1XC9A 4H0OA 4CF0A 4GVMA 1QVFM 1BI4B 5KQ8A 2NUBA 3E9PA 3CCQN 2FBTA 5BRHA 2FC0A 4O8KA 3G6EN 4DCHA 4FLZA 1Q86O 4LC9B 1JXEA 4CJ3A 1VSKA 1UA0A 2IVPA 2ZM6K 2NLXA 3OHRA 4CHOA 1HPZA 4JYAK 5HRPA 2DFFA 5EOYA 4DF4A 4FWPA 1RTJA 2HBLA 3O1WA 1W7AA 4LSLA 1J5EK 4FVMA 3PX0A 3PUFA 5ADXH 1TYQA 3TAGA 1C0MA 3TTCA 1T44A 3FZKA 4KI6A 3F9KA 1RBVA 2NRHA 3PV8A 1X9SA 1S1UA 3K5MA 3BF1A 4DWIA 4ILGB 3MEEA 3L8BA 3SJJA 3OYGA 2GV9A 3P5JA 4DFMA 3WQTA 1J54A 3J8AA 2UU9K 1VQ4N 2KHOA 2VYPA 4FJJA 2ASOA 4H5VA 4LF5K 3SK3A 4DS4A 1K6YA 1W0HA 3ITHA 2X78A 4K8XA 4I2QA 3CJBA 4DTUA 4CF9A 2BTFA 5BR8K 4WE1A 3QNNA 3RTVA 3CQYA 1RT6A 5HLFA 5BPLA 5AQPA 2YNFA 1S1XA 4ZHRA 4KAZA 4CE9A 1S6PA 5I42A 3ISNC 3O9TA 3ZSWA 3MAQA 4FWKA 5IT9O 2O8FA 4IXCA 1SS6A 3H3OB 4LF9K 2W6KA 4CGIA 5AZJA 5EY4A 2D0OA 3FZLA 3QEXA 2FBVA 4DKWA 1P8ZA 4C8MA 3ZT0A 5FPMA 3SAHA 4BDPA 3ASMA 3NE6A 4FLXA 1QSYA 2ZF5O 5AQWA 2P9PB 4WQ5C 3TAQA 1DGKN 3NDKA 4EAHD 2FXUA 3SJHA 4JK9A 3HT3A 4GW6A 3OW2M 5KPRA 3L3VA 3K57A 1NGDA 2IC3A 4MDAA 4KHYA 1S1WA 3C6UA 4BG9A 4CZFA 2D0PA 1SL1A 5DM7L 3OJUA 2NRRA 2Q1NA 1TVRA 1VSFA 3CIPA 4GY2B 3BY5A 1CZBA 4GMJB 4NCGA 4FK2A 4BR7A 5AQSA 3E01A 4CJUA 3MX2A 3MN5A 3IKMA 3LAMA 4AILC 1NKBA 3MCAB 1NGCA 1D8YA 4NB4A 1NJWA 3KTQA 3DXKB 5BPNA 3AGKA 3KZBA 4K43A 3VGMA 2ZGYA 3OYFA 1TKDA 3GE1A 2ATQA 1VSIA 4G9ZA 3AVFA 2V51B 3RMCA 2AP1A 4B9TA 2PYJA 3K2PA 3ZSZA 2Y1JA 3V1QA 4JAXA 2BE2A 3G25A 1TL3A 2FSKA 3NH2A 3MEGA 4FJ5A 4LFBK 4EZ9A 2GWKA 4GNIA 1VRTA 5CE3A 3SI6A 5EX5A 4ZTFA 1NK0A 3HSCA 1FKOA 2GEMA 4CECA 1C1AA 1QQMA 3H08A 3DLLL 3OYCA 1KFSA 4H4OA 1S5JA 4XH4A 4BWMA 1OH8A 3AARA 4FJMA 2E5LK 4KTWA 3ZSQA 5KRTA 3CCJN 4BE0A 5C24A 3W0LA 2D4WA 3I55N 3O9SA 2W6LA 3LZIA 2XY7A 3WXIA 1MDUB 3CI5A 4NLBA 4JN4A 1IG9A 3UKUA 3A5MC 1RT3A 4BRGA 5HRRA 2O8EB 3R9PA 3HVRA 3H45C 1BIZA 3LDQA 2OPRA 3QERA 4AHUA 5CR4A 3ZT3A 4B9MA 1O1WA 5AQKA 4CJVA 4J2BA 2IIRA 3MCPA 4Y1CA 2QWRA 1SKRA 4OLAA 1REVA 2ZJRL 3V9ZA 4FLUA 1WSIA 3K5NA 4JD2A 3UB5A 3OYDA 1KSPA 3RVCA 4ELUA 4YNQA 1K8AO 1L3TA 3ZSOA 4X62K 5BREA 4B3MK 3LWMA 1UWBA 1N5YA 3M6GA 4FSVA 2WONA 1LWEA 2JWKA 4OVLA 4RW7A 5CZ2A 5KGWA 1NKEA 1KC8O 2HF3A 3HP9A 1A5WA 4E7HA 1JXBA 4BRCA 4YOYA 3PX6A 1TL1A 4AF1A 4Z4FA 4BQZA 1HNVA 3A0IX 1IBKK 1YVUA 3DOKA 3NVMA 2IVNA 4FJNA 1HKBA 3FZHA 3R3LA 4OX9K 3OJSA 1Q7YO 5HRNA 3M8RA 3HVTA 4R5PA 3PIOL 4B1YB 1RTDA 3O1BA 2HNDA 1XMOK 1TV6A 1HNXK 5M1FA 1IKWA 3SZ2A 2P9KA 2VWJA 4DR1K 2I5JA 3PO4A 2ITGA 1DEJA 2JGUA 3LDOA 3TU5A 3VOVA 5LL6Z 1JL1A 4KHNA 4WFNL 4RTFD 3V9XA 4AM6A 5M1OA 1WSJA 4KKOA 3T69A 4PWDA 4B8CA 2I7PA 1YT3A 2ZJPL 1G99A 4XH5A 1JLBA 1Y64A 4A2AA 2HHXA 1VSEA 4FVUA 4BACA 1FKPA 4JKBA 5JLHA 1RCHA 4EHTA 1ZBFA 4J2EA 5AQOA 4H0XB 1WUAA 2F8SA 4RW8A 2QW9A 1A5XA 1BL3A 4B3SK 3L2WA 4OO1J 2QM1A 3AAQA 3O6WA 3ZT2A 2E1YA 3PIPL 3E66A 4L8RB 2YI1A 3VQ7A 1QHAA 2QXLA 1EWRA 5J1EA 3ZX3A 4DTSA 4CK1A 4FJXA 3U4LA 1B9DA 1R0AA 3OYMA 5CY4A 1TUUA 1X3NA 3JSMA 3SLCA 5BRDA 2VG6A 3O5BA 5AQQA 1YJWN 1M1KO 3VQPA 5LMNK 1VQ6N 1BCMA 3MX5A 1JLQA 5F2RA 4J2AA 1VSLA 3A5NC 2IS3A 4FPBA 4M3UA 2DY4A 5J2PA 3THWB 3A5LC 1CZAN 1Q18A 3IUCA 4CHZA 3DRSA 4WYBA 1NGAA 1NBWA 1X3MA 1YJ9N 4MLEA 3M3ZA 2P9SB 3RWUA 1TAUA 4DQIA 2OZSA 2ETJA 4JKGB 5CYMA 4M7YA 5AFUH 3ZETB 4JI5K 3VQCA 4B3TK 1KAXA 3DLGA 3AVMA 3SNNA 1GLCG 3QLHA 3DM2A 1EWQA 1HYSA 3T19A 3CM5A 3R8EA 5GAEP 4AM7A 1SL2A 3CFOA 1V4TA 3VMFB 5F1XA 3LP0A 1NK4A 4CZMA 3BF3A 3CHWA 3FFKB 3HPGA 3P31A 2F4VK 4BRHA 3CQXA 1YITN 1RDBA 1S1TA 3I56N 4MO4A 2X6NA 1S1VA 4FJ7A 3M5RA 3ZSVA 4FM0A 4I6MB 4KB0A 5FPDA 3O3HA 3DWLA 4ELVA 5BN9A 3NAEA 3CJ7A 4CF2A 3KK3A 3BDPA 3EY1A 2O4GA 1BU6O 4W5RA 4IDKA 4LSNA 1RNHA 2O8DB 4CJEA 3CERA 4AHRA 1C0UA 1E4GT 3ZCMA 1CXQA 5SWMA 5J2MA 4GV6A 1QQOA 1S72N 1I3AA 4B9VA 4CK3A 3BZKA 1X9JA 1JCGA 3KWGA 1YIJN 5ADXA 2XY5A 1D9DA 2KKZA 1ZBSA 1WNSA 4TSXA 3WNEA 4NLCA 2A1RA 4PY5A 2Z1IA 1OKJA 2HHHK 1WOQA 3LPTA 4IG3A 3AVKA 3NMUA 1QZ5A 3NCIA 3RRGA 3WUHA 1RT7A 3LL3A 3H1QA 3AVNA 2E20A 4DSKA 1YTAA 3CCSN 1TK5A 3MEDA 5I3UA 3DYAA 4CESA 1WN7A 3KKSA 4LF7K 3LDSA 2F7TA 2F9WA 3ENHA 4IFVA 1VHXA 2V7ZA 3NF9A 3EEQA 2Z1GA 4JKAA 1KLMA 4RW4A 3OYEA 1KLNA 2QTDA 5KPTA 1J5OA 2ZGZA 4A5BA 2P1JA 4O5FA 3VERA 4AHVA 4M3XA 2IAJA 3M8PA 3QESA 3G71N 4OGCA 1T8EA 4F2RA 2XRIA 2CH5A 2BDPA 4MO5A 3RRHA 2ZJQL 3R6MA 4ISGA 1U2VA 3RSEA 1Q81O 4DR3K 3KK2A 4CBXA 1FW6A 3TTFA 4CGJA 1YTUA 1HUXA 4CJKA 4FJLA 3QBXA 3MK6A 3CCRN 4BRQA 4NCBA 4Q0BA 1D4XA 1TKZA 4OPKA 4BDYA 3DLKA 1WSFA 1NOYA 3KVGA 3WXMB 3N4PA 4DV5K 3P38A 4CIFA 2WOMA 1N33K 4DG1A 4KHUA 5A2QO 2O4IA 2GX9A 4H0PA 2DFHA 5AQFA 3OS0A 3C7NB 3I0SA 3QICA 2YHXA 4FLTA 4FJ9A 4WCEL 2VQEK 4FZYA 1IH7A 1TK0A 4MDBA 4OKJA 5AQHA 1FK9A 3OYAA 3IFRA 1HR0K 3UKRA 5AQVA 3FZFA 3T1AA 3D2FA 4QCLA 3KLFA 4YDUA 1VQ8N 4JI4K 4DQ8A 3GG4A 4A5AA 4Z4HA 4YHHK 4IEIA 3N4QA 1W97L 1UA1A 1SV5A 2IOCA 4WQ4A 4A2BA 2HW3A 3H46O 4E7JA 1ZXOA 5AQGA 3T1YK 1BHLA 4OGEA 4N47A 4DMNA 2KFZA 3LZJA 4BWJA 4BC2A 2I7NA 4KBOA 3THYB 3PLAA 4DV6K 1WLJA 2Y1IA 2VWBA 4K41A 4CK2A 4DSJA 4BRIA 4JLHA 5GAGP 4B1XB 4HHTA 2G8UA 4HCCA 3NVKA 3OYBA 3HYFA 4I9LA 1W2BM 4F4KA 3E1YA 2KZMA 1V4SA 4HUEA 1C0GA 1A5VA 2OA8A 4DR5K 2UXCK 1SUQA 3QBWA 4BC3A 1JLEA 1RBSA 3CM6A 1WBBA 1TKXA 1L5UA 2NRVA 4FOIA 1KVBA 4E7IA 2YNGA 4FW2A 3CG7A 4Z4EA 3C0BA 2G8WA 4FK0A 1NGJA 5MLCQ 3K5OA 2BH1A 2LSNA 5FLXO 1N8RO 1S9EA 3TSPA 4FZZA 4O4GA 1XHXA 1RBTA 4HUFA 3JXUA 3WNGA 3RMDA 1GLFO 5J2NA 4OPHA 1NK6A 3ULEA 1HYZA 3QEWA 3ZYYX 1RFQA 4DR7K 4CIGA 1HX1A 1HLUA 3LDLA 2QWOA 3VQ6A 3C65A 4DFPA 4BRNA 4NXNK 5LMUK 3VTIA 3AVJA 4PKGA 4O8UA 4HTLA 2V52B 3KKRA 1VQLN 2Q97A 5GADP 4IG0A 4QS8A 3HOTA 4IZ9A 4DFJA 4BDZA 1VQ5N 4CZHA 2E8AA 1OH6A 1D9FA 2VGNA 3WEEB 3I0RA 2CH6A 3JYTA 5M1PA 1SKSA 2KTQA 2HBMA 3QEVA 4FWLA 4CEDA 3OS1A 5AQIA 4IOXA 1IKXA 3WXKA 2KQ2A 3TAPA 3EZWA 4KO0A 1BDGA 4F3TA 4RG8A 1N34K 3EN9A 2P5GA 4XIUA 3D0PA 3ZEUB 1GOAA 3ZSYA 1N32K 4EP5A 4DLGA 1RDDA 3OY9A 1KQSM 4IJAA 4DTXA 4I2PA 3KJVA 4CHNA 1JLAA 2GBZA 5KI6A 3AO4A 1NMDA 4H03B 4PL7A 4JKDA 2WC9A 3O9QA 2E1ZA 4ILJA 4RCHA 4BRMA 1O13A 1ZYQA 5GIPA 3EO3A 3L2RA 5GIOA 3D2EA 2YJFA 1BQMA 2A41A 2HF4A 5JLFA 4X66K 4LF6K 2KZZA 1SAZA 2ZE2A 2QI2A 1U45A 4FWSA 3VENA 4CZIA 3WQUA 4F9OA 3SMPA 3AA5X 3EKUA 4CJWA 1BI4A 2HHQA 2P9UB 2A5XA 1LCUA 3PSIA 3L4IA 5T7BA 2CGJA 4BE1A 1QVGM 1Y97A 3G10A 3VQ5A 3ID8A 3MXMA 1LAVA 3GDQA 2F9TA 5LJVA 3KD1E 5C15A 4DB3A 4E0DA 4FZXC 1ZBIA 3GBTA 4PKIA 3C95A 1IG8A 3SUPA 3CMEN 2J4RA 3DXMB 4HVJA 3AY9A 1JLCA 1GLDG 2A6AA 4QAGA 3BGRA 1NGIA 3ENBA 1NGHA 3CQ8A 1RDWX 4EIAA 2P9LB 4B8AB 2HNZA 3J7YP 4CJ5A 4Z0UA 1WAFA 3QEPA 4KPYA 3SAFA 4CVNE 3EYZA 2PFUA 2XHBA 1EQYA 4DR2K 4JEPA 4R79A 4FLVA 3TSUA 5JVHL 4K8ZA 4NO7A 1JLFA 4LH4A 3A2FA 3RR8A 4E1MA 4CEAA 3CCMN 4JI6K 2Z1JA 3LPUA 2NRXA 3AO2A 4B1UB 4F2SA 2F8TA 4CJ7A 1JCEA 3ZT4A 1QE1A 4E89A 4B1WB 5AQXA 3VQQA 4IO9L 5AQJA 4M41A 3H6EA 3VQAA 1Z05A 1WSHA 4PKHA 1T6CA 3IDHA 3D45A 3U6FA 3IAYA 3CETA 3DJCA 5FRNA 1BQNA 2P5OA 4JRQA 4C8OA 5C2DA 1HNWK 3AVGA 2O8BB 3O3FA 4DTMA 4CD1A 2P9PA 4QS9A 1NU0A 2PAVA 4ISEA 3V1OA 1ILYA 4CGFA 4FO0A 2NNWA 4KV8A 2IDOA 4AHSA 4B9LA 5BR9A 5M1QA 4B9QA 4AHTA 3VESA 4ID1A 2NRTA 3ALYA 1U47A 3SV4A 4BGBA 3VQ4A 4X64K 5AZIA 4DSIA 4DSFA 4DTJA 4IEEA 4O44A 3L6QA 1VSMA 3CPEA 1KAYA 1GLJO 1ZBLA 2W41A 1VQKN 4CZGA 2UUAK 5F0XA 5E41A 4H0TB 1NJZA 3AO1A 4YORA 4JS5A 1Z26A 3SPZA 3FLCO 1YAGA 1XI1A 5B8HA 4W5TA 2QWQA 1ASUA 5TKWA 3DLHA 2QWMA 3CFPA 3ATUA 1HRHA 4JHDB 1D5AA 3DMJA 2ITMA 3WXJA 2FBYA 2EWSA 3DXKA 3AVBA 3O9UA 4KH4A 3OS2A 4Z94A 1WB9A 2P9IA 4QOZB 4CF1A 3HRGA 4KHWA 3HO1A 2YKNA 3TABA 1KRPA 2GWJA 3MDQA 2QKKA 3SAGA 4KHSA 1NJXA 3O08A 4FOEA 4CEOA 3OBWA 3FE1A 4H5WA 4CJSA 4PHTX 5M1NA 3QFUA 3KK7A 3NGYA 1JL2A 1K73O 4OKKA 3RMAA 4J2DA 4JK8A 3QIOA 2RE2A 3RR7A 2ZQBA 5EU7A 5AQMA 5I9EB 1XHZA 4KH5A 4E7KA 4BG8A 4LFAK 2HHSA 1HJRA 4K25A 4I7FA 2VWKA 3THXB 3QO9A 4BR2A 3DRRA 1S22A 5HROA 2UXDK 5E84A 4JKHA 3VA3A 2G8HA 3V81A 4BY9C 3CPWM 1OVQA 3IRXA 4DV7K 4E1JA 4IOCL 1EETA 4AH9A 3OVNA 4CFBA 1KVAA 4DU3A 3J7ZO 2YHBA 2Q31A 4YOUA 5LY3A 4O55A 3V6DA 3UKRB 4DTNA 2O8EA 1NMNA 1CXUA 1RDCA 3AVHA 3TTDA 4JV5K 3CMAN 1YXQA 5GAHP 4WF9L 2X6SA 4W5OA 1LAWA 4UQGA 3M8SA 3O8MA 5C10A 4FL9A 4DV2K 5IWAK 3ZX0A 4ID5A 1KXPA 1NM1A 2E2QA 2QK9A 3SBTA 3L4QA 5FROA 5HBMA 3T3FA 3MXJA 2HMIA 1DTQA 1TYQB 3VEOA 4A57A 4B1VA 4C1NK 1S3XA 1TKTA 3OYJA 3QDKA 1GLEG 1L3UA 1K9MO 1RDAA 2YHYA 4KB1A 1VSDA 4CIEA 2RF2A 1NJIO 2KFNA 3PSFA 2E6MA 3V1RA 3A8YA 3LWLA 4BR4A 4DV0K 3AVLA 3CF5L 2OPPA 3NBPA 2DTUA 2UYTA 1KVCA 3KK1A 4DV3K 3AGRA 3O80A 4Y0WA 2HVHA 2OTJN 3HM9A 4BR0A 2D1KA 3Q7CA 2NRWA 1H1VA 1LOTB 2P51A 1HPMA 3AA2A 3I33A 4CF8A 4H0YB 3V4IA 1EO1A 5C25A 1QQNA 5ELZA 5FPNA 1T6DA 4DQQA 3DI6A 2FSJA 2PBDA 2O8FB 1BUPA 2NZTA 3HOSA 4LF8K 4PA1A 5AZJB 4CFDA 1BA0A 1K8KA 1LW0A 4FWRA 3AVIA 1T03A 4FJHA 3MN9A 3LM9A 4N41A 3FR0A 1Q82O 1G15A 1ESVA 4YY3K 4Z4IA 2WUSA 3VQEA 4BE2A 1Z6RA 2A1SA 3I8BA 3EL2A 3J7AP 4DFKA 3O4QA 3CYMA 3VN5A 2OPSA 4FJKA 3VQDA 3SPYA 3CFRA 4MLHA 3L3UA 3TPQA 3F73A 5BPMA 1I39A 3SV3A 1X9WA 4F8RA 2HHWA 4RW9A 3J81O 4E7LA 3VGLA 3TR8A 1C6VA 1C1BA 4HUGA 3NH1A 4QS7A 4C8LA 1VQNN 3MECA 1VQMN 2HHUA 4H5TA 2E2PA 4DQPA 1HNIA 1HKGA 5K14A 4L3QA 1MWMA 4F3OA 2Q36A 2OYQA 3WNFA 3C6HA 1NK8A 4DUZK 4CGHA 3MN7A 4GV9A 1B9FA 1NGBA 3O4NA 4GKJK 1SQKA 1KFDA 3U3GA 2E88A 3ZLJA 4BVPA 3HM8A 1HNZK 5BN8A 4FPAA 2VGMA 3EE9A 4CZEA 4JI8K 4KHQA 2VG5A 2D0BA 4FWNA 3LANA 3LDNA 4FW1A 4K42A 4BC4A 1NK7A 4CD3A 1IKVA 2P9NA 4CJRA 1TUYA 4J8FA 2A3ZA 3THWA 3ATVA 1TAQA 3MXIA 2GUPA 4B3OA 4BRFA 3V9UA 2CGKA 3VGKA 5C0YA 1U6ZA 4JKGA 3Q7BA 3NH0A 1NGGA 3MWPA 3HP6A 1RBRA 3ZETA 4CBWA 1XNRK 3TARA 4CCHA 2HMPA 3LDPA 4C23A 4CEEA 4FLYA 1E3MA 1NJYA 4M42A 3LM2A 1NGFA 1WSEA 2YKMA 3OYKA 2NRZA 2QXFA 3S3MA 1F21A 3CCUN 5LJWA 3BP8A 1IV0A 3W3DA 4K0KK 3UKUB 4CEZA 4JRPA 4M45A 4U7BA 3VEYA 5C12A 4AHCA 1M90O 1VQ9N 2W40A 1S9GA 3B6OA 4I6MA 3HPOA 2ZD1A 2OPQA 4O0IA 4BQLA 4DU4A 5C2FA 3OBYA 5AQLA 3VF6A 2HBJA 1VAZA 2D0AA 1DT9A 4JD2B 2HBKA 4DV1K 5GINA 3KLEA 2O8DA 3KLIA 2FF3B 5EXWA 2JLEA 3SBGA 2HNYA 3F2KA 2IGIA 1VQ7N 2BGGA 2HSTA 3E9OA 3TAFA 1RTIA 1R59O 4Y1DA 3H1VX 3VPZA 1NK5A 3L2UA 3G4SN 3AA3A 3KHYA 2BANA 1QS4A 3K0SA 3P1GA 4RWTA 4DSLA 4NCAA 2EHGA 5JICA 5H1SQ 2G8IA 2G8FA 1FJGK 2QKBA 1RT1A 1YVNA 3F9MA 4ELTA 2KLAA 3ZSRA 3CCVN 3AVCA 4KTQA 4CEBA 3S3NA 3K9KA 3T1HK 1KD1O 4X65K 1RBUA 3M8QA 1WBDA 2RN2A 3F5TA 4CEFA 2HOEA 1YI2N 3VF4A 2P9KB 4FM1A 4ILHA 1P90A 1RILA 3GOIA 1RDUA 2DPNA 1YF5L 3K5LA 3EE8A 5KTQA 3SYZA 4DTRA 2FF6A 3OA9A 4H4MA 4OJRA 5CYQA 5EVZA 4H5NA 1U04A 1OH7A 2YHWA 2Z1HA 2QEXN 4DTOA 4V19S 5AZIB 1NKCA 3DAWA 1BG3A 3K9JA 2O8CA 5CHIA 4YOWA 4A62A 4DF8A 2YHAA 3O9RA 4DV4K 3IMXA 3OYHA 3H3NO 1BOTO 1UAXA 1KTQA 3HTVA 4JI1K 1IKYA 4LF4K 3SUQA 3CC4N
chains in the Genus database with same CATH topology
4CF2A 4GVMA 3KK3A 3BDPA 1BI4B 2NUBA 2FBTA 3EY1A 1LW2A 2FC0A 2O4GA 2IDOA 4KV8A 3VQBA 4AHSA 4W5RA 4IDKA 4FLZA 5J2QA 4B9LA 4LSNA 1RNHA 1JXEA 4AHTA 1VSHA 4ID1A 4CJEA 3ALYA 1U47A 4CJ3A 3SV4A 1VSKA 1UA0A 3SQ2A 4AHRA 1C0UA 3VQ4A 4Q5VA 4DSIA 3ZCMA 1CXQA 4DSFA 5SWMA 4DTJA 5J2MA 2E4LA 1BISA 1I3AA 4O44A 4B9VA 1VSMA 4CHOA 4CK3A 1HPZA 1ZBLA 1SKWA 5HRPA 2DFFA 1EKEA 4EZ6A 5E41A 2XY5A 3QIPA 3TI0A 1D9DA 4DF4A 1RTJA 1NJZA 3AO1A 4JS5A 3SPZA 1Z26A 1WNSA 3NHGA 4LSLA 4OLBA 4TSXA 4FVMA 3WNEA 3PX0A 3DLRA 3PUFA 2A1RA 4W5TA 2Z1IA 1EP4A 3TAGA 1C0MA 1XI1A 4PY5A 4KRFA 3LALA 1ASUA 4KI6A 3LPTA 3F9KA 1RBVA 4IG3A 3DLHA 3PV8A 3AVKA 1X9SA 1TGOA 3CFPA 1S1UA 3IS9A 3OYLA 3K5MA 4DWIA 1BCOA 3NCIA 3RRGA 1HRHA 3L8BA 3MEEA 1RT7A 3SJJA 3OYGA 2GV9A 1D5AA 3DRPA 3DMJA 3P5JA 4DFMA 2FBYA 3AVNA 1J54A 2HHTA 4DSKA 3AVBA 1YTAA 1TK5A 3MEDA 3OS2A 4FJJA 5I3UA 3C6TA 3DYAA 4CESA 4QOZB 1WN7A 3KKSA 4CF1A 4DS4A 4CJ4A 4KHWA 3OYIA 3HO1A 1K6YA 1FXXA 2YKNA 1W0HA 3ITHA 2X78A 1TK8A 4K8XA 3TABA 1KRPA 3QINA 4I2QA 3LDSA 1J53A 4JS4A 4CF9A 4DTUA 2QKKA 4KHSA 1NJXA 4WE1A 3QNNA 4IFVA 3RTVA 4O5BA 3NF9A 1RT6A 4CEOA 5HLFA 2Z1GA 2YNFA 1S1XA 4ZHRA 4KAZA 1KLMA 4CE9A 4CJSA 4FXDA 1S6PA 5I42A 3ISNC 4RW4A 4FJGA 3NGYA 4C8NA 1JL2A 3ZSWA 3OYEA 3MAQA 2RPIA 4OKKA 3RMAA 1KLNA 4LH5A 4DU1A 4J2DA 5JS2A 3QIOA 4CJQA 2PY5A 1J5OA 4B9UA 4HCBA 3RR7A 2PZSA 2ZQBA 2P1JA 4CGIA 5EU7A 2KW4A 1XHZA 4E7KA 4AHVA 2FBVA 3QEXA 1CZ9A 2DFEA 2IAJA 3M8PA 4M3XA 1ASWA 1HJRA 2HHSA 3QESA 2YV0X 4OGCA 4C8MA 3LP1A 4I7FA 3ZT0A 2XRIA 1T8EA 4F2RA 2BDPA 2VWKA 4BDPA 3RRHA 3QO9A 3ASMA 3DRRA 3NE6A 4FLXA 3SUNA 5HROA 1QSYA 2D5RA 2G8HA 3VA3A 3V81A 3KK2A 3IRXA 3SQ0A 3TAQA 1Q9XA 1ZBHA 4CGJA 1YTUA 1N6QA 1EETA 4AH9A 1JLGA 4CJKA 3NDKA 4FJLA 3OVNA 4CFBA 4B08A 3PY8A 1KVAA 4DU3A 2YHBA 3HT3A 4NCBA 4Q0BA 4GW6A 1TKZA 3G0ZA 4OPKA 1NK9A 4BDYA 4FCYA 1C0TA 3DLKA 4O55A 1WSFA 4DTNA 3V6DA 3P83D 1NOYA 3L3VA 3K57A 1CXUA 2IC3A 4IFYA 1RDCA 4KHYA 1S1WA 4FM2A 3HSTB 3C6UA 3AVHA 2WOMA 4CIFA 4ZTJA 4DG1A 3DLBA 4KHUA 1SL1A 2X6SA 4MQ3A 1LAWA 4W5OA 4UQGA 2O4IA 3M8SA 3OJUA 1U48A 2YNIA 4Z4GA 3ZSXA 2DFHA 1TVRA 4CGDA 1VSFA 3OS0A 3I0SA 4FLTA 4FJ9A 3S3OA 1CZBA 4ID5A 4GMJB 4NCGA 1IO2A 1IH7A 1TK0A 4FZYA 4FK2A 2QK9A 1KCFA 3EZ5A 4OKJA 3E01A 1CLQA 1QSLA 5FROA 5HBMA 4CJUA 3MXJA 3T3FA 1L3SA 1DTQA 2HMIA 1S6QA 1FK9A 1TKTA 3OYJA 3OYAA 4FYDA 3LAKA 3HK2A 1Q8IA 3LAMA 1L3UA 4I9QA 4AILC 1RDAA 1NKBA 4KB1A 1VSDA 4CIEA 2RF2A 3T1AA 3NF8A 1D8YA 4QCLA 3KLFA 4CHQA 2KFNA 3VQ9A 1NJWA 2E6MA 3KTQA 2B5JA 3IG1A 3V1RA 4DS5A 3LWLA 3TANA 4Z4HA 3AVLA 4CERA 3NFAA 2OPPA 3OYFA 1TKDA 2B6AA 3NBPA 1UA1A 1SV5A 2ATQA 2DTUA 4KI4A 1KVCA 1VSIA 4B9SA 1LWFA 3AVFA 3ULDA 2IOCA 3RMCA 3KK1A 4B9TA 3AV9A 2PYJA 3K2PA 3ZSZA 2HVHA 2Y1JA 3V1QA 3HM9A 2HW3A 1WAJA 4E7JA 2BE2A 4KTZA 2P51A 3AA2A 1TL3A 3NH2A 1BHLA 4CF8A 4OGEA 3RMBA 3MEGA 3V4IA 4N47A 3NF7A 4DMNA 3LZJA 4BWJA 4FJ5A 2KFZA 5C25A 2HVIA 2VG7A 4N5SA 4EZ9A 2F96A 4DQQA 3DI6A 1VRTA 4FLWA 1Q9YA 3SI6A 4ZTFA 3KD5E 3QEIA 1WLJA 1NK0A 3VQ8A 1FKOA 2Y1IA 5DK5A 4CEQA 4PA1A 2OZMA 4CFDA 4CECA 1C1AA 1LW0A 3H08A 3KLHA 4B9NA 3AVIA 4CK2A 3OYCA 1KFSA 4DSJA 4JLHA 4H4OA 1S5JA 1T03A 4FJHA 4BWMA 4PUOA 4HHTA 2G8UA 4HCCA 3HPHA 4N41A 3OYBA 3HYFA 4I9LA 3V9SA 4F4KA 1G15A 3TAEA 4FJMA 1QTMA 1DTTA 4Z4CA 4Z4IA 2KZMA 1DLOA 3VQEA 4KTWA 3ZSQA 5KRTA 4HUEA 4BE2A 4BE0A 1A5VA 2A1SA 5C24A 1SL0A 3TWHA 2OA8A 3SQ4A 3LZIA 1SUQA 4DFKA 2XY7A 3O4QA 1JLEA 1RBSA 3CM6A 5D3GA 3CYMA 3LP2A 1IG9A 3VN5A 1RT3A 1TKXA 3K58A 1L5UA 3AA4A 1ITGA 1EX4A 5HRRA 2OPSA 4FJKA 3VQDA 4DQSA 1KVBA 3SPYA 3HVRA 4E7IA 3L2VA 3WNHA 3CFRA 2YNGA 4DLEA 4FW2A 3CG7A 1QSSA 4Z4EA 3L3UA 3F73A 2G8WA 4FK0A 1I39A 3SV3A 1BIZA 1X9WA 2OPRA 1BIUA 3QERA 4AHUA 3ZT3A 4F8RA 4RW9A 3K59A 3K5OA 4E7LA 2HHWA 3TR8A 4MFBA 4B9MA 1C6VA 1C1BA 1O1WA 4HUGA 2LSNA 1EXQA 1ASVA 3NH1A 1S9EA 4CJVA 4J2BA 4Y1CA 2E6LA 4IBNA 4E19A 4CHYA 3THVA 4C8LA 1RTHA 3MECA 4O4GA 4FZZA 1SKRA 2HHUA 1XHXA 1RBTA 4OLAA 1REVA 4HUFA 3AO3A 4DQPA 3V9ZA 1HNIA 4FLUA 1WSIA 5K14A 3K5NA 3WNGA 4F3OA 1X1PA 3OYDA 1KSPA 2OYQA 3WNFA 3V9WA 3RMDA 1NK8A 4ELUA 4YNQA 5J2NA 5KRSA 1L3TA 3ZSOA 1B92A 4CGHA 1NK6A 1GOBA 1B9FA 1HYZA 3O4NA 3LWMA 3QEWA 4CIGA 1UWBA 5HRSA 1N5YA 1KFDA 3U3GA 4NYFA 2WONA 1C1CA 3VQ6A 1LWEA 4G1QA 4OVLA 1HQUA 4DFPA 1J9AA 4RW7A 5HP1A 5CZ2A 5KGWA 1NKEA 1U49A 4CJFA 3AVJA 3HP9A 4KHQA 1A5WA 2VG5A 4E7HA 2D0BA 3LANA 4FW1A 3KKRA 1QHTA 1VRUA 1NK7A 3QNOA 1UOCA 4M3YA 1JXBA 4IG0A 4DFJA 5FRMA 3PX6A 1TL1A 4BDZA 4RW6A 4Z4FA 4PQUA 1IKVA 1HNVA 1D9FA 1YVUA 4CJRA 3I0RA 1XWLA 3DOKA 3JYTA 1SKSA 2KTQA 1TAQA 3QEVA 4FJNA 4FK4A 3AVAA 3OJSA 1BGXT 4CEDA 5HRNA 3OS1A 3HVTA 4R5PA 2FBXA 3M8RA 3MXIA 2PYLA 4B3OA 1RTDA 1X9MA 1IKXA 2HNDA 3V9UA 4W5NA 1TV6A 2KQ2A 3FFIA 3TAPA 4KO0A 5SZTA 4CGGA 4F3TA 1IKWA 4RG8A 3SZ2A 2VWJA 1RT2A 2I5JA 3NH0A 4XIUA 2G8VA 3D0PA 1L3VA 3DLEA 2P5GA 3HP6A 4M3TA 1GOAA 1RBRA 3ZSYA 4EP5A 4DLGA 3TARA 3PX4A 3PO4A 4CCHA 1RDDA 2ITGA 2JGUA 3OY9A 3PO5A 4M3ZA 2GUIA 4CEEA 4FLYA 4DTXA 1JL1A 4KHNA 4I2PA 1NJYA 3KJVA 4M42A 4CHNA 1JLAA 2GBZA 5KI6A 3AO4A 1WSEA 1T7PA 3V9XA 2YKMA 3OYKA 1WSJA 2HHVA 2QXFA 3S3MA 1F21A 4KKOA 5KGXA 2Q3SA 3OYNA 2XY6A 4PWDA 1RT4A 4B8CA 1YT3A 1ZYQA 5JS1A 1JLBA 5DMRA 4CEZA 4JRPA 1VSEA 3L2RA 2HHXA 1HYVA 4M45A 4BACA 1FKPA 1BQMA 1RCHA 1ZBFA 4J2EA 4AHCA 3SCXA 2KZZA 1S9GA 2ZE2A 3B6OA 1U45A 3HPOA 4CJTA 2F8SA 2ZD1A 4RW8A 1VSJA 2OPQA 4O0IA 4DU4A 1A5XA 4EP4A 1BL3A 3L2WA 4CJLA 4KREA 1JKHA 1HQEA 3AA5X 3ZT2A 4CJWA 1BI4A 2HHQA 2D0AA 2X74A 4L8RB 2D0CA 3VQ7A 2B4JA 3DOLA 3KLEA 3KLIA 5T7BA 3TAMA 5J1EA 2JLEA 3HXMA 4LY7A 4BE1A 4FJIA 4DTSA 2HNYA 4CK1A 3HL8A 4FJXA 1B9DA 1Y97A 3G10A 1R0AA 2IGIA 1VK0A 5CY4A 3VQ5A 3OYMA 4N76A 2BGGA 3JSMA 3MXMA 1LAVA 1GOCA 4OPJA 3TAFA 3KD1E 4E0DA 4W5QA 2VG6A 1RT5A 1RTIA 4E3SA 1T05A 4FZXC 4Y1DA 5CZ1A 1ZBIA 1NK5A 3VQPA 3L2UA 3HJFA 3AA3A 3C95A 1BCMA 3I8DA 2BANA 1QS4A 4FJ8A 3SUPA 1JLQA 4O0JA 4J2AA 3P1GA 1VSLA 1W9HA 4DSLA 4NCAA 4HVJA 2EHGA 4LD0A 4H8KA 2IS3A 2G8IA 2G8FA 4M3UA 1JLCA 1QQCA 2RKIA 4N56A 2DY4A 3B6PA 3S9HA 1RT1A 2QKBA 5J2PA 4ELTA 4QAGA 3BGRA 1WSGA 3ZSRA 2G8KA 3CQ8A 2YNHA 3AVCA 4CEBA 4CHZA 3DRSA 3S3NA 4KTQA 4B8AB 2HNZA 4CJPA 1NOZA 1RBUA 2HB5A 3M8QA 1WAFA 3NF6A 4Z0UA 4CJ5A 2XO7A 3QEPA 4HTUA 4KPYA 3EYZA 3O3GA 1LV5A 2RN2A 1ZBUA 3RWUA 1TAUA 2XHBA 4DQIA 4CEFA 2OZSA 2ETJA 4FM1A 2R7YA 4NYNA 4FLVA 1RILA 5CYMA 3NGIA 4K8ZA 1JLFA 4LH4A 3A2FA 3VQCA 3RR8A 4E1MA 4CEAA 4CHPA 2Z1JA 3K5LA 3LPUA 5KTQA 4CFAA 3SYZA 3DLGA 4KFBA 3AO2A 3AVMA 3C94A 3KLGA 4DSEA 3SNNA 4F2SA 3NGZA 2F8TA 3QLHA 2AJQA 4DTPA 3DM2A 3VA0A 3ZT4A 1MU2A 3CM5A 3T19A 1QE1A 4DTRA 1SL2A 1HYSA 5FDLA 4H4MA 4OJRA 3CFOA 5CYQA 1Z25A 4E89A 3ZT1A 3LP3A 3LP0A 4M3RA 1U04A 4ICLA 3QETA 1NK4A 3VQQA 3HPGA 3KIOA 4M41A 2Z1HA 3VQAA 2XY8A 4DTOA 1NKCA 1WSHA 4M3WA 3U3YA 3SQ1A 1RDBA 1LWCA 3D45A 1HMVA 1S1TA 2EX3A 2YHAA 4DF8A 3U6FA 1BQNA 3IAYA 5FRNA 4CFCA 4YFUA 2P5OA 4DQRA 4JRQA 4C8OA 2W42A 2X6NA 1S1VA 4FJ7A 5C42A 3L2QA 3ZSVA 3AVGA 3OYHA 4FM0A 3O3FA 4KB0A 4DTMA 3AO5A 1UAXA 4E1NA 3SUOA 4IKFA 1KTQA 4OKEA 3O3HA 4C8KA 4ELVA 1IKYA 3UIQA 1U4BA 3SUQA 1XC9A 3V1OA 3NAEA 4CGFA 4CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CF2 A;  4GVM A;  3KK3 A;  3BDP A;  1BI4 B;  2NUB A;  2FBT A;  3EY1 A;  1LW2 A;  2FC0 A;  2O4G A;  2IDO A;  4KV8 A;  3VQB A;  4AHS A;  4W5R A;  4IDK A;  4FLZ A;  5J2Q A;  4B9L A;  4LSN A;  1RNH A;  1JXE A;  4AHT A;  1VSH A;  4ID1 A;  4CJE A;  3ALY A;  1U47 A;  4CJ3 A;  3SV4 A;  1VSK A;  1UA0 A;  3SQ2 A;  4AHR A;  1C0U A;  3VQ4 A;  4Q5V A;  4DSI A;  3ZCM A;  1CXQ A;  4DSF A;  5SWM A;  4DTJ A;  5J2M A;  2E4L A;  1BIS A;  1I3A A;  4O44 A;  4B9V A;  1VSM A;  4CHO A;  4CK3 A;  1HPZ A;  1ZBL A;  1SKW A;  5HRP A;  2DFF A;  1EKE A;  4EZ6 A;  5E41 A;  2XY5 A;  3QIP A;  3TI0 A;  1D9D A;  4DF4 A;  1RTJ A;  1NJZ A;  3AO1 A;  4JS5 A;  3SPZ A;  1Z26 A;  1WNS A;  3NHG A;  4LSL A;  4OLB A;  4TSX A;  4FVM A;  3WNE A;  3PX0 A;  3DLR A;  3PUF A;  2A1R A;  4W5T A;  2Z1I A;  1EP4 A;  3TAG A;  1C0M A;  1XI1 A;  4PY5 A;  4KRF A;  3LAL A;  1ASU A;  4KI6 A;  3LPT A;  3F9K A;  1RBV A;  4IG3 A;  3DLH A;  3PV8 A;  3AVK A;  1X9S A;  1TGO A;  3CFP A;  1S1U A;  3IS9 A;  3OYL A;  3K5M A;  4DWI A;  1BCO A;  3NCI A;  3RRG A;  1HRH A;  3L8B A;  3MEE A;  1RT7 A;  3SJJ A;  3OYG A;  2GV9 A;  1D5A A;  3DRP A;  3DMJ A;  3P5J A;  4DFM A;  2FBY A;  3AVN A;  1J54 A;  2HHT A;  4DSK A;  3AVB A;  1YTA A;  1TK5 A;  3MED A;  3OS2 A;  4FJJ A;  5I3U A;  3C6T A;  3DYA A;  4CES A;  4QOZ B;  1WN7 A;  3KKS A;  4CF1 A;  4DS4 A;  4CJ4 A;  4KHW A;  3OYI A;  3HO1 A;  1K6Y A;  1FXX A;  2YKN A;  1W0H A;  3ITH A;  2X78 A;  1TK8 A;  4K8X A;  3TAB A;  1KRP A;  3QIN A;  4I2Q A;  3LDS A;  1J53 A;  4JS4 A;  4CF9 A;  4DTU A;  2QKK A;  4KHS A;  1NJX A;  4WE1 A;  3QNN A;  4IFV A;  3RTV A;  4O5B A;  3NF9 A;  1RT6 A;  4CEO A;  5HLF A;  2Z1G A;  2YNF A;  1S1X A;  4ZHR A;  4KAZ A;  1KLM A;  4CE9 A;  4CJS A;  4FXD A;  1S6P A;  5I42 A;  3ISN C;  4RW4 A;  4FJG A;  3NGY A;  4C8N A;  1JL2 A;  3ZSW A;  3OYE A;  3MAQ A;  2RPI A;  4OKK A;  3RMA A;  1KLN A;  4LH5 A;  4DU1 A;  4J2D A;  5JS2 A;  3QIO A;  4CJQ A;  2PY5 A;  1J5O A;  4B9U A;  4HCB A;  3RR7 A;  2PZS A;  2ZQB A;  2P1J A;  4CGI A;  5EU7 A;  2KW4 A;  1XHZ A;  4E7K A;  4AHV A;  2FBV A;  3QEX A;  1CZ9 A;  2DFE A;  2IAJ A;  3M8P A;  4M3X A;  1ASW A;  1HJR A;  2HHS A;  3QES A;  2YV0 X;  4OGC A;  4C8M A;  3LP1 A;  4I7F A;  3ZT0 A;  2XRI A;  1T8E A;  4F2R A;  2BDP A;  2VWK A;  4BDP A;  3RRH A;  3QO9 A;  3ASM A;  3DRR A;  3NE6 A;  4FLX A;  3SUN A;  5HRO A;  1QSY A;  2D5R A;  2G8H A;  3VA3 A;  3V81 A;  3KK2 A;  3IRX A;  3SQ0 A;  3TAQ A;  1Q9X A;  1ZBH A;  4CGJ A;  1YTU A;  1N6Q A;  1EET A;  4AH9 A;  1JLG A;  4CJK A;  3NDK A;  4FJL A;  3OVN A;  4CFB A;  4B08 A;  3PY8 A;  1KVA A;  4DU3 A;  2YHB A;  3HT3 A;  4NCB A;  4Q0B A;  4GW6 A;  1TKZ A;  3G0Z A;  4OPK A;  1NK9 A;  4BDY A;  4FCY A;  1C0T A;  3DLK A;  4O55 A;  1WSF A;  4DTN A;  3V6D A;  3P83 D;  1NOY A;  3L3V A;  3K57 A;  1CXU A;  2IC3 A;  4IFY A;  1RDC A;  4KHY A;  1S1W A;  4FM2 A;  3HST B;  3C6U A;  3AVH A;  2WOM A;  4CIF A;  4ZTJ A;  4DG1 A;  3DLB A;  4KHU A;  1SL1 A;  2X6S A;  4MQ3 A;  1LAW A;  4W5O A;  4UQG A;  2O4I A;  3M8S A;  3OJU A;  1U48 A;  2YNI A;  4Z4G A;  3ZSX A;  2DFH A;  1TVR A;  4CGD A;  1VSF A;  3OS0 A;  3I0S A;  4FLT A;  4FJ9 A;  3S3O A;  1CZB A;  4ID5 A;  4GMJ B;  4NCG A;  1IO2 A;  1IH7 A;  1TK0 A;  4FZY A;  4FK2 A;  2QK9 A;  1KCF A;  3EZ5 A;  4OKJ A;  3E01 A;  1CLQ A;  1QSL A;  5FRO A;  5HBM A;  4CJU A;  3MXJ A;  3T3F A;  1L3S A;  1DTQ A;  2HMI A;  1S6Q A;  1FK9 A;  1TKT A;  3OYJ A;  3OYA A;  4FYD A;  3LAK A;  3HK2 A;  1Q8I A;  3LAM A;  1L3U A;  4I9Q A;  4AIL C;  1RDA A;  1NKB A;  4KB1 A;  1VSD A;  4CIE A;  2RF2 A;  3T1A A;  3NF8 A;  1D8Y A;  4QCL A;  3KLF A;  4CHQ A;  2KFN A;  3VQ9 A;  1NJW A;  2E6M A;  3KTQ A;  2B5J A;  3IG1 A;  3V1R A;  4DS5 A;  3LWL A;  3TAN A;  4Z4H A;  3AVL A;  4CER A;  3NFA A;  2OPP A;  3OYF A;  1TKD A;  2B6A A;  3NBP A;  1UA1 A;  1SV5 A;  2ATQ A;  2DTU A;  4KI4 A;  1KVC A;  1VSI A;  4B9S A;  1LWF A;  3AVF A;  3ULD A;  2IOC A;  3RMC A;  3KK1 A;  4B9T A;  3AV9 A;  2PYJ A;  3K2P A;  3ZSZ A;  2HVH A;  2Y1J A;  3V1Q A;  3HM9 A;  2HW3 A;  1WAJ A;  4E7J A;  2BE2 A;  4KTZ A;  2P51 A;  3AA2 A;  1TL3 A;  3NH2 A;  1BHL A;  4CF8 A;  4OGE A;  3RMB A;  3MEG A;  3V4I A;  4N47 A;  3NF7 A;  4DMN A;  3LZJ A;  4BWJ A;  4FJ5 A;  2KFZ A;  5C25 A;  2HVI A;  2VG7 A;  4N5S A;  4EZ9 A;  2F96 A;  4DQQ A;  3DI6 A;  1VRT A;  4FLW A;  1Q9Y A;  3SI6 A;  4ZTF A;  3KD5 E;  3QEI A;  1WLJ A;  1NK0 A;  3VQ8 A;  1FKO A;  2Y1I A;  5DK5 A;  4CEQ A;  4PA1 A;  2OZM A;  4CFD A;  4CEC A;  1C1A A;  1LW0 A;  3H08 A;  3KLH A;  4B9N A;  3AVI A;  4CK2 A;  3OYC A;  1KFS A;  4DSJ A;  4JLH A;  4H4O A;  1S5J A;  1T03 A;  4FJH A;  4BWM A;  4PUO A;  4HHT A;  2G8U A;  4HCC A;  3HPH A;  4N41 A;  3OYB A;  3HYF A;  4I9L A;  3V9S A;  4F4K A;  1G15 A;  3TAE A;  4FJM A;  1QTM A;  1DTT A;  4Z4C A;  4Z4I A;  2KZM A;  1DLO A;  3VQE A;  4KTW A;  3ZSQ A;  5KRT A;  4HUE A;  4BE2 A;  4BE0 A;  1A5V A;  2A1S A;  5C24 A;  1SL0 A;  3TWH A;  2OA8 A;  3SQ4 A;  3LZI A;  1SUQ A;  4DFK A;  2XY7 A;  3O4Q A;  1JLE A;  1RBS A;  3CM6 A;  5D3G A;  3CYM A;  3LP2 A;  1IG9 A;  3VN5 A;  1RT3 A;  1TKX A;  3K58 A;  1L5U A;  3AA4 A;  1ITG A;  1EX4 A;  5HRR A;  2OPS A;  4FJK A;  3VQD A;  4DQS A;  1KVB A;  3SPY A;  3HVR A;  4E7I A;  3L2V A;  3WNH A;  3CFR A;  2YNG A;  4DLE A;  4FW2 A;  3CG7 A;  1QSS A;  4Z4E A;  3L3U A;  3F73 A;  2G8W A;  4FK0 A;  1I39 A;  3SV3 A;  1BIZ A;  1X9W A;  2OPR A;  1BIU A;  3QER A;  4AHU A;  3ZT3 A;  4F8R A;  4RW9 A;  3K59 A;  3K5O A;  4E7L A;  2HHW A;  3TR8 A;  4MFB A;  4B9M A;  1C6V A;  1C1B A;  1O1W A;  4HUG A;  2LSN A;  1EXQ A;  1ASV A;  3NH1 A;  1S9E A;  4CJV A;  4J2B A;  4Y1C A;  2E6L A;  4IBN A;  4E19 A;  4CHY A;  3THV A;  4C8L A;  1RTH A;  3MEC A;  4O4G A;  4FZZ A;  1SKR A;  2HHU A;  1XHX A;  1RBT A;  4OLA A;  1REV A;  4HUF A;  3AO3 A;  4DQP A;  3V9Z A;  1HNI A;  4FLU A;  1WSI A;  5K14 A;  3K5N A;  3WNG A;  4F3O A;  1X1P A;  3OYD A;  1KSP A;  2OYQ A;  3WNF A;  3V9W A;  3RMD A;  1NK8 A;  4ELU A;  4YNQ A;  5J2N A;  5KRS A;  1L3T A;  3ZSO A;  1B92 A;  4CGH A;  1NK6 A;  1GOB A;  1B9F A;  1HYZ A;  3O4N A;  3LWM A;  3QEW A;  4CIG A;  1UWB A;  5HRS A;  1N5Y A;  1KFD A;  3U3G A;  4NYF A;  2WON A;  1C1C A;  3VQ6 A;  1LWE A;  4G1Q A;  4OVL A;  1HQU A;  4DFP A;  1J9A A;  4RW7 A;  5HP1 A;  5CZ2 A;  5KGW A;  1NKE A;  1U49 A;  4CJF A;  3AVJ A;  3HP9 A;  4KHQ A;  1A5W A;  2VG5 A;  4E7H A;  2D0B A;  3LAN A;  4FW1 A;  3KKR A;  1QHT A;  1VRU A;  1NK7 A;  3QNO A;  1UOC A;  4M3Y A;  1JXB A;  4IG0 A;  4DFJ A;  5FRM A;  3PX6 A;  1TL1 A;  4BDZ A;  4RW6 A;  4Z4F A;  4PQU A;  1IKV A;  1HNV A;  1D9F A;  1YVU A;  4CJR A;  3I0R A;  1XWL A;  3DOK A;  3JYT A;  1SKS A;  2KTQ A;  1TAQ A;  3QEV A;  4FJN A;  4FK4 A;  3AVA A;  3OJS A;  1BGX T;  4CED A;  5HRN A;  3OS1 A;  3HVT A;  4R5P A;  2FBX A;  3M8R A;  3MXI A;  2PYL A;  4B3O A;  1RTD A;  1X9M A;  1IKX A;  2HND A;  3V9U A;  4W5N A;  1TV6 A;  2KQ2 A;  3FFI A;  3TAP A;  4KO0 A;  5SZT A;  4CGG A;  4F3T A;  1IKW A;  4RG8 A;  3SZ2 A;  2VWJ A;  1RT2 A;  2I5J A;  3NH0 A;  4XIU A;  2G8V A;  3D0P A;  1L3V A;  3DLE A;  2P5G A;  3HP6 A;  4M3T A;  1GOA A;  1RBR A;  3ZSY A;  4EP5 A;  4DLG A;  3TAR A;  3PX4 A;  3PO4 A;  4CCH A;  1RDD A;  2ITG A;  2JGU A;  3OY9 A;  3PO5 A;  4M3Z A;  2GUI A;  4CEE A;  4FLY A;  4DTX A;  1JL1 A;  4KHN A;  4I2P A;  1NJY A;  3KJV A;  4M42 A;  4CHN A;  1JLA A;  2GBZ A;  5KI6 A;  3AO4 A;  1WSE A;  1T7P A;  3V9X A;  2YKM A;  3OYK A;  1WSJ A;  2HHV A;  2QXF A;  3S3M A;  1F21 A;  4KKO A;  5KGX A;  2Q3S A;  3OYN A;  2XY6 A;  4PWD A;  1RT4 A;  4B8C A;  1YT3 A;  1ZYQ A;  5JS1 A;  1JLB A;  5DMR A;  4CEZ A;  4JRP A;  1VSE A;  3L2R A;  2HHX A;  1HYV A;  4M45 A;  4BAC A;  1FKP A;  1BQM A;  1RCH A;  1ZBF A;  4J2E A;  4AHC A;  3SCX A;  2KZZ A;  1S9G A;  2ZE2 A;  3B6O A;  1U45 A;  3HPO A;  4CJT A;  2F8S A;  2ZD1 A;  4RW8 A;  1VSJ A;  2OPQ A;  4O0I A;  4DU4 A;  1A5X A;  4EP4 A;  1BL3 A;  3L2W A;  4CJL A;  4KRE A;  1JKH A;  1HQE A;  3AA5 X;  3ZT2 A;  4CJW A;  1BI4 A;  2HHQ A;  2D0A A;  2X74 A;  4L8R B;  2D0C A;  3VQ7 A;  2B4J A;  3DOL A;  3KLE A;  3KLI A;  5T7B A;  3TAM A;  5J1E A;  2JLE A;  3HXM A;  4LY7 A;  4BE1 A;  4FJI A;  4DTS A;  2HNY A;  4CK1 A;  3HL8 A;  4FJX A;  1B9D A;  1Y97 A;  3G10 A;  1R0A A;  2IGI A;  1VK0 A;  5CY4 A;  3VQ5 A;  3OYM A;  4N76 A;  2BGG A;  3JSM A;  3MXM A;  1LAV A;  1GOC A;  4OPJ A;  3TAF A;  3KD1 E;  4E0D A;  4W5Q A;  2VG6 A;  1RT5 A;  1RTI A;  4E3S A;  1T05 A;  4FZX C;  4Y1D A;  5CZ1 A;  1ZBI A;  1NK5 A;  3VQP A;  3L2U A;  3HJF A;  3AA3 A;  3C95 A;  1BCM A;  3I8D A;  2BAN A;  1QS4 A;  4FJ8 A;  3SUP A;  1JLQ A;  4O0J A;  4J2A A;  3P1G A;  1VSL A;  1W9H A;  4DSL A;  4NCA A;  4HVJ A;  2EHG A;  4LD0 A;  4H8K A;  2IS3 A;  2G8I A;  2G8F A;  4M3U A;  1JLC A;  1QQC A;  2RKI A;  4N56 A;  2DY4 A;  3B6P A;  3S9H A;  1RT1 A;  2QKB A;  5J2P A;  4ELT A;  4QAG A;  3BGR A;  1WSG A;  3ZSR A;  2G8K A;  3CQ8 A;  2YNH A;  3AVC A;  4CEB A;  4CHZ A;  3DRS A;  3S3N A;  4KTQ A;  4B8A B;  2HNZ A;  4CJP A;  1NOZ A;  1RBU A;  2HB5 A;  3M8Q A;  1WAF A;  3NF6 A;  4Z0U A;  4CJ5 A;  2XO7 A;  3QEP A;  4HTU A;  4KPY A;  3EYZ A;  3O3G A;  1LV5 A;  2RN2 A;  1ZBU A;  3RWU A;  1TAU A;  2XHB A;  4DQI A;  4CEF A;  2OZS A;  2ETJ A;  4FM1 A;  2R7Y A;  4NYN A;  4FLV A;  1RIL A;  5CYM A;  3NGI A;  4K8Z A;  1JLF A;  4LH4 A;  3A2F A;  3VQC A;  3RR8 A;  4E1M A;  4CEA A;  4CHP A;  2Z1J A;  3K5L A;  3LPU A;  5KTQ A;  4CFA A;  3SYZ A;  3DLG A;  4KFB A;  3AO2 A;  3AVM A;  3C94 A;  3KLG A;  4DSE A;  3SNN A;  4F2S A;  3NGZ A;  2F8T A;  3QLH A;  2AJQ A;  4DTP A;  3DM2 A;  3VA0 A;  3ZT4 A;  1MU2 A;  3CM5 A;  3T19 A;  1QE1 A;  4DTR A;  1SL2 A;  1HYS A;  5FDL A;  4H4M A;  4OJR A;  3CFO A;  5CYQ A;  1Z25 A;  4E89 A;  3ZT1 A;  3LP3 A;  3LP0 A;  4M3R A;  1U04 A;  4ICL A;  3QET A;  1NK4 A;  3VQQ A;  3HPG A;  3KIO A;  4M41 A;  2Z1H A;  3VQA A;  2XY8 A;  4DTO A;  1NKC A;  1WSH A;  4M3W A;  3U3Y A;  3SQ1 A;  1RDB A;  1LWC A;  3D45 A;  1HMV A;  1S1T A;  2EX3 A;  2YHA A;  4DF8 A;  3U6F A;  1BQN A;  3IAY A;  5FRN A;  4CFC A;  4YFU A;  2P5O A;  4DQR A;  4JRQ A;  4C8O A;  2W42 A;  2X6N A;  1S1V A;  4FJ7 A;  5C42 A;  3L2Q A;  3ZSV A;  3AVG A;  3OYH A;  4FM0 A;  3O3F A;  4KB0 A;  4DTM A;  3AO5 A;  1UAX A;  4E1N A;  3SUO A;  4IKF A;  1KTQ A;  4OKE A;  3O3H A;  4C8K A;  4ELV A;  1IKY A;  3UIQ A;  1U4B A;  3SUQ A;  1XC9 A;  3V1O A;  3NAE A;  4CGF A;  4CF0 A; 
#chains in the Genus database with same CATH topology
 5JVG L;  3P4I A;  4UY8 O;  1LW2 A;  3VQB A;  4IDH A;  5AQN A;  3D7E O;  5J2Q A;  1VSH A;  1DKG D;  4HWI A;  3SQ2 A;  4Q5V A;  2E2O A;  2E4L A;  3R1X A;  2P9I B;  1BIS A;  4YOT A;  3JAM O;  1NGE A;  3D6R A;  3C6A A;  1SKW A;  3C7N A;  1EKE A;  3ZX2 A;  4EZ6 A;  3QIP A;  3TI0 A;  2IVO A;  4OLB A;  1C0F A;  3NHG A;  3QB0 A;  4FWM A;  3DLR A;  1EP4 A;  4KRF A;  3LAL A;  5AQZ A;  1TGO A;  3IS9 A;  3OYL A;  1BCO A;  3DRP A;  1JCF A;  4EHU A;  2HHT A;  4M7X A;  1ATN A;  1HJO A;  3GL1 A;  3M1F A;  3C6T A;  4JI7 K;  3MN6 A;  4CJ4 A;  3OYI A;  1FXX A;  4JK7 A;  1TK8 A;  3QIN A;  4JS4 A;  1J53 A;  4GVE A;  4O5B A;  5BRF A;  4FXD A;  4Z4G A;  4FJG A;  4C8N A;  1NNE A;  2RPI A;  3THY A;  4LH5 A;  4DU1 A;  5JS2 A;  4CJQ A;  3ID6 A;  2GTD A;  2PY5 A;  2QWP A;  3A5O C;  4B9U A;  1XQS C;  4HCB A;  2PZS A;  5AQR A;  2GEL A;  2KW4 A;  5AQT A;  1BO5 O;  1IJJ A;  1CZ9 A;  2DFE A;  5AFU A;  1ASW A;  2YV0 X;  3VEW A;  3LP1 A;  1VQO N;  3SUN A;  2A42 A;  2D5R A;  4LFC K;  3SQ0 A;  3P39 A;  1Q9X A;  3AAP A;  1ZBH A;  1N6Q A;  1ATS A;  1JLG A;  4FWO A;  4B08 A;  3PY8 A;  3G0Z A;  1NK9 A;  4FCY A;  1C0T A;  3P83 D;  4IFY A;  4FM2 A;  3HST B;  4WFA L;  3O4W A;  3WXL A;  3FZM A;  4ZTJ A;  3DLB A;  1J6Z A;  1XUP O;  4MQ3 A;  1BA1 A;  4YOX A;  1U48 A;  1KAZ A;  2UUB K;  2YNI A;  5JMV A;  3ZSX A;  4CGD A;  3HZ6 A;  3T7Z A;  3S3O A;  1YJN N;  1IO2 A;  1BWF O;  3L0Q A;  1KCF A;  3EZ5 A;  1CLQ A;  1QSL A;  1L3S A;  2UXB K;  1S6Q A;  1XNQ K;  4FYD A;  3LAK A;  4GV3 A;  3HK2 A;  1Q8I A;  4I9Q A;  3NF8 A;  4WQ5 A;  4CHQ A;  3VQ9 A;  1K8K B;  3EKS A;  2VQF K;  2B5J A;  3IG1 A;  4DS5 A;  3QFP A;  3TAN A;  4CER A;  5FPE A;  3NFA A;  5AQY A;  2B6A A;  4KI4 A;  4B9S A;  1LWF A;  1MA9 B;  3ULD A;  3WT0 A;  3KWI A;  3AV9 A;  3VEV A;  1ATR A;  2OCE A;  4CZL A;  5DM6 L;  1WAJ A;  4KTZ A;  3WEE A;  3CC2 N;  3RMB A;  3MWT A;  3CJ9 A;  2H3G X;  3VF2 A;  1GLA G;  3NF7 A;  2HVI A;  2VG7 A;  4N5S A;  4AQY K;  2F96 A;  4BVO A;  1Q9Y A;  4FLW A;  3BZC A;  3KD5 E;  3QEI A;  2JWL A;  3VQ8 A;  5DK5 A;  4CEQ A;  2OZM A;  5TKY A;  4H0V B;  4CW7 B;  1I94 K;  4XEI A;  2ZWH A;  3KLH A;  4B9N A;  4A61 A;  4BRP A;  3BEX A;  3ZEU A;  4PUO A;  2Q0U A;  3HPH A;  3TSQ A;  2FSN A;  3V9S A;  3TAE A;  1QTM A;  1DTT A;  4Z4C A;  2ASM A;  1DLO A;  3JS6 A;  1U2V B;  4BR5 A;  3RSE B;  1SL0 A;  3CCE N;  3TWH A;  3CXC M;  3CC7 N;  4U67 L;  3SQ4 A;  3CD6 N;  3U9D A;  5D3G A;  3LP2 A;  3UE5 A;  3K58 A;  3MMV A;  3AA4 A;  1ITG A;  1EX4 A;  4DQS A;  4JKC A;  3WNH A;  3L2V A;  4DLE A;  1QSS A;  4JI2 K;  5AJ3 K;  2YCH A;  4BRK A;  1BIU A;  3OTO K;  3K59 A;  4MFB A;  1EXQ A;  1ASV A;  5AR0 A;  4E19 A;  2E6L A;  4IBN A;  4CHY A;  3THV A;  1RTH A;  5KPZ A;  3U9Z A;  2P9N B;  5M1K A;  3HBT A;  2P9U A;  3AO3 A;  4YDU C;  5HL7 L;  3CJ1 A;  1X1P A;  2AA4 A;  3V9W A;  2CGL A;  5KRS A;  1B92 A;  1GOB A;  4DHY A;  3E9L A;  3CCL N;  4C1N I;  4WQ4 C;  4CZJ A;  5HRS A;  4DR6 K;  4BGA A;  4NYF A;  3D2F B;  1C1C A;  3SMS A;  4G1Q A;  1HQU A;  4A59 A;  1J9A A;  4XH1 A;  3VEX A;  5HP1 A;  1U49 A;  4CJF A;  4DUY K;  4H5R A;  3HI0 A;  1QHT A;  1VRU A;  3DXM A;  3QNO A;  1UOC A;  4M3Y A;  5FRM A;  4KHP K;  4KH6 A;  4RW6 A;  4PQU A;  1NWK A;  1XC3 A;  3CJA A;  1XWL A;  4FK4 A;  3AVA A;  1T3V A;  1BGX T;  5E26 A;  3VTH A;  2PYL A;  2P9L A;  2FBX A;  5KQD A;  1X9M A;  2ASP A;  4W5N A;  3FFI A;  1YUW A;  1HKC A;  5SZT A;  4CGG A;  2RHK A;  1NG9 A;  4CI6 A;  3CJC A;  1SZ2 A;  1RT2 A;  2YJE A;  2G8V A;  4M3T A;  1YHQ N;  1L3V A;  3DLE A;  4BRL A;  2WBN A;  4WFB L;  4IO8 A;  3PX4 A;  2OTL N;  3PO5 A;  4M3Z A;  2GUI A;  4IOA L;  3B8A X;  1OVY A;  4M63 C;  1T7P A;  2QA4 N;  3VET A;  2HHV A;  2FLO A;  5KGX A;  2Q3S A;  4CZK A;  3OYN A;  2XY6 A;  2A40 A;  1RT4 A;  4JKF A;  5JS1 A;  5DMR A;  4IWV A;  1HYV A;  1IBL K;  4BRO A;  2Q0R A;  4B1Z A;  1ZC6 A;  3J80 O;  3SCX A;  1GLB G;  4NXM K;  2O8B A;  4CJT A;  2E2N A;  1VSJ A;  4FWQ A;  2YX6 A;  2V7Y A;  4EP4 A;  4JNE A;  4BR9 A;  4CJL A;  4KRE A;  1JKH A;  1HQE A;  2X74 A;  2BUP A;  5AQU A;  3S41 A;  2D0C A;  2B4J A;  3DOL A;  3ENO A;  1JJ2 M;  2UUC K;  3TAM A;  3HXM A;  4LY7 A;  3ULE B;  5HOO A;  4FJI A;  3HL8 A;  4BC5 A;  1OH5 A;  1VK0 A;  4YOV A;  4N76 A;  1GOC A;  4OPJ A;  2WTU A;  3VEZ A;  4W5Q A;  4E3S A;  1RT5 A;  1T05 A;  4GKK K;  5CZ1 A;  2VCP A;  3HJF A;  3I8D A;  4FJ8 A;  4O0J A;  1W9H A;  2WFB A;  4JI0 K;  4LD0 A;  4H8K A;  1VQP N;  1QQC A;  2RKI A;  4N56 A;  3B6P A;  3S9H A;  3BUZ B;  4BRA A;  1WSG A;  2G8K A;  2YNH A;  4JHD A;  2Q2R A;  1GLL O;  4CJP A;  1NOZ A;  2HB5 A;  2XO7 A;  3NF6 A;  2O8C B;  4HTU A;  3FGU A;  3O3G A;  2QWL A;  1LV5 A;  1ZBU A;  4B3R K;  1NLV A;  4EFH A;  2R7Y A;  1QZ6 A;  4NYN A;  3U8X A;  3NGI A;  4BRE A;  4CHP A;  4JI3 K;  4CFA A;  4JKE A;  4KFB A;  3C94 A;  1E4F T;  4IFE A;  3KLG A;  4DSE A;  3NGZ A;  2AJQ A;  4DTP A;  2OAN A;  4IJN A;  4OPA A;  1MU2 A;  3VA0 A;  5FDL A;  1Z25 A;  1XMQ K;  3ZT1 A;  3LP3 A;  4DR4 K;  4M3R A;  4ICL A;  4BRD A;  3QET A;  3KIO A;  2XY8 A;  4PL8 A;  4M3W A;  1IBM K;  3D2E B;  3U3Y A;  3SQ1 A;  1LWC A;  1HMV A;  2EX3 A;  2P9S A;  1N36 K;  4CFC A;  4YFU A;  4DQR A;  3QML A;  2W42 A;  3THX A;  1MWK A;  1RGI A;  5C42 A;  3L2Q A;  4ISF A;  3AO5 A;  2QWN A;  4CBU A;  4E1N A;  3SUO A;  4OKE A;  4IKF A;  4C8K A;  3UIQ A;  1U4B A;  1XC9 A;  4H0O A;  4CF0 A;  4GVM A;  1QVF M;  1BI4 B;  5KQ8 A;  2NUB A;  3E9P A;  3CCQ N;  2FBT A;  5BRH A;  2FC0 A;  4O8K A;  3G6E N;  4DCH A;  4FLZ A;  1Q86 O;  4LC9 B;  1JXE A;  4CJ3 A;  1VSK A;  1UA0 A;  2IVP A;  2ZM6 K;  2NLX A;  3OHR A;  4CHO A;  1HPZ A;  4JYA K;  5HRP A;  2DFF A;  5EOY A;  4DF4 A;  4FWP A;  1RTJ A;  2HBL A;  3O1W A;  1W7A A;  4LSL A;  1J5E K;  4FVM A;  3PX0 A;  3PUF A;  5ADX H;  1TYQ A;  3TAG A;  1C0M A;  3TTC A;  1T44 A;  3FZK A;  4KI6 A;  3F9K A;  1RBV A;  2NRH A;  3PV8 A;  1X9S A;  1S1U A;  3K5M A;  3BF1 A;  4DWI A;  4ILG B;  3MEE A;  3L8B A;  3SJJ A;  3OYG A;  2GV9 A;  3P5J A;  4DFM A;  3WQT A;  1J54 A;  3J8A A;  2UU9 K;  1VQ4 N;  2KHO A;  2VYP A;  4FJJ A;  2ASO A;  4H5V A;  4LF5 K;  3SK3 A;  4DS4 A;  1K6Y A;  1W0H A;  3ITH A;  2X78 A;  4K8X A;  4I2Q A;  3CJB A;  4DTU A;  4CF9 A;  2BTF A;  5BR8 K;  4WE1 A;  3QNN A;  3RTV A;  3CQY A;  1RT6 A;  5HLF A;  5BPL A;  5AQP A;  2YNF A;  1S1X A;  4ZHR A;  4KAZ A;  4CE9 A;  1S6P A;  5I42 A;  3ISN C;  3O9T A;  3ZSW A;  3MAQ A;  4FWK A;  5IT9 O;  2O8F A;  4IXC A;  1SS6 A;  3H3O B;  4LF9 K;  2W6K A;  4CGI A;  5AZJ A;  5EY4 A;  2D0O A;  3FZL A;  3QEX A;  2FBV A;  4DKW A;  1P8Z A;  4C8M A;  3ZT0 A;  5FPM A;  3SAH A;  4BDP A;  3ASM A;  3NE6 A;  4FLX A;  1QSY A;  2ZF5 O;  5AQW A;  2P9P B;  4WQ5 C;  3TAQ A;  1DGK N;  3NDK A;  4EAH D;  2FXU A;  3SJH A;  4JK9 A;  3HT3 A;  4GW6 A;  3OW2 M;  5KPR A;  3L3V A;  3K57 A;  1NGD A;  2IC3 A;  4MDA A;  4KHY A;  1S1W A;  3C6U A;  4BG9 A;  4CZF A;  2D0P A;  1SL1 A;  5DM7 L;  3OJU A;  2NRR A;  2Q1N A;  1TVR A;  1VSF A;  3CIP A;  4GY2 B;  3BY5 A;  1CZB A;  4GMJ B;  4NCG A;  4FK2 A;  4BR7 A;  5AQS A;  3E01 A;  4CJU A;  3MX2 A;  3MN5 A;  3IKM A;  3LAM A;  4AIL C;  1NKB A;  3MCA B;  1NGC A;  1D8Y A;  4NB4 A;  1NJW A;  3KTQ A;  3DXK B;  5BPN A;  3AGK A;  3KZB A;  4K43 A;  3VGM A;  2ZGY A;  3OYF A;  1TKD A;  3GE1 A;  2ATQ A;  1VSI A;  4G9Z A;  3AVF A;  2V51 B;  3RMC A;  2AP1 A;  4B9T A;  2PYJ A;  3K2P A;  3ZSZ A;  2Y1J A;  3V1Q A;  4JAX A;  2BE2 A;  3G25 A;  1TL3 A;  2FSK A;  3NH2 A;  3MEG A;  4FJ5 A;  4LFB K;  4EZ9 A;  2GWK A;  4GNI A;  1VRT A;  5CE3 A;  3SI6 A;  5EX5 A;  4ZTF A;  1NK0 A;  3HSC A;  1FKO A;  2GEM A;  4CEC A;  1C1A A;  1QQM A;  3H08 A;  3DLL L;  3OYC A;  1KFS A;  4H4O A;  1S5J A;  4XH4 A;  4BWM A;  1OH8 A;  3AAR A;  4FJM A;  2E5L K;  4KTW A;  3ZSQ A;  5KRT A;  3CCJ N;  4BE0 A;  5C24 A;  3W0L A;  2D4W A;  3I55 N;  3O9S A;  2W6L A;  3LZI A;  2XY7 A;  3WXI A;  1MDU B;  3CI5 A;  4NLB A;  4JN4 A;  1IG9 A;  3UKU A;  3A5M C;  1RT3 A;  4BRG A;  5HRR A;  2O8E B;  3R9P A;  3HVR A;  3H45 C;  1BIZ A;  3LDQ A;  2OPR A;  3QER A;  4AHU A;  5CR4 A;  3ZT3 A;  4B9M A;  1O1W A;  5AQK A;  4CJV A;  4J2B A;  2IIR A;  3MCP A;  4Y1C A;  2QWR A;  1SKR A;  4OLA A;  1REV A;  2ZJR L;  3V9Z A;  4FLU A;  1WSI A;  3K5N A;  4JD2 A;  3UB5 A;  3OYD A;  1KSP A;  3RVC A;  4ELU A;  4YNQ A;  1K8A O;  1L3T A;  3ZSO A;  4X62 K;  5BRE A;  4B3M K;  3LWM A;  1UWB A;  1N5Y A;  3M6G A;  4FSV A;  2WON A;  1LWE A;  2JWK A;  4OVL A;  4RW7 A;  5CZ2 A;  5KGW A;  1NKE A;  1KC8 O;  2HF3 A;  3HP9 A;  1A5W A;  4E7H A;  1JXB A;  4BRC A;  4YOY A;  3PX6 A;  1TL1 A;  4AF1 A;  4Z4F A;  4BQZ A;  1HNV A;  3A0I X;  1IBK K;  1YVU A;  3DOK A;  3NVM A;  2IVN A;  4FJN A;  1HKB A;  3FZH A;  3R3L A;  4OX9 K;  3OJS A;  1Q7Y O;  5HRN A;  3M8R A;  3HVT A;  4R5P A;  3PIO L;  4B1Y B;  1RTD A;  3O1B A;  2HND A;  1XMO K;  1TV6 A;  1HNX K;  5M1F A;  1IKW A;  3SZ2 A;  2P9K A;  2VWJ A;  4DR1 K;  2I5J A;  3PO4 A;  2ITG A;  1DEJ A;  2JGU A;  3LDO A;  3TU5 A;  3VOV A;  5LL6 Z;  1JL1 A;  4KHN A;  4WFN L;  4RTF D;  3V9X A;  4AM6 A;  5M1O A;  1WSJ A;  4KKO A;  3T69 A;  4PWD A;  4B8C A;  2I7P A;  1YT3 A;  2ZJP L;  1G99 A;  4XH5 A;  1JLB A;  1Y64 A;  4A2A A;  2HHX A;  1VSE A;  4FVU A;  4BAC A;  1FKP A;  4JKB A;  5JLH A;  1RCH A;  4EHT A;  1ZBF A;  4J2E A;  5AQO A;  4H0X B;  1WUA A;  2F8S A;  4RW8 A;  2QW9 A;  1A5X A;  1BL3 A;  4B3S K;  3L2W A;  4OO1 J;  2QM1 A;  3AAQ A;  3O6W A;  3ZT2 A;  2E1Y A;  3PIP L;  3E66 A;  4L8R B;  2YI1 A;  3VQ7 A;  1QHA A;  2QXL A;  1EWR A;  5J1E A;  3ZX3 A;  4DTS A;  4CK1 A;  4FJX A;  3U4L A;  1B9D A;  1R0A A;  3OYM A;  5CY4 A;  1TUU A;  1X3N A;  3JSM A;  3SLC A;  5BRD A;  2VG6 A;  3O5B A;  5AQQ A;  1YJW N;  1M1K O;  3VQP A;  5LMN K;  1VQ6 N;  1BCM A;  3MX5 A;  1JLQ A;  5F2R A;  4J2A A;  1VSL A;  3A5N C;  2IS3 A;  4FPB A;  4M3U A;  2DY4 A;  5J2P A;  3THW B;  3A5L C;  1CZA N;  1Q18 A;  3IUC A;  4CHZ A;  3DRS A;  4WYB A;  1NGA A;  1NBW A;  1X3M A;  1YJ9 N;  4MLE A;  3M3Z A;  2P9S B;  3RWU A;  1TAU A;  4DQI A;  2OZS A;  2ETJ A;  4JKG B;  5CYM A;  4M7Y A;  5AFU H;  3ZET B;  4JI5 K;  3VQC A;  4B3T K;  1KAX A;  3DLG A;  3AVM A;  3SNN A;  1GLC G;  3QLH A;  3DM2 A;  1EWQ A;  1HYS A;  3T19 A;  3CM5 A;  3R8E A;  5GAE P;  4AM7 A;  1SL2 A;  3CFO A;  1V4T A;  3VMF B;  5F1X A;  3LP0 A;  1NK4 A;  4CZM A;  3BF3 A;  3CHW A;  3FFK B;  3HPG A;  3P31 A;  2F4V K;  4BRH A;  3CQX A;  1YIT N;  1RDB A;  1S1T A;  3I56 N;  4MO4 A;  2X6N A;  1S1V A;  4FJ7 A;  3M5R A;  3ZSV A;  4FM0 A;  4I6M B;  4KB0 A;  5FPD A;  3O3H A;  3DWL A;  4ELV A;  5BN9 A;  3NAE A;  3CJ7 A;  4CF2 A;  3KK3 A;  3BDP A;  3EY1 A;  2O4G A;  1BU6 O;  4W5R A;  4IDK A;  4LSN A;  1RNH A;  2O8D B;  4CJE A;  3CER A;  4AHR A;  1C0U A;  1E4G T;  3ZCM A;  1CXQ A;  5SWM A;  5J2M A;  4GV6 A;  1QQO A;  1S72 N;  1I3A A;  4B9V A;  4CK3 A;  3BZK A;  1X9J A;  1JCG A;  3KWG A;  1YIJ N;  5ADX A;  2XY5 A;  1D9D A;  2KKZ A;  1ZBS A;  1WNS A;  4TSX A;  3WNE A;  4NLC A;  2A1R A;  4PY5 A;  2Z1I A;  1OKJ A;  2HHH K;  1WOQ A;  3LPT A;  4IG3 A;  3AVK A;  3NMU A;  1QZ5 A;  3NCI A;  3RRG A;  3WUH A;  1RT7 A;  3LL3 A;  3H1Q A;  3AVN A;  2E20 A;  4DSK A;  1YTA A;  3CCS N;  1TK5 A;  3MED A;  5I3U A;  3DYA A;  4CES A;  1WN7 A;  3KKS A;  4LF7 K;  3LDS A;  2F7T A;  2F9W A;  3ENH A;  4IFV A;  1VHX A;  2V7Z A;  3NF9 A;  3EEQ A;  2Z1G A;  4JKA A;  1KLM A;  4RW4 A;  3OYE A;  1KLN A;  2QTD A;  5KPT A;  1J5O A;  2ZGZ A;  4A5B A;  2P1J A;  4O5F A;  3VER A;  4AHV A;  4M3X A;  2IAJ A;  3M8P A;  3QES A;  3G71 N;  4OGC A;  1T8E A;  4F2R A;  2XRI A;  2CH5 A;  2BDP A;  4MO5 A;  3RRH A;  2ZJQ L;  3R6M A;  4ISG A;  1U2V A;  3RSE A;  1Q81 O;  4DR3 K;  3KK2 A;  4CBX A;  1FW6 A;  3TTF A;  4CGJ A;  1YTU A;  1HUX A;  4CJK A;  4FJL A;  3QBX A;  3MK6 A;  3CCR N;  4BRQ A;  4NCB A;  4Q0B A;  1D4X A;  1TKZ A;  4OPK A;  4BDY A;  3DLK A;  1WSF A;  1NOY A;  3KVG A;  3WXM B;  3N4P A;  4DV5 K;  3P38 A;  4CIF A;  2WOM A;  1N33 K;  4DG1 A;  4KHU A;  5A2Q O;  2O4I A;  2GX9 A;  4H0P A;  2DFH A;  5AQF A;  3OS0 A;  3C7N B;  3I0S A;  3QIC A;  2YHX A;  4FLT A;  4FJ9 A;  4WCE L;  2VQE K;  4FZY A;  1IH7 A;  1TK0 A;  4MDB A;  4OKJ A;  5AQH A;  1FK9 A;  3OYA A;  3IFR A;  1HR0 K;  3UKR A;  5AQV A;  3FZF A;  3T1A A;  3D2F A;  4QCL A;  3KLF A;  4YDU A;  1VQ8 N;  4JI4 K;  4DQ8 A;  3GG4 A;  4A5A A;  4Z4H A;  4YHH K;  4IEI A;  3N4Q A;  1W97 L;  1UA1 A;  1SV5 A;  2IOC A;  4WQ4 A;  4A2B A;  2HW3 A;  3H46 O;  4E7J A;  1ZXO A;  5AQG A;  3T1Y K;  1BHL A;  4OGE A;  4N47 A;  4DMN A;  2KFZ A;  3LZJ A;  4BWJ A;  4BC2 A;  2I7N A;  4KBO A;  3THY B;  3PLA A;  4DV6 K;  1WLJ A;  2Y1I A;  2VWB A;  4K41 A;  4CK2 A;  4DSJ A;  4BRI A;  4JLH A;  5GAG P;  4B1X B;  4HHT A;  2G8U A;  4HCC A;  3NVK A;  3OYB A;  3HYF A;  4I9L A;  1W2B M;  4F4K A;  3E1Y A;  2KZM A;  1V4S A;  4HUE A;  1C0G A;  1A5V A;  2OA8 A;  4DR5 K;  2UXC K;  1SUQ A;  3QBW A;  4BC3 A;  1JLE A;  1RBS A;  3CM6 A;  1WBB A;  1TKX A;  1L5U A;  2NRV A;  4FOI A;  1KVB A;  4E7I A;  2YNG A;  4FW2 A;  3CG7 A;  4Z4E A;  3C0B A;  2G8W A;  4FK0 A;  1NGJ A;  5MLC Q;  3K5O A;  2BH1 A;  2LSN A;  5FLX O;  1N8R O;  1S9E A;  3TSP A;  4FZZ A;  4O4G A;  1XHX A;  1RBT A;  4HUF A;  3JXU A;  3WNG A;  3RMD A;  1GLF O;  5J2N A;  4OPH A;  1NK6 A;  3ULE A;  1HYZ A;  3QEW A;  3ZYY X;  1RFQ A;  4DR7 K;  4CIG A;  1HX1 A;  1HLU A;  3LDL A;  2QWO A;  3VQ6 A;  3C65 A;  4DFP A;  4BRN A;  4NXN K;  5LMU K;  3VTI A;  3AVJ A;  4PKG A;  4O8U A;  4HTL A;  2V52 B;  3KKR A;  1VQL N;  2Q97 A;  5GAD P;  4IG0 A;  4QS8 A;  3HOT A;  4IZ9 A;  4DFJ A;  4BDZ A;  1VQ5 N;  4CZH A;  2E8A A;  1OH6 A;  1D9F A;  2VGN A;  3WEE B;  3I0R A;  2CH6 A;  3JYT A;  5M1P A;  1SKS A;  2KTQ A;  2HBM A;  3QEV A;  4FWL A;  4CED A;  3OS1 A;  5AQI A;  4IOX A;  1IKX A;  3WXK A;  2KQ2 A;  3TAP A;  3EZW A;  4KO0 A;  1BDG A;  4F3T A;  4RG8 A;  1N34 K;  3EN9 A;  2P5G A;  4XIU A;  3D0P A;  3ZEU B;  1GOA A;  3ZSY A;  1N32 K;  4EP5 A;  4DLG A;  1RDD A;  3OY9 A;  1KQS M;  4IJA A;  4DTX A;  4I2P A;  3KJV A;  4CHN A;  1JLA A;  2GBZ A;  5KI6 A;  3AO4 A;  1NMD A;  4H03 B;  4PL7 A;  4JKD A;  2WC9 A;  3O9Q A;  2E1Z A;  4ILJ A;  4RCH A;  4BRM A;  1O13 A;  1ZYQ A;  5GIP A;  3EO3 A;  3L2R A;  5GIO A;  3D2E A;  2YJF A;  1BQM A;  2A41 A;  2HF4 A;  5JLF A;  4X66 K;  4LF6 K;  2KZZ A;  1SAZ A;  2ZE2 A;  2QI2 A;  1U45 A;  4FWS A;  3VEN A;  4CZI A;  3WQU A;  4F9O A;  3SMP A;  3AA5 X;  3EKU A;  4CJW A;  1BI4 A;  2HHQ A;  2P9U B;  2A5X A;  1LCU A;  3PSI A;  3L4I A;  5T7B A;  2CGJ A;  4BE1 A;  1QVG M;  1Y97 A;  3G10 A;  3VQ5 A;  3ID8 A;  3MXM A;  1LAV A;  3GDQ A;  2F9T A;  5LJV A;  3KD1 E;  5C15 A;  4DB3 A;  4E0D A;  4FZX C;  1ZBI A;  3GBT A;  4PKI A;  3C95 A;  1IG8 A;  3SUP A;  3CME N;  2J4R A;  3DXM B;  4HVJ A;  3AY9 A;  1JLC A;  1GLD G;  2A6A A;  4QAG A;  3BGR A;  1NGI A;  3ENB A;  1NGH A;  3CQ8 A;  1RDW X;  4EIA A;  2P9L B;  4B8A B;  2HNZ A;  3J7Y P;  4CJ5 A;  4Z0U A;  1WAF A;  3QEP A;  4KPY A;  3SAF A;  4CVN E;  3EYZ A;  2PFU A;  2XHB A;  1EQY A;  4DR2 K;  4JEP A;  4R79 A;  4FLV A;  3TSU A;  5JVH L;  4K8Z A;  4NO7 A;  1JLF A;  4LH4 A;  3A2F A;  3RR8 A;  4E1M A;  4CEA A;  3CCM N;  4JI6 K;  2Z1J A;  3LPU A;  2NRX A;  3AO2 A;  4B1U B;  4F2S A;  2F8T A;  4CJ7 A;  1JCE A;  3ZT4 A;  1QE1 A;  4E89 A;  4B1W B;  5AQX A;  3VQQ A;  4IO9 L;  5AQJ A;  4M41 A;  3H6E A;  3VQA A;  1Z05 A;  1WSH A;  4PKH A;  1T6C A;  3IDH A;  3D45 A;  3U6F A;  3IAY A;  3CET A;  3DJC A;  5FRN A;  1BQN A;  2P5O A;  4JRQ A;  4C8O A;  5C2D A;  1HNW K;  3AVG A;  2O8B B;  3O3F A;  4DTM A;  4CD1 A;  2P9P A;  4QS9 A;  1NU0 A;  2PAV A;  4ISE A;  3V1O A;  1ILY A;  4CGF A;  4FO0 A;  2NNW A;  4KV8 A;  2IDO A;  4AHS A;  4B9L A;  5BR9 A;  5M1Q A;  4B9Q A;  4AHT A;  3VES A;  4ID1 A;  2NRT A;  3ALY A;  1U47 A;  3SV4 A;  4BGB A;  3VQ4 A;  4X64 K;  5AZI A;  4DSI A;  4DSF A;  4DTJ A;  4IEE A;  4O44 A;  3L6Q A;  1VSM A;  3CPE A;  1KAY A;  1GLJ O;  1ZBL A;  2W41 A;  1VQK N;  4CZG A;  2UUA K;  5F0X A;  5E41 A;  4H0T B;  1NJZ A;  3AO1 A;  4YOR A;  4JS5 A;  1Z26 A;  3SPZ A;  3FLC O;  1YAG A;  1XI1 A;  5B8H A;  4W5T A;  2QWQ A;  1ASU A;  5TKW A;  3DLH A;  2QWM A;  3CFP A;  3ATU A;  1HRH A;  4JHD B;  1D5A A;  3DMJ A;  2ITM A;  3WXJ A;  2FBY A;  2EWS A;  3DXK A;  3AVB A;  3O9U A;  4KH4 A;  3OS2 A;  4Z94 A;  1WB9 A;  2P9I A;  4QOZ B;  4CF1 A;  3HRG A;  4KHW A;  3HO1 A;  2YKN A;  3TAB A;  1KRP A;  2GWJ A;  3MDQ A;  2QKK A;  3SAG A;  4KHS A;  1NJX A;  3O08 A;  4FOE A;  4CEO A;  3OBW A;  3FE1 A;  4H5W A;  4CJS A;  4PHT X;  5M1N A;  3QFU A;  3KK7 A;  3NGY A;  1JL2 A;  1K73 O;  4OKK A;  3RMA A;  4J2D A;  4JK8 A;  3QIO A;  2RE2 A;  3RR7 A;  2ZQB A;  5EU7 A;  5AQM A;  5I9E B;  1XHZ A;  4KH5 A;  4E7K A;  4BG8 A;  4LFA K;  2HHS A;  1HJR A;  4K25 A;  4I7F A;  2VWK A;  3THX B;  3QO9 A;  4BR2 A;  3DRR A;  1S22 A;  5HRO A;  2UXD K;  5E84 A;  4JKH A;  3VA3 A;  2G8H A;  3V81 A;  4BY9 C;  3CPW M;  1OVQ A;  3IRX A;  4DV7 K;  4E1J A;  4IOC L;  1EET A;  4AH9 A;  3OVN A;  4CFB A;  1KVA A;  4DU3 A;  3J7Z O;  2YHB A;  2Q31 A;  4YOU A;  5LY3 A;  4O55 A;  3V6D A;  3UKR B;  4DTN A;  2O8E A;  1NMN A;  1CXU A;  1RDC A;  3AVH A;  3TTD A;  4JV5 K;  3CMA N;  1YXQ A;  5GAH P;  4WF9 L;  2X6S A;  4W5O A;  1LAW A;  4UQG A;  3M8S A;  3O8M A;  5C10 A;  4FL9 A;  4DV2 K;  5IWA K;  3ZX0 A;  4ID5 A;  1KXP A;  1NM1 A;  2E2Q A;  2QK9 A;  3SBT A;  3L4Q A;  5FRO A;  5HBM A;  3T3F A;  3MXJ A;  2HMI A;  1DTQ A;  1TYQ B;  3VEO A;  4A57 A;  4B1V A;  4C1N K;  1S3X A;  1TKT A;  3OYJ A;  3QDK A;  1GLE G;  1L3U A;  1K9M O;  1RDA A;  2YHY A;  4KB1 A;  1VSD A;  4CIE A;  2RF2 A;  1NJI O;  2KFN A;  3PSF A;  2E6M A;  3V1R A;  3A8Y A;  3LWL A;  4BR4 A;  4DV0 K;  3AVL A;  3CF5 L;  2OPP A;  3NBP A;  2DTU A;  2UYT A;  1KVC A;  3KK1 A;  4DV3 K;  3AGR A;  3O80 A;  4Y0W A;  2HVH A;  2OTJ N;  3HM9 A;  4BR0 A;  2D1K A;  3Q7C A;  2NRW A;  1H1V A;  1LOT B;  2P51 A;  1HPM A;  3AA2 A;  3I33 A;  4CF8 A;  4H0Y B;  3V4I A;  1EO1 A;  5C25 A;  1QQN A;  5ELZ A;  5FPN A;  1T6D A;  4DQQ A;  3DI6 A;  2FSJ A;  2PBD A;  2O8F B;  1BUP A;  2NZT A;  3HOS A;  4LF8 K;  4PA1 A;  5AZJ B;  4CFD A;  1BA0 A;  1K8K A;  1LW0 A;  4FWR A;  3AVI A;  1T03 A;  4FJH A;  3MN9 A;  3LM9 A;  4N41 A;  3FR0 A;  1Q82 O;  1G15 A;  1ESV A;  4YY3 K;  4Z4I A;  2WUS A;  3VQE A;  4BE2 A;  1Z6R A;  2A1S A;  3I8B A;  3EL2 A;  3J7A P;  4DFK A;  3O4Q A;  3CYM A;  3VN5 A;  2OPS A;  4FJK A;  3VQD A;  3SPY A;  3CFR A;  4MLH A;  3L3U A;  3TPQ A;  3F73 A;  5BPM A;  1I39 A;  3SV3 A;  1X9W A;  4F8R A;  2HHW A;  4RW9 A;  3J81 O;  4E7L A;  3VGL A;  3TR8 A;  1C6V A;  1C1B A;  4HUG A;  3NH1 A;  4QS7 A;  4C8L A;  1VQN N;  3MEC A;  1VQM N;  2HHU A;  4H5T A;  2E2P A;  4DQP A;  1HNI A;  1HKG A;  5K14 A;  4L3Q A;  1MWM A;  4F3O A;  2Q36 A;  2OYQ A;  3WNF A;  3C6H A;  1NK8 A;  4DUZ K;  4CGH A;  3MN7 A;  4GV9 A;  1B9F A;  1NGB A;  3O4N A;  4GKJ K;  1SQK A;  1KFD A;  3U3G A;  2E88 A;  3ZLJ A;  4BVP A;  3HM8 A;  1HNZ K;  5BN8 A;  4FPA A;  2VGM A;  3EE9 A;  4CZE A;  4JI8 K;  4KHQ A;  2VG5 A;  2D0B A;  4FWN A;  3LAN A;  3LDN A;  4FW1 A;  4K42 A;  4BC4 A;  1NK7 A;  4CD3 A;  1IKV A;  2P9N A;  4CJR A;  1TUY A;  4J8F A;  2A3Z A;  3THW A;  3ATV A;  1TAQ A;  3MXI A;  2GUP A;  4B3O A;  4BRF A;  3V9U A;  2CGK A;  3VGK A;  5C0Y A;  1U6Z A;  4JKG A;  3Q7B A;  3NH0 A;  1NGG A;  3MWP A;  3HP6 A;  1RBR A;  3ZET A;  4CBW A;  1XNR K;  3TAR A;  4CCH A;  2HMP A;  3LDP A;  4C23 A;  4CEE A;  4FLY A;  1E3M A;  1NJY A;  4M42 A;  3LM2 A;  1NGF A;  1WSE A;  2YKM A;  3OYK A;  2NRZ A;  2QXF A;  3S3M A;  1F21 A;  3CCU N;  5LJW A;  3BP8 A;  1IV0 A;  3W3D A;  4K0K K;  3UKU B;  4CEZ A;  4JRP A;  4M45 A;  4U7B A;  3VEY A;  5C12 A;  4AHC A;  1M90 O;  1VQ9 N;  2W40 A;  1S9G A;  3B6O A;  4I6M A;  3HPO A;  2ZD1 A;  2OPQ A;  4O0I A;  4BQL A;  4DU4 A;  5C2F A;  3OBY A;  5AQL A;  3VF6 A;  2HBJ A;  1VAZ A;  2D0A A;  1DT9 A;  4JD2 B;  2HBK A;  4DV1 K;  5GIN A;  3KLE A;  2O8D A;  3KLI A;  2FF3 B;  5EXW A;  2JLE A;  3SBG A;  2HNY A;  3F2K A;  2IGI A;  1VQ7 N;  2BGG A;  2HST A;  3E9O A;  3TAF A;  1RTI A;  1R59 O;  4Y1D A;  3H1V X;  3VPZ A;  1NK5 A;  3L2U A;  3G4S N;  3AA3 A;  3KHY A;  2BAN A;  1QS4 A;  3K0S A;  3P1G A;  4RWT A;  4DSL A;  4NCA A;  2EHG A;  5JIC A;  5H1S Q;  2G8I A;  2G8F A;  1FJG K;  2QKB A;  1RT1 A;  1YVN A;  3F9M A;  4ELT A;  2KLA A;  3ZSR A;  3CCV N;  3AVC A;  4KTQ A;  4CEB A;  3S3N A;  3K9K A;  3T1H K;  1KD1 O;  4X65 K;  1RBU A;  3M8Q A;  1WBD A;  2RN2 A;  3F5T A;  4CEF A;  2HOE A;  1YI2 N;  3VF4 A;  2P9K B;  4FM1 A;  4ILH A;  1P90 A;  1RIL A;  3GOI A;  1RDU A;  2DPN A;  1YF5 L;  3K5L A;  3EE8 A;  5KTQ A;  3SYZ A;  4DTR A;  2FF6 A;  3OA9 A;  4H4M A;  4OJR A;  5CYQ A;  5EVZ A;  4H5N A;  1U04 A;  1OH7 A;  2YHW A;  2Z1H A;  2QEX N;  4DTO A;  4V19 S;  5AZI B;  1NKC A;  3DAW A;  1BG3 A;  3K9J A;  2O8C A;  5CHI A;  4YOW A;  4A62 A;  4DF8 A;  2YHA A;  3O9R A;  4DV4 K;  3IMX A;  3OYH A;  3H3N O;  1BOT O;  1UAX A;  1KTQ A;  3HTV A;  4JI1 K;  1IKY A;  4LF4 K;  3SUQ A;  3CC4 N; 
#chains in the Genus database with same CATH homology
 4CF2 A;  4GVM A;  3KK3 A;  3BDP A;  1BI4 B;  2NUB A;  2FBT A;  3EY1 A;  1LW2 A;  2FC0 A;  2O4G A;  2IDO A;  4KV8 A;  3VQB A;  4AHS A;  4W5R A;  4IDK A;  4FLZ A;  5J2Q A;  4B9L A;  4LSN A;  1RNH A;  1JXE A;  4AHT A;  1VSH A;  4ID1 A;  4CJE A;  3ALY A;  1U47 A;  4CJ3 A;  3SV4 A;  1VSK A;  1UA0 A;  3SQ2 A;  4AHR A;  1C0U A;  3VQ4 A;  4Q5V A;  4DSI A;  3ZCM A;  1CXQ A;  4DSF A;  5SWM A;  4DTJ A;  5J2M A;  2E4L A;  1BIS A;  1I3A A;  4O44 A;  4B9V A;  1VSM A;  4CHO A;  4CK3 A;  1HPZ A;  1ZBL A;  1SKW A;  5HRP A;  2DFF A;  1EKE A;  4EZ6 A;  5E41 A;  2XY5 A;  3QIP A;  3TI0 A;  1D9D A;  4DF4 A;  1RTJ A;  1NJZ A;  3AO1 A;  4JS5 A;  3SPZ A;  1Z26 A;  1WNS A;  3NHG A;  4LSL A;  4OLB A;  4TSX A;  4FVM A;  3WNE A;  3PX0 A;  3DLR A;  3PUF A;  2A1R A;  4W5T A;  2Z1I A;  1EP4 A;  3TAG A;  1C0M A;  1XI1 A;  4PY5 A;  4KRF A;  3LAL A;  1ASU A;  4KI6 A;  3LPT A;  3F9K A;  1RBV A;  4IG3 A;  3DLH A;  3PV8 A;  3AVK A;  1X9S A;  1TGO A;  3CFP A;  1S1U A;  3IS9 A;  3OYL A;  3K5M A;  4DWI A;  1BCO A;  3NCI A;  3RRG A;  1HRH A;  3L8B A;  3MEE A;  1RT7 A;  3SJJ A;  3OYG A;  2GV9 A;  1D5A A;  3DRP A;  3DMJ A;  3P5J A;  4DFM A;  2FBY A;  3AVN A;  1J54 A;  2HHT A;  4DSK A;  3AVB A;  1YTA A;  1TK5 A;  3MED A;  3OS2 A;  4FJJ A;  5I3U A;  3C6T A;  3DYA A;  4CES A;  4QOZ B;  1WN7 A;  3KKS A;  4CF1 A;  4DS4 A;  4CJ4 A;  4KHW A;  3OYI A;  3HO1 A;  1K6Y A;  1FXX A;  2YKN A;  1W0H A;  3ITH A;  2X78 A;  1TK8 A;  4K8X A;  3TAB A;  1KRP A;  3QIN A;  4I2Q A;  3LDS A;  1J53 A;  4JS4 A;  4CF9 A;  4DTU A;  2QKK A;  4KHS A;  1NJX A;  4WE1 A;  3QNN A;  4IFV A;  3RTV A;  4O5B A;  3NF9 A;  1RT6 A;  4CEO A;  5HLF A;  2Z1G A;  2YNF A;  1S1X A;  4ZHR A;  4KAZ A;  1KLM A;  4CE9 A;  4CJS A;  4FXD A;  1S6P A;  5I42 A;  3ISN C;  4RW4 A;  4FJG A;  3NGY A;  4C8N A;  1JL2 A;  3ZSW A;  3OYE A;  3MAQ A;  2RPI A;  4OKK A;  3RMA A;  1KLN A;  4LH5 A;  4DU1 A;  4J2D A;  5JS2 A;  3QIO A;  4CJQ A;  2PY5 A;  1J5O A;  4B9U A;  4HCB A;  3RR7 A;  2PZS A;  2ZQB A;  2P1J A;  4CGI A;  5EU7 A;  2KW4 A;  1XHZ A;  4E7K A;  4AHV A;  2FBV A;  3QEX A;  1CZ9 A;  2DFE A;  2IAJ A;  3M8P A;  4M3X A;  1ASW A;  1HJR A;  2HHS A;  3QES A;  2YV0 X;  4OGC A;  4C8M A;  3LP1 A;  4I7F A;  3ZT0 A;  2XRI A;  1T8E A;  4F2R A;  2BDP A;  2VWK A;  4BDP A;  3RRH A;  3QO9 A;  3ASM A;  3DRR A;  3NE6 A;  4FLX A;  3SUN A;  5HRO A;  1QSY A;  2D5R A;  2G8H A;  3VA3 A;  3V81 A;  3KK2 A;  3IRX A;  3SQ0 A;  3TAQ A;  1Q9X A;  1ZBH A;  4CGJ A;  1YTU A;  1N6Q A;  1EET A;  4AH9 A;  1JLG A;  4CJK A;  3NDK A;  4FJL A;  3OVN A;  4CFB A;  4B08 A;  3PY8 A;  1KVA A;  4DU3 A;  2YHB A;  3HT3 A;  4NCB A;  4Q0B A;  4GW6 A;  1TKZ A;  3G0Z A;  4OPK A;  1NK9 A;  4BDY A;  4FCY A;  1C0T A;  3DLK A;  4O55 A;  1WSF A;  4DTN A;  3V6D A;  3P83 D;  1NOY A;  3L3V A;  3K57 A;  1CXU A;  2IC3 A;  4IFY A;  1RDC A;  4KHY A;  1S1W A;  4FM2 A;  3HST B;  3C6U A;  3AVH A;  2WOM A;  4CIF A;  4ZTJ A;  4DG1 A;  3DLB A;  4KHU A;  1SL1 A;  2X6S A;  4MQ3 A;  1LAW A;  4W5O A;  4UQG A;  2O4I A;  3M8S A;  3OJU A;  1U48 A;  2YNI A;  4Z4G A;  3ZSX A;  2DFH A;  1TVR A;  4CGD A;  1VSF A;  3OS0 A;  3I0S A;  4FLT A;  4FJ9 A;  3S3O A;  1CZB A;  4ID5 A;  4GMJ B;  4NCG A;  1IO2 A;  1IH7 A;  1TK0 A;  4FZY A;  4FK2 A;  2QK9 A;  1KCF A;  3EZ5 A;  4OKJ A;  3E01 A;  1CLQ A;  1QSL A;  5FRO A;  5HBM A;  4CJU A;  3MXJ A;  3T3F A;  1L3S A;  1DTQ A;  2HMI A;  1S6Q A;  1FK9 A;  1TKT A;  3OYJ A;  3OYA A;  4FYD A;  3LAK A;  3HK2 A;  1Q8I A;  3LAM A;  1L3U A;  4I9Q A;  4AIL C;  1RDA A;  1NKB A;  4KB1 A;  1VSD A;  4CIE A;  2RF2 A;  3T1A A;  3NF8 A;  1D8Y A;  4QCL A;  3KLF A;  4CHQ A;  2KFN A;  3VQ9 A;  1NJW A;  2E6M A;  3KTQ A;  2B5J A;  3IG1 A;  3V1R A;  4DS5 A;  3LWL A;  3TAN A;  4Z4H A;  3AVL A;  4CER A;  3NFA A;  2OPP A;  3OYF A;  1TKD A;  2B6A A;  3NBP A;  1UA1 A;  1SV5 A;  2ATQ A;  2DTU A;  4KI4 A;  1KVC A;  1VSI A;  4B9S A;  1LWF A;  3AVF A;  3ULD A;  2IOC A;  3RMC A;  3KK1 A;  4B9T A;  3AV9 A;  2PYJ A;  3K2P A;  3ZSZ A;  2HVH A;  2Y1J A;  3V1Q A;  3HM9 A;  2HW3 A;  1WAJ A;  4E7J A;  2BE2 A;  4KTZ A;  2P51 A;  3AA2 A;  1TL3 A;  3NH2 A;  1BHL A;  4CF8 A;  4OGE A;  3RMB A;  3MEG A;  3V4I A;  4N47 A;  3NF7 A;  4DMN A;  3LZJ A;  4BWJ A;  4FJ5 A;  2KFZ A;  5C25 A;  2HVI A;  2VG7 A;  4N5S A;  4EZ9 A;  2F96 A;  4DQQ A;  3DI6 A;  1VRT A;  4FLW A;  1Q9Y A;  3SI6 A;  4ZTF A;  3KD5 E;  3QEI A;  1WLJ A;  1NK0 A;  3VQ8 A;  1FKO A;  2Y1I A;  5DK5 A;  4CEQ A;  4PA1 A;  2OZM A;  4CFD A;  4CEC A;  1C1A A;  1LW0 A;  3H08 A;  3KLH A;  4B9N A;  3AVI A;  4CK2 A;  3OYC A;  1KFS A;  4DSJ A;  4JLH A;  4H4O A;  1S5J A;  1T03 A;  4FJH A;  4BWM A;  4PUO A;  4HHT A;  2G8U A;  4HCC A;  3HPH A;  4N41 A;  3OYB A;  3HYF A;  4I9L A;  3V9S A;  4F4K A;  1G15 A;  3TAE A;  4FJM A;  1QTM A;  1DTT A;  4Z4C A;  4Z4I A;  2KZM A;  1DLO A;  3VQE A;  4KTW A;  3ZSQ A;  5KRT A;  4HUE A;  4BE2 A;  4BE0 A;  1A5V A;  2A1S A;  5C24 A;  1SL0 A;  3TWH A;  2OA8 A;  3SQ4 A;  3LZI A;  1SUQ A;  4DFK A;  2XY7 A;  3O4Q A;  1JLE A;  1RBS A;  3CM6 A;  5D3G A;  3CYM A;  3LP2 A;  1IG9 A;  3VN5 A;  1RT3 A;  1TKX A;  3K58 A;  1L5U A;  3AA4 A;  1ITG A;  1EX4 A;  5HRR A;  2OPS A;  4FJK A;  3VQD A;  4DQS A;  1KVB A;  3SPY A;  3HVR A;  4E7I A;  3L2V A;  3WNH A;  3CFR A;  2YNG A;  4DLE A;  4FW2 A;  3CG7 A;  1QSS A;  4Z4E A;  3L3U A;  3F73 A;  2G8W A;  4FK0 A;  1I39 A;  3SV3 A;  1BIZ A;  1X9W A;  2OPR A;  1BIU A;  3QER A;  4AHU A;  3ZT3 A;  4F8R A;  4RW9 A;  3K59 A;  3K5O A;  4E7L A;  2HHW A;  3TR8 A;  4MFB A;  4B9M A;  1C6V A;  1C1B A;  1O1W A;  4HUG A;  2LSN A;  1EXQ A;  1ASV A;  3NH1 A;  1S9E A;  4CJV A;  4J2B A;  4Y1C A;  2E6L A;  4IBN A;  4E19 A;  4CHY A;  3THV A;  4C8L A;  1RTH A;  3MEC A;  4O4G A;  4FZZ A;  1SKR A;  2HHU A;  1XHX A;  1RBT A;  4OLA A;  1REV A;  4HUF A;  3AO3 A;  4DQP A;  3V9Z A;  1HNI A;  4FLU A;  1WSI A;  5K14 A;  3K5N A;  3WNG A;  4F3O A;  1X1P A;  3OYD A;  1KSP A;  2OYQ A;  3WNF A;  3V9W A;  3RMD A;  1NK8 A;  4ELU A;  4YNQ A;  5J2N A;  5KRS A;  1L3T A;  3ZSO A;  1B92 A;  4CGH A;  1NK6 A;  1GOB A;  1B9F A;  1HYZ A;  3O4N A;  3LWM A;  3QEW A;  4CIG A;  1UWB A;  5HRS A;  1N5Y A;  1KFD A;  3U3G A;  4NYF A;  2WON A;  1C1C A;  3VQ6 A;  1LWE A;  4G1Q A;  4OVL A;  1HQU A;  4DFP A;  1J9A A;  4RW7 A;  5HP1 A;  5CZ2 A;  5KGW A;  1NKE A;  1U49 A;  4CJF A;  3AVJ A;  3HP9 A;  4KHQ A;  1A5W A;  2VG5 A;  4E7H A;  2D0B A;  3LAN A;  4FW1 A;  3KKR A;  1QHT A;  1VRU A;  1NK7 A;  3QNO A;  1UOC A;  4M3Y A;  1JXB A;  4IG0 A;  4DFJ A;  5FRM A;  3PX6 A;  1TL1 A;  4BDZ A;  4RW6 A;  4Z4F A;  4PQU A;  1IKV A;  1HNV A;  1D9F A;  1YVU A;  4CJR A;  3I0R A;  1XWL A;  3DOK A;  3JYT A;  1SKS A;  2KTQ A;  1TAQ A;  3QEV A;  4FJN A;  4FK4 A;  3AVA A;  3OJS A;  1BGX T;  4CED A;  5HRN A;  3OS1 A;  3HVT A;  4R5P A;  2FBX A;  3M8R A;  3MXI A;  2PYL A;  4B3O A;  1RTD A;  1X9M A;  1IKX A;  2HND A;  3V9U A;  4W5N A;  1TV6 A;  2KQ2 A;  3FFI A;  3TAP A;  4KO0 A;  5SZT A;  4CGG A;  4F3T A;  1IKW A;  4RG8 A;  3SZ2 A;  2VWJ A;  1RT2 A;  2I5J A;  3NH0 A;  4XIU A;  2G8V A;  3D0P A;  1L3V A;  3DLE A;  2P5G A;  3HP6 A;  4M3T A;  1GOA A;  1RBR A;  3ZSY A;  4EP5 A;  4DLG A;  3TAR A;  3PX4 A;  3PO4 A;  4CCH A;  1RDD A;  2ITG A;  2JGU A;  3OY9 A;  3PO5 A;  4M3Z A;  2GUI A;  4CEE A;  4FLY A;  4DTX A;  1JL1 A;  4KHN A;  4I2P A;  1NJY A;  3KJV A;  4M42 A;  4CHN A;  1JLA A;  2GBZ A;  5KI6 A;  3AO4 A;  1WSE A;  1T7P A;  3V9X A;  2YKM A;  3OYK A;  1WSJ A;  2HHV A;  2QXF A;  3S3M A;  1F21 A;  4KKO A;  5KGX A;  2Q3S A;  3OYN A;  2XY6 A;  4PWD A;  1RT4 A;  4B8C A;  1YT3 A;  1ZYQ A;  5JS1 A;  1JLB A;  5DMR A;  4CEZ A;  4JRP A;  1VSE A;  3L2R A;  2HHX A;  1HYV A;  4M45 A;  4BAC A;  1FKP A;  1BQM A;  1RCH A;  1ZBF A;  4J2E A;  4AHC A;  3SCX A;  2KZZ A;  1S9G A;  2ZE2 A;  3B6O A;  1U45 A;  3HPO A;  4CJT A;  2F8S A;  2ZD1 A;  4RW8 A;  1VSJ A;  2OPQ A;  4O0I A;  4DU4 A;  1A5X A;  4EP4 A;  1BL3 A;  3L2W A;  4CJL A;  4KRE A;  1JKH A;  1HQE A;  3AA5 X;  3ZT2 A;  4CJW A;  1BI4 A;  2HHQ A;  2D0A A;  2X74 A;  4L8R B;  2D0C A;  3VQ7 A;  2B4J A;  3DOL A;  3KLE A;  3KLI A;  5T7B A;  3TAM A;  5J1E A;  2JLE A;  3HXM A;  4LY7 A;  4BE1 A;  4FJI A;  4DTS A;  2HNY A;  4CK1 A;  3HL8 A;  4FJX A;  1B9D A;  1Y97 A;  3G10 A;  1R0A A;  2IGI A;  1VK0 A;  5CY4 A;  3VQ5 A;  3OYM A;  4N76 A;  2BGG A;  3JSM A;  3MXM A;  1LAV A;  1GOC A;  4OPJ A;  3TAF A;  3KD1 E;  4E0D A;  4W5Q A;  2VG6 A;  1RT5 A;  1RTI A;  4E3S A;  1T05 A;  4FZX C;  4Y1D A;  5CZ1 A;  1ZBI A;  1NK5 A;  3VQP A;  3L2U A;  3HJF A;  3AA3 A;  3C95 A;  1BCM A;  3I8D A;  2BAN A;  1QS4 A;  4FJ8 A;  3SUP A;  1JLQ A;  4O0J A;  4J2A A;  3P1G A;  1VSL A;  1W9H A;  4DSL A;  4NCA A;  4HVJ A;  2EHG A;  4LD0 A;  4H8K A;  2IS3 A;  2G8I A;  2G8F A;  4M3U A;  1JLC A;  1QQC A;  2RKI A;  4N56 A;  2DY4 A;  3B6P A;  3S9H A;  1RT1 A;  2QKB A;  5J2P A;  4ELT A;  4QAG A;  3BGR A;  1WSG A;  3ZSR A;  2G8K A;  3CQ8 A;  2YNH A;  3AVC A;  4CEB A;  4CHZ A;  3DRS A;  3S3N A;  4KTQ A;  4B8A B;  2HNZ A;  4CJP A;  1NOZ A;  1RBU A;  2HB5 A;  3M8Q A;  1WAF A;  3NF6 A;  4Z0U A;  4CJ5 A;  2XO7 A;  3QEP A;  4HTU A;  4KPY A;  3EYZ A;  3O3G A;  1LV5 A;  2RN2 A;  1ZBU A;  3RWU A;  1TAU A;  2XHB A;  4DQI A;  4CEF A;  2OZS A;  2ETJ A;  4FM1 A;  2R7Y A;  4NYN A;  4FLV A;  1RIL A;  5CYM A;  3NGI A;  4K8Z A;  1JLF A;  4LH4 A;  3A2F A;  3VQC A;  3RR8 A;  4E1M A;  4CEA A;  4CHP A;  2Z1J A;  3K5L A;  3LPU A;  5KTQ A;  4CFA A;  3SYZ A;  3DLG A;  4KFB A;  3AO2 A;  3AVM A;  3C94 A;  3KLG A;  4DSE A;  3SNN A;  4F2S A;  3NGZ A;  2F8T A;  3QLH A;  2AJQ A;  4DTP A;  3DM2 A;  3VA0 A;  3ZT4 A;  1MU2 A;  3CM5 A;  3T19 A;  1QE1 A;  4DTR A;  1SL2 A;  1HYS A;  5FDL A;  4H4M A;  4OJR A;  3CFO A;  5CYQ A;  1Z25 A;  4E89 A;  3ZT1 A;  3LP3 A;  3LP0 A;  4M3R A;  1U04 A;  4ICL A;  3QET A;  1NK4 A;  3VQQ A;  3HPG A;  3KIO A;  4M41 A;  2Z1H A;  3VQA A;  2XY8 A;  4DTO A;  1NKC A;  1WSH A;  4M3W A;  3U3Y A;  3SQ1 A;  1RDB A;  1LWC A;  3D45 A;  1HMV A;  1S1T A;  2EX3 A;  2YHA A;  4DF8 A;  3U6F A;  1BQN A;  3IAY A;  5FRN A;  4CFC A;  4YFU A;  2P5O A;  4DQR A;  4JRQ A;  4C8O A;  2W42 A;  2X6N A;  1S1V A;  4FJ7 A;  5C42 A;  3L2Q A;  3ZSV A;  3AVG A;  3OYH A;  4FM0 A;  3O3F A;  4KB0 A;  4DTM A;  3AO5 A;  1UAX A;  4E1N A;  3SUO A;  4IKF A;  1KTQ A;  4OKE A;  3O3H A;  4C8K A;  4ELV A;  1IKY A;  3UIQ A;  1U4B A;  3SUQ A;  1XC9 A;  3V1O A;  3NAE A;  4CGF A;  4CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...