2E4LA

Thermodynamic and structural analysis of thermolabile rnase hi from shewanella oneidensis mr-1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
LKLIHIFTDGSCLGNPGPGGYGIVMNYKGHTKEMSDGFSLTTNNRMELLAPIVALEALKEPCKIILTSDSQYMRQGIMTWIHGWKKKGWMTSNRTPVKNVDLWKRLDKAAQLHQIDWRWVKGHAGHAENERCDQLARAAAEANPTQIDTGYQAES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Structural, thermodynamic, and mutational analyses of a psychrotrophic RNase HI.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Hydrolase
total genus 48
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2006-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2e4lA00
3AVNA 2OPRA 3WNHA 5C24A 2VG7A 2B6AA 4CF9A 3S3NA 3RMBA 1VK0A 3TAMA 3HPGA 4FJLA 3ZSQA 2YNGA 4DTPA 1GOCA 5EU7A 3QIOA 3K58A 4FZZA 4GW6A 1IO2A 1FXXA 4I2PA 2Z1IA 1FK9A 2LSNA 4CF2A 4FVMA 1DTTA 4IFVA 1B9DA 1KVBA 3B6OA 3ZSWA 1XHXA 3SI6A 4F8RA 4M3YA 4FK4A 3H08A 2EX3A 4H4MA 2B4JA 1S6QA 3KLIA 4NCBA 3V9XA 1S1WA 4IG0A 4CF1A 3AVGA 3NGYA 1ZYQA 1L3UA 3OYIA 3NE6A 4FJHA 1L3SA 1O1WA 1QHTA 4CGJA 3QERA 1XI1A 5FDLA 2G8WA 3PO4A 3I0SA 4CFCA 1D5AA 1QE1A 1IKXA 1UOCA 2Z1GA 1CZBA 4LSLA 2DFHA 3BGRA 3OJUA 4FJXA 3B6PA 2XHBA 4FM1A 4CEQA 4IDKA 4CJQA 1W0HA 1BCOA 4CEDA 1HMVA 2D0BA 4CGHA 4CJWA 3KLEA 2HHQA 4AHCA 4E89A 1QSYA 1QSSA 3UIQA 3M8SA 4FK2A 4OLAA 4DG1A 1GOAA 2RF2A 3V4IA 2XY8A 4E7JA 1ZBIA 4FJKA 3QESA 1VSFA 4CEEA 3TWHA 1S9GA 5DMRA 3TI0A 4C8KA 4M41A 3SUNA 4CGIA 4CHQA 2HVHA 3OVNA 4KAZA 3CFPA 4O44A 1VSKA 1TK5A 1NKCA 3MXIA 4NCGA 3LALA 3L2RA 3VQ8A 4CEOA 3OS0A 4KB1A 3KD5E 2Z1JA 4LSNA 1NK8A 3AVFA 2XY7A 2G8FA 1VSMA 1L3VA 3AO1A 4DU4A 2X6SA 4BACA 4Z4HA 3PX6A 2HVIA 3TAGA 1TKDA 1I39A 3JYTA 4ZTFA 4FJMA 3VA0A 5C42A 4N47A 5FRNA 3LAMA 3DRSA 3OY9A 3JSMA 4DSKA 3QEIA 2HHWA 2HW3A 4KHYA 3AVAA 1RBVA 1TKTA 1LWEA 3QINA 3ZT2A 3ZSXA 3L8BA 1KTQA 2F8SA 3TAFA 1HQEA 2XRIA 3DM2A 1ZBLA 1RTDA 1NK4A 2DTUA 1L5UA 1TGOA 3KKSA 3AVKA 2VWJA 3V1RA 3DLHA 3HT3A 2HB5A 4JS4A 1I3AA 1ASWA 2JGUA 3T1AA 1ZBUA 4DFMA 5HP1A 3MXMA 4DSIA 4PA1A 4Y1DA 3ZT0A 4E7LA 4B3OA 3KIOA 3V9WA 3SQ0A 4CERA 2HNZA 2YNHA 4GMJB 1U4BA 1JLCA 2NUBA 3SV4A 4FZXC 1HYVA 3U3YA 4M3ZA 1LV5A 4CHZA 3M8RA 4O55A 3SQ1A 2YNIA 3QEPA 1UAXA 2XO7A 1J5OA 2HNYA 3KLGA 4OKJA 2O4GA 2R7YA 3SPZA 4KV8A 3ZSZA 4FJJA 4KTZA 1UWBA 3SJJA 3DLEA 4IBNA 1R0AA 1VSJA 1BL3A 3BDPA 1HQUA 5KTQA 3RRHA 3OYCA 3LWMA 1RT7A 1HNVA 1Z26A 2FBXA 2YHBA 3NHGA 3OYDA 3P83D 2P5OA 4F2SA 1RTHA 3A2FA 3MXJA 5DK5A 3O3GA 3KTQA 1RILA 1KVCA 2KFZA 3P5JA 2ATQA 4CHOA 3KJVA 4CK1A 1Q8IA 1U45A 4PUOA 3SQ4A 2A1RA 1WAJA 3LDSA 3U6FA 4JS5A 1VSIA 3QEWA 4FLWA 3I0RA 1JXEA 3RR7A 1RT5A 3NF7A 4W5QA 1VRTA 4CFAA 3IAYA 2KZZA 3RMAA 4BDZA 4DQQA 2OZMA 4CESA 1S6PA 2WONA 4C8LA 3MEDA 4FK0A 5K14A 1J9AA 4FM2A 1N5YA 1T03A 4I9LA 4FJ9A 1C0MA 1T8EA 1A5VA 4DQSA 1S1TA 1C1AA 4OGEA 3HYFA 1HPZA 1RBUA 3RTVA 3K57A 2KW4A 1HNIA 1RT2A 1WSJA 3OYFA 3TABA 2DY4A 4YNQA 4MQ3A 1ASVA 4Z0UA 3NH2A 3DLKA 1RT4A 2XY6A 1TKZA 1IH7A 3TAEA 1EP4A 2PYJA 3QNNA 4FM0A 4KRFA 3K5OA 3G0ZA 3K59A 4KHUA 1JLEA 1LW0A 3K5MA 4LD0A 4IG3A 3OS1A 3AVJA 3F73A 3ZT4A 4E7HA 4KKOA 4J2BA 1RNHA 2YNFA 4DSEA 3AO4A 3M8QA 4LH4A 1X9MA 3QNOA 3K5NA 4FLZA 1QSLA 4Y1CA 3E01A 2D5RA 3IRXA 3C94A 4CJRA 3KK3A 3AA2A 3RMDA 5HROA 3TARA 1NK0A 1VSLA 4JRPA 2X6NA 1TK0A 1Q9XA 4QCLA 1SL1A 4H4OA 4J2AA 4M45A 2IS3A 2FBYA 1JKHA 1WSGA 2E6MA 4KHQA 1UA0A 4ELVA 3ASMA 4CEFA 3D0PA 1S1XA 1SUQA 2G8IA 4CIGA 3HP9A 2IDOA 5HRPA 4ZHRA 3KLFA 4BE2A 4PQUA 3NGIA 3IS9A 2RPIA 1JLQA 1GOBA 1BQNA 4H8KA 4YFUA 3D45A 4KI4A 2XY5A 1XHZA 1VSDA 1JLFA 3LP0A 4RG8A 4DMNA 1BI4B 3SV3A 3QETA 1SL2A 4FJ7A 3VQEA 2P51A 1RDBA 4O4GA 4AHVA 4CK3A 4E0DA 4HCBA 3MAQA 3NDKA 2Y1JA 3K2PA 2G8KA 1F21A 3ITHA 4FW1A 5KI6A 3G10A 4C8NA 3WNFA 1JLGA 3QO9A 3QLHA 4DTUA 1S1UA 3V6DA 1NKBA 1FKOA 4CJ3A 4N56A 5J2QA 2QXFA 1EETA 1LWFA 3AO5A 4TSXA 3OYGA 2JLEA 3HJFA 4CJLA 4R5PA 3HVTA 5J2MA 1QQCA 3SUPA 3ZT3A 2HHSA 3LP1A 1WSHA 1SKWA 3SUQA 1RTIA 3PV8A 1KLMA 2P5GA 1NJZA 4DWIA 1WSIA 1JXBA 3L2WA 4ELUA 2HHVA 3ZCMA 3MECA 5KRSA 4AILC 5SZTA 1BHLA 4F3OA 4O5BA 4WE1A 4HVJA 1YT3A 2KFNA 3V9SA 4CGFA 2KZMA 4DSJA 3QIPA 3LZJA 2HHUA 4OJRA 4HUFA 4NYNA 4CF0A 3U3GA 4DU1A 3TANA 4B9MA 4OGCA 4CCHA 2IAJA 3DRRA 3PO5A 1BI4A 3ZSVA 1JLAA 4Q5VA 1BCMA 4DTSA 2BGGA 3AVHA 5HRRA 1N6QA 3OYAA 4FLYA 3OYLA 1IG9A 3TAPA 3LPUA 4B9NA 4OLBA 4B9TA 1NJYA 4N5SA 5CZ2A 5KRTA 4FLUA 4K8ZA 3HO1A 1NK5A 5J2NA 3RMCA 3F9KA 3VQ5A 4E19A 2VWKA 4BDYA 1X9SA 3LP3A 2ZQBA 2G8HA 3O4QA 1ITGA 4CHNA 3ALYA 1VRUA 1VSHA 1B9FA 3P1GA 1RBSA 4OKKA 1CXQA 2X74A 5CYMA 4CEZA 4CIFA 3HPOA 4AHUA 1NJWA 1KSPA 4CJVA 3C6TA 4ZTJA 2OA8A 3ZT1A 3NFAA 4DSFA 4BWJA 4F4KA 4CJTA 3LWLA 4M3XA 4W5NA 4E1NA 3AA4A 4MFBA 3DMJA 3RRGA 3O3FA 4B9SA 2F96A 3LP2A 1NOZA 3CFRA 3EZ5A 3MEEA 3AA5X 4EZ9A 4EZ6A 4M3TA 2GBZA 5CY4A 4G1QA 3AVBA 1D9DA 1LAWA 4L8RB 3NF9A 3SQ2A 1U49A 5FROA 4DTRA 3L3UA 1JL2A 4KI6A 3DOLA 3THVA 4ICLA 3CFOA 4CJ4A 3DLBA 4BDPA 4DS5A 4DU3A 5KGXA 4B9VA 4Z4IA 4CFDA 3L2VA 4HTUA 3L2QA 1TAQA 3OYMA 1NK6A 4Z4FA 4IKFA 3AO2A 4FJNA 1CLQA 1DLOA 4FJ5A 3HXMA 5HLFA 2ZE2A 1ASUA 3HSTB 4DQRA 4DSLA 1LAVA 2Q3SA 4DF4A 1RCHA 1Z25A 4O0JA 4M3RA 4CJKA 3SCXA 3OYJA 4HUGA 3SUOA 2YV0X 1EKEA 4NYFA 4FXDA 3O3HA 2O4IA 2HHTA 5C25A 1S9EA 3DOKA 1HRHA 4KHNA 1SKRA 4KFBA 2OPPA 2QK9A 4B9UA 4KB0A 2VG6A 2OYQA 4M3WA 1RT3A 5HBMA 3OYNA 1YVUA 3V9UA 4E7IA 3AO3A 4FJ8A 1RBRA 3EY1A 2OPSA 4K8XA 4E1MA 4B8AB 3L2UA 3SZ2A 2GUIA 1RT6A 4LY7A 3HL8A 3CM5A 1HJRA 1IKWA 1SV5A 2E4LA 3ZSYA 4FJIA 4DS4A 3PX4A 1W9HA 3HM9A 4E7KA 1YTUA 3DI6A 3NCIA 1Q9YA 3PUFA 1ZBFA 4CGDA 1L3TA 2KQ2A 3V81A 5T7BA 1EXQA 1LWCA 3AVCA 3CM6A 4CJSA 4DQPA 4N41A 2BE2A 2B5JA 1J54A 3PY8A 2DFEA 1G15A 3MEGA 4BWMA 1NKEA 3AA3A 4I7FA 3HK2A 4AHTA 2FBVA 2GV9A 3NF6A 5J2PA 3AVLA 2E6LA 3V1OA 3V1QA 3VQBA 1C1BA 1XC9A 1U47A 1A5WA 1TV6A 3IG1A 3L3VA 3VA3A 3KLHA 3NGZA 1IKVA 1X9WA 1JLBA 5CZ1A 4KHWA 4Q0BA 2QKKA 4HUEA 2Z1HA 1ZBHA 4IFYA 3OYHA 3DLRA 3VQCA 4CF8A 4F3TA 3EYZA 4CHPA 4GVMA 3VQ4A 4O0IA 1KRPA 4ELTA 1RTJA 1UA1A 1TVRA 2PYLA 2HHXA 1DTQA 1RDCA 3S3MA 1C6VA 4KO0A 4M42A 1WLJA 5D3GA 4RW6A 4B8CA 2RKIA 4RW9A 4OKEA 2IGIA 3QEXA 5FRMA 3PX0A 1S5JA 3FFIA 3O4NA 4B08A 4CJEA 1T05A 3CYMA 4CECA 4DTJA 5J1EA 4W5RA 3AV9A 1RT1A 3LZIA 4JRQA 5JS2A 4XIUA 2IC3A 4DFPA 1EX4A 4CHYA 4JLHA 4B9LA 4Z4CA 3OYBA 5KGWA 4DF8A 3ZSOA 3NAEA 4N76A 4FYDA 3ZSRA 3VQDA 3RWUA 4AHRA 1X1PA 4W5TA 3ULDA 4DTMA 3SNNA 4ID5A 2G8UA 2BDPA 1KCFA 1VSEA 1TAUA 3HVRA 3CQ8A 2PZSA 3OYKA 1BGXT 4CIEA 3I8DA 4DTXA 1NOYA 2QKBA 2P1JA 1RDDA 4KTWA 4J2DA 4CK2A 2HMIA 1KLNA 2G8VA 3C6UA 3HPHA 3LPTA 4KTQA 2KTQA 3AVIA 2YHAA 4HCCA 4RW8A 2RN2A 3T19A 1U04A 3S9HA 4FLVA 1NK9A 2YKMA 1KFDA 4BE1A 3S3OA 3T3FA 4CE9A 3RR8A 4FJGA 4DQIA 4PY5A 3QEVA 2I5JA 3ISNC 3KK2A 1RDAA 5CYQA 4CJ5A 3KD1E 4KREA 4UQGA 3SPYA 2ITGA 1KVAA 1WNSA 4Z4GA 4RW4A 2OPQA 1BISA 2PY5A 1WN7A 3CG7A 3DYAA 4QOZB 1TL3A 3WNGA 2ETJA 3VQPA 1A5XA 4RW7A 3VN5A 1JL1A 4OPKA 3V9ZA 4AH9A 1FKPA 1QS4A 1D9FA 1SKSA 2FC0A 4C8MA 3SYZA 1BIZA 2D0AA 1WAFA 2ZD1A 4ID1A 5I3UA 1WSFA 3VQ6A 4FZYA 4OPJA 3NH1A 3HP6A 1MU2A 2D0CA 4F2RA 1SL0A 4FLXA 1S1VA 2WOMA 4DTNA 2HNDA 5HRNA 1XWLA 1HYZA 3KKRA 1CZ9A 1QTMA 2A1SA 1LW2A 5I42A 3NH0A 4CEBA 3NF8A 5JS1A 4DLGA 3AVMA 1TL1A 1T7PA 4FW2A 3OS2A 4DLEA 3TAQA 5HRSA 2AJQA 2EHGA 3DLGA 1IKYA 3LAKA 3C95A 4OVLA 4CGGA 2W42A 3VQQA 3LANA 3KK1A 4BE0A 2DFFA 4DTOA 4DFKA 3WNEA 4EP4A 1C1CA 1REVA 5E41A 4FLTA 1J53A 2X78A 2FBTA 4C8OA 2OZSA 3DRPA 3NBPA 4E3SA 1HYSA 4I2QA 3OYEA 4LH5A 1BIUA 2Y1IA 4CJUA 4KHSA 1TKXA 1K6YA 4W5OA 3OJSA 3K5LA 1TK8A 4KPYA 1CXUA 4PWDA 1BQMA 1RBTA 2BANA 4Z4EA 1NK7A 3VQ7A 5SWMA 1YTAA 4FCYA 4CJFA 3TR8A 4CEAA 4EP5A 4NCAA 1U48A 4J2EA 1C0UA 4DFJA 2VG5A 4HHTA 4AHSA 1Y97A 2F8TA 3VQ9A 1C0TA 1B92A 3M8PA 4QAGA 4CJPA 1KFSA 1WSEA 2YKNA 3VQAA 4I9QA 4M3UA 4CFBA 2IOCA 1NJXA 1D8YA
chains in the Genus database with same CATH superfamily
3VERA 3HPGA 1NM1A 2V7YA 3CMAN 3BEXA 3O80A 2QI2A 4FZZA 4GW6A 1FXXA 4I2PA 2NRVA 4CF2A 2GEMA 1K8KA 1DTTA 1RDUA 3QFPA 4M3YA 5AQNA 4DV5K 4B1ZA 4FK4A 5EOYA 3EZWA 3UKUB 4AF1A 3KLIA 2HF4A 3V9XA 1ZBSA 3AVGA 2UUBK 2CGLA 1ZYQA 3UB5A 5TKYA 1XI1A 5M1OA 3I0SA 4QCLA 1CZBA 4FM1A 4IDKA 2OTLN 1W0HA 4CGHA 2D0BA 2IIRA 1NGBA 3UIQA 3M5RA 5AQPA 1S9GA 4MDAA 3KK7A 4JHDB 4CGIA 3CQYA 4CHQA 3HI0A 4BC4A 1NKCA 3MXIA 2I7NA 3AVFA 2G8FA 1VSMA 1L3VA 3AO1A 3PX6A 1TKDA 2FSJA 3LAMA 3OY9A 3JSMA 2HHWA 3OW2M 1TKTA 3CJ9A 3QINA 3OTOK 1KTQA 3T1HK 2XRIA 1ZBLA 4BRIA 3AVKA 3CCQN 2BH1A 3V1RA 1GLAG 5HP1A 4JHDA 2ASMA 4B3OA 2KLAA 3V9WA 4A2BA 1U4BA 3CCUN 1HYVA 1RGIA 3EE9A 2WUSA 2YNIA 1IBLK 2R7YA 1JCFA 3SJJA 1OVYA 3ZETB 1R0AA 1RDWX 1VSJA 1BL3A 3OYCA 1HNVA 2FBXA 5GAGP 1W7AA 4FWPA 1RTHA 1RILA 4CHOA 3WXLA 4PUOA 3MX5A 3U6FA 3MX2A 1VSIA 3UKRA 3NF7A 1QQMA 4BDZA 2WONA 4FK0A 4IFEA 1T03A 3LDPA 1C0MA 4DQSA 4LF9K 1DGKN 1ZC6A 3RTVA 2KW4A 1HNIA 1KAZA 1O13A 3OYFA 4CW7B 4YNQA 1ASVA 2D1KA 3DLKA 1TKZA 2PYJA 1DT9A 4KRFA 5E26A 3CPWM 1LW0A 3K5MA 2VQFK 3ZT4A 4JV5K 4DSEA 3M8QA 4LH4A 1X9MA 2Q0RA 3CJCA 4JKAA 4CD3A 5M1FA 3E01A 5C2DA 4WQ5C 3AA2A 3RMDA 3TARA 4JRPA 4B3RK 2X6NA 1TK0A 4H4OA 2E20A 2PAVA 4M45A 4KHQA 1JKHA 2E6MA 1SUQA 3HP9A 2IDOA 3KLFA 4BE2A 5BN9A 3Q7CA 3W3DA 3D45A 2XY5A 2WTUA 2I7PA 3QETA 1BI4B 1YIJN 1RDBA 4O4GA 3MAQA 5KI6A 4H5RA 4C8NA 3WNFA 3QLHA 4CJ3A 1EETA 1VQON 3G25A 1ESVA 3OYGA 2JLEA 5BPMA 4CJLA 3HVTA 3SUPA 3CMEN 1U2VB 2FLOA 2W40A 3LP1A 4BRMA 3FZLA 1NNEA 1SKWA 3SUQA 4JKBA 1KLMA 2P5GA 1BDGA 4JI7K 1WSIA 2HOEA 1HX1A 1XMQK 4WE1A 1YT3A 2HBJA 3QIPA 3LZJA 2HHUA 4OJRA 3U9ZA 4FWMA 4OGCA 4CCHA 4WQ4C 4JD2B 5AQSA 1BI4A 3AAQA 1K8AO 4BR4A 5HRRA 3VETA 3OYAA 1IG9A 5FPNA 3QBWA 5IWAK 4N5SA 4K8ZA 5KRTA 3RMCA 3IUCA 3CCSN 4E19A 2VWKA 4BDYA 3R9PA 3H1VX 1BA1A 4CHNA 4MO5A 1VSHA 1NGCA 1U2VA 1VRUA 4OKKA 4CEZA 3HPOA 4CIFA 4DSIA 3H45C 4IJAA 3VEYA 4JKCA 4W5NA 3LWLA 3C7NB 4MFBA 5AQTA 3DMJA 3IMXA 4KH5A 2ASPA 4EZ9A 3FZKA 3GBTA 5CY4A 3QICA 1GLBG 3PSFA 4FWOA 1JL2A 4JD2A 3DOLA 1X3MA 4DV3K 4BC3A 3H1QA 4HTUA 2E5LK 1NK6A 4IKFA 1EQYA 3AO2A 1DLOA 1T6DA 3F9MA 5HLFA 2ZE2A 1K73O 4DQRA 2ZGYA 4DSLA 3FFKB 1RCHA 4CJKA 1NGDA 4HUGA 3M1FA 2ZJPL 5AQUA 5EY4A 5C25A 3DOKA 4B3SK 1SKRA 2QK9A 3C7NA 2IVNA 3EKUA 3AO3A 3O9TA 3MN5A 3L2UA 4LY7A 2A6AA 3HL8A 3CM5A 1G99A 3M3ZA 1E3MA 3HBTA 4FWLA 3ZSYA 3J81O 3PX4A 4GV6A 4E7KA 1I94K 1C0FA 3F5TA 1BOTO 4DV7K 1LCUA 3VEVA 3AVCA 4CJSA 3E9LA 3PY8A 2DFEA 4I7FA 4KHPK 1VQNN 1VQ4N 1XC9A 1C1BA 5LL6Z 1U47A 3L3VA 1TV6A 2F7TA 3ENBA 1IKVA 3THWB 5CZ1A 1X9WA 2QKKA 3NMUA 4B3TK 4IFYA 3DLRA 4O8KA 4CF8A 3IFRA 1TUYA 4FOEA 3J80O 5BR8K 4ELTA 1TVRA 3R6MA 2PYLA 1GLJO 4CZIA 1RDCA 3HM8A 3OBYA 4YOWA 3O4NA 4CJEA 3JS6A 4OPHA 2UUCK 4DFPA 1GLDG 3D2FB 3IKMA 3TTFA 4JLHA 4B9LA 4NLBA 1VQ6N 3WXIA 1YITN 3GL1A 4CZFA 4W5TA 2BDPA 4DV1K 1KCFA 1VSEA 2YHWA 4DR7K 3CQ8A 3THWA 4CIEA 1RDDA 3C6UA 4BRAA 4H0XB 4LF7K 2FXUA 4FLVA 1NK9A 4BE1A 4CE9A 1GLEG 3EL2A 3DLLL 4UQGA 1KVAA 1WNSA 5HL7L 4Z4GA 4CD1A 2OPQA 1BISA 3DYAA 4QOZB 1TL3A 3VPZA 3VN5A 1A5XA 4RW7A 1JL1A 3LM9A 4O8UA 3V9ZA 2QWNA 1FKPA 2NLXA 2FC0A 3D2FA 4C8MA 4JI5K 1WAFA 2ZD1A 2P9SB 3VQ6A 2P9KA 4OPJA 5AQJA 2D0CA 4YORA 4IXCA 1SL0A 3Q7BA 2HBKA 3SMSA 1HYZA 4IWVA 2ZGZA 5I42A 2VYPA 3AVMA 3HSCA 1T7PA 2O8FB 3TAQA 4RWTA 3LAKA 3VQQA 3KK1A 4DFKA 2GX9A 1C1CA 1REVA 5E41A 1J53A 4PL8A 2QWPA 1XUPO 3KWGA 1JJ2M 3GE1A 1W97L 4KPYA 4CVNE 5KPRA 1YJNN 4Z4EA 1Q18A 2P9SA 1YTAA 1Z6RA 1ATNA 3KWIA 2UXCK 4EP5A 5FLXO 1U48A 2VG5A 4AHSA 3R1XA 1C0TA 1N8RO 1NGEA 4J8FA 4MDBA 4DB3A 4CZMA 1EWRA 3ZSQA 2ZJQL 3QIOA 3WT0A 2VCPA 1FK9A 1U6ZA 4XH5A 1B9DA 3B6OA 2QWLA 5AQYA 4H4MA 4V19S 1SZ2A 5AFUA 4NCBA 1S1WA 4CF1A 1ILYA 1S72N 3NE6A 1O1WA 1QHTA 2H3GX 1W2BM 2G8WA 2O8DB 5C0YA 3BUZB 4IOCL 1D5AA 1UOCA 4OX9K 2DFHA 3BGRA 3B6PA 2NRRA 4CJQA 4A57A 1BCOA 4CEDA 1HMVA 3KLEA 1QSSA 4DG1A 2RF2A 1ZBIA 4E7JA 1E4FT 4FJKA 4CZLA 3QESA 4CEEA 3TWHA 2CGKA 4JKEA 5CE3A 4DHYA 5BRDA 3BZKA 2FF6A 1VSKA 3L2RA 3VQ8A 4IJNA 1E4GT 3SAGA 2XY7A 2HVIA 4CZKA 3JYTA 4ZTFA 5C42A 5FRNA 3DRSA 1Q82O 4IO9L 4BROA 2HW3A 1RBVA 3O9UA 1HNWK 1HKGA 3ZSXA 3L8BA 1HQEA 4O5FA 1TGOA 3KKSA 4NXNK 5LMUK 2HB5A 4JS4A 1I3AA 3A5LC 2JGUA 4DFMA 1ZBUA 4PA1A 3ZT0A 2W6LA 3EO3A 2EWSA 1SAZA 4CERA 3CQXA 3EE8A 2V52B 3M8RA 4ISGA 5JVGL 3HTVA 5I9EB 2HMPA 3WEEB 2E1YA 2GUPA 3GG4A 1UAXA 4FWKA 4FJJA 4KV8A 4KTZA 1UWBA 3VTHA 3PIOL 3U4LA 4IBNA 4C1NI 1HQUA 3TTCA 3RRHA 3K9JA 4JI4K 1RT7A 3SLCA 3LWMA 3QDKA 3P83D 4F2SA 3H3OB 5DK5A 3O3GA 1YAGA 5BRFA 2ATQA 3KJVA 1K8KB 3O1WA 4IZ9A 3SQ4A 2A1RA 3LDSA 1KAYA 4FLWA 3RR7A 1JXEA 4DKWA 4Z94A 4DQQA 2D4WA 2OZMA 4C8LA 1N5YA 4DUYK 1A5VA 1HKCA 1S1TA 3RVCA 1C1AA 4H5VA 3GDQA 3O5BA 4JYAK 1RT2A 1WSJA 2VQEK 3TABA 2A40A 3VGKA 4WFAL 1NG9A 3LDOA 4FSVA 1IG8A 3ATVA 1J6ZA 3K5OA 4JKDA 3THXA 4XH4A 4IG3A 4BRCA 3OS1A 4E7HA 5AQGA 3AO4A 5GAHP 4FPBA 3C6HA 1WB9A 4JNEA 4QS9A 4Y1CA 3IRXA 3C94A 3KK3A 1NK0A 1VSLA 2P9IB 1MDUB 2FBYA 4ELVA 4CBXA 4AQYK 3A5NC 4CEFA 2O8BA 1OKJA 1XHZA 1VSDA 4DMNA 1SL2A 2P51A 4CK3A 4AHVA 4JKFA 4A59A 4HCBA 2Y1JA 1QVGM 1F21A 3G10A 1JLGA 1S1UA 1FKOA 4N56A 4BGBA 2D0PA 4WQ5A 3MK6A 3I56N 3H6EA 2W41A 5J2MA 5BN8A 4ILGB 2P9IA 2FF3B 5F2RA 1YXQA 4M7YA 3PV8A 4DR3K 3DWLA 5JLHA 2HBMA 2HHVA 1QHAA 3CCEN 5SZTA 1BHLA 4UY8O 4DSJA 3BF3A 4WYBA 3UKRB 4NYNA 4HUFA 3TANA 1BWFO 3FLCO 2IAJA 3DRRA 3PO5A 3PLAA 1GLLO 1BCMA 5GINA 4WF9L 4FWNA 4K41A 1YJ9N 1JCGA 4OLBA 5CZ2A 5C15A 3CCMN 4DV2K 3F9KA 3VQ5A 3LP3A 3JXUA 3M6GA 3ALYA 3P1GA 1B9FA 1YJWN 1CXQA 4XH1A 2OA8A 3ZT1A 5KPTA 4F4KA 3RRGA 3R8EA 4IDHA 3O3FA 4B9SA 3EZ5A 3AA5X 5E84A 4WQ4A 1NGGA 4L8RB 3NF9A 3CJ1A 4KI6A 3THVA 4X62K 3LDQA 5KGXA 4Z4IA 4CFDA 3SAFA 3L2QA 4Z4FA 4FJ5A 3HXMA 1NGIA 4IO8A 1Z05A 4B1VA 1LAVA 4DF4A 1Z25A 4EHTA 3CD6N 3SUOA 4FXDA 3O3HA 1NGFA 2VWBA 2OPPA 3VESA 2OYQA 1RT3A 5AR0A 1YVUA 1RBRA 3EY1A 2OPSA 4PKGA 2QWRA 4K8XA 4B1UB 4E1MA 1CZAN 1ATRA 3LL3A 1RT6A 3O9QA 1SV5A 4FJIA 4DS4A 2O8EA 4YOTA 4DR6K 1Q9YA 5M1QA 1MA9B 4YY3K 3V81A 1EXQA 5FPDA 1JCEA 1S3XA 3MEGA 4BWMA 4HTLA 4E1JA 4AHTA 3CERA 1HR0K 2FBVA 2GV9A 3NF6A 3AVLA 4H0TB 4KHWA 1JLBA 4Q0BA 2Z1HA 3VEXA 3OYHA 4Y0WA 3AY9A 5AQXA 4PKIA 4JKHA 1OH8A 4KO0A 2A3ZA 1WLJA 4RW6A 1BA0A 2RKIA 3OBWA 4B8CA 3CC7N 2IGIA 3QEXA 5FRMA 3WXMB 5HOOA 4CECA 3J7ZO 4DTJA 3LZIA 1RT1A 4JRQA 2IC3A 1EX4A 4CHYA 1VAZA 4H03B 4Z4CA 4N76A 3NAEA 3FE1A 3VQDA 5CHIA 5FPEA 3SNNA 3ULDA 4ID5A 3VF2A 1TAUA 1NOYA 4BR9A 4DTXA 3THYB 1IJJA 4KTWA 4J2DA 1Q81O 2G8VA 3HPHA 2YHAA 5ADXH 2RN2A 1U04A 4JN4A 4MO4A 2DPNA 4DR1K 2V7ZA 3RR8A 4FJGA 3ISNC 4LF8K 3A5OC 1YF5L 3SPYA 5A2QO 4AM7A 1DKGD 1WN7A 3CG7A 4OPKA 3VQPA 5AQWA 3L4QA 1NGHA 1QS4A 4LC9B 5KPZA 1SKSA 2QWQA 1MWMA 5I3UA 2IVPA 4FZYA 3CCVN 3HP6A 3W0LA 4BQZA 4HWIA 2WOMA 4H0VB 2CH6A 1CZ9A 1QTMA 3THYA 4MLHA 1TL1A 4PKHA 3DLGA 1IKYA 4OVLA 3H46O 3TSUA 2DFFA 2QA4N 3O8MA 2QM1A 5AZIB 4FLTA 4I2QA 3OYEA 1BIUA 2Y1IA 3E9OA 2J4RA 4U67L 1K6YA 2E8AA 1RBTA 4JKGA 2IVOA 3TR8A 4NCAA 1FJGK 2F8TA 3VQ9A 3J7AP 4KH4A 1WSEA 2YKNA 3ID8A 5JMVA 4CFBA 2IOCA 3LDLA 1NJXA 3MWPA 3AVNA 2OPRA 3WNHA 2B6AA 4CF9A 3S3NA 3RMBA 3KZBA 3TAMA 4BRPA 4FJLA 3CHWA 1GOCA 5EU7A 4BRNA 2Z1IA 5AZIA 4IFVA 3BY5A 1NBWA 3JAMO 3H08A 3MN7A 2B4JA 1BUPA 3NGYA 1L3UA 4B1WB 1L3SA 4CGJA 4IEEA 3PO4A 3K0SA 4EAHD 4LSLA 3CF5L 4FJXA 3EEQA 4DQ8A 2XHBA 4CEQA 5AQRA 3ZX3A 2WC9A 4AHCA 4E89A 1QSYA 3V4IA 5TKWA 4BRQA 1VSFA 3TI0A 4C8KA 4M41A 3SUNA 4JK8A 4EIAA 3OHRA 4H0OA 2HVHA 3OVNA 3G6EN 1BU6O 1TK5A 1SQKA 2P9KB 4NCGA 5CR4A 3LALA 3OS0A 1VQMN 4F9OA 3KD5E 2Z1JA 4KB1A 4GKKK 4K0KK 4BACA 3VGMA 5LY3A 3TAGA 4YOXA 1I39A 2JWKA 3VA0A 4XEIA 4DSKA 3QEIA 4BQLA 3CJAA 1LWEA 1OVQA 3ZT2A 3VOVA 3TAFA 3L4IA 3DM2A 1RTDA 1XNQK 1NK4A 3TTDA 4CJ7A 1QQNA 3CC4N 4A5BA 4JI0K 3ZX2A 3DLHA 3HT3A 4H5TA 2P9NA 2V51B 3K9KA 1ASWA 3T1AA 2OTJN 1WUAA 3VF4A 1VQ7N 4ISEA 2HNZA 4GMJB 4FZXC 3SV4A 3U8XA 3U3YA 3QEPA 1J5OA 5F1XA 2ASOA 4OKJA 5DM6L 1X3NA 1P90A 3SPZA 3DLEA 4FOIA 1Z26A 3NHGA 3OYDA 3TPQA 2P5OA 3A2FA 3MXJA 1HNXK 2KFZA 3P5JA 5AZJB 1Q8IA 3ULEB 4IOAL 5M1PA 4A2AA 4JS5A 3MMVA 5GIOA 4KBOA 1RT5A 4W5QA 1VRTA 4CFAA 2KZZA 5KQ8A 4LF5K 4JI1K 4CESA 3HOTA 4H5WA 3MEDA 1N33K 5K14A 1J9AA 4FM2A 4GV3A 4FJ9A 1IV0A 4OGEA 3HYFA 1HPZA 4I6MB 3K57A 5H1SQ 3NH2A 1RT4A 5AQHA 2XY6A 1IH7A 3TAEA 3T7ZA 5GAEP 3E1YA 4KHUA 2NNWA 1JLEA 3CI5A 4LD0A 3AVJA 3F73A 5AZJA 4J2BA 3ULEA 4JK9A 1RNHA 2YNFA 4DV6K 3QNOA 4FLZA 1QSLA 3I8BA 3ENHA 4DR2K 2NRZA 2D5RA 2UU9K 1VQLN 4CZGA 5BPNA 4J2AA 2IS3A 2ZF5O 1UA0A 1ZXOA 4BVPA 2YX6A 4I6MA 1S1XA 1M90O 4PQUA 3IS9A 4H0PA 4FWSA 2E1ZA 4BRLA 3MN6A 3E66A 3AGRA 3LP0A 1JLFA 4DUZK 4FJ7A 1NWKA 3VQEA 4E0DA 3NDKA 3K2PA 2G8KA 4FW1A 3PSIA 1NKBA 1KQSM 4BG8A 2ZWHA 1LWFA 4TSXA 3R3LA 3WUHA 2UXDK 1QQCA 4FPAA 3ZT3A 3LM2A 3SBGA 3O08A 1Q86O 4KH6A 1RTIA 1Q7YO 3L2WA 3ZCMA 5KRSA 4LFAK 2YHXA 4F3OA 3V9SA 4WFNL 3CC2N 4CGFA 2KZMA 2Q1NA 4DU1A 4B9MA 3U3GA 2QW9A 1YUWA 5BRHA 3ZSVA 1JLAA 4Q5VA 2BGGA 1N6QA 3OYLA 1QZ6A 3TAPA 3LPUA 4B9NA 4BR7A 3HO1A 5J2NA 2UXBK 2WBNA 1X9SA 1OH6A 4JI8K 4A61A 1ITGA 4NO7A 5CYMA 2HBLA 1BO5O 1RBSA 3MWTA 5F0XA 2X74A 1NJWA 4AHUA 1KSPA 4ZTJA 3NVMA 3THXB 3NFAA 4CJTA 4BG9A 3I55N 3L0QA 3AA4A 4E1NA 2UUAK 2F96A 4BREA 3MEEA 4YOVA 4EZ6A 4FO0A 2GBZA 1XMOK 1XQSC 5AQFA 3SQ2A 4DR4K 4DTRA 4JI3K 4CJ4A 4DS5A 3PIPL 4BR2A 3QB0A 4U7BA 3OYMA 1CLQA 2RE2A 1ASUA 3HSTB 4EHUA 2O8BB 5AQOA 4YOUA 2Q3SA 3ZEUB 4R79A 1VHXA 3A0IX 4WCEL 2YV0X 1EKEA 2QXLA 5C2FA 2O4IA 2HHTA 3CETA 5BREA 4X65K 2VG6A 2VGNA 3C65A 4M7XA 4M3WA 5HBMA 3OYNA 2PBDA 4E7IA 4FJ8A 3C0BA 1QZ5A 3IDHA 4B8AB 5M1NA 5AQIA 3O4WA 3MCAB 1SS6A 1HJRA 1IKWA 2E4LA 4CBWA 1ZBFA 4CGDA 1TYQB 5T7BA 1LWCA 1V4SA 4AM6A 4DQPA 2BE2A 1J54A 5AFUH 1NKEA 3AA3A 3VEZA 3ZEUA 4LF4K 3VQBA 3IG1A 3VA3A 3MDQA 3NGZA 4OO1J 5DM7L 1OH7A 3VQCA 1KC8O 3EYZA 4GVMA 3VQ4A 3SK3A 3N4QA 1UA1A 2FSKA 1HPMA 4YDUC 2O8CB 5D3GA 1KD1O 4RW9A 4B08A 5J1EA 1TYQA 1N34K 3BF1A 4GV9A 5KQDA 3CJ7A 4FVUA 4DF8A 5KGWA 2A5XA 4FYDA 3RWUA 4AHRA 2HF3A 1X1PA 2G8UA 3HVRA 3UKUA 1BGXT 4JEPA 4CK2A 2HMIA 4B1YB 4KTQA 2Q97A 2KTQA 3AVIA 1NGAA 3P38A 3S9HA 1TUUA 4BGAA 3OA9A 3T3FA 4DQIA 4PY5A 3QEVA 3KK2A 2O8CA 5CYQA 5MLCQ 4CJ5A 3N4PA 4KREA 2YCHA 2ITGA 5ADXA 5AQVA 4RW4A 3CXCM 2PY5A 3EN9A 2ETJA 2PFUA 4YHHK 4AH9A 1ATSA 1KAXA 2YHYA 1RFQA 1BIZA 2D0AA 1GLCG 2FSNA 3NH1A 2E2PA 4FLXA 1S1VA 3KKRA 3D7EO 5LJWA 2NRXA 3ENOA 3NF8A 4PL7A 5JS1A 2O8EB 4DLGA 4FW2A 2KHOA 2AJQA 1H1VA 2EHGA 2W42A 3LANA 5AQZA 3U9DA 5GIPA 3QFUA 1IBMK 4BC5A 2FBTA 3CIPA 3DRPA 3G4SN 4E3SA 3VEWA 1HYSA 4CJUA 4PHTX 2Q36A 3UE5A 3OJSA 1TK8A 4PWDA 1BQMA 2BANA 4MLEA 1NLVA 2W6KA 3VQ7A 4FCYA 3EKSA 4DFJA 4HHTA 1Y97A 3A8YA 5B8HA 1B92A 4I9QA 1KFSA 3VQAA 4FWQA 4M3UA 2QEXN 5FPMA 5C24A 2VG7A 1EO1A 3ZETA 3CPEA 1VK0A 3SAHA 2YNGA 1T6CA 4DTPA 4DR5K 3K58A 3O9SA 1IO2A 3DAWA 3A5MC 2LSNA 4CZJA 4FVMA 3HZ6A 4H0YB 1KVBA 3ZSWA 3SI6A 4F8RA 1XHXA 2A41A 3ATUA 2EX3A 4LFBK 1S6QA 4IG0A 4BRDA 2YI1A 3S41A 3OYIA 4FJHA 4LFCK 3QERA 5FDLA 2E2OA 3BZCA 4CFCA 1WBDA 4QS7A 1QE1A 1IKXA 2Z1GA 3OJUA 3SJHA 1M1KO 2HHQA 4CJWA 4C23A 4C1NK 4OLAA 2UYTA 3M8SA 4FK2A 1GOAA 2XY8A 4DCHA 4JAXA 5DMRA 4KAZA 2YJEA 3CFPA 4LF6K 4O44A 3ZX0A 1WOQA 4CZHA 4CEOA 5AQKA 4LSNA 1NK8A 4DU4A 2X6SA 4BRGA 4Z4HA 1K9MO 4FJMA 4N47A 2Q2RA 1HLUA 4KHYA 3AVAA 1XNRK 2HHHK 2F8SA 3CCJN 2GELA 3D2EB 2NRTA 2DTUA 1L5UA 1X9JA 2VWJA 3J8AA 3I33A 3MCPA 3MXMA 1DEJA 3AAPA 3O6WA 4Y1DA 4E7LA 3KIOA 4JKGB 4RCHA 3SQ0A 2QWMA 2YNHA 1JLCA 2NUBA 1N36K 4M3ZA 1LV5A 3CJBA 4CHZA 4O55A 4WFBL 3SQ1A 1HJOA 2XO7A 1NJIO 2HNYA 3KLGA 2O4GA 3ZSZA 3ID6A 3BDPA 5KTQA 2YHBA 4FL9A 3KTQA 1KVCA 3D2EA 2ITMA 4CK1A 1U45A 5M1KA 5AQMA 1WAJA 2QWOA 4CBUA 3QEWA 3WXKA 3I0RA 2OANA 2F4VK 3FZHA 3LDNA 3TU5A 2NRWA 3IAYA 5ELZA 3RMAA 3TSPA 1S6PA 2BTFA 4I9LA 3AARA 1T8EA 1N32K 3NVKA 4ILJA 1RBUA 4X66K 2JWLA 4IEIA 2Q31A 2DY4A 1GLFO 4MQ3A 4Z0UA 1LOTB 5JLFA 3BP8A 1EP4A 4GNIA 3QNNA 4FM0A 3FZMA 5BPLA 3G0ZA 3E9PA 3K59A 4JI2K 4KKOA 1D4XA 1NGJA 5EVZA 3K5NA 3P4IA 1NMDA 3DJCA 4CJRA 3KHYA 5HROA 1Q9XA 3D6RA 1SL1A 1WSGA 3ASMA 3D0PA 3HRGA 2G8IA 4CIGA 3FZFA 5HRPA 4ZHRA 5LJVA 1HNZK 5AQQA 4BC2A 3NGIA 1QVFM 2RPIA 4K25A 3VENA 1JLQA 1GOBA 2QTDA 1BQNA 2P9NB 1YVNA 2KKZA 4H8KA 4YFUA 4KI4A 4BR5A 4RG8A 3SV3A 3GOIA 4GY2B 3ITHA 4BRKA 4DTUA 3QO9A 3V6DA 5J2QA 4G9ZA 3QBXA 2QXFA 1VQ8N 3AO5A 5JICA 2ZJRL 3HJFA 1XC3A 1Y64A 4R5PA 2HHSA 1WSHA 5GADP 3FR0A 5EX5A 4DWIA 1NJZA 4ELUA 1JXBA 1BG3A 4AILC 3MECA 3VF6A 2E2NA 4O5BA 4HVJA 2KFNA 4YOYA 1C0GA 4NB4A 2NZTA 4CF0A 4BY9C 3O9RA 4DTSA 3CCRN 3AVHA 4L3QA 4FLYA 4DV4K 1T3VA 4B9TA 1NJYA 4FLUA 1NK5A 3T1YK 3VTIA 4NXMK 2ZM6K 2ZQBA 3L6QA 3O4QA 2G8HA 3SYZA 1YHQN 4JI6K 4CJVA 3C6TA 4DSFA 4BWJA 4M3XA 2P9UB 4DV0K 1V4TA 3LP2A 1NOZA 3CFRA 2F9TA 4GVEA 4M3TA 4G1QA 3AVBA 1D9DA 1VQKN 1LAWA 3P31A 1U49A 5FROA 3TSQA 3L3UA 4A5AA 4ICLA 3CFOA 3O1BA 4NLCA 3VEOA 3DLBA 4BDPA 4B9QA 4DU3A 1VQPN 4B9VA 2WFBA 3L2VA 1TAQA 4M63C 4FJNA 1J5EK 3SCXA 4M3RA 4O0JA 4B3MK 3OYJA 4NYFA 2P9PB 1S9EA 1HRHA 4KHNA 4KFBA 4RTFD 4K42A 2P9UA 4B9UA 4KB0A 1EWQA 3V9UA 2GTDA 1T44A 1OH5A 2OCEA 1S22A 5C12A 3MN9A 4B1XB 5EXWA 2RHKA 3SZ2A 2GUIA 1HUXA 5AJ3K 3H3NO 1W9HA 3HM9A 1YTUA 3FGUA 3DI6A 3NCIA 2O8FA 3PUFA 1P8ZA 1L3TA 3T69A 5IT9O 2KQ2A 2E88A 3CM6A 4N41A 3HOSA 2B5JA 3DXMB 1G15A 3HK2A 5J2PA 3V1OA 2E6LA 3V1QA 2P9LB 2F9WA 1A5WA 3KLHA 3DXKB 2P9PA 2VGMA 4HUEA 1ZBHA 3AGKA 3P39A 2GWKA 4BRFA 4F3TA 4QS8A 4GKJK 3J7YP 1VQ5N 4CHPA 5AQLA 4O0IA 1KRPA 1RTJA 2HHXA 1R59O 1DTQA 3S3MA 1C6VA 4M42A 2AP1A 4OKEA 3SMPA 3PX0A 1S5JA 3FFIA 1T05A 3CYMA 4X64K 4W5RA 3AV9A 5JS2A 4XIUA 3DXMA 1WBBA 2AA4A 3OYBA 3ZSOA 5LMNK 3ZSRA 4BRHA 3F2KA 2NRHA 3WXJA 2P9LA 1IBKK 3VGLA 4DTMA 2D0OA 3KVGA 3DXKA 4BR0A 3OYKA 3I8DA 1FW6A 2PZSA 3WQUA 2QKBA 2CGJA 2P1JA 4A62A 1KLNA 3LPTA 2E2QA 1YI2N 4CZEA 1VQ9N 4HCCA 4RW8A 3T19A 2GWJA 2O8DA 4YDUA 2YKMA 1KFDA 3S3OA 1NMNA 2I5JA 3ZLJA 1RDAA 3KD1E 2Q0UA 3WNGA 4IOXA 1D9FA 3VMFB 4ILHA 4ID1A 1WSFA 1MU2A 4F2RA 4FWRA 3RSEB 4ISFA 4DTNA 2HNDA 5HRNA 1XWLA 5JVHL 3B8AX 2A1SA 1LW2A 3NH0A 4CEBA 2HSTA 1KXPA 1QQOA 3OS2A 4DLEA 5HRSA 5C10A 3C95A 4CGGA 4BE0A 4DTOA 2CH5A 3WNEA 4EP4A 3C6AA 1HKBA 4EFHA 2X78A 4C8OA 2YJFA 2OZSA 3NBPA 3G71N 1MWKA 4LH5A 3SBTA 4H5NA 4KHSA 4JK7A 3QMLA 1TKXA 4W5OA 2A42A 3K5LA 1CXUA 1NU0A 1NK7A 5SWMA 4CI6A 4CJFA 2BUPA 4CEAA 5BR9A 4J2EA 1C0UA 3ZYYX 4BVOA 3CCLN 3WQTA 3RSEA 3M8PA 4QAGA 4K43A 4OPAA 4CJPA 3WEEA 1D8YA
chains in the Genus database with same CATH topology
3AVNA 2OPRA 3WNHA 5C24A 2VG7A 2B6AA 4CF9A 3S3NA 3RMBA 1VK0A 3TAMA 3HPGA 4FJLA 3ZSQA 2YNGA 4DTPA 1GOCA 5EU7A 3QIOA 3K58A 4FZZA 4GW6A 1IO2A 1FXXA 4I2PA 2Z1IA 1FK9A 2LSNA 4CF2A 4FVMA 1DTTA 4IFVA 1B9DA 1KVBA 3B6OA 3ZSWA 1XHXA 3SI6A 4F8RA 4M3YA 4FK4A 3H08A 2EX3A 4H4MA 2B4JA 1S6QA 3KLIA 4NCBA 3V9XA 1S1WA 4IG0A 4CF1A 3AVGA 3NGYA 1ZYQA 1L3UA 3OYIA 3NE6A 4FJHA 1L3SA 1O1WA 1QHTA 4CGJA 3QERA 1XI1A 5FDLA 2G8WA 3PO4A 3I0SA 4CFCA 1D5AA 1QE1A 1IKXA 1UOCA 2Z1GA 1CZBA 4LSLA 2DFHA 3BGRA 3OJUA 4FJXA 3B6PA 2XHBA 4FM1A 4CEQA 4IDKA 4CJQA 1W0HA 1BCOA 4CEDA 1HMVA 2D0BA 4CGHA 4CJWA 3KLEA 2HHQA 4AHCA 4E89A 1QSYA 1QSSA 3UIQA 3M8SA 4FK2A 4OLAA 4DG1A 1GOAA 2RF2A 3V4IA 2XY8A 4E7JA 1ZBIA 4FJKA 3QESA 1VSFA 4CEEA 3TWHA 1S9GA 5DMRA 3TI0A 4C8KA 4M41A 3SUNA 4CGIA 4CHQA 2HVHA 3OVNA 4KAZA 3CFPA 4O44A 1VSKA 1TK5A 1NKCA 3MXIA 4NCGA 3LALA 3L2RA 3VQ8A 4CEOA 3OS0A 4KB1A 3KD5E 2Z1JA 4LSNA 1NK8A 3AVFA 2XY7A 2G8FA 1VSMA 1L3VA 3AO1A 4DU4A 2X6SA 4BACA 4Z4HA 3PX6A 2HVIA 3TAGA 1TKDA 1I39A 3JYTA 4ZTFA 4FJMA 3VA0A 5C42A 4N47A 5FRNA 3LAMA 3DRSA 3OY9A 3JSMA 4DSKA 3QEIA 2HHWA 2HW3A 4KHYA 3AVAA 1RBVA 1TKTA 1LWEA 3QINA 3ZT2A 3ZSXA 3L8BA 1KTQA 2F8SA 3TAFA 1HQEA 2XRIA 3DM2A 1ZBLA 1RTDA 1NK4A 2DTUA 1L5UA 1TGOA 3KKSA 3AVKA 2VWJA 3V1RA 3DLHA 3HT3A 2HB5A 4JS4A 1I3AA 1ASWA 2JGUA 3T1AA 1ZBUA 4DFMA 5HP1A 3MXMA 4DSIA 4PA1A 4Y1DA 3ZT0A 4E7LA 4B3OA 3KIOA 3V9WA 3SQ0A 4CERA 2HNZA 2YNHA 4GMJB 1U4BA 1JLCA 2NUBA 3SV4A 4FZXC 1HYVA 3U3YA 4M3ZA 1LV5A 4CHZA 3M8RA 4O55A 3SQ1A 2YNIA 3QEPA 1UAXA 2XO7A 1J5OA 2HNYA 3KLGA 4OKJA 2O4GA 2R7YA 3SPZA 4KV8A 3ZSZA 4FJJA 4KTZA 1UWBA 3SJJA 3DLEA 4IBNA 1R0AA 1VSJA 1BL3A 3BDPA 1HQUA 5KTQA 3RRHA 3OYCA 3LWMA 1RT7A 1HNVA 1Z26A 2FBXA 2YHBA 3NHGA 3OYDA 3P83D 2P5OA 4F2SA 1RTHA 3A2FA 3MXJA 5DK5A 3O3GA 3KTQA 1RILA 1KVCA 2KFZA 3P5JA 2ATQA 4CHOA 3KJVA 4CK1A 1Q8IA 1U45A 4PUOA 3SQ4A 2A1RA 1WAJA 3LDSA 3U6FA 4JS5A 1VSIA 3QEWA 4FLWA 3I0RA 1JXEA 3RR7A 1RT5A 3NF7A 4W5QA 1VRTA 4CFAA 3IAYA 2KZZA 3RMAA 4BDZA 4DQQA 2OZMA 4CESA 1S6PA 2WONA 4C8LA 3MEDA 4FK0A 5K14A 1J9AA 4FM2A 1N5YA 1T03A 4I9LA 4FJ9A 1C0MA 1T8EA 1A5VA 4DQSA 1S1TA 1C1AA 4OGEA 3HYFA 1HPZA 1RBUA 3RTVA 3K57A 2KW4A 1HNIA 1RT2A 1WSJA 3OYFA 3TABA 2DY4A 4YNQA 4MQ3A 1ASVA 4Z0UA 3NH2A 3DLKA 1RT4A 2XY6A 1TKZA 1IH7A 3TAEA 1EP4A 2PYJA 3QNNA 4FM0A 4KRFA 3K5OA 3G0ZA 3K59A 4KHUA 1JLEA 1LW0A 3K5MA 4LD0A 4IG3A 3OS1A 3AVJA 3F73A 3ZT4A 4E7HA 4KKOA 4J2BA 1RNHA 2YNFA 4DSEA 3AO4A 3M8QA 4LH4A 1X9MA 3QNOA 3K5NA 4FLZA 1QSLA 4Y1CA 3E01A 2D5RA 3IRXA 3C94A 4CJRA 3KK3A 3AA2A 3RMDA 5HROA 3TARA 1NK0A 1VSLA 4JRPA 2X6NA 1TK0A 1Q9XA 4QCLA 1SL1A 4H4OA 4J2AA 4M45A 2IS3A 2FBYA 1JKHA 1WSGA 2E6MA 4KHQA 1UA0A 4ELVA 3ASMA 4CEFA 3D0PA 1S1XA 1SUQA 2G8IA 4CIGA 3HP9A 2IDOA 5HRPA 4ZHRA 3KLFA 4BE2A 4PQUA 3NGIA 3IS9A 2RPIA 1JLQA 1GOBA 1BQNA 4H8KA 4YFUA 3D45A 4KI4A 2XY5A 1XHZA 1VSDA 1JLFA 3LP0A 4RG8A 4DMNA 1BI4B 3SV3A 3QETA 1SL2A 4FJ7A 3VQEA 2P51A 1RDBA 4O4GA 4AHVA 4CK3A 4E0DA 4HCBA 3MAQA 3NDKA 2Y1JA 3K2PA 2G8KA 1F21A 3ITHA 4FW1A 5KI6A 3G10A 4C8NA 3WNFA 1JLGA 3QO9A 3QLHA 4DTUA 1S1UA 3V6DA 1NKBA 1FKOA 4CJ3A 4N56A 5J2QA 2QXFA 1EETA 1LWFA 3AO5A 4TSXA 3OYGA 2JLEA 3HJFA 4CJLA 4R5PA 3HVTA 5J2MA 1QQCA 3SUPA 3ZT3A 2HHSA 3LP1A 1WSHA 1SKWA 3SUQA 1RTIA 3PV8A 1KLMA 2P5GA 1NJZA 4DWIA 1WSIA 1JXBA 3L2WA 4ELUA 2HHVA 3ZCMA 3MECA 5KRSA 4AILC 5SZTA 1BHLA 4F3OA 4O5BA 4WE1A 4HVJA 1YT3A 2KFNA 3V9SA 4CGFA 2KZMA 4DSJA 3QIPA 3LZJA 2HHUA 4OJRA 4HUFA 4NYNA 4CF0A 3U3GA 4DU1A 3TANA 4B9MA 4OGCA 4CCHA 2IAJA 3DRRA 3PO5A 1BI4A 3ZSVA 1JLAA 4Q5VA 1BCMA 4DTSA 2BGGA 3AVHA 5HRRA 1N6QA 3OYAA 4FLYA 3OYLA 1IG9A 3TAPA 3LPUA 4B9NA 4OLBA 4B9TA 1NJYA 4N5SA 5CZ2A 5KRTA 4FLUA 4K8ZA 3HO1A 1NK5A 5J2NA 3RMCA 3F9KA 3VQ5A 4E19A 2VWKA 4BDYA 1X9SA 3LP3A 2ZQBA 2G8HA 3O4QA 1ITGA 4CHNA 3ALYA 1VRUA 1VSHA 1B9FA 3P1GA 1RBSA 4OKKA 1CXQA 2X74A 5CYMA 4CEZA 4CIFA 3HPOA 4AHUA 1NJWA 1KSPA 4CJVA 3C6TA 4ZTJA 2OA8A 3ZT1A 3NFAA 4DSFA 4BWJA 4F4KA 4CJTA 3LWLA 4M3XA 4W5NA 4E1NA 3AA4A 4MFBA 3DMJA 3RRGA 3O3FA 4B9SA 2F96A 3LP2A 1NOZA 3CFRA 3EZ5A 3MEEA 3AA5X 4EZ9A 4EZ6A 4M3TA 2GBZA 5CY4A 4G1QA 3AVBA 1D9DA 1LAWA 4L8RB 3NF9A 3SQ2A 1U49A 5FROA 4DTRA 3L3UA 1JL2A 4KI6A 3DOLA 3THVA 4ICLA 3CFOA 4CJ4A 3DLBA 4BDPA 4DS5A 4DU3A 5KGXA 4B9VA 4Z4IA 4CFDA 3L2VA 4HTUA 3L2QA 1TAQA 3OYMA 1NK6A 4Z4FA 4IKFA 3AO2A 4FJNA 1CLQA 1DLOA 4FJ5A 3HXMA 5HLFA 2ZE2A 1ASUA 3HSTB 4DQRA 4DSLA 1LAVA 2Q3SA 4DF4A 1RCHA 1Z25A 4O0JA 4M3RA 4CJKA 3SCXA 3OYJA 4HUGA 3SUOA 2YV0X 1EKEA 4NYFA 4FXDA 3O3HA 2O4IA 2HHTA 5C25A 1S9EA 3DOKA 1HRHA 4KHNA 1SKRA 4KFBA 2OPPA 2QK9A 4B9UA 4KB0A 2VG6A 2OYQA 4M3WA 1RT3A 5HBMA 3OYNA 1YVUA 3V9UA 4E7IA 3AO3A 4FJ8A 1RBRA 3EY1A 2OPSA 4K8XA 4E1MA 4B8AB 3L2UA 3SZ2A 2GUIA 1RT6A 4LY7A 3HL8A 3CM5A 1HJRA 1IKWA 1SV5A 2E4LA 3ZSYA 4FJIA 4DS4A 3PX4A 1W9HA 3HM9A 4E7KA 1YTUA 3DI6A 3NCIA 1Q9YA 3PUFA 1ZBFA 4CGDA 1L3TA 2KQ2A 3V81A 5T7BA 1EXQA 1LWCA 3AVCA 3CM6A 4CJSA 4DQPA 4N41A 2BE2A 2B5JA 1J54A 3PY8A 2DFEA 1G15A 3MEGA 4BWMA 1NKEA 3AA3A 4I7FA 3HK2A 4AHTA 2FBVA 2GV9A 3NF6A 5J2PA 3AVLA 2E6LA 3V1OA 3V1QA 3VQBA 1C1BA 1XC9A 1U47A 1A5WA 1TV6A 3IG1A 3L3VA 3VA3A 3KLHA 3NGZA 1IKVA 1X9WA 1JLBA 5CZ1A 4KHWA 4Q0BA 2QKKA 4HUEA 2Z1HA 1ZBHA 4IFYA 3OYHA 3DLRA 3VQCA 4CF8A 4F3TA 3EYZA 4CHPA 4GVMA 3VQ4A 4O0IA 1KRPA 4ELTA 1RTJA 1UA1A 1TVRA 2PYLA 2HHXA 1DTQA 1RDCA 3S3MA 1C6VA 4KO0A 4M42A 1WLJA 5D3GA 4RW6A 4B8CA 2RKIA 4RW9A 4OKEA 2IGIA 3QEXA 5FRMA 3PX0A 1S5JA 3FFIA 3O4NA 4B08A 4CJEA 1T05A 3CYMA 4CECA 4DTJA 5J1EA 4W5RA 3AV9A 1RT1A 3LZIA 4JRQA 5JS2A 4XIUA 2IC3A 4DFPA 1EX4A 4CHYA 4JLHA 4B9LA 4Z4CA 3OYBA 5KGWA 4DF8A 3ZSOA 3NAEA 4N76A 4FYDA 3ZSRA 3VQDA 3RWUA 4AHRA 1X1PA 4W5TA 3ULDA 4DTMA 3SNNA 4ID5A 2G8UA 2BDPA 1KCFA 1VSEA 1TAUA 3HVRA 3CQ8A 2PZSA 3OYKA 1BGXT 4CIEA 3I8DA 4DTXA 1NOYA 2QKBA 2P1JA 1RDDA 4KTWA 4J2DA 4CK2A 2HMIA 1KLNA 2G8VA 3C6UA 3HPHA 3LPTA 4KTQA 2KTQA 3AVIA 2YHAA 4HCCA 4RW8A 2RN2A 3T19A 1U04A 3S9HA 4FLVA 1NK9A 2YKMA 1KFDA 4BE1A 3S3OA 3T3FA 4CE9A 3RR8A 4FJGA 4DQIA 4PY5A 3QEVA 2I5JA 3ISNC 3KK2A 1RDAA 5CYQA 4CJ5A 3KD1E 4KREA 4UQGA 3SPYA 2ITGA 1KVAA 1WNSA 4Z4GA 4RW4A 2OPQA 1BISA 2PY5A 1WN7A 3CG7A 3DYAA 4QOZB 1TL3A 3WNGA 2ETJA 3VQPA 1A5XA 4RW7A 3VN5A 1JL1A 4OPKA 3V9ZA 4AH9A 1FKPA 1QS4A 1D9FA 1SKSA 2FC0A 4C8MA 3SYZA 1BIZA 2D0AA 1WAFA 2ZD1A 4ID1A 5I3UA 1WSFA 3VQ6A 4FZYA 4OPJA 3NH1A 3HP6A 1MU2A 2D0CA 4F2RA 1SL0A 4FLXA 1S1VA 2WOMA 4DTNA 2HNDA 5HRNA 1XWLA 1HYZA 3KKRA 1CZ9A 1QTMA 2A1SA 1LW2A 5I42A 3NH0A 4CEBA 3NF8A 5JS1A 4DLGA 3AVMA 1TL1A 1T7PA 4FW2A 3OS2A 4DLEA 3TAQA 5HRSA 2AJQA 2EHGA 3DLGA 1IKYA 3LAKA 3C95A 4OVLA 4CGGA 2W42A 3VQQA 3LANA 3KK1A 4BE0A 2DFFA 4DTOA 4DFKA 3WNEA 4EP4A 1C1CA 1REVA 5E41A 4FLTA 1J53A 2X78A 2FBTA 4C8OA 2OZSA 3DRPA 3NBPA 4E3SA 1HYSA 4I2QA 3OYEA 4LH5A 1BIUA 2Y1IA 4CJUA 4KHSA 1TKXA 1K6YA 4W5OA 3OJSA 3K5LA 1TK8A 4KPYA 1CXUA 4PWDA 1BQMA 1RBTA 2BANA 4Z4EA 1NK7A 3VQ7A 5SWMA 1YTAA 4FCYA 4CJFA 3TR8A 4CEAA 4EP5A 4NCAA 1U48A 4J2EA 1C0UA 4DFJA 2VG5A 4HHTA 4AHSA 1Y97A 2F8TA 3VQ9A 1C0TA 1B92A 3M8PA 4QAGA 4CJPA 1KFSA 1WSEA 2YKNA 3VQAA 4I9QA 4M3UA 4CFBA 2IOCA 1NJXA 1D8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVN A;  2OPR A;  3WNH A;  5C24 A;  2VG7 A;  2B6A A;  4CF9 A;  3S3N A;  3RMB A;  1VK0 A;  3TAM A;  3HPG A;  4FJL A;  3ZSQ A;  2YNG A;  4DTP A;  1GOC A;  5EU7 A;  3QIO A;  3K58 A;  4FZZ A;  4GW6 A;  1IO2 A;  1FXX A;  4I2P A;  2Z1I A;  1FK9 A;  2LSN A;  4CF2 A;  4FVM A;  1DTT A;  4IFV A;  1B9D A;  1KVB A;  3B6O A;  3ZSW A;  1XHX A;  3SI6 A;  4F8R A;  4M3Y A;  4FK4 A;  3H08 A;  2EX3 A;  4H4M A;  2B4J A;  1S6Q A;  3KLI A;  4NCB A;  3V9X A;  1S1W A;  4IG0 A;  4CF1 A;  3AVG A;  3NGY A;  1ZYQ A;  1L3U A;  3OYI A;  3NE6 A;  4FJH A;  1L3S A;  1O1W A;  1QHT A;  4CGJ A;  3QER A;  1XI1 A;  5FDL A;  2G8W A;  3PO4 A;  3I0S A;  4CFC A;  1D5A A;  1QE1 A;  1IKX A;  1UOC A;  2Z1G A;  1CZB A;  4LSL A;  2DFH A;  3BGR A;  3OJU A;  4FJX A;  3B6P A;  2XHB A;  4FM1 A;  4CEQ A;  4IDK A;  4CJQ A;  1W0H A;  1BCO A;  4CED A;  1HMV A;  2D0B A;  4CGH A;  4CJW A;  3KLE A;  2HHQ A;  4AHC A;  4E89 A;  1QSY A;  1QSS A;  3UIQ A;  3M8S A;  4FK2 A;  4OLA A;  4DG1 A;  1GOA A;  2RF2 A;  3V4I A;  2XY8 A;  4E7J A;  1ZBI A;  4FJK A;  3QES A;  1VSF A;  4CEE A;  3TWH A;  1S9G A;  5DMR A;  3TI0 A;  4C8K A;  4M41 A;  3SUN A;  4CGI A;  4CHQ A;  2HVH A;  3OVN A;  4KAZ A;  3CFP A;  4O44 A;  1VSK A;  1TK5 A;  1NKC A;  3MXI A;  4NCG A;  3LAL A;  3L2R A;  3VQ8 A;  4CEO A;  3OS0 A;  4KB1 A;  3KD5 E;  2Z1J A;  4LSN A;  1NK8 A;  3AVF A;  2XY7 A;  2G8F A;  1VSM A;  1L3V A;  3AO1 A;  4DU4 A;  2X6S A;  4BAC A;  4Z4H A;  3PX6 A;  2HVI A;  3TAG A;  1TKD A;  1I39 A;  3JYT A;  4ZTF A;  4FJM A;  3VA0 A;  5C42 A;  4N47 A;  5FRN A;  3LAM A;  3DRS A;  3OY9 A;  3JSM A;  4DSK A;  3QEI A;  2HHW A;  2HW3 A;  4KHY A;  3AVA A;  1RBV A;  1TKT A;  1LWE A;  3QIN A;  3ZT2 A;  3ZSX A;  3L8B A;  1KTQ A;  2F8S A;  3TAF A;  1HQE A;  2XRI A;  3DM2 A;  1ZBL A;  1RTD A;  1NK4 A;  2DTU A;  1L5U A;  1TGO A;  3KKS A;  3AVK A;  2VWJ A;  3V1R A;  3DLH A;  3HT3 A;  2HB5 A;  4JS4 A;  1I3A A;  1ASW A;  2JGU A;  3T1A A;  1ZBU A;  4DFM A;  5HP1 A;  3MXM A;  4DSI A;  4PA1 A;  4Y1D A;  3ZT0 A;  4E7L A;  4B3O A;  3KIO A;  3V9W A;  3SQ0 A;  4CER A;  2HNZ A;  2YNH A;  4GMJ B;  1U4B A;  1JLC A;  2NUB A;  3SV4 A;  4FZX C;  1HYV A;  3U3Y A;  4M3Z A;  1LV5 A;  4CHZ A;  3M8R A;  4O55 A;  3SQ1 A;  2YNI A;  3QEP A;  1UAX A;  2XO7 A;  1J5O A;  2HNY A;  3KLG A;  4OKJ A;  2O4G A;  2R7Y A;  3SPZ A;  4KV8 A;  3ZSZ A;  4FJJ A;  4KTZ A;  1UWB A;  3SJJ A;  3DLE A;  4IBN A;  1R0A A;  1VSJ A;  1BL3 A;  3BDP A;  1HQU A;  5KTQ A;  3RRH A;  3OYC A;  3LWM A;  1RT7 A;  1HNV A;  1Z26 A;  2FBX A;  2YHB A;  3NHG A;  3OYD A;  3P83 D;  2P5O A;  4F2S A;  1RTH A;  3A2F A;  3MXJ A;  5DK5 A;  3O3G A;  3KTQ A;  1RIL A;  1KVC A;  2KFZ A;  3P5J A;  2ATQ A;  4CHO A;  3KJV A;  4CK1 A;  1Q8I A;  1U45 A;  4PUO A;  3SQ4 A;  2A1R A;  1WAJ A;  3LDS A;  3U6F A;  4JS5 A;  1VSI A;  3QEW A;  4FLW A;  3I0R A;  1JXE A;  3RR7 A;  1RT5 A;  3NF7 A;  4W5Q A;  1VRT A;  4CFA A;  3IAY A;  2KZZ A;  3RMA A;  4BDZ A;  4DQQ A;  2OZM A;  4CES A;  1S6P A;  2WON A;  4C8L A;  3MED A;  4FK0 A;  5K14 A;  1J9A A;  4FM2 A;  1N5Y A;  1T03 A;  4I9L A;  4FJ9 A;  1C0M A;  1T8E A;  1A5V A;  4DQS A;  1S1T A;  1C1A A;  4OGE A;  3HYF A;  1HPZ A;  1RBU A;  3RTV A;  3K57 A;  2KW4 A;  1HNI A;  1RT2 A;  1WSJ A;  3OYF A;  3TAB A;  2DY4 A;  4YNQ A;  4MQ3 A;  1ASV A;  4Z0U A;  3NH2 A;  3DLK A;  1RT4 A;  2XY6 A;  1TKZ A;  1IH7 A;  3TAE A;  1EP4 A;  2PYJ A;  3QNN A;  4FM0 A;  4KRF A;  3K5O A;  3G0Z A;  3K59 A;  4KHU A;  1JLE A;  1LW0 A;  3K5M A;  4LD0 A;  4IG3 A;  3OS1 A;  3AVJ A;  3F73 A;  3ZT4 A;  4E7H A;  4KKO A;  4J2B A;  1RNH A;  2YNF A;  4DSE A;  3AO4 A;  3M8Q A;  4LH4 A;  1X9M A;  3QNO A;  3K5N A;  4FLZ A;  1QSL A;  4Y1C A;  3E01 A;  2D5R A;  3IRX A;  3C94 A;  4CJR A;  3KK3 A;  3AA2 A;  3RMD A;  5HRO A;  3TAR A;  1NK0 A;  1VSL A;  4JRP A;  2X6N A;  1TK0 A;  1Q9X A;  4QCL A;  1SL1 A;  4H4O A;  4J2A A;  4M45 A;  2IS3 A;  2FBY A;  1JKH A;  1WSG A;  2E6M A;  4KHQ A;  1UA0 A;  4ELV A;  3ASM A;  4CEF A;  3D0P A;  1S1X A;  1SUQ A;  2G8I A;  4CIG A;  3HP9 A;  2IDO A;  5HRP A;  4ZHR A;  3KLF A;  4BE2 A;  4PQU A;  3NGI A;  3IS9 A;  2RPI A;  1JLQ A;  1GOB A;  1BQN A;  4H8K A;  4YFU A;  3D45 A;  4KI4 A;  2XY5 A;  1XHZ A;  1VSD A;  1JLF A;  3LP0 A;  4RG8 A;  4DMN A;  1BI4 B;  3SV3 A;  3QET A;  1SL2 A;  4FJ7 A;  3VQE A;  2P51 A;  1RDB A;  4O4G A;  4AHV A;  4CK3 A;  4E0D A;  4HCB A;  3MAQ A;  3NDK A;  2Y1J A;  3K2P A;  2G8K A;  1F21 A;  3ITH A;  4FW1 A;  5KI6 A;  3G10 A;  4C8N A;  3WNF A;  1JLG A;  3QO9 A;  3QLH A;  4DTU A;  1S1U A;  3V6D A;  1NKB A;  1FKO A;  4CJ3 A;  4N56 A;  5J2Q A;  2QXF A;  1EET A;  1LWF A;  3AO5 A;  4TSX A;  3OYG A;  2JLE A;  3HJF A;  4CJL A;  4R5P A;  3HVT A;  5J2M A;  1QQC A;  3SUP A;  3ZT3 A;  2HHS A;  3LP1 A;  1WSH A;  1SKW A;  3SUQ A;  1RTI A;  3PV8 A;  1KLM A;  2P5G A;  1NJZ A;  4DWI A;  1WSI A;  1JXB A;  3L2W A;  4ELU A;  2HHV A;  3ZCM A;  3MEC A;  5KRS A;  4AIL C;  5SZT A;  1BHL A;  4F3O A;  4O5B A;  4WE1 A;  4HVJ A;  1YT3 A;  2KFN A;  3V9S A;  4CGF A;  2KZM A;  4DSJ A;  3QIP A;  3LZJ A;  2HHU A;  4OJR A;  4HUF A;  4NYN A;  4CF0 A;  3U3G A;  4DU1 A;  3TAN A;  4B9M A;  4OGC A;  4CCH A;  2IAJ A;  3DRR A;  3PO5 A;  1BI4 A;  3ZSV A;  1JLA A;  4Q5V A;  1BCM A;  4DTS A;  2BGG A;  3AVH A;  5HRR A;  1N6Q A;  3OYA A;  4FLY A;  3OYL A;  1IG9 A;  3TAP A;  3LPU A;  4B9N A;  4OLB A;  4B9T A;  1NJY A;  4N5S A;  5CZ2 A;  5KRT A;  4FLU A;  4K8Z A;  3HO1 A;  1NK5 A;  5J2N A;  3RMC A;  3F9K A;  3VQ5 A;  4E19 A;  2VWK A;  4BDY A;  1X9S A;  3LP3 A;  2ZQB A;  2G8H A;  3O4Q A;  1ITG A;  4CHN A;  3ALY A;  1VRU A;  1VSH A;  1B9F A;  3P1G A;  1RBS A;  4OKK A;  1CXQ A;  2X74 A;  5CYM A;  4CEZ A;  4CIF A;  3HPO A;  4AHU A;  1NJW A;  1KSP A;  4CJV A;  3C6T A;  4ZTJ A;  2OA8 A;  3ZT1 A;  3NFA A;  4DSF A;  4BWJ A;  4F4K A;  4CJT A;  3LWL A;  4M3X A;  4W5N A;  4E1N A;  3AA4 A;  4MFB A;  3DMJ A;  3RRG A;  3O3F A;  4B9S A;  2F96 A;  3LP2 A;  1NOZ A;  3CFR A;  3EZ5 A;  3MEE A;  3AA5 X;  4EZ9 A;  4EZ6 A;  4M3T A;  2GBZ A;  5CY4 A;  4G1Q A;  3AVB A;  1D9D A;  1LAW A;  4L8R B;  3NF9 A;  3SQ2 A;  1U49 A;  5FRO A;  4DTR A;  3L3U A;  1JL2 A;  4KI6 A;  3DOL A;  3THV A;  4ICL A;  3CFO A;  4CJ4 A;  3DLB A;  4BDP A;  4DS5 A;  4DU3 A;  5KGX A;  4B9V A;  4Z4I A;  4CFD A;  3L2V A;  4HTU A;  3L2Q A;  1TAQ A;  3OYM A;  1NK6 A;  4Z4F A;  4IKF A;  3AO2 A;  4FJN A;  1CLQ A;  1DLO A;  4FJ5 A;  3HXM A;  5HLF A;  2ZE2 A;  1ASU A;  3HST B;  4DQR A;  4DSL A;  1LAV A;  2Q3S A;  4DF4 A;  1RCH A;  1Z25 A;  4O0J A;  4M3R A;  4CJK A;  3SCX A;  3OYJ A;  4HUG A;  3SUO A;  2YV0 X;  1EKE A;  4NYF A;  4FXD A;  3O3H A;  2O4I A;  2HHT A;  5C25 A;  1S9E A;  3DOK A;  1HRH A;  4KHN A;  1SKR A;  4KFB A;  2OPP A;  2QK9 A;  4B9U A;  4KB0 A;  2VG6 A;  2OYQ A;  4M3W A;  1RT3 A;  5HBM A;  3OYN A;  1YVU A;  3V9U A;  4E7I A;  3AO3 A;  4FJ8 A;  1RBR A;  3EY1 A;  2OPS A;  4K8X A;  4E1M A;  4B8A B;  3L2U A;  3SZ2 A;  2GUI A;  1RT6 A;  4LY7 A;  3HL8 A;  3CM5 A;  1HJR A;  1IKW A;  1SV5 A;  2E4L A;  3ZSY A;  4FJI A;  4DS4 A;  3PX4 A;  1W9H A;  3HM9 A;  4E7K A;  1YTU A;  3DI6 A;  3NCI A;  1Q9Y A;  3PUF A;  1ZBF A;  4CGD A;  1L3T A;  2KQ2 A;  3V81 A;  5T7B A;  1EXQ A;  1LWC A;  3AVC A;  3CM6 A;  4CJS A;  4DQP A;  4N41 A;  2BE2 A;  2B5J A;  1J54 A;  3PY8 A;  2DFE A;  1G15 A;  3MEG A;  4BWM A;  1NKE A;  3AA3 A;  4I7F A;  3HK2 A;  4AHT A;  2FBV A;  2GV9 A;  3NF6 A;  5J2P A;  3AVL A;  2E6L A;  3V1O A;  3V1Q A;  3VQB A;  1C1B A;  1XC9 A;  1U47 A;  1A5W A;  1TV6 A;  3IG1 A;  3L3V A;  3VA3 A;  3KLH A;  3NGZ A;  1IKV A;  1X9W A;  1JLB A;  5CZ1 A;  4KHW A;  4Q0B A;  2QKK A;  4HUE A;  2Z1H A;  1ZBH A;  4IFY A;  3OYH A;  3DLR A;  3VQC A;  4CF8 A;  4F3T A;  3EYZ A;  4CHP A;  4GVM A;  3VQ4 A;  4O0I A;  1KRP A;  4ELT A;  1RTJ A;  1UA1 A;  1TVR A;  2PYL A;  2HHX A;  1DTQ A;  1RDC A;  3S3M A;  1C6V A;  4KO0 A;  4M42 A;  1WLJ A;  5D3G A;  4RW6 A;  4B8C A;  2RKI A;  4RW9 A;  4OKE A;  2IGI A;  3QEX A;  5FRM A;  3PX0 A;  1S5J A;  3FFI A;  3O4N A;  4B08 A;  4CJE A;  1T05 A;  3CYM A;  4CEC A;  4DTJ A;  5J1E A;  4W5R A;  3AV9 A;  1RT1 A;  3LZI A;  4JRQ A;  5JS2 A;  4XIU A;  2IC3 A;  4DFP A;  1EX4 A;  4CHY A;  4JLH A;  4B9L A;  4Z4C A;  3OYB A;  5KGW A;  4DF8 A;  3ZSO A;  3NAE A;  4N76 A;  4FYD A;  3ZSR A;  3VQD A;  3RWU A;  4AHR A;  1X1P A;  4W5T A;  3ULD A;  4DTM A;  3SNN A;  4ID5 A;  2G8U A;  2BDP A;  1KCF A;  1VSE A;  1TAU A;  3HVR A;  3CQ8 A;  2PZS A;  3OYK A;  1BGX T;  4CIE A;  3I8D A;  4DTX A;  1NOY A;  2QKB A;  2P1J A;  1RDD A;  4KTW A;  4J2D A;  4CK2 A;  2HMI A;  1KLN A;  2G8V A;  3C6U A;  3HPH A;  3LPT A;  4KTQ A;  2KTQ A;  3AVI A;  2YHA A;  4HCC A;  4RW8 A;  2RN2 A;  3T19 A;  1U04 A;  3S9H A;  4FLV A;  1NK9 A;  2YKM A;  1KFD A;  4BE1 A;  3S3O A;  3T3F A;  4CE9 A;  3RR8 A;  4FJG A;  4DQI A;  4PY5 A;  3QEV A;  2I5J A;  3ISN C;  3KK2 A;  1RDA A;  5CYQ A;  4CJ5 A;  3KD1 E;  4KRE A;  4UQG A;  3SPY A;  2ITG A;  1KVA A;  1WNS A;  4Z4G A;  4RW4 A;  2OPQ A;  1BIS A;  2PY5 A;  1WN7 A;  3CG7 A;  3DYA A;  4QOZ B;  1TL3 A;  3WNG A;  2ETJ A;  3VQP A;  1A5X A;  4RW7 A;  3VN5 A;  1JL1 A;  4OPK A;  3V9Z A;  4AH9 A;  1FKP A;  1QS4 A;  1D9F A;  1SKS A;  2FC0 A;  4C8M A;  3SYZ A;  1BIZ A;  2D0A A;  1WAF A;  2ZD1 A;  4ID1 A;  5I3U A;  1WSF A;  3VQ6 A;  4FZY A;  4OPJ A;  3NH1 A;  3HP6 A;  1MU2 A;  2D0C A;  4F2R A;  1SL0 A;  4FLX A;  1S1V A;  2WOM A;  4DTN A;  2HND A;  5HRN A;  1XWL A;  1HYZ A;  3KKR A;  1CZ9 A;  1QTM A;  2A1S A;  1LW2 A;  5I42 A;  3NH0 A;  4CEB A;  3NF8 A;  5JS1 A;  4DLG A;  3AVM A;  1TL1 A;  1T7P A;  4FW2 A;  3OS2 A;  4DLE A;  3TAQ A;  5HRS A;  2AJQ A;  2EHG A;  3DLG A;  1IKY A;  3LAK A;  3C95 A;  4OVL A;  4CGG A;  2W42 A;  3VQQ A;  3LAN A;  3KK1 A;  4BE0 A;  2DFF A;  4DTO A;  4DFK A;  3WNE A;  4EP4 A;  1C1C A;  1REV A;  5E41 A;  4FLT A;  1J53 A;  2X78 A;  2FBT A;  4C8O A;  2OZS A;  3DRP A;  3NBP A;  4E3S A;  1HYS A;  4I2Q A;  3OYE A;  4LH5 A;  1BIU A;  2Y1I A;  4CJU A;  4KHS A;  1TKX A;  1K6Y A;  4W5O A;  3OJS A;  3K5L A;  1TK8 A;  4KPY A;  1CXU A;  4PWD A;  1BQM A;  1RBT A;  2BAN A;  4Z4E A;  1NK7 A;  3VQ7 A;  5SWM A;  1YTA A;  4FCY A;  4CJF A;  3TR8 A;  4CEA A;  4EP5 A;  4NCA A;  1U48 A;  4J2E A;  1C0U A;  4DFJ A;  2VG5 A;  4HHT A;  4AHS A;  1Y97 A;  2F8T A;  3VQ9 A;  1C0T A;  1B92 A;  3M8P A;  4QAG A;  4CJP A;  1KFS A;  1WSE A;  2YKN A;  3VQA A;  4I9Q A;  4M3U A;  4CFB A;  2IOC A;  1NJX A;  1D8Y A; 
#chains in the Genus database with same CATH topology
 3VER A;  3HPG A;  1NM1 A;  2V7Y A;  3CMA N;  3BEX A;  3O80 A;  2QI2 A;  4FZZ A;  4GW6 A;  1FXX A;  4I2P A;  2NRV A;  4CF2 A;  2GEM A;  1K8K A;  1DTT A;  1RDU A;  3QFP A;  4M3Y A;  5AQN A;  4DV5 K;  4B1Z A;  4FK4 A;  5EOY A;  3EZW A;  3UKU B;  4AF1 A;  3KLI A;  2HF4 A;  3V9X A;  1ZBS A;  3AVG A;  2UUB K;  2CGL A;  1ZYQ A;  3UB5 A;  5TKY A;  1XI1 A;  5M1O A;  3I0S A;  4QCL A;  1CZB A;  4FM1 A;  4IDK A;  2OTL N;  1W0H A;  4CGH A;  2D0B A;  2IIR A;  1NGB A;  3UIQ A;  3M5R A;  5AQP A;  1S9G A;  4MDA A;  3KK7 A;  4JHD B;  4CGI A;  3CQY A;  4CHQ A;  3HI0 A;  4BC4 A;  1NKC A;  3MXI A;  2I7N A;  3AVF A;  2G8F A;  1VSM A;  1L3V A;  3AO1 A;  3PX6 A;  1TKD A;  2FSJ A;  3LAM A;  3OY9 A;  3JSM A;  2HHW A;  3OW2 M;  1TKT A;  3CJ9 A;  3QIN A;  3OTO K;  1KTQ A;  3T1H K;  2XRI A;  1ZBL A;  4BRI A;  3AVK A;  3CCQ N;  2BH1 A;  3V1R A;  1GLA G;  5HP1 A;  4JHD A;  2ASM A;  4B3O A;  2KLA A;  3V9W A;  4A2B A;  1U4B A;  3CCU N;  1HYV A;  1RGI A;  3EE9 A;  2WUS A;  2YNI A;  1IBL K;  2R7Y A;  1JCF A;  3SJJ A;  1OVY A;  3ZET B;  1R0A A;  1RDW X;  1VSJ A;  1BL3 A;  3OYC A;  1HNV A;  2FBX A;  5GAG P;  1W7A A;  4FWP A;  1RTH A;  1RIL A;  4CHO A;  3WXL A;  4PUO A;  3MX5 A;  3U6F A;  3MX2 A;  1VSI A;  3UKR A;  3NF7 A;  1QQM A;  4BDZ A;  2WON A;  4FK0 A;  4IFE A;  1T03 A;  3LDP A;  1C0M A;  4DQS A;  4LF9 K;  1DGK N;  1ZC6 A;  3RTV A;  2KW4 A;  1HNI A;  1KAZ A;  1O13 A;  3OYF A;  4CW7 B;  4YNQ A;  1ASV A;  2D1K A;  3DLK A;  1TKZ A;  2PYJ A;  1DT9 A;  4KRF A;  5E26 A;  3CPW M;  1LW0 A;  3K5M A;  2VQF K;  3ZT4 A;  4JV5 K;  4DSE A;  3M8Q A;  4LH4 A;  1X9M A;  2Q0R A;  3CJC A;  4JKA A;  4CD3 A;  5M1F A;  3E01 A;  5C2D A;  4WQ5 C;  3AA2 A;  3RMD A;  3TAR A;  4JRP A;  4B3R K;  2X6N A;  1TK0 A;  4H4O A;  2E20 A;  2PAV A;  4M45 A;  4KHQ A;  1JKH A;  2E6M A;  1SUQ A;  3HP9 A;  2IDO A;  3KLF A;  4BE2 A;  5BN9 A;  3Q7C A;  3W3D A;  3D45 A;  2XY5 A;  2WTU A;  2I7P A;  3QET A;  1BI4 B;  1YIJ N;  1RDB A;  4O4G A;  3MAQ A;  5KI6 A;  4H5R A;  4C8N A;  3WNF A;  3QLH A;  4CJ3 A;  1EET A;  1VQO N;  3G25 A;  1ESV A;  3OYG A;  2JLE A;  5BPM A;  4CJL A;  3HVT A;  3SUP A;  3CME N;  1U2V B;  2FLO A;  2W40 A;  3LP1 A;  4BRM A;  3FZL A;  1NNE A;  1SKW A;  3SUQ A;  4JKB A;  1KLM A;  2P5G A;  1BDG A;  4JI7 K;  1WSI A;  2HOE A;  1HX1 A;  1XMQ K;  4WE1 A;  1YT3 A;  2HBJ A;  3QIP A;  3LZJ A;  2HHU A;  4OJR A;  3U9Z A;  4FWM A;  4OGC A;  4CCH A;  4WQ4 C;  4JD2 B;  5AQS A;  1BI4 A;  3AAQ A;  1K8A O;  4BR4 A;  5HRR A;  3VET A;  3OYA A;  1IG9 A;  5FPN A;  3QBW A;  5IWA K;  4N5S A;  4K8Z A;  5KRT A;  3RMC A;  3IUC A;  3CCS N;  4E19 A;  2VWK A;  4BDY A;  3R9P A;  3H1V X;  1BA1 A;  4CHN A;  4MO5 A;  1VSH A;  1NGC A;  1U2V A;  1VRU A;  4OKK A;  4CEZ A;  3HPO A;  4CIF A;  4DSI A;  3H45 C;  4IJA A;  3VEY A;  4JKC A;  4W5N A;  3LWL A;  3C7N B;  4MFB A;  5AQT A;  3DMJ A;  3IMX A;  4KH5 A;  2ASP A;  4EZ9 A;  3FZK A;  3GBT A;  5CY4 A;  3QIC A;  1GLB G;  3PSF A;  4FWO A;  1JL2 A;  4JD2 A;  3DOL A;  1X3M A;  4DV3 K;  4BC3 A;  3H1Q A;  4HTU A;  2E5L K;  1NK6 A;  4IKF A;  1EQY A;  3AO2 A;  1DLO A;  1T6D A;  3F9M A;  5HLF A;  2ZE2 A;  1K73 O;  4DQR A;  2ZGY A;  4DSL A;  3FFK B;  1RCH A;  4CJK A;  1NGD A;  4HUG A;  3M1F A;  2ZJP L;  5AQU A;  5EY4 A;  5C25 A;  3DOK A;  4B3S K;  1SKR A;  2QK9 A;  3C7N A;  2IVN A;  3EKU A;  3AO3 A;  3O9T A;  3MN5 A;  3L2U A;  4LY7 A;  2A6A A;  3HL8 A;  3CM5 A;  1G99 A;  3M3Z A;  1E3M A;  3HBT A;  4FWL A;  3ZSY A;  3J81 O;  3PX4 A;  4GV6 A;  4E7K A;  1I94 K;  1C0F A;  3F5T A;  1BOT O;  4DV7 K;  1LCU A;  3VEV A;  3AVC A;  4CJS A;  3E9L A;  3PY8 A;  2DFE A;  4I7F A;  4KHP K;  1VQN N;  1VQ4 N;  1XC9 A;  1C1B A;  5LL6 Z;  1U47 A;  3L3V A;  1TV6 A;  2F7T A;  3ENB A;  1IKV A;  3THW B;  5CZ1 A;  1X9W A;  2QKK A;  3NMU A;  4B3T K;  4IFY A;  3DLR A;  4O8K A;  4CF8 A;  3IFR A;  1TUY A;  4FOE A;  3J80 O;  5BR8 K;  4ELT A;  1TVR A;  3R6M A;  2PYL A;  1GLJ O;  4CZI A;  1RDC A;  3HM8 A;  3OBY A;  4YOW A;  3O4N A;  4CJE A;  3JS6 A;  4OPH A;  2UUC K;  4DFP A;  1GLD G;  3D2F B;  3IKM A;  3TTF A;  4JLH A;  4B9L A;  4NLB A;  1VQ6 N;  3WXI A;  1YIT N;  3GL1 A;  4CZF A;  4W5T A;  2BDP A;  4DV1 K;  1KCF A;  1VSE A;  2YHW A;  4DR7 K;  3CQ8 A;  3THW A;  4CIE A;  1RDD A;  3C6U A;  4BRA A;  4H0X B;  4LF7 K;  2FXU A;  4FLV A;  1NK9 A;  4BE1 A;  4CE9 A;  1GLE G;  3EL2 A;  3DLL L;  4UQG A;  1KVA A;  1WNS A;  5HL7 L;  4Z4G A;  4CD1 A;  2OPQ A;  1BIS A;  3DYA A;  4QOZ B;  1TL3 A;  3VPZ A;  3VN5 A;  1A5X A;  4RW7 A;  1JL1 A;  3LM9 A;  4O8U A;  3V9Z A;  2QWN A;  1FKP A;  2NLX A;  2FC0 A;  3D2F A;  4C8M A;  4JI5 K;  1WAF A;  2ZD1 A;  2P9S B;  3VQ6 A;  2P9K A;  4OPJ A;  5AQJ A;  2D0C A;  4YOR A;  4IXC A;  1SL0 A;  3Q7B A;  2HBK A;  3SMS A;  1HYZ A;  4IWV A;  2ZGZ A;  5I42 A;  2VYP A;  3AVM A;  3HSC A;  1T7P A;  2O8F B;  3TAQ A;  4RWT A;  3LAK A;  3VQQ A;  3KK1 A;  4DFK A;  2GX9 A;  1C1C A;  1REV A;  5E41 A;  1J53 A;  4PL8 A;  2QWP A;  1XUP O;  3KWG A;  1JJ2 M;  3GE1 A;  1W97 L;  4KPY A;  4CVN E;  5KPR A;  1YJN N;  4Z4E A;  1Q18 A;  2P9S A;  1YTA A;  1Z6R A;  1ATN A;  3KWI A;  2UXC K;  4EP5 A;  5FLX O;  1U48 A;  2VG5 A;  4AHS A;  3R1X A;  1C0T A;  1N8R O;  1NGE A;  4J8F A;  4MDB A;  4DB3 A;  4CZM A;  1EWR A;  3ZSQ A;  2ZJQ L;  3QIO A;  3WT0 A;  2VCP A;  1FK9 A;  1U6Z A;  4XH5 A;  1B9D A;  3B6O A;  2QWL A;  5AQY A;  4H4M A;  4V19 S;  1SZ2 A;  5AFU A;  4NCB A;  1S1W A;  4CF1 A;  1ILY A;  1S72 N;  3NE6 A;  1O1W A;  1QHT A;  2H3G X;  1W2B M;  2G8W A;  2O8D B;  5C0Y A;  3BUZ B;  4IOC L;  1D5A A;  1UOC A;  4OX9 K;  2DFH A;  3BGR A;  3B6P A;  2NRR A;  4CJQ A;  4A57 A;  1BCO A;  4CED A;  1HMV A;  3KLE A;  1QSS A;  4DG1 A;  2RF2 A;  1ZBI A;  4E7J A;  1E4F T;  4FJK A;  4CZL A;  3QES A;  4CEE A;  3TWH A;  2CGK A;  4JKE A;  5CE3 A;  4DHY A;  5BRD A;  3BZK A;  2FF6 A;  1VSK A;  3L2R A;  3VQ8 A;  4IJN A;  1E4G T;  3SAG A;  2XY7 A;  2HVI A;  4CZK A;  3JYT A;  4ZTF A;  5C42 A;  5FRN A;  3DRS A;  1Q82 O;  4IO9 L;  4BRO A;  2HW3 A;  1RBV A;  3O9U A;  1HNW K;  1HKG A;  3ZSX A;  3L8B A;  1HQE A;  4O5F A;  1TGO A;  3KKS A;  4NXN K;  5LMU K;  2HB5 A;  4JS4 A;  1I3A A;  3A5L C;  2JGU A;  4DFM A;  1ZBU A;  4PA1 A;  3ZT0 A;  2W6L A;  3EO3 A;  2EWS A;  1SAZ A;  4CER A;  3CQX A;  3EE8 A;  2V52 B;  3M8R A;  4ISG A;  5JVG L;  3HTV A;  5I9E B;  2HMP A;  3WEE B;  2E1Y A;  2GUP A;  3GG4 A;  1UAX A;  4FWK A;  4FJJ A;  4KV8 A;  4KTZ A;  1UWB A;  3VTH A;  3PIO L;  3U4L A;  4IBN A;  4C1N I;  1HQU A;  3TTC A;  3RRH A;  3K9J A;  4JI4 K;  1RT7 A;  3SLC A;  3LWM A;  3QDK A;  3P83 D;  4F2S A;  3H3O B;  5DK5 A;  3O3G A;  1YAG A;  5BRF A;  2ATQ A;  3KJV A;  1K8K B;  3O1W A;  4IZ9 A;  3SQ4 A;  2A1R A;  3LDS A;  1KAY A;  4FLW A;  3RR7 A;  1JXE A;  4DKW A;  4Z94 A;  4DQQ A;  2D4W A;  2OZM A;  4C8L A;  1N5Y A;  4DUY K;  1A5V A;  1HKC A;  1S1T A;  3RVC A;  1C1A A;  4H5V A;  3GDQ A;  3O5B A;  4JYA K;  1RT2 A;  1WSJ A;  2VQE K;  3TAB A;  2A40 A;  3VGK A;  4WFA L;  1NG9 A;  3LDO A;  4FSV A;  1IG8 A;  3ATV A;  1J6Z A;  3K5O A;  4JKD A;  3THX A;  4XH4 A;  4IG3 A;  4BRC A;  3OS1 A;  4E7H A;  5AQG A;  3AO4 A;  5GAH P;  4FPB A;  3C6H A;  1WB9 A;  4JNE A;  4QS9 A;  4Y1C A;  3IRX A;  3C94 A;  3KK3 A;  1NK0 A;  1VSL A;  2P9I B;  1MDU B;  2FBY A;  4ELV A;  4CBX A;  4AQY K;  3A5N C;  4CEF A;  2O8B A;  1OKJ A;  1XHZ A;  1VSD A;  4DMN A;  1SL2 A;  2P51 A;  4CK3 A;  4AHV A;  4JKF A;  4A59 A;  4HCB A;  2Y1J A;  1QVG M;  1F21 A;  3G10 A;  1JLG A;  1S1U A;  1FKO A;  4N56 A;  4BGB A;  2D0P A;  4WQ5 A;  3MK6 A;  3I56 N;  3H6E A;  2W41 A;  5J2M A;  5BN8 A;  4ILG B;  2P9I A;  2FF3 B;  5F2R A;  1YXQ A;  4M7Y A;  3PV8 A;  4DR3 K;  3DWL A;  5JLH A;  2HBM A;  2HHV A;  1QHA A;  3CCE N;  5SZT A;  1BHL A;  4UY8 O;  4DSJ A;  3BF3 A;  4WYB A;  3UKR B;  4NYN A;  4HUF A;  3TAN A;  1BWF O;  3FLC O;  2IAJ A;  3DRR A;  3PO5 A;  3PLA A;  1GLL O;  1BCM A;  5GIN A;  4WF9 L;  4FWN A;  4K41 A;  1YJ9 N;  1JCG A;  4OLB A;  5CZ2 A;  5C15 A;  3CCM N;  4DV2 K;  3F9K A;  3VQ5 A;  3LP3 A;  3JXU A;  3M6G A;  3ALY A;  3P1G A;  1B9F A;  1YJW N;  1CXQ A;  4XH1 A;  2OA8 A;  3ZT1 A;  5KPT A;  4F4K A;  3RRG A;  3R8E A;  4IDH A;  3O3F A;  4B9S A;  3EZ5 A;  3AA5 X;  5E84 A;  4WQ4 A;  1NGG A;  4L8R B;  3NF9 A;  3CJ1 A;  4KI6 A;  3THV A;  4X62 K;  3LDQ A;  5KGX A;  4Z4I A;  4CFD A;  3SAF A;  3L2Q A;  4Z4F A;  4FJ5 A;  3HXM A;  1NGI A;  4IO8 A;  1Z05 A;  4B1V A;  1LAV A;  4DF4 A;  1Z25 A;  4EHT A;  3CD6 N;  3SUO A;  4FXD A;  3O3H A;  1NGF A;  2VWB A;  2OPP A;  3VES A;  2OYQ A;  1RT3 A;  5AR0 A;  1YVU A;  1RBR A;  3EY1 A;  2OPS A;  4PKG A;  2QWR A;  4K8X A;  4B1U B;  4E1M A;  1CZA N;  1ATR A;  3LL3 A;  1RT6 A;  3O9Q A;  1SV5 A;  4FJI A;  4DS4 A;  2O8E A;  4YOT A;  4DR6 K;  1Q9Y A;  5M1Q A;  1MA9 B;  4YY3 K;  3V81 A;  1EXQ A;  5FPD A;  1JCE A;  1S3X A;  3MEG A;  4BWM A;  4HTL A;  4E1J A;  4AHT A;  3CER A;  1HR0 K;  2FBV A;  2GV9 A;  3NF6 A;  3AVL A;  4H0T B;  4KHW A;  1JLB A;  4Q0B A;  2Z1H A;  3VEX A;  3OYH A;  4Y0W A;  3AY9 A;  5AQX A;  4PKI A;  4JKH A;  1OH8 A;  4KO0 A;  2A3Z A;  1WLJ A;  4RW6 A;  1BA0 A;  2RKI A;  3OBW A;  4B8C A;  3CC7 N;  2IGI A;  3QEX A;  5FRM A;  3WXM B;  5HOO A;  4CEC A;  3J7Z O;  4DTJ A;  3LZI A;  1RT1 A;  4JRQ A;  2IC3 A;  1EX4 A;  4CHY A;  1VAZ A;  4H03 B;  4Z4C A;  4N76 A;  3NAE A;  3FE1 A;  3VQD A;  5CHI A;  5FPE A;  3SNN A;  3ULD A;  4ID5 A;  3VF2 A;  1TAU A;  1NOY A;  4BR9 A;  4DTX A;  3THY B;  1IJJ A;  4KTW A;  4J2D A;  1Q81 O;  2G8V A;  3HPH A;  2YHA A;  5ADX H;  2RN2 A;  1U04 A;  4JN4 A;  4MO4 A;  2DPN A;  4DR1 K;  2V7Z A;  3RR8 A;  4FJG A;  3ISN C;  4LF8 K;  3A5O C;  1YF5 L;  3SPY A;  5A2Q O;  4AM7 A;  1DKG D;  1WN7 A;  3CG7 A;  4OPK A;  3VQP A;  5AQW A;  3L4Q A;  1NGH A;  1QS4 A;  4LC9 B;  5KPZ A;  1SKS A;  2QWQ A;  1MWM A;  5I3U A;  2IVP A;  4FZY A;  3CCV N;  3HP6 A;  3W0L A;  4BQZ A;  4HWI A;  2WOM A;  4H0V B;  2CH6 A;  1CZ9 A;  1QTM A;  3THY A;  4MLH A;  1TL1 A;  4PKH A;  3DLG A;  1IKY A;  4OVL A;  3H46 O;  3TSU A;  2DFF A;  2QA4 N;  3O8M A;  2QM1 A;  5AZI B;  4FLT A;  4I2Q A;  3OYE A;  1BIU A;  2Y1I A;  3E9O A;  2J4R A;  4U67 L;  1K6Y A;  2E8A A;  1RBT A;  4JKG A;  2IVO A;  3TR8 A;  4NCA A;  1FJG K;  2F8T A;  3VQ9 A;  3J7A P;  4KH4 A;  1WSE A;  2YKN A;  3ID8 A;  5JMV A;  4CFB A;  2IOC A;  3LDL A;  1NJX A;  3MWP A;  3AVN A;  2OPR A;  3WNH A;  2B6A A;  4CF9 A;  3S3N A;  3RMB A;  3KZB A;  3TAM A;  4BRP A;  4FJL A;  3CHW A;  1GOC A;  5EU7 A;  4BRN A;  2Z1I A;  5AZI A;  4IFV A;  3BY5 A;  1NBW A;  3JAM O;  3H08 A;  3MN7 A;  2B4J A;  1BUP A;  3NGY A;  1L3U A;  4B1W B;  1L3S A;  4CGJ A;  4IEE A;  3PO4 A;  3K0S A;  4EAH D;  4LSL A;  3CF5 L;  4FJX A;  3EEQ A;  4DQ8 A;  2XHB A;  4CEQ A;  5AQR A;  3ZX3 A;  2WC9 A;  4AHC A;  4E89 A;  1QSY A;  3V4I A;  5TKW A;  4BRQ A;  1VSF A;  3TI0 A;  4C8K A;  4M41 A;  3SUN A;  4JK8 A;  4EIA A;  3OHR A;  4H0O A;  2HVH A;  3OVN A;  3G6E N;  1BU6 O;  1TK5 A;  1SQK A;  2P9K B;  4NCG A;  5CR4 A;  3LAL A;  3OS0 A;  1VQM N;  4F9O A;  3KD5 E;  2Z1J A;  4KB1 A;  4GKK K;  4K0K K;  4BAC A;  3VGM A;  5LY3 A;  3TAG A;  4YOX A;  1I39 A;  2JWK A;  3VA0 A;  4XEI A;  4DSK A;  3QEI A;  4BQL A;  3CJA A;  1LWE A;  1OVQ A;  3ZT2 A;  3VOV A;  3TAF A;  3L4I A;  3DM2 A;  1RTD A;  1XNQ K;  1NK4 A;  3TTD A;  4CJ7 A;  1QQN A;  3CC4 N;  4A5B A;  4JI0 K;  3ZX2 A;  3DLH A;  3HT3 A;  4H5T A;  2P9N A;  2V51 B;  3K9K A;  1ASW A;  3T1A A;  2OTJ N;  1WUA A;  3VF4 A;  1VQ7 N;  4ISE A;  2HNZ A;  4GMJ B;  4FZX C;  3SV4 A;  3U8X A;  3U3Y A;  3QEP A;  1J5O A;  5F1X A;  2ASO A;  4OKJ A;  5DM6 L;  1X3N A;  1P90 A;  3SPZ A;  3DLE A;  4FOI A;  1Z26 A;  3NHG A;  3OYD A;  3TPQ A;  2P5O A;  3A2F A;  3MXJ A;  1HNX K;  2KFZ A;  3P5J A;  5AZJ B;  1Q8I A;  3ULE B;  4IOA L;  5M1P A;  4A2A A;  4JS5 A;  3MMV A;  5GIO A;  4KBO A;  1RT5 A;  4W5Q A;  1VRT A;  4CFA A;  2KZZ A;  5KQ8 A;  4LF5 K;  4JI1 K;  4CES A;  3HOT A;  4H5W A;  3MED A;  1N33 K;  5K14 A;  1J9A A;  4FM2 A;  4GV3 A;  4FJ9 A;  1IV0 A;  4OGE A;  3HYF A;  1HPZ A;  4I6M B;  3K57 A;  5H1S Q;  3NH2 A;  1RT4 A;  5AQH A;  2XY6 A;  1IH7 A;  3TAE A;  3T7Z A;  5GAE P;  3E1Y A;  4KHU A;  2NNW A;  1JLE A;  3CI5 A;  4LD0 A;  3AVJ A;  3F73 A;  5AZJ A;  4J2B A;  3ULE A;  4JK9 A;  1RNH A;  2YNF A;  4DV6 K;  3QNO A;  4FLZ A;  1QSL A;  3I8B A;  3ENH A;  4DR2 K;  2NRZ A;  2D5R A;  2UU9 K;  1VQL N;  4CZG A;  5BPN A;  4J2A A;  2IS3 A;  2ZF5 O;  1UA0 A;  1ZXO A;  4BVP A;  2YX6 A;  4I6M A;  1S1X A;  1M90 O;  4PQU A;  3IS9 A;  4H0P A;  4FWS A;  2E1Z A;  4BRL A;  3MN6 A;  3E66 A;  3AGR A;  3LP0 A;  1JLF A;  4DUZ K;  4FJ7 A;  1NWK A;  3VQE A;  4E0D A;  3NDK A;  3K2P A;  2G8K A;  4FW1 A;  3PSI A;  1NKB A;  1KQS M;  4BG8 A;  2ZWH A;  1LWF A;  4TSX A;  3R3L A;  3WUH A;  2UXD K;  1QQC A;  4FPA A;  3ZT3 A;  3LM2 A;  3SBG A;  3O08 A;  1Q86 O;  4KH6 A;  1RTI A;  1Q7Y O;  3L2W A;  3ZCM A;  5KRS A;  4LFA K;  2YHX A;  4F3O A;  3V9S A;  4WFN L;  3CC2 N;  4CGF A;  2KZM A;  2Q1N A;  4DU1 A;  4B9M A;  3U3G A;  2QW9 A;  1YUW A;  5BRH A;  3ZSV A;  1JLA A;  4Q5V A;  2BGG A;  1N6Q A;  3OYL A;  1QZ6 A;  3TAP A;  3LPU A;  4B9N A;  4BR7 A;  3HO1 A;  5J2N A;  2UXB K;  2WBN A;  1X9S A;  1OH6 A;  4JI8 K;  4A61 A;  1ITG A;  4NO7 A;  5CYM A;  2HBL A;  1BO5 O;  1RBS A;  3MWT A;  5F0X A;  2X74 A;  1NJW A;  4AHU A;  1KSP A;  4ZTJ A;  3NVM A;  3THX B;  3NFA A;  4CJT A;  4BG9 A;  3I55 N;  3L0Q A;  3AA4 A;  4E1N A;  2UUA K;  2F96 A;  4BRE A;  3MEE A;  4YOV A;  4EZ6 A;  4FO0 A;  2GBZ A;  1XMO K;  1XQS C;  5AQF A;  3SQ2 A;  4DR4 K;  4DTR A;  4JI3 K;  4CJ4 A;  4DS5 A;  3PIP L;  4BR2 A;  3QB0 A;  4U7B A;  3OYM A;  1CLQ A;  2RE2 A;  1ASU A;  3HST B;  4EHU A;  2O8B B;  5AQO A;  4YOU A;  2Q3S A;  3ZEU B;  4R79 A;  1VHX A;  3A0I X;  4WCE L;  2YV0 X;  1EKE A;  2QXL A;  5C2F A;  2O4I A;  2HHT A;  3CET A;  5BRE A;  4X65 K;  2VG6 A;  2VGN A;  3C65 A;  4M7X A;  4M3W A;  5HBM A;  3OYN A;  2PBD A;  4E7I A;  4FJ8 A;  3C0B A;  1QZ5 A;  3IDH A;  4B8A B;  5M1N A;  5AQI A;  3O4W A;  3MCA B;  1SS6 A;  1HJR A;  1IKW A;  2E4L A;  4CBW A;  1ZBF A;  4CGD A;  1TYQ B;  5T7B A;  1LWC A;  1V4S A;  4AM6 A;  4DQP A;  2BE2 A;  1J54 A;  5AFU H;  1NKE A;  3AA3 A;  3VEZ A;  3ZEU A;  4LF4 K;  3VQB A;  3IG1 A;  3VA3 A;  3MDQ A;  3NGZ A;  4OO1 J;  5DM7 L;  1OH7 A;  3VQC A;  1KC8 O;  3EYZ A;  4GVM A;  3VQ4 A;  3SK3 A;  3N4Q A;  1UA1 A;  2FSK A;  1HPM A;  4YDU C;  2O8C B;  5D3G A;  1KD1 O;  4RW9 A;  4B08 A;  5J1E A;  1TYQ A;  1N34 K;  3BF1 A;  4GV9 A;  5KQD A;  3CJ7 A;  4FVU A;  4DF8 A;  5KGW A;  2A5X A;  4FYD A;  3RWU A;  4AHR A;  2HF3 A;  1X1P A;  2G8U A;  3HVR A;  3UKU A;  1BGX T;  4JEP A;  4CK2 A;  2HMI A;  4B1Y B;  4KTQ A;  2Q97 A;  2KTQ A;  3AVI A;  1NGA A;  3P38 A;  3S9H A;  1TUU A;  4BGA A;  3OA9 A;  3T3F A;  4DQI A;  4PY5 A;  3QEV A;  3KK2 A;  2O8C A;  5CYQ A;  5MLC Q;  4CJ5 A;  3N4P A;  4KRE A;  2YCH A;  2ITG A;  5ADX A;  5AQV A;  4RW4 A;  3CXC M;  2PY5 A;  3EN9 A;  2ETJ A;  2PFU A;  4YHH K;  4AH9 A;  1ATS A;  1KAX A;  2YHY A;  1RFQ A;  1BIZ A;  2D0A A;  1GLC G;  2FSN A;  3NH1 A;  2E2P A;  4FLX A;  1S1V A;  3KKR A;  3D7E O;  5LJW A;  2NRX A;  3ENO A;  3NF8 A;  4PL7 A;  5JS1 A;  2O8E B;  4DLG A;  4FW2 A;  2KHO A;  2AJQ A;  1H1V A;  2EHG A;  2W42 A;  3LAN A;  5AQZ A;  3U9D A;  5GIP A;  3QFU A;  1IBM K;  4BC5 A;  2FBT A;  3CIP A;  3DRP A;  3G4S N;  4E3S A;  3VEW A;  1HYS A;  4CJU A;  4PHT X;  2Q36 A;  3UE5 A;  3OJS A;  1TK8 A;  4PWD A;  1BQM A;  2BAN A;  4MLE A;  1NLV A;  2W6K A;  3VQ7 A;  4FCY A;  3EKS A;  4DFJ A;  4HHT A;  1Y97 A;  3A8Y A;  5B8H A;  1B92 A;  4I9Q A;  1KFS A;  3VQA A;  4FWQ A;  4M3U A;  2QEX N;  5FPM A;  5C24 A;  2VG7 A;  1EO1 A;  3ZET A;  3CPE A;  1VK0 A;  3SAH A;  2YNG A;  1T6C A;  4DTP A;  4DR5 K;  3K58 A;  3O9S A;  1IO2 A;  3DAW A;  3A5M C;  2LSN A;  4CZJ A;  4FVM A;  3HZ6 A;  4H0Y B;  1KVB A;  3ZSW A;  3SI6 A;  4F8R A;  1XHX A;  2A41 A;  3ATU A;  2EX3 A;  4LFB K;  1S6Q A;  4IG0 A;  4BRD A;  2YI1 A;  3S41 A;  3OYI A;  4FJH A;  4LFC K;  3QER A;  5FDL A;  2E2O A;  3BZC A;  4CFC A;  1WBD A;  4QS7 A;  1QE1 A;  1IKX A;  2Z1G A;  3OJU A;  3SJH A;  1M1K O;  2HHQ A;  4CJW A;  4C23 A;  4C1N K;  4OLA A;  2UYT A;  3M8S A;  4FK2 A;  1GOA A;  2XY8 A;  4DCH A;  4JAX A;  5DMR A;  4KAZ A;  2YJE A;  3CFP A;  4LF6 K;  4O44 A;  3ZX0 A;  1WOQ A;  4CZH A;  4CEO A;  5AQK A;  4LSN A;  1NK8 A;  4DU4 A;  2X6S A;  4BRG A;  4Z4H A;  1K9M O;  4FJM A;  4N47 A;  2Q2R A;  1HLU A;  4KHY A;  3AVA A;  1XNR K;  2HHH K;  2F8S A;  3CCJ N;  2GEL A;  3D2E B;  2NRT A;  2DTU A;  1L5U A;  1X9J A;  2VWJ A;  3J8A A;  3I33 A;  3MCP A;  3MXM A;  1DEJ A;  3AAP A;  3O6W A;  4Y1D A;  4E7L A;  3KIO A;  4JKG B;  4RCH A;  3SQ0 A;  2QWM A;  2YNH A;  1JLC A;  2NUB A;  1N36 K;  4M3Z A;  1LV5 A;  3CJB A;  4CHZ A;  4O55 A;  4WFB L;  3SQ1 A;  1HJO A;  2XO7 A;  1NJI O;  2HNY A;  3KLG A;  2O4G A;  3ZSZ A;  3ID6 A;  3BDP A;  5KTQ A;  2YHB A;  4FL9 A;  3KTQ A;  1KVC A;  3D2E A;  2ITM A;  4CK1 A;  1U45 A;  5M1K A;  5AQM A;  1WAJ A;  2QWO A;  4CBU A;  3QEW A;  3WXK A;  3I0R A;  2OAN A;  2F4V K;  3FZH A;  3LDN A;  3TU5 A;  2NRW A;  3IAY A;  5ELZ A;  3RMA A;  3TSP A;  1S6P A;  2BTF A;  4I9L A;  3AAR A;  1T8E A;  1N32 K;  3NVK A;  4ILJ A;  1RBU A;  4X66 K;  2JWL A;  4IEI A;  2Q31 A;  2DY4 A;  1GLF O;  4MQ3 A;  4Z0U A;  1LOT B;  5JLF A;  3BP8 A;  1EP4 A;  4GNI A;  3QNN A;  4FM0 A;  3FZM A;  5BPL A;  3G0Z A;  3E9P A;  3K59 A;  4JI2 K;  4KKO A;  1D4X A;  1NGJ A;  5EVZ A;  3K5N A;  3P4I A;  1NMD A;  3DJC A;  4CJR A;  3KHY A;  5HRO A;  1Q9X A;  3D6R A;  1SL1 A;  1WSG A;  3ASM A;  3D0P A;  3HRG A;  2G8I A;  4CIG A;  3FZF A;  5HRP A;  4ZHR A;  5LJV A;  1HNZ K;  5AQQ A;  4BC2 A;  3NGI A;  1QVF M;  2RPI A;  4K25 A;  3VEN A;  1JLQ A;  1GOB A;  2QTD A;  1BQN A;  2P9N B;  1YVN A;  2KKZ A;  4H8K A;  4YFU A;  4KI4 A;  4BR5 A;  4RG8 A;  3SV3 A;  3GOI A;  4GY2 B;  3ITH A;  4BRK A;  4DTU A;  3QO9 A;  3V6D A;  5J2Q A;  4G9Z A;  3QBX A;  2QXF A;  1VQ8 N;  3AO5 A;  5JIC A;  2ZJR L;  3HJF A;  1XC3 A;  1Y64 A;  4R5P A;  2HHS A;  1WSH A;  5GAD P;  3FR0 A;  5EX5 A;  4DWI A;  1NJZ A;  4ELU A;  1JXB A;  1BG3 A;  4AIL C;  3MEC A;  3VF6 A;  2E2N A;  4O5B A;  4HVJ A;  2KFN A;  4YOY A;  1C0G A;  4NB4 A;  2NZT A;  4CF0 A;  4BY9 C;  3O9R A;  4DTS A;  3CCR N;  3AVH A;  4L3Q A;  4FLY A;  4DV4 K;  1T3V A;  4B9T A;  1NJY A;  4FLU A;  1NK5 A;  3T1Y K;  3VTI A;  4NXM K;  2ZM6 K;  2ZQB A;  3L6Q A;  3O4Q A;  2G8H A;  3SYZ A;  1YHQ N;  4JI6 K;  4CJV A;  3C6T A;  4DSF A;  4BWJ A;  4M3X A;  2P9U B;  4DV0 K;  1V4T A;  3LP2 A;  1NOZ A;  3CFR A;  2F9T A;  4GVE A;  4M3T A;  4G1Q A;  3AVB A;  1D9D A;  1VQK N;  1LAW A;  3P31 A;  1U49 A;  5FRO A;  3TSQ A;  3L3U A;  4A5A A;  4ICL A;  3CFO A;  3O1B A;  4NLC A;  3VEO A;  3DLB A;  4BDP A;  4B9Q A;  4DU3 A;  1VQP N;  4B9V A;  2WFB A;  3L2V A;  1TAQ A;  4M63 C;  4FJN A;  1J5E K;  3SCX A;  4M3R A;  4O0J A;  4B3M K;  3OYJ A;  4NYF A;  2P9P B;  1S9E A;  1HRH A;  4KHN A;  4KFB A;  4RTF D;  4K42 A;  2P9U A;  4B9U A;  4KB0 A;  1EWQ A;  3V9U A;  2GTD A;  1T44 A;  1OH5 A;  2OCE A;  1S22 A;  5C12 A;  3MN9 A;  4B1X B;  5EXW A;  2RHK A;  3SZ2 A;  2GUI A;  1HUX A;  5AJ3 K;  3H3N O;  1W9H A;  3HM9 A;  1YTU A;  3FGU A;  3DI6 A;  3NCI A;  2O8F A;  3PUF A;  1P8Z A;  1L3T A;  3T69 A;  5IT9 O;  2KQ2 A;  2E88 A;  3CM6 A;  4N41 A;  3HOS A;  2B5J A;  3DXM B;  1G15 A;  3HK2 A;  5J2P A;  3V1O A;  2E6L A;  3V1Q A;  2P9L B;  2F9W A;  1A5W A;  3KLH A;  3DXK B;  2P9P A;  2VGM A;  4HUE A;  1ZBH A;  3AGK A;  3P39 A;  2GWK A;  4BRF A;  4F3T A;  4QS8 A;  4GKJ K;  3J7Y P;  1VQ5 N;  4CHP A;  5AQL A;  4O0I A;  1KRP A;  1RTJ A;  2HHX A;  1R59 O;  1DTQ A;  3S3M A;  1C6V A;  4M42 A;  2AP1 A;  4OKE A;  3SMP A;  3PX0 A;  1S5J A;  3FFI A;  1T05 A;  3CYM A;  4X64 K;  4W5R A;  3AV9 A;  5JS2 A;  4XIU A;  3DXM A;  1WBB A;  2AA4 A;  3OYB A;  3ZSO A;  5LMN K;  3ZSR A;  4BRH A;  3F2K A;  2NRH A;  3WXJ A;  2P9L A;  1IBK K;  3VGL A;  4DTM A;  2D0O A;  3KVG A;  3DXK A;  4BR0 A;  3OYK A;  3I8D A;  1FW6 A;  2PZS A;  3WQU A;  2QKB A;  2CGJ A;  2P1J A;  4A62 A;  1KLN A;  3LPT A;  2E2Q A;  1YI2 N;  4CZE A;  1VQ9 N;  4HCC A;  4RW8 A;  3T19 A;  2GWJ A;  2O8D A;  4YDU A;  2YKM A;  1KFD A;  3S3O A;  1NMN A;  2I5J A;  3ZLJ A;  1RDA A;  3KD1 E;  2Q0U A;  3WNG A;  4IOX A;  1D9F A;  3VMF B;  4ILH A;  4ID1 A;  1WSF A;  1MU2 A;  4F2R A;  4FWR A;  3RSE B;  4ISF A;  4DTN A;  2HND A;  5HRN A;  1XWL A;  5JVH L;  3B8A X;  2A1S A;  1LW2 A;  3NH0 A;  4CEB A;  2HST A;  1KXP A;  1QQO A;  3OS2 A;  4DLE A;  5HRS A;  5C10 A;  3C95 A;  4CGG A;  4BE0 A;  4DTO A;  2CH5 A;  3WNE A;  4EP4 A;  3C6A A;  1HKB A;  4EFH A;  2X78 A;  4C8O A;  2YJF A;  2OZS A;  3NBP A;  3G71 N;  1MWK A;  4LH5 A;  3SBT A;  4H5N A;  4KHS A;  4JK7 A;  3QML A;  1TKX A;  4W5O A;  2A42 A;  3K5L A;  1CXU A;  1NU0 A;  1NK7 A;  5SWM A;  4CI6 A;  4CJF A;  2BUP A;  4CEA A;  5BR9 A;  4J2E A;  1C0U A;  3ZYY X;  4BVO A;  3CCL N;  3WQT A;  3RSE A;  3M8P A;  4QAG A;  4K43 A;  4OPA A;  4CJP A;  3WEE A;  1D8Y A; 
#chains in the Genus database with same CATH homology
 3AVN A;  2OPR A;  3WNH A;  5C24 A;  2VG7 A;  2B6A A;  4CF9 A;  3S3N A;  3RMB A;  1VK0 A;  3TAM A;  3HPG A;  4FJL A;  3ZSQ A;  2YNG A;  4DTP A;  1GOC A;  5EU7 A;  3QIO A;  3K58 A;  4FZZ A;  4GW6 A;  1IO2 A;  1FXX A;  4I2P A;  2Z1I A;  1FK9 A;  2LSN A;  4CF2 A;  4FVM A;  1DTT A;  4IFV A;  1B9D A;  1KVB A;  3B6O A;  3ZSW A;  1XHX A;  3SI6 A;  4F8R A;  4M3Y A;  4FK4 A;  3H08 A;  2EX3 A;  4H4M A;  2B4J A;  1S6Q A;  3KLI A;  4NCB A;  3V9X A;  1S1W A;  4IG0 A;  4CF1 A;  3AVG A;  3NGY A;  1ZYQ A;  1L3U A;  3OYI A;  3NE6 A;  4FJH A;  1L3S A;  1O1W A;  1QHT A;  4CGJ A;  3QER A;  1XI1 A;  5FDL A;  2G8W A;  3PO4 A;  3I0S A;  4CFC A;  1D5A A;  1QE1 A;  1IKX A;  1UOC A;  2Z1G A;  1CZB A;  4LSL A;  2DFH A;  3BGR A;  3OJU A;  4FJX A;  3B6P A;  2XHB A;  4FM1 A;  4CEQ A;  4IDK A;  4CJQ A;  1W0H A;  1BCO A;  4CED A;  1HMV A;  2D0B A;  4CGH A;  4CJW A;  3KLE A;  2HHQ A;  4AHC A;  4E89 A;  1QSY A;  1QSS A;  3UIQ A;  3M8S A;  4FK2 A;  4OLA A;  4DG1 A;  1GOA A;  2RF2 A;  3V4I A;  2XY8 A;  4E7J A;  1ZBI A;  4FJK A;  3QES A;  1VSF A;  4CEE A;  3TWH A;  1S9G A;  5DMR A;  3TI0 A;  4C8K A;  4M41 A;  3SUN A;  4CGI A;  4CHQ A;  2HVH A;  3OVN A;  4KAZ A;  3CFP A;  4O44 A;  1VSK A;  1TK5 A;  1NKC A;  3MXI A;  4NCG A;  3LAL A;  3L2R A;  3VQ8 A;  4CEO A;  3OS0 A;  4KB1 A;  3KD5 E;  2Z1J A;  4LSN A;  1NK8 A;  3AVF A;  2XY7 A;  2G8F A;  1VSM A;  1L3V A;  3AO1 A;  4DU4 A;  2X6S A;  4BAC A;  4Z4H A;  3PX6 A;  2HVI A;  3TAG A;  1TKD A;  1I39 A;  3JYT A;  4ZTF A;  4FJM A;  3VA0 A;  5C42 A;  4N47 A;  5FRN A;  3LAM A;  3DRS A;  3OY9 A;  3JSM A;  4DSK A;  3QEI A;  2HHW A;  2HW3 A;  4KHY A;  3AVA A;  1RBV A;  1TKT A;  1LWE A;  3QIN A;  3ZT2 A;  3ZSX A;  3L8B A;  1KTQ A;  2F8S A;  3TAF A;  1HQE A;  2XRI A;  3DM2 A;  1ZBL A;  1RTD A;  1NK4 A;  2DTU A;  1L5U A;  1TGO A;  3KKS A;  3AVK A;  2VWJ A;  3V1R A;  3DLH A;  3HT3 A;  2HB5 A;  4JS4 A;  1I3A A;  1ASW A;  2JGU A;  3T1A A;  1ZBU A;  4DFM A;  5HP1 A;  3MXM A;  4DSI A;  4PA1 A;  4Y1D A;  3ZT0 A;  4E7L A;  4B3O A;  3KIO A;  3V9W A;  3SQ0 A;  4CER A;  2HNZ A;  2YNH A;  4GMJ B;  1U4B A;  1JLC A;  2NUB A;  3SV4 A;  4FZX C;  1HYV A;  3U3Y A;  4M3Z A;  1LV5 A;  4CHZ A;  3M8R A;  4O55 A;  3SQ1 A;  2YNI A;  3QEP A;  1UAX A;  2XO7 A;  1J5O A;  2HNY A;  3KLG A;  4OKJ A;  2O4G A;  2R7Y A;  3SPZ A;  4KV8 A;  3ZSZ A;  4FJJ A;  4KTZ A;  1UWB A;  3SJJ A;  3DLE A;  4IBN A;  1R0A A;  1VSJ A;  1BL3 A;  3BDP A;  1HQU A;  5KTQ A;  3RRH A;  3OYC A;  3LWM A;  1RT7 A;  1HNV A;  1Z26 A;  2FBX A;  2YHB A;  3NHG A;  3OYD A;  3P83 D;  2P5O A;  4F2S A;  1RTH A;  3A2F A;  3MXJ A;  5DK5 A;  3O3G A;  3KTQ A;  1RIL A;  1KVC A;  2KFZ A;  3P5J A;  2ATQ A;  4CHO A;  3KJV A;  4CK1 A;  1Q8I A;  1U45 A;  4PUO A;  3SQ4 A;  2A1R A;  1WAJ A;  3LDS A;  3U6F A;  4JS5 A;  1VSI A;  3QEW A;  4FLW A;  3I0R A;  1JXE A;  3RR7 A;  1RT5 A;  3NF7 A;  4W5Q A;  1VRT A;  4CFA A;  3IAY A;  2KZZ A;  3RMA A;  4BDZ A;  4DQQ A;  2OZM A;  4CES A;  1S6P A;  2WON A;  4C8L A;  3MED A;  4FK0 A;  5K14 A;  1J9A A;  4FM2 A;  1N5Y A;  1T03 A;  4I9L A;  4FJ9 A;  1C0M A;  1T8E A;  1A5V A;  4DQS A;  1S1T A;  1C1A A;  4OGE A;  3HYF A;  1HPZ A;  1RBU A;  3RTV A;  3K57 A;  2KW4 A;  1HNI A;  1RT2 A;  1WSJ A;  3OYF A;  3TAB A;  2DY4 A;  4YNQ A;  4MQ3 A;  1ASV A;  4Z0U A;  3NH2 A;  3DLK A;  1RT4 A;  2XY6 A;  1TKZ A;  1IH7 A;  3TAE A;  1EP4 A;  2PYJ A;  3QNN A;  4FM0 A;  4KRF A;  3K5O A;  3G0Z A;  3K59 A;  4KHU A;  1JLE A;  1LW0 A;  3K5M A;  4LD0 A;  4IG3 A;  3OS1 A;  3AVJ A;  3F73 A;  3ZT4 A;  4E7H A;  4KKO A;  4J2B A;  1RNH A;  2YNF A;  4DSE A;  3AO4 A;  3M8Q A;  4LH4 A;  1X9M A;  3QNO A;  3K5N A;  4FLZ A;  1QSL A;  4Y1C A;  3E01 A;  2D5R A;  3IRX A;  3C94 A;  4CJR A;  3KK3 A;  3AA2 A;  3RMD A;  5HRO A;  3TAR A;  1NK0 A;  1VSL A;  4JRP A;  2X6N A;  1TK0 A;  1Q9X A;  4QCL A;  1SL1 A;  4H4O A;  4J2A A;  4M45 A;  2IS3 A;  2FBY A;  1JKH A;  1WSG A;  2E6M A;  4KHQ A;  1UA0 A;  4ELV A;  3ASM A;  4CEF A;  3D0P A;  1S1X A;  1SUQ A;  2G8I A;  4CIG A;  3HP9 A;  2IDO A;  5HRP A;  4ZHR A;  3KLF A;  4BE2 A;  4PQU A;  3NGI A;  3IS9 A;  2RPI A;  1JLQ A;  1GOB A;  1BQN A;  4H8K A;  4YFU A;  3D45 A;  4KI4 A;  2XY5 A;  1XHZ A;  1VSD A;  1JLF A;  3LP0 A;  4RG8 A;  4DMN A;  1BI4 B;  3SV3 A;  3QET A;  1SL2 A;  4FJ7 A;  3VQE A;  2P51 A;  1RDB A;  4O4G A;  4AHV A;  4CK3 A;  4E0D A;  4HCB A;  3MAQ A;  3NDK A;  2Y1J A;  3K2P A;  2G8K A;  1F21 A;  3ITH A;  4FW1 A;  5KI6 A;  3G10 A;  4C8N A;  3WNF A;  1JLG A;  3QO9 A;  3QLH A;  4DTU A;  1S1U A;  3V6D A;  1NKB A;  1FKO A;  4CJ3 A;  4N56 A;  5J2Q A;  2QXF A;  1EET A;  1LWF A;  3AO5 A;  4TSX A;  3OYG A;  2JLE A;  3HJF A;  4CJL A;  4R5P A;  3HVT A;  5J2M A;  1QQC A;  3SUP A;  3ZT3 A;  2HHS A;  3LP1 A;  1WSH A;  1SKW A;  3SUQ A;  1RTI A;  3PV8 A;  1KLM A;  2P5G A;  1NJZ A;  4DWI A;  1WSI A;  1JXB A;  3L2W A;  4ELU A;  2HHV A;  3ZCM A;  3MEC A;  5KRS A;  4AIL C;  5SZT A;  1BHL A;  4F3O A;  4O5B A;  4WE1 A;  4HVJ A;  1YT3 A;  2KFN A;  3V9S A;  4CGF A;  2KZM A;  4DSJ A;  3QIP A;  3LZJ A;  2HHU A;  4OJR A;  4HUF A;  4NYN A;  4CF0 A;  3U3G A;  4DU1 A;  3TAN A;  4B9M A;  4OGC A;  4CCH A;  2IAJ A;  3DRR A;  3PO5 A;  1BI4 A;  3ZSV A;  1JLA A;  4Q5V A;  1BCM A;  4DTS A;  2BGG A;  3AVH A;  5HRR A;  1N6Q A;  3OYA A;  4FLY A;  3OYL A;  1IG9 A;  3TAP A;  3LPU A;  4B9N A;  4OLB A;  4B9T A;  1NJY A;  4N5S A;  5CZ2 A;  5KRT A;  4FLU A;  4K8Z A;  3HO1 A;  1NK5 A;  5J2N A;  3RMC A;  3F9K A;  3VQ5 A;  4E19 A;  2VWK A;  4BDY A;  1X9S A;  3LP3 A;  2ZQB A;  2G8H A;  3O4Q A;  1ITG A;  4CHN A;  3ALY A;  1VRU A;  1VSH A;  1B9F A;  3P1G A;  1RBS A;  4OKK A;  1CXQ A;  2X74 A;  5CYM A;  4CEZ A;  4CIF A;  3HPO A;  4AHU A;  1NJW A;  1KSP A;  4CJV A;  3C6T A;  4ZTJ A;  2OA8 A;  3ZT1 A;  3NFA A;  4DSF A;  4BWJ A;  4F4K A;  4CJT A;  3LWL A;  4M3X A;  4W5N A;  4E1N A;  3AA4 A;  4MFB A;  3DMJ A;  3RRG A;  3O3F A;  4B9S A;  2F96 A;  3LP2 A;  1NOZ A;  3CFR A;  3EZ5 A;  3MEE A;  3AA5 X;  4EZ9 A;  4EZ6 A;  4M3T A;  2GBZ A;  5CY4 A;  4G1Q A;  3AVB A;  1D9D A;  1LAW A;  4L8R B;  3NF9 A;  3SQ2 A;  1U49 A;  5FRO A;  4DTR A;  3L3U A;  1JL2 A;  4KI6 A;  3DOL A;  3THV A;  4ICL A;  3CFO A;  4CJ4 A;  3DLB A;  4BDP A;  4DS5 A;  4DU3 A;  5KGX A;  4B9V A;  4Z4I A;  4CFD A;  3L2V A;  4HTU A;  3L2Q A;  1TAQ A;  3OYM A;  1NK6 A;  4Z4F A;  4IKF A;  3AO2 A;  4FJN A;  1CLQ A;  1DLO A;  4FJ5 A;  3HXM A;  5HLF A;  2ZE2 A;  1ASU A;  3HST B;  4DQR A;  4DSL A;  1LAV A;  2Q3S A;  4DF4 A;  1RCH A;  1Z25 A;  4O0J A;  4M3R A;  4CJK A;  3SCX A;  3OYJ A;  4HUG A;  3SUO A;  2YV0 X;  1EKE A;  4NYF A;  4FXD A;  3O3H A;  2O4I A;  2HHT A;  5C25 A;  1S9E A;  3DOK A;  1HRH A;  4KHN A;  1SKR A;  4KFB A;  2OPP A;  2QK9 A;  4B9U A;  4KB0 A;  2VG6 A;  2OYQ A;  4M3W A;  1RT3 A;  5HBM A;  3OYN A;  1YVU A;  3V9U A;  4E7I A;  3AO3 A;  4FJ8 A;  1RBR A;  3EY1 A;  2OPS A;  4K8X A;  4E1M A;  4B8A B;  3L2U A;  3SZ2 A;  2GUI A;  1RT6 A;  4LY7 A;  3HL8 A;  3CM5 A;  1HJR A;  1IKW A;  1SV5 A;  2E4L A;  3ZSY A;  4FJI A;  4DS4 A;  3PX4 A;  1W9H A;  3HM9 A;  4E7K A;  1YTU A;  3DI6 A;  3NCI A;  1Q9Y A;  3PUF A;  1ZBF A;  4CGD A;  1L3T A;  2KQ2 A;  3V81 A;  5T7B A;  1EXQ A;  1LWC A;  3AVC A;  3CM6 A;  4CJS A;  4DQP A;  4N41 A;  2BE2 A;  2B5J A;  1J54 A;  3PY8 A;  2DFE A;  1G15 A;  3MEG A;  4BWM A;  1NKE A;  3AA3 A;  4I7F A;  3HK2 A;  4AHT A;  2FBV A;  2GV9 A;  3NF6 A;  5J2P A;  3AVL A;  2E6L A;  3V1O A;  3V1Q A;  3VQB A;  1C1B A;  1XC9 A;  1U47 A;  1A5W A;  1TV6 A;  3IG1 A;  3L3V A;  3VA3 A;  3KLH A;  3NGZ A;  1IKV A;  1X9W A;  1JLB A;  5CZ1 A;  4KHW A;  4Q0B A;  2QKK A;  4HUE A;  2Z1H A;  1ZBH A;  4IFY A;  3OYH A;  3DLR A;  3VQC A;  4CF8 A;  4F3T A;  3EYZ A;  4CHP A;  4GVM A;  3VQ4 A;  4O0I A;  1KRP A;  4ELT A;  1RTJ A;  1UA1 A;  1TVR A;  2PYL A;  2HHX A;  1DTQ A;  1RDC A;  3S3M A;  1C6V A;  4KO0 A;  4M42 A;  1WLJ A;  5D3G A;  4RW6 A;  4B8C A;  2RKI A;  4RW9 A;  4OKE A;  2IGI A;  3QEX A;  5FRM A;  3PX0 A;  1S5J A;  3FFI A;  3O4N A;  4B08 A;  4CJE A;  1T05 A;  3CYM A;  4CEC A;  4DTJ A;  5J1E A;  4W5R A;  3AV9 A;  1RT1 A;  3LZI A;  4JRQ A;  5JS2 A;  4XIU A;  2IC3 A;  4DFP A;  1EX4 A;  4CHY A;  4JLH A;  4B9L A;  4Z4C A;  3OYB A;  5KGW A;  4DF8 A;  3ZSO A;  3NAE A;  4N76 A;  4FYD A;  3ZSR A;  3VQD A;  3RWU A;  4AHR A;  1X1P A;  4W5T A;  3ULD A;  4DTM A;  3SNN A;  4ID5 A;  2G8U A;  2BDP A;  1KCF A;  1VSE A;  1TAU A;  3HVR A;  3CQ8 A;  2PZS A;  3OYK A;  1BGX T;  4CIE A;  3I8D A;  4DTX A;  1NOY A;  2QKB A;  2P1J A;  1RDD A;  4KTW A;  4J2D A;  4CK2 A;  2HMI A;  1KLN A;  2G8V A;  3C6U A;  3HPH A;  3LPT A;  4KTQ A;  2KTQ A;  3AVI A;  2YHA A;  4HCC A;  4RW8 A;  2RN2 A;  3T19 A;  1U04 A;  3S9H A;  4FLV A;  1NK9 A;  2YKM A;  1KFD A;  4BE1 A;  3S3O A;  3T3F A;  4CE9 A;  3RR8 A;  4FJG A;  4DQI A;  4PY5 A;  3QEV A;  2I5J A;  3ISN C;  3KK2 A;  1RDA A;  5CYQ A;  4CJ5 A;  3KD1 E;  4KRE A;  4UQG A;  3SPY A;  2ITG A;  1KVA A;  1WNS A;  4Z4G A;  4RW4 A;  2OPQ A;  1BIS A;  2PY5 A;  1WN7 A;  3CG7 A;  3DYA A;  4QOZ B;  1TL3 A;  3WNG A;  2ETJ A;  3VQP A;  1A5X A;  4RW7 A;  3VN5 A;  1JL1 A;  4OPK A;  3V9Z A;  4AH9 A;  1FKP A;  1QS4 A;  1D9F A;  1SKS A;  2FC0 A;  4C8M A;  3SYZ A;  1BIZ A;  2D0A A;  1WAF A;  2ZD1 A;  4ID1 A;  5I3U A;  1WSF A;  3VQ6 A;  4FZY A;  4OPJ A;  3NH1 A;  3HP6 A;  1MU2 A;  2D0C A;  4F2R A;  1SL0 A;  4FLX A;  1S1V A;  2WOM A;  4DTN A;  2HND A;  5HRN A;  1XWL A;  1HYZ A;  3KKR A;  1CZ9 A;  1QTM A;  2A1S A;  1LW2 A;  5I42 A;  3NH0 A;  4CEB A;  3NF8 A;  5JS1 A;  4DLG A;  3AVM A;  1TL1 A;  1T7P A;  4FW2 A;  3OS2 A;  4DLE A;  3TAQ A;  5HRS A;  2AJQ A;  2EHG A;  3DLG A;  1IKY A;  3LAK A;  3C95 A;  4OVL A;  4CGG A;  2W42 A;  3VQQ A;  3LAN A;  3KK1 A;  4BE0 A;  2DFF A;  4DTO A;  4DFK A;  3WNE A;  4EP4 A;  1C1C A;  1REV A;  5E41 A;  4FLT A;  1J53 A;  2X78 A;  2FBT A;  4C8O A;  2OZS A;  3DRP A;  3NBP A;  4E3S A;  1HYS A;  4I2Q A;  3OYE A;  4LH5 A;  1BIU A;  2Y1I A;  4CJU A;  4KHS A;  1TKX A;  1K6Y A;  4W5O A;  3OJS A;  3K5L A;  1TK8 A;  4KPY A;  1CXU A;  4PWD A;  1BQM A;  1RBT A;  2BAN A;  4Z4E A;  1NK7 A;  3VQ7 A;  5SWM A;  1YTA A;  4FCY A;  4CJF A;  3TR8 A;  4CEA A;  4EP5 A;  4NCA A;  1U48 A;  4J2E A;  1C0U A;  4DFJ A;  2VG5 A;  4HHT A;  4AHS A;  1Y97 A;  2F8T A;  3VQ9 A;  1C0T A;  1B92 A;  3M8P A;  4QAG A;  4CJP A;  1KFS A;  1WSE A;  2YKN A;  3VQA A;  4I9Q A;  4M3U A;  4CFB A;  2IOC A;  1NJX A;  1D8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...