1ILYA

Solution structure of ribosomal protein l18 of thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
RLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGGLEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBOSOMAL PROTEIN L18
publication title The solution structure of ribosomal protein L18 from Thermus thermophilus reveals a conserved RNA-binding fold.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Rna binding protein
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2001-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1ilyA00
1Q82O 5JVGL 5JVHL 1VQ6N 3CCSN 1VQMN 2ZJQL 2OTJN 3CC7N 1VQPN 4UY8O 3OW2M 1YJ9N 1NJIO 1KQSM 3I55N 4U67L 5GAEP 3CCUN 3CCQN 3CMEN 3CCLN 3CF5L 1JJ2M 1ILYA 3CXCM 1YIJN 2QA4N 1YJWN 4IO9L 1Q7YO 5DM6L 1M1KO 1OVYA 5DM7L 3CCRN 5GADP 1VQLN 5HL7L 1VQ5N 1QVFM 3CCJN 3G71N 1M90O 1VQ8N 2OTLN 1S72N 4WFBL 5H1SQ 5GAGP 1Q81O 3CD6N 3CPWM 3DLLL 3CMAN 1VQNN 2QEXN 3CCEN 1VQON 3PIOL 1YITN 1YHQN 3G4SN 3CCVN 3CCMN 1QVGM 1N8RO 3I56N 4WCEL 1KC8O 1VQ4N 3G6EN 1K9MO 4WFNL 1K73O 3PIPL 1K8AO 2ZJPL 4IOCL 1Q86O 4WFAL 2ZJRL 3CC4N 4IOAL 1W2BM 3J7ZO 1VQ7N 1YI2N 5MLCQ 1VQKN 1YJNN 1VQ9N 1KD1O 4WF9L 3CC2N 5GAHP
chains in the Genus database with same CATH superfamily
4XEIA 1OH5A 2HHXA 5AQZA 2IVOA 3QMLA 1VAZA 3AVAA 1X1PA 3CJBA 5AQLA 1KLNA 4QS7A 4CJUA 3S3MA 1RNHA 1L3UA 3RR7A 4M3WA 3I55N 4B9MA 3ULDA 5LMUK 1J5EK 3CCQN 3H1VX 4CBXA 3CCLN 4W5QA 1BUPA 3BDPA 3SYZA 3FFKB 3RMBA 4LF7K 1CXQA 4FWPA 3L2WA 3WXIA 5BREA 4I7FA 4NO7A 2XO7A 3QNOA 3IKMA 4IDKA 3WNEA 3P1GA 4H4MA 3DI6A 1Q7YO 3AARA 4OPHA 2LSNA 5BR9A 3KWGA 4KREA 4BRPA 3V81A 4MO5A 3OYLA 2JGUA 3DAWA 3VQDA 4FWOA 4M41A 3GBTA 3J8AA 1ATRA 4CGJA 1LAWA 1CZBA 5I9EB 2G8VA 4AHSA 4OGEA 3KD5E 4KHWA 4XH4A 1Q81O 3MEEA 3B6PA 1JLFA 3O9SA 1XC9A 3SJJA 3SLCA 4JLHA 3M8PA 5CYMA 2QWNA 2X6SA 4CE9A 3KJVA 2VG5A 4B9SA 2GTDA 3AO1A 4CZMA 3R3LA 3EEQA 1CZ9A 3ZEUA 2Q0RA 5CY4A 3I56N 2QWQA 1HYSA 3E66A 3P31A 2XY8A 3AA4A 4I9QA 3RMAA 4FJ7A 3ZETB 4CJ7A 1TV6A 3OBYA 4BR2A 3D7EO 1JLBA 2F4VK 1YTAA 4XH5A 2IS3A 3VQ7A 4IOAL 4B3SK 1HJOA 2W41A 5AZJA 4BE1A 1GLLO 5BRDA 4BG9A 3A5MC 1KVAA 4HTUA 3K5OA 3ZSVA 5AZJB 2I5JA 4KHQA 1TYQA 3M6GA 4H5VA 2DFHA 3FZLA 5AQFA 4CZJA 4FM1A 1JCFA 3NH2A 1KAYA 4C1NK 4AILC 4CESA 1SL2A 4BY9C 4CW7B 4F2RA 5LJWA 3C7NB 3WNGA 1P90A 5F2RA 4IG0A 4CEQA 3FZKA 2DFFA 1K6YA 3OYJA 4FLVA 3A2FA 4FVMA 3MXIA 4DQPA 3T1AA 4BWMA 4F9OA 4M45A 4NCBA 1YVUA 2XY7A 3AA2A 1ZC6A 2YNIA 3LANA 1HNIA 5AQQA 3V1QA 4KTQA 4RG8A 4JI1K 4JKAA 3OA9A 3S41A 3TTFA 4Z4FA 5HP1A 3KLIA 4DQIA 4LY7A 3L2UA 1K8KB 1GLEG 5DK5A 1S72N 4BC2A 2QXFA 4A57A 1HPMA 4Z4IA 3TAQA 3SMSA 3U9DA 3DM2A 1QS4A 3QEVA 4ZTJA 3FLCO 3RRHA 2E5LK 3P38A 2F96A 2QTDA 3MN5A 3SPYA 2KW4A 3HO1A 2QWOA 4U7BA 3QEIA 3SQ1A 1OH7A 4PL7A 1SKWA 2PBDA 3CJ9A 2G8KA 3PSFA 5BRFA 2HW3A 2FSJA 5KRSA 4ISFA 2NRXA 1C1CA 4EHUA 1VQ4N 2E4LA 3G6EN 3F5TA 4M3UA 3QIPA 3SPZA 1U2VB 3VGMA 3MWPA 4FJLA 3NVMA 4FLWA 1NOYA 3HI0A 2FXUA 4H0PA 5ADXA 4BACA 4DS4A 4CEZA 1BQNA 4AHTA 4E1MA 3OVNA 5MLCQ 2UUCK 4BRGA 4CHZA 3U3GA 3PY8A 4DV0K 4JI3K 1RBSA 2ZGYA 4A59A 5JLHA 3DXKA 4GW6A 3H45C 1S22A 5JMVA 1Y64A 4E1JA 2QWLA 4DR3K 1LAVA 1YT3A 3CI5A 2X78A 2G8IA 3PX4A 1QSYA 4BRNA 4G1QA 3R9PA 1NMDA 3AGKA 4MO4A 4PUOA 3OYBA 3FFIA 3EKUA 2Q3SA 2O8CB 1NK5A 2ASMA 1VK0A 1YAGA 2QM1A 3ATVA 2ATQA 1JXBA 4M7XA 1RTJA 3DYAA 3CYMA 4Y0WA 4DMNA 3J7AP 2YKNA 2ITGA 2X6NA 5ADXH 5ELZA 3OJSA 2O4IA 1F21A 1O13A 3ZSOA 2O8DA 4BGBA 1ATNA 4CFAA 3CCJN 4CZGA 4DV7K 3ISNC 1UAXA 3GG4A 5F0XA 1QHAA 3NH1A 5CR4A 4BQZA 4K25A 1WSGA 2QXLA 4HUEA 5KPRA 3HT3A 1WSJA 2QI2A 3LAKA 2IC3A 1NGIA 3VF6A 4CJLA 3QFUA 5KTQA 1JKHA 1VQON 2OZSA 5AQXA 3ZSQA 2KFNA 2PAVA 4W5NA 4CK2A 3GE1A 1TUYA 3HL8A 4DFMA 3L0QA 2JWLA 5JS1A 5B8HA 3RWUA 3KTQA 4DTOA 3F2KA 1EO1A 3S3OA 2E2PA 4KH5A 4AQYK 3PIPL 4KHSA 3VF2A 4FJIA 1QZ6A 5C24A 4YY3K 4O8KA 2E8AA 2P9KA 1NGFA 4GMJB 2YNFA 4LF5K 1QZ5A 1VHXA 2P9KB 1LWEA 4JS4A 1L5UA 4WF9L 3D2EA 1Q82O 4CZHA 2E6LA 3NF9A 1D9FA 3D2EB 3KK2A 1TK8A 3KLHA 4V19S 4DWIA 2Q1NA 4JEPA 4E1NA 5C10A 2VCPA 4OLAA 1N36K 5AQMA 5J2NA 3QFPA 3M5RA 3CPEA 3MEDA 5AQPA 1RILA 4FW2A 1RDDA 1JLAA 4HTLA 4BRAA 1NGHA 1R0AA 3I0RA 2EWSA 5IT9O 4JD2A 4B1YB 1HNVA 4DFJA 1E4FT 4N5SA 4YOTA 4Q0BA 4IEIA 4OPJA 1W97L 3BZKA 3CFRA 1VQLN 4PKGA 5HLFA 4BREA 4EP5A 1RTHA 4F8RA 4RW6A 3OYHA 1M90O 3L2RA 3RTVA 4GKJK 3K9JA 2OYQA 4H03B 1W9HA 2RPIA 3LALA 5JLFA 5FDLA 1DKGD 3TPQA 4IJNA 5AQYA 2CH6A 4N76A 3MN7A 4CIGA 2QEXN 4C1NI 3BEXA 3CCEN 3MX2A 1TK0A 1EP4A 5E26A 2A42A 4E7KA 2BGGA 3MDQA 4K42A 4FSVA 4AHUA 1T6CA 4EZ6A 3OBWA 5BPMA 4CGGA 3V1OA 1Q9YA 2HBMA 1T8EA 4X62K 4DR5K 4DUYK 3TAPA 4CFBA 5KPTA 4RW9A 5AFUA 2F7TA 2EX3A 3LWLA 4K8XA 3HM8A 3QBWA 4BR9A 4J2EA 4JHDA 2KKZA 5C2FA 2BUPA 4H5WA 3M8SA 1DTQA 5BPLA 1SKRA 4KB1A 2GV9A 2YI1A 3DMJA 3DLRA 4LSNA 3AY9A 3MAQA 1GLFO 4H0VB 5BRHA 3HZ6A 3K2PA 1U6ZA 4FJJA 2WOMA 1BIUA 1R59O 5HBMA 4X65K 3LWMA 1MDUB 2Y1IA 4H5RA 4E3SA 1HNWK 5LL6Z 1HJRA 3CJCA 5HRSA 5FPNA 3OW2M 3LZIA 3VQQA 3TSQA 4CJ3A 2ITMA 1BA0A 4B08A 4IJAA 2YNGA 1ASVA 3O5BA 4QCLA 3E9OA 2O8BB 4JKHA 4DFPA 3CM6A 2QA4N 1YJWN 3DLKA 4B8AB 1A5XA 3EN9A 3FE1A 1OVQA 5BN8A 2VQEK 3ENOA 4BR4A 4E7LA 2YNHA 1WBBA 5HL7L 4H5NA 1NOZA 1S9EA 2IDOA 4CIFA 3OYMA 4ILJA 4NLBA 2UYTA 4CECA 1XMQK 5LJVA 3W3DA 2OTLN 4FL9A 4BRHA 3SJHA 4OLBA 1WSIA 4YOWA 4DU4A 3RMCA 4KH6A 1VSLA 3D0PA 3I0SA 4FM2A 4DFKA 3ZLJA 4WQ5A 4BROA 5M1FA 3AA3A 2O8FB 4H8KA 2UXDK 3M8RA 4DR2K 3PIOL 5EVZA 3QEWA 3SCXA 1NGCA 1Q18A 3P83D 4DS5A 2PFUA 4W5TA 1TGOA 5HOOA 2Z1JA 2P9IA 2E2QA 4MQ3A 2P9IB 3HTVA 1BHLA 2VWKA 4E0DA 2P5GA 3U3YA 3SUOA 1T6DA 3LL3A 3S3NA 3CC4N 4FPBA 5D3GA 3NH0A 3CETA 1ZBUA 3J81O 3HOTA 1KD1O 4DTUA 1N34K 5KQDA 1HNZK 3HK2A 1YF5L 3QETA 3SZ2A 4DQRA 3J7YP 1NWKA 3QLHA 4HVJA 3A5LC 4G9ZA 3CC7N 3FZFA 1KAXA 4JI2K 4DSFA 2GWJA 3AVJA 1XI1A 1NJIO 5AQJA 4CIEA 2CGKA 4KTZA 5GAEP 3L8BA 3QNNA 2YJFA 4L3QA 1RGIA 4FXDA 3FR0A 3KKRA 1NGDA 2D0BA 3RSEB 3LDPA 5HROA 4OO1J 4B1ZA 3UKUB 4B3RK 3ULEB 4CJWA 1HX1A 5KQ8A 3O9RA 3WXMB 3SAGA 4YOUA 3THWA 1M1KO 2HHUA 3AVFA 4F3OA 3ALYA 4CGIA 3NVKA 1CXUA 1C0TA 3TANA 3VPZA 2XY5A 1C1BA 4FWRA 3K9KA 4YDUA 2HMIA 1VQ5N 3H46O 1J9AA 3VESA 2P9PA 1QSLA 3VQAA 3FZMA 3TR8A 3C6UA 3HVTA 5AQGA 4WFBL 2P9PB 3AO3A 3ZCMA 2IIRA 4DR4K 4BRIA 3K57A 1JCEA 4LH4A 1WNSA 4LSLA 4DTSA 1JL2A 4BRLA 4B1UB 4KHYA 2F9WA 1SAZA 4ILHA 3C94A 1E3MA 4F3TA 3VQ5A 5C12A 2HHVA 3HSCA 3HP9A 5SWMA 1QVGM 1QQOA 3FZHA 4BWJA 3VGKA 1KVCA 1HYVA 4OKEA 3TAMA 2FBTA 3EE8A 4CEDA 1KVBA 1BI4A 1NGBA 4O5BA 3VEZA 4QOZB 2FSNA 2OANA 3SUNA 2HNYA 4PHTX 2HVIA 3NGYA 3M8QA 5I3UA 2KFZA 4I2PA 1S1XA 3OYFA 2HSTA 1N6QA 1TL3A 4CF1A 1MWMA 3LPUA 3KK7A 2GX9A 2FSKA 3HJFA 3NCIA 2ZJQL 4ID5A 4O0JA 4OX9K 3ZEUB 3ENHA 3VQEA 2CH5A 3BF3A 3CJ7A 5EOYA 3QERA 4X66K 3HXMA 3BY5A 3N4QA 4N47A 4IFYA 1S6PA 2YJEA 3OTOK 1GOAA 1RBVA 3VOVA 4WE1A 1NNEA 1CZAN 4AM7A 1XMOK 3AVKA 4B1WB 4M3RA 1DLOA 1NGAA 5AZIA 1GOCA 1TYQB 1I3AA 2NRHA 2HOEA 3EKSA 3ZSXA 1ITGA 2NRTA 4DF4A 4GV6A 4B9TA 1ZBSA 3E9LA 4YORA 1NBWA 1I94K 4HCCA 4KBOA 4CJSA 3O3HA 3KZBA 2E88A 2OPPA 2ZE2A 1S1WA 4J8FA 4PA1A 5GINA 4BC4A 2OPRA 4B9QA 5EU7A 5AQNA 3BF1A 3WEEA 4O55A 3O3FA 3SAFA 2YHBA 2WUSA 4CCHA 4DSKA 1MWKA 4A62A 1TKXA 5AQHA 1GLJO 2NRVA 4KB0A 4MDBA 1T44A 3O3GA 4CJPA 2QKBA 4BE0A 4B9LA 4GVEA 1MU2A 4MLEA 1Q8IA 1QQMA 5GIPA 4JKCA 3W0LA 3VQBA 1I39A 4O0IA 1KXPA 3H3NO 5I42A 1NLVA 4NCAA 2O8EA 3KIOA 3OS0A 4QS8A 1UA1A 4H4OA 3WT0A 5SZTA 2O8EB 3U9ZA 5EX5A 1NGJA 2BE2A 1N32K 1FW6A 4CEBA 3SQ4A 1W2BM 3QDKA 4CEEA 3PV8A 2D1KA 4FLUA 1YJNN 1RFQA 4BR5A 4M42A 3ZT1A 2HHSA 2RN2A 3O9QA 2G8HA 1X9SA 4CZEA 2WONA 3AA5X 3VEWA 3ZYYX 1LWCA 3H08A 3L3VA 1IG9A 4BRCA 3D2FA 1S9GA 2G8WA 2VGNA 1NKCA 2VQFK 1X9JA 4KO0A 1C6VA 3D2FB 3V9XA 3O80A 1JJ2M 5CZ2A 2ZF5O 3CXCM 1XWLA 4H0TB 4C8NA 3DLBA 3T7ZA 3KLFA 3TAEA 1QE1A 4ELTA 3KD1E 1S5JA 5DM7L 4CF2A 1NG9A 4ELUA 4AHCA 3DXKB 4Q5VA 1BU6O 3DRPA 4RW8A 1HNXK 1TL1A 4IOXA 1QSSA 4BDYA 5FROA 1EWQA 3BZCA 4FK4A 2UXCK 4PL8A 3WXJA 4Y1DA 4B3TK 5HRRA 5M1QA 1IJJA 1VRUA 3UE5A 3TI0A 1BGXT 4IWVA 3RR8A 4OKKA 3VEOA 4CK1A 2D0AA 2VYPA 1WSEA 4QS9A 3KKSA 4KPYA 2NUBA 2F8SA 4O5FA 1C0MA 1U47A 1RDCA 3WNHA 1XNQK 2P9LA 2CGLA 1BA1A 2O8DB 4PKIA 4FJXA 3HYFA 1ESVA 1UOCA 1KC8O 5FLXO 1SL1A 4HCBA 2P9LB 1K9MO 2FLOA 4YHHK 4FJ8A 3VEYA 2VGMA 2D0PA 4CF8A 1N5YA 4YNQA 4JK7A 3F9MA 2NRZA 5M1NA 2JLEA 2FC0A 1EKEA 3MN9A 4CJEA 1KLMA 3AGRA 2RE2A 4FYDA 3AVCA 3MMVA 3LDNA 5CHIA 4WQ5C 2WFBA 3QBXA 2B5JA 2E20A 4NLCA 2Q36A 2HMPA 2A1RA 1KFDA 1ASUA 3R6MA 4N41A 5AQOA 3QICA 2OPQA 4WYBA 5AQKA 4Z4EA 3DLEA 1XUPO 3GOIA 1BG3A 3E1YA 1TKDA 1WBDA 2RF2A 4FWQA 3EY1A 3PSIA 3LP3A 4DUZK 3TSUA 1UWBA 3T19A 4CI6A 1NGEA 2ZD1A 3MXMA 5FPMA 3JS6A 4LD0A 4A61A 1NK9A 2OA8A 1KSPA 3G10A 2OCEA 3SV4A 1HYZA 4FWMA 1T05A 1SUQA 1LCUA 2DPNA 3DOLA 4DSIA 4DQSA 5KGXA 2BH1A 4RTFD 2HBJA 2HBLA 3ITHA 5EY4A 5BPNA 4RWTA 3O08A 4AHVA 3NF6A 4MFBA 3K59A 1VQ8N 3D6RA 4DSEA 5AJ3K 3LM9A 4JK8A 1WN7A 1RBUA 3I8DA 4DTJA 5GAGP 4ZTFA 1V4SA 1EQYA 1NMNA 3MCPA 2DTUA 4CERA 4A2AA 3IS9A 2BDPA 4CD1A 4LF4K 1RCHA 1ZBFA 4JD2B 1WAFA 4BRQA 4ISGA 4BRMA 1FJGK 2ZWHA 1IV0A 1XC3A 4NCGA 3VTHA 1ZBHA 4BVOA 1YUWA 3V9WA 1NM1A 2HHHK 5TKYA 3IMXA 3MEGA 4Z94A 4WCEL 3LAMA 4JYAK 2QWRA 3GDQA 3EE9A 3SQ2A 4CJ4A 4DQQA 2B4JA 2YHAA 4C23A 2Q31A 4IOCL 4IO8A 3BP8A 3LP1A 1X3MA 4M7YA 1OH8A 2QWPA 3GL1A 1HQEA 4KRFA 5JS2A 2HNZA 3OY9A 4IDHA 3AV9A 4CHNA 1RDAA 1IO2A 2E2NA 4LH5A 5CYQA 4DV3K 1SKSA 4DTRA 4U67L 4JHDB 4H0XB 1RDBA 1T03A 2W40A 1G15A 4Z4HA 3SV3A 3VQ9A 3CQ8A 3CF5L 4KTWA 4N56A 3RVCA 1C0GA 3RRGA 5DM6L 1J53A 1KCFA 4O44A 3MX5A 3M1FA 3QO9A 4K41A 3CCRN 3H3OB 3KK3A 3UKRA 1HQUA 1RBRA 4DTXA 4KI6A 3K5MA 5C0YA 1NK4A 1X3NA 2PYLA 3HM9A 3QINA 1QVFM 3ZT4A 1HRHA 1QTMA 2P9NA 1UA0A 4C8OA 3TU5A 3ID8A 4CZIA 2P9SA 4B3OA 1D4XA 2P9NB 3RMDA 4DTNA 3OYEA 2QWMA 4BQLA 2P9SB 4FLXA 2B6AA 1RT4A 4FZYA 3LDSA 5LMNK 2CGJA 2HVHA 2P1JA 2OZMA 4W5RA 1TKTA 1X9WA 3H6EA 2FF3B 3VGLA 3SNNA 1RBTA 3DRRA 3U8XA 4I6MA 2NNWA 4JKDA 1RDUA 3NAEA 4XIUA 4FJ5A 1WOQA 2HB5A 4DR1K 1O1WA 2BTFA 2YHWA 3KLGA 2RKIA 4J2AA 3NDKA 4C8KA 4YOXA 1K8AO 2I7NA 1S3XA 4R79A 1BQMA 4WFAL 2ZJRL 3VETA 4CEFA 3ATUA 3L3UA 3M3ZA 4JI7K 1YTUA 4DSJA 3HVRA 3VA3A 4DU1A 1JLEA 3VEXA 2QW9A 1WLJA 3Q7BA 1RT3A 1J54A 4DHYA 3T69A 3HBTA 5JVGL 4BDPA 3VQ6A 3WXKA 3IRXA 4CVNE 3DWLA 4FVUA 4DV1K 4JI6K 1OH6A 1IKWA 2AJQA 4CJFA 4JV5K 4BR0A 4CZKA 2WC9A 4IFVA 4KHPK 1KFSA 3MN6A 3K58A 2HHQA 4BRKA 5TKWA 1SQKA 4LF9K 2YHXA 1U45A 4JKEA 3CERA 1ZBIA 2EHGA 2XRIA 3OS1A 4X64K 2Q2RA 1Y97A 3H1QA 3OYGA 4B1XB 1FXXA 3DXMA 1GLBG 3AVBA 3WNFA 4CJQA 4IBNA 4LF8K 3HP6A 1QHTA 3DXMB 1IKXA 1TVRA 4HUFA 2YCHA 4LF6K 3L6QA 2F9TA 3ZX3A 3AAPA 1SZ2A 1A5WA 3EO3A 4FOIA 4BC3A 3G71N 4YOVA 3QIOA 4ICLA 5BR8K 4NYFA 2Z1IA 1BWFO 1BCOA 2OPSA 4GV3A 2A6AA 2E1ZA 3CPWM 4JKGA 3DLLL 3MECA 1NK8A 1LW0A 5KRTA 4O8UA 4CJ5A 1C0FA 3THWB 4IZ9A 2P9UA 3L2QA 4FOEA 4DR6K 2FBVA 1SV5A 1RT7A 4CEAA 2Q0UA 3AVIA 4L8RB 2ZQBA 3TAGA 3CCVN 3PUFA 1WSFA 2D0CA 4FM0A 3SK3A 4K43A 4B9UA 4ZHRA 1K73O 5JICA 1ATSA 3E01A 3WUHA 5K14A 1S1UA 1ZBLA 3CQYA 1C0UA 2VG7A 4FJ9A 3MK6A 4FWLA 1XHXA 4CFDA 2AA4A 3VENA 4GY2B 3VTIA 4A2BA 3HPOA 3OS2A 4M3TA 2FF6A 3LDLA 3CC2N 5GAHP 4KHNA 1RTIA 1VQ6N 2WTUA 3LZJA 1A5VA 4CGHA 1LWFA 1BL3A 4DV5K 2QKKA 3NE6A 4H0OA 1VSDA 1U49A 4FJMA 2Y1JA 1BI4B 3U6FA 1VSJA 3O4QA 4B1VA 5BN9A 1YVNA 1P8ZA 1IBLK 1YIJN 4WQ4A 4CBUA 2HBKA 1VSFA 1QQNA 4CHPA 3KLEA 1IKYA 4KHUA 1NK0A 4K0KK 4W5OA 2PZSA 4JK9A 2VWJA 3SAHA 1BISA 4AF1A 2FBXA 3CIPA 4CZLA 1EX4A 3I33A 2UUAK 2YHYA 4NB4A 1G99A 1LOTB 1HKCA 4GKKK 3TAFA 2IVPA 5FPDA 5H1SQ 1FKPA 2UUBK 3THXA 3ZETA 4OPKA 3TARA 4Y1CA 5E84A 3ZX2A 2Q97A 1KTQA 3KHYA 3THXB 4CBWA 3I8BA 1JLCA 5C15A 3NBPA 3WQUA 5AZIB 2D5RA 1NKBA 5AQTA 3AO5A 3CHWA 3IFRA 3S9HA 1YHQN 2GWKA 4BGAA 1VSMA 4CJTA 3IAYA 3DLGA 3OYNA 5FRMA 2W42A 3TWHA 3QEXA 1VRTA 4DV4K 1V4TA 5E41A 2J4RA 3C7NA 4K8ZA 2W6KA 1WUAA 1YXQA 4DSLA 3WEEB 3CG7A 2KZMA 1H1VA 1Q86O 3DOKA 3NHGA 4M3YA 3J7ZO 1Z26A 4BVPA 4EFHA 4CHQA 1LW2A 4PQUA 3T1YK 4FWSA 5AQUA 4LFBK 5JVHL 1SL0A 3SUPA 1VQMN 1GLCG 3O9UA 4DG1A 4I9LA 1W7AA 3O6WA 1EXQA 1VSHA 3CFOA 2NRWA 3SBGA 1YJ9N 1ASWA 2F8TA 1KQSM 1K8KA 1J6ZA 2KQ2A 1RT1A 3J80O 5AQRA 3SBTA 1DGKN 5FPEA 3IDHA 1Z6RA 3HSTB 4EIAA 2IGIA 3LM2A 2IVNA 1IKVA 4GVMA 3T3FA 2QK9A 5T7BA 1VSEA 4FJHA 5DMRA 3OYAA 4OKJA 4FCYA 1HKGA 4FW1A 3NFAA 1JLGA 4JAXA 4HUGA 1WB9A 2A1SA 4A5AA 2FBYA 4DKWA 3VQ8A 3JAMO 4M63C 5GIOA 4CHOA 5AQSA 1D9DA 4J2DA 3TABA 1VSKA 3OHRA 1U2VA 5M1PA 3SUQA 3A0IX 5C42A 3PO5A 3KVGA 3ENBA 2HHWA 2G8FA 1NJWA 2KHOA 4KH4A 1ZXOA 1BCMA 1VQNN 3V4IA 5J2PA 4EHTA 3G0ZA 3ZSRA 4MDAA 3V9SA 2X74A 4QAGA 5C25A 2DFEA 1YITN 3C65A 3WQTA 5M1KA 3CCMN 3THVA 1EWRA 3V9ZA 3WXLA 3ZX0A 2E6MA 1RT5A 3VEVA 4KAZA 3MWTA 4EZ9A 4WFNL 3A5NC 3VMFB 3OYKA 4A5BA 2P51A 4HWIA 3LP0A 3VA0A 2HF3A 5AQIA 2XY6A 1U04A 5KI6A 1LV5A 1FKOA 4NXMK 3PX0A 3AO2A 4RW7A 1REVA 1TAUA 1VQ9N 3NF8A 3BUZB 5J2QA 3DRSA 2VWBA 1NJYA 2O8CA 2WBNA 1JXEA 3IUCA 4AH9A 1WSHA 1XQSC 3OJUA 3PO4A 1WAJA 4OVLA 3TTCA 3F9KA 1JLQA 1KAZA 1Q9XA 2ZM6K 4FZZA 3CFPA 4RCHA 3THYA 2A5XA 4Z4CA 4F2SA 4FK2A 4DV2K 4IG3A 4NXNK 4CF0A 3CCUN 2P5OA 3THYB 3NGZA 3ID6A 1W0HA 4J2BA 5HRPA 3CQXA 3QEPA 2KLAA 1DEJA 1RT6A 1NK6A 3ZSWA 5FRNA 2BANA 3NMUA 5M1OA 2E2OA 4GNIA 4DLGA 3L4QA 5J2MA 1E4GT 1OVYA 3MXJA 2O4GA 4DR7K 4C8MA 1U4BA 2R7YA 3QESA 5GADP 2HF4A 3ZSZA 1RTDA 3V1RA 1J5OA 1BIZA 1RDWX 3JYTA 4OPAA 3PLAA 4CZFA 4B3MK 1S1VA 3CD6N 3ZSYA 1OKJA 2A41A 3P4IA 2YV0X 2I7PA 3CJ1A 3ZT3A 4EAHD 3LDOA 2H3GX 4KFBA 4HHTA 4CGDA 1CLQA 2ASPA 1SS6A 3E9PA 3HOSA 4M3XA 4JRQA 4JS5A 1HMVA 2W6LA 3G4SN 3N4PA 1NU0A 4DLEA 4FLYA 4E7HA 1GLAG 3EZ5A 4E7IA 1N8RO 3C6AA 3Q7CA 3ZT0A 1BDGA 3R8EA 1VSIA 2GUPA 4OJRA 1B9DA 1EETA 5J1EA 3B6OA 1IH7A 2IAJA 4FO0A 4O4GA 3G25A 4KKOA 2D4WA 4M3ZA 3K5NA 4BRFA 3CJAA 3IG1A 3NGIA 1XHZA 4H0YB 4CHYA 1NGGA 1S1TA 3OYDA 2JWKA 3CM5A 4JI4K 1VQ7N 4LFAK 1YI2N 3DLHA 4FWNA 3MCAB 3UIQA 2GUIA 5EXWA 5AR0A 3AVHA 5KGWA 1JL1A 3AVGA 4FLTA 2XHBA 4BDZA 1IG8A 4XH1A 4FJGA 1HUXA 2HNDA 1NJXA 2OTJN 3FGUA 4CJVA 4FLZA 3AVLA 4LC9B 4DU3A 2GBZA 3O1WA 4I2QA 2V51B 4YDUC 3HRGA 4ILGB 1C1AA 4FK0A 3TTDA 1DT9A 4CD3A 3K0SA 2DY4A 3CMEN 1ILYA 1D8YA 2V52B 2D0OA 4E89A 3AVNA 3KK1A 3C0BA 2ETJA 3K5LA 4IXCA 4IO9L 4ELVA 3VN5A 4AHRA 2Z1HA 2G8UA 3ASMA 5CZ1A 4IEEA 4JI0K 4GV9A 5HRNA 1NJZA 4CF9A 1S6QA 5LY3A 2HHTA 1X9MA 4RW4A 2UU9K 3EZWA 4UQGA 3P39A 3AVMA 1RT2A 3HPGA 4PY5A 1GLDG 3SQ0A 4JI8K 4IKFA 1TK5A 3OYCA 4FWKA 3TSPA 4JKFA 3U4LA 4R5PA 3HPHA 2A3ZA 4E19A 3LP2A 4BR7A 3L2VA 4MLHA 2Z1GA 3EL2A 2V7ZA 2UXBK 4OGCA 1B9FA 4BE2A 3PX6A 3UKRB 4FJKA 2V7YA 4JKBA 3R1XA 1IBKK 4KI4A 2NRRA 2YX6A 4TSXA 4WQ4C 2IOCA 4JRPA 1KRPA 4CJKA 1HLUA 3LDQA 1QQCA 1DTTA 4E7JA 3O4NA 3BGRA 5CE3A 2PY5A 2ZJPL 5C2DA 1BO5O 4PKHA 4LFCK 4CK3A 3F73A 5AQWA 2PYJA 2O8BA 2RHKA 5A2QO 5AQVA 1HPZA 4DV6K 1L3VA 3EYZA 3OYIA 1JCGA 1XNRK 5F1XA 1VQKN 1L3SA 3O8MA 4DTPA 4NYNA 1HKBA 3CCSN 1N33K 4DB3A 4ISEA 5AFUH 4I6MB 3C6HA 1VQPN 4H5TA 4UY8O 2KTQA 1MA9B 4JN4A 4Z4GA 3NF7A 4B9VA 4Z0UA 3VQCA 1D5AA 4BRDA 1TAQA 1HR0K 3JSMA 3DJCA 1ZYQA 4B9NA 3SMPA 4JI5K 4FJNA 2O8FA 3QB0A 3V9UA 5KPZA 4YOYA 3LPTA 3VERA 4CFCA 4FZXC 1GOBA 1TUUA 3O9TA 3VQPA 3D45A 4ID1A 4KV8A 4JNEA 2KZZA 3C6TA 2GELA 4DTMA 2NZTA 3L4IA 3AO4A 4EP4A 3VF4A 3AAQA 5IWAK 4AM6A 2A40A 3B8AX 2GEMA 3SI6A 3CMAN 1Z05A 1U48A 1TKZA 3V6DA 3P5JA 3T1HK 1B92A 1Z25A 3VQ4A 4DCHA 3A5OC 4CJRA 1IBMK 1BOTO 4CEOA 2YKMA 4YFUA 1NK7A 1L3TA 4F4KA 4BG8A 2AP1A 4DF8A 1NKEA 1T7PA 4FPAA 2ASOA 2VG6A 3O1BA 2ZGZA 2NLXA 4BC5A 4CGFA 1T3VA 4B8CA 3O4WA 3UB5A 3ZT2A 4JKGB 2E1YA 4DQ8A 3C95A 3A8YA 3RSEA 1FK9A 3UKUA 3ULEA 2P9UB 4C8LA 4IFEA 3KWIA 3JXUA 4PWDA
chains in the Genus database with same CATH topology
5AQUA 4XEIA 3HZ6A 5JVHL 1U6ZA 3LDNA 5CHIA 4WQ5C 5AQZA 2IVOA 2WFBA 1R59O 1VAZA 2E20A 3QBXA 3QMLA 1GLCG 1MDUB 2Q36A 3O9UA 4H5RA 4NLCA 1VQMN 2HMPA 3CJBA 5AQLA 3O6WA 3R6MA 4QS7A 5AQOA 2NRWA 3SBGA 3CJCA 3QICA 4WYBA 5AQKA 5FPNA 3OW2M 1YJ9N 1XUPO 1KQSM 3GOIA 1BG3A 3E1YA 1K8KA 1J6ZA 3I55N 3TSQA 4FWQA 2ITMA 5AQRA 1BA0A 3SBTA 1DGKN 4IJAA 3CCQN 5FPEA 3H1VX 4CBXA 3CCLN 3IDHA 3TSUA 1BUPA 3O5BA 1NGEA 4CI6A 1Z6RA 3FFKB 3E9OA 4FWPA 5FPMA 3JS6A 4JKHA 3WXIA 4EIAA 5BREA 4NO7A 3LM2A 4A61A 2IVNA 3IKMA 2QA4N 1YJWN 1Q7YO 3EN9A 3FE1A 3AARA 5BN8A 4OPHA 1HKGA 4FWMA 5BR9A 1LCUA 2DPNA 4JAXA 3ENOA 3KWGA 2BH1A 4RTFD 4BR4A 4BRPA 2HBJA 4MO5A 4A5AA 2HBLA 5HL7L 4H5NA 5EY4A 5BPNA 3DAWA 4RWTA 4ILJA 4FWOA 4DKWA 4NLBA 2UYTA 3O08A 4M63C 5GIOA 3GBTA 5AQSA 1VQ8N 3D6RA 5LJVA 3W3DA 2OTLN 3J8AA 1ATRA 4FL9A 3SJHA 3LM9A 4JK8A 4BRHA 3OHRA 5I9EB 1U2VA 5M1PA 4YOWA 3A0IX 5GAGP 3KVGA 3ENBA 4KH6A 4XH4A 1V4SA 1Q81O 1EQYA 4WQ5A 3MCPA 4BROA 2KHOA 4KH4A 4A2AA 1ZXOA 3O9SA 5M1FA 1VQNN 4EHTA 4CD1A 3SLCA 4JD2B 4BRQA 4ISGA 4MDAA 4BRMA 2ZWHA 2QWNA 3PIOL 5EVZA 1YITN 1XC3A 1NGCA 1Q18A 3VTHA 2PFUA 4BVOA 1YUWA 3C65A 3WQTA 5M1KA 2GTDA 5HOOA 3CCMN 1NM1A 2P9IA 4CZMA 3R3LA 3WXLA 3ZX0A 2E2QA 3ZEUA 2Q0RA 3IMXA 5TKYA 4Z94A 3I56N 2QWQA 4WCEL 2P9IB 3VEVA 3MWTA 2QWRA 3HTVA 3E66A 3P31A 3GDQA 3EE9A 4WFNL 3A5NC 3VMFB 3ZETB 4CJ7A 3OBYA 4BR2A 4A5BA 4HWIA 3D7EO 2HF3A 1T6DA 5AQIA 3LL3A 2Q31A 4C23A 4IO8A 4IOCL 3CC4N 3BP8A 4FPBA 4XH5A 4IOAL 3CETA 1HJOA 2W41A 1X3MA 4M7YA 5AZJA 2QWPA 3GL1A 1GLLO 5BRDA 4BG9A 3A5MC 3HOTA 3BUZB 1VQ9N 1KD1O 5AZJB 2VWBA 2WBNA 1TYQA 5KQDA 3M6GA 3IUCA 4H5VA 4CZJA 3FZLA 5AQFA 1JCFA 1XQSC 1YF5L 1KAYA 4C1NK 4IDHA 4BY9C 1NWKA 3A5LC 3TTCA 4G9ZA 3CC7N 1KAZA 3FZFA 1KAXA 5LJWA 2GWJA 3C7NB 2E2NA 4RCHA 1P90A 5F2RA 1NJIO 5AQJA 2A5XA 2CGKA 5GAEP 4U67L 4JHDB 4H0XB 2W40A 3FZKA 3CCUN 2YJFA 4L3QA 1RGIA 3CF5L 3FR0A 3ID6A 1NGDA 3RSEB 3LDPA 3RVCA 3CQXA 4OO1J 2KLAA 1DEJA 4B1ZA 1C0GA 3UKUB 3ULEB 3NMUA 5M1OA 2E2OA 1HX1A 5DM6L 4F9OA 4GNIA 5KQ8A 3L4QA 3O9RA 3MX5A 4YOUA 1E4GT 3M1FA 3WXMB 3SAGA 1M1KO 4K41A 1OVYA 3NVKA 1ZC6A 3CCRN 3H3OB 5C0YA 3UKRA 5AQQA 3VPZA 5GADP 2HF4A 3K9KA 3OA9A 4FWRA 4JKAA 4YDUA 3S41A 3TTFA 1X3NA 3H46O 1VQ5N 3VESA 1QVFM 2P9PA 1K8KB 1RDWX 1GLEG 3FZMA 5AQGA 1S72N 4OPAA 4BC2A 4WFBL 2P9NA 2P9PB 2IIRA 4A57A 3TU5A 3PLAA 1HPMA 3ID8A 4BRIA 4CZFA 4CZIA 3SMSA 2P9SA 3U9DA 1D4XA 3CD6N 1JCEA 2P9NB 1OKJA 2A41A 3P4IA 2I7PA 2QWMA 3FLCO 4BQLA 3CJ1A 2P9SB 3P38A 4EAHD 3LDOA 2QTDA 2H3GX 4BRLA 2CGJA 3MN5A 4B1UB 2ASPA 2F9WA 1SS6A 3E9PA 3HOSA 3H6EA 1SAZA 4ILHA 2FF3B 2QWOA 4U7BA 3G4SN 3N4PA 5C12A 3VGLA 3HSCA 4PL7A 2PBDA 1GLAG 3CJ9A 1QVGM 1QQOA 3FZHA 3U8XA 5BRFA 1N8RO 3C6AA 2FSJA 3Q7CA 4I6MA 4ISFA 1BDGA 2NNWA 2NRXA 3R8EA 3VGKA 4EHUA 1VQ4N 2GUPA 4JKDA 3G6EN 3F5TA 1RDUA 1WOQA 1U2VB 3VGMA 2BTFA 2YHWA 3EE8A 3MWPA 3G25A 4FO0A 2D4WA 3NVMA 3VEZA 1NGBA 4BRFA 3HI0A 4YOXA 2FSNA 2I7NA 2OANA 1K8AO 3CJAA 2FXUA 1S3XA 4H0PA 4R79A 4WFAL 2ZJRL 3VETA 5ADXA 4PHTX 3ATUA 4H0YB 3M3ZA 1NGGA 1VQ7N 2JWKA 1YI2N 5MLCQ 4BRGA 2HSTA 4FWNA 3MCAB 2QW9A 3VEXA 3Q7BA 5EXWA 5AR0A 4DHYA 3T69A 1MWMA 3HBTA 5JVGL 3KK7A 2GX9A 3WXKA 3DWLA 2ZGYA 2FSKA 1IG8A 4FVUA 4XH1A 1HUXA 4A59A 5JLHA 2ZJQL 2OTJN 3FGUA 3DXKA 3ZEUB 3ENHA 3H45C 1S22A 4LC9B 2CH5A 4BR0A 5JMVA 4CZKA 2WC9A 3O1WA 3BF3A 1Y64A 3CJ7A 3MN6A 5EOYA 4E1JA 2QWLA 2V51B 4YDUC 4BRKA 3HRGA 5TKWA 4ILGB 3TTDA 1DT9A 3N4QA 4CD3A 1SQKA 3CI5A 2YHXA 2YJEA 3CMEN 4JKEA 3CERA 4BRNA 3R9PA 1NMDA 3AGKA 3VOVA 1ILYA 2Q2RA 1CZAN 2V52B 2D0OA 4AM7A 4MO4A 3H1QA 4B1WB 3C0BA 3EKUA 4B1XB 4IXCA 4IO9L 3DXMA 1NGAA 5AZIA 1GLBG 1TYQB 2NRHA 2HOEA 3EKSA 2ASMA 1YAGA 4IEEA 2QM1A 3DXMB 3ATVA 4GV9A 4M7XA 5LY3A 2NRTA 4Y0WA 4GV6A 1ZBSA 2YCHA 3E9LA 3L6QA 1NBWA 2F9TA 3AAPA 4YORA 5ELZA 1SZ2A 3EZWA 3ZX3A 4KBOA 5ADXH 3P39A 1O13A 3EO3A 4BGBA 1ATNA 4FOIA 4BC3A 1GLDG 3KZBA 3CCJN 2E88A 4CZGA 3G71N 4YOVA 4J8FA 5GINA 3GG4A 5F0XA 4FWKA 3TSPA 1QHAA 4BC4A 4B9QA 4JKFA 5AQNA 5CR4A 3BF1A 3U4LA 4K25A 4BQZA 1BWFO 2A3ZA 3WEEA 2QXLA 5KPRA 3SAFA 4BR7A 4GV3A 2A6AA 2E1ZA 3CPWM 4JKGA 3DLLL 4MLHA 2QI2A 2WUSA 1NGIA 1MWKA 3VF6A 4O8UA 4A62A 3EL2A 2V7ZA 1C0FA 1GLJO 3QFUA 2NRVA 5AQHA 4IZ9A 2P9UA 4MDBA 1T44A 4FOEA 1VQON 5AQXA 2PAVA 2Q0UA 3UKRB 4GVEA 2V7YA 3GE1A 4JKBA 1TUYA 4MLEA 3CCVN 1QQMA 3L0QA 3R1XA 2JWLA 2NRRA 4JKCA 3W0LA 2YX6A 5GIPA 4WQ4C 5B8HA 1KXPA 3H3NO 3SK3A 4K43A 3F2KA 1HLUA 1NLVA 3LDQA 1EO1A 2E2PA 4KH5A 5JICA 1ATSA 4QS8A 1K73O 3WUHA 3WT0A 3PIPL 3VF2A 3CQYA 3U9ZA 1QZ6A 5CE3A 2ZJPL 5EX5A 5C2DA 3MK6A 1NGJA 1BO5O 2E8AA 4O8KA 2P9KA 4PKHA 1NGFA 4FWLA 5AQWA 1W2BM 3QDKA 2RHKA 1QZ5A 5AQVA 2AA4A 2P9KB 3VENA 2D1KA 4GY2B 3VTIA 1RFQA 4A2BA 1JCGA 4BR5A 1YJNN 2FF6A 5F1XA 3LDLA 4WF9L 3CC2N 5GAHP 3D2EA 3O9QA 1Q82O 3O8MA 1VQKN 1VQ6N 4CZHA 1HKBA 4CZEA 3CCSN 4DB3A 3D2EB 4ISEA 5AFUH 4I6MB 3C6HA 2Q1NA 4JEPA 3VEWA 1VQPN 4H5TA 5C10A 4UY8O 1MA9B 4JN4A 2VCPA 4H0OA 3ZYYX 5AQMA 3D2FA 4BRCA 2VGNA 3QFPA 1X9JA 3M5RA 3CPEA 4BRDA 4B1VA 5AQPA 3D2FB 5BN9A 3O80A 1JJ2M 2ZF5O 1YVNA 3CXCM 4HTLA 1P8ZA 4BRAA 3DJCA 4H0TB 3SMPA 1NGHA 4WQ4A 1YIJN 2EWSA 4CBUA 2HBKA 3T7ZA 1QQNA 3QB0A 4JD2A 4B1YB 5KPZA 5DM7L 1E4FT 4JK9A 4YOYA 3SAHA 4AF1A 3DXKB 4YOTA 3VERA 3CIPA 4IEIA 1W97L 4CZLA 1VQLN 1BU6O 4PKGA 3I33A 4BREA 1TUUA 3O9TA 2YHYA 4IOXA 4NB4A 1M90O 1G99A 4JNEA 1LOTB 2GELA 1HKCA 2NZTA 3L4IA 2IVPA 5FPDA 5H1SQ 4PL8A 3WXJA 3K9JA 3ZETA 3VF4A 3AAQA 4H03B 5M1QA 1IJJA 4AM6A 5JLFA 5E84A 3ZX2A 3UE5A 2Q97A 1DKGD 3KHYA 2A40A 4IJNA 5AQYA 3TPQA 2CH6A 2GEMA 3B8AX 4CBWA 3CMAN 1Z05A 4IWVA 3I8BA 3MN7A 5C15A 3VEOA 4DCHA 3WQUA 2QEXN 5AZIB 4C1NI 3A5OC 3BEXA 2VYPA 3CCEN 1BOTO 5AQTA 3MX2A 3CHWA 4QS9A 3IFRA 5E26A 1YHQN 2A42A 2GWKA 4BGAA 3MDQA 4K42A 4FSVA 4O5FA 4BG8A 1T6CA 3OBWA 2P9LA 2AP1A 2CGLA 1BA1A 5BPMA 4FPAA 2ASOA 4PKIA 2HBMA 1ESVA 3O1BA 1KC8O 1V4TA 2ZGZA 2P9LB 2NLXA 1K9MO 2J4RA 5KPTA 3C7NA 2FLOA 4BC5A 3VEYA 2VGMA 2F7TA 5AFUA 1WUAA 1YXQA 3HM8A 2D0PA 3QBWA 4BR9A 1T3VA 4JK7A 4JHDA 2KKZA 3WEEB 5C2FA 3O4WA 2BUPA 4H5WA 3UB5A 1H1VA 1Q86O 4JKGB 3F9MA 2NRZA 5BPLA 2YI1A 2E1YA 5M1NA 4DQ8A 3A8YA 3J7ZO 3MN9A 4BVPA 3RSEA 4EFHA 3AY9A 3AGRA 2RE2A 3UKUA 3ULEA 2P9UB 4IFEA 3KWIA 1GLFO 3JXUA 4FWSA 4H0VB 5BRHA 3MMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 O;  5JVG L;  5JVH L;  1VQ6 N;  3CCS N;  1VQM N;  2ZJQ L;  2OTJ N;  3CC7 N;  1VQP N;  4UY8 O;  3OW2 M;  1YJ9 N;  1NJI O;  1KQS M;  3I55 N;  4U67 L;  5GAE P;  3CCU N;  3CCQ N;  3CME N;  3CCL N;  3CF5 L;  1JJ2 M;  1ILY A;  3CXC M;  1YIJ N;  2QA4 N;  1YJW N;  4IO9 L;  1Q7Y O;  5DM6 L;  1M1K O;  1OVY A;  5DM7 L;  3CCR N;  5GAD P;  1VQL N;  5HL7 L;  1VQ5 N;  1QVF M;  3CCJ N;  3G71 N;  1M90 O;  1VQ8 N;  2OTL N;  1S72 N;  4WFB L;  5H1S Q;  5GAG P;  1Q81 O;  3CD6 N;  3CPW M;  3DLL L;  3CMA N;  1VQN N;  2QEX N;  3CCE N;  1VQO N;  3PIO L;  1YIT N;  1YHQ N;  3G4S N;  3CCV N;  3CCM N;  1QVG M;  1N8R O;  3I56 N;  4WCE L;  1KC8 O;  1VQ4 N;  3G6E N;  1K9M O;  4WFN L;  1K73 O;  3PIP L;  1K8A O;  2ZJP L;  4IOC L;  1Q86 O;  4WFA L;  2ZJR L;  3CC4 N;  4IOA L;  1W2B M;  3J7Z O;  1VQ7 N;  1YI2 N;  5MLC Q;  1VQK N;  1YJN N;  1VQ9 N;  1KD1 O;  4WF9 L;  3CC2 N;  5GAH P; 
#chains in the Genus database with same CATH topology
 4XEI A;  1OH5 A;  2HHX A;  5AQZ A;  2IVO A;  3QML A;  1VAZ A;  3AVA A;  1X1P A;  3CJB A;  5AQL A;  1KLN A;  4QS7 A;  4CJU A;  3S3M A;  1RNH A;  1L3U A;  3RR7 A;  4M3W A;  3I55 N;  4B9M A;  3ULD A;  5LMU K;  1J5E K;  3CCQ N;  3H1V X;  4CBX A;  3CCL N;  4W5Q A;  1BUP A;  3BDP A;  3SYZ A;  3FFK B;  3RMB A;  4LF7 K;  1CXQ A;  4FWP A;  3L2W A;  3WXI A;  5BRE A;  4I7F A;  4NO7 A;  2XO7 A;  3QNO A;  3IKM A;  4IDK A;  3WNE A;  3P1G A;  4H4M A;  3DI6 A;  1Q7Y O;  3AAR A;  4OPH A;  2LSN A;  5BR9 A;  3KWG A;  4KRE A;  4BRP A;  3V81 A;  4MO5 A;  3OYL A;  2JGU A;  3DAW A;  3VQD A;  4FWO A;  4M41 A;  3GBT A;  3J8A A;  1ATR A;  4CGJ A;  1LAW A;  1CZB A;  5I9E B;  2G8V A;  4AHS A;  4OGE A;  3KD5 E;  4KHW A;  4XH4 A;  1Q81 O;  3MEE A;  3B6P A;  1JLF A;  3O9S A;  1XC9 A;  3SJJ A;  3SLC A;  4JLH A;  3M8P A;  5CYM A;  2QWN A;  2X6S A;  4CE9 A;  3KJV A;  2VG5 A;  4B9S A;  2GTD A;  3AO1 A;  4CZM A;  3R3L A;  3EEQ A;  1CZ9 A;  3ZEU A;  2Q0R A;  5CY4 A;  3I56 N;  2QWQ A;  1HYS A;  3E66 A;  3P31 A;  2XY8 A;  3AA4 A;  4I9Q A;  3RMA A;  4FJ7 A;  3ZET B;  4CJ7 A;  1TV6 A;  3OBY A;  4BR2 A;  3D7E O;  1JLB A;  2F4V K;  1YTA A;  4XH5 A;  2IS3 A;  3VQ7 A;  4IOA L;  4B3S K;  1HJO A;  2W41 A;  5AZJ A;  4BE1 A;  1GLL O;  5BRD A;  4BG9 A;  3A5M C;  1KVA A;  4HTU A;  3K5O A;  3ZSV A;  5AZJ B;  2I5J A;  4KHQ A;  1TYQ A;  3M6G A;  4H5V A;  2DFH A;  3FZL A;  5AQF A;  4CZJ A;  4FM1 A;  1JCF A;  3NH2 A;  1KAY A;  4C1N K;  4AIL C;  4CES A;  1SL2 A;  4BY9 C;  4CW7 B;  4F2R A;  5LJW A;  3C7N B;  3WNG A;  1P90 A;  5F2R A;  4IG0 A;  4CEQ A;  3FZK A;  2DFF A;  1K6Y A;  3OYJ A;  4FLV A;  3A2F A;  4FVM A;  3MXI A;  4DQP A;  3T1A A;  4BWM A;  4F9O A;  4M45 A;  4NCB A;  1YVU A;  2XY7 A;  3AA2 A;  1ZC6 A;  2YNI A;  3LAN A;  1HNI A;  5AQQ A;  3V1Q A;  4KTQ A;  4RG8 A;  4JI1 K;  4JKA A;  3OA9 A;  3S41 A;  3TTF A;  4Z4F A;  5HP1 A;  3KLI A;  4DQI A;  4LY7 A;  3L2U A;  1K8K B;  1GLE G;  5DK5 A;  1S72 N;  4BC2 A;  2QXF A;  4A57 A;  1HPM A;  4Z4I A;  3TAQ A;  3SMS A;  3U9D A;  3DM2 A;  1QS4 A;  3QEV A;  4ZTJ A;  3FLC O;  3RRH A;  2E5L K;  3P38 A;  2F96 A;  2QTD A;  3MN5 A;  3SPY A;  2KW4 A;  3HO1 A;  2QWO A;  4U7B A;  3QEI A;  3SQ1 A;  1OH7 A;  4PL7 A;  1SKW A;  2PBD A;  3CJ9 A;  2G8K A;  3PSF A;  5BRF A;  2HW3 A;  2FSJ A;  5KRS A;  4ISF A;  2NRX A;  1C1C A;  4EHU A;  1VQ4 N;  2E4L A;  3G6E N;  3F5T A;  4M3U A;  3QIP A;  3SPZ A;  1U2V B;  3VGM A;  3MWP A;  4FJL A;  3NVM A;  4FLW A;  1NOY A;  3HI0 A;  2FXU A;  4H0P A;  5ADX A;  4BAC A;  4DS4 A;  4CEZ A;  1BQN A;  4AHT A;  4E1M A;  3OVN A;  5MLC Q;  2UUC K;  4BRG A;  4CHZ A;  3U3G A;  3PY8 A;  4DV0 K;  4JI3 K;  1RBS A;  2ZGY A;  4A59 A;  5JLH A;  3DXK A;  4GW6 A;  3H45 C;  1S22 A;  5JMV A;  1Y64 A;  4E1J A;  2QWL A;  4DR3 K;  1LAV A;  1YT3 A;  3CI5 A;  2X78 A;  2G8I A;  3PX4 A;  1QSY A;  4BRN A;  4G1Q A;  3R9P A;  1NMD A;  3AGK A;  4MO4 A;  4PUO A;  3OYB A;  3FFI A;  3EKU A;  2Q3S A;  2O8C B;  1NK5 A;  2ASM A;  1VK0 A;  1YAG A;  2QM1 A;  3ATV A;  2ATQ A;  1JXB A;  4M7X A;  1RTJ A;  3DYA A;  3CYM A;  4Y0W A;  4DMN A;  3J7A P;  2YKN A;  2ITG A;  2X6N A;  5ADX H;  5ELZ A;  3OJS A;  2O4I A;  1F21 A;  1O13 A;  3ZSO A;  2O8D A;  4BGB A;  1ATN A;  4CFA A;  3CCJ N;  4CZG A;  4DV7 K;  3ISN C;  1UAX A;  3GG4 A;  5F0X A;  1QHA A;  3NH1 A;  5CR4 A;  4BQZ A;  4K25 A;  1WSG A;  2QXL A;  4HUE A;  5KPR A;  3HT3 A;  1WSJ A;  2QI2 A;  3LAK A;  2IC3 A;  1NGI A;  3VF6 A;  4CJL A;  3QFU A;  5KTQ A;  1JKH A;  1VQO N;  2OZS A;  5AQX A;  3ZSQ A;  2KFN A;  2PAV A;  4W5N A;  4CK2 A;  3GE1 A;  1TUY A;  3HL8 A;  4DFM A;  3L0Q A;  2JWL A;  5JS1 A;  5B8H A;  3RWU A;  3KTQ A;  4DTO A;  3F2K A;  1EO1 A;  3S3O A;  2E2P A;  4KH5 A;  4AQY K;  3PIP L;  4KHS A;  3VF2 A;  4FJI A;  1QZ6 A;  5C24 A;  4YY3 K;  4O8K A;  2E8A A;  2P9K A;  1NGF A;  4GMJ B;  2YNF A;  4LF5 K;  1QZ5 A;  1VHX A;  2P9K B;  1LWE A;  4JS4 A;  1L5U A;  4WF9 L;  3D2E A;  1Q82 O;  4CZH A;  2E6L A;  3NF9 A;  1D9F A;  3D2E B;  3KK2 A;  1TK8 A;  3KLH A;  4V19 S;  4DWI A;  2Q1N A;  4JEP A;  4E1N A;  5C10 A;  2VCP A;  4OLA A;  1N36 K;  5AQM A;  5J2N A;  3QFP A;  3M5R A;  3CPE A;  3MED A;  5AQP A;  1RIL A;  4FW2 A;  1RDD A;  1JLA A;  4HTL A;  4BRA A;  1NGH A;  1R0A A;  3I0R A;  2EWS A;  5IT9 O;  4JD2 A;  4B1Y B;  1HNV A;  4DFJ A;  1E4F T;  4N5S A;  4YOT A;  4Q0B A;  4IEI A;  4OPJ A;  1W97 L;  3BZK A;  3CFR A;  1VQL N;  4PKG A;  5HLF A;  4BRE A;  4EP5 A;  1RTH A;  4F8R A;  4RW6 A;  3OYH A;  1M90 O;  3L2R A;  3RTV A;  4GKJ K;  3K9J A;  2OYQ A;  4H03 B;  1W9H A;  2RPI A;  3LAL A;  5JLF A;  5FDL A;  1DKG D;  3TPQ A;  4IJN A;  5AQY A;  2CH6 A;  4N76 A;  3MN7 A;  4CIG A;  2QEX N;  4C1N I;  3BEX A;  3CCE N;  3MX2 A;  1TK0 A;  1EP4 A;  5E26 A;  2A42 A;  4E7K A;  2BGG A;  3MDQ A;  4K42 A;  4FSV A;  4AHU A;  1T6C A;  4EZ6 A;  3OBW A;  5BPM A;  4CGG A;  3V1O A;  1Q9Y A;  2HBM A;  1T8E A;  4X62 K;  4DR5 K;  4DUY K;  3TAP A;  4CFB A;  5KPT A;  4RW9 A;  5AFU A;  2F7T A;  2EX3 A;  3LWL A;  4K8X A;  3HM8 A;  3QBW A;  4BR9 A;  4J2E A;  4JHD A;  2KKZ A;  5C2F A;  2BUP A;  4H5W A;  3M8S A;  1DTQ A;  5BPL A;  1SKR A;  4KB1 A;  2GV9 A;  2YI1 A;  3DMJ A;  3DLR A;  4LSN A;  3AY9 A;  3MAQ A;  1GLF O;  4H0V B;  5BRH A;  3HZ6 A;  3K2P A;  1U6Z A;  4FJJ A;  2WOM A;  1BIU A;  1R59 O;  5HBM A;  4X65 K;  3LWM A;  1MDU B;  2Y1I A;  4H5R A;  4E3S A;  1HNW K;  5LL6 Z;  1HJR A;  3CJC A;  5HRS A;  5FPN A;  3OW2 M;  3LZI A;  3VQQ A;  3TSQ A;  4CJ3 A;  2ITM A;  1BA0 A;  4B08 A;  4IJA A;  2YNG A;  1ASV A;  3O5B A;  4QCL A;  3E9O A;  2O8B B;  4JKH A;  4DFP A;  3CM6 A;  2QA4 N;  1YJW N;  3DLK A;  4B8A B;  1A5X A;  3EN9 A;  3FE1 A;  1OVQ A;  5BN8 A;  2VQE K;  3ENO A;  4BR4 A;  4E7L A;  2YNH A;  1WBB A;  5HL7 L;  4H5N A;  1NOZ A;  1S9E A;  2IDO A;  4CIF A;  3OYM A;  4ILJ A;  4NLB A;  2UYT A;  4CEC A;  1XMQ K;  5LJV A;  3W3D A;  2OTL N;  4FL9 A;  4BRH A;  3SJH A;  4OLB A;  1WSI A;  4YOW A;  4DU4 A;  3RMC A;  4KH6 A;  1VSL A;  3D0P A;  3I0S A;  4FM2 A;  4DFK A;  3ZLJ A;  4WQ5 A;  4BRO A;  5M1F A;  3AA3 A;  2O8F B;  4H8K A;  2UXD K;  3M8R A;  4DR2 K;  3PIO L;  5EVZ A;  3QEW A;  3SCX A;  1NGC A;  1Q18 A;  3P83 D;  4DS5 A;  2PFU A;  4W5T A;  1TGO A;  5HOO A;  2Z1J A;  2P9I A;  2E2Q A;  4MQ3 A;  2P9I B;  3HTV A;  1BHL A;  2VWK A;  4E0D A;  2P5G A;  3U3Y A;  3SUO A;  1T6D A;  3LL3 A;  3S3N A;  3CC4 N;  4FPB A;  5D3G A;  3NH0 A;  3CET A;  1ZBU A;  3J81 O;  3HOT A;  1KD1 O;  4DTU A;  1N34 K;  5KQD A;  1HNZ K;  3HK2 A;  1YF5 L;  3QET A;  3SZ2 A;  4DQR A;  3J7Y P;  1NWK A;  3QLH A;  4HVJ A;  3A5L C;  4G9Z A;  3CC7 N;  3FZF A;  1KAX A;  4JI2 K;  4DSF A;  2GWJ A;  3AVJ A;  1XI1 A;  1NJI O;  5AQJ A;  4CIE A;  2CGK A;  4KTZ A;  5GAE P;  3L8B A;  3QNN A;  2YJF A;  4L3Q A;  1RGI A;  4FXD A;  3FR0 A;  3KKR A;  1NGD A;  2D0B A;  3RSE B;  3LDP A;  5HRO A;  4OO1 J;  4B1Z A;  3UKU B;  4B3R K;  3ULE B;  4CJW A;  1HX1 A;  5KQ8 A;  3O9R A;  3WXM B;  3SAG A;  4YOU A;  3THW A;  1M1K O;  2HHU A;  3AVF A;  4F3O A;  3ALY A;  4CGI A;  3NVK A;  1CXU A;  1C0T A;  3TAN A;  3VPZ A;  2XY5 A;  1C1B A;  4FWR A;  3K9K A;  4YDU A;  2HMI A;  1VQ5 N;  3H46 O;  1J9A A;  3VES A;  2P9P A;  1QSL A;  3VQA A;  3FZM A;  3TR8 A;  3C6U A;  3HVT A;  5AQG A;  4WFB L;  2P9P B;  3AO3 A;  3ZCM A;  2IIR A;  4DR4 K;  4BRI A;  3K57 A;  1JCE A;  4LH4 A;  1WNS A;  4LSL A;  4DTS A;  1JL2 A;  4BRL A;  4B1U B;  4KHY A;  2F9W A;  1SAZ A;  4ILH A;  3C94 A;  1E3M A;  4F3T A;  3VQ5 A;  5C12 A;  2HHV A;  3HSC A;  3HP9 A;  5SWM A;  1QVG M;  1QQO A;  3FZH A;  4BWJ A;  3VGK A;  1KVC A;  1HYV A;  4OKE A;  3TAM A;  2FBT A;  3EE8 A;  4CED A;  1KVB A;  1BI4 A;  1NGB A;  4O5B A;  3VEZ A;  4QOZ B;  2FSN A;  2OAN A;  3SUN A;  2HNY A;  4PHT X;  2HVI A;  3NGY A;  3M8Q A;  5I3U A;  2KFZ A;  4I2P A;  1S1X A;  3OYF A;  2HST A;  1N6Q A;  1TL3 A;  4CF1 A;  1MWM A;  3LPU A;  3KK7 A;  2GX9 A;  2FSK A;  3HJF A;  3NCI A;  2ZJQ L;  4ID5 A;  4O0J A;  4OX9 K;  3ZEU B;  3ENH A;  3VQE A;  2CH5 A;  3BF3 A;  3CJ7 A;  5EOY A;  3QER A;  4X66 K;  3HXM A;  3BY5 A;  3N4Q A;  4N47 A;  4IFY A;  1S6P A;  2YJE A;  3OTO K;  1GOA A;  1RBV A;  3VOV A;  4WE1 A;  1NNE A;  1CZA N;  4AM7 A;  1XMO K;  3AVK A;  4B1W B;  4M3R A;  1DLO A;  1NGA A;  5AZI A;  1GOC A;  1TYQ B;  1I3A A;  2NRH A;  2HOE A;  3EKS A;  3ZSX A;  1ITG A;  2NRT A;  4DF4 A;  4GV6 A;  4B9T A;  1ZBS A;  3E9L A;  4YOR A;  1NBW A;  1I94 K;  4HCC A;  4KBO A;  4CJS A;  3O3H A;  3KZB A;  2E88 A;  2OPP A;  2ZE2 A;  1S1W A;  4J8F A;  4PA1 A;  5GIN A;  4BC4 A;  2OPR A;  4B9Q A;  5EU7 A;  5AQN A;  3BF1 A;  3WEE A;  4O55 A;  3O3F A;  3SAF A;  2YHB A;  2WUS A;  4CCH A;  4DSK A;  1MWK A;  4A62 A;  1TKX A;  5AQH A;  1GLJ O;  2NRV A;  4KB0 A;  4MDB A;  1T44 A;  3O3G A;  4CJP A;  2QKB A;  4BE0 A;  4B9L A;  4GVE A;  1MU2 A;  4MLE A;  1Q8I A;  1QQM A;  5GIP A;  4JKC A;  3W0L A;  3VQB A;  1I39 A;  4O0I A;  1KXP A;  3H3N O;  5I42 A;  1NLV A;  4NCA A;  2O8E A;  3KIO A;  3OS0 A;  4QS8 A;  1UA1 A;  4H4O A;  3WT0 A;  5SZT A;  2O8E B;  3U9Z A;  5EX5 A;  1NGJ A;  2BE2 A;  1N32 K;  1FW6 A;  4CEB A;  3SQ4 A;  1W2B M;  3QDK A;  4CEE A;  3PV8 A;  2D1K A;  4FLU A;  1YJN N;  1RFQ A;  4BR5 A;  4M42 A;  3ZT1 A;  2HHS A;  2RN2 A;  3O9Q A;  2G8H A;  1X9S A;  4CZE A;  2WON A;  3AA5 X;  3VEW A;  3ZYY X;  1LWC A;  3H08 A;  3L3V A;  1IG9 A;  4BRC A;  3D2F A;  1S9G A;  2G8W A;  2VGN A;  1NKC A;  2VQF K;  1X9J A;  4KO0 A;  1C6V A;  3D2F B;  3V9X A;  3O80 A;  1JJ2 M;  5CZ2 A;  2ZF5 O;  3CXC M;  1XWL A;  4H0T B;  4C8N A;  3DLB A;  3T7Z A;  3KLF A;  3TAE A;  1QE1 A;  4ELT A;  3KD1 E;  1S5J A;  5DM7 L;  4CF2 A;  1NG9 A;  4ELU A;  4AHC A;  3DXK B;  4Q5V A;  1BU6 O;  3DRP A;  4RW8 A;  1HNX K;  1TL1 A;  4IOX A;  1QSS A;  4BDY A;  5FRO A;  1EWQ A;  3BZC A;  4FK4 A;  2UXC K;  4PL8 A;  3WXJ A;  4Y1D A;  4B3T K;  5HRR A;  5M1Q A;  1IJJ A;  1VRU A;  3UE5 A;  3TI0 A;  1BGX T;  4IWV A;  3RR8 A;  4OKK A;  3VEO A;  4CK1 A;  2D0A A;  2VYP A;  1WSE A;  4QS9 A;  3KKS A;  4KPY A;  2NUB A;  2F8S A;  4O5F A;  1C0M A;  1U47 A;  1RDC A;  3WNH A;  1XNQ K;  2P9L A;  2CGL A;  1BA1 A;  2O8D B;  4PKI A;  4FJX A;  3HYF A;  1ESV A;  1UOC A;  1KC8 O;  5FLX O;  1SL1 A;  4HCB A;  2P9L B;  1K9M O;  2FLO A;  4YHH K;  4FJ8 A;  3VEY A;  2VGM A;  2D0P A;  4CF8 A;  1N5Y A;  4YNQ A;  4JK7 A;  3F9M A;  2NRZ A;  5M1N A;  2JLE A;  2FC0 A;  1EKE A;  3MN9 A;  4CJE A;  1KLM A;  3AGR A;  2RE2 A;  4FYD A;  3AVC A;  3MMV A;  3LDN A;  5CHI A;  4WQ5 C;  2WFB A;  3QBX A;  2B5J A;  2E20 A;  4NLC A;  2Q36 A;  2HMP A;  2A1R A;  1KFD A;  1ASU A;  3R6M A;  4N41 A;  5AQO A;  3QIC A;  2OPQ A;  4WYB A;  5AQK A;  4Z4E A;  3DLE A;  1XUP O;  3GOI A;  1BG3 A;  3E1Y A;  1TKD A;  1WBD A;  2RF2 A;  4FWQ A;  3EY1 A;  3PSI A;  3LP3 A;  4DUZ K;  3TSU A;  1UWB A;  3T19 A;  4CI6 A;  1NGE A;  2ZD1 A;  3MXM A;  5FPM A;  3JS6 A;  4LD0 A;  4A61 A;  1NK9 A;  2OA8 A;  1KSP A;  3G10 A;  2OCE A;  3SV4 A;  1HYZ A;  4FWM A;  1T05 A;  1SUQ A;  1LCU A;  2DPN A;  3DOL A;  4DSI A;  4DQS A;  5KGX A;  2BH1 A;  4RTF D;  2HBJ A;  2HBL A;  3ITH A;  5EY4 A;  5BPN A;  4RWT A;  3O08 A;  4AHV A;  3NF6 A;  4MFB A;  3K59 A;  1VQ8 N;  3D6R A;  4DSE A;  5AJ3 K;  3LM9 A;  4JK8 A;  1WN7 A;  1RBU A;  3I8D A;  4DTJ A;  5GAG P;  4ZTF A;  1V4S A;  1EQY A;  1NMN A;  3MCP A;  2DTU A;  4CER A;  4A2A A;  3IS9 A;  2BDP A;  4CD1 A;  4LF4 K;  1RCH A;  1ZBF A;  4JD2 B;  1WAF A;  4BRQ A;  4ISG A;  4BRM A;  1FJG K;  2ZWH A;  1IV0 A;  1XC3 A;  4NCG A;  3VTH A;  1ZBH A;  4BVO A;  1YUW A;  3V9W A;  1NM1 A;  2HHH K;  5TKY A;  3IMX A;  3MEG A;  4Z94 A;  4WCE L;  3LAM A;  4JYA K;  2QWR A;  3GDQ A;  3EE9 A;  3SQ2 A;  4CJ4 A;  4DQQ A;  2B4J A;  2YHA A;  4C23 A;  2Q31 A;  4IOC L;  4IO8 A;  3BP8 A;  3LP1 A;  1X3M A;  4M7Y A;  1OH8 A;  2QWP A;  3GL1 A;  1HQE A;  4KRF A;  5JS2 A;  2HNZ A;  3OY9 A;  4IDH A;  3AV9 A;  4CHN A;  1RDA A;  1IO2 A;  2E2N A;  4LH5 A;  5CYQ A;  4DV3 K;  1SKS A;  4DTR A;  4U67 L;  4JHD B;  4H0X B;  1RDB A;  1T03 A;  2W40 A;  1G15 A;  4Z4H A;  3SV3 A;  3VQ9 A;  3CQ8 A;  3CF5 L;  4KTW A;  4N56 A;  3RVC A;  1C0G A;  3RRG A;  5DM6 L;  1J53 A;  1KCF A;  4O44 A;  3MX5 A;  3M1F A;  3QO9 A;  4K41 A;  3CCR N;  3H3O B;  3KK3 A;  3UKR A;  1HQU A;  1RBR A;  4DTX A;  4KI6 A;  3K5M A;  5C0Y A;  1NK4 A;  1X3N A;  2PYL A;  3HM9 A;  3QIN A;  1QVF M;  3ZT4 A;  1HRH A;  1QTM A;  2P9N A;  1UA0 A;  4C8O A;  3TU5 A;  3ID8 A;  4CZI A;  2P9S A;  4B3O A;  1D4X A;  2P9N B;  3RMD A;  4DTN A;  3OYE A;  2QWM A;  4BQL A;  2P9S B;  4FLX A;  2B6A A;  1RT4 A;  4FZY A;  3LDS A;  5LMN K;  2CGJ A;  2HVH A;  2P1J A;  2OZM A;  4W5R A;  1TKT A;  1X9W A;  3H6E A;  2FF3 B;  3VGL A;  3SNN A;  1RBT A;  3DRR A;  3U8X A;  4I6M A;  2NNW A;  4JKD A;  1RDU A;  3NAE A;  4XIU A;  4FJ5 A;  1WOQ A;  2HB5 A;  4DR1 K;  1O1W A;  2BTF A;  2YHW A;  3KLG A;  2RKI A;  4J2A A;  3NDK A;  4C8K A;  4YOX A;  1K8A O;  2I7N A;  1S3X A;  4R79 A;  1BQM A;  4WFA L;  2ZJR L;  3VET A;  4CEF A;  3ATU A;  3L3U A;  3M3Z A;  4JI7 K;  1YTU A;  4DSJ A;  3HVR A;  3VA3 A;  4DU1 A;  1JLE A;  3VEX A;  2QW9 A;  1WLJ A;  3Q7B A;  1RT3 A;  1J54 A;  4DHY A;  3T69 A;  3HBT A;  5JVG L;  4BDP A;  3VQ6 A;  3WXK A;  3IRX A;  4CVN E;  3DWL A;  4FVU A;  4DV1 K;  4JI6 K;  1OH6 A;  1IKW A;  2AJQ A;  4CJF A;  4JV5 K;  4BR0 A;  4CZK A;  2WC9 A;  4IFV A;  4KHP K;  1KFS A;  3MN6 A;  3K58 A;  2HHQ A;  4BRK A;  5TKW A;  1SQK A;  4LF9 K;  2YHX A;  1U45 A;  4JKE A;  3CER A;  1ZBI A;  2EHG A;  2XRI A;  3OS1 A;  4X64 K;  2Q2R A;  1Y97 A;  3H1Q A;  3OYG A;  4B1X B;  1FXX A;  3DXM A;  1GLB G;  3AVB A;  3WNF A;  4CJQ A;  4IBN A;  4LF8 K;  3HP6 A;  1QHT A;  3DXM B;  1IKX A;  1TVR A;  4HUF A;  2YCH A;  4LF6 K;  3L6Q A;  2F9T A;  3ZX3 A;  3AAP A;  1SZ2 A;  1A5W A;  3EO3 A;  4FOI A;  4BC3 A;  3G71 N;  4YOV A;  3QIO A;  4ICL A;  5BR8 K;  4NYF A;  2Z1I A;  1BWF O;  1BCO A;  2OPS A;  4GV3 A;  2A6A A;  2E1Z A;  3CPW M;  4JKG A;  3DLL L;  3MEC A;  1NK8 A;  1LW0 A;  5KRT A;  4O8U A;  4CJ5 A;  1C0F A;  3THW B;  4IZ9 A;  2P9U A;  3L2Q A;  4FOE A;  4DR6 K;  2FBV A;  1SV5 A;  1RT7 A;  4CEA A;  2Q0U A;  3AVI A;  4L8R B;  2ZQB A;  3TAG A;  3CCV N;  3PUF A;  1WSF A;  2D0C A;  4FM0 A;  3SK3 A;  4K43 A;  4B9U A;  4ZHR A;  1K73 O;  5JIC A;  1ATS A;  3E01 A;  3WUH A;  5K14 A;  1S1U A;  1ZBL A;  3CQY A;  1C0U A;  2VG7 A;  4FJ9 A;  3MK6 A;  4FWL A;  1XHX A;  4CFD A;  2AA4 A;  3VEN A;  4GY2 B;  3VTI A;  4A2B A;  3HPO A;  3OS2 A;  4M3T A;  2FF6 A;  3LDL A;  3CC2 N;  5GAH P;  4KHN A;  1RTI A;  1VQ6 N;  2WTU A;  3LZJ A;  1A5V A;  4CGH A;  1LWF A;  1BL3 A;  4DV5 K;  2QKK A;  3NE6 A;  4H0O A;  1VSD A;  1U49 A;  4FJM A;  2Y1J A;  1BI4 B;  3U6F A;  1VSJ A;  3O4Q A;  4B1V A;  5BN9 A;  1YVN A;  1P8Z A;  1IBL K;  1YIJ N;  4WQ4 A;  4CBU A;  2HBK A;  1VSF A;  1QQN A;  4CHP A;  3KLE A;  1IKY A;  4KHU A;  1NK0 A;  4K0K K;  4W5O A;  2PZS A;  4JK9 A;  2VWJ A;  3SAH A;  1BIS A;  4AF1 A;  2FBX A;  3CIP A;  4CZL A;  1EX4 A;  3I33 A;  2UUA K;  2YHY A;  4NB4 A;  1G99 A;  1LOT B;  1HKC A;  4GKK K;  3TAF A;  2IVP A;  5FPD A;  5H1S Q;  1FKP A;  2UUB K;  3THX A;  3ZET A;  4OPK A;  3TAR A;  4Y1C A;  5E84 A;  3ZX2 A;  2Q97 A;  1KTQ A;  3KHY A;  3THX B;  4CBW A;  3I8B A;  1JLC A;  5C15 A;  3NBP A;  3WQU A;  5AZI B;  2D5R A;  1NKB A;  5AQT A;  3AO5 A;  3CHW A;  3IFR A;  3S9H A;  1YHQ N;  2GWK A;  4BGA A;  1VSM A;  4CJT A;  3IAY A;  3DLG A;  3OYN A;  5FRM A;  2W42 A;  3TWH A;  3QEX A;  1VRT A;  4DV4 K;  1V4T A;  5E41 A;  2J4R A;  3C7N A;  4K8Z A;  2W6K A;  1WUA A;  1YXQ A;  4DSL A;  3WEE B;  3CG7 A;  2KZM A;  1H1V A;  1Q86 O;  3DOK A;  3NHG A;  4M3Y A;  3J7Z O;  1Z26 A;  4BVP A;  4EFH A;  4CHQ A;  1LW2 A;  4PQU A;  3T1Y K;  4FWS A;  5AQU A;  4LFB K;  5JVH L;  1SL0 A;  3SUP A;  1VQM N;  1GLC G;  3O9U A;  4DG1 A;  4I9L A;  1W7A A;  3O6W A;  1EXQ A;  1VSH A;  3CFO A;  2NRW A;  3SBG A;  1YJ9 N;  1ASW A;  2F8T A;  1KQS M;  1K8K A;  1J6Z A;  2KQ2 A;  1RT1 A;  3J80 O;  5AQR A;  3SBT A;  1DGK N;  5FPE A;  3IDH A;  1Z6R A;  3HST B;  4EIA A;  2IGI A;  3LM2 A;  2IVN A;  1IKV A;  4GVM A;  3T3F A;  2QK9 A;  5T7B A;  1VSE A;  4FJH A;  5DMR A;  3OYA A;  4OKJ A;  4FCY A;  1HKG A;  4FW1 A;  3NFA A;  1JLG A;  4JAX A;  4HUG A;  1WB9 A;  2A1S A;  4A5A A;  2FBY A;  4DKW A;  3VQ8 A;  3JAM O;  4M63 C;  5GIO A;  4CHO A;  5AQS A;  1D9D A;  4J2D A;  3TAB A;  1VSK A;  3OHR A;  1U2V A;  5M1P A;  3SUQ A;  3A0I X;  5C42 A;  3PO5 A;  3KVG A;  3ENB A;  2HHW A;  2G8F A;  1NJW A;  2KHO A;  4KH4 A;  1ZXO A;  1BCM A;  1VQN N;  3V4I A;  5J2P A;  4EHT A;  3G0Z A;  3ZSR A;  4MDA A;  3V9S A;  2X74 A;  4QAG A;  5C25 A;  2DFE A;  1YIT N;  3C65 A;  3WQT A;  5M1K A;  3CCM N;  3THV A;  1EWR A;  3V9Z A;  3WXL A;  3ZX0 A;  2E6M A;  1RT5 A;  3VEV A;  4KAZ A;  3MWT A;  4EZ9 A;  4WFN L;  3A5N C;  3VMF B;  3OYK A;  4A5B A;  2P51 A;  4HWI A;  3LP0 A;  3VA0 A;  2HF3 A;  5AQI A;  2XY6 A;  1U04 A;  5KI6 A;  1LV5 A;  1FKO A;  4NXM K;  3PX0 A;  3AO2 A;  4RW7 A;  1REV A;  1TAU A;  1VQ9 N;  3NF8 A;  3BUZ B;  5J2Q A;  3DRS A;  2VWB A;  1NJY A;  2O8C A;  2WBN A;  1JXE A;  3IUC A;  4AH9 A;  1WSH A;  1XQS C;  3OJU A;  3PO4 A;  1WAJ A;  4OVL A;  3TTC A;  3F9K A;  1JLQ A;  1KAZ A;  1Q9X A;  2ZM6 K;  4FZZ A;  3CFP A;  4RCH A;  3THY A;  2A5X A;  4Z4C A;  4F2S A;  4FK2 A;  4DV2 K;  4IG3 A;  4NXN K;  4CF0 A;  3CCU N;  2P5O A;  3THY B;  3NGZ A;  3ID6 A;  1W0H A;  4J2B A;  5HRP A;  3CQX A;  3QEP A;  2KLA A;  1DEJ A;  1RT6 A;  1NK6 A;  3ZSW A;  5FRN A;  2BAN A;  3NMU A;  5M1O A;  2E2O A;  4GNI A;  4DLG A;  3L4Q A;  5J2M A;  1E4G T;  1OVY A;  3MXJ A;  2O4G A;  4DR7 K;  4C8M A;  1U4B A;  2R7Y A;  3QES A;  5GAD P;  2HF4 A;  3ZSZ A;  1RTD A;  3V1R A;  1J5O A;  1BIZ A;  1RDW X;  3JYT A;  4OPA A;  3PLA A;  4CZF A;  4B3M K;  1S1V A;  3CD6 N;  3ZSY A;  1OKJ A;  2A41 A;  3P4I A;  2YV0 X;  2I7P A;  3CJ1 A;  3ZT3 A;  4EAH D;  3LDO A;  2H3G X;  4KFB A;  4HHT A;  4CGD A;  1CLQ A;  2ASP A;  1SS6 A;  3E9P A;  3HOS A;  4M3X A;  4JRQ A;  4JS5 A;  1HMV A;  2W6L A;  3G4S N;  3N4P A;  1NU0 A;  4DLE A;  4FLY A;  4E7H A;  1GLA G;  3EZ5 A;  4E7I A;  1N8R O;  3C6A A;  3Q7C A;  3ZT0 A;  1BDG A;  3R8E A;  1VSI A;  2GUP A;  4OJR A;  1B9D A;  1EET A;  5J1E A;  3B6O A;  1IH7 A;  2IAJ A;  4FO0 A;  4O4G A;  3G25 A;  4KKO A;  2D4W A;  4M3Z A;  3K5N A;  4BRF A;  3CJA A;  3IG1 A;  3NGI A;  1XHZ A;  4H0Y B;  4CHY A;  1NGG A;  1S1T A;  3OYD A;  2JWK A;  3CM5 A;  4JI4 K;  1VQ7 N;  4LFA K;  1YI2 N;  3DLH A;  4FWN A;  3MCA B;  3UIQ A;  2GUI A;  5EXW A;  5AR0 A;  3AVH A;  5KGW A;  1JL1 A;  3AVG A;  4FLT A;  2XHB A;  4BDZ A;  1IG8 A;  4XH1 A;  4FJG A;  1HUX A;  2HND A;  1NJX A;  2OTJ N;  3FGU A;  4CJV A;  4FLZ A;  3AVL A;  4LC9 B;  4DU3 A;  2GBZ A;  3O1W A;  4I2Q A;  2V51 B;  4YDU C;  3HRG A;  4ILG B;  1C1A A;  4FK0 A;  3TTD A;  1DT9 A;  4CD3 A;  3K0S A;  2DY4 A;  3CME N;  1ILY A;  1D8Y A;  2V52 B;  2D0O A;  4E89 A;  3AVN A;  3KK1 A;  3C0B A;  2ETJ A;  3K5L A;  4IXC A;  4IO9 L;  4ELV A;  3VN5 A;  4AHR A;  2Z1H A;  2G8U A;  3ASM A;  5CZ1 A;  4IEE A;  4JI0 K;  4GV9 A;  5HRN A;  1NJZ A;  4CF9 A;  1S6Q A;  5LY3 A;  2HHT A;  1X9M A;  4RW4 A;  2UU9 K;  3EZW A;  4UQG A;  3P39 A;  3AVM A;  1RT2 A;  3HPG A;  4PY5 A;  1GLD G;  3SQ0 A;  4JI8 K;  4IKF A;  1TK5 A;  3OYC A;  4FWK A;  3TSP A;  4JKF A;  3U4L A;  4R5P A;  3HPH A;  2A3Z A;  4E19 A;  3LP2 A;  4BR7 A;  3L2V A;  4MLH A;  2Z1G A;  3EL2 A;  2V7Z A;  2UXB K;  4OGC A;  1B9F A;  4BE2 A;  3PX6 A;  3UKR B;  4FJK A;  2V7Y A;  4JKB A;  3R1X A;  1IBK K;  4KI4 A;  2NRR A;  2YX6 A;  4TSX A;  4WQ4 C;  2IOC A;  4JRP A;  1KRP A;  4CJK A;  1HLU A;  3LDQ A;  1QQC A;  1DTT A;  4E7J A;  3O4N A;  3BGR A;  5CE3 A;  2PY5 A;  2ZJP L;  5C2D A;  1BO5 O;  4PKH A;  4LFC K;  4CK3 A;  3F73 A;  5AQW A;  2PYJ A;  2O8B A;  2RHK A;  5A2Q O;  5AQV A;  1HPZ A;  4DV6 K;  1L3V A;  3EYZ A;  3OYI A;  1JCG A;  1XNR K;  5F1X A;  1VQK N;  1L3S A;  3O8M A;  4DTP A;  4NYN A;  1HKB A;  3CCS N;  1N33 K;  4DB3 A;  4ISE A;  5AFU H;  4I6M B;  3C6H A;  1VQP N;  4H5T A;  4UY8 O;  2KTQ A;  1MA9 B;  4JN4 A;  4Z4G A;  3NF7 A;  4B9V A;  4Z0U A;  3VQC A;  1D5A A;  4BRD A;  1TAQ A;  1HR0 K;  3JSM A;  3DJC A;  1ZYQ A;  4B9N A;  3SMP A;  4JI5 K;  4FJN A;  2O8F A;  3QB0 A;  3V9U A;  5KPZ A;  4YOY A;  3LPT A;  3VER A;  4CFC A;  4FZX C;  1GOB A;  1TUU A;  3O9T A;  3VQP A;  3D45 A;  4ID1 A;  4KV8 A;  4JNE A;  2KZZ A;  3C6T A;  2GEL A;  4DTM A;  2NZT A;  3L4I A;  3AO4 A;  4EP4 A;  3VF4 A;  3AAQ A;  5IWA K;  4AM6 A;  2A40 A;  3B8A X;  2GEM A;  3SI6 A;  3CMA N;  1Z05 A;  1U48 A;  1TKZ A;  3V6D A;  3P5J A;  3T1H K;  1B92 A;  1Z25 A;  3VQ4 A;  4DCH A;  3A5O C;  4CJR A;  1IBM K;  1BOT O;  4CEO A;  2YKM A;  4YFU A;  1NK7 A;  1L3T A;  4F4K A;  4BG8 A;  2AP1 A;  4DF8 A;  1NKE A;  1T7P A;  4FPA A;  2ASO A;  2VG6 A;  3O1B A;  2ZGZ A;  2NLX A;  4BC5 A;  4CGF A;  1T3V A;  4B8C A;  3O4W A;  3UB5 A;  3ZT2 A;  4JKG B;  2E1Y A;  4DQ8 A;  3C95 A;  3A8Y A;  3RSE A;  1FK9 A;  3UKU A;  3ULE A;  2P9U B;  4C8L A;  4IFE A;  3KWI A;  3JXU A;  4PWD A; 
#chains in the Genus database with same CATH homology
 5AQU A;  4XEI A;  3HZ6 A;  5JVH L;  1U6Z A;  3LDN A;  5CHI A;  4WQ5 C;  5AQZ A;  2IVO A;  2WFB A;  1R59 O;  1VAZ A;  2E20 A;  3QBX A;  3QML A;  1GLC G;  1MDU B;  2Q36 A;  3O9U A;  4H5R A;  4NLC A;  1VQM N;  2HMP A;  3CJB A;  5AQL A;  3O6W A;  3R6M A;  4QS7 A;  5AQO A;  2NRW A;  3SBG A;  3CJC A;  3QIC A;  4WYB A;  5AQK A;  5FPN A;  3OW2 M;  1YJ9 N;  1XUP O;  1KQS M;  3GOI A;  1BG3 A;  3E1Y A;  1K8K A;  1J6Z A;  3I55 N;  3TSQ A;  4FWQ A;  2ITM A;  5AQR A;  1BA0 A;  3SBT A;  1DGK N;  4IJA A;  3CCQ N;  5FPE A;  3H1V X;  4CBX A;  3CCL N;  3IDH A;  3TSU A;  1BUP A;  3O5B A;  1NGE A;  4CI6 A;  1Z6R A;  3FFK B;  3E9O A;  4FWP A;  5FPM A;  3JS6 A;  4JKH A;  3WXI A;  4EIA A;  5BRE A;  4NO7 A;  3LM2 A;  4A61 A;  2IVN A;  3IKM A;  2QA4 N;  1YJW N;  1Q7Y O;  3EN9 A;  3FE1 A;  3AAR A;  5BN8 A;  4OPH A;  1HKG A;  4FWM A;  5BR9 A;  1LCU A;  2DPN A;  4JAX A;  3ENO A;  3KWG A;  2BH1 A;  4RTF D;  4BR4 A;  4BRP A;  2HBJ A;  4MO5 A;  4A5A A;  2HBL A;  5HL7 L;  4H5N A;  5EY4 A;  5BPN A;  3DAW A;  4RWT A;  4ILJ A;  4FWO A;  4DKW A;  4NLB A;  2UYT A;  3O08 A;  4M63 C;  5GIO A;  3GBT A;  5AQS A;  1VQ8 N;  3D6R A;  5LJV A;  3W3D A;  2OTL N;  3J8A A;  1ATR A;  4FL9 A;  3SJH A;  3LM9 A;  4JK8 A;  4BRH A;  3OHR A;  5I9E B;  1U2V A;  5M1P A;  4YOW A;  3A0I X;  5GAG P;  3KVG A;  3ENB A;  4KH6 A;  4XH4 A;  1V4S A;  1Q81 O;  1EQY A;  4WQ5 A;  3MCP A;  4BRO A;  2KHO A;  4KH4 A;  4A2A A;  1ZXO A;  3O9S A;  5M1F A;  1VQN N;  4EHT A;  4CD1 A;  3SLC A;  4JD2 B;  4BRQ A;  4ISG A;  4MDA A;  4BRM A;  2ZWH A;  2QWN A;  3PIO L;  5EVZ A;  1YIT N;  1XC3 A;  1NGC A;  1Q18 A;  3VTH A;  2PFU A;  4BVO A;  1YUW A;  3C65 A;  3WQT A;  5M1K A;  2GTD A;  5HOO A;  3CCM N;  1NM1 A;  2P9I A;  4CZM A;  3R3L A;  3WXL A;  3ZX0 A;  2E2Q A;  3ZEU A;  2Q0R A;  3IMX A;  5TKY A;  4Z94 A;  3I56 N;  2QWQ A;  4WCE L;  2P9I B;  3VEV A;  3MWT A;  2QWR A;  3HTV A;  3E66 A;  3P31 A;  3GDQ A;  3EE9 A;  4WFN L;  3A5N C;  3VMF B;  3ZET B;  4CJ7 A;  3OBY A;  4BR2 A;  4A5B A;  4HWI A;  3D7E O;  2HF3 A;  1T6D A;  5AQI A;  3LL3 A;  2Q31 A;  4C23 A;  4IO8 A;  4IOC L;  3CC4 N;  3BP8 A;  4FPB A;  4XH5 A;  4IOA L;  3CET A;  1HJO A;  2W41 A;  1X3M A;  4M7Y A;  5AZJ A;  2QWP A;  3GL1 A;  1GLL O;  5BRD A;  4BG9 A;  3A5M C;  3HOT A;  3BUZ B;  1VQ9 N;  1KD1 O;  5AZJ B;  2VWB A;  2WBN A;  1TYQ A;  5KQD A;  3M6G A;  3IUC A;  4H5V A;  4CZJ A;  3FZL A;  5AQF A;  1JCF A;  1XQS C;  1YF5 L;  1KAY A;  4C1N K;  4IDH A;  4BY9 C;  1NWK A;  3A5L C;  3TTC A;  4G9Z A;  3CC7 N;  1KAZ A;  3FZF A;  1KAX A;  5LJW A;  2GWJ A;  3C7N B;  2E2N A;  4RCH A;  1P90 A;  5F2R A;  1NJI O;  5AQJ A;  2A5X A;  2CGK A;  5GAE P;  4U67 L;  4JHD B;  4H0X B;  2W40 A;  3FZK A;  3CCU N;  2YJF A;  4L3Q A;  1RGI A;  3CF5 L;  3FR0 A;  3ID6 A;  1NGD A;  3RSE B;  3LDP A;  3RVC A;  3CQX A;  4OO1 J;  2KLA A;  1DEJ A;  4B1Z A;  1C0G A;  3UKU B;  3ULE B;  3NMU A;  5M1O A;  2E2O A;  1HX1 A;  5DM6 L;  4F9O A;  4GNI A;  5KQ8 A;  3L4Q A;  3O9R A;  3MX5 A;  4YOU A;  1E4G T;  3M1F A;  3WXM B;  3SAG A;  1M1K O;  4K41 A;  1OVY A;  3NVK A;  1ZC6 A;  3CCR N;  3H3O B;  5C0Y A;  3UKR A;  5AQQ A;  3VPZ A;  5GAD P;  2HF4 A;  3K9K A;  3OA9 A;  4FWR A;  4JKA A;  4YDU A;  3S41 A;  3TTF A;  1X3N A;  3H46 O;  1VQ5 N;  3VES A;  1QVF M;  2P9P A;  1K8K B;  1RDW X;  1GLE G;  3FZM A;  5AQG A;  1S72 N;  4OPA A;  4BC2 A;  4WFB L;  2P9N A;  2P9P B;  2IIR A;  4A57 A;  3TU5 A;  3PLA A;  1HPM A;  3ID8 A;  4BRI A;  4CZF A;  4CZI A;  3SMS A;  2P9S A;  3U9D A;  1D4X A;  3CD6 N;  1JCE A;  2P9N B;  1OKJ A;  2A41 A;  3P4I A;  2I7P A;  2QWM A;  3FLC O;  4BQL A;  3CJ1 A;  2P9S B;  3P38 A;  4EAH D;  3LDO A;  2QTD A;  2H3G X;  4BRL A;  2CGJ A;  3MN5 A;  4B1U B;  2ASP A;  2F9W A;  1SS6 A;  3E9P A;  3HOS A;  3H6E A;  1SAZ A;  4ILH A;  2FF3 B;  2QWO A;  4U7B A;  3G4S N;  3N4P A;  5C12 A;  3VGL A;  3HSC A;  4PL7 A;  2PBD A;  1GLA G;  3CJ9 A;  1QVG M;  1QQO A;  3FZH A;  3U8X A;  5BRF A;  1N8R O;  3C6A A;  2FSJ A;  3Q7C A;  4I6M A;  4ISF A;  1BDG A;  2NNW A;  2NRX A;  3R8E A;  3VGK A;  4EHU A;  1VQ4 N;  2GUP A;  4JKD A;  3G6E N;  3F5T A;  1RDU A;  1WOQ A;  1U2V B;  3VGM A;  2BTF A;  2YHW A;  3EE8 A;  3MWP A;  3G25 A;  4FO0 A;  2D4W A;  3NVM A;  3VEZ A;  1NGB A;  4BRF A;  3HI0 A;  4YOX A;  2FSN A;  2I7N A;  2OAN A;  1K8A O;  3CJA A;  2FXU A;  1S3X A;  4H0P A;  4R79 A;  4WFA L;  2ZJR L;  3VET A;  5ADX A;  4PHT X;  3ATU A;  4H0Y B;  3M3Z A;  1NGG A;  1VQ7 N;  2JWK A;  1YI2 N;  5MLC Q;  4BRG A;  2HST A;  4FWN A;  3MCA B;  2QW9 A;  3VEX A;  3Q7B A;  5EXW A;  5AR0 A;  4DHY A;  3T69 A;  1MWM A;  3HBT A;  5JVG L;  3KK7 A;  2GX9 A;  3WXK A;  3DWL A;  2ZGY A;  2FSK A;  1IG8 A;  4FVU A;  4XH1 A;  1HUX A;  4A59 A;  5JLH A;  2ZJQ L;  2OTJ N;  3FGU A;  3DXK A;  3ZEU B;  3ENH A;  3H45 C;  1S22 A;  4LC9 B;  2CH5 A;  4BR0 A;  5JMV A;  4CZK A;  2WC9 A;  3O1W A;  3BF3 A;  1Y64 A;  3CJ7 A;  3MN6 A;  5EOY A;  4E1J A;  2QWL A;  2V51 B;  4YDU C;  4BRK A;  3HRG A;  5TKW A;  4ILG B;  3TTD A;  1DT9 A;  3N4Q A;  4CD3 A;  1SQK A;  3CI5 A;  2YHX A;  2YJE A;  3CME N;  4JKE A;  3CER A;  4BRN A;  3R9P A;  1NMD A;  3AGK A;  3VOV A;  1ILY A;  2Q2R A;  1CZA N;  2V52 B;  2D0O A;  4AM7 A;  4MO4 A;  3H1Q A;  4B1W B;  3C0B A;  3EKU A;  4B1X B;  4IXC A;  4IO9 L;  3DXM A;  1NGA A;  5AZI A;  1GLB G;  1TYQ B;  2NRH A;  2HOE A;  3EKS A;  2ASM A;  1YAG A;  4IEE A;  2QM1 A;  3DXM B;  3ATV A;  4GV9 A;  4M7X A;  5LY3 A;  2NRT A;  4Y0W A;  4GV6 A;  1ZBS A;  2YCH A;  3E9L A;  3L6Q A;  1NBW A;  2F9T A;  3AAP A;  4YOR A;  5ELZ A;  1SZ2 A;  3EZW A;  3ZX3 A;  4KBO A;  5ADX H;  3P39 A;  1O13 A;  3EO3 A;  4BGB A;  1ATN A;  4FOI A;  4BC3 A;  1GLD G;  3KZB A;  3CCJ N;  2E88 A;  4CZG A;  3G71 N;  4YOV A;  4J8F A;  5GIN A;  3GG4 A;  5F0X A;  4FWK A;  3TSP A;  1QHA A;  4BC4 A;  4B9Q A;  4JKF A;  5AQN A;  5CR4 A;  3BF1 A;  3U4L A;  4K25 A;  4BQZ A;  1BWF O;  2A3Z A;  3WEE A;  2QXL A;  5KPR A;  3SAF A;  4BR7 A;  4GV3 A;  2A6A A;  2E1Z A;  3CPW M;  4JKG A;  3DLL L;  4MLH A;  2QI2 A;  2WUS A;  1NGI A;  1MWK A;  3VF6 A;  4O8U A;  4A62 A;  3EL2 A;  2V7Z A;  1C0F A;  1GLJ O;  3QFU A;  2NRV A;  5AQH A;  4IZ9 A;  2P9U A;  4MDB A;  1T44 A;  4FOE A;  1VQO N;  5AQX A;  2PAV A;  2Q0U A;  3UKR B;  4GVE A;  2V7Y A;  3GE1 A;  4JKB A;  1TUY A;  4MLE A;  3CCV N;  1QQM A;  3L0Q A;  3R1X A;  2JWL A;  2NRR A;  4JKC A;  3W0L A;  2YX6 A;  5GIP A;  4WQ4 C;  5B8H A;  1KXP A;  3H3N O;  3SK3 A;  4K43 A;  3F2K A;  1HLU A;  1NLV A;  3LDQ A;  1EO1 A;  2E2P A;  4KH5 A;  5JIC A;  1ATS A;  4QS8 A;  1K73 O;  3WUH A;  3WT0 A;  3PIP L;  3VF2 A;  3CQY A;  3U9Z A;  1QZ6 A;  5CE3 A;  2ZJP L;  5EX5 A;  5C2D A;  3MK6 A;  1NGJ A;  1BO5 O;  2E8A A;  4O8K A;  2P9K A;  4PKH A;  1NGF A;  4FWL A;  5AQW A;  1W2B M;  3QDK A;  2RHK A;  1QZ5 A;  5AQV A;  2AA4 A;  2P9K B;  3VEN A;  2D1K A;  4GY2 B;  3VTI A;  1RFQ A;  4A2B A;  1JCG A;  4BR5 A;  1YJN N;  2FF6 A;  5F1X A;  3LDL A;  4WF9 L;  3CC2 N;  5GAH P;  3D2E A;  3O9Q A;  1Q82 O;  3O8M A;  1VQK N;  1VQ6 N;  4CZH A;  1HKB A;  4CZE A;  3CCS N;  4DB3 A;  3D2E B;  4ISE A;  5AFU H;  4I6M B;  3C6H A;  2Q1N A;  4JEP A;  3VEW A;  1VQP N;  4H5T A;  5C10 A;  4UY8 O;  1MA9 B;  4JN4 A;  2VCP A;  4H0O A;  3ZYY X;  5AQM A;  3D2F A;  4BRC A;  2VGN A;  3QFP A;  1X9J A;  3M5R A;  3CPE A;  4BRD A;  4B1V A;  5AQP A;  3D2F B;  5BN9 A;  3O80 A;  1JJ2 M;  2ZF5 O;  1YVN A;  3CXC M;  4HTL A;  1P8Z A;  4BRA A;  3DJC A;  4H0T B;  3SMP A;  1NGH A;  4WQ4 A;  1YIJ N;  2EWS A;  4CBU A;  2HBK A;  3T7Z A;  1QQN A;  3QB0 A;  4JD2 A;  4B1Y B;  5KPZ A;  5DM7 L;  1E4F T;  4JK9 A;  4YOY A;  3SAH A;  4AF1 A;  3DXK B;  4YOT A;  3VER A;  3CIP A;  4IEI A;  1W97 L;  4CZL A;  1VQL N;  1BU6 O;  4PKG A;  3I33 A;  4BRE A;  1TUU A;  3O9T A;  2YHY A;  4IOX A;  4NB4 A;  1M90 O;  1G99 A;  4JNE A;  1LOT B;  2GEL A;  1HKC A;  2NZT A;  3L4I A;  2IVP A;  5FPD A;  5H1S Q;  4PL8 A;  3WXJ A;  3K9J A;  3ZET A;  3VF4 A;  3AAQ A;  4H03 B;  5M1Q A;  1IJJ A;  4AM6 A;  5JLF A;  5E84 A;  3ZX2 A;  3UE5 A;  2Q97 A;  1DKG D;  3KHY A;  2A40 A;  4IJN A;  5AQY A;  3TPQ A;  2CH6 A;  2GEM A;  3B8A X;  4CBW A;  3CMA N;  1Z05 A;  4IWV A;  3I8B A;  3MN7 A;  5C15 A;  3VEO A;  4DCH A;  3WQU A;  2QEX N;  5AZI B;  4C1N I;  3A5O C;  3BEX A;  2VYP A;  3CCE N;  1BOT O;  5AQT A;  3MX2 A;  3CHW A;  4QS9 A;  3IFR A;  5E26 A;  1YHQ N;  2A42 A;  2GWK A;  4BGA A;  3MDQ A;  4K42 A;  4FSV A;  4O5F A;  4BG8 A;  1T6C A;  3OBW A;  2P9L A;  2AP1 A;  2CGL A;  1BA1 A;  5BPM A;  4FPA A;  2ASO A;  4PKI A;  2HBM A;  1ESV A;  3O1B A;  1KC8 O;  1V4T A;  2ZGZ A;  2P9L B;  2NLX A;  1K9M O;  2J4R A;  5KPT A;  3C7N A;  2FLO A;  4BC5 A;  3VEY A;  2VGM A;  2F7T A;  5AFU A;  1WUA A;  1YXQ A;  3HM8 A;  2D0P A;  3QBW A;  4BR9 A;  1T3V A;  4JK7 A;  4JHD A;  2KKZ A;  3WEE B;  5C2F A;  3O4W A;  2BUP A;  4H5W A;  3UB5 A;  1H1V A;  1Q86 O;  4JKG B;  3F9M A;  2NRZ A;  5BPL A;  2YI1 A;  2E1Y A;  5M1N A;  4DQ8 A;  3A8Y A;  3J7Z O;  3MN9 A;  4BVP A;  3RSE A;  4EFH A;  3AY9 A;  3AGR A;  2RE2 A;  3UKU A;  3ULE A;  2P9U B;  4IFE A;  3KWI A;  1GLF O;  3JXU A;  4FWS A;  4H0V B;  5BRH A;  3MMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...