1ILYA

Solution structure of ribosomal protein l18 of thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
RLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGGLEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords RIBOSOMAL PROTEIN L18
publication title The solution structure of ribosomal protein L18 from Thermus thermophilus reveals a conserved RNA-binding fold.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2001-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1ilyA00
3PIOL 2OTJN 1YJ9N 1QVGM 3CCRN 1VQ4N 5MLCQ 1N8RO 5DM7L 1VQ5N 1VQLN 5GAGP 1QVFM 4UY8O 3CCQN 3I56N 4IO9L 1YITN 3CCUN 4WFAL 3CCVN 1KC8O 4WFNL 5JVHL 5JVGL 2QEXN 1YJWN 3CC2N 4IOAL 3CCJN 1YHQN 2ZJPL 1Q86O 1YJNN 1M90O 1Q82O 3CC4N 1KD1O 3J7ZO 3CMAN 3CD6N 1VQ8N 1K8AO 2ZJQL 5GAEP 5GADP 1OVYA 3CCSN 3PIPL 4WF9L 1K73O 3CXCM 1KQSM 5HL7L 5H1SQ 1VQMN 3CCMN 1VQ7N 4U67L 3CF5L 1K9MO 3CCEN 2OTLN 4IOCL 2ZJRL 3CPWM 1JJ2M 3CCLN 1W2BM 3CMEN 1NJIO 1VQKN 1ILYA 3G4SN 1YI2N 1VQ6N 5GAHP 1Q81O 1Q7YO 3I55N 2QA4N 1VQON 1VQ9N 1M1KO 1VQPN 1YIJN 5DM6L 3OW2M 3CC7N 3G6EN 4WCEL 1VQNN 4WFBL 1S72N 3DLLL 3G71N
chains in the Genus database with same CATH superfamily
1IKXA 5KGWA 1BI4A 5KQDA 1WB9A 4DR4K 3OS1A 4KO0A 3HVTA 5TKYA 3KJVA 1QE1A 4BVOA 1N8RO 1EETA 4CZIA 3LP1A 3MX5A 4JI1K 4CEQA 4N56A 3RWUA 4CJ5A 3C65A 1D9DA 4HCBA 3KVGA 3ZSQA 1GLCG 4Z0UA 1C1AA 1GLDG 5EVZA 3SAHA 4BDYA 1JLAA 1O1WA 5JVHL 3HSTB 4M3RA 3LAMA 3CQXA 3NAEA 3CC2N 1NK6A 3J8AA 3D2EA 4Y1DA 4JKGA 2Q0UA 3CJAA 4OKJA 3THYB 1W7AA 4BC2A 4L8RB 2P9UA 3LL3A 2ZM6K 3MAQA 2X6SA 1VSJA 4K41A 4DQRA 1RDBA 5JLHA 3LP2A 1RDWX 1N32K 5FPMA 4DWIA 3QERA 2IC3A 2P9NA 4KPYA 2HNZA 4FO0A 2NRXA 4E1MA 1ZBSA 1S5JA 2P9IA 4KFBA 1NK4A 3TARA 4BG8A 2D0BA 3RMAA 3HPHA 5KPTA 3KLFA 1LOTB 2P9PB 3FZMA 3V1OA 5AFUA 1C1CA 4JS4A 3B8AX 3MEEA 2FSKA 3ATUA 3HI0A 2VG6A 2KLAA 3V81A 1BIUA 2WTUA 4OLAA 4A2BA 3SUOA 5JLFA 1VQ9N 4IG0A 3VGKA 2HBJA 3DRRA 4E7LA 1RBVA 1SZ2A 2ZGZA 4PKHA 2YHAA 5EU7A 5C42A 4FLZA 5AFUH 5HLFA 1BL3A 1VQNN 4X65K 4DTUA 1IJJA 4ISGA 3UKRA 1JL1A 3SBTA 1NLVA 5C12A 2O8DB 5BR8K 4E7KA 2FSJA 4N47A 4N41A 3LP0A 3LANA 4CFCA 2Y1IA 2OZMA 1QS4A 4XH4A 4BY9C 1JLCA 2ZD1A 4LH4A 3GL1A 3A8YA 5M1KA 4HWIA 4OVLA 2PFUA 4JV5K 1YITN 3CCUN 3MN6A 5HRRA 2P5OA 4PHTX 2QEXN 4WYBA 3SUQA 2WONA 4FLXA 1QZ5A 1QQCA 5GIOA 4CI6A 3THXB 2KFNA 2E1ZA 1YJNN 3ULDA 1HJRA 3OS2A 4DR7K 3J7ZO 3DYAA 1OH8A 4CZGA 3PX4A 3HK2A 1U2VA 1CLQA 3R6MA 3PO4A 2VCPA 3O4WA 3WEEA 4FZXC 5KTQA 1VSFA 2WC9A 1B92A 2D0AA 4FK4A 5AQRA 1W9HA 1X1PA 3O9SA 2GEMA 4IWVA 3HYFA 2QWPA 1RDUA 3TAQA 3AGKA 1I3AA 2D5RA 2YJFA 4AHVA 4PUOA 3NF7A 4DLEA 3CFRA 3FZLA 5E26A 5KRTA 5J2PA 5AQWA 1RTHA 1HMVA 3M8SA 3SQ2A 1S6QA 3CERA 4DTPA 2PYLA 1GOCA 3CJ7A 3TTFA 3L2RA 5CHIA 2QXLA 4DTOA 3ZETA 5DM6L 4OO1J 2HMIA 4H0TB 3L3VA 4F3OA 2HB5A 4DTMA 2IVNA 1DEJA 3F5TA 2E8AA 1NKEA 3NGIA 2ITMA 2ZE2A 4M45A 4CJEA 2NRZA 4GVEA 1UWBA 4RG8A 4FJJA 3KZBA 1VQ4N 2D4WA 1NGHA 4FZYA 5E41A 3TSQA 4B1WB 1HPMA 1EQYA 4M3UA 2UXDK 3U9DA 4CJTA 5EOYA 1IH7A 3VQDA 1TKTA 3T19A 1MWMA 3LM9A 2HHUA 3RVCA 2ETJA 1Y97A 5FPEA 3WXMB 4IEIA 3DAWA 4H03B 4FLVA 2GX9A 2UUAK 4NB4A 4FOIA 5AR0A 3M5RA 3AO5A 3TABA 5HRPA 1UA1A 3THYA 2YHWA 4BRQA 3QO9A 2PY5A 1NG9A 5BRHA 4JKHA 3O4QA 1SKWA 4EIAA 2WBNA 3OJSA 3SUPA 3NMUA 2OPSA 4OPJA 4H5WA 1YTAA 2GV9A 4H4MA 1K73O 1QSSA 5LJVA 4AHSA 4DTJA 1HJOA 3BP8A 4FLWA 5AQLA 1BCMA 1J53A 4M42A 4FW2A 4R5PA 2Q36A 1QSLA 1YT3A 1NOZA 4RW4A 3OBWA 1KSPA 1HX1A 3CCEN 2JWLA 1LCUA 4MO4A 2P9PA 4JRQA 4CJFA 5SZTA 3EZWA 4YOVA 2Q2RA 3CPWM 3GE1A 3HM9A 3KLEA 1JXBA 1KFSA 1BWFO 4YHHK 4JK7A 3K2PA 3EZ5A 2F8TA 1TV6A 4CEEA 3NGYA 3I55N 4HUEA 4JI6K 3D7EO 2QA4N 4I9QA 4WQ4A 3AARA 2O8BB 4KKOA 1TL3A 1HR0K 4IOXA 4JI8K 3DRPA 5J2NA 1YIJN 3MK6A 4JD2B 3P5JA 5AQJA 1XC9A 2IVPA 4DR5K 1MU2A 1XWLA 3SBGA 2I7PA 4KHWA 1KVAA 3OVNA 2O8DA 1NGCA 3M8QA 1J5OA 3BUZB 3V9WA 3VEYA 3DJCA 1T05A 3U4LA 4BC3A 5AQSA 3VEWA 2R7YA 4A2AA 3M6GA 1ZBUA 4QS7A 4CJ3A 4LH5A 4DTXA 3AO4A 2VG7A 3CG7A 1Q8IA 3O6WA 3C6TA 4AM6A 1QVFM 4GVMA 1ATSA 3HOTA 4BACA 2X78A 1NGFA 5BN9A 5AQMA 2QTDA 4L3QA 4W5QA 3EE8A 4KTZA 4Z94A 4FLYA 1A5WA 1IV0A 2FBVA 1S1VA 4E7HA 5M1OA 3THXA 5JVGL 3VERA 3ZSOA 3L2WA 4XH5A 4JYAK 3IDHA 4KHNA 4YY3K 4LFCK 4B3RK 4DU4A 4XIUA 3FE1A 2W42A 3OYHA 4OGEA 5CZ1A 5CYQA 1RILA 4CJLA 1HQEA 2EWSA 1TGOA 4O55A 4Z4EA 1RBTA 2D0CA 2DPNA 4F2RA 2DTUA 3MXJA 3MWTA 4CD1A 1NK8A 4H0XB 2BTFA 3K58A 3V6DA 2O8FB 2G8IA 3LALA 4CIFA 2WFBA 4ZTFA 3VQ5A 5BPLA 3TTDA 3QNNA 4EZ6A 3DRSA 4DQ8A 3CCLN 4LF9K 4RW7A 4BRNA 1T3VA 2KKZA 3VPZA 4CEDA 1WUAA 3HP6A 2X74A 5B8HA 1K8KB 1VK0A 2G8UA 3W3DA 2E5LK 4E0DA 3U8XA 3WXKA 2ZWHA 2NUBA 5JS1A 4ISFA 3V4IA 4AQYK 3CC7N 4MQ3A 3O3GA 4BREA 4B3MK 2A6AA 3MCPA 2QWNA 3ASMA 4GW6A 4DV2K 3O1BA 3VF4A 4BRDA 4A59A 4JI7K 2UXCK 5KRSA 3QEIA 1ZYQA 4O4GA 5D3GA 2PZSA 3G0ZA 2A41A 4BROA 3PX6A 2E1YA 3QEWA 1NM1A 5HBMA 3WNHA 4AF1A 4FJXA 3T3FA 1VQ5N 3JSMA 4UY8O 3L8BA 1DGKN 3MCAB 3OYFA 1JLEA 2QI2A 2YNGA 3CFPA 3IRXA 1BDGA 3C6UA 3AVGA 2JWKA 3K9JA 4WFAL 2RE2A 4BRKA 2E2NA 3CYMA 3HL8A 4DR3K 3ZYYX 3OYEA 3AVAA 1V4TA 3C7NB 2UUCK 1X9SA 3QNOA 1L3TA 4GY2B 3HM8A 3NVMA 4OX9K 1VSKA 2V52B 4CJ7A 5BPMA 1K8AO 2UUBK 3M1FA 3F73A 4FJ5A 1KQSM 1O13A 3NH1A 4JI2K 3WQTA 4ID5A 4MFBA 5CR4A 4B1XB 3C95A 3SYZA 4OPKA 4N5SA 1NGAA 4IFEA 1RTJA 3VMFB 2NRTA 1U47A 2B4JA 1RT3A 4CJWA 4RW8A 3CMEN 4X66K 3U6FA 3MWPA 3PX0A 2O8BA 4CZFA 1VQ6N 1HNIA 1QZ6A 1KAYA 3HTVA 4M3ZA 5ELZA 3G10A 4JK9A 4XEIA 5CE3A 2HF4A 3SCXA 4NLBA 4KHYA 4JD2A 4YOYA 2D1KA 3PLAA 4KH4A 3ZSYA 1XQSC 3RR7A 4KHSA 4GNIA 1IG9A 3ZSWA 2HOEA 1NK5A 3OS0A 1VSMA 1SL2A 4Z4GA 2QWOA 5C2DA 5FDLA 2Y1JA 4CF1A 5CZ2A 3VENA 3ZX2A 3HSCA 2Q3SA 2GWJA 1S1WA 3O9QA 3MMVA 2QWLA 3VQCA 2H3GX 2Z1HA 4OKKA 2VYPA 1EWQA 3JS6A 1VSLA 4FM2A 4PA1A 4JEPA 4Z4FA 5C24A 3NH2A 4A5BA 2BH1A 1RT5A 4ISEA 5AQKA 4BRIA 2IOCA 1RBSA 3QEXA 4NLCA 3E1YA 3DLKA 3SPZA 2XRIA 3SMPA 4JI4K 4BRGA 3D45A 3Q7CA 3SLCA 4IFVA 3EN9A 3H45C 3MXMA 3KKRA 4BVPA 3QB0A 5AZIB 4NCAA 2IIRA 1VQ8N 4C8KA 4RW6A 2GUIA 1RDAA 4B8AB 5J2QA 4F3TA 3EYZA 3PIPL 4CEFA 4OGCA 3OYCA 4DQIA 3A0IX 5H1SQ 2O8FA 2NRRA 5KPZA 3FGUA 3NDKA 5AQUA 4FLTA 4LF7K 3CCMN 4G9ZA 3QEPA 1K6YA 2HBLA 4LF6K 1TAQA 2GTDA 3QBXA 4CFBA 4CF9A 3J7YP 3ZEUB 1XNQK 1Z26A 4DFPA 4CHNA 4Q0BA 1EXQA 2XHBA 3SMSA 4WQ4C 1F21A 1K8KA 4NCBA 3H08A 4LF4K 1JCGA 3S3NA 2VGMA 4ILHA 4CJKA 4J2EA 2P9SB 2OCEA 2QWRA 4FWOA 4YFUA 4CJQA 3DLHA 3QLHA 3I0SA 4DQPA 1YVNA 3O3HA 3AVBA 5FRMA 1KFDA 3OYIA 4DG1A 2E4LA 2IDOA 1ZBIA 2UU9K 3VGMA 4W5TA 3DM2A 3JXUA 4DR1K 4DQQA 1TK0A 5BN8A 1SV5A 3L6QA 1SUQA 2YCHA 4A57A 1EO1A 5AQHA 4CGJA 4YDUC 1YUWA 1NGDA 1GLBG 1MDUB 5AQYA 2FBXA 4FW1A 2ASOA 3I8BA 3WQUA 3J81O 3DLEA 1E4GT 2FLOA 2HHVA 4DV3K 3CIPA 3C7NA 3IMXA 1NGGA 4PL7A 4NXNK 4C8MA 3CPEA 3AVFA 3R8EA 2IS3A 1NNEA 2V7YA 4QOZB 4C1NK 4E1NA 4FWSA 4IG3A 2Q1NA 1HUXA 4CJVA 4Z4CA 1D8YA 4O5FA 3K5NA 3SV3A 4BGBA 4FK0A 1OVYA 3SK3A 1HYSA 3IG1A 1YAGA 5EX5A 3CCSN 4OPAA 1FW6A 5I9EB 2D0OA 3RR8A 4FWNA 1TKZA 4C8LA 4B1UB 4FK2A 4DSIA 4M7YA 4ZTJA 4B3OA 3F9MA 4DUYK 1TAUA 5FLXO 2J4RA 1NGBA 1ZBFA 3FZKA 4AHRA 1J9AA 1TYQB 3AVLA 5BRDA 5AJ3K 2OTLN 3VQ9A 1BQMA 1WBBA 3L2VA 2YV0X 1TK8A 2HBMA 1T7PA 4AILC 3QFPA 3VF2A 3KD1E 3MN7A 1RBUA 3B6OA 2Z1IA 1UA0A 2P5GA 4IJNA 4EP4A 2GUPA 2V51B 2GELA 1JLQA 2F9WA 2F8SA 4DSKA 4CVNE 4ELUA 2Q31A 3R9PA 3VGLA 5ADXA 1C0TA 1NGJA 1X3NA 1G15A 5C10A 4H8KA 3OYGA 1BUPA 1NJWA 4CJ4A 4Y1CA 3RSEB 1HYZA 1XMOK 3O3FA 1KRPA 3OYLA 1NJZA 3ZT0A 4JKDA 3OYMA 1H1VA 4I6MB 4QS9A 4IKFA 4ELTA 4GV3A 1X9WA 3M8PA 1IO2A 2PBDA 1IBMK 2OTJN 4B08A 3D0PA 4B9UA 2VQFK 1FKOA 5ADXH 3KK7A 5J1EA 3SAGA 1QQMA 1NJYA 5C2FA 4FJIA 3O08A 4RTFD 4CHZA 3M3ZA 4BWJA 5LJWA 4Z4HA 3ZSXA 2YKNA 1SKRA 3V9SA 4N76A 2QKKA 3ZLJA 3VESA 4J2DA 2RHKA 2DFEA 4DFJA 5AQTA 5AZIA 4DSFA 2O8CB 1GLAG 4DFKA 4CF0A 1YHQN 1TVRA 4CGIA 2QKBA 3LDOA 4CK2A 1LV5A 3FR0A 3O9TA 1CZ9A 3E01A 3A2FA 4YNQA 3F9KA 3DOLA 3CMAN 5J2MA 3VQPA 4CEOA 4BQLA 5HOOA 5HL7L 4YOUA 3EO3A 3AO1A 4FLUA 3ZEUA 4V19S 1R59O 3TAMA 4CEBA 4JNEA 4H0PA 5GINA 4KTWA 4WQ5A 1S3XA 1TKXA 4IOCL 4FVMA 4BR0A 4RCHA 2HVHA 3CJCA 4JKEA 4BGAA 3ZT4A 1W2BM 4FWQA 2E2QA 4Z4IA 2FF3B 2HMPA 3C6AA 2P9SA 4CCHA 5KI6A 5GAHP 2F4VK 3NVKA 3FFIA 5TKWA 4IDKA 4Y0WA 1HNWK 5EXWA 1FKPA 4CJSA 4DSJA 4X64K 1HNXK 1XUPO 1WNSA 4NXMK 1BQNA 4AHTA 2Z1JA 1EX4A 3QIPA 4AHCA 1BA0A 3E9PA 1SL0A 1QQOA 4CGFA 3LZJA 1GLEG 3SI6A 1NK9A 1D9FA 3E66A 1BISA 3AVMA 4CBUA 1L5UA 3CCRN 4B9NA 4JKCA 1RT1A 1ZC6A 3I33A 2YNIA 4X62K 1T6DA 4LY7A 5AQGA 5DM7L 5GAGP 1A5XA 3MEGA 3VQ4A 2G8WA 2BUPA 3VQ7A 1Q9XA 3T1AA 4BRFA 1LAWA 3CCQN 4DKWA 5I42A 4CEAA 3ENBA 3KLIA 4H5NA 3SJHA 1KC8O 4DU1A 4C23A 3ZT1A 3FZHA 2KQ2A 5FPDA 1WAFA 3VQAA 3WNEA 4BRAA 3RRHA 1YJWN 1JLBA 4DHYA 1RT4A 3ZT2A 4J2BA 2JLEA 4O0IA 3AV9A 3AA4A 1Q82O 2A5XA 1ZBHA 5T7BA 4PWDA 3PY8A 3DXKB 1NBWA 1UAXA 1VSEA 3L2UA 2BGGA 3AVKA 5GAEP 4YDUA 2HBKA 4ID1A 1KLNA 2O8EB 2OYQA 3RTVA 1TYQA 1TUYA 4MLEA 3JYTA 2CGLA 2FXUA 3K59A 2HF3A 3EY1A 3O8MA 1SAZA 4ICLA 2YNHA 1EWRA 4JKAA 3T69A 3QMLA 3R3LA 1D5AA 3KLHA 3AVIA 2I7NA 4B9MA 3K5LA 3T7ZA 1BHLA 2HSTA 4OKEA 1RNHA 2CH6A 3I8DA 1JLGA 1FXXA 4CGHA 4FPBA 3O4NA 3LDPA 1OVQA 1EP4A 2FBYA 1X9MA 1VQON 4BR9A 3RSEA 3AO2A 1QSYA 3WNGA 1M1KO 2KZZA 5M1QA 1N34K 4I6MA 2V7ZA 1WAJA 3TPQA 1R0AA 4RWTA 3MN9A 3ZX0A 1KVBA 5DK5A 1CXQA 4BC5A 4WFBL 1N36K 1BGXT 3VF6A 1S9GA 3LDQA 2AP1A 1ITGA 2RN2A 4HTUA 2QWMA 4LF5K 4FJKA 3ALYA 3RRGA 5AQIA 4E7JA 3TI0A 3OJUA 3V1RA 4FJ7A 4OLBA 3MDQA 1XHXA 3VA0A 3NF8A 3IAYA 1MWKA 4RW9A 3E9OA 3HT3A 1TK5A 4F4KA 2O8CA 3VEVA 1L3UA 3CCVN 4DF8A 4FOEA 1LWEA 4NYNA 2WOMA 5K14A 5KGXA 1Z6RA 1X3MA 1DKGD 2ZJPL 3HPOA 3SPYA 3LPTA 4HUFA 1VRTA 4IXCA 3RMBA 2BANA 3TR8A 4CJUA 2X6NA 2ZJQL 2E6MA 1VHXA 1NMDA 4B1YB 3H3NO 3KK2A 1WSHA 4CBXA 3EEQA 4KREA 4EP5A 1OH7A 5M1PA 2W6LA 3TTCA 3P4IA 4FM1A 3PUFA 3KD5E 4CFAA 5E84A 4FWMA 1EKEA 2KHOA 4GKKK 3KWGA 5IT9O 4KH5A 2JGUA 1HLUA 1OH5A 2FBTA 4E89A 4NCGA 1WLJA 4H5VA 1J5EK 2YHYA 3VQBA 5FPNA 1NWKA 1HRHA 1GOAA 3G4SN 1VSHA 3FZFA 1YI2N 5AQOA 3MXIA 2UXBK 1ASUA 1LW0A 4H5TA 1HQUA 4LC9B 5AQXA 4JKFA 3OTOK 5AQPA 4YOTA 4F9OA 3DXMB 2VWJA 5HROA 4M3XA 1HPZA 4DS4A 3OYAA 4KI6A 2VQEK 4ILGB 4E1JA 4FJHA 3VTHA 2OPRA 1L3VA 3UKUB 3CFOA 3A5MC 4CESA 4C8NA 4M7XA 1LWCA 4K43A 4BRLA 1C6VA 4DQSA 1JKHA 2NNWA 3AY9A 3EL2A 3S3OA 1ESVA 1KXPA 4O5BA 4ELVA 4DV1K 1QTMA 4G1QA 3O5BA 3P39A 1G99A 4CIEA 1XC3A 4B3SK 5C15A 4B9QA 2G8FA 3AAQA 3DMJA 2HHWA 4CZEA 3DXKA 4CK1A 1NJXA 1J54A 2PAVA 4EZ9A 2O8EA 2G8KA 4FYDA 1SQKA 3AVJA 2VWKA 5M1NA 3KK3A 4WF9L 1U4BA 4M3TA 3CXCM 3DOKA 4CK3A 3GDQA 1VRUA 4KHUA 3SNNA 3CJ1A 1VQMN 3SQ0A 1IKWA 2RPIA 1HKGA 1WSIA 3QIOA 4WQ5C 3HO1A 2A42A 4JKBA 2IGIA 1QHTA 2VG5A 1VSIA 1VQ7N 4DR2K 4DTRA 2A1SA 2E20A 3CM5A 4H0VB 2E6LA 2YX6A 1IBKK 3UB5A 1NKBA 1BO5O 5KQ8A 2E2PA 1U6ZA 4DCHA 1Q9YA 1U49A 3AA5X 4YORA 3DLBA 3TAEA 4HCCA 4JS5A 3NF9A 3T1YK 3OHRA 1I39A 4FWPA 1LW2A 3ATVA 4FCYA 3LWMA 3QBWA 4BR5A 4CZKA 4BWMA 4CEZA 4FM0A 2O4GA 1HKCA 1BA1A 2EHGA 2YHBA 3CQ8A 2W41A 4OPHA 4A62A 2B6AA 4EHUA 4K8XA 4EHTA 1RTDA 1XMQK 1RTIA 1B9FA 3NF6A 2ASMA 4CECA 4QS8A 1C1BA 1S6PA 2ZGYA 1A5VA 3TAPA 3QETA 4DR6K 3ULEB 1I94K 2A40A 1SL1A 5SWMA 3ID8A 3OBYA 1FK9A 4CIGA 3AVNA 3NGZA 5KPRA 1C0UA 2ZQBA 3LDSA 3OYBA 4E3SA 3SAFA 2DFFA 1S9EA 3I0RA 4EAHD 4IBNA 2P9KB 4CZHA 5BREA 4R79A 3T1HK 3KIOA 1JCEA 1KLMA 1RDDA 2UYTA 3LZIA 5AZJB 4NO7A 1MA9B 4PL8A 5AQZA 2DFHA 4CGGA 5HP1A 4DV4K 2I5JA 3WXJA 3DLRA 1M90O 3E9LA 3H3OB 3A5LC 3CD6N 4PY5A 4KAZA 4CZMA 2HW3A 3V9ZA 1OKJA 1N5YA 4BC4A 4JN4A 2P9LB 4DU3A 3OY9A 4KTQA 4CW7B 3CJBA 5AQQA 3S9HA 4BR7A 1YF5L 4FJMA 5BR9A 3TAGA 1Y64A 1T44A 3G25A 5FROA 4CERA 2FC0A 5IWAK 2OZSA 3W0LA 4Q5VA 3P83D 3KWIA 1C0FA 4CHOA 4UQGA 3WXLA 4KHQA 2O4IA 3LM2A 1U48A 3ISNC 3K5OA 4YOXA 3F2KA 4BR4A 1IBLK 4FJNA 5JS2A 3DXMA 3AAPA 1KAXA 4KB1A 1DT9A 1VQPN 4B9VA 2NZTA 3HZ6A 1E3MA 1SKSA 3OW2M 3P1GA 3L4QA 3G6EN 4B9SA 4FJGA 4J2AA 3PSFA 3LP3A 3THVA 4KI4A 3UKUA 5HRSA 3K5MA 1KAZA 4PKIA 1HNVA 4TSXA 1BCOA 2XO7A 4GV6A 4QCLA 2IVOA 4B1VA 4CHYA 4FJ8A 1Q18A 4W5RA 3RMCA 5HRNA 2CGKA 4FVUA 3HRGA 3BDPA 5BRFA 1NKCA 3BY5A 4BRPA 1RGIA 4DV0K 4IDHA 3N4PA 3LPUA 2BDPA 1NGIA 3GOIA 2OPQA 4JHDB 3B6PA 3D2FB 4PQUA 3AVCA 1U45A 2F7TA 4IFYA 3HXMA 3MEDA 1NOYA 3O1WA 4C1NI 4CBWA 4DTSA 2HNDA 4I7FA 3QFUA 1U04A 2KZMA 3WXIA 1WN7A 1RT7A 2GWKA 1N6QA 2CGJA 3DI6A 4B9TA 1J6ZA 1GLLO 4LF8K 1DTTA 2W6KA 3SQ4A 2HHQA 2F9TA 3KLGA 2B5JA 4MDBA 3EKUA 3ZSVA 3MECA 4AH9A 3BF3A 1DTQA 2YHXA 4I2PA 2HVIA 3NE6A 1YXQA 3LDNA 1BU6O 2Q97A 2XY7A 4CJRA 1IKYA 4ILJA 3CF5L 1WSJA 1GOBA 3BGRA 1E4FT 5AQNA 3FFKB 2ASPA 4BQZA 3O9RA 3THWB 4C8OA 3VQ8A 3AO3A 3HVRA 1JJ2M 4M41A 4A5AA 2HHHK 1ILYA 1JCFA 4CFDA 2EX3A 2KTQA 4B9LA 3CI5A 3VEOA 2HHTA 1P8ZA 4PKGA 3EE9A 4HTLA 5LL6Z 4BRCA 3O80A 4GKJK 4KRFA 3LWLA 4I9LA 4FSVA 3V9UA 3KTQA 3H6EA 4DLGA 3DLGA 4IEEA 4WCEL 4IZ9A 4FWRA 3VA3A 3VOVA 5A2QO 2YNFA 3UIQA 4LSLA 4BRHA 1S72N 3ULEA 1C0MA 5I3UA 1IKVA 3QEVA 1ASWA 3NH0A 1ATRA 3SQ1A 4K0KK 3QESA 1C0GA 4DFMA 2E88A 3C6HA 3VETA 5MLCQ 3OYNA 3TWHA 4M3WA 3S41A 1WOQA 1BIZA 3BEXA 2P9KA 4FZZA 3GG4A 3WUHA 2PYJA 4IO9L 5AZJA 1NGEA 4JI0K 1GLFO 3CHWA 2QM1A 3HOSA 1LAVA 1D4XA 1NU0A 3AGRA 1WSFA 3HPGA 4IOAL 2IAJA 2OPPA 3VTIA 2P9LA 1S1TA 4FL9A 3SV4A 2A3ZA 4I2QA 1CZAN 2GBZA 4DV7K 4MLHA 4LSNA 5LMUK 2BE2A 3ENHA 4FJLA 3IKMA 4BG9A 2Z1GA 4JRPA 3MX2A 1NK0A 1B9DA 3MN5A 4K25A 4XH1A 3S3MA 3AA2A 4K42A 2KW4A 1SS6A 3H1QA 1RCHA 4BE2A 3C94A 4U67L 1K9MO 1P90A 4NYFA 2W40A 5JMVA 3J80O 2WUSA 2ZJRL 1CXUA 1Z25A 1N33K 4YOWA 1BG3A 1IG8A 1X9JA 2NRWA 4F8RA 3KKSA 4AHUA 3HBTA 5LY3A 1S1UA 1VQKN 4LFAK 1KVCA 4H4OA 4J8FA 1UOCA 3LAKA 5JICA 2NLXA 4O8UA 1TKDA 3C0BA 1Q81O 3O9UA 4KHPK 4CD3A 1RT6A 3P31A 3CQYA 4M3YA 3A5OC 3SJJA 4FWKA 3U3YA 1JLFA 3VN5A 4B8CA 4CZJA 4CF8A 2QW9A 4AM7A 2QXFA 4CGDA 3L0QA 3TU5A 4GV9A 5F0XA 3BZCA 2OANA 2YJEA 4JK8A 1L3SA 3HJFA 4IJAA 5AQVA 4CJPA 4W5NA 3CM6A 1QQNA 3Q7BA 4M63C 3PV8A 4BRMA 3PIOL 2ATQA 1XI1A 5M1FA 4U7BA 3LDLA 1QVGM 1W97L 4GMJB 5F1XA 3QDKA 3RMDA 4CE9A 4H5RA 1BI4B 1NK7A 3AVHA 4IO8A 3TANA 3ID6A 3CJ9A 2G8VA 4DS5A 1VSDA 2HHSA 4JI5K 4JHDA 2DY4A 4CZLA 3PSIA 3D2FA 1HNZK 3J7AP 1T6CA 3NBPA 2YKMA 3M8RA 4OJRA 4CF2A 4WFNL 3H46O 3OA9A 2RKIA 3AA3A 2P51A 3R1XA 3VQ6A 3EKSA 3CCJN 4CHPA 4O0JA 3D6RA 3FLCO 3HP9A 1KD1O 2A1RA 3V9XA 5EY4A 4B3TK 3D2EB 5GADP 4EFHA 2XY6A 1T03A 5C25A 4JKGB 3VEZA 3P38A 1HYVA 1OH6A 4O8KA 5GIPA 4FXDA 4KBOA 4BE1A 3K0SA 4HUGA 1CZBA 1T8EA 2P9UB 3L4IA 4DTNA 2HNYA 3THWA 3IUCA 1ATNA 3KHYA 4A61A 1JXEA 1ZBLA 1ZXOA 3NHGA 1XHZA 1S1XA 2P9NB 3H1VX 4LFBK 3ENOA 3DWLA 4DMNA 1QHAA 4BDZA 2P9IB 3BZKA 1NJIO 4H0OA 4B1ZA 1RFQA 4KH6A 2FF6A 4K8ZA 3NCIA 4FJ9A 4DB3A 3WT0A 3K9KA 1REVA 3U9ZA 1VAZA 3L3UA 2CH5A 3QICA 4MDAA 1RDCA 3ZT3A 1Z05A 2RF2A 3L2QA 4DF4A 3ZSRA 3KK1A 3SZ2A 4HHTA 4FPAA 3NFAA 3QINA 3V1QA 3ZCMA 3ZSZA 1WBDA 2OA8A 4BDPA 3G71N 4DUZK 4KB0A 5CY4A 1YJ9N 3OYJA 5CYMA 3UKRB 2ZF5O 4BE0A 3VQQA 1WSEA 4KV8A 3IS9A 3UE5A 1VQLN 2LSNA 4E7IA 2AJQA 1DLOA 1JL2A 1HKBA 1NMNA 3ZX3A 1WSGA 3I56N 2HHXA 2F96A 4QAGA 4DSEA 4LD0A 3ITHA 3TAFA 1W0HA 3WNFA 4JLHA 2VGNA 1Q86O 3GBTA 1RBRA 4HVJA 3CC4N 4E19A 5DMRA 1RT2A 2XY8A 2D0PA 3IFRA 1FJGK 4FWLA 4MO5A 2QWQA 2VWBA 1ASVA 4CHQA 4JAXA 2FSNA 2G8HA 1U2VB 4DV5K 4DSLA 3TSUA 1KCFA 1V4SA 4WE1A 3SUNA 3WEEB 2E2OA 1TL1A 5BPNA 2Q0RA 2XY5A 4F2SA 3A5NC 4JI3K 5FRNA 5F2RA 3OYDA 1KTQA 3BF1A 3K57A 3U3GA 4DV6K 4H0YB 2NRVA 2KFZA 4ZHRA 1XNRK 1GLJO 1YTUA 1Q7YO 5AQFA 3OYKA 1YVUA 3TSPA 1TUUA 5C0YA 4BR2A 3JAMO 3N4QA 2QK9A 3PO5A 2ITGA 2P1JA 2YI1A 1S22A 4O44A 1BOTO 3VQEA 3VEXA 3ZETB 5LMNK 4W5OA 1LWFA 2AA4A 2NRHA 3CETA 3DLLL
chains in the Genus database with same CATH topology
4BROA 4CBUA 2E1YA 4GV6A 2IVOA 4B1VA 5KQDA 1Q18A 3CCRN 4JKCA 1ZC6A 3I33A 1NM1A 5TKYA 4AF1A 1T6DA 5AQGA 4BVOA 1N8RO 4CZIA 5DM7L 1VQ5N 3MX5A 5GAGP 2BUPA 2CGKA 4FVUA 4UY8O 3HRGA 4BRFA 5BRFA 1DGKN 3MCAB 3CCQN 2QI2A 3C65A 4BRPA 4DKWA 1RGIA 3KVGA 4IDHA 1GLCG 1BDGA 3N4PA 1GLDG 3ENBA 4H5NA 2JWKA 3K9JA 5EVZA 1NGIA 2RE2A 3GOIA 3SJHA 2E2NA 4BRKA 3SAHA 1KC8O 4C23A 4JHDB 5JVHL 3FZHA 3ZYYX 3D2FB 5FPDA 1V4TA 4BRAA 3CQXA 3C7NB 1YJWN 2F7TA 4DHYA 3CC2N 4GY2B 3J8AA 3HM8A 3NVMA 3D2EA 3O1WA 4C1NI 4CBWA 1Q82O 2A5XA 2V52B 4JKGA 2Q0UA 3CJAA 3QFUA 4CJ7A 5BPMA 3DXKB 1NBWA 3WXIA 2GWKA 1K8AO 4BC2A 5GAEP 2CGJA 3M1FA 4YDUA 2HBKA 1J6ZA 1GLLO 1KQSM 2F9TA 2P9UA 3LL3A 1O13A 4K41A 3WQTA 1TYQA 1TUYA 4MDBA 3EKUA 4MLEA 5JLHA 2CGLA 1RDWX 2FXUA 3BF3A 2YHXA 2HF3A 5FPMA 4B1XB 5CR4A 1YXQA 3O8MA 1SAZA 3LDNA 4JKAA 3T69A 3QMLA 1BU6O 3R3LA 2P9NA 2Q97A 4FO0A 2NRXA 4ILJA 3CF5L 1ZBSA 2P9IA 1NGAA 4IFEA 2I7NA 4BG8A 1E4FT 5AQNA 3FFKB 2ASPA 3T7ZA 4BQZA 3VMFB 3O9RA 2HSTA 2NRTA 1JJ2M 5KPTA 1LOTB 2CH6A 2P9PB 3CMEN 3FZMA 5AFUA 4A5AA 4FPBA 3B8AX 1ILYA 3MWPA 2FSKA 3LDPA 1JCFA 3ATUA 3HI0A 4CZFA 2KLAA 1VQ6N 1QZ6A 1KAYA 3HTVA 5ELZA 4A2BA 4JK9A 4XEIA 1VQON 3CI5A 3VEOA 5CE3A 2HF4A 4BR9A 4NLBA 4JD2A 3RSEA 5JLFA 4YOYA 1VQ9N 2D1KA 3PLAA 1P8ZA 4KH4A 4PKGA 1XQSC 3EE9A 4HTLA 3VGKA 4BRCA 3O80A 1M1KO 5M1QA 4GNIA 2HBJA 2HOEA 1SZ2A 4FSVA 4I6MA 2V7ZA 2ZGZA 4PKHA 3TPQA 3H6EA 2QWOA 4RWTA 4IEEA 3MN9A 5AFUH 3ZX0A 5C2DA 4WCEL 4IZ9A 4FWRA 3VOVA 1VQNN 4BC5A 1IJJA 4ISGA 3VENA 3UKRA 3ZX2A 3HSCA 4BRHA 4WFBL 1S72N 3ULEA 3SBTA 1NLVA 3VF6A 5C12A 3LDQA 2AP1A 2FSJA 2GWJA 3O9QA 2QWMA 3MMVA 2QWLA 2H3GX 1ATRA 2VYPA 3JS6A 4XH4A 5AQIA 1C0GA 4JEPA 2E88A 4BY9C 3C6HA 3VETA 5MLCQ 4A5BA 3S41A 1WOQA 3GL1A 3MDQA 2BH1A 3A8YA 4ISEA 3BEXA 5AQKA 4BRIA 5M1KA 2P9KA 4NLCA 3E1YA 3GG4A 4HWIA 3WUHA 2PFUA 4IO9L 5AZJA 1MWKA 3SMPA 1NGEA 1YITN 1GLFO 3E9OA 3CCUN 3MN6A 3VEVA 3CHWA 4BRGA 2QM1A 3HOSA 3CCVN 4FOEA 1D4XA 3Q7CA 3SLCA 4PHTX 3AGRA 3EN9A 2QEXN 4WYBA 3H45C 1Z6RA 4IOAL 4BVPA 1X3MA 3QB0A 1QZ5A 1DKGD 5GIOA 2ZJPL 4CI6A 5AZIB 2E1ZA 1YJNN 3VTIA 2P9LA 4IXCA 2IIRA 3J7ZO 4FL9A 1VQ8N 2ZJQL 1NMDA 4B1YB 2A3ZA 4CZGA 1CZAN 4MLHA 3PIPL 1U2VA 3H3NO 3R6MA 3A0IX 3ENHA 2VCPA 4CBXA 3O4WA 3IKMA 4BG9A 5H1SQ 3MX2A 2NRRA 5M1PA 3WEEA 5KPZA 3FGUA 3TTCA 5AQUA 3MN5A 4K25A 4XH1A 3CCMN 4G9ZA 3P4IA 4K42A 2HBLA 2WC9A 1SS6A 2GTDA 3H1QA 3QBXA 4U67L 5E84A 4FWMA 2KHOA 5AQRA 1K9MO 1P90A 3KWGA 2W40A 3O9SA 2GEMA 4IWVA 5JMVA 3ZEUB 4KH5A 2WUSA 2ZJRL 1HLUA 2QWPA 1RDUA 3AGKA 4YOWA 2YJFA 4H5VA 1BG3A 1IG8A 1X9JA 2NRWA 3FZLA 2YHYA 5LY3A 3HBTA 5E26A 5FPNA 3SMSA 1NWKA 1VQKN 4WQ4C 4J8FA 1K8KA 3G4SN 1YI2N 3FZFA 5AQOA 1JCGA 5AQWA 5JICA 2NLXA 4O8UA 1Q81O 3C0BA 2VGMA 3O9UA 4H5TA 4ILHA 4CD3A 4LC9B 5AQXA 3CERA 2P9SB 3P31A 3CQYA 4JKFA 2QWRA 3CJ7A 3A5OC 4FWOA 3TTFA 5CHIA 4FWKA 5AQPA 1YVNA 2QXLA 4YOTA 3ZETA 5DM6L 4OO1J 4F9OA 4CZJA 2QW9A 4H0TB 4AM7A 3DXMB 2IVNA 3L0QA 3TU5A 1DEJA 4GV9A 3VGMA 5F0XA 3F5TA 2E8AA 3JXUA 2OANA 2YJEA 4ILGB 4JK8A 4E1JA 2ITMA 4IJAA 5AQVA 5BN8A 3VTHA 3L6QA 1QQNA 3Q7BA 4M63C 2NRZA 4BRMA 3PIOL 4GVEA 2YCHA 3UKUB 5M1FA 4U7BA 3KZBA 3LDLA 1QVGM 4A57A 1W97L 1VQ4N 2D4WA 1NGHA 5AQHA 1EO1A 3A5MC 3TSQA 4B1WB 4YDUC 1HPMA 5F1XA 1YUWA 3QDKA 1EQYA 1NGDA 1GLBG 1MDUB 4H5RA 4M7XA 5AQYA 4K43A 2ASOA 3I8BA 4IO8A 3U9DA 3WQUA 4BRLA 5EOYA 2NNWA 1E4GT 3AY9A 1MWMA 3EL2A 3LM9A 3ID6A 1ESVA 2FLOA 3CJ9A 3RVCA 1KXPA 5FPEA 4JHDA 3WXMB 4IEIA 3DAWA 4CZLA 3D2FA 1T6CA 4H03B 3CIPA 3C7NA 3IMXA 1NGGA 2GX9A 4WFAL 3O5BA 4PL7A 4NB4A 4WFNL 3P39A 1G99A 4FOIA 1XC3A 3H46O 3M5RA 5AR0A 3OA9A 5C15A 4B9QA 3CPEA 3AAQA 3R1XA 3R8EA 3EKSA 4CZEA 2V7YA 3DXKA 3CCJN 2YHWA 4BRQA 4C1NK 2PAVA 4FWSA 5BRHA 4JKHA 3D6RA 2WBNA 4EIAA 3FLCO 1SQKA 2Q1NA 1KD1O 1HUXA 3NMUA 5EY4A 4H5WA 4O5FA 5M1NA 3D2EB 5GADP 4EFHA 4BGBA 1OVYA 3SK3A 1YAGA 5EX5A 4WF9L 4JKGB 3VEZA 3CCSN 3CXCM 1K73O 5LJVA 3P38A 4OPAA 3GDQA 4O8KA 5GIPA 4KBOA 1HJOA 5I9EB 2D0OA 3DLLL 4FWNA 3BP8A 3CJ1A 1VQMN 4B1UB 5AQLA 4M7YA 3F9MA 1HKGA 2P9UB 4WQ5C 2J4RA 1NGBA 2A42A 3L4IA 3FZKA 4JKBA 1TYQB 2Q36A 1VQ7N 3IUCA 3OBWA 1ATNA 1HX1A 5BRDA 3KHYA 4A61A 2JWLA 3CCEN 1ZXOA 1LCUA 4MO4A 2P9PA 2OTLN 2E20A 3EZWA 4H0VB 2YX6A 4YOVA 2Q2RA 2P9NB 2HBMA 3H1VX 3ENOA 3UB5A 1BO5O 3DWLA 3GE1A 3CPWM 1QHAA 3QFPA 2P9IB 3VF2A 1BWFO 3MN7A 5KQ8A 2E2PA 1U6ZA 4JK7A 4DCHA 4IJNA 1NJIO 4YORA 2GUPA 2V51B 4H0OA 2GELA 4B1ZA 2F9WA 1RFQA 3OHRA 3I55N 4KH6A 2FF6A 2Q31A 3D7EO 4FWPA 3R9PA 2QA4N 4WQ4A 3AARA 3ATVA 4DB3A 3WT0A 3VGLA 4IOXA 5ADXA 3K9KA 3U9ZA 1NGJA 1VAZA 1X3NA 2CH5A 3QBWA 3QICA 4BR5A 4MDAA 4CZKA 5C10A 1BUPA 1YIJN 3MK6A 4JD2B 3RSEB 5AQJA 2IVPA 3SBGA 1HKCA 1BA1A 2I7PA 1Z05A 2W41A 4OPHA 4JKDA 1NGCA 4A62A 3BUZB 3VEYA 4EHUA 4FPAA 1H1VA 3DJCA 4I6MB 4EHTA 4QS9A 3U4LA 4GV3A 4BC3A 5AQSA 2ASMA 3G71N 4QS8A 3VEWA 2PBDA 2ZGYA 4A2AA 2OTJN 3M6GA 1YJ9N 3UKRB 2ZF5O 5ADXH 4QS7A 3ULEB 2A40A 3KK7A 3UE5A 3SAGA 1QQMA 3ID8A 1VQLN 3OBYA 3O6WA 5C2FA 3O08A 4RTFD 4AM6A 1QVFM 1ATSA 3M3ZA 5LJWA 3HOTA 1HKBA 5KPRA 5BN9A 1NGFA 3ZX3A 5AQMA 2QTDA 4L3QA 3I56N 3EE8A 3SAFA 4Z94A 4EAHD 4CZHA 2P9KB 5BREA 4R79A 1JCEA 3VESA 2RHKA 2UYTA 5M1OA 5AZJB 4NO7A 5AQTA 5AZIA 1MA9B 4PL8A 5JVGL 5AQZA 3VERA 1GLAG 4XH5A 1YHQN 2VGNA 3IDHA 3LDOA 3WXJA 1Q86O 3FR0A 3O9TA 3GBTA 1M90O 3E9LA 3CC4N 3H3OB 3CMAN 3A5LC 3FE1A 3CD6N 4CZMA 1OKJA 2D0PA 3IFRA 4BQLA 4FWLA 4MO5A 4JN4A 2P9LB 4BC4A 2QWQA 5HOOA 2VWBA 2EWSA 5HL7L 4YOUA 3EO3A 2DPNA 4JAXA 2FSNA 3MWTA 4CD1A 3CJBA 1U2VB 4H0XB 3TSUA 3ZEUA 5AQQA 2BTFA 1V4SA 1R59O 4BR7A 1YF5L 3WEEB 2E2OA 5BR9A 5BPNA 4JNEA 2Q0RA 4H0PA 5GINA 1Y64A 1T44A 3A5NC 4WQ5A 2WFBA 1S3XA 5F2RA 4IOCL 3G25A 5BPLA 4BR0A 4RCHA 3TTDA 3CJCA 3BF1A 4DQ8A 3CCLN 3W0LA 4JKEA 4BGAA 1W2BM 4FWQA 4H0YB 2E2QA 2NRVA 4BRNA 1T3VA 2FF3B 2HMPA 3C6AA 3KWIA 1C0FA 2KKZA 2P9SA 3VPZA 1GLJO 1WUAA 5GAHP 3WXLA 1Q7YO 5AQFA 5B8HA 3NVKA 5TKWA 3LM2A 1K8KB 4YOXA 3F2KA 3W3DA 4BR4A 4Y0WA 3TSPA 3DXMA 3U8XA 1TUUA 3AAPA 3WXKA 5C0YA 5EXWA 4BR2A 1KAXA 1DT9A 2ZWHA 1VQPN 4ISFA 3N4QA 2NZTA 3HZ6A 3CC7N 3OW2M 1XUPO 4BREA 3L4QA 2YI1A 1BA0A 3G6EN 1S22A 1BOTO 3E9PA 3VEXA 2A6AA 3MCPA 3ZETB 2QWNA 1QQOA 3UKUA 3O1BA 1KAZA 4PKIA 3VF4A 4A59A 1GLEG 4BRDA 2AA4A 3E66A 2NRHA 3CETA 2A41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO L;  2OTJ N;  1YJ9 N;  1QVG M;  3CCR N;  1VQ4 N;  5MLC Q;  1N8R O;  5DM7 L;  1VQ5 N;  1VQL N;  5GAG P;  1QVF M;  4UY8 O;  3CCQ N;  3I56 N;  4IO9 L;  1YIT N;  3CCU N;  4WFA L;  3CCV N;  1KC8 O;  4WFN L;  5JVH L;  5JVG L;  2QEX N;  1YJW N;  3CC2 N;  4IOA L;  3CCJ N;  1YHQ N;  2ZJP L;  1Q86 O;  1YJN N;  1M90 O;  1Q82 O;  3CC4 N;  1KD1 O;  3J7Z O;  3CMA N;  3CD6 N;  1VQ8 N;  1K8A O;  2ZJQ L;  5GAE P;  5GAD P;  1OVY A;  3CCS N;  3PIP L;  4WF9 L;  1K73 O;  3CXC M;  1KQS M;  5HL7 L;  5H1S Q;  1VQM N;  3CCM N;  1VQ7 N;  4U67 L;  3CF5 L;  1K9M O;  3CCE N;  2OTL N;  4IOC L;  2ZJR L;  3CPW M;  1JJ2 M;  3CCL N;  1W2B M;  3CME N;  1NJI O;  1VQK N;  1ILY A;  3G4S N;  1YI2 N;  1VQ6 N;  5GAH P;  1Q81 O;  1Q7Y O;  3I55 N;  2QA4 N;  1VQO N;  1VQ9 N;  1M1K O;  1VQP N;  1YIJ N;  5DM6 L;  3OW2 M;  3CC7 N;  3G6E N;  4WCE L;  1VQN N;  4WFB L;  1S72 N;  3DLL L;  3G71 N; 
#chains in the Genus database with same CATH topology
 1IKX A;  5KGW A;  1BI4 A;  5KQD A;  1WB9 A;  4DR4 K;  3OS1 A;  4KO0 A;  3HVT A;  5TKY A;  3KJV A;  1QE1 A;  4BVO A;  1N8R O;  1EET A;  4CZI A;  3LP1 A;  3MX5 A;  4JI1 K;  4CEQ A;  4N56 A;  3RWU A;  4CJ5 A;  3C65 A;  1D9D A;  4HCB A;  3KVG A;  3ZSQ A;  1GLC G;  4Z0U A;  1C1A A;  1GLD G;  5EVZ A;  3SAH A;  4BDY A;  1JLA A;  1O1W A;  5JVH L;  3HST B;  4M3R A;  3LAM A;  3CQX A;  3NAE A;  3CC2 N;  1NK6 A;  3J8A A;  3D2E A;  4Y1D A;  4JKG A;  2Q0U A;  3CJA A;  4OKJ A;  3THY B;  1W7A A;  4BC2 A;  4L8R B;  2P9U A;  3LL3 A;  2ZM6 K;  3MAQ A;  2X6S A;  1VSJ A;  4K41 A;  4DQR A;  1RDB A;  5JLH A;  3LP2 A;  1RDW X;  1N32 K;  5FPM A;  4DWI A;  3QER A;  2IC3 A;  2P9N A;  4KPY A;  2HNZ A;  4FO0 A;  2NRX A;  4E1M A;  1ZBS A;  1S5J A;  2P9I A;  4KFB A;  1NK4 A;  3TAR A;  4BG8 A;  2D0B A;  3RMA A;  3HPH A;  5KPT A;  3KLF A;  1LOT B;  2P9P B;  3FZM A;  3V1O A;  5AFU A;  1C1C A;  4JS4 A;  3B8A X;  3MEE A;  2FSK A;  3ATU A;  3HI0 A;  2VG6 A;  2KLA A;  3V81 A;  1BIU A;  2WTU A;  4OLA A;  4A2B A;  3SUO A;  5JLF A;  1VQ9 N;  4IG0 A;  3VGK A;  2HBJ A;  3DRR A;  4E7L A;  1RBV A;  1SZ2 A;  2ZGZ A;  4PKH A;  2YHA A;  5EU7 A;  5C42 A;  4FLZ A;  5AFU H;  5HLF A;  1BL3 A;  1VQN N;  4X65 K;  4DTU A;  1IJJ A;  4ISG A;  3UKR A;  1JL1 A;  3SBT A;  1NLV A;  5C12 A;  2O8D B;  5BR8 K;  4E7K A;  2FSJ A;  4N47 A;  4N41 A;  3LP0 A;  3LAN A;  4CFC A;  2Y1I A;  2OZM A;  1QS4 A;  4XH4 A;  4BY9 C;  1JLC A;  2ZD1 A;  4LH4 A;  3GL1 A;  3A8Y A;  5M1K A;  4HWI A;  4OVL A;  2PFU A;  4JV5 K;  1YIT N;  3CCU N;  3MN6 A;  5HRR A;  2P5O A;  4PHT X;  2QEX N;  4WYB A;  3SUQ A;  2WON A;  4FLX A;  1QZ5 A;  1QQC A;  5GIO A;  4CI6 A;  3THX B;  2KFN A;  2E1Z A;  1YJN N;  3ULD A;  1HJR A;  3OS2 A;  4DR7 K;  3J7Z O;  3DYA A;  1OH8 A;  4CZG A;  3PX4 A;  3HK2 A;  1U2V A;  1CLQ A;  3R6M A;  3PO4 A;  2VCP A;  3O4W A;  3WEE A;  4FZX C;  5KTQ A;  1VSF A;  2WC9 A;  1B92 A;  2D0A A;  4FK4 A;  5AQR A;  1W9H A;  1X1P A;  3O9S A;  2GEM A;  4IWV A;  3HYF A;  2QWP A;  1RDU A;  3TAQ A;  3AGK A;  1I3A A;  2D5R A;  2YJF A;  4AHV A;  4PUO A;  3NF7 A;  4DLE A;  3CFR A;  3FZL A;  5E26 A;  5KRT A;  5J2P A;  5AQW A;  1RTH A;  1HMV A;  3M8S A;  3SQ2 A;  1S6Q A;  3CER A;  4DTP A;  2PYL A;  1GOC A;  3CJ7 A;  3TTF A;  3L2R A;  5CHI A;  2QXL A;  4DTO A;  3ZET A;  5DM6 L;  4OO1 J;  2HMI A;  4H0T B;  3L3V A;  4F3O A;  2HB5 A;  4DTM A;  2IVN A;  1DEJ A;  3F5T A;  2E8A A;  1NKE A;  3NGI A;  2ITM A;  2ZE2 A;  4M45 A;  4CJE A;  2NRZ A;  4GVE A;  1UWB A;  4RG8 A;  4FJJ A;  3KZB A;  1VQ4 N;  2D4W A;  1NGH A;  4FZY A;  5E41 A;  3TSQ A;  4B1W B;  1HPM A;  1EQY A;  4M3U A;  2UXD K;  3U9D A;  4CJT A;  5EOY A;  1IH7 A;  3VQD A;  1TKT A;  3T19 A;  1MWM A;  3LM9 A;  2HHU A;  3RVC A;  2ETJ A;  1Y97 A;  5FPE A;  3WXM B;  4IEI A;  3DAW A;  4H03 B;  4FLV A;  2GX9 A;  2UUA K;  4NB4 A;  4FOI A;  5AR0 A;  3M5R A;  3AO5 A;  3TAB A;  5HRP A;  1UA1 A;  3THY A;  2YHW A;  4BRQ A;  3QO9 A;  2PY5 A;  1NG9 A;  5BRH A;  4JKH A;  3O4Q A;  1SKW A;  4EIA A;  2WBN A;  3OJS A;  3SUP A;  3NMU A;  2OPS A;  4OPJ A;  4H5W A;  1YTA A;  2GV9 A;  4H4M A;  1K73 O;  1QSS A;  5LJV A;  4AHS A;  4DTJ A;  1HJO A;  3BP8 A;  4FLW A;  5AQL A;  1BCM A;  1J53 A;  4M42 A;  4FW2 A;  4R5P A;  2Q36 A;  1QSL A;  1YT3 A;  1NOZ A;  4RW4 A;  3OBW A;  1KSP A;  1HX1 A;  3CCE N;  2JWL A;  1LCU A;  4MO4 A;  2P9P A;  4JRQ A;  4CJF A;  5SZT A;  3EZW A;  4YOV A;  2Q2R A;  3CPW M;  3GE1 A;  3HM9 A;  3KLE A;  1JXB A;  1KFS A;  1BWF O;  4YHH K;  4JK7 A;  3K2P A;  3EZ5 A;  2F8T A;  1TV6 A;  4CEE A;  3NGY A;  3I55 N;  4HUE A;  4JI6 K;  3D7E O;  2QA4 N;  4I9Q A;  4WQ4 A;  3AAR A;  2O8B B;  4KKO A;  1TL3 A;  1HR0 K;  4IOX A;  4JI8 K;  3DRP A;  5J2N A;  1YIJ N;  3MK6 A;  4JD2 B;  3P5J A;  5AQJ A;  1XC9 A;  2IVP A;  4DR5 K;  1MU2 A;  1XWL A;  3SBG A;  2I7P A;  4KHW A;  1KVA A;  3OVN A;  2O8D A;  1NGC A;  3M8Q A;  1J5O A;  3BUZ B;  3V9W A;  3VEY A;  3DJC A;  1T05 A;  3U4L A;  4BC3 A;  5AQS A;  3VEW A;  2R7Y A;  4A2A A;  3M6G A;  1ZBU A;  4QS7 A;  4CJ3 A;  4LH5 A;  4DTX A;  3AO4 A;  2VG7 A;  3CG7 A;  1Q8I A;  3O6W A;  3C6T A;  4AM6 A;  1QVF M;  4GVM A;  1ATS A;  3HOT A;  4BAC A;  2X78 A;  1NGF A;  5BN9 A;  5AQM A;  2QTD A;  4L3Q A;  4W5Q A;  3EE8 A;  4KTZ A;  4Z94 A;  4FLY A;  1A5W A;  1IV0 A;  2FBV A;  1S1V A;  4E7H A;  5M1O A;  3THX A;  5JVG L;  3VER A;  3ZSO A;  3L2W A;  4XH5 A;  4JYA K;  3IDH A;  4KHN A;  4YY3 K;  4LFC K;  4B3R K;  4DU4 A;  4XIU A;  3FE1 A;  2W42 A;  3OYH A;  4OGE A;  5CZ1 A;  5CYQ A;  1RIL A;  4CJL A;  1HQE A;  2EWS A;  1TGO A;  4O55 A;  4Z4E A;  1RBT A;  2D0C A;  2DPN A;  4F2R A;  2DTU A;  3MXJ A;  3MWT A;  4CD1 A;  1NK8 A;  4H0X B;  2BTF A;  3K58 A;  3V6D A;  2O8F B;  2G8I A;  3LAL A;  4CIF A;  2WFB A;  4ZTF A;  3VQ5 A;  5BPL A;  3TTD A;  3QNN A;  4EZ6 A;  3DRS A;  4DQ8 A;  3CCL N;  4LF9 K;  4RW7 A;  4BRN A;  1T3V A;  2KKZ A;  3VPZ A;  4CED A;  1WUA A;  3HP6 A;  2X74 A;  5B8H A;  1K8K B;  1VK0 A;  2G8U A;  3W3D A;  2E5L K;  4E0D A;  3U8X A;  3WXK A;  2ZWH A;  2NUB A;  5JS1 A;  4ISF A;  3V4I A;  4AQY K;  3CC7 N;  4MQ3 A;  3O3G A;  4BRE A;  4B3M K;  2A6A A;  3MCP A;  2QWN A;  3ASM A;  4GW6 A;  4DV2 K;  3O1B A;  3VF4 A;  4BRD A;  4A59 A;  4JI7 K;  2UXC K;  5KRS A;  3QEI A;  1ZYQ A;  4O4G A;  5D3G A;  2PZS A;  3G0Z A;  2A41 A;  4BRO A;  3PX6 A;  2E1Y A;  3QEW A;  1NM1 A;  5HBM A;  3WNH A;  4AF1 A;  4FJX A;  3T3F A;  1VQ5 N;  3JSM A;  4UY8 O;  3L8B A;  1DGK N;  3MCA B;  3OYF A;  1JLE A;  2QI2 A;  2YNG A;  3CFP A;  3IRX A;  1BDG A;  3C6U A;  3AVG A;  2JWK A;  3K9J A;  4WFA L;  2RE2 A;  4BRK A;  2E2N A;  3CYM A;  3HL8 A;  4DR3 K;  3ZYY X;  3OYE A;  3AVA A;  1V4T A;  3C7N B;  2UUC K;  1X9S A;  3QNO A;  1L3T A;  4GY2 B;  3HM8 A;  3NVM A;  4OX9 K;  1VSK A;  2V52 B;  4CJ7 A;  5BPM A;  1K8A O;  2UUB K;  3M1F A;  3F73 A;  4FJ5 A;  1KQS M;  1O13 A;  3NH1 A;  4JI2 K;  3WQT A;  4ID5 A;  4MFB A;  5CR4 A;  4B1X B;  3C95 A;  3SYZ A;  4OPK A;  4N5S A;  1NGA A;  4IFE A;  1RTJ A;  3VMF B;  2NRT A;  1U47 A;  2B4J A;  1RT3 A;  4CJW A;  4RW8 A;  3CME N;  4X66 K;  3U6F A;  3MWP A;  3PX0 A;  2O8B A;  4CZF A;  1VQ6 N;  1HNI A;  1QZ6 A;  1KAY A;  3HTV A;  4M3Z A;  5ELZ A;  3G10 A;  4JK9 A;  4XEI A;  5CE3 A;  2HF4 A;  3SCX A;  4NLB A;  4KHY A;  4JD2 A;  4YOY A;  2D1K A;  3PLA A;  4KH4 A;  3ZSY A;  1XQS C;  3RR7 A;  4KHS A;  4GNI A;  1IG9 A;  3ZSW A;  2HOE A;  1NK5 A;  3OS0 A;  1VSM A;  1SL2 A;  4Z4G A;  2QWO A;  5C2D A;  5FDL A;  2Y1J A;  4CF1 A;  5CZ2 A;  3VEN A;  3ZX2 A;  3HSC A;  2Q3S A;  2GWJ A;  1S1W A;  3O9Q A;  3MMV A;  2QWL A;  3VQC A;  2H3G X;  2Z1H A;  4OKK A;  2VYP A;  1EWQ A;  3JS6 A;  1VSL A;  4FM2 A;  4PA1 A;  4JEP A;  4Z4F A;  5C24 A;  3NH2 A;  4A5B A;  2BH1 A;  1RT5 A;  4ISE A;  5AQK A;  4BRI A;  2IOC A;  1RBS A;  3QEX A;  4NLC A;  3E1Y A;  3DLK A;  3SPZ A;  2XRI A;  3SMP A;  4JI4 K;  4BRG A;  3D45 A;  3Q7C A;  3SLC A;  4IFV A;  3EN9 A;  3H45 C;  3MXM A;  3KKR A;  4BVP A;  3QB0 A;  5AZI B;  4NCA A;  2IIR A;  1VQ8 N;  4C8K A;  4RW6 A;  2GUI A;  1RDA A;  4B8A B;  5J2Q A;  4F3T A;  3EYZ A;  3PIP L;  4CEF A;  4OGC A;  3OYC A;  4DQI A;  3A0I X;  5H1S Q;  2O8F A;  2NRR A;  5KPZ A;  3FGU A;  3NDK A;  5AQU A;  4FLT A;  4LF7 K;  3CCM N;  4G9Z A;  3QEP A;  1K6Y A;  2HBL A;  4LF6 K;  1TAQ A;  2GTD A;  3QBX A;  4CFB A;  4CF9 A;  3J7Y P;  3ZEU B;  1XNQ K;  1Z26 A;  4DFP A;  4CHN A;  4Q0B A;  1EXQ A;  2XHB A;  3SMS A;  4WQ4 C;  1F21 A;  1K8K A;  4NCB A;  3H08 A;  4LF4 K;  1JCG A;  3S3N A;  2VGM A;  4ILH A;  4CJK A;  4J2E A;  2P9S B;  2OCE A;  2QWR A;  4FWO A;  4YFU A;  4CJQ A;  3DLH A;  3QLH A;  3I0S A;  4DQP A;  1YVN A;  3O3H A;  3AVB A;  5FRM A;  1KFD A;  3OYI A;  4DG1 A;  2E4L A;  2IDO A;  1ZBI A;  2UU9 K;  3VGM A;  4W5T A;  3DM2 A;  3JXU A;  4DR1 K;  4DQQ A;  1TK0 A;  5BN8 A;  1SV5 A;  3L6Q A;  1SUQ A;  2YCH A;  4A57 A;  1EO1 A;  5AQH A;  4CGJ A;  4YDU C;  1YUW A;  1NGD A;  1GLB G;  1MDU B;  5AQY A;  2FBX A;  4FW1 A;  2ASO A;  3I8B A;  3WQU A;  3J81 O;  3DLE A;  1E4G T;  2FLO A;  2HHV A;  4DV3 K;  3CIP A;  3C7N A;  3IMX A;  1NGG A;  4PL7 A;  4NXN K;  4C8M A;  3CPE A;  3AVF A;  3R8E A;  2IS3 A;  1NNE A;  2V7Y A;  4QOZ B;  4C1N K;  4E1N A;  4FWS A;  4IG3 A;  2Q1N A;  1HUX A;  4CJV A;  4Z4C A;  1D8Y A;  4O5F A;  3K5N A;  3SV3 A;  4BGB A;  4FK0 A;  1OVY A;  3SK3 A;  1HYS A;  3IG1 A;  1YAG A;  5EX5 A;  3CCS N;  4OPA A;  1FW6 A;  5I9E B;  2D0O A;  3RR8 A;  4FWN A;  1TKZ A;  4C8L A;  4B1U B;  4FK2 A;  4DSI A;  4M7Y A;  4ZTJ A;  4B3O A;  3F9M A;  4DUY K;  1TAU A;  5FLX O;  2J4R A;  1NGB A;  1ZBF A;  3FZK A;  4AHR A;  1J9A A;  1TYQ B;  3AVL A;  5BRD A;  5AJ3 K;  2OTL N;  3VQ9 A;  1BQM A;  1WBB A;  3L2V A;  2YV0 X;  1TK8 A;  2HBM A;  1T7P A;  4AIL C;  3QFP A;  3VF2 A;  3KD1 E;  3MN7 A;  1RBU A;  3B6O A;  2Z1I A;  1UA0 A;  2P5G A;  4IJN A;  4EP4 A;  2GUP A;  2V51 B;  2GEL A;  1JLQ A;  2F9W A;  2F8S A;  4DSK A;  4CVN E;  4ELU A;  2Q31 A;  3R9P A;  3VGL A;  5ADX A;  1C0T A;  1NGJ A;  1X3N A;  1G15 A;  5C10 A;  4H8K A;  3OYG A;  1BUP A;  1NJW A;  4CJ4 A;  4Y1C A;  3RSE B;  1HYZ A;  1XMO K;  3O3F A;  1KRP A;  3OYL A;  1NJZ A;  3ZT0 A;  4JKD A;  3OYM A;  1H1V A;  4I6M B;  4QS9 A;  4IKF A;  4ELT A;  4GV3 A;  1X9W A;  3M8P A;  1IO2 A;  2PBD A;  1IBM K;  2OTJ N;  4B08 A;  3D0P A;  4B9U A;  2VQF K;  1FKO A;  5ADX H;  3KK7 A;  5J1E A;  3SAG A;  1QQM A;  1NJY A;  5C2F A;  4FJI A;  3O08 A;  4RTF D;  4CHZ A;  3M3Z A;  4BWJ A;  5LJW A;  4Z4H A;  3ZSX A;  2YKN A;  1SKR A;  3V9S A;  4N76 A;  2QKK A;  3ZLJ A;  3VES A;  4J2D A;  2RHK A;  2DFE A;  4DFJ A;  5AQT A;  5AZI A;  4DSF A;  2O8C B;  1GLA G;  4DFK A;  4CF0 A;  1YHQ N;  1TVR A;  4CGI A;  2QKB A;  3LDO A;  4CK2 A;  1LV5 A;  3FR0 A;  3O9T A;  1CZ9 A;  3E01 A;  3A2F A;  4YNQ A;  3F9K A;  3DOL A;  3CMA N;  5J2M A;  3VQP A;  4CEO A;  4BQL A;  5HOO A;  5HL7 L;  4YOU A;  3EO3 A;  3AO1 A;  4FLU A;  3ZEU A;  4V19 S;  1R59 O;  3TAM A;  4CEB A;  4JNE A;  4H0P A;  5GIN A;  4KTW A;  4WQ5 A;  1S3X A;  1TKX A;  4IOC L;  4FVM A;  4BR0 A;  4RCH A;  2HVH A;  3CJC A;  4JKE A;  4BGA A;  3ZT4 A;  1W2B M;  4FWQ A;  2E2Q A;  4Z4I A;  2FF3 B;  2HMP A;  3C6A A;  2P9S A;  4CCH A;  5KI6 A;  5GAH P;  2F4V K;  3NVK A;  3FFI A;  5TKW A;  4IDK A;  4Y0W A;  1HNW K;  5EXW A;  1FKP A;  4CJS A;  4DSJ A;  4X64 K;  1HNX K;  1XUP O;  1WNS A;  4NXM K;  1BQN A;  4AHT A;  2Z1J A;  1EX4 A;  3QIP A;  4AHC A;  1BA0 A;  3E9P A;  1SL0 A;  1QQO A;  4CGF A;  3LZJ A;  1GLE G;  3SI6 A;  1NK9 A;  1D9F A;  3E66 A;  1BIS A;  3AVM A;  4CBU A;  1L5U A;  3CCR N;  4B9N A;  4JKC A;  1RT1 A;  1ZC6 A;  3I33 A;  2YNI A;  4X62 K;  1T6D A;  4LY7 A;  5AQG A;  5DM7 L;  5GAG P;  1A5X A;  3MEG A;  3VQ4 A;  2G8W A;  2BUP A;  3VQ7 A;  1Q9X A;  3T1A A;  4BRF A;  1LAW A;  3CCQ N;  4DKW A;  5I42 A;  4CEA A;  3ENB A;  3KLI A;  4H5N A;  3SJH A;  1KC8 O;  4DU1 A;  4C23 A;  3ZT1 A;  3FZH A;  2KQ2 A;  5FPD A;  1WAF A;  3VQA A;  3WNE A;  4BRA A;  3RRH A;  1YJW N;  1JLB A;  4DHY A;  1RT4 A;  3ZT2 A;  4J2B A;  2JLE A;  4O0I A;  3AV9 A;  3AA4 A;  1Q82 O;  2A5X A;  1ZBH A;  5T7B A;  4PWD A;  3PY8 A;  3DXK B;  1NBW A;  1UAX A;  1VSE A;  3L2U A;  2BGG A;  3AVK A;  5GAE P;  4YDU A;  2HBK A;  4ID1 A;  1KLN A;  2O8E B;  2OYQ A;  3RTV A;  1TYQ A;  1TUY A;  4MLE A;  3JYT A;  2CGL A;  2FXU A;  3K59 A;  2HF3 A;  3EY1 A;  3O8M A;  1SAZ A;  4ICL A;  2YNH A;  1EWR A;  4JKA A;  3T69 A;  3QML A;  3R3L A;  1D5A A;  3KLH A;  3AVI A;  2I7N A;  4B9M A;  3K5L A;  3T7Z A;  1BHL A;  2HST A;  4OKE A;  1RNH A;  2CH6 A;  3I8D A;  1JLG A;  1FXX A;  4CGH A;  4FPB A;  3O4N A;  3LDP A;  1OVQ A;  1EP4 A;  2FBY A;  1X9M A;  1VQO N;  4BR9 A;  3RSE A;  3AO2 A;  1QSY A;  3WNG A;  1M1K O;  2KZZ A;  5M1Q A;  1N34 K;  4I6M A;  2V7Z A;  1WAJ A;  3TPQ A;  1R0A A;  4RWT A;  3MN9 A;  3ZX0 A;  1KVB A;  5DK5 A;  1CXQ A;  4BC5 A;  4WFB L;  1N36 K;  1BGX T;  3VF6 A;  1S9G A;  3LDQ A;  2AP1 A;  1ITG A;  2RN2 A;  4HTU A;  2QWM A;  4LF5 K;  4FJK A;  3ALY A;  3RRG A;  5AQI A;  4E7J A;  3TI0 A;  3OJU A;  3V1R A;  4FJ7 A;  4OLB A;  3MDQ A;  1XHX A;  3VA0 A;  3NF8 A;  3IAY A;  1MWK A;  4RW9 A;  3E9O A;  3HT3 A;  1TK5 A;  4F4K A;  2O8C A;  3VEV A;  1L3U A;  3CCV N;  4DF8 A;  4FOE A;  1LWE A;  4NYN A;  2WOM A;  5K14 A;  5KGX A;  1Z6R A;  1X3M A;  1DKG D;  2ZJP L;  3HPO A;  3SPY A;  3LPT A;  4HUF A;  1VRT A;  4IXC A;  3RMB A;  2BAN A;  3TR8 A;  4CJU A;  2X6N A;  2ZJQ L;  2E6M A;  1VHX A;  1NMD A;  4B1Y B;  3H3N O;  3KK2 A;  1WSH A;  4CBX A;  3EEQ A;  4KRE A;  4EP5 A;  1OH7 A;  5M1P A;  2W6L A;  3TTC A;  3P4I A;  4FM1 A;  3PUF A;  3KD5 E;  4CFA A;  5E84 A;  4FWM A;  1EKE A;  2KHO A;  4GKK K;  3KWG A;  5IT9 O;  4KH5 A;  2JGU A;  1HLU A;  1OH5 A;  2FBT A;  4E89 A;  4NCG A;  1WLJ A;  4H5V A;  1J5E K;  2YHY A;  3VQB A;  5FPN A;  1NWK A;  1HRH A;  1GOA A;  3G4S N;  1VSH A;  3FZF A;  1YI2 N;  5AQO A;  3MXI A;  2UXB K;  1ASU A;  1LW0 A;  4H5T A;  1HQU A;  4LC9 B;  5AQX A;  4JKF A;  3OTO K;  5AQP A;  4YOT A;  4F9O A;  3DXM B;  2VWJ A;  5HRO A;  4M3X A;  1HPZ A;  4DS4 A;  3OYA A;  4KI6 A;  2VQE K;  4ILG B;  4E1J A;  4FJH A;  3VTH A;  2OPR A;  1L3V A;  3UKU B;  3CFO A;  3A5M C;  4CES A;  4C8N A;  4M7X A;  1LWC A;  4K43 A;  4BRL A;  1C6V A;  4DQS A;  1JKH A;  2NNW A;  3AY9 A;  3EL2 A;  3S3O A;  1ESV A;  1KXP A;  4O5B A;  4ELV A;  4DV1 K;  1QTM A;  4G1Q A;  3O5B A;  3P39 A;  1G99 A;  4CIE A;  1XC3 A;  4B3S K;  5C15 A;  4B9Q A;  2G8F A;  3AAQ A;  3DMJ A;  2HHW A;  4CZE A;  3DXK A;  4CK1 A;  1NJX A;  1J54 A;  2PAV A;  4EZ9 A;  2O8E A;  2G8K A;  4FYD A;  1SQK A;  3AVJ A;  2VWK A;  5M1N A;  3KK3 A;  4WF9 L;  1U4B A;  4M3T A;  3CXC M;  3DOK A;  4CK3 A;  3GDQ A;  1VRU A;  4KHU A;  3SNN A;  3CJ1 A;  1VQM N;  3SQ0 A;  1IKW A;  2RPI A;  1HKG A;  1WSI A;  3QIO A;  4WQ5 C;  3HO1 A;  2A42 A;  4JKB A;  2IGI A;  1QHT A;  2VG5 A;  1VSI A;  1VQ7 N;  4DR2 K;  4DTR A;  2A1S A;  2E20 A;  3CM5 A;  4H0V B;  2E6L A;  2YX6 A;  1IBK K;  3UB5 A;  1NKB A;  1BO5 O;  5KQ8 A;  2E2P A;  1U6Z A;  4DCH A;  1Q9Y A;  1U49 A;  3AA5 X;  4YOR A;  3DLB A;  3TAE A;  4HCC A;  4JS5 A;  3NF9 A;  3T1Y K;  3OHR A;  1I39 A;  4FWP A;  1LW2 A;  3ATV A;  4FCY A;  3LWM A;  3QBW A;  4BR5 A;  4CZK A;  4BWM A;  4CEZ A;  4FM0 A;  2O4G A;  1HKC A;  1BA1 A;  2EHG A;  2YHB A;  3CQ8 A;  2W41 A;  4OPH A;  4A62 A;  2B6A A;  4EHU A;  4K8X A;  4EHT A;  1RTD A;  1XMQ K;  1RTI A;  1B9F A;  3NF6 A;  2ASM A;  4CEC A;  4QS8 A;  1C1B A;  1S6P A;  2ZGY A;  1A5V A;  3TAP A;  3QET A;  4DR6 K;  3ULE B;  1I94 K;  2A40 A;  1SL1 A;  5SWM A;  3ID8 A;  3OBY A;  1FK9 A;  4CIG A;  3AVN A;  3NGZ A;  5KPR A;  1C0U A;  2ZQB A;  3LDS A;  3OYB A;  4E3S A;  3SAF A;  2DFF A;  1S9E A;  3I0R A;  4EAH D;  4IBN A;  2P9K B;  4CZH A;  5BRE A;  4R79 A;  3T1H K;  3KIO A;  1JCE A;  1KLM A;  1RDD A;  2UYT A;  3LZI A;  5AZJ B;  4NO7 A;  1MA9 B;  4PL8 A;  5AQZ A;  2DFH A;  4CGG A;  5HP1 A;  4DV4 K;  2I5J A;  3WXJ A;  3DLR A;  1M90 O;  3E9L A;  3H3O B;  3A5L C;  3CD6 N;  4PY5 A;  4KAZ A;  4CZM A;  2HW3 A;  3V9Z A;  1OKJ A;  1N5Y A;  4BC4 A;  4JN4 A;  2P9L B;  4DU3 A;  3OY9 A;  4KTQ A;  4CW7 B;  3CJB A;  5AQQ A;  3S9H A;  4BR7 A;  1YF5 L;  4FJM A;  5BR9 A;  3TAG A;  1Y64 A;  1T44 A;  3G25 A;  5FRO A;  4CER A;  2FC0 A;  5IWA K;  2OZS A;  3W0L A;  4Q5V A;  3P83 D;  3KWI A;  1C0F A;  4CHO A;  4UQG A;  3WXL A;  4KHQ A;  2O4I A;  3LM2 A;  1U48 A;  3ISN C;  3K5O A;  4YOX A;  3F2K A;  4BR4 A;  1IBL K;  4FJN A;  5JS2 A;  3DXM A;  3AAP A;  1KAX A;  4KB1 A;  1DT9 A;  1VQP N;  4B9V A;  2NZT A;  3HZ6 A;  1E3M A;  1SKS A;  3OW2 M;  3P1G A;  3L4Q A;  3G6E N;  4B9S A;  4FJG A;  4J2A A;  3PSF A;  3LP3 A;  3THV A;  4KI4 A;  3UKU A;  5HRS A;  3K5M A;  1KAZ A;  4PKI A;  1HNV A;  4TSX A;  1BCO A;  2XO7 A;  4GV6 A;  4QCL A;  2IVO A;  4B1V A;  4CHY A;  4FJ8 A;  1Q18 A;  4W5R A;  3RMC A;  5HRN A;  2CGK A;  4FVU A;  3HRG A;  3BDP A;  5BRF A;  1NKC A;  3BY5 A;  4BRP A;  1RGI A;  4DV0 K;  4IDH A;  3N4P A;  3LPU A;  2BDP A;  1NGI A;  3GOI A;  2OPQ A;  4JHD B;  3B6P A;  3D2F B;  4PQU A;  3AVC A;  1U45 A;  2F7T A;  4IFY A;  3HXM A;  3MED A;  1NOY A;  3O1W A;  4C1N I;  4CBW A;  4DTS A;  2HND A;  4I7F A;  3QFU A;  1U04 A;  2KZM A;  3WXI A;  1WN7 A;  1RT7 A;  2GWK A;  1N6Q A;  2CGJ A;  3DI6 A;  4B9T A;  1J6Z A;  1GLL O;  4LF8 K;  1DTT A;  2W6K A;  3SQ4 A;  2HHQ A;  2F9T A;  3KLG A;  2B5J A;  4MDB A;  3EKU A;  3ZSV A;  3MEC A;  4AH9 A;  3BF3 A;  1DTQ A;  2YHX A;  4I2P A;  2HVI A;  3NE6 A;  1YXQ A;  3LDN A;  1BU6 O;  2Q97 A;  2XY7 A;  4CJR A;  1IKY A;  4ILJ A;  3CF5 L;  1WSJ A;  1GOB A;  3BGR A;  1E4F T;  5AQN A;  3FFK B;  2ASP A;  4BQZ A;  3O9R A;  3THW B;  4C8O A;  3VQ8 A;  3AO3 A;  3HVR A;  1JJ2 M;  4M41 A;  4A5A A;  2HHH K;  1ILY A;  1JCF A;  4CFD A;  2EX3 A;  2KTQ A;  4B9L A;  3CI5 A;  3VEO A;  2HHT A;  1P8Z A;  4PKG A;  3EE9 A;  4HTL A;  5LL6 Z;  4BRC A;  3O80 A;  4GKJ K;  4KRF A;  3LWL A;  4I9L A;  4FSV A;  3V9U A;  3KTQ A;  3H6E A;  4DLG A;  3DLG A;  4IEE A;  4WCE L;  4IZ9 A;  4FWR A;  3VA3 A;  3VOV A;  5A2Q O;  2YNF A;  3UIQ A;  4LSL A;  4BRH A;  1S72 N;  3ULE A;  1C0M A;  5I3U A;  1IKV A;  3QEV A;  1ASW A;  3NH0 A;  1ATR A;  3SQ1 A;  4K0K K;  3QES A;  1C0G A;  4DFM A;  2E88 A;  3C6H A;  3VET A;  5MLC Q;  3OYN A;  3TWH A;  4M3W A;  3S41 A;  1WOQ A;  1BIZ A;  3BEX A;  2P9K A;  4FZZ A;  3GG4 A;  3WUH A;  2PYJ A;  4IO9 L;  5AZJ A;  1NGE A;  4JI0 K;  1GLF O;  3CHW A;  2QM1 A;  3HOS A;  1LAV A;  1D4X A;  1NU0 A;  3AGR A;  1WSF A;  3HPG A;  4IOA L;  2IAJ A;  2OPP A;  3VTI A;  2P9L A;  1S1T A;  4FL9 A;  3SV4 A;  2A3Z A;  4I2Q A;  1CZA N;  2GBZ A;  4DV7 K;  4MLH A;  4LSN A;  5LMU K;  2BE2 A;  3ENH A;  4FJL A;  3IKM A;  4BG9 A;  2Z1G A;  4JRP A;  3MX2 A;  1NK0 A;  1B9D A;  3MN5 A;  4K25 A;  4XH1 A;  3S3M A;  3AA2 A;  4K42 A;  2KW4 A;  1SS6 A;  3H1Q A;  1RCH A;  4BE2 A;  3C94 A;  4U67 L;  1K9M O;  1P90 A;  4NYF A;  2W40 A;  5JMV A;  3J80 O;  2WUS A;  2ZJR L;  1CXU A;  1Z25 A;  1N33 K;  4YOW A;  1BG3 A;  1IG8 A;  1X9J A;  2NRW A;  4F8R A;  3KKS A;  4AHU A;  3HBT A;  5LY3 A;  1S1U A;  1VQK N;  4LFA K;  1KVC A;  4H4O A;  4J8F A;  1UOC A;  3LAK A;  5JIC A;  2NLX A;  4O8U A;  1TKD A;  3C0B A;  1Q81 O;  3O9U A;  4KHP K;  4CD3 A;  1RT6 A;  3P31 A;  3CQY A;  4M3Y A;  3A5O C;  3SJJ A;  4FWK A;  3U3Y A;  1JLF A;  3VN5 A;  4B8C A;  4CZJ A;  4CF8 A;  2QW9 A;  4AM7 A;  2QXF A;  4CGD A;  3L0Q A;  3TU5 A;  4GV9 A;  5F0X A;  3BZC A;  2OAN A;  2YJE A;  4JK8 A;  1L3S A;  3HJF A;  4IJA A;  5AQV A;  4CJP A;  4W5N A;  3CM6 A;  1QQN A;  3Q7B A;  4M63 C;  3PV8 A;  4BRM A;  3PIO L;  2ATQ A;  1XI1 A;  5M1F A;  4U7B A;  3LDL A;  1QVG M;  1W97 L;  4GMJ B;  5F1X A;  3QDK A;  3RMD A;  4CE9 A;  4H5R A;  1BI4 B;  1NK7 A;  3AVH A;  4IO8 A;  3TAN A;  3ID6 A;  3CJ9 A;  2G8V A;  4DS5 A;  1VSD A;  2HHS A;  4JI5 K;  4JHD A;  2DY4 A;  4CZL A;  3PSI A;  3D2F A;  1HNZ K;  3J7A P;  1T6C A;  3NBP A;  2YKM A;  3M8R A;  4OJR A;  4CF2 A;  4WFN L;  3H46 O;  3OA9 A;  2RKI A;  3AA3 A;  2P51 A;  3R1X A;  3VQ6 A;  3EKS A;  3CCJ N;  4CHP A;  4O0J A;  3D6R A;  3FLC O;  3HP9 A;  1KD1 O;  2A1R A;  3V9X A;  5EY4 A;  4B3T K;  3D2E B;  5GAD P;  4EFH A;  2XY6 A;  1T03 A;  5C25 A;  4JKG B;  3VEZ A;  3P38 A;  1HYV A;  1OH6 A;  4O8K A;  5GIP A;  4FXD A;  4KBO A;  4BE1 A;  3K0S A;  4HUG A;  1CZB A;  1T8E A;  2P9U B;  3L4I A;  4DTN A;  2HNY A;  3THW A;  3IUC A;  1ATN A;  3KHY A;  4A61 A;  1JXE A;  1ZBL A;  1ZXO A;  3NHG A;  1XHZ A;  1S1X A;  2P9N B;  3H1V X;  4LFB K;  3ENO A;  3DWL A;  4DMN A;  1QHA A;  4BDZ A;  2P9I B;  3BZK A;  1NJI O;  4H0O A;  4B1Z A;  1RFQ A;  4KH6 A;  2FF6 A;  4K8Z A;  3NCI A;  4FJ9 A;  4DB3 A;  3WT0 A;  3K9K A;  1REV A;  3U9Z A;  1VAZ A;  3L3U A;  2CH5 A;  3QIC A;  4MDA A;  1RDC A;  3ZT3 A;  1Z05 A;  2RF2 A;  3L2Q A;  4DF4 A;  3ZSR A;  3KK1 A;  3SZ2 A;  4HHT A;  4FPA A;  3NFA A;  3QIN A;  3V1Q A;  3ZCM A;  3ZSZ A;  1WBD A;  2OA8 A;  4BDP A;  3G71 N;  4DUZ K;  4KB0 A;  5CY4 A;  1YJ9 N;  3OYJ A;  5CYM A;  3UKR B;  2ZF5 O;  4BE0 A;  3VQQ A;  1WSE A;  4KV8 A;  3IS9 A;  3UE5 A;  1VQL N;  2LSN A;  4E7I A;  2AJQ A;  1DLO A;  1JL2 A;  1HKB A;  1NMN A;  3ZX3 A;  1WSG A;  3I56 N;  2HHX A;  2F96 A;  4QAG A;  4DSE A;  4LD0 A;  3ITH A;  3TAF A;  1W0H A;  3WNF A;  4JLH A;  2VGN A;  1Q86 O;  3GBT A;  1RBR A;  4HVJ A;  3CC4 N;  4E19 A;  5DMR A;  1RT2 A;  2XY8 A;  2D0P A;  3IFR A;  1FJG K;  4FWL A;  4MO5 A;  2QWQ A;  2VWB A;  1ASV A;  4CHQ A;  4JAX A;  2FSN A;  2G8H A;  1U2V B;  4DV5 K;  4DSL A;  3TSU A;  1KCF A;  1V4S A;  4WE1 A;  3SUN A;  3WEE B;  2E2O A;  1TL1 A;  5BPN A;  2Q0R A;  2XY5 A;  4F2S A;  3A5N C;  4JI3 K;  5FRN A;  5F2R A;  3OYD A;  1KTQ A;  3BF1 A;  3K57 A;  3U3G A;  4DV6 K;  4H0Y B;  2NRV A;  2KFZ A;  4ZHR A;  1XNR K;  1GLJ O;  1YTU A;  1Q7Y O;  5AQF A;  3OYK A;  1YVU A;  3TSP A;  1TUU A;  5C0Y A;  4BR2 A;  3JAM O;  3N4Q A;  2QK9 A;  3PO5 A;  2ITG A;  2P1J A;  2YI1 A;  1S22 A;  4O44 A;  1BOT O;  3VQE A;  3VEX A;  3ZET B;  5LMN K;  4W5O A;  1LWF A;  2AA4 A;  2NRH A;  3CET A;  3DLL L; 
#chains in the Genus database with same CATH homology
 4BRO A;  4CBU A;  2E1Y A;  4GV6 A;  2IVO A;  4B1V A;  5KQD A;  1Q18 A;  3CCR N;  4JKC A;  1ZC6 A;  3I33 A;  1NM1 A;  5TKY A;  4AF1 A;  1T6D A;  5AQG A;  4BVO A;  1N8R O;  4CZI A;  5DM7 L;  1VQ5 N;  3MX5 A;  5GAG P;  2BUP A;  2CGK A;  4FVU A;  4UY8 O;  3HRG A;  4BRF A;  5BRF A;  1DGK N;  3MCA B;  3CCQ N;  2QI2 A;  3C65 A;  4BRP A;  4DKW A;  1RGI A;  3KVG A;  4IDH A;  1GLC G;  1BDG A;  3N4P A;  1GLD G;  3ENB A;  4H5N A;  2JWK A;  3K9J A;  5EVZ A;  1NGI A;  2RE2 A;  3GOI A;  3SJH A;  2E2N A;  4BRK A;  3SAH A;  1KC8 O;  4C23 A;  4JHD B;  5JVH L;  3FZH A;  3ZYY X;  3D2F B;  5FPD A;  1V4T A;  4BRA A;  3CQX A;  3C7N B;  1YJW N;  2F7T A;  4DHY A;  3CC2 N;  4GY2 B;  3J8A A;  3HM8 A;  3NVM A;  3D2E A;  3O1W A;  4C1N I;  4CBW A;  1Q82 O;  2A5X A;  2V52 B;  4JKG A;  2Q0U A;  3CJA A;  3QFU A;  4CJ7 A;  5BPM A;  3DXK B;  1NBW A;  3WXI A;  2GWK A;  1K8A O;  4BC2 A;  5GAE P;  2CGJ A;  3M1F A;  4YDU A;  2HBK A;  1J6Z A;  1GLL O;  1KQS M;  2F9T A;  2P9U A;  3LL3 A;  1O13 A;  4K41 A;  3WQT A;  1TYQ A;  1TUY A;  4MDB A;  3EKU A;  4MLE A;  5JLH A;  2CGL A;  1RDW X;  2FXU A;  3BF3 A;  2YHX A;  2HF3 A;  5FPM A;  4B1X B;  5CR4 A;  1YXQ A;  3O8M A;  1SAZ A;  3LDN A;  4JKA A;  3T69 A;  3QML A;  1BU6 O;  3R3L A;  2P9N A;  2Q97 A;  4FO0 A;  2NRX A;  4ILJ A;  3CF5 L;  1ZBS A;  2P9I A;  1NGA A;  4IFE A;  2I7N A;  4BG8 A;  1E4F T;  5AQN A;  3FFK B;  2ASP A;  3T7Z A;  4BQZ A;  3VMF B;  3O9R A;  2HST A;  2NRT A;  1JJ2 M;  5KPT A;  1LOT B;  2CH6 A;  2P9P B;  3CME N;  3FZM A;  5AFU A;  4A5A A;  4FPB A;  3B8A X;  1ILY A;  3MWP A;  2FSK A;  3LDP A;  1JCF A;  3ATU A;  3HI0 A;  4CZF A;  2KLA A;  1VQ6 N;  1QZ6 A;  1KAY A;  3HTV A;  5ELZ A;  4A2B A;  4JK9 A;  4XEI A;  1VQO N;  3CI5 A;  3VEO A;  5CE3 A;  2HF4 A;  4BR9 A;  4NLB A;  4JD2 A;  3RSE A;  5JLF A;  4YOY A;  1VQ9 N;  2D1K A;  3PLA A;  1P8Z A;  4KH4 A;  4PKG A;  1XQS C;  3EE9 A;  4HTL A;  3VGK A;  4BRC A;  3O80 A;  1M1K O;  5M1Q A;  4GNI A;  2HBJ A;  2HOE A;  1SZ2 A;  4FSV A;  4I6M A;  2V7Z A;  2ZGZ A;  4PKH A;  3TPQ A;  3H6E A;  2QWO A;  4RWT A;  4IEE A;  3MN9 A;  5AFU H;  3ZX0 A;  5C2D A;  4WCE L;  4IZ9 A;  4FWR A;  3VOV A;  1VQN N;  4BC5 A;  1IJJ A;  4ISG A;  3VEN A;  3UKR A;  3ZX2 A;  3HSC A;  4BRH A;  4WFB L;  1S72 N;  3ULE A;  3SBT A;  1NLV A;  3VF6 A;  5C12 A;  3LDQ A;  2AP1 A;  2FSJ A;  2GWJ A;  3O9Q A;  2QWM A;  3MMV A;  2QWL A;  2H3G X;  1ATR A;  2VYP A;  3JS6 A;  4XH4 A;  5AQI A;  1C0G A;  4JEP A;  2E88 A;  4BY9 C;  3C6H A;  3VET A;  5MLC Q;  4A5B A;  3S41 A;  1WOQ A;  3GL1 A;  3MDQ A;  2BH1 A;  3A8Y A;  4ISE A;  3BEX A;  5AQK A;  4BRI A;  5M1K A;  2P9K A;  4NLC A;  3E1Y A;  3GG4 A;  4HWI A;  3WUH A;  2PFU A;  4IO9 L;  5AZJ A;  1MWK A;  3SMP A;  1NGE A;  1YIT N;  1GLF O;  3E9O A;  3CCU N;  3MN6 A;  3VEV A;  3CHW A;  4BRG A;  2QM1 A;  3HOS A;  3CCV N;  4FOE A;  1D4X A;  3Q7C A;  3SLC A;  4PHT X;  3AGR A;  3EN9 A;  2QEX N;  4WYB A;  3H45 C;  1Z6R A;  4IOA L;  4BVP A;  1X3M A;  3QB0 A;  1QZ5 A;  1DKG D;  5GIO A;  2ZJP L;  4CI6 A;  5AZI B;  2E1Z A;  1YJN N;  3VTI A;  2P9L A;  4IXC A;  2IIR A;  3J7Z O;  4FL9 A;  1VQ8 N;  2ZJQ L;  1NMD A;  4B1Y B;  2A3Z A;  4CZG A;  1CZA N;  4MLH A;  3PIP L;  1U2V A;  3H3N O;  3R6M A;  3A0I X;  3ENH A;  2VCP A;  4CBX A;  3O4W A;  3IKM A;  4BG9 A;  5H1S Q;  3MX2 A;  2NRR A;  5M1P A;  3WEE A;  5KPZ A;  3FGU A;  3TTC A;  5AQU A;  3MN5 A;  4K25 A;  4XH1 A;  3CCM N;  4G9Z A;  3P4I A;  4K42 A;  2HBL A;  2WC9 A;  1SS6 A;  2GTD A;  3H1Q A;  3QBX A;  4U67 L;  5E84 A;  4FWM A;  2KHO A;  5AQR A;  1K9M O;  1P90 A;  3KWG A;  2W40 A;  3O9S A;  2GEM A;  4IWV A;  5JMV A;  3ZEU B;  4KH5 A;  2WUS A;  2ZJR L;  1HLU A;  2QWP A;  1RDU A;  3AGK A;  4YOW A;  2YJF A;  4H5V A;  1BG3 A;  1IG8 A;  1X9J A;  2NRW A;  3FZL A;  2YHY A;  5LY3 A;  3HBT A;  5E26 A;  5FPN A;  3SMS A;  1NWK A;  1VQK N;  4WQ4 C;  4J8F A;  1K8K A;  3G4S N;  1YI2 N;  3FZF A;  5AQO A;  1JCG A;  5AQW A;  5JIC A;  2NLX A;  4O8U A;  1Q81 O;  3C0B A;  2VGM A;  3O9U A;  4H5T A;  4ILH A;  4CD3 A;  4LC9 B;  5AQX A;  3CER A;  2P9S B;  3P31 A;  3CQY A;  4JKF A;  2QWR A;  3CJ7 A;  3A5O C;  4FWO A;  3TTF A;  5CHI A;  4FWK A;  5AQP A;  1YVN A;  2QXL A;  4YOT A;  3ZET A;  5DM6 L;  4OO1 J;  4F9O A;  4CZJ A;  2QW9 A;  4H0T B;  4AM7 A;  3DXM B;  2IVN A;  3L0Q A;  3TU5 A;  1DEJ A;  4GV9 A;  3VGM A;  5F0X A;  3F5T A;  2E8A A;  3JXU A;  2OAN A;  2YJE A;  4ILG B;  4JK8 A;  4E1J A;  2ITM A;  4IJA A;  5AQV A;  5BN8 A;  3VTH A;  3L6Q A;  1QQN A;  3Q7B A;  4M63 C;  2NRZ A;  4BRM A;  3PIO L;  4GVE A;  2YCH A;  3UKU B;  5M1F A;  4U7B A;  3KZB A;  3LDL A;  1QVG M;  4A57 A;  1W97 L;  1VQ4 N;  2D4W A;  1NGH A;  5AQH A;  1EO1 A;  3A5M C;  3TSQ A;  4B1W B;  4YDU C;  1HPM A;  5F1X A;  1YUW A;  3QDK A;  1EQY A;  1NGD A;  1GLB G;  1MDU B;  4H5R A;  4M7X A;  5AQY A;  4K43 A;  2ASO A;  3I8B A;  4IO8 A;  3U9D A;  3WQU A;  4BRL A;  5EOY A;  2NNW A;  1E4G T;  3AY9 A;  1MWM A;  3EL2 A;  3LM9 A;  3ID6 A;  1ESV A;  2FLO A;  3CJ9 A;  3RVC A;  1KXP A;  5FPE A;  4JHD A;  3WXM B;  4IEI A;  3DAW A;  4CZL A;  3D2F A;  1T6C A;  4H03 B;  3CIP A;  3C7N A;  3IMX A;  1NGG A;  2GX9 A;  4WFA L;  3O5B A;  4PL7 A;  4NB4 A;  4WFN L;  3P39 A;  1G99 A;  4FOI A;  1XC3 A;  3H46 O;  3M5R A;  5AR0 A;  3OA9 A;  5C15 A;  4B9Q A;  3CPE A;  3AAQ A;  3R1X A;  3R8E A;  3EKS A;  4CZE A;  2V7Y A;  3DXK A;  3CCJ N;  2YHW A;  4BRQ A;  4C1N K;  2PAV A;  4FWS A;  5BRH A;  4JKH A;  3D6R A;  2WBN A;  4EIA A;  3FLC O;  1SQK A;  2Q1N A;  1KD1 O;  1HUX A;  3NMU A;  5EY4 A;  4H5W A;  4O5F A;  5M1N A;  3D2E B;  5GAD P;  4EFH A;  4BGB A;  1OVY A;  3SK3 A;  1YAG A;  5EX5 A;  4WF9 L;  4JKG B;  3VEZ A;  3CCS N;  3CXC M;  1K73 O;  5LJV A;  3P38 A;  4OPA A;  3GDQ A;  4O8K A;  5GIP A;  4KBO A;  1HJO A;  5I9E B;  2D0O A;  3DLL L;  4FWN A;  3BP8 A;  3CJ1 A;  1VQM N;  4B1U B;  5AQL A;  4M7Y A;  3F9M A;  1HKG A;  2P9U B;  4WQ5 C;  2J4R A;  1NGB A;  2A42 A;  3L4I A;  3FZK A;  4JKB A;  1TYQ B;  2Q36 A;  1VQ7 N;  3IUC A;  3OBW A;  1ATN A;  1HX1 A;  5BRD A;  3KHY A;  4A61 A;  2JWL A;  3CCE N;  1ZXO A;  1LCU A;  4MO4 A;  2P9P A;  2OTL N;  2E20 A;  3EZW A;  4H0V B;  2YX6 A;  4YOV A;  2Q2R A;  2P9N B;  2HBM A;  3H1V X;  3ENO A;  3UB5 A;  1BO5 O;  3DWL A;  3GE1 A;  3CPW M;  1QHA A;  3QFP A;  2P9I B;  3VF2 A;  1BWF O;  3MN7 A;  5KQ8 A;  2E2P A;  1U6Z A;  4JK7 A;  4DCH A;  4IJN A;  1NJI O;  4YOR A;  2GUP A;  2V51 B;  4H0O A;  2GEL A;  4B1Z A;  2F9W A;  1RFQ A;  3OHR A;  3I55 N;  4KH6 A;  2FF6 A;  2Q31 A;  3D7E O;  4FWP A;  3R9P A;  2QA4 N;  4WQ4 A;  3AAR A;  3ATV A;  4DB3 A;  3WT0 A;  3VGL A;  4IOX A;  5ADX A;  3K9K A;  3U9Z A;  1NGJ A;  1VAZ A;  1X3N A;  2CH5 A;  3QBW A;  3QIC A;  4BR5 A;  4MDA A;  4CZK A;  5C10 A;  1BUP A;  1YIJ N;  3MK6 A;  4JD2 B;  3RSE B;  5AQJ A;  2IVP A;  3SBG A;  1HKC A;  1BA1 A;  2I7P A;  1Z05 A;  2W41 A;  4OPH A;  4JKD A;  1NGC A;  4A62 A;  3BUZ B;  3VEY A;  4EHU A;  4FPA A;  1H1V A;  3DJC A;  4I6M B;  4EHT A;  4QS9 A;  3U4L A;  4GV3 A;  4BC3 A;  5AQS A;  2ASM A;  3G71 N;  4QS8 A;  3VEW A;  2PBD A;  2ZGY A;  4A2A A;  2OTJ N;  3M6G A;  1YJ9 N;  3UKR B;  2ZF5 O;  5ADX H;  4QS7 A;  3ULE B;  2A40 A;  3KK7 A;  3UE5 A;  3SAG A;  1QQM A;  3ID8 A;  1VQL N;  3OBY A;  3O6W A;  5C2F A;  3O08 A;  4RTF D;  4AM6 A;  1QVF M;  1ATS A;  3M3Z A;  5LJW A;  3HOT A;  1HKB A;  5KPR A;  5BN9 A;  1NGF A;  3ZX3 A;  5AQM A;  2QTD A;  4L3Q A;  3I56 N;  3EE8 A;  3SAF A;  4Z94 A;  4EAH D;  4CZH A;  2P9K B;  5BRE A;  4R79 A;  1JCE A;  3VES A;  2RHK A;  2UYT A;  5M1O A;  5AZJ B;  4NO7 A;  5AQT A;  5AZI A;  1MA9 B;  4PL8 A;  5JVG L;  5AQZ A;  3VER A;  1GLA G;  4XH5 A;  1YHQ N;  2VGN A;  3IDH A;  3LDO A;  3WXJ A;  1Q86 O;  3FR0 A;  3O9T A;  3GBT A;  1M90 O;  3E9L A;  3CC4 N;  3H3O B;  3CMA N;  3A5L C;  3FE1 A;  3CD6 N;  4CZM A;  1OKJ A;  2D0P A;  3IFR A;  4BQL A;  4FWL A;  4MO5 A;  4JN4 A;  2P9L B;  4BC4 A;  2QWQ A;  5HOO A;  2VWB A;  2EWS A;  5HL7 L;  4YOU A;  3EO3 A;  2DPN A;  4JAX A;  2FSN A;  3MWT A;  4CD1 A;  3CJB A;  1U2V B;  4H0X B;  3TSU A;  3ZEU A;  5AQQ A;  2BTF A;  1V4S A;  1R59 O;  4BR7 A;  1YF5 L;  3WEE B;  2E2O A;  5BR9 A;  5BPN A;  4JNE A;  2Q0R A;  4H0P A;  5GIN A;  1Y64 A;  1T44 A;  3A5N C;  4WQ5 A;  2WFB A;  1S3X A;  5F2R A;  4IOC L;  3G25 A;  5BPL A;  4BR0 A;  4RCH A;  3TTD A;  3CJC A;  3BF1 A;  4DQ8 A;  3CCL N;  3W0L A;  4JKE A;  4BGA A;  1W2B M;  4FWQ A;  4H0Y B;  2E2Q A;  2NRV A;  4BRN A;  1T3V A;  2FF3 B;  2HMP A;  3C6A A;  3KWI A;  1C0F A;  2KKZ A;  2P9S A;  3VPZ A;  1GLJ O;  1WUA A;  5GAH P;  3WXL A;  1Q7Y O;  5AQF A;  5B8H A;  3NVK A;  5TKW A;  3LM2 A;  1K8K B;  4YOX A;  3F2K A;  3W3D A;  4BR4 A;  4Y0W A;  3TSP A;  3DXM A;  3U8X A;  1TUU A;  3AAP A;  3WXK A;  5C0Y A;  5EXW A;  4BR2 A;  1KAX A;  1DT9 A;  2ZWH A;  1VQP N;  4ISF A;  3N4Q A;  2NZT A;  3HZ6 A;  3CC7 N;  3OW2 M;  1XUP O;  4BRE A;  3L4Q A;  2YI1 A;  1BA0 A;  3G6E N;  1S22 A;  1BOT O;  3E9P A;  3VEX A;  2A6A A;  3MCP A;  3ZET B;  2QWN A;  1QQO A;  3UKU A;  3O1B A;  1KAZ A;  4PKI A;  3VF4 A;  4A59 A;  1GLE G;  4BRD A;  2AA4 A;  3E66 A;  2NRH A;  3CET A;  2A41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...