5DM6L

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
RRKLRTRRKVRTTTAASGKLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2015-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5dm6L01
1K8AO 5JVHL 3PIPL 5GADP 1Q82O 3G71N 3CCLN 3CCMN 1YHQN 3CCQN 5HL7L 1Q7YO 3CMEN 3CCUN 4WFAL 3CMAN 1Q81O 3CCEN 1YJ9N 3CPWM 1VQ6N 1VQ4N 2QEXN 1VQ9N 1VQKN 1OVYA 1VQ8N 1KD1O 3CCVN 4WFBL 4WFNL 5GAGP 1YITN 3CC7N 1Q86O 3PIOL 1S72N 1VQNN 4WCEL 3I55N 5JVGL 3CD6N 3CCRN 1W2BM 1VQMN 5DM6L 1VQPN 4IOCL 1ILYA 1K9MO 4U67L 3G4SN 1VQ7N 5MLCQ 3CF5L 1K73O 1QVFM 4UY8O 3CC4N 3DLLL 1NJIO 2OTJN 2ZJRL 5DM7L 1YJWN 3I56N 1VQ5N 3CCSN 1KC8O 1YJNN 5GAEP 2QA4N 2OTLN 1JJ2M 5GAHP 3CCJN 1YI2N 1M90O 3OW2M 1VQON 3CXCM 4IO9L 1N8RO 3G6EN 4IOAL 2ZJQL 3J7ZO 1KQSM 4WF9L 1VQLN 1QVGM 3CC2N 2ZJPL 1M1KO 1YIJN 5H1SQ
chains in the Genus database with same CATH superfamily
4FLVA 1VAZA 4KHQA 3VEWA 3DXKB 4DS4A 1XC9A 3DYAA 1B9FA 1C0FA 4A61A 5SWMA 4DV5K 3SJJA 4JD2B 4BGBA 3PLAA 5TKYA 5B8HA 4CVNE 4DCHA 1RCHA 3IUCA 4QOZB 4FM0A 1JLGA 2AJQA 3J8AA 4BRCA 1YTUA 5F2RA 3KD5E 1N5YA 2FBVA 4BDPA 3BY5A 3VQAA 1C1AA 3KVGA 1BHLA 2VYPA 4Q5VA 4AF1A 2H3GX 2IS3A 3D2FA 4BVPA 3NFAA 1WSHA 1VRUA 1X3NA 1R0AA 2O4GA 1RILA 4H0YB 4E19A 4DSKA 3LP2A 4E0DA 3SJHA 2Z1JA 2IOCA 3V1OA 1LW0A 3QEIA 1L5UA 1NGDA 2OCEA 3THXA 4PKGA 5JLFA 3T3FA 2KLAA 1W2BM 1NLVA 4O0IA 3V9ZA 3THWB 4R79A 1K9MO 3MN5A 4JRPA 1S3XA 2P9LA 3OYEA 1IKYA 1Q8IA 4DR7K 4E7JA 2YJEA 1HNVA 3M8PA 3OBYA 3SQ0A 4CZFA 1WSEA 3J80O 4CEDA 5FPEA 2OYQA 4CECA 2O8EA 5AQFA 3MXMA 1TK5A 3WQTA 3HXMA 4PKIA 4LFBK 3UKRB 4DG1A 1KXPA 1Y64A 4Z0UA 2NRXA 3ZSWA 4E3SA 1YI2N 3TR8A 3AO1A 3THYB 2Q36A 1RDWX 2O8CA 3CM6A 3SAFA 2W41A 4BC2A 3G0ZA 4WF9L 3CJ1A 1VQLN 1QVGM 1IBMK 1J5EK 3MWPA 2WTUA 4OPHA 4YHHK 3H3NO 1SKWA 3PY8A 2KKZA 3DAWA 1NWKA 1D9FA 3O4QA 1FXXA 2OZMA 4FJGA 4XH5A 3I8DA 3C95A 2QM1A 4DTNA 2ZM6K 4K42A 4CEAA 3VQ6A 4FJLA 3WUHA 2D0PA 2I7PA 4BC4A 3HOSA 1SL2A 1W0HA 1VQ4N 4F8RA 5EOYA 5BRDA 1JXEA 4GKKK 1JCFA 3DXMA 4Z4GA 2WC9A 3WQUA 3DXKA 4X65K 1HPZA 4FOEA 3JXUA 3OYJA 3OBWA 1NK7A 1IKWA 4CGGA 4CFDA 3CC7N 4BWMA 1VHXA 4B8CA 4KRFA 4Z4HA 3FZKA 4HUFA 1LW2A 3KD1E 2ETJA 4OKJA 3P5JA 4CBWA 1BUPA 1HLUA 3SNNA 3VTIA 4CIFA 1YT3A 5ADXH 4M3RA 4DMNA 1HNZK 3QDKA 3NF8A 2P9IA 4KB1A 4B1YB 1KCFA 4B1ZA 4H5RA 4E7IA 3C6TA 3VN5A 4FWOA 3ATVA 3CERA 3M6GA 3VQ9A 3OYNA 1NK4A 2Q31A 3GDQA 3VQEA 3VA3A 2NUBA 1SAZA 4H8KA 3AGRA 1WUAA 5AQZA 3NVKA 5FDLA 4CZLA 2HW3A 1LCUA 3W3DA 4ZTJA 2UXBK 2E2OA 2P1JA 1I94K 2ITMA 4CEFA 1JLAA 4CFCA 2BUPA 5AQMA 3MEDA 2E6LA 4BRDA 3AVNA 2FF3B 1P90A 3AA4A 1YF5L 4EIAA 2HHSA 2VCPA 3LP0A 3WXJA 3A5NC 3NDKA 4B9SA 3R8EA 3VETA 4B08A 4QS7A 1E4GT 5BREA 2PYLA 5HOOA 1CZBA 2XY5A 4F4KA 5BPMA 1L3TA 1RDBA 2QXLA 4FWPA 1NOZA 4NCGA 3QEWA 1CXUA 4CFAA 4KHUA 2KW4A 5AQOA 4NXMK 4FL9A 4BRKA 1L3VA 1SV5A 1QQOA 1TV6A 3CPWM 1GLCG 1OH5A 4FW1A 3OY9A 3I8BA 3ULDA 1Y97A 4FWSA 1VSHA 3BF3A 4IDHA 5E84A 1VSFA 4CI6A 1YVUA 3C65A 4FLUA 1JLQA 3AVGA 4CJPA 2BANA 3SAGA 2QK9A 3L8BA 3O3GA 4GVEA 4JYAK 1U49A 2O8FB 3VQCA 4A5AA 1NG9A 4FJ7A 3ZSYA 1VSEA 4CE9A 1RBSA 4BRFA 5HRNA 3OYBA 4JS4A 3ZETB 2ITGA 2HBKA 4E7KA 3CJ7A 4H4MA 4KTQA 4W5QA 2P9NA 1HKGA 3K58A 4MDAA 2D0OA 4BR4A 2ZE2A 3EEQA 3R6MA 3DLLL 4FZXC 4FVMA 1KFDA 1T3VA 3PV8A 1CXQA 3OS0A 3EE8A 4KH5A 4BRQA 1BIZA 1ZC6A 4OKKA 5GAEP 3ZSXA 1XUPO 3V6DA 2OTLN 5HP1A 1F21A 4FJ8A 1JL1A 3BUZB 4F9OA 3LP1A 3GOIA 1Q18A 4CHQA 3O3FA 3EKUA 4H0VB 2A6AA 5I3UA 3TSQA 5C10A 2W42A 2DFEA 5HBMA 4OGCA 4DQSA 1U48A 2JLEA 5GADP 3CFPA 4B3OA 1Z6RA 5CHIA 5TKWA 4JV5K 5AQUA 3VQ8A 1A5VA 1UA1A 3UKUB 1S1WA 5FPNA 4J2BA 4J2EA 5AQSA 1N6QA 4RW9A 4YOTA 1GLLO 3CCUN 1HJRA 4CGIA 4A5BA 5AQTA 4FK4A 4N56A 1VQ6N 3WT0A 3RR7A 1S9GA 4PQUA 2A3ZA 1RGIA 1LV5A 1I39A 4G9ZA 1ATRA 3MCPA 1JLCA 5GAGP 3OYMA 1H1VA 4KH4A 1X9SA 1QQMA 1B92A 1C0MA 4K43A 5LJVA 5KPTA 1TUUA 4IZ9A 4OPAA 1EXQA 3NGIA 1X3MA 2HB5A 1HNWK 1L3UA 4IJNA 5EU7A 3J7YP 1RT5A 1ASVA 4K8ZA 1ATSA 3HJFA 3T1YK 5BN9A 3AVMA 4HTLA 3SV4A 1NBWA 4JKCA 1T7PA 3H1QA 2YKNA 1QHAA 1WLJA 4CHNA 2VWBA 3LM2A 4DFJA 4F2SA 4DQ8A 1J54A 3H45C 3NGYA 4CK2A 3KKSA 2XRIA 2VG7A 5C15A 4BC3A 1BO5O 3BP8A 4JKAA 4B1WB 4DV4K 2E6MA 4QS9A 1WB9A 2YKMA 3CJBA 2HOEA 3IKMA 3BEXA 4FOIA 2YNFA 1JJ2M 3MEGA 4EP5A 2HNZA 3OS2A 5M1FA 3U3GA 2VWJA 4CK1A 2GWJA 1WNSA 4HVJA 5H1SQ 4B9TA 1K8AO 2NRTA 1SL1A 4W5TA 4LSNA 4AHUA 1NJZA 4EFHA 4DR3K 2KZZA 1KRPA 1BQNA 2HHHK 4H03B 1RT1A 2LSNA 3KK2A 4DTMA 3CMEN 4DSFA 4YNQA 2GV9A 3RMCA 3HOTA 3QEXA 5AQLA 4OVLA 2RN2A 2GX9A 1VQ9N 1C6VA 3QLHA 4JNEA 2QWPA 2VWKA 4B1XB 2YHAA 4DQPA 3ENBA 4CF1A 2ZD1A 5KRTA 3AVKA 4BR2A 4L8RB 1HNXK 3KZBA 3VQBA 2BE2A 1P8ZA 4LF6K 1NK8A 2QWRA 3KWIA 4DLGA 3FE1A 5JICA 3FZMA 4FJMA 3MDQA 3F2KA 5AZIB 3ZSVA 1XHZA 1VQMN 4ELTA 5J2MA 4DTSA 1WOQA 5FRNA 3MXJA 1NGAA 1IKXA 3QIOA 4KH6A 2IIRA 2PBDA 3IAYA 3TANA 3LM9A 1VK0A 2BH1A 4MLHA 1KTQA 5AQQA 4IDKA 1UA0A 4CJQA 1LWEA 2AP1A 3P1GA 2OTJN 3LDQA 3A2FA 3VPZA 3SPYA 2KHOA 4H0OA 1U45A 3S3OA 3CCSN 1Z26A 2HBLA 1HJOA 2D1KA 4FWRA 1TAQA 3EE9A 2F4VK 3L2UA 1IBLK 4MO4A 4C1NK 4B9NA 4NXNK 2UXCK 4C8NA 2A41A 4IFEA 4IJAA 4ID1A 1HYVA 2NRHA 5AQHA 3O3HA 3PX6A 4ID5A 3ATUA 2NRWA 1JCEA 1U47A 1SL0A 3WEEA 4M3ZA 4N41A 1Q82O 2Q0RA 1W9HA 3G71N 3L4IA 5J2PA 3EZ5A 4KHWA 3OA9A 3AVJA 4BWJA 3ZSRA 4PHTX 3CCQN 4PWDA 3ID8A 4I6MB 4DR2K 2FBTA 4BGAA 4WFAL 4FLZA 4BR7A 3D2EA 1B9DA 3AO3A 4EHTA 4B3TK 4X62K 1T8EA 2ATQA 1NMNA 3EKSA 1KVBA 3MN9A 3N4PA 5CZ2A 2F8SA 3N4QA 3UB5A 2HVIA 4MFBA 5AQYA 3LWLA 1SUQA 4DF4A 5AQRA 4FXDA 3S3MA 5EXWA 4FJ9A 3ZX2A 5AZJB 4FM1A 3HRGA 5AFUA 3DOKA 3CD6N 1NJYA 3P38A 5M1PA 4DSJA 1G15A 1VRTA 5AFUH 1QSSA 1RDDA 4FJJA 3ZT2A 3H08A 2YHWA 2NRZA 3VF6A 2A1RA 3E1YA 2A42A 3CQYA 2WFBA 3HP9A 4JK7A 4UY8O 3AO4A 3VA0A 2OPPA 3L6QA 2E20A 4I7FA 2VGMA 4N76A 3VF4A 2P9KB 1ZBLA 1DLOA 1KVAA 4FWNA 4FZYA 1SS6A 3OHRA 3SK3A 3TAMA 4BRGA 1WBBA 5C25A 4OPKA 3HO1A 5AZIA 3KHYA 3CCJN 2GELA 3HPGA 4X66K 5EY4A 1QE1A 5BRFA 4CF2A 5J2NA 4CHZA 2FXUA 4FK0A 4IWVA 1R59O 3V1RA 5GIPA 3K5MA 1K8KB 3O4WA 1TKZA 2CGLA 1QTMA 5KPRA 4JHDB 4JKGB 3DOLA 1JLFA 3VENA 5M1NA 3A0IX 3RMBA 3O5BA 1BG3A 1W97L 4KTWA 3CCMN 4JAXA 3VGLA 1RFQA 1Q7YO 2HHTA 4IKFA 2DY4A 1OKJA 2UYTA 4O8UA 4CD3A 3FZHA 3LL3A 1QQNA 4DS5A 3ZT3A 2KFNA 4BC5A 5ELZA 3HVTA 2F96A 3CFOA 4A2BA 3T69A 4JKBA 1NGIA 3O9TA 2X74A 1GLJO 2D4WA 4FSVA 3RRHA 4FJNA 1WSGA 3I55N 5JVGL 4ILJA 3MX5A 1NGJA 3KIOA 3HSTB 4JI4K 4NB4A 4BRLA 4CEBA 3TAGA 1T44A 3OJUA 3OYDA 2ZGZA 3R1XA 4DTPA 1ATNA 4BRNA 4PL8A 3CHWA 5E41A 4BG9A 3K5LA 3HM9A 2YNHA 2ZF5O 4JD2A 3UE5A 1NNEA 4JI7K 3A5LC 2FLOA 1NGCA 1QVFM 1S6QA 4NLBA 1NJIO 1KSPA 1IV0A 4DUYK 3VGKA 1MWMA 5CR4A 1TUYA 5AZJA 3A8YA 2I7NA 1HYSA 4N47A 1IG9A 1G99A 3AA2A 5AQIA 5ADXA 3RMDA 1NGEA 2KZMA 1OVQA 4DTOA 4BRMA 1KC8O 3DLBA 1ZXOA 4CK3A 4NO7A 4CJFA 3C94A 2BGGA 1QS4A 5LMNK 2W40A 4NYFA 3DM2A 3QICA 1X9WA 1UWBA 3TI0A 4BQZA 4F3OA 1E3MA 4FJKA 2UUCK 3KLHA 4JI8K 2ZJPL 3C6AA 4CJTA 1YIJN 1T6CA 2KFZA 3GG4A 2IAJA 3OS1A 1NJWA 4DFKA 1XC3A 3ZSQA 3OYAA 3AAQA 2B6AA 2P9SB 1RDUA 3AAPA 4Z4FA 4NCBA 3T1HK 3LP3A 3THWA 4KHPK 2HNYA 1TK0A 3P4IA 1V4SA 3BZCA 4EHUA 4YFUA 3KLEA 4I9LA 3LDOA 4YOYA 2QEXN 3TABA 3OYCA 1DGKN 1VQKN 5K14A 1KFSA 1JLBA 4JHDA 4JKGA 4KAZA 1KD1O 2PYJA 1GLFO 1IG8A 4AQYK 5HRPA 2NRRA 3C7NB 4W5OA 3UKRA 5F0XA 1WAFA 2FBXA 3QBXA 2YHBA 4ILHA 2OPRA 3MX2A 4E7LA 3THYA 4WCEL 4HWIA 4E1MA 1D4XA 4DV1K 3K5NA 4V19S 3ZEUB 5A2QO 3ENOA 1KLMA 1A5WA 5KGWA 3U9DA 5KPZA 2YCHA 1VQPN 3SAHA 3O9UA 2P9PB 3WNHA 2XY8A 1EP4A 2FBYA 1VQ7N 4GKJK 4FWKA 2O8BB 3MK6A 3NAEA 1EWQA 4DR4K 1U04A 4CD1A 3G25A 2ZJRL 1NK6A 2VQEK 3TARA 1VSMA 3TTDA 3JAMO 2X6NA 4CCHA 3DMJA 2ASPA 3SLCA 4CJKA 4IEEA 5GAHP 4O8KA 4CEZA 3TAEA 2JWLA 2EX3A 3OW2M 1A5XA 3L2RA 3B6PA 4KI6A 1RBRA 4JN4A 4ISGA 3E9PA 2V7YA 4H5WA 3W0LA 4DU4A 3QIPA 3ZYYX 5KQ8A 2IGIA 4BRPA 4YY3K 2X78A 1M1KO 4BR9A 3MECA 2Z1GA 4J2AA 4HUEA 2E1YA 4KHYA 4E1NA 2W6LA 5JLHA 3E9LA 2QI2A 2YNGA 3P39A 3ZCMA 4BDZA 1DEJA 1BA1A 3CJCA 4AH9A 3LDLA 1S6PA 4CIGA 4BR0A 2NRVA 1Q81O 3DRRA 2QKBA 1CZAN 3LPUA 4Y1CA 2E2NA 2PFUA 3SQ4A 5D3GA 1HQEA 4BRAA 5AQVA 4FM2A 3NH0A 1VQ8N 3TTCA 3VQ7A 4NLCA 4CFBA 3TWHA 4CBXA 1C0GA 4MDBA 3WNFA 4IEIA 3M3ZA 1LAWA 1SZ2A 3P83D 1YITN 4PY5A 4DV7K 3L0QA 1S1UA 4B9LA 3KK1A 1VQNN 4CHPA 4KB0A 1C1CA 1HQUA 2QWLA 3CCRN 4BE0A 3V9UA 3HSCA 4QCLA 1NK5A 3VERA 5BN8A 3AGKA 4Q0BA 4J8FA 1T05A 2QTDA 3NH2A 4GV3A 3QBWA 1MA9B 2B5JA 1BOTO 1GLAG 3TAQA 3VEYA 1TVRA 3ITHA 3ZSZA 3AA3A 2E4LA 3T19A 4GV6A 1XQSC 4PL7A 1HX1A 5EX5A 2Z1HA 1ASUA 5AQPA 4CGDA 1IH7A 2A1SA 1HR0K 4DR5K 4Y0WA 2YX6A 3OYFA 3PUFA 4CJVA 3F9MA 4FLTA 3ZEUA 4C1NI 4DQIA 1ZBIA 1BISA 1NK9A 2G8HA 4EZ6A 4YOWA 2W6KA 3UIQA 2YV0X 2DTUA 4C8LA 3SCXA 3VEVA 1WAJA 2QXFA 3O1WA 4CJ4A 2O8BA 3I0RA 3U4LA 4W5RA 5FRMA 3K2PA 1NM1A 4CZEA 1J6ZA 3ZT1A 4YDUC 4EAHD 4AM6A 1RDAA 4IFYA 4M63C 2O8FA 4JI1K 4QAGA 2O4IA 3ZETA 4FPBA 4CJ3A 3MEEA 4WQ4C 1RT2A 4FCYA 2DPNA 1QSLA 1FKOA 4Z4IA 1JXBA 1WSIA 1EWRA 3FFIA 3CCEN 4O5BA 1SKSA 2XY7A 4JKEA 5I9EB 3LAMA 2QW9A 3VQQA 4JI2K 4CGJA 1GOCA 4YOXA 2D5RA 4IOXA 4FWMA 4GW6A 4LF5K 3V9SA 4DF8A 4FO0A 3O08A 5AQXA 3I33A 1S1XA 5GINA 1W7AA 1TKXA 1U2VB 4CBUA 1D8YA 1S72N 3QERA 2WUSA 3O80A 2UXDK 2WOMA 5DK5A 4B8AB 1YVNA 1WSFA 1C0TA 4BROA 3RMAA 1ASWA 4BDYA 5T7BA 4GMJB 4ILGB 4JK8A 4CZMA 1JLEA 1BL3A 5I42A 2ZWHA 3QO9A 1K6YA 1J5OA 2Q3SA 3Q7BA 1JL2A 3V9WA 3TPQA 4RW6A 4BREA 1Z25A 2G8IA 3L3UA 4IG3A 2G8FA 1ZBSA 1XWLA 3LPTA 3UKUA 2ZGYA 1Q9YA 5IWAK 1RTJA 4GY2B 2X6SA 1YJWN 1VQ5N 1HMVA 2XO7A 4IG0A 4M7YA 3U8XA 3V81A 1YJNN 3NBPA 3D7EO 2AA4A 2QA4N 3ALYA 3BDPA 4FLYA 3KLGA 5C24A 1D9DA 2GUPA 4CF9A 2CH5A 3ZLJA 5LJWA 1VSDA 1GOAA 4B9MA 4KPYA 4JEPA 2NLXA 3THXB 3PO5A 4ELUA 1N8RO 3RWUA 3VQ4A 3PSIA 3TSPA 2VGNA 3SMSA 4C8KA 2P9LB 4F3TA 1BIUA 1FK9A 3LDSA 3T7ZA 2YHXA 4IO8A 3K9KA 4FJXA 4AHRA 4LF8K 4FK2A 3S9HA 4YDUA 2F7TA 3H3OB 1C1BA 5IT9O 4B1VA 5HL7L 4RW8A 3LZJA 2ASMA 3HK2A 3M5RA 1KLNA 3SBTA 3OYLA 3M8SA 2XY6A 2E5LK 4WQ4A 1SQKA 3D6RA 3NMUA 5BR9A 3LALA 4OKEA 5M1KA 3AARA 4K41A 4HUGA 5AQKA 2O8CB 4FJHA 3PSFA 4EZ9A 3DLEA 2Q97A 4RW4A 4WFBL 3IDHA 4M45A 3OYIA 4LFAK 1X9JA 2CGKA 3VQDA 4DR1K 1S9EA 4CGHA 3IMXA 2UUAK 4R5PA 4LF4K 3CPEA 4LF9K 4LD0A 3TSUA 1S1VA 3VESA 1RT4A 3NE6A 2QWMA 3K57A 2YNIA 4H5NA 4ZHRA 4CZHA 3CFRA 2IVOA 2VQFK 1ILYA 4C23A 1QZ5A 2QKKA 2Q1NA 3NF7A 3MAQA 2HVHA 4CF8A 3IRXA 2Z1IA 3NHGA 2G8VA 4HTUA 4DV6K 4DTJA 3QB0A 4OX9K 4GNIA 3DXMB 1TK8A 3R9PA 3SI6A 1QZ6A 2CH6A 3DLKA 5CZ1A 1HRHA 2A40A 4QS8A 4GVMA 4MQ3A 1RBUA 4BRHA 5C12A 3FFKB 3AV9A 1EX4A 4DHYA 3V1QA 1U6ZA 3O8MA 1S22A 4LSLA 5KI6A 4IO9L 4B3MK 3ULEB 2UU9K 3CG7A 3F5TA 2PY5A 4XH4A 3SUOA 3C6UA 2XHBA 4ICLA 5M1QA 3CC2N 1SKRA 1N36K 1IJJA 2P9IB 2RHKA 1S5JA 1RDCA 5KRSA 4BY9C 2OZSA 1GOBA 3PIPL 4KV8A 2E88A 1EETA 2IVNA 4CJLA 4J2DA 2DFFA 3DWLA 2HSTA 5C42A 4I2QA 3M1FA 3KTQA 4CIEA 1OH8A 4CW7B 4M3XA 1WSJA 1DKGD 4MO5A 3VQ5A 3F9KA 4FW2A 3FZFA 4KI4A 4JKHA 1NU0A 3VEOA 4Z4EA 3QETA 1BWFO 2ASOA 3DJCA 4Z4CA 2E8AA 3E9OA 1FKPA 3D45A 1LAVA 3FR0A 3K5OA 3VMFB 3MCAB 2G8WA 4DB3A 3HBTA 1WN7A 4H0XB 4CGFA 4NYNA 4E1JA 4DSLA 3I0SA 2E2QA 1E4FT 2A5XA 3QFPA 3PIOL 3ISNC 2BDPA 1NGGA 4WE1A 1ZBUA 5FROA 2NNWA 3KLIA 3DI6A 3KK7A 5JS2A 4OLAA 2HBMA 3WNGA 1N32K 1S1TA 3HP6A 4X64K 3C6HA 2HMPA 4JS5A 3CIPA 3TAPA 1LWFA 3CF5L 1NKCA 4CERA 3IS9A 3H1VX 2QWNA 1KAXA 2HF3A 1Q9XA 3D0PA 4CHYA 2FC0A 4F2RA 4XEIA 4I6MA 4RG8A 5DM7L 2FSKA 4BE2A 2O8DB 3O1BA 3EY1A 4NCAA 3IG1A 3NCIA 3I56N 4B3RK 4CEQA 4JI5K 2OANA 1IKVA 1ESVA 2GBZA 1TGOA 2CGJA 3FLCO 2P5OA 4O5FA 3NF9A 1FW6A 2IDOA 2Y1IA 3WXLA 4CJSA 2FSNA 3TTFA 5J2QA 2ZJQL 4JRQA 3SUPA 5CYMA 3L2WA 1RTDA 4EP4A 2G8UA 5LMUK 3OVNA 4KFBA 2RKIA 3O9QA 3TAFA 2P9NB 4H0TB 5C2FA 2RE2A 1NGFA 1MDUB 4G1QA 4DFMA 3HM8A 1RTHA 3HZ6A 4DV2K 5E26A 3WNEA 2OA8A 2WBNA 4CZKA 4JK9A 2KQ2A 3HL8A 1YHQN 4O4GA 3LANA 4ZTFA 4CZIA 3QNNA 4KREA 5F1XA 3ZSOA 1BDGA 3A5MC 3G10A 4GV9A 3ULEA 1BCMA 3SQ2A 2D0CA 4B1UB 2P9KA 4M3YA 4OGEA 4CEEA 4DTUA 3AVBA 3QNOA 3K9JA 2GEMA 4HCCA 3VEZA 4DLEA 4WFNL 4CESA 1BCOA 4AHVA 3RR8A 1QHTA 1Q86O 3WXKA 1CZ9A 2Q2RA 1KAZA 1L3SA 3ENHA 4JKDA 1QSYA 4I2PA 2HHVA 5KGXA 2YI1A 3NF6A 1K8KA 2F9TA 2BTFA 3C0BA 4H4OA 5DM6L 4BE1A 4LF7K 2KTQA 1UAXA 3CYMA 4DKWA 2HBJA 4YORA 3JYTA 4W5NA 5MLCQ 4O0JA 3ZX3A 3SV3A 3QEVA 2HHWA 1HUXA 3RSEB 2J4RA 4MLEA 5FPMA 3T1AA 3SPZA 4B3SK 3HPHA 1BGXT 2IC3A 3ZX0A 5C2DA 3U3YA 1X1PA 2GTDA 1TL3A 2QWOA 2YHYA 5AJ3K 1VSKA 2P51A 4DV3K 3F73A 1GLDG 1GLEG 3NVMA 3HVRA 4XIUA 3L2QA 4FJIA 1QQCA 3S3NA 1X9MA 1Z05A 3A5OC 2QWQA 3DLRA 4YOUA 1VQON 1RBTA 3SZ2A 2HHUA 1IBKK 3HPOA 2E1ZA 3VTHA 3G6EN 4CJ5A 4RW7A 2JWKA 2PZSA 4LFCK 3LAKA 2NZTA 3VF2A 1VSJA 4JI6K 2RF2A 1IO2A 4DTRA 2O8DA 4M41A 4FJ5A 1DTQA 1KAYA 3BF1A 4H0PA 3ASMA 3TU5A 1RNHA 3AVFA 3AO2A 3SYZA 4DU3A 4M3TA 4ELVA 2R7YA 3THVA 1YJ9N 4M42A 4CJ7A 1HKBA 3AA5X 1XNRK 1UOCA 4H5VA 3CJAA 1JKHA 4DU1A 4ISFA 3LZIA 4L3QA 1J53A 1JCGA 1HPMA 4FLXA 3U6FA 1J9AA 2IVPA 1TYQB 3SUQA 4KO0A 3DRPA 3MMVA 2OPQA 3CI5A 3DRSA 4AHTA 4CHOA 3J7AP 3IFRA 1RT7A 4C8MA 5AQJA 4B9VA 1BQMA 3AVLA 5AR0A 4N5SA 4M3WA 4IOCL 3KK3A 3HYFA 5C0YA 5LY3A 2V51B 5BR8K 1RT3A 2HMIA 5CE3A 1HKCA 3CC4N 2P9SA 4BRIA 4DUZK 4FWLA 4FPAA 2V52B 4E7HA 4BACA 2GWKA 3NGZA 3SQ1A 2EHGA 2D0AA 3CJ9A 4IXCA 3J81O 4DQRA 4DFPA 5FLXO 1EKEA 4CZGA 3SUNA 4A62A 4WQ5C 1RTIA 1YTAA 4PA1A 3AO5A 1LOTB 1MU2A 4CJEA 3LWMA 4C8OA 2F9WA 4BR5A 3FZLA 3LDPA 3P31A 1NGBA 3KWGA 3MN6A 1C0UA 1DTTA 4O44A 3OJSA 4DTXA 3C7NA 1YUWA 3RRGA 4IOAL 3RSEA 4RWTA 2I5JA 4IBNA 5BRHA 3SBGA 5AQGA 3PO4A 5HRSA 3H6EA 1N33K 3QEPA 5GIOA 3DLHA 5JVHL 4KTZA 3V4IA 4CF0A 3VGMA 4AHCA 3NH1A 5JS1A 3GBTA 4FYDA 4KBOA 4FVUA 1V4TA 3WXIA 4CJWA 3GE1A 1NKEA 2P9PA 4DR6K 4KHNA 1ZBFA 2V7ZA 4O55A 1XMQK 1CLQA 1XI1A 3EN9A 3BZKA 4CZJA 5BPNA 3OYGA 4FWQA 2VG5A 3MXIA 1EO1A 3QESA 4HHTA 3KKRA 5HROA 3DLGA 2Q0UA 4M3UA 3ZT4A 3CQXA 1NOYA 4BQLA 2HNDA 3AVHA 1D5AA 4CJUA 3CCVN 2Y1JA 1TKDA 4BG8A 3E01A 2P5GA 3U9ZA 3VOVA 1YXQA 3WXMB 3S41A 3VQPA 3L3VA 3WEEB 3AVAA 1BI4B 4A59A 1HNIA 3OYKA 3JS6A 5AQNA 4XH1A 3M8RA 3HI0A 4UQGA 3O6WA 2P9UB 2WONA 3HTVA 3G4SN 3OTOK 5JMVA 1BA0A 3CQ8A 2G8KA 4LH5A 1MWKA 4DV0K 3FGUA 1K73O 3D2EB 4TSXA 3K0SA 1TYQA 1XHXA 3E66A 5CY4A 3RVCA 4JKFA 3V9XA 2YJFA 4M7XA 4OLBA 4K0KK 3HT3A 1U4BA 3Q7CA 2PAVA 5DMRA 2FF6A 4E89A 2HF4A 4FLWA 4OJRA 1N34K 4PKHA 3CETA 1REVA 1TKTA 4WQ5A 2D0BA 4AM7A 5SZTA 4JI3K 1VSLA 5BPLA 1FJGK 1ITGA 3O9RA 3VEXA 4K8XA 3J7ZO 1HYZA 3CM5A 2ZQBA 1NGHA 3PX4A 2FSJA 5EVZA 2RPIA 3D2FB 3EO3A 5J1EA 5KQDA 3KLFA 4KHSA 4B9QA 4A57A 4OPJA 3QMLA 3CCLN 1XMOK 2JGUA 2F8TA 3EL2A 1TL1A 3GL1A 4DWIA 4I9QA 5HRRA 3KJVA 4HCBA 3CMAN 4OO1J 1LWCA 3B8AX 4CEOA 1O13A 5AQWA 1DT9A 3RTVA 1OH7A 1NMDA 1OVYA 3ID6A 3ZT0A 2HHXA 2GUIA 1NKBA 3QFUA 4B9UA 4AHSA 3B6OA 4JLHA 3OYHA 4DQQA 5CYQA 3QINA 2O8EB 1RT6A 5HLFA 1GLBG 1YAGA 2B4JA 1RBVA 1T03A 4JI0K 4U7BA 2EWSA 1NK0A 4A2AA 5M1OA 1OH6A 3PX0A 1NJXA 3L4QA 2E2PA 4Y1DA 4PUOA 4LY7A 4H5TA 3MN7A 4ISEA 4Z94A 4U67L 4K25A 2VG6A 3LDNA 5KTQA 4RCHA 3R3LA 1XNQK 3BGRA 3SMPA 4LH4A 4YOVA 5LL6Z 4RTFD 4WYBA 3O9SA 4KKOA 1ZYQA 3JSMA 1BU6O 4AILC 1T6DA 3AY9A 3EZWA 3EYZA 4FZZA 1WBDA 1TAUA 3H46O 1EQYA 1BI4A 2OPSA 4BVOA 3AVCA 2HHQA 3AVIA 2DFHA 1ZBHA 1O1WA 3M8QA 4DSIA 2UUBK 5FPDA 3K59A 2P9UA 1M90O 4CJRA 3CXCM 3MWTA 1VSIA 1KVCA 1KQSM 4DSEA 3O4NA 1U2VA 1I3AA 3L2VA 4LC9B 4IFVA
chains in the Genus database with same CATH topology
2E1YA 2P9NB 4H0TB 1K8AO 1VAZA 2RE2A 5C2FA 1NGFA 2NRTA 3DXKB 3VEWA 1C0FA 1MDUB 4EFHA 4A61A 3HM8A 4JD2B 4BGBA 3HZ6A 5E26A 5JLHA 3E9LA 3PLAA 2QI2A 2WBNA 5TKYA 4CZKA 5B8HA 4JK9A 3P39A 4H03B 4DCHA 3IUCA 1YHQN 1DEJA 1BA1A 3CJCA 4CZIA 3LDLA 3CMEN 5F1XA 3HOTA 4BR0A 2NRVA 3J8AA 4BRCA 1BDGA 5F2RA 3A5MC 1Q81O 4GV9A 5AQLA 3ULEA 1CZAN 2E2NA 2PFUA 2GX9A 4B1UB 1VQ9N 4JNEA 2P9KA 4BRAA 2QWPA 5AQVA 3KVGA 1VQ8N 2VYPA 4B1XB 3TTCA 3K9JA 3ENBA 4AF1A 2GEMA 4NLCA 2H3GX 3VEZA 4BR2A 3D2FA 4BVPA 4WFNL 4CBXA 1C0GA 3KZBA 4MDBA 1X3NA 3M3ZA 4IEIA 1SZ2A 4H0YB 1YITN 1Q86O 3WXKA 3L0QA 2Q2RA 1P8ZA 2QWRA 1VQNN 1KAZA 3KWIA 3SJHA 3FE1A 5JICA 3FZMA 2QWLA 3CCRN 3ENHA 4JKDA 3HSCA 1NGDA 3MDQA 4PKGA 3F2KA 2YI1A 5JLFA 1K8KA 3VERA 2F9TA 2KLAA 3AGKA 2BTFA 3C0BA 5BN8A 1W2BM 5AZIB 1VQMN 4J8FA 1NLVA 5DM6L 2QTDA 4GV3A 1WOQA 3QBWA 4R79A 1NGAA 1K9MO 3MN5A 1MA9B 1S3XA 4KH6A 1BOTO 2IIRA 2P9LA 2HBJA 4YORA 1GLAG 2PBDA 4DKWA 5MLCQ 3LM9A 3ZX3A 3VEYA 2BH1A 2YJEA 1HUXA 4MLHA 3RSEB 2J4RA 4MLEA 3OBYA 5AQQA 5FPMA 4GV6A 4CZFA 1XQSC 4PL7A 1HX1A 5EX5A 5FPEA 2AP1A 3ZX0A 5C2DA 2OTJN 3LDQA 2GTDA 2QWOA 2YHYA 5AQFA 5AQPA 3VPZA 2KHOA 1GLDG 4H0OA 4Y0WA 1GLEG 3WQTA 2YX6A 3NVMA 3CCSN 2HBLA 1HJOA 4PKIA 3F9MA 2D1KA 3UKRB 4FWRA 1KXPA 1Y64A 2NRXA 3ZEUA 4C1NI 3EE9A 1Z05A 1YI2N 4MO4A 3A5OC 2QWQA 4YOWA 2Q36A 4YOUA 1RDWX 1VQON 4C1NK 3SAFA 2W41A 4BC2A 2A41A 2E1ZA 3VEVA 4IFEA 4IJAA 3VTHA 3O1WA 3G6EN 4UY8O 2NRHA 5AQHA 4WF9L 3CJ1A 2JWKA 3U4LA 1VQLN 1QVGM 1NM1A 4CZEA 3MWPA 3ATUA 1J6ZA 2NZTA 4OPHA 2NRWA 4YDUC 1JCEA 3VF2A 4AM6A 4EAHD 3H3NO 4M63C 2KKZA 3WEEA 3DAWA 1NWKA 1Q82O 4XH5A 2Q0RA 3G71N 3L4IA 3ZETA 1KAYA 3BF1A 4H0PA 2QM1A 4FPBA 3TU5A 4WQ4C 2DPNA 4K42A 3OA9A 4PHTX 3CCQN 3ID8A 3WUHA 4I6MB 2D0PA 2I7PA 4BC4A 3HOSA 4BGAA 4WFAL 3CCEN 4BR7A 1YJ9N 3D2EA 4CJ7A 4EHTA 4JKEA 1HKBA 1VQ4N 5EOYA 5BRDA 5I9EB 2QW9A 4H5VA 1JCFA 3CJAA 3DXMA 3EKSA 3MN9A 3N4PA 4ISFA 4YOXA 3N4QA 4FWMA 4IOXA 2WC9A 3UB5A 3WQUA 4L3QA 1JCGA 1HPMA 3DXKA 3O08A 4FO0A 4FOEA 3JXUA 5AQYA 5AQRA 2IVPA 3I33A 5AQXA 5EXWA 1TYQB 3OBWA 5GINA 3ZX2A 1U2VB 4CBUA 5AZJB 3MMVA 3CC7N 3HRGA 3CI5A 1S72N 2WUSA 5AFUA 3IFRA 3CD6N 3O80A 5AQJA 3FZKA 3P38A 5M1PA 1YVNA 5AFUH 4CBWA 1BUPA 5AR0A 1HLUA 4BROA 3VTIA 4IOCL 5ADXH 2YHWA 2NRZA 5C0YA 5LY3A 4ILGB 3VF6A 3QDKA 2P9IA 4JK8A 4B1YB 4CZMA 4B1ZA 2ZWHA 3E1YA 2A42A 3CQYA 2V51B 4H5RA 2WFBA 3Q7BA 3TPQA 4JK7A 1HKCA 4FWOA 5CE3A 3ATVA 3CC4N 2P9SA 4BRIA 3L6QA 3CERA 3M6GA 4FWLA 2E20A 2Q31A 3GDQA 4FPAA 4BREA 2V52B 2VGMA 3VF4A 2P9KB 2GWKA 1ZBSA 3UKUA 2ZGYA 3CJ9A 4FWNA 4GY2B 1SAZA 4IXCA 3AGRA 1WUAA 1YJWN 5AQZA 1SS6A 4CZGA 1VQ5N 3NVKA 4A62A 4WQ5C 3OHRA 3SK3A 4M7YA 3U8XA 4CZLA 4BRGA 1LCUA 3D7EO 1YJNN 3W3DA 1LOTB 2AA4A 2QA4N 2E2OA 3KHYA 5AZIA 3CCJN 2GELA 2GUPA 5EY4A 5BRFA 2ITMA 2F9WA 2CH5A 3FZLA 2BUPA 4BR5A 5LJWA 3LDPA 5AQMA 3P31A 1NGBA 2FXUA 3KWGA 3MN6A 4BRDA 4JEPA 2FF3B 1P90A 1R59O 2NLXA 4IWVA 3C7NA 5GIPA 1YUWA 1N8RO 1K8KB 1YF5L 4EIAA 4IOAL 3RSEA 4RWTA 3O4WA 3TSPA 5BRHA 2VCPA 3WXJA 2CGLA 3A5NC 5AQGA 3SBGA 2VGNA 5KPRA 3SMSA 3H6EA 4JHDB 4JKGB 3R8EA 3VETA 2P9LB 4QS7A 5GIOA 1E4GT 5BREA 5JVHL 3T7ZA 5HOOA 2YHXA 4IO8A 3VENA 3K9KA 3VGMA 5M1NA 3GBTA 4KBOA 3A0IX 4FVUA 4YDUA 5BPMA 2F7TA 1V4TA 2QXLA 1BG3A 3H3OB 3O5BA 4FWPA 3WXIA 1W97L 3GE1A 3CCMN 4JAXA 2P9PA 4B1VA 5HL7L 3VGLA 1RFQA 2V7ZA 1Q7YO 5AQOA 2ASMA 3M5RA 1OKJA 2UYTA 3EN9A 4O8UA 3SBTA 4CD3A 4FL9A 3FZHA 4WQ4A 4BRKA 3LL3A 1QQOA 1SQKA 4CZJA 1QQNA 5BPNA 3CPWM 1GLCG 4FWQA 3D6RA 3NMUA 1EO1A 5BR9A 5M1KA 3AARA 4K41A 4BC5A 3I8BA 2Q0UA 5AQKA 5ELZA 3CQXA 4BQLA 4FWSA 3BF3A 4IDHA 5E84A 2Q97A 4A2BA 3T69A 4CI6A 3CCVN 4JKBA 3IDHA 4WFBL 3C65A 1NGIA 4BG8A 1X9JA 2CGKA 3O9TA 1GLJO 2D4WA 4FSVA 3IMXA 3U9ZA 3SAGA 3VOVA 1YXQA 4GVEA 3WXMB 3S41A 3CPEA 3I55N 5JVGL 4A5AA 3WEEB 4ILJA 4A59A 3TSUA 3MX5A 1NGJA 3JS6A 5AQNA 3VESA 4XH1A 4BRFA 2QWMA 3HI0A 3ZETB 4NB4A 4BRLA 2HBKA 4H5NA 3CJ7A 4CZHA 2IVOA 3O6WA 1T44A 2P9UB 1ILYA 4C23A 2ZGZA 3R1XA 1QZ5A 2P9NA 1HKGA 3HTVA 1ATNA 2Q1NA 4PL8A 4BRNA 3G4SN 3CHWA 5JMVA 4BG9A 1BA0A 4MDAA 1MWKA 2ZF5O 2D0OA 4JD2A 4BR4A 3FGUA 3UE5A 1K73O 3A5LC 2FLOA 3D2EB 1NGCA 3R6MA 1QVFM 3DLLL 1NJIO 4NLBA 3VGKA 1MWMA 1TYQA 3QB0A 5CR4A 1TUYA 3E66A 5AZJA 3A8YA 2I7NA 3DXMB 1T3VA 4GNIA 3RVCA 3R9PA 1QZ6A 4JKFA 3EE8A 4KH5A 2CH6A 2YJFA 1G99A 5AQIA 5ADXA 1NGEA 4M7XA 4BRQA 2A40A 1ZC6A 4BRMA 1KC8O 4QS8A 5GAEP 1ZXOA 2PAVA 3Q7CA 1XUPO 2OTLN 2FF6A 4BRHA 5C12A 3FFKB 4NO7A 2HF4A 4DHYA 4PKHA 1U6ZA 3CETA 3O8MA 1S22A 3BUZB 4F9OA 2W40A 3GOIA 4WQ5A 4AM7A 5BPLA 3QICA 1Q18A 4IO9L 3ULEB 3F5TA 3O9RA 3VEXA 4BQZA 4XH4A 3EKUA 3J7ZO 5M1QA 3CC2N 2ZJPL 3C6AA 4H0VB 1NGHA 1YIJN 2A6AA 1IJJA 2P9IB 1T6CA 2FSJA 2RHKA 3TSQA 5C10A 3GG4A 5EVZA 4BY9C 3D2FB 3PIPL 1XC3A 2E88A 3EO3A 5KQDA 5GADP 3AAQA 2IVNA 4B9QA 4A57A 1Z6RA 2P9SB 1RDUA 3AAPA 3QMLA 5TKWA 5AQUA 5CHIA 3CCLN 3DWLA 2HSTA 3M1FA 3EL2A 3UKUB 3P4IA 3GL1A 1V4SA 5FPNA 5AQSA 1DKGD 4MO5A 4EHUA 4YOTA 1GLLO 3CCUN 3FZFA 4JKHA 3CMAN 4A5BA 5AQTA 3VEOA 4OO1J 3LDOA 4YOYA 1VQ6N 1BWFO 3B8AX 2ASOA 3DJCA 2QEXN 2E8AA 1DGKN 1O13A 5AQWA 1DT9A 3E9OA 3WT0A 1VQKN 1NMDA 1OVYA 3ID6A 3FR0A 3VMFB 2A3ZA 3MCAB 4JHDA 1RGIA 3QFUA 4JKGA 4DB3A 4G9ZA 3HBTA 4H0XB 1KD1O 1GLFO 1IG8A 4E1JA 1ATRA 3MCPA 2E2QA 2NRRA 3C7NB 5GAGP 1H1VA 3UKRA 5F0XA 3QBXA 4KH4A 1E4FT 2A5XA 1QQMA 4ILHA 3MX2A 1GLBG 3QFPA 4K43A 1YAGA 3PIOL 1NGGA 5LJVA 5KPTA 1TUUA 4IZ9A 4WCEL 4U7BA 2NNWA 4HWIA 4OPAA 2EWSA 1X3MA 4IJNA 3KK7A 1D4XA 4A2AA 5M1OA 3ZEUB 2HBMA 3L4QA 3ENOA 5KPZA 3U9DA 1VQPN 2YCHA 1ATSA 3C6HA 2E2PA 3SAHA 4H5TA 3MN7A 2HMPA 3O9UA 2P9PB 4ISEA 4Z94A 3CIPA 5BN9A 4K25A 4U67L 3LDNA 4HTLA 1VQ7N 4RCHA 3R3LA 1NBWA 4FWKA 3CF5L 4JKCA 3H1QA 3SMPA 3H1VX 3MK6A 2QWNA 1QHAA 2VWBA 1KAXA 2HF3A 4YOVA 4RTFD 3LM2A 4WYBA 3O9SA 4DQ8A 3H45C 4CD1A 3G25A 1BU6O 2ZJRL 1T6DA 4I6MA 4XEIA 3AY9A 5DM7L 2FSKA 3EZWA 5C15A 3O1BA 4BC3A 3I56N 1BO5O 1EQYA 3BP8A 3H46O 3TTDA 4BVOA 2OANA 4JKAA 4B1WB 2ASPA 4QS9A 3CJBA 3SLCA 2HOEA 1ESVA 3IKMA 3BEXA 4FOIA 1JJ2M 4IEEA 5GAHP 4O8KA 2CGJA 3FLCO 2JWLA 5FPDA 2P9UA 4O5FA 1M90O 3OW2M 4JN4A 3CXCM 5M1FA 3MWTA 4ISGA 3WXLA 3E9PA 2V7YA 4H5WA 2FSNA 3W0LA 3TTFA 2ZJQL 1KQSM 3ZYYX 1U2VA 5KQ8A 4BRPA 2GWJA 1M1KO 4BR9A 4LC9B 3O9QA 5H1SQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8A O;  5JVH L;  3PIP L;  5GAD P;  1Q82 O;  3G71 N;  3CCL N;  3CCM N;  1YHQ N;  3CCQ N;  5HL7 L;  1Q7Y O;  3CME N;  3CCU N;  4WFA L;  3CMA N;  1Q81 O;  3CCE N;  1YJ9 N;  3CPW M;  1VQ6 N;  1VQ4 N;  2QEX N;  1VQ9 N;  1VQK N;  1OVY A;  1VQ8 N;  1KD1 O;  3CCV N;  4WFB L;  4WFN L;  5GAG P;  1YIT N;  3CC7 N;  1Q86 O;  3PIO L;  1S72 N;  1VQN N;  4WCE L;  3I55 N;  5JVG L;  3CD6 N;  3CCR N;  1W2B M;  1VQM N;  5DM6 L;  1VQP N;  4IOC L;  1ILY A;  1K9M O;  4U67 L;  3G4S N;  1VQ7 N;  5MLC Q;  3CF5 L;  1K73 O;  1QVF M;  4UY8 O;  3CC4 N;  3DLL L;  1NJI O;  2OTJ N;  2ZJR L;  5DM7 L;  1YJW N;  3I56 N;  1VQ5 N;  3CCS N;  1KC8 O;  1YJN N;  5GAE P;  2QA4 N;  2OTL N;  1JJ2 M;  5GAH P;  3CCJ N;  1YI2 N;  1M90 O;  3OW2 M;  1VQO N;  3CXC M;  4IO9 L;  1N8R O;  3G6E N;  4IOA L;  2ZJQ L;  3J7Z O;  1KQS M;  4WF9 L;  1VQL N;  1QVG M;  3CC2 N;  2ZJP L;  1M1K O;  1YIJ N;  5H1S Q; 
#chains in the Genus database with same CATH topology
 4FLV A;  1VAZ A;  4KHQ A;  3VEW A;  3DXK B;  4DS4 A;  1XC9 A;  3DYA A;  1B9F A;  1C0F A;  4A61 A;  5SWM A;  4DV5 K;  3SJJ A;  4JD2 B;  4BGB A;  3PLA A;  5TKY A;  5B8H A;  4CVN E;  4DCH A;  1RCH A;  3IUC A;  4QOZ B;  4FM0 A;  1JLG A;  2AJQ A;  3J8A A;  4BRC A;  1YTU A;  5F2R A;  3KD5 E;  1N5Y A;  2FBV A;  4BDP A;  3BY5 A;  3VQA A;  1C1A A;  3KVG A;  1BHL A;  2VYP A;  4Q5V A;  4AF1 A;  2H3G X;  2IS3 A;  3D2F A;  4BVP A;  3NFA A;  1WSH A;  1VRU A;  1X3N A;  1R0A A;  2O4G A;  1RIL A;  4H0Y B;  4E19 A;  4DSK A;  3LP2 A;  4E0D A;  3SJH A;  2Z1J A;  2IOC A;  3V1O A;  1LW0 A;  3QEI A;  1L5U A;  1NGD A;  2OCE A;  3THX A;  4PKG A;  5JLF A;  3T3F A;  2KLA A;  1W2B M;  1NLV A;  4O0I A;  3V9Z A;  3THW B;  4R79 A;  1K9M O;  3MN5 A;  4JRP A;  1S3X A;  2P9L A;  3OYE A;  1IKY A;  1Q8I A;  4DR7 K;  4E7J A;  2YJE A;  1HNV A;  3M8P A;  3OBY A;  3SQ0 A;  4CZF A;  1WSE A;  3J80 O;  4CED A;  5FPE A;  2OYQ A;  4CEC A;  2O8E A;  5AQF A;  3MXM A;  1TK5 A;  3WQT A;  3HXM A;  4PKI A;  4LFB K;  3UKR B;  4DG1 A;  1KXP A;  1Y64 A;  4Z0U A;  2NRX A;  3ZSW A;  4E3S A;  1YI2 N;  3TR8 A;  3AO1 A;  3THY B;  2Q36 A;  1RDW X;  2O8C A;  3CM6 A;  3SAF A;  2W41 A;  4BC2 A;  3G0Z A;  4WF9 L;  3CJ1 A;  1VQL N;  1QVG M;  1IBM K;  1J5E K;  3MWP A;  2WTU A;  4OPH A;  4YHH K;  3H3N O;  1SKW A;  3PY8 A;  2KKZ A;  3DAW A;  1NWK A;  1D9F A;  3O4Q A;  1FXX A;  2OZM A;  4FJG A;  4XH5 A;  3I8D A;  3C95 A;  2QM1 A;  4DTN A;  2ZM6 K;  4K42 A;  4CEA A;  3VQ6 A;  4FJL A;  3WUH A;  2D0P A;  2I7P A;  4BC4 A;  3HOS A;  1SL2 A;  1W0H A;  1VQ4 N;  4F8R A;  5EOY A;  5BRD A;  1JXE A;  4GKK K;  1JCF A;  3DXM A;  4Z4G A;  2WC9 A;  3WQU A;  3DXK A;  4X65 K;  1HPZ A;  4FOE A;  3JXU A;  3OYJ A;  3OBW A;  1NK7 A;  1IKW A;  4CGG A;  4CFD A;  3CC7 N;  4BWM A;  1VHX A;  4B8C A;  4KRF A;  4Z4H A;  3FZK A;  4HUF A;  1LW2 A;  3KD1 E;  2ETJ A;  4OKJ A;  3P5J A;  4CBW A;  1BUP A;  1HLU A;  3SNN A;  3VTI A;  4CIF A;  1YT3 A;  5ADX H;  4M3R A;  4DMN A;  1HNZ K;  3QDK A;  3NF8 A;  2P9I A;  4KB1 A;  4B1Y B;  1KCF A;  4B1Z A;  4H5R A;  4E7I A;  3C6T A;  3VN5 A;  4FWO A;  3ATV A;  3CER A;  3M6G A;  3VQ9 A;  3OYN A;  1NK4 A;  2Q31 A;  3GDQ A;  3VQE A;  3VA3 A;  2NUB A;  1SAZ A;  4H8K A;  3AGR A;  1WUA A;  5AQZ A;  3NVK A;  5FDL A;  4CZL A;  2HW3 A;  1LCU A;  3W3D A;  4ZTJ A;  2UXB K;  2E2O A;  2P1J A;  1I94 K;  2ITM A;  4CEF A;  1JLA A;  4CFC A;  2BUP A;  5AQM A;  3MED A;  2E6L A;  4BRD A;  3AVN A;  2FF3 B;  1P90 A;  3AA4 A;  1YF5 L;  4EIA A;  2HHS A;  2VCP A;  3LP0 A;  3WXJ A;  3A5N C;  3NDK A;  4B9S A;  3R8E A;  3VET A;  4B08 A;  4QS7 A;  1E4G T;  5BRE A;  2PYL A;  5HOO A;  1CZB A;  2XY5 A;  4F4K A;  5BPM A;  1L3T A;  1RDB A;  2QXL A;  4FWP A;  1NOZ A;  4NCG A;  3QEW A;  1CXU A;  4CFA A;  4KHU A;  2KW4 A;  5AQO A;  4NXM K;  4FL9 A;  4BRK A;  1L3V A;  1SV5 A;  1QQO A;  1TV6 A;  3CPW M;  1GLC G;  1OH5 A;  4FW1 A;  3OY9 A;  3I8B A;  3ULD A;  1Y97 A;  4FWS A;  1VSH A;  3BF3 A;  4IDH A;  5E84 A;  1VSF A;  4CI6 A;  1YVU A;  3C65 A;  4FLU A;  1JLQ A;  3AVG A;  4CJP A;  2BAN A;  3SAG A;  2QK9 A;  3L8B A;  3O3G A;  4GVE A;  4JYA K;  1U49 A;  2O8F B;  3VQC A;  4A5A A;  1NG9 A;  4FJ7 A;  3ZSY A;  1VSE A;  4CE9 A;  1RBS A;  4BRF A;  5HRN A;  3OYB A;  4JS4 A;  3ZET B;  2ITG A;  2HBK A;  4E7K A;  3CJ7 A;  4H4M A;  4KTQ A;  4W5Q A;  2P9N A;  1HKG A;  3K58 A;  4MDA A;  2D0O A;  4BR4 A;  2ZE2 A;  3EEQ A;  3R6M A;  3DLL L;  4FZX C;  4FVM A;  1KFD A;  1T3V A;  3PV8 A;  1CXQ A;  3OS0 A;  3EE8 A;  4KH5 A;  4BRQ A;  1BIZ A;  1ZC6 A;  4OKK A;  5GAE P;  3ZSX A;  1XUP O;  3V6D A;  2OTL N;  5HP1 A;  1F21 A;  4FJ8 A;  1JL1 A;  3BUZ B;  4F9O A;  3LP1 A;  3GOI A;  1Q18 A;  4CHQ A;  3O3F A;  3EKU A;  4H0V B;  2A6A A;  5I3U A;  3TSQ A;  5C10 A;  2W42 A;  2DFE A;  5HBM A;  4OGC A;  4DQS A;  1U48 A;  2JLE A;  5GAD P;  3CFP A;  4B3O A;  1Z6R A;  5CHI A;  5TKW A;  4JV5 K;  5AQU A;  3VQ8 A;  1A5V A;  1UA1 A;  3UKU B;  1S1W A;  5FPN A;  4J2B A;  4J2E A;  5AQS A;  1N6Q A;  4RW9 A;  4YOT A;  1GLL O;  3CCU N;  1HJR A;  4CGI A;  4A5B A;  5AQT A;  4FK4 A;  4N56 A;  1VQ6 N;  3WT0 A;  3RR7 A;  1S9G A;  4PQU A;  2A3Z A;  1RGI A;  1LV5 A;  1I39 A;  4G9Z A;  1ATR A;  3MCP A;  1JLC A;  5GAG P;  3OYM A;  1H1V A;  4KH4 A;  1X9S A;  1QQM A;  1B92 A;  1C0M A;  4K43 A;  5LJV A;  5KPT A;  1TUU A;  4IZ9 A;  4OPA A;  1EXQ A;  3NGI A;  1X3M A;  2HB5 A;  1HNW K;  1L3U A;  4IJN A;  5EU7 A;  3J7Y P;  1RT5 A;  1ASV A;  4K8Z A;  1ATS A;  3HJF A;  3T1Y K;  5BN9 A;  3AVM A;  4HTL A;  3SV4 A;  1NBW A;  4JKC A;  1T7P A;  3H1Q A;  2YKN A;  1QHA A;  1WLJ A;  4CHN A;  2VWB A;  3LM2 A;  4DFJ A;  4F2S A;  4DQ8 A;  1J54 A;  3H45 C;  3NGY A;  4CK2 A;  3KKS A;  2XRI A;  2VG7 A;  5C15 A;  4BC3 A;  1BO5 O;  3BP8 A;  4JKA A;  4B1W B;  4DV4 K;  2E6M A;  4QS9 A;  1WB9 A;  2YKM A;  3CJB A;  2HOE A;  3IKM A;  3BEX A;  4FOI A;  2YNF A;  1JJ2 M;  3MEG A;  4EP5 A;  2HNZ A;  3OS2 A;  5M1F A;  3U3G A;  2VWJ A;  4CK1 A;  2GWJ A;  1WNS A;  4HVJ A;  5H1S Q;  4B9T A;  1K8A O;  2NRT A;  1SL1 A;  4W5T A;  4LSN A;  4AHU A;  1NJZ A;  4EFH A;  4DR3 K;  2KZZ A;  1KRP A;  1BQN A;  2HHH K;  4H03 B;  1RT1 A;  2LSN A;  3KK2 A;  4DTM A;  3CME N;  4DSF A;  4YNQ A;  2GV9 A;  3RMC A;  3HOT A;  3QEX A;  5AQL A;  4OVL A;  2RN2 A;  2GX9 A;  1VQ9 N;  1C6V A;  3QLH A;  4JNE A;  2QWP A;  2VWK A;  4B1X B;  2YHA A;  4DQP A;  3ENB A;  4CF1 A;  2ZD1 A;  5KRT A;  3AVK A;  4BR2 A;  4L8R B;  1HNX K;  3KZB A;  3VQB A;  2BE2 A;  1P8Z A;  4LF6 K;  1NK8 A;  2QWR A;  3KWI A;  4DLG A;  3FE1 A;  5JIC A;  3FZM A;  4FJM A;  3MDQ A;  3F2K A;  5AZI B;  3ZSV A;  1XHZ A;  1VQM N;  4ELT A;  5J2M A;  4DTS A;  1WOQ A;  5FRN A;  3MXJ A;  1NGA A;  1IKX A;  3QIO A;  4KH6 A;  2IIR A;  2PBD A;  3IAY A;  3TAN A;  3LM9 A;  1VK0 A;  2BH1 A;  4MLH A;  1KTQ A;  5AQQ A;  4IDK A;  1UA0 A;  4CJQ A;  1LWE A;  2AP1 A;  3P1G A;  2OTJ N;  3LDQ A;  3A2F A;  3VPZ A;  3SPY A;  2KHO A;  4H0O A;  1U45 A;  3S3O A;  3CCS N;  1Z26 A;  2HBL A;  1HJO A;  2D1K A;  4FWR A;  1TAQ A;  3EE9 A;  2F4V K;  3L2U A;  1IBL K;  4MO4 A;  4C1N K;  4B9N A;  4NXN K;  2UXC K;  4C8N A;  2A41 A;  4IFE A;  4IJA A;  4ID1 A;  1HYV A;  2NRH A;  5AQH A;  3O3H A;  3PX6 A;  4ID5 A;  3ATU A;  2NRW A;  1JCE A;  1U47 A;  1SL0 A;  3WEE A;  4M3Z A;  4N41 A;  1Q82 O;  2Q0R A;  1W9H A;  3G71 N;  3L4I A;  5J2P A;  3EZ5 A;  4KHW A;  3OA9 A;  3AVJ A;  4BWJ A;  3ZSR A;  4PHT X;  3CCQ N;  4PWD A;  3ID8 A;  4I6M B;  4DR2 K;  2FBT A;  4BGA A;  4WFA L;  4FLZ A;  4BR7 A;  3D2E A;  1B9D A;  3AO3 A;  4EHT A;  4B3T K;  4X62 K;  1T8E A;  2ATQ A;  1NMN A;  3EKS A;  1KVB A;  3MN9 A;  3N4P A;  5CZ2 A;  2F8S A;  3N4Q A;  3UB5 A;  2HVI A;  4MFB A;  5AQY A;  3LWL A;  1SUQ A;  4DF4 A;  5AQR A;  4FXD A;  3S3M A;  5EXW A;  4FJ9 A;  3ZX2 A;  5AZJ B;  4FM1 A;  3HRG A;  5AFU A;  3DOK A;  3CD6 N;  1NJY A;  3P38 A;  5M1P A;  4DSJ A;  1G15 A;  1VRT A;  5AFU H;  1QSS A;  1RDD A;  4FJJ A;  3ZT2 A;  3H08 A;  2YHW A;  2NRZ A;  3VF6 A;  2A1R A;  3E1Y A;  2A42 A;  3CQY A;  2WFB A;  3HP9 A;  4JK7 A;  4UY8 O;  3AO4 A;  3VA0 A;  2OPP A;  3L6Q A;  2E20 A;  4I7F A;  2VGM A;  4N76 A;  3VF4 A;  2P9K B;  1ZBL A;  1DLO A;  1KVA A;  4FWN A;  4FZY A;  1SS6 A;  3OHR A;  3SK3 A;  3TAM A;  4BRG A;  1WBB A;  5C25 A;  4OPK A;  3HO1 A;  5AZI A;  3KHY A;  3CCJ N;  2GEL A;  3HPG A;  4X66 K;  5EY4 A;  1QE1 A;  5BRF A;  4CF2 A;  5J2N A;  4CHZ A;  2FXU A;  4FK0 A;  4IWV A;  1R59 O;  3V1R A;  5GIP A;  3K5M A;  1K8K B;  3O4W A;  1TKZ A;  2CGL A;  1QTM A;  5KPR A;  4JHD B;  4JKG B;  3DOL A;  1JLF A;  3VEN A;  5M1N A;  3A0I X;  3RMB A;  3O5B A;  1BG3 A;  1W97 L;  4KTW A;  3CCM N;  4JAX A;  3VGL A;  1RFQ A;  1Q7Y O;  2HHT A;  4IKF A;  2DY4 A;  1OKJ A;  2UYT A;  4O8U A;  4CD3 A;  3FZH A;  3LL3 A;  1QQN A;  4DS5 A;  3ZT3 A;  2KFN A;  4BC5 A;  5ELZ A;  3HVT A;  2F96 A;  3CFO A;  4A2B A;  3T69 A;  4JKB A;  1NGI A;  3O9T A;  2X74 A;  1GLJ O;  2D4W A;  4FSV A;  3RRH A;  4FJN A;  1WSG A;  3I55 N;  5JVG L;  4ILJ A;  3MX5 A;  1NGJ A;  3KIO A;  3HST B;  4JI4 K;  4NB4 A;  4BRL A;  4CEB A;  3TAG A;  1T44 A;  3OJU A;  3OYD A;  2ZGZ A;  3R1X A;  4DTP A;  1ATN A;  4BRN A;  4PL8 A;  3CHW A;  5E41 A;  4BG9 A;  3K5L A;  3HM9 A;  2YNH A;  2ZF5 O;  4JD2 A;  3UE5 A;  1NNE A;  4JI7 K;  3A5L C;  2FLO A;  1NGC A;  1QVF M;  1S6Q A;  4NLB A;  1NJI O;  1KSP A;  1IV0 A;  4DUY K;  3VGK A;  1MWM A;  5CR4 A;  1TUY A;  5AZJ A;  3A8Y A;  2I7N A;  1HYS A;  4N47 A;  1IG9 A;  1G99 A;  3AA2 A;  5AQI A;  5ADX A;  3RMD A;  1NGE A;  2KZM A;  1OVQ A;  4DTO A;  4BRM A;  1KC8 O;  3DLB A;  1ZXO A;  4CK3 A;  4NO7 A;  4CJF A;  3C94 A;  2BGG A;  1QS4 A;  5LMN K;  2W40 A;  4NYF A;  3DM2 A;  3QIC A;  1X9W A;  1UWB A;  3TI0 A;  4BQZ A;  4F3O A;  1E3M A;  4FJK A;  2UUC K;  3KLH A;  4JI8 K;  2ZJP L;  3C6A A;  4CJT A;  1YIJ N;  1T6C A;  2KFZ A;  3GG4 A;  2IAJ A;  3OS1 A;  1NJW A;  4DFK A;  1XC3 A;  3ZSQ A;  3OYA A;  3AAQ A;  2B6A A;  2P9S B;  1RDU A;  3AAP A;  4Z4F A;  4NCB A;  3T1H K;  3LP3 A;  3THW A;  4KHP K;  2HNY A;  1TK0 A;  3P4I A;  1V4S A;  3BZC A;  4EHU A;  4YFU A;  3KLE A;  4I9L A;  3LDO A;  4YOY A;  2QEX N;  3TAB A;  3OYC A;  1DGK N;  1VQK N;  5K14 A;  1KFS A;  1JLB A;  4JHD A;  4JKG A;  4KAZ A;  1KD1 O;  2PYJ A;  1GLF O;  1IG8 A;  4AQY K;  5HRP A;  2NRR A;  3C7N B;  4W5O A;  3UKR A;  5F0X A;  1WAF A;  2FBX A;  3QBX A;  2YHB A;  4ILH A;  2OPR A;  3MX2 A;  4E7L A;  3THY A;  4WCE L;  4HWI A;  4E1M A;  1D4X A;  4DV1 K;  3K5N A;  4V19 S;  3ZEU B;  5A2Q O;  3ENO A;  1KLM A;  1A5W A;  5KGW A;  3U9D A;  5KPZ A;  2YCH A;  1VQP N;  3SAH A;  3O9U A;  2P9P B;  3WNH A;  2XY8 A;  1EP4 A;  2FBY A;  1VQ7 N;  4GKJ K;  4FWK A;  2O8B B;  3MK6 A;  3NAE A;  1EWQ A;  4DR4 K;  1U04 A;  4CD1 A;  3G25 A;  2ZJR L;  1NK6 A;  2VQE K;  3TAR A;  1VSM A;  3TTD A;  3JAM O;  2X6N A;  4CCH A;  3DMJ A;  2ASP A;  3SLC A;  4CJK A;  4IEE A;  5GAH P;  4O8K A;  4CEZ A;  3TAE A;  2JWL A;  2EX3 A;  3OW2 M;  1A5X A;  3L2R A;  3B6P A;  4KI6 A;  1RBR A;  4JN4 A;  4ISG A;  3E9P A;  2V7Y A;  4H5W A;  3W0L A;  4DU4 A;  3QIP A;  3ZYY X;  5KQ8 A;  2IGI A;  4BRP A;  4YY3 K;  2X78 A;  1M1K O;  4BR9 A;  3MEC A;  2Z1G A;  4J2A A;  4HUE A;  2E1Y A;  4KHY A;  4E1N A;  2W6L A;  5JLH A;  3E9L A;  2QI2 A;  2YNG A;  3P39 A;  3ZCM A;  4BDZ A;  1DEJ A;  1BA1 A;  3CJC A;  4AH9 A;  3LDL A;  1S6P A;  4CIG A;  4BR0 A;  2NRV A;  1Q81 O;  3DRR A;  2QKB A;  1CZA N;  3LPU A;  4Y1C A;  2E2N A;  2PFU A;  3SQ4 A;  5D3G A;  1HQE A;  4BRA A;  5AQV A;  4FM2 A;  3NH0 A;  1VQ8 N;  3TTC A;  3VQ7 A;  4NLC A;  4CFB A;  3TWH A;  4CBX A;  1C0G A;  4MDB A;  3WNF A;  4IEI A;  3M3Z A;  1LAW A;  1SZ2 A;  3P83 D;  1YIT N;  4PY5 A;  4DV7 K;  3L0Q A;  1S1U A;  4B9L A;  3KK1 A;  1VQN N;  4CHP A;  4KB0 A;  1C1C A;  1HQU A;  2QWL A;  3CCR N;  4BE0 A;  3V9U A;  3HSC A;  4QCL A;  1NK5 A;  3VER A;  5BN8 A;  3AGK A;  4Q0B A;  4J8F A;  1T05 A;  2QTD A;  3NH2 A;  4GV3 A;  3QBW A;  1MA9 B;  2B5J A;  1BOT O;  1GLA G;  3TAQ A;  3VEY A;  1TVR A;  3ITH A;  3ZSZ A;  3AA3 A;  2E4L A;  3T19 A;  4GV6 A;  1XQS C;  4PL7 A;  1HX1 A;  5EX5 A;  2Z1H A;  1ASU A;  5AQP A;  4CGD A;  1IH7 A;  2A1S A;  1HR0 K;  4DR5 K;  4Y0W A;  2YX6 A;  3OYF A;  3PUF A;  4CJV A;  3F9M A;  4FLT A;  3ZEU A;  4C1N I;  4DQI A;  1ZBI A;  1BIS A;  1NK9 A;  2G8H A;  4EZ6 A;  4YOW A;  2W6K A;  3UIQ A;  2YV0 X;  2DTU A;  4C8L A;  3SCX A;  3VEV A;  1WAJ A;  2QXF A;  3O1W A;  4CJ4 A;  2O8B A;  3I0R A;  3U4L A;  4W5R A;  5FRM A;  3K2P A;  1NM1 A;  4CZE A;  1J6Z A;  3ZT1 A;  4YDU C;  4EAH D;  4AM6 A;  1RDA A;  4IFY A;  4M63 C;  2O8F A;  4JI1 K;  4QAG A;  2O4I A;  3ZET A;  4FPB A;  4CJ3 A;  3MEE A;  4WQ4 C;  1RT2 A;  4FCY A;  2DPN A;  1QSL A;  1FKO A;  4Z4I A;  1JXB A;  1WSI A;  1EWR A;  3FFI A;  3CCE N;  4O5B A;  1SKS A;  2XY7 A;  4JKE A;  5I9E B;  3LAM A;  2QW9 A;  3VQQ A;  4JI2 K;  4CGJ A;  1GOC A;  4YOX A;  2D5R A;  4IOX A;  4FWM A;  4GW6 A;  4LF5 K;  3V9S A;  4DF8 A;  4FO0 A;  3O08 A;  5AQX A;  3I33 A;  1S1X A;  5GIN A;  1W7A A;  1TKX A;  1U2V B;  4CBU A;  1D8Y A;  1S72 N;  3QER A;  2WUS A;  3O80 A;  2UXD K;  2WOM A;  5DK5 A;  4B8A B;  1YVN A;  1WSF A;  1C0T A;  4BRO A;  3RMA A;  1ASW A;  4BDY A;  5T7B A;  4GMJ B;  4ILG B;  4JK8 A;  4CZM A;  1JLE A;  1BL3 A;  5I42 A;  2ZWH A;  3QO9 A;  1K6Y A;  1J5O A;  2Q3S A;  3Q7B A;  1JL2 A;  3V9W A;  3TPQ A;  4RW6 A;  4BRE A;  1Z25 A;  2G8I A;  3L3U A;  4IG3 A;  2G8F A;  1ZBS A;  1XWL A;  3LPT A;  3UKU A;  2ZGY A;  1Q9Y A;  5IWA K;  1RTJ A;  4GY2 B;  2X6S A;  1YJW N;  1VQ5 N;  1HMV A;  2XO7 A;  4IG0 A;  4M7Y A;  3U8X A;  3V81 A;  1YJN N;  3NBP A;  3D7E O;  2AA4 A;  2QA4 N;  3ALY A;  3BDP A;  4FLY A;  3KLG A;  5C24 A;  1D9D A;  2GUP A;  4CF9 A;  2CH5 A;  3ZLJ A;  5LJW A;  1VSD A;  1GOA A;  4B9M A;  4KPY A;  4JEP A;  2NLX A;  3THX B;  3PO5 A;  4ELU A;  1N8R O;  3RWU A;  3VQ4 A;  3PSI A;  3TSP A;  2VGN A;  3SMS A;  4C8K A;  2P9L B;  4F3T A;  1BIU A;  1FK9 A;  3LDS A;  3T7Z A;  2YHX A;  4IO8 A;  3K9K A;  4FJX A;  4AHR A;  4LF8 K;  4FK2 A;  3S9H A;  4YDU A;  2F7T A;  3H3O B;  1C1B A;  5IT9 O;  4B1V A;  5HL7 L;  4RW8 A;  3LZJ A;  2ASM A;  3HK2 A;  3M5R A;  1KLN A;  3SBT A;  3OYL A;  3M8S A;  2XY6 A;  2E5L K;  4WQ4 A;  1SQK A;  3D6R A;  3NMU A;  5BR9 A;  3LAL A;  4OKE A;  5M1K A;  3AAR A;  4K41 A;  4HUG A;  5AQK A;  2O8C B;  4FJH A;  3PSF A;  4EZ9 A;  3DLE A;  2Q97 A;  4RW4 A;  4WFB L;  3IDH A;  4M45 A;  3OYI A;  4LFA K;  1X9J A;  2CGK A;  3VQD A;  4DR1 K;  1S9E A;  4CGH A;  3IMX A;  2UUA K;  4R5P A;  4LF4 K;  3CPE A;  4LF9 K;  4LD0 A;  3TSU A;  1S1V A;  3VES A;  1RT4 A;  3NE6 A;  2QWM A;  3K57 A;  2YNI A;  4H5N A;  4ZHR A;  4CZH A;  3CFR A;  2IVO A;  2VQF K;  1ILY A;  4C23 A;  1QZ5 A;  2QKK A;  2Q1N A;  3NF7 A;  3MAQ A;  2HVH A;  4CF8 A;  3IRX A;  2Z1I A;  3NHG A;  2G8V A;  4HTU A;  4DV6 K;  4DTJ A;  3QB0 A;  4OX9 K;  4GNI A;  3DXM B;  1TK8 A;  3R9P A;  3SI6 A;  1QZ6 A;  2CH6 A;  3DLK A;  5CZ1 A;  1HRH A;  2A40 A;  4QS8 A;  4GVM A;  4MQ3 A;  1RBU A;  4BRH A;  5C12 A;  3FFK B;  3AV9 A;  1EX4 A;  4DHY A;  3V1Q A;  1U6Z A;  3O8M A;  1S22 A;  4LSL A;  5KI6 A;  4IO9 L;  4B3M K;  3ULE B;  2UU9 K;  3CG7 A;  3F5T A;  2PY5 A;  4XH4 A;  3SUO A;  3C6U A;  2XHB A;  4ICL A;  5M1Q A;  3CC2 N;  1SKR A;  1N36 K;  1IJJ A;  2P9I B;  2RHK A;  1S5J A;  1RDC A;  5KRS A;  4BY9 C;  2OZS A;  1GOB A;  3PIP L;  4KV8 A;  2E88 A;  1EET A;  2IVN A;  4CJL A;  4J2D A;  2DFF A;  3DWL A;  2HST A;  5C42 A;  4I2Q A;  3M1F A;  3KTQ A;  4CIE A;  1OH8 A;  4CW7 B;  4M3X A;  1WSJ A;  1DKG D;  4MO5 A;  3VQ5 A;  3F9K A;  4FW2 A;  3FZF A;  4KI4 A;  4JKH A;  1NU0 A;  3VEO A;  4Z4E A;  3QET A;  1BWF O;  2ASO A;  3DJC A;  4Z4C A;  2E8A A;  3E9O A;  1FKP A;  3D45 A;  1LAV A;  3FR0 A;  3K5O A;  3VMF B;  3MCA B;  2G8W A;  4DB3 A;  3HBT A;  1WN7 A;  4H0X B;  4CGF A;  4NYN A;  4E1J A;  4DSL A;  3I0S A;  2E2Q A;  1E4F T;  2A5X A;  3QFP A;  3PIO L;  3ISN C;  2BDP A;  1NGG A;  4WE1 A;  1ZBU A;  5FRO A;  2NNW A;  3KLI A;  3DI6 A;  3KK7 A;  5JS2 A;  4OLA A;  2HBM A;  3WNG A;  1N32 K;  1S1T A;  3HP6 A;  4X64 K;  3C6H A;  2HMP A;  4JS5 A;  3CIP A;  3TAP A;  1LWF A;  3CF5 L;  1NKC A;  4CER A;  3IS9 A;  3H1V X;  2QWN A;  1KAX A;  2HF3 A;  1Q9X A;  3D0P A;  4CHY A;  2FC0 A;  4F2R A;  4XEI A;  4I6M A;  4RG8 A;  5DM7 L;  2FSK A;  4BE2 A;  2O8D B;  3O1B A;  3EY1 A;  4NCA A;  3IG1 A;  3NCI A;  3I56 N;  4B3R K;  4CEQ A;  4JI5 K;  2OAN A;  1IKV A;  1ESV A;  2GBZ A;  1TGO A;  2CGJ A;  3FLC O;  2P5O A;  4O5F A;  3NF9 A;  1FW6 A;  2IDO A;  2Y1I A;  3WXL A;  4CJS A;  2FSN A;  3TTF A;  5J2Q A;  2ZJQ L;  4JRQ A;  3SUP A;  5CYM A;  3L2W A;  1RTD A;  4EP4 A;  2G8U A;  5LMU K;  3OVN A;  4KFB A;  2RKI A;  3O9Q A;  3TAF A;  2P9N B;  4H0T B;  5C2F A;  2RE2 A;  1NGF A;  1MDU B;  4G1Q A;  4DFM A;  3HM8 A;  1RTH A;  3HZ6 A;  4DV2 K;  5E26 A;  3WNE A;  2OA8 A;  2WBN A;  4CZK A;  4JK9 A;  2KQ2 A;  3HL8 A;  1YHQ N;  4O4G A;  3LAN A;  4ZTF A;  4CZI A;  3QNN A;  4KRE A;  5F1X A;  3ZSO A;  1BDG A;  3A5M C;  3G10 A;  4GV9 A;  3ULE A;  1BCM A;  3SQ2 A;  2D0C A;  4B1U B;  2P9K A;  4M3Y A;  4OGE A;  4CEE A;  4DTU A;  3AVB A;  3QNO A;  3K9J A;  2GEM A;  4HCC A;  3VEZ A;  4DLE A;  4WFN L;  4CES A;  1BCO A;  4AHV A;  3RR8 A;  1QHT A;  1Q86 O;  3WXK A;  1CZ9 A;  2Q2R A;  1KAZ A;  1L3S A;  3ENH A;  4JKD A;  1QSY A;  4I2P A;  2HHV A;  5KGX A;  2YI1 A;  3NF6 A;  1K8K A;  2F9T A;  2BTF A;  3C0B A;  4H4O A;  5DM6 L;  4BE1 A;  4LF7 K;  2KTQ A;  1UAX A;  3CYM A;  4DKW A;  2HBJ A;  4YOR A;  3JYT A;  4W5N A;  5MLC Q;  4O0J A;  3ZX3 A;  3SV3 A;  3QEV A;  2HHW A;  1HUX A;  3RSE B;  2J4R A;  4MLE A;  5FPM A;  3T1A A;  3SPZ A;  4B3S K;  3HPH A;  1BGX T;  2IC3 A;  3ZX0 A;  5C2D A;  3U3Y A;  1X1P A;  2GTD A;  1TL3 A;  2QWO A;  2YHY A;  5AJ3 K;  1VSK A;  2P51 A;  4DV3 K;  3F73 A;  1GLD G;  1GLE G;  3NVM A;  3HVR A;  4XIU A;  3L2Q A;  4FJI A;  1QQC A;  3S3N A;  1X9M A;  1Z05 A;  3A5O C;  2QWQ A;  3DLR A;  4YOU A;  1VQO N;  1RBT A;  3SZ2 A;  2HHU A;  1IBK K;  3HPO A;  2E1Z A;  3VTH A;  3G6E N;  4CJ5 A;  4RW7 A;  2JWK A;  2PZS A;  4LFC K;  3LAK A;  2NZT A;  3VF2 A;  1VSJ A;  4JI6 K;  2RF2 A;  1IO2 A;  4DTR A;  2O8D A;  4M41 A;  4FJ5 A;  1DTQ A;  1KAY A;  3BF1 A;  4H0P A;  3ASM A;  3TU5 A;  1RNH A;  3AVF A;  3AO2 A;  3SYZ A;  4DU3 A;  4M3T A;  4ELV A;  2R7Y A;  3THV A;  1YJ9 N;  4M42 A;  4CJ7 A;  1HKB A;  3AA5 X;  1XNR K;  1UOC A;  4H5V A;  3CJA A;  1JKH A;  4DU1 A;  4ISF A;  3LZI A;  4L3Q A;  1J53 A;  1JCG A;  1HPM A;  4FLX A;  3U6F A;  1J9A A;  2IVP A;  1TYQ B;  3SUQ A;  4KO0 A;  3DRP A;  3MMV A;  2OPQ A;  3CI5 A;  3DRS A;  4AHT A;  4CHO A;  3J7A P;  3IFR A;  1RT7 A;  4C8M A;  5AQJ A;  4B9V A;  1BQM A;  3AVL A;  5AR0 A;  4N5S A;  4M3W A;  4IOC L;  3KK3 A;  3HYF A;  5C0Y A;  5LY3 A;  2V51 B;  5BR8 K;  1RT3 A;  2HMI A;  5CE3 A;  1HKC A;  3CC4 N;  2P9S A;  4BRI A;  4DUZ K;  4FWL A;  4FPA A;  2V52 B;  4E7H A;  4BAC A;  2GWK A;  3NGZ A;  3SQ1 A;  2EHG A;  2D0A A;  3CJ9 A;  4IXC A;  3J81 O;  4DQR A;  4DFP A;  5FLX O;  1EKE A;  4CZG A;  3SUN A;  4A62 A;  4WQ5 C;  1RTI A;  1YTA A;  4PA1 A;  3AO5 A;  1LOT B;  1MU2 A;  4CJE A;  3LWM A;  4C8O A;  2F9W A;  4BR5 A;  3FZL A;  3LDP A;  3P31 A;  1NGB A;  3KWG A;  3MN6 A;  1C0U A;  1DTT A;  4O44 A;  3OJS A;  4DTX A;  3C7N A;  1YUW A;  3RRG A;  4IOA L;  3RSE A;  4RWT A;  2I5J A;  4IBN A;  5BRH A;  3SBG A;  5AQG A;  3PO4 A;  5HRS A;  3H6E A;  1N33 K;  3QEP A;  5GIO A;  3DLH A;  5JVH L;  4KTZ A;  3V4I A;  4CF0 A;  3VGM A;  4AHC A;  3NH1 A;  5JS1 A;  3GBT A;  4FYD A;  4KBO A;  4FVU A;  1V4T A;  3WXI A;  4CJW A;  3GE1 A;  1NKE A;  2P9P A;  4DR6 K;  4KHN A;  1ZBF A;  2V7Z A;  4O55 A;  1XMQ K;  1CLQ A;  1XI1 A;  3EN9 A;  3BZK A;  4CZJ A;  5BPN A;  3OYG A;  4FWQ A;  2VG5 A;  3MXI A;  1EO1 A;  3QES A;  4HHT A;  3KKR A;  5HRO A;  3DLG A;  2Q0U A;  4M3U A;  3ZT4 A;  3CQX A;  1NOY A;  4BQL A;  2HND A;  3AVH A;  1D5A A;  4CJU A;  3CCV N;  2Y1J A;  1TKD A;  4BG8 A;  3E01 A;  2P5G A;  3U9Z A;  3VOV A;  1YXQ A;  3WXM B;  3S41 A;  3VQP A;  3L3V A;  3WEE B;  3AVA A;  1BI4 B;  4A59 A;  1HNI A;  3OYK A;  3JS6 A;  5AQN A;  4XH1 A;  3M8R A;  3HI0 A;  4UQG A;  3O6W A;  2P9U B;  2WON A;  3HTV A;  3G4S N;  3OTO K;  5JMV A;  1BA0 A;  3CQ8 A;  2G8K A;  4LH5 A;  1MWK A;  4DV0 K;  3FGU A;  1K73 O;  3D2E B;  4TSX A;  3K0S A;  1TYQ A;  1XHX A;  3E66 A;  5CY4 A;  3RVC A;  4JKF A;  3V9X A;  2YJF A;  4M7X A;  4OLB A;  4K0K K;  3HT3 A;  1U4B A;  3Q7C A;  2PAV A;  5DMR A;  2FF6 A;  4E89 A;  2HF4 A;  4FLW A;  4OJR A;  1N34 K;  4PKH A;  3CET A;  1REV A;  1TKT A;  4WQ5 A;  2D0B A;  4AM7 A;  5SZT A;  4JI3 K;  1VSL A;  5BPL A;  1FJG K;  1ITG A;  3O9R A;  3VEX A;  4K8X A;  3J7Z O;  1HYZ A;  3CM5 A;  2ZQB A;  1NGH A;  3PX4 A;  2FSJ A;  5EVZ A;  2RPI A;  3D2F B;  3EO3 A;  5J1E A;  5KQD A;  3KLF A;  4KHS A;  4B9Q A;  4A57 A;  4OPJ A;  3QML A;  3CCL N;  1XMO K;  2JGU A;  2F8T A;  3EL2 A;  1TL1 A;  3GL1 A;  4DWI A;  4I9Q A;  5HRR A;  3KJV A;  4HCB A;  3CMA N;  4OO1 J;  1LWC A;  3B8A X;  4CEO A;  1O13 A;  5AQW A;  1DT9 A;  3RTV A;  1OH7 A;  1NMD A;  1OVY A;  3ID6 A;  3ZT0 A;  2HHX A;  2GUI A;  1NKB A;  3QFU A;  4B9U A;  4AHS A;  3B6O A;  4JLH A;  3OYH A;  4DQQ A;  5CYQ A;  3QIN A;  2O8E B;  1RT6 A;  5HLF A;  1GLB G;  1YAG A;  2B4J A;  1RBV A;  1T03 A;  4JI0 K;  4U7B A;  2EWS A;  1NK0 A;  4A2A A;  5M1O A;  1OH6 A;  3PX0 A;  1NJX A;  3L4Q A;  2E2P A;  4Y1D A;  4PUO A;  4LY7 A;  4H5T A;  3MN7 A;  4ISE A;  4Z94 A;  4U67 L;  4K25 A;  2VG6 A;  3LDN A;  5KTQ A;  4RCH A;  3R3L A;  1XNQ K;  3BGR A;  3SMP A;  4LH4 A;  4YOV A;  5LL6 Z;  4RTF D;  4WYB A;  3O9S A;  4KKO A;  1ZYQ A;  3JSM A;  1BU6 O;  4AIL C;  1T6D A;  3AY9 A;  3EZW A;  3EYZ A;  4FZZ A;  1WBD A;  1TAU A;  3H46 O;  1EQY A;  1BI4 A;  2OPS A;  4BVO A;  3AVC A;  2HHQ A;  3AVI A;  2DFH A;  1ZBH A;  1O1W A;  3M8Q A;  4DSI A;  2UUB K;  5FPD A;  3K59 A;  2P9U A;  1M90 O;  4CJR A;  3CXC M;  3MWT A;  1VSI A;  1KVC A;  1KQS M;  4DSE A;  3O4N A;  1U2V A;  1I3A A;  3L2V A;  4LC9 B;  4IFV A; 
#chains in the Genus database with same CATH homology
 2E1Y A;  2P9N B;  4H0T B;  1K8A O;  1VAZ A;  2RE2 A;  5C2F A;  1NGF A;  2NRT A;  3DXK B;  3VEW A;  1C0F A;  1MDU B;  4EFH A;  4A61 A;  3HM8 A;  4JD2 B;  4BGB A;  3HZ6 A;  5E26 A;  5JLH A;  3E9L A;  3PLA A;  2QI2 A;  2WBN A;  5TKY A;  4CZK A;  5B8H A;  4JK9 A;  3P39 A;  4H03 B;  4DCH A;  3IUC A;  1YHQ N;  1DEJ A;  1BA1 A;  3CJC A;  4CZI A;  3LDL A;  3CME N;  5F1X A;  3HOT A;  4BR0 A;  2NRV A;  3J8A A;  4BRC A;  1BDG A;  5F2R A;  3A5M C;  1Q81 O;  4GV9 A;  5AQL A;  3ULE A;  1CZA N;  2E2N A;  2PFU A;  2GX9 A;  4B1U B;  1VQ9 N;  4JNE A;  2P9K A;  4BRA A;  2QWP A;  5AQV A;  3KVG A;  1VQ8 N;  2VYP A;  4B1X B;  3TTC A;  3K9J A;  3ENB A;  4AF1 A;  2GEM A;  4NLC A;  2H3G X;  3VEZ A;  4BR2 A;  3D2F A;  4BVP A;  4WFN L;  4CBX A;  1C0G A;  3KZB A;  4MDB A;  1X3N A;  3M3Z A;  4IEI A;  1SZ2 A;  4H0Y B;  1YIT N;  1Q86 O;  3WXK A;  3L0Q A;  2Q2R A;  1P8Z A;  2QWR A;  1VQN N;  1KAZ A;  3KWI A;  3SJH A;  3FE1 A;  5JIC A;  3FZM A;  2QWL A;  3CCR N;  3ENH A;  4JKD A;  3HSC A;  1NGD A;  3MDQ A;  4PKG A;  3F2K A;  2YI1 A;  5JLF A;  1K8K A;  3VER A;  2F9T A;  2KLA A;  3AGK A;  2BTF A;  3C0B A;  5BN8 A;  1W2B M;  5AZI B;  1VQM N;  4J8F A;  1NLV A;  5DM6 L;  2QTD A;  4GV3 A;  1WOQ A;  3QBW A;  4R79 A;  1NGA A;  1K9M O;  3MN5 A;  1MA9 B;  1S3X A;  4KH6 A;  1BOT O;  2IIR A;  2P9L A;  2HBJ A;  4YOR A;  1GLA G;  2PBD A;  4DKW A;  5MLC Q;  3LM9 A;  3ZX3 A;  3VEY A;  2BH1 A;  2YJE A;  1HUX A;  4MLH A;  3RSE B;  2J4R A;  4MLE A;  3OBY A;  5AQQ A;  5FPM A;  4GV6 A;  4CZF A;  1XQS C;  4PL7 A;  1HX1 A;  5EX5 A;  5FPE A;  2AP1 A;  3ZX0 A;  5C2D A;  2OTJ N;  3LDQ A;  2GTD A;  2QWO A;  2YHY A;  5AQF A;  5AQP A;  3VPZ A;  2KHO A;  1GLD G;  4H0O A;  4Y0W A;  1GLE G;  3WQT A;  2YX6 A;  3NVM A;  3CCS N;  2HBL A;  1HJO A;  4PKI A;  3F9M A;  2D1K A;  3UKR B;  4FWR A;  1KXP A;  1Y64 A;  2NRX A;  3ZEU A;  4C1N I;  3EE9 A;  1Z05 A;  1YI2 N;  4MO4 A;  3A5O C;  2QWQ A;  4YOW A;  2Q36 A;  4YOU A;  1RDW X;  1VQO N;  4C1N K;  3SAF A;  2W41 A;  4BC2 A;  2A41 A;  2E1Z A;  3VEV A;  4IFE A;  4IJA A;  3VTH A;  3O1W A;  3G6E N;  4UY8 O;  2NRH A;  5AQH A;  4WF9 L;  3CJ1 A;  2JWK A;  3U4L A;  1VQL N;  1QVG M;  1NM1 A;  4CZE A;  3MWP A;  3ATU A;  1J6Z A;  2NZT A;  4OPH A;  2NRW A;  4YDU C;  1JCE A;  3VF2 A;  4AM6 A;  4EAH D;  3H3N O;  4M63 C;  2KKZ A;  3WEE A;  3DAW A;  1NWK A;  1Q82 O;  4XH5 A;  2Q0R A;  3G71 N;  3L4I A;  3ZET A;  1KAY A;  3BF1 A;  4H0P A;  2QM1 A;  4FPB A;  3TU5 A;  4WQ4 C;  2DPN A;  4K42 A;  3OA9 A;  4PHT X;  3CCQ N;  3ID8 A;  3WUH A;  4I6M B;  2D0P A;  2I7P A;  4BC4 A;  3HOS A;  4BGA A;  4WFA L;  3CCE N;  4BR7 A;  1YJ9 N;  3D2E A;  4CJ7 A;  4EHT A;  4JKE A;  1HKB A;  1VQ4 N;  5EOY A;  5BRD A;  5I9E B;  2QW9 A;  4H5V A;  1JCF A;  3CJA A;  3DXM A;  3EKS A;  3MN9 A;  3N4P A;  4ISF A;  4YOX A;  3N4Q A;  4FWM A;  4IOX A;  2WC9 A;  3UB5 A;  3WQU A;  4L3Q A;  1JCG A;  1HPM A;  3DXK A;  3O08 A;  4FO0 A;  4FOE A;  3JXU A;  5AQY A;  5AQR A;  2IVP A;  3I33 A;  5AQX A;  5EXW A;  1TYQ B;  3OBW A;  5GIN A;  3ZX2 A;  1U2V B;  4CBU A;  5AZJ B;  3MMV A;  3CC7 N;  3HRG A;  3CI5 A;  1S72 N;  2WUS A;  5AFU A;  3IFR A;  3CD6 N;  3O80 A;  5AQJ A;  3FZK A;  3P38 A;  5M1P A;  1YVN A;  5AFU H;  4CBW A;  1BUP A;  5AR0 A;  1HLU A;  4BRO A;  3VTI A;  4IOC L;  5ADX H;  2YHW A;  2NRZ A;  5C0Y A;  5LY3 A;  4ILG B;  3VF6 A;  3QDK A;  2P9I A;  4JK8 A;  4B1Y B;  4CZM A;  4B1Z A;  2ZWH A;  3E1Y A;  2A42 A;  3CQY A;  2V51 B;  4H5R A;  2WFB A;  3Q7B A;  3TPQ A;  4JK7 A;  1HKC A;  4FWO A;  5CE3 A;  3ATV A;  3CC4 N;  2P9S A;  4BRI A;  3L6Q A;  3CER A;  3M6G A;  4FWL A;  2E20 A;  2Q31 A;  3GDQ A;  4FPA A;  4BRE A;  2V52 B;  2VGM A;  3VF4 A;  2P9K B;  2GWK A;  1ZBS A;  3UKU A;  2ZGY A;  3CJ9 A;  4FWN A;  4GY2 B;  1SAZ A;  4IXC A;  3AGR A;  1WUA A;  1YJW N;  5AQZ A;  1SS6 A;  4CZG A;  1VQ5 N;  3NVK A;  4A62 A;  4WQ5 C;  3OHR A;  3SK3 A;  4M7Y A;  3U8X A;  4CZL A;  4BRG A;  1LCU A;  3D7E O;  1YJN N;  3W3D A;  1LOT B;  2AA4 A;  2QA4 N;  2E2O A;  3KHY A;  5AZI A;  3CCJ N;  2GEL A;  2GUP A;  5EY4 A;  5BRF A;  2ITM A;  2F9W A;  2CH5 A;  3FZL A;  2BUP A;  4BR5 A;  5LJW A;  3LDP A;  5AQM A;  3P31 A;  1NGB A;  2FXU A;  3KWG A;  3MN6 A;  4BRD A;  4JEP A;  2FF3 B;  1P90 A;  1R59 O;  2NLX A;  4IWV A;  3C7N A;  5GIP A;  1YUW A;  1N8R O;  1K8K B;  1YF5 L;  4EIA A;  4IOA L;  3RSE A;  4RWT A;  3O4W A;  3TSP A;  5BRH A;  2VCP A;  3WXJ A;  2CGL A;  3A5N C;  5AQG A;  3SBG A;  2VGN A;  5KPR A;  3SMS A;  3H6E A;  4JHD B;  4JKG B;  3R8E A;  3VET A;  2P9L B;  4QS7 A;  5GIO A;  1E4G T;  5BRE A;  5JVH L;  3T7Z A;  5HOO A;  2YHX A;  4IO8 A;  3VEN A;  3K9K A;  3VGM A;  5M1N A;  3GBT A;  4KBO A;  3A0I X;  4FVU A;  4YDU A;  5BPM A;  2F7T A;  1V4T A;  2QXL A;  1BG3 A;  3H3O B;  3O5B A;  4FWP A;  3WXI A;  1W97 L;  3GE1 A;  3CCM N;  4JAX A;  2P9P A;  4B1V A;  5HL7 L;  3VGL A;  1RFQ A;  2V7Z A;  1Q7Y O;  5AQO A;  2ASM A;  3M5R A;  1OKJ A;  2UYT A;  3EN9 A;  4O8U A;  3SBT A;  4CD3 A;  4FL9 A;  3FZH A;  4WQ4 A;  4BRK A;  3LL3 A;  1QQO A;  1SQK A;  4CZJ A;  1QQN A;  5BPN A;  3CPW M;  1GLC G;  4FWQ A;  3D6R A;  3NMU A;  1EO1 A;  5BR9 A;  5M1K A;  3AAR A;  4K41 A;  4BC5 A;  3I8B A;  2Q0U A;  5AQK A;  5ELZ A;  3CQX A;  4BQL A;  4FWS A;  3BF3 A;  4IDH A;  5E84 A;  2Q97 A;  4A2B A;  3T69 A;  4CI6 A;  3CCV N;  4JKB A;  3IDH A;  4WFB L;  3C65 A;  1NGI A;  4BG8 A;  1X9J A;  2CGK A;  3O9T A;  1GLJ O;  2D4W A;  4FSV A;  3IMX A;  3U9Z A;  3SAG A;  3VOV A;  1YXQ A;  4GVE A;  3WXM B;  3S41 A;  3CPE A;  3I55 N;  5JVG L;  4A5A A;  3WEE B;  4ILJ A;  4A59 A;  3TSU A;  3MX5 A;  1NGJ A;  3JS6 A;  5AQN A;  3VES A;  4XH1 A;  4BRF A;  2QWM A;  3HI0 A;  3ZET B;  4NB4 A;  4BRL A;  2HBK A;  4H5N A;  3CJ7 A;  4CZH A;  2IVO A;  3O6W A;  1T44 A;  2P9U B;  1ILY A;  4C23 A;  2ZGZ A;  3R1X A;  1QZ5 A;  2P9N A;  1HKG A;  3HTV A;  1ATN A;  2Q1N A;  4PL8 A;  4BRN A;  3G4S N;  3CHW A;  5JMV A;  4BG9 A;  1BA0 A;  4MDA A;  1MWK A;  2ZF5 O;  2D0O A;  4JD2 A;  4BR4 A;  3FGU A;  3UE5 A;  1K73 O;  3A5L C;  2FLO A;  3D2E B;  1NGC A;  3R6M A;  1QVF M;  3DLL L;  1NJI O;  4NLB A;  3VGK A;  1MWM A;  1TYQ A;  3QB0 A;  5CR4 A;  1TUY A;  3E66 A;  5AZJ A;  3A8Y A;  2I7N A;  3DXM B;  1T3V A;  4GNI A;  3RVC A;  3R9P A;  1QZ6 A;  4JKF A;  3EE8 A;  4KH5 A;  2CH6 A;  2YJF A;  1G99 A;  5AQI A;  5ADX A;  1NGE A;  4M7X A;  4BRQ A;  2A40 A;  1ZC6 A;  4BRM A;  1KC8 O;  4QS8 A;  5GAE P;  1ZXO A;  2PAV A;  3Q7C A;  1XUP O;  2OTL N;  2FF6 A;  4BRH A;  5C12 A;  3FFK B;  4NO7 A;  2HF4 A;  4DHY A;  4PKH A;  1U6Z A;  3CET A;  3O8M A;  1S22 A;  3BUZ B;  4F9O A;  2W40 A;  3GOI A;  4WQ5 A;  4AM7 A;  5BPL A;  3QIC A;  1Q18 A;  4IO9 L;  3ULE B;  3F5T A;  3O9R A;  3VEX A;  4BQZ A;  4XH4 A;  3EKU A;  3J7Z O;  5M1Q A;  3CC2 N;  2ZJP L;  3C6A A;  4H0V B;  1NGH A;  1YIJ N;  2A6A A;  1IJJ A;  2P9I B;  1T6C A;  2FSJ A;  2RHK A;  3TSQ A;  5C10 A;  3GG4 A;  5EVZ A;  4BY9 C;  3D2F B;  3PIP L;  1XC3 A;  2E88 A;  3EO3 A;  5KQD A;  5GAD P;  3AAQ A;  2IVN A;  4B9Q A;  4A57 A;  1Z6R A;  2P9S B;  1RDU A;  3AAP A;  3QML A;  5TKW A;  5AQU A;  5CHI A;  3CCL N;  3DWL A;  2HST A;  3M1F A;  3EL2 A;  3UKU B;  3P4I A;  3GL1 A;  1V4S A;  5FPN A;  5AQS A;  1DKG D;  4MO5 A;  4EHU A;  4YOT A;  1GLL O;  3CCU N;  3FZF A;  4JKH A;  3CMA N;  4A5B A;  5AQT A;  3VEO A;  4OO1 J;  3LDO A;  4YOY A;  1VQ6 N;  1BWF O;  3B8A X;  2ASO A;  3DJC A;  2QEX N;  2E8A A;  1DGK N;  1O13 A;  5AQW A;  1DT9 A;  3E9O A;  3WT0 A;  1VQK N;  1NMD A;  1OVY A;  3ID6 A;  3FR0 A;  3VMF B;  2A3Z A;  3MCA B;  4JHD A;  1RGI A;  3QFU A;  4JKG A;  4DB3 A;  4G9Z A;  3HBT A;  4H0X B;  1KD1 O;  1GLF O;  1IG8 A;  4E1J A;  1ATR A;  3MCP A;  2E2Q A;  2NRR A;  3C7N B;  5GAG P;  1H1V A;  3UKR A;  5F0X A;  3QBX A;  4KH4 A;  1E4F T;  2A5X A;  1QQM A;  4ILH A;  3MX2 A;  1GLB G;  3QFP A;  4K43 A;  1YAG A;  3PIO L;  1NGG A;  5LJV A;  5KPT A;  1TUU A;  4IZ9 A;  4WCE L;  4U7B A;  2NNW A;  4HWI A;  4OPA A;  2EWS A;  1X3M A;  4IJN A;  3KK7 A;  1D4X A;  4A2A A;  5M1O A;  3ZEU B;  2HBM A;  3L4Q A;  3ENO A;  5KPZ A;  3U9D A;  1VQP N;  2YCH A;  1ATS A;  3C6H A;  2E2P A;  3SAH A;  4H5T A;  3MN7 A;  2HMP A;  3O9U A;  2P9P B;  4ISE A;  4Z94 A;  3CIP A;  5BN9 A;  4K25 A;  4U67 L;  3LDN A;  4HTL A;  1VQ7 N;  4RCH A;  3R3L A;  1NBW A;  4FWK A;  3CF5 L;  4JKC A;  3H1Q A;  3SMP A;  3H1V X;  3MK6 A;  2QWN A;  1QHA A;  2VWB A;  1KAX A;  2HF3 A;  4YOV A;  4RTF D;  3LM2 A;  4WYB A;  3O9S A;  4DQ8 A;  3H45 C;  4CD1 A;  3G25 A;  1BU6 O;  2ZJR L;  1T6D A;  4I6M A;  4XEI A;  3AY9 A;  5DM7 L;  2FSK A;  3EZW A;  5C15 A;  3O1B A;  4BC3 A;  3I56 N;  1BO5 O;  1EQY A;  3BP8 A;  3H46 O;  3TTD A;  4BVO A;  2OAN A;  4JKA A;  4B1W B;  2ASP A;  4QS9 A;  3CJB A;  3SLC A;  2HOE A;  1ESV A;  3IKM A;  3BEX A;  4FOI A;  1JJ2 M;  4IEE A;  5GAH P;  4O8K A;  2CGJ A;  3FLC O;  2JWL A;  5FPD A;  2P9U A;  4O5F A;  1M90 O;  3OW2 M;  4JN4 A;  3CXC M;  5M1F A;  3MWT A;  4ISG A;  3WXL A;  3E9P A;  2V7Y A;  4H5W A;  2FSN A;  3W0L A;  3TTF A;  2ZJQ L;  1KQS M;  3ZYY X;  1U2V A;  5KQ8 A;  4BRP A;  2GWJ A;  1M1K O;  4BR9 A;  4LC9 B;  3O9Q A;  5H1S Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...