1HNZK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnzK00
1IBLK 4NXNK 2UU9K 2UUAK 2E5LK 5IT9O 4DR7K 3J7AP 4B3RK 3OTOK 4DV5K 4DR2K 1IBKK 4DV0K 4GKKK 4LF5K 5AJ3K 4X62K 4X66K 4DUYK 1N32K 2UXDK 3J81O 3J80O 4DR4K 4AQYK 2UXBK 4CVNE 4DR1K 1N33K 1XMQK 2F4VK 4DV3K 4LFCK 4GKJK 3T1HK 5BR8K 1HNXK 4V19S 3T1YK 4LF8K 4JI6K 5A2QO 4B3MK 4JI5K 2ZM6K 4JI2K 3JAMO 4YY3K 1XNQK 1FJGK 5LMNK 1XNRK 4JV5K 2UUBK 4LF6K 2VQFK 4DR6K 1N34K 4X65K 4JI1K 2UXCK 2UUCK 1I94K 4DR3K 4LF7K 4LFAK 3J7YP 1HNZK 1N36K 2VQEK 4JI3K 4K0KK 4DV6K 4DUZK 1HR0K 5IWAK 4X64K 4B3TK 4JI4K 5LMUK 4NXMK 2HHHK 4JI0K 4KHPK 4JI7K 4LFBK 4DV4K 5LL6Z 4OX9K 4DV7K 5FLXO 4LF4K 4YHHK 1HNWK 4B3SK 4DV1K 4LF9K 1J5EK 1IBMK 1XMOK 4CW7B 4JI8K 4DV2K 4JYAK 4DR5K
chains in the Genus database with same CATH superfamily
3O9QA 1MDUB 1HX1A 3IS9A 3RSEB 4DU4A 4A62A 1XWLA 2WUSA 4KRFA 3VF4A 1EWRA 4AM6A 1IBKK 4DV0K 4F2RA 4YOUA 5AJ3K 4PWDA 4DFMA 1VQPN 4PY5A 3ZCMA 5CZ2A 2E8AA 4IG3A 4DTRA 3QEPA 2OZSA 4IZ9A 3V1OA 1N6QA 4M45A 3MK6A 5AZIA 1X9JA 3RMCA 1HQUA 3AVNA 2X74A 4CERA 1HYZA 4IOXA 4CJRA 1DTTA 3M8SA 4DU3A 5FROA 4KREA 1KFDA 3A5MC 3SQ4A 2KQ2A 1U2VB 4BRGA 4DQ8A 5A2QO 2VG6A 3ID6A 5CY4A 4F3OA 1FJGK 3AY9A 2G8FA 4CJLA 3E66A 1C1BA 4MO5A 3HOTA 4K8ZA 2ASMA 4X65K 4JI1K 3V1RA 2P1JA 4KH4A 3CJBA 3WQUA 4GV6A 4EFHA 3ATUA 4FWLA 2E1ZA 3NGYA 5JICA 3J7YP 2F8SA 3L0QA 1BQMA 3V9XA 2WTUA 4DG1A 1NU0A 1EETA 5LJVA 4E3SA 5AQNA 4CESA 5EX5A 4PKGA 3Q7BA 5AFUH 5BPMA 4M42A 1IO2A 4X64K 5KGWA 1RT6A 3AO5A 1N8RO 4LY7A 4FWNA 3HM8A 4JS5A 4RW9A 2AA4A 3A2FA 4HTLA 5DM6L 3TR8A 1CLQA 3E01A 3H46O 1BU6O 1BA0A 1R0AA 3V9WA 2W42A 4BRIA 1FXXA 3LP0A 3DI6A 3E1YA 4DV1K 3QO9A 1SZ2A 4JKFA 1I3AA 1RFQA 3CC4N 2HW3A 2ASOA 1D9DA 2BGGA 4C1NI 2O8BA 3KWGA 4KI6A 1SQKA 4K42A 4BRLA 3FZFA 1XHXA 4FZXC 3EYZA 4CJTA 2KHOA 3OTOK 3LDSA 1RTHA 3VQ8A 2IIRA 1QZ5A 5TKWA 4GKKK 5AQSA 1ASVA 4DFPA 4YORA 4KHNA 4KH5A 2UXDK 2NRHA 3HSCA 2A3ZA 5M1PA 1YJWN 1QTMA 1KXPA 1QVFM 1NJWA 2E2PA 3QEWA 2IAJA 1QS4A 1S9GA 1CZ9A 2ASPA 2GWKA 2QK9A 4CZEA 5E26A 3F9KA 2ZQBA 2QA4N 3R9PA 4FLVA 4NCGA 3DWLA 4DQIA 3VERA 4JD2B 2J4RA 1WSJA 5AQKA 4RW8A 4YY3K 3KLGA 1QVGM 3VQDA 3OYCA 5LMNK 4HTUA 4BRDA 2P9IB 1NOZA 4F3TA 2VQFK 4AHSA 4BGBA 3LZIA 2P9NA 3SAGA 4CZFA 1QE1A 1TL1A 4IDHA 4F8RA 1HNZK 3PSFA 1NGDA 2A1SA 2O8CA 4CZIA 4DSLA 2F9TA 1JL2A 3DRPA 4MO4A 4DQSA 4FJKA 3L3VA 3THXB 1NJZA 1NG9A 1LW0A 3UKRB 3O4NA 3MXJA 3V9UA 4DSIA 4B9TA 3BUZB 2QTDA 1NM1A 3I33A 3D2FB 1XC3A 5BR9A 1D5AA 1D9FA 1TYQA 2WOMA 1HQEA 3JXUA 1VQNN 4CF9A 1B92A 1OVQA 4IO9L 3OS1A 1KVAA 4BACA 3CC2N 2UUAK 4EAHD 5J2NA 1KAYA 4FJLA 2F7TA 4FM0A 1NGFA 3DLHA 3AA4A 2IVPA 3TAMA 4N47A 1YUWA 4DUYK 3OYJA 3FGUA 4KAZA 3LM9A 1E4FT 2FBXA 4FLYA 4CEEA 3S9HA 3ZSQA 3UKUB 4FOEA 1ILYA 2V7YA 3T19A 3W0LA 4BC2A 4YOXA 4Z4HA 4DTUA 3NMUA 3BEXA 2W6LA 3RSEA 2H3GX 3CFRA 3ZEUB 4RW6A 2GV9A 3NF7A 4RTFD 2WFBA 3CYMA 5KRTA 2DY4A 3TAQA 4JI6K 4ZHRA 4BWMA 4B1ZA 4CEDA 4BREA 2VGNA 1VRUA 1X9MA 3EY1A 3E9OA 4E1NA 3NGZA 1RDBA 4FOIA 4IDKA 3ZSZA 2UXCK 1S6QA 4GV3A 2Z1IA 3AA2A 3G25A 2A5XA 3OYDA 3QEIA 4DTXA 1U6ZA 1ESVA 3S3MA 2YNIA 4F9OA 1WLJA 4FWRA 4FVUA 3CFOA 2VQEK 4OGCA 2QWLA 3KD5E 3W3DA 1U4BA 3TSPA 4DV6K 1BCMA 4C8KA 1WSEA 2VG5A 4B9NA 3VQ9A 4H5VA 4WFAL 1RTIA 5AQHA 4FLWA 4DCHA 3SMPA 4CF1A 3M6GA 3HBTA 1U49A 3D2EB 1WBBA 1UAXA 1NKEA 3BDPA 4L3QA 2RPIA 4BRKA 4JKGA 1HJRA 1JLBA 1JLQA 4EHTA 3CCQN 2V51B 4BE0A 5FDLA 1KD1O 3KHYA 4UY8O 1LWFA 4DFKA 1DEJA 5EY4A 4FLZA 4H5WA 2AJQA 4WFBL 3PIPL 3CG7A 1NK6A 2I5JA 4FJXA 1TVRA 4CIGA 4KHQA 1S1WA 3OYIA 3HPHA 1QSSA 3ZT4A 5AQPA 2X78A 3K5MA 1BIUA 1I39A 1JCFA 3O3HA 4I2QA 4RW4A 4W5RA 2AP1A 4DF4A 5C10A 1BWFO 3DRRA 2YKMA 1Q18A 4YOWA 4BDPA 4DLGA 1GLAG 3QFPA 4W5TA 1C0MA 3SQ1A 3WNHA 4FO0A 4R79A 1NK4A 4NYFA 4F2SA 1P8ZA 4B9SA 2E6LA 1UA0A 1RT7A 3QLHA 2JWLA 1Q8IA 3AVJA 3QIOA 4DMNA 3PLAA 4DR6K 2PZSA 4AHTA 3WT0A 2QKBA 2WC9A 4J2BA 1GLLO 5LY3A 1KFSA 2IGIA 2P9PA 4IXCA 4YNQA 3G71N 4HHTA 3QIPA 3LP3A 1ATNA 3A5OC 3THWB 1CZAN 4ZTFA 4PQUA 3L2WA 3U4LA 2E1YA 1JXBA 4G9ZA 3I55N 1YI2N 3PUFA 5C42A 3OYGA 5AQIA 5AZIB 1RT3A 2XY5A 1VSLA 4J8FA 5JVGL 3DLEA 2Q36A 3H6EA 3QNOA 4FW2A 4K25A 1HNWK 3DMJA 5KPRA 3CQYA 3KKRA 3EO3A 1C0GA 4DSJA 3ITHA 4CW7B 3RVCA 4JRPA 4JI8K 3BGRA 4I9QA 4CHZA 3AVGA 3LDNA 4CGHA 3ALYA 4N5SA 4FJJA 2JGUA 3CCLN 4DV5K 2HHXA 3OYAA 2W6KA 4WQ4A 4MLHA 1JL1A 3FFKB 4JK7A 3C6AA 1XUPO 3ENOA 4H8KA 5BRDA 4JK9A 5AFUA 3TAEA 1XC9A 1TK0A 3KD1E 1VQ6N 2FLOA 3SPZA 3H3OB 4N41A 4M3ZA 1NBWA 3DOLA 3C95A 1N33K 4CBXA 2PYLA 1KAXA 3L2QA 4DWIA 1OH5A 3O5BA 4CJUA 1VSJA 5B8HA 3VQ7A 2E20A 2HF4A 4FJNA 1YITN 1HPZA 3QICA 4N56A 1QQMA 4LH4A 3J8AA 4CFAA 3JS6A 2G8UA 2F9WA 3DAWA 1ASWA 5AQZA 3K5LA 1NGBA 2XY6A 3MEDA 4B3OA 3NHGA 3P4IA 2IVNA 3OYBA 4QOZB 4I6MB 1L3UA 2R7YA 3O1BA 2QWQA 2QWPA 3AVIA 1NKCA 2QW9A 4BVPA 3WXKA 1CXUA 1Y97A 2RHKA 2GTDA 3OS0A 5F0XA 2UYTA 4H4MA 3O9RA 4WQ5A 1NGHA 4CEQA 3ENBA 1OH7A 4ILHA 1W2BM 1J54A 4FWMA 4BC3A 4NCBA 3MX5A 1IKWA 4CFBA 4ELVA 3LL3A 4JI7K 5JS2A 3P38A 5EU7A 1HJOA 2YNFA 4CEBA 4CHQA 1GLFO 3KLFA 1VQ7N 4CJEA 1YTUA 2O8CB 5AQUA 1J5EK 1GLEG 4RW7A 4DV2K 4DR5K 3LPTA 2VG7A 1IBLK 2A1RA 3UE5A 4C23A 1XQSC 4CZGA 4IBNA 4HVJA 1OH8A 3EN9A 1M1KO 4O0JA 1ZXOA 3LALA 4X66K 1X3NA 3BP8A 4ILJA 1YTAA 1NGCA 1EKEA 2JLEA 1T3VA 2JWKA 2UXBK 4BE1A 3QERA 1WN7A 3AO3A 4CVNE 3DLKA 1C0UA 1S72N 5AQGA 4IG0A 4BQZA 1RILA 2O8DA 4ZTJA 1VSDA 3IG1A 5DMRA 2GWJA 4M3YA 4GKJK 3T1HK 2OYQA 1S1VA 3EZWA 4W5OA 3D2FA 3KLEA 3T1YK 4YFUA 4FZZA 1ZBUA 3HSTB 1RBRA 4BRCA 3A0IX 2ZM6K 4KTQA 4KHUA 2OPRA 1Z05A 3V1QA 4KBOA 1GOBA 1T7PA 1R59O 2RF2A 1O1WA 4B8AB 5GAHP 4FK0A 5AQWA 1OH6A 2QXFA 2KFZA 3RRHA 1U48A 3GOIA 4O44A 4FW1A 2ZGZA 1M90O 1XI1A 1TYQB 1KVBA 3SZ2A 3VF2A 1K6YA 1WB9A 2BH1A 4CHPA 5KGXA 4K0KK 4BY9C 4CK3A 3H3NO 2D4WA 1KAZA 4B08A 3RWUA 4Z0UA 3ULEB 2IDOA 3RR8A 4CZHA 1NKBA 4IJAA 5AQXA 2PBDA 2FC0A 3KJVA 3F73A 4BRFA 4PHTX 5KPZA 2HHHK 4JI0K 2EX3A 3THYA 4CGFA 1L5UA 3QBXA 4F4KA 1C6VA 1RDCA 3RMDA 1RDDA 1HNVA 3T7ZA 3TSUA 4DLEA 1TUUA 3HPGA 1WUAA 1B9DA 4WF9L 4OPKA 1OKJA 4L8RB 4BVOA 3IKMA 1ZBHA 2BDPA 4NYNA 1JLEA 4GVMA 3AV9A 3CJAA 3AA5X 3PIOL 4B3RK 5HBMA 2QWMA 4PL8A 2NRXA 4JN4A 4ISGA 3I8BA 2D5RA 3ZX0A 4IEEA 2VWJA 4LF5K 4CEZA 2Q97A 2OPSA 5JVHL 4Z4EA 3FZLA 1WSIA 1N32K 1ITGA 1E4GT 4O5BA 3MN6A 5GINA 1VAZA 2B5JA 4QAGA 2FF3B 4EP5A 3OYKA 4CGJA 3HO1A 2YHWA 3D2EA 2HHUA 1J53A 1LWCA 3CCUN 3CJ1A 5CE3A 1RT2A 2P9NB 1Q86O 1DKGD 5FPMA 2CH6A 4IWVA 4GY2B 1U47A 4Z94A 3NF6A 3M8QA 1EXQA 4OGEA 4CJ5A 3O3GA 2HBLA 3SUQA 1K8KA 3VQ4A 1Z25A 3VQ5A 1QQNA 1NMNA 4JKHA 4ICLA 4C8NA 2P9UA 3NBPA 4YOYA 1ASUA 5F2RA 4GVEA 5FRNA 1XHZA 4N76A 4JI2K 4H0OA 3CJ9A 4E19A 1X9WA 4JAXA 1XNRK 3P83D 3BF1A 4XH1A 3KK7A 3HVTA 4DQPA 3NFAA 3U3GA 3B6OA 2E4LA 4IFYA 3D7EO 5I9EB 2HF3A 1T44A 3EE8A 3CCVN 3ZT3A 4IKFA 3CI5A 2ZJRL 3TWHA 4JEPA 4NCAA 4QCLA 4JI3K 1S6PA 3U9ZA 1RNHA 4DSFA 3RMBA 1EP4A 1N5YA 1KQSM 2V52B 4HCBA 4C8LA 4O8UA 4OO1J 4AHRA 2Q0UA 1U04A 3UB5A 4CI6A 3KZBA 2DFHA 5AZJA 3NVMA 1RTJA 4A5BA 4FM1A 2IS3A 4W5NA 3ZSWA 4A2BA 3RMAA 1ZYQA 4H0TB 1KTQA 1IG8A 2E88A 4FPAA 4JYAK 3KK1A 2D0AA 2VGMA 2QKKA 4FK2A 4C1NK 2KW4A 3NH2A 5HROA 5JS1A 4BRMA 2NNWA 4B1YB 1G15A 4WE1A 2OTJN 2FSNA 1VQLN 4BC5A 1FW6A 3VQAA 2B6AA 1VQ5N 3VEWA 3HI0A 3MCAB 3LZJA 3DXKA 4AHUA 4CHOA 4E7KA 3O1WA 1C0TA 5HRPA 1L3SA 3IMXA 4BWJA 3VESA 3M1FA 3P5JA 3UKRA 4E7HA 5KQDA 3K5OA 1JLCA 1NWKA 2YV0X 3ZT0A 1VSKA 4E7JA 3O08A 2KZMA 4R5PA 3DXMA 1HMVA 3NAEA 3HP9A 3KK3A 2OANA 3C6TA 2Y1IA 3TU5A 2P5GA 3AGKA 4I7FA 2FBVA 3T69A 1BO5O 3MEEA 3VPZA 1P90A 3U6FA 3P39A 5C12A 4BR7A 5BPLA 4H0YB 5EVZA 5DK5A 3GDQA 4CJKA 1N34K 1SS6A 3D6RA 3HM9A 4MFBA 4WYBA 4DR3K 1RTDA 4KFBA 4FJHA 4WQ5C 1T03A 2P9LB 3HYFA 1N36K 4J2DA 1BI4B 3L3UA 4I9LA 1BUPA 2O8EA 4A5AA 3NE6A 2FXUA 4JI4K 3L4IA 2BANA 3C6HA 4DB3A 4E89A 4JKCA 3U3YA 4J2EA 2PAVA 4DQRA 4NO7A 3KLHA 1X9SA 4FYDA 5AQLA 4Z4FA 3DXKB 2RKIA 3AVFA 4OVLA 4BR0A 2X6SA 3NGIA 3WUHA 3C0BA 4QS9A 4B8CA 3CXCM 3OJSA 4E0DA 2QWNA 3MECA 3B8AX 1S3XA 4CIEA 1W0HA 3I0RA 4Z4GA 1GOCA 1ATSA 1BOTO 4CGDA 3FE1A 3ZSOA 5J1EA 4KKOA 2ZJQL 1WBDA 3TI0A 3WXJA 4LSNA 1YHQN 2O8EB 3EEQA 1S9EA 4MDBA 1NMDA 1DT9A 3M8PA 3THXA 1HYVA 4GV9A 4CEAA 3TAPA 4Y0WA 3ENHA 3V9SA 1YJ9N 2F4VK 4GMJB 5KPTA 5BN9A 4LSLA 1QQOA 1VQKN 3FZMA 5M1OA 4K41A 3VENA 4OJRA 4QS7A 2CGKA 3R1XA 1HNXK 3K59A 1RT1A 3KIOA 4BRHA 4RWTA 1VQ8N 3EKUA 3VTHA 2O4GA 1T6DA 2ITGA 1IKXA 2I7PA 3SMSA 3MN7A 4FM2A 2NZTA 1V4SA 3O9TA 2P5OA 2DTUA 3FZHA 3ZETB 4C8OA 4FJMA 5TKYA 4ELUA 3NH0A 1YIJN 1EX4A 1K8KB 3LM2A 3S3OA 1LW2A 4K43A 4BRPA 3NF8A 1S5JA 1VK0A 4BR4A 4B3TK 5KRSA 1BL3A 5CZ1A 2PY5A 1EQYA 5GIPA 2YKNA 1NGIA 1Q7YO 3CJCA 1JLFA 4NXMK 1X3MA 3ISNC 3C7NB 4IFEA 3R6MA 3CCMN 1NGGA 3OYFA 2G8VA 3I56N 4DTOA 1BQNA 1VQ9N 4RCHA 1QHAA 4JD2A 5C15A 4B9QA 1KLMA 2FBYA 2Z1HA 1TV6A 3AAQA 4BDYA 3TABA 5JLHA 4CJVA 3JSMA 5AQRA 4NXNK 4CHNA 4Q5VA 3SCXA 5SWMA 4CJFA 4EIAA 1S1TA 3OY9A 2HB5A 3CCJN 3THYB 4FJ5A 3AVMA 1NK9A 1T05A 5CR4A 4FWQA 4M63C 1YVNA 3CERA 4A2AA 4H0VB 2GUIA 4X62K 3J7ZO 1KSPA 5AQJA 1X1PA 4GW6A 3DLGA 4FVMA 1ZC6A 2ITMA 4BGAA 3PO5A 4B1XB 1BGXT 1HKCA 3GBTA 1SKWA 4BR9A 1SAZA 3V81A 2XY7A 3VETA 2WBNA 1LAWA 3FR0A 5F1XA 1WAJA 5BR8K 5FPNA 2OCEA 5M1QA 3NH1A 4JKBA 1YVUA 4B1VA 2GBZA 3ZX3A 4C8MA 4M3UA 3ZSYA 5C2DA 3MX2A 2UUBK 3KTQA 4FSVA 4MQ3A 3KKSA 2RE2A 3P31A 4FPBA 1I94K 1NK5A 3CPEA 4AM7A 4A59A 4BRNA 2DPNA 4IO8A 2YCHA 3VEZA 2GX9A 4G1QA 3AVCA 2Q3SA 1L3VA 3OYLA 1LWEA 3AAPA 3D0PA 1VSFA 4DS5A 2OZMA 4AHCA 4FLXA 2ETJA 3OBYA 5LMUK 1VSIA 3O4WA 4KTZA 5HRRA 3L4QA 2HMPA 4DKWA 3C94A 3CCRN 3IDHA 2CGJA 4OX9K 4IFVA 5K14A 3SUPA 2W41A 1FK9A 2A41A 3ZT2A 3LPUA 3MXIA 1TKZA 3WNFA 2V7ZA 1GLDG 1KVCA 2KLAA 4PUOA 2IC3A 3LDQA 4H0XB 1JCGA 2E5LK 5HRSA 3ID8A 5HRNA 3PX6A 3LAKA 4PKHA 2QI2A 4CEFA 2WONA 4DR2K 2E2OA 5AQMA 2Z1GA 2P9PB 4Z4CA 2X6NA 4XEIA 4FJIA 3MWTA 4FL9A 2QWRA 3J80O 3NVKA 5KI6A 4DR4K 4CJPA 4DR1K 3K5NA 4BR5A 3O6WA 1IH7A 2EWSA 3VEOA 4FCYA 3AVLA 2YI1A 2FSJA 4H5NA 4CZJA 5AQFA 3CFPA 4AILC 4B9VA 4V19S 4B1UB 1T6CA 2YHAA 1LV5A 1Q9YA 1SL1A 2HVIA 3VEXA 4B3MK 3SK3A 2HVHA 3ULEA 4HUFA 1QSYA 2QM1A 1HYSA 1D4XA 2VWKA 4YOVA 2I7NA 5AQVA 4O4GA 2HHTA 2IOCA 3SBGA 4JNEA 2UUCK 4CD1A 4JKGB 1HPMA 4JKEA 3N4QA 2NRVA 4PA1A 4AF1A 5GIOA 1TGOA 2ZJPL 3MAQA 3RTVA 1HNIA 1RBVA 1GOAA 3H1VX 1Z6RA 4CZLA 4XH5A 3HXMA 1RBUA 4O8KA 1ATRA 4FLUA 1U45A 1Q81O 5C24A 4KHYA 5C0YA 1DLOA 2KTQA 1S1XA 4LD0A 1RDWX 3VMFB 5LL6Z 5M1KA 2ZGYA 3LDLA 3NF9A 3G6EN 4LF4K 4M3XA 4PKIA 1VRTA 2P9SB 1RT5A 2E2NA 1J9AA 1VSMA 4TSXA 3OYHA 1NK8A 3KLIA 3DLRA 1HLUA 4M7YA 4CZMA 4E1JA 5IT9O 4EZ6A 1CXQA 3HJFA 3DJCA 3VEVA 4BE2A 4DFJA 1SUQA 3C7NA 3ZT1A 5C25A 1BG3A 4CK2A 4RG8A 4FWSA 5C2FA 3AGRA 2E6MA 1RBTA 1BCOA 4M3TA 1ZBLA 4Y1DA 5BN8A 2D0CA 3OW2M 1MWKA 2NRZA 4XH4A 3SV4A 4CJ3A 4DQQA 4BG8A 4KHSA 2ZD1A 2ZE2A 3MXMA 1G99A 1BA1A 1RT4A 5AQQA 5GAGP 3AVHA 3OYMA 4LFCK 4KO0A 4BG9A 2P51A 1RBSA 1EO1A 1Z26A 2HMIA 1WNSA 4CIFA 3MN5A 5ADXA 3OYNA 4A57A 3WEEB 3AVAA 2ZWHA 4LF8K 3OA9A 4DTPA 4FK4A 3SQ2A 1F21A 4HUGA 4BDZA 3PX4A 3R3LA 1WSGA 1NLVA 2BTFA 3UKUA 4GNIA 4LF6K 4FJGA 2O8BB 3IRXA 4OKJA 3L6QA 4LC9B 4OKEA 3LAMA 4O55A 4LF7K 3V6DA 2NLXA 1RDAA 4Z4IA 1LOTB 2A6AA 3BF3A 4CF8A 3ULDA 3HOSA 4JKDA 3I0SA 5SZTA 2HBJA 5BPNA 3O8MA 4FWKA 3M3ZA 1TKTA 3A5LC 2GELA 2KKZA 2NUBA 4KHPK 3AVBA 1SV5A 4O0IA 3H08A 2HHSA 3BY5A 2F8TA 1VQMN 2KFNA 4DV7K 5CYMA 1IJJA 2HNDA 2O4IA 2O8FA 4CJWA 3K58A 1RDUA 3G0ZA 1IKYA 2LSNA 3L8BA 3K2PA 1VHXA 3LP1A 4WQ4C 2NRRA 2YNGA 3UIQA 5H1SQ 4KHWA 4OPAA 3PY8A 5JMVA 3VQ6A 1SL0A 4PL7A 2RN2A 4DHYA 5GADP 1HKBA 4NLCA 1BI4A 3T3FA 1NJYA 4H5RA 2B4JA 3SJJA 4Q0BA 1BDGA 3F2KA 3VQEA 1S22A 5AQYA 4FXDA 3AARA 1SKRA 3S41A 5I3UA 4Y1CA 3TTCA 3HT3A 4FJ9A 3SAHA 2BUPA 3AO2A 5E84A 4CBWA 1TL3A 3SYZA 1NK0A 1NOYA 4YOTA 3SUNA 3L2VA 2VWBA 4JK8A 3QEVA 3ZSVA 2E2QA 3G4SN 2OA8A 3WNEA 3WNGA 1RGIA 3DLBA 1JLAA 4OLBA 1QHTA 1A5WA 4JKAA 1HRHA 1WSHA 2Q0RA 4OKKA 4OPHA 3G10A 2A42A 2D1KA 2Q1NA 3K9KA 4CZKA 1S1UA 1QZ6A 1TKXA 1W7AA 1UWBA 4DSKA 3HK2A 3F5TA 4CJQA 4CE9A 4JRQA 4CJ4A 5E41A 4LFAK 4M3WA 2P9SA 4CF0A 2YHYA 3OJUA 3CM5A 3AO1A 4IOCL 3CM6A 3ZX2A 5GAEP 4E1MA 3OYEA 3TAFA 3FLCO 1YF5L 1JXEA 3VQPA 2P9KB 1REVA 4BRAA 1VSEA 3CCSN 3H1QA 4ISFA 1NJIO 3VQBA 1C1CA 1WOQA 1K8AO 2XO7A 2QEXN 2G8IA 1YT3A 4MDAA 4DTMA 3I8DA 4CEOA 1ZBSA 1DGKN 3VN5A 1D8YA 3LDOA 3P1GA 1A5VA 5DM7L 4CF2A 3QFUA 1HUXA 1KC8O 5AR0A 3PSIA 3GE1A 4CJ7A 1K73O 1NJXA 2UU9K 3SV3A 4H5TA 4JHDA 4U7BA 3J7AP 4NB4A 4LH5A 4JS4A 3AO4A 4M41A 2Z1JA 3CQXA 3CPWM 2DFFA 4KI4A 1RCHA 2PFUA 2A40A 1B9FA 4O5FA 4UQGA 5HL7L 3CQ8A 4FLTA 4FJ8A 1ZBFA 3O3FA 5AQOA 3HL8A 1WSFA 2G8KA 3ATVA 3ZSRA 4CHYA 4ISEA 4DSEA 2YHBA 3QNNA 5EXWA 4KPYA 1H1VA 2XY8A 2P9KA 4H4OA 3PO4A 2D0PA 4KV8A 4MLEA 4AH9A 3SPYA 1JKHA 1T8EA 4AHVA 3EZ5A 1VQON 4CBUA 3VF6A 3NCIA 3V4IA 3H45C 3K0SA 4CCHA 3O4QA 3MWPA 4KB1A 1UOCA 2HHWA 3EKSA 3HZ6A 4DTSA 4QS8A 3DM2A 3N4PA 4JI5K 3TAGA 3JAMO 4H03B 3M8RA 1HKGA 3TARA 1NGJA 4JV5K 4HCCA 1QQCA 1Y64A 1V4TA 3JYTA 1YJNN 4NLBA 3PV8A 3MMVA 5FRMA 2YJFA 3SJHA 4HUEA 1O13A 1W9HA 1UA1A 3QDKA 3HVRA 4DTJA 4IOAL 3D45A 1Q9XA 3CIPA 1Q82O 4U67L 2D0OA 4DUZK 2YJEA 3DLLL 4IEIA 3ZYYX 1C1AA 5J2PA 1JJ2M 3C6UA 2DFEA 3CMEN 3GL1A 2Q31A 2HBMA 3ZEUA 3SUOA 3DXMB 4DV4K 5M1FA 3L2RA 3SLCA 5EOYA 4B9UA 2D0BA 4CECA 3KVGA 5BRHA 1TUYA 2HNZA 4ELTA 2KZZA 5FPEA 2HHVA 2PYJA 4LF9K 1JLGA 2HBKA 1W97L 3HP6A 1A5XA 5FPDA 3THWA 1YXQA 3MN9A 2ZF5O 3BZKA 4I2PA 3VGMA 4DTNA 1TK5A 4DR7K 3QETA 1EWQA 4ID5A 4BR2A 1TKDA 3O9UA 1LCUA 1TAUA 3LP2A 4A61A 1GLCG 2VCPA 1FKPA 2NRWA 3PX0A 1IV0A 3T1AA 4H0PA 3J81O 5BRFA 1BISA 5J2QA 1NK7A 3GG4A 5LJWA 1VQ4N 1QSLA 4BC4A 4B1WB 1BHLA 2CH5A 3DRSA 3RRGA 4DV3K 4M7XA 1NNEA 3IFRA 4B9LA 5AZJB 4CFCA 3A8YA 3S3NA 1SKSA 3KWIA 2Q2RA 2OPPA 4CFDA 3MCPA 2O8FB 2Y1JA 3V9ZA 3EE9A 3LDPA 3SBTA 4EHUA 1XNQK 2OPQA 4CD3A 4M3RA 1KCFA 3WXMB 3MEGA 4JHDB 4WCEL 3SI6A 3TANA 3CCEN 4KH6A 4EZ9A 1DTQA 4W5QA 1J5OA 1CZBA 3R8EA 3VEYA 5T7BA 3WQTA 1C0FA 1TK8A 4DS4A 3AA3A 3E9LA 1HR0K 3SQ0A 5D3GA 3TPQA 3TSQA 4JLHA 3M5RA 3KK2A 3C65A 4FJ7A 3LWLA 5I42A 4CGIA 1YAGA 3A5NC 5MLCQ 3THVA 4LFBK 5ELZA 3VTIA 1NGEA 3QEXA 3RR7A 4ID1A 3O9SA 3SAFA 3QMLA 1GLBG 4YHHK 3BZCA 3U8XA 4B3SK 1JCEA 4FWOA 1KRPA 1IBMK 3VGLA 2G8HA 2HSTA 4BROA 4B9MA 3OVNA 3K9JA 1KLNA 2P9IA 4ILGB 2FBTA 5BREA 2QWOA 1MU2A 3NDKA 2G8WA 2OTLN 3VGKA 3OS2A 4OLAA 3WXLA 4I6MA 2XRIA 2FSKA 2CGLA 5M1NA 3ZETA 1E3MA 4CK1A 3CD6N 1ZBIA 3HRGA 3B6PA 3F9MA 3LWMA 1FKOA 1VSHA 2HNYA 1L3TA 3CMAN 4FWPA 5HLFA 2ATQA 2NRTA 1MA9B 3HTVA 4AQYK 3CJ7A 1WAFA 3L2UA 4J2AA 4HWIA 3VA3A 1OVYA 3VQCA 2YNHA 3OHRA 1XMQK 2IVOA 3CETA 3TTDA 3IAYA 3DOKA 1GLJO 3QB0A 3ZSXA 5CHIA 4E7IA 3SNNA 2HOEA 3TTFA 4KB0A 4FZYA 5HOOA 3WXIA 2GEMA 3EL2A 3OBWA 4YDUC 4EP4A 3CF5L 2QXLA 3LANA 4OPJA 4CJSA 3IUCA 2YX6A 4YDUA 2FF6A 2YHXA 3MDQA 3FFIA 3CHWA 1BIZA 3HPOA 1IG9A 2W40A 5HP1A 4IJNA 3VQQA 4KTWA 3DYAA 5JLFA 4BRQA 2P9UB 1TAQA 3VOVA 1U2VA 3Q7CA 4CGGA 3U9DA 1IKVA 2HHQA 1NGAA 2VYPA 3K57A 5KQ8A 3QESA 1K9MO 5IWAK 3CC7N 5J2MA 3FZKA 3E9PA 4E7LA 3ZLJA 5CYQA 5AQTA 3AVKA 4DF8A 1J6ZA 3QINA 4K8XA 2O8DB 3ASMA 5KTQA 4XIUA 2F96A 3VA0A 4WFNL 2XHBA 2GUPA 5FLXO 1MWMA 2BE2A 3WEEA 2P9LA 4DU1A 1XMOK 2EHGA 3O80A 4BQLA 1LAVA 3QBWA 5ADXH 1SL2A
chains in the Genus database with same CATH topology
1IBLK 4NXNK 2UU9K 2UUAK 2E5LK 5IT9O 4DR7K 3J7AP 4B3RK 3OTOK 4DV5K 4DR2K 1IBKK 4DV0K 4GKKK 4LF5K 5AJ3K 4X62K 4X66K 4DUYK 1N32K 2UXDK 3J81O 3J80O 4DR4K 4AQYK 2UXBK 4CVNE 4DR1K 1N33K 1XMQK 2F4VK 4DV3K 4LFCK 4GKJK 3T1HK 5BR8K 1HNXK 4V19S 3T1YK 4LF8K 4JI6K 5A2QO 4B3MK 4JI5K 2ZM6K 4JI2K 3JAMO 4YY3K 1XNQK 1FJGK 5LMNK 1XNRK 4JV5K 2UUBK 4LF6K 2VQFK 4DR6K 1N34K 4X65K 4JI1K 2UXCK 2UUCK 1I94K 4DR3K 4LF7K 4LFAK 3J7YP 1HNZK 1N36K 2VQEK 4JI3K 4K0KK 4DV6K 4DUZK 1HR0K 5IWAK 4X64K 4B3TK 4JI4K 5LMUK 4NXMK 2HHHK 4JI0K 4KHPK 4JI7K 4LFBK 4DV4K 5LL6Z 4OX9K 4DV7K 5FLXO 4LF4K 4YHHK 1HNWK 4B3SK 4DV1K 4LF9K 1J5EK 1IBMK 1XMOK 4CW7B 4JI8K 4DV2K 4JYAK 4DR5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL K;  4NXN K;  2UU9 K;  2UUA K;  2E5L K;  5IT9 O;  4DR7 K;  3J7A P;  4B3R K;  3OTO K;  4DV5 K;  4DR2 K;  1IBK K;  4DV0 K;  4GKK K;  4LF5 K;  5AJ3 K;  4X62 K;  4X66 K;  4DUY K;  1N32 K;  2UXD K;  3J81 O;  3J80 O;  4DR4 K;  4AQY K;  2UXB K;  4CVN E;  4DR1 K;  1N33 K;  1XMQ K;  2F4V K;  4DV3 K;  4LFC K;  4GKJ K;  3T1H K;  5BR8 K;  1HNX K;  4V19 S;  3T1Y K;  4LF8 K;  4JI6 K;  5A2Q O;  4B3M K;  4JI5 K;  2ZM6 K;  4JI2 K;  3JAM O;  4YY3 K;  1XNQ K;  1FJG K;  5LMN K;  1XNR K;  4JV5 K;  2UUB K;  4LF6 K;  2VQF K;  4DR6 K;  1N34 K;  4X65 K;  4JI1 K;  2UXC K;  2UUC K;  1I94 K;  4DR3 K;  4LF7 K;  4LFA K;  3J7Y P;  1HNZ K;  1N36 K;  2VQE K;  4JI3 K;  4K0K K;  4DV6 K;  4DUZ K;  1HR0 K;  5IWA K;  4X64 K;  4B3T K;  4JI4 K;  5LMU K;  4NXM K;  2HHH K;  4JI0 K;  4KHP K;  4JI7 K;  4LFB K;  4DV4 K;  5LL6 Z;  4OX9 K;  4DV7 K;  5FLX O;  4LF4 K;  4YHH K;  1HNW K;  4B3S K;  4DV1 K;  4LF9 K;  1J5E K;  1IBM K;  1XMO K;  4CW7 B;  4JI8 K;  4DV2 K;  4JYA K;  4DR5 K; 
#chains in the Genus database with same CATH topology
 3O9Q A;  1MDU B;  1HX1 A;  3IS9 A;  3RSE B;  4DU4 A;  4A62 A;  1XWL A;  2WUS A;  4KRF A;  3VF4 A;  1EWR A;  4AM6 A;  1IBK K;  4DV0 K;  4F2R A;  4YOU A;  5AJ3 K;  4PWD A;  4DFM A;  1VQP N;  4PY5 A;  3ZCM A;  5CZ2 A;  2E8A A;  4IG3 A;  4DTR A;  3QEP A;  2OZS A;  4IZ9 A;  3V1O A;  1N6Q A;  4M45 A;  3MK6 A;  5AZI A;  1X9J A;  3RMC A;  1HQU A;  3AVN A;  2X74 A;  4CER A;  1HYZ A;  4IOX A;  4CJR A;  1DTT A;  3M8S A;  4DU3 A;  5FRO A;  4KRE A;  1KFD A;  3A5M C;  3SQ4 A;  2KQ2 A;  1U2V B;  4BRG A;  4DQ8 A;  5A2Q O;  2VG6 A;  3ID6 A;  5CY4 A;  4F3O A;  1FJG K;  3AY9 A;  2G8F A;  4CJL A;  3E66 A;  1C1B A;  4MO5 A;  3HOT A;  4K8Z A;  2ASM A;  4X65 K;  4JI1 K;  3V1R A;  2P1J A;  4KH4 A;  3CJB A;  3WQU A;  4GV6 A;  4EFH A;  3ATU A;  4FWL A;  2E1Z A;  3NGY A;  5JIC A;  3J7Y P;  2F8S A;  3L0Q A;  1BQM A;  3V9X A;  2WTU A;  4DG1 A;  1NU0 A;  1EET A;  5LJV A;  4E3S A;  5AQN A;  4CES A;  5EX5 A;  4PKG A;  3Q7B A;  5AFU H;  5BPM A;  4M42 A;  1IO2 A;  4X64 K;  5KGW A;  1RT6 A;  3AO5 A;  1N8R O;  4LY7 A;  4FWN A;  3HM8 A;  4JS5 A;  4RW9 A;  2AA4 A;  3A2F A;  4HTL A;  5DM6 L;  3TR8 A;  1CLQ A;  3E01 A;  3H46 O;  1BU6 O;  1BA0 A;  1R0A A;  3V9W A;  2W42 A;  4BRI A;  1FXX A;  3LP0 A;  3DI6 A;  3E1Y A;  4DV1 K;  3QO9 A;  1SZ2 A;  4JKF A;  1I3A A;  1RFQ A;  3CC4 N;  2HW3 A;  2ASO A;  1D9D A;  2BGG A;  4C1N I;  2O8B A;  3KWG A;  4KI6 A;  1SQK A;  4K42 A;  4BRL A;  3FZF A;  1XHX A;  4FZX C;  3EYZ A;  4CJT A;  2KHO A;  3OTO K;  3LDS A;  1RTH A;  3VQ8 A;  2IIR A;  1QZ5 A;  5TKW A;  4GKK K;  5AQS A;  1ASV A;  4DFP A;  4YOR A;  4KHN A;  4KH5 A;  2UXD K;  2NRH A;  3HSC A;  2A3Z A;  5M1P A;  1YJW N;  1QTM A;  1KXP A;  1QVF M;  1NJW A;  2E2P A;  3QEW A;  2IAJ A;  1QS4 A;  1S9G A;  1CZ9 A;  2ASP A;  2GWK A;  2QK9 A;  4CZE A;  5E26 A;  3F9K A;  2ZQB A;  2QA4 N;  3R9P A;  4FLV A;  4NCG A;  3DWL A;  4DQI A;  3VER A;  4JD2 B;  2J4R A;  1WSJ A;  5AQK A;  4RW8 A;  4YY3 K;  3KLG A;  1QVG M;  3VQD A;  3OYC A;  5LMN K;  4HTU A;  4BRD A;  2P9I B;  1NOZ A;  4F3T A;  2VQF K;  4AHS A;  4BGB A;  3LZI A;  2P9N A;  3SAG A;  4CZF A;  1QE1 A;  1TL1 A;  4IDH A;  4F8R A;  1HNZ K;  3PSF A;  1NGD A;  2A1S A;  2O8C A;  4CZI A;  4DSL A;  2F9T A;  1JL2 A;  3DRP A;  4MO4 A;  4DQS A;  4FJK A;  3L3V A;  3THX B;  1NJZ A;  1NG9 A;  1LW0 A;  3UKR B;  3O4N A;  3MXJ A;  3V9U A;  4DSI A;  4B9T A;  3BUZ B;  2QTD A;  1NM1 A;  3I33 A;  3D2F B;  1XC3 A;  5BR9 A;  1D5A A;  1D9F A;  1TYQ A;  2WOM A;  1HQE A;  3JXU A;  1VQN N;  4CF9 A;  1B92 A;  1OVQ A;  4IO9 L;  3OS1 A;  1KVA A;  4BAC A;  3CC2 N;  2UUA K;  4EAH D;  5J2N A;  1KAY A;  4FJL A;  2F7T A;  4FM0 A;  1NGF A;  3DLH A;  3AA4 A;  2IVP A;  3TAM A;  4N47 A;  1YUW A;  4DUY K;  3OYJ A;  3FGU A;  4KAZ A;  3LM9 A;  1E4F T;  2FBX A;  4FLY A;  4CEE A;  3S9H A;  3ZSQ A;  3UKU B;  4FOE A;  1ILY A;  2V7Y A;  3T19 A;  3W0L A;  4BC2 A;  4YOX A;  4Z4H A;  4DTU A;  3NMU A;  3BEX A;  2W6L A;  3RSE A;  2H3G X;  3CFR A;  3ZEU B;  4RW6 A;  2GV9 A;  3NF7 A;  4RTF D;  2WFB A;  3CYM A;  5KRT A;  2DY4 A;  3TAQ A;  4JI6 K;  4ZHR A;  4BWM A;  4B1Z A;  4CED A;  4BRE A;  2VGN A;  1VRU A;  1X9M A;  3EY1 A;  3E9O A;  4E1N A;  3NGZ A;  1RDB A;  4FOI A;  4IDK A;  3ZSZ A;  2UXC K;  1S6Q A;  4GV3 A;  2Z1I A;  3AA2 A;  3G25 A;  2A5X A;  3OYD A;  3QEI A;  4DTX A;  1U6Z A;  1ESV A;  3S3M A;  2YNI A;  4F9O A;  1WLJ A;  4FWR A;  4FVU A;  3CFO A;  2VQE K;  4OGC A;  2QWL A;  3KD5 E;  3W3D A;  1U4B A;  3TSP A;  4DV6 K;  1BCM A;  4C8K A;  1WSE A;  2VG5 A;  4B9N A;  3VQ9 A;  4H5V A;  4WFA L;  1RTI A;  5AQH A;  4FLW A;  4DCH A;  3SMP A;  4CF1 A;  3M6G A;  3HBT A;  1U49 A;  3D2E B;  1WBB A;  1UAX A;  1NKE A;  3BDP A;  4L3Q A;  2RPI A;  4BRK A;  4JKG A;  1HJR A;  1JLB A;  1JLQ A;  4EHT A;  3CCQ N;  2V51 B;  4BE0 A;  5FDL A;  1KD1 O;  3KHY A;  4UY8 O;  1LWF A;  4DFK A;  1DEJ A;  5EY4 A;  4FLZ A;  4H5W A;  2AJQ A;  4WFB L;  3PIP L;  3CG7 A;  1NK6 A;  2I5J A;  4FJX A;  1TVR A;  4CIG A;  4KHQ A;  1S1W A;  3OYI A;  3HPH A;  1QSS A;  3ZT4 A;  5AQP A;  2X78 A;  3K5M A;  1BIU A;  1I39 A;  1JCF A;  3O3H A;  4I2Q A;  4RW4 A;  4W5R A;  2AP1 A;  4DF4 A;  5C10 A;  1BWF O;  3DRR A;  2YKM A;  1Q18 A;  4YOW A;  4BDP A;  4DLG A;  1GLA G;  3QFP A;  4W5T A;  1C0M A;  3SQ1 A;  3WNH A;  4FO0 A;  4R79 A;  1NK4 A;  4NYF A;  4F2S A;  1P8Z A;  4B9S A;  2E6L A;  1UA0 A;  1RT7 A;  3QLH A;  2JWL A;  1Q8I A;  3AVJ A;  3QIO A;  4DMN A;  3PLA A;  4DR6 K;  2PZS A;  4AHT A;  3WT0 A;  2QKB A;  2WC9 A;  4J2B A;  1GLL O;  5LY3 A;  1KFS A;  2IGI A;  2P9P A;  4IXC A;  4YNQ A;  3G71 N;  4HHT A;  3QIP A;  3LP3 A;  1ATN A;  3A5O C;  3THW B;  1CZA N;  4ZTF A;  4PQU A;  3L2W A;  3U4L A;  2E1Y A;  1JXB A;  4G9Z A;  3I55 N;  1YI2 N;  3PUF A;  5C42 A;  3OYG A;  5AQI A;  5AZI B;  1RT3 A;  2XY5 A;  1VSL A;  4J8F A;  5JVG L;  3DLE A;  2Q36 A;  3H6E A;  3QNO A;  4FW2 A;  4K25 A;  1HNW K;  3DMJ A;  5KPR A;  3CQY A;  3KKR A;  3EO3 A;  1C0G A;  4DSJ A;  3ITH A;  4CW7 B;  3RVC A;  4JRP A;  4JI8 K;  3BGR A;  4I9Q A;  4CHZ A;  3AVG A;  3LDN A;  4CGH A;  3ALY A;  4N5S A;  4FJJ A;  2JGU A;  3CCL N;  4DV5 K;  2HHX A;  3OYA A;  2W6K A;  4WQ4 A;  4MLH A;  1JL1 A;  3FFK B;  4JK7 A;  3C6A A;  1XUP O;  3ENO A;  4H8K A;  5BRD A;  4JK9 A;  5AFU A;  3TAE A;  1XC9 A;  1TK0 A;  3KD1 E;  1VQ6 N;  2FLO A;  3SPZ A;  3H3O B;  4N41 A;  4M3Z A;  1NBW A;  3DOL A;  3C95 A;  1N33 K;  4CBX A;  2PYL A;  1KAX A;  3L2Q A;  4DWI A;  1OH5 A;  3O5B A;  4CJU A;  1VSJ A;  5B8H A;  3VQ7 A;  2E20 A;  2HF4 A;  4FJN A;  1YIT N;  1HPZ A;  3QIC A;  4N56 A;  1QQM A;  4LH4 A;  3J8A A;  4CFA A;  3JS6 A;  2G8U A;  2F9W A;  3DAW A;  1ASW A;  5AQZ A;  3K5L A;  1NGB A;  2XY6 A;  3MED A;  4B3O A;  3NHG A;  3P4I A;  2IVN A;  3OYB A;  4QOZ B;  4I6M B;  1L3U A;  2R7Y A;  3O1B A;  2QWQ A;  2QWP A;  3AVI A;  1NKC A;  2QW9 A;  4BVP A;  3WXK A;  1CXU A;  1Y97 A;  2RHK A;  2GTD A;  3OS0 A;  5F0X A;  2UYT A;  4H4M A;  3O9R A;  4WQ5 A;  1NGH A;  4CEQ A;  3ENB A;  1OH7 A;  4ILH A;  1W2B M;  1J54 A;  4FWM A;  4BC3 A;  4NCB A;  3MX5 A;  1IKW A;  4CFB A;  4ELV A;  3LL3 A;  4JI7 K;  5JS2 A;  3P38 A;  5EU7 A;  1HJO A;  2YNF A;  4CEB A;  4CHQ A;  1GLF O;  3KLF A;  1VQ7 N;  4CJE A;  1YTU A;  2O8C B;  5AQU A;  1J5E K;  1GLE G;  4RW7 A;  4DV2 K;  4DR5 K;  3LPT A;  2VG7 A;  1IBL K;  2A1R A;  3UE5 A;  4C23 A;  1XQS C;  4CZG A;  4IBN A;  4HVJ A;  1OH8 A;  3EN9 A;  1M1K O;  4O0J A;  1ZXO A;  3LAL A;  4X66 K;  1X3N A;  3BP8 A;  4ILJ A;  1YTA A;  1NGC A;  1EKE A;  2JLE A;  1T3V A;  2JWK A;  2UXB K;  4BE1 A;  3QER A;  1WN7 A;  3AO3 A;  4CVN E;  3DLK A;  1C0U A;  1S72 N;  5AQG A;  4IG0 A;  4BQZ A;  1RIL A;  2O8D A;  4ZTJ A;  1VSD A;  3IG1 A;  5DMR A;  2GWJ A;  4M3Y A;  4GKJ K;  3T1H K;  2OYQ A;  1S1V A;  3EZW A;  4W5O A;  3D2F A;  3KLE A;  3T1Y K;  4YFU A;  4FZZ A;  1ZBU A;  3HST B;  1RBR A;  4BRC A;  3A0I X;  2ZM6 K;  4KTQ A;  4KHU A;  2OPR A;  1Z05 A;  3V1Q A;  4KBO A;  1GOB A;  1T7P A;  1R59 O;  2RF2 A;  1O1W A;  4B8A B;  5GAH P;  4FK0 A;  5AQW A;  1OH6 A;  2QXF A;  2KFZ A;  3RRH A;  1U48 A;  3GOI A;  4O44 A;  4FW1 A;  2ZGZ A;  1M90 O;  1XI1 A;  1TYQ B;  1KVB A;  3SZ2 A;  3VF2 A;  1K6Y A;  1WB9 A;  2BH1 A;  4CHP A;  5KGX A;  4K0K K;  4BY9 C;  4CK3 A;  3H3N O;  2D4W A;  1KAZ A;  4B08 A;  3RWU A;  4Z0U A;  3ULE B;  2IDO A;  3RR8 A;  4CZH A;  1NKB A;  4IJA A;  5AQX A;  2PBD A;  2FC0 A;  3KJV A;  3F73 A;  4BRF A;  4PHT X;  5KPZ A;  2HHH K;  4JI0 K;  2EX3 A;  3THY A;  4CGF A;  1L5U A;  3QBX A;  4F4K A;  1C6V A;  1RDC A;  3RMD A;  1RDD A;  1HNV A;  3T7Z A;  3TSU A;  4DLE A;  1TUU A;  3HPG A;  1WUA A;  1B9D A;  4WF9 L;  4OPK A;  1OKJ A;  4L8R B;  4BVO A;  3IKM A;  1ZBH A;  2BDP A;  4NYN A;  1JLE A;  4GVM A;  3AV9 A;  3CJA A;  3AA5 X;  3PIO L;  4B3R K;  5HBM A;  2QWM A;  4PL8 A;  2NRX A;  4JN4 A;  4ISG A;  3I8B A;  2D5R A;  3ZX0 A;  4IEE A;  2VWJ A;  4LF5 K;  4CEZ A;  2Q97 A;  2OPS A;  5JVH L;  4Z4E A;  3FZL A;  1WSI A;  1N32 K;  1ITG A;  1E4G T;  4O5B A;  3MN6 A;  5GIN A;  1VAZ A;  2B5J A;  4QAG A;  2FF3 B;  4EP5 A;  3OYK A;  4CGJ A;  3HO1 A;  2YHW A;  3D2E A;  2HHU A;  1J53 A;  1LWC A;  3CCU N;  3CJ1 A;  5CE3 A;  1RT2 A;  2P9N B;  1Q86 O;  1DKG D;  5FPM A;  2CH6 A;  4IWV A;  4GY2 B;  1U47 A;  4Z94 A;  3NF6 A;  3M8Q A;  1EXQ A;  4OGE A;  4CJ5 A;  3O3G A;  2HBL A;  3SUQ A;  1K8K A;  3VQ4 A;  1Z25 A;  3VQ5 A;  1QQN A;  1NMN A;  4JKH A;  4ICL A;  4C8N A;  2P9U A;  3NBP A;  4YOY A;  1ASU A;  5F2R A;  4GVE A;  5FRN A;  1XHZ A;  4N76 A;  4JI2 K;  4H0O A;  3CJ9 A;  4E19 A;  1X9W A;  4JAX A;  1XNR K;  3P83 D;  3BF1 A;  4XH1 A;  3KK7 A;  3HVT A;  4DQP A;  3NFA A;  3U3G A;  3B6O A;  2E4L A;  4IFY A;  3D7E O;  5I9E B;  2HF3 A;  1T44 A;  3EE8 A;  3CCV N;  3ZT3 A;  4IKF A;  3CI5 A;  2ZJR L;  3TWH A;  4JEP A;  4NCA A;  4QCL A;  4JI3 K;  1S6P A;  3U9Z A;  1RNH A;  4DSF A;  3RMB A;  1EP4 A;  1N5Y A;  1KQS M;  2V52 B;  4HCB A;  4C8L A;  4O8U A;  4OO1 J;  4AHR A;  2Q0U A;  1U04 A;  3UB5 A;  4CI6 A;  3KZB A;  2DFH A;  5AZJ A;  3NVM A;  1RTJ A;  4A5B A;  4FM1 A;  2IS3 A;  4W5N A;  3ZSW A;  4A2B A;  3RMA A;  1ZYQ A;  4H0T B;  1KTQ A;  1IG8 A;  2E88 A;  4FPA A;  4JYA K;  3KK1 A;  2D0A A;  2VGM A;  2QKK A;  4FK2 A;  4C1N K;  2KW4 A;  3NH2 A;  5HRO A;  5JS1 A;  4BRM A;  2NNW A;  4B1Y B;  1G15 A;  4WE1 A;  2OTJ N;  2FSN A;  1VQL N;  4BC5 A;  1FW6 A;  3VQA A;  2B6A A;  1VQ5 N;  3VEW A;  3HI0 A;  3MCA B;  3LZJ A;  3DXK A;  4AHU A;  4CHO A;  4E7K A;  3O1W A;  1C0T A;  5HRP A;  1L3S A;  3IMX A;  4BWJ A;  3VES A;  3M1F A;  3P5J A;  3UKR A;  4E7H A;  5KQD A;  3K5O A;  1JLC A;  1NWK A;  2YV0 X;  3ZT0 A;  1VSK A;  4E7J A;  3O08 A;  2KZM A;  4R5P A;  3DXM A;  1HMV A;  3NAE A;  3HP9 A;  3KK3 A;  2OAN A;  3C6T A;  2Y1I A;  3TU5 A;  2P5G A;  3AGK A;  4I7F A;  2FBV A;  3T69 A;  1BO5 O;  3MEE A;  3VPZ A;  1P90 A;  3U6F A;  3P39 A;  5C12 A;  4BR7 A;  5BPL A;  4H0Y B;  5EVZ A;  5DK5 A;  3GDQ A;  4CJK A;  1N34 K;  1SS6 A;  3D6R A;  3HM9 A;  4MFB A;  4WYB A;  4DR3 K;  1RTD A;  4KFB A;  4FJH A;  4WQ5 C;  1T03 A;  2P9L B;  3HYF A;  1N36 K;  4J2D A;  1BI4 B;  3L3U A;  4I9L A;  1BUP A;  2O8E A;  4A5A A;  3NE6 A;  2FXU A;  4JI4 K;  3L4I A;  2BAN A;  3C6H A;  4DB3 A;  4E89 A;  4JKC A;  3U3Y A;  4J2E A;  2PAV A;  4DQR A;  4NO7 A;  3KLH A;  1X9S A;  4FYD A;  5AQL A;  4Z4F A;  3DXK B;  2RKI A;  3AVF A;  4OVL A;  4BR0 A;  2X6S A;  3NGI A;  3WUH A;  3C0B A;  4QS9 A;  4B8C A;  3CXC M;  3OJS A;  4E0D A;  2QWN A;  3MEC A;  3B8A X;  1S3X A;  4CIE A;  1W0H A;  3I0R A;  4Z4G A;  1GOC A;  1ATS A;  1BOT O;  4CGD A;  3FE1 A;  3ZSO A;  5J1E A;  4KKO A;  2ZJQ L;  1WBD A;  3TI0 A;  3WXJ A;  4LSN A;  1YHQ N;  2O8E B;  3EEQ A;  1S9E A;  4MDB A;  1NMD A;  1DT9 A;  3M8P A;  3THX A;  1HYV A;  4GV9 A;  4CEA A;  3TAP A;  4Y0W A;  3ENH A;  3V9S A;  1YJ9 N;  2F4V K;  4GMJ B;  5KPT A;  5BN9 A;  4LSL A;  1QQO A;  1VQK N;  3FZM A;  5M1O A;  4K41 A;  3VEN A;  4OJR A;  4QS7 A;  2CGK A;  3R1X A;  1HNX K;  3K59 A;  1RT1 A;  3KIO A;  4BRH A;  4RWT A;  1VQ8 N;  3EKU A;  3VTH A;  2O4G A;  1T6D A;  2ITG A;  1IKX A;  2I7P A;  3SMS A;  3MN7 A;  4FM2 A;  2NZT A;  1V4S A;  3O9T A;  2P5O A;  2DTU A;  3FZH A;  3ZET B;  4C8O A;  4FJM A;  5TKY A;  4ELU A;  3NH0 A;  1YIJ N;  1EX4 A;  1K8K B;  3LM2 A;  3S3O A;  1LW2 A;  4K43 A;  4BRP A;  3NF8 A;  1S5J A;  1VK0 A;  4BR4 A;  4B3T K;  5KRS A;  1BL3 A;  5CZ1 A;  2PY5 A;  1EQY A;  5GIP A;  2YKN A;  1NGI A;  1Q7Y O;  3CJC A;  1JLF A;  4NXM K;  1X3M A;  3ISN C;  3C7N B;  4IFE A;  3R6M A;  3CCM N;  1NGG A;  3OYF A;  2G8V A;  3I56 N;  4DTO A;  1BQN A;  1VQ9 N;  4RCH A;  1QHA A;  4JD2 A;  5C15 A;  4B9Q A;  1KLM A;  2FBY A;  2Z1H A;  1TV6 A;  3AAQ A;  4BDY A;  3TAB A;  5JLH A;  4CJV A;  3JSM A;  5AQR A;  4NXN K;  4CHN A;  4Q5V A;  3SCX A;  5SWM A;  4CJF A;  4EIA A;  1S1T A;  3OY9 A;  2HB5 A;  3CCJ N;  3THY B;  4FJ5 A;  3AVM A;  1NK9 A;  1T05 A;  5CR4 A;  4FWQ A;  4M63 C;  1YVN A;  3CER A;  4A2A A;  4H0V B;  2GUI A;  4X62 K;  3J7Z O;  1KSP A;  5AQJ A;  1X1P A;  4GW6 A;  3DLG A;  4FVM A;  1ZC6 A;  2ITM A;  4BGA A;  3PO5 A;  4B1X B;  1BGX T;  1HKC A;  3GBT A;  1SKW A;  4BR9 A;  1SAZ A;  3V81 A;  2XY7 A;  3VET A;  2WBN A;  1LAW A;  3FR0 A;  5F1X A;  1WAJ A;  5BR8 K;  5FPN A;  2OCE A;  5M1Q A;  3NH1 A;  4JKB A;  1YVU A;  4B1V A;  2GBZ A;  3ZX3 A;  4C8M A;  4M3U A;  3ZSY A;  5C2D A;  3MX2 A;  2UUB K;  3KTQ A;  4FSV A;  4MQ3 A;  3KKS A;  2RE2 A;  3P31 A;  4FPB A;  1I94 K;  1NK5 A;  3CPE A;  4AM7 A;  4A59 A;  4BRN A;  2DPN A;  4IO8 A;  2YCH A;  3VEZ A;  2GX9 A;  4G1Q A;  3AVC A;  2Q3S A;  1L3V A;  3OYL A;  1LWE A;  3AAP A;  3D0P A;  1VSF A;  4DS5 A;  2OZM A;  4AHC A;  4FLX A;  2ETJ A;  3OBY A;  5LMU K;  1VSI A;  3O4W A;  4KTZ A;  5HRR A;  3L4Q A;  2HMP A;  4DKW A;  3C94 A;  3CCR N;  3IDH A;  2CGJ A;  4OX9 K;  4IFV A;  5K14 A;  3SUP A;  2W41 A;  1FK9 A;  2A41 A;  3ZT2 A;  3LPU A;  3MXI A;  1TKZ A;  3WNF A;  2V7Z A;  1GLD G;  1KVC A;  2KLA A;  4PUO A;  2IC3 A;  3LDQ A;  4H0X B;  1JCG A;  2E5L K;  5HRS A;  3ID8 A;  5HRN A;  3PX6 A;  3LAK A;  4PKH A;  2QI2 A;  4CEF A;  2WON A;  4DR2 K;  2E2O A;  5AQM A;  2Z1G A;  2P9P B;  4Z4C A;  2X6N A;  4XEI A;  4FJI A;  3MWT A;  4FL9 A;  2QWR A;  3J80 O;  3NVK A;  5KI6 A;  4DR4 K;  4CJP A;  4DR1 K;  3K5N A;  4BR5 A;  3O6W A;  1IH7 A;  2EWS A;  3VEO A;  4FCY A;  3AVL A;  2YI1 A;  2FSJ A;  4H5N A;  4CZJ A;  5AQF A;  3CFP A;  4AIL C;  4B9V A;  4V19 S;  4B1U B;  1T6C A;  2YHA A;  1LV5 A;  1Q9Y A;  1SL1 A;  2HVI A;  3VEX A;  4B3M K;  3SK3 A;  2HVH A;  3ULE A;  4HUF A;  1QSY A;  2QM1 A;  1HYS A;  1D4X A;  2VWK A;  4YOV A;  2I7N A;  5AQV A;  4O4G A;  2HHT A;  2IOC A;  3SBG A;  4JNE A;  2UUC K;  4CD1 A;  4JKG B;  1HPM A;  4JKE A;  3N4Q A;  2NRV A;  4PA1 A;  4AF1 A;  5GIO A;  1TGO A;  2ZJP L;  3MAQ A;  3RTV A;  1HNI A;  1RBV A;  1GOA A;  3H1V X;  1Z6R A;  4CZL A;  4XH5 A;  3HXM A;  1RBU A;  4O8K A;  1ATR A;  4FLU A;  1U45 A;  1Q81 O;  5C24 A;  4KHY A;  5C0Y A;  1DLO A;  2KTQ A;  1S1X A;  4LD0 A;  1RDW X;  3VMF B;  5LL6 Z;  5M1K A;  2ZGY A;  3LDL A;  3NF9 A;  3G6E N;  4LF4 K;  4M3X A;  4PKI A;  1VRT A;  2P9S B;  1RT5 A;  2E2N A;  1J9A A;  1VSM A;  4TSX A;  3OYH A;  1NK8 A;  3KLI A;  3DLR A;  1HLU A;  4M7Y A;  4CZM A;  4E1J A;  5IT9 O;  4EZ6 A;  1CXQ A;  3HJF A;  3DJC A;  3VEV A;  4BE2 A;  4DFJ A;  1SUQ A;  3C7N A;  3ZT1 A;  5C25 A;  1BG3 A;  4CK2 A;  4RG8 A;  4FWS A;  5C2F A;  3AGR A;  2E6M A;  1RBT A;  1BCO A;  4M3T A;  1ZBL A;  4Y1D A;  5BN8 A;  2D0C A;  3OW2 M;  1MWK A;  2NRZ A;  4XH4 A;  3SV4 A;  4CJ3 A;  4DQQ A;  4BG8 A;  4KHS A;  2ZD1 A;  2ZE2 A;  3MXM A;  1G99 A;  1BA1 A;  1RT4 A;  5AQQ A;  5GAG P;  3AVH A;  3OYM A;  4LFC K;  4KO0 A;  4BG9 A;  2P51 A;  1RBS A;  1EO1 A;  1Z26 A;  2HMI A;  1WNS A;  4CIF A;  3MN5 A;  5ADX A;  3OYN A;  4A57 A;  3WEE B;  3AVA A;  2ZWH A;  4LF8 K;  3OA9 A;  4DTP A;  4FK4 A;  3SQ2 A;  1F21 A;  4HUG A;  4BDZ A;  3PX4 A;  3R3L A;  1WSG A;  1NLV A;  2BTF A;  3UKU A;  4GNI A;  4LF6 K;  4FJG A;  2O8B B;  3IRX A;  4OKJ A;  3L6Q A;  4LC9 B;  4OKE A;  3LAM A;  4O55 A;  4LF7 K;  3V6D A;  2NLX A;  1RDA A;  4Z4I A;  1LOT B;  2A6A A;  3BF3 A;  4CF8 A;  3ULD A;  3HOS A;  4JKD A;  3I0S A;  5SZT A;  2HBJ A;  5BPN A;  3O8M A;  4FWK A;  3M3Z A;  1TKT A;  3A5L C;  2GEL A;  2KKZ A;  2NUB A;  4KHP K;  3AVB A;  1SV5 A;  4O0I A;  3H08 A;  2HHS A;  3BY5 A;  2F8T A;  1VQM N;  2KFN A;  4DV7 K;  5CYM A;  1IJJ A;  2HND A;  2O4I A;  2O8F A;  4CJW A;  3K58 A;  1RDU A;  3G0Z A;  1IKY A;  2LSN A;  3L8B A;  3K2P A;  1VHX A;  3LP1 A;  4WQ4 C;  2NRR A;  2YNG A;  3UIQ A;  5H1S Q;  4KHW A;  4OPA A;  3PY8 A;  5JMV A;  3VQ6 A;  1SL0 A;  4PL7 A;  2RN2 A;  4DHY A;  5GAD P;  1HKB A;  4NLC A;  1BI4 A;  3T3F A;  1NJY A;  4H5R A;  2B4J A;  3SJJ A;  4Q0B A;  1BDG A;  3F2K A;  3VQE A;  1S22 A;  5AQY A;  4FXD A;  3AAR A;  1SKR A;  3S41 A;  5I3U A;  4Y1C A;  3TTC A;  3HT3 A;  4FJ9 A;  3SAH A;  2BUP A;  3AO2 A;  5E84 A;  4CBW A;  1TL3 A;  3SYZ A;  1NK0 A;  1NOY A;  4YOT A;  3SUN A;  3L2V A;  2VWB A;  4JK8 A;  3QEV A;  3ZSV A;  2E2Q A;  3G4S N;  2OA8 A;  3WNE A;  3WNG A;  1RGI A;  3DLB A;  1JLA A;  4OLB A;  1QHT A;  1A5W A;  4JKA A;  1HRH A;  1WSH A;  2Q0R A;  4OKK A;  4OPH A;  3G10 A;  2A42 A;  2D1K A;  2Q1N A;  3K9K A;  4CZK A;  1S1U A;  1QZ6 A;  1TKX A;  1W7A A;  1UWB A;  4DSK A;  3HK2 A;  3F5T A;  4CJQ A;  4CE9 A;  4JRQ A;  4CJ4 A;  5E41 A;  4LFA K;  4M3W A;  2P9S A;  4CF0 A;  2YHY A;  3OJU A;  3CM5 A;  3AO1 A;  4IOC L;  3CM6 A;  3ZX2 A;  5GAE P;  4E1M A;  3OYE A;  3TAF A;  3FLC O;  1YF5 L;  1JXE A;  3VQP A;  2P9K B;  1REV A;  4BRA A;  1VSE A;  3CCS N;  3H1Q A;  4ISF A;  1NJI O;  3VQB A;  1C1C A;  1WOQ A;  1K8A O;  2XO7 A;  2QEX N;  2G8I A;  1YT3 A;  4MDA A;  4DTM A;  3I8D A;  4CEO A;  1ZBS A;  1DGK N;  3VN5 A;  1D8Y A;  3LDO A;  3P1G A;  1A5V A;  5DM7 L;  4CF2 A;  3QFU A;  1HUX A;  1KC8 O;  5AR0 A;  3PSI A;  3GE1 A;  4CJ7 A;  1K73 O;  1NJX A;  2UU9 K;  3SV3 A;  4H5T A;  4JHD A;  4U7B A;  3J7A P;  4NB4 A;  4LH5 A;  4JS4 A;  3AO4 A;  4M41 A;  2Z1J A;  3CQX A;  3CPW M;  2DFF A;  4KI4 A;  1RCH A;  2PFU A;  2A40 A;  1B9F A;  4O5F A;  4UQG A;  5HL7 L;  3CQ8 A;  4FLT A;  4FJ8 A;  1ZBF A;  3O3F A;  5AQO A;  3HL8 A;  1WSF A;  2G8K A;  3ATV A;  3ZSR A;  4CHY A;  4ISE A;  4DSE A;  2YHB A;  3QNN A;  5EXW A;  4KPY A;  1H1V A;  2XY8 A;  2P9K A;  4H4O A;  3PO4 A;  2D0P A;  4KV8 A;  4MLE A;  4AH9 A;  3SPY A;  1JKH A;  1T8E A;  4AHV A;  3EZ5 A;  1VQO N;  4CBU A;  3VF6 A;  3NCI A;  3V4I A;  3H45 C;  3K0S A;  4CCH A;  3O4Q A;  3MWP A;  4KB1 A;  1UOC A;  2HHW A;  3EKS A;  3HZ6 A;  4DTS A;  4QS8 A;  3DM2 A;  3N4P A;  4JI5 K;  3TAG A;  3JAM O;  4H03 B;  3M8R A;  1HKG A;  3TAR A;  1NGJ A;  4JV5 K;  4HCC A;  1QQC A;  1Y64 A;  1V4T A;  3JYT A;  1YJN N;  4NLB A;  3PV8 A;  3MMV A;  5FRM A;  2YJF A;  3SJH A;  4HUE A;  1O13 A;  1W9H A;  1UA1 A;  3QDK A;  3HVR A;  4DTJ A;  4IOA L;  3D45 A;  1Q9X A;  3CIP A;  1Q82 O;  4U67 L;  2D0O A;  4DUZ K;  2YJE A;  3DLL L;  4IEI A;  3ZYY X;  1C1A A;  5J2P A;  1JJ2 M;  3C6U A;  2DFE A;  3CME N;  3GL1 A;  2Q31 A;  2HBM A;  3ZEU A;  3SUO A;  3DXM B;  4DV4 K;  5M1F A;  3L2R A;  3SLC A;  5EOY A;  4B9U A;  2D0B A;  4CEC A;  3KVG A;  5BRH A;  1TUY A;  2HNZ A;  4ELT A;  2KZZ A;  5FPE A;  2HHV A;  2PYJ A;  4LF9 K;  1JLG A;  2HBK A;  1W97 L;  3HP6 A;  1A5X A;  5FPD A;  3THW A;  1YXQ A;  3MN9 A;  2ZF5 O;  3BZK A;  4I2P A;  3VGM A;  4DTN A;  1TK5 A;  4DR7 K;  3QET A;  1EWQ A;  4ID5 A;  4BR2 A;  1TKD A;  3O9U A;  1LCU A;  1TAU A;  3LP2 A;  4A61 A;  1GLC G;  2VCP A;  1FKP A;  2NRW A;  3PX0 A;  1IV0 A;  3T1A A;  4H0P A;  3J81 O;  5BRF A;  1BIS A;  5J2Q A;  1NK7 A;  3GG4 A;  5LJW A;  1VQ4 N;  1QSL A;  4BC4 A;  4B1W B;  1BHL A;  2CH5 A;  3DRS A;  3RRG A;  4DV3 K;  4M7X A;  1NNE A;  3IFR A;  4B9L A;  5AZJ B;  4CFC A;  3A8Y A;  3S3N A;  1SKS A;  3KWI A;  2Q2R A;  2OPP A;  4CFD A;  3MCP A;  2O8F B;  2Y1J A;  3V9Z A;  3EE9 A;  3LDP A;  3SBT A;  4EHU A;  1XNQ K;  2OPQ A;  4CD3 A;  4M3R A;  1KCF A;  3WXM B;  3MEG A;  4JHD B;  4WCE L;  3SI6 A;  3TAN A;  3CCE N;  4KH6 A;  4EZ9 A;  1DTQ A;  4W5Q A;  1J5O A;  1CZB A;  3R8E A;  3VEY A;  5T7B A;  3WQT A;  1C0F A;  1TK8 A;  4DS4 A;  3AA3 A;  3E9L A;  1HR0 K;  3SQ0 A;  5D3G A;  3TPQ A;  3TSQ A;  4JLH A;  3M5R A;  3KK2 A;  3C65 A;  4FJ7 A;  3LWL A;  5I42 A;  4CGI A;  1YAG A;  3A5N C;  5MLC Q;  3THV A;  4LFB K;  5ELZ A;  3VTI A;  1NGE A;  3QEX A;  3RR7 A;  4ID1 A;  3O9S A;  3SAF A;  3QML A;  1GLB G;  4YHH K;  3BZC A;  3U8X A;  4B3S K;  1JCE A;  4FWO A;  1KRP A;  1IBM K;  3VGL A;  2G8H A;  2HST A;  4BRO A;  4B9M A;  3OVN A;  3K9J A;  1KLN A;  2P9I A;  4ILG B;  2FBT A;  5BRE A;  2QWO A;  1MU2 A;  3NDK A;  2G8W A;  2OTL N;  3VGK A;  3OS2 A;  4OLA A;  3WXL A;  4I6M A;  2XRI A;  2FSK A;  2CGL A;  5M1N A;  3ZET A;  1E3M A;  4CK1 A;  3CD6 N;  1ZBI A;  3HRG A;  3B6P A;  3F9M A;  3LWM A;  1FKO A;  1VSH A;  2HNY A;  1L3T A;  3CMA N;  4FWP A;  5HLF A;  2ATQ A;  2NRT A;  1MA9 B;  3HTV A;  4AQY K;  3CJ7 A;  1WAF A;  3L2U A;  4J2A A;  4HWI A;  3VA3 A;  1OVY A;  3VQC A;  2YNH A;  3OHR A;  1XMQ K;  2IVO A;  3CET A;  3TTD A;  3IAY A;  3DOK A;  1GLJ O;  3QB0 A;  3ZSX A;  5CHI A;  4E7I A;  3SNN A;  2HOE A;  3TTF A;  4KB0 A;  4FZY A;  5HOO A;  3WXI A;  2GEM A;  3EL2 A;  3OBW A;  4YDU C;  4EP4 A;  3CF5 L;  2QXL A;  3LAN A;  4OPJ A;  4CJS A;  3IUC A;  2YX6 A;  4YDU A;  2FF6 A;  2YHX A;  3MDQ A;  3FFI A;  3CHW A;  1BIZ A;  3HPO A;  1IG9 A;  2W40 A;  5HP1 A;  4IJN A;  3VQQ A;  4KTW A;  3DYA A;  5JLF A;  4BRQ A;  2P9U B;  1TAQ A;  3VOV A;  1U2V A;  3Q7C A;  4CGG A;  3U9D A;  1IKV A;  2HHQ A;  1NGA A;  2VYP A;  3K57 A;  5KQ8 A;  3QES A;  1K9M O;  5IWA K;  3CC7 N;  5J2M A;  3FZK A;  3E9P A;  4E7L A;  3ZLJ A;  5CYQ A;  5AQT A;  3AVK A;  4DF8 A;  1J6Z A;  3QIN A;  4K8X A;  2O8D B;  3ASM A;  5KTQ A;  4XIU A;  2F96 A;  3VA0 A;  4WFN L;  2XHB A;  2GUP A;  5FLX O;  1MWM A;  2BE2 A;  3WEE A;  2P9L A;  4DU1 A;  1XMO K;  2EHG A;  3O80 A;  4BQL A;  1LAV A;  3QBW A;  5ADX H;  1SL2 A; 
#chains in the Genus database with same CATH homology
 1IBL K;  4NXN K;  2UU9 K;  2UUA K;  2E5L K;  5IT9 O;  4DR7 K;  3J7A P;  4B3R K;  3OTO K;  4DV5 K;  4DR2 K;  1IBK K;  4DV0 K;  4GKK K;  4LF5 K;  5AJ3 K;  4X62 K;  4X66 K;  4DUY K;  1N32 K;  2UXD K;  3J81 O;  3J80 O;  4DR4 K;  4AQY K;  2UXB K;  4CVN E;  4DR1 K;  1N33 K;  1XMQ K;  2F4V K;  4DV3 K;  4LFC K;  4GKJ K;  3T1H K;  5BR8 K;  1HNX K;  4V19 S;  3T1Y K;  4LF8 K;  4JI6 K;  5A2Q O;  4B3M K;  4JI5 K;  2ZM6 K;  4JI2 K;  3JAM O;  4YY3 K;  1XNQ K;  1FJG K;  5LMN K;  1XNR K;  4JV5 K;  2UUB K;  4LF6 K;  2VQF K;  4DR6 K;  1N34 K;  4X65 K;  4JI1 K;  2UXC K;  2UUC K;  1I94 K;  4DR3 K;  4LF7 K;  4LFA K;  3J7Y P;  1HNZ K;  1N36 K;  2VQE K;  4JI3 K;  4K0K K;  4DV6 K;  4DUZ K;  1HR0 K;  5IWA K;  4X64 K;  4B3T K;  4JI4 K;  5LMU K;  4NXM K;  2HHH K;  4JI0 K;  4KHP K;  4JI7 K;  4LFB K;  4DV4 K;  5LL6 Z;  4OX9 K;  4DV7 K;  5FLX O;  4LF4 K;  4YHH K;  1HNW K;  4B3S K;  4DV1 K;  4LF9 K;  1J5E K;  1IBM K;  1XMO K;  4CW7 B;  4JI8 K;  4DV2 K;  4JYA K;  4DR5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...