1HNZK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnzK00
4GKJK 2ZM6K 4NXMK 4DV4K 4LF7K 4B3RK 5BR8K 4DV0K 1N32K 3T1HK 4AQYK 2VQFK 4DR6K 2E5LK 2UXDK 4JI4K 4X64K 4DV6K 2F4VK 2UXBK 4LFAK 2UUBK 4X65K 1N34K 2UUCK 2HHHK 4KHPK 3J7YP 4DV2K 1J5EK 4CW7B 1XNRK 4JI1K 5IT9O 4JI3K 4B3SK 4JV5K 2UXCK 4YY3K 4LF4K 2UU9K 4LF6K 4JI8K 4OX9K 1N36K 4JI2K 5LL6Z 4DR5K 1XNQK 4B3TK 1IBMK 4DUYK 4B3MK 4DUZK 4DR7K 1HR0K 4JI7K 4LFBK 5AJ3K 1XMQK 1FJGK 5IWAK 4DR3K 5LMUK 4X62K 4LF8K 1N33K 3J81O 4V19S 3JAMO 3OTOK 4LFCK 1IBKK 2VQEK 5LMNK 4DV7K 2UUAK 4NXNK 4JYAK 4YHHK 1HNXK 4LF5K 4DV1K 5FLXO 4DV5K 4K0KK 4LF9K 3J80O 4DV3K 5A2QO 3J7AP 4X66K 3T1YK 4CVNE 1HNWK 4GKKK 4JI0K 1IBLK 4DR2K 4DR1K 1XMOK 4JI6K 1HNZK 1I94K 4JI5K 4DR4K
chains in the Genus database with same CATH superfamily
1LW2A 1RBSA 3HM8A 1NGAA 2OYQA 3G25A 1L3UA 1VSJA 2A40A 1U47A 4K42A 2HBKA 4IFYA 4I9QA 1KFSA 2QKBA 3CF5L 3UKUB 4OGEA 1GLEG 1NGDA 1IKVA 5DM6L 4DV6K 1B92A 3OVNA 4KH5A 2P9LA 4CEQA 3THWB 2HHUA 2NRVA 3P5JA 1EQYA 1SL2A 4F4KA 3DLEA 4B08A 4CJTA 4A61A 4QS7A 1HMVA 4FJKA 3TPQA 4FWNA 4U67L 3H46O 3OYMA 1UWBA 1WSFA 1W7AA 1DGKN 1QQMA 3NGZA 1MA9B 3HJFA 1KVCA 1KFDA 3E9OA 3HYFA 4DLEA 3O6WA 2FF3B 3RR8A 3KWIA 4H0PA 1U49A 4CEEA 4A62A 3O1BA 3ZT0A 4IO9L 2D0CA 3NH0A 3UKRA 3LDSA 2D0OA 3JSMA 3S9HA 4J2EA 1OH6A 3BF1A 4FJMA 3MAQA 5AFUH 3CMEN 4A5AA 1WB9A 4CFAA 1NGBA 1EWQA 3WNFA 4BRQA 2IVPA 1TL3A 3CCVN 1NJWA 3L6QA 4KRFA 1Q81O 1C0UA 4CIEA 1YJ9N 3TAMA 2F9WA 3WEEA 5J2MA 1J54A 1WSIA 3OS0A 3AO2A 1QSLA 1C1AA 3J80O 1K8AO 1WNSA 4PL8A 5KI6A 4CBWA 5CYQA 3LP3A 4GKKK 4FLYA 3EZ5A 1OH5A 4CJ3A 1S1WA 1U2VA 3KLHA 3BUZB 1BIZA 3K5MA 4GV3A 4JI5K 4H0YB 3SUNA 1D9DA 4BWJA 1QHTA 1OVYA 4DV4K 4DLGA 4MO4A 1XC9A 2FBXA 2KHOA 2YI1A 3OA9A 3JYTA 4M7XA 5AZIB 1KC8O 3AGRA 2GWJA 4JI4K 3C65A 4O5FA 1IV0A 3QIPA 3DLLL 3A2FA 1W97L 2YNIA 2YX6A 3LL3A 2O8CA 4OJRA 3SMPA 4ILHA 3ULEB 5BN8A 1RDUA 3RMDA 3AVLA 4DSLA 2X74A 1X9MA 1Q8IA 3ZSZA 4O8UA 4BRFA 4CZHA 4E3SA 3QLHA 2FC0A 2OTLN 5B8HA 3TU5A 1RBVA 3M3ZA 5HOOA 1N36K 1RDDA 2BANA 3WXIA 4H0OA 3QINA 3MX2A 4YOWA 3NDKA 4JRQA 3CMAN 2OZMA 1XNQK 2E2NA 3DYAA 1IBMK 1C0MA 4H03B 3SV3A 4CEOA 1IKYA 4M3ZA 2BH1A 3CM6A 3QEIA 3QEPA 3E1YA 4LF8K 3D2FB 1N33K 5F2RA 3HTVA 4CF0A 4M3XA 4NCGA 2VWJA 2YHXA 2YNFA 1IBKK 3VN5A 3IS9A 3OYEA 2VWBA 4K25A 3AV9A 5KPTA 3HM9A 4PL7A 4FLXA 4KHYA 5M1QA 1X9JA 1VRTA 1JKHA 2V51B 2GEMA 1C6VA 2Z1GA 1TYQB 1YTUA 4DQSA 5M1PA 3ZETB 1KAYA 4Z4HA 1U48A 1RFQA 4MLHA 1KLMA 1QSSA 1RT2A 3NBPA 1BQNA 2E4LA 4CBUA 4RW6A 3VF4A 3PO5A 3A5MC 3OBYA 3G71N 3AVBA 1REVA 3VTHA 3DAWA 5BRHA 3CPEA 3DRSA 3GOIA 3I56N 1J5OA 2QM1A 1HUXA 3HOTA 4B9UA 2IVOA 2E8AA 1QQNA 3IFRA 1NGFA 3S3MA 2E1YA 1VSEA 4HTLA 3CC2N 4KI4A 1KXPA 1XC3A 3RRHA 5K14A 4CFDA 5JVHL 4B9SA 1WBDA 3CHWA 3C6TA 5KGXA 3HVRA 3P38A 1RBTA 4M3YA 1JXBA 2CGJA 4IOCL 2UUBK 4CJQA 3E9PA 2DFHA 3K9KA 3FLCO 4Z4GA 4IJAA 3LDOA 4DFPA 1JCFA 4CJ5A 3HI0A 1J5EK 2HMPA 2VG5A 4IBNA 3KD1E 1X9SA 5IT9O 2NLXA 4CERA 2UXCK 4HWIA 1I3AA 4LC9B 5KTQA 3J7ZO 2UYTA 3QEWA 1BUPA 3AARA 3CCJN 4FOEA 2P51A 4EIAA 1SKWA 5AQPA 2E2OA 4N76A 1UOCA 2KW4A 1YAGA 3WNEA 4CEZA 1JCEA 1YI2N 4FLVA 5BN9A 1JLGA 4RWTA 3SI6A 1HKBA 2KKZA 4BG8A 1ILYA 2Q31A 3GL1A 1J9AA 1S1VA 4E0DA 4BE1A 1OVQA 4JLHA 1HPZA 3VETA 5LMUK 3SUQA 4GNIA 2DFEA 3SBGA 2HF4A 1JJ2M 3VF2A 3I8DA 2Y1JA 5E41A 4OLAA 1K8KB 5M1NA 1LWFA 4ZTFA 2HBJA 4F2SA 1NK5A 3CCUN 1X1PA 3CI5A 2KZZA 4BVPA 2IIRA 3H08A 1Z26A 3VF6A 1BU6O 1T44A 3L4IA 2O8BA 1MWKA 1ASWA 1VQNN 1VQPN 3KTQA 4C1NK 4OPHA 5TKYA 3VQCA 5T7BA 1ZC6A 4A59A 3A0IX 3MN9A 1T05A 4FJ9A 3NMUA 1R59O 4WFAL 4OKKA 3LZIA 1IG8A 1KAXA 4YOUA 4MLEA 2A1RA 3HZ6A 5CE3A 1O1WA 4J2BA 5AQVA 5AZJA 2VG6A 4HUEA 4Q0BA 2OPQA 5I3UA 3T1HK 1VAZA 3MEEA 4GW6A 4JKDA 4I6MB 3MCPA 3OYAA 4BRDA 3DOLA 1T03A 4Z0UA 4E19A 4NLBA 3C94A 4OKJA 5C12A 3OYKA 3E66A 4RW9A 4B1VA 1QS4A 3L2UA 3NF7A 5AQWA 2Q36A 3LDNA 3V6DA 3NFAA 3GBTA 4CGGA 3OYFA 2A41A 4EZ9A 4UQGA 1RDAA 4DQ8A 2X78A 4KV8A 3KK3A 1TV6A 4LF4K 4BR2A 2Q97A 2DTUA 2RF2A 4FM2A 2NUBA 3AVCA 2KZMA 4Z4CA 1GLLO 4J2DA 5KPRA 4AHCA 3O8MA 3MN6A 4DTOA 3QEVA 4A57A 4BRKA 4LFBK 3C95A 1EKEA 2O8DB 4LD0A 3MMVA 4KFBA 1T3VA 1NG9A 2ZJRL 4O44A 3R9PA 1TK5A 3M8QA 5LMNK 2OCEA 3P83D 2OA8A 1HKCA 1O13A 4FZYA 1YVUA 3MN5A 2KFZA 5FDLA 1TL1A 3FZMA 3O3GA 4BR7A 3RRGA 3N4PA 2IOCA 1ASVA 1BQMA 3EY1A 1ESVA 3O9TA 1NKCA 4ELUA 1RILA 3OYBA 2P9NB 2D4WA 1NK9A 3DRRA 4BC5A 3CD6N 2W6LA 4IWVA 2P9IB 3ZSVA 3D2EB 3VQ7A 5AQTA 1S1XA 3O9RA 3L2WA 4XH1A 3LWLA 4KTZA 3IMXA 4OPAA 4IEEA 4GKJK 1YXQA 3CJ1A 4CK3A 1N6QA 2KLAA 3D6RA 5GAGP 4DQPA 1VQKN 4EHTA 1C1BA 4I9LA 5AQRA 4JS5A 3WNHA 4RTFD 3WUHA 1IO2A 3SV4A 3SQ0A 3OYIA 2UXBK 1BDGA 2VG7A 4M45A 1HLUA 2P9UB 3D7EO 4DFKA 2IC3A 1BA0A 3SQ4A 4ID1A 3ZLJA 3GDQA 4CHZA 1NMDA 3H3NO 1HJOA 4AHVA 2HHSA 1Q82O 1VQLN 3QBXA 3O3HA 2OPSA 4ELTA 1BIUA 2GWKA 3THYA 1E4FT 2FSJA 4BRGA 2E20A 1NK8A 3F5TA 5EX5A 1BGXT 4CJVA 1VSKA 1EETA 3AAQA 2QTDA 3LP2A 3CIPA 1TKTA 3R3LA 4WQ4C 3AO1A 2V7ZA 4AHRA 4CF1A 4QOZB 5KQ8A 1OH7A 2YKMA 4EFHA 3O4NA 1SKSA 2G8KA 2D0BA 4H4MA 2HNDA 3THXB 2B4JA 1WBBA 5AJ3K 3HOSA 3K5LA 4BC3A 5IWAK 1NK7A 3V9WA 3H3OB 5HRRA 4FW1A 3VQ9A 5AQJA 4FJHA 1RTJA 4W5TA 5AQXA 2VGNA 3SCXA 1NGJA 3VGKA 5C0YA 3SAHA 1EP4A 2F96A 3CETA 1GLJO 4C8KA 5KGWA 3D45A 5AQOA 1D9FA 3VTIA 2B6AA 4BR0A 4CEFA 4OLBA 3QIOA 1LWEA 4FCYA 4CHNA 3QEXA 5A2QO 1YT3A 2OPRA 1MDUB 3OY9A 4JKFA 1ATSA 4F8RA 4JHDA 3NHGA 5GAHP 1NGIA 4WE1A 3TSPA 3CM5A 1D8YA 4BGBA 3HT3A 3SYZA 3ATVA 1M1KO 3KK2A 3BZKA 5DM7L 3KLIA 1YTAA 1TKXA 3W0LA 1HYVA 4MO5A 2CGLA 2ZF5O 5FROA 1D4XA 3SZ2A 2HHXA 1S9GA 5BPNA 1YHQN 2HMIA 3CJAA 4PKGA 2JGUA 1FW6A 3SAGA 4BC4A 3VPZA 1VSDA 2Z1JA 3V9UA 4AHTA 1QTMA 3KWGA 2BTFA 4DS5A 3ZT3A 3AGKA 4AHUA 3QFPA 3DLBA 5ELZA 4B1WB 3WT0A 4CJEA 3KKRA 4A5BA 2FSKA 1BCOA 2JWKA 3UE5A 4KHQA 1TUYA 5KRTA 1JLFA 4WFBL 3B6PA 4MDAA 2HSTA 5KQDA 5LJVA 1TVRA 3KIOA 4CCHA 2PFUA 2WFBA 4O8KA 1V4SA 2AJQA 3ITHA 4IO8A 5JICA 1S9EA 3S3NA 2W40A 4DUYK 3SNNA 4CFBA 4IKFA 3MWTA 3PIPL 4WQ4A 4DR7K 1FXXA 2WOMA 5BPLA 1UA0A 2P9KB 1DKGD 4KHNA 2QKKA 2D0PA 2RPIA 2QK9A 3A5LC 4M3WA 4B1ZA 3C7NB 4O5BA 3SUPA 2P9LB 3O80A 4JK7A 3AA5X 3LPUA 2WTUA 2QWOA 3T3FA 4FJIA 4PKIA 3WQTA 4LF5K 1LAVA 5HRNA 4GVMA 1N5YA 4O4GA 4HCBA 4L8RB 4FJLA 4OPKA 4M3TA 4YORA 5E84A 1C0TA 3O5BA 3TTFA 2F7TA 2OANA 3KJVA 5CZ2A 3WQUA 2YV0X 3LDLA 4FPBA 2ZGYA 3SJJA 3CXCM 3VEXA 4CIFA 3HBTA 1WUAA 2PBDA 2G8UA 4IDHA 4CJ4A 3C6UA 4O0JA 1QVGM 2HHVA 4I2PA 5JLFA 3ZSRA 4DG1A 3KK7A 4FK4A 1XQSC 4BC2A 4E7KA 2XY7A 3VQBA 4A2AA 1NU0A 1S5JA 4FWRA 4YOVA 3MECA 1HX1A 3O4WA 3CG7A 1ZBFA 2V7YA 1NKEA 1ZBLA 1IJJA 4QS8A 3CCMN 4F2RA 2ITMA 1WAJA 2W6KA 5GAEP 3WEEB 5J2QA 3PV8A 1YJWN 4E89A 2ATQA 1W0HA 2ZJQL 4JV5K 1QZ5A 4EAHD 2QXFA 3G0ZA 2WBNA 3VA0A 2NRHA 3VEVA 4CZKA 3IG1A 1VK0A 4K8ZA 3HPHA 1NGHA 3CCSN 1BOTO 1S6PA 5C42A 1YITN 5BREA 4FJ7A 5DK5A 3EL2A 3VQQA 4FLZA 1RCHA 4E1JA 1DTTA 4F9OA 5CR4A 4FO0A 2Q2RA 3LANA 1GLBG 3HVTA 4KHWA 2OZSA 2FBYA 1VQ7N 1KQSM 4FWLA 3VGLA 2DPNA 1J53A 1WSGA 3S3OA 3ZSQA 3L2RA 1RTDA 3HP9A 3HSTB 2O8CB 3FFIA 3BY5A 4HUFA 4KH6A 3U4LA 2XHBA 1LCUA 4ID5A 3TABA 5AQNA 2EHGA 5AQHA 5I9EB 2GBZA 4A2BA 3ATUA 5CHIA 3EKSA 4BR5A 4DSJA 1SAZA 3PSFA 2PZSA 4KB1A 3VQAA 3KZBA 1HNZK 1EXQA 2ASOA 3ZEUA 3VESA 4C1NI 4CF2A 3OYCA 3QNNA 2ZGZA 1TYQA 5EY4A 3ZETA 2E6MA 3HO1A 4M42A 1G99A 1C1CA 4FLUA 5ADXA 2E5LK 3AO4A 3MX5A 4DS4A 1T7PA 1SL0A 5JS1A 1QZ6A 2IVNA 2OPPA 4DTSA 1NGCA 2QWMA 3L2QA 3DJCA 5C2FA 4H5NA 3U3GA 5BPMA 1RT7A 4CJLA 4GMJB 1VSHA 4U7BA 1K9MO 2GTDA 3DI6A 5AQSA 2QI2A 1U04A 4CZJA 4NLCA 4FK2A 1VSFA 1ZBSA 4CEBA 4H0XB 3G4SN 2PAVA 4K43A 3LALA 3RVCA 2DFFA 3EE8A 3TAQA 3TANA 4JKAA 5LL6Z 3LWMA 4DR5K 4B3MK 5AQQA 1BA1A 4KHUA 4DUZK 2V52B 5BRFA 1NJYA 2IDOA 3DLRA 3K58A 4WYBA 3RSEB 2CGKA 4M41A 3DOKA 3LP0A 3FZLA 1FJGK 1IG9A 3MXMA 2ITGA 4H4OA 1SZ2A 4W5OA 3OTOK 3IKMA 4CJKA 4Z94A 2VQEK 3FZHA 5GIOA 1Q86O 3FFKB 3ZX2A 3B6OA 3W3DA 1P90A 4CHQA 3KD5E 3IUCA 4DB3A 3NF6A 4MFBA 3VMFB 1FK9A 4JD2A 3MN7A 4CESA 1TAUA 3TAFA 1TKDA 3NVKA 4C8MA 1D5AA 1Z25A 1A5WA 3J7AP 1F21A 4YOYA 1YUWA 3T1YK 2CH5A 4CVNE 3QB0A 1LWCA 3CFOA 3H45C 4N47A 4DR2K 3H1VX 3K0SA 3DXMB 5FPEA 3UIQA 4FWPA 3TTCA 4XEIA 4AM7A 1NK4A 1HJRA 4JI6K 2AP1A 4BRMA 1C0GA 1K8KA 4FJGA 1QHAA 3EYZA 5AQFA 1HQUA 3ZSXA 1ATRA 1HRHA 4J2AA 4BRHA 3ZSYA 4PHTX 4C8OA 3TI0A 4I7FA 3RMBA 3F9KA 4LFAK 4KI6A 5I42A 3M5RA 4O55A 3MXJA 4JKBA 3BDPA 2ZE2A 1EX4A 1SL1A 3AA3A 2YHWA 4CK2A 5JS2A 4BACA 1WAFA 3PX0A 2ETJA 5SZTA 1Q9YA 2HVIA 1TK8A 1XHZA 4RW4A 3Q7CA 4NB4A 3O9SA 2XY8A 4I6MA 1A5XA 4IDKA 4YY3K 4AM6A 1IKXA 2P9SB 5FPNA 1BISA 3E01A 2HBLA 4CEAA 4DQQA 3SPYA 2NRRA 4CJUA 4W5QA 1RT5A 4JI2K 3PLAA 4CGHA 3DMJA 4WCEL 5C2DA 1KRPA 1RT3A 4BREA 1U4BA 4XH4A 2E88A 4CJFA 3WXKA 1RDBA 3AY9A 3CCQN 1JL2A 4CZIA 4FVUA 1HKGA 4XIUA 4DR3K 4KO0A 3JAMO 1L5UA 3VOVA 3NAEA 3CJBA 3QBWA 1E4GT 3B8AX 1ASUA 3P1GA 2A6AA 2PYLA 3CJ7A 3LAMA 3EE9A 3MDQA 2QXLA 3U6FA 3UB5A 3QMLA 5AQUA 3K5OA 1U45A 1BCMA 2O8DA 4LH4A 5HROA 4ISEA 4PWDA 3CPWM 4JK9A 5HP1A 4H5VA 2Q0RA 3ZT4A 2YHYA 1IKWA 4QCLA 4BWMA 1WSJA 2A3ZA 1SV5A 1RTHA 3PIOL 4B9MA 4FYDA 3AVJA 3IRXA 3ISNC 5M1KA 2PYJA 4M3UA 4EHUA 2GUIA 1BWFO 1RDWX 4HTUA 4FW2A 3AVFA 3ALYA 3RR7A 3AA2A 2P9NA 3RMAA 3EO3A 4KREA 3I8BA 4X64K 4FJJA 1VSLA 3IAYA 3D2EA 4E1MA 3T69A 1KAZA 4IFVA 1W9HA 1JLBA 3QO9A 4BRNA 4KAZA 4DV2K 4CW7B 3VQ4A 5SWMA 3SK3A 3VQ8A 4ICLA 4FOIA 1JL1A 3KKSA 4R5PA 1Q9XA 2X6SA 4B9TA 4BR4A 1SKRA 2YKNA 3VQEA 2Q0UA 3H6EA 4B8AB 1WLJA 4Y0WA 1RGIA 4BY9C 3DM2A 4B9NA 3SPZA 2JLEA 3V9XA 4LY7A 5ADXH 3GE1A 2HHTA 1GLDG 4NYNA 4DHYA 4BRLA 4V19S 2E2PA 1M90O 3DRPA 3SQ1A 4BROA 3ASMA 4N41A 4DV7K 4B1YB 2HB5A 1JLCA 3VERA 3THXA 5FRMA 4CGJA 4RW8A 4B9QA 2O8EB 3K2PA 1H1VA 2I7PA 3A5OC 4FPAA 4YOTA 2O8FB 5MLCQ 1OH8A 3ZSWA 2W42A 4CZFA 4BDYA 1CXUA 4YOXA 5JVGL 3DLHA 1S1UA 3AVKA 4FL9A 4Y1DA 1VQ9N 2IS3A 2XY5A 4EP4A 1HNVA 5FPMA 1NKBA 2VWKA 1C0FA 4HCCA 1CZAN 1V4TA 3L2VA 3F73A 2ZM6K 4NXMK 4YFUA 2RN2A 3MK6A 1WOQA 4BQZA 3DXKB 5F0XA 4BRCA 3KVGA 4JKGB 4C8NA 4CGFA 1BI4B 4OPJA 3CC4N 2P9PA 4IZ9A 3DWLA 1NK6A 1RBRA 1GOAA 1MWMA 4FJ5A 4IXCA 3CJ9A 1ZBUA 3OYJA 4JK8A 4KBOA 2HHHK 4Z4FA 4JEPA 3J7YP 4YDUC 2NZTA 1X3NA 3OW2M 4F3TA 1E3MA 3FZFA 3PUFA 3ZCMA 2XY6A 1EWRA 1ZXOA 4H0VB 4DSKA 3C6AA 2ZD1A 4BRIA 1FKOA 3TSUA 3QESA 3IDHA 1QSYA 1HYZA 3C0BA 4H5WA 1X3MA 4CJWA 1YJNN 3ID6A 4LF6K 5AQKA 3FZKA 4JKHA 3O1WA 4FLWA 4IOAL 4DTJA 4ZHRA 4HVJA 4DTXA 4B3TK 4ELVA 1BL3A 4ILJA 5KRSA 2H3GX 4WQ5C 2XO7A 5AQLA 4E7HA 4JAXA 1VQ4N 3U3YA 4EZ6A 2OTJN 2YJFA 3UKUA 2FSNA 2Q1NA 3NH2A 3FR0A 4KB0A 1GLAG 4BR9A 3THWA 3MWPA 3ENOA 3NE6A 3LM9A 3RTVA 1T8EA 2UUAK 2QWPA 1RNHA 1LAWA 3S41A 5EOYA 5EVZA 3EN9A 3HRGA 1TUUA 4KTQA 1NGEA 4PKHA 2P9KA 4CZGA 1DLOA 3CCLN 2XRIA 4CF9A 4C23A 2HF3A 4X66K 4IG3A 4H8KA 3C7NA 1IBLK 4BG9A 4FJXA 1TAQA 3SUOA 4JN4A 4NCBA 1B9DA 4M7YA 3V4IA 3RMCA 3BF3A 1L3SA 2G8VA 2Z1IA 2HOEA 4DSIA 3U8XA 3NVMA 3CFRA 1KCFA 4KKOA 1N8RO 3VQ6A 4WF9L 5TKWA 1WSEA 2EWSA 3FGUA 2Y1IA 1VQMN 1IH7A 4DFJA 4CGDA 1K73O 1RT4A 4B1XB 4R79A 3OHRA 2VCPA 3BGRA 3LDPA 5AQYA 3OJSA 4X65K 4E1NA 2RE2A 4E7IA 5GIPA 1MU2A 1TK0A 3CJCA 1QE1A 4CD1A 3OYGA 4AHSA 2HHQA 3P4IA 1RBUA 1CLQA 1XNRK 3C6HA 4JI1K 1DTQA 1VSMA 3UKRB 1RDCA 2QA4N 3TAEA 1GLFO 3KLGA 1YIJN 3OYDA 4YDUA 4FLTA 3WXLA 2G8FA 1VHXA 3O4QA 2UU9K 2B5JA 2Z1HA 2P5OA 5GADP 2NRZA 3V1RA 3QETA 4M3RA 5JLHA 4FZXC 4LSNA 5E26A 1NK0A 1L3VA 3ZT2A 1S1TA 1HR0K 3ULDA 1S72N 3PSIA 3MEGA 4J8FA 1RT1A 5AZIA 3I0SA 2VGMA 4ISGA 4FSVA 3ZX0A 1UA1A 1JCGA 4Z4EA 3H1QA 1GOBA 4WQ5A 1I39A 4MDBA 4JNEA 1LW0A 2F8SA 3AVNA 2W41A 3OYHA 4NYFA 3ULEA 4CD3A 4BE0A 1HNXK 3K9JA 5AQMA 5C24A 1U2VB 1XWLA 1UAXA 5FLXO 1P8ZA 2E1ZA 4DU1A 1EO1A 3M8SA 2A5XA 1NM1A 4K0KK 2ZQBA 4F3OA 4DFMA 3ENHA 3OYLA 3LM2A 3SBTA 2QWLA 4E7JA 1QQCA 5M1FA 4M63C 2QWRA 5HLFA 1Q18A 2KFNA 2FF6A 3BZCA 4B9VA 1KLNA 4FWQA 3U9ZA 3ZYYX 5M1OA 4GVEA 3QNOA 4K8XA 2WC9A 2I5JA 2JWLA 3O3FA 4DR4K 1VSIA 3HSCA 4C8LA 4AF1A 5C15A 3OS2A 2NRXA 4FWMA 1B9FA 3PY8A 4DV0K 3VQPA 1BHLA 3D2FA 4AQYK 2FXUA 2I7NA 2ASMA 4BRPA 1NMNA 4KH4A 5C25A 2F4VK 4OVLA 3G6EN 5J2NA 3AA4A 4CK1A 1BO5O 1U6ZA 4KHPK 3G10A 1NJIO 2GUPA 3HPGA 1X9WA 1QVFM 4LSLA 3ENBA 3I0RA 1VQ8N 1YF5L 3QICA 4W5RA 4DTNA 4WFNL 1CZBA 2BUPA 4FJNA 4JS4A 4BGAA 2QW9A 3TSQA 1NOZA 1FKPA 3DLKA 1Z6RA 4OX9K 4AILC 2PY5A 3KLFA 1ZBHA 4IG0A 2BGGA 2O4GA 3ZEUB 5CZ1A 3AVAA 4H0TB 4L3QA 1XUPO 4QS9A 3VQ5A 5LY3A 5D3GA 2ASPA 5FPDA 5KPZA 4B3OA 4EP5A 3EEQA 3VEYA 4CBXA 4HUGA 3TTDA 1KD1O 1HNIA 3L8BA 1VQON 2KQ2A 4FM0A 4DSFA 3FE1A 4BDZA 3CCEN 3M6GA 1Y64A 5BRDA 4MQ3A 1NBWA 4JKEA 4ISFA 3RSEA 3EZWA 3PX6A 1KSPA 1BG3A 5HRSA 3PX4A 4I2QA 4JI0K 4CI6A 2IAJA 1S6QA 3JS6A 1OKJA 3HK2A 2D1KA 4CIGA 4Q5VA 2G8WA 2E2QA 2P1JA 3OYNA 4FVMA 4OKEA 3DLGA 4XH5A 4LF7K 4B3RK 5CY4A 2HNYA 4CZMA 4CHYA 5BR8K 2R7YA 3P39A 5LJWA 1NJZA 3CQYA 5J1EA 4CECA 4DTRA 3LPTA 2A1SA 3DXMA 4DR6K 4DQIA 4AH9A 3I55N 3PO4A 1NWKA 1Z05A 2VYPA 1S3XA 4ZTJA 3GG4A 3O9UA 4BQLA 4E7LA 1VQ5N 5CYMA 3HP6A 5HBMA 1GOCA 3O08A 3J8AA 4JD2B 3WXMB 1JLAA 1G15A 1JLEA 3LP1A 4G1QA 4DSEA 4B3SK 4IFEA 2O4IA 3T19A 5BR9A 1TKZA 3R1XA 1WN7A 2X6NA 2HHWA 1VQ6N 3THVA 3VENA 4DU4A 4B8CA 3CERA 2FBVA 3AVMA 3LDQA 4DTPA 4QAGA 2YJEA 1VRUA 1RTIA 1LOTB 5FRNA 5AQIA 1XMQK 4CZEA 3AVGA 3VA3A 3BEXA 4TSXA 2P9SA 3EKUA 3J81O 3Q7BA 3F9MA 2O8BB 4CFCA 3MEDA 3V81A 4GY2B 4LFCK 2CH6A 1CXQA 4YHHK 3A5NC 1DT9A 3CFPA 3ZT1A 2E6LA 5EXWA 4DV1K 2DY4A 4KHSA 5AQGA 3R6MA 4CJPA 1ZBIA 4BVOA 4LF9K 1SS6A 4CE9A 4W5NA 2RKIA 3F2KA 5AZJB 3M8RA 4DQRA 1HNWK 1JXEA 2WUSA 4DR1K 4DKWA 2YNGA 4FJ8A 3U9DA 2HBMA 5C10A 4BDPA 3HXMA 2HVHA 3SJHA 1T6CA 3VEZA 4GV6A 1N32K 3T1AA 2QEXN 3L3VA 2BDPA 5AFUA 1WSHA 3NH1A 3V9SA 2UXDK 4CZLA 1NNEA 4H5RA 3K59A 1Y97A 2D5RA 1JLQA 2YHBA 2Q3SA 4RCHA 4PUOA 1KVBA 3VEOA 4FWOA 3M8PA 4FK0A 3K57A 4DCHA 1ITGA 3ZX3A 2QWNA 3LZJA 5EU7A 5AQZA 3AVIA 3NF9A 1KVAA 2P9IA 4DU3A 2BE2A 4G9ZA 3AVHA 2YNHA 5F1XA 1NLVA 2YHAA 4CHOA 2P5GA 4KTWA 4JI7K 3I33A 2GX9A 1T6DA 2F9TA 3D0PA 4LH5A 3AO3A 5H1SQ 3WXJA 4X62K 4IJNA 3JXUA 4IOXA 5JMVA 2P9UA 2EX3A 3VQDA 2WONA 5J2PA 4NXNK 4JYAK 3CCRN 3HL8A 3OBWA 3TAGA 4Y1CA 4DF8A 4BRAA 4Z4IA 1HPMA 4FXDA 4FWSA 4KPYA 4IEIA 3SQ2A 2IGIA 2RHKA 4O0IA 4CEDA 3L0QA 4NO7A 4ILGB 4FWKA 4H5TA 2NRWA 4RW7A 4DTMA 3NCIA 1XMOK 3ZSOA 4JKCA 4CJRA 4CJSA 3K5NA 2NRTA 4CF8A 1S22A 3AAPA 5DMRA 2O8EA 1QQOA 2HNZA 3WNGA 1ZYQA 3THYB 1LV5A 5HRPA 4JRPA 2O8FA 4PY5A 2G8HA 4CJ7A 3TWHA 3L3UA 2VQFK 3TAPA 2QWQA 5GINA 1J6ZA 4OO1J 1L3TA 4OGCA 2A42A 3HPOA 2G8IA 4DF4A 1HYSA 1ATNA 3VGMA 4FZZA 2NNWA 1N34K 2UUCK 3AO5A 3ID8A 2YCHA 3CQ8A 3CC7N 3V1QA 1KTQA 5HL7L 3MCAB 2LSNA 3DXKA 3CYMA 2GV9A 3NGYA 4JKGA 3A8YA 1BI4A 3QDKA 4DMNA 4JI3K 2HW3A 3KHYA 2D0AA 3NGIA 1K6YA 4B9LA 4GV9A 5AR0A 4JI8K 1TGOA 3L4QA 4UY8O 3SMSA 1Q7YO 1XI1A 3KK1A 4N56A 3OJUA 2FLOA 2GELA 3M1FA 3NF8A 2ZJPL 1DEJA 2AA4A 3T7ZA 4BE2A 4B1UB 1W2BM 4K41A 4YNQA 3V1OA 3P31A 3QFUA 1SQKA 2KTQA 4HHTA 2P9PB 3TARA 2ZWHA 4JHDB 3R8EA 3OS1A 3V9ZA 1A5VA 4PA1A 4FM1A 4CHPA 4CGIA 1GLCG 2F8TA 1XHXA 1YVNA 1SUQA 4DWIA 1NJXA 4RG8A 3SAFA 4DV5K 4DTUA 1RT6A 4N5SA 3N4QA 3BP8A 4DV3K 3KLEA 3RWUA 3LAKA 4PQUA 1NOYA 3VEWA 1CZ9A 2FBTA 3SLCA 4NCAA 2J4RA 3CQXA 3MXIA 3O9QA 1R0AA 1HQEA 1NGGA 3TR8A 3QERA 1I94K 3E9LA
chains in the Genus database with same CATH topology
4GKJK 2ZM6K 4NXMK 4DV4K 4LF7K 4B3RK 5BR8K 4DV0K 1N32K 3T1HK 4AQYK 2VQFK 4DR6K 2E5LK 2UXDK 4JI4K 4X64K 4DV6K 2F4VK 2UXBK 4LFAK 2UUBK 4X65K 1N34K 2UUCK 2HHHK 4KHPK 3J7YP 4DV2K 1J5EK 4CW7B 1XNRK 4JI1K 5IT9O 4JI3K 4B3SK 4JV5K 2UXCK 4YY3K 4LF4K 2UU9K 4LF6K 4JI8K 4OX9K 1N36K 4JI2K 5LL6Z 4DR5K 1XNQK 4B3TK 1IBMK 4DUYK 4B3MK 4DUZK 4DR7K 1HR0K 4JI7K 4LFBK 5AJ3K 1XMQK 1FJGK 5IWAK 4DR3K 5LMUK 4X62K 4LF8K 1N33K 3J81O 4V19S 3JAMO 3OTOK 4LFCK 1IBKK 2VQEK 5LMNK 4DV7K 2UUAK 4NXNK 4JYAK 4YHHK 1HNXK 4LF5K 4DV1K 5FLXO 4DV5K 4K0KK 4LF9K 3J80O 4DV3K 5A2QO 3J7AP 4X66K 3T1YK 4CVNE 1HNWK 4GKKK 4JI0K 1IBLK 4DR2K 4DR1K 1XMOK 4JI6K 1HNZK 1I94K 4JI5K 4DR4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ K;  2ZM6 K;  4NXM K;  4DV4 K;  4LF7 K;  4B3R K;  5BR8 K;  4DV0 K;  1N32 K;  3T1H K;  4AQY K;  2VQF K;  4DR6 K;  2E5L K;  2UXD K;  4JI4 K;  4X64 K;  4DV6 K;  2F4V K;  2UXB K;  4LFA K;  2UUB K;  4X65 K;  1N34 K;  2UUC K;  2HHH K;  4KHP K;  3J7Y P;  4DV2 K;  1J5E K;  4CW7 B;  1XNR K;  4JI1 K;  5IT9 O;  4JI3 K;  4B3S K;  4JV5 K;  2UXC K;  4YY3 K;  4LF4 K;  2UU9 K;  4LF6 K;  4JI8 K;  4OX9 K;  1N36 K;  4JI2 K;  5LL6 Z;  4DR5 K;  1XNQ K;  4B3T K;  1IBM K;  4DUY K;  4B3M K;  4DUZ K;  4DR7 K;  1HR0 K;  4JI7 K;  4LFB K;  5AJ3 K;  1XMQ K;  1FJG K;  5IWA K;  4DR3 K;  5LMU K;  4X62 K;  4LF8 K;  1N33 K;  3J81 O;  4V19 S;  3JAM O;  3OTO K;  4LFC K;  1IBK K;  2VQE K;  5LMN K;  4DV7 K;  2UUA K;  4NXN K;  4JYA K;  4YHH K;  1HNX K;  4LF5 K;  4DV1 K;  5FLX O;  4DV5 K;  4K0K K;  4LF9 K;  3J80 O;  4DV3 K;  5A2Q O;  3J7A P;  4X66 K;  3T1Y K;  4CVN E;  1HNW K;  4GKK K;  4JI0 K;  1IBL K;  4DR2 K;  4DR1 K;  1XMO K;  4JI6 K;  1HNZ K;  1I94 K;  4JI5 K;  4DR4 K; 
#chains in the Genus database with same CATH topology
 1LW2 A;  1RBS A;  3HM8 A;  1NGA A;  2OYQ A;  3G25 A;  1L3U A;  1VSJ A;  2A40 A;  1U47 A;  4K42 A;  2HBK A;  4IFY A;  4I9Q A;  1KFS A;  2QKB A;  3CF5 L;  3UKU B;  4OGE A;  1GLE G;  1NGD A;  1IKV A;  5DM6 L;  4DV6 K;  1B92 A;  3OVN A;  4KH5 A;  2P9L A;  4CEQ A;  3THW B;  2HHU A;  2NRV A;  3P5J A;  1EQY A;  1SL2 A;  4F4K A;  3DLE A;  4B08 A;  4CJT A;  4A61 A;  4QS7 A;  1HMV A;  4FJK A;  3TPQ A;  4FWN A;  4U67 L;  3H46 O;  3OYM A;  1UWB A;  1WSF A;  1W7A A;  1DGK N;  1QQM A;  3NGZ A;  1MA9 B;  3HJF A;  1KVC A;  1KFD A;  3E9O A;  3HYF A;  4DLE A;  3O6W A;  2FF3 B;  3RR8 A;  3KWI A;  4H0P A;  1U49 A;  4CEE A;  4A62 A;  3O1B A;  3ZT0 A;  4IO9 L;  2D0C A;  3NH0 A;  3UKR A;  3LDS A;  2D0O A;  3JSM A;  3S9H A;  4J2E A;  1OH6 A;  3BF1 A;  4FJM A;  3MAQ A;  5AFU H;  3CME N;  4A5A A;  1WB9 A;  4CFA A;  1NGB A;  1EWQ A;  3WNF A;  4BRQ A;  2IVP A;  1TL3 A;  3CCV N;  1NJW A;  3L6Q A;  4KRF A;  1Q81 O;  1C0U A;  4CIE A;  1YJ9 N;  3TAM A;  2F9W A;  3WEE A;  5J2M A;  1J54 A;  1WSI A;  3OS0 A;  3AO2 A;  1QSL A;  1C1A A;  3J80 O;  1K8A O;  1WNS A;  4PL8 A;  5KI6 A;  4CBW A;  5CYQ A;  3LP3 A;  4GKK K;  4FLY A;  3EZ5 A;  1OH5 A;  4CJ3 A;  1S1W A;  1U2V A;  3KLH A;  3BUZ B;  1BIZ A;  3K5M A;  4GV3 A;  4JI5 K;  4H0Y B;  3SUN A;  1D9D A;  4BWJ A;  1QHT A;  1OVY A;  4DV4 K;  4DLG A;  4MO4 A;  1XC9 A;  2FBX A;  2KHO A;  2YI1 A;  3OA9 A;  3JYT A;  4M7X A;  5AZI B;  1KC8 O;  3AGR A;  2GWJ A;  4JI4 K;  3C65 A;  4O5F A;  1IV0 A;  3QIP A;  3DLL L;  3A2F A;  1W97 L;  2YNI A;  2YX6 A;  3LL3 A;  2O8C A;  4OJR A;  3SMP A;  4ILH A;  3ULE B;  5BN8 A;  1RDU A;  3RMD A;  3AVL A;  4DSL A;  2X74 A;  1X9M A;  1Q8I A;  3ZSZ A;  4O8U A;  4BRF A;  4CZH A;  4E3S A;  3QLH A;  2FC0 A;  2OTL N;  5B8H A;  3TU5 A;  1RBV A;  3M3Z A;  5HOO A;  1N36 K;  1RDD A;  2BAN A;  3WXI A;  4H0O A;  3QIN A;  3MX2 A;  4YOW A;  3NDK A;  4JRQ A;  3CMA N;  2OZM A;  1XNQ K;  2E2N A;  3DYA A;  1IBM K;  1C0M A;  4H03 B;  3SV3 A;  4CEO A;  1IKY A;  4M3Z A;  2BH1 A;  3CM6 A;  3QEI A;  3QEP A;  3E1Y A;  4LF8 K;  3D2F B;  1N33 K;  5F2R A;  3HTV A;  4CF0 A;  4M3X A;  4NCG A;  2VWJ A;  2YHX A;  2YNF A;  1IBK K;  3VN5 A;  3IS9 A;  3OYE A;  2VWB A;  4K25 A;  3AV9 A;  5KPT A;  3HM9 A;  4PL7 A;  4FLX A;  4KHY A;  5M1Q A;  1X9J A;  1VRT A;  1JKH A;  2V51 B;  2GEM A;  1C6V A;  2Z1G A;  1TYQ B;  1YTU A;  4DQS A;  5M1P A;  3ZET B;  1KAY A;  4Z4H A;  1U48 A;  1RFQ A;  4MLH A;  1KLM A;  1QSS A;  1RT2 A;  3NBP A;  1BQN A;  2E4L A;  4CBU A;  4RW6 A;  3VF4 A;  3PO5 A;  3A5M C;  3OBY A;  3G71 N;  3AVB A;  1REV A;  3VTH A;  3DAW A;  5BRH A;  3CPE A;  3DRS A;  3GOI A;  3I56 N;  1J5O A;  2QM1 A;  1HUX A;  3HOT A;  4B9U A;  2IVO A;  2E8A A;  1QQN A;  3IFR A;  1NGF A;  3S3M A;  2E1Y A;  1VSE A;  4HTL A;  3CC2 N;  4KI4 A;  1KXP A;  1XC3 A;  3RRH A;  5K14 A;  4CFD A;  5JVH L;  4B9S A;  1WBD A;  3CHW A;  3C6T A;  5KGX A;  3HVR A;  3P38 A;  1RBT A;  4M3Y A;  1JXB A;  2CGJ A;  4IOC L;  2UUB K;  4CJQ A;  3E9P A;  2DFH A;  3K9K A;  3FLC O;  4Z4G A;  4IJA A;  3LDO A;  4DFP A;  1JCF A;  4CJ5 A;  3HI0 A;  1J5E K;  2HMP A;  2VG5 A;  4IBN A;  3KD1 E;  1X9S A;  5IT9 O;  2NLX A;  4CER A;  2UXC K;  4HWI A;  1I3A A;  4LC9 B;  5KTQ A;  3J7Z O;  2UYT A;  3QEW A;  1BUP A;  3AAR A;  3CCJ N;  4FOE A;  2P51 A;  4EIA A;  1SKW A;  5AQP A;  2E2O A;  4N76 A;  1UOC A;  2KW4 A;  1YAG A;  3WNE A;  4CEZ A;  1JCE A;  1YI2 N;  4FLV A;  5BN9 A;  1JLG A;  4RWT A;  3SI6 A;  1HKB A;  2KKZ A;  4BG8 A;  1ILY A;  2Q31 A;  3GL1 A;  1J9A A;  1S1V A;  4E0D A;  4BE1 A;  1OVQ A;  4JLH A;  1HPZ A;  3VET A;  5LMU K;  3SUQ A;  4GNI A;  2DFE A;  3SBG A;  2HF4 A;  1JJ2 M;  3VF2 A;  3I8D A;  2Y1J A;  5E41 A;  4OLA A;  1K8K B;  5M1N A;  1LWF A;  4ZTF A;  2HBJ A;  4F2S A;  1NK5 A;  3CCU N;  1X1P A;  3CI5 A;  2KZZ A;  4BVP A;  2IIR A;  3H08 A;  1Z26 A;  3VF6 A;  1BU6 O;  1T44 A;  3L4I A;  2O8B A;  1MWK A;  1ASW A;  1VQN N;  1VQP N;  3KTQ A;  4C1N K;  4OPH A;  5TKY A;  3VQC A;  5T7B A;  1ZC6 A;  4A59 A;  3A0I X;  3MN9 A;  1T05 A;  4FJ9 A;  3NMU A;  1R59 O;  4WFA L;  4OKK A;  3LZI A;  1IG8 A;  1KAX A;  4YOU A;  4MLE A;  2A1R A;  3HZ6 A;  5CE3 A;  1O1W A;  4J2B A;  5AQV A;  5AZJ A;  2VG6 A;  4HUE A;  4Q0B A;  2OPQ A;  5I3U A;  3T1H K;  1VAZ A;  3MEE A;  4GW6 A;  4JKD A;  4I6M B;  3MCP A;  3OYA A;  4BRD A;  3DOL A;  1T03 A;  4Z0U A;  4E19 A;  4NLB A;  3C94 A;  4OKJ A;  5C12 A;  3OYK A;  3E66 A;  4RW9 A;  4B1V A;  1QS4 A;  3L2U A;  3NF7 A;  5AQW A;  2Q36 A;  3LDN A;  3V6D A;  3NFA A;  3GBT A;  4CGG A;  3OYF A;  2A41 A;  4EZ9 A;  4UQG A;  1RDA A;  4DQ8 A;  2X78 A;  4KV8 A;  3KK3 A;  1TV6 A;  4LF4 K;  4BR2 A;  2Q97 A;  2DTU A;  2RF2 A;  4FM2 A;  2NUB A;  3AVC A;  2KZM A;  4Z4C A;  1GLL O;  4J2D A;  5KPR A;  4AHC A;  3O8M A;  3MN6 A;  4DTO A;  3QEV A;  4A57 A;  4BRK A;  4LFB K;  3C95 A;  1EKE A;  2O8D B;  4LD0 A;  3MMV A;  4KFB A;  1T3V A;  1NG9 A;  2ZJR L;  4O44 A;  3R9P A;  1TK5 A;  3M8Q A;  5LMN K;  2OCE A;  3P83 D;  2OA8 A;  1HKC A;  1O13 A;  4FZY A;  1YVU A;  3MN5 A;  2KFZ A;  5FDL A;  1TL1 A;  3FZM A;  3O3G A;  4BR7 A;  3RRG A;  3N4P A;  2IOC A;  1ASV A;  1BQM A;  3EY1 A;  1ESV A;  3O9T A;  1NKC A;  4ELU A;  1RIL A;  3OYB A;  2P9N B;  2D4W A;  1NK9 A;  3DRR A;  4BC5 A;  3CD6 N;  2W6L A;  4IWV A;  2P9I B;  3ZSV A;  3D2E B;  3VQ7 A;  5AQT A;  1S1X A;  3O9R A;  3L2W A;  4XH1 A;  3LWL A;  4KTZ A;  3IMX A;  4OPA A;  4IEE A;  4GKJ K;  1YXQ A;  3CJ1 A;  4CK3 A;  1N6Q A;  2KLA A;  3D6R A;  5GAG P;  4DQP A;  1VQK N;  4EHT A;  1C1B A;  4I9L A;  5AQR A;  4JS5 A;  3WNH A;  4RTF D;  3WUH A;  1IO2 A;  3SV4 A;  3SQ0 A;  3OYI A;  2UXB K;  1BDG A;  2VG7 A;  4M45 A;  1HLU A;  2P9U B;  3D7E O;  4DFK A;  2IC3 A;  1BA0 A;  3SQ4 A;  4ID1 A;  3ZLJ A;  3GDQ A;  4CHZ A;  1NMD A;  3H3N O;  1HJO A;  4AHV A;  2HHS A;  1Q82 O;  1VQL N;  3QBX A;  3O3H A;  2OPS A;  4ELT A;  1BIU A;  2GWK A;  3THY A;  1E4F T;  2FSJ A;  4BRG A;  2E20 A;  1NK8 A;  3F5T A;  5EX5 A;  1BGX T;  4CJV A;  1VSK A;  1EET A;  3AAQ A;  2QTD A;  3LP2 A;  3CIP A;  1TKT A;  3R3L A;  4WQ4 C;  3AO1 A;  2V7Z A;  4AHR A;  4CF1 A;  4QOZ B;  5KQ8 A;  1OH7 A;  2YKM A;  4EFH A;  3O4N A;  1SKS A;  2G8K A;  2D0B A;  4H4M A;  2HND A;  3THX B;  2B4J A;  1WBB A;  5AJ3 K;  3HOS A;  3K5L A;  4BC3 A;  5IWA K;  1NK7 A;  3V9W A;  3H3O B;  5HRR A;  4FW1 A;  3VQ9 A;  5AQJ A;  4FJH A;  1RTJ A;  4W5T A;  5AQX A;  2VGN A;  3SCX A;  1NGJ A;  3VGK A;  5C0Y A;  3SAH A;  1EP4 A;  2F96 A;  3CET A;  1GLJ O;  4C8K A;  5KGW A;  3D45 A;  5AQO A;  1D9F A;  3VTI A;  2B6A A;  4BR0 A;  4CEF A;  4OLB A;  3QIO A;  1LWE A;  4FCY A;  4CHN A;  3QEX A;  5A2Q O;  1YT3 A;  2OPR A;  1MDU B;  3OY9 A;  4JKF A;  1ATS A;  4F8R A;  4JHD A;  3NHG A;  5GAH P;  1NGI A;  4WE1 A;  3TSP A;  3CM5 A;  1D8Y A;  4BGB A;  3HT3 A;  3SYZ A;  3ATV A;  1M1K O;  3KK2 A;  3BZK A;  5DM7 L;  3KLI A;  1YTA A;  1TKX A;  3W0L A;  1HYV A;  4MO5 A;  2CGL A;  2ZF5 O;  5FRO A;  1D4X A;  3SZ2 A;  2HHX A;  1S9G A;  5BPN A;  1YHQ N;  2HMI A;  3CJA A;  4PKG A;  2JGU A;  1FW6 A;  3SAG A;  4BC4 A;  3VPZ A;  1VSD A;  2Z1J A;  3V9U A;  4AHT A;  1QTM A;  3KWG A;  2BTF A;  4DS5 A;  3ZT3 A;  3AGK A;  4AHU A;  3QFP A;  3DLB A;  5ELZ A;  4B1W B;  3WT0 A;  4CJE A;  3KKR A;  4A5B A;  2FSK A;  1BCO A;  2JWK A;  3UE5 A;  4KHQ A;  1TUY A;  5KRT A;  1JLF A;  4WFB L;  3B6P A;  4MDA A;  2HST A;  5KQD A;  5LJV A;  1TVR A;  3KIO A;  4CCH A;  2PFU A;  2WFB A;  4O8K A;  1V4S A;  2AJQ A;  3ITH A;  4IO8 A;  5JIC A;  1S9E A;  3S3N A;  2W40 A;  4DUY K;  3SNN A;  4CFB A;  4IKF A;  3MWT A;  3PIP L;  4WQ4 A;  4DR7 K;  1FXX A;  2WOM A;  5BPL A;  1UA0 A;  2P9K B;  1DKG D;  4KHN A;  2QKK A;  2D0P A;  2RPI A;  2QK9 A;  3A5L C;  4M3W A;  4B1Z A;  3C7N B;  4O5B A;  3SUP A;  2P9L B;  3O80 A;  4JK7 A;  3AA5 X;  3LPU A;  2WTU A;  2QWO A;  3T3F A;  4FJI A;  4PKI A;  3WQT A;  4LF5 K;  1LAV A;  5HRN A;  4GVM A;  1N5Y A;  4O4G A;  4HCB A;  4L8R B;  4FJL A;  4OPK A;  4M3T A;  4YOR A;  5E84 A;  1C0T A;  3O5B A;  3TTF A;  2F7T A;  2OAN A;  3KJV A;  5CZ2 A;  3WQU A;  2YV0 X;  3LDL A;  4FPB A;  2ZGY A;  3SJJ A;  3CXC M;  3VEX A;  4CIF A;  3HBT A;  1WUA A;  2PBD A;  2G8U A;  4IDH A;  4CJ4 A;  3C6U A;  4O0J A;  1QVG M;  2HHV A;  4I2P A;  5JLF A;  3ZSR A;  4DG1 A;  3KK7 A;  4FK4 A;  1XQS C;  4BC2 A;  4E7K A;  2XY7 A;  3VQB A;  4A2A A;  1NU0 A;  1S5J A;  4FWR A;  4YOV A;  3MEC A;  1HX1 A;  3O4W A;  3CG7 A;  1ZBF A;  2V7Y A;  1NKE A;  1ZBL A;  1IJJ A;  4QS8 A;  3CCM N;  4F2R A;  2ITM A;  1WAJ A;  2W6K A;  5GAE P;  3WEE B;  5J2Q A;  3PV8 A;  1YJW N;  4E89 A;  2ATQ A;  1W0H A;  2ZJQ L;  4JV5 K;  1QZ5 A;  4EAH D;  2QXF A;  3G0Z A;  2WBN A;  3VA0 A;  2NRH A;  3VEV A;  4CZK A;  3IG1 A;  1VK0 A;  4K8Z A;  3HPH A;  1NGH A;  3CCS N;  1BOT O;  1S6P A;  5C42 A;  1YIT N;  5BRE A;  4FJ7 A;  5DK5 A;  3EL2 A;  3VQQ A;  4FLZ A;  1RCH A;  4E1J A;  1DTT A;  4F9O A;  5CR4 A;  4FO0 A;  2Q2R A;  3LAN A;  1GLB G;  3HVT A;  4KHW A;  2OZS A;  2FBY A;  1VQ7 N;  1KQS M;  4FWL A;  3VGL A;  2DPN A;  1J53 A;  1WSG A;  3S3O A;  3ZSQ A;  3L2R A;  1RTD A;  3HP9 A;  3HST B;  2O8C B;  3FFI A;  3BY5 A;  4HUF A;  4KH6 A;  3U4L A;  2XHB A;  1LCU A;  4ID5 A;  3TAB A;  5AQN A;  2EHG A;  5AQH A;  5I9E B;  2GBZ A;  4A2B A;  3ATU A;  5CHI A;  3EKS A;  4BR5 A;  4DSJ A;  1SAZ A;  3PSF A;  2PZS A;  4KB1 A;  3VQA A;  3KZB A;  1HNZ K;  1EXQ A;  2ASO A;  3ZEU A;  3VES A;  4C1N I;  4CF2 A;  3OYC A;  3QNN A;  2ZGZ A;  1TYQ A;  5EY4 A;  3ZET A;  2E6M A;  3HO1 A;  4M42 A;  1G99 A;  1C1C A;  4FLU A;  5ADX A;  2E5L K;  3AO4 A;  3MX5 A;  4DS4 A;  1T7P A;  1SL0 A;  5JS1 A;  1QZ6 A;  2IVN A;  2OPP A;  4DTS A;  1NGC A;  2QWM A;  3L2Q A;  3DJC A;  5C2F A;  4H5N A;  3U3G A;  5BPM A;  1RT7 A;  4CJL A;  4GMJ B;  1VSH A;  4U7B A;  1K9M O;  2GTD A;  3DI6 A;  5AQS A;  2QI2 A;  1U04 A;  4CZJ A;  4NLC A;  4FK2 A;  1VSF A;  1ZBS A;  4CEB A;  4H0X B;  3G4S N;  2PAV A;  4K43 A;  3LAL A;  3RVC A;  2DFF A;  3EE8 A;  3TAQ A;  3TAN A;  4JKA A;  5LL6 Z;  3LWM A;  4DR5 K;  4B3M K;  5AQQ A;  1BA1 A;  4KHU A;  4DUZ K;  2V52 B;  5BRF A;  1NJY A;  2IDO A;  3DLR A;  3K58 A;  4WYB A;  3RSE B;  2CGK A;  4M41 A;  3DOK A;  3LP0 A;  3FZL A;  1FJG K;  1IG9 A;  3MXM A;  2ITG A;  4H4O A;  1SZ2 A;  4W5O A;  3OTO K;  3IKM A;  4CJK A;  4Z94 A;  2VQE K;  3FZH A;  5GIO A;  1Q86 O;  3FFK B;  3ZX2 A;  3B6O A;  3W3D A;  1P90 A;  4CHQ A;  3KD5 E;  3IUC A;  4DB3 A;  3NF6 A;  4MFB A;  3VMF B;  1FK9 A;  4JD2 A;  3MN7 A;  4CES A;  1TAU A;  3TAF A;  1TKD A;  3NVK A;  4C8M A;  1D5A A;  1Z25 A;  1A5W A;  3J7A P;  1F21 A;  4YOY A;  1YUW A;  3T1Y K;  2CH5 A;  4CVN E;  3QB0 A;  1LWC A;  3CFO A;  3H45 C;  4N47 A;  4DR2 K;  3H1V X;  3K0S A;  3DXM B;  5FPE A;  3UIQ A;  4FWP A;  3TTC A;  4XEI A;  4AM7 A;  1NK4 A;  1HJR A;  4JI6 K;  2AP1 A;  4BRM A;  1C0G A;  1K8K A;  4FJG A;  1QHA A;  3EYZ A;  5AQF A;  1HQU A;  3ZSX A;  1ATR A;  1HRH A;  4J2A A;  4BRH A;  3ZSY A;  4PHT X;  4C8O A;  3TI0 A;  4I7F A;  3RMB A;  3F9K A;  4LFA K;  4KI6 A;  5I42 A;  3M5R A;  4O55 A;  3MXJ A;  4JKB A;  3BDP A;  2ZE2 A;  1EX4 A;  1SL1 A;  3AA3 A;  2YHW A;  4CK2 A;  5JS2 A;  4BAC A;  1WAF A;  3PX0 A;  2ETJ A;  5SZT A;  1Q9Y A;  2HVI A;  1TK8 A;  1XHZ A;  4RW4 A;  3Q7C A;  4NB4 A;  3O9S A;  2XY8 A;  4I6M A;  1A5X A;  4IDK A;  4YY3 K;  4AM6 A;  1IKX A;  2P9S B;  5FPN A;  1BIS A;  3E01 A;  2HBL A;  4CEA A;  4DQQ A;  3SPY A;  2NRR A;  4CJU A;  4W5Q A;  1RT5 A;  4JI2 K;  3PLA A;  4CGH A;  3DMJ A;  4WCE L;  5C2D A;  1KRP A;  1RT3 A;  4BRE A;  1U4B A;  4XH4 A;  2E88 A;  4CJF A;  3WXK A;  1RDB A;  3AY9 A;  3CCQ N;  1JL2 A;  4CZI A;  4FVU A;  1HKG A;  4XIU A;  4DR3 K;  4KO0 A;  3JAM O;  1L5U A;  3VOV A;  3NAE A;  3CJB A;  3QBW A;  1E4G T;  3B8A X;  1ASU A;  3P1G A;  2A6A A;  2PYL A;  3CJ7 A;  3LAM A;  3EE9 A;  3MDQ A;  2QXL A;  3U6F A;  3UB5 A;  3QML A;  5AQU A;  3K5O A;  1U45 A;  1BCM A;  2O8D A;  4LH4 A;  5HRO A;  4ISE A;  4PWD A;  3CPW M;  4JK9 A;  5HP1 A;  4H5V A;  2Q0R A;  3ZT4 A;  2YHY A;  1IKW A;  4QCL A;  4BWM A;  1WSJ A;  2A3Z A;  1SV5 A;  1RTH A;  3PIO L;  4B9M A;  4FYD A;  3AVJ A;  3IRX A;  3ISN C;  5M1K A;  2PYJ A;  4M3U A;  4EHU A;  2GUI A;  1BWF O;  1RDW X;  4HTU A;  4FW2 A;  3AVF A;  3ALY A;  3RR7 A;  3AA2 A;  2P9N A;  3RMA A;  3EO3 A;  4KRE A;  3I8B A;  4X64 K;  4FJJ A;  1VSL A;  3IAY A;  3D2E A;  4E1M A;  3T69 A;  1KAZ A;  4IFV A;  1W9H A;  1JLB A;  3QO9 A;  4BRN A;  4KAZ A;  4DV2 K;  4CW7 B;  3VQ4 A;  5SWM A;  3SK3 A;  3VQ8 A;  4ICL A;  4FOI A;  1JL1 A;  3KKS A;  4R5P A;  1Q9X A;  2X6S A;  4B9T A;  4BR4 A;  1SKR A;  2YKN A;  3VQE A;  2Q0U A;  3H6E A;  4B8A B;  1WLJ A;  4Y0W A;  1RGI A;  4BY9 C;  3DM2 A;  4B9N A;  3SPZ A;  2JLE A;  3V9X A;  4LY7 A;  5ADX H;  3GE1 A;  2HHT A;  1GLD G;  4NYN A;  4DHY A;  4BRL A;  4V19 S;  2E2P A;  1M90 O;  3DRP A;  3SQ1 A;  4BRO A;  3ASM A;  4N41 A;  4DV7 K;  4B1Y B;  2HB5 A;  1JLC A;  3VER A;  3THX A;  5FRM A;  4CGJ A;  4RW8 A;  4B9Q A;  2O8E B;  3K2P A;  1H1V A;  2I7P A;  3A5O C;  4FPA A;  4YOT A;  2O8F B;  5MLC Q;  1OH8 A;  3ZSW A;  2W42 A;  4CZF A;  4BDY A;  1CXU A;  4YOX A;  5JVG L;  3DLH A;  1S1U A;  3AVK A;  4FL9 A;  4Y1D A;  1VQ9 N;  2IS3 A;  2XY5 A;  4EP4 A;  1HNV A;  5FPM A;  1NKB A;  2VWK A;  1C0F A;  4HCC A;  1CZA N;  1V4T A;  3L2V A;  3F73 A;  2ZM6 K;  4NXM K;  4YFU A;  2RN2 A;  3MK6 A;  1WOQ A;  4BQZ A;  3DXK B;  5F0X A;  4BRC A;  3KVG A;  4JKG B;  4C8N A;  4CGF A;  1BI4 B;  4OPJ A;  3CC4 N;  2P9P A;  4IZ9 A;  3DWL A;  1NK6 A;  1RBR A;  1GOA A;  1MWM A;  4FJ5 A;  4IXC A;  3CJ9 A;  1ZBU A;  3OYJ A;  4JK8 A;  4KBO A;  2HHH K;  4Z4F A;  4JEP A;  3J7Y P;  4YDU C;  2NZT A;  1X3N A;  3OW2 M;  4F3T A;  1E3M A;  3FZF A;  3PUF A;  3ZCM A;  2XY6 A;  1EWR A;  1ZXO A;  4H0V B;  4DSK A;  3C6A A;  2ZD1 A;  4BRI A;  1FKO A;  3TSU A;  3QES A;  3IDH A;  1QSY A;  1HYZ A;  3C0B A;  4H5W A;  1X3M A;  4CJW A;  1YJN N;  3ID6 A;  4LF6 K;  5AQK A;  3FZK A;  4JKH A;  3O1W A;  4FLW A;  4IOA L;  4DTJ A;  4ZHR A;  4HVJ A;  4DTX A;  4B3T K;  4ELV A;  1BL3 A;  4ILJ A;  5KRS A;  2H3G X;  4WQ5 C;  2XO7 A;  5AQL A;  4E7H A;  4JAX A;  1VQ4 N;  3U3Y A;  4EZ6 A;  2OTJ N;  2YJF A;  3UKU A;  2FSN A;  2Q1N A;  3NH2 A;  3FR0 A;  4KB0 A;  1GLA G;  4BR9 A;  3THW A;  3MWP A;  3ENO A;  3NE6 A;  3LM9 A;  3RTV A;  1T8E A;  2UUA K;  2QWP A;  1RNH A;  1LAW A;  3S41 A;  5EOY A;  5EVZ A;  3EN9 A;  3HRG A;  1TUU A;  4KTQ A;  1NGE A;  4PKH A;  2P9K A;  4CZG A;  1DLO A;  3CCL N;  2XRI A;  4CF9 A;  4C23 A;  2HF3 A;  4X66 K;  4IG3 A;  4H8K A;  3C7N A;  1IBL K;  4BG9 A;  4FJX A;  1TAQ A;  3SUO A;  4JN4 A;  4NCB A;  1B9D A;  4M7Y A;  3V4I A;  3RMC A;  3BF3 A;  1L3S A;  2G8V A;  2Z1I A;  2HOE A;  4DSI A;  3U8X A;  3NVM A;  3CFR A;  1KCF A;  4KKO A;  1N8R O;  3VQ6 A;  4WF9 L;  5TKW A;  1WSE A;  2EWS A;  3FGU A;  2Y1I A;  1VQM N;  1IH7 A;  4DFJ A;  4CGD A;  1K73 O;  1RT4 A;  4B1X B;  4R79 A;  3OHR A;  2VCP A;  3BGR A;  3LDP A;  5AQY A;  3OJS A;  4X65 K;  4E1N A;  2RE2 A;  4E7I A;  5GIP A;  1MU2 A;  1TK0 A;  3CJC A;  1QE1 A;  4CD1 A;  3OYG A;  4AHS A;  2HHQ A;  3P4I A;  1RBU A;  1CLQ A;  1XNR K;  3C6H A;  4JI1 K;  1DTQ A;  1VSM A;  3UKR B;  1RDC A;  2QA4 N;  3TAE A;  1GLF O;  3KLG A;  1YIJ N;  3OYD A;  4YDU A;  4FLT A;  3WXL A;  2G8F A;  1VHX A;  3O4Q A;  2UU9 K;  2B5J A;  2Z1H A;  2P5O A;  5GAD P;  2NRZ A;  3V1R A;  3QET A;  4M3R A;  5JLH A;  4FZX C;  4LSN A;  5E26 A;  1NK0 A;  1L3V A;  3ZT2 A;  1S1T A;  1HR0 K;  3ULD A;  1S72 N;  3PSI A;  3MEG A;  4J8F A;  1RT1 A;  5AZI A;  3I0S A;  2VGM A;  4ISG A;  4FSV A;  3ZX0 A;  1UA1 A;  1JCG A;  4Z4E A;  3H1Q A;  1GOB A;  4WQ5 A;  1I39 A;  4MDB A;  4JNE A;  1LW0 A;  2F8S A;  3AVN A;  2W41 A;  3OYH A;  4NYF A;  3ULE A;  4CD3 A;  4BE0 A;  1HNX K;  3K9J A;  5AQM A;  5C24 A;  1U2V B;  1XWL A;  1UAX A;  5FLX O;  1P8Z A;  2E1Z A;  4DU1 A;  1EO1 A;  3M8S A;  2A5X A;  1NM1 A;  4K0K K;  2ZQB A;  4F3O A;  4DFM A;  3ENH A;  3OYL A;  3LM2 A;  3SBT A;  2QWL A;  4E7J A;  1QQC A;  5M1F A;  4M63 C;  2QWR A;  5HLF A;  1Q18 A;  2KFN A;  2FF6 A;  3BZC A;  4B9V A;  1KLN A;  4FWQ A;  3U9Z A;  3ZYY X;  5M1O A;  4GVE A;  3QNO A;  4K8X A;  2WC9 A;  2I5J A;  2JWL A;  3O3F A;  4DR4 K;  1VSI A;  3HSC A;  4C8L A;  4AF1 A;  5C15 A;  3OS2 A;  2NRX A;  4FWM A;  1B9F A;  3PY8 A;  4DV0 K;  3VQP A;  1BHL A;  3D2F A;  4AQY K;  2FXU A;  2I7N A;  2ASM A;  4BRP A;  1NMN A;  4KH4 A;  5C25 A;  2F4V K;  4OVL A;  3G6E N;  5J2N A;  3AA4 A;  4CK1 A;  1BO5 O;  1U6Z A;  4KHP K;  3G10 A;  1NJI O;  2GUP A;  3HPG A;  1X9W A;  1QVF M;  4LSL A;  3ENB A;  3I0R A;  1VQ8 N;  1YF5 L;  3QIC A;  4W5R A;  4DTN A;  4WFN L;  1CZB A;  2BUP A;  4FJN A;  4JS4 A;  4BGA A;  2QW9 A;  3TSQ A;  1NOZ A;  1FKP A;  3DLK A;  1Z6R A;  4OX9 K;  4AIL C;  2PY5 A;  3KLF A;  1ZBH A;  4IG0 A;  2BGG A;  2O4G A;  3ZEU B;  5CZ1 A;  3AVA A;  4H0T B;  4L3Q A;  1XUP O;  4QS9 A;  3VQ5 A;  5LY3 A;  5D3G A;  2ASP A;  5FPD A;  5KPZ A;  4B3O A;  4EP5 A;  3EEQ A;  3VEY A;  4CBX A;  4HUG A;  3TTD A;  1KD1 O;  1HNI A;  3L8B A;  1VQO N;  2KQ2 A;  4FM0 A;  4DSF A;  3FE1 A;  4BDZ A;  3CCE N;  3M6G A;  1Y64 A;  5BRD A;  4MQ3 A;  1NBW A;  4JKE A;  4ISF A;  3RSE A;  3EZW A;  3PX6 A;  1KSP A;  1BG3 A;  5HRS A;  3PX4 A;  4I2Q A;  4JI0 K;  4CI6 A;  2IAJ A;  1S6Q A;  3JS6 A;  1OKJ A;  3HK2 A;  2D1K A;  4CIG A;  4Q5V A;  2G8W A;  2E2Q A;  2P1J A;  3OYN A;  4FVM A;  4OKE A;  3DLG A;  4XH5 A;  4LF7 K;  4B3R K;  5CY4 A;  2HNY A;  4CZM A;  4CHY A;  5BR8 K;  2R7Y A;  3P39 A;  5LJW A;  1NJZ A;  3CQY A;  5J1E A;  4CEC A;  4DTR A;  3LPT A;  2A1S A;  3DXM A;  4DR6 K;  4DQI A;  4AH9 A;  3I55 N;  3PO4 A;  1NWK A;  1Z05 A;  2VYP A;  1S3X A;  4ZTJ A;  3GG4 A;  3O9U A;  4BQL A;  4E7L A;  1VQ5 N;  5CYM A;  3HP6 A;  5HBM A;  1GOC A;  3O08 A;  3J8A A;  4JD2 B;  3WXM B;  1JLA A;  1G15 A;  1JLE A;  3LP1 A;  4G1Q A;  4DSE A;  4B3S K;  4IFE A;  2O4I A;  3T19 A;  5BR9 A;  1TKZ A;  3R1X A;  1WN7 A;  2X6N A;  2HHW A;  1VQ6 N;  3THV A;  3VEN A;  4DU4 A;  4B8C A;  3CER A;  2FBV A;  3AVM A;  3LDQ A;  4DTP A;  4QAG A;  2YJE A;  1VRU A;  1RTI A;  1LOT B;  5FRN A;  5AQI A;  1XMQ K;  4CZE A;  3AVG A;  3VA3 A;  3BEX A;  4TSX A;  2P9S A;  3EKU A;  3J81 O;  3Q7B A;  3F9M A;  2O8B B;  4CFC A;  3MED A;  3V81 A;  4GY2 B;  4LFC K;  2CH6 A;  1CXQ A;  4YHH K;  3A5N C;  1DT9 A;  3CFP A;  3ZT1 A;  2E6L A;  5EXW A;  4DV1 K;  2DY4 A;  4KHS A;  5AQG A;  3R6M A;  4CJP A;  1ZBI A;  4BVO A;  4LF9 K;  1SS6 A;  4CE9 A;  4W5N A;  2RKI A;  3F2K A;  5AZJ B;  3M8R A;  4DQR A;  1HNW K;  1JXE A;  2WUS A;  4DR1 K;  4DKW A;  2YNG A;  4FJ8 A;  3U9D A;  2HBM A;  5C10 A;  4BDP A;  3HXM A;  2HVH A;  3SJH A;  1T6C A;  3VEZ A;  4GV6 A;  1N32 K;  3T1A A;  2QEX N;  3L3V A;  2BDP A;  5AFU A;  1WSH A;  3NH1 A;  3V9S A;  2UXD K;  4CZL A;  1NNE A;  4H5R A;  3K59 A;  1Y97 A;  2D5R A;  1JLQ A;  2YHB A;  2Q3S A;  4RCH A;  4PUO A;  1KVB A;  3VEO A;  4FWO A;  3M8P A;  4FK0 A;  3K57 A;  4DCH A;  1ITG A;  3ZX3 A;  2QWN A;  3LZJ A;  5EU7 A;  5AQZ A;  3AVI A;  3NF9 A;  1KVA A;  2P9I A;  4DU3 A;  2BE2 A;  4G9Z A;  3AVH A;  2YNH A;  5F1X A;  1NLV A;  2YHA A;  4CHO A;  2P5G A;  4KTW A;  4JI7 K;  3I33 A;  2GX9 A;  1T6D A;  2F9T A;  3D0P A;  4LH5 A;  3AO3 A;  5H1S Q;  3WXJ A;  4X62 K;  4IJN A;  3JXU A;  4IOX A;  5JMV A;  2P9U A;  2EX3 A;  3VQD A;  2WON A;  5J2P A;  4NXN K;  4JYA K;  3CCR N;  3HL8 A;  3OBW A;  3TAG A;  4Y1C A;  4DF8 A;  4BRA A;  4Z4I A;  1HPM A;  4FXD A;  4FWS A;  4KPY A;  4IEI A;  3SQ2 A;  2IGI A;  2RHK A;  4O0I A;  4CED A;  3L0Q A;  4NO7 A;  4ILG B;  4FWK A;  4H5T A;  2NRW A;  4RW7 A;  4DTM A;  3NCI A;  1XMO K;  3ZSO A;  4JKC A;  4CJR A;  4CJS A;  3K5N A;  2NRT A;  4CF8 A;  1S22 A;  3AAP A;  5DMR A;  2O8E A;  1QQO A;  2HNZ A;  3WNG A;  1ZYQ A;  3THY B;  1LV5 A;  5HRP A;  4JRP A;  2O8F A;  4PY5 A;  2G8H A;  4CJ7 A;  3TWH A;  3L3U A;  2VQF K;  3TAP A;  2QWQ A;  5GIN A;  1J6Z A;  4OO1 J;  1L3T A;  4OGC A;  2A42 A;  3HPO A;  2G8I A;  4DF4 A;  1HYS A;  1ATN A;  3VGM A;  4FZZ A;  2NNW A;  1N34 K;  2UUC K;  3AO5 A;  3ID8 A;  2YCH A;  3CQ8 A;  3CC7 N;  3V1Q A;  1KTQ A;  5HL7 L;  3MCA B;  2LSN A;  3DXK A;  3CYM A;  2GV9 A;  3NGY A;  4JKG A;  3A8Y A;  1BI4 A;  3QDK A;  4DMN A;  4JI3 K;  2HW3 A;  3KHY A;  2D0A A;  3NGI A;  1K6Y A;  4B9L A;  4GV9 A;  5AR0 A;  4JI8 K;  1TGO A;  3L4Q A;  4UY8 O;  3SMS A;  1Q7Y O;  1XI1 A;  3KK1 A;  4N56 A;  3OJU A;  2FLO A;  2GEL A;  3M1F A;  3NF8 A;  2ZJP L;  1DEJ A;  2AA4 A;  3T7Z A;  4BE2 A;  4B1U B;  1W2B M;  4K41 A;  4YNQ A;  3V1O A;  3P31 A;  3QFU A;  1SQK A;  2KTQ A;  4HHT A;  2P9P B;  3TAR A;  2ZWH A;  4JHD B;  3R8E A;  3OS1 A;  3V9Z A;  1A5V A;  4PA1 A;  4FM1 A;  4CHP A;  4CGI A;  1GLC G;  2F8T A;  1XHX A;  1YVN A;  1SUQ A;  4DWI A;  1NJX A;  4RG8 A;  3SAF A;  4DV5 K;  4DTU A;  1RT6 A;  4N5S A;  3N4Q A;  3BP8 A;  4DV3 K;  3KLE A;  3RWU A;  3LAK A;  4PQU A;  1NOY A;  3VEW A;  1CZ9 A;  2FBT A;  3SLC A;  4NCA A;  2J4R A;  3CQX A;  3MXI A;  3O9Q A;  1R0A A;  1HQE A;  1NGG A;  3TR8 A;  3QER A;  1I94 K;  3E9L A; 
#chains in the Genus database with same CATH homology
 4GKJ K;  2ZM6 K;  4NXM K;  4DV4 K;  4LF7 K;  4B3R K;  5BR8 K;  4DV0 K;  1N32 K;  3T1H K;  4AQY K;  2VQF K;  4DR6 K;  2E5L K;  2UXD K;  4JI4 K;  4X64 K;  4DV6 K;  2F4V K;  2UXB K;  4LFA K;  2UUB K;  4X65 K;  1N34 K;  2UUC K;  2HHH K;  4KHP K;  3J7Y P;  4DV2 K;  1J5E K;  4CW7 B;  1XNR K;  4JI1 K;  5IT9 O;  4JI3 K;  4B3S K;  4JV5 K;  2UXC K;  4YY3 K;  4LF4 K;  2UU9 K;  4LF6 K;  4JI8 K;  4OX9 K;  1N36 K;  4JI2 K;  5LL6 Z;  4DR5 K;  1XNQ K;  4B3T K;  1IBM K;  4DUY K;  4B3M K;  4DUZ K;  4DR7 K;  1HR0 K;  4JI7 K;  4LFB K;  5AJ3 K;  1XMQ K;  1FJG K;  5IWA K;  4DR3 K;  5LMU K;  4X62 K;  4LF8 K;  1N33 K;  3J81 O;  4V19 S;  3JAM O;  3OTO K;  4LFC K;  1IBK K;  2VQE K;  5LMN K;  4DV7 K;  2UUA K;  4NXN K;  4JYA K;  4YHH K;  1HNX K;  4LF5 K;  4DV1 K;  5FLX O;  4DV5 K;  4K0K K;  4LF9 K;  3J80 O;  4DV3 K;  5A2Q O;  3J7A P;  4X66 K;  3T1Y K;  4CVN E;  1HNW K;  4GKK K;  4JI0 K;  1IBL K;  4DR2 K;  4DR1 K;  1XMO K;  4JI6 K;  1HNZ K;  1I94 K;  4JI5 K;  4DR4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...