1HNZK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnzK00
2UXBK 1HNZK 1HNWK 3JAMO 4GKJK 5AJ3K 4YHHK 1IBLK 4LF9K 5BR8K 4X64K 4LFAK 4DR4K 4B3RK 4K0KK 4DR5K 2UXDK 1IBKK 1XNRK 4DR6K 1HR0K 4V19S 1FJGK 4DUYK 4JI1K 4DR2K 5FLXO 2UUCK 3T1HK 4B3MK 2UUBK 1N33K 4JI2K 4DR7K 4B3SK 4DV4K 4JI4K 3J7YP 4DV7K 2UU9K 5LL6Z 4LF8K 4CVNE 3OTOK 4JI0K 4DR3K 1XMOK 4X62K 4LFBK 2HHHK 4X66K 2UXCK 1XMQK 4KHPK 4DV5K 1N32K 4B3TK 5IWAK 4LF4K 4DV3K 4DV1K 4X65K 5LMNK 4OX9K 4JV5K 4JI6K 1N36K 4GKKK 4AQYK 4NXNK 4JI7K 5LMUK 4DV0K 2VQFK 1N34K 1IBMK 1XNQK 4JI5K 3J80O 4LF5K 4JYAK 4YY3K 4DR1K 5A2QO 2VQEK 3J81O 4DUZK 4DV2K 4LFCK 4DV6K 4LF7K 4NXMK 1HNXK 5IT9O 3J7AP 4LF6K 2ZM6K 2UUAK 2F4VK 4CW7B 3T1YK 4JI8K 1I94K 2E5LK 1J5EK 4JI3K
chains in the Genus database with same CATH superfamily
1BUPA 4K8XA 5J2PA 4CZHA 1Q8IA 5GIPA 3G4SN 5BRFA 4BE1A 2HBJA 4OVLA 4BVOA 3CYMA 5E84A 3VMFB 5M1OA 3FZMA 2P5GA 1ATRA 4DSEA 3G6EN 3SPYA 4FZYA 2P9UB 1Z6RA 1I3AA 4YOVA 3K58A 3OBYA 3A2FA 5BRHA 4C8NA 1VQON 2A42A 1XHZA 3HM9A 4U67L 2V7ZA 4DR2K 4DMNA 1GLAG 2P9PB 3PO4A 2E88A 4OGEA 1YJ9N 1BIUA 4KI6A 3BGRA 4XEIA 3TSPA 1YITN 1WAFA 3UKRB 2OPQA 3TARA 4JK8A 4JKCA 1HX1A 4H0OA 5LY3A 1VQ6N 4JD2A 4JEPA 4PL8A 2D0PA 2GELA 2E6LA 3C6TA 2ETJA 2D1KA 3VEVA 2HHHK 1N6QA 3H3OB 2Q1NA 4CZGA 1XMQK 4KPYA 4RW9A 1QTMA 2DTUA 2GX9A 3SV3A 1IH7A 1YT3A 3E66A 2Z1GA 3HPGA 4FPBA 3OYFA 5CE3A 1BQNA 3RRHA 3CCUN 5LJWA 5C2DA 1RT5A 2VQFK 3FZHA 4IFVA 1BIZA 3QICA 4XH4A 1KFDA 4B9VA 1X1PA 3K5NA 5AQTA 4DSLA 3DI6A 4MFBA 1NK8A 4PL7A 4BC5A 4OGCA 4CJ7A 3CFOA 3QBXA 4LF7K 3D2EA 5HRSA 4BWJA 4FJGA 3NAEA 4I7FA 3HJFA 4CZJA 4LF6K 2NRHA 2WUSA 3O9RA 5AFUH 4A61A 2QA4N 4ISFA 3SK3A 1E4GT 1A5WA 2HBLA 4DFJA 3CETA 1OKJA 4Q5VA 4CECA 4AM7A 2BE2A 1NKEA 4CJ5A 3SUQA 4DTXA 5M1QA 1VQPN 1NJZA 4DTSA 3VQ6A 3GOIA 2W6LA 5BR9A 3T69A 2ASMA 3PSFA 4GVEA 4E19A 3U9DA 4JAXA 1ZYQA 2O8EA 1MWMA 4CE9A 1B92A 1S22A 4JKHA 1UWBA 5JS1A 3SBTA 4B9NA 4FWSA 2E1YA 2GUIA 3M6GA 4U7BA 4CFBA 4CIEA 3CERA 1BCOA 3K59A 2WC9A 4JN4A 3B6OA 1W2BM 1SS6A 5AQKA 3SCXA 3H1VX 4N56A 4FO0A 1LWCA 5C42A 4DU3A 2ZJQL 4JRQA 1S5JA 4FWLA 4JI4K 3CC4N 2HMPA 1JKHA 3L4IA 4O0JA 3C7NA 5AQGA 3THVA 4LFBK 3V1QA 2CGJA 2OTLN 2HOEA 2NRXA 2YJFA 4DWIA 1QQMA 1IKYA 3OYJA 1NKBA 1EKEA 5DM6L 4JV5K 3ZT4A 4WYBA 4IG0A 4CF2A 1NGAA 3E9PA 5LMUK 2Z1JA 2A1SA 3AA4A 3CXCM 2O8DB 3I33A 4CZKA 4YOUA 5CYQA 1WSFA 5J2MA 1VQ4N 3ZSOA 1WSHA 1VQ9N 4E1JA 4JLHA 3UB5A 3SMPA 3NGZA 2KHOA 3C65A 1VSKA 4FCYA 4JS4A 1NMNA 1JLCA 4YDUC 4DUZK 2BDPA 2QI2A 3VTHA 1K8AO 4C1NI 4H4MA 1VAZA 4J2DA 1HYZA 1KAYA 2O8DA 2YV0X 3PX0A 5I3UA 4FL9A 4FJ9A 2HF3A 4AHTA 4B1VA 1I94K 4BGBA 1TYQB 5BN9A 4XH1A 1C6VA 4CHQA 4FZXC 1O13A 2DFFA 5AQVA 2W42A 1VRTA 4BE0A 1C0FA 5HRRA 4MLHA 4AHVA 4LFAK 4OPAA 1ASWA 3O4QA 3PY8A 1RDUA 4DQRA 3QEXA 3F5TA 4DTMA 1C1CA 2O8BA 3OYBA 2YNFA 3K2PA 4DCHA 4QCLA 4DUYK 1YUWA 3VF4A 4A5AA 1M1KO 2QM1A 4JI1K 1LW2A 3KZBA 3BF1A 5FLXO 1NJXA 2I5JA 3NGYA 3OYGA 3CQ8A 4IEEA 1WSGA 5C10A 2GUPA 1TKDA 1CXQA 3WQUA 4N47A 5EY4A 3G10A 2F7TA 3SUNA 5GINA 2AJQA 4CEFA 2KQ2A 3DOKA 4CHOA 3H46O 5KPZA 1KLNA 1Y97A 4Q0BA 3T7ZA 1ITGA 4OX9K 1UAXA 2YHXA 3GBTA 1N36K 2IC3A 2V51B 2CGLA 1NGFA 5I9EB 1NGGA 5EU7A 3WXJA 3TAGA 4KTZA 3VQCA 2FBVA 3FFIA 3JS6A 1S72N 1YTUA 5FPNA 3KKRA 3M8SA 1IO2A 3CJAA 3PV8A 4FLWA 1BI4B 3VQPA 1ASUA 3GL1A 3IRXA 3IS9A 2D5RA 5GAHP 3W0LA 3WXKA 3CIPA 3HI0A 4CJQA 3O80A 2ZM6K 4GMJB 3MWPA 3QETA 3BUZB 1TK0A 5AQZA 4FJKA 3PSIA 3PX4A 3SUPA 5E26A 5AQFA 1RBTA 3NCIA 4M3UA 3VF6A 3VETA 3NBPA 4IJNA 2O4GA 2FBYA 3O9QA 3QEIA 3IG1A 5LJVA 1X3MA 2ASOA 5KRSA 3C94A 4YDUA 4CJTA 3I0RA 1JLBA 1QVGM 1NOZA 1I39A 1RDBA 1L5UA 3H1QA 3CD6N 4IBNA 3CMAN 4K0KK 4JNEA 1XNRK 3SZ2A 3ID6A 4CHYA 1ZBSA 2HBMA 4MO4A 3MCPA 3OYNA 3QLHA 1KTQA 4CZLA 5FPDA 5GADP 4IO9L 3BZCA 3C6AA 2YNHA 3CPWM 3GG4A 3LP1A 4GNIA 4FJ5A 5KRTA 4CJ3A 3CCJN 4W5QA 3MXMA 3HZ6A 1TVRA 1WLJA 4PA1A 3EEQA 4E1MA 4H5VA 5AQHA 4RW7A 5KPRA 4BR5A 3WXIA 1W0HA 2XY6A 1N32K 4LH4A 3VEYA 2KLAA 4KH4A 3EKUA 1VSDA 4ILGB 3QIOA 3SAHA 3O9UA 5F0XA 3HYFA 2QKBA 1NJWA 3TTCA 4B1YB 3KLFA 3P31A 3SI6A 4FZZA 4KTQA 3E9OA 4EIAA 4Z4EA 2RKIA 2FC0A 4IOCL 3AVHA 5AR0A 3FGUA 5FDLA 3CJCA 1R0AA 4ZHRA 3KHYA 1F21A 4M3WA 3TAPA 4B8AB 4CEAA 1SAZA 5AQQA 4YOTA 5C12A 5ELZA 3NE6A 4AH9A 1HUXA 3W3DA 2GWJA 3L8BA 2GEMA 4CFCA 3SQ1A 4DKWA 4H5WA 5KQ8A 2YKNA 2BGGA 4I9QA 1VK0A 2UXDK 2RPIA 3LALA 4FJIA 1MU2A 4FJJA 3D2FB 3CM5A 1RDAA 4CK3A 1G99A 1Q7YO 4CBWA 1NBWA 3RVCA 4F9OA 4M3YA 3DYAA 1TGOA 2CH5A 1SUQA 1WOQA 1XHXA 4FLYA 3NVKA 1U2VA 4FWMA 3SQ0A 4B3OA 3UKUA 4IG3A 4F8RA 3HSTB 2YNGA 4BRPA 3DLBA 1KFSA 1JLQA 1JLAA 1UOCA 3LDPA 2UXCK 3QO9A 4DV5K 1OH8A 5CZ1A 2QWNA 3QIPA 4IOXA 4DSJA 1KXPA 2V7YA 2OPSA 2FSJA 4AQYK 1RT7A 3NH2A 4B9UA 2IGIA 1RT3A 2ZJPL 3TTFA 4DFMA 2NUBA 4CJLA 1N5YA 3D45A 2VGMA 3MK6A 3OYDA 3SUOA 3WXMB 4BRDA 3O4NA 1A5VA 3HXMA 3NDKA 2CH6A 3VEZA 2RF2A 3ZETB 3VOVA 1JL1A 4H5TA 3ZSXA 3NMUA 3L3VA 3K9KA 4E0DA 2HB5A 3IAYA 4AM6A 1T8EA 2BH1A 5HRNA 4AHUA 3MXIA 1CLQA 4H8KA 3ATUA 1X9WA 3AAPA 1YJNN 1T05A 4CIGA 3AVIA 1X3NA 3L2VA 4CW7B 3BF3A 4A2AA 1VSJA 5AQPA 4A62A 4BDPA 5JS2A 3WUHA 2BANA 1RT6A 4RTFD 1VSEA 4DTOA 1DTTA 4YHHK 4CD3A 1GLLO 5ADXA 1X9SA 1MA9B 1W97L 3V9UA 2HSTA 2QWRA 3LP0A 3EO3A 2YHWA 1S1UA 1NGJA 1HR0K 1QSSA 1VQ5N 4DQQA 4BG9A 4OPKA 4IO8A 4CEOA 4EHTA 4UY8O 4JK7A 4BY9C 4KTWA 4CEBA 3ASMA 2G8WA 4DB3A 4FWRA 3L2QA 3CM6A 5HLFA 3SV4A 2WONA 1QHAA 1D5AA 3J7YP 3HP6A 4DV7K 3I8BA 3S41A 2WTUA 1TAQA 3RMAA 1Q86O 1ZBLA 1TL3A 4CJUA 2A1RA 1XMOK 1BL3A 4JD2B 2EHGA 1QQNA 1D9DA 3LWMA 5M1PA 3CI5A 4E3SA 4FJXA 4B1ZA 3KD1E 4KHWA 4WQ4C 1CZAN 3MMVA 3TANA 4CGDA 1FW6A 5AQXA 2HNYA 1V4TA 3TAMA 2D0OA 2G8FA 4H4OA 4N41A 3P39A 4RG8A 3MDQA 3DXKB 1XNQK 3U8XA 4JKBA 1YTAA 3TWHA 2VCPA 1OVQA 3OY9A 3SMSA 3VPZA 4YNQA 4NLCA 3DLGA 1NGEA 3LANA 4DR1K 1QS4A 3O08A 5FRNA 4FJMA 3WQTA 3ZLJA 2OPPA 4FLVA 1RILA 3AO2A 3D2EB 3J7AP 2E2NA 4WFBL 1H1VA 3K5LA 4H0YB 3AO3A 3DXKA 4JS5A 4KBOA 4CHNA 3DLRA 3CCSN 3MWTA 3T1YK 4KV8A 4GVMA 4BC3A 4B9LA 1ZBHA 1KVCA 3HOTA 1T6CA 2QWOA 5C2FA 4LF9K 5JMVA 3C95A 3SJJA 4QOZB 1NK0A 3OYEA 3R1XA 3CQYA 1RDCA 1IBKK 4BG8A 5DM7L 3CJBA 3ZSVA 2O8EB 3OYKA 4A59A 4DQPA 2QWLA 4WFAL 3HBTA 2G8KA 2FBXA 4OPJA 1VSFA 1YAGA 3RR7A 2V52B 5AQLA 1QZ5A 2NRZA 4CJKA 4IWVA 2QWPA 1OH6A 4K42A 5ADXH 3E9LA 3VQ8A 2FSKA 4XIUA 2P5OA 3VGMA 2P9NB 3FZKA 1T6DA 4DR3K 4GV9A 4BR2A 3KK7A 2F9TA 4X62K 3RSEA 3VQQA 3O3FA 3C7NB 4B3TK 3AVJA 1OH7A 4DSFA 4C8LA 2G8VA 4CBUA 3BP8A 2OZSA 3AAQA 2A40A 3H45C 4O5BA 1RTIA 1IKVA 3ENHA 5C25A 3B6PA 1FKPA 1VSIA 3VQBA 1SL0A 4YOYA 1N34K 1U45A 1LWFA 4FJNA 2P9NA 1Y64A 2ASPA 3KD5E 2E2QA 4JI5K 3IUCA 3KWIA 5AQMA 2RE2A 4UQGA 4DV6K 1R59O 2KTQA 4PUOA 2FBTA 4BDYA 1L3VA 2O8CB 1K8KB 1U47A 5CHIA 1Q9YA 3VGKA 3ZSZA 4DS5A 2P1JA 3IMXA 3LPUA 3MCAB 4FWPA 3U4LA 1GLJO 1LW0A 1RT2A 2UUAK 4O55A 1SZ2A 3Q7BA 3ULDA 3ZSQA 4YOWA 1EWRA 4LC9B 3SBGA 4DU4A 3V9ZA 5FRMA 2PYJA 4JI8K 3LPTA 3PIOL 5HL7L 1T44A 1VQNN 1RGIA 4H0VB 2HNZA 2E4LA 2ZD1A 3JAMO 1T3VA 1HKBA 2O8CA 1K8KA 3LZJA 3KJVA 3K9JA 1GLDG 4B9QA 2X78A 1SQKA 1BA1A 3OYLA 2YHYA 3DLKA 2O4IA 4DHYA 3UIQA 4CJSA 1QSLA 4FJLA 2O8BB 1RT1A 3P4IA 1YI2N 3CJ9A 4OKKA 1CXUA 3HP9A 4ZTFA 5AQJA 3AY9A 4B1UB 1B9FA 2A3ZA 3T1HK 4Z0UA 4DFKA 4CK2A 4E89A 3BY5A 3VERA 4ID5A 4H0XB 4CF1A 3O5BA 4LF8K 2P9SB 4PKHA 3G71N 1DTQA 4EP4A 1OH5A 4X66K 4G1QA 3CQXA 4BDZA 2HHVA 3EYZA 1HJRA 3KK1A 3VQEA 3FR0A 3PIPL 1JJ2M 3E01A 4JI6K 4HWIA 4MO5A 2HMIA 2P9SA 2HHSA 3NVMA 4Z4IA 4B08A 4CBXA 4CGGA 1ZBUA 2NRRA 1L3SA 1MDUB 2W41A 3L0QA 2HVIA 4C8OA 3B8AX 3RTVA 2KFZA 4M45A 2VGNA 4RW4A 3JXUA 5AQWA 3NH1A 3F73A 1QQCA 2OYQA 1HMVA 3VA3A 3IKMA 3M1FA 4BRFA 3KKSA 3THWB 3AO1A 3O1WA 5IT9O 3V6DA 3L6QA 3ZT3A 4BRKA 2IVPA 3CC2N 4W5NA 1K9MO 2F4VK 5HBMA 4C23A 4CFAA 5EX5A 1IJJA 4CHPA 3MN9A 1TKZA 4KI4A 2P9LA 2IIRA 2HVHA 4EFHA 4WFNL 1BCMA 2IAJA 3DLHA 3N4PA 1W9HA 3CFRA 3KTQA 4OJRA 5KGXA 1B9DA 1Q81O 1BQMA 3F9MA 3ITHA 2VG5A 3THWA 2HHTA 4JRPA 4NCBA 3OYHA 4FXDA 3WNFA 5TKYA 4O5FA 3U3GA 3OJUA 1IV0A 3CFPA 4BRLA 4V19S 1ILYA 3C0BA 4MLEA 3WEEA 3C6HA 4W5TA 4CJPA 2X6NA 5I42A 3EL2A 2UUCK 4HUEA 3IDHA 1TKXA 4CERA 1NWKA 5HRPA 1YXQA 1FK9A 2Q36A 4RW8A 2H3GX 2YHAA 1JXEA 4CJFA 3O3HA 3DMJA 3KK2A 1X9MA 1RBUA 3O4WA 3MX2A 4JKFA 4FM0A 2HHQA 3AVBA 3VF2A 3R8EA 3HK2A 2E2PA 4IXCA 3LP2A 4ISEA 5IWAK 3KVGA 4HCCA 4YOXA 4LF4K 2FSNA 4X65K 1LWEA 1YHQN 3KIOA 4HTLA 2E6MA 2F9WA 3DWLA 1RBVA 4GKKK 3O9SA 1CZ9A 4NXNK 3PX6A 1J9AA 1BWFO 3F9KA 4FW1A 3CHWA 3SAGA 4DSKA 4H03B 1BISA 4KKOA 3LWLA 1WSEA 4JHDB 3KLGA 4F2RA 1Z26A 4HCBA 2BUPA 3OYIA 3G0ZA 2GTDA 1BHLA 4EAHD 3NF7A 4FW2A 4WCEL 4AHSA 3CMEN 5CR4A 3L4QA 4NXMK 4LSLA 1G15A 4Y1DA 2FF6A 3QMLA 4M3ZA 2BTFA 4I9LA 4BR0A 3CPEA 4H0TB 3VQ7A 5SWMA 3RRGA 4JHDA 4EZ6A 4FJHA 2YKMA 4C8KA 3GDQA 4BRGA 5BRDA 4KH6A 4RW6A 1YVUA 4M3XA 2HHUA 2IVNA 4EZ9A 1QQOA 3AVMA 2P9KB 1VHXA 1DEJA 1J5OA 3KK3A 4CF8A 5JLHA 1OVYA 4CEEA 3NH0A 3U6FA 5C15A 1U49A 3QNNA 4M3TA 4FLZA 5M1KA 1BGXT 3TAFA 4A2BA 1HQEA 3MAQA 1YF5L 2OANA 2E1ZA 3PO5A 4BR9A 1NGDA 2P9KA 3A8YA 3OJSA 1VSLA 4J2AA 3A5OC 1NGCA 3HPOA 1D9FA 1WSJA 2ATQA 2ZQBA 4B3MK 2Q31A 4CJWA 4M63C 3D6RA 3ZX2A 2Z1IA 1U2VB 4R5PA 4CHZA 3JSMA 3S3OA 3UKUB 3OTOK 3ZCMA 1IG9A 3LDNA 4BVPA 4E7LA 1YVNA 2QWMA 4MDBA 3U3YA 4KHPK 1X9JA 2QXLA 4JK9A 4DTUA 4DV3K 4CZFA 4DV1K 1TL1A 5LMNK 1NK6A 4BR7A 3A0IX 1J54A 4ICLA 4BRAA 3DRRA 3TR8A 4JI7K 4CZEA 3LM2A 3V1RA 3KLEA 3TAQA 2XRIA 4QAGA 4FYDA 4FPAA 1S1VA 1TK8A 1HPMA 4E1NA 4KH5A 2QKKA 4IZ9A 3VA0A 4B1WB 1RNHA 3ZSWA 4JYAK 2QWQA 4B9SA 4FOEA 3MEEA 3U9ZA 4IOAL 3CCQN 3VQ5A 3L2UA 1HQUA 4KFBA 4C8MA 5HOOA 2QEXN 4CCHA 4HTUA 4BRQA 5JVHL 3MECA 1HNXK 4NYFA 4F4KA 5HROA 3AVAA 4BRHA 2XHBA 3NHGA 1TKTA 1YIJN 2G8UA 1RBRA 4R79A 3A5MC 4FSVA 1C1BA 2YNIA 1J5EK 3BEXA 1NLVA 3IFRA 2R7YA 4KB1A 4K41A 3OW2M 2QK9A 3QERA 3RR8A 3N4QA 4GKJK 1IBLK 1U48A 3L2RA 3QBWA 1WB9A 4DR4K 3EE8A 1QVFM 3HSCA 1RDDA 1TAUA 3O1BA 1TV6A 4M3RA 4C1NK 5GAGP 1HNIA 2NNWA 3V9WA 1NU0A 3CCEN 1QSYA 4M7XA 2X74A 3ZSYA 4FM1A 3MXJA 1HPZA 2B6AA 2E20A 2FXUA 5TKWA 3SAFA 3EZ5A 3CCMN 3TSQA 4QS8A 1EXQA 3D7EO 1TUUA 1RTJA 1GOAA 4JI0K 4NCGA 3QB0A 2E2OA 3EY1A 3THYA 2W6KA 3ZX0A 5KPTA 4FWQA 3PUFA 4HUFA 3ZX3A 1E3MA 1REVA 2A41A 1NK4A 3BZKA 1KSPA 1NK7A 2Q97A 1DLOA 1NJYA 2WBNA 1Q18A 2J4RA 3L3UA 4BR4A 1NMDA 3OYAA 2G8IA 1O1WA 3ZSRA 2RN2A 5EVZA 3DAWA 1S1WA 3LDSA 4F2SA 1VSMA 3OYCA 4DTPA 1LAVA 4F3TA 2PY5A 2XY5A 3TAEA 1Z25A 3WXLA 2I7NA 4CJ4A 4YY3K 2LSNA 4CGHA 1U4BA 3SLCA 4PY5A 4KB0A 3VGLA 2HBKA 2RHKA 2E8AA 4A5BA 2VQEK 1UA0A 1EWQA 3HM8A 3K0SA 1JLFA 1C1AA 1MWKA 4M7YA 4GW6A 4NYNA 4B1XB 1XQSC 4ZTJA 3OS1A 3AO4A 2Q0UA 2NRVA 1WNSA 3OA9A 1XI1A 3WT0A 2HF4A 2DPNA 2ZWHA 4DFPA 4E7IA 4QS7A 3NF8A 1K6YA 2Q2RA 4AHCA 1DT9A 1U6ZA 1C0UA 1QZ6A 3C6UA 3THXB 4KAZA 1HNWK 3LDLA 4B9TA 3CCVN 1U04A 3OS2A 3CG7A 2JGUA 4B3RK 1BO5O 2P9UA 1IG8A 4NCAA 3E1YA 1E4FT 1RTHA 3GE1A 2DY4A 3O6WA 3ZEUB 4Y0WA 2Z1HA 2P9PA 3LM9A 3THXA 1NNEA 2YI1A 4I2PA 3MN6A 4DQIA 1JCFA 1NK9A 5AQSA 2UUBK 1YJWN 4J2EA 3UKRA 1L3UA 3AA5X 4NLBA 2UU9K 3I55N 2A5XA 3ID8A 1JCEA 3ZEUA 5GAEP 4KHSA 3QEVA 3V9XA 1NJIO 3VEWA 2YX6A 2QTDA 3HVRA 1VQ7N 2EWSA 3RSEB 4DSIA 4KHYA 3ENOA 3CC7N 2D0BA 4IDKA 3T1AA 1IKWA 3NFAA 3I8DA 4F3OA 5BPLA 1IBMK 2VWKA 4FM2A 4IJAA 3VENA 1JLEA 3F2KA 1VSHA 1WSIA 4LD0A 4WQ5C 1S9GA 2WFBA 3H08A 1TK5A 4ISGA 3AV9A 3M8QA 3SPZA 4O4GA 4CK1A 3FZFA 4LFCK 3A5NC 1GLFO 4KHUA 3QFUA 5D3GA 2ZE2A 4CGJA 3LDQA 4HHTA 1XC9A 5B8HA 4CZIA 2OTJN 3AVKA 3VQ9A 1D4XA 4B8CA 2PBDA 2IS3A 2KZZA 1KQSM 3QNOA 1NGBA 1ZXOA 3TSUA 4KRFA 3RWUA 3K5MA 3AA3A 4HUGA 2QW9A 1VQMN 2A6AA 5T7BA 2Y1JA 4X64K 4OKJA 3ZT0A 4CGFA 3D0PA 4WQ4A 4MDAA 3ATVA 2UYTA 4E7JA 2EX3A 4FK2A 4HVJA 3ZYYX 4BC4A 1GLCG 2ZJRL 3R9PA 4BRCA 3V1OA 1NK5A 2VWJA 1QE1A 3EN9A 1LOTB 1LAWA 4DTRA 5JVGL 3T3FA 2IVOA 4JKAA 3QINA 2DFEA 5J2NA 4KO0A 3NGIA 2Y1IA 4CFDA 3V81A 4FOIA 3AGKA 1W7AA 3SYZA 3Q7CA 4CGIA 2B5JA 4FWNA 1A5XA 5AQRA 1HYSA 1BDGA 2PAVA 3TI0A 1WBBA 2ITMA 2KFNA 4FLTA 2HHWA 3VQAA 3T19A 3AVGA 4FK0A 5AQOA 1T03A 1BOTO 2IOCA 1VQ8N 4L3QA 4ELTA 4BACA 3DLEA 1KVAA 2FF3B 2F8SA 5BN8A 4CEQA 5AZIB 5M1FA 2KKZA 4W5OA 3S3NA 3M5RA 4M41A 1NKCA 5CY4A 2ZGZA 4BRMA 4BC2A 3QEWA 5GIOA 3WNHA 4ILJA 4G9ZA 3DRSA 4OO1J 4FWOA 3SQ4A 4DV2K 3J81O 4GV3A 4DF4A 5BPMA 4CZMA 2HHXA 5AZIA 3FLCO 5MLCQ 3V4IA 3HPHA 1Q82O 1XWLA 2ZF5O 1SKRA 4B9MA 1KD1O 3QESA 1BU6O 1TYQA 1HKCA 1ZC6A 4WQ5A 2P9LB 2Q0RA 3M8RA 5AJ3K 3WNGA 5BR8K 3KWGA 2XY7A 3HL8A 5H1SQ 1RTDA 4JKGB 1XUPO 1P90A 4AF1A 1ZBFA 4LSNA 4EP5A 5AQIA 2JWLA 4DR5K 3VESA 4CESA 3MEGA 2GBZA 4DR6K 1BG3A 1FJGK 4Z94A 1JLGA 1KLMA 4KREA 2O8FB 1XC3A 3WEEB 1RFQA 3A5LC 5C24A 4IDHA 4JKGA 2OZMA 2XY8A 2W40A 1KAXA 3AVCA 1C0MA 4I6MB 4DR7K 4DV4K 3G25A 3QEPA 3H3NO 3SJHA 1TUYA 5E41A 1JXBA 5LL6Z 1J53A 1RCHA 1SL1A 4K8ZA 3KLIA 5J1EA 4E7KA 1EETA 4CVNE 1M90O 3O3GA 2AP1A 4DU1A 4J2BA 1J6ZA 1GLEG 3DOLA 1BA0A 2OPRA 1SL2A 4J8FA 2O8FA 1GLBG 3P1GA 4E7HA 4PWDA 4YORA 3LP3A 4DS4A 5C0YA 4I6MA 3I56N 1ASVA 1KAZA 1EO1A 2OCEA 1EX4A 1DKGD 2PFUA 4OPHA 4DQ8A 5AQNA 5AQUA 3S3MA 2NZTA 2YCHA 4O44A 4BGAA 4KHNA 1ESVA 4K43A 4XH5A 5EXWA 2QXFA 1WAJA 3AGRA 1BI4A 3OYMA 4KHQA 1DGKN 3L2WA 4CIFA 1ATSA 2NRTA 4Z4HA 3HRGA 4BE2A 1K73O 1HLUA 4JKDA 4FVMA 1N8RO 2HW3A 1WN7A 3FE1A 2VG6A 3HT3A 1HYVA 4BQZA 4O8KA 4OLAA 2GWKA 5FPMA 2JLEA 3WNEA 3RMCA 2F8TA 2YHBA 4GY2B 3DXMB 1KRPA 2UXBK 5KGWA 1FKOA 1WUAA 5CYMA 3QFPA 3J8AA 3AVNA 4DLEA 4PKGA 1S6QA 4Y1CA 3LDOA 4QS9A 4NO7A 5F1XA 1GOBA 2HNDA 4H5RA 4K25A 5SZTA 2VG7A 3OBWA 1EQYA 2D4WA 4N76A 4OKEA 2B4JA 1EP4A 3DRPA 4I2QA 3NF6A 4N5SA 4Z4FA 2D0CA 3R6MA 3DXMA 3K57A 3CJ1A 4FVUA 5JLFA 4FJ7A 1HKGA 1S6PA 1SKWA 4AHRA 4A57A 5HP1A 3HVTA 4FJ8A 2GV9A 4JI2K 3CCRN 4B3SK 4GV6A 1Q9XA 3PLAA 1VQKN 2I7PA 1S3XA 3VQDA 5FPEA 4FLXA 1Z05A 4YFUA 3VTIA 2D0AA 4IFEA 2P9IB 4H5NA 4Z4GA 2AA4A 3NF9A 1RT4A 3VN5A 5F2RA 4CF9A 1C0TA 3CCLN 1NOYA 1UA1A 3RMDA 2G8HA 3O9TA 1NGIA 4PKIA 4DTNA 1KCFA 4CJVA 1NM1A 3ZT1A 2DFHA 4DV0K 3TU5A 2P9IA 4NB4A 2NLXA 4BWMA 3SNNA 2VWBA 1S1XA 3VEXA 3J80O 4LF5K 3K5OA 3LAMA 3ENBA 5KI6A 2ITGA 1RDWX 4EHUA 3EZWA 4RWTA 5A2QO 1S9EA 1QHTA 2JWKA 3S9HA 4DQSA 3CJ7A 3AVFA 3MN7A 3UE5A 3ALYA 5DMRA 3VQ4A 4LH5A 1RBSA 3MN5A 5AZJB 4IFYA 2OA8A 3FFKB 4CEZA 2ZGYA 2PZSA 1SKSA 1VQLN 4CI6A 5DK5A 2KZMA 4WE1A 4FLUA 5BREA 4JI3K 1IKXA 3TTDA 5K14A 3I0SA 3OVNA 1D8YA 3CF5L 2VYPA 1HNZK 4L8RB 1JCGA 3TPQA 1ATNA 5BPNA 1FXXA 5AZJA 3AVLA 4PQUA 3D2FA 3H6EA 3OHRA 4ILHA 2IDOA 3M8PA 4PHTX 5M1NA 3RMBA 4BROA 3MEDA 1HRHA 5EOYA 3LAKA 5KQDA 1P8ZA 4FK4A 4DG1A 4DLGA 4JKEA 1KC8O 4BRIA 1JL2A 4W5RA 5AQYA 1N33K 1C0GA 5KTQA 2F96A 3OS0A 2FLOA 1VRUA 3EKSA 5JICA 3HOSA 4BREA 3HTVA 4CF0A 3M3ZA 4IEIA 1GOCA 3J7ZO 4CEDA 2X6SA 4H0PA 3ULEB 3HO1A 4AILC 3R3LA 1NG9A 4IKFA 3THYB 4M42A 4Z4CA 3FZLA 2KW4A 4FWKA 1V4SA 3TABA 1LCUA 3O8MA 3AA2A 4DF8A 2XO7A 2YJEA 4WF9L 1S1TA 5AFUA 3DJCA 4ELVA 4CJRA 4BRNA 4RCHA 2CGKA 3EE9A 1KVBA 1T7PA 5J2QA 1HJOA 4TSXA 1CZBA 3ZETA 2P51A 3ULEA 4ID1A 3DLLL 1WBDA 3DM2A 3P83D 1LV5A 4DTJA 2NRWA 3KLHA 3QDKA 4BQLA 3LL3A 2PYLA 3V9SA 3JYTA 3MX5A 4CD1A 4CJEA 4OLBA 5FROA 3VEOA 4O8UA 4LY7A 1SV5A 2WOMA 2Q3SA 3P5JA 5CZ2A 3SQ2A 1ZBIA 3ISNC 3AARA 3BDPA 3P38A 1NGHA 1HNVA 3LZIA 4ELUA 4MQ3A 4O0IA 1L3TA 2E5LK 3AO5A 3ZT2A
chains in the Genus database with same CATH topology
2UXBK 1HNZK 1HNWK 3JAMO 4GKJK 5AJ3K 4YHHK 1IBLK 4LF9K 5BR8K 4X64K 4LFAK 4DR4K 4B3RK 4K0KK 4DR5K 2UXDK 1IBKK 1XNRK 4DR6K 1HR0K 4V19S 1FJGK 4DUYK 4JI1K 4DR2K 5FLXO 2UUCK 3T1HK 4B3MK 2UUBK 1N33K 4JI2K 4DR7K 4B3SK 4DV4K 4JI4K 3J7YP 4DV7K 2UU9K 5LL6Z 4LF8K 4CVNE 3OTOK 4JI0K 4DR3K 1XMOK 4X62K 4LFBK 2HHHK 4X66K 2UXCK 1XMQK 4KHPK 4DV5K 1N32K 4B3TK 5IWAK 4LF4K 4DV3K 4DV1K 4X65K 5LMNK 4OX9K 4JV5K 4JI6K 1N36K 4GKKK 4AQYK 4NXNK 4JI7K 5LMUK 4DV0K 2VQFK 1N34K 1IBMK 1XNQK 4JI5K 3J80O 4LF5K 4JYAK 4YY3K 4DR1K 5A2QO 2VQEK 3J81O 4DUZK 4DV2K 4LFCK 4DV6K 4LF7K 4NXMK 1HNXK 5IT9O 3J7AP 4LF6K 2ZM6K 2UUAK 2F4VK 4CW7B 3T1YK 4JI8K 1I94K 2E5LK 1J5EK 4JI3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB K;  1HNZ K;  1HNW K;  3JAM O;  4GKJ K;  5AJ3 K;  4YHH K;  1IBL K;  4LF9 K;  5BR8 K;  4X64 K;  4LFA K;  4DR4 K;  4B3R K;  4K0K K;  4DR5 K;  2UXD K;  1IBK K;  1XNR K;  4DR6 K;  1HR0 K;  4V19 S;  1FJG K;  4DUY K;  4JI1 K;  4DR2 K;  5FLX O;  2UUC K;  3T1H K;  4B3M K;  2UUB K;  1N33 K;  4JI2 K;  4DR7 K;  4B3S K;  4DV4 K;  4JI4 K;  3J7Y P;  4DV7 K;  2UU9 K;  5LL6 Z;  4LF8 K;  4CVN E;  3OTO K;  4JI0 K;  4DR3 K;  1XMO K;  4X62 K;  4LFB K;  2HHH K;  4X66 K;  2UXC K;  1XMQ K;  4KHP K;  4DV5 K;  1N32 K;  4B3T K;  5IWA K;  4LF4 K;  4DV3 K;  4DV1 K;  4X65 K;  5LMN K;  4OX9 K;  4JV5 K;  4JI6 K;  1N36 K;  4GKK K;  4AQY K;  4NXN K;  4JI7 K;  5LMU K;  4DV0 K;  2VQF K;  1N34 K;  1IBM K;  1XNQ K;  4JI5 K;  3J80 O;  4LF5 K;  4JYA K;  4YY3 K;  4DR1 K;  5A2Q O;  2VQE K;  3J81 O;  4DUZ K;  4DV2 K;  4LFC K;  4DV6 K;  4LF7 K;  4NXM K;  1HNX K;  5IT9 O;  3J7A P;  4LF6 K;  2ZM6 K;  2UUA K;  2F4V K;  4CW7 B;  3T1Y K;  4JI8 K;  1I94 K;  2E5L K;  1J5E K;  4JI3 K; 
#chains in the Genus database with same CATH topology
 1BUP A;  4K8X A;  5J2P A;  4CZH A;  1Q8I A;  5GIP A;  3G4S N;  5BRF A;  4BE1 A;  2HBJ A;  4OVL A;  4BVO A;  3CYM A;  5E84 A;  3VMF B;  5M1O A;  3FZM A;  2P5G A;  1ATR A;  4DSE A;  3G6E N;  3SPY A;  4FZY A;  2P9U B;  1Z6R A;  1I3A A;  4YOV A;  3K58 A;  3OBY A;  3A2F A;  5BRH A;  4C8N A;  1VQO N;  2A42 A;  1XHZ A;  3HM9 A;  4U67 L;  2V7Z A;  4DR2 K;  4DMN A;  1GLA G;  2P9P B;  3PO4 A;  2E88 A;  4OGE A;  1YJ9 N;  1BIU A;  4KI6 A;  3BGR A;  4XEI A;  3TSP A;  1YIT N;  1WAF A;  3UKR B;  2OPQ A;  3TAR A;  4JK8 A;  4JKC A;  1HX1 A;  4H0O A;  5LY3 A;  1VQ6 N;  4JD2 A;  4JEP A;  4PL8 A;  2D0P A;  2GEL A;  2E6L A;  3C6T A;  2ETJ A;  2D1K A;  3VEV A;  2HHH K;  1N6Q A;  3H3O B;  2Q1N A;  4CZG A;  1XMQ K;  4KPY A;  4RW9 A;  1QTM A;  2DTU A;  2GX9 A;  3SV3 A;  1IH7 A;  1YT3 A;  3E66 A;  2Z1G A;  3HPG A;  4FPB A;  3OYF A;  5CE3 A;  1BQN A;  3RRH A;  3CCU N;  5LJW A;  5C2D A;  1RT5 A;  2VQF K;  3FZH A;  4IFV A;  1BIZ A;  3QIC A;  4XH4 A;  1KFD A;  4B9V A;  1X1P A;  3K5N A;  5AQT A;  4DSL A;  3DI6 A;  4MFB A;  1NK8 A;  4PL7 A;  4BC5 A;  4OGC A;  4CJ7 A;  3CFO A;  3QBX A;  4LF7 K;  3D2E A;  5HRS A;  4BWJ A;  4FJG A;  3NAE A;  4I7F A;  3HJF A;  4CZJ A;  4LF6 K;  2NRH A;  2WUS A;  3O9R A;  5AFU H;  4A61 A;  2QA4 N;  4ISF A;  3SK3 A;  1E4G T;  1A5W A;  2HBL A;  4DFJ A;  3CET A;  1OKJ A;  4Q5V A;  4CEC A;  4AM7 A;  2BE2 A;  1NKE A;  4CJ5 A;  3SUQ A;  4DTX A;  5M1Q A;  1VQP N;  1NJZ A;  4DTS A;  3VQ6 A;  3GOI A;  2W6L A;  5BR9 A;  3T69 A;  2ASM A;  3PSF A;  4GVE A;  4E19 A;  3U9D A;  4JAX A;  1ZYQ A;  2O8E A;  1MWM A;  4CE9 A;  1B92 A;  1S22 A;  4JKH A;  1UWB A;  5JS1 A;  3SBT A;  4B9N A;  4FWS A;  2E1Y A;  2GUI A;  3M6G A;  4U7B A;  4CFB A;  4CIE A;  3CER A;  1BCO A;  3K59 A;  2WC9 A;  4JN4 A;  3B6O A;  1W2B M;  1SS6 A;  5AQK A;  3SCX A;  3H1V X;  4N56 A;  4FO0 A;  1LWC A;  5C42 A;  4DU3 A;  2ZJQ L;  4JRQ A;  1S5J A;  4FWL A;  4JI4 K;  3CC4 N;  2HMP A;  1JKH A;  3L4I A;  4O0J A;  3C7N A;  5AQG A;  3THV A;  4LFB K;  3V1Q A;  2CGJ A;  2OTL N;  2HOE A;  2NRX A;  2YJF A;  4DWI A;  1QQM A;  1IKY A;  3OYJ A;  1NKB A;  1EKE A;  5DM6 L;  4JV5 K;  3ZT4 A;  4WYB A;  4IG0 A;  4CF2 A;  1NGA A;  3E9P A;  5LMU K;  2Z1J A;  2A1S A;  3AA4 A;  3CXC M;  2O8D B;  3I33 A;  4CZK A;  4YOU A;  5CYQ A;  1WSF A;  5J2M A;  1VQ4 N;  3ZSO A;  1WSH A;  1VQ9 N;  4E1J A;  4JLH A;  3UB5 A;  3SMP A;  3NGZ A;  2KHO A;  3C65 A;  1VSK A;  4FCY A;  4JS4 A;  1NMN A;  1JLC A;  4YDU C;  4DUZ K;  2BDP A;  2QI2 A;  3VTH A;  1K8A O;  4C1N I;  4H4M A;  1VAZ A;  4J2D A;  1HYZ A;  1KAY A;  2O8D A;  2YV0 X;  3PX0 A;  5I3U A;  4FL9 A;  4FJ9 A;  2HF3 A;  4AHT A;  4B1V A;  1I94 K;  4BGB A;  1TYQ B;  5BN9 A;  4XH1 A;  1C6V A;  4CHQ A;  4FZX C;  1O13 A;  2DFF A;  5AQV A;  2W42 A;  1VRT A;  4BE0 A;  1C0F A;  5HRR A;  4MLH A;  4AHV A;  4LFA K;  4OPA A;  1ASW A;  3O4Q A;  3PY8 A;  1RDU A;  4DQR A;  3QEX A;  3F5T A;  4DTM A;  1C1C A;  2O8B A;  3OYB A;  2YNF A;  3K2P A;  4DCH A;  4QCL A;  4DUY K;  1YUW A;  3VF4 A;  4A5A A;  1M1K O;  2QM1 A;  4JI1 K;  1LW2 A;  3KZB A;  3BF1 A;  5FLX O;  1NJX A;  2I5J A;  3NGY A;  3OYG A;  3CQ8 A;  4IEE A;  1WSG A;  5C10 A;  2GUP A;  1TKD A;  1CXQ A;  3WQU A;  4N47 A;  5EY4 A;  3G10 A;  2F7T A;  3SUN A;  5GIN A;  2AJQ A;  4CEF A;  2KQ2 A;  3DOK A;  4CHO A;  3H46 O;  5KPZ A;  1KLN A;  1Y97 A;  4Q0B A;  3T7Z A;  1ITG A;  4OX9 K;  1UAX A;  2YHX A;  3GBT A;  1N36 K;  2IC3 A;  2V51 B;  2CGL A;  1NGF A;  5I9E B;  1NGG A;  5EU7 A;  3WXJ A;  3TAG A;  4KTZ A;  3VQC A;  2FBV A;  3FFI A;  3JS6 A;  1S72 N;  1YTU A;  5FPN A;  3KKR A;  3M8S A;  1IO2 A;  3CJA A;  3PV8 A;  4FLW A;  1BI4 B;  3VQP A;  1ASU A;  3GL1 A;  3IRX A;  3IS9 A;  2D5R A;  5GAH P;  3W0L A;  3WXK A;  3CIP A;  3HI0 A;  4CJQ A;  3O80 A;  2ZM6 K;  4GMJ B;  3MWP A;  3QET A;  3BUZ B;  1TK0 A;  5AQZ A;  4FJK A;  3PSI A;  3PX4 A;  3SUP A;  5E26 A;  5AQF A;  1RBT A;  3NCI A;  4M3U A;  3VF6 A;  3VET A;  3NBP A;  4IJN A;  2O4G A;  2FBY A;  3O9Q A;  3QEI A;  3IG1 A;  5LJV A;  1X3M A;  2ASO A;  5KRS A;  3C94 A;  4YDU A;  4CJT A;  3I0R A;  1JLB A;  1QVG M;  1NOZ A;  1I39 A;  1RDB A;  1L5U A;  3H1Q A;  3CD6 N;  4IBN A;  3CMA N;  4K0K K;  4JNE A;  1XNR K;  3SZ2 A;  3ID6 A;  4CHY A;  1ZBS A;  2HBM A;  4MO4 A;  3MCP A;  3OYN A;  3QLH A;  1KTQ A;  4CZL A;  5FPD A;  5GAD P;  4IO9 L;  3BZC A;  3C6A A;  2YNH A;  3CPW M;  3GG4 A;  3LP1 A;  4GNI A;  4FJ5 A;  5KRT A;  4CJ3 A;  3CCJ N;  4W5Q A;  3MXM A;  3HZ6 A;  1TVR A;  1WLJ A;  4PA1 A;  3EEQ A;  4E1M A;  4H5V A;  5AQH A;  4RW7 A;  5KPR A;  4BR5 A;  3WXI A;  1W0H A;  2XY6 A;  1N32 K;  4LH4 A;  3VEY A;  2KLA A;  4KH4 A;  3EKU A;  1VSD A;  4ILG B;  3QIO A;  3SAH A;  3O9U A;  5F0X A;  3HYF A;  2QKB A;  1NJW A;  3TTC A;  4B1Y B;  3KLF A;  3P31 A;  3SI6 A;  4FZZ A;  4KTQ A;  3E9O A;  4EIA A;  4Z4E A;  2RKI A;  2FC0 A;  4IOC L;  3AVH A;  5AR0 A;  3FGU A;  5FDL A;  3CJC A;  1R0A A;  4ZHR A;  3KHY A;  1F21 A;  4M3W A;  3TAP A;  4B8A B;  4CEA A;  1SAZ A;  5AQQ A;  4YOT A;  5C12 A;  5ELZ A;  3NE6 A;  4AH9 A;  1HUX A;  3W3D A;  2GWJ A;  3L8B A;  2GEM A;  4CFC A;  3SQ1 A;  4DKW A;  4H5W A;  5KQ8 A;  2YKN A;  2BGG A;  4I9Q A;  1VK0 A;  2UXD K;  2RPI A;  3LAL A;  4FJI A;  1MU2 A;  4FJJ A;  3D2F B;  3CM5 A;  1RDA A;  4CK3 A;  1G99 A;  1Q7Y O;  4CBW A;  1NBW A;  3RVC A;  4F9O A;  4M3Y A;  3DYA A;  1TGO A;  2CH5 A;  1SUQ A;  1WOQ A;  1XHX A;  4FLY A;  3NVK A;  1U2V A;  4FWM A;  3SQ0 A;  4B3O A;  3UKU A;  4IG3 A;  4F8R A;  3HST B;  2YNG A;  4BRP A;  3DLB A;  1KFS A;  1JLQ A;  1JLA A;  1UOC A;  3LDP A;  2UXC K;  3QO9 A;  4DV5 K;  1OH8 A;  5CZ1 A;  2QWN A;  3QIP A;  4IOX A;  4DSJ A;  1KXP A;  2V7Y A;  2OPS A;  2FSJ A;  4AQY K;  1RT7 A;  3NH2 A;  4B9U A;  2IGI A;  1RT3 A;  2ZJP L;  3TTF A;  4DFM A;  2NUB A;  4CJL A;  1N5Y A;  3D45 A;  2VGM A;  3MK6 A;  3OYD A;  3SUO A;  3WXM B;  4BRD A;  3O4N A;  1A5V A;  3HXM A;  3NDK A;  2CH6 A;  3VEZ A;  2RF2 A;  3ZET B;  3VOV A;  1JL1 A;  4H5T A;  3ZSX A;  3NMU A;  3L3V A;  3K9K A;  4E0D A;  2HB5 A;  3IAY A;  4AM6 A;  1T8E A;  2BH1 A;  5HRN A;  4AHU A;  3MXI A;  1CLQ A;  4H8K A;  3ATU A;  1X9W A;  3AAP A;  1YJN N;  1T05 A;  4CIG A;  3AVI A;  1X3N A;  3L2V A;  4CW7 B;  3BF3 A;  4A2A A;  1VSJ A;  5AQP A;  4A62 A;  4BDP A;  5JS2 A;  3WUH A;  2BAN A;  1RT6 A;  4RTF D;  1VSE A;  4DTO A;  1DTT A;  4YHH K;  4CD3 A;  1GLL O;  5ADX A;  1X9S A;  1MA9 B;  1W97 L;  3V9U A;  2HST A;  2QWR A;  3LP0 A;  3EO3 A;  2YHW A;  1S1U A;  1NGJ A;  1HR0 K;  1QSS A;  1VQ5 N;  4DQQ A;  4BG9 A;  4OPK A;  4IO8 A;  4CEO A;  4EHT A;  4UY8 O;  4JK7 A;  4BY9 C;  4KTW A;  4CEB A;  3ASM A;  2G8W A;  4DB3 A;  4FWR A;  3L2Q A;  3CM6 A;  5HLF A;  3SV4 A;  2WON A;  1QHA A;  1D5A A;  3J7Y P;  3HP6 A;  4DV7 K;  3I8B A;  3S41 A;  2WTU A;  1TAQ A;  3RMA A;  1Q86 O;  1ZBL A;  1TL3 A;  4CJU A;  2A1R A;  1XMO K;  1BL3 A;  4JD2 B;  2EHG A;  1QQN A;  1D9D A;  3LWM A;  5M1P A;  3CI5 A;  4E3S A;  4FJX A;  4B1Z A;  3KD1 E;  4KHW A;  4WQ4 C;  1CZA N;  3MMV A;  3TAN A;  4CGD A;  1FW6 A;  5AQX A;  2HNY A;  1V4T A;  3TAM A;  2D0O A;  2G8F A;  4H4O A;  4N41 A;  3P39 A;  4RG8 A;  3MDQ A;  3DXK B;  1XNQ K;  3U8X A;  4JKB A;  1YTA A;  3TWH A;  2VCP A;  1OVQ A;  3OY9 A;  3SMS A;  3VPZ A;  4YNQ A;  4NLC A;  3DLG A;  1NGE A;  3LAN A;  4DR1 K;  1QS4 A;  3O08 A;  5FRN A;  4FJM A;  3WQT A;  3ZLJ A;  2OPP A;  4FLV A;  1RIL A;  3AO2 A;  3D2E B;  3J7A P;  2E2N A;  4WFB L;  1H1V A;  3K5L A;  4H0Y B;  3AO3 A;  3DXK A;  4JS5 A;  4KBO A;  4CHN A;  3DLR A;  3CCS N;  3MWT A;  3T1Y K;  4KV8 A;  4GVM A;  4BC3 A;  4B9L A;  1ZBH A;  1KVC A;  3HOT A;  1T6C A;  2QWO A;  5C2F A;  4LF9 K;  5JMV A;  3C95 A;  3SJJ A;  4QOZ B;  1NK0 A;  3OYE A;  3R1X A;  3CQY A;  1RDC A;  1IBK K;  4BG8 A;  5DM7 L;  3CJB A;  3ZSV A;  2O8E B;  3OYK A;  4A59 A;  4DQP A;  2QWL A;  4WFA L;  3HBT A;  2G8K A;  2FBX A;  4OPJ A;  1VSF A;  1YAG A;  3RR7 A;  2V52 B;  5AQL A;  1QZ5 A;  2NRZ A;  4CJK A;  4IWV A;  2QWP A;  1OH6 A;  4K42 A;  5ADX H;  3E9L A;  3VQ8 A;  2FSK A;  4XIU A;  2P5O A;  3VGM A;  2P9N B;  3FZK A;  1T6D A;  4DR3 K;  4GV9 A;  4BR2 A;  3KK7 A;  2F9T A;  4X62 K;  3RSE A;  3VQQ A;  3O3F A;  3C7N B;  4B3T K;  3AVJ A;  1OH7 A;  4DSF A;  4C8L A;  2G8V A;  4CBU A;  3BP8 A;  2OZS A;  3AAQ A;  2A40 A;  3H45 C;  4O5B A;  1RTI A;  1IKV A;  3ENH A;  5C25 A;  3B6P A;  1FKP A;  1VSI A;  3VQB A;  1SL0 A;  4YOY A;  1N34 K;  1U45 A;  1LWF A;  4FJN A;  2P9N A;  1Y64 A;  2ASP A;  3KD5 E;  2E2Q A;  4JI5 K;  3IUC A;  3KWI A;  5AQM A;  2RE2 A;  4UQG A;  4DV6 K;  1R59 O;  2KTQ A;  4PUO A;  2FBT A;  4BDY A;  1L3V A;  2O8C B;  1K8K B;  1U47 A;  5CHI A;  1Q9Y A;  3VGK A;  3ZSZ A;  4DS5 A;  2P1J A;  3IMX A;  3LPU A;  3MCA B;  4FWP A;  3U4L A;  1GLJ O;  1LW0 A;  1RT2 A;  2UUA K;  4O55 A;  1SZ2 A;  3Q7B A;  3ULD A;  3ZSQ A;  4YOW A;  1EWR A;  4LC9 B;  3SBG A;  4DU4 A;  3V9Z A;  5FRM A;  2PYJ A;  4JI8 K;  3LPT A;  3PIO L;  5HL7 L;  1T44 A;  1VQN N;  1RGI A;  4H0V B;  2HNZ A;  2E4L A;  2ZD1 A;  3JAM O;  1T3V A;  1HKB A;  2O8C A;  1K8K A;  3LZJ A;  3KJV A;  3K9J A;  1GLD G;  4B9Q A;  2X78 A;  1SQK A;  1BA1 A;  3OYL A;  2YHY A;  3DLK A;  2O4I A;  4DHY A;  3UIQ A;  4CJS A;  1QSL A;  4FJL A;  2O8B B;  1RT1 A;  3P4I A;  1YI2 N;  3CJ9 A;  4OKK A;  1CXU A;  3HP9 A;  4ZTF A;  5AQJ A;  3AY9 A;  4B1U B;  1B9F A;  2A3Z A;  3T1H K;  4Z0U A;  4DFK A;  4CK2 A;  4E89 A;  3BY5 A;  3VER A;  4ID5 A;  4H0X B;  4CF1 A;  3O5B A;  4LF8 K;  2P9S B;  4PKH A;  3G71 N;  1DTQ A;  4EP4 A;  1OH5 A;  4X66 K;  4G1Q A;  3CQX A;  4BDZ A;  2HHV A;  3EYZ A;  1HJR A;  3KK1 A;  3VQE A;  3FR0 A;  3PIP L;  1JJ2 M;  3E01 A;  4JI6 K;  4HWI A;  4MO5 A;  2HMI A;  2P9S A;  2HHS A;  3NVM A;  4Z4I A;  4B08 A;  4CBX A;  4CGG A;  1ZBU A;  2NRR A;  1L3S A;  1MDU B;  2W41 A;  3L0Q A;  2HVI A;  4C8O A;  3B8A X;  3RTV A;  2KFZ A;  4M45 A;  2VGN A;  4RW4 A;  3JXU A;  5AQW A;  3NH1 A;  3F73 A;  1QQC A;  2OYQ A;  1HMV A;  3VA3 A;  3IKM A;  3M1F A;  4BRF A;  3KKS A;  3THW B;  3AO1 A;  3O1W A;  5IT9 O;  3V6D A;  3L6Q A;  3ZT3 A;  4BRK A;  2IVP A;  3CC2 N;  4W5N A;  1K9M O;  2F4V K;  5HBM A;  4C23 A;  4CFA A;  5EX5 A;  1IJJ A;  4CHP A;  3MN9 A;  1TKZ A;  4KI4 A;  2P9L A;  2IIR A;  2HVH A;  4EFH A;  4WFN L;  1BCM A;  2IAJ A;  3DLH A;  3N4P A;  1W9H A;  3CFR A;  3KTQ A;  4OJR A;  5KGX A;  1B9D A;  1Q81 O;  1BQM A;  3F9M A;  3ITH A;  2VG5 A;  3THW A;  2HHT A;  4JRP A;  4NCB A;  3OYH A;  4FXD A;  3WNF A;  5TKY A;  4O5F A;  3U3G A;  3OJU A;  1IV0 A;  3CFP A;  4BRL A;  4V19 S;  1ILY A;  3C0B A;  4MLE A;  3WEE A;  3C6H A;  4W5T A;  4CJP A;  2X6N A;  5I42 A;  3EL2 A;  2UUC K;  4HUE A;  3IDH A;  1TKX A;  4CER A;  1NWK A;  5HRP A;  1YXQ A;  1FK9 A;  2Q36 A;  4RW8 A;  2H3G X;  2YHA A;  1JXE A;  4CJF A;  3O3H A;  3DMJ A;  3KK2 A;  1X9M A;  1RBU A;  3O4W A;  3MX2 A;  4JKF A;  4FM0 A;  2HHQ A;  3AVB A;  3VF2 A;  3R8E A;  3HK2 A;  2E2P A;  4IXC A;  3LP2 A;  4ISE A;  5IWA K;  3KVG A;  4HCC A;  4YOX A;  4LF4 K;  2FSN A;  4X65 K;  1LWE A;  1YHQ N;  3KIO A;  4HTL A;  2E6M A;  2F9W A;  3DWL A;  1RBV A;  4GKK K;  3O9S A;  1CZ9 A;  4NXN K;  3PX6 A;  1J9A A;  1BWF O;  3F9K A;  4FW1 A;  3CHW A;  3SAG A;  4DSK A;  4H03 B;  1BIS A;  4KKO A;  3LWL A;  1WSE A;  4JHD B;  3KLG A;  4F2R A;  1Z26 A;  4HCB A;  2BUP A;  3OYI A;  3G0Z A;  2GTD A;  1BHL A;  4EAH D;  3NF7 A;  4FW2 A;  4WCE L;  4AHS A;  3CME N;  5CR4 A;  3L4Q A;  4NXM K;  4LSL A;  1G15 A;  4Y1D A;  2FF6 A;  3QML A;  4M3Z A;  2BTF A;  4I9L A;  4BR0 A;  3CPE A;  4H0T B;  3VQ7 A;  5SWM A;  3RRG A;  4JHD A;  4EZ6 A;  4FJH A;  2YKM A;  4C8K A;  3GDQ A;  4BRG A;  5BRD A;  4KH6 A;  4RW6 A;  1YVU A;  4M3X A;  2HHU A;  2IVN A;  4EZ9 A;  1QQO A;  3AVM A;  2P9K B;  1VHX A;  1DEJ A;  1J5O A;  3KK3 A;  4CF8 A;  5JLH A;  1OVY A;  4CEE A;  3NH0 A;  3U6F A;  5C15 A;  1U49 A;  3QNN A;  4M3T A;  4FLZ A;  5M1K A;  1BGX T;  3TAF A;  4A2B A;  1HQE A;  3MAQ A;  1YF5 L;  2OAN A;  2E1Z A;  3PO5 A;  4BR9 A;  1NGD A;  2P9K A;  3A8Y A;  3OJS A;  1VSL A;  4J2A A;  3A5O C;  1NGC A;  3HPO A;  1D9F A;  1WSJ A;  2ATQ A;  2ZQB A;  4B3M K;  2Q31 A;  4CJW A;  4M63 C;  3D6R A;  3ZX2 A;  2Z1I A;  1U2V B;  4R5P A;  4CHZ A;  3JSM A;  3S3O A;  3UKU B;  3OTO K;  3ZCM A;  1IG9 A;  3LDN A;  4BVP A;  4E7L A;  1YVN A;  2QWM A;  4MDB A;  3U3Y A;  4KHP K;  1X9J A;  2QXL A;  4JK9 A;  4DTU A;  4DV3 K;  4CZF A;  4DV1 K;  1TL1 A;  5LMN K;  1NK6 A;  4BR7 A;  3A0I X;  1J54 A;  4ICL A;  4BRA A;  3DRR A;  3TR8 A;  4JI7 K;  4CZE A;  3LM2 A;  3V1R A;  3KLE A;  3TAQ A;  2XRI A;  4QAG A;  4FYD A;  4FPA A;  1S1V A;  1TK8 A;  1HPM A;  4E1N A;  4KH5 A;  2QKK A;  4IZ9 A;  3VA0 A;  4B1W B;  1RNH A;  3ZSW A;  4JYA K;  2QWQ A;  4B9S A;  4FOE A;  3MEE A;  3U9Z A;  4IOA L;  3CCQ N;  3VQ5 A;  3L2U A;  1HQU A;  4KFB A;  4C8M A;  5HOO A;  2QEX N;  4CCH A;  4HTU A;  4BRQ A;  5JVH L;  3MEC A;  1HNX K;  4NYF A;  4F4K A;  5HRO A;  3AVA A;  4BRH A;  2XHB A;  3NHG A;  1TKT A;  1YIJ N;  2G8U A;  1RBR A;  4R79 A;  3A5M C;  4FSV A;  1C1B A;  2YNI A;  1J5E K;  3BEX A;  1NLV A;  3IFR A;  2R7Y A;  4KB1 A;  4K41 A;  3OW2 M;  2QK9 A;  3QER A;  3RR8 A;  3N4Q A;  4GKJ K;  1IBL K;  1U48 A;  3L2R A;  3QBW A;  1WB9 A;  4DR4 K;  3EE8 A;  1QVF M;  3HSC A;  1RDD A;  1TAU A;  3O1B A;  1TV6 A;  4M3R A;  4C1N K;  5GAG P;  1HNI A;  2NNW A;  3V9W A;  1NU0 A;  3CCE N;  1QSY A;  4M7X A;  2X74 A;  3ZSY A;  4FM1 A;  3MXJ A;  1HPZ A;  2B6A A;  2E20 A;  2FXU A;  5TKW A;  3SAF A;  3EZ5 A;  3CCM N;  3TSQ A;  4QS8 A;  1EXQ A;  3D7E O;  1TUU A;  1RTJ A;  1GOA A;  4JI0 K;  4NCG A;  3QB0 A;  2E2O A;  3EY1 A;  3THY A;  2W6K A;  3ZX0 A;  5KPT A;  4FWQ A;  3PUF A;  4HUF A;  3ZX3 A;  1E3M A;  1REV A;  2A41 A;  1NK4 A;  3BZK A;  1KSP A;  1NK7 A;  2Q97 A;  1DLO A;  1NJY A;  2WBN A;  1Q18 A;  2J4R A;  3L3U A;  4BR4 A;  1NMD A;  3OYA A;  2G8I A;  1O1W A;  3ZSR A;  2RN2 A;  5EVZ A;  3DAW A;  1S1W A;  3LDS A;  4F2S A;  1VSM A;  3OYC A;  4DTP A;  1LAV A;  4F3T A;  2PY5 A;  2XY5 A;  3TAE A;  1Z25 A;  3WXL A;  2I7N A;  4CJ4 A;  4YY3 K;  2LSN A;  4CGH A;  1U4B A;  3SLC A;  4PY5 A;  4KB0 A;  3VGL A;  2HBK A;  2RHK A;  2E8A A;  4A5B A;  2VQE K;  1UA0 A;  1EWQ A;  3HM8 A;  3K0S A;  1JLF A;  1C1A A;  1MWK A;  4M7Y A;  4GW6 A;  4NYN A;  4B1X B;  1XQS C;  4ZTJ A;  3OS1 A;  3AO4 A;  2Q0U A;  2NRV A;  1WNS A;  3OA9 A;  1XI1 A;  3WT0 A;  2HF4 A;  2DPN A;  2ZWH A;  4DFP A;  4E7I A;  4QS7 A;  3NF8 A;  1K6Y A;  2Q2R A;  4AHC A;  1DT9 A;  1U6Z A;  1C0U A;  1QZ6 A;  3C6U A;  3THX B;  4KAZ A;  1HNW K;  3LDL A;  4B9T A;  3CCV N;  1U04 A;  3OS2 A;  3CG7 A;  2JGU A;  4B3R K;  1BO5 O;  2P9U A;  1IG8 A;  4NCA A;  3E1Y A;  1E4F T;  1RTH A;  3GE1 A;  2DY4 A;  3O6W A;  3ZEU B;  4Y0W A;  2Z1H A;  2P9P A;  3LM9 A;  3THX A;  1NNE A;  2YI1 A;  4I2P A;  3MN6 A;  4DQI A;  1JCF A;  1NK9 A;  5AQS A;  2UUB K;  1YJW N;  4J2E A;  3UKR A;  1L3U A;  3AA5 X;  4NLB A;  2UU9 K;  3I55 N;  2A5X A;  3ID8 A;  1JCE A;  3ZEU A;  5GAE P;  4KHS A;  3QEV A;  3V9X A;  1NJI O;  3VEW A;  2YX6 A;  2QTD A;  3HVR A;  1VQ7 N;  2EWS A;  3RSE B;  4DSI A;  4KHY A;  3ENO A;  3CC7 N;  2D0B A;  4IDK A;  3T1A A;  1IKW A;  3NFA A;  3I8D A;  4F3O A;  5BPL A;  1IBM K;  2VWK A;  4FM2 A;  4IJA A;  3VEN A;  1JLE A;  3F2K A;  1VSH A;  1WSI A;  4LD0 A;  4WQ5 C;  1S9G A;  2WFB A;  3H08 A;  1TK5 A;  4ISG A;  3AV9 A;  3M8Q A;  3SPZ A;  4O4G A;  4CK1 A;  3FZF A;  4LFC K;  3A5N C;  1GLF O;  4KHU A;  3QFU A;  5D3G A;  2ZE2 A;  4CGJ A;  3LDQ A;  4HHT A;  1XC9 A;  5B8H A;  4CZI A;  2OTJ N;  3AVK A;  3VQ9 A;  1D4X A;  4B8C A;  2PBD A;  2IS3 A;  2KZZ A;  1KQS M;  3QNO A;  1NGB A;  1ZXO A;  3TSU A;  4KRF A;  3RWU A;  3K5M A;  3AA3 A;  4HUG A;  2QW9 A;  1VQM N;  2A6A A;  5T7B A;  2Y1J A;  4X64 K;  4OKJ A;  3ZT0 A;  4CGF A;  3D0P A;  4WQ4 A;  4MDA A;  3ATV A;  2UYT A;  4E7J A;  2EX3 A;  4FK2 A;  4HVJ A;  3ZYY X;  4BC4 A;  1GLC G;  2ZJR L;  3R9P A;  4BRC A;  3V1O A;  1NK5 A;  2VWJ A;  1QE1 A;  3EN9 A;  1LOT B;  1LAW A;  4DTR A;  5JVG L;  3T3F A;  2IVO A;  4JKA A;  3QIN A;  2DFE A;  5J2N A;  4KO0 A;  3NGI A;  2Y1I A;  4CFD A;  3V81 A;  4FOI A;  3AGK A;  1W7A A;  3SYZ A;  3Q7C A;  4CGI A;  2B5J A;  4FWN A;  1A5X A;  5AQR A;  1HYS A;  1BDG A;  2PAV A;  3TI0 A;  1WBB A;  2ITM A;  2KFN A;  4FLT A;  2HHW A;  3VQA A;  3T19 A;  3AVG A;  4FK0 A;  5AQO A;  1T03 A;  1BOT O;  2IOC A;  1VQ8 N;  4L3Q A;  4ELT A;  4BAC A;  3DLE A;  1KVA A;  2FF3 B;  2F8S A;  5BN8 A;  4CEQ A;  5AZI B;  5M1F A;  2KKZ A;  4W5O A;  3S3N A;  3M5R A;  4M41 A;  1NKC A;  5CY4 A;  2ZGZ A;  4BRM A;  4BC2 A;  3QEW A;  5GIO A;  3WNH A;  4ILJ A;  4G9Z A;  3DRS A;  4OO1 J;  4FWO A;  3SQ4 A;  4DV2 K;  3J81 O;  4GV3 A;  4DF4 A;  5BPM A;  4CZM A;  2HHX A;  5AZI A;  3FLC O;  5MLC Q;  3V4I A;  3HPH A;  1Q82 O;  1XWL A;  2ZF5 O;  1SKR A;  4B9M A;  1KD1 O;  3QES A;  1BU6 O;  1TYQ A;  1HKC A;  1ZC6 A;  4WQ5 A;  2P9L B;  2Q0R A;  3M8R A;  5AJ3 K;  3WNG A;  5BR8 K;  3KWG A;  2XY7 A;  3HL8 A;  5H1S Q;  1RTD A;  4JKG B;  1XUP O;  1P90 A;  4AF1 A;  1ZBF A;  4LSN A;  4EP5 A;  5AQI A;  2JWL A;  4DR5 K;  3VES A;  4CES A;  3MEG A;  2GBZ A;  4DR6 K;  1BG3 A;  1FJG K;  4Z94 A;  1JLG A;  1KLM A;  4KRE A;  2O8F B;  1XC3 A;  3WEE B;  1RFQ A;  3A5L C;  5C24 A;  4IDH A;  4JKG A;  2OZM A;  2XY8 A;  2W40 A;  1KAX A;  3AVC A;  1C0M A;  4I6M B;  4DR7 K;  4DV4 K;  3G25 A;  3QEP A;  3H3N O;  3SJH A;  1TUY A;  5E41 A;  1JXB A;  5LL6 Z;  1J53 A;  1RCH A;  1SL1 A;  4K8Z A;  3KLI A;  5J1E A;  4E7K A;  1EET A;  4CVN E;  1M90 O;  3O3G A;  2AP1 A;  4DU1 A;  4J2B A;  1J6Z A;  1GLE G;  3DOL A;  1BA0 A;  2OPR A;  1SL2 A;  4J8F A;  2O8F A;  1GLB G;  3P1G A;  4E7H A;  4PWD A;  4YOR A;  3LP3 A;  4DS4 A;  5C0Y A;  4I6M A;  3I56 N;  1ASV A;  1KAZ A;  1EO1 A;  2OCE A;  1EX4 A;  1DKG D;  2PFU A;  4OPH A;  4DQ8 A;  5AQN A;  5AQU A;  3S3M A;  2NZT A;  2YCH A;  4O44 A;  4BGA A;  4KHN A;  1ESV A;  4K43 A;  4XH5 A;  5EXW A;  2QXF A;  1WAJ A;  3AGR A;  1BI4 A;  3OYM A;  4KHQ A;  1DGK N;  3L2W A;  4CIF A;  1ATS A;  2NRT A;  4Z4H A;  3HRG A;  4BE2 A;  1K73 O;  1HLU A;  4JKD A;  4FVM A;  1N8R O;  2HW3 A;  1WN7 A;  3FE1 A;  2VG6 A;  3HT3 A;  1HYV A;  4BQZ A;  4O8K A;  4OLA A;  2GWK A;  5FPM A;  2JLE A;  3WNE A;  3RMC A;  2F8T A;  2YHB A;  4GY2 B;  3DXM B;  1KRP A;  2UXB K;  5KGW A;  1FKO A;  1WUA A;  5CYM A;  3QFP A;  3J8A A;  3AVN A;  4DLE A;  4PKG A;  1S6Q A;  4Y1C A;  3LDO A;  4QS9 A;  4NO7 A;  5F1X A;  1GOB A;  2HND A;  4H5R A;  4K25 A;  5SZT A;  2VG7 A;  3OBW A;  1EQY A;  2D4W A;  4N76 A;  4OKE A;  2B4J A;  1EP4 A;  3DRP A;  4I2Q A;  3NF6 A;  4N5S A;  4Z4F A;  2D0C A;  3R6M A;  3DXM A;  3K57 A;  3CJ1 A;  4FVU A;  5JLF A;  4FJ7 A;  1HKG A;  1S6P A;  1SKW A;  4AHR A;  4A57 A;  5HP1 A;  3HVT A;  4FJ8 A;  2GV9 A;  4JI2 K;  3CCR N;  4B3S K;  4GV6 A;  1Q9X A;  3PLA A;  1VQK N;  2I7P A;  1S3X A;  3VQD A;  5FPE A;  4FLX A;  1Z05 A;  4YFU A;  3VTI A;  2D0A A;  4IFE A;  2P9I B;  4H5N A;  4Z4G A;  2AA4 A;  3NF9 A;  1RT4 A;  3VN5 A;  5F2R A;  4CF9 A;  1C0T A;  3CCL N;  1NOY A;  1UA1 A;  3RMD A;  2G8H A;  3O9T A;  1NGI A;  4PKI A;  4DTN A;  1KCF A;  4CJV A;  1NM1 A;  3ZT1 A;  2DFH A;  4DV0 K;  3TU5 A;  2P9I A;  4NB4 A;  2NLX A;  4BWM A;  3SNN A;  2VWB A;  1S1X A;  3VEX A;  3J80 O;  4LF5 K;  3K5O A;  3LAM A;  3ENB A;  5KI6 A;  2ITG A;  1RDW X;  4EHU A;  3EZW A;  4RWT A;  5A2Q O;  1S9E A;  1QHT A;  2JWK A;  3S9H A;  4DQS A;  3CJ7 A;  3AVF A;  3MN7 A;  3UE5 A;  3ALY A;  5DMR A;  3VQ4 A;  4LH5 A;  1RBS A;  3MN5 A;  5AZJ B;  4IFY A;  2OA8 A;  3FFK B;  4CEZ A;  2ZGY A;  2PZS A;  1SKS A;  1VQL N;  4CI6 A;  5DK5 A;  2KZM A;  4WE1 A;  4FLU A;  5BRE A;  4JI3 K;  1IKX A;  3TTD A;  5K14 A;  3I0S A;  3OVN A;  1D8Y A;  3CF5 L;  2VYP A;  1HNZ K;  4L8R B;  1JCG A;  3TPQ A;  1ATN A;  5BPN A;  1FXX A;  5AZJ A;  3AVL A;  4PQU A;  3D2F A;  3H6E A;  3OHR A;  4ILH A;  2IDO A;  3M8P A;  4PHT X;  5M1N A;  3RMB A;  4BRO A;  3MED A;  1HRH A;  5EOY A;  3LAK A;  5KQD A;  1P8Z A;  4FK4 A;  4DG1 A;  4DLG A;  4JKE A;  1KC8 O;  4BRI A;  1JL2 A;  4W5R A;  5AQY A;  1N33 K;  1C0G A;  5KTQ A;  2F96 A;  3OS0 A;  2FLO A;  1VRU A;  3EKS A;  5JIC A;  3HOS A;  4BRE A;  3HTV A;  4CF0 A;  3M3Z A;  4IEI A;  1GOC A;  3J7Z O;  4CED A;  2X6S A;  4H0P A;  3ULE B;  3HO1 A;  4AIL C;  3R3L A;  1NG9 A;  4IKF A;  3THY B;  4M42 A;  4Z4C A;  3FZL A;  2KW4 A;  4FWK A;  1V4S A;  3TAB A;  1LCU A;  3O8M A;  3AA2 A;  4DF8 A;  2XO7 A;  2YJE A;  4WF9 L;  1S1T A;  5AFU A;  3DJC A;  4ELV A;  4CJR A;  4BRN A;  4RCH A;  2CGK A;  3EE9 A;  1KVB A;  1T7P A;  5J2Q A;  1HJO A;  4TSX A;  1CZB A;  3ZET A;  2P51 A;  3ULE A;  4ID1 A;  3DLL L;  1WBD A;  3DM2 A;  3P83 D;  1LV5 A;  4DTJ A;  2NRW A;  3KLH A;  3QDK A;  4BQL A;  3LL3 A;  2PYL A;  3V9S A;  3JYT A;  3MX5 A;  4CD1 A;  4CJE A;  4OLB A;  5FRO A;  3VEO A;  4O8U A;  4LY7 A;  1SV5 A;  2WOM A;  2Q3S A;  3P5J A;  5CZ2 A;  3SQ2 A;  1ZBI A;  3ISN C;  3AAR A;  3BDP A;  3P38 A;  1NGH A;  1HNV A;  3LZI A;  4ELU A;  4MQ3 A;  4O0I A;  1L3T A;  2E5L K;  3AO5 A;  3ZT2 A; 
#chains in the Genus database with same CATH homology
 2UXB K;  1HNZ K;  1HNW K;  3JAM O;  4GKJ K;  5AJ3 K;  4YHH K;  1IBL K;  4LF9 K;  5BR8 K;  4X64 K;  4LFA K;  4DR4 K;  4B3R K;  4K0K K;  4DR5 K;  2UXD K;  1IBK K;  1XNR K;  4DR6 K;  1HR0 K;  4V19 S;  1FJG K;  4DUY K;  4JI1 K;  4DR2 K;  5FLX O;  2UUC K;  3T1H K;  4B3M K;  2UUB K;  1N33 K;  4JI2 K;  4DR7 K;  4B3S K;  4DV4 K;  4JI4 K;  3J7Y P;  4DV7 K;  2UU9 K;  5LL6 Z;  4LF8 K;  4CVN E;  3OTO K;  4JI0 K;  4DR3 K;  1XMO K;  4X62 K;  4LFB K;  2HHH K;  4X66 K;  2UXC K;  1XMQ K;  4KHP K;  4DV5 K;  1N32 K;  4B3T K;  5IWA K;  4LF4 K;  4DV3 K;  4DV1 K;  4X65 K;  5LMN K;  4OX9 K;  4JV5 K;  4JI6 K;  1N36 K;  4GKK K;  4AQY K;  4NXN K;  4JI7 K;  5LMU K;  4DV0 K;  2VQF K;  1N34 K;  1IBM K;  1XNQ K;  4JI5 K;  3J80 O;  4LF5 K;  4JYA K;  4YY3 K;  4DR1 K;  5A2Q O;  2VQE K;  3J81 O;  4DUZ K;  4DV2 K;  4LFC K;  4DV6 K;  4LF7 K;  4NXM K;  1HNX K;  5IT9 O;  3J7A P;  4LF6 K;  2ZM6 K;  2UUA K;  2F4V K;  4CW7 B;  3T1Y K;  4JI8 K;  1I94 K;  2E5L K;  1J5E K;  4JI3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...