1HNZK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnzK00
4GKKK 4DV7K 4DV3K 4K0KK 4JI0K 4DR7K 1IBMK 4V19S 4LF9K 2UXCK 4GKJK 4DV0K 3JAMO 1XMOK 5FLXO 4JI7K 4OX9K 4LF8K 2VQFK 2E5LK 4LF4K 1N36K 5AJ3K 4YHHK 1IBKK 4CVNE 5LMUK 4B3RK 1HNXK 4LFCK 4JV5K 4X64K 1HNWK 3J81O 4JI4K 1N32K 1J5EK 2UXBK 4DV6K 4DV4K 4DR2K 4DUYK 1HNZK 4NXMK 4LF6K 5IWAK 4X66K 4JI8K 4CW7B 4JYAK 1N33K 1I94K 4B3SK 4X65K 5A2QO 4DV5K 4DV2K 4LF7K 4LFAK 3T1HK 4DR5K 2UUCK 4JI5K 3J7AP 2UXDK 4LFBK 2VQEK 4KHPK 5LL6Z 4DR4K 3J80O 4X62K 2HHHK 1XMQK 5LMNK 3T1YK 4DV1K 1N34K 4LF5K 1XNQK 1XNRK 4JI3K 4AQYK 4JI2K 4DUZK 1IBLK 2UU9K 4B3MK 4JI1K 5BR8K 4DR1K 1HR0K 3OTOK 4NXNK 1FJGK 2ZM6K 3J7YP 4YY3K 2UUBK 4B3TK 4DR3K 5IT9O 2F4VK 2UUAK 4JI6K 4DR6K
chains in the Genus database with same CATH superfamily
5J2QA 1TYQA 1SAZA 3FZHA 1U47A 4A5BA 4DTRA 4CEAA 4DS4A 4FL9A 4HUFA 1HKBA 4LF9K 4O0IA 4BRFA 5JLFA 4O8UA 5M1OA 1WSFA 1QTMA 3RSEB 3LL3A 1YJWN 2E2OA 5I3UA 3OYAA 5EOYA 4NCBA 4IFEA 3M8SA 3SBGA 4CGHA 4K42A 4Z4HA 3CJ9A 5AZJA 2DFFA 3CCLN 4RW4A 4JKHA 4YORA 4H0YB 2YHWA 2G8WA 3RSEA 4E0DA 2IOCA 1TK0A 1YVUA 5C10A 3CFOA 2VGNA 4XH5A 1XC9A 2HHQA 3NVMA 3ZSQA 4WFBL 1JKHA 4E7KA 3OYIA 5TKWA 4CK2A 4F3OA 1VSHA 3TTFA 3VEWA 1ILYA 2A6AA 5J2MA 2ITMA 1Q7YO 2X78A 3CIPA 4CJ5A 5CZ2A 1KLNA 3VGMA 3AY9A 2HW3A 3G0ZA 1WSIA 4NO7A 4KRFA 2FLOA 4KI4A 2HF4A 1HYSA 2WBNA 2Z1IA 4BWJA 4CF9A 1U2VA 4FWNA 4JKFA 3DXMA 1WLJA 3CJCA 1VQ8N 4FXDA 3THWA 1IBLK 4M3WA 3GE1A 1WBBA 2YCHA 5AQRA 1RT2A 3MX2A 1R0AA 3D45A 4B9UA 4LSLA 3TWHA 2RKIA 4DU3A 4KHSA 1LAVA 1I3AA 1RTJA 1ZBLA 4FLVA 2ZM6K 4H5VA 4WQ4C 3EKUA 3OYJA 1BI4B 4FWOA 2PFUA 3CMAN 4JKGB 1KAZA 1TL3A 4CGFA 4B1XB 2QWNA 4C8KA 4FJJA 4IWVA 3ZSZA 5GINA 4W5TA 3CM6A 4BC4A 3L2VA 2UXCK 4CJFA 3M3ZA 1WSJA 2G8KA 1YTUA 4BG8A 5FLXO 3QEPA 4NCAA 1FXXA 3VESA 1X9SA 1GLJO 3CG7A 2Q31A 2OCEA 3LP1A 3K0SA 1RT7A 3CC7N 3AO5A 4PL7A 2NLXA 1D8YA 4FWRA 4LH4A 1NK0A 2QWRA 2W6KA 2Z1HA 4BDZA 2CGJA 4CEZA 4IXCA 4IZ9A 1OH6A 3HK2A 3E9OA 1GOAA 3V1RA 1S72N 3LDPA 3P4IA 1B92A 3OYGA 3H6EA 3BZCA 1E4FT 3BF1A 4JHDB 3SQ0A 1QQOA 1DEJA 4B1ZA 1NGIA 4CJ3A 1YHQN 3BP8A 4OKEA 3UKRB 2OPPA 4PKGA 4PKHA 2KZZA 1NLVA 1J6ZA 4QAGA 4BVPA 4A5AA 4FLXA 1S9EA 3PO4A 3J7AP 2DTUA 2KFNA 2E1ZA 1X3MA 4L3QA 4FLZA 4E89A 1ASWA 4BE0A 4XEIA 5HLFA 2O8EB 2XRIA 4PL8A 1REVA 2HHUA 1Q86O 4CEFA 4J2BA 1IH7A 1S6QA 3AVHA 3IUCA 1NK9A 4L8RB 4EHTA 1TK8A 3TSQA 1GLFO 4I7FA 1HQUA 3VEVA 4KTQA 4B3MK 3AA3A 4DSEA 1W0HA 2HSTA 3K57A 1Q8IA 4DLGA 1C0FA 4FJMA 1ATRA 2I7NA 4BE1A 3CETA 4A59A 5JVGL 3EEQA 4F2RA 3Q7CA 3IRXA 3C95A 3OVNA 4JI6K 1NOYA 1RGIA 2GWKA 4CERA 4JD2A 1Z26A 2P5GA 1KXPA 4YOTA 1S1VA 3OW2M 4KREA 3EZ5A 3KD1E 3TABA 1XMOK 4JLHA 3DXMB 2VWKA 4DTXA 4DF8A 5KQDA 1KSPA 3IFRA 5BPMA 5AJ3K 1CZAN 1YVNA 3ZSXA 5F0XA 2XY6A 5FRMA 3DXKA 2D5RA 5LMUK 3C7NA 4R79A 4QS9A 4JRQA 1IG8A 3JXUA 2HNZA 1HKCA 1HNXK 3KVGA 3V6DA 3DWLA 5BRHA 4IDHA 4A2AA 2WUSA 1YIJN 3J81O 4ELVA 1N32K 1Z6RA 3K5NA 2D0OA 2P1JA 4DV6K 1NU0A 1XC3A 5C25A 1HNIA 1A5XA 3FZFA 2QXLA 1A5VA 4YDUA 4H5TA 4ELUA 3WNGA 4JI8K 4FJXA 3SUPA 3LP2A 4M3YA 1QQMA 3EN9A 3O8MA 4H0VB 1TKTA 4OLAA 3RMCA 1S1WA 4CHPA 2YJEA 3WEEA 2VG7A 3VQ7A 3ZX2A 3CI5A 5FROA 3BUZB 1VHXA 1S1TA 3AVNA 2QWLA 1QVGM 5HRNA 3VQ5A 2IVNA 4BC5A 2E6MA 3E01A 1NK4A 2Q3SA 5E26A 4Z4CA 1K8KA 5KGWA 1RTHA 5DK5A 5AQFA 3FZKA 4H0TB 4ILGB 1QHTA 3F5TA 4YOWA 3L0QA 3WQTA 1UAXA 1UOCA 2P9KB 1ESVA 3PV8A 1KAYA 5F2RA 4GVEA 3HZ6A 1R59O 1A5WA 3C6UA 5MLCQ 4XH4A 1W7AA 1NGAA 1C0MA 3VTHA 3P83D 4ZTJA 1J54A 1NOZA 4DB3A 5DMRA 3KIOA 1FKPA 4OKKA 1HLUA 4M7YA 3WUHA 4I9LA 3CQYA 2GTDA 5C2FA 4DMNA 3H08A 2NRVA 1O13A 2I7PA 1N8RO 3SPZA 4CIEA 3V1QA 1WSGA 3U9ZA 3TSUA 3VQCA 3KHYA 1EKEA 2FSKA 3ULEB 3WXJA 4CI6A 3V9ZA 3LPUA 2F9TA 4M63C 3MN5A 4CVNE 1KLMA 2PYLA 4KPYA 3ZSOA 1KRPA 1S1XA 3P39A 4KTWA 2IVPA 4FJNA 3OYDA 1ZBHA 2P51A 2X6SA 3A5NC 3LP3A 1LAWA 4HVJA 3V1OA 1NJWA 3UKRA 4BDPA 3VA0A 3E9PA 4CHQA 4CJ4A 4EAHD 2KQ2A 4U67L 1KVCA 2X6NA 4Z0UA 4DV4K 4DR2K 2PYJA 2VWBA 2CGKA 3SV4A 4KH5A 3OYKA 4CHOA 3THXB 1HRHA 2IVOA 1NGJA 1NMNA 3ENOA 4CW7B 4NB4A 2B4JA 3TSPA 3HP9A 4H5WA 3LDOA 1C1AA 4OPJA 1J9AA 1QVFM 2YX6A 1MWMA 4RW6A 3P31A 4FM2A 4ELTA 4ID1A 2P9IA 4CZFA 2BANA 2HMIA 1SL2A 3B6PA 1LCUA 3CJ1A 4JI3K 5BPLA 2BE2A 2RN2A 2O8CA 2E2QA 3SK3A 1CZ9A 3KLIA 4BRKA 3LAMA 4CGIA 2ZF5O 1Q9XA 5FPMA 3R9PA 1RCHA 5IT9O 2E88A 1JJ2M 3CCRN 1KD1O 3Q7BA 4FW1A 4JKEA 4CEOA 4K0KK 2OTJN 1XWLA 3E9LA 3L2UA 1NK7A 2FF6A 3G4SN 3HPHA 1RDCA 3KJVA 1WSHA 2QTDA 3T1AA 1IKXA 4NYFA 4BROA 4FJKA 3SZ2A 3I8BA 1IBKK 5C42A 2P9UA 5CZ1A 4EP5A 5EX5A 4QCLA 5AQWA 1D9DA 1VSFA 3ZETA 4FM1A 3ZT1A 3HOSA 3DRPA 2ZGZA 2W41A 2RE2A 1KFSA 1F21A 2KLAA 3ID6A 3HO1A 5I9EB 2FBYA 1KTQA 1BOTO 3AVAA 4QOZB 5CYQA 4FJIA 3V9SA 5KGXA 3RTVA 4JYAK 2QEXN 1QS4A 4B9NA 2G8IA 3THYB 2XY5A 3TAPA 4EZ9A 3LALA 4Z4FA 3S9HA 4LFAK 1CXUA 3JS6A 5AZIB 4CJUA 3IG1A 1BO5O 5AQXA 4FWMA 3SUNA 3C6HA 3ZYYX 2VQEK 3HM8A 3BZKA 5M1KA 3J80O 4H5RA 2IAJA 1HQEA 1RTDA 4CEQA 1VSDA 3T1YK 1Y97A 4KB1A 1LWCA 3C6AA 2QK9A 4M3RA 4CCHA 4GW6A 4DV1K 4DQPA 3EYZA 2XY8A 2IDOA 5AQHA 1ATSA 1SKSA 4KH4A 3NDKA 3DMJA 4B9SA 4A57A 3HBTA 3SJJA 2EHGA 2UYTA 5JMVA 1RBRA 1X9MA 3O9QA 4MLHA 4LH5A 3I33A 4F3TA 2ASMA 4KHUA 1DT9A 5AR0A 4BR0A 4FSVA 4K43A 1VQON 3BDPA 4GKKK 1WNSA 4CD1A 5C24A 4MDAA 1IBMK 3A2FA 3QERA 3CQXA 3JAMO 4XH1A 5ADXA 1YXQA 4CFCA 2VQFK 3PO5A 1MU2A 2F8SA 3KLGA 3AAPA 3M1FA 3PX4A 3TAFA 3H46O 3D2FB 2P9IB 2DFEA 2HBLA 4OKJA 5BN9A 2E2PA 1W97L 1OVYA 1BCOA 4W5OA 3ZLJA 4H0PA 1QHAA 3PSIA 2WC9A 3PSFA 3NGYA 5JICA 3CJBA 5EU7A 3GL1A 4LF6K 2FBTA 4DTPA 5IWAK 4CZJA 4B9TA 3VF2A 4X66K 1NG9A 3NF9A 2ZWHA 1TVRA 5BRFA 2VCPA 4JAXA 5J1EA 5DM7L 4J8FA 5KTQA 2GBZA 5AFUA 1H1VA 3D6RA 4C8OA 3VGKA 4ISFA 2KKZA 5GAGP 4RTFD 1GLBG 3O1BA 4CEBA 2QKKA 4FO0A 1U4BA 2F9WA 5H1SQ 5GIOA 3OJSA 3MXIA 3HSCA 2P9KA 2HHHK 3VQBA 1K6YA 3ZT4A 4Z4EA 1VSKA 4M3XA 1TK5A 1WUAA 1VQLN 3PY8A 1TV6A 4FWQA 3AVCA 1QSSA 3VQPA 4JKAA 5FPDA 3M8RA 5AQPA 1UA0A 5HRPA 3CPEA 4BRDA 5BR8K 4KHYA 3MXJA 3SV3A 3ZEUB 1L3TA 3LDLA 3MN6A 4M7XA 2G8UA 5BN8A 2JLEA 4DR6K 3HTVA 1NGBA 3UE5A 1T7PA 3K58A 4JN4A 4OPHA 3CHWA 1WSEA 1J53A 3VF4A 4AHUA 4FZYA 1GLDG 2A1SA 4IJAA 3L2WA 1EXQA 2A3ZA 3KK3A 2NRWA 3LANA 4B3OA 3MX5A 4C8NA 3EZWA 1T44A 4FM0A 3L2RA 1N36K 1KVBA 5AQIA 4WCEL 1JL2A 3ALYA 4BR7A 2GELA 4M45A 1GLCG 1NBWA 4BRHA 5AQMA 1D9FA 3CCEN 1RT3A 3MXMA 4PUOA 3KLHA 3CM5A 4E1NA 3VQQA 1X1PA 4F2SA 3L6QA 3SUQA 2KFZA 2ASPA 5CHIA 2WTUA 3O6WA 4RG8A 3SQ1A 1BL3A 2YNFA 3SCXA 4HHTA 5AQZA 4CHZA 2X74A 3AVFA 3OYFA 3DLLL 4BY9C 4DTSA 3QETA 1QQCA 3SYZA 1ITGA 3VERA 4DTNA 3TAMA 4B9MA 2FBXA 1NJZA 5LY3A 1C0UA 4JKDA 5FPEA 1S9GA 2YHBA 4CF2A 1JL1A 2P9PB 1JLEA 2UXDK 2VG5A 4WF9L 3K5LA 1VSMA 4ISGA 4O4GA 3AGRA 4X62K 4RCHA 1HYZA 4GV6A 4CK1A 3O3FA 2KHOA 5M1NA 4FOIA 2G8FA 2ZJRL 4JS5A 2O8EA 1DTQA 1L3VA 1UA1A 4GVMA 4Y0WA 4NLBA 2HHXA 1Y64A 4FWLA 2QM1A 2PBDA 2A5XA 4F9OA 3QB0A 1T03A 5KI6A 1RDBA 4DTMA 3G10A 2E4LA 3K5OA 4KI6A 3L3VA 2F4VK 2HB5A 4GV9A 4DLEA 1VK0A 4DV7K 4DV3K 4JI0K 3A0IX 3KK7A 3CCMN 1EO1A 4GKJK 1QZ5A 3DLGA 3I55N 3HPOA 3QEIA 1EP4A 4DS5A 4JI7K 3O9SA 4DQIA 1X9JA 2QWOA 3A8YA 2GV9A 2Q2RA 2OA8A 2B5JA 1BIUA 2NRRA 4IOXA 4YOUA 4B8CA 3P38A 1S1UA 4E1MA 1U45A 2GUPA 1VAZA 4B3RK 3BEXA 1BUPA 1VSLA 4IDKA 1TAUA 3VQ8A 4A2BA 4CF1A 1NJXA 2CGLA 2V52B 4BRNA 4RW7A 1BHLA 3ZT0A 3NMUA 3OBYA 4WFAL 3BGRA 4AHVA 2PAVA 3WQUA 2AA4A 3MWPA 4E1JA 1BISA 4C23A 3CFRA 4IG0A 3KKSA 3QICA 1HJRA 4Y1CA 2BTFA 3VPZA 1HNVA 4BC2A 3NAEA 1YJ9N 1LWFA 1X9WA 4DV2K 3VQAA 4UQGA 3QNOA 3T3FA 2VGMA 1OH8A 2DPNA 1S6PA 3MN9A 1SKRA 2YKMA 3QMLA 3AVBA 5LJVA 2R7YA 1VQ6N 4F4KA 3WNEA 4U7BA 3M8PA 5LMNK 1RBSA 3IS9A 5BR9A 3K9KA 2ZE2A 1IV0A 3NHGA 3SPYA 2GEMA 4FK2A 4CZLA 1RDUA 4EIAA 2UU9K 4H5NA 4YFUA 5HP1A 3I56N 3HRGA 3ZETB 4DR1K 4GMJB 4Z94A 2P9NB 3U3YA 3HSTB 1G15A 1T8EA 1JLGA 2AP1A 4DFMA 1JLQA 4JKBA 1ZYQA 2UUBK 4B3TK 2HF3A 4PWDA 2KTQA 4ISEA 3NH0A 3ID8A 2H3GX 4CD3A 3SMPA 1N6QA 3RRHA 1VSEA 3NCIA 4BC3A 3MDQA 1NMDA 3S3NA 2GUIA 4WQ5A 4C1NK 1QZ6A 5GIPA 4E7IA 1BQMA 3G71N 1B9FA 4CIGA 2HBMA 3CF5L 4JKGA 1D4XA 4G1QA 4JK8A 4LF4K 4YHHK 3FR0A 2QWPA 4HCCA 2HNYA 3QESA 1T6CA 4G9ZA 3U3GA 1SV5A 2GX9A 2V51B 3AAQA 4DF4A 2P9LA 3OYLA 2P9SB 3K2PA 3GBTA 3AO2A 4H8KA 1BDGA 4CJKA 3U9DA 5HROA 4OGEA 4CE9A 3EY1A 1NK5A 4I6MB 3MEDA 1G99A 1V4SA 2OPSA 3CD6N 1U6ZA 1B9DA 2XY7A 4KFBA 4M3TA 4NLCA 4AF1A 2YNHA 5CY4A 4DG1A 3LDSA 4DSIA 5AQLA 1ZBUA 1RTIA 3QIPA 3TARA 3K59A 3T69A 3L3UA 4B1YB 4M3ZA 1C1BA 3LDQA 4OPAA 3R1XA 4B8AB 2RPIA 3NF7A 4WE1A 2WFBA 3DLBA 2NUBA 1NK8A 4CHYA 3EE9A 2FSNA 5M1QA 3AA5X 1D5AA 3M5RA 3LPTA 3L4QA 4RW8A 1BA0A 1ZBSA 4DR5K 3J8AA 2NZTA 4HUGA 2B6AA 3QEWA 4CEDA 1NNEA 4B9VA 4B1VA 5LL6Z 2QKBA 3THYA 5AQJA 3ZSVA 4CJRA 3N4PA 1RDWX 4YDUC 3PLAA 1BQNA 3N4QA 4FLTA 4DQSA 4DFJA 3AVJA 1Z05A 3SAGA 1WBDA 1N34K 4JK7A 3ULDA 1DKGD 1L3UA 3UKUB 4B1UB 3OS0A 3O3GA 3WXKA 3KK1A 3OS2A 4CEEA 3O3HA 2Q0UA 3CCSN 2O4IA 1KAXA 4EZ6A 3RR7A 3OYEA 4YY3K 4DCHA 3QINA 3HVRA 3G6EN 3MK6A 1IKWA 4K8XA 2YJFA 2E5LK 3CYMA 2P9LB 3TR8A 4FVMA 4DR7K 4QS8A 4M41A 1ATNA 4DV0K 4YOVA 3R3LA 2V7YA 4CZEA 1EQYA 3DRRA 4K8ZA 5E41A 3WEEB 4N5SA 1SZ2A 4CJPA 4O5BA 4LF8K 2E20A 3A5OC 3OYMA 4AILC 3EE8A 3SAFA 5EVZA 3D2FA 1QSLA 1SQKA 4BR5A 1WOQA 2Q0RA 1VSIA 2HHSA 3E1YA 3D2EA 2D1KA 2PY5A 5AQOA 3OYHA 1M90O 1NK6A 3CC4N 4EHUA 5FRNA 3E66A 3GG4A 2P9SA 4CGDA 4CFDA 1HNZK 4J2AA 5AZIA 4DQRA 3LWLA 3VQ4A 3CXCM 4BR4A 1VSJA 1X3NA 1YT3A 3R8EA 1I94K 3VOVA 4IG3A 5B8HA 3O9TA 4AHCA 3SQ4A 4I2PA 1SL0A 5M1PA 4N56A 4Z4IA 1P8ZA 4CJEA 4GV3A 4CJVA 1IG9A 4DSLA 3NE6A 1XMQK 1N5YA 1T3VA 5FPNA 3PX6A 1C0GA 4FPBA 4LF5K 1VQPN 1HX1A 1MWKA 5C2DA 1BA1A 3W3DA 1JLAA 1ZBFA 1IKYA 5AQYA 1I39A 3V9XA 4C1NI 4UY8O 1YI2N 1E3MA 2JGUA 4GNIA 3O9UA 2YKNA 5JS1A 5J2NA 1FJGK 2E2NA 3AO4A 4CJQA 3WXMB 4DSFA 3SMSA 3F73A 3DJCA 3IAYA 3DLHA 1VQ9N 3ZX0A 4HUEA 3L4IA 5KPRA 2ASOA 3UIQA 4CBWA 4QS7A 4B9LA 2E6LA 3GDQA 4I6MA 3NGZA 3VQ9A 2JWKA 4PY5A 1ASUA 3ZEUA 3CPWM 3T19A 4DFKA 4CHNA 1XHXA 5AQKA 1NWKA 3QEXA 4Y1DA 4CGJA 1U48A 2FBVA 3O4WA 2W42A 3NH1A 3ENBA 2VYPA 4ILJA 1VRTA 4MFBA 3F2KA 2NRHA 4FJ7A 3O4NA 2HNDA 3RMBA 1TKDA 4CK3A 3HPGA 3BF3A 3VEYA 4YNQA 1VQ5N 3EO3A 3AO3A 3NF8A 3O9RA 1Q82O 4JNEA 4CECA 4PHTX 3H3NO 4JI4K 1OVQA 5K14A 1J5EK 4BRQA 3AA2A 4JKCA 1RFQA 3ZSWA 1NKBA 3P1GA 5BRDA 1L5UA 4A61A 1E4GT 3ATVA 1U49A 5F1XA 3DOKA 5ADXH 3D0PA 2P9NA 1NJIO 2OYQA 1RNHA 4DSJA 1XI1A 2F7TA 3I8DA 4J2EA 2YV0X 2D0CA 2BDPA 3V9WA 2NRZA 1HPZA 3AVGA 3CJ7A 2G8HA 5BREA 4WQ4A 3TAEA 4KV8A 2O8DA 4OJRA 4H03B 3LAKA 4DFPA 4CZKA 1K73O 4FK4A 4NCGA 1VQ4N 3DRSA 1C1CA 4KB0A 1NKEA 3TPQA 3VQ6A 2D0PA 3PX0A 5JLHA 3P5JA 3VETA 1MDUB 4OO1J 1S3XA 1RBUA 5JS2A 2OANA 1OKJA 2P5OA 2IIRA 1C0TA 4BREA 3OYCA 4W5QA 4H4OA 1HR0K 3AV9A 1QE1A 1C6VA 2YHXA 1ASVA 2WONA 3OY9A 4MO5A 4IKFA 4DR3K 3M6GA 1KFDA 3THVA 1L3SA 1BGXT 4C8MA 1XHZA 3ZT3A 4MDBA 4I2QA 3M8QA 4V19S 4AHSA 3WNHA 1DLOA 3LM9A 1V4TA 3CCJN 4FWSA 3CCVN 1CLQA 4AHTA 3CQ8A 4CGGA 3MAQA 3WXIA 1U04A 3RRGA 1QSYA 1RT4A 3V9UA 3FFKB 1HPMA 4ILHA 1HYVA 4KO0A 2YI1A 1ZXOA 3AVKA 4B08A 3NBPA 3BY5A 4BRLA 5LJWA 4DQQA 4NXMK 1LWEA 3SQ2A 5AZJB 5SWMA 1P90A 4R5PA 3TAGA 4AH9A 2YHYA 5SZTA 5I42A 3QNNA 3FGUA 2OTLN 4FYDA 4BQLA 1T05A 1XQSC 5ELZA 1Q18A 2LSNA 1U2VB 4O8KA 5J2PA 3FZMA 4CIFA 1JCEA 4LFBK 1LW2A 3QFPA 3RMDA 4KHPK 4LD0A 3S3MA 4DR4K 3NFAA 2EX3A 2FF3B 1J5OA 1BCMA 3MCPA 4WYBA 3QEVA 4CF0A 4JHDA 2CH6A 4DTOA 1XNQK 3WXLA 4BWMA 4DUZK 2IGIA 4EFHA 5HL7L 3KK2A 2F8TA 1RDAA 3HL8A 3DLRA 5CYMA 2HVHA 4IEIA 4CZMA 1O1WA 4CF8A 2VG6A 1OH7A 3WNFA 4E7JA 5AQNA 3H1VX 4CZIA 5BPNA 4BG9A 3NVKA 3ITHA 5TKYA 3R6MA 4XIUA 4JS4A 2OPQA 3OJUA 1LOTB 3LDNA 3PUFA 2Q1NA 1FK9A 1SL1A 4CBUA 3O08A 4DHYA 3FFIA 3UKUA 1RT5A 5AQTA 1TYQB 1QQNA 2E1YA 4KKOA 1Q81O 5GADP 3TTDA 4OX9K 1RBVA 2O8FA 3AGKA 4BGBA 4CESA 3NH2A 3AVIA 5FDLA 4BR2A 3OA9A 5DM6L 4JEPA 4OGCA 1NGDA 1EWRA 2RF2A 2KZMA 2HHTA 2IS3A 1YJNN 4AM7A 3FZLA 3FLCO 4JV5K 4EP4A 5KQ8A 3B8AX 2GWJA 2HBJA 3HVTA 3SJHA 4BRCA 2D0AA 1T6DA 2O4GA 3G25A 3CFPA 3KLEA 4J2DA 2ZJQL 4A62A 5HOOA 4MO4A 4ICLA 2E8AA 4HTUA 4BVOA 4E19A 2HOEA 4ZTFA 1W9HA 5E84A 1KCFA 1BU6O 3DYAA 1WB9A 5AQQA 3DAWA 4BRIA 1ZC6A 5A2QO 4KBOA 4Q5VA 3A5LC 4JK9A 3VEZA 3T1HK 1GOCA 2G8VA 2UUCK 3AO1A 3S3OA 1JCFA 2VWJA 3U8XA 1TKZA 3ZSRA 2HVIA 5KRSA 3VF6A 3OHRA 1JLCA 3EL2A 5KRTA 1TUYA 1RDDA 1JCGA 3H3OB 3H45C 4O55A 1VRUA 4BE2A 4N41A 2QXFA 1OH5A 2Y1JA 3QO9A 3T7ZA 4JI1K 1ZBIA 1JLBA 4FPAA 5C12A 3VQEA 1NM1A 4WQ5C 4K41A 3O4QA 3VEOA 4CJTA 4KH6A 4FLYA 3B6OA 3KD5E 3QIOA 5AQVA 2EWSA 3I0SA 2KW4A 3K5MA 4IOCL 3EKSA 3FE1A 2NRTA 3LP0A 2P9UB 1BI4A 3VA3A 3MEEA 1EETA 3PIOL 2QWQA 3DM2A 1KVAA 4M42A 3MEGA 1K9MO 3HOTA 2W6LA 3LWMA 3OS1A 4MLEA 3RR8A 5KPZA 3CERA 1IJJA 1S22A 1BWFO 2D4WA 3ISNC 1NKCA 4LSNA 4PKIA 3A5MC 4NYNA 4FJ5A 1K8AO 3NF6A 3F9KA 3NGIA 4CZGA 3GOIA 2A1RA 4LFCK 1LW0A 3LZIA 4X64K 4H0XB 5HBMA 2OZSA 4CJLA 3OYBA 4DUYK 4FLUA 4IFVA 3JYTA 1NGFA 3VEXA 3J7ZO 2F96A 2YNIA 3HJFA 2ATQA 3OBWA 4B3SK 4X65K 5HRSA 4DQ8A 3MCAB 2JWLA 4W5NA 3CCUN 2Y1IA 4FWPA 2QA4N 3ZSYA 2Z1JA 3AVLA 4RWTA 1M1KO 1VQ7N 4I9QA 2O8BB 4PA1A 2HMPA 4DKWA 5AFUH 3C65A 2RHKA 1RT1A 2DFHA 2A40A 3U6FA 1EWQA 4AQYK 3AARA 3CMEN 4DTJA 4FVUA 3VN5A 4BRMA 5HRRA 4K25A 3IDHA 3TANA 1JLFA 1IO2A 3KLFA 1JXEA 1S5JA 3UB5A 4FJ8A 3W0LA 3HP6A 4NXNK 5C15A 3V4IA 1GLAG 4CFAA 2W40A 3I0RA 4KTZA 3J7YP 3DOLA 4O44A 4KHNA 3VGLA 4KHWA 3SBTA 2QW9A 4JD2B 4DTUA 3D2EB 1DTTA 2ITGA 5D3GA 1TL1A 4IOAL 1HKGA 3QBWA 2Z1GA 1YAGA 3WT0A 4DU1A 3CCQN 1GLLO 3CC2N 1FKOA 3MN7A 3SNNA 4Z4GA 4B9QA 3F9MA 3IKMA 4CJWA 4KHQA 2ZJPL 1YITN 3QFUA 1JXBA 4W5RA 3AVMA 3KWIA 2HHVA 3AA4A 4IO8A 1CZBA 3RVCA 5CR4A 4HWIA 4O5FA 3CJAA 2HHWA 3K9JA 3O5BA 2BUPA 1GLEG 1HNWK 3D7EO 3HYFA 2A42A 3PIPL 4OPKA 3S41A 3KTQA 2AJQA 4E3SA 2FC0A 3JSMA 1VQMN 3LZJA 1EX4A 2O8BA 5CE3A 3U4LA 3THWB 1MA9B 4MQ3A 1N33K 4DU4A 5EY4A 4CBXA 2PZSA 3C0BA 2BGGA 1WAFA 1K8KB 1NGEA 4DV5K 2Q97A 4YOXA 4DSKA 4FJHA 4FK0A 3QLHA 1CXQA 1HUXA 1WN7A 4JI5K 4OLBA 4O0JA 3LM2A 2YNGA 2D0BA 3ZX3A 4AM6A 2IC3A 4CFBA 3KZBA 3THXA 4LC9B 3SI6A 2DY4A 3HT3A 1XNRK 4F8RA 3VMFB 2ZGYA 3H1QA 4BQZA 3IMXA 2OZMA 3DLKA 1LV5A 3DLEA 3VENA 3V81A 1SS6A 3O1WA 4N47A 3OTOK 3RWUA 3ASMA 2BH1A 4TSXA 5AQSA 3SAHA 5JVHL 4FLWA 2ZD1A 4BR9A 1BG3A 4IO9L 2FSJA 4HTLA 5GAEP 4KAZA 1BIZA 4H0OA 1YTAA 4FZZA 4CJ7A 3TTCA 1W2BM 3C7NB 1FW6A 2NRXA 3HM9A 3DXKB 1UWBA 1TUUA 3QDKA 4CJSA 2XHBA 1NJYA 3VTIA 3TI0A 4WFNL 4IBNA 3RMAA 2O8CB 3VQDA 1Q9YA 3ZCMA 2ZQBA 4BDYA 4FWKA 2OPRA 1NGCA 2J4RA 1IKVA 3DI6A 2XO7A 4BACA 1XUPO 3KWGA 3MMVA 1RBTA 4H4MA 3L2QA 5KPTA 4IEEA 4CZHA 5EXWA 1DGKN 1WAJA 4B1WB 2V7ZA 4IJNA 3ZT2A 4OVLA 1YUWA 4E7HA 4FOEA 4BGAA 1KQSM 2P9PA 4AHRA 2UXBK 5AQUA 3ENHA 4PQUA 2QWMA 3SUOA 2CH5A 1GOBA 5M1FA 4LY7A 4M3UA 1Z25A 1TGOA 1NGGA 1VQNN 1YF5L 4ZHRA 3HI0A 4FZXC 3MWTA 1NGHA 5T7BA 2YHAA 1KC8O 2QI2A 4LF7K 4BRPA 4JRPA 1SKWA 4ID5A 4C8LA 3HXMA 1RILA 2WOMA 4E7LA 4FJLA 5C0YA 1SUQA 4Q0BA 4FJGA 4HCBA 2A41A 1HMVA 1VQKN 3OYNA 2NNWA 4FJ9A 5GAHP 4IFYA 4FW2A 2O8DB 3C94A 3O80A 4RW9A 3KKRA 4BRAA 2HBKA 3MECA 4YOYA 3QBXA 2Q36A 4JI2K 3C6TA 1HJOA 3SLCA 4FCYA 3TAQA 4BRGA 1TKXA 4GY2B 5AQGA 2ETJA 3TU5A 4N76A 4DWIA 2I5JA 1RT6A 2FXUA 3L8BA 2UUAK 1TAQA 3ULEA 2O8FB 3ATUA
chains in the Genus database with same CATH topology
4GKKK 4DV7K 4DV3K 4K0KK 4JI0K 4DR7K 1IBMK 4V19S 4LF9K 2UXCK 4GKJK 4DV0K 3JAMO 1XMOK 5FLXO 4JI7K 4OX9K 4LF8K 2VQFK 2E5LK 4LF4K 1N36K 5AJ3K 4YHHK 1IBKK 4CVNE 5LMUK 4B3RK 1HNXK 4LFCK 4JV5K 4X64K 1HNWK 3J81O 4JI4K 1N32K 1J5EK 2UXBK 4DV6K 4DV4K 4DR2K 4DUYK 1HNZK 4NXMK 4LF6K 5IWAK 4X66K 4JI8K 4CW7B 4JYAK 1N33K 1I94K 4B3SK 4X65K 5A2QO 4DV5K 4DV2K 4LF7K 4LFAK 3T1HK 4DR5K 2UUCK 4JI5K 3J7AP 2UXDK 4LFBK 2VQEK 4KHPK 5LL6Z 4DR4K 3J80O 4X62K 2HHHK 1XMQK 5LMNK 3T1YK 4DV1K 1N34K 4LF5K 1XNQK 1XNRK 4JI3K 4AQYK 4JI2K 4DUZK 1IBLK 2UU9K 4B3MK 4JI1K 5BR8K 4DR1K 1HR0K 3OTOK 4NXNK 1FJGK 2ZM6K 3J7YP 4YY3K 2UUBK 4B3TK 4DR3K 5IT9O 2F4VK 2UUAK 4JI6K 4DR6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK K;  4DV7 K;  4DV3 K;  4K0K K;  4JI0 K;  4DR7 K;  1IBM K;  4V19 S;  4LF9 K;  2UXC K;  4GKJ K;  4DV0 K;  3JAM O;  1XMO K;  5FLX O;  4JI7 K;  4OX9 K;  4LF8 K;  2VQF K;  2E5L K;  4LF4 K;  1N36 K;  5AJ3 K;  4YHH K;  1IBK K;  4CVN E;  5LMU K;  4B3R K;  1HNX K;  4LFC K;  4JV5 K;  4X64 K;  1HNW K;  3J81 O;  4JI4 K;  1N32 K;  1J5E K;  2UXB K;  4DV6 K;  4DV4 K;  4DR2 K;  4DUY K;  1HNZ K;  4NXM K;  4LF6 K;  5IWA K;  4X66 K;  4JI8 K;  4CW7 B;  4JYA K;  1N33 K;  1I94 K;  4B3S K;  4X65 K;  5A2Q O;  4DV5 K;  4DV2 K;  4LF7 K;  4LFA K;  3T1H K;  4DR5 K;  2UUC K;  4JI5 K;  3J7A P;  2UXD K;  4LFB K;  2VQE K;  4KHP K;  5LL6 Z;  4DR4 K;  3J80 O;  4X62 K;  2HHH K;  1XMQ K;  5LMN K;  3T1Y K;  4DV1 K;  1N34 K;  4LF5 K;  1XNQ K;  1XNR K;  4JI3 K;  4AQY K;  4JI2 K;  4DUZ K;  1IBL K;  2UU9 K;  4B3M K;  4JI1 K;  5BR8 K;  4DR1 K;  1HR0 K;  3OTO K;  4NXN K;  1FJG K;  2ZM6 K;  3J7Y P;  4YY3 K;  2UUB K;  4B3T K;  4DR3 K;  5IT9 O;  2F4V K;  2UUA K;  4JI6 K;  4DR6 K; 
#chains in the Genus database with same CATH topology
 5J2Q A;  1TYQ A;  1SAZ A;  3FZH A;  1U47 A;  4A5B A;  4DTR A;  4CEA A;  4DS4 A;  4FL9 A;  4HUF A;  1HKB A;  4LF9 K;  4O0I A;  4BRF A;  5JLF A;  4O8U A;  5M1O A;  1WSF A;  1QTM A;  3RSE B;  3LL3 A;  1YJW N;  2E2O A;  5I3U A;  3OYA A;  5EOY A;  4NCB A;  4IFE A;  3M8S A;  3SBG A;  4CGH A;  4K42 A;  4Z4H A;  3CJ9 A;  5AZJ A;  2DFF A;  3CCL N;  4RW4 A;  4JKH A;  4YOR A;  4H0Y B;  2YHW A;  2G8W A;  3RSE A;  4E0D A;  2IOC A;  1TK0 A;  1YVU A;  5C10 A;  3CFO A;  2VGN A;  4XH5 A;  1XC9 A;  2HHQ A;  3NVM A;  3ZSQ A;  4WFB L;  1JKH A;  4E7K A;  3OYI A;  5TKW A;  4CK2 A;  4F3O A;  1VSH A;  3TTF A;  3VEW A;  1ILY A;  2A6A A;  5J2M A;  2ITM A;  1Q7Y O;  2X78 A;  3CIP A;  4CJ5 A;  5CZ2 A;  1KLN A;  3VGM A;  3AY9 A;  2HW3 A;  3G0Z A;  1WSI A;  4NO7 A;  4KRF A;  2FLO A;  4KI4 A;  2HF4 A;  1HYS A;  2WBN A;  2Z1I A;  4BWJ A;  4CF9 A;  1U2V A;  4FWN A;  4JKF A;  3DXM A;  1WLJ A;  3CJC A;  1VQ8 N;  4FXD A;  3THW A;  1IBL K;  4M3W A;  3GE1 A;  1WBB A;  2YCH A;  5AQR A;  1RT2 A;  3MX2 A;  1R0A A;  3D45 A;  4B9U A;  4LSL A;  3TWH A;  2RKI A;  4DU3 A;  4KHS A;  1LAV A;  1I3A A;  1RTJ A;  1ZBL A;  4FLV A;  2ZM6 K;  4H5V A;  4WQ4 C;  3EKU A;  3OYJ A;  1BI4 B;  4FWO A;  2PFU A;  3CMA N;  4JKG B;  1KAZ A;  1TL3 A;  4CGF A;  4B1X B;  2QWN A;  4C8K A;  4FJJ A;  4IWV A;  3ZSZ A;  5GIN A;  4W5T A;  3CM6 A;  4BC4 A;  3L2V A;  2UXC K;  4CJF A;  3M3Z A;  1WSJ A;  2G8K A;  1YTU A;  4BG8 A;  5FLX O;  3QEP A;  4NCA A;  1FXX A;  3VES A;  1X9S A;  1GLJ O;  3CG7 A;  2Q31 A;  2OCE A;  3LP1 A;  3K0S A;  1RT7 A;  3CC7 N;  3AO5 A;  4PL7 A;  2NLX A;  1D8Y A;  4FWR A;  4LH4 A;  1NK0 A;  2QWR A;  2W6K A;  2Z1H A;  4BDZ A;  2CGJ A;  4CEZ A;  4IXC A;  4IZ9 A;  1OH6 A;  3HK2 A;  3E9O A;  1GOA A;  3V1R A;  1S72 N;  3LDP A;  3P4I A;  1B92 A;  3OYG A;  3H6E A;  3BZC A;  1E4F T;  3BF1 A;  4JHD B;  3SQ0 A;  1QQO A;  1DEJ A;  4B1Z A;  1NGI A;  4CJ3 A;  1YHQ N;  3BP8 A;  4OKE A;  3UKR B;  2OPP A;  4PKG A;  4PKH A;  2KZZ A;  1NLV A;  1J6Z A;  4QAG A;  4BVP A;  4A5A A;  4FLX A;  1S9E A;  3PO4 A;  3J7A P;  2DTU A;  2KFN A;  2E1Z A;  1X3M A;  4L3Q A;  4FLZ A;  4E89 A;  1ASW A;  4BE0 A;  4XEI A;  5HLF A;  2O8E B;  2XRI A;  4PL8 A;  1REV A;  2HHU A;  1Q86 O;  4CEF A;  4J2B A;  1IH7 A;  1S6Q A;  3AVH A;  3IUC A;  1NK9 A;  4L8R B;  4EHT A;  1TK8 A;  3TSQ A;  1GLF O;  4I7F A;  1HQU A;  3VEV A;  4KTQ A;  4B3M K;  3AA3 A;  4DSE A;  1W0H A;  2HST A;  3K57 A;  1Q8I A;  4DLG A;  1C0F A;  4FJM A;  1ATR A;  2I7N A;  4BE1 A;  3CET A;  4A59 A;  5JVG L;  3EEQ A;  4F2R A;  3Q7C A;  3IRX A;  3C95 A;  3OVN A;  4JI6 K;  1NOY A;  1RGI A;  2GWK A;  4CER A;  4JD2 A;  1Z26 A;  2P5G A;  1KXP A;  4YOT A;  1S1V A;  3OW2 M;  4KRE A;  3EZ5 A;  3KD1 E;  3TAB A;  1XMO K;  4JLH A;  3DXM B;  2VWK A;  4DTX A;  4DF8 A;  5KQD A;  1KSP A;  3IFR A;  5BPM A;  5AJ3 K;  1CZA N;  1YVN A;  3ZSX A;  5F0X A;  2XY6 A;  5FRM A;  3DXK A;  2D5R A;  5LMU K;  3C7N A;  4R79 A;  4QS9 A;  4JRQ A;  1IG8 A;  3JXU A;  2HNZ A;  1HKC A;  1HNX K;  3KVG A;  3V6D A;  3DWL A;  5BRH A;  4IDH A;  4A2A A;  2WUS A;  1YIJ N;  3J81 O;  4ELV A;  1N32 K;  1Z6R A;  3K5N A;  2D0O A;  2P1J A;  4DV6 K;  1NU0 A;  1XC3 A;  5C25 A;  1HNI A;  1A5X A;  3FZF A;  2QXL A;  1A5V A;  4YDU A;  4H5T A;  4ELU A;  3WNG A;  4JI8 K;  4FJX A;  3SUP A;  3LP2 A;  4M3Y A;  1QQM A;  3EN9 A;  3O8M A;  4H0V B;  1TKT A;  4OLA A;  3RMC A;  1S1W A;  4CHP A;  2YJE A;  3WEE A;  2VG7 A;  3VQ7 A;  3ZX2 A;  3CI5 A;  5FRO A;  3BUZ B;  1VHX A;  1S1T A;  3AVN A;  2QWL A;  1QVG M;  5HRN A;  3VQ5 A;  2IVN A;  4BC5 A;  2E6M A;  3E01 A;  1NK4 A;  2Q3S A;  5E26 A;  4Z4C A;  1K8K A;  5KGW A;  1RTH A;  5DK5 A;  5AQF A;  3FZK A;  4H0T B;  4ILG B;  1QHT A;  3F5T A;  4YOW A;  3L0Q A;  3WQT A;  1UAX A;  1UOC A;  2P9K B;  1ESV A;  3PV8 A;  1KAY A;  5F2R A;  4GVE A;  3HZ6 A;  1R59 O;  1A5W A;  3C6U A;  5MLC Q;  4XH4 A;  1W7A A;  1NGA A;  1C0M A;  3VTH A;  3P83 D;  4ZTJ A;  1J54 A;  1NOZ A;  4DB3 A;  5DMR A;  3KIO A;  1FKP A;  4OKK A;  1HLU A;  4M7Y A;  3WUH A;  4I9L A;  3CQY A;  2GTD A;  5C2F A;  4DMN A;  3H08 A;  2NRV A;  1O13 A;  2I7P A;  1N8R O;  3SPZ A;  4CIE A;  3V1Q A;  1WSG A;  3U9Z A;  3TSU A;  3VQC A;  3KHY A;  1EKE A;  2FSK A;  3ULE B;  3WXJ A;  4CI6 A;  3V9Z A;  3LPU A;  2F9T A;  4M63 C;  3MN5 A;  4CVN E;  1KLM A;  2PYL A;  4KPY A;  3ZSO A;  1KRP A;  1S1X A;  3P39 A;  4KTW A;  2IVP A;  4FJN A;  3OYD A;  1ZBH A;  2P51 A;  2X6S A;  3A5N C;  3LP3 A;  1LAW A;  4HVJ A;  3V1O A;  1NJW A;  3UKR A;  4BDP A;  3VA0 A;  3E9P A;  4CHQ A;  4CJ4 A;  4EAH D;  2KQ2 A;  4U67 L;  1KVC A;  2X6N A;  4Z0U A;  4DV4 K;  4DR2 K;  2PYJ A;  2VWB A;  2CGK A;  3SV4 A;  4KH5 A;  3OYK A;  4CHO A;  3THX B;  1HRH A;  2IVO A;  1NGJ A;  1NMN A;  3ENO A;  4CW7 B;  4NB4 A;  2B4J A;  3TSP A;  3HP9 A;  4H5W A;  3LDO A;  1C1A A;  4OPJ A;  1J9A A;  1QVF M;  2YX6 A;  1MWM A;  4RW6 A;  3P31 A;  4FM2 A;  4ELT A;  4ID1 A;  2P9I A;  4CZF A;  2BAN A;  2HMI A;  1SL2 A;  3B6P A;  1LCU A;  3CJ1 A;  4JI3 K;  5BPL A;  2BE2 A;  2RN2 A;  2O8C A;  2E2Q A;  3SK3 A;  1CZ9 A;  3KLI A;  4BRK A;  3LAM A;  4CGI A;  2ZF5 O;  1Q9X A;  5FPM A;  3R9P A;  1RCH A;  5IT9 O;  2E88 A;  1JJ2 M;  3CCR N;  1KD1 O;  3Q7B A;  4FW1 A;  4JKE A;  4CEO A;  4K0K K;  2OTJ N;  1XWL A;  3E9L A;  3L2U A;  1NK7 A;  2FF6 A;  3G4S N;  3HPH A;  1RDC A;  3KJV A;  1WSH A;  2QTD A;  3T1A A;  1IKX A;  4NYF A;  4BRO A;  4FJK A;  3SZ2 A;  3I8B A;  1IBK K;  5C42 A;  2P9U A;  5CZ1 A;  4EP5 A;  5EX5 A;  4QCL A;  5AQW A;  1D9D A;  1VSF A;  3ZET A;  4FM1 A;  3ZT1 A;  3HOS A;  3DRP A;  2ZGZ A;  2W41 A;  2RE2 A;  1KFS A;  1F21 A;  2KLA A;  3ID6 A;  3HO1 A;  5I9E B;  2FBY A;  1KTQ A;  1BOT O;  3AVA A;  4QOZ B;  5CYQ A;  4FJI A;  3V9S A;  5KGX A;  3RTV A;  4JYA K;  2QEX N;  1QS4 A;  4B9N A;  2G8I A;  3THY B;  2XY5 A;  3TAP A;  4EZ9 A;  3LAL A;  4Z4F A;  3S9H A;  4LFA K;  1CXU A;  3JS6 A;  5AZI B;  4CJU A;  3IG1 A;  1BO5 O;  5AQX A;  4FWM A;  3SUN A;  3C6H A;  3ZYY X;  2VQE K;  3HM8 A;  3BZK A;  5M1K A;  3J80 O;  4H5R A;  2IAJ A;  1HQE A;  1RTD A;  4CEQ A;  1VSD A;  3T1Y K;  1Y97 A;  4KB1 A;  1LWC A;  3C6A A;  2QK9 A;  4M3R A;  4CCH A;  4GW6 A;  4DV1 K;  4DQP A;  3EYZ A;  2XY8 A;  2IDO A;  5AQH A;  1ATS A;  1SKS A;  4KH4 A;  3NDK A;  3DMJ A;  4B9S A;  4A57 A;  3HBT A;  3SJJ A;  2EHG A;  2UYT A;  5JMV A;  1RBR A;  1X9M A;  3O9Q A;  4MLH A;  4LH5 A;  3I33 A;  4F3T A;  2ASM A;  4KHU A;  1DT9 A;  5AR0 A;  4BR0 A;  4FSV A;  4K43 A;  1VQO N;  3BDP A;  4GKK K;  1WNS A;  4CD1 A;  5C24 A;  4MDA A;  1IBM K;  3A2F A;  3QER A;  3CQX A;  3JAM O;  4XH1 A;  5ADX A;  1YXQ A;  4CFC A;  2VQF K;  3PO5 A;  1MU2 A;  2F8S A;  3KLG A;  3AAP A;  3M1F A;  3PX4 A;  3TAF A;  3H46 O;  3D2F B;  2P9I B;  2DFE A;  2HBL A;  4OKJ A;  5BN9 A;  2E2P A;  1W97 L;  1OVY A;  1BCO A;  4W5O A;  3ZLJ A;  4H0P A;  1QHA A;  3PSI A;  2WC9 A;  3PSF A;  3NGY A;  5JIC A;  3CJB A;  5EU7 A;  3GL1 A;  4LF6 K;  2FBT A;  4DTP A;  5IWA K;  4CZJ A;  4B9T A;  3VF2 A;  4X66 K;  1NG9 A;  3NF9 A;  2ZWH A;  1TVR A;  5BRF A;  2VCP A;  4JAX A;  5J1E A;  5DM7 L;  4J8F A;  5KTQ A;  2GBZ A;  5AFU A;  1H1V A;  3D6R A;  4C8O A;  3VGK A;  4ISF A;  2KKZ A;  5GAG P;  4RTF D;  1GLB G;  3O1B A;  4CEB A;  2QKK A;  4FO0 A;  1U4B A;  2F9W A;  5H1S Q;  5GIO A;  3OJS A;  3MXI A;  3HSC A;  2P9K A;  2HHH K;  3VQB A;  1K6Y A;  3ZT4 A;  4Z4E A;  1VSK A;  4M3X A;  1TK5 A;  1WUA A;  1VQL N;  3PY8 A;  1TV6 A;  4FWQ A;  3AVC A;  1QSS A;  3VQP A;  4JKA A;  5FPD A;  3M8R A;  5AQP A;  1UA0 A;  5HRP A;  3CPE A;  4BRD A;  5BR8 K;  4KHY A;  3MXJ A;  3SV3 A;  3ZEU B;  1L3T A;  3LDL A;  3MN6 A;  4M7X A;  2G8U A;  5BN8 A;  2JLE A;  4DR6 K;  3HTV A;  1NGB A;  3UE5 A;  1T7P A;  3K58 A;  4JN4 A;  4OPH A;  3CHW A;  1WSE A;  1J53 A;  3VF4 A;  4AHU A;  4FZY A;  1GLD G;  2A1S A;  4IJA A;  3L2W A;  1EXQ A;  2A3Z A;  3KK3 A;  2NRW A;  3LAN A;  4B3O A;  3MX5 A;  4C8N A;  3EZW A;  1T44 A;  4FM0 A;  3L2R A;  1N36 K;  1KVB A;  5AQI A;  4WCE L;  1JL2 A;  3ALY A;  4BR7 A;  2GEL A;  4M45 A;  1GLC G;  1NBW A;  4BRH A;  5AQM A;  1D9F A;  3CCE N;  1RT3 A;  3MXM A;  4PUO A;  3KLH A;  3CM5 A;  4E1N A;  3VQQ A;  1X1P A;  4F2S A;  3L6Q A;  3SUQ A;  2KFZ A;  2ASP A;  5CHI A;  2WTU A;  3O6W A;  4RG8 A;  3SQ1 A;  1BL3 A;  2YNF A;  3SCX A;  4HHT A;  5AQZ A;  4CHZ A;  2X74 A;  3AVF A;  3OYF A;  3DLL L;  4BY9 C;  4DTS A;  3QET A;  1QQC A;  3SYZ A;  1ITG A;  3VER A;  4DTN A;  3TAM A;  4B9M A;  2FBX A;  1NJZ A;  5LY3 A;  1C0U A;  4JKD A;  5FPE A;  1S9G A;  2YHB A;  4CF2 A;  1JL1 A;  2P9P B;  1JLE A;  2UXD K;  2VG5 A;  4WF9 L;  3K5L A;  1VSM A;  4ISG A;  4O4G A;  3AGR A;  4X62 K;  4RCH A;  1HYZ A;  4GV6 A;  4CK1 A;  3O3F A;  2KHO A;  5M1N A;  4FOI A;  2G8F A;  2ZJR L;  4JS5 A;  2O8E A;  1DTQ A;  1L3V A;  1UA1 A;  4GVM A;  4Y0W A;  4NLB A;  2HHX A;  1Y64 A;  4FWL A;  2QM1 A;  2PBD A;  2A5X A;  4F9O A;  3QB0 A;  1T03 A;  5KI6 A;  1RDB A;  4DTM A;  3G10 A;  2E4L A;  3K5O A;  4KI6 A;  3L3V A;  2F4V K;  2HB5 A;  4GV9 A;  4DLE A;  1VK0 A;  4DV7 K;  4DV3 K;  4JI0 K;  3A0I X;  3KK7 A;  3CCM N;  1EO1 A;  4GKJ K;  1QZ5 A;  3DLG A;  3I55 N;  3HPO A;  3QEI A;  1EP4 A;  4DS5 A;  4JI7 K;  3O9S A;  4DQI A;  1X9J A;  2QWO A;  3A8Y A;  2GV9 A;  2Q2R A;  2OA8 A;  2B5J A;  1BIU A;  2NRR A;  4IOX A;  4YOU A;  4B8C A;  3P38 A;  1S1U A;  4E1M A;  1U45 A;  2GUP A;  1VAZ A;  4B3R K;  3BEX A;  1BUP A;  1VSL A;  4IDK A;  1TAU A;  3VQ8 A;  4A2B A;  4CF1 A;  1NJX A;  2CGL A;  2V52 B;  4BRN A;  4RW7 A;  1BHL A;  3ZT0 A;  3NMU A;  3OBY A;  4WFA L;  3BGR A;  4AHV A;  2PAV A;  3WQU A;  2AA4 A;  3MWP A;  4E1J A;  1BIS A;  4C23 A;  3CFR A;  4IG0 A;  3KKS A;  3QIC A;  1HJR A;  4Y1C A;  2BTF A;  3VPZ A;  1HNV A;  4BC2 A;  3NAE A;  1YJ9 N;  1LWF A;  1X9W A;  4DV2 K;  3VQA A;  4UQG A;  3QNO A;  3T3F A;  2VGM A;  1OH8 A;  2DPN A;  1S6P A;  3MN9 A;  1SKR A;  2YKM A;  3QML A;  3AVB A;  5LJV A;  2R7Y A;  1VQ6 N;  4F4K A;  3WNE A;  4U7B A;  3M8P A;  5LMN K;  1RBS A;  3IS9 A;  5BR9 A;  3K9K A;  2ZE2 A;  1IV0 A;  3NHG A;  3SPY A;  2GEM A;  4FK2 A;  4CZL A;  1RDU A;  4EIA A;  2UU9 K;  4H5N A;  4YFU A;  5HP1 A;  3I56 N;  3HRG A;  3ZET B;  4DR1 K;  4GMJ B;  4Z94 A;  2P9N B;  3U3Y A;  3HST B;  1G15 A;  1T8E A;  1JLG A;  2AP1 A;  4DFM A;  1JLQ A;  4JKB A;  1ZYQ A;  2UUB K;  4B3T K;  2HF3 A;  4PWD A;  2KTQ A;  4ISE A;  3NH0 A;  3ID8 A;  2H3G X;  4CD3 A;  3SMP A;  1N6Q A;  3RRH A;  1VSE A;  3NCI A;  4BC3 A;  3MDQ A;  1NMD A;  3S3N A;  2GUI A;  4WQ5 A;  4C1N K;  1QZ6 A;  5GIP A;  4E7I A;  1BQM A;  3G71 N;  1B9F A;  4CIG A;  2HBM A;  3CF5 L;  4JKG A;  1D4X A;  4G1Q A;  4JK8 A;  4LF4 K;  4YHH K;  3FR0 A;  2QWP A;  4HCC A;  2HNY A;  3QES A;  1T6C A;  4G9Z A;  3U3G A;  1SV5 A;  2GX9 A;  2V51 B;  3AAQ A;  4DF4 A;  2P9L A;  3OYL A;  2P9S B;  3K2P A;  3GBT A;  3AO2 A;  4H8K A;  1BDG A;  4CJK A;  3U9D A;  5HRO A;  4OGE A;  4CE9 A;  3EY1 A;  1NK5 A;  4I6M B;  3MED A;  1G99 A;  1V4S A;  2OPS A;  3CD6 N;  1U6Z A;  1B9D A;  2XY7 A;  4KFB A;  4M3T A;  4NLC A;  4AF1 A;  2YNH A;  5CY4 A;  4DG1 A;  3LDS A;  4DSI A;  5AQL A;  1ZBU A;  1RTI A;  3QIP A;  3TAR A;  3K59 A;  3T69 A;  3L3U A;  4B1Y B;  4M3Z A;  1C1B A;  3LDQ A;  4OPA A;  3R1X A;  4B8A B;  2RPI A;  3NF7 A;  4WE1 A;  2WFB A;  3DLB A;  2NUB A;  1NK8 A;  4CHY A;  3EE9 A;  2FSN A;  5M1Q A;  3AA5 X;  1D5A A;  3M5R A;  3LPT A;  3L4Q A;  4RW8 A;  1BA0 A;  1ZBS A;  4DR5 K;  3J8A A;  2NZT A;  4HUG A;  2B6A A;  3QEW A;  4CED A;  1NNE A;  4B9V A;  4B1V A;  5LL6 Z;  2QKB A;  3THY A;  5AQJ A;  3ZSV A;  4CJR A;  3N4P A;  1RDW X;  4YDU C;  3PLA A;  1BQN A;  3N4Q A;  4FLT A;  4DQS A;  4DFJ A;  3AVJ A;  1Z05 A;  3SAG A;  1WBD A;  1N34 K;  4JK7 A;  3ULD A;  1DKG D;  1L3U A;  3UKU B;  4B1U B;  3OS0 A;  3O3G A;  3WXK A;  3KK1 A;  3OS2 A;  4CEE A;  3O3H A;  2Q0U A;  3CCS N;  2O4I A;  1KAX A;  4EZ6 A;  3RR7 A;  3OYE A;  4YY3 K;  4DCH A;  3QIN A;  3HVR A;  3G6E N;  3MK6 A;  1IKW A;  4K8X A;  2YJF A;  2E5L K;  3CYM A;  2P9L B;  3TR8 A;  4FVM A;  4DR7 K;  4QS8 A;  4M41 A;  1ATN A;  4DV0 K;  4YOV A;  3R3L A;  2V7Y A;  4CZE A;  1EQY A;  3DRR A;  4K8Z A;  5E41 A;  3WEE B;  4N5S A;  1SZ2 A;  4CJP A;  4O5B A;  4LF8 K;  2E20 A;  3A5O C;  3OYM A;  4AIL C;  3EE8 A;  3SAF A;  5EVZ A;  3D2F A;  1QSL A;  1SQK A;  4BR5 A;  1WOQ A;  2Q0R A;  1VSI A;  2HHS A;  3E1Y A;  3D2E A;  2D1K A;  2PY5 A;  5AQO A;  3OYH A;  1M90 O;  1NK6 A;  3CC4 N;  4EHU A;  5FRN A;  3E66 A;  3GG4 A;  2P9S A;  4CGD A;  4CFD A;  1HNZ K;  4J2A A;  5AZI A;  4DQR A;  3LWL A;  3VQ4 A;  3CXC M;  4BR4 A;  1VSJ A;  1X3N A;  1YT3 A;  3R8E A;  1I94 K;  3VOV A;  4IG3 A;  5B8H A;  3O9T A;  4AHC A;  3SQ4 A;  4I2P A;  1SL0 A;  5M1P A;  4N56 A;  4Z4I A;  1P8Z A;  4CJE A;  4GV3 A;  4CJV A;  1IG9 A;  4DSL A;  3NE6 A;  1XMQ K;  1N5Y A;  1T3V A;  5FPN A;  3PX6 A;  1C0G A;  4FPB A;  4LF5 K;  1VQP N;  1HX1 A;  1MWK A;  5C2D A;  1BA1 A;  3W3D A;  1JLA A;  1ZBF A;  1IKY A;  5AQY A;  1I39 A;  3V9X A;  4C1N I;  4UY8 O;  1YI2 N;  1E3M A;  2JGU A;  4GNI A;  3O9U A;  2YKN A;  5JS1 A;  5J2N A;  1FJG K;  2E2N A;  3AO4 A;  4CJQ A;  3WXM B;  4DSF A;  3SMS A;  3F73 A;  3DJC A;  3IAY A;  3DLH A;  1VQ9 N;  3ZX0 A;  4HUE A;  3L4I A;  5KPR A;  2ASO A;  3UIQ A;  4CBW A;  4QS7 A;  4B9L A;  2E6L A;  3GDQ A;  4I6M A;  3NGZ A;  3VQ9 A;  2JWK A;  4PY5 A;  1ASU A;  3ZEU A;  3CPW M;  3T19 A;  4DFK A;  4CHN A;  1XHX A;  5AQK A;  1NWK A;  3QEX A;  4Y1D A;  4CGJ A;  1U48 A;  2FBV A;  3O4W A;  2W42 A;  3NH1 A;  3ENB A;  2VYP A;  4ILJ A;  1VRT A;  4MFB A;  3F2K A;  2NRH A;  4FJ7 A;  3O4N A;  2HND A;  3RMB A;  1TKD A;  4CK3 A;  3HPG A;  3BF3 A;  3VEY A;  4YNQ A;  1VQ5 N;  3EO3 A;  3AO3 A;  3NF8 A;  3O9R A;  1Q82 O;  4JNE A;  4CEC A;  4PHT X;  3H3N O;  4JI4 K;  1OVQ A;  5K14 A;  1J5E K;  4BRQ A;  3AA2 A;  4JKC A;  1RFQ A;  3ZSW A;  1NKB A;  3P1G A;  5BRD A;  1L5U A;  4A61 A;  1E4G T;  3ATV A;  1U49 A;  5F1X A;  3DOK A;  5ADX H;  3D0P A;  2P9N A;  1NJI O;  2OYQ A;  1RNH A;  4DSJ A;  1XI1 A;  2F7T A;  3I8D A;  4J2E A;  2YV0 X;  2D0C A;  2BDP A;  3V9W A;  2NRZ A;  1HPZ A;  3AVG A;  3CJ7 A;  2G8H A;  5BRE A;  4WQ4 A;  3TAE A;  4KV8 A;  2O8D A;  4OJR A;  4H03 B;  3LAK A;  4DFP A;  4CZK A;  1K73 O;  4FK4 A;  4NCG A;  1VQ4 N;  3DRS A;  1C1C A;  4KB0 A;  1NKE A;  3TPQ A;  3VQ6 A;  2D0P A;  3PX0 A;  5JLH A;  3P5J A;  3VET A;  1MDU B;  4OO1 J;  1S3X A;  1RBU A;  5JS2 A;  2OAN A;  1OKJ A;  2P5O A;  2IIR A;  1C0T A;  4BRE A;  3OYC A;  4W5Q A;  4H4O A;  1HR0 K;  3AV9 A;  1QE1 A;  1C6V A;  2YHX A;  1ASV A;  2WON A;  3OY9 A;  4MO5 A;  4IKF A;  4DR3 K;  3M6G A;  1KFD A;  3THV A;  1L3S A;  1BGX T;  4C8M A;  1XHZ A;  3ZT3 A;  4MDB A;  4I2Q A;  3M8Q A;  4V19 S;  4AHS A;  3WNH A;  1DLO A;  3LM9 A;  1V4T A;  3CCJ N;  4FWS A;  3CCV N;  1CLQ A;  4AHT A;  3CQ8 A;  4CGG A;  3MAQ A;  3WXI A;  1U04 A;  3RRG A;  1QSY A;  1RT4 A;  3V9U A;  3FFK B;  1HPM A;  4ILH A;  1HYV A;  4KO0 A;  2YI1 A;  1ZXO A;  3AVK A;  4B08 A;  3NBP A;  3BY5 A;  4BRL A;  5LJW A;  4DQQ A;  4NXM K;  1LWE A;  3SQ2 A;  5AZJ B;  5SWM A;  1P90 A;  4R5P A;  3TAG A;  4AH9 A;  2YHY A;  5SZT A;  5I42 A;  3QNN A;  3FGU A;  2OTL N;  4FYD A;  4BQL A;  1T05 A;  1XQS C;  5ELZ A;  1Q18 A;  2LSN A;  1U2V B;  4O8K A;  5J2P A;  3FZM A;  4CIF A;  1JCE A;  4LFB K;  1LW2 A;  3QFP A;  3RMD A;  4KHP K;  4LD0 A;  3S3M A;  4DR4 K;  3NFA A;  2EX3 A;  2FF3 B;  1J5O A;  1BCM A;  3MCP A;  4WYB A;  3QEV A;  4CF0 A;  4JHD A;  2CH6 A;  4DTO A;  1XNQ K;  3WXL A;  4BWM A;  4DUZ K;  2IGI A;  4EFH A;  5HL7 L;  3KK2 A;  2F8T A;  1RDA A;  3HL8 A;  3DLR A;  5CYM A;  2HVH A;  4IEI A;  4CZM A;  1O1W A;  4CF8 A;  2VG6 A;  1OH7 A;  3WNF A;  4E7J A;  5AQN A;  3H1V X;  4CZI A;  5BPN A;  4BG9 A;  3NVK A;  3ITH A;  5TKY A;  3R6M A;  4XIU A;  4JS4 A;  2OPQ A;  3OJU A;  1LOT B;  3LDN A;  3PUF A;  2Q1N A;  1FK9 A;  1SL1 A;  4CBU A;  3O08 A;  4DHY A;  3FFI A;  3UKU A;  1RT5 A;  5AQT A;  1TYQ B;  1QQN A;  2E1Y A;  4KKO A;  1Q81 O;  5GAD P;  3TTD A;  4OX9 K;  1RBV A;  2O8F A;  3AGK A;  4BGB A;  4CES A;  3NH2 A;  3AVI A;  5FDL A;  4BR2 A;  3OA9 A;  5DM6 L;  4JEP A;  4OGC A;  1NGD A;  1EWR A;  2RF2 A;  2KZM A;  2HHT A;  2IS3 A;  1YJN N;  4AM7 A;  3FZL A;  3FLC O;  4JV5 K;  4EP4 A;  5KQ8 A;  3B8A X;  2GWJ A;  2HBJ A;  3HVT A;  3SJH A;  4BRC A;  2D0A A;  1T6D A;  2O4G A;  3G25 A;  3CFP A;  3KLE A;  4J2D A;  2ZJQ L;  4A62 A;  5HOO A;  4MO4 A;  4ICL A;  2E8A A;  4HTU A;  4BVO A;  4E19 A;  2HOE A;  4ZTF A;  1W9H A;  5E84 A;  1KCF A;  1BU6 O;  3DYA A;  1WB9 A;  5AQQ A;  3DAW A;  4BRI A;  1ZC6 A;  5A2Q O;  4KBO A;  4Q5V A;  3A5L C;  4JK9 A;  3VEZ A;  3T1H K;  1GOC A;  2G8V A;  2UUC K;  3AO1 A;  3S3O A;  1JCF A;  2VWJ A;  3U8X A;  1TKZ A;  3ZSR A;  2HVI A;  5KRS A;  3VF6 A;  3OHR A;  1JLC A;  3EL2 A;  5KRT A;  1TUY A;  1RDD A;  1JCG A;  3H3O B;  3H45 C;  4O55 A;  1VRU A;  4BE2 A;  4N41 A;  2QXF A;  1OH5 A;  2Y1J A;  3QO9 A;  3T7Z A;  4JI1 K;  1ZBI A;  1JLB A;  4FPA A;  5C12 A;  3VQE A;  1NM1 A;  4WQ5 C;  4K41 A;  3O4Q A;  3VEO A;  4CJT A;  4KH6 A;  4FLY A;  3B6O A;  3KD5 E;  3QIO A;  5AQV A;  2EWS A;  3I0S A;  2KW4 A;  3K5M A;  4IOC L;  3EKS A;  3FE1 A;  2NRT A;  3LP0 A;  2P9U B;  1BI4 A;  3VA3 A;  3MEE A;  1EET A;  3PIO L;  2QWQ A;  3DM2 A;  1KVA A;  4M42 A;  3MEG A;  1K9M O;  3HOT A;  2W6L A;  3LWM A;  3OS1 A;  4MLE A;  3RR8 A;  5KPZ A;  3CER A;  1IJJ A;  1S22 A;  1BWF O;  2D4W A;  3ISN C;  1NKC A;  4LSN A;  4PKI A;  3A5M C;  4NYN A;  4FJ5 A;  1K8A O;  3NF6 A;  3F9K A;  3NGI A;  4CZG A;  3GOI A;  2A1R A;  4LFC K;  1LW0 A;  3LZI A;  4X64 K;  4H0X B;  5HBM A;  2OZS A;  4CJL A;  3OYB A;  4DUY K;  4FLU A;  4IFV A;  3JYT A;  1NGF A;  3VEX A;  3J7Z O;  2F96 A;  2YNI A;  3HJF A;  2ATQ A;  3OBW A;  4B3S K;  4X65 K;  5HRS A;  4DQ8 A;  3MCA B;  2JWL A;  4W5N A;  3CCU N;  2Y1I A;  4FWP A;  2QA4 N;  3ZSY A;  2Z1J A;  3AVL A;  4RWT A;  1M1K O;  1VQ7 N;  4I9Q A;  2O8B B;  4PA1 A;  2HMP A;  4DKW A;  5AFU H;  3C65 A;  2RHK A;  1RT1 A;  2DFH A;  2A40 A;  3U6F A;  1EWQ A;  4AQY K;  3AAR A;  3CME N;  4DTJ A;  4FVU A;  3VN5 A;  4BRM A;  5HRR A;  4K25 A;  3IDH A;  3TAN A;  1JLF A;  1IO2 A;  3KLF A;  1JXE A;  1S5J A;  3UB5 A;  4FJ8 A;  3W0L A;  3HP6 A;  4NXN K;  5C15 A;  3V4I A;  1GLA G;  4CFA A;  2W40 A;  3I0R A;  4KTZ A;  3J7Y P;  3DOL A;  4O44 A;  4KHN A;  3VGL A;  4KHW A;  3SBT A;  2QW9 A;  4JD2 B;  4DTU A;  3D2E B;  1DTT A;  2ITG A;  5D3G A;  1TL1 A;  4IOA L;  1HKG A;  3QBW A;  2Z1G A;  1YAG A;  3WT0 A;  4DU1 A;  3CCQ N;  1GLL O;  3CC2 N;  1FKO A;  3MN7 A;  3SNN A;  4Z4G A;  4B9Q A;  3F9M A;  3IKM A;  4CJW A;  4KHQ A;  2ZJP L;  1YIT N;  3QFU A;  1JXB A;  4W5R A;  3AVM A;  3KWI A;  2HHV A;  3AA4 A;  4IO8 A;  1CZB A;  3RVC A;  5CR4 A;  4HWI A;  4O5F A;  3CJA A;  2HHW A;  3K9J A;  3O5B A;  2BUP A;  1GLE G;  1HNW K;  3D7E O;  3HYF A;  2A42 A;  3PIP L;  4OPK A;  3S41 A;  3KTQ A;  2AJQ A;  4E3S A;  2FC0 A;  3JSM A;  1VQM N;  3LZJ A;  1EX4 A;  2O8B A;  5CE3 A;  3U4L A;  3THW B;  1MA9 B;  4MQ3 A;  1N33 K;  4DU4 A;  5EY4 A;  4CBX A;  2PZS A;  3C0B A;  2BGG A;  1WAF A;  1K8K B;  1NGE A;  4DV5 K;  2Q97 A;  4YOX A;  4DSK A;  4FJH A;  4FK0 A;  3QLH A;  1CXQ A;  1HUX A;  1WN7 A;  4JI5 K;  4OLB A;  4O0J A;  3LM2 A;  2YNG A;  2D0B A;  3ZX3 A;  4AM6 A;  2IC3 A;  4CFB A;  3KZB A;  3THX A;  4LC9 B;  3SI6 A;  2DY4 A;  3HT3 A;  1XNR K;  4F8R A;  3VMF B;  2ZGY A;  3H1Q A;  4BQZ A;  3IMX A;  2OZM A;  3DLK A;  1LV5 A;  3DLE A;  3VEN A;  3V81 A;  1SS6 A;  3O1W A;  4N47 A;  3OTO K;  3RWU A;  3ASM A;  2BH1 A;  4TSX A;  5AQS A;  3SAH A;  5JVH L;  4FLW A;  2ZD1 A;  4BR9 A;  1BG3 A;  4IO9 L;  2FSJ A;  4HTL A;  5GAE P;  4KAZ A;  1BIZ A;  4H0O A;  1YTA A;  4FZZ A;  4CJ7 A;  3TTC A;  1W2B M;  3C7N B;  1FW6 A;  2NRX A;  3HM9 A;  3DXK B;  1UWB A;  1TUU A;  3QDK A;  4CJS A;  2XHB A;  1NJY A;  3VTI A;  3TI0 A;  4WFN L;  4IBN A;  3RMA A;  2O8C B;  3VQD A;  1Q9Y A;  3ZCM A;  2ZQB A;  4BDY A;  4FWK A;  2OPR A;  1NGC A;  2J4R A;  1IKV A;  3DI6 A;  2XO7 A;  4BAC A;  1XUP O;  3KWG A;  3MMV A;  1RBT A;  4H4M A;  3L2Q A;  5KPT A;  4IEE A;  4CZH A;  5EXW A;  1DGK N;  1WAJ A;  4B1W B;  2V7Z A;  4IJN A;  3ZT2 A;  4OVL A;  1YUW A;  4E7H A;  4FOE A;  4BGA A;  1KQS M;  2P9P A;  4AHR A;  2UXB K;  5AQU A;  3ENH A;  4PQU A;  2QWM A;  3SUO A;  2CH5 A;  1GOB A;  5M1F A;  4LY7 A;  4M3U A;  1Z25 A;  1TGO A;  1NGG A;  1VQN N;  1YF5 L;  4ZHR A;  3HI0 A;  4FZX C;  3MWT A;  1NGH A;  5T7B A;  2YHA A;  1KC8 O;  2QI2 A;  4LF7 K;  4BRP A;  4JRP A;  1SKW A;  4ID5 A;  4C8L A;  3HXM A;  1RIL A;  2WOM A;  4E7L A;  4FJL A;  5C0Y A;  1SUQ A;  4Q0B A;  4FJG A;  4HCB A;  2A41 A;  1HMV A;  1VQK N;  3OYN A;  2NNW A;  4FJ9 A;  5GAH P;  4IFY A;  4FW2 A;  2O8D B;  3C94 A;  3O80 A;  4RW9 A;  3KKR A;  4BRA A;  2HBK A;  3MEC A;  4YOY A;  3QBX A;  2Q36 A;  4JI2 K;  3C6T A;  1HJO A;  3SLC A;  4FCY A;  3TAQ A;  4BRG A;  1TKX A;  4GY2 B;  5AQG A;  2ETJ A;  3TU5 A;  4N76 A;  4DWI A;  2I5J A;  1RT6 A;  2FXU A;  3L8B A;  2UUA K;  1TAQ A;  3ULE A;  2O8F B;  3ATU A; 
#chains in the Genus database with same CATH homology
 4GKK K;  4DV7 K;  4DV3 K;  4K0K K;  4JI0 K;  4DR7 K;  1IBM K;  4V19 S;  4LF9 K;  2UXC K;  4GKJ K;  4DV0 K;  3JAM O;  1XMO K;  5FLX O;  4JI7 K;  4OX9 K;  4LF8 K;  2VQF K;  2E5L K;  4LF4 K;  1N36 K;  5AJ3 K;  4YHH K;  1IBK K;  4CVN E;  5LMU K;  4B3R K;  1HNX K;  4LFC K;  4JV5 K;  4X64 K;  1HNW K;  3J81 O;  4JI4 K;  1N32 K;  1J5E K;  2UXB K;  4DV6 K;  4DV4 K;  4DR2 K;  4DUY K;  1HNZ K;  4NXM K;  4LF6 K;  5IWA K;  4X66 K;  4JI8 K;  4CW7 B;  4JYA K;  1N33 K;  1I94 K;  4B3S K;  4X65 K;  5A2Q O;  4DV5 K;  4DV2 K;  4LF7 K;  4LFA K;  3T1H K;  4DR5 K;  2UUC K;  4JI5 K;  3J7A P;  2UXD K;  4LFB K;  2VQE K;  4KHP K;  5LL6 Z;  4DR4 K;  3J80 O;  4X62 K;  2HHH K;  1XMQ K;  5LMN K;  3T1Y K;  4DV1 K;  1N34 K;  4LF5 K;  1XNQ K;  1XNR K;  4JI3 K;  4AQY K;  4JI2 K;  4DUZ K;  1IBL K;  2UU9 K;  4B3M K;  4JI1 K;  5BR8 K;  4DR1 K;  1HR0 K;  3OTO K;  4NXN K;  1FJG K;  2ZM6 K;  3J7Y P;  4YY3 K;  2UUB K;  4B3T K;  4DR3 K;  5IT9 O;  2F4V K;  2UUA K;  4JI6 K;  4DR6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...