1HNZK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnzK00
1XMOK 4B3SK 4LF9K 1XMQK 4NXMK 4B3RK 4K0KK 4NXNK 4DR6K 4X65K 2UUCK 4DUYK 5FLXO 1IBKK 3J7YP 1FJGK 4JI2K 4DV1K 3J81O 1IBMK 2UXBK 4DV6K 4DR3K 3T1HK 4DR2K 1HNZK 2UUAK 4LF8K 4X66K 4DV5K 4AQYK 4JI6K 2UU9K 5LMNK 4V19S 2UUBK 1J5EK 4JI1K 4CW7B 4LFAK 3J80O 1XNQK 1HR0K 1IBLK 4JI3K 4GKKK 4X64K 4GKJK 2F4VK 1XNRK 4JI8K 2UXDK 4DR5K 4B3MK 2VQEK 4DV7K 3J7AP 4JV5K 2HHHK 4OX9K 5IWAK 4YHHK 4LF7K 5AJ3K 5BR8K 4B3TK 4YY3K 4LFCK 2ZM6K 5LMUK 4X62K 4LF6K 4DV3K 4LF4K 5IT9O 1N33K 4JYAK 4JI5K 4DV4K 2UXCK 4DV2K 2VQFK 4DR1K 1N34K 4LF5K 3T1YK 4JI7K 1N32K 4CVNE 1HNXK 4JI4K 4JI0K 4KHPK 5LL6Z 2E5LK 3JAMO 1HNWK 4DUZK 5A2QO 4DR7K 4LFBK 1I94K 4DR4K 1N36K 3OTOK 4DV0K
chains in the Genus database with same CATH superfamily
1IKVA 2HSTA 4FJ5A 3ZLJA 1KD1O 4CJKA 4ID1A 4Z4CA 3OYDA 1XMQK 2P9KA 3KTQA 5AQLA 3O9QA 3O80A 4FJLA 4X65K 4N5SA 2FBTA 4UY8O 3PX0A 3TTDA 1KVBA 4IDKA 2OANA 1NK8A 2KLAA 2O8FA 4CZEA 3H6EA 3K57A 3GL1A 1JJ2M 3AA2A 3DYAA 5C10A 1IBMK 4KTQA 4E7IA 4CF8A 1QHAA 1BDGA 4DR3K 4M3UA 5BREA 4CF2A 5M1PA 1LAVA 4F3OA 2WBNA 3DI6A 1W0HA 2PFUA 3HVTA 5AZIB 3W3DA 3K9KA 4J2EA 4DQPA 3PV8A 1BI4B 1U45A 4KH4A 1RTDA 4CBUA 5M1FA 2ITGA 1ZC6A 4CW7B 1S6QA 3J80O 1BA1A 1LWEA 4E3SA 2E2PA 4KB0A 4KHSA 1VQMN 3D6RA 4FZYA 1ASWA 4K8XA 3QINA 3QFUA 4BRIA 1EXQA 1DEJA 4FJJA 2V7ZA 2OPSA 3F2KA 5SWMA 1KTQA 4OGCA 4M3TA 2P5GA 3S3OA 4FWPA 4K41A 3U4LA 4FLZA 3OW2M 3CCEN 5DM6L 2OTJN 3NF7A 3M8SA 3CCVN 5C15A 3AGKA 3ZCMA 1EWRA 2IDOA 3NDKA 2HNDA 3THWA 1GLBG 5FPNA 3Q7BA 3ZSQA 2ZJPL 1SZ2A 4DTSA 3V6DA 3R3LA 3BZKA 1BISA 4DUZK 4DR7K 4N47A 4KAZA 4PL7A 3EL2A 4DV0K 4CK3A 4DU1A 4WCEL 4NLCA 4CD3A 2QA4N 1IV0A 5KRTA 3SI6A 2EX3A 4FZXC 2ZF5O 3CHWA 4BC4A 3AO3A 1L3VA 3W0LA 1RT3A 5J1EA 3HPGA 2E2OA 3I8DA 4CHPA 3OBYA 4HUGA 5AQYA 3VF2A 3P5JA 3DLLL 4FWSA 2YCHA 3RMAA 4FSVA 2ASOA 5JVGL 1A5VA 2A40A 1N8RO 3AA3A 3V9XA 3S9HA 4FL9A 3MECA 4B3OA 3RMDA 4GV3A 3D45A 3QBWA 1NNEA 2ZWHA 1Q8IA 1NOZA 3VETA 3O8MA 3OYGA 1ASVA 1NBWA 3L8BA 4BGAA 1Q81O 4JKAA 1X3NA 4OGEA 3FZMA 4RCHA 2FXUA 1IBLK 4DFMA 1JCGA 2CGJA 1XNRK 1UA0A 1CZ9A 1ATRA 1HX1A 3H3NO 3R1XA 3VOVA 4AHTA 2VWBA 4DFPA 3T19A 4CBXA 3NE6A 1IKYA 4FOEA 1HPMA 3JXUA 3I8BA 3OVNA 4WFAL 2YNFA 4LF7K 5AJ3K 2P9NB 2NRWA 3FLCO 4W5OA 3K59A 3HM8A 4BRFA 5AZJA 2P9PA 4FWRA 5AQTA 2ITMA 1NJZA 4E19A 3EY1A 4FYDA 5E41A 3VF4A 4JKCA 3WXMB 2GWJA 3QIOA 4ELVA 3H1VX 4DLGA 3AVCA 4NYFA 4JN4A 1NMNA 2IS3A 2CGKA 2Q97A 3PO5A 5M1OA 1EQYA 3SQ4A 2EHGA 4I2PA 1NGCA 3SUNA 1S9EA 4J8FA 1T8EA 4OKEA 5AR0A 1HKBA 1IKWA 3CCSN 1LOTB 4MFBA 4GY2B 4NLBA 3HP9A 1S9GA 4YDUC 1KAXA 3CJ7A 1TKTA 4MO4A 1YHQN 3MX2A 3MDQA 1IBKK 1ATSA 1NJYA 4DV1K 5CYMA 1D4XA 1NGGA 3A5NC 3LDNA 1CXQA 4BRCA 3H1QA 2QWOA 1QQNA 3L3VA 2ZQBA 3QEVA 5K14A 4HCBA 3ZETA 3BEXA 1K8AO 1QVFM 3LDQA 1VQPN 4DV5K 4CFBA 1NGIA 4DWIA 1K8KA 3UE5A 1HYZA 4Z4FA 4IBNA 2Q0RA 1SKWA 4FWLA 1HKGA 3FFKB 4DU4A 2P5OA 5EVZA 3H3OB 4Q0BA 3VGKA 3THXB 4I2QA 4C1NK 3ISNC 1SS6A 3H45C 1WSIA 1W7AA 1KVCA 5HLFA 3UKUB 4XH4A 4B3TK 4KREA 5AFUA 1TGOA 2OCEA 3DXKB 2QKBA 4JHDA 2E4LA 3C65A 1NKCA 4FWMA 2QXFA 5KQDA 3MAQA 2P9LA 4MQ3A 4BRQA 3HPOA 4GV9A 4DQRA 3MMVA 4DKWA 1IO2A 4BR2A 3VEVA 1T44A 2Q36A 2NUBA 3PUFA 5C25A 4QS8A 1S1VA 3WEEB 4QOZB 4CVNE 4GVMA 1NG9A 3SV3A 3O1WA 4NO7A 1EETA 1Y64A 2KFNA 1DT9A 3RRHA 4C8LA 4H5WA 1TL1A 3F5TA 4H0PA 2KW4A 2OYQA 1ILYA 4YOVA 4IJNA 2DPNA 4DSLA 1KRPA 4E7KA 3HRGA 1VQ9N 3L2WA 4CFDA 4DFKA 2F96A 4DTOA 1J54A 4H0VB 4HUFA 3QEIA 4KO0A 3AGRA 4G9ZA 4H5NA 4FJKA 4KKOA 3QNNA 2O4IA 3QERA 1YJWN 1RT1A 5BN9A 1KSPA 4PUOA 2HNYA 4JKEA 2UUAK 2D4WA 3SBTA 4PKGA 1X9JA 4E7HA 3HJFA 3TI0A 3BZCA 4JI6K 1JKHA 1LCUA 4OLAA 4FOIA 3WUHA 4ZTJA 4V19S 4WQ4A 2ASPA 3HSCA 4JI1K 1JLAA 2XO7A 1S72N 1T3VA 5AQSA 5M1KA 2PAVA 1VSIA 2Q31A 5HOOA 1RBRA 4GMJB 4FK0A 5C0YA 3CCMN 1RT6A 2OPPA 4OKKA 3NH1A 4IEEA 3C95A 5BPMA 1RT7A 5BRFA 2HHHK 5FDLA 4DHYA 3DRRA 2GWKA 1Z6RA 4IFEA 4AHSA 3V81A 4CHNA 4H0OA 4CJLA 5J2NA 4MDAA 3SQ2A 2P9KB 3VQ4A 2E1ZA 2NRXA 1BL3A 1TAQA 2GV9A 3LP0A 5ADXA 1T7PA 1YF5L 1Z05A 3QEWA 2O8FB 5GAHP 4XIUA 3R8EA 2PYLA 4CJTA 2A1SA 3O1BA 4LFBK 1HYVA 3CF5L 4Q5VA 3E9OA 2YNGA 3MEGA 2B4JA 4CCHA 2F9TA 1TAUA 5E84A 4M3ZA 1RBUA 1WSHA 3OS2A 1MWKA 1IH7A 3LPTA 1WSGA 3WT0A 3AA5X 5FPDA 3TAQA 1VK0A 1QE1A 3OS1A 4KHWA 2VYPA 4OLBA 2UUCK 3A5OC 3V9SA 3IMXA 4CK1A 3PSIA 1K9MO 2ETJA 2HHUA 4UQGA 1C1BA 5DMRA 3D2EA 1LWFA 5F0XA 2X74A 3TAFA 3AVFA 1SV5A 3SUOA 1O1WA 1VRTA 2Z1JA 3F9MA 3DXKA 1RTHA 3MXJA 3A0IX 4NYNA 4LF8K 4G1QA 4EP4A 2F9WA 2G8VA 1VQON 3CIPA 3MWPA 3TANA 2QWQA 5CR4A 3RTVA 3SMSA 2HHSA 4B8AB 4B1UB 3PX4A 3PSFA 3ULEB 5AQQA 3ZT1A 1HUXA 3E01A 4CJSA 4KHQA 2A6AA 4DFJA 3OYMA 3WEEA 4AHCA 3THWB 3L4QA 1D5AA 4CFAA 4U7BA 2NZTA 4CJ4A 4DV7K 3SJHA 3EZ5A 2G8WA 4CJ7A 5J2MA 1QTMA 4YOTA 1T6DA 4YHHK 4CHYA 1ASUA 3D7EO 4H8KA 3N4QA 3CC2N 3P83D 1FKPA 3P39A 3SCXA 1BWFO 2CGLA 3MEEA 4W5RA 4ZTFA 5J2QA 2YKMA 3HOTA 1RFQA 3O4WA 1GLEG 3C0BA 4LSNA 1NK9A 3L2RA 3CYMA 3LDSA 1D8YA 3CM5A 2WC9A 3LZIA 4B1WB 3A5MC 3CFPA 4JI7K 4CGIA 3AAPA 4BQLA 3TSPA 4CGGA 4FO0A 4NCBA 4JK8A 3T1AA 4O0IA 3I0SA 4YDUA 5HRNA 4CZMA 4KFBA 3LZJA 3WNHA 3WXJA 1RTJA 4C8KA 4RWTA 2RKIA 1SQKA 1VRUA 4KH6A 3CG7A 3VQQA 4BRLA 3KK3A 3O5BA 2X6NA 4CZLA 1CZAN 3QLHA 3RMBA 1RGIA 3VEWA 4OJRA 2G8KA 3C94A 1NK7A 1X3MA 1QQOA 5LY3A 4KHUA 3VEYA 1Q9XA 2KZMA 4O55A 3KHYA 3OYEA 1RT5A 2H3GX 4DR2K 1S1XA 3ENHA 2ZGYA 3P31A 3ITHA 1XUPO 5AZJB 1BUPA 4CJQA 1HPZA 2P9PB 3BF3A 2W41A 4DSFA 4O44A 4AQYK 3SAGA 1NKBA 2NRHA 2UUBK 2D5RA 4L8RB 2XRIA 3K5OA 2HVIA 1J5EK 3TSQA 5CZ2A 2YHWA 4W5TA 4ISFA 2EWSA 3D2FA 3PLAA 4IXCA 2VCPA 1FKOA 1OKJA 3ZSWA 3UKRA 5JICA 2YHAA 4AILC 4AF1A 4AHRA 3EKUA 3O9RA 3CMAN 1RCHA 4LY7A 5C42A 2D0AA 1HNIA 4NCAA 4M45A 3VQ9A 3DWLA 4M7XA 3CPWM 3WXLA 1VSMA 3ENBA 3DM2A 4IG0A 4CZJA 4JYAK 3MEDA 3M1FA 4IFYA 4OPKA 3NH2A 4JKGA 4CJPA 5HRSA 1UAXA 2CH6A 3PIPL 1L3SA 4WQ4C 1N34K 2GELA 3MK6A 4Y1CA 3CCLN 4RW4A 2HBMA 5HBMA 1WSEA 2NRTA 5MLCQ 4BG8A 4LH4A 5LL6Z 2IAJA 2VGNA 4EZ6A 2IOCA 1ZBUA 3MXIA 3ZETB 2P9IA 1OH7A 1HJOA 1J9AA 4E89A 3SPZA 3K5NA 5GAEP 3ULEA 4M3RA 2FF6A 3SMPA 1K8KB 3VQ7A 4ELUA 3HO1A 1RBVA 2KQ2A 2Z1HA 3VF6A 3CJCA 1VAZA 5GIOA 4W5NA 4FJ7A 1BIZA 2BDPA 2VWKA 3GG4A 3V9ZA 1ZBLA 2GUIA 2P9UA 4BRAA 1RDCA 4U67L 1C0MA 4A61A 3PY8A 5AQVA 3QIPA 4CERA 3RR8A 1A5XA 3LP1A 1YI2N 2LSNA 4Y0WA 4PWDA 3J7ZO 1UA1A 4GW6A 3QMLA 1S1UA 4JHDB 3NH0A 3TTCA 4A2AA 1BQMA 3HP6A 1C1AA 3U9DA 5BN8A 1NMDA 4MLHA 3OYCA 2P9LB 3G71N 1VSJA 1WBDA 3WQUA 4C8OA 3ATVA 3SV4A 3ID8A 5KGWA 2W6LA 1YXQA 4CIGA 1KFDA 3CFOA 4M7YA 1NGJA 1HR0K 4JI3K 2YV0X 1BQNA 3NFAA 2DFHA 3P38A 4BR0A 2F4VK 4JI8K 1Z26A 2F7TA 4C8NA 4FWKA 2O8CA 4RW8A 3ZEUA 3O3GA 3CJ1A 2XY5A 3PX6A 4B3MK 3HZ6A 5BR9A 2E1YA 1IG9A 1U2VA 3ZSYA 5AQUA 3L6QA 5IWAK 4OPAA 1JLEA 4MLEA 4BQZA 1JL2A 1N6QA 5LMUK 4CF9A 4X62K 3VA0A 3CC7N 5KPRA 4LF4K 1TVRA 3TWHA 4FLVA 3SUQA 4BC2A 1RT4A 3FZHA 3OYKA 2W40A 4RG8A 3A5LC 4OO1J 2HNZA 4LF5K 3CQXA 4IKFA 4FLWA 4DTMA 1M90O 4JI4K 1GLCG 3KD5E 1U04A 1SKRA 4HCCA 4JI0K 2QEXN 4CIEA 3U3YA 3NGYA 2ZJQL 3U3GA 4I6MA 2GTDA 3ENOA 4H4MA 1MA9B 1VSEA 3B6PA 3AVBA 3KWIA 4CHQA 3G6EN 2O8DA 1U47A 1K6YA 4KTZA 5AQWA 4F2SA 3ATUA 4CBWA 1TK5A 2WONA 4YOWA 3VQ8A 3CCQN 4BACA 1YUWA 4RW7A 3NGZA 5JLHA 1VQLN 4K8ZA 4CZKA 2HHXA 5BPLA 5GIPA 4BRNA 1BHLA 3LL3A 1NJWA 3KVGA 3OY9A 3S3MA 4B9QA 4CEQA 4OVLA 4WE1A 3QBXA 5B8HA 2O8BA 2HOEA 5AQXA 1KAYA 1NLVA 3UB5A 4BR5A 1SAZA 4A57A 4LFAK 3OBWA 1KC8O 4GV6A 1D9DA 3A8YA 4BREA 4KV8A 1RDWX 1NJXA 1QQCA 3Q7CA 1GLAG 3MWTA 3T3FA 4CECA 3KZBA 1W9HA 2I7NA 1NWKA 2WFBA 1S3XA 4RW9A 1DGKN 4IO9L 3HI0A 5EU7A 2V51B 3F9KA 4QAGA 3NVKA 1S1TA 3OYLA 1BCMA 4I9QA 1RT2A 4CGFA 1T05A 4FJMA 3CD6N 3VEZA 5AQIA 2YJEA 4EHUA 4KHNA 1WSJA 4DTRA 3BF1A 4Z4GA 1WB9A 1QSSA 1RDBA 3MN5A 1JCFA 2OZSA 3DXMB 3D2EB 1ITGA 3TAGA 1NGAA 4IOAL 3OYIA 3NAEA 1OH8A 3ZT0A 2Q0UA 3FFIA 4CEOA 3VGMA 4CEZA 5A2QO 1VQ4N 4DTJA 3LP3A 2G8IA 3AO5A 1SKSA 5M1NA 2AJQA 3SNNA 3DRPA 1GLFO 1JXEA 3CMEN 5GADP 1C6VA 4B3RK 1WNSA 4PHTX 4NXNK 4B9MA 3C6UA 1WBBA 5I9EB 1YITN 1JLBA 4DUYK 1HJRA 5FLXO 4HUEA 3J7YP 2HHVA 4AM6A 4K43A 4DTXA 3SAFA 3QFPA 1L5UA 4JKBA 2UXBK 4XH1A 1WOQA 3T1HK 4FJ9A 1HNZK 3VMFB 2E6LA 4Z4HA 1ZYQA 5AQFA 3TR8A 4ILGB 3OYHA 1Q82O 1RILA 1KXPA 5ELZA 1G99A 4CGJA 3KLFA 4FLXA 4DSJA 3I55N 1JLCA 4I9LA 3AVNA 4DSKA 4GKJK 4BGBA 3KK2A 3SAHA 4I7FA 4BRPA 1YAGA 5EY4A 2RPIA 3ASMA 2Q3SA 4OKJA 3F73A 4K25A 1BOTO 2VG7A 1VQNN 4CJRA 4KPYA 4E1MA 3OS0A 1UWBA 4YY3K 5GINA 4GNIA 1NK5A 4FK4A 4F3TA 4PA1A 4J2BA 4TSXA 1BCOA 4LSLA 3M8RA 1GOAA 2YJFA 1RDDA 3EEQA 4DV2K 3DOKA 3NHGA 1U6ZA 4EP5A 3L2QA 4CJWA 4AH9A 1DKGD 4QS9A 4CF1A 1C0UA 1FK9A 3HTVA 3SLCA 3MXMA 3RRGA 4KHPK 3TTFA 3VQAA 2ZGZA 5CHIA 1NGFA 3WXKA 4BROA 3QNOA 3G25A 3QEPA 4DR4K 3ZSRA 1JCEA 3AY9A 1OVQA 3E66A 4FJGA 3ZSZA 5BRDA 3L4IA 1TKZA 3VQDA 2ZJRL 5KGXA 4ID5A 1BO5O 3G10A 4JAXA 3E1YA 4QCLA 2O8EB 2BTFA 1KQSM 4MDBA 1QZ6A 3D2FB 3UKRB 4M63C 5FROA 2IC3A 1VQ8N 4B1YB 2HF4A 4ELTA 1DTTA 3SQ1A 2GX9A 4E7JA 3THVA 1HQEA 1NU0A 4DS5A 3V1QA 4IFVA 2JLEA 2QTDA 1GOCA 3QB0A 3VTHA 4JKDA 2KKZA 4JKGB 3O9SA 5EXWA 2PZSA 3IKMA 1HRHA 4CEAA 3HBTA 3VQ6A 3M5RA 3RMCA 3PO4A 1ESVA 3DXMA 3EE9A 4KHYA 4R5PA 4IG3A 3TAMA 3IDHA 3KK7A 3V1RA 3H08A 3OJUA 4Z4EA 3J7AP 4CZFA 4ZHRA 5D3GA 3B6OA 3ZX0A 2P9IB 2J4RA 3IS9A 1C0FA 1BGXT 5TKWA 3ZSVA 5BR8K 3AV9A 1XHXA 5AQJA 2RHKA 4KI4A 4BDYA 4B9TA 2R7YA 3C7NB 1IKXA 3OYJA 1KLMA 1WLJA 4LC9B 2Z1IA 4XH5A 3DLEA 2P9UB 1HMVA 4ICLA 4OPHA 4CE9A 1TKDA 5JS2A 1O13A 4CEEA 2JGUA 3AARA 3DMJA 3NF6A 4O5FA 2VG5A 4LD0A 5BPNA 4F4KA 2YI1A 3LDPA 4PY5A 4YNQA 4E1JA 3VQEA 3KKSA 1TYQA 1C0GA 4CJ5A 1BIUA 4Z4IA 3TPQA 3EO3A 1L3UA 4B3SK 3TAPA 4HVJA 1EX4A 3BUZB 3JYTA 5M1QA 2QWMA 3HK2A 3M8QA 5F2RA 2D1KA 4F9OA 3QO9A 3DLKA 3K5LA 2HHQA 3IG1A 2A42A 4EIAA 2HB5A 4OPJA 2BUPA 3O9TA 5C12A 4IWVA 4MO5A 3SQ0A 3HT3A 2RF2A 4JI2K 2O8CB 4FJNA 3ZEUB 5FPEA 3HL8A 1U2VB 1VSHA 2E2NA 4PKIA 1CZBA 1V4TA 2YHBA 4BE2A 1DLOA 3KD1E 2YKNA 2FSJA 1C1CA 1TUYA 5HRRA 2QWLA 1RTIA 1QVGM 2VWJA 3CPEA 4DSEA 3KLGA 5FRNA 2F8SA 3E9LA 3S41A 5JS1A 1YTUA 2Y1IA 3DAWA 1X1PA 2FF3B 4FM0A 4BG9A 4CF0A 2NNWA 5KTQA 1TL3A 2VQEK 4IOXA 5LJVA 3OYAA 1JLFA 3ZSOA 4CGDA 2OZMA 3U9ZA 4I6MB 4F8RA 1WUAA 3IUCA 1YVNA 2E20A 1ATNA 2O8DB 5EOYA 3NCIA 3EZWA 2E2QA 2WTUA 2XY7A 4AHUA 3MX5A 2O8EA 4AHVA 5IT9O 3R9PA 1D9FA 1FW6A 3QDKA 1Q9YA 2UXCK 4WFBL 1RBSA 1U49A 3VA3A 3VQBA 3LP2A 2HMIA 4JD2A 2F8TA 4A2BA 1NJIO 4YOUA 4WQ5C 5AQPA 3MN6A 5AQZA 4K42A 4M3YA 4FJXA 3GDQA 4PQUA 3DRSA 3U8XA 1QHTA 1XC9A 3DLBA 3CERA 3WNGA 1LW2A 3BGRA 4NB4A 3O4QA 1T6CA 4O0JA 2P9SA 4Z0UA 2O8BB 4FJIA 3THYA 4IOCL 1BG3A 3QEXA 4R79A 3ULDA 4BRDA 1V4SA 4BDPA 4FWQA 1K73O 1XWLA 3HOSA 1UOCA 2GBZA 4BDZA 1S1WA 1F21A 1ZBFA 1XC3A 3DLHA 1FJGK 3EN9A 4FVMA 3J81O 3RSEA 2FBXA 4B9VA 1WSFA 4BC5A 2JWKA 2A41A 1W2BM 4JNEA 4M3WA 1H1VA 4KBOA 1TK0A 2IVPA 3C7NA 3DLRA 2PY5A 2XHBA 4BRGA 3PIOL 1KAZA 2IVOA 4FK2A 3NGIA 3KLHA 2P1JA 5HL7L 1XNQK 5DK5A 2V52B 3VENA 2ASMA 4CGHA 3LALA 3RWUA 3L3UA 4H0XB 3M8PA 3I33A 2A5XA 1E4FT 1EWQA 3DLGA 4FLUA 3AO4A 3VN5A 4DR5K 1NOYA 2HVHA 3AVGA 2IVNA 2CH5A 3M6GA 4IZ9A 1KCFA 4E1NA 2HBLA 4BE0A 4OX9K 5BRHA 3AVKA 4ISGA 3HYFA 4JK9A 4KRFA 5JMVA 1TKXA 4B1VA 5CYQA 4JK7A 3NVMA 5TKYA 1U48A 1VSDA 3LWMA 3CCRN 4JI5K 3FR0A 2HBJA 1ZBHA 4N56A 1NK0A 1HKCA 4DTNA 5T7BA 3ZT2A 1X9MA 4DR1K 3AO2A 2DFFA 1YIJN 2WUSA 1VQKN 3KK1A 4BY9C 2QI2A 4B9NA 2FLOA 4CHOA 2YHXA 4E7LA 1LV5A 4A5BA 1HNWK 2FC0A 1B9FA 3MCPA 4JRPA 1R59O 1NGDA 2A1RA 4CHZA 1W97L 3B8AX 3SJJA 3SUPA 1ZBIA 3S3NA 4BR9A 1MWMA 2G8FA 2HMPA 1RNHA 2I7PA 2QXLA 5C2DA 2E88A 1I3AA 4YFUA 4BWMA 3VQPA 4DR6K 2QWRA 1MDUB 3C6AA 4CEFA 2QWNA 2JWLA 2D0OA 1S5JA 1B9DA 4PL8A 1RBTA 1GLDG 1BA0A 1R0AA 4RW6A 1P90A 5GAGP 3ZT4A 2Z1GA 4FCYA 3T69A 1GOBA 3QETA 2FBYA 4CZIA 2DTUA 4HWIA 4DV6K 5FRMA 3CJBA 4B9UA 3AVHA 5AFUH 2HF3A 3P1GA 3HSTB 3OHRA 4DTUA 4DLEA 4EAHD 5AQNA 3ZSXA 2E8AA 4M3XA 4IJAA 4CK2A 1JLQA 3I56N 4BWJA 2OPQA 3G4SN 3RVCA 1CLQA 1S6PA 3V9UA 3WXIA 4H5VA 3T7ZA 4CJEA 1T03A 3EYZA 4EFHA 3I0RA 3SBGA 4BR4A 4JLHA 3AVMA 4WYBA 4C8MA 5AZIA 5KI6A 4E0DA 1JLGA 2ZM6K 4B8CA 2Q2RA 3N4PA 1VQ6N 3NF8A 1BI4A 5I42A 4H5TA 4DF4A 2AP1A 5AQRA 4H5RA 3AVAA 1YT3A 2ZD1A 4KB1A 4FM2A 1BU6O 3TU5A 2HBKA 4N41A 3OYBA 3BDPA 1YTAA 3MN7A 1E4GT 3R6MA 4DG1A 4W5QA 3IAYA 4HHTA 4RTFD 3CFRA 1M1KO 3EKSA 4BRHA 1QQMA 4O8UA 4CZGA 3LM2A 4FXDA 1TK8A 5JVHL 3VESA 2QK9A 4FLTA 4BR7A 2XY8A 3AO1A 2FSKA 2Y1JA 1VQ5N 4LF9K 3DJCA 1KLNA 2QM1A 3GBTA 3H46O 4H0YB 1I39A 5SZTA 1QSYA 3VERA 4WFNL 1JL1A 3AAQA 1XI1A 3IRXA 1Z25A 4C1NI 3OYNA 1IJJA 3FE1A 2DY4A 1TUUA 1XQSC 2P51A 4FZZA 2OTLN 4A59A 2NRVA 4PKHA 2NRZA 3K58A 4EHTA 4FJ8A 5AQGA 5AQOA 2X78A 3WQTA 1X9WA 3O3FA 1VSKA 3CCUN 2KZZA 2UU9K 2A3ZA 4H0TB 3TARA 3QESA 3A2FA 1VSFA 3CJAA 1G15A 1XHZA 5ADXH 2V7YA 5EX5A 3CI5A 3O4NA 4CD1A 1IG8A 3M3ZA 4JKFA 3AA4A 1NGEA 2X6SA 1Q86O 4WF9L 3LM9A 1RDAA 3KKRA 2D0BA 1U4BA 2UYTA 1EO1A 1TYQB 1N5YA 2Q1NA 4L3QA 1J6ZA 1CXUA 1EP4A 4LFCK 2HHTA 3FZKA 3ZYYX 4JRQA 3MN9A 1VSLA 1YJ9N 2BGGA 4WQ5A 5AQMA 1N33K 5HRPA 1HLUA 3KWGA 3ZX2A 4Z94A 1QZ5A 3WNEA 4DTPA 5HP1A 2B5JA 3LDLA 2W42A 3BP8A 4DF8A 5AQHA 1GLJO 4FLYA 3LDOA 2QWPA 3FZFA 4CESA 2HHWA 1J5OA 4BRMA 1L3TA 3SYZA 1Y97A 2G8UA 3RR7A 5KPTA 2IGIA 4BRKA 4BVPA 2P9NA 1XMOK 3QICA 1JXBA 3LANA 3FZLA 3TSUA 1J53A 4M41A 4B1ZA 1Q18A 2NLXA 3FGUA 4K0KK 3GE1A 1DTQA 3KLEA 4ILHA 3CM6A 3CJ9A 3NMUA 2QKKA 4DS4A 3LPUA 4M42A 3ID6A 1NM1A 5C2FA 3NF9A 3JS6A 5E26A 3GOIA 3CQ8A 1HQUA 1S22A 4CEBA 2VGMA 3NBPA 4KI6A 1NGHA 2B6AA 4X66K 3ALYA 4YOXA 1OH6A 4CJUA 5LMNK 2YX6A 3LAMA 1KFSA 4FW2A 1WAJA 2GEMA 4CIFA 2IIRA 2DFEA 1YJNN 1ZBSA 3K9JA 4DCHA 4GKKK 5AQKA 4JD2B 3K5MA 4A5AA 2I5JA 3SK3A 3LWLA 2FBVA 2RE2A 4CI6A 4QS7A 2W6KA 1SUQA 4CZHA 4YOYA 1HNVA 4JV5K 1FXXA 2E6MA 5HROA 1NK6A 4FPBA 4FJHA 5CZ1A 3G0ZA 3IFRA 4AM7A 3VQ5A 1ZXOA 1SL1A 2P9SB 5F1XA 3THYB 4LF6K 1NKEA 4DV3K 3L2VA 1NGBA 5H1SQ 4NCGA 4DV4K 4GVEA 3MCAB 4ISEA 1GLLO 2GUPA 2WOMA 4CJFA 2YNIA 1OVYA 1LWCA 1EKEA 4FPAA 1HYSA 4B9LA 1N32K 2O4GA 1HNXK 3RSEB 1REVA 4IEIA 3CQYA 4FWOA 3LAKA 5LJWA 3THXA 1SL0A 4DSIA 3V1OA 2E5LK 3P4IA 3JAMO 1YVUA 1KVAA 2BANA 2BH1A 1Q7YO 2HW3A 3UKUA 3OJSA 5JLFA 3OTOK 2ZE2A 4FW1A 3VEOA 4O5BA 2D0CA 1WAFA 4FVUA 3KJVA 3CC4N 4KTWA 4NXMK 3L0QA 5FPMA 4O4GA 3BY5A 4BC3A 1LW0A 2YNHA 4B08A 4KH5A 3E9PA 3O6WA 4JKHA 2D0PA 1B92A 4BVOA 2ATQA 4J2AA 3AVLA 4IO8A 3HM9A 3VGLA 3J8AA 2KFZA 3SZ2A 4B1XB 3WNFA 4IDHA 4DQ8A 1SL2A 1NK4A 3C6TA 4DB3A 4Y1DA 5C24A 4DU3A 3KLIA 4CFCA 2RN2A 5KQ8A 3HVRA 4EZ9A 2KTQA 4JS4A 3TABA 3V4IA 1MU2A 1TV6A 4DQQA 4HTLA 5CY4A 1QSLA 2PBDA 3EE8A 2OA8A 4CJVA 3OA9A 4LH5A 4H03B 1LAWA 3VQCA 2G8HA 1E3MA 1QS4A 1P8ZA 3L2UA 3SPYA 1VQ7N 4C23A 2BE2A 1A5WA 5KRSA 4X64K 3K2PA 4CEDA 5CE3A 3UIQA 3VEXA 1X9SA 4JEPA 4JS5A 3O08A 3K0SA 3KIOA 2UXDK 2OPRA 3VPZA 4F2RA 4HTUA 4B9SA 4ILJA 2XY6A 1WN7A 2YHYA 4FM1A 3U6FA 4J2DA 3O3HA 4DMNA 2NRRA 3C6HA 5KPZA 3ZX3A 3DOLA 4O8KA 3O9UA 3V9WA 4N76A 2VG6A 3AVIA 5J2PA 4CJ3A 4H4OA 3HXMA 3CETA 1RDUA 2QW9A 2VQFK 4DQIA 1OH5A 1VHXA 2PYJA 3T1YK 1C0TA 4A62A 3HPHA 2AA4A 3ZT3A 3CXCM 4BE1A 4DQSA 4YORA 4XEIA 3JSMA 2KHOA 3VTIA 3AVJA 2FSNA 5I3UA 5DM7L 1I94K 3D0PA 3CCJN 3TAEA 1N36K 4FWNA 3OYFA
chains in the Genus database with same CATH topology
1XMOK 4B3SK 4LF9K 1XMQK 4NXMK 4B3RK 4K0KK 4NXNK 4DR6K 4X65K 2UUCK 4DUYK 5FLXO 1IBKK 3J7YP 1FJGK 4JI2K 4DV1K 3J81O 1IBMK 2UXBK 4DV6K 4DR3K 3T1HK 4DR2K 1HNZK 2UUAK 4LF8K 4X66K 4DV5K 4AQYK 4JI6K 2UU9K 5LMNK 4V19S 2UUBK 1J5EK 4JI1K 4CW7B 4LFAK 3J80O 1XNQK 1HR0K 1IBLK 4JI3K 4GKKK 4X64K 4GKJK 2F4VK 1XNRK 4JI8K 2UXDK 4DR5K 4B3MK 2VQEK 4DV7K 3J7AP 4JV5K 2HHHK 4OX9K 5IWAK 4YHHK 4LF7K 5AJ3K 5BR8K 4B3TK 4YY3K 4LFCK 2ZM6K 5LMUK 4X62K 4LF6K 4DV3K 4LF4K 5IT9O 1N33K 4JYAK 4JI5K 4DV4K 2UXCK 4DV2K 2VQFK 4DR1K 1N34K 4LF5K 3T1YK 4JI7K 1N32K 4CVNE 1HNXK 4JI4K 4JI0K 4KHPK 5LL6Z 2E5LK 3JAMO 1HNWK 4DUZK 5A2QO 4DR7K 4LFBK 1I94K 4DR4K 1N36K 3OTOK 4DV0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO K;  4B3S K;  4LF9 K;  1XMQ K;  4NXM K;  4B3R K;  4K0K K;  4NXN K;  4DR6 K;  4X65 K;  2UUC K;  4DUY K;  5FLX O;  1IBK K;  3J7Y P;  1FJG K;  4JI2 K;  4DV1 K;  3J81 O;  1IBM K;  2UXB K;  4DV6 K;  4DR3 K;  3T1H K;  4DR2 K;  1HNZ K;  2UUA K;  4LF8 K;  4X66 K;  4DV5 K;  4AQY K;  4JI6 K;  2UU9 K;  5LMN K;  4V19 S;  2UUB K;  1J5E K;  4JI1 K;  4CW7 B;  4LFA K;  3J80 O;  1XNQ K;  1HR0 K;  1IBL K;  4JI3 K;  4GKK K;  4X64 K;  4GKJ K;  2F4V K;  1XNR K;  4JI8 K;  2UXD K;  4DR5 K;  4B3M K;  2VQE K;  4DV7 K;  3J7A P;  4JV5 K;  2HHH K;  4OX9 K;  5IWA K;  4YHH K;  4LF7 K;  5AJ3 K;  5BR8 K;  4B3T K;  4YY3 K;  4LFC K;  2ZM6 K;  5LMU K;  4X62 K;  4LF6 K;  4DV3 K;  4LF4 K;  5IT9 O;  1N33 K;  4JYA K;  4JI5 K;  4DV4 K;  2UXC K;  4DV2 K;  2VQF K;  4DR1 K;  1N34 K;  4LF5 K;  3T1Y K;  4JI7 K;  1N32 K;  4CVN E;  1HNX K;  4JI4 K;  4JI0 K;  4KHP K;  5LL6 Z;  2E5L K;  3JAM O;  1HNW K;  4DUZ K;  5A2Q O;  4DR7 K;  4LFB K;  1I94 K;  4DR4 K;  1N36 K;  3OTO K;  4DV0 K; 
#chains in the Genus database with same CATH topology
 1IKV A;  2HST A;  4FJ5 A;  3ZLJ A;  1KD1 O;  4CJK A;  4ID1 A;  4Z4C A;  3OYD A;  1XMQ K;  2P9K A;  3KTQ A;  5AQL A;  3O9Q A;  3O80 A;  4FJL A;  4X65 K;  4N5S A;  2FBT A;  4UY8 O;  3PX0 A;  3TTD A;  1KVB A;  4IDK A;  2OAN A;  1NK8 A;  2KLA A;  2O8F A;  4CZE A;  3H6E A;  3K57 A;  3GL1 A;  1JJ2 M;  3AA2 A;  3DYA A;  5C10 A;  1IBM K;  4KTQ A;  4E7I A;  4CF8 A;  1QHA A;  1BDG A;  4DR3 K;  4M3U A;  5BRE A;  4CF2 A;  5M1P A;  1LAV A;  4F3O A;  2WBN A;  3DI6 A;  1W0H A;  2PFU A;  3HVT A;  5AZI B;  3W3D A;  3K9K A;  4J2E A;  4DQP A;  3PV8 A;  1BI4 B;  1U45 A;  4KH4 A;  1RTD A;  4CBU A;  5M1F A;  2ITG A;  1ZC6 A;  4CW7 B;  1S6Q A;  3J80 O;  1BA1 A;  1LWE A;  4E3S A;  2E2P A;  4KB0 A;  4KHS A;  1VQM N;  3D6R A;  4FZY A;  1ASW A;  4K8X A;  3QIN A;  3QFU A;  4BRI A;  1EXQ A;  1DEJ A;  4FJJ A;  2V7Z A;  2OPS A;  3F2K A;  5SWM A;  1KTQ A;  4OGC A;  4M3T A;  2P5G A;  3S3O A;  4FWP A;  4K41 A;  3U4L A;  4FLZ A;  3OW2 M;  3CCE N;  5DM6 L;  2OTJ N;  3NF7 A;  3M8S A;  3CCV N;  5C15 A;  3AGK A;  3ZCM A;  1EWR A;  2IDO A;  3NDK A;  2HND A;  3THW A;  1GLB G;  5FPN A;  3Q7B A;  3ZSQ A;  2ZJP L;  1SZ2 A;  4DTS A;  3V6D A;  3R3L A;  3BZK A;  1BIS A;  4DUZ K;  4DR7 K;  4N47 A;  4KAZ A;  4PL7 A;  3EL2 A;  4DV0 K;  4CK3 A;  4DU1 A;  4WCE L;  4NLC A;  4CD3 A;  2QA4 N;  1IV0 A;  5KRT A;  3SI6 A;  2EX3 A;  4FZX C;  2ZF5 O;  3CHW A;  4BC4 A;  3AO3 A;  1L3V A;  3W0L A;  1RT3 A;  5J1E A;  3HPG A;  2E2O A;  3I8D A;  4CHP A;  3OBY A;  4HUG A;  5AQY A;  3VF2 A;  3P5J A;  3DLL L;  4FWS A;  2YCH A;  3RMA A;  4FSV A;  2ASO A;  5JVG L;  1A5V A;  2A40 A;  1N8R O;  3AA3 A;  3V9X A;  3S9H A;  4FL9 A;  3MEC A;  4B3O A;  3RMD A;  4GV3 A;  3D45 A;  3QBW A;  1NNE A;  2ZWH A;  1Q8I A;  1NOZ A;  3VET A;  3O8M A;  3OYG A;  1ASV A;  1NBW A;  3L8B A;  4BGA A;  1Q81 O;  4JKA A;  1X3N A;  4OGE A;  3FZM A;  4RCH A;  2FXU A;  1IBL K;  4DFM A;  1JCG A;  2CGJ A;  1XNR K;  1UA0 A;  1CZ9 A;  1ATR A;  1HX1 A;  3H3N O;  3R1X A;  3VOV A;  4AHT A;  2VWB A;  4DFP A;  3T19 A;  4CBX A;  3NE6 A;  1IKY A;  4FOE A;  1HPM A;  3JXU A;  3I8B A;  3OVN A;  4WFA L;  2YNF A;  4LF7 K;  5AJ3 K;  2P9N B;  2NRW A;  3FLC O;  4W5O A;  3K59 A;  3HM8 A;  4BRF A;  5AZJ A;  2P9P A;  4FWR A;  5AQT A;  2ITM A;  1NJZ A;  4E19 A;  3EY1 A;  4FYD A;  5E41 A;  3VF4 A;  4JKC A;  3WXM B;  2GWJ A;  3QIO A;  4ELV A;  3H1V X;  4DLG A;  3AVC A;  4NYF A;  4JN4 A;  1NMN A;  2IS3 A;  2CGK A;  2Q97 A;  3PO5 A;  5M1O A;  1EQY A;  3SQ4 A;  2EHG A;  4I2P A;  1NGC A;  3SUN A;  1S9E A;  4J8F A;  1T8E A;  4OKE A;  5AR0 A;  1HKB A;  1IKW A;  3CCS N;  1LOT B;  4MFB A;  4GY2 B;  4NLB A;  3HP9 A;  1S9G A;  4YDU C;  1KAX A;  3CJ7 A;  1TKT A;  4MO4 A;  1YHQ N;  3MX2 A;  3MDQ A;  1IBK K;  1ATS A;  1NJY A;  4DV1 K;  5CYM A;  1D4X A;  1NGG A;  3A5N C;  3LDN A;  1CXQ A;  4BRC A;  3H1Q A;  2QWO A;  1QQN A;  3L3V A;  2ZQB A;  3QEV A;  5K14 A;  4HCB A;  3ZET A;  3BEX A;  1K8A O;  1QVF M;  3LDQ A;  1VQP N;  4DV5 K;  4CFB A;  1NGI A;  4DWI A;  1K8K A;  3UE5 A;  1HYZ A;  4Z4F A;  4IBN A;  2Q0R A;  1SKW A;  4FWL A;  1HKG A;  3FFK B;  4DU4 A;  2P5O A;  5EVZ A;  3H3O B;  4Q0B A;  3VGK A;  3THX B;  4I2Q A;  4C1N K;  3ISN C;  1SS6 A;  3H45 C;  1WSI A;  1W7A A;  1KVC A;  5HLF A;  3UKU B;  4XH4 A;  4B3T K;  4KRE A;  5AFU A;  1TGO A;  2OCE A;  3DXK B;  2QKB A;  4JHD A;  2E4L A;  3C65 A;  1NKC A;  4FWM A;  2QXF A;  5KQD A;  3MAQ A;  2P9L A;  4MQ3 A;  4BRQ A;  3HPO A;  4GV9 A;  4DQR A;  3MMV A;  4DKW A;  1IO2 A;  4BR2 A;  3VEV A;  1T44 A;  2Q36 A;  2NUB A;  3PUF A;  5C25 A;  4QS8 A;  1S1V A;  3WEE B;  4QOZ B;  4CVN E;  4GVM A;  1NG9 A;  3SV3 A;  3O1W A;  4NO7 A;  1EET A;  1Y64 A;  2KFN A;  1DT9 A;  3RRH A;  4C8L A;  4H5W A;  1TL1 A;  3F5T A;  4H0P A;  2KW4 A;  2OYQ A;  1ILY A;  4YOV A;  4IJN A;  2DPN A;  4DSL A;  1KRP A;  4E7K A;  3HRG A;  1VQ9 N;  3L2W A;  4CFD A;  4DFK A;  2F96 A;  4DTO A;  1J54 A;  4H0V B;  4HUF A;  3QEI A;  4KO0 A;  3AGR A;  4G9Z A;  4H5N A;  4FJK A;  4KKO A;  3QNN A;  2O4I A;  3QER A;  1YJW N;  1RT1 A;  5BN9 A;  1KSP A;  4PUO A;  2HNY A;  4JKE A;  2UUA K;  2D4W A;  3SBT A;  4PKG A;  1X9J A;  4E7H A;  3HJF A;  3TI0 A;  3BZC A;  4JI6 K;  1JKH A;  1LCU A;  4OLA A;  4FOI A;  3WUH A;  4ZTJ A;  4V19 S;  4WQ4 A;  2ASP A;  3HSC A;  4JI1 K;  1JLA A;  2XO7 A;  1S72 N;  1T3V A;  5AQS A;  5M1K A;  2PAV A;  1VSI A;  2Q31 A;  5HOO A;  1RBR A;  4GMJ B;  4FK0 A;  5C0Y A;  3CCM N;  1RT6 A;  2OPP A;  4OKK A;  3NH1 A;  4IEE A;  3C95 A;  5BPM A;  1RT7 A;  5BRF A;  2HHH K;  5FDL A;  4DHY A;  3DRR A;  2GWK A;  1Z6R A;  4IFE A;  4AHS A;  3V81 A;  4CHN A;  4H0O A;  4CJL A;  5J2N A;  4MDA A;  3SQ2 A;  2P9K B;  3VQ4 A;  2E1Z A;  2NRX A;  1BL3 A;  1TAQ A;  2GV9 A;  3LP0 A;  5ADX A;  1T7P A;  1YF5 L;  1Z05 A;  3QEW A;  2O8F B;  5GAH P;  4XIU A;  3R8E A;  2PYL A;  4CJT A;  2A1S A;  3O1B A;  4LFB K;  1HYV A;  3CF5 L;  4Q5V A;  3E9O A;  2YNG A;  3MEG A;  2B4J A;  4CCH A;  2F9T A;  1TAU A;  5E84 A;  4M3Z A;  1RBU A;  1WSH A;  3OS2 A;  1MWK A;  1IH7 A;  3LPT A;  1WSG A;  3WT0 A;  3AA5 X;  5FPD A;  3TAQ A;  1VK0 A;  1QE1 A;  3OS1 A;  4KHW A;  2VYP A;  4OLB A;  2UUC K;  3A5O C;  3V9S A;  3IMX A;  4CK1 A;  3PSI A;  1K9M O;  2ETJ A;  2HHU A;  4UQG A;  1C1B A;  5DMR A;  3D2E A;  1LWF A;  5F0X A;  2X74 A;  3TAF A;  3AVF A;  1SV5 A;  3SUO A;  1O1W A;  1VRT A;  2Z1J A;  3F9M A;  3DXK A;  1RTH A;  3MXJ A;  3A0I X;  4NYN A;  4LF8 K;  4G1Q A;  4EP4 A;  2F9W A;  2G8V A;  1VQO N;  3CIP A;  3MWP A;  3TAN A;  2QWQ A;  5CR4 A;  3RTV A;  3SMS A;  2HHS A;  4B8A B;  4B1U B;  3PX4 A;  3PSF A;  3ULE B;  5AQQ A;  3ZT1 A;  1HUX A;  3E01 A;  4CJS A;  4KHQ A;  2A6A A;  4DFJ A;  3OYM A;  3WEE A;  4AHC A;  3THW B;  3L4Q A;  1D5A A;  4CFA A;  4U7B A;  2NZT A;  4CJ4 A;  4DV7 K;  3SJH A;  3EZ5 A;  2G8W A;  4CJ7 A;  5J2M A;  1QTM A;  4YOT A;  1T6D A;  4YHH K;  4CHY A;  1ASU A;  3D7E O;  4H8K A;  3N4Q A;  3CC2 N;  3P83 D;  1FKP A;  3P39 A;  3SCX A;  1BWF O;  2CGL A;  3MEE A;  4W5R A;  4ZTF A;  5J2Q A;  2YKM A;  3HOT A;  1RFQ A;  3O4W A;  1GLE G;  3C0B A;  4LSN A;  1NK9 A;  3L2R A;  3CYM A;  3LDS A;  1D8Y A;  3CM5 A;  2WC9 A;  3LZI A;  4B1W B;  3A5M C;  3CFP A;  4JI7 K;  4CGI A;  3AAP A;  4BQL A;  3TSP A;  4CGG A;  4FO0 A;  4NCB A;  4JK8 A;  3T1A A;  4O0I A;  3I0S A;  4YDU A;  5HRN A;  4CZM A;  4KFB A;  3LZJ A;  3WNH A;  3WXJ A;  1RTJ A;  4C8K A;  4RWT A;  2RKI A;  1SQK A;  1VRU A;  4KH6 A;  3CG7 A;  3VQQ A;  4BRL A;  3KK3 A;  3O5B A;  2X6N A;  4CZL A;  1CZA N;  3QLH A;  3RMB A;  1RGI A;  3VEW A;  4OJR A;  2G8K A;  3C94 A;  1NK7 A;  1X3M A;  1QQO A;  5LY3 A;  4KHU A;  3VEY A;  1Q9X A;  2KZM A;  4O55 A;  3KHY A;  3OYE A;  1RT5 A;  2H3G X;  4DR2 K;  1S1X A;  3ENH A;  2ZGY A;  3P31 A;  3ITH A;  1XUP O;  5AZJ B;  1BUP A;  4CJQ A;  1HPZ A;  2P9P B;  3BF3 A;  2W41 A;  4DSF A;  4O44 A;  4AQY K;  3SAG A;  1NKB A;  2NRH A;  2UUB K;  2D5R A;  4L8R B;  2XRI A;  3K5O A;  2HVI A;  1J5E K;  3TSQ A;  5CZ2 A;  2YHW A;  4W5T A;  4ISF A;  2EWS A;  3D2F A;  3PLA A;  4IXC A;  2VCP A;  1FKO A;  1OKJ A;  3ZSW A;  3UKR A;  5JIC A;  2YHA A;  4AIL C;  4AF1 A;  4AHR A;  3EKU A;  3O9R A;  3CMA N;  1RCH A;  4LY7 A;  5C42 A;  2D0A A;  1HNI A;  4NCA A;  4M45 A;  3VQ9 A;  3DWL A;  4M7X A;  3CPW M;  3WXL A;  1VSM A;  3ENB A;  3DM2 A;  4IG0 A;  4CZJ A;  4JYA K;  3MED A;  3M1F A;  4IFY A;  4OPK A;  3NH2 A;  4JKG A;  4CJP A;  5HRS A;  1UAX A;  2CH6 A;  3PIP L;  1L3S A;  4WQ4 C;  1N34 K;  2GEL A;  3MK6 A;  4Y1C A;  3CCL N;  4RW4 A;  2HBM A;  5HBM A;  1WSE A;  2NRT A;  5MLC Q;  4BG8 A;  4LH4 A;  5LL6 Z;  2IAJ A;  2VGN A;  4EZ6 A;  2IOC A;  1ZBU A;  3MXI A;  3ZET B;  2P9I A;  1OH7 A;  1HJO A;  1J9A A;  4E89 A;  3SPZ A;  3K5N A;  5GAE P;  3ULE A;  4M3R A;  2FF6 A;  3SMP A;  1K8K B;  3VQ7 A;  4ELU A;  3HO1 A;  1RBV A;  2KQ2 A;  2Z1H A;  3VF6 A;  3CJC A;  1VAZ A;  5GIO A;  4W5N A;  4FJ7 A;  1BIZ A;  2BDP A;  2VWK A;  3GG4 A;  3V9Z A;  1ZBL A;  2GUI A;  2P9U A;  4BRA A;  1RDC A;  4U67 L;  1C0M A;  4A61 A;  3PY8 A;  5AQV A;  3QIP A;  4CER A;  3RR8 A;  1A5X A;  3LP1 A;  1YI2 N;  2LSN A;  4Y0W A;  4PWD A;  3J7Z O;  1UA1 A;  4GW6 A;  3QML A;  1S1U A;  4JHD B;  3NH0 A;  3TTC A;  4A2A A;  1BQM A;  3HP6 A;  1C1A A;  3U9D A;  5BN8 A;  1NMD A;  4MLH A;  3OYC A;  2P9L B;  3G71 N;  1VSJ A;  1WBD A;  3WQU A;  4C8O A;  3ATV A;  3SV4 A;  3ID8 A;  5KGW A;  2W6L A;  1YXQ A;  4CIG A;  1KFD A;  3CFO A;  4M7Y A;  1NGJ A;  1HR0 K;  4JI3 K;  2YV0 X;  1BQN A;  3NFA A;  2DFH A;  3P38 A;  4BR0 A;  2F4V K;  4JI8 K;  1Z26 A;  2F7T A;  4C8N A;  4FWK A;  2O8C A;  4RW8 A;  3ZEU A;  3O3G A;  3CJ1 A;  2XY5 A;  3PX6 A;  4B3M K;  3HZ6 A;  5BR9 A;  2E1Y A;  1IG9 A;  1U2V A;  3ZSY A;  5AQU A;  3L6Q A;  5IWA K;  4OPA A;  1JLE A;  4MLE A;  4BQZ A;  1JL2 A;  1N6Q A;  5LMU K;  4CF9 A;  4X62 K;  3VA0 A;  3CC7 N;  5KPR A;  4LF4 K;  1TVR A;  3TWH A;  4FLV A;  3SUQ A;  4BC2 A;  1RT4 A;  3FZH A;  3OYK A;  2W40 A;  4RG8 A;  3A5L C;  4OO1 J;  2HNZ A;  4LF5 K;  3CQX A;  4IKF A;  4FLW A;  4DTM A;  1M90 O;  4JI4 K;  1GLC G;  3KD5 E;  1U04 A;  1SKR A;  4HCC A;  4JI0 K;  2QEX N;  4CIE A;  3U3Y A;  3NGY A;  2ZJQ L;  3U3G A;  4I6M A;  2GTD A;  3ENO A;  4H4M A;  1MA9 B;  1VSE A;  3B6P A;  3AVB A;  3KWI A;  4CHQ A;  3G6E N;  2O8D A;  1U47 A;  1K6Y A;  4KTZ A;  5AQW A;  4F2S A;  3ATU A;  4CBW A;  1TK5 A;  2WON A;  4YOW A;  3VQ8 A;  3CCQ N;  4BAC A;  1YUW A;  4RW7 A;  3NGZ A;  5JLH A;  1VQL N;  4K8Z A;  4CZK A;  2HHX A;  5BPL A;  5GIP A;  4BRN A;  1BHL A;  3LL3 A;  1NJW A;  3KVG A;  3OY9 A;  3S3M A;  4B9Q A;  4CEQ A;  4OVL A;  4WE1 A;  3QBX A;  5B8H A;  2O8B A;  2HOE A;  5AQX A;  1KAY A;  1NLV A;  3UB5 A;  4BR5 A;  1SAZ A;  4A57 A;  4LFA K;  3OBW A;  1KC8 O;  4GV6 A;  1D9D A;  3A8Y A;  4BRE A;  4KV8 A;  1RDW X;  1NJX A;  1QQC A;  3Q7C A;  1GLA G;  3MWT A;  3T3F A;  4CEC A;  3KZB A;  1W9H A;  2I7N A;  1NWK A;  2WFB A;  1S3X A;  4RW9 A;  1DGK N;  4IO9 L;  3HI0 A;  5EU7 A;  2V51 B;  3F9K A;  4QAG A;  3NVK A;  1S1T A;  3OYL A;  1BCM A;  4I9Q A;  1RT2 A;  4CGF A;  1T05 A;  4FJM A;  3CD6 N;  3VEZ A;  5AQI A;  2YJE A;  4EHU A;  4KHN A;  1WSJ A;  4DTR A;  3BF1 A;  4Z4G A;  1WB9 A;  1QSS A;  1RDB A;  3MN5 A;  1JCF A;  2OZS A;  3DXM B;  3D2E B;  1ITG A;  3TAG A;  1NGA A;  4IOA L;  3OYI A;  3NAE A;  1OH8 A;  3ZT0 A;  2Q0U A;  3FFI A;  4CEO A;  3VGM A;  4CEZ A;  5A2Q O;  1VQ4 N;  4DTJ A;  3LP3 A;  2G8I A;  3AO5 A;  1SKS A;  5M1N A;  2AJQ A;  3SNN A;  3DRP A;  1GLF O;  1JXE A;  3CME N;  5GAD P;  1C6V A;  4B3R K;  1WNS A;  4PHT X;  4NXN K;  4B9M A;  3C6U A;  1WBB A;  5I9E B;  1YIT N;  1JLB A;  4DUY K;  1HJR A;  5FLX O;  4HUE A;  3J7Y P;  2HHV A;  4AM6 A;  4K43 A;  4DTX A;  3SAF A;  3QFP A;  1L5U A;  4JKB A;  2UXB K;  4XH1 A;  1WOQ A;  3T1H K;  4FJ9 A;  1HNZ K;  3VMF B;  2E6L A;  4Z4H A;  1ZYQ A;  5AQF A;  3TR8 A;  4ILG B;  3OYH A;  1Q82 O;  1RIL A;  1KXP A;  5ELZ A;  1G99 A;  4CGJ A;  3KLF A;  4FLX A;  4DSJ A;  3I55 N;  1JLC A;  4I9L A;  3AVN A;  4DSK A;  4GKJ K;  4BGB A;  3KK2 A;  3SAH A;  4I7F A;  4BRP A;  1YAG A;  5EY4 A;  2RPI A;  3ASM A;  2Q3S A;  4OKJ A;  3F73 A;  4K25 A;  1BOT O;  2VG7 A;  1VQN N;  4CJR A;  4KPY A;  4E1M A;  3OS0 A;  1UWB A;  4YY3 K;  5GIN A;  4GNI A;  1NK5 A;  4FK4 A;  4F3T A;  4PA1 A;  4J2B A;  4TSX A;  1BCO A;  4LSL A;  3M8R A;  1GOA A;  2YJF A;  1RDD A;  3EEQ A;  4DV2 K;  3DOK A;  3NHG A;  1U6Z A;  4EP5 A;  3L2Q A;  4CJW A;  4AH9 A;  1DKG D;  4QS9 A;  4CF1 A;  1C0U A;  1FK9 A;  3HTV A;  3SLC A;  3MXM A;  3RRG A;  4KHP K;  3TTF A;  3VQA A;  2ZGZ A;  5CHI A;  1NGF A;  3WXK A;  4BRO A;  3QNO A;  3G25 A;  3QEP A;  4DR4 K;  3ZSR A;  1JCE A;  3AY9 A;  1OVQ A;  3E66 A;  4FJG A;  3ZSZ A;  5BRD A;  3L4I A;  1TKZ A;  3VQD A;  2ZJR L;  5KGX A;  4ID5 A;  1BO5 O;  3G10 A;  4JAX A;  3E1Y A;  4QCL A;  2O8E B;  2BTF A;  1KQS M;  4MDB A;  1QZ6 A;  3D2F B;  3UKR B;  4M63 C;  5FRO A;  2IC3 A;  1VQ8 N;  4B1Y B;  2HF4 A;  4ELT A;  1DTT A;  3SQ1 A;  2GX9 A;  4E7J A;  3THV A;  1HQE A;  1NU0 A;  4DS5 A;  3V1Q A;  4IFV A;  2JLE A;  2QTD A;  1GOC A;  3QB0 A;  3VTH A;  4JKD A;  2KKZ A;  4JKG B;  3O9S A;  5EXW A;  2PZS A;  3IKM A;  1HRH A;  4CEA A;  3HBT A;  3VQ6 A;  3M5R A;  3RMC A;  3PO4 A;  1ESV A;  3DXM A;  3EE9 A;  4KHY A;  4R5P A;  4IG3 A;  3TAM A;  3IDH A;  3KK7 A;  3V1R A;  3H08 A;  3OJU A;  4Z4E A;  3J7A P;  4CZF A;  4ZHR A;  5D3G A;  3B6O A;  3ZX0 A;  2P9I B;  2J4R A;  3IS9 A;  1C0F A;  1BGX T;  5TKW A;  3ZSV A;  5BR8 K;  3AV9 A;  1XHX A;  5AQJ A;  2RHK A;  4KI4 A;  4BDY A;  4B9T A;  2R7Y A;  3C7N B;  1IKX A;  3OYJ A;  1KLM A;  1WLJ A;  4LC9 B;  2Z1I A;  4XH5 A;  3DLE A;  2P9U B;  1HMV A;  4ICL A;  4OPH A;  4CE9 A;  1TKD A;  5JS2 A;  1O13 A;  4CEE A;  2JGU A;  3AAR A;  3DMJ A;  3NF6 A;  4O5F A;  2VG5 A;  4LD0 A;  5BPN A;  4F4K A;  2YI1 A;  3LDP A;  4PY5 A;  4YNQ A;  4E1J A;  3VQE A;  3KKS A;  1TYQ A;  1C0G A;  4CJ5 A;  1BIU A;  4Z4I A;  3TPQ A;  3EO3 A;  1L3U A;  4B3S K;  3TAP A;  4HVJ A;  1EX4 A;  3BUZ B;  3JYT A;  5M1Q A;  2QWM A;  3HK2 A;  3M8Q A;  5F2R A;  2D1K A;  4F9O A;  3QO9 A;  3DLK A;  3K5L A;  2HHQ A;  3IG1 A;  2A42 A;  4EIA A;  2HB5 A;  4OPJ A;  2BUP A;  3O9T A;  5C12 A;  4IWV A;  4MO5 A;  3SQ0 A;  3HT3 A;  2RF2 A;  4JI2 K;  2O8C B;  4FJN A;  3ZEU B;  5FPE A;  3HL8 A;  1U2V B;  1VSH A;  2E2N A;  4PKI A;  1CZB A;  1V4T A;  2YHB A;  4BE2 A;  1DLO A;  3KD1 E;  2YKN A;  2FSJ A;  1C1C A;  1TUY A;  5HRR A;  2QWL A;  1RTI A;  1QVG M;  2VWJ A;  3CPE A;  4DSE A;  3KLG A;  5FRN A;  2F8S A;  3E9L A;  3S41 A;  5JS1 A;  1YTU A;  2Y1I A;  3DAW A;  1X1P A;  2FF3 B;  4FM0 A;  4BG9 A;  4CF0 A;  2NNW A;  5KTQ A;  1TL3 A;  2VQE K;  4IOX A;  5LJV A;  3OYA A;  1JLF A;  3ZSO A;  4CGD A;  2OZM A;  3U9Z A;  4I6M B;  4F8R A;  1WUA A;  3IUC A;  1YVN A;  2E20 A;  1ATN A;  2O8D B;  5EOY A;  3NCI A;  3EZW A;  2E2Q A;  2WTU A;  2XY7 A;  4AHU A;  3MX5 A;  2O8E A;  4AHV A;  5IT9 O;  3R9P A;  1D9F A;  1FW6 A;  3QDK A;  1Q9Y A;  2UXC K;  4WFB L;  1RBS A;  1U49 A;  3VA3 A;  3VQB A;  3LP2 A;  2HMI A;  4JD2 A;  2F8T A;  4A2B A;  1NJI O;  4YOU A;  4WQ5 C;  5AQP A;  3MN6 A;  5AQZ A;  4K42 A;  4M3Y A;  4FJX A;  3GDQ A;  4PQU A;  3DRS A;  3U8X A;  1QHT A;  1XC9 A;  3DLB A;  3CER A;  3WNG A;  1LW2 A;  3BGR A;  4NB4 A;  3O4Q A;  1T6C A;  4O0J A;  2P9S A;  4Z0U A;  2O8B B;  4FJI A;  3THY A;  4IOC L;  1BG3 A;  3QEX A;  4R79 A;  3ULD A;  4BRD A;  1V4S A;  4BDP A;  4FWQ A;  1K73 O;  1XWL A;  3HOS A;  1UOC A;  2GBZ A;  4BDZ A;  1S1W A;  1F21 A;  1ZBF A;  1XC3 A;  3DLH A;  1FJG K;  3EN9 A;  4FVM A;  3J81 O;  3RSE A;  2FBX A;  4B9V A;  1WSF A;  4BC5 A;  2JWK A;  2A41 A;  1W2B M;  4JNE A;  4M3W A;  1H1V A;  4KBO A;  1TK0 A;  2IVP A;  3C7N A;  3DLR A;  2PY5 A;  2XHB A;  4BRG A;  3PIO L;  1KAZ A;  2IVO A;  4FK2 A;  3NGI A;  3KLH A;  2P1J A;  5HL7 L;  1XNQ K;  5DK5 A;  2V52 B;  3VEN A;  2ASM A;  4CGH A;  3LAL A;  3RWU A;  3L3U A;  4H0X B;  3M8P A;  3I33 A;  2A5X A;  1E4F T;  1EWQ A;  3DLG A;  4FLU A;  3AO4 A;  3VN5 A;  4DR5 K;  1NOY A;  2HVH A;  3AVG A;  2IVN A;  2CH5 A;  3M6G A;  4IZ9 A;  1KCF A;  4E1N A;  2HBL A;  4BE0 A;  4OX9 K;  5BRH A;  3AVK A;  4ISG A;  3HYF A;  4JK9 A;  4KRF A;  5JMV A;  1TKX A;  4B1V A;  5CYQ A;  4JK7 A;  3NVM A;  5TKY A;  1U48 A;  1VSD A;  3LWM A;  3CCR N;  4JI5 K;  3FR0 A;  2HBJ A;  1ZBH A;  4N56 A;  1NK0 A;  1HKC A;  4DTN A;  5T7B A;  3ZT2 A;  1X9M A;  4DR1 K;  3AO2 A;  2DFF A;  1YIJ N;  2WUS A;  1VQK N;  3KK1 A;  4BY9 C;  2QI2 A;  4B9N A;  2FLO A;  4CHO A;  2YHX A;  4E7L A;  1LV5 A;  4A5B A;  1HNW K;  2FC0 A;  1B9F A;  3MCP A;  4JRP A;  1R59 O;  1NGD A;  2A1R A;  4CHZ A;  1W97 L;  3B8A X;  3SJJ A;  3SUP A;  1ZBI A;  3S3N A;  4BR9 A;  1MWM A;  2G8F A;  2HMP A;  1RNH A;  2I7P A;  2QXL A;  5C2D A;  2E88 A;  1I3A A;  4YFU A;  4BWM A;  3VQP A;  4DR6 K;  2QWR A;  1MDU B;  3C6A A;  4CEF A;  2QWN A;  2JWL A;  2D0O A;  1S5J A;  1B9D A;  4PL8 A;  1RBT A;  1GLD G;  1BA0 A;  1R0A A;  4RW6 A;  1P90 A;  5GAG P;  3ZT4 A;  2Z1G A;  4FCY A;  3T69 A;  1GOB A;  3QET A;  2FBY A;  4CZI A;  2DTU A;  4HWI A;  4DV6 K;  5FRM A;  3CJB A;  4B9U A;  3AVH A;  5AFU H;  2HF3 A;  3P1G A;  3HST B;  3OHR A;  4DTU A;  4DLE A;  4EAH D;  5AQN A;  3ZSX A;  2E8A A;  4M3X A;  4IJA A;  4CK2 A;  1JLQ A;  3I56 N;  4BWJ A;  2OPQ A;  3G4S N;  3RVC A;  1CLQ A;  1S6P A;  3V9U A;  3WXI A;  4H5V A;  3T7Z A;  4CJE A;  1T03 A;  3EYZ A;  4EFH A;  3I0R A;  3SBG A;  4BR4 A;  4JLH A;  3AVM A;  4WYB A;  4C8M A;  5AZI A;  5KI6 A;  4E0D A;  1JLG A;  2ZM6 K;  4B8C A;  2Q2R A;  3N4P A;  1VQ6 N;  3NF8 A;  1BI4 A;  5I42 A;  4H5T A;  4DF4 A;  2AP1 A;  5AQR A;  4H5R A;  3AVA A;  1YT3 A;  2ZD1 A;  4KB1 A;  4FM2 A;  1BU6 O;  3TU5 A;  2HBK A;  4N41 A;  3OYB A;  3BDP A;  1YTA A;  3MN7 A;  1E4G T;  3R6M A;  4DG1 A;  4W5Q A;  3IAY A;  4HHT A;  4RTF D;  3CFR A;  1M1K O;  3EKS A;  4BRH A;  1QQM A;  4O8U A;  4CZG A;  3LM2 A;  4FXD A;  1TK8 A;  5JVH L;  3VES A;  2QK9 A;  4FLT A;  4BR7 A;  2XY8 A;  3AO1 A;  2FSK A;  2Y1J A;  1VQ5 N;  4LF9 K;  3DJC A;  1KLN A;  2QM1 A;  3GBT A;  3H46 O;  4H0Y B;  1I39 A;  5SZT A;  1QSY A;  3VER A;  4WFN L;  1JL1 A;  3AAQ A;  1XI1 A;  3IRX A;  1Z25 A;  4C1N I;  3OYN A;  1IJJ A;  3FE1 A;  2DY4 A;  1TUU A;  1XQS C;  2P51 A;  4FZZ A;  2OTL N;  4A59 A;  2NRV A;  4PKH A;  2NRZ A;  3K58 A;  4EHT A;  4FJ8 A;  5AQG A;  5AQO A;  2X78 A;  3WQT A;  1X9W A;  3O3F A;  1VSK A;  3CCU N;  2KZZ A;  2UU9 K;  2A3Z A;  4H0T B;  3TAR A;  3QES A;  3A2F A;  1VSF A;  3CJA A;  1G15 A;  1XHZ A;  5ADX H;  2V7Y A;  5EX5 A;  3CI5 A;  3O4N A;  4CD1 A;  1IG8 A;  3M3Z A;  4JKF A;  3AA4 A;  1NGE A;  2X6S A;  1Q86 O;  4WF9 L;  3LM9 A;  1RDA A;  3KKR A;  2D0B A;  1U4B A;  2UYT A;  1EO1 A;  1TYQ B;  1N5Y A;  2Q1N A;  4L3Q A;  1J6Z A;  1CXU A;  1EP4 A;  4LFC K;  2HHT A;  3FZK A;  3ZYY X;  4JRQ A;  3MN9 A;  1VSL A;  1YJ9 N;  2BGG A;  4WQ5 A;  5AQM A;  1N33 K;  5HRP A;  1HLU A;  3KWG A;  3ZX2 A;  4Z94 A;  1QZ5 A;  3WNE A;  4DTP A;  5HP1 A;  2B5J A;  3LDL A;  2W42 A;  3BP8 A;  4DF8 A;  5AQH A;  1GLJ O;  4FLY A;  3LDO A;  2QWP A;  3FZF A;  4CES A;  2HHW A;  1J5O A;  4BRM A;  1L3T A;  3SYZ A;  1Y97 A;  2G8U A;  3RR7 A;  5KPT A;  2IGI A;  4BRK A;  4BVP A;  2P9N A;  1XMO K;  3QIC A;  1JXB A;  3LAN A;  3FZL A;  3TSU A;  1J53 A;  4M41 A;  4B1Z A;  1Q18 A;  2NLX A;  3FGU A;  4K0K K;  3GE1 A;  1DTQ A;  3KLE A;  4ILH A;  3CM6 A;  3CJ9 A;  3NMU A;  2QKK A;  4DS4 A;  3LPU A;  4M42 A;  3ID6 A;  1NM1 A;  5C2F A;  3NF9 A;  3JS6 A;  5E26 A;  3GOI A;  3CQ8 A;  1HQU A;  1S22 A;  4CEB A;  2VGM A;  3NBP A;  4KI6 A;  1NGH A;  2B6A A;  4X66 K;  3ALY A;  4YOX A;  1OH6 A;  4CJU A;  5LMN K;  2YX6 A;  3LAM A;  1KFS A;  4FW2 A;  1WAJ A;  2GEM A;  4CIF A;  2IIR A;  2DFE A;  1YJN N;  1ZBS A;  3K9J A;  4DCH A;  4GKK K;  5AQK A;  4JD2 B;  3K5M A;  4A5A A;  2I5J A;  3SK3 A;  3LWL A;  2FBV A;  2RE2 A;  4CI6 A;  4QS7 A;  2W6K A;  1SUQ A;  4CZH A;  4YOY A;  1HNV A;  4JV5 K;  1FXX A;  2E6M A;  5HRO A;  1NK6 A;  4FPB A;  4FJH A;  5CZ1 A;  3G0Z A;  3IFR A;  4AM7 A;  3VQ5 A;  1ZXO A;  1SL1 A;  2P9S B;  5F1X A;  3THY B;  4LF6 K;  1NKE A;  4DV3 K;  3L2V A;  1NGB A;  5H1S Q;  4NCG A;  4DV4 K;  4GVE A;  3MCA B;  4ISE A;  1GLL O;  2GUP A;  2WOM A;  4CJF A;  2YNI A;  1OVY A;  1LWC A;  1EKE A;  4FPA A;  1HYS A;  4B9L A;  1N32 K;  2O4G A;  1HNX K;  3RSE B;  1REV A;  4IEI A;  3CQY A;  4FWO A;  3LAK A;  5LJW A;  3THX A;  1SL0 A;  4DSI A;  3V1O A;  2E5L K;  3P4I A;  3JAM O;  1YVU A;  1KVA A;  2BAN A;  2BH1 A;  1Q7Y O;  2HW3 A;  3UKU A;  3OJS A;  5JLF A;  3OTO K;  2ZE2 A;  4FW1 A;  3VEO A;  4O5B A;  2D0C A;  1WAF A;  4FVU A;  3KJV A;  3CC4 N;  4KTW A;  4NXM K;  3L0Q A;  5FPM A;  4O4G A;  3BY5 A;  4BC3 A;  1LW0 A;  2YNH A;  4B08 A;  4KH5 A;  3E9P A;  3O6W A;  4JKH A;  2D0P A;  1B92 A;  4BVO A;  2ATQ A;  4J2A A;  3AVL A;  4IO8 A;  3HM9 A;  3VGL A;  3J8A A;  2KFZ A;  3SZ2 A;  4B1X B;  3WNF A;  4IDH A;  4DQ8 A;  1SL2 A;  1NK4 A;  3C6T A;  4DB3 A;  4Y1D A;  5C24 A;  4DU3 A;  3KLI A;  4CFC A;  2RN2 A;  5KQ8 A;  3HVR A;  4EZ9 A;  2KTQ A;  4JS4 A;  3TAB A;  3V4I A;  1MU2 A;  1TV6 A;  4DQQ A;  4HTL A;  5CY4 A;  1QSL A;  2PBD A;  3EE8 A;  2OA8 A;  4CJV A;  3OA9 A;  4LH5 A;  4H03 B;  1LAW A;  3VQC A;  2G8H A;  1E3M A;  1QS4 A;  1P8Z A;  3L2U A;  3SPY A;  1VQ7 N;  4C23 A;  2BE2 A;  1A5W A;  5KRS A;  4X64 K;  3K2P A;  4CED A;  5CE3 A;  3UIQ A;  3VEX A;  1X9S A;  4JEP A;  4JS5 A;  3O08 A;  3K0S A;  3KIO A;  2UXD K;  2OPR A;  3VPZ A;  4F2R A;  4HTU A;  4B9S A;  4ILJ A;  2XY6 A;  1WN7 A;  2YHY A;  4FM1 A;  3U6F A;  4J2D A;  3O3H A;  4DMN A;  2NRR A;  3C6H A;  5KPZ A;  3ZX3 A;  3DOL A;  4O8K A;  3O9U A;  3V9W A;  4N76 A;  2VG6 A;  3AVI A;  5J2P A;  4CJ3 A;  4H4O A;  3HXM A;  3CET A;  1RDU A;  2QW9 A;  2VQF K;  4DQI A;  1OH5 A;  1VHX A;  2PYJ A;  3T1Y K;  1C0T A;  4A62 A;  3HPH A;  2AA4 A;  3ZT3 A;  3CXC M;  4BE1 A;  4DQS A;  4YOR A;  4XEI A;  3JSM A;  2KHO A;  3VTI A;  3AVJ A;  2FSN A;  5I3U A;  5DM7 L;  1I94 K;  3D0P A;  3CCJ N;  3TAE A;  1N36 K;  4FWN A;  3OYF A; 
#chains in the Genus database with same CATH homology
 1XMO K;  4B3S K;  4LF9 K;  1XMQ K;  4NXM K;  4B3R K;  4K0K K;  4NXN K;  4DR6 K;  4X65 K;  2UUC K;  4DUY K;  5FLX O;  1IBK K;  3J7Y P;  1FJG K;  4JI2 K;  4DV1 K;  3J81 O;  1IBM K;  2UXB K;  4DV6 K;  4DR3 K;  3T1H K;  4DR2 K;  1HNZ K;  2UUA K;  4LF8 K;  4X66 K;  4DV5 K;  4AQY K;  4JI6 K;  2UU9 K;  5LMN K;  4V19 S;  2UUB K;  1J5E K;  4JI1 K;  4CW7 B;  4LFA K;  3J80 O;  1XNQ K;  1HR0 K;  1IBL K;  4JI3 K;  4GKK K;  4X64 K;  4GKJ K;  2F4V K;  1XNR K;  4JI8 K;  2UXD K;  4DR5 K;  4B3M K;  2VQE K;  4DV7 K;  3J7A P;  4JV5 K;  2HHH K;  4OX9 K;  5IWA K;  4YHH K;  4LF7 K;  5AJ3 K;  5BR8 K;  4B3T K;  4YY3 K;  4LFC K;  2ZM6 K;  5LMU K;  4X62 K;  4LF6 K;  4DV3 K;  4LF4 K;  5IT9 O;  1N33 K;  4JYA K;  4JI5 K;  4DV4 K;  2UXC K;  4DV2 K;  2VQF K;  4DR1 K;  1N34 K;  4LF5 K;  3T1Y K;  4JI7 K;  1N32 K;  4CVN E;  1HNX K;  4JI4 K;  4JI0 K;  4KHP K;  5LL6 Z;  2E5L K;  3JAM O;  1HNW K;  4DUZ K;  5A2Q O;  4DR7 K;  4LFB K;  1I94 K;  4DR4 K;  1N36 K;  3OTO K;  4DV0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...