4IEIA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with adp
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
461
structure length
449
Chain Sequence
NPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 162
structure length 449
sequence length 461
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ieiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ieiA01
3NIBA 2HF9A 3PCRB 3L0OA 2IYWA 4AG5A 4AKGA 4ZI3A 1XPOA 1SKQA 1L8QA 2WZQA 3OESA 4PTLA 3KQLA 4C7OA 3BIFA 4DLVA 4RD6A 1YZNA 1XTIA 2QM8A 1WBBA 1QHXA 4AG6A 4HI0E 4W5JA 4AURA 4OQXA 4TL9A 1LVGA 1JPJA 1DAMA 1Q0UA 1YR9A 4DCUA 3QF4B 3T5GA 4BFSA 4TTRA 4TN1A 4KI0A 3THXA 1L4UA 5TMPA 2G77B 1ZIPA 2DCUA 3B9PA 2A78A 3THYB 3RC3A 4BZXA 2XNDA 3ZVMA 1KMHA 5DE3A 4ACBA 1NVXQ 1NVUQ 1XFAA 2QU8A 3MFYA 2XEXA 4A6XA 1GOTA 4TYQA 5KSYA 2BHRA 4OK6A 1FP7A 1A7JA 2Q3MA 2AFHE 2QP9X 4BRWA 4LCBA 5F9HA 1X1SA 1ZRHA 2QMHA 4Q01A 3W6PA 1JNYA 1Q1QA 3WMEA 4F38A 1E2JA 3UK6A 4Q9KA 2OFOA 5FOSA 1E32A 2ZRCA 5FBRB 3FKSD 5C10A 2GXSA 3ZQJA 3VKWA 3AVWA 1GVNB 3UMFA 2ZE7A 2FPLA 3NC1C 2CEAA 4NU0A 4XIGS 1Z0IA 2R44A 4IFBA 4FMDF 2ZEJA 3KKNA 4GL2A 3QPWA 2FN4A 2WSSA 4DDWA 1ZBDA 1ZCAA 3B82A 3ICEA 3CKLA 2P67A 4D4LA 4GOKA 1R0ZA 4UXIA 3CWQA 1HV8A 4KBGA 4KCGA 3KKMA 4IVQA 2XXAB 3VR4A 2F6RA 3SJBA 1FW6A 4KSCA 4CGZA 2PMDA 3H1TA 3AVYA 1QHHB 2BV3A 5EE3A 1K5DA 4I1OA 3IDQA 1W4RA 3CNLA 3K09A 4LZZA 4M53A 2EFCB 2QPOA 3C5HA 2IBMA 1IXZA 2ANCA 2W6ID 4TT3A 4UNNA 5L3VA 5FTJA 3CW2A 2W2TA 2VP2A 4TL7A 2B92A 5L3RA 2ZI4A 1Z63A 4RZXA 3U3RA 3VU9A 1FPMA 2YZ2A 2ZRFA 3ZGXA 4CEHB 5GVSA 3EAQA 1UKVY 5DGXA 1LF0A 2JDID 2RGXA 3L8ZA 4QG7A 5FBWB 4QKQA 4J0QA 3K9NA 4W5HA 4Q1FA 3G82C 1AIPA 4KVGA 2VP0A 2NO6A 3ZIAA 3RVBA 4GPTA 1W0KD 1S9HA 3GMTA 3X1YA 2JLWA 1OW3B 1GG2A 1UADA 3AP1A 4HB0A 2UZIR 1II0A 2ZRIA 1OXXK 2KWIA 5JHHB 4DSUA 3U3KA 4F7WA 3AM1A 2C9YA 3BFXA 5J47A 3MAAC 4MITA 3QQ5A 4URYR 4PAMA 1R5BA 2BWJA 5AUPB 2J0UA 1MT0A 4BZPA 3X2SA 2IHBA 3QKRB 5FTLA 1S2MA 2Z4RA 4AD8A 1E2MA 1H8HD 1FP6A 2YJTD 1I2DA 3GFPA 3Q9LA 3ZH9B 2B8WA 2J0VA 3AVOA 2F7SA 1XF9A 2VRWA 5CK4A 1HEIA 1PUJA 4PQRA 4XD7A 4OK5A 3X1WA 4D4MA 2JATA 2AWOA 3IHLA 3QPUA 2BC9A 2KJQA 3A4LA 2XTNA 4NYJR 3TSWA 3GLHA 1G16A 2J41A 3H4MA 2YVUA 3CONA 4NKRA 4OHZA 4DLYA 4I4LA 2HJGA 2P2LA 4LPSA 4UNQA 5FOXA 4URZR 3SE0A 4L5BA 4B2LA 3W6NA 2NG1A 4PO8A 3SYNA 2PT5A 1TQ2A 2JJ2A 3K09C 3R8CA 2GEUA 2F1HA 2NQ2C 2QRZA 2VHJA 3BGWA 3FPAA 3P27A 2QAJA 3BH6A 2KBFA 3EC2A 3SI7A 4LHZA 4NYJQ 1OIXA 2R62A 4LJ8A 4LV5B 4OQLA 3GLIA 1S1CA 5EP3A 5CM8B 5IF9A 1R5OA 1ZM3A 3BWDD 1KAOA 2R6AA 3QKUA 4RZ2A 3RS5A 1QHYA 5M1KA 2ZI6A 4TTPA 2H92A 1RJ9B 3CRMA 5JSZA 3C16C 3HR8A 1KYIA 2A5YB 4W7SA 4KBFA 1MRNA 4EFMA 1H65A 2ZM5A 3KQHA 2BCJQ 3N5CA 3GJXC 2CNWA 4KFRA 4MRVA 5DYGA 3EA0A 5CK5A 2WJIA 3OEHD 1TPZA 4DLSA 1VG8A 3OIUA 3LXRA 5EXXA 1ZD9A 3EPJA 3CWZA 1PLLA 1YZQA 2BOVA 2QRNA 1G5PA 3FGNA 4OI4A 2BBSA 2H17A 1RRFA 3OIWA 1VG0B 1W2GA 5HCNA 2C5LA 4IOJA 1E3MA 1IN5A 4M1TA 1AKYA 2BKEA 4PC6A 1NRJB 2VTKA 2ZRJA 3I62A 4C0KA 1T91A 4IOMA 4WZ6A 2KB0A 1OLOA 2FSHA 1OFIA 4PSKA 4G5SA 4FW9A 1AA9A 4RFSA 3SFVA 3ND8A 3U5ZB 3WMGA 4BLRA 3K70B 2ZANA 1CP2A 2JA1A 1AK2A 3BE4A 3K9GA 3V9PA 2JASA 3W34A 3I32A 1NMXA 3S1AB 1XEWY 2FGKA 4V02A 4C9BA 1O87A 3CNOA 3ZJYA 4TMXA 2OAQ1 5E7JA 3PITA 2GZAA 5C1BA 1IJEA 4DCNA 3IIKA 4Q1EA 4Q1CA 3K0EA 4HAXA 2ZR9A 1YRAA 2WJJA 4NZYA 4QM6A 1E2GA 3TRFA 4NCNA 4QNRA 2J87A 5HCIA 2HUPA 2F3RA 2H57A 1JJ7A 3B5JA 4ITRC 4V0ME 4B2IA 3OAAD 3P26A 3RYTC 4IDQA 2QGNA 4C0HA 4A8JA 4F4JA 3LW8A 4HLCA 1U90A 4Q4AA 2FFBA 2ZAOA 5FOWA 1T8UA 4Q4HB 1FTNA 1S96A 1KK2A 4YXWD 5FUYA 4R9UC 5JMTA 2QBYA 5SZHB 3ZZTA 2I4IA 3TLXA 5D3MB 1UBGA 4PSAA 1EWQA 1VCOA 3VR3A 3SOPA 2IYSA 2Z4SA 2Q0HA 3A1WA 3K1JA 3N2EA 1B23P 2ZJ8A 4Z8YA 4TZ0A 3I3SR 1YR8A 4FD2A 5LB4A 1JAHA 2EFHB 1IN6A 3WMFA 3M4YA 2OBMA 3ZS8A 4L15A 5KTYA 1A4RA 4AC9A 4QL3A 1CR0A 4Q5IA 2GCOB 2ZXUA 4XWKA 2OUKA 1Z28A 3RLFA 5G40A 2R8RA 1GAJA 3HDTA 5E4FA 1A2BA 4IDNA 5GVRA 1G6OA 2F1JA 3T15A 4HB4A 821PA 2MMCA 2OHFA 3A1VA 4ZDIA 1XDBA 4IXNA 4YMUA 2A9KA 3SDZA 1U9IC 2NO1A 3FMFA 4H1VA 2RKOA 1GKIA 4AKHA 3IIJA 3LNCA 2HYDA 2EFEB 3JZMA 1W1WA 5K8UA 1P4SA 4DRZA 3CF2A 3B1XA 4IRUB 3U6BA 3ASZA 4JLJA 4JJKA 4LYJA 1SHZA 3JVUA 1HQCA 1AS0A 5DHFA 1FUKA 3QJYA 2ZRLA 1G7SA 2V7QD 1E1RD 5TARA 2XOKD 4AWXA 5IK2D 4U02A 2KE5A 4TLEA 3L8YA 1Q1EA 1Z2AA 3KQKA 2XB2A 2Z0MA 4JVMA 4GMDA 1U8YA 5FTNA 1W4AA 3CB4A 2JAQA 2XTMA 1T3HA 4HB3A 2YOGA 2XSZD 1MRSA 4N1AA 2PEZA 1KKLA 5AUQA 5KSZA 4FCTA 1Z08A 3CNNA 5CJPA 4BLOA 4B71A 2DY1A 2QROA 1XB2A 2GVZC 4LSGA 4WIAA 3LDAA 4A8JC 2PH1A 4URWR 5TY0A 2ZR7A 1OT3A 3D3QA 1J99A 3PJRA 1XXHE 4MH0R 1E0KA 2FPKA 1G8GA 3X1XA 2C98A 1D2MA 2V6IA 2X2EA 2XTZA 3TUJC 2IS2A 3PEVA 2G83A 2FNAA 4NCIA 1RE0A 1XBTA 2IEZA 1MR3F 2ECKA 4JS0A 3W8NA 3ZD7A 1KSGA 4MUAA 2WBLC 4B6EA 1OYWA 3KTAB 2NTYC 4Q7LA 2ZREA 4HAWA 3MLEA 3FHCB 5C2FA 1VIYA 1XD2B 4L4UA 4PQYA 2IYTA 1KI2A 2AR7A 5AUNB 3Q3JB 2CE2X 1UKEA 4B32A 1KHTA 4MGKR 4DLWA 1E9DA 4ZKDA 1A5TA 5H8WA 4RSGA 2DBYA 1NBMA 1U99A 2NO7A 4I99A 5DH9A 5C2JB 2PLRA 3LBNA 1IN7A 1XWIA 1OV4A 3DEFA 4FWIB 1X1RA 1XX6A 4XVRA 1Q3TA 2FMXA 1N6PA 3B1WA 4K46A 3RAPR 2V55B 4CEIB 1CJTC 3FVQA 1Q3HA 3B6EA 3B8HA 2VHQA 5L3QB 3K70D 3G0HA 1DELA 3TSOA 2AN9A 4BFTA 3KL4A 2JLVA 4URUR 4ZKEA 3TH5A 3FOZA 2ZRBA 1IY1A 2JEOA 2IW3A 2YWGA 2D74A 4LV6A 1NIPA 2CK3D 2RGAA 4IKEA 2ATVA 3NC0C 3UPUA 3WXMA 4M9XA 1T5LA 2YV5A 1G19A 4WOPA 1Z22A 1ZUHA 2OM2A 1IY2A 1II8B 1P61B 5BN4A 5EP1A 2J46A 3RRYA 3BH0A 3FWYA 4M0LA 3TUIC 3X1DA 1BS1A 1W36B 3KFXA 3O8BA 1OXUA 5M1PA 1RYHA 1U0HC 5BXQC 4ZV4A 4JSTA 5J4LA 2OCPA 2WJYA 5FUVA 1BMFD 4E5UA 1W0JD 2W00A 3SYKA 4H9GA 4C30A 2IS1A 4XSHA 2NOAA 1BYIA 1D9XA 4UXHA 5C12A 1NN3A 1KOFA 2V8OA 3VKHA 3HWSA 3FFAA 4PR0A 3DM9B 2ZSEA 4JL5A 3ZVRA 4A0GA 1SVLA 3DPUA 4FMCB 1NN0A 4O3MA 5C4MA 5KHOC 1G64A 1WBDA 1QHIA 1EGAA 1E2NA 3BS4A 5K8LA 4RD2A 5KSPA 2LKDA 4Q19A 2ZAMA 4KV9A 4DVGA 5LPNA 1TF2A 3QNUA 1YR6A 2WKRA 3I92A 2YC4C 1COWD 3U44A 1KSHA 1G7TA 1FOEB 4M9ZA 2QGZA 4DKXA 3BOSA 1N6OA 1Z6YA 4RCZA 3OE7D 4F92B 1W46A 1LS1A 4JBXA 5BWMA 1JR3A 4IXMA 4S35A 4FXPA 1MV5A 2C8VA 2J1LA 3W5JA 2ZS9A 2XZOA 1UM8A 1JBKA 3IEUA 1VYVA 2FV8A 5EQTA 3UXMA 1DG1G 2FG5A 3W8RA 1K6MA 4YMSA 3EZ7A 1B0UA 3ZYCA 1FNNA 3EWAA 2HV8A 1HT2E 2HT6A 2GJKA 1QG2A 2Q9CA 2W0SA 3NVAA 1N0UA 3PFIA 4GI7A 2IEYA 4D0GA 1KI9A 1KO1A 1P60A 4XWOA 5KOYA 1VG1A 2WWIA 4P4SA 4QFMA 1KSFX 3PUZA 3RS3A 1A1VA 3R7WB 1KO4A 2WWWA 4BQSA 5FOVA 2O8CB 3V00A 2O8FA 3VR1A 1RRPA 1AGRA 1N0WA 2EW1A 1PV4A 4LGMA 3EG5A 1VMAA 5B30A 4FINA 2ZVQX 4HZUA 3PG5A 4Q21A 3KUCA 4QJ4A 5CYPA 1DBSA 1IXRC 3RRNA 1OH6A 3KXIA 2G0TA 2R6FA 1SVOA 3A1TA 4HLQB 1LS6A 1F2UB 4MKGA 2Z43A 3BB3A 4IDOA 2NZJA 4M2LA 3FHOA 5AK0A 721PA 3I61A 1E9SA 2FFHA 1ZYUA 3OHMA 3VR6A 2OLJA 2YYZA 2ZRGA 3FFBA 3PUVA 5TVKA 4BFUA 2CHQA 1XPUA 3IQWA 1ODFA 3VX4A 2P5TB 1H8EA 3L0SA 2F43A 1Z0KA 2I1VB 2QAGA 1JECA 2ORWA 1ZU5A 4C2UA 4JYCA 3H0KA 3TW8B 3U6KA 1UBCA 5HPYB 3CX6A 3AKYA 3WY9A 2ZR0A 1SXJA 2CLSA 3KJIA 2AK2A 1RW4A 3NEYA 4LHWA 3V4RA 1TF5A 3KQNA 1KMQA 3CUEF 1CRQA 1TQ4A 2Z6VA 5B58C 1TQDA 2CHVA 2A5FA 3L2OB 3QXXA 1T6NA 1LFDB 1PJRA 2GVDC 4JKYA 4B3BA 3VQTA 2GNOA 4GP7A 2H18A 4GOXA 3WRYC 2O8DA 3WP0A 4QBHA 3D7MA 2BCGY 2NIPA 5F98A 2UVQA 1OH5A 4EAQA 5CIWA 5JEDA 3B85A 2WTUA 4HB2A 3RSLA 3VX3A 4QJ5A 2ZROA 1CF4A 2CMKA 2IYVA 5EE5B 1N5KA 4G3XA 1DAFA 2AXNA 4BWYA 3NG1A 3THXB 2PJRA 2AKYA 5CB8A 2JLXA 2ASEA 5FFMA 1AJEA 2IS4A 4NCKA 1GL6A 3T1VA 2ZJBA 1QBKC 3AF4A 2ZYUX 4P33A 2FU5C 5CDFA 3HYRA 5UKDA 3IKJA 2ZJYA 5H68A 4DXAA 1P6XA 3ZQ6A 2IHYA 1KJWA 4NYMR 1GNQA 1P62B 4I1VA 1GIAA 4M8NE 2CCGA 4G01B 2C78A 3MUFA 1W36D 3GJ0A 4NBSA 4TTQA 1NI3A 3ZDQA 4B48A 3W3ZB 4ZDJA 4AK9A 2RGDA 2WOJA 3C41J 1FQJA 4EPTA 2FWRA 2HT1A 3CX7A 1W4BA 2WKPA 3NTUA 4KXFB 3W5IA 4D26A 2IUUA 1OHHD 5IRCD 3AKDA 5CYOA 1JB1A 1GDDA 1F60A 4M1MA 4IHQA 3QEJA 5AJXA 4LHYA 5FPKA 3CH5A 1P9NA 1NMYA 2G88A 3QVVA 4X8LA 3FKSA 4NYMQ 2RH5A 3T12A 3QE0A 3OEED 3R9IA 3TVTA 3PVSA 4LJ7A 2ERXA 5M1FA 1F2TA 1HH4A 3C15C 3TE6A 2F9LA 1T3SA 1QVRA 1NNEA 1OPXA 5EZ5A 1TQ6A 1IN4A 3LVQE 3MWLA 2QEQA 3DZ8A 1SXJC 4JMPA 1CEEA 3T5DA 4A2WA 3TAUA 3P4XA 1TL7C 1X6VA 4XTRA 2DWQA 3LBHA 1YZTA 5IHPA 1R5NA 4IOKA 1E98A 1Z29A 2EQBA 4QNMA 2J7PD 2CDNA 4YMVA 2OXRA 4QRHA 3IPYA 5FTMA 1KZGB 1KKMA 4HAUA 4BE7B 3JZAA 1VYUA 3EIQA 4JZKA 3VU9B 1OB5A 3AEZA 1ELOA 1Z6AA 4B47A 4ZPXA 2W6IA 1HE1C 3E5HA 1VKJA 4C0JA 5J40A 1DG3A 1KI4A 1ESNA 1V5WA 2Q6TA 5FL3A 3WHLA 3NHAA 1TX4B 1Z2CA 2Q9BA 621PA 1EX6A 4L16A 1LNZA 1TF7A 2ZJZA 4KVAA 1DE0A 3QEOA 4TLDA 3A4NA 4N3NA 2RCNA 4TLCA 2EYUA 5EXTA 4DSNA 1E9AA 4DDUA 5EP4A 4DDTA 1N6KA 3LWNA 2P65A 3LLUA 1ZM4A 4BLSA 1KO5A 1DADA 3K0FA 4KITB 5C15A 2J0UB 4GZMA 1KI6A 1XRJA 3W90A 3EPLA 1JR3E 1VHTA 2VSOA 3SEAA 4DT1A 4WVFA 5A5GA 4PX9A 3AQ4A 3U3JA 2BDTA 1E4VA 3RWOA 1VCMA 2WWHA 3B2EA 1XXHB 1GNPA 2D2EA 1DEKA 2GILA 1E1QD 3VAAA 5EXSA 2QM7A 1E2IA 1OXVA 2R6CA 1EG7A 1H8HA 2QE7D 4Q18A 2ODBA 4KJZA 4DUGA 3AVXA 3L0IB 4Q7KA 3VR5A 1PUIA 3GLHB 4DB4A 3ADDA 4B2PA 1KK3A 2R9VA 4MA4A 4KFTA 3ICQB 1E0AA 5AR1A 2ORIA 3GEHA 3EASA 3AUYA 3GJ3A 5JZVA 4TMVA 1R2QA 1Q1BA 1E6CA 3B1ZA 2QSZA 3ECCA 3H86A 4FMCF 4OKSA 5FL7D 4AKEA 5BW8A 1NG9A 4Z1MA 3DKVA 1IY0A 2YWFA 2OE2A 1G4AE 3VHLB 1O3YA 5LB2A 1SVWA 3NBFA 1CTQA 4QBFA 3GLIB 3IGFA 2D62A 3K0SA 4OI2A 4EFNA 2IYZA 1DVRA 4B73A 3RDPA 2G1KA 1ZP6A 1AS3A 2ZIAA 4KU4A 1XTSA 1P9RA 3IHWA 4PO9A 3TJZA 5EUMA 3KJHA 2OV2A 1CJUC 1NKSA 2CXXA 3R9WA 1ZMXA 2G0NA 3SZRA 4CYMA 2IUTA 4ARZA 4H1UA 5G3ZA 5IT5A 3GLGA 3QKSB 2YKGA 2FE4A 2GEDA 5B57C 2P0EA 4G5GA 2XNDD 2REBA 4RFVA 1E69A 3Q5DA 4ESVA 3BB4A 5KYKA 2IYXA 2PZEA 3Q7QA 3VTKA 1OIWA 1VCIA 5JI2E 1G3UA 3IBGA 4BLTA 1PVOA 2HLDA 4ASUD 1YZLA 3WRXC 1KNXA 2WIBA 1GP2A 3WBJA 3PEYA 5HR5A 2ZJ2A 2D4HA 4YC7A 5KNBA 3EIHA 5KO2A 2DWOA 1QDEA 2BBOA 3GJ8A 1HURA 3B7GA 1Z47A 1Z0FA 1G7RA 3KUDA 4ESHA 4E03A 4I1SA 2WSSD 2FJUA 2GDJA 1OXSC 1DOAA 2ZJ5A 3GEIA 1HYQA 2ZI9A 3JVVA 3V4FA 2D2FA 2EVWX 3IBYA 5FUWA 3THWB 1M34E 2ZSFA 1P2UA 3CRQA 1N5JA 1XD8A 4JLMA 4JIMA 3EZ9A 4PZZA 1IN8A 4EQ6A 4GP6A 2GHIA 2YOFA 3WYGA 5GADl 3IO3A 1S3SA 2BJVA 3QG1A 4V0OA 5JBQA 4R2IA 2XXAA 2DPXA 1KI7A 1RC8A 4TT3D 4M1SA 2GRJA 2PZFA 4WAUA 3VKGA 1ZJ6A 2IYUA 4A8JB 1GZSA 4QBIA 4BFVA 4YMTA 3W6OA 1YZGA 2FSIA 4KLZA 1ESMA 3OAAA 4LBVA 5DISB 3U61B 4KAXA 2QBYB 5DYIA 1Q57A 2A3RA 5C18A 1E79A 2NO9A 3GJ6A 2F1IA 4CEHA 1M7BA 1D9ZA 2BM0A 3LQQA 4TZ6A 5E95A 4YXWA 2QTHA 3HU2A 5SZKB 4PC7A 1AN0A 3NBXX 5E7MA 2WSMA 1G41A 4ZIRB 5ANRB 1QRAA 1GTVA 2REXB 1UFQA 4A82A 3AUXA 2DHRA 1G17A 4JLVA 2I1QA 4QGFA 3UMRA 1Q21A 3AH8A 1QZXA 3A37A 2OZEA 5FBVB 1I4DD 2JLUA 2GETA 1HQYE 1KK0A 1X8LA 1E9EA 1LB1B 3VFDA 3EX7C 1D6JA 1NG1A 1T5IA 1U0LA 2MSDB 1U8AA 3H2YA 2V3CC 5SZIA 1WE2A 2BMFA 2CLDX 1Q12A 1ZC4A 2N1BA 2D7CA 3C14C 1E2QA 2D7DA 3EZ6A 1UEIA 4WA7A 5M1OA 1N6HA 2C99A 2W2VA 2WJHA 4Q4JA 4PC2A 3AGPA 3CRVA 2O8BA 1D5CA 1E2LA 5J4KA 4LJ4A 5DN6D 1N5LA 4RZ3A 1N3BA 3SS8A 2ZRAA 2Y8EA 5LBIA 2JJ2D 1U8ZA 3UG6A 4FI3C 1KDPA 4OHVA 1EXMA 1NN5A 1E1RA 2XOKA 5IK2A 1QHNA 3QKTA 5JHGB 1ZVQA 5E7IA 3SR0A 3TAHA 1XEWX 1NSTA 1G5TA 1AQYA 1UDXA 3P1JA 4TL8A 3T1OA 1HA3A 4Q4LA 2WWYA 3FE2A 4E09A 4QGAA 2A30A 4Q48A 3AVUA 2V54A 1WCV1 4HDQB 4BGDA 2C9CA 3C4JA 1TUIA 3NDBB 1JALA 3EC1A 2W6JD 4HDOB 4DHEA 2D06A 2E1RA 1GILA 1XCMA 2CNWD 3M1IA 1I4LD 2JGNA 2ZRNA 3FYHA 3CR8A 5JWRA 4LJAA 4MUBA 1LTQA 4TQ9A 4B3XA 4HAZA 2VEDA 1NVWQ 1NY6A 1DO2A 3LX8A 2WICA 3TBKA 4AI6A 3KFVA 5JFGA 2ZRPA 5J5CA 1IONA 1SVKA 5E3HA 2IYLD 2GJ9A 3U7EB 4X8HA 3T06B 1KDTA 1G9XA 2VHTA 4M1WA 2A2ZA 3T61A 2WAYA 2A5GA 4C0AC 2V9PA 2IUSA 2OLKA 4PHFA 1FMLA 2ZE8A 4O0MA 5GJWC 5HE8A 3SN6A 4PSVA 5FPYA 1NKTA 3A58B 2BMDA 4JLKA 1UEJA 5CIQA 1UKZA 4JVSB 2ODWA 1RPZA 2OG2A 2IC5A 2J5XA 3GFTA 5C4GB 1CULC 2QMEA 5AJZA 2NO0A 2ZYTX 4OHWA 4WZBE 4BUJA 5KU1A 3SJAA 6Q21A 4WBSA 2GEVA 2EFGA 1XMVA 2ZU6A 5L3SA 1PZNA 3LO5A 3DDCA 1W44A 3AF1A 4TSFD 3WNBA 2YWHA 1R0XA 3UMSA 2BMEA 1G7CA 3P4YA 1E2DA 1ZC3A 1GKUB 2RHDA 1QHGA 3I4LA 2QZ4A 4B3FX 4NMMA 4NL4H 3S1AA 5FR1A 2CK3A 5D3QA 5IDVA 4A0RA 5CLQA 4PPQA 3ZZUA 3OIVA 3QENA 4EUNA 4Z8XA 5CITA 3C5CA 5EJEA 1R10A 2PT7A 3THOA 3I5YA 5FOTA 1LF5A 4QHSA 3Q8XB 1XD9A 3M6AA 4M1OA 1GNRA 2ZUCA 4AYWA 4LYFA 2BEKA 2JLRA 1ZU4A 2FA9A 3GLHE 1EFTA 3O8CA 1BMFA 1OB2A 2QY9A 3WYFA 1ZNYA 1U0JA 5P21A 4Q4HA 2OBLA 4XJXA 4LX0A 2WAXA 1DARA 2CJWA 2MMGA 3I1FA 4LPKA 4OHXA 1W5TA 4D6PA 3U44B 1E2FA 1A2KC 3IILA 4EKDA 3W3AA 2OXCA 3A8TA 2GCNA 4NTZA 1ONBA 4QM7A 3A4MA 1XTQA 4GMXA 3FB4A 4HUTA 3GLIE 2IXFA 3KQUA 4MYHA 1CIPA 3QIAA 2XB4A 1XTKA 2VO1A 3QPVA 4HSEA 1ZM2A 1OKKA 2GCOA 1R6BX 1BO6A 4HDCA 3FDIA 4XTCS 4Q9JA 3BORA 4QGGA 4CF7A 4A36A 2JCSA 1ZINA 3R8FA 1IBRA 2I3BA 3KZ1E 5G41A 1N25A 3BH7A 1KI3A 1SVIA 2PX3A 5KSOA 2ZPTX 5BQ5A 1M74A 2J45A 1OIVA 3KB2A 3K70C 5LD2C 3D8BA 2NMVA 2V6JA 1FZQA 2WKQA 4PC1A 1RIFA 1IAQA 2VA8A 1TU4A 2QPAA 4JVNA 4LJ6A 2GXUA 5DI3B 3CRRA 4RD0A 3GLFA 1CU1A 1Z0AA 3RSOA 1HTWA 4HZUB 3CH4B 4UXJA 2QP4A 2WPDA 1UKYA 2WHXA 3KB1A 2HJVA 5F3WB 4CW7A 1RRGA 3ND9A 2CCKA 5K8TA 1JI0A 4RD4A 4UNSA 3QSYA 1GM5A 2QT0A 4L8GA 4PFSA 3MWYW 4Q7JB 1J7KA 1M6NA 1N2CE 2GZHA 4EDHA 4P4TA 1TTTA 2PCLA 4DB2A 2O8EA 1XU4A 3CF6R 4EPVA 1VYTA 1W48A 5FI0B 4QXAA 2BVNA 3GEEA 3KX2A 2FFAA 4V0NA 3RS4A 1XTRA 4OQFA 4AKIA 1P72A 3TW4A 2IXEA 2RAPA 2F1RA 2ORVA 4U7DA 5F2EA 5AJWA 4BLPA 3VNUA 1M7GA 1WXQA 2F43B 4JLNA 3PQCA 4D25A 1JXOA 4YDHB 3U4QA 2LKCA 1E0SA 3C8UA 3DO6A 2G9NA 5G53C 3KXKA 3VMFA 1SKYB 2NZ8A 2W2XA 1E0JA 2JJ1D 2ZJAA 3A1UA 2CBZA 2ZS8A 1JEDA 4PHHA 1E2EA 2E9SA 5CLLA 3KTAA 3ZVNA 3ZZ0A 1SXJB 3SHFA 3HPQA 2QMUA 3B1VA 3QXCA 4NCHA 1YU9A 3QXHA 2YHSA 1NBMD 5B64A 3AKCA 3MMPA 4QGHA 3VNVA 4D2IA 4MQBA 3AGQA 2CL0X 2CCJA 3SHWA 1F3OA 3F5FA 2AD5A 1IM2A 3TIFA 2JLQA 2IYYA 3HPRA 4JLPA 2ZITA 5EXPA 4YMWA 1E2PA 3E1SA 2G6BA 3UATA 3AF3A 3M0EA 4O2LA 2BM1A 1J8MF 4GBMA 2JIZA 1EFRD 1E9CA 4JBYA 3UIEA 1G3RA 1ZCBA 3ASYA 5ELXA 4CEIA 1XMJA 1KSJA 4IDPA 5L3QA 5GJVC 2PL3A 2UZ3A 4PXAA 1PLJA 2GK7A 1XEXB 2FSGA 2VH5R 3DHWC 4UKDA 5HKKA 3U3OA 3O47A 4HZIA 2WV9A 2N46A 2GF9A 4TMZA 2H1LA 5FI1B 4EPXA 2PX0A 3SBEA 3PEWA 2XNSA 2FFQA 4B6FA 2OBNA 1GRRA 3ZVLA 1CR2A 4Q03A 4JL6A 4LYAA 1M2OB 2ODEA 2GBLA 2RGEA 3CIOA 1LV7A 3BXZA 2J0QA 4QC2A 2CL6X 4O2RA 1M8PA 1TEXA 4TL6A 2AD1A 1JR6A 5LDDC 1DPFA 5JEEA 5C46F 2DWPA 1JJVA 4G0NA 2IWHA 2VP6A 1CBUA 5C2DA 3AVVA 3SU8A 1L2TA 2ZU0C 2ZYVX 3RC8A 3GCGA 3OFND 3MJHA 4B3DA 1RRCA 1E9RA 2QENA 4ZCLA 4F4IA 1NY5A 2GJ8A 4LC1A 4RD1A 1T0JB 1P2SA 3Q7PA 1WF3A 4Q1DA 1YJ5A 1J8YF 3G5UA 2JLZA 2X2FA 1NSFA 5A0FA 4M4SA 1XZQA 4YONB 2LWIA 1JR3D 4LHVA 1P75A 4C7OB 3TKLA 2WWFA 3AB3A 4CRWB 3VR2A 1GSIA 1XJQA 2ZETA 5KNCA 4C0LA 1TMKA 2C9OA 3P20A 2QTFA 1TU3A 4BEBA 1KIMA 3K0AA 3U3MA 4DSTA 4NE2A 5JECA 3CR7A 4YDSA 1SQ5A 2GA8A 3QG5A 1T3LA 4DDVA 1MO5A 2J7PA 4G1UC 2A7QA 2AXPA 2NGRA 3NKVA 3NH9A 2F55A 3I8SA 1OSNA 5GJCA 3GPLA 1JXMA 1BOFA 4M1KA 1QVAA 1W7AA 4NHOA 3HR7A 4AY2A 4NDZA 1MOZA 2DFNA 5TV2A 1KMHB 4MRNA 2FEOA 4EJSA 3WYAA 4L9WA 5TB5A 1GRNA 4XSGA 1ZUIA 4AYXA 4XOIA 4NYIR 2OAP1 1XTJA 1XCPA 1HT1E 4R98A 4A0HA 5M1NA 4LDJA 1KJZA 4MRSA 4UJ3A 1A82A 3AVPA 1E9BA 1NBME 3PV0A 4QOSA 3R7WA 3UKDA 3K0FB 3NBYC 4FCWA 4MYTA 2GBLC 4EFLA 4PZYA 4FWTA 5G3YA 4G5OA 4DC9A 4DT1B 1GL9B 3QUSA 2W58A 5DIFA 3D6TB 1U81A 4NPHA 1SHKA 4DJTA 1NVVR 3SYLA 4TYNA 4HYYA 4UNRA 2VSXA 2AK3A 2ZRMA 3GJ7A 1XEFA 2QAGC 2HXYA 4NYIQ 1OH8A 3PR1A 1R4AA 4WW0A 4GT1A 1E2KA 4Q7MB 3KKQA 2XX3A 1G8FA 1G8PA 4DEXA 2YWEA 1NN1A 2ZS7A 1D2NA 3BAFA 1WRBA 5AJYA 2GJAA 1K5GA 1OF1A 2GTPA 2XJ4A 4D0NA 4LC0A 3ADBA 4P4UA 2J0SA 1UDWA 5KDOA 1R0YA 3PUYA 2OILA 1WA5A 2D3WA 1CR1A 1C9KA 1NVVQ 1M1YE 4JLOA 1G291 1G5RA 4WXPA 5BYJA 4DEYA 1SXJD 2JJ8A 4LV8B 1Z5ZA 2CVFA 2WVJA 3CRW1 1MABA 1US8A 2VSFA 1WB9A 1S9DA 2V1UA 1CLUA 1HUQA 1VIAA 3B60A 4OBEA 1EK0A 2YINC 1G8HA 1OE0A 3MWKA 4B3CA 2CL7X 2DYKA 3B13B 4MYCA 2RGNA 4A4DA 1ZD1A 4DIDA 4D80A 4MKIA 1G4UR 2O5VA 4RD3A 1GUAA 4LYHA 2JDIA 2X8AA 3ETLA 2C77A 3LD9A 3EWSA 4F91B 3TQCA 1CKEA 3QY0A 4MDEA 4DWJA 4EJSC 1GFIA 1W0KA 4ARZB 1NIJA 3IEVA 3GLGB 1E9FA 4KLNA 2KI5A 5FPSA 4BZQA 1ZM7A 1N6RA 1FX0A 2VP4A 3GD7A 2B6HA 3LLMA 3BK7A 2GAAA 2VP9A 2ZRDA 3H84A 5FBLB 1WQ1R 5GJBA 1W4CA 1KY2A 2WOOA 1YRBA 5M04A 1E2HA 1OFTA 4POAA 1J2JA 4GSYA 1K8RA 1AZTA 4ABYA 3SNHA 2IX3A 2BMJA 2DFTA 2VP5A 1JPNA 3SFZA 4V0LA 1S1MA 4LI0A 4HUQA 4Q1BA 2XZPA 3U60B 4V0MA 4E22A 1BH2A 1QHSA 2H5EA 4Q47A 4ASUA 4M22A 1X8JA 4CDGA 3LW7A 1Y63A 4HAYA 5EZ6B 4BFXA 4FIDA 3RHFA 1Q22A 4LK2A 5FR2A 5HZKA 4JVLA 3U7HB 4EIWA 1N0VC 2WWGA 5JJLA 5JLJA 4CEJA 4OHYA 1V43A 1VG9B 1Z0JA 4P31A 4G5RA 3VHXA 1KGDA 3P32A 4EQ6B 4C4PA 1AQUA 1SGWA 4GRAA 4YQFA 2JLSA 5FPHA 1Q1ZA 3BC1A 1IOZA 3SJZA 1G6HA 1NL3A 3PIRA 2WIAA 1E4YA 1SZPA 3RS0A 2CLCX 5JSZB 2QNRA 3MG9A 2FF7A 5DI9A 1CJKC 4A15A 3TMKA 2RGNC 2V4ZA 3MCAA 1R0WA 1VCNA 4JJZA 1Z83A 4LWZA 4PZLA 3X1ZA 1XJCA 2WMNB 4GNKA 4QHYA 1KTVA 3FMOB 4UNPA 4NONA 2GESA 2VHUA 2ODNA 2OSBA 3EXAA 1Q20A 5JS7A 2O0KA 1OFHA 1GL7A 3AVQA 2YNMA 3BBPA 3OZXA 3R20A 2ZUDA 2C04A 1J90A 1ZD8A 3QF4A 1R8QA 221PA 3FKQA 1SKYE 3DL0A 3I73A 4LBYA 3OEHA 421PA 4D82A 4TYYA 1N6NA 2SHKA 3SQWA 3LY5A 2O0HA 4EPRA 2FPMA 3THYA 1EFHA 1SXJE 4X8OA 4DLTA 4KFSA 2R6DA 4JKIA 5AWFC 4P3YA 3L43A 4IEIA 2B7BA 2IK8A 1ZM9A 1CR4A 5L8VA 521PA 5CJ2A 1FQKA 2PMKA 3A36A 1KI1A 4RFSB 3LA6A 1T9HA 3EA5A 1D2EA 2PJZA 2P6NA 4F93B 5JRJA 4IEEA 4KHZA 1UAAA 3NEJA 1KJYA 4JLAA 4US2R 1Z3IX 5EE1A 2Q21A 5JWHA 2OT3B 4DUGD 1GKYA 1XXHA 4ZDWA 4M21A 2ATXA 4Q4JB 3Q5EA 1GWNA 3CPHA 3TR5A 1Z6GA 2O8BB 4B3GA 1ZIOA 2WM9B 2AWNA 2C2HA 1QG4A 3C7KA 1G20E 2IL1A 5CDFE 2JLYA 3IUYA 2AX4A 3IPXA 3AF2A 1I2MA 4JT2A 4L9SA 4Q00A 3GQBA 2XGJA 4PANA 4ACAA 3B9QA 121PA 3EZ2A 2ZE6A 4Z1MD 4CZ2A 5J4YA 1QHHA 4UJ5A 5DN6A 2ZSAA 1JQJC 4AIIA 2L0XA 1KAGA 4E07A 3J81k 4RKEA 1YHNA 1G18A 1AKEA 1DO0A 3BB1A 4Q4AB 2HYIC 1WP9A 3LV8A 1F6BA 3K8YA 3MD0A 3BFKA 4LJ5A 2ZYWX 1KO8A 1XMIA 2Q9AA 2VF7A 2FH5B 1MO3A 2QUZA 1S3GA 2KBEA 1FTSA 4P32A 3ZIAD 2OEPA 4BFZA 3QOFA 1L7VC 2ZSDA 4IJMA 3WBKA 3FHTA 2OFWA 4JSYA 2ZVPX 4PHGA 4B43A 3KKOA 3C6HA 4DIEA 4LBWA 2PZGA 4MGIR 2A5JA 2VQSA 2J9RA 4B75A 1YQTA 3CLVA 2RB4A 2W6JA 1U98A 2B21A 4Z54A 4W5WA 3REGA 4B35A 4A2PA 4DLRA 4ZO4A 2CVHA 1OJLA 1DAGA 1KY3A 1OYYA 2R6GA 4TWZA 3T34A 2GCPA 3TK1A 4PPGA 4B76A 1G1MA 3QKSA 1X86B 4CT4B 2HLDD 5JRZA 3I72A 2QI9C 1NLZA 2R65A 4P0TA 4NH0A 1F48A 4I1UA 4R71A 4TMWA 4XD7D 3U7FB 3QKRA 2DFLA 2IF0A 3HU3A 2VHCA 4A9AA 5FH9A 3LBIA 5TXGA 4Y0AA 1AM4D 1CJVC 2QORA 5KDLA 2IYQA 4Z51A 4U00A 4FCVA 1NMZA 1RKBA 1U9IA 1BIFA 2VBCA 2VIIA 2BBWA 5L3SB 1T4GA 1OH7A 4HATA 5LD2B 4LBZA 2DB3A 1UPTA 1I4TD 4O25A 2PEYA 2YOHA 3MJRA 4CT5A 2V7QA 4A1FA 2ZTSA 2GF0A 5DNYB 4NP6A 3EARA 1NLFA 2ERYA 4JBWA 5DO9A 4RCYA 4TSFA 3U7GA 3LFUA 2PLFA 1UBEA 1YKSA 3THWA 2XSZA 4ZDKA 3DOFA 3IIMA 2FDCA 3R9XA 1YZUA 1UJ2A 2FEMA 2P5SA 3WNDA 4C0SA 4Y0VA 3NXSA 2HF8A 3MSXA 3CX8A 4C0QC 4ZCIA 5H70A 2ZRHA 4ZI2A 4Q9IA 2FSFA 1RVDA 4URXR 2MSCB 1R8SA 1RJ9A 2QQ0A 3B78A 3HYTA 3N70A 4QJ3A 3AP3A 4LY6A 4NCJA 2AKAB 3AP2A 3LQRA 1F5NA 3NHBA 1Z0DA 1E79D 4YLGA 4D81A 3QBTA 2IWRA 4M9SA 4JL8A 4KODA 2G1JA 4JLDA 1VDZA 4OI0A 2CJWB 4OJKA 4RKFA 2GAOA 5HZHA 2AHOA 2E87A 2C96A 2RHMA 4V0KA 2PCJA 1Y3AA 3QF7A 3T1TA 4HLDA 5BN3A 3DOEA 1IQPA 2IS6A 2PBRA 4PPFA 3Q85A 1E94E 1TUEA 1W49A 1ZAKA 1ZNXA 4DCSA 1HY3A 2HDNB 1G8YA 4KSBA 1XPRA 1E96A 3ONWA 1N6LA 1P2VA 3L0PA 4B44A 4B74A 4ZIRA 4HEJA 2V1XA 2GJSA 3NH6A 4LOAA 4TMTA 4DCTA 1W5SA 3D31A 3EW9A 2IYRA 4D0LB 4BRUA 2RGCA 2ZI5A 3Q72A 1OFUX 4IVPA 4EPWA 2WMOB 3OF5A 4PPNA 1U2RA 3I5XA 1CRPA 3TVDA 5EUQB 3NBZC 5HE9A 1VTKA 3CPEA 2VPPA 3SBDA 2QMOA 3AF0A 4HLUA 2RMKA 3GLGE 1IXSB 2EU8A 4IFEA 4XVUA 3LX5A 1R7RA 4DLUA 4OJQA 3A1SA 4KYIB 3DVLA 2Z83A 4BEJA 5JCPA 3OIYA 5EE0A 1PLKA 3F0TA 5JJIA 2FGJA 4TYWA 3RRZA 3GLFB 4IW3B 1KNQA 2N42A 3EZFA 3KKPA 3T1QA 1KI8A 1Z06A 3UWKA 4BLQA 4BECA 5K8IA 3LAWA 2OCBA 1KK1A 2VLIA 1MO4A 1W47A 1AZSC 5JJKA 1FNMA 4D4JA 3RABA 1NF3A 5HTKA 1N5IA 4LHXA 1E99A 4V03A 2LCFA 2O8EB 3HU1A 2IF2A 3L82B 3SQXA 3MRSA 1ETUA 4CIDA 1EWRA 1MH1A 1W0JA 1G21E 3RRMA 2XZLA 2X1VA 4A92A 4U5XA 2X77A 1GITA 1DAIA 4M1YA 4UQOA 4A6PA 3CBQA 3EIEA 4XVQA 4S2EA 1KDOA 1SVSA 4BFYA 5D3MA 2GWHA 5KPJA 3U4QB 1XP8A 4QBGB 2J59A 3K53A 4B33A 2BJWA 2QT1A 4KO8A 4MRRA 2ZRKA 4N0EA 3RS7A 3LH5A 2P6UA 2F3TA 3AV0B 1KZ7B 1COWA 2Z5FA 2B8TA 2TMKA 1EFCA 3BRWD 5KUTA 3BJIC 1ZUNB 2JJ1A 3OE7A 3WHKA 4RJLA 2EYQA 2NPFA 1Z07A 1SVMA 2XITA 3LXXA 4MDFA 3EPHA 3ADKA 3CF0A 2FZ4A 3CZQA 1XNJA 3E70C 4DLZA 3PEUA 2BBTA 2P3SA 2AL7A 2QL6A 1DAHA 4P4SB 1FUUA 3UANA 1TADA 4D4KA 4HLUC 3AVTA 1NJFA 1DTSA 2HXSA 2O8FB 1P5ZB 1EFRA 3KJEA 4WZAE 4DZZA 2RGBA 1JEEA 3MGCA 5JI3E 3WNCA 4PHTA 4Q02A 2EFDB 4HAVA 1SULA 2OFXA 3PUXA 4RVCA 1RYFA 4B34A 4C3ZA 3RANA 2QPTA 3F3YA 4X8MA 2B7CA 1FMJA 4ILEA 2ONJA 3UG7A 3BERA 4FMDB 2ZQ5A 1U94A 4OK3A 8OHMA 2O0JA 3PUWA 3TGPA 1T0HB 3DMNA 5J4VA 5EP2A 5FBQB 2C95A 2NPIA 3CPJB 2GK6A 5B2ZA 4A2QA 3DKPA 3HJNA 3QXJA 1G3MA 4LJYA 4Q66C 2QAGB 2IXGA 2KSQA 4F4CA 4C2TA 2RGGA 3SJCA 4IDHA 3SC3A 2GZDA 3TQFA 2OO7A 4K81B 1XJ0A 3I8XA 4OL0A 2XJ9A 1EESA 5DHAA 3IO5A 5BN5A 4WXRA 2O52A 4LJ9A 2DFKB 1CXZA 4US0R 1HE8B 1UBFA 1XD2A 2BIFA 3OFNA 5JWOA 4OYHA 5F9FA 3GJ4A 4Q9LA 4W9MC 4JLBA 1G3IA 2IT1A 1P73A 3O8RA 3K0CA 1ANKA 1EX7A 4MKHA 4PAOA 5JCZA 2QN6A 4PAQA 4DSOA 1S8FA 3O8DA 2O8DB 4PQFA 5KNDA 2OESA 4R7ZA 1W2HA 4G5QA 3TNFA 4RY2A 3QVUA 2F9MA 1OKKD 3E2IA 3IQXA 3NDPA 3K0AB 4EPYA 1Z6XA 4GOJA 2HCBA 3N2IA 1S0UA 1X3SA 5DLQC 1CS4C 2H8KA 3C6AA 2YC2C 1EFUA 2ZI7A 4QHTA 2BEJA 4C0BA 2REOA 2GXAA 3K9LA 3HP1A 2HCJB 4BPBA 3WP1B 5KDDA 2C03A 1WDTA 3W9YA 1BKDR 2FZLA 5FUXA 4IOLA 4EJSB 1C1YA 4PC3A 1J70A 1DAEA 5M1QA 4IVRA 2CHGA 3TSZA 2EWVA 1MKYA 1ZNZA 4M9QA 4AYTA 2FX3A 2QP3A 1ZW6A 4MRPA 2WPDD 1XCGB 1TNDA 1G3QA 1II8A 2J3EA 1JQLB 4LRWA 3CO5A 3BFVA 5DI3A 3KXLA 4MGZR 5CM9C 4URVR 2VL7A 1YZKA 5SZJA 2VYFA 3MWJA 3QBVA 4GFDA 1JAIA 3DMDA 1BYUA 4XWAA 3DZDA 2H7VA 3PENA 3FTQA 1Z6TA 1OHHA 1NLYA 1D8TA 1P7CA 1RZ3A 1X8KA 2CE7A 4XH9B 2A5DA 3ZLJA 1F2TB 3CM0A 2BKUA 1YVDA 3FMPB 1N6IA 1LY1A 1M7HA 3OEEA 1QF9A 4FN5A 1TAGA 4ON9A 2ZSBA 4II7A 5FTKA 3NWJA 4TQAA 1YE8A 2MSEB 1UF9A 2QA5A 4TLBA 5EE9A 5AUOB 2AFIE 3BD9A 1Q44A 1DAKA 3UWOA 2X19A 4GDFA 3K0CC 2ZI3A 2QTVB 2WJVA 1XZPA 3ZS9A 4FMBB 3F8TA 5J4HA 1II9A 4LUCA 2XAUA 1MABB 1US8B 1VPLA 2WJGA 5DSZA 3KJGA 1AGPA 2W0MA 3GP8A 1GRQA 3RWMB 1L4YA 1MO6A 4OQNA 1ZNWA 4ERNA 1P2TA 4N0DA 3ZD6A 1C4OA 4RZUA 4MYUA 1OXTA 5KPDA 3AKEA 2JIZD 1P9WA 2OCAA 3GJ5A 4CVNA 2GXQA 5FOUA 2H16A 1LW7A 4PO1A 3ADCA 1NJGA 5H1YA 2DR3A 4JT4A 2G3YA 5HKKD 2QSYA 3K9HA 1KDRA 1FX0B 4I81A 3LRPA 2O8CA 4MKFA 3TR0A 1KI6B 2QG6A 3QI2A 4TYPA 5AJVB 4TLAA 1XEXA 5JS8A 3TUZC 4Q1AA 1RFLA 1TEVA 4KYUA 3A6PC 1P3JA 4TMKA 4TQUS 1S4QA 5CB6A 4DCVA 1AS2A 3T35A 1W36C 1DS6A 1VECA 3EPKA 2ONKA 3RNLA 4R2HA 2FOLA 3CZPA 4JYBA 4BFWA 1XMSA 4US1R 1IHUA 1F2UA 2OCYC 2W83A 1T8TA 1FFHA 2ZE5A 2EWWA 4HUQB 2ANBA 2QQEA 4K8OA 1FL9A 4OI1A 1NP6A 3U2QA 2UKDA 1WMSA 3FMIA 4KFUA 2HEIA 4Q9HA 1H8ED 4MGYR 4DLXA 1E1QA 1CJMA 2Q3FA 2ZJOA 3B1YA 2P6RA 3LVRE 1IJFA 2QE7A 3KDSE 1YR7A 2J7KA 3REFA 2Q3HA 2IA5A 4A0FA 4CEJB 1KO7A 3GFOA 4DBLC 3RS2A 3GLFE 5BYKA 2VF8A 5A4JA 3DM5A 3QXSA 5FPTA 2ZUBA 2GKSA 5TDHA 2R2AA 2WWXA 2K5UA 5FL7A 3PXGA 4OQMA 1VHLA 4ZCMA 1Z8FA 4BASA 4GZLA
chains in the Genus database with same CATH superfamily
3O73A 2O1SA 2YJFA 2IYWA 4QXQA 1UK8A 2VJMA 3ETNA 3BIFA 3T7DA 4RW8A 3GO4A 1JPJA 1DAMA 5GOZA 2I2CA 3FOFC 2BGNA 3VVCA 3EZ5A 4R9NA 4OPKA 1A5BB 3RTVA 5B53A 1U31A 2G8KA 1UJ6A 3OPVA 1NVUQ 1S22A 3IIIA 4P86A 4TYQA 3FZEA 1ZH4A 1Q1QA 1E2JA 4CM4A 3AVWA 4BKMA 1GSAA 2R44A 3HKEA 2DUNA 3NETA 1H2YA 2HHTA 3VVMA 2W43A 3DNPA 1ULSA 2XDWA 5T41A 2PMDA 3UAVA 1AHIA 2D59A 3A05A 1W4RA 2CGKA 2V5UA 1D2CA 5HROA 3DLPX 1XRQA 3KYIB 4ER5A 1ZJZA 4TL7A 4PKGA 5J2UB 4CEHB 1LF0A 5FPMA 3RUAA 1C0PA 4GR4A 4J16C 4ND8A 2NO6A 3ZIAA 1S9HA 4RIFA 5I9IA 3OCWA 5F5LA 3ULEB 1JH9A 3FFWA 4DSUA 1GLLO 3NM6B 3GXOA 4PAMA 1TGVA 4B3RB 5A5EA 5FTLA 3EY1A 2ID8A 3U3ZA 1OGYA 1ISGA 4NEHB 4PQRA 2Q27A 4NYJR 2ST1A 4F5WA 2DFPA 5GAGP 2J41A 4ARBA 3RJTA 4DLYA 3AHGA 4LVNA 2JGFA 2Y1FA 2AN4A 1Y3IA 3SD7A 2VPXA 2VHJA 3V3KA 4EKIA 1OGJA 3CX4A 1HQUA 2PRJA 3KR1A 4AMYA 1MRNA 1H65A 1MA9B 4O29A 1NBAA 4GVMA 2QRNA 3D5QA 4EHJA 1S1VA 1D3AA 2IAJA 2P1ZA 2H0RA 3G2PA 2JGJA 2HN9A 3O1BA 4PC6A 1U7HA 4D41A 4WZ6A 4WE1A 3UW1A 1TRHA 4YV1A 2J09A 1E64A 4ENVA 3OYDA 1CY8A 1H6BA 2AFIB 5HQJA 5GZ3A 1IATA 2HF7A 1EYZA 3ANLA 2ZR9A 5EIEA 3QFPA 1M6VB 1Q95A 1Q2XA 2FP4A 4U7WA 3ZHZA 2G63A 3I01A 1UM9A 1Q0LA 2O54A 4PGAA 4OFZA 4KHSA 2F1OA 3I09A 3RUPA 3D8SA 2VNJA 1UBGA 3NI2A 1CDDA 3OUUA 3TRDA 2NUPB 3I3SR 4FD2A 5IC4A 3L77A 3AV9A 1BO5O 3D2FB 1BJTA 1BE6A 1DWPA 2ZD1A 3GH1A 5CGZA 3V1KA 1WO8A 3A31A 1IDN1 4AJLA 3W4KA 3RNOA 4EGAA 2JFWA 5CH3A 1FUKA 2ZRLA 1E1RD 1K8QA 2C3OA 4U02A 4CW7B 4DNPA 2G25A 3OLWA 5LFAA 3OOJA 2XSZD 1CUDA 3WXIA 2C20A 1J00A 1WPRA 4BVLA 3PGVA 3D3QA 1UBUS 1G8GA 2C98A 1LRKA 2V7XA 3OBIA 3PQ6A 2ECKA 2DPHA 2HNBA 1QIFA 2RHTA 2NTYC 1E7MA 5C2FA 3EEFA 1N33B 1E9DA 4JGGA 1ZR2A 4GXQA 3HVJA 1XWIA 2Q0SA 2Q8QA 4CEIB 1DIBA 4IIXA 4CF0A 4HDMA 2V7VA 3H99A 4DTXA 2AN3A 3CW8X 4DPLA 1JLEA 4FCYA 2RGAA 4P53A 5EJ4A 3T7IA 1DRUA 5SICE 4PBSA 2X0FA 2NU6A 5BN4A 4EB3A 1XIVA 1BS1A 3O8BA 1J5OA 3QEPA 1QKKA 1JFLA 4WNCA 4UXHA 4EYKA 1R6XA 2WG2A 4AHUA 3DPUA 1X7WB 3JQBC 3NGZA 4QS9A 5C5DA 5LPNA 1TF2A 2X5JO 3I92A 1KSHA 1M0EA 5F5NA 1N6OA 3OE7D 1W46A 3EMKA 1JR3A 1FVHA 4E7HA 2J1LA 4KQWA 3KQQA 2OCEA 1YJAA 3EWAA 4O59O 2Q9CA 5ALPA 3NVAA 4FWMA 1VG1A 2OKGA 3AVAA 1KO4A 4IIUA 3X44A 5H9WA 3FNHA 3O26A 1VMAA 5B30A 2ZVQX 2PX5A 2F3SA 4M2LA 3FHOA 1T2AA 2NSLA 3ZOZA 721PA 4C6RA 3NH1A 3OD5A 3J7TA 3HDGA 3EXEB 3TX6A 2D0OB 2JPDA 1JECA 3GF4A 4DKWA 2I78A 3M1FA 4PFQA 3KQNA 5LYJB 4M8SA 3GCDA 3EC7A 3O1WA 3GAMA 4DG8A 4MR9A 4O4IF 2NIPA 4WNIA 4MQ3A 3B85A 4HAIA 4DCGA 4JITA 4OEHA 3Q2IA 5B1YA 4BX3A 1BQ3A 3NG1A 2JLXA 1AJEA 3AF4A 4DXAA 4MLZA 4EY5A 4MVJP 1FSFA 4MULA 1DJNA 4TTQA 3A70A 3J80A 1URPA 4WFNL 4F5DA 4ARCA 1P8ZA 5EPOA 3CVOA 3MXJA 3CE9A 4TKZA 1D4OA 1NMYA 3UJHA 2RH5A 2YHUA 2PX6A 3DP7A 2G8WA 3DVAB 5IT9O 1QVRA 1NNEA 3LIIA 1MXFA 3OPNA 2OA8A 1CUBA 1U2TA 1ZI9A 2A6AA 2CDNA 3I6IA 5FTMA 5JQGF 2AUTA 2DMRA 4L8YA 2JJQA 3LTNC 5D3ZA 2HA4A 3FAZA 4IEFB 3WGYA 4AJ9A 1KZ9A 4JV5B 1NVMB 4KVAA 1NUQA 3EYWA 4Y2VA 5HZGA 4AHCA 4C3VA 2G04A 2QDXA 1L7MA 1RI1A 1CLQA 5A5GA 4M9CA 3DMGA 4JHLA 3VAAA 3HKCA 3L02A 1FP4A 2WV7A 4YJKA 1LSOA 2B1QA 2DF8A 3A6JA 1WP4A 4DV4K 3GJ3A 3B1ZA 2QSZA 3COVA 5H80A 1YNSA 4IOXA 2IYZA 2VSQA 1DVRA 1EHYA 1H4VB 3U4IA 4S3MA 2YYSA 3TJZA 4KLAA 5D86A 1NKSA 4G1VA 2E2QA 5G3ZA 2WHPB 5H59A 1YL7A 2FE4A 2YV2A 3OYCA 1Z34A 1WSAA 1X1EA 1AHNA 1ZR4A 2HHLA 1MB0A 3PEYA 3Q12A 3UXYA 1CZOA 3KLEA 2JWKA 4Z0NA 1XZFA 2WSSD 3EUEA 1TD1A 3T3IA 3NNSA 3THWB 3PXCX 1C7IA 1LWCA 3S4YA 4KQXA 1ZBHA 1DQNA 5B3JC 2XZTA 1VL6A 1OZGA 4JI4K 4OX9Y 4EAAA 3OHSX 1N32B 4CLXA 1P7WA 4N4AA 3F1LA 2P1DA 3ZU5A 5TGTA 2YHYA 3AR9A 4UVHA 2NV2B 1I4DD 2X76A 1ENZA 2QM0A 5EMHA 5A2QA 1AXGA 2YUTA 3AR2A 1Q50A 3QLUC 2JI6A 2MSDB 1TJ5A 4X0EA 2VRCA 4LGYA 3C14C 1X80B 1SOVA 1UEIA 2C99A 1QTRA 3AGPA 2FQQA 3CRVA 3R5FA 2FLWA 4N48A 3KTOA 4RZ3A 3HRGA 3TLBA 1E1RA 2DECA 1QHNA 4BVOA 1JXEA 5AQPA 4ALMA 4CF5A 1WMDA 1NK7A 3EXHA 3FBGA 1NXSA 2EGGA 2V54A 3NDBB 5EUBA 3M1IA 2JGNA 3EVCA 3KU1A 5DWDA 3MGBA 2ZYIA 3OJWA 4BLWA 3U7RA 3JY6A 2VHTA 4MV8A 1HX1A 2V0CA 4MW5A 4OP2A 5A3RA 1OI4A 4E08A 3WYNA 1UEJA 2X6TA 4KQFA 3USZA 1H1DA 3K4PA 5L3SA 1XOIA 4KYVA 4AL4A 1GKUB 1EFPB 2JARA 2P2CA 3S1AA 1I33A 3H5IA 1GUYA 3IP3A 5EJEA 2ZUCA 1ZICA 2Z1MA 3TEJA 4EI8A 2OBXA 1Y5LA 5JSQA 1GN9A 3LKBA 3M3ZA 4QASA 1YJQA 4JD2A 3D6HA 5E6UB 3QINA 1XTQA 3QIAA 4FFBA 5KJ1A 3KFLA 4OXIA 1A77A 3SLGA 2Y0BA 1SCIA 1TB4A 3KLOA 3JATA 3PHGA 2PXAA 3WLKX 1FZQA 3I1YA 3BL5A 5JAQA 1QP7A 4PC1A 2ZIXA 5TSDA 4BG9A 2R60A 4BCDA 2VAMA 2A9RA 4KQIA 2GD1O 5EUCA 1XTRA 4XE5A 1YI2N 1MB3A 3ILVA 4JLNA 3NBAA 3BJZA 5DGHA 5KNLA 1XLVA 4FLTA 1UBSB 2CJPA 3M1AA 1YIAA 3K6SA 5LN1A 1WZIA 2BUPA 2P9CA 1WXFA 1QS4A 3W8EA 3M0EA 1QYDA 2X5OA 4W9NA 3AO0B 4CEEA 4C3OB 1M1XB 1VAZA 3D4OA 5A7FA 2JAWA 1K98A 2V58A 2FSGA 2E6MA 3W5DA 3F6PA 1KXJA 2FFQA 4OXNA 4B7CA 3ZW9A 4R9SA 3O8MA 1F0YA 3LUDA 3B6OA 2WJAA 1AQNA 3GD5A 4I5EA 1L2TA 1MX3A 3GCGA 5TVGA 1RWQA 2L82A 1F4LA 4H0CA 3Q7PA 4U7BA 1Q9XA 1XKLA 3C1TA 4M4SA 5DBOA 4IIJF 3ER6A 2WAOA 5CA1F 3MDQA 4J90A 4J2DA 2C9OA 2QTFA 1N75A 4BKQA 1NXWA 3CVUA 3PBKA 2O2HA 4DILA 2EGUA 1JXMA 3RSQA 4MPRA 4NHOA 1U5BA 2PGIA 4AHRA 3SZMA 3LCMA 1RLTA 3EBLA 4MEAA 2I4OA 1BQEA 5IT0A 3M6UA 1IEVA 3OZSA 3SQMA 4DC9A 3OO1A 3FIJA 1DMSA 4P22A 5HK8A 3NFYA 3VYSB 2O1WA 5EIBD 4FXDA 4FJMA 1E3JA 3VYWA 4S0ZA 2GJAA 1K5GA 4AU1A 4M0KA 1P44A 4G5FA 1BMQA 3RVOA 1XV5A 3OLYA 1T3GA 3E3OA 1OFUA 3I8OA 1T29A 4EX7A 1N3YA 3WMWA 1XZKA 4G84A 1ECFA 4MYCA 3IA7A 4OB8A 4BX0A 2XWQA 4ENPA 5FOQA 2KFNA 2YWJA 2A6PA 5EIOA 1PW7A 2KI5A 2GN1A 5FPSA 3TXXA 1FX0A 2VP9A 3OYAA 4POAA 4E5MA 3UKJA 3PDJA 4Y6GB 5K3SA 5TEVA 5FHRA 3PFWO 2M6LA 3MIZA 4H16A 3NGLA 4MV7A 4I6EA 2CXHA 3IUMA 3JQAB 2WD9A 1HE3A 3RS9A 1AQUA 2JLSA 1FTGA 2YVQA 3O94A 3PIRA 5FJJA 3G6WA 2XV1A 2OWEA 1KSPA 1Y6RA 1M73E 4ECAA 3V4ZA 2QQ5A 4BRAA 1N6NA 3O74A 2FPMA 4WZAB 4DA9A 1EFHA 3KYCB 4UTOA 2XYQA 1T1GA 1CR4A 3FCSB 3KQWA 1OV6A 5CJ2A 2PMKA 3KHTA 3V7WA 4R79A 2REQA 5JICA 3ZD8A 3WGIA 4QOZB 4OOEA 1C3XA 3Q5EA 3T1HB 3TR5A 2A33A 4B3GA 3LDUA 1M0WA 3KSBC 4BBPA 4L9SA 3D6AA 5EIFA 3EZ2A 4B4WA 3ZDDA 4UOEA 1Z5UA 1KAGA 1I9GA 2AOUA 1KO8A 5EXDA 3D6VA 3MBOA 2QW0X 4G0PA 4LVCA 2D4WA 4WL0A 2B9VA 4NCXA 4PHGA 3DMHA 3EEIA 1WR8A 4MB2A 4MGIR 4BR7A 1YQTA 1FPQA 4CMBA 3PC2A 3BHNA 2B21A 1EM8B 1XWWA 1U2PA 4B76A 1O13A 4ZCSA 4EP1A 3PC3A 3AVCA 3K1AA 3H0EA 3KD5E 4DCOA 1L5WA 1U04A 2BM9A 2AZ4A 1XN1A 3GZTB 4DTRA 1J21A 2IZ6A 1PQ4A 3L0DA 4EVRA 4QUIA 3HY4A 3CJTA 2D8AA 1E5VA 4C4YA 3OEWA 1OBCA 5AKEA 3SIXA 3ID6C 1UJ2A 2PY5A 5FI3A 2C5GA 3HVHA 2IGIA 3MINA 2DSNA 1BG6A 4QJ3A 4KNYA 3AP3A 3LQRA 3NHBA 1Z0DA 1KXZA 1KY4A 5SY4A 3BFJA 4JLDA 1XALA 4Z3OA 4UU1A 1JTFA 2GAOA 2V6BA 1IQPA 4ZU1X 4U2GA 3AOGA 2YMQA 5CHEA 1HY3A 2CY0A 1TO6A 1U3UA 4REQA 2NAPA 3LGSA 4HEJA 2V1XA 2VRBA 4BC3A 3NH6A 3WHPA 3Q9UA 4NF2A 2IOFK 2WTMA 4O4HF 1JEJA 2Q49A 3AFIA 5DT9A 4CR6A 3ZHQA 3DTYA 1B14A 5J2PA 1TJYA 3PFGA 2P2YA 1IXSB 3FOEC 1C3EA 1M1YB 5KYWA 5JD6A 5E3IA 4D02A 3ZLTA 5JJIA 3WGLA 3UWKA 1VQNN 5HX7A 5I7AA 5JJKA 1FNMA 4D4JA 1OZ0A 4XB2A 1JFRA 2D5CA 3EFBA 1GGHA 4ZI7F 1H85A 5IKMA 4EUKA 4ONEA 2IW1A 2HIGA 1GITA 3ECSA 4X65B 4XVQA 2VKTA 3UMCA 4RTNA 1UBMS 3AOEC 4TWJA 1YJBA 2PMFA 2PRKA 3CFYA 2J59A 4KO8A 1D7AA 2HU7A 3ZSQA 2ODPA 1I8TA 1EFCA 4G0OA 5KUTA 3KO8A 3U49A 2HEGA 2AIRA 2FR1A 3BJIC 1WXIA 3BMOA 3C6BA 1QBGA 4LHEA 2GHRA 1L8AA 2FWPA 5I9LA 2AFHB 2R97A 2FZ4A 3NOXA 2YZNA 2J4FA 5AQOA 5FA8A 2NYUA 4F6RB 2GKGA 2FMFA 1EJ6A 2JBAB 1UQUA 3N4PA 1OAAA 1I7QB 5CBPA 4YWHA 1HL7A 2Y4OA 1SULA 5EKDA 5E8RA 1HYGA 1XQYA 5FUMA 1FMJA 3E5MA 2ONJA 1I4OA 1N5YA 5FV7A 3HJNA 1R15A 5MFZA 2PWAA 2VYND 4AJEA 3SJCA 5FPDA 1W75A 4NNOA 5I7OA 3SEZA 1X39A 2HPVA 3GJ4A 1ZK3A 4J7AA 2KLBA 5JCZA 1N78A 4PQFA 2L19A 3TNFA 3RTEA 2VDRB 4IS2A 4E2XA 5IVIA 3SC4A 2BRUA 5J2TF 4E7LA 2P3LA 2WFAA 2ZI7A 3C4VA 2CNOA 3ZV6A 2FN3A 3KPVA 1U2EA 4MWZA 5HW0A 3ISVA 4KQ6A 3HI6A 5F78A 3UAOA 2EWVA 3JTEA 5BUSA 4AYTA 5ER9A 1UDRA 4LSLA 2GUWA 1BYUA 3CEMA 2H7VA 4FK0A 1Q11A 4OUKX 4KHPB 1NLYA 2G5TA 4X1YA 2VPTA 4EUEA 1VSTA 3KVYA 5EE9A 1YOBA 3HA2A 1T1SA 4H7EA 1L7RA 4JI5B 1JA9A 4FMBB 4WK4B 1IWOA 1NMNA 5AVYA 4HR7A 3D4IA 1S3XA 4YASA 1DQSA 1A5SB 3L5OA 4MYUA 2B99A 2ZTVA 3VQ7A 1HTTA 3ADCA 1MCZA 2DR3A 1L0BA 2QL5A 4QXOA 1CUVA 3LRPA 2CHUA 3TR0A 2QG6A 4C0WA 4FE4A 4KYUA 2Y2VA 3OPYB 3SMPA 1JHDA 3RNLA 2FOLA 1IHUA 3WGQA 2ANBA 4CQMD 5JDIC 1M2OA 5FIUA 2EC5A 5KYUB 1AG9A 1X1AA 4B1UB 3B1YA 1Z7GA 2QE7A 4FOEA 1NASA 3VHXB 5A4JA 1JSCA 2FKNA 2K2WA 4CMIA 4S1OA 3RPEA 3EISA 2M6SA 1RKQA 3UB3A 3RU7A 2ZBPA 2VTDA 3CY6A 2GNPA 1ORIA 4FKZA 4WGFA 4BFSA 2LZ0A 2QMYA 1DOZA 3IVAA 3PQ7A 2ROQA 2P9EA 3DRPA 2QU8A 2KLAA 1GOTA 3DE6X 1Y3FE 1ZCZA 2NXCA 3AA5X 3H5OA 1ZK1A 3LC1O 4OPHA 3A27A 3UMFA 1FDIA 3KKNA 4QZVA 2JLCA 4B40A 3HZ6A 1TUBA 2X9VA 5BNFA 1R0ZA 4C3UA 4KCGA 2P9SA 1C1XB 4FXOA 1NE7A 1CZNA 3FDFA 4RV9A 3FZMA 4KP7A 2B92A 1GA4A 2W6ZA 5GVSA 2GLUA 1F12A 2JDID 4W5HA 4V2UA 4LYEA 1GZHB 4XCVA 2PU7A 1AIPA 3A26A 3OQOA 1IJKA 2UZIR 3WX0A 3I42A 5FEUA 3MTBA 1M8GA 1N2OA 3MB8A 5DM1A 4CMJA 5LU8A 2P4EA 3QKRB 1H8HD 4MPPA 1HBJA 3VR5D 3PGMA 2J0VA 2AEFA 4FWSA 2VRWA 3W9SA 3KV3O 4P81A 4MQLA 5JJCA 3U7IA 5AQIA 2QRLA 4PN3A 1CG6A 3PDWA 2VQ3A 4XUDA 4ZICA 4IO8A 2F1HA 3BH6A 5ENDA 3SI7A 2R62A 2CXSA 4OAQA 2Q6OA 3L79A 3VV2A 4DR7B 5ADHA 2H92A 1RJ9B 1U8XX 1JQAA 5IYZF 2BDEA 1NGFA 4TTTS 5JD4A 3GJXC 3PDUA 3OYKA 1TPZA 4G2NA 3OIUA 1E6EA 1E0DA 3OX1A 4FHCA 1W2GA 4R8MA 2CH6A 4PR3A 1O8BA 2VR1A 2ZKIA 4ZTUB 2ZANA 3KSMA 2C0QA 2CZGA 4KG7A 4UM7A 1XEWY 2VVTA 4BWGA 1O87A 3KXPA 3MK31 3TTCA 3N0TA 2QD1A 2QI2A 4Q1EA 1DRWA 7AT1A 3UKUA 3FZHA 4ID9A 5EMLA 4JI1B 2QGNA 3I5MA 4F2DA 1V1RB 1YJXA 3V6DA 1H5UA 2ZAOA 1QFJA 1FTNA 3NAMA 2ZP1A 3DZKA 3HXOA 3OQIA 2QKKA 4YOUA 1XDZA 4Q5IA 2GCOB 1ADJA 4FZ5A 4HDKA 1GGNA 1GAJA 1G6OA 3OOSA 4P82A 4W9RA 4YMUA 3G0DA 1PBNA 1K8KA 2M32A 4DQIA 1TECE 2HLPA 4XLZA 2J5RA 2DFEA 1AKRA 1WXGA 2EDCA 4BVEA 2H9YA 4I3FA 2QROA 5AVRA 3NJRA 1YHZA 4WFKA 3KAKA 2W6MA 1D2MA 3A4TA 3G17A 5KX5B 1ZUWA 2VF5X 2FQYA 3D2CA 3A6KA 5BUCA 4MGKR 1CVIA 4KIWA 3GJSA 3NWBA 1OV4A 3B1WA 2Q5CA 2V55B 2VHQA 2EERA 3CEHA 1JJBA 5T3UA 4ZKEA 3FOZA 3HFRA 1GCUA 3P83D 1V4TA 1CZ9A 3EUAA 3D2BA 2J3QA 4RMNA 4F5EA 1QRRA 1QRUA 2GYYA 3KFXA 2E4ZA 2MSLA 4ZPJA 1N9ZA 2QHXA 5J4LA 3RO7A 4E5UA 2W00A 4P2BA 3EMVA 5KGXA 1NN0A 3LPTA 3GLSA 2YHAA 3G2NA 2IHJA 1L4MA 5KSPA 5H7XA 4OATA 3EGXB 1YR6A 2IOFA 1IZ8A 1TYQB 1VJTA 4GPAA 4S1PA 3V2GA 3V8VA 1JIQA 3DLLL 1B0UA 5E26A 5IN4A 4FP9A 4XWOA 1F8FA 1VMKA 2AVDA 1GYPA 3LC2O 3VR1A 2EW1A 4LRXA 3LRTA 1IXRC 3PT5A 1LS6A 4HDNA 4BB0A 1QONA 3IS9A 3I61A 2NO5A 2ZRGA 3GEDA 3QYFA 1ASVA 2XYGA 4H31A 2R7YA 5JNRA 1Z0KA 1RE1A 2ORWA 5PGMA 1ZLXA 2OSVA 3JZDA 2XA1A 4E1AA 1BDMA 2E4YA 3C95A 4IQGA 4B3BA 4JKYA 3NALA 4MYDA 4P0PB 3AB7A 2UVQA 1A5WA 3NTXA 1FDSA 3NMUF 4BWYA 1T9DA 3BA6A 4X66K 4QYTA 3DE1X 3FGUA 3T1VA 4ZO6A 4D9NA 1G20A 2PRYA 5AQHA 2ZJYA 4CJ4A 2XHZA 5DULA 3VA3A 2OR3A 4M8NE 1YS6A 2AQ8A 3A6DA 3W3ZB 3C41J 3MT9A 3QNNA 2HCRA 1JDPA 1OHHD 5AJXA 3W2FA 1NU6A 1NHWA 3QE0A 1NU0A 3BTOA 2QTZA 5AQMA 3AJAA 1OPXA 4B7UA 3TCKA 4YPOA 2XMQA 2H8GA 5J43A 4PRYA 4HNSA 3ICOA 2B2XA 3S8MA 1BAPA 2FCAA 4YMVA 2OXRA 2BMWA 3G5AA 4Z9YA 2I2BA 3RR2A 1HQKA 1KJQA 2OCXA 3JZAA 3DZHA 1HE1C 3AEQB 3MBIA 3AUSA 5LU9A 3NHAA 2AOVA 1Z2CA 1V6AA 4XDYA 5HS6A 4IOAL 3KAJA 3DCNA 4DSNA 3UAXA 5EP4A 3U9SA 1TUYA 3LLUA 1JR4A 3SPXA 2NXEA 1CV2A 3NHPA 3LYLA 4OKIA 1E1QD 1XQ9A 3RWUA 4MA0A 2V03A 1BVUA 4AZSA 2OZSA 1H8HA 3KKEA 3VR5A 5MLCQ 3GQBB 4IH9A 4HNGA 2YWBA 1Q1BA 1L3IA 1EVLA 1F8UA 3VQEA 4MPDA 5FUQA 2R5WA 1A9YA 2HXGA 2PPVA 4NOKA 2V51B 2OY0A 1NQUA 2O9JA 4EA8A 5D6NA 5DFAA 3QKSB 1AMUA 4ZHQA 5JAMA 2W98A 4Z0HO 4PLTA 3VC7A 3S8EA 4J91A 1YAJA 3NHUA 4ZVNA 1KNXA 3IVRA 4I50F 1B76A 2BBOA 1KJ8A 2PPLA 2OCLA 4F46A 3G0ZA 3O91A 4PAWA 2MYPA 2PH7A 4X1OA 4XIUA 4JS5A 4P98A 2JAUA 2PUAA 1QYRA 3HJTA 1QGUA 2QJTA 4AJPA 1Y1SA 2WEKA 2P9YA 4EJFA 1LFAA 3VKFA 4KGZA 4FBGA 3MSCA 2Q3LA 5C18A 1E79A 1NYLA 2O1EA 3CLKA 5E95A 2HNAA 3ABRB 1ZJ4A 2WSMA 2RKIA 4AMUA 2H54A 1WSBA 2I76A 4DQVA 4HXFB 3KUXA 2Y93A 1LB1B 2AYZA 2DBZA 2H1OA 3EX7C 1NG1A 4CFBA 3I9V1 2R6HA 2I8AA 2N1BA 5JALA 1NKVA 5KKNB 4Q4JA 4HWTA 1Q15A 2O8BA 2H5IA 4M3YA 4HPWA 4WCVA 2WONA 3HP6A 2UUBK 4IKPA 1XEWX 1G5TA 3QFTA 4TXLA 1IMJA 1MA0A 2C9CA 1XLUA 3KTQA 5COBA 4FOIA 1EBFA 5JYBA 3HZHA 4TXMA 3WL5A 2ZRNA 3CCJN 3PUIA 4I9LA 2WICA 4YRDA 1L1RA 2IYLD 3PB3A 4K88A 3T06B 3KOYA 4C6SA 3G8DA 2W6QA 4O0MA 3D8RA 4NX2A 4BJ1A 2I5PO 5LA6A 4ARVA 1YCFA 4LQDA 2A5XA 2V98A 3HNOA 4D99A 3EIFA 3UBMA 3F71A 4BXOB 3ZPXA 1LDMA 3M9WA 3S2GA 1DIOB 3QPBA 4MVJH 5BYAA 1IG9A 5CB4A 2CXQA 1HNZK 2WK1A 2IJGX 4K9PA 1KRXA 3D54D 4MP6A 2OORA 1EWVA 4GC5A 4YQZA 3O8CA 3HI0A 3GRYA 5E2AA 3HZOA 4NE7A 4ZEWA 2VQ6A 3EVBA 4I9HA 1QM5A 5CDYA 2GCNA 4NTZA 4PRLA 3FB4A 3J81A 3Q8WA 2JLBA 2O7NA 4FOLA 3GUVA 1LDYA 1JQ5A 1QS0B 4Q9JA 4L8WB 5DK4A 5HKLA 4WBNA 2PX3A 2CNKA 4B3MB 1OIVA 3A4VA 2L18A 4YI5A 4AZTA 4EELA 3CD6N 1CYEA 3I9OA 4RU1A 1X7GA 4UXJA 5F3WB 2POQX 3R09A 5JZMA 3HT3A 4UMVA 3LECA 3L4BA 1VYTA 2DFVA 3M2TA 5EERA 3E22A 2AF4C 4BLPA 1SR8A 1OCEA 4X20A 4X1KA 1LPAB 2G07A 2WHEA 3MBKA 1LSSA 1KRHA 1P0QA 4YJ2F 3AKCA 3IT1A 1B73A 3GG9A 4JLPA 2CYAA 4QAJA 3SC6A 4BWFB 4JQSA 5EPUA 1T6CA 5TQVA 1X19A 5GJVC 1DTWA 3C3KA 1FXSA 5EMKA 3NZEA 4HZIA 3JASB 2WV9A 3DOUA 4QD3A 5I7SA 4RG8A 4F3KA 2WABA 4R1OA 1QV9A 1VI6A 1ARZA 1VMIA 1SZCA 3GELA 1OREA 1BGVA 2H06A 4S1VA 2RB5A 1NK5A 2FF3B 1SN7A 5FNVF 1TDJA 1J9ZA 1NGJA 2ZBRA 2XKBA 4EBBA 1GPWB 1Z9BA 4JU8A 1JR3D 4FK4A 3UENA 1P75A 1BEZA 3CA8A 4INOA 1L5GB 4E1BA 5JECA 3PO5A 2JEZA 3E84A 4YGXB 4DBZA 3D6JA 1IBLK 5H3HA 1NTRA 1S4MA 2W40A 1QVAA 4NFYA 3OC6A 1PK7A 3HR7A 2HW3A 4ZMSA 2CMFA 4X6LA 2OAP1 1KJNA 1JFFB 3WISA 2YHBA 3PXXA 4B6GA 5TMBA 3R7WA 3P0HA 1NJWA 4JQOA 5TQ2A 3ZBUA 1GL9B 3D6TB 1E4OA 4RTSA 4B0OA 4X7BA 4TYNA 2R00C 1SQKA 4NIMA 4RPCA 3HEMA 1JIXA 3OPXA 1JU4A 1UWCA 5LMCA 1T5HX 4NYIQ 4E0DA 1USUA 3GB9A 4GT1A 1RLOA 4IF4A 5AVKA 4DEXA 1ECLA 1NN1A 4YORA 5KDOA 2OILA 2Q3SA 4DSKA 2RHJA 4LF6B 1H1VA 3OIFA 4W4TA 1G5RA 3AARA 6REQA 2YH2A 4IIFA 4QDZA 4YCDA 2CVFA 2BT4A 2Q6LA 3KWIA 5E0KB 4AN4A 3K2EA 4PG7A 4RD3A 1GLEG 4UUAA 3KTDA 3HNPA 1S2OA 1SUIA 2BMVA 2XAAA 4DWJA 4EJSC 4KQMA 4KLNA 3SKVA 5K0CA 3HXKA 2J3MA 3PLRA 3QFRA 4K6FA 2Q8NA 3PXAA 2WOOA 2Q4DA 4FYYA 1OFTA 1ZK2A 2CWDA 1GZDA 3ENWA 3ZDBA 1X8JA 1I51A 3BGOS 3TDKA 1FLVA 4FIDA 2Q4OA 2NP6A 1N0VC 5C5CA 4JC8A 3L4IA 1CDOA 1QJCA 3BJEA 3V8NA 4M49A 4S12A 4I2QA 1R6VA 1O94C 2WMNB 1HM5A 3OS2A 4B3IA 1PJAA 4MPTA 5EL0A 3OZXA 421PA 4TYYA 3RT1A 2C4MA 2SHKA 2O0HA 4LRYA 3TDNA 3ILSA 4UPDA 4D8TA 2IP2A 3H1AA 3JQFA 1LWEA 3TLEA 1YITN 3IDSA 3KHKA 4PGFA 2QS9A 5JRJA 2P5OA 2CFIA 1IVNA 4PVCA 2HRZA 4GMGA 1QG0A 2RH9B 4AIRA 16PKA 3DGFC 4NS4A 1G20E 5DYWA 1IB6A 1M5UA 5F73A 1X7YA 1SQ0A 2DLNA 2ABWA 4UJ5A 1ZISA 3C7CB 4LZOA 1B8UA 4RKEA 2OHVA 3BPSA 1CZBA 3LV8A 4LJ5A 1LD3A 2BEUB 1N0IA 4FO0A 3OLQA 3RUEA 3LDOA 3WBKA 2OFWA 3UY4A 4JSYA 1JSLA 2UVPB 3F73A 4WTOA 3BMNA 2ZSJA 1XZDA 1KY3A 2AC2A 5GOTA 3EF3A 1Z8NA 1TZKA 3FCAA 4GVEA 4R71A 4F9GA 4L75A 3QWHA 2NZXA 1WV0A 1XQSC 1UBNA 1V5GA 1OH7A 1UC9A 3O84A 4AP9A 3ODGA 5EC8A 2QSJA 3AEXA 4U4AA 2PLFA 4Z4QA 5HQ3B 1VE7A 3T0IA 1JKMA 1K7FB 2BELA 3M6WA 2P6MA 4HNVA 1Y1RA 2XUFA 4QDKA 2OGUA 3Q11A 1HSZA 4M88A 3PZRA 3RHZA 3VHRA 4Z49A 2EQ5A 1XT6A 4KQKA 2VGNA 1P1JA 2PK3A 3YASA 1WQ3A 4RKFA 1SUQA 2PSFA 3RARA 1Z36A 4H0YB 3PEEA 1MA3A 2FJPA 4MQMA 2BFWA 4LFCB 2HNKA 2HJHA 3D31A 2VA9A 4BGUA 4CWAA 1U3DA 2AEMA 2VRCD 3ZHRA 1U7PA 2VPPA 3QELA 1CQIA 1E6KA 2XWSA 4DLUA 1YI0A 1O97D 4B84A 2XUOA 1T5BA 3A2NA 4LZWA 2C4VA 3JR7A 5K8IA 1ADFA 1KI8A 1Z06A 3EPPA 3MQ2A 1NNSA 1MO4A 3EXHC 3FYDA 3KJNA 5A04A 2FSJA 3T38A 3TRJA 2IPNA 3RRMA 2XZLA 3QX8A 2OANA 2G4VA 5T3YA 4P7JA 2HFJA 3V5NA 4DTSA 1ODCA 4LJKA 1Q7RA 5G4KA 5HKBA 4PYOA 4JP3A 3MUEA 4YECA 4DC0A 3IURA 4NB4A 5TGZA 1PUXA 5I4CA 3CF0A 5IJZA 1AKVA 5EZYB 3N07A 3UANA 1XMOB 1CRZA 2IZ1A 4EARA 4H1WA 1WEKA 5T8KC 2LIVA 3TSAA 2EFDB 2OFXA 4EAHD 2MYTA 4RVCA 3BDIA 1DQYA 3ZJTA 4KO1S 4HQNA 3ESQA 3WGHA 3PUWA 5AI8A 3V1LA 2QUAA 3WHIA 2Q0UA 5C8YF 3QB0A 4Y8VA 4OX9B 5B58T 1XJ0A 4N5MA 3BF1A 3IO5A 1V96A 2OA0A 3V4PB 2FK8A 1ZGZA 1HE8B 3VZCA 1NGDA 5F9FA 1V3TA 3CIPA 2IT1A 1MAWA 3H1VX 1ANKA 1E5TA 2C4UA 3QVUA 4DE5A 3TAEA 4WE3A 3GUZA 1Z4IA 2H8KA 1Q6YA 4JA0A 2YC2C 1W97L 2HX1A 5CVTA 3LCCA 3WLNA 3KYJB 1IIRA 2KW5A 2FTKE 3LCVB 2FX3A 3IA2A 2R66A 4YRZA 2VDKB 4JJEA 3E23A 4HTFA 3H1FA 5MDHA 8AT1A 4LF5B 4ZVTA 3WAKA 3MEDA 2NU8A 3STXA 3L8FA 4M87A 1EE2A 2VYVA 4XH9B 1JLAA 2ZUTA 2CF6A 3FAKA 5L9AA 4FN5A 1TAGA 2ZSBA 3O4FA 1XLWA 5FX2A 1BW9A 2PXXA 5HHTA 4LXIA 5F2KA 3ZS9A 4ED9A 4O0JA 3MEGA 3TARA 3VAYA 3I28A 2C5FA 4N0DA 4MTLA 1IUNA 1P9WA 4UATA 2G82A 3AB8A 3W5HA 4X60A 4C05A 3GFGA 3WICA 4EMBA 2E89A 5AJVB 3FMVA 4TLAA 4MNTA 5JS8A 2ZBEA 4TQUS 4QBTA 5JMPA 3ZY4A 3SZGA 8MHTA 1NQ5A 4US1R 1HTBA 3URMA 4HUQB 4OI1A 1GRVA 4RK6A 1WMSA 1JDZA 4A0QA 3LZDA 5CNIA 1UMDB 2GM9A 1XNRB 5C32A 2I9PA 5MHTA 3H6KA 2QWPA 2R3SA 5IBPA 4C5BA 1ILYA 4R51A 2HF9A 4K9SA 4BRKA 3L0OA 4IH1A 1XPOA 2WZQA 1B2LA 4IUBS 1IG0A 3KQLA 2CXUA 5EFOA 4I8IA 1TM2A 2P9QA 4YQYA 4OP3A 2FXIA 3SZOA 1QCCA 5TMPA 4N6OA 1VFNA 4D98A 2OK8A 5REQB 4XH4A 2AEJA 2PZLA 1F21A 2Y1DA 1X1SA 4P3XA 1GPUA 3ZSXA 4HQLA 3WIEA 2C5EA 3NRCA 4KSCA 1J39A 3AVYA 2XR1A 3GHYA 5EQFA 3SSNA 3JAWB 4EJMA 4HZGA 2F8SA 1N2EA 3DBIA 4CESA 1QGZA 2ZI4A 4MEJA 1UKVY 4J0QA 5TQ0B 3K0BA 2VP0A 2HHHK 3LPUA 1U9CA 2TMYA 2QW8A 5D7BA 5EJ9A 4NJEA 2CFRA 1SOWA 4OVKA 5JHHB 3RBXA 1MQAA 2I7DA 1Y7TA 1MJGA 4DTIA 4Y9TA 2IHBA 1S2MA 3W7AA 4F8JA 2B8WA 3EHDA 1I3KA 3QVTA 1PIWA 2XODA 2IH2A 1QB8A 1OLXA 2BC9A 3A4LA 4ETIA 2BEVB 2BP7B 3D8UA 4YMHA 1S6QA 1FKOA 1KLMA 3K09C 4XI9A 3FPAA 3MWFA 5KQRA 1VMEA 2HB5A 3F3KA 2H4YA 1WSFA 3FJYA 3DE2X 4X24A 4BACA 1O03A 1RBQA 4MS3B 1L7OA 2F3QA 4OQQA 1ORVA 2IX9A 1C30A 3WA7A 2B7LA 1C9EA 4Z9AA 1PLLA 4HNUA 4UUOA 1NR5A 2I3DA 2BBSA 1V11A 5KIAA 1RRFA 5C81A 1EINA 2M6KA 3OTOK 1KEZA 2O19A 3BK2A 4WY2A 4C7KA 4D42A 3WMGA 1GDHA 3AF6A 2JA1A 4RXMA 1AK2A 3UMVA 3IP8A 1E3LA 2FGKA 2ZYHA 1E4EB 3R9PA