4IEIA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with adp
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
461
structure length
449
Chain Sequence
b'NPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
molecule tags Viral protein
total genus 162
structure length 449
sequence length 461
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ieiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ieiA01
2P6UA 1R8QA 3T1QA 2FOLA 1BYIA 2JLSA 4LV6A 4QHTA 1N0WA 4XWAA 3UK6A 5FFMA 1UKVY 5CLLA 4DBLC 1KAGA 3RSOA 1I2MA 4JSYA 5P21A 2ONJA 3LQQA 1U0JA 2YWHA 1PV4A 1OIXA 1GM5A 2ZE6A 1P7CA 2EFGA 4MRPA 4ESHA 2P6RA 2WMOB 3FHTA 4Q47A 3J81k 1WDTA 1OB5A 2X2EA 1XRJA 3W8NA 2DWQA 3MMPA 4ZDKA 1OSNA 3TQCA 1DAFA 2A5GA 1LS1A 3VR4A 1A82A 4DSNA 2QUZA 1JXMA 4B3XA 1EWQA 2IK8A 2BMDA 1ZNZA 1VYTA 3X1WA 1S3GA 1KJWA 3AP2A 5DI3A 1KK3A 1E2IA 5FI0B 1XFAA 4XWKA 4LJ6A 2NTYC 1AA9A 3ZLJA 1E96A 3DKPA 1UKZA 1E2DA 1G6HA 2ZEJA 4FW9A 3R7WB 1NVVQ 2DCUA 1F6BA 4IXMA 4V0LA 1XXHA 2WAYA 1Z6AA 1ZC4A 4URWR 4PO8A 2R8RA 5AJZA 1BYUA 2CLDX 5FBQB 4H1VA 1YJ5A 3CRQA 4PHFA 2BEJA 4LV5B 4LBYA 1FTNA 4QOSA 2AWNA 3VU9A 4EIWA 1I4DD 1JECA 2VSXA 4MGIR 5M04A 3T5DA 4TN1A 3P32A 2W2VA 1Z5ZA 5B57C 3BB1A 3MCAA 3RNLA 4ILEA 4TLBA 4D81A 1CEEA 5IK2A 2PCLA 2KE5A 4PFSA 1HQCA 3L0SA 3RRZA 1VDZA 4NZYA 4OJKA 2A5DA 3PEUA 3W8RA 2P5SA 3EARA 1C1YA 2O0HA 3U5ZB 5C46F 1PUJA 4QJ5A 2H7VA 1D8TA 1SXJA 1EX6A 1W5TA 2IUSA 4JL6A 1B0UA 4ASUA 1XWIA 2ZXUA 3OESA 2P5TB 121PA 2W2TA 3OEHD 3LV8A 4AC9A 1RVDA 1I4LD 2WZQA 1U0HC 2GXQA 4Q4AA 2VPPA 4RJLA 3CONA 2FX3A 2FH5B 3I1FA 3OAAA 5K8UA 2ZR0A 4M2LA 1CJVC 1DO2A 4LY6A 2G3YA 4BE7B 3DM5A 1CR4A 2YYZA 1HTWA 1Z8FA 3IKJA 4GDFA 4POAA 4QGAA 5J4YA 4WW0A 4MKFA 1US8A 3NC0C 2BBWA 2PCJA 1GSIA 1Z06A 4XVRA 3LRPA 1FP6A 1O3YA 1OXXK 1QHIA 4F4JA 1NN5A 2CL7X 2ZI6A 5BN3A 4AKGA 2CLCX 2ZYTX 2NOAA 3QJYA 4CEHB 2NG1A 4C0HA 3EC2A 1LFDB 4C7OB 3MFYA 1YR9A 2G1JA 2GCNA 4UQOA 3T61A 4OYHA 4D0LB 2JLWA 5TMPA 3B60A 5BN4A 1ESMA 2RGNA 1XF9A 3VFDA 2X77A 4IVPA 2BEKA 5EUQB 2OLKA 1E4VA 4F7WA 4DC9A 1SVOA 2DFTA 2YJTD 5C2FA 2GXSA 3KKPA 2ZJAA 3W90A 3KQNA 1N25A 3WP0A 3JVVA 2YZ2A 1RYHA 3AKCA 2ORWA 1KI2A 1MOZA 1U9IA 3RWOA 3WYAA 3SZRA 1W7AA 4MH0R 3EZ9A 1KZ7B 4O25A 8OHMA 2VHCA 2J1LA 1OFUX 4HLDA 4PX9A 3EZ7A 3SU8A 1Z29A 5EXXA 5F9HA 4EUNA 1E3MA 5C15A 1L4UA 4GMXA 4PC2A 5E7IA 1G1MA 5AJYA 4FN5A 2PJRA 1W36D 2AD5A 3BFVA 2E87A 4NYMQ 4OQLA 3EA0A 4TSFD 2I3BA 5AWFC 3QXXA 2FPMA 4NYJQ 4PO1A 1UJ2A 1XD8A 1PLLA 1TQ6A 3NBYC 2B7BA 4OI4A 3OZXA 1F2TA 3QXSA 1E99A 1CR1A 1SXJC 3VNUA 1E2NA 2CK3A 1E9AA 3AUXA 3BH6A 4B71A 4HATA 1UBCA 3EWAA 3DZDA 2OLJA 3HU1A 2VLIA 1GRQA 1VPLA 2JATA 2PMDA 2Q21A 4B73A 1P72A 2DHRA 3OIUA 1FMJA 1LS6A 1P4SA 4URUR 3GLIE 3OHMA 3OIYA 4MDFA 3TK1A 1E0SA 2W6JD 3F5FA 2WOOA 4L15A 3P1JA 2P67A 1GVNB 3AKDA 4KFSA 1QG2A 2XEXA 4IOLA 1R0YA 5KU1A 4WXRA 1XU4A 1T8UA 3I5XA 1VECA 4HI0E 2IW3A 1X8KA 4RD0A 5CM9C 2NO0A 2ZETA 4KV9A 3EIQA 1RW4A 1OYWA 5DYIA 2ZR9A 2QTVB 4IVQA 1S2MA 1K5DA 3FMFA 3GJ8A 3GLHE 1X6VA 4DSOA 1AGRA 2JJ8A 5M1NA 4M21A 1SHKA 4S2EA 4BFSA 1JJ7A 4PPQA 3B85A 2C8VA 4JVMA 1VG1A 1W0JA 4FMCB 4CDGA 1TQ2A 2JLXA 4AK9A 1G64A 2OAP1 4C0AC 4NCIA 3K0CA 3KTAB 4BFVA 4Q4LA 4Y0VA 4G5SA 4B6FA 4DSTA 2IYYA 2RGNC 4YXWA 1ZCBA 1QVRA 3CPJB 4Q1AA 4Q9JA 3HWSA 1NG9A 2GCOA 3PR1A 1ZP6A 5CM8B 3QEJA 3KXKA 4NH0A 2ZSAA 5C18A 4IOJA 4LJ4A 2BM1A 4W5HA 2CJWB 3RHFA 1U9IC 3A8TA 3NWJA 1AN0A 3WRYC 3F3YA 4TT3A 3EC1A 3THXB 3FFBA 1S0UA 2DBYA 1E2HA 2C04A 3WMGA 4CF7A 4II7A 4PSVA 3PXGA 2H5EA 1ZC3A 4QBHA 4KVGA 1RKBA 4MITA 4ZV4A 3GJ0A 4XJXA 4PQRA 4DWJA 3CO5A 3EPLA 1KHTA 2GNOA 1W36C 1CP2A 1P75A 4HZUA 2G6BA 2PZFA 4Y0AA 5DGXA 5JMTA 4D2IA 3AVYA 2K5UA 2IYVA 3ZVRA 1TAGA 3BH0A 5IHPA 5J4LA 2WOJA 1XCMA 3ZVLA 4M8NE 5FPHA 5HKKA 5HPYB 1W5SA 1Z2AA 2OXCA 4TLAA 3AH8A 5EE9A 3Q7QA 4JKIA 2GA8A 2JJ1A 1T9HA 2N1BA 2GTPA 4EJSC 5DIFA 5FTNA 3VR2A 3FMPB 3K09A 5HCIA 3ZYCA 2ZSEA 2J41A 1Z3IX 4MDEA 2GJ9A 4HB0A 2B7CA 4BFZA 3ZVNA 5JSZB 1U8YA 1NY5A 3U4QA 2KB0A 4FCVA 3QXCA 1KI1A 3U44A 2ZSBA 3AVQA 4OI0A 1EWRA 5HZKA 1GFIA 3EASA 3AF1A 1ZAKA 5BWMA 1ZVQA 2HDNB 4DSUA 2H92A 4CT5A 3U2QA 2O8FA 3IO3A 2ZI9A 1YZTA 4ARZB 4HB2A 2XXAA 2DR3A 1AQYA 3L82B 4ZCLA 3OFND 2VO1A 3ADCA 2BCJQ 2WWHA 2W6IA 5GVRA 2BOVA 4LUCA 4OQMA 1G5TA 2OCBA 1E1QD 3U61B 3LVRE 2GJSA 3LO5A 4JYCA 4KLZA 4ZPXA 4GL2A 1IXZA 721PA 3JZAA 1NNEA 3W34A 3LBNA 2R6FA 3K0CC 4Z1MA 4OHZA 1Q12A 1T8TA 3BRWD 5GADl 5FOVA 1U94A 1UADA 3MJRA 3R8FA 2D4HA 2G1KA 1K5GA 1ZRHA 3SHFA 5FPTA 3FOZA 3RC8A 2GAOA 2NO1A 1NIPA 1OB2A 2AK3A 2R44A 4GP7A 1QHNA 2QT1A 3B7GA 2ODWA 2QSYA 1SKYE 3CPHA 1W1WA 3M1IA 3T1TA 1CULC 2IA5A 2OZEA 4K81B 4UXHA 2VHUA 1IOZA 3I4LA 1VG9B 5KSOA 1W36B 1OHHD 3LX5A 5AJWA 4A92A 1T5LA 5LBIA 2N46A 3I8XA 2FU5C 3SN6A 5TARA 1NG1A 2F9LA 4ZCMA 1IN7A 4BGDA 3B9QA 2J0UB 2QEQA 2WIBA 3NBZC 3WP1B 4EFMA 5UKDA 3SS8A 3GD7A 1Q1BA 3WMFA 4YDSA 1S9DA 4MQBA 1A1VA 4EJSB 4PQYA 2C9CA 2DFNA 2BJWA 4B3CA 1G8GA 1GUAA 1YVDA 4A15A 2BVNA 4M1TA 1JEEA 4AY2A 4OK5A 5CJ2A 4ZIRA 3CM0A 4XH9B 4JBXA 2GRJA 1YZNA 4UJ3A 4HAVA 3K09C 1G5PA 1VHLA 2VIIA 5FL7D 3I32A 3OEEA 3LX8A 4N3NA 4H1UA 4PC7A 4EQ6A 1T0JB 4B3BA 5HTKA 3QBTA 1QHXA 2OCPA 1ZM4A 2ZRHA 3AF3A 4RY2A 2FE4A 5EP1A 4A36A 5E3HA 1KJZA 4RFSB 4C0JA 1CJKC 3QF4A 3Q9LA 1G8PA 3QG5A 5TVKA 5AUQA 1HT2E 4HAYA 3O8BA 4CVNA 3U7EB 3RRNA 2IXGA 4KXFB 2FFQA 2JJ2D 4JSTA 4Q4JB 4WVFA 3IBYA 5JRJA 3CUEF 1COWD 1Z0KA 4Z54A 1KTVA 1E9BA 3ZJYA 1JEDA 4GI7A 4D4KA 4MYHA 1F5NA 2PL3A 4C0LA 4D4MA 1T3SA 3KQKA 1S3SA 3PENA 4Q00A 3CB4A 2A2ZA 3B6EA 2WPDA 4DZZA 2CBZA 2GZAA 2RH5A 1U8ZA 1Q21A 4LRWA 5KHOC 4A0HA 3M0EA 4KSBA 1P5ZB 2EFCB 1H8HA 2GEVA 2OT3B 3W5JA 1TPZA 3U3KA 3GLIB 3MJHA 5JWHA 2L0XA 3OE7A 1R2QA 2IT1A 4Q5IA 1XTJA 2QMHA 5J5CA 1Z6GA 3Q85A 1QHHB 1XP8A 3KFVA 2DY1A 4TL9A 3THWB 2NMVA 2BJVA 4Q21A 2ZREA 3C41J 3ZGXA 3RC3A 1Y3AA 1KNXA 4Q1BA 5L3VA 1TU4A 1OLOA 3I62A 5F2EA 1W2GA 2BBTA 1AS0A 1DO0A 2FFBA 2QORA 1TUIA 3QPVA 2UVQA 4GZMA 4RD3A 4M1WA 4JT4A 3TVTA 2ZJ8A 3R7WA 1B23P 4Q7MB 3KKOA 2FEMA 4D0GA 2GWHA 4TMZA 2GCPA 5KSZA 2BCGY 4P4UA 3C15C 4OQFA 1CKEA 3KJEA 3THYB 4YMWA 2OILA 4PQFA 3UATA 1FNNA 2FSIA 3EPHA 4WIAA 4B3FX 2H57A 3Q7PA 5ANRB 5BN5A 1LTQA 2FSGA 2QI9C 1G3QA 4M9SA 3CNLA 1W47A 1MO6A 2FF7A 5EE5B 4R9UC 1IN4A 2V7QA 2QE7D 3W6PA 4KFTA 1CR0A 1MH1A 4I81A 4A8JC 2EFHB 3PVSA 3WYFA 1UPTA 1BH2A 1OH8A 2ZI7A 4TLDA 4ACAA 2Q3MA 2A5YB 3R9IA 2NZJA 1KSGA 1Z2CA 1GAJA 1P9WA 2XNDA 3CLVA 3FE2A 2G9NA 3KJIA 3N70A 3V4FA 1V43A 4EPTA 1G3UA 5GJWC 4KAXA 4Q7KA 2ZTSA 4MRSA 4M0LA 2IYWA 3ADBA 3AF4A 3NH9A 5AUOB 3U7HB 1QF9A 3MD0A 1OH5A 4JZKA 1WE2A 1Z0AA 2AFIE 1YRAA 3CX6A 3NHBA 3ZZ0A 3AVPA 2MSDB 1WA5A 4UNQA 1NLZA 4ZKEA 4PO9A 2AKYA 4TQAA 1H8ED 3CWZA 2IUTA 3QXHA 4L8GA 2R6CA 4AD8A 1NL3A 2OBLA 1E1RD 1T0HB 2EU8A 3LVQE 2EQBA 1IM2A 4IOMA 4QBIA 1AIPA 2IF0A 1RPZA 1GNQA 2BV3A 2XJ4A 3CWQA 4N0EA 5KOYA 3F0TA 3LLUA 1OXVA 3U3RA 4CEHA 1Z6XA 4NCHA 3FKQA 4C7OA 1OKKD 2ZYVX 4L4UA 2Q9CA 2WVJA 4NE2A 1AKEA 1N6KA 5FBWB 2WKPA 5JZVA 1Z6YA 1N6NA 1U8AA 3PJRA 2IYSA 2AWOA 2ZRNA 5CK4A 2HCBA 1XEXB 3W5IA 2QMUA 4LDJA 3SYLA 3VQTA 2P3SA 3IQXA 2MSEB 1BIFA 1E9FA 5IDVA 5JJIA 2CVHA 3UWOA 1J8MF 2VP9A 1YZKA 2MMGA 1XPUA 2PEYA 4G5OA 3IUYA 2CNWD 2ORVA 1V5WA 4M1OA 3NKVA 2O8EB 3UIEA 1G5RA 2HLDD 5B30A 4G1UC 1S4QA 2GETA 4V0ME 1FQKA 2IYLD 2ZS8A 1DBSA 4JLJA 1KSHA 2IHYA 4BZPA 4ABYA 3FGNA 5KDLA 1AM4D 3GEEA 3KKQA 3X1YA 4D0NA 2F7SA 5IF9A 3ADDA 2IXFA 1DG3A 5FBRB 4A8JB 1E2FA 1ONBA 2REOA 3RAPR 4NONA 3T1OA 2IBMA 1VG0B 2DWPA 4Q7JB 3MUFA 3VX3A 1ODFA 1SKYB 5AJVB 5DHFA 3RYTC 1CJUC 1KYIA 2O0JA 5FPYA 3LAWA 4DCSA 3L43A 3W3ZB 4C0BA 3ZD6A 5EE3A 5A5GA 1U81A 3BAFA 4DCVA 1IQPA 1SGWA 1RJ9B 1IY0A 2AXNA 2BBOA 3TKLA 3TQFA 3ZZTA 4Q9IA 2A7QA 1KI4A 3PV0A 2ATVA 4O2LA 5CIQA 3K1JA 2ZU0C 3MLEA 4P31A 2J0QA 4HDQB 4C4PA 1N0VC 3HYRA 2RGBA 1NJGA 1R0XA 4M1SA 4K46A 2A5FA 4I99A 1L2TA 3D3QA 4YC7A 2V6IA 2P0EA 2NO9A 4OQNA 1W44A 3EPJA 4RD4A 3QY0A 3SR0A 4B44A 2RGXA 4L16A 1WBDA 5C1BA 3FFAA 3QNUA 1JQJC 3MWLA 4Q03A 5DE3A 1Q3HA 3RDPA 3ICEA 3D31A 4DJTA 3BBPA 5M1PA 4FCWA 1NBME 3H1TA 1DPFA 3NEYA 1VYUA 3THOA 3TW8B 4G3XA 1W2HA 5FOSA 3ZVMA 2FZ4A 4LJ5A 2UKDA 4MUAA 1OYYA 2NGRA 4N1AA 5H70A 3HPQA 1Z0DA 4AKEA 3C4JA 4JT2A 4TL6A 4JL8A 1R5NA 3T06B 4V0OA 1ZBDA 3KTAA 3C5HA 5EP4A 4GOXA 1U0LA 2Y8EA 4Z8XA 1KO5A 4IFBA 2IYRA 1FZQA 4RZ3A 3RWMB 5H8WA 4CYMA 3RS5A 2FEOA 4LYFA 2E1RA 2IS1A 1OPXA 2R6GA 1TF2A 1NIJA 3PITA 4WBSA 1Q0UA 3ICQB 5KO2A 3BB4A 4LOAA 2CJWA 2C77A 2ZM5A 3B9PA 4LYHA 4JS0A 3H4MA 4P4SB 4A4DA 1IJFA 3V9PA 3N2IA 4TWZA 4PPFA 1TX4B 5SZJA 2QQEA 3THXA 2ZE7A 4B47A 1YU9A 2BDTA 3UANA 4K8OA 4M4SA 1G16A 2D3WA 4TTRA 4Q9HA 2PZGA 3SJCA 5C12A 4XTRA 5L3SB 1VTKA 4I1UA 1OXTA 1UBFA 3H2YA 4NCNA 2BKUA 2LWIA 5AUPB 1NBMD 2O8BB 1M1YE 3AF0A 4PPGA 4IVRA 1HURA 1WXQA 1SVWA 2ZRLA 4JLOA 2YOHA 1Q1EA 5LDDC 4FWTA 5LB4A 4NHOA 3KUDA 2VBCA 3PCRB 3O8DA 3VNVA 5M1FA 4CRWB 1RFLA 5HZHA 5KNBA 2FFHA 1JR3E 4TMTA 3OEHA 1S96A 4NCKA 3SFZA 4Z8YA 1AZTA 2Z0MA 1JXOA 2OCAA 1OT3A 1CJTC 1WP9A 3LBHA 3GP8A 3KKMA 4WZBE 5JSZA 2J45A 3NIBA 2YVUA 3SYNA 2OO7A 3QOFA 2FGKA 3SE0A 2YC2C 2YHSA 3QKSB 5FOTA 5KUTA 5TY0A 2R65A 1J8YF 4AYTA 3DMDA 4TL8A 1U2RA 2G0NA 3MG9A 1HEIA 3MGCA 4YQFA 3K9LA 2IHBA 2ZAMA 4A1FA 4ARZA 4OHVA 1N2CE 4B3DA 3BK7A 2FMXA 2FV8A 3U6BA 3CIOA 2FPKA 5FOXA 1P2SA 3TR5A 1GRNA 3K0FB 3L0OA 2QGNA 5LB2A 5HR5A 3Q5DA 3EX7C 4QGHA 2C98A 1PJRA 4NDZA 4NL4H 2XSZD 1JR3D 4OQXA 2CHGA 3T5GA 4D80A 4D6PA 4RSGA 1DAIA 1E4YA 1KSFX 4B74A 1NN0A 2QNRA 1IJEA 3P26A 3T1VA 1OFHA 4RCZA 3RS7A 3QKRB 3FDIA 4NPHA 4BUJA 2HT1A 5SZHB 3KQUA 1M8PA 1Z0JA 3U60B 3CBQA 1MR3F 2QAGB 3WHKA 1U99A 1II8B 1WQ1R 1T3LA 3NHAA 1A7JA 4LX0A 4O2RA 5CDFE 4CEIB 1N3BA 3IEVA 1BMFD 2O0KA 2WHXA 4P32A 1A2KC 4HSEA 4TSFA 4X8HA 3UG7A 4EPYA 3QPWA 3LNCA 4TZ6A 3HU3A 1UAAA 2J0UA 3E5HA 1NMXA 5L3QB 1HV8A 2ZE8A 2F1IA 2Z6VA 2GBLC 4KYIB 4FCTA 5CITA 2B8TA 2JAQA 1DARA 4PAQA 4RCYA 1KDOA 1YRBA 2ONKA 3I61A 2Q3FA 2IEYA 1ZNWA 5E7JA 4EJSA 1AJEA 5BYKA 1G9XA 1J99A 2XNSA 1XZQA 5DHAA 1ZU4A 3ND9A 2SHKA 2O8CB 3QIAA 2XGJA 4ZI2A 1ANKA 2CLSA 1P60A 4PR0A 5DO9A 3BIFA 3IEUA 4PPNA 4MKHA 5D3MB 3WNBA 3KQHA 3EZ6A 1T3HA 2VHQA 1Q22A 5CIWA 1LB1B 4PXAA 1G41A 4AI6A 2W6JA 2V55B 2J0SA 3CNNA 4U00A 4JVSB 2KJQA 4Q18A 4RFSA 4Q1EA 3VTKA 4B2PA 2WJJA 3CR7A 1RRGA 2VA8A 4BECA 4KFRA 4KCGA 2AHOA 3RS3A 4H9GA 5JS8A 4LPKA 5JHHB 1N6RA 1G7TA 1IAQA 3ASZA 1FMLA 3NVAA 3QENA 2OFXA 3H86A 4BLOA 4C0SA 2VP4A 2PZEA 4HLQB 1G291 1RE0A 1TEVA 2HT6A 4MKIA 1RIFA 1XEWY 4Q4JA 2FJUA 3NH6A 4LC1A 1C4OA 4OHXA 4AG6A 3LWNA 4IOKA 1IXRC 3CH5A 2D62A 1GP2A 2GK6A 4EFNA 3DPUA 1NSFA 5JCZA 2Q3HA 5DYGA 3B1WA 5JWOA 3PQCA 3M4YA 5G40A 1Q3TA 1XEWX 3K0AB 4LJ7A 2BMEA 4E07A 1NVWQ 1P9NA 1YZGA 2ZROA 2C78A 3BB3A 2OFWA 4UNSA 2IYXA 3QUSA 3IO5A 1QZXA 3P20A 4QGGA 4JLDA 4EFLA 4XTCS 5DI3B 3GLIA 3BE4A 1E2MA 1E69A 2WWGA 1QRAA 1QHHA 3THWA 4NTZA 3EZ2A 4TYPA 4JLMA 1SQ5A 2QPOA 5FOUA 4AKIA 1G6OA 2ZR7A 1XJCA 1RRCA 2JLRA 3LW7A 2ZVQX 4IDOA 2VHJA 2D74A 4FINA 3Q5EA 4DRZA 2X19A 4B32A 4URXR 1XTIA 1TL7C 3WBJA 1MT0A 2OXRA 2HV8A 2QMEA 1QBKC 4E22A 5JHGB 2WJHA 2ZRBA 6Q21A 3C6AA 421PA 2QAJA 4GBMA 4LJ9A 2QU8A 3VHXA 2LKDA 3THYA 2W58A 2BMFA 1E2JA 2UZ3A 2NQ2C 1PVOA 1MO4A 4URVR 1H65A 2AFHE 1GNPA 2V9PA 3HYTA 2F3TA 3UMRA 3LH5A 5JCPA 1Y63A 1F60A 3BH7A 5SZKB 2IYZA 3I8SA 3W6NA 3UG6A 2RCNA 5BYJA 3GLFA 3K9HA 4GMDA 3KQLA 5FBVB 2I1QA 2FG5A 3TSWA 4LWZA 1DS6A 1E9RA 4PAMA 2GHIA 1UDWA 4XSHA 1E0AA 3WBKA 3BOSA 1IHUA 2PMKA 3FMOB 4GNKA 4QHYA 4R7ZA 3GJ6A 2V3CC 5EP2A 1S1CA 1S8FA 3EAQA 5J40A 2J7PD 2DFLA 2ZYUX 5FH9A 4QJ4A 1TUEA 1ZW6A 2FSHA 3EPKA 2JLUA 5AR1A 1F2UB 3X2SA 5CB8A 4UNRA 2F1RA 3OFNA 5E7MA 2RB4A 1MRSA 3JZMA 4NYIR 5SZIA 2GXUA 2CCKA 1FP7A 2HXYA 1E1QA 1EFHA 2QP4A 3K0EA 3QEOA 3RANA 1G3IA 2RKOA 3GLGE 1GIAA 4WOPA 3DEFA 4RZUA 2XITA 2JLYA 1BS1A 3A36A 4DCUA 4PC6A 3DM9B 1CIPA 3D6TB 2E9SA 2ZI5A 4IDHA 2CL6X 3CF2A 2QBYB 2VL7A 521PA 4EPXA 1CRQA 5CJPA 3EWSA 1KY3A 2FNAA 1F3OA 3BFXA 1HE8B 1JB1A 2ERYA 3KL4A 3AB3A 2XZLA 1EG7A 5EQTA 2F1JA 5JI3E 4ACBA 1KO1A 1OW3B 1R5BA 1E2GA 2QP9X 3NEJA 4R71A 2VP5A 2O8DB 1GL9B 3EIEA 2GVZC 5EZ6B 4QBGB 2ZI4A 1FOEB 4PC1A 5FBLB 1QDEA 1O87A 1E0KA 2GF0A 1OHHA 2WJGA 1R6BX 4I4LA 4PANA 4XWOA 2XXAB 4CW7A 1GKUB 4LJYA 2OESA 1OIWA 4TZ0A 1XEXA 4HB3A 4US2R 2IXEA 2RHDA 3U6KA 2WWWA 5IT5A 3T34A 2J3EA 5HE8A 5A4JA 2GDJA 2AKAB 4PHHA 4Q4HB 1AGPA 1YZLA 4KODA 4KBFA 4LHYA 3UXMA 3FTQA 2O8EA 3VKGA 821PA 5B64A 1GITA 1E94E 2ZSDA 4TQUS 2PEZA 5FOWA 4JYBA 5DNYB 1YKSA 5TXGA 2J9RA 3AM1A 2WAXA 2VRWA 2ZRJA 3P4XA 1DAKA 3PFIA 4XD7D 2QA5A 5JEEA 3ETLA 4L5BA 4QL3A 4B33A 2JIZD 5FR1A 2VP0A 4JVLA 1MO3A 1GILA 1FX0A 4EPWA 5FL7A 1XJQA 1L8QA 4LC0A 4A8JA 2REBA 3RS4A 4TTQA 4LJAA 1YR7A 4JJZA 4JKYA 3CPEA 2CCJA 2JDID 2B92A 4NBSA 5J4VA 3P27A 3TNFA 4W9MC 1CRPA 4B34A 3NDBB 3QF7A 2GK7A 3L8ZA 2A5JA 2FDCA 2QTFA 1AZSC 4DUGD 3DDCA 2BKEA 1FNMA 2WICA 1GZSA 2DB3A 4XVUA 2JJ2A 1GL6A 4I1OA 1JR6A 2VSOA 1JI0A 1RJ9A 4RD2A 3S1AB 1COWA 3CRW1 4NP6A 4JBYA 3PIRA 1UBEA 1KI7A 1J2JA 4A2PA 3A58B 3SQWA 1SULA 4JLPA 1AKYA 2F6RA 2J0VA 1DG1G 3T35A 1P2TA 1KKMA 1KDTA 1PLKA 3C6HA 3WY9A 3FKSD 5HE9A 3T15A 4ESVA 3AVUA 5G3YA 1NVVR 4DT1B 3ADKA 2JEOA 3AKYA 4QNRA 5E95A 1E79D 4G0NA 3PEWA 5DLQC 3SOPA 1UF9A 3TAHA 3P4YA 4WA7A 1F48A 4DIDA 1KI8A 5FTKA 4MRVA 4KJZA 1NN3A 2F43B 1N5IA 3TW4A 3ND8A 4AYXA 5B58C 4GZLA 2ZUDA 5F3WB 1ZD9A 5AJXA 4QJ3A 1IXSB 1E9DA 1S1MA 1G20E 1TQ4A 4G5RA 1RC8A 1CU1A 2HEIA 1Z0IA 2KSQA 2MMCA 3AF2A 3E1SA 1LVGA 5DN6D 1JALA 3GJ3A 4A6XA 4YLGA 1KAOA 2ZANA 3GLHB 3QXJA 3HP1A 1LNZA 4BFXA 1SHZA 4V03A 5M1OA 4Q19A 3ZIAD 3EXAA 4BZXA 4ZDJA 1IN5A 1W0KD 1KI3A 1MO5A 3VMFA 1GRRA 3I72A 3PEVA 2YWGA 1VG8A 4P4SA 3CW2A 3QKUA 2WBLC 1P9RA 2ZJ2A 3TMKA 1KY2A 1AS2A 4B6EA 2FPLA 2G77B 4IJMA 5TV2A 3TH5A 3FHCB 3DOFA 5JI2E 3KJGA 5EE0A 1OJLA 4DIEA 5L3SA 1P73A 1SZPA 1XD2B 4JL5A 4EDHA 2QE7A 4QHSA 4F91B 3SJZA 2IS6A 4CEJB 4M9QA 4Q1DA 2Z4SA 3HJNA 4PC3A 5L8VA 3EZFA 2O8BA 2ZS7A 4ZI3A 3AV0B 1JAIA 4JLVA 2XAUA 3PUZA 3IILA 5F9FA 1EFRD 4HZIA 1FQJA 2HYIC 1N6HA 5G3ZA 2VF8A 4JLKA 4X8LA 4ZO4A 4IEIA 2RGCA 4ITRC 5DISB 2WIAA 3AP1A 4IFEA 3CF6R 1K6MA 2V6JA 621PA 4FWIB 2V1UA 3ZH9B 4BLQA 2XB2A 5KDOA 2WJVA 4D26A 4WZAE 3TIFA 3GEHA 3REFA 4FXPA 1ZM3A 3BD9A 1LW7A 4D25A 1G7CA 2YNMA 3ASYA 4Q66C 1HY3A 1EFTA 3QKSA 1XPOA 1XMIA 1H8EA 1CTQA 2HF9A 3BJIC 1AS3A 2LKCA 3MSXA 2XOKD 4P3YA 2TMKA 2BC9A 1E1RA 4RZ2A 2Z83A 1ZUIA 1CR2A 2PBRA 1E2QA 2YC4C 2J7KA 3B82A 3BXZA 4D82A 1XTKA 2Z4RA 5EP3A 4HAXA 3DKVA 4JIMA 2ODNA 1R8SA 3OIVA 4HAUA 3B1XA 1P61B 2KWIA 3MAAC 4JJKA 5K8IA 3GFTA 2ZQ5A 2EWVA 4F38A 2ZJYA 1M6NA 2F55A 1ZYUA 1D5CA 1KDPA 5C2JB 2OG2A 4Q9LA 1CBUA 1ZM9A 2X8AA 4XIGS 1LF5A 1EK0A 3BGWA 1OXUA 3K0FA 1OKKA 4KBGA 2A9KA 2CE7A 1IN6A 1MKYA 2BIFA 3FVQA 4ZDIA 4NYMR 3IIMA 3QG1A 5FTMA 1L4YA 221PA 4NYJR 2VTKA 3LD9A 4A0GA 3DVLA 4QXAA 2JLZA 2XZOA 4CZ2A 2PLFA 1ZM7A 4LHWA 1S9HA 3QKRA 2CNWA 4B2IA 4BFTA 4UXIA 4Q9KA 3TRFA 3GPLA 3GLGB 4MYTA 1JPJA 4I1SA 3TBKA 2HLDA 3IHLA 3B1VA 1SVSA 2REXB 4US0R 1BOFA 2NZ8A 2QAGA 1OH7A 1KSJA 2QY9A 1II8A 4A0FA 1HYQA 3TVDA 5KNDA 3GFOA 2R2AA 3NG1A 4CEIA 2CE2X 1CS4C 4OBEA 3D8BA 3IBGA 5TDHA 1E2LA 2OM2A 1XMJA 4CGZA 4DLXA 4KU4A 1JNYA 2FWRA 2AL7A 3B78A 1G7SA 4RD1A 4C2UA 5L3QA 3RRMA 1YR8A 4BQSA 1CXZA 3C8UA 2WSSD 3SQXA 4RFVA 3GQBA 1CLUA 2YINC 4LHXA 1ZNXA 4C3ZA 2D06A 1Z83A 2O8CA 1G4UR 1HUQA 3ZZUA 2Q6TA 4RKEA 2XJ9A 1A2BA 1E0JA 5D3MA 3SBEA 2XZPA 1GTVA 3RSLA 2G0TA 3AVTA 1FL9A 2QENA 3PUWA 1Z6TA 1U98A 4V0KA 3SBDA 4PAOA 4V0MA 2IYUA 4DCNA 3VR1A 2EW1A 1XXHE 2ZUCA 4C0QC 4PZYA 4IW3B 2QRNA 4DLYA 5JJLA 3AQ4A 1BKDR 1I2DA 5K8TA 1N5KA 4IDPA 1E2KA 2IF2A 4TYQA 4XVQA 2OV2A 4A82A 2PH1A 4GRAA 4LZZA 3K70D 3I5YA 1NP6A 2NPFA 2GAAA 4FMBB 4LBZA 5C2DA 2WSMA 2HF8A 2ZRFA 5FTLA 5H68A 3UKDA 1OFIA 3LXXA 2GF9A 1X3SA 4YONB 4DLTA 1Q20A 2WWIA 2JLVA 2YV5A 4W7SA 4ZDWA 2ATXA 4UXJA 4MKGA 2JCSA 3K0AA 2H8KA 3TAUA 2X2FA 4KFUA 3A4LA 3CR8A 3X1ZA 3CZQA 2CCGA 2EVWX 3E70C 4Q02A 2Z43A 1SXJE 3LDAA 2VP2A 4QGFA 1KNQA 3WHLA 3IPXA 4PHGA 3RS0A 3AGPA 5CYOA 2JLQA 4OL0A 2W0MA 3WRXC 1KI9A 3GEIA 2QN6A 1RZ3A 2D2EA 2QPAA 1KI6B 3K0SA 1W4CA 3A1WA 4O3MA 2IYQA 4CT4B 1R4AA 2QAGC 2IC5A 4G01B 1VMAA 1VKJA 2ZIAA 3Q72A 4HUQB 1N6OA 1DAMA 1EFUA 2A3RA 5KSPA 3SFVA 2ZJZA 4UKDA 4TL7A 4B48A 4D4LA 2A78A 1WF3A 2VHTA 3CX8A 3CRVA 4L9WA 5GJVC 4BEJA 3I92A 4PSKA 1XZPA 1Z08A 3KZ1E 4GOJA 1NBMA 2GBLA 1D2EA 3TGPA 3Q3JB 4NMMA 4P0TA 3VR6A 4OJQA 3VR3A 3QKTA 2OUKA 1OIVA 3KKNA 2ZITA 3UWKA 3L2OB 4LYAA 5IK2D 1ZNYA 4U7DA 2CDNA 2WKRA 3DHWC 4DLSA 4I1VA 2IS4A 2QP3A 5C10A 2PX0A 3SJAA 2PT7A 1UM8A 2YKGA 4B3GA 4B75A 2XB4A 1XNJA 1SXJD 4BLRA 3RS2A 2YOGA 2OEPA 4ASUD 1UEJA 3NDPA 3TR0A 3OIWA 3FHOA 1II0A 1KO4A 4DLVA 1XTSA 5HCNA 1KKLA 4OHWA 2CHQA 2ZJBA 4QM6A 5GVSA 4OK6A 3QQ5A 3WYGA 1GOTA 1KO8A 5JLJA 1TEXA 4HYYA 2QM8A 1KJYA 3UMSA 4HLUA 4IEEA 1XMSA 1OF1A 2Q9AA 5JFGA 3OAAD 1NKTA 2GJKA 1E2PA 4MGYR 2G88A 2EFDB 1F2UA 2IS2A 3EG5A 2J87A 3K70C 2ZI3A 3IDQA 1KMHB 4NU0A 5A0FA 2H1LA 2FGJA 4TYNA 3GJ7A 2C9YA 2QMOA 4FMCF 4FMDF 4DVGA 1KO7A 2IEZA 2D7CA 3B5JA 2XSZA 1JR3A 4E09A 3B2EA 1DE0A 4GP6A 4EPVA 1GDDA 2V8OA 2WTUA 3BS4A 3BWDD 2AR7A 1A4RA 3C7KA 4B2LA 2OCYC 2ZAOA 3L0PA 2QBYA 4OHYA 2N42A 1NLFA 3PUYA 3QBVA 4QRHA 3GMTA 1ZMXA 4R2HA 2DYKA 1MABB 1P2VA 4BASA 3TE6A 2W00A 2QRZA 4YMTA 2GJAA 4GT1A 3B1YA 2YWFA 2O8DA 1PUIA 1LF0A 5TB5A 3W9YA 4QKQA 1EGAA 3BFKA 3WNCA 1AK2A 4JBWA 4DEYA 2H17A 3R20A 4DEXA 1BMFA 2JGNA 4KO8A 1ZD8A 4WZ6A 2ERXA 2ZVPX 2X1VA 4EPRA 2OE2A 2QSZA 4BLPA 4MRRA 4F93B 2QTHA 4LYJA 3B1ZA 3QSYA 2ZU6A 1OE0A 4MGKR 1SVKA 3MWYW 2ANBA 1R10A 1R5OA 2HJGA 2KBEA 4HB4A 4Q4HA 4HDOB 1G3MA 1XX6A 4P33A 2QPTA 2ZE5A 3VKHA 1AQUA 4US1R 4YMUA 4BLSA 1X86B 3VHLB 4Z51A 5EZ5A 3AGQA 3DL0A 4C30A 3ZS9A 2QROA 4HUTA 2ASEA 4MGZR 1SKQA 3K53A 5K8LA 4WAUA 1TADA 4BRWA 2CXXA 2ZSFA 4D4JA 2BMJA 3GFPA 3IGFA 3TUZC 5F98A 1CJMA 3B13B 4B35A 3WNDA 1TF7A 1NVXQ 2ZRMA 4OI2A 2PJZA 2CK3D 1E98A 5J47A 2R9VA 2GZDA 3ECCA 2Q9BA 4AKHA 1EFCA 2RGEA 3ONWA 1X8JA 1IY1A 4R98A 4F92B 5KPDA 2W0SA 3CNOA 4U02A 5CDFA 3UPUA 3IHWA 4QG7A 1X1RA 2D2FA 3PEYA 5FPSA 4DLRA 1M74A 2AX4A 3FYHA 4XSGA 3SDZA 3JVUA 4HLUC 3K70B 1Z22A 2YWEA 5EJEA 1XTRA 1NF3A 1VCOA 3CF0A 1NI3A 3S1AA 2WWYA 1G17A 1OFTA 4W5WA 4N0DA 2G83A 2GZHA 3PG5A 1NVUQ 3H84A 4M9XA 1G7RA 3Q8XB 5AUNB 3G0HA 1R7RA 3RABA 3F8TA 3ZS8A 2C99A 1JPNA 4JMPA 3SJBA 3VAAA 3A1SA 2GEDA 2VYFA 4Q1FA 2LCFA 1KK1A 4BEBA 5KDDA 1ZCAA 3KFXA 4DT1A 3AVWA 2EYUA 2VSFA 2I4IA 1W0JD 5JBQA 4RVCA 3BORA 2ZS9A 4FMDB 2ZJOA 1YE8A 1X8LA 2F43A 4TTPA 2ANCA 3TUJC 2C9OA 5EE1A 1NRJB 2F9MA 1XXHB 4YXWD 2ZJ5A 5DSZA 3C5CA 3AVXA 3GJ5A 3LY5A 4DB4A 2IX3A 1WCV1 3GLFE 1NKSA 3GLHA 2FFAA 1UFQA 1XTQA 3K9GA 3VU9B 2B21A 4JLAA 4P4TA 1N6LA 1UDXA 4TT3D 4X8OA 3AVOA 2XTMA 1CF4A 3A1TA 2NIPA 2ZRKA 3B8HA 2C95A 4U5XA 4AWXA 3U7GA 1A5TA 4FD2A 3LW8A 3U3OA 3W6OA 1HQYE 3REGA 4A6PA 4PTLA 2GVDC 4LSGA 3KB1A 2DFKB 3NBFA 1Z63A 2ZYWX 3CKLA 5CB6A 1E6CA 4B43A 5FUYA 3O47A 3NTUA 2FSFA 3OF5A 5EXPA 3VX4A 3ZQ6A 4EKDA 5FPKA 3R9WA 1SXJB 5M1KA 3G82C 1W49A 2CVFA 1DAHA 3NXSA 4Q1CA 4TLEA 1XD2A 2R6DA 2ZUBA 5HKKD 4LK2A 4NKRA 2FZLA 2QM7A 1IY2A 1XBTA 4CEJA 1BO6A 1N5JA 1VIAA 2JJ1D 4UNNA 3CRRA 3WMEA 3R8CA 1G4AE 4Q4AB 2J7PA 3EA5A 4URYR 3I3SR 2ZPTX 4HEJA 1E9CA 5EXTA 1TMKA 4GSYA 4A0RA 3KXIA 3U7FB 5AK0A 5GJCA 1Z0FA 3O8CA 1II9A 2V1XA 2XTZA 2IWHA 2GKSA 4IRUB 1US8B 2HJVA 2XTNA 5DI9A 2HUPA 1T5IA 4TMKA 1Q57A 3HPRA 1M34E 1DOAA 2P65A 1XMVA 3GJ4A 1KOFA 4JVNA 4LPSA 4DLZA 1JJVA 5BW8A 1NLYA 4E03A 4GOKA 2FA9A 1NN1A 4FIDA 2CEAA 2P6NA 2W6ID 4FI3C 4RKFA 1GL7A 2B8WA 2WMNB 3GJXC 3IIJA 3MWKA 5CK5A 4G5QA 1GKYA 4GPTA 1FUKA 4QFMA 3T12A 5FUVA 4DLWA 4F4CA 1FW6A 4MRNA 1DAGA 4Z1MD 1GWNA 5KPJA 2V54A 4LCBA 4KLNA 2CL0X 3X1DA 2NO6A 4UJ5A 1YR6A 4NCJA 3TSOA 3L0IB 4GFDA 1VCMA 1G8HA 5EUMA 2NPIA 4A2WA 4UNPA 3SYKA 2IL1A 1KDRA 1VHTA 4WXPA 1D6JA 2OHFA 3KJHA 1OV4A 1G3RA 5B2ZA 2WJIA 3LQRA 4BPBA 1IONA 4JLBA 2WWXA 4IDQA 4YDHB 1E9EA 3U3JA 1NMYA 1N6PA 4OI1A 2VQSA 2WM9B 3K8YA 5J4KA 4QM7A 2HYDA 2QL6A 4XOIA 2WJYA 4AG5A 1C9KA 1M2OB 3GLGA 1QHYA 2OBNA 3H0KA 3AP3A 4XD7A 1G8FA 2JIZA 1KIMA 4KI0A 2H16A 4M9ZA 4MUBA 1D9XA 1F2TB 1FFHA 3HR8A 1MRNA 1XDBA 3NBXX 2A30A 3PUVA 5LPNA 5KSYA 1TU3A 3A4MA 3DMNA 1YHNA 1DEKA 1EXMA 2JDIA 3W3AA 2IWRA 4RD6A 4AIIA 4ZKDA 3AVVA 4QNMA 2PX3A 5FI1B 1X1SA 4PZZA 3LLMA 4C9BA 5CLQA 3LA6A 1E9SA 1XD9A 1Q44A 4DUGA 3OEED 1W48A 2EFEB 1D2MA 4LHZA 3TSZA 1P62B 1I4TD 4MYUA 4DXAA 1KK0A 2GESA 3VKWA 1Z47A 3FPAA 3A6PC 5JRZA 1M7HA 2ECKA 3D7MA 3KXLA 5C4GB 3TJZA 1Z07A 2ZRPA 1M7GA 1DTSA 1NY6A 3CZPA 3KDSE 2RGDA 5C4MA 2PLRA 4PZLA 2O52A 2C03A 2UZIR 5EXSA 4V0NA 4CIDA 1LV7A 3RVBA 1ZINA 5BXQC 3AKEA 4KVAA 1ZIOA 3FKSA 4KYUA 4A2QA 1P3JA 3LBIA 4RZXA 3A1UA 4PHTA 1W4BA 1E79A 2KI5A 1L7VC 3N2EA 5G53C 2WKQA 4QC2A 3QE0A 5L3RA 4ERNA 2WPDD 3C14C 1N5LA 5JS7A 1DAEA 3CRMA 2ODEA 1OH6A 2GCOB 4TMVA 1ZIPA 1H8HD 2GJ8A 1ZD1A 1TTTA 1QVAA 5DN6A 2GEUA 2I1VB 2WV9A 2R6AA 4KHZA 4M53A 3OE7D 1ZJ6A 4OK3A 5ELXA 1RRPA 4JLNA 4L9SA 1DVRA 2W83A 2F3RA 3FB4A 2BHRA 3O8RA 2QT0A 4ON9A 3ZIAA 1KZGB 2AK2A 4Q7LA 2C96A 2QGZA 3FMIA 4O0MA 2C5LA 1GG2A 4M1KA 3ZQJA 1W0KA 3FWYA 4IXNA 5IRCD 2QZ4A 2MSCB 5JEDA 1UKYA 1LY1A 2FN4A 1KGDA 2QG6A 3GCGA 1YZQA 2C2HA 1TNDA 5JWRA 4DB2A 2GILA 3V4RA 4BLTA 3QI2A 2J59A 2PT5A 3KX2A 1YQTA 4C0KA 4HZUB 1XJ0A 3VR5A 1KI6A 5FUXA 1UBGA 1DADA 3I73A 2R62A 3RLFA 1DELA 4G5GA 4Q01A 1J90A 2J5XA 2Z5FA 1P6XA 2OAQ1 5H1YA 1VCIA 1GKIA 2VF7A 1SVMA 2AD1A 2BBSA 4HUQA 1N6IA 3IQWA 1J7KA 2ZRAA 1PLJA 4F4IA 1IBRA 4LHVA 4DDTA 3KUCA 5GJBA 1U90A 1G21E 2RAPA 1IN8A 2BM0A 2VH5R 3QVUA 1HA3A 1WMSA 1T4GA 1YZUA 4PSAA 4Q48A 2XX3A 3GLFB 4TMXA 1EFRA 1VIYA 3U4QB 4M1YA 2VEDA 4MYCA 3U44B 2V7QD 4S35A 4BWYA 1KMQA 3AEZA 4R2IA 3HR7A 1FPMA 1SVIA 3SNHA 5FTJA 4EAQA 2DPXA 2ZRDA 1JQLB 1UEIA 3DOEA 1HE1C 1UKEA 1W46A 4YMSA 3X1XA 1K8RA 2RHMA 3SI7A 2JASA 4BRUA 2XNDD 2GXAA 2YOFA 5LD2C 2O8FB 3CX7A 1FUUA 4KSCA 4BZQA 4TLCA 2RMKA 2RGGA 1XCGB 1ZUNB 1ZM2A 4W5JA 4LJ8A 4X8MA 4AYWA 1XPRA 3ZD7A 1ESNA 1QG4A 4LV8B 4E5UA 1GNRA 4HAZA 4ZCIA 1JAHA 2RGAA 3DZ8A 4C2TA 4M22A 1ETUA 2XOKA 2B6HA 2DWOA 3IPYA 3LXRA 2OFOA 4QBFA 1Q1QA 2D7DA 2VP6A 1RRFA 3C16C 3A37A 3QVVA 2NO7A 3MRSA 4DKXA 2IYTA 2KBFA 3RRYA 2ORIA 1HH4A 1FTSA 2OSBA 4DDVA 1VCNA 5FR2A 4OKSA 1Q1ZA 1T91A 1KMHA 1VYVA 5CYPA 2BWJA 4M1MA 4AURA 2ZRGA 4DHEA 3A1VA 3CH4B 1D2NA 5JECA 4B76A 2WWFA 5KYKA 1T6NA 4LBVA 1J70A 1RYFA 1PZNA 5D3QA 1MV5A 1TF5A 3EW9A 4BFUA 3HDTA 1Z28A 2O5VA 3KB2A 2HXSA 3M6AA 4IDNA 4NYIQ 1JBKA 4YMVA 2EYQA 1G19A 4BFWA 1WB9A 4TMWA 4DDUA 1NMZA 3MWJA 2V4ZA 3BERA 3LFUA 5FL3A 1E2EA 1EX7A 3HU2A 2OBMA 2J46A 1N0UA 1P2UA 2QQ0A 1M7BA 1ZU5A 1SVLA 1MABA 4TQ9A 1R0WA 4DCTA 2CMKA 1G18A 3L8YA 5E4FA 3A4NA 5KTYA 2Q0HA 4J0QA 1G8YA 1ELOA 4LI0A 4URZR 3SEAA 2ZRIA 1NJFA 1KK2A 1W4AA 2JA1A 3PUXA 4IHQA 5FUWA 2ZRCA 3U3MA 3BC1A 3ZDQA 3EIHA 3WXMA 3V00A 2F1HA 1R0ZA 1HT1E 5M1QA 3N5CA 2W2XA 1OXSC 4ZIRB 5BQ5A 4IKEA 5KNCA 1WBBA 4DLUA 1XCPA 3DO6A 1FX0B 4EQ6B 2WSSA 4HAWA 4LGMA 2AXPA 3SHWA 1D9ZA 1QHSA 2H18A 4V02A 3SC3A 3TUIC 3QF4B 3R9XA 4A9AA 2AN9A 2ODBA 2EWWA 3E2IA 1XEFA 2HCJB 5LD2B 1ZUHA 4LBWA 1WRBA 3AUYA 2CHVA 1XB2A 1E32A 3K9NA 5DH9A 4HLCA 2IUUA 4TYWA 4HDCA 3UMFA 4DDWA 4TYYA 1EESA 1NSTA 3G5UA 3NC1C 4KITB 1TQDA 1W4RA 2P2LA 5J4HA 3QPUA 1QHGA 4BFYA 3IIKA 3TLXA 5JJKA 5G41A 4MA4A
chains in the Genus database with same CATH superfamily
5FBHA 2P9CA 5FA6A 4Q93A 2ONJA 3OPVA 2ZGYA 4IVNA 2PSFA 3M5RA 1CF9A 1TM2A 1Z74A 1P4AA 4NZZA 1KTIA 3S2ZA 4ZZ1A 3SR4A 1TLTA 3LKDA 4EY7A 3OYMA 5IYZA 2CLDX 4LF8B 1YJ5A 2GAJA 1IO2A 1VQKN 3CH7A 4HQ0A 3CLHA 1ISIA 4J76A 5B57C 2B6NA 2Y0PA 1IJKA 5JQGA 3ZWBA 3N4QA 1B0UA 4YDRA 5CIYA 5BUCA 1ZK2A 1B15A 2Q5HA 1SUSA 4RZSA 1ZI9A 3CONA 4YEDA 2FX3A 4F3NA 4GQAA 5BRJA 2HPHA 2DBVO 2AN1A 4WFIA 3GG2A 4I4NA 3A7EA 1UH5A 2HIGA 4AQDA 1X7WA 2PQ0A 4AKGA 2ZYTX 1CY1A 4C0HA 3EC2A 2G1JA 5T4HA 4D0LB 1YNSA 1M66A 3NM4A 5EUQB 2FEAA 2M1XA 1E4VA 1KVBA 1SVOA 3KKPA 4C7KA 3P9RA 5HF5A 2CMHA 1SKRA 3WB0A 2CHUA 5LOVB 4BNKA 2E3JA 3IEXA 3I76A 3MWEA 1CQJB 1Z38A 1UJ2A 3A5LC 4YRCA 2P9ZA 2HU7A 3VNUA 4GICA 1FFXA 3UUWA 4CKBA 4H03B 4HATA 1LC0A 1SC6A 4ML3A 2Q3SA 4MDFA 2SNIE 3AKDA 1QFSA 3DBLB 4IOLA 5LYJB 1T8UA 5CLFA 3I5XA 1VECA 2DSTA 4JI5B 3UW3A 3GBTA 3N2KB 3AL0C 4ZGWA 3LRXA 3FIUA 3GVCA 2EATA 4BQFA 4S2EA 1SHKA 2V65A 5K51A 1MQ8B 2YY7A 1TVEA 5CBPA 4W9NC 4DSTA 4ZQGA 2Z8ZA 4RV4A 3DDZX 2WVHA 2FFRA 2XT6A 1XCLA 3RFFA 2HA5A 3MS2A 4BNIA 4EYEA 4XUGB 4L6IA 4JI2B 1I3MA 3F2KA 4I4TF 4MW2A 3PXGA 3GW8A 4KVGA 3GNQA 4PCLA 1N5RA 2PZJA 4FNAA 3ZWMA 1JEQB 5IHPA 4OUKX 3SJJA 3K09A 4BFZA 2Y3IA 1R0RE 3B5IA 1L7EA 4MPTA 5DGIA 4EKEA 4N6GA 3TZLA 4D6YA 1YBAA 4PKHA 1PGQA 3BF8A 1JLEA 3RMDA 4OPJA 1C0PA 3ENBA 2BSAA 4PVDA 1PI3A 2IPXA 5CNIA 721PA 3U1BA 4FNGA 3PUIA 1Q0SA 3WC4A 4JK9A 2ZUTA 5AR0A 2JH9A 4YRPA 4PS1A 5KCMA 4OXKA 3DYAA 3F5MA 3SQLA 1YZVA 2GAOA 1EJ6A 2R44A 1X9HA 1J0AA 1SKYE 3CPHA 1W1WA 4LF7B 2E1ZA 4OO1J 3A27A 1Q7YO 4NENA 4ZCMA 2IZ7A 4BO2A 1OA1A 4PGGA 1H23A 4XDZA 1UFRA 4EJSB 4PQYA 2BJWA 3ECSA 4M1TA 4N7RA 2EBUA 5CJ2A 2WJWA 1PS8A 3LT2A 3TTTA 1G5PA 1T4CB 4DIKA 3LX8A 5CXUA 4TPKA 3GHYA 1CJKC 3WGHA 3Q9LA 4MYSA 1DQYA 1T3GA 5BW6B 2R1VA 2YKNA 1GGVA 1PKEA 4X20B 3IBYA 3VN5A 3P2MA 4Q00A 1VQLN 3OJEA 2ZTUA 2BGGA 2CBZA 3OS2A 2FUEA 3M0EA 3FLMA 1FNBA 7MHTA 2OR3A 1V1JA 3ZCUA 2D4WA 2HZ7A 1W94A 2I3DA 2B5OA 1FDIA 3JQ9C 2Q2NA 4Q1BA 5JH7F 4RTKA 2BBTA 1YVPA 5ARDA 4UTRA 2EFYA 5COBA 4H60A 4YMWA 2WZCA 2C8JA 2Q45A 4P58A 3UIQA 2BGLA 4C7BA 2FF7A 1UBJS 2V7QA 2QE7D 1YL5A 4A8JC 3RRXA 3IUBA 1MC4A 3V4OA 1GAJA 3PNVA 2VUHB 2HNBA 4KI4A 2NPOA 2XOEA 1P0FA 2XT9A 3ESXA 2CL5A 4CFZA 1YRAA 3B1FA 4NSNA 4A61A 1OZAA 2GYVA 5DVZA 3FSRA 5C3MA 3LZDA 2VLBA 2EQBA 3VO8A 4P92A 5AKXA 2VXOA 2I0FA 9MHTA 1WKVA 4YI3A 2PUHA 2HHXA 1E7YA 1T15A 3OPYI 3IQXA 4UEOA 5TEVA 2VBIA 2CVHA 2GYYA 3T6KA 3LX4A 5JH7B 3UIEA 3OC6A 3BZKA 3WEEA 2F17A 1PQ4A 3CH6A 3ZDBA 3BSYA 3DGFC 3HCNA 1OVQA 2Z1GA 3KB8A 4KUGA 3RSEB 4D8UA 1EPUA 4FL9A 4UAVA 2WFLA 3O82A 4EOGA 3MEGA 3AUFA 1KS2A 3KVNA 3ZBTA 3F9IA 3DMJA 5H02A 1W88B 3J7TA 5K1ZA 4U7FA 4M99A 1E4GT 3WZ2A 3C70A 4PV7A 3Q6MA 3I9NA 1Z5WA 4EF4A 1GPKA 3NFYA 1GZ3A 2PA0A 3DXYA 2PGJA 1OYVA 3BMXA 4LJ5A 4TL6A 4OXYA 2YW2A 2RI6A 3RS5A 2DC1A 2FEOA 5G0VA 2I6FA 4ZU3A 1SOVA 2H7CA 1BKSB 4GF5A 3DE0X 4PLVA 1QRUA 4UHEA 1SU8A 1G16A 4Q9HA 5L3SB 1KDZA 1Q0QA 1YASA 3QEAZ 4D1YA 3AF0A 4PPGA 1JJBA 2QR3A 1XMPA 4IIVA 3IG1A 1ATZA 3ELUA 4UUOA 1XQVA 5KNBA 2FFHA 1YRQA 4Z8YA 3BBLA 3OQJA 5LBTA 2V0GA 4N8EA 4P6VF 2OO7A 1PR4A 3S9HA 5LQRA 3SZOA 1DC8A 1IM8A 3MG9A 3K9LA 5ALOA 4QULA 4ARZA 3DO8A 1WQ4A 4D99A 3VOAA 1X13A 5AQUA 1TAHA 1NAIA 3BDIA 3OU7A 3EX7C 2JFZA 2OV1A 3ESZA 4FYIA 1QK4A 5IN5A 2C4KA 4I4IA 1YC2A 4DY6A 4MROA 1R0CA 3IDFA 2QAGB 5JVHL 3UO8B 5IMSA 4G07A 2ZB2A 2ZWIA 3RG8A 3UHJA 3LNCA 4N8SA 2BMAA 3PE6A 2YASA 1GDTA 4MMXB 3SEQA 4LCJA 1WPGA 2XNSA 4WGFA 4BBAA 4RX1A 1VKZA 3SYRA 4B2PA 3GROA 2WG2A 1KZ6A 1XV5A 4CI0B 4EFDA 1LD3A 3D5EA 1B00A 2I54A 4C0SA 4E46A 4OCZA 1RE0A 3ZZ1A 5KVCA 3CUSA 4OHXA 1NPTO 3VNSA 4EFNA 4JI3B 1BN6A 3JCZA 4AN4A 3K0AB 5LQCA 2WTEA 3KVVA 1N1MA 5EHGA 3P97A 3CCCA 3REOA 2R00C 5KYUA 3KZCA 1VQNN 3JAMA 4TYPA 4AKIA 4WX2B 2ZVQX 4QARA 4QE3A 5AQJA 4BL5A 3KQQA 2YRXA 5AVYA 3DLHA 1NDQA 2RK6A 1KC1A 4GW3A 6Q21A 1XL0A 1NBAA 5AQFA 3VHXA 3PR3A 5AHKA 4XQCA 1DV1A 2Z4TA 1K4YA 3HO6A 4QLOA 3LH5A 1FMCA 1PWEA 1J00A 1K2WA 4RJJA 3TSWA 4QUJA 2IPOA 2Q4TA 3BOSA 2EJCA 5EP2A 3RVPA 2JGLA 4D41A 5FH9A 4C08A 3JXEA 3PXBA 2FSHA 1ZW6A 2O20A 3SMSA 2XDWA 4CGDA 2WHYA 3PA6A 1H1LA 3CMMA 3ZKAA 1I2BA 1V5FA 1WLSA 5J2MA 1NW5A 4E2XA 5TMBA 5DZSA 3LUJA 5KOJB 1DG9A 3TECE 1RJFA 5HROA 2CL6X 1TTPB 4QELA 2QBYB 1DP4A 1JU3A 3HXTA 2XZLA 5AW4A 1U0GA 5LCXA 1ISSA 5G4LA 2PKQO 4CQLB 3IKTA 1DQNA 1XSEA 2ZATA 1UMKA 1FKPA 3OQNA 3VKGA 5DNYB 5A05A 3P2EA 2H08A 3VYSB 1GGJA 1XJQA 1W34A 2OOSA 4K1LA 4MI9A 4LJAA 1TZCA 3GG4A 3FLCO 3I12A 1PWHA 3NBUA 3D8TA 1OTHA 1HETA 3ZR4B 4NP6A 3CRW1 3M83A 1C7EA 1NUPA 4O44A 2QR5A 4Q15A 1XQWA 1SULA 4PQUA 4GLOA 5IZCC 4ZT7A 1LAWA 2VPWA 2CT8A 5KYYB 3SLCA 4BVFA 1BJTA 5E95A 3SOPA 4BKOA 1ZH2A 1VYHA 1VQ5N 1OI4A 4HNTA 5KTPA 1Y3DE 3E9CA 3ND8A 1FDUA 2UUAK 2NNWB 3ZY2A 1FVHA 4BR7A 4CG0A 3U9TA 3RV4A 2HWYA 2OAEA 5BV1A 5IKXA 2JGDA 4NMLA 4L73A 2MYNA 5A3VA 1ZOPA 5JD3A 2BM9A 4Y8VA 2BI4A 1LBEA 3PDIB 1V8ZA 4JL5A 4Q3LA 2F3PA 4M9QA 2DLNA 1JAIA 5C4IA 3V3TA 1M6HA 3SM3A 5HIIA 1Q86O 4ND3A 1GQQA 2HWWA 2PUBA 3CT4A 4BLQA 4KQCA 1CVLA 3F2IA 1LW7A 2XF2A 2ZSJA 3MBIA 5E8JA 1RHRA 3VPCA 5EWJA 2ODNA 4U63A 2XUJA 4WNIA 1LF5A 1QTIA 3SYZA 4KBGA 1RI4A 3IC5A 2F3UA 3FYUA 3NT5A 2AFVA 3VO1A 4X97A 3QU9A 1ORVA 2CNWA 6ABPA 4PZAA 4ID1A 4I1SA 4MI6A 3QVJA 5JCJA 2B5WA 2HGZA 4I14A 4L5JA 4R01A 2YN0A 2FHPA 5AI8A 3LRTA 3OQIA 5JDIA 4YRDA 3WADA 2M6LA 1E64A 2UUBB 1C0EA 2PHZA 1C1XB 1LH0A 4KU4A 1VBKA 4IQFA 1XZNA 4MPDA 3USCS 4LHXA 3P52A 4J2BA 2AI1A 3HY3A 1GTVA 1VL2A 1WUYA 4MS1B 3DMHA 1NVMB 4KKVA 5K3DA 4B6SA 4MPRA 1W8DA 2WHEA 1BGXT 5IN4A 3C4QA 2XDYA 3I9OA 5E38A 4B1FA 4L5YA 1VLLA 2EKDA 1MRZA 3L7NA 4NCGA 4GRAA 3PV8A 4FR2A 1NP6A 4N5IX 5FTLA 4BMDA 2CJXA 3ZHBA 1MEOA 4MINA 3V1OA 3UAXA 1B1CA 1WSWA 1KNQA 2PL9A 5H0IA 3QW4B 2O54A 3TPCA 1IKWA 3E9YA 3AZPA 2GBCA 3A1WA 1A9OA 5D84A 4WQMA 4E1VA 2J30A 3KCQA 2XHEA 4HUQB 4IXTA 1DAMA 1NNLA 3CUKA 5K0CA 1CFZA 3ESRA 1Z35A 4GOJA 2HX1A 3OLVA 2O5EA 3Q3JB 3VR6A 2FLOA 3VTAA 5I01A 1C4XA 4DWVA 4DLSA 3U19A 3E9DA 1ADBA 5CGQB 2GEJA 2HBQA 1TJ5A 4YYEA 1NXWA 3KUXA 3V4LA 2FZEA 2GX9A 2Q9AA 1ECJA 2W2PA 3O90A 3PFNA 3IV9A 4NU0A 3CSDA 1ID1A 1YCHA 2W37A 2YJ4A 4J2DA 3B2EA 4NBVA 4W5TA 2D2IA 4EABA 4AN0A 1YJXA 3J7YP 1DLIA 3BS4A 2G72A 5TQ0A 4C3VA 3RYIA 4BX8A 3PKZA 4GS5A 3SPZA 5AJUA 5FWXB 1ABFA 4E1AA 1YS7A 1IVNA 5M5BA 4Y9SA 3NKFA 1U5BA 5JZBA 5BSHA 5HQTA 1WD5A 4RDHA 4WESA 3J80A 2HJGA 2C7PA 2OZKA 1P3DA 1O54A 4M6WA 3H9GA 1R3DA 3HADA 2NZWA 3E5MA 1M2GA 4OFXA 3U9LA 1CIJA 4D57A 1CR6A 3NAQA 3EEOA 4WOKA 1IY1A 4YDUA 3CNOA 4BG9A 1M74A 2M6RA 4QRDA 3ZJ4A 3S1AA 3NH1A 3HC7A 4LXGA 3COJA 1BCOA 5A2QO 1JYFA 4FLVA 4MUGA 3HLKA 3T19A 3QKWA 4P98A 4CLRB 2CKMA 1A9XA 4BQRA 2AZXA 4B1WB 2X4LA 1SOUA 1VHQA 2YZMA 4KQ9A 3LVBA 4I1YA 3OQOA 1EP2B 3KJQA 1N9ZA 2OK8A 3A1TA 2O8NA 2PX2A 5I6DA 1KVCA 1ZA1A 4MTLA 4YCSA 4BRAA 1QGAA 1S72N 2FQWA 3R9WA 5K3SA 3NNDA 2YIDA 3AU8A 1IY2A 4CEJA 3LUHA 4G2TA 4R9VA 3A04A 2JARA 1G4AE 4TWAA 1N5OX 4URYR 3A5MC 2YS6A 5LFAA 4KQHA 1II9A 3BEXA 3GL9A 2AGVA 5HEKA 1HO3A 1VB3A 1F21A 2GKGA 2BUBA 1ZD3A 2XRZA 4G9GA 3MWPA 5BW8A 4YUWA 2W6ID 3B8EA 5F1YA 4G89A 4G5QA 1PCXA 3OO0A 3EAGA 3T9DA 3HZZA 3R3WA 1HC7A 3PX3A 4ENUA 1C7RA 1YDEA 5KJCA 3GRPA 1SXIA 3TSOA 1YI1A 1DXYA 2WW8A 3SLRA 4JLHA 2TMGA 1D6JA 1G3RA 2C2GA 1NASA 4IBNA 4QOEA 1JVSA 2IU6A 4OI1A 4X6UA 3AB8A 2X42A 3TCNA 1MV8A 4RSRA 4DJJA 3FPLA 5C1IA 2BLLA 1NMEA 2ZWPA 4RD6A 1FRFS 1X1SA 3C6UA 5BV2P 3V1NA 4DUGA 1THMA 3K05A 3SXUB 4J9UE 4CQMD 2GESA 4W5OA 2PPLA 1DX6A 3AIIA 1H3EA 3U40A 4FS3A 4PZLA 3Q7CA 4Y6PA 1BHLA 5IW8A 3UMVA 1DIHA 2H06A 1LV7A 1H2WA 3FR0A 4KYUA 3STTA 3GVHA 4DCJA 4UMFA 4MPJA 1UKAA 2JANA 2V6FA 4QUBA 5G4KA 3LU1A 1OLSB 1PG2A 1ZJ6A 1EWVA 1OCEA 1U6JA 5JJ5A 3LUFA 5LJLA 4H6WA 2HQ1A 5D85A 3MCZA 1WUKS 3CLRD 1UBGA 4YAKA 5CYMA 2R62A 3RLFA 2J9YB 4KH6A 5LIRA 4Q4CA 1MIOA 5K0SA 2P0YA 3RTEA 1U90A 3D1VA 1S5PA 4KIUA 2XCIA 1T4GA 4B6JA 2LGJA 1R16A 4GPZA 4EL5A 3V4ZA 4ARVA 6REQB 3AU9A 1BDGA 4IIJB 1NGJA 4IJ5A 4BRUA 4BWFB 2XNDD 3BGSA 1VDMA 3A6EA 3CV3A 1Z4MA 4MI1A 1JAHA 3QV2A 4M22A 4CF0A 1X1CA 3NHRA 2VP6A 1YRWA 2QTGA 3NF7A 1GTZA 3F6RA 3A3NA 4YIKA 2ORIA 4DR4K 3MT7A 1VCNA 1KMHA 4YRRA 2OP0A 1NMDA 4KC0A 3DOUA 2OPHA 4YMVA 4IMPA 4MJLA 2ET6A 4EZ6A 1GAQA 3W4IA 3PIIA 1EHYA 1P2FA 3NALA 1ZEJA 4JRPA 4KQIA 3GRRA 5DYWA 3BC1A 3LY8A 5DM2A 3WO1A 2AT1A 2RCYA 4QUKA 5KQPA 4IQ8A 4IMJB 5A03A 4K9OA 4Y2SA 5FCDA 3HM8A 1KR5A 4GNRA 8MHTA 5DTJA 4JKEA 1K06A 3WGUA 1T5OA 3HCEA 3QLUC 5FNVF 3AFHA 4O4IB 2H4ZA 3T1QA 1SS6A 3DB2A 5CLLA 1I2MA 5DHQA 2PDAA 4G0VA 4JEHA 1E7WA 3VR4A 2F2TA 4TTAA 3U4LA 4RNDB 5C8YA 1AA9A 2Y1DA 5CYQA 1OBFO 1E2DA 4FW9A 1GCIA 2DCUA 4M83A 3L7LA 3DUWA 5AJZA 3NUQA 3TSYA 2IUEA 2WDPA 3PX7A 2QW0X 2YZKA 2VSXA 1QOQB 1YT5A 3B38A 4TLBA 1EJ0A 4RK0A 4PFSA 1XA3A 3R1XA 5DEIA 4F2WA 3EFEA 1TO1E 1JZTA 4JL6A 3EH2A 4PYIA 2P5TB 1GT91 2PYIA 5MGNA 3WL7A 4JK3A 5F7XA 3R77A 5HQJA 4HNHA 1CJVC 4CK2A 3W2TA 3S3OA 3C3YA 1V16A 4B3RK 2Z98A 1YJWN 1Z06A 2BEUA 3M4JA 1OXXK 4XIIA 4RK1A 2CL7X 4LRSB 4DV4K 5ER6A 4CL8A 1JIJA 5I5EA 4JKFA 1DKUA 4RU1A 3UFBA 1T6CA 1CY0A 4OHRA 1USIA 5I9TA 2X77A 2UZ1A 4GU5A 4DC9A 4I9FA 2YJTD 5I7HA 4N6OA 1MOZA 2G4CA 5IKOA 1JXAA 4O4LA 4LFCK 4FIZA 1A3CA 1GPMA 5DGDA 1Z29A 4FJGA 4GVPA 5C15A 5E7IA 4U7HA 5AJYA 1X1PA 1Q1AA 3OQVA 1J06A 5AWFC 3VSDA 2HMPA 1TQ6A 2WIGA 2WIJA 2O1XA 4CQNA 3H2GA 4FYWA 2P75A 4B71A 3M3PA 3NGLA 3RD5A 1GO2A 2JL1A 4WY5A 1T9BA 5AI4A 4MVJG 4FLZA 3ETJA 4FW2A 1C4WA 1X8KA 4RD0A 1PEKE 1EX4A 1U5CA 3G0DA 3IP7A 1OXKB 1IHYA 4F71A 4M21A 3H0EA 3ETGA 2WT9A 1XQ9A 2DQZA 4BFVA 4Y0VA 3ZETB 4HPWA 3T5PA 3I5MA 2CWDA 4CMIA 2L2QA 5KIAA 2PX4A 3RUAA 4PSVA 2F90A 3TXAA 1RKBA 4YCBA 3EPLA 1F12A 3E3AA 4HZUA 3IP1A 3MN1A 4CKWA 1PT6A 3EDCA 1GA6A 2OD2A 2VDNB 1WUAA 2ITGA 4M8NE 3V9UA 2F8SA 2RG7A 4WINA 2FQQA 3CJ9A 3UT5B 2ZSEA 5J2PA 4XPIA 1IBLB 3U44A 2ZD1A 5JCXA 1EWRA 1IYZA 2JHCA 3VA3A 1PJZA 4GLJA 2X6NA 1WZNA 2DR3A 4ND2A 3LO5A 4FOSA 2DJIA 2ETVA 4P22A 3FUVA 2OC9A 3AQIA 4A8HA 3LBNA 3IVCA 2B2XA 2Y1IA 4TS9A 3HSYA 4B9EA 2D4HA 2G1KA 5FUMA 3HRIA 1OB2A 3M9XA 3WSVA 3SR3A 3STWA 4KNWA 5DM60 4FXOA 2DFHA 1IOZA 3FBTA 3BCHA 3PI6A 4AF8A 1NXOA 2C58A 3ZJ5A 1RAHA 2C7QA 2NQTA 2QR2A 4RESA 3GIWA 4KYTA 4YDSA 1EP3B 2C9CA 4QU9A 1GGKA 1GUAA 1EVJA 1C0IA 5EOVA 1DNPA 1LJLA 3QBTA 1Y1TA 5E3HA 1I5OA 4AQYB 3R5XA 4CLOA 5IWCA 1UWBA 4CUZA 5AUQA 2ZBDA 4HAYA 4G6ZA 3DE4X 2YN2A 4BRNA 5ALTA 5AVZA 2AOXA 4KXMA 4DV2K 1J8VA 1JEDA 4GI7A 1NGAA 1VXRA 3AAQA 3WLFA 1V48A 3BA1A 4COKA 1H8HA 4AO7A 4FYPA 5D6NA 2PY5A 1XMXA 3FWPA 3UT6A 4Q5IA 4AHSA 1Z5VA 4AMVA 2NMVA 1S9EA 2OZPA 3VA0A 3FGZA 3V3KA 4E3SA 2QM0A 3R7WA 1X87A 3N7TA 3QP9A 4B6RA 4YACA 2YN4A 1UEXC 1ECGA 4WLUA 2C00A 4PQFA 4H7HA 1G3QA 5M34A 4R9UC 5LZ4A 3DMTA 4UHJA 4MDHA 3ENHA 1HQDA 3ZXIA 5H16A 1VQMN 4OJRA 3GRKA 3D8SA 2ABWA 4I4CA 4E32A 3OKCA 4JI7B 3L4EA 4C7JA 3RHSA 2AKYA 4TUYB 4H6PA 4KK4A 1YDGA 1DC4A 3RJZA 1A27A 5LLDA 5LN1A 3L6EA 9ATCA 1XDWA 4Q7QA 3CN7A 4M3RA 1E6LA 4L4UA 1KH2A 1JJ2M 4K9LA 3QUBA 2EL9A 2Y1FA 1FFDA 3FRIA 1E6KA 3A4TA 3L4SO 3ZQUA 4DZTA 4DG1A 3OWOA 1XPUA 1DHTA 5T6BA 3SNNA 3L8MA 4BS9A 2QD4A 3OO1A 2FBVA 2OL4A 4C07A 3OKAA 3CG0A 5IF9A 5A4AA 3TOXA 4OP1A 3ONFA 2IV3A 3HXMA 2G06A 5AJVB 4ZCRA 1RBZA 4KHUA 5FPYA 4UD2A 4GXQA 1Q91A 1CJSA 1N33B 3QBWA 4BDTA 3TJMA 4J16A 5IH7A 3KHTA 3N9IA 4K46A 3EXHC 4UVDA 3OUTA 2IPLA 4ETMA 3GHHA 5LXTA 1D6MA 1JQJC 3AI1A 4G09A 4YRBA 4FCWA 2Q6IA 1IPHA 3LPAA 5HCUA 3C4JA 3CBGA 1XQ6A 1R18A 1KO5A 3IBTA 2E1RA 4R7TA 4NB4A 1Q0UA 3BB4A 1I4WA 2ZM5A 3KD1E 2WYOA 4MJ7A 1M83A 4CFAA 3B12A 3THXA 4CI6A 3LPLA 4K8OA 1I1HA 3RFUA 2D3WA 5CBKA 3ZW8A 1GQSA 1VTKA 4AJOA 1OXTA 5E6SB 2BEWA 4NHOA 1QNFA 5E1OA 3BGVA 1PT9A 1P74A 3DYBA 2A0UA 1FKOA 1R66A 1FFGA 4UEWA 4F0JA 4NCAA 3K9WA 3SYTA 2ZP1A 5EWMA 3ZNQA 3IPCA 1BEUB 4XW2A 3K0FB 3LCJA 3QGMA 5LDGA 4OG2A 2W4QA 1MJGA 4R6XA 5LQKA 3MT8A 3ORYA 4PQEA 1K7YA 1B14A 4IKFA 1BMFD 4BRDA 1K8AO 5IH3A 1D1QA 2HWUA 2GYWA 3AJDA 4RM3A 5DHAA 4F9GA 2SHKA 2O8CB 5D3MB 4HFRA 3WK7A 3DE7X 1G41A 2KJQA 4Q18A 1G8AA 5HUJA 2FKNA 4BECA 1LAVA 4HDSA 5DMXA 3AJEA 6PFKA 3UAOA 2QLLA 4Q4JA 3NH6A 3DPUA 1DQRA 3A14A 4B7XA 3I8OA 2F9TA 4JU9A 2JKYA 2ZROA 2C78A 4L5IA 4NI5A 4JLDA 4B09A 5T5QA 1FXWA 4F9OA 3SNKA 3C6TA 2X0KA 1YA4A 1NXQA 5LA6B 1RXSA 4XIUA 4EGJA 3V7FA 1LPAB 1GFWA 2VDUE 1EVEA 1IULA 3LYLA 3SHQA 4GBMA 4LJ9A 5AM5A 3HA3A 3URMA 3KR2A 3BWBA 3TQOA 4I6JA 1JEYA 2YV1A 1FFBA 3W6NA 2HRCA 4D8YA 3A70A 4Z9FA 4M0MA 4LWZA 2FWIA 2XLCA 4XSHA 4QUIA 4ARUA 4CPDA 4K0KB 1S1CA 4ZRMA 3ICOA 3F5TA 2G9QA 3D2AA 3X2SA 4AQ7A 1N7GA 4FC6A 3SP1A 4HVAA 1W5FA 3C6YA 4BNGA 1C9NA 3VZCA 4LDRA 3WICA 3HDHA 1Y0BA 2JLYA 4OGCA 2ZI5A 1JWLA 2IVFA 2Q6LA 4MUJA 1F3OA 4BE2A 3KL4A 2F1JA 4ZAYA 4LXHA 4JAXA 5EZ6B 2NVBA 2GF0A 1ACLA 1N2CB 3N5KA 5JYDA 3VBCA 4KQEA 1Y9ZA 2VCHA 2ZSDA 1GPBA 1OZGA 1DPGA 2XAAA 1GU7A 4L5BA 4B33A 1BH6A 1MAAA 2W42A 3K15A 1CVRA 4JJZA 4CLDA 1U5AA 5A4FS 1V2HE 4CEEA 4MVXA 4EP5A 3NDBB 4YORA 3F46A 2HQOA 2RONA 3L8ZA 2FDCA 3ZNNA 3GLUA 3QIPA 1R8YA 3G0GA 4OGKA 2Y67A 3REQA 5ED4A 1P7YA 3KK3A 3OIGA 1U6KA 4TLMB 1BVHA 1E2BA 3KJZA 4UQGA 1F2VA 5KMGB 3KYIB 1AUXA 1ZXLA 3SHVA 5CZ1A 4PM4A 4OKJA 1C50A 1HEYA 1NGBA 3GVPA 1RTHA 5DCWA 1WZCA 2C59A 3WNZA 3TW8A 1Z0IA 3E1SA 3GLSA 1UZLA 3DXXA 2ZPUA 1UQUA 3VTHA 2FPPB 2J48A 4V38A 3T38A 1ZJWA 3IQGX 2R4TA 1U8XX 4MQ5A 3X3HA 3BGIA 3FF4A 3H6GA 4ND6A 1QYVA 1IZYA 3E18A 4XCVA 3R3LA 1QLJA 1OAOC 2HC9A 4DA6A 4FWPA 2ATCA 2FW6A 2VF8A 4YP6A 3OZBA 1U6IA 3ZH9B 3KZNA 3W8FA 4D26A 5CDTA 3H2JA 4EMBA 3DXFA 1EFTA 2H3HA 3M70A 3OQ1A 1XPOA 4L22A 1UPBA 2TMKA 4RZ2A 3IRVA 1YJAA 3DKVA 4JIMA 3SC2B 1GXSB 2G5GX 2YDYA 7YASA 3NNNA 2JBHA 5JNVA 1OROA 4PNPA 1L5LA 5ED0A 3BQNB 3HABA 3WLIA 1QANA 5ALNA 3F6YA 3U62A 2OCEA 2Q27A 1MOPA 1JTVA 1ZSYA 2H9YA 2N9UA 3AY6A 1EO1A 3TCXB 3DD5A 4ARBA 4XIJA 4Y2TA 3LDOA 4ZI5A 1Z82A 4GSKA 2BZSA 3FUCA 3PUJA 1HJRA 1J09A 1ZWKA 4D92A 2D06A 1C1CA 4NICA 3DJFA 5ESXA 4MB6A 1WP4A 4YOWA 2J07A 2NSYA 3LLSA 4MS3B 5EKDA 2QRNA 1E2KA 2HY7A 4LJKA 1NHGA 3ROQA 3A26A 5AZJA 4DSFA 3JVDA 4JHLA 3KAJA 3CYFA 1BW9A 3U4AA 2Y9MB 3LXXA 4PA1A 2JCSA 4WK0B 5ULLA 1MC8A 1BA3A 4W5QA 4MULA 2VP2A 4FX2A 4PHGA 4C6TB 4DAOA 1KYYA 3SPYA 3HVJA 1RZ3A 5LOVF 2VDWA 3MCVA 3P31A 2D0PB 3GGOA 4MR9B 3ZV3A 1ZZEA 3CTMA 3KZ1E 2RAVA 5T4BA 4PL8A 5F3RA 1E3EA 3KSAC 3HB9A 1L6IA 2YJ3A 1N36K 2PM8A 2WLSA 1U2VA 1E0DA 2AF3C 5JSKA 2GX6A 3JASB 2AJDA 3EXIB 5DX1A 5LYJF 1DOZA 5HF9A 2Q0SA 2QM8A 4FDMA 4Z4QA 1MMFB 3DZFA 2RKIA 1GPDG 2XY7A 1WW3A 3EG9A 3Q7RA 4GNIA 4HRXA 5DHTA 3RU9A 4CNBA 3DTVD 2ID4A 4WN9A 4EPVA 4RZQA 1H9CA 1ZBIA 2V8OA 4WZAB 4W63A 1RC1A 2GELA 1JHZA 4LQ4A 4QRHA 4MIOA 4J7UA 5I8WA 3VAYA 4ALMA 4YECA 2FBXA 4CMKA 3WNCA 1AK2A 4MHOA 2XCRB 2QRPA 2ZB8A 4GHWA 3BXGA 3BVPA 2A1UB 4FZVA 3OPNA 3IOEA 2ANBA 3LSTA 1J9AA 3OPYB 1B6TA 4UE3S 4BLSA 3K9QO 1DLJA 2QG4A 1QFJA 3IP8A 4GR4A 1K68A 1CJMA 1YDWA 1TF7A 2R60A 1X9JA 3KPWA 4W8GA 1EUCA 3R4VA 1OPRA 4RA6B 2JHGA 4QG7A 1GCOA 2W6KA 4IIBA 2J6HA 3JVUA 4F8EA 2VPXA 3JATB 3K5IA 2YCHA 1NQXA 2YRFA 4MV8A 2XVMA 1UMDB 3BJEA 1TL3A 5KTMA 2ZVDA 1JPNA 5HRNA 2Q5QA 4ZV9A 5J2NA 2EYUA 1XLTC 3QELA 4PGFA 4F5YA 5IBCA 2QVZX 1AK1A 2E49A 1JE0A 4DUYK 1UFQA 4DF8A 1U65A 3ZX3A 2ENUA 3ND6A 2CSUA 4TV8B 4K43A 4AWXA 2NRZA 4B9UA 4PY2A 2VUTA 1WG8A 2YV2A 4U9UA 4WKGA 3T99A 3UA3A 3MGBA 1DAHA 2ZUBA 3TSUA 4WH0A 3N74A 1U2SA 1G15A 3OVMA 2R2GA 4Q4AB 1PSDA 1E9CA 3GDOA 3C6BA 3FJYA 4R3NA 4CN8A 5KQRA 1PEDA 2I33A 4UNIA 3HV0A 2I7TA 4ZO7A 5DI9A 2LPMA 3NYWA 4TMKA 2EW2A 1JJVA 3WTCA 1EP4A 3OE4A 5EIAA 1VIMA 5CEEA 1PJLA 3CCVN 1Y6RA 4WKCA 3NS7A 1WVGA 3UXYA 2Q4BA 4CJSA 1AO0A 1R9GA 1DAGA 4OHUA 4I1RA 3M1AA 4KLNA 1PO7A 2NO6A 4AY6A 2Z08A 2RPIA 1VHTA 2QZZA 1GPWB 3Q15C 2B34A 2HYDA 1BWRA 1R64A 5B7NA 2XQFA 3M8PA 1J5EB 3SMVA 5BRNA 1MRNA 1XDBA 2XY5A 4QXRA 4LY3A 4O2AB 3IOBA 4NXMB 1TZMA 2FSJA 2PX3A 3FMGA 5FI1B 3G5LA 1YFLA 1E9SA 1RTJA 1YJ8A 4NABA 4ID3A 1VB5A 5JRZA 2VDPB 4C03A 3I2YX 1EP9A 3Q3HA 2NP7A 5BR9A 3OLXA 2O4GA 1NR1A 4QXOA 2UU9B 1PG5A 3SIWA 4WMLA 4H1HA 3HB5X 4YCNA 4JYAK 5L3RA 3C1TA 4CKEB 1DWQA 4GXNA 4KMOA 1Q7TA 3R6MA 2E4ZA 1FDRA 3L3UA 1TTTA 4TKLA 3OE7D 4QYXA 1RRPA 4JLNA 1QGYA 4J91A 2C5LA 4M1KA 3TQTA 3K2EA 3GCGA 2MU1A 1MB4A 2GILA 3R8XA 1H4QA 5MN4A 3VR5A 1X1QA 3I73A 5EJ8A 1XIVA 3A6ZA 3CISA 1J90A 2Z5FA 3QLVC 4JASB 3FAZA 3NNSA 1UWVA 4LVCA 5CDUA 2OGUA 4E3WA 1U31A 2XX3A 3ORHA 3LUCA 4AY5A 2H2WA 3LWZA 3JU3A 1KR2A 3KV3O 4IJ6A 1SVIA 2WZDA 4G1EB 1MW8X 1A5SB 4YMSA 1NR5A 5EINA 3S5JA 3RUFA 2NRHA 2E5WA 1VRVA 1XPRA 1U0RA 1JTEA 2BGNA 1TC1A 2IIVA 1B1AA 1X1TA 3PKJA 4XRRA 1H2RS 2D59A 2IYTA 2KBFA 3FOWA 4PWYA 4LQCA 3G9XA 3DE3X 4FE4A 2B4JA 1PE0A 4FWBA 1WB9A 2V0NA 1XPJA 3TG8A 1N9GB 1U3DA 1P2UA 4NV1A 3HBFA 3H4IA 3RTDA 4CBUA 3VPSA 5BSWA 3BP8A 1SBYA 3QX8A 2YXPX 1SQFA 3TNJA 4J7AA 1QAQA 3QTLA 3GOHA 4JD2B 2OANA 1L5YA 3V8RA 1L7QA 3UGQA 2R6R1 3DO6A 2C8KA 4X60A 2WSSA 4CMBA 2AXPA 1NWKA 1RWWA 4DY4A 3E9NA 4QQNA 2AN9A 3AUSA 1E3LA 1WRBA 4I55B 5EXEA 4BUCA 5BRDA 2ZOSA 1A71A 3HKBA 3MWTA 5JTUA 1BNCA 3EPRA 4E13A 1FP2A 3G88A 3AEXA 3IIKA 2BGUA 4B9NA 3MXMA 1YB6A 4RCVA 1ISJA 4UTPA 2XGMA 1UKVY 2Z1MA 4H4CA 1P19A 3GFGA 1X3LA 1OIXA 1J20A 3BHJA 4HWKA 1ACJA 1KQOA 2J3LA 2QUZA 3ANMA 2Q1TA 1GOAA 3GUVA 1TEHA 4ZU6X 5LMUK 4N9QA 3DKPA 3R3JA 3PNQA 2WAYA 5F0XA 1U8EA 1Y8QA 4LV5B 5CTAA 3EF3A 3CLUC 1I4DD 5M04A 5HM8A 3H19A 2P68A 3VXKA 2XB6A 2PD4A 2R4QA 1WDLA 3VZDA 1LPPA 1VMIA 3U5ZB 5JPCA 1K0FA 2H2GA 4D3FA 2R6JA 4J1NA 3OESA 2E5LB 2VWBA 1RVDA 2FPWA 3W06A 3K1TA 4RJLA 2EJTA 1WW8A 1M1YA 4BE7B 5E0KB 1HTWA 3N2NA 3ZBQA 3DP9A 3I04M 5KKAA 1U7XA 1KRXA 4E08A 1IPFA 5BN3A 2Q8PA 5B36A 3T1NA 1X9SA 3LL4A 4UQOA 1IY8A 2DE0X 4UTNA 1JG6A 3T9CA 3OJWA 3MDQA 1JTFA 4IVPA 1UMCA 4XR9A 2AR0A 2G1AA 4F7WA 2F1KA 4YAIA 2DFTA 4DQVA 1FDWA 2ACKA 1O77A 1LPSA 5HSGA 1D4OA 4P81A 4TLLB 1J2RA 5EEHA 3I0MA 5F9HA 2O48X 1HQKA 2GERA 2RJNA 1W36D 1EVYA 3U4CA 2IZ0A 4MUHA 4K87A 5IG2A 4MWBA 4C29A 4JEIA 1ZFNA 5IXJA 3TF5A 3E23A 2FEXA 2X14A 1XYYA 1FMJA 1M1NB 4CG2A 4L15A 3ITKA 1C0LA 2F8TA 3H3XA 2X4IA 1XWWA 5AK5A 1T36A 3HKEB 3BK1A 4GRIA 2EKPA 3S2YA 3C7CB