4IEIA

Crystal structure of the large terminase subunit gp2 of bacterial virus sf6 complexed with adp
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
461
structure length
449
Chain Sequence
NPIFEPFIEAHRYKVAKGGRGSGKSWAIARLLVEAARRQPVRILCARELQNSISDSVIRLLEDTIEREGYSAEFEIQRSMIRHLGTNAEFMFYGIKNNPTKIKSLEGIDICWVEEAEAVTKESWDILIPTIRKPFSEIWVSFNPKNILDDTYQRFVVNPPDDICLLTVNYTDNPHFPEVLRLEMEECKRRNPTLYRHIWLGEPVSASDMAIIKREWLEAATDAHKKLGWKAKGAVVSAHDPSDTGPDAKGYASRHGSVVKRIAEGLLMDINEGADWATSLAIEDGADHYLWDGDGVGAGLRRQTTEAFSGKKITATMFKGSESPFDEDAPYQAVRTIGDVFRNKRAQFYYALADRLYLTYRAVVHGEYADPDDMLSFDKEAIGEKMLEKLFAELTQIQRKFNNNGKLELMTKVEMKQKLGIPSPNLADALMMCMHCPALVREETEIYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gene 2 protein
publication title Structures of the phage Sf6 large terminase provide new insights into DNA translocation and cleavage.
pubmed doi rcsb
source organism Shigella phage sf6
total genus 162
structure length 449
sequence length 461
ec nomenclature
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04466 Terminase_3 Phage terminase large subunit
A PF17288 Terminase_3C Terminase RNAseH like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4ieiA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ieiA01
1W0KA 2ZS9A 4HB4A 1G8HA 2GXSA 2ANBA 2C77A 4LJ4A 2WWFA 2WIBA 2GZHA 4AI6A 1YE8A 3KJIA 1NLZA 2VF8A 4BLPA 3ZLJA 1G5RA 1ZNYA 4JBYA 3O8CA 4G3XA 3DHWC 1EK0A 2QUZA 3PVSA 3IHLA 3Q5DA 3GEEA 1F3OA 1VYUA 1XMJA 3BXZA 4LDJA 1P2VA 4Q7LA 3TNFA 1B23P 2O0JA 2ZRFA 1JR6A 3ZGXA 4PANA 5FL7A 4PXAA 3T1VA 1GDDA 1KJYA 4IOMA 1O3YA 1YJ5A 2ZSFA 1II8B 4GOKA 5GVRA 1TUEA 1P3JA 4DZZA 4NCIA 4Q4HB 3WMFA 4ESVA 3VR2A 5BWMA 1B0UA 2PX0A 3AVXA 2UZIR 1XB2A 4OJKA 2ZRGA 5JRZA 5HKKA 1TQ6A 1WRBA 4DLSA 1FP7A 2QY9A 4JT2A 1KO4A 4NDZA 5L3VA 1XXHE 3I8XA 4QC2A 2YC4C 2IYXA 1WCV1 1OB2A 2C99A 3ICQB 2WSMA 2QT0A 2J0SA 3BRWD 1NVVQ 1F2TB 2ZROA 3MG9A 3X2SA 4ZKEA 4EKDA 3CRRA 4NYMR 2NPFA 3BGWA 1VG1A 2ODWA 3QBTA 1DBSA 4PAMA 3MWYW 5LBIA 5IK2D 1W2HA 1RRGA 5DO9A 1GL6A 3PQCA 1PJRA 1Q21A 2VP9A 2W58A 4QGHA 5CK4A 2WSSD 1M2OB 1ONBA 2VL7A 3AVTA 1UF9A 2VHJA 1Z83A 4LWZA 2FNAA 2GETA 3TQCA 2E9SA 1NKSA 5H1YA 3W34A 4TLDA 4O3MA 2FE4A 2VA8A 1T6NA 4PO8A 3SJCA 1P2TA 2PZEA 2ZEJA 3C4JA 3THYB 3ZVMA 3B82A 1ZM4A 1ETUA 1P2SA 1H8EA 621PA 4AC9A 3KKQA 4L8GA 2WVJA 1WMSA 1U81A 1E98A 2OBNA 4Q4HA 3LD9A 2VEDA 4QM6A 1W36C 2A9KA 1HT2E 2Z6VA 3RHFA 4A15A 4DSNA 3TUJC 3KFVA 3W6PA 3LY5A 3QKTA 4DIDA 3I8SA 3BJIC 3ND9A 3A6PC 4Q21A 3BH7A 5FUWA 5D3MA 3HWSA 1Z0KA 1N2CE 1KSFX 3NEYA 1V5WA 1FX0B 3AM1A 4HAZA 5KSOA 4MRPA 1OPXA 2NQ2C 2ONJA 1D8TA 1D5CA 1TAGA 4D4KA 3T1TA 5KDLA 2JLVA 4TTQA 3NG1A 3QENA 5HE8A 5DYGA 1G8GA 4A9AA 3X1WA 2DB3A 3VR1A 4JLVA 4YDHB 2F1HA 1TU4A 2XJ4A 3LO5A 5DISB 1E9DA 1P2UA 1E2PA 3Q8XB 3TAHA 4B3GA 3LFUA 5HE9A 1Y3AA 1DOAA 1W36D 221PA 3K0SA 2BMDA 2V1UA 4V0NA 4C0HA 5FPKA 4PPGA 2GJAA 2RGEA 4HLQB 1UBGA 1M74A 4XWAA 4B33A 5EJEA 3LX5A 1N5IA 1QG4A 2JIZD 3KQKA 1XXHB 3I72A 4DCTA 5HTKA 1EFCA 2J0UA 2XGJA 1Q22A 4JKIA 1XTKA 1Z6TA 3CH4B 1ZW6A 3QVUA 4NYMQ 2JLXA 4II7A 4L9WA 2L0XA 1CJKC 1AKYA 5EP4A 1QHSA 1N6OA 2PJZA 3DKVA 2GK7A 3O8DA 1OXVA 1KO8A 2IYQA 3ZVLA 2ZREA 1OXXK 4JL5A 3KTAB 1US8A 1CJVC 2ZIAA 2KWIA 3GJ5A 3DEFA 3CIOA 3K0AB 5EXSA 4FMCF 3GMTA 4P31A 3UIEA 3TQFA 2YV5A 3W3AA 4TSFA 2O8CA 2NO6A 4ON9A 3IPXA 2PMKA 2G88A 3UANA 2Z43A 1FUKA 4OK6A 4CW7A 2OFOA 4PHFA 4RD0A 2IYRA 4W5JA 3R9WA 1NF3A 3FOZA 1F6BA 3EIQA 5UKDA 2QRZA 2P5SA 1P72A 2JCSA 5SZJA 4LHVA 3I3SR 1FW6A 1EGAA 4QHYA 1XXHA 2IYSA 5FR1A 3TW8B 3OEHD 3SFZA 3QF4A 3CKLA 1Z6AA 3PUXA 1SVWA 1G17A 5AUQA 4QJ3A 2FPLA 2WJJA 1GKIA 2PLRA 2ONKA 5KHOC 4LHYA 2DR3A 2CK3A 2C8VA 2VTKA 1LV7A 2WKPA 3QUSA 1WB9A 3U2QA 3E5HA 3C16C 3U5ZB 1KI9A 1WBBA 1E2NA 2R2AA 5FBVB 3VKHA 1ESNA 3U3OA 2RGNA 4DLTA 4Q48A 3OF5A 3Q85A 2G3YA 3OZXA 1N6IA 1EFHA 4MGKR 3EC2A 3OAAD 4F38A 1Q3HA 2WJVA 3KTAA 1VHTA 4DCUA 1KMQA 3GJ4A 1FMLA 4TYQA 1XZQA 2MSEB 2OCAA 4UXIA 1Z6GA 2EU8A 5JI2E 5FI0B 3L8ZA 2WWWA 2BM1A 5CK5A 5KSPA 4JBXA 5C10A 2J1LA 5E7JA 5EE3A 2ZS8A 3U61B 2W00A 2ZJ2A 1MV5A 1Q57A 2HF8A 2J7PD 1UPTA 1VPLA 2DBYA 4NCHA 5ANRB 4E5UA 3FHOA 4IVRA 2H57A 3S1AB 2LKDA 1XWIA 3K9HA 2H17A 2NG1A 2WPDA 3AGQA 2DFLA 4L5BA 3SFVA 2V55B 3I4LA 5DI9A 1XTSA 2WIAA 2OLJA 1XEXB 1DAMA 3N70A 1DE0A 4CYMA 1IXRC 4FINA 4LJ6A 2W6ID 3K0FB 5FUVA 1GRNA 1G21E 3QE0A 5F3WB 4W9MC 2ZUDA 1QVRA 4DT1B 2DFKB 5IF9A 4IW3B 3I5XA 1GVNB 4KYIB 2GZDA 1T3LA 1VHLA 2PCLA 1Q12A 1Z2CA 2ZSEA 2GF0A 1FTNA 1IOZA 3P26A 4XVUA 3AKEA 1G8FA 4TYNA 2JLYA 3IO5A 3U3JA 1L2TA 3SBEA 1XTJA 2FA9A 3NXSA 1XMVA 2QMEA 2JLQA 4I1OA 4C0JA 2X19A 1XCGB 2O52A 5EZ6B 5K8TA 1JPNA 2R6GA 3QKSB 4B32A 4B6EA 4C0KA 2GRJA 4FCTA 2ZE7A 2FOLA 3UATA 4EJSC 4A36A 2JATA 2YZ2A 4FMDB 3U3MA 3L0SA 5IK2A 4EPXA 3AF2A 4GZMA 1AQUA 4Q9JA 3KXLA 2RB4A 2W0SA 4DSUA 4QOSA 5LPNA 4PR0A 1WQ1R 3F8TA 4RD4A 1MH1A 5EXTA 2VLIA 2WSSA 4G5GA 1KY3A 2DCUA 1DO0A 1N6NA 5DSZA 2ZYUX 1ZU5A 3ZIAD 4P4SA 2REOA 2MSCB 1XTIA 3K0CC 5CM8B 4EPVA 1JXMA 4C0QC 4C2TA 2BDTA 1XCMA 2HF9A 3TUZC 1YR7A 4AG5A 2IUTA 4N0EA 8OHMA 2ZRNA 2ZAMA 3GJ3A 1T3SA 1XRJA 4A8JB 4W7SA 1CJMA 3FKQA 3TGPA 4OHXA 5KO2A 3LNCA 1MO5A 3TW4A 4AYTA 4MYCA 3A1UA 2OFWA 4XWKA 3PEUA 3AVUA 1OJLA 1UBFA 2RGXA 1RC8A 1NRJB 2O8BB 2ODBA 3EWSA 2XNSA 3RSOA 3K9GA 3QKSA 3BBPA 2HXSA 1V43A 3HR8A 2OFXA 1ZM9A 5F2EA 4QFMA 5H68A 1E99A 1P62B 2QZ4A 2BEJA 3SJAA 4M9XA 1SHKA 3ZQJA 3PFIA 3RWMB 3BS4A 4ZI3A 5CYOA 2XZPA 1DO2A 5FI1B 4TQAA 1KI3A 4O25A 3PITA 2EWVA 5JWHA 1S4QA 4WBSA 3WXMA 4LJ8A 2YVUA 1ZM2A 3Q7PA 4PZYA 1GIAA 4QGFA 4WIAA 1Z47A 4JL6A 1IM2A 5HCIA 1Q1EA 5KTYA 4S2EA 3X1YA 4GFDA 4EIWA 1HH4A 2JLZA 1VECA 3MMPA 4PHHA 2CLCX 4YONB 4LV6A 2QMHA 3O8BA 1E79D 2Z4RA 4MKHA 1XD2A 2P3SA 4TLEA 2ZI9A 1NBME 3FMIA 4K8OA 4Z54A 2A7QA 5CJ2A 5J40A 4W5WA 3L0PA 4ZCIA 5HZHA 4R7ZA 4TYPA 3T12A 1OE0A 4Q7KA 1VG8A 4LRWA 4P0TA 1SXJC 4B76A 1Z28A 2IS1A 2GEDA 3FPAA 1ZC4A 1ZAKA 2AD1A 2BV3A 2GF9A 1J8YF 1N6PA 5FL7D 5B64A 3LWNA 4Q18A 2OCYC 2W2TA 3CW2A 1GITA 3KDSE 4HB2A 4RFVA 4OQNA 3LVQE 4Y0AA 1YZUA 1VDZA 1W1WA 5FTLA 2J46A 1DVRA 5IT5A 4XOIA 1U9IC 3W8NA 3PEYA 1XEWY 3FVQA 3HPRA 4K81B 1G41A 3PUZA 1ZINA 2WKQA 1N0UA 5FTMA 5JLJA 5JI3E 1X8LA 4DCVA 4DCNA 2NO1A 4FMBB 1OH6A 1KAGA 3AF4A 1OW3B 4MYUA 5KPJA 4ZCLA 5C4GB 1XDBA 2OUKA 4BEJA 3ASZA 1SXJD 1AA9A 3KKPA 5TB5A 1SVOA 2F6RA 4UXJA 5JZVA 5FL3A 2B7CA 4WOPA 4XSGA 4D25A 4TMVA 2FEOA 3NBZC 4M2LA 5TARA 4CIDA 1RJ9A 4B3DA 3VTKA 2JLRA 2V9PA 5DI3A 4IHQA 4B2PA 4RFSB 3U4QB 2VYFA 2KE5A 4MKGA 1ZD8A 3SHWA 2ZRCA 4WVFA 5HZKA 5FOTA 3OEHA 3U44B 4MITA 4LUCA 4MUAA 4TQ9A 4BFVA 2C5LA 4KODA 3HR7A 2JGNA 5J47A 4D4JA 4QBIA 1AM4D 2QL6A 3CPHA 1ZIOA 3GJ0A 2F3TA 1R7RA 4KI0A 3AUXA 4IOKA 3EZ9A 2VP4A 2ODNA 4ZIRA 5KSZA 5KUTA 3J81k 4TL7A 1NP6A 4HB3A 3EZ6A 1ZYUA 3OAAA 1AS0A 1E3MA 3NBFA 4A0FA 2GDJA 4YDSA 2B8TA 2RGGA 1IAQA 3JZAA 4KBGA 2Q3FA 1R0XA 4FN5A 3NBYC 3CF2A 1E2KA 4PQFA 4TL8A 2AFIE 1MKYA 5AJXA 1W46A 2ZETA 1TNDA 2NIPA 1D2EA 4KFTA 4Q7JB 2FFHA 5EE1A 4A6XA 4J0QA 4Q4AB 3OFND 3SJBA 5G3YA 3WY9A 2Z5FA 2J7PA 3K70C 1S96A 1JQLB 2WM9B 3WP1B 4URUR 3CZPA 4BFUA 1PLJA 2LCFA 4RFSA 4B3XA 4CGZA 4LYFA 2AKYA 2YYZA 4P32A 4DDTA 3IIJA 4JJKA 4HYYA 5CB8A 3GQBA 1EESA 1Q1BA 2WKRA 3MGCA 3A4MA 2GEVA 3C7KA 3MWKA 1T0HB 2D7CA 4WXRA 3GPLA 2W6IA 1KKMA 2C98A 3RS0A 1L4YA 2XTNA 1MO6A 4MQBA 5E7IA 3EIEA 2WMNB 1W0JD 1NSTA 3K8YA 4X8HA 4UKDA 4BFZA 4R98A 2EFCB 1OH5A 2JJ1D 3TJZA 2ZJOA 2OILA 3A58B 4D6PA 3CX8A 4Z1MD 2BBTA 5AUNB 1KI1A 2ZYWX 2HV8A 2J5XA 2QGNA 3DPUA 4PPQA 3AVYA 4DDWA 2REBA 1M7BA 2BJVA 3H86A 4OBEA 2IF2A 4BFWA 2EYQA 3WYGA 1RYHA 2C9YA 4TL9A 2AK3A 4LC1A 3RDPA 2IT1A 1MABB 3L8YA 4M1OA 3C14C 2H8KA 2ZJ5A 1E32A 3KKMA 3TSZA 3G0HA 2ZI5A 1RPZA 2WJYA 4D82A 4HDOB 1JECA 2I4IA 4LHXA 4RD3A 4NL4H 2KBFA 1ODFA 1IY2A 1XCPA 4Q9HA 3U7EB 4F7WA 2GAAA 2PT7A 2ODEA 1CR2A 4QJ5A 5M1FA 2IUSA 1NVWQ 2FFAA 4OQMA 2D2EA 2EFDB 3HYTA 2F3RA 2JAQA 2J7KA 5JCZA 4XD7A 4KITB 5FTJA 2G1JA 1Z0DA 2QPAA 3MCAA 4LJAA 3H84A 5L3QB 4DEXA 3C6AA 3ZIAA 2IL1A 1HQYE 4M1KA 3BH6A 5FTNA 2VP0A 3WRYC 1ZVQA 3WMEA 4DXAA 2B7BA 2E1RA 4UNSA 2C03A 4KAXA 4MUBA 2ECKA 4PAQA 1AQYA 2CK3D 3FYHA 3N2IA 1YHNA 2Y8EA 3IKJA 5JEEA 4EJSA 1ZUHA 5DE3A 2JJ2D 4NP6A 1IONA 2A2ZA 2UZ3A 3EWAA 3MSXA 1M1YE 2Z4SA 2FX3A 3HU2A 4LJ5A 1W4AA 4Q7MB 5AJZA 5LB4A 2VO1A 3B8HA 5EUQB 3ZZTA 5FFMA 2CCGA 2QP3A 4TLAA 4BWYA 1MABA 3ADBA 1R5NA 1BIFA 1XF9A 1BO6A 2GCNA 3BOSA 5E3HA 4LV5B 4BLOA 3REFA 1BOFA 2PBRA 1N6LA 4Z51A 5IRCD 1KMHB 2QRNA 5L3RA 2PCJA 3IEUA 3K0CA 5GJVC 4B2IA 4DCSA 2NMVA 4RD1A 4F4JA 2W0MA 3SNHA 4NONA 4BLRA 2CVFA 4FWIB 1KI7A 3PEVA 1CJUC 1OIWA 2ZUBA 3GEHA 4EFMA 5J4KA 3ZS8A 3K09C 2E87A 1AGPA 1ZRHA 1Z0JA 2IXFA 4M9ZA 1MRSA 1TTTA 1ZCAA 1IBRA 3GJ6A 1ZU4A 4YMVA 1VTKA 4XJXA 1SULA 3RAPR 2WV9A 2GBLC 2HYIC 5JJLA 3EXAA 3BD9A 1RKBA 5FOVA 2BKUA 4EPRA 2VHQA 4M1SA 3W5IA 2HUPA 2O8DB 1KDRA 1E79A 2CL0X 1XU4A 5SZHB 4B73A 1NLFA 3CBQA 1U2RA 5CLQA 4M1YA 2LKCA 3SR0A 4XWOA 2QI9C 2GJ8A 2R6FA 3B2EA 3B7GA 4GZLA 2FMXA 2FEMA 4FD2A 4R71A 3ETLA 5B2ZA 4OHZA 1TF2A 4JYCA 4LSGA 3AF1A 4KSBA 3SJZA 2VP5A 3B1WA 4F4CA 4JS0A 1SVKA 4ZDWA 2I1VB 1UKZA 4M8NE 5DHFA 1M6NA 2VP2A 2A3RA 2XTZA 3REGA 5EZ5A 1QHYA 1E2MA 3O8RA 1PLLA 4EQ6A 3P4YA 3DOEA 1FNMA 2P0EA 5KDOA 1WF3A 2ZUCA 5FOXA 3VQTA 4LOAA 5G3ZA 2XXAA 4GP7A 1UADA 2CJWB 3AP2A 4PSKA 4ERNA 3GLGA 3KB2A 3I32A 3QJYA 5AJYA 1VIAA 1KNQA 1NIJA 4MGYR 1G291 1SXJA 5CITA 5KPDA 4OJQA 1R4AA 3BK7A 2WAXA 2OBLA 1N6HA 1YZQA 1UFQA 4JLNA 3QNUA 1N6RA 1C4OA 3HP1A 4U7DA 1JALA 3E2IA 4KV9A 4TMWA 1QHIA 2O8DA 2WMOB 2QPOA 1K6MA 2ZPTX 2F9MA 3DVLA 1DAHA 3OIVA 3OIYA 3UWKA 4DSOA 1KK1A 1U9IA 1J7KA 1G7CA 3Q5EA 4M21A 1E9SA 2PZFA 4PSVA 2DWQA 5P21A 2GHIA 4EUNA 1G6OA 5M1KA 1KK3A 4LX0A 1DAFA 1RFLA 2YINC 1II8A 3AKDA 3QXXA 1R0YA 1HA3A 4BFYA 5JSZB 2OE2A 2HDNB 3CNNA 3P4XA 3DM5A 1NNEA 2ZRKA 3CB4A 3LAWA 5CIQA 2CHGA 3K70B 4IFBA 4RD6A 1OXSC 1ZD1A 4DLZA 1F2TA 3AUYA 3EPJA 1TQDA 1A7JA 2ZJAA 3K0EA 4EAQA 4A8JC 2BBOA 2EFHB 4ASUD 1Z6XA 3QXJA 1AK2A 4CVNA 3QG5A 4C7OB 1CKEA 4B47A 5FR2A 2JASA 1X1SA 3OEED 4V0KA 3A36A 2CBZA 3OFNA 5BXQC 1GRQA 1HYQA 2J0VA 5AJVB 4QNRA 1SKYE 4PC7A 3GLHE 1Z0AA 1DARA 4PZZA 5M1NA 1CF4A 2OV2A 2O0HA 2AL7A 1OFUX 3U7FB 3CZQA 2V6JA 3SZRA 1G20E 2PEYA 1EG7A 3B5JA 5C2DA 1JEEA 3FE2A 4JLKA 4KHZA 1NKTA 4N1AA 3UK6A 3THYA 2AD5A 3B85A 4PFSA 4Z8XA 2J3EA 2AXNA 1NJFA 1RRPA 2PMDA 2R62A 4XIGS 2IW3A 5CM9C 3U3RA 1NY6A 3B6EA 3GEIA 3GLIE 2QM8A 2VSOA 4GMXA 2DWOA 1HT1E 3OIWA 4HEJA 5CLLA 4BZPA 5JRJA 5KOYA 4BPBA 1NI3A 2FF7A 4Q9KA 2YOGA 2WTUA 1W0JA 1HE8B 2ZRHA 5KSYA 4A1FA 2AKAB 4FI3C 1TEXA 1N5KA 1N0VC 2JJ1A 2FU5C 3CF0A 1WDTA 1QHXA 1FL9A 4MDFA 4NCNA 4Z1MA 1TUIA 4NE2A 1XTRA 5EXXA 1FX0A 1E9RA 3BB3A 2G77B 5CYPA 3C5CA 2XAUA 1G9XA 1I4TD 4PC3A 4P4TA 3K53A 4LPSA 4A0HA 4JBWA 4AIIA 1G3IA 3LXXA 3QXCA 4GDFA 1GTVA 1E9CA 2OLKA 2W2VA 3BORA 3FWYA 4X8MA 3ZVRA 1GM5A 2XNDD 3ND8A 2PJRA 1CBUA 4YMUA 5EUMA 1IXZA 3CLVA 1U8AA 1K8RA 1KO5A 1YU9A 2CL6X 3JVUA 1I4DD 2GTPA 1G4AE 4L16A 1Z8FA 3P27A 3LXRA 5F9HA 2FGJA 721PA 2JLWA 4Q5IA 5E95A 1X8KA 4H1UA 2F43B 1KI4A 3D8BA 2PH1A 4BQSA 1KDPA 5FPSA 4QBFA 3WNBA 4LHZA 2WICA 4W5HA 5A5GA 1UAAA 2ZE5A 3QPWA 4HZIA 4C0AC 1HURA 4HAWA 2WPDD 3IDQA 5EE9A 4B3CA 4B6FA 5GADl 2UKDA 4B71A 1GOTA 1Z08A 5BQ5A 3THWB 1EX7A 3TMKA 1GRRA 4LBWA 3VR4A 2Q3MA 2ZYTX 1GP2A 3VR6A 2GWHA 2JJ2A 3C15C 4IDOA 4JJZA 2D3WA 4TMZA 3E1SA 1E1QD 4IDQA 3VKWA 1SKYB 3GLHB 1E0JA 4U5XA 3U6KA 2FSHA 3K0AA 1XMSA 2MMGA 2Q9CA 1CP2A 2ERXA 4CDGA 2GESA 1DAEA 5DIFA 2XOKD 1G3MA 2VHCA 4YMSA 1RYFA 4MRNA 2QTVB 2D62A 1KO7A 5CIWA 1YVDA 1JI0A 3RS4A 5FOWA 3IILA 1BYIA 2ZRPA 3MAAC 3GLIB 4OKSA 1JAIA 4ZCMA 1QDEA 3ZZ0A 1OYYA 1A4RA 2DWPA 4F4IA 5JBQA 2P5TB 2W2XA 1LTQA 1QHHB 1Z07A 1KJWA 4DHEA 1XPOA 4NZYA 3M1IA 2DFTA 4ZO4A 4Q9IA 2VSXA 5C12A 3ZVNA 5D3QA 5K8LA 1A82A 4OQFA 4M9SA 4RZ2A 2JEOA 2Q3HA 1HUQA 4JLPA 3ZH9B 1IXSB 4YMTA 1XFAA 3CONA 2R6DA 2ZITA 2IF0A 1XX6A 3PR1A 5EP2A 2KI5A 5A4JA 3IUYA 1NIPA 4US2R 1U8YA 2ZRIA 3OESA 4OI2A 2QM7A 4QBHA 1NN1A 1E2FA 1WA5A 2HYDA 4I1VA 1X8JA 3SC3A 4I4LA 5AK0A 1E9AA 1E2LA 4G5QA 2AWNA 4RCZA 2FN4A 1ZMXA 2NOAA 2QG6A 2YWHA 3QKUA 4I99A 2HLDD 3K09A 3W5JA 4A2WA 821PA 3KZ1E 1AKEA 1U99A 2IYVA 4KFSA 5JJIA 3EA0A 3KJEA 5G40A 3T15A 4AURA 1E9BA 1JPJA 2CDNA 2H18A 3NKVA 4HDCA 1W4RA 3TSOA 2GBLA 4JVSB 1NBMD 2PLFA 1Q1ZA 5CDFE 3B13B 1KSHA 2ZAOA 2IS4A 2X2FA 2OZEA 2BCJQ 3RRNA 3RS2A 4WW0A 4FWTA 1W49A 1KAOA 2QN6A 3T1OA 4Q4JB 2CNWD 3S1AA 3AKCA 2AK2A 1G6HA 5EE5B 1N5LA 4M1TA 1E96A 4AG6A 4I81A 1NN5A 1M7GA 2WWHA 1XEXA 1GZSA 3DMDA 4XD7D 2V7QD 3VU9B 1NJGA 3LDAA 2G1KA 1IN6A 2HT6A 3K0FA 4LY6A 3SN6A 1YRAA 2ZRBA 4KXFB 4OQLA 2GJKA 2PEZA 3SI7A 3PUWA 4DT1A 2XB4A 2HJGA 3QSYA 3VX4A 5EQTA 4YLGA 1DG1G 1OT3A 2QORA 1L8QA 4GOXA 3IO3A 1X1RA 2QAGB 4D0LB 2JA1A 3QPVA 4HB0A 1MT0A 4WXPA 5AJWA 1HE1C 5EP1A 3V4FA 3AF3A 1A2KC 5TV2A 2D4HA 1G3RA 3FHCB 3PG5A 2REXB 4G5SA 4V03A 1J70A 3KKOA 3QEJA 3NDBB 2F9LA 2CHQA 3ZD7A 3AVOA 4IXNA 4B3FX 3IPYA 4JVMA 2ZANA 1XNJA 5M04A 3L0OA 2WOOA 2QBYB 1G7RA 1YR8A 1Z29A 4YMWA 1XEWX 1NLYA 2FPMA 2ZSBA 2RH5A 4E07A 1G5TA 3DM9B 4ASUA 1XBTA 4KO8A 1X86B 2O5VA 1W5SA 4LZZA 3P32A 2ZQ5A 3OEEA 1JNYA 3TIFA 5AUOB 1U0HC 1FPMA 1L4UA 2C04A 5LB2A 4Q01A 1AZSC 2IYWA 1E2HA 3AP3A 4M22A 5LDDC 5JMTA 3AEZA 1P7CA 1WXQA 1ZUIA 3TR0A 4G5RA 1F2UB 1OFHA 1T91A 4M9QA 4OHVA 5JS8A 3PXGA 4A92A 4RY2A 4X8LA 2K5UA 4CEHB 3LRPA 4B3BA 2QP9X 2VPPA 3A1VA 2QE7A 5JJKA 3EC1A 1E69A 3RS5A 3TRFA 4AKGA 3RRZA 1KHTA 4OL0A 1F48A 4GBMA 5E4FA 2RGBA 4A8JA 4CT5A 3RANA 4OHYA 5GVSA 1VCMA 3VAAA 3DDCA 2QNRA 5BYJA 3EPHA 1BS1A 1LS6A 2WOJA 3A1WA 2O8BA 2AX4A 2VHUA 4O0MA 3IHWA 3WNDA 5L3SB 2A5FA 4JYBA 5B58C 1T9HA 4Q4LA 3W6NA 4GSYA 1C9KA 2BEKA 2FPKA 3AP1A 3QQ5A 5J4HA 4YXWD 1VG0B 5FOSA 4RZUA 3RLFA 4PC6A 521PA 2IYLD 4NYJR 1P61B 3UG6A 1N5JA 1F5NA 2VF7A 3OE7A 1KI8A 3WBJA 3I73A 2XNDA 2ORVA 2ZJYA 3P1JA 4NCJA 4JVLA 3EPKA 2X1VA 3LQRA 2AXPA 4HI0E 4DLYA 3KQLA 5BN3A 4QHSA 1YZLA 1D9XA 4TN1A 4GI7A 1KI6B 1QF9A 2CMKA 1H65A 3FMOB 1U94A 3WBKA 4FCWA 4OHWA 2YKGA 1N0WA 2QA5A 2WWXA 2BCGY 4KVGA 3BFVA 3CX6A 2IK8A 4F92B 3M0EA 2P6NA 3MRSA 3IQWA 1KJZA 2KBEA 5J4VA 3TKLA 2BKEA 1NSFA 1O87A 2H16A 2P6UA 3B1ZA 3RABA 1J2JA 3QKRB 2FSGA 2GVDC 4L9SA 4FCVA 3SOPA 1JQJC 4Q1CA 3GP8A 3UKDA 3EIHA 3RC3A 2QQEA 3VFDA 5J4YA 4IKEA 4US1R 4EFNA 5C18A 2GEUA 3LVRE 4G1UC 3NHAA 1CULC 1G7TA 4DIEA 4KYUA 4Q00A 1UEJA 4MRVA 2ATXA 3THOA 1JEDA 4JLMA 2W6JD 1OXUA 3M4YA 3RS3A 1S2MA 1E1RA 1ZIPA 2Z0MA 1QRAA 3BIFA 4Q02A 1LY1A 1E1QA 3FFBA 1GILA 4CEJB 4IVQA 2GCOB 4IJMA 2C9CA 1X6VA 4PPNA 2BMJA 3DL0A 1KOFA 2W83A 2XTMA 1E0AA 1WP9A 2G0TA 4DKXA 1Y63A 1EFRD 3CRMA 4A2QA 2XOKA 2AWOA 5TMPA 4Q1DA 2QENA 4IEIA 2ZI7A 2V6IA 3IQXA 1JR3E 3T35A 3H1TA 1KSJA 1XZPA 4QG7A 2FZ4A 1K5GA 1CXZA 1QZXA 1T5LA 4DEYA 3U6BA 2Q21A 4M1MA 2XSZD 4I1UA 4GOJA 3CR8A 1T5IA 2DYKA 2IX3A 2IYTA 3FFAA 1P5ZB 3TE6A 4PC1A 4URYR 3U4QA 1MOZA 4UNQA 3QKRA 2EYUA 3WYAA 4V0LA 5H70A 4Q1FA 2GJSA 3SQXA 3U44A 2GCPA 4LYJA 1OXTA 5LD2C 2OT3B 1T8TA 5GJWC 3GJ7A 1SVMA 2OESA 2VSFA 2JDID 4HUQB 4FIDA 5L8VA 4F93B 4CEIB 1YR9A 4XTCS 4Z8YA 4NYJQ 1MR3F 4MGZR 4K46A 1OIVA 4JLBA 3NWJA 4ARZB 4HLUC 4FMDF 2ZR7A 2ASEA 4LGMA 3K70D 6Q21A 4JT4A 2J0QA 2CHVA 1R10A 1UDXA 2HLDA 3LQQA 2QAJA 2OO7A 1ZM3A 1E0KA 1G19A 1LB1B 2YHSA 4BUJA 2ZJZA 1W7AA 3KJGA 2EWWA 1DELA 3UMFA 2F1IA 4KVAA 4QBGB 4ZPXA 2GKSA 4AD8A 3AF0A 1CR4A 1GG2A 1R8SA 4H9GA 1NBMA 4Q4AA 3R7WB 2ZM5A 4OI0A 1HTWA 1E4YA 3CWZA 2BVNA 4TMXA 4TQUS 3CX7A 4E09A 1KSGA 1OF1A 3GFPA 1CJTC 2JJ8A 1NVXQ 3KUDA 2CNWA 2IWHA 1KY2A 1R8QA 2YWFA 4HDQB 1PV4A 2B6HA 1RVDA 2Q0HA 3NBXX 1RIFA 4ZDKA 3VNVA 2HXYA 3EA5A 1IN4A 4BLTA 5JS7A 2O8EB 2ATVA 1W4CA 2V7QA 2GJ9A 1NY5A 3MD0A 2IXEA 4LJ9A 4WAUA 2G83A 4UNRA 2C2HA 4D0GA 3NEJA 2WWGA 3C41J 4ZKDA 4HZUB 2CVHA 1RRCA 2YNMA 4RZ3A 3IEVA 3Q9LA 3P20A 2ZRJA 3N5CA 3I92A 4KCGA 3PEWA 4AKHA 3F0TA 4RKEA 1U8ZA 4DLXA 1GL9B 4CF7A 5F98A 1TL7C 2EW1A 3ZDQA 3CPJB 4BZXA 4DLWA 2ZVPX 2Q9BA 4NYIR 3EZ7A 4GMDA 4O2RA 3DOFA 1LFDB 2GXQA 1EFTA 1E2EA 1KGDA 5KNBA 3TAUA 4FMCB 1VG9B 2WJHA 1UBCA 2OXRA 2V54A 2LWIA 2NPIA 3BC1A 3CO5A 3QIAA 1OH8A 4B48A 4JZKA 1YZNA 3WMGA 2PX3A 4BEBA 1II0A 3PV0A 2VIIA 3SHFA 4ZV4A 3PUVA 5JFGA 1QBKC 1N25A 3H2YA 1UBEA 5M1OA 2P2LA 1IN8A 4MRSA 4PZLA 4TZ0A 4BRUA 2R6AA 2WZQA 4I1SA 2EFGA 2AN9A 4LYAA 3I5YA 3WHLA 2R6CA 3EAQA 4L4UA 3CF6R 4GRAA 5J5CA 1E2IA 5L3QA 2QPTA 2QGZA 1JAHA 2ZI6A 2ZRMA 2JLSA 4M0LA 1IY0A 1KDTA 4D2IA 1LVGA 1CEEA 1S1MA 1SHZA 5KYKA 1SZPA 1DTSA 2OSBA 2WJIA 4FW9A 4HZUA 2EVWX 1J99A 2WWIA 2QU8A 1IY1A 1EFUA 5FUYA 2OM2A 3VMFA 2A30A 3LLUA 4JKYA 3R20A 4G01B 1Z2AA 1EX6A 1R5OA 1U90A 1UDWA 1CLUA 4ZDJA 1GFIA 1XMIA 2ZSDA 4Q19A 4F91B 4Y0VA 5GJCA 4H1VA 3E70C 1T0JB 3A4NA 4BFSA 1AN0A 3RYTC 3FTQA 4DLVA 5K8UA 2Q6TA 1G8PA 4G5OA 1AS3A 1XJ0A 2C9OA 4O2LA 2NZ8A 1OFIA 1T4GA 4NU0A 3RS7A 2YWEA 4TYWA 2ZU0C 1KMHA 3SYNA 4YXWA 4ITRC 2ZSAA 3TSWA 4TZ6A 4QKQA 2OCBA 3D7MA 4LJYA 1KK0A 2IWRA 1S0UA 1S3SA 1ZP6A 4LHWA 4PC2A 1IHUA 3HJNA 3CNLA 3MWLA 3THXB 2CLDX 3H0KA 2ZS7A 1PUJA 3LX8A 5HCNA 5EXPA 3AV0B 1COWA 1F60A 4P4UA 5FBRB 1W48A 4OI1A 4KFRA 5JCPA 1CIPA 3MWJA 2J45A 2VBCA 1AGRA 2YC2C 3L0IB 4GNKA 2JLUA 4Q1EA 4MA4A 1D9ZA 5D3MB 4NYIQ 4C0SA 3EZFA 3NC0C 2FDCA 3D6TB 4RJLA 4MYHA 1NVUQ 3DZ8A 3K9NA 3MUFA 5EE0A 1BMFD 5M1PA 5JHGB 4A4DA 4DLRA 3TR5A 1W44A 3ADKA 4JVNA 3SU8A 1GNQA 421PA 1VKJA 3T34A 5J4LA 1ZD9A 5C15A 1PZNA 2ZR0A 1CU1A 4PAOA 4RZXA 2QQ0A 4PQYA 2J41A 3ADDA 2W6JA 3R8FA 1G5PA 3CH5A 1D2MA 4DLUA 2OAQ1 3B1VA 4ACBA 3X1XA 1G1MA 2QP4A 1XPRA 2QAGC 2AR7A 2ZTSA 5C4MA 2CJWA 2IHBA 3TBKA 4DVGA 4EFLA 1EFRA 1TEVA 3KKNA 4LCBA 1HY3A 3I62A 3THXA 2CE2X 5DYIA 4D0NA 1ELOA 3TLXA 3UXMA 2NGRA 3RRYA 2J0UB 1GNRA 1OIXA 3NH6A 4ABYA 4DDVA 5LD2B 3ECCA 2VP6A 1NMXA 5SZIA 4BLQA 1CR0A 2X77A 1A2BA 4JSYA 4PHTA 2A5JA 4B43A 2XSZA 4A82A 3GD7A 3LW8A 1IN5A 1CRQA 2KJQA 4XVRA 1W2GA 1DPFA 4LC0A 3EX7C 3GLFE 3FGNA 1VYVA 3QPUA 2XB2A 4LBVA 3RWOA 4RSGA 3LLMA 4B74A 3QG1A 4Q47A 3KUCA 1US8B 4RKFA 2QE7D 2ZJ8A 3HU3A 4OK3A 1S9HA 3Q72A 4WZBE 3ZYCA 3B1YA 3ZS9A 1KZ7B 2JDIA 4UJ3A 2RAPA 1LS1A 4HAXA 1NG9A 2FG5A 4UQOA 3X1DA 3AH8A 5JSZA 3DO6A 2O8CB 4ZI2A 4NH0A 2IEZA 4US0R 1UM8A 2H1LA 2ERYA 4IOJA 2OCPA 4Q1AA 5IDVA 2IUUA 1LF5A 1SVIA 2ZE8A 2GA8A 4TLBA 4EPTA 1E94E 1ZC3A 2XEXA 2ZYVX 2RGCA 4XTRA 1Q0UA 3SE0A 3W6OA 4BZQA 1W5TA 5BW8A 5TXGA 4IVPA 3HYRA 1XEFA 4HLCA 3LH5A 2NO9A 1J8MF 2I1QA 1RZ3A 4IOLA 3LV8A 1D2NA 3AVWA 1ZCBA 2QROA 4PQRA 1ZJ6A 4C7OA 2BBWA 1GSIA 4LPKA 3QF4B 5G53C 3OE7D 5G41A 4A6PA 4TL6A 2R8RA 4BGDA 3D31A 5M1QA 5KNCA 2CCJA 3JVVA 4AY2A 1U0JA 2UVQA 4EPWA 1Z06A 1Q3TA 2XJ9A 2OAP1 3HDTA 2DFNA 3KQUA 4PSAA 2F55A 1UEIA 3I61A 3KFXA 2HEIA 2ANCA 4HLUA 3W9YA 4U02A 4A0GA 2WHXA 5JHHB 1CTQA 3SS8A 1ZNWA 1CRPA 4KJZA 2QTFA 4Q66C 1DG3A 2H5EA 3KJHA 4C3ZA 3FKSA 1E0SA 3KL4A 4G0NA 2QSYA 2V8OA 3V9PA 4QJ4A 4HUTA 2N1BA 2PL3A 4RVCA 2HT1A 3AGPA 4Q1BA 4YC7A 4KLNA 5ELXA 3QF7A 3TK1A 3BB4A 1P4SA 1QHGA 1MO4A 1R0WA 3CNOA 3IBYA 1T3HA 4HAUA 1KTVA 2D06A 3QEOA 4QXAA 4R9UC 1E1RD 1H8HD 2B8WA 1XPUA 4WZ6A 4FXPA 2C96A 1GKUB 4KFUA 2PT5A 4DUGA 2RHDA 3NVAA 1VIYA 1Z5ZA 3KXIA 5SZKB 2FSFA 1ESMA 1OHHD 4LI0A 2HJVA 5H8WA 4GL2A 1G16A 4HSEA 3GLFB 1Z6YA 4D26A 2J87A 1XTQA 1KDOA 4MKIA 5FPYA 4TYYA 1WE2A 1VCNA 2BM0A 4DB2A 1E2JA 4EPYA 4LV8B 5F9FA 5EP3A 3GCGA 1W47A 2IYUA 4PHGA 4A2PA 4MDEA 5DGXA 1Q1QA 3ONWA 4RD2A 3VR5A 1Z22A 3TUIC 2F43A 3JZMA 2O8FB 2ZRAA 3EARA 4RCYA 4AYXA 2XZLA 3QXSA 1NN3A 5DNYB 4URZR 2R65A 3UG7A 2BBSA 4B34A 3GJXC 3DZDA 1Z0IA 2RGAA 3CM0A 3H4MA 3UMSA 1GL7A 4AKEA 1XJCA 1UKVY 3AB3A 2NO7A 1E2QA 4CRWB 1PUIA 1OV4A 1P75A 1S1CA 2FV8A 3THWA 4NKRA 4UNNA 4HATA 1QVAA 2IYYA 3RVBA 1N6KA 3VX3A 1OLOA 4DC9A 4C9BA 3CRQA 1FFHA 3AVQA 5DN6A 5DLQC 2AFHE 2ORWA 2OHFA 3GLHA 4QRHA 3N2EA 1SVSA 1X3SA 3GLFA 4EDHA 2FGKA 2EFEB 4D4LA 1P9NA 2GXUA 4NPHA 2ZR9A 4P4SB 3A8TA 1IJEA 2FFBA 3SDZA 2CL7X 4B44A 2OXCA 3L43A 3Q7QA 4BE7B 3EZ2A 2GZAA 3I1FA 5B30A 2H7VA 1KKLA 4QHTA 3TVTA 3GLIA 1JXOA 1SQ5A 3QBVA 2EQBA 4ESHA 4IXMA 2NO0A 4LK2A 1UKEA 2G6BA 1QHHA 3UWOA 2O8FA 1RW4A 4BECA 4DWJA 1Z63A 1SKQA 2IYZA 2P6RA 1FQJA 3RRMA 4PO9A 3CUEF 3AVPA 2ZJBA 1OYWA 3L2OB 1W4BA 1NMYA 1SVLA 1D6JA 2OBMA 3WYFA 3AKYA 2IEYA 3K1JA 1TPZA 5FBWB 4QM7A 1KO1A 2X2EA 3ICEA 3NIBA 3T06B 3LBHA 1SGWA 3LBNA 1WBDA 5FH9A 1U98A 3U7GA 1BMFA 2MMCA 2V1XA 1ZNXA 4LBZA 4NMMA 2O0KA 4IRUB 5E7MA 2BIFA 3KQNA 1J90A 2N42A 3ADCA 2ZI3A 2GVZC 3LA6A 1YQTA 2ZXUA 1FTSA 4TWZA 2NTYC 3MLEA 4ACAA 3BB1A 1EWRA 2FSIA 4GPTA 4D81A 4AKIA 2VQSA 3B78A 1W36B 1FOEB 1JJ7A 3IBGA 2B92A 2A5GA 1E6CA 3F3YA 1Q20A 4HAVA 4MGIR 1OB5A 3NH9A 4S35A 1XD2B 1E4VA 1IN7A 4IDPA 4M4SA 2GK6A 3O47A 3RC8A 2SHKA 1P73A 3SQWA 3BWDD 4TTRA 1FMJA 4CT4B 5A0FA 4JMPA 3CPEA 5BN5A 1DAIA 1OFTA 4Q4JA 4GP6A 2H92A 4N3NA 1HEIA 3FHTA 2D7DA 2Z83A 4TMKA 2F1RA 1NG1A 5JECA 1JJVA 3HU1A 1BH2A 4V0ME 1PVOA 3VHLB 2N46A 1MRNA 1XP8A 3ZJYA 5HPYB 4XVQA 3VU9A 1UKYA 2C95A 4R2HA 2RKOA 4XSHA 5BYKA 1R0ZA 5K8IA 4YQFA 4TT3D 2P67A 2CXXA 4N0DA 4KU4A 4NHOA 2ZE6A 4P3YA 4QGGA 1KI2A 2QAGA 1CS4C 4CZ2A 2BHRA 3MJRA 4BASA 1P9RA 2HCJB 5C1BA 1IJFA 3AQ4A 3X1ZA 2XZOA 1JR3D 4E03A 2IBMA 1QG2A 1OKKD 1C1YA 3A4LA 2R44A 1W0KD 1U0LA 1G3QA 4U00A 3ZD6A 1I2DA 2G0NA 1FQKA 4MYTA 4V02A 3CRVA 1RJ9B 2MSDB 3M6AA 4ZDIA 2QBYA 2F1JA 5KNDA 1HV8A 5DI3B 4LBYA 5KDDA 3UMRA 5JEDA 3CRW1 1NN0A 2JIZA 1AIPA 1I2MA 1G3UA 1S8FA 3TVDA 5C2FA 1M34E 1R2QA 3L82B 3HPQA 4TMTA 4MH0R 2YOFA 4BFXA 1TQ4A 1II9A 3OIUA 1DS6A 2Q9AA 2CLSA 1VMAA 4QL3A 4E22A 4V0OA 3W8RA 3SEAA 3QXHA 4D4MA 4NBSA 5HKKD 1F2UA 1COWD 1DAGA 3OHMA 5TDHA 4ZIRB 4GT1A 4B75A 2RMKA 4AYWA 3B9QA 1ZBDA 4WZAE 4CEHA 2PZGA 3BERA 3VR3A 1YRBA 1LW7A 3R8CA 2BMFA 1QHNA 1Z3IX 3KQHA 3B60A 1BKDR 1I4LD 3VKGA 1P60A 1KIMA 2P65A 3NDPA 4OYHA 5CB6A 3R9IA 2ZI4A 5CDFA 4Q03A 1FNNA 1FP6A 4DJTA 5CJPA 1A1VA 1DAKA 3W90A 1ZM7A 4L15A 4PTLA 3PIRA 1ANKA 3NHBA 1TX4B 1GWNA 2KB0A 4JL8A 2CCKA 5L3SA 2G9NA 1GAJA 3BH0A 2AHOA 1T8UA 1VCIA 3PCRB 2QEQA 4QNMA 1KNXA 1H8HA 3V00A 2YJTD 1RRFA 3IGFA 3IIMA 4DBLC 5JWRA 4JLAA 1HQCA 3ASYA 4BRWA 3TH5A 1L7VC 3NTUA 3QY0A 5DH9A 3C5HA 4URXR 3PUYA 3WHKA 4IEEA 4XH9B 4OQXA 1OHHA 1H8ED 2VHTA 1R5BA 4DDUA 1YZTA 2A78A 1EXMA 2X8AA 4AK9A 4PO1A 3BE4A 2GILA 2ZRDA 2IC5A 4IDHA 1AJEA 1PLKA 1KI6A 1R6BX 1GNPA 1E2DA 1XD8A 2OEPA 3KX2A 3RNLA 2XITA 4URVR 5IHPA 3U60B 2NZJA 2WBLC 3K9LA 4AWXA 4KSCA 1GUAA 4DSTA 2RGDA 3SYKA 2QMUA 2QSZA 2XX3A 4HAYA 4TLCA 5KU1A 1S3GA 2IA5A 1RE0A 3DKPA 3FMFA 4Q9LA 3LW7A 2WAYA 2IXGA 4JLOA 1TADA 2BWJA 3C8UA 3F5FA 5FPTA 2GXAA 3QVVA 1JBKA 3GFOA 3A1TA 2CEAA 4KLZA 4NCKA 2FZLA 4UXHA 3EW9A 4QGAA 4MKFA 4OI4A 3T1QA 3KB1A 4C30A 4V0MA 1YKSA 5FUXA 1JB1A 1MO3A 1A5TA 4CEJA 4MRRA 2GCOA 4M1WA 5TVKA 1YZKA 1DEKA 3U7HB 1FUUA 5BN4A 3SBDA 5DHAA 4DB4A 3PJRA 1YZGA 3CR7A 3D3QA 4JLJA 1ZUNB 5JWOA 1VYTA 3MJHA 3AVVA 1G64A 2D2FA 3R9XA 3PENA 1E9EA 3GLGE 2A5DA 4URWR 3C6HA 1SXJE 4P33A 3WP0A 4DRZA 1XJQA 4KBFA 4R2IA 2GAOA 5C2JB 1OSNA 3EASA 1NL3A 3G82C 4EJSB 1G7SA 3MFYA 5FTKA 1N3BA 4JLDA 2BJWA 2F7SA 3V4RA 4BLSA 3FB4A 1XD9A 5FBLB 2J9RA 3U3KA 5FPHA 1KK2A 2ZVQX 2DHRA 1NMZA 3BFKA 4C4PA 4HLDA 2BC9A 3VNUA 3G5UA 1KZGB 2GNOA 1Q44A 4M53A 1TF5A 2FWRA 3EG5A 2YWGA 4HUQA 4UJ5A 3BFXA 1OH7A 2KSQA 1LNZA 5B57C 4TSFD 2FH5B 3FKSD 4CEIA 5AUPB 4OK5A 3RSLA 2QTHA 5GJBA 1E9FA 2RGNC 4UNPA 4B35A 1IQPA 2RHMA 3WNCA 4ARZA 2FFQA 5HR5A 4WA7A 3UPUA 1EWQA 1K5DA 2R9VA 4NTZA 2VH5R 3W3ZB 4X8OA 2HCBA 3CWQA 3QI2A 1AS2A 2BMEA 3VHXA 1NVVR 3LBIA 2C78A 2ORIA 1G8YA 4IDNA 3EPLA 2DPXA 4JIMA 1DADA 4DUGD 2DY1A 2RCNA 4PX9A 3T5DA 1AZTA 1G18A 2YOHA 2QT1A 3R7WA 3B9PA 3GFTA 3ZQ6A 2IHYA 1UJ2A 1P6XA 5TY0A 4ILEA 1S9DA 5FBQB 2WWYA 1M8PA 2QMOA 3FDIA 5AWFC 3WRXC 4D80A 1G4UR 5AR1A 3A1SA 2A5YB 2IS6A 1TU3A 4C0LA 1FZQA 3FMPB 1CR1A 3ZZUA 4A0RA 3IIKA 4C0BA 2I3BA 4POAA 3A37A 2D74A 1BYUA 1KYIA 3BAFA 3T5GA 3Q3JB 4B2LA 4C2UA 5FOUA 2O8EA 121PA 3SYLA 2V4ZA 1ZNZA 2V3CC 1M7HA 2CE7A 1TQ2A 1VCOA 2IS2A 4TT3A 1GKYA 2J59A 2B21A 3NC1C 2ZU6A 3T61A 4PPFA 2BOVA 1YR6A 4EQ6B 2FJUA 5C46F 3QOFA 2TMKA 2VRWA 3GJ8A 1P9WA 1Z0FA 4LJ7A 1TF7A 1E2GA 3KXKA 4TTPA 2XXAB 1LF0A 3B1XA 4JSTA 3DMNA 1JR3A 2WJGA 1TMKA 4BFTA 2ZRLA 3GLGB 1OKKA 5DN6D 4IFEA 1SXJB 2OG2A 4LYHA
chains in the Genus database with same CATH superfamily
5FYDA 3WDMA 4ZMBA 1Q1NA 1WW8A 2CFOA 5EI5A 1QKIA 3WMWA 3SCZA 4BLPA 3O8CA 1JXAA 2QUZA 2TMDA 3OMXA 3CB2A 2VWJA 4LDJA 4M0PA 1IM8A 5FL7A 3T1VA 1FEZA 1O3YA 2FVXA 4IJUA 3L6BA 4JT2A 5L3VA 2VC2B 3BRWD 3MG9A 1PFQA 3ORRA 3BGWA 3QBTA 1DBSA 1RHRA 2YHYA 1U49A 1KVUA 3C65A 1JHZA 2JFWA 4AF1A 1ZVKA 1SAZA 3AVTA 4PY5A 1WUKS 1GFWA 1C9JA 1Z83A 4L07A 1L5VA 5KC8A 4KPGA 4XLZA 2QZPA 2RHBA 4PO8A 2GSWA 3O8NA 1Q0RA 3TCXB 3KJVA 1LV5A 3VVCA 1WCIB 1FX0B 2FPGA 2UXCB 4RX1A 1X9GA 1E6MA 5AYVA 2E6UX 3X43A 1G8GA 4ZAYA 3RM3A 2SBTA 3EVTA 1U48A 1Y3AA 2ASOA 3CD6N 3VR5H 3VA7A 3MBIA 5BNZA 2ZT6A 2JD1A 1FMCA 5BSWA 3OCCA 3V6LA 4BNWA 2BFMA 1HYZA 4HHTA 1ZW6A 1BVRA 4CCSA 1CZNA 1M6WA 4L9WA 5AQPA 1YI1A 3BRCA 4P5EA 1KP9A 4CLXA 3GU3A 2ZREA 1FUYB 1DKRA 2HMYB 1CJVC 1RT5A 2QQGA 1VQKN 2PKQP 5K20A 2PMKA 5T5QA 3DEYX 4RD0A 3U8XA 3FOZA 3OT1B 3I53A 3I3SR 4LVOA 2B2NA 4PS0A 4I1RA 5LMNB 1N5OX 1P1FA 4DS5A 4FVUA 2TMGA 1GKIA 5BSFA 4QARA 4IIXA 4UHCA 2WKPA 4L27A 2GAIA 4DIFA 1ZGZA 2RG1A 4MGKR 2KYRA 4DLBA 5HKBA 1MX3A 3G6KA 2JJQA 2OCAA 3DBHB 4EF4A 4DJJA 2KLAA 6YASA 4F3CA 3EMDA 4E5UA 3E18A 1TM3E 4JWKA 3NJ8A 1GQOA 4LJ6A 2W6ID 1VSTA 3I37X 3HXMA 3DMTC 4HVCA 1T8RA 2C4MA 5HRCA 4UVEA 5ECYA 1RHJA 1LUAA 3FOAA 1EVEA 1RMTA 2RONA 3RH0A 5AKXA 1YI2N 4RW8A 1CY4A 2BTFA 3ZETA 3N7AA 2O52A 1S7CA 2H2IA 4W5NA 2GUPA 2I22A 2GRJA 2PIDA 3EVZA 5JYCA 2ZJFA 4EPXA 4U2FA 4MV1A 4DSUA 1V8FA 2VWGA 1NW9B 1A9XB 3N2GA 4MS4B 3DMYA 4FYWA 3OU2A 1GKLA 1FMTA 4KRYA 4Y0NA 1QR2A 3K0CC 2Y1FA 4C76A 1YR7A 1GAEO 1RT4A 4BNFA 3LDQA 3NTOA 2RBGA 2QRVB 3JQAA 1YTUA 3D7KA 5KO2A 4CJKA 4R3NA 4MVJP 1RILA 1TCCA 3DBRB 2OYQA 5LL6Z 1NK8A 2JK0A 3HR8A 1NDQA 5C7LO 3N2ZB 5FWYA 1QRSA 3DPIA 3WIVA 3UV7A 1X9WA 3LVBA 1IM2A 2Z2YA 3ZV4A 2FWPA 3JQ8B 2Z4RA 3D1JA 2APJA 5CT9A 1GUZA 1PFGA 3RSSA 3IOMA 2ZIXB 1ZC4A 4LFCK 1DC3A 5HFJA 1ABFA 3P39A 5DNVA 2VJPA 5I7WA 4RTQA 3EQ2A 3AL0C 3LVQE 2HFKA 4DQSA 2N1MA 2NTNA 2DPMA 1MDFA 3TDMA 2VHVA 4MQLA 2PKEA 3KHYA 2EP8A 1L7AA 2V7EA 1UK9A 4LDNA 4HVLA 2FN8A 4NQRA 5SY4A 4M54A 1N36K 3EBOA 1ZHFA 1M6EX 4JI0B 4S1WA 1O95A 2IODA 4D4JA 5AM2A 3LANA 3VSBA 3SEFA 1R7RA 2DZDA 3EZ9A 3RSFA 5DLDA 2I33A 4AH9A 3X2EA 1AS0A 1E3MA 4ZICA 1Q74A 2B8TA 4AHCA 1PYDA 2FPWA 3FYUC 4MHSA 4GDMA 2V7BA 2NIPA 3ELWA 5KAPA 3QVGB 1EAMA 3WG9A 2ZBVA 5EUBA 1WVIA 5ALJA 5JE8A 4MEJA 1GZ7A 5AXDA 1WTAA 3NQ41 4B3IA 5E7IA 1T3ZA 1E1NA 3LS2A 3RIMA 2QLTA 4N6NA 1YC2A 2H1CA 4I8IA 3RIXA 1XRSB 2V9CA 1DZ3A 1R0BA 2JGFA 2QGNA 3MNFA 3AVYA 3L9XA 2REBA 2C9YA 2IT1A 3LCRA 3E9OA 3PJDA 4QEDA 1LRKA 1V35A 2ZWMA 2JH9A 2PT7A 4MW1A 4QJ5A 2FFAA 1GGHA 4CK2A 2ZG6A 1RRKA 2UUCB 4DEXA 3FA2A 2QLMA 1GGKA 1Q17A 2YXBA 2DTDA 2ECKA 2CK3D 3A6LA 3NC4A 4RABA 4ZJYA 3F98A 5CA0F 1FUEA 2JJ2D 1ZGJA 4MIOA 5AICA 6ADHA 2PGOA 3MCVA 5SV2A 4JEUA 1F8XA 5L3RA 4BLRA 1IG0A 4YOYA 3B3FA 3GEDA 3P9IA 4HMPA 2F62A 2NU6A 4KXVA 1ZCAA 1XDZA 2F48A 3ACCA 2J6HA 3F7OA 3ZE0B 4F8RA 2BKUA 2VHQA 2FZVA 1KDRA 4LZLA 4YUWA 1P1KA 1JLCA 3QBJA 2FR8A 4LOIA 4NS1A 2GT1A 3LCMA 4FD2A 1AUXA 4XB1A 2CFSA 4MIEA 3V4PB 4OKNA 2Z8YM 4JS0A 3AO4A 3LP0A 1WTCA 3WNQA 2D4AA 4G9ZA 5GIOA 2J48A 4XH4A 3EMBA 3STYA 4LOJA 1SO8A 5FOXA 4HYTA 4KQ1A 3AP2A 3OY2A 4ERNA 1VIAA 1NIJA 2E55A 3NBAA 1N6HA 2PUWA 1NFRA 4XUCA 2CC2A 3BFPA 1JJFA 3UWKA 4YYEA 1K97A 1J7KA 4MYDA 2W6LA 2DMRA 1KRHA 4DABA 5IWCA 4M60A 3ZBQA 3EYWA 5B3JC 3UAWA 4A8JC 3WUHA 2CUNA 4ASUD 5KVSA 4BKPA 1X1SA 2A6PA 3LDSA 3W04A 1SWWA 3GV0A 1CF4A 3IS3A 2O0HA 4ENVA 4QUIA 3JZDA 3ZGVA 4PFSA 2J3EA 1BDBA 3MMVA 3SZ2A 1HT1E 3CSUA 4F84A 3C3PA 3B1JA 1HE8B 4FWLA 4JELA 5AW7A 1I33A 3RVCA 1NRIA 3GOQA 5LA6B 5EESA 2AS0A 1NVFA 2CXPA 2D1YA 2VGMA 3ZV3A 3BORA 2PJRA 4DR7B 3HNRA 4YMUA 3DHYA 3LVFO 3P27A 2W43A 1RT1A 4DQRA 3RUHA 1NJ6A 3D02A 3GCWA 3D8BA 4J2AA 2QZ9A 4Y2VA 4CF6A 1UAAA 3CKMA 5KTNA 2DUWA 1U2DA 1JSRA 1QBGA 4U2BA 1GOTA 4DF3A 2V6FA 3TSUA 2Q3MA 2RHOA 4IDOA 2JHPA 1ITGA 2C88A 3OTWA 4QDOA 3GLHB 4RLFA 3AIIA 3WBBA 1QP0A 3VYTB 3VZQA 5CIWA 2OSVA 3DLCA 2I3AA 5G4KA 4CXMA 3TLMA 1M66A 1A4RA 3HP4A 3MXTA 1HXHA 4DHEA 4P7GA 3OTOB 2XE8A 2XB9A 5EUCA 1A82A 1VPTA 2Q3HA 4EEZA 4D8XA 2ZITA 1LSSA 2KI5A 1E7WA 5AK0A 2QD5A 3TLCA 3VI3B 4RCZA 5F78A 5THQA 2XLCA 3VO8A 2OZKA 1DC7A 1CCWA 3R1XA 2CDNA 1BXGA 1Y8RA 2WM2A 4IP0A 1R59O 2WILA 4OJMX 1KAZA 4FZXC 5AFSA 5HBMA 2HFJA 4MO4A 1KMIY 3W77A 3OTGA 3ZK9A 5ADWA 4Y3UA 3HB4X 2FN9A 4H7DA 5JOQA 3ZEUA 4KPFC 2CDBA 2X0KA 3GPDG 3B1KA 2YQZA 4YLGA 4DTNA 2EX1A 2PAAA 1LWEA 3MN1A 4HB0A 5ALXA 5EP1A 4RZQA 1QFJA 3HBJA 5DBEX 5GONA 1JKMA 1S01A 3NDBB 6REQB 4KE9A 4LIPD 3R6LA 4QG3A 3THVA 4MGEA 3AETB 3DM9B 5B6IA 1JNYA 3U1BA 4RV5A 3EULA 3AWDA 3EXHA 4ZARA 4OUDB 3QFCA 1WXQA 4I4NA 1LCUA 5TVGA 4NXNB 3HZ6A 3KL2A 1NQVA 1R74A 1I2AA 1RT9A 4FLEA 3VAAA 2IHZA 1SC6A 4LWPA 1VJ0A 1J49A 4JXKA 3D54D 1D2RA 4MX8A 2M1XA 3F78A 1UBMS 5J4HA 4TTTS 4OSEA 1G42A 3U7RA 3EPKA 2PO7A 2R7MA 3SBGA 3TR6A 3UB2A 5HDQA 4FM2A 1ZH4A 2BKEA 2P6UA 2BW0A 3EMKA 5J4YA 1Z4QA 3IQIX 5KPZA 1DG9A 4R5MA 3KHSA 2BGMA 3UOAB 2Z4TA 1XCOA 2I1WA 4Q02A 4Q16A 1SUPA 4UTNA 2QTZA 1GTSA 4AROA 5H3CA 1WP9A 4DKXA 3PUJA 1F7UA 2AWOA 3AFNA 2ZI7A 4L95C 4ETIA 5IZCC 1TK3A 1KSJA 2NZ2A 4PO3X 1LTKA 4HQ0A 3T7RA 1GG5A 4OQ4A 5H70A 3E3LA 5ALWA 1U0EA 4C22A 4BE9A 1W29A 2XGOA 2VSFA 2QVBA 4Z8YA 3B38A 1EP1B 3ZHOA 2CY0A 4R9RA 2I29A 1NUSA 2A33A 3ZGNA 3RAJA 5I01A 3H8VA 1T2NA 4KX5A 3KSDO 4YRAA 4E13A 1GGNA 3AARA 5A05A 3NIDB 4H9GA 4KTQA 3D8HA 3PUIA 2V5UA 3O3OB 1F0KA 1VM6A 2Q0HA 3LUHA 3JXUA 1UIRA 4G07A 3GPCA 3VEXA 3LGAA 1P5RA 1J09A 2YZMA 1WULS 5B55A 2JD0A 2C2BA 1UPFA 3PXXA 5FD8A 4X7MA 4AKHA 1GL9B 1DFHA 5JAQA 2O5EA 3B12A 2JHFA 2C2GA 3E4DA 1TVKB 5EXEA 4LJSA 1JE1A 3G0GA 2Y4OA 1VBNA 1M2EA 1C7QA 4G2NA 4PZLA 1DGKN 1O89A 2RK4A 1IPFA 4M0DA 1B8PA 1DLIA 3CF6R 3FPJA 1VMEA 3AFOA 4AP9A 1DWOA 1CEEA 3DCJA 2XYPA 4EF5A 2HF4A 3GLKA 3R20A 3SMSA 2O2JA 4BS9A 5GJCA 3E70C 4EG5A 2Q6TA 4JC4A 1L7RA 2PL9A 2GN4A 5DXFA 1D1SA 2O1EA 4YDQA 3C87A 2QXFA 4MQ4A 4DM3A 5KINB 4K9SA 1L4MA 3M33A 3LX8A 4ZHQA 4HUFA 5HCNA 1VBMA 2F3QA 1JEJA 1VE9A 3PS9A 4QAJA 3IDSA 3UE5A 4UUPA 2HSGA 3F67A 3K9NA 3OA2A 4MLHA 3HGTA 4Q4DA 4BNYA 3ZX4A 4DLRA 1ATSA 1AQJA 3I9NA 2XQVA 2G6TA 2XOEA 1DAOA 4JBLA 1C0UA 3ZJ4A 3QEIA 4JB0A 4DMMA 3T9BA 1OZFA 2P35A 2C9MA 4RLHA 1H0RA 2CE2X 3E22B 2NGRA 5AQZA 4DMUB 2IIVA 5F12A 1CR0A 3VR4H 3VR6H 2SCUB 1AMOA 2XE7A 3QG1A 1T4CB 1UDCA 5F1XA 3RT7A 4OK3A 2JRCA 4JKCA 4UJ3A 4L6AA 5JNRA 4BGEA 3EXFB 4EG8A 3SE0A 1Q6ZA 2VPQA 3PDJA 1GU1A 3JRNA 4WN9B 1ATIA 1KQSM 3OZRA 5HW0A 3AI7A 3KZKA 5G41A 4TL6A 3WJ1A 2W4IA 4PZPA 5JMPA 2PUCA 1JIKA 3QESA 3BGOS 2BSAA 3OCYA 2HMUA 4P34A 1FXUA 2MYTA 5DRTA 2FSSA 4EGAA 3MOSA 3UB3A 3ZY5A 2XAAA 1T9GR 1K8XB 3AVBA 4YP0A 4R9UC 5K3OA 3A4VA 3U0VA 1E1RD 3DLIA 1YGYA 4GWLA 2G71A 4IJNA 1BQ3A 4ER3A 2VQEK 4XWGA 3TUIC 1T36A 2ID4A 5D86A 2D1TA 3VH2A 3LHFA 5B1SA 5TJHA 3LDUA 1BX1A 2PH5A 1AV6A 3UMSA 2WFBA 4CRWB 2CNDA 3THWA 3VYWA 4XEHA 3DAHA 5FPDA 1ID1A 3N2EA 1QFXA 3AG5A 2OYCA 1RBMA 1X3SA 2EFEB 3SDZA 3E9NA 4N5IX 5L4SA 4LK2A 4C6TA 2PA3A 3OLQA 1RTTA 3A0RB 4PO9A 1XMQK 2J3DA 1XCBA 4XFJA 2ZULA 5BSRA 3UUEA 1I51A 3V1YA 4RK5A 3M6VA 4FCCA 1YJWN 3NIBA 4B6PA 3KEFA 3BJMA 3SXJA 1N5YA 2D5IA 3DLLL 3H8WA 4BMXA 3MLEA 1Q20A 3G5TA 5DK4A 1GDTA 3RC8A 3V32A 4HNTA 1RSZA 1VKNA 2DU8A 3KB8A 5BN5A 3W5UA 3K16A 3Q0IA 3FHTA 1TLTA 2Z83A 3I9V1 4WNAB 3UKUA 1C1HA 4LZJA 2N46A 3GFRA 4XVQA 2EGUA 4ZCTA 5F76A 1HG1A 4YAIA 4R2HA 2RKOA 2P40A 4BB6A 4YQFA 3OPYI 1VBFA 1DL5A 3M5CA 4BASA 1SU8A 4C21A 4XGQA 3RSHA 4DSIA 1WKCA 2GPTA 2MSWA 2PQ0A 3UMRA 4LF6K 2YXEA 3Q87B 1T0PA 4WESA 1I2MA 5LOVB 3OFJA 5CFPA 5CR4A 2A94A 5LFAA 4F2RA 3F1KA 4AQ7A 1CVRA 4QLBA 4MUGA 1DT3A 1GN9A 2AZXA 2HAEA 3VQEA 3PFKA 4FLTA 3R8CA 4L5IA 4D3YA 3M81A 3VH4A 5CJPA 3AINA 1ZLYA 5EMKA 1DKQA 1DB3A 3SXUA 1RHQA 5FNVB 4F4UA 2W4MA 3N76A 1E1YA 3HMKA 4OHBA 3QY0A 3G1WA 3JYQA 5HGXA 2R7KA 3H9JA 1OHHA 1EVQA 3OYHA 3DWIA 1EXMA 3PFFA 3G49A 1QE0A 2X0FA 2CBGA 2HCFA 2XX3A 2RDMA 4HAYA 2FMFA 1A04A 1D6NA 1GLNA 3JWEA 5FPTA 3QIPA 3N05A 4B9EA 2P0YA 3OZGA 1KL7A 3KB1A 1YI0A 3K96A 2BEUB 5AW5A 3WXBA 3O31A 1DKGD 3RVOA 1MU2A 1QOZA 2PX4A 3HB7A 3AVVA 1S2GA 3A7EA 4X9XA 2P9PB 2J8ZA 2AMLA 3NH2A 4RMGA 5I9EB 4QYMA 2ZR8A 4P3OA 2VUTA 2AFRA 5KYWA 3Q8MA 4C8OA 2WU4A 2ZVQX 2WD7B 2O5RA 1XV5A 1C0IA 1C0GA 3O94A 3S70A 2DH5A 1G5FA 1ZZGA 1VL8A 1SK9A 2RHMA 1MVOA 3CWQA 1PWYE 4ZTUB 4DUGD 1DADA 1DXHA 3ZEAA 1RDUA 2ZXFA 4MJXA 2YOHA 5EWMA 3RTEA 5FBQB 1TQ8A 2X3YA 3CCLN 1G4UR 3ZHRA 4YJFB 2YYYA 4E5SA 4G0WA 3T5GA 3P1GA 5ISMA 5FOUA 3M1AA 2B4KA 4GBED 1Z2OX 3EGCA 2OO3A 2ZYAA 4KIUA 1O6CA 1KVTA 2NZXA 2B21A 4B2YA 3OYMA 4G1CA 3HVRA 2IHNA 4LEIA 1WKVA 5IG2A 3HRKA 3SUOA 4BMNA 2ZRLA 2QWXA 1UJMA 4IFEA 1W0KA 3SR4A 4FFPA 3ETHA 3FCYA 2ANBA 2XRMA 4C1NI 3FROA 3R5FA 3L4JA 3HCPA 4JBYA 3DHWC 4TWBA 2GD1O 4JJ6A 3MJSA 1B23P 4Q7LA 3B36A 4GLBA 2D1RA 4HG2A 4B9SA 1II8B 2G28A 1TUEA 3EE9A 4RTPA 3ROKA 1WRBA 5E4JA 3DP9A 2YVLA 4X1YB 3DB2A 3LGSA 3H8SA 4RK4A 4D57A 1RRGA 3TW0A 1U7PA 5JS6A 3JQ7B 4QGHA 2LRHA 3RUCA 1ADFA 1VE3A 5JNLA 3PNOA 1ZR2A 1ZM4A 1IEVA 1N3YA 4PYOA 1WQ4A 4LF9K 1UFOA 5C24A 2UXBK 3ANYB 3JQAD 5JAMA 2JWLA 3GW8A 3LY5A 3QKTA 5EJAA 4JBNA 3A6PC 5ILQA 4RS4A 2BM9A 3GLUA 2I7XA 4C7BA 2E88A 4TTQA 1QH1A 4LS3A 1QMGA 3MWDA 4U7BA 1RKXA 3K0SA 1QQCA 1MC4A 5EERA 4V0NA 4AF7A 1NNI1 2PX2A 1W8DA 5DRYA 1I2BA 1MX5A 5KHAA 5EP4A 3VETA 5CFOA 4HQNA 3HB0A 3DKVA 2RSLA 3FNFA 1ZCZA 1KO8A 4DV0B 2NUPB 1Z38A 3KTAB 4G5XA 3CIOA 5EXSA 3GMTA 2W22A 2JFNA 1DC4A 2G88A 1OC2A 4O55A 1QTQA 1SCNE 1J22A 4UDYX 1P17A 2JAHA 4RJ2A 2C3MA 1I3NA 2C4NA 3QF4A 3PUXA 5AUQA 5LP6C 1ZHOA 3IBFA 2CK3A 2HOQA 3U2QA 1UMCA 3EQ7A 2EIHA 1Q3HA 2QYSA 4DCUA 1NXVA 4E4RA 1WNTA 2VP3A 1KZ6A 5AQLA 1GT91 2VQ6A 3UMGA 3DO8A 1N1EA 2I4NA 3K31A 3CG0A 8AT1A 5A0TA 3V6MA 3WRXA 1JKJB 3ZHCA 1POXA 5JQGB 4F3YA 3OQ1A 1LBSA 1M5TA 3AR6A 2DT5A 3RIYA 4DBZA 2XE6A 1GSHA 2MCFA 2A0FA 4KYIB 3BZWA 4XVUA 2FP4A 2BHLA 2XO7A 3M4JA 2AOWA 1XTJA 2QRHA 1HYEA 2Z5VA 2G17A 3L8FA 5EIHA 4DM7A 3UCEA 3KG2A 1P33A 5LWHA 3I9MA 1VZ3A 1GQQA 3SG0A 3SUPA 4C4YA 2IRWA 3LDLA 2CVPA 4FFLA 4FWKA 5I7SA 1MH1A 5JAPA 4RVSA 3FF1A 5MHTA 1EUZA 1P1RA 4P4SA 4B08A 2ZBQA 4L0CA 1OWOA 2HBKA 3WQHA 2C54A 3QX7A 1KS9A 1L4FA 3ROEA 4MOWA 1J5EK 2I87A 2ZAMA 2BFPA 1F8UA 4P80A 2CMGA 3FVVA 1UBUS 1MO5A 2J3HA 4QGSA 3MINB 3CNQS 2RGXA 3EWSA 2BKLA 4V38A 1YCDA 1NPTO 3ZQJA 3DMRA 1G21B 2XZPA 2DHCA 2JBAA 3JQ9A 5BN3B 2WFLB 1GIAA 2JIPA 4YUYA 2UU9K 4F3OA 1X2BA 1KYWA 4BRLA 4BQIA 1LLQA 2WPNA 4ZANA 1OE0A 4Q7KA 3G5AA 3QLUC 4FWSA 1O96A 1OVGA 3OSZA 5FTLA 5D51S 3IXLA 3KUUA 3IAXA 1NT4A 3BKWA 1OH6A 1KAGA 3B3QA 5TKYA 3AF4A 4P4NA 2YIVX 1T8WA 1XDBA 1RYYA 5LP6B 1T0UA 5AKYA 2FWAA 4XLTA 1JLEA 3DRRA 2CLIB 4WVFA 3OEHA 2P5UA 1C1AA 1FKPA 2PUFA 3QVTA 2I76A 4CD3A 3I64A 4NXMB 3ZI4A 3LUFA 3MEEA 1TK5A 5F21A 2VP4A 3J81k 3M8QA 1RNHA 1ZYUA 3QUTA 1PW7A 5CNJA 1FTWA 1B6TA 8ATCA 3WKDA 4YUZA 4IMJB 2P7HA 2E4AA 1ZH0A 5K03A 2H1IA 1BGVA 2VRCA 3OLZA 3HN6A 3TW6A 3AEKB 4KH5A 1Q1BA 3NFRA 5EMMA 3UAXA 4KVZA 3QA3E 4WBNA 3NHMA 4UKDA 4C1BA 1OH5A 4F0JA 1M2NA 3H9CA 4J16A 1LW0A 4X1KA 2BBTA 3IP3A 1MBZA 4PKHA 1RWKA 4O29A 4V2IA 4L22A 2ES4A 3DPUA 4DDWA 1M7BA 3W4KA 3EDYA 3WYGA 3BD8A 1E61A 4ZXPA 2HQRA 3DDOA 1IY2A 2QN8A 5LZ8A 3DOOA 3U16A 3L41A 2GAAA 3VYUB 1FYWA 4G23A 3G10A 1V39A 3GX1A 2IL1A 1YKGA 2B7BA 4DILA 5HRSA 5M3BA 3ABIA 1SAYA 4O4JB 4KGXA 3KQSA 4FOOA 2HU2A 3D8SA 4TLMB 3HU2A 4CGJA 2HGSA 2CCGA 4MWBA 2PV7A 2ZTVA 2IVPA 4KXYA 4CJ5A 1SR8A 4KR3A 4LV5B 1KMHB 5K3DA 4DCSA 3FB1A 4OU4A 1KI7A 2GGSA 1JQBA 3WQQA 1TKDA 2HX1A 4M9ZA 1MRSA 1W6UA 2BGNA 1ULUA 3ZQ4A 2UZAA 5D8DA 2I2AA 2X0EA 1E79A 4BBZA 3SR0A 2CZCA 1OTXA 4X66K 4YHHB 1VLJA 4KREA 4KSBA 1ZONA 5CGZA 5LUAA 2C7PA 2GZ1A 1C30B 1NBHA 1YV9A 5E2IA 3FOFC 3GLGA 3V8PA 4OJQA 4HFNA 1LKZA 2O2ZA 1HZZC 2KKZA 4U7DA 2YNGA 1HMYA 3T5BA 1KK1A 1U5BB 1E9SA 3AI1A 4X95A 3AU8A 4R8MA 1I6LA 4EUNA 3K9BA 4ZT7A 4QDKA 2FJPA 4EFDA 1UBJS 3V1TC 2P2DA 4OSOA 4XGKA 1H4TA 2GN0A 4E2XA 3GZ4A 4EAQA 1KKUA 3QEAZ 3N3AC 5T57A 2O8NA 1HYQA 3ZHSA 4GXRA 3OLVA 2NSDA 1QHTA 1TMGE 3GLHE 4RBNA 1Z0AA 1DARA 3CZQA 2D13A 4GNIA 4BQPA 1NY6A 4WY5A 4BPBA 2QLJA 5AI0A 2IOYA 1BO5O 3QVXA 4R2WA 4MQEB 3ZT0A 3WA6A 1E9RA 1I4TD 3HHEA 1GTVA 4U67L 2ST1A 4OLFA 3AVNA 2HMAA 1I4DD 2Q99A 3WRWA 4ETNA 1KU6A 5AI8A 1CV2A 3LXRA 4KB0A 5CEJA 1X8KA 1ZA1A 3BXFA 4CTJA 4W5HA 1HNVA 3IURA 4Z7JA 2NU9B 1KRWA 5EE9A 3TANA 1QOPB 2H8GA 1FRQA 2ZYTX 1PAUA 1VSMA 3E1SA 4EECA 1O1YA 1CP2A 5DNUA 1G20B 3R3JA 5JMOA 1H0HA 5FX2A 3E9CA 4M41A 2HMVA 5FOWA 4S0ZA 2D6FA 2ZRPA 4NENB 3GLIB 3I0RA 2A3NA 3KWGA 1Z0SA 4ALNA 2ZTHA 1KF0A 2G1UA 1Z07A 3M1IA 2WNHA 3UGJA 1REQB 1JEYA 2P9SB 2G72A 4MO2A 5FRDA 3OYLA 2GN6A 1JJAA 2Y4NA 1LPOA 4IS2A 4IO9L 3B20A 3D3WA 3H2JA 4HEHA 4NZOA 1E9BA 1E5QA 4B4VA 2XA1A 3TSOA 4N48A 1KQNA 1KSHA 4M3RA 5KPTA 2YWRA 3RS2A 1VGVA 3A9CA 4PHTX 3W5AA 2C2KA 2OBYA 2WWHA 1X77A 1IPHA 1BCMA 3TTTA 4N7MA 3IUCA 3AM5A 3AIKA 3SI7A 1MX9A 3HTXA 3VX4A 1DG1G 1SC9A 1A2KC 4DUPA 2Z1IA 1I3AA 4ND8A 2HHUA 4V03A 2ZANA 1XNJA 2I3GA 2GAFA 4JCCA 3PD7A 3V2IA 2WOOA 3NE6A 4L1KA 3IG1A 3PNBA 4QJIA 1RBVA 1WKBA 4BRHA 4R8KA 1ECJA 3D3NA 3FNIA 3UGKA 4G5RA 1CW2B 2H4JA 5HKLA 3UJBA 1O94C 4M9QA 4YJHB 3PXGA 1THTA 4GI1A 4UDOA 5CNIA 4DU1A 4NNJA 3IQHX 1S9GA 1Y5NA 4IX9A 5E4FA 5J2TB 2FW9A 1CNFA 3AIOA 4J75A 1BE1A 3CG4A 3JY6A 4ZEXA 4HY3A 3IRXA 2FF5A 1YJBA 1P61B 3I73A 4BMYA 5FLKA 1B6SA 4NCJA 2X5XA 4YCDA 3B3AA 4ND2A 3WB2A 3B2QA 1XE3A 5AKLA 4MXDA 3NAEA 4EJ0A 3C7AA 2FF6A 1YZYA 2CB0A 2YKGA 2QA5A 2OD7A 4N8SA 2BTQB 1XN4A 5DBOA 1AF4A 3M0EA 3CJRA 2C4HA 3D6MA 1F5SA 1QVZA 4I3GA 3OJFA 4QQKA 3MYRA 5HDBB 2GEUA 2WA1A 4DSEA 3NHAA 1NNUA 3OQJA 3V7FA 5ICSA 1CZOA 3BRSA 1E1RA 2PZLA 4N3AA 1RU3A 4IVQA 3GDQA 4HX5A 4NEQA 3AZPA 4V3BA 5AM4A 4QSMA 5G2OA 2V6IA 5CCBA 1VLVA 1EVZA 2JFBA 2JIRA 4QG7A 2POQX 2DYKA 2VTEA 4UATA 4E1BA 2IX3A 3K1TA 5CXXA 1E92A 2BFEA 4LYJA 1WY7A 4MZXA 4TV8A 4XTCS 4TRRA 3DT6A 1NGIA 4MGZR 1J00A 1DCFA 2HNBA 1ZL2A 6Q21A 2CHVA 2QAJA 2OO7A 3LIIA 3NU1A 2CLLB 4O0LA 1ZBLA 4B9TA 1QVGM 2UVPA 2BELA 3NH1A 1W59A 1HPZA 2VJYA 2XUKA 3RCBA 2AZMA 3OD5A 5FCDA 5FPNA 2HPHA 5C3UA 2X14A 4RF5A 3RFTA 3OYNA 3Q8WA 4EVIA 2H85A 3IEXA 5KMGB 4CF7A 3DOFA 5K0SA 2AOXA 4FMCB 1YDGA 1USIA 1V41E 5C3MA 3SHFA 2GCEA 3H2YA 2HMIA 2IY7A 4TZ0A 3EY1A 4ISGA 1OA0A 4I1SA 2EFGA 3L8HA 5JVDA 2R6CA 2WLSA 4BO0A 4XRGA 3NGIA 3P31A 2PSEA 2ERCA 2VDOB 1IY0A 3KAKA 1I5EA 4L3VA 1CDZA 2WWIA 2BTOA 4OGGA 1YT5A 4MKZA 1YULA 3G0BA 5H02A 3LLUA 1UDWA 4EHJA 5KYXA 3OE1A 3PXAA 1T5HX 2VDVE 2Y68A 1OFIA 4I4TA 3D43A 4WRRA 3O1JC 5AM0A 3SYNA 4HWIA 4E7HA 3AR8A 4TZ6A 3VGJA 3ICCA 2XUAA 2DFVA 1I01A 5REQB 1ZBHA 2J45A 5D3MB 1RJWA 3H0CA 1DEAA 1KA9H 2DSTA 2MINA 2H4WA 6AT1A 1ISHA 4GX5A 2B3TA 3OYEA 4A4DA 5JYEA 3ZWYA 1ZD9A 1B6RA 1OX5A 5DCYA 4ACBA 4KX3A 2OAQ1 4OBXA 1NFFA 5JH7F 1VPEA 3LT4A 2QP4A 5H5JA 5LC1A 3MIIA 2ZGYA 5JAZA 1B3BA 5DTJA 4E33A 4FFNA 3ZV6A 3TBKA 1UBSB 4DVGA 5DYNA 1EJ0A 2J0UB 2F1OA 3FW1A 2F8MA 4TLLB 3GHYA 4FXDA 5BQPA 3P9QA 4R3WA 1AGNA 2VJNA 3BKXA 3KUCA 4FHGA 2A41A 3CJ9A 3PQEA 4YBRA 1P4JA 4IOJA 4H3HB 3EXEA 1O2DA 1AKQA 5J23A 1EDDA 1VKZA 3VC2A 4DRYA 1SBTA 4XDHA 4B9MA 3NHYA 2AQIA 1D2NA 4F9GA 5U9CA 4C7OA 4LH5A 2GKOA 2R8RA 1X7YA 4QU0A 1WXHA 1X19A 4AY2A 1RPJA 3ULEB 1U0JA 4ZXFA 5D85A 3C1UA 3NPAA 4FXOA 4E51A 4YBZA 3SS8A 3UB4A 2A67A 1VSFA 3MWGA 3VQ5A 2D1FA 1NF2A 4CLOB 1U7TA 3LPLA 1YBFA 1KTVA 2D06A 3H9UA 3CI5A 3JR3A 2XNKA 3JYOA 2C0QA 1GPYA 4DUGA 4BEVA 3SM3A 3KXIA 2DY0A 1VSHA 1OHHD 4RWTA 3L8CA 3H1VX 4DB2A 2IVZA 1XHFA 5EP3A 2ZUUA 4PHGA 3FFIA 4CZMA 2H63A 2XW6A 3VSEA 2QUKA 3AVKA 1KHHA 1P75A 2FV8A 5EINA 3NDJA 1LDYA 3L7NA 1X1TA 1SA0B 3TU5A 5CEEA 1FFHA 4K9KA 1XU7A 4QRHA 4F9FA 1M0SA 1L3IA 1W4LA 2P1ZA 2Q29A 1QSYA 1IJEA 5DW0A 5M29A 5TT0A 1QIMA 2H7VA 2FZ5A 2NW6A 2EQBA 4YR7A 1SMKA 1P9LA 4PGMA 3SPXA 4IWNA 4KL8S 1ZN2A 2HDWA 3W6UA 2PY5A 4RF2A 1BFUA 3T06B 4OKEA 1WBDA 1BMFA 4AZSA 5BXYA 5BPHA 3ADCA 1NV9A 3UM9A 2P8SA 4UD2A 1FTSA 3CLKA 3CCSN 4J3FA 3U49A 1J97A 3ASUA 4BNJA 1SHJA 1L5RA 4RVDA 3O47A 1KZ4A 1P77A 1NMSA 2O6HA 2IC3A 3EZWA 4O02B 4Z4IA 4IAOA 5IYZA 1JWAB 4GE3A 4QGGA 3U37A 3ZGOA 3VF6A 3ADOA 4PG5A 3X1ZA 3FJYA 3OM9A 1E2BA 2I9KA 2XKAA 5F64A 4B7AA 4KR9A 1W0KD 2DUMA 4Q3KA 4UHKA 4IO0A 4AJJA 4ZREA 2D54A 4IWYA 3CH7A 3HKDB 2YICA 2EGHA 2NRXA 5TDHA 4YV0A 1B1CA 4B0PA 4CKWA 3TWHA 2PZGA 5SY9A 4ZYVA 4RMIA 2WP0A 1DC6A 1H85A 1U5CA 5LU8A 3TLYA 1IV0A 2ZBUA 4IF4A 1DOZA 1A1VA 3T7TA 2ZYGA 3NKLA 4H4OA 5TNXA 4MR8B 1S6YA 4AP6A 4HGQA 4EHTA 2ENUA 3HPHA 4ER5A 3O5BA 4W1QA 1AJEA 1LK5A 3OMWA 3K9LA 1UJ5A 4CQMA 3FSRA 2PV0A 5KNBH 1L8XA 1GGJA 4Z9XA 2ZUWA 4INJA 4JLOA 3BG5A 4LDPA 1UM9A 2CEAA 1JL1A 1M34B 5FEMA 4IIFA 4M1WA 4ZRMA 4FK0A 1QLJA 3VHXB 4ZYUA 4JLJA 1IKYA 3WWOA 4MWSA 4DR5B 4F56A 1XJQA 5F7ZA 1T0BA 1SXHA 4BLSA 2W8ZA 2EL7A 1CDOA 4PR3A 3K1AA 2Q2RA 4GMJB 1S1TA 2BC9A 4XCXA 3N1UA 2XV1A 4UJ5A 4IXCA 1CUGA 1Y1SA 2Y1CA 1IQPA 3TI0A 5HR5A 4UHHA 4N47A 4RZSA 4CKCB 1PJCA 4FR0A 5E6RA 4ISBA 3K72B 1T05A 4HXYA 4BQQA 3VAYA 1R0CA 3R7WA 1XKTA 1RBQA 5LXTF 1M8PA 1JTVA 2ACEA 2P41A 3E9LA 1DCTA 4DSJA 1KJ9A 2CE7A 1V37A 3T61A 3DZCA 2IYOA 3WMXA 4JSTA 4YPOA 4RSMA 4BFTA 5DN6D 3SV4A 3GNSA 2Q0RA 2BFCB 1YE8A 4ZZ0A 2Q7OE 3ZU2A 2YX1A 3Q5DA 3H45C 2R4TA 3IUSA 1F3OA 3R0QA 3PLNA 2A9QA 5A3QA 4UEJA 5GVRA 2BL4A 2ISSD 2II6A 3O9QA 5JRZA 2YR0A 4QOEA 2VYNA 3RIEA 2J0SA 4JGBA 3OQIA 4EJFA 1H0SA 1JCGA 3MWYW 2OP1A 1GL6A 4H0OA 4X97A 4Z1OA 3B6PA 2BRUC 5JCOA 2JRLA 1A8SA 4LWZA 4A5BA 4DTOA 4JA2A 4CM4A 3NWPA 3FGPA 1ETUA 4DCCA 2IX9A 1SZ2A 3DL7A 3FYUB 2OBNA 1M1ZA 2X41A 4EG0A 2ZB4A 1J53A 1XRMA 3RHFA 1RQRA 5LMUB 3FFTA 3C7NB 4D3DA 3QPCA 2ZE2A 2OCLA 3ODGA 4KVFA 4NZNA 3X1WA 1RBUA 1NKBA 5J3JA 2XJ4A 1Z5OA 4HC4A 1V5FA 3P9NA 2O7VA 1OPRA 4FLZA 5IJ9A 2FRVA 4C0HA 4I4IA 3I4FA 4EBFA 5JCJD 1P29A 4XWAA 2VJDA 3OLXA 4JYAB 5LQNA 1QG4A 1G6Q1 1LI4A 4RC9A 2DT8A 3ITEA 1K6JA 2A14A 1ACLA 1ODIA 3CE9A 4KQJA 4AQYK 5MGNA 3PX7A 2O06A 3CX3A 3M70A 3TNDA 2ZIAA 4OP1A 3WAJA 2YV5A 5EJ7A 4GX2A 3RARA 3IPXA 4RXTA 1UJCA 4PHFA 5AW8A 4A8TA 2H29A 3RYFB 4HJXA 2YJ6A 4LXGA 2JHAA 2OZSA 3ZI0A 2NSLA 3G2PA 4IJ5A 1N75A