4CEEA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceeA00
4OPKA 2Z1JA 3U3YA 4CFDA 4KHYA 1RBUA 3LZIA 1TAQA 2KFNA 3OYJA 2HNYA 1EETA 1BCOA 4O0IA 4DQRA 1ZBFA 4RW6A 3OYHA 2QKKA 4M3RA 1SL0A 4N41A 4DQSA 2YKMA 4DQPA 4WE1A 4AH9A 1VSLA 3OYMA 3MAQA 4Z4CA 4NCBA 4H4OA 1VSMA 4KI6A 4ZHRA 1C0TA 3AVFA 3AVNA 3CFPA 4E7HA 4CK3A 3HP6A 2VWKA 1RNHA 4I7FA 3KLIA 4CF2A 1QQCA 3T19A 1KSPA 4QOZB 3V9WA 1Q8IA 4CGGA 4CJKA 2R7YA 3TARA 2Z1HA 5HLFA 3ZT0A 3L8BA 4DF4A 3ZT4A 1R0AA 4DU4A 2XY7A 2KW4A 1HQUA 2Z1GA 4N56A 4KHNA 5K14A 1HQEA 3QO9A 4AHVA 4FJ8A 4B08A 1RBVA 2E4LA 1D9FA 5FRMA 2HNDA 2A1RA 4DTJA 3LP1A 4AHUA 3HPOA 1IKWA 4MQ3A 1BQMA 3LALA 1CZ9A 4IDKA 2OZMA 2G8VA 1S1TA 2XHBA 4DSJA 4M3TA 1QS4A 4DU1A 2W42A 4B9TA 4ICLA 3TAGA 1C1BA 1RILA 2G8UA 1XHXA 1RBSA 4B9SA 1VSKA 2XY8A 3QIPA 3TWHA 4BE2A 2G8FA 3RMDA 4HCCA 2Z1IA 4DFKA 4ID5A 2G8HA 3JSMA 4I9LA 3OS2A 3U3GA 1TK0A 3I0SA 5I3UA 3OS1A 3HP9A 4JRQA 5HRNA 1KLMA 3KKSA 2OYQA 1RTHA 3AO5A 3TR8A 3L3UA 3B6PA 1TGOA 3ZSZA 3VQPA 5J2NA 3NH2A 4CJUA 1S1WA 1SL2A 1J53A 3HYFA 4CJLA 3I8DA 4CK1A 2DTUA 5C25A 5KGXA 1TK5A 2HHSA 4HUGA 2X6NA 4CEZA 4XIUA 3KLFA 3VA0A 3SUOA 4HCBA 5KGWA 2ZE2A 4FLVA 1BL3A 4KHQA 1B92A 3UIQA 3WNEA 4FZXC 1ASUA 2YKNA 1X1PA 2WONA 1QSLA 3AO4A 5EU7A 4AHTA 2A1SA 1Y97A 4RW7A 2HHQA 1VK0A 1IO2A 3C95A 3BDPA 1VSIA 3DRSA 3ZSYA 3DRRA 3HK2A 3BGRA 3MEDA 3S9HA 4Z4HA 2B5JA 3DYAA 3KLEA 4CHPA 3AA3A 4C8MA 4LH5A 4CE9A 3SYZA 3KK1A 3OYNA 3OJUA 1L3TA 3ZT2A 3OYIA 3KJVA 3AVAA 3LAMA 3OYAA 1QTMA 4E7JA 3AA2A 3THVA 1KCFA 3OYFA 3HPHA 1I39A 4FJIA 1CLQA 3MXIA 3NE6A 4W5QA 5CYQA 5DMRA 3KD1E 1XHZA 3AVCA 3VQCA 4Z4GA 1L3UA 1RDBA 2BANA 3RMAA 4H4MA 2GUIA 4DSLA 3CFOA 1KRPA 1JXEA 4FK0A 4DTMA 1WSHA 3K59A 2F96A 4CJPA 4M3YA 3QINA 4W5RA 2Q3SA 1LV5A 2PYJA 1EP4A 4PY5A 2YNHA 1NK8A 1IKXA 4CEBA 4B8AB 3S3MA 3O3HA 1KFSA 1O1WA 3OVNA 4DFJA 3CM5A 1BQNA 4Q5VA 1S1XA 4R5PA 4FJGA 4IFVA 4DG1A 1C1AA 3V1OA 1U49A 2QKBA 4BWJA 1W0HA 2D0BA 3EY1A 4B9VA 2QXFA 4FM1A 4CHYA 3O3FA 3QEWA 4KB1A 2G8KA 1J5OA 3DLEA 3VQAA 4FLZA 1WAJA 3LP0A 1L3VA 5JS1A 4KV8A 5DK5A 4C8NA 4M41A 4AHCA 2Y1JA 4O5BA 3MXMA 1S5JA 3LWLA 3QERA 4C8KA 3LPTA 3VQEA 1LAWA 3PX6A 1X9WA 1TK8A 4B9MA 3HXMA 3VN5A 3DI6A 3C6TA 4RW8A 3AV9A 4DFMA 4RW9A 4LSNA 3V1RA 1CZBA 1L5UA 1LWCA 4FLTA 4DSKA 4M3WA 3L2WA 3VQ7A 4O44A 1RT6A 3CYMA 3AVLA 4DSEA 1TAUA 3LPUA 1RT5A 3KK2A 3T3FA 1C6VA 1LW0A 2ATQA 3MEGA 1B9DA 3V81A 1UA0A 4DWIA 5KI6A 3VQ4A 1JLBA 1DLOA 2LSNA 4DTRA 1NK6A 4FXDA 2YNIA 3RWUA 3ALYA 1WSGA 4L8RB 4ZTFA 3ISNC 1WLJA 1B9FA 2KQ2A 2ZD1A 4J2EA 2DFFA 3QEIA 1EXQA 4CEQA 3DOKA 4AHSA 2HVIA 1IH7A 5J2MA 3KIOA 3LAKA 2X78A 4OJRA 3TAQA 1ASVA 1NK0A 4F4KA 1JKHA 2X74A 1A5VA 3ZT3A 1NKCA 2EHGA 3LWMA 4DTPA 3V4IA 4N5SA 1UAXA 4CGJA 1WN7A 5CYMA 4CF0A 1QSSA 3OYDA 4EZ9A 4CIFA 1ZBUA 5HRRA 4OLAA 4ELUA 3IRXA 1WAFA 1HYSA 4CGIA 2YHBA 4NCGA 4DFPA 1TKDA 4C8OA 4K8ZA 5D3GA 4JLHA 1ITGA 1HPZA 1QHTA 4LD0A 2OPRA 1C0MA 2IDOA 5E41A 1Q9YA 3HT3A 3NH0A 3OS0A 4Y1CA 4CJVA 1TKTA 2YV0X 1IG9A 4E1MA 4O4GA 4DTNA 4KB0A 4KRFA 4FW2A 1U48A 4OKEA 1VSHA 2KZZA 4DLGA 3L2QA 4CJ3A 1TL3A 4CF8A 1RT3A 1CXUA 3AVJA 3QEXA 2VG5A 3KK3A 4DSFA 3SUQA 2OA8A 3K5LA 1IKVA 4OKKA 2O4IA 4C8LA 1RCHA 2RN2A 4KHSA 4DU3A 2DY4A 4OLBA 1RTIA 3QEVA 3MXJA 4I9QA 4F3OA 1RT7A 1XC9A 3EYZA 3D0PA 4LSLA 4LY7A 4OKJA 3V9ZA 3L3VA 4GVMA 3M8RA 4KTWA 4CFCA 3TI0A 1JXBA 3HSTB 3K5OA 2WOMA 3JYTA 3AVIA 4RG8A 5FDLA 2HW3A 5J2PA 4FM0A 4ID1A 4CK2A 4DMNA 1W9HA 3NAEA 1GOBA 1U47A 3NGZA 5HP1A 4N76A 2HNZA 2P5GA 4CHQA 4F2RA 1ZBLA 4E89A 2VG7A 4DF8A 4FJXA 3HJFA 3KD5E 4PQUA 4B9NA 2HMIA 2X6SA 4CHOA 4KTQA 4YNQA 1NJYA 1TKXA 1NJZA 3S3NA 1SKSA 4QCLA 1VSJA 4CJEA 3SQ1A 1VRUA 3G10A 2HVHA 3ZSXA 1CXQA 1Q9XA 2YNGA 1KTQA 2PYLA 1BI4B 2JLEA 4KPYA 4FCYA 1LWEA 4OVLA 2YNFA 1WSIA 4FLWA 2XRIA 1UA1A 4AHRA 5SWMA 3U6FA 4M42A 4IG0A 1SV5A 5CZ1A 4CEDA 1YVUA 3AVKA 3VQ9A 1Z26A 3VQ5A 3ULDA 2E6MA 4CEOA 3O3GA 4FJ7A 3LANA 2VWJA 4FJHA 4IKFA 3SQ4A 1IKYA 4FLUA 3ZSVA 3QESA 3S3OA 4FJ9A 2HHUA 4CHNA 3NF7A 4CF1A 4CJRA 3V9XA 1NKEA 1MU2A 3SZ2A 3TABA 4ZTJA 3NF6A 3P83D 4FVMA 1T03A 2HHWA 2OZSA 4FZZA 4M3UA 1F21A 4CJSA 1SUQA 1BHLA 2G8IA 4E1NA 4BDYA 1HRHA 2XO7A 3P5JA 2B4JA 4KO0A 2BDPA 4M3ZA 5SZTA 1FKOA 1BCMA 3OYGA 1S6PA 3ZCMA 3KKRA 1N5YA 1RDDA 4IBNA 3AA5X 3C6UA 3PO4A 1C0UA 3NFAA 4Z0UA 3IAYA 4BDZA 5KRSA 4MFBA 3AVMA 1S6QA 3ASMA 4NYNA 3AVBA 3QLHA 2IC3A 3LDSA 3TANA 3RTVA 2FBYA 1NJXA 2F8SA 2HHVA 4FYDA 4Z4EA 4DQQA 4CGHA 2GBZA 1JLCA 3ZSWA 1FK9A 4O55A 3DLKA 3VQQA 3PX4A 2DFEA 3SI6A 4J2BA 4FJMA 4CEAA 1WNSA 3OYCA 1UWBA 5HRPA 3QETA 1VSEA 4CIGA 2P5OA 4F2SA 4UQGA 4DLEA 3AVGA 3SUPA 1RBRA 3V6DA 1N6QA 3O4QA 1GOCA 4CCHA 1KLNA 2KZMA 3DLHA 4DQIA 2FC0A 3DLGA 1T7PA 3TAMA 4W5OA 1VSDA 1HYZA 1LW2A 3WNFA 4EZ6A 3SPYA 1RBTA 4CEEA 4CFBA 3ITHA 3M8SA 3L2UA 1NK7A 4IFYA 1JLGA 1RT1A 2IOCA 5J1EA 3CQ8A 2ZQBA 3SV3A 1ZBHA 4FZYA 3NGIA 1HNVA 4QAGA 3VQ8A 4J2AA 4DTUA 1WSFA 2F8TA 5HRSA 3OY9A 3SJJA 4B9LA 3NCIA 2JGUA 3AO1A 1TV6A 3OYLA 4OPJA 3I0RA 5CY4A 4IG3A 2EX3A 3RRHA 4DTSA 4KHUA 4HUFA 4H8KA 4CEFA 3L2VA 3RMCA 3OYEA 1L3SA 4ELVA 4BDPA 4FJNA 3AO2A 1JL1A 2HB5A 2YHAA 4TSXA 1A5XA 3VQBA 3EZ5A 4W5NA 3B6OA 3DRPA 3HPGA 1FXXA 1K6YA 2IGIA 3HVTA 4J2DA 2ETJA 3HVRA 1S1VA 4DTXA 4CERA 4B3OA 3DLBA 2IAJA 4HUEA 3P1GA 1EX4A 4FLYA 3PUFA 3RR8A 3IG1A 3NF8A 2XY6A 4YFUA 1VRTA 3NDKA 3LP2A 2OPPA 3QNNA 3PX0A 3V1QA 1SKRA 3A2FA 1NOZA 2FBVA 2KTQA 2RF2A 2OPQA 2XY5A 2D0AA 4JS4A 4HHTA 1D5AA 1YT3A 4N47A 4CJQA 1RTDA 1RTJA 1S1UA 2DFHA 1HJRA 4FW1A 4CJ4A 1NK4A 4E0DA 3L2RA 4CIEA 3K57A 4DTOA 1KFDA 4K8XA 4I2PA 5C42A 4RW4A 4HVJA 1J9AA 2PY5A 1REVA 3MECA 3PO5A 4OGCA 1C1CA 5HROA 1D8YA 3HO1A 2RKIA 1I3AA 3VQ6A 1J54A 4E19A 4W5TA 3PY8A 4F3TA 3G0ZA 4CHZA 1ASWA 1SKWA 2GV9A 3NF9A 4PA1A 3K5MA 1S9EA 1WSEA 3VQDA 2FBTA 4E7KA 4FJKA 3TAPA 4Z4FA 2I5JA 5J2QA 3OJSA 2HHXA 2QK9A 3RR7A 3ZSRA 3QIOA 5JS2A 4NYFA 1VSFA 1KVBA 3V9SA 1KVAA 3IS9A 1X9SA 3T1AA 2VG6A 3M8PA 3SV4A 2P1JA 4M45A 1S9GA 3AO3A 3RRGA 4CJTA 3KLGA 4BWMA 1NKBA 1JLEA 3K58A 4F8RA 3ZSOA 1D9DA 3ZSQA 4ELTA 3AVHA 4BE1A 2AJQA 4KTZA 3QEPA 1WSJA 1A5WA 4KI4A 1RT4A 1QE1A 1Z25A 1HYVA 1KVCA 3NGYA 5KTQA 1NOYA 4FK2A 1SL1A 1YTAA 4CESA 4M3XA 1HMVA 3WNHA 3SQ0A 3PV8A 4PWDA 1UOCA 1TKZA 3CG7A 3CM6A 3RMBA 4DS4A 4O0JA 5FRNA 3E01A 1GOAA 2Y1IA 1BI4A 2FBXA 3SCXA 3AA4A 4CECA 1LAVA 2O4GA 2D5RA 2IS3A 3HL8A 3DOLA 3K5NA 4NCAA 2B6AA 2P51A 2BE2A 3D45A 3WNGA 1U45A 1RT2A 1FKPA 3LP3A 3SUNA 3OYKA 3CFRA 1T05A 1NJWA 4FM2A 4E3SA 4FK4A 3F9KA 4G1QA 3DLRA 1RDCA 1JL2A 3DMJA 5C24A 4DSIA 4FLXA 2G8WA 1NK5A 4EP4A 1JLAA 2HHTA 5HBMA 5KRTA 4Z4IA 3F73A 1JLQA 2BGGA 3FFIA 4FJ5A 1ZYQA 4KAZA 4AILC 1TL1A 1U04A 4JRPA 3QNOA 4LH4A 4CGFA 1DTQA 1QSYA 4CJWA 1T8EA 4BE0A 1JLFA 4KKOA 3SPZA 2NUBA 1X9MA 1BIZA 4GW6A 4CJ5A 3TAEA 3ZT1A 4CGDA 4KFBA 2KFZA 1BIUA 4I2QA 1ZBIA 2D0CA 4Q0BA 4E7IA 3NHGA 4PUOA 3LZJA 4Y1DA 3SQ2A 2PZSA 2ITGA 4BACA 2OPSA 4B8CA 5FROA 1NK9A 3V9UA 1BGXT 2RPIA 4CFAA 1TVRA 4FJJA 5CZ2A 3NBPA 3KLHA 3HM9A 3KTQA 1DTTA 2E6LA 5T7BA 3OYBA 4JS5A 4CF9A 1BISA 1RDAA 3K2PA 4CJFA 3NH1A 4KREA 4E7LA 4GMJB 3O4NA 3SNNA 4FJLA 1XI1A 5I42A 1U4BA 4KHWA 1EKEA 3MEEA 1LWFA 3H08A 4DS5A 3TAFA 3M8QA 4B9UA 4EP5A 4OGEA 3VA3A 1XWLA 1YTUA 1HNIA 1G15A 4HTUA 3C94A 3DM2A
chains in the Genus database with same CATH superfamily
2Z1JA 1TAQA 1EETA 4DQRA 4RW6A 4DQSA 4DQPA 4AH9A 3MAQA 2I7NA 4CJ7A 1VSMA 2NLXA 4ZHRA 3GOIA 3F2KA 2VWKA 1RNHA 3T19A 3OTOK 4KTQA 4CJKA 4DR6K 5LJWA 3ZT4A 1R0AA 4DU4A 2KW4A 2Q31A 2Z1GA 4N56A 1HQEA 3SAGA 2A5XA 2HNDA 3TTDA 4IDKA 2HOEA 4BR0A 3THWA 1S1TA 4DSJA 4CD1A 5AZIB 2PBDA 4ICLA 1N33K 4NXMK 2Q36A 2Z1IA 1K73O 3U3GA 5I3UA 4JRQA 3KKSA 1RTHA 3CETA 3C7NA 3ZSZA 3CQYA 3VQPA 1S1WA 3VGMA 5JVHL 4CJLA 2DTUA 5C25A 3SUOA 3KLFA 4FLVA 4K25A 3AO4A 1KAYA 1GLBG 2A1SA 4AHTA 3WEEB 3C95A 3CCSN 1HKCA 3ENHA 5I9EB 1NNEA 3AA3A 4C8MA 5LMUK 5GINA 3KJVA 1XMOK 4CBUA 3LAMA 1QHAA 3CIPA 5FPMA 3M1FA 3HPHA 3Q7CA 3VF6A 1VQMN 3VF4A 2WC9A 3AVCA 3VQCA 1RDBA 1HLUA 2NRRA 4H4MA 4GV9A 3CPEA 1EO1A 1KRPA 4DTMA 1WSHA 4OPAA 3M3ZA 2F96A 3K59A 4CJPA 3CQXA 3QINA 4W5RA 3CJBA 3VETA 3WT0A 2O8EA 4H5WA 4CEBA 3S3MA 4JI8K 1S1XA 3ZETA 4BWJA 3BP8A 4XH4A 3FZFA 4KB1A 1YHQN 3VQAA 1WAJA 4FWLA 4KV8A 5DK5A 4C8NA 4B3TK 4FOIA 3LWLA 3QERA 4C8KA 5GAEP 1U6ZA 5F2RA 5KPZA 3C6TA 4DFMA 1QZ6A 4DSKA 2E20A 1NGDA 3MN7A 3VQ7A 3CYMA 4DSEA 3KK2A 3T3FA 1C6VA 3KVGA 5KI6A 3VQ4A 1DLOA 4DTRA 1GLCG 4FXDA 4LF9K 1Q81O 3SAHA 5E26A 3THXB 1VQ6N 2ZF5O 3CHWA 3CCQN 4GKJK 1HX1A 3KIOA 3LAKA 3VEZA 1NK0A 2E8AA 3ZT3A 1BOTO 4V19S 3TSQA 2GX9A 3CJAA 4RWTA 4CF0A 4CIFA 4OLAA 1HYSA 4CBXA 2Q1NA 4KH4A 2BTFA 1ITGA 3KWIA 4LD0A 4Y1CA 2YV0X 4H03B 5AQOA 2PAVA 4E1MA 1VSHA 2KZZA 3L2QA 4CF8A 3BF3A 5LJVA 1CXUA 2VG5A 2OA8A 2P9UB 2O4IA 3KWGA 3O9TA 3VTIA 2W6KA 1KD1O 1RTIA 1XNRK 3MXJA 4F3OA 4LY7A 4FK2A 5BRDA 1NU0A 1JXBA 1TUYA 4BRPA 1RFQA 5BR8K 4DMNA 3NGZA 3LM2A 2HNZA 1ZBLA 1OVYA 4OX9K 2VG7A 2P9SA 5KPRA 4GNIA 4ILJA 1TKXA 3C0BA 3S3NA 1VSJA 3SQ1A 1VRUA 3G10A 5C15A 1OVQA 2JLEA 4KPYA 4FCYA 2YNFA 4CZLA 1S22A 1WSIA 4FLWA 3O9UA 3U6FA 3H1VX 4B1VA 3VQ9A 1Z26A 2E6MA 4DV0K 4CZFA 3VF2A 3SQ4A 2D1KA 1OH6A 4CHNA 1MU2A 4ZTJA 2ASOA 3DAWA 4FVMA 4L3QA 4DR1K 5AZJA 4JKDA 4M3UA 1BHLA 5MLCQ 4KO0A 2B4JA 2BDPA 2NRTA 1FKOA 3ZCMA 1V4SA 1RDDA 2ASPA 3AA5X 3HBTA 1S6QA 3ASMA 2WBNA 3H3NO 3RTVA 1NJXA 2F8SA 4Z4EA 1T6CA 1BA0A 3KHYA 3THYA 1JLCA 4JHDB 2Q97A 1HNWK 4CEAA 3EE9A 3GG4A 1BA1A 5C0YA 3K0SA 3CMEN 3V6DA 3O1BA 4LFCK 3R8EA 4B1YB 3EZWA 3C6AA 4O8UA 3DLHA 4DQIA 1ATRA 4BR7A 3DLGA 1T7PA 4YOTA 4W5OA 4OO1J 4R79A 1MDUB 3A8YA 3M8SA 3L2UA 4JI3K 3EKUA 1NMNA 4FZYA 2A40A 4QAGA 3VQ8A 4J2AA 3ZLJA 1WSFA 3KK7A 4BGBA 2JGUA 3AO1A 4OPJA 3PIPL 3I0RA 5CY4A 3O4WA 4KHUA 1L3SA 4AM7A 3JS6A 4TSXA 2FF6A 1ILYA 1S72N 1YUWA 3HPGA 3BY5A 1FXXA 4DV4K 1ATSA 3HVTA 3CCLN 1S1VA 4AF1A 4B3OA 3DLBA 2IAJA 2XY6A 3GL1A 3LP2A 4B9QA 1SKRA 2QW9A 4W5NA 2FBVA 3G71N 2RF2A 4EFHA 2WTUA 2D0AA 4JS4A 1RTDA 4F4KA 4N47A 1YT3A 4CJQA 4YDUA 2JWKA 1HJRA 4IOCL 3K57A 4DTOA 1KFDA 4I2PA 2E2PA 1REVA 4JD2B 1EWRA 5HROA 2RKIA 4E19A 4W5TA 1J54A 3JXUA 3AARA 3G0ZA 4CHZA 1SKWA 3K5MA 1S9EA 3VQDA 5FLXO 3OJSA 3VEVA 2CGLA 2UXDK 5JS2A 4NYFA 1VSFA 3CCMN 3V9SA 5ADXA 2VG6A 4B1UB 4DQ8A 4CJTA 3KLGA 2E1YA 3FLCO 3K58A 3ZSOA 4MDBA 1D9DA 3ZSQA 4ELTA 3BZCA 4QS9A 1A5WA 3DWLA 2VQEK 1QE1A 3L4QA 5CHIA 2BUPA 1YTAA 4CESA 1HMVA 3PV8A 5LMNK 1TKZA 3ATUA 3CC2N 1VQ8N 4GV6A 5FRNA 5KQDA 1BI4A 3IMXA 4IEIA 3N4QA 1LAVA 1NGAA 3P4IA 4WQ4C 1VQLN 2B6AA 2KHOA 4E3SA 1YXQA 4FK4A 2O8FB 1RDCA 3O9QA 4WFBL 5AQYA 4NB4A 4BG9A 4EP4A 2G8WA 2HHTA 1NMDA 5HBMA 2V7ZA 3H45C 3F73A 2BGGA 4DR2K 1ZYQA 1NG9A 4AILC 3L6QA 4UY8O 3O5BA 1DTQA 4CJWA 1T8EA 4JKGA 2P9PA 4KKOA 2O8CA 3SPZA 2CGKA 2KFZA 4CGDA 4Q0BA 4E7IA 3SAFA 2QI2A 4IFEA 4Y1DA 3SQ2A 2PZSA 4B8CA 2HF3A 5FPDA 4CFAA 1TVRA 3VEOA 3MK6A 3HM9A 1DTTA 4JS5A 4CF9A 1RDAA 2EWSA 4CD3A 3NH1A 4YOVA 3S41A 1N34K 1QZ5A 2F9WA 3VGLA 3UKUA 5AQJA 2GELA 1C0FA 3M8QA 4IEEA 4DS5A 4OGEA 3VA3A 3OYJA 1JCFA 3DM2A 4CFDA 4KHYA 3LZIA 5AQNA 3ATVA 2Q0RA 3OYHA 4N41A 1U2VA 2YKMA 3OYMA 3ZEUA 4H4OA 3AVNA 4MDAA 3WUHA 4JI5K 3OBWA 4CF2A 5AQFA 4QOZB 3V9WA 3L8BA 4DF4A 2ZM6K 1BUPA 4K43A 4KHNA 5K14A 4FJ8A 4I6MA 2A1RA 3D2FB 3LP1A 3HPOA 5M1PA 1BQMA 3LALA 2OZMA 4M3TA 1I94K 1XQSC 5AFUH 3W0LA 3QICA 2FF3B 2W42A 3TAGA 2ZJRL 1C1BA 2P9NB 1RBSA 4BE2A 3TWHA 1M1KO 3RMDA 4JI1K 4BR5A 5BREA 4H0YB 3HP9A 2OYQA 3EN9A 1DGKN 4FWMA 3L3UA 3TR8A 1TGOA 2CH5A 3PLAA 2H3GX 2HHSA 5BR9A 4CEZA 3VA0A 3RSEA 3WNEA 1N8RO 2CH6A 5EU7A 1VK0A 3DRRA 3MEDA 4H5RA 4LH5A 3R3LA 2VGMA 1T44A 1L3TA 3ZT2A 3ULEA 4XEIA 2HMPA 3AA2A 4LF4K 1KCFA 4DV5K 4FJIA 4FWRA 5DMRA 3KD1E 1XHZA 4IJAA 2PFUA 2BANA 3RMAA 4BRCA 3HOSA 5AQKA 1J6ZA 5EOYA 1JCGA 4DHYA 4QS7A 2PYJA 1EP4A 3CI5A 1NM1A 3QFUA 2I7PA 4JI2K 1KFSA 3G4SN 3OVNA 1VQ9N 1KC8O 4R5PA 1X3NA 4FJGA 1C1AA 2QKBA 3G6EN 2D0BA 4WQ5A 2QXFA 4CHYA 3O3FA 5AQQA 2YJEA 1YITN 5GIOA 3WXMB 4M41A 3NVKA 1S5JA 5H1SQ 3LPTA 3VQEA 1LAWA 3B8AX 1X9WA 1TK8A 3MMVA 3VN5A 3DI6A 3AV9A 4RW9A 1KQSM 4FLTA 3U8XA 3UKRA 2RHKA 1RT5A 1IJJA 3TPQA 1LW0A 2ATQA 4F9OA 1UA0A 3CJ9A 5BPNA 4LFAK 2LSNA 3E9LA 3ALYA 1WSGA 4L8RB 4ZTFA 4FWOA 2A6AA 1B9FA 4CEQA 3DOKA 4JI7K 2HVIA 5J2MA 2GUPA 2O8DA 1ASVA 1JKHA 2X74A 1A5VA 1NKCA 4DTPA 4N5SA 1UAXA 5CYMA 1QSSA 5HRRA 4DFPA 3H3OB 1TKDA 1MWMA 3ENBA 4C8OA 4K8ZA 2FSNA 1HPZA 1QHTA 4IO8A 1NGFA 1Q9YA 2VCPA 4CZKA 4DTNA 2QWNA 4KB0A 4KRFA 4FW2A 4DLGA 5JLHA 4BR2A 3THWB 3AVJA 3HRGA 3QEXA 2Q0UA 4H5TA 3SUQA 3OA9A 2RN2A 2UUCK 4KHSA 3FZHA 5AR0A 2QWPA 4I9QA 4DR5K 1XC9A 4LF6K 4K0KK 3TI0A 4OKJA 2P5OA 3AY9A 4CZEA 3K5OA 4GKKK 4RG8A 2BH1A 3TTFA 4FM0A 4CK2A 1HJOA 3ID8A 3NAEA 1GOBA 4JK7A 1U47A 4N76A 1OKJA 4F2RA 1DKGD 4IDHA 4FJXA 2HMIA 5B8HA 1NJZA 2HVHA 2FLOA 3JAMO 3C6HA 2PYLA 4FWKA 4BQZA 1LWEA 3CJ7A 4DR7K 3R1XA 4JKEA 3FZKA 5SWMA 4M42A 4CEDA 1SV5A 3AVKA 4H0OA 4JN4A 4WYBA 3ULDA 3LANA 3WXJA 3BZKA 4FJHA 1NGIA 4FLUA 3ZSVA 4FJ9A 3V9XA 2OTLN 3SZ2A 2HHWA 3P83D 3O80A 3IDHA 4CJSA 3KZBA 1HRHA 2O8EB 2XO7A 4MO4A 1S6PA 4A2BA 3KKRA 3ZETB 1N5YA 4A59A 4BDZA 4MFBA 3HSCA 4BRNA 3AVBA 1Q86O 4X62K 3TANA 2HHVA 4FYDA 1QVGM 4CGHA 2GBZA 3ENOA 3ZSWA 1ATNA 3PX4A 2DFEA 2QWRA 4J2BA 1UWBA 3QDKA 4UQGA 4DLEA 3AVGA 1NJIO 5AQPA 3SUPA 1NWKA 1RBRA 5BRFA 3FR0A 3O4QA 4HTLA 1GOCA 5AQHA 5A2QO 4NXNK 3HTVA 4M7YA 3TAMA 1VSDA 1HYZA 3LDQA 3U9DA 4CEEA 4B1ZA 1NK7A 4IFYA 1JLGA 3DXKA 3SV3A 1ZBHA 3NGIA 3FE1A 3VENA 5HRSA 3EL2A 4JEPA 3RVCA 3THXA 3T1YK 3H46O 2EX3A 4DTSA 4H8KA 4CEFA 2V52B 3OYEA 4ELVA 2NRXA 1D4XA 2IVNA 1A5XA 1HUXA 3B6OA 2DPNA 2E2OA 4J2DA 5DM6L 2ASMA 2QEXN 3P1GA 4CZHA 4FL9A 3NDKA 1QQOA 2O8BB 3PX0A 1BG3A 1S1UA 4YOYA 4CJ4A 4E0DA 4BY9C 1J9AA 3LL3A 3CCVN 3PO5A 4OGCA 3SMSA 1C1CA 2AP1A 5BN9A 1VQON 3VQ6A 4BC3A 2P9UA 2FXUA 4GY2B 3OHRA 4LC9B 3CCEN 3O9RA 1K9MO 4O8KA 1NLVA 5J2QA 2HHXA 3RR7A 5AJ3K 2P9SB 1K8KA 3IS9A 2P9LB 3M8PA 3AO3A 2OANA 1NKBA 1JLEA 4PKIA 3T1HK 4F8RA 3QFPA 4PKHA 4M7XA 3VESA 4KTZA 2GWKA 3M5RA 1HYVA 4YHHK 3SQ0A 4CZIA 3CG7A 4H5NA 5JICA 2D5RA 1SS6A 2IS3A 5AZJB 3DOLA 3K5NA 4IXCA 4IOAL 4NCAA 3WNGA 3D45A 1U45A 3LP3A 3SUNA 1NJWA 4FM2A 3CXCM 3DLRA 5C24A 2YX6A 4BRGA 2YHWA 3CMAN 5KRTA 4BRLA 4Z4IA 1NBWA 1CZAN 2UXBK 4KAZA 4RCHA 1BWFO 3LM9A 5JMVA 4CGFA 3DXMB 2NUBA 1BIZA 1Q82O 3ZT1A 1HPMA 1E3MA 3LZJA 4FWSA 5AQGA 2OPSA 5FROA 1BGXT 2NRHA 2HBJA 2RPIA 4FJJA 3KLHA 2VQFK 1N36K 3OYBA 1BISA 2W6LA 3WXIA 4KHWA 1HNIA 1G15A 2A41A 4HTUA 3C94A 3K5LA 5EXWA 4A62A 2KFNA 4OPHA 4NLBA 2HNYA 4DB3A 3GE1A 4O0IA 1ZBFA 3E9OA 4FOEA 4BR4A 2WUSA 1VSLA 1E4FT 4KI6A 3AVFA 4ISFA 2QWQA 3CFPA 3HP6A 4I7FA 3ID6A 1KSPA 4O5FA 5M1KA 2JWLA 1Q8IA 4CGGA 4WF9L 3TARA 2Z1HA 3MX2A 1HQUA 3VEXA 4AHVA 3QO9A 4B08A 2E4LA 2P9IB 3MDQA 1VQKN 4LFBK 4AHUA 4MQ3A 4B1WB 3MWPA 2YCHA 2XHBA 4DU1A 4B9TA 2G8UA 1RILA 1XHXA 3L4IA 4B9SA 3QIPA 2G8FA 4HCCA 4DFKA 1E4GT 2G8HA 4I9LA 4JI0K 1TK0A 3OS1A 2AA4A 5HRNA 4DV2K 3MWTA 4JD2A 2YHXA 1WB9A 5J2NA 4CJUA 1QQNA 1SL2A 1J53A 3VPZA 4DV6K 3IFRA 3I8DA 4CK1A 5KGXA 3A5LC 4JKCA 2ZE2A 5KGWA 1BL3A 4KHQA 4X65K 4A61A 1ASUA 2YKNA 2WONA 1HKBA 2QM1A 1Y97A 3NMUA 1EQYA 1HR0K 4ILGB 3BDPA 3DRSA 3HK2A 2Q2RA 4Y0WA 1P90A 4Z4HA 2B5JA 3KLEA 4CHPA 4CE9A 5BRHA 3SYZA 5AQMA 3KK1A 3OYNA 3OJUA 3LDPA 5IWAK 3OYAA 2GWJA 1QTMA 5AQTA 4DUZK 4E7JA 2HSTA 4GV3A 3OYFA 1I39A 3NE6A 4H0TB 5CYQA 5BPLA 3D7EO 3PSFA 4Z4GA 1L3UA 2GUIA 4DSLA 3CFOA 4FK0A 3MN6A 3VEYA 4M3YA 4B1XB 4PY5A 1FJGK 4B8AB 4FVUA 4KHPK 1P8ZA 4DG1A 3V1OA 1W0HA 4CI6A 3EY1A 2OTJN 4FM1A 3QEWA 1S3XA 1J5OA 1L3VA 3LP0A 5JS1A 3CCJN 4YDUC 1NGEA 4AHCA 3TSUA 3FFKB 3BUZB 2F4VK 3PX6A 3HXMA 1HKGA 4RW8A 2VWBA 4M63C 4LSNA 1CZBA 4IO9L 4M3WA 2F7TA 3VMFB 4A57A 1TAUA 3LPUA 4H0XB 1T6DA 4DWIA 1JLBA 1NK6A 1X3MA 2YNIA 4LF5K 4FPBA 1LOTB 3WXLA 2ZD1A 1GLAG 2DFFA 1EXQA 4J8FA 5M1QA 3TAQA 1BO5O 3E66A 4HWIA 5BPMA 1U2VB 3LWMA 1GLFO 5AQSA 5AFUA 1WN7A 5HOOA 1ZBUA 1TYQB 1WAFA 5BN8A 4NCGA 2P9KB 5D3GA 1YF5L 3L0QA 4JLHA 2OPRA 1C0MA 4JK8A 1JCEA 3HT3A 4I6MB 4CJVA 1TKTA 1IG9A 3O9SA 4O4GA 1U48A 2QXLA 1TL3A 1RT3A 3H6EA 2NRVA 3QB0A 4DSFA 3O1WA 1WBDA 1IKVA 4OKKA 1IG8A 2DY4A 4WCEL 3CC7N 4BRIA 3PSIA 1SZ2A 5M1FA 3EYZA 5AQUA 2QKKA 3M8RA 4CFCA 5GIPA 5C2DA 4EIAA 4YY3K 5J2PA 4ID1A 1W9HA 1R59O 3VEWA 1O13A 4CZJA 4BRMA 4CHQA 2P5GA 1G99A 4DF8A 2UU9K 3HJFA 4PQUA 2X6SA 4YNQA 1NJYA 1DEJA 3ZSXA 1CXQA 1Q9XA 5LL6Z 4AQYK 2YNGA 5HL7L 4OVLA 5AQLA 4B3MK 3ULEB 2XRIA 1UA1A 5M1OA 4IG0A 3AAPA 5CZ1A 4BC4A 1YVUA 2UXCK 4A5BA 4CEOA 3I33A 2VWJA 4IKFA 3A0IX 3QESA 4BRHA 3NF7A 1NKEA 1NGJA 3TABA 1W7AA 1T03A 2E2QA 2OZSA 3HM8A 1F21A 1SUQA 4BDYA 3TU5A 3BF1A 3P5JA 1BCMA 4IBNA 3C6UA 4IZ9A 3PO4A 4Z0UA 3IAYA 5KRSA 1YJ9N 3AVMA 3QLHA 3WQUA 1OH5A 2IC3A 4MLHA 1BU6O 2FBYA 1Z6RA 4DQQA 4YOXA 2ITMA 2A3ZA 4O55A 3DLKA 3SI6A 4FJMA 2D0PA 4CIGA 4A2AA 3J8AA 1SAZA 5IT9O 5C2FA 3D2EB 4CCHA 1KLNA 2KZMA 1XUPO 3U9ZA 1IBLK 2FC0A 4KH5A 2ZJPL 3WNFA 3FZMA 3SPYA 4JKBA 3EKSA 2O8DB 3ITHA 3W3DA 2IOCA 4BRKA 3WXKA 3SMPA 2F8TA 1IV0A 4B9LA 1LCUA 4JYAK 3OYLA 5EVZA 4IG3A 3RRHA 2E2NA 3F9MA 4BDPA 2HB5A 3T69A 4BVPA 1XNQK 4QS8A 4CBWA 3Q7BA 1KXPA 2ETJA 4CERA 3O6WA 3RR8A 3NF8A 1VRTA 3IKMA 2OPPA 3QNNA 3V1QA 2KTQA 2OPQA 2XY5A 4FSVA 1D5AA 4K42A 1JJ2M 1VQ5N 1RTJA 2DFHA 4DUYK 4FW1A 1NK4A 1VQNN 2F9TA 3A5MC 5C42A 4HVJA 3MECA 3C7NB 2UYTA 5CE3A 5AZIA 3HO1A 1I3AA 3PY8A 2HBKA 2IVPA 4WQ5C 4ILHA 2GV9A 4LF8K 4FJKA 2FBTA 4E7KA 4BRDA 2I5JA 2HBLA 4JAXA 3ZSRA 1BDGA 5JLFA 1KVAA 2J4RA 5EX5A 1X9SA 3T1AA 1YJNN 3RRGA 1S9GA 4A5AA 4BWMA 5M1NA 1MA9B 3VERA 3CCUN 3F5TA 4BE1A 2QTDA 2AJQA 3WEEA 1WSJA 3MCPA 3A5OC 1RT4A 1Z25A 4B3RK 3MN9A 1KVCA 5KTQA 1HNXK 2W40A 5F0XA 1WBBA 4M3XA 3WNHA 5C10A 1OH8A 4FWNA 2VYPA 4PWDA 3O8MA 3CM6A 3RMBA 4O0JA 3E01A 4K41A 3T7ZA 1GOAA 2FBXA 4CECA 3J7AP 4IWVA 1XC3A 3CPWM 2BE2A 1FKPA 2V7YA 3OYKA 1T05A 1Q18A 3F9KA 4G1QA 5C12A 3EO3A 1JL2A 4DSIA 4FLXA 1W97L 3SLCA 3K9JA 3D6RA 1JLQA 3GBTA 3FFIA 2ZJQL 4BROA 2NRZA 1VQ7N 1J5EK 4JRPA 3QNOA 3AGKA 4LH4A 1QSYA 1H1VA 1JLFA 3ZYYX 3N4PA 4BQLA 2VGNA 1X9MA 4GW6A 3TAEA 4CJ5A 5AQWA 4KFBA 1BIUA 4I2QA 3M6GA 1ZBIA 1YJWN 4BG8A 2ITGA 1NK9A 1Y64A 5TKWA 2NRWA 1SQKA 5CZ2A 3IUCA 2E6LA 5T7BA 4CJFA 3K2PA 4KREA 3J7YP 3NVMA 4FJLA 1XI1A 5I42A 4CVNE 4H0PA 2FSKA 3TAFA 4EP5A 3DXKB 2CGJA 1YTUA 3DJCA 3VGKA 4OPKA 3MN5A 4JKFA 3U3YA 1RDUA 3SK3A 1RBUA 1NGHA 4EHTA 1GLEG 1BCOA 2YI1A 2D4WA 1Q7YO 1GLJO 4M3RA 1SL0A 4WE1A 1KAXA 4XH5A 4Z4CA 4NCBA 2IVOA 4X66K 1C0TA 1GLLO 4PHTX 4NLCA 4E7HA 4CK3A 3KLIA 5GADP 1QQCA 5AQIA 5HLFA 2R7YA 3ZT0A 2XY7A 4KBOA 1N32K 1NGGA 1RBVA 1D9FA 5FRMA 4DTJA 1IKWA 3AGRA 2NZTA 1CZ9A 4FWQA 2QWLA 2G8VA 5KPTA 1QS4A 4JI6K 4DV3K 2O8BA 1VSKA 2XY8A 4H5VA 4Z94A 1QVFM 4ID5A 2RE2A 3JSMA 3OS2A 3I0SA 2QWOA 1KLMA 3AO5A 4BRAA 3B6PA 1T3VA 3OW2M 3NH2A 1K8KB 3HYFA 4BRQA 1TK5A 4HUGA 2X6NA 4XIUA 4HCBA 5ELZA 1B92A 3J7ZO 3UIQA 4FZXC 2W41A 1X1PA 1QSLA 2HHQA 4RW7A 3HOTA 1IO2A 1VSIA 5AQRA 3ZSYA 3BGRA 3S9HA 2P9LA 3DYAA 2E5LK 1Z05A 3ZX3A 3OYIA 3AVAA 3O08A 3THVA 1CLQA 3MXIA 3MCAB 4W5QA 3DLLL 4ISEA 2QWMA 3FZLA 1K8AO 5FPNA 4KH6A 4WFNL 1JXEA 4BVOA 4DV7K 3J80O 2E88A 1LV5A 2Q3SA 2ZGZA 2YNHA 4DKWA 3QBWA 1IKXA 1NK8A 3THYB 2KKZA 4BC5A 3O3HA 1O1WA 4DFJA 3CM5A 1BQNA 4Q5VA 4IFVA 2OCEA 1U49A 1HNZK 4B9VA 2G8KA 1ZBSA 2FSJA 3DLEA 3R6MA 4FLZA 2Y1JA 3MXMA 4O5BA 4PL8A 2NNWA 4JHDA 4B9MA 2WFBA 3DXMA 1DT9A 3A5NC 1XMQK 3V1RA 4BREA 1L5UA 1LWCA 3EEQA 4FO0A 5AQXA 3VTHA 4YOUA 3L2WA 3MX5A 4O44A 1RT6A 3AVLA 3TSPA 3PIOL 2HF4A 3MEGA 4EHUA 1EWQA 1B9DA 3V81A 3RWUA 2E1ZA 3CERA 3ISNC 1WLJA 2KQ2A 4J2EA 3QEIA 4AHSA 1IH7A 4OJRA 2X78A 4AM6A 1X9JA 1YI2N 2EHGA 4WQ4A 3ZX0A 3AAQA 3V4IA 4CGJA 2GEMA 3HI0A 3OYDA 4EZ9A 3G25A 4BRFA 4ELUA 3IRXA 4CGIA 2YHBA 4YORA 2IDOA 5E41A 3NH0A 3OS0A 4U7BA 5EY4A 3E9PA 4OKEA 2KLAA 4CJ3A 4CZGA 4JNEA 3KK3A 4C8LA 1V4TA 1RCHA 1NGCA 4BGAA 3J81O 2P9IA 4DU3A 3WQTA 3CF5L 4DR3K 3QEVA 1VHXA 3FGUA 4C23A 4U67L 4JV5K 1RT7A 3D0PA 4LSLA 4OLBA 3V9ZA 3L3VA 4GVMA 4KTWA 3HSTB 2WOMA 4PL7A 4YOWA 3JYTA 1NGBA 2UUBK 3AVIA 5FDLA 2HW3A 4H0VB 1KAZA 5KQ8A 5HP1A 4E89A 3EE8A 3SBTA 3KD5E 4B9NA 4CHOA 4QCLA 1SKSA 4CJEA 3GDQA 1KTQA 1BI4B 5GAHP 1MWKA 4AHRA 3OBYA 1WUAA 1ESVA 3VQ5A 4FJ7A 3CD6N 3O3GA 2V51B 4PKGA 1IKYA 4JI4K 3S3OA 5TKYA 2HHUA 4MLEA 3UE5A 4CF1A 3CC4N 4CJRA 3NF6A 5ADXH 1ZXOA 4WFAL 4FZZA 1WOQA 4DCHA 2G8IA 4E1NA 4M3ZA 4X64K 2O8FA 5SZTA 5DM7L 4FPAA 2P9PB 4JKGB 3OYGA 3SJHA 5CR4A 2O8CB 1C0UA 3NFAA 2D0OA 4NYNA 4C1NK 3P31A 4IOXA 3ZX2A 3LDSA 2IIRA 3LDOA 1FK9A 3VQQA 3OYCA 1WNSA 5HRPA 3QETA 1VSEA 2ZGYA 2ZWHA 3I55N 4F2SA 3UB5A 3UKUB 1N6QA 3HZ6A 4BR9A 3U4LA 1GLDG 1LW2A 1YAGA 4EZ6A 1RBTA 4CFBA 4C1NI 1RT1A 3ZEUB 5J1EA 3CQ8A 2ZQBA 1IBKK 1HNVA 4DTUA 3OY9A 3SJJA 3NCIA 3VOVA 1TV6A 1C0GA 2UUAK 4HUFA 3L2VA 3RMCA 2HHHK 4FJNA 3AO2A 2A42A 1JL1A 2YHAA 3VQBA 3EZ5A 3H1QA 3DRPA 1RGIA 1K6YA 2IGIA 4LF7K 3HVRA 2YJFA 4DTXA 4DR4K 1TUUA 3CJ1A 4HUEA 1TYQA 1EX4A 1QQMA 3PUFA 5JVGL 4FLYA 3IG1A 4YFUA 2P9KA 4FWPA 3A2FA 1NOZA 4HHTA 4IJNA 3P38A 3D2FA 4MO5A 3SBGA 4CIEA 3I56N 3L2RA 4K8XA 4RW4A 4EAHD 4E1JA 4NO7A 2PY5A 1YIJN 1D8YA 2P9NA 3BEXA 3QBXA 4F3TA 3LDNA 1ZC6A 1ASWA 3NF9A 3RSEB 4PA1A 3TTCA 1WSEA 4Z4FA 4G9ZA 3LDLA 3K9KA 3TAPA 5E84A 4CW7B 2QK9A 2HBMA 3QIOA 1KVBA 1M90O 2YHYA 3SV4A 2P1JA 4JKAA 4M45A 3CJCA 3AVHA 4RTFD 5GAGP 3QEPA 3P39A 3E1YA 4KI4A 4JK9A 1NOYA 3NGYA 1VQPN 1SL1A 4DV1K 4B3SK 1IBMK 1UOCA 4DS4A 2QA4N 2Y1IA 3SCXA 3AA4A 2O4GA 3HL8A 1YVNA 5F1XA 4GVEA 2P51A 1RT2A 3CFRA 3DMJA 1FW6A 1NK5A 4BC2A 1JLAA 3C65A 4ISGA 1W2BM 4FJ5A 5FPEA 1TL1A 1U04A 5AQVA 4BE0A 3R9PA 3QMLA 5AQZA 3UKRB 1VQ4N 2D0CA 4CZMA 3NHGA 4PUOA 4XH1A 4BACA 3V9UA 3NBPA 3KTQA 3CCRN 2GTDA 1RDWX 4E7LA 4GMJB 3O4NA 3SNNA 1U4BA 1EKEA 3MEEA 1LWFA 3H08A 1OH7A 4JKHA 3I8BA 4B9UA 1VAZA 1XWLA 3D2EA 5LY3A
chains in the Genus database with same CATH topology
4OPKA 2Z1JA 3U3YA 4CFDA 4KHYA 1RBUA 3LZIA 1TAQA 2KFNA 3OYJA 2HNYA 1EETA 1BCOA 4O0IA 4DQRA 1ZBFA 4RW6A 3OYHA 2QKKA 4M3RA 1SL0A 4N41A 4DQSA 2YKMA 4DQPA 4WE1A 4AH9A 1VSLA 3OYMA 3MAQA 4Z4CA 4NCBA 4H4OA 1VSMA 4KI6A 4ZHRA 1C0TA 3AVFA 3AVNA 3CFPA 4E7HA 4CK3A 3HP6A 2VWKA 1RNHA 4I7FA 3KLIA 4CF2A 1QQCA 3T19A 1KSPA 4QOZB 3V9WA 1Q8IA 4CGGA 4CJKA 2R7YA 3TARA 2Z1HA 5HLFA 3ZT0A 3L8BA 4DF4A 3ZT4A 1R0AA 4DU4A 2XY7A 2KW4A 1HQUA 2Z1GA 4N56A 4KHNA 5K14A 1HQEA 3QO9A 4AHVA 4FJ8A 4B08A 1RBVA 2E4LA 1D9FA 5FRMA 2HNDA 2A1RA 4DTJA 3LP1A 4AHUA 3HPOA 1IKWA 4MQ3A 1BQMA 3LALA 1CZ9A 4IDKA 2OZMA 2G8VA 1S1TA 2XHBA 4DSJA 4M3TA 1QS4A 4DU1A 2W42A 4B9TA 4ICLA 3TAGA 1C1BA 1RILA 2G8UA 1XHXA 1RBSA 4B9SA 1VSKA 2XY8A 3QIPA 3TWHA 4BE2A 2G8FA 3RMDA 4HCCA 2Z1IA 4DFKA 4ID5A 2G8HA 3JSMA 4I9LA 3OS2A 3U3GA 1TK0A 3I0SA 5I3UA 3OS1A 3HP9A 4JRQA 5HRNA 1KLMA 3KKSA 2OYQA 1RTHA 3AO5A 3TR8A 3L3UA 3B6PA 1TGOA 3ZSZA 3VQPA 5J2NA 3NH2A 4CJUA 1S1WA 1SL2A 1J53A 3HYFA 4CJLA 3I8DA 4CK1A 2DTUA 5C25A 5KGXA 1TK5A 2HHSA 4HUGA 2X6NA 4CEZA 4XIUA 3KLFA 3VA0A 3SUOA 4HCBA 5KGWA 2ZE2A 4FLVA 1BL3A 4KHQA 1B92A 3UIQA 3WNEA 4FZXC 1ASUA 2YKNA 1X1PA 2WONA 1QSLA 3AO4A 5EU7A 4AHTA 2A1SA 1Y97A 4RW7A 2HHQA 1VK0A 1IO2A 3C95A 3BDPA 1VSIA 3DRSA 3ZSYA 3DRRA 3HK2A 3BGRA 3MEDA 3S9HA 4Z4HA 2B5JA 3DYAA 3KLEA 4CHPA 3AA3A 4C8MA 4LH5A 4CE9A 3SYZA 3KK1A 3OYNA 3OJUA 1L3TA 3ZT2A 3OYIA 3KJVA 3AVAA 3LAMA 3OYAA 1QTMA 4E7JA 3AA2A 3THVA 1KCFA 3OYFA 3HPHA 1I39A 4FJIA 1CLQA 3MXIA 3NE6A 4W5QA 5CYQA 5DMRA 3KD1E 1XHZA 3AVCA 3VQCA 4Z4GA 1L3UA 1RDBA 2BANA 3RMAA 4H4MA 2GUIA 4DSLA 3CFOA 1KRPA 1JXEA 4FK0A 4DTMA 1WSHA 3K59A 2F96A 4CJPA 4M3YA 3QINA 4W5RA 2Q3SA 1LV5A 2PYJA 1EP4A 4PY5A 2YNHA 1NK8A 1IKXA 4CEBA 4B8AB 3S3MA 3O3HA 1KFSA 1O1WA 3OVNA 4DFJA 3CM5A 1BQNA 4Q5VA 1S1XA 4R5PA 4FJGA 4IFVA 4DG1A 1C1AA 3V1OA 1U49A 2QKBA 4BWJA 1W0HA 2D0BA 3EY1A 4B9VA 2QXFA 4FM1A 4CHYA 3O3FA 3QEWA 4KB1A 2G8KA 1J5OA 3DLEA 3VQAA 4FLZA 1WAJA 3LP0A 1L3VA 5JS1A 4KV8A 5DK5A 4C8NA 4M41A 4AHCA 2Y1JA 4O5BA 3MXMA 1S5JA 3LWLA 3QERA 4C8KA 3LPTA 3VQEA 1LAWA 3PX6A 1X9WA 1TK8A 4B9MA 3HXMA 3VN5A 3DI6A 3C6TA 4RW8A 3AV9A 4DFMA 4RW9A 4LSNA 3V1RA 1CZBA 1L5UA 1LWCA 4FLTA 4DSKA 4M3WA 3L2WA 3VQ7A 4O44A 1RT6A 3CYMA 3AVLA 4DSEA 1TAUA 3LPUA 1RT5A 3KK2A 3T3FA 1C6VA 1LW0A 2ATQA 3MEGA 1B9DA 3V81A 1UA0A 4DWIA 5KI6A 3VQ4A 1JLBA 1DLOA 2LSNA 4DTRA 1NK6A 4FXDA 2YNIA 3RWUA 3ALYA 1WSGA 4L8RB 4ZTFA 3ISNC 1WLJA 1B9FA 2KQ2A 2ZD1A 4J2EA 2DFFA 3QEIA 1EXQA 4CEQA 3DOKA 4AHSA 2HVIA 1IH7A 5J2MA 3KIOA 3LAKA 2X78A 4OJRA 3TAQA 1ASVA 1NK0A 4F4KA 1JKHA 2X74A 1A5VA 3ZT3A 1NKCA 2EHGA 3LWMA 4DTPA 3V4IA 4N5SA 1UAXA 4CGJA 1WN7A 5CYMA 4CF0A 1QSSA 3OYDA 4EZ9A 4CIFA 1ZBUA 5HRRA 4OLAA 4ELUA 3IRXA 1WAFA 1HYSA 4CGIA 2YHBA 4NCGA 4DFPA 1TKDA 4C8OA 4K8ZA 5D3GA 4JLHA 1ITGA 1HPZA 1QHTA 4LD0A 2OPRA 1C0MA 2IDOA 5E41A 1Q9YA 3HT3A 3NH0A 3OS0A 4Y1CA 4CJVA 1TKTA 2YV0X 1IG9A 4E1MA 4O4GA 4DTNA 4KB0A 4KRFA 4FW2A 1U48A 4OKEA 1VSHA 2KZZA 4DLGA 3L2QA 4CJ3A 1TL3A 4CF8A 1RT3A 1CXUA 3AVJA 3QEXA 2VG5A 3KK3A 4DSFA 3SUQA 2OA8A 3K5LA 1IKVA 4OKKA 2O4IA 4C8LA 1RCHA 2RN2A 4KHSA 4DU3A 2DY4A 4OLBA 1RTIA 3QEVA 3MXJA 4I9QA 4F3OA 1RT7A 1XC9A 3EYZA 3D0PA 4LSLA 4LY7A 4OKJA 3V9ZA 3L3VA 4GVMA 3M8RA 4KTWA 4CFCA 3TI0A 1JXBA 3HSTB 3K5OA 2WOMA 3JYTA 3AVIA 4RG8A 5FDLA 2HW3A 5J2PA 4FM0A 4ID1A 4CK2A 4DMNA 1W9HA 3NAEA 1GOBA 1U47A 3NGZA 5HP1A 4N76A 2HNZA 2P5GA 4CHQA 4F2RA 1ZBLA 4E89A 2VG7A 4DF8A 4FJXA 3HJFA 3KD5E 4PQUA 4B9NA 2HMIA 2X6SA 4CHOA 4KTQA 4YNQA 1NJYA 1TKXA 1NJZA 3S3NA 1SKSA 4QCLA 1VSJA 4CJEA 3SQ1A 1VRUA 3G10A 2HVHA 3ZSXA 1CXQA 1Q9XA 2YNGA 1KTQA 2PYLA 1BI4B 2JLEA 4KPYA 4FCYA 1LWEA 4OVLA 2YNFA 1WSIA 4FLWA 2XRIA 1UA1A 4AHRA 5SWMA 3U6FA 4M42A 4IG0A 1SV5A 5CZ1A 4CEDA 1YVUA 3AVKA 3VQ9A 1Z26A 3VQ5A 3ULDA 2E6MA 4CEOA 3O3GA 4FJ7A 3LANA 2VWJA 4FJHA 4IKFA 3SQ4A 1IKYA 4FLUA 3ZSVA 3QESA 3S3OA 4FJ9A 2HHUA 4CHNA 3NF7A 4CF1A 4CJRA 3V9XA 1NKEA 1MU2A 3SZ2A 3TABA 4ZTJA 3NF6A 3P83D 4FVMA 1T03A 2HHWA 2OZSA 4FZZA 4M3UA 1F21A 4CJSA 1SUQA 1BHLA 2G8IA 4E1NA 4BDYA 1HRHA 2XO7A 3P5JA 2B4JA 4KO0A 2BDPA 4M3ZA 5SZTA 1FKOA 1BCMA 3OYGA 1S6PA 3ZCMA 3KKRA 1N5YA 1RDDA 4IBNA 3AA5X 3C6UA 3PO4A 1C0UA 3NFAA 4Z0UA 3IAYA 4BDZA 5KRSA 4MFBA 3AVMA 1S6QA 3ASMA 4NYNA 3AVBA 3QLHA 2IC3A 3LDSA 3TANA 3RTVA 2FBYA 1NJXA 2F8SA 2HHVA 4FYDA 4Z4EA 4DQQA 4CGHA 2GBZA 1JLCA 3ZSWA 1FK9A 4O55A 3DLKA 3VQQA 3PX4A 2DFEA 3SI6A 4J2BA 4FJMA 4CEAA 1WNSA 3OYCA 1UWBA 5HRPA 3QETA 1VSEA 4CIGA 2P5OA 4F2SA 4UQGA 4DLEA 3AVGA 3SUPA 1RBRA 3V6DA 1N6QA 3O4QA 1GOCA 4CCHA 1KLNA 2KZMA 3DLHA 4DQIA 2FC0A 3DLGA 1T7PA 3TAMA 4W5OA 1VSDA 1HYZA 1LW2A 3WNFA 4EZ6A 3SPYA 1RBTA 4CEEA 4CFBA 3ITHA 3M8SA 3L2UA 1NK7A 4IFYA 1JLGA 1RT1A 2IOCA 5J1EA 3CQ8A 2ZQBA 3SV3A 1ZBHA 4FZYA 3NGIA 1HNVA 4QAGA 3VQ8A 4J2AA 4DTUA 1WSFA 2F8TA 5HRSA 3OY9A 3SJJA 4B9LA 3NCIA 2JGUA 3AO1A 1TV6A 3OYLA 4OPJA 3I0RA 5CY4A 4IG3A 2EX3A 3RRHA 4DTSA 4KHUA 4HUFA 4H8KA 4CEFA 3L2VA 3RMCA 3OYEA 1L3SA 4ELVA 4BDPA 4FJNA 3AO2A 1JL1A 2HB5A 2YHAA 4TSXA 1A5XA 3VQBA 3EZ5A 4W5NA 3B6OA 3DRPA 3HPGA 1FXXA 1K6YA 2IGIA 3HVTA 4J2DA 2ETJA 3HVRA 1S1VA 4DTXA 4CERA 4B3OA 3DLBA 2IAJA 4HUEA 3P1GA 1EX4A 4FLYA 3PUFA 3RR8A 3IG1A 3NF8A 2XY6A 4YFUA 1VRTA 3NDKA 3LP2A 2OPPA 3QNNA 3PX0A 3V1QA 1SKRA 3A2FA 1NOZA 2FBVA 2KTQA 2RF2A 2OPQA 2XY5A 2D0AA 4JS4A 4HHTA 1D5AA 1YT3A 4N47A 4CJQA 1RTDA 1RTJA 1S1UA 2DFHA 1HJRA 4FW1A 4CJ4A 1NK4A 4E0DA 3L2RA 4CIEA 3K57A 4DTOA 1KFDA 4K8XA 4I2PA 5C42A 4RW4A 4HVJA 1J9AA 2PY5A 1REVA 3MECA 3PO5A 4OGCA 1C1CA 5HROA 1D8YA 3HO1A 2RKIA 1I3AA 3VQ6A 1J54A 4E19A 4W5TA 3PY8A 4F3TA 3G0ZA 4CHZA 1ASWA 1SKWA 2GV9A 3NF9A 4PA1A 3K5MA 1S9EA 1WSEA 3VQDA 2FBTA 4E7KA 4FJKA 3TAPA 4Z4FA 2I5JA 5J2QA 3OJSA 2HHXA 2QK9A 3RR7A 3ZSRA 3QIOA 5JS2A 4NYFA 1VSFA 1KVBA 3V9SA 1KVAA 3IS9A 1X9SA 3T1AA 2VG6A 3M8PA 3SV4A 2P1JA 4M45A 1S9GA 3AO3A 3RRGA 4CJTA 3KLGA 4BWMA 1NKBA 1JLEA 3K58A 4F8RA 3ZSOA 1D9DA 3ZSQA 4ELTA 3AVHA 4BE1A 2AJQA 4KTZA 3QEPA 1WSJA 1A5WA 4KI4A 1RT4A 1QE1A 1Z25A 1HYVA 1KVCA 3NGYA 5KTQA 1NOYA 4FK2A 1SL1A 1YTAA 4CESA 4M3XA 1HMVA 3WNHA 3SQ0A 3PV8A 4PWDA 1UOCA 1TKZA 3CG7A 3CM6A 3RMBA 4DS4A 4O0JA 5FRNA 3E01A 1GOAA 2Y1IA 1BI4A 2FBXA 3SCXA 3AA4A 4CECA 1LAVA 2O4GA 2D5RA 2IS3A 3HL8A 3DOLA 3K5NA 4NCAA 2B6AA 2P51A 2BE2A 3D45A 3WNGA 1U45A 1RT2A 1FKPA 3LP3A 3SUNA 3OYKA 3CFRA 1T05A 1NJWA 4FM2A 4E3SA 4FK4A 3F9KA 4G1QA 3DLRA 1RDCA 1JL2A 3DMJA 5C24A 4DSIA 4FLXA 2G8WA 1NK5A 4EP4A 1JLAA 2HHTA 5HBMA 5KRTA 4Z4IA 3F73A 1JLQA 2BGGA 3FFIA 4FJ5A 1ZYQA 4KAZA 4AILC 1TL1A 1U04A 4JRPA 3QNOA 4LH4A 4CGFA 1DTQA 1QSYA 4CJWA 1T8EA 4BE0A 1JLFA 4KKOA 3SPZA 2NUBA 1X9MA 1BIZA 4GW6A 4CJ5A 3TAEA 3ZT1A 4CGDA 4KFBA 2KFZA 1BIUA 4I2QA 1ZBIA 2D0CA 4Q0BA 4E7IA 3NHGA 4PUOA 3LZJA 4Y1DA 3SQ2A 2PZSA 2ITGA 4BACA 2OPSA 4B8CA 5FROA 1NK9A 3V9UA 1BGXT 2RPIA 4CFAA 1TVRA 4FJJA 5CZ2A 3NBPA 3KLHA 3HM9A 3KTQA 1DTTA 2E6LA 5T7BA 3OYBA 4JS5A 4CF9A 1BISA 1RDAA 3K2PA 4CJFA 3NH1A 4KREA 4E7LA 4GMJB 3O4NA 3SNNA 4FJLA 1XI1A 5I42A 1U4BA 4KHWA 1EKEA 3MEEA 1LWFA 3H08A 4DS5A 3TAFA 3M8QA 4B9UA 4EP5A 4OGEA 3VA3A 1XWLA 1YTUA 1HNIA 1G15A 4HTUA 3C94A 3DM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPK A;  2Z1J A;  3U3Y A;  4CFD A;  4KHY A;  1RBU A;  3LZI A;  1TAQ A;  2KFN A;  3OYJ A;  2HNY A;  1EET A;  1BCO A;  4O0I A;  4DQR A;  1ZBF A;  4RW6 A;  3OYH A;  2QKK A;  4M3R A;  1SL0 A;  4N41 A;  4DQS A;  2YKM A;  4DQP A;  4WE1 A;  4AH9 A;  1VSL A;  3OYM A;  3MAQ A;  4Z4C A;  4NCB A;  4H4O A;  1VSM A;  4KI6 A;  4ZHR A;  1C0T A;  3AVF A;  3AVN A;  3CFP A;  4E7H A;  4CK3 A;  3HP6 A;  2VWK A;  1RNH A;  4I7F A;  3KLI A;  4CF2 A;  1QQC A;  3T19 A;  1KSP A;  4QOZ B;  3V9W A;  1Q8I A;  4CGG A;  4CJK A;  2R7Y A;  3TAR A;  2Z1H A;  5HLF A;  3ZT0 A;  3L8B A;  4DF4 A;  3ZT4 A;  1R0A A;  4DU4 A;  2XY7 A;  2KW4 A;  1HQU A;  2Z1G A;  4N56 A;  4KHN A;  5K14 A;  1HQE A;  3QO9 A;  4AHV A;  4FJ8 A;  4B08 A;  1RBV A;  2E4L A;  1D9F A;  5FRM A;  2HND A;  2A1R A;  4DTJ A;  3LP1 A;  4AHU A;  3HPO A;  1IKW A;  4MQ3 A;  1BQM A;  3LAL A;  1CZ9 A;  4IDK A;  2OZM A;  2G8V A;  1S1T A;  2XHB A;  4DSJ A;  4M3T A;  1QS4 A;  4DU1 A;  2W42 A;  4B9T A;  4ICL A;  3TAG A;  1C1B A;  1RIL A;  2G8U A;  1XHX A;  1RBS A;  4B9S A;  1VSK A;  2XY8 A;  3QIP A;  3TWH A;  4BE2 A;  2G8F A;  3RMD A;  4HCC A;  2Z1I A;  4DFK A;  4ID5 A;  2G8H A;  3JSM A;  4I9L A;  3OS2 A;  3U3G A;  1TK0 A;  3I0S A;  5I3U A;  3OS1 A;  3HP9 A;  4JRQ A;  5HRN A;  1KLM A;  3KKS A;  2OYQ A;  1RTH A;  3AO5 A;  3TR8 A;  3L3U A;  3B6P A;  1TGO A;  3ZSZ A;  3VQP A;  5J2N A;  3NH2 A;  4CJU A;  1S1W A;  1SL2 A;  1J53 A;  3HYF A;  4CJL A;  3I8D A;  4CK1 A;  2DTU A;  5C25 A;  5KGX A;  1TK5 A;  2HHS A;  4HUG A;  2X6N A;  4CEZ A;  4XIU A;  3KLF A;  3VA0 A;  3SUO A;  4HCB A;  5KGW A;  2ZE2 A;  4FLV A;  1BL3 A;  4KHQ A;  1B92 A;  3UIQ A;  3WNE A;  4FZX C;  1ASU A;  2YKN A;  1X1P A;  2WON A;  1QSL A;  3AO4 A;  5EU7 A;  4AHT A;  2A1S A;  1Y97 A;  4RW7 A;  2HHQ A;  1VK0 A;  1IO2 A;  3C95 A;  3BDP A;  1VSI A;  3DRS A;  3ZSY A;  3DRR A;  3HK2 A;  3BGR A;  3MED A;  3S9H A;  4Z4H A;  2B5J A;  3DYA A;  3KLE A;  4CHP A;  3AA3 A;  4C8M A;  4LH5 A;  4CE9 A;  3SYZ A;  3KK1 A;  3OYN A;  3OJU A;  1L3T A;  3ZT2 A;  3OYI A;  3KJV A;  3AVA A;  3LAM A;  3OYA A;  1QTM A;  4E7J A;  3AA2 A;  3THV A;  1KCF A;  3OYF A;  3HPH A;  1I39 A;  4FJI A;  1CLQ A;  3MXI A;  3NE6 A;  4W5Q A;  5CYQ A;  5DMR A;  3KD1 E;  1XHZ A;  3AVC A;  3VQC A;  4Z4G A;  1L3U A;  1RDB A;  2BAN A;  3RMA A;  4H4M A;  2GUI A;  4DSL A;  3CFO A;  1KRP A;  1JXE A;  4FK0 A;  4DTM A;  1WSH A;  3K59 A;  2F96 A;  4CJP A;  4M3Y A;  3QIN A;  4W5R A;  2Q3S A;  1LV5 A;  2PYJ A;  1EP4 A;  4PY5 A;  2YNH A;  1NK8 A;  1IKX A;  4CEB A;  4B8A B;  3S3M A;  3O3H A;  1KFS A;  1O1W A;  3OVN A;  4DFJ A;  3CM5 A;  1BQN A;  4Q5V A;  1S1X A;  4R5P A;  4FJG A;  4IFV A;  4DG1 A;  1C1A A;  3V1O A;  1U49 A;  2QKB A;  4BWJ A;  1W0H A;  2D0B A;  3EY1 A;  4B9V A;  2QXF A;  4FM1 A;  4CHY A;  3O3F A;  3QEW A;  4KB1 A;  2G8K A;  1J5O A;  3DLE A;  3VQA A;  4FLZ A;  1WAJ A;  3LP0 A;  1L3V A;  5JS1 A;  4KV8 A;  5DK5 A;  4C8N A;  4M41 A;  4AHC A;  2Y1J A;  4O5B A;  3MXM A;  1S5J A;  3LWL A;  3QER A;  4C8K A;  3LPT A;  3VQE A;  1LAW A;  3PX6 A;  1X9W A;  1TK8 A;  4B9M A;  3HXM A;  3VN5 A;  3DI6 A;  3C6T A;  4RW8 A;  3AV9 A;  4DFM A;  4RW9 A;  4LSN A;  3V1R A;  1CZB A;  1L5U A;  1LWC A;  4FLT A;  4DSK A;  4M3W A;  3L2W A;  3VQ7 A;  4O44 A;  1RT6 A;  3CYM A;  3AVL A;  4DSE A;  1TAU A;  3LPU A;  1RT5 A;  3KK2 A;  3T3F A;  1C6V A;  1LW0 A;  2ATQ A;  3MEG A;  1B9D A;  3V81 A;  1UA0 A;  4DWI A;  5KI6 A;  3VQ4 A;  1JLB A;  1DLO A;  2LSN A;  4DTR A;  1NK6 A;  4FXD A;  2YNI A;  3RWU A;  3ALY A;  1WSG A;  4L8R B;  4ZTF A;  3ISN C;  1WLJ A;  1B9F A;  2KQ2 A;  2ZD1 A;  4J2E A;  2DFF A;  3QEI A;  1EXQ A;  4CEQ A;  3DOK A;  4AHS A;  2HVI A;  1IH7 A;  5J2M A;  3KIO A;  3LAK A;  2X78 A;  4OJR A;  3TAQ A;  1ASV A;  1NK0 A;  4F4K A;  1JKH A;  2X74 A;  1A5V A;  3ZT3 A;  1NKC A;  2EHG A;  3LWM A;  4DTP A;  3V4I A;  4N5S A;  1UAX A;  4CGJ A;  1WN7 A;  5CYM A;  4CF0 A;  1QSS A;  3OYD A;  4EZ9 A;  4CIF A;  1ZBU A;  5HRR A;  4OLA A;  4ELU A;  3IRX A;  1WAF A;  1HYS A;  4CGI A;  2YHB A;  4NCG A;  4DFP A;  1TKD A;  4C8O A;  4K8Z A;  5D3G A;  4JLH A;  1ITG A;  1HPZ A;  1QHT A;  4LD0 A;  2OPR A;  1C0M A;  2IDO A;  5E41 A;  1Q9Y A;  3HT3 A;  3NH0 A;  3OS0 A;  4Y1C A;  4CJV A;  1TKT A;  2YV0 X;  1IG9 A;  4E1M A;  4O4G A;  4DTN A;  4KB0 A;  4KRF A;  4FW2 A;  1U48 A;  4OKE A;  1VSH A;  2KZZ A;  4DLG A;  3L2Q A;  4CJ3 A;  1TL3 A;  4CF8 A;  1RT3 A;  1CXU A;  3AVJ A;  3QEX A;  2VG5 A;  3KK3 A;  4DSF A;  3SUQ A;  2OA8 A;  3K5L A;  1IKV A;  4OKK A;  2O4I A;  4C8L A;  1RCH A;  2RN2 A;  4KHS A;  4DU3 A;  2DY4 A;  4OLB A;  1RTI A;  3QEV A;  3MXJ A;  4I9Q A;  4F3O A;  1RT7 A;  1XC9 A;  3EYZ A;  3D0P A;  4LSL A;  4LY7 A;  4OKJ A;  3V9Z A;  3L3V A;  4GVM A;  3M8R A;  4KTW A;  4CFC A;  3TI0 A;  1JXB A;  3HST B;  3K5O A;  2WOM A;  3JYT A;  3AVI A;  4RG8 A;  5FDL A;  2HW3 A;  5J2P A;  4FM0 A;  4ID1 A;  4CK2 A;  4DMN A;  1W9H A;  3NAE A;  1GOB A;  1U47 A;  3NGZ A;  5HP1 A;  4N76 A;  2HNZ A;  2P5G A;  4CHQ A;  4F2R A;  1ZBL A;  4E89 A;  2VG7 A;  4DF8 A;  4FJX A;  3HJF A;  3KD5 E;  4PQU A;  4B9N A;  2HMI A;  2X6S A;  4CHO A;  4KTQ A;  4YNQ A;  1NJY A;  1TKX A;  1NJZ A;  3S3N A;  1SKS A;  4QCL A;  1VSJ A;  4CJE A;  3SQ1 A;  1VRU A;  3G10 A;  2HVH A;  3ZSX A;  1CXQ A;  1Q9X A;  2YNG A;  1KTQ A;  2PYL A;  1BI4 B;  2JLE A;  4KPY A;  4FCY A;  1LWE A;  4OVL A;  2YNF A;  1WSI A;  4FLW A;  2XRI A;  1UA1 A;  4AHR A;  5SWM A;  3U6F A;  4M42 A;  4IG0 A;  1SV5 A;  5CZ1 A;  4CED A;  1YVU A;  3AVK A;  3VQ9 A;  1Z26 A;  3VQ5 A;  3ULD A;  2E6M A;  4CEO A;  3O3G A;  4FJ7 A;  3LAN A;  2VWJ A;  4FJH A;  4IKF A;  3SQ4 A;  1IKY A;  4FLU A;  3ZSV A;  3QES A;  3S3O A;  4FJ9 A;  2HHU A;  4CHN A;  3NF7 A;  4CF1 A;  4CJR A;  3V9X A;  1NKE A;  1MU2 A;  3SZ2 A;  3TAB A;  4ZTJ A;  3NF6 A;  3P83 D;  4FVM A;  1T03 A;  2HHW A;  2OZS A;  4FZZ A;  4M3U A;  1F21 A;  4CJS A;  1SUQ A;  1BHL A;  2G8I A;  4E1N A;  4BDY A;  1HRH A;  2XO7 A;  3P5J A;  2B4J A;  4KO0 A;  2BDP A;  4M3Z A;  5SZT A;  1FKO A;  1BCM A;  3OYG A;  1S6P A;  3ZCM A;  3KKR A;  1N5Y A;  1RDD A;  4IBN A;  3AA5 X;  3C6U A;  3PO4 A;  1C0U A;  3NFA A;  4Z0U A;  3IAY A;  4BDZ A;  5KRS A;  4MFB A;  3AVM A;  1S6Q A;  3ASM A;  4NYN A;  3AVB A;  3QLH A;  2IC3 A;  3LDS A;  3TAN A;  3RTV A;  2FBY A;  1NJX A;  2F8S A;  2HHV A;  4FYD A;  4Z4E A;  4DQQ A;  4CGH A;  2GBZ A;  1JLC A;  3ZSW A;  1FK9 A;  4O55 A;  3DLK A;  3VQQ A;  3PX4 A;  2DFE A;  3SI6 A;  4J2B A;  4FJM A;  4CEA A;  1WNS A;  3OYC A;  1UWB A;  5HRP A;  3QET A;  1VSE A;  4CIG A;  2P5O A;  4F2S A;  4UQG A;  4DLE A;  3AVG A;  3SUP A;  1RBR A;  3V6D A;  1N6Q A;  3O4Q A;  1GOC A;  4CCH A;  1KLN A;  2KZM A;  3DLH A;  4DQI A;  2FC0 A;  3DLG A;  1T7P A;  3TAM A;  4W5O A;  1VSD A;  1HYZ A;  1LW2 A;  3WNF A;  4EZ6 A;  3SPY A;  1RBT A;  4CEE A;  4CFB A;  3ITH A;  3M8S A;  3L2U A;  1NK7 A;  4IFY A;  1JLG A;  1RT1 A;  2IOC A;  5J1E A;  3CQ8 A;  2ZQB A;  3SV3 A;  1ZBH A;  4FZY A;  3NGI A;  1HNV A;  4QAG A;  3VQ8 A;  4J2A A;  4DTU A;  1WSF A;  2F8T A;  5HRS A;  3OY9 A;  3SJJ A;  4B9L A;  3NCI A;  2JGU A;  3AO1 A;  1TV6 A;  3OYL A;  4OPJ A;  3I0R A;  5CY4 A;  4IG3 A;  2EX3 A;  3RRH A;  4DTS A;  4KHU A;  4HUF A;  4H8K A;  4CEF A;  3L2V A;  3RMC A;  3OYE A;  1L3S A;  4ELV A;  4BDP A;  4FJN A;  3AO2 A;  1JL1 A;  2HB5 A;  2YHA A;  4TSX A;  1A5X A;  3VQB A;  3EZ5 A;  4W5N A;  3B6O A;  3DRP A;  3HPG A;  1FXX A;  1K6Y A;  2IGI A;  3HVT A;  4J2D A;  2ETJ A;  3HVR A;  1S1V A;  4DTX A;  4CER A;  4B3O A;  3DLB A;  2IAJ A;  4HUE A;  3P1G A;  1EX4 A;  4FLY A;  3PUF A;  3RR8 A;  3IG1 A;  3NF8 A;  2XY6 A;  4YFU A;  1VRT A;  3NDK A;  3LP2 A;  2OPP A;  3QNN A;  3PX0 A;  3V1Q A;  1SKR A;  3A2F A;  1NOZ A;  2FBV A;  2KTQ A;  2RF2 A;  2OPQ A;  2XY5 A;  2D0A A;  4JS4 A;  4HHT A;  1D5A A;  1YT3 A;  4N47 A;  4CJQ A;  1RTD A;  1RTJ A;  1S1U A;  2DFH A;  1HJR A;  4FW1 A;  4CJ4 A;  1NK4 A;  4E0D A;  3L2R A;  4CIE A;  3K57 A;  4DTO A;  1KFD A;  4K8X A;  4I2P A;  5C42 A;  4RW4 A;  4HVJ A;  1J9A A;  2PY5 A;  1REV A;  3MEC A;  3PO5 A;  4OGC A;  1C1C A;  5HRO A;  1D8Y A;  3HO1 A;  2RKI A;  1I3A A;  3VQ6 A;  1J54 A;  4E19 A;  4W5T A;  3PY8 A;  4F3T A;  3G0Z A;  4CHZ A;  1ASW A;  1SKW A;  2GV9 A;  3NF9 A;  4PA1 A;  3K5M A;  1S9E A;  1WSE A;  3VQD A;  2FBT A;  4E7K A;  4FJK A;  3TAP A;  4Z4F A;  2I5J A;  5J2Q A;  3OJS A;  2HHX A;  2QK9 A;  3RR7 A;  3ZSR A;  3QIO A;  5JS2 A;  4NYF A;  1VSF A;  1KVB A;  3V9S A;  1KVA A;  3IS9 A;  1X9S A;  3T1A A;  2VG6 A;  3M8P A;  3SV4 A;  2P1J A;  4M45 A;  1S9G A;  3AO3 A;  3RRG A;  4CJT A;  3KLG A;  4BWM A;  1NKB A;  1JLE A;  3K58 A;  4F8R A;  3ZSO A;  1D9D A;  3ZSQ A;  4ELT A;  3AVH A;  4BE1 A;  2AJQ A;  4KTZ A;  3QEP A;  1WSJ A;  1A5W A;  4KI4 A;  1RT4 A;  1QE1 A;  1Z25 A;  1HYV A;  1KVC A;  3NGY A;  5KTQ A;  1NOY A;  4FK2 A;  1SL1 A;  1YTA A;  4CES A;  4M3X A;  1HMV A;  3WNH A;  3SQ0 A;  3PV8 A;  4PWD A;  1UOC A;  1TKZ A;  3CG7 A;  3CM6 A;  3RMB A;  4DS4 A;  4O0J A;  5FRN A;  3E01 A;  1GOA A;  2Y1I A;  1BI4 A;  2FBX A;  3SCX A;  3AA4 A;  4CEC A;  1LAV A;  2O4G A;  2D5R A;  2IS3 A;  3HL8 A;  3DOL A;  3K5N A;  4NCA A;  2B6A A;  2P51 A;  2BE2 A;  3D45 A;  3WNG A;  1U45 A;  1RT2 A;  1FKP A;  3LP3 A;  3SUN A;  3OYK A;  3CFR A;  1T05 A;  1NJW A;  4FM2 A;  4E3S A;  4FK4 A;  3F9K A;  4G1Q A;  3DLR A;  1RDC A;  1JL2 A;  3DMJ A;  5C24 A;  4DSI A;  4FLX A;  2G8W A;  1NK5 A;  4EP4 A;  1JLA A;  2HHT A;  5HBM A;  5KRT A;  4Z4I A;  3F73 A;  1JLQ A;  2BGG A;  3FFI A;  4FJ5 A;  1ZYQ A;  4KAZ A;  4AIL C;  1TL1 A;  1U04 A;  4JRP A;  3QNO A;  4LH4 A;  4CGF A;  1DTQ A;  1QSY A;  4CJW A;  1T8E A;  4BE0 A;  1JLF A;  4KKO A;  3SPZ A;  2NUB A;  1X9M A;  1BIZ A;  4GW6 A;  4CJ5 A;  3TAE A;  3ZT1 A;  4CGD A;  4KFB A;  2KFZ A;  1BIU A;  4I2Q A;  1ZBI A;  2D0C A;  4Q0B A;  4E7I A;  3NHG A;  4PUO A;  3LZJ A;  4Y1D A;  3SQ2 A;  2PZS A;  2ITG A;  4BAC A;  2OPS A;  4B8C A;  5FRO A;  1NK9 A;  3V9U A;  1BGX T;  2RPI A;  4CFA A;  1TVR A;  4FJJ A;  5CZ2 A;  3NBP A;  3KLH A;  3HM9 A;  3KTQ A;  1DTT A;  2E6L A;  5T7B A;  3OYB A;  4JS5 A;  4CF9 A;  1BIS A;  1RDA A;  3K2P A;  4CJF A;  3NH1 A;  4KRE A;  4E7L A;  4GMJ B;  3O4N A;  3SNN A;  4FJL A;  1XI1 A;  5I42 A;  1U4B A;  4KHW A;  1EKE A;  3MEE A;  1LWF A;  3H08 A;  4DS5 A;  3TAF A;  3M8Q A;  4B9U A;  4EP5 A;  4OGE A;  3VA3 A;  1XWL A;  1YTU A;  1HNI A;  1G15 A;  4HTU A;  3C94 A;  3DM2 A; 
#chains in the Genus database with same CATH topology
 2Z1J A;  1TAQ A;  1EET A;  4DQR A;  4RW6 A;  4DQS A;  4DQP A;  4AH9 A;  3MAQ A;  2I7N A;  4CJ7 A;  1VSM A;  2NLX A;  4ZHR A;  3GOI A;  3F2K A;  2VWK A;  1RNH A;  3T19 A;  3OTO K;  4KTQ A;  4CJK A;  4DR6 K;  5LJW A;  3ZT4 A;  1R0A A;  4DU4 A;  2KW4 A;  2Q31 A;  2Z1G A;  4N56 A;  1HQE A;  3SAG A;  2A5X A;  2HND A;  3TTD A;  4IDK A;  2HOE A;  4BR0 A;  3THW A;  1S1T A;  4DSJ A;  4CD1 A;  5AZI B;  2PBD A;  4ICL A;  1N33 K;  4NXM K;  2Q36 A;  2Z1I A;  1K73 O;  3U3G A;  5I3U A;  4JRQ A;  3KKS A;  1RTH A;  3CET A;  3C7N A;  3ZSZ A;  3CQY A;  3VQP A;  1S1W A;  3VGM A;  5JVH L;  4CJL A;  2DTU A;  5C25 A;  3SUO A;  3KLF A;  4FLV A;  4K25 A;  3AO4 A;  1KAY A;  1GLB G;  2A1S A;  4AHT A;  3WEE B;  3C95 A;  3CCS N;  1HKC A;  3ENH A;  5I9E B;  1NNE A;  3AA3 A;  4C8M A;  5LMU K;  5GIN A;  3KJV A;  1XMO K;  4CBU A;  3LAM A;  1QHA A;  3CIP A;  5FPM A;  3M1F A;  3HPH A;  3Q7C A;  3VF6 A;  1VQM N;  3VF4 A;  2WC9 A;  3AVC A;  3VQC A;  1RDB A;  1HLU A;  2NRR A;  4H4M A;  4GV9 A;  3CPE A;  1EO1 A;  1KRP A;  4DTM A;  1WSH A;  4OPA A;  3M3Z A;  2F96 A;  3K59 A;  4CJP A;  3CQX A;  3QIN A;  4W5R A;  3CJB A;  3VET A;  3WT0 A;  2O8E A;  4H5W A;  4CEB A;  3S3M A;  4JI8 K;  1S1X A;  3ZET A;  4BWJ A;  3BP8 A;  4XH4 A;  3FZF A;  4KB1 A;  1YHQ N;  3VQA A;  1WAJ A;  4FWL A;  4KV8 A;  5DK5 A;  4C8N A;  4B3T K;  4FOI A;  3LWL A;  3QER A;  4C8K A;  5GAE P;  1U6Z A;  5F2R A;  5KPZ A;  3C6T A;  4DFM A;  1QZ6 A;  4DSK A;  2E20 A;  1NGD A;  3MN7 A;  3VQ7 A;  3CYM A;  4DSE A;  3KK2 A;  3T3F A;  1C6V A;  3KVG A;  5KI6 A;  3VQ4 A;  1DLO A;  4DTR A;  1GLC G;  4FXD A;  4LF9 K;  1Q81 O;  3SAH A;  5E26 A;  3THX B;  1VQ6 N;  2ZF5 O;  3CHW A;  3CCQ N;  4GKJ K;  1HX1 A;  3KIO A;  3LAK A;  3VEZ A;  1NK0 A;  2E8A A;  3ZT3 A;  1BOT O;  4V19 S;  3TSQ A;  2GX9 A;  3CJA A;  4RWT A;  4CF0 A;  4CIF A;  4OLA A;  1HYS A;  4CBX A;  2Q1N A;  4KH4 A;  2BTF A;  1ITG A;  3KWI A;  4LD0 A;  4Y1C A;  2YV0 X;  4H03 B;  5AQO A;  2PAV A;  4E1M A;  1VSH A;  2KZZ A;  3L2Q A;  4CF8 A;  3BF3 A;  5LJV A;  1CXU A;  2VG5 A;  2OA8 A;  2P9U B;  2O4I A;  3KWG A;  3O9T A;  3VTI A;  2W6K A;  1KD1 O;  1RTI A;  1XNR K;  3MXJ A;  4F3O A;  4LY7 A;  4FK2 A;  5BRD A;  1NU0 A;  1JXB A;  1TUY A;  4BRP A;  1RFQ A;  5BR8 K;  4DMN A;  3NGZ A;  3LM2 A;  2HNZ A;  1ZBL A;  1OVY A;  4OX9 K;  2VG7 A;  2P9S A;  5KPR A;  4GNI A;  4ILJ A;  1TKX A;  3C0B A;  3S3N A;  1VSJ A;  3SQ1 A;  1VRU A;  3G10 A;  5C15 A;  1OVQ A;  2JLE A;  4KPY A;  4FCY A;  2YNF A;  4CZL A;  1S22 A;  1WSI A;  4FLW A;  3O9U A;  3U6F A;  3H1V X;  4B1V A;  3VQ9 A;  1Z26 A;  2E6M A;  4DV0 K;  4CZF A;  3VF2 A;  3SQ4 A;  2D1K A;  1OH6 A;  4CHN A;  1MU2 A;  4ZTJ A;  2ASO A;  3DAW A;  4FVM A;  4L3Q A;  4DR1 K;  5AZJ A;  4JKD A;  4M3U A;  1BHL A;  5MLC Q;  4KO0 A;  2B4J A;  2BDP A;  2NRT A;  1FKO A;  3ZCM A;  1V4S A;  1RDD A;  2ASP A;  3AA5 X;  3HBT A;  1S6Q A;  3ASM A;  2WBN A;  3H3N O;  3RTV A;  1NJX A;  2F8S A;  4Z4E A;  1T6C A;  1BA0 A;  3KHY A;  3THY A;  1JLC A;  4JHD B;  2Q97 A;  1HNW K;  4CEA A;  3EE9 A;  3GG4 A;  1BA1 A;  5C0Y A;  3K0S A;  3CME N;  3V6D A;  3O1B A;  4LFC K;  3R8E A;  4B1Y B;  3EZW A;  3C6A A;  4O8U A;  3DLH A;  4DQI A;  1ATR A;  4BR7 A;  3DLG A;  1T7P A;  4YOT A;  4W5O A;  4OO1 J;  4R79 A;  1MDU B;  3A8Y A;  3M8S A;  3L2U A;  4JI3 K;  3EKU A;  1NMN A;  4FZY A;  2A40 A;  4QAG A;  3VQ8 A;  4J2A A;  3ZLJ A;  1WSF A;  3KK7 A;  4BGB A;  2JGU A;  3AO1 A;  4OPJ A;  3PIP L;  3I0R A;  5CY4 A;  3O4W A;  4KHU A;  1L3S A;  4AM7 A;  3JS6 A;  4TSX A;  2FF6 A;  1ILY A;  1S72 N;  1YUW A;  3HPG A;  3BY5 A;  1FXX A;  4DV4 K;  1ATS A;  3HVT A;  3CCL N;  1S1V A;  4AF1 A;  4B3O A;  3DLB A;  2IAJ A;  2XY6 A;  3GL1 A;  3LP2 A;  4B9Q A;  1SKR A;  2QW9 A;  4W5N A;  2FBV A;  3G71 N;  2RF2 A;  4EFH A;  2WTU A;  2D0A A;  4JS4 A;  1RTD A;  4F4K A;  4N47 A;  1YT3 A;  4CJQ A;  4YDU A;  2JWK A;  1HJR A;  4IOC L;  3K57 A;  4DTO A;  1KFD A;  4I2P A;  2E2P A;  1REV A;  4JD2 B;  1EWR A;  5HRO A;  2RKI A;  4E19 A;  4W5T A;  1J54 A;  3JXU A;  3AAR A;  3G0Z A;  4CHZ A;  1SKW A;  3K5M A;  1S9E A;  3VQD A;  5FLX O;  3OJS A;  3VEV A;  2CGL A;  2UXD K;  5JS2 A;  4NYF A;  1VSF A;  3CCM N;  3V9S A;  5ADX A;  2VG6 A;  4B1U B;  4DQ8 A;  4CJT A;  3KLG A;  2E1Y A;  3FLC O;  3K58 A;  3ZSO A;  4MDB A;  1D9D A;  3ZSQ A;  4ELT A;  3BZC A;  4QS9 A;  1A5W A;  3DWL A;  2VQE K;  1QE1 A;  3L4Q A;  5CHI A;  2BUP A;  1YTA A;  4CES A;  1HMV A;  3PV8 A;  5LMN K;  1TKZ A;  3ATU A;  3CC2 N;  1VQ8 N;  4GV6 A;  5FRN A;  5KQD A;  1BI4 A;  3IMX A;  4IEI A;  3N4Q A;  1LAV A;  1NGA A;  3P4I A;  4WQ4 C;  1VQL N;  2B6A A;  2KHO A;  4E3S A;  1YXQ A;  4FK4 A;  2O8F B;  1RDC A;  3O9Q A;  4WFB L;  5AQY A;  4NB4 A;  4BG9 A;  4EP4 A;  2G8W A;  2HHT A;  1NMD A;  5HBM A;  2V7Z A;  3H45 C;  3F73 A;  2BGG A;  4DR2 K;  1ZYQ A;  1NG9 A;  4AIL C;  3L6Q A;  4UY8 O;  3O5B A;  1DTQ A;  4CJW A;  1T8E A;  4JKG A;  2P9P A;  4KKO A;  2O8C A;  3SPZ A;  2CGK A;  2KFZ A;  4CGD A;  4Q0B A;  4E7I A;  3SAF A;  2QI2 A;  4IFE A;  4Y1D A;  3SQ2 A;  2PZS A;  4B8C A;  2HF3 A;  5FPD A;  4CFA A;  1TVR A;  3VEO A;  3MK6 A;  3HM9 A;  1DTT A;  4JS5 A;  4CF9 A;  1RDA A;  2EWS A;  4CD3 A;  3NH1 A;  4YOV A;  3S41 A;  1N34 K;  1QZ5 A;  2F9W A;  3VGL A;  3UKU A;  5AQJ A;  2GEL A;  1C0F A;  3M8Q A;  4IEE A;  4DS5 A;  4OGE A;  3VA3 A;  3OYJ A;  1JCF A;  3DM2 A;  4CFD A;  4KHY A;  3LZI A;  5AQN A;  3ATV A;  2Q0R A;  3OYH A;  4N41 A;  1U2V A;  2YKM A;  3OYM A;  3ZEU A;  4H4O A;  3AVN A;  4MDA A;  3WUH A;  4JI5 K;  3OBW A;  4CF2 A;  5AQF A;  4QOZ B;  3V9W A;  3L8B A;  4DF4 A;  2ZM6 K;  1BUP A;  4K43 A;  4KHN A;  5K14 A;  4FJ8 A;  4I6M A;  2A1R A;  3D2F B;  3LP1 A;  3HPO A;  5M1P A;  1BQM A;  3LAL A;  2OZM A;  4M3T A;  1I94 K;  1XQS C;  5AFU H;  3W0L A;  3QIC A;  2FF3 B;  2W42 A;  3TAG A;  2ZJR L;  1C1B A;  2P9N B;  1RBS A;  4BE2 A;  3TWH A;  1M1K O;  3RMD A;  4JI1 K;  4BR5 A;  5BRE A;  4H0Y B;  3HP9 A;  2OYQ A;  3EN9 A;  1DGK N;  4FWM A;  3L3U A;  3TR8 A;  1TGO A;  2CH5 A;  3PLA A;  2H3G X;  2HHS A;  5BR9 A;  4CEZ A;  3VA0 A;  3RSE A;  3WNE A;  1N8R O;  2CH6 A;  5EU7 A;  1VK0 A;  3DRR A;  3MED A;  4H5R A;  4LH5 A;  3R3L A;  2VGM A;  1T44 A;  1L3T A;  3ZT2 A;  3ULE A;  4XEI A;  2HMP A;  3AA2 A;  4LF4 K;  1KCF A;  4DV5 K;  4FJI A;  4FWR A;  5DMR A;  3KD1 E;  1XHZ A;  4IJA A;  2PFU A;  2BAN A;  3RMA A;  4BRC A;  3HOS A;  5AQK A;  1J6Z A;  5EOY A;  1JCG A;  4DHY A;  4QS7 A;  2PYJ A;  1EP4 A;  3CI5 A;  1NM1 A;  3QFU A;  2I7P A;  4JI2 K;  1KFS A;  3G4S N;  3OVN A;  1VQ9 N;  1KC8 O;  4R5P A;  1X3N A;  4FJG A;  1C1A A;  2QKB A;  3G6E N;  2D0B A;  4WQ5 A;  2QXF A;  4CHY A;  3O3F A;  5AQQ A;  2YJE A;  1YIT N;  5GIO A;  3WXM B;  4M41 A;  3NVK A;  1S5J A;  5H1S Q;  3LPT A;  3VQE A;  1LAW A;  3B8A X;  1X9W A;  1TK8 A;  3MMV A;  3VN5 A;  3DI6 A;  3AV9 A;  4RW9 A;  1KQS M;  4FLT A;  3U8X A;  3UKR A;  2RHK A;  1RT5 A;  1IJJ A;  3TPQ A;  1LW0 A;  2ATQ A;  4F9O A;  1UA0 A;  3CJ9 A;  5BPN A;  4LFA K;  2LSN A;  3E9L A;  3ALY A;  1WSG A;  4L8R B;  4ZTF A;  4FWO A;  2A6A A;  1B9F A;  4CEQ A;  3DOK A;  4JI7 K;  2HVI A;  5J2M A;  2GUP A;  2O8D A;  1ASV A;  1JKH A;  2X74 A;  1A5V A;  1NKC A;  4DTP A;  4N5S A;  1UAX A;  5CYM A;  1QSS A;  5HRR A;  4DFP A;  3H3O B;  1TKD A;  1MWM A;  3ENB A;  4C8O A;  4K8Z A;  2FSN A;  1HPZ A;  1QHT A;  4IO8 A;  1NGF A;  1Q9Y A;  2VCP A;  4CZK A;  4DTN A;  2QWN A;  4KB0 A;  4KRF A;  4FW2 A;  4DLG A;  5JLH A;  4BR2 A;  3THW B;  3AVJ A;  3HRG A;  3QEX A;  2Q0U A;  4H5T A;  3SUQ A;  3OA9 A;  2RN2 A;  2UUC K;  4KHS A;  3FZH A;  5AR0 A;  2QWP A;  4I9Q A;  4DR5 K;  1XC9 A;  4LF6 K;  4K0K K;  3TI0 A;  4OKJ A;  2P5O A;  3AY9 A;  4CZE A;  3K5O A;  4GKK K;  4RG8 A;  2BH1 A;  3TTF A;  4FM0 A;  4CK2 A;  1HJO A;  3ID8 A;  3NAE A;  1GOB A;  4JK7 A;  1U47 A;  4N76 A;  1OKJ A;  4F2R A;  1DKG D;  4IDH A;  4FJX A;  2HMI A;  5B8H A;  1NJZ A;  2HVH A;  2FLO A;  3JAM O;  3C6H A;  2PYL A;  4FWK A;  4BQZ A;  1LWE A;  3CJ7 A;  4DR7 K;  3R1X A;  4JKE A;  3FZK A;  5SWM A;  4M42 A;  4CED A;  1SV5 A;  3AVK A;  4H0O A;  4JN4 A;  4WYB A;  3ULD A;  3LAN A;  3WXJ A;  3BZK A;  4FJH A;  1NGI A;  4FLU A;  3ZSV A;  4FJ9 A;  3V9X A;  2OTL N;  3SZ2 A;  2HHW A;  3P83 D;  3O80 A;  3IDH A;  4CJS A;  3KZB A;  1HRH A;  2O8E B;  2XO7 A;  4MO4 A;  1S6P A;  4A2B A;  3KKR A;  3ZET B;  1N5Y A;  4A59 A;  4BDZ A;  4MFB A;  3HSC A;  4BRN A;  3AVB A;  1Q86 O;  4X62 K;  3TAN A;  2HHV A;  4FYD A;  1QVG M;  4CGH A;  2GBZ A;  3ENO A;  3ZSW A;  1ATN A;  3PX4 A;  2DFE A;  2QWR A;  4J2B A;  1UWB A;  3QDK A;  4UQG A;  4DLE A;  3AVG A;  1NJI O;  5AQP A;  3SUP A;  1NWK A;  1RBR A;  5BRF A;  3FR0 A;  3O4Q A;  4HTL A;  1GOC A;  5AQH A;  5A2Q O;  4NXN K;  3HTV A;  4M7Y A;  3TAM A;  1VSD A;  1HYZ A;  3LDQ A;  3U9D A;  4CEE A;  4B1Z A;  1NK7 A;  4IFY A;  1JLG A;  3DXK A;  3SV3 A;  1ZBH A;  3NGI A;  3FE1 A;  3VEN A;  5HRS A;  3EL2 A;  4JEP A;  3RVC A;  3THX A;  3T1Y K;  3H46 O;  2EX3 A;  4DTS A;  4H8K A;  4CEF A;  2V52 B;  3OYE A;  4ELV A;  2NRX A;  1D4X A;  2IVN A;  1A5X A;  1HUX A;  3B6O A;  2DPN A;  2E2O A;  4J2D A;  5DM6 L;  2ASM A;  2QEX N;  3P1G A;  4CZH A;  4FL9 A;  3NDK A;  1QQO A;  2O8B B;  3PX0 A;  1BG3 A;  1S1U A;  4YOY A;  4CJ4 A;  4E0D A;  4BY9 C;  1J9A A;  3LL3 A;  3CCV N;  3PO5 A;  4OGC A;  3SMS A;  1C1C A;  2AP1 A;  5BN9 A;  1VQO N;  3VQ6 A;  4BC3 A;  2P9U A;  2FXU A;  4GY2 B;  3OHR A;  4LC9 B;  3CCE N;  3O9R A;  1K9M O;  4O8K A;  1NLV A;  5J2Q A;  2HHX A;  3RR7 A;  5AJ3 K;  2P9S B;  1K8K A;  3IS9 A;  2P9L B;  3M8P A;  3AO3 A;  2OAN A;  1NKB A;  1JLE A;  4PKI A;  3T1H K;  4F8R A;  3QFP A;  4PKH A;  4M7X A;  3VES A;  4KTZ A;  2GWK A;  3M5R A;  1HYV A;  4YHH K;  3SQ0 A;  4CZI A;  3CG7 A;  4H5N A;  5JIC A;  2D5R A;  1SS6 A;  2IS3 A;  5AZJ B;  3DOL A;  3K5N A;  4IXC A;  4IOA L;  4NCA A;  3WNG A;  3D45 A;  1U45 A;  3LP3 A;  3SUN A;  1NJW A;  4FM2 A;  3CXC M;  3DLR A;  5C24 A;  2YX6 A;  4BRG A;  2YHW A;  3CMA N;  5KRT A;  4BRL A;  4Z4I A;  1NBW A;  1CZA N;  2UXB K;  4KAZ A;  4RCH A;  1BWF O;  3LM9 A;  5JMV A;  4CGF A;  3DXM B;  2NUB A;  1BIZ A;  1Q82 O;  3ZT1 A;  1HPM A;  1E3M A;  3LZJ A;  4FWS A;  5AQG A;  2OPS A;  5FRO A;  1BGX T;  2NRH A;  2HBJ A;  2RPI A;  4FJJ A;  3KLH A;  2VQF K;  1N36 K;  3OYB A;  1BIS A;  2W6L A;  3WXI A;  4KHW A;  1HNI A;  1G15 A;  2A41 A;  4HTU A;  3C94 A;  3K5L A;  5EXW A;  4A62 A;  2KFN A;  4OPH A;  4NLB A;  2HNY A;  4DB3 A;  3GE1 A;  4O0I A;  1ZBF A;  3E9O A;  4FOE A;  4BR4 A;  2WUS A;  1VSL A;  1E4F T;  4KI6 A;  3AVF A;  4ISF A;  2QWQ A;  3CFP A;  3HP6 A;  4I7F A;  3ID6 A;  1KSP A;  4O5F A;  5M1K A;  2JWL A;  1Q8I A;  4CGG A;  4WF9 L;  3TAR A;  2Z1H A;  3MX2 A;  1HQU A;  3VEX A;  4AHV A;  3QO9 A;  4B08 A;  2E4L A;  2P9I B;  3MDQ A;  1VQK N;  4LFB K;  4AHU A;  4MQ3 A;  4B1W B;  3MWP A;  2YCH A;  2XHB A;  4DU1 A;  4B9T A;  2G8U A;  1RIL A;  1XHX A;  3L4I A;  4B9S A;  3QIP A;  2G8F A;  4HCC A;  4DFK A;  1E4G T;  2G8H A;  4I9L A;  4JI0 K;  1TK0 A;  3OS1 A;  2AA4 A;  5HRN A;  4DV2 K;  3MWT A;  4JD2 A;  2YHX A;  1WB9 A;  5J2N A;  4CJU A;  1QQN A;  1SL2 A;  1J53 A;  3VPZ A;  4DV6 K;  3IFR A;  3I8D A;  4CK1 A;  5KGX A;  3A5L C;  4JKC A;  2ZE2 A;  5KGW A;  1BL3 A;  4KHQ A;  4X65 K;  4A61 A;  1ASU A;  2YKN A;  2WON A;  1HKB A;  2QM1 A;  1Y97 A;  3NMU A;  1EQY A;  1HR0 K;  4ILG B;  3BDP A;  3DRS A;  3HK2 A;  2Q2R A;  4Y0W A;  1P90 A;  4Z4H A;  2B5J A;  3KLE A;  4CHP A;  4CE9 A;  5BRH A;  3SYZ A;  5AQM A;  3KK1 A;  3OYN A;  3OJU A;  3LDP A;  5IWA K;  3OYA A;  2GWJ A;  1QTM A;  5AQT A;  4DUZ K;  4E7J A;  2HST A;  4GV3 A;  3OYF A;  1I39 A;  3NE6 A;  4H0T B;  5CYQ A;  5BPL A;  3D7E O;  3PSF A;  4Z4G A;  1L3U A;  2GUI A;  4DSL A;  3CFO A;  4FK0 A;  3MN6 A;  3VEY A;  4M3Y A;  4B1X B;  4PY5 A;  1FJG K;  4B8A B;  4FVU A;  4KHP K;  1P8Z A;  4DG1 A;  3V1O A;  1W0H A;  4CI6 A;  3EY1 A;  2OTJ N;  4FM1 A;  3QEW A;  1S3X A;  1J5O A;  1L3V A;  3LP0 A;  5JS1 A;  3CCJ N;  4YDU C;  1NGE A;  4AHC A;  3TSU A;  3FFK B;  3BUZ B;  2F4V K;  3PX6 A;  3HXM A;  1HKG A;  4RW8 A;  2VWB A;  4M63 C;  4LSN A;  1CZB A;  4IO9 L;  4M3W A;  2F7T A;  3VMF B;  4A57 A;  1TAU A;  3LPU A;  4H0X B;  1T6D A;  4DWI A;  1JLB A;  1NK6 A;  1X3M A;  2YNI A;  4LF5 K;  4FPB A;  1LOT B;  3WXL A;  2ZD1 A;  1GLA G;  2DFF A;  1EXQ A;  4J8F A;  5M1Q A;  3TAQ A;  1BO5 O;  3E66 A;  4HWI A;  5BPM A;  1U2V B;  3LWM A;  1GLF O;  5AQS A;  5AFU A;  1WN7 A;  5HOO A;  1ZBU A;  1TYQ B;  1WAF A;  5BN8 A;  4NCG A;  2P9K B;  5D3G A;  1YF5 L;  3L0Q A;  4JLH A;  2OPR A;  1C0M A;  4JK8 A;  1JCE A;  3HT3 A;  4I6M B;  4CJV A;  1TKT A;  1IG9 A;  3O9S A;  4O4G A;  1U48 A;  2QXL A;  1TL3 A;  1RT3 A;  3H6E A;  2NRV A;  3QB0 A;  4DSF A;  3O1W A;  1WBD A;  1IKV A;  4OKK A;  1IG8 A;  2DY4 A;  4WCE L;  3CC7 N;  4BRI A;  3PSI A;  1SZ2 A;  5M1F A;  3EYZ A;  5AQU A;  2QKK A;  3M8R A;  4CFC A;  5GIP A;  5C2D A;  4EIA A;  4YY3 K;  5J2P A;  4ID1 A;  1W9H A;  1R59 O;  3VEW A;  1O13 A;  4CZJ A;  4BRM A;  4CHQ A;  2P5G A;  1G99 A;  4DF8 A;  2UU9 K;  3HJF A;  4PQU A;  2X6S A;  4YNQ A;  1NJY A;  1DEJ A;  3ZSX A;  1CXQ A;  1Q9X A;  5LL6 Z;  4AQY K;  2YNG A;  5HL7 L;  4OVL A;  5AQL A;  4B3M K;  3ULE B;  2XRI A;  1UA1 A;  5M1O A;  4IG0 A;  3AAP A;  5CZ1 A;  4BC4 A;  1YVU A;  2UXC K;  4A5B A;  4CEO A;  3I33 A;  2VWJ A;  4IKF A;  3A0I X;  3QES A;  4BRH A;  3NF7 A;  1NKE A;  1NGJ A;  3TAB A;  1W7A A;  1T03 A;  2E2Q A;  2OZS A;  3HM8 A;  1F21 A;  1SUQ A;  4BDY A;  3TU5 A;  3BF1 A;  3P5J A;  1BCM A;  4IBN A;  3C6U A;  4IZ9 A;  3PO4 A;  4Z0U A;  3IAY A;  5KRS A;  1YJ9 N;  3AVM A;  3QLH A;  3WQU A;  1OH5 A;  2IC3 A;  4MLH A;  1BU6 O;  2FBY A;  1Z6R A;  4DQQ A;  4YOX A;  2ITM A;  2A3Z A;  4O55 A;  3DLK A;  3SI6 A;  4FJM A;  2D0P A;  4CIG A;  4A2A A;  3J8A A;  1SAZ A;  5IT9 O;  5C2F A;  3D2E B;  4CCH A;  1KLN A;  2KZM A;  1XUP O;  3U9Z A;  1IBL K;  2FC0 A;  4KH5 A;  2ZJP L;  3WNF A;  3FZM A;  3SPY A;  4JKB A;  3EKS A;  2O8D B;  3ITH A;  3W3D A;  2IOC A;  4BRK A;  3WXK A;  3SMP A;  2F8T A;  1IV0 A;  4B9L A;  1LCU A;  4JYA K;  3OYL A;  5EVZ A;  4IG3 A;  3RRH A;  2E2N A;  3F9M A;  4BDP A;  2HB5 A;  3T69 A;  4BVP A;  1XNQ K;  4QS8 A;  4CBW A;  3Q7B A;  1KXP A;  2ETJ A;  4CER A;  3O6W A;  3RR8 A;  3NF8 A;  1VRT A;  3IKM A;  2OPP A;  3QNN A;  3V1Q A;  2KTQ A;  2OPQ A;  2XY5 A;  4FSV A;  1D5A A;  4K42 A;  1JJ2 M;  1VQ5 N;  1RTJ A;  2DFH A;  4DUY K;  4FW1 A;  1NK4 A;  1VQN N;  2F9T A;  3A5M C;  5C42 A;  4HVJ A;  3MEC A;  3C7N B;  2UYT A;  5CE3 A;  5AZI A;  3HO1 A;  1I3A A;  3PY8 A;  2HBK A;  2IVP A;  4WQ5 C;  4ILH A;  2GV9 A;  4LF8 K;  4FJK A;  2FBT A;  4E7K A;  4BRD A;  2I5J A;  2HBL A;  4JAX A;  3ZSR A;  1BDG A;  5JLF A;  1KVA A;  2J4R A;  5EX5 A;  1X9S A;  3T1A A;  1YJN N;  3RRG A;  1S9G A;  4A5A A;  4BWM A;  5M1N A;  1MA9 B;  3VER A;  3CCU N;  3F5T A;  4BE1 A;  2QTD A;  2AJQ A;  3WEE A;  1WSJ A;  3MCP A;  3A5O C;  1RT4 A;  1Z25 A;  4B3R K;  3MN9 A;  1KVC A;  5KTQ A;  1HNX K;  2W40 A;  5F0X A;  1WBB A;  4M3X A;  3WNH A;  5C10 A;  1OH8 A;  4FWN A;  2VYP A;  4PWD A;  3O8M A;  3CM6 A;  3RMB A;  4O0J A;  3E01 A;  4K41 A;  3T7Z A;  1GOA A;  2FBX A;  4CEC A;  3J7A P;  4IWV A;  1XC3 A;  3CPW M;  2BE2 A;  1FKP A;  2V7Y A;  3OYK A;  1T05 A;  1Q18 A;  3F9K A;  4G1Q A;  5C12 A;  3EO3 A;  1JL2 A;  4DSI A;  4FLX A;  1W97 L;  3SLC A;  3K9J A;  3D6R A;  1JLQ A;  3GBT A;  3FFI A;  2ZJQ L;  4BRO A;  2NRZ A;  1VQ7 N;  1J5E K;  4JRP A;  3QNO A;  3AGK A;  4LH4 A;  1QSY A;  1H1V A;  1JLF A;  3ZYY X;  3N4P A;  4BQL A;  2VGN A;  1X9M A;  4GW6 A;  3TAE A;  4CJ5 A;  5AQW A;  4KFB A;  1BIU A;  4I2Q A;  3M6G A;  1ZBI A;  1YJW N;  4BG8 A;  2ITG A;  1NK9 A;  1Y64 A;  5TKW A;  2NRW A;  1SQK A;  5CZ2 A;  3IUC A;  2E6L A;  5T7B A;  4CJF A;  3K2P A;  4KRE A;  3J7Y P;  3NVM A;  4FJL A;  1XI1 A;  5I42 A;  4CVN E;  4H0P A;  2FSK A;  3TAF A;  4EP5 A;  3DXK B;  2CGJ A;  1YTU A;  3DJC A;  3VGK A;  4OPK A;  3MN5 A;  4JKF A;  3U3Y A;  1RDU A;  3SK3 A;  1RBU A;  1NGH A;  4EHT A;  1GLE G;  1BCO A;  2YI1 A;  2D4W A;  1Q7Y O;  1GLJ O;  4M3R A;  1SL0 A;  4WE1 A;  1KAX A;  4XH5 A;  4Z4C A;  4NCB A;  2IVO A;  4X66 K;  1C0T A;  1GLL O;  4PHT X;  4NLC A;  4E7H A;  4CK3 A;  3KLI A;  5GAD P;  1QQC A;  5AQI A;  5HLF A;  2R7Y A;  3ZT0 A;  2XY7 A;  4KBO A;  1N32 K;  1NGG A;  1RBV A;  1D9F A;  5FRM A;  4DTJ A;  1IKW A;  3AGR A;  2NZT A;  1CZ9 A;  4FWQ A;  2QWL A;  2G8V A;  5KPT A;  1QS4 A;  4JI6 K;  4DV3 K;  2O8B A;  1VSK A;  2XY8 A;  4H5V A;  4Z94 A;  1QVF M;  4ID5 A;  2RE2 A;  3JSM A;  3OS2 A;  3I0S A;  2QWO A;  1KLM A;  3AO5 A;  4BRA A;  3B6P A;  1T3V A;  3OW2 M;  3NH2 A;  1K8K B;  3HYF A;  4BRQ A;  1TK5 A;  4HUG A;  2X6N A;  4XIU A;  4HCB A;  5ELZ A;  1B92 A;  3J7Z O;  3UIQ A;  4FZX C;  2W41 A;  1X1P A;  1QSL A;  2HHQ A;  4RW7 A;  3HOT A;  1IO2 A;  1VSI A;  5AQR A;  3ZSY A;  3BGR A;  3S9H A;  2P9L A;  3DYA A;  2E5L K;  1Z05 A;  3ZX3 A;  3OYI A;  3AVA A;  3O08 A;  3THV A;  1CLQ A;  3MXI A;  3MCA B;  4W5Q A;  3DLL L;  4ISE A;  2QWM A;  3FZL A;  1K8A O;  5FPN A;  4KH6 A;  4WFN L;  1JXE A;  4BVO A;  4DV7 K;  3J80 O;  2E88 A;  1LV5 A;  2Q3S A;  2ZGZ A;  2YNH A;  4DKW A;  3QBW A;  1IKX A;  1NK8 A;  3THY B;  2KKZ A;  4BC5 A;  3O3H A;  1O1W A;  4DFJ A;  3CM5 A;  1BQN A;  4Q5V A;  4IFV A;  2OCE A;  1U49 A;  1HNZ K;  4B9V A;  2G8K A;  1ZBS A;  2FSJ A;  3DLE A;  3R6M A;  4FLZ A;  2Y1J A;  3MXM A;  4O5B A;  4PL8 A;  2NNW A;  4JHD A;  4B9M A;  2WFB A;  3DXM A;  1DT9 A;  3A5N C;  1XMQ K;  3V1R A;  4BRE A;  1L5U A;  1LWC A;  3EEQ A;  4FO0 A;  5AQX A;  3VTH A;  4YOU A;  3L2W A;  3MX5 A;  4O44 A;  1RT6 A;  3AVL A;  3TSP A;  3PIO L;  2HF4 A;  3MEG A;  4EHU A;  1EWQ A;  1B9D A;  3V81 A;  3RWU A;  2E1Z A;  3CER A;  3ISN C;  1WLJ A;  2KQ2 A;  4J2E A;  3QEI A;  4AHS A;  1IH7 A;  4OJR A;  2X78 A;  4AM6 A;  1X9J A;  1YI2 N;  2EHG A;  4WQ4 A;  3ZX0 A;  3AAQ A;  3V4I A;  4CGJ A;  2GEM A;  3HI0 A;  3OYD A;  4EZ9 A;  3G25 A;  4BRF A;  4ELU A;  3IRX A;  4CGI A;  2YHB A;  4YOR A;  2IDO A;  5E41 A;  3NH0 A;  3OS0 A;  4U7B A;  5EY4 A;  3E9P A;  4OKE A;  2KLA A;  4CJ3 A;  4CZG A;  4JNE A;  3KK3 A;  4C8L A;  1V4T A;  1RCH A;  1NGC A;  4BGA A;  3J81 O;  2P9I A;  4DU3 A;  3WQT A;  3CF5 L;  4DR3 K;  3QEV A;  1VHX A;  3FGU A;  4C23 A;  4U67 L;  4JV5 K;  1RT7 A;  3D0P A;  4LSL A;  4OLB A;  3V9Z A;  3L3V A;  4GVM A;  4KTW A;  3HST B;  2WOM A;  4PL7 A;  4YOW A;  3JYT A;  1NGB A;  2UUB K;  3AVI A;  5FDL A;  2HW3 A;  4H0V B;  1KAZ A;  5KQ8 A;  5HP1 A;  4E89 A;  3EE8 A;  3SBT A;  3KD5 E;  4B9N A;  4CHO A;  4QCL A;  1SKS A;  4CJE A;  3GDQ A;  1KTQ A;  1BI4 B;  5GAH P;  1MWK A;  4AHR A;  3OBY A;  1WUA A;  1ESV A;  3VQ5 A;  4FJ7 A;  3CD6 N;  3O3G A;  2V51 B;  4PKG A;  1IKY A;  4JI4 K;  3S3O A;  5TKY A;  2HHU A;  4MLE A;  3UE5 A;  4CF1 A;  3CC4 N;  4CJR A;  3NF6 A;  5ADX H;  1ZXO A;  4WFA L;  4FZZ A;  1WOQ A;  4DCH A;  2G8I A;  4E1N A;  4M3Z A;  4X64 K;  2O8F A;  5SZT A;  5DM7 L;  4FPA A;  2P9P B;  4JKG B;  3OYG A;  3SJH A;  5CR4 A;  2O8C B;  1C0U A;  3NFA A;  2D0O A;  4NYN A;  4C1N K;  3P31 A;  4IOX A;  3ZX2 A;  3LDS A;  2IIR A;  3LDO A;  1FK9 A;  3VQQ A;  3OYC A;  1WNS A;  5HRP A;  3QET A;  1VSE A;  2ZGY A;  2ZWH A;  3I55 N;  4F2S A;  3UB5 A;  3UKU B;  1N6Q A;  3HZ6 A;  4BR9 A;  3U4L A;  1GLD G;  1LW2 A;  1YAG A;  4EZ6 A;  1RBT A;  4CFB A;  4C1N I;  1RT1 A;  3ZEU B;  5J1E A;  3CQ8 A;  2ZQB A;  1IBK K;  1HNV A;  4DTU A;  3OY9 A;  3SJJ A;  3NCI A;  3VOV A;  1TV6 A;  1C0G A;  2UUA K;  4HUF A;  3L2V A;  3RMC A;  2HHH K;  4FJN A;  3AO2 A;  2A42 A;  1JL1 A;  2YHA A;  3VQB A;  3EZ5 A;  3H1Q A;  3DRP A;  1RGI A;  1K6Y A;  2IGI A;  4LF7 K;  3HVR A;  2YJF A;  4DTX A;  4DR4 K;  1TUU A;  3CJ1 A;  4HUE A;  1TYQ A;  1EX4 A;  1QQM A;  3PUF A;  5JVG L;  4FLY A;  3IG1 A;  4YFU A;  2P9K A;  4FWP A;  3A2F A;  1NOZ A;  4HHT A;  4IJN A;  3P38 A;  3D2F A;  4MO5 A;  3SBG A;  4CIE A;  3I56 N;  3L2R A;  4K8X A;  4RW4 A;  4EAH D;  4E1J A;  4NO7 A;  2PY5 A;  1YIJ N;  1D8Y A;  2P9N A;  3BEX A;  3QBX A;  4F3T A;  3LDN A;  1ZC6 A;  1ASW A;  3NF9 A;  3RSE B;  4PA1 A;  3TTC A;  1WSE A;  4Z4F A;  4G9Z A;  3LDL A;  3K9K A;  3TAP A;  5E84 A;  4CW7 B;  2QK9 A;  2HBM A;  3QIO A;  1KVB A;  1M90 O;  2YHY A;  3SV4 A;  2P1J A;  4JKA A;  4M45 A;  3CJC A;  3AVH A;  4RTF D;  5GAG P;  3QEP A;  3P39 A;  3E1Y A;  4KI4 A;  4JK9 A;  1NOY A;  3NGY A;  1VQP N;  1SL1 A;  4DV1 K;  4B3S K;  1IBM K;  1UOC A;  4DS4 A;  2QA4 N;  2Y1I A;  3SCX A;  3AA4 A;  2O4G A;  3HL8 A;  1YVN A;  5F1X A;  4GVE A;  2P51 A;  1RT2 A;  3CFR A;  3DMJ A;  1FW6 A;  1NK5 A;  4BC2 A;  1JLA A;  3C65 A;  4ISG A;  1W2B M;  4FJ5 A;  5FPE A;  1TL1 A;  1U04 A;  5AQV A;  4BE0 A;  3R9P A;  3QML A;  5AQZ A;  3UKR B;  1VQ4 N;  2D0C A;  4CZM A;  3NHG A;  4PUO A;  4XH1 A;  4BAC A;  3V9U A;  3NBP A;  3KTQ A;  3CCR N;  2GTD A;  1RDW X;  4E7L A;  4GMJ B;  3O4N A;  3SNN A;  1U4B A;  1EKE A;  3MEE A;  1LWF A;  3H08 A;  1OH7 A;  4JKH A;  3I8B A;  4B9U A;  1VAZ A;  1XWL A;  3D2E A;  5LY3 A; 
#chains in the Genus database with same CATH homology
 4OPK A;  2Z1J A;  3U3Y A;  4CFD A;  4KHY A;  1RBU A;  3LZI A;  1TAQ A;  2KFN A;  3OYJ A;  2HNY A;  1EET A;  1BCO A;  4O0I A;  4DQR A;  1ZBF A;  4RW6 A;  3OYH A;  2QKK A;  4M3R A;  1SL0 A;  4N41 A;  4DQS A;  2YKM A;  4DQP A;  4WE1 A;  4AH9 A;  1VSL A;  3OYM A;  3MAQ A;  4Z4C A;  4NCB A;  4H4O A;  1VSM A;  4KI6 A;  4ZHR A;  1C0T A;  3AVF A;  3AVN A;  3CFP A;  4E7H A;  4CK3 A;  3HP6 A;  2VWK A;  1RNH A;  4I7F A;  3KLI A;  4CF2 A;  1QQC A;  3T19 A;  1KSP A;  4QOZ B;  3V9W A;  1Q8I A;  4CGG A;  4CJK A;  2R7Y A;  3TAR A;  2Z1H A;  5HLF A;  3ZT0 A;  3L8B A;  4DF4 A;  3ZT4 A;  1R0A A;  4DU4 A;  2XY7 A;  2KW4 A;  1HQU A;  2Z1G A;  4N56 A;  4KHN A;  5K14 A;  1HQE A;  3QO9 A;  4AHV A;  4FJ8 A;  4B08 A;  1RBV A;  2E4L A;  1D9F A;  5FRM A;  2HND A;  2A1R A;  4DTJ A;  3LP1 A;  4AHU A;  3HPO A;  1IKW A;  4MQ3 A;  1BQM A;  3LAL A;  1CZ9 A;  4IDK A;  2OZM A;  2G8V A;  1S1T A;  2XHB A;  4DSJ A;  4M3T A;  1QS4 A;  4DU1 A;  2W42 A;  4B9T A;  4ICL A;  3TAG A;  1C1B A;  1RIL A;  2G8U A;  1XHX A;  1RBS A;  4B9S A;  1VSK A;  2XY8 A;  3QIP A;  3TWH A;  4BE2 A;  2G8F A;  3RMD A;  4HCC A;  2Z1I A;  4DFK A;  4ID5 A;  2G8H A;  3JSM A;  4I9L A;  3OS2 A;  3U3G A;  1TK0 A;  3I0S A;  5I3U A;  3OS1 A;  3HP9 A;  4JRQ A;  5HRN A;  1KLM A;  3KKS A;  2OYQ A;  1RTH A;  3AO5 A;  3TR8 A;  3L3U A;  3B6P A;  1TGO A;  3ZSZ A;  3VQP A;  5J2N A;  3NH2 A;  4CJU A;  1S1W A;  1SL2 A;  1J53 A;  3HYF A;  4CJL A;  3I8D A;  4CK1 A;  2DTU A;  5C25 A;  5KGX A;  1TK5 A;  2HHS A;  4HUG A;  2X6N A;  4CEZ A;  4XIU A;  3KLF A;  3VA0 A;  3SUO A;  4HCB A;  5KGW A;  2ZE2 A;  4FLV A;  1BL3 A;  4KHQ A;  1B92 A;  3UIQ A;  3WNE A;  4FZX C;  1ASU A;  2YKN A;  1X1P A;  2WON A;  1QSL A;  3AO4 A;  5EU7 A;  4AHT A;  2A1S A;  1Y97 A;  4RW7 A;  2HHQ A;  1VK0 A;  1IO2 A;  3C95 A;  3BDP A;  1VSI A;  3DRS A;  3ZSY A;  3DRR A;  3HK2 A;  3BGR A;  3MED A;  3S9H A;  4Z4H A;  2B5J A;  3DYA A;  3KLE A;  4CHP A;  3AA3 A;  4C8M A;  4LH5 A;  4CE9 A;  3SYZ A;  3KK1 A;  3OYN A;  3OJU A;  1L3T A;  3ZT2 A;  3OYI A;  3KJV A;  3AVA A;  3LAM A;  3OYA A;  1QTM A;  4E7J A;  3AA2 A;  3THV A;  1KCF A;  3OYF A;  3HPH A;  1I39 A;  4FJI A;  1CLQ A;  3MXI A;  3NE6 A;  4W5Q A;  5CYQ A;  5DMR A;  3KD1 E;  1XHZ A;  3AVC A;  3VQC A;  4Z4G A;  1L3U A;  1RDB A;  2BAN A;  3RMA A;  4H4M A;  2GUI A;  4DSL A;  3CFO A;  1KRP A;  1JXE A;  4FK0 A;  4DTM A;  1WSH A;  3K59 A;  2F96 A;  4CJP A;  4M3Y A;  3QIN A;  4W5R A;  2Q3S A;  1LV5 A;  2PYJ A;  1EP4 A;  4PY5 A;  2YNH A;  1NK8 A;  1IKX A;  4CEB A;  4B8A B;  3S3M A;  3O3H A;  1KFS A;  1O1W A;  3OVN A;  4DFJ A;  3CM5 A;  1BQN A;  4Q5V A;  1S1X A;  4R5P A;  4FJG A;  4IFV A;  4DG1 A;  1C1A A;  3V1O A;  1U49 A;  2QKB A;  4BWJ A;  1W0H A;  2D0B A;  3EY1 A;  4B9V A;  2QXF A;  4FM1 A;  4CHY A;  3O3F A;  3QEW A;  4KB1 A;  2G8K A;  1J5O A;  3DLE A;  3VQA A;  4FLZ A;  1WAJ A;  3LP0 A;  1L3V A;  5JS1 A;  4KV8 A;  5DK5 A;  4C8N A;  4M41 A;  4AHC A;  2Y1J A;  4O5B A;  3MXM A;  1S5J A;  3LWL A;  3QER A;  4C8K A;  3LPT A;  3VQE A;  1LAW A;  3PX6 A;  1X9W A;  1TK8 A;  4B9M A;  3HXM A;  3VN5 A;  3DI6 A;  3C6T A;  4RW8 A;  3AV9 A;  4DFM A;  4RW9 A;  4LSN A;  3V1R A;  1CZB A;  1L5U A;  1LWC A;  4FLT A;  4DSK A;  4M3W A;  3L2W A;  3VQ7 A;  4O44 A;  1RT6 A;  3CYM A;  3AVL A;  4DSE A;  1TAU A;  3LPU A;  1RT5 A;  3KK2 A;  3T3F A;  1C6V A;  1LW0 A;  2ATQ A;  3MEG A;  1B9D A;  3V81 A;  1UA0 A;  4DWI A;  5KI6 A;  3VQ4 A;  1JLB A;  1DLO A;  2LSN A;  4DTR A;  1NK6 A;  4FXD A;  2YNI A;  3RWU A;  3ALY A;  1WSG A;  4L8R B;  4ZTF A;  3ISN C;  1WLJ A;  1B9F A;  2KQ2 A;  2ZD1 A;  4J2E A;  2DFF A;  3QEI A;  1EXQ A;  4CEQ A;  3DOK A;  4AHS A;  2HVI A;  1IH7 A;  5J2M A;  3KIO A;  3LAK A;  2X78 A;  4OJR A;  3TAQ A;  1ASV A;  1NK0 A;  4F4K A;  1JKH A;  2X74 A;  1A5V A;  3ZT3 A;  1NKC A;  2EHG A;  3LWM A;  4DTP A;  3V4I A;  4N5S A;  1UAX A;  4CGJ A;  1WN7 A;  5CYM A;  4CF0 A;  1QSS A;  3OYD A;  4EZ9 A;  4CIF A;  1ZBU A;  5HRR A;  4OLA A;  4ELU A;  3IRX A;  1WAF A;  1HYS A;  4CGI A;  2YHB A;  4NCG A;  4DFP A;  1TKD A;  4C8O A;  4K8Z A;  5D3G A;  4JLH A;  1ITG A;  1HPZ A;  1QHT A;  4LD0 A;  2OPR A;  1C0M A;  2IDO A;  5E41 A;  1Q9Y A;  3HT3 A;  3NH0 A;  3OS0 A;  4Y1C A;  4CJV A;  1TKT A;  2YV0 X;  1IG9 A;  4E1M A;  4O4G A;  4DTN A;  4KB0 A;  4KRF A;  4FW2 A;  1U48 A;  4OKE A;  1VSH A;  2KZZ A;  4DLG A;  3L2Q A;  4CJ3 A;  1TL3 A;  4CF8 A;  1RT3 A;  1CXU A;  3AVJ A;  3QEX A;  2VG5 A;  3KK3 A;  4DSF A;  3SUQ A;  2OA8 A;  3K5L A;  1IKV A;  4OKK A;  2O4I A;  4C8L A;  1RCH A;  2RN2 A;  4KHS A;  4DU3 A;  2DY4 A;  4OLB A;  1RTI A;  3QEV A;  3MXJ A;  4I9Q A;  4F3O A;  1RT7 A;  1XC9 A;  3EYZ A;  3D0P A;  4LSL A;  4LY7 A;  4OKJ A;  3V9Z A;  3L3V A;  4GVM A;  3M8R A;  4KTW A;  4CFC A;  3TI0 A;  1JXB A;  3HST B;  3K5O A;  2WOM A;  3JYT A;  3AVI A;  4RG8 A;  5FDL A;  2HW3 A;  5J2P A;  4FM0 A;  4ID1 A;  4CK2 A;  4DMN A;  1W9H A;  3NAE A;  1GOB A;  1U47 A;  3NGZ A;  5HP1 A;  4N76 A;  2HNZ A;  2P5G A;  4CHQ A;  4F2R A;  1ZBL A;  4E89 A;  2VG7 A;  4DF8 A;  4FJX A;  3HJF A;  3KD5 E;  4PQU A;  4B9N A;  2HMI A;  2X6S A;  4CHO A;  4KTQ A;  4YNQ A;  1NJY A;  1TKX A;  1NJZ A;  3S3N A;  1SKS A;  4QCL A;  1VSJ A;  4CJE A;  3SQ1 A;  1VRU A;  3G10 A;  2HVH A;  3ZSX A;  1CXQ A;  1Q9X A;  2YNG A;  1KTQ A;  2PYL A;  1BI4 B;  2JLE A;  4KPY A;  4FCY A;  1LWE A;  4OVL A;  2YNF A;  1WSI A;  4FLW A;  2XRI A;  1UA1 A;  4AHR A;  5SWM A;  3U6F A;  4M42 A;  4IG0 A;  1SV5 A;  5CZ1 A;  4CED A;  1YVU A;  3AVK A;  3VQ9 A;  1Z26 A;  3VQ5 A;  3ULD A;  2E6M A;  4CEO A;  3O3G A;  4FJ7 A;  3LAN A;  2VWJ A;  4FJH A;  4IKF A;  3SQ4 A;  1IKY A;  4FLU A;  3ZSV A;  3QES A;  3S3O A;  4FJ9 A;  2HHU A;  4CHN A;  3NF7 A;  4CF1 A;  4CJR A;  3V9X A;  1NKE A;  1MU2 A;  3SZ2 A;  3TAB A;  4ZTJ A;  3NF6 A;  3P83 D;  4FVM A;  1T03 A;  2HHW A;  2OZS A;  4FZZ A;  4M3U A;  1F21 A;  4CJS A;  1SUQ A;  1BHL A;  2G8I A;  4E1N A;  4BDY A;  1HRH A;  2XO7 A;  3P5J A;  2B4J A;  4KO0 A;  2BDP A;  4M3Z A;  5SZT A;  1FKO A;  1BCM A;  3OYG A;  1S6P A;  3ZCM A;  3KKR A;  1N5Y A;  1RDD A;  4IBN A;  3AA5 X;  3C6U A;  3PO4 A;  1C0U A;  3NFA A;  4Z0U A;  3IAY A;  4BDZ A;  5KRS A;  4MFB A;  3AVM A;  1S6Q A;  3ASM A;  4NYN A;  3AVB A;  3QLH A;  2IC3 A;  3LDS A;  3TAN A;  3RTV A;  2FBY A;  1NJX A;  2F8S A;  2HHV A;  4FYD A;  4Z4E A;  4DQQ A;  4CGH A;  2GBZ A;  1JLC A;  3ZSW A;  1FK9 A;  4O55 A;  3DLK A;  3VQQ A;  3PX4 A;  2DFE A;  3SI6 A;  4J2B A;  4FJM A;  4CEA A;  1WNS A;  3OYC A;  1UWB A;  5HRP A;  3QET A;  1VSE A;  4CIG A;  2P5O A;  4F2S A;  4UQG A;  4DLE A;  3AVG A;  3SUP A;  1RBR A;  3V6D A;  1N6Q A;  3O4Q A;  1GOC A;  4CCH A;  1KLN A;  2KZM A;  3DLH A;  4DQI A;  2FC0 A;  3DLG A;  1T7P A;  3TAM A;  4W5O A;  1VSD A;  1HYZ A;  1LW2 A;  3WNF A;  4EZ6 A;  3SPY A;  1RBT A;  4CEE A;  4CFB A;  3ITH A;  3M8S A;  3L2U A;  1NK7 A;  4IFY A;  1JLG A;  1RT1 A;  2IOC A;  5J1E A;  3CQ8 A;  2ZQB A;  3SV3 A;  1ZBH A;  4FZY A;  3NGI A;  1HNV A;  4QAG A;  3VQ8 A;  4J2A A;  4DTU A;  1WSF A;  2F8T A;  5HRS A;  3OY9 A;  3SJJ A;  4B9L A;  3NCI A;  2JGU A;  3AO1 A;  1TV6 A;  3OYL A;  4OPJ A;  3I0R A;  5CY4 A;  4IG3 A;  2EX3 A;  3RRH A;  4DTS A;  4KHU A;  4HUF A;  4H8K A;  4CEF A;  3L2V A;  3RMC A;  3OYE A;  1L3S A;  4ELV A;  4BDP A;  4FJN A;  3AO2 A;  1JL1 A;  2HB5 A;  2YHA A;  4TSX A;  1A5X A;  3VQB A;  3EZ5 A;  4W5N A;  3B6O A;  3DRP A;  3HPG A;  1FXX A;  1K6Y A;  2IGI A;  3HVT A;  4J2D A;  2ETJ A;  3HVR A;  1S1V A;  4DTX A;  4CER A;  4B3O A;  3DLB A;  2IAJ A;  4HUE A;  3P1G A;  1EX4 A;  4FLY A;  3PUF A;  3RR8 A;  3IG1 A;  3NF8 A;  2XY6 A;  4YFU A;  1VRT A;  3NDK A;  3LP2 A;  2OPP A;  3QNN A;  3PX0 A;  3V1Q A;  1SKR A;  3A2F A;  1NOZ A;  2FBV A;  2KTQ A;  2RF2 A;  2OPQ A;  2XY5 A;  2D0A A;  4JS4 A;  4HHT A;  1D5A A;  1YT3 A;  4N47 A;  4CJQ A;  1RTD A;  1RTJ A;  1S1U A;  2DFH A;  1HJR A;  4FW1 A;  4CJ4 A;  1NK4 A;  4E0D A;  3L2R A;  4CIE A;  3K57 A;  4DTO A;  1KFD A;  4K8X A;  4I2P A;  5C42 A;  4RW4 A;  4HVJ A;  1J9A A;  2PY5 A;  1REV A;  3MEC A;  3PO5 A;  4OGC A;  1C1C A;  5HRO A;  1D8Y A;  3HO1 A;  2RKI A;  1I3A A;  3VQ6 A;  1J54 A;  4E19 A;  4W5T A;  3PY8 A;  4F3T A;  3G0Z A;  4CHZ A;  1ASW A;  1SKW A;  2GV9 A;  3NF9 A;  4PA1 A;  3K5M A;  1S9E A;  1WSE A;  3VQD A;  2FBT A;  4E7K A;  4FJK A;  3TAP A;  4Z4F A;  2I5J A;  5J2Q A;  3OJS A;  2HHX A;  2QK9 A;  3RR7 A;  3ZSR A;  3QIO A;  5JS2 A;  4NYF A;  1VSF A;  1KVB A;  3V9S A;  1KVA A;  3IS9 A;  1X9S A;  3T1A A;  2VG6 A;  3M8P A;  3SV4 A;  2P1J A;  4M45 A;  1S9G A;  3AO3 A;  3RRG A;  4CJT A;  3KLG A;  4BWM A;  1NKB A;  1JLE A;  3K58 A;  4F8R A;  3ZSO A;  1D9D A;  3ZSQ A;  4ELT A;  3AVH A;  4BE1 A;  2AJQ A;  4KTZ A;  3QEP A;  1WSJ A;  1A5W A;  4KI4 A;  1RT4 A;  1QE1 A;  1Z25 A;  1HYV A;  1KVC A;  3NGY A;  5KTQ A;  1NOY A;  4FK2 A;  1SL1 A;  1YTA A;  4CES A;  4M3X A;  1HMV A;  3WNH A;  3SQ0 A;  3PV8 A;  4PWD A;  1UOC A;  1TKZ A;  3CG7 A;  3CM6 A;  3RMB A;  4DS4 A;  4O0J A;  5FRN A;  3E01 A;  1GOA A;  2Y1I A;  1BI4 A;  2FBX A;  3SCX A;  3AA4 A;  4CEC A;  1LAV A;  2O4G A;  2D5R A;  2IS3 A;  3HL8 A;  3DOL A;  3K5N A;  4NCA A;  2B6A A;  2P51 A;  2BE2 A;  3D45 A;  3WNG A;  1U45 A;  1RT2 A;  1FKP A;  3LP3 A;  3SUN A;  3OYK A;  3CFR A;  1T05 A;  1NJW A;  4FM2 A;  4E3S A;  4FK4 A;  3F9K A;  4G1Q A;  3DLR A;  1RDC A;  1JL2 A;  3DMJ A;  5C24 A;  4DSI A;  4FLX A;  2G8W A;  1NK5 A;  4EP4 A;  1JLA A;  2HHT A;  5HBM A;  5KRT A;  4Z4I A;  3F73 A;  1JLQ A;  2BGG A;  3FFI A;  4FJ5 A;  1ZYQ A;  4KAZ A;  4AIL C;  1TL1 A;  1U04 A;  4JRP A;  3QNO A;  4LH4 A;  4CGF A;  1DTQ A;  1QSY A;  4CJW A;  1T8E A;  4BE0 A;  1JLF A;  4KKO A;  3SPZ A;  2NUB A;  1X9M A;  1BIZ A;  4GW6 A;  4CJ5 A;  3TAE A;  3ZT1 A;  4CGD A;  4KFB A;  2KFZ A;  1BIU A;  4I2Q A;  1ZBI A;  2D0C A;  4Q0B A;  4E7I A;  3NHG A;  4PUO A;  3LZJ A;  4Y1D A;  3SQ2 A;  2PZS A;  2ITG A;  4BAC A;  2OPS A;  4B8C A;  5FRO A;  1NK9 A;  3V9U A;  1BGX T;  2RPI A;  4CFA A;  1TVR A;  4FJJ A;  5CZ2 A;  3NBP A;  3KLH A;  3HM9 A;  3KTQ A;  1DTT A;  2E6L A;  5T7B A;  3OYB A;  4JS5 A;  4CF9 A;  1BIS A;  1RDA A;  3K2P A;  4CJF A;  3NH1 A;  4KRE A;  4E7L A;  4GMJ B;  3O4N A;  3SNN A;  4FJL A;  1XI1 A;  5I42 A;  1U4B A;  4KHW A;  1EKE A;  3MEE A;  1LWF A;  3H08 A;  4DS5 A;  3TAF A;  3M8Q A;  4B9U A;  4EP5 A;  4OGE A;  3VA3 A;  1XWL A;  1YTU A;  1HNI A;  1G15 A;  4HTU A;  3C94 A;  3DM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...