4CEEA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceeA00
3ZT4A 4FJKA 4H8KA 4I7FA 3NH2A 3U3GA 3I0RA 3CM5A 1TV6A 4DTPA 4RW6A 2XY8A 4NCBA 3RR7A 3LP2A 3HK2A 1SV5A 2XY5A 2F8SA 2XO7A 1HQEA 1TVRA 1WSIA 4W5NA 3MXMA 3DOKA 2FBTA 3PX4A 4I9LA 4CJVA 3NF7A 2KTQA 2KW4A 3S3MA 1RCHA 4Z4FA 1X1PA 3G0ZA 1FKOA 4JRQA 1A5XA 1TL1A 1C0MA 1DLOA 1KFSA 3AO1A 3SUNA 1HNIA 4RG8A 4O0JA 4AHRA 4OPJA 2ETJA 2WOMA 4LD0A 4XIUA 3M8SA 3NHGA 3SQ4A 4B8AB 3ULDA 1QSLA 3V9ZA 1BCOA 3QEVA 3AVMA 5HP1A 2HNDA 3ZT3A 1NK5A 1HMVA 3K58A 4DQRA 4AHCA 1IKXA 4M45A 4BDPA 2G8FA 3HPHA 1Z25A 4M3WA 1VSIA 3KLHA 4CHQA 3LZIA 4I2PA 2IOCA 3T1AA 1WSJA 5CYMA 1IG9A 3KJVA 4F2SA 4J2DA 3C6TA 3TANA 3DLBA 2KFZA 1KRPA 1SUQA 3OJSA 4QOZB 4BWJA 3VN5A 1A5VA 3AVCA 1J53A 2RF2A 1RILA 4DQQA 3OS1A 3CFPA 4M3XA 4H4OA 3AA2A 4PQUA 3NF8A 5KI6A 3QESA 4AILC 1NJWA 1LV5A 2OA8A 3SZ2A 4KTQA 3PO5A 1T05A 2KFNA 3HM9A 1G15A 3L2WA 4PUOA 4KHQA 3HJFA 1IKVA 5FRMA 1VSHA 4Y1DA 4C8NA 4FJ9A 3SNNA 4RW8A 4CECA 4DSKA 1JLGA 1KVCA 1D9FA 4FJIA 2O4IA 3VQAA 1RT1A 3P83D 1RTDA 1TKZA 2YHAA 4CF8A 2D0BA 1VRTA 5EU7A 4CIGA 4CEZA 3VQPA 1N6QA 1S9EA 4CHNA 4KHSA 2OZSA 4FK4A 4KAZA 3MXJA 1U48A 3SYZA 1ASVA 1QS4A 1LWFA 3V81A 4KHNA 3WNFA 3OYBA 3KKRA 4CJSA 4CJWA 4DTJA 3SUOA 2GV9A 5HLFA 3KIOA 4C8KA 4DU3A 4L8RB 2EHGA 5J2PA 3ASMA 3D45A 4IBNA 1NKEA 4N76A 3FFIA 2VG6A 4DMNA 2DTUA 1L3UA 4O55A 2BANA 4DTSA 2BE2A 2ZD1A 3WNHA 2OPQA 2JGUA 4CHPA 1BIZA 2X78A 1L3SA 1GOBA 1HYZA 3MEEA 5KRSA 2B5JA 1TAQA 1MU2A 3VQEA 2PY5A 4OVLA 3F73A 3NBPA 3V4IA 4FK0A 2YNIA 2VWJA 3ZSQA 3THVA 3NH1A 1RBUA 1TL3A 3P5JA 2Y1IA 2HHTA 3OYCA 1T8EA 1RT6A 1EKEA 2P1JA 1QHTA 1JL1A 1NK4A 2PYJA 4CEAA 4FJXA 4KI6A 3LAKA 3QINA 4CHZA 4LY7A 4KTWA 1HNVA 1JLAA 3LALA 2YHBA 4M3TA 2FBYA 3HVRA 3DRSA 3SUQA 1VSFA 1REVA 3VQQA 2ITGA 3NGIA 3D0PA 2HW3A 4HUEA 4DTUA 4FYDA 1EETA 3SPYA 3PUFA 5KRTA 1L3TA 1WN7A 2A1SA 4N56A 2W42A 4E0DA 4FK2A 4KRFA 4B9TA 1K6YA 1QTMA 1BGXT 4LSNA 4CFCA 4Z4EA 3VQ6A 1NJZA 1NKBA 1YVUA 3MEGA 1JLQA 3KTQA 2E6LA 3ZCMA 3OYDA 3OYAA 3KLFA 4ELTA 3HPGA 3VQ7A 4ELUA 1WAFA 4GMJB 1NK9A 4OLBA 1J9AA 4KREA 3QEIA 3RMAA 3DRRA 4IFVA 5CZ2A 3AVBA 3C95A 3K59A 4MFBA 1BI4A 3S9HA 1RT5A 4DFKA 4DWIA 1C1CA 3KLIA 1BQNA 3IG1A 1TKTA 1XWLA 2DFFA 1UA1A 1NK7A 4PA1A 1Y97A 3K2PA 4CHYA 1RDAA 4FM2A 1D9DA 2KQ2A 3L2VA 2P5GA 3RWUA 2HB5A 2OPSA 4DTOA 2JLEA 4FJLA 4IFYA 1I3AA 1NK6A 2P5OA 5HROA 4M41A 1X9WA 1CXUA 1VSLA 5J2QA 3VQBA 2ATQA 3QNOA 3DLEA 1CZBA 1ZBLA 2G8HA 3DLHA 4FXDA 2HHQA 4CCHA 1IO2A 5C24A 3O3GA 1S1TA 1TK8A 4B9VA 2HNYA 3SJJA 3SPZA 1NJYA 1S6PA 1BL3A 5CY4A 2OPRA 1RDCA 4HCBA 1HYSA 3K57A 4FJ5A 1RBSA 4HUFA 3QLHA 5I3UA 3AVHA 3WNGA 4KV8A 4KKOA 1ITGA 3AO4A 4Z4GA 1ZBHA 5J2MA 4CJQA 4N41A 4ICLA 2Z1GA 1C1AA 3L2QA 3RRGA 2HHXA 4BE0A 4CFDA 3ZSYA 1C1BA 3AO5A 1R0AA 1JXBA 1RDDA 4DQPA 3NDKA 4JS4A 1KLMA 2E4LA 3DLRA 2RKIA 4CGIA 4Y1CA 1LWCA 4B8CA 4W5TA 4F8RA 4CJ5A 4CJ3A 5J1EA 3NAEA 3JYTA 2NUBA 4DFMA 4F3TA 4CEFA 1QSSA 4H4MA 4FJHA 2DFHA 3OYJA 4FJJA 4O0IA 1X9SA 4KHUA 3T3FA 4B9SA 1A5WA 5CYQA 4JRPA 1S9GA 1QQCA 4CJRA 2VG7A 1NK0A 4FLTA 3PX0A 2AJQA 4C8MA 4FVMA 3ZSXA 3OS2A 1CZ9A 4YNQA 1WSGA 3DM2A 3TI0A 1UAXA 1IH7A 1VRUA 2HVHA 3AVKA 2G8UA 4FZXC 1U04A 1LW0A 1HPZA 4BE2A 4B3OA 3H08A 2F96A 2HHWA 4LH4A 4E7KA 4I9QA 3TARA 1WLJA 3ISNC 2OYQA 2OPPA 4CJLA 3AA5X 4NCGA 1SL0A 2G8VA 2XRIA 2ZQBA 5KGWA 4CE9A 4KB1A 4DSJA 1NKCA 3ZSRA 4FLWA 1F21A 3IS9A 3TABA 1XC9A 4IDKA 4HTUA 4DTMA 3NGZA 3OY9A 3TAFA 3LP1A 2XHBA 1JLEA 2GBZA 5I42A 1KSPA 1B9DA 3NF6A 5HRNA 3OYGA 3HP9A 3HVTA 4Z4HA 3SQ2A 3AVIA 4J2EA 4E89A 1W0HA 3KLGA 3DRPA 4DSLA 4DF4A 1J5OA 3C94A 1BHLA 4BDYA 4CF0A 2A1RA 4J2BA 4E1MA 4DSIA 3EZ5A 1NOZA 1U47A 4KB0A 2FBXA 5JS2A 1DTQA 4CK2A 1FKPA 3DOLA 2R7YA 3T19A 4CK3A 2HMIA 4FZYA 3OYHA 1KVAA 4NYFA 4PWDA 1I39A 1SKRA 1RT4A 3LP3A 2G8KA 4KFBA 4CEEA 3IAYA 1YTAA 5FDLA 2VG5A 4DLEA 4KHWA 1WSEA 2IDOA 3TWHA 2FBVA 1C6VA 4W5RA 1UOCA 3M8PA 1Q8IA 4B9UA 3OS0A 4AHUA 4DU4A 1NOYA 4PY5A 2E6MA 3VQCA 4WE1A 5HRPA 4CJPA 4K8ZA 4LH5A 1SKWA 1ASWA 2DFEA 4BE1A 3L3VA 2IGIA 1ZBIA 4HUGA 1VSDA 3QIPA 4R5PA 1S5JA 2G8IA 4I2QA 2Z1HA 4CF9A 1U49A 2VWKA 4M3YA 4OKKA 4QCLA 3SCXA 3KD5E 3BGRA 3AA3A 3EY1A 2OZMA 4GVMA 4G1QA 5SWMA 3QEWA 4KHYA 4OJRA 3V1OA 1SKSA 3HPOA 3TAMA 1RBTA 4EZ9A 3K5MA 4FW1A 2HNZA 2Q3SA 4BACA 1UWBA 3ZSWA 2QXFA 3LAMA 1GOCA 1S1VA 1VK0A 4ID1A 4CJFA 2D0CA 3HO1A 1HRHA 2HHVA 3S3OA 2GUIA 3G10A 3V1QA 3I0SA 3AVGA 4CGGA 4DS4A 1Z26A 3I8DA 1KFDA 2ZE2A 3MEDA 4B9MA 4NCAA 4ZTJA 1T7PA 4Q0BA 4YFUA 3VQ9A 4CGFA 3OYIA 4O4GA 1JLBA 3O3HA 4DU1A 1CXQA 4GW6A 1BQMA 3VA0A 1FXXA 3OVNA 1BISA 5JS1A 3LP0A 4BWMA 3OYNA 4OGEA 4KO0A 3NH0A 3AO3A 3SV3A 1L5UA 1TAUA 5HBMA 4IG3A 3DMJA 3L8BA 3QNNA 4OKJA 2RN2A 1C0TA 4DQSA 3TAQA 1BIUA 4FJNA 1RTJA 3ITHA 5KTQA 4HCCA 4M3UA 1EP4A 4J2AA 1DTTA 4B9NA 3LPTA 4CGJA 3TAEA 3HYFA 3V1RA 1NK8A 4QAGA 4CF2A 3QETA 1T03A 1RNHA 4DSFA 4ID5A 1TKXA 3PX6A 3QIOA 1LW2A 1WSHA 3QO9A 4CESA 3AVFA 1GOAA 2I5JA 1S1WA 3OYLA 4FJ7A 3DI6A 3KK3A 4CK1A 3O3FA 4F2RA 4RW4A 1RTIA 3P1GA 4HHTA 4EP5A 3DLGA 4DFPA 3KKSA 3MECA 1JLCA 3AVAA 2B4JA 4FLYA 4CEQA 3O4NA 4OGCA 3CQ8A 3QEXA 3SI6A 1JL2A 2FC0A 4RW9A 4OKEA 1ASUA 3L2RA 4CJ4A 2P51A 1IKYA 3TAGA 1ZYQA 3BDPA 1RDBA 4M3RA 1YTUA 2YKMA 4DTXA 3VA3A 4CJUA 1S1UA 4EZ6A 5DMRA 4W5QA 4E7HA 4RW7A 4E7LA 2QKBA 3ALYA 5E41A 3ZT1A 4HVJA 3RMCA 4ZTFA 3OYKA 4FW2A 1Q9XA 3B6OA 5CZ1A 1VSMA 4CEOA 4UQGA 4FCYA 3OYEA 1NJXA 1HQUA 4N5SA 4C8OA 1U45A 5D3GA 2HHUA 3LWMA 4ELVA 3ZSZA 4CF1A 2G8WA 3HXMA 3SQ0A 4Q5VA 3AVNA 3OYFA 4DF8A 1B9FA 4DTNA 5K14A 3PV8A 3LANA 2Y1JA 2LSNA 4FLVA 2KZZA 4Z0UA 3DYAA 5HRSA 4OPKA 1D5AA 1LWEA 3TR8A 1B92A 3WNEA 3K5NA 4CEDA 1WSFA 3VQ5A 3CG7A 4CGHA 3B6PA 3MXIA 3AV9A 4E7JA 1ZBFA 5J2NA 3CYMA 2YNGA 1VSEA 1TGOA 3E01A 4W5OA 3RR8A 2PZSA 1QE1A 2IS3A 3VQ4A 2O4GA 4E1NA 4DSEA 1BI4B 3U6FA 3PO4A 5C25A 4CFBA 1BCMA 4F4KA 2DY4A 1ZBUA 1HJRA 3KK2A 4BDZA 1QSYA 3ZSVA 4CHOA 2F8TA 4AHVA 3RTVA 2QK9A 2IC3A 4E19A 2YV0X 4MQ3A 4FLXA 5HRRA 3LZJA 3ZSOA 1FK9A 4CEBA 3L2UA 4DQIA 3V9SA 3M8QA 5KGXA 4JLHA 1VSJA 1RBVA 4DFJA 1LAWA 4CIEA 3KLEA 5FRNA 4EP4A 1O1WA 2BGGA 4DLGA 1LAVA 4NYNA 1JKHA 4O44A 1TK5A 4FJMA 4Z4IA 3V9XA 5C42A 3O4QA 3DLKA 3V6DA 3VQDA 3KD1E 5T7BA 1TK0A 4K8XA 4OLAA 4CERA 4TSXA 3AO2A 4DS5A 4M42A 4DG1A 3LDSA 1HYVA 3NCIA 3OYMA 3HT3A 3CFOA 4IKFA 3RMDA 4FJ8A 2HVIA 4F3OA 2RPIA 3U3YA 1S6QA 3KK1A 2B6AA 3V9UA 2HHSA 1N5YA 1RT3A 3CM6A 4AHTA 4CJKA 3PY8A 1D8YA 4CFAA 3AVLA 3F9KA 2KZMA 3S3NA 4CJTA 1SL1A 4FLUA 3K5OA 3HL8A 1XHZA 3MAQA 4ZHRA 3AA4A 1WAJA 2YNHA 3SV4A 1J54A 3OJUA 1X9MA 4C8LA 1KVBA 4FLZA 4M3ZA 2Z1JA 1RT2A 2YKNA 4FJGA 2YNFA 3NFAA 4DTRA 2D0AA 3M8RA 1UA0A 3L3UA 1Q9YA 4FM1A 1XI1A 1JXEA 4AH9A 3SUPA 3K5LA 4KPYA 3TAPA 4FZZA 3NGYA 1RTHA 1XHXA 1W9HA 2PYLA 4IG0A 5DK5A 1JLFA 1WNSA 3NF9A 3CFRA 1KTQA 3HSTB 3NE6A 4FM0A 4N47A 3V9WA 1KCFA 3A2FA 4KTZA 2X6NA 3EYZA 3C6UA 3UIQA 3LPUA 1YT3A 1KLNA 3AVJA 4JS5A 1L3VA 1EXQA 1TKDA 4CJEA 1VSKA 2X74A 1RBRA 2X6SA 4E7IA 3HP6A 1C0UA 1U4BA 2BDPA 4Z4CA 4LSLA 4CGDA 1EX4A 1S1XA 5FROA 3VQ8A 4B9LA 1IKWA 3QERA 4O5BA 2D5RA 1RT7A 3QEPA 3LWLA 2IAJA 5SZTA 3ZT0A 3RRHA 2EX3A 2WONA 4E3SA 3IRXA 3SQ1A 1CLQA 4AHSA 4CIFA 2XY6A 4KI4A 1SL2A 3ZT2A 3JSMA 3RMBA 2XY7A 4B08A 2Z1IA 2QKKA
chains in the Genus database with same CATH superfamily
4H8KA 2QWLA 4I7FA 3UKUA 4DTPA 3W0LA 4A5AA 4NCBA 3LP2A 2XO7A 1TVRA 3H46O 3A5LC 3MXMA 3PX4A 2FBTA 1ATNA 3TU5A 3NF7A 3S3MA 3G0ZA 2YHXA 1KFSA 3AO1A 4O0JA 3SQ4A 2ETJA 4LD0A 5M1OA 4H0YB 4B8AB 3QEVA 3JXUA 4DQRA 3K58A 4M45A 2VQFK 1VQ4N 5AJ3K 4FVUA 5KQDA 3HPHA 4M3WA 1VSIA 1K8KB 2P9UB 1WSJA 2VCPA 5CYMA 3TANA 4LFBK 5BN9A 1M90O 1SUQA 3OJSA 4QOZB 2GTDA 3AVCA 2RF2A 4H4OA 1G99A 1BO5O 4KTQA 1BA0A 4AQYK 1T05A 2KFNA 1MDUB 1G15A 4FWNA 4BG9A 1VSHA 4Y1DA 2W6LA 4FJIA 2O4IA 3ZX0A 4CF8A 1OH8A 4L3QA 3VQPA 1N6QA 4CHNA 2O8BB 4KAZA 2UYTA 3VGLA 3WEEB 2Q36A 3LDOA 5AQWA 3WNFA 4L8RB 4C8KA 3KIOA 1NKEA 5LL6Z 4DQ8A 4K43A 1L3UA 3K9JA 2HBKA 3WNHA 4CHPA 1BIZA 3MEEA 3VERA 3ZETA 4FK0A 2YNIA 1TYQB 1YF5L 3PLAA 5AR0A 3QB0A 3OYCA 3MX2A 1EKEA 1BU6O 2P1JA 1QHTA 1JL1A 1NK4A 4CHZA 1HLUA 1P8ZA 4QS8A 3SUQA 2HSTA 3VQQA 1EETA 3PUFA 1NJIO 3TSUA 4FK2A 5DM7L 3H3NO 4CFCA 4Z4EA 2UUBK 3VQ6A 3MEGA 1KXPA 4CD3A 2E6LA 3ZCMA 3KLFA 3HPGA 1WAFA 4OLBA 3RMAA 2Q0UA 4B1YB 5JICA 4IOXA 3AVBA 3K59A 1NWKA 1KD1O 4MFBA 1BI4A 1NU0A 1C1CA 1OH7A 2DFFA 3A0IX 4JI7K 3O9UA 4LF7K 3UB5A 4DR5K 4CHYA 4H5VA 4FM2A 2HB5A 4IFYA 1Q18A 4DR2K 1X9WA 1CXUA 5EXWA 3OA9A 5C10A 3DLHA 4CCHA 1DT9A 1TK8A 2HNYA 3SPZA 4DV6K 2P9KA 1RDCA 4WFNL 4KV8A 2E1YA 5J2MA 4FWPA 4N41A 4H0OA 4ICLA 3L2QA 3H45C 3FR0A 3ZSYA 1C1BA 1YJ9N 3O1BA 3NDKA 4CGIA 5LY3A 2OTJN 4Y1CA 1LWCA 4A5BA 4CEFA 2A40A 1QSSA 4FJHA 3ID6A 3KK7A 4O0IA 3T3FA 4B9SA 1NK0A 3ZETB 2UUCK 1SQKA 3PSIA 3OS2A 4YNQA 3C6HA 3U9DA 3CQYA 4BRMA 3TI0A 2HVHA 1VRUA 3L6QA 2G8UA 4FZXC 1LW0A 4BRNA 1KAYA 2NRTA 3TSQA 3CCRN 3TARA 3E9PA 2OYQA 1RGIA 2OPPA 4CJLA 4JYAK 1SL0A 3QFPA 4CE9A 4KB1A 4NXMK 4JK7A 1VQLN 3IS9A 1VQ8N 4HTUA 2ASPA 4DTMA 4JEPA 2WTUA 5I42A 5HRNA 3OYGA 4GV3A 4B1WB 4E89A 4DSLA 2P9LA 5GAEP 4BDYA 2A1RA 4J2BA 4E1MA 4FWMA 5AQGA 1DTQA 4CK2A 4CZJA 5KPZA 4PWDA 2HMIA 1D4XA 1KVAA 1K73O 2G8KA 4KFBA 4CEEA 1YTAA 5FDLA 1WSEA 5GINA 4W5RA 5KPTA 4NLCA 1Q8IA 4B9UA 1NOYA 3OHRA 4WE1A 2P9KB 5HRPA 4CJPA 2E88A 4IOCL 5AQKA 3I56N 3H1VX 4M3YA 2VWKA 3KD5E 2I7PA 2CGJA 2OZMA 3R6MA 4A61A 3V1OA 2QWMA 3TAMA 2HNZA 4BRDA 1MA9B 3VEWA 1KAXA 1S1VA 1JCFA 1HRHA 3I0SA 4DS4A 4CGGA 4B9MA 4JKDA 3MEDA 2ZE2A 4NCAA 1ZC6A 4WFBL 2GUPA 3D2EA 3O3HA 1BQMA 3ENHA 2IVPA 4E1JA 5JS1A 3LP0A 3OYNA 4OGEA 1TAUA 3NH0A 3SV3A 1L5UA 5HBMA 3L8BA 3QNNA 2RN2A 4FJNA 1RTJA 5AQTA 4IJNA 4HCCA 3IUCA 3LPTA 4CGJA 2IVOA 1I94K 4QAGA 5GADP 3QETA 5IWAK 1LW2A 2I5JA 3AVFA 1S1WA 1NGJA 5C15A 3J7YP 3UKRB 4OX9K 4EP5A 3DLGA 4MDBA 4BR7A 3AVAA 3CMAN 4MLEA 1ASUA 3L2RA 2P51A 2Q1NA 2BH1A 3VA3A 2QKBA 4RW7A 1HNWK 2E2QA 3L4IA 1ATRA 5TKYA 4ZTFA 4B3MK 3OYKA 1P90A 4GVEA 1VSMA 3IMXA 4H0VB 4CEOA 1HQUA 4C8OA 3HBTA 4BRGA 3OYFA 3M1FA 1XNRK 3MN7A 5HL7L 2LSNA 5LMUK 3QFUA 4Z0UA 3J81O 2YCHA 3TR8A 2NZTA 1B92A 1WSFA 3CG7A 1X3MA 1ZBFA 5J2NA 4IFEA 3BEXA 1VSEA 3A5MC 3P31A 5CR4A 3VEXA 4E1NA 3VOVA 3HZ6A 3I55N 3PO4A 5AFUA 4RTFD 1BCMA 5HOOA 4WFAL 5EY4A 3KK2A 1HJRA 3BP8A 4CHOA 2QK9A 4E19A 1QVGM 2YV0X 4DV4K 1VQ7N 4DHYA 2O8FB 2NRZA 3CCUN 1VSJA 1RBVA 4CIEA 1EWQA 4BRCA 5ELZA 4JAXA 2BGGA 1JKHA 3CCMN 4Z4IA 4CW7B 3V6DA 3KD1E 4OLAA 1C0FA 4DG1A 3LDSA 1HYVA 3HT3A 3C7NA 4FOIA 3I8BA 2RPIA 2HHSA 5E26A 3KZBA 1RT3A 2E1ZA 3CM6A 4CJKA 4CFAA 3AVLA 2EWSA 3S3NA 3GL1A 4BQLA 4ZHRA 3AA4A 1WAJA 3SV4A 3OJUA 1NGIA 4M3ZA 4FJGA 3HRGA 4DTRA 3KVGA 2D0AA 2O8CA 4WF9L 1GLBG 2V7ZA 1XHXA 1W9HA 5DK5A 1JLFA 3NF9A 3HSTB 4KTZA 1KCFA 2GX9A 2X6NA 3A2FA 2JWKA 1YT3A 1KLNA 3U9ZA 3ENOA 4E7IA 3CC2N 3QICA 4Z4CA 1EX4A 3IFRA 1IKWA 2NRXA 4IEIA 2D5RA 5SZTA 3ZT0A 3RRHA 2EX3A 2WONA 4AHSA 2ZGZA 4WCEL 4CIFA 1NMDA 1YXQA 1XQSC 4KHUA 2V52B 1HPMA 4C1NI 3NH2A 1TV6A 4FWSA 1IBKK 3HK2A 3WXJA 4IXCA 1N33K 2A5XA 3HTVA 1WSIA 5F1XA 1GLLO 2KW4A 4Z4FA 1X1PA 3VGKA 3PSFA 2GELA 4JRQA 1A5XA 1HNIA 4RCHA 2BUPA 4OPJA 4XIUA 5AQYA 4BVPA 1QSLA 3QMLA 5HP1A 1YIJN 3ZT3A 1NK5A 1HMVA 2CH6A 2G8FA 4JKHA 4QS9A 2IOCA 1IG9A 2ZJPL 3KJVA 4J2DA 3DLBA 3OTOK 5LJWA 3VN5A 1J53A 3LDLA 4DQQA 3OS1A 4M3XA 2OTLN 4PQUA 1VHXA 3QESA 1Z6RA 1NJWA 3SZ2A 2NRRA 1VQMN 1BOTO 1NNEA 4BGAA 3L2WA 1T3VA 3SLCA 5FRMA 4FPAA 2P9PB 4FJ9A 4DSKA 2V7YA 1RTDA 3P83D 2O8CB 3E66A 4DCHA 4KHSA 2F9WA 3WXIA 3MXJA 4BR4A 1U48A 4YOUA 1VQNN 4KHNA 5C2FA 3KKRA 4CJWA 3GBTA 3SUOA 2GV9A 2EHGA 1WUAA 2DTUA 4IBNA 4PKIA 4DMNA 2AA4A 4BC5A 2BE2A 2ZD1A 4QS7A 3ULEA 1HYZA 5KRSA 1MU2A 3VQEA 4OVLA 4X64K 3NH1A 1TL3A 2HHTA 4BY9C 5AQMA 1IG8A 1T8EA 1RT6A 1E4FT 2ZJQL 4FJXA 1R59O 4BGBA 4KTWA 3LALA 3HVRA 3DRSA 2ITGA 4B1XB 1OH5A 3SPYA 4K25A 5KRTA 1WN7A 2W42A 4KRFA 3F9MA 3LL3A 1NJZA 1U2VA 1NKBA 1YVUA 3KTQA 3OYAA 1JCEA 4ELTA 3VQ7A 1OH6A 2P9IB 2VWBA 4IZ9A 3E9LA 5AQOA 4DWIA 4JI1K 3KLIA 4PA1A 1WBBA 1D9DA 3L2VA 2P5GA 2ZJRL 2JLEA 5AZIA 2P5OA 1RDWX 3BY5A 4M41A 5HROA 1VSLA 5AQHA 3VQBA 3QNOA 3FZHA 2G8HA 1CZBA 2HHQA 1IO2A 1NGHA 3SJJA 1NJYA 1HYSA 3K57A 4FJ5A 1IBLK 4C23A 1ZBHA 4Z4GA 1C1AA 2HHXA 4BE0A 1JXBA 4DQPA 5I9EB 4ILJA 4JS4A 1KLMA 4A2BA 4W5TA 4F8RA 4H4MA 2QWOA 4KH4A 4PHTX 1X9SA 4AM6A 5CYQA 4JRPA 2YJFA 2WBNA 2AJQA 2HOEA 3ZSXA 3VETA 5AQNA 3MWTA 2VGMA 4YDUC 1CZ9A 3O9TA 4DV2K 4C1NK 3LM9A 3OBYA 2F9TA 4F9OA 4EFHA 2OCEA 3O9RA 2HHWA 4Y0WA 4NCGA 3CJBA 4BC2A 4DSJA 4FLWA 4IDKA 3MCAB 2GBZA 4CJ7A 3LDPA 1SAZA 2UUAK 3HP9A 3HVTA 5CE3A 1YITN 1NGCA 3C94A 1BHLA 4CF0A 3HSCA 1QZ5A 2O8DA 3EN9A 4BC3A 3DOLA 3ZLJA 3T19A 4B3TK 3O9SA 3OYHA 3BUZB 1I39A 5TKWA 3DAWA 1SKRA 5AZIB 3IAYA 1Y64A 4GKJK 3UKUB 3MK6A 4KH5A 3OS0A 3ATUA 2E6MA 3S41A 1N34K 3R1XA 3MMVA 4JKCA 2IGIA 3VPZA 4CZKA 1S5JA 3GE1A 2Z1HA 1U49A 1W2BM 2YHWA 1X3NA 4WQ5A 3CIPA 3P38A 4FPBA 3DLLL 4JI6K 4OJRA 3CXCM 1SKSA 3K5MA 3ZX2A 4FWQA 4BACA 1UWBA 3HO1A 1BWFO 3CJ1A 4IO8A 2HHVA 3G6EN 3S3OA 2GUIA 1Z26A 4DV3K 4B1VA 3CCJN 2P9SA 4CGFA 4IOAL 4DU1A 1Q82O 3U8XA 2UU9K 3CCEN 3T7ZA 4MDAA 4KO0A 3VTIA 4IG3A 2KHOA 4CZHA 5BN8A 3ITHA 5FPDA 4NO7A 4H5TA 4CZIA 1KC8O 3CHWA 5AFUH 3O5BA 4YOVA 1TKXA 1WSHA 4CZEA 3OYLA 4CK1A 2AP1A 3O3FA 4RW4A 1ILYA 3MECA 1GLCG 5MLCQ 2B4JA 4CEQA 4OGCA 3CQ8A 3SI6A 3H6EA 2O8DB 2FC0A 3BDPA 1RDBA 4DR1K 4DTXA 1YAGA 5AQZA 4ISEA 3ZT1A 5KQ8A 1J5EK 3ZX3A 4FW2A 4H0TB 4PKGA 4FCYA 4UQGA 2UXCK 3OYEA 3A8YA 5LMNK 3AAQA 4KH6A 1U45A 5D3GA 3EE9A 2HHUA 4ELVA 1J6ZA 4CF1A 5FPEA 2NRWA 3R8EA 4Q5VA 3DJCA 4YDUA 3ZEUA 4FSVA 5BPLA 1HJOA 5K14A 3LANA 1KAZA 5HRSA 4ISGA 4OPKA 5JVGL 4YOXA 3VEOA 4CEDA 3K5NA 3CC4N 3CERA 4G9ZA 1VQPN 1EWRA 4CBXA 3J7ZO 1GLFO 1TGOA 2IS3A 1BI4B 1RFQA 4BR5A 1DEJA 3U6FA 2DY4A 4F4KA 1ZBUA 5EX5A 4MQ3A 4UY8O 1YI2N 1XUPO 1ESVA 1TUYA 3M8QA 5KGXA 3TTDA 4I6MA 1O1WA 1LAVA 4YOYA 5C42A 3O4QA 3DLKA 4ISFA 4CERA 3AO2A 4DS5A 4M42A 1HX1A 2Q31A 3NCIA 3OYMA 3CFOA 3RMDA 3ID8A 3PY8A 1GLDG 3OW2M 5CHIA 3K5OA 1EO1A 4JI4K 3MAQA 5A2QO 2YNHA 1BA1A 3VTHA 3VF2A 3IDHA 2YKNA 2RE2A 4BRKA 2A3ZA 4LF5K 2KKZA 3BZKA 3M8RA 1UA0A 3L3UA 2GEMA 3NGYA 1RTHA 3P4IA 4IG0A 4B1ZA 1WNSA 5M1PA 3NE6A 5AQRA 3KHYA 4X66K 5BR8K 3FLCO 3UIQA 4JS5A 1EXQA 4CJEA 2X6SA 1U4BA 4XH5A 3TTCA 5BRHA 3QEPA 4MLHA 3RSEA 1CLQA 4LFCK 2I7NA 1QHAA 3RMBA 2XY7A 2WUSA 1W97L 3ZT4A 3N4PA 4FJKA 3CM5A 4FWOA 3VF4A 2XY8A 2P9LB 4DV7K 1DGKN 1SV5A 2F8SA 1HQEA 4W5NA 4IEEA 4CJVA 1FKOA 4BRQA 1TL1A 1DLOA 4RG8A 2HF3A 3NHGA 1N32K 2E2PA 5GAHP 3CJCA 2QI2A 3AVMA 4XEIA 1IKXA 1Q81O 3H1QA 1Z25A 4CHQA 3LZIA 3T1AA 4F2SA 2KFZA 1XMOK 4JK9A 4BWJA 1YJNN 4BRHA 1A5VA 4DV0K 5ADXA 3KWGA 3NF8A 4KHPK 4YOTA 3HM9A 3H3OB 4PUOA 5AQJA 1IKVA 3JS6A 2ASMA 4C8NA 1HR0K 4EAHD 4JKGA 4CECA 1JLGA 1D9FA 2FXUA 3K0SA 1E4GT 3HOSA 1TKZA 4BRFA 3ATVA 4CEZA 3LDNA 1S9EA 1VQ6N 4FK4A 3J8AA 3U4LA 1ASVA 1V4SA 3V81A 1LWFA 4U7BA 3D2EB 1QVFM 5HLFA 4CJSA 4DTJA 1Q86O 3PIPL 3ASMA 3D45A 5J2PA 2VG6A 3CETA 4GY2B 2OPQA 1L3SA 3D6RA 2B5JA 2PY5A 3WXMB 3G25A 2VWJA 3THVA 3RSEB 1RBUA 3P5JA 2ZF5O 4MO4A 2GWKA 4YHHK 3EEQA 4CEAA 4JHDA 3QINA 1HNVA 4M7XA 2YHBA 4M3TA 4JD2A 3NGIA 2DPNA 1BUPA 1QQNA 5GIOA 4HUEA 4DTUA 4E0DA 1QZ6A 1K6YA 1BGXT 4LSNA 1JLQA 4ELUA 5AQFA 1NK9A 1J9AA 1X9JA 5BRDA 3QEIA 3DRRA 4CD1A 4LFAK 5CZ2A 1U6ZA 1VQ9N 4JI2K 3S9HA 3BF1A 2F4VK 3AAPA 1S72N 3J7AP 3GOIA 1BQNA 3IG1A 1TKTA 4HTLA 1Y97A 4YY3K 4DUZK 1HNXK 4DTOA 1NK6A 1I3AA 5FLXO 2KLAA 4JI8K 2ATQA 4FXDA 3DLEA 1ZBLA 5C24A 3O3GA 1YUWA 1S1TA 4B9VA 3SMSA 1BL3A 4BRAA 5CY4A 4HCBA 1RBSA 4HUFA 3AVHA 1T6CA 2IIRA 4KKOA 3AO4A 4BR9A 2Z1GA 3AO5A 2JWLA 2VQEK 3EL2A 2E4LA 2RKIA 4B8CA 2QWNA 4CJ5A 4CJ3A 1XC3A 5J1EA 3A5NC 3JYTA 4DFMA 5AQUA 4H0PA 2DFHA 3OYJA 4FJJA 1A5WA 5EVZA 1WOQA 3C7NB 3M3ZA 4FLTA 5B8HA 3PX0A 4FVMA 4BC4A 3O8MA 2QTDA 1WSGA 3PIOL 3AVKA 4B3SK 2CGLA 4FO0A 2ZM6K 4H5NA 3SK3A 1JJ2M 4BE2A 4B3OA 2F96A 4LH4A 4E7KA 4I9QA 2QXLA 1WLJA 1NGBA 3AA5X 2Q0RA 3ZSRA 1XC9A 3EKSA 1WBDA 3NGZA 3OY9A 3LP1A 2XHBA 1JLEA 3AGKA 1B9DA 3NF6A 4Z4HA 5M1KA 4DV1K 5JMVA 3AVIA 4J2EA 3KLGA 2FF6A 3DRPA 5JLFA 1Q7YO 1V4TA 4DSIA 1YHQN 4O5FA 3EZ5A 1FW6A 1U47A 4KB0A 4V19S 2FBXA 5JS2A 5KPRA 3VMFB 5AQXA 4FZYA 4NYFA 2D0OA 1NGEA 2VG5A 3SBGA 4KHWA 2OANA 2VYPA 3M5RA 3TTFA 5AQPA 2QEXN 2FBVA 1C6VA 2VGNA 1OVQA 4M7YA 4AHUA 4DU4A 4PY5A 4BRLA 4A59A 4EHTA 2CGKA 1K8KA 2P9UA 1SKWA 1ASWA 1JCGA 4FWRA 4WQ5C 2W6KA 2DFEA 4BE1A 3L3VA 3M6GA 4HUGA 4WQ4A 2G8IA 2FSJA 4I2QA 4YOWA 4CF9A 4OKKA 4O8UA 3AA3A 4O8KA 4GVMA 4G1QA 5SWMA 4KHYA 3HPOA 2UXBK 3VEZA 3HM8A 2QXFA 4ID1A 4CJFA 2QM1A 3G10A 3I8DA 4ZTJA 2QWQA 3WEEA 3OYIA 4O4GA 1JLBA 1NBWA 1CXQA 1BISA 2H3GX 4BWMA 3DWLA 3AO3A 1T6DA 2FSNA 3DMJA 3O80A 1E3MA 1NLVA 1HNZK 3O1WA 4DQSA 3TAQA 1BIUA 2FLOA 3O08A 4J2AA 1TYQA 4JN4A 3V1RA 4BRPA 3EZWA 3PX6A 4ID5A 3QO9A 4CESA 1DKGD 1GOAA 3NMUA 4FJ7A 3DI6A 1RTIA 3P1GA 3T1HK 3MN9A 4DFPA 4LF9K 3B8AX 1JLCA 3MN5A 4FLYA 3O4NA 4A57A 3ULEB 1JL2A 4OKEA 3CI5A 4M3RA 2YKMA 4EZ6A 5DMRA 4E7LA 3ALYA 3RMCA 3SAGA 3VESA 2QW9A 1HKGA 1Q9XA 4AM7A 3LWMA 2HHHK 3HXMA 2E20A 3AVNA 2FSKA 4DF8A 1B9FA 3O6WA 3PV8A 2Y1JA 4FLVA 3DYAA 2HBJA 1D5AA 1LWEA 4K41A 1U2VB 2YX6A 4BRIA 4LF8K 4CGHA 3B6PA 3CYMA 5AQVA 4W5OA 1QQMA 4A62A 2O4GA 2BTFA 5EOYA 5C25A 4BDZA 2F8TA 4KBOA 3ZSVA 4H0XB 2IC3A 3CMEN 1FK9A 3V9SA 4EIAA 4EP4A 5BPMA 1TK5A 3V9XA 3EE8A 5AQLA 3VQDA 5M1NA 3N4QA 3VGMA 3VF6A 4IKFA 2NLXA 5FPNA 4F3OA 1S6QA 3KK1A 1N5YA 2CH5A 5F2RA 4JI5K 3Q7CA 2V51B 5DM6L 4CJTA 4H5WA 1YJWN 3L0QA 1J54A 4FLZA 2Z1JA 1S3XA 2YNFA 5AQQA 1Q9YA 3FZMA 4A2AA 1JXEA 4FOEA 3SUPA 4J8FA 2PYLA 3CFRA 4FM0A 1KTQA 3E9OA 4DV5K 3C6UA 3LPUA 4JV5K 3O9QA 3AVJA 3SMPA 5ADXH 4CZLA 1VSKA 2X74A 3F2KA 3ENBA 4MO5A 3HP6A 1C0UA 3TPQA 4CBWA 3VQ8A 3NVMA 5AQSA 2E8AA 4B9LA 1MWKA 4O5BA 3CCSN 2Q2RA 3SJHA 2XY6A 3JAMO 4KI4A 3ZT2A 3JSMA 4BQZA 3MN6A 1LOTB 1Z05A 3U3GA 3I0RA 3UE5A 2W41A 3IKMA 4RW6A 3T1YK 3FE1A 3RR7A 5BR9A 2XY5A 3W3DA 3DOKA 2KTQA 4I9LA 1RCHA 5AZJA 3RVCA 1C0MA 3MDQA 3SUNA 4OPHA 4AHRA 4KI6A 2WOMA 3M8SA 3ULDA 3V9ZA 1BCOA 3CJAA 2HNDA 1VQKN 4CBUA 4BR2A 4AHCA 4BDPA 3A5OC 3KLHA 5IT9O 3MWPA 4I2PA 3C6AA 3CD6N 3C6TA 3BZCA 1KRPA 1ZXOA 1HKCA 3CPEA 2W40A 1RILA 2J4RA 2PFUA 3CFPA 4DR6K 3AA2A 5KI6A 4AILC 1LV5A 1KQSM 2OA8A 5M1QA 3PO5A 3FZFA 2NRHA 3AY9A 1NMNA 4XH4A 3HJFA 4KHQA 4YORA 2ZWHA 4LC9B 3SNNA 4RW8A 1KVCA 4H5RA 3VQAA 1RT1A 2YHAA 1TUUA 2D0BA 1VRTA 1ATSA 5EU7A 4CIGA 4ILGB 3D7EO 2OZSA 3SYZA 2ITMA 2P9SB 1QS4A 3OYBA 3SAHA 4B9QA 2YJEA 3UKRA 4DU3A 4N76A 3FFIA 4AF1A 4O55A 2BANA 4DTSA 3O4WA 2JGUA 2X78A 1GOBA 4OPAA 3G71N 3HOTA 1TAQA 4DR4K 2PBDA 3THXA 3F73A 3NBPA 3V4IA 1XMQK 3E1YA 1HKBA 5BPNA 3ZSQA 2Y1IA 4JK8A 3AARA 2PYJA 4JI0K 3LAKA 4LY7A 1JLAA 5LJVA 3FGUA 2FBYA 4IWVA 1VSFA 1REVA 4BREA 3D0PA 1NGDA 2HW3A 4RWTA 1IV0A 4FYDA 1L3TA 3AGRA 2A1SA 4N56A 4B9TA 1QTMA 3I33A 3CCVN 5AZJB 1M1KO 2PAVA 3OYDA 4BVOA 1LCUA 4GMJB 4KREA 3LM2A 3P39A 4IFVA 3C95A 2NNWA 1RT5A 4DFKA 1XWLA 1UA1A 1NK7A 3ZEUB 3K2PA 1RDAA 2KQ2A 4EHUA 3RWUA 2OPSA 4FJLA 2O8FA 1QQOA 5J2QA 2IVNA 4JI3K 3DXKA 1K9MO 1OVYA 3VEYA 4GV9A 1S6PA 3FFKB 2OPRA 2QWRA 3CPWM 3T69A 5I3UA 3QLHA 4K42A 3WNGA 1ITGA 3WXKA 2WFBA 3D2FA 4CJQA 3RRGA 4JKFA 4CFDA 3MCPA 1R0AA 1RDDA 4I6MB 3R3LA 2UXDK 3ZYYX 3DLRA 1MWMA 4B1UB 1XNQK 1N8RO 5AQIA 3NAEA 4F3TA 1VAZA 2NUBA 3OBWA 4DR7K 3TSPA 5FPMA 2FF3B 1S9GA 1QQCA 3KWIA 2VG7A 4CJRA 3THXB 3QBXA 4C8MA 4NLBA 1W7AA 3EO3A 3CJ7A 3DM2A 1RDUA 4GNIA 1UAXA 1IH7A 5F0XA 1U04A 1HPZA 1SS6A 1FJGK 3H08A 2A42A 3ISNC 2G8VA 2XRIA 2E2NA 2ZQBA 5KGWA 3MX5A 1NKCA 1F21A 3TABA 3TAFA 2GWJA 1KSPA 3SQ2A 4IDHA 1W0HA 4DF4A 1J5OA 1IBMK 2E2OA 1T44A 3THWA 1NOZA 1S22A 3DXMA 1FKPA 2R7YA 4CK3A 3VENA 5GIPA 3WT0A 1RT4A 3LP3A 5C12A 4DLEA 3LDQA 2HF4A 2IDOA 2HBMA 4WQ4C 2RHKA 3TWHA 3DXKB 1UOCA 3M8PA 3CJ9A 1OKJA 3VQCA 4K8ZA 4LH5A 1EQYA 3EKUA 1ZBIA 2NRVA 3D2FB 1VSDA 3QIPA 4R5PA 4LF6K 4ILHA 4QCLA 3SCXA 3BGRA 3EY1A 1BG3A 2ZGYA 5E84A 3QEWA 2YHYA 2ASOA 3C0BA 2YI1A 4PL7A 2P9PA 1RBTA 4EZ9A 4FW1A 2Q3SA 3ZSWA 3LAMA 4BROA 1GOCA 1VK0A 2D0CA 4H03B 3F5TA 4R79A 4CZGA 3V1QA 3AVGA 4DR3K 1KFDA 4NXNK 3CQXA 1T7PA 4Q0BA 5BREA 4YFUA 3VQ9A 2D1KA 4GW6A 3VA0A 1VQ5N 1FXXA 1NM1A 3OVNA 1IJJA 3J80O 4JKAA 2O8EA 4JKGB 4OKJA 1NGAA 4CZMA 1C0TA 1ZBSA 5KTQA 4M3UA 1EP4A 1DTTA 4B9NA 3TAEA 1NK8A 3HYFA 1HUXA 4BG8A 3R9PA 4CF2A 1T03A 1RNHA 3G4SN 4DSFA 3VEVA 3QIOA 2QA4N 4JKEA 3KK3A 4F2RA 4HHTA 4JNEA 2D4WA 1VQON 4IJAA 3CC7N 3KKSA 3CCLN 4X62K 3WUHA 2A6AA 3QEXA 3THWB 4NB4A 4RW9A 4CVNE 4CJ4A 3FZKA 1IKYA 3TAGA 1ZYQA 3DXMB 1YTUA 4CJUA 1S1UA 4W5QA 4E7HA 2P9NA 4Z94A 5C0YA 5E41A 4HVJA 3THYA 1N36K 2P9IA 3BF3A 3WXLA 3B6OA 5CZ1A 1NJXA 4DB3A 4JHDB 4B3RK 4N5SA 4JKBA 3ZSZA 4X65K 2G8WA 4JD2B 1SZ2A 3GG4A 3SQ0A 4DTNA 1GLEG 2KZZA 3WNEA 4BR0A 1NG9A 4WYBA 3VQ5A 3MXIA 3AV9A 4E7JA 3QBWA 1WB9A 2YNGA 3Q7BA 3E01A 3RR8A 2QWPA 2PZSA 1QE1A 3VQ4A 4DSEA 4FWLA 5BRFA 4IO9L 4U67L 2D0PA 4CFBA 4DUYK 1GLJO 1QSYA 4AHVA 3RTVA 4FL9A 4FLXA 5HRRA 3LZJA 3ZSOA 4CEBA 4DQIA 3L2UA 3CCQN 4JLHA 5GAGP 4DFJA 4M63C 1LAWA 5M1FA 3KLEA 5FRNA 4GV6A 4DLGA 4NYNA 3FZLA 4O44A 4FJMA 2HMPA 4CI6A 5T7BA 1TK0A 4K8XA 4PKHA 4TSXA 2O8EB 2HBLA 1K8AO 3WQTA 5JVHL 4FJ8A 2HVIA 3GDQA 3C65A 3U3YA 3QDKA 2Q97A 2B6AA 3V9UA 1H1VA 4AHTA 1D8YA 1C0GA 5C2DA 3F9KA 2KZMA 4LF4K 1NGFA 1SL1A 4FLUA 3HL8A 1XHZA 3CF5L 2F7TA 1X9MA 4C8LA 3SAFA 1KVBA 1RT2A 3NFAA 4CZFA 3L4QA 4FM1A 1XI1A 5H1SQ 4AH9A 3K5LA 4KPYA 3TAPA 4FZZA 2A41A 1O13A 1BDGA 2P9NB 2O8BA 3THYB 4N47A 5JLHA 3V9WA 1YVNA 3EYZA 1L3VA 4HWIA 1TKDA 1GLAG 3HI0A 1RBRA 2WC9A 2BDPA 4LSLA 4CGDA 1S1XA 5FROA 3QERA 4FWKA 3K9KA 4GKKK 1RT7A 3LWLA 2IAJA 4PL8A 4E3SA 3IRXA 3WQUA 4DKWA 3SQ1A 4K0KK 1CZAN 1NGGA 1SL2A 4XH1A 3SBTA 2E5LK 3NVKA 4OO1J 4B08A 2Z1IA 2QKKA
chains in the Genus database with same CATH topology
3ZT4A 4FJKA 4H8KA 4I7FA 3NH2A 3U3GA 3I0RA 3CM5A 1TV6A 4DTPA 4RW6A 2XY8A 4NCBA 3RR7A 3LP2A 3HK2A 1SV5A 2XY5A 2F8SA 2XO7A 1HQEA 1TVRA 1WSIA 4W5NA 3MXMA 3DOKA 2FBTA 3PX4A 4I9LA 4CJVA 3NF7A 2KTQA 2KW4A 3S3MA 1RCHA 4Z4FA 1X1PA 3G0ZA 1FKOA 4JRQA 1A5XA 1TL1A 1C0MA 1DLOA 1KFSA 3AO1A 3SUNA 1HNIA 4RG8A 4O0JA 4AHRA 4OPJA 2ETJA 2WOMA 4LD0A 4XIUA 3M8SA 3NHGA 3SQ4A 4B8AB 3ULDA 1QSLA 3V9ZA 1BCOA 3QEVA 3AVMA 5HP1A 2HNDA 3ZT3A 1NK5A 1HMVA 3K58A 4DQRA 4AHCA 1IKXA 4M45A 4BDPA 2G8FA 3HPHA 1Z25A 4M3WA 1VSIA 3KLHA 4CHQA 3LZIA 4I2PA 2IOCA 3T1AA 1WSJA 5CYMA 1IG9A 3KJVA 4F2SA 4J2DA 3C6TA 3TANA 3DLBA 2KFZA 1KRPA 1SUQA 3OJSA 4QOZB 4BWJA 3VN5A 1A5VA 3AVCA 1J53A 2RF2A 1RILA 4DQQA 3OS1A 3CFPA 4M3XA 4H4OA 3AA2A 4PQUA 3NF8A 5KI6A 3QESA 4AILC 1NJWA 1LV5A 2OA8A 3SZ2A 4KTQA 3PO5A 1T05A 2KFNA 3HM9A 1G15A 3L2WA 4PUOA 4KHQA 3HJFA 1IKVA 5FRMA 1VSHA 4Y1DA 4C8NA 4FJ9A 3SNNA 4RW8A 4CECA 4DSKA 1JLGA 1KVCA 1D9FA 4FJIA 2O4IA 3VQAA 1RT1A 3P83D 1RTDA 1TKZA 2YHAA 4CF8A 2D0BA 1VRTA 5EU7A 4CIGA 4CEZA 3VQPA 1N6QA 1S9EA 4CHNA 4KHSA 2OZSA 4FK4A 4KAZA 3MXJA 1U48A 3SYZA 1ASVA 1QS4A 1LWFA 3V81A 4KHNA 3WNFA 3OYBA 3KKRA 4CJSA 4CJWA 4DTJA 3SUOA 2GV9A 5HLFA 3KIOA 4C8KA 4DU3A 4L8RB 2EHGA 5J2PA 3ASMA 3D45A 4IBNA 1NKEA 4N76A 3FFIA 2VG6A 4DMNA 2DTUA 1L3UA 4O55A 2BANA 4DTSA 2BE2A 2ZD1A 3WNHA 2OPQA 2JGUA 4CHPA 1BIZA 2X78A 1L3SA 1GOBA 1HYZA 3MEEA 5KRSA 2B5JA 1TAQA 1MU2A 3VQEA 2PY5A 4OVLA 3F73A 3NBPA 3V4IA 4FK0A 2YNIA 2VWJA 3ZSQA 3THVA 3NH1A 1RBUA 1TL3A 3P5JA 2Y1IA 2HHTA 3OYCA 1T8EA 1RT6A 1EKEA 2P1JA 1QHTA 1JL1A 1NK4A 2PYJA 4CEAA 4FJXA 4KI6A 3LAKA 3QINA 4CHZA 4LY7A 4KTWA 1HNVA 1JLAA 3LALA 2YHBA 4M3TA 2FBYA 3HVRA 3DRSA 3SUQA 1VSFA 1REVA 3VQQA 2ITGA 3NGIA 3D0PA 2HW3A 4HUEA 4DTUA 4FYDA 1EETA 3SPYA 3PUFA 5KRTA 1L3TA 1WN7A 2A1SA 4N56A 2W42A 4E0DA 4FK2A 4KRFA 4B9TA 1K6YA 1QTMA 1BGXT 4LSNA 4CFCA 4Z4EA 3VQ6A 1NJZA 1NKBA 1YVUA 3MEGA 1JLQA 3KTQA 2E6LA 3ZCMA 3OYDA 3OYAA 3KLFA 4ELTA 3HPGA 3VQ7A 4ELUA 1WAFA 4GMJB 1NK9A 4OLBA 1J9AA 4KREA 3QEIA 3RMAA 3DRRA 4IFVA 5CZ2A 3AVBA 3C95A 3K59A 4MFBA 1BI4A 3S9HA 1RT5A 4DFKA 4DWIA 1C1CA 3KLIA 1BQNA 3IG1A 1TKTA 1XWLA 2DFFA 1UA1A 1NK7A 4PA1A 1Y97A 3K2PA 4CHYA 1RDAA 4FM2A 1D9DA 2KQ2A 3L2VA 2P5GA 3RWUA 2HB5A 2OPSA 4DTOA 2JLEA 4FJLA 4IFYA 1I3AA 1NK6A 2P5OA 5HROA 4M41A 1X9WA 1CXUA 1VSLA 5J2QA 3VQBA 2ATQA 3QNOA 3DLEA 1CZBA 1ZBLA 2G8HA 3DLHA 4FXDA 2HHQA 4CCHA 1IO2A 5C24A 3O3GA 1S1TA 1TK8A 4B9VA 2HNYA 3SJJA 3SPZA 1NJYA 1S6PA 1BL3A 5CY4A 2OPRA 1RDCA 4HCBA 1HYSA 3K57A 4FJ5A 1RBSA 4HUFA 3QLHA 5I3UA 3AVHA 3WNGA 4KV8A 4KKOA 1ITGA 3AO4A 4Z4GA 1ZBHA 5J2MA 4CJQA 4N41A 4ICLA 2Z1GA 1C1AA 3L2QA 3RRGA 2HHXA 4BE0A 4CFDA 3ZSYA 1C1BA 3AO5A 1R0AA 1JXBA 1RDDA 4DQPA 3NDKA 4JS4A 1KLMA 2E4LA 3DLRA 2RKIA 4CGIA 4Y1CA 1LWCA 4B8CA 4W5TA 4F8RA 4CJ5A 4CJ3A 5J1EA 3NAEA 3JYTA 2NUBA 4DFMA 4F3TA 4CEFA 1QSSA 4H4MA 4FJHA 2DFHA 3OYJA 4FJJA 4O0IA 1X9SA 4KHUA 3T3FA 4B9SA 1A5WA 5CYQA 4JRPA 1S9GA 1QQCA 4CJRA 2VG7A 1NK0A 4FLTA 3PX0A 2AJQA 4C8MA 4FVMA 3ZSXA 3OS2A 1CZ9A 4YNQA 1WSGA 3DM2A 3TI0A 1UAXA 1IH7A 1VRUA 2HVHA 3AVKA 2G8UA 4FZXC 1U04A 1LW0A 1HPZA 4BE2A 4B3OA 3H08A 2F96A 2HHWA 4LH4A 4E7KA 4I9QA 3TARA 1WLJA 3ISNC 2OYQA 2OPPA 4CJLA 3AA5X 4NCGA 1SL0A 2G8VA 2XRIA 2ZQBA 5KGWA 4CE9A 4KB1A 4DSJA 1NKCA 3ZSRA 4FLWA 1F21A 3IS9A 3TABA 1XC9A 4IDKA 4HTUA 4DTMA 3NGZA 3OY9A 3TAFA 3LP1A 2XHBA 1JLEA 2GBZA 5I42A 1KSPA 1B9DA 3NF6A 5HRNA 3OYGA 3HP9A 3HVTA 4Z4HA 3SQ2A 3AVIA 4J2EA 4E89A 1W0HA 3KLGA 3DRPA 4DSLA 4DF4A 1J5OA 3C94A 1BHLA 4BDYA 4CF0A 2A1RA 4J2BA 4E1MA 4DSIA 3EZ5A 1NOZA 1U47A 4KB0A 2FBXA 5JS2A 1DTQA 4CK2A 1FKPA 3DOLA 2R7YA 3T19A 4CK3A 2HMIA 4FZYA 3OYHA 1KVAA 4NYFA 4PWDA 1I39A 1SKRA 1RT4A 3LP3A 2G8KA 4KFBA 4CEEA 3IAYA 1YTAA 5FDLA 2VG5A 4DLEA 4KHWA 1WSEA 2IDOA 3TWHA 2FBVA 1C6VA 4W5RA 1UOCA 3M8PA 1Q8IA 4B9UA 3OS0A 4AHUA 4DU4A 1NOYA 4PY5A 2E6MA 3VQCA 4WE1A 5HRPA 4CJPA 4K8ZA 4LH5A 1SKWA 1ASWA 2DFEA 4BE1A 3L3VA 2IGIA 1ZBIA 4HUGA 1VSDA 3QIPA 4R5PA 1S5JA 2G8IA 4I2QA 2Z1HA 4CF9A 1U49A 2VWKA 4M3YA 4OKKA 4QCLA 3SCXA 3KD5E 3BGRA 3AA3A 3EY1A 2OZMA 4GVMA 4G1QA 5SWMA 3QEWA 4KHYA 4OJRA 3V1OA 1SKSA 3HPOA 3TAMA 1RBTA 4EZ9A 3K5MA 4FW1A 2HNZA 2Q3SA 4BACA 1UWBA 3ZSWA 2QXFA 3LAMA 1GOCA 1S1VA 1VK0A 4ID1A 4CJFA 2D0CA 3HO1A 1HRHA 2HHVA 3S3OA 2GUIA 3G10A 3V1QA 3I0SA 3AVGA 4CGGA 4DS4A 1Z26A 3I8DA 1KFDA 2ZE2A 3MEDA 4B9MA 4NCAA 4ZTJA 1T7PA 4Q0BA 4YFUA 3VQ9A 4CGFA 3OYIA 4O4GA 1JLBA 3O3HA 4DU1A 1CXQA 4GW6A 1BQMA 3VA0A 1FXXA 3OVNA 1BISA 5JS1A 3LP0A 4BWMA 3OYNA 4OGEA 4KO0A 3NH0A 3AO3A 3SV3A 1L5UA 1TAUA 5HBMA 4IG3A 3DMJA 3L8BA 3QNNA 4OKJA 2RN2A 1C0TA 4DQSA 3TAQA 1BIUA 4FJNA 1RTJA 3ITHA 5KTQA 4HCCA 4M3UA 1EP4A 4J2AA 1DTTA 4B9NA 3LPTA 4CGJA 3TAEA 3HYFA 3V1RA 1NK8A 4QAGA 4CF2A 3QETA 1T03A 1RNHA 4DSFA 4ID5A 1TKXA 3PX6A 3QIOA 1LW2A 1WSHA 3QO9A 4CESA 3AVFA 1GOAA 2I5JA 1S1WA 3OYLA 4FJ7A 3DI6A 3KK3A 4CK1A 3O3FA 4F2RA 4RW4A 1RTIA 3P1GA 4HHTA 4EP5A 3DLGA 4DFPA 3KKSA 3MECA 1JLCA 3AVAA 2B4JA 4FLYA 4CEQA 3O4NA 4OGCA 3CQ8A 3QEXA 3SI6A 1JL2A 2FC0A 4RW9A 4OKEA 1ASUA 3L2RA 4CJ4A 2P51A 1IKYA 3TAGA 1ZYQA 3BDPA 1RDBA 4M3RA 1YTUA 2YKMA 4DTXA 3VA3A 4CJUA 1S1UA 4EZ6A 5DMRA 4W5QA 4E7HA 4RW7A 4E7LA 2QKBA 3ALYA 5E41A 3ZT1A 4HVJA 3RMCA 4ZTFA 3OYKA 4FW2A 1Q9XA 3B6OA 5CZ1A 1VSMA 4CEOA 4UQGA 4FCYA 3OYEA 1NJXA 1HQUA 4N5SA 4C8OA 1U45A 5D3GA 2HHUA 3LWMA 4ELVA 3ZSZA 4CF1A 2G8WA 3HXMA 3SQ0A 4Q5VA 3AVNA 3OYFA 4DF8A 1B9FA 4DTNA 5K14A 3PV8A 3LANA 2Y1JA 2LSNA 4FLVA 2KZZA 4Z0UA 3DYAA 5HRSA 4OPKA 1D5AA 1LWEA 3TR8A 1B92A 3WNEA 3K5NA 4CEDA 1WSFA 3VQ5A 3CG7A 4CGHA 3B6PA 3MXIA 3AV9A 4E7JA 1ZBFA 5J2NA 3CYMA 2YNGA 1VSEA 1TGOA 3E01A 4W5OA 3RR8A 2PZSA 1QE1A 2IS3A 3VQ4A 2O4GA 4E1NA 4DSEA 1BI4B 3U6FA 3PO4A 5C25A 4CFBA 1BCMA 4F4KA 2DY4A 1ZBUA 1HJRA 3KK2A 4BDZA 1QSYA 3ZSVA 4CHOA 2F8TA 4AHVA 3RTVA 2QK9A 2IC3A 4E19A 2YV0X 4MQ3A 4FLXA 5HRRA 3LZJA 3ZSOA 1FK9A 4CEBA 3L2UA 4DQIA 3V9SA 3M8QA 5KGXA 4JLHA 1VSJA 1RBVA 4DFJA 1LAWA 4CIEA 3KLEA 5FRNA 4EP4A 1O1WA 2BGGA 4DLGA 1LAVA 4NYNA 1JKHA 4O44A 1TK5A 4FJMA 4Z4IA 3V9XA 5C42A 3O4QA 3DLKA 3V6DA 3VQDA 3KD1E 5T7BA 1TK0A 4K8XA 4OLAA 4CERA 4TSXA 3AO2A 4DS5A 4M42A 4DG1A 3LDSA 1HYVA 3NCIA 3OYMA 3HT3A 3CFOA 4IKFA 3RMDA 4FJ8A 2HVIA 4F3OA 2RPIA 3U3YA 1S6QA 3KK1A 2B6AA 3V9UA 2HHSA 1N5YA 1RT3A 3CM6A 4AHTA 4CJKA 3PY8A 1D8YA 4CFAA 3AVLA 3F9KA 2KZMA 3S3NA 4CJTA 1SL1A 4FLUA 3K5OA 3HL8A 1XHZA 3MAQA 4ZHRA 3AA4A 1WAJA 2YNHA 3SV4A 1J54A 3OJUA 1X9MA 4C8LA 1KVBA 4FLZA 4M3ZA 2Z1JA 1RT2A 2YKNA 4FJGA 2YNFA 3NFAA 4DTRA 2D0AA 3M8RA 1UA0A 3L3UA 1Q9YA 4FM1A 1XI1A 1JXEA 4AH9A 3SUPA 3K5LA 4KPYA 3TAPA 4FZZA 3NGYA 1RTHA 1XHXA 1W9HA 2PYLA 4IG0A 5DK5A 1JLFA 1WNSA 3NF9A 3CFRA 1KTQA 3HSTB 3NE6A 4FM0A 4N47A 3V9WA 1KCFA 3A2FA 4KTZA 2X6NA 3EYZA 3C6UA 3UIQA 3LPUA 1YT3A 1KLNA 3AVJA 4JS5A 1L3VA 1EXQA 1TKDA 4CJEA 1VSKA 2X74A 1RBRA 2X6SA 4E7IA 3HP6A 1C0UA 1U4BA 2BDPA 4Z4CA 4LSLA 4CGDA 1EX4A 1S1XA 5FROA 3VQ8A 4B9LA 1IKWA 3QERA 4O5BA 2D5RA 1RT7A 3QEPA 3LWLA 2IAJA 5SZTA 3ZT0A 3RRHA 2EX3A 2WONA 4E3SA 3IRXA 3SQ1A 1CLQA 4AHSA 4CIFA 2XY6A 4KI4A 1SL2A 3ZT2A 3JSMA 3RMBA 2XY7A 4B08A 2Z1IA 2QKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT4 A;  4FJK A;  4H8K A;  4I7F A;  3NH2 A;  3U3G A;  3I0R A;  3CM5 A;  1TV6 A;  4DTP A;  4RW6 A;  2XY8 A;  4NCB A;  3RR7 A;  3LP2 A;  3HK2 A;  1SV5 A;  2XY5 A;  2F8S A;  2XO7 A;  1HQE A;  1TVR A;  1WSI A;  4W5N A;  3MXM A;  3DOK A;  2FBT A;  3PX4 A;  4I9L A;  4CJV A;  3NF7 A;  2KTQ A;  2KW4 A;  3S3M A;  1RCH A;  4Z4F A;  1X1P A;  3G0Z A;  1FKO A;  4JRQ A;  1A5X A;  1TL1 A;  1C0M A;  1DLO A;  1KFS A;  3AO1 A;  3SUN A;  1HNI A;  4RG8 A;  4O0J A;  4AHR A;  4OPJ A;  2ETJ A;  2WOM A;  4LD0 A;  4XIU A;  3M8S A;  3NHG A;  3SQ4 A;  4B8A B;  3ULD A;  1QSL A;  3V9Z A;  1BCO A;  3QEV A;  3AVM A;  5HP1 A;  2HND A;  3ZT3 A;  1NK5 A;  1HMV A;  3K58 A;  4DQR A;  4AHC A;  1IKX A;  4M45 A;  4BDP A;  2G8F A;  3HPH A;  1Z25 A;  4M3W A;  1VSI A;  3KLH A;  4CHQ A;  3LZI A;  4I2P A;  2IOC A;  3T1A A;  1WSJ A;  5CYM A;  1IG9 A;  3KJV A;  4F2S A;  4J2D A;  3C6T A;  3TAN A;  3DLB A;  2KFZ A;  1KRP A;  1SUQ A;  3OJS A;  4QOZ B;  4BWJ A;  3VN5 A;  1A5V A;  3AVC A;  1J53 A;  2RF2 A;  1RIL A;  4DQQ A;  3OS1 A;  3CFP A;  4M3X A;  4H4O A;  3AA2 A;  4PQU A;  3NF8 A;  5KI6 A;  3QES A;  4AIL C;  1NJW A;  1LV5 A;  2OA8 A;  3SZ2 A;  4KTQ A;  3PO5 A;  1T05 A;  2KFN A;  3HM9 A;  1G15 A;  3L2W A;  4PUO A;  4KHQ A;  3HJF A;  1IKV A;  5FRM A;  1VSH A;  4Y1D A;  4C8N A;  4FJ9 A;  3SNN A;  4RW8 A;  4CEC A;  4DSK A;  1JLG A;  1KVC A;  1D9F A;  4FJI A;  2O4I A;  3VQA A;  1RT1 A;  3P83 D;  1RTD A;  1TKZ A;  2YHA A;  4CF8 A;  2D0B A;  1VRT A;  5EU7 A;  4CIG A;  4CEZ A;  3VQP A;  1N6Q A;  1S9E A;  4CHN A;  4KHS A;  2OZS A;  4FK4 A;  4KAZ A;  3MXJ A;  1U48 A;  3SYZ A;  1ASV A;  1QS4 A;  1LWF A;  3V81 A;  4KHN A;  3WNF A;  3OYB A;  3KKR A;  4CJS A;  4CJW A;  4DTJ A;  3SUO A;  2GV9 A;  5HLF A;  3KIO A;  4C8K A;  4DU3 A;  4L8R B;  2EHG A;  5J2P A;  3ASM A;  3D45 A;  4IBN A;  1NKE A;  4N76 A;  3FFI A;  2VG6 A;  4DMN A;  2DTU A;  1L3U A;  4O55 A;  2BAN A;  4DTS A;  2BE2 A;  2ZD1 A;  3WNH A;  2OPQ A;  2JGU A;  4CHP A;  1BIZ A;  2X78 A;  1L3S A;  1GOB A;  1HYZ A;  3MEE A;  5KRS A;  2B5J A;  1TAQ A;  1MU2 A;  3VQE A;  2PY5 A;  4OVL A;  3F73 A;  3NBP A;  3V4I A;  4FK0 A;  2YNI A;  2VWJ A;  3ZSQ A;  3THV A;  3NH1 A;  1RBU A;  1TL3 A;  3P5J A;  2Y1I A;  2HHT A;  3OYC A;  1T8E A;  1RT6 A;  1EKE A;  2P1J A;  1QHT A;  1JL1 A;  1NK4 A;  2PYJ A;  4CEA A;  4FJX A;  4KI6 A;  3LAK A;  3QIN A;  4CHZ A;  4LY7 A;  4KTW A;  1HNV A;  1JLA A;  3LAL A;  2YHB A;  4M3T A;  2FBY A;  3HVR A;  3DRS A;  3SUQ A;  1VSF A;  1REV A;  3VQQ A;  2ITG A;  3NGI A;  3D0P A;  2HW3 A;  4HUE A;  4DTU A;  4FYD A;  1EET A;  3SPY A;  3PUF A;  5KRT A;  1L3T A;  1WN7 A;  2A1S A;  4N56 A;  2W42 A;  4E0D A;  4FK2 A;  4KRF A;  4B9T A;  1K6Y A;  1QTM A;  1BGX T;  4LSN A;  4CFC A;  4Z4E A;  3VQ6 A;  1NJZ A;  1NKB A;  1YVU A;  3MEG A;  1JLQ A;  3KTQ A;  2E6L A;  3ZCM A;  3OYD A;  3OYA A;  3KLF A;  4ELT A;  3HPG A;  3VQ7 A;  4ELU A;  1WAF A;  4GMJ B;  1NK9 A;  4OLB A;  1J9A A;  4KRE A;  3QEI A;  3RMA A;  3DRR A;  4IFV A;  5CZ2 A;  3AVB A;  3C95 A;  3K59 A;  4MFB A;  1BI4 A;  3S9H A;  1RT5 A;  4DFK A;  4DWI A;  1C1C A;  3KLI A;  1BQN A;  3IG1 A;  1TKT A;  1XWL A;  2DFF A;  1UA1 A;  1NK7 A;  4PA1 A;  1Y97 A;  3K2P A;  4CHY A;  1RDA A;  4FM2 A;  1D9D A;  2KQ2 A;  3L2V A;  2P5G A;  3RWU A;  2HB5 A;  2OPS A;  4DTO A;  2JLE A;  4FJL A;  4IFY A;  1I3A A;  1NK6 A;  2P5O A;  5HRO A;  4M41 A;  1X9W A;  1CXU A;  1VSL A;  5J2Q A;  3VQB A;  2ATQ A;  3QNO A;  3DLE A;  1CZB A;  1ZBL A;  2G8H A;  3DLH A;  4FXD A;  2HHQ A;  4CCH A;  1IO2 A;  5C24 A;  3O3G A;  1S1T A;  1TK8 A;  4B9V A;  2HNY A;  3SJJ A;  3SPZ A;  1NJY A;  1S6P A;  1BL3 A;  5CY4 A;  2OPR A;  1RDC A;  4HCB A;  1HYS A;  3K57 A;  4FJ5 A;  1RBS A;  4HUF A;  3QLH A;  5I3U A;  3AVH A;  3WNG A;  4KV8 A;  4KKO A;  1ITG A;  3AO4 A;  4Z4G A;  1ZBH A;  5J2M A;  4CJQ A;  4N41 A;  4ICL A;  2Z1G A;  1C1A A;  3L2Q A;  3RRG A;  2HHX A;  4BE0 A;  4CFD A;  3ZSY A;  1C1B A;  3AO5 A;  1R0A A;  1JXB A;  1RDD A;  4DQP A;  3NDK A;  4JS4 A;  1KLM A;  2E4L A;  3DLR A;  2RKI A;  4CGI A;  4Y1C A;  1LWC A;  4B8C A;  4W5T A;  4F8R A;  4CJ5 A;  4CJ3 A;  5J1E A;  3NAE A;  3JYT A;  2NUB A;  4DFM A;  4F3T A;  4CEF A;  1QSS A;  4H4M A;  4FJH A;  2DFH A;  3OYJ A;  4FJJ A;  4O0I A;  1X9S A;  4KHU A;  3T3F A;  4B9S A;  1A5W A;  5CYQ A;  4JRP A;  1S9G A;  1QQC A;  4CJR A;  2VG7 A;  1NK0 A;  4FLT A;  3PX0 A;  2AJQ A;  4C8M A;  4FVM A;  3ZSX A;  3OS2 A;  1CZ9 A;  4YNQ A;  1WSG A;  3DM2 A;  3TI0 A;  1UAX A;  1IH7 A;  1VRU A;  2HVH A;  3AVK A;  2G8U A;  4FZX C;  1U04 A;  1LW0 A;  1HPZ A;  4BE2 A;  4B3O A;  3H08 A;  2F96 A;  2HHW A;  4LH4 A;  4E7K A;  4I9Q A;  3TAR A;  1WLJ A;  3ISN C;  2OYQ A;  2OPP A;  4CJL A;  3AA5 X;  4NCG A;  1SL0 A;  2G8V A;  2XRI A;  2ZQB A;  5KGW A;  4CE9 A;  4KB1 A;  4DSJ A;  1NKC A;  3ZSR A;  4FLW A;  1F21 A;  3IS9 A;  3TAB A;  1XC9 A;  4IDK A;  4HTU A;  4DTM A;  3NGZ A;  3OY9 A;  3TAF A;  3LP1 A;  2XHB A;  1JLE A;  2GBZ A;  5I42 A;  1KSP A;  1B9D A;  3NF6 A;  5HRN A;  3OYG A;  3HP9 A;  3HVT A;  4Z4H A;  3SQ2 A;  3AVI A;  4J2E A;  4E89 A;  1W0H A;  3KLG A;  3DRP A;  4DSL A;  4DF4 A;  1J5O A;  3C94 A;  1BHL A;  4BDY A;  4CF0 A;  2A1R A;  4J2B A;  4E1M A;  4DSI A;  3EZ5 A;  1NOZ A;  1U47 A;  4KB0 A;  2FBX A;  5JS2 A;  1DTQ A;  4CK2 A;  1FKP A;  3DOL A;  2R7Y A;  3T19 A;  4CK3 A;  2HMI A;  4FZY A;  3OYH A;  1KVA A;  4NYF A;  4PWD A;  1I39 A;  1SKR A;  1RT4 A;  3LP3 A;  2G8K A;  4KFB A;  4CEE A;  3IAY A;  1YTA A;  5FDL A;  2VG5 A;  4DLE A;  4KHW A;  1WSE A;  2IDO A;  3TWH A;  2FBV A;  1C6V A;  4W5R A;  1UOC A;  3M8P A;  1Q8I A;  4B9U A;  3OS0 A;  4AHU A;  4DU4 A;  1NOY A;  4PY5 A;  2E6M A;  3VQC A;  4WE1 A;  5HRP A;  4CJP A;  4K8Z A;  4LH5 A;  1SKW A;  1ASW A;  2DFE A;  4BE1 A;  3L3V A;  2IGI A;  1ZBI A;  4HUG A;  1VSD A;  3QIP A;  4R5P A;  1S5J A;  2G8I A;  4I2Q A;  2Z1H A;  4CF9 A;  1U49 A;  2VWK A;  4M3Y A;  4OKK A;  4QCL A;  3SCX A;  3KD5 E;  3BGR A;  3AA3 A;  3EY1 A;  2OZM A;  4GVM A;  4G1Q A;  5SWM A;  3QEW A;  4KHY A;  4OJR A;  3V1O A;  1SKS A;  3HPO A;  3TAM A;  1RBT A;  4EZ9 A;  3K5M A;  4FW1 A;  2HNZ A;  2Q3S A;  4BAC A;  1UWB A;  3ZSW A;  2QXF A;  3LAM A;  1GOC A;  1S1V A;  1VK0 A;  4ID1 A;  4CJF A;  2D0C A;  3HO1 A;  1HRH A;  2HHV A;  3S3O A;  2GUI A;  3G10 A;  3V1Q A;  3I0S A;  3AVG A;  4CGG A;  4DS4 A;  1Z26 A;  3I8D A;  1KFD A;  2ZE2 A;  3MED A;  4B9M A;  4NCA A;  4ZTJ A;  1T7P A;  4Q0B A;  4YFU A;  3VQ9 A;  4CGF A;  3OYI A;  4O4G A;  1JLB A;  3O3H A;  4DU1 A;  1CXQ A;  4GW6 A;  1BQM A;  3VA0 A;  1FXX A;  3OVN A;  1BIS A;  5JS1 A;  3LP0 A;  4BWM A;  3OYN A;  4OGE A;  4KO0 A;  3NH0 A;  3AO3 A;  3SV3 A;  1L5U A;  1TAU A;  5HBM A;  4IG3 A;  3DMJ A;  3L8B A;  3QNN A;  4OKJ A;  2RN2 A;  1C0T A;  4DQS A;  3TAQ A;  1BIU A;  4FJN A;  1RTJ A;  3ITH A;  5KTQ A;  4HCC A;  4M3U A;  1EP4 A;  4J2A A;  1DTT A;  4B9N A;  3LPT A;  4CGJ A;  3TAE A;  3HYF A;  3V1R A;  1NK8 A;  4QAG A;  4CF2 A;  3QET A;  1T03 A;  1RNH A;  4DSF A;  4ID5 A;  1TKX A;  3PX6 A;  3QIO A;  1LW2 A;  1WSH A;  3QO9 A;  4CES A;  3AVF A;  1GOA A;  2I5J A;  1S1W A;  3OYL A;  4FJ7 A;  3DI6 A;  3KK3 A;  4CK1 A;  3O3F A;  4F2R A;  4RW4 A;  1RTI A;  3P1G A;  4HHT A;  4EP5 A;  3DLG A;  4DFP A;  3KKS A;  3MEC A;  1JLC A;  3AVA A;  2B4J A;  4FLY A;  4CEQ A;  3O4N A;  4OGC A;  3CQ8 A;  3QEX A;  3SI6 A;  1JL2 A;  2FC0 A;  4RW9 A;  4OKE A;  1ASU A;  3L2R A;  4CJ4 A;  2P51 A;  1IKY A;  3TAG A;  1ZYQ A;  3BDP A;  1RDB A;  4M3R A;  1YTU A;  2YKM A;  4DTX A;  3VA3 A;  4CJU A;  1S1U A;  4EZ6 A;  5DMR A;  4W5Q A;  4E7H A;  4RW7 A;  4E7L A;  2QKB A;  3ALY A;  5E41 A;  3ZT1 A;  4HVJ A;  3RMC A;  4ZTF A;  3OYK A;  4FW2 A;  1Q9X A;  3B6O A;  5CZ1 A;  1VSM A;  4CEO A;  4UQG A;  4FCY A;  3OYE A;  1NJX A;  1HQU A;  4N5S A;  4C8O A;  1U45 A;  5D3G A;  2HHU A;  3LWM A;  4ELV A;  3ZSZ A;  4CF1 A;  2G8W A;  3HXM A;  3SQ0 A;  4Q5V A;  3AVN A;  3OYF A;  4DF8 A;  1B9F A;  4DTN A;  5K14 A;  3PV8 A;  3LAN A;  2Y1J A;  2LSN A;  4FLV A;  2KZZ A;  4Z0U A;  3DYA A;  5HRS A;  4OPK A;  1D5A A;  1LWE A;  3TR8 A;  1B92 A;  3WNE A;  3K5N A;  4CED A;  1WSF A;  3VQ5 A;  3CG7 A;  4CGH A;  3B6P A;  3MXI A;  3AV9 A;  4E7J A;  1ZBF A;  5J2N A;  3CYM A;  2YNG A;  1VSE A;  1TGO A;  3E01 A;  4W5O A;  3RR8 A;  2PZS A;  1QE1 A;  2IS3 A;  3VQ4 A;  2O4G A;  4E1N A;  4DSE A;  1BI4 B;  3U6F A;  3PO4 A;  5C25 A;  4CFB A;  1BCM A;  4F4K A;  2DY4 A;  1ZBU A;  1HJR A;  3KK2 A;  4BDZ A;  1QSY A;  3ZSV A;  4CHO A;  2F8T A;  4AHV A;  3RTV A;  2QK9 A;  2IC3 A;  4E19 A;  2YV0 X;  4MQ3 A;  4FLX A;  5HRR A;  3LZJ A;  3ZSO A;  1FK9 A;  4CEB A;  3L2U A;  4DQI A;  3V9S A;  3M8Q A;  5KGX A;  4JLH A;  1VSJ A;  1RBV A;  4DFJ A;  1LAW A;  4CIE A;  3KLE A;  5FRN A;  4EP4 A;  1O1W A;  2BGG A;  4DLG A;  1LAV A;  4NYN A;  1JKH A;  4O44 A;  1TK5 A;  4FJM A;  4Z4I A;  3V9X A;  5C42 A;  3O4Q A;  3DLK A;  3V6D A;  3VQD A;  3KD1 E;  5T7B A;  1TK0 A;  4K8X A;  4OLA A;  4CER A;  4TSX A;  3AO2 A;  4DS5 A;  4M42 A;  4DG1 A;  3LDS A;  1HYV A;  3NCI A;  3OYM A;  3HT3 A;  3CFO A;  4IKF A;  3RMD A;  4FJ8 A;  2HVI A;  4F3O A;  2RPI A;  3U3Y A;  1S6Q A;  3KK1 A;  2B6A A;  3V9U A;  2HHS A;  1N5Y A;  1RT3 A;  3CM6 A;  4AHT A;  4CJK A;  3PY8 A;  1D8Y A;  4CFA A;  3AVL A;  3F9K A;  2KZM A;  3S3N A;  4CJT A;  1SL1 A;  4FLU A;  3K5O A;  3HL8 A;  1XHZ A;  3MAQ A;  4ZHR A;  3AA4 A;  1WAJ A;  2YNH A;  3SV4 A;  1J54 A;  3OJU A;  1X9M A;  4C8L A;  1KVB A;  4FLZ A;  4M3Z A;  2Z1J A;  1RT2 A;  2YKN A;  4FJG A;  2YNF A;  3NFA A;  4DTR A;  2D0A A;  3M8R A;  1UA0 A;  3L3U A;  1Q9Y A;  4FM1 A;  1XI1 A;  1JXE A;  4AH9 A;  3SUP A;  3K5L A;  4KPY A;  3TAP A;  4FZZ A;  3NGY A;  1RTH A;  1XHX A;  1W9H A;  2PYL A;  4IG0 A;  5DK5 A;  1JLF A;  1WNS A;  3NF9 A;  3CFR A;  1KTQ A;  3HST B;  3NE6 A;  4FM0 A;  4N47 A;  3V9W A;  1KCF A;  3A2F A;  4KTZ A;  2X6N A;  3EYZ A;  3C6U A;  3UIQ A;  3LPU A;  1YT3 A;  1KLN A;  3AVJ A;  4JS5 A;  1L3V A;  1EXQ A;  1TKD A;  4CJE A;  1VSK A;  2X74 A;  1RBR A;  2X6S A;  4E7I A;  3HP6 A;  1C0U A;  1U4B A;  2BDP A;  4Z4C A;  4LSL A;  4CGD A;  1EX4 A;  1S1X A;  5FRO A;  3VQ8 A;  4B9L A;  1IKW A;  3QER A;  4O5B A;  2D5R A;  1RT7 A;  3QEP A;  3LWL A;  2IAJ A;  5SZT A;  3ZT0 A;  3RRH A;  2EX3 A;  2WON A;  4E3S A;  3IRX A;  3SQ1 A;  1CLQ A;  4AHS A;  4CIF A;  2XY6 A;  4KI4 A;  1SL2 A;  3ZT2 A;  3JSM A;  3RMB A;  2XY7 A;  4B08 A;  2Z1I A;  2QKK A; 
#chains in the Genus database with same CATH topology
 4H8K A;  2QWL A;  4I7F A;  3UKU A;  4DTP A;  3W0L A;  4A5A A;  4NCB A;  3LP2 A;  2XO7 A;  1TVR A;  3H46 O;  3A5L C;  3MXM A;  3PX4 A;  2FBT A;  1ATN A;  3TU5 A;  3NF7 A;  3S3M A;  3G0Z A;  2YHX A;  1KFS A;  3AO1 A;  4O0J A;  3SQ4 A;  2ETJ A;  4LD0 A;  5M1O A;  4H0Y B;  4B8A B;  3QEV A;  3JXU A;  4DQR A;  3K58 A;  4M45 A;  2VQF K;  1VQ4 N;  5AJ3 K;  4FVU A;  5KQD A;  3HPH A;  4M3W A;  1VSI A;  1K8K B;  2P9U B;  1WSJ A;  2VCP A;  5CYM A;  3TAN A;  4LFB K;  5BN9 A;  1M90 O;  1SUQ A;  3OJS A;  4QOZ B;  2GTD A;  3AVC A;  2RF2 A;  4H4O A;  1G99 A;  1BO5 O;  4KTQ A;  1BA0 A;  4AQY K;  1T05 A;  2KFN A;  1MDU B;  1G15 A;  4FWN A;  4BG9 A;  1VSH A;  4Y1D A;  2W6L A;  4FJI A;  2O4I A;  3ZX0 A;  4CF8 A;  1OH8 A;  4L3Q A;  3VQP A;  1N6Q A;  4CHN A;  2O8B B;  4KAZ A;  2UYT A;  3VGL A;  3WEE B;  2Q36 A;  3LDO A;  5AQW A;  3WNF A;  4L8R B;  4C8K A;  3KIO A;  1NKE A;  5LL6 Z;  4DQ8 A;  4K43 A;  1L3U A;  3K9J A;  2HBK A;  3WNH A;  4CHP A;  1BIZ A;  3MEE A;  3VER A;  3ZET A;  4FK0 A;  2YNI A;  1TYQ B;  1YF5 L;  3PLA A;  5AR0 A;  3QB0 A;  3OYC A;  3MX2 A;  1EKE A;  1BU6 O;  2P1J A;  1QHT A;  1JL1 A;  1NK4 A;  4CHZ A;  1HLU A;  1P8Z A;  4QS8 A;  3SUQ A;  2HST A;  3VQQ A;  1EET A;  3PUF A;  1NJI O;  3TSU A;  4FK2 A;  5DM7 L;  3H3N O;  4CFC A;  4Z4E A;  2UUB K;  3VQ6 A;  3MEG A;  1KXP A;  4CD3 A;  2E6L A;  3ZCM A;  3KLF A;  3HPG A;  1WAF A;  4OLB A;  3RMA A;  2Q0U A;  4B1Y B;  5JIC A;  4IOX A;  3AVB A;  3K59 A;  1NWK A;  1KD1 O;  4MFB A;  1BI4 A;  1NU0 A;  1C1C A;  1OH7 A;  2DFF A;  3A0I X;  4JI7 K;  3O9U A;  4LF7 K;  3UB5 A;  4DR5 K;  4CHY A;  4H5V A;  4FM2 A;  2HB5 A;  4IFY A;  1Q18 A;  4DR2 K;  1X9W A;  1CXU A;  5EXW A;  3OA9 A;  5C10 A;  3DLH A;  4CCH A;  1DT9 A;  1TK8 A;  2HNY A;  3SPZ A;  4DV6 K;  2P9K A;  1RDC A;  4WFN L;  4KV8 A;  2E1Y A;  5J2M A;  4FWP A;  4N41 A;  4H0O A;  4ICL A;  3L2Q A;  3H45 C;  3FR0 A;  3ZSY A;  1C1B A;  1YJ9 N;  3O1B A;  3NDK A;  4CGI A;  5LY3 A;  2OTJ N;  4Y1C A;  1LWC A;  4A5B A;  4CEF A;  2A40 A;  1QSS A;  4FJH A;  3ID6 A;  3KK7 A;  4O0I A;  3T3F A;  4B9S A;  1NK0 A;  3ZET B;  2UUC K;  1SQK A;  3PSI A;  3OS2 A;  4YNQ A;  3C6H A;  3U9D A;  3CQY A;  4BRM A;  3TI0 A;  2HVH A;  1VRU A;  3L6Q A;  2G8U A;  4FZX C;  1LW0 A;  4BRN A;  1KAY A;  2NRT A;  3TSQ A;  3CCR N;  3TAR A;  3E9P A;  2OYQ A;  1RGI A;  2OPP A;  4CJL A;  4JYA K;  1SL0 A;  3QFP A;  4CE9 A;  4KB1 A;  4NXM K;  4JK7 A;  1VQL N;  3IS9 A;  1VQ8 N;  4HTU A;  2ASP A;  4DTM A;  4JEP A;  2WTU A;  5I42 A;  5HRN A;  3OYG A;  4GV3 A;  4B1W B;  4E89 A;  4DSL A;  2P9L A;  5GAE P;  4BDY A;  2A1R A;  4J2B A;  4E1M A;  4FWM A;  5AQG A;  1DTQ A;  4CK2 A;  4CZJ A;  5KPZ A;  4PWD A;  2HMI A;  1D4X A;  1KVA A;  1K73 O;  2G8K A;  4KFB A;  4CEE A;  1YTA A;  5FDL A;  1WSE A;  5GIN A;  4W5R A;  5KPT A;  4NLC A;  1Q8I A;  4B9U A;  1NOY A;  3OHR A;  4WE1 A;  2P9K B;  5HRP A;  4CJP A;  2E88 A;  4IOC L;  5AQK A;  3I56 N;  3H1V X;  4M3Y A;  2VWK A;  3KD5 E;  2I7P A;  2CGJ A;  2OZM A;  3R6M A;  4A61 A;  3V1O A;  2QWM A;  3TAM A;  2HNZ A;  4BRD A;  1MA9 B;  3VEW A;  1KAX A;  1S1V A;  1JCF A;  1HRH A;  3I0S A;  4DS4 A;  4CGG A;  4B9M A;  4JKD A;  3MED A;  2ZE2 A;  4NCA A;  1ZC6 A;  4WFB L;  2GUP A;  3D2E A;  3O3H A;  1BQM A;  3ENH A;  2IVP A;  4E1J A;  5JS1 A;  3LP0 A;  3OYN A;  4OGE A;  1TAU A;  3NH0 A;  3SV3 A;  1L5U A;  5HBM A;  3L8B A;  3QNN A;  2RN2 A;  4FJN A;  1RTJ A;  5AQT A;  4IJN A;  4HCC A;  3IUC A;  3LPT A;  4CGJ A;  2IVO A;  1I94 K;  4QAG A;  5GAD P;  3QET A;  5IWA K;  1LW2 A;  2I5J A;  3AVF A;  1S1W A;  1NGJ A;  5C15 A;  3J7Y P;  3UKR B;  4OX9 K;  4EP5 A;  3DLG A;  4MDB A;  4BR7 A;  3AVA A;  3CMA N;  4MLE A;  1ASU A;  3L2R A;  2P51 A;  2Q1N A;  2BH1 A;  3VA3 A;  2QKB A;  4RW7 A;  1HNW K;  2E2Q A;  3L4I A;  1ATR A;  5TKY A;  4ZTF A;  4B3M K;  3OYK A;  1P90 A;  4GVE A;  1VSM A;  3IMX A;  4H0V B;  4CEO A;  1HQU A;  4C8O A;  3HBT A;  4BRG A;  3OYF A;  3M1F A;  1XNR K;  3MN7 A;  5HL7 L;  2LSN A;  5LMU K;  3QFU A;  4Z0U A;  3J81 O;  2YCH A;  3TR8 A;  2NZT A;  1B92 A;  1WSF A;  3CG7 A;  1X3M A;  1ZBF A;  5J2N A;  4IFE A;  3BEX A;  1VSE A;  3A5M C;  3P31 A;  5CR4 A;  3VEX A;  4E1N A;  3VOV A;  3HZ6 A;  3I55 N;  3PO4 A;  5AFU A;  4RTF D;  1BCM A;  5HOO A;  4WFA L;  5EY4 A;  3KK2 A;  1HJR A;  3BP8 A;  4CHO A;  2QK9 A;  4E19 A;  1QVG M;  2YV0 X;  4DV4 K;  1VQ7 N;  4DHY A;  2O8F B;  2NRZ A;  3CCU N;  1VSJ A;  1RBV A;  4CIE A;  1EWQ A;  4BRC A;  5ELZ A;  4JAX A;  2BGG A;  1JKH A;  3CCM N;  4Z4I A;  4CW7 B;  3V6D A;  3KD1 E;  4OLA A;  1C0F A;  4DG1 A;  3LDS A;  1HYV A;  3HT3 A;  3C7N A;  4FOI A;  3I8B A;  2RPI A;  2HHS A;  5E26 A;  3KZB A;  1RT3 A;  2E1Z A;  3CM6 A;  4CJK A;  4CFA A;  3AVL A;  2EWS A;  3S3N A;  3GL1 A;  4BQL A;  4ZHR A;  3AA4 A;  1WAJ A;  3SV4 A;  3OJU A;  1NGI A;  4M3Z A;  4FJG A;  3HRG A;  4DTR A;  3KVG A;  2D0A A;  2O8C A;  4WF9 L;  1GLB G;  2V7Z A;  1XHX A;  1W9H A;  5DK5 A;  1JLF A;  3NF9 A;  3HST B;  4KTZ A;  1KCF A;  2GX9 A;  2X6N A;  3A2F A;  2JWK A;  1YT3 A;  1KLN A;  3U9Z A;  3ENO A;  4E7I A;  3CC2 N;  3QIC A;  4Z4C A;  1EX4 A;  3IFR A;  1IKW A;  2NRX A;  4IEI A;  2D5R A;  5SZT A;  3ZT0 A;  3RRH A;  2EX3 A;  2WON A;  4AHS A;  2ZGZ A;  4WCE L;  4CIF A;  1NMD A;  1YXQ A;  1XQS C;  4KHU A;  2V52 B;  1HPM A;  4C1N I;  3NH2 A;  1TV6 A;  4FWS A;  1IBK K;  3HK2 A;  3WXJ A;  4IXC A;  1N33 K;  2A5X A;  3HTV A;  1WSI A;  5F1X A;  1GLL O;  2KW4 A;  4Z4F A;  1X1P A;  3VGK A;  3PSF A;  2GEL A;  4JRQ A;  1A5X A;  1HNI A;  4RCH A;  2BUP A;  4OPJ A;  4XIU A;  5AQY A;  4BVP A;  1QSL A;  3QML A;  5HP1 A;  1YIJ N;  3ZT3 A;  1NK5 A;  1HMV A;  2CH6 A;  2G8F A;  4JKH A;  4QS9 A;  2IOC A;  1IG9 A;  2ZJP L;  3KJV A;  4J2D A;  3DLB A;  3OTO K;  5LJW A;  3VN5 A;  1J53 A;  3LDL A;  4DQQ A;  3OS1 A;  4M3X A;  2OTL N;  4PQU A;  1VHX A;  3QES A;  1Z6R A;  1NJW A;  3SZ2 A;  2NRR A;  1VQM N;  1BOT O;  1NNE A;  4BGA A;  3L2W A;  1T3V A;  3SLC A;  5FRM A;  4FPA A;  2P9P B;  4FJ9 A;  4DSK A;  2V7Y A;  1RTD A;  3P83 D;  2O8C B;  3E66 A;  4DCH A;  4KHS A;  2F9W A;  3WXI A;  3MXJ A;  4BR4 A;  1U48 A;  4YOU A;  1VQN N;  4KHN A;  5C2F A;  3KKR A;  4CJW A;  3GBT A;  3SUO A;  2GV9 A;  2EHG A;  1WUA A;  2DTU A;  4IBN A;  4PKI A;  4DMN A;  2AA4 A;  4BC5 A;  2BE2 A;  2ZD1 A;  4QS7 A;  3ULE A;  1HYZ A;  5KRS A;  1MU2 A;  3VQE A;  4OVL A;  4X64 K;  3NH1 A;  1TL3 A;  2HHT A;  4BY9 C;  5AQM A;  1IG8 A;  1T8E A;  1RT6 A;  1E4F T;  2ZJQ L;  4FJX A;  1R59 O;  4BGB A;  4KTW A;  3LAL A;  3HVR A;  3DRS A;  2ITG A;  4B1X B;  1OH5 A;  3SPY A;  4K25 A;  5KRT A;  1WN7 A;  2W42 A;  4KRF A;  3F9M A;  3LL3 A;  1NJZ A;  1U2V A;  1NKB A;  1YVU A;  3KTQ A;  3OYA A;  1JCE A;  4ELT A;  3VQ7 A;  1OH6 A;  2P9I B;  2VWB A;  4IZ9 A;  3E9L A;  5AQO A;  4DWI A;  4JI1 K;  3KLI A;  4PA1 A;  1WBB A;  1D9D A;  3L2V A;  2P5G A;  2ZJR L;  2JLE A;  5AZI A;  2P5O A;  1RDW X;  3BY5 A;  4M41 A;  5HRO A;  1VSL A;  5AQH A;  3VQB A;  3QNO A;  3FZH A;  2G8H A;  1CZB A;  2HHQ A;  1IO2 A;  1NGH A;  3SJJ A;  1NJY A;  1HYS A;  3K57 A;  4FJ5 A;  1IBL K;  4C23 A;  1ZBH A;  4Z4G A;  1C1A A;  2HHX A;  4BE0 A;  1JXB A;  4DQP A;  5I9E B;  4ILJ A;  4JS4 A;  1KLM A;  4A2B A;  4W5T A;  4F8R A;  4H4M A;  2QWO A;  4KH4 A;  4PHT X;  1X9S A;  4AM6 A;  5CYQ A;  4JRP A;  2YJF A;  2WBN A;  2AJQ A;  2HOE A;  3ZSX A;  3VET A;  5AQN A;  3MWT A;  2VGM A;  4YDU C;  1CZ9 A;  3O9T A;  4DV2 K;  4C1N K;  3LM9 A;  3OBY A;  2F9T A;  4F9O A;  4EFH A;  2OCE A;  3O9R A;  2HHW A;  4Y0W A;  4NCG A;  3CJB A;  4BC2 A;  4DSJ A;  4FLW A;  4IDK A;  3MCA B;  2GBZ A;  4CJ7 A;  3LDP A;  1SAZ A;  2UUA K;  3HP9 A;  3HVT A;  5CE3 A;  1YIT N;  1NGC A;  3C94 A;  1BHL A;  4CF0 A;  3HSC A;  1QZ5 A;  2O8D A;  3EN9 A;  4BC3 A;  3DOL A;  3ZLJ A;  3T19 A;  4B3T K;  3O9S A;  3OYH A;  3BUZ B;  1I39 A;  5TKW A;  3DAW A;  1SKR A;  5AZI B;  3IAY A;  1Y64 A;  4GKJ K;  3UKU B;  3MK6 A;  4KH5 A;  3OS0 A;  3ATU A;  2E6M A;  3S41 A;  1N34 K;  3R1X A;  3MMV A;  4JKC A;  2IGI A;  3VPZ A;  4CZK A;  1S5J A;  3GE1 A;  2Z1H A;  1U49 A;  1W2B M;  2YHW A;  1X3N A;  4WQ5 A;  3CIP A;  3P38 A;  4FPB A;  3DLL L;  4JI6 K;  4OJR A;  3CXC M;  1SKS A;  3K5M A;  3ZX2 A;  4FWQ A;  4BAC A;  1UWB A;  3HO1 A;  1BWF O;  3CJ1 A;  4IO8 A;  2HHV A;  3G6E N;  3S3O A;  2GUI A;  1Z26 A;  4DV3 K;  4B1V A;  3CCJ N;  2P9S A;  4CGF A;  4IOA L;  4DU1 A;  1Q82 O;  3U8X A;  2UU9 K;  3CCE N;  3T7Z A;  4MDA A;  4KO0 A;  3VTI A;  4IG3 A;  2KHO A;  4CZH A;  5BN8 A;  3ITH A;  5FPD A;  4NO7 A;  4H5T A;  4CZI A;  1KC8 O;  3CHW A;  5AFU H;  3O5B A;  4YOV A;  1TKX A;  1WSH A;  4CZE A;  3OYL A;  4CK1 A;  2AP1 A;  3O3F A;  4RW4 A;  1ILY A;  3MEC A;  1GLC G;  5MLC Q;  2B4J A;  4CEQ A;  4OGC A;  3CQ8 A;  3SI6 A;  3H6E A;  2O8D B;  2FC0 A;  3BDP A;  1RDB A;  4DR1 K;  4DTX A;  1YAG A;  5AQZ A;  4ISE A;  3ZT1 A;  5KQ8 A;  1J5E K;  3ZX3 A;  4FW2 A;  4H0T B;  4PKG A;  4FCY A;  4UQG A;  2UXC K;  3OYE A;  3A8Y A;  5LMN K;  3AAQ A;  4KH6 A;  1U45 A;  5D3G A;  3EE9 A;  2HHU A;  4ELV A;  1J6Z A;  4CF1 A;  5FPE A;  2NRW A;  3R8E A;  4Q5V A;  3DJC A;  4YDU A;  3ZEU A;  4FSV A;  5BPL A;  1HJO A;  5K14 A;  3LAN A;  1KAZ A;  5HRS A;  4ISG A;  4OPK A;  5JVG L;  4YOX A;  3VEO A;  4CED A;  3K5N A;  3CC4 N;  3CER A;  4G9Z A;  1VQP N;  1EWR A;  4CBX A;  3J7Z O;  1GLF O;  1TGO A;  2IS3 A;  1BI4 B;  1RFQ A;  4BR5 A;  1DEJ A;  3U6F A;  2DY4 A;  4F4K A;  1ZBU A;  5EX5 A;  4MQ3 A;  4UY8 O;  1YI2 N;  1XUP O;  1ESV A;  1TUY A;  3M8Q A;  5KGX A;  3TTD A;  4I6M A;  1O1W A;  1LAV A;  4YOY A;  5C42 A;  3O4Q A;  3DLK A;  4ISF A;  4CER A;  3AO2 A;  4DS5 A;  4M42 A;  1HX1 A;  2Q31 A;  3NCI A;  3OYM A;  3CFO A;  3RMD A;  3ID8 A;  3PY8 A;  1GLD G;  3OW2 M;  5CHI A;  3K5O A;  1EO1 A;  4JI4 K;  3MAQ A;  5A2Q O;  2YNH A;  1BA1 A;  3VTH A;  3VF2 A;  3IDH A;  2YKN A;  2RE2 A;  4BRK A;  2A3Z A;  4LF5 K;  2KKZ A;  3BZK A;  3M8R A;  1UA0 A;  3L3U A;  2GEM A;  3NGY A;  1RTH A;  3P4I A;  4IG0 A;  4B1Z A;  1WNS A;  5M1P A;  3NE6 A;  5AQR A;  3KHY A;  4X66 K;  5BR8 K;  3FLC O;  3UIQ A;  4JS5 A;  1EXQ A;  4CJE A;  2X6S A;  1U4B A;  4XH5 A;  3TTC A;  5BRH A;  3QEP A;  4MLH A;  3RSE A;  1CLQ A;  4LFC K;  2I7N A;  1QHA A;  3RMB A;  2XY7 A;  2WUS A;  1W97 L;  3ZT4 A;  3N4P A;  4FJK A;  3CM5 A;  4FWO A;  3VF4 A;  2XY8 A;  2P9L B;  4DV7 K;  1DGK N;  1SV5 A;  2F8S A;  1HQE A;  4W5N A;  4IEE A;  4CJV A;  1FKO A;  4BRQ A;  1TL1 A;  1DLO A;  4RG8 A;  2HF3 A;  3NHG A;  1N32 K;  2E2P A;  5GAH P;  3CJC A;  2QI2 A;  3AVM A;  4XEI A;  1IKX A;  1Q81 O;  3H1Q A;  1Z25 A;  4CHQ A;  3LZI A;  3T1A A;  4F2S A;  2KFZ A;  1XMO K;  4JK9 A;  4BWJ A;  1YJN N;  4BRH A;  1A5V A;  4DV0 K;  5ADX A;  3KWG A;  3NF8 A;  4KHP K;  4YOT A;  3HM9 A;  3H3O B;  4PUO A;  5AQJ A;  1IKV A;  3JS6 A;  2ASM A;  4C8N A;  1HR0 K;  4EAH D;  4JKG A;  4CEC A;  1JLG A;  1D9F A;  2FXU A;  3K0S A;  1E4G T;  3HOS A;  1TKZ A;  4BRF A;  3ATV A;  4CEZ A;  3LDN A;  1S9E A;  1VQ6 N;  4FK4 A;  3J8A A;  3U4L A;  1ASV A;  1V4S A;  3V81 A;  1LWF A;  4U7B A;  3D2E B;  1QVF M;  5HLF A;  4CJS A;  4DTJ A;  1Q86 O;  3PIP L;  3ASM A;  3D45 A;  5J2P A;  2VG6 A;  3CET A;  4GY2 B;  2OPQ A;  1L3S A;  3D6R A;  2B5J A;  2PY5 A;  3WXM B;  3G25 A;  2VWJ A;  3THV A;  3RSE B;  1RBU A;  3P5J A;  2ZF5 O;  4MO4 A;  2GWK A;  4YHH K;  3EEQ A;  4CEA A;  4JHD A;  3QIN A;  1HNV A;  4M7X A;  2YHB A;  4M3T A;  4JD2 A;  3NGI A;  2DPN A;  1BUP A;  1QQN A;  5GIO A;  4HUE A;  4DTU A;  4E0D A;  1QZ6 A;  1K6Y A;  1BGX T;  4LSN A;  1JLQ A;  4ELU A;  5AQF A;  1NK9 A;  1J9A A;  1X9J A;  5BRD A;  3QEI A;  3DRR A;  4CD1 A;  4LFA K;  5CZ2 A;  1U6Z A;  1VQ9 N;  4JI2 K;  3S9H A;  3BF1 A;  2F4V K;  3AAP A;  1S72 N;  3J7A P;  3GOI A;  1BQN A;  3IG1 A;  1TKT A;  4HTL A;  1Y97 A;  4YY3 K;  4DUZ K;  1HNX K;  4DTO A;  1NK6 A;  1I3A A;  5FLX O;  2KLA A;  4JI8 K;  2ATQ A;  4FXD A;  3DLE A;  1ZBL A;  5C24 A;  3O3G A;  1YUW A;  1S1T A;  4B9V A;  3SMS A;  1BL3 A;  4BRA A;  5CY4 A;  4HCB A;  1RBS A;  4HUF A;  3AVH A;  1T6C A;  2IIR A;  4KKO A;  3AO4 A;  4BR9 A;  2Z1G A;  3AO5 A;  2JWL A;  2VQE K;  3EL2 A;  2E4L A;  2RKI A;  4B8C A;  2QWN A;  4CJ5 A;  4CJ3 A;  1XC3 A;  5J1E A;  3A5N C;  3JYT A;  4DFM A;  5AQU A;  4H0P A;  2DFH A;  3OYJ A;  4FJJ A;  1A5W A;  5EVZ A;  1WOQ A;  3C7N B;  3M3Z A;  4FLT A;  5B8H A;  3PX0 A;  4FVM A;  4BC4 A;  3O8M A;  2QTD A;  1WSG A;  3PIO L;  3AVK A;  4B3S K;  2CGL A;  4FO0 A;  2ZM6 K;  4H5N A;  3SK3 A;  1JJ2 M;  4BE2 A;  4B3O A;  2F96 A;  4LH4 A;  4E7K A;  4I9Q A;  2QXL A;  1WLJ A;  1NGB A;  3AA5 X;  2Q0R A;  3ZSR A;  1XC9 A;  3EKS A;  1WBD A;  3NGZ A;  3OY9 A;  3LP1 A;  2XHB A;  1JLE A;  3AGK A;  1B9D A;  3NF6 A;  4Z4H A;  5M1K A;  4DV1 K;  5JMV A;  3AVI A;  4J2E A;  3KLG A;  2FF6 A;  3DRP A;  5JLF A;  1Q7Y O;  1V4T A;  4DSI A;  1YHQ N;  4O5F A;  3EZ5 A;  1FW6 A;  1U47 A;  4KB0 A;  4V19 S;  2FBX A;  5JS2 A;  5KPR A;  3VMF B;  5AQX A;  4FZY A;  4NYF A;  2D0O A;  1NGE A;  2VG5 A;  3SBG A;  4KHW A;  2OAN A;  2VYP A;  3M5R A;  3TTF A;  5AQP A;  2QEX N;  2FBV A;  1C6V A;  2VGN A;  1OVQ A;  4M7Y A;  4AHU A;  4DU4 A;  4PY5 A;  4BRL A;  4A59 A;  4EHT A;  2CGK A;  1K8K A;  2P9U A;  1SKW A;  1ASW A;  1JCG A;  4FWR A;  4WQ5 C;  2W6K A;  2DFE A;  4BE1 A;  3L3V A;  3M6G A;  4HUG A;  4WQ4 A;  2G8I A;  2FSJ A;  4I2Q A;  4YOW A;  4CF9 A;  4OKK A;  4O8U A;  3AA3 A;  4O8K A;  4GVM A;  4G1Q A;  5SWM A;  4KHY A;  3HPO A;  2UXB K;  3VEZ A;  3HM8 A;  2QXF A;  4ID1 A;  4CJF A;  2QM1 A;  3G10 A;  3I8D A;  4ZTJ A;  2QWQ A;  3WEE A;  3OYI A;  4O4G A;  1JLB A;  1NBW A;  1CXQ A;  1BIS A;  2H3G X;  4BWM A;  3DWL A;  3AO3 A;  1T6D A;  2FSN A;  3DMJ A;  3O80 A;  1E3M A;  1NLV A;  1HNZ K;  3O1W A;  4DQS A;  3TAQ A;  1BIU A;  2FLO A;  3O08 A;  4J2A A;  1TYQ A;  4JN4 A;  3V1R A;  4BRP A;  3EZW A;  3PX6 A;  4ID5 A;  3QO9 A;  4CES A;  1DKG D;  1GOA A;  3NMU A;  4FJ7 A;  3DI6 A;  1RTI A;  3P1G A;  3T1H K;  3MN9 A;  4DFP A;  4LF9 K;  3B8A X;  1JLC A;  3MN5 A;  4FLY A;  3O4N A;  4A57 A;  3ULE B;  1JL2 A;  4OKE A;  3CI5 A;  4M3R A;  2YKM A;  4EZ6 A;  5DMR A;  4E7L A;  3ALY A;  3RMC A;  3SAG A;  3VES A;  2QW9 A;  1HKG A;  1Q9X A;  4AM7 A;  3LWM A;  2HHH K;  3HXM A;  2E20 A;  3AVN A;  2FSK A;  4DF8 A;  1B9F A;  3O6W A;  3PV8 A;  2Y1J A;  4FLV A;  3DYA A;  2HBJ A;  1D5A A;  1LWE A;  4K41 A;  1U2V B;  2YX6 A;  4BRI A;  4LF8 K;  4CGH A;  3B6P A;  3CYM A;  5AQV A;  4W5O A;  1QQM A;  4A62 A;  2O4G A;  2BTF A;  5EOY A;  5C25 A;  4BDZ A;  2F8T A;  4KBO A;  3ZSV A;  4H0X B;  2IC3 A;  3CME N;  1FK9 A;  3V9S A;  4EIA A;  4EP4 A;  5BPM A;  1TK5 A;  3V9X A;  3EE8 A;  5AQL A;  3VQD A;  5M1N A;  3N4Q A;  3VGM A;  3VF6 A;  4IKF A;  2NLX A;  5FPN A;  4F3O A;  1S6Q A;  3KK1 A;  1N5Y A;  2CH5 A;  5F2R A;  4JI5 K;  3Q7C A;  2V51 B;  5DM6 L;  4CJT A;  4H5W A;  1YJW N;  3L0Q A;  1J54 A;  4FLZ A;  2Z1J A;  1S3X A;  2YNF A;  5AQQ A;  1Q9Y A;  3FZM A;  4A2A A;  1JXE A;  4FOE A;  3SUP A;  4J8F A;  2PYL A;  3CFR A;  4FM0 A;  1KTQ A;  3E9O A;  4DV5 K;  3C6U A;  3LPU A;  4JV5 K;  3O9Q A;  3AVJ A;  3SMP A;  5ADX H;  4CZL A;  1VSK A;  2X74 A;  3F2K A;  3ENB A;  4MO5 A;  3HP6 A;  1C0U A;  3TPQ A;  4CBW A;  3VQ8 A;  3NVM A;  5AQS A;  2E8A A;  4B9L A;  1MWK A;  4O5B A;  3CCS N;  2Q2R A;  3SJH A;  2XY6 A;  3JAM O;  4KI4 A;  3ZT2 A;  3JSM A;  4BQZ A;  3MN6 A;  1LOT B;  1Z05 A;  3U3G A;  3I0R A;  3UE5 A;  2W41 A;  3IKM A;  4RW6 A;  3T1Y K;  3FE1 A;  3RR7 A;  5BR9 A;  2XY5 A;  3W3D A;  3DOK A;  2KTQ A;  4I9L A;  1RCH A;  5AZJ A;  3RVC A;  1C0M A;  3MDQ A;  3SUN A;  4OPH A;  4AHR A;  4KI6 A;  2WOM A;  3M8S A;  3ULD A;  3V9Z A;  1BCO A;  3CJA A;  2HND A;  1VQK N;  4CBU A;  4BR2 A;  4AHC A;  4BDP A;  3A5O C;  3KLH A;  5IT9 O;  3MWP A;  4I2P A;  3C6A A;  3CD6 N;  3C6T A;  3BZC A;  1KRP A;  1ZXO A;  1HKC A;  3CPE A;  2W40 A;  1RIL A;  2J4R A;  2PFU A;  3CFP A;  4DR6 K;  3AA2 A;  5KI6 A;  4AIL C;  1LV5 A;  1KQS M;  2OA8 A;  5M1Q A;  3PO5 A;  3FZF A;  2NRH A;  3AY9 A;  1NMN A;  4XH4 A;  3HJF A;  4KHQ A;  4YOR A;  2ZWH A;  4LC9 B;  3SNN A;  4RW8 A;  1KVC A;  4H5R A;  3VQA A;  1RT1 A;  2YHA A;  1TUU A;  2D0B A;  1VRT A;  1ATS A;  5EU7 A;  4CIG A;  4ILG B;  3D7E O;  2OZS A;  3SYZ A;  2ITM A;  2P9S B;  1QS4 A;  3OYB A;  3SAH A;  4B9Q A;  2YJE A;  3UKR A;  4DU3 A;  4N76 A;  3FFI A;  4AF1 A;  4O55 A;  2BAN A;  4DTS A;  3O4W A;  2JGU A;  2X78 A;  1GOB A;  4OPA A;  3G71 N;  3HOT A;  1TAQ A;  4DR4 K;  2PBD A;  3THX A;  3F73 A;  3NBP A;  3V4I A;  1XMQ K;  3E1Y A;  1HKB A;  5BPN A;  3ZSQ A;  2Y1I A;  4JK8 A;  3AAR A;  2PYJ A;  4JI0 K;  3LAK A;  4LY7 A;  1JLA A;  5LJV A;  3FGU A;  2FBY A;  4IWV A;  1VSF A;  1REV A;  4BRE A;  3D0P A;  1NGD A;  2HW3 A;  4RWT A;  1IV0 A;  4FYD A;  1L3T A;  3AGR A;  2A1S A;  4N56 A;  4B9T A;  1QTM A;  3I33 A;  3CCV N;  5AZJ B;  1M1K O;  2PAV A;  3OYD A;  4BVO A;  1LCU A;  4GMJ B;  4KRE A;  3LM2 A;  3P39 A;  4IFV A;  3C95 A;  2NNW A;  1RT5 A;  4DFK A;  1XWL A;  1UA1 A;  1NK7 A;  3ZEU B;  3K2P A;  1RDA A;  2KQ2 A;  4EHU A;  3RWU A;  2OPS A;  4FJL A;  2O8F A;  1QQO A;  5J2Q A;  2IVN A;  4JI3 K;  3DXK A;  1K9M O;  1OVY A;  3VEY A;  4GV9 A;  1S6P A;  3FFK B;  2OPR A;  2QWR A;  3CPW M;  3T69 A;  5I3U A;  3QLH A;  4K42 A;  3WNG A;  1ITG A;  3WXK A;  2WFB A;  3D2F A;  4CJQ A;  3RRG A;  4JKF A;  4CFD A;  3MCP A;  1R0A A;  1RDD A;  4I6M B;  3R3L A;  2UXD K;  3ZYY X;  3DLR A;  1MWM A;  4B1U B;  1XNQ K;  1N8R O;  5AQI A;  3NAE A;  4F3T A;  1VAZ A;  2NUB A;  3OBW A;  4DR7 K;  3TSP A;  5FPM A;  2FF3 B;  1S9G A;  1QQC A;  3KWI A;  2VG7 A;  4CJR A;  3THX B;  3QBX A;  4C8M A;  4NLB A;  1W7A A;  3EO3 A;  3CJ7 A;  3DM2 A;  1RDU A;  4GNI A;  1UAX A;  1IH7 A;  5F0X A;  1U04 A;  1HPZ A;  1SS6 A;  1FJG K;  3H08 A;  2A42 A;  3ISN C;  2G8V A;  2XRI A;  2E2N A;  2ZQB A;  5KGW A;  3MX5 A;  1NKC A;  1F21 A;  3TAB A;  3TAF A;  2GWJ A;  1KSP A;  3SQ2 A;  4IDH A;  1W0H A;  4DF4 A;  1J5O A;  1IBM K;  2E2O A;  1T44 A;  3THW A;  1NOZ A;  1S22 A;  3DXM A;  1FKP A;  2R7Y A;  4CK3 A;  3VEN A;  5GIP A;  3WT0 A;  1RT4 A;  3LP3 A;  5C12 A;  4DLE A;  3LDQ A;  2HF4 A;  2IDO A;  2HBM A;  4WQ4 C;  2RHK A;  3TWH A;  3DXK B;  1UOC A;  3M8P A;  3CJ9 A;  1OKJ A;  3VQC A;  4K8Z A;  4LH5 A;  1EQY A;  3EKU A;  1ZBI A;  2NRV A;  3D2F B;  1VSD A;  3QIP A;  4R5P A;  4LF6 K;  4ILH A;  4QCL A;  3SCX A;  3BGR A;  3EY1 A;  1BG3 A;  2ZGY A;  5E84 A;  3QEW A;  2YHY A;  2ASO A;  3C0B A;  2YI1 A;  4PL7 A;  2P9P A;  1RBT A;  4EZ9 A;  4FW1 A;  2Q3S A;  3ZSW A;  3LAM A;  4BRO A;  1GOC A;  1VK0 A;  2D0C A;  4H03 B;  3F5T A;  4R79 A;  4CZG A;  3V1Q A;  3AVG A;  4DR3 K;  1KFD A;  4NXN K;  3CQX A;  1T7P A;  4Q0B A;  5BRE A;  4YFU A;  3VQ9 A;  2D1K A;  4GW6 A;  3VA0 A;  1VQ5 N;  1FXX A;  1NM1 A;  3OVN A;  1IJJ A;  3J80 O;  4JKA A;  2O8E A;  4JKG B;  4OKJ A;  1NGA A;  4CZM A;  1C0T A;  1ZBS A;  5KTQ A;  4M3U A;  1EP4 A;  1DTT A;  4B9N A;  3TAE A;  1NK8 A;  3HYF A;  1HUX A;  4BG8 A;  3R9P A;  4CF2 A;  1T03 A;  1RNH A;  3G4S N;  4DSF A;  3VEV A;  3QIO A;  2QA4 N;  4JKE A;  3KK3 A;  4F2R A;  4HHT A;  4JNE A;  2D4W A;  1VQO N;  4IJA A;  3CC7 N;  3KKS A;  3CCL N;  4X62 K;  3WUH A;  2A6A A;  3QEX A;  3THW B;  4NB4 A;  4RW9 A;  4CVN E;  4CJ4 A;  3FZK A;  1IKY A;  3TAG A;  1ZYQ A;  3DXM B;  1YTU A;  4CJU A;  1S1U A;  4W5Q A;  4E7H A;  2P9N A;  4Z94 A;  5C0Y A;  5E41 A;  4HVJ A;  3THY A;  1N36 K;  2P9I A;  3BF3 A;  3WXL A;  3B6O A;  5CZ1 A;  1NJX A;  4DB3 A;  4JHD B;  4B3R K;  4N5S A;  4JKB A;  3ZSZ A;  4X65 K;  2G8W A;  4JD2 B;  1SZ2 A;  3GG4 A;  3SQ0 A;  4DTN A;  1GLE G;  2KZZ A;  3WNE A;  4BR0 A;  1NG9 A;  4WYB A;  3VQ5 A;  3MXI A;  3AV9 A;  4E7J A;  3QBW A;  1WB9 A;  2YNG A;  3Q7B A;  3E01 A;  3RR8 A;  2QWP A;  2PZS A;  1QE1 A;  3VQ4 A;  4DSE A;  4FWL A;  5BRF A;  4IO9 L;  4U67 L;  2D0P A;  4CFB A;  4DUY K;  1GLJ O;  1QSY A;  4AHV A;  3RTV A;  4FL9 A;  4FLX A;  5HRR A;  3LZJ A;  3ZSO A;  4CEB A;  4DQI A;  3L2U A;  3CCQ N;  4JLH A;  5GAG P;  4DFJ A;  4M63 C;  1LAW A;  5M1F A;  3KLE A;  5FRN A;  4GV6 A;  4DLG A;  4NYN A;  3FZL A;  4O44 A;  4FJM A;  2HMP A;  4CI6 A;  5T7B A;  1TK0 A;  4K8X A;  4PKH A;  4TSX A;  2O8E B;  2HBL A;  1K8A O;  3WQT A;  5JVH L;  4FJ8 A;  2HVI A;  3GDQ A;  3C65 A;  3U3Y A;  3QDK A;  2Q97 A;  2B6A A;  3V9U A;  1H1V A;  4AHT A;  1D8Y A;  1C0G A;  5C2D A;  3F9K A;  2KZM A;  4LF4 K;  1NGF A;  1SL1 A;  4FLU A;  3HL8 A;  1XHZ A;  3CF5 L;  2F7T A;  1X9M A;  4C8L A;  3SAF A;  1KVB A;  1RT2 A;  3NFA A;  4CZF A;  3L4Q A;  4FM1 A;  1XI1 A;  5H1S Q;  4AH9 A;  3K5L A;  4KPY A;  3TAP A;  4FZZ A;  2A41 A;  1O13 A;  1BDG A;  2P9N B;  2O8B A;  3THY B;  4N47 A;  5JLH A;  3V9W A;  1YVN A;  3EYZ A;  1L3V A;  4HWI A;  1TKD A;  1GLA G;  3HI0 A;  1RBR A;  2WC9 A;  2BDP A;  4LSL A;  4CGD A;  1S1X A;  5FRO A;  3QER A;  4FWK A;  3K9K A;  4GKK K;  1RT7 A;  3LWL A;  2IAJ A;  4PL8 A;  4E3S A;  3IRX A;  3WQU A;  4DKW A;  3SQ1 A;  4K0K K;  1CZA N;  1NGG A;  1SL2 A;  4XH1 A;  3SBT A;  2E5L K;  3NVK A;  4OO1 J;  4B08 A;  2Z1I A;  2QKK A; 
#chains in the Genus database with same CATH homology
 3ZT4 A;  4FJK A;  4H8K A;  4I7F A;  3NH2 A;  3U3G A;  3I0R A;  3CM5 A;  1TV6 A;  4DTP A;  4RW6 A;  2XY8 A;  4NCB A;  3RR7 A;  3LP2 A;  3HK2 A;  1SV5 A;  2XY5 A;  2F8S A;  2XO7 A;  1HQE A;  1TVR A;  1WSI A;  4W5N A;  3MXM A;  3DOK A;  2FBT A;  3PX4 A;  4I9L A;  4CJV A;  3NF7 A;  2KTQ A;  2KW4 A;  3S3M A;  1RCH A;  4Z4F A;  1X1P A;  3G0Z A;  1FKO A;  4JRQ A;  1A5X A;  1TL1 A;  1C0M A;  1DLO A;  1KFS A;  3AO1 A;  3SUN A;  1HNI A;  4RG8 A;  4O0J A;  4AHR A;  4OPJ A;  2ETJ A;  2WOM A;  4LD0 A;  4XIU A;  3M8S A;  3NHG A;  3SQ4 A;  4B8A B;  3ULD A;  1QSL A;  3V9Z A;  1BCO A;  3QEV A;  3AVM A;  5HP1 A;  2HND A;  3ZT3 A;  1NK5 A;  1HMV A;  3K58 A;  4DQR A;  4AHC A;  1IKX A;  4M45 A;  4BDP A;  2G8F A;  3HPH A;  1Z25 A;  4M3W A;  1VSI A;  3KLH A;  4CHQ A;  3LZI A;  4I2P A;  2IOC A;  3T1A A;  1WSJ A;  5CYM A;  1IG9 A;  3KJV A;  4F2S A;  4J2D A;  3C6T A;  3TAN A;  3DLB A;  2KFZ A;  1KRP A;  1SUQ A;  3OJS A;  4QOZ B;  4BWJ A;  3VN5 A;  1A5V A;  3AVC A;  1J53 A;  2RF2 A;  1RIL A;  4DQQ A;  3OS1 A;  3CFP A;  4M3X A;  4H4O A;  3AA2 A;  4PQU A;  3NF8 A;  5KI6 A;  3QES A;  4AIL C;  1NJW A;  1LV5 A;  2OA8 A;  3SZ2 A;  4KTQ A;  3PO5 A;  1T05 A;  2KFN A;  3HM9 A;  1G15 A;  3L2W A;  4PUO A;  4KHQ A;  3HJF A;  1IKV A;  5FRM A;  1VSH A;  4Y1D A;  4C8N A;  4FJ9 A;  3SNN A;  4RW8 A;  4CEC A;  4DSK A;  1JLG A;  1KVC A;  1D9F A;  4FJI A;  2O4I A;  3VQA A;  1RT1 A;  3P83 D;  1RTD A;  1TKZ A;  2YHA A;  4CF8 A;  2D0B A;  1VRT A;  5EU7 A;  4CIG A;  4CEZ A;  3VQP A;  1N6Q A;  1S9E A;  4CHN A;  4KHS A;  2OZS A;  4FK4 A;  4KAZ A;  3MXJ A;  1U48 A;  3SYZ A;  1ASV A;  1QS4 A;  1LWF A;  3V81 A;  4KHN A;  3WNF A;  3OYB A;  3KKR A;  4CJS A;  4CJW A;  4DTJ A;  3SUO A;  2GV9 A;  5HLF A;  3KIO A;  4C8K A;  4DU3 A;  4L8R B;  2EHG A;  5J2P A;  3ASM A;  3D45 A;  4IBN A;  1NKE A;  4N76 A;  3FFI A;  2VG6 A;  4DMN A;  2DTU A;  1L3U A;  4O55 A;  2BAN A;  4DTS A;  2BE2 A;  2ZD1 A;  3WNH A;  2OPQ A;  2JGU A;  4CHP A;  1BIZ A;  2X78 A;  1L3S A;  1GOB A;  1HYZ A;  3MEE A;  5KRS A;  2B5J A;  1TAQ A;  1MU2 A;  3VQE A;  2PY5 A;  4OVL A;  3F73 A;  3NBP A;  3V4I A;  4FK0 A;  2YNI A;  2VWJ A;  3ZSQ A;  3THV A;  3NH1 A;  1RBU A;  1TL3 A;  3P5J A;  2Y1I A;  2HHT A;  3OYC A;  1T8E A;  1RT6 A;  1EKE A;  2P1J A;  1QHT A;  1JL1 A;  1NK4 A;  2PYJ A;  4CEA A;  4FJX A;  4KI6 A;  3LAK A;  3QIN A;  4CHZ A;  4LY7 A;  4KTW A;  1HNV A;  1JLA A;  3LAL A;  2YHB A;  4M3T A;  2FBY A;  3HVR A;  3DRS A;  3SUQ A;  1VSF A;  1REV A;  3VQQ A;  2ITG A;  3NGI A;  3D0P A;  2HW3 A;  4HUE A;  4DTU A;  4FYD A;  1EET A;  3SPY A;  3PUF A;  5KRT A;  1L3T A;  1WN7 A;  2A1S A;  4N56 A;  2W42 A;  4E0D A;  4FK2 A;  4KRF A;  4B9T A;  1K6Y A;  1QTM A;  1BGX T;  4LSN A;  4CFC A;  4Z4E A;  3VQ6 A;  1NJZ A;  1NKB A;  1YVU A;  3MEG A;  1JLQ A;  3KTQ A;  2E6L A;  3ZCM A;  3OYD A;  3OYA A;  3KLF A;  4ELT A;  3HPG A;  3VQ7 A;  4ELU A;  1WAF A;  4GMJ B;  1NK9 A;  4OLB A;  1J9A A;  4KRE A;  3QEI A;  3RMA A;  3DRR A;  4IFV A;  5CZ2 A;  3AVB A;  3C95 A;  3K59 A;  4MFB A;  1BI4 A;  3S9H A;  1RT5 A;  4DFK A;  4DWI A;  1C1C A;  3KLI A;  1BQN A;  3IG1 A;  1TKT A;  1XWL A;  2DFF A;  1UA1 A;  1NK7 A;  4PA1 A;  1Y97 A;  3K2P A;  4CHY A;  1RDA A;  4FM2 A;  1D9D A;  2KQ2 A;  3L2V A;  2P5G A;  3RWU A;  2HB5 A;  2OPS A;  4DTO A;  2JLE A;  4FJL A;  4IFY A;  1I3A A;  1NK6 A;  2P5O A;  5HRO A;  4M41 A;  1X9W A;  1CXU A;  1VSL A;  5J2Q A;  3VQB A;  2ATQ A;  3QNO A;  3DLE A;  1CZB A;  1ZBL A;  2G8H A;  3DLH A;  4FXD A;  2HHQ A;  4CCH A;  1IO2 A;  5C24 A;  3O3G A;  1S1T A;  1TK8 A;  4B9V A;  2HNY A;  3SJJ A;  3SPZ A;  1NJY A;  1S6P A;  1BL3 A;  5CY4 A;  2OPR A;  1RDC A;  4HCB A;  1HYS A;  3K57 A;  4FJ5 A;  1RBS A;  4HUF A;  3QLH A;  5I3U A;  3AVH A;  3WNG A;  4KV8 A;  4KKO A;  1ITG A;  3AO4 A;  4Z4G A;  1ZBH A;  5J2M A;  4CJQ A;  4N41 A;  4ICL A;  2Z1G A;  1C1A A;  3L2Q A;  3RRG A;  2HHX A;  4BE0 A;  4CFD A;  3ZSY A;  1C1B A;  3AO5 A;  1R0A A;  1JXB A;  1RDD A;  4DQP A;  3NDK A;  4JS4 A;  1KLM A;  2E4L A;  3DLR A;  2RKI A;  4CGI A;  4Y1C A;  1LWC A;  4B8C A;  4W5T A;  4F8R A;  4CJ5 A;  4CJ3 A;  5J1E A;  3NAE A;  3JYT A;  2NUB A;  4DFM A;  4F3T A;  4CEF A;  1QSS A;  4H4M A;  4FJH A;  2DFH A;  3OYJ A;  4FJJ A;  4O0I A;  1X9S A;  4KHU A;  3T3F A;  4B9S A;  1A5W A;  5CYQ A;  4JRP A;  1S9G A;  1QQC A;  4CJR A;  2VG7 A;  1NK0 A;  4FLT A;  3PX0 A;  2AJQ A;  4C8M A;  4FVM A;  3ZSX A;  3OS2 A;  1CZ9 A;  4YNQ A;  1WSG A;  3DM2 A;  3TI0 A;  1UAX A;  1IH7 A;  1VRU A;  2HVH A;  3AVK A;  2G8U A;  4FZX C;  1U04 A;  1LW0 A;  1HPZ A;  4BE2 A;  4B3O A;  3H08 A;  2F96 A;  2HHW A;  4LH4 A;  4E7K A;  4I9Q A;  3TAR A;  1WLJ A;  3ISN C;  2OYQ A;  2OPP A;  4CJL A;  3AA5 X;  4NCG A;  1SL0 A;  2G8V A;  2XRI A;  2ZQB A;  5KGW A;  4CE9 A;  4KB1 A;  4DSJ A;  1NKC A;  3ZSR A;  4FLW A;  1F21 A;  3IS9 A;  3TAB A;  1XC9 A;  4IDK A;  4HTU A;  4DTM A;  3NGZ A;  3OY9 A;  3TAF A;  3LP1 A;  2XHB A;  1JLE A;  2GBZ A;  5I42 A;  1KSP A;  1B9D A;  3NF6 A;  5HRN A;  3OYG A;  3HP9 A;  3HVT A;  4Z4H A;  3SQ2 A;  3AVI A;  4J2E A;  4E89 A;  1W0H A;  3KLG A;  3DRP A;  4DSL A;  4DF4 A;  1J5O A;  3C94 A;  1BHL A;  4BDY A;  4CF0 A;  2A1R A;  4J2B A;  4E1M A;  4DSI A;  3EZ5 A;  1NOZ A;  1U47 A;  4KB0 A;  2FBX A;  5JS2 A;  1DTQ A;  4CK2 A;  1FKP A;  3DOL A;  2R7Y A;  3T19 A;  4CK3 A;  2HMI A;  4FZY A;  3OYH A;  1KVA A;  4NYF A;  4PWD A;  1I39 A;  1SKR A;  1RT4 A;  3LP3 A;  2G8K A;  4KFB A;  4CEE A;  3IAY A;  1YTA A;  5FDL A;  2VG5 A;  4DLE A;  4KHW A;  1WSE A;  2IDO A;  3TWH A;  2FBV A;  1C6V A;  4W5R A;  1UOC A;  3M8P A;  1Q8I A;  4B9U A;  3OS0 A;  4AHU A;  4DU4 A;  1NOY A;  4PY5 A;  2E6M A;  3VQC A;  4WE1 A;  5HRP A;  4CJP A;  4K8Z A;  4LH5 A;  1SKW A;  1ASW A;  2DFE A;  4BE1 A;  3L3V A;  2IGI A;  1ZBI A;  4HUG A;  1VSD A;  3QIP A;  4R5P A;  1S5J A;  2G8I A;  4I2Q A;  2Z1H A;  4CF9 A;  1U49 A;  2VWK A;  4M3Y A;  4OKK A;  4QCL A;  3SCX A;  3KD5 E;  3BGR A;  3AA3 A;  3EY1 A;  2OZM A;  4GVM A;  4G1Q A;  5SWM A;  3QEW A;  4KHY A;  4OJR A;  3V1O A;  1SKS A;  3HPO A;  3TAM A;  1RBT A;  4EZ9 A;  3K5M A;  4FW1 A;  2HNZ A;  2Q3S A;  4BAC A;  1UWB A;  3ZSW A;  2QXF A;  3LAM A;  1GOC A;  1S1V A;  1VK0 A;  4ID1 A;  4CJF A;  2D0C A;  3HO1 A;  1HRH A;  2HHV A;  3S3O A;  2GUI A;  3G10 A;  3V1Q A;  3I0S A;  3AVG A;  4CGG A;  4DS4 A;  1Z26 A;  3I8D A;  1KFD A;  2ZE2 A;  3MED A;  4B9M A;  4NCA A;  4ZTJ A;  1T7P A;  4Q0B A;  4YFU A;  3VQ9 A;  4CGF A;  3OYI A;  4O4G A;  1JLB A;  3O3H A;  4DU1 A;  1CXQ A;  4GW6 A;  1BQM A;  3VA0 A;  1FXX A;  3OVN A;  1BIS A;  5JS1 A;  3LP0 A;  4BWM A;  3OYN A;  4OGE A;  4KO0 A;  3NH0 A;  3AO3 A;  3SV3 A;  1L5U A;  1TAU A;  5HBM A;  4IG3 A;  3DMJ A;  3L8B A;  3QNN A;  4OKJ A;  2RN2 A;  1C0T A;  4DQS A;  3TAQ A;  1BIU A;  4FJN A;  1RTJ A;  3ITH A;  5KTQ A;  4HCC A;  4M3U A;  1EP4 A;  4J2A A;  1DTT A;  4B9N A;  3LPT A;  4CGJ A;  3TAE A;  3HYF A;  3V1R A;  1NK8 A;  4QAG A;  4CF2 A;  3QET A;  1T03 A;  1RNH A;  4DSF A;  4ID5 A;  1TKX A;  3PX6 A;  3QIO A;  1LW2 A;  1WSH A;  3QO9 A;  4CES A;  3AVF A;  1GOA A;  2I5J A;  1S1W A;  3OYL A;  4FJ7 A;  3DI6 A;  3KK3 A;  4CK1 A;  3O3F A;  4F2R A;  4RW4 A;  1RTI A;  3P1G A;  4HHT A;  4EP5 A;  3DLG A;  4DFP A;  3KKS A;  3MEC A;  1JLC A;  3AVA A;  2B4J A;  4FLY A;  4CEQ A;  3O4N A;  4OGC A;  3CQ8 A;  3QEX A;  3SI6 A;  1JL2 A;  2FC0 A;  4RW9 A;  4OKE A;  1ASU A;  3L2R A;  4CJ4 A;  2P51 A;  1IKY A;  3TAG A;  1ZYQ A;  3BDP A;  1RDB A;  4M3R A;  1YTU A;  2YKM A;  4DTX A;  3VA3 A;  4CJU A;  1S1U A;  4EZ6 A;  5DMR A;  4W5Q A;  4E7H A;  4RW7 A;  4E7L A;  2QKB A;  3ALY A;  5E41 A;  3ZT1 A;  4HVJ A;  3RMC A;  4ZTF A;  3OYK A;  4FW2 A;  1Q9X A;  3B6O A;  5CZ1 A;  1VSM A;  4CEO A;  4UQG A;  4FCY A;  3OYE A;  1NJX A;  1HQU A;  4N5S A;  4C8O A;  1U45 A;  5D3G A;  2HHU A;  3LWM A;  4ELV A;  3ZSZ A;  4CF1 A;  2G8W A;  3HXM A;  3SQ0 A;  4Q5V A;  3AVN A;  3OYF A;  4DF8 A;  1B9F A;  4DTN A;  5K14 A;  3PV8 A;  3LAN A;  2Y1J A;  2LSN A;  4FLV A;  2KZZ A;  4Z0U A;  3DYA A;  5HRS A;  4OPK A;  1D5A A;  1LWE A;  3TR8 A;  1B92 A;  3WNE A;  3K5N A;  4CED A;  1WSF A;  3VQ5 A;  3CG7 A;  4CGH A;  3B6P A;  3MXI A;  3AV9 A;  4E7J A;  1ZBF A;  5J2N A;  3CYM A;  2YNG A;  1VSE A;  1TGO A;  3E01 A;  4W5O A;  3RR8 A;  2PZS A;  1QE1 A;  2IS3 A;  3VQ4 A;  2O4G A;  4E1N A;  4DSE A;  1BI4 B;  3U6F A;  3PO4 A;  5C25 A;  4CFB A;  1BCM A;  4F4K A;  2DY4 A;  1ZBU A;  1HJR A;  3KK2 A;  4BDZ A;  1QSY A;  3ZSV A;  4CHO A;  2F8T A;  4AHV A;  3RTV A;  2QK9 A;  2IC3 A;  4E19 A;  2YV0 X;  4MQ3 A;  4FLX A;  5HRR A;  3LZJ A;  3ZSO A;  1FK9 A;  4CEB A;  3L2U A;  4DQI A;  3V9S A;  3M8Q A;  5KGX A;  4JLH A;  1VSJ A;  1RBV A;  4DFJ A;  1LAW A;  4CIE A;  3KLE A;  5FRN A;  4EP4 A;  1O1W A;  2BGG A;  4DLG A;  1LAV A;  4NYN A;  1JKH A;  4O44 A;  1TK5 A;  4FJM A;  4Z4I A;  3V9X A;  5C42 A;  3O4Q A;  3DLK A;  3V6D A;  3VQD A;  3KD1 E;  5T7B A;  1TK0 A;  4K8X A;  4OLA A;  4CER A;  4TSX A;  3AO2 A;  4DS5 A;  4M42 A;  4DG1 A;  3LDS A;  1HYV A;  3NCI A;  3OYM A;  3HT3 A;  3CFO A;  4IKF A;  3RMD A;  4FJ8 A;  2HVI A;  4F3O A;  2RPI A;  3U3Y A;  1S6Q A;  3KK1 A;  2B6A A;  3V9U A;  2HHS A;  1N5Y A;  1RT3 A;  3CM6 A;  4AHT A;  4CJK A;  3PY8 A;  1D8Y A;  4CFA A;  3AVL A;  3F9K A;  2KZM A;  3S3N A;  4CJT A;  1SL1 A;  4FLU A;  3K5O A;  3HL8 A;  1XHZ A;  3MAQ A;  4ZHR A;  3AA4 A;  1WAJ A;  2YNH A;  3SV4 A;  1J54 A;  3OJU A;  1X9M A;  4C8L A;  1KVB A;  4FLZ A;  4M3Z A;  2Z1J A;  1RT2 A;  2YKN A;  4FJG A;  2YNF A;  3NFA A;  4DTR A;  2D0A A;  3M8R A;  1UA0 A;  3L3U A;  1Q9Y A;  4FM1 A;  1XI1 A;  1JXE A;  4AH9 A;  3SUP A;  3K5L A;  4KPY A;  3TAP A;  4FZZ A;  3NGY A;  1RTH A;  1XHX A;  1W9H A;  2PYL A;  4IG0 A;  5DK5 A;  1JLF A;  1WNS A;  3NF9 A;  3CFR A;  1KTQ A;  3HST B;  3NE6 A;  4FM0 A;  4N47 A;  3V9W A;  1KCF A;  3A2F A;  4KTZ A;  2X6N A;  3EYZ A;  3C6U A;  3UIQ A;  3LPU A;  1YT3 A;  1KLN A;  3AVJ A;  4JS5 A;  1L3V A;  1EXQ A;  1TKD A;  4CJE A;  1VSK A;  2X74 A;  1RBR A;  2X6S A;  4E7I A;  3HP6 A;  1C0U A;  1U4B A;  2BDP A;  4Z4C A;  4LSL A;  4CGD A;  1EX4 A;  1S1X A;  5FRO A;  3VQ8 A;  4B9L A;  1IKW A;  3QER A;  4O5B A;  2D5R A;  1RT7 A;  3QEP A;  3LWL A;  2IAJ A;  5SZT A;  3ZT0 A;  3RRH A;  2EX3 A;  2WON A;  4E3S A;  3IRX A;  3SQ1 A;  1CLQ A;  4AHS A;  4CIF A;  2XY6 A;  4KI4 A;  1SL2 A;  3ZT2 A;  3JSM A;  3RMB A;  2XY7 A;  4B08 A;  2Z1I A;  2QKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...