4CEEA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 59
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ceeA00
4RW8A 2HNDA 4DTUA 1TK8A 3AVCA 1KLNA 1Z25A 1NK4A 4UQGA 1RTDA 1Q9XA 1T7PA 3ZT4A 3ASMA 3NHGA 3NF6A 3V6DA 2Z1IA 4CF2A 1DLOA 1TKDA 3AVMA 3CM6A 3HXMA 1RT4A 3RTVA 1QS4A 1NK8A 1J5OA 1L3UA 2HW3A 3LP1A 3V1OA 4DTMA 2G8WA 4IFYA 1NOYA 4FM0A 2HVIA 1JLBA 4AHCA 4CJUA 4FJKA 4DTOA 3PUFA 4M3UA 3VQPA 4RW9A 5HRPA 2YNGA 4ZTJA 1SKWA 4M3ZA 4CEZA 3SNNA 4KREA 1EX4A 3CFOA 4CEQA 5SWMA 4CJ5A 1VSFA 3B6OA 4HVJA 2B4JA 2IS3A 3M8PA 2YNHA 2GV9A 4CFAA 3ULDA 1HRHA 1HYZA 3RRHA 2IDOA 3SQ0A 2X6SA 3KD1E 3QEXA 4OKEA 4CHYA 1HPZA 4JRQA 1VK0A 4KHUA 1JLFA 3HP9A 4DFKA 4CF8A 5DMRA 1TV6A 3KLEA 4DF4A 4FJXA 4I7FA 3RR8A 1WSJA 1UA1A 4RW6A 3KLHA 2B5JA 2HHTA 2W42A 4M42A 2BDPA 4KTZA 5CYQA 5HRRA 5CZ1A 2XY6A 1JLAA 5FRNA 4JS4A 1ASVA 1IKXA 4BE1A 3DLBA 1LAWA 2RKIA 4FLWA 1C0UA 3QINA 2RN2A 4E89A 1VSJA 1WAFA 1NKCA 4FZXC 4W5QA 4PUOA 2E6LA 3E01A 3L2RA 2O4GA 3PX4A 4ZTFA 2NUBA 4W5TA 4O0IA 1FKOA 4BWJA 2HNYA 1BGXT 3V1RA 1EETA 3HYFA 3LZJA 1VSIA 3AVLA 1X9WA 1S5JA 4CGFA 5KGXA 4FJ8A 4FK2A 1ZBHA 4DSKA 4KTQA 1NK7A 3ALYA 4CFDA 3TAMA 3O3HA 4KI6A 4CGIA 1HYVA 4GVMA 3VQ9A 2Z1HA 1W0HA 1C1BA 4IG0A 1VSEA 4DSLA 4NCAA 4OKKA 3JYTA 3NCIA 2HHVA 4E7KA 4FW1A 4C8KA 1LAVA 1KVCA 4EP5A 2DY4A 4NCGA 1VRTA 3K57A 3DLKA 3AA4A 1NK6A 2XO7A 1VSKA 4H8KA 5CZ2A 3FFIA 3M8QA 4MQ3A 3NBPA 3NF7A 4CEOA 3O3FA 2G8FA 4FJHA 4CFBA 1RBVA 5HRSA 2XHBA 5I42A 1Q8IA 1QSYA 3KTQA 3RWUA 1LWEA 1N6QA 4IBNA 2BE2A 4ELTA 4FJ7A 1YTAA 1BISA 1S9EA 4QCLA 4DQSA 1HNVA 4KKOA 2KW4A 4HUGA 3P5JA 4LH4A 3KIOA 2IAJA 3OYFA 3L2WA 3CQ8A 1TGOA 4CGHA 3LWMA 3OS0A 1U49A 1U48A 2P5GA 4J2AA 2FBYA 1TL1A 1X9MA 3OVNA 4O55A 4CJPA 3K5NA 2P51A 4CEDA 4CERA 3RMDA 2IGIA 3RMBA 3HP6A 4CESA 1X9SA 1N5YA 1ASUA 3MXJA 3ZSVA 2A1SA 4CEAA 4KHWA 3TWHA 3DRRA 2QK9A 1R0AA 3SJJA 4CJFA 4CJLA 1C6VA 2YNFA 4BE2A 4DU4A 3SUPA 4K8XA 3MAQA 4E7LA 3U3YA 4M3WA 4CIGA 2HMIA 4B9UA 2B6AA 1C0MA 1RBSA 5FRMA 3WNEA 4MFBA 3P83D 1VSLA 3T3FA 1BIUA 1TKZA 3K5LA 3KK3A 4CK1A 1NJZA 3OYCA 3VQQA 3VQ7A 4HUFA 1TAUA 4J2DA 4DTRA 1NJXA 4GMJB 1U45A 1WSIA 3RMCA 2PYLA 4JLHA 3S9HA 4CHZA 1FXXA 3ITHA 4AH9A 4DSEA 2D5RA 4AHTA 3AV9A 3QNNA 3HL8A 1TKXA 3OYAA 3DI6A 4CECA 3DLEA 4OPJA 4N41A 1WLJA 4LD0A 1JL1A 3OYEA 3S3NA 2QKKA 4B8CA 1L3TA 1NOZA 1BCOA 1VRUA 1A5WA 2G8VA 2KZZA 3HPGA 3DM2A 4M3XA 1S9GA 4F2RA 4DLEA 3U6FA 1BHLA 3L8BA 1NK9A 4DTSA 4AHRA 4FK4A 4OGCA 3WNHA 4IFVA 3BGRA 2OZSA 2G8KA 2Y1JA 3QESA 3DRPA 5HBMA 1XI1A 3CFRA 2XY8A 4FLYA 4KTWA 3TAFA 1HJRA 1REVA 3TABA 4M3RA 1XWLA 4E7IA 1KFSA 3AO1A 2XY5A 1SKSA 3V4IA 1RDDA 5DK5A 1NK5A 1BL3A 4GW6A 3AA5X 4AILC 3AVFA 1U47A 3C95A 1RT1A 1SKRA 3HT3A 2KQ2A 3CYMA 3OJUA 3QEVA 3MXMA 1D8YA 1NJWA 4CGDA 4G1QA 4CK2A 3NH0A 1JLGA 2FBXA 2BGGA 3QIPA 4CJRA 4O5BA 4B8AB 4F3TA 2HHUA 2HHSA 3AVHA 1KVBA 2D0CA 3QIOA 2JLEA 4KFBA 4FLVA 4PWDA 1YVUA 3VQDA 1ZBUA 2ITGA 3SQ2A 4M3YA 4E1NA 4N76A 4DTPA 1I3AA 1LWFA 1RTJA 3NDKA 4I9QA 2KFZA 4DS5A 1G15A 3P1GA 1IG9A 1NKBA 3M8RA 4BE0A 4DTJA 5D3GA 3D0PA 2FBVA 2GUIA 4PA1A 1RTIA 1Y97A 4AHVA 2D0BA 1LV5A 1JL2A 3THVA 4M3TA 4KI4A 2E6MA 1RT3A 3UIQA 4BDPA 4HHTA 3PO5A 5JS1A 2YKMA 3MECA 3H08A 1X1PA 3HM9A 3ZCMA 3TAQA 1KRPA 3SUQA 5CYMA 2VG6A 3EY1A 3C6TA 1KFDA 1VSMA 3AVNA 1RCHA 3LZIA 1S1WA 4OGEA 3S3MA 5SZTA 1SUQA 1KLMA 3NH1A 4PY5A 3V9UA 4KB0A 4CJEA 3V9ZA 4FJ9A 1I39A 4FLZA 1RT7A 1WSFA 1J9AA 4KHSA 1HQUA 1IKYA 3DLGA 1XHXA 2G8UA 2EHGA 1SV5A 3ZT0A 1UAXA 1WSGA 4N56A 2YHBA 3LWLA 1TL3A 4BWMA 3AO2A 1J53A 5KRTA 3QEWA 3DMJA 4FLTA 1RNHA 4B9TA 4FZYA 3KLIA 1BIZA 4DLGA 2OZMA 4KHNA 3G0ZA 3ZSRA 1KVAA 1HNIA 1S6PA 3KLFA 3O3GA 2OPQA 2QXFA 2YV0X 3ZT3A 3TI0A 4EZ6A 2VG5A 1QQCA 4AHUA 3C6UA 1RBRA 4B08A 3AVKA 3VQBA 1CZBA 4OPKA 1A5XA 1EP4A 2VWJA 3SUNA 3VQ5A 3PO4A 3LP3A 4FM1A 4FW2A 4W5RA 2KTQA 4DSFA 1BCMA 1DTTA 4CGGA 1JXBA 3LANA 3ZT2A 3MEDA 4E7HA 3RRGA 4KB1A 4OLBA 4IDKA 3OS1A 4N47A 4I2PA 4FZZA 5C24A 1WN7A 3DRSA 4LY7A 2E4LA 3SPZA 1MU2A 4FK0A 4DTNA 3SQ1A 3VQ6A 4I9LA 3VQ8A 4DF8A 5I3UA 1YTUA 1RT5A 1ZBFA 3VQAA 1NKEA 1Z26A 2G8IA 4FM2A 3QERA 4E19A 4B3OA 2D0AA 4CJTA 3K59A 4HCCA 4HCBA 2VG7A 3OYNA 1D5AA 3AA3A 3SCXA 2VWKA 3EZ5A 3QEIA 1T8EA 3HO1A 2X6NA 3PX0A 1S1UA 4F3OA 3HJFA 1JXEA 3HK2A 3ZSZA 1S6QA 3L3UA 4Y1CA 5J1EA 2A1RA 5HRNA 3I0RA 3LPUA 5KI6A 4CJQA 4DG1A 3AO5A 1QSSA 4C8LA 3OYBA 3V9WA 2RF2A 2I5JA 4F2SA 4TSXA 1IKVA 3OYIA 1RDAA 3L2QA 1CZ9A 1SL0A 3AVAA 2HHXA 1HQEA 3WNGA 2PYJA 4B9NA 4L8RB 1NK0A 1W9HA 2WOMA 3DOLA 2IC3A 1ZBIA 4DFMA 1J54A 1WNSA 4KO0A 4LSLA 3F73A 5EU7A 1FKPA 4DFPA 5KRSA 3M8SA 4WE1A 3TANA 1Q9YA 1KTQA 1EXQA 2BANA 3D45A 4ELUA 4FLUA 5J2QA 4N5SA 4H4MA 3HVRA 4FLXA 3PV8A 4DQPA 3T19A 4Z4GA 3AVIA 3LPTA 1UOCA 4ZHRA 5CY4A 3ZSYA 5C42A 3NGZA 1NJYA 4KHYA 1XHZA 3OYGA 3ZSOA 2HVHA 3OY9A 1O1WA 3TAPA 2OYQA 4E0DA 3T1AA 3JSMA 3OS2A 2DTUA 3SI6A 4HUEA 1L5UA 4YNQA 1S1XA 4HTUA 4FXDA 3RMAA 3KKSA 3V9XA 4CJ3A 5E41A 4JRPA 4BACA 3ZSWA 4DU3A 3QNOA 1RBTA 1JLEA 1S1VA 3L3VA 3O4NA 2R7YA 3EYZA 4FJLA 2YKNA 4KPYA 2KZMA 2OPPA 2P5OA 2ZD1A 1SL2A 1TAQA 4CJWA 3QEPA 3AVGA 4OLAA 3SZ2A 3ISNC 2X74A 4E7JA 4Y1DA 4IG3A 4M45A 2ZE2A 3NGIA 4NYNA 1JKHA 1FK9A 3O4QA 1TKTA 5J2MA 4KAZA 3MXIA 1HMVA 3LP2A 4FJGA 2ZQBA 4M41A 4O4GA 3DLRA 5C25A 3AO3A 4Z0UA 4O44A 4E3SA 3SPYA 2HB5A 3LAKA 4EP4A 3HPOA 4J2EA 1WSEA 3SQ4A 2FC0A 3CFPA 1CXUA 4C8NA 2YNIA 1B92A 1DTQA 3K5OA 4RW4A 3F9KA 1QTMA 4DSIA 1B9DA 4CIFA 2Z1JA 3NF8A 3NE6A 4CF0A 3NF9A 5J2PA 5T7BA 1U04A 1ZBLA 4R5PA 3SV4A 3S3OA 3BDPA 4H4OA 4CK3A 3NFAA 2RPIA 2WONA 2DFHA 3OYHA 4FJMA 3KJVA 4YFUA 4DQQA 3ZT1A 3I8DA 4W5NA 3NH2A 3MEEA 4CE9A 1RT2A 3OYDA 4CF9A 3HVTA 2Y1IA 3OYLA 4CJVA 3LDSA 2F8TA 3DYAA 4Z4IA 3LP0A 4Z4HA 4OVLA 2AJQA 4ID1A 5HLFA 2HHQA 4DU1A 1T03A 4EZ9A 2HHWA 1GOCA 1F21A 1LWCA 3IS9A 3KLGA 4FJNA 3HSTB 3B6PA 5HROA 3AVJA 1ZYQA 1SL1A 3AA2A 4RW7A 2OPSA 4C8MA 3VQCA 4DMNA 1TK5A 4ELVA 4DQIA 1GOBA 4CHQA 1RDBA 1UWBA 4NYFA 4KRFA 1C1AA 3KKRA 3VA3A 1IKWA 1BQNA 2ETJA 3G10A 1B9FA 4F8RA 4FYDA 3QLHA 4BDZA 4QOZB 3HPHA 4CCHA 3VQ4A 4I2QA 4DFJA 5JS2A 4CGJA 4OJRA 3V9SA 2PY5A 3SUOA 2XY7A 1C1CA 4B9SA 1BQMA 4CF1A 4FJ5A 3OYJA 3L2UA 3A2FA 4Q5VA 4DSJA 2P1JA 2EX3A 4RG8A 1HYSA 2F8SA 1JLQA 1RDCA 1QHTA 1WSHA 3VQEA 4XIUA 4J2BA 1L3SA 4NCBA 1CLQA 2O4IA 3ZSXA 1QSLA 3L2VA 2OPRA 3NGYA 2OA8A 4LSNA 3IAYA 3LALA 1TK0A 3KD5E 1S1TA 1VSDA 3VA0A 3OYMA 3KK1A 4FJJA 3OYKA 3TAEA 4KV8A 5J2NA 4CJ4A 1TVRA 2Q3SA 4ICLA 4CEEA 2PZSA 1K6YA 2DFEA 2ATQA 4BDYA 3MEGA 3DLHA 1QE1A 1LW2A 1IO2A 3WNFA 4CJSA 4W5OA 3RR7A 3PX6A 3TR8A 3KK2A 4FJIA 1BI4A 4ID5A 3IRXA 1CXQA 1EKEA 3V81A 4DWIA 4PQUA 1GOAA 3IG1A 2X78A 3AO4A 4CEFA 5HP1A 2G8HA 4F4KA 5FROA 2DFFA 1A5VA 3CG7A 1KSPA 2Z1GA 4CFCA 4QAGA 1L3VA 1D9FA 5K14A 2QKBA 3SV3A 4Z4CA 3SYZA 4IKFA 1YT3A 4DS4A 4FVMA 1WAJA 1RT6A 2FBTA 3OJSA 1C0TA 5FDLA 1ASWA 4DTXA 5KGWA 4CIEA 4CJKA 1JLCA 4B9LA 2IOCA 2HNZA 1BI4B 4FCYA 1UA0A 1T05A 4O0JA 2LSNA 3LAMA 3U3GA 4JS5A 1KCFA 3PY8A 4Z4EA 1D9DA 1VSHA 3C94A 2KFNA 3TARA 2F96A 4CHOA 1IH7A 4CHNA 5KTQA 3NAEA 4B9MA 4CEBA 3ZSQA 4DQRA 4C8OA 1U4BA 3AVBA 1RILA 3I0SA 3K5MA 1LW0A 4K8ZA 3V1QA 4LH5A 1RBUA 3K58A 3VN5A 3K2PA 4Z4FA 4Q0BA 4B9VA 3DOKA 4OKJA 2XRIA 1XC9A 3QETA 3TAGA 4AHSA 1ITGA 2JGUA 2GBZA 3QO9A 4KHQA 1RTHA 3CM5A 2YHAA 4CHPA 4E1MA
chains in the Genus database with same CATH superfamily
4DTUA 2QXLA 2DPNA 1KLNA 1RTDA 4WQ4C 3ASMA 4CF2A 1TKDA 1HPMA 1NMNA 4GV3A 3IKMA 2NLXA 2HW3A 3V1OA 2P9NB 4FM0A 4JKDA 3RSEB 3PUFA 5M1QA 3VQPA 5HRPA 4M3UA 4ZTJA 1T6DA 5SWMA 4KHPK 4JYAK 4HVJA 4FWQA 2B4JA 2QWRA 3M8PA 2GV9A 3CHWA 4B3SK 1HYZA 3MN6A 1U6ZA 2VCPA 1HPZA 4JKEA 1HUXA 1QQNA 1QHAA 3MDQA 1TV6A 2HSTA 3EKUA 1NU0A 3O9SA 4KTZA 3MK6A 4PHTX 1JLAA 5FRNA 3GL1A 4BE1A 1IKXA 1Q81O 3G6EN 2YHXA 1IBMK 4FZXC 2E6LA 4LC9B 3WT0A 2O4GA 4ZTFA 4MLHA 2HNYA 1BGXT 2NRRA 1EETA 3HYFA 3QBWA 2O8CA 2KKZA 4BQZA 1T6CA 4B1VA 2QWPA 3VEZA 3IDHA 3O3HA 3I8BA 4GVMA 4DQ8A 5GADP 1V4TA 4JKFA 1T3VA 4LF7K 4JI3K 1LAVA 4EP5A 1OH6A 3M3ZA 4NCGA 2FSNA 3DLKA 2E2OA 1VSKA 2XO7A 3SAGA 1C0GA 2H3GX 4A2BA 4CZEA 5FPNA 5M1NA 3L6QA 1RBVA 2XHBA 1Q8IA 3VETA 1LWEA 2BE2A 4FJ7A 1YTAA 1GLBG 1S9EA 2WBNA 2E2QA 1YJWN 2NRVA 4LH4A 4H0VB 3L2WA 3CQ8A 1TGOA 4CGHA 3LWMA 1U49A 1U48A 1GLLO 4DV5K 1X9MA 3OVNA 4CJPA 1NGDA 3O9RA 3H45C 1MWMA 3MXJA 2A1SA 3N4PA 3ZSVA 4BRCA 3TWHA 3THXB 1R0AA 4CBXA 3SJJA 3VEXA 4CJLA 4R79A 2J4RA 4E7LA 5JICA 4CIGA 2HMIA 4B9UA 2B6AA 5FRMA 2V52B 3WNEA 1BIUA 3K5LA 3A5MC 1TAUA 4GMJB 1WSIA 2PYLA 1QQMA 5DM7L 4DSEA 4DB3A 3OW2M 3QNNA 3HL8A 3AARA 3OYAA 4CI6A 1JL1A 2VQEK 3F9MA 1EO1A 1DKGD 1A5WA 1SQKA 3HPGA 4NLBA 3ZLJA 2QWQA 1S9GA 3ID6A 4F2RA 4DLEA 1NK9A 5BPMA 3CC7N 4OGCA 3WNHA 4BRDA 3BGRA 3SLCA 4B3TK 4YHHK 3QESA 2OZSA 4DCHA 2XY8A 4FLYA 3A5LC 1WOQA 4DR2K 4E7IA 4CD1A 5TKYA 2XY5A 4GW6A 3AA5X 3VERA 4AILC 2KQ2A 2YX6A 1JLGA 4CD3A 4B8AB 4QS8A 4F3TA 2HHUA 2HHSA 2D0CA 2Q36A 5AZJB 1E3MA 4E1NA 5AQOA 1LWFA 3NDKA 4IOXA 4DS5A 4B1XB 1NKBA 4M63C 1P8ZA 4BDPA 3CCQN 2YJEA 5CYMA 1HNZK 3EY1A 3CQYA 3C6TA 4H5TA 3TSPA 3LZIA 1RCHA 1S22A 5SZTA 4PL8A 3C65A 4KB0A 1IG8A 3DXKA 4KHSA 3DLGA 2E1ZA 3DLLL 3ID8A 2EHGA 4DV6K 4DR7K 5GIPA 4N56A 3LWLA 2A42A 3WXKA 2HBKA 3QEWA 2P9KB 4FL9A 5EOYA 3ZSRA 3ZT3A 1RBRA 3AVKA 1CZBA 3VQ5A 2F7TA 3PO4A 2KTQA 3RRGA 3KVGA 4O8UA 3O1BA 4OLBA 4IDKA 2QM1A 3P31A 3SPZA 1BG3A 4KH5A 3VQ6A 4I9LA 4DF8A 5AQKA 1ZBFA 3L4IA 3VQAA 1YI2N 3VF2A 4B3OA 4CJTA 3K59A 4AM7A 2VWKA 2W6LA 2P9IB 4FWOA 2CH5A 1JXEA 3L3UA 5AJ3K 4JEPA 5KI6A 3V9WA 3E66A 4TSXA 1RDAA 1CZ9A 5M1OA 2O8FA 1SL0A 4B9NA 2P9PB 1V4SA 1NK0A 3QDKA 3LDOA 4KO0A 5EU7A 5AQNA 4WE1A 2YHWA 2VGNA 3S41A 5J2QA 3HVRA 4FLXA 3PV8A 4BC3A 2IIRA 3NGZA 3LPTA 3ZSYA 3ZSOA 3EL2A 3JSMA 2DTUA 5LMNK 1L5UA 3QBXA 2IVPA 4JRPA 3QNOA 3L3VA 2O8BA 3EO3A 2YKNA 2P5OA 1SL2A 3QEPA 1OH7A 4OLAA 3SZ2A 4FOIA 2X74A 4BVOA 3LP2A 4FJGA 3FE1A 3AO3A 4J2EA 4JI2K 3SPYA 1NGEA 3LAKA 2RE2A 2FC0A 3CFPA 1B92A 3K5OA 1QTMA 3ZYYX 1BA0A 3SV4A 2GWKA 5AZIB 5M1KA 3O5BA 3BDPA 4U67L 4H4OA 4BVPA 3CJAA 3LDPA 3CCJN 2QTDA 2O8EB 4YFUA 3I8DA 3SBGA 3G71N 1NM1A 4C1NI 2CGJA 3NH2A 1RT2A 4X62K 4ILHA 2V7ZA 3HVTA 3C7NB 4GNIA 4WYBA 3WQUA 3LP0A 2AJQA 3O9TA 2P9UA 4DU1A 3IS9A 4JNEA 2NRHA 3IUCA 4NLCA 3HSTB 5E26A 3PLAA 2PAVA 1SL1A 2ZJPL 2OPSA 4DMNA 3VQCA 1RDBA 2QWLA 4GV9A 3J80O 1VAZA 1IKWA 1BQNA 3QLHA 1VQ8N 3HPHA 4QOZB 4BRPA 2A41A 3CJ7A 1ATRA 3D2FB 1O13A 1BOTO 2XY7A 4FJ5A 3L2UA 3ZEUA 3VEOA 2UYTA 4BROA 4DSJA 4GKJK 2JWLA 5BPLA 3VESA 1JLQA 5BRHA 4NCBA 1QSLA 1VHXA 3L2VA 3NGYA 2GTDA 2NRXA 3K9KA 4LSNA 1S1TA 2D4WA 4IJNA 3THWA 5B8HA 5J2NA 2IVOA 2PZSA 2DFEA 3GDQA 1N36K 3MEGA 4IO9L 2HOEA 3PX6A 3NMUA 3KK2A 3AAQA 3FLCO 3V81A 1EKEA 1HX1A 2OANA 5HP1A 1KSPA 4KBOA 4JD2A 4BC4A 2QKBA 3NVKA 4IKFA 1YT3A 5BREA 1RT6A 4FWMA 3OJSA 5FDLA 4H5NA 4DTXA 4CIEA 3MN9A 1BI4B 3AY9A 2LSNA 3LAMA 3PY8A 4Z4EA 2KFNA 3TARA 4CHOA 1YITN 3EN9A 4CEBA 1U4BA 3J7ZO 2ZM6K 4LH5A 5ADXH 3UKUB 2XRIA 3MCPA 1HJOA 4JK9A 3RSEA 4CZLA 1Q86O 3NHGA 2YHAA 3U3YA 4CHPA 3W0LA 1Z25A 5ADXA 3TSUA 1SZ2A 3ZT4A 3V6DA 1JCGA 1DLOA 1IBKK 1RT4A 1NK8A 3T7ZA 1J5OA 1L3UA 3LP1A 4DTMA 4IFYA 3DAWA 2HVIA 3HRGA 5HOOA 4AHCA 4FJKA 4LFCK 4DTOA 4AM6A 2YNGA 4CEZA 1Q82O 2IS3A 3CF5L 3RRHA 4CZIA 1P90A 4H0XB 2F4VK 2X6SA 5CHIA 3QEXA 4JRQA 3CJCA 4DFKA 4CF8A 4FJXA 2ZJQL 4I7FA 3RR8A 3CERA 3KLHA 2BDPA 5HRRA 5CYQA 5CZ1A 1ASVA 3DLBA 2RN2A 1NKCA 1VSJA 2NRWA 3A5OC 1D4XA 2QW9A 2V7YA 1I94K 3T1HK 4CZFA 4A5AA 5AQTA 4W5TA 4O0IA 4LF5K 1Z6RA 2FXUA 3AVLA 1S5JA 4IXCA 3B8AX 4JHDB 4KTQA 1R59O 5BRDA 3O6WA 2Z1HA 3VQ9A 4YOWA 4DSLA 1VSEA 4NCAA 3NCIA 2HHVA 1VQ6N 2ASOA 4E7KA 4FW1A 4HTLA 3AA4A 4U7BA 4LFBK 3M8QA 3BZKA 3NBPA 4A5BA 4CEOA 3HBTA 3THXA 5AQFA 1S72N 3RWUA 5I42A 2P9SA 3WQTA 5C0YA 2FF3B 4J2AA 4HWIA 1H1VA 2WTUA 1VQ5N 3M1FA 2ZGYA 4JKGB 3VMFB 1N5YA 1XNQK 4FWNA 4BR7A 1XQSC 1C6VA 3ZX0A 3EEQA 2YI1A 4CZJA 4GY2B 3P83D 2Q31A 4F9OA 3OYCA 3VQQA 3VQ7A 2E5LK 4J2DA 1U45A 4JLHA 3S9HA 4CHZA 1FXXA 1NGJA 5AQQA 1T44A 4DUZK 4AHTA 3AV9A 3CC2N 4OPJA 3DLEA 1QQOA 4LD0A 3Q7CA 3S3NA 3OYEA 3SAHA 4DV0K 1L3TA 4JV5K 2HBMA 2KZZA 1IV0A 3DM2A 3CCLN 3U6FA 3L8BA 3AAPA 5AQPA 3ZETB 5BRFA 5HBMA 5HL7L 4JK7A 3TAFA 1REVA 3TABA 1KFSA 3AO1A 4CZMA 4RWTA 3CCRN 4A61A 3HT3A 1U2VB 2GELA 3CYMA 1YXQA 3OBYA 4JN4A 3OJUA 3QEVA 1NJWA 1D8YA 4G1QA 3UKRB 1OKJA 1GLJO 4CJRA 4DR4K 4O5BA 3AVHA 1KVBA 2JLEA 3VQDA 1ZBUA 2ITGA 3TPQA 5C2FA 5FPDA 5H1SQ 4DTPA 1I3AA 4BRQA 2KFZA 1RDWX 3MX2A 4BRFA 1X9JA 2Q97A 4DTJA 4B1UB 4BRMA 2GUPA 2FBVA 4PA1A 3BP8A 2BUPA 2D0BA 4KI4A 5CE3A 3PO5A 5JS1A 2YKMA 3MECA 3H08A 3CCEN 1X1PA 3ZCMA 3TAQA 3TTCA 1LOTB 1GLFO 3SUQA 2CGLA 2VG6A 1KFDA 3J7YP 1NJIO 1KLMA 4PY5A 4EAHD 4JKBA 4CJEA 4BRLA 1RT7A 4FWRA 3SMPA 1ZXOA 1WSGA 3CC4N 2YHBA 3AO2A 4DR5K 1RNHA 1RGIA 1XMOK 1W7AA 3KLIA 1BIZA 4DLGA 1HNIA 3O3GA 4EZ6A 1QQCA 4K25A 3VQBA 2P9IA 4OPKA 1A5XA 1EP4A 3OTOK 3KK7A 3P38A 3CMAN 3LP3A 4FM1A 1ILYA 4W5RA 4DSFA 1DTTA 1KC8O 3ZT2A 1QZ5A 2D0OA 4E7HA 3VTIA 3OS1A 1YJNN 4FSVA 4FZZA 3ENOA 4FK0A 3VF6A 1NKEA 1Z26A 2P9PA 2VYPA 5AQIA 3QERA 4IFEA 5M1FA 4HCBA 4OX9K 2VG7A 1N32K 4WQ5A 3AA3A 3SCXA 3EZ5A 3QEIA 2BH1A 5LMUK 3HO1A 2P9LB 5F1XA 3PX0A 5GAHP 3HK2A 3ZSZA 1S6QA 4Y1CA 1QZ6A 5J1EA 2A1RA 3I0RA 3LPUA 3GE1A 1ZC6A 3AO5A 1QSSA 1BU6O 3QFPA 3OYBA 2I5JA 3OYIA 2Q0UA 4M7XA 4X64K 5EVZA 1HQEA 3A5NC 2PYJA 4CW7B 3CMEN 2WOMA 3MN5A 3DOLA 1J54A 4Z94A 1WNSA 3F73A 1FKPA 5KRSA 5JMVA 1Q9YA 1KTQA 2BANA 4ELUA 2OTLN 2D0PA 4ZHRA 4GV6A 5C42A 3CCSN 3OYGA 3QFUA 2OYQA 4PL7A 3H3OB 3VEVA 3T1AA 3OS2A 4HTUA 3V9XA 5E41A 5EXWA 4DU3A 1RBTA 3IMXA 1S1VA 3O4NA 5AZIA 2R7YA 4FJLA 2OPPA 4DV4K 3AVGA 2A3ZA 3WEEB 4E7JA 3NGIA 1MDUB 4WQ5C 4IG3A 1JKHA 3O4QA 1TKTA 3VF4A 2ZQBA 4M41A 1BO5O 4O4GA 3DLRA 4A62A 5C25A 4Z0UA 2HB5A 4EP4A 1WSEA 3C7NA 4C8NA 2YNIA 2CGKA 1B9DA 4YOUA 5T7BA 4BRNA 4MO4A 1TUUA 2RPIA 2WONA 4DV3K 2AA4A 3KJVA 4W5NA 2HBJA 3H6EA 5KQ8A 2Y1IA 4H0TB 4BGAA 4X66K 2QI2A 3OYLA 3D2FA 5HLFA 4CZKA 1GOCA 1F21A 5JLHA 4BY9C 4FJNA 3B6PA 5HROA 3FZLA 4ELVA 2VQFK 4YOYA 1HNWK 1YIJN 4L3QA 4NYFA 1C1AA 4A57A 3VA3A 4C23A 3G10A 1B9FA 4F8RA 4I2QA 4BRHA 4KH6A 4MO5A 4CGJA 4JKCA 3SUOA 3MN7A 2NRZA 4Q5VA 1VQPN 2P1JA 2W40A 1QHTA 3VQEA 3CCUN 2O4IA 2OA8A 4ISEA 1HNXK 5JVHL 4OPHA 3IAYA 3LALA 3OA9A 1TK0A 3LM2A 3OYMA 3VEYA 3R6MA 3P4IA 2Q3SA 4ICLA 3SBTA 1K6YA 4BDYA 4EFHA 3DLHA 3RR7A 1VQKN 4AF1A 1YVNA 2ZGZA 1BI4A 4ID5A 1MWKA 3IRXA 4GKKK 4EIAA 3AGRA 3G25A 3IG1A 2X78A 2G8HA 4F4KA 2DFFA 4CFCA 4QAGA 4WCEL 2UUAK 4BC5A 3SYZA 4DS4A 4FVMA 4H03B 3UKUA 3LDQA 1M90O 4B9LA 1UA0A 5BN8A 5KPTA 3U3GA 1NGIA 1D9DA 3FFKB 1FJGK 2F96A 5KTQA 1IH7A 4B9MA 2OTJN 4C8OA 1RILA 4B1YB 1LCUA 4IEEA 1CZAN 5AQZA 1RBUA 3ULEB 3VN5A 4Z4FA 1NGCA 4Q0BA 3DOKA 1JCEA 3QETA 4AHSA 1ITGA 2JGUA 3QO9A 4KHQA 1RTHA 3BEXA 1VQLN 4E1MA 4RW8A 2HNDA 4B1WB 1TK8A 1YHQN 4UQGA 2I7PA 1TYQA 3CM6A 4UY8O 3CD6N 3RTVA 1QS4A 1YJ9N 1VQON 5AQGA 5IWAK 3PSIA 4JI6K 5EY4A 1SKWA 1KQSM 2QWOA 4H5VA 1EX4A 3CFOA 4CEQA 4IZ9A 4CJ5A 1VSFA 3B6OA 4LF8K 4FWSA 4CFAA 1HRHA 5MLCQ 3F2KA 3SQ0A 1QVFM 2FSJA 4K42A 4KHUA 1JLFA 2RHKA 4JKAA 3MCAB 5DMRA 3O80A 2D1KA 1EWRA 2HHHK 4RW6A 4KH4A 2HHTA 4JHDA 5TKWA 5M1PA 1LAWA 1S3XA 4E89A 4PUOA 3GG4A 2NUBA 1FKOA 4BWJA 3R3LA 3V1RA 4WFAL 3LZJA 1NGAA 1X9WA 2HF3A 4FK2A 4FJ8A 1ZBHA 3LDNA 1NK7A 5AQUA 3I55N 3ALYA 1EQYA 1WBDA 4CGIA 4KI6A 1W0HA 1C1BA 4IG0A 3ZX3A 4OKKA 4BR5A 3FR0A 2A40A 4C8KA 4IOAL 1GLEG 4G9ZA 2DY4A 1KAYA 1NK6A 4CBWA 2W41A 4H8KA 5CZ2A 3FFIA 3CXCM 4MQ3A 3NF7A 4FJHA 4CFBA 5HRSA 1QSYA 3KTQA 1BUPA 4IBNA 3CPWM 4QCLA 4BR4A 4DQSA 4KKOA 2KW4A 2A6AA 3BUZB 2IAJA 2O8DA 4DV7K 5AQXA 2ITMA 1HKBA 2FBYA 2KLAA 1NMDA 1NG9A 4O55A 3K5NA 4CEDA 4CERA 3DXMB 3HP6A 4CESA 1X9SA 4CEAA 5DM6L 3DRRA 4XH4A 2QK9A 4CJFA 3HOSA 4BE2A 2YNFA 4DU4A 3SUPA 1J5EK 4K8XA 3A8YA 1BDGA 1C0MA 4J8FA 1VSLA 3T3FA 1TKZA 4CK1A 4H5RA 4FOEA 4HUFA 1Y64A 3ITHA 3CJ9A 5FPMA 2P9NA 5CR4A 1C0FA 1TKXA 3DI6A 3MX5A 4XEIA 1YUWA 1JCFA 1NOZA 1BCOA 2YCHA 2G8VA 5GAEP 4BRIA 3HM8A 1BHLA 3QB0A 2Y1JA 3DRPA 3U9DA 5LJWA 4M3RA 3FZKA 1RDDA 5DK5A 2HF4A 1NK5A 1ZBSA 2PBDA 3AVFA 3C95A 1RT1A 3W3DA 1SKRA 2E1YA 4M7YA 4CGDA 2BGGA 2NZTA 3QIOA 1N33K 4PWDA 1YVUA 4C1NK 3SQ2A 4M3YA 2NRTA 4LF4K 1JJ2M 1RTJA 5AQVA 3TTDA 3M8RA 4LFAK 4FWKA 4AHVA 1LV5A 1JL2A 2F9TA 3THVA 4M3TA 4CJ7A 3UIQA 4YORA 2A5XA 3C0BA 3HM9A 2E2NA 5F0XA 3GOIA 4PKIA 3O8MA 4YOXA 4LF6K 2FLOA 4I6MB 3NH1A 3GBTA 4DV1K 3V9ZA 1VQ7N 1I39A 4FLZA 5AFUH 5AQYA 2G8UA 4BC2A 1SV5A 1UAXA 5AQJA 1TL3A 5KRTA 4ISFA 2HBLA 2P9UB 4FZYA 2OZMA 5LY3A 4KHNA 3U4LA 3G0ZA 1S6PA 5AFUA 2OPQA 1BA1A 2YV0X 3TI0A 2VG5A 3SUNA 2VWJA 3M6GA 4QS7A 2QWNA 2P9LA 4FW2A 3HI0A 1JXBA 3BF1A 4BR2A 3MEDA 4ILJA 4KB1A 2VGMA 4DV2K 4N47A 4YOVA 5C24A 3DRSA 4LY7A 2E4LA 1MU2A 4DTNA 1ATSA 3FGUA 3VQ8A 4B3MK 4HCCA 3VEWA 3ZEUB 4WF9L 3OYNA 1D5AA 4PKHA 4H0YB 3HJFA 4F3OA 4JI0K 1DEJA 4CJQA 3ZX2A 3L2QA 3QICA 1NGHA 2HHXA 3WNGA 3THWB 1GLCG 2NNWA 5AQSA 2IC3A 3UE5A 4LSLA 3OHRA 3L0QA 3M8SA 1GLAG 1XC3A 4JKHA 1HKCA 4FLUA 4N5SA 3T19A 4Z4GA 4BREA 1UOCA 4MDAA 5CY4A 1VQMN 4KHYA 2HVHA 3OY9A 4BRGA 4E0DA 1VQ9N 4B9QA 3SI6A 4HUEA 4YNQA 1S1XA 4FXDA 5AZJA 4CJ3A 4NXNK 1JLEA 3AGKA 5LL6Z 3EYZA 5AQWA 2YHYA 5LJVA 2IVNA 1E4FT 3ISNC 3ATVA 4Y1DA 5J2MA 4DR3K 3LM9A 4NYNA 1FK9A 2HMPA 1YAGA 4O44A 1K8KB 1NLVA 5C12A 1CXUA 3F9KA 4DSIA 4GVEA 3NF9A 5J2PA 2GEMA 2UU9K 1ZBLA 3S3OA 3BZCA 3CIPA 3F5TA 3NFAA 1RFQA 4JI5K 4FJMA 3H3NO 4DQQA 3ZT1A 5FLXO 2Q2RA 1W2BM 4CE9A 3OYDA 4CF9A 4CJVA 3LDSA 2F8TA 4Z4HA 4OVLA 4ID1A 2P9KA 3U9ZA 4OPAA 2HHQA 4EZ9A 2HHWA 3KLGA 3ATUA 4DR1K 4RW7A 4C8MA 4DQIA 1GOBA 4CHQA 4BQLA 1UWBA 3KKRA 5KQDA 2ETJA 4BR9A 4FYDA 4CBUA 5FPEA 4CCHA 3VQ4A 3VPZA 4DFJA 3CETA 3Q7BA 3DWLA 2PY5A 1C1CA 3D2EB 1K8AO 4CF1A 5A2QO 4B9SA 2E88A 5GAGP 5JVGL 1KAZA 3A2FA 2GWJA 2EX3A 4RG8A 3O4WA 2F8SA 4O8KA 1RDCA 1WSHA 4J2BA 1L3SA 3D7EO 3ZSXA 2OPRA 2GX9A 3KD5E 1KXPA 1VSDA 3VA0A 4YY3K 3KK1A 4CJ4A 1TVRA 4BGBA 4CEEA 4FVUA 2ATQA 4DUYK 1QE1A 1LW2A 1IO2A 3ENBA 4W5OA 1N8RO 1CXQA 4DWIA 2F9WA 3AO4A 4CEFA 1A5VA 3CG7A 1HLUA 1D9FA 5K14A 4FO0A 5E84A 5F2RA 1QVGM 3MWTA 3ULEA 3SV3A 4Z4CA 1WAJA 2FBTA 1HKGA 1ASWA 4AQYK 4CJKA 2IOCA 3H46O 4O0JA 3JS6A 4E1JA 2P9SB 4CHNA 3NAEA 3ZSQA 3QMLA 4DQRA 3T69A 1X3NA 3K5MA 2E2PA 1LW0A 4K8ZA 3V1QA 4H5WA 1SAZA 2UUBK 3K2PA 4B9VA 1NNEA 1XC9A 2WC9A 3TAGA 2O8EA 4QS9A 3R1XA 4XH5A 2GBZA 2Q1NA 4K41A 3SJHA 3CM5A 3JAMO 3E9OA 3E9PA 3AVCA 1J6ZA 1WUAA 1NK4A 3BY5A 1Q9XA 1T7PA 3NF6A 2Z1IA 3VENA 3I56N 3AVMA 3HXMA 1VQ4N 1SS6A 3BF3A 1ESVA 3THYB 2EWSA 2G8WA 1BWFO 1NOYA 3TU5A 1RDUA 1JLBA 4RCHA 4CJUA 4MLEA 1W97L 3KWIA 4RW9A 5BR8K 4M3ZA 3SNNA 4KREA 2YJFA 4WFBL 3ULDA 2YNHA 2WFBA 1MA9B 1DT9A 2IDOA 3KD1E 4OO1J 4OKEA 4CHYA 1VK0A 5EX5A 3HP9A 4DF4A 3KLEA 1WSJA 1UA1A 3MWPA 2B5JA 2W42A 4NO7A 2XY6A 4JI7K 4JS4A 5JLFA 2RKIA 4FLWA 1XMQK 1C0UA 3QINA 3D6RA 1WAFA 3HTVA 4W5QA 5ELZA 3SMSA 3E01A 3L2RA 3PX4A 2QWMA 4IJAA 1VSIA 3VTHA 1G99A 4CGFA 5KGXA 4BR0A 4DSKA 4ILGB 1ATNA 4CFDA 3TAMA 1HYVA 2ZWHA 3CPEA 2CH6A 1XNRK 3OBWA 3JYTA 3N4QA 3LL3A 3IFRA 4FWLA 3VGMA 4A2AA 1KVCA 1VRTA 3K57A 2I7NA 2WUSA 2O8CB 2FF6A 3PIPL 3DXMA 2VWBA 3O3FA 2G8FA 3L4QA 3WXLA 4XH1A 4CVNE 1N6QA 4PKGA 4ELTA 5C15A 1BISA 3HSCA 1HNVA 1NGBA 3P5JA 5I9EB 4HUGA 4A59A 3KIOA 3OYFA 3OS0A 2P5GA 1TL1A 4DKWA 2P51A 3RMDA 2IGIA 3RMBA 1ASUA 4KHWA 4V19S 1EWQA 5C2DA 3EZWA 1K73O 3MAQA 4M3WA 1RBSA 4MFBA 1NJZA 4BRAA 1VQNN 3KK3A 4K0KK 3CI5A 3MMVA 4DTRA 1NJXA 5KPZA 3RMCA 1Q18A 4AH9A 2D5RA 3O9QA 4CECA 4N41A 1OH5A 1WLJA 2QKKA 4K43A 4B8CA 1HR0K 1VRUA 3CJBA 5AQRA 4M3XA 4DTSA 3VOVA 4AHRA 4FPBA 4FK4A 4Y0WA 4IFVA 2G8KA 1XI1A 2KHOA 5AQHA 3CFRA 4KTWA 1HJRA 4NXMK 1IBLK 1XWLA 3R9PA 1NGFA 3HOTA 3O1WA 3V4IA 1SKSA 1BL3A 2UXDK 1U47A 3SK3A 4FPAA 5BR9A 3PIOL 3MXMA 3CCMN 4CK2A 3NH0A 2FBXA 3QIPA 4FLVA 3O08A 4KFBA 2ASPA 1NWKA 4N76A 1E4GT 1DGKN 4I6MA 4I9QA 1G15A 3P1GA 1OVYA 4BG8A 4BE0A 1IG9A 5D3GA 3D0PA 4BG9A 2GUIA 3J81O 1RTIA 4CZGA 1Y97A 3SAFA 2E6MA 1RT3A 3EE9A 4IEIA 4HHTA 1KRPA 1VSMA 3AVNA 1S1WA 4OGEA 5BPNA 3S3MA 1SUQA 5AQMA 1NBWA 3V9UA 4FJ9A 4EHTA 4IWVA 1WB9A 1K9MO 1WSFA 1J9AA 1HQUA 1IKYA 1XHXA 5KPRA 3ZT0A 1NGGA 3JXUA 4BWMA 5C10A 1J53A 3DMJA 4EHUA 3WXIA 4FLTA 2UUCK 4CZHA 4B9TA 4MDBA 1TUYA 1KVAA 4M42A 3KLFA 2QXFA 3EE8A 4JI8K 3WUHA 4AHUA 3C6UA 4B08A 2Q0RA 2KZMA 3KHYA 4ISGA 1BCMA 4JKGA 3DXKB 3LANA 4CGGA 2AP1A 3I33A 4I2PA 1WN7A 3SQ1A 5I3UA 1YTUA 3G4SN 1RT5A 4DR6K 2G8IA 4B3RK 4FM2A 4E19A 2D0AA 5GINA 4BRKA 3O9UA 4LF9K 1T8EA 2X6NA 1S1UA 5HRNA 4DG1A 3P39A 4C8LA 2RF2A 4F2SA 1IKVA 3H1QA 3WXJA 3FZFA 3AVAA 4L8RB 1W9HA 1ZBIA 3J7AP 4DFMA 3K0SA 3ZETA 4DFPA 3LDLA 3A0IX 3TANA 1EXQA 3D45A 4IOCL 4H4MA 2OCEA 3VGLA 4DQPA 4JAXA 3AVIA 1NJYA 4H0OA 1XHZA 1U2VA 1K8KA 2O8FB 1O1WA 3TAPA 3E1YA 3UKRA 4NB4A 3C6AA 3RMAA 3KKSA 4BACA 3ZSWA 4DHYA 3C6HA 4KPYA 1FW6A 2ZD1A 1TAQA 4CJWA 3WXMB 2W6KA 3T1YK 4M45A 2ZE2A 3VGKA 5AR0A 4KAZA 3NVMA 3MXIA 1HMVA 3UB5A 4B1ZA 4E3SA 3CJ1A 3HPOA 3SQ4A 4YDUA 4RW4A 1DTQA 1XUPO 2JWKA 4CIFA 2Z1JA 3NF8A 3NE6A 4CF0A 1U04A 4R5PA 1Q7YO 2O8BB 4CK3A 3ENHA 4JI1K 3FZMA 2DFHA 3OYHA 4X65K 3TSQA 3MEEA 2ZF5O 3CQXA 3K9JA 3DYAA 4Z4IA 1TYQB 3TTFA 1T03A 1LWCA 2QA4N 3U8XA 1KAXA 3D2EA 2UXBK 3AVJA 1ZYQA 3AA2A 4FWPA 1TK5A 1KD1O 2E20A 4KRFA 3R8EA 4H0PA 4BDZA 3EKSA 5JS2A 4OJRA 3V9SA 2UXCK 4JK8A 4JI4K 4RTFD 3FZHA 1BQMA 4YDUC 3OYJA 2FSKA 2V51B 1Z05A 1HYSA 1CLQA 4XIUA 3E9LA 2ZJRL 2QEXN 4O5FA 4FJJA 1M1KO 3OYKA 3RVCA 3TAEA 4KV8A 4IDHA 3J8AA 4CJSA 3WNFA 1OVQA 3PSFA 3TR8A 4FJIA 3DJCA 1WBBA 4WQ4A 4PQUA 1GOAA 1X3MA 3HZ6A 5FROA 2Z1GA 1L3VA 2PFUA 3KZBA 1C0TA 3M5RA 1GLDG 4YOTA 5KGWA 1JLCA 2E8AA 2HNZA 3WEEA 4FCYA 1T05A 4JS5A 5GIOA 1KCFA 3CCVN 2ASMA 1N34K 1VSHA 3C94A 4WFNL 5IT9O 2BTFA 3AVBA 3I0SA 4JD2B 2O8DB 3K58A 4OKJA 3THYA 3KWGA 1IJJA 5BN9A 4IO8A 3H1VX 1OH8A 5AQLA 1YF5L
chains in the Genus database with same CATH topology
4RW8A 2HNDA 4DTUA 1TK8A 3AVCA 1KLNA 1Z25A 1NK4A 4UQGA 1RTDA 1Q9XA 1T7PA 3ZT4A 3ASMA 3NHGA 3NF6A 3V6DA 2Z1IA 4CF2A 1DLOA 1TKDA 3AVMA 3CM6A 3HXMA 1RT4A 3RTVA 1QS4A 1NK8A 1J5OA 1L3UA 2HW3A 3LP1A 3V1OA 4DTMA 2G8WA 4IFYA 1NOYA 4FM0A 2HVIA 1JLBA 4AHCA 4CJUA 4FJKA 4DTOA 3PUFA 4M3UA 3VQPA 4RW9A 5HRPA 2YNGA 4ZTJA 1SKWA 4M3ZA 4CEZA 3SNNA 4KREA 1EX4A 3CFOA 4CEQA 5SWMA 4CJ5A 1VSFA 3B6OA 4HVJA 2B4JA 2IS3A 3M8PA 2YNHA 2GV9A 4CFAA 3ULDA 1HRHA 1HYZA 3RRHA 2IDOA 3SQ0A 2X6SA 3KD1E 3QEXA 4OKEA 4CHYA 1HPZA 4JRQA 1VK0A 4KHUA 1JLFA 3HP9A 4DFKA 4CF8A 5DMRA 1TV6A 3KLEA 4DF4A 4FJXA 4I7FA 3RR8A 1WSJA 1UA1A 4RW6A 3KLHA 2B5JA 2HHTA 2W42A 4M42A 2BDPA 4KTZA 5CYQA 5HRRA 5CZ1A 2XY6A 1JLAA 5FRNA 4JS4A 1ASVA 1IKXA 4BE1A 3DLBA 1LAWA 2RKIA 4FLWA 1C0UA 3QINA 2RN2A 4E89A 1VSJA 1WAFA 1NKCA 4FZXC 4W5QA 4PUOA 2E6LA 3E01A 3L2RA 2O4GA 3PX4A 4ZTFA 2NUBA 4W5TA 4O0IA 1FKOA 4BWJA 2HNYA 1BGXT 3V1RA 1EETA 3HYFA 3LZJA 1VSIA 3AVLA 1X9WA 1S5JA 4CGFA 5KGXA 4FJ8A 4FK2A 1ZBHA 4DSKA 4KTQA 1NK7A 3ALYA 4CFDA 3TAMA 3O3HA 4KI6A 4CGIA 1HYVA 4GVMA 3VQ9A 2Z1HA 1W0HA 1C1BA 4IG0A 1VSEA 4DSLA 4NCAA 4OKKA 3JYTA 3NCIA 2HHVA 4E7KA 4FW1A 4C8KA 1LAVA 1KVCA 4EP5A 2DY4A 4NCGA 1VRTA 3K57A 3DLKA 3AA4A 1NK6A 2XO7A 1VSKA 4H8KA 5CZ2A 3FFIA 3M8QA 4MQ3A 3NBPA 3NF7A 4CEOA 3O3FA 2G8FA 4FJHA 4CFBA 1RBVA 5HRSA 2XHBA 5I42A 1Q8IA 1QSYA 3KTQA 3RWUA 1LWEA 1N6QA 4IBNA 2BE2A 4ELTA 4FJ7A 1YTAA 1BISA 1S9EA 4QCLA 4DQSA 1HNVA 4KKOA 2KW4A 4HUGA 3P5JA 4LH4A 3KIOA 2IAJA 3OYFA 3L2WA 3CQ8A 1TGOA 4CGHA 3LWMA 3OS0A 1U49A 1U48A 2P5GA 4J2AA 2FBYA 1TL1A 1X9MA 3OVNA 4O55A 4CJPA 3K5NA 2P51A 4CEDA 4CERA 3RMDA 2IGIA 3RMBA 3HP6A 4CESA 1X9SA 1N5YA 1ASUA 3MXJA 3ZSVA 2A1SA 4CEAA 4KHWA 3TWHA 3DRRA 2QK9A 1R0AA 3SJJA 4CJFA 4CJLA 1C6VA 2YNFA 4BE2A 4DU4A 3SUPA 4K8XA 3MAQA 4E7LA 3U3YA 4M3WA 4CIGA 2HMIA 4B9UA 2B6AA 1C0MA 1RBSA 5FRMA 3WNEA 4MFBA 3P83D 1VSLA 3T3FA 1BIUA 1TKZA 3K5LA 3KK3A 4CK1A 1NJZA 3OYCA 3VQQA 3VQ7A 4HUFA 1TAUA 4J2DA 4DTRA 1NJXA 4GMJB 1U45A 1WSIA 3RMCA 2PYLA 4JLHA 3S9HA 4CHZA 1FXXA 3ITHA 4AH9A 4DSEA 2D5RA 4AHTA 3AV9A 3QNNA 3HL8A 1TKXA 3OYAA 3DI6A 4CECA 3DLEA 4OPJA 4N41A 1WLJA 4LD0A 1JL1A 3OYEA 3S3NA 2QKKA 4B8CA 1L3TA 1NOZA 1BCOA 1VRUA 1A5WA 2G8VA 2KZZA 3HPGA 3DM2A 4M3XA 1S9GA 4F2RA 4DLEA 3U6FA 1BHLA 3L8BA 1NK9A 4DTSA 4AHRA 4FK4A 4OGCA 3WNHA 4IFVA 3BGRA 2OZSA 2G8KA 2Y1JA 3QESA 3DRPA 5HBMA 1XI1A 3CFRA 2XY8A 4FLYA 4KTWA 3TAFA 1HJRA 1REVA 3TABA 4M3RA 1XWLA 4E7IA 1KFSA 3AO1A 2XY5A 1SKSA 3V4IA 1RDDA 5DK5A 1NK5A 1BL3A 4GW6A 3AA5X 4AILC 3AVFA 1U47A 3C95A 1RT1A 1SKRA 3HT3A 2KQ2A 3CYMA 3OJUA 3QEVA 3MXMA 1D8YA 1NJWA 4CGDA 4G1QA 4CK2A 3NH0A 1JLGA 2FBXA 2BGGA 3QIPA 4CJRA 4O5BA 4B8AB 4F3TA 2HHUA 2HHSA 3AVHA 1KVBA 2D0CA 3QIOA 2JLEA 4KFBA 4FLVA 4PWDA 1YVUA 3VQDA 1ZBUA 2ITGA 3SQ2A 4M3YA 4E1NA 4N76A 4DTPA 1I3AA 1LWFA 1RTJA 3NDKA 4I9QA 2KFZA 4DS5A 1G15A 3P1GA 1IG9A 1NKBA 3M8RA 4BE0A 4DTJA 5D3GA 3D0PA 2FBVA 2GUIA 4PA1A 1RTIA 1Y97A 4AHVA 2D0BA 1LV5A 1JL2A 3THVA 4M3TA 4KI4A 2E6MA 1RT3A 3UIQA 4BDPA 4HHTA 3PO5A 5JS1A 2YKMA 3MECA 3H08A 1X1PA 3HM9A 3ZCMA 3TAQA 1KRPA 3SUQA 5CYMA 2VG6A 3EY1A 3C6TA 1KFDA 1VSMA 3AVNA 1RCHA 3LZIA 1S1WA 4OGEA 3S3MA 5SZTA 1SUQA 1KLMA 3NH1A 4PY5A 3V9UA 4KB0A 4CJEA 3V9ZA 4FJ9A 1I39A 4FLZA 1RT7A 1WSFA 1J9AA 4KHSA 1HQUA 1IKYA 3DLGA 1XHXA 2G8UA 2EHGA 1SV5A 3ZT0A 1UAXA 1WSGA 4N56A 2YHBA 3LWLA 1TL3A 4BWMA 3AO2A 1J53A 5KRTA 3QEWA 3DMJA 4FLTA 1RNHA 4B9TA 4FZYA 3KLIA 1BIZA 4DLGA 2OZMA 4KHNA 3G0ZA 3ZSRA 1KVAA 1HNIA 1S6PA 3KLFA 3O3GA 2OPQA 2QXFA 2YV0X 3ZT3A 3TI0A 4EZ6A 2VG5A 1QQCA 4AHUA 3C6UA 1RBRA 4B08A 3AVKA 3VQBA 1CZBA 4OPKA 1A5XA 1EP4A 2VWJA 3SUNA 3VQ5A 3PO4A 3LP3A 4FM1A 4FW2A 4W5RA 2KTQA 4DSFA 1BCMA 1DTTA 4CGGA 1JXBA 3LANA 3ZT2A 3MEDA 4E7HA 3RRGA 4KB1A 4OLBA 4IDKA 3OS1A 4N47A 4I2PA 4FZZA 5C24A 1WN7A 3DRSA 4LY7A 2E4LA 3SPZA 1MU2A 4FK0A 4DTNA 3SQ1A 3VQ6A 4I9LA 3VQ8A 4DF8A 5I3UA 1YTUA 1RT5A 1ZBFA 3VQAA 1NKEA 1Z26A 2G8IA 4FM2A 3QERA 4E19A 4B3OA 2D0AA 4CJTA 3K59A 4HCCA 4HCBA 2VG7A 3OYNA 1D5AA 3AA3A 3SCXA 2VWKA 3EZ5A 3QEIA 1T8EA 3HO1A 2X6NA 3PX0A 1S1UA 4F3OA 3HJFA 1JXEA 3HK2A 3ZSZA 1S6QA 3L3UA 4Y1CA 5J1EA 2A1RA 5HRNA 3I0RA 3LPUA 5KI6A 4CJQA 4DG1A 3AO5A 1QSSA 4C8LA 3OYBA 3V9WA 2RF2A 2I5JA 4F2SA 4TSXA 1IKVA 3OYIA 1RDAA 3L2QA 1CZ9A 1SL0A 3AVAA 2HHXA 1HQEA 3WNGA 2PYJA 4B9NA 4L8RB 1NK0A 1W9HA 2WOMA 3DOLA 2IC3A 1ZBIA 4DFMA 1J54A 1WNSA 4KO0A 4LSLA 3F73A 5EU7A 1FKPA 4DFPA 5KRSA 3M8SA 4WE1A 3TANA 1Q9YA 1KTQA 1EXQA 2BANA 3D45A 4ELUA 4FLUA 5J2QA 4N5SA 4H4MA 3HVRA 4FLXA 3PV8A 4DQPA 3T19A 4Z4GA 3AVIA 3LPTA 1UOCA 4ZHRA 5CY4A 3ZSYA 5C42A 3NGZA 1NJYA 4KHYA 1XHZA 3OYGA 3ZSOA 2HVHA 3OY9A 1O1WA 3TAPA 2OYQA 4E0DA 3T1AA 3JSMA 3OS2A 2DTUA 3SI6A 4HUEA 1L5UA 4YNQA 1S1XA 4HTUA 4FXDA 3RMAA 3KKSA 3V9XA 4CJ3A 5E41A 4JRPA 4BACA 3ZSWA 4DU3A 3QNOA 1RBTA 1JLEA 1S1VA 3L3VA 3O4NA 2R7YA 3EYZA 4FJLA 2YKNA 4KPYA 2KZMA 2OPPA 2P5OA 2ZD1A 1SL2A 1TAQA 4CJWA 3QEPA 3AVGA 4OLAA 3SZ2A 3ISNC 2X74A 4E7JA 4Y1DA 4IG3A 4M45A 2ZE2A 3NGIA 4NYNA 1JKHA 1FK9A 3O4QA 1TKTA 5J2MA 4KAZA 3MXIA 1HMVA 3LP2A 4FJGA 2ZQBA 4M41A 4O4GA 3DLRA 5C25A 3AO3A 4Z0UA 4O44A 4E3SA 3SPYA 2HB5A 3LAKA 4EP4A 3HPOA 4J2EA 1WSEA 3SQ4A 2FC0A 3CFPA 1CXUA 4C8NA 2YNIA 1B92A 1DTQA 3K5OA 4RW4A 3F9KA 1QTMA 4DSIA 1B9DA 4CIFA 2Z1JA 3NF8A 3NE6A 4CF0A 3NF9A 5J2PA 5T7BA 1U04A 1ZBLA 4R5PA 3SV4A 3S3OA 3BDPA 4H4OA 4CK3A 3NFAA 2RPIA 2WONA 2DFHA 3OYHA 4FJMA 3KJVA 4YFUA 4DQQA 3ZT1A 3I8DA 4W5NA 3NH2A 3MEEA 4CE9A 1RT2A 3OYDA 4CF9A 3HVTA 2Y1IA 3OYLA 4CJVA 3LDSA 2F8TA 3DYAA 4Z4IA 3LP0A 4Z4HA 4OVLA 2AJQA 4ID1A 5HLFA 2HHQA 4DU1A 1T03A 4EZ9A 2HHWA 1GOCA 1F21A 1LWCA 3IS9A 3KLGA 4FJNA 3HSTB 3B6PA 5HROA 3AVJA 1ZYQA 1SL1A 3AA2A 4RW7A 2OPSA 4C8MA 3VQCA 4DMNA 1TK5A 4ELVA 4DQIA 1GOBA 4CHQA 1RDBA 1UWBA 4NYFA 4KRFA 1C1AA 3KKRA 3VA3A 1IKWA 1BQNA 2ETJA 3G10A 1B9FA 4F8RA 4FYDA 3QLHA 4BDZA 4QOZB 3HPHA 4CCHA 3VQ4A 4I2QA 4DFJA 5JS2A 4CGJA 4OJRA 3V9SA 2PY5A 3SUOA 2XY7A 1C1CA 4B9SA 1BQMA 4CF1A 4FJ5A 3OYJA 3L2UA 3A2FA 4Q5VA 4DSJA 2P1JA 2EX3A 4RG8A 1HYSA 2F8SA 1JLQA 1RDCA 1QHTA 1WSHA 3VQEA 4XIUA 4J2BA 1L3SA 4NCBA 1CLQA 2O4IA 3ZSXA 1QSLA 3L2VA 2OPRA 3NGYA 2OA8A 4LSNA 3IAYA 3LALA 1TK0A 3KD5E 1S1TA 1VSDA 3VA0A 3OYMA 3KK1A 4FJJA 3OYKA 3TAEA 4KV8A 5J2NA 4CJ4A 1TVRA 2Q3SA 4ICLA 4CEEA 2PZSA 1K6YA 2DFEA 2ATQA 4BDYA 3MEGA 3DLHA 1QE1A 1LW2A 1IO2A 3WNFA 4CJSA 4W5OA 3RR7A 3PX6A 3TR8A 3KK2A 4FJIA 1BI4A 4ID5A 3IRXA 1CXQA 1EKEA 3V81A 4DWIA 4PQUA 1GOAA 3IG1A 2X78A 3AO4A 4CEFA 5HP1A 2G8HA 4F4KA 5FROA 2DFFA 1A5VA 3CG7A 1KSPA 2Z1GA 4CFCA 4QAGA 1L3VA 1D9FA 5K14A 2QKBA 3SV3A 4Z4CA 3SYZA 4IKFA 1YT3A 4DS4A 4FVMA 1WAJA 1RT6A 2FBTA 3OJSA 1C0TA 5FDLA 1ASWA 4DTXA 5KGWA 4CIEA 4CJKA 1JLCA 4B9LA 2IOCA 2HNZA 1BI4B 4FCYA 1UA0A 1T05A 4O0JA 2LSNA 3LAMA 3U3GA 4JS5A 1KCFA 3PY8A 4Z4EA 1D9DA 1VSHA 3C94A 2KFNA 3TARA 2F96A 4CHOA 1IH7A 4CHNA 5KTQA 3NAEA 4B9MA 4CEBA 3ZSQA 4DQRA 4C8OA 1U4BA 3AVBA 1RILA 3I0SA 3K5MA 1LW0A 4K8ZA 3V1QA 4LH5A 1RBUA 3K58A 3VN5A 3K2PA 4Z4FA 4Q0BA 4B9VA 3DOKA 4OKJA 2XRIA 1XC9A 3QETA 3TAGA 4AHSA 1ITGA 2JGUA 2GBZA 3QO9A 4KHQA 1RTHA 3CM5A 2YHAA 4CHPA 4E1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RW8 A;  2HND A;  4DTU A;  1TK8 A;  3AVC A;  1KLN A;  1Z25 A;  1NK4 A;  4UQG A;  1RTD A;  1Q9X A;  1T7P A;  3ZT4 A;  3ASM A;  3NHG A;  3NF6 A;  3V6D A;  2Z1I A;  4CF2 A;  1DLO A;  1TKD A;  3AVM A;  3CM6 A;  3HXM A;  1RT4 A;  3RTV A;  1QS4 A;  1NK8 A;  1J5O A;  1L3U A;  2HW3 A;  3LP1 A;  3V1O A;  4DTM A;  2G8W A;  4IFY A;  1NOY A;  4FM0 A;  2HVI A;  1JLB A;  4AHC A;  4CJU A;  4FJK A;  4DTO A;  3PUF A;  4M3U A;  3VQP A;  4RW9 A;  5HRP A;  2YNG A;  4ZTJ A;  1SKW A;  4M3Z A;  4CEZ A;  3SNN A;  4KRE A;  1EX4 A;  3CFO A;  4CEQ A;  5SWM A;  4CJ5 A;  1VSF A;  3B6O A;  4HVJ A;  2B4J A;  2IS3 A;  3M8P A;  2YNH A;  2GV9 A;  4CFA A;  3ULD A;  1HRH A;  1HYZ A;  3RRH A;  2IDO A;  3SQ0 A;  2X6S A;  3KD1 E;  3QEX A;  4OKE A;  4CHY A;  1HPZ A;  4JRQ A;  1VK0 A;  4KHU A;  1JLF A;  3HP9 A;  4DFK A;  4CF8 A;  5DMR A;  1TV6 A;  3KLE A;  4DF4 A;  4FJX A;  4I7F A;  3RR8 A;  1WSJ A;  1UA1 A;  4RW6 A;  3KLH A;  2B5J A;  2HHT A;  2W42 A;  4M42 A;  2BDP A;  4KTZ A;  5CYQ A;  5HRR A;  5CZ1 A;  2XY6 A;  1JLA A;  5FRN A;  4JS4 A;  1ASV A;  1IKX A;  4BE1 A;  3DLB A;  1LAW A;  2RKI A;  4FLW A;  1C0U A;  3QIN A;  2RN2 A;  4E89 A;  1VSJ A;  1WAF A;  1NKC A;  4FZX C;  4W5Q A;  4PUO A;  2E6L A;  3E01 A;  3L2R A;  2O4G A;  3PX4 A;  4ZTF A;  2NUB A;  4W5T A;  4O0I A;  1FKO A;  4BWJ A;  2HNY A;  1BGX T;  3V1R A;  1EET A;  3HYF A;  3LZJ A;  1VSI A;  3AVL A;  1X9W A;  1S5J A;  4CGF A;  5KGX A;  4FJ8 A;  4FK2 A;  1ZBH A;  4DSK A;  4KTQ A;  1NK7 A;  3ALY A;  4CFD A;  3TAM A;  3O3H A;  4KI6 A;  4CGI A;  1HYV A;  4GVM A;  3VQ9 A;  2Z1H A;  1W0H A;  1C1B A;  4IG0 A;  1VSE A;  4DSL A;  4NCA A;  4OKK A;  3JYT A;  3NCI A;  2HHV A;  4E7K A;  4FW1 A;  4C8K A;  1LAV A;  1KVC A;  4EP5 A;  2DY4 A;  4NCG A;  1VRT A;  3K57 A;  3DLK A;  3AA4 A;  1NK6 A;  2XO7 A;  1VSK A;  4H8K A;  5CZ2 A;  3FFI A;  3M8Q A;  4MQ3 A;  3NBP A;  3NF7 A;  4CEO A;  3O3F A;  2G8F A;  4FJH A;  4CFB A;  1RBV A;  5HRS A;  2XHB A;  5I42 A;  1Q8I A;  1QSY A;  3KTQ A;  3RWU A;  1LWE A;  1N6Q A;  4IBN A;  2BE2 A;  4ELT A;  4FJ7 A;  1YTA A;  1BIS A;  1S9E A;  4QCL A;  4DQS A;  1HNV A;  4KKO A;  2KW4 A;  4HUG A;  3P5J A;  4LH4 A;  3KIO A;  2IAJ A;  3OYF A;  3L2W A;  3CQ8 A;  1TGO A;  4CGH A;  3LWM A;  3OS0 A;  1U49 A;  1U48 A;  2P5G A;  4J2A A;  2FBY A;  1TL1 A;  1X9M A;  3OVN A;  4O55 A;  4CJP A;  3K5N A;  2P51 A;  4CED A;  4CER A;  3RMD A;  2IGI A;  3RMB A;  3HP6 A;  4CES A;  1X9S A;  1N5Y A;  1ASU A;  3MXJ A;  3ZSV A;  2A1S A;  4CEA A;  4KHW A;  3TWH A;  3DRR A;  2QK9 A;  1R0A A;  3SJJ A;  4CJF A;  4CJL A;  1C6V A;  2YNF A;  4BE2 A;  4DU4 A;  3SUP A;  4K8X A;  3MAQ A;  4E7L A;  3U3Y A;  4M3W A;  4CIG A;  2HMI A;  4B9U A;  2B6A A;  1C0M A;  1RBS A;  5FRM A;  3WNE A;  4MFB A;  3P83 D;  1VSL A;  3T3F A;  1BIU A;  1TKZ A;  3K5L A;  3KK3 A;  4CK1 A;  1NJZ A;  3OYC A;  3VQQ A;  3VQ7 A;  4HUF A;  1TAU A;  4J2D A;  4DTR A;  1NJX A;  4GMJ B;  1U45 A;  1WSI A;  3RMC A;  2PYL A;  4JLH A;  3S9H A;  4CHZ A;  1FXX A;  3ITH A;  4AH9 A;  4DSE A;  2D5R A;  4AHT A;  3AV9 A;  3QNN A;  3HL8 A;  1TKX A;  3OYA A;  3DI6 A;  4CEC A;  3DLE A;  4OPJ A;  4N41 A;  1WLJ A;  4LD0 A;  1JL1 A;  3OYE A;  3S3N A;  2QKK A;  4B8C A;  1L3T A;  1NOZ A;  1BCO A;  1VRU A;  1A5W A;  2G8V A;  2KZZ A;  3HPG A;  3DM2 A;  4M3X A;  1S9G A;  4F2R A;  4DLE A;  3U6F A;  1BHL A;  3L8B A;  1NK9 A;  4DTS A;  4AHR A;  4FK4 A;  4OGC A;  3WNH A;  4IFV A;  3BGR A;  2OZS A;  2G8K A;  2Y1J A;  3QES A;  3DRP A;  5HBM A;  1XI1 A;  3CFR A;  2XY8 A;  4FLY A;  4KTW A;  3TAF A;  1HJR A;  1REV A;  3TAB A;  4M3R A;  1XWL A;  4E7I A;  1KFS A;  3AO1 A;  2XY5 A;  1SKS A;  3V4I A;  1RDD A;  5DK5 A;  1NK5 A;  1BL3 A;  4GW6 A;  3AA5 X;  4AIL C;  3AVF A;  1U47 A;  3C95 A;  1RT1 A;  1SKR A;  3HT3 A;  2KQ2 A;  3CYM A;  3OJU A;  3QEV A;  3MXM A;  1D8Y A;  1NJW A;  4CGD A;  4G1Q A;  4CK2 A;  3NH0 A;  1JLG A;  2FBX A;  2BGG A;  3QIP A;  4CJR A;  4O5B A;  4B8A B;  4F3T A;  2HHU A;  2HHS A;  3AVH A;  1KVB A;  2D0C A;  3QIO A;  2JLE A;  4KFB A;  4FLV A;  4PWD A;  1YVU A;  3VQD A;  1ZBU A;  2ITG A;  3SQ2 A;  4M3Y A;  4E1N A;  4N76 A;  4DTP A;  1I3A A;  1LWF A;  1RTJ A;  3NDK A;  4I9Q A;  2KFZ A;  4DS5 A;  1G15 A;  3P1G A;  1IG9 A;  1NKB A;  3M8R A;  4BE0 A;  4DTJ A;  5D3G A;  3D0P A;  2FBV A;  2GUI A;  4PA1 A;  1RTI A;  1Y97 A;  4AHV A;  2D0B A;  1LV5 A;  1JL2 A;  3THV A;  4M3T A;  4KI4 A;  2E6M A;  1RT3 A;  3UIQ A;  4BDP A;  4HHT A;  3PO5 A;  5JS1 A;  2YKM A;  3MEC A;  3H08 A;  1X1P A;  3HM9 A;  3ZCM A;  3TAQ A;  1KRP A;  3SUQ A;  5CYM A;  2VG6 A;  3EY1 A;  3C6T A;  1KFD A;  1VSM A;  3AVN A;  1RCH A;  3LZI A;  1S1W A;  4OGE A;  3S3M A;  5SZT A;  1SUQ A;  1KLM A;  3NH1 A;  4PY5 A;  3V9U A;  4KB0 A;  4CJE A;  3V9Z A;  4FJ9 A;  1I39 A;  4FLZ A;  1RT7 A;  1WSF A;  1J9A A;  4KHS A;  1HQU A;  1IKY A;  3DLG A;  1XHX A;  2G8U A;  2EHG A;  1SV5 A;  3ZT0 A;  1UAX A;  1WSG A;  4N56 A;  2YHB A;  3LWL A;  1TL3 A;  4BWM A;  3AO2 A;  1J53 A;  5KRT A;  3QEW A;  3DMJ A;  4FLT A;  1RNH A;  4B9T A;  4FZY A;  3KLI A;  1BIZ A;  4DLG A;  2OZM A;  4KHN A;  3G0Z A;  3ZSR A;  1KVA A;  1HNI A;  1S6P A;  3KLF A;  3O3G A;  2OPQ A;  2QXF A;  2YV0 X;  3ZT3 A;  3TI0 A;  4EZ6 A;  2VG5 A;  1QQC A;  4AHU A;  3C6U A;  1RBR A;  4B08 A;  3AVK A;  3VQB A;  1CZB A;  4OPK A;  1A5X A;  1EP4 A;  2VWJ A;  3SUN A;  3VQ5 A;  3PO4 A;  3LP3 A;  4FM1 A;  4FW2 A;  4W5R A;  2KTQ A;  4DSF A;  1BCM A;  1DTT A;  4CGG A;  1JXB A;  3LAN A;  3ZT2 A;  3MED A;  4E7H A;  3RRG A;  4KB1 A;  4OLB A;  4IDK A;  3OS1 A;  4N47 A;  4I2P A;  4FZZ A;  5C24 A;  1WN7 A;  3DRS A;  4LY7 A;  2E4L A;  3SPZ A;  1MU2 A;  4FK0 A;  4DTN A;  3SQ1 A;  3VQ6 A;  4I9L A;  3VQ8 A;  4DF8 A;  5I3U A;  1YTU A;  1RT5 A;  1ZBF A;  3VQA A;  1NKE A;  1Z26 A;  2G8I A;  4FM2 A;  3QER A;  4E19 A;  4B3O A;  2D0A A;  4CJT A;  3K59 A;  4HCC A;  4HCB A;  2VG7 A;  3OYN A;  1D5A A;  3AA3 A;  3SCX A;  2VWK A;  3EZ5 A;  3QEI A;  1T8E A;  3HO1 A;  2X6N A;  3PX0 A;  1S1U A;  4F3O A;  3HJF A;  1JXE A;  3HK2 A;  3ZSZ A;  1S6Q A;  3L3U A;  4Y1C A;  5J1E A;  2A1R A;  5HRN A;  3I0R A;  3LPU A;  5KI6 A;  4CJQ A;  4DG1 A;  3AO5 A;  1QSS A;  4C8L A;  3OYB A;  3V9W A;  2RF2 A;  2I5J A;  4F2S A;  4TSX A;  1IKV A;  3OYI A;  1RDA A;  3L2Q A;  1CZ9 A;  1SL0 A;  3AVA A;  2HHX A;  1HQE A;  3WNG A;  2PYJ A;  4B9N A;  4L8R B;  1NK0 A;  1W9H A;  2WOM A;  3DOL A;  2IC3 A;  1ZBI A;  4DFM A;  1J54 A;  1WNS A;  4KO0 A;  4LSL A;  3F73 A;  5EU7 A;  1FKP A;  4DFP A;  5KRS A;  3M8S A;  4WE1 A;  3TAN A;  1Q9Y A;  1KTQ A;  1EXQ A;  2BAN A;  3D45 A;  4ELU A;  4FLU A;  5J2Q A;  4N5S A;  4H4M A;  3HVR A;  4FLX A;  3PV8 A;  4DQP A;  3T19 A;  4Z4G A;  3AVI A;  3LPT A;  1UOC A;  4ZHR A;  5CY4 A;  3ZSY A;  5C42 A;  3NGZ A;  1NJY A;  4KHY A;  1XHZ A;  3OYG A;  3ZSO A;  2HVH A;  3OY9 A;  1O1W A;  3TAP A;  2OYQ A;  4E0D A;  3T1A A;  3JSM A;  3OS2 A;  2DTU A;  3SI6 A;  4HUE A;  1L5U A;  4YNQ A;  1S1X A;  4HTU A;  4FXD A;  3RMA A;  3KKS A;  3V9X A;  4CJ3 A;  5E41 A;  4JRP A;  4BAC A;  3ZSW A;  4DU3 A;  3QNO A;  1RBT A;  1JLE A;  1S1V A;  3L3V A;  3O4N A;  2R7Y A;  3EYZ A;  4FJL A;  2YKN A;  4KPY A;  2KZM A;  2OPP A;  2P5O A;  2ZD1 A;  1SL2 A;  1TAQ A;  4CJW A;  3QEP A;  3AVG A;  4OLA A;  3SZ2 A;  3ISN C;  2X74 A;  4E7J A;  4Y1D A;  4IG3 A;  4M45 A;  2ZE2 A;  3NGI A;  4NYN A;  1JKH A;  1FK9 A;  3O4Q A;  1TKT A;  5J2M A;  4KAZ A;  3MXI A;  1HMV A;  3LP2 A;  4FJG A;  2ZQB A;  4M41 A;  4O4G A;  3DLR A;  5C25 A;  3AO3 A;  4Z0U A;  4O44 A;  4E3S A;  3SPY A;  2HB5 A;  3LAK A;  4EP4 A;  3HPO A;  4J2E A;  1WSE A;  3SQ4 A;  2FC0 A;  3CFP A;  1CXU A;  4C8N A;  2YNI A;  1B92 A;  1DTQ A;  3K5O A;  4RW4 A;  3F9K A;  1QTM A;  4DSI A;  1B9D A;  4CIF A;  2Z1J A;  3NF8 A;  3NE6 A;  4CF0 A;  3NF9 A;  5J2P A;  5T7B A;  1U04 A;  1ZBL A;  4R5P A;  3SV4 A;  3S3O A;  3BDP A;  4H4O A;  4CK3 A;  3NFA A;  2RPI A;  2WON A;  2DFH A;  3OYH A;  4FJM A;  3KJV A;  4YFU A;  4DQQ A;  3ZT1 A;  3I8D A;  4W5N A;  3NH2 A;  3MEE A;  4CE9 A;  1RT2 A;  3OYD A;  4CF9 A;  3HVT A;  2Y1I A;  3OYL A;  4CJV A;  3LDS A;  2F8T A;  3DYA A;  4Z4I A;  3LP0 A;  4Z4H A;  4OVL A;  2AJQ A;  4ID1 A;  5HLF A;  2HHQ A;  4DU1 A;  1T03 A;  4EZ9 A;  2HHW A;  1GOC A;  1F21 A;  1LWC A;  3IS9 A;  3KLG A;  4FJN A;  3HST B;  3B6P A;  5HRO A;  3AVJ A;  1ZYQ A;  1SL1 A;  3AA2 A;  4RW7 A;  2OPS A;  4C8M A;  3VQC A;  4DMN A;  1TK5 A;  4ELV A;  4DQI A;  1GOB A;  4CHQ A;  1RDB A;  1UWB A;  4NYF A;  4KRF A;  1C1A A;  3KKR A;  3VA3 A;  1IKW A;  1BQN A;  2ETJ A;  3G10 A;  1B9F A;  4F8R A;  4FYD A;  3QLH A;  4BDZ A;  4QOZ B;  3HPH A;  4CCH A;  3VQ4 A;  4I2Q A;  4DFJ A;  5JS2 A;  4CGJ A;  4OJR A;  3V9S A;  2PY5 A;  3SUO A;  2XY7 A;  1C1C A;  4B9S A;  1BQM A;  4CF1 A;  4FJ5 A;  3OYJ A;  3L2U A;  3A2F A;  4Q5V A;  4DSJ A;  2P1J A;  2EX3 A;  4RG8 A;  1HYS A;  2F8S A;  1JLQ A;  1RDC A;  1QHT A;  1WSH A;  3VQE A;  4XIU A;  4J2B A;  1L3S A;  4NCB A;  1CLQ A;  2O4I A;  3ZSX A;  1QSL A;  3L2V A;  2OPR A;  3NGY A;  2OA8 A;  4LSN A;  3IAY A;  3LAL A;  1TK0 A;  3KD5 E;  1S1T A;  1VSD A;  3VA0 A;  3OYM A;  3KK1 A;  4FJJ A;  3OYK A;  3TAE A;  4KV8 A;  5J2N A;  4CJ4 A;  1TVR A;  2Q3S A;  4ICL A;  4CEE A;  2PZS A;  1K6Y A;  2DFE A;  2ATQ A;  4BDY A;  3MEG A;  3DLH A;  1QE1 A;  1LW2 A;  1IO2 A;  3WNF A;  4CJS A;  4W5O A;  3RR7 A;  3PX6 A;  3TR8 A;  3KK2 A;  4FJI A;  1BI4 A;  4ID5 A;  3IRX A;  1CXQ A;  1EKE A;  3V81 A;  4DWI A;  4PQU A;  1GOA A;  3IG1 A;  2X78 A;  3AO4 A;  4CEF A;  5HP1 A;  2G8H A;  4F4K A;  5FRO A;  2DFF A;  1A5V A;  3CG7 A;  1KSP A;  2Z1G A;  4CFC A;  4QAG A;  1L3V A;  1D9F A;  5K14 A;  2QKB A;  3SV3 A;  4Z4C A;  3SYZ A;  4IKF A;  1YT3 A;  4DS4 A;  4FVM A;  1WAJ A;  1RT6 A;  2FBT A;  3OJS A;  1C0T A;  5FDL A;  1ASW A;  4DTX A;  5KGW A;  4CIE A;  4CJK A;  1JLC A;  4B9L A;  2IOC A;  2HNZ A;  1BI4 B;  4FCY A;  1UA0 A;  1T05 A;  4O0J A;  2LSN A;  3LAM A;  3U3G A;  4JS5 A;  1KCF A;  3PY8 A;  4Z4E A;  1D9D A;  1VSH A;  3C94 A;  2KFN A;  3TAR A;  2F96 A;  4CHO A;  1IH7 A;  4CHN A;  5KTQ A;  3NAE A;  4B9M A;  4CEB A;  3ZSQ A;  4DQR A;  4C8O A;  1U4B A;  3AVB A;  1RIL A;  3I0S A;  3K5M A;  1LW0 A;  4K8Z A;  3V1Q A;  4LH5 A;  1RBU A;  3K58 A;  3VN5 A;  3K2P A;  4Z4F A;  4Q0B A;  4B9V A;  3DOK A;  4OKJ A;  2XRI A;  1XC9 A;  3QET A;  3TAG A;  4AHS A;  1ITG A;  2JGU A;  2GBZ A;  3QO9 A;  4KHQ A;  1RTH A;  3CM5 A;  2YHA A;  4CHP A;  4E1M A; 
#chains in the Genus database with same CATH topology
 4DTU A;  2QXL A;  2DPN A;  1KLN A;  1RTD A;  4WQ4 C;  3ASM A;  4CF2 A;  1TKD A;  1HPM A;  1NMN A;  4GV3 A;  3IKM A;  2NLX A;  2HW3 A;  3V1O A;  2P9N B;  4FM0 A;  4JKD A;  3RSE B;  3PUF A;  5M1Q A;  3VQP A;  5HRP A;  4M3U A;  4ZTJ A;  1T6D A;  5SWM A;  4KHP K;  4JYA K;  4HVJ A;  4FWQ A;  2B4J A;  2QWR A;  3M8P A;  2GV9 A;  3CHW A;  4B3S K;  1HYZ A;  3MN6 A;  1U6Z A;  2VCP A;  1HPZ A;  4JKE A;  1HUX A;  1QQN A;  1QHA A;  3MDQ A;  1TV6 A;  2HST A;  3EKU A;  1NU0 A;  3O9S A;  4KTZ A;  3MK6 A;  4PHT X;  1JLA A;  5FRN A;  3GL1 A;  4BE1 A;  1IKX A;  1Q81 O;  3G6E N;  2YHX A;  1IBM K;  4FZX C;  2E6L A;  4LC9 B;  3WT0 A;  2O4G A;  4ZTF A;  4MLH A;  2HNY A;  1BGX T;  2NRR A;  1EET A;  3HYF A;  3QBW A;  2O8C A;  2KKZ A;  4BQZ A;  1T6C A;  4B1V A;  2QWP A;  3VEZ A;  3IDH A;  3O3H A;  3I8B A;  4GVM A;  4DQ8 A;  5GAD P;  1V4T A;  4JKF A;  1T3V A;  4LF7 K;  4JI3 K;  1LAV A;  4EP5 A;  1OH6 A;  3M3Z A;  4NCG A;  2FSN A;  3DLK A;  2E2O A;  1VSK A;  2XO7 A;  3SAG A;  1C0G A;  2H3G X;  4A2B A;  4CZE A;  5FPN A;  5M1N A;  3L6Q A;  1RBV A;  2XHB A;  1Q8I A;  3VET A;  1LWE A;  2BE2 A;  4FJ7 A;  1YTA A;  1GLB G;  1S9E A;  2WBN A;  2E2Q A;  1YJW N;  2NRV A;  4LH4 A;  4H0V B;  3L2W A;  3CQ8 A;  1TGO A;  4CGH A;  3LWM A;  1U49 A;  1U48 A;  1GLL O;  4DV5 K;  1X9M A;  3OVN A;  4CJP A;  1NGD A;  3O9R A;  3H45 C;  1MWM A;  3MXJ A;  2A1S A;  3N4P A;  3ZSV A;  4BRC A;  3TWH A;  3THX B;  1R0A A;  4CBX A;  3SJJ A;  3VEX A;  4CJL A;  4R79 A;  2J4R A;  4E7L A;  5JIC A;  4CIG A;  2HMI A;  4B9U A;  2B6A A;  5FRM A;  2V52 B;  3WNE A;  1BIU A;  3K5L A;  3A5M C;  1TAU A;  4GMJ B;  1WSI A;  2PYL A;  1QQM A;  5DM7 L;  4DSE A;  4DB3 A;  3OW2 M;  3QNN A;  3HL8 A;  3AAR A;  3OYA A;  4CI6 A;  1JL1 A;  2VQE K;  3F9M A;  1EO1 A;  1DKG D;  1A5W A;  1SQK A;  3HPG A;  4NLB A;  3ZLJ A;  2QWQ A;  1S9G A;  3ID6 A;  4F2R A;  4DLE A;  1NK9 A;  5BPM A;  3CC7 N;  4OGC A;  3WNH A;  4BRD A;  3BGR A;  3SLC A;  4B3T K;  4YHH K;  3QES A;  2OZS A;  4DCH A;  2XY8 A;  4FLY A;  3A5L C;  1WOQ A;  4DR2 K;  4E7I A;  4CD1 A;  5TKY A;  2XY5 A;  4GW6 A;  3AA5 X;  3VER A;  4AIL C;  2KQ2 A;  2YX6 A;  1JLG A;  4CD3 A;  4B8A B;  4QS8 A;  4F3T A;  2HHU A;  2HHS A;  2D0C A;  2Q36 A;  5AZJ B;  1E3M A;  4E1N A;  5AQO A;  1LWF A;  3NDK A;  4IOX A;  4DS5 A;  4B1X B;  1NKB A;  4M63 C;  1P8Z A;  4BDP A;  3CCQ N;  2YJE A;  5CYM A;  1HNZ K;  3EY1 A;  3CQY A;  3C6T A;  4H5T A;  3TSP A;  3LZI A;  1RCH A;  1S22 A;  5SZT A;  4PL8 A;  3C65 A;  4KB0 A;  1IG8 A;  3DXK A;  4KHS A;  3DLG A;  2E1Z A;  3DLL L;  3ID8 A;  2EHG A;  4DV6 K;  4DR7 K;  5GIP A;  4N56 A;  3LWL A;  2A42 A;  3WXK A;  2HBK A;  3QEW A;  2P9K B;  4FL9 A;  5EOY A;  3ZSR A;  3ZT3 A;  1RBR A;  3AVK A;  1CZB A;  3VQ5 A;  2F7T A;  3PO4 A;  2KTQ A;  3RRG A;  3KVG A;  4O8U A;  3O1B A;  4OLB A;  4IDK A;  2QM1 A;  3P31 A;  3SPZ A;  1BG3 A;  4KH5 A;  3VQ6 A;  4I9L A;  4DF8 A;  5AQK A;  1ZBF A;  3L4I A;  3VQA A;  1YI2 N;  3VF2 A;  4B3O A;  4CJT A;  3K59 A;  4AM7 A;  2VWK A;  2W6L A;  2P9I B;  4FWO A;  2CH5 A;  1JXE A;  3L3U A;  5AJ3 K;  4JEP A;  5KI6 A;  3V9W A;  3E66 A;  4TSX A;  1RDA A;  1CZ9 A;  5M1O A;  2O8F A;  1SL0 A;  4B9N A;  2P9P B;  1V4S A;  1NK0 A;  3QDK A;  3LDO A;  4KO0 A;  5EU7 A;  5AQN A;  4WE1 A;  2YHW A;  2VGN A;  3S41 A;  5J2Q A;  3HVR A;  4FLX A;  3PV8 A;  4BC3 A;  2IIR A;  3NGZ A;  3LPT A;  3ZSY A;  3ZSO A;  3EL2 A;  3JSM A;  2DTU A;  5LMN K;  1L5U A;  3QBX A;  2IVP A;  4JRP A;  3QNO A;  3L3V A;  2O8B A;  3EO3 A;  2YKN A;  2P5O A;  1SL2 A;  3QEP A;  1OH7 A;  4OLA A;  3SZ2 A;  4FOI A;  2X74 A;  4BVO A;  3LP2 A;  4FJG A;  3FE1 A;  3AO3 A;  4J2E A;  4JI2 K;  3SPY A;  1NGE A;  3LAK A;  2RE2 A;  2FC0 A;  3CFP A;  1B92 A;  3K5O A;  1QTM A;  3ZYY X;  1BA0 A;  3SV4 A;  2GWK A;  5AZI B;  5M1K A;  3O5B A;  3BDP A;  4U67 L;  4H4O A;  4BVP A;  3CJA A;  3LDP A;  3CCJ N;  2QTD A;  2O8E B;  4YFU A;  3I8D A;  3SBG A;  3G71 N;  1NM1 A;  4C1N I;  2CGJ A;  3NH2 A;  1RT2 A;  4X62 K;  4ILH A;  2V7Z A;  3HVT A;  3C7N B;  4GNI A;  4WYB A;  3WQU A;  3LP0 A;  2AJQ A;  3O9T A;  2P9U A;  4DU1 A;  3IS9 A;  4JNE A;  2NRH A;  3IUC A;  4NLC A;  3HST B;  5E26 A;  3PLA A;  2PAV A;  1SL1 A;  2ZJP L;  2OPS A;  4DMN A;  3VQC A;  1RDB A;  2QWL A;  4GV9 A;  3J80 O;  1VAZ A;  1IKW A;  1BQN A;  3QLH A;  1VQ8 N;  3HPH A;  4QOZ B;  4BRP A;  2A41 A;  3CJ7 A;  1ATR A;  3D2F B;  1O13 A;  1BOT O;  2XY7 A;  4FJ5 A;  3L2U A;  3ZEU A;  3VEO A;  2UYT A;  4BRO A;  4DSJ A;  4GKJ K;  2JWL A;  5BPL A;  3VES A;  1JLQ A;  5BRH A;  4NCB A;  1QSL A;  1VHX A;  3L2V A;  3NGY A;  2GTD A;  2NRX A;  3K9K A;  4LSN A;  1S1T A;  2D4W A;  4IJN A;  3THW A;  5B8H A;  5J2N A;  2IVO A;  2PZS A;  2DFE A;  3GDQ A;  1N36 K;  3MEG A;  4IO9 L;  2HOE A;  3PX6 A;  3NMU A;  3KK2 A;  3AAQ A;  3FLC O;  3V81 A;  1EKE A;  1HX1 A;  2OAN A;  5HP1 A;  1KSP A;  4KBO A;  4JD2 A;  4BC4 A;  2QKB A;  3NVK A;  4IKF A;  1YT3 A;  5BRE A;  1RT6 A;  4FWM A;  3OJS A;  5FDL A;  4H5N A;  4DTX A;  4CIE A;  3MN9 A;  1BI4 B;  3AY9 A;  2LSN A;  3LAM A;  3PY8 A;  4Z4E A;  2KFN A;  3TAR A;  4CHO A;  1YIT N;  3EN9 A;  4CEB A;  1U4B A;  3J7Z O;  2ZM6 K;  4LH5 A;  5ADX H;  3UKU B;  2XRI A;  3MCP A;  1HJO A;  4JK9 A;  3RSE A;  4CZL A;  1Q86 O;  3NHG A;  2YHA A;  3U3Y A;  4CHP A;  3W0L A;  1Z25 A;  5ADX A;  3TSU A;  1SZ2 A;  3ZT4 A;  3V6D A;  1JCG A;  1DLO A;  1IBK K;  1RT4 A;  1NK8 A;  3T7Z A;  1J5O A;  1L3U A;  3LP1 A;  4DTM A;  4IFY A;  3DAW A;  2HVI A;  3HRG A;  5HOO A;  4AHC A;  4FJK A;  4LFC K;  4DTO A;  4AM6 A;  2YNG A;  4CEZ A;  1Q82 O;  2IS3 A;  3CF5 L;  3RRH A;  4CZI A;  1P90 A;  4H0X B;  2F4V K;  2X6S A;  5CHI A;  3QEX A;  4JRQ A;  3CJC A;  4DFK A;  4CF8 A;  4FJX A;  2ZJQ L;  4I7F A;  3RR8 A;  3CER A;  3KLH A;  2BDP A;  5HRR A;  5CYQ A;  5CZ1 A;  1ASV A;  3DLB A;  2RN2 A;  1NKC A;  1VSJ A;  2NRW A;  3A5O C;  1D4X A;  2QW9 A;  2V7Y A;  1I94 K;  3T1H K;  4CZF A;  4A5A A;  5AQT A;  4W5T A;  4O0I A;  4LF5 K;  1Z6R A;  2FXU A;  3AVL A;  1S5J A;  4IXC A;  3B8A X;  4JHD B;  4KTQ A;  1R59 O;  5BRD A;  3O6W A;  2Z1H A;  3VQ9 A;  4YOW A;  4DSL A;  1VSE A;  4NCA A;  3NCI A;  2HHV A;  1VQ6 N;  2ASO A;  4E7K A;  4FW1 A;  4HTL A;  3AA4 A;  4U7B A;  4LFB K;  3M8Q A;  3BZK A;  3NBP A;  4A5B A;  4CEO A;  3HBT A;  3THX A;  5AQF A;  1S72 N;  3RWU A;  5I42 A;  2P9S A;  3WQT A;  5C0Y A;  2FF3 B;  4J2A A;  4HWI A;  1H1V A;  2WTU A;  1VQ5 N;  3M1F A;  2ZGY A;  4JKG B;  3VMF B;  1N5Y A;  1XNQ K;  4FWN A;  4BR7 A;  1XQS C;  1C6V A;  3ZX0 A;  3EEQ A;  2YI1 A;  4CZJ A;  4GY2 B;  3P83 D;  2Q31 A;  4F9O A;  3OYC A;  3VQQ A;  3VQ7 A;  2E5L K;  4J2D A;  1U45 A;  4JLH A;  3S9H A;  4CHZ A;  1FXX A;  1NGJ A;  5AQQ A;  1T44 A;  4DUZ K;  4AHT A;  3AV9 A;  3CC2 N;  4OPJ A;  3DLE A;  1QQO A;  4LD0 A;  3Q7C A;  3S3N A;  3OYE A;  3SAH A;  4DV0 K;  1L3T A;  4JV5 K;  2HBM A;  2KZZ A;  1IV0 A;  3DM2 A;  3CCL N;  3U6F A;  3L8B A;  3AAP A;  5AQP A;  3ZET B;  5BRF A;  5HBM A;  5HL7 L;  4JK7 A;  3TAF A;  1REV A;  3TAB A;  1KFS A;  3AO1 A;  4CZM A;  4RWT A;  3CCR N;  4A61 A;  3HT3 A;  1U2V B;  2GEL A;  3CYM A;  1YXQ A;  3OBY A;  4JN4 A;  3OJU A;  3QEV A;  1NJW A;  1D8Y A;  4G1Q A;  3UKR B;  1OKJ A;  1GLJ O;  4CJR A;  4DR4 K;  4O5B A;  3AVH A;  1KVB A;  2JLE A;  3VQD A;  1ZBU A;  2ITG A;  3TPQ A;  5C2F A;  5FPD A;  5H1S Q;  4DTP A;  1I3A A;  4BRQ A;  2KFZ A;  1RDW X;  3MX2 A;  4BRF A;  1X9J A;  2Q97 A;  4DTJ A;  4B1U B;  4BRM A;  2GUP A;  2FBV A;  4PA1 A;  3BP8 A;  2BUP A;  2D0B A;  4KI4 A;  5CE3 A;  3PO5 A;  5JS1 A;  2YKM A;  3MEC A;  3H08 A;  3CCE N;  1X1P A;  3ZCM A;  3TAQ A;  3TTC A;  1LOT B;  1GLF O;  3SUQ A;  2CGL A;  2VG6 A;  1KFD A;  3J7Y P;  1NJI O;  1KLM A;  4PY5 A;  4EAH D;  4JKB A;  4CJE A;  4BRL A;  1RT7 A;  4FWR A;  3SMP A;  1ZXO A;  1WSG A;  3CC4 N;  2YHB A;  3AO2 A;  4DR5 K;  1RNH A;  1RGI A;  1XMO K;  1W7A A;  3KLI A;  1BIZ A;  4DLG A;  1HNI A;  3O3G A;  4EZ6 A;  1QQC A;  4K25 A;  3VQB A;  2P9I A;  4OPK A;  1A5X A;  1EP4 A;  3OTO K;  3KK7 A;  3P38 A;  3CMA N;  3LP3 A;  4FM1 A;  1ILY A;  4W5R A;  4DSF A;  1DTT A;  1KC8 O;  3ZT2 A;  1QZ5 A;  2D0O A;  4E7H A;  3VTI A;  3OS1 A;  1YJN N;  4FSV A;  4FZZ A;  3ENO A;  4FK0 A;  3VF6 A;  1NKE A;  1Z26 A;  2P9P A;  2VYP A;  5AQI A;  3QER A;  4IFE A;  5M1F A;  4HCB A;  4OX9 K;  2VG7 A;  1N32 K;  4WQ5 A;  3AA3 A;  3SCX A;  3EZ5 A;  3QEI A;  2BH1 A;  5LMU K;  3HO1 A;  2P9L B;  5F1X A;  3PX0 A;  5GAH P;  3HK2 A;  3ZSZ A;  1S6Q A;  4Y1C A;  1QZ6 A;  5J1E A;  2A1R A;  3I0R A;  3LPU A;  3GE1 A;  1ZC6 A;  3AO5 A;  1QSS A;  1BU6 O;  3QFP A;  3OYB A;  2I5J A;  3OYI A;  2Q0U A;  4M7X A;  4X64 K;  5EVZ A;  1HQE A;  3A5N C;  2PYJ A;  4CW7 B;  3CME N;  2WOM A;  3MN5 A;  3DOL A;  1J54 A;  4Z94 A;  1WNS A;  3F73 A;  1FKP A;  5KRS A;  5JMV A;  1Q9Y A;  1KTQ A;  2BAN A;  4ELU A;  2OTL N;  2D0P A;  4ZHR A;  4GV6 A;  5C42 A;  3CCS N;  3OYG A;  3QFU A;  2OYQ A;  4PL7 A;  3H3O B;  3VEV A;  3T1A A;  3OS2 A;  4HTU A;  3V9X A;  5E41 A;  5EXW A;  4DU3 A;  1RBT A;  3IMX A;  1S1V A;  3O4N A;  5AZI A;  2R7Y A;  4FJL A;  2OPP A;  4DV4 K;  3AVG A;  2A3Z A;  3WEE B;  4E7J A;  3NGI A;  1MDU B;  4WQ5 C;  4IG3 A;  1JKH A;  3O4Q A;  1TKT A;  3VF4 A;  2ZQB A;  4M41 A;  1BO5 O;  4O4G A;  3DLR A;  4A62 A;  5C25 A;  4Z0U A;  2HB5 A;  4EP4 A;  1WSE A;  3C7N A;  4C8N A;  2YNI A;  2CGK A;  1B9D A;  4YOU A;  5T7B A;  4BRN A;  4MO4 A;  1TUU A;  2RPI A;  2WON A;  4DV3 K;  2AA4 A;  3KJV A;  4W5N A;  2HBJ A;  3H6E A;  5KQ8 A;  2Y1I A;  4H0T B;  4BGA A;  4X66 K;  2QI2 A;  3OYL A;  3D2F A;  5HLF A;  4CZK A;  1GOC A;  1F21 A;  5JLH A;  4BY9 C;  4FJN A;  3B6P A;  5HRO A;  3FZL A;  4ELV A;  2VQF K;  4YOY A;  1HNW K;  1YIJ N;  4L3Q A;  4NYF A;  1C1A A;  4A57 A;  3VA3 A;  4C23 A;  3G10 A;  1B9F A;  4F8R A;  4I2Q A;  4BRH A;  4KH6 A;  4MO5 A;  4CGJ A;  4JKC A;  3SUO A;  3MN7 A;  2NRZ A;  4Q5V A;  1VQP N;  2P1J A;  2W40 A;  1QHT A;  3VQE A;  3CCU N;  2O4I A;  2OA8 A;  4ISE A;  1HNX K;  5JVH L;  4OPH A;  3IAY A;  3LAL A;  3OA9 A;  1TK0 A;  3LM2 A;  3OYM A;  3VEY A;  3R6M A;  3P4I A;  2Q3S A;  4ICL A;  3SBT A;  1K6Y A;  4BDY A;  4EFH A;  3DLH A;  3RR7 A;  1VQK N;  4AF1 A;  1YVN A;  2ZGZ A;  1BI4 A;  4ID5 A;  1MWK A;  3IRX A;  4GKK K;  4EIA A;  3AGR A;  3G25 A;  3IG1 A;  2X78 A;  2G8H A;  4F4K A;  2DFF A;  4CFC A;  4QAG A;  4WCE L;  2UUA K;  4BC5 A;  3SYZ A;  4DS4 A;  4FVM A;  4H03 B;  3UKU A;  3LDQ A;  1M90 O;  4B9L A;  1UA0 A;  5BN8 A;  5KPT A;  3U3G A;  1NGI A;  1D9D A;  3FFK B;  1FJG K;  2F96 A;  5KTQ A;  1IH7 A;  4B9M A;  2OTJ N;  4C8O A;  1RIL A;  4B1Y B;  1LCU A;  4IEE A;  1CZA N;  5AQZ A;  1RBU A;  3ULE B;  3VN5 A;  4Z4F A;  1NGC A;  4Q0B A;  3DOK A;  1JCE A;  3QET A;  4AHS A;  1ITG A;  2JGU A;  3QO9 A;  4KHQ A;  1RTH A;  3BEX A;  1VQL N;  4E1M A;  4RW8 A;  2HND A;  4B1W B;  1TK8 A;  1YHQ N;  4UQG A;  2I7P A;  1TYQ A;  3CM6 A;  4UY8 O;  3CD6 N;  3RTV A;  1QS4 A;  1YJ9 N;  1VQO N;  5AQG A;  5IWA K;  3PSI A;  4JI6 K;  5EY4 A;  1SKW A;  1KQS M;  2QWO A;  4H5V A;  1EX4 A;  3CFO A;  4CEQ A;  4IZ9 A;  4CJ5 A;  1VSF A;  3B6O A;  4LF8 K;  4FWS A;  4CFA A;  1HRH A;  5MLC Q;  3F2K A;  3SQ0 A;  1QVF M;  2FSJ A;  4K42 A;  4KHU A;  1JLF A;  2RHK A;  4JKA A;  3MCA B;  5DMR A;  3O80 A;  2D1K A;  1EWR A;  2HHH K;  4RW6 A;  4KH4 A;  2HHT A;  4JHD A;  5TKW A;  5M1P A;  1LAW A;  1S3X A;  4E89 A;  4PUO A;  3GG4 A;  2NUB A;  1FKO A;  4BWJ A;  3R3L A;  3V1R A;  4WFA L;  3LZJ A;  1NGA A;  1X9W A;  2HF3 A;  4FK2 A;  4FJ8 A;  1ZBH A;  3LDN A;  1NK7 A;  5AQU A;  3I55 N;  3ALY A;  1EQY A;  1WBD A;  4CGI A;  4KI6 A;  1W0H A;  1C1B A;  4IG0 A;  3ZX3 A;  4OKK A;  4BR5 A;  3FR0 A;  2A40 A;  4C8K A;  4IOA L;  1GLE G;  4G9Z A;  2DY4 A;  1KAY A;  1NK6 A;  4CBW A;  2W41 A;  4H8K A;  5CZ2 A;  3FFI A;  3CXC M;  4MQ3 A;  3NF7 A;  4FJH A;  4CFB A;  5HRS A;  1QSY A;  3KTQ A;  1BUP A;  4IBN A;  3CPW M;  4QCL A;  4BR4 A;  4DQS A;  4KKO A;  2KW4 A;  2A6A A;  3BUZ B;  2IAJ A;  2O8D A;  4DV7 K;  5AQX A;  2ITM A;  1HKB A;  2FBY A;  2KLA A;  1NMD A;  1NG9 A;  4O55 A;  3K5N A;  4CED A;  4CER A;  3DXM B;  3HP6 A;  4CES A;  1X9S A;  4CEA A;  5DM6 L;  3DRR A;  4XH4 A;  2QK9 A;  4CJF A;  3HOS A;  4BE2 A;  2YNF A;  4DU4 A;  3SUP A;  1J5E K;  4K8X A;  3A8Y A;  1BDG A;  1C0M A;  4J8F A;  1VSL A;  3T3F A;  1TKZ A;  4CK1 A;  4H5R A;  4FOE A;  4HUF A;  1Y64 A;  3ITH A;  3CJ9 A;  5FPM A;  2P9N A;  5CR4 A;  1C0F A;  1TKX A;  3DI6 A;  3MX5 A;  4XEI A;  1YUW A;  1JCF A;  1NOZ A;  1BCO A;  2YCH A;  2G8V A;  5GAE P;  4BRI A;  3HM8 A;  1BHL A;  3QB0 A;  2Y1J A;  3DRP A;  3U9D A;  5LJW A;  4M3R A;  3FZK A;  1RDD A;  5DK5 A;  2HF4 A;  1NK5 A;  1ZBS A;  2PBD A;  3AVF A;  3C95 A;  1RT1 A;  3W3D A;  1SKR A;  2E1Y A;  4M7Y A;  4CGD A;  2BGG A;  2NZT A;  3QIO A;  1N33 K;  4PWD A;  1YVU A;  4C1N K;  3SQ2 A;  4M3Y A;  2NRT A;  4LF4 K;  1JJ2 M;  1RTJ A;  5AQV A;  3TTD A;  3M8R A;  4LFA K;  4FWK A;  4AHV A;  1LV5 A;  1JL2 A;  2F9T A;  3THV A;  4M3T A;  4CJ7 A;  3UIQ A;  4YOR A;  2A5X A;  3C0B A;  3HM9 A;  2E2N A;  5F0X A;  3GOI A;  4PKI A;  3O8M A;  4YOX A;  4LF6 K;  2FLO A;  4I6M B;  3NH1 A;  3GBT A;  4DV1 K;  3V9Z A;  1VQ7 N;  1I39 A;  4FLZ A;  5AFU H;  5AQY A;  2G8U A;  4BC2 A;  1SV5 A;  1UAX A;  5AQJ A;  1TL3 A;  5KRT A;  4ISF A;  2HBL A;  2P9U B;  4FZY A;  2OZM A;  5LY3 A;  4KHN A;  3U4L A;  3G0Z A;  1S6P A;  5AFU A;  2OPQ A;  1BA1 A;  2YV0 X;  3TI0 A;  2VG5 A;  3SUN A;  2VWJ A;  3M6G A;  4QS7 A;  2QWN A;  2P9L A;  4FW2 A;  3HI0 A;  1JXB A;  3BF1 A;  4BR2 A;  3MED A;  4ILJ A;  4KB1 A;  2VGM A;  4DV2 K;  4N47 A;  4YOV A;  5C24 A;  3DRS A;  4LY7 A;  2E4L A;  1MU2 A;  4DTN A;  1ATS A;  3FGU A;  3VQ8 A;  4B3M K;  4HCC A;  3VEW A;  3ZEU B;  4WF9 L;  3OYN A;  1D5A A;  4PKH A;  4H0Y B;  3HJF A;  4F3O A;  4JI0 K;  1DEJ A;  4CJQ A;  3ZX2 A;  3L2Q A;  3QIC A;  1NGH A;  2HHX A;  3WNG A;  3THW B;  1GLC G;  2NNW A;  5AQS A;  2IC3 A;  3UE5 A;  4LSL A;  3OHR A;  3L0Q A;  3M8S A;  1GLA G;  1XC3 A;  4JKH A;  1HKC A;  4FLU A;  4N5S A;  3T19 A;  4Z4G A;  4BRE A;  1UOC A;  4MDA A;  5CY4 A;  1VQM N;  4KHY A;  2HVH A;  3OY9 A;  4BRG A;  4E0D A;  1VQ9 N;  4B9Q A;  3SI6 A;  4HUE A;  4YNQ A;  1S1X A;  4FXD A;  5AZJ A;  4CJ3 A;  4NXN K;  1JLE A;  3AGK A;  5LL6 Z;  3EYZ A;  5AQW A;  2YHY A;  5LJV A;  2IVN A;  1E4F T;  3ISN C;  3ATV A;  4Y1D A;  5J2M A;  4DR3 K;  3LM9 A;  4NYN A;  1FK9 A;  2HMP A;  1YAG A;  4O44 A;  1K8K B;  1NLV A;  5C12 A;  1CXU A;  3F9K A;  4DSI A;  4GVE A;  3NF9 A;  5J2P A;  2GEM A;  2UU9 K;  1ZBL A;  3S3O A;  3BZC A;  3CIP A;  3F5T A;  3NFA A;  1RFQ A;  4JI5 K;  4FJM A;  3H3N O;  4DQQ A;  3ZT1 A;  5FLX O;  2Q2R A;  1W2B M;  4CE9 A;  3OYD A;  4CF9 A;  4CJV A;  3LDS A;  2F8T A;  4Z4H A;  4OVL A;  4ID1 A;  2P9K A;  3U9Z A;  4OPA A;  2HHQ A;  4EZ9 A;  2HHW A;  3KLG A;  3ATU A;  4DR1 K;  4RW7 A;  4C8M A;  4DQI A;  1GOB A;  4CHQ A;  4BQL A;  1UWB A;  3KKR A;  5KQD A;  2ETJ A;  4BR9 A;  4FYD A;  4CBU A;  5FPE A;  4CCH A;  3VQ4 A;  3VPZ A;  4DFJ A;  3CET A;  3Q7B A;  3DWL A;  2PY5 A;  1C1C A;  3D2E B;  1K8A O;  4CF1 A;  5A2Q O;  4B9S A;  2E88 A;  5GAG P;  5JVG L;  1KAZ A;  3A2F A;  2GWJ A;  2EX3 A;  4RG8 A;  3O4W A;  2F8S A;  4O8K A;  1RDC A;  1WSH A;  4J2B A;  1L3S A;  3D7E O;  3ZSX A;  2OPR A;  2GX9 A;  3KD5 E;  1KXP A;  1VSD A;  3VA0 A;  4YY3 K;  3KK1 A;  4CJ4 A;  1TVR A;  4BGB A;  4CEE A;  4FVU A;  2ATQ A;  4DUY K;  1QE1 A;  1LW2 A;  1IO2 A;  3ENB A;  4W5O A;  1N8R O;  1CXQ A;  4DWI A;  2F9W A;  3AO4 A;  4CEF A;  1A5V A;  3CG7 A;  1HLU A;  1D9F A;  5K14 A;  4FO0 A;  5E84 A;  5F2R A;  1QVG M;  3MWT A;  3ULE A;  3SV3 A;  4Z4C A;  1WAJ A;  2FBT A;  1HKG A;  1ASW A;  4AQY K;  4CJK A;  2IOC A;  3H46 O;  4O0J A;  3JS6 A;  4E1J A;  2P9S B;  4CHN A;  3NAE A;  3ZSQ A;  3QML A;  4DQR A;  3T69 A;  1X3N A;  3K5M A;  2E2P A;  1LW0 A;  4K8Z A;  3V1Q A;  4H5W A;  1SAZ A;  2UUB K;  3K2P A;  4B9V A;  1NNE A;  1XC9 A;  2WC9 A;  3TAG A;  2O8E A;  4QS9 A;  3R1X A;  4XH5 A;  2GBZ A;  2Q1N A;  4K41 A;  3SJH A;  3CM5 A;  3JAM O;  3E9O A;  3E9P A;  3AVC A;  1J6Z A;  1WUA A;  1NK4 A;  3BY5 A;  1Q9X A;  1T7P A;  3NF6 A;  2Z1I A;  3VEN A;  3I56 N;  3AVM A;  3HXM A;  1VQ4 N;  1SS6 A;  3BF3 A;  1ESV A;  3THY B;  2EWS A;  2G8W A;  1BWF O;  1NOY A;  3TU5 A;  1RDU A;  1JLB A;  4RCH A;  4CJU A;  4MLE A;  1W97 L;  3KWI A;  4RW9 A;  5BR8 K;  4M3Z A;  3SNN A;  4KRE A;  2YJF A;  4WFB L;  3ULD A;  2YNH A;  2WFB A;  1MA9 B;  1DT9 A;  2IDO A;  3KD1 E;  4OO1 J;  4OKE A;  4CHY A;  1VK0 A;  5EX5 A;  3HP9 A;  4DF4 A;  3KLE A;  1WSJ A;  1UA1 A;  3MWP A;  2B5J A;  2W42 A;  4NO7 A;  2XY6 A;  4JI7 K;  4JS4 A;  5JLF A;  2RKI A;  4FLW A;  1XMQ K;  1C0U A;  3QIN A;  3D6R A;  1WAF A;  3HTV A;  4W5Q A;  5ELZ A;  3SMS A;  3E01 A;  3L2R A;  3PX4 A;  2QWM A;  4IJA A;  1VSI A;  3VTH A;  1G99 A;  4CGF A;  5KGX A;  4BR0 A;  4DSK A;  4ILG B;  1ATN A;  4CFD A;  3TAM A;  1HYV A;  2ZWH A;  3CPE A;  2CH6 A;  1XNR K;  3OBW A;  3JYT A;  3N4Q A;  3LL3 A;  3IFR A;  4FWL A;  3VGM A;  4A2A A;  1KVC A;  1VRT A;  3K57 A;  2I7N A;  2WUS A;  2O8C B;  2FF6 A;  3PIP L;  3DXM A;  2VWB A;  3O3F A;  2G8F A;  3L4Q A;  3WXL A;  4XH1 A;  4CVN E;  1N6Q A;  4PKG A;  4ELT A;  5C15 A;  1BIS A;  3HSC A;  1HNV A;  1NGB A;  3P5J A;  5I9E B;  4HUG A;  4A59 A;  3KIO A;  3OYF A;  3OS0 A;  2P5G A;  1TL1 A;  4DKW A;  2P51 A;  3RMD A;  2IGI A;  3RMB A;  1ASU A;  4KHW A;  4V19 S;  1EWQ A;  5C2D A;  3EZW A;  1K73 O;  3MAQ A;  4M3W A;  1RBS A;  4MFB A;  1NJZ A;  4BRA A;  1VQN N;  3KK3 A;  4K0K K;  3CI5 A;  3MMV A;  4DTR A;  1NJX A;  5KPZ A;  3RMC A;  1Q18 A;  4AH9 A;  2D5R A;  3O9Q A;  4CEC A;  4N41 A;  1OH5 A;  1WLJ A;  2QKK A;  4K43 A;  4B8C A;  1HR0 K;  1VRU A;  3CJB A;  5AQR A;  4M3X A;  4DTS A;  3VOV A;  4AHR A;  4FPB A;  4FK4 A;  4Y0W A;  4IFV A;  2G8K A;  1XI1 A;  2KHO A;  5AQH A;  3CFR A;  4KTW A;  1HJR A;  4NXM K;  1IBL K;  1XWL A;  3R9P A;  1NGF A;  3HOT A;  3O1W A;  3V4I A;  1SKS A;  1BL3 A;  2UXD K;  1U47 A;  3SK3 A;  4FPA A;  5BR9 A;  3PIO L;  3MXM A;  3CCM N;  4CK2 A;  3NH0 A;  2FBX A;  3QIP A;  4FLV A;  3O08 A;  4KFB A;  2ASP A;  1NWK A;  4N76 A;  1E4G T;  1DGK N;  4I6M A;  4I9Q A;  1G15 A;  3P1G A;  1OVY A;  4BG8 A;  4BE0 A;  1IG9 A;  5D3G A;  3D0P A;  4BG9 A;  2GUI A;  3J81 O;  1RTI A;  4CZG A;  1Y97 A;  3SAF A;  2E6M A;  1RT3 A;  3EE9 A;  4IEI A;  4HHT A;  1KRP A;  1VSM A;  3AVN A;  1S1W A;  4OGE A;  5BPN A;  3S3M A;  1SUQ A;  5AQM A;  1NBW A;  3V9U A;  4FJ9 A;  4EHT A;  4IWV A;  1WB9 A;  1K9M O;  1WSF A;  1J9A A;  1HQU A;  1IKY A;  1XHX A;  5KPR A;  3ZT0 A;  1NGG A;  3JXU A;  4BWM A;  5C10 A;  1J53 A;  3DMJ A;  4EHU A;  3WXI A;  4FLT A;  2UUC K;  4CZH A;  4B9T A;  4MDB A;  1TUY A;  1KVA A;  4M42 A;  3KLF A;  2QXF A;  3EE8 A;  4JI8 K;  3WUH A;  4AHU A;  3C6U A;  4B08 A;  2Q0R A;  2KZM A;  3KHY A;  4ISG A;  1BCM A;  4JKG A;  3DXK B;  3LAN A;  4CGG A;  2AP1 A;  3I33 A;  4I2P A;  1WN7 A;  3SQ1 A;  5I3U A;  1YTU A;  3G4S N;  1RT5 A;  4DR6 K;  2G8I A;  4B3R K;  4FM2 A;  4E19 A;  2D0A A;  5GIN A;  4BRK A;  3O9U A;  4LF9 K;  1T8E A;  2X6N A;  1S1U A;  5HRN A;  4DG1 A;  3P39 A;  4C8L A;  2RF2 A;  4F2S A;  1IKV A;  3H1Q A;  3WXJ A;  3FZF A;  3AVA A;  4L8R B;  1W9H A;  1ZBI A;  3J7A P;  4DFM A;  3K0S A;  3ZET A;  4DFP A;  3LDL A;  3A0I X;  3TAN A;  1EXQ A;  3D45 A;  4IOC L;  4H4M A;  2OCE A;  3VGL A;  4DQP A;  4JAX A;  3AVI A;  1NJY A;  4H0O A;  1XHZ A;  1U2V A;  1K8K A;  2O8F B;  1O1W A;  3TAP A;  3E1Y A;  3UKR A;  4NB4 A;  3C6A A;  3RMA A;  3KKS A;  4BAC A;  3ZSW A;  4DHY A;  3C6H A;  4KPY A;  1FW6 A;  2ZD1 A;  1TAQ A;  4CJW A;  3WXM B;  2W6K A;  3T1Y K;  4M45 A;  2ZE2 A;  3VGK A;  5AR0 A;  4KAZ A;  3NVM A;  3MXI A;  1HMV A;  3UB5 A;  4B1Z A;  4E3S A;  3CJ1 A;  3HPO A;  3SQ4 A;  4YDU A;  4RW4 A;  1DTQ A;  1XUP O;  2JWK A;  4CIF A;  2Z1J A;  3NF8 A;  3NE6 A;  4CF0 A;  1U04 A;  4R5P A;  1Q7Y O;  2O8B B;  4CK3 A;  3ENH A;  4JI1 K;  3FZM A;  2DFH A;  3OYH A;  4X65 K;  3TSQ A;  3MEE A;  2ZF5 O;  3CQX A;  3K9J A;  3DYA A;  4Z4I A;  1TYQ B;  3TTF A;  1T03 A;  1LWC A;  2QA4 N;  3U8X A;  1KAX A;  3D2E A;  2UXB K;  3AVJ A;  1ZYQ A;  3AA2 A;  4FWP A;  1TK5 A;  1KD1 O;  2E20 A;  4KRF A;  3R8E A;  4H0P A;  4BDZ A;  3EKS A;  5JS2 A;  4OJR A;  3V9S A;  2UXC K;  4JK8 A;  4JI4 K;  4RTF D;  3FZH A;  1BQM A;  4YDU C;  3OYJ A;  2FSK A;  2V51 B;  1Z05 A;  1HYS A;  1CLQ A;  4XIU A;  3E9L A;  2ZJR L;  2QEX N;  4O5F A;  4FJJ A;  1M1K O;  3OYK A;  3RVC A;  3TAE A;  4KV8 A;  4IDH A;  3J8A A;  4CJS A;  3WNF A;  1OVQ A;  3PSF A;  3TR8 A;  4FJI A;  3DJC A;  1WBB A;  4WQ4 A;  4PQU A;  1GOA A;  1X3M A;  3HZ6 A;  5FRO A;  2Z1G A;  1L3V A;  2PFU A;  3KZB A;  1C0T A;  3M5R A;  1GLD G;  4YOT A;  5KGW A;  1JLC A;  2E8A A;  2HNZ A;  3WEE A;  4FCY A;  1T05 A;  4JS5 A;  5GIO A;  1KCF A;  3CCV N;  2ASM A;  1N34 K;  1VSH A;  3C94 A;  4WFN L;  5IT9 O;  2BTF A;  3AVB A;  3I0S A;  4JD2 B;  2O8D B;  3K58 A;  4OKJ A;  3THY A;  3KWG A;  1IJJ A;  5BN9 A;  4IO8 A;  3H1V X;  1OH8 A;  5AQL A;  1YF5 L; 
#chains in the Genus database with same CATH homology
 4RW8 A;  2HND A;  4DTU A;  1TK8 A;  3AVC A;  1KLN A;  1Z25 A;  1NK4 A;  4UQG A;  1RTD A;  1Q9X A;  1T7P A;  3ZT4 A;  3ASM A;  3NHG A;  3NF6 A;  3V6D A;  2Z1I A;  4CF2 A;  1DLO A;  1TKD A;  3AVM A;  3CM6 A;  3HXM A;  1RT4 A;  3RTV A;  1QS4 A;  1NK8 A;  1J5O A;  1L3U A;  2HW3 A;  3LP1 A;  3V1O A;  4DTM A;  2G8W A;  4IFY A;  1NOY A;  4FM0 A;  2HVI A;  1JLB A;  4AHC A;  4CJU A;  4FJK A;  4DTO A;  3PUF A;  4M3U A;  3VQP A;  4RW9 A;  5HRP A;  2YNG A;  4ZTJ A;  1SKW A;  4M3Z A;  4CEZ A;  3SNN A;  4KRE A;  1EX4 A;  3CFO A;  4CEQ A;  5SWM A;  4CJ5 A;  1VSF A;  3B6O A;  4HVJ A;  2B4J A;  2IS3 A;  3M8P A;  2YNH A;  2GV9 A;  4CFA A;  3ULD A;  1HRH A;  1HYZ A;  3RRH A;  2IDO A;  3SQ0 A;  2X6S A;  3KD1 E;  3QEX A;  4OKE A;  4CHY A;  1HPZ A;  4JRQ A;  1VK0 A;  4KHU A;  1JLF A;  3HP9 A;  4DFK A;  4CF8 A;  5DMR A;  1TV6 A;  3KLE A;  4DF4 A;  4FJX A;  4I7F A;  3RR8 A;  1WSJ A;  1UA1 A;  4RW6 A;  3KLH A;  2B5J A;  2HHT A;  2W42 A;  4M42 A;  2BDP A;  4KTZ A;  5CYQ A;  5HRR A;  5CZ1 A;  2XY6 A;  1JLA A;  5FRN A;  4JS4 A;  1ASV A;  1IKX A;  4BE1 A;  3DLB A;  1LAW A;  2RKI A;  4FLW A;  1C0U A;  3QIN A;  2RN2 A;  4E89 A;  1VSJ A;  1WAF A;  1NKC A;  4FZX C;  4W5Q A;  4PUO A;  2E6L A;  3E01 A;  3L2R A;  2O4G A;  3PX4 A;  4ZTF A;  2NUB A;  4W5T A;  4O0I A;  1FKO A;  4BWJ A;  2HNY A;  1BGX T;  3V1R A;  1EET A;  3HYF A;  3LZJ A;  1VSI A;  3AVL A;  1X9W A;  1S5J A;  4CGF A;  5KGX A;  4FJ8 A;  4FK2 A;  1ZBH A;  4DSK A;  4KTQ A;  1NK7 A;  3ALY A;  4CFD A;  3TAM A;  3O3H A;  4KI6 A;  4CGI A;  1HYV A;  4GVM A;  3VQ9 A;  2Z1H A;  1W0H A;  1C1B A;  4IG0 A;  1VSE A;  4DSL A;  4NCA A;  4OKK A;  3JYT A;  3NCI A;  2HHV A;  4E7K A;  4FW1 A;  4C8K A;  1LAV A;  1KVC A;  4EP5 A;  2DY4 A;  4NCG A;  1VRT A;  3K57 A;  3DLK A;  3AA4 A;  1NK6 A;  2XO7 A;  1VSK A;  4H8K A;  5CZ2 A;  3FFI A;  3M8Q A;  4MQ3 A;  3NBP A;  3NF7 A;  4CEO A;  3O3F A;  2G8F A;  4FJH A;  4CFB A;  1RBV A;  5HRS A;  2XHB A;  5I42 A;  1Q8I A;  1QSY A;  3KTQ A;  3RWU A;  1LWE A;  1N6Q A;  4IBN A;  2BE2 A;  4ELT A;  4FJ7 A;  1YTA A;  1BIS A;  1S9E A;  4QCL A;  4DQS A;  1HNV A;  4KKO A;  2KW4 A;  4HUG A;  3P5J A;  4LH4 A;  3KIO A;  2IAJ A;  3OYF A;  3L2W A;  3CQ8 A;  1TGO A;  4CGH A;  3LWM A;  3OS0 A;  1U49 A;  1U48 A;  2P5G A;  4J2A A;  2FBY A;  1TL1 A;  1X9M A;  3OVN A;  4O55 A;  4CJP A;  3K5N A;  2P51 A;  4CED A;  4CER A;  3RMD A;  2IGI A;  3RMB A;  3HP6 A;  4CES A;  1X9S A;  1N5Y A;  1ASU A;  3MXJ A;  3ZSV A;  2A1S A;  4CEA A;  4KHW A;  3TWH A;  3DRR A;  2QK9 A;  1R0A A;  3SJJ A;  4CJF A;  4CJL A;  1C6V A;  2YNF A;  4BE2 A;  4DU4 A;  3SUP A;  4K8X A;  3MAQ A;  4E7L A;  3U3Y A;  4M3W A;  4CIG A;  2HMI A;  4B9U A;  2B6A A;  1C0M A;  1RBS A;  5FRM A;  3WNE A;  4MFB A;  3P83 D;  1VSL A;  3T3F A;  1BIU A;  1TKZ A;  3K5L A;  3KK3 A;  4CK1 A;  1NJZ A;  3OYC A;  3VQQ A;  3VQ7 A;  4HUF A;  1TAU A;  4J2D A;  4DTR A;  1NJX A;  4GMJ B;  1U45 A;  1WSI A;  3RMC A;  2PYL A;  4JLH A;  3S9H A;  4CHZ A;  1FXX A;  3ITH A;  4AH9 A;  4DSE A;  2D5R A;  4AHT A;  3AV9 A;  3QNN A;  3HL8 A;  1TKX A;  3OYA A;  3DI6 A;  4CEC A;  3DLE A;  4OPJ A;  4N41 A;  1WLJ A;  4LD0 A;  1JL1 A;  3OYE A;  3S3N A;  2QKK A;  4B8C A;  1L3T A;  1NOZ A;  1BCO A;  1VRU A;  1A5W A;  2G8V A;  2KZZ A;  3HPG A;  3DM2 A;  4M3X A;  1S9G A;  4F2R A;  4DLE A;  3U6F A;  1BHL A;  3L8B A;  1NK9 A;  4DTS A;  4AHR A;  4FK4 A;  4OGC A;  3WNH A;  4IFV A;  3BGR A;  2OZS A;  2G8K A;  2Y1J A;  3QES A;  3DRP A;  5HBM A;  1XI1 A;  3CFR A;  2XY8 A;  4FLY A;  4KTW A;  3TAF A;  1HJR A;  1REV A;  3TAB A;  4M3R A;  1XWL A;  4E7I A;  1KFS A;  3AO1 A;  2XY5 A;  1SKS A;  3V4I A;  1RDD A;  5DK5 A;  1NK5 A;  1BL3 A;  4GW6 A;  3AA5 X;  4AIL C;  3AVF A;  1U47 A;  3C95 A;  1RT1 A;  1SKR A;  3HT3 A;  2KQ2 A;  3CYM A;  3OJU A;  3QEV A;  3MXM A;  1D8Y A;  1NJW A;  4CGD A;  4G1Q A;  4CK2 A;  3NH0 A;  1JLG A;  2FBX A;  2BGG A;  3QIP A;  4CJR A;  4O5B A;  4B8A B;  4F3T A;  2HHU A;  2HHS A;  3AVH A;  1KVB A;  2D0C A;  3QIO A;  2JLE A;  4KFB A;  4FLV A;  4PWD A;  1YVU A;  3VQD A;  1ZBU A;  2ITG A;  3SQ2 A;  4M3Y A;  4E1N A;  4N76 A;  4DTP A;  1I3A A;  1LWF A;  1RTJ A;  3NDK A;  4I9Q A;  2KFZ A;  4DS5 A;  1G15 A;  3P1G A;  1IG9 A;  1NKB A;  3M8R A;  4BE0 A;  4DTJ A;  5D3G A;  3D0P A;  2FBV A;  2GUI A;  4PA1 A;  1RTI A;  1Y97 A;  4AHV A;  2D0B A;  1LV5 A;  1JL2 A;  3THV A;  4M3T A;  4KI4 A;  2E6M A;  1RT3 A;  3UIQ A;  4BDP A;  4HHT A;  3PO5 A;  5JS1 A;  2YKM A;  3MEC A;  3H08 A;  1X1P A;  3HM9 A;  3ZCM A;  3TAQ A;  1KRP A;  3SUQ A;  5CYM A;  2VG6 A;  3EY1 A;  3C6T A;  1KFD A;  1VSM A;  3AVN A;  1RCH A;  3LZI A;  1S1W A;  4OGE A;  3S3M A;  5SZT A;  1SUQ A;  1KLM A;  3NH1 A;  4PY5 A;  3V9U A;  4KB0 A;  4CJE A;  3V9Z A;  4FJ9 A;  1I39 A;  4FLZ A;  1RT7 A;  1WSF A;  1J9A A;  4KHS A;  1HQU A;  1IKY A;  3DLG A;  1XHX A;  2G8U A;  2EHG A;  1SV5 A;  3ZT0 A;  1UAX A;  1WSG A;  4N56 A;  2YHB A;  3LWL A;  1TL3 A;  4BWM A;  3AO2 A;  1J53 A;  5KRT A;  3QEW A;  3DMJ A;  4FLT A;  1RNH A;  4B9T A;  4FZY A;  3KLI A;  1BIZ A;  4DLG A;  2OZM A;  4KHN A;  3G0Z A;  3ZSR A;  1KVA A;  1HNI A;  1S6P A;  3KLF A;  3O3G A;  2OPQ A;  2QXF A;  2YV0 X;  3ZT3 A;  3TI0 A;  4EZ6 A;  2VG5 A;  1QQC A;  4AHU A;  3C6U A;  1RBR A;  4B08 A;  3AVK A;  3VQB A;  1CZB A;  4OPK A;  1A5X A;  1EP4 A;  2VWJ A;  3SUN A;  3VQ5 A;  3PO4 A;  3LP3 A;  4FM1 A;  4FW2 A;  4W5R A;  2KTQ A;  4DSF A;  1BCM A;  1DTT A;  4CGG A;  1JXB A;  3LAN A;  3ZT2 A;  3MED A;  4E7H A;  3RRG A;  4KB1 A;  4OLB A;  4IDK A;  3OS1 A;  4N47 A;  4I2P A;  4FZZ A;  5C24 A;  1WN7 A;  3DRS A;  4LY7 A;  2E4L A;  3SPZ A;  1MU2 A;  4FK0 A;  4DTN A;  3SQ1 A;  3VQ6 A;  4I9L A;  3VQ8 A;  4DF8 A;  5I3U A;  1YTU A;  1RT5 A;  1ZBF A;  3VQA A;  1NKE A;  1Z26 A;  2G8I A;  4FM2 A;  3QER A;  4E19 A;  4B3O A;  2D0A A;  4CJT A;  3K59 A;  4HCC A;  4HCB A;  2VG7 A;  3OYN A;  1D5A A;  3AA3 A;  3SCX A;  2VWK A;  3EZ5 A;  3QEI A;  1T8E A;  3HO1 A;  2X6N A;  3PX0 A;  1S1U A;  4F3O A;  3HJF A;  1JXE A;  3HK2 A;  3ZSZ A;  1S6Q A;  3L3U A;  4Y1C A;  5J1E A;  2A1R A;  5HRN A;  3I0R A;  3LPU A;  5KI6 A;  4CJQ A;  4DG1 A;  3AO5 A;  1QSS A;  4C8L A;  3OYB A;  3V9W A;  2RF2 A;  2I5J A;  4F2S A;  4TSX A;  1IKV A;  3OYI A;  1RDA A;  3L2Q A;  1CZ9 A;  1SL0 A;  3AVA A;  2HHX A;  1HQE A;  3WNG A;  2PYJ A;  4B9N A;  4L8R B;  1NK0 A;  1W9H A;  2WOM A;  3DOL A;  2IC3 A;  1ZBI A;  4DFM A;  1J54 A;  1WNS A;  4KO0 A;  4LSL A;  3F73 A;  5EU7 A;  1FKP A;  4DFP A;  5KRS A;  3M8S A;  4WE1 A;  3TAN A;  1Q9Y A;  1KTQ A;  1EXQ A;  2BAN A;  3D45 A;  4ELU A;  4FLU A;  5J2Q A;  4N5S A;  4H4M A;  3HVR A;  4FLX A;  3PV8 A;  4DQP A;  3T19 A;  4Z4G A;  3AVI A;  3LPT A;  1UOC A;  4ZHR A;  5CY4 A;  3ZSY A;  5C42 A;  3NGZ A;  1NJY A;  4KHY A;  1XHZ A;  3OYG A;  3ZSO A;  2HVH A;  3OY9 A;  1O1W A;  3TAP A;  2OYQ A;  4E0D A;  3T1A A;  3JSM A;  3OS2 A;  2DTU A;  3SI6 A;  4HUE A;  1L5U A;  4YNQ A;  1S1X A;  4HTU A;  4FXD A;  3RMA A;  3KKS A;  3V9X A;  4CJ3 A;  5E41 A;  4JRP A;  4BAC A;  3ZSW A;  4DU3 A;  3QNO A;  1RBT A;  1JLE A;  1S1V A;  3L3V A;  3O4N A;  2R7Y A;  3EYZ A;  4FJL A;  2YKN A;  4KPY A;  2KZM A;  2OPP A;  2P5O A;  2ZD1 A;  1SL2 A;  1TAQ A;  4CJW A;  3QEP A;  3AVG A;  4OLA A;  3SZ2 A;  3ISN C;  2X74 A;  4E7J A;  4Y1D A;  4IG3 A;  4M45 A;  2ZE2 A;  3NGI A;  4NYN A;  1JKH A;  1FK9 A;  3O4Q A;  1TKT A;  5J2M A;  4KAZ A;  3MXI A;  1HMV A;  3LP2 A;  4FJG A;  2ZQB A;  4M41 A;  4O4G A;  3DLR A;  5C25 A;  3AO3 A;  4Z0U A;  4O44 A;  4E3S A;  3SPY A;  2HB5 A;  3LAK A;  4EP4 A;  3HPO A;  4J2E A;  1WSE A;  3SQ4 A;  2FC0 A;  3CFP A;  1CXU A;  4C8N A;  2YNI A;  1B92 A;  1DTQ A;  3K5O A;  4RW4 A;  3F9K A;  1QTM A;  4DSI A;  1B9D A;  4CIF A;  2Z1J A;  3NF8 A;  3NE6 A;  4CF0 A;  3NF9 A;  5J2P A;  5T7B A;  1U04 A;  1ZBL A;  4R5P A;  3SV4 A;  3S3O A;  3BDP A;  4H4O A;  4CK3 A;  3NFA A;  2RPI A;  2WON A;  2DFH A;  3OYH A;  4FJM A;  3KJV A;  4YFU A;  4DQQ A;  3ZT1 A;  3I8D A;  4W5N A;  3NH2 A;  3MEE A;  4CE9 A;  1RT2 A;  3OYD A;  4CF9 A;  3HVT A;  2Y1I A;  3OYL A;  4CJV A;  3LDS A;  2F8T A;  3DYA A;  4Z4I A;  3LP0 A;  4Z4H A;  4OVL A;  2AJQ A;  4ID1 A;  5HLF A;  2HHQ A;  4DU1 A;  1T03 A;  4EZ9 A;  2HHW A;  1GOC A;  1F21 A;  1LWC A;  3IS9 A;  3KLG A;  4FJN A;  3HST B;  3B6P A;  5HRO A;  3AVJ A;  1ZYQ A;  1SL1 A;  3AA2 A;  4RW7 A;  2OPS A;  4C8M A;  3VQC A;  4DMN A;  1TK5 A;  4ELV A;  4DQI A;  1GOB A;  4CHQ A;  1RDB A;  1UWB A;  4NYF A;  4KRF A;  1C1A A;  3KKR A;  3VA3 A;  1IKW A;  1BQN A;  2ETJ A;  3G10 A;  1B9F A;  4F8R A;  4FYD A;  3QLH A;  4BDZ A;  4QOZ B;  3HPH A;  4CCH A;  3VQ4 A;  4I2Q A;  4DFJ A;  5JS2 A;  4CGJ A;  4OJR A;  3V9S A;  2PY5 A;  3SUO A;  2XY7 A;  1C1C A;  4B9S A;  1BQM A;  4CF1 A;  4FJ5 A;  3OYJ A;  3L2U A;  3A2F A;  4Q5V A;  4DSJ A;  2P1J A;  2EX3 A;  4RG8 A;  1HYS A;  2F8S A;  1JLQ A;  1RDC A;  1QHT A;  1WSH A;  3VQE A;  4XIU A;  4J2B A;  1L3S A;  4NCB A;  1CLQ A;  2O4I A;  3ZSX A;  1QSL A;  3L2V A;  2OPR A;  3NGY A;  2OA8 A;  4LSN A;  3IAY A;  3LAL A;  1TK0 A;  3KD5 E;  1S1T A;  1VSD A;  3VA0 A;  3OYM A;  3KK1 A;  4FJJ A;  3OYK A;  3TAE A;  4KV8 A;  5J2N A;  4CJ4 A;  1TVR A;  2Q3S A;  4ICL A;  4CEE A;  2PZS A;  1K6Y A;  2DFE A;  2ATQ A;  4BDY A;  3MEG A;  3DLH A;  1QE1 A;  1LW2 A;  1IO2 A;  3WNF A;  4CJS A;  4W5O A;  3RR7 A;  3PX6 A;  3TR8 A;  3KK2 A;  4FJI A;  1BI4 A;  4ID5 A;  3IRX A;  1CXQ A;  1EKE A;  3V81 A;  4DWI A;  4PQU A;  1GOA A;  3IG1 A;  2X78 A;  3AO4 A;  4CEF A;  5HP1 A;  2G8H A;  4F4K A;  5FRO A;  2DFF A;  1A5V A;  3CG7 A;  1KSP A;  2Z1G A;  4CFC A;  4QAG A;  1L3V A;  1D9F A;  5K14 A;  2QKB A;  3SV3 A;  4Z4C A;  3SYZ A;  4IKF A;  1YT3 A;  4DS4 A;  4FVM A;  1WAJ A;  1RT6 A;  2FBT A;  3OJS A;  1C0T A;  5FDL A;  1ASW A;  4DTX A;  5KGW A;  4CIE A;  4CJK A;  1JLC A;  4B9L A;  2IOC A;  2HNZ A;  1BI4 B;  4FCY A;  1UA0 A;  1T05 A;  4O0J A;  2LSN A;  3LAM A;  3U3G A;  4JS5 A;  1KCF A;  3PY8 A;  4Z4E A;  1D9D A;  1VSH A;  3C94 A;  2KFN A;  3TAR A;  2F96 A;  4CHO A;  1IH7 A;  4CHN A;  5KTQ A;  3NAE A;  4B9M A;  4CEB A;  3ZSQ A;  4DQR A;  4C8O A;  1U4B A;  3AVB A;  1RIL A;  3I0S A;  3K5M A;  1LW0 A;  4K8Z A;  3V1Q A;  4LH5 A;  1RBU A;  3K58 A;  3VN5 A;  3K2P A;  4Z4F A;  4Q0B A;  4B9V A;  3DOK A;  4OKJ A;  2XRI A;  1XC9 A;  3QET A;  3TAG A;  4AHS A;  1ITG A;  2JGU A;  2GBZ A;  3QO9 A;  4KHQ A;  1RTH A;  3CM5 A;  2YHA A;  4CHP A;  4E1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...