1VHXA

Crystal structure of putative holliday junction resolvase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
SLRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFPKNMNGTVGPRGEASQTFAKVLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVIDKMAAVMILQGYLDSLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Holliday junction resolvase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 37
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.140 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 YqgF/RNase H-like domain 1vhxA00
1IV0A 2OCEA 3PSIA 3BZKA 1OVQA 1NU0A 1NMNA 3BZCA 3PSFA 1VHXA
chains in the Genus database with same CATH superfamily
5KGWA 3ZETB 4B08A 3KLEA 3J81O 5HP1A 3DOLA 4KHPK 3FFIA 3ZX2A 3I56N 1VQPN 4V19S 5EU7A 2NUBA 1SAZA 4OKEA 4DTJA 4FJNA 2W40A 3WUHA 2HVHA 3DI6A 4BR9A 4B1XB 3G25A 2E5LK 1YTUA 3V9XA 4KTWA 2HB5A 4I2PA 1KXPA 1NK8A 2XY8A 3K9JA 1BQMA 4JK9A 4M3WA 3F73A 1WBDA 4Z4FA 3V9ZA 3AA4A 3I0SA 3OA9A 3HM9A 5J2PA 4JI7K 2EWSA 2HMIA 4UQGA 2EHGA 1NM1A 5ELZA 4YOTA 4JRQA 4WE1A 1D9DA 1BA0A 5J2QA 4LF8K 4CJTA 4FWPA 2A1RA 1WN7A 4CD1A 4Q0BA 1C6VA 1LAWA 1KAYA 3KK1A 4FLWA 2GX9A 4I6MB 1YITN 1K8AO 1NGBA 1YIJN 1L3VA 3D2FB 1JLFA 3VF2A 1E3MA 4GVEA 3IMXA 3AVHA 1YVUA 4F2SA 3PIPL 4LC9B 3DXMA 5FROA 5AQVA 3E9LA 3IFRA 3L2WA 4B9VA 3NDKA 2GWJA 1XQSC 1J54A 5I9EB 3ZCMA 3JAMO 3HOSA 4HCBA 4DU1A 2P9IB 4QAGA 4WCEL 1RDWX 1B9DA 5AFUH 3O6WA 3SI6A 2I5JA 3T1HK 3CMAN 4BR0A 3VEZA 2B4JA 4LFAK 1QHTA 2I7NA 5KGXA 3HP6A 4RG8A 3LDNA 5AQMA 2UU9K 4FLYA 1S1XA 2FBVA 1EXQA 1Z25A 3GL1A 3KHYA 4BDZA 1C1CA 4X64K 4KPYA 4ID5A 4X62K 3P39A 2HHQA 3FLCO 1X9WA 1EKEA 4BREA 2D0PA 4DV5K 2BUPA 3CFOA 3CJ9A 1YUWA 3KLGA 5CYMA 1IBKK 4WFBL 3AY9A 4H5RA 1QTMA 4BDPA 4DQPA 5AQWA 3U8XA 5AR0A 3H3NO 3VQAA 1JJ2M 3CETA 1T7PA 4LF7K 2JWKA 4XH1A 4KHYA 3P38A 1NJXA 3UIQA 5HROA 2VWKA 3D7EO 4H4MA 4FOEA 1RTHA 4CJ3A 4E7JA 4CHQA 5LJVA 1ZBLA 1KVBA 1A5VA 5F2RA 4BR2A 4JI3K 4WYBA 1K8KA 4M3YA 4O5FA 1ATRA 3HTVA 4PY5A 4HWIA 5LMNK 4YORA 3FR0A 5JVGL 3BF3A 1U6ZA 4IG0A 5FPMA 5HLFA 4J8FA 3OY9A 5GIOA 4GV3A 3N4PA 2D5RA 3L2RA 1NJIO 1HNWK 4J2DA 3M8PA 5AJ3K 3H1QA 2OANA 3HYFA 4BG9A 2GUIA 3LWLA 4FM2A 1VRUA 1U49A 3KK2A 4M63C 2E1YA 2DFFA 4KV8A 4LSLA 3G4SN 3OS0A 1JXBA 3H45C 3E66A 3EL2A 2QWQA 2ZF5O 4BE1A 3TARA 5LY3A 2CH6A 1NGAA 4E3SA 2ZJRL 2F8TA 1IG8A 3VQCA 3VQ5A 3DLGA 1IG9A 5AQOA 3RSEB 5KRTA 4JI5K 1U45A 4DR5K 3LALA 4FK0A 3ZT1A 4GKKK 4IO8A 1YT3A 1TVRA 2R7YA 3UB5A 2RHKA 1CZBA 3DLRA 3C6HA 4EHTA 1XUPO 1T3VA 1BISA 4GKJK 4CJSA 4AHCA 2VQEK 2PZSA 4CGFA 5SWMA 1JCFA 1SL1A 3HT3A 1HUXA 3KWGA 1KFDA 3OBWA 4MO4A 4EHUA 3OYLA 1UA1A 2G8UA 4BDYA 3LP0A 1Q81O 5EXWA 3I33A 5KTQA 3QMLA 1YHQN 1SUQA 4BGAA 1ZBFA 4E7HA 2XHBA 1A5WA 3I8BA 4BRNA 3NGZA 3TSQA 4MFBA 2FF6A 3P5JA 4B1VA 3S3MA 1U4BA 3MMVA 2KQ2A 2BGGA 4FWMA 1RT2A 3D0PA 4FLVA 4KREA 3M1FA 1HKCA 4FJGA 2G8IA 2HNDA 4YOYA 3T1YK 3QLHA 1XC3A 4CEFA 3K59A 4DLEA 4FLZA 3M8SA 3SUQA 3LDSA 4NCBA 4LD0A 3SMSA 4BVOA 3VQ4A 3CIPA 1Q7YO 4JI1K 1HJOA 4LFCK 5HRRA 3PY8A 2YHWA 3V1QA 4RW8A 3WQUA 1X9MA 2QWPA 4FJLA 3CCQN 1C0TA 3VEOA 3NMUA 2E4LA 4B9TA 3CJ7A 1TYQA 4H0YB 4Q5VA 5K14A 4JRPA 4K43A 3A5OC 4Z4IA 3ZSZA 3THYB 2HBKA 1VSKA 4DR6K 4DKWA 4B3TK 4NO7A 3ASMA 3VQ6A 3GG4A 3ZETA 1A5XA 3QFUA 3O9TA 1N6QA 3A2FA 3ZX0A 3AVGA 3QNOA 2GWKA 2DFHA 2Z1GA 3KIOA 5GADP 4C1NK 1KVCA 4JKHA 5BPNA 3CQYA 2HHTA 4BROA 4OVLA 4JKGB 5D3GA 4I9LA 4JKFA 4DU3A 3K58A 1Q9XA 4PKGA 3HOTA 3KLHA 4B1WB 4O4GA 1HQEA 1RT3A 3WNFA 4M3XA 2HHHK 3VEWA 1O1WA 2P9LB 2QWNA 5AQPA 3I55N 4HUFA 1TKDA 2HHWA 4N56A 1HQUA 5E26A 4FSVA 2RKIA 1N8RO 4KRFA 3T7ZA 5LJWA 3MX2A 3SAFA 1XNQK 4DFJA 1IO2A 3AVNA 1RGIA 5AQTA 4M7YA 4BY9C 3OYIA 4CECA 4DTMA 3E1YA 1QQCA 2CGJA 4FL9A 4I6MA 3KJVA 4PWDA 3NGYA 3TTDA 4BC3A 4HCCA 3J80O 1D9FA 3D2FA 4AHRA 4JI0K 3HM8A 3AGKA 3HBTA 3NF9A 3MDQA 3CI5A 2G8KA 1Q82O 3VPZA 3AA5X 1WSGA 2E2QA 3OHRA 4BRFA 1D4XA 2DFEA 3ZSXA 4FZZA 3C7NB 3OTOK 3MEDA 3T19A 3LZIA 1LW2A 4OPAA 3DXKB 3L0QA 2P9IA 1EETA 1EX4A 4O8KA 4BC4A 4BRCA 4PL8A 3L3VA 4CZHA 2A40A 3K5LA 3BUZB 4CZGA 3OJUA 3DLHA 3L2QA 1HRHA 3L2UA 1NBWA 4BR7A 4BR5A 1U04A 5AZJB 3WXJA 2F96A 4E7LA 3ISNC 5AZIB 2UXDK 4JD2B 3O9RA 3QO9A 4WQ4A 2OA8A 4KI4A 2ATQA 1H1VA 3VGKA 3J8AA 1ZBUA 1XHZA 1WB9A 4JHDB 3SJJA 4HUEA 5KPRA 4KHQA 2GBZA 3CFRA 4CF2A 1IKYA 4GV9A 2RPIA 3OYJA 4FJJA 3O4NA 4BC5A 4GVMA 2QWRA 1WNSA 2H3GX 3KD5E 4FK4A 1HR0K 2KKZA 2HHXA 4JI6K 3QEXA 3RTVA 3AO2A 4JS4A 4CFAA 3MN6A 1N32K 2HNZA 4DMNA 1RTIA 2HMPA 4IG3A 4CBWA 1SL0A 4DFMA 4FJIA 4JI2K 4JKEA 4K0KK 3JYTA 3QEVA 1SQKA 5DM7L 2QK9A 4A59A 5FRMA 2FC0A 4CF1A 4A5AA 3DJCA 4FWOA 1RBUA 4KTZA 2E20A 3BZCA 3O5BA 4G1QA 2O8FB 1CZ9A 1P8ZA 5AQJA 2QEXN 2OPPA 3MEEA 4FLTA 5C15A 2Q36A 3WNGA 4KI6A 3BP8A 3OYDA 3U9ZA 2GUPA 2F7TA 2YI1A 4BE0A 1SKRA 1XHXA 2HOEA 4ZHRA 3RMDA 3C65A 3U9DA 3FZMA 5TKYA 5AQIA 5BN8A 1YI2N 3SQ1A 3OYHA 2HF3A 3CJAA 1FKPA 3O4WA 3HSCA 3TR8A 1VQON 3HL8A 4A57A 3PX0A 3SUOA 3EZ5A 4Z0UA 3SYZA 1E4FT 1NK4A 2NZTA 3FGUA 2X6SA 3RSEA 2BDPA 3TPQA 5C10A 5CZ2A 1VQ6N 4CJ5A 2A5XA 2NLXA 2CGLA 2GV9A 1GLBG 3RR8A 1N33K 3SUPA 3O08A 3FZKA 4QS9A 1J6ZA 3EEQA 1DTTA 3O9UA 1NGJA 3A8YA 2IVPA 3JSMA 1P90A 2UUCK 3C95A 5SZTA 3RR7A 3V1RA 4DSJA 1UA0A 4KH4A 3LP3A 4IJAA 1F21A 1NGEA 5IWAK 2ZJQL 5C25A 1LW0A 5AQFA 4IOXA 4YOWA 4CBXA 2YHYA 3TU5A 1UAXA 2ZWHA 1KRPA 1TGOA 1KC8O 1MA9B 2QKBA 2QWMA 4DV7K 3OYAA 3TAMA 3AA2A 3P1GA 1GOAA 1NKBA 2OTJN 4FWSA 4OPKA 1N5YA 2E1ZA 4XIUA 2ZM6K 2RF2A 4B3MK 1JLCA 3UKUB 4EIAA 5C42A 4LH5A 5M1NA 1IBMK 1EP4A 4CHOA 1NKEA 1S1WA 3THYA 4B3RK 5FPDA 5DK5A 1IKVA 2VWBA 3CJ1A 3WNEA 2KZMA 2P5OA 1C1BA 1FXXA 5F1XA 1QQMA 2NRVA 1D8YA 4B9NA 1JLAA 2F9TA 3VQPA 2X6NA 3QDKA 1CLQA 4QS7A 4EP4A 3CCJN 3V4IA 4BE2A 4DTPA 1NNEA 1HKBA 4DTOA 2HVIA 4JKGA 1XC9A 3CFPA 1KAXA 1LWEA 3AVCA 4W5TA 3F9MA 1NK5A 2VGNA 1NJWA 2VCPA 3FZFA 2QXLA 3AAPA 2P9LA 5AQLA 3NHGA 5GAEP 4QCLA 3M5RA 4JKDA 1HYZA 4H5WA 3FFKB 5DM6L 4CHYA 2BTFA 3WXLA 4CFDA 3H6EA 1VSHA 3KZBA 3OJSA 2NRXA 4BGBA 3B6PA 4DTXA 5KPTA 5AQQA 1C0UA 4IO9L 1S1UA 4F2RA 4DV3K 3L6QA 2XY5A 1HNXK 1NGGA 4JS5A 5MLCQ 4FJ5A 1QVFM 2F4VK 3C94A 4CEDA 1QHAA 3OYGA 2DY4A 2FBTA 5AQKA 3LP2A 4CIGA 4IOAL 3WQTA 4DQIA 3ZT2A 2HHVA 4MQ3A 3O9SA 3THWB 4M3ZA 1S5JA 3C7NA 4YNQA 3IUCA 2OYQA 3A5LC 3DLBA 3ID8A 2E8AA 3THVA 1S6QA 5JS2A 1Q9YA 2B5JA 1ZBHA 4O0IA 2VG5A 4E7KA 3CCUN 1RNHA 4M7XA 2O8BB 1ESVA 4LH4A 4CZJA 4BWJA 3TANA 4JKBA 1VSLA 3WXMB 2KZZA 2X78A 5AZIA 4JD2A 4FJKA 4YDUA 4JNEA 2XRIA 2UYTA 1NOYA 1O13A 4B1ZA 1W2BM 1BUPA 1NMDA 1ZXOA 2UUAK 5AQNA 4FZXC 4GY2B 4YHHK 1GOCA 3AAQA 2YCHA 3IKMA 3F5TA 4OLAA 1I39A 4G9ZA 2Q0RA 2BH1A 1KD1O 5M1PA 1KTQA 2CH5A 1W0HA 1RDAA 1NLVA 1LWFA 1RT7A 2CGKA 3VESA 3S9HA 1RBVA 2OCEA 5AQYA 3ZX3A 4DR7K 3FZLA 2YJEA 5JLFA 1MDUB 3LP1A 1IJJA 4WQ5C 4H5VA 2YHAA 3SV3A 3U6FA 2XY7A 3E9PA 1NGCA 2WOMA 4OKKA 3THXA 1BQNA 4OJRA 4CGDA 4CEAA 1BHLA 4ILHA 3L8BA 2Q3SA 3S3NA 4KH5A 3ZSOA 4RW6A 1X3MA 3UKRB 2O8FA 2V7ZA 3RMBA 2PYLA 3NFAA 2ZGZA 2V52B 3G71N 4IWVA 2O8EB 4K8ZA 3ZSQA 2P9UB 2OTLN 3CPEA 1GLAG 3HZ6A 2D4WA 3CPWM 4XH4A 1R0AA 1QSLA 2YKNA 3AVIA 3LPTA 4CD3A 1XNRK 2E88A 4N41A 3VENA 3KTQA 4HTUA 3O80A 4DS4A 2E2OA 2QI2A 3EKSA 4DV1K 1J5OA 1JL1A 5KI6A 1VSMA 4DB3A 1VSEA 2E2PA 4BVPA 4WF9L 4FVUA 4C8LA 2A41A 3AARA 5AQSA 3CJBA 3PX4A 3IRXA 3C6TA 5C2FA 3P4IA 4CGHA 4FCYA 3M3ZA 3K5NA 4KHNA 2UUBK 1YXQA 1BCMA 1YAGA 1FW6A 3V9WA 1TKTA 3RMAA 5FRNA 1N36K 2Z1HA 3MK6A 3J7AP 3R8EA 4FZYA 5CR4A 4LSNA 1ITGA 3ULEB 4B9LA 5LL6Z 4E89A 1C0FA 1BU6O 1MU2A 1I3AA 1QQOA 1QSYA 3PIOL 3ATUA 4FPBA 4DCHA 2NRWA 1DT9A 3BEXA 4M45A 4C1NI 4DF4A 1WUAA 3KLIA 2WUSA 4BR4A 1KCFA 2Q31A 3B8AX 4CJWA 1YJWN 1G15A 5BR8K 3PSIA 4DU4A 4FVMA 3L4IA 5M1OA 4DFKA 1D5AA 1BG3A 3PX6A 1GLLO 1YF5L 3VQ8A 1JLBA 5JICA 5GINA 1U2VB 4CJEA 3FE1A 4YOUA 3NF6A 2X74A 3O9QA 4J2BA 3K57A 4ELUA 4BRQA 1NGHA 4KHWA 3LWMA 1CXQA 2Z1IA 4M41A 2P9SB 4U7BA 3CXCM 3SPZA 2YKMA 2W6KA 4NCGA 1V4SA 5HBMA 4JV5K 1V4TA 1VSFA 1BOTO 3LM9A 4JYAK 3MAQA 5T7BA 1OVYA 3HPGA 3OYCA 4NYFA 1RBSA 4E7IA 4Y1DA 4C8NA 4CHPA 2FSJA 2IOCA 2YV0X 3VTHA 2ZE2A 4AM7A 4DR4K 3LAMA 3CHWA 1S1TA 2EX3A 2O8DB 2VGMA 5FPNA 1X1PA 1BIUA 2Q0UA 3MXIA 3AVJA 1TV6A 1N34K 1T6CA 3LDOA 4CEEA 2VWJA 2YHXA 1GLFO 2V7YA 5HRPA 1W9HA 4DTSA 5AQUA 3OBYA 1WSEA 1TK5A 4B9SA 1S22A 4NXMK 4MDBA 3CCEN 3R3LA 4HVJA 4IFVA 3CF5L 5F0XA 2OPRA 4F3OA 4RW7A 4CESA 3HI0A 3NH0A 3H3OB 4NCAA 4IOCL 4MLHA 4AHTA 2RN2A 4O8UA 4FWRA 2QKKA 4EP5A 1WSIA 4JK7A 1QE1A 5JS1A 4CJKA 4A61A 4H03B 1IV0A 4JN4A 1WAFA 4CK2A 3SBGA 5GAGP 2NRHA 3SMPA 3AA3A 3L3UA 1HJRA 1SV5A 3IDHA 1RDCA 4DR2K 4O0JA 2OZSA 3CCRN 3THWA 4ICLA 3OYEA 5GIPA 1BO5O 1TUYA 5BR9A 4CJLA 5JVHL 1OH5A 4LFBK 3A0IX 5I3UA 4B9UA 3SBTA 4OKJA 4CEQA 4K8XA 4GMJB 1RBRA 3KK3A 2O8BA 1ASVA 1L3TA 4FWLA 3O4QA 3AO3A 3HPOA 2Q2RA 4FW2A 1HKGA 3CM5A 1T03A 3NVKA 1OVQA 5C12A 2HW3A 2WFBA 4LF6K 2O4GA 4DSFA 3LANA 1Q18A 5M1KA 4CFBA 5CHIA 1KAZA 3C0BA 4OLBA 4CGGA 2HBJA 3SCXA 3ID6A 3VF4A 2JGUA 4JKCA 3O3HA 2WTUA 3VQ7A 4Y0WA 3VQQA 3P31A 3VQ9A 4KKOA 4GV6A 3ZEUB 2ZGYA 1IKXA 1ATSA 3HPHA 4I7FA 4K25A 3LDQA 3HP9A 4DSKA 2F9WA 3CCSN 3VETA 2E6LA 4EZ9A 4FLXA 3SQ0A 3HJFA 2VG7A 1ZBSA 3NF8A 3V6DA 2V51B 4DR3K 2ASOA 1BDGA 4CIFA 4GW6A 4FWKA 1FK9A 3QERA 1IKWA 3SK3A 1SKWA 1JLGA 5BPMA 1RTDA 4KAZA 3MXJA 2VYPA 1CXUA 5J1EA 4CEZA 2O8CB 4DQQA 1RCHA 3QIPA 1HNVA 1X3NA 3JXUA 2FBYA 3E01A 1ZBIA 1NJYA 4CERA 1NGDA 3UKRA 3LL3A 1SL2A 3RWUA 3O1BA 3DLLL 2AJQA 2KLAA 1DKGD 4M3RA 1HNZK 3GOIA 3NH2A 2O8EA 3C6UA 1GLJO 2NNWA 5J2MA 2A3ZA 2P9UA 3A5NC 1KQSM 1VQKN 2G8WA 3CCVN 2P9KB 2FXUA 3H46O 3NAEA 4BG8A 4JI8K 3L4QA 2WONA 5J2NA 3U4LA 2P9NB 2LSNA 1EQYA 4DV6K 4LY7A 1RBTA 4DSEA 3MWPA 4C8MA 1LCUA 3VQEA 4AHVA 3NCIA 3ULDA 5BRFA 3KKSA 2QWOA 2QWLA 2Q97A 1VRTA 1BA1A 4DWIA 4O44A 2D0AA 1FJGK 3VN5A 4LF9K 4W5OA 4C8KA 3A5MC 1ZC6A 3TAQA 4CJQA 3AO1A 1Y64A 1VQ7N 2GEMA 4DLGA 1XMOK 4I9QA 3W3DA 4WFAL 1JXEA 4MDAA 5LMUK 3GE1A 4C8OA 1VSJA 4ZTJA 1RFQA 1HYVA 3ULEA 3LZJA 3SQ2A 4FO0A 1OKJA 2PAVA 4H0PA 3RRGA 3H08A 4DV0K 2IC3A 4L8RB 4H4OA 1ZYQA 4FJHA 3I8DA 5M1QA 1RT4A 4PQUA 3L2VA 3AVBA 4CZFA 4IBNA 4N47A 1VK0A 3J7YP 2P5GA 3ATVA 4DG1A 2Y1IA 1RILA 3KK7A 1MWKA 3K0SA 5ADXA 3CCMN 4X65K 3DLKA 3KLFA 3SZ2A 4CCHA 1L5UA 3O8MA 5B8HA 1RT1A 4E1MA 4YOVA 1DLOA 3EN9A 1U2VA 3MECA 3K5MA 1I94K 3CM6A 4B9QA 4R79A 2VQFK 3MN9A 1LOTB 2VG6A 3DRRA 3ZSVA 1XMQK 3EKUA 2Z1JA 4A62A 2P9SA 4X66K 3IAYA 4IXCA 1W7AA 5E41A 3DAWA 4Z4HA 3VGLA 1BWFO 1HYSA 4AILC 4ISGA 4K42A 1R59O 1L3UA 4KBOA 4H0OA 2P1JA 4F9OA 4K41A 4IKFA 4FJ7A 1T8EA 4OGCA 4B3SK 3BZKA 3OYFA 4Z4GA 5EOYA 4CHNA 3T3FA 4L3QA 1K6YA 3MN5A 4KTQA 4E1JA 1BIZA 1NWKA 1XI1A 2O8DA 1EO1A 3TAGA 1Y97A 3EZWA 4H5TA 2G8VA 3WEEB 4BWMA 4YY3K 1VQ5N 5M1FA 3GDQA 4H0VB 4CJRA 3LDLA 4FJMA 3QBXA 3LM2A 3DM2A 3TTCA 4Z4EA 4BQLA 3DLEA 4AHUA 4DTNA 3FZHA 3V81A 2E6MA 1RDDA 3HO1A 1YTAA 4GNIA 4AH9A 5DMRA 3F9KA 4A2BA 1WSFA 3T69A 4KHSA 3KVGA 1BI4B 1U48A 4DTUA 4FJ8A 5A2QO 3IS9A 3LDPA 4H0XB 5HL7L 3MCAB 1OH6A 2E2NA 2HSTA 3O3FA 5KQDA 4KO0A 3DXKA 2ETJA 1J9AA 3F2KA 3CG7A 3MN7A 4EAHD 4FOIA 2Y1JA 1KLNA 1DGKN 4CJFA 5KQ8A 5HOOA 2HHSA 4AF1A 1B92A 1TL3A 2KW4A 4JKAA 4DTRA 4Z4CA 2FF3B 3V9UA 3J7ZO 1NG9A 4BRLA 5AZJA 1BCOA 1WAJA 3QNNA 4EZ6A 4QS8A 1Q8IA 1S72N 3ENOA 2D0CA 2YJFA 4C23A 4HHTA 4JHDA 2HNYA 3QINA 4J2EA 4A2AA 2JWLA 5E84A 1ATNA 4BRAA 3RMCA 1KVAA 4BRPA 1IH7A 2YNIA 2YHBA 4BRMA 2IVNA 1RT6A 3K5OA 4F4KA 2D0BA 2P9PB 3AVMA 4KHUA 3D45A 1JLQA 4CI6A 3V9SA 3CQ8A 1VSIA 5C0YA 5BN9A 3TWHA 4NLCA 1W97L 1OH8A 3V1OA 4W5QA 3W0LA 4FWNA 4CE9A 4WQ4C 2IDOA 2F8SA 3PV8A 3EYZA 4HUGA 1TK0A 1NK9A 3G10A 2KTQA 4M3TA 1HLUA 2FSNA 3HXMA 4O5BA 3ZEUA 3K9KA 2YNHA 4M3UA 1Z05A 2RE2A 3VQBA 3S3OA 4R5PA 1Z26A 4IDKA 4RCHA 4RWTA 3PLAA 1YJNN 4FWQA 1E4GT 3VA0A 2QTDA 3DMJA 4ELTA 4FW1A 3R1XA 1XWLA 1C0GA 3WXIA 3D2EB 5CE3A 4F3TA 4NLBA 2HBMA 2ASMA 3LPUA 2O8CA 1QQNA 1Q86O 1TL1A 3WT0A 1ILYA 4DS5A 4CEOA 3VTIA 2FSKA 3R9PA 4MO5A 1VQ4N 3AV9A 1CZAN 4EFHA 1U47A 1T44A 2HF4A 4BRDA 4DR1K 4E1NA 4JLHA 4AM6A 4Y1CA 4HTLA 3CQXA 3QICA 3AVFA 2WBNA 3Q7BA 3WXKA 4CJPA 4B9MA 3AGRA 3ALYA 2KHOA 4CF0A 2P9KA 3AO4A 4B3OA 3O1WA 3SLCA 3VQDA 1HPZA 1NJZA 1K73O 2P9NA 4BACA 4W5NA 4KH6A 3SPYA 4XEIA 1S1VA 2PFUA 4E19A 1SS6A 1ASWA 2NRZA 3ZSRA 3RVCA 5AFUA 1NMNA 4RW9A 4CZMA 3M8QA 1IBLK 1SZ2A 5AQRA 1MWMA 5AQZA 4NYNA 1HNIA 3GBTA 1TKXA 3TABA 4JI4K 1T6DA 3VEVA 4CW7B 3MX5A 1J53A 1NOZA 4CHZA 1T05A 2AP1A 1REVA 2KFNA 2KFZA 4CZEA 1WSHA 2A42A 3M8RA 1YJ9N 3KWIA 4TSXA 1NGIA 4UY8O 3SJHA 4QOZB 4JEPA 1QZ5A 2GELA 4CEBA 1GLDG 4OX9K 3G0ZA 3AO5A 2BE2A 3CD6N 4OGEA 3PUFA 3QIOA 4RTFD 4FLUA 4N76A 1NK6A 4FJ9A 3ITHA 4IDHA 1WSJA 4BQZA 3OVNA 3MCPA 4NXNK 2IGIA 3HSTB 3TSPA 4BRGA 3TI0A 4DQSA 1X9SA 3K2PA 3BGRA 3WNHA 4CK3A 2XO7A 3VEXA 4LF4K 3UKUA 4B1YB 1TK8A 3EE9A 5C2DA 4DSIA 2G8FA 5KPZA 4WFNL 4FXDA 5CZ1A 1FKOA 5HRSA 1KFSA 4PKHA 4OO1J 3EE8A 2D0OA 4DFPA 4H0TB 3HRGA 4DSLA 4Z94A 2FLOA 3ZT4A 4FYDA 4IFYA 5BPLA 1GLCG 2IAJA 4DHYA 3SAHA 1JLEA 5CY4A 5GAHP 1VQNN 3AVLA 4F8RA 3VEYA 2XY6A 2Q1NA 1J5EK 1M90O 3KD1E 3EO3A 4CJUA 3EY1A 3BDPA 2W41A 4ID1A 1JCEA 1VAZA 3E9OA 4FK2A 1QZ6A 1UWBA 2QW9A 3BY5A 4FJXA 2QXFA 3DXMB 3HK2A 4E0DA 1RT5A 4CZLA 1VQLN 4BRHA 4CJVA 3HVRA 4DQRA 3WEEA 3QEIA 3ZYYX 3NVMA 1LV5A 2HHUA 5AQGA 1QS4A 3Q7CA 3B6OA 1YVNA 5H1SQ 2YNGA 2IIRA 1QSSA 4U67L 3CC7N 3MXMA 3NBPA 4J2AA 4IJNA 3M6GA 2ZD1A 5JLHA 3VGMA 1WBBA 3OYKA 4DV2K 2ITMA 3OYBA 4CF8A 4ILGB 3SUNA 4JAXA 4CIEA 3OW2M 3SAGA 4IZ9A 4BRIA 3CJCA 3H1VX 3PSFA 1BI4A 1TUUA 1DTQA 2B6AA 3ZT0A 1K9MO 4CF9A 3U3GA 5EVZA 3N4QA 3P83D 3KKRA 3MWTA 3DOKA 1JCGA 2IS3A 4B8CA 4AQYK 4PUOA 5EY4A 3QBWA 1C1AA 1GOBA 3SNNA 3RRHA 4FM0A 1NGFA 2ZJPL 4NB4A 3NGIA 3VOVA 3MEGA 5HRNA 4B1UB 5BREA 4WQ5A 2PBDA 1TAUA 5FLXO 4ELVA 3DRSA 4CZKA 3VF6A 3G6EN 4H5NA 5BRDA 4CJ4A 3HVTA 2PY5A 3ZLJA 2ZQBA 3ZSYA 4W5RA 5FPEA 3DYAA 3VMFB 4BRKA 1K8KB 3D6RA 2DTUA 5ADXH 5EX5A 1S6PA 3DRPA 1QVGM 4PA1A 1KLMA 4JK8A 4OPHA 3TAEA 5BRHA 2P9PA 3PO4A 1LWCA 3DWLA 4CFCA 2OPQA 1Z6RA 3NE6A 2NRRA 2WC9A 3QEPA 4AHSA 2W42A 3I0RA 1JKHA 4YDUC 2BANA 4N5SA 4LF5K 5IT9O 3TTFA 2A6AA 3THXB 2W6LA 1VQ8N 1HMVA 1JL2A 3R6MA 4KB1A 5TKWA 3VA3A 2OPSA 2D1KA 4FPAA 3QFPA 4CVNE 3OYNA 3OS1A 4PHTX 2HBLA 2ASPA 2FBXA 4M42A 1EWRA 2GTDA 4CGIA 3TSUA 1X9JA 2G8HA 4DUZK 3ENHA 2JLEA 3PO5A 1VHXA 1BGXT 1S9EA 3D2EA 3SV4A 2O4IA 3ZSWA 4CK1A 1NKCA 1BL3A 4OPJA 3OS2A 3OYMA 4KFBA 4KB0A 4DUYK 3LAKA 2UXCK 3UE5A 3QEWA 3BF1A 3CYMA 2QA4N 3JS6A 4CJ7A 3QESA 1RDBA 1TKZA 1RTJA 4YFUA 2PYJA 3QETA 3SQ4A 1VQMN 3VERA 4MLEA 2YX6A 3ZT3A 4ZTFA 1KSPA 3T1AA 4FM1A 3CC2N 4ISEA 1M1KO 5CYQA 2QM1A 5KRSA 3CC4N 1OH7A 3NH1A 3TAPA 3TAFA 1RDUA 4IEEA 2AA4A 4B8AB 1WOQA 4BC2A 4ILJA 4IEIA 4CBUA 3AVAA 1G99A 2J4RA 4I2QA 5JMVA 3QB0A 1NK0A 3AVKA 1S3XA 1S9GA 3CMEN 5AQXA 1NU0A 1C0MA 4A5BA 1L3SA 4XH5A 1HPMA 1NK7A 1TAQA 5I42A 1ASUA 4H8KA 4RW4A 1EWQA 1UOCA 2IVOA 4ISFA 4PKIA 5FDLA 3U3YA 3C6AA 2ITGA 1SKSA 2I7PA 4CZIA 2YNFA 4DV4K 1VQ9N 2A1SA 4IFEA 1WLJA 4CGJA 3S41A 4YOXA 3CERA 3ENBA 2DPNA 1LAVA 2NRTA 4DF8A 5C24A 1TYQB 2UXBK 3CCLN 4DQ8A 1GLEG 3O3GA 1VSDA 3IG1A 1HX1A 3NF7A 5AQHA 4O55A 1DEJA 4PL7A 1B9FA 2P51A 2OZMA
chains in the Genus database with same CATH topology
1IV0A 2OCEA 3PSIA 3BZKA 1OVQA 1NU0A 1NMNA 3BZCA 3PSFA 1VHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IV0 A;  2OCE A;  3PSI A;  3BZK A;  1OVQ A;  1NU0 A;  1NMN A;  3BZC A;  3PSF A;  1VHX A; 
#chains in the Genus database with same CATH topology
 5KGW A;  3ZET B;  4B08 A;  3KLE A;  3J81 O;  5HP1 A;  3DOL A;  4KHP K;  3FFI A;  3ZX2 A;  3I56 N;  1VQP N;  4V19 S;  5EU7 A;  2NUB A;  1SAZ A;  4OKE A;  4DTJ A;  4FJN A;  2W40 A;  3WUH A;  2HVH A;  3DI6 A;  4BR9 A;  4B1X B;  3G25 A;  2E5L K;  1YTU A;  3V9X A;  4KTW A;  2HB5 A;  4I2P A;  1KXP A;  1NK8 A;  2XY8 A;  3K9J A;  1BQM A;  4JK9 A;  4M3W A;  3F73 A;  1WBD A;  4Z4F A;  3V9Z A;  3AA4 A;  3I0S A;  3OA9 A;  3HM9 A;  5J2P A;  4JI7 K;  2EWS A;  2HMI A;  4UQG A;  2EHG A;  1NM1 A;  5ELZ A;  4YOT A;  4JRQ A;  4WE1 A;  1D9D A;  1BA0 A;  5J2Q A;  4LF8 K;  4CJT A;  4FWP A;  2A1R A;  1WN7 A;  4CD1 A;  4Q0B A;  1C6V A;  1LAW A;  1KAY A;  3KK1 A;  4FLW A;  2GX9 A;  4I6M B;  1YIT N;  1K8A O;  1NGB A;  1YIJ N;  1L3V A;  3D2F B;  1JLF A;  3VF2 A;  1E3M A;  4GVE A;  3IMX A;  3AVH A;  1YVU A;  4F2S A;  3PIP L;  4LC9 B;  3DXM A;  5FRO A;  5AQV A;  3E9L A;  3IFR A;  3L2W A;  4B9V A;  3NDK A;  2GWJ A;  1XQS C;  1J54 A;  5I9E B;  3ZCM A;  3JAM O;  3HOS A;  4HCB A;  4DU1 A;  2P9I B;  4QAG A;  4WCE L;  1RDW X;  1B9D A;  5AFU H;  3O6W A;  3SI6 A;  2I5J A;  3T1H K;  3CMA N;  4BR0 A;  3VEZ A;  2B4J A;  4LFA K;  1QHT A;  2I7N A;  5KGX A;  3HP6 A;  4RG8 A;  3LDN A;  5AQM A;  2UU9 K;  4FLY A;  1S1X A;  2FBV A;  1EXQ A;  1Z25 A;  3GL1 A;  3KHY A;  4BDZ A;  1C1C A;  4X64 K;  4KPY A;  4ID5 A;  4X62 K;  3P39 A;  2HHQ A;  3FLC O;  1X9W A;  1EKE A;  4BRE A;  2D0P A;  4DV5 K;  2BUP A;  3CFO A;  3CJ9 A;  1YUW A;  3KLG A;  5CYM A;  1IBK K;  4WFB L;  3AY9 A;  4H5R A;  1QTM A;  4BDP A;  4DQP A;  5AQW A;  3U8X A;  5AR0 A;  3H3N O;  3VQA A;  1JJ2 M;  3CET A;  1T7P A;  4LF7 K;  2JWK A;  4XH1 A;  4KHY A;  3P38 A;  1NJX A;  3UIQ A;  5HRO A;  2VWK A;  3D7E O;  4H4M A;  4FOE A;  1RTH A;  4CJ3 A;  4E7J A;  4CHQ A;  5LJV A;  1ZBL A;  1KVB A;  1A5V A;  5F2R A;  4BR2 A;  4JI3 K;  4WYB A;  1K8K A;  4M3Y A;  4O5F A;  1ATR A;  3HTV A;  4PY5 A;  4HWI A;  5LMN K;  4YOR A;  3FR0 A;  5JVG L;  3BF3 A;  1U6Z A;  4IG0 A;  5FPM A;  5HLF A;  4J8F A;  3OY9 A;  5GIO A;  4GV3 A;  3N4P A;  2D5R A;  3L2R A;  1NJI O;  1HNW K;  4J2D A;  3M8P A;  5AJ3 K;  3H1Q A;  2OAN A;  3HYF A;  4BG9 A;  2GUI A;  3LWL A;  4FM2 A;  1VRU A;  1U49 A;  3KK2 A;  4M63 C;  2E1Y A;  2DFF A;  4KV8 A;  4LSL A;  3G4S N;  3OS0 A;  1JXB A;  3H45 C;  3E66 A;  3EL2 A;  2QWQ A;  2ZF5 O;  4BE1 A;  3TAR A;  5LY3 A;  2CH6 A;  1NGA A;  4E3S A;  2ZJR L;  2F8T A;  1IG8 A;  3VQC A;  3VQ5 A;  3DLG A;  1IG9 A;  5AQO A;  3RSE B;  5KRT A;  4JI5 K;  1U45 A;  4DR5 K;  3LAL A;  4FK0 A;  3ZT1 A;  4GKK K;  4IO8 A;  1YT3 A;  1TVR A;  2R7Y A;  3UB5 A;  2RHK A;  1CZB A;  3DLR A;  3C6H A;  4EHT A;  1XUP O;  1T3V A;  1BIS A;  4GKJ K;  4CJS A;  4AHC A;  2VQE K;  2PZS A;  4CGF A;  5SWM A;  1JCF A;  1SL1 A;  3HT3 A;  1HUX A;  3KWG A;  1KFD A;  3OBW A;  4MO4 A;  4EHU A;  3OYL A;  1UA1 A;  2G8U A;  4BDY A;  3LP0 A;  1Q81 O;  5EXW A;  3I33 A;  5KTQ A;  3QML A;  1YHQ N;  1SUQ A;  4BGA A;  1ZBF A;  4E7H A;  2XHB A;  1A5W A;  3I8B A;  4BRN A;  3NGZ A;  3TSQ A;  4MFB A;  2FF6 A;  3P5J A;  4B1V A;  3S3M A;  1U4B A;  3MMV A;  2KQ2 A;  2BGG A;  4FWM A;  1RT2 A;  3D0P A;  4FLV A;  4KRE A;  3M1F A;  1HKC A;  4FJG A;  2G8I A;  2HND A;  4YOY A;  3T1Y K;  3QLH A;  1XC3 A;  4CEF A;  3K59 A;  4DLE A;  4FLZ A;  3M8S A;  3SUQ A;  3LDS A;  4NCB A;  4LD0 A;  3SMS A;  4BVO A;  3VQ4 A;  3CIP A;  1Q7Y O;  4JI1 K;  1HJO A;  4LFC K;  5HRR A;  3PY8 A;  2YHW A;  3V1Q A;  4RW8 A;  3WQU A;  1X9M A;  2QWP A;  4FJL A;  3CCQ N;  1C0T A;  3VEO A;  3NMU A;  2E4L A;  4B9T A;  3CJ7 A;  1TYQ A;  4H0Y B;  4Q5V A;  5K14 A;  4JRP A;  4K43 A;  3A5O C;  4Z4I A;  3ZSZ A;  3THY B;  2HBK A;  1VSK A;  4DR6 K;  4DKW A;  4B3T K;  4NO7 A;  3ASM A;  3VQ6 A;  3GG4 A;  3ZET A;  1A5X A;  3QFU A;  3O9T A;  1N6Q A;  3A2F A;  3ZX0 A;  3AVG A;  3QNO A;  2GWK A;  2DFH A;  2Z1G A;  3KIO A;  5GAD P;  4C1N K;  1KVC A;  4JKH A;  5BPN A;  3CQY A;  2HHT A;  4BRO A;  4OVL A;  4JKG B;  5D3G A;  4I9L A;  4JKF A;  4DU3 A;  3K58 A;  1Q9X A;  4PKG A;  3HOT A;  3KLH A;  4B1W B;  4O4G A;  1HQE A;  1RT3 A;  3WNF A;  4M3X A;  2HHH K;  3VEW A;  1O1W A;  2P9L B;  2QWN A;  5AQP A;  3I55 N;  4HUF A;  1TKD A;  2HHW A;  4N56 A;  1HQU A;  5E26 A;  4FSV A;  2RKI A;  1N8R O;  4KRF A;  3T7Z A;  5LJW A;  3MX2 A;  3SAF A;  1XNQ K;  4DFJ A;  1IO2 A;  3AVN A;  1RGI A;  5AQT A;  4M7Y A;  4BY9 C;  3OYI A;  4CEC A;  4DTM A;  3E1Y A;  1QQC A;  2CGJ A;  4FL9 A;  4I6M A;  3KJV A;  4PWD A;  3NGY A;  3TTD A;  4BC3 A;  4HCC A;  3J80 O;  1D9F A;  3D2F A;  4AHR A;  4JI0 K;  3HM8 A;  3AGK A;  3HBT A;  3NF9 A;  3MDQ A;  3CI5 A;  2G8K A;  1Q82 O;  3VPZ A;  3AA5 X;  1WSG A;  2E2Q A;  3OHR A;  4BRF A;  1D4X A;  2DFE A;  3ZSX A;  4FZZ A;  3C7N B;  3OTO K;  3MED A;  3T19 A;  3LZI A;  1LW2 A;  4OPA A;  3DXK B;  3L0Q A;  2P9I A;  1EET A;  1EX4 A;  4O8K A;  4BC4 A;  4BRC A;  4PL8 A;  3L3V A;  4CZH A;  2A40 A;  3K5L A;  3BUZ B;  4CZG A;  3OJU A;  3DLH A;  3L2Q A;  1HRH A;  3L2U A;  1NBW A;  4BR7 A;  4BR5 A;  1U04 A;  5AZJ B;  3WXJ A;  2F96 A;  4E7L A;  3ISN C;  5AZI B;  2UXD K;  4JD2 B;  3O9R A;  3QO9 A;  4WQ4 A;  2OA8 A;  4KI4 A;  2ATQ A;  1H1V A;  3VGK A;  3J8A A;  1ZBU A;  1XHZ A;  1WB9 A;  4JHD B;  3SJJ A;  4HUE A;  5KPR A;  4KHQ A;  2GBZ A;  3CFR A;  4CF2 A;  1IKY A;  4GV9 A;  2RPI A;  3OYJ A;  4FJJ A;  3O4N A;  4BC5 A;  4GVM A;  2QWR A;  1WNS A;  2H3G X;  3KD5 E;  4FK4 A;  1HR0 K;  2KKZ A;  2HHX A;  4JI6 K;  3QEX A;  3RTV A;  3AO2 A;  4JS4 A;  4CFA A;  3MN6 A;  1N32 K;  2HNZ A;  4DMN A;  1RTI A;  2HMP A;  4IG3 A;  4CBW A;  1SL0 A;  4DFM A;  4FJI A;  4JI2 K;  4JKE A;  4K0K K;  3JYT A;  3QEV A;  1SQK A;  5DM7 L;  2QK9 A;  4A59 A;  5FRM A;  2FC0 A;  4CF1 A;  4A5A A;  3DJC A;  4FWO A;  1RBU A;  4KTZ A;  2E20 A;  3BZC A;  3O5B A;  4G1Q A;  2O8F B;  1CZ9 A;  1P8Z A;  5AQJ A;  2QEX N;  2OPP A;  3MEE A;  4FLT A;  5C15 A;  2Q36 A;  3WNG A;  4KI6 A;  3BP8 A;  3OYD A;  3U9Z A;  2GUP A;  2F7T A;  2YI1 A;  4BE0 A;  1SKR A;  1XHX A;  2HOE A;  4ZHR A;  3RMD A;  3C65 A;  3U9D A;  3FZM A;  5TKY A;  5AQI A;  5BN8 A;  1YI2 N;  3SQ1 A;  3OYH A;  2HF3 A;  3CJA A;  1FKP A;  3O4W A;  3HSC A;  3TR8 A;  1VQO N;  3HL8 A;  4A57 A;  3PX0 A;  3SUO A;  3EZ5 A;  4Z0U A;  3SYZ A;  1E4F T;  1NK4 A;  2NZT A;  3FGU A;  2X6S A;  3RSE A;  2BDP A;  3TPQ A;  5C10 A;  5CZ2 A;  1VQ6 N;  4CJ5 A;  2A5X A;  2NLX A;  2CGL A;  2GV9 A;  1GLB G;  3RR8 A;  1N33 K;  3SUP A;  3O08 A;  3FZK A;  4QS9 A;  1J6Z A;  3EEQ A;  1DTT A;  3O9U A;  1NGJ A;  3A8Y A;  2IVP A;  3JSM A;  1P90 A;  2UUC K;  3C95 A;  5SZT A;  3RR7 A;  3V1R A;  4DSJ A;  1UA0 A;  4KH4 A;  3LP3 A;  4IJA A;  1F21 A;  1NGE A;  5IWA K;  2ZJQ L;  5C25 A;  1LW0 A;  5AQF A;  4IOX A;  4YOW A;  4CBX A;  2YHY A;  3TU5 A;  1UAX A;  2ZWH A;  1KRP A;  1TGO A;  1KC8 O;  1MA9 B;  2QKB A;  2QWM A;  4DV7 K;  3OYA A;  3TAM A;  3AA2 A;  3P1G A;  1GOA A;  1NKB A;  2OTJ N;  4FWS A;  4OPK A;  1N5Y A;  2E1Z A;  4XIU A;  2ZM6 K;  2RF2 A;  4B3M K;  1JLC A;  3UKU B;  4EIA A;  5C42 A;  4LH5 A;  5M1N A;  1IBM K;  1EP4 A;  4CHO A;  1NKE A;  1S1W A;  3THY A;  4B3R K;  5FPD A;  5DK5 A;  1IKV A;  2VWB A;  3CJ1 A;  3WNE A;  2KZM A;  2P5O A;  1C1B A;  1FXX A;  5F1X A;  1QQM A;  2NRV A;  1D8Y A;  4B9N A;  1JLA A;  2F9T A;  3VQP A;  2X6N A;  3QDK A;  1CLQ A;  4QS7 A;  4EP4 A;  3CCJ N;  3V4I A;  4BE2 A;  4DTP A;  1NNE A;  1HKB A;  4DTO A;  2HVI A;  4JKG A;  1XC9 A;  3CFP A;  1KAX A;  1LWE A;  3AVC A;  4W5T A;  3F9M A;  1NK5 A;  2VGN A;  1NJW A;  2VCP A;  3FZF A;  2QXL A;  3AAP A;  2P9L A;  5AQL A;  3NHG A;  5GAE P;  4QCL A;  3M5R A;  4JKD A;  1HYZ A;  4H5W A;  3FFK B;  5DM6 L;  4CHY A;  2BTF A;  3WXL A;  4CFD A;  3H6E A;  1VSH A;  3KZB A;  3OJS A;  2NRX A;  4BGB A;  3B6P A;  4DTX A;  5KPT A;  5AQQ A;  1C0U A;  4IO9 L;  1S1U A;  4F2R A;  4DV3 K;  3L6Q A;  2XY5 A;  1HNX K;  1NGG A;  4JS5 A;  5MLC Q;  4FJ5 A;  1QVF M;  2F4V K;  3C94 A;  4CED A;  1QHA A;  3OYG A;  2DY4 A;  2FBT A;  5AQK A;  3LP2 A;  4CIG A;  4IOA L;  3WQT A;  4DQI A;  3ZT2 A;  2HHV A;  4MQ3 A;  3O9S A;  3THW B;  4M3Z A;  1S5J A;  3C7N A;  4YNQ A;  3IUC A;  2OYQ A;  3A5L C;  3DLB A;  3ID8 A;  2E8A A;  3THV A;  1S6Q A;  5JS2 A;  1Q9Y A;  2B5J A;  1ZBH A;  4O0I A;  2VG5 A;  4E7K A;  3CCU N;  1RNH A;  4M7X A;  2O8B B;  1ESV A;  4LH4 A;  4CZJ A;  4BWJ A;  3TAN A;  4JKB A;  1VSL A;  3WXM B;  2KZZ A;  2X78 A;  5AZI A;  4JD2 A;  4FJK A;  4YDU A;  4JNE A;  2XRI A;  2UYT A;  1NOY A;  1O13 A;  4B1Z A;  1W2B M;  1BUP A;  1NMD A;  1ZXO A;  2UUA K;  5AQN A;  4FZX C;  4GY2 B;  4YHH K;  1GOC A;  3AAQ A;  2YCH A;  3IKM A;  3F5T A;  4OLA A;  1I39 A;  4G9Z A;  2Q0R A;  2BH1 A;  1KD1 O;  5M1P A;  1KTQ A;  2CH5 A;  1W0H A;  1RDA A;  1NLV A;  1LWF A;  1RT7 A;  2CGK A;  3VES A;  3S9H A;  1RBV A;  2OCE A;  5AQY A;  3ZX3 A;  4DR7 K;  3FZL A;  2YJE A;  5JLF A;  1MDU B;  3LP1 A;  1IJJ A;  4WQ5 C;  4H5V A;  2YHA A;  3SV3 A;  3U6F A;  2XY7 A;  3E9P A;  1NGC A;  2WOM A;  4OKK A;  3THX A;  1BQN A;  4OJR A;  4CGD A;  4CEA A;  1BHL A;  4ILH A;  3L8B A;  2Q3S A;  3S3N A;  4KH5 A;  3ZSO A;  4RW6 A;  1X3M A;  3UKR B;  2O8F A;  2V7Z A;  3RMB A;  2PYL A;  3NFA A;  2ZGZ A;  2V52 B;  3G71 N;  4IWV A;  2O8E B;  4K8Z A;  3ZSQ A;  2P9U B;  2OTL N;  3CPE A;  1GLA G;  3HZ6 A;  2D4W A;  3CPW M;  4XH4 A;  1R0A A;  1QSL A;  2YKN A;  3AVI A;  3LPT A;  4CD3 A;  1XNR K;  2E88 A;  4N41 A;  3VEN A;  3KTQ A;  4HTU A;  3O80 A;  4DS4 A;  2E2O A;  2QI2 A;  3EKS A;  4DV1 K;  1J5O A;  1JL1 A;  5KI6 A;  1VSM A;  4DB3 A;  1VSE A;  2E2P A;  4BVP A;  4WF9 L;  4FVU A;  4C8L A;  2A41 A;  3AAR A;  5AQS A;  3CJB A;  3PX4 A;  3IRX A;  3C6T A;  5C2F A;  3P4I A;  4CGH A;  4FCY A;  3M3Z A;  3K5N A;  4KHN A;  2UUB K;  1YXQ A;  1BCM A;  1YAG A;  1FW6 A;  3V9W A;  1TKT A;  3RMA A;  5FRN A;  1N36 K;  2Z1H A;  3MK6 A;  3J7A P;  3R8E A;  4FZY A;  5CR4 A;  4LSN A;  1ITG A;  3ULE B;  4B9L A;  5LL6 Z;  4E89 A;  1C0F A;  1BU6 O;  1MU2 A;  1I3A A;  1QQO A;  1QSY A;  3PIO L;  3ATU A;  4FPB A;  4DCH A;  2NRW A;  1DT9 A;  3BEX A;  4M45 A;  4C1N I;  4DF4 A;  1WUA A;  3KLI A;  2WUS A;  4BR4 A;  1KCF A;  2Q31 A;  3B8A X;  4CJW A;  1YJW N;  1G15 A;  5BR8 K;  3PSI A;  4DU4 A;  4FVM A;  3L4I A;  5M1O A;  4DFK A;  1D5A A;  1BG3 A;  3PX6 A;  1GLL O;  1YF5 L;  3VQ8 A;  1JLB A;  5JIC A;  5GIN A;  1U2V B;  4CJE A;  3FE1 A;  4YOU A;  3NF6 A;  2X74 A;  3O9Q A;  4J2B A;  3K57 A;  4ELU A;  4BRQ A;  1NGH A;  4KHW A;  3LWM A;  1CXQ A;  2Z1I A;  4M41 A;  2P9S B;  4U7B A;  3CXC M;  3SPZ A;  2YKM A;  2W6K A;  4NCG A;  1V4S A;  5HBM A;  4JV5 K;  1V4T A;  1VSF A;  1BOT O;  3LM9 A;  4JYA K;  3MAQ A;  5T7B A;  1OVY A;  3HPG A;  3OYC A;  4NYF A;  1RBS A;  4E7I A;  4Y1D A;  4C8N A;  4CHP A;  2FSJ A;  2IOC A;  2YV0 X;  3VTH A;  2ZE2 A;  4AM7 A;  4DR4 K;  3LAM A;  3CHW A;  1S1T A;  2EX3 A;  2O8D B;  2VGM A;  5FPN A;  1X1P A;  1BIU A;  2Q0U A;  3MXI A;  3AVJ A;  1TV6 A;  1N34 K;  1T6C A;  3LDO A;  4CEE A;  2VWJ A;  2YHX A;  1GLF O;  2V7Y A;  5HRP A;  1W9H A;  4DTS A;  5AQU A;  3OBY A;  1WSE A;  1TK5 A;  4B9S A;  1S22 A;  4NXM K;  4MDB A;  3CCE N;  3R3L A;  4HVJ A;  4IFV A;  3CF5 L;  5F0X A;  2OPR A;  4F3O A;  4RW7 A;  4CES A;  3HI0 A;  3NH0 A;  3H3O B;  4NCA A;  4IOC L;  4MLH A;  4AHT A;  2RN2 A;  4O8U A;  4FWR A;  2QKK A;  4EP5 A;  1WSI A;  4JK7 A;  1QE1 A;  5JS1 A;  4CJK A;  4A61 A;  4H03 B;  1IV0 A;  4JN4 A;  1WAF A;  4CK2 A;  3SBG A;  5GAG P;  2NRH A;  3SMP A;  3AA3 A;  3L3U A;  1HJR A;  1SV5 A;  3IDH A;  1RDC A;  4DR2 K;  4O0J A;  2OZS A;  3CCR N;  3THW A;  4ICL A;  3OYE A;  5GIP A;  1BO5 O;  1TUY A;  5BR9 A;  4CJL A;  5JVH L;  1OH5 A;  4LFB K;  3A0I X;  5I3U A;  4B9U A;  3SBT A;  4OKJ A;  4CEQ A;  4K8X A;  4GMJ B;  1RBR A;  3KK3 A;  2O8B A;  1ASV A;  1L3T A;  4FWL A;  3O4Q A;  3AO3 A;  3HPO A;  2Q2R A;  4FW2 A;  1HKG A;  3CM5 A;  1T03 A;  3NVK A;  1OVQ A;  5C12 A;  2HW3 A;  2WFB A;  4LF6 K;  2O4G A;  4DSF A;  3LAN A;  1Q18 A;  5M1K A;  4CFB A;  5CHI A;  1KAZ A;  3C0B A;  4OLB A;  4CGG A;  2HBJ A;  3SCX A;  3ID6 A;  3VF4 A;  2JGU A;  4JKC A;  3O3H A;  2WTU A;  3VQ7 A;  4Y0W A;  3VQQ A;  3P31 A;  3VQ9 A;  4KKO A;  4GV6 A;  3ZEU B;  2ZGY A;  1IKX A;  1ATS A;  3HPH A;  4I7F A;  4K25 A;  3LDQ A;  3HP9 A;  4DSK A;  2F9W A;  3CCS N;  3VET A;  2E6L A;  4EZ9 A;  4FLX A;  3SQ0 A;  3HJF A;  2VG7 A;  1ZBS A;  3NF8 A;  3V6D A;  2V51 B;  4DR3 K;  2ASO A;  1BDG A;  4CIF A;  4GW6 A;  4FWK A;  1FK9 A;  3QER A;  1IKW A;  3SK3 A;  1SKW A;  1JLG A;  5BPM A;  1RTD A;  4KAZ A;  3MXJ A;  2VYP A;  1CXU A;  5J1E A;  4CEZ A;  2O8C B;  4DQQ A;  1RCH A;  3QIP A;  1HNV A;  1X3N A;  3JXU A;  2FBY A;  3E01 A;  1ZBI A;  1NJY A;  4CER A;  1NGD A;  3UKR A;  3LL3 A;  1SL2 A;  3RWU A;  3O1B A;  3DLL L;  2AJQ A;  2KLA A;  1DKG D;  4M3R A;  1HNZ K;  3GOI A;  3NH2 A;  2O8E A;  3C6U A;  1GLJ O;  2NNW A;  5J2M A;  2A3Z A;  2P9U A;  3A5N C;  1KQS M;  1VQK N;  2G8W A;  3CCV N;  2P9K B;  2FXU A;  3H46 O;  3NAE A;  4BG8 A;  4JI8 K;  3L4Q A;  2WON A;  5J2N A;  3U4L A;  2P9N B;  2LSN A;  1EQY A;  4DV6 K;  4LY7 A;  1RBT A;  4DSE A;  3MWP A;  4C8M A;  1LCU A;  3VQE A;  4AHV A;  3NCI A;  3ULD A;  5BRF A;  3KKS A;  2QWO A;  2QWL A;  2Q97 A;  1VRT A;  1BA1 A;  4DWI A;  4O44 A;  2D0A A;  1FJG K;  3VN5 A;  4LF9 K;  4W5O A;  4C8K A;  3A5M C;  1ZC6 A;  3TAQ A;  4CJQ A;  3AO1 A;  1Y64 A;  1VQ7 N;  2GEM A;  4DLG A;  1XMO K;  4I9Q A;  3W3D A;  4WFA L;  1JXE A;  4MDA A;  5LMU K;  3GE1 A;  4C8O A;  1VSJ A;  4ZTJ A;  1RFQ A;  1HYV A;  3ULE A;  3LZJ A;  3SQ2 A;  4FO0 A;  1OKJ A;  2PAV A;  4H0P A;  3RRG A;  3H08 A;  4DV0 K;  2IC3 A;  4L8R B;  4H4O A;  1ZYQ A;  4FJH A;  3I8D A;  5M1Q A;  1RT4 A;  4PQU A;  3L2V A;  3AVB A;  4CZF A;  4IBN A;  4N47 A;  1VK0 A;  3J7Y P;  2P5G A;  3ATV A;  4DG1 A;  2Y1I A;  1RIL A;  3KK7 A;  1MWK A;  3K0S A;  5ADX A;  3CCM N;  4X65 K;  3DLK A;  3KLF A;  3SZ2 A;  4CCH A;  1L5U A;  3O8M A;  5B8H A;  1RT1 A;  4E1M A;  4YOV A;  1DLO A;  3EN9 A;  1U2V A;  3MEC A;  3K5M A;  1I94 K;  3CM6 A;  4B9Q A;  4R79 A;  2VQF K;  3MN9 A;  1LOT B;  2VG6 A;  3DRR A;  3ZSV A;  1XMQ K;  3EKU A;  2Z1J A;  4A62 A;  2P9S A;  4X66 K;  3IAY A;  4IXC A;  1W7A A;  5E41 A;  3DAW A;  4Z4H A;  3VGL A;  1BWF O;  1HYS A;  4AIL C;  4ISG A;  4K42 A;  1R59 O;  1L3U A;  4KBO A;  4H0O A;  2P1J A;  4F9O A;  4K41 A;  4IKF A;  4FJ7 A;  1T8E A;  4OGC A;  4B3S K;  3BZK A;  3OYF A;  4Z4G A;  5EOY A;  4CHN A;  3T3F A;  4L3Q A;  1K6Y A;  3MN5 A;  4KTQ A;  4E1J A;  1BIZ A;  1NWK A;  1XI1 A;  2O8D A;  1EO1 A;  3TAG A;  1Y97 A;  3EZW A;  4H5T A;  2G8V A;  3WEE B;  4BWM A;  4YY3 K;  1VQ5 N;  5M1F A;  3GDQ A;  4H0V B;  4CJR A;  3LDL A;  4FJM A;  3QBX A;  3LM2 A;  3DM2 A;  3TTC A;  4Z4E A;  4BQL A;  3DLE A;  4AHU A;  4DTN A;  3FZH A;  3V81 A;  2E6M A;  1RDD A;  3HO1 A;  1YTA A;  4GNI A;  4AH9 A;  5DMR A;  3F9K A;  4A2B A;  1WSF A;  3T69 A;  4KHS A;  3KVG A;  1BI4 B;  1U48 A;  4DTU A;  4FJ8 A;  5A2Q O;  3IS9 A;  3LDP A;  4H0X B;  5HL7 L;  3MCA B;  1OH6 A;  2E2N A;  2HST A;  3O3F A;  5KQD A;  4KO0 A;  3DXK A;  2ETJ A;  1J9A A;  3F2K A;  3CG7 A;  3MN7 A;  4EAH D;  4FOI A;  2Y1J A;  1KLN A;  1DGK N;  4CJF A;  5KQ8 A;  5HOO A;  2HHS A;  4AF1 A;  1B92 A;  1TL3 A;  2KW4 A;  4JKA A;  4DTR A;  4Z4C A;  2FF3 B;  3V9U A;  3J7Z O;  1NG9 A;  4BRL A;  5AZJ A;  1BCO A;  1WAJ A;  3QNN A;  4EZ6 A;  4QS8 A;  1Q8I A;  1S72 N;  3ENO A;  2D0C A;  2YJF A;  4C23 A;  4HHT A;  4JHD A;  2HNY A;  3QIN A;  4J2E A;  4A2A A;  2JWL A;  5E84 A;  1ATN A;  4BRA A;  3RMC A;  1KVA A;  4BRP A;  1IH7 A;  2YNI A;  2YHB A;  4BRM A;  2IVN A;  1RT6 A;  3K5O A;  4F4K A;  2D0B A;  2P9P B;  3AVM A;  4KHU A;  3D45 A;  1JLQ A;  4CI6 A;  3V9S A;  3CQ8 A;  1VSI A;  5C0Y A;  5BN9 A;  3TWH A;  4NLC A;  1W97 L;  1OH8 A;  3V1O A;  4W5Q A;  3W0L A;  4FWN A;  4CE9 A;  4WQ4 C;  2IDO A;  2F8S A;  3PV8 A;  3EYZ A;  4HUG A;  1TK0 A;  1NK9 A;  3G10 A;  2KTQ A;  4M3T A;  1HLU A;  2FSN A;  3HXM A;  4O5B A;  3ZEU A;  3K9K A;  2YNH A;  4M3U A;  1Z05 A;  2RE2 A;  3VQB A;  3S3O A;  4R5P A;  1Z26 A;  4IDK A;  4RCH A;  4RWT A;  3PLA A;  1YJN N;  4FWQ A;  1E4G T;  3VA0 A;  2QTD A;  3DMJ A;  4ELT A;  4FW1 A;  3R1X A;  1XWL A;  1C0G A;  3WXI A;  3D2E B;  5CE3 A;  4F3T A;  4NLB A;  2HBM A;  2ASM A;  3LPU A;  2O8C A;  1QQN A;  1Q86 O;  1TL1 A;  3WT0 A;  1ILY A;  4DS5 A;  4CEO A;  3VTI A;  2FSK A;  3R9P A;  4MO5 A;  1VQ4 N;  3AV9 A;  1CZA N;  4EFH A;  1U47 A;  1T44 A;  2HF4 A;  4BRD A;  4DR1 K;  4E1N A;  4JLH A;  4AM6 A;  4Y1C A;  4HTL A;  3CQX A;  3QIC A;  3AVF A;  2WBN A;  3Q7B A;  3WXK A;  4CJP A;  4B9M A;  3AGR A;  3ALY A;  2KHO A;  4CF0 A;  2P9K A;  3AO4 A;  4B3O A;  3O1W A;  3SLC A;  3VQD A;  1HPZ A;  1NJZ A;  1K73 O;  2P9N A;  4BAC A;  4W5N A;  4KH6 A;  3SPY A;  4XEI A;  1S1V A;  2PFU A;  4E19 A;  1SS6 A;  1ASW A;  2NRZ A;  3ZSR A;  3RVC A;  5AFU A;  1NMN A;  4RW9 A;  4CZM A;  3M8Q A;  1IBL K;  1SZ2 A;  5AQR A;  1MWM A;  5AQZ A;  4NYN A;  1HNI A;  3GBT A;  1TKX A;  3TAB A;  4JI4 K;  1T6D A;  3VEV A;  4CW7 B;  3MX5 A;  1J53 A;  1NOZ A;  4CHZ A;  1T05 A;  2AP1 A;  1REV A;  2KFN A;  2KFZ A;  4CZE A;  1WSH A;  2A42 A;  3M8R A;  1YJ9 N;  3KWI A;  4TSX A;  1NGI A;  4UY8 O;  3SJH A;  4QOZ B;  4JEP A;  1QZ5 A;  2GEL A;  4CEB A;  1GLD G;  4OX9 K;  3G0Z A;  3AO5 A;  2BE2 A;  3CD6 N;  4OGE A;  3PUF A;  3QIO A;  4RTF D;  4FLU A;  4N76 A;  1NK6 A;  4FJ9 A;  3ITH A;  4IDH A;  1WSJ A;  4BQZ A;  3OVN A;  3MCP A;  4NXN K;  2IGI A;  3HST B;  3TSP A;  4BRG A;  3TI0 A;  4DQS A;  1X9S A;  3K2P A;  3BGR A;  3WNH A;  4CK3 A;  2XO7 A;  3VEX A;  4LF4 K;  3UKU A;  4B1Y B;  1TK8 A;  3EE9 A;  5C2D A;  4DSI A;  2G8F A;  5KPZ A;  4WFN L;  4FXD A;  5CZ1 A;  1FKO A;  5HRS A;  1KFS A;  4PKH A;  4OO1 J;  3EE8 A;  2D0O A;  4DFP A;  4H0T B;  3HRG A;  4DSL A;  4Z94 A;  2FLO A;  3ZT4 A;  4FYD A;  4IFY A;  5BPL A;  1GLC G;  2IAJ A;  4DHY A;  3SAH A;  1JLE A;  5CY4 A;  5GAH P;  1VQN N;  3AVL A;  4F8R A;  3VEY A;  2XY6 A;  2Q1N A;  1J5E K;  1M90 O;  3KD1 E;  3EO3 A;  4CJU A;  3EY1 A;  3BDP A;  2W41 A;  4ID1 A;  1JCE A;  1VAZ A;  3E9O A;  4FK2 A;  1QZ6 A;  1UWB A;  2QW9 A;  3BY5 A;  4FJX A;  2QXF A;  3DXM B;  3HK2 A;  4E0D A;  1RT5 A;  4CZL A;  1VQL N;  4BRH A;  4CJV A;  3HVR A;  4DQR A;  3WEE A;  3QEI A;  3ZYY X;  3NVM A;  1LV5 A;  2HHU A;  5AQG A;  1QS4 A;  3Q7C A;  3B6O A;  1YVN A;  5H1S Q;  2YNG A;  2IIR A;  1QSS A;  4U67 L;  3CC7 N;  3MXM A;  3NBP A;  4J2A A;  4IJN A;  3M6G A;  2ZD1 A;  5JLH A;  3VGM A;  1WBB A;  3OYK A;  4DV2 K;  2ITM A;  3OYB A;  4CF8 A;  4ILG B;  3SUN A;  4JAX A;  4CIE A;  3OW2 M;  3SAG A;  4IZ9 A;  4BRI A;  3CJC A;  3H1V X;  3PSF A;  1BI4 A;  1TUU A;  1DTQ A;  2B6A A;  3ZT0 A;  1K9M O;  4CF9 A;  3U3G A;  5EVZ A;  3N4Q A;  3P83 D;  3KKR A;  3MWT A;  3DOK A;  1JCG A;  2IS3 A;  4B8C A;  4AQY K;  4PUO A;  5EY4 A;  3QBW A;  1C1A A;  1GOB A;  3SNN A;  3RRH A;  4FM0 A;  1NGF A;  2ZJP L;  4NB4 A;  3NGI A;  3VOV A;  3MEG A;  5HRN A;  4B1U B;  5BRE A;  4WQ5 A;  2PBD A;  1TAU A;  5FLX O;  4ELV A;  3DRS A;  4CZK A;  3VF6 A;  3G6E N;  4H5N A;  5BRD A;  4CJ4 A;  3HVT A;  2PY5 A;  3ZLJ A;  2ZQB A;  3ZSY A;  4W5R A;  5FPE A;  3DYA A;  3VMF B;  4BRK A;  1K8K B;  3D6R A;  2DTU A;  5ADX H;  5EX5 A;  1S6P A;  3DRP A;  1QVG M;  4PA1 A;  1KLM A;  4JK8 A;  4OPH A;  3TAE A;  5BRH A;  2P9P A;  3PO4 A;  1LWC A;  3DWL A;  4CFC A;  2OPQ A;  1Z6R A;  3NE6 A;  2NRR A;  2WC9 A;  3QEP A;  4AHS A;  2W42 A;  3I0R A;  1JKH A;  4YDU C;  2BAN A;  4N5S A;  4LF5 K;  5IT9 O;  3TTF A;  2A6A A;  3THX B;  2W6L A;  1VQ8 N;  1HMV A;  1JL2 A;  3R6M A;  4KB1 A;  5TKW A;  3VA3 A;  2OPS A;  2D1K A;  4FPA A;  3QFP A;  4CVN E;  3OYN A;  3OS1 A;  4PHT X;  2HBL A;  2ASP A;  2FBX A;  4M42 A;  1EWR A;  2GTD A;  4CGI A;  3TSU A;  1X9J A;  2G8H A;  4DUZ K;  3ENH A;  2JLE A;  3PO5 A;  1VHX A;  1BGX T;  1S9E A;  3D2E A;  3SV4 A;  2O4I A;  3ZSW A;  4CK1 A;  1NKC A;  1BL3 A;  4OPJ A;  3OS2 A;  3OYM A;  4KFB A;  4KB0 A;  4DUY K;  3LAK A;  2UXC K;  3UE5 A;  3QEW A;  3BF1 A;  3CYM A;  2QA4 N;  3JS6 A;  4CJ7 A;  3QES A;  1RDB A;  1TKZ A;  1RTJ A;  4YFU A;  2PYJ A;  3QET A;  3SQ4 A;  1VQM N;  3VER A;  4MLE A;  2YX6 A;  3ZT3 A;  4ZTF A;  1KSP A;  3T1A A;  4FM1 A;  3CC2 N;  4ISE A;  1M1K O;  5CYQ A;  2QM1 A;  5KRS A;  3CC4 N;  1OH7 A;  3NH1 A;  3TAP A;  3TAF A;  1RDU A;  4IEE A;  2AA4 A;  4B8A B;  1WOQ A;  4BC2 A;  4ILJ A;  4IEI A;  4CBU A;  3AVA A;  1G99 A;  2J4R A;  4I2Q A;  5JMV A;  3QB0 A;  1NK0 A;  3AVK A;  1S3X A;  1S9G A;  3CME N;  5AQX A;  1NU0 A;  1C0M A;  4A5B A;  1L3S A;  4XH5 A;  1HPM A;  1NK7 A;  1TAQ A;  5I42 A;  1ASU A;  4H8K A;  4RW4 A;  1EWQ A;  1UOC A;  2IVO A;  4ISF A;  4PKI A;  5FDL A;  3U3Y A;  3C6A A;  2ITG A;  1SKS A;  2I7P A;  4CZI A;  2YNF A;  4DV4 K;  1VQ9 N;  2A1S A;  4IFE A;  1WLJ A;  4CGJ A;  3S41 A;  4YOX A;  3CER A;  3ENB A;  2DPN A;  1LAV A;  2NRT A;  4DF8 A;  5C24 A;  1TYQ B;  2UXB K;  3CCL N;  4DQ8 A;  1GLE G;  3O3G A;  1VSD A;  3IG1 A;  1HX1 A;  3NF7 A;  5AQH A;  4O55 A;  1DEJ A;  4PL7 A;  1B9F A;  2P51 A;  2OZM A; 
#chains in the Genus database with same CATH homology
 1IV0 A;  2OCE A;  3PSI A;  3BZK A;  1OVQ A;  1NU0 A;  1NMN A;  3BZC A;  3PSF A;  1VHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...