1VHXA

Crystal structure of putative holliday junction resolvase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
SLRILGLDLGTKTLGVALSDEMGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFPKNMNGTVGPRGEASQTFAKVLETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVIDKMAAVMILQGYLDSLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative Holliday junction resolvase
publication title Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb
source organism Bacillus subtilis
total genus 37
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2003-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.140 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 YqgF/RNase H-like domain 1vhxA00
1VHXA 2OCEA 3BZKA 1IV0A 3BZCA 1OVQA 3PSFA 3PSIA 1NMNA 1NU0A
chains in the Genus database with same CATH superfamily
4IG3A 2HNYA 5E41A 4M45A 4C8KA 1IJJA 5BREA 2QWLA 3P38A 1RT2A 3R8EA 2Q2RA 2HNZA 1LCUA 1SZ2A 4JK9A 5BN9A 4L8RB 3R6MA 4BR7A 1NGBA 2EHGA 2UXDK 1GLBG 1NJIO 2NRWA 1VSEA 4K8XA 3DI6A 2O8DA 2NNWA 3OYMA 3AGKA 2X6NA 4DU1A 1N8RO 1XMQK 3EE8A 1NKBA 5FROA 4ELUA 4J2BA 4K41A 3P5JA 4CFAA 3U4LA 1ZBUA 4FL9A 4W5QA 4B9VA 4Z4GA 3VGMA 4JKDA 5AQJA 3U3YA 3GOIA 1B9DA 1A5XA 1JLEA 4GV3A 4CGFA 1S1VA 3J7ZO 5CHIA 3FFIA 2WUSA 4JKEA 5KRTA 2KLAA 3B8AX 3LM2A 4DV3K 4DF4A 1FW6A 3MN9A 3I0RA 4XH5A 4IZ9A 3NCIA 1S6QA 5GIOA 4YNQA 4AILC 4CEDA 2XHBA 2HVIA 1BIZA 1IKWA 1LAWA 2ZJPL 1JCFA 1VSKA 4K0KK 2AJQA 1TAQA 3AO1A 2W41A 1ASWA 3CETA 1BIUA 4I6MB 3LZIA 3CPWM 4WF9L 4RCHA 1X3NA 4DTPA 4DTNA 1E4GT 4LSNA 4AHSA 3K5OA 2P9UA 4Z94A 1NM1A 4M3UA 3OYNA 3VF6A 4JI7K 5M1KA 4FJXA 2KQ2A 5M1FA 3CC4N 1DT9A 3I33A 3AVJA 4ELTA 5AQNA 1HKGA 1Q9XA 4O0JA 4LFCK 4RWTA 1NMDA 4CD1A 2ASOA 1XNQK 3DJCA 2GELA 4H0OA 1QZ5A 4NXNK 3P83D 4DR3K 1G15A 4BDZA 4LF9K 4FW2A 4DU4A 3LP3A 5JS1A 4BGBA 4O4GA 1J9AA 2P9UB 3KK2A 4BACA 1ZYQA 4CJLA 3THYA 3OYEA 1SKSA 5AQHA 2NUBA 1HLUA 5HBMA 2YNHA 2BE2A 1SL0A 2O8FA 3C6TA 3AVGA 3S3NA 4MDAA 4BC4A 3PO4A 3DXKA 3IDHA 3TAEA 4F3OA 4ZTJA 1NGEA 4JKFA 4WFAL 3NVMA 3AO4A 4U67L 2O8EA 4M3YA 3DOKA 1KAYA 3OYFA 4QAGA 3CJ7A 4AF1A 1L3SA 1BISA 3A0IX 4BVOA 3PY8A 3MX2A 2RKIA 2P9KA 3CJ1A 1RT3A 3THYB 1I94K 5I3UA 1WOQA 4O44A 4B08A 5BN8A 3OYDA 4DSEA 3RRHA 2Z1JA 3L0QA 3F73A 4I2QA 1IG9A 3CQYA 1J53A 2O8FB 3QMLA 4CEQA 3QEVA 3DXKB 3KTQA 4DQIA 4JV5K 1MDUB 1QVFM 1GLFO 3AA4A 4DQSA 2E4LA 3DWLA 4CJRA 3V4IA 1NGAA 3J81O 4Z4CA 1JLBA 4O5BA 2V7ZA 4RW4A 2WTUA 4DV5K 3FFKB 5C24A 4IFEA 1WN7A 3ID8A 3FR0A 1SAZA 1A5VA 4QS9A 1QSSA 1KVAA 2P9KB 1RBSA 2GX9A 2DFEA 4NLBA 5AZIA 2ETJA 3O3FA 3NE6A 5C0YA 3OYAA 5M1OA 1QVGM 3BF1A 2ZJRL 4FZZA 1VQPN 2G8UA 3OVNA 1D8YA 3HBTA 1CXUA 4BRKA 3AA2A 3H08A 1VQMN 2JWKA 3UB5A 3DLHA 1VSMA 1U04A 4FOIA 3AAQA 4FVMA 3SV4A 4FWRA 1K8AO 4FJ9A 4JEPA 1K6YA 3NF8A 4B3TK 3AARA 1WSGA 2HMIA 3O1BA 3U9ZA 4QCLA 4DU3A 3KK7A 1R59O 4B1YB 3KKSA 4JN4A 1QHTA 3VQ7A 3ENOA 5AZIB 1X9WA 4KHPK 4JAXA 5HRNA 3DRSA 3T1HK 3THWA 4W5OA 2YHWA 2Q3SA 4N47A 1JCEA 2QK9A 1RFQA 3QICA 3QFUA 1S9GA 4NXMK 2YHYA 4ID1A 3M1FA 4CZHA 1UAXA 3SAFA 3UIQA 4BQZA 2KZMA 1ZBHA 3BY5A 1J5EK 3NF6A 4B3SK 1C0FA 5BRFA 1HNIA 1J6ZA 3C6AA 1HNXK 5GADP 2B6AA 3OYHA 4DQRA 4BC3A 1IBKK 1Z05A 1SQKA 4KH6A 1KC8O 1S1UA 3VA3A 5TKYA 4A2BA 4EP4A 1KFSA 1SKWA 4DR5K 1IH7A 4CJ3A 1D9DA 1RDWX 1ZC6A 4ID5A 2A42A 4E19A 4FJMA 2P9IB 5AFUA 1M90O 4DTSA 4BY9C 5I9EB 4RW8A 1NK7A 1LW2A 4MFBA 4O5FA 5JLFA 3JXUA 4IOAL 1LOTB 1Q18A 5BPMA 2YV0X 3J8AA 4YOTA 2QWOA 1E3MA 3OY9A 3TU5A 3C7NA 1C0TA 3M6GA 3PIOL 3GBTA 4QS7A 2YNFA 3ZX3A 1KLNA 1O1WA 4A59A 2RHKA 4CCHA 4BWMA 2GEMA 4A5BA 4FOEA 3N4QA 4FWOA 3ZT3A 3VQ9A 3AVNA 1L5UA 1WSHA 4DSIA 2Z1HA 4E7IA 5KQ8A 4AQYK 2Q97A 4J8FA 4UQGA 4C8MA 1WSFA 3DOLA 3HTVA 3AVHA 3ID6A 3V1OA 1Q81O 2WFBA 1GLAG 3SPZA 4CJTA 3SQ0A 4NCAA 4IOXA 1RT5A 3IRXA 3QFPA 3ENBA 1XHXA 1RILA 2OCEA 1U2VB 1IKXA 3HZ6A 3VQBA 1HNZK 2VYPA 5CR4A 4JKCA 3FGUA 3OA9A 3TTDA 2I7NA 5E26A 5FPDA 4K43A 2PFUA 4AHCA 1K8KA 3SMSA 3VTHA 2E88A 5HP1A 1FKOA 3WNFA 4CGIA 4NLCA 2FLOA 2F7TA 2BANA 4AM6A 4CJ4A 3H46O 4DSFA 4JK8A 1TL1A 3PLAA 1NK6A 1JJ2M 3EZ5A 1NJWA 1JKHA 1BCMA 3J7YP 1S5JA 3RMBA 4E7HA 2HMPA 3VN5A 4JI5K 3K57A 1BDGA 3KKRA 3SJJA 1C1BA 4F3TA 3P1GA 4ICLA 4E7LA 2Y1IA 3VQDA 5AQLA 1K8KB 3OYGA 4H4OA 4KTQA 3ALYA 4RTFD 3KLIA 2Z1GA 4B9NA 1WUAA 3H6EA 1YTAA 4DTOA 1RDUA 4ZHRA 4OKEA 5AQWA 3OBWA 2Q0RA 4LD0A 3L4IA 4YY3K 5C15A 2OPSA 2NZTA 4CF1A 4BR0A 4IEIA 3QEPA 1VQ7N 2QWQA 3O9QA 3VQCA 4GNIA 2VWJA 2NLXA 2FSJA 3DLKA 4EFHA 2QKKA 1HX1A 4DKWA 1V4SA 1Q7YO 4OPKA 4N76A 4M3TA 3BUZB 4FPAA 4E7KA 2ZWHA 4B1VA 4JI8K 4BE1A 1RDCA 1BU6O 2P1JA 4CI6A 5ADXH 3NDKA 3RVCA 1QQCA 3HPHA 3SV3A 3QIPA 4BC5A 3BDPA 4CFCA 1T6CA 3F9MA 3U8XA 1EP4A 3VEWA 3Q7CA 1Q86O 1JLCA 4DFMA 1A5WA 5C2DA 1L3VA 3L2QA 4OPJA 5FPEA 1HPMA 2P9NA 1RT6A 3MXMA 3NMUA 4BR9A 1KAZA 1C0GA 3SYZA 1S72N 1HRHA 5BRHA 1CZAN 5IT9O 2YX6A 4DTXA 2ZGZA 3KIOA 4C8LA 3C94A 5C10A 4BRDA 3QNNA 2OANA 3MN7A 1RTIA 3PUFA 3ZT0A 5T7BA 3L2RA 2P9NB 2E2PA 1VSIA 2HF4A 3AA3A 1X9MA 1KSPA 1YHQN 3OS1A 2KTQA 3EY1A 4G9ZA 3A5MC 4DHYA 3WNHA 4N56A 4XH1A 3D0PA 1NK8A 1MWKA 1B92A 4CF0A 2D4WA 4M63C 4CIGA 5FPNA 3O3HA 3QO9A 3R3LA 1GLJO 4OKKA 3VQPA 4CJ7A 3FE1A 3VQEA 1RTJA 1YTUA 3O4NA 3TI0A 4GVEA 2VWBA 1VAZA 1JXBA 3BZKA 4DR2K 3EE9A 1LAVA 1XMOK 2DTUA 4CZEA 5F1XA 3VEOA 4BRIA 1SS6A 1QHAA 3G25A 2E1YA 4CJFA 3F5TA 2E6LA 4BC2A 4CHOA 3NBPA 1NGHA 1S1XA 4KFBA 3SUPA 3CM5A 3ZT2A 4DLEA 3DMJA 4F2SA 3O9UA 4DFPA 4RW6A 1QSYA 2HBMA 1IKVA 2V52B 3WEEA 3SI6A 1Y97A 5HROA 1FJGK 3NGZA 4MLHA 2XY8A 2HHTA 1TKTA 2ZF5O 2A40A 5C42A 3M8SA 3MX5A 4KTWA 1ZXOA 4JLHA 2OZMA 4NCGA 2PZSA 3SAGA 4LF5K 3ASMA 1TK5A 1JLAA 1QQNA 3AY9A 1E4FT 2XRIA 3MWTA 4Q5VA 3HP6A 4FLWA 3WEEB 2QM1A 4KTZA 3C6UA 3V9XA 5CY4A 1L3UA 4FLVA 3O4WA 2FSKA 1I3AA 2A1SA 1KTQA 1EO1A 4B9UA 1MU2A 4EZ9A 1ZBIA 3NF9A 4CJSA 3VEZA 4H5NA 1QTMA 5HRSA 4M3WA 4BQLA 4O8KA 4KI6A 2KFZA 5LMUK 2ASMA 5DMRA 1N6QA 4FZYA 3ISNC 3AVCA 4PKIA 3A5OC 3L2UA 1KFDA 3AVBA 1IO2A 1DKGD 4HUFA 1DTTA 2VCPA 4DTMA 1KQSM 3CCLN 4B9MA 4KAZA 3L2VA 2V51B 3VQ5A 2A5XA 3RTVA 4DF8A 4BRAA 4HVJA 4CZKA 4W5RA 3O6WA 4H8KA 1HKCA 1RNHA 1OH5A 5LMNK 4H0YB 4E89A 4LSLA 4DSJA 1VRTA 5JMVA 1NGIA 3UE5A 3ULEA 4I6MA 1C0UA 3A5LC 1N5YA 4YOYA 3MEDA 3FZLA 4M41A 2VQEK 3TWHA 1U6ZA 2QWRA 3ZSZA 1YI2N 2Q1NA 4PL7A 4CF9A 4DR1K 2XY5A 1RBUA 1DGKN 1S1TA 2CGKA 2D0AA 4GMJB 3BEXA 4CK1A 4KHSA 3O9RA 4H0VB 3CCEN 1QE1A 4BRGA 3T69A 3ULEB 3HM8A 1BOTO 3UKUA 4WQ4A 1NLVA 5HRPA 5BR9A 1TVRA 1T44A 2NRRA 2OPRA 3QINA 3HRGA 4FVUA 4MLEA 4B1XB 4YOWA 3BGRA 4W5NA 5JLHA 3AVKA 1ZBSA 4CECA 1S1WA 1XHZA 3O9TA 2PBDA 3M5RA 4OLAA 1MWMA 2P9SA 3SPYA 1C1CA 3QERA 4UY8O 4F9OA 2PYLA 4BRPA 1YITN 3DLLL 4KRFA 3B6PA 1R0AA 1ZBLA 4FJ7A 1HYZA 3O8MA 3LDQA 3UKUB 1EX4A 4CW7B 3WT0A 4CEEA 1JCGA 1WAFA 4I9QA 4NYNA 3MAQA 4CJKA 4BRQA 2VG6A 4KI4A 3L6QA 3OS2A 1RGIA 3WNEA 4CJ5A 4JYAK 3CJAA 3OYCA 5AQSA 2P9SB 3CXCM 1BO5O 5AQXA 5CZ2A 4DS4A 5KQDA 5B8HA 3LP2A 1HUXA 4CGGA 2IGIA 3SBTA 1XNRK 1NGDA 1XWLA 4A61A 4LFAK 1BGXT 5M1QA 2WONA 2QKBA 4CFBA 4DTRA 1U49A 1TL3A 4FJLA 4GV6A 4Z4HA 3EYZA 1TAUA 3VQAA 4IJNA 4BR5A 2G8HA 2VWKA 2ZE2A 3MXIA 3QIOA 1YVNA 3CJBA 1L3TA 3KD1E 4DB3A 2FSNA 3IS9A 4FJHA 4PHTX 5LY3A 4E3SA 1KRPA 1WNSA 1BL3A 3QETA 3ATUA 1WBDA 4FXDA 2Q0UA 4CJUA 2AP1A 4CEOA 4JKHA 4ISEA 3EN9A 1GLLO 4F8RA 3K9JA 5M1PA 5GAGP 1S3XA 3DAWA 1ITGA 1T03A 4CHPA 5ADXA 2F8SA 2YHAA 4YHHK 1XQSC 1LV5A 3HSCA 4H4MA 3ZCMA 5M1NA 3TSUA 2ZD1A 1XC3A 3T1YK 4LF7K 4FK4A 4CJVA 1TUYA 1IBMK 3GL1A 4B8AB 2UU9K 3S3OA 1LWFA 4E1MA 3NH1A 4Z4EA 3LDSA 4BRMA 4OJRA 4J2DA 1LW0A 3CPEA 1X1PA 2P9IA 3CERA 3M8PA 2F8TA 3HL8A 3G71N 3TAQA 1JXEA 1VK0A 2FBYA 5HOOA 2YI1A 4CZMA 1JL1A 2VQFK 4PWDA 3VOVA 3CCQN 3ATVA 2Q36A 1VSDA 4JKGA 4EHUA 1EQYA 2CH5A 1NKCA 2FBTA 4HTLA 1NG9A 3CIPA 2IC3A 4EAHD 3S3MA 3VGLA 1TK0A 4Y1DA 4DQQA 5J2NA 1QZ6A 2GUPA 3AO5A 2GV9A 1BG3A 1T3VA 2HHQA 5AQKA 4HHTA 2QWNA 4CHNA 2IAJA 3ULDA 4A2AA 4WQ4C 4DV1K 4DV2K 1Q9YA 2QA4N 4JKGB 5GIPA 3VQ8A 4RG8A 4NYFA 3NFAA 5DM6L 2IDOA 1U2VA 4M7YA 1CXQA 5C12A 1HJOA 5AQRA 1KVCA 3D2EA 2UUCK 3C65A 3CG7A 3KD5E 4LC9B 4Z4IA 1VQNN 5TKWA 3OYBA 3D45A 1G99A 3QESA 3W0LA 3R1XA 1F21A 3AA5X 2Y1JA 3SUOA 3F2KA 1BQNA 3D2FA 3I0SA 3TR8A 4FW1A 3PO5A 4BG8A 1RT7A 4MDBA 1EWQA 1GOCA 1KVBA 2G8FA 3S9HA 4KB0A 2HHXA 3ZYYX 3PSIA 5DK5A 3AO2A 3D2EB 3G6EN 3KLEA 2VG7A 5HRRA 3DLGA 3NH0A 4F4KA 3DYAA 2G8KA 2YNIA 4X66K 2WBNA 2HVHA 3OYKA 2KW4A 4YFUA 5CZ1A 3ENHA 3MN5A 5JVHL 4BE2A 5AQTA 5E84A 2HHVA 3NGIA 4FM1A 2NRVA 3WXIA 3D2FB 4PL8A 3J80O 3LZJA 1NJZA 3RMDA 2IIRA 2ZM6K 2D0BA 2VGMA 4QS8A 4DV6K 2E2NA 1EETA 3UKRA 5C25A 4DTJA 5J2PA 3TAFA 1QQMA 4CJEA 3WNGA 4OVLA 2YHBA 2DFHA 1NJXA 3ZSYA 3IG1A 1YVUA 1J54A 3PX0A 3JAMO 3HK2A 4JKBA 3WQUA 1RT4A 3PIPL 1EWRA 4CIEA 4K8ZA 4AHVA 4H5RA 3TABA 3DXMB 1XC9A 4X65K 4IFYA 1VQ8N 1OKJA 2HF3A 3UKRB 3HOTA 2YKMA 1D9FA 3P4IA 4LFBK 2XY6A 3ZEUA 3PX6A 1S22A 2IVOA 4GV9A 4KHNA 1JLGA 4CHZA 3G10A 1VQ9N 5DM7L 4I9LA 4GY2B 1NK5A 4ILGB 4FYDA 1W2BM 5AQUA 2R7YA 1BUPA 3CM6A 2CGLA 3Q7BA 3RR7A 4H0PA 5KPRA 1RTHA 3LP1A 2ZJQL 1ASUA 3ZSWA 1RBTA 1QS4A 5BPNA 3U6FA 2G8WA 2XO7A 3FZKA 4CZGA 3VEXA 4FWSA 4DQ8A 3ZEUB 3LP0A 3ZSVA 4B9LA 1NWKA 4OPAA 1K9MO 4DG1A 2RN2A 3THXB 3NVKA 4B3MK 1YUWA 4LH5A 1SKRA 1TV6A 1IG8A 1NGFA 5FRNA 2GBZA 4CE9A 1ATRA 3DM2A 1SL1A 2B4JA 3CYMA 3SUNA 4DSLA 4YOUA 3QEWA 4DSKA 3CCJN 3CQXA 3V1QA 4EIAA 1W9HA 4YOXA 3NF7A 4LF8K 1EXQA 1RCHA 3L3UA 2I5JA 4K42A 4CEBA 3DRPA 3V81A 4FWQA 1ILYA 1Q8IA 1GLDG 2BTFA 3MCPA 3OBYA 4DUYK 3MMVA 3CC2N 4H5WA 3NGYA 1VSLA 5LJWA 3TPQA 5BRDA 5KPTA 3LAMA 1VSJA 3LM9A 3CF5L 4H0XB 3OJSA 5SZTA 4E7JA 1XUPO 4OGCA 1ASVA 2LSNA 3KLGA 3E66A 4CZIA 5AFUH 3CCRN 4M3XA 3HYFA 4BR2A 3MN6A 1W0HA 3WXLA 1NU0A 2D0CA 1X9JA 3TTFA 3CHWA 1S9EA 4CGDA 3BZCA 2P5GA 4X64K 4A57A 4DR7K 1RDAA 2F4VK 4YDUA 4NB4A 5FDLA 4JI4K 4CK2A 3V9UA 3H3OB 1UA1A 2OA8A 1WBBA 4DFKA 1WLJA 4H5VA 1HR0K 2QI2A 1ATSA 1BWFO 2W6LA 2Q31A 4GVMA 3HSTB 4CD3A 2EWSA 4N5SA 5KI6A 3OYLA 1IBLK 4CFDA 3FLCO 3VEYA 3VGKA 1SUQA 3VTIA 2P9LB 4J2EA 4LY7A 1GLCG 4ISGA 4CZLA 4DMNA 3M8RA 3QLHA 3KK1A 4E0DA 3CQ8A 3ZSOA 5KGWA 1REVA 4FJ8A 4B1WB 4MO5A 2EX3A 3KHYA 4BR4A 3K0SA 2H3GX 2ZQBA 4KREA 1NBWA 2ASPA 4KHQA 4WQ5C 1TKDA 5EXWA 1YJNN 1VQ5N 3O80A 2E20A 4H0TB 3HO1A 4O8UA 4FLUA 2NRHA 3HP9A 3SK3A 3LPTA 4FZXC 4BRNA 4C8OA 1CLQA 3CMEN 4AM7A 3TARA 3SZ2A 5D3GA 2KFNA 4WE1A 4CEFA 3O9SA 4DFJA 2UUBK 3L8BA 3MCAB 1VRUA 2QXFA 1V4TA 4H5TA 2J4RA 3HI0A 2VGNA 4M3ZA 3L3VA 4FWNA 4FWKA 3CCUN 3THVA 1T7PA 4DQPA 2RE2A 4GKJK 5AQGA 4IDHA 4XIUA 4N41A 5C2FA 2RF2A 2O4GA 5AQIA 4IWVA 4CZFA 3ZT4A 4WFBL 1TKZA 3HPOA 2BGGA 5AQZA 4WFNL 1D4XA 1IV0A 2W42A 4JI0K 3TSPA 4GKKK 3E9PA 4PKGA 4DTUA 2HBJA 3IMXA 1KAXA 1X9SA 4B9QA 3HJFA 4BWJA 1HKBA 3EKUA 4B1ZA 2OPPA 1W97L 4IEEA 1LWEA 5AQOA 4ZTFA 2WOMA 2FXUA 4FLYA 4BDYA 3QEIA 1TKXA 2YCHA 2E1ZA 3NHGA 1D5AA 4BROA 2HB5A 3CFRA 2OYQA 2QTDA 1HYSA 1GOBA 2X78A 3MEEA 3CCSN 5FRMA 1P90A 5CE3A 1HNWK 3AVFA 5AQMA 3V9SA 4CERA 4HUEA 2FBXA 5LL6Z 5CYQA 5FLXO 4J2AA 1OH6A 1UWBA 3R9PA 1S6PA 1N33K 5F2RA 2O8DB 5KGXA 3ZETA 3CCVN 1DEJA 3LALA 3G0ZA 4KHWA 3DLRA 4KB1A 3KLHA 3C95A 4ILJA 4BDPA 3ZLJA 3OW2M 1N36K 4PUOA 4KH5A 1UOCA 3VMFB 1NK0A 4X62K 5FPMA 2GWJA 1OVQA 5AR0A 2O4IA 3FZFA 4B1UB 4HWIA 3K58A 2O8CA 3MEGA 3VQ4A 3ZETB 4OPHA 3OTOK 2DFFA 2W40A 3EL2A 4IKFA 2HNDA 1VQ6N 1KXPA 4CHQA 1T8EA 3VENA 3MXJA 4HTUA 3OS0A 1UA0A 3VF4A 3K9KA 1ZBFA 2IS3A 4MO4A 1CZ9A 3H1QA 1BCOA 3RSEA 4FK0A 3V9WA 3O08A 4FPBA 4YDUC 3HVRA 1LWCA 5EOYA 4DV4K 1T05A 2O8CB 3H1VX 1YXQA 3LDNA 4BE0A 3QEXA 4G1QA 3SQ4A 4BREA 4WYBA 4AHRA 3I56N 3E1YA 5GAEP 5GINA 5J2QA 3MK6A 2UXCK 3T7ZA 3K2PA 1KD1O 3RSEB 2HOEA 3RMCA 1YJ9N 3GDQA 4FSVA 3E9LA 3QNOA 4M7XA 4JS5A 4KHYA 4JRQA 3CMAN 2X6SA 3AVLA 2UUAK 4FLZA 3NAEA 4IOCL 3O4QA 2NRTA 1JLFA 2E6MA 3IKMA 2OTJN 3F9KA 1WSEA 2O8EB 4I7FA 1ATNA 2RPIA 3OYIA 1IKYA 4KBOA 2BDPA 4FO0A 3ZX0A 4AHTA 1HQEA 3SQ2A 1VQKN 5KRSA 3D7EO 4C1NK 4CK3A 4CBUA 3S41A 3ZSRA 2YHXA 4FLTA 4V19S 1RBVA 4I2PA 4CJPA 1U4BA 2QEXN 4FJIA 3DLEA 5F0XA 3TSQA 4OO1J 3HT3A 4DR4K 1BA1A 2QWMA 3E01A 4U7BA 1NK9A 2KZZA 1WAJA 3SQ1A 5KTQA 4PKHA 4F2RA 2HHSA 3KWIA 4IBNA 4AHUA 1YJWN 1HQUA 1Z25A 3WXJA 4DLGA 3VETA 3KJVA 4FLXA 3A5NC 1JLQA 1GLEG 3RR8A 1OVYA 2OZSA 2A6AA 3LPUA 5J2MA 3QBXA 5EY4A 1NKEA 4W5TA 4FJJA 3DLBA 3EZWA 3WXKA 5IWAK 5ELZA 4AH9A 3D6RA 3LWMA 4JRPA 3CCMN 1C1AA 3PX4A 3K5MA 1NOZA 3I55N 4FM0A 5AJ3K 4JI2K 2QXLA 1NGCA 3QDKA 3CJ9A 2HHHK 2D0PA 3L2WA 1RBRA 3MECA 3OJUA 3SMPA 4BRFA 1J5OA 4A5AA 4DS5A 1NK4A 4Y1CA 3BP8A 3WXMB 2PYJA 2HHWA 2P9PA 3THWB 1DLOA 2NRZA 1MA9B 1RDBA 3VF2A 1N32K 3ZSXA 5H1SQ 4M3RA 3SAHA 3A8YA 5JVGL 3JSMA 3EEQA 2DPNA 4PY5A 4M42A 2HBKA 4JHDA 2QWPA 1O13A 2V7YA 4TSXA 2FF6A 3W3DA 3SUQA 5GAHP 5EVZA 2P9PB 1YIJN 5HLFA 2JLEA 4FJ5A 1WB9A 5A2QO 3HXMA 5AQPA 3AVAA 1VQON 3ZSQA 3AVMA 1X3MA 1YT3A 3A2FA 3H3NO 4FWLA 4IO9L 3LWLA 4BVPA 4RW7A 4JHDB 3QB0A 3L4QA 1B9FA 3G4SN 2E8AA 1C6VA 1HMVA 1U47A 3VERA 5JS2A 4ELVA 4FJNA 2HBLA 4JI1K 1U48A 3C7NB 1TUUA 5HL7L 3FZMA 3I8BA 4XEIA 2W6KA 5AZJA 1RT1A 2BUPA 4YOVA 3T1AA 4HCCA 4LF6K 1HNVA 5K14A 3O1WA 4H03B 1YF5L 4CZJA 3B6OA 2I7PA 1NOYA 3DXMA 4FJKA 4LH4A 1QSLA 2HSTA 4CF8A 4CHYA 3HOSA 1OH7A 2JWLA 3RMAA 4IXCA 1TK8A 3BF3A 2YNGA 2VG5A 4DV7K 1TYQA 2E2QA 3ZT1A 4BRLA 1RTDA 3SCXA 5AQFA 3IFRA 3KWGA 5AZJB 3M3ZA 4GW6A 5EX5A 4WQ5A 2YJEA 3M8QA 4C8NA 4JK7A 5AQVA 2UXBK 4JNEA 3U9DA 3P39A 1NJYA 2E5LK 2A3ZA 1ESVA 4JD2A 4CBXA 2F96A 3PV8A 3KZBA 4FWPA 1VQLN 3K59A 1TYQB 2QW9A 2NRXA 3SLCA 4A62A 4OLBA 3VQ6A 2CGJA 2YKNA 2DY4A 1H1VA 3THXA 1P8ZA 4RW9A 1T6DA 1GOAA 3DRRA 1M1KO 4C1NI 4KV8A 2GTDA 3GE1A 4ISFA 4NO7A 3KK3A 2XY7A 2IVNA 1KLMA 4JD2B 2D1KA 3LDLA 2G8IA 4PA1A 3HVTA 4CVNE 3VEVA 3LDPA 1WSIA 5JICA 2A41A 3K5NA 5LJVA 3C0BA 5SWMA 3CD6N 1VQ4N 1JL2A 1I39A 4JS4A 1NMNA 4DCHA 5EU7A 3HPGA 2KKZA 4PQUA 5I42A 1C0MA 2X74A 3V6DA 1Y64A 2IVPA 3E9OA 1Z26A 4JI6K 3CFPA 4EP5A 3CJCA 3LANA 4KHUA 3AAPA 5CYMA 4KO0A 2ZGYA 2BH1A 4DUZK 2ITGA 2D0OA 4JKAA 4CESA 3IUCA 4DR6K 5J1EA 3JYTA 3C6HA 2P51A 1K73O 1Z6RA 4JI3K 3EKSA 4OKJA 4IDKA 4Z0UA 3AO3A 2IOCA 4C23A 3CFOA 2WC9A 3ITHA 1N34K 2FBVA 5KPZA 1XI1A 2HW3A 1W7AA 3PSFA 3HM9A 4B3RK 3TAMA 4CGHA 4Y0WA 4BRHA 4CJQA 3VA0A 1WSJA 4FM2A 2FF3B 1HPZA 1YAGA 4O55A 1U45A 3AVIA 4NCBA 1SL2A 1HYVA 3JS6A 5AQQA 3CI5A 4IG0A 2CH6A 2GUIA 4E1NA 3V1RA 4CJWA 2E2OA 4L3QA 5BR8K 4R5PA 3LDOA 3WQTA 1DTQA 2AA4A 4ILHA 1BQMA 4OGEA 4CBWA 4XH4A 3CC7N 1VSHA 3O5BA 1OH8A 2F9TA 2PY5A 3IAYA 4CEZA 2G8VA 2P5OA 2YJFA 2GWKA 2KHOA 2PAVA 2P9LA 4B3OA 5AQYA 3VPZA 3AV9A 3T19A 3TTCA 1BI4A 3K5LA 2HHUA 4KPYA 1FXXA 5BPLA 1CZBA 4HUGA 2Z1IA 1FK9A 3LAKA 4CEAA 4B9SA 3SJHA 4KH4A 4B9TA 2OTLN 1Q82O 4LF4K 3VQQA 4MQ3A 4EZ6A 1RDDA 3VESA 3KVGA 2F9WA 3NH2A 3SNNA 1BA0A 1SV5A 4Z4FA 1BI4B 3RWUA 3GG4A 3J7AP 3N4PA 2OPQA 2D5RA 3EO3A 1BHLA 3OHRA 2B5JA 4IFVA 3H45C 3TANA 2O8BA 3TAPA 4BGAA 4BG9A 1QQOA 4DV0K 1HJRA 4EHTA 4BRCA 3OYJA 5MLCQ 2FC0A 3RRGA 3FZHA 1VHXA 1NGJA 3I8DA 1EKEA 4FWMA 3T3FA 2ITMA 2A1RA 1TGOA 4R79A 4WCEL 3SBGA 4FCYA 1NGGA 3KLFA 3TAGA 4FJGA 3P31A 3ZX2A 4QOZB 4YORA 4DWIA 4IO8A 4O0IA 3LL3A 1KCFA 4OX9K 3MWPA 2ATQA 4E1JA 1FKPA 3V9ZA 1NNEA 4FK2A 3AGRA 4CIFA 2O8BB 3QBWA 3WUHA 3MDQA 4IJAA 4HCBA 4K25A 4B8CA 4CGJA 4KKOA 4Q0BA 1VSFA 2JGUA 3O3GA 4CF2A 2UYTA 3U3GA
chains in the Genus database with same CATH topology
1VHXA 2OCEA 3BZKA 1IV0A 3BZCA 1OVQA 3PSFA 3PSIA 1NMNA 1NU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VHX A;  2OCE A;  3BZK A;  1IV0 A;  3BZC A;  1OVQ A;  3PSF A;  3PSI A;  1NMN A;  1NU0 A; 
#chains in the Genus database with same CATH topology
 4IG3 A;  2HNY A;  5E41 A;  4M45 A;  4C8K A;  1IJJ A;  5BRE A;  2QWL A;  3P38 A;  1RT2 A;  3R8E A;  2Q2R A;  2HNZ A;  1LCU A;  1SZ2 A;  4JK9 A;  5BN9 A;  4L8R B;  3R6M A;  4BR7 A;  1NGB A;  2EHG A;  2UXD K;  1GLB G;  1NJI O;  2NRW A;  1VSE A;  4K8X A;  3DI6 A;  2O8D A;  2NNW A;  3OYM A;  3AGK A;  2X6N A;  4DU1 A;  1N8R O;  1XMQ K;  3EE8 A;  1NKB A;  5FRO A;  4ELU A;  4J2B A;  4K41 A;  3P5J A;  4CFA A;  3U4L A;  1ZBU A;  4FL9 A;  4W5Q A;  4B9V A;  4Z4G A;  3VGM A;  4JKD A;  5AQJ A;  3U3Y A;  3GOI A;  1B9D A;  1A5X A;  1JLE A;  4GV3 A;  4CGF A;  1S1V A;  3J7Z O;  5CHI A;  3FFI A;  2WUS A;  4JKE A;  5KRT A;  2KLA A;  3B8A X;  3LM2 A;  4DV3 K;  4DF4 A;  1FW6 A;  3MN9 A;  3I0R A;  4XH5 A;  4IZ9 A;  3NCI A;  1S6Q A;  5GIO A;  4YNQ A;  4AIL C;  4CED A;  2XHB A;  2HVI A;  1BIZ A;  1IKW A;  1LAW A;  2ZJP L;  1JCF A;  1VSK A;  4K0K K;  2AJQ A;  1TAQ A;  3AO1 A;  2W41 A;  1ASW A;  3CET A;  1BIU A;  4I6M B;  3LZI A;  3CPW M;  4WF9 L;  4RCH A;  1X3N A;  4DTP A;  4DTN A;  1E4G T;  4LSN A;  4AHS A;  3K5O A;  2P9U A;  4Z94 A;  1NM1 A;  4M3U A;  3OYN A;  3VF6 A;  4JI7 K;  5M1K A;  4FJX A;  2KQ2 A;  5M1F A;  3CC4 N;  1DT9 A;  3I33 A;  3AVJ A;  4ELT A;  5AQN A;  1HKG A;  1Q9X A;  4O0J A;  4LFC K;  4RWT A;  1NMD A;  4CD1 A;  2ASO A;  1XNQ K;  3DJC A;  2GEL A;  4H0O A;  1QZ5 A;  4NXN K;  3P83 D;  4DR3 K;  1G15 A;  4BDZ A;  4LF9 K;  4FW2 A;  4DU4 A;  3LP3 A;  5JS1 A;  4BGB A;  4O4G A;  1J9A A;  2P9U B;  3KK2 A;  4BAC A;  1ZYQ A;  4CJL A;  3THY A;  3OYE A;  1SKS A;  5AQH A;  2NUB A;  1HLU A;  5HBM A;  2YNH A;  2BE2 A;  1SL0 A;  2O8F A;  3C6T A;  3AVG A;  3S3N A;  4MDA A;  4BC4 A;  3PO4 A;  3DXK A;  3IDH A;  3TAE A;  4F3O A;  4ZTJ A;  1NGE A;  4JKF A;  4WFA L;  3NVM A;  3AO4 A;  4U67 L;  2O8E A;  4M3Y A;  3DOK A;  1KAY A;  3OYF A;  4QAG A;  3CJ7 A;  4AF1 A;  1L3S A;  1BIS A;  3A0I X;  4BVO A;  3PY8 A;  3MX2 A;  2RKI A;  2P9K A;  3CJ1 A;  1RT3 A;  3THY B;  1I94 K;  5I3U A;  1WOQ A;  4O44 A;  4B08 A;  5BN8 A;  3OYD A;  4DSE A;  3RRH A;  2Z1J A;  3L0Q A;  3F73 A;  4I2Q A;  1IG9 A;  3CQY A;  1J53 A;  2O8F B;  3QML A;  4CEQ A;  3QEV A;  3DXK B;  3KTQ A;  4DQI A;  4JV5 K;  1MDU B;  1QVF M;  1GLF O;  3AA4 A;  4DQS A;  2E4L A;  3DWL A;  4CJR A;  3V4I A;  1NGA A;  3J81 O;  4Z4C A;  1JLB A;  4O5B A;  2V7Z A;  4RW4 A;  2WTU A;  4DV5 K;  3FFK B;  5C24 A;  4IFE A;  1WN7 A;  3ID8 A;  3FR0 A;  1SAZ A;  1A5V A;  4QS9 A;  1QSS A;  1KVA A;  2P9K B;  1RBS A;  2GX9 A;  2DFE A;  4NLB A;  5AZI A;  2ETJ A;  3O3F A;  3NE6 A;  5C0Y A;  3OYA A;  5M1O A;  1QVG M;  3BF1 A;  2ZJR L;  4FZZ A;  1VQP N;  2G8U A;  3OVN A;  1D8Y A;  3HBT A;  1CXU A;  4BRK A;  3AA2 A;  3H08 A;  1VQM N;  2JWK A;  3UB5 A;  3DLH A;  1VSM A;  1U04 A;  4FOI A;  3AAQ A;  4FVM A;  3SV4 A;  4FWR A;  1K8A O;  4FJ9 A;  4JEP A;  1K6Y A;  3NF8 A;  4B3T K;  3AAR A;  1WSG A;  2HMI A;  3O1B A;  3U9Z A;  4QCL A;  4DU3 A;  3KK7 A;  1R59 O;  4B1Y B;  3KKS A;  4JN4 A;  1QHT A;  3VQ7 A;  3ENO A;  5AZI B;  1X9W A;  4KHP K;  4JAX A;  5HRN A;  3DRS A;  3T1H K;  3THW A;  4W5O A;  2YHW A;  2Q3S A;  4N47 A;  1JCE A;  2QK9 A;  1RFQ A;  3QIC A;  3QFU A;  1S9G A;  4NXM K;  2YHY A;  4ID1 A;  3M1F A;  4CZH A;  1UAX A;  3SAF A;  3UIQ A;  4BQZ A;  2KZM A;  1ZBH A;  3BY5 A;  1J5E K;  3NF6 A;  4B3S K;  1C0F A;  5BRF A;  1HNI A;  1J6Z A;  3C6A A;  1HNX K;  5GAD P;  2B6A A;  3OYH A;  4DQR A;  4BC3 A;  1IBK K;  1Z05 A;  1SQK A;  4KH6 A;  1KC8 O;  1S1U A;  3VA3 A;  5TKY A;  4A2B A;  4EP4 A;  1KFS A;  1SKW A;  4DR5 K;  1IH7 A;  4CJ3 A;  1D9D A;  1RDW X;  1ZC6 A;  4ID5 A;  2A42 A;  4E19 A;  4FJM A;  2P9I B;  5AFU A;  1M90 O;  4DTS A;  4BY9 C;  5I9E B;  4RW8 A;  1NK7 A;  1LW2 A;  4MFB A;  4O5F A;  5JLF A;  3JXU A;  4IOA L;  1LOT B;  1Q18 A;  5BPM A;  2YV0 X;  3J8A A;  4YOT A;  2QWO A;  1E3M A;  3OY9 A;  3TU5 A;  3C7N A;  1C0T A;  3M6G A;  3PIO L;  3GBT A;  4QS7 A;  2YNF A;  3ZX3 A;  1KLN A;  1O1W A;  4A59 A;  2RHK A;  4CCH A;  4BWM A;  2GEM A;  4A5B A;  4FOE A;  3N4Q A;  4FWO A;  3ZT3 A;  3VQ9 A;  3AVN A;  1L5U A;  1WSH A;  4DSI A;  2Z1H A;  4E7I A;  5KQ8 A;  4AQY K;  2Q97 A;  4J8F A;  4UQG A;  4C8M A;  1WSF A;  3DOL A;  3HTV A;  3AVH A;  3ID6 A;  3V1O A;  1Q81 O;  2WFB A;  1GLA G;  3SPZ A;  4CJT A;  3SQ0 A;  4NCA A;  4IOX A;  1RT5 A;  3IRX A;  3QFP A;  3ENB A;  1XHX A;  1RIL A;  2OCE A;  1U2V B;  1IKX A;  3HZ6 A;  3VQB A;  1HNZ K;  2VYP A;  5CR4 A;  4JKC A;  3FGU A;  3OA9 A;  3TTD A;  2I7N A;  5E26 A;  5FPD A;  4K43 A;  2PFU A;  4AHC A;  1K8K A;  3SMS A;  3VTH A;  2E88 A;  5HP1 A;  1FKO A;  3WNF A;  4CGI A;  4NLC A;  2FLO A;  2F7T A;  2BAN A;  4AM6 A;  4CJ4 A;  3H46 O;  4DSF A;  4JK8 A;  1TL1 A;  3PLA A;  1NK6 A;  1JJ2 M;  3EZ5 A;  1NJW A;  1JKH A;  1BCM A;  3J7Y P;  1S5J A;  3RMB A;  4E7H A;  2HMP A;  3VN5 A;  4JI5 K;  3K57 A;  1BDG A;  3KKR A;  3SJJ A;  1C1B A;  4F3T A;  3P1G A;  4ICL A;  4E7L A;  2Y1I A;  3VQD A;  5AQL A;  1K8K B;  3OYG A;  4H4O A;  4KTQ A;  3ALY A;  4RTF D;  3KLI A;  2Z1G A;  4B9N A;  1WUA A;  3H6E A;  1YTA A;  4DTO A;  1RDU A;  4ZHR A;  4OKE A;  5AQW A;  3OBW A;  2Q0R A;  4LD0 A;  3L4I A;  4YY3 K;  5C15 A;  2OPS A;  2NZT A;  4CF1 A;  4BR0 A;  4IEI A;  3QEP A;  1VQ7 N;  2QWQ A;  3O9Q A;  3VQC A;  4GNI A;  2VWJ A;  2NLX A;  2FSJ A;  3DLK A;  4EFH A;  2QKK A;  1HX1 A;  4DKW A;  1V4S A;  1Q7Y O;  4OPK A;  4N76 A;  4M3T A;  3BUZ B;  4FPA A;  4E7K A;  2ZWH A;  4B1V A;  4JI8 K;  4BE1 A;  1RDC A;  1BU6 O;  2P1J A;  4CI6 A;  5ADX H;  3NDK A;  3RVC A;  1QQC A;  3HPH A;  3SV3 A;  3QIP A;  4BC5 A;  3BDP A;  4CFC A;  1T6C A;  3F9M A;  3U8X A;  1EP4 A;  3VEW A;  3Q7C A;  1Q86 O;  1JLC A;  4DFM A;  1A5W A;  5C2D A;  1L3V A;  3L2Q A;  4OPJ A;  5FPE A;  1HPM A;  2P9N A;  1RT6 A;  3MXM A;  3NMU A;  4BR9 A;  1KAZ A;  1C0G A;  3SYZ A;  1S72 N;  1HRH A;  5BRH A;  1CZA N;  5IT9 O;  2YX6 A;  4DTX A;  2ZGZ A;  3KIO A;  4C8L A;  3C94 A;  5C10 A;  4BRD A;  3QNN A;  2OAN A;  3MN7 A;  1RTI A;  3PUF A;  3ZT0 A;  5T7B A;  3L2R A;  2P9N B;  2E2P A;  1VSI A;  2HF4 A;  3AA3 A;  1X9M A;  1KSP A;  1YHQ N;  3OS1 A;  2KTQ A;  3EY1 A;  4G9Z A;  3A5M C;  4DHY A;  3WNH A;  4N56 A;  4XH1 A;  3D0P A;  1NK8 A;  1MWK A;  1B92 A;  4CF0 A;  2D4W A;  4M63 C;  4CIG A;  5FPN A;  3O3H A;  3QO9 A;  3R3L A;  1GLJ O;  4OKK A;  3VQP A;  4CJ7 A;  3FE1 A;  3VQE A;  1RTJ A;  1YTU A;  3O4N A;  3TI0 A;  4GVE A;  2VWB A;  1VAZ A;  1JXB A;  3BZK A;  4DR2 K;  3EE9 A;  1LAV A;  1XMO K;  2DTU A;  4CZE A;  5F1X A;  3VEO A;  4BRI A;  1SS6 A;  1QHA A;  3G25 A;  2E1Y A;  4CJF A;  3F5T A;  2E6L A;  4BC2 A;  4CHO A;  3NBP A;  1NGH A;  1S1X A;  4KFB A;  3SUP A;  3CM5 A;  3ZT2 A;  4DLE A;  3DMJ A;  4F2S A;  3O9U A;  4DFP A;  4RW6 A;  1QSY A;  2HBM A;  1IKV A;  2V52 B;  3WEE A;  3SI6 A;  1Y97 A;  5HRO A;  1FJG K;  3NGZ A;  4MLH A;  2XY8 A;  2HHT A;  1TKT A;  2ZF5 O;  2A40 A;  5C42 A;  3M8S A;  3MX5 A;  4KTW A;  1ZXO A;  4JLH A;  2OZM A;  4NCG A;  2PZS A;  3SAG A;  4LF5 K;  3ASM A;  1TK5 A;  1JLA A;  1QQN A;  3AY9 A;  1E4F T;  2XRI A;  3MWT A;  4Q5V A;  3HP6 A;  4FLW A;  3WEE B;  2QM1 A;  4KTZ A;  3C6U A;  3V9X A;  5CY4 A;  1L3U A;  4FLV A;  3O4W A;  2FSK A;  1I3A A;  2A1S A;  1KTQ A;  1EO1 A;  4B9U A;  1MU2 A;  4EZ9 A;  1ZBI A;  3NF9 A;  4CJS A;  3VEZ A;  4H5N A;  1QTM A;  5HRS A;  4M3W A;  4BQL A;  4O8K A;  4KI6 A;  2KFZ A;  5LMU K;  2ASM A;  5DMR A;  1N6Q A;  4FZY A;  3ISN C;  3AVC A;  4PKI A;  3A5O C;  3L2U A;  1KFD A;  3AVB A;  1IO2 A;  1DKG D;  4HUF A;  1DTT A;  2VCP A;  4DTM A;  1KQS M;  3CCL N;  4B9M A;  4KAZ A;  3L2V A;  2V51 B;  3VQ5 A;  2A5X A;  3RTV A;  4DF8 A;  4BRA A;  4HVJ A;  4CZK A;  4W5R A;  3O6W A;  4H8K A;  1HKC A;  1RNH A;  1OH5 A;  5LMN K;  4H0Y B;  4E89 A;  4LSL A;  4DSJ A;  1VRT A;  5JMV A;  1NGI A;  3UE5 A;  3ULE A;  4I6M A;  1C0U A;  3A5L C;  1N5Y A;  4YOY A;  3MED A;  3FZL A;  4M41 A;  2VQE K;  3TWH A;  1U6Z A;  2QWR A;  3ZSZ A;  1YI2 N;  2Q1N A;  4PL7 A;  4CF9 A;  4DR1 K;  2XY5 A;  1RBU A;  1DGK N;  1S1T A;  2CGK A;  2D0A A;  4GMJ B;  3BEX A;  4CK1 A;  4KHS A;  3O9R A;  4H0V B;  3CCE N;  1QE1 A;  4BRG A;  3T69 A;  3ULE B;  3HM8 A;  1BOT O;  3UKU A;  4WQ4 A;  1NLV A;  5HRP A;  5BR9 A;  1TVR A;  1T44 A;  2NRR A;  2OPR A;  3QIN A;  3HRG A;  4FVU A;  4MLE A;  4B1X B;  4YOW A;  3BGR A;  4W5N A;  5JLH A;  3AVK A;  1ZBS A;  4CEC A;  1S1W A;  1XHZ A;  3O9T A;  2PBD A;  3M5R A;  4OLA A;  1MWM A;  2P9S A;  3SPY A;  1C1C A;  3QER A;  4UY8 O;  4F9O A;  2PYL A;  4BRP A;  1YIT N;  3DLL L;  4KRF A;  3B6P A;  1R0A A;  1ZBL A;  4FJ7 A;  1HYZ A;  3O8M A;  3LDQ A;  3UKU B;  1EX4 A;  4CW7 B;  3WT0 A;  4CEE A;  1JCG A;  1WAF A;  4I9Q A;  4NYN A;  3MAQ A;  4CJK A;  4BRQ A;  2VG6 A;  4KI4 A;  3L6Q A;  3OS2 A;  1RGI A;  3WNE A;  4CJ5 A;  4JYA K;  3CJA A;  3OYC A;  5AQS A;  2P9S B;  3CXC M;  1BO5 O;  5AQX A;  5CZ2 A;  4DS4 A;  5KQD A;  5B8H A;  3LP2 A;  1HUX A;  4CGG A;  2IGI A;  3SBT A;  1XNR K;  1NGD A;  1XWL A;  4A61 A;  4LFA K;  1BGX T;  5M1Q A;  2WON A;  2QKB A;  4CFB A;  4DTR A;  1U49 A;  1TL3 A;  4FJL A;  4GV6 A;  4Z4H A;  3EYZ A;  1TAU A;  3VQA A;  4IJN A;  4BR5 A;  2G8H A;  2VWK A;  2ZE2 A;  3MXI A;  3QIO A;  1YVN A;  3CJB A;  1L3T A;  3KD1 E;  4DB3 A;  2FSN A;  3IS9 A;  4FJH A;  4PHT X;  5LY3 A;  4E3S A;  1KRP A;  1WNS A;  1BL3 A;  3QET A;  3ATU A;  1WBD A;  4FXD A;  2Q0U A;  4CJU A;  2AP1 A;  4CEO A;  4JKH A;  4ISE A;  3EN9 A;  1GLL O;  4F8R A;  3K9J A;  5M1P A;  5GAG P;  1S3X A;  3DAW A;  1ITG A;  1T03 A;  4CHP A;  5ADX A;  2F8S A;  2YHA A;  4YHH K;  1XQS C;  1LV5 A;  3HSC A;  4H4M A;  3ZCM A;  5M1N A;  3TSU A;  2ZD1 A;  1XC3 A;  3T1Y K;  4LF7 K;  4FK4 A;  4CJV A;  1TUY A;  1IBM K;  3GL1 A;  4B8A B;  2UU9 K;  3S3O A;  1LWF A;  4E1M A;  3NH1 A;  4Z4E A;  3LDS A;  4BRM A;  4OJR A;  4J2D A;  1LW0 A;  3CPE A;  1X1P A;  2P9I A;  3CER A;  3M8P A;  2F8T A;  3HL8 A;  3G71 N;  3TAQ A;  1JXE A;  1VK0 A;  2FBY A;  5HOO A;  2YI1 A;  4CZM A;  1JL1 A;  2VQF K;  4PWD A;  3VOV A;  3CCQ N;  3ATV A;  2Q36 A;  1VSD A;  4JKG A;  4EHU A;  1EQY A;  2CH5 A;  1NKC A;  2FBT A;  4HTL A;  1NG9 A;  3CIP A;  2IC3 A;  4EAH D;  3S3M A;  3VGL A;  1TK0 A;  4Y1D A;  4DQQ A;  5J2N A;  1QZ6 A;  2GUP A;  3AO5 A;  2GV9 A;  1BG3 A;  1T3V A;  2HHQ A;  5AQK A;  4HHT A;  2QWN A;  4CHN A;  2IAJ A;  3ULD A;  4A2A A;  4WQ4 C;  4DV1 K;  4DV2 K;  1Q9Y A;  2QA4 N;  4JKG B;  5GIP A;  3VQ8 A;  4RG8 A;  4NYF A;  3NFA A;  5DM6 L;  2IDO A;  1U2V A;  4M7Y A;  1CXQ A;  5C12 A;  1HJO A;  5AQR A;  1KVC A;  3D2E A;  2UUC K;  3C65 A;  3CG7 A;  3KD5 E;  4LC9 B;  4Z4I A;  1VQN N;  5TKW A;  3OYB A;  3D45 A;  1G99 A;  3QES A;  3W0L A;  3R1X A;  1F21 A;  3AA5 X;  2Y1J A;  3SUO A;  3F2K A;  1BQN A;  3D2F A;  3I0S A;  3TR8 A;  4FW1 A;  3PO5 A;  4BG8 A;  1RT7 A;  4MDB A;  1EWQ A;  1GOC A;  1KVB A;  2G8F A;  3S9H A;  4KB0 A;  2HHX A;  3ZYY X;  3PSI A;  5DK5 A;  3AO2 A;  3D2E B;  3G6E N;  3KLE A;  2VG7 A;  5HRR A;  3DLG A;  3NH0 A;  4F4K A;  3DYA A;  2G8K A;  2YNI A;  4X66 K;  2WBN A;  2HVH A;  3OYK A;  2KW4 A;  4YFU A;  5CZ1 A;  3ENH A;  3MN5 A;  5JVH L;  4BE2 A;  5AQT A;  5E84 A;  2HHV A;  3NGI A;  4FM1 A;  2NRV A;  3WXI A;  3D2F B;  4PL8 A;  3J80 O;  3LZJ A;  1NJZ A;  3RMD A;  2IIR A;  2ZM6 K;  2D0B A;  2VGM A;  4QS8 A;  4DV6 K;  2E2N A;  1EET A;  3UKR A;  5C25 A;  4DTJ A;  5J2P A;  3TAF A;  1QQM A;  4CJE A;  3WNG A;  4OVL A;  2YHB A;  2DFH A;  1NJX A;  3ZSY A;  3IG1 A;  1YVU A;  1J54 A;  3PX0 A;  3JAM O;  3HK2 A;  4JKB A;  3WQU A;  1RT4 A;  3PIP L;  1EWR A;  4CIE A;  4K8Z A;  4AHV A;  4H5R A;  3TAB A;  3DXM B;  1XC9 A;  4X65 K;  4IFY A;  1VQ8 N;  1OKJ A;  2HF3 A;  3UKR B;  3HOT A;  2YKM A;  1D9F A;  3P4I A;  4LFB K;  2XY6 A;  3ZEU A;  3PX6 A;  1S22 A;  2IVO A;  4GV9 A;  4KHN A;  1JLG A;  4CHZ A;  3G10 A;  1VQ9 N;  5DM7 L;  4I9L A;  4GY2 B;  1NK5 A;  4ILG B;  4FYD A;  1W2B M;  5AQU A;  2R7Y A;  1BUP A;  3CM6 A;  2CGL A;  3Q7B A;  3RR7 A;  4H0P A;  5KPR A;  1RTH A;  3LP1 A;  2ZJQ L;  1ASU A;  3ZSW A;  1RBT A;  1QS4 A;  5BPN A;  3U6F A;  2G8W A;  2XO7 A;  3FZK A;  4CZG A;  3VEX A;  4FWS A;  4DQ8 A;  3ZEU B;  3LP0 A;  3ZSV A;  4B9L A;  1NWK A;  4OPA A;  1K9M O;  4DG1 A;  2RN2 A;  3THX B;  3NVK A;  4B3M K;  1YUW A;  4LH5 A;  1SKR A;  1TV6 A;  1IG8 A;  1NGF A;  5FRN A;  2GBZ A;  4CE9 A;  1ATR A;  3DM2 A;  1SL1 A;  2B4J A;  3CYM A;  3SUN A;  4DSL A;  4YOU A;  3QEW A;  4DSK A;  3CCJ N;  3CQX A;  3V1Q A;  4EIA A;  1W9H A;  4YOX A;  3NF7 A;  4LF8 K;  1EXQ A;  1RCH A;  3L3U A;  2I5J A;  4K42 A;  4CEB A;  3DRP A;  3V81 A;  4FWQ A;  1ILY A;  1Q8I A;  1GLD G;  2BTF A;  3MCP A;  3OBY A;  4DUY K;  3MMV A;  3CC2 N;  4H5W A;  3NGY A;  1VSL A;  5LJW A;  3TPQ A;  5BRD A;  5KPT A;  3LAM A;  1VSJ A;  3LM9 A;  3CF5 L;  4H0X B;  3OJS A;  5SZT A;  4E7J A;  1XUP O;  4OGC A;  1ASV A;  2LSN A;  3KLG A;  3E66 A;  4CZI A;  5AFU H;  3CCR N;  4M3X A;  3HYF A;  4BR2 A;  3MN6 A;  1W0H A;  3WXL A;  1NU0 A;  2D0C A;  1X9J A;  3TTF A;  3CHW A;  1S9E A;  4CGD A;  3BZC A;  2P5G A;  4X64 K;  4A57 A;  4DR7 K;  1RDA A;  2F4V K;  4YDU A;  4NB4 A;  5FDL A;  4JI4 K;  4CK2 A;  3V9U A;  3H3O B;  1UA1 A;  2OA8 A;  1WBB A;  4DFK A;  1WLJ A;  4H5V A;  1HR0 K;  2QI2 A;  1ATS A;  1BWF O;  2W6L A;  2Q31 A;  4GVM A;  3HST B;  4CD3 A;  2EWS A;  4N5S A;  5KI6 A;  3OYL A;  1IBL K;  4CFD A;  3FLC O;  3VEY A;  3VGK A;  1SUQ A;  3VTI A;  2P9L B;  4J2E A;  4LY7 A;  1GLC G;  4ISG A;  4CZL A;  4DMN A;  3M8R A;  3QLH A;  3KK1 A;  4E0D A;  3CQ8 A;  3ZSO A;  5KGW A;  1REV A;  4FJ8 A;  4B1W B;  4MO5 A;  2EX3 A;  3KHY A;  4BR4 A;  3K0S A;  2H3G X;  2ZQB A;  4KRE A;  1NBW A;  2ASP A;  4KHQ A;  4WQ5 C;  1TKD A;  5EXW A;  1YJN N;  1VQ5 N;  3O80 A;  2E20 A;  4H0T B;  3HO1 A;  4O8U A;  4FLU A;  2NRH A;  3HP9 A;  3SK3 A;  3LPT A;  4FZX C;  4BRN A;  4C8O A;  1CLQ A;  3CME N;  4AM7 A;  3TAR A;  3SZ2 A;  5D3G A;  2KFN A;  4WE1 A;  4CEF A;  3O9S A;  4DFJ A;  2UUB K;  3L8B A;  3MCA B;  1VRU A;  2QXF A;  1V4T A;  4H5T A;  2J4R A;  3HI0 A;  2VGN A;  4M3Z A;  3L3V A;  4FWN A;  4FWK A;  3CCU N;  3THV A;  1T7P A;  4DQP A;  2RE2 A;  4GKJ K;  5AQG A;  4IDH A;  4XIU A;  4N41 A;  5C2F A;  2RF2 A;  2O4G A;  5AQI A;  4IWV A;  4CZF A;  3ZT4 A;  4WFB L;  1TKZ A;  3HPO A;  2BGG A;  5AQZ A;  4WFN L;  1D4X A;  1IV0 A;  2W42 A;  4JI0 K;  3TSP A;  4GKK K;  3E9P A;  4PKG A;  4DTU A;  2HBJ A;  3IMX A;  1KAX A;  1X9S A;  4B9Q A;  3HJF A;  4BWJ A;  1HKB A;  3EKU A;  4B1Z A;  2OPP A;  1W97 L;  4IEE A;  1LWE A;  5AQO A;  4ZTF A;  2WOM A;  2FXU A;  4FLY A;  4BDY A;  3QEI A;  1TKX A;  2YCH A;  2E1Z A;  3NHG A;  1D5A A;  4BRO A;  2HB5 A;  3CFR A;  2OYQ A;  2QTD A;  1HYS A;  1GOB A;  2X78 A;  3MEE A;  3CCS N;  5FRM A;  1P90 A;  5CE3 A;  1HNW K;  3AVF A;  5AQM A;  3V9S A;  4CER A;  4HUE A;  2FBX A;  5LL6 Z;  5CYQ A;  5FLX O;  4J2A A;  1OH6 A;  1UWB A;  3R9P A;  1S6P A;  1N33 K;  5F2R A;  2O8D B;  5KGX A;  3ZET A;  3CCV N;  1DEJ A;  3LAL A;  3G0Z A;  4KHW A;  3DLR A;  4KB1 A;  3KLH A;  3C95 A;  4ILJ A;  4BDP A;  3ZLJ A;  3OW2 M;  1N36 K;  4PUO A;  4KH5 A;  1UOC A;  3VMF B;  1NK0 A;  4X62 K;  5FPM A;  2GWJ A;  1OVQ A;  5AR0 A;  2O4I A;  3FZF A;  4B1U B;  4HWI A;  3K58 A;  2O8C A;  3MEG A;  3VQ4 A;  3ZET B;  4OPH A;  3OTO K;  2DFF A;  2W40 A;  3EL2 A;  4IKF A;  2HND A;  1VQ6 N;  1KXP A;  4CHQ A;  1T8E A;  3VEN A;  3MXJ A;  4HTU A;  3OS0 A;  1UA0 A;  3VF4 A;  3K9K A;  1ZBF A;  2IS3 A;  4MO4 A;  1CZ9 A;  3H1Q A;  1BCO A;  3RSE A;  4FK0 A;  3V9W A;  3O08 A;  4FPB A;  4YDU C;  3HVR A;  1LWC A;  5EOY A;  4DV4 K;  1T05 A;  2O8C B;  3H1V X;  1YXQ A;  3LDN A;  4BE0 A;  3QEX A;  4G1Q A;  3SQ4 A;  4BRE A;  4WYB A;  4AHR A;  3I56 N;  3E1Y A;  5GAE P;  5GIN A;  5J2Q A;  3MK6 A;  2UXC K;  3T7Z A;  3K2P A;  1KD1 O;  3RSE B;  2HOE A;  3RMC A;  1YJ9 N;  3GDQ A;  4FSV A;  3E9L A;  3QNO A;  4M7X A;  4JS5 A;  4KHY A;  4JRQ A;  3CMA N;  2X6S A;  3AVL A;  2UUA K;  4FLZ A;  3NAE A;  4IOC L;  3O4Q A;  2NRT A;  1JLF A;  2E6M A;  3IKM A;  2OTJ N;  3F9K A;  1WSE A;  2O8E B;  4I7F A;  1ATN A;  2RPI A;  3OYI A;  1IKY A;  4KBO A;  2BDP A;  4FO0 A;  3ZX0 A;  4AHT A;  1HQE A;  3SQ2 A;  1VQK N;  5KRS A;  3D7E O;  4C1N K;  4CK3 A;  4CBU A;  3S41 A;  3ZSR A;  2YHX A;  4FLT A;  4V19 S;  1RBV A;  4I2P A;  4CJP A;  1U4B A;  2QEX N;  4FJI A;  3DLE A;  5F0X A;  3TSQ A;  4OO1 J;  3HT3 A;  4DR4 K;  1BA1 A;  2QWM A;  3E01 A;  4U7B A;  1NK9 A;  2KZZ A;  1WAJ A;  3SQ1 A;  5KTQ A;  4PKH A;  4F2R A;  2HHS A;  3KWI A;  4IBN A;  4AHU A;  1YJW N;  1HQU A;  1Z25 A;  3WXJ A;  4DLG A;  3VET A;  3KJV A;  4FLX A;  3A5N C;  1JLQ A;  1GLE G;  3RR8 A;  1OVY A;  2OZS A;  2A6A A;  3LPU A;  5J2M A;  3QBX A;  5EY4 A;  1NKE A;  4W5T A;  4FJJ A;  3DLB A;  3EZW A;  3WXK A;  5IWA K;  5ELZ A;  4AH9 A;  3D6R A;  3LWM A;  4JRP A;  3CCM N;  1C1A A;  3PX4 A;  3K5M A;  1NOZ A;  3I55 N;  4FM0 A;  5AJ3 K;  4JI2 K;  2QXL A;  1NGC A;  3QDK A;  3CJ9 A;  2HHH K;  2D0P A;  3L2W A;  1RBR A;  3MEC A;  3OJU A;  3SMP A;  4BRF A;  1J5O A;  4A5A A;  4DS5 A;  1NK4 A;  4Y1C A;  3BP8 A;  3WXM B;  2PYJ A;  2HHW A;  2P9P A;  3THW B;  1DLO A;  2NRZ A;  1MA9 B;  1RDB A;  3VF2 A;  1N32 K;  3ZSX A;  5H1S Q;  4M3R A;  3SAH A;  3A8Y A;  5JVG L;  3JSM A;  3EEQ A;  2DPN A;  4PY5 A;  4M42 A;  2HBK A;  4JHD A;  2QWP A;  1O13 A;  2V7Y A;  4TSX A;  2FF6 A;  3W3D A;  3SUQ A;  5GAH P;  5EVZ A;  2P9P B;  1YIJ N;  5HLF A;  2JLE A;  4FJ5 A;  1WB9 A;  5A2Q O;  3HXM A;  5AQP A;  3AVA A;  1VQO N;  3ZSQ A;  3AVM A;  1X3M A;  1YT3 A;  3A2F A;  3H3N O;  4FWL A;  4IO9 L;  3LWL A;  4BVP A;  4RW7 A;  4JHD B;  3QB0 A;  3L4Q A;  1B9F A;  3G4S N;  2E8A A;  1C6V A;  1HMV A;  1U47 A;  3VER A;  5JS2 A;  4ELV A;  4FJN A;  2HBL A;  4JI1 K;  1U48 A;  3C7N B;  1TUU A;  5HL7 L;  3FZM A;  3I8B A;  4XEI A;  2W6K A;  5AZJ A;  1RT1 A;  2BUP A;  4YOV A;  3T1A A;  4HCC A;  4LF6 K;  1HNV A;  5K14 A;  3O1W A;  4H03 B;  1YF5 L;  4CZJ A;  3B6O A;  2I7P A;  1NOY A;  3DXM A;  4FJK A;  4LH4 A;  1QSL A;  2HST A;  4CF8 A;  4CHY A;  3HOS A;  1OH7 A;  2JWL A;  3RMA A;  4IXC A;  1TK8 A;  3BF3 A;  2YNG A;  2VG5 A;  4DV7 K;  1TYQ A;  2E2Q A;  3ZT1 A;  4BRL A;  1RTD A;  3SCX A;  5AQF A;  3IFR A;  3KWG A;  5AZJ B;  3M3Z A;  4GW6 A;  5EX5 A;  4WQ5 A;  2YJE A;  3M8Q A;  4C8N A;  4JK7 A;  5AQV A;  2UXB K;  4JNE A;  3U9D A;  3P39 A;  1NJY A;  2E5L K;  2A3Z A;  1ESV A;  4JD2 A;  4CBX A;  2F96 A;  3PV8 A;  3KZB A;  4FWP A;  1VQL N;  3K59 A;  1TYQ B;  2QW9 A;  2NRX A;  3SLC A;  4A62 A;  4OLB A;  3VQ6 A;  2CGJ A;  2YKN A;  2DY4 A;  1H1V A;  3THX A;  1P8Z A;  4RW9 A;  1T6D A;  1GOA A;  3DRR A;  1M1K O;  4C1N I;  4KV8 A;  2GTD A;  3GE1 A;  4ISF A;  4NO7 A;  3KK3 A;  2XY7 A;  2IVN A;  1KLM A;  4JD2 B;  2D1K A;  3LDL A;  2G8I A;  4PA1 A;  3HVT A;  4CVN E;  3VEV A;  3LDP A;  1WSI A;  5JIC A;  2A41 A;  3K5N A;  5LJV A;  3C0B A;  5SWM A;  3CD6 N;  1VQ4 N;  1JL2 A;  1I39 A;  4JS4 A;  1NMN A;  4DCH A;  5EU7 A;  3HPG A;  2KKZ A;  4PQU A;  5I42 A;  1C0M A;  2X74 A;  3V6D A;  1Y64 A;  2IVP A;  3E9O A;  1Z26 A;  4JI6 K;  3CFP A;  4EP5 A;  3CJC A;  3LAN A;  4KHU A;  3AAP A;  5CYM A;  4KO0 A;  2ZGY A;  2BH1 A;  4DUZ K;  2ITG A;  2D0O A;  4JKA A;  4CES A;  3IUC A;  4DR6 K;  5J1E A;  3JYT A;  3C6H A;  2P51 A;  1K73 O;  1Z6R A;  4JI3 K;  3EKS A;  4OKJ A;  4IDK A;  4Z0U A;  3AO3 A;  2IOC A;  4C23 A;  3CFO A;  2WC9 A;  3ITH A;  1N34 K;  2FBV A;  5KPZ A;  1XI1 A;  2HW3 A;  1W7A A;  3PSF A;  3HM9 A;  4B3R K;  3TAM A;  4CGH A;  4Y0W A;  4BRH A;  4CJQ A;  3VA0 A;  1WSJ A;  4FM2 A;  2FF3 B;  1HPZ A;  1YAG A;  4O55 A;  1U45 A;  3AVI A;  4NCB A;  1SL2 A;  1HYV A;  3JS6 A;  5AQQ A;  3CI5 A;  4IG0 A;  2CH6 A;  2GUI A;  4E1N A;  3V1R A;  4CJW A;  2E2O A;  4L3Q A;  5BR8 K;  4R5P A;  3LDO A;  3WQT A;  1DTQ A;  2AA4 A;  4ILH A;  1BQM A;  4OGE A;  4CBW A;  4XH4 A;  3CC7 N;  1VSH A;  3O5B A;  1OH8 A;  2F9T A;  2PY5 A;  3IAY A;  4CEZ A;  2G8V A;  2P5O A;  2YJF A;  2GWK A;  2KHO A;  2PAV A;  2P9L A;  4B3O A;  5AQY A;  3VPZ A;  3AV9 A;  3T19 A;  3TTC A;  1BI4 A;  3K5L A;  2HHU A;  4KPY A;  1FXX A;  5BPL A;  1CZB A;  4HUG A;  2Z1I A;  1FK9 A;  3LAK A;  4CEA A;  4B9S A;  3SJH A;  4KH4 A;  4B9T A;  2OTL N;  1Q82 O;  4LF4 K;  3VQQ A;  4MQ3 A;  4EZ6 A;  1RDD A;  3VES A;  3KVG A;  2F9W A;  3NH2 A;  3SNN A;  1BA0 A;  1SV5 A;  4Z4F A;  1BI4 B;  3RWU A;  3GG4 A;  3J7A P;  3N4P A;  2OPQ A;  2D5R A;  3EO3 A;  1BHL A;  3OHR A;  2B5J A;  4IFV A;  3H45 C;  3TAN A;  2O8B A;  3TAP A;  4BGA A;  4BG9 A;  1QQO A;  4DV0 K;  1HJR A;  4EHT A;  4BRC A;  3OYJ A;  5MLC Q;  2FC0 A;  3RRG A;  3FZH A;  1VHX A;  1NGJ A;  3I8D A;  1EKE A;  4FWM A;  3T3F A;  2ITM A;  2A1R A;  1TGO A;  4R79 A;  4WCE L;  3SBG A;  4FCY A;  1NGG A;  3KLF A;  3TAG A;  4FJG A;  3P31 A;  3ZX2 A;  4QOZ B;  4YOR A;  4DWI A;  4IO8 A;  4O0I A;  3LL3 A;  1KCF A;  4OX9 K;  3MWP A;  2ATQ A;  4E1J A;  1FKP A;  3V9Z A;  1NNE A;  4FK2 A;  3AGR A;  4CIF A;  2O8B B;  3QBW A;  3WUH A;  3MDQ A;  4IJA A;  4HCB A;  4K25 A;  4B8C A;  4CGJ A;  4KKO A;  4Q0B A;  1VSF A;  2JGU A;  3O3G A;  4CF2 A;  2UYT A;  3U3G A; 
#chains in the Genus database with same CATH homology
 1VHX A;  2OCE A;  3BZK A;  1IV0 A;  3BZC A;  1OVQ A;  3PSF A;  3PSI A;  1NMN A;  1NU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...