3DYAA

Hiv-1 rt with non-nucleoside inhibitor annulated pyrazole 1
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
555
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 161
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dyaA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dyaA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dyaA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dyaA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dyaA05
4WZQA 4F2SA 3VQCA 1S5JA 5DQGA 4TLRA 1YTAA 5KFIA 2YKNA 5J2PA 4NLSA 1TKZB 3PW7A 3KK2A 3L2WA 4XO0A 4PQUB 3CO9A 2ZD1A 3OSNA 4ECUA 1X9MA 3TABA 4ZP8A 1HYSA 2O5DA 3TR8A 3ZSRA 2XY6A 1ZYQA 3DI6B 4TN2A 1G15A 1WSJA 2XCAA 5J2NB 2XY5A 1CXQA 4URSA 3NH2A 2HB5A 2Z1IA 3QZ7A 3TAPA 4FM1A 4CJPA 4ZVFA 5F8IA 3DLGB 4NLDA 4H8KA 3H98A 3AO2A 3PUFA 4FLYA 1JLCA 3OHAA 3C94A 1CZ9A 1TVRA 4FYDA 2HNYA 3AO5A 4CE9A 3GIJA 4W5QA 2IC3B 3DYAA 1EX4A 3V6KA 4ICLB 4IFYA 4MH8A 5KFRA 3BSNA 4FW1A 5L1IA 2IM3A 5JUMA 3LWMA 5HP1A 3PVXA 2FBTA 3V9UA 3MECB 4ED1A 4DLEA 4KB7A 4DQSA 5KFTA 4R0EA 1S9GA 5KFPA 4ZVEA 4B9LA 5CY4A 1GOCA 2WCXA 4U7CA 4ECVA 4NYFA 4EZ9A 1HPZB 4Q0BA 2IGIA 3PO5A 4N5SA 1ZTWA 5KRTA 3PX0A 5KT2A 4IG0A 3L3UA 1DTQB 4F4WA 4IFVB 5KT3A 3QLHA 3KLGB 3VQSA 3SQ1A 4W5RA 4CFAA 2RPIA 4J9QA 3NL0A 2PYLA 2Y1JA 1SH2A 1RT5A 1J53A 1B9FA 1HYSB 1WNEA 2R2RA 4C8NA 3SQ0A 3LP1B 4MQ3A 4F4YA 2V9WA 3SQ4A 3SV3A 1HJRA 3VQ4A 2WOMB 3ZSOA 3NGYA 4KAZA 1ZBIA 1VSLA 4LH5A 5JXSA 5E41A 1NJYA 3LP3A 1SKSA 3MR2A 1GOBA 4LSNA 3I0SB 4O3RA 4CGGA 1C0UA 1Z26A 1HYVA 4CESA 2PZSA 3KD1E 2R2UA 4B8AB 2P51A 5CYMB 1VRTB 3VQEA 1JXEA 1WAFA 2DFHA 1WAJA 1N56A 4BDPA 3H4BA 3AVCA 1FK9A 1TGOA 1BCOA 5J1EA 4B3OB 4RW6A 3WNGA 1RT6A 1SH3A 1S6PB 4DMNA 1U47A 2I5JB 5F8NA 3V1OA 4ECWA 4WFXA 1WN7A 3OL8A 3OVNA 1BIZA 3MEDA 1TKXB 4Q45A 2GV9A 4F50A 3PX6A 3G6XA 4LSLB 1ZTTA 4KHNA 3T3FA 4DFMA 5KT7A 5KI6A 1BQMA 1XWLA 3ZT4A 4UQGA 3NGDA 4RW8B 2B4JA 4LD0A 3DRSB 5KFWA 3OYHA 3KTQA 1S1VB 5HBMA 4JV0A 3QNOA 1CLQA 1C0TB 4CIGA 2G8HA 5J2MA 5KT4A 3L2UA 2OPQB 1NHVA 4AHSA 3SV4A 4H4MB 3NH1A 5CYQB 3DMJA 4CECA 2ZE2B 3QETA 3SNNA 5KFLA 2XY7A 5I42A 3V81A 4TQSA 3UQSA 4ECQA 3T19A 4QOZB 2UVVA 2W7PA 2HNZA 1IKWB 2ASLA 3K2PA 3SQ2A 1S1TA 3D5MA 4ZHRB 4CIEA 1NOZA 2JEGA 4YR0A 3FRZA 2J6TA 3CFRA 3K5NA 3OYGA 1ASWA 3S3NA 1BQMB 4CEDA 4NLXA 5F8HA 3OL6A 4PQUA 1S6PA 1LW2B 1QHTA 3OYAA 4FJ8A 4GVMA 1ZBLA 2BRLA 1C0TA 3KLFA 3MF5A 1QS4A 3AV9A 4ED0A 2E9ZA 4CHQA 4NLTA 3DDKA 4NLOA 5KG2A 4FZYA 4E7HA 4DTXA 5DLGA 2B5JA 3KOAA 1FKOB 1NK0A 1HMVA 2ZD1B 3LP0B 4ZPCA 3BGRB 1XHZA 4DU4A 2IOCA 2W8LA 5FRMA 4CGDA 3HL8A 4CJ5A 3L2VA 1QQCA 2HNYB 3AVBA 3CVKA 3HPHA 2Q3SA 5DMRA 2XCPA 2EHGA 4DSFA 2G8KA 1RT3B 2WK4A 4TY8A 1IKWA 2AGQA 2AWZA 2UVUA 2VG5A 3CM6A 4CJSA 3VQDA 1Q9XA 3T5LA 1S9EA 4DSLA 4J9OA 3UIQA 3ISNC 4I2QA 4IFYB 3KD5E 4C8MA 4M45A 3AVLA 4BWJA 2UVRA 1DTTB 5C42A 3MECA 1JLQB 4KTZA 1RT4B 1BIUA 1LW2A 4F2RA 4HTUA 4FJ5A 4DL7A 3CIZA 3ZT2A 4Y34A 4OKJA 4PY5A 2DPJA 2QKKA 4HCBA 1HARA 2JC0A 1T94A 1EP4A 3HO1A 3DOLA 2YKMB 3HPOA 2WHOA 3HJFA 2DFFA 4RNFA 4M3ZA 1A5WA 4FXDA 1NKBA 4L8RB 4Q0BB 4I2PB 5DLFA 3I5BA 2P5OA 1WSGA 3C6UA 2F8SA 3C6TB 4QWCA 1HYZA 3HVAA 3V6HA 3MFHA 4BE2A 4LQ3A 1LW0B 1BQNA 2XI3A 2OPRB 3MR3A 5KTQA 4BACA 2X78A 4MKBA 4CK3A 3DM2B 4FJ7A 1S0MA 2GUIA 3KIOA 5KFYA 4FK4A 3MXMA 3LP2A 4WYLA 1QAIA 3ICLA 3QIPB 3CDUA 3HVTA 2YNGA 5J2QA 3RMCA 3Q8QB 4FK2A 3KHGA 3GV7B 4JV1A 1IG9A 1C0UB 2JEFA 4ELTA 1NOYA 4CEBA 3I0RB 3KK1A 1LAWA 3TAEA 4F8RA 3IAYA 2JLEA 3TAQA 3KK3A 1WSEA 4CK2A 1D9FA 2BQ3A 5KG6A 5DG7A 3Q8SB 2D3UA 4K4ZA 4ELVA 1GOAA 3EPIA 3LPUA 4KI6A 4CGIA 1T05A 3CQ8A 1DLOB 2X74A 4KO0A 4YNQA 4W5NA 4NCGA 3KLHB 1KFSA 5KFBA 4NRTA 3C6TA 4RW7B 3CJ0A 1JKHB 3ZSYA 3H4DA 1TL1A 2R8KA 5CZ2A 1KVCA 3OYJA 1JX4A 4ZVHA 2I5JA 2AX0A 5EWFA 2YKNB 5J2PB 3LANA 1CZBA 3O3FA 4IG3A 4HVJA 5I42B 3SCXA 4M3TA 4URQU 5KG4A 5KG5A 3NF8A 2Z1GA 3OJSA 1KHVA 1SKWA 3RRHA 4J9SA 3DRRB 3IRXB 3M8QB 4NLRA 1S1VA 5HBMB 3KHHA 4KFBB 5HLFB 3UR0A 2X6NA 4M3WA 4MKAA 5KFXA 3RAQA 4KHWA 3NAIA 3B6PA 3D0PA 3H5XA 1LWFA 4CGFA 3K5MA 4FM0A 1EKEA 4OL8A 2D0BA 3D45A 4FJLA 2VG6A 1Z4UA 5FDLB 4M95A 5KFHA 1TP7A 1B92A 5DGAA 1W0HA 3HYFA 3MAQA 3AVNA 1Y97A 3DOKA 4KHUA 4Q8FA 4ECYA 4OKKA 4NZ0A 3EYZA 2HHTA 4GW6A 4KSEB 2QKBA 4Z4GA 2V4RA 4KHQA 3I5CA 2IM2A 1KHWA 1TL3B 3Q8PB 2JGUA 3KLEA 1QTMA 3FQLA 3OYLA 3RMAA 3OSPA 3RWUA 3VN5A 5T14A 3UDLA 2D0AA 2HHSA 3NF6A 1S9EB 2B5JB 4ECRA 1HQUB 3BGRA 4QPXA 1JLBB 2Y1IA 3K57A 3KHLA 4EP5A 1SUQA 2E6LA 1C1BA 3SPZA 3RR8A 1JXLA 4ELUA 3CJ2A 4NLGA 5KFCA 4QWEA 4N41A 3RB3A 4FK0A 2QK9A 3OS2A 3BQ1A 1TK0A 2E6MA 3CFOA 2GIQA 3OYCA 1IO2A 1T8EA 4TXSA 4K4VA 1WLJA 4E3SA 4KHYA 2FLLA 4EYHB 3ASMA 4FLUA 3MEEA 5C25B 2F8EX 4MK9A 5KFVA 1W9HA 3G10A 2KFZA 3MEDB 2FC0A 1SL1A 4QWDA 4FLXA 4FLZA 4QWBA 3LWLA 3LAKA 1C1AA 5DK5A 4WE1A 2E9RX 1RILA 4FW2A 4O0JA 5SZTA 4GC6A 1RTIB 1N5YB 4ZP6A 1JLGB 3DLRA 1WSHA 4I9LA 1UWBA 4DQIA 4CJFA 1OS5A 2G8UA 2ALZA 1RCHA 3SFUA 3DLGA 4OVLA 3SJJA 4LSLA 1S6QA 1RTJA 5HRPA 4OGEA 2ZE2A 1VSEA 2FBXA 4FJNA 3V9XA 3BREA 1RT1B 4DTOA 3NGIA 4DS5A 4OKEA 2AU0A 3RB6A 3QIPA 1BL3A 2YNIA 2R8GA 3RR7A 4FZXC 1HNVA 3VQ5A 4DSJA 1CXUA 2AQ4A 4DG1A 5J2MB 2OPSA 1RBTA 4RUCA 4RNMA 3RBEA 1JLBA 4F3OA 3KLIA 4CJVA 3NFAA 4CEZA 3ULDA 4KPYA 2WONB 4RG8A 3THVA 4G1QB 4NCGB 3ITHA 3KLHA 4DSIA 4DL6A 2ITGA 3SI6A 4OLBA 1T3NA 3I5AA 3JYTA 4DL2A 1Z25A 1S48A 4R5PB 3BJYA 1TKDA 2AX1A 4DQPA 3AVHA 4RW7A 1RDDA 4RW9A 3MR5A 1HQEB 3QEXA 1U4BA 3M9MB 3L2QA 4CERA 2ASDA 4M3YA 1RAJA 1NKEA 4DFJA 3CDWA 1D8YA 1RT5B 4IBNA 1IKYB 3OYDA 5DQHA 1JKHA 3NBPA 4K4TA 4F4XA 1LAVA 3V6JA 2D0CA 1ITGA 3P83D 2O4IA 1XHXA 2BR0A 3VQ8A 4ID5A 1QAJA 1KVAA 4CHZA 4FJ9A 4K8ZA 4I7FB 3QO9B 4ZTFA 4O44B 3KLVA 3TAFA 4K4UA 4ZHRA 4Z0UA 4WFZA 3PJXA 3V4IA 4Y2AA 1X1PA 3IN5A 1ZBFA 4Z4CA 2YNHA 4WXOA 1O1WA 3HM9A 1S1XA 4Q43A 1BI4B 4B08A 2BANA 4M3XA 3AO1A 3UPFA 5JS2A 4M42A 4CJ4A 3OYNA 3AA4A 1SKRA 1X9SA 1QSSA 4CF2A 3PHEA 2BRKA 3Q8RB 4DEZA 5KG1A 2RDIA 1MMLA 5HROB 2J6SA 2ILYA 1TL3A 1L3UA 4Z4FA 1T03B 3QEVA 4H4OA 2HMIA 3OLAA 5L9XA 5KFZA 2UUTA 1TKTA 3OS0A 5KFFA 3DLEB 1EETB 4CJRA 3MTKA 4CEEA 4O4RA 3LP1A 3F73A 1FKPB 4F4KA 5KFNA 1S1UB 3KHRA 1C6VA 1L5UA 3FFIA 3AVAA 4E0DA 1NJWA 2C2RA 2XGPA 3ZT1A 4KTQA 4KB0A 4DTRA 1NJZA 4M94A 2R8IA 4NYNA 1KVBA 3TAGA 1TK8A 3G6YA 5DG9A 5K14B 4YP3A 4Y1DA 3VQ9A 3SUQA 2KZZA 3DRPB 4KE5A 4CHPA 1VSIA 2V0NA 1RT2A 3QINA 3L2RA 2IC3A 2Z1HA 4RW6B 4O3OA 1B9DA 4DTSA 4IKFA 3IS9B 1JLAA 4E7JA 1S1TB 4FVMA 3KMSA 2C2EA 1I39A 3D28A 2ZQBA 1JL2A 3LZJA 4EZ6A 4K50A 4J9LA 3PX4A 2P5GA 1KTQA 4KAIA 4DS4A 3V9WA 2ILZA 3B6OA 4AHVA 2WB4A 4M41A 4NLUA 4M3UA 4KKOA 2VA3A 3L3VA 4ECZA 3QGIA 2HVIA 1SL2A 5SWMA 1JLEB 1IKVB 1S1UA 5KFGA 1C1CA 4ZPBA 4E19A 2W9BA 1U48A 5HRRA 4RNNA 2FLPA 4RU9A 4U6PA 4IRKA 1BGXT 4CFCA 1VRUA 1LW0A 3V9SA 1RTDA 3NCIA 4YR3A 4H4OB 4XPCA 1WSIA 4E7IA 1JIHA 3H5UA 1QSYA 3KKSA 4WE1B 1NJXA 1LWEA 3VQAA 1HPZA 4CF9A 3NF7A 3LP2B 1JLGA 4JS5A 4IFVA 5F8JA 5J2QB 2BQUA 4QAGA 3KKRA 2XGQA 4DU1A 2C28A 3NF9A 4WXWA 2FLNA 1QE1B 3E01A 3AO3A 4BE0A 2HNDA 1S6QB 4CFBA 4DF8A 4ID1A 4HHTA 1RT1A 2YHBA 3GV5B 1WNSA 2R2TA 4NLWA 3AA5X 3NGZA 4URGA 1RT6B 4Z4IA 4N56A 4OGCA 1YTUA 1IKVA 4B9SA 3IGVA 1RBRA 3TI0A 3L8BA 1TKXA 1C2PA 4LSNB 4DU3A 2R8HA 2IA6A 5EWEA 1HNIB 4CCHA 1IKYA 2C2DA 3VQ7A 4ZVGA 2OPPB 4F3TA 2RKIA 4LH4A 4KKOB 2IM1A 4I2PA 3EPGA 4IH6A 2YV0X 5F8GA 2D5RA 1I3AA 2RF2B 3K58A 2P1JA 2W9CA 3OLBA 3BDPA 5FRNA 2FVQA 3AA2A 3KJVA 1SV5A 4TY8B 4B8CA 4CJLA 3SPYA 5T7BA 4CEAA 4DSEA 2HNDB 1REVA 3O4NA 1D0EA 4FJJA 3BSCA 3O4QA 4I2QB 3HVRA 2XC9A 1U45A 1LWCB 3NBPB 3PZPA 4NYZA 4OJRA 4HUEA 1C1BB 2ZKUA 3BQ2A 3HP9A 1UOCA 3K5LA 3HVWA 3SUOA 1X9WA 3VA3A 1UAXA 3CJ4A 1N6QA 4CIFA 2D7SA 2KZMA 3QERA 4CEFA 4KTWA 3HP6A 3PW4A 4CGJA 3AO4A 1EP4B 2GIRA 5KFQA 3ZCMA 2F96A 3QO9A 5KFAA 5KFDA 3V4IB 2B43A 1EXQA 3M8RA 3M8PB 4IDKA 4RW4B 2HWHA 1MU2A 2W9CB 4IRDA 5HRNA 3ISND 4MFBB 3T5HA 4CF1A 3KK1B 3EY1A 4O3PA 1J5OA 4EYIB 4ECXA 3FQKA 3DI6A 4EEYA 4OPKA 3OL9A 3HXMA 4FZZA 2IDOA 3DMJB 1JL1A 1RT7A 1N48A 2QXFA 4KO0B 4TQRA 4DFPA 3N6MA 4KB1A 1SUQB 3CJ5A 4FBUA 4PUOA 1S1WA 2GC8A 2QV6A 4CGHA 4IOBA 4IG0B 1RYSA 4KV8B 3MEGA 3KLFB 1RBUA 3AVKA 2OPSB 4NCAA 2XWYA 3TAMA 1BHLA 3DRPA 1RTJB 4N47A 4MK8A 3RB4A 1U09A 3ZSQA 4RW4A 3ZSZA 4J2EA 3S9HA 4JRQA 2ATQA 4CJEA 2HHXA 5EDWA 4YR2A 3OYKA 3TARA 4X2BA 4DG1B 2IS3A 4Z4HA 2R7YA 2IAJA 2FJWA 3CWJA 2LSNA 3AVIA 1HQEA 3CJ3A 2VA2A 4JLHA 1VRTA 3HSTB 4BDYA 3U6FA 2BQRA 3O3GA 3M8PA 3M9OB 2ETJA 4NLQA 1LWEB 5KT5A 4E1MA 1J5OB 3GYNA 1BQNB 3SFGA 1S9FA 4ZMMA 1VRUB 2AGOA 1QUVA 3OHBA 1IKXA 3CYMA 3TAMB 1YVFA 4ZP7A 3H5YA 2JEIA 1ASVA 3S3MA 3DLHA 3BSAA 4RNHA 4H54A 2C22A 4IR9A 4J9NA 4IH5A 5KG7A 2B6AA 4CHNA 3QEWA 3I0RA 3RBDA 4E7KA 4FS2A 2OH2A 2HVHA 3NKYA 4DTMA 1L3SA 2ATLA 1XI1A 1NK5A 4DFKA 5KG3A 3HKWA 1D1UA 4EO6A 1S0OA 4DTNA 4DF4A 4Q44A 4ECTA 3PO4A 5CYMA 4DTPA 3I8DA 2HMIB 4NLPA 2D3ZA 3V9ZA 4WFYA 2DY4A 1U04A 4EBCA 1SH0A 4NCBA 4FBTA 1N4LA 1TAQA 3GIMA 3AA3A 4DTJA 1ZBHA 2F8TA 3T5KA 3JSMB 3QYYA 4EBEA 1UA0A 4ID5B 5J2NA 3OYFA 4J2AA 2W9AA 4O5BA 1NK6A 2CJQA 4CJ3A 4TYBA 4JS4A 2WTFA 2RF2A 4LY7A 1KLMA 4KHMA 2HNZB 4W5OA 3KNAA 1RA7A 4IKAA 1REVB 1TAUA 4XPEA 3QLHB 5F9LA 3MFIA 4IG3B 3AVGA 1RDCA 1SV5B 2A1RA 4FLVA 3K59A 1TV6A 1K1QA 1HMVB 3LP0A 4ED2A 3OJUA 3RMDA 4ED3A 4CF8A 5CYQA 4G3IA 4AILC 5KT6A 5HROA 3WNFA 3QIOA 4C8OA 1FXXA 4B9UA 3JYTB 2YNFB 5HRSA 3DRRA 1CSJA 5D3GB 2E9TA 3DYAB 4J9RA 3V1QA 4BDZA 4OLAA 3VQBA 3V6DA 1JXBA 1RTIA 2BE2A 2FJXA 3H59A 2IM0A 5C24A 3H08A 1NK7A 1S49A 3KLEB 1SL0A 3U3YA 4YQWA 4EO8A 3SUNA 3SI8A 5I3UA 4O55A 4JUZA 2RN2A 2FVCA 1NK9A 1XR5A 2D41A 2PY5A 2FBYA 1RYRA 3CDEA 3GIKA 3KMQA 1BCMA 4KRFA 3DOKB 1HNVB 5L1JA 3G6VA 3EZUA 3HK2A 2NUBA 4IR1A 2KFNA 3DOLB 3NAHA 4CHOA 3TWHA 3OYBA 2VWJA 3ZSVA 2DFEA 4AHRA 1S1XB 3H5SA 4PUOB 1BISA 4YMEA 5KRSA 1RT7B 4QWAA 3NH0A 1I6JA 1D9DA 1VSFA 3ZSWA 3MEGB 2HHVA 3P1GA 2W7OA 3MEEB 3QGHA 1RTHB 1JLEA 5KFMA 1KSPA 1TKZA 1C1CB 3PV8A 1NNDA 3NDKA 4BE1A 4KV8A 3TANA 2J6UA 4R8UA 3N6NA 5KFOA 3VQQA 4E1NA 4Q8EA 4CJTA 2YKMA 4FS1A 3OS1A 2EX3A 1TKTB 3H40A 3PR4A 3P5JA 4JRPA 2FVPA 1VSKA 4QCLA 4QW8A 4EBDA 1JLQA 5F8LA 4ED7A 1F21A 4K4YA 1UWBB 2X6SA 4XIUA 1IH7A 4NRUA 3PR5B 3LALA 4DQQA 1S4FA 3LPTA 4N76A 4FLWA 4CJUA 3H2LA 1RDAA 3KK2B 5EUHA 4IQXA 1S9GB 2IAJB 3FDSA 4BWMA 3NAEA 1Q9YA 4CEOA 1JLCB 1A5VA 3HVTB 2KQ2A 2OPPA 3DLBA 2HHUA 4Y2CA 4FJGA 1FKPA 3M9NB 3LDSA 3QEIA 4TYAA 3QZ8A 4FCYA 5KFUA 3HPGA 4B9MA 4WZMA 3KLGA 3CFPA 3BR9A 3ALYA 4HKQA 4FJMA 1TK5A 4AHUA 2HWIA 2R8JA 4O3NA 4G1QA 4DQRA 2AJQA 3GILA 1S10A 4Y1CA 2W8KA 5L1KA 1T7PA 2HAIA 4Q5VA 4J9KA 1VSMA 2RKIB 1VSDA 4O4GB 1T05B 4KFBA 5HLFA 5C5JA 1RBVA 4O3QA 2RDJA 5KFJA 3JSMA 1N6QB 1KLNA 1QSLA 1WSFA 4MK7A 4HCCA 2R2SA 2JEJA 2OA8A 2FJVA 2PYJA 4MIBA 4GC7A 2VG7A 3QGGA 3SYZA 4E7LA 3OYMA 3CG7A 2WONA 1LV5A 4KBIA 3PW2A 2WOMA 5F8MA 1R0AA 4IDKB 1JLFA 1RBSA 5DQIA 3TVKA 3RB0A 3QIDA 3O3HA 1GX6A 2OZMA 4K8XA 4PWDA 3DLKB 2A1SA 4QW9A 2YHAA 4ED8A 4J2BA 4CF0A 4ZTJA 3OY9A 4B9VA 3OL7A 2FVRA 3T5JA 3OYIA 2GBZA 3CM5A 1BI4A 3HHKA 3F9KA 1DTTA 4DLGA 4LQ9A 5D3GA 4ZPAA 1RDRA 4O4GA 3LAMA 2VG6B 3M8QA 2BE2B 5DGBA 4KI4A 4OPJA 4DWIA 1A5XA 2IJNA 3GQCA 4WYWA 3V81B 3GIIA 5C24B 4E89A 1Q8IA 4FJIA 5EWGA 4CK1A 3NHGA 1FK9B 4DL4A 2YNGB 4RW8A 1HRHA 4RNOA 1RT4A 1R0AB 3VA0A 2IMWP 3NMAA 4FJXA 4Y3CA 3LZIA 2YNFA 2BANB 3C95A 2KTQA 2UUWA 2DTUA 2G8IA 4J9PA 5JS1A 4PWDB 3MXJA 1D5AA 4FM2A 4IH7A 1KRPA 3EZ5A 2VWKA 4B9TA 1J9AA 3V6DB 3BSOA 1J54A 4GMJB 4ZP9A 3IG1A 3K5OA 1HQUA 1ZBUA 4B9NA 5I3UB 3DM2A 4AHCA 4HYKA 1U49A 4NLYA 1VSJA 1L3VA 3IS9A 1IM4A 4CJWA 2KW4A 1RNHA 3DRSA 1K6YA 3FFIB 4ICLA 1RTHA 3ZT0A 3KJVB 3RTVA 4K4WA 2E4LA 2CKWA 1FKOA 5C25A 2IJFA 1S0NA 5HP1B 2BDPA 4YFUA 2DPIA 1RA6A 2XI2A 1T03A 2XO7A 3IRXA 1EETA 3DLEA 1JLAB 5K14A 1RDBA 1RT3A 4CFDA 2FVSA 4KHSA 4K4XA 4F4ZA 3GV8B 5DG8A 1NK8A 4DL5A 2VG5B 1N5YA 1TVRB 2W9BB 2HHQA 5L1LA 1XR7A 4I9QA 2AGPA 2W42A 3VQ6A 3PJWA 1C0MA 1S97A 2HW3A 2I1RA 3E51A 4C8LA 3IG1B 2XHBA 3AVJA 4DL3A 1KCFA 4KREA 3OYEA 4R8UB 1RT2B 4O3SA 3A2FA 1K1SA 1YVUA 1MU2B 2YNIB 1KLMB 3PW0A 5KGXA 3I0SA 4ZPDA 1DTQA 4RZRA 2G8WA 3SUPA 1ZETA 3G0ZA 2B6AB 1NKCA 3KLIB 3HT3A 5KFSA 1NHUA 2G8FA 4HUFA 3QEPA 3AVFA 3MR6A 1TV6B 3TQ1A 3ITHB 3QNNA 4RUAA 3T1AA 4CEQA 1RTDB 3G86A 3BQ0A 3RMBA 1YT3A 3PW5A 1L3TA 1GX5A 1S1WB 4IRCA 3M8SA 4TSXA 4FJHA 1QE1A 3E01B 2OPRA 4PA1A 4CHYA 3WNEA 3RAXA 2XY8A 3VQPA 1LWFB 4I7FA 2XRIA 4ECSA 4RW9B 5C42B 2UVWA 2YNHB 1VK0A 4CJKA 3N6LA 4TY9A 2VG7B 5FDLA 1NK4A 3WNHA 5J1EB 4B3OA 2OYQA 2OZSA 1KFDA 4M3RA 4R5PA 4O0IA 3MXIA 2EC0A 4O44A 5F9NA 4FLTA 5KG0A 3S3OA 1TQLA 3SZ2A 3NE6A 3DLKA 2OPQA 4CJQA 3RRGA 4KHRA 4J9MA 1HNIA 3PY8A 1W25A 1XR6A 4H4MA 4EP4A 4AH9A 4NLVA 2ASJA 1JLFB 4W5TA 4C8KA 2O4GA 4AHTA 3C6UB 5CZ1A 5EU7A 3QESA 4DSKA 5KGWA 5KFKA 5KFEA 3ZT3A 2IBKA 2QE5A 2V4QA 1IKXB 3ZSXA 3KK3B 4K4SA 1LWCA 2JC1A 1VSHA 2FBVA 1ASUA 5FROA 4DTUA 4HUGA 4J2DA 2WRMA 3IGNA 3V1RA 1UA1A 2BGGA 4FJKA 2HHWA 2Z1JA 3FSIA 1DLOA 1XC9A 3U3GA 4ED6A 4MFBA 4Z4EA 4JV2A 2G8VA 3AVMA 1TL1B 4MIAA
chains in the Genus database with same CATH superfamily
2YX4A 4YHHK 2HSEB 5KFIA 2YKNA 4NLSA 4HACB 3U1MA 3C14A 4DR5F 4XO0A 1M5OC 5LMNF 4LF7K 5DDOC 1AUSL 3R9LA 4CD3A 2XY6A 1TL4A 4TN2A 4WK1A 1BXNA 1H98A 2XCAA 5ADXA 3LO3A 3ZFVA 1X5SA 2HB5A 4IO9Q 3QZ7A 1RACB 4FM1A 4C6AA 1YIJS 3DLGB 2ZITA 3AAQA 3H98A 3ZTQA 3J7YI 1JLCA 1IWGA 3EJMA 4E1JA 1TVRA 3A8EA 3W5ZA 3J7AP 3PM9A 3SSRA 2HNYA 3FJ2A 3DYAA 4LRCA 2W41A 3V6KA 4ICLB 5HK4A 2UV8G 5KFRA 1RLDA 5JUMA 2HHPA 2GHVC 3H25A 3PVXA 1K8KB 3FLCO 1V3RA 1NHKL 1QY7A 4R0EA 3SQGA 3AQOA 2F7TA 3TJ8A 5AJ3K 4DR3F 4J5OA 2WCXA 1XMQF 4NYFA 3BH7B 1K73T 1ZTWA 3TUIC 4JV5F 1FRXA 3L3UA 4L73A 3NY0A 3QLHA 2VFUA 4W5RA 2Q3PA 2RPIA 2PYLA 2Y1JA 1PSDA 4G1PA 1B9FA 2R2RA 3WDOA 5F2RA 4F4YA 2V9WA 3SV3A 3VQ4A 1ZBIA 1WOPA 1VSLA 1SKSA 3LP3A 1GOBA 2EG2A 2K3KA 4O3RA 3B4DA 2DNOA 1GLJO 1XNRF 2PZSA 3UD3P 3UD5A 3I56N 1JWWA 4IZ9A 1VYAA 3UNGC 4AYBD 2P9LA 1N56A 3VGKA 3H4BA 4G65A 1FK9A 4LR8A 2QSFA 4FYYB 3W5XA 4DMNA 1V9OA 1HWLA 1HR0J 1T9XA 1U47A 4ECWA 2LXFA 4WFXA 5I9EB 3KJQB 3OVNA 4A8FA 4CVNE 1TKXB 4LSLB 3I87A 3QPIA 3IKMA 3W7BA 1HNZK 3POTA 2XMUA 1JMTA 2OSQA 2B4JA 3ZETA 4CW7B 1SQEA 3DRSB 3N4WA 1MWQA 3ZNUA 1T9WA 1YJWS 5H9FK 4YEAA 1EHWA 3FZBA 5CYQB 3QAUA 4FZVA 4DR4F 4CECA 2YWEA 2BOPA 2B3TB 2XYHB 5I42A 2OI2A 2KJWA 3UE2A 4TQSA 3K5PA 3T19A 4BR0A 4B3RJ 3FCWA 3P5TL 5E33A 2Q1LA 1IBKJ 3PIOQ 2ASLA 2DNRA 4ZHRB 5K5MA 2J8SA 4CIEA 1ZM4A 1ZBSA 2BUNA 4B1VA 1GMVA 3FRZA 3MM9A 4KGKA 3K5NA 2VGMA 3S3NA 3BGOP 1BQMB 3E2EA 3WEEA 2FYXA 4MDBA 2NUHA 2I7PA 3T1HK 4JYAK 1FDDA 2R7SA 1ZBLA 1N32J 3KLFA 1VQOS 4ED0A 2DNNA 4JYAJ 1H0HB 4NLTA 3BO3A 2GJFA 5DLGA 2B5JA 3KOAA 4JK8A 4A5AA 2RHSB 1HMVA 3LP0B 4ZPCA 5L9NA 3DDIA 1NG9A 4ZCLA 1UVNA 1FXRA 2DBBA 2IOCA 1U6FA 5FRMA 3HL8A 4CJ5A 3AVBA 5BRFA 2E5JA 3MWPA 4FF2A 2I38A 3HPHA 2Q3SA 1GMWA 1T9UA 2O8DA 2WK4A 3MEKA 4TY8A 1N34F 3H3OB 1W2BR 1IKWA 2Q0RA 3Q2SC 2UVUA 1P1TA 2VPZB 5A0YA 3VQDA 1IQZA 4IFYB 4WP8A 4RX6A 4C8MA 4BWJA 2MQPA 3EKSA 5C42A 3BGFA 3BYPA 3MR7A 4KTZA 4D3HA 1GMUA 1UMJA 3CJ9A 1S7HA 4DL7A 3VZIA 2RQKA 1UFLA 4M5JA 4Y34A 4KC5A 2FHKA 1IR2A 2JC0A 5T7LA 1T94A 1QZ5A 3GE9A 2YKMB 5AQUA 4BRCA 5IT0A 2WHOA 5TKWA 2DFFA 3ZEUA 1A5WA 2P9CA 3JTPA 3O9QA 3CMQA 2P5OA 2M0GB 4ZPTR 2CADA 4PG5A 1HYZA 4CTAA 4C8YA 3M2UA 1KOHA 2ZWPA 1HHSA 4QQBA 2L08A 2KXHA 3EN9A 5E2QA 2VOOA 4DUYF 3Q8QB 3GV7B 3CCSS 1LCUA 2N82B 2JEFA 5ETOA 2KRBA 3MMBA 4BVPA 2LYVA 3TAQA 1HI1A 3D0GE 1D9FA 3W65A 5KG6A 3LF0A 5AQZA 5AXLA 5DG7A 2MZJA 2VV5A 4K4ZA 4ELVA 2V7ZA 1UJ5A 3BH6B 4BRDA 4W5NA 2AJ0A 4P2XA 4ZITA 4NRTA 2CRLA 4M5HA 3WQPA 3ZSYA 1ELOA 3U4LA 3RAMA 3OYJA 4EAHD 1R8BA 2YKNB 3LANA 4HVJA 4EFHA 3HSZA 4M63A 3SCXA 4OI3A 4URQU 4OLPA 5KG4A 3C66A 3OJSA 2Z1GA 1SKWA 3NF8A 3RRHA 3D3BJ 4R0JA 1MDUB 1UETA 3AOCA 4NXMF 5H1SQ 4PKIA 5HLFB 3UR0A 2X6NA 4M3WA 4MKAA 1FEEA 2J7UA 3HKZD 3VAMA 4KHWA 1LFPA 3ETMA 3NAIA 3B6PA 1VBKA 1G99A 1NO8A 3VGSA 1NXIA 3RBXA 4ZVQB 2ZOFA 4GVBA 3FVYA 4FJLA 1KAXA 4TU8A 2GVZB 2OJ3A 2VG6A 5FDLB 1TP7A 4EMDA 1PYTA 3HYFA 2DNGA 3QQCD 3L0QA 1Q0NA 4LFBJ 4ECYA 4OKKA 2ZC4A 3DOMB 1HNZJ 3ZZTA 3CMAS 2EBEA 4N8OA 4LFBK 2GQQA 2R7RA 2BA9A 2ZNZA 3S8SA 1KHWA 1SXLA 2JGUA 2XLKA 1FW6A 3OSPA 2DGWA 1OH6A 3RWUA 2PSZA 2L9WA 4B3TK 3NF6A 4YY3J 1Q79A 1S9EB 1VQ7S 4ECRA 5IWAF 2CGJA 4GKKJ 3PKYA 3CJSA 3NGSA 3D1QA 3H42A 2AMCB 1VQ5S 3IWNC 4PG6A 3SPZA 4DR5K 4ELUA 2N3OA 1JXLA 3CJ2A 4G1IA 2ZJPL 4NLGA 2I6WA 2NPIA 5KFCA 2VQFJ 1FTCA 1TK0A 2E6MA 1RB0A 1KC8O 4BRHA 2OANA 3N5BA 1IO2A 1T8EA 4TXSA 4F26A 4K4VA 4E3SA 3ASMA 5C25B 1W9HA 4DV2F 4FWKA 2KFZA 5M1FA 2V51B 5JVHL 4DR7K 4FLZA 2FHMA 3QFUA 1R0BG 3UN5A 1U0HA 2WSCC 4BQLA 4CZKA 2Y8YA 1K44A 2F40A 2UUBK 2ZOMA 3L6QA 2MXYA 1RTIB 4ZVPB 3MCSA 3LDNA 3O44A 4I9LA 1UWBA 2MKSA 3C7NB 3PG9A 3A3NB 4CJFA 1FJCA 2R42A 2ALZA 3SFUA 3DLGA 1BHNA 3CJQA 4C1NK 4OI0A 1VRQC 4I56A 3V9XA 2RMLA 5LJWA 3CO0P 4A8YA 2KH9A 1RDUA 4OKEA 2LXUA 5KPRA 4NMXA 4FZXC 1ATRA 3VQ5A 4DSJA 2AQ4A 5J2MB 2APOA 4ZPWR 4RUCA 3RBEA 1R31A 5IC4B 3OXFA 3NFAA 3H2UB 3ULDA 1IBKK 2LDYA 4BC2A 4NCGB 4DPUA 4DSIA 2ITGA 3SI6A 2CQHA 3MPWA 4YOUA 3JYTA 4AFFA 1NJIO 4Y0WA 2QEXS 3W63A 3ZETB 3AVHA 1KVJA 1ULRA 2VUGA 3TVYA 2HBQB 3L2QA 4CERA 4M7XA 1RAJA 4A47A 1D8YA 5IS2A 1U2VB 1JKHA 2ZBRA 2V4JB 2HS3A 4IO1A 1GLLO 3I55N 4DMZA 4KY3A 2ZWHA 5BRDA 3R1HA 2BR0A 2B7BB 3TTFA 5K8NA 4C97A 1A0OB 3KLVA 1GEHA 4P7TA 4K4UA 1U2CA 4Z0UA 2CA9A 2HVZA 3UI3A 5HJXA 2J8AA 4YHHF 4WFNL 3IN5A 5F1XA 4IOCQ 3A5NC 3OTOF 3ZX2A 2H3EB 3R6LB 4B08A 1BI4B 4F36A 3HHLD 4M3XA 3AO1A 4X4RA 2W01A 2A2CA 2QGFB 5AZJA 2HBLA 4CF2A 4M5KA 2JH3A 2P2CB 1RI7A 2BRKA 1PCAA 1SI9A 3MPUB 5FD1A 1NM1A 2RDIA 4DXLA 1MMLA 2FC8A 4FPRA 5AQLA 1FXDA 2BEFA 2ILYA 4I6YA 4YOEA 5F0WA 1TL5A 3QEVA 3QMLA 2HMIA 5KFZA 1S6UA 5KFFA 3DLEB 3TSUA 1FJGF 1WC0A 4QIWD 1YX2A 3R5DA 3PIPL 4BG8A 3N9UC 1L5UA 3C19A 4B3SK 3M8YA 5LXRA 1WB9A 1NJWA 3MHYA 4KTQA 4M94A 4JKEA 2IFXA 1TK8A 4YP3A 3VQ9A 2KZZA 3BB5A 3OFFA 1VSIA 3CDBA 1RT2A 1AZSA 4RBUA 2RS2A 2IC3A 1U25A 2Z1HA 3L2RA 1RGVA 4IKFA 4PG7A 2V34A 3EWGA 2GVDA 2LA6A 1S3XA 2C2EA 5ETRA 5LM7E 3D28A 3I96A 5BPNA 2ZUGA 2P5GA 3DDNA 1KTQA 2RT3A 1OKJA 2RE1A 3E66A 1YWXA 5EHHA 2UUBF 1PJ5A 4M41A 5IOLA 3LDLA 3QGIA 2CDRB 4NPOA 4OHWA 2HVIA 3BYRA 2FUG9 2DR7A 1X8DA 3VVTA 2IVYA 4CZFA 2W9BA 2GCFA 1UVMA 1JJHA 4Y0FA 4RU9A 2KG0A 4U6PA 2XMAA 3MN7A 4BRKA 3NCIA 5EOYA 4H4OB 1SJRA 1WSIA 5CA5A 2KL8A 2JVRA 2U1AA 4E8UA 3VQAA 1TMJA 2JLFA 3CCEN 2IYGA 1VHXA 5IM0B 2ZEJA 1TR0A 5F8JA 3KKRA 1CULA 2BJ8A 2C28A 1V5IB 3G9CA 3NF9A 2FLNA 2G1HA 2EPIA 1S6QB 2DEJA 5BR9A 3GPAA 1RT1A 2YHBA 4FYXB 3OVSA 5MLCQ 2NZ4A 1W97L 3AA5X 4URGA 1RT6B 2CQ0A 2ZJRQ 2CNKB 2DGVA 3OA9A 5F41A 4L72B 4B9SA 4DR7J 1HNZF 1OY9A 1WC4A 4LFBF 3L8BA 2WSFC 3LQVA 4DU3A 1DURA 4Y2IA 2IA6A 2IJRA 3QFHA 2XHCA 1FHTA 3QSIA 1HNIB 4CCHA 4YDXA 2GQCA 3ZTRA 4ZVGA 4H0OA 4LH4A 2IM1A 4IH6A 2YV0X 3U02A 1I3AA 2RF2B 2NRXA 2P1JA 2W9CA 3OLBA 3Q89A 2O8DB 5AE3A 2I0XA 3R7NB 1VC0A 3KJVA 4DCHA 2PMWA 4ZVOB 1XIQA 4X66K 4CJLA 4B1XB 1FJEB 1O8BA 4FJJA 4RPFA 4NXNK 2OSRA 3ENAA 4CYUA 1XMOF 5H1SV 2JOQA 2HGMA 1UOCA 2E1CA 3VEXA 2CQIA 1X9WA 3ET6A 1R6VA 3IWXA 1UAXA 3M6VA 3BBFA 3WXLA 1NGDA 3QERA 1MROB 2HBKA 3DKDA 4DR2F 3PW4A 2MKHA 1URRA 2RRNA 1UEUA 5KFQA 4OX7A 4CP5A 2F96A 4Z37A 1WI8A 5K8MA 3V4IB 2B43A 2DIVA 3LA0A 2AYEA 4IDKA 2FSJA 4LRDA 2W9CB 4C8ZA 5HRNA 2ERRA 4MFBB 2QXLA 5AJ3J 5E84A 1J5OA 1I94J 4EEYA 3R5AA 4OPKA 2GHPA 2IDOA 2UXCF 5AQJA 4AXIA 1HD1A 2GGPA 3RW6A 1RE1B 3VALA 2QXFA 4KO0B 1NMNA 4KPCA 1SUQB 3O1LA 4FBUA 5CQGA 4MT1A 1B70B 2HYIB 3TO8A 4PUOA 2ZDOA 1S7IA 4DX5A 5F3ZA 1BDGA 4CGHA 2NYHA 5EGYA 4IG0B 2CVIA 2JWKA 3KLFB 2VOPA 4DN9A 1CJKA 4H0XB 1FTRA 1UTAA 1WF0A 3ISZA 3RB4A 2FY1A 3L9ZA 3D2EB 5IT9Y 3ZSZA 4JRQA 1YXQA 2V5HG 2WVDA 5U47A 1X4FA 3TARA 1DRZA 4X2BA 4DG1B 1TUYA 2IS3A 2R7YA 3QICA 1S5ZA 3THYB 2QTWA 4FYWB 1YRUA 3CJ3A 4JLHA 1U8SA 3LOUA 3KG0A 3MI7X 4PXDA 1T6CA 2GGPB 1WHYA 4BDYA 4K59A 4FNHA 3NNAA 1HBUB 4H4KA 2P9NA 1Q8KA 2YJEA 5L38A 5KT5A 4E1MA 4CBUA 1OQ3A 1TU0B 3CD6S 3ATVA 1J5OB 1Q86O 3G8TA 1VRUB 3GYXB 1OVQA 4CZLA 1IKXA 1J6ZA 2BH1A 3EE9A 4LFCK 4X4SA 3FNNA 5RUBA 1EARA 4J9NA 4IH5A 3QEWA 3RBDA 1H73A 2ROGA 2H5EA 2VFRA 1LOTB 2HVHA 1MWZA 3NKYA 4WJBA 1S22A 1L3SA 4DTMA 1WD6A 2HBJA 4WQ4A 4DFKA 3HKWA 1YQHA 1D1UA 1H7XA 2RB7A 1S0OA 4FXVA 4DF4A 1X4DA 4LF2A 4ECTA 2DNPA 2Q1NA 2UUCF 5AQSA 3V9ZA 4WFYA 1U04A 1RBLA 3IAS9 4FBTA 3ILLA 1N4LA 3KNGA 3SMPA 4JI3K 3CC7S 1JJ2M 1NMDA 4QOTA 3QYYA 3UDEA 1YDLA 5J2NA 2CNNB 1Q1KA 4NI2A 4CYUB 1NK6A 4GV9A 4OYPA 4LRAA 4TYBA 2HFZA 4JS4A 5JMVA 2C3YA 2DPNA 3HTVA 1KLMA 3GFZA 2GAGC 1LXNA 4KHMA 4FWOA 5HATA 1J5EJ 3ID8A 4IWVA 2OP5A 2VL1A 4ZLNA 4IKAA 3GP9A 3QLHB 5F9LA 1FF2A 3DN9A 1U1NA 4FLVA 1TV6A 3FBFA 3OR2B 5AXKA 3AY9A 9RUBA 2G0IA 3OJUA 1XMQJ 1XNQJ 3K9JA 2V69A 4G3IA 5KT6A 2OMOA 3NXZA 1K0TA 5HROA 5LXYA 3QIOA 4B9UA 1FXXA 2Z30B 1QAXA 2YNFB 1CSJA 2M8HA 2B8PA 5D3GB 1E4GT 3QAEA 2E9TA 2B56A 1RUSA 1O5JA 1AFIA 4ENOA 2BE2A 2FJXA 4NYOA 4OZ3A 5C24A 3H08A 3H1QA 3TUZC 4FPAA 4H4KC 3KLEB 3U3YA 3FEXB 1RHJB 4QR0A 1Q7YO 5D6GA 4JUZA 2DRAA 2FVCA 2L3MA 2KB2A 3D6HB 2D41A 2PY5A 4OI4A 4KR0B 4X62K 3GIKA 3CCMN 2P9SB 1XNRK 3DOKB 2BJ7A 5L1JA 1HQ2A 1GQEA 5L39A 4DUZJ 2ALYB 3EXCX 3OYBA 1NU4A 3ZSVA 3TW0A 1HNXK 3ENBA 1RHUB 2HAFA 3SAFA 1OH8A 4IOCL 1B0TA 4Y65A 5D0GA 4GKKK 4RUBA 4J90A 4YMEA 1D9DA 1NSQA 1JCGA 4LBIA 3P1GA 3MEEB 3QGHA 1RTHB 5KFMA 1KSPA 4PABA 1TKZA 1C1CB 3O8MA 4QU6A 2CZVC 2X3GA 4KV8A 4CJ7A 2YH0A 2Z2MA 1WOOA 3PTWA 2J6UA 4R8UA 3N6NA 4Q8EA 4FS1A 3OS1A 3UWTA 3H40A 4ZVTB 2L9NA 3PR4A 3LTOA 3EZOA 3GJQB 3P5JA 1RWMB 1VSKA 4JK9A 1GLEG 4QCLA 4QW8A 1JLQA 3DU5A 3T41A 2O01C 4K4YA 3WZ0A 2X6SA 1IR1A 2MYFA 3I4PA 4NRUA 3THXA 3LPTA 1QHAA 4N76A 4H0PA 4FLWA 1RDAA 4IQXA 2K06A 3THYA 4BWMA 2DD8S 2FZGB 1JLCB 3DLBA 3ONQA 3CC2S 1LXJA 2HHUA 3M9NB 3QZ8A 2MQ8A 4B9MA 1KOOA 4DUZK 4ANEA 1N5QA 2KHDA 3TX8A 2EFGA 1FVSA 1RAOA 1TK5A 4AHUA 2A41A 4RBVA 1ZM9A 2M70A 5IQQA 5LJVA 2MDAA 1U2RA 2DNZA 1YJNN 2MKKA 5L1KA 1T7PA 3MM5A 3JAMO 4A2BA 1YRXA 4Q5VA 4J9KA 1TUUA 2EFNA 2RKIB 2JZ5A 3CIPA 2NRVA 3W64A 3IM8A 3T9NA 3SCJE 2RDJA 3ZZ0A 1KLNA 2Y3YA 1WSFA 1HBNA 3J8AA 2EG1A 2PYJA 2V7YA 5HMWA 1HHTP 2VG7A 2QIFA 1TYQA 2R7QA 1XMOJ 3OYMA 5IWAJ 5E3PA 3A1YG 3D54A 1LV5A 3B6BA 4IDKB 1S12A 5DQIA 3TVKA 1ZAVA 4OJGA 2YKAA 3PYDA 4DOZA 1GX6A 3DLKB 3EUNA 2GZOA 2R4FA 2YHAA 4PQAA 4CF0A 3OY9A 3OYIA 4W92B 2ZNYA 2P9IA 4ES3A 4W90B 1XUPO 1EO1A 3CPWM 1VBZA 2BE2B 3KVGA 1RZMA 4HI1A 2Q6CA 1NU0A 4U8VA 4MJKA 2IJNA 1APSA 1RHKB 5A8WB 2E1RA 2C2ZB 1OWXA 2BE9B 1M5HA 4FJIA 1UL3A 1FK9B 2HEKA 1HRHA 4JI0K 2JLGA 4DV5J 2IMWP 3NMAA 4Y3CA 3LZIA 1FERA 2DTUA 4M5DB 5JS1A 4PWDB 3MXJA 1ZPWX 5DZ7A 3RRKA 3BSOA 1VQ5N 4Z7YA 5I3UB 3OTBA 5F0XA 4A5BA 1VSJA 3BUZB 3MDQA 1IM4A 1RNHA 3DRSA 4P71A 3AOBA 1N34J 3KJVB 1MSWD 2HRTA 2OFHX 4KYZA 4K4WA 5C2GA 1S0NA 3BO4A 5HP1B 2U2FA 1C0GA 2BDPA 1VK3A 1NSKL 1VOMA 3HLUA 2QMXA 2Q79A 4MTPA 1VQ8S 1MWYA 3M32A 5AZIA 1WELA 4KHSA 2FVSA 4F4ZA 2EWSA 3MCOA 1HUXA 5ETQA 4I9QA 2AGPA 2KVQE 3FE1A 3VQ6A 2CWKA 4USUA 2GVDB 3JSBA 2NSBA 2I1RA 2Z8QA 1HKGA 3CJKB 3IG1B 1KXPA 3DXKA 2R7OA 3AVJA 4DL3A 4F9OA 5IFMA 4DR1J 1NH8A 3A2FA 3H0PA 4HH1A 2MLYA 4DR6K 1KLMB 3PW0A 5FLXU 1Q18A 1WJ9A 4RZRA 3DOMA 3SUPA 2F9TA 2B6AB 3WX8A 1NKCA 4GY2B 3CCUS 3HT3A 5KFSA 1NHUA 3ZEUB 3RYLA 3B82A 1WSVA 4GNIA 3Q8UA 4PL7A 4JP8A 5GAHI 2QLBB 3RJMB 2DNLA 3T1AA 1T3VA 1N5SA 1S72N 1L3TA 2NRRA 3BKTA 1NB2A 3UNYA 1RWXB 1XQIA 3NGKA 4CHYA 1IJJA 5B09A 3WNEA 2QA4G 3F44A 2XY8A 5KOWA 1WOSA 3TSQA 1ZM3A 2CPFA 4OYMA 4U8YA 2CQDA 4B02A 3OTOJ 5ETNA 2V2ZA 5HJYA 1VK0A 4B1WB 2VG7B 4UOGA 3KZBA 5HVHA 3UKRA 2OYQA 3IFEA 3VEVA 2M3DA 4M3RA 4PPZA 3VAFA 2P6SA 4XK8C 4GKJK 3MXIA 3Q2TC 4O44A 2MQNA 3QRPA 3AD9C 5F9NA 3SZ2A 3DLKA 1XNQF 4CJQA 2F65A 2L9DA 1XR6A 2DHAA 1OVYA 2XM3A 3MCNA 3P31A 3NWRA 1M1GA 5KFEA 2CJ9A 3GJTB 2ADBA 1X4HA 2JL9A 4B3TF 4FPBA 4PKDB 3PXGa 1VSHA 2FBVA 4DTUA 2YWGA 4J2DA 1QQNA 3QT5A 3EMTA 3SBMA 3CT9A 2DITA 2HHWA 1DLOA 3FMWA 3U9DA 4DDFA 3EX7B 5HI7A 2JSXA 2DH9A 4LFAF 2G8VA 4RUHA 2P9KB 3W60A 2I2YA 2LLZA 2ASYA 4OHXA 1YTAA 2IVFB 2B4PA 5J2PA 2XZTB 1N54B 3PW7A 2QA1A 1G7CB 2NLWA 1GLCG 3OSNA 2DVIA 4NYPA 1GNKA 3NLCA 1HYSA 3J7AN 1QD1A 2ZH6A 2VASA 5IC6B 2QWPA 1G15A 3PIOL 1GFWB 4O8KA 1ZPVA 2XY5A 1SPBP 2QLJB 1AW0A 2Z1IA 3TAPA 2HQDA 3G6ES 4NLDA 4YOTA 2MQMA 1YTYA 3AO2A 4FLYA 4BHQA 2BZ2A 3C94A 3R3TA 2YKQA 3JAMU 1UZHA 4ZS6A 1U1MA 4FYDA 3NS5A 2ZJQQ 4PKGA 4C4WA 3R3LA 4KJIA 1EX4A 3B8AX 4HHUA 1Q86T 3O9RA 4MH8A 2FPHX 2DNKA 2IM3A 1GMWD 5HP1A 4RL1A 3LPEA 1DARA 2AD9A 4KB7A 3SJHA 2PBDA 5IT9U 1FNOA 4ZVEA 1T6DA 4HT7A 1TL7A 4JI7J 1RKIA 4EZ9A 1HPZB 4Q0BA 3PO5A 3SSSA 1LK7A 5EY4A 2CQPA 3PX0A 4F4WA 1O6XA 5KT3A 1ESVA 2WVFA 1UVKA 1LWXA 4EUVA 3FKBA 2G2OA 2W2OP 4J9QA 4OHYA 4K43A 1CZAN 2PD1A 1OYDA 2PA8D 1RT5A 1J53A 5D4PA 1HYSB 4OYXA 1WG4A 3LP1B 3SQ0A 3SQ4A 3KHYA 2WOMB 4KAZA 3FEZA 4ZVUB 4HDHA 2EWHA 2M9KA 2V2KA 4DV3J 3GB0A 2QWMA 2Q66A 1C0UA 2KKZA 1I94F 4CESA 3D7SB 4B8AB 5IT4A 5A8WA 1K8KA 5CYMB 3AODA 1VRTB 2QW9A 3VQEA 2OTLN 5G0RB 1JXEA 4BCAA 1WAFA 2CYYA 1SQGA 2O3DA 1WAJA 3AVCA 2HS0A 1TGOA 2E5LF 1OSCA 1G4CA 3TP2A 3WNGA 1RT6A 4H0YB 1HW8A 1S77D 5F8NA 3MZIA 1RHQB 5D4LA 4A8OA 3FBBA 3QBCA 2DCUB 4K2JA 4AL6A 4NO7A 4O5FA 2W24A 4J7CA 4F50A 3PX6A 1WACA 1PC5A 1VJWA 2QA2A 4HLBA 3TRGA 3LDPA 4B1YB 4DX6A 4DR2J 3UDCA 1XC3A 4UQGA 2ZC3A 3H8YA 1Y5NB 1WDDA 4LD0A 3MMAB 5KFWA 3SBTA 3CB4A 5D0RA 4BRIA 2MQLA 3VV2B 4P6QA 5LMUJ 2C1EB 5J2MA 5KT4A 1I3OB 2OPQB 1J5EK 3X1LB 1H6KX 1YITN 2VDIA 3NH1A 3DMJA 5CAAA 2B9WA 4DV3K 1REGX 3FFKB 4RLEA 4QOZB 2LU1A 3O1BA 4A48A 1SJ1A 4WP3A 3SQ2A 2VKRA 1MMDA 2JEGA 1RHMB 3EM1A 4JKAA 4YR0A 1HHQA 5DM7Q 2J6TA 2HFNA 4CZHA 3OYGA 1ASWA 1Q7LB 1S6PA 3CCWA 1E6VA 3MAAA 2QLXA 4FJ8A 2BXJA 1VQYA 3SIPB 1C0TA 3MF5A 1MN9A 1QS4A 3HZ6A 4M5NA 3AV9A 5ETLA 2QLFB 4H5VA 1KR4A 1NK0A 1FNMA 1XHZA 6FDRA 5FPEA 2LU2A 3FSYA 2LEPA 3SMSA 4LSZB 3B54A 5DMRA 2XCPA 1RT3B 4YN3B 4GVLA 2BKNA 3HF5A 4CJSA 1WHWA 1Q9XA 1ICEB 2IYIA 3T5LA 1S9EA 4DSLA 3K7RA 3GG4A 1BD6A 4V1Ak 5A8KA 1R6YA 4C3MA 4P75A 3VAIA 2OHDA 3V5RA 2UVRA 1DTTB 3L7PA 3GSIA 4I69A 5EX0A 1RT4B 4HL9A 4CM2A 4W4MA 2QMUB 1WKJA 3CIZA 3WQTA 4OKJA 2NNWA 4FF3A 1PKUA 2PO4A 3C65A 3F2KA 3BPDA 3CI5A 1EP4A 4UOCA 2QJ3A 5ITHA 1PAEX 5IQ6A 3CCES 4RNFA 1NKBA 1E6VB 3R8YA 1RWKB 1WSGA 4NA2A 1PC4A 3THXB 3DFEA 3VWSA 1Q53A 1VHIA 3HVAA 1P8ZA 3MFHA 1Z2ZA 4BE2A 1Y0HA 2LFVA 1LW0B 3S1TA 1FRLA 4ATNA 4DN0A 4CZCA 4QYRA 2OPRB 5KTQA 3MR3A 2M8DB 4B3TJ 3WUHA 4CK3A 4OZ2A 3DM2B 4JNEA 4FJ7A 2GUIA 4B3RK 4JI7F 3TTDA 4P2MA 3VF4A 4NB4A 1YJ9N 4WYLA 1QAIA 1HKCA 4FK2A 3KHGA 5GAHU 1S72S 3DXMB 1PIEA 3DLLL 3V4MA 2OFGX 4ELTA 2CFXA 1Y11A 4CEBA 7FD1A 3I0RB 3KK1A 1QM9A 3D66A 4EWTA 4WBFA 4OX9F 2QO3A 2AEMA 1Y5LB 4JN4A 4CK2A 3CJKA 3CPEA 3LM9A 4HACA 3M5RA 3POTB 2E66A 3GG1A 1ZBTA 3LPUA 5BR8K 4CGIA 4CO0A 3KLHB 2BJ3A 1KFSA 5KFBA 1T9TA 4YHHJ 3H4DA 1C4CA 1TL1A 3OTOK 3NVMA 1JX4A 5JJBA 3QFWA 4ZCKA 3CCVS 1WTBA 2IPOB 1CJKB 2XZWA 3WQUA 2MSSA 2H54B 4CLZA 1S1VA 1VQPS 3NCPA 3KHHA 4KHPJ 4KFBB 3BP8A 4BR9A 5CHIA 1IBMF 3D0PA 4CGFA 3G71S 3FC9A 4FM0A 3O6WA 4WKRA 4CT9A 3A3OB 3CC4S 1Z4UA 5KFHA 2WTUA 2YTCA 4ZIWA 1B92A 1W0HA 2AW0A 3TJAA 1G3OA 4FYVB 1PILA 2GNKA 3AVNA 4KHUA 3JSYA 1R8AA 3UW1A 3P49B 1T9VA 2W2NP 2HHTA 1BOTO 2FF3B 2QKBA 4KSEB 4O8UA 2A2DA 2P9PB 3JTNA 2MQOA 1CQMA 3I5CA 4BS2A 3Q23A 4QYZK 3J7YP 5DM6Q 2UP1A 3OYLA 1MNEA 5FPNA 3HI0A 1VQNS 2HHSA 2HZVA 1P6TA 4ED5A 1IN0A 4U67Q 2UUAF 2B5JB 1NAQA 2H4WB 1HQUB 5LL6Z 3VOVA 3T1YJ 3A13A 3GR1A 4QPXA 1MWKA 1JLBB 2GJ2A 1HBMA 1H2VZ 4NLBA 3KHLA 1SUQA 2XS2A 2AP1A 2RHQB 5A6WA 2KFYA 2E6LA 2VWBA 1A6LA 2WVBA 4QWEA 3RB3A 2QK9A 3OS2A 4N8NA 1VMBA 1HD0A 4I6AA 3E3XA 1VQ6N 4KHYA 3LH2S 1WF1A 5K9FA 4FLUA 3MEEA 1HI8A 2L41A 3KWGA 4XEIA 1RXOB 1SL1A 2YY3A 4CBWA 2EKYA 1WF2A 3SQOP 2XEXA 3LWLA 3NGRA 3R6MA 3FUYA 3PEJA 4OYWA 1C1AA 4WE1A 1RILA 4FW2A 2DGQA 4O0JA 5SZTA 2V8GA 3K8WA 1KTVA 3HHNB 1E6YA 4CLFA 1KN6A 4AM6A 2H48B 4DQIA 1RAAB 4OVLA 4A8XA 5AQMA 2RQ4A 1F9HA 3O5BA 1S6QA 1X9JA 5HRPA 4OGEA 2ZE2A 2FBXA 1ACMB 3BREA 3G6EN 4DTOA 3D0IE 3CETA 3N4QA 2LA4A 5H9FJ 5M2UA 5M1PA 2I7NA 8AT1B 1Q8BA 5IM0A 3N0VA 4OHVA 5M2PA 2OPSA 1RBTA 5H9EJ 1NDPA 4AE5A 3DAWA 3KLIA 4CEZA 4KPYA 4PCQA 4F0HA 2WONB 2RU3A 4RG8A 3KLHA 3ITHA 5AQKA 2E7WA 4DL6A 4OLBA 4P74A 2NS1B 3I5AA 4BVOA 4K0KF 3P45B 4ZLJA 2Y0SD 1Z25A 5JLHA 1FE0A 1FDNA 3BJYA 3GBTA 4C11B 1TKDA 4XTTA 5FPMA 4P7VA 4RW7A 1KQGB 5BJRA 2CXEA 3QEXA 4KH4A 1N34K 1IG8A 1NKEA 4DFJA 4YOWA 4IBNA 3OT9A 5DQHA 4OLOA 3O9TA 4F4XA 3Q8YA 2DTJA 5BPMA 3TU5A 2O4IA 1SC3B 1XHXA 1FD2A 4F3QA 4QYZJ 4W98A 4RCHA 3SAHA 1RWPB 4K8ZA 4ZTFA 2DK2A 2NXJA 4WFZA 3PJXA 3V4IA 3QGPA 3TA1A 5HMXA 4Z4CA 4WXOA 5ADZA 2DXDA 1NNEA 2NRTA 1T02A 2UUAK 5E3RA 2Z4PA 1SKRA 1IQTA 1XMQK 2CAJA 1ZAXA 2PFDA 1M5PC 3JS9A 2DGTA 1L3UA 4AT1B 1T03B 4CLTA 1WG5A 4ILLA 4QS9A 2V9KA 3CCSN 1BY9A 2AJ2A 4ZLPA 3MTKA 3H46O 3F73A 2YWFA 3DLJA 1H2TZ 2HLTA 2KXFA 4F4KA 3KHRA 3MUTP 3ZZUA 3FFIA 4JI4J 2C3OA 2XGPA 3ZT1A 1N52B 5L8RC 1NJZA 4CO4A 1OMSA 2R8IA 1KVBA 1VC5A 4ILGB 3U9ZA 1WC3A 1Y64A 4X65J 2ZH1A 4Y1DA 3AQPA 4NXNJ 3MCAB 2D4WA 3BPSP 1HKBA 4N77A 4DTSA 5CD4H 2P9KA 2MSTA 1T11A 3KMSA 4L6V3 1I39A 3LZJA 4DUZF 4EZ6A 4K50A 3PX4A 1X4AA 1B7FA 2D1KA 1OO0B 4DS4A 5LL6d 1CJTB 2ILZA 4NLCA 4AHVA 3DXKB 1VQNN 4M3UA 2A6MA 4KKOA 2VA3A 2DHSA 2FJEB 5B8HA 1K8AO 1YJNS 4NXMJ 1RCOB 3R1XA 1M5VC 5AR0A 4NEZA 1S1UA 1HW9A 2R7VA 4ZPBA 4E19A 1U48A 3FZFA 3CEDA 3O1WA 3D6RA 4IRKA 3C2PA 2MKJA 4YR3A 3J80U 3H5UA 4WE1B 2AEJA 4NA3A 3FEYB 1LWEA 1HPZA 2J0SD 1CJUB 4CF9A 2Y1LB 1KKHA 2DY9A 3LP2B 4JS5A 2XMTA 3C6HA 4CWBA 3VHQA 1NGFA 2ZZMA 1VR6A 2LQJA 1QE1B 4ZOSA 1HIYA 1IVZA 4ZN1A 4ID1A 4I6MB 2V50A 1WNSA 2DJWA 2R2TA 5HQ8A 3MUMP 1BLUA 2OEMA 1G2EA 1RWOB 4PL8A 5DDPC 4DR7F 4OGCA 4ILMA 1WG1A 2FIUA 2EBGA 2HWTA 2QTDA 4LSNB 3BKFA 3IRWP 4M5MA 3VAGA 1IKYA 3GCWP 1UVIA 5MAOA 3VQ7A 2HZAA 3TVZA 2OPPB 3IUCA 5B0AA 3J7YU 2F9DA 2DRBA 1NGJA 4X64F 5MLCV 5C7PA 5FRNA 4HT5A 2FVQA 4AM7A 1SV5A 3HHEA 3Q22A 5T7BA 1NBWA 3CMEN 4DSEA 2ACMA 1R8CA 4GV3A 4DI6A 3BF3A 4DR4J 3HVRA 1U45A 4YB5A 3S6EA 3NBPB 2ZM6K 1HBOA 3PZPA 1A7GE 2D3OR 4OJRA 1FFSB 4HUEA 3CCMS 3MGJA 3BQ2A 4JI0F 3I9V9 2KT5A 3K5LA 1YJ9S 1CS4A 3CJ4A 3IWLA 2D7SA 3VGUA 3MXHP 3MPYA 5AZJB 2CQ2A 4KTWA 5HL7L 1EP4B 1BWFO 2GIRA 5AQRA 3QO9A 3SK3A 5KFDA 2DNMA 5LT5A 3MTJA 1Z05A 1FRIA 1FDBA 1HL6A 1EXQA 3CCLN 3M8RA 1K0VA 3GWCA 2VODA 2HHHF 4DV6J 4DV2J 2N3LA 2H5IB 3EY1A 4EYIB 3PNIA 1DFDA 4ECXA 3FQKA 3MCMA 2ZH5A 1FWLA 1LQ9A 1T9YA 5HL7Q 1UEVA 3A0IX 4FZZA 3O5TB 1Q95G 2K2PA 1RADB 4KHPK 1NGAA 2F5GA 1N48A 1XNRJ 3M4XA 3SDEB 1N32F 1FRHA 3CJ5A 1NGEA 1UJ6A 3MMCA 2VICA 5ETTA 2QV6A 5A0YB 2N7YA 4TU7A 3QBWA 4F7VA 4DX8H 2EEYA 1RYSA 4KV8B 3MEGA 3O9UA 2F7VA 5KOXA 3AVKA 2OPSB 3CTRA 4NCAA 4BRMA 4OJ3A 3BS9A 3BEXA 3TAMA 4KH6A 4U7UD 3NCRA 3DRPA 3NMRA 4NZ6A 4RW4A 3MN5A 3S9HA 2QMWA 2NRHA 4CJEA 1P27B 2HHXA 1E3MA 3U1NA 3OYKA 4YB6A 3R5CA 5ETKA 1NZ8A 3GZ7A 1VQ4S 3IFRA 3M2RB 2ASPA 1I94K 3HSTB 5CCMA 4DCOB 4ZLLA 2NSCA 2ETJA 3JXUA 3T6BA 1NBEB 4OYBA 3R9PA 1BQNB 3SFGA 2O8EB 1CVJA 1UP1A 2WC9A 3OHBA 4P73A 1YVFA 3H5YA 2JEIA 3DLHA 3LDOA 3G82A 4H54A 4YDDB 3Q7CA 1U1OA 4TLQA 2WFBA 1V3ZA 2G4BA 2B6AA 3KDNA 4LFAJ 3NS6A 4U9RA 2BX6A 4OYAA 2ATLA 2A6AA 1OIAA 3J81j 1FX2A 1N33J 4OV1A 3I8DA 2HMIB 4NLPA 3VVUA 5AQYA 3OTEA 4DX7A 2DY4A 5M1OA 2EFVA 2W6LA 3W8GA 3O6QA 2UU9J 2O8EA 4JI5J 2E44A 2ZFHA 3T5KA 3JSMB 4PEOA 2B4VA 4LF8J 1BWEA 2W9AA 1X5OA 4OX9K 2DXEA 3GE1A 3JQKA 2HLUA 4CJ3A 2EXUA 4MLHA 3TSPA 2RF2A 3ZXWA 3FZHA 5AE1A 1NJIT 4KH0B 3EEQA 4RBTA 3VERA 3FSXA 2HFVA 4BR7A 1QUPA 3AVGA 1SV5B 3ENOA 4IDHA 1HMVB 3LP0A 3G82B 3RMDA 1I51B 4TVAB 3CCVN 5CYQA 4LBHA 3CXCR 1RP5A 3ID6A 1GTHA 2YKPA 2KU7A 4OZLA 3H45C 3O08A 1Q16B 2W6KA 1BE4A 4J9RA 3MM8B 3V6DA 2YXLA 4AXJA 2O67A 1OH7A 3IR6B 3A8IA 3SUNA 2BJDA 3GSDA 3VAJA 3Q86A 5HQLA 1NK9A 2EVZA 4RWWA 1RWVB 4WFBL 1DY3A 5IWAK 1Y00A 1RYRA 5AFUA 1BCMA 4KRFA 4M5LA 1NGIA 3EZUA 2PEHA 2NRZA 3MM6B 2KFNA 2DEIA 1WDTA 2VWJA 4JB8B 1VQKN 2KHCA 2P9EA 4AHRA 2WSEC 1RU1A 4NZ7A 4PUOB 1BISA 3VENA 3O8WA 1RT7B 1SCJB 4UTGA 4QWAA 3NH0A 4DV0F 3N4PA 1W7WA 3PSFA 4F02A 4CTAB 3HSGA 4C11A 3W61A 2J0XA 7FDRA 1YKWA 2KVIA 2PDAA 4U67L 4DQ8A 1HR0K 4BE1A 5KFOA 4UUWA 3M32B 2E1MC 1TKTB 2PI5A 3P4IA 4JRPA 2FVPA 3TNVA 4CO3A 1ATNA 4EBDA 2V8HA 1JK9B 5LSRA 4UUXA 4RO0A 3I6PA 4CNYA 3PEHA 3MM8A 1UWBB 1WC1A 3C7NA 4TU9A 3LALA 4PAAA 3M1FA 3MM6A 2E88A 4CO2A 4CJUA 1U24A 3D67A 3SQGB 3CCLS 3FDSA 3HRGA 3NAEA 3HVTB 2KQ2A 2OPPA 1U1RA 5LSOA 3HT0A 1NGGA 1FKPA 4U95A 3LDSA 3BY5A 1WWHA 3KLGA 4BC3A 2P9SA 1LOUA 3R27A 2MGZA 4CLPA 4FJMA 2HWIA 2R8JA 4O3NA 3GILA 2W8KA 2HQFA 1WBDA 2MKCA 4JKDA 1HNWF 4O4GB 4KFBA 2PMHA 5C5JA 2VYPA 4E98A 3ADAC 2ZZNA 4C3KA 4O3QA 4CLKA 4JI2K 1QSLA 1V4SA 2CPIA 5HVGA 4MK7A 3P6YC 4HCCA 5M2RA 2R2SA 2JEJA 2CPXA 3P5BP 2RIJA 3QNWB 1X4CA 4CLLA 1L3KA 3NGTA 4CD1A 2EK1A 2WOMA 1R0AA 1JLFA 3RB0A 5D8HB 3QIDA 3EGZA 2QA4S 1P1LA 3O3HA 2ZH3A 4K8XA 4PWDA 2A1SA 2B4OA 2BBEA 4J2BA 2QSWA 4ZTJA 5AXNA 3OL7A 2CPHA 2HRUA 3F0NA 1FJGJ 1GXTA 1BI4A 2XYGB 3F9KA 3GMGA 4X4VA 2FXUA 5D3GA 4USMA 4WQ5A 4O4GA 3LAMA 5GIPA 2XG8A 4B1ZA 2LQ9A 3D3CJ 4V19S 2D9OA 1AUDA 4GKJF 2PE8A 2KO1A 4WYWA 2RRAA 3GIIA 4DV1K 2C2OB 3MMVA 4GMKA 4E89A 2KT3A 2VDHA 1Q8IA 2MMYA 2OTJN 2JFKA 2YPYA 2ZBIA 3T1HJ 1C4AA 3DHWC 4R25A 3DXMA 2W4PA 5AZIB 1R0AB 3VAHA 3UB5A 2FGOA 4BC5A 4FJXA 2KTQA 4BRNA 3ZX3A 1X0FA 4FF4A 2BTFA 1D5AA 2VWKA 1DHMA 4QU7A 1J9AA 1IUJA 2BKOA 3V6DB 4M7YA 4DJBA 5CZVA 1JB0C 3K5OA 1ZBUA 1FX4A 4B9NA 4JI3J 2UXBF 2OELA 4AHCA 4CO5A 3RZAA 4NXMK 4HYKA 1U49A 3A8YA 1L3VA 1P90A 3R2CJ 2KW4A 5B0DA 5FLXO 3FFIB 4WU3A 3A4TA 3RTVA 2E4LA 2CKWA 2XSJA 5C25A 1HWIA 3M8WA 3AHPA 1RA6A 3JSRA 2XI2A 1M5KC 1T03A 1IBCB 2XO7A 4LFAK 3IRXA 2C2NA 5A8RB 1EETA 2ZHAA 2DR8A 1NWKA 4LUBA 3M6WA 1RT3A 3TEGA 2ZWOA 1TVRB 2W9BB 2X51A 2GMHA 2DRDA 3PJWA 4FWMA 3PRDA 2HMPA 1S97A 1UVLA 2B7CB 5LJ5Y 3U27A 2HW3A 2UUCJ 3TQEA 4PG8A 5A2QU 2AIRB 5A2QY 3ETOA 4DR3J 4AQYJ 3ZZPA 1YLXA 1B4SA 4O3SA 1R43A 2YBVA 2D1CA 1K1SA 2BE7D 2OTLS 5D0EA 3LUYA 2NRWA 3NOGA 1YJTA 1BUPA 5T7LB 3MK6A 1YGYA 3CD6N 2C3MA 8RUCA 2RS8A 2G8FA 4FNIA 4JI3F 4HUFA 3QEPA 3AVFA 3HOSA 3ITHB 2ZKTA 3G25A 1M1KO 3GJSB 3G86A 3FR0A 1V5VA 1YT3A 1URNA 3ZZZA 2ZGZA 3VGLA 4DL0C 5B0CA 4TSXA 1YJUA 3G71N 5E26A 1QE1A 4NA1A 4PA1A 2A5XA 2PMZD 1ZZNA 2MZSA 5L46A 3OW2M 1M1HA 4OIXA 3EE3A 2SXLA 3HHLB 3E9OA 4X4NA 1NPPA 2Q0UA 2UVWA 2V2QA 1SKUB 5IZHA 4JI4K 4B1UB 4CJKA 2A1BA 1NK4A 1F0XA 5CH7B 1JNRB 3MCPA 3K0JA 5J1EB 1WUAA 1U0SA 2WZ1A 5HSPA 1VQMN 1J5EF 2OZSA 4GKKF 2NXUA 3O80A 4O0IA 4QBUA 1N33K 4LF5K 1Q5YA 2BM1A 1TQLA 1E4FT 2OPQA 8ATCB 2GEMA 3RRGA 2FTRA 5DO2A 1N8RO 4H4MA 1N8RT 4UOHA 4YDUA 2IVMA 4NLVA 4YY3F 2G0CA 4C8KA 5CYJA 4AL7A 3C6UB 3QESA 5KGWA 4I67A 4QR2A 4UQTA 5GINA 2KLAA 3VEYA 5GADP 3G4SS 2QE5A 4IQMA 1IKXB 3N01A 4RWTA 1P8GA 1LWCA 1ASUA 5I3PA 3CMES 2E8AA 1S59A 2GO8A 2HKEA 2EFPA 2QWOA 2AHOB 1FI4A 2Q2RA 1XC9A 1TMMA 1RAFB 1VQ6S 4JV2A 3N5FA 4F2SA 3VQCA 1S5JA 2JVOA 2LQ8A 3R7BB 5ETVA 3KKFA 1TKZB 2A10A 3NVKA 1F60B 3KK2A 4CZJA 4ISGA 3J80O 4BQZA 4PQUB 5IT9O 3UCUP 2XTJP 1X9MA 2CNLB 4OV6A 4ZP8A 1Q5VA 1VQMS 3CCQN 2O5DA 1ZYQA 3ZSRA 1BA1A 5JVGQ 2PFUA 3AJ2A 1WI6A 4NEYA 3DI6B 2UXCK 1WSJA 2MZRA 1YK9A 1KVIA 5AFUH 2XBPA 4URSA 2CGLA 2DGOA 4IXCA 2RAQA 5F8IA 5LOQA 4H8KA 2MHNA 1PYSB 3PUFA 3OHAA 2RRBA 2KJVA 4CE9A 3GIJA 2IC3B 2D0OA 2JHEA 4IFYA 5L1IA 2NXCA 2H51B 3R97A 3SCKE 2FBTA 3V9UA 4DLEA 4ED1A 3BN7A 2E2OA 4DQSA 5KFTA 5BYQA 1S9GA 3CD5A 5KFPA 1S99A 1Q81T 5CY4A 1HI0P 2RNEA 2L48A 4ECVA 3OUYA 4N5SA 1HJOA 3WXMB 1WORA 3C46A 5KT2A 4IG0A 1Y10A 1DTQB 4IFVB 3KLGB 3VQSA 3ZTSA 4Q2LA 3SQ1A 3FZLA 4BREA 5CABA 3SCLE 2FHJA 3BZCA 4KGXB 1GLAG 4KRWA 1WNEA 2HGNA 1UKUA 4C8NA 1NPRA 3BR8A 4MQ3A 5GVQA 2EI5A 4JOUA 1HJRA 1QVFM 1QVGR 2BW7A 4MMOA 2QL9B 1WEZA 5E41A 1HNXF 4LH5A 3MR2A 1KVKA 4MDAA 2YX6A 4OX8A 1Z26A 3PCOB 2JX2A 1YIJN 3M2RA 1HYVA 3KD1E 3W2VA 4BC9A 2FJAB 4DV6K 4BG9A 3L95X 1ZOTA 1U6BA 3HZEA 4C9DA 1GAOA 1BCOA 4B3OB 3US5A 3L4QA 4C23A 2W2MP 4ISFA 2OUGA 2I5JB 2UXDK 3BBCA 3V1OA 2E5LJ 1RWWB 1WN7A 4KH1B 2CVEA 5CZXA 3OL8A 4DV1F 3SXLA 1BIZA 1CG2A 3MEDA 5BN9A 3AAPA 2GV9A 2K1RB 3EDQB 1ZTTA 2GW8A 1R59O 1BUXA 3T3FA 4DFMA 2KM8C 1BQMA 1XWLA 3ZT4A 4A8MP 3NGDA 4DZDA 3H1VX 3OYHA 4BLGA 3KTQA 2D3O1 4USTA 5HBMA 1CLQA 1C0TB 2G8HA 3L2UA 4UF4A 2A0FB 3ENWA 3SV4A 4AHSA 4XH4A 4JEPA 4H4MB 2PI4A 3PKMA 5I3QA 2ZE2B 3SNNA 2XY7A 3V81A 3UQSA 4ECQA 4RU2A 2UVVA 2W7PA 4DU7A 3M8ZA 3J7ZT 1RWUA 3K89A 1QDUB 3F9MA 2ZBCA 1GTEA 2HNZA 3ZZRA 1S1TA 3D5MA 3BBBA 1U1PA 3ET6B 1VBYA 4FP9A 1YI2N 1GLBG 3HFZB 3QWPA 4J91A 3D68A 4USKA 4H5WA 4C98A 5B08A 5F8HA 3OL6A 2V4JA 4BR4A 1QHTA 2J0QD 2QYGA 4GVMA 3BF4A 3A12A 1FT8A 2V94A 2E9ZA 1CULB 3D1OA 1U26A 3DDKA 5KG2A 4FZYA 4PWWA 4E7HA 4DTXA 1NMEB 1FKOB 5DDRC 2MJNA 1U2FA 4UY8T 4DU4A 4H5TA 5JLFA 3C16B 1VIXA 2W8LA 2QRRA 4CGDA 5LMUK 1QQCA 2HNYB 2GMLA 3CVKA 2YHXA 1RTZA 2DNHA 3M30B 4DSFA 3FGVA 4IO8A 2G8KA 2AGQA 2AWZA 2VG5A 4X65K 4JI6F 4J9OA 3ISNC 1RGIA 2LP4A 4C0HA 4I4BA 3KD5E 4CZEA 3MECA 1RKJA 1JLQB 3G8QA 5C10A 4F2RA 5IV4A 2ROPA 2E5GA 4TNOA 5K8OA 3ZT2A 1B0PA 2QKKA 4HCBA 3BZQA 2Y1RI 1KQSM 3HO1A 3HPOA 1BC6A 2VHGA 4YOXA 1SS6A 3HJFA 3J7A1 3KJFB 5HMYA 3QRQA 4M3ZA 4FXDA 4I2PB 2VZ9A 1PG5B 1YJ7A 2IRYA 4YORA 1IXKA 3K8VA 1CJVB 4QWCA 4O0NA 1U1QA 3PIPQ 2GX8A 1BQNA 2XI3A 3VEWA 3EVOA 2X78A 4MKBA 3UCGA 2W7AA 4IEIA 2AF6A 4BY9C 1S0MA 1PAUB 3KIOA 5T41A 3LP2A 3ICLA 3QIPB 3CDUA 3PFOA 3HVTA 4LT6A 5J2QA 3RMCA 3CC4N 2DY1A 3TZYA 3AJ1A 4JV1A 1IG9A 1I1GA 1C0UB 2GMJA 1LAWA 3TAEA 3IAYA 2JLEA 3BGLA 3PFEA 4WU2A 3KK3A 1WSEA 1FCAA 2RH3A 1HLUA 1JNZB 2D3UA 3EPIA 1T05A 1DLOB 2X74A 4KO0A 1EIYB 2FGCA 4NCGA 5EVZA 1RBOB 4A8WA 2UUCK 2R8KA 1YHQN 2HFOA 2XMJA 1DKGD 4M5IA 2B9EA 1PO6A 2R7WA 3R7SB 4BGAA 4ZVHA 2YX7A 2E1PA 4FXWA 5EWFA 3NNCA 3RG6A 1CZBA 3O3FA 2PEBA 5I42B 3VCDA 4NLRA 5HBMB 2XMVA 3R5JB 3UDVA 4S0MA 5KFXA 3Q83A 3GDQA 1YBUA 1Y4ZB 2J9EA 3H5XA 1LWFA 3WX4A 4X4QA 1EKEA 2D0BA 4DB3A 3D45A 1J27A 3CUNA 1YRTA 5D78A 4M95A 2ZJQL 3MD1A 3RW7A 3TZXA 4B3MK 5DGAA 4LF1A 1MN7A 1U0HB 2C3PA 3RU0A 2JJ4D 1VQ9S 3D2EA 4CBXA 5FLXY 4F0KA 4QR1A 4Q8FA 4EHUA 3IMXA 4NZ0A 1VQLS 3EYZA 2W4CA 3MUVP 4Z7CA 4OYIA 4NE9C 2ZH4A 1KP6A 3HHLA 4GW6A 4A2AA 2V4RA 2ASOA 4KHQA 2IM2A 4NASA 2YH1A 4G6VB 4EU0A 4CLSA 3VN5A 5T14A 3OUYB 3H3NO 2D0AA 4V19J 5AQHA 5KPZA 2FB0A 1FESA 4HTLA 4H0VB 3K57A 4BRQA 4I1TA 1Q8LA 1F2HA 3CERA 1C1BA 3RR8A 1WEYA 3JAMY 3VF6A 3UD4P 3C8YA 2LECA 4N41A 2KT2A 5A76A 4PYAA 2WVEA 3CULA 3OYCA 5GAEU 4NOHA 4UZCA 4M8LA 4A57A 1M5SA 2F8EX 5KFVA 1JCFA 3MEDB 2P9PA 4QWDA 3F41A 4FLXA 1QJHA 1Q4RA 4QWBA 2ADCA 4LRBA 4LBPA 4H5NA 2FDNA 5DK5A 2E9RX 5GMEA 3UE5A 6FD1A 4LF8K 4GC6A 3CMAN 1N5YB 2AV5A 4NXNF 2YKOA 1WSHA 1N5VA 4X62F 2W40A 2K7KA 4A8SA 4DV3F 1RCHA 1S57A 1WHXA 3SJJA 4LSLA 2DGSA 1CJUA 2IA0A 1RTJA 3GJRB 3UKUB 4ILHA 1SQFA 1ZA1B 1VSEA 3DCAA 4FJNA 2ZZTA 4I64A 1RT1B 2QWQA 2YWWA 4OI2A 3NGIA 2P9GA 4DS5A 4FKXA 2AU0A 3RB6A 1NPKA 4PZVA 1BL3A 3AARA 1Z1ZA 3RR7A 2LMIA 4HHHA 3MDFA 4RNMA 1JLBA 2MZQA 3HSJA 1HA1A 4CJVA 3N28A 3ELHA 3CJ8A 3C14B 3THVA 4G1QB 3FZKA 3UR3C 3WIUA 1S48A 2A6OA 2YI1A 5B0FA 2E1AA 3CJAA 5GAEP 2AX1A 4BC4A 4DQPA 1A9NB 2DGXA 3AT1B 3CF5L 4RW9A 3MR5A 1HQEB 5LY3A 2E5HA 3M9MB 3MOJB 3P38A 5BN8A 1NSAA 3CDWA 2KN4A 4PWUA 2EKNA 1IKYB 4JI2J 3HD2A 4IUFA 5B0EA 1W2BM 1LAVA 4FWRA 1ITGA 2YCHA 3P83D 3T69A 3VGMA 3VQ8A 3ILOA 1HWJA 1KVAA 1UW4A 2XMKA 4CHZA 3NGUA 4FJ9A 2PIIA 3OR1A 3D6TB 2OAUA 4I7FB 4O44B 2QC3A 4QS8A 3TAFA 4ZHRA 1RAHB 3L4IA 4Y2AA 3IM9A 1X1PA 2YNHA 2V8PA 1RQ0A 1O1WA 3HM9A 1S1XA 2E7VA 3AOAA 3EO3A 4Q43A 3THPA 5D77A 2W2QP 3K17A 5AXMA 3UPFA 1X3NA 3QFPA 3PHEA 3IDHA 1NSPA 4YOYA 1WKKA 2CWXA 3LM2A 5LMNK 1IR0A 4DEZA 5KG1A 3CSKA 2C2MB 1RSCA 5HROB 2XQCA 3VGTA 2BM0A 1R8HA 5L9XA 1TKTA 1Y5IB 5CE3A 1EETB 1WHVA 4CEEA 4O4RA 1SJ3P 3LP1A 1BA0A 1FKPB 3AD8C 5KPTA 1HWKA 1NGBA 2W25A 2J9DA 1S1UB 3SSQA 2F4VJ 1ATSA 4B3RF 4XDDA 3Q0AA 2C2RA 4WF9L 4OZ1A 3M2VA 4NYNA 3OQ2A 3G6YA 4X65F 2O66A 5K14B 3DRPB 4CHPA 3QINA 3BDEA 5ADXH 4O3OA 1B9DA 4H0TB 4JI8F 1JLAA 4E7JA 1S1TB 2C2KB 4FVMA 3TUJC 4IEEA 2E2PA 2RDDA 4J9LA 2MGZB 4UY8O 4KAIA 4B3SF 4IJNA 5GAGP 3B6OA 5BREA 4QIFA 2WB4A 4HTIA 4K5RA 3VETA 1RAEB 3L3VA 4ECZA 2HFUA 1SL2A 2VBXA 1JLEB 3HCXA 3CE8A 1C1CA 5SUHA 4BR2A 1Y7PA 4LF6F 4EHTA 1KQFB 3CCRS 1BGXT 5TKYA 1LW0A 3V9SA 3QJPA 2XB2D 3BF1A 1RTDA 4XPCA 3RGIA 4E7IA 2VQFF 4F67A 3GG0A 4KH5A 4CI0B 1JLGA 5DM6L 2BQUA 1CPZA 4QAGA 3OD2A 2XGQA 4FOEA 4UOFA 3AO3A 2HNDA 5A8KB 3EXYA 3VR1A 1HBOB 1I5OB 1SC1B 4NLWA 4FOIA 1JJ2R 2CQCA 4Z4IA 2KHOA 2VFTA 3T1YK 4N56A 1K9MO 3IGVA 1RBRA 2DKOB 1TKXA 1C2PA 4P52A 2R8HA 1OJ4A 5BR8F 3MM5B 2XULA 4FDFA 2QI2A 1OPIA 2DHGA 4F3TA 4JI5K 4KKOB 4I2PA 1XBWA 2VBWA 3EPGA 4JBCA 3MX2A 5F8GA 4LR7A 4BRPA 3K58A 4YB7A 5C2FA 3GFHA 3BDPA 4TY8B 3SPYA 1KD1T 4CT8A 4DV4K 1R8PA 2BACA 1HWUA 2HNDB 2CJYB 3O2IA 1XERA 5DDQC 1D0EA 3QJJA 3BSCA 4I2QB 2YWKA 1X0PA 4NYZA 4QJVA 2MPUA 1C1BB 1RK8A 2GVZA 1RBAA 2P6TA 1N6QA 2N7CA 1FD8A 4CIFA 2AT1B 5AQXA 4ES1A 4C0BA 5E3QA 5IV3A 4CGJA 2MKYA 4B17A 2XS5A 2H1YA 4DV5F 4A61A 2HHHJ 4BROA 3W5YA 4NX9A 1F9EB 1D09B 3ATUA 2H3GX 1KNZA 3IMQJ 4LC9B 2Q6BA 2HWHA 2NZTA 4IRDA 3K0SA 3M05A 4C2MA 2GAHC 4LF5F 3Q7BA 4YB1P 3OFEA 2ACYA 3LGNA 2AEFA 4GVEA 5DETA 4WPAA 2ZBQA 3DI6A 4BRAA 3HXMA