3DYAA

Hiv-1 rt with non-nucleoside inhibitor annulated pyrazole 1
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
555
structure length
551
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 161
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dyaA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dyaA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dyaA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dyaA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dyaA05
4IBNA 3KLIB 3AVBA 1IH7A 3V6DA 5KFAA 4EP4A 1U45A 1RTJA 5L1IA 3PW5A 4IFVA 2IDOA 5T14A 3GV7B 4EYIB 1C2PA 4LQ3A 3WNFA 3TANA 4XO0A 4ZPDA 1U48A 4HKQA 1RA6A 3KTQA 2D3UA 3PW0A 2WB4A 1C6VA 3AV9A 3ZSOA 4NLTA 2XCAA 3DLKA 3TAEA 1DTTA 2YNFA 4CHOA 3SQ1A 2Y1JA 3ZT1A 2W9BB 3BGRA 3OYNA 4KV8B 2ZE2B 2IM3A 4KTZA 4JV2A 3ZSQA 5KFFA 4YNQA 4IG0B 1T05B 2KTQA 3CO9A 5F8JA 1XC9A 2E9RX 1HQEB 3VQ8A 4FW1A 2HHWA 1L3VA 4JV0A 4M42A 4EZ9A 4BDZA 1YT3A 4TY8A 4QWAA 4JRQA 4J9PA 3SCXA 5HRRA 3RMCA 1BQMA 5C42A 4DTSA 3RMBA 4DL5A 4K4YA 4ECUA 1T03A 4CHZA 3NBPB 3C95A 2BE2A 4RG8A 1MMLA 3DOLA 4FBTA 5HRSA 3KLGB 4DS4A 2VG7A 2GIQA 2OH2A 3KNAA 4FYDA 4CECA 5HRNA 2UVVA 3K2PA 2VG5B 2IJNA 4CF0A 3OYMA 1I39A 3VA0A 3LALA 3HXMA 2JEFA 2XRIA 3NHGA 3TAQA 1HMVB 4EEYA 5J2PA 3H59A 3OYLA 1VRTA 4DG1B 2G8HA 2HNDB 3DOKA 3T5JA 5DK5A 5KFRA 2RN2A 2OPSB 4CGGA 4CJQA 4B9TA 4M3WA 3SZ2A 1EX4A 2XO7A 3PO4A 5KFCA 3K5LA 4CJSA 3OS2A 3RAQA 4CEOA 2XCPA 2HB5A 2G8UA 1JXEA 2AU0A 3OL7A 2YHBA 1FKOA 3U3GA 1SL1A 2JC1A 1J9AA 4RNNA 4KKOB 1ZETA 1JLQA 1NJWA 2HNYA 4CJ5A 4I2QB 3TAPA 2QK9A 1NJZA 1N4LA 2DPIA 3H5UA 4N76A 4H4OB 4FJ9A 3KHHA 2R2SA 1B9DA 4ID5A 2R2TA 3I0RA 1JX4A 5J2NA 4Y2AA 4DFKA 3I5CA 1IKXB 4K4UA 3GIMA 2OYQA 3B6OA 1UWBA 3HVTB 3LWMA 3AVLA 4KI4A 1GX6A 3RBEA 4FZZA 4RU9A 2A1SA 4FK2A 4WE1B 2LSNA 5KG2A 3RB6A 4CEFA 1KTQA 2B5JA 1S1WB 4G3IA 1XR7A 4CEQA 4FM2A 1S9EA 4RNOA 3AO4A 1TKXA 5HROA 4DTPA 1U49A 5KT5A 2DFFA 1IKVB 3T3FA 4F50A 3OYFA 2XY5A 1RA7A 4Y1DA 3DRRA 4BWJA 4NLPA 4O3RA 4N5SA 1NK4A 4C8KA 2C28A 3V4IA 3N6LA 2KW4A 1TKZA 1NK6A 3CM5A 5KFWA 4K4ZA 4CCHA 1D9DA 1RT7A 1S48A 4DL2A 2O4IA 3EPGA 3HL8A 4CF2A 5CY4A 1JLGA 3AVHA 3TARA 3G6VA 4RW4B 3MEGA 5F8HA 3MR6A 1KCFA 1LW0A 2OPQB 4NCGB 4Z4CA 1VSDA 1X9WA 3DLGA 5C5JA 5JS2A 4WFYA 4KI6A 2E6MA 4KFBA 1QQCA 3HVRA 4O4GB 2I5JB 4NLQA 4RNHA 4MH8A 4NYNA 1UOCA 5KFEA 3OYHA 3O4NA 3OYBA 4RUCA 1S1XA 2XC9A 3CDWA 3ITHB 4YMEA 4OKKA 4W5OA 3PO5A 1LWEB 1RT6A 3F9KA 3LP2B 3QIPB 4ZVHA 1L3TA 4KREA 4M3XA 1S6PB 2IAJB 5KT4A 1QAIA 3PJWA 1RTHB 2DY4A 4K50A 3LP1A 4URGA 2JLEA 1FXXA 2ZD1A 5KGWA 4AHUA 5C24B 4AHCA 1TL1B 2RDJA 4BDPA 1F21A 1ZTTA 4IRCA 4KO0B 4DSJA 4IDKA 1U47A 3NGZA 4JS4A 5C25B 4CJFA 4AHRA 3NGIA 3FSIA 4DU3A 4DSLA 4B9VA 1NK7A 2WRMA 1N5YB 1RT3A 3LDSA 4FM1A 5J2QA 3C6TA 3O3HA 4KB7A 3V1OA 4CGHA 4F4KA 1JL2A 4E89A 3SPYA 1A5VA 4CJ3A 3QO9B 2BANB 3M8SA 2GIRA 4XIUA 2JEJA 2ASJA 2X78A 1QSSA 2W9CA 3HPGA 2AJQA 5F8IA 4R8UA 3AA2A 4LH5A 3UDLA 4Q8FA 1B9FA 4Q5VA 1SKSA 3CJ0A 4O0JA 3OJSA 4DSIA 4ZHRA 3PX4A 2YNIA 4M3ZA 3L8BA 1JLEB 4NRUA 1TP7A 3U6FA 3KLVA 2BQRA 4B3OA 1YTAA 3IG1B 2HHTA 4YQWA 1C0UA 4CJVA 3VQBA 1RDAA 4KB0A 4ZPBA 3ALYA 3EZ5A 1REVA 4OGCA 3AVMA 2WTFA 4FLYA 4WXOA 4KHWA 3GIJA 1QAJA 4ICLA 1C1BB 4ECXA 1S10A 5KFPA 4R5PA 4JLHA 4ECYA 3KLIA 3VQ6A 2OPPA 1TKDA 1ITGA 4QWCA 1WLJA 4NLSA 3CM6A 4FJ5A 1SUQB 4LSLA 4IH6A 3QYYA 3Q8SB 2O5DA 4NLUA 3ZSRA 3CDUA 2R2UA 1LWCA 4DTUA 1CZ9A 5FRMA 3S3MA 5J2MB 1N6QB 3M9OB 2R8HA 1X1PA 2GBZA 4CEAA 1ZBHA 3OYAA 3DYAA 4K4WA 2W9BA 3LP0B 4IH5A 2ZE2A 1BQNA 1HYVA 4FLWA 3DLEA 1MU2A 3BSCA 4FK4A 4TN2A 4KPYA 1RTDA 3QNNA 3CQ8A 4NLGA 3MEDA 4OVLA 2VG6A 1I6JA 1R0AA 4NLXA 4QWBA 1ZBFA 4DF8A 4O3QA 2HVHA 2V4RA 3KLHB 3ZSXA 3I5BA 3P1GA 4CHPA 4I9QA 5KFQA 4YR3A 1VRUA 3I8DA 5CYQB 1WSFA 2Z1GA 3KLGA 1JLCA 1EP4B 1Y97A 5KT2A 1HPZA 3BSOA 4CIGA 4W5RA 4FW2A 5KG5A 5DQGA 1JLAA 1KVAA 2D7SA 4E7HA 4MFBA 4FJ8A 1T94A 5DLFA 3VQCA 3CFRA 5KTQA 3WNEA 3O3FA 1BL3A 3TAFA 1BISA 5CYMB 1LWFB 2HNDA 3PUFA 1ASUA 3K5NA 4ZTJA 2QKBA 4Z4FA 1D0EA 3QGIA 5DQHA 5KT6A 2OPSA 4OL8A 5CZ2A 4CJRA 2CKWA 3LWLA 1HNVA 2RF2A 2E6LA 1JKHB 3QEXA 4F4XA 1TQLA 4XPEA 4ELVA 3LZIA 4AHTA 1S5JA 5E41A 1BCOA 1RT4A 2D5RA 2X74A 3OLBA 4RW9B 2GC8A 4M3UA 4CESA 3MR5A 3OL8A 2C22A 1HJRA 3AVNA 1CXUA 4CEBA 4I7FA 3DLHA 3IGVA 2E9ZA 3AO2A 4E7KA 4Q8EA 1IG9A 3P83D 3HVTA 3IRXA 1RT1A 3Q8RB 1SL0A 4O44B 4KHMA 3HVAA 4F2SA 4WE1A 1S6QA 1SL2A 3H40A 1JXLA 2IBKA 1WAFA 3V81B 5HRPA 3ICLA 1U09A 4ED6A 4IQXA 4IR1A 4J2AA 3KK2A 4ZVEA 4ED7A 2R7YA 5DG8A 1FKPB 5KFBA 4RW7A 4W5TA 2X6NA 3H5XA 2FVSA 3SQ4A 4ED3A 1IKVA 1S1TA 3GV8B 1IO2A 2HWIA 3N6MA 1X9SA 2Z1JA 4Q43A 5KFDA 2W8KA 4J9QA 3NF9A 3H4DA 4NCBA 1LW2B 3BQ0A 4CFCA 3U3YA 4ID1A 3WNHA 3EYZA 3I0SA 2RPIA 4KB1A 4Z0UA 1SH0A 2G8FA 4CK1A 3V1RA 3THVA 5KT3A 4FXDA 3DLBA 2BGGA 1HYZA 3NAEA 2J6TA 1D5AA 4I9LA 3D0PA 2YNGA 3DI6A 3PW4A 3V9WA 3KLFA 5HBMA 3SFGA 1KSPA 2OPQA 4J2BA 4NCGA 1C1CA 1C0TB 2HMIB 4FJKA 1S9FA 2V0NA 3EZUA 3SUPA 4CHYA 4IH7A 1HQUA 2XGQA 1EXQA 3VQSA 4CK2A 3V9XA 2C2RA 1WSIA 2YV0X 4RNFA 3KMQA 5F8LA 3NH2A 2IJFA 3CIZA 3Q8PB 1KFSA 3ISND 1W9HA 1IKWB 4HCCA 4LSNB 3DDKA 4QWDA 2BRLA 1RILA 4CFAA 3QIPA 3PVXA 2FVCA 4B9SA 1S6PA 4ECWA 4FVMA 2IAJA 3OSPA 2AGOA 2YNHB 1K1SA 5JXSA 3KK3B 4ECTA 1ZYQA 5C24A 4HYKA 3QEVA 4RW6B 4ED1A 1RYRA 3T5KA 2IC3B 2G8KA 3PJXA 5C25A 1KVCA 4TYAA 4M3RA 4QOZB 5KG6A 2YKNB 3D28A 3L2QA 3HVWA 5DGAA 3SPZA 4NLYA 3M8QB 3JSMA 3RBDA 4OKJA 2WONA 2HNZB 3H4BA 4ECZA 3DRPB 4C8NA 1BI4A 4KHNA 3NAHA 3BSAA 1XHXA 1ZBLA 4DTNA 1DLOB 4M94A 3C6UA 4PWDA 4DLEA 3HYFA 1BIZA 4O55A 3MR2A 2FJVA 1ZBIA 1HNIB 4TYBA 1J5OB 3AVFA 4EZ6A 4Q0BB 2HAIA 1JLBA 4E1MA 3UPFA 4DEZA 1J54A 3IG1A 5HP1A 4F8RA 3QLHB 3PW7A 3BQ2A 2IS3A 2OPRA 5KG0A 1NJYA 2B6AA 1S49A 4NYFA 3MEEA 3OYDA 3DM2A 1HYSB 4DL3A 4CEZA 3S3NA 1ASVA 4PUOB 4GC6A 2DFHA 1GOAA 1IKYA 1D9FA 1JLFA 1NOZA 3HO1A 3MAQA 2P5OA 3SV4A 1QE1B 1KVBA 3A2FA 3LPTA 4ECQA 1RDDA 2FVQA 2HHSA 3C94A 3QESA 1NKBA 1RT5B 1TV6B 4GMJB 4OLBA 1UA0A 3E01B 4OPKA 1DTQB 2C2EA 3PR5B 5I42B 4IOBA 2AGQA 4WFZA 3I5AA 1K6YA 2EX3A 5KG7A 2ATLA 4M45A 4IG3B 3PZPA 4ELTA 1RBUA 1NJXA 1S9GB 3DRSB 1EKEA 2J6UA 5F8GA 4J9NA 1LV5A 3RRHA 3KK1B 2G8IA 4KTWA 4E3SA 4O0IA 3V6DB 3BJYA 1EETA 1RTJB 5K14A 1SKWA 3OYGA 5L9XA 3KLHA 3S3OA 2ALZA 4DSKA 3QINA 3PW2A 3AVIA 2RKIB 5KFHA 2FJWA 4O3SA 2XI2A 3T5HA 3CYMA 3DLRA 3H5SA 1EP4A 4X2BA 3TI0A 1S1UA 4IFYA 4AH9A 4DU4A 1CLQA 4EO6A 2W7OA 2UVWA 4N47A 3DLKB 2FLPA 1S1VB 4ZP8A 2YNFB 2KZMA 2KQ2A 2YKMB 4CE9A 1QUVA 4KRFA 1SKRA 2OA8A 3LP3A 4JRPA 1QTMA 4FJJA 1ZTWA 3NGDA 3ZT0A 3RMAA 4CJKA 4TY8B 4K4VA 3RMDA 2BQUA 2J6SA 1A5WA 3SQ2A 1BQMB 1GOBA 4K4SA 1RTIB 1ASWA 3HKWA 3PX0A 1T03B 3S9HA 2BE2B 3TQ1A 5SWMA 1XR6A 3DOLB 1KLMA 3KLEA 3G10A 2AWZA 2VG7B 1VSKA 1L5UA 4RW9A 1BCMA 4RUAA 3VQEA 3V6KA 3HJFA 3BDPA 3IS9A 3CJ3A 5J2PB 2YHAA 3V9SA 5KI6A 3DOKB 3FRZA 3AVGA 3SV3A 4FJHA 3UQSA 4H4MA 4CF9A 4DLGA 4G1QB 4F3TA 1Q9XA 4K8ZA 3V1QA 3LPUA 2P5GA 4CHQA 5EUHA 3MF5A 4RW8A 3MFHA 2R2RA 3NF8A 1CSJA 4EBEA 3D5MA 4Y1CA 4ZP7A 1FKPA 3KHGA 4GW6A 4QAGA 4CFDA 3ASMA 4CGFA 3FQKA 1FKOB 2JEIA 3RAXA 1SH3A 2ATQA 3K5OA 3NAIA 3AVCA 1JLQB 1VSFA 1NK5A 5HLFB 2FVRA 4CERA 2WCXA 4EP5A 4ID5B 3I0RB 5J2NB 1JIHA 1KHVA 3H98A 1UWBB 3AO5A 3NH1A 3B6PA 3OYIA 4FLVA 4CGJA 2JC0A 4TLRA 4O3NA 4OPJA 3FFIB 1WN7A 3ISNC 3L3VA 1NOYA 3VQ4A 3BR9A 1HRHA 4HHTA 4FLZA 4WYLA 2B5JB 4BE1A 4FJXA 2VWJA 4YFUA 4EO8A 4PY5A 3M8PB 1WSEA 1TKXB 1U4BA 3IN5A 5KG3A 5HROB 4MK9A 2R8JA 2AX0A 2XHBA 4I2PB 4KV8A 3BREA 4E19A 4Z4IA 4IR9A 3ZSVA 4BE2A 4IG0A 3DRRB 2Q3SA 1T05A 3L2UA 1IKWA 1HQEA 3V6HA 4LSNA 3MR3A 1NK8A 3HSTB 5I3UB 5L1KA 3V4IB 4CIFA 3CFPA 2XY6A 3KJVB 2W42A 4CJEA 4U6PA 3PHEA 4NCAA 3NBPA 3TWHA 3MXIA 1GOCA 5KFJA 2QXFA 4DL7A 1RDBA 5KFVA 4KHRA 3H5YA 3QIDA 2FBYA 4ZPAA 1JLGB 3OS1A 2VG5A 3RB3A 1TKTB 1LW0B 3NFAA 1IM4A 3AA3A 4EYHB 3DLGB 4DTMA 3RRGA 2AGPA 4CGIA 4FZXC 4KFBB 2V4QA 3QIOA 4NYZA 3VQQA 5F9LA 3OSNA 1HMVA 4ZVGA 4LQ9A 2HNZA 3HP6A 5KT7A 3O3GA 1NK0A 4FJIA 5KFOA 3G0ZA 4HVJA 4QWEA 4DG1A 3FQLA 4FLXA 2DPJA 3L2VA 1TK5A 1RT6B 4ZP9A 3QZ7A 1RT2B 2HHVA 1DLOA 2OZSA 3ZT3A 1NHUA 1ZBUA 3N6NA 5KRTA 4KSEB 4IRDA 3K5MA 4F3OA 1J5OA 4M95A 5L1LA 4NLVA 3G6YA 1C1AA 4PA1A 4DSFA 3QETA 2FBVA 2VA3A 4J9LA 4KKOA 4MK7A 1I3AA 4I2QA 2A1RA 1Q9YA 4H4OA 4YP3A 5J2QB 3C6TB 3OHAA 3NH0A 4NZ0A 3ZCMA 1IKXA 4XPCA 2HHXA 1TK8A 1N56A 3KD1E 3PR4A 4OKEA 2UUTA 2B43A 4DL6A 2W9CB 4F2RA 5KFZA 4R8UB 3OY9A 1S1WA 3SYZA 4ZVFA 2W8LA 4YR0A 3NCIA 4EBCA 4ZPCA 4CJUA 4Q44A 3KKSA 1VK0A 3AVKA 2ETJA 3HT3A 1XWLA 4ZHRB 2YNIB 1TV6A 4MIBA 1DTQA 3GILA 4B9LA 3H2LA 4DTOA 2CJQA 5KFYA 4B9UA 1REVB 4CFBA 2FC0A 5KRSA 3K58A 4MQ3A 3NGYA 4CHNA 4F4WA 2JGUA 4LD0A 3MTKA 3HPOA 4FJMA 4GC7A 4ICLB 3CWJA 5L1JA 3SUOA 5SZTA 4BDYA 3MFIA 2FBTA 4RW4A 2ITGA 2OPPB 1QSLA 5FRNA 3M8RA 4KHUA 2D0CA 1D8YA 4LSLB 4M3YA 5FDLB 2IGIA 3CFOA 4AHSA 2ASLA 5KFXA 3L3UA 4W5NA 2BRKA 2RKIA 2I1RA 4GVMA 2IM1A 3FDSA 4O4GA 2I5JA 3OYJA 4CJPA 3Q8QB 3DMJB 1LWCB 3AO3A 4R0EA 3NMAA 3O4QA 4F4ZA 4ECRA 2BQ3A 1VSHA 5KFMA 1S1VA 5F9NA 3ITHA 3DYAB 2YKMA 2BDPA 4ED2A 1LWEA 4TQRA 3LP2A 4O3PA 3LZJA 1RBTA 1BQNB 4E7JA 3MECB 3JYTB 1RTHA 3DLEB 4KE5A 1MU2B 1NKCA 4QW8A 2QKKA 3RR8A 3G86A 3UR0A 3TAMB 1RTDB 3MXJA 3MEDB 1TL1A 3M9MB 2VG6B 4E7LA 1TGOA 1R0AB 3QERA 1RBSA 4J2EA 4KO0A 4O5BA 3CJ2A 3QEWA 4BACA 2WHOA 2E4LA 1RTIA 1Z26A 4HUFA 4DQIA 1UA1A 2VWKA 1JXBA 5D3GB 1VRUB 4H54A 3PX6A 3E51A 2EC0A 1JLCB 1N5YA 4FM0A 2IMWP 2KZZA 5FROA 1U04A 2FVPA 1VSIA 4ZP6A 3NF6A 1HPZB 1K1QA 3NE6A 2GUIA 1T7PA 4URSA 4J9RA 5F8MA 1TVRB 5JUMA 2FBXA 1JLAB 2X6SA 1X9MA 3PY8A 2UUWA 2ILYA 3QO9A 4M41A 2BANA 2WOMB 4MFBB 1XHZA 3OVNA 1FK9B 3T19A 1TAQA 5CZ1A 3OYKA 4CF8A 1S4FA 3OHBA 1SV5B 3OYEA 3T1AA 4FZYA 3SFUA 2R8IA 4QCLA 3KHLA 1TAUA 1JLEA 1HNVB 2RF2B 4WFXA 4HUGA 2E9TA 3VQDA 4G1QA 2XI3A 3SI6A 4JV1A 5KFKA 1RT4B 4J9SA 4KHSA 1Z25A 5JS1A 3AA4A 4LY7A 1G15A 4WYWA 2KFNA 3AVJA 4E1NA 3SNNA 1D1UA 3NKYA 3VQAA 1C1BA 5HLFA 4I7FB 2UVUA 4CIEA 4DQRA 5KFNA 5EWFA 3VQPA 3AA5X 1SUQA 4C8LA 3GYNA 3IRXB 1RT1B 1CXQA 2PZSA 4QW9A 1RBVA 4ELUA 3FFIA 1S6QB 1WNSA 4PQUB 3AVAA 4URQU 2HWHA 4WZQA 5J2MA 1N6QA 2D41A 3KK2B 3M8PA 4TQSA 3VA3A 4KTQA 4RW7B 5J1EB 1TL3B 3LP0A 3IGNA 1LAWA 5KFLA 4I2PA 1S1TB 1RDCA 3D45A 5KG4A 4Z4HA 3MXMA 4J9KA 2QE5A 1B92A 3V6JA 1WNEA 4J9OA 4B9MA 3ULDA 3L2RA 5I3UA 3VN5A 2IM2A 2Y1IA 4FJLA 4MKBA 3I0SB 5DQIA 3KJVA 1TK0A 4IFVB 4B8CA 4DFMA 4FJGA 3QGHA 2F96A 4F4YA 2EHGA 1GX5A 4L8RB 5T7BA 5CYQA 3QEPA 1VSLA 5EWGA 2YNGB 3KIOA 3DI6B 1YVUA 3KD5E 3KLFB 3OL6A 2F8EX 3KHRA 3KMSA 4QPXA 1TKTA 5HBMB 1WSGA 4MK8A 1DTTB 4DL4A 4OGEA 1C1CB 2VA2A 1QSYA 4CF1A 3QGGA 1KFDA 4B8AB 4FK0A 3BGRB 2XWYA 1HQUB 2D3ZA 2IM0A 3LAKA 4FS2A 3UIQA 4CJ4A 4DF4A 4KAZA 4Y34A 4J2DA 1NKEA 2FJXA 4AHVA 5CYMA 5EU7A 1LWFA 1XI1A 4J9MA 5C42B 4JUZA 1RT2A 4FCYA 5KFTA 1JKHA 2R8GA 1N48A 2QV6A 2FLNA 4O3OA 3BQ1A 3RR7A 1RAJA 1QS4A 3HPHA 3CDEA 1LAVA 2G8VA 5DGBA 1S0OA 3GQCA 3RTVA 4KHQA 2AQ4A 1VSJA 3HP9A 4ECSA 2Z1HA 1CZBA 2W9AA 4N41A 4KHYA 1OS5A 2NUBA 3EY1A 4EBDA 4H8KA 3M9NB 4DTJA 5KFGA 5KFUA 3JSMB 1UAXA 2WONB 2D0BA 4DQPA 4DS5A 3BSNA 3GIKA 1BI4B 1VRTB 2HHQA 4HCBA 3NF7A 4CEEA 4CGDA 4O44A 4FJ7A 4K4TA 5KG1A 3C6UB 2P1JA 4TSXA 1RBRA 4DMNA 4OLAA 2IOCA 4IKFA 4PWDB 3V81A 1T3NA 2G8WA 3VQ9A 2HVIA 2KFZA 4E0DA 3T5LA 4NLRA 4ZMMA 4DQQA 5F8NA 4Y2CA 1S0NA 5EWEA 3SQ0A 2P51A 4ED8A 1O1WA 1RCHA 1JLBB 4O4RA 4CK3A 4FLUA 5HP1B 1VSMA 1QHTA 2HNYB 2OPRB 4E7IA 5KFSA 2B6AB 4BWMA 3MEEB 3DM2B 1LW2A 3SI8A 3TAGA 3QZ8A 1VSEA 4W5QA 4DU1A 1IKYB 4DTXA 3IAYA 1JLFB 4DTRA 3VQ5A 3ZSZA 4CJWA 3TR8A 3CJ4A 3OLAA 4AILC 1Z4UA 4MIAA 4Q45A 1KHWA 2GV9A 1S9EB 4KBIA 4N56A 3ZT4A 1C0TA 5FDLA 2HMIA 4OJRA 4K4XA 4NLDA 4BE0A 4YR2A 5DG7A 4NRTA 2XGPA 3SJJA 3DMJA 4UQGA 1KRPA 4CEDA 1KLNA 4K8XA 3CG7A 4HTUA 2V9WA 3WNGA 4DSEA 1WAJA 2D0AA 3V9ZA 1TKZB 4TXSA 3MECA 3JYTA 3CJ5A 2YNHA 3OL9A 4C8OA 3TAMA 3KK3A 2F8TA 3OYCA 3QNOA 2BR0A 1RT7B 3SUNA 1Q8IA 4RW6A 2RDIA 2IC3A 2DTUA 1RYSA 2IA6A 1BGXT 3MEGB 3ZSWA 3HHKA 1EETB 3CVKA 5K14B 4LH4A 3PV8A 3NDKA 4Z4GA 2ILZA 4U7CA 2YKNA 5D3GA 4TY9A 2PYLA 4MKAA 3LAMA 2JEGA 1NHVA 3AO1A 3QEIA 2PY5A 3M8QA 1S1UB 4IFYB 3HK2A 4FJNA 2HW3A 3K57A 4Y3CA 3DRPA 1S1XB 2R8KA 1XR5A 1TVRA 5EDWA 4JS5A 2XY7A 1W25A 2WK4A 3KKRA 1RNHA 2WOMA 2C2DA 1WSJA 4FBUA 1FK9A 1W0HA 1SH2A 2Z1IA 2XY8A 4B08A 3RB4A 3LP1B 2ZD1B 1HARA 2AX1A 1SV5A 3OJUA 4DWIA 3RWUA 1HNIA 3GIIA 5DLGA 3TABA 4IDKB 3H08A 3TVKA 4Z4EA 4Q0BA 3ZT2A 1S0MA 3LANA 4WZMA 1NK9A 3VQ7A 1L3SA 4KAIA 3KOAA 2HHUA 3QLHA 4WXWA 1KLMB 3KLEB 5KFIA 3ZSYA 4CJTA 1RT3B 3V9UA 4CJLA 4C8MA 4ZTFA 3OS0A 1HYSA 1BIUA 4IRKA 1JL1A 4HUEA 1S97A 4PUOA 3L2WA 1C0MA 1WSHA 2B4JA 3HM9A 3IS9B 4R5PB 4DQSA 2DFEA 2OZMA 4ED0A 2UVRA 2ZKUA 1QE1A 5DMRA 2ASDA 4FS1A 3GV5B 4M3TA 1J53A 5KGXA 4IKAA 1RT5A 4H4MB 2FLLA 1A5XA 2O4GA 2PYJA 1RDRA 4RZRA 3P5JA 3E01A 3SUQA 4B3OB 4PQUA 4DFPA 1BHLA 5I42A 3K59A 4RW8B 1C0UB 1YVFA 5DG9A 2W7PA 2ZQBA 5J1EA 1NNDA 1TL3A 4ECVA 2F8SA 3F73A 4B9NA 4FLTA 4IG3A 3RB0A 1L3UA 3G6XA 3NL0A 4NLOA 1YTUA 4RNMA 4DFJA 1S9GA 3DRSA 4NLWA 3EPIA 1T8EA 3KK1A
chains in the Genus database with same CATH superfamily
2QYGA 3M2RA 4IBNA 1IH7A 5KFAA 3Q7BA 3NCRA 2AKWB 4PWWA 5IC4B 4Y0WA 1WJ9A 1IN0A 2IDOA 3H6EA 3TANA 4XO0A 3N4PA 2B9XA 4ZLLA 1RA6A 5BYRA 4UT4A 1C6VA 3ZSOA 3WC2A 5IZHA 4JI2K 1FFSB 3DLKA 1F1BB 2NPIA 2Q1NA 1CPZA 3SQ1A 2KJVA 3ZT1A 2P9NB 2X1BA 4KV8B 1TYQB 2IM3A 4KTZA 5KFFA 4EK2A 2J9DA 4K25A 3CPEA 5A8RA 4YEAA 2KTQA 4XAKA 2UV8G 2HHWA 4FW1A 4M42A 4QWAA 5B0BA 4H5NA 4J9PA 3RMCA 4B1YB 2Q36A 4FNHA 3M6WA 3O1WA 1X60A 4RBVA 5DZ7A 3C95A 3KK7A 2D1CA 4CECA 5HRNA 2UVVA 5HO4A 3K2PA 3NCQA 3FZBA 2MY7A 1BDGA 5AQGA 4BVPA 2CGJA 2P9KB 2JEFA 3DHXA 4ZN3A 5J2PA 1TUGB 2EWSA 2N3OA 2B4UA 1VRTA 3T5JA 5DETA 5DK5A 5KFRA 1FJGK 2RN2A 4BRMA 2L9NA 1QM9A 2XO7A 3K5LA 4LF2A 2LLZA 3R5GA 2DITA 3RAQA 5EGYA 4PG4A 2HB5A 2G8UA 2QRRA 3UW1A 1FKOA 4A4JA 1SL1A 2D4WA 4ZJQA 4KHPF 4LFAJ 3TJAA 3L09A 3CQXA 1O51A 3HDSA 2OCEA 3IDHA 3FJ2A 4CJ5A 1ATNA 1YUWA 4KY3A 4H4OB 2R2SA 3M6GA 5E7OB 5J2NA 4Y2AA 4DFKA 2HOEA 2FHJD 3W62A 5BREA 3OXFA 2UU9J 1HKAA 4LR8A 4CI0B 3MCOA 3LWMA 5HSPA 4KI4A 1MMNA 2FY1A 4FZZA 5GAHI 3D0HE 4RU9A 3GG1A 4DR4J 1Z6RA 3J80Y 2LSNA 2AP6A 4CEFA 4FWOA 4YY3F 2M4MA 3VOVA 1FEHA 1DRZA 5BRFA 4Y1DA 2AYMA 3AA9A 3EE3A 1IVZA 1YX2A 2DNKA 2YKAA 4N5SA 4NL5A 2C28A 5AQWA 2CJKA 1M1HA 2KW4A 4A8WA 1TKZA 5M1FA 4LF5J 2GUPA 4CCHA 4DV6J 4C1NI 2O4IA 1CVJA 3CCUN 5ETVA 4RW4B 2K1RB 1YJ9N 3MEGA 5F8HA 1RHMB 3MR6A 1T3OA 1P8ZA 3WUHA 1X9WA 3DLGA 3MN9A 4KI6A 4ZPWR 4A8XA 3ZEUB 1OVQA 4O4GB 1UOCA 1WOSA 3O4NA 3K7RA 3CQYA 1S1XA 3CDWA 4FWQA 4CVNE 4OKKA 1RT6A 2R7XA 2NRWA 4FWKA 4KREA 1K0TA 2KHDA 3EGNA 5KT4A 3RSEA 3MM7A 2DNOA 5DDOC 2RU9A 2AEMA 1BUPA 4YOYA 4QS7A 4LJMA 1U24A 4CO2A 4BDPA 3LDLA 1VR6A 4GRSA 1F21A 4IRCA 4DSJA 1U47A 2HFSA 2DIUA 4JS4A 1YAGA 2AA4A 2AZ1A 3NVKA 3CSKA 1U8SA 2ROGA 5J2QA 1VI7A 3BM7A 2MXYA 2DH8A 2UUCK 3V1OA 1H74A 5AQPA 1S0VA 2FIUA 3HFZB 4XTTA 2KN4A 2ADBA 3M8SA 2J7UA 3RRKA 1SS6A 4XIUA 3O5BA 2Z8QA 4R8UA 4NMLA 4KH0B 4LH5A 3UDLA 4Q8FA 3MM8A 2P9GA 2JX2A 2RHQB 1IQZA 3MCAB 4O0JA 2G0CA 3CHWA 1FD2A 2YNIA 3B6BA 3L8BA 1JLEB 4NRUA 2PI4A 2HZVA 1C0UA 4CJVA 3PHTA 4J9UE 4XK8C 3VTIA 1REVA 3VTHA 5HMWA 1HNWJ 2YWFA 4FLYA 2QWLA 3FNNA 2CPZA 2LYVA 3C6HA 4WXOA 3BN7A 4LRFA 1QAJA 3C6AA 3I4PA 1U1LA 4BR0A 2ZH9A 2NSBA 4ECYA 2OPPA 3HSJA 2OO4A 1HNZF 4JI6F 2EBGA 3QYYA 3Q8SB 3OVBA 3NMUA 2O5DA 4JI1K 1J5EF 3BBBA 4C23A 4WU3A 3RW7A 2R2UA 1JJ2R 4M5DA 1CZ9A 2MKHA 1X1PA 2LDIA 3W3SA 4OYBA 4CEAA 1ZBHA 3MD3A 5GIOA 4IH5A 1TYQA 5AT1B 2MQOA 3ATUA 2A3ZA 4BR5A 2EFVA 4TN2A 3BY5A 1KC8O 2KDOA 1D8ZA 3KJNB 1R0AA 2WSFC 4NLXA 1ZBFA 1NZAA 4DF8A 2VV5A 3OTEA 1KVIA 4ZPVR 2V8PA 3S1TA 2DHHA 1F2GA 3P1GA 3B4DA 2MLXA 5DDRC 3I8DA 5AFUA 5KT2A 4A59A 1L3KA 3PNIA 2O8DB 3BSOA 4JKHA 3VGMA 1UCNA 3R5AA 4XH4A 5DQGA 1NM2A 1RBLA 4MFBA 4FJ8A 5KTQA 3CC4S 3MHYA 3CD7A 5CZXA 2DY1A 1CULB 1H2VZ 1BL3A 4LF7J 1X5OA 1JCGA 3OUYA 1EKRA 2CQPA 1ASUA 1Q7YT 2QKBA 3D4JA 2COLA 3LWLA 4OL8A 1NDLA 2H3GX 5BR8F 4CJRA 2RF2A 2E6LA 2HQFA 3DJCA 1IJJA 3N4QA 3TUIC 4XPEA 3Q23A 2UU9K 3QFWA 4L73A 2A41A 1UETA 5HQMA 2CDQA 1RT4A 2PA3A 3OFFA 3OLBA 3DLJA 4DR4K 2ZH7A 3MR5A 1A6LA 3FSYA 5ETMA 2ZM6J 3M1FA 3AGKA 1HJRA 3BKTA 3GCXP 3GB0A 4DR1F 1CXUA 2EK1A 4JEPA 2CRLA 4EI2A 2EFQA 2CAJA 3IGVA 2E9ZA 2RE2A 3MPYA 1UFWA 3CC2N 3L7OA 3IRXA 3Q8RB 1XN9A 1VQYA 5LJ3Y 3VEZA 2J76E 1S6QA 2P6SA 2IBKA 5CD4H 3UCGA 3QFUA 2ZZTA 3CETA 4E98A 1U09A 4IQXA 4LF8F 3L6QA 4BC2A 4LF5K 4ZVEA 1IR1A 1ELOA 3A3OB 5DG8A 1FKPB 4DV6K 4ZA1A 2ASMA 1X9SA 4J9QA 4NO7A 3CCMN 1RZMA 2O1PA 1PAEX 3U3YA 1KNZA 4ID1A 4OZ1A 3CCTA 4FPBA 1YZ6A 2RPIA 5D0GA 4KB1A 4Z0UA 1SH0A 4CK1A 2O8EB 1VRQC 4PL8A 1YTYA 4UOCA 3FZMA 2J6TA 1D5AA 4CYUB 2QGFB 2YNGA 4EU0A 3SIPB 3CMES 2G13A 5HBMA 2C3OA 2VICA 1UEKA 3VF4A 1Y3KA 2GHVC 1C0TB 2HMIB 4FJKA 3EZUA 4CHYA 2XGQA 4C97A 1WSIA 3HHLC 4ILLA 2YV0X 4RNFA 5F8LA 1TL7A 1VQOS 4LSNB 5AQRA 2HLUA 1R6YA 2BRLA 2BKPA 2Q97A 2P9LB 3FBBA 1NJIO 1T3VA 3MOZA 1E6YA 3OSPA 2AGOA 4IQMA 2HQIA 1K1SA 1S72N 5M1OA 2NLWA 4HYKA 3I9V9 2J8AA 4CNYA 4KBOA 3FRYA 3U8XA 3W65A 4TYAA 4QOZB 4GVBB 3OA9A 2WB1D 2YKNB 1CS4A 2I7NA 2C3PA 1HFEL 3BBCA 3H4BA 2RD5C 2P9IA 2ZJRL 1BI4A 3ZNJ1 2DNRA 3IRWP 1ZBLA 1XEZA 3LF0A 2VPYB 3C6UA 1TMMA 4OI1A 1HNWK 4W4MA 1HD0A 4X65F 1NGHA 3T7ZA 1OVYA 5AQUA 4CLSA 4DLEA 1VQ4N 1FVSA 4YB7A 2FGOA 2FJVA 2GJFA 4RPFA 2EVZA 1J5OB 1VQ7N 1WEXA 1KTVA 1P9YA 1NG9A 4Q0BB 3R9PA 2IIHA 3FE1A 5KG0A 3GMGA 1NJYA 2B6AA 1S49A 2UP1A 1GLEG 3DM2A 4YHHF 4GV6A 5A6WA 1WI6A 4CEZA 1SPBP 1X4BA 2VQEJ 5AFUH 2BTFA 1E3MA 2LP4A 1GOAA 3WXLA 4C3KA 2E5IA 3TX8A 4DX8H 4RWXA 3IR7B 3GJSB 3MDQA 1RBOB 3ZTSA 4G6VB 2HHSA 4LIWA 3O6QA 5AJ3J 4GMJB 3FR0A 3HF5A 4FWLA 5EX3A 3H1VX 3IA0A 3SQGB 1X5TA 4WQ5A 3ENWA 2BXJA 3JQJA 2BV3A 1GTEA 2RSQA 1WF0A 4K0KJ 4M45A 5ETPA 3OR2A 3PZPA 1RBUA 5L39A 4PKIA 1ICEB 4GMKA 3DXKB 2ZJRQ 2XSFA 1VQNN 4F04B 2BX6A 4I6AA 2KVQE 5F8GA 2KKHA 2ZNZA 3KK1B 1WKLA 4KTWA 1AZSA 3BJYA 1EETA 1RTJB 1YDLA 2QMXA 5K14A 5L9XA 3E9OA 2J0WA 3D67A 5JICA 3PW2A 2IRYA 3T1HJ 4CZLA 3DLRA 3H5SA 3TI0A 2W7OA 2EPIA 1S1VB 2IBOA 2E2NA 1MROB 4JKGA 1VQPS 4DU8A 4F26A 5GADU 2ZM6K 1FESA 4FJJA 3CJRA 1FF2A 3HHLD 3ZETA 4TY8B 2YWEA 5JLFA 3RMDA 2BQUA 4JBCA 4JI0F 2ZWHA 2DRBA 1EWQA 4OZ5A 1ASWA 1IJEB 3TQ1A 2C2OB 1R8HA 1XR6A 3QAUA 1VHXA 3DOLB 3CCSN 1JCEA 1VSKA 1K8AO 2BZ2A 4BR2A 1BCMA 5BXIA 1VBZA 3L7PA 4FYWB 3KDNA 4RUAA 1KOOA 3HJFA 4C11B 5HJXA 1YRXA 3IS9A 4KT0C 2G9OA 1VBYA 3UVJB 3P6YC 2MHNA 3G8QA 4WBFA 3WX8A 4G1IA 2Y8WA 3DOKB 1F6TA 1K47A 5CQGA 2HHHJ 2XQCA 4CF9A 4G1QB 4DR6K 1J6ZA 1Q9XA 3V1QA 5LMNF 2P5GA 4FNIA 4D3GA 3LDPA 2E5HA 1NNEA 4A2BA 3NF8A 1CSJA 2F65A 3MAHA 3D5MA 1FKPA 5ETOA 3CPWR 4QAGA 3JAMY 4CGFA 3FQKA 5K20B 2JEIA 2HGLA 2OHDA 2ATQA 1NDKA 3AVCA 3POTA 1JLQB 4ER8A 1DQAA 4YDXA 5IC6B 1TU0B 3NY0A 4IZ9A 1R0BG 3MI7X 1E4GT 2O8EA 1BD6A 4DR2K 3TA1A 4I6MB 1JMTA 2ZH4A 3VQ4A 3SMSA 3E66A 4BRQA 2B5JB 4BE1A 2VWJA 3M4XA 4GKKK 4X62F 2DNHA 3R97A 3NNHA 3VMFB 1TKXB 1U4BA 2I6WA 2QTWA 2MSSA 1UAWA 2Z4PA 4I2PB 3BREA 5MAOA 1AA1B 4USWA 4IR9A 3VF6A 1D3WA 1T05A 1V5VA 2Q3SA 1BWFO 4LSNA 3MMCB 1YJ9S 4RUHA 1UW4A 3CFPA 1NEEA 4NCAA 2AYEA 1QVFM 3GONA 3MMBB 4ISGA 1NAQA 1UWAA 3Q8VA 1JLGB 3OS1A 3VEOA 3CJQA 1IM4A 4JKCA 2NXCA 3CDAA 3R5DA 3FCVA 4DTMA 1EZZB 1U1MA 4CGIA 4L76A 2Z2YB 3QIOA 4NYZA 1N36F 2FZGB 5F9LA 4P73A 3OSNA 1O6XA 2ZWPA 2J0SD 1KQGB 2O8BB 4KHPJ 3J7ZT 2RU3A 4FLXA 2L9WA 1TK5A 1T0TV 2PC6A 1OQ3A 2ERRA 2HHVA 4XH1A 2OZSA 1QDUB 1VQ9N 2VQEK 3AHPA 4IRDA 4LF4F 4LFBF 3CB4A 3THYA 2PA8D 2MQQA 4F3OA 1J5OA 4M95A 3LH2S 1R8AA 4PA1A 2DGQA 2IRXA 2FBVA 3VEXA 4KKOA 4MK7A 4YY3J 3VZIA 2W01A 4Q2MA 1RAFB 2L3MA 4EUVA 2OD6A 3CJSA 1Q9YA 2GX9A 3KUGA 4YP3A 4W92B 4O0NA 3OHAA 3NH0A 2IHR1 2GIFA 4B3TF 4DCJB 4IEIA 2DTJA 3ZC4A 3C7NA 2W4PA 4NXNF 4AXJA 2GQ2A 2W9CB 4K0KK 1N5SA 3OY9A 4ZVFA 4IDHA 3GCWP 5IV4A 1JNZB 1U0HA 5ELZA 4Q44A 3KKSA 2SXLA 2YPYA 3AVKA 3HT3A 1XWLA 3EKSA 1LK5A 2FYXA 1DQ9A 1H0HB 5FPEA 4DTOA 1PYOB 3SQGA 2VFUA 1YXQA 1IBKF 3T1HK 3MTJA 3Q2SC 8AT1B 5A76A 4I64A 2VH7A 4A8QA 2Y8YA 4CFBA 3K58A 4MQ3A 3NGYA 1HWLA 4F4WA 2NXNA 3MTKA 3DXKA 1HBMA 4ICLB 5T41A 2DRAA 4HHHA 3SUOA 3PLAA 3HFKA 2FBTA 2KO1A 2ITGA 3M8RA 4KHUA 3N01A 1WC3A 3I32A 2D0CA 1N34J 1D8YA 4FWNA 3NWGA 5KFXA 1E6VB 5HN0A 2BJ3A 4GVMA 3FDSA 2I5JA 1NH8A 4KPCA 4CJPA 4LRBA 3DMJB 2FJEB 3T6JA 4H03B 1LWCB 4JKEA 4JOUA 3RG6A 3D6TB 4ECRA 1LKZA 5AXMA 1S1VA 4HACB 2UV8A 3SCJE 1SC6A 2LU1A 3UR3C 4TQRA 3LP2A 3LZJA 4LR9A 4DV1F 3TU5A 3MECB 1RTHA 2OMLA 2N3LA 1MU2B 1NKCA 3RR8A 3TAMB 2YJFA 1X4DA 3MEDB 2VG6B 3C46A 4BRGA 2WHOA 1MSWD 2FJBB 2OMOA 3U7JA 4DQIA 2CWXA 2R42A 1JXBA 5D3GB 4R79A 3DAWA 1M5OC 3ZZYA 3E51A 2XULA 1RKJA 4CLYA 1JLCB 4CBUA 2IMWP 2P9CA 4H0PA 1ILYA 2ZH3A 1HPZB 3UD3P 9RUBA 3NE6A 2IVYA 4J9RA 5F8MA 3BPDA 3DN9A 3J7Z5 2MGZA 3PY8A 3M05A 2ILYA 3S7RA 4C11A 3FZFA 4JI8F 3OVNA 2WBMA 2VFVA 3OYKA 3HLUA 3R3LA 3VESA 1TL4A 2EFGA 1SV5B 3OYEA 4CLTA 4LBIA 3T1AA 4JI5F 3W66A 1OWXA 2V8HA 2XNQA 1EQ0A 2JJ4D 3W5ZA 1I3OB 4G1QA 2P9SA 1N0UA 1K9MT 4JI6J 3C16A 2MQMA 4K5RA 2H51B 5KFKA 3GSIA 4KHSA 2VBWA 1W26A 3CC2S 2E66A 3SCIE 4DV5J 2QMWA 2HQDA 1X9JA 4E1NA 1C1BA 2C2KB 4I7FB 4DR7F 1K8KA 4EMDA 1FTCA 3JQKA 4CIEA 1S79A 3HZ6A 1OIAA 1G2EA 2XHWA 3VQPA 3TSUA 1MMDA 2MZJA 4C8LA 2APOA 1CXQA 4I6MA 2QL5B 1GH8A 3GJRB 1XERA 4MO5A 3CCMS 1X31C 1R27B 3IBFB 2XB2D 2NXEA 1SIWB 4WZQA 1U2VB 5J2MA 1N6QA 4BREA 3KK2B 2BUPA 2CPDA 4LFCF 1KVKA 5KFLA 4I2PA 3NGUA 5A2QO 1S1TB 1ZC6A 2I8EA 3TX0A 2PGCA 2XHCA 2WTUA 3FGUA 1B92A 3GE9A 1WNEA 3ULDA 4EIAA 3L2RA 2IM2A 1Q7LB 5BYSA 2C1EB 3I0SB 5DQIA 2GQCA 4KHPK 4DFMA 1QZ6A 1GX5A 2WVBA 4DCOB 5HVFA 4FOIA 3DI6B 3IFEA 3CJ9A 3KD5E 3IR6B 2F5GA 2F9TA 1S7HA 4QPXA 2GWJA 1WSGA 4HL9A 4BROA 1HR0F 2MHEA 2WVDA 4CF1A 3M1VA 1KFDA 1F9EB 2XWYA 2IM0A 1S72S 3UIQA 1OY6A 1OO0B 3UD5A 4OX7A 4G9ZA 2HRYA 3D9BA 4P6QA 4Y34A 4YY3K 1RGIA 3NGSA 4IYQA 2DR6A 1LWFA 4C3LA 1BUXA 4A8MP 3VGLA 3BEGB 5DO2A 2VL1A 2E1YA 2YX4A 3BBFA 2R8GA 1N48A 1GMVA 3MCSA 3BQ1A 3RR7A 1RAJA 4U7UD 1X4AA 3HPHA 3PKMA 1S0OA 2O8CA 5D4NA 1VSJA 1CZBA 2A2DA 4KHYA 2B4VA 2H54B 2ZDOA 2QM1A 4H8KA 3M9NB 2ACMA 1VQ4S 2MJUA 3QWUA 2WZ1A 1ZXOA 2D0BA 3MPWA 2WW8A 4DQPA 4DS5A 3GIKA 1VQ7S 2VFSA 3BZQA 3HHLB 1Y10A 4HCBA 3NF7A 4CEEA 1S6UA 3THWA 3JXUA 3ZLJA 2P1JA 5E3QA 4U7UK 3CE8A 2HRUA 4PPZA 1YWXA 1T3NA 1RHQB 3SCLE 5IT9Y 1FRLA 3TYTA 4Y2CA 1MLAA 2IPOB 3LDQA 5GAGU 4ED8A 1O1WA 1JLBB 4O4RA 4FLUA 2QSFA 3G96A 5K8OA 1N34K 1VSMA 3W5YA 5KFSA 3MEEB 4NE9C 1IR2A 2AP1A 3O08A 1FJ7A 5AR0A 1W7WA 3IAYA 4BRDA 3N9UC 2HIQA 3PYDA 4CJWA 2CNLB 3OLAA 3ZXWA 1NSAA 4IJNA 2Q66A 1S9EB 4KBIA 4K4XA 4FYVB 2VFTA 2V51B 2DH7A 3MEKA 3A5LC 1GMWA 1VQNS 3I9ZA 3DMJA 2JNJA 3MCMA 4HTUA 4DPYA 4EHTA 1NH7A 1IQTA 4DSEA 5A8WA 3MGJA 2DR8A 1HIYA 1C0FA 3V9ZA 3MECA 4H0TB 2VKRA 3CJ5A 2OUGA 3OL9A 3TAMA 3KK3A 1TUUA 2O01C 3QNOA 2BR0A 3G6ES 2RH3A 5T7LB 1RT7B 2MQ8A 3R7BB 2EFNA 2VJUA 2IC3A 1RYSA 3HHKA 4X65J 4FF3A 4USKA 1OQ6A 3PV8A 4M63C 1P90A 5D3GA 2CNOB 2LQBA 1NHVA 3P4IA 3N0VA 4OMFG 3HK2A 1M5VC 3W2VB 2KRRA 1HBNA 5IM0B 4JI6K 3HSDA 1WC0A 3QNWB 1W25A 2ZVIA 4EGLA 1RNHA 4YHHJ 3RZAA 4WP8A 2QLBB 2JFDA 2C2DA 1WSJA 2Z1IA 1SH2A 3ZZTA 1AT1B 2CPJA 4E1JA 3CCSS 3LPYA 2LQ5A 4DV5K 1RHUB 4WIIA 2AX1A 1SV5A 3RWUA 1HI0P 3TABA 4IDKB 4HT5A 1KXPA 3H08A 4Z4EA 4DDFA 4BRNA 3SXLA 4KAIA 3W64A 3ENQA 1U2CA 1Q82O 1TFYA 1KLMB 2Z30B 3ZSYA 1FDDA 4CJLA 4M5HA 4ZTFA 3OS0A 2K8GA 2NZ4A 5D4LA 3CUNA 1GLBG 3CJKA 4Z7YA 4XH5A 2MKKA 3FGVA 1WSHA 2B4JA 1VHFA 4FDFA 2EFPA 1YKWA 2DFEA 1QE1A 1VQ5S 4ZPTR 3BEXA 3ULEB 1Q5YA 1M5PC 4OHXA 4OIXA 4L74A 2GNKA 1A5XA 5AE3A 2WC9A 1WTBA 4QIVA 5I42A 5CXTA 1YVFA 2GHPA 3PSIA 1U1QA 1YJNN 2W7PA 1X0PA 3UN3A 2BBEA 2V8VA 5JLHA 1PJ5A 3RB0A 3VGSA 4ZLNA 4NLOA 1WORA 2V2VA 4DFJA 5CCMA 3DRSA 1UVMA 4A57A 3TNVA 3CCRN 2V34A 3W9JA 3V6DA 1U45A 2JZ5A 3MN7A 2KYZA 5L1IA 3GIRA 5T14A 3GV7B 2XMWA 3PRDA 2GAGC 4DR1K 1W7AA 1C2PA 4LQ3A 3D0GE 2KL8A 4CLZA 2ALYB 2XZWA 4ZPDA 4JI0J 2D3UA 1U7LA 2OTLN 2PFUA 3TAEA 4BC4A 1JK9B 2HK3A 2YNFA 3BUZB 3H2UB 3OYNA 2ZE2B 4MYTA 2LA6A 4QQBA 3R6GB 4IG0B 5F8JA 4LF8K 2E9RX 1HQEB 2AEFA 3ATVA 2B8PA 3HD2A 4ZCMA 2VB6A 4DV2F 3BGLA 4ECUA 1VC6A 1MMLA 4ENOA 4FBTA 4RJVA 3AA8A 3KLGB 4DS4A 3PXGa 4FYDA 2OH2A 3KNAA 4YDDB 4PXBA 5D77A 3ISZA 2EW9A 2IJNA 4CF0A 3ILLA 4ANEA 3OYMA 3PM9A 1PJ7A 3VA0A 3HXMA 3NMRA 1VQ9S 1VIOA 3TAQA 5F2RA 4EFAC 3H59A 1YK9A 3OYLA 3MUTP 4DG1B 2HNDB 4X4NA 1CJUB 2YTCA 2AMCB 4DMZA 4M3WA 2X1AA 4YDUC 3SZ2A 1EX4A 3PO4A 3UKRA 5EXWA 3F2KA 4CEOA 3R1LA 4YN3B 1CQMA 1UP1A 5K5MA 1KAXA 3U3GA 1J9AA 3SCKE 2WVFA 1XC3A 1ZETA 3M6XA 3TAPA 2MQPA 1S59A 3T9NA 3A8YA 4ID5A 1JX4A 1WI8A 5ITHA 3ZX3A 4OZLA 2PI5A 4K4UA 5KQDA 2OYQA 5ETNA 1Q8KA 4CD1A 2M2BA 2YQ0A 2M9KA 1RDUA 1M1KO 1N88A 3RBEA 1M90T 2ABYA 3KUEA 3HHDA 3N5FA 3DOMB 2A1SA 4FK2A 1V3ZA 2ZKTA 3AJ1A 5KG2A 3M8WA 3RB6A 3KG1A 1SQFA 4G3IA 2HBMA 4CEQA 1S9EA 4RNOA 3EGWB 3NS6A 4H0YB 4QBUA 4DUYF 1U49A 4LMZA 2KXHA 2PT0A 4JV5F 1NGBA 1IKVB 4I6YA 2PIIA 4X65K 1RA7A 1VMBA 3A8EA 3HJVA 3DRRA 4NLPA 4O3RA 2W24A 1NK4A 3FLCO 3J80U 1LXJA 3V4IA 2R7UA 4Y2KA 2BJEA 2ZNYA 1NK6A 3KWGA 2YWGA 4P2XA 3X3UA 1T6DA 4OZJA 1RT7A 1S48A 2JRSA 5A8KB 1RAAB 5AQYA 4YHHK 3P5TL 3HL8A 1FRHA 1ATSA 3AVHA 4Y2MA 4OJ1A 3IBCB 2UUCF 2OPQB 2UYTA 4Z4CA 2AJ2A 4C0HA 3J81j 5C5JA 5JS2A 5AQNA 2NR0A 3HVRA 2AJ0A 1Z2ZA 1O13A 3EZOA 5KFEA 3W2VA 2AIRB 4RUCA 4ED4A 2VYPA 3PO5A 1LWEB 3F9KA 4ZVHA 3Q2TC 3M6VA 2IVPA 4ITSA 2XMTA 4QR0A 5LJVA 3O4WA 4URGA 5IT4A 2ZC4A 4NXNJ 1TL1B 1PC5A 4YB6A 1RADB 1EAYC 1ZTTA 4IDKA 5KPTA 2KH9A 3PYEA 2ZZNA 5GAHP 1GXLA 5HL7L 3O80A 1N5YB 2RJZA 4FM1A 3C6TA 3I96A 1R8CA 2QTDA 4IOCL 1VIXA 1NM1A 1GXUA 2KI2A 3D54A 4E89A 3SPYA 5K8PA 1IBKJ 4CJ3A 1SQEA 1OKJA 2JEJA 3C15B 2AJQA 3P49B 2YPZA 2Z58B 2E5JA 3HD1A 4Q5VA 2QL9B 4TNOA 3OTOJ 4MO4A 3BKUA 4ZHRA 3E2EA 4M3ZA 3M7VA 2W7AA 1TP7A 2KXNB 3U6FA 5DM7L 4PL7A 3L0QA 4B1UB 4R25A 3EVWA 4YQWA 3VQBA 1NUEA 4C48A 2XZDB 4MLHA 2D0OA 1RDAA 4WFNL 3M30A 4KRWA 4ZPBA 4X4TA 4OGCA 4JI0K 3H90A 2WTFA 3RAMA 1FERA 4ZK7M 3RYLA 2F40A 4USUA 2W2NP 1UVKA 2YKOA 1LK7A 4ECXA 1ZBTA 1S4EA 1S10A 2VUGA 1PYSB 3L4IA 4JLHA 1IWAA 1YBAA 1WLJA 4NLSA 3CM6A 4DI6A 4LSLA 2VZ9A 3MN5A 1SJ1A 4DN0A 4DPUA 2UXDF 1OPIA 3ZSRA 5LT5A 4NLCA 4JHDA 2RS2A 2K2PA 3DNCA 3S3MA 4LFAF 3QMLA 1EWRA 5LL6Z 3DYAA 5HL7Q 2DXDA 2ZWOA 3KKFA 2ZE2A 1BQNA 3R7NB 4J9VA 4FLWA 2M5YA 3QFPA 4IOCQ 1RTDA 3QNNA 4AL7A 4NLGA 3G9CA 4RX6A 4OVLA 3KWIA 4H5TA 1RFQA 4JI8J 4QWBA 4PYAA 5DS7A 2V4RA 1X4EA 1LCUA 3LDNA 3I5BA 4OYMA 3ILJA 4P52A 4JI5J 5CYQB 1WSFA 3KLGA 3UCZP 2CQGA 2RB7A 3UDEA 3I33A 4W5RA 5KG5A 1JLAA 2ZH5A 5DLFA 3VQCA 3CFRA 3AJDA 1H6KX 3GWCA 5A6PA 3O3FA 1T9YA 5AXNA 5AZIA 2AEJA 4NI2A 2P9UB 4X62K 1BISA 3QICA 2HNDA 4UOFA 4ZTJA 2Y3YA 3VGUA 2QWPA 2CQ4A 1NGCA 3QGIA 5KT6A 2F8MA 1HNVA 1JKHB 1FEEA 2CJ9A 4F4XA 1TQLA 4ELVA 1URRA 1LFWA 3LZIA 5GADP 2HURA 3RU0A 3X1LB 1BCOA 2Q3PA 1S57A 2X74A 4OYOA 2P6TA 4RW9B 5HJYA 3FZHA 1RWKB 1CJTA 1X5PA 2CZ4A 1PO6A 1RWNB 2N4DA 4LFCJ 3NGRA 2XBPA 2HQ3A 2DKOB 1CBKA 2CH6A 1XTZA 2H1YA 4Q8EA 1IG9A 4PKDB 1RT1A 4CM2A 4O44B 4ILJA 4KHMA 1JWWA 4F2SA 5C10A 4GVLA 1AYEA 5B7WA 3H40A 4C4WA 2GMJA 1JXLA 1DZ5A 5HRPA 5D78A 4ED6A 2F1FA 4IR1A 4J2AA 4ISFA 1KONA 4B1WB 5KOWA 4DQ8A 4C8YA 4PG7A 2IVFB 2RHKA 1N0VC 4RW7A 5KFBA 4U8YA 2VQFF 3QT8A 5BRDA 2X6NA 2MJNA 2YQ3A 3BGFA 3QATA 1IKVA 2HWIA 4Q43A 5KFDA 4LF4K 5LXYA 1HR0J 3H4DA 3A8KA 3T9ZA 1OPZA 5CZVA 1NWKA 1QLNA 1HWJA 4HI2A 2A18A 2VPZB 4GV3A 3I31A 3CMQA 1BHNA 3VF2A 1H7XA 2DNYA 3THVA 5KT3A 3MM6B 4X4RA 3QBXA 1ZOTA 4TKTA 4I9LA 2FXUA 5BPNA 1NPRA 2OPQA 4MYUA 2JLFA 4NXNK 2FSJA 2ZJPL 2R7TA 3AT1B 1FXDA 4IH7A 1HQUA 3TVZA 4CK2A 3A8JA 3EXYA 2POKA 3UNYA 3KMQA 1WF2A 3ENAA 3CIZA 3ISND 3S6EA 1W9HA 2EXUA 2J9CA 3DDKA 4QWDA 2LCWA 3EDRB 3PKYA 4KQZA 1SQGA 2FVCA 1RHKB 4B9SA 4QIEA 1WG5A 4ECTA 3K8VA 3D2FB 1IM6A 2V5HG 3QEVA 1IBKK 4ED1A 1NGEA 3MD1A 3I87A 1W2IA 3ONQA 3QT5A 3EVOA 2A42A 1WC5A 3DC2A 3D28A 4ZKAA 4LBPA 5DGAA 4DN9A 3K17A 3JSMA 3RBDA 2HNZB 1AFJA 3WX4A 2G2OA 3F0NA 4C8NA 5EX0A 3GDQA 3LDOA 3H45C 4KHNA 4BVOA 3MDFA 1IG8A 2NRZA 5IT0A 4M94A 3C2PA 3C15A 4ID8A 4PWDA 3HYFA 4O55A 3MR2A 3CD0A 1FDBA 4TYBA 3JTNA 1R6VA 2HVZA 5HP1A 4F8RA 1Y5NB 3PW7A 1WWHA 3BQ2A 3BP8A 2OPRA 5EVZA 2ZJPQ 4NYFA 3OYDA 4P10A 3OR1A 1HYSB 4FXVA 4PUOB 1KWMA 2B4PA 3EE9A 4LF7F 1JLFA 3HO1A 4USIA 3LGHA 3CJ8A 1UFKA 4HHJA 5LL6d 1YJNS 3QMQA 1KVBA 3A2FA 3LPTA 2YY3A 1NKBA 1RT5B 4JI8K 2C3YA 1WUAA 1UA0A 3T41A 2C2EA 3PR5B 3WZ0A 3KNGA 2AGQA 2V8DA 4IOAL 4JI5K 3RGIA 1K6YA 2EX3A 3B8AX 5KG7A 2ATLA 5FPMA 3TEHB 4IG3B 1Q1KA 4ZN1A 3D1HA 1JJ4A 4CZJA 4J9NA 4OI0A 3M2RB 1F60B 3K9JA 2VDHA 1J27A 1KOHA 2FSKA 3OYGA 3S3OA 1EKSA 2ALZA 4DSKA 6AT1B 5GMKa 3AVIA 3W5XA 2RKIB 4O3SA 1LQ9A 1WBDA 1HNXJ 4X2BA 1P1TA 1CLQA 3GG0A 2F9JA 1SXLA 4N47A 3DLKB 2FLPA 2EWHA 5AQOA 2KZMA 4CE9A 3EN9A 2CPYA 1TMJA 4PAAA 1DBDA 3OBWA 1RWXB 2OA8A 3LP3A 1PG5B 2HSTA 2P9PA 5A8RB 1QTMA 2HFVA 1ZTWA 5M2PA 3UDVA 3IFRA 2FZKB 2R7SA 4LFCK 2CADA 4LF9F 4OI2A 1GOBA 3SK3A 4K4SA 2JWKA 2GELA 2F9DA 2OFHX 5SWMA 5DJBA 1L5UA 1TELA 4RW9A 3CIMA 2NXJA 2OFGX 3C8YA 4UZBA 4EWTA 4CNZA 1G4CA 2D9OA 4QU6A 3VQEA 1K8AT 4IOAQ 3BDPA 1UZDA 4ZVRB 3BGOP 1VQ8N 4NA2A 5J2PB 1SZ2A 3V9SA 3QRPA 3SSRA 1HR0K 5A2QY 1RHRB 5KI6A 4CWBA 5BPMA 4A47A 1H98A 2KFYA 4FJHA 3WXKA 1K0VA 2XZTB 3UQSA 4H4MA 3CPWM 3BPSP 1T9TA 6FDRA 4F0HA 1U2RA 3LPUA 4CHQA 2R2RA 4Y1CA 2RNEA 4CFDA 1YG0A 5AQMA 1IR0A 1FKOB 4YOVA 4EAHD 3K5OA 2KT5A 1VSFA 5TKYA 5HLFB 1DFDA 2FVRA 4CERA 3FK4A 4BCAA 2AYGA 5J2NB 4EFHA 1JIHA 4PHTX 2Z2ZA 4UY85 3H98A 1X7VA 2IA0A 3AO5A 1T9XA 3NH1A 3B6PA 4G65A 3OYIA 2ZF5O 1WSRA 4B3SJ 3KDOA 1WN7A 3JAMU 2FPHX 1HRHA 4FLZA 2ZBIA 4FPRA 4DV2J 4YFUA 4NYOA 2QWMA 2EK6A 4FKXA 1YLXA 3VR1A 1WSEA 4OO1J 3IN5A 2FD2A 5KG3A 2VBZA 2R8JA 2AX0A 2XHBA 3RUBL 1VCTA 1LXNA 2HPUA 2BE9B 3ZSVA 2Q31A 3GL1A 2HGMA 3V6HA 4GKJJ 3SBGA 3MR3A 2G2YA 2V2ZA 2JH3A 2LA4A 2RMLA 4LVOP 4CIFA 3O8MA 3AH6A 2XY6A 4QIGA 2W42A 2MZSA 2OEKA 2DNMA 5IXUA 2VWBA 4U6PA 2QJ3A 3NBPA 1VHIA 2UUAF 1RDBA 1KAYA 2QWNA 5KFVA 1SJFA 4KHRA 2A5XA 3QIDA 2FBYA 2O8FA 2V8GA 5AJ3F 1BG3A 2VG5A 4M5JA 2VGNA 2DVIA 2BOAA 2RT3A 3AA3A 3DLGB 4L3KA 3FMBA 3RRGA 2XYHB 1UPMB 1URNA 1HMVA 4K0KF 3WEEB 4ZVGA 1PIEA 4HTLA 2HNZA 3O3GA 4PG6A 4QWEA 1U1PA 4P71A 2I2YA 2L08A 1RT6B 3QT7A 1RT2B 3HI9A 3ZT3A 3RSEB 2UXCJ 4RLEA 2QLFB 1JJCB 4PKHA 1U6BA 4DB3A 3K5MA 2KYXA 2MYFA 4BG8A 2A0FB 3T1HF 3U02A 3G6YA 1C1AA 4DSFA 3CCEN 5BJRA 4B1VA 2EKNA 4I2QA 4M63A 2A1RA 5D8HB 4DUYJ 2J9DE 1WACA 3M32B 5J2QB 1HL6A 1IKXA 2HYIB 2HHXA 1N56A 2ZDPA 1UKUA 4IFEA 3VAFA 3QWPA 2UUTA 1QY7A 2Q2RA 4F2RA 3EL2A 3GJQB 4R8UB 3G71N 1S1WA 3SYZA 3MM8B 3IWLA 3WIVA 3K0SA 4CJUA 4OJHA 3R8YA 2LQ8A 3VEWA 1ZM3A 5JJBA 1VK0A 2YNIB 1GLJO 3ID6A 2K06A 4B9LA 3OD2A 3H2LA 5ETKA 3BF4A 1R0CB 1RQ0A 3J7YU 3ZTPA 5E2QA 1REVB 4J8FA 1HNXK 1BQXA 5KRSA 4ZOSA 4UQTA 4LD0A 4X4UA 3G2XA 3BF1A 5GAGP 3TUZC 3CJCA 3HPOA 4FJMA 2DCUB 5L1JA 3OXGA 3MFIA 2HHHF 2A6OA 2LU2A 1QSLA 2OPPB 1Q18A 5FRNA 4IJAA 2W2OP 4I68A 1DQ8A 2IGIA 2ASLA 3L3UA 2V7YA 2RKIA 2I1RA 1IWGA 1IUJA 4M5DB 3AO3A 4R0EA 1MWKA 5KFMA 2PO4A 3ITHA 3D2EA 2BDPA 2RRNA 4ED2A 1OY8A 1EJ7L 2KHOA 1XMBA 1RBTA 2H3EB 2K3KA 1DGKN 2JHEA 5AQXA 2GJ2A 2ZVSA 3DFEA 4FKYA 4E7LA 2CQ0A 2BUNA 1TGOA 1R0AB 2H65B 4J2EA 4KO0A 4O5BA 2ZOMA 3CJ2A 2E4LA 3ZTRA 1Z1ZA 4H54A 3PX6A 2FVPA 4ZP6A 3NF6A 2ZZMA 1NSQA 2V50A 4URSA 2DR9A 1D09B 1B3TA 3QO9A 4M41A 2BANA 4MFBB 1U8WA 2QW9A 3T19A 1TAQA 2DGWA 9ATCB 4CF8A 1DARA 1S4FA 4Y00A 3OHBA 3KG4A 4V19S 1PSDA 4LUBA 4FZYA 3AQPA 3SFUA 3OUYB 2J0QD 1HKBA 2FSNA 1VBKA 1REGX 1T6CA 2RF2B 2Y9HA 2XI3A 3SI6A 1EHWA 2W40A 4FF1A 4B3SK 4LRCA 1RT4B 2DGSA 2UXDJ 3O6WA 2EG1A 1BA0A 3MPUB 4JYAJ 4DV2K 4UOGA 4PYDA 3FCHA 3AVJA 3I6PA 3NKYA 3VQAA 5HLFA 5DDPC 3MMVA 3QT6A 2V69A 3R2DJ 2CQ1A 3OBIA 4ZVQB 5KFNA 4LVNP 2CG8A 5RUBA 1SUQA 5K8NA 3IRXB 2HEKA 4KH4A 4QW9A 1S6QB 1OMSA 4OZ2A 4N8OA 4R0JA 1SC1B 4OJGA 5IOLA 4TU8A 2MDAA 4KIAA 1H7WA 4YDUA 3OTBA 3UNGC 3LP0A 3IGNA 3BN4A 3SEOA 2DISA 3LOUA 1RDCA 4CH1A 3NGKA 3QSYB 3V6JA 4JK8A 2OIHA 4J9OA 4B9MA 3VN5A 4FJLA 4FYYB 5IT9O 1TK0A 1R3NA 2ZHBA 2F96A 2LXUA 2MKYA 4L8RB 1RI7A 1NBEB 5EWGA 2YNGB 5D0HA 1TTHB 5ETTA 1HHQA 3O9UA 4DKWA 5HBMB 2CPXA 4DL4A 1OH5A 1QSYA 2H4YB 4FK0A 4BHQA 4DR3F 1EX8A 3CF5Q 4FS2A 1CG2A 3WEEA 1ZS6A 1TL7B 1WHXA 5FLXO 1NKEA 2FJXA 4WU2A 1N52B 5CYMA 1DAXA 3KWMA 4WF9Q 5C42B 2WW4A 4F0KA 4DUYK 4CO0A 5CD4A 1RT2A 4JV5K 4A8SA 1UJ5A 1E6YB 3IR5B 2H5JB 2QV6A 4O3OA 1N34F 2UXBF 1TL5A 2AT1B 2G1HA 4M7YA 2G8VA 5DGBA 3GQCA 3RTVA 5KAKA 2AQ4A 4GO7X 1G7CB 3HP9A 3SAGA 1NLKL 1HA1A 2W9AA 4N41A 1OS5A 4AUKA 2NUBA 4OV6A 3MR7A 4M7XA 2GQQA 1CS4B 2IMOA 1N54B 3ZFVA 4DTJA 2VQFJ 2IRUA 5KFGA 5KFUA 3M32A 5U47A 2P9IB 1CEZA 3R1HA 1BI4B 2HHQA 3R1XA 4A61A 1ATRA 3E8OA 4FJ7A 3S8SA 5KG1A 3C6UB 3PRBA 1GAOA 3GSDA 4IKFA 1DEJA 1SJRA 4NEYA 3V81A 1QQOA 3O1BA 2G8WA 3VQ9A 2HVIA 2W4DA 2KFZA 5BPLA 1S7IA 4ZMMA 3FBFA 4DQQA 3CCJN 1RGVA 3SQ0A 2P51A 3JB9k 1RCHA 1SJ4P 1BWEA 3OW2R 1RTZA 2HNYB 1QHTA 4OHWA 1VLYA 1Z2LA 2B6AB 3DM2B 1LW2A 3SI8A 3CJBA 1ZAVA 1VSEA 5IT9U 3F56A 4HLBA 4DTRA 2A6AA 3FMWA 3G8SA 3ZSZA 3WC0A 5KPZA 4BR9A 4AILC 4CTAA 2CJXB 2V2KA 1Q5VA 3A12A 2GV9A 2HFUA 1XNQF 2E5LF 4OJRA 3NG8A 1QQNA 1XK8A 3DCAA 4YR2A 4DXLA 4B3RF 4UQGA 2E1ZA 5M1QA 4BY9C 2VGMA 4DV5F 1Y5LB 4QR2A 3SLCA 2V9WA 2DPNA 3ENHA 1B70B 3C14A 3OR2B 4K7QA 3IAS9 4WYBA 2GEMA 1VQKN 2YNHA 3CJ7A 5EY4A 2YX6A 5E33A 3B4MA 1CLFA 2QZ8A 4CLUA 4V19X 1NRKA 1Q8IA 4RW6A 2GS8A 2WUSA 1AZSB 1BGXT 1GLDG 1EETB 3CVKA 5K14B 5C0YA 3NDKA 4USHA 2KT2A 2Y1LB 3TZYA 2PYLA 3PIPL 3L7UA 3AO1A 4A8YA 1FXLA 3M8QA 4FJNA 3K57A 3GFHA 4P2FA 1HKGA 3DRPA 1LOUA 2HZAA 1XR5A 5EDWA 3GLJA 4WTYA 4XEIA 4JKGB 2UXDK 4OI6A 1VFJA 4OLPA 4FBUA 4ANDA 1W0HA 3LP1B 2OTJS 4AT1B 5F3ZA 2ZD1B 5LSRA 2MZ1A 4LFAK 1F5CA 4CD3A 3ZETB 1HNIA 3GIIA 3MUMP 5DLGA 3QAEA 3T69A 4NYPA 2GWKA 3P3DA 1SJQA 1WC1A 2MB0B 3VAHA 3PJ9A 5CYJA 3A8IA 4WZMA 1VS3A 1FKAF 3KOAA 3QLHA 2CQBA 3O2IA 1VQ8S 2YWKA 5KFIA 1GLCG 4CJTA 1RT3B 4JKAA 3V9UA 3A13A 4C8MA 1Q4RA 1KKHA 3D0IE 2MMYA 2V9KA 4CZCA 2RS8A 1Q82T 3L2WA 2W4CA 1IBLF 4FWSA 3TA2A 2F9WA 4CO4A 3IS9B 1EARA 3G4SN 4ED0A 3W60A 3J7A1 3DHWC 4FS1A 3LM2A 1B7YB 4M3TA 1J53A 5KGXA 4KH6A 4PXEA 2O4GA 2PYJA 3E01A 3SUQA 4B3OB 1SB6A 4PABA 4DFPA 4ZVOB 1BHLA 3OHRA 4A8KA 3PIPQ 3VAMA 1NGAA 1UVIA 4NASA 3L3CA 1NNDA 4OX8A 2CQIA 4FLTA 1GMWD 4USMA 4J37A 3JS9A 3AB2B 1VISA 3NL0A 3POTB 1S9GA 3HOSA 1HX1A 2H5IB 3EPIA 2RUSA 3KLIB 5I9EB 3AVBA 5HQ8A 1U26A 4EYIB 2CGKA 2UUBF 2Q0RA 3O44A 3THXB 3KJFB 4ES2A 1H73A 3PIOL 2LMIA 1U48A 4LF9J 4HKQA 5D15A 3KTQA 3PW0A 2E20A 3GFYA 5AQKA 2DGUA 3AV9A 2QEXN 4NLTA 3F9MA 2XCAA 2VBXA 3UKUA 2Y1JA 2W9BB 5H9EJ 3B78A 2YI1A 2B9EA 2E29A 3ZSQA 1I1GA 4I4BA 1T05B 3CO9A 1XC9A 1U6ZA 2HG4A 2V52B 3LM9A 4CH7A 4EZ9A 1WC4A 1YT3A 2VQFK 3SCXA 2NRXA 1BQMA 5C42A 3CEDA 3RMBA 1YGYA 4DL5A 3DGPA 1TUWA 5GAHU 4K4YA 3E1YA 1T03A 2L9DA 4ED5A 2BE2A 4RG8A 3SBTA 3O8WA 5AQJA 2VG7A 1CJVA 2GIQA 2DEIA 3MPVA 2IJRA 2LECA 1H2TZ 4H0XB 1OH8A 1FE4A 1I39A 2XRIA 1ROFA 5GAEI 4B3MJ 4P72A 3SQOP 3N79A 4GNIA 2M0GB 3CGIA 2FC9A 3JSRA 1KS2A 2NZCA 2G8HA 3CCES 1K9MO 3MCPA 1V9OA 2OPSB 1HI1A 3Q8UA 2DNZA 5GVQA 2QA4N 3AXKA 4XDCA 5KFCA 3M2VA 3THYB 3E3XA 3J81O 1JXEA 3PIOQ 3VHQA 3H25A 2QA1A 3GJTB 2YHBA 3MWPA 1NPPA 4QOTA 2JC1A 3AXMA 1DHMA 1LWXA 4KKOB 2V6AA 1NJWA 2HNYA 2QK9A 1N4LA 3G71S 1HBUA 3FEZA 3H5UA 4FJ9A 3I0RA 2YXLA 3I5CA 3GIMA 4LC9B 1UWBA 1S22A 3C7NB 3HVTB 1GX6A 2ZBPA 4Z94A 3IMQJ 3M8ZA 1Y00A 4BS2A 4WE1B 3JTOA 4FOEA 1QAYA 1WD6A 4HH1A 1R59O 1M1KT 1Q53A 2J7WA 1VQLN 2PMHA 4FM2A 5CHCB 3U1LA 1U0HB 4V19J 1XMOJ 2UUAJ 2OI2A 5HROA 1VOMA 3G82B 4DTPA 3VAIA 2DFFA 4OV1A 4F50A 3OYFA 1DJ0A 2XSJB 3VPZA 3L4QA 4BWJA 3BO3A 2CPFA 3CM5A 5KFWA 2M3DA 3I8BA 2BACA 1BA1A 1RSCA 4K4ZA 1HBMB 3EXCX 5CR4A 2B51A 1ZZFA 4DL2A 2QXLA 2BJ8A 5EX5A 4CF2A 4CDIA 3G6VA 1VC5A 1NGJA 4IEEA 2F3JA 3CXCR 5IV3A 1X4GA 1KCFA 1LW0A 4NCGB 3ETOA 4LF7K 3ZX2A 3DXMA 4WFYA 3MOJB 3ZX0A 1ZM2A 4KFBA 1QQCA 2P5VA 4NLQA 2I5JB 1FWKA 4DR5F 4NYNA 3OYBA 4BRHA 3V2UC 1Y4ZB 2DGXA 4W5OA 5AQHA 1ZA1B 2W6LA 3LP2B 3QIPB 2GO9A 1L3TA 4B9QA 1S6PB 2IAJB 1M5KC 3C19A 3PJWA 4F3MA 1RTHB 3MWBA 3TZXA 4K50A 1KD1O 3LP1A 2B9WA 2Z0GA 1FXXA 2JLEA 1FO1A 2ZD1A 3CC4N 5C24B 3A0IX 4JP8A 4H5WA 3H3OB 2HAFA 2Z57B 1KN6A 2ZJQL 3NGZA 2BKOA 4CJFA 3NGIA 2LVWA 4C1NK 2WBNA 4DSLA 4B9VA 1NK7A 2WRMA 1P9QC 5E84A 1RT3A 4CI6A 3LDSA 4PEOA 4O5FA 3LPEA 1FRJA 4KB7A 2BYCA 5AE1A 2W6KA 5GINA 2U2FA 3ENOA 4F7VA 2MGZB 2YKQA 3OFEA 4F4KA 1JL2A 4IO1A 3THTA 1LOTB 2VHGA 2ASJA 2X78A 2QX0A 4OZ3A 2CQ2A 2D74B 1HBOB 5F8IA 1BLUA 2QT7A 3EVMA 4ZLPA 2A6MA 3ZO7A 3ZNUA 2DNQA 4X66F 5JVGQ 1B9FA 3ZZUA 4A46A 3CJ0A 2GJIA 3HX9A 4BC3A 1HW8A 3OJSA 4DSIA 3D6MB 2DGVA 3KLVA 2BQRA 2EEYA 4B3OA 1YTAA 3IG1B 3PFOA 2P9SB 4P9SA 1JQGA 3TZWA 1B4SA 3GU0A 3C16B 4YOUA 3MPDA 2I0XA 1NU4A 3ALYA 2H9ZA 4LF9K 3AVMA 5E3CA 4M5MA 3GIJA 1C1BB 3ZZPA 5ETRA 1M5SA 4CZHA 5H9EK 1K8KB 1RP5A 1GLFO 1YBUA 2HWTA 5KFPA 3KLIA 1ITGA 4QWCA 3AOAA 4FJ5A 4GV9A 1U1RA 5KQ8A 4IH6A 1GQEA 3MM9A 4UZCA 2CJYB 1YQHA 1T11A 2GVDB 3THXA 2CPIA 4CJ7A 4PR6A 2ZJQQ 1XMQF 3HRGA 2RHSB 5J2MB 1N6QB 3M9OB 2R8HA 1FNXH 1KQKA 2OGUA 3P45B 4QJVA 3UB5A 2W41A 3OYAA 4KYZA 5EOYA 4ZLJA 4FPAA 2W9BA 2XS5A 1P27B 1VDHA 3DLEA 3BSCA 2CNKB 4FK4A 5JMNA 4BRLA 3SAFA 3CQ8A 1S77D 1IBMF 1I6JA 3CCUS 1VQON 4B3MK 3M2UA 5CAAA 5HK4A 4O3QA 5C2CA 1YSJA 2GGPA 4ZIWA 3WIUA 2BABA 4I9QA 1RLCL 4YR3A 2PMWA 1VRUA 2ZGYA 3CD6N 2Z1GA 3TSQA 1EP4B 3GBTA 3U9ZA 3KHYA 1R43A 1UVLA 3AFGA 2DNPA 4C3MA 2O3DA 4CQ1A 4OPHA 4BQZA 2BW2A 2FHKA 2HIYA 2YH1A 3IO1A 3M1VB 1KVAA 2D7SA 1BWVA 1FRIA 4E7HA 1RACB 3WNEA 1HLUA 2E2PA 3G87A 3Q24A 5E3PA 1KQSM 3TAFA 2B3TB 4C8ZA 1LWFB 3K5NA 4IOXA 1FWLA 2RRAA 1FX4A 5DQHA 5CZ2A 2OPSA 1RUSA 1ZPWX 2CKWA 4WPAA 3QEXA 2QC3A 2NNWA 1WBBA 3WDOA 2XYGB 2CQ3A 4AHTA 2QLJB 1T9UA 2O8CB 2MSTA 2DY9A 4A62A 4M3UA 1F3VA 4CESA 2HVDA 3ILOA 1FWPA 2GV1A 3AVNA 3QGPA 1YJTA 4CEBA 2UUAK 1V3SA 2ZOGA 1WKJA 2KG1A 5AJ3K 4E7KA 3P83D 3CCJS 5AE2A 3HVTA 1SL0A 3THWB 1Y5IB 3O3LA 3HVAA 4WE1A 3D7EO 1ZM9A 2HZCA 3ICLA 4XDDA 3IM9A 4MKYA 2Q1LA 4ED7A 1I5OB 2R7YA 4M8LA 3KVGA 3G82A 3H5XA 1QVGR 2M52A 2AD9A 2FVSA 4ED3A 1H38A 4JAXA 4X4VA 3N6MA 2GHWA 2JLGA 2XSJA 5EHHA 2R7VA 4NCBA 4DR3J 3WNHA 2NRRA 4BRAA 3EYZA 2ZH2A 3VEYA 3OXLA 4LSZB 4P74A 1X3MA 4FXDA 2DXFA 4P7TA 2KJWA 3OTOF 4FWMA 3D0PA 2F4VF 2EC2A 1G6BA 3HULA 3PRVA 4Q2LA 2ZUGA 3KLFA 4OHYA 1JJHA 2CVIA 2Q6BA 4J2BA 4NCGA 8RUCA 3JTPA 2UXBJ 1C1CA 1T02A 4DPXA 3P39A 1S9FA 3SUPA 2HHPA 1EXQA 5AQQA 1VQKS 4LREA 3V9XA 4M5KA 2C2RA 2ZBQA 2LEPA 5ETSA 3EO3A 4WQ4A 2C2NA 2PFDA 1KFSA 1FDNA 1KDNA 1IKWB 2JVRA 4JI1J 3TO8A 2ZHOA 1RILA 2HLTA 4DV7F 4CFAA 4L6V3 4ZVSB 2FHMA 2A40A 5A8WB 3QIPA 5E3AA 1AW0A 5LOQA 1S6PA 4PWUA 4FVMA 2IAJA 1VQPN 4KGVB 5JXSA 3KK3B 3NS5A 5C24A 2A3JA 2IC3B 2NQPA 2NREA 2G8KA 2R7QA 3UN2A 1KVCA 1GFWB 2DHSA 2RVJA 4M3RA 2F8HA 1RWWB 2OD4A 2GTDA 5F0XA 3L2QA 3KZBA 5M1KA 2ROPA 3SPZA 4FYXB 3W8PA 1HJOA 2WONA 4YORA 2HHHK 4YUDA 4RTFD 3H8YA 1HBNB 1RU2A 2GAHC 3R7SB 1GTHA 3BSAA 1XHXA 1ZAWA 4FVCA 4DTNA 1DLOB 1D4XA 4U95A 5B0CA 1HBOA 1DKGD 2FY8A 2GW8A 3AARA 1ZBIA 4YB5A 3HI0A 2WVEA 2JL9A 3AVFA 2JFKA 2KT3A 4EZ6A 2HAIA 3ADAC 4E1MA 5GMDA 1WDTA 4DEZA 3C66A 4ERDA 3IG1A 3ZZZA 4U8VA 1XNQJ 4ZJLA 3G4SS 2W2MP 2E5LJ 1B7FA 3ZZOA 3H1QA 2FJDB 3DRXA 4DZDA 3CNQP 5SUHA 1FRKA 1M90O 1ASVA 4DV3F 4B3RJ 3EICA 3CJKB 1WOQA 1IKYA 2HBJA 3FBEA 1NOZA 2CPEA 3MAQA 3OTDA 1XNRF 1A0OB 3H46O 4P75A 4ILMA 4PKGA 4HT7A 4LRAA 3SV4A 1QE1B 2ADCA 3NEKA 4B02A 4F25A 4ECQA 1RDDA 2HF4A 3QESA 2GVDA 2AJ4A 1TV6B 4OYAA 3NLCA 4OLBA 1UEVA 1DTQB 3IM8A 5I42B 4J90A 4IOBA 3TTCA 2HBLA 1X8DA 3AODA 2E1CA 3VGVA 4OLOA 3HBTA 4ELTA 2R7RA 4FWPA 1RB0A 3DRSB 3D6FB 4RBUA 1WG1A 1LV5A 3RRHA 5FJ4A 2G8IA 2QEXS 4E3SA 4O0IA 3V6DB 3J7YP 3NWRA 6FD1A 4F3QA 4CP5A 2CJBA 3B82A 3TW0A 4BRIA 3JSBA 1NZ8A 2KXFA 2FJWA 2YHXA 3UO0A 1EP4A 1S1UA 4IFYA 4AH9A 4DU4A 2V67A 4BRPA 4EO6A 1TUVA 1I51B 4QS8A 3ENVA 2N4CA 4ZP8A 2YNFB 2KQ2A 2YKMB 1X4CA 3D68A 3EX7B 3O9TA 1F0XA 4KGMA 1IBLJ 3NGDA 4KGXB 3RMAA 2AHOB 2IYIA 2PFFB 4CJKA 2VC0A 4K4VA 5D4PA 3LTOA 5E5NA 3J8AA 3DRYA 2W2PP 1WUUA 4QYZJ 5AZJB 2X7IA 1Q86O 2EI5A 1HWIA 2ACYA 3SJHA 1HKCA 4HTJA 3KLEA 3ID8A 5LXRA 3A3PB 2YQ1A 4RL1A 4CLFA 1KEKA 1BY9A 5AQIA 4CZGA 3V6KA 3TZZA 3FZLA 2QA4S 5HATA 1YRTA 3CJ3A 2E7WA 2KU7A 4U7BA 5HI7A 1UFLA 3D3BJ 2YHAA 4PG5A 1UVNA 3FZKA 2DHAA 3NXZA 1AB8A 5G0RA 4LRDA 1NSPA 3SV3A 4DR3K 4ANCA 3LL3A 2BA9A 3BF3A 1KBRA 4F3TA 2FC8A 3UKRB 1GLAG 3MF5A 4RW8A 3MFHA 2UUBJ 5BR9A 4EBEA 4LF1A 4ZP7A 4GW6A 3ASMA 3TR5A 2JSXA 2U1AA 3PSFA 3I55N 3RAXA 1N33F 5A2QU 3NNAA 3NAIA 4JK7A 5GADI 2HFZA 1HWKA 2UXBK 4ID5B 1VQLS 4W98A 1KHVA 3D3CJ 4HI1A 1WEZA 2CGLA 5H9FJ 4FLVA 4CGJA 3JXOA 4OPJA 1X4FA 4TLRA 3FFIB 4ZVUB 5FLXY 2BJ9A 5HAOA 2MQNA 3RVCA 5J1NA 4EO8A 2QL7B 3VWSA 3M8PB 4MK9A 2QLXA 2P9NA 4KV8A 3WT0A 3TSPA 4E19A 4IO9L 5K9FA 1VYAA 3DWLA 2JVOA 2DHGA 3DRRB 3L2UA 4U67L 1IKWA 1NK8A 1AFIA 3CCZA 2KM8C 3Q83A 3HSTB 3W3DA 1X0FA 3V4IB 3KJVB 4C9DA 5L46A 3TWHA 3H3NO 3CCWA 1GOCA 5LJ5Y 2QXFA 2KLAA 4DL7A 4NB4A 4WKRA 1JXVA 4CZEA 2E2OA 3EUNA 2FB0A 2HBZB 4B17A 1WELA 1NHKL 4ZPAA 1SBRA 5B0AA 3GPAA 4U9RA 3RB3A 1TKTB 2N82B 5IQQA 3NFAA 4H0VB 1FCAA 2PAVA 2YWHA 2OANA 4EYHB 2HSEB 2P9KA 1R89A 1K73O 2AGPA 4FZXC 2V4QA 3RBXA 1Q0NA 4LQ9A 2IVOA 3TUJC 1NK0A 5F41A 4FJIA 4Y28C 4K41A 1XNQK 2BW7A 2E5LK