3DYAA

Hiv-1 rt with non-nucleoside inhibitor annulated pyrazole 1
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
555
structure length
551
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 161
structure length 551
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dyaA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dyaA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dyaA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dyaA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3dyaA05
4CHOA 5JS1A 5KFKA 5KFZA 4JV2A 4PWDA 4KFBA 2R2TA 4JLHA 3CJ2A 4FXDA 4NLPA 4EBEA 2HNDB 3RBDA 4J2AA 4RZRA 1YTUA 4MFBB 3Q8QB 4DG1B 4I7FA 3CYMA 1IKXB 1EP4A 2AX1A 1T8EA 5HRPA 4DTUA 3QIPA 2IAJA 4E7HA 2OPQB 1GOBA 2UUWA 2DFFA 3AO1A 2IM0A 4ZP7A 4OLBA 1C0MA 2GUIA 2ASDA 4CF1A 3QLHA 2BE2B 5CYQB 1S6QA 3K5NA 3DOLB 4F2RA 2XY6A 5L9XA 2W9AA 3IS9A 3DYAB 3BDPA 4KI6A 4NYZA 1C6VA 1JXEA 4AHTA 3KLHB 2F8TA 2IS3A 4ZP8A 3DOKA 5C42A 2ZQBA 3MXJA 2J6SA 3KMSA 4KI4A 4MKBA 4CHZA 4Z4CA 1BIUA 2B6AB 4RW9A 3NAEA 1WLJA 5HLFB 1LWCB 5HRRA 3ULDA 3V4IB 4K4ZA 1C0TB 2DFEA 2ILZA 3KLVA 1LWFA 1RTIA 5FROA 1NK0A 1S9EB 3L3VA 2OPSA 5KG6A 3A2FA 5J2QB 2W9BA 2KQ2A 2YKNA 3VQ5A 4DTSA 4ECVA 4IH5A 3GILA 1NK5A 3DLGA 4M3WA 3MR6A 4M95A 4KHWA 4KRFA 1S1TA 3UIQA 3T5HA 3MR2A 1HNVB 1W25A 1HQEA 2D7SA 1RYRA 3H5YA 3ZSOA 4BDPA 4C8LA 3RRHA 5FDLB 4ID5A 3SYZA 3CJ5A 3AA5X 3NH2A 2B5JA 4EBDA 4ED2A 3V9XA 2UVWA 2V0NA 1KLMA 4Z4HA 4FLYA 4QW9A 3THVA 4TY9A 3BQ1A 1TV6B 3V6KA 2QKBA 4NLDA 3CJ0A 3H4DA 4O0JA 3KLFB 3KMQA 1X9MA 2WTFA 2XWYA 2X74A 1VRUA 1S48A 2YNHB 5HRSA 4NZ0A 1C1AA 3RRGA 2V4RA 3OL7A 4Y1CA 1SH0A 1VRTB 3AA2A 4J9QA 5F8GA 2RF2A 1UWBB 4FJ7A 1QS4A 5T14A 2R2SA 2FVRA 1NK7A 3HP6A 4YR2A 2J6UA 2ATLA 5KTQA 1TVRB 4LSNA 4M3UA 3CVKA 3VQCA 4CHYA 4IQXA 2HHWA 4IRCA 3M8PA 3QIDA 4KHQA 1TKDA 4CJVA 4RUAA 1WSFA 2WOMA 3RR7A 4DQRA 4ZHRB 2YNFA 3GV5B 2JC0A 1JLGA 2KFNA 3AVGA 4KO0A 1S1WB 4FJLA 2FC0A 5KG4A 1NK9A 3DLBA 2FVQA 4TYBA 4LD0A 3ITHB 4E7KA 4O3SA 3M8QA 2QE5A 2LSNA 4I2QA 2Y1IA 3L2VA 5SWMA 5F9LA 4ECXA 5FRMA 4W5TA 4OJRA 2HWIA 4ELTA 4CHQA 3QGHA 3LP0B 2Z1HA 1HPZB 1KRPA 5D3GA 1U45A 4DL5A 2BRLA 4KHUA 5C24B 1FKPB 4JV1A 4F50A 1I6JA 4CEBA 4I2PB 1T05A 4O55A 3OYCA 4RG8A 3MEDB 4TN2A 3SI6A 3KLGA 4NLXA 4O4GA 2FLLA 4OKEA 4IDKA 5J1EA 4IR9A 4JS4A 3OYNA 5J2PB 4NLQA 3HHKA 3QEXA 1VSEA 4FZZA 3MXMA 1KHWA 2W8KA 3ZSQA 2OPRA 1SH2A 4HUGA 4M42A 5CZ2A 4TYAA 1S1VB 1BQMB 4F3OA 1S1UA 3N6MA 2YNIB 3VA3A 2FBXA 1WSEA 1JL1A 4JV0A 3DM2A 2XRIA 3TABA 1U47A 1TL3A 1RT2A 5DLFA 5KFLA 2B43A 3TQ1A 3VQQA 3QGGA 1N4LA 1QAJA 2HW3A 5KG1A 3RBEA 1JLQB 4DSIA 4AILC 3EZ5A 3QO9B 3VQAA 3OSNA 1S97A 1S0OA 4FM2A 5F8NA 4ED0A 1JLAB 5C5JA 4H54A 4KKOA 1XWLA 4KB0A 4IRKA 2AGOA 4H4MB 4BE1A 1JKHB 4DSJA 2ATQA 2IBKA 1SL1A 3CIZA 3GIMA 3OJUA 2ASJA 1NJWA 1WNSA 1NOYA 3M9NB 4NCAA 3BJYA 4NLSA 2IC3B 4EZ6A 4DTRA 4QWEA 4O3OA 3BGRB 4DL2A 3D5MA 3NF9A 3ZCMA 2ASLA 3V6HA 4ZVGA 2R8IA 2VWKA 4K50A 2EC0A 1JIHA 3H4BA 4KREA 3MEGA 4K8ZA 4PQUB 3QNNA 3MECA 1S0MA 2CKWA 3K5LA 3I5CA 2IM1A 3TARA 2O5DA 1WSGA 2HNYB 3KHRA 3NF8A 2HNZA 3DLKB 1S49A 3TR8A 4Y2CA 4ECQA 4KPYA 1JLCB 3PUFA 4KB1A 2VG6A 2R8GA 1YTAA 3OSPA 4FK2A 1TKZB 2WCXA 1KVCA 4CJPA 4AHUA 1B9FA 2D41A 2V9WA 4QWCA 4ED7A 4TQRA 3EPGA 4F4YA 3RTVA 1IKWA 3NFAA 4DQPA 4UQGA 1RT3B 1J54A 2Z1JA 1RT6B 3OS2A 3PO5A 1RTJA 4CJLA 5KT6A 4TLRA 3KK3A 4TY8A 4J9OA 1YVFA 3T3FA 4CERA 4NLRA 3FFIB 4IG3B 3PW0A 1JLBA 4ICLA 4YQWA 1N5YB 5DQHA 3PX6A 2G8VA 4G3IA 4CIGA 3KK2A 4G1QA 1GOCA 1C1BA 3HM9A 3AVLA 2RDIA 4N41A 4RU9A 1LW0A 1BCOA 3MEEA 4RW4A 4DU4A 2W7PA 4B3OB 3O3GA 5KFEA 5DG7A 2YNGB 4CHPA 4OPJA 3NL0A 4HUFA 3NF7A 2HAIA 4W5OA 1J53A 2OPPA 2CJQA 2XGQA 1T3NA 1NKBA 3K5MA 3QZ8A 2XO7A 4WFYA 4HUEA 4CE9A 3SNNA 3PO4A 2G8KA 3DRRA 2R8HA 3KJVA 4NLOA 5KFCA 2G8IA 4MK9A 2RKIA 4FM0A 3IG1B 4LQ3A 4LSLA 4ECTA 4KHYA 3OYKA 3QNOA 4CEAA 4CF0A 3B6OA 2O4IA 1C1CA 3QETA 4EO6A 3NGDA 2GIRA 4AHVA 4IFYA 4FJ5A 2FBTA 4KSEB 4DFMA 1N56A 3CG7A 3I0SA 4CJFA 1S9GB 2F8EX 2XY7A 3L2QA 3CFOA 1EKEA 3EY1A 2EHGA 1IKVB 2C2RA 3KHHA 3PR5B 3PW4A 4K4TA 3HVWA 4IBNA 2ALZA 4MK7A 3DLRA 3V1OA 3WNGA 3HT3A 3DMJB 4ED1A 5CY4A 4BDZA 3OYJA 4FK4A 4ZMMA 1EETB 3ISND 1XR5A 4M45A 3N6NA 3KK1A 2W42A 3AO3A 4H8KA 3NGIA 1RT7A 4J2BA 4O3NA 3BSOA 2VG5A 3OS0A 5DLGA 2E6LA 4K8XA 4CIEA 4RW7A 4OKJA 4E7LA 2O4GA 1RT5B 4LY7A 1SH3A 4KAZA 1HQUB 5T7BA 4C8OA 3V6DB 1Y97A 4O3PA 3I5BA 2FVCA 3GIJA 2OH2A 4K4WA 4EO8A 4AHRA 1JLEB 1WAFA 3OS1A 2JC1A 1RCHA 4M3RA 2P5GA 2RDJA 1U04A 5DGAA 5HP1A 3O4NA 2GIQA 4MFBA 3VQPA 3ZT0A 3SQ1A 1SUQA 4DG1A 1GX6A 4QWBA 3GV7B 3OL8A 1D9DA 3D45A 1TKXA 3G6VA 3OYIA 2HHTA 4MIAA 3AVBA 5HBMA 3M9MB 2C28A 1HYSA 1D1UA 3LZIA 3CM5A 5CYMB 3DRPB 4E19A 4B8AB 4B9VA 3O3HA 3IAYA 5K14A 4FW1A 1FK9B 4H4OA 3HSTB 3U3GA 1JXLA 3V9UA 4CEOA 3Q8SB 2WONA 2D0BA 3NAHA 5KG0A 4CEDA 1HYZA 1J5OB 4RNOA 3KHGA 4NLGA 1JLFA 4Q5VA 3KTQA 1FKOB 3EPIA 4FK0A 2UVVA 3NDKA 3I0RB 3KLHA 3K5OA 1DTTB 1VSIA 2YKMA 4ZVEA 5EDWA 1QUVA 4J9NA 1W0HA 4WE1A 4PWDB 4KFBB 4F4XA 2R2UA 4PA1A 1RTDA 4MQ3A 4RW6B 1C0TA 1ZBFA 3E01A 3M8RA 4CGIA 3ZT1A 1HMVB 3OYEA 2JEGA 4FZXC 2HHSA 2OYQA 1EP4B 4WZQA 3ZSVA 1VSDA 3QIPB 3RB0A 4HCCA 3G86A 2IAJB 3DRSA 4IKAA 1RT1A 2D0CA 3MXIA 1U49A 2J6TA 3ZSWA 3FRZA 3JYTA 3D28A 5KFBA 2AWZA 3AVHA 4KB7A 4C8MA 2YHAA 1QHTA 5HROB 5DQGA 1RDBA 4JRQA 4QOZB 1S6QB 2HHUA 5KFNA 4FBTA 2BR0A 1SL2A 4R8UA 2G8UA 1DLOA 1ZBIA 5KFQA 3PW7A 1TQLA 4Q8EA 1WSJA 1S10A 3DOKB 5F8MA 5KFDA 2FBVA 1KFSA 1Z26A 1TV6A 1J9AA 4OGEA 4KBIA 1RDAA 3CDUA 4FJGA 3AVNA 3VN5A 4RW9B 1T7PA 2F8SA 3PW2A 3KLFA 3ASMA 3HVTA 4DL4A 3KD1E 3RB4A 5I3UA 4O4RA 2OPSB 4CCHA 4B8CA 2DPIA 3ZT4A 1QE1A 2W9BB 1XI1A 3HPHA 2ILYA 3I5AA 3SFUA 4K4YA 3DLGB 4J9SA 3AA4A 3MFHA 4QW8A 4KHMA 4E1MA 3IRXA 1S1TB 2P1JA 2QXFA 4DTMA 4URGA 1HQEB 4LH4A 1I3AA 2GBZA 1BQNA 1S1XA 1BISA 3M8SA 4ECSA 4WXWA 4WXOA 4YP3A 2B5JB 4BE0A 4XPEA 4YMEA 4WFXA 1LWEA 4CF2A 2R2RA 3HL8A 3DLHA 1KLMB 4CEQA 4CJQA 3OYBA 2HVHA 1WSIA 2GC8A 5KFUA 2ZD1A 1XHXA 3ITHA 1TAQA 3QEIA 2AGPA 3TAPA 1RTHB 1VRUB 1TK0A 2AGQA 5DMRA 1NKCA 3NKYA 4NYFA 4EP5A 4WZMA 1XR7A 1HPZA 3PW5A 3EZUA 2RF2B 3UDLA 2WK4A 1X9WA 1QTMA 2JEFA 4QCLA 4W5NA 2Y1JA 1BCMA 4Q43A 1MU2B 3OYFA 4CFAA 3Q8PB 3TAGA 1TKTA 4MK8A 1ZYQA 4EYHB 3H5XA 4IH6A 5KG5A 2IDOA 4LSNB 3NGYA 4IR1A 1EX4A 3M8PB 1K6YA 2FJXA 4FS1A 4E3SA 1IO2A 3SQ4A 2PY5A 4RNNA 4ZP6A 4B9SA 2WOMB 2QV6A 3CFPA 4R5PA 2YNFB 4FVMA 1TP7A 1JLGB 4JS5A 1HNIA 4M3ZA 5FRNA 4KO0B 1ZBLA 5KG2A 1NJYA 3MF5A 1KFDA 5I42A 3M8QB 1ASUA 3JSMA 1WNEA 4I2QB 3U6FA 4PY5A 3LP3A 3T5JA 1L3UA 2KTQA 2AU0A 1NK8A 4IFVA 3GIIA 3FDSA 4TQSA 3UQSA 3H5UA 4DSLA 4NLVA 1KTQA 2IMWP 3RAQA 1A5WA 4C8KA 1ZBHA 5D3GB 1X9SA 4EEYA 4CJWA 2QK9A 5KGWA 3PR4A 4FJNA 3LP1A 1EXQA 5DK5A 2HHXA 1T05B 4O0IA 2IGIA 1NK6A 3KLGB 1C0UA 4FS2A 2VA3A 3WNEA 4ZPBA 4O4GB 2OZSA 3KLIA 4IDKB 2XC9A 3ZSYA 4K4XA 5CZ1A 3C6UA 4Y34A 1DTQA 2BQUA 2DY4A 3S9HA 4WFZA 3NBPB 4E7IA 2VG7A 2OPRB 2ZE2A 1R0AA 4F4WA 4RW8A 3V81A 1BI4A 4XIUA 2KW4A 3U3YA 1S1UB 2HMIA 4CJKA 4J9RA 4E0DA 3DM2B 1OS5A 1Q9YA 1TL3B 1RT2B 1HYVA 3P5JA 4J9PA 2PYLA 1VSHA 3UPFA 3LALA 3HO1A 3SPYA 1RBRA 1REVA 3DLEB 5J2NA 4DLGA 2W8LA 2IOCA 3NHGA 4DSKA 3PJWA 3DI6A 1B92A 4KKOB 2G8WA 3G10A 4QPXA 4E7JA 4FJXA 4NLTA 3QEWA 3IN5A 4XPCA 2X6SA 4ID1A 4DF8A 4EZ9A 4DU3A 4CGGA 2I5JA 2HHQA 3WNHA 4DF4A 3CFRA 5C25A 4IG0A 4EP4A 4IG3A 3H2LA 5KFSA 3QEVA 5J2MA 2DTUA 1RBTA 4Z4GA 1IKYA 1X1PA 3PX0A 3VQ6A 4CF8A 2W9CB 2D0AA 4HKQA 4CK1A 1N6QA 1NNDA 4YFUA 4Y2AA 2ZKUA 3VQEA 1WN7A 5KFPA 4CHNA 1KSPA 4B08A 3OYMA 1LW2A 3MECB 4URQU 3KLEA 4B9NA 4RNFA 2XY8A 4NCBA 1T03A 1NOZA 4O3RA 4FJMA 5KFYA 4OKKA 3OYHA 2VG6B 4MKAA 1RA6A 1SV5A 4DQIA 1A5XA 3CM6A 3KKRA 2FVPA 4AH9A 1IKWB 4Q0BA 4OL8A 3LANA 4EYIB 2BANA 1MMLA 3KK3B 4NLWA 4F8RA 4TY8B 1LAVA 4FBUA 3O4QA 4U6PA 3I8DA 4ECRA 4PUOA 3TAMB 4GW6A 1S0NA 3SUNA 1JLBB 4ICLB 3OL9A 4ECUA 1JXBA 5KI6A 4CEFA 1BGXT 1S6PA 2FVSA 2UVRA 3FQLA 3RWUA 3FQKA 4CGFA 3KK2B 4G1QB 2OZMA 1RBVA 5EWEA 2XHBA 2F96A 1LW0B 3MEEB 4AHCA 4TXSA 3KNAA 1IKVA 1IM4A 3OYGA 1RT4A 5EWGA 4O44A 4JRPA 1RBSA 5HRNA 3LP2A 5F9NA 2Q3SA 3OHBA 4I9LA 3CQ8A 4E89A 4FW2A 3C6TA 2OPPB 2RN2A 2W7OA 3HYFA 4K4SA 4Y3CA 4ZVFA 5F8LA 1SKWA 4FZYA 2FJWA 3DRRB 3AVAA 1TK8A 1TL1A 2UVUA 3S3MA 4HHTA 3KJVB 1JL2A 4N56A 3NH0A 3SPZA 4F4KA 4EBCA 1LAWA 5L1IA 5KFRA 4ZP9A 2AJQA 1ITGA 1TAUA 2FLNA 4KV8A 4L8RB 2HB5A 1C1CB 4Q45A 3RB3A 3HVRA 3H98A 3KIOA 3TANA 4NCGA 2C2EA 4M3YA 3I0SB 2XGPA 3C94A 1D8YA 4IH7A 4URSA 1W9HA 2R7YA 4K4VA 1QSLA 2EX3A 5KFJA 2ITGA 4Y1DA 1K1SA 1JX4A 4KAIA 2HNDA 4B9UA 1GX5A 4DSFA 1U09A 2B4JA 3V1RA 3LAKA 4FLVA 4OVLA 3KK1B 1D5AA 1IKXA 1BIZA 5KFIA 4MH8A 1QSYA 5DQIA 4FM1A 1K1QA 3K57A 4DLEA 1RT7B 2OPQA 2VG5B 1CLQA 3AO5A 3SUPA 3NF6A 4RW7B 4FJIA 4X2BA 4Z4IA 1F21A 2BE2A 4Z4FA 4DTXA 3H59A 3OYAA 5CYQA 4FYDA 1RDCA 3VQ4A 3PVXA 3DOLA 4RW6A 2ETJA 3DYAA 2OA8A 5HP1B 2BDPA 4ECWA 3AVCA 1HMVA 1SUQB 3SUOA 1ZBUA 4CJ4A 3OL6A 3MR3A 2VWJA 1TKXB 3P83D 5HBMB 3GYNA 5JXSA 2B6AA 1HYSB 3PHEA 4OGCA 1VSKA 5HLFA 4FLZA 1LWCA 3V4IA 4CJRA 3H40A 5L1LA 4NRTA 3TI0A 2XCPA 3NGZA 3PY8A 3P1GA 5K14B 1YT3A 1S9EA 4H4OB 4I7FB 1CXQA 5KG7A 3SZ2A 1IG9A 3T5LA 4FLTA 4HCBA 5EWFA 5J2QA 5HROA 3RMCA 3LAMA 4O5BA 2WONB 3K58A 3V9WA 3UR0A 3OYLA 4Q44A 1KVBA 2XCAA 3VQSA 1HRHA 2IM3A 1JLFB 3CWJA 1HNVA 3MR5A 1YVUA 1QAIA 4CEEA 2YKMB 3ZT2A 4FLWA 3QYYA 4CJEA 1XHZA 3QLHB 4WE1B 2IM2A 5FDLA 4BWMA 3CO9A 2E9TA 1RTDB 5JS2A 3PX4A 3E01B 3QEPA 3IS9B 2R8JA 1RDDA 4I9QA 3ZT3A 3AVIA 2XI3A 1S4FA 3HXMA 4KHSA 5C42B 4RNMA 4QWAA 5KFAA 3DRSB 5DGBA 1XR6A 3TVKA 1RT1B 4CK3A 1LWFB 4FJKA 4GVMA 1RTIB 1FXXA 3AO4A 1VK0A 1BL3A 3JYTB 2E9ZA 3K59A 2YNHA 3S3NA 3KKSA 4OPKA 5KFVA 1SKRA 2YKNB 4CJTA 3RMAA 4ZPAA 4CGJA 4O3QA 4LH5A 3IGVA 1VRTA 3PJXA 1SKSA 4R8UB 2E6MA 1DLOB 1UWBA 3B6PA 1NHUA 4DEZA 3RMBA 1TVRA 3H08A 3KD5E 4ID5B 2KZZA 3Q8RB 4CK2A 1CZBA 3HVTB 4KHRA 2P5OA 2WHOA 1NK4A 1RTHA 2P51A 3BSCA 3VQ8A 5I3UB 2HWHA 1D9FA 4N5SA 3SV4A 5EUHA 1NJZA 4DL6A 1QE1B 4ZHRA 3PZPA 2YV0X 1CZ9A 4YR3A 2A1SA 1S1WA 2I1RA 1LV5A 4RUCA 3IRXB 3FSIA 4ZTJA 3AV9A 3CDEA 1KVAA 2BGGA 1MU2A 1BQNB 1S1XB 4AHSA 3M9OB 4B9MA 4NRUA 2D3ZA 2BQRA 3HP9A 5KFWA 3L8BA 4WYLA 3LP0A 4TSXA 4ZVHA 4DL7A 4FJ9A 4CECA 1LWEB 5C24A 3KHLA 3AVMA 1FKPA 2KZMA 3LPTA 3L2UA 2G8FA 1C2PA 1HJRA 3HPOA 4OLAA 4I2PA 4R0EA 4W5QA 3BQ0A 3MEDA 2ZD1B 4M3TA 5DG9A 3K2PA 3AA3A 3VQBA 4DQSA 1TK5A 3G0ZA 3SJJA 2FBYA 3NH1A 5J2PA 4CJ3A 1Q8IA 4NLUA 4GC7A 1VSFA 3G6XA 3AO2A 5EU7A 2E9RX 1KCFA 2Z1IA 1B9DA 3BSAA 4KE5A 2WRMA 4ZPCA 1S1VA 1BQMA 3QERA 1ZTWA 2YNIA 4J9LA 4KHNA 4N47A 5KFOA 4CFDA 3BREA 5KT5A 5KRTA 3CJ4A 1L3SA 1TKTB 3O3FA 5KT3A 4XO0A 3OJSA 1WAJA 1IH7A 4F4ZA 1JLQA 4FJJA 3EYZA 1Q9XA 4DMNA 5KT7A 5KT2A 3QO9A 3TAFA 4J2EA 3L2WA 2A1RA 1JLAA 3AVKA 3V1QA 4RNHA 4DU1A 4R5PB 1UOCA 3OHAA 2JEIA 4HVJA 3NBPA 3L2RA 1HNIB 1ZTTA 4H4MA 3H5SA 1JKHA 3SV3A 5I42B 3JSMB 1KHVA 3QESA 3BSNA 5J1EB 4DWIA 5L1KA 4DTPA 5KFMA 4WYWA 3T5KA 4DTOA 4IFVB 2JGUA 4CGDA 4FCYA 3CDWA 4DFKA 4B9LA 2IC3A 3SQ2A 3BGRA 4Z0UA 4QAGA 5KFTA 4ED6A 1UA1A 4FJ8A 4GC6A 3RAXA 1NJXA 2WB4A 4M3XA 4CIFA 3MFIA 3DLEA 4CJUA 4PQUA 2UUTA 4BACA 1U4BA 3HPGA 3LP1B 3T19A 2FLPA 1HARA 4YR0A 3F73A 2KFZA 2NUBA 2C22A 1SL0A 2BQ3A 2HNYA 4Z4EA 1QSSA 3DLKA 1C0UB 1A5VA 3NAIA 4E1NA 3OLAA 3OY9A 3KLIB 1JLCA 2HVIA 3GQCA 4ELVA 4CJSA 3CJ3A 3C6UB 2IA6A 2V4QA 1TKZA 1DTQB 4CESA 1UAXA 2AX0A 1RDRA 2VG7B 1RT3A 2W9CA 1RYSA 1VSMA 2ZE2B 4IOBA 1R0AB 3ZSXA 3V9SA 1RT6A 4RW8B 3V81B 4DFJA 1BI4B 3NMAA 1G15A 2HMIB 4CFBA 3QGIA 4IRDA 1VSJA 3FFIA 4M94A 4CF9A 1L5UA 4CEZA 1N5YA 1RBUA 2XY5A 4MIBA 4FJHA 1ASWA 1I39A 4M41A 4JUZA 5KFFA 2GV9A 3RR8A 4YNQA 1RILA 3BQ2A 2JEJA 2BRKA 4FLXA 1CXUA 1REVB 5J2NB 3MEGB 5E41A 1O1WA 4Q8FA 3GV8B 1N48A 3DI6B 4ELUA 4B3OA 3LWMA 2AQ4A 4CJ5A 1L3VA 4ZPDA 2RPIA 2XI2A 2YNGA 5KGXA 2HNZB 3LZJA 2I5JB 3DDKA 5SZTA 1NHVA 3SUQA 4ECYA 2IJNA 2HHVA 3SQ0A 1ASVA 5C25B 4IG0B 5L1JA 4DTNA 4KTZA 3TAMA 2FJVA 5J2MB 3ISNC 1T94A 3C95A 4CGHA 1L3TA 3OVNA 5F8JA 3HK2A 5F8IA 3HKWA 5JUMA 1IKYB 4U7CA 3SI8A 1Z25A 1TGOA 4KTWA 3VA0A 3ALYA 1N6QB 4ED8A 4DTJA 1RTJB 3SCXA 3ICLA 3RMDA 3IG1A 4DS5A 3G6YA 1QQCA 2IJFA 3OLBA 3OYDA 3GIKA 1LW2B 5KFXA 3KLEB 2PYJA 4GMJB 1XC9A 1RA7A 3VQ9A 3QINA 1T03B 1ZETA 4NLYA 4DSEA 1C1BB 2X78A 1S9GA 5KRSA 4NYNA 4DFPA 1U48A 3V9ZA 4RW4B 2D5RA 3HVAA 4C8NA 4F3TA 1SV5B 2G8HA 1GOAA 3NCIA 4Q0BB 3ZSZA 5KFGA 2DPJA 3DMJA 2BANB 4B9TA 3QZ7A 4F2SA 3LWLA 1EETA 4FLUA 3TAEA 3WNFA 4BWJA 4PUOB 4DL3A 3TWHA 4DS4A 4ED3A 1S6PB 2D3UA 5KT4A 1BHLA 3AVFA 1CSJA 4K4UA 4HTUA 3RB6A 2RKIB 4J9MA 3HJFA 1Z4UA 3S3OA 1VSLA 4ECZA 4LSLB 2QKKA 1RT5A 2JLEA 3AVJA 1HQUA 3V6DA 1RT4B 4W5RA 4O44B 1RAJA 1UA0A 3VQ7A 3LP2B 4IFYB 3ZSRA 1JLEA 3VQDA 3D0PA 4LQ9A 3BR9A 4N76A 3KOAA 3LPUA 2YHBA 3T1AA 3C6TB 3MAQA 2PZSA 4J9KA 5F8HA 3NE6A 2E4LA 4DQQA 1S5JA 1NKEA 1KLNA 3SFGA 4CFCA 3E51A 1S9FA 1TL1B 4IKFA 2R8KA 2X6NA 3V6JA 5CYMA 2C2DA 1WSHA 4J2DA 3DRPA 3F9KA 3QIOA 3IGNA 2DFHA 3LDSA 4QWDA 1FK9A 1D0EA 3TAQA 4KV8B 3L3UA 4ZTFA 5KG3A 1RNHA 2VA2A 4HYKA 3N6LA 5DG8A 4BDYA 3PV8A 2Z1GA 4KTQA 1J5OA 4NCGB 3MTKA 1FKOA 3I0RA 4BE2A 1DTTA 5KFHA
chains in the Genus database with same CATH superfamily
4CHOA 4BRNA 2EFPA 1SJ3P 3PKMA 3JXOA 1BA0A 2R2TA 3OTEA 4IOCL 3R5JB 4NLPA 1VHXA 2NRRA 4DR2J 4J2AA 1U25A 4MFBB 2V7YA 4DG1B 3I56N 4F0KA 3CYMA 1IKXB 2HQDA 3CCMS 2XYHB 1T8EA 3QIPA 2N7YA 2IAJA 2E2OA 2OPQB 4ZA1A 2LCWA 3CMQA 4NE9C 2IM0A 4BR5A 1PBAA 2VPXB 2H54B 4BR7A 2H3EB 1C0MA 2MQOA 2GUIA 1MROA 4GRSA 5AZJA 4HEA9 1S6QA 1LXJA 4OJ3A 1E6VA 3MM6B 1S12A 3NCPA 5LXYA 3CMES 3I87A 4F2RA 4QU6A 4PPDA 2FSJA 2DNNA 1YZ7A 4FP9A 3KLHB 2IS3A 4ZP8A 2AZ3A 1VBYA 1HPMA 1BIUA 3SLCA 1WLJA 3BO3A 3QJPA 3ULDA 1OYEA 1RKJA 4K4ZA 2ILZA 3C66A 3KLVA 3O9QA 1RWPB 2OPSA 3LDQA 3GIRA 1Q82O 2LEBA 2Y1LB 2YKNA 3VQ5A 4IOAL 2KJWA 1NK5A 1G7CB 1HW8A 4KHWA 4KRFA 3A5MC 1X0PA 3CEDA 5HL7L 3MR2A 1HNVB 2D7SA 4CI6A 4BDPA 2GO8A 3EGVA 4BGBA 5HATA 4DR6J 2JHEA 3ZZYA 4E2FB 3AA5X 3NH2A 2B5JA 2AV5A 1U8SA 3V9XA 1OO0B 3S1TA 1OWXA 1PBUA 2ZOGA 1NB2A 1F1BB 2JFKA 2DRAA 3THVA 3BQ1A 1FNXH 3H4DA 2LQBA 2NYIA 4A4JA 3ZX0A 1RUSA 4FF1A 4ZN1A 3OFEA 2XB2D 3ENHA 1MWMA 3CMAS 2EFVA 5HRSA 4NZ0A 3RRGA 2V4RA 4BRDA 3OL7A 3WC0A 5D0EA 4CP5A 4EIAA 3H45C 4JI8J 2B9WA 1YVNA 5F8GA 1UWBB 2LECA 2OMLA 1T3OA 2R2SA 3A8EA 4M3UA 4HACB 3CVKA 2H48B 4KQZA 4QPTA 4IRCA 3M32B 3M8PA 3IWNC 1OVYA 1TKDA 1JQGA 1NH7A 4V1Ak 1WSFA 1E4FT 4A46A 2HRTA 2YXLA 2LVWA 3MM8A 3W2VA 4USUA 3RR7A 1NGJA 3AVGA 4FJLA 1S1WB 5F2RA 2FC0A 3W3SA 4TYBA 2JWLA 2HZCA 2VH7A 1VJWA 1X3NA 4MO4A 5B0DA 2XSJA 5BRFA 2CPZA 5B0FA 3FVYA 1RK8A 2HWIA 1PG5B 1Q8BA 4ELTA 2BJ9A 3UI3A 3W8PA 5LMNK 1UJ6A 4A8OA 3M6XA 2XEXA 4JV1A 3FZBA 1WC4A 4BRMA 1QQMA 3UB5A 1I6JA 4CEBA 4NLCA 1VGYA 3MEDB 4WIIA 3SI6A 2NS1B 4JHDB 2PIIA 3P5TL 4X64K 3D7EO 1SC6A 3QEXA 1HNZJ 1F6TA 2JZ5A 3N28A 3DRYA 2W8KA 3CUNA 4AL6A 2OPRA 3ZTPA 2L08A 1S1VB 1BQMB 4JI7J 3O9RA 2F63A 3FGUA 3W0LA 1JL1A 4JV0A 1TL3A 5FPDA 5EHHA 4NA1A 1DARA 3FC9A 2UXDF 1G3OA 5KFLA 1DKGD 1PILA 2B43A 3VQQA 3QGGA 3LPYA 1QAJA 3R2DJ 1JLQB 4AILC 2OSQA 4LIRA 3QO9B 3GYXB 4QS7A 3MMBA 5C5JA 2VPZB 5E3QA 1N33J 4K41A 9ATCB 4JKAA 2GUPA 3H25A 3OVAA 2ATQA 3CCSN 3BV8A 3CIZA 1T6CA 2CQ1A 2DK2A 2G1DA 1WNSA 3TVYA 3M9NB 4NCAA 2MTLA 1K8KA 3B54A 2CQGA 2IC3B 1BHNA 1ZAWA 4NLSA 4CD1A 4QWEA 1WD6A 2YWFA 5ETMA 1S3XA 3V6HA 1MN7A 4CIOA 4K50A 3BZKA 2EC0A 2QT7A 4LREA 4KGMA 1GTHA 1N5QA 1MLAA 2H65B 3MECA 4LF8K 2QSFA 1LFPA 1GXUA 3KHRA 1WEXA 2Q3PA 3DLKB 3CULA 3FZHA 2ZM6J 5K8MA 4Y2CA 2R8GA 4DV0K 4P2XA 3O3LA 3P49B 3AAWB 4DB3A 4LFCK 4AHUA 1B9FA 4CLZA 4B3TK 4TQRA 3EPGA 2C3UA 3NFAA 1WG5A 1B0PA 4O23A 1J54A 2CPIA 2NXEA 2A2CA 1T95A 4JI1J 4S0MA 4CJLA 3T3FA 3FFIB 2YX1A 1U26A 2AJ1A 2Z0GA 4M5GA 3U4LA 5DQHA 4C97A 4HL9A 1K8AT 2G8VA 3KHYA 1Q7YO 2DGUA 2MZQA 6FD1A 4OHWA 4N41A 3CJ7A 4RW4A 4B3OB 4CO2A 4YDUC 1HR0F 3OA9A 3L4BC 2HWTA 2QWOA 3LW5C 5M1KA 3NL0A 1RJJA 3NF7A 2L48A 1UJ4A 1J53A 3VCDA 3R5BA 4DR5F 1T3NA 3K5MA 3QWPA 3QZ8A 2QFJA 1U1LA 4CE9A 2N7CA 5A8KA 3FZ2A 1QY7A 2F9TA 4J8FA 2RNEA 4LF7J 3OW2M 4LFAJ 1I94J 4FM0A 1ZC6A 3DHWC 3QBXA 4DV3J 3H2VE 3CJ1A 1C1CA 2D0OA 3QFHA 3QETA 4YN3B 4AXJA 3NGDA 3DU5A 4NXNF 4ETZA 4MKYA 1N56A 3CG7A 3U1MA 3L2QA 4CZGA 4ANEA 2EHGA 3KHHA 3PR5B 1SC4B 2NRHA 1HNXJ 4LF4J 2E5GA 3HVWA 3LH2S 1M5OC 4ED1A 4HTLA 2NPIA 4ZMMA 1EETB 4I68A 1NM1A 4J90A 4UY8T 2PC6A 3N6NA 2NLWA 2QYGA 3AO3A 4H8KA 2ZVSA 5HI7A 3CDBA 2DYAA 3BSOA 3MCAB 2HHHK 4K8XA 2MZJA 3JS6A 1RT5B 1R8AA 1WI6A 3PKYA 1SH3A 1HQUB 3V6DB 2RUGA 3OFHA 4CRJA 2X51A 2ZHAA 2CQ4A 5GIOA 3GIJA 2OH2A 4K4WA 2R7XA 1WAFA 5AQXA 5GVQA 2P9SA 3NGRA 2RDJA 3PEHA 3SQ1A 5EVZA 3KUHA 4QWBA 3EXYA 3GV7B 2AKWB 3D45A 3CD7A 1TKXA 3G6VA 3OYIA 2QO3A 2GX9A 1XQSC 3CIMA 4X62F 3POTB 2ZBRA 3QPIA 5K8OA 4G6VB 3JQKA 2N4CA 2QLJB 4B8AB 2BJEA 3IAYA 5AJ3J 1FK9B 3HSTB 3MI7X 1FO1A 4ANCA 2R7RA 4H0XB 4DHVA 3PSFA 5AQTA 3V9UA 4ZOSA 3Q8SB 3PNIA 5CCMA 1TL7A 2D0BA 3NAHA 2D74B 1GLDG 5KG0A 4K42A 5BREA 1FFGB 3WQPA 4WK3A 4RNOA 1BWFO 4Q5VA 2M8DB 1NSQA 3K9KA 2IDLA 3NDKA 5I3PA 4JV5J 2YKMA 4J9NA 3EN9A 4YHHK 2R2UA 1XMOK 1NDKA 5KQ8A 1Q78A 3O44A 1ZBFA 2FJDB 2QEXN 1VR6A 1LQ9A 1GLLO 1JB0C 1RAGB 1X4DA 1WHVA 2MZSA 4FZXC 2GWKA 1VQ9S 1UW9A 3W65A 2EWHA 3QIPB 4HCCA 2IAJB 5C12A 4A8XA 2D0CA 2CQCA 2CNNB 3IR7B 1MROB 2MZTA 5HROB 1DT9A 5AZJB 1NDCA 1EWQA 1S6QB 2RU3A 3O9TA 5C2DA 1E6VB 2DNZA 2KHDA 4MT1A 1VHIA 4FBTA 3EZWA 4DR2K 3VF2A 1DLOA 3J7ZT 4L73A 1IBKJ 2MJNA 4ISFA 1WSJA 3MPDA 1ITPA 1RDAA 2GAGC 5A2QO 1S7IA 2F8SA 3PW2A 3KLFA 1X8DA 1TMJA 2BA9A 5AQHA 3KD1E 4FWRA 1Q86T 4DV2J 2HBRB 4PCQA 5A6WA 2OPSB 4CCHA 4B8CA 2DPIA 1QE1A 3OVSA 2NRTA 1NGEA 1S76D 3MFHA 4E1MA 4X64F 2QXFA 4B3SF 4ZCIA 2UUCJ 3J7YP 2ZH2A 1I3AA 2CJXB 1S1XA 1JWWA 1KOOA 1IQZA 4WXWA 4WXOA 2ZOMA 4YP3A 2B5JB 2P5VA 4XPEA 1Y0HA 2CYYA 2FHJD 3J81O 4YMEA 5E7OB 3HL8A 3PYDA 3VVUA 1JJ2M 5LSLA 3OYBA 2M7SA 5DJBA 2OCEA 1CJKA 1WSIA 3CJRA 2GMJA 4I67A 2ZD1A 3ITHA 1WG1A 2WBRA 3AAQA 3F0NA 3M8ZA 3KVGA 2D1KA 1P90A 1Y00A 5LM7E 1W7WA 1ROFA 2EK1A 3IWLA 4P52A 1GXLA 5DMRA 1NKCA 1WB9A 2YH1A 3I8BA 3ZZRA 4JKHA 5EY4A 4DR6K 3G6ES 1JJCB 3UE5A 1HPZA 3R6GB 3UDLA 1H3DA 2XNQA 4PQAA 2WK4A 1VHFA 4F0HA 1ACMB 1QTMA 1H7XA 4HH0A 4W5NA 2Y1JA 1BCMA 4Q43A 3FMWA 3OYFA 4MK8A 1ZYQA 4LF9J 2M52A 4IH6A 3KWIA 2XLJA 3HHLD 1T9XA 2QW9A 2W7AA 3ILOA 5M1FA 3EL2A 4IR1A 1EX4A 3M8PB 1B64A 4K59A 2FJXA 3ULHA 1VQ4N 3G9CA 2CPDA 3TSPA 2QTWA 1RABB 3W2VB 4WTOB 3A0IX 4LF8F 3G2XA 1TP7A 3MX5A 5FRNA 3TZWA 3AY0A 1TYQA 3FZFA 4JI8K 2HQFA 3I9V9 1BE4A 3LP3A 2XSJB 3CCEN 2FJBB 2KTQA 3M2VA 4DV0F 2MGZA 4TQSA 1F5BA 3M6VA 4DN9A 4XK8C 5E2QA 3H46O 4NLVA 2BTFA 2EKNA 2Z4PA 4NZ7A 3CETA 2M3DA 1RDUA 2NUUG 4BBYA 2F4FA 2YPYA 2RRBA 3ILLA 1CC8A 1NK6A 4FS2A 3OUYA 5F0WA 4IOXA 2V63A 3KLIA 2GGPA 5AFUH 3CCUS 1R8HA 1SJRA 1WC3A 4K4XA 4OIXA 3MMCA 1FCAA 1LCUA 2BQUA 1WTFA 3GG4A 3HBTA 4E7IA 2VG7A 2OPRB 2CQPA 1R0AA 3V81A 2FTRA 3WX8A 2FJAB 1OPIA 2HMIA 4CJKA 1OS5A 1TL3B 4CNYA 1WACA 3P5JA 4BRKA 1FEHA 3KNGA 4DPXA 4J9PA 3CJKA 4A47A 1VSHA 1VI7A 3UPFA 3A1YG 4B1XB 5EX5A 4N8NA 1RBRA 1REVA 3DLEB 5J2NA 5T41A 3U8XA 4DLGA 3VETA 5DDPC 4YOXA 2PFUA 3MMBB 3BF1A 3SAGA 3ENQA 4FJXA 4E7JA 2CGLA 4NLTA 4XPCA 4EZ9A 1WC5A 2ZZTA 4DF8A 2NLXA 4MTPA 2HHQA 4IO1A 3WNHA 1ZA1B 4JI7K 2VQFF 3BM7A 4IG0A 3UN2A 4IG3A 3H2LA 3GJRB 4X84A 2FGOA 4ES2A 1K8KB 2IVPA 4BRIA 2DTUA 5JVHL 4Z4GA 1IKYA 2LQ8A 3HULA 2YWHA 2W9CB 4HKQA 4CK1A 5BR9A 1U1NA 4W90B 3OYMA 2JWNA 3HSJA 3MECB 5B0BA 3KLEA 1T9VA 2WFBA 1K47A 2L9DA 3FSXA 1JJ4A 1N33K 4DDFA 4IZ9A 1T03A 1FD8A 1S72S 3D0IE 1RE1B 1WHWA 1NMEB 4OKKA 3OYHA 5CHIA 1WORA 2X1GA 4MKAA 1U1PA 4EHTA 1QZ6A 3MCSA 3CCES 3CM6A 1P6TA 2ATCB 4MIWA 4AH9A 1KOHA 1YX2A 4Q0BA 1VC0A 2NNWA 3MAAA 5D6GA 2ZZNA 4EYIB 2D3OR 1G1XA 4EAHD 4NLWA 3FMBA 3ID8A 1VQOS 3MWTA 4U6PA 2WVBA 3SIPB 3SUNA 4ECUA 5KI6A 2OFHX 4CEFA 2UZAA 3FQKA 4CGFA 4MYUA 2KJVA 3THWB 3T1HJ 5I3QA 3E9OA 3Q0AA 5EWGA 4JRPA 1RBSA 3BKFA 1DJ0A 3FBFA 3VPZA 2Q3SA 4ENOA 2QC3A 4DOZA 2VOPA 3E3XA 4JI1K 4JKFA 3C6TA 2IRXA 4ZVUB 2Q1LA 3ENAA 4L3KA 4Y3CA 1UFWA 2IHR1 1V3ZA 2FJWA 4DV5F 3GJTB 3EZOA 5A8KB 1VIXA 3AVAA 3SCIE 3S3MA 4HHTA 2HQIA 1JL2A 3SPZA 4FO0A 3CD6S 2QMUB 1LAWA 2HF4A 1E3MA 4I4BA 2MSSA 3Q7BA 4KV8A 1C1CB 4F02A 3HVRA 2LEAA 1NWKA 4DBQA 3H98A 4M1KA 1WC0A 2C2EA 2CUYA 3WXJA 2VFUA 2R7YA 4XTTA 1J6ZA 1VBXA 1UW4A 1IJJA 3CJTA 4KAIA 3DGPA 4LF7K 3LDPA 1U09A 3AJ2A 4LFAK 3LAKA 1I94K 4FLVA 4LRDA 4F25A 5KFIA 4DV3K 3WXMB 4MH8A 2VGNA 1K1QA 3K57A 1XK8A 2XZWA 3TO8A 3IDHA 2MPUA 2KT3A 4BY9C 5DZ7A 4DR7F 2P9EA 5DO2A 3AO5A 5K8PA 3NF6A 5GAGP 4OI2A 1RWXB 4FJIA 3IM8A 4ZPTR 1VQMS 4H5TA 1RDCA 3W8GA 5KPRA 1HNXK 4LF4K 2P9SB 3D2EA 2ETJA 1EKSA 2MQMA 1H38A 3EGWB 4E8UA 4X66F 4MLEA 4OZ2A 2GNKA 1ELOA 3MR3A 4Y0WA 1TKXB 3P83D 2IVFB 1Q82T 3SEOA 4QR2A 1DURA 2NXUA 2HLTA 4NRTA 3PIPQ 1H98A 4O0NA 4C0OC 3IM9A 5KG7A 3SZ2A 3T5LA 2RMLA 1TL7B 2BACA 5B0GA 2ALYB 3R9PA 4Y00A 1KAYA 3CCQN 3VQSA 3NCRA 1HHTP 2GMHA 1QAIA 2U2FA 2YKMB 4U7BA 2XS5A 1GLFO 1SJFA 4A8FA 2IM2A 1OYDA 4OHYA 3ILIA 4PXDA 3LDOA 3AVIA 3VGKA 5AJ3K 1RWVB 5C42B 1ZS6A 4TU9A 1MWYA 4CM2A 4TKTA 2AEMA 2XS2A 4RNMA 4PAAA 5A6PA 1U2VA 1XR6A 3TVKA 3VALA 4CK3A 4GVMA 3UR3C 1FXXA 3MOJB 2W40A 4JV5K 3J80O 3PTWA 2O8CA 1ZA2B 3KKSA 1NNEA 4OPKA 5KFVA 3RMAA 4CGJA 3EDRB 3MM7A 3IGVA 3BGFA 3O4WA 2E6MA 1DLOB 1FDNA 3SCLE 1C4AA 3VGVA 3HTVA 2F5GA 4NB4A 5FLXY 1PC4A 4QR1A 2KZZA 1UCNA 2J8SA 1CZBA 4FPIA 1H0HB 3IFEA 2ZH3A 4KHRA 2KN4A 1RTHA 2P51A 3CD5A 3Q8VA 3VEYA 2OO4A 3F2KA 2HWHA 1P27B 2E44A 4PG4A 4QU7A 1QE1B 4UTGA 3PZPA 3BEGB 1CZ9A 4YR3A 2A1SA 4CW7B 1V3RA 2I1RA 2CG8A 2A0FB 4RO0A 4YORA 2P6SA 3CDEA 1IBKK 1NM2A 2ZDPA 3IBCB 2BGGA 1HBNA 2VFSA 4YY3F 4GV9A 4FPBA 1S1XB 3WQUA 3A5OC 4WFNQ 4PWUA 2D3ZA 4PG5A 2BQRA 5KFWA 4WYLA 4O5FA 4TSXA 3HZEA 2HFOA 4CECA 4YOYA 4DV2K 2HSEB 1C2PA 2WUSA 1O13A 5AE3A 1CJKB 3ET6A 2H51B 3JAMO 1FERA 2VFVA 2MKIA 2ZD1B 4M3TA 5DG9A 1TK5A 2LDYA 2UUCK 4NLUA 3SMZA 3QB0A 3AO2A 4KHPJ 5SUHA 4C11A 2WRMA 2G0CA 1XNRF 1OVQA 1GLJO 3QERA 2RUSA 5LY3A 4DX6A 1ESVA 4N47A 3BREA 5THWA 5KRTA 3CJ4A 1L3SA 5TKWA 1X4AA 2PFDA 2P9NA 2KI2A 4PXBA 3IMXA 4FJJA 3W5ZA 3L2WA 3D2FA 2A1RA 2JX2A 3AVKA 2ASPA 4DU1A 5C0YA 2Y1RI 5E0OA 1KQFB 4HVJA 3NBPA 2RB7A 1ZTTA 2ZWPA 2CQDA 1NXIA 1TYQB 4HLBA 1SB6A 3VEVA 1KHVA 3QESA 1D09B 2MKHA 3M05A 4WYWA 3QICA 3T5KA 2O8BB 4ISEA 3M2VB 1KEKA 2JGUA 4FCYA 3G82A 1FTRA 4LF9K 2Z2MA 2OJ3A 1VQ5N 3R5GA 4Z0UA 1UA1A 2GVZA 3UWTA 4OYZA 1NJXA 3ZTSA 5KPTA 2Z58B 1K73O 4OJHA 3DFEA 1U4BA 4BACA 3T19A 1HARA 1RISA 4YR0A 3F73A 1M90T 3K0SA 2NUBA 1KTVA 2C22A 2GV1A 2K2PA 2HNYA 4Z4EA 2JH3A 3OUYB 4V19X 3NAIA 3R9LA 3OY9A 1CQNA 3KLIB 1JLCA 2GGPB 2HVIA 1HA1A 1V9OA 3MMCB 2V4QA 1TKZA 2DEJA 2VG7B 4BRQA 2B7CB 3HHEA 5L8RC 1R0AB 3E8OA 3V81B 5FPNA 3NMAA 3MDQA 3SMSA 2HMIB 2OEJA 4CFBA 1X60A 1Q7YT 4IRDA 3QT5A 4YDXA 4CEZA 2MZRA 2VONA 1KVIA 1N5YA 3CJKB 1V3SA 5KFFA 2GV9A 5DDRC 4YNQA 1VQNN 4P7VA 3BQ2A 2JEJA 2FXUA 2JOQA 1REVB 2HIQA 4I64A 2D3O1 5J2NB 3WQTA 4Q8FA 1QJHA 3LWMA 2R7VA 3HSDA 4C8ZA 1WSVA 4ZPDA 1ZM2A 3I9ZA 5KGXA 3DDKA 5SZTA 2BBEA 2IJNA 1VMBA 4CLPA 2UXCF 4BRCA 4DTNA 4IG0B 3M2RA 2CH5A 1OPZA 1L3TA 3OVNA 5F8JA 3HK2A 3HKWA 4XDCA 1IKYB 1VQSA 1VBKA 3SI8A 3RSEA 1Z25A 5E5NA 4KTWA 4BRAA 3ALYA 2HF3A 3A12A 3BEXA 2GS8A 4LF7F 3D7SB 5F0XA 1PYSB 1QQCA 4OPHA 3CD0A 2IJFA 3OYDA 3PIPL 3KLEB 4GMJB 2IBOA 4DV3F 4UY85 1RA7A 2BM0A 3CXCM 5BYRA 1T03B 3TR5A 2GQCA 4LF5J 4DUYJ 2XMKA 1VQKS 2GHWA 5AQJA 2X78A 1HBUA 4DCOB 2D5RA 1IUJA 3HVAA 2ZDOA 4F3TA 2G2YA 3CJBA 1VFJA 3NNHA 2G8HA 3EWGA 1GOAA 4Q0BB 4YS2A 3WT0A 3AGKA 1VQ5S 2OD6A 1NBEB 1T9UA 3R5CA 3CCVN 2MLXA 4MKVA 3WNFA 4BWJA 1NH8A 1NSPA 2O1PA 4DL3A 4CO5A 4DS4A 2CQIA 2VQEJ 3MUTP 3LGHA 2EFOA 3FLCO 1UZHA 1BHLA 1CSJA 2D9PA 4ZVRB 3LTOA 1UWAA 3RB6A 2IJRA 2RKIB 2AJ4A 4EHUA 4C1NI 3O9UA 5AXKA 4W5RA 2BUNA 2HQ3A 2J5AA 2H5EA 3DAWA 3QWUA 4LR7A 3CJSA 1JLEA 1DAXA 2CJBA 3D0PA 2DKOB 3TJ9A 4LQ9A 1HX1A 3BR9A 2GO9A 3C6TB 2JVRA 4U67Q 2KYZA 3NE6A 2V8HA 3U27A 1NKEA 4C0BA 3FBCA 3D6HB 3ETMA 2FF6A 2WVDA 2C2DA 3FRYA 1CJVA 3AJDA 4ZK7M 3GBTA 1YIJS 5DS7A 3F9KA 1SPBP 2B4OA 4KH0B 3LDSA 4QWDA 3T1HK 1VQNS 4BG8A 2I7NA 4KV8B 3CCLN 4QS8A 3LGNA 5AQRA 3N6LA 4BDYA 3PV8A 1HKBA 2Z56B 2C2KB 2N3OA 2R4FA 3VAIA 1HWJA 2Q36A 3HD1A 3L4IA 1SZ2A 1WSRA 5KFHA 2YKQA 1C0FA 2A5XA 5KFKA 4PWDA 4EBEA 2Q0RA 4WFNL 3VVTA 3MX2A 4KH4A 5AE2A 2VYPA 4I7FA 1H73A 5DM6Q 3J7Z5 3G25A 2MKYA 2CQHA 2UYTA 4YOUA 4DTUA 3R7NB 1GOBA 1FFWB 4ZCKA 3AO1A 2UV8A 3Q83A 2G4BA 5DDQC 4C48A 2ASDA 4CF1A 2OTJN 4CYUA 3ATUA 3QLHA 4CO3A 3PRVA 3TA0A 4RPFA 3P38A 1YQHA 3JB9k 2XY6A 2D4WA 3D2EB 3DJCA 5L9XA 2W9AA 1HFEL 3KJFB 1WELA 2F40A 3Q89A 2CG4A 4AHTA 2RHSB 1RI7A 5HK4A 3MXJA 3L95X 3NOCA 4RW9A 3NAEA 5HRRA 2DFEA 2DHAA 4PPZA 1NZAA 3M1FA 1RTIA 1B3TA 3T1YF 1EX8A 2YHWA 4DPYA 2E20A 2HBZB 4O8KA 3A2FA 4FVCA 2W9BA 2AD9A 4DTSA 4ECVA 1RAIB 2AHOB 1RWWB 3DLGA 4M3WA 1P1TA 3T5HA 1Q8KA 1W25A 3LM9A 3WIVA 1RYRA 3H5YA 3MPWA 2OHDA 4U9RA 4M5DA 4WQ4A 1MWKA 1FNOA 4ID5A 4EBDA 1DQ8A 3HHLC 2HZVA 4I6MA 3ZEUA 4Z4HA 4FLYA 2H1YA 3IXQA 3V6KA 4AM6A 4NLDA 3RBXA 3I33A 1U2VB 3ZZTA 3CCLS 5AQPA 4BHQA 2IDEA 2O8CB 2AT1B 1C1AA 1NLVA 2CPJA 2P9GA 5BPNA 4BQZA 3MM7B 1SH0A 3GSIA 4J9QA 1FHTA 2RF2A 4C7QA 4ZLLA 2J9CA 1BD6A 1QS4A 4WKYA 2FVRA 1F9FA 1YI2S 5EGYA 1NK7A 2A18A 2DHSA 4H0YB 4YR2A 3UCUP 2L9NA 2ATLA 2K7KA 3RW7A 1SQFA 4LSNA 2RQKA 4YOVA 2HHWA 5ETRA 4CBUA 3QIDA 1VQPN 3GYGA 4RUAA 5K9FA 2WOMA 4Z37A 1IM6A 4B3MK 3ZTRA 1VLOA 1JLGA 3EUNA 2Z2LA 2FVQA 4E7KA 4O3SA 3M30A 3M8QA 2QE5A 2LSNA 1YJ9S 4I2QA 2F4VJ 4ANDA 2KH9A 2XZTB 1HBNB 5SWMA 5F9LA 4WPAA 4CHQA 3QGHA 2PFFB 1KRPA 4DL5A 4A8QA 2BRLA 3CC7N 2V69A 1VQ6S 2E2QA 5EOYA 5KOWA 4CO1A 1T05A 3KUEA 4O55A 1WUAA 2CZVC 4RG8A 4TN2A 1TUWA 2HGLA 4BC4A 2VGMA 2UP1A 2FLLA 4OKEA 4IDKA 4NLQA 3MCMA 1VSEA 1APSA 5K5MA 4ZPWR 1KHWA 3CPWR 3ZSQA 1M1GA 4HUGA 4C11B 2DO4A 4M42A 4A8YA 1GMWD 4UF4A 4OZJA 4TYAA 2BUPA 3AXMA 3V2UC 1S1UA 1U6ZA 3CF5Q 1U47A 2XRIA 4J5OA 2KYXA 5HSPA 3FZLA 1EQYA 3X3UA 5DLFA 3I82A 3R1XA 3QFUA 2P9NB 4K0KJ 3O8WA 4L76A 2BE9B 2MQLA 2HW3A 4MAKA 3PLAA 2OTLN 1S97A 1PJ5A 1FRJA 3D2FB 2I0XA 2XMUA 3UVJA 4H54A 4KKOA 1NPPA 2APOA 1G2EA 4KB0A 2P9CA 4DSJA 3O9SA 1XNQF 2IBKA 4PXCA 1WDTA 3OJUA 3HFZB 1R6VA 1NJWA 4LR9A 4U67L 1RWUA 3G82B 1K0VA 3O1BA 3EKSA 2BEFA 4EZ6A 4DTRA 4O3OA 3KZBA 3AQPA 1YRTA 1T0TV 3D5MA 2GVZB 2ASLA 1SS6A 3ZCMA 1Z1ZA 4F9OA 5JLHA 4ZVGA 3C6HA 1IJEB 4CH1A 2IPOB 1F2GA 5GADI 2NUHA 3HHDA 4JI4J 4OX9J 1VQPS 2MDAA 4K8ZA 4A8WA 2O3DA 4JI0F 3QNNA 4DV1J 4DPWA 4JK7A 1MN9A 1PJ6A 4LT6A 1YUWA 1QVFR 2HNYB 4GVLA 3NF8A 2VC1A 1S49A 1YG0A 4KPYA 1JLCB 3PUFA 3T9ZA 1DZ5A 3R1LA 2VG6A 4MDBA 4FK2A 1TKZB 2C3YA 3M2UA 4DR4F 1NGAA 5AQVA 2D41A 4ED7A 3IA0A 3JSBA 3RTVA 4DQPA 4M5KA 2MZ1A 3Q2TC 5KT6A 5AQOA 4P2SA 2Q0UA 3NVKA 1N32K 1YVFA 4NZ6A 5L46A 5FLXU 1N34F 3PW0A 1WBBA 1N5YB 5DM6L 2UUBJ 4G3IA 2OMOA 1SAZA 4G1QA 1C1BA 4UOFA 2GAHC 3IP0A 4DU4A 2W7PA 1FJGF 3O3GA 3PCOB 2DGSA 4Z94A 2H4WB 7FD1A 2F8HA 2IVMA 5ITHA 4W5OA 4FWLA 2OPPA 4DUZJ 3PXGa 1NGDA 3QMQA 3DRRA 2UUAK 4WF9Q 1YJWN 2R8HA 3RSEB 3KJVA 2OEMA 3W62A 3BZCA 4NLOA 3QSYB 4RWXA 2ZC3A 2VBYA 3M6UA 2V2QA 4LSLA 5LJ3Y 4ECTA 4PKHA 4KHYA 3OYKA 2ZITA 5BR8F 3L3CA 4C4WA 1CJTA 2K8GA 2OTLS 4EO6A 4IFYA 2FBTA 3OFFA 4MJKA 1T9YA 2FSNA 1BU6O 4CJFA 1HBUB 2FB0A 3CFOA 1EKEA 2GVDB 2LU1A 3EY1A 2XQCA 1IKVB 5HVGA 1S79A 5JMNA 3ZZPA 1U8WA 3NNCA 1ZM3A 1RWMB 2Q31A 3RG6A 3DLRA 3V1OA 4BDZA 1HJOA 3OYJA 2WB1D 2RD5C 2RE2A 1FRHA 3MUVP 4WIQA 4O3NA 2V9KA 3D6RA 4B02A 4LF5K 1IBLF 1OH7A 4DUYK 1P8GA 3AARA 3BGOP 3IC1A 5G4DA 1HNWF 4CLKA 4OKJA 3IBWA 1F5AA 3NWRA 4E7LA 4WBFA 4LY7A 4XEIA 4C8OA 2DO0A 3OVBA 4EWTA 3CI5A 4CZLA 1JLEB 2XYGB 3M8YA 1RCHA 2P5GA 4YB7A 1U04A 4WK1A 5HP1A 2XG8A 2P9PA 1M5PC 3BO4A 4MFBA 4I6WA 3ZT0A 1SUQA 4DG1A 1EJ7L 2ZH6A 3L09A 1GX6A 3OL8A 2DGTA 2HHTA 4MIAA 2C28A 2HSTA 1HYSA 2VQEK 3LZIA 3CM5A 1LNQA 2HMPA 4E19A 1CJVB 4UY8O 2V8VA 4DR1F 4B9VA 2L3MA 5K14A 4CO0A 3KKFA 5K20B 4IUFA 3M6WA 1WOQA 3MMJA 2W2PP 3VQTA 2WVEA 4CEDA 1WKKA 2DGWA 1ZZNA 4NLGA 3EPIA 2VPWB 3KLHA 3K5OA 3WHIA 3GDQA 5F0UA 2Y9HA 1GTEA 4PWDB 4F4XA 4MQ3A 5E84A 2ZUGA 4GKKJ 5ETVA 4H0VB 4DI6A 4Z7YA 5CD4H 3ZT1A 5C2FA 3KJNB 3H1VX 2JEGA 4JOUA 2NRWA 4WZQA 3ZSVA 3O2IA 3G86A 4B3RK 3DRSA 4B1UB 2V8PA 2ZZMA 3TQEA 2XMTA 3MXIA 1U49A 3FRZA 5E3RA 2EI5A 4KPCA 3V5RA 1QHTA 4CYUB 3UNYA 1RDBA 3LOUA 4JRQA 4B3MF 4QOZB 1SQGA 1YJUA 2G2OA 3TSUA 2YI1A 5GAHP 2BR0A 1SL2A 1ZBIA 1AZSA 5KFQA 4JYAF 1YJNN 5M2PA 4Q8EA 2R3VA 1KFSA 3CF5L 2CPFA 4FJGA 3AVNA 1K9MO 3VN5A 4RW9B 4YEAA 3A3OB 2F9JA 4ZN3A 1X4BA 2QXLA 5CAAA 2IY5B 2VDHA 3VGUA 3ZT4A 5IV4A 2W9BB 1XI1A 3SFUA 2A6OA 2K1RA 3DLGB 3LO3A 2RQCA 4LRCA 4D3HA 4KHMA 2QTDA 1Y9OA 3MPUB 1FWPA 4DTMA 3O5BA 3HD2A 2GBZA 1BQNA 4KBOA 1ZBTA 1BISA 4M5DB 4DZ6A 2H5JB 3BBFA 2E5LJ 3H42A 1SI9A 4ZCMA 1UVLA 2B9YA 4FWPA 2EW9A 2P9KA 3I6PA 4WFXA 1LWEA 3FKBA 1Q81O 2DHHA 2QN6B 3DLHA 4I6MB 3ZEUB 4K8RA 2LA4A 5JMVA 1JCFA 4HDHA 9RUBA 2GC8A 5KFUA 2F7VA 1J5EF 4RR5A 1VQLS 3TAPA 2HBJA 5AFUA 4GKJJ 1TK0A 1R0CB 4AM7A 4Y2MA 2AGQA 4A2BA 2RHQB 3H3NO 4NEZA 1P1LA 2BM1A 2QIFA 2IVNA 2ZHOA 3GOIA 2MQNA 3PW5A 3EZUA 2RF2B 2JEFA 4QCLA 4HT5A 3UCGA 1MU2B 3MWBA 2V52B 4CFAA 3Q8PB 1TKTA 5KG5A 4LSNB 5AXLA 3ILJA 1NPRA 2DTJA 1FWLA 1Q8LA 4OZ5A 4RNNA 3SQ4A 2PY5A 5IWAJ 2WOMB 2WSFC 3G8QA 4FYVB 4OJ1A 5HOOA 4I1TA 1JLGB 4M3ZA 5K8NA 2VUGA 1KFDA 1SC3B 3TOQA 5I42A 3M8QB 3M30B 4FN5A 3JSMA 5D15A 4DV7J 1WNEA 4I2QB 2FHJA 3NG8A 3U6FA 4DX8H 3T5JA 1L3UA 1DY3A 2AU0A 3N4PA 4IFVA 3GIIA 1K73T 3FDSA 3I96A 2B7BB 3H5UA 1RXOB 1EARA 1Z05A 4DSLA 1A5WA 1ZBHA 4WF9L 1X9SA 2HKEA 4EEYA 2W1BA 4CJWA 2QK9A 5KGWA 1N32F 3C0BA 4FJNA 1EXQA 1KC8T 4QS9A 2B4PA 1GEHA 1T05B 1BQXA 1VRQC 4O0IA 2IGIA 3GR0A 4NXMK 1C0UA 2VA3A 2GW8A 2OIHA 4IDKB 2F4VK 3ZSYA 1XMQJ 5CZ1A 3R7BB 3C6UA 2JLFA 4Y34A 2FIUA 3HI9A 3CB4A 4Y0FA 2P9LA 4B9QA 2DY4A 2AP6A 4USIA 3TZZA 2JVOA 4FOIA 4K2XA 2F8MA 3K17A 4OZ0A 4RW8A 1BI4A 4XIUA 1S1UB 1VBZA 2YKAA 1HYVA 3RYLA 2OSRA 3BPDA 1FRLA 3BYRA 3SMPA 2UUAF 2PYLA 2E29A 3BDEA 3LALA 3OTOF 3HO1A 4BR2A 3EJMA 2Z30B 2FQQB 2IMOA 3NHGA 4DSKA 1Y11A 3OFGA 3DOMA 2Z2YB 3UVJB 4KKOB 4QPXA 2UXBJ 4N7TA 4ID1A 3VEOA 4LF6F 2CPYA 1HWIA 1IBMJ 3CFRA 5C25A 4QIVA 5KFSA 2OGUA 5D4PA 4CLTA 4JNEA 2Q66A 3VQ6A 1KN6A 3QQCD 4NL5A 4JI5J 1OH6A 4K0KK 4YFUA 3THPA 4Y2AA 2W41A 5AQFA 2MY7A 1WN7A 1O0PA 2DNOA 2KLAA 1DBDA 4B08A 1FFSB 4UOGA 4B9NA 4FWSA 5AE1A 2XY8A 2NZTA 3ENOA 4NCBA 3HZ6A 3BH7B 3CSKA 5M1PA 2CDQA 3BKTA 3W60A 1VLYA 3EEQA 2LYVA 4F0MA 2VG6B 3IFRA 2ADBA 3FR0A 4AQYK 1A5XA 2J0SD 3PRDA 2IRYA 4XH1A 2M0GB 3IR5B 2HGMA 2HFZA 4CLWA 4JI4K 4F8RA 1BUPA 4OX9K 1LAVA 4ZVTB 3WEEA 1CBKA 3O4QA 3TAMB 3B8AX 4DV1K 3OL9A 4QIWD 4GY2B 3ENVA 3MCOA 2KB2A 2RS8A 3Q8YA 4OZ1A 2NXJA 2UVRA 4JI6J 2B56A 4DL0C 4G1QB 4M63A 2YKPA 2JWKA 1T9TA 4ZITA 1RBVA 1VK3A 2QFIA 2F96A 1OY6A 3NGTA 2VF3A 1IM4A 2VU5A 4YOEA 2WC9A 4NX9A 1TTHB 3LP2A 5F9NA 1FVQA 1M1HA 1YJTA 3WX4A 2ASMA 2AEJA 4CJ7A 4E89A 2RN2A 2OPPB 1R43A 3OTDA 2W7OA 3C7NA 4FZYA 4BC2A 3DRRB 4JEPA 2UUBK 4ITSA 3KJVB 2CQ3A 3GZ7A 4JI2F 1N36J 4N56A 4F4KA 2DR5A 4PKIA 3ZTOA 2BOAA 5KFRA 4IDHA 2FLNA 5JVGQ 1HD1A 1CJTB 4X4TA 1XERA 3A5NC 2FZGB 4B3RF 4X4NA 4KGKA 3GLJA 4NCGA 3W1YC 3LDNA 1RSCA 1D8YA 1GAOA 3DXKA 2MKJA 4URSA 5CHCB 4DUZK 3KJQB 4K4VA 2EX3A 4YOTA 4KGZB 1PCAA 1SXLA 4M5JA 2GJ2A 2ITGA 4Y1DA 1AFJA 3C15A 2ACMA 2FDNA 2CAJA 3TTDA 2CQ2A 3EM1A 4LFBK 4LRFA 1BIZA 4YUDA 4FM1A 3B78A 3R6LB 5JLFA 2MQ8A 3HM8A 1CLQA 1XUPO 1NEEA 4H5RA 5IV3A 3MN6A 5A8WB 1SQEA 2CJAA 2I8EA 4AL5A 1Y7PA 2BE2A 4HTJA 4OV1A 2VBXA 2VOOA 2PO4A 3PVXA 1TMMA 1M5KC 3DOLA 2RAQA 4A48A 3MHYA 4QR0A 3DYAA 1H2TZ 2OA8A 5HP1B 2P9PB 4ECWA 1SUQB 1ZBUA 2W6LA 2CQ0A 1F60B 2NSCA 4WU2A 2B6AA 1HYSB 3PHEA 4OGCA 1VSKA 5HLFA 4FLZA 1LWCA 2HVEA 1KBRA 2XCPA 4LC9B 3NGZA 4USWA 3PY8A 3P1GA 1Q79A 1N8RT 5K14B 1YT3A 1RGIA 3P8BB 4HCBA 5HROA 1KP6A 3RMCA 3PG9A 3LAMA 4O5BA 3K58A 3UR0A 3OYLA 3EVOA 2EVZA 4BRHA 1EAYC 2G2ZA 2V51B 1YVUA 2HBLA 4CEEA 3NS7B 4FLWA 3QYYA 1XHZA 1H1VA 4BWMA 4M5NA 1WF2A 5BYQA 4OI6A 3QEPA 3IS9B 1HBMA 2R8JA 1RDDA 2FY8A 1KAZA 1JNZB 5FPMA 2WW8A 1DQ9A 2XI3A 2FUG9 5A0YA 4GVEA 3VGLA 3X1LB 2DBBA 3DRSB 5DGBA 4A2AA 3KYLA 1NDLA 2YQ1A 4CLSA 1LWFB 4FJKA 3AO4A 1BL3A 1VK0A 1OQ6A 3NMUA 4X65F 4CVNE 3K59A 4K2JA 4ZPAA 4AUKA 2YX7A 4YDDB 4O3QA 3CERA 1VRTA 2WSCC 4KRWA 4GKKK 1VC5A 1AZSB 3AFGA 2OD4A 3AT1B 1XN9A 4CZIA 2DR6A 2AZ1A 1H74A 3KD5E 3Q8RB 3BYPA 1W2BR 3DXMA 5HMYA 3EGNA 2ROGA 4PZVA 2P5OA 2ZGZA 1KAXA 1AUSL 3VAKA 2OLWA 4N5SA 2LXUA 1RWKB 1NJZA 4DL6A 4ZHRA 1OJ4A 1CS4A 2K1RB 2V6AA 4BCAA 4NXMF 4DR3F 4M5MA 2E1AA 1KVAA 4CO4A 3MPVA 3JTOA 1BQNB 3PACA 2Y8WA 2KRRA 4B9MA 3EGZA 4TVAB 3C16A 3I56S 2HK3A 1GFWB 3HP9A 3SXLA 5D4LA 3LP0A 8AT1B 3S7RA 2FZCB 2P9KB 5B09A 2ERRA 1S6OA 1LWEB 1IG8A 5C24A 3BY5A 5H1SV 1FKPA 3AQOA 5B7WA 3ONQA 3OBIA 3L2UA 5DETA 4CT9A 3HX9A 1RBLA 3HPOA 2HG4A 3K89A 2UU9F 3WC2A 4A5BA 2V94A 3BQ0A 4W5QA 4ZDNA 2YBVA 3AA3A 3G0ZA 3NGKA 5MAOA 2V68A 4ZVQB 3TEHB 5J2PA 2PI5A 2DGQA 4CJ3A 3CCRN 4IXCA 1PAUB 1VSFA 4EFHA 3UCZP 3G6XA 3FCWA 3N5FA 2QWNA 3EVMA 3W7BA 2E9RX 3MTJA 1B9DA 3TSQA 2E5LK 3J7YU 1EB0A 2MHEA 1XIQA 2BW2A 1YHQN 3D3CJ 4C3MA 4J9LA 4CFDA 1QAYA 2W2MP 1TKTB 5BN8A 3SQOP 4CZJA 2EK6A 2XWXA 4FVUA 1HWKA 4P73A 3P3DA 1T44A 2NCKL 3PM9A 1Q9XA 3MD3A 4GKJK 4J2EA 4F26A 1RGVA 2H3GX 3FCHA 3GG0A 3OHAA 2JEIA 1WDDA 4H4MA 3H5SA 1KVJA 1JKHA 3FFKB 2BJDA 2F7TA 3QFPA 3UDCA 5I42B 3J7YI 3JSMB 1TL4A 2MHNA 3BSNA 4B1WB 5FIIA 5J1EB 5CABA 5KFMA 3D0HE 4DTOA 2QA4G 4IFVB 4ILRA 3CDWA 3D4JA 4DFKA 1HHSA 4AQYF 3SQ2A 1FDDA 3BGRA 5KFTA 4ED6A 4GC6A 3RAXA 4H4KC 2WB4A 4M3XA 2MLYA 3TW0A 3MFIA 3DLEA 2BKOA 2YY3A 1PO6A 2YPZA 5IWAK 2KFZA 2UXDJ 3CXCR 2QWRA 1B4SA 1KQGB 1QSSA 5JVGL 1C0UB 4DX7A 5C2GA 1KXPA 5IT4A 2MB0B 4A57A 4E1NA 3OLAA 1TUVA 4DV7K 2HQCA 4CJSA 2H4YB 3BGLA 2C42A 3C6UB 3HLUA 5ETTA 1NUEA 2P9LB 4CESA 2EWSA 4JI3F 3SDEA 3FBEA 1UAXA 3H6EA 3DGVA 1RDRA 4E98A 3IBFB 2W9CA 3HF5A 3V9SA 1RT6A 4RW8B 4DX5A 1BI4B 2NRVA 3NS5A 2QLWA 1IR0A 1M5VC 4CF9A 3UN5A 1L5UA 4V19S 4MIBA 1ASWA 2DISA 1TUUA 5IQ6A 2PD1A 4ERDA 1RILA 2E1ZA 2PN6A 4U8VA 1CXUA 5CXTA 1M90O 3D9BA 5LL6Z 3JQJA 3MEGB 4U96A 5E41A 1O1WA 5BXIA 1X5OA 4DZDA 1XMQK 2YTCA 3R2CJ 4K25A 4NA2A 3DOMB 4ELUA 3RJMB 1FKAF 4USJC 1OSCA 3CCRS 1L3VA 2O8FA 2HNZB 3LZJA 3M1VA 2YCHA 2MQPA 4YB5A 2RIJA 4IQMA 2HHVA 5EX0A 4K43A 3SQ0A 1NGBA 1KD1O 3H8YA 5C25B 3ZZOA 2FJVA 6AT1B 3ZLJA 1T11A 2VFTA 4FKXA 1AFIA 3VA0A 3Q8UA 2I7PA 2FGCA 1RTJB 3SCXA 3THWA 4N8OA 3RMDA 4DS5A 1OQ3A 1LWXA 3GFXA 5GMDA 4LFBF 5KFXA 3F5TA 2AJ2A 1DRZA 5LJWA 4RTFD 3VQ9A 2QLXA 3QINA 1WKJA 1ZETA 2P6TA 4NLYA 4DSEA 3I32A 4BC3A 1FD2A 2K06A 4WWSA 3UO0A 1IBMK 4NYNA 4PRFA 4DFPA 1HR0J 1K0TA 2DPNA 3M7VA 3SK3A 3S41A 3CTRA 3NCIA 4JI5K 1UFKA 3DMJA 3ZX3A 1MW7A 4DR5J 2VBWA 3RW6A 1S99A 3CE8A 5AR0A 1VCTA 4Y28C 4X4OA 3WEEB 2KVQE 2E1CA 1F9HA 3VEXA 3T6JA 2A40A 2D3UA 5BPLA 3DNCA 1KKHA 1XBWA 1NSAA 1FW6A 4A62A 3HJFA 1Z4UA 3VWSA 1GLBG 1V5VA 6FDRA 3CCSS 2JLEA 3JTNA 3IO1A 4NXNJ 1UA0A 3VQ7A 3LP2B 3ZSRA 3KOAA 3LPUA 3T1AA 3MAQA 4BC5A 4XH4A 2EBEA 4J9KA 1RU2A 3C7NB 4DQQA 4M5LA 3UKUB 3CC2N 5AZIB 5E3AA 1KLNA 2GTDA 3SFGA 1S9FA 3DXBA 2X6NA 2DIVA 1SJ4P 4JI6K 5EXWA 1LEOA 2OELA 3DRPA 1VIOA 2YHYA 2DFHA 3P31A 3MAHA 4ZTFA 5KG3A 4IYQA 2BJ7A 5DG8A 1M5HA 4KTQA 4PYAA 4NCGB 3MTKA 1FKOA 5A8RA 3DXKB 5JVHQ 5ETPA 1DTTA 1YBTA 2KVIA 5KFZA 3JSRA 2CNOB 4KFBA 4JLHA 2DGOA 3HSGA 5BYSA 2ZKTA 3C15B 5D0GA 2KT2A 3RBDA 1JMTA 2CXEA 3Q8QB 2W4PA 3ZTQA 1EP4A 3MZIA 4X62J 4RUHA 2R7UA 3VF4A 3VESA 3MGJA 2UUWA 2DFFA 4LBIA 4OQJA 1KQSR 4ZP7A 3M4XA 4L3QA 2I2YA 2R7TA 4OLBA 2V4JA 1C0GA 2VL1A 2BE2B 1LOUA 2ZWOA 1R3NA 1Q53A 1A7GE 2GX8A 3DOLB 4DV4J 1K9MT 3DYAB 3BDPA 1FE0A 4NYZA 2CWXA 2F8TA 1BDGA 2LXFA 3DOKA 5C42A 4XH5A 4KI4A 4MKBA 1BWEA 2B6AB 2VODA 4H0OA 5HLFB 1LWCB 2NXCA 4ZJQA 1V5IB 1C0TB 1ZBSA 1I5OB 3QAEA 4OYWA 4AXIA 1F3VA 4U7UD 1QDUB 1ZPVA 1NK0A 3L3VA 1D4XA 3W5XA 2CVEA 2ZBCA 4IH5A 1HW9A 3H0PA 2NPFA 1AUDA 3MR6A 5D78A 4M95A 4QYZJ 3NOGA 3UIQA 2DT9A 2FPHX 3OR2A 3ZSOA 2JFDA 3HKZD 3CDAA 3VENA 2E7VA 4A8MP 1N0UA 1Q81T 2FYXA 2LP4A 4Q7AA 3SYZA 3CJ5A 2G0JA 5LMNF 1PYTA 4BRPA 2FHKA 1PJ7A 1HBMB 2UVWA 4P6QA 2V0NA 4GNIA 4LRBA 4IEEA 5A0YB 1GNKA 4GMKA 1TV6B 2QKBA 2V67A 1TZ0A 3CJ0A 1V6HA 2DCLA 4KC5A 2O8DA 4USHA 1X9MA 3KMQA 2WTFA 1X4GA 2BX6A 2WSEC 4USKA 4FPAA 3J7A1 2X74A 1VRUA 1A6LA 4HHHA 3J80U 1S48A 4GKJF 1HBOA 1RLCL 4Y1CA 2W2QP 1VRTB 3AA2A 1FVSA 1HKCA 3FZMA 1EO1A 4B3SJ 2JJ4D 4FJ7A 1IR1A 3WXIA 3NGUA 1S4EA 4OYIA 1IBCB 5KTQA 1T02A 4JP8A 2BE7D 3AOBA 4JD2A 4IQXA 2PGCA 4F04B 1EIYB 3DXMB 4KHQA 1BMQB 3M8WA 4WQ5A 4FWKA 4CJVA 4BR4A 4J7CA 1ICEB 3DLJA 5GADP 1ZAXA 2V34A 4ZHRB 3UD3P 3GV5B 2JC0A 3OT9A 1CS4B 2KFNA 4KO0A 5KG4A 2J76E 3A8IA 3D6TB 3MWPA 2QEXS 3L2VA 1R8BA 1YZ6A 4ECXA 3C16B 4OJRA 3SBGA 2CGJA 1NGHA 3LP0B 1U1KA 5C24B 4KH1B 2HOEA 1FKPB 1XEZA 4KJIA 1UZDA 3RU0A 3KLGA 4NLXA 2CNKB 1U02A 4ILLA 5J2PB 2O8BA 2B3TB 4LF8J 1XMQF 4USVA 3JXUA 1LXNA 4FZZA 2E7XA 4LFCF 4H0TB 4B3TF 4G1IA 4OHVA 1LK5A 3KG4A 2ASYA 5HANA 1SH2A 1UTAA 5CZ2A 1QZ5A 4U7UK 4F3OA 3PJ9A 1FT8A 3GONA 3N6MA 3PIOQ 1BWVA 2FBXA 3THYA 3S01A 1WSEA 1WOPA 3DM2A 2ZGYA 2CPEA 1JJHA 1YJRA 4ZIVA 1TUGB 3G87A 1F0XA 1ZOTA 4ER8A 3RBEA 1U2FA 1XQIA 1DQAA 2KU7A 1U6FA 3OSNA 4RU2A 5F8NA 1W97L 1UEKA 4LUBA 1XWLA 5IS2A 4IRKA 2AGOA 4LIWA 4H4MB 3ID6A 1JKHB 2QG9B 1DGKN 2ASJA 1IBMF 1NOYA 2H5IB 2VCPA 1O6XA 1PC5A 3ELHA 1PSDA 3V4MA 3BGRB 3CW2C 4DL2A 3NF9A 1TR0A 2R8IA 2VWKA 3H4BA 3R5DA 4KREA 2FF3B 3U1LA 3G71N 5AQWA 1IWAA 4RWTA 1HNZK 5FLXO 2BVZA 1S0MA 4CDIA 3I5CA 2O5DA 3OXFA 1WSGA 3QBCA 4NI2B 4L3NA 3HJVA 2E5JA 5GAEP 2ITMA 1RAHB 3TYTA 3KUGA 3A3NB 2HAFA 4M5IA 3ZNUA 4KB1A 1YTAA 1OH8A 2AW0A 2HZAA 2WCXA 4N77A 3OSPA 4CJPA 3SDEB 3GP9A 4QWCA 1M1KT 1RHJB 2E1PA 1UPPA 4WCEQ 2Z1JA 5AQYA 4WTYA 1RT6B 1I3OB 1URRA 3OS2A 2VQFJ 3PO5A 2QA4N 5B0AA 1R8CA 4TY8A 1WI8A 4NLRA 3K9JA 1VQ4S 1HKGA 2UXDK 4ICLA 1ZZFA 2HRYA 3HFKA 1X3MA 2HYIB 2HQGA 1HHQA 4JKEA 4CIGA 2Q6BA 1UP1A 1GOCA 2CPXA 3HM9A 2HHHF 3CCMN 4RU9A 3ULEB 1FRIA 1BCOA 1U2CA 3MDFA 5KFEA 1RAEB 1ZM9A 3C19A 2O8FB 4CHPA 3M1VB 4OPJA 2ZJRQ 3FJ2A 2F3JA 4HUFA 2HAIA 4QIEA 2XGQA 1S5ZA 3MPYA 5HO4A 2XO7A 1H72C 3FSYA 4HUEA 1H2VZ 3PO4A 3SNNA 2G8KA 4C3KA 5LMUJ 3HZGA 3TJ8A 3MK6A 4PG6A 2ZM6K 2G8IA 2DXDA 4MK9A 2RKIA 3U02A 1BLUA 2X3DA 2WTUA 1Y64A 4CF0A 1FE4A 3B6OA 2O67A 3UW1A 1GMUA 3BKUA 2GIRA 4AHVA 4MYTA 1A9NB 3TUZC 4KSEB 2GELA 4OFZA 3VOVA 2KG1A 2MKKA 2UV8G 2QLFB 5T7LA 2C2RA 2R7QA 2CIMA 5HMXA 4YHHF 3PW4A 1R6YA 4DKWA 1XMOF 4IBNA 2ALZA 4MK7A 3WNGA 3DMJB 1RWOB 3LM2A 4C2MA 4FK4A 5CD4A 3ISND 1XR5A 4M45A 4DV5J 3GSDA 2OI2A 3NLCA 4W4MA 1X4CA 2E66A 4DPUA 2PA8D 1B0VA 4DU8A 1RWNB 1UVIA 3MM9A 1HI8A 2KXFA 3G71S 3A5LC 2ZHBA 4J2BA 3TVZA 3BBCA 3Q2SC 2QI2A 2VG5A 1NMNA 4OYOA 1QM9A 5DLGA 4ISGA 1Y5NB 5LJVA 4RW7A 1ULRA 3TTCA 4P75A 4KAZA 1HR0K 5T7BA 3I5BA 1HD0A 2GHVC 2FVCA 2I38A 4OZNA 4CLLA 4EO8A 1S77D 1XTZA 2BZ2A 3OS1A 2JC1A 4M3RA 2X7IA 4DR2F 2QMWA 2LDIA 4DR5K 4Z2XA 4BS2A 3CMAN 1IV0A 1IJFB 2LXIA 3WUHA 1D9DA 4WFBQ 3AVBA 5HBMA 3D6FB 3M9MB 4OI4A 3OTBA 3VZIA 5HMWA 3DRPB 4WU3A 3OXGA 2V50A 2EC2A 3ENWA 3AOAA 1Z2LA 1UEUA 5ETKA 4PHTX 1IQTA 3R8YA 4H4OA 4P2MA 3TA1A 1JXLA 2AEFA 4PG8A 4CEOA 4HDGA 5ETOA 2D69A 4FWQA 4NXNK 1HYZA 4CZCA 3AOCA 4J9VA 4DR7J 1JLFA 3KTQA 1FKOB 4PKGA 2UVVA 5A8RB 2P9IB 1DTTB 1VSIA 4ZCLA 4ZVEA 1KONA 5EDWA 5B0CA 2IA0A 5CE3A 5U47A 4WE1A 2HBQB 3G96A 4KFBB 4RW6B 2WW4A 5HQMA 3E01A 2YQ0A 3M8RA 4CGIA 4C6AA 3KXDA 3OXLA 1HMVB 2KRBA 4X66J 3OYEA 3CJQA 4YDUA 2OYQA 3QRPA 4P74A 3TPQA 1EP4B 2BYCA 2FJEB 1VSDA 3RB0A 2J7UA 4IKAA 1IR2A 2HVZA 1RT1A 2J6TA 3ZSWA 3W66A 3D28A 4QZVB 1UMJA 2AWZA 1PGZA 3AVHA 4DN0A 4CZEA 2V4JB 2HHUA 1R7IA 2E7WA 5KQDA 4DR6F 2W6KA 4HTIA 3W9HA 3QSIA 2XLKA 3H7HB 1Y3JA 1E6YA 1S10A 3DOKB 5F8MA 5KFDA 2FBVA 3PIOL 1Z26A 4OGEA 1J9AA 4A8SA 3DCAA 3CDUA 4X62K 1T7PA 3B82A 1YXQA 2RT3A 3AJ1A 3RB4A 4DCPB 5I3UA 2O8EA 4ES3A 4O4RA 4DHYA 3K7RA 2OFGX 2LQ5A 3I5AA 4CBWA 2Q43A 1RCOB 4K4YA 5M2RA 3TEGA 4J9SA 3AA4A 5KPZA 1FWKA 4QW8A 1FJ7A 3QJJA 4DV4K 2QL7B 1J2VA 1P9QC 4JI8F 4BR0A 4GV3A 3OR2B 4LH4A 5IT9Y 2CQBA 4P2FA 4ZKAA 3MR7A 3M8SA 4ECSA 2E1RA 1B70B 1YDLA 1UPMB 4CF2A 2R2RA 5AQLA 4TNOA 2HVHA 3C6AA 2B9XA 3EMTA 2O8DB 4B17A 4Y2KA 1XHXA 4QYZK 2AGPA 4J37A 4JB8B 1AB8A 1CQMA 1VRUB 2EXUA 1OMSA 4A61A 3TP2A 1HBOB 4UUXA 3NKYA 1WEYA 3MURP 4NYFA 4EP5A 4WZMA 1X7VA 3C46A 5L9NA 1WTBA 5D0HA 3TWZA 1X9WA 4WCEL 5EX3A 4YY3J 1F3FA 2PSZA 3PYGA 2YHXA 1TELA 3TAGA 4EYHB 3H5XA 3A8JA 4JD2B 1WHYA 3VV2B 4E3SA 3NS6A 4I69A 2QA1A 4CTAA 5GIPA 1Q1KA 2J7KA 1IO2A 4ZP6A 3CCQS 4B9SA 2FD2A 2KT5A 2QV6A 4R5PA 3LGMA 1HNZF 1HNIA 4KO0B 5KG2A 1NJYA 5AQZA 3GPAA 1ASUA 4B3SK 4PY5A 2ZJRL 1GK8A 2ZVIA 4JI7F 4JAXA 1NK8A 3MXHP 2HS3A 3UQSA 5F41A 3HMJG 2PA3A 3BZQA 3JS9A 1OY9A 1KTQA 2IMWP 4C8KA 4A59A 1XNRJ 4FOEA 2PMHA 3VF6A 5C2CA 1OIAA 1UEVA 4MO5A 4EK2A 4R0JA 4IO8A 3LP1A 1RCXB 5DK5A 3AODA 2HHXA 4FYXB 3DRXA 5ETNA 3RUBL 3DXSX 3KLGB 4DCJB 1N33F 3NEKA 1Q4RA 3WNEA 4Y6IA 5LOQA 1OH5A 4NMLA 3IAS9 2CZ9A 2YWKA 3RVCA 3ETOA 3MM5A 2YVSA 1F9EB 3ZETA 1WWHA 3J81j 4I6YA 1Z6RA 3BGUA 3H20A 1FEEA 1WC1A 4LSZB 3THYB 4E0DA 3IWXA 3DM2B 1O5JA 1Q9YA 1RAOA 5E3CA 3JQMA 1U1RA 4P9SA 1I51B 3TZXA 4DCHA 3EICA 4C0HA 2CVIA 1WOOA 3F41A 2YX4A 1ZM4A 2QWQA 2DNQA 3SPYA 5ETLA 1VC6A 1KC8O 2ZM6F 2ROEA 1M0SA 2W8LA 2IOCA 2NZ4A 3AA8A 1NSKL 3DI6A 2G8WA 3G10A 4OHZA 1KD1T 3CCZA 3IN5A 3QMLA 1X5TA 4DU3A 3PYEA 4CGGA 2I5JA 3ZC4A 5IQQA 3L7UA 2V2ZA 4NASA 4JI1F