2WOMA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2womA05
5J2MB 4E7KA 1SKWA 4AILC 1T8EA 4KTWA 4KI6A 3VQQA 4M3YA 3V6KA 5KFAA 4FJHA 3S3OA 3T19A 4DLGA 1JKHA 3IS9B 3JSMB 4EP5A 3OL9A 3KLIB 4CJRA 1D0EA 4KTZA 3OYEA 3FFIA 4FM1A 2Z1HA 4DF4A 1IKXA 4YMEA 3PX6A 1CSJA 1JLEB 2ETJA 1UAXA 4EBDA 4FZYA 3H4BA 2GIQA 1SL0A 5KRTA 3OYIA 3V9WA 3DLHA 4ECXA 2WOMB 5KFZA 3BR9A 3AO1A 2P1JA 3IS9A 2V0NA 5FROA 3M8QA 4NZ0A 4KHUA 2HVIA 3CJ0A 3HVWA 4OPKA 3I0SA 3RWUA 4YFUA 1SH2A 5CYQA 4B9TA 1IKWA 4J2DA 2XCAA 4CHYA 2WTFA 2HNZB 2GV9A 3MEGA 4KAIA 3PW0A 3AA5X 3RMAA 4JUZA 2JGUA 1SKRA 4CFAA 4O3PA 2HNDB 4ED2A 1UA0A 4M42A 4NCAA 4FXDA 1IKWB 4HYKA 4DTNA 3NGYA 1C0TA 1KFDA 2ZD1B 2IJNA 5KFEA 4TY9A 1Z4UA 4WE1B 1QTMA 3GIIA 2FVSA 1NNDA 2IC3A 5CY4A 1NKBA 1RT2A 2P51A 5HP1B 3V1QA 2HMIB 2Q3SA 2BQ3A 1DTQB 2R2TA 4LH5A 3VQCA 1FXXA 1TL3A 3PX0A 4F2SA 1S6QB 1VSIA 2YHAA 4K8ZA 1IKVB 4TQRA 3AO3A 5KFKA 4EBCA 5KFRA 4H4OB 4WE1A 3N6MA 3QEWA 4MH8A 2OPRB 3G6XA 2FVRA 1RDCA 4C8LA 3OHBA 1S9EA 2HHWA 2VWKA 1QSSA 2YV0X 4Q44A 4IRDA 4BWMA 1NJWA 3ICLA 1S0MA 2IOCA 1CLQA 3HPOA 1W25A 3O4NA 3K58A 4OKKA 1RBSA 4TY8A 2FBVA 3G6YA 1J53A 1VRUB 4RW4B 4FJXA 4CJLA 2JEFA 4H54A 5DG8A 3Q8RB 3SQ2A 2HB5A 3I0RB 1QQCA 1TK5A 4IKFA 1HMVA 3SYZA 4M3TA 3NH2A 4DQIA 1LW2B 5KG2A 3KLHB 3VQ6A 4QCLA 5KFLA 3RMCA 4Y34A 4CEFA 1LAVA 2HVHA 2W9BA 1HPZA 4CFCA 2RF2B 1LV5A 1L5UA 1NHUA 3C6TA 4FJMA 4ZTJA 2C2EA 2W7OA 4FZXC 3KK2B 1JLFB 1BI4A 4MK7A 4CGGA 4DWIA 1O1WA 3ZT0A 1T05B 1HPZB 2BQUA 4BE2A 3UQSA 2OPPA 4YP3A 2ASDA 1MMLA 2ILYA 4ECZA 3QGIA 4H4MA 5KRSA 4DL6A 4Z4IA 1X9MA 4ED6A 2XY5A 3KD5E 4NLYA 3OSPA 1WSIA 3V9SA 2A1RA 3FRZA 3QIDA 4RW7B 1S6PA 1K6YA 4C8OA 5KFCA 5KTQA 4LQ3A 4M95A 4BE0A 4BDYA 3QZ7A 1VSKA 2RKIA 3F9KA 4HCBA 1WNEA 1NK0A 4HCCA 4BWJA 1QAJA 4KE5A 5C42A 1BQMA 2FLLA 1KHWA 3HJFA 3DRRA 1Q8IA 1S6PB 2V4QA 1MU2A 1RBRA 3BGRB 3FQKA 4KV8B 4QAGA 2RKIB 4J2EA 3KLVA 4I2PA 1C1AA 5J2QB 4URQU 3NF7A 2OPSA 4E7IA 3FFIB 1IKXB 2Z1IA 5HRPA 3NMAA 3GV8B 4B9UA 1HYSB 4RNMA 1WSFA 1N6QB 2BGGA 3C95A 3HXMA 2XY8A 3PVXA 5DK5A 4K4ZA 3I5BA 2XY6A 1S9GB 2IBKA 3T5LA 3RR8A 3ITHA 3SQ1A 3LP0B 4R5PB 3OS1A 2A1SA 4M3XA 1VRTB 1RA6A 4NLDA 4F4KA 4LD0A 3OYGA 3MEGB 5DGBA 2C2DA 4WXWA 1JLQB 1RDRA 1QE1B 3QINA 5EUHA 4QWCA 1S9GA 1RTJB 1NK5A 1NKEA 4N5SA 3CFOA 3HVAA 3DLEA 2R2SA 1ZTWA 4NRTA 2FLNA 4C8KA 2XCPA 2ZD1A 4QPXA 1S5JA 4CIEA 4Q43A 4CGJA 3LP1B 1C0UB 2G8IA 1BIUA 1FKPA 4NLOA 4JRQA 3KLEA 1S6QA 2YNHA 3NH1A 3MECB 2R8IA 1JXEA 5HBMA 3Q8SB 4IG3B 2BANA 1JLGA 4DQRA 2HHQA 4W5QA 3VA0A 1D5AA 3E01B 3DM2B 1C1CB 1XWLA 3LP1A 2I5JA 4WFXA 4CEAA 3HVTA 3KK1B 5KFYA 3UIQA 3V1OA 5KG6A 1EP4B 3P1GA 1IKYB 2IM0A 2WOMA 2ATLA 1U09A 3VQ8A 2Z1JA 3KLFB 1JLGB 4NYFA 2QKBA 1XR6A 1NJYA 2O4GA 5DMRA 4B08A 2BRKA 2WONB 2FVPA 1EP4A 2FLPA 5L1JA 3CM6A 3I5CA 4FLWA 1HNVA 4F3TA 1RT3B 3EZ5A 4H8KA 4KAZA 4CEQA 2XO7A 3LALA 2WONA 1BIZA 4FJ5A 3MAQA 4ZPBA 2UVVA 3NGDA 1JLEA 4HHTA 3OLBA 5KT6A 3UDLA 2KTQA 4TLRA 1L3VA 1TV6B 4B9SA 5C5JA 1GX5A 4FLTA 4IH5A 4DFKA 3QETA 3BSAA 3NGIA 4FJIA 2IAJA 1D9DA 2BDPA 1U4BA 3JYTB 4WYWA 1RBUA 4Y2AA 5T7BA 3K5NA 4O3QA 1JLFA 5HRRA 5C25B 5KT2A 4CFBA 4BDPA 4R0EA 4FLVA 3RBEA 3HPGA 3SNNA 3VQBA 3IRXA 4DSLA 4FJKA 4FLZA 4K8XA 5J2NA 4DL5A 3QIPB 1RA7A 4DQSA 3UR0A 1RT1B 4Y1CA 4N56A 3ULDA 1S1UA 1T94A 5F8NA 2AWZA 4J9QA 4FJ7A 4EYIB 3LPTA 1U04A 3K2PA 3M9MB 1ZBLA 1BQNB 4DU1A 2QE5A 2HNZA 3HL8A 4WZQA 1TKDA 3QYYA 3DRPA 3K5MA 3MEDA 3NL0A 3FQLA 3HVRA 4DTPA 3HKWA 3DOKA 1MU2B 3BGRA 4O3SA 2P5OA 4ECWA 1YT3A 2AU0A 1BQNA 1RBVA 4LH4A 1EETB 1RTHA 1RYRA 3VQ7A 4J9KA 3L2UA 2OPSB 1K1SA 4AHRA 3M8PB 4WFZA 4DL7A 1JXLA 2XGQA 3PJWA 4I9QA 3T3FA 3MR5A 3OS0A 3HM9A 3MR6A 4LSLA 3MFHA 4KB1A 4MKBA 4FW2A 3BREA 3QEIA 4DFJA 3TAPA 3HK2A 4ZVGA 1LAWA 3RB3A 4OKEA 3ZSRA 2YNGA 2FBYA 3OS2A 4UQGA 3GQCA 2QV6A 3H59A 3IAYA 4J2AA 2OPQA 4CF0A 3ZT3A 1VRTA 2J6SA 3U3GA 3F73A 3RRGA 4MIAA 1UOCA 4ECVA 5DQGA 4DEZA 3KKSA 4FLYA 3C94A 1L3SA 4RW6B 2EC0A 3TI0A 4ED0A 2AGQA 3N6NA 4I2QA 4RNOA 4TY8B 3AO4A 4DTMA 2C28A 1W0HA 1S1WA 3PO5A 2XRIA 2XHBA 4DMNA 3NF9A 4XPCA 4QOZB 4OGCA 3KLEB 1KVCA 1LWFA 1BI4B 4K4SA 2B43A 3BQ0A 4ICLA 1S97A 2HHTA 2ZE2B 1YTAA 4IFVA 5L9XA 3MTKA 4ZVEA 2IS3A 4NLPA 1TK0A 3E01A 4NCGA 3S3NA 1C1CA 5JS2A 3L2VA 2XY7A 3NKYA 1D1UA 3CFPA 4FM0A 1L3UA 1HNIB 3S9HA 4F4WA 3U3YA 4ICLB 1KLMB 3OYFA 4IDKA 3WNEA 3SI6A 5KFWA 4ZP8A 2YKNA 4ECYA 1LW0A 3DYAA 4PWDB 3TARA 3RBDA 3H08A 3ITHB 1A5XA 4R8UA 1NK4A 3TR8A 4H4MB 1QSYA 1RBTA 4HUFA 3NE6A 1BGXT 3NFAA 3PO4A 4B3OB 4B8AB 2OH2A 1U49A 3G10A 3GIKA 4R8UB 3BQ1A 3ZSQA 3OJSA 1HQEB 2BE2A 1FK9A 4BE1A 2PZSA 3OJUA 2VG5A 1S1TA 2AGPA 5EWFA 4F4ZA 1VSJA 4CEDA 3OYBA 1JKHB 3C6UB 4O5BA 4NYZA 4TXSA 3AA4A 2F8TA 2JEGA 5HBMB 3P83D 3NBPA 3VQ9A 3NAHA 4OGEA 4RZRA 1UWBB 1IH7A 1C1BB 1GOAA 3KK1A 5KG0A 4Z4GA 4NRUA 3RR7A 4NLSA 3OVNA 2FC0A 5K14A 4EYHB 3V4IB 3RAQA 1N6QA 3ZT1A 4CHQA 2UVWA 4ED7A 1KHVA 4N76A 2FVCA 4K4YA 4N41A 3RRHA 1NK9A 4C8NA 3MXMA 2YNHB 3GIMA 1X9SA 4FYDA 5F8LA 2IM1A 4CF9A 4MFBB 1ASWA 4JRPA 4CHOA 4R5PA 1N56A 1JLCB 2VWJA 2ITGA 2FJWA 3CIZA 4DSEA 2HW3A 3MEDB 3DM2A 2IM3A 3V9XA 4FJGA 5F8JA 3GILA 1RYSA 5HLFA 3HVTB 4CK2A 3T1AA 1QAIA 3CWJA 1RT7B 2OZMA 1IKVA 3OYKA 2O5DA 4PUOA 1RTHB 1T03B 2QXFA 1RT6A 4IH6A 2DPIA 3D45A 2B5JA 2JC1A 4OLBA 4K4XA 3JYTA 1XHZA 3VQAA 1RT5A 1RT7A 4PQUA 4CE9A 3EYZA 1TKTA 4URGA 4IG3A 2BANB 3ZSXA 4ELTA 4CJ3A 1S0OA 3AO5A 1I6JA 3EPGA 1S1VB 2UVUA 1WSGA 3BQ2A 1WAFA 5D3GB 1SV5A 3RMBA 2YNIA 1S48A 3LWMA 2EHGA 4CCHA 3A2FA 5J1EB 2P5GA 2DFEA 4QW9A 1S1UB 1VRUA 1Z25A 3EZUA 5KFXA 2IM2A 3ZT4A 1S1VA 3OYNA 3LP2A 3G0ZA 3DLBA 1RTDA 3H5UA 3IG1B 3K59A 1T7PA 3IN5A 3KHHA 1RT4B 2W42A 3K57A 4FJ9A 4Y2CA 3PJXA 2RDJA 2HMIA 3H4DA 3D28A 1XR5A 3V6JA 3ZSVA 3D5MA 4IG0B 2XGPA 3KIOA 4ZPCA 1Q9YA 5KFTA 3L8BA 2AX0A 4DS4A 3E51A 5KG5A 3GIJA 2E9ZA 2JLEA 4CFDA 2PYJA 1RT1A 2OPRA 3GYNA 1I3AA 1XHXA 5DGAA 1NOYA 2VG6A 4OVLA 4CJVA 3VN5A 4QWDA 4I9LA 4DTSA 4RU9A 4FCYA 3V9UA 1ASVA 1VSLA 3SQ0A 4CHNA 2YNGB 4W5OA 4CJQA 1FKOA 4CESA 4DSKA 1RDDA 5I42B 4OL8A 5F8HA 5DG9A 3DRPB 3M9OB 3KJVB 2KFZA 2AX1A 2IC3B 4DTXA 1C0MA 2HWHA 2UUWA 3AVMA 4FS2A 1QS4A 4E7JA 4TQSA 5JS1A 1BHLA 3VA3A 1JXBA 4JLHA 3AVFA 3CJ4A 1JIHA 3VQ4A 3KOAA 4KKOB 1S1XA 4ZP6A 4DS5A 1TL1B 1S1TB 4O4RA 4NLXA 4CJWA 1N48A 1RTIB 4MQ3A 4Q8FA 1TKXB 1TKZB 5KGWA 4OJRA 4AHSA 3H5SA 4KKOA 3TQ1A 1TK8A 1EKEA 1REVA 3AVLA 2G8HA 4MIBA 4IFYB 3VQ5A 4KRFA 2RF2A 5HRNA 3MFIA 4CEZA 4DFPA 3I8DA 3KK2A 3DLGA 4ID5A 3KD1E 2HNYB 2DPJA 4Z4HA 3CVKA 1NKCA 1S49A 4XO0A 1JLBB 4CHZA 3QESA 3V4IA 4HVJA 4E7HA 2RPIA 2IGIA 4CIFA 4CJ4A 4EZ6A 3CFRA 3QGGA 2G8WA 3AVJA 3O3FA 4KHWA 4RG8A 4AHCA 4RW7A 2W8KA 3PW7A 1LWEA 4KHNA 5KFJA 3SUQA 3NF8A 3QO9B 1KCFA 4IFVB 2YKMA 4NLTA 4CIGA 3L2QA 3AVAA 1VSHA 4EZ9A 4IKAA 5DLFA 1BCOA 4DSIA 1NHVA 4G1QB 2W8LA 4ID1A 2E9RX 3RMDA 1NK8A 3NAIA 4PUOB 4HKQA 4I2QB 4B8CA 4CF2A 1N5YB 5KFSA 2I1RA 2WCXA 1BL3A 1JLAB 2PYLA 1LWCA 3CJ2A 4JS4A 3ZSOA 1KVBA 5KFUA 4E19A 1ZBIA 1RT5B 3DMJB 3DRSB 1SH0A 1OS5A 1HYSA 4JV2A 4K4UA 4OPJA 1DTTA 1YVUA 4J9OA 3M8RA 2X6SA 3WNFA 3RB4A 3CDWA 3LZIA 4RUCA 3KHGA 4IBNA 3ZCMA 4TYAA 4ZPDA 3PR5B 5EU7A 1SV5B 3KHRA 4DSJA 4FK4A 1WN7A 3TAGA 2B6AA 3O3HA 3LP0A 3P5JA 4O0JA 1VSMA 3MEEA 2O4IA 3DRRB 4IDKB 3HO1A 3ISNC 5KFPA 3M8QB 4HUGA 2VG5B 1WAJA 3T5KA 3DYAB 4PWDA 5KFVA 3LP2B 5HROB 4FS1A 4CJKA 5C24B 1RTDB 3SFGA 2RN2A 4NLUA 2B6AB 3V9ZA 2EX3A 2E4LA 4E1NA 3SQ4A 3VQEA 3G6VA 1C6VA 4DQQA 5L1LA 1J5OB 4W5RA 1UWBA 2KZMA 1XI1A 4FW1A 3DOLB 3FDSA 4DL3A 3KLIA 2R7YA 4IG0A 3TWHA 2HHXA 4OKJA 2R2UA 3QLHA 1I39A 2QK9A 3AVIA 1HQEA 4U6PA 1FK9B 4KB0A 3AO2A 2B5JB 2KQ2A 1IM4A 5KT5A 1UA1A 4CK1A 3MR3A 1TL3B 4GW6A 4KHQA 1Z26A 2VG6B 1IKYA 2HHUA 3TAMB 3AVGA 2D5RA 1TAUA 2ILZA 1EX4A 3L2WA 2QKKA 4DQPA 3NBPB 4Q8EA 4PA1A 5J2NB 1HJRA 5KFHA 3CG7A 3MR2A 4QW8A 5JXSA 4B9NA 2J6UA 1JLCA 3VQSA 4YR0A 4ECSA 2D7SA 2R2RA 2VA2A 1SKSA 4RNFA 3PV8A 1FKPB 4WXOA 4CJSA 3QEVA 4WYLA 3Q8QB 3AV9A 1SUQA 4O4GB 4I7FB 2ZKUA 4DL2A 3SPYA 3V6DA 3WNGA 4LSNA 3AVHA 3NDKA 4EEYA 5FRMA 3IG1A 4KHMA 2V9WA 2LSNA 1WNSA 3OYMA 5HP1A 2I5JB 3V1RA 4FLXA 1JL2A 5L1IA 3LAMA 2GUIA 4XPEA 3V81A 1TKTB 4ZVFA 3K5LA 4MFBA 4BACA 4I7FA 3KLGA 1D9FA 1WSEA 1HARA 3ALYA 4EBEA 4KO0A 3LWLA 4HTUA 4B9LA 4DL4A 1X9WA 5KFQA 4ZVHA 4F4YA 3SI8A 3OL7A 4RNHA 5D3GA 4ED8A 1KTQA 3KKRA 2YNIB 1IG9A 3DI6A 4F2RA 5DQHA 2D0AA 1WSJA 3KLGB 3SPZA 1RT3A 4MK8A 2HNYA 3OLAA 4EO8A 2W9CB 4M41A 1U48A 2R8JA 3IRXB 5CZ2A 2OYQA 1RCHA 4O3OA 2YNFB 2OPQB 4J2BA 4ELUA 3DI6B 4O0IA 4FJLA 2HHSA 1F21A 1RT4A 4YR2A 4IRCA 3H5YA 3Q8PB 4CJTA 1A5WA 4GMJB 1DLOA 3LDSA 2F8SA 2BR0A 3HYFA 4Q45A 4Y1DA 3HPHA 1ZBFA 5T14A 3H2LA 2D3ZA 4QWAA 4O3NA 4E89A 3CQ8A 3CDEA 3PY8A 2IAJB 2G8KA 4FBTA 1C0TB 3LAKA 2D41A 5DLGA 3SV4A 2DY4A 3CDUA 1QSLA 2G8FA 3NHGA 5J2PB 5C25A 2VG7B 5F8MA 4ED3A 3RB6A 4KHRA 5F9NA 4CF8A 3H98A 5F8IA 2WRMA 1VSFA 3VQDA 2OZSA 3L3UA 1EETA 1TKXA 1EXQA 2ATQA 2KZZA 1HQUB 4KFBA 5KGXA 4ZPAA 4K4TA 3CO9A 3BDPA 3QZ8A 5I42A 1TVRB 1HYZA 3KJVA 1KVAA 1S9EB 2WK4A 1U45A 3QEPA 3EY1A 3DLKB 4ZHRA 1B9FA 3CYMA 3M8SA 1T05A 3SV3A 4MKAA 3D0PA 2X78A 2D0CA 3BJYA 1NJXA 4NLGA 2R8GA 4CGHA 4EP4A 3BSOA 4B9VA 5KFOA 3KHLA 2J6TA 4J9NA 3SFUA 4DG1B 2HAIA 3MXIA 1TQLA 5F9LA 3OHAA 3AVCA 3DDKA 4NLQA 4CEBA 1TAQA 2IMWP 4Z0UA 4IFYA 1B9DA 4K4VA 3ZSWA 3NF6A 4M3ZA 1WSHA 4DU3A 4E1MA 5E41A 3AA2A 3OYLA 2X6NA 4YQWA 4KV8A 5DG7A 1S10A 3ZSZA 3PW4A 5FDLA 3C6UA 1RTJA 2V4RA 1S4FA 4J9PA 2ZE2A 3KK3B 1IO2A 1R0AA 1TL1A 4NCGB 4NCBA 5JUMA 4KBIA 4DFMA 3HP6A 1C1BA 4MK9A 1CZ9A 4J9RA 3MECA 2FBTA 3LZJA 1RTIA 3OY9A 4N47A 5I3UA 1TKZA 3TAEA 1HYVA 3QERA 4RW6A 4LQ9A 2XWYA 2JEJA 4TYBA 5EWEA 4J9LA 4CJFA 4IQXA 3DLGB 3O3GA 1JLQA 1QE1A 3MEEB 4CJEA 4CHPA 2VA3A 1LWFB 4FM2A 4E0DA 3AVBA 4K4WA 1ITGA 3TAFA 2HHVA 5KFBA 5C24A 4F4XA 4B3OA 1JX4A 4AHTA 1JLAA 4IR9A 5HLFB 2DFFA 3ASMA 4ECQA 5KFMA 3DRSA 4OLAA 2CJQA 4ECUA 4IH7A 3QO9A 2F96A 1RNHA 1J5OA 4Z4EA 1GOBA 2YKNB 4F8RA 4IRKA 2IJFA 2GC8A 5J2QA 1U47A 2Z1GA 2WHOA 3KMSA 4G1QA 1RDBA 3PZPA 1VSEA 4J9MA 3KTQA 4FLUA 3SCXA 3MF5A 4FVMA 2YHBA 3LPUA 1ZBHA 2W9AA 3AVKA 4DTJA 3ZT2A 3TAMA 1LWCB 4CK3A 3PR4A 4CF1A 5KT7A 4ZP7A 4KSEB 1KFSA 4RW9B 5CYMA 1NK6A 4NLRA 4CGIA 4FJJA 3OYCA 4RW8B 4CGFA 4X2BA 2ASLA 3G86A 3LANA 4M45A 3I0SB 3IGVA 3PW5A 3DOLA 3QIOA 1JL1A 4AHUA 3QIPA 1KLNA 3DLEB 4KTQA 1ZETA 3V6HA 3QLHB 3WNHA 4RW8A 4G3IA 1SL2A 5J2MA 2IA6A 4L8RB 5CZ1A 3OL8A 1RDAA 4ZTFA 1C0UA 4QWEA 4URSA 1GX6A 2VG7A 3BSCA 3GV7B 3SUPA 3V81B 1YTUA 3RTVA 4YR3A 4NYNA 4ECTA 1CXUA 5FRNA 4XIUA 1YVFA 5K14B 5KT4A 1KSPA 5KI6A 1ZBUA 4JS5A 4O55A 1RT2B 2FBXA 1QHTA 2FJXA 4LY7A 3DOKB 3HSTB 2FJVA 1XC9A 1W9HA 2RDIA 2FVQA 3TABA 2XC9A 4W5TA 3HT3A 1TP7A 3DLRA 3GV5B 3KLFA 3OYHA 5CYQB 5KFNA 1SUQB 3M8PA 4O4GA 4CJUA 3SUOA 4DTOA 1NK7A 1KRPA 4WZMA 3I0RA 4E7LA 4DG1A 4DTUA 4FJNA 3LP3A 3PUFA 4M3UA 3NAEA 1A5VA 4O3RA 1BCMA 4O44B 2OA8A 3KMQA 3KLHA 4KREA 1DLOB 3HP9A 1T3NA 3B6OA 1T03A 4DU4A 1RT6B 4DSFA 1C2PA 3OSNA 1Y97A 1DTQA 3OYAA 4F50A 3KNAA 3C6TB 4O44A 3AVNA 4KPYA 1D8YA 4FZZA 4BDZA 4B9MA 4NLWA 1N4LA 2W9CA 4K50A 1L3TA 3T5JA 3RB0A 2HWIA 4FK2A 2OPPB 4JV0A 3CJ3A 3B6PA 2Y1IA 4FJ8A 1LW2A 3N6LA 5J1EA 2JC0A 1J9AA 3I5AA 4EO6A 1TVRA 4KO0B 3TAQA 3NGZA 5KFFA 4IR1A 3DLKA 4ZHRB 4DLEA 4J9SA 1JLBA 1SH3A 3L3VA 2DFHA 2BRLA 3EPIA 4Q5VA 3CM5A 4FK0A 1G15A 5C42B 4CJPA 2E9TA 3NCIA 1KLMA 4DF8A 1LWEB 1QUVA 4CJ5A 2HNDA 5J2PA 4NLVA 2PY5A 1S9FA 4KI4A 2R8KA 1CXQA 3L2RA 4HUEA 4E3SA 2YNFA 1XR7A 4AH9A 5KG3A 1BISA 4I2PB 3ISND 1VSDA 3RAXA 4KFBB 4CECA 4Y3CA 4C8MA 3PW2A 4PY5A 1RILA 1S1XB 3H5XA 2R8HA 2JEIA 2ALZA 5F8GA 1N5YA 4H4OA 3PHEA 3AA3A 5SWMA 3OL6A 2UVRA 5KG7A 3KK3A 4Z4FA 3TVKA 1R0AB 1FKOB 5KFIA 4M3RA 3FSIA 2C2RA 4LSLB 4JV1A 1DTTB 3UPFA 3NH0A 5DQIA 5EWGA 4TN2A 2D0BA 4W5NA 1CZBA 4ID5B 3SJJA 3S3MA 1LW0B 4GC7A 2BQRA 1HQUA 5I3UB 2G8VA 2IDOA 4WFYA 3SZ2A 4ED1A 1TGOA 4CEEA 3ZSYA 4RW9A 5CYMB 2CKWA 3T5HA 3PX4A 1S0NA 4ELVA 1HRHA 3QGHA 1B92A 3VQPA 2ZQBA 2KFNA 2XI3A 3OYJA 4RW4A 5HROA 4TSXA 5KG1A 5FDLB 2G8UA 4U7CA 2W7PA 1SL1A 2E6MA 3U6FA 4CERA 1BQMB 5KT3A 2C22A 4RNNA 1REVB 4Z4CA 1GOCA 2XI2A 1HMVB 2BE2B 1ZYQA 1S1WB 3TANA 4GC6A 2ASJA 3K5OA 3MXJA 4KHYA 4FBUA 4Q0BB 2Y1JA 1NOZA 1K1QA 1NJZA 2DTUA 2AGOA 2W9BB 3QNNA 2F8EX 1ZTTA 5L1KA 4GVMA 3SUNA 4YNQA 2X74A 4KB7A 4F3OA 2B4JA 4QWBA 4Q0BA 5KG4A 1HNIA 2GBZA 4IOBA 3THVA 2E6LA 1RAJA 5KFDA 2D3UA 3IGNA 2KW4A 1ASUA 2NUBA 4ZP9A 1J54A 4KHSA 3O4QA 5EDWA 2YKMB 2AJQA 4RUAA 4CGDA 4PQUB 2UUTA 1VK0A 4DTRA 3H40A 3M9NB 3OYDA 2GIRA 1X1PA 1TV6A 1Q9XA 3HHKA 4CEOA 3BSNA 3QNOA 3V6DB 4ECRA 4LSNB 2WB4A 5SZTA 3JSMA 4M3WA 4M94A 5HRSA 2AQ4A 4AHVA 1WLJA 5KFGA 1HNVB 3CJ5A 4ZMMA 3DMJA 3QEXA
chains in the Genus database with same CATH superfamily
5J2MB 4E7KA 1NSKL 1U26A 3J7YI 4FJHA 4JI3F 2E5HA 4DLGA 1JKHA 2GMLA 3N28A 4KTZA 3PX6A 1CSJA 2HFNA 2GIQA 4KT0C 4ECXA 1RWXB 2WOMB 4I56A 3T6BA 4G1PA 3AO1A 1PAUB 4IOAQ 3VEWA 3M8QA 1FVSA 3ID8A 2MZSA 1C0GA 3HVWA 5GINA 2EXUA 4JB8B 4P72A 5CYQA 2W2OP 4GRSA 1IKWA 4J2DA 4DV2F 2YWHA 4GMKA 5KOXA 4DUTA 3AA5X 4KAIA 1K73O 3KUGA 4GKJF 2DTJA 1J5EK 4FXDA 1WBBA 4JI7F 4FXWA 3MWPA 1IBLJ 3W65A 1C0TA 4MKYA 2ZD1B 3G4SN 3CCJN 4C3KA 3HTVA 3V1QA 5HP1B 2HMIB 2BQ3A 1DTQB 2R2TA 1R0BG 1KAYA 4LH5A 3VQCA 2MKYA 4WFBL 2E5LK 3ZZZA 2F4VK 1QVGM 4UOHA 1YUWA 1VQ4N 5KFRA 2UUBJ 1MDUB 4HHJA 1M1KT 3N6MA 3I55S 1FX4A 3R6LB 1F9FA 2B4PA 4C8LA 4KGZB 3OHBA 5A8KB 1SZ2A 2IYGA 3IWXA 2R7TA 1W26A 1S4EA 3JAMO 2RS8A 2M7SA 1B64A 1S0MA 2IOCA 4HR2A 2ZZTA 2QSFA 1MROB 4P9SA 1RHMB 3K58A 1CBKA 3FKBA 2ZJPL 4OKKA 4FWRA 2FBVA 4UQTA 3G6YA 1Q7YT 1VRUB 2RAQA 2JEFA 3C46A 5CCMA 1Q8KA 4RR5A 4OLPA 3SIPB 1TK5A 3SBMA 3QFPA 1VQSA 2RMLA 1HMVA 1SCJB 2H48B 2HBQB 3OFFA 4ILGB 2ZJRQ 3TSPA 3VQ6A 2FSJA 1M5HA 4CYUB 3G96A 4NXMK 2C3MA 4FWSA 3POTA 4Q2MA 2MQLA 2V8DA 1HPZA 4CFCA 4FL9A 4X64J 1L5UA 3MI7X 4L3KA 4ZTJA 1FW6A 2W7OA 5CXTA 1JLFB 4ID8A 4MK7A 4ZVOB 4PXCA 4JN4A 3RG6A 4JYAF 4BE2A 3FEXB 2OHDA 2OPPA 2FF3B 2ILYA 4DL6A 4Z4IA 1XNRK 5M2PA 3PYGA 4WQ4C 1KONA 4WKYA 1YBAA 2OSQA 1WSIA 1I1GA 4JI7K 5AXKA 1K6YA 5KFCA 5KTQA 4RCHA 1XTZA 2RKIA 3TNVA 1NK0A 2MDAA 4HCCA 5GMKa 2P9LA 4BWJA 4KE5A 5AQZA 1YTYA 1KHWA 2IPOB 4PR6A 2GWJA 4B1ZA 2WAQD 4AM7A 3FQKA 3SDEB 4L72B 2V8VA 1C1AA 4MDBA 2P9LB 1OH7A 4URQU 3FFIB 1RWPB 1X4FA 2Z1IA 5AZJB 3GV8B 4FYWB 3D1HA 1WSFA 1N6QB 3C95A 3HXMA 2XY8A 3C7NA 1BY9A 2AJ1A 1PIEA 3D7SB 3PVXA 5DK5A 2XY6A 1S9GB 4USIA 1HW8A 4WU2A 2IBKA 3ENQA 1HX1A 1RA6A 4NLDA 4F4KA 4DR6K 4B3RF 3OYGA 2ZNZA 5DGBA 2DHHA 2YKAA 2BW7A 1IQZA 1JLQB 3O9TA 5EUHA 2XMAA 1YJWN 1RTJB 2F4FA 3CFOA 3BUZB 3W60A 5IWAF 2R2SA 2LFVA 2O3DA 4CZJA 2ZD1A 2RRAA 1U1OA 4JI2K 4CGJA 2XMUA 2YY3A 3DGVA 2BYCA 1BIUA 4JRQA 4WFAL 5HBMA 3RBXA 3Q8SB 1JLGA 1BWVA 3ZZ0A 1D5AA 4MMOA 3A3OB 4CLFA 1FJGJ 3IAM9 4WFXA 4CEAA 3UVJA 2FHOB 1Y7PA 4JAXA 1EP4B 4W98A 2F3JA 1IXKA 3W62A 1EWQA 1U09A 2Z1JA 5DDOC 2QKBA 4X4SA 4DV3K 3M05A 2O4GA 5AZIA 4B08A 2BRKA 2P9EA 2YPYA 1EP4A 1M90T 2FLPA 3Q7CA 3AODA 2DPNA 4CO2A 2UXBJ 2XS7A 4LC9B 4EIAA 1FEHA 2DR8A 2XO7A 3LALA 4CH1A 4FWQA 3SQGA 3RZAA 2F7TA 2J8AA 4HHTA 1HR0K 1U1RA 1DRZA 3T6JA 5AE3A 4TLRA 1TR0A 3G82B 4IOAL 4FLTA 2KJWA 2MKCA 1M90O 1WSVA 3EO3A 2YPZA 4Y2AA 3QICA 2V9KA 5HRRA 4BDPA 4FLVA 3RBEA 1WKLA 4DSLA 3KVGA 4Z37A 3QIPB 4X66K 2ZH1A 1RT1B 4DR2K 4Y1CA 3NVKA 1NMEB 2CFXA 1S1UA 3JSRA 1D3WA 4J9QA 2JFDA 4FJ7A 3LPTA 1IM6A 2VHGA 4CLTA 3AB4B 4DU1A 4WZQA 3VAHA 3QYYA 1Y5IB 1U02A 2K8GA 3MEDA 2LXUA 4WFNQ 4DTPA 3HVRA 1MU2B 1U1MA 4H0YB 1FXDA 5AE2A 5L46A 5AR0A 2P5OA 4ECWA 1AFJA 4PRFA 1EETB 1RYRA 3A8EA 3VQ7A 1K1SA 2MLZA 2ASPA 2R7WA 2CQIA 3T3FA 3I9V9 3OS0A 3MR6A 1AA1B 3MPYA 4FW2A 2L41A 3EGVA 2OMLA 4FWLA 1LFPA 3J81j 1UMJA 3CD0A 1H3DA 5HL7L 4FWKA 1H72C 3IAYA 3OVAA 3HSJA 2KL8A 2FGOA 4MIAA 3M6GA 1UOCA 4U9RA 4DEZA 1T11A 5GMEA 3KKSA 1F5CA 2EC0A 3TI0A 2PSZA 1IR2A 1NG9A 3ETMA 2KRRA 2NCKL 2Q1NA 3NXZA 3LF0A 3TRGA 2Q6BA 3KLEB 1JCGA 1KVCA 2XMWA 2HK3A 3HSDA 4K4SA 4E1JA 1NNEA 2V63A 4M5DB 3MTKA 3VF4A 4JI1J 4ZVEA 4ZKAA 4NCGA 3EGNA 1D1UA 4CZEA 4FM0A 1GEHA 1L3UA 3C0BA 4ICLB 2QLJB 2JRSA 2UUCK 2HFUA 4C8ZA 1CVJA 2B9XA 3I9ZA 5DM6Q 2ZJQQ 5JLHA 2MZQA 4C0HA 1Z2ZA 1JNRB 1A5XA 1Q82T 3CB4A 3JAMY 4LFBJ 3VMFB 4HUFA 2XQCA 2UP1A 4TLQA 3M4XA 5BN9A 3N5BA 2OH2A 5GAEP 4UZCA 2I38A 4R8UB 3BQ1A 1HQEB 1DBDA 4BE1A 1FO1A 2DXFA 5IC6B 2BTFA 5EWFA 2OELA 5T41A 2X1GA 1VSJA 3OYBA 1X31C 3BZCA 1JKHB 3C6UB 4O5BA 3FK4A 2VDHA 3AA4A 2FF6A 3HSCA 2GELA 2QYCA 4MT1A 2V7ZA 1VQ7S 2MQOA 1ELOA 4W90B 4FZVA 3N5FA 4RZRA 3M2RA 1UWBB 4H5RA 4P7VA 5IT0A 2E5JA 1WC5A 2KRBA 3RR7A 1B3TA 5DS7A 2HLTA 4TU7A 2RJZA 5HJYA 4OYBA 4WF9L 3ZX2A 5BRHA 3VF2A 4CHQA 4JI8J 1S7HA 4OPAA 4I69A 2FVCA 2KYZA 1NK9A 2VODA 3MXMA 3LGNA 4Y0FA 4CF9A 1NRKA 4R5PA 3MTJA 4M63C 2FJWA 4DSEA 1Q86O 4F3MA 2HW3A 3DM2A 2DO4A 5HATA 3TUJC 1Z05A 2I0XA 3HVTB 3CC7S 1OY6A 4YHHK 1OVYA 3SMZA 2ZZMA 3CPWM 2YCHA 1K9MO 3UE5A 2AZ1A 2RHKA 1GLLO 1RTHB 2OTLS 2QXFA 1GT8A 3IWLA 4USTA 2DRBA 3EE3A 3VVUA 1YIJS 4TU8A 4ZJQA 3D45A 2JC1A 3JYTA 3W2VB 1SIWB 1NUEA 4IG3A 1R8HA 4FOEA 8RUCA 4ELTA 1S0OA 3AO5A 1I6JA 3F56A 4TKTA 2E29A 4FWPA 1WSGA 1FTRA 1SS6A 1WAFA 1SV5A 3LWMA 4USJC 2HBJA 5JJBA 2G0CA 4J9VA 1KOOA 3LUYA 3EVOA 2ZWHA 4CW7B 2IM2A 2ZBRA 4B3RJ 3QMLA 1T0TV 2B7BB 3IP0A 1RTDA 1Y00A 4LR8A 2ZM6F 3IG1B 2QG9B 3IMXA 4HEA9 4I67A 2KM8C 2DR6A 1SJFA 4X62J 4EGLA 2XMMA 4OYOA 3QJJA 3QRPA 2PMZD 2KM8B 4CO3A 3DNCA 2CNNB 3D28A 1WF2A 1UJ5A 2XGPA 1Q9YA 1SJ1A 3K8WA 4BLGA 2WVBA 2P9IA 2Y0BB 2E9ZA 4CFDA 3EE9A 3E1YA 3ONQA 3THWA 4DV5J 1Q81T 2NRHA 4A59A 4KC5A 1E3MA 3AJDA 2VG6A 2FHKA 2UXCJ 3FGUA 4P75A 4QWDA 4DTSA 5E84A 2V67A 1P1LA 4RU9A 2W4PA 4FCYA 2ZOMA 3MM6B 3V9UA 3VZIA 4JKCA 1ASVA 3SK3A 3SQ0A 5I42B 2KFZA 4DQ8A 3DRPB 2Z4PA 2IC3B 4DTXA 2HZCA 5AQHA 2IRYA 1NGCA 7FDRA 2ZKTA 4KYZA 3OTBA 3WEEB 3T1YK 4EAHD 4NZ6A 5EGYA 3CJ4A 4BG8A 2RH3A 2GQQA 1X4DA 4BR0A 5A76A 2U1AA 4CNYA 2NZCA 1WHWA 5BR8K 1SJ3P 3RYLA 3V5RA 3PHTA 1TKXB 3LL3A 1B4SA 5KGWA 1JCEA 2BH1A 4AHSA 3CCSS 1TK8A 1EKEA 1REVA 2BE9B 2XHWA 1J2VA 1YBTA 2HPUA 3IO1A 3ULHA 2YHXA 3I8DA 2A6OA 3DLGA 4ID5A 1NLKL 2FPHX 3R5GA 4CI0B 1LOTB 3CHWA 3CCSN 2E66A 3DKDA 1VQON 3ILIA 1KEKA 1U2FA 4ZJOA 3TA2A 3QESA 3V4IA 4HVJA 4ISGA 2IGIA 3ZETB 2CWXA 3QGGA 1DQ8A 1FKAF 1V4SA 2D0OA 4JI5F 3EMTA 1LWEA 1HBUB 5KFJA 5JVGL 1FRLA 2DRAA 3PIPQ 3SMSA 4CI6A 3I87A 4M5DA 2KT3A 2K3IA 3E9LA 4M5LA 1ITPA 5LOQA 3R27A 3QT8A 3UR3C 2IYIA 4X62F 3BPDA 4NXMJ 2W8LA 1RLDA 4ID1A 1IV0A 3J81O 3R6GB 3RMDA 5FIIA 1S3XA 4FF1A 4LRBA 4A8XA 4WK3A 3J81Y 4AUKA 2OFGX 2I1RA 1CC8A 3MD1A 1U1PA 2W1BA 2DEIA 2MSSA 2PYLA 4DBQA 3A8JA 4EU0A 3IR5B 2NPFA 3MN5A 1YVUA 2LQJA 3V2UC 5AQSA 2Z30B 3R8YA 4RUCA 4UW2A 3KHGA 3O08A 2QWOA 4IBNA 2PD1A 4DSJA 3D6TB 2HHHF 4JI7J 4JI0K 1YAGA 4E8UA 3P5JA 4KGXB 3MEEA 1VSMA 2O4IA 3MMVA 3HO1A 1X0FA 3ISNC 3F2KA 2HHHJ 5HJXA 1Y5NB 2H9ZA 5KFPA 2P9UA 2VG5B 3CC7N 3DYAB 3LP2B 3M32B 2GNKA 3ULEA 1N32J 4WFBQ 2E4LA 3Q83A 2A2DA 3SQ4A 1LXJA 3TEHB 5JLFA 4AE5A 1HUXA 1C6VA 4DQQA 5L1LA 5H9FJ 4W5RA 2ZFHA 4GKKF 4FXVA 4CLKA 4YOXA 3H3NO 3KLIA 3WUHA 3C15B 2J0WA 2R2UA 3QLHA 3GCWP 1IJEB 3IXQA 3O4WA 4IUFA 3SBTA 2Z2LA 2GUPA 4H5TA 2V34A 3AO2A 2D74B 2B5JB 2KQ2A 1IM4A 3W5YA 5KT5A 1N0VC 1VQ9N 4PKIA 1MN9A 1WTFA 3UD4P 2D1CA 3IFRA 4Q8EA 3OXFA 5KFHA 4X4NA 1IQTA 3EXCX 1VQ6S 3VQSA 2FY1A 4YR0A 4ECSA 1X9JA 2VA2A 1P9YA 4F4AA 1VBKA 2O1PA 3PXGa 3PV8A 3Q8QB 1G4CA 1TMJA 1BHNA 4JI2J 1SUQA 1OIAA 2ZKUA 4DL2A 3SPYA 1ACMB 4A47A 3HULA 4EEYA 3TSUA 1B0PA 3IG1A 4KHMA 2V9WA 4BC7A 2EBGA 3OYMA 3TYTA 5GADI 3V1RA 4FLXA 4CZGA 3NOCA 1FDBA 4XPEA 4WP3A 2UUAK 1TKTB 4ZVFA 2MMYA 5E2QA 4I7FA 3KLGA 2CNOB 1HARA 2EBEA 1FJGK 4ZLJA 3NCRA 1HKAA 4EBEA 2R7RA 4HTUA 4OZ2A 1FRHA 1ZZFA 5D3GA 1KTQA 3G8SA 3TA1A 2YNIB 3HOTA 4PXBA 2LP4A 4WCEL 2IVNA 1WKJA 4HHUA 3L4QA 1RT3A 4MK8A 4A8SA 4P6QA 4EO8A 2BXJA 4KR0B 4LFAK 4JD2A 4M41A 2ALYB 5CZ2A 3JQJA 2YNFB 2OPQB 4ELUA 2E44A 5JMVA 3J7AN 4FJLA 1F21A 4WWSA 2UXBK 4IRCA 3H5YA 3OTOK 4USVA 4MAKA 4CJTA 5G0RA 1D09B 2I8EA 2IBOA 2W24A 1A5WA 4GMJB 1DLOA 4P2SA 3OVBA 2BR0A 5CD4H 3HYFA 4Y1DA 3HPHA 3H2LA 4O3NA 2CQ3A 5AQRA 3PY8A 1CULA 1IUJA 2ZF5O 4JKBA 2VPZB 3SV4A 3CDUA 4OV6A 1KN6A 2Y1LB 4JI6F 2G8FA 2DGTA 4C97A 2BKNA 5C25A 1V3SA 2GX9A 2POKA 4CF8A 3H98A 3MM7A 3VQDA 3P4UB 2LYVA 5C10A 2KZZA 4C8YA 4ZPAA 3ZNUA 4K4TA 4OJ1A 3LPEA 1HYZA 1TUGB 1KVAA 3EY1A 2I7NA 2W2QP 2UU9K 2VUGA 4MKAA 3KWMA 1XNQK 2X78A 4DR2J 2UV8G 2FJBB 4DV6J 4DR5J 5KFOA 1I3OB 2QMUB 1QQOA 2A6MA 4DG1B 2ZBPA 2FHJA 2EKNA 5F9LA 3VGVA 4F3QA 3QFHA 4BRFA 3OPKA 2X7IA 1V6HA 2EFGA 3CMEN 1KVIA 5B7WA 1VRQC 2IMWP 1H0HB 2J9CA 1SPBP 1DY3A 4NMLA 4BVOA 4IFYA 4DU3A 2XLIA 5E41A 3AA2A 2A42A 3PYDA 2HQDA 3PW4A 3CSKA 1G7CB 1R8CA 2V4RA 2XYGB 4QU6A 3HM8A 4ILRA 4DUZF 2ROGA 3QQCD 1YK9A 1B0VA 2B51A 3P38A 4NCGB 4KBIA 4PHTX 1VQMS 1R31A 5AQUA 4JI5K 4O8KA 2FBTA 4N47A 1TKZA 3TAEA 1T9YA 3I33A 6AT1B 3VQTA 4FP9A 5GAEU 2ZJPQ 3QERA 2P9KA 2WSCC 4TYBA 3WT0A 2KHOA 4GY2B 1WKKA 4ALZA 5EWEA 3QJLA 3D66A 3ZXWA 1FD8A 3MHYA 2Q36A 3NGTA 3CULA 3MR7A 2V51B 4KH1B 4E0DA 3AVBA 4BREA 2BEFA 2QTDA 1U8SA 2QL7B 2FZGB 2ATCB 2G2YA 3GJQB 2VIHA 1JX4A 4AHTA 3ASMA 3CCUS 5CYJA 4DR3J 1F60B 4JI1K 3QO9A 1YWXA 1AUDA 1ZA2B 4K2JA 3UD3P 5LL6Z 1UFWA 3CIPA 4CZHA 1SXLA 1K9MT 2ASMA 3DJCA 2WHOA 4G1QA 1RDBA 3PZPA 4J9MA 2G0IA 4V19J 1F3FA 3MM8A 4BQZA 4KBOA 4FLUA 4RJVA 1YZ7A 3CCJS 4H5NA 2YHBA 4BG9A 1HKBA 3LDLA 3UKRA 2W9AA 3O44A 3H25A 4ZVQB 1UZHA 5TKYA 4V1Ak 1WOSA 4CF1A 5KT7A 4ZP7A 1KFSA 4RW9B 1NK6A 2PMWA 1E6VB 2EPIA 4JNEA 1GLJO 2DH9A 4X2BA 3LANA 3NCQA 3BZKA 3R9PA 2L48A 3QIOA 3C8YA 4AHUA 1U7LA 3QIPA 1T95A 3G25A 3SSQA 3N4WA 2F8MA 1FFSB 3QLHB 3DGPA 2DHSA 1BA1A 1HL6A 4L8RB 1NDLA 4OZ3A 2QMXA 3AARA 1RI7A 3DDIA 1EWRA 2VPYB 4URSA 4CO5A 3P5TL 3GV7B 3RTVA 1CXUA 1YVFA 4J8FA 3BGOP 1KSPA 2VOOA 5KI6A 2QWRA 4QYRA 1RT2B 2FJXA 3GJTB 3CC4S 4AXJA 1W9HA 3BKTA 3TVYA 4MYTA 4FF4A 4BR7A 1GMWD 1T9XA 3JXOA 2XBPA 1TP7A 3OYHA 5CYQB 1R0CB 1SUQB 4JI8K 3AA9A 2AZ3A 2QLFB 2H5JB 2QM1A 4ZVSB 5A8KA 3I0RA 2F5GA 3R1HA 4DV0K 1PYTA 4OYAA 1SVDA 3FE1A 3D1OA 1F3VA 5BN8A 4I0WA 5CABA 3WIVA 1RT6B 2GA7A 3T41A 2RQCA 4YDDB 4DSFA 1S76D 2I9SA 2R4FA 1RADB 3LA0A 2AYGA 1WJ9A 3OYAA 3ATUA 4J7CA 3UDVA 3R2CJ 2CPHA 4BVPA 3OFGA 3CERA 1F9EB 2GX8A 2XTJP 2MKIA 4NLWA 2IIRA 2OPPB 4JV0A 1HI0P 4FJ8A 4WTOB 5ADXH 1WD6A 2W25A 1J9AA 3I5AA 4OIXA 4KO0B 2GS8A 3JTNA 5JVHL 1FDDA 3AT1B 4DLEA 5DETA 1IBKJ 3QB0A 5ETOA 1JLBA 1SH3A 3O5BA 4X4VA 4LR9A 2BKPA 4Q5VA 9ATCB 2CIMA 1N8RT 1GLCG 4DF8A 2E9TA 2HNDA 4NLVA 4YOUA 4KI4A 3L2RA 3M3ZA 2YNFA 1XR7A 4AH9A 3MMAB 5JICA 3I82A 4I2PB 5IQ6A 2AP6A 1OVQA 3ISND 2KFYA 3G4SS 3W8GA 2DD8S 4Y3CA 5HMZA 3PW2A 2JEIA 5F0WA 2ALZA 5AQKA 5DDRC 3VGTA 2QLXA 3SLCA 3RUBL 2B7CB 4H4OA 5SWMA 3VAFA 3OL6A 1OY9A 5KG7A 3KK3A 1H74A 2Q79A 2BJ3A 3TVKA 4FPRA 3VF6A 2BUNA 1GLAG 2BX6A 4M3RA 3HHLC 3FSIA 3A12A 4C0OC 1XUPO 3SCJE 3UPFA 3RRKA 3NH0A 5DQIA 5EWGA 1NGJA 1DAXA 1CZBA 3O8MA 3S3MA 1LW0B 4GC7A 3SZ2A 2DHAA 1TGOA 4RW9A 2VFRA 2DNPA 1S0NA 3T1YJ 3QGHA 2CJAA 2V2QA 5E0OA 3OYJA 4B3SK 2RQKA 1VQ8N 2MKSA 5HROA 1XMOK 3AH6A 1SL1A 4F0HA 1A6LA 4CM0A 3H0PA 3A5OC 1ZOTA 5KT3A 5K5MA 4CD3A 4BHQA 2LCWA 5BR8J 5J1PA 1R27B 3S41A 2ASJA 1N34J 3HKZD 2DCUB 3W2WA 1WC4A 3VGLA 3M7VA 4C3LA 5K8NA 4QIWD 2MXYA 2DNLA 3CIMA 1NLVA 2F8EX 1ZTTA 2OSRA 4K0KJ 2KT2A 5AZIB 5ETTA 1TL5A 1BUPA 1XC3A 2B4JA 2DGQA 4QWBA 3DC2A 4IOBA 3TPQA 3W63A 1GMUA 1GQEA 1ZA1B 2D3UA 3IGNA 1ASUA 1J54A 4EI2A 4KHSA 3CETA 5EDWA 4E98A 2W01A 2AJQA 5IT9Y 2CPFA 3MDFA 4PQUB 3A1YG 3PJ9A 1X8DA 1U8WA 1HNWF 1WACA 3R9LA 5LJVA 3M9NB 2GGPB 3PYEA 4DUYK 3HHKA 1HKGA 4F04B 4HI2A 4ECRA 4LSNB 2WB4A 4PYAA 5SZTA 3AQOA 1DQ9A 1UEKA 3DLLQ 4AHVA 1RU2A 4BCAA 2NRRA 5EVZA 3DMJA 2VWBA 2F4VF 4AILC 1T8EA 2GV1A 2VQFF 3T19A 1KP6A 4CJRA 2GJFA 3GR0A 3US5A 1LWXA 4YMEA 2V7YA 1N33F 2E2PA 4PXDA 5ETMA 3KFWX 2E1MC 5KRTA 3V9WA 3NMRA 3O9SA 1HKCA 3EDQB 1F2GA 3ZX0A 1NXIA 2V0NA 4NZ0A 2P9UB 4KHUA 4ANDA 3CJ0A 3I0SA 3RWUA 1RDWX 1S79A 4B9TA 2E1YA 4PKDB 2LEAA 2D69A 3DU5A 4CLYA 3MD3A 3MEGA 3E66A 4KY3A 2NNWA 1SKRA 3D1QA 2FY8A 4M42A 2HNDB 4NCAA 2A6AA 3R6MA 1NU0A 4RUHA 2YX1A 3D0HE 4U8VA 4QJVA 4LUBA 2P6TA 4MYUA 5KFEA 1UJ6A 2FVSA 2IC3A 1NKBA 3J7ZT 5CY4A 3M1VA 2P51A 2Q3SA 4RTFD 2X3DA 1S6QB 1VSIA 2YHAA 2PFDA 1HR0J 5KFKA 1GXUA 4BC2A 4H4OB 3FNNA 1XQIA 4BRHA 4WE1A 4DR5F 3QEWA 4DPWA 2FLOA 3G6XA 2FVRA 2CZ4A 3BV8A 4DR2F 4AYBD 1S9EA 2G4BA 1HBNB 3HHNB 2HHWA 2VWKA 1QSSA 2V94A 1WELA 3OBWA 4Q44A 4IRDA 1OSCA 3B78A 1CLQA 3HPOA 1S12A 1W25A 3Q8YA 1WDDA 4O5FA 2W6KA 2KN4A 4E2FB 2Z2YB 3SJHA 1J53A 2ZH4A 2JLGA 4CJLA 3Q8RB 3SQ2A 2KVQE 2XSFA 3W5XA 1U2RA 3E3XA 3I0RB 1QQCA 4ZCIA 2P9PA 2EFPA 5B0AA 3SYZA 3CW2C 4DN9A 3EKSA 3LH2S 3RMCA 2MYFA 4Y34A 1P90A 1LAVA 3FZ2A 1ZAXA 4DV4K 4LIRA 4QPTA 2D9PA 3L09A 2WBRA 2EK1A 1NHUA 3EJMA 4YHHF 4FNIA 4LFAJ 1VHXA 1BI4A 4MIWA 3IR6B 1AZSB 1O1WA 4P71A 3ZT0A 4HWIA 2BQUA 1X7VA 4ZLLA 4NLBA 4UZBA 4BRLA 4H4MA 2XM3A 4H5WA 5KRSA 1X9MA 2CDRB 3GONA 3JXUA 3KD5E 4NLYA 3OSPA 2AEJA 1S59A 2A1RA 3QIDA 2LQ5A 4RPFA 4C8OA 1VQ8S 2B56A 1GLFO 4BE0A 3KG1A 4BDYA 1VSKA 3MM7B 3F9KA 4HCBA 4G6VB 1IJJA 3WDOA 3EGZA 5C42A 1HBMA 3DRRA 4BRAA 1S6PB 1MU2A 4U67Q 3UE2A 1UJ4A 1N33J 1T6CA 4RUBA 4QAGA 4J2EA 1AB8A 3KLVA 2DO0A 1H98A 2ABYA 4DV5F 1HNXK 4CDIA 1H73A 2OPSA 4IQMA 3NF7A 2YJFA 1IKXB 3ZTSA 4WFAQ 1YJVA 3NMAA 3RU0A 3PFOA 1CJTB 3QSYB 5GAGI 1HI1A 4RNMA 3MDQA 1QTNB 1FJEB 1EQMA 1RUSA 2FGCA 5HN0A 4DR5K 2JWKA 3TTFA 3I5BA 4IXCA 3HOSA 5KPZA 4B3TJ 2DNOA 3CJQA 2CJ9A 3T5LA 3RR8A 3ITHA 2LMIA 3M2RB 3SQ1A 3OS1A 3JTOA 3MGJA 3ETOA 4Y65A 2D3OR 1FERA 3HDSA 5BREA 1VQNN 3M6WA 3TTCA 1RDRA 1F9HA 4Q2LA 2HBYB 3ZC4A 2MSTA 1OWXA 1NK5A 1NKEA 4N5SA 1U1KA 1RHJB 2JH3A 4Y0WA 3AXKA 1DQAA 1ZTWA 1BE4A 4NRTA 2EFNA 2DNYA 5HMXA 4C8KA 4OI0A 3NMUA 3OTDA 2J8SA 1M5OC 4CVNE 4CIEA 4Q43A 2XZWA 4P2XA 5IM0B 2ZZNA 5AFUH 1C0UB 4LF9K 3IC1A 1NSQA 1S6QA 4ZITA 3MECB 1B99A 5D6GA 4B9QA 1JXEA 1V4TA 4K2XA 3BBFA 1T9WA 4B1WB 3VGMA 3DM2B 3EZOA 4JI5J 5FPMA 3LP1A 1TFWA 1N34F 2R7VA 3CC4N 5KFYA 3UIQA 2YWFA 2OLWA 1WUAA 2PT0A 4ED5A 3MMCA 5BR8F 2KVIA 2WW4A 2IM0A 4ZLNA 2ASOA 2ATLA 4QR1A 1I94K 1JLGB 1XR6A 5FD1A 3DXMB 3GU0A 5DMRA 3CMES 1NDCA 3GG4A 4F3TA 4ZA1A 4BS2A 2C2NA 3R97A 4YN3B 1V3ZA 4H8KA 3AAWB 4KAZA 1RE1B 4CEQA 4IO8A 1FE4A 2DNRA 1BIZA 4M5GA 4FJ5A 3MAQA 2UVVA 1MW7A 3FZBA 4XEIA 2NLWA 3M1VB 4A57A 1YLXA 3H90A 4DFKA 4YHHJ 2ZGZA 4PG4A 1OO0B 3QETA 2B8QA 4FJIA 4LF7F 2IAJA 2BDPA 4FVUA 3JYTB 4WYWA 4LMZA 4LBPA 1H2VZ 2N4CA 2W7AA 3VENA 3C3LA 4NYOA 4O3QA 1R6VA 1JLFA 2FC9A 5KT2A 3D2FA 4R0EA 4W92B 3SNNA 3VQBA 4FWNA 5AQQA 4ANEA 4IOCQ 4DQSA 4NZ7A 4LREA 1MWKA 3ET6B 4LFBF 1ZM2A 5F8NA 5MLCQ 3CXCM 3B4DA 4XAKA 2HK2A 1EO1A 5A8RB 2Y8WA 2OTJN 1CULB 2HNZA 3HL8A 2MLYA 1WBDA 4JK8A 2NLXA 4CO0A 1HBMB 3FQLA 4M63A 4BRKA 3CJ8A 2F9TA 3BGRA 2CG8A 1O51A 2BMBA 1F2HA 4LH4A 1FTCA 2ZM6J 3TP2A 1K0TA 3WXLA 3L2UA 2OPSB 2OTLN 1VS3A 4AHRA 1HJOA 3V4MA 2YX6A 5AZJA 4ZN3A 4DL7A 4EMDA 4JI1F 3PJWA 5AXMA 2EW9A 4MKBA 2QIFA 3IR7B 2RE1A 1S5ZA 3TAPA 3CF5Q 1VJWA 3RB3A 2V5HG 3ZSRA 2YNGA 2UXCK 4DU8A 4GKKK 3AQPA 3GQCA 2ZOFA 4QOTA 4DXLA 1REGX 1VRTA 1IBKF 3U3GA 2F63A 1RAAB 3IAS9 1X4GA 5AQOA 3I6PA 1IR1A 4J5OA 3MPVA 2ZEJA 4GVLA 2JZ5A 1L3SA 1T9UA 1TL7A 2A41A 4ED0A 3QMQA 4I2QA 5LMUK 1PBAA 4I6AA 1GXLA 1S6UA 4CZIA 4Z7YA 4DTMA 3GCXP 3PO5A 2XRIA 3CXCR 2DNZA 3UCZP 1HW9A 4DMNA 4XPCA 4BR9A 3KJFB 3ZZPA 3J7A1 1BI4B 4Y6IA 4LF7K 4ICLA 2ZE2B 2AKWB 4X65F 4NLPA 1TK0A 3S3NA 1KVJA 5JS2A 1N5QA 2XY7A 2V8HA 3NKYA 1RABB 3CFPA 2DY1A 5C2DA 4I68A 2HQCA 4M7YA 4F4WA 2FHJD 3U3YA 3FBCA 2VQFJ 2C3PA 3H42A 4ZP8A 4L73A 4ECYA 4CLZA 3DYAA 4BY9C 3VR1A 3UWTA 3RBDA 4LJMA 3QWUA 9RUBA 1NK4A 1OYEA 2DGOA 1U2VB 1VBYA 3TR8A 1HNWJ 5M1NA 3NFAA 1HWLA 4OYPA 3GIKA 2RHSB 3OJSA 2BE2A 1FK9A 3P45B 2VG5A 3H2UB 3TOQA 4F4ZA 3C7NB 2JLFA 4C23A 4NYZA 2A2CA 2J9DE 2F8TA 2JEGA 1UW4A 3VQ9A 4YOTA 5IT9U 1U0HB 2J76E 4OGEA 1KD1O 1DKGD 4YY3K 3DHWC 2RD5C 4R0JA 2VC1A 3IMQJ 5KG0A 4X4UA 4Z4GA 4NRUA 4NLSA 1Z6RA 5E5NA 3OVNA 1VK8A 4EYHB 1N6QA 3LGMA 2O8BA 2YJEA 2W4DA 2XMTA 4ED7A 3D6RA 1KAXA 3W7BA 5CZVA 3H1VX 2MQQA 4FYVB 4C8NA 1G3OA 3CCVS 1K8AT 2YNHB 4CZMA 1N36J 4X65J 4OHYA 2IM1A 1MN7A 2C2KB 2N7CA 4MFBB 2NREA 4CHOA 1ZBTA 4HTLA 2ITGA 1N34K 3CIZA 3MEDB 2IM3A 3V9XA 5F8JA 1ZAVA 3GILA 1MWMA 1QAIA 1BU6O 1RT7B 2VH7A 2OZMA 3GWCA 1EHWA 3MCNA 4LFCJ 4MKVA 1C4AA 1FNXH 3OD2A 1T03B 2BACA 3KWGA 3NNHA 2B5JA 4DPYA 4K4XA 4AQYK 1XHZA 1RT5A 3L6QA 4EFAC 2HBZB 5M2UA 4ZIWA 2P9NA 3S6EA 3ZSXA 2UVUA 1RQ0A 4L76A 3NGSA 4QR2A 1S48A 2MY7A 3TU5A 4CCHA 2IVYA 3DXBA 5J1EB 2W2MP 2P5GA 2J7WA 4DV7K 3MK6A 2CZVC 4QW9A 1S1UB 3BPSP 3SCLE 3TX0A 3EZUA 3PKMA 3OYNA 3ZEUA 3LP2A 3G0ZA 3P96A 4LF8F 1VJQA 4PABA 3DWLA 5AQJA 2Q1LA 2W42A 1TZ0A 1WB9A 4QIEA 3THPA 4OYXA 3NOGA 1HPMA 1KNZA 3AOCA 2QL5B 4LF2A 3ZSVA 4IG0B 4ZPCA 1WHXA 2UUAJ 3GIJA 3JQMA 4NX9A 1RT1A 3IBFB 3ZTRA 4WP8A 1SQKA 2YX4A 3TR5A 4F67A 1I3AA 4NLCA 2G2OA 1XN9A 4Y28C 2XZTB 3ZZTA 3MCAB 1VSLA 4YEAA 1F1BB 2O8DB 1FKOA 5DM7Q 3NP5A 3BZQA 2H5EA 2AX1A 1WF1A 1C0MA 2YH1A 2HWHA 2PBDA 2ACYA 4TQSA 4OV1A 1BHLA 5GIOA 1MWZA 3IWNC 2B4OA 2R7XA 4DV7F 1JIHA 3VQ4A 4BRPA 1LFWA 4LF8K 4XH5A 3K7RA 4ILHA 1W7WA 4OI1A 2AT1B 3R1XA 1PCAA 3CMAN 1S1TB 2JWNA 3QT7A 4CJWA 2VFSA 5CE3A 1U1QA 4L3NA 3TQ1A 3I56S 2ZWPA 3AVLA 3KHYA 1WF0A 1WEYA 5HRNA 2YVSA 3R7SB 4CEZA 2QRRA 5LM7E 3KK2A 1HA1A 2HNYB 5DZ7A 1RAIB 3MAAA 4AQYF 1HLUA 5B0FA 4OI3A 1RDUA 2RU3A 4EZ6A 2VDIA 3AVJA 3BR8A 4DV6K 5I9EB 2BUPA 4RG8A 1O8BA 5JMNA 4RW7A 1IBLF 1Q95G 4KHNA 4OLOA 2KO1A 4IFVB 4NE9C 3TWZA 2AJ0A 4WU3A 3AVAA 3Q89A 1MNEA 4IKAA 3LOUA 3W9HA 4CZKA 1PO6A 3ELHA 4WKRA 4DZ6A 3Q0AA 3GFHA 4UT4A 5LMNF 4B8CA 1N8RO 4PYDA 4CF2A 5I3PA 2GQ2A 1TMMA 2UUBF 3AOBA 1KVBA 1ZBIA 1HYSA 5DJBA 1RWKB 2H65B 3GR1A 1Q79A 3M8RA 4J9OA 5A2QY 2M2BA 5HVFA 2W2PP 3GB0A 4DR3F 1K8KB 1DFDA 5A2QO 4TYAA 1U25A 3VGSA 1RU1A 1RK8A 2B6AA 3EXYA 3B8HA 4O0JA 2BW2A 1SJQA 4IDKB 4ED4A 3SAHA 1Y10A 3M8QB 3MX5A 4HUGA 1WAJA 3T5KA 4CJKA 2K2PA 5HROB 3SFGA 4NLUA 4NASA 5HL7Q 2EX3A 2GAHC 5C15A 1U1LA 2JX2A 4QS7A 1FFGB 3C14B 2VBXA 5IM0A 4BC9A 3Q2TC 1SBRA 3HSGA 1XI1A 3DOLB 1YVNA 3TWHA 2Y3YA 2B9WA 3U9ZA 2ZWOA 2QFIA 5T7LA 4B3TF 2JNJA 1N32F 1D8ZA 2VV5A 4DUZJ 2NRTA 4HI1A 1UA1A 4IZ9A 2HURA 3CJKA 2YX7A 1Z26A 2ADCA 3AVGA 3VEYA 1HIYA 2ILZA 4S0MA 4DQPA 1BOTO 2GIFA 4FF2A 1NB2A 3CG7A 5JXSA 1JLCA 3KXDA 3OTOF 2JSXA 4L74A 3H2VE 5IS2A 1SKSA 3D2EA 4RNFA 4CJSA 3AV9A 1VQLS 1BQXA 4I7FB 3P5BP 4B1XB 3WNGA 4LSNA 3AVHA 2LEPA 3CCES 5DM6L 5A6WA 2LSNA 4DV6F 2WW8A 1XMQJ 3CNQP 3EEQA 2XULA 3K5LA 4BACA 1VISA 1WSEA 2XO6A 5D8HB 5HOOA 3TW0A 4B9LA 1LNQA 4ZVHA 3OL7A 3PYFA 4RNHA 4ED8A 1SIZA 3KKRA 2L08A 4F0KA 2DBBA 1I94J 4BR2A 4F2RA 1OJ4A 1O5JA 4B17A 4JKGA 4DCJB 1H6KX 2DNGA 2HNYA 3OLAA 4HACB 2XB2D 1MWYA 2R8JA 2VFUA 3THYB 3KJNB 4I4BA 2VU5A 4J2BA 3DI6B 1Y5LB 4O0IA 1TUYA 3EWGA 1RT4A 4YR2A 3VHQA 2A10A 1YXQA 5THWA 2XMKA 3DLLL 3CDAA 1AROP 1KKHA 2F8SA 1FT8A 3QJPA 4Q45A 4D3HA 4DMZA 4GVBA 2D3ZA 4CWBA 4QWAA 4E89A 2HVEA 5TKWA 4FBTA 2EG2A 1U1NA 5DLGA 2UYTA 1YZ6A 2KJVA 3HI0A 4ISFA 1QSLA 3NHGA 3QSIA 5AXNA 4CD1A 4ED3A 3RB6A 3A4TA 1VQ4S 4KHRA 5F8IA 1VSFA 3L3UA 2D0PA 1EETA 2AHOB 1RWVB 2ATQA 2BJ1A 1XEZA 4HTJA 3QZ8A 3FZKA 3CCLN 2F65A 1S9EB 2WK4A 4U96A 3DLKB 4ZHRA 1B9FA 4NA3A 1LQ9A 3M8SA 1YITS 3CYMA 3SV3A 4HH1A 3O9QA 4DV1J 4A5AA 2N7YA 1XMQF 4EP4A 3BSOA 1VQKS 1IBKK 1X5PA 3KHLA 2VONA 3SFUA 4X4RA 4XH4A 3MXIA 4ATNA 3AD7C 1S72N 4KGMA 3K0SA 2RUGA 2DR5A 2Z2ZA 5GAHU 1TELA 5D78A 4JI3J 2E5LJ 1X3NA 2DKOB 5CQGA 3T1HJ 2WB1D 2F4VJ 5MAOA 4K4VA 4M3ZA 1JCFA 4JKFA 2KKHA 2GMJA 2BKOA 2DGXA 2X6NA 4YQWA 2XS5A 4Y2IA 1APSA 4UY85 3C6UA 3BS9A 5LSOA 2ZE2A 5B0DA 3P49B 1TL1A 4C6AA 3ENVA 2N82B 3AD8C 4DFMA 3HP6A 4U7UK 2APOA 4IWVA 1CZ9A 5CR4A 4J9RA 3LZJA 3T9NA 1RTIA 2VBZA 2DY9A 4OQJA 4GKKJ 2NPIA 4BGAA 1GMWA 2JEJA 1U6BA 3CMAS 2CH6A 3HBTA 2RILA 2CXEA 3L9ZA 2UXDJ 2WSFC 3P6YC 4DPXA 1WHYA 1CQMA 3O3GA 1DT9A 4K0KF 1QE1A 3MEEB 2R7QA 2VA3A 1FRIA 2IVMA 4K4WA 2HHVA 2C3OA 4F4XA 2DNQA 3I4PA 4B3OA 2P8IA 1XMOJ 1FRMA 3AA8A 2LLZA 3FZFA 1JLAA 2H54B 1Y64A 3TA0A 4ECQA 3MUVP 3DRSA 1N52B 3C14A 1YRUA 4IH7A 5E33A 1SB6A 4GV6A 3HD1A 2C1EB 3CQXA 2GFFA 1GOBA 2YKNB 4F8RA 2IJFA 2OCEA 5J2QA 3KNGA 3W9IA 1R8AA 3CUNA 3HZEA 3NG8A 2QC3A 3KMSA 3T1YF 3R8EA 3BP8A 4FVMA 1OSDA 4JI8F 2A3ZA 2YHWA 4PG6A 1ZM4A 1B70B 3BGFA 2M3DA 1BDGA 4DV4F 5CYMA 4N8NA 4NLRA 4FJJA 3OYCA 3F0NA 4USMA 2PEBA 1PILA 2OFHX 3EGWB 2EC2A 4ES2A 2JVOA 1RGIA 3I0SB 5C0YA 2PE8A 2KLAA 1YGYA 4ER8A 3VEZA 1QVGR 4KTQA 3V6HA 4RW8A 4Y00A 5J2MA 2BZ2A 4OX6A 5CZ1A 1RDAA 2KT5A 4GO7X 4ZOSA 1G1XA 3W3DA 2VG7A 3U9DA 2M88A 3MM9B 1EJ7L 1HNZF 2E2NA 4IO9Q 4YR3A 1O6XA 5FRNA 4XIUA 3MMBA 1RWOB 5K14B 2FTRA 4YY3J 1WWHA 2O8CA 3TJ9A 1LK5A 1QHTA 3DOKB 2YKOA 4NXNF 1NPKA 4JP8A 2FVQA 2CQGA 3CGIA 2MB0B 5IOLA 3KLFA 1BG3A 1PJ6A 3RW6A 2DB1A 2OJ3A 3M8PA 3ET6A 4V19S 3OQ2A 5GVQA 2V50A 2E20A 1X0PA 4DTUA 3LP3A 4M3UA 3NAEA 1N36K 2WFBA 1A5VA 3KZBA 3Q7BA 4ZK7M 3W64A 5G0RB 1Y11A 3KMQA 3KUEA 3MOJB 1T3NA 2HIQA 3VETA 1KC8O 2UZAA 3LGHA 4JEPA 4WTYA 2VQEF 1Y97A 2QI2A 1DTQA 4C48A 4F50A 2JVRA 4YB5A 2DH7A 3AVNA 1D8YA 3ENAA 3R3TA 4F26A 2E1PA 3O1LA 1N5SA 3ZTQA 2CQ0A 4BDZA 4OJHA 1N4LA 2W9CA 2FJAB 1YQHA 3T5JA 5B0EA 1S7IA 2HWIA 1Q7YO 3D54A 1H2TZ 2F7VA 3AFGA 3OUYB 1WG5A 3TAQA 3NGZA 4IR1A 2RHQB 1FWKA 3CI5A 3L3VA 4OHXA 5AQYA 3FSYA 3EPIA 2DR9A 1P8ZA 4DI6A 2EFOA 2M8HA 2A5XA 3O1WA 2HFOA 2AD9A 4WK1A 2A3JA 1KQSR 3NCIA 1NSPA 4CJ5A 3H8YA 2RB7A 2PY5A 2R8KA 1RCXB 1CXQA 4K8RA 1YSJA 4JOUA 1BISA 4KH4A 3Q86A 2OP5A 2KKZA 1Q16B 4IEIA 4WIQA 1GK8A 3RAXA 4CO4A 2OD6A 4PY5A 1RILA 3MN6A 3SAGA 5KOWA 1FJ7A 1G2EA 2GQCA 5FLXY 4B3MJ 3N4QA 4CTAA 2R3VA 3LPYA 3DU6A 1UFKA 5AQFA 2LXIA 5AQXA 3PHEA 2DJWA 2EK6A 1EX8A 5EN1A 1CPZA 2IDLA 4Z4FA 2PA3A 4FSVA 2E1AA 5KFIA 4IOCL 3CQYA 3D3CJ 3J7Z5 4DX8H 2XSJA 4JK7A 4A2AA 2ZH8A 1JXVA 4ID5B 4OZ1A 2BQRA 1HQUA 2ZHOA 4XDDA 4ZS6A 1TFYA 2IDOA 3M2VA 2CPYA 3Q8VA 2VBYA 1ZPVA 4H03B 1VC6A 3P31A 1S99A 3ZSYA 3PX4A 4QQBA 3VQPA 2ZQBA 4HTIA 4RW4A 5KG1A 1W7AA 4U7CA 2W41A 2E6MA 4BRIA 4CERA 5GIPA 2HGLA 3HT0A 2C22A 1REVB 4JV5F 2XI2A 1ZYQA 4GC6A 3K5OA 3MXJA 1FJGF 2P9SA 4AT1B 4XTTA 4FBUA 5LMNK 3DLJA 5ETPA 1K1QA 2IDEA 3UNGC 1N33K 3CD7A 1PSDA 2X74A 4KB7A 1XERA 4F3OA 2P9SB 2UXBF 3CJKB 1I5OB 5EHHA 1AZSA 5IWAJ 5E26A 5BPMA 3TUZC 2MZTA 2NXJA 4JI6K 3QATA 4BROA 2O8BB 1KAZA 2PDAA 5E3QA 4BQLA 1VK0A 1FE0A 1SC1B 3MPWA 4LVOP 4DTRA 2RT3A 5FPDA 3JB9k 3GZ7A 5CHCB 2HQ3A 3L7PA 3V6DB 2QZ8A 3FLCO 4B02A 2AQ4A 4C7QA 2QO3A 5KFGA 4NA2A 3I56N 2VFTA 1SKWA 5AQMA 1F5BA 3DRXA 4KTWA 2IFXA 3VQQA 4M3YA 2QA1A 1NJIO 5KFAA 3S3OA 1JJHA 3IS9B 3JSMB 4EP5A 3OL9A 3KLIB 1FESA 3FFIA 4FM1A 2Z1HA 4F02A 4PKGA 2ETJA 3TUIC 1Y3KA 3R5CA 1UAXA 4FZYA 1SQGA 1SL0A 3OYIA 1X4AA 2HIYA 3DLHA 4PL7A 5KFZA 2P9GA 3KJQB 2QA2A 2P1JA 5FROA 4JD2B 3M8YA 4YFUA 2OANA 1SH2A 5H9EJ 2P6SA 3DHXA 5F0UA 5LY3A 5ADZA 4CHYA 2WTFA 2HNZB 2GV9A 5KQDA 1QZ5A 3M6UA 3RMAA 2VASA 3ENOA 2JGUA 4X66F 4O3PA 4ED2A 3D2EB 3I32A 3CC2S 1IKWB 1RBAA 5IT9O 3MMBB 1KFDA 1GTHA 3C65A 1GAOA 4TY9A 1Z4UA 4WE1B 1DJ0A 3GIIA 2HFVA 3FMWA 2C42A 1RT2A 5ETSA 1RHRB 4JI4K 3DXSX 1VHFA 1TL3A 3PX0A 4K8ZA 1IKVB 1WC1A 4TQRA 2JJ4D 4DR1J 3F41A 4EBCA 1WEZA 1QY7A 2DHXA 4EFHA 3S7RA 3R5AA 3THWB 2OKQA 5LL6d 1FJCA 4YS2A 5AFUA 1RDCA 1VQ6N 1HBOB 2V6AA 4LF4J 2ZUAA 2K7JA 3MX2A 3D6FB 2YV0X 1XNRJ 5AQNA 2KB2A 3ICLA 2E1ZA 4YDUA 3K17A 3BEXA 3R5JB 1LK7A 3O4NA 1ICEB 2ZHAA 2CPJA 1RBSA 4TY8A 3WEEA 3MMJA 1SJ4P 4RW4B 3B54A 2J0QD 4ISEA 4H54A 1RLCL 1J5EJ 1BC6A 2E2OA 4ANCA 2QX0A 4N7TA 3KLHB 5KFLA 1FWLA 4CEFA 4KQZA 1UVNA 2W9BA 3GYXB 4U67L 4UY8T 4ES3A 2RF2B 1NGEA 1LV5A 3MM5B 4CBUA 2ZDOA 3KG4A 3UCGA 3H7HB 2U2FA 3CJAA 3KK2B 2KG0A 1JWWA 4QBUA 1W2BM 4DWIA 2ZOGA 5BXIA 3MWBA 3UQSA 1VR6A 2EWHA 4ECZA 3QGIA 3LM9A 1UVKA 4ED6A 3O6WA 1URRA 1GXTA 4B3RK 3V9SA 1EQ0A 3FRZA 4RW7B 1E6YB 3DXKB 2K3KA 4LQ3A 5M1QA 2XEXA 4HH0A 3FC9A 2PMHA 2O8EA 1WNEA 1K0VA 1QAJA 3WXJA 3H3OB 1BQMA 2FLLA 1IBMK 3HJFA 2Q0UA 1Q8IA 1U0HA 2KG1A 4MTPA 1RBRA 3BGRB 2X3GA 2ZH2A 4KV8B 2RKIB 2O8EB 2VZ9A 4FDFA 3J80Y 3VV2B 5J2QB 4ILJA 2C2MB 5GAGU 5HRPA 5LXRA 2G1DA 4B9UA 1TYQA 2NXEA 2JOQA 1HYSB 2BGGA 1LKZA 4DV1K 2LQ9A 2ERRA 2QEXS 5IZHA 1VLYA 3IBCB 2FSKA 2QA4G 1OYDA 3CD5A 3G8QA 2KI2A 4GNIA 2VQFK 4MO4A 2UU9F 5L39A 1FHTA 1RHKB 1RHQB 4R5PB 2A1SA 4M3XA 4R79A 1FNOA 3A8YA 2CPEA 2YHYA 4KH0B 4LD0A 2C2DA 4WXWA 5HQMA 4H0TB 3QINA 2Z0GA 4QWCA 4JV5K 3T1HK 2XNRA 3J80U 2X1FA 1OPIA 2Q2RA 4DCOB 1XBWA 3DLEA 4CH0S 2FLNA 2XCPA 4QPXA 4QU7A 5GADU 4JKEA 2H51B 2OD4A 4NXMF 2G8IA 1FKPA 3KLEA 2YNHA 2R8IA 2WVFA 5IT4A 4RWTA 2BANA 4I6MA 4DQRA 4W5QA 4C11A 1QJHA 3E01B 1EKRA 1WHVA 3HVTA 3KK1B 3EICA 5KG6A 1QVFM 4ILLA 5EXWA 2YKQA 4NA1A 1LEOA 2WOMA 1UEUA 1U0SA 3KUHA 3VQ8A 3KLFB 4NYFA 1K44A 4U8YA 3HX9A 3PCOB 2AA4A 3MXHP 1M1GA 3GL1A 3GBTA 3CJRA 3HI9A 1PC4A 3HJVA 2A1BA 3FFKB 1NH8A 1VFJA 1RT3B 3EZ5A 2HGMA 2IY5B 1NO8A 5AQLA 3J7ZO 4ZIVA 1JLEA 1VCTA 1HWIA 3OLBA 4JYAJ 5KT6A 1XJWB 2V4JB 4PPZA 2KTQA 4A8OA 1L3VA 1TV6B 4B9SA 5C5JA 4I6YA 4IH5A 3AD9C 4CZCA 1K73T 3BSAA 1U4BA 1YJNN 4LRCA 5T7BA 3G82A 4CFBA 5C25B 4Q7AA 1A9NB 2CQBA 2Z56B 2DITA 2Z57B 2HMPA 3IRXA 4FN5A 4DV2K 4X4TA 4FLZA 3D68A 4K8XA 5J2NA 4DL5A 1URNA 1Z1ZA 2RUSA 5B8HA 1FRXA 3CF5L 2HWTA 3CJ7A 4N56A 5GADP 3Q2SC 3ULDA 2HEKA 1T94A 2AWZA 3NWGA 4EHUA 5KAKA 2CZ9A 1OKJA 3K2PA 3M9MB 3OW2R 3PEJA 4X4OA 1ZBLA 2QE5A 2HS4A 3FJ2A 2C3UA 3PRDA 3EZWA 3K5MA 3NL0A 3S01A 1UL3A 2B9YA 3T1HF 3CPWR 4O3SA 3BKUA 1MWQA 2AU0A 1BQNA 3WC2A 2CG4A 1RTHA 4KH6A 5BYRA 4WFZA 3HRGA 4FPAA 4JBCA 3HM9A 3MFHA 4KB1A 1QZ6A 2HRUA 1HR0F 2UXCF 2KDOA 2IVOA 3HK2A 1Q5YA 4ZVGA 3UKUA 1GLEG 1SJRA 2PEHA 3IKMA 4OKEA 1G99A 2E5IA 2M52A 2FBYA 1YJ7A 3OS2A 4UQGA 3RAMA 3GJRB 3H59A 2B9EA 2OPQA 4CF0A 1NDKA 3ZT3A 2J6SA 3F73A 3RRGA 1K8AO 4PZVA 5FLXU 4LFBK 3EKUA 3GFYA 4ECVA 3OTCA 5DQGA 3M6XA 3IUCA 2VYPA 3C94A 3KG0A 4Z2XA 2YTCA 2WC9A 2AGQA 2NYIA 1C4CA 3N6NA 7FD1A 3MZIA 2BABA 4RNOA 2CAJA 3AO4A 2C28A 1W0HA 3QT5A 2XHBA 2NZ4A 3THXB 3NF9A 7AT1B 4QS9A 2B43A 2XLJA 1S97A 2HHTA 2IS3A 2MGZB 4A61A 5ADXA 2FQQB 4WBFA 3ZTOA 1E4GT 3QRRA 1NGAA 3CCEN 3OYFA 4D3GA 4IDKA 2V68A 2YKNA 1VQNS 3OT9A 3MM5A 4PWDB 1FX2A 3TARA 1AFIA 3ZETA 2E7VA 3LQVA 4K43A 3NGKA 2NRZA 1KBRA 2G9OA 3ITHB 3U02A 3QWPA 3MAHA 1UTAA 2C2OB 3BEGB 4H4MB 3PG9A 1RBTA 1BGXT 1TUUA 3PO4A 4B8AB 1U49A 3G10A 4M1KA 2GJ2A 2MHEA 1P9QC 4DHVA 2PZSA 1Q0NA 1S1TA 3CC2N 3W1YC 1FXRA 1YJ9N 4CEDA 4DN0A 4LF5F 2AEFA 5F2RA 1Q5VA 3M8WA 3G71S 4CBWA 2C2ZB 4QYZJ 5HVGA 3P83D 3NBPA 3NAHA 5D0EA 3WXMB 3SQOP 1XNQJ 4MLHA 1GOAA 3KK1A 4F0MA 4JHDA 1Q4RA 1CZAN 2EWSA 3BDEA 2ZBQA 4DR6F 2FC0A 5K14A 2P9CA 3J81U 1S0VA 2MHNA 3HCXA 3ZT1A 1HFEL 2UVWA 3UCUP 4N76A 1AW0A 4M5HA 4K4YA 2OAUA 3RRHA 2HF4A 3NNAA 5M1OA 5F8LA 2EKYA 1CJUB 3K9KA 2KHCA 1ESVA 3DGPB 1N56A 3OVSA 5K9FA 3OW2M 5HLFA 3UVJB 4CK2A 3T1AA 1V5VA 1IKVA 3C16B 4BRNA 3OYKA 4KIAA 1VYAA 4ZVUB 2DPIA 5C2GA 3FCWA 5IXUA 1R6YA 2F40A 4FNHA 1NGIA 4OLBA 2A18A 4A8FA 3VQAA 1RT7A 1F5AA 3TQEA 3MM8B 3EYZA 1TKTA 2CRLA 4UUXA 4NPOA 4URGA 2BANB 2IJRA 2YWKA 3EPGA 2FUG9 4C11B 4DKWA 4BRCA 4P74A 4NOHA 1WUUA 3RMBA 2YNIA 2EHGA 1NU4A 2FDNA 3VTIA 4OHZA 2DRDA 2GW8A 3J7AP 2DXEA 5CA5A 2DFEA 4Z94A 4H0PA 1VOMA 4OI2A 1VRUA 1ZS6A 5KFXA 2ZC4A 1VQ5N 2X51A 3AJ1A 1TL7B 3H5UA 2YBVA 1B7FA 2C3YA 3K59A 1T7PA 2K06A 3IN5A 3KHHA 1RT4B 1Q8BA 1PKUA 3CJ9A 2Z8QA 2MZ1A 1YHQS 3DRYA 4FJ9A 1N54B 2FC8A 4Y2CA 3BBCA 4ZVRB 2ZHBA 1QAYA 2NUHA 2QWPA 1VQLN 1FDNA 3TZWA 2DGSA 2LDYA 2GO9A 3H4DA 4P7TA 1XR5A 3V6JA 3MN7A 3D5MA 3KIOA 2AX0A 4DS4A 4LF6F 5KG5A 2YWWA 1WSRA 2JLEA 4CT9A 3HHLB 1P27B 1BUXA 2FD2A 1D9AA 2AJFE 2YKPA 4DPUA 3BF4A 3WXKA 5DGAA 4M5JA 5LJWA 1KTVA 5H9EK 4YB6A 1NOYA 4OVLA 4CJVA 3VN5A 4I9LA 2RRNA 4LBIA 1ZBSA 3SBGA 3DAWA 2XWXA 3UKUB 4LF9F 4G65A 4PQAA 8ATCB 1MG7A 3EVWA 4CHNA 2YNGB 5IV4A 4W5OA 4CJQA 2OEKA 4DSKA 4LRDA 1Q82O 2E8AA 2MJNA 3M9OB 3KJVB 4PL8A 2QWMA 2YQ3A 4FS2A 2PFFB 3VA3A 1BWEA 1JXBA 3DN9A 2QSWA 3VWSA 3AVFA 3U27A 1VQPS 1GH8A 3BH6B 3PRVA 4DX7A 4L6V3 3KOAA 4ENOA 1S1XA 4H4KA 3VAIA 3M6VA 1TL1B 1A7GE 1NGHA 1J27A 2QWLA 1RTIB 4MQ3A 1XNRF 3VAMA 4FO0A 1TKZB 2FJDB 3G87A 2G8HA 3VQ5A 4PWUA 3EM1A 2AV5A 4XK8C 1ULRA 3ZYYX 2Q6CA 1WORA 2MJUA 1QQMA 3KD1E 1QDUB 3CVKA 4DR1F 1R89A 3CCUN 1JLBB 4CHZA 1NAQA 3U4LA 2JL9A 2YXLA 4CIFA 1NMDA 3M5RA 3BN4A 2P2CB 4CM2A 3R7NB 3OFEA 3PW7A 3VAGA 4NMXA 3SUQA 2W4CA 1O0PA 3QO9B 2PI4A 3D6HB 4LVNP 4NLTA 4CIGA 3FRYA 3L2QA 3D67A 1NPPA 4EZ9A 3LO3A 2QW9A 1EARA 1FFWB 4G1IA 4DSIA 1BCOA 2I7PA 4JI3K 3MN9A 5M2RA 4AL7A 4G1QB 5B08A 3I55N 4NB4A 4CP5A 4PUOB 5BRFA 1WC0A 4YDUC 4MDAA 1N5YB 4RWWA 2JHEA 2WCXA 1BL3A 1JJ2R 2HQGA 1YRTA 4X4QA 3CJ2A 4JS4A 3ZSOA 4E19A 1KQFB 4FPIA 1RT5B 3DMJB 3DRSB 2ZNYA 1SH0A 5ETLA 5HQLA 1SQFA 3CT9A 3BH7B 2X6SA 3WNFA 3RB4A 4JHDB 3LZIA 2Z58B 3ZCMA 2Q31A 5CZXA 1SQEA 3P4IA 5BJRA 1RTZA 4OJ3A 1WN7A 2VKZG 2WVDA 4DR7K 3LP0A 3DRRB 3GYGA 4X66J 1YHQN 3O2IA 1RWWB 2DIUA 1QLNA 3CE8A 4FS1A 1VGYA 5AJ3J 3G9CA 3OBYA 2PAVA 3GIRA 2EFQA 3V9ZA 3BO4A 3VQEA 3PACA 2KZMA 2V69A 3LTOA 3A8KA 3NWRA 3JSBA