2WOMA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2womA05
4CK1A 3NF7A 1C6VA 1RBRA 1N4LA 1BQMA 1LAVA 4W5TA 4W5OA 2P1JA 4F4XA 4JV0A 2A1RA 4MK8A 3AA3A 3DDKA 3M9MB 1B9DA 1S10A 4RNMA 4NLOA 1SV5B 2AGQA 1S1WA 1RA7A 4CF0A 3NCIA 1NNDA 1QUVA 1EX4A 3ZSWA 1VSJA 2F8TA 3MF5A 2R7YA 3OJSA 3CIZA 3KK1A 3M8SA 3IS9B 2EC0A 4ECTA 1RT2A 3QYYA 4IR1A 2RDIA 3U3GA 5D3GB 3VQ5A 3HVRA 3LP1B 1RBUA 3AO4A 5EWGA 3K5NA 4FK4A 1HYSB 3HVWA 2UUWA 4NRTA 4YQWA 5KFPA 1RT7B 3JYTA 1U4BA 5J2QA 5C42A 2E4LA 3IN5A 2CKWA 1LV5A 4IG0A 4DSJA 2JC0A 4DFPA 1NJZA 3NE6A 3Q8QB 3TAMB 4IKFA 4KPYA 1ZBLA 4O3RA 4FW2A 1CZ9A 4BE0A 3ZT1A 3T3FA 3ZSQA 1X9MA 1XR7A 4K4TA 4MKAA 3KLHA 3Q8RB 4M3RA 4ZPCA 3VQAA 5F8NA 3PHEA 3SPZA 4CGFA 5KFOA 2HHVA 4N41A 5J2MA 5E41A 3OYFA 1RT3B 2ILZA 4O44A 4L8RB 3AA4A 1SV5A 4DU3A 2C2RA 4CJ4A 4LD0A 2EX3A 5DQHA 3OL8A 3EPGA 1T94A 3TAFA 1RTDA 4J9MA 3CDWA 2ZE2A 3L3VA 3F73A 3ZSVA 5KFDA 4TXSA 1RT6A 2X74A 2E9RX 4W5RA 3H98A 3I0RA 1WN7A 4R8UA 4JS5A 4FJMA 3K5LA 4XPEA 1CSJA 3HM9A 4RU9A 3FSIA 3DLGB 4CGDA 4QWBA 2JLEA 5C24B 2AX0A 1RT4B 4B9VA 4DSIA 1TGOA 1C0MA 4FLTA 2O5DA 3ITHB 2HNYA 4PUOB 3NH1A 4Z4HA 1WSGA 4K4XA 3OYDA 1DTQA 3HL8A 1SL0A 1W0HA 1WAFA 2G8FA 4M3UA 3HJFA 1JLGA 1BCMA 3TANA 4CECA 3PV8A 5KG0A 1HMVA 4I2QA 4IRCA 2D7SA 1N5YA 1ZBHA 2WK4A 3M8PB 4J9LA 4NLGA 3CJ4A 3NF8A 2O4IA 1R0AA 1RNHA 4DFJA 2IC3B 2XY7A 3ALYA 4CJ3A 2XY6A 1C0TA 3V9XA 4F4YA 2WOMB 1T05A 1D9DA 3OSNA 1KLMB 1JXEA 4LSNA 3C6TB 2ZE2B 4IFVB 4DTNA 1BQNA 5KG2A 3RTVA 3OS0A 4R8UB 4EO8A 1RBSA 1QE1A 2X78A 3O4QA 4Q0BB 3NBPB 3TI0A 2IJFA 3DLGA 3EZ5A 1D9FA 2E6LA 4QOZB 4R5PA 4FK2A 3NHGA 4EBEA 4C8OA 3L2UA 3OYMA 4RNOA 1HRHA 2V4QA 2WB4A 1FXXA 3IGVA 1DTQB 4IBNA 3M8QB 1C1AA 3THVA 5JUMA 3HVTB 3RBEA 5KFKA 4CJTA 3BSOA 1L5UA 5HRSA 3PR4A 4F4WA 4NZ0A 3D45A 4YMEA 2RKIA 4DL3A 4NCGA 3BDPA 2W42A 1SKWA 3OYIA 4CHOA 4KHUA 5KFZA 1S1UB 1DLOB 3SFGA 1TKZB 3FDSA 5KRTA 1NK8A 4EZ9A 4B8AB 3PJXA 2XRIA 1S1WB 4KE5A 2B5JA 1J53A 3QERA 3PR5B 3TABA 3CM5A 2BANB 4DL2A 4CHZA 4FLZA 3C6TA 1VRTA 1QTMA 3CDEA 4ZVFA 1NJWA 1ZYQA 3V1OA 3WNFA 2HNDA 4E1MA 2AQ4A 3BGRB 1NK9A 1HYSA 4RG8A 3G6VA 2VG7B 3DMJA 4ZHRB 2G8IA 3QESA 4AHSA 4NLDA 4KFBA 4CCHA 4ED0A 2Z1JA 5KFAA 4IDKB 3SI8A 1T03A 5EWEA 5L1JA 3BSNA 4BWMA 4B9UA 3VN5A 4NLQA 4FJXA 4CHQA 4K4YA 1NK5A 4NRUA 5HROA 3RR8A 4Z0UA 3OVNA 2ZD1B 3KLHB 4AILC 3RB4A 4KB1A 5DK5A 4WFZA 3RB0A 1IH7A 4EBDA 1VSHA 3UIQA 5KG6A 3L8BA 2W9AA 1B92A 1RDRA 3K5OA 1VSMA 4Q5VA 1TAUA 3G0ZA 4FJ9A 4E89A 1XR6A 3TQ1A 3AA5X 5DG8A 2YHAA 1TKTB 3TWHA 1NOYA 1LWFA 3QINA 2C22A 1JXLA 2AWZA 5KTQA 4KHNA 2B5JB 1BISA 5KFEA 4HCBA 3NDKA 4IH6A 3NGZA 3KLFB 3VQ9A 4CEBA 4ECUA 3CYMA 1JLAA 1RYRA 4J9QA 1D5AA 3MXMA 2G8WA 2XCPA 3SQ4A 4FW1A 4WYWA 2VG7A 3B6OA 4I2PA 4IH5A 3DOLA 5KGXA 2YHBA 4CF9A 1TVRA 1RDCA 2VWKA 2HVIA 4PUOA 5L1IA 4Q43A 1L3VA 5DMRA 3K57A 3QZ7A 4IKAA 3BQ1A 2I5JA 4ELUA 5JS2A 4M42A 2ZKUA 2HHWA 1SL1A 3AVNA 5HROB 2NUBA 4ID5A 2ZD1A 1Q9XA 4U6PA 3OLAA 3AVBA 2OPSA 2OYQA 1RILA 1KVBA 1S6QA 1HMVB 1HQUB 2W8KA 4CEQA 1ASVA 3VQQA 5KT2A 2KW4A 1CXUA 5I3UA 4EZ6A 5KFLA 2W7PA 4O3OA 1UAXA 1ZBUA 1YVUA 4QW9A 2E9TA 3H5UA 1SH3A 3ICLA 1BIZA 4DL6A 3DRRA 4E3SA 2IDOA 3OYLA 2FJWA 5KG4A 2AJQA 4MQ3A 3HO1A 1LW2B 4FJHA 4KV8B 4ED6A 4FLVA 4H4OA 5I42A 3FFIB 1CLQA 4M3ZA 2YNGA 3U3YA 4CJWA 3SJJA 3L2WA 2E9ZA 3AVHA 1JLAB 1KTQA 3KLGB 4K4WA 1VSIA 4CEAA 4U7CA 4I9QA 1IKWB 1ASWA 5D3GA 2VA3A 1QSLA 2HHSA 3E01B 1J9AA 2V4RA 4IR9A 2HNZB 4HHTA 5KFVA 5C42B 4YR0A 3KKRA 4ICLB 2OPRA 4DTUA 4OL8A 1TKXA 2G8KA 4MK9A 2PYLA 1DTTB 2HMIB 4CF2A 4DL4A 4N56A 2C2DA 3V4IA 2FJVA 5DG7A 3NAEA 2IM0A 4ID5B 1QS4A 4UQGA 2A1SA 5KT7A 1MU2B 2RKIB 1GOCA 2J6TA 3BR9A 4NCGB 4ID1A 3H4DA 4CFAA 1J5OA 5KFHA 1HNVA 3CM6A 3KHGA 3AVGA 4FLWA 4ECVA 4RUCA 3PO4A 5F9NA 4CK3A 3OY9A 1QQCA 3FQKA 4DU4A 3EPIA 5KT6A 1TK0A 3PW7A 4KHRA 3LZIA 4RZRA 4IFYB 3G86A 1RTIB 3H4BA 3BSAA 2IM1A 1TL3B 3FFIA 2R8GA 1VRTB 2WCXA 3GIIA 4YFUA 3TR8A 4AHUA 2HNDB 3OSPA 3OS2A 2YKMB 5J1EB 5HP1B 3I0RB 3GIMA 5KT5A 3AO5A 4ED2A 5HRNA 1U47A 4M41A 3V81A 4GW6A 5C24A 3CJ5A 1IKYA 3G6YA 3KHRA 3NH0A 4EO6A 2Z1GA 3QIPA 4NCBA 2D0AA 5KG5A 4PWDA 3H2LA 4DQRA 4G3IA 5DLFA 1VSKA 4M3XA 4B9TA 3N6NA 4WXOA 3V4IB 3NAIA 1S9GB 2G8UA 5J2PB 4OGCA 5CYQB 2FJXA 4Q8FA 1I3AA 2UVUA 1YT3A 2YV0X 1WSFA 3S3NA 1D8YA 3TAEA 1J5OB 2R2UA 1TQLA 5CYMA 3A2FA 1TL1A 4ZP6A 2P51A 3LPTA 4ZTFA 3VQCA 3Q8SB 4J9RA 3TAQA 3V6KA 2KTQA 1TKTA 4KTZA 3CJ3A 4TSXA 1NK0A 1U45A 1C0TB 1TV6B 1SUQB 2DFEA 3RAXA 4ECSA 3MEDB 3KK1B 2ITGA 3WNGA 3HXMA 5T7BA 1WSIA 3CJ2A 5C25A 5DQIA 4JS4A 4DS4A 3KMQA 3C94A 2BR0A 2YKMA 4KSEB 5J1EA 2RF2A 1G15A 1C1BB 2IM3A 5DLGA 4WE1B 1S6PB 4E7HA 3OYEA 4KHSA 4Q0BA 4BDZA 1T7PA 1HQEA 3AO3A 4C8NA 3JYTB 3DOLB 1SL2A 5J2QB 1TVRB 4ZPAA 3OYJA 4H8KA 4CK2A 1JL2A 3QEPA 1ITGA 3L2QA 3M8QA 4QWEA 3KD1E 5KFUA 1T8EA 4YR2A 2PYJA 1ZETA 1JXBA 3PW5A 4ZPDA 1TAQA 3LANA 3SUOA 2W9CB 4B08A 4F2RA 3CFRA 2R8IA 4EYIB 1TK5A 4ZVEA 4KREA 5CYMB 4FK0A 2YNFB 2BQRA 4FZXC 3MECA 3KLEB 1D0EA 1TL1B 1ZBIA 3ZT0A 4KHWA 1VSDA 3QGGA 4O44B 1S5JA 4KB7A 3SYZA 2P5OA 4CJSA 4Y2AA 1SUQA 4FVMA 4CFCA 1GOBA 1ZBFA 1IKXB 4H4MB 4H4OB 5I42B 4ZVHA 1GX5A 2W8LA 4EYHB 3SZ2A 4FXDA 2B4JA 4F8RA 1SKSA 3O3HA 4O3NA 3C6UB 1WNSA 1C1BA 1XR5A 3LWMA 1QAJA 3T5HA 4DQPA 3BGRA 2V9WA 4WE1A 3OJUA 4O3SA 1ZTWA 4Q45A 3IRXB 1RT4A 3VA0A 1VK0A 4J2DA 3RMAA 4ICLA 4EP5A 3ITHA 4DL7A 2ATQA 1EXQA 4O0JA 1Q9YA 2QE5A 1JLFA 1W9HA 2J6UA 4ED1A 5KFFA 2DPJA 3OYKA 3NF9A 3PJWA 3ASMA 4M95A 4BACA 4DSLA 4DU1A 3IGNA 4JUZA 2YNHA 4QWDA 4DTRA 1GOAA 1HNVB 2OZSA 2DTUA 3M8PA 4I9LA 2YNFA 3DLRA 1KRPA 1GX6A 3KK3A 3FRZA 3RR7A 2VWJA 3P5JA 1REVB 4B9LA 4FZYA 3V6JA 4LH4A 4KAZA 4CJRA 3AVKA 4KI4A 4HTUA 3VQDA 1BGXT 5CZ2A 1U48A 3OL7A 3PY8A 3FQLA 4O55A 3KOAA 2OPQA 4NLSA 4Q44A 4OPKA 3BQ0A 1S1VB 1NKCA 4ECWA 1S1TA 1Q8IA 1RT5A 3P1GA 3DRPA 3SI6A 1RTJA 4GVMA 5EDWA 4I2PB 1IKYB 2R8HA 3ULDA 2Z1IA 3DI6B 3RAQA 3RMBA 3CDUA 3QIPB 4F4KA 4F2SA 3ZT4A 2FLPA 3HVTA 4AHVA 2IBKA 1ZTTA 3PW4A 4AHCA 3KHLA 4OPJA 4O5BA 1FKPA 4TY9A 1JLBA 3LP3A 2QKBA 1HQUA 2HWHA 4F4ZA 3QIDA 3UPFA 2D5RA 2JEFA 3KNAA 1UOCA 4Z4IA 2FBXA 3SCXA 4DSFA 1S48A 1IO2A 4FZZA 4CGIA 1X9SA 2VG6B 2BRKA 4WXWA 3GIKA 2IAJA 3QO9B 3G6XA 3ISND 3PW0A 3QEVA 2PZSA 1IKVA 2VG5A 2D3ZA 3VQ8A 2V0NA 1JLEA 4BE1A 4CEFA 1TV6A 5HRRA 4ED7A 2XGPA 1JLCA 2YNGB 3LPUA 1KFSA 4O4RA 5KRSA 4YR3A 4ZP8A 4FS1A 4F3OA 3DOKB 3AVLA 4CEZA 4TQSA 3LP2A 3AVCA 1IKWA 5KFJA 4ED3A 3T5KA 1L3SA 4CEOA 3U6FA 1RT5B 4N47A 4C8MA 1KFDA 3DRPB 3E01A 5KFXA 1QSYA 3VA3A 3DMJB 4ZHRA 1I39A 2HNZA 2ILYA 3L3UA 3V9ZA 1S49A 1WSHA 2OPPA 1QAIA 3AA2A 4CF8A 4CJEA 4XPCA 1S0OA 3EZUA 3PX4A 3V6HA 4C8LA 1JIHA 2UVVA 3V1RA 1X9WA 5HLFA 1TK8A 3MR6A 4HYKA 1BCOA 4AH9A 1MMLA 4WYLA 4FLUA 2YKNB 1KLNA 4Q8EA 2JEIA 2I1RA 5KFQA 3KLEA 2GC8A 1RDDA 3HPGA 1NK7A 1KCFA 1IKVB 3ZCMA 1EKEA 3PX0A 5KFIA 5FROA 3O4NA 3HP9A 2Z1HA 3AVMA 4O3PA 3OYAA 1TL3A 3RB6A 5KT3A 1EETA 2R8JA 4QCLA 4QPXA 1XHXA 4BWJA 3DOKA 3MFIA 5HP1A 3C6UA 1HPZA 3BSCA 3OYHA 3HK2A 4Y3CA 1VRUB 4MIBA 4KBIA 4JV1A 2OZMA 2E6MA 2JEJA 3V81B 2FBTA 4IG3A 4DTSA 3VQ7A 4CERA 1HARA 1C2PA 2AX1A 1JL1A 4FJKA 2X6SA 1N6QA 1IM4A 3O3FA 3I0SB 4J2EA 4HKQA 1NHVA 4CJQA 4W5NA 1CXQA 4RNFA 3T5LA 3RRGA 3DLKA 3OYBA 5HLFB 4NYNA 3QIOA 1IG9A 1RYSA 2OPSB 3E51A 4E0DA 1S6QB 4DWIA 1Z4UA 5KI6A 4CEEA 2PY5A 5L1KA 4Z4EA 2FVSA 1HJRA 4LQ3A 4WFYA 4QW8A 3UDLA 3NGDA 3VQ6A 5KFCA 1NHUA 4CGGA 4ELTA 2G8VA 2XHBA 4IRKA 3RB3A 1JKHB 1S1XA 3DRRB 4DS5A 1REVA 3VQBA 4FM0A 3CJ0A 4GC7A 3GV7B 3HT3A 2BQ3A 2HAIA 1LW2A 4KHQA 5KFMA 2Y1IA 4TYAA 3V9SA 5KG3A 1SH2A 3N6MA 5K14B 3OS1A 1EETB 2YNIA 4PY5A 5C25B 2O4GA 4Z4CA 3KLGA 5T14A 3BQ2A 5HRPA 2XGQA 3OYNA 2RF2B 4J2BA 4TQRA 4HVJA 1NKBA 1RT1B 3K59A 1HQEB 4FJNA 4IG3B 4LQ9A 1RDBA 3JSMB 4NYFA 3LP0B 3RWUA 1FK9A 3SNNA 3KJVA 2OPRB 4BDPA 4RW6B 1TKXB 3DI6A 4J9KA 3N6LA 4B3OA 4EBCA 2HMIA 5F8JA 2HB5A 3KKSA 4I7FA 3I5BA 3EY1A 3SV3A 4ZP7A 2KZMA 5F9LA 2IOCA 2FVRA 4TYBA 1MU2A 4FYDA 5DQGA 3MAQA 4C8KA 3HHKA 1K1SA 3RMCA 4B9MA 1KSPA 2IM2A 1D1UA 5KT4A 3WNHA 3KK2A 1J54A 3MECB 1Z25A 1QHTA 3MFHA 3C95A 4KHMA 1S1XB 4ZTJA 4FJ8A 4EEYA 3Q8PB 4IQXA 3D0PA 3OLBA 2FC0A 3CQ8A 4FM1A 1UWBB 3DLHA 4IFYA 3IG1A 3AO2A 1RTIA 1IKXA 4WZQA 3H5XA 4H4MA 1HNIA 1S9FA 3NGYA 4O0IA 4G1QB 3NGIA 3SUNA 3SPYA 3MEGB 1VSLA 1YTUA 1U04A 3DRSA 4MFBA 4DF4A 1SKRA 4FM2A 2B6AA 4HUEA 2F96A 4DMNA 4OLAA 4GC6A 4IRDA 4LH5A 3KIOA 3IRXA 3JSMA 3DLEA 1KHWA 3I8DA 2EHGA 5FRNA 3QGHA 5EUHA 3L2RA 3AVIA 4KI6A 4CE9A 2B43A 4E7IA 4KB0A 1JLFB 4URSA 4E7JA 4JRPA 1S9GA 2QV6A 2J6SA 4CJUA 4DQQA 1ASUA 2XWYA 5CYQA 4DTXA 4CGHA 4TLRA 2YNHB 3CVKA 3ZSYA 2UVRA 2RPIA 1EP4A 4CEDA 3DM2B 3KK2B 4RW9B 4CFBA 3KK3B 3HVAA 3VQ4A 3SQ0A 4RNHA 1RBVA 3P83D 3H08A 1BI4B 3GQCA 3D28A 2UVWA 3RRHA 3ISNC 3IG1B 1TP7A 2HHQA 3QNNA 4DTOA 3MEDA 1K1QA 4MH8A 1NOZA 4HUFA 2Q3SA 1S1VA 4Y1DA 4DL5A 1S6PA 2B6AB 4ECQA 4E7KA 3PO5A 5SWMA 3SFUA 1RTJB 3RMDA 3TVKA 2HWIA 1XI1A 3DLEB 2WHOA 3NKYA 2C2EA 2R2RA 5KFBA 4JRQA 3G10A 3OHAA 1N48A 3KHHA 3OYCA 4DSEA 5HBMA 5F8HA 4RUAA 1FKPB 1S0NA 3QEIA 1WSJA 1TKDA 4Z4GA 2W9CA 3UR0A 4IG0B 2BRLA 3QETA 2BE2B 4PQUA 3V6DB 4JLHA 2XY5A 3LAMA 1FKOB 1WLJA 4CJKA 2IAJB 3QO9A 4ECZA 4PA1A 1XWLA 4Y1CA 4DFKA 3SQ2A 4N76A 4FLYA 2DPIA 4FS2A 2VG5B 3EYZA 3MXJA 1JLEB 4K8ZA 4ECXA 3OL9A 1KVCA 1C1CB 4DQSA 3QLHB 4MK7A 1JLCB 4KO0B 2F8EX 5K14A 2GBZA 4J9SA 1KHVA 4DTJA 2R2TA 1JX4A 3BJYA 2LSNA 4ZP9A 4HUGA 4N5SA 1C0UA 1HYZA 5C5JA 4K4UA 4DSKA 3NFAA 4ZVGA 4CJPA 1LAWA 4J9PA 4K4ZA 3UQSA 3NH2A 3ZT2A 1RTDB 1FK9B 1UA0A 4AHRA 4NLTA 3LDSA 1LW0A 1NK4A 4B3OB 2JGUA 3QNOA 2FBVA 2QXFA 2F8SA 3K5MA 4KTWA 3SUPA 4O4GB 4CF1A 5HBMB 2FLNA 4E7LA 1S4FA 1S9EB 4K4VA 1LWCB 2GIRA 2KFZA 3D5MA 3SUQA 2FVQA 1RBTA 2WONB 4M3TA 5DGAA 4CIGA 3H5YA 3V6DA 4ECYA 4CHPA 4DFMA 4F3TA 1U09A 1YTAA 4R0EA 2WRMA 1FKOA 2RN2A 4FJLA 2HW3A 4LSLB 3LZJA 2XI3A 4NLRA 3BREA 2OA8A 3I5AA 2ASLA 4Z4FA 3NF6A 4M94A 4OLBA 2IS3A 1RA6A 3S3MA 4URGA 2VA2A 5CZ1A 1WSEA 1YVFA 4I2QB 1C1CA 3QLHA 1BQMB 1HNIB 4JV2A 2FBYA 2FLLA 1N5YB 4KO0A 4URQU 1XC9A 4K50A 3PZPA 3MEGA 2OPQB 4KKOA 4TY8B 1F21A 4YNQA 1SH0A 1HPZB 1S0MA 1RTHA 1S1TB 1T3NA 3LALA 1OS5A 2FVCA 2KFNA 4KAIA 2IGIA 4CIFA 4W5QA 3H59A 4QAGA 3ZSOA 4M3YA 1LW0B 5KFRA 2X6NA 4YP3A 1RT2B 4RW4B 1QSSA 4XO0A 2BGGA 1A5XA 3K2PA 2DY4A 2QKKA 5JXSA 4FBUA 4F50A 4M3WA 5KFYA 3HKWA 2ASJA 1JLBB 4NLWA 4CFDA 4WZMA 4RW7B 4LY7A 4J9NA 4E1NA 3TAMA 1XHZA 2XC9A 4OJRA 2ASDA 4RW9A 3DYAB 3ZSXA 2VG6A 4ECRA 2UUTA 2AU0A 4ED8A 4B8CA 3T19A 5KG7A 4RW8B 5FDLA 3PVXA 2HHUA 3PW2A 3MR3A 4CHYA 1NJYA 4X2BA 2YNIB 3AVAA 1NJXA 2P5GA 3GV5B 4KKOB 4TY8A 1L3UA 2JEGA 3LP2B 3MR5A 2XI2A 4XIUA 4NLUA 1RTHB 1K6YA 3ZT3A 3I5CA 4CGJA 4FLXA 4NYZA 4HCCA 3HSTB 4DF8A 4MKBA 4DTMA 3KD5E 2C28A 4FCYA 2JC1A 3H40A 4EP4A 3LP0A 3QGIA 3QEWA 4ELVA 4RW6A 2OPPB 3MEEB 3O3GA 2W7OA 3TAPA 4NLPA 3MTKA 1RT6B 4RW4A 4J9OA 4I7FB 5KGWA 3S9HA 2BDPA 4OVLA 2FVPA 3KTQA 3CWJA 5SZTA 1VSFA 4RW7A 3TAGA 4DTPA 5FRMA 2YKNA 2ATLA 2BE2A 3HPOA 2HVHA 4PQUB 2HHXA 3DYAA 2IA6A 2W9BB 2D3UA 1A5WA 4B9NA 3GYNA 4E19A 5EWFA 3H5SA 3RBDA 4DEZA 1UWBA 1Y97A 4FJIA 3KMSA 4K4SA 2IJNA 3GV8B 2GV9A 3V9WA 1WNEA 3S3OA 4FJ7A 3DRSB 2KQ2A 1W25A 5KFGA 2BQUA 4FJGA 1VRUA 4WFXA 1LWFB 4CJFA 4NCAA 1WAJA 2WOMA 1T05B 2D0CA 4CJ5A 5EU7A 4B9SA 5F8GA 4LSNB 3M8RA 1N6QB 4NLVA 1N56A 3IS9A 3IAYA 3KLIB 3I0SA 3AVJA 3ZSZA 3L2VA 1BQNB 3V9UA 4O4GA 3DLKB 1A5VA 5J2NA 1BL3A 1QE1B 4H54A 1S9EA 3NBPA 3HYFA 1BIUA 4BDYA 5L9XA 4K8XA 5JS1A 3QEXA 4R5PB 5KG1A 1O1WA 1RAJA 1BHLA 2WONA 2D41A 3DM2A 3HPHA 2I5JB 3NMAA 5KFNA 1JKHA 3OHBA 1BI4A 3AV9A 5KFTA 4DG1A 2XY8A 4MIAA 1Z26A 3GIJA 4CIEA 2GUIA 5J2MB 4M45A 1RCHA 5I3UB 4OKEA 3MXIA 3DLBA 2IMWP 1S1UA 1DLOA 3PX6A 1RT3A 3VQPA 2OH2A 1TKZA 3SQ1A 2Y1JA 1RT1A 3GILA 2HHTA 5DG9A 2XCAA 3K58A 4QWAA 2BANA 4KV8A 3KJVB 4KRFA 3TARA 1LWEA 2CJQA 4Y2CA 3KLIA 3V1QA 3OYGA 2DFFA 4FJ5A 3MR2A 4NLXA 2WTFA 3OL6A 5J2NB 3ZSRA 2D0BA 3KLVA 2R2SA 4IH7A 3T5JA 4CHNA 5F8IA 2ALZA 1NKEA 1JLQB 4O3QA 1L3TA 4KFBB 4KHYA 2HNYB 4IDKA 3LAKA 4CJVA 1T03B 3T1AA 1DTTA 2ETJA 5F8LA 3M9OB 3WNEA 1JLGB 3PUFA 2AGPA 4DLEA 4RW8A 5FDLB 3LWLA 2RDJA 4DG1B 1U49A 1I6JA 2AGOA 4FBTA 1HYVA 3M9NB 1UA1A 1NK6A 3NAHA 4OKJA 3CG7A 5F8MA 4OKKA 4G1QA 2DFHA 3NL0A 2XO7A 2KZZA 4FJJA 4MFBB 4Y34A 5CY4A 2QK9A 1C0UB 1R0AB 3VQSA 5DGBA 3F9KA 2IC3A 1VSEA 4CJLA 4IOBA 3AVFA 4NLYA 4DLGA 3CFPA 1KLMA 1KVAA 1LWEB 5L1LA 4OGEA 3MEEA 4GMJB 3KLFA 4DQIA 4BE2A 1S97A 4IFVA 4AHTA 3QZ8A 3CFOA 4KTQA 4J2AA 3LP1A 4CESA 1B9FA 4ZMMA 3AO1A 3VQEA 2ZQBA 1LWCA 1RT7A 1JLQA 3CO9A 2R8KA 1RDAA 2G8HA 1X1PA 3SV4A 5KFSA 1EP4B 4PWDB 4RNNA 5KFWA 4QWCA 2GIQA 1CZBA 4TN2A 3HP6A 2W9BA 4ZPBA 4LSLA 5J2PA 3B6PA
chains in the Genus database with same CATH superfamily
4PKHA 2YKQA 3AGKA 4QZVB 2E5LJ 3CXCM 4Y28C 4C3LA 5BPLA 1GMVA 1S7HA 1FVQA 1JQGA 3EGVA 1IJEB 1RDUA 1KXPA 2B7BB 4F4XA 2CQPA 1KWMA 2V2QA 3M9MB 3DN9A 1FRMA 1S10A 2HHHF 4NLOA 2B8PA 4QYZJ 4CF0A 4JKHA 1NNDA 1QUVA 3NCRA 1OJ4A 3WXMB 2DR9A 4H0TB 2B0GA 1G99A 4BRKA 3M8SA 5ELZA 2Q1LA 4ECTA 3CCMN 4ID8A 1DQ8A 3KG1A 2MZTA 2KG0A 3HVRA 4JP8A 4EAHD 3AO4A 1TTHB 3TR5A 4P2XA 1F0XA 1CC8A 3KUHA 3ZNJ1 4DBQA 2KRBA 1U4BA 1JNRB 2K7KA 3R8YA 4DSJA 2JC0A 4IKFA 3Q8QB 3O6WA 1GXTA 1Y3KA 1UJ5A 2XM3A 2O1PA 3IRWP 3AXKA 1YBAA 3VQAA 4OX8A 3SPZA 4CM2A 4FXWA 5E0OA 5ETOA 4RWWA 4DMZA 5E41A 3OYFA 4JK8A 2R42A 1E6VB 5IM0B 1SV5A 2EI5A 2OELA 4LD0A 3HCXA 2QA1A 2M7SA 1Q81T 1U8SA 4GVEA 2CPHA 3CDWA 3L3VA 5E2QA 2DEJA 4TXSA 2ITMA 4N8NA 2I9SA 4W5RA 2GVDB 1VLYA 2QRRA 1WN7A 2D0PA 3K5LA 4OYMA 1CSJA 4ETZA 3S41A 2JLEA 4B3SK 3M2UB 1NDCA 3AAWB 2O5DA 2CPEA 2HNYA 1FXLA 3NH1A 3I55N 3OYDA 2B7CB 2YH1A 3TJ8A 2FY1A 4EIAA 1H6KX 3DXKB 3AA9A 4M3UA 2GO9A 3HJFA 3PV8A 1NGEA 1ZM2A 2L48A 1HMVA 3B82A 4IRCA 2RUGA 1N5YA 2MHEA 3M8PB 1U2RA 4JI2J 3AQPA 2EFVA 4DR1F 2GJIA 5IFMA 2KRRA 1R0AA 2ADCA 4RKUC 4PR6A 3ALYA 5AJ3K 2XY6A 3V9XA 5FD1A 4F4YA 2OTLN 2WOMB 1T05A 1D9DA 4M1KA 2X3DA 3R5JB 3CD6N 1JXEA 1LWXA 3TA2A 3Q23A 1RP5A 1HKCA 4IFVB 4PEOA 4DTNA 1NB2A 2XG8A 3HOSA 3TRGA 4ZVRB 3RTVA 4OJHA 2PA3A 1QE1A 2RS2A 3TI0A 4F7VA 3EZ5A 1D9FA 4FK2A 3ET6B 4P2FA 3F9MA 4RNOA 5GINA 2WB4A 3CJRA 3UCGA 1SBRA 2YWEA 5JUMA 5KFKA 4CJTA 1PSDA 5HRSA 2H5JB 1I1GA 1WI6A 3D45A 1HIYA 3KVGA 4DQ8A 2ATCB 2QWMA 3MM8A 3BM7A 5D0HA 4IQMA 4EZ9A 1TKZB 4A57A 2OMOA 4B8AB 4QR2A 2FXUA 1FDBA 1RWVB 2MMYA 3QERA 3SQOP 4ES3A 1S0VA 1FNXH 4FLZA 1X5PA 1QTMA 3I9V9 2QWOA 3KWGA 3PKYA 2CQ1A 3WNFA 2VV5A 2ZJPL 2DRAA 4E1MA 3BGRB 3MUVP 3O9UA 3VAMA 3G6VA 3M32A 1VQKN 1MWQA 3DMJA 2BE9B 3ULEA 3OR1A 4LFBF 4CCHA 1LOUA 2J9DA 3D6TB 5EWEA 5L1JA 3BSNA 3LGHA 2UXDF 1YJ9N 3EDQB 5HROA 1YI2S 1RTZA 4Z0UA 2VQFJ 3RB4A 4KB1A 4FOEA 5DK5A 4WFZA 3RB0A 1F9FA 4B3TJ 2UXDK 2HFZA 5KG6A 2W9AA 3D3CJ 3LDQA 2XYPB 3K5OA 2B51A 4Q5VA 5A6PA 2ZJPQ 1TAUA 3VAKA 2ZZTA 4E89A 3QMQA 3BS9A 4Q7AA 2PFDA 2YHAA 1TKTB 4DV5K 3NP5A 2DK2A 3OTEA 3Q8VA 1JXLA 5KTQA 2YQ1A 2KN4A 1BISA 5KFEA 5DDQC 7FDRA 1FNOA 3NDKA 2C1EB 2K7JA 4IH6A 3U9DA 1RSCA 2F65A 4ER8A 1ATNA 1SQGA 1JLAA 2A40A 1QD1A 2ZH2A 2PT0A 3MGJA 4JI4J 4WYWA 3B6OA 4DCJB 4IH5A 4I68A 4WK1A 1TUYA 2YHBA 4CF9A 4Y0FA 1NM1A 1ZAXA 4PUOA 5AJ3F 1WG5A 2VDIA 4ELUA 1IJJA 3R7SB 3QJLA 5HROB 2NUBA 3O9TA 2ZWPA 3PCOB 4ID5A 1Q9XA 1AFJA 2OPSA 3VEZA 1NZ8A 2GVZB 3M6GA 4BQZA 5FLXY 1ASVA 5KT2A 4I6YA 4EZ6A 5AJ3J 2W7PA 1NGFA 1UAXA 1YVUA 3WDOA 4LFAF 2YHYA 3H5UA 1T6DA 4CBUA 5C10A 3GL1A 2XSJB 4DL6A 4DR6F 4AYBD 2LA4A 5KG4A 2AJQA 3WC0A 4QQBA 4KHPK 4ED6A 1FA0A 1N0UA 3RGIA 5C2DA 5AE2A 3U3YA 4DV4F 3AJ1A 2E9ZA 2VD3A 3KLGB 4I9QA 1IJFB 2VA3A 4IO9Q 2V4RA 3AAQA 4YR0A 4ICLB 2OPRA 4DTUA 2G8KA 2W2NP 1S12A 4DOZA 2E1RA 4H03B 1ZPVA 1VMBA 1I94K 3EE8A 2HBQB 2DGQA 5DG7A 2KJVA 4U8VA 2MGZB 4UQGA 2B9YA 2XLIA 2F9WA 4OJ3A 3BR9A 4DV1F 4MO4A 4ID1A 1VBKA 4CFAA 1HNVA 4MTPA 2DRBA 5I9EB 1ZM9A 2KHOA 3D6HB 3CMES 3FQKA 4C8ZA 3PHTA 1QVFM 2HAFA 1TK0A 2A6MA 1V3SA 1HLUA 4KH1B 3LZIA 2GS8A 4USKA 4F26A 1K73T 2IM1A 1TL3B 4IOAL 1N36F 3ID8A 5H1SV 5J1EB 3NG8A 2WVBA 1FTCA 5HMWA 4ED2A 3HD1A 4LF7J 3VZHA 1Q8LA 3IWNC 3PIOL 1U47A 2CZVC 5CR4A 2N4CA 1IKYA 3CJ5A 5GAHP 2W6LA 4DCPB 2BJ8A 4NCBA 4DQRA 1Q95G 3N6NA 4WXOA 1NLKL 5HQLA 3NAIA 4DUZF 2JFKA 2G8UA 3PACA 2FJXA 1I3AA 5L39A 3S3NA 3F2KA 3EGWB 5E3QA 3VF4A 1C0FA 1ZXOA 2DKOB 3W2VA 4ZTFA 1XMQK 3TAQA 2B4UA 2YHXA 1TKTA 3VPZA 3E9LA 2HBYB 4MLHA 3VTIA 1TV6B 5D0GA 2VGMA 2ZC3A 3WNGA 2ITGA 3O9RA 4PXCA 2HZAA 2LFVA 5T7BA 3X1LB 1VLOA 4JS4A 3KMQA 3AD7C 2BR0A 1RCXB 5HN0A 4KHSA 3RW6A 3HTVA 2E5LF 3OQ2A 1HBMB 4WF9L 1T9WA 2OI2A 4C8NA 3DOLB 1SL2A 3FJ2A 4YDXA 3D2EB 1TVRB 2H5IB 2Z56B 1H74A 2LECA 3M8QA 2LU2A 4QWEA 1FWLA 2VPXB 3SMZA 3KJFB 4KH0B 2PYJA 1BUPA 3THPA 3B8HA 3OD2A 4CNYA 3ZLJA 1RU2A 2K06A 5IV4A 2J0SD 3CT9A 2W9CB 1XMBA 3CFRA 1FESA 1TK5A 4ZVEA 1GH8A 4KREA 5CYMB 4QYZK 5AZJB 1D0EA 1U25A 5E84A 5K9FA 1B64A 4KHWA 2W2PP 4NX9A 4KB7A 1BXNA 2CGKA 5JVHL 2P5OA 4CJSA 3QSIA 3QT6A 1SUQA 1PAUB 3PKMA 2SXLA 1GX5A 1HNZK 6FD1A 3SBGA 3TUIC 2P9LB 2M9KA 3MN9A 3DU5A 1C1BA 3BGRA 2XS2A 5BRHA 3IRXB 3VA0A 2XS7A 4OPHA 4EP5A 3ITHA 5E7OB 2WSFC 1H2TZ 1EXQA 4CNZA 4B3RF 4O0JA 1Q9YA 4I69A 4X66F 3M3ZA 1YZ6A 3J81O 5KFFA 1RFQA 3M8WA 4LBHA 1T9XA 3THYA 4M95A 2I6WA 1C4AA 4DSLA 2OP5A 3IGNA 2HS4A 2DTUA 1HNVB 1QJHA 5BREA 2MQ8A 1KRPA 4AQYK 4OLOA 1GX6A 2VQEK 3THTA 3FRZA 1NNEA 4UOGA 2YY3A 2VWJA 3PJ9A 4DR7J 4LH4A 2G2OA 3C6AA 4KAZA 4KI4A 2IFXA 4HTUA 2KB2A 1WHXA 5CZ2A 3OL7A 2UUAF 3C19A 4BRMA 2CJAA 1O8BA 3BQ0A 2J76E 2P9PB 5IWAK 1Q8IA 3P1GA 2HVEA 2QO3A 1ESVA 5EDWA 1YRUA 1NSQA 3TEGA 5GAEU 3GP9A 3TZWA 2P5VA 4ZCIA 3RAQA 1N32J 1N0VC 3BO4A 3QT8A 3ATUA 3ZT4A 4RLEA 4AHVA 1VBYA 2ZZNA 2QFJA 3OR2B 4M5KA 3EZOA 3PW4A 4JI5F 4O5BA 1FKPA 1PGZA 4EK2A 1JLBA 1HQUA 2HQGA 3QIDA 2JEFA 4DR6K 1RADB 1UOCA 3SAFA 4WJBA 4BC9A 2RNEA 2FBXA 4DSFA 4B1WB 2DNLA 4CGIA 2QJ3A 3GIKA 2IAJA 1NBWA 2PAVA 3UVJA 3QEVA 5HMXA 2DR8A 1E3MA 1WOPA 2Q1NA 1WKJA 1LQ9A 1U1NA 3LPUA 1UTAA 4K59A 4HTIA 4YR3A 3G8QA 3AVLA 4G65A 3PRVA 1IKWA 5KFJA 3ZZYA 4ED3A 1T02A 4CEOA 5F0XA 3U6FA 1ZZFA 2MSTA 4DI6A 2XBPA 3MN7A 3E01A 2XYHB 5KFXA 1QSYA 4WU3A 5FPMA 3TUZC 1AW0A 3EX7B 1B0PA 2OPPA 1QAIA 3AA2A 3SSQA 4HHUA 4CF8A 3T1HF 3K7RA 3EZUA 3F5TA 4QBUA 3PX4A 4ZLPA 4C8LA 1JIHA 3HSCA 2UVVA 1VYAA 4X4TA 1TK8A 4PPDA 3CF5Q 4UY8O 2YKNB 1UL3A 1KLNA 4Q8EA 2JEIA 4CT8A 1RXOB 1YRXA 4JI2F 4DKWA 2L9NA 2AT1B 4ZJLA 3HPGA 2DR6A 1NK7A 4XH1A 4USWA 1WOSA 2RU9A 5KQDA 3HP9A 4GKKK 2BH1A 3RB6A 5AQLA 4NA3A 1UVMA 3CCLN 1WJ9A 4LF5J 4QPXA 1Q8BA 4BWJA 1FFGB 3C6UA 2DH8A 4V19J 1T3VA 3HK2A 3LDPA 2XLJA 2CJYB 2ALYB 1W7WA 4CLFA 2FUG9 2WVDA 4QPTA 1ZBSA 3LDLA 2OZMA 1FJGF 4CERA 1HARA 1C2PA 2FIUA 1RHRB 2AX1A 2X6SA 1IM4A 2A41A 1PBUA 3OUYA 3T5LA 5HLFB 4DPUA 1PO6A 1RYSA 4E0DA 2E29A 3THYB 2FF6A 5KI6A 1CJVB 2O8EB 3CIMA 3CJCA 2YPYA 4LT6A 1TR0A 1EIYB 4EGLA 4CGGA 4IOCQ 1JKHB 4DS5A 1TUGB 1REVA 3VQBA 2P9KA 3J7ZT 3PYGA 1YIJN 2RU3A 3V9SA 4AM7A 4JEPA 2M3DA 4ZCMA 4YY3K 2YNIA 4OJ1A 3CSKA 3M05A 3T9ZA 5T14A 4ISFA 4J9VA 1KQGB 2RF2B 3POTA 4TQRA 1QQNA 3SK3A 2ZH3A 4OIXA 2ZEJA 2J4RA 2DH7A 1QAXA 4NYFA 1UKUA 5K8PA 2Y0SD 3D0IE 2ASPA 2YX4A 2DD8S 3KKSA 3JAMO 3I5BA 3SV3A 1CULB 2MGZA 1QVFR 4L3QA 4V1Ak 3MX2A 1XNQK 2HBMA 2FVRA 2D3OR 3W1YC 3K89A 4FYDA 4GKKF 3F0NA 3HHKA 1K1SA 3H2UB 5BJRA 4B9MA 4JI3J 2PC6A 8RUCA 5THWA 1D1UA 5KT4A 4TVAB 4C2MA 5K5MA 2BX6A 3C95A 4KHMA 2IPOB 1SJ3P 3OBWA 1T9UA 4JYAK 3N28A 2KFYA 3RBXA 3Q8PB 2FC0A 3G2XA 1HNXK 3DLHA 4CO1A 4KBOA 3AO2A 2PGCA 1RTIA 1PC4A 3KDOA 4BRLA 5CHIA 1YIJS 3NGYA 4G1QB 3DLLQ 3SUNA 3MEGB 2YWKA 1U04A 3DRSA 1F5CA 3OFHA 1UFLA 3I4HX 5FLXO 2B6AA 4HUEA 1WUAA 4BC7A 1FE4A 4DMNA 4OLAA 2RB7A 4FZVA 3SDEB 3AH6A 3OA9A 2ZH9A 2O8CA 2DNNA 1KHWA 3EO3A 4C97A 3R9LA 5EOYA 2B43A 4E7IA 4YOEA 3I31A 2H48B 3QT7A 3H90A 4USJC 2B9WA 1IBKK 5CYQA 2NSBA 4DTXA 2RIJA 4CGHA 1OO0B 3BO3A 1WDTA 1EP4A 1XN9A 3ILOA 3HVAA 4OYIA 4NLBA 1RBVA 4FN5A 3GCWP 5EVZA 3H7HB 4LC9B 4FPRA 3GQCA 3L3CA 1YX2A 2D1CA 3RRHA 2UVWA 4LF5K 1VDHA 1TP7A 2HHQA 2AJFE 1ZOTA 5H1SQ 3W3DA 2COLA 1U8WA 2LQ5A 4DR5F 3VWSA 1Y5IB 2Q3SA 4JI7F 1S6PA 3PO5A 3D54A 3AOAA 2HWIA 4X62F 1FJGJ 4X65F 2O8CB 8AT1B 3EKSA 3J7Z5 4FKXA 1KAXA 3BB5A 4PYAA 3OHAA 1RHQB 3EE9A 3OYCA 4IJAA 4I6WA 3R7NB 1Q18A 3HI9A 1S0NA 1BA0A 4BR9A 1WSJA 3GE1A 1KS2A 1UEUA 1U02A 3V2UC 1VHIA 4ILHA 5IT9U 1WKKA 2LQBA 4IG0B 3DU6A 1Q8KA 4ZOSA 1YJNS 2Z2YB 1X31C 2XY5A 4JLHA 2UXCK 3LAMA 2BUNA 1FKOB 4PA1A 4PG7A 5BPMA 3FZMA 4DFKA 3SQ2A 4FLYA 1SAZA 4DDFA 5D77A 5M1PA 3CC2S 2OD4A 1JLEB 2CH6A 4ECXA 2UXBF 3MXJA 4GKJJ 3FZBA 1JLCB 2F8EX 2BJ9A 2CZ4A 1JX4A 4DR2K 3BJYA 2MQQA 1KC8O 2DB1A 4N5SA 1HYZA 5EX3A 4DSKA 3NFAA 1X3NA 4B3MJ 4DV4K 4ES2A 3TA1A 4LREA 3NH2A 2CVIA 3SCKE 4WTYA 2BJ3A 3FR0A 4JI1J 4NLTA 3DWLA 4K41A 1EARA 3CCJS 3BO2A 2RE2A 3P3DA 2QXFA 4KTWA 3VCDA 3ZEUB 3RAMA 2FLNA 2E1PA 2HQCA 5A8KA 1S9EB 1FJCA 3TUJC 5K8OA 2UUBK 2GHPA 2M0GB 2FLOA 4NPOA 2FVQA 4U7UK 1RBTA 3JTNA 2DGXA 4M3TA 2PFFB 2O3DA 4CIGA 2HVDA 5ETLA 4OI1A 2WRMA 4RO0A 2Y9HA 1SJQA 3LZJA 4NLRA 3I5AA 2MJNA 3C46A 3VOVA 2ASLA 4Z4FA 5HVHA 3S3MA 4URGA 1R8AA 2VA2A 3IMXA 4G1IA 5CZ1A 4I2QB 4OYXA 1XC9A 1RAAB 2ROEA 5JJBA 1F21A 1HPZB 4FPIA 1RTHA 3WEEA 1T3NA 2VOOA 4J7CA 1HNZJ 2KVIA 2ZH7A 3AT1B 5A8RA 2KFNA 5F1XA 2WB1D 4CIFA 5CD4A 3KWIA 2GAGC 3T1YJ 5K8NA 3VEYA 5H9FJ 2DVIA 4LR7A 1WHWA 1RHMB 3TTFA 4M3WA 5LSOA 5AXLA 2VOPA 2DPNA 3NMUA 4GNIA 4CFDA 4RW7B 2M70A 2D69A 3DLJA 4J9NA 4GRSA 3CC4S 3ZZPA 2XC9A 1XHZA 2ASDA 2YJEA 1ZS6A 3DYAB 2F9TA 4LF4J 3R5AA 9RUBA 4ECRA 2OHDA 3J80Y 4DV0K 4DV7F 1R0BG 4HHJA 3WX8A 1NPPA 1TFWA 2LDYA 4NOHA 3J81U 2VBZA 2ASMA 3K5PA 3MR3A 1CJKB 2ZWHA 2YNIB 3AVAA 3H2VE 2W1BA 4QIVA 1U1RA 3GV5B 4KKOB 1L3UA 1U2CA 3LP2B 1T9TA 3MR5A 2XI2A 5HOOA 4NLUA 3FGVA 4NYZA 1N32K 3CJKB 3HSTB 1VQ6S 4DF8A 2C28A 2HBRB 3HBTA 2JC1A 4TU8A 2LU1A 4CLUA 3ILIA 2E1MC 1GLJO 3VGUA 2Y0BB 1R8BA 3CPWM 1XMOK 5LMNF 2FC9A 3LGNA 3BF1A 2FVPA 3CWJA 1PAEX 2NRVA 5SZTA 1VSFA 3CF5L 4FWMA 4P2MA 5FRMA 2YKNA 4B1XB 2Y3YA 3CHWA 1R27B 2W9BB 4AXJA 3VEWA 2EK6A 1A5WA 4B9NA 2PN6A 3GYNA 2YJFA 4K7QA 3O80A 3H5SA 3RBDA 3N4WA 1JNZB 3H1QA 3BPDA 3Q0AA 2CG8A 5AQQA 1UWBA 1UJ6A 1R59O 2ZOFA 2QW9A 1HHQA 1T3OA 2J8AA 3M30A 2F1FA 4YOXA 4ZPTR 3GV8B 2VPYB 5BR8F 4FJ7A 2DNRA 5JVGQ 5KFGA 3CCES 3QMLA 3VVUA 1HKAA 1VRUA 2V69A 4JI5J 5AQWA 5FPNA 1RISA 1X5TA 4OMFG 2Q36A 1PJ6A 2F4VF 4CJFA 4NCAA 5C12A 5IV3A 1WC0A 1QZ5A 2P9SB 1VISA 2MTLA 1QHAA 3JAMU 4CJ5A 5EU7A 1EQ0A 5F8GA 3ZX0A 1OQ3A 1N6QB 1VQNS 1SXLA 4Y0WA 4L72B 2OFGX 4HI1A 1BQNB 3SEOA 2ZHBA 3FZ2A 4IO9L 3DLKB 1U6BA 3HHEA 1VQ8S 4OYAA 4WPAA 3OBYA 1A0OB 1BHLA 2O8EA 5BRFA 1RWPB 4GKKJ 2HVZA 4DX6A 1NMDA 3NMAA 3OHBA 3AV9A 3NGUA 2J8SA 3ENOA 2J7WA 3WQTA 1MMNA 1IBMK 3BGOP 1Z26A 2GQQA 3GIJA 2DY9A 3SBMA 4M45A 1RCHA 5I3UB 2IMWP 4X65K 2H65B 3ONQA 3PX6A 1RT3A 2OH2A 1TKZA 3SQ1A 3OV7A 5J1NA 1N33F 4LF9J 3GZ7A 4GVBB 1VR6A 2HHTA 4ZVQB 3M8YA 3K58A 5CZVA 4BRFA 1Q86O 3GSIA 2BANA 1Q5VA 3KJVB 1AFIA 3GJQB 3R7BB 4DU7A 1Z05A 4FJ5A 3BDEA 4ILGB 4LFBK 3QPIA 5GADP 2W4CA 2YVSA 3OL6A 1MROB 1RBAA 4RBTA 2F7VA 3W0LA 3P49B 1SJFA 1L3TA 4MMOA 4IDKA 3W2WA 1T03B 3EL2A 4LIRA 4WIQA 1DTTA 3IXQA 2XMKA 3NWRA 3VF6A 4XDDA 5GAHU 4U67L 2FJEB 2KDOA 4RW8A 4UUXA 2RDJA 2A1BA 2JVRA 4LRFA 2AGOA 1WOOA 3QGPA 3CGIA 3CJBA 4QIWD 2V4JA 3UNGC 4WP8A 3GCXP 5F8MA 4OKKA 3N01A 1VJWA 3JSYA 5K20B 1P27B 1NJIO 2CNLB 1TMJA 4Y34A 5CY4A 1C0UB 1R0AB 3EDRB 3VQSA 2D1KA 3F9KA 1UW9A 4F25A 4UY85 3K9KA 2IVFB 4QJVA 4FVCA 2LA6A 1YBUA 2DTJA 2DGOA 4BRGA 4LFAJ 3LW5C 5L1LA 3QQCD 4GMJB 4DQIA 3VEOA 4BE2A 3NS7B 3NVKA 4AHTA 3EJMA 3QZ8A 4NASA 4KTQA 2QN6B 4CESA 2CDQA 1NO8A 1LWCA 3IR6B 2E5IA 2HFNA 1JLQA 1RDAA 2Z4PA 1QVGR 1X1PA 2OIHA 1J27A 2GWJA 5GADU 4PG4A 1S59A 1WD6A 4FWKA 5GIOA 3THXB 4JI0K 4CK1A 3ENHA 5B09A 3CE8A 5BXIA 2POKA 4NEYA 1BQMA 2ZBPA 4W5OA 3T6BA 1CG2A 4JV0A 2ADBA 4MK8A 3AY9A 4DR4F 4RNMA 2YX6A 4FKYA 2OTJS 3OFEA 1RA7A 4DCHA 5LY3A 3JB9k 3NCIA 1EX4A 4RR5A 2AZ1A 1HA1A 2C3PA 3CIZA 1YTYA 1H0HB 3H1VX 3IS9B 4YOUA 3C15A 1NHKL 4IR1A 3KJQB 1G1XA 4YOYA 3SCIE 4B3SF 1N34J 4I6MA 1YDLA 1M5PC 1RBUA 1YJ9S 5EWGA 2UUWA 2HF4A 1B0VA 3WXLA 4NRTA 2J7KA 3AJDA 4KGZB 4YQWA 5KFPA 1RT7B 5G0RA 2CZ9A 5J2QA 3VGMA 5C42A 3IN5A 2CKWA 5CD4H 1S57A 4DFPA 3TAMB 1ZBLA 1CZ9A 5DRKA 1X9MA 4MO5A 3UB5A 4K4TA 4WU2A 2YBVA 4MKAA 2CDRB 3F41A 3Q8RB 4M3RA 2O67A 4OZ5A 3G82B 4UQTA 4CGFA 4LSZB 4UZBA 3W5YA 5J2MA 4JAXA 1R8PA 2O8DA 4DPWA 1J5EK 4IO1A 3Q2TC 3FUYA 4OZ2A 4K0KF 5HL7L 4L76A 2HIQA 4O44A 3AA4A 4DU3A 2C2RA 1HI8A 5DQHA 3OL8A 3EPGA 1NU0A 3EZWA 1U1QA 4P10A 4DPTA 3ZSVA 1X4FA 4JKDA 2A3ZA 2X74A 5IOLA 2YKOA 1SS6A 4YHHJ 3IUCA 2W01A 4R8UA 3MN5A 3ZEUA 4JS5A 1NGBA 2MJUA 3HM9A 4Z94A 4RU9A 3FSIA 2HFVA 4CGDA 2DGTA 4QWBA 3ENAA 5C24B 3UN2A 4B9VA 1AYEA 5CYJA 4DSIA 4UW2A 2ZGYA 4DV6K 3IDHA 4FLTA 5J1PA 3ITHB 2VHGA 1J6ZA 1M5HA 4Z4HA 4LF1A 1DTQA 3HL8A 1IBCB 3MURP 3GB0A 1YG0A 2G8FA 4OHYA 3TANA 2VPWB 2F5GA 5KG0A 4V19S 5KPTA 3IFRA 2QM1A 4I2QA 5B8HA 4DV6F 4ANDA 4JYAF 3QAUA 2WK4A 4X64K 2O8DB 1VQMN 3CJ4A 3NF8A 3EXYA 4GKJK 2O4IA 1W2BR 1VC6A 4OI3A 2GHWA 3EICA 4P75A 3BPSP 1EHWA 2V50A 3OFFA 1ICEB 5IT4A 4LSNA 3C6TB 2ZE2B 4CQ1A 2E5HA 1NPRA 1HUXA 2O8BB 3I56N 1BQNA 2YHWA 1URRA 2GAHC 2GUPA 1RBSA 2X78A 4Q0BB 4MT1A 2IJFA 3DLGA 4X65J 4HI2A 3R3TA 4R5PA 1NMNA 2O8FA 4DX5A 4TNOA 4YN3B 3NHGA 4C8OA 3K0SA 3L2UA 1HRHA 3DGPA 2M8HA 1VK8A 5FPEA 2RD5C 3M5RA 3E9OA 2IVMA 3BSOA 4EUVA 5ETQA 2YTCA 1U1MA 3CJ7A 5AQYA 2FJBB 1TUUA 3H0PA 5C0YA 3NS6A 2W42A 3NGTA 5A2QY 4L6V3 1SKWA 3OYIA 4KHUA 2FD2A 1GLDG 2P6TA 1BWEA 2ZH4A 5AQHA 3SFGA 5KRTA 1V4SA 5H9FK 1NGGA 2B5JA 3PR5B 3TABA 2KXHA 4DL2A 3CD5A 3OXLA 3G9CA 3WIVA 3THWA 1RBOB 3V1OA 1WDDA 3PIPQ 3CULA 1Y00A 2AQ4A 3M2VA 1UFWA 4RG8A 1ZPWX 2EKNA 2G8IA 1FKAF 1HD1A 4NLDA 3CEDA 4KFBA 4K25A 5AQOA 2A18A 5HVFA 3QFHA 5KFAA 3TPQA 1T03A 5BYRA 4WCEQ 2CXEA 3TOQA 4B9UA 4NLQA 4FJXA 4CHQA 5AQRA 4K4YA 1NK5A 1QUPA 3H3NO 4CVNE 1V6HA 3OVNA 2ZD1B 3KLHB 3MR7A 3A8YA 2GVZA 1VSHA 4C1NK 4H0XB 1RDRA 3TO8A 4P2SA 2E7VA 1XR6A 3W64A 4C98A 3TQ1A 3FC9A 5DG8A 1HI0P 3LOUA 4DHYA 2C22A 3BBBA 4KGVB 2AWZA 4KHNA 5HJYA 2B5JB 1UVKA 1S22A 2AJ1A 4WQ5A 1O5JA 2QI2A 3R6MA 3A8IA 4M8LA 4BROA 2NLWA 3CD0A 3MD3A 3KLFB 3C7NB 2CUYA 4J9QA 3CCQN 3Q7BA 3UE5A 3IBWA 5M2PA 2MKKA 3H46O 4I2PA 3AFGA 3MMAA 3DOLA 5KGXA 4LF8F 3GYXB 2NZTA 1QTNB 1L3VA 5DMRA 3K57A 2ZM6J 4IKAA 3BQ1A 1CJUB 2I5JA 5JS2A 4M42A 4QU6A 3ID6A 2HHWA 4CZJA 1GLEG 4HDHA 2MY7A 1RWNB 2PE8A 4BR5A 3OLAA 3V5RA 4M7XA 4EI2A 5AZIB 1KVBA 1S6QA 1HMVB 2W8KA 1S76D 4F0MA 5IT9Y 3VQQA 2KW4A 5I3UA 2RHSB 5KFLA 1MG7A 4O3OA 3UFCX 4QW9A 3ICLA 3KG0A 1U1KA 2IDOA 4DB3A 2F4VJ 4ILJA 2W4PA 3HO1A 4MQ3A 4KV8B 4FLVA 1KEKA 2VU5A 2D9OA 2L08A 4ZCKA 5E5NA 1NUEA 3C15B 3BBFA 3RU0A 4K4WA 2DNKA 4U7CA 4C4WA 1IKWB 3GYGA 2G0CA 4A8KA 2WFBA 5ETNA 1QSLA 3ZZTA 3CCUN 1OVYA 2R7UA 2O66A 2K3IA 2HNZB 5G0RB 4HHTA 4DV0J 2K3KA 5KFVA 1LNQA 4LF8J 5CE3A 4ZVOB 4OL8A 4X4UA 2QLJB 5HSPA 1IR1A 1MSWD 3DGPB 4CF2A 5EGYA 4DL4A 1KQSM 4N56A 2C2DA 2FJVA 4CLYA 1MWMA 2IM0A 1QS4A 3HD2A 5A0YB 2OEMA 3L9ZA 3NNAA 2F8MA 2J6TA 3NGSA 2F63A 3CM6A 3AVGA 3MDQA 4A4JA 3OY9A 4C1NI 1QQCA 4NXNK 3CC7N 1WF2A 3VVTA 2DNGA 3EPIA 1V9OA 3PW7A 5DETA 4RZRA 1K0TA 3BSAA 3EWGA 4OX7A 3FFIA 2R8GA 3FEYB 3MMBB 3VQTA 3THWB 2CWXA 3GIIA 2HFOA 3K8VA 1HR0F 4X66K 1FWPA 2HNDB 2YKMB 5HP1B 3GIMA 4LRCA 5MAOA 1NGCA 5HRNA 1D4XA 2VKRA 1HD0A 6AT1B 1VQ7S 2HQ3A 3N0VA 2A6OA 3V81A 1C4CA 5AQXA 3R5BA 3G6YA 3NH0A 3D2EA 1BMQB 3J81j 2C2ZB 3H2LA 2NZCA 4G3IA 4KIAA 4M3XA 2GWKA 2HHHK 3QDKA 4ZN3A 1HWIA 1M5OC 4ZITA 2UXCJ 2V5HG 3NCPA 2IIHA 1J5OB 1TQLA 1RAGB 1Q78A 2DNZA 3UD3P 4JD2B 4LRAA 1K47A 3VQCA 3LTOA 3HSJA 3T69A 2KTQA 3UVJB 4KTZA 3FRYA 4I56A 1SQFA 3ZTPA 2AHOB 1DY3A 4TSXA 2GMLA 3KKFA 1NK0A 2CH5A 1QQMA 3MMJA 2UUCK 3MEDB 3D0HE 4MIWA 2FHKA 2IYGA 3MM6A 2BXJA 3PRBA 4ES1A 1JMTA 2Z30B 1N5VA 4DS4A 4X4NA 2NPFA 3P5BP 1P8GA 8ATCB 1G15A 1RCOB 1C1BB 2KM8B 4WE1B 1BHNA 4X4VA 3OYEA 1AXQA 2ZNYA 1HQEA 4OHVA 3AO3A 2MY8A 3JSBA 1F2GA 2U1AA 5J2QB 4WFNL 2FSNA 3QEPA 1ITGA 3L2QA 2XYGB 4PABA 2LDIA 2N3OA 3WUHA 4E8UA 4QS7A 3D7SB 1T8EA 3N4PA 4BHQA 4YR2A 3DXMA 3VMFB 4WP9A 2DNYA 1ZETA 2OJ3A 1U2VB 3DXSX 5D0EA 1HNWK 1TAQA 3SUOA 4A47A 3MWTA 4XDCA 3TYTA 4O8KA 2QA4N 2FY8A 3MEKA 1F60B 3ETOA 4FZXC 4JD2A 2ZDPA 2XMJA 4JI1F 3ZT0A 2ZZMA 3QGGA 1S5JA 1FTRA 3IAM9 4BVPA 3VEXA 4RUHA 1F3FA 4ZVHA 1F6TA 2YWGA 4EYHB 2AJ4A 3SZ2A 2HGNA 4F8RA 4X62J 3D2FB 5AQSA 1X4DA 3O3HA 1WKLA 2LYVA 2E44A 3LWMA 4CZEA 3T5HA 4DQPA 2VODA 3QBCA 3QFPA 5LMNJ 1MLAA 1RWMB 1FXRA 1HPMA 2HSTA 2VWBA 1ZTWA 4Q45A 3J7AP 3KYLA 4J2DA 3OR1B 1LK7A 3MPYA 4DV5J 4FWQA 2ATQA 4PAAA 4M5NA 2QE5A 1W9HA 1FDDA 3CCZA 4DR4J 4ED1A 3DXMB 1ZZNA 3I56S 2DPJA 2XHCA 3OYKA 3A8EA 4YDUC 4ZKAA 3ASMA 3TVZA 2JHEA 2MLYA 2AEFA 5DO2A 4DU1A 2RRBA 2A2DA 2VGNA 4DTRA 4I9LA 3W63A 2YNFA 2CQIA 2Y1RI 3DLRA 4NXNF 3JQMA 4NO7A 3KK3A 2MZSA 1BDGA 2EXUA 5HJXA 1QVGM 1IBLF 2DITA 1WC4A 1X8DA 3VQDA 2MLZA 4C0BA 1YSJA 5K8MA 3CDBA 1X4EA 4PL8A 3FQLA 4NLSA 4OX9F 4KGKA 2WW4A 1S1TA 1RT5A 3DRPA 3BR8A 5B08A 1NAQA 4HVZA 4Q2MA 3GJTB 2QWRA 4KT0C 1XMOJ 2R8HA 5BPNA 3WHIA 4M5GA 3LO3A 4BGAA 3RMBA 4F4KA 2CNKB 2WSCC 4F2SA 1T95A 3PLAA 3ADAC 1N34F 2IBKA 4DUYK 1ZTTA 2CNNB 4OPJA 1RWOB 3K17A 2CNOB 3LP3A 1E6YB 1JXVA 2QKBA 2NXNA 2D9PA 5D15A 3UPFA 1I3OB 1Y7PA 3JXUA 2D5RA 4JI3F 2KKHA 1D09B 2A3JA 2QWLA 3HZGA 3BEXA 5EX5A 1K73O 3SCXA 1YITS 3G6XA 1RACB 2CYYA 2PZSA 5DM6L 5HANA 4CZHA 4JI8J 1Q7LB 2VG5A 1SI9A 2D3ZA 3VQ8A 4MDAA 1VJQA 4BE1A 3MOJB 3BP8A 5HRRA 2B56A 3FEZA 4DXLA 3FGUA 2XGPA 1XQIA 2H54B 1JLCA 4OHZA 3FFKB 2GQ2A 1PJ7A 1KFSA 4O4RA 5JVGL 4ZP8A 4FS1A 3DOKB 5JMNA 3LP2A 1L3SA 1Q4RA 2CGJA 4N47A 2VCPA 4ZHRA 2ILYA 1XERA 1S49A 1WSHA 4WIIA 1BQXA 2VBWA 1HNWJ 4K0KK 3V1RA 3OR2A 1OVQA 5AE1A 2VFUA 3HSZA 2QX0A 1BY9A 4PXEA 1OSDA 4NZ7A 3VETA 4MAKA 1GLLO 3CCVS 1S4EA 4JI4F 2VQEF 3HF5A 1HKBA 3OXFA 4AQYF 3FSYA 1RDDA 4BVOA 3ZCMA 1H2UX 5ADZA 3O4NA 3MZIA 3Q89A 1VCTA 3OYAA 3BUZB 1TL3A 2DHGA 2QYGA 4CTAA 3K9JA 4QR0A 4DUTA 4Q2LA 1B7YB 1X4GA 2QL9B 4A8SA 3BSCA 1HPZA 4LR9A 4Y3CA 3V4MA 1PG5B 1NEEA 1BU6O 1J5EF 4IG3A 3VQ7A 4P7VA 3C3LA 1M5VC 1XJWB 2LEPA 3ZXWA 1SVDA 4A8XA 1N6QA 2WTUA 3HJVA 1LEOA 5HMZA 4HKQA 2RAQA 4CJQA 3WT0A 1DAXA 3G87A 4DV5F 4YB6A 3RRGA 3O5TB 2HQFA 3OYBA 2GZOA 2OKQA 3E51A 2RQ4A 3U1MA 4FWSA 2G9OA 2QXLA 1S6QB 4DWIA 1Y0HA 4CLPA 2B8QA 4E2FB 1U1PA 3AXMA 3M2RA 4LQ3A 2PMWA 4WFYA 5KFCA 2KHCA 4IRKA 3RB3A 5CZXA 1KAZA 2JVOA 2J0QD 3DRRB 1IQZA 1K8KB 2NRXA 4LF6J 4BRAA 1LW2A 4CLWA 5KFMA 5B0FA 3ZYYX 4TYAA 5KG3A 1GLAG 1FHTA 5K14B 1Y4ZB 4DV2F 2VONA 4QIEA 5HRPA 1BLUA 1REGX 2DIUA 1ZM4A 4GVBA 2LQ9A 4AUKA 3FZLA 4CRJA 3JSMB 1X4AA 4LF4K 1Z2ZA 5AQPA 1V5IB 2ZBCA 3HMJG 3VAIA 1TKXB 3DI6A 1ROFA 4B3OA 4QR1A 5F8JA 2HB5A 2CGLA 3MCMA 2NREA 1IUJA 5HO4A 3W9IA 2KZMA 2Z58B 2K8GA 3ETMA 4C9DA 2IOCA 2MYFA 3H45C 4DZ6A 1CJVA 3D9BA 1Q7YO 2E1ZA 3RJMB 2K1RA 3AB4B 1J54A 3MECB 4BLGA 4B3SJ 4W4MA 4DV6J 1YWXA 4ZTJA 3DGVA 4FJ8A 4IQXA 4EEYA 2HQIA 4PPZA 3IG1A 1IKXA 4WZQA 4H4MA 2HLTA 3MMBA 2RMLA 2V4JB 3MI7X 2YWHA 3QFWA 1YTUA 4RWXA 3M6XA 3QWPA 1GLFO 2F96A 4WQ5C 4GC6A 2P9CA 4IRDA 3IRXA 4B1ZA 3I8DA 1SJ1A 3PEHA 3R97A 4FF2A 5EUHA 3H20A 3U1NA 1GMWD 4KI6A 4CE9A 2ZKTA 3EGZA 4DR2F 1GXLA 2XO6A 1TYQB 3C16B 1ASUA 3SQGA 3CCSS 2XNQA 4TLRA 1WG1A 3UDCA 3P4IA 1I5OB 1CS4B 1HR0J 4RL1A 3DM2B 4ZK7M 2C2MB 1NLVA 4H4KC 3P83D 3H08A 2Q6BA 2UP1A 3ISNC 1WORA 2AF6A 2C2OB 4W98A 1K1QA 3SLCA 4H4KA 4WTOB 5B0GA 4JK7A 1HW9A 2CJBA 4FNHA 1VQPS 1YJWS 4Y1DA 4DL5A 2B6AB 3AD8C 4ECQA 3CJKA 4Y6IA 4FWLA 4OLPA 1RHUB 3DCAA 3ILLA 1OKJA 1XI1A 4R0JA 1OY9A 1QZ6A 3NKYA 4JRQA 1NH8A 3G10A 1NZAA 2NUUG 2IIRA 3SSRA 2P9EA 5HBMA 5F8HA 1KQFB 3DRXA 4RUAA 3HSGA 4NA1A 3HHLC 2JSXA 4CI0B 2YQ3A 4Z4GA 4LF5F 3D67A 3CJ9A 2BRLA 3G8TA 3O5BA 3MX5A 4OZ1A 3WXKA 4ECZA 1XWLA 5AQKA 4Y1CA 3CCRN 4FS2A 3EYZA 3OL9A 1MWZA 4KRWA 2FPHX 4KO0B 5K14A 2V8DA 2M52A 4J9SA 1KHVA 3TVYA 3KWMA 4BR2A 5AFUH 5LJ3Y 4OQJA 1FE0A 1FX2A 3DLLL 1C0UA 1NGDA 2YX1A 4LIWA 2BOAA 4CD1A 1F5AA 1OQ6A 3CC4N 3ZT2A 5M2RA 1UA0A 2QA4G 1KVKA 5D78A 4NA2A 3TX8A 1AT1B 1IBLJ 3N5FA 2AIRB 2F8SA 2DGSA 4O4GB 3M1VB 3CW2C 4BY9C 1CULA 4DV2K 3EUNA 5KPRA 2AJ0A 1TU0B 4K4VA 4I0WA 4Y00A 2VL1A 2C3UA 3SUQA 2WONB 3ZTQA 5DM7L 3HDSA 3V6DA 4DFMA 4CHPA 4F3TA 1U09A 4FJLA 1Y5NB 3DXKA 4I4BA 2XI3A 2OA8A 5BR9A 1IR2A 3I87A 5E3AA 2W25A 3NF6A 3M6WA 2IS3A 3RG6A 1J5EJ 2E7WA 2ZM6F 1WSEA 1YVFA 3GLJA 3MUMP 3QLHA 1HNIB 2VB6A 2IRUA 1CJKA 4URQU 1VQLS 2CQGA 4K50A 2NQPA 3PZPA 1RWKB 3P8BB 1SH0A 1UVNA 1S0MA 2A42A 3LALA 4O5FA 2B4PA 4BC3A 1IBLK 2FVCA 1YJUA 3CCVN 5IQ6A 4WCEL 4IZ9A 1RQ0A 4W5QA 4QAGA 4YY3F 2XMUA 2ZNZA 5KFRA 1GTHA 2X6NA 3EVOA 2QSFA 4XO0A 3SMPA 4ZJOA 1A5XA 3CJ8A 3GTYX 1FRLA 2DY4A 3HKWA 3Q7CA 1DZ5A 1P6TA 2G1DA 2ASJA 1XNRF 3ENQA 2QA2A 4WZMA 2UUCF 3I96A 2OUGA 2G1HA 1IVZA 1RGVA 2JL9A 4LF9F 4RWTA 4E1NA 3TJ9A 2CWKA 4OJRA 3QB0A 5FIIA 3W8PA 2UXDJ 1VC5A 2VFVA 2YQ0A 2AU0A 2FTRA 4WFNQ 5KG7A 5FDLA 2HHUA 3TUPA 2FYXA 2ZUAA 3BGFA 4MLEA 4PL7A 2AEJA 4HEA9 4CHYA 3WIUA 1NJYA 5F2RA 2Z2ZA 3GR1A 1FJGK 4TY8A 4YB1P 4DV1K 3I5CA 4CGJA 5DZ7A 4O0NA 3CPEA 3AOBA 3LM9A 3M8ZA 5A8RB 4FCYA 3H40A 3JTOA 4EP4A 2KH9A 3QEWA 1V5VA 2CIMA 4RW6A 5IWAJ 2OPPB 4OI6A 2JDJA 3MEEB 2ZOMA 2MZJA 2V2VA 2X1FA 1RT6B 2PA8D 4F67A 4CO5A 1MDUB 4J9OA 3R2CJ 3CETA 2OAUA 3AQOA 5KGWA 3RSEB 3TZZA 1TL7B 2CQBA 3P39A 2B4VA 2I2YA 2HVHA 4DV4J 4B3MK 4PQUB 4P52A 4GY2B 3DYAA 1CQNA 1ATRA 2C42A 2D3UA 4NMLA 5IC4B 5EWFA 3W9JA 1QDUB 4DEZA 4CW7B 4KY3A 4FJIA 4BCAA 3H6EA 2QTWA 4K4SA 3HFKA 2IJNA 3R5DA 2GV9A 4FWOA 2F9JA 3S3OA 1FFWB 3SXLA 5BR8J 3GONA 3ULHA 1NH7A 5FJ4A 4MKVA 2GIFA 2NR0A 1WAJA 1PYOB 4RBUA 2DHSA 4JHDA 3BKUA 3MCNA 2MKCA 3VHQA 4WK3A 1Y10A 3IS9A 1TZ0A 3KLIB 5CABA 4WBFA 4JI7K 2HRYA 4I6MB 1BL3A 2MSSA 2L41A 4TLQA 1LXNA 1SC4B 3SSSA 4BDYA 3QEXA 2J9EA 2LCWA 3A5LC 1RAJA 1N32F 2WONA 4FPAA 2D41A 1CS4A 2NSCA 4BGBA 3LQVA 5B0BA 3E2EA 5KFNA 3S7RA 3HHLA 4AL7A 4F4AA 2BW2A 4WQ4C 1RI7A 1LKZA 4EWTA 3F56A 1BI4A 1CBKA 5AXNA 5T7LA 2KO1A 4DG1A 1JJHA 3O4WA 1YUWA 1WEYA 3A12A 1UVLA 4U67Q 3HZ6A 2GUIA 4OKEA 2PEHA 1S1UA 4HH1A 2IBOA 3KG4A 1I51B 1X9JA 1RT1A 3I8BA 2CRLA 3D7EO 4QWAA 4PG8A 1YZ7A 4HACB 3T7ZA 3D0GE 3IR7B 1OH5A 4MYUA 4Y2CA 3KLIA 3ZX3A 3A3NB 3V1QA 3D66A 4FP9A 2WTFA 2BVZA 5J2NB 3E66A 3LDOA 3T5JA 4X66J 3J7A1 4F3QA 5F8IA 1NKEA 4KHYA 2RSQA 3EVWA 4OZ0A 3C2PA 1N36J 5GAEP 3LAKA 4CJVA 1NG9A 4KPCA 4H5NA 3BBCA 5F8LA 4H0YB 2D74B 4PXDA 3THXA 3M9OB 1PC5A 1JLGB 1OMSA 3PUFA 1VQPN 5EN1A 4DLEA 5FDLB 1IM6A 1H98A 1O6XA 2E2NA 4H0OA 1I6JA 4FBTA 1HYVA 3M9NB 4C3MA 1WF1A 4OKJA 3CG7A 2DFHA 4H5VA 3PYFA 2KZZA 2XO7A 3E1YA 4WP3A 4FJJA 4MFBB 2BBEA 2J7UA 3BYRA 2BKOA 2Z57B 4CJLA 1M1HA 5MLCQ 2P9UB 4DV3K 4OI4A 1YKWA 3G4SS 4OGEA 3GIRA 1S97A 2VQFK 4DV3F 1X4CA 4OZLA 1HFEL 1NBEB 3ZZRA 3FVYA 1BC6A 3AO1A 3A3OB 4DR1J 5IXUA 3VQEA 1RT7A 2CG4A 4USMA 3R5CA 3CCJN 3MPWA 3CO9A 2R8KA 1OPIA 5ITHA 2FGCA 5KFSA 1PYSB 1N5SA 3LGMA 4QWCA 2GIQA 4DR3K 1Q53A 2WBNA 1W7AA 1E4GT 5J2PA 4LF6F 1RBRA 1N4LA 2QLBB 1FRJA 3M30B 4IEEA 4X4RA 1PYTA 1LAVA 4HWIA 4X4OA 3TA0A 3DDKA 2B9XA 2IVPA 5IM0A 4OO1J 3AODA 1H38A 2D3O1 1T0TV 2P9UA 3FKBA 3ZSWA 1VSJA 4JI7J 1FFSB 3OJSA 2AA4A 2RH3A 3KK1A 2V8HA 2EC0A 1NGJA 1RT2A 2HIYA 1RDWX 3QYYA 3B78A 3E9PA 1J2VA 2RDIA 3U3GA 2X1GA 3K5NA 3HX9A 1HYSB 4EFHA 3SBTA 3J81Y 3UN3A 4BR7A 2E4LA 4FF3A 4QS9A 1LV5A 4WKYA 3VGVA 3CD6S 4BE0A 3C66A 4FO0A 3HLUA 4X4QA 1XR7A 1W97L 4HTLA 2PMZD 2Z8QA 3G4SN 3PHEA 1VQMS 2HRTA 5KFOA 3PIOQ 4C23A 4CBXA 3AY0A 2QL5B 2UV8A 2PI4A 5I4MA 3US5A 1M5KC 2ILZA 1I94F 2XMAA 1UVIA 2V34A 1NM2A 2QA4S 1T94A 4M5IA 2W7AA 1RWWB 1RTDA 5E3CA 4DUYF 3L4BC 4J9MA 1B7FA 2ZE2A 2ZHAA 4LVOP 5KFDA 1RT6A 3KK7A 2P9LA 4Y65A 3TZYA 4FL9A 3RSEA 4XPEA 3MM7A 4DR5K 1GMWA 3DLGB 1R6VA 2QT7A 1RAFB 2AX0A 5BR8K 1RT4B 1IN0A 1TGOA 2JNJA 3MDFA 2WBMA 4JKBA 1WSGA 3R1LA 1XC3A 4K4XA 4I6AA 3G25A 1NMEB 3OTCA 1W0HA 1WAFA 3G71N 2OGUA 1Z6RA 4A8YA 5HL7Q 4CECA 3D6RA 5HQ8A 1APSA 2VJUA 4CO4A 2D7SA 1NDLA 4KR0B 1ZBHA 3EMTA 4J9LA 2K2PA 2R7RA 4LF2A 5D4OA 2I7NA 2YX7A 4DFJA 3NOGA 2BV3A 4DR6J 3GG4A 4LUBA 4CJ3A 5FPDA 1C0TA 1HKGA 1HBOB 3MPDA 3B54A 2ZH1A 4XH4A 1KLMB 2XMTA 5LMNK 3W3SA 5G4DA 4KHPJ 1S3XA 2HOEA 5KG2A 5C2FA 1L3KA 3OS0A 1RU1A 4P73A 4EO8A 3O4QA 4AE5A 4CBWA 1VQ9S 2E6LA 4QOZB 3ULEB 2X1BA 5IZHA 2KM8C 5HAOA 3DJCA 2V4QA 4IUFA 1DTQB 3M8QB 4IBNA 3Q22A 3EXCX 3THVA 3OVBA 3RBEA 5LL6d 3W8GA 4W90B 1U2VA 3PR4A 4F4WA 2AMCB 4H5WA 2RKIA 1V3RA 4JKAA 3T41A 2FHMA 4C8YA 2JJ4D 5ETKA 1XNQF 1S1UB 1AZSA 5T41A 4L74A 4CO0A 4AL6A 1XMOF 1NK8A 2P9NA 1DKGD 3PJXA 5LJWA 3M6VA 2XRIA 1S1WB 4KE5A 1J53A 1Y5LB 4JI6K 1KOOA 3S1TA 5C7PA 2BANB 3FCWA 4CHZA 3W62A 3C6TA 2HSEB 4UF4A 4ZVFA 3O6QA 2GJFA 1S5ZA 2ZBRA 4OHWA 2HNDA 1H72C 2JZ5A 2RE1A 2ZUGA 3CTRA 1R8HA 3T1YK 1NK9A 2NRRA 1HYSA 1MMDA 4B02A 4ZHRB 3QESA 4AHSA 2RHKA 1WC5A 1VS3A 3R1HA 3SI8A 1M0SA 5D4PA 3IMQJ 3CCTA 2DEIA 2V9KA 3RR8A 4FYYB 2CQDA 3W5XA 4AILC 4M63A 3PYDA 2AKWB 1IH7A 2A2CA 1KQKA 2CQ0A 4L73A 3G82A 3CCLS 5BN8A 1VQ6N 1VSMA 2B9EA 4FF1A 3NY0A 2H5EA 3G0ZA 3W2VB 3PIPL 4N8OA 3TWHA 3QINA 4WQ4A 3CB4A 1FRIA 1UPPA 1IR0A 2IVYA 4CLTA 2HEKA 3NGZA 4I64A 2E5LK 1EKRA 3ZX2A 2XCPA 3SQ4A 5CCLA 4FW1A 3NWGA 3QNWB 2VG7A 4AQYJ 1TELA 1TVRA 5AQVA 1TUVA 5A76A 4X4PA 4Q43A 1F5BA 4C11B 2ERRA 3QZ7A 2A5XA 2CPIA 2UXBK 2E1AA 1FT8A 3S01A 2HQDA 3MHYA 1SL1A 3AVNA 2VFRA 1N8RT 3LL3A 2ZD1A 4U6PA 1D9AA 4OYBA 4RU2A 3AVBA 1RILA 2FGOA 2E20A 3OBIA 3UKUB 2CPZA 1KP6A 1CXUA 4PWWA 2CPXA 4TKTA 4JKGA 1ZBUA 2E9TA 4DPXA 1BIZA 3HFVA 2BJ7A 4E3SA 4JKEA 3DOMA 5D4LA 1LW2B 4FJHA 3IM8A 1WBDA 2PO4A 3FFIB 2AP6A 1VBZA 3J80O 2J9CA 4M3ZA 3L2WA 2P9IA 5TKYA 1JLAB 4CEAA 1ASWA 5D3GA 1VRQC 5LT5A 2KLAA 1ZM3A 2CFXA 2HHSA 3E01B 4QOTA 2RRNA 4X62K 4TU9A 4E1JA 4CD3A 2NZ4A 2OSRA 5C42B 1FD2A 1YLXA 3FMBA 3KKRA 4R79A 2O8FB 3CJ1A 3QATA 1TKXA 4MK9A 4MYTA 2PYLA 1DTTB 2HMIB 1QY7A 2GELA 1K44A 2V7ZA 3NAEA 4RX6A 4OV1A 4ID5B 2A1SA 3AHPA 5KT7A 1MU2B 2RKIB 2F9DA 2HFSA 2GGPB 1NDKA 1P1TA 3GE9A 4DPOA 3L6QA 5JVHQ 5E3RA 3H4DA 1J5OA 3SCJE 4FLWA 4ECVA 3PO4A 4OX6A 4JKGB 4CK3A 4DU4A 4QYRA 1DQ9A 3IR5B 4JKFA 1RZMA 5KT6A 3U4LA 5IQQA 1N5QA 5LXYA 1WB9A 2QMWA 5IS2A 1NGHA 3U9ZA 2MEWA 2WCXA 2ZJQQ 4YFUA 1TFYA 3TR8A 2EG2A 1RWUA 3OS2A 4B3RK 3I0RB 4RPFA 3IM9A 1F2HA 2OSQA 4V19X 3QT5A 1B0TA 1DFDA 4M41A 2A0FB 2V94A 4GW6A 3RZAA 4EO6A 4PKIA 2Z1GA 1E4FT 1XNQJ 2D0AA 2V51B 3HZEA 4PWDA 4K2JA 3R3LA 1HNXF 2Q31A 4ISEA 4B9TA 3V4IB 3ZNUA 1S9GB 3OXGA 4ENOA 1HNZF 4KH5A 4OGCA 1UP1A 5CYQB 4Q8FA 2UVUA 4K8RA 1FERA 1YT3A 2YV0X 1WSVA 5GAGP 4Z7YA 1AA1B 5CYMA 3BZKA 3QBXA 4ZP6A 2P51A 3LPTA 2NRHA 4J9RA 3FZHA 4X4SA 3IP0A 4F04B 2Y8YA 3QBWA 2HZVA 3X3UA 4BC4A 4JI8K 5E33A 1WSIA 2B3TB 5DQIA 4ED4A 3PM9A 3C94A 2YKMA 4KSEB 4DV3J 3HOTA 2Q43A 4OZJA 5DLGA 1S6PB 4E7HA 4M5JA 4Q0BA 4BDZA 5BYQA 3JYTB 3WC2A 3PSFA 2ZJRL 4JI0J 1VQKS 4H8KA 2N7CA 1JL2A 2G0IA 4C11A 4RJVA 2PFUA 1CEZA 4LF6K 5AQFA 2RRAA 2GHVC 5KFUA 4CH7A 1DURA 3FCHA 2WUSA 1JXBA 3PW5A 4ZPDA 3LANA 2CPJA 4GO7X 1LFWA 2Z2MA 1VQ7N 1BO5O 2R8IA 4Z37A 4FK0A 2YNFB 3NS5A 1H1VA 3KLEB 1UPMB 2C3YA 2NRTA 2DJWA 4PQAA 2Q97A 1NSAA 1Y3JA 4ZIVA 5L38A 3SYZA 4Y2AA 4FVMA 1GOBA 4K0KJ 1IKXB 2W8LA 4ILMA 3CCEN 2HBLA 2XZWA 4O3NA 1JJ2R 2I38A 4F36A 3HRGA 1XR5A 1QAJA 2KT2A 4WE1A 2XNRA 3SDEA 4O3SA 1RT4A 1VK0A 3RMAA 4ICLA 2KYZA 2YWWA 4XEIA 1UVJA 1KVJA 2QSWA 3CD7A 3JXOA 1OYDA 1GQEA 3AB2B 3O44A 1V3ZA 3D1OA 2MQNA 1HNWF 5CXTA 2LLZA 3PRDA 1UMJA 4CM0A 4BACA 3S6EA 1IBMF 4JUZA 4QWDA 4A8OA 3M2RB 2LQJA 2IYIA 1NJIT 4NMXA 2CJ9A 5LSRA 1T44A 5H9EK 4OHXA 4YOTA 2IMOA 1HW8A 4UY8T 3LPYA 3NNCA 2V63A 1ZC6A 4B9LA 4FZYA 3V6JA 4WFAQ 2HKEA 2U2FA 2KKZA 1HBOA 1NSKL 1BGXT 4OYPA 2DY1A 2ZBIA 4L75A 3AJ2A 4O8UA 1EQYA 5ETSA 4O55A 3KOAA 2OPQA 4OPKA 4YEAA 4ECWA 3VGKA 3N5BA 2PSZA 1RAOA 3J7YP 3SI6A 1RTJA 3CJAA 3BZCA 4I2PB 2DXEA 3S8SA 5CCMA 2Z1IA 3DI6B 3QIPB 2F4VK 1NU4A 1WSRA 4BS2A 3HVTA 1G7CB 1FNMA 3G6ES 2JH3A 1VGYA 3D6FB 2DXFA 2CADA 2HWHA 4F4ZA 1X0FA 2YI1A 2EFGA 4PG6A 2Q0RA 1DGKN 2WVFA 1S48A 4IYQA 1IO2A 4H5RA 4FZZA 1X9SA 2VG6B 2BRKA 4NZ6A 4WXWA 5F41A 1IKVA 3PFEA 2OMLA 1Q81O 4DJBA 2QYCA 4CEFA 1TV6A 1XIQA 4ED7A 2QEXN 4U95A 2YNGB 4C0HA 1PJ5A 4CEZA 2BM1A 2DBBA 3M2VB 2AP1A 5ETTA 1RT5B 5IWAF 3GPAA 4KC5A 4ZVSB 2HBZB 2G2ZA 2ZHOA 2E2PA 3N79A 2HNZA 2G13A 4EHTA 3TTCA 3WXIA 4CJEA 1VQ9N 4XPCA 3JS9A 2WVCA 3CXCR 1TYQA 4FYWB 5HLFA 2VIHA 5AE3A 3FZKA 4HYKA 4AH9A 2XLKA 2ASOA 2I0XA 4HH0A 4FLUA 5HQMA 2I1RA 2KU7A 2MKSA 2E2QA 2R7TA 4DV7J 4IO8A 2GC8A 2HWTA 2YKPA 5GADI 3L4QA 3A5OC 2X51A 1EKEA 3PX0A 1U6ZA 3FCVA 2N7YA 2IY5B 3AVMA 4O3PA 3B6BA 4PCQA 5EHHA 4A2AA 1DARA 5BYSA 4FNIA 5AQIA 1EETA 4QCLA 1XHXA 3NXZA 3MFIA 5HP1A 4CP5A 3OYHA 4OX9K 4BQLA 4MIBA 4KBIA 1ILYA 3BH6B 2KYXA 2FBTA 2MXYA 4DTSA 1PIEA 2OFHX 1VIXA 4FJKA 1KTVA 5LXRA 3I0SB 4J2EA 1IWAA 4CLZA 1SB6A 2YH0A 1M1KT 4W5NA 1KBRA 4P74A 4RNFA 2F40A 3O8WA 3KFWX 4X64J 4BREA 4NYNA 2A10A 4IOAQ 2H3GX 3CJTA 3QIOA 2PI5A 1IG9A 1R0CB 3CJQA 1IQTA 1U1OA 2N4DA 2CQHA 4OPAA 3H8YA 1NPKA 5L1KA 1HJRA 4M7YA 1HJOA 3CDAA 4QW8A 3UDLA 3VERA 3NGDA 4ELTA 1KQSR 3VQ6A 2FJAB 2G8VA 2XHBA 2XSJA 3MCPA 2DO4A 1FRXA