2WOMA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2womA05
5J1EB 3MXJA 2V4QA 3PVXA 2UVVA 3NE6A 4JV2A 3V9UA 3FDSA 3HJFA 3K5MA 1LWEA 4W5QA 1A5WA 1XI1A 1SL2A 4F4ZA 1TK5A 4MKAA 3IRXA 2P51A 4RNOA 4DF8A 3LP1B 5KG5A 1RDCA 4I2QB 3SUPA 4DLGA 3SUNA 3QNNA 5L1LA 1XR5A 3GIKA 2ASDA 3MEDB 4RG8A 3PX0A 3O4NA 3QIOA 5KFWA 5KFQA 1REVA 3N6MA 1S6QA 3OHAA 4EEYA 5J2NB 3U6FA 3DDKA 5F8HA 2FVSA 4O3QA 4M3ZA 1KLMA 4ZHRB 3KLFB 4O3OA 3F73A 3VQ6A 4ED6A 2IGIA 2YHAA 3M8QB 2B6AA 3AV9A 3QINA 2HWIA 4Y2AA 1XC9A 4E3SA 4J2BA 3MR2A 2R8IA 4ECQA 4B9UA 1Q9YA 1JX4A 3RAQA 2IOCA 1TKXA 1J5OA 3KLIB 2QE5A 3KKRA 3SUQA 2IDOA 4TY9A 3K58A 3KK3B 3CFOA 3NF8A 3MAQA 2R2TA 5E41A 2ZE2A 3CYMA 4KREA 3AVCA 2G8HA 4AH9A 4CHNA 5KI6A 1TVRA 1C0UB 1LWFA 3V6DB 2YKMA 3H5SA 1RT4B 3N6NA 5HBMB 2GIRA 1S97A 2HNDA 4F4WA 1LW0B 3HVWA 2BE2A 3CJ2A 1BCOA 3AVBA 1T7PA 2WTFA 1RBTA 2VG5A 4E7HA 3TAPA 4E1NA 3GIIA 3T3FA 4MFBA 4AHSA 1VRUB 2XHBA 3QEIA 4CEBA 4FLWA 3KHLA 1N56A 2HHXA 1IKVA 2DPJA 4FK0A 3DLGB 4J2DA 2W42A 3MEEB 5C25A 1D9FA 5L1KA 4IRKA 3VQ9A 4E7LA 2UVRA 3M8PB 3AA4A 3V1RA 1XR7A 4IFYA 3L3VA 4OJRA 4DLEA 3HK2A 2HWHA 3V6JA 5KFYA 1TAUA 4JV1A 1RDBA 4CF1A 3AA2A 4B9NA 1RILA 1TP7A 1J53A 3TI0A 3D5MA 3C6UA 2PY5A 1FK9A 4CHPA 4H4MA 3HKWA 3O3GA 1RTIB 1SH0A 4KE5A 5J2PA 4RUAA 1S1UA 4IG0B 4GW6A 4KKOA 4WE1A 5C42A 3DYAB 1RTJB 1B9DA 3N6LA 3T5LA 4FZZA 3RMDA 2KZZA 2AWZA 4DQPA 2JC1A 3HVTA 4W5TA 3GILA 1ZBIA 1X9SA 4KHNA 3OYJA 2I5JB 4KB7A 3PO5A 3QZ7A 3D0PA 3ZT4A 4IQXA 4TSXA 3V4IA 4FJIA 4CF2A 2V4RA 3WNHA 4CEEA 4CEAA 1X9MA 1IKWA 1RT5A 4YFUA 3MXIA 4TXSA 4Y2CA 2AX0A 1JLGA 3QIPB 4PWDB 1RBRA 4NRTA 3ZT1A 3CFPA 4EP4A 2GBZA 3SQ4A 5KT5A 4M94A 1T03B 2AGOA 3VA3A 3HSTB 1WSJA 2AJQA 3HPOA 4DSIA 5KRSA 5T14A 3LP1A 1RBUA 1BI4B 4I2QA 4MK7A 1JLCB 4CGIA 1RA7A 1EXQA 4M45A 3E01B 4DSFA 4HKQA 3MEDA 1GX5A 2KTQA 5KFOA 3AVKA 4FJHA 4QCLA 4KHUA 4BE2A 4IBNA 5J2NA 3OL8A 3KHRA 4URGA 4ZHRA 3KLFA 4IH6A 4CGJA 1SV5B 1S0OA 3OL7A 3M8QA 3KLHB 2IAJB 4CGFA 4FJ7A 4KTWA 3DOLA 1JLAB 1L3VA 4K4VA 3CVKA 3HXMA 5KGXA 2O4IA 5F8NA 3GIMA 4C8KA 3KLIA 2FC0A 4CJSA 3NCIA 3SI8A 2C2DA 3OYAA 3CJ4A 5EWEA 3M9NB 3KK3A 4NLDA 4DQQA 5CYQB 4NZ0A 2XI3A 5L1JA 5KFZA 4CHYA 5CYMB 1NK5A 2D3UA 1A5XA 2BGGA 1C0UA 3V6DA 1RT4A 4CEOA 5HBMA 3EZUA 3PHEA 2ASLA 3Q8QB 4NLTA 3DLRA 1LW0A 1WAFA 2AGQA 4NLPA 3V81B 3CJ3A 2OPRA 5HRNA 2HHQA 2F8EX 1YVFA 4KPYA 4NLUA 3T5HA 4J2EA 3QEPA 4LH5A 3MECB 3C95A 3GV8B 1S4FA 3DLGA 3MEEA 1QS4A 4QW9A 4YR3A 3CM6A 4DFJA 1W25A 4O3PA 1KRPA 1RT3B 3NAHA 3QGGA 3M8PA 3BGRB 5J2MB 3CO9A 3SNNA 3KLGB 1HYSB 3T5JA 3MR6A 4LY7A 4M3YA 3KLVA 2YNGB 1S1XB 1KTQA 3IS9B 3QEWA 4MK9A 4J9SA 1RT7B 1SKWA 1RTIA 2J6SA 1VSMA 5HRPA 4ECSA 2RDJA 3AVFA 4IG0A 4KI4A 3DYAA 1K1QA 3NGZA 4FLTA 2ETJA 4C8MA 4KB1A 1Z26A 1ZBFA 2I5JA 4F3TA 2QXFA 2Z1JA 4NLVA 3CDUA 2VWJA 3G6XA 4O0IA 3NH2A 3CWJA 3ZSOA 3NF7A 3AVAA 1ASWA 3EYZA 4ZP8A 4F4XA 2A1RA 2GC8A 4DSKA 4K4UA 5CZ2A 5KFDA 4JV0A 3G86A 2W9BB 3QIPA 4PWDA 3I0SB 4HVJA 1YVUA 1Z25A 4OKEA 3SV3A 3L2UA 2RKIB 1T03A 4GMJB 4W5NA 3K5OA 2HW3A 1JLFB 1JLEB 4FJGA 3OLBA 3CIZA 4B8CA 1BI4A 1JLCA 1MMLA 3E01A 2W9AA 1KFDA 4J9RA 5EWFA 4CJPA 1SH3A 3VQSA 2OH2A 1Q9XA 4FJ9A 2QK9A 4IH7A 1JKHB 1HPZA 2FLLA 1S48A 3F9KA 3IGNA 4CJKA 4NLGA 4QOZB 1SV5A 3OJUA 3KLEB 5HRRA 5KG3A 3EPIA 1SKSA 4XPEA 3KLHA 4DF4A 4ZVFA 2G8UA 1GOAA 4CF8A 4DTRA 3TARA 4HCBA 4FJ8A 4K4TA 3HO1A 1K1SA 4FK4A 3E51A 4QWDA 4OPJA 4KI6A 4IKAA 3RB4A 3VA0A 3QESA 3BSOA 5F8LA 3VQ5A 5CYQA 5KG0A 5C5JA 3T1AA 5CYMA 3H5XA 3HL8A 1SL0A 4ELUA 4CESA 1C0TB 4K4YA 1HYVA 4F2RA 4GVMA 4DU3A 2OPPB 5KFBA 2Z1GA 1U47A 4CGDA 2EC0A 3RB0A 2VG6B 3PX4A 3LDSA 2KZMA 4H4OB 1RTDA 4CJFA 2HHTA 3V81A 3AA3A 4CJ3A 4KAIA 3K5LA 4Z0UA 3MF5A 3RRHA 4E0DA 5SWMA 1DTQB 4E7KA 4RW9A 4EYHB 4DU1A 2X6NA 1RDRA 1L3TA 3MECA 2D0CA 1TV6B 4QWCA 4AHUA 4FJNA 5KT3A 5C24B 3LAKA 1RT3A 4B3OB 1KVCA 3BGRA 4ZVGA 4O4RA 2JEIA 5J2MA 4CGHA 4ECWA 3QO9B 5KRTA 3U3YA 3KLGA 1HYSA 3PO4A 4ECRA 3KD5E 4CHZA 4J9LA 3RMAA 4ECZA 3RB6A 4DQSA 2YNGA 1S1XA 4NLYA 3IS9A 2G8FA 4ZP9A 3OS0A 1TKTB 4QWEA 1NJWA 1RT7A 5K14B 1UA0A 3UDLA 4Z4HA 4Y34A 2GV9A 1VSDA 1C2PA 4C8NA 1BISA 3S3NA 2UUTA 3MEGB 2YNFB 4F8RA 3V6HA 4NCBA 4PQUB 4IR1A 3ASMA 4CJ4A 4LSNB 2OA8A 2IC3B 4LD0A 4J2AA 1KFSA 5FRNA 1N5YB 4EBEA 3PUFA 2AX1A 4ZPCA 4MQ3A 2JC0A 2IM1A 4RW7B 4MH8A 4ID5B 4FJMA 4WFYA 4K4WA 4HUEA 4DL7A 2R2RA 5JUMA 2W9BA 1S1WB 2C2RA 5KT4A 1JLQB 1HQEB 3T19A 3BQ1A 2RKIA 4CJRA 3H98A 2IJNA 1S49A 3ICLA 3TAEA 5HP1B 1JLFA 4AHRA 3DRSB 3RMBA 2IJFA 1JLEA 2BANA 3AVHA 5KG6A 3H5UA 5EWGA 1JXBA 4E7IA 2C28A 1C1CA 3ZSWA 4DSEA 4Y3CA 4NLQA 4IOBA 3G0ZA 3DMJB 2E6LA 4FM0A 1SKRA 4KO0B 2RN2A 1JKHA 3QIDA 4DQIA 3SFGA 3VQDA 3H4BA 3VQ7A 5SZTA 4HYKA 3HP9A 3KLEA 3U3GA 3WNGA 1HARA 4ED3A 3RR7A 5KFLA 2FVPA 4KBIA 4EO8A 3MFHA 1CZ9A 1QSYA 1EETB 4BDPA 2W7PA 1JXEA 2FBYA 4RW8A 1TL3B 1ASVA 4KHSA 4KRFA 1GX6A 1JLBB 2G8WA 2D5RA 4DSJA 4KTZA 5KFMA 4M3TA 1RT1B 4FYDA 3M8SA 4FCYA 4E1MA 4M42A 4WYWA 3NF9A 2OPPA 3ZSRA 3ISND 4JRPA 4O3SA 1SH2A 1WAJA 2RDIA 2VG6A 3DOKB 3PW5A 2KW4A 4NLRA 3ZSXA 4X2BA 3AVIA 2WRMA 1VSEA 1DTQA 3P5JA 3T5KA 2XY8A 3M9MB 4ECVA 3ZT2A 2JEJA 1HYZA 4G1QB 2P5GA 1TV6A 3L3UA 2W8KA 3I5BA 2R2UA 1RDDA 3NBPB 3LP0B 2VG7A 1TK0A 4IRCA 4CJEA 2IM3A 4J9NA 3QO9A 2G8VA 1LW2B 2HAIA 1S1VA 4N41A 1EP4B 4CERA 2YHBA 4R0EA 4TYBA 2E9RX 2W9CB 3L8BA 1YTAA 5KFJA 3KK2B 2YNIB 1TKTA 4FJ5A 2FLPA 4RW4B 1VSIA 3OYCA 3BJYA 1S6PB 2YKNA 5K14A 1KHWA 2DPIA 3QYYA 2OZSA 4FS1A 1WNEA 4ED2A 4AHTA 3NMAA 2VWKA 4IFVB 3ZSQA 2EHGA 3MEGA 2YNFA 3JSMB 1DLOB 2HB5A 4PQUA 3VQ4A 1NKCA 3BSNA 1BHLA 3LANA 4LSNA 4Z4GA 4CFCA 2E9ZA 4FXDA 2IC3A 4ELVA 1N5YA 5J1EA 2B5JB 4RW6B 2BQRA 4RW7A 1RNHA 3S3OA 5KG4A 1BIUA 4ID5A 2J6TA 1T94A 4CJQA 4CEFA 3NH1A 3RMCA 3FQKA 4CK1A 4KSEB 2P5OA 4Z4CA 4KTQA 2D7SA 2BQUA 5KFKA 3OS2A 2XY5A 4Z4EA 4FJXA 3ZCMA 3OL9A 2R7YA 1JLQA 1HQEA 1UA1A 1ZBLA 1JL2A 5DG7A 4ED0A 3WNEA 2KFNA 4K50A 5HP1A 4WFXA 3BREA 3DRSA 4YR2A 5HRSA 1KLNA 4N5SA 4WZMA 5KFFA 3Q8PB 3DMJA 4JS5A 1VK0A 1JL1A 4N56A 4FZYA 3AO2A 4KO0A 3CQ8A 2ZQBA 1WNSA 3OYNA 4NLWA 4DTSA 3OSNA 1HJRA 2XY7A 2FBVA 1QAJA 3MR5A 1CXUA 1S0NA 3OYMA 3FFIB 4J9QA 2DY4A 5HLFB 3I8DA 3H4DA 1JXLA 3SJJA 3PW7A 4IH5A 2XRIA 5KG7A 3OSPA 3H08A 4LH4A 4CFDA 5JS1A 1EETA 4KB0A 4HTUA 4FW2A 1TL3A 1RBSA 1U04A 1NK0A 3SZ2A 1C0MA 3PV8A 1JLBA 1RTHB 1U45A 3CJ0A 4B9TA 2XO7A 3V9XA 3I5AA 2R8GA 5F8IA 1RT1A 2R8JA 1NHVA 3RWUA 3H40A 3O3FA 3I5CA 3AVLA 3VN5A 4R8UB 2Q3SA 1ZETA 3OYFA 3HVRA 1T3NA 3TQ1A 4ID1A 4DTPA 5DGBA 1VRUA 4TYAA 4CEQA 4OPKA 3KOAA 3L2WA 1TKZB 3LWLA 5DLGA 3ISNC 1WSHA 4Y1CA 5KFEA 3PW0A 2D3ZA 4DL3A 4G1QA 1SUQB 3HM9A 3OYLA 5KG1A 3NH0A 1KSPA 4PUOB 3NGYA 4F4KA 3NBPA 1U48A 3PY8A 1RCHA 3LP0A 4DTJA 3A2FA 4GC7A 3SI6A 4MKBA 3JYTB 1W0HA 3IG1B 3SUOA 3LP2B 2HHWA 2OYQA 1U09A 3SQ1A 4TLRA 4HHTA 1LW2A 4RUCA 3FRZA 1EP4A 4R5PB 2FVCA 2HNZB 2W9CA 2Y1JA 1RTJA 3KK2A 4M3UA 2YNIA 4CJVA 4MIBA 4RZRA 4OVLA 1KVAA 1J54A 4RW4A 5F8GA 3TWHA 1NJZA 3OS1A 1S6PA 1UWBB 1CXQA 2X78A 5KT6A 4EZ6A 4IFVA 3CM5A 1ZYQA 4M3WA 3MR3A 4BE1A 3KJVB 3JSMA 3SV4A 1DLOA 3RBEA 2JLEA 2FJVA 3IN5A 3B6OA 4O44B 4H54A 4CHOA 4K8XA 3ZSVA 4DL2A 4XO0A 2B5JA 4RW6A 1RYRA 5FDLB 5FROA 4LQ3A 4Q8EA 5EU7A 1NK9A 4IR9A 1D0EA 3AVNA 4KFBB 3QGIA 2J6UA 4CEDA 3KKSA 3KMQA 4WZQA 4RU9A 2ZKUA 2IBKA 4E89A 1GOBA 2F96A 2HVIA 1S9EB 3TAMB 4FLUA 5KFSA 4CCHA 5KFGA 2PYJA 3NKYA 2IAJA 4C8OA 4CJUA 1JLAA 5KFCA 2F8SA 1TAQA 4N47A 1BQNB 3KHGA 1B9FA 5L1IA 5KFTA 4DS4A 3ZSZA 4DTUA 1G15A 4WYLA 3MXMA 3FFIA 1TKXB 5HLFA 3V9SA 4NLOA 4PA1A 3NAIA 3QZ8A 4F2SA 1HMVB 1QAIA 2B43A 1U4BA 4M41A 1IG9A 1F21A 4YMEA 4OLBA 3ALYA 3GV7B 4FLYA 1VSHA 3AO3A 4ELTA 2ATLA 3LALA 4F50A 4LQ9A 1RTHA 2HMIB 2BRLA 4FBUA 1D5AA 3OJSA 3RR8A 2HNDB 2YV0X 3BR9A 4KAZA 1OS5A 4CHQA 4FBTA 4R8UA 5DQHA 4YP3A 3TAFA 1RBVA 4O4GB 4J9PA 3EZ5A 5DLFA 3PW4A 1VSLA 3SQ2A 2IS3A 4K4SA 4J9OA 5J2QB 3NDKA 1TKZA 4RNNA 2XWYA 4NCAA 5CY4A 1FKOB 4KV8B 2C22A 1BQMB 4ED8A 3RTVA 5EDWA 1SUQA 2PZSA 4PUOA 3V9ZA 3MTKA 2FJWA 2UVWA 3I0RB 3NL0A 1DTTB 4IFYB 5KT7A 2XCPA 4DQRA 3JYTA 3IG1A 4B9MA 3LP2A 2ALZA 3TAQA 4I7FB 1HQUB 3ZT0A 4HUFA 3HYFA 2HNZA 4Q43A 1NHUA 2BR0A 1FXXA 4Q5VA 1S1TB 3MFIA 1QQCA 2O5DA 5KFPA 3OYEA 1UWBA 2D0AA 4OKJA 1QHTA 1KCFA 3PX6A 2AU0A 4ZTJA 2OPQB 4O55A 1B92A 3LPUA 4NLSA 3G6VA 3C6TB 4FZXC 1I39A 3LP3A 1I6JA 4O44A 2D41A 2HHUA 3VQEA 1YTUA 1NJYA 1S9GB 2HNYB 2CKWA 1J9AA 1R0AB 3I0SA 2QKKA 5FDLA 4F3OA 1T05B 4N76A 3ITHB 4DFKA 4OLAA 1JLGB 5FRMA 2WB4A 1NJXA 2RPIA 4BE0A 4KFBA 4ECYA 3BDPA 2WHOA 1D1UA 3DLEB 2GUIA 4TN2A 2OPSB 2IMWP 2VA2A 3CFRA 4CJTA 4KHYA 4KHMA 3G6YA 3CG7A 1S9EA 3TAMA 1U49A 3LZJA 1NK7A 5JXSA 3G10A 2WOMB 3V9WA 1XHZA 4BACA 4XPCA 3AVMA 3DM2B 2JEFA 2QKBA 4CK2A 2CJQA 1IKXB 1KHVA 4IRDA 1BQNA 4J9KA 3UPFA 1BL3A 3TVKA 3DOLB 4MIAA 4NYNA 2HVHA 4DMNA 4ICLB 4K4ZA 3TR8A 4DFPA 2XGQA 4E7JA 1WSFA 1HMVA 1Z4UA 3DI6B 5KFVA 2BRKA 1C0TA 4B9LA 2O4GA 3AO4A 4FM2A 3QLHB 4AILC 4JLHA 4L8RB 4J9MA 1A5VA 2HMIA 3KHHA 4O0JA 4O5BA 4H4OA 1VSJA 3DLKB 4IKFA 4DTMA 4DTNA 1QUVA 5F9NA 4EP5A 1NKEA 4CK3A 2ATQA 1WSEA 4O4GA 3HVAA 2OPRB 3GIJA 4ZPBA 2NUBA 1CLQA 2W7OA 4GC6A 2R8HA 4FLZA 3QGHA 4W5OA 3IGVA 1NKBA 4CGGA 5J2QA 5C24A 4I9LA 2DFHA 3GYNA 4ED1A 2D0BA 3O4QA 4YNQA 1FKOA 1XHXA 4B3OA 1CSJA 4KV8A 1BQMA 3BQ0A 4WXOA 5KFNA 4ZP6A 3RB3A 1L3UA 4CECA 3QNOA 3I0RA 3CDEA 3OYIA 1DTTA 1RT2B 5KFRA 3S3MA 4FLXA 4TY8B 3GV5B 3THVA 2IA6A 2IM2A 4U7CA 4I7FA 1S5JA 3PW2A 1HQUA 1WLJA 4HUGA 4NYZA 3KK1B 3KIOA 2RF2B 3LZIA 4DWIA 3L2QA 4TQRA 5DGAA 3WNFA 5HROB 1S1TA 4QWAA 4BWMA 2ILYA 4HCCA 4ECUA 1TL1B 1JIHA 4BDZA 1UOCA 4FK2A 2FBTA 1TKDA 2OPQA 3NFAA 1ZTWA 3BSAA 4CF9A 3L2RA 3UIQA 3K59A 3C6TA 3AVGA 3NGIA 3BSCA 4TQSA 2ZD1B 4CIGA 3KMSA 1EKEA 1YT3A 4Z4IA 1S9FA 5D3GB 1HRHA 4NCGB 4Z4FA 1S9GA 4NLXA 2HNYA 1R0AA 3VQCA 1S1WA 4FJJA 3VQAA 1T05A 2AGPA 2UUWA 1NOZA 3ITHA 4I2PB 1QTMA 4K8ZA 2AQ4A 1QE1B 4CIFA 5JS2A 3KNAA 4QW8A 4K4XA 3OLAA 4FJLA 4I9QA 3DLEA 2JEGA 1LAWA 4CEZA 2OZMA 2B4JA 2OPSA 3SYZA 3V1OA 4E19A 3DRPB 1ITGA 1N6QB 4KHWA 3H59A 2VA3A 2DTUA 3OYGA 1WN7A 2X74A 3DLHA 3BQ2A 2WOMA 3QETA 1HPZB 4Q0BB 4RNMA 1LWCB 3SFUA 3DM2A 2W8LA 4BWJA 3V1QA 2R8KA 3IAYA 1IKXA 2YNHB 5KFUA 4JS4A 1GOCA 2UVUA 4F4YA 2PYLA 4ICLA 4RNFA 4EYIB 2KQ2A 5EUHA 2V0NA 3DI6A 4NYFA 5T7BA 4ZTFA 1XWLA 1VRTB 5KFAA 1C1BB 1IO2A 4O3NA 4NRUA 2Z1IA 1D9DA 3SPYA 3QLHA 1N4LA 1RT6B 4IG3B 1HNVB 2QV6A 4OGEA 4CIEA 4JRQA 4AHVA 2DFFA 3AO5A 1LAVA 2R2SA 4UQGA 3NHGA 2KFZA 3DOKA 3NGDA 3DLKA 4IDKB 1WSGA 2ASJA 3OYKA 4M95A 1VSFA 4U6PA 1QSLA 2P1JA 1RTDB 5I3UB 5F8JA 1IKYB 3UQSA 2WK4A 4YQWA 2HHSA 4EO6A 4ZPAA 5KFHA 4G3IA 3HPHA 3PR5B 2WONB 4RW9B 1IM4A 2F8TA 3ZSYA 1EX4A 3K5NA 4FM1A 1SL1A 4H8KA 4FW1A 5DK5A 4QWBA 1VSKA 2Y1IA 3AA5X 3Q8SB 2HHVA 1RT2A 1I3AA 1UAXA 4AHCA 4TY8A 3PJWA 2G8IA 4CJ5A 1MU2B 4ZPDA 4CF0A 1Q8IA 4RNHA 1NK6A 1LV5A 4DG1B 1XR6A 1NK4A 3M8RA 3KK1A 2ITGA 4DTXA 1WSIA 2RF2A 3LPTA 4LSLB 3PZPA 1QSSA 1HNIB 1FKPB 5HROA 3DRRB 5I42B 4CFBA 2DFEA 3TAGA 4ZP7A 1TL1A 4CFAA 5CZ1A 4DEZA 1O1WA 1CZBA 5L9XA 4EBDA 1X1PA 2FJXA 4ZVEA 1K6YA 3KD1E 1RAJA 3AO1A 4B9VA 2ZD1A 4B9SA 1T8EA 2GIQA 3OYHA 1L5UA 4B8AB 5KTQA 4ZMMA 5D3GA 4NCGA 3ULDA 1TGOA 3UR0A 2Z1HA 5KGWA 2FVQA 1LWEB 4W5RA 3EY1A 3VQPA 3D45A 4DS5A 2G8KA 4URQU 4YR0A 3V6KA 4DTOA 4CJLA 1ASUA 3KTQA 1S10A 3IRXB 4I2PA 3OYBA 1QE1A 4XIUA 2XCAA 2XC9A 4FVMA 1S0MA 3HPGA 3EPGA 4URSA 4KHQA 4EBCA 3AVJA 3OVNA 3RRGA 4M3XA 5KFIA 1TQLA 3GQCA 3C94A 2BANB 1REVB 4CE9A 1S6QB 4DL6A 3DRPA 3CDWA 1C1CB 1N6QA 3OY9A 2XGPA 3K57A 1KLMB 4Q44A 4Q8FA 4Q45A 2B6AB 3H5YA 1ZBUA 1L3SA 3FQLA 2FBXA 4Q0BA 1LWCA 1J5OB 3OL6A 1RYSA 2WCXA 5F9LA 2YNHA 1BIZA 3TANA 2XY6A 4FJKA 3Q8RB 4DFMA 2ZE2B 5KG2A 3ZT3A 1IH7A 3PJXA 3O3HA 4C8LA 4OL8A 1N48A 4RW8B 3M9OB 2I1RA 4ED7A 1TVRB 1LWFB 3RBDA 2YKMB 3QEXA 1VRTA 1C1BA 1ZTTA 3P83D 4CJWA 2E4LA 2BE2B 1RT6A 4IG3A 4OKKA 3VQ8A 2LSNA 5KT2A 1HNVA 4WFZA 2JGUA 3DLBA 4Y1DA 2VG5B 3S9HA 4FS2A 3NAEA 4WXWA 4IDKA 3K2PA 4EZ9A 4OGCA 4DSLA 4M3RA 4MFBB 3HP6A 2FVRA 3TABA 5I3UA 4ECTA 1IKYA 3FSIA 3LWMA 2EX3A 1IKVB 3OHBA 4FLVA 1NNDA 2WONA 3SQ0A 5C25B 4PY5A 3VQQA 3LAMA 5DMRA 3P1GA 2V9WA 1NOYA 1BGXT 4MK8A 3OYDA 2BDPA 5DQGA 1ZBHA 2E6MA 1RA6A 2IM0A 1C1AA 2VG7B 3NF6A 3D28A 1RDAA 3HHKA 1TK8A 3HT3A 4R5PA 3RAXA 2FLNA 3C6UB 1FK9B 3QEVA 4ZVHA 2X6SA 4H4MB 5KFXA 1S1VB 2C2EA 1MU2A 2BQ3A 1BCMA 5J2PB 1KVBA 1S1UB 5F8MA 1NK8A 4KKOB 4WE1B 4DG1A 5C42B 1Y97A 5DG8A 1W9HA 3HVTB 4LSLA 3B6PA 2YKNB 1D8YA 1HNIA 1FKPA 3DRRA 5I42A 4QPXA 4BDYA 4KHRA 3VQBA 4B08A 3KJVA 3L2VA 4JUZA 3SPZA 4ECXA 4QAGA 2A1SA 4DL4A 5DQIA 3PR4A 1C6VA 3V4IB 4DL5A 3H2LA 1X9WA 5DG9A 1IKWB 1RT5B 3QERA 2ILZA 4O3RA 3CJ5A 3SCXA 4DU4A 2E9TA 2XI2A
chains in the Genus database with same CATH superfamily
5J1EB 3CE8A 3MXJA 4DPTA 2BXJA 3UKRA 2UVVA 3FDSA 2ZBIA 3K5MA 4OYWA 1UW4A 2BJ1A 4EWTA 1GTHA 2RIJA 3GCXP 3UCGA 4DX6A 1MMNA 1PILA 1TK5A 4FWLA 3ET6A 2C3UA 5KG5A 2KU7A 3KVGA 4A8MP 5KOXA 1XR5A 2ASDA 4JV5J 4RWXA 3MEDB 2CJKA 3PX0A 1IN0A 3O4NA 4H0OA 2IA0A 1REVA 3M1VA 1S6QA 1GEHA 1UEVA 5F8HA 2FVSA 4O3QA 3M8QB 2B6AA 4CH0S 1XC9A 1TL7B 1ZZFA 3THWB 4ECQA 3RAQA 4DR6J 1TKXA 4CLWA 4DUYK 3KLIB 4DI6A 5IFMA 4DV7J 2POKA 5A2QU 3K58A 3RJMB 3CCJS 1Q95G 1HBOB 3NF8A 4FWPA 2ZE2A 4BC9A 4KREA 2V2ZA 3OR1A 3MOZA 4AH9A 3BGUA 2E88A 3D3BJ 1HUXA 4WQ5A 3BGFA 2HNDA 1LW0B 3HVWA 3GR0A 1YBAA 4FP9A 1K44A 1BCOA 2IVMA 1T7PA 3A5LC 1RBTA 2VG5A 2AEFA 4WFAL 5LMNJ 5IWAK 3ENHA 2DGWA 2E7WA 4AHSA 4BR9A 2XHBA 1FEEA 2UXDF 1TELA 3POTB 2W42A 2Z2MA 4M5DA 5C25A 2N7YA 1IBMF 2P9IA 2DISA 4LF5J 4IEIA 2Q43A 4E7LA 2YHWA 3AA4A 3V1RA 2N4DA 4DR2J 3MK6A 4ZVSB 2HWHA 1GNKA 3EVWA 2VBXA 1U1NA 1RDBA 5GADP 3BR8A 4IXCA 4B9NA 1ZOTA 3EZOA 1TP7A 3D5MA 3N4QA 5EX5A 2NLXA 1WSVA 1RWPB 4JI0K 2MKCA 1PC5A 1SH0A 1SIWB 4N8OA 3CDAA 3LTOA 3R27A 4IG0B 3PIPQ 2FHKA 5C42A 4PPZA 2J8SA 4FZZA 4MLHA 2AWZA 1OY9A 1KAXA 5M1NA 2JC1A 1X9SA 4HHJA 3Q83A 2W4DA 1QD1A 3WX8A 2DJWA 3CCSN 4ZCMA 3QZ7A 1J5EF 3ZT4A 2U1AA 1FJGF 3LGHA 5M2RA 1M90O 3AHPA 5JMNA 4I56A 3OXGA 4LRCA 4B3MJ 3CB4A 4Y2CA 2QO3A 2F9TA 2DR8A 5KOWA 2E1RA 3OW2R 1RBRA 2KKZA 1H73A 2GBZA 5B0AA 3B8AX 5AZIB 2YKAA 1T03B 2AGOA 1KTVA 5AXLA 1AA1B 3HPOA 4NXMK 1O8BA 4DV6J 3E9OA 4CGIA 2VQEF 1N34F 2JSXA 5H9EJ 3MEDA 2KTQA 3TZYA 2BTFA 4JKBA 2K2PA 5AT1B 2QSFA 2CNKB 4IBNA 1XMOK 5B0EA 2Q2RA 4K2JA 3BO4A 4L3KA 3G8QA 3BB5A 2JRSA 1VOMA 3DXMB 3M8QA 1KQSM 3AJDA 4KTWA 3DOLA 2GEMA 1JLAB 1TL7A 2X1BA 2H3EB 3CVKA 3THWA 2W2PP 4X4QA 2EFNA 3AD9C 2Y3YA 4YDUA 1RI7A 1T44A 3KLIA 5LMUJ 4DU7A 1JK9B 4LBHA 1IBKF 3CJ4A 2LQ9A 4AQYF 4BQZA 1HBOA 4JK9A 1NK5A 2D3UA 1GXTA 1U25A 3C0BA 4A8OA 4FO0A 3UD3P 4NLTA 1LW0A 3M7VA 1UCNA 2UU9K 3VAJA 4OX7A 1I94J 3VF6A 4LFAJ 3T5HA 4OMFG 1NSAA 3QEPA 3US5A 4NEYA 4LH5A 4QR1A 1GMUA 3C95A 1FDAA 3GV8B 5LM7E 4M5JA 3POTA 2EEYA 2RSQA 3CI5A 2MLXA 3CM6A 4DFJA 4O3PA 2QW9A 3NAHA 2D3O1 3SNNA 2O8BA 1UWAA 1T9UA 3EWGA 3TA2A 3AY9A 4BRIA 2DPNA 1F9EB 3T5JA 1H74A 1MG7A 3O9UA 3R2DJ 3QBWA 1FEHA 4M3YA 1N32F 1S1XB 2F3JA 3MD1A 3J7ZO 4WJBA 4ZCIA 3QEWA 5F3ZA 1RT7B 5HRPA 3NP5A 4A46A 4C0OC 5K9FA 4IG0A 2QYGA 3NGZA 2F4FA 4WP8A 4ZIWA 1WOQA 3JXUA 1WC5A 3EGNA 3MM8B 4FLTA 2NRRA 5E2QA 2CQPA 2RILA 2Z1JA 3K8VA 1Q7YO 2JDJA 4DPWA 4BRQA 1VLOA 2BOAA 3OTEA 2GC8A 1RFQA 2AJ4A 2ZWHA 5KFDA 3H7HB 3EVMA 3G86A 3QNWB 3ENOA 2AJ0A 2E66A 4OKEA 1S77D 1IBCB 3RYLA 4BVPA 1T02A 2RKIB 4X4UA 1T03A 2HW3A 3O1WA 1JLFB 3S41A 1B3TA 1LQ9A 3I56S 3CO0P 4B8CA 4MT1A 4CO2A 3GYXB 1AB8A 3R2CJ 4X4RA 3VQSA 1JKHB 1OPZA 5FIIA 3F9KA 2HRTA 5D15A 5AZJB 4CJKA 1VFJA 1UPMB 3DXMA 3EPIA 2P9LB 1BO5O 4XPEA 2H4WB 3IMQJ 2RE1A 4ZVFA 2G8UA 4WIIA 2IMOA 4CF8A 4DTRA 2WTUA 1K1SA 1NGFA 2VWBA 2YVSA 4IKAA 4MMOA 2MKSA 3VA0A 5F8LA 2JWLA 4C3LA 4DPXA 1SL0A 3HL8A 4H0TB 1SQKA 2DGXA 4DUYF 1QVFM 2OPPB 3QBXA 5KFBA 1XMBA 5HVFA 3PX4A 3LDSA 4HACA 4H4OB 1RTDA 2HHTA 2DNRA 4BRKA 3K5LA 1E6YA 4Z0UA 4QIWD 3RRHA 4U7UD 3QAEA 4E0DA 2MKKA 3CMEN 1P1LA 2X6NA 4M1KA 1L3TA 1TV6B 2EWHA 4QWCA 1N5SA 3WUHA 5E26A 3LAKA 1N5TA 1KVCA 2JFKA 2BM0A 5IWAF 2C1EB 4P2FA 2I2YA 3GB0A 4ZLPA 3EGZA 2GFFA 3CPEA 3O9RA 2G13A 2LEBA 1S1XA 4NLYA 3OS0A 2BE7D 2MKYA 1NJWA 5GINA 1RT7A 1RAOA 5K14B 1RWWB 3UDLA 2UXCJ 2W2NP 4Z4HA 2XTJP 2X7IA 1BOTO 1REGX 3QWPA 4ZVUB 1HA1A 3MM8A 1ZZNA 3MEGB 5HOOA 4F8RA 3V6HA 4DV5K 1RWNB 4JI0F 4PRFA 1NRKA 2HPUA 3W9HA 3EX7B 4GRSA 4JI6K 3N4WA 2KM8C 5FRNA 4AUKA 4MQ3A 2MDAA 2O8CB 4RW7B 2X3GA 4ISGA 1HW9A 2OEJA 4MH8A 2LQ5A 4ID5B 2FY8A 4FJMA 4NOHA 3TJ9A 4DL7A 4USKA 2YHYA 4YB5A 1WHYA 2C2RA 3MHYA 2WSCC 4E1JA 2RKIA 2BW7A 3TAEA 1JLFA 4AHRA 3RMBA 2IJFA 4OZ3A 1F3VA 1U2CA 2BANA 5CABA 2H3GX 1S79A 5KG6A 2BUNA 1M0SA 3TSUA 3G0ZA 4FM0A 1SKRA 3CW2C 2NRHA 3O08A 4KO0B 1P90A 1JKHA 3BO2A 2J5AA 4NXMF 2OTJN 4KR0B 1M5KC 2BBEA 3BY5A 3VQ7A 3HP9A 4CLKA 4ZPVR 2P9LA 2EKNA 4LF7K 3C6AA 4ED3A 2WC9A 2HBYB 4EO8A 3O8WA 5AE3A 3MFHA 3K8WA 8RUCA 2W7PA 3IM9A 2FBYA 3VOVA 1TL3B 3PSIA 1GX6A 3BBBA 3O8MA 4M7YA 3UN2A 2D69A 5GAHI 4KTZA 4M3TA 2QA2A 4FYDA 4FCYA 4WYWA 4KGXB 3IRWP 1SC3B 2OPPA 3ISND 4JRPA 4O3SA 1VLYA 1HR0K 3CJ9A 1WAJA 1H3DA 4FPAA 3IA0A 2KW4A 4JK7A 2JWNA 4X2BA 4DR5J 4YOVA 4BRPA 2WRMA 5FD1A 3KWIA 2OO4A 3P5JA 3ZZ0A 2P9GA 1BXNA 4BGAA 3ZT2A 1KONA 1RSCA 2JEJA 3TUJC 2C3YA 2UU9F 1TV6A 2DK2A 2W8KA 3R1HA 3I5BA 2R2UA 3NBPB 1U1QA 3LP0B 4NZ6A 1SKUB 5C2GA 2QWLA 2MYFA 4UQTA 1NEEA 4J9NA 4OI2A 4TU7A 2HAIA 4JI2J 1TUGB 4OFZA 2BKOA 4CERA 3L7OA 2E9RX 1CPZA 3BGOP 2YNIB 3TQEA 1F3FA 4RW4B 1KOHA 4QIEA 1KHWA 5K14A 4K2XA 1NBWA 2MLZA 3AJ1A 5AJ3J 1WNEA 1WEXA 2I0XA 3NMAA 2VWKA 1O5JA 4ETZA 2L3MA 4IFVB 1SBRA 3D66A 3MEGA 3JSMB 5B7WA 1NKCA 2DNMA 1YRXA 1FX2A 4FXDA 4ELVA 1HI0P 2XS2A 2BQRA 2A40A 2O8CA 2LA4A 4RW7A 2RS8A 3S3OA 4ID5A 2J6TA 5HMWA 2I9SA 1T94A 4PXBA 4Z4CA 4KTQA 2FJDB 4Q2MA 1Z2ZA 2BQUA 2NYHA 5KFKA 3OS2A 2MEWA 5IS2A 2AHOB 5CZXA 1UA1A 1BUPA 1ZBLA 1JL2A 5DG7A 4ED0A 3WNEA 3HJVA 2KFNA 4WU2A 4K50A 4RWWA 2FF3B 1JWWA 3W5XA 3J80U 4YR2A 4KH5A 1WG5A 4W4MA 2VC1A 1F6TA 4PG5A 4O8KA 4ZVRB 2HBJA 4DR2K 1ATRA 1CZAN 4Y2KA 4IOCL 5CYJA 5KFFA 3Q8PB 4JS5A 1VK0A 4N56A 3CCEN 4KO0A 3ZFVA 5BR9A 1HJRA 2XY7A 2DXEA 2CH5A 2P8IA 4OZ2A 1EARA 4I1TA 3ZZYA 5HLFB 2DY4A 2YH1A 3PW7A 1GLAG 2XRIA 1N36K 4LH4A 2PDAA 3NWRA 2QFJA 2EC2A 5AQXA 1TL3A 3B78A 2HBQB 3CC2S 1R8AA 2XO7A 4ERDA 1NHVA 3RWUA 5E0OA 4ENOA 3I5CA 1OH8A 3IAM9 1KNZA 3OYFA 3HVRA 2ZKTA 3TQ1A 5M1KA 4ID1A 5DGBA 1VRUA 4TYAA 4DJBA 4OPKA 4C1NK 5DM7L 2B9XA 3ZEUA 1VQLN 3ISNC 1QDUB 2EXUA 3TSPA 3C8YA 4DV6K 1SUQB 1U0HB 5KG1A 4JI8K 4M8LA 3M6UA 3NBPA 2BKNA 1RCHA 3LP0A 1VISA 2HHWA 2XSFA 2PGCA 3CJQA 4QR0A 2V8VA 4OZ1A 4WFNL 4M5NA 4BRAA 3U27A 1FO1A 5KPTA 2YNIA 3IKMA 4RW4A 6FD1A 1HHTP 1CXQA 2X78A 5HVHA 2UXBK 2M88A 4IFVA 3CM5A 5AQRA 1W7AA 3D2EB 4PG8A 5B0FA 3D2WA 3KJVB 3JSMA 4ZCLA 1SZ2A 3RBEA 4FYWB 2FJVA 4DR4K 4H54A 2MGZB 1G7CB 4K8XA 1NMDA 4DUZK 2ZDPA 4RUHA 4CLSA 2HGMA 2PD1A 4LQ3A 4Q8EA 2B8PA 4JI4F 3T6JA 3I87A 1SJ3P 4DV5F 1TFYA 2OFGX 2ZH4A 4CYUB 4JI6F 3IFRA 1X9JA 2DHGA 3KWMA 4WZQA 3I8BA 4RU9A 2IBKA 1H72C 2F96A 3TAMB 4FLUA 5KFSA 2DH8A 2YH0A 1D4XA 1OJ4A 5KAKA 3E8OA 4CNZA 2DRDA 2IAJA 3CCZA 1TAQA 4DZ6A 3I6PA 4FDFA 4LR8A 2UUAJ 1K73O 5KFTA 1OYEA 1RGIA 4WYLA 4X64K 4M5KA 2GIFA 3BBFA 4U7UK 2CPHA 5HLFA 2XZDB 4NLOA 4PKDB 1TL5A 4KHPJ 1HMVB 4M41A 5JLHA 3B4DA 4JYAJ 1F21A 5E7OB 2JWKA 2V52B 4CH1A 2DNYA 4OLBA 1HBUB 3ALYA 5BRDA 1EAYC 3UW1A 2X51A 4F50A 2V2KA 1F9HA 4FBUA 2BRLA 4LF7F 3GDQA 5GAEU 5I4MA 2YV0X 4FVCA 5LXYA 4I64A 4O4GB 4P71A 1VSLA 4UF4A 3SQ2A 4H0XB 2DXDA 5JVGQ 2QI2A 2WSFC 3NDKA 3QT8A 5A2QY 2HYIB 2VDHA 3J7YP 4LRFA 2H65B 5CY4A 5C2DA 1FNMA 1FKOB 1O13A 4KV8B 4ED8A 1HR0F 3DGVA 1SUQA 1U0HA 2PZSA 3OT9A 2PSZA 5CH7B 4MYUA 3NL0A 1RCXB 4ANCA 1DTTB 4IFYB 2OEKA 4DQRA 3DNCA 4R0JA 1RLCL 4FWMA 1AZSB 4HHUA 2LU2A 4NMXA 4Q43A 2XS5A 1U24A 4F4AA 1SIZA 2R7XA 2A10A 3OYEA 1A6LA 2V63A 3L7PA 4OKJA 1QHTA 3PX6A 1KCFA 4ZTJA 2OPQB 3TPQA 3D2EA 5DDOC 5EN1A 1NGCA 2OTLN 2GVDB 3LP3A 4BRDA 2FHMA 1I6JA 4M63A 2D41A 1HHQA 2MGZA 1S22A 2DNKA 1YTUA 4DCHA 4BVOA 2HNYB 4KT0C 2EPIA 3DDIA 4CM2A 5AQHA 2QKKA 4N76A 3HULA 5B0CA 3ITHB 5GAGI 1ZS6A 4LIWA 3CCTA 1NJXA 4ZDNA 4U8VA 1NPKA 3KJNB 4H5TA 1QM9A 3P96A 5IC4B 2VBZA 4V1Ak 3U4LA 1MA9B 3CFRA 2ZVSA 1WHXA 2E5GA 2GAGC 2FHJD 3RW6A 3TAMA 2D1CA 3DXKB 1XHZA 4IOCQ 4XPCA 1NH7A 3D6HB 3C66A 4IRDA 3UPFA 1BL3A 4MIAA 4LIRA 3A3OB 5GADU 1NUEA 1TMMA 4K4ZA 1V4SA 4DR2F 3I9V9 4OPAA 1MWZA 5LSRA 1HMVA 2UXCK 4HI2A 1Z4UA 3GJQB 3KWGA 2MKIA 3LDLA 1HBUA 4FYYB 1C0TA 1SQGA 3ULHA 4FM2A 5LL6Z 4TLQA 3O9SA 2QFIA 4J9MA 1BUXA 1N36F 2XWXA 3DLKB 2A6AA 2CYYA 3Q24A 1Q8BA 3MDFA 4MKVA 3B82A 3K5PA 2UUBK 2ATQA 4O4GA 2OPRB 5SUHA 4GC6A 5I9EB 2GHWA 1NSPA 2SXLA 2VONA 3AARA 4BREA 2MPUA 2N82B 1ACMB 5DM7Q 2NSBA 2DFHA 3MWBA 2FTRA 3O4QA 4YNQA 3W3SA 1FKOA 1CSJA 4KV8A 1T9VA 2A2DA 1SAZA 4WXOA 2DHSA 3SBTA 3PTWA 4IDHA 1P8ZA 1DTTA 3VEOA 4H0YB 4TY8B 3GV5B 1AZSA 1KWMA 2IA6A 2ADCA 2DGOA 3PW2A 3MI7X 4DV6F 2W6KA 2YY3A 2MSSA 5M2PA 4HUGA 3OBYA 3KK1B 3KIOA 4NE9C 2DHAA 2RF2B 3LZIA 3L2QA 2V7YA 4TQRA 3OD2A 4F02A 1TTHB 1VHFA 2NXCA 4ECUA 3QFUA 1GLDG 2YPZA 1TKDA 5DDPC 2OPQA 3AQOA 1VQMS 4CF9A 1GLFO 1CS4B 2VL1A 4GO7X 1VC0A 2J9DE 2ZD1B 2GVDA 2GZOA 3BM7A 1AUSL 4BR7A 4Z4IA 2DR5A 2QJ3A 3A12A 4A61A 1U2VA 3H3NO 3V5RA 5C7PA 4NLXA 2HNYA 1LXNA 2WVEA 3VQCA 4C3MA 2UXBF 1NPPA 3ITHA 2CQ4A 3NGRA 3OVBA 4P2XA 1WB9A 4I2PB 3KKFA 4CIFA 1UL3A 5BYQA 4DR4F 3OTDA 5F1XA 1U1PA 4IO9L 3N5FA 4FJLA 2JHEA 4DUZF 4OYZA 1QVGR 2JEGA 1LAWA 4A8SA 2G0IA 3SYZA 1UETA 4E19A 3ID6A 4HVZA 1ITGA 3H59A 1V6HA 2VPZB 3G87A 3BQ2A 1VQYA 2PN6A 3QT5A 5K5MA 1UEUA 3DXKA 3QETA 4Q0BB 3WT0A 1LWCB 1RHQB 2W8LA 2DHHA 1XQIA 2R8KA 1FX4A 3N9UC 1F5AA 4OJGA 2W1BA 2UVUA 3MCOA 4F4YA 2JLFA 1E6VB 1Y9OA 1D3WA 4BR0A 4EYIB 3A1YG 3A4TA 5EUHA 1YK9A 1VRTB 2Y8WA 3BF1A 4CJ7A 2G1HA 4O3NA 3SPYA 3LM2A 3CUNA 3HSJA 4X64F 4F7VA 3EEQA 1HNVB 2QV6A 4CIEA 2DFFA 2ZJQQ 3VGVA 2ZH3A 4UQGA 3DOKA 1NM2A 1UJ4A 3DLKA 1HNXK 4ANDA 1QSLA 1N88A 1IKYB 4YQWA 4UT4A 1RAAB 4IFEA 2Y0SD 2GWJA 4RW9B 4HTLA 2OSRA 4B17A 2A42A 3FJ2A 3OTOK 3K5NA 3VEYA 5AQLA 4H8KA 2MQLA 3FZFA 1LEOA 3A8EA 4EFAC 1RZMA 1W26A 3AA5X 4FKXA 4AHCA 4TY8A 4AL5A 4CJ5A 1MU2B 3R5BA 4ZPDA 4ILHA 5L39A 1LV5A 2OELA 2PO4A 3KK1A 1WSIA 2RF2A 2KLAA 3LW5C 1QSSA 1RGVA 1WTFA 5I42B 1C4CA 4ILLA 4ZP7A 4CVNE 3R7NB 1DQ8A 4ITSA 2J76E 2NPIA 3G82B 1CS4A 3KD1E 2LEAA 2RH3A 4B9VA 1JQGA 2ZD1A 1V5IB 4B9SA 3UKUB 1T8EA 2GIQA 3H0PA 4B8AB 1VQMN 4CW7B 4Y6IA 3VF2A 4UY85 2VYPA 3VQPA 3T6BA 3CNQP 4CJLA 3KTQA 4I2PA 3D6FB 3OYBA 4J9VA 4MIWA 4XIUA 1XNQJ 2CADA 1VQ5S 3Q2SC 4NMLA 4Y00A 2QX0A 1F1BB 3BV8A 1S0MA 3PKMA 2QG9B 4ALZA 3OVNA 4JI7J 3GQCA 5LXRA 1C1CB 3RSEB 3MWPA 1KLMB 4C2MA 4Q8FA 4Q45A 3H3OB 1IWAA 1L3SA 1ZBUA 4IEEA 4AM6A 4Q0BA 1LWCA 5AQQA 1ULRA 2KM8B 4DR1K 2L08A 5CD4A 2BX6A 4WTOB 3EMTA 4AXIA 1Y00A 3CCVS 3TANA 1E6VA 1HLUA 1CJKB 3H1VX 3ZT3A 4GV3A 3EDQB 3PJXA 3O3HA 4RW8B 3M9OB 2I1RA 2YKMB 1LK5A 3CULA 1WDDA 1VRTA 4FF3A 1Q86O 1X0PA 3U1MA 3P83D 2P9EA 2BE2B 2QWOA 1HNVA 1BLUA 3AOAA 3MPUB 2XB2D 3DLBA 3A3PB 4CZJA 2UXCF 1WI6A 4WXWA 3IXQA 3UI3A 1GLBG 1Y0HA 4DSLA 3CCWA 2QN6B 1IKYA 1U2RA 3DHWC 1X3NA 2W01A 1IKVB 1GMVA 1NNDA 1MN7A 2V5HG 1NJIT 3MEKA 2BDPA 3OYDA 1VQOS 1LNQA 1RA6A 1Z05A 3AXMA 2UUBF 1URNA 1LWXA 2ZDOA 2BUPA 2VG7B 3NF6A 1WKKA 3P4IA 2HHHK 2ROEA 4NXNJ 3HHKA 3CETA 3HT3A 3KK7A 2FLNA 3C6UB 1FK9B 3QEVA 3KYLA 4ZVHA 1Q81T 1VDHA 2C3PA 1S1VB 1WSRA 1MU2A 4DL0C 2WVDA 2IVOA 5F8MA 1NK8A 3FEYB 1M5OC 3WHIA 4DR7J 1H1VA 2Q0RA 1HNZJ 2OEMA 1W9HA 2CZ4A 3HVTB 4L3QA 5D0GA 4YOUA 5I42A 2ZBPA 2HK3A 4M5MA 1A0OB 4QAGA 4DL4A 7AT1B 4DX7A 2XMWA 3G82A 1VQ7S 1RT5B 3SDEA 4O3RA 4LF8J 3QRRA 3QMQA 2A3JA 3UKUA 5IQ6A 4JV2A 3HJFA 2VPYB 1EKRA 3ELHA 1NGHA 4W5QA 1UMJA 5D4PA 2J0QD 1A5WA 3DXSX 1SL2A 2VQFK 1RDCA 4I2QB 3C2PA 2QLXA 4DV0K 4YN3B 3SUNA 3W5ZA 2GJIA 5L1LA 3Q2TC 3TR5A 4AM7A 1RADB 4CLZA 5TKYA 3QIOA 5GMKa 3KJQB 3EM1A 3U6FA 4LREA 3RSEA 2PFDA 1KLMA 4ZHRB 3F5TA 3VQ6A 4BS2A 4ED6A 2NXNA 2YHAA 2KVIA 3AV9A 3EO3A 3QINA 2HWIA 4Y2AA 2UUCJ 3DKDA 1GK8A 2PIIA 4B9UA 1Q9YA 2IOCA 2QE5A 5F2RA 2IDOA 4TY9A 1J6ZA 1HNWK 1WHVA 2LLZA 3GIRA 3ILIA 3KK3B 1GH8A 1CJKA 2HWTA 3CYMA 2FC9A 3AVCA 2G8HA 5KI6A 2YKMA 3CCVN 3CD0A 3J80Y 4BC4A 4F4WA 4NB4A 2BE2A 3CJ2A 1W7WA 3EE9A 2QL7B 4CLLA 3W64A 5LJWA 1WF1A 1U2FA 5K20B 3MAHA 3NRBA 3M32B 2A5XA 4E1NA 3AAPA 2FIUA 3TP2A 3E2EA 3HBTA 2MHEA 3QEIA 2IDLA 4KY3A 2ZEJA 2RB7A 1N56A 1IKVA 2B4UA 2DPJA 4FK0A 3TZWA 3DLGB 4ES1A 2CPIA 1WUUA 3HZ6A 1UVNA 4JKFA 4RBUA 2BM1A 2CQCA 3QJLA 2UVRA 1B0PA 2OHDA 3M8ZA 1XR7A 4YS2A 1YJ7A 1NU0A 1QZ5A 3L3VA 4DLEA 3HK2A 3B4MA 5KFYA 1TAUA 2KXHA 1HIYA 1S72N 4DDFA 2H5IB 3W8PA 3MMJA 1VQON 3VAIA 4EUVA 4P73A 5IT4A 2VUGA 3JQMA 1RILA 1J53A 1EHWA 3C6UA 8AT1B 3HKZD 1FK9A 3ENWA 1FT8A 3HKWA 1T9YA 3OTOF 3O3GA 2DNQA 5M1OA 3K9JA 2ZM6J 2DKOB 3BZKA 1B9DA 3JAMU 3N6LA 5D8HB 2FZCB 3RMDA 2PMWA 4WPAA 3HVTA 1H7XA 1UZHA 1ZBIA 1PJ7A 2C2OB 3D0PA 3E9PA 2YJEA 3BUZB 1RP5A 4TSXA 1Q16B 4CF2A 2V4RA 3WNHA 1RT5A 4YFUA 4ZITA 2QWQA 1HWIA 1IBMJ 2LP4A 2AX0A 1F5BA 4USMA 4NRTA 1VQ7N 4DBQA 3GG4A 3ZZZA 3RBZA 2AJQA 4EU0A 5KRSA 4WIQA 1HD1A 5EY4A 2VH7A 1RBUA 4I2QA 1JLCB 4H0VB 1URRA 1RA7A 5IV4A 1VQKS 4M45A 2QMWA 4DSFA 2YWEA 3ZO7A 4FJHA 3HOSA 5FPNA 2RAQA 3FZLA 3VAGA 1Z2LA 4CGJA 4ZHRA 4FOIA 1SV5B 2HQDA 4DN9A 4F3MA 5A6WA 2CA9A 2HGLA 4K4VA 2QIFA 3OTBA 2O4IA 3GOIA 2CJXB 1H7WA 2O67A 1OVYA 3FUYA 1FJGJ 3C15A 4HDHA 4OI1A 1CLFA 2L9WA 5AQPA 3OYAA 3JTOA 5D0HA 2CH6A 3OHRA 3KK3A 5CYQB 3Q7BA 5CYMB 3NG8A 1Q81O 1G6BA 3EKSA 4ZS6A 3EZUA 3M1FA 3MMCB 4DR1F 4PL8A 2IYIA 1UEKA 2AGQA 3IUCA 3V81B 3CJ3A 3QPIA 2VQEJ 2KT3A 1WF2A 3PEHA 2HHQA 2F8EX 2HSTA 4D3GA 3AA9A 1DEJA 4BC3A 2NPFA 2M0GB 2BZ2A 1J2VA 3M32A 2LMIA 4KPYA 3S6EA 3VGMA 1T9TA 3MECB 4LFCJ 1S4FA 1TFWA 3DLGA 1QS4A 3VEXA 1RT3B 5J2MB 2Z4PA 4B3RK 3CO9A 1GQEA 1FRJA 3GBTA 2ZFHA 4P9SA 2GJFA 1HYSB 1IBKJ 3MR6A 4AQYJ 1YUWA 4PCQA 3IS9B 5A0YB 2DXFA 5LSLA 2PT0A 2VOPA 1VSMA 4ECSA 2RDJA 3AVFA 2KI2A 2HHHF 3K2YA 2NRZA 4YY3K 4MDBA 2VHGA 2R7VA 4X4VA 1FDBA 3CCQS 1JJ4A 3CD6S 4F3TA 3G6XA 4WU3A 2UUAF 5GAHP 4O0IA 3NH2A 3C19A 3CWJA 2D0OA 4AD6A 1UVMA 2A1RA 2D0PA 1PBUA 4JV0A 3GR1A 3I0SB 4HVJA 1Z25A 3GJTB 3MWTA 2BJ9A 1OMSA 4W5NA 5IXUA 4X62K 3MCMA 1H2VZ 3TJAA 4W98A 3CIZA 3QDKA 1N32J 1H6KX 1JLCA 1UVKA 5D0RA 1YJNS 4J9RA 2EFQA 3HF5A 4CJPA 3KHYA 1SH3A 3J7YU 2OH2A 2NR0A 2QK9A 4RKUC 4ZVTB 2JL9A 1VQKN 2C2KB 3ZX0A 4KIAA 3L6QA 3JSRA 1GLEG 3IGNA 3AJ2A 4OYMA 1SV5A 4WWSA 5IT9O 2EFVA 1SKSA 4YOYA 4HI1A 4DF4A 3ULEB 3HO1A 4XH5A 2B9YA 3H2UB 4K7QA 4FK4A 2V67A 3RB4A 2PA3A 5C15A 2ABYA 5HATA 5CYQA 5KG0A 1Q1KA 3T1AA 5C5JA 5CYMA 5M1PA 3MURP 3J80O 4LVOP 3O5BA 1AFIA 4NPOA 4F0KA 3IBFB 4F2RA 4GVMA 3MMCA 4OYBA 1HNWF 1Z1ZA 2Z1GA 4MKYA 1HFEL 2EC0A 2YXLA 4CJFA 3V81A 4CJ3A 3RRKA 3ZTSA 5ADXA 4KGKA 5SWMA 2EFGA 1AFJA 2KB2A 2RD5C 4TU8A 5DO2A 5EOYA 2K1RB 1R8PA 5HMYA 4JI5K 2LYVA 4GY2B 1Y3KA 3MECA 3FSYA 4P10A 5E5NA 5BREA 5A76A 1RT3A 2Y1LB 3IM8A 5J2MA 4C7QA 2P9CA 1VI7A 3SMZA 3U3YA 1HYSA 3PO4A 2E29A 4ECRA 3CSKA 3RMAA 3FCHA 1RHMB 3D7EO 4DQSA 3ZNJ1 3IS9A 5A0YA 1KQKA 3ONQA 4GKKK 3LGNA 1FTRA 3SLCA 4WP3A 1UA0A 2BEFA 2HZAA 3I55S 3OUYA 5K8OA 4OI4A 4Y34A 1VSDA 4CZEA 1SC4B 3S3NA 2RHKA 2NS1B 3L95X 2DB1A 4TVAB 4BR5A 2R3VA 3D4JA 1FJ7A 9RUBA 1NPRA 4WQ4C 2IC3B 4J2AA 1KFSA 4JKEA 3PUFA 4ZPCA 1SJFA 2QRRA 2IM1A 1UAWA 4F67A 1NCLA 3AD8C 4YORA 4HUEA 1X4GA 3QWUA 2KRRA 1S1WB 1B0VA 1EO1A 2F8HA 3C7NB 5IWAJ 4MLEA 3GTYX 2VPWB 2IIHA 1MWYA 3BQ1A 1IUJA 1N33K 3H98A 1YRUA 1S49A 3ICLA 2LXFA 1JXBA 1FTCA 3MX5A 1ROFA 1B64A 1FWLA 2BKPA 2FDNA 4NLQA 4IOBA 2V51B 4BRGA 1M5HA 4J37A 4NXNK 3QIDA 4DQIA 1YSJA 4NL5A 3SJHA 4CD1A 1N54B 1X4CA 5SZTA 5AXMA 5CD4H 1FI4A 4C6AA 3GMGA 3ULEA 3KUHA 3MPWA 3ILOA 1VQ4N 1CZ9A 1QSYA 2CNLB 1JXEA 3WZ0A 1ASVA 1KP6A 4KHSA 2AEJA 2MJNA 2IFXA 1HX1A 4QJVA 4QBUA 2ZITA 1RT1B 3BH6B 4X65K 3M8SA 2GS8A 2P9SA 4KRWA 1YGYA 3ZSRA 3TJ8A 4LF8K 2H5EA 2ASPA 2WAQD 3PW5A 4NLRA 1HI8A 1PYSB 4A8FA 4AXJA 2XZWA 3M9MB 3O3LA 4ECVA 3SMPA 2K1RA 1X5PA 4PHTX 1DGKN 4NXMJ 1ZA2B 3L3UA 3PNIA 1Y11A 3OTCA 3P3DA 3KFWX 4XAKA 3A8IA 2QA4S 3EGVA 1XMOJ 3FC9A 1T3OA 1YJ9S 2NREA 2YHBA 2Z2ZA 4R0EA 4C11B 2R42A 3SIPB 3NVKA 1G3OA 1YTAA 3KK2B 2E5JA 5M1QA 5JVHL 4KH1B 3CMAS 3CCRS 1RE1B 3BJYA 2F9WA 4CZKA 3IWLA 1S6PB 2YKNA 1ICEB 2DPIA 3THTA 4U67L 1VGYA 2OZSA 2YX4A 3QT6A 4OZNA 4ED2A 2P5VA 3ZSQA 1JJHA 5EX0A 1H98A 2EHGA 3EICA 2O8EB 3I55N 1SQFA 1YBUA 4DV2K 2CXEA 3HFZB 4Z4GA 1FE0A 4KQZA 2ZF5O 2IC3A 3A8YA 2R7QA 2W24A 2B5JB 2UU9J 5CHIA 5C2CA 1RWVB 3OFEA 4CEFA 4YY3F 3FQKA 4UZBA 4KSEB 4PQAA 1VQPN 1RDUA 3C7NA 3EVOA 4Z4EA 5F0XA 4OHZA 2AYEA 4WFXA 2YWWA 4JKHA 2RT3A 2DTJA 3GCWP 3UDCA 5E3QA 5HRSA 1KLNA 1UVIA 3T9ZA 2KYZA 2L41A 2CWXA 1WORA 4QOTA 4WZMA 1X7VA 2V4JB 1JL1A 3PIOL 4FZYA 4X62F 5HQMA 2OUGA 1WNSA 3OYNA 1WG1A 8ATCB 4NLWA 1WDTA 5HK4A 5LJ5Y 1CXUA 1DBDA 1JXLA 3SJJA 5ADZA 2G0JA 3H08A 4CFDA 1RWOB 3FZBA 5T41A 2PMZD 3SZ2A 3U7JA 3PV8A 2QC3A 2E44A 3A8JA 1RTHB 4PWWA 4HEA9 3W2VB 4FOEA 5F8IA 1RT1A 3LO3A 3AXKA 2ZBCA 3RVCA 1R0CB 3AVLA 2Q3SA 3WX4A 3DC2A 4FN5A 3KG4A 1T3NA 4DTPA 1UJ5A 3L2WA 1TKZB 1OH5A 5DLGA 3D6TB 3ZZPA 3UCUP 4X66K 3TX0A 2Z8QA 5AQVA 4BC2A 2FHJA 3EKUA 4M5GA 3NGYA 4F4KA 1FFSB 1FDDA 1I5OB 4MKBA 1YWXA 4PWUA 3SUOA 3LP2B 3HSZA 2PEBA 5GMEA 6FDRA 3P8BB 1DZ5A 3FRZA 1YXQA 2FJBB 2QA4N 1NO8A 4C11A 2HNZB 2E1ZA 3MMAB 2O8DA 2DY9A 1RTJA 3KK2A 4M3UA 4OVLA 3AD7C 2IY5B 3CJAA 1J54A 1OH7A 5F8GA 4DCJB 1NJZA 3TO8A 1S6PA 1UWBB 4ZVOB 3VVUA 4DR3K 3S1TA 1FW6A 1FA0A 4G1IA 3CERA 4M3WA 3HI9A 2O8EA 3IN5A 4GKKF 1CJTB 4DMZA 3WQPA 2B5JA 1RYRA 3R9PA 1FERA 4J90A 5FROA 3BS9A 1HKGA 1KVIA 5EU7A 2QGFB 1D0EA 2RDDA 2HBKA 2EFPA 4KFBB 2J6UA 4XTTA 2DBBA 3FNNA 4CEDA 3D3CJ 2MTLA 2E1MC 3KMQA 1CJUA 5GADI 2B4OA 3HLUA 2NCKL 4N77A 1GOBA 2HVIA 1S9EB 2CVIA 4OHXA 2KT5A 5IZHA 3WXMB 4FVUA 2FSJA 1LFWA 2V8GA 2V4JA 4ZLLA 2FUG9 5HQ8A 3CPWR 3HHLC 2M8DB 2I38A 3ZSZA 4I6WA 4LRDA 1G15A 5HL7Q 4A8KA 4PXDA 1TKXB 1M90T 4OO1J 3NAIA 1WJ9A 3QZ8A 2M8HA 2WW4A 3J7A1 4CZFA 3DU5A 1HBNA 2DR7A 4NXNF 3DLLQ 1OSCA 1QUPA 4D3HA 1VSHA 2G2YA 4FLYA 2ROGA 1EX8A 3BN7A 2KVQE 4LQ9A 1RTHA 4AL7A 4DV5J 3HI0A 3W2VA 1RBAA 2V34A 3ATUA 4OX6A 3GG1A 3OJSA 3RR8A 2HNDB 4JI6J 4KAZA 2AMCB 4B1WB 1OS5A 4CHQA 3HDSA 3SQOP 2ACMA 3TAFA 1W2IA 2NRXA 1Y64A 4CD3A 5DLFA 1CBKA 1C0GA 3N79A 2IS3A 4J9OA 1XERA 5J2QB 1B7YB 1TKZA 4RNNA 2E7VA 3VALA 2OSQA 4C3KA 3J81U 4OHYA 4JKCA 1EWQA 2C22A 1BQMB 2GVZB 4LF8F 5EDWA 4M63C 1SJRA 1N5VA 3V9ZA 3MTKA 2VCPA 2UVWA 3CF5L 3AB4B 2CFXA 3I0RB 4AE5A 3CD7A 3W9JA 2R7RA 1PC4A 2YQ3A 3P5TL 1KEKA 1Q4RA 5KT7A 2ZZMA 4B9MA 3LP2A 2ASYA 1RWKB 4B1ZA 1VS3A 1B70B 2RRNA 2R7OA 1HQUB 1WC3A 1FESA 3O5TB 2A0FB 2F1FA 2YKPA 2Q1NA 2HNZA 3DJCA 3MMAA 4LF7J 4Q5VA 4JK8A 3MFIA 1QQCA 5KFPA 5JVHQ 2CJYB 1UWBA 4U67Q 1KDNA 4RCHA 2OJ3A 3ZTQA 1LK7A 2UUCF 2CZ9A 1I39A 5ETKA 1CJTA 2XMAA 3PG9A 1IQZA 4UUWA 1WC4A 1RAGB 1ZBSA 1J9AA 1HR0J 2L9DA 5BRHA 5FPEA 4P7TA 2BW2A 2OAUA 1WC1A 4DV2F 3OA9A 4BE0A 4KFBA 3MM6B 3BDPA 3QJPA 3R6LB 2X1GA 2WHOA 3DLEB 2MQOA 3JAMY 2GUIA 4TN2A 2OPSB 2E5IA 2KHOA 2ZH9A 2LCWA 4IOAL 3J7ZT 4KHYA 4H5VA 3G6YA 3CG7A 1S9EA 1MLAA 1TL4A 2ERRA 3OFGA 3LZJA 2E5HA 3MM9A 5JXSA 3G10A 2CWKA 1RKJA 3BYRA 1NGEA 3R1XA 1Q0NA 4BACA 3ENAA 3DM2B 1LFPA 5LSOA 1NMEB 2OI2A 3ZTOA 3DOLB 2ASOA 4FF2A 1Q7YT 2HSEB 4ICLB 2FD2A 3TR8A 3G2XA 4DFPA 2XGQA 4E7JA 1WSFA 3DI6B 1V5VA 4NWBA 5KFVA 4P2MA 4B9LA 3QB0A 2MB0B 2L9NA 3D7SB 3BEGB 4L8RB 2QTWA 1UZDA 1ATNA 3Q8VA 2H48B 4GKJK 1Y3JA 2ZM6F 3KHHA 4O0JA 2UYTA 1GLJO 2O3DA 2V7ZA 5ADXH 4ZVPB 3DGPA 3NOGA 4CP5A 4DTNA 1RWXB 3L09A 4B1YB 1NKEA 5HAOA 4H0PA 1CLQA 1O51A 2W7OA 2HK2A 2R8HA 1EKSA 1K9MO 5AQIA 1CQNA 3QGHA 2F9DA 3IBCB 5J2QA 5C24A 3FBFA 3RAMA 4B3OA 1BQMA 1OSDA 2GVZA 3BQ0A 1TUUA 3RB3A 1L3UA 4CECA 3I0RA 3CDEA 4XDCA 3MZIA 4MTPA 2O8BB 5KFRA 3S3MA 1JJ2M 3THVA 4RO0A 4K43A 4X66F 1S5JA 1X5TA 2KJVA 4FL9A 1HQUA 4ES3A 1YI2N 3CJ7A 3BGLA 1QQNA 5HROB 3K17A 1N36J 1PIEA 2ZJRL 2W2MP 4FK2A 1S5ZA 4LF6K 1NZAA 2DGSA 4BRFA 3NFAA 3BSAA 3L2RA 1QJHA 4UOHA 3DHXA 2E1YA 4TQSA 3JS6A 2CPFA 2Q0UA 1OKJA 1S9FA 5D3GB 1HRHA 4NCGB 4Z4FA 4DR3F 3H90A 4FJJA 4WK3A 2AGPA 2GHPA 4OI0A 3UN3A 1QTMA 3KNAA 3HD1A 3OLAA 3M6VA 3MM6A 3ID8A 3HRGA 1HI1A 2YI1A 3DLEA 4CEZA 3I9ZA 2OPSA 4BRLA 3V1OA 1WEYA 4K25A 4JI8J 1N6QB 1RWMB 4PL7A 4KGZB 4C97A 3BP8A 4FNHA 3FFKB 1SCJB 2I6WA 3GLJA 4LFCF 1JMTA 1NSKL 3VGLA 3DM2A 4YDXA 4ES2A 3R5JB 3IAYA 2FPHX 4DB3A 1D9AA 2YNHB 3VAMA 1EQYA 4JEPA 1GOCA 4IZ9A 4FPIA 4ICLA 4RNFA 2DH9A 4ZPWR 2G9OA 1MN9A 2ZOGA 3Q8YA 1XN9A 2V0NA 3DI6A 4ZTFA 4TNOA 4O23A 5KFAA 2UXBJ 1D9DA 1N4LA 2EVZA 1RT6B 4IG3B 2AW0A 4OGEA 3A0IX 4DR4J 1DAXA 3CCMN 3NGDA 4DUZJ 3LDNA 4M95A 1OIAA 1VSFA 4U6PA 3WC2A 2XHWA 2P1JA 1LKZA 4HACB 1RTDB 3CMES 5I3UB 5GAHU 3BO3A 5I3PA 3N0VA 4UOCA 5AE1A 1CG2A 1E6YB 3TEGA 2KYXA 3D2FB 3DU6A 1EX4A 4PEOA 4FW1A 5DK5A 2QZ8A 3MR7A 3PYEA 1VSKA 4XEIA 3TNVA 3WXIA 5CZVA 3CF5Q 4O0NA 4CO3A 1I3AA 4C4WA 3RZAA 2W25A 3PJWA 2G8IA 3OW2M 1M5VC 1CC8A 1KC8T 2DEIA 4RNHA 1NK4A 3M8RA 2K8GA 4X64J 3LGMA 5DRKA 1HKAA 1YZ7A 3NGKA 3LPTA 4LSLB 5HROA 3JB9k 3DRRB 1RHKB 4GMKA 3TAGA 5D77A 3CDBA 4CFAA 1B4SA 1ESVA 3LUYA 4JP8A 3O80A 1ZBTA 1DHMA 5BR8J 1PJ5A 4ZVEA 1K6YA 1RAJA 2MSTA 3HFKA 3HHNB 2W6LA 2RRBA 5MAOA 1L5UA 3OYHA 5KTQA 5A8RB 4ZMMA 5D3GA 4NCGA 5CR4A 3ULDA 5KGWA 2F7TA 4RLEA 3MGJA 5E3AA 3S01A 3D45A 4DS5A 3UD4P 3V6KA 3OVAA 4DTOA 1ASUA 2F7VA 1S10A 3OFHA 3DLJA 1RABB 2XC9A 2JOQA 3JAMO 1N0UA 1NAQA 4KHQA 4EBCA 2NLWA 1LXJA 3AT1B 1IJFB 1OYDA 1R43A 4A48A 4M3XA 3C94A 2BANB 4IOAQ 2NZCA 3W66A 5AQMA 3CGIA 3CDWA 4ZLNA 1N6QA 3OY9A 2OTJS 2DO4A 2F5GA 4ED4A 4NLCA 2X1AA 2ZUAA 4GVBB 2FBXA 3ENBA 1UPPA 1J5OB 3K7RA 2WB1D 4BROA 1RKIA 1F60B 1RYSA 4H03B 3L0QA 2OD4A 2XMMA 2YNHA 5JICA 2A3ZA 4ANEA 1BIZA 4LT6A 4FJKA 5EX3A 4DFMA 1IH7A 1HW8A 4OL8A 1RTZA 4BC5A 1VCTA 4HWIA 2HRUA 3NS7B 3SSQA 1NLKL 5B09A 1VBYA 1RT6A 1IR0A 4IG3A 1RUSA 4RBVA 3LPEA 2ZH7A 3A13A 1QAYA 1SPBP 3HP6A 5I3UA 4ZK7M 5DM6L 3VR1A 3O1BA 5CA5A 2MQ8A 4FLVA 4WFAQ 4GKJF 3VQQA 1U02A 3D2FA 2GQCA 1ZBHA 3SAHA 3QSIA 2JH3A 4CRJA 3BF4A 4CO1A 1C1AA 3JTNA 5CXTA 3D28A 2P9UB 4WCEL 2CQIA 3ZC4A 4R5PA 4P75A 1Y5NB 2KN4A 2X6SA 3PSFA 4H4MB 1UW9A 2BQ3A 2CGLA 5KQDA 5T7LA 5J2PB 1KVBA 4WTYA 4KKOB 5MLCV 1RHUB 5J1NA 5DG8A 4UUXA 1V9OA 3I33A 4GVLA 4LSLA 4F0MA 2WVCA 4L3NA 2NUHA 3DRRA 1Y4ZB 3VQBA 4QZVB 4F26A 2ZJRQ 3PACA 3SPZA 2OMLA 3CJSA 4ECXA 2A1SA 3R3TA 3V4IB 1UVJA 4USUA 2JZ5A 5DG9A 2ILZA 4FWRA 2AV5A 1BWEA 4DU4A 4RTFD 3T7ZA 2DNLA 5A8RA 3PVXA 2J7WA 2UUBJ 1K47A 3SXLA 2EFOA 3OV7A 2C3OA 2LXIA 1XI1A 4F4ZA 4O5FA 2ZJPL 2QWRA 4MKAA 3L3CA 1RBLA 4RNOA 2CJAA 5D78A 1RDWX 1UFKA 3SUPA 2GMLA 3GIKA 1S99A 3C3LA 1ZA1B 3QQCD 4Z2XA 3EDRB 1JNZB 3LL3A 4KH4A 5KFWA 2W40A 5KFQA 4OQJA 3CCES 3N6MA 1YF5L 2D1KA 3OHAA 4EEYA 2UP1A 2PEHA 3DDKA 3UE2A 3G8SA 4M3ZA 3F73A 2IGIA 4Y0WA 4J2BA 1UP1A 2HS4A 3MR2A 2R8IA 4GVBA 4K0KK 1JX4A 5JLFA 1J5OA 2MQQA 4WQ4A 3KKRA 3SUQA 2CDRB 2XYGB 4OJ1A 3ATVA 3VENA 2EG1A 3CFOA 4CM0A 2N3LA 2PFUA 1VR6A 1XMOF 4CHNA 1C0UB 3X1LB 3SMSA 1NHKL 3H5SA 1RT4B 2RQ4A 2GIRA 1S97A 2J9DA 1GMWD 1R27B 1KC8O 2AYMA 3UDEA 2K3IA 3LPYA 3NCPA 2O8FB 2AKWB 2WTFA 4G9ZA 3ISZA 4E7HA 1TU0B 4DX5A 1KKHA 3GIIA 1VQLS 2YPYA 1VRUB 1KVJA 3KHLA 1R89A 3MAAB 3BDEA 2G2OA 2M70A 1JNRB 1B7FA 3ZEUB 3MN5A 1D9FA 4IRKA 3VQ9A 3M8PB 1K73T 2CQ2A 1D09B 4FSVA 4PYAA 5BRFA 5G4DA 2J9EA 4CBWA 2Z2LA 2B56A 2CJBA 2GMHA 1X4HA 4A8QA 2RUSA 2P9UA 1S7HA 2G2ZA 2PY5A 2KDOA 4H4MA 4KE5A 3JQKA 5J2PA 4KKOA 3DYAB 4WF9L 1IG8A 3T5LA 3SEOA 2KZZA 4DQPA 2ALYB 1NDPA 4BBYA 4H5NA 5GIPA 4KHNA 4QU6A 3DFEA 3PO5A 4B3SK 4BQLA 2IVNA 1Q5VA 4Y2IA 4IQXA 3V4IA 4FJIA 4CEEA 4C8YA 4CEAA 2NZ4A 2QLFB 4TXSA 5IC6B 3NS6A 1SVDA 3K0SA 1JLGA 1HNXJ 3J7YI 3ZT1A 3CFPA 2BH1A 5KT5A 4M94A 2HIYA 3VA3A 3HSTB 4A2AA 4PXCA 4DSIA 3E66A 5KQ8A 5T14A 2Q6BA 1BI4B 3P31A 1XMQK 3E01B 2PAVA 2XMKA 3OTOJ 4H5RA 4XH1A 2N4CA 3CXCR 5FPMA 4MO5A 3AVKA 1IV0A 4QCLA 4BE2A 4USTA 4YOXA 4C8ZA 4CTAB 3OL8A 3KHRA 3K9KA 4BRNA 4IH6A 1X4AA 1S0OA 3M2VB 3TSQA 3OL7A 2ZBRA 1Y5IB 1GTEA 3KLHB 2IAJB 1TMJA 4C1NI 4FJ7A 2XLIA 3GPAA 1DY3A 2GX8A 4BC7A 4H4KC 1L3VA 5KGXA 5F8NA 3GIMA 3CTRA 3PLAA 3IR7B 1JXVA 2GWKA 3W8GA 4CJSA 2OGUA 1RAFB 3SI8A 2C2DA 5EWEA 1YITN 4QS9A 4NLDA 2XI3A 4CI0B 5L1JA 5KFZA 2HVDA 2HS3A 3CJKB 4CHYA 5IOLA 2UXDK 2XNRA 3AA8A 3CJ8A 2ZC4A 2BGGA 1C0UA 3NY0A 1IJJA 1RT4A 1CQMA 3PHEA 2E5LK 3FSXA 3DLRA 1C4AA 2NSCA 1X0FA 5H1SV 2OLWA 2O8FA 4IYQA 5HRNA 2JVOA 4WK1A 3PYFA 3WEEB 4RPFA 5E3PA 3W9IA 4NLUA 2FYXA 4J2EA 4ED5A 5DM6Q 3MAAA 3HHLB 2CG8A 2DGUA 1HPMA 2ITMA 1KAZA 2AJ1A 3QGGA 3M8PA 1U8SA 4PAAA 3AGRA 2C2NA 3A5NC 4ZVQB 2M5YA 3D0HE 2Q66A 3KLGB 2BJEA 2K3KA 1C0FA 3KLVA 3PIPL 4WCEQ 2YNGB 1CJVB 4JKGB 1KTQA 4MK9A 2VDIA 4J9SA 2R4FA 1SKWA 2DCLA 3IBWA 3THXB 4DR1J 4KI4A 4HDGA 3DYAA 4NA3A 3RU0A 3DWLA 1K1QA 4Z7CA 3BKUA 2IVFB 2XMVA 1YAGA 3J81Y 4KB1A 1Z26A 2OTLS 1ZBFA 2QXFA 4NLVA 2ZVIA 2VWJA 4V19J 3NGTA 1DQ9A 1H2TZ 1N34K 3AVAA 3QSYB 1ASWA 3EYZA 4F4XA 2CDQA 2GJ2A 5DDRC 3CC4S 4C0HA 4DSKA 2GO8A 4TU9A 4M7XA 4K4UA 5CZ2A 2Q36A 4ATNA 2HAFA 2W9BB 3ETMA 3U9ZA 1BWVA 3E9LA 3K5OA 2ZJPQ 1JLEB 1RISA 3O2IA 3OLBA 4F25A 1U26A 3IFEA 2IHR1 1BI4A 4FYVB 2IRUA 2X1FA 3E01A 5ETMA 3MMVA 1KQGB 1QAXA 2ZGZA 1PGZA 1Q9XA 4FJ9A 3MPDA 2UV8G 3ENQA 1HPZA 2FHOB 2FLLA 2HHHJ 4CTAA 2FSKA 1S48A 1UKUA 4HH0A 4YHHK 3OJUA 3KLEB 3M2VA 5HRRA 5KG3A 4KYZA 3KLHA 4EI2A 3TVZA 4KPCA 4GV9A 1GOAA 4OV1A 3TARA 1F0XA 4FJ8A 4PKHA 2XSJB 1RXOB 4FKYA 3E51A 3T1HK 2MZTA 3QESA 2GCFA 3BSOA 2YKOA 3CJKA 4QU7A 3SBMA 3H5XA 4ELUA 4HT7A 1C0TB 4JI3K 3VVTA 2FGOA 5BR8K 1HYVA 3MTJA 3VTHA 2GA7A 1YHQS 2KZMA 3HZGA 3L9ZA 4LJMA 4UY8T 5AQTA 3WEEA 1BD6A 4EYHB 3NCQA 4J91A 2CPXA 4DU1A 2DCUB 2JFDA 2D0CA 2J7UA 4WFBL 3HHLA 3EUNA 3ZXWA 5KT3A 2VQFJ 3T1YK 4JHDB 3VGKA 4DV0J 1Q8KA 1MWMA 5K8NA 4ECWA 2B7CB 2DITA 5KRTA 3KLGA 4XDDA 4FWSA 2V94A 4J9LA 4NI2B 4ECZA 1SS6A 3F0NA 3RB6A 2YNGA 1CJVA 4JKGA 1IBLJ 1XEZA 2R7SA 2E2QA 4ZP9A 4OZLA 4QWEA 4DV3K 4A8XA 2QEXS 5CQGA 3W63A 1HNWJ 3THXA 5LL6d 5LOQA 4YB1P 2GV9A 1C2PA 2E20A 5MLCQ 4C8NA 2UUTA 2QWPA 3H25A 3TZXA 4PQUB 2Q79A 4NCBA 2HG4A 2L48A 1WEZA 5HI7A 4LSNB 2MZQA 4IJAA 4LD0A 5D6GA 1H0HB 2NXJA 4HR2A 2JC0A 1ZXOA 4WFYA 1XC3A 2KXNB 3TUPA 2R2RA 4USWA 1U2VB 4A59A 2W9BA 4B3SF 2CAJA 2HQ3A 3CJTA 2LQ8A 3CC4N 3NNHA 5KT4A 3IP0A 3LH2S 3T19A 2ZHOA 1YTYA 2M2BA 4CJRA 2IJNA 4DV4K 5D4LA 3OBWA 4DZDA 5HP1B 1R8CA 2HF3A 3DRSB 3HMJG 1JLEA 2RQKA 4NX9A 2HFZA 1UFLA 3GU0A 3H5UA 5EWGA 4E7IA 1OQ3A 1DQAA 3H20A 4QS8A 3QMLA 2B4PA 4K8RA 2E6LA 4PZVA 2KFYA 4GVEA 2RN2A 3VEZA 5AR0A 2D9OA 3SFGA 4YB6A 3FEZA 4OX9K 2QA4G 3KLEA 1WACA 1XMQF 2J9CA 1HARA 3RR7A 4CBUA 5M1FA 5KFLA 2FVPA 4KBIA 2XSJA 4CLFA 2IIRA 4BDPA 1FRMA 3MN6A 2E2PA 2E1AA 1U1KA 2D5RA 1AROP 4DSJA 2XLKA 1BC6A 3AGKA 3X3UA 5H9FK 4E1MA 2GAHC 2BVZA 2VJUA 4L75A 1SH2A 1KQSR 3DOKB 3ZSXA 3AVIA 1YHQN 1VSEA 2ZH8A 3QAUA 1S0VA 2XY8A 3T41A 2E5LF 2DVIA 1T9XA 5JMVA 2CQ1A 5B0GA 4G1QB 3P6YC 4JHDA 3M6XA 1OWXA 4JOUA 3J7AN 1A7GE 1TK0A 4IRCA 4CJEA 2IM3A 2EK6A 4BR2A 3TOQA 4FWQA 2G8VA 3NVMA 1LW2B 3WQUA 3Q22A 3VAKA 2JVRA 1YJRA 4N41A 1BHNA 4NI2A 3IDHA 3D0GE 4LF9K 2W9CB 2EBGA 2COLA 5KFJA 1Q86T 1AUDA 1T3VA 2FLPA 1VSIA 3OYCA 3GE9A 4JI8F 4P6QA 4WFNQ 2V2QA 1M5PC 4AHTA 1JCGA 3J81O 1GFWB 1WC0A 2QEXN 2CPYA 2D4WA 1KXPA 4V19S 2HB5A 4I68A 4PQUA 2QM1A 2K06A 3BSNA 1BHLA 2FXUA 4LSNA 1WKLA 4JN4A 1K8KB 4CFCA 2E9ZA 3TW0A 2FZKB 4A2BA 5J1EA 4Y28C 4RW6B 4U95A 1APSA 2QA1A 1RNHA 2W2OP 5AQKA 1BIUA 4CJQA 2B0GA 2BA9A 3NNCA 2W7AA 2G1DA 4WYBA 1X4BA 2KL8A 3F41A 2XY5A 3UN5A 5EVZA 3OL9A 4WKRA 2O1PA 2XBPA 2LQBA 3HCXA 3SCIE 5HP1A 3BREA 3DRSA 4DV1K 4HT5A 1FRXA 1NGAA 1BMQB 2VPXB 5ETTA 2VV5A 2HVZA 3KJFB 2M7SA 4UY8O 5F3TA 3MPYA 4B3RJ 2XMTA 4N5SA 1AW0A 3H1QA 2HZCA 2ZQBA 4CIOA 4DTSA 3OSNA 1QAJA 1ZH5A 1F5CA 3GFXA 1S0NA 3OYMA 4J9QA 4MO4A 4LF2A 3VGTA 3H4DA 1IWGA 1OO0B 3VMFB 4RL1A 2YX1A 3G9CA 4B1VA 2R7WA 4HTUA 3CCJN 2VD3A 4FW2A 2RS2A 1RBSA 2VASA 2MY8A 1FRHA 4YHHF 4YY3J 1U45A 4B9TA 3FVYA 4IO8A 3I5AA 5DETA 2Y0BB 2R8JA 3H40A 1VQ9S 3O3FA 2CPDA 4CLPA 4YDDB 3T1HF 4CLUA 4I69A 2I7PA 4CH7A 2DEJA 3AH6A 4LF1A 5H1SQ 3QT7A 4CEQA 3KOAA 3KDNA 4JI3F 1Y5LB 2XYPB 3LWLA 1QQMA 4A8WA 5BR8F 2HQCA 5A2QO 4X62J 2NZTA 4G1QA 3OBIA 4WFBQ 3UDVA 3KDOA 3PY8A 2F4VJ 3HT0A 4DTJA 4GC7A 5EGYA 3PFOA 1OPIA 1YQHA 1QVFR 3IG1B 4ILMA 1U09A 3SQ1A 1LW2A 2JJ4D 4RUCA 4LR7A 3Q8UA 3CCUS 3T1YF 5LJ3Y 2DNZA 1KR4A 2W9CA 2Y1JA 2HHPA 2PC6A 2CGJA 2J4RA 3CJRA 3CQXA 4M5LA 3TWZA 1QVGM 1RLDA 1RJJA 5KT6A 1T9WA 4EZ6A 4BRMA 1HWLA 1ZYQA 2M9KA 4HTJA 2HKEA 3MR3A 3SV4A 3UO0A 2KG0A 3B6OA 4DV3F 4JI1K 1FHTA 5U47A 3ZSVA 1K8KA 5A8WB 4LBPA 4RW6A 1M5SA 2RMLA 3SDEB 5FDLB 1N8RT 5L8RC 2XZTB 4IR9A 5AZIA 4XK8C 5GIOA 4OI6A 3JSBA 2VKZG 3GP9A 4JI5J 3M8WA 5RUBA 2IYGA 3FMBA 5KFGA 3OQ2A 2NYIA 3NKYA 4CI6A 1JLAA 5KFCA 4DV4F 2F8SA 4LUBA 1BQNB 3KHGA 5L1IA 2OFHX 1B99A 2CPJA 4QYZK 4OYXA 3W60A 4QR2A 3V9SA 1NNEA 2NRWA 4GKKJ 4E8UA 4F2SA 2WW8A 1QAIA 2B43A 2YQ1A 1U4BA 1YIJS 1E3MA 2QYCA 1YJUA 1IG9A 3CJCA 4YMEA 3GV7B 3J7AP 3AO3A 2BOPA 4OX9F 4ELTA 2ATLA 2FC8A 2A6OA 3BZQA 5E84A 2HMIB 4R