2WOMA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2womA05
4Y1CA 4E7HA 4YR2A 1HNIB 4CK2A 3VQ8A 3AVNA 4NLSA 3V6DB 2R8KA 3HHKA 1RA6A 3I0SA 5KFDA 2P5OA 2J6SA 4QWCA 3UIQA 4CFDA 3KKSA 2VG5A 3PW4A 3PX6A 2XY8A 4CK1A 5KFZA 4FCYA 4IRKA 2IC3A 4PWDA 5F8JA 2QK9A 3TAEA 1JXEA 3M9NB 2IM2A 3CIZA 4JS5A 5D3GA 4KI6A 4WXOA 3SFGA 2XRIA 2FJWA 1BI4B 4F50A 4NCAA 3AA5X 2G8FA 1IKVB 4FJJA 2PY5A 3VQ9A 1DLOA 4IFVA 2HWIA 1KSPA 3H40A 3ZSRA 5KGXA 2ZE2A 3NH1A 4J9KA 3JSMB 2FBXA 4RW8B 3FRZA 3NL0A 1RT5B 3HVTA 3G6VA 1KLNA 1RDCA 4HVJA 1NJXA 4YR3A 3DRPA 4NRTA 3F9KA 3BREA 3HPOA 1YVFA 3OL6A 5KFTA 2E9ZA 2FJXA 5F8NA 1SH0A 4DTPA 4K8XA 1S4FA 2FBVA 1Z25A 4KO0B 4FJ5A 3HJFA 2D0BA 2Z1JA 1C1AA 2HVHA 2IM0A 2D3UA 3DOKA 4O4GA 1NKEA 4FLTA 3N6NA 2JEFA 4TSXA 3DM2B 2JEGA 3RMBA 1BCOA 4WE1A 4KFBB 4B3OA 2OPSB 4NCBA 5DG9A 1JLEA 4CGFA 4ELUA 2R7YA 1FKPA 5DQGA 1WSGA 2XY7A 2JLEA 4YQWA 1J9AA 1RT4B 3CFPA 1KFSA 3ALYA 4ID1A 2XGQA 3QETA 3SFUA 3FFIB 2XWYA 3GIMA 4ECVA 4FLYA 1HNVB 4MH8A 3QZ8A 2ASLA 4LQ9A 5KT5A 3VQBA 2C28A 4CIEA 1HYSA 1T8EA 4YNQA 2XY5A 4UQGA 2HHWA 2KFZA 3PUFA 4F3OA 2WHOA 1HQUB 4OLAA 4B9MA 3PW7A 3VQ4A 4NLRA 4CEFA 4ID5A 3HVAA 1X9WA 3CJ0A 3D28A 4H54A 5L1LA 4CGJA 1VSJA 4N76A 2O4GA 1HMVB 2ILZA 1Z26A 3DRRB 4DF4A 3QGGA 5DG8A 2IM1A 4HKQA 3OS2A 2KTQA 4WYWA 5KFGA 4N47A 1QUVA 2UVWA 3SUPA 1TK5A 5C24A 2QE5A 4CF2A 2HNDA 1CZBA 4CERA 4DF8A 1RT2A 5HLFA 4Y2CA 4DFPA 3PW5A 2HNZB 3DYAA 3KLIA 2DFEA 3AVHA 4AILC 1DTTB 1DTQA 3NGYA 4F2RA 4ED1A 2R8JA 2E4LA 4G3IA 1HNIA 4IKAA 3L3UA 3SYZA 4ED6A 3V6DA 1XC9A 1TKTA 1KHVA 2R8GA 2A1RA 1JXLA 3MAQA 3EPIA 4Q0BB 4WXWA 3ULDA 1VSIA 4AHVA 3C94A 2RPIA 4JLHA 1S0NA 3ZT4A 1KVCA 1D5AA 2P51A 5CYQB 4FK2A 4EP5A 4LD0A 4CCHA 4NLXA 1JIHA 4FW1A 4NLUA 4IR9A 2B43A 3BQ2A 3C6UB 3C6TB 4O0IA 5KFEA 1B92A 1D8YA 1IKXA 1QSSA 3SI8A 1XHZA 5J2MB 1WSFA 4FJGA 2GIRA 1IKVA 5F8HA 3AO1A 1NK0A 3I5CA 1Q9YA 4IRCA 4ZTFA 2X78A 3SPZA 1C2PA 1RTIB 2GV9A 3G6YA 3CO9A 4FLZA 3JSMA 3G6XA 3RMAA 4RW8A 5DQHA 4CIFA 1U49A 4IG3B 1RT5A 1IKWB 3Q8QB 4O55A 4DG1B 3SUNA 1NHUA 2XY6A 1X9SA 4CFBA 4OKJA 5KG7A 3NAIA 4RU9A 5KFAA 3PHEA 2R2SA 1K1SA 4NLQA 4DU3A 4KO0A 2W9CB 3MR5A 5KFUA 1I6JA 3SUOA 3QEXA 2Z1IA 3E51A 5KFKA 3K5LA 1VSKA 2P1JA 3K5MA 3DM2A 3QIOA 1C1BB 1KHWA 4KFBA 2OPSA 5FRNA 3AVMA 3S3NA 3HVRA 3C95A 2AGOA 4B9TA 1REVB 1IM4A 3BGRB 5HRPA 1GOCA 3NBPB 3KK2B 4MIAA 4CEEA 5HP1B 1RT4A 2WTFA 4F4WA 1EKEA 2FVRA 3QESA 2R2RA 4KSEB 3FFIA 3KHRA 4ED0A 3SV3A 4LSLB 1NJZA 5T7BA 1J53A 5JXSA 1C1CB 4Q8EA 4M3WA 3HSTB 2WONB 1HQUA 4CK3A 4KAZA 2B4JA 1HPZB 4R8UB 3AVCA 3U6FA 1S1UA 2AX0A 3IGNA 4B9VA 2FVQA 4Y2AA 2QKBA 4NLYA 1TL1B 3ICLA 3EPGA 4J9SA 1SL0A 5KGWA 1BCMA 1HMVA 3DRRA 4CF8A 5DK5A 3VQAA 3TAFA 1UA1A 2Y1IA 4RNMA 3V6JA 4MKAA 5KTQA 4DFMA 1Q9XA 3LP1B 4RNNA 1RBVA 4QAGA 2UUWA 4CGHA 4J9OA 3ZSOA 3D5MA 3HP6A 3L3VA 4WFZA 2HNZA 2OPRB 1L5UA 4BWMA 2GUIA 1JLBB 2HHVA 1DTTA 4O3OA 1TQLA 2VG6B 3MXIA 1QAJA 4KKOB 2YHAA 3H5XA 3NGDA 3LZIA 3L8BA 1QSLA 1MMLA 2OYQA 3H98A 4EO6A 2D0CA 4N56A 1NNDA 1XR6A 2Q3SA 1RT3B 4ELVA 5HROB 4ECTA 4FZZA 5HRRA 4ECRA 4YFUA 2ASJA 5J1EB 5CYQA 3IAYA 3A2FA 4CEQA 4DSIA 4MQ3A 3DLRA 3C6UA 3C6TA 4CHPA 1NJWA 5KFBA 1X1PA 4R0EA 3CVKA 5KT2A 4Y34A 5J2MA 2YNFB 3LDSA 1YTAA 5J2PB 3VQEA 3VA3A 1HJRA 3OLBA 3WNHA 1WAJA 3QEIA 4W5NA 3HPGA 5E41A 1S48A 4EBEA 1NOZA 1RTIA 1S9EA 3OY9A 2DPJA 1EP4B 5EWGA 5FDLB 3DLKB 3EYZA 4N41A 4Z4CA 4IG3A 1IKWA 3RRGA 2HHTA 3RB6A 4OGEA 2VWKA 4DG1A 2G8IA 4DSFA 2VA2A 2YKNB 1RBUA 2DFHA 1WSJA 2W9CA 1VSMA 2AX1A 3UDLA 5L1JA 4W5RA 3THVA 1BQNB 1U45A 4QWEA 3QEVA 1LWCB 3V1RA 4BE2A 3NH2A 2BGGA 4NLGA 1C1BA 4FVMA 3IRXB 4K4UA 2FC0A 4FLXA 2FVPA 2ASDA 4WZMA 4KREA 5L1IA 3SV4A 4F4KA 1FKPB 1CXQA 4RG8A 3V9UA 4CHZA 4B9UA 1REVA 3V6HA 3BGRA 3NBPA 3KK2A 3V6KA 5HP1A 3CJ5A 3BQ1A 2C22A 3V9ZA 4K4YA 1BGXT 3E01B 3QEPA 1C6VA 4FLUA 3TANA 4ICLB 4K4WA 4KE5A 1T03B 4PUOB 4Y3CA 5EU7A 3KLGB 4LSLA 1N4LA 4ZPDA 3CFRA 1C1CA 4FS2A 2RF2B 1RAJA 2WONA 4I2PB 1TK0A 1UA0A 1HPZA 4R8UA 4RW9A 3FQLA 3WNEA 3VQ5A 4OLBA 3DLGB 3OL7A 4QCLA 4FLWA 1ZBUA 1S0MA 1TL1A 4XIUA 3RRHA 4MK8A 5T14A 1CSJA 4EZ9A 1NK4A 3FQKA 3VQQA 4LH5A 3ZT2A 1X9MA 4FJMA 3PX4A 1WSHA 1RBRA 4E7LA 3LP1A 3V1OA 4J9PA 4DL5A 1U04A 2WCXA 5C5JA 2OPRA 3EY1A 4OJRA 3HL8A 1JLBA 4DSLA 5KRSA 3SQ0A 4IH6A 4HUGA 4O3PA 4ECXA 3T5LA 2QV6A 4ECWA 2VG6A 1SV5B 3TWHA 3S9HA 4J9LA 2Z1HA 4KKOA 5DG7A 3VA0A 1TKTB 4AHCA 2W42A 4HCCA 2BE2B 3LAKA 3CDWA 4OL8A 4IH7A 4Q5VA 2ITGA 1RT3A 5HROA 4URQU 3EZ5A 4BE0A 4KHNA 1T7PA 5J1EA 3U3GA 3M8SA 2A1SA 1YT3A 4MK7A 4DTXA 4ZVGA 1LW2B 5F8GA 2V4RA 4CF0A 3AA4A 4Q8FA 4E7JA 1IKXB 2JEIA 1S97A 1JLFB 1LWFB 3MEGB 2YKMB 2YNFA 4TYBA 4I9LA 1QS4A 4WFXA 5J2PA 1N48A 3RBDA 3RMDA 1WN7A 1TL3B 3BSOA 4FK4A 1W25A 2IOCA 1TKXB 4QW8A 4KHRA 1WNSA 4ZP7A 1EP4A 5FDLA 3DLKA 3NF9A 5F9LA 4JV0A 2X6SA 1S1WB 2HAIA 4WYLA 1U09A 2YKNA 1BL3A 1IKYB 4PQUB 4IOBA 4AHRA 1RILA 4O5BA 5F8LA 3QNOA 1VRUB 1T3NA 3GIIA 4RNHA 2QKKA 1VK0A 1BQNA 4QWBA 1LWCA 2UVVA 4KHWA 1S1TB 3SCXA 3IRXA 4M3TA 1D9FA 5KG6A 3ZSXA 4CJFA 1YTUA 4Q44A 4IQXA 1KTQA 1XR7A 4GMJB 2ZQBA 4HTUA 3SI6A 3H5YA 5FRMA 3KHHA 4HYKA 1UWBB 5KG3A 2HHQA 2CJQA 3HO1A 3E01A 3CDUA 4ZPAA 3ZSWA 4ICLA 3CFOA 2E6MA 4K4TA 4HHTA 3IN5A 5L1KA 1T03A 4PUOA 1TVRB 3KLGA 3TVKA 4KTQA 1I3AA 1N56A 5KFHA 4DS4A 1SKWA 2RF2A 3LPUA 4U6PA 3CWJA 3S3OA 3VQ6A 4I2PA 4OKEA 4JS4A 4EZ6A 1RDRA 3BR9A 4TY8B 1S1UB 5HRSA 3DLGA 3LANA 1JKHB 4M94A 3OHAA 4QOZB 3K5NA 1UAXA 3O3GA 2XHBA 3MFHA 1QTMA 3CJ3A 2HMIB 3OSNA 4RUAA 1LAVA 2W8LA 2IS3A 4ED2A 3GIJA 3BSNA 1S9FA 1LW0B 4QPXA 1NKBA 3ITHB 2C2DA 4K4XA 4ZP6A 3KHLA 2FLNA 1XR5A 1K6YA 1LAWA 3MR6A 3ISND 1RT6B 3RAQA 3KLHB 1RDDA 1SV5A 1D9DA 4FJIA 3I8DA 2ZKUA 2HW3A 2PYJA 3T5JA 3T1AA 4IBNA 4KRFA 3MEEB 2BRLA 2BE2A 3O4NA 3NF8A 3NKYA 3OL8A 3OSPA 1TP7A 2JC1A 2WOMB 4QWDA 4W5OA 3OYIA 2FVSA 4RNOA 1KLMB 3IGVA 3F73A 2HB5A 5DLFA 1LW2A 3MR3A 4CJUA 2PYLA 2FVCA 1S1VA 2F8SA 1JLFA 1LWFA 3MEGA 2YKMA 3ZSVA 4M45A 1U48A 5KFPA 1TL3A 1RT7B 1ZBHA 4RW4B 2OZSA 1TKXA 2JC0A 4RW7B 1S9EB 4KB0A 3BJYA 4J2AA 1GX5A 4IR1A 4CEAA 3V4IA 4GC6A 3AVIA 4CJSA 4J2DA 4BWJA 1ZETA 3H5SA 4GVMA 4DSJA 4ELTA 1S1WA 2YNGB 4DFKA 5KFYA 4CEBA 1IKYA 4FYDA 4PQUA 3SUQA 5HRNA 1S6PB 2KZMA 1RNHA 1SH3A 1VRUA 5KRTA 4QW9A 3NAHA 4J9QA 4AH9A 4MK9A 3HP9A 1F21A 2AQ4A 3CDEA 2R8HA 5KFSA 5I42B 3KNAA 4IDKB 4DU1A 3HT3A 1S1TA 1L3SA 1D0EA 4CEZA 3AV9A 2IA6A 1VSHA 3BQ0A 4FJ7A 3IG1A 5FROA 4RW6B 3OS0A 4LY7A 4KHYA 1UWBA 4Z0UA 3NGIA 2VG7B 1S5JA 2Y1JA 3OJUA 2OZMA 3LP0B 1BIUA 1XHXA 4DL4A 4EEYA 4CJ3A 2JEJA 2RKIB 4CE9A 1ASWA 2JGUA 2IDOA 1TVRA 4K8ZA 3NMAA 2E9TA 5KT3A 3M8QB 1S0OA 3NHGA 4JRPA 4M95A 4RW9B 2V9WA 3VN5A 4TY8A 1O1WA 4C8LA 1QQCA 1JKHA 1WAFA 4JV2A 3PR5B 3BSAA 3PO5A 4Y1DA 3VQ7A 4AHSA 3DMJB 2NUBA 2HMIA 3ASMA 4ZTJA 3DDKA 4CFCA 1RBTA 4CEOA 3K58A 1LW0A 4DL7A 2XO7A 1CZ9A 1ZYQA 3ITHA 3JYTB 1HARA 4DQSA 1S1XB 1ZBFA 5KFIA 4DQQA 2X6NA 4B8AB 2HNYB 1RT6A 3TR8A 3KLHA 2D5RA 4NYFA 1D1UA 4KPYA 4O3NA 2OPPB 4CJEA 3B6PA 3OJSA 4M41A 1KVAA 2B5JB 3GV8B 4ZVFA 2OPQB 2W7OA 1JX4A 1TAQA 4OVLA 3ISNC 3LWLA 3MEEA 4KHUA 1BHLA 4NLOA 4CJLA 2HHSA 3KK3B 4KHMA 2W8KA 2WOMA 3Q8SB 2B6AB 3ZSYA 3P5JA 2C2RA 4AHUA 3LZJA 2P5GA 4M3XA 4EP4A 1RYSA 1GX6A 1KLMA 3AVGA 4H4OB 4CJVA 3CM6A 4CIGA 1L3VA 4CHYA 5CY4A 1QSYA 4FJLA 4R5PB 3PO4A 4CEDA 5EWEA 4DQPA 3K57A 4TYAA 2D7SA 1RT7A 2XCPA 3O3HA 4RW4A 2DFFA 3UQSA 4RW7A 4ZP8A 3GV5B 2XI2A 4E1NA 4J2BA 3AVAA 4F4YA 1TV6B 3KKRA 4YMEA 1NK7A 2VWJA 2WRMA 3KLVA 3DOLB 4KBIA 3AVKA 2YNGA 3H08A 1W0HA 1JL1A 3MECB 3H5UA 3HVWA 1S6PA 4ECUA 1IO2A 4CF1A 3D45A 3NDKA 3V9XA 4FS1A 2I1RA 4Q45A 1SUQB 3OYGA 5I42A 4IDKA 4GC7A 3V9SA 3QGHA 4DLEA 1RTDB 4FBUA 4ECYA 2UUTA 2G8HA 4FM2A 4TXSA 1T05B 4KB7A 2E6LA 1T94A 2X74A 4RW6A 3AO5A 4TY9A 4EBCA 1QE1B 1RA7A 4ZHRB 4NYNA 4FZXC 1JLAB 2VG7A 2KQ2A 4NYZA 1ITGA 3LP0A 1KVBA 4FJXA 2OH2A 4CJKA 2RKIA 1LWEB 2RDJA 3ZT0A 3QINA 5JUMA 3AO3A 4CJPA 3IS9B 2O4IA 3M8QA 2GBZA 3BSCA 1L3TA 3TQ1A 4HCBA 4O3QA 3AA3A 5DGBA 2IAJB 5L9XA 4DQIA 3M9MB 4M3YA 2VA3A 3MR2A 3M9OB 4ECZA 1NK9A 3DMJA 5DGAA 3PR4A 4IKFA 4FXDA 4ZPCA 4RUCA 2R2UA 2IJFA 3JYTA 1HQEB 5KFJA 1S1XA 3S3MA 3DRSB 1FKOB 4BDYA 1N6QB 1VSDA 3QYYA 1VRTB 2G8WA 2EC0A 2HHUA 2D0AA 2HNYA 4DSKA 2J6UA 4O44B 4B08A 1WLJA 3I5AA 4F2SA 3I0RB 4DTJA 3QIDA 5DMRA 2OPPA 3I5BA 3AVFA 3ZSQA 5F9NA 2B5JA 4DL3A 1U47A 3MTKA 3DLEB 1KFDA 2OPQA 4IFYB 4B9NA 1N5YB 4DU4A 3P1GA 5KG2A 4G1QB 3KK3A 4FBTA 4YP3A 5J2NB 3CJ2A 3AVLA 3SNNA 4J9NA 4L8RB 1J5OB 3GYNA 2B6AA 3H4BA 1QAIA 2YNHB 4H4OA 3KIOA 1RTHB 4E1MA 1S1VB 4K4SA 1GOAA 2RN2A 3QIPB 4R5PA 3CQ8A 3MEDB 2YV0X 3TAPA 3QO9A 3PVXA 4KTZA 3RTVA 1TV6A 5CZ2A 4E7IA 2EX3A 3V4IB 4JUZA 4CJWA 3MF5A 4CECA 3OYHA 3K59A 4TQSA 5KFFA 3AA2A 3DOLA 3OYBA 5KT4A 3DI6B 1RTJB 3OYFA 3MECA 5KFMA 1TK8A 4MIBA 4Q43A 3QZ7A 3T19A 4I9QA 4ED8A 4NCGB 4BDPA 3SQ1A 3CG7A 1ASUA 3RB4A 1SUQA 2C2EA 4FJ9A 3QERA 4OPJA 3OYAA 4NLWA 1ZTWA 3PW0A 1VSLA 1TKZB 1RTDA 2AWZA 4ED3A 2UVRA 5KFOA 3IG1B 3ZT1A 1T05A 3RB0A 4MKBA 4QWAA 4DLGA 1JLQB 1QE1A 4ZHRA 5KFNA 3LP2B 1JLAA 1S49A 3OL9A 3GIKA 4CF9A 3PX0A 4XPEA 4E89A 1LWEA 3DLHA 2I5JB 4EBDA 2LSNA 3IS9A 4O3SA 4H4MB 2O5DA 1EXQA 1XI1A 3L2QA 3TAMB 5KG5A 3HK2A 1SKSA 4C8NA 3TAGA 2IAJA 4NRUA 1IH7A 4I2QB 2D41A 2ALZA 1XWLA 3G10A 3OYCA 4F3TA 2DY4A 3KLFB 5EUHA 3QEWA 4IH5A 2HHXA 3PZPA 1WSEA 4MFBB 3KMQA 3MXMA 3AO2A 3OYDA 4CHNA 3KMSA 2D3ZA 5F8MA 4KV8B 3UR0A 3AO4A 1FK9A 1MU2B 1FXXA 3TABA 1HQEA 5KFVA 3T5HA 3DRSA 1FKOA 2F8EX 3H59A 4FM0A 1N6QA 1VRTA 1BISA 4N5SA 4O44A 3N6LA 4Z4FA 4AHTA 4CJ4A 3I0RA 3OYKA 1TGOA 3KJVB 3Q8PB 4RZRA 4CFAA 4ZP9A 3SQ4A 4PY5A 4C8OA 1C0TB 4DTOA 1NK8A 3DLEA 4GW6A 2IBKA 4IFYA 1N5YA 1RCHA 4FW2A 1JXBA 3EZUA 5KFRA 2Z1GA 3SQ2A 2ILYA 4KHQA 4DFJA 1NKCA 4FK0A 3T5KA 4G1QA 3PW2A 3CYMA 2RDIA 4LH4A 5J2NA 1J54A 2AGQA 3GILA 2ATQA 1J5OA 4X2BA 4TQRA 3N6MA 4NLDA 3K5OA 2V4QA 2YNHA 1BIZA 3HM9A 3CM5A 1RTHA 1RDBA 3NFAA 3HKWA 1G15A 4EYHB 1A5WA 3NF7A 3B6OA 4DS5A 2G8UA 3QIPA 3MEDA 4E3SA 4FJHA 3KD1E 4KB1A 2BANB 3PJWA 4BE1A 1BQMB 3NE6A 4DTNA 4TLRA 5KFWA 2BRKA 3M8RA 1HYVA 5KFLA 4CESA 5SWMA 1C0UB 1BI4A 1KCFA 4OPKA 4ECQA 2GIQA 4ECSA 4FM1A 3HPHA 4CJRA 4BDZA 4CJ5A 4J9RA 3O4QA 3DI6A 1NK6A 1RTJA 4M3RA 4CGIA 3HXMA 4XO0A 3AVBA 5KG4A 1IG9A 1SH2A 2HVIA 3OYLA 3CJ4A 3GV7B 3RR8A 4FJ8A 3RBEA 3OYJA 2ETJA 4DMNA 4NLTA 4NCGA 4O4RA 2BDPA 3KHGA 3DLBA 3OHBA 2BQUA 3OYMA 2V0NA 4IRDA 1ZTTA 4DTRA 3KLEB 1CLQA 4E0DA 4HUEA 3H2LA 1B9DA 3HYFA 1TKZA 4ED7A 1EETB 2YNIB 5C25B 2WK4A 1NOYA 4FJKA 5CYMB 4KAIA 4RNFA 1Q8IA 2PZSA 3V81B 1JLQA 2F8TA 3OYNA 3LP2A 3M8PB 1RDAA 1S6QB 4I7FB 5J2QB 4LQ3A 5KFXA 4CJQA 3LP3A 2XCAA 4KHSA 2I5JA 4DTUA 4NLPA 4E19A 4H4MA 1LV5A 4CHQA 1RBSA 2KW4A 2AJQA 1ZBIA 1OS5A 3NAEA 4F4ZA 3TAMA 3QGIA 2W7PA 5C42B 1HNVA 1JLCB 4I2QA 3V9WA 5KT6A 3V1QA 4CGGA 4B9LA 4F4XA 4B9SA 5DQIA 2W9BB 3G86A 4W5QA 3KLFA 2R2TA 2HWHA 3FDSA 4W5TA 4BACA 4LSNB 4JRQA 4MFBA 4JV1A 5JS2A 2G8KA 3PV8A 4IG0B 3KK1B 4M42A 4KTWA 4Z4IA 3L2RA 1S9GB 4KV8A 3T3FA 4KI4A 1K1QA 1GOBA 1MU2A 1HRHA 3L2WA 3ZSZA 5HBMB 3SJJA 1R0AB 4K4ZA 1I39A 2XGPA 1JLGB 5I3UB 1Z4UA 4DL2A 2ZD1B 3WNFA 5EDWA 5KT7A 2J6TA 4WZQA 3KJVA 5K14B 1JL2A 4K50A 1C0TA 3KTQA 4O0JA 1YVUA 1RT1B 2XC9A 3QLHB 4O3RA 3LPTA 1TKDA 2KZZA 2WB4A 4EO8A 3VQDA 3NF6A 4E7KA 3RWUA 3Q8RB 4C8KA 1WNEA 2IM3A 1QHTA 3I0SB 1L3UA 2BR0A 2F96A 2XI3A 3TI0A 4PA1A 5DLGA 2R8IA 1B9FA 2VG5B 1C0MA 4Z4GA 4Q0BA 3QNNA 4XPCA 4WFYA 2W9AA 5KG0A 4OKKA 4F8RA 3QO9B 2IC3B 4ZMMA 4PWDB 1U4BA 3NH0A 2BANA 3SPYA 1BQMA 2UVUA 2IJNA 5D3GB 3L2VA 4URGA 3KOAA 1UOCA 1C0UA 4NLVA 2FLLA 5KFQA 5KG1A 1DLOB 2OA8A 4IFVB 4FLVA 4ZVHA 3ZT3A 1SL1A 1TAUA 1EX4A 3FSIA 4B8CA 2ZE2B 4M3ZA 4CHOA 5JS1A 1NK5A 3O3FA 3K2PA 4FZYA 4YR0A 2FLPA 4DTMA 2BQ3A 4DSEA 3HVTB 3D0PA 3WNGA 2FJVA 1A5XA 4FJNA 3DRPB 1ZBLA 3MXJA 4K4VA 3ZCMA 4M3UA 1NHVA 3AVJA 3VQCA 3U3YA 2FBTA 4Z4HA 1VSEA 4HUFA 3KLEA 5EWFA 3NGZA 1EETA 2YNIA 5C25A 3RAXA 3VQSA 4U7CA 5CYMA 3DOKB 4O4GB 1NJYA 2BQRA 3PJXA 3RR7A 3V81A 3L2UA 5CZ1A 3BDPA 3M8PA 4WE1B 3TARA 2QXFA 4B3OB 1CXUA 1S10A 1S6QA 1JLEB 3LWMA 4I7FA 1WSIA 2YHBA 5J2QA 2ATLA 1Y97A 1KRPA 3OYEA 4ZVEA 4CGDA 1VSFA 2E9RX 4H8KA 2DPIA 2FBYA 1A5VA 5KFCA 3RMCA 4CJTA 4J2EA 2IGIA 3H4DA 5KI6A 5SZTA 3OLAA 1ASVA 3TAQA 3OS1A 5C42A 1JLCA 4DWIA 1HYSB 4TN2A 2IMWP 2W9BA 2EHGA 4ZPBA 4Z4EA 3LAMA 2AGPA 4LSNA 4NZ0A 3NCIA 2DTUA 4ID5B 4DL6A 4IG0A 4C8MA 3KK1A 3PY8A 4DQRA 2AU0A 1S9GA 3OVNA 4URSA 3MFIA 1SL2A 1FK9B 5HBMA 1R0AA 3RB3A 1HYZA 1SKRA 3P83D 2CKWA 1JLGA 5I3UA 2ZD1A 5C24B 2G8VA 3LALA 3UPFA 1W9HA 2HNDB 2KFNA 1RT2B 5HLFB 2GC8A 4EYIB 5K14A 3VQPA 3G0ZA 4DTSA 4J9MA 3DYAB 3KLIB 3GQCA 4OGCA 3KD5E 1RT1A 3QLHA 4DEZA 1DTQB 3SZ2A 1RYRA 5F8IA
chains in the Genus database with same CATH superfamily
2ZGYA 3MMAB 4DU7A 1RISA 3I4HX 1J6ZA 3P49B 2B9EA 4E7HA 1M1KO 4YR2A 4CK2A 2I8EA 4KGKA 3AVNA 3V6DB 5BR8J 2R8KA 2GX8A 5HO4A 2CQPA 5KFDA 5MAOA 3BKUA 5IZHA 2JZ5A 3KKSA 3QBCA 4P71A 4TLQA 3CNQP 2M88A 3Q24A 4A5BA 2AZ3A 1RKJA 2HF3A 2BKOA 3M9NB 2Q6CA 4JS5A 2M2BA 1OKJA 2Q0UA 4FYVB 3SFGA 1TTHB 2FJWA 4YOEA 4NMXA 1VQLN 2G8FA 4CBWA 2PY5A 3VQ9A 3R1LA 4BR2A 3THXB 3MGJA 1DY3A 2ZM6K 5LJWA 2JH3A 3ZSRA 5CZVA 5KGXA 1KQKA 3GB0A 1IBCB 3SQOP 2UXDJ 1QVGM 1Z2LA 1Q0NA 4JD2B 1V5VA 4RUBA 1RT5B 4CO4A 1FRXA 2G0JA 3PTWA 3F9KA 3HPOA 1YVFA 5KFTA 4PHTX 4LF1A 4DTPA 4B1YB 2KO1A 3FEZA 2E29A 4KO0B 3HJFA 2D0BA 2G13A 1B7FA 4AL6A 3O5BA 1N5VA 2ZC3A 3T1HK 2DNYA 2N4DA 2JEFA 2M8HA 3DM2B 3CTRA 2JEGA 5CYJA 4WE1A 4QU6A 4B3OA 2HIYA 1N0UA 2ZUGA 2HPUA 2RHQB 2WVDA 4ZA1A 4DR2K 2JLEA 4JK8A 4LFBK 2D9PA 3SFUA 4FLYA 3DXKA 2H5JB 2NQPA 4DV2J 1OY8A 4NO7A 4LQ9A 4CIEA 1PC5A 1QQOA 3EJMA 5BR8K 2ZJQQ 4F3OA 1VK8A 4J9UE 3DU6A 2HRTA 3MM5B 4MKYA 4NLRA 2HFNA 3GONA 1X9WA 1I5OB 3CJ0A 1QAXA 5L1LA 3ILOA 2Q97A 3FBFA 4XK8C 1WOOA 4E98A 5DG8A 2IM1A 4WYWA 3NNCA 4E8UA 5KFGA 1UVJA 3W61A 2UVWA 4MO5A 1TL7B 4HI1A 2LLZA 1M90O 3S6EA 3Q22A 4NXMJ 1RT2A 3G25A 4DFPA 3PW5A 4JK9A 3BUZB 4AILC 2RNEA 3OR1B 2C3MA 4X4PA 2C42A 1RGIA 1PC4A 1YF5L 1K47A 2UXDK 4IKAA 1G7CB 1M5KC 4B3MF 4ED6A 5LOQA 1XC9A 3DRXA 2CGJA 4WXWA 4AHVA 4E2FB 2RPIA 4QIFA 3P38A 2OTLN 4CCHA 4LD0A 3W60A 2F4VJ 3QICA 4BRNA 1BLUA 3BQ2A 4ZK7M 5KFEA 2VWBA 1B92A 4UY8O 3KG0A 1UFKA 1NK0A 1HNZJ 2IIHA 1VOMA 2HKEA 3SBMA 4RW8A 3OBYA 4K0KF 3OVBA 1GFWB 2JVOA 3CD7A 2DGOA 2UUBF 3H2UB 1EO1A 2XY6A 2V7ZA 4JI2F 3MAHA 3I56N 1F60B 4DV2K 2DNNA 4RU9A 5KFAA 3AY9A 1K1SA 4DU3A 3W7BA 1UCNA 2HHHF 4LF6J 2W24A 1HLUA 1GMWD 2Z1IA 2M8DB 2Z56B 2DHSA 1VSKA 3K5MA 4KY3A 3GBTA 3R97A 3BV8A 3AVMA 3CI5A 3HRGA 4C11B 3AGKA 2RUGA 3FGVA 2ZH9A 3HVRA 4X4RA 1WHYA 1REVB 3M1FA 4NXMK 3BGRB 5IT4A 3BO3A 5HRPA 3KK2B 3TOQA 4CEEA 3ZTRA 1VI7A 4PYAA 1T9XA 5AQXA 1EKEA 2QA4N 3TTDA 3KJNB 1PIEA 2OJ3A 2Y8YA 1YJ7A 3FFIA 3KHRA 1VQLS 1NGEA 5A8KA 3R27A 4Q8EA 3PG9A 4IEEA 1XC3A 1HQUA 4AUKA 1HPZB 3AVCA 1FE0A 2XSFA 1IWAA 2AX0A 3NGUA 2APOA 4Y2AA 4FWRA 4NLYA 2MB0B 1OH6A 1F5AA 1SXLA 1T9UA 1UA1A 3W66A 2VOOA 4MKAA 4AXIA 3D4JA 2ZKTA 3L4BC 5EVZA 4C0BA 4ATNA 1Q9XA 3WEEB 2B7BB 3NGSA 1RBVA 4YN3B 1TMJA 4BR7A 3ZC4A 3K9JA 4LBHA 3HP6A 1FFWB 1CQMA 2AZ1A 3C15A 2QW9A 4DV7J 1HNZK 1DTTA 4WCEL 1LEOA 5BYSA 1S99A 1TQLA 1NH7A 1GT8A 2JRSA 4OZ5A 1QAJA 3LL3A 4CD1A 2DHAA 4L72B 2GFFA 3J7YI 2ASPA 2YHAA 5E26A 4DB3A 3H98A 2R7TA 2CWXA 1TZ0A 4HTIA 4PXCA 1SZ2A 4USIA 4XH4A 4K41A 1HW8A 4DSIA 1GTEA 2FSKA 4LF6K 2MDAA 2L9NA 3D68A 3M2RA 2DNPA 3C6UA 1WF2A 3C6TA 1NJWA 3GFZA 3PRBA 4R0EA 4F04B 4XH1A 2CG4A 3DWLA 3VQEA 3VA3A 2MGZA 1HJRA 3JQMA 3OLBA 3WNHA 3DN9A 4BC9A 5M2PA 4W5NA 1HHSA 1S48A 1K73O 3TSPA 6AT1B 1RHMB 2FB0A 5M1FA 3P4UB 4CT9A 3DLKB 4X66J 4B3TF 2R7SA 3CJBA 4IG3A 3RB6A 1HKCA 4OGEA 5GAEI 2P9PA 2G8IA 3J81U 1N8RO 2YKNB 2PIIA 3C14B 4IXCA 3H2VE 3WX8A 5ADXA 1ULRA 4P72A 3MUVP 2W9CA 3LDQA 3KG4A 2QA1A 1RFQA 1I1GA 5AXKA 3PDNA 4LF8F 3QNWB 2BGGA 3NH2A 3O9RA 3FSYA 3O1LA 3TP2A 4K4UA 4RKUC 5L1IA 1U26A 3WIVA 2LXFA 2KJWA 3M32B 4CHZA 1VRQC 1Q5YA 3NBPA 3V6KA 1NXIA 5I3PA 1T6CA 4K4YA 3N0VA 4DV7K 1X4GA 3GG1A 2IVOA 4K4WA 1XNQF 3VENA 1Q86O 4PUOB 5LJVA 3UR3C 3OR2B 1C1CA 2VHGA 2RF2B 3W2VB 5D8HB 1FF2A 4J7CA 1YHQN 4FWKA 4Y2IA 4AD6A 4OLBA 3OL7A 4QCLA 4DR3J 3IBWA 2MZQA 3VGMA 1S0MA 1FESA 1TL1A 4YHHF 4JI6J 3MCPA 3SIPB 1N36J 4OYZA 4CNZA 3DOMB 3GJTB 2CJXB 3D6FB 4ZVSB 2MQ8A 1WSHA 2EK6A 3LP1A 3V1OA 1VQ8S 2W41A 1GTHA 4ILGB 5D4NA 2HSTA 4BRPA 2JSXA 4O8KA 1M1HA 3HHDA 1YGYA 1TUYA 3EM1A 4DSLA 1JXVA 4HUGA 2V7YA 3T5LA 1SV5B 3NG8A 2L9WA 4PG8A 2R7UA 5DG7A 1FRHA 4X66K 3VA0A 1TKTB 4B17A 4AHCA 1K8AT 4CZEA 1A0OB 3H0PA 1X4BA 3CDWA 2XQCA 1GLCG 1H74A 4DR1F 2ITGA 1RT3A 5M2UA 1FWPA 2DGQA 3U3GA 3I96A 4HACA 1WORA 1TUWA 2A1SA 4A62A 3TVZA 4O23A 1LW2B 2V4RA 2V8HA 4RTFD 3MEGB 2P9UB 4TYBA 4I9LA 5J2PA 1G2EA 3RMDA 3R8YA 3A8JA 4M5MA 3BSOA 4FK4A 3RGIA 2VUGA 1F9FA 2CRLA 1NGDA 3QT7A 3I31A 4QJVA 2X1AA 3LGNA 1D3WA 5FDLA 2YH1A 3L6QA 2MKYA 2X6SA 2V8VA 5T7LB 2HAIA 5HJXA 1BL3A 1VC5A 4IOBA 4Z2XA 1CJTA 1RILA 3EL2A 4O5BA 5F8LA 2JDJA 4OLPA 3GIIA 3CQXA 3MN6A 1ACMB 4BRQA 2YKAA 4CM0A 4DR3K 1BQNA 3SQGB 1LWCA 4JI6K 2NXEA 3TZZA 1S1TB 2QO3A 4X65F 2BKNA 3L7UA 3LTOA 4U9RA 3I82A 3MMVA 3VGKA 4DDFA 4A4JA 3GPAA 2Y3YA 2HHQA 2OSQA 2JWNA 2P9GA 3ZTSA 3HO1A 5ETTA 2E6MA 4K4TA 1KQGB 1SC4B 1Y0HA 5L1KA 3KLGA 1I3AA 4RCHA 1VJWA 4DS4A 1FJEB 4U6PA 3S3OA 3VQ6A 1EQYA 3UNYA 4EZ6A 1EB0A 1RDRA 5HRSA 3GOIA 2B4PA 3ULHA 4JI3J 4QOZB 4LFAF 1UAXA 2XHBA 1SS6A 2P9KB 1QTMA 3K8WA 2L08A 3OSNA 1PKUA 1IVZA 3TNVA 2IS3A 4ED2A 3GIJA 1S9FA 1NKBA 2LQ5A 5HATA 1G99A 2V67A 2DO4A 3R6MA 1XR5A 4MO4A 3VETA 4WFAL 4F3MA 3ISND 4FNHA 4I4BA 2O8EB 3ZZOA 1JWWA 4Y00A 3W8GA 4NZ7A 2QJ3A 4XDDA 5CCMA 4FJIA 5AE3A 3I8DA 1VQ4N 4U67L 1YLXA 2M4MA 2VZ9A 2C2OB 3MEEB 2BE2A 4UTGA 1IBMF 3W1YC 2OTJN 4DV6J 2QWPA 1BU6O 4QWDA 3OYIA 2DGSA 3B8AX 2ASOA 1V9OA 2HB5A 2JX2A 3UN2A 1NZAA 3MMCB 1YHQS 4P6QA 2CYYA 2HHPA 1TL3A 3BM7A 4BR0A 5A8WA 2YVSA 2JC0A 2NXJA 5G4DA 4J2DA 1UETA 5IS2A 5DM7L 2QL9B 5HN0A 3BF3A 3CF5Q 3ISZA 1S1WA 5KFYA 2SXLA 3F44A 1HNWJ 3SUQA 4USHA 3GFHA 4PABA 2ZH4A 2WBMA 3IA0A 1VRUA 3WIUA 4AF1A 4LBPA 3C7NB 5EHHA 4Y6IA 2RU3A 2AQ4A 3ZZUA 4GVBA 3GLJA 4JI3K 5KFSA 2MZRA 4DU1A 2DVIA 2PGCA 4A8SA 2A42A 2OO4A 1ZS6A 3BQ0A 2UYTA 3ILLA 4PR6A 1BWVA 2GHWA 1ESVA 5FROA 1IN0A 4LY7A 2ZEJA 4KHYA 2QTWA 4EK2A 3NGIA 2Y1JA 3OJUA 1YUWA 4HDGA 1BIUA 2MJNA 1R0BG 3MD1A 2O8BB 3B82A 3QWPA 4CE9A 4K8ZA 1EAYC 1FEEA 2F5GA 4CWBA 2DGTA 3PXGa 4ETZA 2IRUA 3QJPA 3NHGA 4JRPA 2DNOA 3KFWX 4M95A 3VN5A 2DH8A 3GIRA 1O1WA 4WFBL 4C8LA 4FXWA 1JKHA 4DV6K 1U2FA 1UWAA 1NDLA 1O51A 4JV2A 2GTDA 5GMKa 3GFXA 3VQ7A 5B7WA 4YOTA 4AHSA 4BRGA 4I6AA 2NUBA 4WP8A 3QFUA 2GMLA 2HMIA 1RBTA 4CEOA 1XERA 1LW0A 4DL7A 4FPBA 4K25A 2XS7A 2DNHA 1U7LA 4B1XB 2YWFA 4P73A 1ZBFA 1RT6A 2W6KA 2PO4A 1YRXA 4O3NA 3NXZA 3K5PA 4J91A 2KB2A 1L3KA 2B5JB 1YDLA 3ID8A 4NLOA 1OPIA 2HHSA 1EZZB 3KK3B 1DJ0A 3HSZA 4JKGA 3EE8A 2W8KA 3Q8SB 3UDCA 1HNWK 1U2RA 3P5JA 4R25A 3P39A 4OQJA 2P5GA 2DHGA 2DNGA 3PEHA 2P9SA 4H4OB 2E5LF 3CJKA 2FHOB 4FJLA 2GNKA 2Q36A 4ES3A 1IG8A 4LF4J 1DQ9A 5EWEA 2X3GA 1U0HB 2IDEA 2H4YB 3KWMA 4RW4A 4DV3F 3H20A 4GKKJ 1TV6B 3MZIA 2PI4A 3AD7C 2BABA 2RILA 2IDLA 4KIAA 2E1YA 5I3QA 2OLWA 2R3VA 3QJLA 2DGVA 2N4CA 1T9YA 2CZ9A 3NDKA 2KT3A 2F9DA 2XYGB 1VQ4S 3GFYA 2C2KB 4LREA 2MKHA 1SUQB 1ITPA 1HI8A 3P5BP 5I42A 3DRYA 3QGHA 3CCRN 1RTDB 4PAAA 3R9PA 1T05B 4A57A 1R8BA 4ANEA 5E2QA 3LP0A 3U02A 4ILRA 2RDJA 1B0PA 2R7QA 4HEA9 3L4IA 3OTCA 2GBZA 4BBYA 1U8SA 1GXUA 4DQ8A 3SAHA 1ZXOA 2IAJB 5HMZA 2VA3A 3MR2A 2GAGC 4AL5A 1NSQA 4ECZA 3CCVS 1NK9A 1VISA 5DGAA 4CYUA 4JKAA 3SMSA 5A76A 2V68A 5CHCB 4BRHA 2HBJA 4ZJOA 3G87A 4WQ5C 2IJFA 3QT8A 4LF4K 1HQEB 5KFJA 1TU0B 3S3MA 3DRSB 1FKOB 3TA2A 4BDYA 1CJUB 2G8WA 3NVKA 4DSKA 3TPQA 4GKKK 3I0RB 5DMRA 5ETVA 4WYBA 4DL3A 3MTKA 3DLEB 1KFDA 1Q5VA 2BYCA 1LOTB 3P1GA 5GMEA 2V4JA 1WOSA 4LBIA 4OJ1A 1MMDA 3ENQA 5I4MA 4LF5F 4JI8J 2BH1A 1QAIA 2YNHB 2CUYA 4DPYA 4DR4J 3KIOA 3QRPA 2ADCA 2R9LA 2FC9A 1VCTA 2OAUA 3CQ8A 1AZSA 3Q8VA 2Q43A 3JXOA 2P6TA 4P2XA 2YV0X 4D3GA 2P9IA 1ZA1B 3OFFA 1ROFA 1RWMB 5EOYA 3V4IB 2LFVA 5F0XA 4CJWA 5BRFA 4RBTA 4YOYA 3OXLA 3OYHA 4M5NA 3DOLA 1FRIA 3OYBA 1RB0A 4WWSA 3PM9A 1DRZA 3PYEA 5CHIA 4I6MA 3IR5B 1K9MO 4NOHA 4V19J 3DKDA 4I9QA 1NMEB 2W2OP 3MPWA 4CLFA 4KQZA 1ASUA 4FWMA 2GJFA 1CJKA 1WD6A 2OCEA 2UXCJ 1TKZB 5IM0B 1K8KA 5KFOA 3NWRA 4MKBA 2VASA 3G6EN 1S57A 2ALYB 1QE1A 4ZHRA 1FD2A 3QBXA 1JLAA 3M8WA 1BC6A 4FVUA 4DX6A 3THYA 2FYXA 3GIKA 2EKNA 2O8FB 2PSZA 3DLHA 2ZBRA 4OI6A 3VESA 4H4MB 3AJ2A 2O5DA 1RHJB 3MMBA 4CH1A 4A2BA 1RAIB 2PEBA 5GMDA 3TAMB 4C8NA 5EGYA 3TAGA 4I2QB 2D41A 2ALZA 1JNRB 5JVGL 1C4AA 4LVNP 3G82B 2AJ1A 4JI8K 2NZ4A 3QEWA 2I9SA 4IH5A 2HHXA 2OEMA 3KMQA 3D2EA 3OYDA 3FVYA 4CHNA 4DR4K 2EVZA 5HQMA 3EVMA 3MCNA 3QWUA 3AO4A 2E88A 3KDNA 1FXXA 2HQ3A 3C6AA 3TABA 1XTZA 5L8RC 3T5HA 3U27A 1VBXA 1VRTA 3OVAA 1BISA 4N5SA 4E1JA 4O44A 1P90A 3N6LA 3FCVA 4CJ4A 3UCZP 3OYKA 4M5DA 1N5QA 2V2QA 3KJVB 3Q8PB 4CFAA 2CWKA 5IT9O 5J1NA 4C8OA 2CQ2A 1NK8A 4DTOA 4EGLA 1N5YA 1WELA 3O6QA 4PKGA 4G1QA 3LW5C 1VC6A 2RDIA 4LH4A 1YBUA 2WSFC 2FTRA 5J2NA 2ATQA 4X2BA 1YQHA 5M2RA 4LUBA 3I4PA 1T9WA 4HL9A 3CMQA 2BJDA 2YWHA 2V52B 1RTHA 3FZBA 4DPXA 3VF0B 4EYHB 3NF7A 2UUAF 4DS5A 3QIPA 1ZAWA 3IFRA 2UXCK 2UZAA 2CQGA 3TJAA 1HL6A 1TELA 5LT5A 3CCLN 3O8MA 4BE1A 2FJEB 4DTNA 1FCAA 1NWKA 1OH7A 1U6ZA 2XULA 2HK2A 1BI4A 2PBDA 4OPKA 1N5TA 2E5GA 1G4CA 1T11A 4BDZA 4O0NA 7FD1A 1N52B 3EDQB 4CJ5A 4J9RA 3ZEUB 2WVEA 4Q2MA 1RTJA 4M3RA 4CGIA 2FDNA 5BPNA 5KG4A 1LK7A 3O44A 3KK7A 4H5TA 4AL7A 1NRKA 4FJ8A 3RBEA 4YOXA 4AM7A 4O4RA 3KHGA 2OEJA 1M1GA 5GADU 4IRDA 3L3CA 3CETA 1H7XA 4NEYA 3KLEB 4F7VA 2HFVA 3MAAA 1B9DA 2MKSA 3DNCA 1C0FA 1NOYA 5JVHL 4XAKA 2XSJB 1VQKN 1VQ6N 1YJ9N 4F4AA 4M1KA 2PZSA 1JLQA 3N4QA 2W2NP 3OYNA 1RDAA 1AXQA 5A6PA 3TEGA 5J2QB 1SJ3P 3GCXP 4B02A 4LQ3A 2UUCJ 5KFXA 3LP3A 2MLYA 4M5JA 2I5JA 4CLPA 5CZXA 2NPIA 2AJQA 3Q0AA 1PSDA 3NAEA 3RSEA 1UVLA 4FSVA 2HFZA 3C2PA 1HNVA 4WF9L 2W9BB 5HL7L 4OV1A 1MROA 4OLOA 2RDDA 2VU5A 3CCJN 4LSNB 5AT1B 5JS2A 2C3OA 1RU1A 3PV8A 4OPAA 3L2RA 4DZDA 3T3FA 3WQUA 1HRHA 1EX8A 2CPIA 3B4MA 1I39A 5AZIA 2LVWA 1JLGB 2RAQA 4DL2A 5MLCQ 5KT7A 4HH1A 4K5SA 1HBMA 5K14B 4ZVPB 2E2NA 4UT4A 1C0TA 3H6EA 1YVUA 2RSQA 1RI7A 4O3RA 3LPTA 1NNEA 2KFYA 1HA1A 2KZZA 1RWNB 4EO8A 3NF6A 3RWUA 4J37A 4FYWB 1SQGA 2RS2A 2RJZA 1V4SA 2IM3A 3I0SB 1XNRF 4FOEA 4RR5A 2BR0A 4PA1A 2CNKB 3BGOP 5DLGA 1B9FA 4FVCA 4Y2MA 1R8AA 3ETOA 3QNNA 3AA9A 1P1TA 5IC6B 3QO9B 3U1MA 5J1PA 1B7YB 1U4BA 2Q31A 3T9ZA 3IXQA 4HI2A 3SBGA 4WPAA 2OIHA 2QX0A 3NGRA 2MQPA 5CCLA 1NSPA 1DLOB 4FLVA 1SL1A 5AQSA 3OFHA 1HBNB 2UUCK 2XYHB 2A3ZA 1UEKA 4DMZA 3O3FA 3KJFB 4BY9C 4FZYA 1HW9A 1X31C 3MM8B 2I38A 4UUXA 1PO6A 2FXUA 1WG1A 2EG2A 4K4VA 2VDHA 5IQQA 4Z4HA 1CC7A 4HUFA 2DR7A 2P8IA 5EWFA 3W0LA 2PE8A 1FEHA 2V5HG 1GQEA 2ACMA 4ZS6A 2ZH5A 3ENWA 1Y5LB 3ULEA 4BC4A 5C25A 2YWGA 1JJHA 1KQSR 4U7CA 3DOKB 1NJYA 1KAYA 4WP3A 2BQRA 1SC3B 1G6BA 3BDPA 4CZFA 3M8PA 4JNEA 3C0BA 2QXFA 5KOXA 1BY9A 2QI2A 1S6QA 1JLEB 3N28A 3PYFA 1KRPA 3JSBA 3FLCO 2GZOA 3LQVA 2FLOA 3CE8A 3FC9A 4F26A 4P75A 3RMCA 1YKWA 4ZOSA 4ZJLA 2HOEA 2VBXA 5L9NA 4CJTA 4J2EA 2IGIA 4X64F 5KI6A 4LSZB 2MKJA 3UCUP 2EKYA 4TN2A 1QAYA 4N7TA 2IMWP 4NYPA 2KYZA 1RACB 1M5SA 2FY8A 3NCIA 5AXNA 3BEGB 5A0YB 5IT0A 4URSA 2D3O1 1SL2A 1FK9B 3LPEA 3DAWA 3VF2A 2J7WA 5BN8A 4LR9A 5HBMA 1HYZA 3OBWA 2CDQA 4CD3A 5AQPA 5GVQA 5I3UA 3CIMA 2ZD1A 5C24B 3CJ9A 5C2DA 2OUGA 1FJGF 3O1BA 2GC8A 3A8IA 3LUYA 2JFKA 3KLIB 2MYFA 3GQCA 4B3MJ 4BGBA 1RT1A 1XEZA 1YJ9S 2CJAA 3KUHA 4IO8A 3OT9A 3M6VA 2DTJA 4PG4A 5KPZA 1NSAA 5HVHA 2W25A 2XYPB 4NLSA 5GAEU 3MMJA 3FZFA 3HDSA 4QWCA 1P6TA 2P9NB 3D6RA 2XY8A 2ZBIA 1RWOB 1FFGB 4IRKA 1WC3A 2IC3A 4R0JA 3DCAA 5BJRA 3HHLA 4KYZA 4C23A 3TAEA 2AV5A 1IR0A 1U1MA 3BBBA 2IM2A 2QLWA 2H54B 3AAWB 3CIZA 3CCJS 3CCSN 2NYIA 5B0EA 2EBGA 4F50A 5DM6L 3SCKE 3AA5X 3GMGA 2VPYB 3EVWA 2ZVSA 4UUWA 4K0KJ 3K89A 2QFJA 2UUBJ 2ZE2A 3VEWA 4J9KA 3M2UA 3EGVA 3DHWC 4JI2J 4QR0A 3PHTA 3R3TA 3HVTA 1MMNA 1RDCA 1NJXA 3DRPA 4NRTA 3BREA 2HHHJ 2PFUA 2N82B 3CCQN 1MWYA 4AT1B 2QC3A 3P31A 3BR8A 2XMTA 3D9BA 3MM7A 4K8XA 4FJ5A 2YJFA 2BV3A 1I94J 2D3UA 3PKMA 4JEPA 4O4GA 3FCWA 1FX2A 1H7WA 1CJVA 5DRKA 3QFWA 4ER8A 3BH6B 3FZLA 4KH4A 2BUNA 4CGFA 4FOIA 3J7Z5 4PYDA 1FKPA 4LF9J 1N33F 5AFUA 2OP5A 2A18A 2RQMA 4JI4F 4B3MK 4NA1A 5IWAF 5E3QA 3H1VX 4ID1A 4QS9A 4K2JA 3GIMA 2GGPB 2XHCA 1UPMB 2O8DA 5KT5A 3TUIC 1HYSA 4YNQA 4UQGA 2HHWA 2KFZA 4OLAA 2HS4A 4CEFA 1OPZA 1V5IB 3LM9A 3D28A 1SC1B 4F36A 3MPDA 3BKFA 2WBNA 2O4GA 1O6XA 1RGVA 1DQ8A 5KPRA 3OS2A 1QUVA 3AJDA 3OTBA 2QE5A 4DF8A 2ZDPA 1UW9A 3WBZA 4Y2CA 3ZX3A 2HNZB 1U1LA 3SK3A 4BC2A 2R7VA 3DYAA 2DFEA 3AVHA 4OYOA 4LF7F 2E7WA 4K0KK 1LXJA 2V9KA 3NGYA 6FDRA 1CVJA 2UUBK 4ED1A 2QWLA 2E4LA 3MMAA 5DDPC 1WDDA 4JI2K 3TUZC 1VGYA 3EXYA 3V6DA 3HT0A 2R8GA 3GWCA 3OTEA 2A1RA 3TW0A 5D0GA 4FWOA 3EN9A 4M63A 3MAQA 3EPIA 2HHHK 4Q0BB 5AQRA 2N3LA 3C94A 3N4PA 2R42A 3W64A 2P51A 2U1AA 3NCRA 4FK2A 4NLXA 3OVSA 1JIHA 4CLLA 5K8OA 4F02A 5HQ8A 2AD9A 3AQPA 2EFPA 3UKRB 1SBRA 1IKXA 1NO8A 2IA0A 3HOTA 1XHZA 1WDTA 5J2MB 5F8HA 4RWWA 1Q9YA 4B3TJ 3THXA 2V8GA 2X78A 3SPZA 3A8YA 2M7SA 1C2PA 2GV9A 1WC4A 4IQMA 1WF1A 1VLYA 1U49A 4JD2A 3D3CJ 4CDIA 1RT5A 1IKWB 1SJQA 3MEKA 3Q8QB 2LDIA 2HBYB 2Z58B 4DG1B 3SUNA 3L7PA 1NHUA 1X9SA 4CFBA 4R79A 4OKJA 3TYTA 4IEIA 2K2PA 1Y9OA 3EX7B 5KG7A 3NAIA 4LF8J 2MKKA 3PHEA 2R2SA 1F5BA 2UV8A 1U6FA 4KO0A 3MR5A 2QM1A 1ZM9A 3PLAA 4RLEA 4AQYF 1FDNA 1TYQB 3BPSP 3K5LA 1JJ4A 4FF2A 3DM2A 2KXFA 3D0GE 2HZAA 2IBOA 5FRNA 3SSSA 3S3NA 4ZIWA 4JK7A 2AGOA 2AJ2A 4B9TA 1XNQJ 1IM4A 2YKPA 1GOCA 1DURA 5HP1B 4F4WA 2FVRA 4OYBA 2R7OA 4KSEB 1R8CA 4ED0A 1AYEA 2FF6A 3SV3A 5T7BA 1DFDA 4C0OC 4YHHJ 2C2NA 2WONB 5LXYA 3MM5A 2GIFA 4OHZA 3AGRA 5E84A 3T7ZA 2R7WA 3US5A 1Q7YT 3H25A 3VMFB 2QKBA 2JHEA 2DITA 4OX8A 2CXEA 2V2ZA 5KGWA 3OXGA 4UF4A 2NNWA 3CCQS 3CULA 4DFMA 3FGUA 2DGWA 2QYCA 3R1HA 2IVFB 3VGVA 2D0OA 4EFAC 3M1VB 1TL7A 4MYTA 1Z2ZA 2HIQA 2XMAA 1L5UA 4BWMA 2F8MA 4C2MA 1JLBB 4B3TK 2CQ4A 2AJFE 3OR1A 2MMYA 3MXIA 2QL5B 2KVIA 3IM8A 2MXYA 4DR1J 2NSCA 3G96A 4KKOB 3DJCA 2QXLA 3THPA 3L8BA 3LZIA 3IP0A 4PZVA 4EO6A 2D0CA 2YQ0A 2LDYA 4H0VB 2Q3SA 5HROB 4LF8K 4YFUA 3WT0A 4JBCA 2ASJA 5J1EB 3M30B 3I32A 5G0RA 2H4WB 2HLTA 2W4PA 1V4TA 4ZN3A 1P9QC 2YH0A 5GAGU 2XZDB 3LDSA 3D1OA 3KYLA 4OZNA 5KAKA 2Q6BA 2NLXA 2CJKA 5BRHA 1GLBG 4OX7A 4A8OA 5AXMA 4JKHA 1XNQK 2DPJA 1Q81O 1F6TA 5EWGA 4Z4CA 2E5JA 2HHTA 2VWKA 3QAUA 4DSFA 3ZZ0A 5F2RA 1RWVB 2AT1B 2FJBB 1XMQJ 2DFHA 3EXCX 4C0HA 2FC8A 4YHHK 4YUDA 4ZVTB 2D4WA 4DR6F 4X65J 1V3ZA 1U1RA 5FLXY 4GV9A 3THVA 1VQON 1U45A 1EQMA 1U2VB 3T69A 4J5OA 1H73A 3KUGA 4JI5F 3IRXB 2Z2MA 1M0SA 4O5FA 3JS9A 2FC0A 3IMXA 4KRWA 4WZMA 4C11A 1YAGA 2XNQA 4F4KA 1CXQA 1HKBA 4B9UA 1REVA 5D77A 3V6HA 3BGRA 3KK2A 2ROPA 2C22A 3E01B 3QEPA 4FLUA 5TKWA 3TANA 1BWFO 1RAEB 4ICLB 2EXUA 2NSBA 2XEXA 3CXCR 2B4UA 2J8SA 1IQTA 4C9DA 5F3TA 1N4LA 4DR1K 4ZPDA 1YG0A 1JCEA 4LFAJ 1TL4A 4F25A 1RAJA 5MLCV 1S79A 4CZJA 1HPZA 4RW9A 1WUUA 3WNEA 2HBRB 1FDBA 4Q7AA 3ELHA 3G4SS 3QMQA 4MK8A 1NK4A 3VQQA 1T44A 4LH5A 4FJMA 1KQSM 1RBRA 3WEEA 4KBOA 4E7LA 3RBXA 4DL5A 2CFXA 2KRRA 2EFVA 2WCXA 5C5JA 3EY1A 3Q86A 3G9CA 2BZ2A 2HF4A 5KRSA 4IH6A 4O3PA 4BROA 5D4OA 4ECWA 2W1BA 5LY3A 3S9HA 3FKBA 2YKOA 1WB9A 5DO2A 4HCCA 1GMUA 4OL8A 2B9YA 1YXQA 2H48B 1XMQK 2OI2A 5GAHP 4C3MA 1T7PA 4L6V3 2E2PA 5AQVA 4IFEA 2YQ3A 1HR0F 4DTXA 3Q8YA 4X65K 5F8GA 4PG6A 3LH2S 3AA4A 2A2DA 3HCXA 1R6VA 3VAFA 1S97A 1LWFB 1IXKA 4C97A 4WFXA 5AE2A 4QS8A 4DBQA 2WW4A 1T9VA 2IOCA 2DY1A 5AQIA 1TKXB 4BC5A 4F3QA 4BQLA 4ISEA 4HT7A 3NNAA 3HM8A 3CCTA 3M3ZA 3LOUA 3DLKA 4JN4A 2QWQA 4KPCA 3HFVA 4WYLA 2YKNA 1IKYB 3C14A 2HSEB 1QDUB 4AHRA 2B51A 4LFAK 1IJEB 1VBZA 3ZLJA 5C15A 2ZH3A 5CA5A 4LRDA 3TUPA 2UVVA 4KHWA 3C16B 4M3TA 2QWOA 1JMTA 1XR7A 3X1LB 4WIQA 1S4EA 3M32A 1NDKA 3R7BB 2YWWA 1ZOTA 3SSQA 3FZKA 4WFNQ 2RQKA 2KXHA 2VFRA 3CDUA 3ZSWA 3DGPB 1VQ5S 5ETMA 3IN5A 4PUOA 1VQYA 4OX9F 1IBMK 4BQZA 1CG2A 2COLA 1N56A 2QEXN 3WQTA 1SKWA 2RF2A 3W2VA 4DL0C 2GO9A 2YPYA 3H7HB 3BR9A 1H0HB 3A5LC 3M7VA 4TU9A 5H1SQ 4YDUC 2FZCB 2EFGA 3K0JA 2HQCA 3T1YF 3MFHA 3D6TB 3DOMA 3T1HF 1WF0A 2VJUA 2Q1LA 1LAVA 2W8LA 1R8PA 4MAKA 5E3RA 3POTB 2GUPA 3LGHA 5A6WA 1ZAXA 3LDPA 1VQOS 3CMAS 3RAQA 3KLHB 3QDKA 1RDDA 2PDAA 1SV5A 3L9ZA 2ZKUA 2PYJA 3T1AA 4KRFA 2BRLA 3PCOB 5D0EA 2E5LJ 1F2GA 3NKYA 3OL8A 2JC1A 3E2EA 2DNLA 2DT9A 2F1FA 2GQCA 5HL7Q 1B3TA 4H0OA 1OVQA 4RNOA 1KLMB 2OGUA 3F73A 5DLFA 1LW2A 2NUHA 4DN0A 2Q79A 4CJUA 2PYLA 2FVCA 3THTA 4DV3J 2BJ8A 3MEGA 2P9UA 5ETRA 2R7XA 5IQ6A 3ZSVA 2XNRA 4JI7F 1U48A 2K06A 4M45A 1RT7B 1ZBHA 4ZLNA 2HVZA 3TSQA 3BJYA 4IO1A 3O2IA 4CZCA 1EIYB 1FI4A 2E1ZA 4OZLA 5HQLA 2DCLA 3AVIA 4B3SF 1ZETA 4GVMA 4C8YA 4KHPF 4ELTA 3VAGA 5T7LA 2XMWA 1S6OA 3T6JA 1FKAF 4X4TA 1RNHA 5KRTA 3SBTA 3B54A 2CPDA 4DHYA 2GVDB 2AW0A 4MK9A 1OH8A 3MN5A 2C1EB 3SQGA 4BVOA 3CO0P 3OW2R 1S1TA 4RWTA 4CEZA 1VSHA 4BRAA 3QPIA 5D78A 2JJ4D 3IG1A 1NLKL 2HLUA 4RW6B 3JTPA 2OZMA 4UQTA 3MK6A 1OQ3A 2H5EA 1RKIA 1XHXA 2L41A 4DL4A 4EEYA 4CJ3A 2UP1A 1ASWA 2JGUA 4BGAA 1NM2A 5LJ5Y 3ENOA 2RRAA 5E3AA 4FN5A 3JTOA 3R2CJ 1P27B 3HD1A 3CCMS 2E5LK 3AD9C 1Q1KA 2W4DA 1WAFA 3AAQA 3PO5A 2P9KA 2FHJD 3CJAA 3ASMA 4ZTJA 4G65A 4QYZJ 3K58A 4DV3K 3FE1A 1ZYQA 2HRUA 4GO7X 4DQSA 1VIXA 5KFIA 4DQQA 4B8AB 2HNYB 2O8EA 5CR4A 3TR8A 1HLWA 4HTLA 1D1UA 4IJAA 4KPYA 3B6PA 3OJSA 4DV0F 4LF5J 2OPQB 2Q3PA 2W7OA 1TAQA 1JX4A 4OVLA 3ISNC 3MEEA 3CF5L 4KHUA 2J0WA 3RU0A 2ZH1A 4KHMA 5AZJB 4N8OA 1M1KT 2A5XA 2B6AB 2CJBA 1UW4A 4EP4A 1ZBSA 3N9UC 3O9TA 2GV1A 4FWQA 4M8LA 2QEXS 4PCQA 3MPVA 5FLXU 2F4VF 4DQPA 4CEDA 3K57A 4TYAA 4CH0S 2QA2A 3R5CA 1VQ9N 2XI2A 2GVZB 3HSDA 2M9KA 2CQIA 5LXRA 4OHVA 2VWJA 4A2AA 1RWUA 2WRMA 3KLVA 3EUNA 4QPTA 1GAOA 1N0VC 2LQJA 1VIOA 4DX8H 1BUXA 3KWIA 2LEBA 2ROGA 3H5UA 4FF3A 1DKGD 3ET6B 1LWXA 3C7NA 1ZPWX 2LXIA 3P3DA 1R89A 1YJUA 2I1RA 3FRYA 1ATRA 1CEZA 3KNGA 1OMSA 2F9TA 4DLEA 2E5IA 3WXLA 1PGZA 4ECYA 1NGJA 5CXTA 2CADA 4PL7A 4QYZK 5CQGA 2E6LA 2BBEA 2NR0A 3AO5A 1CULB 3SDEB 1GNKA 4YOVA 1U0SA 1VFJA 4M5HA 3BEXA 2KQ2A 3KHYA 4NYZA 4UOCA 2RRNA 2O8BA 5AQFA 1MSWD 3ZT0A 1NAQA 3QINA 3AO3A 3IS9B 2Y1RI 4LMZA 2O4IA 3FMWA 4LF5K 3TQ1A 2F40A 4HCBA 2DXEA 4O3QA 3PIOQ 3PFEA 4CQ1A 5DGBA 2ZBPA 3PEJA 2IHR1 1BA1A 1KAZA 3JSYA 3M9OB 1OVYA 2EC2A 2VKZG 3BPDA 1KONA 2IY5B 2XMVA 4ZPCA 4BREA 2BOAA 1EJ7L 2VKRA 1KC8O 4M7XA 1D09B 1B4SA 1JJ2R 4B08A 3S01A 5BREA 1F3VA 2LXUA 1M90T 1U2CA 3I5BA 4NA3A 4OMFG 3ZSQA 2B5JA 2QG9B 2F3JA 1XMBA 3CXCM 3KK3A 2A0FB 2MKCA 4FBTA 4B3RJ 4YP3A 3AVLA 1VBKA 4KH0B 4DKWA 2UUAJ 3H4BA 4NE9C 4U8VA 5AJ3F 2C2ZB 4H4OA 3CPWR 3BDEA 2DNMA 2RN2A 1N88A 5C12A 2GHPA 3M05A 3T41A 3PVXA 3J7AN 1U0HA 1NZ8A 1ILYA 3RTVA 3DXMA 3VZIA 3WXIA 2K8GA 5BN9A 2ZFHA 1RABB 1TV6A 1RWPB 4UY8T 1CC8A 2J9DE 1X4AA 4WJBA 3TZWA 4PKIA 4CECA 3AA2A 5KT4A 2FPHX 5KFMA 3PRDA 1T9TA 1TK8A 4MIBA 4U95A 4CLZA 3IO1A 1R27B 5FPNA 5M1OA 4ED8A 4NCGB 4BDPA 3BS9A 1O5JA 3RB4A 1SUQA 5ETOA 3QERA 4HHUA 1UJ5A 4NWBA 4NLWA 5AQHA 3VEVA 1RTDA 1FT8A 2QMWA 4KH1B 3ZT1A 1T05A 3R5JB 4ENOA 3NMRA 1U1NA 5KFNA 2BE9B 2JWLA 4BC3A 1ZA2B 1X9JA 5HMYA 2VJVA 2KVQE 2MZJA 3MWTA 1NGBA 1QY7A 2E2OA 2PMZD 2YHWA 2DR9A 1U25A 1Q8BA 1LNQA 4EBDA 3GP9A 3GTYX 1VQ9S 4DCJB 4O3SA 4KH5A 3VHQA 1GMWA 1WC5A 1T95A 1FDDA 3HULA 3MM6B 3L2QA 2NCKL 1SKSA 5IXUA 1V3SA 2NRWA 2IAJA 1IH7A 4B3RK 5HK4A 3G10A 3OYCA 4F3TA 2DY4A 2AA4A 3KLFB 5GADI 2UUAK 5EX3A 4A8FA 5E0OA 4MFBB 3MXMA 4BS2A 4V1Ak 1RK8A 1Y4ZB 2D3ZA 3UVJB 1N36F 1MU2B 4CO0A 1HQEA 3DRSA 2LU1A 1FKOA 4FM0A 1RLDA 1BE4A 1CJUA 3HHLD 3MR7A 4DPWA 4L73A 3I0RA 1HQ2A 1TGOA 4RZRA 4ZP9A 1FERA 2CH5A 3DLEA 1HI0P 5C0YA 1JXBA 5KFRA 2MHNA 4DFJA 1XNRJ 1NKCA 3PW2A 2Y0SD 3CW2C 3CYMA 3QATA 1GLAG 3D2FB 4DV1F 2AGQA 1WKJA 3C3LA 2XZWA 4NLDA 3K5OA 4YY3F 3E66A 2YNHA 3GSDA 3PKYA 2GMJA 3TJ9A 1BIZA 3TX0A 3J7ZO 4QU7A 1RDBA 2F7TA 3NFAA 3HKWA 2LKZA 1FFSB 3B6OA 1MWQA 2EPIA 1HHQA 4KB1A 3HZ6A 3UD4P 3J8AA 3SMZA 4ZPVR 2BRKA 1HYVA 1F0XA 3AOCA 5SWMA 2CIMA 3GJSB 3I9V9 4ZVOB 1C0UB 3AOBA 4ECSA 1I3OB 3GR1A 1QD1A 3HPHA 4CJRA 3B78A 1A6LA 2XMMA 3O4QA 1NK6A 1K73T 4XO0A 3O08A 2HVIA 1HPMA 2MZ1A 1YVNA 2K3IA 4U7UD 2QGFB 4DUZF 2ETJA 4NLTA 2BDPA 4EMDA 1N8RT 3EGNA 2BQUA 2IRYA 2V0NA 1ZTTA 4DTRA 4HT5A 2JFDA 2ZC4A 2EW9A 3M6XA 4E0DA 3CQYA 1VQ8N 1TKZA 4FKXA 1EETB 2YNIB 5IM0A 3ZFVA 5CYMB 2D69A 4KAIA 4OI2A 3S1TA 1IJJA 2DBBA 1F2HA 3IFEA 5H1SV 5A8RB 2CPHA 4IOXA 4W98A 3ZNUA 2O8FA 2Z30B 4X64J 4LRCA 3O1WA 2HBQB 2M0GB 4YEAA 2HFUA 2XCAA 2BEFA 2UXBF 4NLPA 1YZ7A 4H4MA 1RBSA 1QZ5A 4I64A 1XNRK 3QB0A 3TAMA 2KM8C 1RHRB 4J8FA 2W7PA 5C42B 1Q86T 4I2QA 3V9WA 4F4XA 2IYGA 3G82A 1RDUA 2R2TA 1YBTA 3FDSA 4W5TA 4BACA 1NGGA 4L74A 2HYIB 4CM2A 1DAXA 5B0BA 3A3PB 3KK1B 2HFOA 1GOBA 1FJGJ 3OW2M 2E66A 4QBUA 3ZSZA 2OMLA 3SJJA 1Q8LA 4K4ZA 1RWXB 2KDOA 4P9SA 4WP9A 2V51B 4WZQA 1IR2A 5AQLA 3KJVA 1LKZA 2V6AA 1JL2A 2V8PA 4O0JA 3JAMY 4H5RA 3QLHB 4ANCA 2QLFB 4W90B 2WB4A 4FPRA 3FZ2A 3Q8RB 2HMPA 4NASA 5SUHA 2WFBA 3EZOA 3WXJA 2XI3A 3TI0A 2VG5B 1C0MA 2P2CB 2W9AA 5KG0A 4OKKA 5D15A 2B8PA 4PWDB 2E7VA 3EMTA 2P9CA 3SLCA 3SPYA 1WEZA 2IJNA 3ZETB 5D3GB 3L2VA 4URGA 3KOAA 1WTBA 1CQNA 1FDAA 1N32F 2B7CB 5KG1A 2OA8A 4IFVB 4ZVHA 1TAUA 2G0IA 1BQXA 2IVYA 3ZEUA 4X64K 1VJQA 4CHOA 5JS1A 1FE4A 1NK5A 4F67A 5K8MA 3K2PA 4YR0A 1U6BA 3KG1A 4DSEA 1NU0A 3D0PA 2FJVA 2HFSA 3AXKA 1ZBLA 4L3QA 1Q95G 1WG4A 3ZCMA 1NGCA 4M3UA 4C48A 2HZVA 1UL3A 1XMOF 3U3YA 4YDDB 1VSEA 2VD3A 3KLEA 2OFGX 4A46A 3JTNA 2EWHA 3BO2A 5DDOC 3F5TA 1VQNS 1MA9B 3RAXA 2IFXA 3MI7X 1X5OA 1OH5A 4FWLA 1YRTA 1FJGK 3RR7A 1N33J 4W92B 1PAEX 3THYB 4ZVRB 4JI4J 3NEKA 5J2QA 1WSRA 1Y97A 5IWAJ 3UKUB 2KHDA 4B1WB 4ILJA 2WBRA 2R4FA 1AT1B 2E9RX 4TU8A 4BRIA 3MMBB 3IM9A 1IBKF 3H4DA 2QWMA 3MCSA 2RUSA 1ASVA 1FHTA 4DWIA 4CW7B 2W9BA 2EHGA 3PIPL 4Z4EA 4L3NA 1SCJB 4LSNA 4NZ0A 2DTUA 4ID5B 4DL6A 4OJHA 4C8MA 2Z2YB 1VR6A 3A3OB 1DBDA 2CZVC 4LR7A 3OVNA 2V2VA 5IV3A 3JB9k 2ZJRL 3CJ8A 3J80Y 2V2KA 1W97L 1NSKL 3W8PA 1JLGA 2FQQB 3UPFA 2HNDB 2KFNA 5T41A 1GLEG 4BRKA 5HLFB 2F9JA 2WAQD 4PWUA 2NS1B 5K14A 3VQPA 4BRMA 3G0ZA 4DTSA 4J9MA 5AQTA 2BW2A 2HGNA 4OGCA 1HNXF 2G4BA 1DTQB 3SZ2A 1U1KA 1W2IA 3NGTA 1YRUA 1UFLA 1P8GA 5F8IA 4Y1CA 4RBUA 1HNIB 3VQ8A 3NGKA 3AARA 3HHKA 2KN4A 3I0SA 2J6SA 2YHYA 1PAUB 3MURP 3EZWA 1ZBTA 2X1GA 3PX6A 3AAPA 1EWQA 3RUBL 4CK1A 2OELA 3ZTQA 1A9NB 4FCYA 5K5MA 1SAZA 3CUNA 3HZGA 2GJ2A 2CH6A 3MM9B 4NZ6A 5F8JA 2QK9A 4WKRA 1CS4B 5F41A 2A2CA 2MJUA 4LF4F 3BZQA 4KI6A 4LVOP 1BI4B 4NCAA 1N33K 1SPBP 3E3XA 1IKVB 1JJ2M 1DLOA 2L9DA 2HWIA 2EFNA 5K9FA 3FJ2A 4JI4K 1HBNA 3FR0A 1SIZA 5IWAK 3NH1A 3JSMB 2DEJA 4V19X 2HVDA 2FBXA 3CJSA 3FRZA 3NL0A 2CQBA 3G6VA 1KLNA 3MM8A 3CERA 4FDFA 2QFIA 1BMQB 2FY1A 4AQYJ 2Q66A 2E9ZA 2FJXA 3NNHA 5HVFA 2HWTA 3JQJA 2ZHOA 1UVNA 3SSRA 2MQOA 3CPWM 4M5IA 2Z1JA 2ITMA 2IM0A 2QWNA 4H0YB 3DOKA 3I8BA 3J7A1 1VQSA 4FLTA 3N6NA 1S77D 4GO5X 1X4HA 1RAOA 4BLGA 4KFBB 2OPSB 2LU2A 2XBPA 4QIVA 5DG9A 1JLEA 1LFPA 2ZBQA 4LF7K 4QIWD 1S76D 2R7YA 2AMCB 3VF4A 2XY7A 4OYAA 1J9AA 1RT4B 4ED4A 1MWMA 1SJ1A 4DV4F 1KFSA 2XGQA 3QETA 2XWYA 3D54A 2XWXA 4ECVA 1HNVB 4MH8A 4C3KA 2ASLA 5FPEA 1T8EA 4A8YA 3A12A 3PUFA 2WVFA 4B9MA 4PL8A 3VQ4A 3VGTA 3VGUA 3HFZB 5A0YA 3GE9A 1PYSB 3EE9A 3IRWP 3HTVA 4N76A 1HMVB 2ILZA 1Z26A 3DRRB 1S7HA 4DF4A 3QGGA 4HKQA 1TUVA 5K8NA 4N47A 3QSIA 3SUPA 5C24A 3RBZA 1M5HA 2ZZMA 5LSOA 4ERDA 4CERA 5EN1A 4P2MA 2HEKA 3G71S 1B99A 3KLIA 1MWZA 1VBYA 2YX7A 1LK5A 3ZTPA 2VPXB 3OUYB 2R8JA 3IWLA 1OJ4A 4K2XA 4G3IA 3O9UA 3SYZA 3DFEA 1YK9A 1S0VA 3ULDA 1VSIA 4AQYK 1YIJN 4JLHA 1NCLA 2FJAB 4QR2A 1WWHA 1S0NA 3ZT4A 1D5AA 5CYQB 1U02A 4FW1A 4OHWA 4DR5F 2OANA 4NLUA 1CLFA 2RIJA 2B43A 1YJRA 4CIOA 2LEPA 1WBDA 1QSSA 4FJGA 2GIRA 1UFWA 2V50A 3I5CA 4IRCA 3BBFA 2AYEA 1FTCA 4Z7CA 1RTIB 4MLEA 2DGUA 2E5HA 3CO9A 4FLZA 3D0IE 1WI8A 3BKTA 1Q82O 3B4DA 3G8TA 3MPYA 1A7GE 2V63A 3QRRA 4CO1A 3TU5A 3CCVN 1U24A 5LMUF 2DNRA 3DHXA 3VERA 5HAOA 2KHCA 4JI5J 3SUOA 1RJJA 3M2VB 3E51A 1OY9A 3U9ZA 4TVAB 5KFKA 4JV5F 5K8PA 5GAGI 3VAMA 1BOTO 2QTDA 3MN9A 3QIOA 3F41A 4OI3A 1C1BB 1KHWA 3BGFA 5KPTA 2MY7A 1RU2A 3C95A 5LL6d 1VLOA 2W2MP 3TA1A 2O66A 2KXNB 3A5MC 1X0FA 1QHAA 1AFJA 2WTFA 3TVYA 3QESA 2DRAA 4H5WA 4PPZA 1AROP 2DYAA 1Q79A 2GGPA 4LSLB 3X3UA 1FNMA 1J53A 5JXSA 5E3CA 4GV6A 4M3WA 2YQ1A 1EKRA 3HSTB 2MKIA 4IZ9A 4CK3A 4YOUA 2B4JA 4R8UB 3U6FA 1S1UA 4B9VA 2BUPA 4C1NK 1RAAB 4X62F 5C7PA 3ICLA 2OSRA 3EPGA 1DHMA 4J9SA 1SL0A 2HS0A 5LSLA 1BCMA 5DK5A 3VQAA 2Y1IA 3V6JA 4P7TA 3GG4A 5BYQA 3CC2S 3UI3A 3MDFA 4QAGA 2UUWA 4CGHA 4HHJA 3ZSOA 3D5MA 2HNZA 2OPRB 4PG7A 1VC0A 2GUIA 4C1NI 1X0PA 2HHVA 3OHRA 3VTHA 4X84A 3QAEA 2VG6B 4CO2A 3FZMA 1B0TA 2NRZA 5L46A 3R6GB 3H5XA 3NGDA 3VPZA 1BD6A 2MQLA 1SI9A 1MMLA 4W4MA 3OTDA 5IOLA 1HR0J 4DR6K 4UOHA 3BYPA 4CVNE 4P10A 1XR6A 3ENHA 4ELVA 4ECTA 5JMVA 2KHOA 2AEJA 4FZZA 2DHXA 5L39A 4ECRA 4JKCA 2GX9A 1RCXB 3IAYA 3A2FA 4JI5K 2D9OA 2RT3A 3ATVA 2ZWHA 4RUHA 3UKRA 3C19A 1X1PA 3GR0A 3CVKA 5KT2A 5J2MA 2YNFB 1YTAA 4DPUA 3PRVA 2LA6A 2DXDA 2L3MA 1WAJA 2RVJA 2OD6A 4Z94A 3QEIA 3HPGA 1NOZA 1S9EA 4L3KA 4WQ4C 3NLCA 1EP4B 5AQNA 4H0TB 3UDVA 1AA1B 4N41A 1IKWA 4M5LA 4ES2A 3RRGA 2M3DA 4DG1A 1NPPA 1DQAA 2DHHA 1S22A 3CDBA 1RBUA 3FEYB 1K9MT 1VQPN 1VSMA 1HWIA 3ZYYX 1W2BR 4CLTA 3CJ7A 1TYQA 4OHXA 4W5RA 3R5BA 3QEVA 3QMLA 4NLGA 5RUBA 3QT5A 5K20B 2GCFA 1YIJS 4FLXA 3R6LB 2ASDA 4I6YA 3SV4A 2FSJA 2YWKA 1FKPB 2WB1D 4RG8A 4U7UK 5HP1A 3J81Y 2QZ8A 2I2YA 1BGXT 1Y10A 1C6VA 1RZMA 4CLYA 4CI6A 3NS5A 4KE5A 3UNGC 5FPMA 4G1IA 1T03B 4Y3CA 3CD0A 4ANDA 2CJYB 3ONQA 3CFRA 2CPZA 2JVRA 3T1YJ 2WONA 4I2PB 1TK0A 1UA0A 2A40A 1XJWB 2XB2D 3FQLA 1FRKA 4EU0A 1HR0K 3DLGB 2J0QD 1KN6A 4FLWA 3W3SA 3I55S 3RRHA 1KWMA 3E1YA 1CSJA 4EZ9A 2HBMA 1H2TZ 5D4PA 5ADZA 2CGLA 3ZT2A 3D6MB 2EFOA 1YX2A 3ILJA 3BBCA 3PX4A 4OI1A 2E1AA 3M1VA 1PG5B 2B9WA 2VODA 4DR7F 2NYHA 2OKQA 4KC5A 1NGIA 2VFSA 3M8YA 1U04A 4I0WA 1GLDG 1NJIO 4OJRA 4EAHD 1JLBA 4ECXA 1KD1O 4XTTA 2QV6A 2A6AA 8AT1B 4J9LA 4KKOA 3O6WA 3I87A 1X4CA 4CZHA 2W42A 4OYXA 1FTRA 3LAKA 5LMNF 4IH7A 3RW7A 4FF4A 4Q5VA 5HROA 4URQU 3EZ5A 4U7BA 4CTAB 4KHNA 5J1EA 3M30A 1MW7A 4JI7J 3M8SA 4IDHA 4USJC 1YT3A 4MK7A 4DI6A 4WKYA 4CF0A 4Q8FA 3N5FA 1ATNA 1IKXB 2ZZNA 4E7JA 1KAXA 2JEIA 1JLFB 2YKMB 3LDOA 2D1KA 3SAFA 3BGUA 2H3EB 4B3SJ 3IKMA 2J5AA 4KHPJ 2YHXA 4QW8A 1M5VC 4P2SA 4A48A 1X60A 1E6VB 1TR0A 4OX9K 3CD5A 1YWXA 2CG8A 1URRA 3DDNA 4JKDA 2M52A 1ZC6A 4PQUB 5HVGA 2A6MA 4M5KA 1Y11A 1NB7A 3QNOA 3T1YK 4CT8A 4FNIA 4RNHA 2QKKA 1VK0A 2P5VA 2VCPA 4QWBA 2P6SA 1YJNS 1X7VA 1U2VA 5C2CA 2RMLA 3U8XA 3AQOA 3SCXA 3QT6A 3IRXA 5JICA 1VS3A 5F0WA 1REGX 1D9FA 3CB4A 3BZKA 3MCAB 5KG6A 3ZSXA 4FYYB 4Q44A 4IQXA 4ILLA 3LM2A 1HD0A 4GMJB 7FDRA 2ZQBA 4FXVA 3SI6A 5FRMA 1FJCA 4HYKA 1UWBB 2F65A 3AOAA 5KG3A 1RHUB 3KZBA 3E01A 2CQDA 1GMVA 2NRTA 2QIFA 1YITN 1RHQB 4ICLA 4HHTA 2XZTB 4G1PA 1TVRB 4KTQA 3TVKA 2GS8A 5KFHA 4N77A 4DPOA 3UN5A 3TQEA 5ETSA 4P7VA 4ZCKA 4JS4A 3CDAA 1XQSC 4TY8B 4G6VB 4M94A 1J2VA 3OHAA 3H90A 2KKHA 3K5NA 3TZXA 3EKSA 4ALZA 4JI7K 4H5VA 4EIAA 3RW6A 1VQPS 1H2VZ 3ITHB 2BTFA 3C66A 4NI2B 2ASMA 4ZP6A 3KHLA 3UN3A 4PEOA 4ILMA 4DV0J 1K6YA 4B3SK 1S3XA 4BRLA 2ZOFA 4KHPK 1VDHA 2O1PA 4FWPA 3WC0A 2AYGA 4RO0A 2G2ZA 3AH6A 1JNZB 4OZ2A 4IBNA 1GLLO 1HBUB 4K59A 3UB5A 8ATCB 4IO9L 3NF8A 4YOWA 1UP1A 1TP7A 2WOMB 2DO0A 4FPIA 3SCLE 3OBIA 4C4WA 3E9LA 3K17A 2VV5A 5ETLA 5G0RB 4OX6A 4W5OA 3MOZA 4QIGA 1AW0A 3IGVA 3PYGA 1E6YB 2VF3A 2DY9A 3MR3A 4AE5A 4CZMA 4NLBA 2H65B 1S1VA 4DZ6A 1UVMA 2F8SA 2V69A 1LWFA 2CVEA 3PACA 1T6DA 4DPTA 5IFMA 3ENAA 5KFPA 5CAAA 2RQ4A 4C8ZA 3H3OB 2OZSA 1LOUA 2VFUA 1TKXA 4RW7B 1UPPA 1WOPA 1VAZA 2WTUA 3E8OA 4WFNL 1M5OC 2V8DA 4XDCA 4BWJA 2M70A 2VC0A 2JLGA 2YNGB 3CD6S 2YBVA 2A6OA 4CEBA 1IKYA 1UAWA 4C3LA 4DX5A 1S6PB 3HI0A 2KZMA 1SH3A 4QW9A 4CZLA 4QIEA 3NAHA 4AH9A 3J7AP 3HP9A 1F21A 2R8HA 5BR9A 1KVIA 2GA7A 1SJRA 3KNAA 4IDKB 1QUPA 3DC2A 1O13A 1L3SA 1I94F 3C16A 1QQMA 1MG7A 4LRAA 1H3DA 4C6AA 5CD4H 2KLAA 4FJ7A 3M6WA 4EHUA 3OS0A 4Z0UA 2VG7B 1S5JA 4I67A 4DV0K 3EO3A 3DGPA 2R7RA 1T3OA 4LF9F 2RKIB 3WHIA 4USMA 4ZITA 3NMAA 2E9TA 2E1PA 5KT3A 4USVA 1BG3A 3M8QB 2VC1A 1S0OA 4OPHA 1ICEB 3RZAA 3UD5A 4RW9B 2V9WA 3EEQA 1WSVA 5JLHA 2K1RB 4DV5F 5A2QY 1QQCA 1D4XA 2KYXA 2PA8D 3PR5B 3BO4A 3BSAA 1W7WA 4FWNA 4Y1DA 1K44A 3R5GA 3DMJB 2F4VK 1WC1A 4JHDB 2A10A 2GELA 2V34A 1NHKL 4LR8A 5FLXO 4UOFA 4DHVA 4OYWA 3POTA 1FNXH 3JYTB 3W2WA 1HARA 1NPRA 2CPEA 1S1XB 4YORA 1Q7LB 2BMBA 1FW6A 2X6NA 3R5DA 4UOGA 3I33A 3KLHA 2D5RA 2OPPB 3R7NB 1OYDA 4ZVFA 2FUG9 2A3JA 1RE1B 3LWLA 5AJ3J 2RE2A 3K9KA 4CJLA 3IAS9 3ENVA 3H1QA 3NRBA 3UDEA 1E4GT 1PJ7A 1YITS 3OFEA 4LT6A 2O01C 4M3XA 2DIUA 3PIPQ 4G9ZA 3FSXA 4ITSA 1GX6A 1KLMA 1C0GA 4CJVA 3SAGA 3BY5A 4GKJF 4CHYA 4LFCF 1QSYA 2O3DA 3QBWA 2CPYA 4R5PB 2WC9A 1MNEA 3PO4A 2N7CA 2X3DA 2BJ9A 3NVMA 2D7SA 2LA4A 1RT7A 2KH9A 3RJMB 2XCPA 2ZJRQ 1I51B 2XLKA 2DFFA 3GV5B 4OYPA 4E1NA 4J2BA 4I56A 3AVAA 4F4YA 3KKRA 4YMEA 4HR2A 3TX8A 2HVEA 4CLWA 4YDXA 2HG4A 2YJEA 3UO0A 2FHKA 3GG0A 3H08A