2WOMA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2womA05
4LQ9A 1NKCA 2I5JB 2JGUA 3RBDA 2ASLA 3V81A 3CDWA 3KNAA 1K1QA 1WSIA 4ZVEA 3AO3A 1NJWA 4CJKA 5HROA 4IOBA 2X78A 2HHXA 4KB0A 5KFCA 2HHVA 3AVMA 3CFOA 3K2PA 4JRPA 4EYIB 4EO6A 4KBIA 1TV6A 3WNHA 4O3RA 4CJ3A 3I5CA 3NBPB 2HWIA 4NLYA 2FVCA 1X1PA 4CEOA 3KLHA 1LWEA 4CFCA 2XI3A 3GQCA 2FBVA 3CFPA 1VRUB 3MEEA 3AVNA 4DTUA 4N5SA 4NLQA 3M8RA 4FS2A 4OKKA 3T3FA 2YKNA 3PVXA 2JEJA 4DTPA 4ELUA 2D3ZA 5DLGA 1JKHA 3BSAA 4OKJA 3H40A 1JXBA 2NUBA 1TKTA 1I3AA 1GOCA 2HHUA 3HXMA 3OY9A 1ZETA 4CHPA 5HBMA 3L3VA 3TAFA 2IC3B 4Y3CA 4AH9A 1SL0A 2QV6A 2AJQA 3QO9B 3RMAA 4KKOA 1RT5A 4F4WA 2AU0A 2KW4A 1K1SA 4CJTA 3I0SB 4DS5A 4ZP6A 3TARA 1EETB 2R8GA 4RW4B 1YT3A 3PUFA 3MEGA 3IN5A 1S0OA 5DMRA 4IH5A 4FLYA 3N6NA 3OS1A 3SNNA 4DG1A 3QIOA 3AA3A 1FKPA 1UWBB 2D0BA 3QEVA 3CM6A 2YKMB 4IFVB 5EDWA 4PWDB 3EPGA 2O4GA 4WYWA 2DFHA 4Q44A 4AHVA 1A5XA 3O4QA 2AGOA 2B5JA 4KHUA 4KHNA 3H4DA 3DOLB 4FJJA 3QIPA 1JLGA 1TQLA 4DFMA 2A1SA 5J2NA 3NDKA 4AILC 3KJVA 1SKRA 4K4VA 2FBYA 5L1JA 4B9VA 4ZP8A 3QINA 4IRDA 4CJQA 5KT5A 3G6XA 3AVGA 4LY7A 2XWYA 4F4ZA 2VG5A 3HVRA 3LP0B 3M8PB 2HMIA 4K8XA 3OSPA 3F9KA 3LPUA 1JLQA 2IDOA 2XHBA 5I42B 1D5AA 1J5OA 4OGCA 2B6AB 1WLJA 1D9FA 1UAXA 1S1TB 3ICLA 3CQ8A 3RR8A 2PY5A 3T5LA 4NRUA 1IKXB 5KT4A 1SUQB 1X9SA 4HUEA 1TL3B 3FQKA 4CFBA 4B9TA 3TAEA 5C5JA 2Y1IA 3DM2B 3BREA 3G6VA 3ZCMA 4FZXC 3AVLA 4QW9A 2UVRA 1C0TA 1RA7A 2WTFA 1HNVB 4DS4A 1RT2B 4PQUB 3JSMA 4B9NA 3JYTA 3AO5A 4TY8B 5KFOA 1D9DA 4FBUA 3BQ1A 4ED1A 1S9FA 3FRZA 3MECA 2E9ZA 1T8EA 1VSDA 5FRNA 4RNFA 2YHAA 1KHVA 1L3TA 1Q8IA 4ELTA 5KG2A 3A2FA 4CJRA 4DF4A 1LAWA 2KFZA 3PO4A 2D41A 5DQIA 4CJ4A 1WAJA 1BCOA 3HYFA 4CEBA 3VQBA 2GV9A 5C24A 2C28A 3V6HA 2V9WA 3LP2A 2BQRA 1TVRB 3I5AA 3SUNA 3DI6B 3MR3A 3ZT3A 3KHGA 5KRSA 1LWCB 5JS1A 4M3UA 3MEDA 3CDUA 2JC0A 3TQ1A 1UOCA 2YHBA 4PY5A 4KHWA 4O3NA 4M42A 4MFBA 5L1IA 4H54A 3Q8SB 4F4XA 4MQ3A 1FKOB 2C2EA 2R8KA 1S1VB 3HVTA 2UVUA 1ASWA 1RDDA 3V9WA 3Q8PB 2VG7B 3ZSOA 3SV4A 4XPCA 4NLDA 3HHKA 1IKYA 3HJFA 1BI4A 1ZBIA 5KFGA 5CZ2A 2AGPA 2RDJA 3OSNA 2W8LA 1VSFA 2Z1JA 4G1QB 4KHRA 3DRPB 1REVB 5FRMA 5KFTA 1WSHA 2FVRA 3PR5B 4RW8A 1VSMA 3F73A 1S9EA 2HNZB 1KHWA 3ISND 1HYSB 2DPJA 3VQAA 5KFSA 1TKZB 4CF1A 2IAJA 1TK5A 3S3OA 3AVHA 3SCXA 3S3NA 4ZP9A 4WXWA 2JEFA 2IM0A 4C8KA 3TAPA 4Q5VA 1IH7A 3PR4A 4NLXA 5K14A 1RBUA 2BRLA 3BSOA 1VRTA 5D3GB 3AA2A 4CEAA 3ASMA 3H5SA 4NLPA 4H4OB 3GV7B 3KK3B 4O3OA 2BQUA 4O4GA 5I3UB 1KLNA 2I1RA 1N6QB 3I8DA 3V1QA 3V1OA 1OS5A 4URQU 1J53A 1S1UB 4O5BA 5E41A 3SV3A 1RYRA 1B9DA 1S1WB 3SZ2A 4RW8B 2R8JA 1SKWA 5KFDA 1LW0A 3K58A 2GIQA 1BQMA 5KGWA 4Q0BB 3HK2A 1S9GB 1SV5B 2YNFB 4J9NA 4KV8B 3QGHA 1EP4A 4JUZA 1RBTA 3MR6A 4Q45A 3H98A 3NAIA 3NCIA 2UUTA 3H4BA 4R5PB 3NGYA 2XGPA 1T94A 2VA3A 2R2SA 2ASJA 2D3UA 2W9CA 4BE0A 3KK2B 4URSA 2WONA 5F8NA 3ULDA 4LSNB 4CGJA 2W9BA 1Z25A 1NK8A 3PJXA 3QIDA 1RTDA 3TAMA 3V6DB 5CYQB 4ZMMA 4CJFA 3N6MA 4N76A 4GC7A 4LSNA 4O0IA 3LZIA 1NJZA 4GC6A 4M3WA 4URGA 1HYVA 3DMJB 3K59A 4C8NA 4ECTA 4M3TA 1CXQA 1IKWB 1C1BB 4CJLA 3AVBA 1KCFA 3S3MA 3FQLA 4KV8A 1HMVA 5FROA 1NJYA 1ITGA 4CF8A 4M94A 1SL1A 4K4SA 4FJHA 3OS2A 4CE9A 5KFFA 1S1XB 4WZQA 3KOAA 3QGGA 4Y2AA 1HPZB 2OPPA 1QAJA 3AVFA 4ZPBA 5T14A 3QEIA 4FLUA 3SQ0A 2V0NA 3HKWA 2FBXA 4DSKA 3G0ZA 4NLGA 3OL7A 4M3XA 4CIEA 4DMNA 4W5OA 3NKYA 1BQNB 3PX0A 3L8BA 4FK4A 5KFYA 4EO8A 2AX0A 1RT1B 1T05A 3GYNA 4DQRA 3LPTA 3AO1A 4E19A 2B43A 4AHCA 2KTQA 3QNNA 3K57A 1IO2A 4MKAA 1RDCA 3QYYA 1U4BA 3U6FA 2AWZA 3Q8RB 2VG6B 4J9KA 3LALA 2IAJB 3HPHA 2HAIA 2IA6A 5DGAA 1N56A 1HYZA 1RBRA 4KTWA 1JLCB 3KKRA 3L2UA 3QZ7A 1KFSA 2XCAA 2KQ2A 2W9BB 1S6PA 2QKBA 4RU9A 2Z1GA 3E01A 1CZBA 2EX3A 1QE1A 4FZZA 4EYHB 1KTQA 4FK0A 4O3QA 2J6TA 3KMSA 2G8VA 3CJ5A 3VQEA 4CGIA 3KTQA 4CFAA 1NKEA 1RTHB 1C1CA 5KT7A 1KVBA 4CEQA 1XR7A 3GIMA 4C8LA 1XR6A 1S1VA 3HVTB 1NHVA 4KO0A 4ICLB 1QE1B 1UA0A 1S6PB 4ECQA 3ZSVA 1LW0B 2FJWA 2FVPA 4E89A 1EETA 3MTKA 4ID5A 4QWAA 3UQSA 4KREA 2R7YA 2W7OA 1RA6A 1BCMA 2VG6A 3P5JA 4NZ0A 3O3HA 1N5YB 4I7FB 1LWCA 1IKVA 1XI1A 4ED8A 1A5VA 4FW1A 1DLOB 4FLXA 3RB6A 2LSNA 4QWBA 3DLRA 3CJ2A 1WAFA 1TVRA 3CWJA 1ASUA 4IRCA 3OYLA 1TL1B 3KHLA 4DL4A 4EP5A 1GOAA 4CEEA 3OYIA 5DLFA 2IM1A 3T5KA 2DFFA 4MK8A 2RN2A 4I2PB 3M9OB 4I9LA 3VQPA 3HVWA 1B92A 4MH8A 3VQCA 4ICLA 2G8HA 1QAIA 5DGBA 1NK9A 2X74A 1LW2B 3PX6A 5EWGA 5J1EA 3G86A 3CIZA 1SL2A 1YVUA 1GOBA 1S9EB 2HNZA 4ECZA 4NCBA 4O4RA 2W9AA 3E01B 4ECXA 4ID1A 1REVA 3B6PA 4AHTA 1U04A 4G1QA 4E7JA 4L8RB 3LAKA 3VN5A 3LDSA 2FLLA 3VA0A 3DOKA 1R0AB 4J2DA 3EZ5A 3HP6A 2D0AA 4FVMA 4DTSA 1WNSA 3SYZA 3V9SA 3OHBA 2DY4A 4JS4A 4DL5A 1FXXA 4DFKA 4YR0A 2XY5A 3CO9A 3WNFA 1C0UA 4YNQA 4R8UB 5KG7A 1NHUA 4J9LA 2BDPA 4O0JA 5KFPA 1X9WA 3OYCA 1W25A 1T7PA 1S1TA 3VQQA 4KHSA 1KVAA 3PW5A 4DTMA 4CESA 4MFBB 2Z1IA 4HTUA 1RTJA 1NOZA 3NH0A 4LH5A 4E0DA 3QEPA 4R8UA 4DLGA 2WRMA 3OL6A 1Q9YA 1RTDB 3RB0A 1KFDA 2DFEA 3M9MB 3AVIA 3NH1A 3VQ8A 2OA8A 3ZSRA 5DQGA 2KZZA 5KFJA 1TAQA 4ED0A 1S1XA 4N41A 4OVLA 2WONB 2HHTA 3KLGA 5DQHA 2JEIA 3KK2A 4K4TA 4BDYA 3OYHA 2EC0A 1HMVB 3V9ZA 1XR5A 4QWDA 3KKSA 4QW8A 5KFUA 3Q8QB 3HM9A 1IKWA 1SH3A 3MECB 3RMBA 3OS0A 2F8TA 3OYFA 4CECA 4HHTA 5C25B 4IR9A 4YR3A 2P1JA 4CF9A 4KSEB 3AVCA 3PY8A 4PQUA 4FJMA 1TL1A 4B08A 1RT2A 4NYNA 2WOMB 2IS3A 1N6QA 4DTJA 1N5YA 3DM2A 5CYQA 3AA4A 2FVSA 1TL3A 3IAYA 1RCHA 3QERA 3U3GA 3V6KA 5D3GA 3PHEA 2E9RX 1A5WA 3M8SA 3AVKA 5DG7A 3U3YA 1S49A 4J9SA 4CGHA 4CJPA 4JRQA 3OYBA 3SQ2A 3BDPA 2OPRA 4FJKA 2C2DA 4DL6A 2JC1A 4F3TA 2ATQA 4Y34A 3NE6A 1C0UB 4R5PA 3M8PA 3CJ3A 3MEEB 1BGXT 3VQSA 2ZKUA 4J9RA 4E7HA 3D28A 2V4QA 5DK5A 4DL7A 4G3IA 4DSFA 1XC9A 3IRXA 4DWIA 1D1UA 2E6MA 1QS4A 5JXSA 3PW2A 4J9MA 4EBCA 2QKKA 4CEDA 1RNHA 4LH4A 4TQRA 2KZMA 1YTUA 2DTUA 5J1EB 3QEWA 3FSIA 5DG8A 1CXUA 3CFRA 1LW2A 2XO7A 4QAGA 1O1WA 1Y97A 1HQEB 3G6YA 4FW2A 1FKOA 2R8IA 4FXDA 4GW6A 3I5BA 3V81B 4DSLA 1RT1A 3MFIA 4R0EA 4RG8A 1BQNA 1YVFA 1IM4A 3ZSZA 4ECWA 4NRTA 3M9NB 2UVWA 4IDKB 4I7FA 3AO4A 4ED7A 5KRTA 4TQSA 4F2SA 2WOMA 4RNMA 2XI2A 1DTQA 4RNHA 4NYZA 4M45A 3H2LA 4EZ9A 5HRRA 1TP7A 4ZP7A 1VSHA 5C25A 2ITGA 1XHXA 4TLRA 4Z4GA 3QLHA 1U09A 4RNNA 4TYBA 3C6TA 3NH2A 4F3OA 3ZT2A 5HP1B 4U6PA 1C1CB 5KG0A 4E7LA 1VSEA 3DMJA 3MXIA 4DF8A 3T19A 4QPXA 1WSEA 2Q3SA 4N47A 3KIOA 1I6JA 2FLPA 1S0NA 1C0TB 4CHQA 4DQIA 2XC9A 4FJ9A 4CK2A 1RDBA 4B8AB 2XRIA 5F8LA 3MR2A 4JV0A 1K6YA 3KLEB 3BR9A 2VWJA 3GIJA 4CFDA 4RZRA 4B9MA 1RTJB 3OLAA 3HO1A 3O3GA 4F2RA 3C94A 3PW4A 3AO2A 1BISA 5J2PA 2B6AA 1T05B 3ZT4A 3ZSYA 2B4JA 2W9CB 3NFAA 4ZHRB 5KT2A 3PX4A 3BSNA 4CJWA 2R2UA 4ZPDA 4CHYA 1QQCA 3LAMA 1BIUA 2YNFA 3DDKA 4Z4IA 3DOKB 1R0AA 1RT4B 3KJVB 3SPZA 1HPZA 2OPPB 4HUFA 1S1WA 4B3OB 3QIPB 1C1AA 3O4NA 4ZTFA 3RB4A 1Z4UA 3DOLA 1JL1A 1RAJA 4TY9A 1X9MA 2YNIA 3EY1A 4DTNA 2BANA 4Q8FA 1WN7A 2YKMA 2FJVA 1W0HA 3SI6A 2QE5A 1DTTA 4O4GB 3S9HA 1C1BA 3QEXA 3KLFA 1ZBFA 4EEYA 3LZJA 3KK3A 3QGIA 4I2PA 1IKXA 2QXFA 5KFVA 5CYMA 1VRTB 3DLHA 3HL8A 2E9TA 2KFNA 5K14B 4OLAA 4FM1A 4KKOB 1FK9A 2D7SA 5F9NA 4FM0A 3CG7A 1DLOA 1NNDA 3L2RA 2ILYA 4F4YA 5I42A 2IC3A 5HLFB 1IKVB 2HMIB 4NCGA 4J9PA 3VA3A 4EP4A 4O3SA 4KE5A 2ATLA 4DTRA 4E1MA 4KFBA 4RW6A 5J2MA 3OHAA 4ID5B 3WNGA 4CJ5A 4WZMA 1D8YA 4IBNA 2JLEA 3ZSWA 4W5NA 3DRPA 4Y1CA 2BE2A 2XY8A 3O3FA 1C6VA 2ETJA 3SUQA 3OYAA 3LP3A 4KO0B 5J2QB 4KB7A 5L1LA 1BI4B 4Z4EA 4OJRA 1WSGA 3NF8A 4ECVA 1RTHA 4I9QA 3H5YA 3VQDA 4IFVA 4QWEA 5KG3A 1FKPB 2YV0X 3RRGA 4B9SA 2HB5A 3WNEA 2VWKA 4K50A 1S9GA 2ZQBA 4Q0BA 3ZSQA 3RB3A 4NLRA 4M41A 5HRNA 2FC0A 2ZE2B 3OYMA 1JXEA 3QETA 3ITHA 3D5MA 2XCPA 1N48A 1C2PA 1C0MA 1RILA 3BJYA 3TAQA 4H8KA 4I2QA 3H5UA 1JLCA 5L9XA 1ZTWA 4NLVA 3TVKA 2R2RA 1J54A 3P1GA 4Q43A 3RMCA 2A1RA 5I3UA 3K5OA 5SZTA 3H5XA 1QSYA 2J6UA 3TR8A 3PJWA 4DSJA 1S6QA 4DFPA 4FBTA 3E51A 5JS2A 3GILA 2OPQA 3OJSA 1TKDA 4CCHA 2W7PA 1JKHB 3LP1A 1CLQA 4CHNA 4DTOA 4KHYA 3KHHA 4YP3A 3UR0A 1JXLA 2HVHA 3M8QA 3RTVA 3BQ0A 4K4WA 1HARA 4FM2A 1KSPA 2C2RA 4NLUA 5SWMA 4GVMA 1HYSA 2P5OA 5KFNA 4HCBA 4X2BA 4N56A 2YNGA 1ASVA 3ZSXA 1VSKA 3MFHA 4BWMA 4RW9A 1LWEB 4DL3A 2P5GA 2OPSA 2OZSA 3K5LA 3NBPA 3C6UB 3IG1B 1JLFB 3V6JA 1IKYB 3GV5B 3G10A 5F9LA 1S0MA 1EX4A 4J2BA 2VG7A 2Z1HA 1JLBA 3D0PA 4FJIA 1RT3B 4RNOA 4J9OA 3IGVA 3SFUA 1LWFB 3ISNC 2J6SA 3CVKA 4B9LA 1JLQB 4CJSA 2HHWA 3V6DA 4CF0A 3C95A 3TAMB 4DU4A 4HUGA 1EKEA 2BRKA 4KHMA 4HYKA 4OLBA 2UUWA 5KG4A 1VSLA 4E7IA 1RT6B 1HNIA 3DI6A 4OKEA 5EU7A 4IH7A 1S48A 5F8MA 3TI0A 5C42B 5F8HA 2FLNA 3LP2B 4WYLA 2O5DA 4DQQA 1JLGB 5C24B 4AHRA 3OL8A 3DLBA 2YNHB 3SFGA 4ED6A 1Z26A 3AV9A 3DYAB 2P51A 2AGQA 5EWEA 1TK8A 1UWBA 3DLGA 1EP4B 2X6SA 4DG1B 4TXSA 4TYAA 2R8HA 1SV5A 4E1NA 1I39A 1N4LA 4CIGA 3PW0A 5KG1A 3P83D 4CHOA 4U7CA 4GMJB 1BQMB 3DLKB 3RMDA 3IGNA 1RT7A 3BQ2A 1MU2A 2F96A 4CHZA 4TY8A 1HQUB 3L2QA 3JSMB 4H4MB 2AQ4A 1KLMB 1SH2A 2E6LA 1RT3A 1S1UA 3UPFA 4YMEA 4ED2A 4O55A 3EYZA 2PYLA 3VQ7A 4WFYA 4CEFA 1L3VA 4IR1A 3PW7A 1WSJA 4O44A 1TK0A 1S4FA 4H4OA 1SKSA 1NK0A 3KK1A 1RDAA 1ZTTA 4ZVHA 3PO5A 2HVIA 3DLEA 4RW7A 4KHQA 1QTMA 3RAQA 1KVCA 1U48A 4IG3A 2YNGB 4B9UA 4KTQA 4NCAA 1JLEA 2G8FA 1CSJA 3FDSA 5HRPA 1UA1A 3KLIB 2IJFA 4Q8EA 3NAEA 4DU3A 2RF2A 2RF2B 3T5HA 4KB1A 4DLEA 2VG5B 1VRUA 3KLIA 1TKZA 1QSLA 2HNDA 4FJ8A 4OPJA 4WE1B 1BIZA 4ECSA 4NLTA 4CK3A 1RTIB 5J2NB 4O3PA 3I0RB 3ALYA 4DFJA 2OPQB 3NMAA 1IG9A 2FJXA 3V4IB 3KK1B 2W8KA 1VSIA 2XY6A 1S6QB 1NK4A 4QOZB 1G15A 2B5JB 2D5RA 4F50A 3MXJA 4JLHA 4M3ZA 3K5MA 3HPOA 3HSTB 4CEZA 2RKIB 1CZ9A 4CJUA 3SJJA 4W5TA 4ZVFA 3UIQA 4CJEA 4KRFA 2CKWA 5KFIA 2HNYA 1KLMA 3HVAA 3NGIA 4FCYA 4NLWA 4I2QB 2ASDA 2IM3A 1JLAB 5KFRA 1HQUA 4NLOA 2IJNA 4K4XA 2O4IA 1JLAA 3I0SA 3UDLA 2I5JA 1F21A 1NKBA 3DRSA 4IG0B 5DG9A 3MR5A 3KD1E 2HNYB 5FDLA 4MK9A 5CZ1A 3NAHA 3HT3A 3MEDB 3NF9A 4FLWA 4CK1A 3RBEA 2RKIA 2HWHA 2G8WA 5HBMB 1B9FA 2GUIA 3GIIA 3HPGA 2FBTA 2ZD1B 5KFAA 4DQSA 5J2QA 2IBKA 4EBEA 3V1RA 2OH2A 4AHUA 3SPYA 3ZT0A 1U47A 3RRHA 1RTIA 4PUOB 5CY4A 1HNIB 4M3RA 3FFIB 3AVAA 1J9AA 4BDZA 4FLTA 1VSJA 5KFEA 5F8GA 4OGEA 4MK7A 4XO0A 2V4RA 4IQXA 3GIKA 2HNDB 4YFUA 1RDRA 5JUMA 4FLZA 3SUPA 2HW3A 3IS9A 5HLFA 4PA1A 1W9HA 4J2EA 1LWFA 1JLEB 4YQWA 1RBSA 1MMLA 3JYTB 4OL8A 5KG5A 5L1KA 1HNVA 4NYFA 3RWUA 3L2WA 4BACA 4FS1A 3V9UA 2VA2A 3BGRB 3SI8A 4FZYA 1RBVA 1TV6B 1XWLA 3KLFB 3IG1A 1NK5A 1NJXA 1SUQA 1QUVA 1ZBLA 2WK4A 2WHOA 3SQ1A 4M95A 5HROB 4HVJA 2GIRA 3OJUA 1JIHA 2OZMA 1J5OB 3KMQA 1L5UA 2D0CA 2QK9A 4W5QA 3OYEA 2GC8A 1S97A 1YTAA 3LP0A 5KFHA 1VK0A 1JX4A 3CJ0A 3TABA 1LV5A 1QHTA 1TGOA 3M8QB 1S5JA 4LSLA 3FFIA 3LP1B 4OPKA 4KTZA 4ZHRA 3OYNA 3AVJA 3HP9A 4HKQA 2AX1A 3NF7A 4FJXA 3N6LA 5J2PB 2CJQA 4ED3A 1T03A 3TWHA 5T7BA 4ZPAA 4FJ5A 2FVQA 4DSEA 1RT6A 4IFYA 3PZPA 4EBDA 4DEZA 4PWDA 4RUCA 4C8MA 5KI6A 4CF2A 4EZ6A 2ALZA 3OLBA 1U49A 4JV2A 3KLEA 3BSCA 4HCCA 3OYJA 3OL9A 4J2AA 3DRSB 4IG0A 3CDEA 3BGRA 4CJVA 3NHGA 3MEGB 4RW4A 4CERA 4B8CA 1RT5B 4NLSA 4QCLA 3QO9A 2JEGA 4BWJA 3VQ6A 4CIFA 2Y1JA 5HRSA 4C8OA 3C6UA 1SH0A 1JL2A 3LWMA 3MXMA 4E3SA 3C6TB 4W5RA 1TKTB 3I0RA 3QLHB 4BDPA 4RW9B 3QNOA 3H59A 4UQGA 1KRPA 2GBZA 4ECYA 2YKNB 3OVNA 4JS5A 4DSIA 4WFXA 2BQ3A 3CM5A 5KFMA 4IKFA 3V9XA 4CGGA 4IG3B 5KFXA 5FDLB 3VQ4A 4FJNA 3T5JA 4ZTJA 4YR2A 3NGZA 2HHQA 3QESA 4XIUA 4Y2CA 3KLHB 1GX5A 5CYMB 2E4LA 4FJLA 4TN2A 2ILZA 3KHRA 3KD5E 4ZPCA 1HQEA 4LQ3A 2OYQA 3SQ4A 3VQ5A 4XPEA 4IRKA 1L3UA 2RDIA 3CYMA 4IFYB 2YNIB 4ELVA 2BGGA 5KG6A 2G8IA 3CJ4A 3ZT1A 3H08A 1T03B 4TSXA 5KGXA 3EPIA 3V4IA 2BR0A 3KLVA 4WFZA 3RAXA 4DU1A 4KPYA 4CGFA 3ITHB 5F8IA 2PZSA 4Z4CA 2X6NA 1RT7B 2ZE2A 5KFLA 3DLKA 3K5NA 5KT3A 2G8UA 4AHSA 3OYKA 1RT4A 3IRXB 4JV1A 3L2VA 2IMWP 4KAZA 4WE1A 3DLGB 4BE1A 1TKXA 1ZBUA 4FJGA 4BE2A 2EHGA 1EXQA 4FYDA 3DRRB 3T1AA 5F8JA 2OPRB 2W42A 4KI6A 4F4KA 4ZVGA 1NK6A 5EUHA 1NK7A 5EWFA 5C42A 2IM2A 4M3YA 1WNEA 4MIAA 5KFWA 2RPIA 4LD0A 5KFKA 2BE2B 4Z4HA 2F8SA 4DL2A 4J9QA 3DLEB 4RW7B 2XGQA 4MKBA 5KT6A 4K4YA 4KFBB 4RW6B 5J2MB 3VQ9A 2G8KA 3THVA 4KI4A 4O44B 2UVVA 5KFBA 4NCGB 3D45A 3NF6A 4DTXA 3PV8A 4K8ZA 2F8EX 1BL3A 3OYGA 2XY7A 4IH6A 3OYDA 3TANA 1XHZA 1L3SA 1LAVA 1QSSA 4Y1DA 1ZYQA 1RYSA 3AA5X 1FK9B 5KFZA 1NOYA 2WB4A 2IOCA 4H4MA 4Z4FA 3LWLA 4ECRA 2WCXA 4ECUA 3LANA 1D0EA 3MAQA 4E7KA 2C22A 1T3NA 1MU2B 4Z0UA 1Q9XA 1S10A 1JLBB 3IS9B 3MF5A 1HRHA 1JLFA 3EZUA 2R2TA 2IGIA 1DTTB 5HP1A 3TAGA 4K4UA 3DYAA 2BANB 5KFQA 1GX6A 4RUAA 2OPSB 4PUOA 2YNHA 3NGDA 1TAUA 3KLGB 4WXOA 4IKAA 4FJ7A 1WSFA 4B3OA 2HHSA 2DPIA 4QWCA 3QZ8A 5KTQA 4DQPA 3L3UA 2ZD1A 3GV8B 3RR7A 1DTQB 4CGDA 3NL0A 3B6OA 2PYJA 3DRRA 1HJRA 4FK2A 4LSLB 4MIBA 4FLVA 4IDKA 1TKXB 4K4ZA 1BHLA 4KAIA 1U45A 1ZBHA 3SUOA 4F8RA
chains in the Genus database with same CATH superfamily
1FDAA 4LQ9A 4EU0A 4CVNE 1MWYA 2LXFA 3RBDA 4J7CA 3Q7BA 1S59A 2KHOA 3KWGA 3CC2N 2J0XA 4PQAA 3J7YU 4I6YA 4M5GA 4QU7A 1NMDA 4FF4A 3RBZA 2HHXA 2ZOMA 3SK3A 3F5TA 3UCGA 4O3RA 4NLYA 4TNOA 1RWXB 3KLHA 2X1AA 1VQ7N 1LWEA 4DR7J 1P8GA 2Y1LB 4OJ3A 3RYLA 3CC4S 1OWXA 4CO4A 1MSWD 5FLXU 3MEEA 4C0BA 4P52A 3M8RA 3VEYA 4BRPA 3MMVA 3J7YI 2JEJA 2DGWA 4ELUA 2D3ZA 2DNNA 4CM0A 4C8YA 1TKTA 1SJ3P 2HHUA 2FSNA 3RRKA 1NM1A 4CHPA 2VH7A 1X3MA 4DI6A 3HF5A 1NGJA 3WXMB 1X4GA 3TAFA 4Y3CA 3F0NA 1G6BA 1EKSA 3RMAA 4ZA1A 4KKOA 4OHZA 1YI2N 1T6CA 3I0SB 1F9EB 4AYBD 3TARA 1EETB 4PZVA 4FKXA 4RW4B 1FJGF 1G1XA 3F56A 3OS1A 3ETOA 3HCXA 5EHHA 3AA3A 2D0BA 3QEVA 2YKMB 4IFVB 3G4SN 4PWDB 1S7IA 2DNPA 1A5XA 2B5JA 3W63A 3CCZA 3TUZC 2CNKB 3KFWX 2VFSA 4YY3J 2IYGA 2NCKL 2ZZMA 5J2NA 1QQNA 4AILC 1LOUA 2XLJA 1SKRA 4RWWA 3SEOA 4LF4K 2ZJPL 2FBYA 2MKCA 2YCHA 2CFXA 4X65J 4ZP8A 2O8BB 4ILJA 3FLCO 2VG5A 3MCOA 2HMIA 3R5AA 3F9KA 3UNYA 3LPUA 1JLQA 1U2CA 2PMHA 2IDOA 2XHBA 4HDGA 3MAAA 2OELA 2D0PA 1WLJA 2GTDA 1D9FA 2R7XA 2HBMA 3QRRA 1S1TB 5C2DA 1VQ6S 4XDDA 4B3TF 4HR2A 2PY5A 3T5LA 2VONA 2ZVIA 1FDNA 3D6HB 5KT4A 2CWXA 2MMYA 3SQGA 4EFHA 5GAHP 1ZC6A 1ZZNA 1TL3B 3FQKA 4CFBA 4B9TA 2OTLN 3VAFA 4OLPA 2U1AA 1K44A 2MQ8A 2MKHA 3BREA 2B4UA 3TJ9A 2YX6A 4BRKA 2DR8A 3CCEN 1HNVB 4DS4A 1FVSA 3GBTA 3IBWA 5HMYA 4B9NA 4WK3A 4JI1F 3AO5A 1D9DA 1NSQA 3BQ1A 5HL7Q 1VISA 1S9FA 2MLYA 3JQJA 4GKJF 1MWQA 1KHVA 3MN5A 4OJGA 4QIGA 5L46A 5KG2A 4YOWA 3IR6B 1KVIA 3CJRA 3PO4A 1U1QA 1WAJA 1IJJA 2P6TA 5F1XA 4CEBA 3VQBA 5C24A 5I4MA 4NE9C 3V6HA 3GG0A 2V9WA 5DM6Q 3I5AA 1S0VA 1FTRA 3ZT3A 1UVMA 3MOJB 2V7ZA 2C3UA 1LWCB 1RWMB 5AXMA 4CT8A 3ZTQA 4M1KA 3TQ1A 2VPYB 1UOCA 2YHBA 2DGQA 3AARA 2LQJA 3THXB 1QAYA 3K0SA 4FWLA 3UWTA 2QA1A 2LEAA 4H5WA 1N33J 1R3NA 3W1YC 2VG7B 1VQKN 1VQOS 1IKYA 4FWNA 4DR5J 4DR7K 2DIUA 2VFRA 5CZ2A 1YLXA 1VJWA 4KHRA 1REVB 4P71A 5FRMA 2GX9A 5KFTA 1WSHA 1MMDA 2HURA 5IV4A 1VSMA 2HS0A 3J80U 4F02A 3POTA 3S3OA 3AVHA 5DJBA 4BS2A 3QFHA 4ZP9A 4WXWA 1UFLA 4C8KA 3TAPA 2W2PP 3ZZZA 5D0RA 5K14A 4DR2J 2J0WA 4QIVA 4OX6A 3LW5C 3CCUN 2RQKA 3H7HB 3H0PA 4YHHF 3JS6A 4JHDB 2DHXA 4O3OA 3E2EA 1LFWA 2ZFHA 2MSSA 4AXIA 1G99A 5I3UB 5EGYA 1N6QB 3P6YC 3I8DA 4F36A 1NGAA 4O5BA 4USMA 5E84A 5E41A 1RYRA 1S1WB 2ZNYA 3CDAA 2GUPA 2RU9A 5K5MA 2GIQA 2EFVA 4J9UE 1K8KB 4Q0BB 2IVOA 3E1YA 1S9GB 3BS9A 4J9NA 4I67A 3CETA 2QO3A 3R6MA 3H4BA 3NGYA 2ALYB 3VGLA 3ATUA 4LVNP 2N3OA 4QIEA 2W9CA 1BXNA 3KK2B 1VAZA 1X4BA 5F8NA 2XTJP 3CI5A 3ULDA 3MMCB 4YOYA 4LSNB 2W9BA 3VGKA 3CJ1A 1Q95G 2XMUA 4W92B 3IR5B 2V63A 1N0UA 4OYIA 5CH7B 2IVNA 3QIDA 1RTDA 4RR5A 3TAMA 2KKHA 3CCVS 3V6DB 1CVJA 2AHOB 4AL6A 3N6MA 3B4DA 4JI4F 2EK1A 3LPYA 1MDUB 1CJKB 2DY1A 2LA6A 4GC7A 1RQ0A 3CULA 3J8AA 5ETSA 1P6TA 2PN6A 3OFEA 4WP9A 2BXJA 3TA1A 4A8KA 2ZWHA 2BBEA 1KAZA 1S72N 3R5DA 3L4IA 2ZJPQ 4MLEA 4C8NA 1TL7B 2P9CA 3MM7A 2F5GA 4C3KA 1KCFA 2XB2D 1UW4A 4JI3F 3QSYB 4M94A 3A3PB 1SQGA 4HH1A 4LF9J 4DU7A 5L8RC 3NCPA 4FJHA 3KDOA 5KFFA 1S1XB 4WZQA 4DV4F 1QJHA 2I0XA 3NEKA 5T14A 5MAOA 3HKWA 4AT1B 1P90A 5F41A 2CPFA 2FQQB 2J8SA 3OL7A 4NLGA 3IBFB 3MM7B 3IMQJ 1BQNB 2VOOA 3L8BA 4WK1A 4USHA 1VQYA 4EO8A 2F4VK 5AQLA 3FGUA 4LSZB 2E2NA 5AZIA 2BX6A 3AO1A 1WF0A 5K8MA 2H3GX 3BR8A 4IOCL 3K57A 4P2MA 4MKAA 1KXPA 3U6FA 3WC0A 2QFJA 3Q8RB 5F0XA 2IA6A 3KKRA 1M90T 3NRBA 3K5PA 2QLXA 2W9BB 1RABB 3E01A 3G4SS 4FZZA 1VK3A 1KTQA 4FXVA 2DR7A 1EKRA 4CTAB 3OHRA 3GMGA 2J6TA 4DX8H 3KMSA 1Q7LB 4D3HA 3A5MC 1U1MA 4H0XB 4CGIA 3D6RA 4CEQA 1CJVB 1NGBA 3MEKA 3I56S 2YHYA 2XM3A 2RVJA 5FPNA 3JB9k 1V3SA 5BXIA 1K8KA 4UF4A 4CLKA 3E9LA 4RWTA 5ADZA 1RBLA 2R7YA 3E3XA 3IR7B 3DGPA 1BCMA 3O3HA 5KPZA 4I7FB 1FVQA 2ROGA 1RLCL 2DNYA 1O5JA 1YJNN 2LSNA 1WAFA 3CJ2A 5AQQA 3CWJA 4IRCA 3OYLA 1NBEB 1RHUB 4EP5A 4CEEA 3CCTA 2RE2A 4L6V3 3T5KA 3EZWA 4NXMF 1HBOA 3T9ZA 4B3TK 4MK8A 2RN2A 4I2PB 3VQPA 2OEJA 4MH8A 3VQCA 4ICLA 3JSYA 3ILOA 1GMWA 1LW2B 2CJYB 3PX6A 4CZHA 1NPRA 4A8WA 3FEXB 4JD2B 5LJ5Y 2GVZA 3GR0A 3P4UB 5BR9A 4PABA 3FR0A 2KT3A 1FDDA 4O4RA 2W9AA 1L3KA 4ECXA 4JI1K 1UJ5A 1REVA 4AHTA 1U04A 2F7TA 3BN4A 3AB4B 3LDSA 3VA0A 2FLLA 2P9PA 5D15A 3EZ5A 3HP6A 4DR3F 3Q8VA 4DTSA 1BO5O 4DL5A 4DFKA 4RL1A 4YNQA 5KG7A 2BDPA 2X1BA 2ZGYA 4O0JA 5HVFA 3AQPA 5THWA 3THXA 4DTMA 2Z1IA 3UE5A 1RTJA 1VQ8N 4LF8F 1UETA 1KAYA 4DLGA 3PHTA 2QLJB 2WRMA 3OL6A 1WC4A 1Q9YA 3GJSB 2W40A 4FWMA 5E7OB 2KRRA 4LJMA 4A2BA 2KVQE 1M5PC 3A1YG 1J2VA 2KZZA 1VBKA 1TAQA 1Z05A 4LF1A 3L95X 1U2FA 3LPEA 4ZDNA 2ZH7A 2MQLA 4M7YA 2AW0A 2HHTA 2JEIA 3A4TA 4K4TA 3W0LA 4BDYA 1HMVB 4DHVA 2Z2LA 3HM9A 2CH5A 2NZCA 1IKWA 4DR7F 3RG6A 1SH3A 4B1UB 4OYZA 3OYFA 4CECA 2HBYB 3WHIA 2P1JA 4CF9A 2VQFK 3N5FA 4FJMA 4B08A 1FXDA 5AZJB 1VQ4N 1KNZA 5CYJA 3PKYA 3VAGA 1N5YA 5CYQA 1D09B 3TUPA 1HR0J 1U0SA 1SPBP 1TL3A 3IAYA 1U1KA 3FBCA 3NMUA 1RZMA 3V6KA 1R8CA 3PHEA 2DGVA 3A8KA 2DHGA 4M8LA 3M8SA 5LSOA 4ISFA 1B0PA 3AVKA 4J90A 1HWIA 3FGVA 1RAGB 2DGOA 4YHHK 3U3YA 4CGHA 4CJPA 2VBXA 3H90A 2JC1A 2P6SA 4DX6A 2ATQA 4ZJQA 3O6QA 1OQ6A 4J9RA 3D28A 3VF0B 5BPLA 2O8BA 4DWIA 4DSFA 4RKUC 1D1UA 2NS1B 2GAGC 2HIYA 1XERA 5JXSA 2AMCB 4LR7A 3PW2A 4J9MA 4EBCA 2QKKA 4CEDA 3D4JA 1N36K 5G0RA 1QUPA 4LH4A 2ZGZA 1KP6A 4DUZJ 1YTUA 2B51A 2I8EA 1N32F 1Q79A 1LW2A 1HBNA 4I6MA 2ADCA 4QAGA 1FRIA 2AJ0A 1Y97A 1Q82O 1B4SA 4DN9A 5D4NA 3AY9A 1DHMA 2W2MP 4Y2MA 3DLLL 1PSDA 2H4WB 1BLUA 2RDDA 5HQMA 3VEOA 1T3OA 4R0EA 2E1MC 3C65A 2Q31A 1O8BA 1ZAVA 4BQZA 4ZPWR 4A5AA 3M9NB 4V1Ak 1FWLA 2CQPA 3A5OC 4IDKB 4I7FA 1UVNA 3H8YA 4B3TJ 4F2SA 3GJTB 2H51B 4JI2K 3R2CJ 1HHTP 1RB0A 1WOOA 3MMBB 1VSHA 2ITGA 4BRHA 2ZOGA 2KYZA 1RHRB 4F3OA 4NB4A 3WXJA 4JI2J 4JKBA 5HP1B 3PRDA 4DV5F 2MY8A 4E7LA 2CZ9A 1WDTA 2QWMA 3ZZ0A 4HDHA 2O66A 2JZ5A 1AROP 5ETOA 3KIOA 1XTZA 3KXDA 4UQTA 2FLPA 1S0NA 4CHQA 4DV4K 2XC9A 3R7BB 5K9FA 4AM6A 1RDBA 2XRIA 3BDEA 3O1BA 3O9QA 4JV0A 3DGVA 1VQNN 3GIJA 3CC4N 3HX9A 2F4VF 2RMLA 3WXLA 4JI6F 4QPTA 1VQPS 2F9JA 2CQ2A 3ZT4A 1W2BM 3CCJN 5KT2A 2DNKA 3PX4A 3BSNA 2FJAB 4AQYF 4JYAK 2JFDA 1QQCA 3LAMA 1NO8A 1WTBA 5AQHA 4I69A 3CMAN 2O8FB 3SCIE 2GVDB 4AFFA 2ZUGA 4HEA9 1FA0A 4EI2A 1N5QA 1JWWA 1C1AA 1JK9B 1B70B 2VICA 2ASMA 3C15B 1YJ9N 1VDHA 2B4PA 4DTNA 2P9KB 2FJVA 3SI6A 1X0PA 2QE5A 2E7WA 5LXRA 3QEXA 4OHVA 3KLFA 4DUYJ 4K42A 3G25A 2CG4A 4DCPB 3OXGA 5KFVA 1UTAA 5KOXA 1VRTB 4WJBA 1P1LA 4AD6A 5TKWA 4IOAQ 4OLAA 4FM1A 2D7SA 3MCPA 1H6KX 2QM1A 2FGOA 2NUUG 2E8AA 1DLOA 1NNDA 2IC3A 4YDDB 5D0EA 4J9PA 2Z2ZA 2ZHAA 4X62K 2ATLA 4DTRA 3PEJA 1ZH5A 2EI5A 3OHAA 2VFTA 4X4RA 3GB0A 2ZZNA 2XY8A 2ETJA 3SUQA 3OYAA 1PJ7A 4KO0B 1LWXA 2E5HA 2QL5B 3LGMA 1RTHA 3VQDA 4QWEA 1X4CA 1UVLA 2HB5A 1S9GA 2ZQBA 1S7HA 4Q0BA 3ZSQA 2BA9A 3W66A 4M5DA 3GG4A 5ADXA 2XCPA 1N48A 4ED5A 1C0MA 3TAQA 3NNHA 2C2NA 1ZTWA 1RFQA 4Q43A 1NGCA 4DHYA 3EE8A 5HSPA 5I3UA 5SZTA 1QSYA 3K89A 3VVTA 2LCWA 3TR8A 3PJWA 1FE4A 3SSSA 1RAIB 2GQCA 5JS2A 5A76A 2VUGA 2XLKA 3IKMA 1TKDA 2DNMA 3PFOA 2DCLA 2C2MB 2GO9A 4YP3A 1PJ5A 3GU0A 1JXLA 4LF8K 3U1NA 2IMOA 4P72A 1GFWB 1VQPN 1FE0A 2ZH8A 2CQDA 4RO0A 4WQ4A 4XK8C 4X2BA 2YNGA 1S79A 4PXDA 3DOMA 2E5LF 3TUJC 1GMVA 2UXBK 3C6UB 3FZMA 1IKYB 1EX4A 1DBDA 2VG7A 5AQIA 4OYAA 3D2FA 1JLBA 3D0PA 1Q86O 2CQIA 3IFRA 2J5AA 2ZH6A 2VQFF 3RUBL 3QT6A 4I56A 1GEHA 3TYTA 3SFUA 1LWFB 5CCMA 3CVKA 3M5RA 3UKRA 3S8SA 4CRJA 2RSQA 5C7PA 4PG7A 3M2RB 4IWVA 1FCAA 2V8GA 3K9KA 2PO4A 4KHMA 1RAOA 2CJXB 2YX7A 5KG4A 2Q0UA 2NSCA 3HHDA 2OTJS 2MGZB 3KJFB 5F8HA 4HT7A 3GL1A 2IPOB 5C24B 4AHRA 5E3CA 3DLBA 2YNHB 3P8BB 3VMFB 2YWEA 3I6PA 1Z26A 1NM2A 3NOCA 2Y9HA 4OYOA 5EWEA 2WUSA 3TJ8A 1TL4A 5E3AA 1E6VA 2E20A 4OJHA 2DHAA 1I94F 4GMJB 3RMDA 1RT7A 4ZLPA 4CBXA 4CT9A 1V6HA 3ULEA 3LA0A 1SH2A 1F0XA 2E6LA 1RT3A 1S1UA 3Q8YA 4YMEA 3DXMA 4WFYA 3IM9A 1FDBA 1GXTA 1L3VA 3AOBA 5AE3A 4B3RK 1YBUA 4O44A 2GNKA 1S4FA 1TK0A 3VF2A 5IT9O 1SKSA 3SBTA 3SQGB 5FD1A 2YI1A 2XS7A 2IYIA 1RDAA 2UZAA 1ZTTA 3PO5A 1VQMN 1N5TA 2AEFA 2XYGB 2UUAK 1U48A 3WIUA 1AT1B 1XNRF 4G9ZA 3R5GA 3DXSX 3F41A 5GADU 3NGTA 2ZH4A 3BH6B 4DU3A 2RF2A 2VG5B 1VRUA 1TKZA 4YORA 1QSLA 4FJ8A 1BD6A 3MPUB 2IBOA 1VHFA 3CJCA 4RBTA 4CK3A 5J2NB 4O3PA 3L3CA 5GMDA 4DFJA 2OPQB 3B6BA 1RE1B 1IG9A 1M1GA 5AXLA 3FSYA 3KK1B 1S6QB 1Q0NA 5AE2A 4QOZB 1G15A 3U9DA 2ZVSA 2B5JB 4M3ZA 3MXJA 5HJYA 4HHJA 4O0NA 4DV5K 3ELHA 3SJJA 1HNXF 3CJ9A 3AFGA 2OEKA 3AAQA 4RLEA 1K0TA 4I2QB 1JLAB 1WHYA 1U1LA 2LEPA 3Q83A 2O4IA 1JQGA 2LP4A 3I0SA 3U1LA 2I5JA 2WBNA 3MR5A 5DG9A 3K2YA 5FDLA 4USWA 2BV3A 3CMEN 2YQ0A 2WW8A 1BOTO 4CK1A 3RBEA 1QTNB 2YKOA 3MM5B 4TVAB 4AL7A 2D9OA 2FC9A 2ZD1B 4DQSA 1FTCA 4LF8J 3FEYB 4EBEA 2OH2A 3ZT0A 1KR4A 5LY3A 1U47A 2O01C 5CY4A 1HNIB 3LDNA 5F3ZA 1J9AA 3MUTP 2V4RA 5AQOA 4IQXA 4AQYK 3HMJG 4RU2A 4B1VA 2M88A 1U6FA 5IWAK 2G1DA 2AV5A 3IS9A 5HLFA 4PA1A 1W9HA 3M30B 3E9OA 4CO0A 2G2OA 2GA7A 1RBSA 1GLFO 1WUAA 2VU5A 5HANA 5DDRC 4BACA 3FCHA 4RBUA 4FS1A 4ISGA 2VA2A 4YS2A 1IBMJ 2WBRA 3W8GA 1I94J 4YY3K 2Y3YA 1RBVA 2KVIA 2ABYA 1EJ7L 4MKYA 1NJXA 1SUQA 3CB4A 2WHOA 2XMAA 3ENWA 2A2CA 2GIRA 1X31C 3OJUA 1FNOA 1ITPA 4F7VA 5JVHQ 2A10A 4DR6K 4W5QA 4QS8A 2GC8A 4BQLA 1RTZA 4ZKAA 2RRAA 3LP0A 1VK0A 3P3DA 4N8NA 1S12A 3CJ0A 2RQ4A 3EGZA 5CAAA 2I7NA 1FRMA 3FFIA 2MKJA 4EHTA 5A8KA 2W7AA 5HATA 3O4WA 1T02A 3AVJA 4HKQA 4DV3K 4XH1A 4KRWA 3N6LA 5J2PB 2IJRA 3TWHA 1RWNB 2CQ3A 2ROEA 1EIYB 4OZ1A 5KI6A 5TKYA 2ZBCA 4FF3A 4JV2A 3LDOA 1TMMA 3KLEA 3BSCA 1FJGJ 5FJ4A 1OY8A 2MJNA 3DRSB 2DYAA 3BGRA 4HI2A 4DX5A 1KDNA 3G82B 2UUBJ 3MEGB 4DUZF 2YPZA 4DV5J 4CERA 4F26A 3BM7A 1RT5B 1N32J 3I32A 4BWJA 5LSRA 4CIFA 1D3WA 3D54A 4ES3A 5HRSA 3G8SA 1TL5A 4C6AA 5A2QY 1JL2A 4ZVRB 1VQ8S 4USUA 4H5NA 3I0RA 1PKUA 3GFYA 2BVZA 4RW9B 1VQ5S 1HR0K 3O6WA 1KRPA 1X9JA 3MWPA 3OVNA 4P75A 4JS5A 2DHHA 2N3LA 2CG8A 4WFXA 2KH9A 2BQ3A 2BJDA 2RAQA 4IKFA 1U1NA 4JI7K 2ZWPA 2DT9A 2EG2A 2ZH1A 3NCQA 4IG3B 3DHXA 4AM7A 3M6WA 3VQ4A 1NGEA 2HHQA 2V8PA 4A5BA 4DR5K 1GX5A 1G2EA 4KGKA 2E5LK 3W9IA 4FJLA 1EQYA 2PBDA 1FHTA 4BRMA 4KYZA 4ZPCA 4U7BA 2ZH9A 4LF9F 2UXBF 4CWBA 3LDPA 2ROPA 2DNHA 1EWRA 5D6GA 4BRDA 4B3SK 1VGYA 2RDIA 3MX2A 3A8YA 4GO5X 3SAHA 2GCFA 4QBUA 2RQCA 4EUVA 3ZETA 4TSXA 1T03B 5KGXA 3V4IA 1GH8A 1DY3A 3QBCA 4CGFA 5F8IA 2XHWA 2ZE2A 3E8OA 1ZOTA 1WOQA 3PYDA 2NRWA 1IR1A 1NBWA 1V9OA 4WE1A 2F4VJ 4BE1A 4A47A 1T0TV 2YQ1A 4FJGA 3R27A 1EXQA 2HQDA 3T1AA 2OPRB 4L3QA 1CZAN 2LFVA 4ZVGA 4H0VB 1CULA 4ED4A 3PSFA 2J0QD 5C42A 3Q22A 1WNEA 1WDDA 5KFWA 2RPIA 1K0VA 4E1JA 2N7CA 3AJ2A 1EAYC 2PFUA 3OTEA 4RW6B 1YZ6A 4KI4A 5E5NA 3X3UA 4B1XB 3CE8A 1T9UA 3KUEA 4GMKA 5KFBA 3OVAA 4NCGB 1BC6A 3RSEB 1WEZA 4HTLA 3HBTA 1BL3A 3OYGA 2XY7A 5CHIA 2LXIA 5AQUA 1SJQA 4CO1A 5KFZA 5JJBA 2MQNA 3TUIC 4CM2A 2XSFA 4Z4FA 5H1SQ 3THWA 4RUBA 3DFEA 2F9DA 2L9NA 1S10A 4ISEA 2XEXA 3EGVA 4C98A 2QSFA 3C2PA 2D69A 2FXUA 2KT2A 2PC6A 2UUBF 1HRHA 1Y9OA 5F3TA 1DTTB 4L74A 4K4UA 3MPYA 3LTOA 3BP8A 4PUOA 4JKEA 2CNLB 5AJ3K 1SJRA 4FJ7A 1AFIA 4DQPA 5AQYA 4K43A 3DKDA 2UUAF 5BR8J 3DRRA 1TMJA 4LSLB 4CH0S 1LEOA 2KYXA 2UXDJ 4FLVA 5B0GA 3IBCB 3O3LA 4OX8A 4F8RA 4M5NA 3EGNA 5LMNF 1NKCA 3C3LA 3ZX2A 3EE3A 2XLIA 3V81A 3KNAA 1KBRA 1NJWA 2QWOA 4CJKA 4CYUB 2W41A 5HROA 1PC4A 3G71S 2X78A 2NREA 2OP5A 5KFCA 3MMAB 3ENBA 2M7SA 1KQSR 4C0HA 1WSRA 4DV2J 1SJFA 4ERDA 1HNXK 3WNHA 2MTLA 3NBPB 3I5CA 3DCAA 4CEOA 1WEYA 4M63C 3IUCA 3PIPQ 4CFCA 2B8QA 1J6ZA 1SKUB 4JV5J 2GQQA 1ZM3A 2MZJA 3AVNA 3D2WA 1RGVA 1E6YA 4N5SA 4FS2A 4AL5A 1F3FA 3T3FA 2KHDA 2X3GA 3PVXA 3C7NA 3JXUA 2WSCC 2KB2A 5DLGA 2Q79A 4NZ6A 1JXBA 2NUBA 1I3AA 2Q97A 1CS4A 4JI0K 3TEHB 2J9DE 3TO8A 3OY9A 5HBMA 2E1YA 1HKAA 2AJQA 2VZ9A 3NOGA 3P38A 2AU0A 2Q6CA 1K1SA 4CJTA 4ZLJA 4ZP6A 4WQ5A 2UV8A 1DQ9A 2JVRA 3AA8A 1E4GT 1NCLA 1S0OA 5H9EK 4FLYA 1XK8A 3SNNA 2KXHA 4DG1A 1UWBB 3CM6A 1AYEA 1H98A 2DFHA 3G87A 4M63A 2Z58B 3DOLB 2QJ3A 4FYXB 3QIPA 3ID8A 2YKPA 4DFMA 2A1SA 1BDGA 4K4VA 3QINA 4CJQA 1M0SA 5JICA 3ZX0A 2KG0A 2XWYA 4F4ZA 3HVRA 2AIRB 1URNA 3QJPA 2XHCA 1YZ7A 1XNRJ 4ZN3A 1B7YB 4OGCA 2B6AB 3OR2B 3FE1A 4DV3F 4UUXA 2UXDF 3G9CA 3ICLA 3CQ8A 1N34K 2DRAA 1X4HA 1M90O 1IKXB 5LMNJ 3U27A 2G1HA 4N8OA 3I55S 4HUEA 4ALZA 1IBLF 2WB1D 5C5JA 4M5JA 1UFWA 1XN9A 5EY4A 3G6VA 3M6GA 4MAKA 3N4QA 1RT2B 2HBLA 1UEVA 3MDFA 4JKHA 4PQUB 4BVPA 3C46A 3JYTA 4P73A 4TY8B 5B0BA 3OT9A 4ILLA 2V50A 4FBUA 3CPEA 4ED1A 3FRZA 3MECA 1AB8A 5FRNA 4RNFA 2YHAA 1L3TA 2HZCA 4QIFA 3KNGA 4ELTA 4KBOA 2O8CB 1FJ7A 2YWKA 4DF4A 4NZ7A 2YJEA 4IJAA 4DR1K 1AZSA 3HYFA 5HVGA 4JV5F 2AP1A 2GV9A 1RADB 1FERA 3LP2A 2XSJA 3BEXA 2QX0A 1FW6A 4XDCA 1SJ4P 2L9WA 1SC3B 4OX9J 3I31A 4E8UA 3WT0A 1MMNA 2X7IA 4FL9A 2R7SA 2BJ1A 4DV6F 2JC0A 3HHLC 3Q8UA 4PY5A 4OPAA 4KHWA 1M5HA 1Q1KA 4M42A 4MFBA 2NRZA 2ZZTA 4MQ3A 1FKOB 4CLTA 1RHQB 2J76E 2C2EA 2Q43A 2R7RA 1ATSA 1JMTA 3HVTA 1U1OA 2XMWA 3P96A 5A8WB 3O9UA 4LF9K 3ZSOA 1QAXA 2CWKA 4HLBA 4XPCA 1DQ8A 2RB7A 4ANEA 1EZZB 3QJJA 3HJFA 4QIWD 2POKA 5KFGA 1IBMF 2M2BA 3TTCA 4G1QB 2PA3A 3EGWB 2XYHB 3TZZA 3PR5B 4RW8A 3VEVA 3AXKA 1KHWA 5AR0A 2HHPA 1SBRA 2ZBIA 3UO0A 3N9UC 4I68A 3EWGA 1TUYA 3SCXA 1U0HA 3S3NA 3QAUA 2UUCJ 4Q5VA 1IH7A 3R5BA 1ILYA 3EVMA 2Q3PA 2P8IA 1RBUA 2BRLA 5D3GB 1ZPVA 3ASMA 3H5SA 4H4OB 3KK3B 4O4GA 4DMZA 2L3MA 3W61A 2X1GA 1J53A 5ETLA 2Y0BB 3A5NC 5CZVA 5H9EJ 1B9DA 4LF7F 4FPRA 3QBWA 1LW0A 1BQMA 2QMXA 3HK2A 1Q5YA 4CLUA 1BA0A 1SV5B 2YNFB 4MIWA 4KV8B 3QGHA 1EP4A 4DV0J 1V3ZA 2UUBK 2HVZA 3NAIA 3LGHA 1YTYA 3HHLA 3NCIA 3EEQA 4A46A 1NUEA 2D3UA 2ZM6J 6FDRA 2WONA 2J9CA 3VHQA 2E5IA 5HJXA 1P9QC 1HIYA 4CGJA 1O6XA 2BJ7A 5F2RA 1Q86T 2R4FA 1PAUB 1PBUA 1SXLA 3QBXA 1LCUA 5I3QA 3CJKB 1NGIA 1TU0B 3F9MA 3TR5A 5A8RA 1EB0A 2E1CA 4FYVB 5LMNK 4DPYA 4EGLA 4L3KA 2F1FA 2ADBA 1A0OB 3CD6S 4OYWA 1VOMA 1IBCB 3DMJB 4C1NK 2I9SA 1CXQA 1C1BB 2W6LA 4Z94A 4OMFG 4KV8A 2XZDB 1NJYA 4PKHA 1X4DA 1LNQA 3WX8A 5CXTA 2VFUA 3OW2R 4USTA 4Y2AA 2OPPA 2ZEJA 3SDEA 1F5AA 2VC1A 3QEIA 3SQ0A 1BU6O 2DGUA 2FBXA 4DSKA 1RWUA 3TZXA 4M3XA 3AOAA 4CIEA 4DMNA 1JJCB 1KVKA 1WOPA 1K47A 3O5TB 4WKYA 1T05A 2C1EB 4KGXB 4PG5A 3LPTA 2K1RB 5HMZA 2KTQA 2B9YA 1RDCA 1VI7A 4LFCK 3QYYA 2BOAA 1EQ0A 2LQ5A 5GMKa 2FC8A 2AWZA 5ITHA 3LALA 3HPHA 2Q1NA 5DGAA 1RBRA 4KTWA 1JLCB 3NCRA 3L2UA 3QZ7A 2M0GB 5DM7L 2KQ2A 1ZS6A 2RQMA 4BC5A 3C16A 1S6PA 4FPIA 4L3NA 4IOXA 2EX3A 5IQ6A 1QE1A 5FIIA 4EYHB 4FK0A 4HACA 3PM9A 3CJ5A 3AJDA 2FSKA 4N77A 2H1YA 3EX7B 3KTQA 4CFAA 1K73T 1C1CA 2V9KA 3BYRA 3GIMA 3MPWA 4C8LA 2EKYA 3HVTB 1NHVA 1UVKA 5AXNA 3UI3A 1W97L 3W2VA 2FJWA 3G6EN 4ID5A 1TUGB 2EC2A 4LF4F 4KREA 1X60A 1ZBSA 2W7OA 1I5OB 1RA6A 2VG6A 2P9IB 1G3OA 4NZ0A 3NS6A 1IKVA 1XI1A 4ED8A 4FW1A 4FLXA 7FD1A 3DLRA 4QWBA 4QOTA 1MN7A 2GAHC 1GOAA 3OYIA 5BN9A 2WVBA 5DLFA 2UXDK 2IM1A 2ERRA 3HD1A 4IJNA 2DNGA 2OGUA 3O5BA 3W9JA 4OHYA 1A6LA 3PIOL 5I3PA 3S1TA 3NS7B 1B92A 3D2EA 5DGBA 4MYUA 1IBLK 5LJWA 5EWGA 3IFEA 1RAFB 1XNQK 3J81Y 1KAXA 3CQYA 3WIVA 1FRHA 1S9EB 2FHJA 5CABA 4WBFA 2RUGA 1GQEA 4B3SJ 1O51A 3M2VB 3CHWA 3JTOA 4BCAA 4CO3A 2ATCB 4H5VA 3VN5A 3DOKA 1R0AB 3SYZA 4GKJK 2DY4A 4JS4A 1Y0HA 3J7YP 4BC2A 2AJFE 2BE9B 1M1HA 2RIJA 4R8UB 1RCOB 1U25A 3PDNA 1NHUA 4WFAQ 4J9LA 1P8ZA 5BR8F 5L39A 3VPZA 3OYCA 2BJ8A 4KJIA 4PG6A 3VQQA 4KHSA 1X0FA 4ETXA 3HJVA 4U96A 5E2QA 1NOZA 1PILA 2DEIA 4WTOB 4E0DA 3MK6A 2A5XA 3QEPA 4R8UA 3ZYYX 2VJVA 3J7ZT 3M9MB 1HBMB 3VQ8A 1GMWD 2V4JB 4LMZA 3ZSRA 3T7ZA 4FOIA 4OX9K 4OHWA 2XMMA 1HNXJ 2GELA 2DO0A 4EHUA 1T95A 2YQ3A 4OVLA 3KLGA 1WC0A 4FZVA 2O67A 2EC0A 3V9ZA 1XR5A 4QWDA 2O8EA 4CQ1A 4QW8A 5KFUA 3Q8QB 2MKSA 2RHSB 4DPWA 5C25B 2EEYA 3JAMO 4LBHA 3PY8A 2R7OA 2HQGA 4X4UA 2YX1A 1VQLN 2WOMB 4LBPA 2PFDA 2IS3A 3DM2A 3AA4A 1WWHA 2F7VA 4DR6J 4X4TA 3K17A 1B64A 1H73A 3DU6A 1U26A 2MKYA 3MCMA 4J9SA 5HL7L 4JRQA 4DXLA 3SQ2A 3BDPA 3AOCA 4FYWB 4Y34A 4OHXA 3GFZA 4R5PA 3M8PA 1DURA 3K7RA 2E5LJ 4HH0A 2V4QA 3S7RA 2RS2A 5DK5A 1LQ9A 4G3IA 3IRXA 4WQ5C 4LF7K 3MUMP 1HWUA 2AA4A 2P9SB 3M3ZA 1RNHA 3UKUB 1HQ2A 3TW0A 3B78A 2DTUA 1HX1A 5DG8A 4RJVA 5C2GA 4G1PA 1F3VA 1GK8A 1HQEB 4KH6A 2GGPA 3N79A 3ZFVA 3I5BA 3ZTPA 4IYQA 3V81B 4ZN1A 4DSLA 4AF1A 1WF1A 3MFIA 4RG8A 1H72C 2Y0SD 3ID6A 2D0OA 4KGMA 4ECWA 4NRTA 2UVWA 3ET6A 2UYTA 5KOWA 4JI0J 3JXOA 4RNMA 3CIPA 1EX8A 2H65B 1TP7A 1XHXA 4JKGB 1YJWS 4TLRA 3IMXA 3QLHA 1RBOB 2OANA 2FB0A 4TYBA 3UDVA 5M1QA 3ZT2A 3BPSP 3KWIA 5KG0A 4WFNL 3R1HA 1J27A 1H7WA 1V5IB 3DMJA 2VJUA 3OXFA 3CC7S 2B4VA 1BWFO 1HPMA 2Q3SA 2XNQA 4N47A 1NJIO 1WKLA 1C0TB 1IQZA 3MM6B 1FD2A 3R6LB 4UOGA 4B8AB 3MXHP 4B1YB 1RUSA 3MCSA 3LDQA 4EMDA 5D0GA 3BR9A 1TYQB 2I38A 3U4LA 2PSZA 3HO1A 3M6VA 3PSIA 4MYTA 3C0BA 1WHVA 4F2RA 3J7AN 4BRQA 2QTDA 1N0VC 1BISA 1TUWA 2R7VA 3LDLA 3SJHA 3ZSYA 2YWFA 3NFAA 4ZHRB 5KPTA 2P2CB 4LFCF 4CJWA 2R2UA 4CLSA 4ZPDA 4CHYA 1BIUA 1V4TA 2YNFA 4JKDA 2LEBA 3R9PA 3CUNA 3KJVB 3NG8A 3CJQA 3SPZA 3THTA 1HPZA 2RRBA 3MM8A 1YRXA 2FZKB 1VQON 3QRPA 3J7AP 5ADXH 1X9MA 3CJ7A 2BANA 2EFPA 4Q8FA 3BGOP 1FEEA 2AYGA 1Y7PA 4O4GB 3S9HA 1ZBFA 5IT0A 3KK3A 2P9NB 2QXFA 5A6WA 2D3O1 1HNZK 5LM7E 3ZZTA 3VAIA 4PAAA 2JLFA 4P6QA 2BYCA 1B3TA 2KFNA 3VEZA 4V19J 4DUYK 4BC7A 5F9NA 4FM0A 5H1SV 4JN4A 1SQFA 5I42A 2YPYA 1H7XA 3MHYA 3VA3A 1ZM9A 4EP4A 4O3SA 1C0GA 2BH1A 5B08A 2VOPA 1SCJB 1PJ6A 1TFYA 4CJ5A 1URRA 2JLEA 2GWKA 3ZEUB 2HHHJ 4Y1CA 2BE2A 2ITMA 3BUZB 5J2QB 2MDAA 2FPHX 2YJFA 4Z4EA 4OJRA 1D8ZA 1OO0B 3Q0AA 1FKPB 2DHSA 2VHGA 4M7XA 3P39A 4DB3A 3WNEA 3FMBA 4NLRA 5IM0B 4M41A 5HRNA 3OYMA 3X1LB 3QETA 2FHJD 3ITHA 3D5MA 3BJYA 1Y10A 4F67A 4NLVA 4DR3K 1J54A 4DCOB 1GTEA 3RMCA 2A1RA 1G4CA 3D7EO 3K5OA 4XH5A 3HFKA 4X65F 3SMPA 1H2TZ 2EPIA 3JSRA 4OFZA 4C4WA 2PFFB 3VGVA 2DY9A 2R7TA 1DRZA 2CUYA 1JKHB 1CLQA 1HKGA 3KHHA 3UR0A 3DXKB 4HHHA 3RTVA 1U1PA 1CQNA 3BQ0A 4K4WA 1HARA 3DDNA 3H1VX 3G8TA 3R6GB 2QA4N 4QR2A 1GLEG 1HYSA 4FSVA 4DV1J 4DV2F 3ZSXA 4RUHA 1VSKA 1W7WA 4OX9F 3MFHA 4H03B 4WYBA 3THYB 2GMJA 4DL3A 3AHPA 3ZO7A 2OPSA 3MX5A 1SVDA 5EOYA 3RU0A 5EX3A 2B9EA 1M5SA 2KG1A 1JLFB 3V6JA 3G10A 3GV5B 1H0HB 4DV7J 4M5MA 2ZNZA 2C2ZB 3R2DJ 2K3IA 1WBBA 3UDEA 2D3OR 4GVBB 4NOHA 4P74A 2GS8A 3FJ2A 2J6SA 1H74A 5GAHI 4H0PA 3C95A 4P7VA 3QT8A 1EKEA 2G9OA 2BRKA 1FFGB 3J81O 1Q8KA 1JXVA 2FLOA 4ANDA 3G96A 4E7IA 1RKIA 1HNIA 4OKEA 5EU7A 1KWMA 5EXWA 4WYLA 2ZH5A 3PNIA 4DQQA 4CZIA 4F0KA 3MM5A 2YWWA 2E1ZA 1YBAA 4CLYA 3DYAB 4FNIA 1TK8A 3UN2A 1UWBA 1GXUA 2RRNA 1FT8A 4DG1B 2R8HA 1N4LA 3RZAA 4JI8K 5KG1A 2PIIA 4BG9A 3L9ZA 5ETVA 1HUXA 3DHWC 1MU2A 2HS4A 2KU7A 1NAQA 3WDOA 2MKIA 3T6BA 2R3VA 2AQ4A 2AKWB 2FGCA 3UPFA 2PYLA 1OPZA 3EN9A 1SIWB 2WAQD 4CEFA 2WW4A 3PW7A 4AUKA 3A13A 2FY8A 2OLWA 1KQFB 1Z1ZA 1XUPO 4LRFA 3HSGA 4ZVTB 1SS6A 3KK1A 2HVIA 3ILJA 3DLEA 2Z2YB 4KHQA 3H3NO 1XJWB 2X1FA 3C7NB 4B9UA 4KTQA 2J9DA 3BKTA 1CSJA 3FDSA 4DCHA 1UA1A 5HRPA 2HFOA 3S6EA 2RF2B 4F0HA 2HHHK 2MHNA 4FWKA 2HNDA 3MD1A 4OPJA 2BM1A 4I64A 1BIZA 4KH5A 5GAGP 3CCLS 2XMJA 2F8HA 1RTIB 3PFEA 2DRDA 4JI5K 1XMQJ 3NMAA 4DDFA 1M5KC 3LGNA 1VSIA 2YH0A 2CQCA 4BRCA 2ZDOA 2D5RA 4F50A 4JLHA 2PI5A 4LVOP 1HNWJ 2W2OP 3HSTB 2RKIB 4F9OA 1T3VA 2WTUA 4KRFA 2QTWA 2CKWA 2HNYA 3ULEB 2O8DB 1Q53A 3HVAA 2GZOA 3KYLA 3NGIA 3CMES 2N82B 4PPDA 1FEHA 5KFRA 3M05A 2EK6A 4UOCA 4L75A 2A2DA 3UDLA 3P49B 1F21A 5AQPA 1E6VB 3NAHA 3HT3A 3MEDB 2ZBRA 4KGZB 3NF9A 1ZXOA 1WKJA 2CQ0A 3GIRA 3HPGA 3A8JA 1QY7A 3ATVA 2F40A 2NRVA 5J2QA 4YOUA 3SPYA 1U8SA 4C48A 4DV6J 4JI6K 2L41A 4PUOB 2P9UB 2UXCF 4FLTA 3CMAS 5KFEA 1X4AA 5F8GA 2IRYA 4OGEA 2P9LA 3GIKA 2CVIA 4YFUA 4JYAF 2KJWA 5JUMA 1S3XA 3RW7A 2HW3A 4FLZA 3SUPA 3UKRB 3CCJS 1LWFA 1JLEB 2CNOB 3CCQS 4Y2KA 4OL8A 2XMKA 2QEXN 2XNRA 3IO1A 4NYFA 2OSQA 3L2WA 4C23A 4HTIA 4FZYA 5LT5A 1HHSA 4USKA 1UZHA 4ZLNA 1HWKA 1QUVA 3G6ES 4NI2A 2D9PA 1HNZF 4BBYA 2R7WA 1J5OB 2UUCF 3VTIA 1SI9A 3M8YA 4DUYF 3I33A 3A8EA 2QK9A 4JAXA 3OYEA 3I8BA 1S97A 3RGIA 3RJMB 1JX4A 4H4KC 3HDSA 4U9RA 4ZJLA 4C3MA 4OI6A 4UY8T 5GAEU 4LF4J 4PKDB 8AT1B 4OPKA 4ZHRA 4KTZA 3OYNA 4LRBA 3NF7A 3CCRS 2ASYA 4NO7A 1WC1A 2DTJA 3I4PA 1T03A 2HRTA 3WEEB 1U2VB 1NPPA 2GHVC 1W26A 2FVQA 4DSEA 4R25A 3VGMA 1RT6A 4EBDA 4C8MA 2ALZA 1K8AT 3OLBA 1XBWA 4DR4F 1Q18A 2F65A 2HIQA 3QGPA 2NRXA 2FHOB 4NLSA 2ZC3A 3QO9A 5HK4A 3FZLA 2JEGA 4ZVQB 2Y1JA 2XG8A 1KC8T 2BOPA 3TWZA 1XQIA 3C14A 3MGJA 2DXDA 3CCWA 3GJQB 2DD8S 1DARA 2MQOA 1NGHA 4X65K 4RPFA 4A61A 3QLHB 1RHJB 3ZTOA 5RUBA 4U7UD 2FTRA 1NJIT 1PGZA 3H59A 2KN4A 4ECYA 2YKNB 5EX5A 3AD8C 2FF6A 2LU1A 2DNQA 2FIUA 3NNAA 4DSIA 3CD5A 2HKEA 3CM5A 5BREA 3UCZP 1RU1A 5KFXA 5FPDA 3T5JA 4DV2K 4ZTJA 3SAGA 3O1LA 4X4QA 2C3PA 3MDQA 4JYAJ 1F60B 2JWKA 2IRXA 1GT8A 2E4LA 4TN2A 3KHRA 2HG4A 4KGVB 3CGIA 3U1MA 1HQEA 2QMWA 2OYQA 3CW2C 3SQ4A 5IXUA 4IRKA 2QWNA 1DEJA 3AQOA 3HT0A 1GLDG 2V8HA 3EPIA 2VGMA 1V5VA 3KLVA 3RAXA 1OVQA 3D6TB 1GLBG 1GXLA 4JNEA 5KFLA 4F4AA 3K5NA 4AHSA 1T6DA 3IRXB 3L2VA 2IMWP 2BACA 4KAZA 2FJEB 3VETA 1TKXA 3MI7X 4F3MA 4BE2A 2OKQA 4A57A 4KI6A 4FF1A 2PMWA 5EUHA 2WBMA 5AXKA 3OTBA 2E1PA 3DLEB 1VJQA 2NNWA 4KFBB 5J2MB 2G8KA 2UVVA 5EVZA 3R7SB 3MN6A 2ZHOA 2F8EX 3WBZA 4K2JA 1L3SA 2LECA 4JI8F 1QSSA 4Y1DA 1I94K 1FK9B 4GVBA 1NOYA 2IOCA 4UY85 4ECRA 4ECUA 3MAQA 1MU2B 1FNXH 4DUTA 1CG2A 3IS9B 4NA1A 3MF5A 1JLFA 2R2TA 4B3RF 2IGIA 1ATNA 2RE1A 5A6PA 5HP1A 3DYAA 2I2YA 5KFQA 1GX6A 2OPSB 1B7FA 3KLGB 2EWSA 3MMBA 4B3OA 3LUYA 2ZD1A 3TTDA 4A8SA 2LKZA 2QA2A 4XTTA 2V4JA 1IQTA 4WF9L 4IDKA 2R7QA 2Z57B 1TKXB 2HVDA 4K4ZA 3CC2S 1BHLA 4KAIA 5AQNA 2HHHF 1IJEB 1U45A 1YITS 2BW2A 2I5JB 2FF3B 1R7IA 2QN6B 3CDWA 5IC4B 4JI5F 2YWHA 1WSIA 2CZVC 4Y2IA 4CW7B 1SC4B 1XMOJ 5M2PA 4FWPA 2P5VA 2GEMA 1EWQA 2HLTA 1YWXA 1HBNB 3AVMA 3CFOA 1NRKA 2VCPA 4EYIB 4KBIA 1TV6A 4IOCQ 3V4MA 2KFYA 2JJ4D 1NWKA 1X1PA 4WFBL 2V69A 1MROB 3GG1A 1DAXA 3GSIA 5ETPA 2MZRA 2XI3A 3GQCA 3RBXA 2FBVA 3CFPA 1VRUB 1VFJA 1IM6A 3UN5A 1VLOA 4CZEA 1KC8O 3HTVA 2YKNA 3TP2A 1OH5A 4F3QA 3DXKA 4DTPA 3VZHA 3QFWA 1JKHA 4OKJA 3QMLA 2PA8D 3JAMY 1KN6A 4K5RA 3UR3C 2UU9K 1GOCA 3CERA 4DV1K 1BUXA 3N01A 2M3DA 3HXMA 1BHNA 4WWSA 2JH3A 1LKZA 4BLGA 4AH9A 1SL0A 2QV6A 3QO9B 1X5PA 4LFCJ 2DNLA 4DS5A 4C2MA 1WC6A 3G8QA 2DR5A 5LMUK 3OW2M 4HTJA 3GYGA 3R5CA 5DMRA 4IH5A 3N6NA 1UW9A 4UY8O 2HF3A 4DZDA 1NSKL 3QIOA 1MA9B 5CZXA 1FKPA 4WPAA 3EPGA 5FLXY 3T1HJ 5EDWA 3PEHA 2R7UA 3SBMA 4F04B 2ZHBA 2AGOA 4KHUA 4NPOA 2Q1LA 1ELOA 4FJJA 4ILHA 4QYZK 4LF5K 2DRBA 1SQKA 4PL7A 1WHWA 1UJ6A 4CO2A 2MGZA 1LK5A 3NDKA 3KJVA 5AQTA 4B3RJ 4LR8A 3M6XA 3ZEUA 3BKUA 4LIRA 4DR6F 4OYXA 4B9VA 3VGUA 4IRDA 4JBCA 3TZWA 2MLXA 3G6XA 2OTJN 2H3EB 3EDQB 2RILA 3SAFA 3BO3A 1K73O 1VBZA 4LY7A 1U6ZA 3GSDA 1N5VA 4K8XA 3OSPA 1K9MO 3IP0A 5I42B 1NDKA 3GCWP 4NWBA 4TU7A 1J5OA 3H20A 4H5RA 4PRFA 5K8NA 2E1RA 3DXBA 4NRUA 4ZVUB 3WC2A 3D2FB 2ZWOA 4XAKA 1X9SA 3LM2A 4MO5A 2RH3A 1VQ9N 1XMOK 4NYPA 2Y1IA 1QVGR 2GV1A 2ZBPA 1Q8BA 1WJ9A 4W98A 3P4IA 3ZCMA 4DR4K 1NLKL 1JJ2R 4PWUA 1ROFA 3W7BA 1KONA 4A4JA 2UVRA 2VV5A 1C0TA 2Z0GA 3JSMA 1YQHA 4CI0B 3MM8B 3I9ZA 2KXNB 2YBVA 3CCSN 2JOQA 1HA1A 2NYIA 3BGFA 2E9ZA 1MLAA 2GJIA 2VASA 3TSQA 1NNEA 3AGKA 3QICA 1O0PA 4OV6A 1YJVA 3O80A 5H9FK 2FHMA 1LAWA 2KFZA 4J9VA 5DQIA 4JKGA 4CJ4A 2QIFA 1BCOA 3AH6A 2AJ4A 3MN7A 2Q6BA 1D4XA 1IXKA 4CLLA 2SXLA 1OSCA 3SUNA 3DI6B 2LQBA 3U02A 1NZAA 3MR3A 2YWGA 2M4MA 2F9WA 3KHGA 5KRSA 1R0BG 5A8RB 3D0IE 1UVJA 1N52B 2G0CA 3BO4A 3MEDA 4JI7F 3T41A 3PTWA 3UB5A 1T44A 2HAFA 4DQ8A 5JLFA 2IVYA 4O3NA 3MM6A 5L1IA 4USIA 4H54A 2O8DA 1WELA 5JVHL 1PBAA 3M8WA 2R8KA 2QL9B 1RDDA 4ZITA 3QRQA 4BRLA 3L09A 3CJAA 2JFKA 3V9WA 1WG1A 1GLLO 3GPAA 3SV4A 4BGAA 1X7VA 4NLDA 4B3SF 3E9PA 2MXYA 3O2IA 1JJ4A 2P9SA 3KVGA 1VQ4S 2RDJA 1VQKS 3OSNA 2W8LA 1VSFA 2Z1JA 2OFHX 4I6WA 1ZM4A 1E3MA 5J1NA 1AFJA 4BR2A 8ATCB 3T1HF 3F73A 4DV7F 1VQNS 3MN9A 2CPYA 2HNZB 2JHEA 3VQAA 4CF1A 2V2KA 1RHKB 4WP8A 2IM0A 3D0GE 5KPRA 4KC5A 3PR4A 4NLXA 3R7NB 2ZH3A 3BSOA 3NWGA 2CRLA 7FDRA 1VRTA 5C10A 3AA2A 4ZVOB 3B4MA 4NLPA 3GV7B 5CD4H 2XYPB 3K0JA 4K7QA 1U02A 1KLNA 2I1RA 4DN0A 4KY3A 1U0HB 2P9KA 5D78A 1OS5A 4URQU 4OYBA 3C15A 1Q16B 1H2UX 4LFBF 3TA0A 3UE2A 2GX8A 4RW8B 1RAHB 2R8JA 1SKWA 5KFDA 5L38A 1UL3A 5KGWA 1TUVA 2GVDA 4QJVA 1YAGA 3FCWA 2K3KA 4JUZA 4OPHA 2WSEC 5M2RA 4R5PB 2XGPA 1T94A 4W4MA 2R2SA 1IJFB 3EDRB 5GADI 3FK4A 2B0GA 3U8XA 1RHMB 4URSA 1CJUB 3KWMA 4BROA 4U8VA 1QDUB 2DEJA 2WVEA 1CJKA 2P9GA 5H9FJ 1NEEA 1NK8A 1F1BB 2LDIA 2QMUB 3UW1A 3PJXA 1M1KT 4UW2A 1T9TA 1W2BR 4CH7A 4GKKK 4CJFA 3F2KA 2A3JA 2ZUAA 4LSNA 2FJBB 4O0IA 2A41A 2IA0A 4GC6A 4JI7J 1AZSB 1HYVA 2HRYA 1KKHA 1VCTA 1RWOB 2O8CA 3NP5A 1RDUA 9RUBA 2ZBQA 3BF1A 4B17A 3S3MA 3FQLA 5GVQA 1ITGA 3H6EA 2YTCA 1KQKA 2E88A 3B54A 3GE1A 5KQDA 3OUYB 2QG9B 2C3OA 3PYFA 4XEIA 3G2XA 3G0ZA 2MLZA 2CNNB 1U2RA 1CEZA 4W5OA 3T9NA 2OD6A 3HZGA 4FN5A 2AX0A 3NGSA 5JVGQ 3FUYA 4JK9A 1PG5B 4E19A 2B43A 4AHCA 4JP8A 3KZBA 2UU9F 2HGLA 2CJKA 1IO2A 3QFUA 4JI0F 4DV1F 3CJTA 4OZNA 1U4BA 4Y6IA 4V19S 2VG6B 2P9IA 4OQJA 2CZ4A 2OD4A 2UXCJ 4NXNJ 3O9SA 1KFSA 2HQ3A 1LOTB 1NH7A 1S76D 2XCAA 3O9TA 3W2VB 4ILRA 4RU9A 3M2VA 5LMUF 1CZBA 2Z1GA 2DH7A 3R1LA 1CJUA 4O3QA 1FFSB 3C6AA 3CMQA 4LFBJ 4TLQA 3GWCA 2C3MA 3VQEA 1IWGA 1NKEA 1RSCA 2W4CA 5KT7A 1C4CA 2EFOA 1XR7A 3D2EB 4RX6A 4HACB 1XR6A 4ZS6A 1QE1B 1YF5L 2CJAA 3JQMA 1S6PB 3ZSVA 4YB1P 2FVPA 3M4XA 1APSA 2QW9A 3MTKA 1U7LA 4QWAA 3UQSA 2CPEA 1VQMS 3HHLD 1N5YB 1LWCA 1A5VA 2Y1RI 3UFCX 3NMRA 2CGJA 3OBIA 1ASUA 2CADA 1T9XA 4PEOA 4LFAK 4BR0A 4KH1B 4A2AA 3GYXB 4OYMA 1N34F 3M9OB 4I9LA 2FY1A 3HVWA 1VS3A 2G8HA 2GFFA 2BJ9A 1QAIA 2PAVA 1QM9A 1VC0A 4DV3J 2HBQB 5HN0A 4WIIA 3MAHA 4JK8A 1XMOF 3VTHA 2DNOA 5J1EA 3CIZA 4OYPA 3CCSS 3SDEB 1YVUA 1GOBA 3QWUA 4P2XA 4WCEQ 2HNZA 3CCMN 1PC5A 4ECZA 2KKZA 4NCBA 4O8UA 2PGCA 3TRGA 3B6PA 4BC3A 2Z2MA 4L8RB 3LAKA 3OBWA 1X5SA 4FVMA 2D0AA 1Z2ZA 4YR0A 4A8QA 2XY5A 4IEIA 3CO9A 1C0UA 2NLWA 3CIMA 1IR2A 5ETRA 1CLFA 2VC0A 3B8HA 4PYDA 4IO9L 3MMAA 2JVOA 2V68A 4DR1F 3WQPA 4ZCIA 3IC1A 3N28A 1S1TA 3IAS9 2K1RA 3LQVA 1KVAA 3PW5A 4CESA 2VBZA 1VK8A 1NPKA 4HTUA 3MZIA 4NA3A 3IRWP 1R27B 4PG8A 2MB0B 4H0TB 4FWOA 2OMLA 3RB0A 4Y00A 1ZA2B 5GINA 3D9BA 1KFDA 4JI5J 4Y0WA 2OUGA 2DFEA 1YJ7A 4DV6K 2VWBA 3AVIA 3S41A 3NH1A 2P9PB 2CH6A 4BR4A 2HSEB 4ED0A 1YG0A 1KQSM 5CD4A 4N41A 5HAOA 2WONB 5DQHA 2M70A 5GAEP 2CDRB 1YHQS 2GVZB 5KQ8A 3HHLB 5IT9Y 3KKSA 5HOOA 2WZ1A 3OS0A 2F8TA 4YN3B 3S01A 5M1OA 4OZ0A 2CPHA 3CEDA 4YR3A 3AVCA 3HKZD 2DO4A 1IBKF 3T1HK 4DV7K 3SLCA 4UOHA 1U24A 2DXEA 1Q78A 2MJUA 4EFAC 2VB6A 2RHKA 3ET6B 5ETNA 3Q24A 4DTJA 1FWKA 3CJKA 2FVSA 3FC9A 3L0QA 4IUFA 3QERA 3U9ZA 3L6QA 3WQUA 5D3GA 1A5WA 1UPPA 4Y65A 2K7KA 4CBWA 4GV3A 1UWAA 4U67L 4C7QA 2LQ9A 2OPRA 1NB2A 4DL6A 4F3TA 2CQ1A 1C0UB 3MEEB 1BGXT 3NWRA 3ONQA 3NS5A 5BYQA 4DL7A 1OH7A 1UKUA 2R42A 3SSRA 2NR0A 2NXCA 2UXBJ 3MWTA 2MZ1A 1QS4A 2R9LA 1CC8A 1PYOB 2WC9A 3VAHA 3THPA 1FXRA 1HNZJ 3R3LA 2D74B 1TTHB 2GJFA 2DB1A 5J1EB 4FPAA 3FSIA 4LF7J 1CXUA 5CR4A 7AT1B 1N88A 2XO7A 2ZKTA 2DNRA 5IQQA 1GNKA 1RP5A 3G6YA 3F44A 1FKOA 2R8IA 4FXDA 4GW6A 2ZITA 5AZIB 4QS9A 4YDUC 4CZCA 3NVMA 3HZ6A 2B8PA 2ZM6F 3FFKB 1BQNA 4A48A 4ZK7M 5GMEA 2ZJRL 1RBAA 2J7KA 4FKYA 1VRQC 3AO4A 1VQ6N 4GKKF 3OVSA 3QWPA 2WOMA 2VD3A 4JK7A 1DTQA 3CD6N 3IAM9 3K8WA 4NLCA 4NYZA 1HLWA 4MDAA 2IIRA 2OCEA 1RISA 1HJOA 4DL0C 5HRRA 4IO1A 4ZP7A 4CLPA 1QHAA 5C25A 4J91A 1WACA 5AE1A 4DR4J 3CJ8A 4Z4GA 4CZFA 3OTDA 4IDHA 3IM8A 4RNNA 4OV1A 1ZA1B 3FRYA 3J7ZO 3BEGB 3W3SA 1VSEA 2KM8C 3IWXA 3HI9A 3QDKA 2IHR1 4DF8A 5BPNA 1WSEA 1Q8LA 4PKGA 3TU5A 2ZJQL 1GTHA 1JCGA 3TSPA 1MROA 1I6JA 1KS2A 4DQIA 4LF2A 3MCNA 4CK2A 1CC7A 3TTFA 1A7GE 5F8LA 1ACMB 3MR2A 1K6YA 3KLEB 3R8YA 4MKVA 2B9WA 3D1OA 2VWJA 4CFDA 2D1KA 2UUAJ 3OLAA 3VAJA 3WX4A 4WCEL 5DDPC 2X51A 3MMCA 2E2PA 3AO2A 5J2PA 2B6AA 2XZWA 2W9CB 4CD3A 3O08A 3R97A 1WI6A 5A8KB 2A40A 2KO1A 4IEEA 1MWKA 4HI1A 4BC9A 3I87A 3MPVA 3CCUS 3M1FA 3DDKA 3DOKB 1R0AA 4HVZA 5GAHU 4CBUA 3OUYA 2HK2A 2VYPA 5LOQA 4GV6A 3CO0P 1YJ9S 4L72B 4MTPA 4HUFA 1S1WA 5E3QA 4B3OB 3QIPB 4ZTFA 3RB4A 1A9NB 1FJCA 3DOLA 2EG1A 3HFZB 4BRAA 1Y5NB 3KUGA 2HBJA 4OZ2A 2PEHA 1W0HA 5B8HA 3PRBA 3O9RA 2KDOA 4Z7CA 3T69A 4EEYA 3LZJA 3QGIA 3R5JB 5JMVA 1IKXA 1ZM2A 3DLHA 3J81U 1OKJA 3EXCX 2QI2A 3HL8A 5K14B 1WB9A 4CI6A 1FK9A 3OR2A 1RLDA 3CG7A 2BJ3A 2PT0A 4OI3A 4G65A 2YH1A 4F4YA 5HLFB 1IKVB 1SJ1A 3SCJE 4YOEA 2HQIA 2A6MA 2HFUA 5SUHA 2EFQA 3HLUA 4KE5A 4KFBA 5J2MA 4ID5B 4I1TA 4WZMA 4IBNA 1IN0A 1NGFA 1C6VA 3LP3A 3N4PA 4JI8J 3CTRA 3PYGA 5L1LA 1ZAXA 1WSGA 2HQFA 4ECVA 5C12A 4QQBA 3MTJA 1FRLA 2EKNA 5KG3A 1XNQF 1HWLA 5A2QU