2WOMA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2womA05
3SUNA 5J2MB 2RF2B 4YR3A 1JXBA 3RMBA 1TKZB 1HYVA 2FBVA 1N6QB 1KRPA 5KG6A 4PWDB 1SKSA 4EYHB 1TV6B 1CXUA 2C22A 1C0TA 1KVCA 1C2PA 1NK6A 3QGIA 1JXLA 1CZBA 4CEBA 2ATLA 4FJ8A 4CEOA 2VG5A 3BJYA 3PW2A 4B9MA 3H98A 4IG0A 4BDPA 5CYMB 2KFZA 3DLKA 1RNHA 2BE2B 1HRHA 3KLIB 5DG7A 2PYLA 1BIUA 4I9QA 4IFYB 1S9FA 1ZYQA 1D5AA 1RDCA 1WSHA 4ECSA 1TKTB 2G8WA 1W0HA 4PA1A 3PVXA 2BQUA 5HP1A 3BSAA 3KOAA 4CGHA 1S10A 2YKMA 3LP0A 3IRXB 3IGNA 4Z4FA 1EETB 4ZVFA 5DK5A 3OJSA 1LWEB 1X9SA 4FK4A 5DQIA 1WAJA 4GMJB 1IKYA 2B6AA 1QQCA 3Q8SB 4FW2A 4J9LA 3KK2A 4H4MB 3GV7B 5CY4A 3VQPA 2HNDA 4ICLA 1SH3A 1WN7A 3H5YA 3LWLA 1ZBLA 2VWKA 4E7LA 1L5UA 2W7OA 3EZUA 4ZMMA 3OJUA 3LP2B 5I3UB 5HROA 2UVUA 2OPSA 1S1UB 2E9ZA 1QUVA 3AVJA 3NH2A 4NCBA 1DTQB 3VQBA 3EZ5A 1LW0B 3E01A 3CJ0A 1T05B 4KAIA 5KFNA 1UA1A 2W8KA 1TK5A 3DLEB 1S6QB 5KFGA 3AO4A 1VSKA 4URSA 5KFLA 3MXIA 4LH4A 3SJJA 2I5JA 4Q8FA 2OPPA 2WTFA 3OYEA 4DLGA 4I7FA 4Z4IA 2XC9A 4IR9A 3CJ3A 3LPUA 4DFKA 4FXDA 1S9EB 1TL3B 1TK8A 4B3OB 2ASJA 3MXJA 4OLBA 3PY8A 5KFBA 1WSEA 1HQEA 1S48A 3I0RA 3K5LA 2DPIA 3CQ8A 4ZPDA 3O3HA 3KK1A 4KPYA 3AVAA 4RW4B 5EWGA 5C25B 3PUFA 1NJZA 3P1GA 3CJ5A 3QEIA 4KTQA 2JC1A 4RNNA 4AHSA 4FS1A 1BQMA 3M8PA 2B4JA 3OS0A 4CGGA 2KW4A 4JV2A 4FM1A 4FJLA 4OL8A 3T5KA 2X6NA 1YVFA 4E19A 5KFFA 2XI3A 1L3UA 4KHYA 2ZQBA 1QE1A 4WFXA 3HL8A 1SV5B 3CM5A 3CFRA 4R8UA 2QK9A 2D7SA 1I6JA 3LP1B 4CEDA 3KHGA 3C6UB 2R2RA 4QPXA 1D1UA 5EWEA 5DLFA 5F8HA 3HVTA 2BRLA 4WZMA 4YNQA 2DPJA 3O3FA 4MK7A 4ED0A 3V1OA 3TARA 5EDWA 3BREA 4CJ4A 4CHYA 3BQ0A 1HYSA 1VSHA 3LP3A 3K59A 5F8LA 2OPRA 3VN5A 3TAGA 4ZP8A 4CGIA 5HBMB 5F8MA 4NLXA 3IS9B 4Q8EA 1RTJA 2OYQA 2OZSA 3UR0A 4KB0A 5KG0A 3DOLB 3SYZA 3OYGA 1TGOA 3RB3A 3CIZA 2AU0A 4CJKA 4FM0A 2YNFB 3L8BA 3MEEA 4YR0A 5KG1A 3ISNC 4LSNB 4ZVHA 2EX3A 4CJEA 2E4LA 2UUWA 2HNYA 3B6PA 3CYMA 4HCBA 1ASVA 3HPHA 2R8HA 3ISND 1NJYA 3I5CA 4AHCA 3AVIA 4M41A 2UVVA 3AVBA 2GC8A 4CHZA 4L8RB 2HHQA 4I2QA 3HVRA 3QETA 4B08A 3G6VA 1VSLA 1W9HA 1TKXB 1RT2A 4DS5A 5KG5A 4IQXA 1NOYA 1BQNB 5CYQB 1DLOB 4HTUA 1NJWA 2BANB 4ECVA 2AWZA 3THVA 3HJFA 4W5RA 2C2EA 4EEYA 5JXSA 4E1NA 3VQ9A 3OSNA 2YV0X 3SV3A 3VQ4A 3DYAA 4J2AA 3CVKA 3FQKA 3OYKA 3DMJB 3NH0A 1NK7A 3NF6A 3AVMA 2KZZA 2IM1A 2E6LA 1X1PA 4U7CA 3UDLA 4DTPA 4RNMA 1NOZA 1KFDA 3OY9A 4PUOB 3H5SA 2KQ2A 5SWMA 4DTSA 2R8IA 3PO5A 1WSFA 1ZETA 4DQIA 1D9FA 5K14A 4ID5B 1SUQB 4CHQA 3AVGA 4QAGA 4FK0A 2JEIA 1HQUB 3NAEA 3DLGA 1KLNA 3CDUA 4J9PA 3KJVA 3CG7A 5KFUA 3V4IB 3H4DA 3MR2A 3TAFA 4CK3A 1QAIA 5KFHA 4MFBA 2D5RA 1D9DA 4PY5A 3LALA 3ITHB 1LW2B 3M9MB 4CJSA 5HRNA 2D0BA 4NZ0A 4JV1A 3L3VA 5F8IA 4F3OA 4RUCA 1EX4A 3RBDA 1X9WA 2HNZB 3L3UA 3QEVA 4J2BA 1RDAA 1ITGA 5KT2A 2ZE2B 4YQWA 4IG3A 3SFUA 4PQUA 2EHGA 3RR8A 5FROA 1KVAA 4DSKA 2E9TA 4B9VA 4IH5A 1GOCA 2XCAA 3DRSB 4O3OA 1RBRA 4RW7B 3OHBA 3NCIA 1HNVA 1QSYA 1FKOA 3ASMA 1S1TA 2XY5A 3MR6A 1UWBA 4RW9A 3HT3A 3DRRA 3KKRA 3RBEA 4HYKA 4O3QA 4KFBA 4JS4A 2FLNA 3L2UA 3C94A 4CJQA 4CJUA 4CIEA 1LWFA 3DRPA 3DOKB 1YT3A 3QGHA 1RT6A 4CHNA 1L3SA 1RT1A 3ZT3A 1Y97A 1HMVA 3KKSA 4FJ7A 1JLCB 1TAUA 3ZSRA 1MU2B 5KG7A 2G8HA 1CZ9A 4MIBA 2WONA 4K4WA 3GV8B 2YNGA 2ZD1B 4Q0BA 4KAZA 2AQ4A 2W42A 4B9UA 1LWCA 4KI4A 1GOAA 1BL3A 4QW8A 3MFHA 4O3RA 2YHAA 3LWMA 4ELUA 1C0TB 4DL4A 4GVMA 3GILA 3OYIA 3MXMA 2UVWA 4AH9A 3WNFA 3QGGA 2WCXA 5L9XA 2VG5B 3DLRA 4Y2AA 4JLHA 4QWAA 2DFFA 1D0EA 4IG0B 3NE6A 4LQ3A 3DLKB 4FJXA 5KFXA 3TVKA 1J9AA 1BIZA 3SFGA 3ICLA 5KG2A 2IBKA 1JLQA 3Q8RB 4DL5A 3ZSOA 2IJNA 1WSIA 5HP1B 3WNEA 4B8AB 3ZSZA 5KFMA 3G6XA 2WOMA 1RT5A 3DLBA 2YKMB 3LP0B 4M3TA 4G3IA 4ELVA 3OYAA 4K4XA 1NK0A 5F8GA 3VQ7A 3GIMA 1RDRA 1JL2A 1IKYB 2B6AB 4FS2A 4M3ZA 4KKOA 3ZSWA 3KK2B 4IRCA 3NGYA 1ZBIA 3UPFA 2HNDB 4ICLB 4WE1A 4KB7A 3H2LA 1S5JA 3AO5A 3NAIA 4Z4EA 4JS5A 3PX6A 2OPSB 1HJRA 4K4SA 4IFVA 4O5BA 3O3GA 3QNNA 2DTUA 3E01B 1RTDA 5KT5A 4ED6A 3QLHA 3SQ4A 5KFEA 3K5NA 4NRTA 2FC0A 4B9SA 4O4RA 2I5JB 1GOBA 2A1SA 2OPPB 5C42A 4RW8A 4XIUA 4WXOA 2JEFA 4I7FB 4O55A 1REVA 3BGRA 4FLXA 1FXXA 5KT4A 5J2QA 2IMWP 3OYCA 4FLUA 2OZMA 4B9TA 3VQ8A 4URQU 3M9NB 1HQEB 3I0RB 5EWFA 5KFCA 3QO9A 4Z0UA 1LAWA 3KK1B 1VSJA 4KHSA 4F50A 3I8DA 4CJPA 4KB1A 1KLMA 3OYNA 3H5UA 4OVLA 3TABA 1BQMB 3M8PB 3NGIA 3WNHA 3QIDA 1Q9YA 2HWIA 4CHOA 4ECXA 4CEZA 3V81A 2QV6A 3EY1A 3NDKA 3HO1A 4N56A 1QE1B 1L3TA 2Z1GA 3ZSXA 4N47A 4R8UB 2J6SA 1VSMA 3RMCA 2C28A 4FLZA 1S97A 4NLDA 3OYHA 3D5MA 3V6HA 2FBXA 3D45A 4DTOA 3TR8A 4ECQA 1SL0A 1VRTA 3IG1A 4ZTFA 3PR4A 4J9OA 4DL7A 4ZVGA 3SUPA 1HARA 4I2PA 1JLGA 4BWMA 4NLWA 4RNOA 5KG3A 1VRUA 2F8TA 4UQGA 2IC3A 3TAMA 1HYSB 2HVIA 2YNIA 3DI6A 4I9LA 4DF8A 4CEFA 1S6PA 5FDLA 4FLTA 4AILC 2CJQA 3H4BA 4XPEA 4ELTA 4FLYA 2IS3A 1JLEA 2OPRB 4CF1A 2Y1JA 1TVRA 2YKNA 1XWLA 4C8NA 4H4OA 4LY7A 3HPOA 4O3NA 4LSLA 3IN5A 3M8QA 1Q9XA 3VA0A 4CGDA 4K8XA 3NF7A 4KV8A 4U6PA 1C1CA 5KRSA 3KIOA 2BGGA 2RN2A 3MEEB 1T03A 3CFOA 4F4ZA 1HPZA 4CHPA 1NKEA 2JEJA 3NFAA 5DMRA 4WZQA 5I42A 4NCGA 2AGQA 4NYNA 4K8ZA 5DG8A 1YTUA 2HNYB 2V4QA 4O0IA 5DGBA 2G8KA 4NLQA 2BQ3A 3HXMA 2D41A 5L1LA 3AO2A 4I2QB 1U09A 4EZ6A 4F4KA 1Z25A 3PJXA 1RT2B 2D0CA 3L2RA 2B5JA 1JX4A 5CYMA 1U4BA 3SPYA 1JLAA 4G1QA 2EC0A 4O44A 2QKBA 4CJ5A 1RBUA 1RDBA 3KLGA 3SUOA 5F9NA 3PW4A 5DQHA 4M3XA 3KHLA 2R2UA 3S3NA 3ZT4A 1RBSA 2W8LA 2WK4A 3U3YA 2XO7A 5C5JA 4KI6A 1B92A 3DYAB 3M8SA 1JLBA 3P83D 4DEZA 1LWEA 2XY7A 1C0MA 2W7PA 5FRNA 1ASUA 4K50A 2HWHA 4NLRA 3JYTA 3FFIA 3QEWA 3RB0A 3RTVA 4NLTA 2P5OA 4IRDA 4FLVA 3OLAA 1CLQA 4EP5A 4TN2A 1U04A 1YVUA 2AGPA 4OKKA 5HLFA 4ED3A 5K14B 3DM2B 4FJNA 4J9QA 1GX5A 4OGEA 2ASLA 1ASWA 4CECA 1RTHA 3DLGB 1UAXA 3KJVB 2G8FA 4WYLA 4URGA 4MKAA 3AA5X 3ZSQA 4MFBB 4MQ3A 3K5MA 4RW6A 4K4VA 4CF0A 1A5WA 3VQCA 2IDOA 4FZYA 4CFAA 1NKCA 1S1XA 3KD1E 4YFUA 2F8SA 5CZ2A 3OYJA 3K2PA 4CIFA 2GIRA 4QOZB 3U3GA 3V9SA 4DG1A 1DTTA 3FSIA 1JXEA 1JLFB 1YTAA 3S3OA 3KHRA 4PQUB 4LH5A 4BDZA 2O4IA 5T14A 3TAPA 1TQLA 4ID1A 4CESA 3QERA 5FRMA 3OYBA 4W5NA 3IGVA 3K5OA 4Q43A 2FJVA 1TKDA 4RW4A 1RT3B 3AVNA 1FKOB 3SQ0A 3VQSA 1S1TB 1IH7A 4ZHRA 4CEEA 3KHHA 1NHUA 1VK0A 3HYFA 4FVMA 1UWBB 3DRRB 1W25A 2XRIA 3OHAA 4OGCA 4KFBB 2C2DA 1IG9A 3RMAA 4ECTA 1LWFB 3DRPB 2XGQA 3KK3A 2GV9A 1RT6B 3V9WA 2PZSA 1RT1B 1SH0A 3PZPA 2BR0A 1HMVB 3SZ2A 2IGIA 4KHWA 1KTQA 4RG8A 3VA3A 2XWYA 4M3UA 1T94A 2WRMA 3MAQA 3QESA 2WONB 2YNGB 3V9UA 3PX4A 4Q0BB 4IH6A 3S3MA 1LWCB 1J54A 4FM2A 3VQ6A 4CK2A 4J2EA 4HUEA 2Y1IA 4M42A 4IDKA 1N5YA 4NLSA 4EO6A 4JRPA 4MH8A 2VG6B 3NHGA 4B9NA 2DFHA 4TSXA 3RMDA 2HHVA 2XY8A 4N5SA 2W9AA 1IKWA 2JC0A 3LZJA 3OVNA 3QIPB 4M95A 1S0NA 3HKWA 3F9KA 4DSFA 4H54A 3LANA 5HBMA 1JLQB 4DLEA 2JLEA 4Y1CA 3QZ7A 3DDKA 4DTMA 3ZSVA 1RT7A 4NLGA 2GUIA 4FJHA 2F8EX 2YNHA 4J9KA 2VG7B 3H59A 1UOCA 2WOMB 4TY8A 4MKBA 4F3TA 3ALYA 3O4NA 3AVFA 4DTRA 4BWJA 4MK8A 3HM9A 1WNSA 3L2VA 4K4TA 4DSLA 3OS2A 2E6MA 1C6VA 4KHQA 1LAVA 2XHBA 4NLVA 1TP7A 4KKOB 1SKRA 2G8UA 3NGDA 2ILYA 2R8GA 4C8KA 2F96A 4WE1B 2QXFA 3NBPA 1N48A 1HYZA 2HB5A 5KGWA 1KVBA 3MEDA 4R5PB 2HHSA 3MFIA 1ZBUA 1U49A 3AA2A 1BHLA 2P5GA 4CJ3A 5CZ1A 3RWUA 4IFVB 3OLBA 4RNFA 3ZCMA 3L2WA 2RPIA 5KFPA 4J9MA 3LZIA 4YMEA 1RTDB 3NF8A 3VQDA 3QLHB 5DLGA 3BDPA 3OL7A 4ED2A 2DY4A 1XR6A 2R2TA 1RT4A 4RW8B 4KREA 4QWBA 3BSCA 1REVB 1S9GA 3BGRB 4ECWA 5EU7A 4DL6A 3EPIA 4ECUA 3EPGA 5HRSA 2GIQA 4HKQA 4F2RA 4CGFA 4DTJA 1U48A 4DL3A 4EBDA 3CJ4A 2Z1JA 4KBIA 1ZBHA 4EO8A 3QO9B 3CDWA 1RCHA 4CGJA 3DLHA 3T3FA 1JIHA 3H08A 1ZTWA 5DGAA 2C2RA 4Q44A 4BE2A 3RB6A 3LAKA 1KLMB 2YHBA 2KFNA 4CJVA 4EYIB 3O4QA 4CFDA 2PY5A 4FBUA 3MECA 4CJTA 4ECZA 4QWEA 4DQQA 3HSTB 1BGXT 1HNIA 4CJRA 4KTWA 4F4WA 2HHWA 3TAQA 4RZRA 3AA4A 1SL1A 2HMIA 5SZTA 1FK9A 4M45A 5KFAA 4OPKA 3IAYA 4HHTA 2IM0A 4DSIA 2Z1IA 1K6YA 3IG1B 1RBTA 4KHRA 1QSLA 1FKPA 4QWDA 1G15A 3PO4A 3ZSYA 4I2PB 3KLFA 1JLGB 3T19A 1Q8IA 1BI4A 1RTIA 2FVSA 5HROB 4KO0A 3EYZA 1VRUB 3PJWA 3TAMB 2RKIA 4KSEB 2YNIB 3DI6B 4DF4A 3TQ1A 1WAFA 4FJMA 1S6PB 4GC6A 3GYNA 2FVPA 1JLEB 2VA3A 4NCAA 1MMLA 1TVRB 2YKNB 4K4YA 3QIOA 2OPQA 4H4OB 3N6LA 2W9BA 1VSFA 3SQ1A 4LSLB 5KFJA 1QTMA 1RA7A 1D8YA 4NLPA 1U45A 4FZZA 5D3GA 2ASDA 2IA6A 3AO1A 3M9OB 4CK1A 1Z26A 4KV8B 3I5BA 3HPGA 5KFSA 1WNEA 1XHXA 1T03B 2XI2A 4XO0A 1IM4A 4FZXC 5I42B 3ZT2A 5J2PA 5JUMA 1S0OA 4NCGB 3LDSA 3QEXA 1IKXA 2IJFA 2XCPA 3S9HA 5KFVA 3OL6A 4DU1A 1RYRA 1KSPA 3CJ2A 1L3VA 3C6TA 3Q8PB 1LV5A 1NK5A 5L1JA 4KRFA 2B5JB 1ZBFA 4IBNA 4ZP7A 3AVLA 1JLAB 4G1QB 4O44B 1JKHA 4CJLA 1IKVA 4Z4CA 3NL0A 5KFWA 4J2DA 2QKKA 4DS4A 2W9CA 4KHMA 4BDYA 3KLHA 3KLGB 3HK2A 3L2QA 5J1EA 1RAJA 4DL2A 1C0UA 4CCHA 3HVAA 4IRKA 4Z4GA 4O0JA 3PW7A 1S1WA 4OJRA 4O4GA 4LQ9A 3QINA 4DFPA 1SL2A 2FBTA 4NYZA 4TQSA 4N41A 3HVTB 5KFZA 1NJXA 3I0SA 4FYDA 1JLBB 3GIJA 1XR7A 2ZKUA 4FCYA 2D3ZA 4FJJA 5DQGA 1S1VA 5JS2A 2X6SA 3SPZA 3JYTB 1TL1A 4H8KA 3FFIB 2CKWA 4AHTA 4DQRA 3OSPA 4AHUA 4NLOA 3KLEA 3JSMA 2G8VA 1BISA 2IOCA 1QHTA 1NHVA 5KG4A 5HLFB 4F2SA 2XGPA 5KFIA 5C24A 1UA0A 2WHOA 3KMQA 1F21A 4KHNA 4KE5A 1RTHB 5J2NA 4YP3A 4DTNA 4BACA 1RTJB 4X2BA 2ETJA 4E7IA 1R0AA 5KI6A 3MEGA 1J5OA 1B9DA 4IR1A 3I5AA 3C95A 1EP4A 3NGZA 3QZ8A 4FJ5A 3H5XA 4GW6A 4RW6B 1C1BA 1C1AA 3VQEA 2HHUA 3OYFA 2IAJA 3V6DA 1CXQA 2ATQA 4W5OA 1S1XB 3CDEA 5J2MA 2RF2A 4DFJA 1WSJA 3TI0A 1I3AA 1TKZA 1KHVA 1U47A 5T7BA 4DG1B 1N6QA 2VWJA 1NKBA 4HUFA 1DTTB 3BSNA 3PHEA 3F73A 3VQQA 4PWDA 4DMNA 1TV6A 4W5TA 4E7HA 4M94A 1K1SA 4CE9A 2BDPA 4AHRA 4KHUA 3OYLA 1BCMA 4J9RA 4FW1A 3PW0A 4OLAA 1IO2A 4WYWA 2HAIA 1S49A 1VSDA 3QEPA 3N6MA 3GIKA 4ZPBA 2BE2A 2B43A 3AVKA 4CFBA 4ZHRB 4CF2A 3CFPA 3G6YA 3G86A 3MR5A 3KLIA 2P51A 2R7YA 4F8RA 4DU4A 4IFYA 2AX1A 4NLUA 3AVCA 3V9XA 2IM3A 1TK0A 1TKTA 4O3SA 5L1KA 4ECRA 4CERA 3RRGA 3KK3B 4C8MA 3G0ZA 3QNOA 4EZ9A 3MR3A 3IRXA 1EETA 1RBVA 3CO9A 2HHXA 4CEAA 3V1RA 3SQ2A 4H4MA 3PW5A 5HRPA 3KD5E 1QS4A 2Q3SA 4DTUA 4C8LA 4IDKB 1N5YB 3MTKA 3HP9A 2UVRA 3BR9A 5JS1A 2A1RA 2BQRA 3LP2A 3HVWA 5I3UA 3D28A 1NK4A 1VSIA 2KTQA 5L1IA 1N4LA 5KFQA 3WNGA 2R8KA 1S1UA 3RAXA 1IKWB 4DWIA 1DTQA 1LW0A 3TANA 2LSNA 3OYMA 1T05A 2O4GA 3V9ZA 4J9NA 3DLEA 1S6QA 1QAJA 4LD0A 2QE5A 5KT3A 3V6JA 4K4ZA 1J53A 3D0PA 1RT7B 3UIQA 4EP4A 2PYJA 3HHKA 3V6KA 4CF8A 4FLWA 2YNHB 2FBYA 5KFKA 4FJ9A 3T1AA 4TY8B 4IG3B 3ZT0A 5KT7A 4E3SA 4DSEA 5DG9A 3P5JA 1S9EA 4HCCA 1TL3A 1I39A 4B3OA 3K57A 3PR5B 3RB4A 4Q5VA 3SI6A 2HW3A 1KFSA 1JL1A 4Y3CA 1HNVB 1N56A 4CJWA 3KTQA 5C25A 4JUZA 4RW9B 1EXQA 3NBPB 3MEDB 5F8JA 1RILA 3CWJA 3NMAA 4EBCA 3A2FA 3FQLA 1EKEA 2DFEA 1OS5A 5KT6A 5E41A 2NUBA 5KFYA 3AA3A 5KGXA 1SV5A 1NK8A 1T8EA 5KRTA 4RUAA 4NRUA 3KLVA 3RAQA 5EUHA 4K4UA 3SI8A 2P1JA 3NH1A 3LP1A 5KFDA 1RT4B 3HP6A 3C6UA 4FK2A 4Y34A 4FBTA 1S9GB 3GQCA 3AO3A 1KCFA 4CFCA 1Z4UA 4ZP6A 1CSJA 2IM2A 1S0MA 1SH2A 4C8OA 5KFTA 4QW9A 3SNNA 4M3WA 4BE0A 4ED1A 1GX6A 4CIGA 1WSGA 3GV5B 3K58A 3QYYA 5KFOA 3T5HA 1XR5A 2WB4A 4ED8A 1NNDA 1XHZA 2FLPA 3DM2A 4FJGA 2J6UA 2AJQA 3GIIA 4F4XA 3V1QA 3IS9A 3KMSA 4RNHA 4QWCA 3MECB 2FLLA 2ITGA 4Y1DA 2HVHA 3FDSA 4E89A 4WFZA 4YR2A 2FVCA 2O5DA 4DU3A 1RA6A 3DOLA 1HNIB 2FVRA 1RT5B 3G10A 2FJXA 2YNFA 2BRKA 3LAMA 4HUGA 4ZVEA 4TXSA 2R8JA 4IH7A 3SCXA 4Q45A 3RRHA 4LSNA 2HMIB 4XPCA 1FK9B 2UUTA 4NYFA 4O3PA 4OKEA 3ZT1A 4DQPA 3KNAA 4AHVA 1JLFA 2V0NA 3FRZA 1FKPB 5HRRA 2J6TA 4JRQA 2Z1HA 3AV9A 3KLFB 1BI4B 1XI1A 1RTIB 2JEGA 4MK9A 4KO0B 3CM6A 3TWHA 4CF9A 1TKXA 2ALZA 2FVQA 4ZPCA 2RKIB 2VA2A 4DSJA 1BQNA 1RT3A 4TLRA 5CYQA 2X74A 1X9MA 1DLOA 4CEQA 2BANA 3RR7A 4B8CA 4NLYA 3UQSA 2OPQB 2W9BB 4RU9A 4QCLA 4TY9A 3VQAA 3LPTA 2OH2A 1T7PA 5C42B 3M8RA 1VSEA 5D3GB 1BCOA 1O1WA 5KTQA 3OYDA 5J2QB 3DMJA 3T5JA 4ZP9A 3NF9A 4CJFA 4E7KA 2V9WA 1RDDA 1NK9A 5J2PB 4IOBA 3SUQA 1IKXB 4PUOA 4DFMA 4EBEA 4B9LA 3C6TB 2RDIA 2VG6A 2X78A 4ID5A 1SUQA 4Z4HA 1A5XA 1HQUA 2RDJA 5F8NA 4M3YA 1B9FA 4HVJA 3NAHA 4OPJA 3PV8A 4GC7A 3U6FA 4JV0A 3V4IA 1XC9A 2KZMA 3QIPA 1K1QA 3AVHA 2G8IA 4F4YA 3V81B 3ULDA 3SV4A 3NKYA 4DTXA 1QSSA 1JKHB 3ITHA 1LW2A 4OKJA 2V4RA 1IKVB 4ZTJA 4Y2CA 1ZTTA 3PX0A 2W9CB 4J9SA 3KLHB 4MIAA 4R0EA 5J1EB 1C0UB 2HNZA 1T3NA 4E0DA 1S1WB 1RYSA 4ED7A 4O4GB 1TAQA 2VG7A 2ZE2A 1A5VA 1WLJA 1VRTB 3I0SB 3BQ2A 3BQ1A 4N76A 4TQRA 3E51A 3N6NA 3H40A 2R2SA 3TAEA 2JGUA 4WFYA 2D0AA 1S1VB 2E9RX 2ILZA 3OS1A 1TL1B 3DRSA 2FJWA 2IC3B 3BSOA 4RW7A 4ECYA 2GBZA 4FJIA 3KLEB 3JSMB 4IKAA 2AGOA 5KFRA 5FDLB 1SKWA 4BE1A 3OL8A 4DQSA 1KHWA 5C24B 4R5PA 2D3UA 3T5LA 3B6OA 4E1MA 4TYAA 5F9LA 2OA8A 3M8QB 5J2NB 2XY6A 2I1RA 3DOKA 4KTZA 1R0AB 4W5QA 4M3RA 3MEGB 1J5OB 2HHTA 4E7JA 1C1CB 1EP4B 1JLCA 4TYBA 3OL9A 1C1BB 1MU2A 3MF5A 3VQ5A 2IAJB 2AX0A 4WXWA 4FJKA 3V6DB 3Q8QB 1HPZB 2ZD1A 1S4FA 4IKFA 4ZPAA
chains in the Genus database with same CATH superfamily
5J2MB 2RF2B 1GQEA 1JXBA 2MKJA 1HYVA 2XHWA 3HSCA 4PWDB 1PCAA 4EYHB 1TV6B 2UUCJ 1CXUA 2A5XA 4RCHA 2C22A 2MB0B 3BY5A 2ZWHA 1DFDA 4B17A 2Z2ZA 2ZJQL 4G6VB 2N7CA 2BBEA 3TNVA 2VG5A 3BKTA 3H98A 5CYMB 4USJC 1BUPA 1PAUB 3F44A 1FX4A 4LJMA 2A3JA 3KLIB 5DDOC 2PYLA 1BIUA 4I9QA 2O66A 4MAKA 4B3SK 1RDCA 4WCEQ 3BGOP 1HD0A 1IN0A 3EGZA 3K9JA 5HP1A 3BSAA 1S10A 1KQSR 4U7BA 1SJQA 3IR7B 3CEDA 2W2NP 3CXCR 4CO4A 2C1EB 1YITN 1KVKA 4GMJB 2YX1A 2J76E 1LEOA 3KJQB 2K8GA 3CD6S 2Q97A 4RBTA 5HROA 2UVUA 2EFGA 4UUXA 1S1UB 4BROA 1MG7A 3AVJA 2QTWA 3VQBA 2YPYA 4PEOA 4KAIA 1VC6A 4LRFA 5LSLA 1VSKA 1Q95G 4URSA 1K9MO 1VHXA 3MXIA 4LH4A 3A5MC 5C12A 3IAM9 4I7FA 1A9NB 5I3PA 2XC9A 4IR9A 4NXMK 3ULHA 1PYTA 3PIPQ 3CJ3A 5B08A 1FD2A 4FXDA 2ZOMA 2G4BA 2ASJA 3CJ9A 4DV7K 3EGWB 2E7WA 1S48A 1WTFA 2CPZA 2D1KA 1JJCB 4ZPDA 2L3MA 2ZF5O 4OYBA 4RW4B 4YDUA 2C2MB 3IDHA 1Y11A 5AQIA 5LT5A 4F9OA 2DR5A 3RSEA 4D3HA 1HBOB 4F7VA 1BQMA 3VVUA 3I4HX 2KW4A 4JV2A 3AGRA 1RAGB 4JK7A 5MLCV 1X3NA 3JXOA 4OL8A 4OX8A 3KZBA 3GG0A 1YVFA 2XZDB 5ETOA 1FDDA 3QBXA 4WFXA 3CM5A 5LXYA 4USIA 2OEMA 2E1YA 2GIFA 3FR0A 4M5JA 2ZJRQ 2ZNYA 1FWLA 3NLCA 1D1UA 1XBWA 3GZ7A 1YQHA 3ZEUB 3GJRB 2DPJA 4M5KA 3TARA 2CJYB 3UE2A 2F8MA 3HSJA 1YTYA 4DR4K 2W25A 1HL6A 4CHYA 1GLLO 3DCAA 3BQ0A 3MCOA 3MM7B 4JKCA 2LQJA 1HYSA 3LP3A 4P9SA 3K0JA 3AY9A 2QWLA 4X64K 2AW0A 2BUNA 3TAGA 4LT6A 3GJSB 1KN6A 1R0BG 2ZWPA 5F8MA 1UTAA 4Q8EA 1W7AA 3Q24A 1B0PA 3UR0A 3SCLE 5KG0A 1EWRA 4XK8C 2CJBA 3CIZA 2CH5A 3L8BA 2KDOA 5KG1A 3TWZA 5GINA 4ZVHA 3W62A 2IDEA 3NCRA 3BP8A 2E4LA 2UUWA 4PR6A 2DHSA 2F4VJ 1UETA 4KRWA 2EK6A 4X4SA 2PSZA 4ILLA 2UVVA 2GC8A 3QPIA 2CZ4A 1SKUB 5K8MA 4DV4F 2YKOA 1RWUA 1W9HA 3UNGC 4DS5A 3MCAB 5KG5A 3I56S 1NOYA 1FWPA 1DLOB 2YX7A 2A6AA 2JFKA 3S8SA 1KXPA 4HTUA 3WIUA 3VGLA 1VS3A 4USWA 4ECVA 1URRA 2AYEA 5A6PA 2XMTA 3ADAC 4LFCK 3HJFA 3UO0A 1N32K 4Z94A 2DO4A 3NNHA 3NOCA 2OTLN 2QA1A 2OANA 3OSNA 2LA6A 3VQ4A 3CVKA 2G1DA 3NH0A 1HPMA 1VK3A 2KZZA 4DV0J 1NUEA 4CJ7A 2VU5A 1WOPA 2C3OA 3ENAA 2XTJP 5GMKa 2BVZA 3UDLA 4DTPA 4RNMA 3L4IA 1KFDA 2ATCB 2KQ2A 5SWMA 2R8IA 1ZETA 2G9OA 2VDHA 1CS4A 1WC3A 4DZDA 3A3PB 2NRWA 1ELOA 3AVGA 2RVJA 3DLGA 3CDUA 3KJNB 4TKTA 4WFBQ 2OKQA 4PRFA 5D4LA 2DR8A 4WIIA 1D9DA 2RHKA 4JI0J 4HDHA 4NZ0A 2NUUG 3K2YA 1X4BA 3HZGA 4YOXA 1QY7A 3M8YA 2HNZB 3OVBA 5LL6d 5C15A 4J2BA 5KT2A 2PA8D 1XNRK 1VYAA 1XEZA 2XSJA 4YDXA 2GVDB 1BO5O 4M5MA 5FROA 3TUIC 1VQ7S 4DSKA 4C3LA 2W41A 3ZO7A 1F5CA 3GSIA 2XCAA 3J80Y 4OX9K 4O3OA 5B0GA 1K9MT 4LC9B 1HNVA 2Y1RI 1JJ2R 1VQ5S 3A13A 3RBEA 5G0RB 2E1PA 4YORA 1G99A 2H5IB 3C94A 4YHHF 6FD1A 2CJAA 1SC3B 2GHWA 1KBRA 2UXBF 3NVKA 1MWYA 1LWFA 5A2QU 3QGHA 4FJ7A 1J5EJ 1U0HB 5JVHQ 2PFDA 4JI3F 2R7VA 2XULA 3C66A 2G8HA 4OZJA 3OTOF 2YQ0A 2MQPA 4K4WA 3VOVA 2ZD1B 3DOMB 4B1VA 3M6GA 4HHJA 4C7QA 3RJMB 4GKJK 2W42A 1LWCA 1EKRA 3LDPA 5BPMA 1KAZA 3CCEN 1PJ5A 3MFHA 4O3RA 4TU9A 4RUBA 1S4EA 4I67A 3PRVA 3DLRA 3ZZRA 3M8WA 3HHNB 3Q89A 2ROGA 3GJTB 3NE6A 4QJVA 2J5AA 4A4JA 1QQOA 3AOCA 4JKHA 2UV8G 1J9AA 1BIZA 1S79A 4RWTA 3SFGA 1FF2A 4BRCA 2ZBQA 2Y9HA 9RUBA 1UKUA 3KXDA 3Q8RB 1AYEA 4HH0A 4DL5A 3ZSOA 3PKMA 3GR1A 2IJNA 2LXFA 1X4GA 5IV4A 2DB1A 3UCZP 4JNEA 4EHTA 5KFMA 1PYOB 1XMQF 1RT5A 3OR2B 2YKMB 3DLBA 3LP0B 3MD1A 4FWNA 3ZNUA 2VJVA 3GIMA 1CC8A 3BZQA 4ZVTB 1IKYB 2B6AB 4FS2A 2CQPA 4KKOA 4XDDA 2OEJA 3Q23A 3NGYA 4IRCA 3KDNA 3UPFA 2HNDB 4ICLB 3L9ZA 3QT7A 1UEVA 4AXJA 2YX4A 1BE4A 4J90A 2HBRB 5IC4B 1P8GA 2ASYA 1S5JA 2CNNB 1HJRA 2R7RA 1TMMA 1UP1A 3J81U 3O3GA 3ETOA 3CTRA 3QNNA 4B3TJ 3EE3A 3IM8A 4NXNJ 3E01B 4ZVRB 1RJJA 5KFEA 5DZ7A 2PC6A 3K5NA 3GFYA 2MZTA 4B9SA 5D78A 2JVRA 1GOBA 4WXOA 4O55A 4MDBA 5LSOA 4ZVUB 5KT4A 3CJAA 3LDOA 1CJVB 5DM6Q 3VQ8A 4URQU 4H0YB 2IDLA 1UEKA 1YJVA 3ILJA 5KFCA 1T9TA 3OFHA 1LAWA 2UUAF 2DNQA 5HK4A 3R3LA 1X4FA 4KB1A 5HJYA 1KLMA 5IS2A 3MMVA 3H5UA 5T7LB 2G2OA 1Q5VA 4RTFD 3Q8UA 4CHOA 4ECXA 1S6OA 3EY1A 4C0OC 3GCWP 3NDKA 3HO1A 2Z1GA 4NX9A 5KQ8A 2C2OB 1ZXOA 4R8UB 2EVZA 1VSMA 2C28A 4Y2MA 5CA5A 5CD4A 1S72S 4DR2K 1JJ4A 3PIOQ 4DTOA 4CBXA 4RX6A 1T6CA 2RUSA 2WVBA 4FNHA 1NRKA 4DL7A 3SUPA 2MSTA 2LXUA 1JLGA 1GXLA 2HHHF 1AFIA 1QJHA 1T9WA 2NXJA 1HI0P 3CMEN 4WPAA 2ZM6F 4X66J 1BUXA 3DI6A 4I9LA 4WKRA 4AILC 2CJQA 4M8LA 4OJ3A 2BKPA 1U1OA 1JLEA 3JAMU 4H03B 5H9FK 4DJBA 4EIAA 2HYIB 4ISEA 4O3NA 4LSLA 1VQKS 2NRXA 3M8QA 2VOOA 3NF7A 1P6TA 4P2FA 3KIOA 2VFUA 2BOAA 4OPAA 2HGNA 4H5TA 4BRPA 1T03A 4IQMA 1SZ2A 2H51B 2JEJA 4JB8B 4OPHA 5BRDA 1BWFO 4WZQA 5E84A 3C7NA 4K8ZA 4V19X 4H0TB 2EFVA 4O0IA 3SSSA 3NY0A 5DGBA 4NLQA 1HFEL 1D9AA 2V94A 3BN4A 5ADXA 4IOXA 2ZFHA 4EZ6A 3CC4N 3SEOA 3ONQA 1Z25A 2LQ5A 2BABA 3VF0B 3PJXA 1RT2B 3M7VA 1JX4A 1JLAA 3T1HF 2MJNA 2ASMA 1FHTA 2WBMA 2F65A 3MMCA 4NO7A 3KLGA 3PW4A 4PG5A 2QYCA 4CO1A 3HKZD 4WFAQ 2B51A 3KWMA 3ZT4A 4AQYK 1GLFO 3NVMA 4LF5F 4LF6F 1RHRB 2XO7A 2HZCA 2HHPA 1Q53A 2X1BA 3AAQA 3S41A 1LWEA 4JI7K 1RAEB 3BBBA 1C0MA 1NSKL 2W7PA 2VH7A 5FRNA 2HWHA 3QT6A 3RB0A 3G4SS 4PG6A 4KBOA 2CWKA 3OLAA 1CLQA 2CPEA 1S99A 2VYPA 3GSDA 1F5AA 1YVUA 1VHIA 2P9PB 5HLFA 3I31A 1AROP 4ED3A 4IUFA 4NASA 4JEPA 3OBWA 2LECA 3VEZA 1MROB 4X62F 1RTHA 5E3RA 3AA5X 1FXLA 3PACA 3C46A 2VGNA 2FHOB 3VQCA 4KGVB 2YHYA 1NKCA 2JWKA 1VBYA 3JSYA 3DXMA 2ASOA 5AQJA 4CIFA 3H1QA 1CJKA 3ZZTA 3U3GA 3V9SA 4DG1A 1ATSA 2D0PA 1JXEA 3KHRA 4GKKK 2D3OR 4BDZA 2M3DA 3PSFA 3TAPA 2QRRA 4CESA 5AFUA 1WKJA 3TR5A 3OYBA 3IGVA 3K5OA 1EQYA 4ID8A 1A6LA 1FKOB 3N01A 1UWBB 2XB2D 2VD3A 2XRIA 4HHUA 1F3FA 3CJSA 1T02A 2ZUGA 2YXLA 3SXLA 3BO2A 3RMAA 4ECTA 3DRPB 2P2CB 1XMOK 5DDRC 1F2GA 5LMNK 4LF8K 1EARA 3TU5A 2IGIA 4KHWA 1NLVA 2XWYA 2CPFA 1Z1ZA 2BE7D 4H5WA 3LGHA 3QESA 2YNGB 1IR0A 4Q0BB 2B3TB 1U2VB 3VQ6A 2J8AA 5HSPA 2Y1IA 4WCEL 1N5YA 4EO6A 2YI1A 1PBAA 3N9UC 4DR1K 4CVNE 3UDCA 1YJ9N 1MMNA 4TSXA 3RMDA 1FEEA 4N5SA 2WBRA 1M1GA 1UPMB 4X65J 3C6HA 2HBMA 4K0KK 3UVJB 1DKGD 3PXGa 1GMUA 4X84A 3UN2A 3HKWA 2P9KA 4FXWA 4DV2K 1G3OA 3W1YC 1S0VA 5HBMA 2MTLA 5A8WA 3CCRS 2QA4S 3ZSVA 3OXFA 4W98A 4FJHA 4OI6A 3SSRA 2YNHA 2ZITA 1VQMN 3IFRA 2UV8A 4FPIA 3H59A 2WOMB 3FBCA 1F9EB 3FZFA 3AVFA 1B7YB 4DTRA 4DSLA 2ALYB 3OS2A 2W2MP 1HW9A 3OUYA 1O8BA 1LAVA 2XHBA 2CJ9A 1NDKA 2QMXA 3WEEA 1SKRA 2J7KA 3R7NB 2V52B 1HBNA 1GMVA 2DNKA 3OR1A 3NBPA 1HYZA 1N0VC 4IYQA 4FWSA 2YHWA 1KC8T 1BA0A 1KOHA 3NRBA 1HKGA 2VHGA 4IFVB 3ZCMA 2ZH7A 5KFPA 3VQDA 4DN0A 2V9KA 3I82A 3OL7A 4ED2A 1XR6A 1IJEB 1RT4A 4U95A 1REVB 3T41A 5D6GA 2WZ1A 4ECUA 3E9PA 4CNZA 4ZITA 4HKQA 4F2RA 4DTJA 2OO4A 2KG1A 5HMWA 4EBDA 3IRWP 2V4JA 5F3ZA 1HBUB 2UXCJ 1SC6A 2E7VA 4CGJA 4ALZA 3H08A 2C2RA 2ZJRL 4BE2A 3LAKA 5E5NA 4A8WA 1OY9A 5E7OB 5FPDA 4CJVA 3MECA 3ZFVA 7AT1B 4QWEA 5GADU 2ZWOA 4YY3F 5A0YA 1BGXT 3DGPB 3QAEA 1WKLA 3CCQS 3KUGA 1RB0A 3CB4A 3TUJC 3A5OC 3TAQA 1F6TA 2AYMA 3Q7BA 2HMIA 5SZTA 3KHYA 4OHYA 3IAYA 4HWIA 2ZDPA 4ETZA 2Z1IA 5IZHA 1QSLA 1G15A 1PIEA 3PO4A 3ZSYA 5E33A 3T19A 1R0CB 3ILIA 4HR2A 5HROB 2IVFB 2IYIA 3I32A 4I6YA 1VRUB 3G96A 4BQLA 4DF4A 3TQ1A 1RGIA 1WAFA 5AQGA 3MR7A 5CE3A 1YBTA 5EGYA 1FXDA 1I5OB 2Q66A 4WQ4A 2MQNA 1TVRB 2LA4A 4H4OB 2QFIA 1VSFA 3DU5A 3SQ1A 1VQ4N 3O6WA 1RGVA 2NLWA 4FZZA 5D3GA 2ASDA 5LMUJ 1Z26A 3TJ9A 4LRCA 3G71N 3HPGA 1F9HA 1WNEA 4UOCA 3GE9A 3FGUA 3K89A 2DCUB 2BX6A 4L72B 2PFFB 5I42B 5J2PA 3M30B 5AJ3K 1IKXA 1U1QA 4QS7A 2YCHA 5GAEP 4A62A 2DY9A 5BR8J 2FGCA 2Q6CA 1RAHB 4C11A 5HN0A 4JKBA 4KRFA 4GVLA 1UCNA 2CWXA 1RHQB 4YEAA 2OIHA 3R5CA 2F9WA 4LMZA 4O44B 1JKHA 3TPQA 1OWXA 4XEIA 4DS4A 3KLHA 2ZGZA 1X4DA 4OLOA 4JYAF 5HVGA 4O0JA 3PW7A 3QINA 4DFPA 3BBFA 2FBTA 4OYWA 4TQSA 2RU3A 4ZVOB 4FYDA 3BGFA 1XR7A 3HHLA 4WFBL 4FCYA 1Z6RA 2F4VK 3BO4A 2D3ZA 5JS2A 1F60B 4CLTA 3SPZA 1TL1A 3FFIB 3CC7N 5ETMA 4AHTA 3U9ZA 3W61A 1UW4A 4AHUA 1RQ0A 4NLOA 3MM8A 2DRBA 2BV3A 2GS8A 3ENVA 4QR1A 1UA0A 2HZVA 2EFNA 2MSSA 2CQ4A 1B70B 4KHNA 4KE5A 4P72A 4WF9L 2ETJA 1J5OA 1RKIA 4IR1A 1SQGA 1KNZA 2UP1A 3U1LA 1QAXA 3J7YP 3UB5A 4KQZA 5CCMA 4B3RJ 1C1AA 1WG5A 1O51A 3MMBB 1FT8A 1CXQA 4JHDA 1S1XB 1WSJA 2JRSA 3N0VA 1TKZA 1YITS 3BF4A 3ET6B 3IA0A 1NKBA 4HUFA 3VQQA 4KHPK 1K1SA 3QFHA 3T1YJ 3DC2A 2PIIA 3NOGA 1M5KC 2ROEA 5AR0A 2ZH8A 1Q79A 5JVHL 3BUZB 2HAIA 1CJUB 4USUA 1H0HB 1S49A 1HR0J 3QEPA 3CJ1A 4F8RA 1DY3A 2AX1A 1WUUA 1OYEA 2GJFA 2IM3A 4J37A 4HACB 5L1KA 1FRLA 4OZ0A 3PEHA 3H46O 5ETNA 2XLJA 3FSYA 2QIFA 3IRXA 1EETA 3M1FA 1OVQA 3ZTRA 1SJ1A 1Q7LB 3JAMO 2RHQB 3W2VA 1XQSC 3KYLA 2HHXA 5FD1A 1NM1A 2NYHA 5GAGU 1DQAA 4ANEA 4K2JA 3PW5A 3KD5E 1QS4A 2AMCB 4F04B 1NGEA 2YH1A 2QWPA 2IFXA 3BR9A 3LP2A 3LDQA 3I55N 3WQUA 3WNGA 4I6MB 2R8KA 3NP5A 2QSFA 1IKWB 2CFXA 1IQTA 4GVBA 1NO8A 2IA0A 3UCUP 3R1XA 3K0SA 3PFEA 3OYMA 1GK8A 1NH7A 3V9ZA 3CCZA 3DLEA 1S6QA 3J7AP 1N5VA 3EM1A 2O01C 2HFZA 1J5EK 1J53A 4F4AA 3D0PA 3UIQA 4EP4A 4IEIA 4FLWA 1IBLK 1WI8A 3O4WA 4FJ9A 1HW8A 4JD2A 1DBDA 2P9IB 5DG9A 3ZZPA 1JQGA 1FKAF 2O67A 4B3OA 4PCQA 1X60A 3K57A 3TQEA 2H65B 1SIWB 3HULA 4NXMF 1HHSA 1WKKA 3QFPA 3HT0A 4ES3A 2A18A 1RE1B 1HNVB 5K8OA 3E1YA 4FL9A 1FD8A 3VAIA 1EXQA 3CGIA 3M1VB 4DR5F 2Z30B 3MEDB 1VBKA 2L9NA 2HGMA 4AUKA 1T9XA 4ZIWA 1RILA 1S6UA 3CWJA 2V8GA 3OBIA 2QYGA 2PD1A 2KXFA 4EBCA 1MW7A 2GELA 5DM6L 4RJVA 3H0PA 5B8HA 5LJ5Y 4WK3A 4FWKA 2NUBA 5KFYA 5AQUA 3AA3A 4E8UA 1SV5A 3FBEA 3UI3A 2VOPA 4CTAB 1NGHA 2GUPA 5H1SV 3HP6A 3BH6B 3C6UA 4AM7A 1Z2LA 1AA1B 1TYQB 3AO3A 1UVMA 4CFCA 1Z4UA 1KAXA 2GJIA 1S0MA 1B3TA 1SH2A 2PA3A 3P39A 2WC9A 3P96A 2K7JA 5KFTA 3L7OA 3FZLA 4X4TA 3QYYA 5KFOA 3E9OA 3T5HA 1XR5A 2CZ9A 2WB4A 4DDFA 1NNDA 3P8BB 2X3GA 1H2UX 3DM2A 4FJGA 2J6UA 2AJQA 4B3TK 2J0SD 3V1QA 4EGLA 1SC4B 3I9V9 4DV3K 4LRAA 2HVHA 4X64F 3MGJA 4IOCQ 4WFZA 3NEKA 2FVCA 5ETPA 4HH1A 4OYAA 1RT5B 5FPNA 1U1NA 2OTLS 2YNFA 4K7QA 2OSQA 3M2VA 4TXSA 4FPAA 4JV5J 5E26A 4UQTA 1ULRA 2E2NA 1FK9B 4NYFA 4OKEA 4LF4J 4DR3J 2FJBB 4CIOA 3TTCA 3IMXA 5AQYA 3FRZA 1FKPB 1VOMA 2Z1HA 4UY8O 2UXDK 1NXIA 1OH6A 2QMUB 1TL4A 3TOQA 2LEPA 4CF9A 1P1LA 3TRGA 4X4QA 2FVQA 1BC6A 4ZPCA 1U1PA 3IP0A 5D15A 3MWTA 2RH3A 1RT3A 2X74A 1X9MA 4B8CA 1FJ7A 3N4WA 1OH5A 2OPQB 4QCLA 2N4DA 3CD7A 3CHWA 2GAHC 4IZ9A 1WF1A 4IO9Q 3N28A 4BQZA 2HEKA 3DMJA 2EXUA 3FRYA 3VEYA 4EMDA 4ZP9A 2BKOA 2NS1B 5HQMA 3J80O 2UU9J 3BKFA 5L8RC 3C65A 3MDFA 1QZ6A 5GAGI 3GIRA 1FNMA 1Q86O 4PL7A 2M8DB 3HHEA 2VPWB 3KK7A 4WFAL 2VG6A 1UFKA 2VQEJ 3GWCA 4ID5A 4Z4HA 1A5XA 3MCPA 1KP6A 4HVJA 3C14B 4GC7A 4LF7J 1XC9A 1V9OA 3MPUB 2ZGYA 3QRRA 3SV4A 2QEXN 4DTXA 3UD4P 4OKJA 3UKUB 1IKVB 3QBWA 4NA3A 4JI6F 1T3NA 2L9WA 2ROPA 2J0XA 2VG7A 5C2GA 1A5VA 3I0SB 1RWKB 3E51A 1HNXF 2CRLA 1DAXA 2D0AA 1DZ5A 1VAZA 3IM9A 3TSQA 3DRSA 4DZ6A 2FJWA 3BSOA 2GBZA 4C0BA 2MYFA 3BM7A 4NEYA 3WC2A 5KFRA 1SKWA 2ADCA 4DQSA 4NMXA 4OHXA 4R5PA 1WBDA 1I94J 1B0TA 5ETQA 4TYAA 1NWKA 2J7UA 2QTDA 3M8QB 2XY6A 2CGLA 3DOKA 3HHDA 5EVZA 3SAGA 1R0AB 1VHFA 2D9PA 1EP4B 2XEXA 1VQYA 1VQ8S 1R89A 3MF5A 3VQ5A 2W4CA 4LBHA 2PE8A 3VGSA 4IKFA 4ZPAA 3SUNA 4YR3A 1RWNB 3RU0A 5D0EA 1FE0A 5EOYA 1C0TA 2GHVC 1NK6A 3U27A 1W2BM 3CJKA 4CEBA 4FJ8A 4KH6A 3MMJA 3PW2A 4EUVA 4H5RA 4B9MA 1AT1B 3C2PA 2KFZA 4Y00A 5AQRA 1N0UA 3DLKA 2BE2B 3HM8A 1ZAXA 2BJEA 2EBGA 1WHXA 2CA9A 1BD6A 2CQ1A 4IFYB 2B56A 1ZYQA 4ECSA 2G8WA 1W0HA 4CH1A 4PA1A 3PVXA 3BO3A 4CGHA 1T9UA 2HLTA 1X7VA 1BU6O 1LWEB 1EZZB 5HL7Q 2V8PA 2EFOA 2B7BB 4FK4A 5DQIA 2KT3A 1QQCA 3UDEA 3ZETA 3CJ7A 4J9LA 3KK2A 4Y0FA 4H4MB 3GV7B 4PL8A 1K44A 3LWLA 3H5YA 1ZBLA 2VWKA 1HNWF 2GO8A 2ZH5A 5E2QA 2DGQA 3OJUA 1M0SA 5I3UB 5LY3A 1SJRA 1WSVA 2E5LJ 1FW6A 4ZDNA 5MLCQ 4YOWA 3VTHA 3R8EA 1VDHA 3NH2A 1U2FA 1LW0B 4DOZA 3SQGB 1N36K 3WHIA 2Y3YA 5F2RA 4BC5A 2NREA 1TK5A 5KFGA 5KFLA 3MUVP 3SJJA 2I5JA 4Q8FA 2SXLA 2OPPA 2WTFA 2NR0A 3QWPA 3R2DJ 2YBVA 1MNEA 4U96A 1AW0A 4B3MF 2MZRA 3LPUA 1S9EB 4PXCA 4OLBA 3I0RA 1TMJA 3G8QA 4IXCA 4DV4K 1RADB 4KPYA 1FRMA 2E20A 3HD1A 3D6FB 4K5SA 3HD2A 3HF5A 4KTQA 4AHSA 4DCHA 4HDGA 4JI5K 4LVNP 1WELA 4CBWA 2B4JA 1GXTA 2WAQD 4FM1A 1RKJA 3J7ZO 2HKEA 2X6NA 3NCPA 4BC2A 5IWAK 5KFFA 2XI3A 1L3UA 2HRUA 2ZQBA 1QE1A 3HZEA 1EIYB 3H90A 4CLYA 1Q86T 5DS7A 5U47A 4DXLA 5LXRA 3DLLQ 2D7SA 3LP1B 4C9DA 3KHGA 5BYRA 4CLWA 4MO5A 2NNWA 2BEFA 3MI7X 4A57A 6AT1B 3VHQA 3HVTA 2RS8A 2VQFK 1HWUA 3O3FA 4MK7A 4ED0A 4LR8A 5CAAA 1BOTO 1Q82O 4CJ4A 3MN6A 4OJ1A 3HRGA 1YKWA 4DUYK 2XMVA 1S12A 3EX7B 4PPDA 2FC8A 1J2VA 5IT0A 3VN5A 1ZM2A 4CM2A 3JQKA 3KVGA 4CGIA 5HBMB 5AQPA 2HFVA 1PKUA 4WIQA 3IS9B 3LPEA 3POTA 2MLXA 2UYTA 2OYQA 2WVEA 2OZSA 2KU7A 1QVGM 1UFWA 1TGOA 3RB3A 4CJKA 2AU0A 4FM0A 4KGMA 3OTCA 4QPTA 1OY6A 1LXJA 3E9LA 4YR0A 1RUSA 2ZVSA 2XQCA 3ISNC 1HWIA 3IMQJ 1PO6A 1H74A 5EN1A 2HNYA 1FRIA 4HCBA 1ASVA 3HPHA 2R8HA 1NSAA 4AHCA 2CNOB 2O8CB 3AVBA 4L8RB 3VERA 3L95X 3W5XA 4EI2A 4I2QA 1UAWA 2M70A 2XNQA 1G6BA 4FF2A 4B08A 1UJ5A 1VSLA 1TKXB 1XK8A 4YHHK 2LU1A 4IQXA 2UXBK 2QO3A 5CYQB 1YVNA 2YWFA 4NI2B 1QVFM 1SAZA 3KG1A 3C16B 2DISA 4KH1B 3CCUN 4JI3K 4J9UE 2O1PA 3OTOK 4S0MA 3LA0A 4DCOB 3ISZA 4BRFA 3VQ9A 1DRZA 4UTGA 2ZOFA 3DYAA 2MDAA 5JJBA 1KS2A 1RWWB 5M2UA 3B6BA 3AVMA 1U26A 1NGCA 4B1ZA 3A12A 1X1PA 2EG1A 4U7CA 4YDUC 3BPDA 3WX4A 4CZEA 2ZHOA 3H5SA 3H1VX 4DTSA 3D7SB 4CZCA 2H5JB 3Q8VA 2AP1A 3J7AN 4RL1A 2P9LA 4CHQA 2Z2YB 4QAGA 4ZLPA 1HQUB 1RBLA 3W5ZA 4LFBF 3C19A 3KJVA 5KFUA 3V4IB 3H4DA 1IBKJ 2HWTA 2AF6A 5KFHA 1XMQK 2RE2A 3M9MB 4FDFA 2D0BA 4LFAK 4KIAA 4JV1A 3L3VA 5F8IA 2ZBCA 1EX4A 3C6AA 3OFGA 1X9WA 3AT1B 3L3UA 4OYZA 3RW6A 4QYZJ 1RDAA 5BREA 1VI7A 2ZE2B 1P90A 3MTJA 1IBMK 4AL5A 2EHGA 5AQQA 1DARA 3H8YA 5GIOA 1GTEA 1Q78A 5HATA 4WFNQ 2E9TA 4A47A 2YKPA 3B54A 3MAHA 1YJ9S 1T3VA 3OHBA 2DO0A 3A5NC 1QSYA 1R8CA 4GKKF 3ASMA 2RB7A 3NGKA 2XY5A 4H5VA 3MR6A 2HSEB 1TL7B 4RW9A 3DRRA 2N3LA 3KKRA 2J9EA 4HYKA 1AZSB 4PKHA 4KFBA 2MQLA 4WYBA 1B0VA 3U7JA 1RT6A 4CHNA 4IEEA 1L3SA 1RT1A 4DR7J 4N8OA 4WWSA 4ZVQB 2B8PA 1MU2B 2CQHA 1XC3A 3RW7A 5KG7A 1K8KA 4M5LA 1HNZK 3L0QA 1WACA 1M5PC 3TEGA 1XMOF 4LR7A 2YVSA 5LMNF 3LM2A 2AQ4A 2U1AA 5D4NA 2KG0A 2FLOA 3UKRA 3K8VA 5E3PA 4KI4A 1PILA 2BJ3A 1ZH5A 4QW8A 1BL3A 1H7XA 1KTVA 3LWMA 4ELUA 2YHAA 3J7ZT 3MCMA 3GILA 3OYIA 3MXMA 2GO9A 4FYYB 2UVWA 2HFSA 2A6OA 5L9XA 1X8DA 2IVOA 1D0EA 4IG0B 1VQPN 2EBEA 4LQ3A 5KFXA 4NYOA 2QT7A 2RHSB 3MMAB 2DH7A 3ICLA 2XYHB 5KG2A 1HKAA 1RLDA 3Q0AA 1BA1A 3J7Z5 4ZLLA 4Z37A 1APSA 2JLGA 4I6WA 3SIPB 5E0OA 2MZ1A 5BN9A 2MKCA 1RHKB 3OYAA 2IIHA 4K4XA 3GYGA 1NK0A 1V6HA 2HHHK 1RDRA 1YSJA 2GZOA 3TUZC 4M3ZA 4AT1B 2BJ9A 4F3MA 4IJNA 2CQ0A 4UOFA 4HEA9 4P75A 4WE1A 1U25A 4UOHA 1TELA 4RKUC 2HMPA 2UUCF 5B0FA 1NMDA 3CCLN 2OPSB 1ZA1B 3R6LB 5I3QA 1YHQS 3MPDA 4O5BA 2DH8A 5BYSA 2DTUA 3V5RA 2ABYA 4P10A 4ED6A 4G65A 2VFSA 2R7SA 2FC0A 3RG6A 4IFEA 4XIUA 4RW8A 4FNIA 2XYPB 2ACMA 4BR2A 3EDRB 5BXIA 5J2QA 2IMWP 1YRUA 3O80A 4A48A 4B9TA 3C15A 3OTDA 1CQNA 1HQEB 3A8EA 2IRUA 3U4LA 4Z0UA 3TX8A 3EN9A 3OFEA 3KK1B 5HO4A 3QGPA 4KHSA 4NA2A 1YIJS 4OI2A 3T1HK 3OXLA 4IO1A 1F9FA 3TABA 2QA2A 3M8PB 1U8WA 2AP6A 2O3DA 2ZDOA 3FSXA 1DQ9A 3WNHA 3QIDA 3VV2B 2CQDA 2HWIA 2KLAA 4JI2K 4CEZA 3V81A 5THWA 5KOWA 1JWWA 4LF5K 3D6RA 2OD4A 4H4KC 3M2UA 3UFCX 3EICA 3D0IE 3D3BJ 5K9FA 2BH1A 3ENWA 1YI2N 2GQQA 3WZ0A 3G71S 3M3ZA 3W2VB 4EWTA 4FLZA 3JTOA 3OYHA 1ZM4A 2UUAJ 3VAKA 1SL0A 3CF5L 1VRTA 2HQDA 4YOTA 3PR4A 2XMUA 3L6QA 1HARA 4IOCL 4BREA 2KVQE 3P49B 2FF3B 2RQMA 4UQGA 1E6VB 3RZAA 3TAMA 4X62K 3GP9A 5IT9U 4GVBB 1ITPA 2YNIA 4V19S 1ESVA 1OH8A 4KGZB 5FDLA 3RRKA 4DV1J 4ELTA 4XPEA 1YAGA 4FLYA 2OPRB 1Q8BA 4P7VA 3TSUA 2M4MA 2LDIA 4KPCA 2LYVA 2YKNA 4C8NA 1EWQA 2BA9A 3OQ2A 5DM7Q 4P2XA 4CGDA 2UUBK 4OZ2A 2G0JA 4KV8A 3O8WA 3UWTA 3VEXA 4X4OA 1O0PA 3W2WB 3MEEB 4DV5K 2J0QD 2PFUA 1HPZA 4CHPA 3HSGA 4N8NA 4C4WA 1UVLA 4PYAA 3VEOA 2G8KA 4DV6J 3W65A 2KFYA 4DPYA 3CC7S 1RI7A 4P74A 4OI0A 3HXMA 1FFSB 4FYVB 1N33K 5L1LA 1V3ZA 2PT0A 4IO9L 1U09A 1WOOA 2YKQA 5D8HB 2FJEB 2O8BB 3C3LA 3VR1A 2D0CA 2B5JA 5BRHA 1U4BA 3ATUA 3SPYA 5KAKA 2OP5A 3AY0A 3U8XA 1RABB 2HIQA 2ZJPQ 2HRYA 2R2UA 3O2IA 1RBSA 2WK4A 4ETXA 3DXBA 4JV5K 2ASPA 4KI6A 3M8SA 5JVGL 1JLBA 1TUUA 4LF4K 2LEBA 1HLWA 2EEYA 3L4BC 2XY7A 2FIUA 2GQ2A 1ASUA 2AIRB 4K50A 3JYTA 3P5BP 1UWAA 3QEWA 1N8RO 1YJNS 2KHCA 4EP5A 4FWQA 3EVWA 4TN2A 1UVIA 2PEBA 5J1NA 2B4PA 3JSBA 2F4VF 1LK5A 5K14B 4LUBA 3DM2B 3HDSA 2CYYA 2ASLA 1Y3KA 2IPOB 4NB4A 1ASWA 2RU9A 4LF6J 2G8FA 4URGA 2CPHA 2Y8YA 4MKAA 1S76D 1CJTB 4MFBB 4QR2A 4RW6A 3BPSP 4YB6A 2WSFC 4L74A 3CCJN 2IDOA 4CFAA 2H1YA 3EJMA 4JKDA 2MHNA 3KD1E 4YFUA 2FD2A 1Q8LA 2F8SA 5CZ2A 3K2PA 1PGZA 1E3MA 4QOZB 5CXTA 1FA0A 3DDIA 2DHGA 2UU9K 3FZKA 5L46A 4PQUB 4LH5A 2O4IA 3HHLD 1TQLA 4ID1A 1NHKL 3MPWA 1QQNA 4DV0F 4HI2A 4W5NA 1S7IA 2IRXA 4Q43A 3E8OA 3I55S 3MM6A 1RT3B 1C4AA 1S1TB 4ZHRA 2CQ2A 3QMQA 4CRJA 3KHHA 1FFWB 2A2CA 1N52B 3S1TA 3EKUA 4LF7K 1IR2A 1W25A 3OHAA 4OGCA 1PJ6A 2KKHA 5L39A 1LFWA 3I96A 3QFUA 4CZHA 2C2DA 1KQSM 2J8SA 1IG9A 2B7CB 2XMAA 3KK3A 3PEJA 1NGAA 3FNNA 3CXCM 1HMVB 2DH9A 3R6MA 4RG8A 3VA3A 4UOGA 4H5NA 4M3UA 5K8NA 2MGZA 2BW7A 4ZPTR 4ED4A 3NMUA 4JI0F 2WONB 2AYBA 2L41A 2F9JA 3L7PA 1DT9A 3LUYA 4JKEA 1K73T 2QWMA 3S3MA 3VESA 1H3DA 3ULEB 3D2EA 1RU1A 4U7UK 4MH8A 2VG6B 4B9NA 2V63A 1QZ5A 5A8RB 3P4IA 1KONA 2W9AA 5DDPC 3T6BA 1B4SA 1RU2A 1U0SA 3MURP 4CW7B 2AZ3A 3F9KA 4C48A 1JLQB 2YY3A 4Y1CA 3QZ7A 1FRKA 4DTMA 3LPYA 4NLGA 3I87A 4GO5X 2VG7B 2GGPA 4PPZA 4Z2XA 5AZJB 3N5FA 3M6XA 4MK8A 1WNSA 2QWNA 3L2VA 1J5EF 5HVFA 4K4TA 4DUZK 1OH7A 2E6MA 3UD5A 4N7TA 2JL9A 4KHQA 3THXA 4WQ5C 4WBFA 1RAAB 1M1HA 1X4CA 3CIPA 2XLKA 2F96A 2P9NA 2ADBA 4AYBD 1HIYA 4R5PB 2JH3A 2P9GA 1V4TA 1OY8A 1T95A 6FDRA 3AA2A 1BHLA 2P5GA 5AQOA 5CZ1A 4ES2A 2X1FA 1VQ6N 5ETLA 3IBCB 3D4JA 2RPIA 1WHYA 2RUGA 3LZIA 1RTDB 3NF8A 4FWLA 4O8UA 3QLHB 5DLGA 2YJEA 2LXIA 1RHMB 1KWMA 2QL5B 3LF0A 2R2TA 3QJPA 2PDAA 3HSDA 4BRNA 1S9GA 3BGRB 3THYB 5EU7A 5HI7A 3THPA 3DXKB 3THWB 4CT8A 3VAFA 2J7WA 1U48A 4OI1A 3ZTSA 4ES1A 1ZZNA 2VBYA 5KQDA 1MSWD 2Z1JA 1ZBHA 4B1YB 3QO9B 3M2RB 3US5A 5A2QY 1CULA 3T3FA 1LK7A 1JIHA 2E5LK 1ZTWA 5DGAA 3RB6A 2GX8A 4DPXA 1NJIO 4HHHA 2YHBA 3G25A 1X5SA 1CZAN 2VKRA 4P2SA 4BR9A 4JYAK 2P5VA 1U2CA 4KH0B 1HNIA 1N8RT 4CJRA 4F4WA 4B3TF 1WBBA 4NXNF 2YQ1A 4DV3F 4M7YA 3R1HA 3KG0A 3BZCA 3JS9A 3CQXA 4DSIA 1X0FA 3TA0A 3IG1B 4QWDA 1H6KX 2GNKA 4I2PB 3KLFA 2E66A 2RMLA 3TA2A 2FC9A 2NZCA 1BI4A 3SMSA 2F4FA 4X4NA 1O13A 4KO0A 2DHAA 5AXMA 3PJWA 5C0YA 1WG4A 3FK4A 2RQCA 4FJMA 1W7WA 1S6PB 4GC6A 3GYNA 2UXDF 2FVPA 1MMLA 1NSQA 4NOHA 2JOQA 2I8EA 1D8YA 2VL1A 3CNQP 4NLPA 1FRXA 2IA6A 2W24A 3ENQA 1OPZA 3NS5A 3Q8YA 3TA1A 1BQXA 3CCMS 2IBOA 1Q16B 1XHXA 2XI2A 2NLXA 1SIZA 4FZXC 2EKYA 3KFWX 3CD6N 2NYIA 1S0OA 4NCGB 3TZXA 3JQMA 5FLXY 4BGBA 2O8EA 3J81Y 4JI4K 2P9SA 4DU1A 3FCHA 2MKKA 3C6TA 3S6EA 3MM9A 3W8GA 5B0EA 4F3QA 1A0OB 2OSRA 4BG8A 1RLCL 3H3NO 1WC4A 1JXVA 3A3OB 2GEMA 3EUNA 4ZP7A 4UW2A 4G1QB 4X66F 2GMJA 2KHDA 3W9IA 2HK3A 4CJLA 4H0VB 2NUHA 4Z4CA 3NL0A 4J2DA 2X7IA 1RWVB 3L2QA 5J1EA 1C0UA 4CCHA 4G1PA 3HVAA 4BR7A 1E4GT 4BRDA 1XJWB 5C2CA 4M5IA 4N41A 3HVTB 4ANDA 5KFZA 4A2AA 4BR0A 2PI5A 1WB9A 1UFLA 3GG4A 4E98A 2Q1NA 3IC1A 3KWIA 5DQGA 1S1VA 2E5GA 2P9EA 3FGVA 1QDUB 2W2QP 4DQRA 5AQWA 3KLEA 2ZKTA 1JJ2M 2M9KA 3JS6A 1BISA 1NHVA 5KG4A 4F2SA 5C24A 2MKIA 4AF1A 5J2NA 4ZKAA 3D1QA 3I5AA 3H5XA 4GW6A 1C1BA 2IAJA 1GT8A 1FDAA 2H3GX 4W5OA 3CDEA 5J2MA 2RF2A 3H45C 1I3AA 5B7WA 2KRRA 1U47A 4USMA 1DTTB 3BSNA 3F73A 4L3KA 4PWDA 4PXBA 4DMNA 1TV6A 4AHRA 3HOTA 2VUGA 4J9RA 4FW1A 3JAMY 1MDUB 4DR6J 4DR5K 4C23A 2JNJA 4JI8J 4WQ4C 3H25A 1PJ7A 1SB6A 3JTPA 1VSDA 3GIKA 4JI1J 4ZPBA 3G86A 3MR5A 3KLIA 4C2MA 1IBKK 3AVCA 3V9XA 2FZKB 3VAMA 4BHQA 1TK0A 4C8MA 3G0ZA 3QNOA 5IT9O 1IR1A 4EZ9A 2B8QA 2NXUA 3OD2A 4KR0B 1LQ9A 2MY7A 4TU7A 1RBVA 2BJ8A 2GW8A 3NGTA 1YWXA 3CO9A 1YJUA 2CNKB 1NJIT 4R0JA 3V1RA 2F5GA 3SQ2A 1JNZB 3NGRA 4CZIA 4ZN3A 1LWXA 2OTJN 4A8SA 3G8TA 1DJ0A 2E5HA 1GMWA 4C8LA 4IDKB 1MN9A 3MTKA 4JP8A 2CH6A 5JS1A 2LKZA 1ATRA 2A1RA 5D77A 1NGJA 3D28A 3I56N 2KTQA 4FSVA 5KFQA 3HMJG 4C6AA 2KJWA 1S1UA 4HVZA 2VONA 4GRSA 2HSTA 4B3SJ 3W63A 4J9NA 1BWVA 1QAJA 4FKXA 4DR7K 2P9UB 3K5PA 5H1SQ 2OAUA 1RT7B 3HHKA 3V6KA 3HHLC 3PYGA 2L48A 1BY9A 2ZHAA 3GLJA 1N36F 4TY8B 1EX8A 2B4OA 4DSEA 4WK1A 4L76A 3G87A 1RISA 3PR5B 3RB4A 4Q5VA 2VC0A 5IOLA 1EO1A 3CJBA 1WDDA 3G6ES 1KFSA 4A8FA 2PMZD 1HHQA 3R2CJ 1TUWA 4RW9B 2K2PA 1HBOA 3VGVA 5F8JA 4GMKA 1QTNB 3QT8A 1S7HA 4NLBA 3W8PA 2ZJQQ 3A2FA 1V3RA 3FQLA 4HI1A 3EWGA 1UVJA 1HWKA 2O8FB 2BKNA 1DHMA 4L6V3 4JI5F 2MZQA 1NK8A 1V4SA 3RAQA 4OJGA 2P1JA 4OHZA 3N5BA 4FBTA 2W01A 5IWAF 3GQCA 3UKRB 1FNOA 4DV7J 4EFHA 1VQ7N 1X4EA 4YB1P 1Q1KA 2MY8A 3LM9A 2IIRA 4IJAA 2VB6A 5B09A 4QW9A 3MM7A 2CJKA 2CGKA 3I8BA 3PDNA 3NXZA 3O08A 1JNRB 3GV5B 3K58A 2VQFF 3WDOA 5HMZA 1ZS6A 2WTUA 2QN6B 5LJ3Y 3AB2B 3RYLA 4CD3A 3FMBA 3X1LB 2BXJA 1PBUA 2R3VA 4DUYF 3UCGA 4RNHA 3W9HA 4QWCA 5EXWA 1YX2A 2FLLA 3GFXA 1X4HA 3FDSA 1T9VA 2MKYA 4E89A 1WOSA 4JI6K 4YR2A 3LTOA 5MAOA 2FVRA 2N82B 2FJXA 4YS2A 4X4RA 3LAMA 4HUGA 4DQ8A 2R8JA 3GFHA 1HNXK 3SCXA 1Y5LB 3RRHA 4OI4A 2UUTA 3ZZUA 2C3MA 3J7A1 2HOEA 4DR4J 1M5VC 2V0NA 2QFJA 5HRRA 1N34K 1JCGA 2HS4A 3AV9A 5DM7L 4ILJA 2LQ8A 3AD7C 1SI9A 4X64J 1RTIB 2JEGA 3CM6A 3TWHA 2E1RA 4M5NA 2AHOB 2RE1A 2RKIB 3HFZB 3K7RA 3CMAS 4TLRA 7FDRA 1DLOA 8RUCA 2EI5A 2W9BB 2BOPA 4RU9A 3VQAA 4FVCA 3BF1A 3QNWB 1VSEA 3LL3A 1R27B 3FUYA 1FTRA 5KTQA 5J2QB 1UEUA 3T5JA 1S5ZA 2B9EA 3QSYB 1YJTA 3D6MB 4MIWA 4RR5A 3ID8A 2DXDA 2ZJPL 2QGFB 3D9BA 2WW4A 4EAHD 5F8NA 3Q83A 4M3YA 1B9FA 3NAHA 5EY4A 2MHEA 4ZS6A 1Z2ZA 3AVHA 4LFCJ 3UN5A 4F4YA 3V81B 1NB2A 2VCPA 2RJZA 2HBZB 3NKYA 4PWUA 4DX6A 4E2FB 1QSSA 4LBIA 1N32J 1MWZA 2AYGA 4FWRA 3H20A 3PX0A 2W9CB 3ILOA 4J9SA 4MJKA 4BRAA 2HNZA 2LQBA 4YUDA 1S1WB 4CYUB 3VGTA 1RYSA 4O4GB 4L3NA 1TAQA 1VRTB 1ACMB 3O8MA 4LFAF 5LMUF 3BQ2A 2Q79A 5HANA 2GVDA 3BQ1A 1HNWK 3N6NA 3H40A 3VGMA 2R2SA 3TAEA 1P27B 4C1NK 1SCJB 4ZCIA 2ILZA 4J91A 1XNQK 1IBMF 3JSMB 3U1MA 5FDLB 1HWJA 4BE1A 1GLBG 3ENHA 1FESA 4ZVSB 2D3UA 5G0RA 4PQAA 5F9LA 1T44A 3Q2TC 2OA8A 4A46A 5FLXU 2I1RA 3MN7A 5M1NA 4YB7A 4M3RA 3MEGB 3VCDA 5H9EK 4BC7A 1P9YA 3OL9A 1U0HA 1NB7A 1Q0NA 4B3MK 3O5TB 5FIIA 3V6DB 4P2MA 3BR8A 1HPZB 1XNRJ 1UJ4A 2ZD1A 3DOMA 4CI0B 5TKWA 3O6QA 2E1ZA 2DITA 4X4VA 4YOVA 1N6QB 1KRPA 5KG6A 2XLIA 1SKSA 1M90O 2Q1LA 2HBJA 4OX9J 2CXEA 1KVCA 3QGIA 5CHIA 1HNZF 1ZBSA 4J5OA 1CZBA 2ZC4A 2MMYA 1MA9B 1WD6A 4JN4A 3TZZA 4BDPA 1RNHA 1VQKN 3RUBL 5DG7A 2Q36A 4UT4A 3IUCA 2VBXA 3AD8C 4QR0A 1TKTB 4F0KA 4RWXA 4ZJOA 3F5TA 1WHWA 3OR2A 2YKMA 1JJHA 1OQ6A 3LP0A 2KRBA 3NMRA 3IGNA 4ZVFA 2E2QA 4GKJJ 1X9SA 1X0PA 3SAHA 2E7XA 1ZM9A 2X51A 4PKIA 4DB3A 1WAJA 5KOXA 1K8AO 4CBUA 1IKYA 2B6AA 4CDIA 1F3VA 2R42A 2VPXB 4HT7A 3OT9A 4FW2A 2DNOA 2HNDA 1U02A 2XMJA 4ICLA 1SH3A 5KPRA 1WN7A 5CR4A 1L5UA 5IXUA 4V19J 3EZUA 4ZMMA 1WEZA 3T1YF 2A6MA 2HVDA 1VLYA 1PAEX 2BACA 2HRTA 5E3CA 5BR9A 4NCBA 3B4DA 1DTQB 2QA4G 3E01A 3A3NB 4UF4A 2UZAA 2R7QA 3CJ0A 4JKAA 1T05B 3EKSA 4ITSA 1UA1A 2W8KA 4GO7X 3DJCA 3AO4A 1NGBA 4CZFA 4DLGA 1YI2S 1FI4A 4CLFA 5D0GA 2W6LA 1CJVA 4DFKA 2E5JA 1TL3B 3MXJA 4WU2A 1WSEA 1RWXB 5ETSA 4E1JA 3ZNJ1 2OD6A 2ZZTA 2DPIA 3CQ8A 1NNEA 4QU6A 3AVAA 3R7SB 5C25B 3PUFA 3QAUA 3P1GA 1ZOTA 2CQGA 5GAEU 3QEIA 1VIXA 5T7LA 2H5EA 1HI1A 3J8AA 3OS0A 1T6DA 4FJLA 2K1RB 2P8IA 3U9DA 2Z57B 2QJ3A 4KHYA 3HL8A 2HQFA 3CFRA 1GLAG 4R8UA 1I6JA 4CEDA 4JI2F 4ZJLA 3BYPA 5DLFA 5AQLA 2FXUA 3HI9A 4WZMA 1C0GA 4YNQA 2DPNA 4GV6A 3O9SA 4H0PA 5E3AA 3PNIA 4H0XB 2GA7A 3FZHA 3HLUA 1FVSA 4BRIA 5AQHA 2KJVA 4QIGA 4LFBK 3K59A 3GTYX 5G4DA 2AA4A 1LFPA 5F8LA 1E6YB 3QWUA 1UL3A 3VETA 2R7XA 2YWEA 1EHWA 1RTJA 2DYAA 3DNCA 3D2FB 1RWMB 2M52A 1FJGJ 5IM0B 3F0NA 3DOLB 4A8KA 3MXHP 2QI2A 3OYGA 2E1MC 3J7YU 2AKWB 2YWHA 5GMDA 4DR2J 1WG1A 5DDQC 2VPYB 2MJUA 2HS0A 4LSNB 2UUBF 1DGKN 2EX3A 1BHNA 3P5TL 1VLOA 1YUWA 3CYMA 2HQ3A 3WT0A 1TFWA 4DV5F 3AVIA 4M41A 2QWQA 4CHZA 3D7EO 3FKBA 4KGXB 4QZVB 5B0BA 4ZA1A 3IFEA 1RT2A 2KM8B 2RQKA 2DCLA 2CPYA 5H9FJ 3WXKA 1BQNB 3ZZYA 3M32A 1RAIB 2GHPA 1N33F 2BANB 3CCRN 2QA4N 3FMWA 2AWZA 4O0NA 2AD9A 4HLBA 5GAHU 2B4UA 4OHWA 2I9SA 2YV0X 3SV3A 5I4MA 5D0HA 1HBMB 2Z8QA 3FQKA 4YN3B 2XS2A 5M1OA 1NK7A 3NF6A 5LL6Z 2IM1A 1W2IA 2E6LA 2HVZA 2C3UA 1WC0A 2ZNZA 1XMBA 1D3WA 4JV5F 3MM5B 3CPEA 3R5BA 2EPIA 3OY9A 3KG4A 4PUOB 1VJWA 5LOQA 2VGMA 2AJ2A 4LF4F 2P9PA 1VCTA 3VGKA 3O1BA 3QFWA 1UVNA 2MQMA 1SUQB 1KLNA 1F1BB 3CG7A 2KB2A 5CYJA 4LF9J 1GLEG 1K8AT 2OMOA 4L75A 5AZIB 4PY5A 3LALA 3ITHB 1LW2B 2V8HA 3MOJB 5HRNA 2O8DB 4AQYJ 8ATCB 1R3NA 4RUCA 3RBDA 2KT5A 2V50A 4NA1A 3QEVA 3I4PA 4JI7J 1ITGA 2F7TA 4YQWA 1NDLA 1CEZA 4IG3A 4ZCMA 4UUWA 1IJJA 1T0TV 2PAVA 1KVAA 4B9VA 4IH5A 2UUCK 5CABA 2RILA 1Q81O 2H9ZA 4RW7B 2UU9F 3NCIA 1IV0A 3R5JB 1FKOA 3F2KA 3NGSA 4M63A 4A5BA 1UWBA 3PG9A 1DURA 5GAEI 1LOTB 4CJQA 2YH0A 3M5RA 3CCQN 3PIPL 3DRPA 4OZ1A 1NMEB 1YT3A 1NLKL 2VWBA 1NDPA 3GBTA 2V8DA 4LF7F 1JLCB 3KKSA 5AQVA 3ZSRA 1RCOB 2AEFA 2BMBA 3GV8B 2YNGA 1NH8A 4NZ6A 2CPIA 1FDBA 4Q0BA 4KAZA 2HG4A 3SBGA 4B9UA 1YBAA 3G82A 3MCSA 4BY9C 2A41A 4GVMA 3WBZA 1J27A 1D09B 1VQLS 3WNFA 2KO1A 2WCXA 2VG5B 1H2VZ 4Z7YA 3QMLA 4Y2AA 4JLHA 4QWAA 1YG0A 2DFFA 3UVJA 3H3OB 2AJ0A 3TP2A 3CJ8A 3LGMA 5IV3A 5F1XA 4FOIA 1WF2A 1XMOJ 1VQSA 2IBKA 3R5GA 5LMNJ 4KH5A 4LF8J 3LDNA 1HKCA 5HP1B 2DNNA 4B8AB 3ZSZA 2WOMA 2QWOA 4Y65A 1RBAA 3VQTA 4ILRA 5DRKA 2HF3A 5F8GA 5J1PA 2JSXA 3SCJE 3VQ7A 1NGGA 3D3CJ 3ZSWA 4DR1J 1ZBIA 2W4DA 5A2QO 1QHAA 5D4OA 3AH6A 4DI6A 1NCLA 4JI8K 4DUZF 2B4VA 1WJ9A 3AJDA 4K0KJ 3H2LA 3AO5A 3NAIA 3PX6A 2FHJA 4K4SA 3AD9C 5HQ8A 4DV2J 4IFVA 4WTOB 3LO3A 2FUG9 3SMPA 2H3EB 3SQ4A 3R1LA 4NRTA 2V69A 2MLYA 4RO0A 4O4RA 4TNOA 3L4QA 1UMJA 5C42A 1R6VA 2ZC3A 3CW2C 5GAHI 1KVJA 2JEFA 4I7FB 1REVA 2OUGA 4FLXA 1FXXA 4CZGA 2OGUA 2HURA 2JVOA 5IC6B 3MZIA 1Y00A 3OYCA 3JTNA 4FLUA 2D3O1 2OZMA 2V2ZA 3OW2R 3M9NB 2RT3A 5EWFA 2D74B 1HBUA 4Q2LA 2M7SA 4U67Q 4GV3A 3F9MA 1IM6A 2V2VA 4F50A 1U1RA 1OIAA 3I8DA 4CJPA 2H4YB 1DQ8A 2PI4A 3RSEB 5AQKA 3OYNA 4OVLA 3CCTA 1BQMB 3NGIA 3OTBA 3QICA 5B0AA 2A0FB 2E5LF 2E29A 3DGPA 3MUTP 1X31C 2AZ1A 4K41A 2CQ3A 4PAAA 2J6SA 1S97A 4OQJA 3D5MA 2FBXA 2C3YA 3D45A 3IXQA 4ISGA 1WTBA 1AXQA 5FLXO 4ECQA 4MO4A 3J81O 2LFVA 1X5TA 4ZTFA 4J9OA 3VF6A 2R9LA 4QIEA 4YDDB 3BZKA 4JKFA 4BWMA 4MTPA 5HMYA 2HS3A 2M88A 1VRUA 2IC3A 1HYSB 2ZH3A 1VGYA 2Y1JA 4C8YA 4CZMA 1TVRA 1XWLA 4H4OA 3NWGA 1Y3JA 3HPOA 1X5PA 4RUHA 3CULA 3IN5A 4JKGA 1Q9XA 3VA0A 4LRBA 4YOYA 4K8XA 3U1NA 4U6PA 3GMGA 5KRSA 1VC0A 3TSPA 1Q81T 2I38A 2K3KA 2ZZMA 3RAMA 2B9YA 4F4ZA 1NKEA 3NFAA 2V34A 5DMRA 5I42A 3M30A 3O1WA 4DV0K 3R8YA 1YTUA 1GEHA 2Q6BA 2V4QA 2RIJA 3M6WA 2BQ3A 2D41A 3AOBA 1JCEA 3CD0A 3PHTA 5AXLA 4F4KA 1R7IA 1RHJB 3TVYA 2AJ4A 3L2RA 4JI4F 4WP9A 4O44A 3LGNA 4CWBA 2JWLA 3DU6A 2QKBA 4CJ5A 3TW0A 4A2BA 1RDBA 5F9NA 2PMWA 4RU2A 4LRDA 4WU3A 5DQHA 4JI0K 5GADI 3U3YA 3N4PA 3CCVN 1TUYA 1B92A 1FO1A 2L9DA 4DEZA 4J9VA 4I1TA 5AJ3J 4GVEA 2ERRA 3GONA 4NLRA 1VQ9N 3FFIA 2QLFB 3D2WA 2P5OA 4IRDA 3O9QA 1NPKA 4ERDA 1U04A 4GNIA 2AGPA 4OKKA 1CS4B 2FHMA 2G2YA 4ZCKA 3TTDA 4CH7A 4FJNA 4J9QA 4OGEA 2VODA 2GVZA 3UNYA 3CPWR 3DLGB 1UAXA 5K20B 3A8YA 2DNLA 2JHEA 4WYLA 3ZSQA 4BC3A 4IO8A 2F3JA 3MMBA 2Y0BB 1A5WA 1Y64A 1S1XA 2DGSA 2NRHA 3OYJA 1R8AA 2GIRA 1V5IB 3ET6A 4OMFG 3TEHB 3ETMA 1YTAA 2V6AA 2XSJB 3S3OA 2OTJS 4C97A 4UZBA 3DRXA 4OYIA 3QERA 5FRMA 2NXEA 4TVAB 3VALA 2FJVA 3FJ2A 2NZTA 1CJUA 3SQ0A 1IH7A 4XH5A 2MEWA 1NHUA 2CVIA 3AA8A 4ZIVA 3WIVA 1BDGA 1P1TA 4HACA 2VKZG 2LVWA 2ZH4A 2LDYA 1LWFB 2XGQA 3CJQA 3O3LA 2GV9A 3WXJA 3PZPA 2BR0A 3HZ6A 2GCFA 4QBUA 1KTQA 1IBKF 3CI5A 3IR6B 3AARA 3PYEA 3TJ8A 1O5JA 5FPEA 3MAQA 1QLNA 4KHPJ 3ZXWA 2HBYB 3PX4A 1RDUA 4IH6A 1LWCB 1J54A 4FM2A 4PABA 4CK2A 4J2EA 4HUEA 2LQ9A 4LIWA 3ZC4A 4NLSA 1PC4A 2EG2A 4LVOP 4JRPA 1ILYA 3WQTA 3SBTA 3KNGA 2DFHA 2XY8A 5C2FA 4A8OA 4I6MA 4DHYA 1IKWA 2B9WA 3LZJA 3OVNA 3O5BA 2CQIA 1S0NA 3DHXA 2V2QA 4AM6A 4Z7CA 5L38A 3UD3P 3RBXA 3IBFB 4H54A 3LANA 3T9ZA 3FCVA 4DLEA 3PIOL 4NXNK 1WI6A 3DDKA 3S7RA 3CDBA 3CE8A 1WHVA 1OYDA 3NWRA 4FWPA 2NXNA 2ZUAA 2P6TA 2RRBA 8AT1B 4PYDA 3GU0A 2AT1B 4MKBA 3ALYA 3T6JA 4WF9Q 2P9IA 2KYXA 4DR7F 2W2OP 1N54B 5JMVA 4I4BA 4KGKA 4CZLA 2XG8A 3L7UA 4NLVA 4KKOB 1HKBA 3QT5A 3GJQB 2Z4PA 1J6ZA 2G8UA 1FERA 4DX8H 4M5HA 2W6KA 3NGDA 1FE4A 1GMWD 4DN9A 2R8GA 5F3TA 5AQTA 3M1VA 1KVBA 3MEDA 1I1GA 2HHSA 3MFIA 2NRTA 2HK2A 4CJ3A 1S3XA 2E5IA 4OYPA 5M2RA 3RWUA 3OLBA 4RNFA 3L2WA 2IVYA 4WP3A 3AAWB 2OFGX 5IT4A 4J9M