2WOMA

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
557
structure length
557
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 151
structure length 557
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2womA05
1SKSA 1UA1A 4ECSA 4HVJA 3DRSA 1C2PA 3V6DA 3TAGA 3DLBA 2D0BA 2OZSA 3MR6A 3NF9A 3OYJA 3AVGA 1NK9A 2OPQB 1S9GA 3KK3B 3MTKA 2FJXA 4FK2A 3H5SA 4O4GA 1X1PA 3OYHA 2X74A 4URSA 1WAFA 5D3GB 3M8QB 3KNAA 1YVFA 3HPGA 1N4LA 4CJEA 3N6LA 2XY8A 3M8PA 2FBXA 1F21A 3KLGB 4KTQA 2B6AB 4OGCA 2D0CA 4K4XA 1T05A 3A2FA 4NYFA 1RT7A 4DFKA 3I0RA 4IG0A 2J6TA 1IH7A 3HHKA 3HVAA 4Y2CA 4I9QA 1EETA 3I8DA 3LP0B 1A5WA 3T5KA 1HPZB 2UVVA 3DRPA 3SNNA 4ELTA 1LWEA 1IO2A 1W0HA 2Z1IA 3K58A 3T5JA 2BQRA 1R0AA 4FLWA 1IKYA 1NJWA 1CXUA 3VQAA 2E9ZA 1DLOA 4KHQA 5KFCA 1X9MA 4I2QB 4ZVFA 4C8LA 3NE6A 3SUPA 4FLXA 3VQ8A 1NK0A 4X2BA 4FJ5A 1REVA 3ITHA 2XWYA 5KFOA 5CY4A 4N56A 1GOBA 5F8GA 2F8EX 4KAZA 1DTTA 4XPEA 2ZE2A 3JYTB 1QSSA 3C6TB 4H4OB 3QEXA 1KVBA 4KI6A 1JKHA 1VSEA 5I42A 4PUOA 3NMAA 3QERA 1J54A 1BQMA 4MIAA 4CGDA 1N5YA 4IRDA 3K5OA 4FM2A 4CEQA 3AVFA 3E01B 2OPSA 4KE5A 2FLLA 4KTWA 5T7BA 1HRHA 1S5JA 1S0OA 2R2UA 3TAMB 1IKXB 3S3NA 1YT3A 3MFHA 2BE2A 5K14B 1JL2A 1S9EA 1QAIA 4KAIA 2G8FA 3IAYA 4OJRA 1TK8A 5DMRA 2ATLA 5KG6A 4QWDA 1UWBB 4MQ3A 4OL8A 1EX4A 3D45A 3L2QA 4RW7B 3CJ3A 4LSLA 3V4IB 3Q8RB 4NLVA 3P83D 2AGOA 3QEVA 1EXQA 4TYBA 3EPIA 4GW6A 4DQSA 4MKBA 3DMJB 3PO5A 5DG9A 1RTHA 5KG3A 1I39A 1TAUA 3RAQA 4FS2A 4IDKB 3KHRA 2P5GA 3SQ2A 4R8UA 3OHAA 2IDOA 2V4RA 4ELUA 3DM2A 3VQSA 1ZETA 1JLGA 5KFLA 4AHUA 3U6FA 3NFAA 1VSIA 3AO5A 3HVTB 5KI6A 3SFUA 1J9AA 4PQUA 3OYBA 3PX4A 4I9LA 1LW0B 3SZ2A 4KFBB 1K1QA 3RMAA 4URQU 4XPCA 4CEAA 3ISNC 3RMDA 3QLHB 3LALA 2I1RA 4ED3A 2HHXA 4RU9A 3SQ1A 1XC9A 4TY8A 2HMIB 4DFMA 1LV5A 4QW9A 1RT6A 1VRTB 2FBYA 4FJ8A 3AV9A 3I5CA 3KLFB 2DTUA 3SQ0A 2E4LA 4JS4A 4B9TA 4MK7A 2OPRB 4CJ4A 3LP1A 2ASDA 3SUQA 2R8HA 3HPHA 4ID1A 2XGPA 1RYRA 3HK2A 1J53A 4FJGA 5KFFA 1IKVB 3RWUA 3WNGA 1HYZA 4LD0A 4AHCA 1TL1B 2EC0A 3MF5A 3Q8PB 3V9SA 3TR8A 5HROB 3DLHA 3K5NA 1W25A 1ZBUA 1WNEA 2P5OA 1U4BA 3H59A 3LAMA 2FVSA 2RKIA 3WNFA 4NZ0A 3NH0A 3TAQA 1S10A 3C95A 3WNEA 4Z4CA 3MR2A 4HUGA 4ECQA 1TKTA 4DF4A 2JEJA 2J6UA 1BI4A 1WSJA 3IGNA 1IM4A 3RB3A 4NLWA 3DLEA 3RB4A 2XO7A 4FJXA 1VSMA 3I0SB 3CFOA 1RT2B 4CJPA 2ILYA 2OPQA 1S1TB 4LSNA 2WRMA 3UPFA 2C2DA 2E6LA 2GUIA 4KHRA 4E0DA 4Z4EA 1SH0A 4DU3A 5EDWA 1RBTA 3KLGA 3K57A 3LDSA 4E7LA 1TK0A 2B6AA 3H08A 4M94A 4HCBA 4KI4A 4KRFA 3AVHA 4RW9A 1S0NA 4E19A 4RW6B 4U7CA 4L8RB 3G6YA 4NCGB 3AA4A 3LAKA 2YNIA 5HP1B 3CDEA 1HPZA 4F4YA 4J9QA 4Q8FA 3PX0A 4O44B 4WFZA 4UQGA 1S1VB 2YKNA 3CYMA 2DY4A 1HMVA 1XR7A 5C24A 3MAQA 4K8XA 3N6MA 2XY7A 4I2QA 2VG5B 3ZSZA 4JV0A 3TAEA 1KVAA 3SPYA 5J2NB 4DTPA 4C8MA 4M3TA 3M9MB 1BQNA 3PHEA 3VQBA 4Z4HA 4RW4B 3O4QA 4WXOA 2RDIA 3G10A 4RW8A 3LP2B 5J2QB 2AX0A 3JSMB 1XR5A 2W42A 4DS5A 2V4QA 3OYIA 4MH8A 4MK9A 4DQIA 5HRPA 1B9DA 5F8JA 1SV5A 1SH2A 2JGUA 2DFFA 1LW2B 3NGDA 1JXBA 3RRGA 4DEZA 1QE1B 4NLRA 3H4BA 4WE1B 3AVKA 4AHSA 1GOCA 3MFIA 1SUQB 3NKYA 1S6QB 4YR3A 4IG3A 4J9SA 2NUBA 4GC7A 4BE1A 3PW7A 3TAMA 5KFTA 1RT5B 1CSJA 1RT1B 1RTIB 3ZT0A 1RBRA 4TSXA 1S6PB 4ECWA 4O0IA 3OLAA 3B6PA 3QESA 4B3OB 3QO9A 1OS5A 3NF8A 2GIRA 1SL2A 4KSEB 5KFMA 5F8LA 4J2DA 2HHQA 1T3NA 1EP4B 4DQPA 4FJ9A 5KGWA 1XR6A 4O3OA 3DMJA 5KG5A 4K50A 3O3FA 2FBTA 2IAJA 2W9BB 3V6HA 4E7JA 2Z1GA 3PW5A 2PZSA 5FROA 1BCOA 1LWFB 2VA3A 1HARA 2HHVA 1VSFA 3C6UA 1U09A 4TLRA 3VQ6A 4J2EA 1TKZB 3BREA 4CEEA 4QAGA 4E3SA 3D28A 2QK9A 3TQ1A 2ZD1A 4E7HA 1NK4A 5HRNA 2PYLA 3V9UA 3K5LA 4FW2A 1LAVA 3B6OA 1K6YA 4HUFA 4DSEA 2WOMA 2IM2A 1RT3B 2G8UA 2RN2A 2DPIA 4CF9A 3TARA 1CZ9A 5KT7A 3CFPA 3AVAA 1ZYQA 5F9LA 1QS4A 2FLPA 1U48A 1VRTA 4ED2A 2X6NA 3KLFA 4MFBB 3PW0A 2W9CB 2YHBA 3T5LA 2IM0A 2G8IA 1WSHA 4J2AA 4Z4GA 5JUMA 4NLGA 1C0UA 2BR0A 1JLBA 1RDAA 4NLOA 3KLEB 3FRZA 4CJSA 3OS1A 1SH3A 1S1WB 3KLHA 1W9HA 3DYAB 3NGZA 3NBPB 1S1UB 4YQWA 4CGHA 1D0EA 1BHLA 3HVWA 1C0MA 4K4ZA 2BQUA 4NRTA 5CZ2A 3IGVA 2Y1JA 4KKOA 5J2MB 4Z4FA 3AA5X 2JC0A 5KFAA 1LAWA 1RBVA 4Y34A 1GOAA 5F8HA 3KMQA 1GX6A 4J2BA 3MEEA 3PJWA 3RRHA 4NCBA 3OL8A 4FLYA 5KGXA 1FK9B 3T19A 4QWAA 4W5RA 4FJIA 3VQPA 4TXSA 1RT2A 4F4ZA 5KG7A 2BANB 3MEGB 3CG7A 4KO0B 1SL1A 5KFUA 1D8YA 1XWLA 1QSLA 1JLQA 3AVCA 4EBEA 5SZTA 1KLMB 1WNSA 4ID5B 5KFXA 1CXQA 1RDDA 3BR9A 3V9WA 4PWDA 5DQGA 4RW6A 1S1XA 4JRQA 5L1JA 1C1CB 3VQDA 3TANA 4FJ7A 5KFIA 1IKWB 3IN5A 4K4TA 4BACA 4DTSA 4DL3A 3DRRB 4K8ZA 3GV7B 3V1RA 4B9MA 3UIQA 5I3UB 2A1RA 2F8TA 4KV8A 3VQEA 1FKPB 3QETA 2C2EA 3V6KA 2XRIA 1FXXA 5L1IA 3MXIA 2AJQA 4KPYA 4YFUA 4O3PA 3KK2A 3SYZA 3FFIB 5HRRA 2YNFB 1NOYA 2FVPA 5KRTA 3LWMA 4IFYA 3OYMA 4EYIB 2VG5A 5KFDA 1JIHA 1TKDA 2C22A 4DTRA 1KSPA 1T03A 1RCHA 1LWCA 3ZSYA 3THVA 3CDUA 4GC6A 3KMSA 3BQ0A 3HVRA 4RW4A 1XHZA 1Z26A 5DQHA 2W9AA 3LP2A 4DG1B 1HNIA 5CYMA 3JSMA 3ZSVA 4CJ3A 3K2PA 2V9WA 4J9OA 4O3NA 2DFEA 2R2TA 2QXFA 1TV6A 5EWEA 2QV6A 2D3ZA 2W7PA 2IJNA 3QIDA 3AA2A 5CZ1A 2PY5A 1JLCA 2HNZB 3IRXA 2R2RA 3ZSWA 3KLVA 4WE1A 2XI3A 1TL3A 1VRUB 3QIOA 4J9KA 1S6QA 2BRKA 3EYZA 4WXWA 1KCFA 5J2PB 3SPZA 1RTDA 1JLAA 2IS3A 3OYKA 4BDZA 3BGRA 5KT2A 3MECB 3KLIB 4ECVA 5FRNA 4TYAA 4IFVB 4DFJA 3KHHA 4PA1A 4ECUA 5C42A 3GQCA 2HNYA 2VG7B 4CHNA 1RYSA 1TVRB 1ZTTA 3OYNA 3M8SA 1L5UA 1QTMA 3QIPB 3VQ5A 3SQ4A 4KHNA 3GIKA 1K1SA 2AGQA 2GIQA 3H5UA 3OS0A 4NYZA 4U6PA 1KVCA 4CHZA 3DLKA 4EP4A 4CJUA 5KFZA 4YP3A 3RB0A 2R8GA 4Q44A 3CM5A 3H40A 2BGGA 4WFYA 3ALYA 3DOLB 3PJXA 4IR9A 3PW2A 1EKEA 3OLBA 3ZSRA 4W5NA 1KHWA 5KFGA 4ICLB 4W5QA 1TKZA 3T1AA 4M3XA 2YNGA 1C1AA 4I7FB 4LH5A 4ZVGA 3DLGB 4FJKA 2OPPA 1BGXT 4EBDA 3FQLA 2Y1IA 1QQCA 4CGGA 3D0PA 5DQIA 5KT3A 1RT4B 3LANA 1RT3A 2G8HA 3MR5A 1VK0A 1TKXA 4FLZA 3DI6A 2QKBA 4CJFA 3E51A 3OSPA 5JS1A 4RUAA 2I5JA 4CJWA 1A5XA 4JUZA 3RTVA 1X9WA 4ZHRA 2B5JA 4ZP7A 1HQUB 3RR8A 2VG6B 3V81B 4CERA 3RBEA 3KKSA 2HNDB 4ZP9A 1ASWA 4DL4A 4DLGA 3VQ4A 2R8JA 3S9HA 4ED8A 5KFNA 1N48A 1SKWA 3OYCA 4QWCA 1ZBIA 3DOKA 5KG2A 2XCAA 4C8KA 4CEZA 1NJXA 4BE0A 3QGIA 1RA7A 2LSNA 4ECYA 4CFBA 1FKOB 4KBIA 4CK1A 2V0NA 1RTJB 1DTQB 2CJQA 4CF8A 4M3WA 5J1EB 5J2MA 1ITGA 2WHOA 1MMLA 2P51A 4O4RA 2HWHA 3IG1A 2XGQA 1U47A 4N5SA 4DL5A 1A5VA 4N41A 5HBMB 3KD1E 2JLEA 1YTAA 2R8IA 3SI6A 4I2PB 4MK8A 3VA3A 1FK9A 2IBKA 1KLNA 3QYYA 2OA8A 3HXMA 4YMEA 4FK0A 4R5PB 3K59A 4FLTA 1IG9A 3MEGA 4IKAA 4OKJA 3QEPA 4FW1A 3OL6A 1QAJA 4IQXA 4FJHA 4DL2A 3MEDB 3GYNA 3KK1B 2KW4A 2GV9A 4IH6A 3LPTA 4KTZA 4ED7A 3DLRA 2J6SA 4ID5A 1Q9XA 4LQ9A 2ILZA 3KK3A 2ZQBA 1VSLA 4M42A 4IBNA 3OVNA 1JLFB 4IRCA 4CESA 5HLFB 5D3GA 3M8QA 4HHTA 3OJSA 3CJ0A 4MIBA 4OKEA 3HKWA 4O3RA 5I3UA 4J9LA 4EBCA 1FKPA 3HSTB 4DQQA 2EHGA 4F2RA 5F9NA 1MU2B 1B9FA 3PR5B 4JLHA 3ZT4A 3NH2A 2FJWA 4ZPDA 4Q5VA 4Q45A 2FVQA 3DRSB 5KRSA 3V6DB 1VSHA 3LP0A 3BDPA 2VA2A 1L3VA 2OH2A 2FBVA 1S9GB 4XIUA 1NKCA 4O4GB 4F2SA 3KHLA 1N6QB 5DK5A 4E7IA 3M9NB 3L3VA 4RNNA 4CE9A 3OHBA 1RA6A 3PR4A 1RNHA 3M8PB 4KB0A 4HTUA 2Z1HA 1JXEA 2IMWP 4ELVA 3ASMA 1RT7B 3AVMA 4IG0B 2HNZA 3ZT1A 2KQ2A 5KFWA 2ASJA 4W5OA 1TP7A 4FJNA 3JYTA 2GBZA 1EETB 3C6TA 4H4OA 1UAXA 5J2PA 3DRPB 1T8EA 2E9RX 1LWEB 1R0AB 4CJ5A 4FBUA 3VQ9A 4CCHA 2XI2A 1RDBA 4IFVA 4E1NA 3LP3A 4Z4IA 3HP9A 4CEFA 3ICLA 3OL9A 3E01A 4ECXA 3ZT2A 3ITHB 2WONB 4CEOA 5KT5A 1IKXA 3AVLA 2IJFA 3QIPA 3AA3A 5K14A 1S48A 1C1BB 4O0JA 4CGJA 1DTTB 1UWBA 2ZE2B 2ASLA 3ZSXA 5KFKA 4RW7A 1NK5A 3QGHA 1JKHB 3V4IA 4AHVA 2W7OA 4WFXA 5I42B 3T3FA 4PUOB 2HHSA 4CJRA 3SFGA 4J9NA 1NKEA 4O5BA 1BQMB 1N5YB 2D41A 2UVUA 4IDKA 4F8RA 2B4JA 4I7FA 5KFQA 3UQSA 4J9RA 4IOBA 3VA0A 3PVXA 4IH7A 4IKFA 2BE2B 1D9DA 1S9EB 4Y3CA 3HVTA 5KTQA 1XI1A 3MXJA 1WSEA 3SI8A 4JV1A 1LW0A 4NLUA 4LSLB 1KHVA 4KFBA 3ISND 2ALZA 3Q8QB 3PUFA 3GV5B 5DGAA 1RTHB 4CECA 3SUNA 5EU7A 3PX6A 4TQRA 3QLHA 1QUVA 4FZYA 4FZZA 2WCXA 3H98A 2R2SA 4R8UB 3HM9A 3VN5A 2HMIA 3DM2B 5CYQB 4WYLA 4DFPA 1RILA 2HHWA 4CK2A 2OPRA 5C5JA 3QEIA 3NGYA 4FM0A 3HL8A 3BSAA 3DDKA 1CLQA 3G86A 4ZVEA 4NLDA 5KFRA 2FVRA 1C0TB 4ZPBA 1IKVA 2ZKUA 3GILA 1TL1A 4K4YA 4YR2A 1U45A 3TABA 3D5MA 3GV8B 2A1SA 4RZRA 5HROA 5T14A 4N47A 5F8MA 4B9VA 4QWEA 2WK4A 4TY8B 1RT6B 5DLGA 4ECTA 2WB4A 4F4WA 4ED0A 2R7YA 4O3SA 3AVNA 3LP1B 1BL3A 4Q8EA 2HWIA 2JEFA 2HB5A 5KT4A 1NHUA 3MEDA 1UA0A 2O4IA 2YKMB 2PYJA 3I0SA 4CF0A 3O3GA 3QZ8A 2IA6A 1S1TA 3AO2A 4LH4A 4DSFA 3NAIA 5KFBA 2UVWA 4F4XA 4KREA 1Q8IA 1SKRA 1NNDA 4DMNA 3SCXA 2RKIB 4B8CA 4DL7A 4F50A 2HVIA 3M8RA 3MR3A 2O5DA 4K4VA 3L2VA 1MU2A 1YVUA 2X78A 1TKTB 4TQSA 4FK4A 1ZBHA 3P1GA 1HYSB 3U3YA 4NCGA 1BI4B 5HP1A 4FZXC 3DLEB 3VQ7A 4OKKA 3OYGA 4O44A 4LSNB 2AU0A 1S1VA 4H54A 4CHOA 3OL7A 1S0MA 1N6QA 2IC3B 3FDSA 2IM3A 4DSJA 4FLUA 3NAEA 4Z0UA 3OSNA 4NYNA 4RNOA 1D9FA 2RPIA 4CHPA 5J2NA 1ZBFA 4RW9B 1SL0A 3PZPA 3KKRA 3NF6A 4FLVA 1JX4A 3CJ4A 2YNIB 4E7KA 2FVCA 4CFCA 4DU4A 3NDKA 5J2QA 3KD5E 5DGBA 4RG8A 3BSOA 1B92A 1KFDA 1WSGA 2YKNB 4C8NA 4DWIA 1HMVB 2HAIA 3KTQA 1LW2A 5C24B 2RF2B 1QE1A 2AX1A 4CJQA 4DSIA 2YNHB 4PY5A 2C2RA 1JXLA 3L8BA 1SUQA 2G8VA 2E6MA 3OY9A 4H4MB 1ASUA 2EX3A 1D5AA 4ECZA 3QNOA 2ITGA 2WONA 5KFHA 2UUWA 1RT5A 5JXSA 3NGIA 4LQ3A 5FDLB 3O3HA 1RT1A 1RTIA 5KFYA 2BRLA 4DSKA 3PW4A 3L2RA 1BQNB 1C1BA 1S6PA 1J5OB 4EO8A 3CQ8A 1QSYA 4B3OA 2D7SA 4K4SA 1U04A 4ZVHA 2QKKA 4RW8B 2C28A 4R0EA 4WYWA 3I5AA 4FCYA 1L3UA 3SV3A 3AO4A 4XO0A 4EP5A 4RNHA 2HHUA 4HCCA 1EP4A 4GVMA 3U3GA 3UDLA 5KT6A 1SV5B 3CJ2A 4GMJB 4AH9A 5DLFA 4QW8A 5KFEA 4CFAA 3L2WA 2W8KA 2E9TA 3CFRA 1NKBA 4DF8A 4EO6A 2W9BA 1NK6A 4AILC 4J9PA 3RAXA 4IG3B 1TQLA 2DPJA 3K5MA 4DTXA 3ZT3A 5C25B 1LWFA 2XY6A 4NRUA 1GX5A 2ETJA 4JRPA 3RMBA 5E41A 3RBDA 4B9NA 3QO9B 1TK5A 3NHGA 1X9SA 3SV4A 3OYLA 4F3TA 4CGFA 1Z4UA 4ED6A 2IOCA 2X6SA 3N6NA 3CM6A 4H8KA 1TGOA 2XY5A 4K4WA 3UR0A 4FS1A 2DFHA 2GC8A 1UOCA 2IAJB 3LPUA 3LZJA 2Z1JA 4FYDA 4CIFA 4M41A 4ED1A 5CYQA 4MFBA 3OYAA 3C6UB 3HJFA 2W9CA 2RDJA 3HP6A 4J9MA 1HQEB 4ZP8A 5KFJA 2ZD1B 1HYVA 4URGA 3V1OA 1C0TA 3KLEA 4KHMA 3IS9B 4ECRA 1S1WA 4IH5A 4QCLA 4QPXA 3OS2A 2QE5A 5KG1A 3DYAA 2WOMB 2JC1A 3NBPA 4KHSA 1S1UA 2UUTA 5DG7A 3HPOA 2KFZA 4BE2A 3V1QA 5F8IA 4DTNA 3OYDA 4CF1A 1CZBA 1C0UB 4Q0BB 1HNVB 4ZP6A 3BJYA 1JLBB 1NHVA 4W5TA 3S3OA 3PV8A 4WZQA 2YKMA 4FBTA 3ZCMA 5JS2A 4BWMA 1QHTA 4JV2A 3KLHB 4G1QB 1JLEB 2BANA 4KO0A 4ZTJA 1L3SA 4OGEA 3OYFA 1U49A 4B08A 2BQ3A 4FJLA 3NF7A 2FLNA 1KLMA 4KKOB 3GIJA 4Y1CA 4CJTA 4FXDA 3P5JA 3EZ5A 1KFSA 4ZPCA 1C1CA 3TWHA 1IKWA 1I3AA 1VSDA 3MEEB 1HYSA 5EWGA 5L1KA 3F9KA 4E1MA 4WZMA 3DRRA 5KFVA 2D5RA 2XHBA 5KFSA 3CVKA 2IM1A 4AHRA 4CGIA 3KJVB 4CHQA 3NCIA 2G8KA 4M3YA 4NLXA 4QOZB 4MKAA 4DL6A 2IC3A 2AWZA 1S9FA 5SWMA 4FJJA 3BSCA 2KFNA 2CKWA 4B9UA 3FFIA 1RAJA 4OLAA 2YNFA 3RMCA 4B9SA 1JLQB 3CJ5A 4M3RA 1KTQA 4DQRA 4HUEA 4PWDB 4Y2AA 1RDRA 4RNFA 3M9OB 4BDPA 4EZ9A 5HRSA 1S1XB 1S49A 4EEYA 2AQ4A 3G0ZA 1NJZA 1BIUA 4NCAA 5EUHA 4NLQA 1YTUA 1T94A 4TY9A 1RDCA 1VSKA 4CK3A 4DG1A 4KV8B 2HVHA 4OPKA 3S3MA 4BWJA 2YHAA 3V9XA 1ASVA 2O4GA 3HYFA 1T05B 2BDPA 3KHGA 3I5BA 3I0RB 3BSNA 3AVIA 3QINA 4C8OA 2RF2A 3ZSOA 2XC9A 3KK2B 2YNHA 4IFYB 1VRUA 2F96A 3T5HA 4H4MA 4Q43A 1S4FA 4M45A 4FJMA 3VQCA 1O1WA 1T03B 1BCMA 3OJUA 4QWBA 5FDLA 1IKYB 3G6XA 3QEWA 1LWCB 1JL1A 3MECA 3KLIA 1TAQA 4CEDA 4KHYA 1DLOB 3FQKA 4KB1A 4M95A 2D3UA 4JS5A 3HT3A 1J5OA 3LZIA 2F8SA 3G6VA 5FRMA 4OVLA 3TVKA 4NLYA 2VG7A 3BQ2A 1RBUA 3FSIA 1HNIB 5CYMB 1TVRA 4DTUA 4HYKA 1REVB 1BIZA 3WNHA 2D0AA 4OLBA 1TV6B 4NLTA 1JLCB 3IRXB 1WSFA 4DTOA 3L2UA 4FM1A 1TL3B 3QGGA 3TI0A 4DU1A 2G8WA 3F73A 1NK7A 3DOLA 1NJYA 5C25A 1RTDB 4KHWA 1JLAB 3CDWA 3V9ZA 5KG4A 3BGRB 3QZ7A 3HO1A 3H5XA 3H2LA 4ICLA 4M3UA 5EWFA 3LWLA 3TAPA 2KZMA 3RR7A 5C42B 3DLGA 2OPSB 3O4NA 2HNYB 4EZ6A 5DG8A 1WLJA 1C6VA 4KB7A 3EZUA 3L3UA 4ZPAA 3RB6A 3NH1A 4CF2A 1I6JA 1RT4A 4O3QA 4FVMA 2HHTA 4TN2A 3KIOA 4DLEA 3DLKB 4NLPA 2YV0X 4K4UA 4B8AB 4EYHB 2KTQA 3EPGA 1T7PA 1XHXA 3CIZA 4AHTA 3SUOA 2VWKA 4ZMMA 4E89A 3ZSQA 1HQUA 3V6JA 2VG6A 4LY7A 2OYQA 3V81A 3OYEA 1HQEA 2HNDA 3AVBA 2WTFA 3GIMA 2UVRA 2YNGB 3CO9A 3AO1A 2B43A 5KG0A 3PY8A 4F4KA 2OPPB 3Q8SB 3NAHA 3IS9A 2R8KA 1VSJA 1WSIA 4KHUA 1JLGB 3ULDA 2FJVA 4NLSA 3CWJA 1ZBLA 1TKXB 2P1JA 1FKOA 2VWJA 1HJRA 3QNNA 3DI6B 4O55A 1RTJA 3TAFA 4F3OA 1DTQA 3EY1A 4PQUB 4G3IA 4RNMA 2I5JB 5L9XA 4DS4A 1KRPA 5J1EA 4CEBA 2KZZA 2FC0A 4CJVA 4ZHRB 4CIGA 4B9LA 2B5JB 1D1UA 3VQQA 5KFPA 3BQ1A 4Y1DA 5L1LA 1NOZA 3AVJA 4Q0BA 5HBMA 1HNVA 1Q9YA 4I2PA 3SJJA 4ZTFA 3PO4A 4YNQA 3H4DA 2JEGA 1RBSA 4IR1A 4IRKA 3DOKB 1NK8A 4HKQA 4G1QA 4R5PA 1N56A 1JLEA 1WN7A 4BDYA 3AO3A 4YR0A 3NL0A 1Z25A 3H5YA 4CJKA 4DTMA 4CJLA 2XCPA 1G15A 3C94A 1WAJA 3KK1A 3KOAA 2IGIA 2W8LA 2OZMA 1BISA 1Y97A 2Q3SA 2JEIA 4RUCA 3IG1B 4DTJA 1JLFA 5HLFA 3GIIA 5F8NA 2ATQA 4M3ZA 4OPJA 1L3TA 2HW3A 3MXMA 4CIEA 3KJVA 2AGPA 4DSLA 1S97A 1ZTWA 4CFDA 4N76A 4CHYA
chains in the Genus database with same CATH superfamily
2RT3A 1RJJA 2CAJA 4HVJA 1UEVA 1X8DA 3FGVA 4L3NA 4USVA 3C15A 3U8XA 2GVDA 5AQYA 2D0BA 2LCWA 5IWAK 1NK9A 2OPQB 4KIAA 3D54A 1U1KA 4FK2A 3H5SA 1X1PA 5A0YA 4URSA 1HI8A 4ZDNA 3KNAA 4FP9A 1NPPA 3GJRB 1HL6A 1AUDA 3N6LA 1NDKA 3RVCA 1GLCG 4DR6F 4K4XA 4NYFA 5GINA 1RT7A 4DFKA 1I1GA 3I0RA 4IG0A 4DR4F 1YJWS 3KWMA 3TYTA 2Q6BA 1H1VA 2XSFA 1SJ4P 2OIHA 3I8DA 1A5WA 3FKBA 1MWQA 1Y11A 3L7UA 2Z1IA 2BQRA 1IKYA 2G0JA 2VQEK 1YX2A 2A3JA 2EFQA 4KHQA 5IT0A 2NXEA 3UDVA 2MMYA 1RXOB 2Q66A 4HEA9 2D3O1 2V7YA 4OX7A 4X2BA 1FNMA 2CYYA 2H5JB 3ITHA 2FSKA 2XWYA 4PL7A 2HRYA 5KFOA 2HIQA 3CMQA 2YJEA 3MPUB 4WU3A 2F8EX 3MM8A 3CETA 4OZNA 3C6TB 1MA9B 3QEXA 3RU0A 3TW0A 1JKHA 3TA0A 2YKAA 2RIJA 3ULEA 3NMAA 3A3OB 1R3NA 5HATA 3C19A 3WHIA 3NXZA 3PKYA 4DV6J 3QERA 1BQMA 3CGIA 4MIAA 3K5OA 3BM7A 2YQ1A 4FYWB 2FLLA 2EPIA 3TAMB 2XMAA 4FF2A 5BRDA 2CFXA 3S3NA 2BZ2A 2VUGA 1ZBSA 2CRLA 3ZO7A 4QWDA 1UWBB 3ZZZA 5F3ZA 2E5LK 2A6OA 2FHOB 1X4DA 2GAGC 2NSCA 3V4IB 1ICEB 1HWKA 3MD1A 2CVEA 5KG3A 1I39A 2W01A 3RAQA 4V19J 4FS2A 2QA1A 2LQBA 3KHRA 1TUUA 3SQ2A 1FERA 5HVFA 4KH4A 2FY1A 3S7RA 2BKOA 2OO4A 1R59O 2QSFA 5KI6A 3ENHA 4IO9Q 2VFSA 3OYBA 1LW0B 7AT1B 3SZ2A 4DR3K 4KFBB 2XMJA 3FCWA 4TVAB 3TUPA 1WTBA 1NJIT 1K1QA 3VAFA 1AFJA 5HAOA 1B0VA 2AP6A 4KH1B 1SKUB 1FJEB 4LUBA 3ISNC 3QLHB 4Q7AA 1WF1A 2I1RA 2HHXA 4FN5A 3SQ1A 2EKNA 2AYGA 1CJVA 4DFMA 4QW9A 2FBYA 1M5PC 3G8TA 2E4LA 2UXBJ 2ZITA 1KQFB 4JI0J 3LP1A 1RWVB 4DN9A 1RHJB 2R8HA 3HPHA 3HHEA 3QJPA 1WG4A 2VGMA 2CNKB 4USJC 1CQMA 1HYZA 1E6VA 4KGMA 1YRTA 3GSIA 4TNOA 2PMHA 3DGPB 2YHWA 1VQ4N 4JV5F 4WFBQ 3TR8A 5HROB 2NPIA 4M5MA 3DLHA 5BPNA 2WSCC 2P5OA 3I87A 1U4BA 3H59A 3LAMA 2FVSA 4KH0B 3J80Y 3UCZP 5AZIA 3ZYYX 1S10A 5HI7A 2GVZB 3C95A 2HGNA 4ECQA 4YB1P 5CYJA 1BI4A 1O13A 3IGNA 1FEEA 4JD2B 1RSCA 3I0SB 4C97A 1RT2B 4BR5A 4Y0FA 4ER8A 5C15A 1S1TB 2WRMA 3UPFA 1DURA 2C2DA 3BO4A 2GUIA 3KXDA 4WQ4C 2F9DA 1MMNA 2HFSA 1ZZNA 5EX5A 3DDIA 1RHKB 5EDWA 2FDNA 3J7Z5 3KLGA 1VQ5S 1VHIA 4WFAQ 3K57A 1TK0A 1HHQA 4KRFA 2PMWA 5DM6L 4CT9A 3Q24A 5HL7L 4U7CA 1F9EB 4YUDA 3G6YA 1MWYA 4NCGB 1VDHA 3R5CA 3O9SA 3SAHA 3KZBA 2KKHA 1HHSA 3CDEA 3SCIE 1HPZA 3PX0A 4O44B 4UY8T 2P9KA 4M7XA 3ZETA 2V68A 4B3RK 3MAQA 2AJFE 4K8XA 4I2QA 2DK2A 4CO2A 2UV8G 1LXNA 4A8FA 4LSZB 4JV0A 1RWKB 2RS2A 4HTJA 4P2SA 2A5XA 3EGVA 3MCAB 4YHHJ 3VQBA 1BO5O 5A76A 4OHYA 4RW4B 2F5GA 3O4QA 2NXJA 2RDIA 3CJTA 3LP2B 2HQFA 2AX0A 3MM6A 1SJ3P 3QJLA 1U0HA 4MH8A 1NXIA 5F8JA 3VESA 5AQZA 4DEZA 2RD5C 4KHPJ 4WE1B 5CABA 2D3OR 3NNCA 2DR7A 4MO4A 1X4GA 3NKYA 4YR3A 3P49B 4FKXA 1VHFA 3MWBA 3NGRA 2NUBA 2KXNB 4QYZK 1M90T 4F0KA 1RTIB 4P7VA 3ZT0A 1KVJA 3PIOQ 1T11A 1FWKA 1OS5A 2MLXA 4NA3A 1AUSL 1KC8T 4W90B 2ZVIA 1BU6O 5EOYA 1EP4B 2UXCK 4DQPA 4FJ9A 1DFDA 2VDHA 4O3OA 4CTAA 3DMJA 4A62A 2GMLA 4BVOA 4J91A 2R7VA 4DHYA 3O3FA 2IAJA 3HOTA 1T0TV 2VH7A 2PZSA 5ADXH 1HARA 2NZ4A 1TMJA 4O5FA 2GQ2A 4F0MA 3VETA 3F2KA 1QVFR 4CEEA 3D6HB 2Z30B 3EDRB 3R7SB 4E7HA 3TWZA 1NK4A 1JCEA 2IPOB 3V9UA 4ZCLA 3GG4A 1YITN 2NYIA 1XNRK 4CDIA 1CZ9A 5KT7A 3CFPA 2MSSA 1WI6A 2ZZTA 3GYGA 2FLPA 1X4EA 1D3WA 2X6NA 2BX6A 2OD6A 3G25A 4DPOA 3VAMA 3T5LA 2F4FA 1RGIA 5DDQC 4H0PA 2G8IA 4Z4GA 2DNLA 3A3NB 1RDAA 3FRZA 1S1WB 2FJEB 3NBPB 2VFUA 2E7WA 3ISZA 4FWRA 3HFZB 3IA0A 4CGHA 1D0EA 2GFFA 3HVWA 1SQEA 4K4ZA 4KH5A 4CWBA 1XNQJ 5J2MB 2BBEA 2HZCA 4NZ6A 4WCEL 5AJ3K 1YI2S 3AARA 4YOTA 4CLZA 2H4YB 6FD1A 2UUAJ 2X1BA 5IT9O 3CMEN 1FK9B 3T19A 1V3SA 2AEJA 4CLYA 3VQPA 2IIRA 3CPWR 1F3FA 4JHDB 1RDWX 3CG7A 2DIVA 3W0LA 1D8YA 4PRFA 1XWLA 1NMEB 4B3MF 2R7UA 5B8HA 3AVCA 1WNSA 2V4JB 2WBRA 1YKWA 3TA1A 1NGGA 4ID5B 2UXDK 3BR9A 1ZZFA 3VVUA 5DQGA 4RW6A 5BN8A 5L1JA 4XAKA 2Z4PA 3ZC4A 5AQFA 4K4TA 3KUEA 4BACA 2O8DB 2RJZA 1P1LA 1VQYA 4OI0A 3ZFVA 4KH6A 1FVQA 2RQCA 2F8TA 2C2EA 2QWNA 1FXDA 1LQ9A 1FXXA 3A8IA 3CULA 3ET6B 5AQKA 1P8ZA 4DPWA 3T1HF 4KPYA 4YFUA 3KK2A 4PG7A 3SYZA 5HRRA 3TZYA 2Z2MA 1MW7A 5KRTA 4IFYA 1TKDA 3M2UB 2G0CA 3V2UC 1URNA 3PACA 4WKRA 4WK3A 4QR0A 3VAJA 3ZSYA 3EO3A 2ASMA 3CDUA 2UUBK 3OR2A 4DHVA 3U1NA 1PIEA 1LK5A 5DQHA 4LF5F 3FUYA 1HNIA 5CYMA 3JSMA 1NGDA 3K2PA 1CJKA 5HVHA 4YOUA 4W98A 2DFEA 4ZVQB 5EWEA 2D3ZA 2IJNA 4C4WA 3EGWB 3QIDA 2IVNA 2PY5A 2HNZB 1X3NA 1RGVA 2XI3A 4DR1K 1KR4A 2E2OA 1VRUB 2VOPA 3QIOA 4NPOA 3AY9A 4WQ5A 2XZTB 3CCVN 1JLAA 1KQGB 3NMRA 3RGIA 3BGRA 3PLAA 3KLIB 4M5KA 1KTVA 5FRNA 4IFVB 3CJQA 4M5LA 2H5EA 2QMUB 1GMVA 3M6XA 4RPFA 3GQCA 2VG7B 2HBKA 5AQMA 1TVRB 2D1KA 2M5YA 4OYXA 1JJ2M 3QIPB 3AT1B 4ZITA 3TEGA 2P9NA 3NWGA 4P7TA 3OS0A 4NYZA 3WZ0A 1RU1A 2P8IA 1N33F 1S7IA 2U2FA 3RB0A 5CZVA 4BG9A 5LSRA 2V6AA 1VK8A 3KG0A 2LQ9A 2R7QA 4W5QA 1KONA 3T1AA 4M3XA 1FDBA 4I7FB 3O8WA 2VQEJ 3ZX2A 3UN3A 1BGXT 2NXCA 3UNYA 3UKRB 1I94K 5KQ8A 2W2NP 2L9WA 3D0PA 5CCLA 1RT4B 1ZA1B 3MR5A 1TKXA 3RSEA 3HZEA 2Z56B 3F56A 2EFVA 3SCKE 1W7AA 4DB3A 1FXRA 4X64K 3Q89A 3RTVA 1T9UA 2RDDA 1JJHA 4C0BA 5HJXA 3BGUA 2B5JA 1EHWA 3KKSA 2HNDB 4ZP9A 2O8EB 1HNWK 3J7AP 3CC2S 3KJQB 3MN9A 4I6WA 4DLGA 3VQ4A 4B3TJ 5U47A 3S9HA 1MROA 1LWXA 4QWCA 1MN7A 3CERA 1YGYA 4RO0A 3LM9A 3WT0A 1HWUA 2R7SA 2P9PB 5MLCQ 2LSNA 5IFMA 4ECYA 2CPIA 5AZJA 4CFBA 3CJAA 1U8SA 5E26A 1CJUA 2V0NA 2OCEA 3BEXA 2ZJRQ 2CJQA 3ZEUB 3DOMB 2ZJPL 1WOPA 1VQNS 1MMLA 4HHHA 3VOVA 2P51A 2E5LJ 3IR5B 1Q81T 4BREA 5HBMB 3WUHA 4ES3A 3KD1E 2HOEA 3ZTQA 4O23A 4GNIA 1R0BG 3SBGA 3OW2M 1RWPB 4R5PB 4M5GA 4A8KA 1MWKA 2C2NA 4FLTA 3ZZYA 4AE5A 4IKAA 3QEPA 3PYDA 5LL6d 1BA1A 4CZCA 2JFKA 3KK1B 2KW4A 3CO0P 4OYAA 3LPTA 4KTZA 3FBEA 3FNNA 1Q9XA 2ZQBA 4ZPVR 4DX6A 4IBNA 3OVNA 1JLFB 3L09A 4RX6A 4DR3J 1RABB 3HZ6A 3IFEA 3FZMA 2DH7A 2K7KA 1VQMN 3HKWA 3CCQN 1IBLK 4I6YA 5I3UA 4EBCA 1FKPA 3UWTA 4F2RA 1MU2B 1JB0C 2FJWA 2IIHA 2W2OP 1NPKA 5FLXO 4Q45A 2FVQA 2PFDA 4YORA 2CPFA 5B08A 3V6DB 1VSHA 4DR7K 2BTFA 2E5HA 1VIOA 1E4GT 1UL3A 4XIUA 2Q0RA 2CJ9A 2FHJA 4CIOA 4Y2KA 3VEXA 5LSLA 4F2SA 5DK5A 3RRKA 5ETLA 4RNNA 3X1LB 4BQZA 2V2KA 5DM7L 1VQSA 4HTUA 2Z1HA 2JVOA 1T6DA 5IQQA 3PJ9A 2A2CA 3H2VE 2PA8D 3EXYA 3AVMA 3WX8A 2H4WB 3N5BA 4GKJF 4PKHA 1BLUA 3AJ2A 4TKTA 3C6TA 4WFNQ 1YDLA 3CSKA 3M8WA 1WG5A 1R0AB 3VQ9A 4CLFA 4A8SA 4CCHA 4Z4IA 3OL9A 1GAOA 4DR2F 4LF6F 3CCTA 4ECXA 4KR0B 3D66A 3GSDA 2AEMA 3ZT2A 3HCXA 5KT5A 4IO8A 3AVLA 2IJFA 1S48A 1C1BB 1UWBA 2ZE2B 5FPEA 2BE7D 4LF7F 3ZSXA 4CZHA 5HK4A 2GO9A 4CZEA 1RWNB 3V4IA 4AHVA 1KEKA 2UUCK 1GXTA 3A1YG 5I42B 3TJAA 2LXUA 4JKAA 4J9NA 1NKEA 2E66A 2JJ4D 5F0UA 2D41A 2UVUA 4WQ4A 1VQ9S 2WC9A 3BZKA 5H9EK 5FIIA 2HG4A 1WORA 1Q79A 3VA0A 3PVXA 3CQXA 4BC4A 2VHGA 1APSA 4Y3CA 4RWWA 3PHTA 1EO1A 4QYRA 3MXJA 4JV1A 1LW0A 4NLUA 4A47A 4LSLB 5ELZA 1QM9A 1R8HA 1M5HA 4MKVA 4KFBA 3F41A 3PSFA 3JB9k 3P96A 2ALZA 3LDNA 2GV1A 4NA1A 4BRKA 3GV5B 5DGAA 3SUNA 2MQ8A 4LFCF 3T6BA 3KUHA 1S0VA 4PKIA 3QLHA 3P3DA 3AAQA 4FZYA 3H98A 1XMQF 3VN5A 5E84A 3DM2B 1FX2A 1V3RA 4ZLNA 4JI4F 1ATNA 1RILA 4V1Ak 4CK2A 3R6LB 4LC9B 4QYZJ 1FRLA 1R8CA 3HL8A 3BSAA 3UI3A 3DDKA 1CLQA 4IDHA 3F9MA 2DRBA 1Q8LA 4DV3J 4PHTX 2DY1A 4YR2A 3DGPA 1VK3A 3D2FB 4GY2B 2KDOA 3DXBA 5HROA 2AA4A 2UXCJ 2IYGA 3B6BA 1YRUA 1GLDG 4JI5F 1V4SA 2E7XA 2WK4A 4QZVB 5DLGA 4FWSA 3OFEA 2GVZA 2K8GA 4UT4A 2XMVA 3AVNA 3CXCM 4FPRA 2HWIA 2HB5A 4OYOA 2YHYA 2NNWA 3ILIA 2ZWHA 2ROEA 1H2TZ 1OH5A 4JD2A 1UPMB 2HFOA 4RBTA 2O4IA 3I0SA 2R7RA 1S1TA 4LH4A 3PEJA 4KREA 4CLWA 1NH7A 2MTLA 2OGUA 2LEAA 2W4DA 1K0VA 2P2CB 3AQPA 1XNRJ 1Q8IA 4AXJA 4JI1K 1SKRA 4DMNA 1S22A 4E98A 3SCXA 1WUUA 4B8CA 4DL7A 2XULA 1PJ5A 2O5DA 2RU3A 5BR8F 2X78A 1R27B 2APOA 3P1GA 1HYSB 3IBWA 4NCGA 4Y6IA 5D15A 4ZIWA 4W92B 4DV4F 3OYGA 4O44A 4LSNB 2RMLA 1N6QA 4FNHA 5K9FA 4CP5A 1XBWA 2IM3A 4DSJA 3SQGB 4FLUA 1GH8A 3AD8C 3VR1A 1MG7A 3OSNA 1D9FA 4NYNA 3QPIA 2KT5A 4RW9B 1XEZA 1H74A 5D6GA 3PZPA 1JX4A 4JI7K 3QJJA 2K3IA 3K0JA 5AJ3J 3R9LA 3NDKA 3HOSA 2R7TA 3DXMA 2VPZB 4RG8A 5D77A 1B92A 2KJVA 1HMVB 2RRNA 3HD2A 2RF2B 4JP8A 3OQ2A 4CJQA 5HOOA 3L8BA 3OY9A 1Q7YO 1ASUA 4ECZA 2WONA 5KFHA 1NM1A 4O8KA 1DGKN 5FDLB 3JQMA 1RTIA 5T7LB 2L48A 1J5OB 2Q79A 3IP0A 3BBBA 1T3VA 5B0GA 4K4SA 1RISA 5C10A 4RW8B 3I5AA 1EP4A 4GVMA 4HVZA 3U3GA 5KT6A 1ZS6A 5DLFA 1CLFA 5KFEA 3L2WA 3CC4N 4H03B 1DBDA 1MLAA 4BR4A 5DZ7A 3LPEA 1K8AO 3K5MA 2XY6A 4PYAA 1XMOK 4XEIA 3CCJN 1T9YA 4PWUA 3C66A 1GX5A 3BUZB 2EXUA 3MM9B 2ETJA 2L08A 1E6YB 3HM8A 5B0BA 4OZ1A 1SZ2A 4F26A 1ZPVA 3J7ZT 3G96A 2DT9A 1X9SA 4L6V3 1W7WA 3L7OA 2YWFA 2Q6CA 2DTJA 4C2MA 3VCDA 1TGOA 1CEZA 2HURA 2JWKA 4UZBA 2B4PA 2GC8A 3VHQA 2UXBF 3DRYA 4DR1J 1RWOB 4JI0F 3A12A 4LVNP 3C6UB 2GJFA 2ZGYA 3HP6A 1HQEB 4ZN1A 2OAUA 2LQ5A 4BLGA 4RBUA 3VGVA 5B7WA 3V1OA 1C0TA 3BB5A 3CDBA 2HBYB 3UE5A 1S1WA 4IH5A 1CJTB 4QCLA 1WF2A 3R7NB 3NBPA 1HBUB 4QIGA 4JV5K 5F0WA 5LM7E 2OI2A 2KFZA 4BE2A 4KYZA 3TSPA 2ZDOA 1BWFO 4QQBA 4JI2K 1NLVA 4OO1J 4DR5J 1RU2A 1VISA 4CF1A 1C0UB 1WEYA 4Q0BB 4WP8A 1HNVB 2KU7A 3RYLA 3KKFA 3ZCMA 1OPZA 4I6AA 4A8QA 4JAXA 3CUNA 4JHDA 2DCUB 3QRQA 1BXNA 1I94J 4OGEA 1SC3B 4Y0WA 1NSAA 3ENBA 5CA5A 5JJBA 3NF7A 5LMNJ 2H3EB 4KKOB 2V4JA 3GIJA 3LGNA 4BGBA 3K0SA 3P5JA 2B9YA 3WC2A 1VRQC 1U2RA 4ZPCA 4IO9L 4X64J 1VC5A 1AA1B 1I3AA 4NLCA 1VSDA 1GMWD 3MEEB 4H4KC 5EWGA 5IXUA 5L1KA 3F9KA 4WZMA 1UVMA 2IVOA 1RAFB 2XHBA 2ITMA 1AW0A 3GU0A 4YY3K 4M3YA 4QOZB 4DL6A 2L41A 3ET6A 2AWZA 2ZH1A 4ZVTB 5SWMA 4FJJA 2MZSA 2CKWA 3MUTP 1WG1A 5BN9A 4OLAA 1N5QA 3CQYA 3E66A 5I3PA 3W2WB 5JMNA 2HBRB 4HUEA 3M2UA 4YHHF 1S1XB 4CH1A 2W4CA 4EEYA 1B4SA 1NJZA 1IBCB 3CMAN 1DRZA 1BIUA 4ILLA 1Q8BA 3HSDA 4BR7A 5EUHA 4LFAK 3FMWA 2A42A 1WBDA 1VSKA 1IVZA 1Q7LB 1I5OB 4WFBL 2PI5A 3S3MA 3SEOA 4FF3A 4BWJA 2RQMA 1ASVA 4BR2A 4KHPF 4DV5K 3WQPA 1T05B 2XC9A 2E2PA 2YNHA 1VRUA 1IJFB 2O3DA 5AQHA 3T5HA 4Q43A 1S4FA 3F0NA 3ETOA 4ED4A 3A5NC 1OH7A 2HRTA 4BRQA 4FJMA 3I32A 1T03B 1BCMA 2BYCA 3G6XA 1LWCB 3KLIA 2ZM6F 4BHQA 4KHYA 2Q36A 3FQKA 4M95A 4NI2B 3EGNA 3LZIA 5EVZA 3NS5A 4ANCA 3TRGA 1RTZA 2H3GX 4JEPA 2VG7A 1YBAA 3BQ2A 3R1LA 1TVRA 3THYB 4HYKA 3B78A 1IBLJ 2D0AA 2PMZD 1TV6B 1DT9A 3MN5A 4WFAL 3A5OC 3IRXB 3H7HB 1TL3B 1H0HB 1NUEA 3VAIA 3UDEA 1YJNS 2G8WA 1NJYA 4FPAA 5C25A 1RTDB 1SJ1A 4KHWA 4K42A 2YKQA 3CDWA 3ZTOA 4WTYA 2YJFA 4RR5A 1RFQA 1KKHA 4DR7J 3H5XA 3H2LA 4BRLA 1VQMS 2XG8A 1IM6A 3ENVA 2ZHBA 3G4SN 3RR7A 4DZ6A 3MMVA 4KB7A 3EZUA 3RB6A 2J9EA 4CF2A 1RT4A 1FE4A 3UDCA 2ZF5O 4EHUA 2RB7A 3FMBA 3DLKB 2R7XA 1ILYA 2G4BA 2G13A 4OYIA 4K4UA 1UEUA 2CQBA 1XHXA 3CIZA 2E29A 2QEXN 2VCPA 4AHTA 2IRUA 3SUOA 2C3YA 3FGUA 1K73T 2OYQA 2HNDA 2HMPA 3CO9A 4FF1A 1N88A 4H5RA 2B43A 3MN7A 5KG0A 4RWXA 1DAXA 5FLXU 2CQ4A 3Q8SB 2R8KA 3M2RB 3P38A 2FJVA 2P9PA 3QNNA 3ILJA 2KI2A 1XNQF 3TAFA 2BUNA 4G3IA 4RNMA 3ZEUA 1OMSA 4K5RA 5L9XA 1CULB 2UUAF 2HQIA 5HMWA 1YVNA 5L1LA 3R3LA 2UUCJ 4YOXA 5HBMA 3VV2B 3VZHA 4X62K 5E2QA 3U1LA 4IR1A 1SB6A 1NK8A 1VIXA 4G1QA 4R5PA 5H9EJ 1JLEA 1W2BR 1WN7A 4KPCA 2CPEA 3NL0A 3H5YA 2HS4A 4R79A 1VLYA 2MJUA 2L9DA 2XCPA 3NRBA 3KK1A 3KOAA 3OV7A 4IOXA 1F3VA 3DC2A 5IOLA 4DV0F 5B09A 1Y97A 2MGZB 2V2QA 4DL0C 1HPMA 3LW5C 4F67A 3MUMP 4DCHA 5D0EA 1JLFA 4F36A 2RH3A 2CQ3A 4QIWD 5KAKA 3TEHB 2ATQA 4AT1B 3N4QA 4M3ZA 3I9ZA 3UVJA 3MMJA 3TX0A 1M0SA 2YTCA 2AGPA 2IJRA 1S97A 4CM0A 1WSVA 3QDKA 2CPYA 3HKZD 2M3DA 4CHYA 1SKSA 3T1HK 4OX9J 1VCTA 3R6GB 2HFVA 4A46A 1C2PA 2B3TB 4BVPA 3V6DA 1KXPA 3IM8A 3VGSA 2LKZA 2QX0A 1YF5L 3NF9A 1MDUB 2FJXA 1KD1O 1P27B 1BC6A 1VBXA 2FHKA 1KNZA 5LMUK 5MAOA 4C9DA 2EFGA 1F2GA 5M1QA 3IKMA 3QFWA 1HI0P 4OGCA 2D0CA 3MUVP 3QICA 3VWSA 2RRAA 1T44A 1IH7A 2JOQA 2E1MC 3HHKA 4Y2CA 4I9QA 1YJ9N 3FCHA 2QTDA 4BC2A 3T5KA 2UVVA 3SNNA 4ELTA 3T5JA 1T9WA 2N7YA 1R0AA 1NJWA 1H98A 1RAHB 1GLJO 2NRWA 5KFCA 1VQKS 2CA9A 4ZVFA 2POKA 3SUPA 2NR0A 4ZCIA 2QGFB 3VQ8A 3MMBB 4ISEA 1V3ZA 4FJ5A 1YUWA 2LQJA 1REVA 4JI1J 1HBOB 4DPYA 4CLUA 1TR0A 1N33K 5HVGA 2ZE2A 2M7SA 1QSSA 5IQ6A 1HKAA 2DNRA 1VSEA 3A8EA 4ISGA 3LL3A 5I42A 2E5GA 4YB7A 1A0OB 2AP1A 3UD3P 3ADAC 2VQEF 1M1KT 1J54A 4IRDA 4FO0A 1HIYA 5IM0B 2VPYB 4ZJOA 2LA6A 2OPSA 4KTWA 4OZ5A 5B0CA 1HRHA 1S0OA 1B3TA 2R2UA 2LU1A 4OHVA 1AT1B 3ZTSA 4A8XA 2I9SA 3MFHA 2RNEA 2E1ZA 3MCMA 3IAYA 3FEXB 5DMRA 2ATLA 2FZGB 2A0FB 4RW7B 4JI7J 3QAEA 4LSLA 2HKEA 2NXUA 5ADXA 1FE0A 3R5DA 4TYBA 3EPIA 4DX5A 4B3TF 4GW6A 4BR0A 4MKBA 4P9SA 5DG9A 1TAUA 3QMQA 3R1HA 3SBMA 3DM2A 4OLPA 3FBCA 4L3QA 4CBXA 5KFLA 3HX9A 1F2HA 3U6FA 3W2VA 4F9OA 2DYAA 3ILOA 3WBZA 3HVTB 3H45C 2DVIA 4UOHA 5GAEP 4PQUA 1WB9A 2E5LF 1FD8A 3UD5A 4I9LA 4FOIA 4OJ1A 1ULRA 4GVEA 3HT0A 4EHTA 4XPCA 2KG0A 5BREA 4CEAA 3UCGA 5BYRA 4ED3A 2CXEA 1WEZA 3Q8VA 2F8MA 1XC9A 2HZAA 1RWUA 2D0OA 4V19S 4FJ8A 3AV9A 3KLFB 2GHPA 5BJRA 2YPYA 5A2QY 5F41A 1YHQN 3C3LA 1XMOJ 5HL7Q 1RYRA 2RILA 4CLKA 1J53A 4FJGA 1U7LA 3HI9A 1IKVB 4JYAK 3RWUA 4BC3A 3M4XA 4AHCA 4DR3F 1TL1B 1U2VA 2OEKA 1HWLA 3Q8PB 4PQAA 1P9QC 1H2UX 4DN0A 1ZBUA 5D4LA 1WNEA 5B0AA 4K7QA 3J80O 3TAQA 5C2FA 2MKIA 3SQOP 5ETNA 4GKKK 4N8NA 2NLWA 2ASYA 2FZCB 4NLWA 3RB4A 1FCAA 2X1GA 1S7HA 1SCJB 1VSMA 1Q82O 3NCPA 3CFOA 3JXUA 4CJPA 4LSNA 2W6KA 4KHRA 2HHPA 1OY6A 2ZBIA 4IQMA 4PKDB 3SQGA 3LDQA 4OYBA 4XH5A 3C14B 2B6AA 1R31A 4RW9A 4TLQA 2ZJRL 4L8RB 4BRIA 2GEMA 2K3KA 4XDDA 4JI2J 4LF8K 2HVDA 5KOWA 1KN6A 3UD4P 1YWXA 2F9WA 4Y28C 3CPWM 3OBIA 1LEOA 2DGVA 2A6MA 3SLCA 1S1VB 3CYMA 1KAXA 1HMVA 5LY3A 1XUPO 3N6MA 2XY7A 2Z57B 4Z7YA 4PYDA 4DR2K 4LF6K 4Y2MA 1H73A 2KXFA 4DTPA 4I67A 5T7LA 1FDDA 3N01A 4ZOSA 2QT7A 2SXLA 5E3RA 1S59A 3VGTA 3C7NB 4Z4HA 5DO2A 4RW8A 5J2QB 2W42A 1T3OA 4P52A 4DS5A 2GCFA 2KVIA 4I64A 1D8ZA 3OYIA 1F9HA 4MK9A 1SVDA 4YY3J 1B9DA 3DNCA 3NGDA 2JGUA 1BWVA 2P9UA 1GOCA 2MB0B 1WC6A 4ANEA 1S6QB 2YX4A 2V34A 6FDRA 5KFTA 2ZVSA 1VC0A 3NGSA 2DNOA 3L7PA 1K9MT 3X3UA 3NGUA 4TSXA 4A8WA 3B6PA 3PTWA 3QESA 2HFNA 3TSQA 2VODA 4ZCMA 1FXLA 3NF8A 1SL2A 2YXLA 1X5TA 5LSOA 4LFAJ 2HHQA 1T3NA 2PE8A 2FGOA 2QWQA 4LFCK 3H90A 2EG2A 3JSYA 4OI2A 2FBTA 2W9BB 1NLKL 3D6RA 2VKRA 3V6HA 4E7JA 4K0KK 1LWFB 3EWGA 3C6UA 3CMAS 1U09A 1UP1A 4WFNL 4UUXA 4E3SA 2CIMA 4CW7B 1S99A 1M5VC 2PYLA 4CZKA 1LAVA 3B6OA 1WF0A 1CJTA 4U67L 1RT3B 2UXCF 1OY9A 4FXWA 3ZTPA 2G2YA 4B17A 2UU9K 3RZAA 1ZYQA 1Y64A 1U48A 1VRTA 1HQ2A 1UVLA 2AYMA 3PW0A 3OTDA 2YHBA 4BCAA 1WC4A 4LMZA 1C0UA 3CI5A 1A6LA 3CJRA 3G6ES 3FFKB 1YJWN 3UN5A 3KLEB 1IJEB 5A6PA 3OS1A 4BRAA 1NO8A 4HI2A 3DYAB 3DXKB 1XNRF 3QSYB 4GRSA 2IMOA 4MLEA 4X65J 2E2QA 2BQUA 2DIUA 1RI7A 1H6KX 4KKOA 4Z4FA 3W65A 2YQ0A 1NMNA 4XK8C 1EWQA 3M1VB 4Y34A 1FHTA 5F8HA 3KK7A 2HSEB 3HZGA 2PEHA 3PRDA 4J2BA 3MEEA 2IA0A 3HSCA 3PJWA 4OJHA 4NCBA 4FLYA 5KGXA 2DNKA 4L73A 5AQSA 1WUAA 4TXSA 4F4ZA 5KG7A 1BWEA 3FJ2A 5FD1A 2MLYA 3P6YC 1N32K 2KYXA 4FPIA 1PKUA 3AD7C 2ZZMA 4OYPA 4WPAA 5KFXA 1VI7A 3FZLA 1HW8A 4M1KA 3CJ9A 3THTA 1S1XA 3K9JA 1HA1A 1IKWB 3S1TA 5AJ3F 4CO3A 3I56S 3DFEA 2CNOB 4DTSA 4DZDA 3A8KA 2DNGA 4K8ZA 3JTOA 1BE4A 3IMQJ 4DXLA 1HNXK 4DV6K 2V51B 3TO8A 3R3TA 4X62J 5EGYA 3N28A 1YJ7A 2FPHX 2AJQA 4O3PA 1NOYA 1IN0A 2FVPA 3BKFA 3LWMA 1JXVA 4EFAC 2VG5A 2RHQB 5CQGA 3MGJA 2C22A 2NYHA 4YOYA 1KSPA 1T03A 1RCHA 5AFUA 1HLWA 1LWCA 3THVA 5CCMA 3MWTA 3OTEA 4GC6A 4NI2A 3WIUA 3KMSA 1XHZA 1Z26A 2W9AA 1G99A 2V8DA 4CJ3A 1RUSA 4B02A 5IV4A 4J9OA 4O3NA 4OZ3A 2QXFA 2YKOA 2NQPA 1TV6A 2NRXA 2QV6A 3ZZUA 1LKZA 3AA2A 4H0XB 2Z58B 2NREA 3IRXA 4RU2A 1TL3A 1RADB 3L95X 2BRKA 1QY7A 4ZJQA 1GLBG 4PAAA 1RTDA 4LBHA 3TVZA 3F44A 2N7CA 3MECB 3ATUA 3ULHA 3DRXA 3RW6A 3M30B 3TJ8A 4ECUA 4BC5A 1YQHA 3UB5A 3CD7A 3EE3A 5LMUJ 3QT6A 2OP5A 3THPA 3OYNA 1FRJA 1L5UA 1PAEX 3VQ5A 3SQ4A 1K1SA 1RKJA 3Q22A 2GIQA 4OYMA 3T69A 4U6PA 1F5BA 1SJQA 3DLKA 4EP4A 2V67A 5KFZA 4DR1F 4JK9A 4YP3A 3HF5A 4Q44A 2O01C 1UJ5A 3AJ1A 3H40A 1NZAA 2CVIA 3ALYA 2FIUA 1YJRA 2GUPA 3PG9A 3JS9A 1KHWA 5KFGA 1TKZA 1WELA 2VOOA 3AGKA 2UP1A 3FQLA 2RHSB 5K8NA 4FKYA 3M2RA 5A8WB 2VQFJ 2N3LA 2VL1A 2VASA 3VEYA 3QMLA 2QKBA 3RJMB 2DY9A 1QQMA 4CJFA 2ZUAA 3E51A 3OSPA 3OA9A 2XLIA 4JKGB 3G87A 4DR5F 4E1JA 3R9PA 4GO7X 5DDOC 3O1WA 2ZBPA 3LGHA 1VQ5N 4ZP7A 2HYIB 4J7CA 4CERA 2NPFA 1GLEG 4BG8A 1ASWA 2AKWB 4DL4A 1EQMA 5EX0A 2EW9A 4U7BA 1QUPA 5ETMA 1ZBIA 1I94F 3I33A 4LIRA 4HT5A 3HHDA 3VGKA 1SAZA 3ZZ0A 2M8DB 3MURP 4KBIA 2N4DA 1DTQB 1F1BB 2ZNZA 4M3WA 4P75A 5J1EB 4X64F 3VEWA 2MGZA 5DDPC 3C0BA 5DS7A 2HWHA 1NGBA 3GP9A 2XGQA 2OKQA 3OTCA 4DL5A 3POTB 2KRBA 2WVFA 4DUYK 2R8IA 1NBEB 3CJBA 3T7ZA 2ASOA 4MO5A 4ES1A 4NB4A 5DM7Q 4FK0A 2KHCA 2QTWA 3HJVA 3TR5A 1HWIA 3MEGA 3CEDA 3R8YA 3SMSA 3OL6A 2CDQA 4BROA 4MYTA 4IQXA 2ZH3A 1WHXA 1Y00A 4DL2A 3MEDB 2OELA 5A8KB 5AQNA 4YOVA 4CYUB 3DLRA 2J6SA 1LNQA 3ZZOA 2ASPA 1VSLA 3K2YA 4I6MB 3EKSA 4CESA 3EJMA 3MDQA 2OEJA 3OJSA 2ROPA 2ZDPA 3M2VA 4MIBA 4OKEA 1RBLA 3M7VA 1OWXA 3DLJA 5H9FK 2NRHA 3HSTB 1WBBA 4TU7A 4DQQA 5F9NA 2C3PA 1MSWD 3NH2A 1ZAWA 4WIQA 4Q5VA 3NGTA 4G65A 2OTLS 3CJ7A 4LF9K 1GXUA 5KPTA 1L3VA 1NBWA 2FBVA 2CG8A 3RBZA 4K41A 2PDAA 3JTNA 4IUFA 4O4GB 3PIPQ 2DNHA 4OZJA 3LO3A 4CE9A 2WSFC 5B0FA 4NXMK 3BO3A 1PSDA 2MQLA 1IBLF 3MMBA 4KB0A 2W1BA 1HBOA 2YY3A 5DDRC 2M88A 2B9WA 2WVDA 5IC4B 1NDCA 2KQ2A 5A6WA 5KFWA 2MEWA 2O1PA 5ETSA 1TELA 4FJNA 3VEVA 1GFWB 2GBZA 1EETB 1WHVA 2XM3A 4GKKJ 1UAXA 1ATSA 1X0FA 5J2PA 4DR7F 3DRPB 1T8EA 3O1BA 2B9XA 2CGKA 4EAHD 3O5BA 4FBUA 2LYVA 4GVLA 1RDBA 3LP3A 1RWWB 3MXHP 2ACMA 1RP5A 2YHXA 2ZH8A 4F0HA 1Y3JA 2EFNA 4CEOA 5MLCV 2QA2A 1T9XA 2JVRA 2ZJQQ 2DRDA 3M3ZA 4M63A 2ATCB 1PJ7A 4LF8J 5KFKA 4RW7A 5E3AA 2ZUGA 3T3FA 1SC4B 3J80U 3K17A 4RUHA 4CJRA 4XH1A 1N5YB 2E1PA 3H0PA 2B4JA 4JKBA 4AL5A 3DU6A 1YI2N 1K8KB 5HMZA 5D0RA 2A40A 1AYEA 2FGCA 3AOCA 3B82A 1U2CA 3BBFA 5JVHQ 2BE2B 4A5BA 2WFBA 4GO5X 3HVTA 2V9KA 2FHJD 1HBMB 4H5NA 2CZ4A 1RAIB 1YIJS 1WSEA 3SI8A 3EGZA 4BRNA 1VGYA 4K25A 2UUCF 1KHVA 2BJ9A 4G1PA 3TVYA 1VBYA 3ISND 5C2GA 3Q8QB 4FWLA 2PT0A 4AD6A 3PUFA 4UZCA 1RTHB 1URRA 3M32B 4OI3A 1NZ8A 2W2PP 2A3ZA 1QUVA 2WCXA 3VF6A 1OH8A 3CT9A 2UZAA 4R8UB 2EWHA 3TZZA 3ENQA 2KO1A 2F65A 2HBLA 3M8YA 3G86A 1IKVA 3AQOA 3HHLB 4YB5A 2CJAA 3RW7A 5I9EB 3GILA 1TL1A 3R7BB 3D0IE 4P74A 1FRHA 2FLOA 3D5MA 2OJ3A 3GV8B 2BJ1A 5T14A 4QWEA 3ETMA 2X7IA 1RB0A 4KT0C 3J81j 1RT6B 5IV3A 2WB4A 4GV3A 4OX9F 4F4WA 2P9GA 2R4FA 3D67A 4K0KJ 1BL3A 4Q8EA 1VQ8N 1REGX 1NHUA 4BRHA 3GJSB 2AJ2A 3W9HA 2ZH6A 1R8AA 5HO4A 4M5IA 3UE2A 1UA0A 5CAAA 4C0HA 8AT1B 2HLTA 2PYJA 3O3GA 2QFIA 3OR1B 3AO2A 2D4WA 4DSFA 3NAIA 1IG8A 3W8GA 3VQTA 5KFBA 3VGMA 3OXLA 4HTLA 4F4XA 5AQRA 3M6WA 2PIIA 1Q86T 2H51B 2W7AA 5CD4A 5BPLA 1V5VA 4N77A 4ITSA 1UMJA 4CT8A 4B3SK 3C14A 1WD6A 2DCLA 4F50A 3M8RA 3MR3A 5CHIA 3L2VA 4JKFA 3UO0A 2XLKA 1YVUA 1TKTB 4FK4A 1IXKA 5AXMA 3U3YA 2W24A 3WXJA 2QWOA 1Q1KA 2O8CB 1S1VA 4H54A 1LOUA 2OLWA 3OL7A 1S0MA 3MCNA 4X4SA 4JI1F 4C6AA 3I55S 3IR7B 3LH2S 5IS2A 1SQKA 4CHPA 1BD6A 2MSTA 1SL0A 3BYRA 2HBZB 5B0EA 3KKRA 2BMBA 4FLVA 4LF1A 2QWMA 2E20A 3C7NA 3HHLC 5J2QA 1YJTA 5DGBA 1KFDA 1WSGA 2YKNB 4DWIA 1X4CA 5C24B 2AX1A 4PY5A 2LXIA 1GLLO 3CC2N 2G8VA 1N32J 2EX3A 4LF2A 3QNOA 2ITGA 4JKHA 1B0PA 5JXSA 1LFWA 4PCQA 3ENWA 5KFYA 3TJ9A 1BQNB 3L2RA 7FD1A 3T9NA 4JI7F 4EO8A 5M2RA 3HDSA 2Y3YA 2X51A 4R0EA 4LRBA 4WYWA 2OTJS 2HHUA 3CCLN 4P10A 1FNXH 1HNXJ 1VQNN 4B3TK 4I4BA 4AH9A 2L3MA 2DHHA 2GWKA 2W8KA 2E9TA 3B8HA 3WXKA 3CFRA 4DF8A 1Y0HA 4EO6A 2W9BA 1NK6A 3GYXB 4IFEA 5M1KA 1TQLA 3QT8A 3VTIA 1LWFA 3OBWA 2ZOFA 2KFYA 1CVJA 4KRWA 2CPHA 3RMBA 2MY8A 3K5PA 1VC6A 3RBDA 3QO9B 4IWVA 1OQ6A 1SPBP 4ALZA 3EX7B 2CH5A 4F3TA 1Z4UA 4ED6A 4USMA 1BDGA 3N6NA 3C6AA 4JK7A 3CM6A 1WC3A 2XY5A 4H8KA 4K4WA 2LXFA 4ZVUB 2AJ1A 3LPUA 2MKHA 1HI1A 4CIFA 5HJYA 4IJNA 5CZXA 5CYQA 2J7UA 5BYSA 2MQOA 1XMOF 1A9NB 3FE1A 2RDJA 1CQNA 1FX4A 3IXQA 1HYVA 4URGA 1ZOTA 3KLEA 5BYQA 2KJWA 4KHMA 4JBCA 3OS2A 3DYAA 2WOMB 2JC1A 4U95A 3WQUA 3DXKA 4KHSA 4WBFA 4ENOA 1ESVA 2UUTA 5DG7A 3S01A 3GCWP 2MYFA 3IC1A 3QSIA 2DGQA 1OYEA 2CUYA 3V1QA 3A5LC 3M1VA 1U1QA 4DTNA 1WC1A 3H3NO 4PWWA 1FTRA 1NHVA 3S3OA 2FSJA 5E5NA 3NS6A 2FC9A 2YKMA 1MN9A 4JV2A 3KLHB 2XZWA 2F3JA 1TFWA 4FWQA 1OKJA 3OYFA 2BKPA 1U1RA 4B08A 4BRFA 2BQ3A 4OV6A 4BBYA 2ROGA 2BACA 4Y1CA 4ILMA 2VYPA 3MAAB 2VB6A 4JI2F 4F04B 1WHYA 4M7YA 1HD0A 1IKWA 3VALA 4CLSA 4NYOA 1VQLS 5KFVA 2GO8A 5KFSA 5TKYA 4USHA 1VOMA 4ISFA 4CHQA 3KJVB 3NCIA 2G8KA 1NSKL 4X66K 1W2BM 3QBXA 2IC3A 1FT8A 4TU9A 1S9FA 2KFNA 4B9UA 2RHKA 2LP4A 1FKAF 2PBDA 2XYGB 4HLBA 3E9LA 2EFPA 4M3RA 3CCZA 4DPXA 1VQ9N 3SCLE 2CJKA 1UWAA 4RNFA 1T95A 5HRSA 1S49A 3G0ZA 2FJBB 3GCXP 1QAXA 4H5WA 4NLQA 3DN9A 2ZKTA 1KOOA 3VAGA 1T94A 4TY9A 2GHWA 1N5SA 4KV8B 1IUJA 4OPKA 4DUYJ 4YY3F 1M5OC 4CBUA 2YHAA 3I31A 1JJ2R 3HYFA 2BDPA 2Z2YB 3I0RB 3ZSOA 3GE9A 5K8PA 1OY8A 2F96A 1WOQA 4H4MA 1NPRA 2YPZA 2XB2D 3VQCA 4NASA 1NGAA 4NEZA 1IKYB 3QEWA 1JL1A 3MECA 4FYXB 3KWIA 3M30A 4JS5A 2D3UA 3GDQA 2MKYA 4RWTA 2QSWA 2F8SA 1Y5NB 4LFAF 4NLYA 2NRTA 4ZVOB 2DXDA 2GMJA 2VBXA 3TUJC 1SI9A 2GNKA 2QMWA 4DV5F 1X31C 1T9VA 1EKSA 4NLTA 2XWXA 2AIRB 1KQKA 5H9FJ 1CS4A 3MM8B 4DTOA 4FM1A 5BXIA 3QGGA 3NY0A 5E3QA 1LK7A 3CJ8A 3F73A 3AODA 3D6MB 4CZIA 4EGLA 2E1RA 1W2IA 1S5ZA 4FWKA 4LF9J 4JI6K 3QZ7A 3HO1A 2CDRB 5FPDA 2ZFHA 4M3UA 1P90A 4L76A 2MZTA 2JH3A 4DV3K 2GGPB 2KZMA 1NSPA 4NWBA 2K1RA 2HNYB 4C0OC 2VC0A 4OIXA 1C6VA 3IFRA 1EIYB 4NXMJ 4I56A 2DGUA 3R5GA 5A8WA 3K8VA 5AT1B 2XYPB 2HHTA 4TN2A 1LFPA 2HQCA 4H0VB 4A4JA 3RAMA 4DLEA 4NLPA 2CPZA 1O5JA 2YKPA 2YV0X 3L6QA 4EYHB 1DQAA 2DHGA 1T7PA 4JKGA 2MPUA 5JVGL 2CQ2A 4ZMMA 4E89A 2ZGZA 2DXEA 4NOHA 3RG6A 2HS3A 4LY7A 2WTFA 2A1BA 2YNGB 2RRBA 3L3CA 2F1FA 3PY8A 1SS6A 3OW2R 3DJCA 3IS9A 1VSJA 1RACB 4FWNA 3ULDA 3G82B 3CWJA 2LECA 1ZBLA 4X65F 3NVKA 2KXHA 2VWJA 2GQQA 1HWJA 2HVEA 8RUCA 4F3OA 1DTQA 3E1YA 3EY1A 2XNQA 4DS4A 1RHRB 5J1EA 4CEBA 2GW8A 2YWHA 4CJVA 4ZHRB 3GIRA 3VQQA 5KFPA 3BQ1A 4J37A 2BW7A 4CD1A 3AVJA 4F3QA 2H65B 4ED5A 2GQCA 4P2FA 3POTA 2FUG9 3PO4A 4NZ7A 4YNQA 1CJVB 3W5ZA 2JEGA 3DOKB 4HKQA 4BDYA 3AO3A 4B1ZA 2V8VA 3I6PA 5BRHA 3ILLA 1WAJA 2W8LA 2OZMA 3QGPA 4CYUA 3GOIA 3JAMY 3MHYA 2GJ2A 2JEIA 4OFZA 2B7CB 3JXOA 4DCOB 3NCQA 3RUBL 2Z2LA 1B70B 5F8NA 1Z05A 3R8EA 4C1NK 3BH6B 4X62F 1L3TA 2HW3A 4CIEA 5AZIB 1U24A 4CFDA 2AV5A 2KYZA 4N76A 2DXFA 1N8RO 2E8AA 3SCJE 2XS5A 1UA1A 4ECSA 3CF5Q 1PC4A 2XZDB 3DLBA 2OZSA 3MR6A 4C48A 1SBRA 2EKYA 3OYJA 3AVGA 3C6HA 2COLA 1BG3A 3KK3B 3TPQA 4O4GA 4H0YB 5D3GB 4QU6A 3WEEA 1HFEL 3HPGA 1WKKA 1UFKA 3W8PA 4CJEA 3O6WA 2FY8A 3CJKB 2FBXA 3KLGB 1S4EA 3K9KA 1NEEA 4B3MJ 3HMJG 5I4MA 2D9PA 3NEKA 3WQTA 3W63A 2QL7B 2YVSA 4HL9A 2IY5B 1HBNA 2MLZA 1EETA 3N5FA 3TZWA 1RQ0A 5EX3A 3IR6B 1HPZB 4Z7CA 1YZ6A 3DRPA 5SUHA 1QD1A 1IO2A 2P9KB 3K58A 4Q2MA 3ZETB 3MMAA 1NCLA 3K7RA 2V8HA 1CXUA 3VQAA 2DISA 3PKMA 3IWNC 1DLOA 4M8LA 5LMUF 3AXMA 4MLHA 2NUUG 5ETVA 4I2QB 4J9UE 3NE6A 1JK9B 1UJ4A 4FLXA 1IJJA 3UKUB 1VQPS 5E7OB 3BYPA 5DETA 3RBXA 4B3SJ 1VQ8S 4RBVA 1ZC6A 4ILGB 4XH4A 5F8GA 2NRRA 4KAZA 2KHOA 1FO1A 1TL7B 5AQJA 1KVBA 3W5XA 5TKWA 3EE9A 5F3TA 1A7GE 4I69A 1XJWB 3WXLA 2EEYA 2FJAB 4ZLJA 2Y1LB 1N5YA 4FM2A 2G0IA 1H38A 1EJ7L 4C98A 2MKCA 4CLTA 3E01B 1IQZA 4L75A 1X7VA 2XHWA 2YX1A 2VQFF 2ZC4A 2GA7A 4USKA 1YT3A 3CCWA 2Y8YA 2BE2A 1JL2A 1QAIA 2G8FA 1TK8A 3OVBA 4AF1A 2AF6A 1HBMA 4MQ3A 1EX4A 3L2QA 5AQPA 4DR5K 4C8YA 1HKCA 4BY9C 2HPUA 3Q8RB 4ZPTR 3CJ1A 1ZA2B 4NLVA 2AGOA 3P83D 3QEVA 1RCOB 4CH7A 3MZIA 5LJVA 3DMJB 3PO5A 1RTHA 4CLPA 2HHHK 3M32A 2EVZA 2C3MA 4RJVA 1VAZA 4NE9C 4X4VA 2P5GA 4R8UA 2IDOA 2V4RA 4ELUA 2QWLA 1JLGA 4ZVRB 4AHUA 3NFAA 3CXCR 5LMNK 1EWRA 3AO5A 2NRZA 2DNPA 1X5PA 3CD6S 3PX4A 2PN6A 4OYWA 3HHLA 2NCKL 3QWUA 3GWCA 3G8QA 4X4NA 2XMMA 4N7TA 2JNJA 3LALA 3R97A 4RU9A 1J2VA 4P6QA 5H1SV 2ZWPA 4DBQA 2IFXA 1RT6A 2BEFA 3I5CA 2E5IA 3SQ0A 1GTEA 3BO2A 3JTPA 2PD1A 5A2QO 3KDOA 4CJ4A 1BHNA 1SQFA 5IC6B 3O80A 3LQVA 1DEJA 3SAFA 5L9NA 3HK2A 1DY3A 4F3MA 5KFFA 1FFGB 2CQ1A 4GVBB 4DPTA 3CCLS 3B4MA 2CJXB 3HULA 3IWLA 3CC7S 4LD0A 3OR1A 2CZ9A 3MF5A 3MTJA 2XTJP 2D0PA 2V52B 4CZFA 2J0QD 1JCGA 1KBRA 4AFFA 1U02A 1W25A 3BKTA 1E3MA 1EKRA 1MWZA 1Y5IB 4IO1A 2R9LA 4NZ0A 5AR0A 3TZXA 2HFUA 3PFOA 2W41A 2M4MA 2LQ8A 2K06A 4LR9A 4ETXA 1TKTA 3MX5A 4DF4A 1KS2A 1UVJA 2JEJA 2J6UA 1T02A 2XO7A 4JYAF 1QHAA 1YJNN 4YDXA 2ILYA 2OPQA 2O8CA 4LF4K 4KBOA 3W5YA 4OQJA 4EU0A 5C0YA 2HBMA 4Z4EA 4DU3A 2ZWOA 1RBTA 1Q18A 3O9UA 4M94A 4E19A 2QXLA 1HNZK 1RBAA 4RW6B 3FVYA 3VAHA 2A10A 1JNZB 4ILHA 4GKKF 2WVEA 5D0HA 4NMXA 3LAKA 5HP1B 1HUXA 5J1PA 1VMBA 4LREA 2DD8S 4F4YA 4LBPA 4Q8FA 1FRKA 2Y0SD 2HIYA 1PCAA 2DITA 4UQGA 2YKNA 2F8HA 2DY4A 1XR7A 5C24A 2KB2A 3FZ2A 2DBBA 4DUZK 2RQ4A 2XEXA 3TUIC 3ZSZA 3SBTA 3WXIA 3TAEA 1KVAA 3O3LA 5J2NB 3LM2A 5JICA 4C8MA 4M3TA 1GQEA 1BQNA 4LF8F 1CC8A 5D8HB 1FVSA 3G10A 5L8RC 2BH1A 3JSMB 2BJ8A 3KWGA 3KG4A 2V4QA 3HRGA 4DQIA 5HRPA 1LW2B 1JXBA 2YWKA 2DFFA 2R3VA 3H3OB 3EMTA 4X66J 4U67Q 1ELOA 3MFIA 1M1HA 3AHPA 2RUSA 4GC7A 4EFHA 3P39A 4BE1A 3PW7A 3TAMA 1GMUA 1FNOA 4PXCA 1CSJA 2AT1B 1NGJA 1RT1B 2CZVC 2C2KB 4HHJA 2EBGA 3BF1A 1VQ7S 4O0IA 4ECWA 2QLXA 1K44A 3OLAA 4B3OB 4WP3A 1HW9A 3QO9A 4WIIA 2J9CA 4IEIA 1WHWA 4KSEB 3EVOA 3PIPL 5F8LA 4DU8A 1GXLA 4J2DA 3LGMA 4BRPA 4X84A 4M5HA 2FB0A 5KGWA 2HGMA 3SK3A 4EIAA 3N9UC 4K50A 1H3DA 3CD5A 3EM1A 2Z1GA 1YBTA 3PW5A 5FROA 2H5IB 2VA3A 2HHVA 2XMUA 2K7JA 4TLRA 3VQ6A 1TU0B 3OD2A 3D28A 4I1TA 3TQ1A 4KGXB 1H2VZ 2QN6B 2W40A 3W9JA 4C8ZA 4ILJA 2HZVA 3K5LA 3R2CJ 4FW2A 3D9BA 4EK2A 1AZSB 2WOMA 1NGCA 2IM2A 4WF9Q 2G8UA 2RN2A 4IEEA 3TARA 3RSEB 1XTZA 2ZHOA 2BV3A 4O0NA 2YBVA 3AVAA 1O51A 6AT1B 2DH9A 5F9LA 1QS4A 4K59A 2PAVA 1C0FA 4FVUA 4K0KF 2ZJQL 4OX9K 2DGTA 3HSGA 3C46A 2W9CB 4Z2XA 2IM0A 1WSHA 4J2AA 3VEOA 3SAGA 3D6TB 4NLGA 1U0SA 2BR0A 1F60B 2DGOA 2HFZA 5LOQA 3PM9A 4JI6J 5AQWA 4ZPWR 1IWAA 4JI3K 1HD1A 3ZX0A 2MZQA 5K5MA 2DO4A 5GAHI 1SH3A 3KLHA 1W9HA 2DGSA 5AZJB 4K5SA 2J8AA 3HI0A 1S1UB 3CCMS 4YQWA 1QJHA 1BHLA 2KT3A 2UU9F 3IGVA 2Y1JA 5JVHL 2WAQD 2MKJA 1VQKN 2JX2A 5D4OA 3MAAA 4LFBK 1VJQA 2JC0A 2P6TA 1LAWA 2B8PA 2ZNYA 3K89A 4DOZA 3J7YI 5BR9A 1GX6A 3RRHA 2HLUA 1YRXA 3D3BJ 3PFEA 4FJIA 4Y00A 1RT2A 3A8YA 1NGFA 3IMXA 2W25A 3SSQA 1SL1A 5KFUA 1TUGB 1QSLA 1SXLA 1N52B 3KDNA 4EBEA 4M5JA 3V9WA 2MY7A 1S72S 4JRQA 1U2FA 3VQDA 3TANA 4FJ7A 4PPZA 2YI1A 3KNGA 4AM6A 3AD9C 4DL3A 1JQGA 1FJ7A 3GV7B 3V1RA 4B9MA 2Q97A 5CR4A 5I3UB 2A1RA 1WJ9A 4KV8A 1FKPB 4ZA1A 2GWJA 3OUYB 3V6KA 2B51A 3TTDA 2FXUA 3HHNB 3MXIA 3M1FA 1N32F 2YNFB 5BR8J 2YWEA 4EYIB 3ZXWA 1JIHA 1YJUA 1P8GA 4E2FB 3EEQA 3U9DA 4DV4J 1P9YA 4KQZA 4PXEA 3TX8A 4FF4A 2IVYA 1WEXA 3TUZC 4RW4A 1OPIA 3QFPA 3LP2A 4DG1B 1HNXF 3ZSVA 3AGRA 4GV6A 3UN2A 2IRXA 1NJIO 4DV6F 2V9WA 3IM9A 2R2TA 1WACA 3IBCB 2ZBRA 1YBUA 1NU0A 5GADI 3GJQB 3CCUS 5ETRA 5CZ1A 4OJGA 2R2RA 4WE1A 2H1YA 5G0RB 5A8RB 3THWB 2IHR1 1CZAN 4J9KA 1IBKK 3EYZA 3C65A 4WXWA 1KCFA 1S76D 4ES2A 1VBKA 4CZLA 4J90A 4TYAA 4DFJA 3KHHA 4PA1A 4QR1A 2GGPA 2VKZG 2ALYB 1C0GA 2HNYA 1RYSA 4M5DB 2WTUA 3ZTRA 4LRAA 4KHNA 2HVZA 2AGQA 1M1GA 5M1FA 3MOJB 2BKNA 4CJUA 2R8GA 4OI1A 3U27A 2BGGA 4ERDA 3DKDA 1JNRB 1GEHA 1N0VC 3TTCA 3OLBA 3ZSRA 1WDTA 3WXMB 3R5BA 2QLWA 5DZ6A 5E3CA 4ICLB 1S6OA 2YNGA 4LH5A 3Q2TC 3DLGB 4FJKA 3QT7A 1S79A 3FRYA 3OFHA 3A0IX 1QQCA 2LA4A 3C2PA 4ETZA 4CGGA 2MZ1A 2EI5A 5DQIA 5KT3A 3G82A 3LANA 2E44A 3KFWX 1VK0A 4FLZA 2CJBA 2MQQA 5JS1A 2PGCA 4RUAA 2A2DA 1A5XA 4JUZA 1EQYA 1X9WA 2O67A 2E7VA 3UCUP 4ZHRA 1OQ3A 5ETTA 3RR8A 5GAGP 3EVWA 3FR0A 4DV1K 1NGEA 3RBEA 2W2QP 2R8JA 1BUPA 3M6VA 4UY8O 5KFNA 4QBUA 1SKWA 4KGKA 3LA0A 5G4DA 3DOKA 5KG2A 4C8KA 3H25A 4CEZA 1NJXA 1Q7YT 3QGIA 4BE0A 1BA0A 2IRYA 4MTPA 1FKOB 3M5RA 3T9ZA 2FTRA 3G71S 2VBWA 3TQEA 1LXJA 4CF8A 1V4TA 3EZWA 5J2MA 1ITGA 3QT5A 5LJ5Y 3NOGA 1R8BA 1U47A 4HACB 1A5VA 3OBYA 4ZS6A 1YTAA 3SI6A 4I2PB 1FK9A 2IBKA 5GAHU 3QYYA 1RHQB 2HHHJ 2MJNA 2X3DA 4LJMA 1KOHA 1K8AT 3E8OA 2M9KA 4OKJA 4FW1A 4X4QA 1QAJA 4FJHA 1OJ4A 4DCPB 2QMXA 2QM1A 2JLGA 2GV9A 1M90O 1WKJA 4CQ1A 4ED7A 5FPNA 4ID5A 4KJIA 2J8SA 4PL8A 1IBMK 3KK3A 3J7YU 2J4RA 5HLFB 4OZLA 5D3GA 4HHTA 1NDLA 3GFXA 2O8DA 4DUYF 1KC8O 3CJ0A 3CJKA 4J9LA 3MWPA 3GR0A 2EHGA 1WOSA 2VDIA 1B9FA 2A18A 3PR5B 2QLBB 3NS7B 1RBOB 1X60A 2VPWB 3MI7X 3DRSB 1NGHA 4A57A 2FYXA 2IBOA 3D2WA 2OH2A 2QG9B 1S9GB 4WYBA 3J81U 4ZVSB 4MKYA 3ID8A 4B1YB 3KHLA 1N6QB 4E7IA 3M9NB 3L3VA 1YXQA 4OHWA 2I38A 4V19X 2DPNA 1RA6A 1RNHA 3M8PB 3UKUA 1X4AA 2VJVA 2O8BB 3BV8A 3VF0B 2C1EB 4DPUA 4FDFA 2LLZA 2I2YA 2IMWP 3ASMA 1UPPA 4DKWA 2HSTA 5M1NA 2HNZA 4DV2K 2VONA 2ASJA 1ACMB 3OXGA 1M5SA 1TL7A 2WW8A 4LF9F 2IVFB 2Z0GA 3DXMB 1LWEB 4DV7K 4FPBA 4CJ5A 3OT9A 1QTNB 3KUGA 2XI2A 5A2QU 4IFVA