4E1NA

Crystal structure of hiv-1 integrase with a non-catayltic site inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
144
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSATVKAAWWAGIKQEFGIPNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 integrase
publication title New Class of HIV-1 Integrase (IN) Inhibitors with a Dual Mode of Action.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 46
structure length 144
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e1nA00
2YKNA 2RF2A 4CHNA 2DFEA 2XY6A 1Y97A 3MEDA 4KHYA 1S1TA 1RT4A 3D45A 4DG1A 1XWLA 1WSHA 1ZBUA 2KQ2A 4IFYA 1D5AA 3ZSOA 4CJLA 3L2WA 3OYJA 1J5OA 1BGXT 4B8AB 1KRPA 3L3VA 3NBPA 4KV8A 4QOZB 1D9FA 4CHOA 1RBRA 1CZ9A 2HNDA 5J2MA 3QEPA 3OYCA 3PO5A 4CJTA 3QLHA 4CESA 1VSEA 1KVAA 2ZD1A 3DLKA 4C8NA 1ZYQA 4DSJA 4L8RB 4KI6A 2YNHA 2HB5A 3QERA 4YNQA 1TK8A 1TAQA 3PX0A 1U4BA 2HW3A 3DMJA 3RR8A 4CIEA 4IKFA 3MAQA 1A5VA 1KVCA 1F21A 2RN2A 5C24A 4AHSA 3OYFA 4BE0A 3CM6A 4KB1A 1G15A 4OVLA 4DQRA 4KHQA 4CECA 1NJZA 2P5GA 2GUIA 2HHUA 1WNSA 1JLFA 2B5JA 3LP3A 1NK5A 1JLCA 1WAFA 1KSPA 1WSJA 4HUGA 4DWIA 1HNIA 1TV6A 5HRPA 1BI4A 1UAXA 4B8CA 3PO4A 4FJLA 2KZZA 3DOKA 3CG7A 2ZE2A 5HBMA 4IFVA 5HRNA 2BANA 4I2PA 4DQPA 3ITHA 1S9GA 4DMNA 4EZ9A 4B9VA 1RT5A 2O4GA 1LAVA 4CF9A 4CHQA 5HROA 2Z1JA 4M3UA 4GW6A 3ZSVA 3NF6A 4KRFA 2B6AA 1KCFA 4EP4A 4M41A 1J54A 4DU4A 1JL1A 2VWKA 3VQAA 4C8OA 1C1BA 3AVLA 3KKRA 3B6OA 3QIOA 5KRSA 4E7LA 1X9WA 1EETA 3CFRA 1R0AA 5JS2A 2NUBA 1NK4A 4FLUA 5FDLA 1C6VA 1TL1A 2DTUA 3T3FA 3NGZA 4GMJB 3WNGA 3IRXA 4AHUA 1HNVA 2YNGA 3QINA 1B9FA 4BWMA 4IG0A 3MEEA 1U48A 1XI1A 4N56A 1NK0A 4B9NA 4IBNA 3U3GA 4DTPA 3MXMA 2PYLA 1B92A 1XHZA 5C42A 1HQUA 3AA3A 3K2PA 4CGHA 1QTMA 4DSLA 3PY8A 3ZSRA 2IAJA 2DFFA 3LANA 3MECA 3HSTB 4DS4A 3AO1A 2BE2A 2QK9A 3HPOA 4DTRA 3HJFA 4DSEA 1HQEA 4MQ3A 3KLIA 4OJRA 1JLAA 3QEWA 3C94A 3WNHA 1QHTA 4UQGA 4DS5A 3NH2A 5J2NA 4FJGA 1RT1A 3AVAA 2KFZA 1HRHA 1GOBA 4I2QA 3L8BA 4AHTA 1WSGA 1SL1A 1GOCA 2XY8A 3HM9A 1HYVA 1REVA 4CIFA 5SWMA 3U3YA 4J2DA 4HTUA 3DI6A 3O3FA 5HP1A 1BHLA 2P51A 1TKZA 4QAGA 3RMAA 4CEOA 1NKEA 1NOYA 4FZYA 3LP2A 3NF7A 1I39A 3VQ6A 5HRRA 3OYAA 3KLHA 4BACA 1NK6A 4M3WA 4PWDA 4CJEA 2G8FA 4F3TA 4DQQA 2VWJA 4KHWA 2A1SA 1TKDA 1VSFA 2AJQA 4CEZA 4OKJA 4O0IA 4W5TA 1SKSA 3TWHA 4CJKA 3RTVA 3QESA 1HYSA 3P5JA 4FW2A 4E19A 1IKWA 2VG6A 4Q0BA 2OA8A 1JLGA 3DLBA 3A2FA 4CFAA 4KPYA 3HPGA 3TAFA 2G8WA 1ZBIA 1UA0A 4CEEA 3SUPA 2KFNA 1BISA 1C1AA 2LSNA 5D3GA 3V9SA 1RT2A 4LY7A 3ZT0A 4GVMA 5J1EA 3I8DA 1GOAA 1ASVA 4HUFA 1C1CA 4ID1A 4DFJA 5DMRA 3M8PA 4FK4A 4BE2A 3AVNA 1S5JA 1KLNA 4AHRA 2E4LA 1EX4A 3LP1A 3SV4A 4FJNA 3RRGA 4WE1A 3QNNA 3OYIA 3KD5E 1TKTA 3KK3A 4CJ4A 1ZBLA 1Q9XA 3OVNA 1ASWA 3OS2A 3OYGA 1SKWA 2D0AA 4CFBA 4CF1A 4OPJA 4M3TA 1W0HA 1NJXA 4F8RA 4ELTA 3SQ4A 3IS9A 1RDAA 4LSLA 3HVTA 4CJVA 4E7KA 3AVGA 2R7YA 4CJFA 4Z4FA 4FLWA 1U45A 1L3SA 1T05A 1UWBA 3DLGA 4AHCA 4KREA 5CZ2A 1D8YA 4CEAA 4HHTA 3JYTA 4FM1A 4KFBA 4H4OA 4KTZA 2HHWA 4CGDA 4Z0UA 3DRPA 4OPKA 3V9WA 4ELVA 3KLGA 1LWFA 1WAJA 3HPHA 2HHSA 3M8QA 4CHPA 3IAYA 3K5MA 3LPTA 2HVHA 3VQCA 4NCAA 1VRUA 4E1NA 4DSKA 4PUOA 5KI6A 1BQMA 5T7BA 1ASUA 3C6UA 1X1PA 1X9MA 4E7JA 4FJHA 5JS1A 4LH5A 4O55A 2BGGA 2D5RA 2KW4A 2HNZA 3LPUA 4KTWA 3M8SA 2E6MA 3V6DA 3ISNC 4DTUA 1RDDA 4CERA 4ZTJA 3P1GA 4CK1A 4E89A 1RBUA 2IGIA 2X74A 5EU7A 4FJMA 4DTXA 2HMIA 4M3YA 1RILA 3HL8A 3SZ2A 4DFPA 1VSHA 2IDOA 4CK2A 4ZHRA 3L2RA 3LZIA 1MU2A 2F8SA 1S9EA 4ID5A 4CJWA 3HXMA 3QNOA 4M3XA 4IDKA 1NKCA 3CFPA 4B9SA 4B9TA 5KGXA 4H8KA 1X9SA 3TAMA 2F96A 1S1VA 2ZQBA 3SQ0A 3TAQA 4CFDA 2E6LA 5K14A 3ZSZA 1WLJA 3MXJA 1Q9YA 3NH1A 1TGOA 2XY7A 3EY1A 1QSYA 4B9LA 1BIZA 1RTIA 4I7FA 1VSIA 4OGCA 3DLEA 1WN7A 3AVFA 3G0ZA 3L2QA 1EP4A 4BE1A 4FLVA 4M42A 3NGYA 4M45A 4I9QA 1DTQA 3AO4A 3L3UA 4K8XA 4NCBA 1QE1A 2X78A 3NGIA 3NE6A 3PX6A 3SNNA 2BDPA 2PY5A 4DSIA 1J9AA 4NCGA 4N76A 4PQUA 5I3UA 4KHNA 4TSXA 1N5YA 4W5OA 3VQBA 4FZZA 4RG8A 1ITGA 1BQNA 1HMVA 3LAMA 2HHXA 3FFIA 3AO5A 1VSMA 3F73A 4JS5A 4JS4A 2JGUA 2G8UA 3HT3A 1RDBA 3I0RA 1JLEA 5KGWA 4W5QA 1HPZA 4LSNA 2WONA 3VQ5A 4CF0A 3OYHA 2HHTA 3BGRA 2YKMA 3OYNA 1SL0A 3OS0A 3RR7A 4E0DA 4DQSA 4CGIA 4ZTFA 4CJQA 1TL3A 2KTQA 3ZSXA 3DLHA 1XHXA 3SYZA 3QIPA 1T8EA 1TK0A 1K6YA 4CJSA 1LV5A 4F3OA 3AVJA 3NDKA 2OPQA 4B08A 3VQ9A 4CEFA 4CJUA 4CF8A 3RMBA 4CJ3A 3KLFA 2Z1IA 1RT3A 1SV5A 4IG3A 3LWLA 4DTMA 1CZBA 3KK1A 3K58A 2Y1IA 2FBXA 3HP6A 5CY4A 2EX3A 3D0PA 3HO1A 1WSIA 3HYFA 1FK9A 1SL2A 3K5NA 3O4NA 4DU3A 4CCHA 1J53A 4DTOA 2A1RA 1NJYA 1JLBA 3NF8A 3IG1A 3T1AA 3V9XA 1EXQA 1WSEA 3MXIA 3TAGA 1QSLA 2IS3A 3ZT4A 3VQ4A 1JLQA 3ZSYA 4FJJA 1RTJA 1S1WA 2PZSA 2W42A 1C0TA 3VA3A 4FJ9A 2HHVA 4CF2A 2YHBA 2DFHA 3AVHA 4DTJA 4BDYA 4FYDA 1O1WA 1NK7A 2G8KA 2FBVA 2GBZA 4E7IA 4F2SA 3DRRA 3DYAA 4O44A 4FK0A 4I9LA 1JKHA 5DK5A 4JRPA 4RW7A 1JXEA 3CM5A 4RW8A 3VQPA 4AH9A 5I42A 4DU1A 3OYMA 3L2VA 3AVCA 4O4GA 3S3NA 1FKOA 2XO7A 1TVRA 4E7HA 3AO3A 1RTHA 1RNHA 1NK8A 2G8IA 3T19A 1NOZA 4KI4A 3K57A 4CJRA 1D9DA 3AV9A 3AVIA 4C8MA 3QETA 3SI6A 4ICLA 5HRSA 2RPIA 4FZXC 4KHSA 4FLTA 1TK5A 4FJIA 4FXDA 3U6FA 1NK9A 3KK2A 5FROA 4FJKA 1YTAA 4PY5A 1QS4A 2QKKA 1ZBFA 4FJ7A 3E01A 4B9UA 3V1QA 5J2PA 1VSJA 2OZSA 4AILC 2D0CA 2VG5A 1YT3A 1IKXA 1S6QA 1LW2A 2IC3A 4DLGA 1U49A 2Z1GA 4OLBA 2HNYA 3QEVA 1HJRA 4BDPA 3K59A 4ELUA 2FC0A 4JRQA 3O3GA 3NFAA 1LWEA 4CE9A 4E1MA 1LW0A 1RT6A 4CIGA 1W9HA 5E41A 4DTSA 3O3HA 3TAEA 2Y1JA 1Q8IA 4PA1A 3O4QA 4Y1CA 4JLHA 4OGEA 4YFUA 1S6PA 3ZSWA 3K5OA 4EP5A 1ZBHA 3B6PA 4DTNA 3PV8A 1C0UA 3TAPA 4DLEA 4CHZA 2P5OA 3V9ZA 1NJWA 2P1JA 3AVMA 2Q3SA 4DSFA 3S3MA 4Z4IA 2OPPA 4Z4GA 4CGJA 4FLYA 4KAZA 1RBSA 3TARA 4KTQA 3LALA 5CZ1A 4O5BA 4CGGA 4R5PA 4Z4CA 4XIUA 3HVRA 1VSLA 3QEIA 1T03A 3LDSA 4HUEA 3SCXA 4FLZA 4E3SA 1L5UA 4NYFA 2XRIA 3M8RA 4DFKA 3LWMA 5FRNA 1VRTA 1TAUA 1CLQA 3P83D 1VK0A 2FBTA 3KLEA 1JL2A 1NKBA 2X6NA 2D0BA 3SJJA 2WOMA 3OYKA 1L3UA 1C0MA 3DRSA 2OPRA 4W5NA 2OZMA 2YNIA 2ITGA 3UIQA 2ATQA 2PYJA 1RBTA 2X6SA 3VQ7A 1UA1A 1RCHA 4W5RA 4N41A 1LAWA 1RT7A 3TR8A 3SQ2A 1Z26A 1B9DA 4CEDA 3C6TA 3WNEA 3L2UA 5J2QA 1IKYA 3OS1A 5KRTA 2F8TA 2G8HA 3NCIA 2QXFA 3V1OA 4CEQA 3JSMA 1A5XA 2YNFA 1RDCA 1I3AA 4FW1A 4CEBA 3PX4A 3ULDA 4FM0A 3VQQA 1IO2A 3HP9A 1IKVA 1BCOA 2Z1HA 1BIUA 3AA5X 1S1XA 2GV9A 1A5WA 2JLEA 3SQ1A 1XC9A 4HCBA 4CGFA 2IOCA 3DM2A 4N5SA 3OYLA 3RWUA 4KB0A 4HCCA 3OYBA 3G10A 2RKIA 1VSKA 5C25A 1CXUA 4KKOA 3TABA 3LAKA 3TI0A 1Z25A 5HLFA 2YV0X 2HHQA 5FRMA 3DOLA 3PUFA 2G8VA 3RMDA 3SUNA 2XY5A 4C8KA 4RW6A 3I0SA 4KO0A 3NHGA 2DY4A 4LD0A 1L3TA 1IG9A 3KD1E 2OYQA 2EHGA 3AO2A 4CFCA 3ZT1A 3KIOA 3NAEA 3SUQA 3RMCA 3THVA 1S1UA 4C8LA 4FJXA 2KZMA 1FXXA 1TKXA 3RRHA 3KKSA 3EZ5A 4B9MA 4FJ8A 4F4KA 3ALYA 4BWJA 1UOCA 3SUOA 4OLAA 2ETJA 1EKEA 4O0JA 4Z4HA 1KTQA 4B3OA 3V81A 1LWCA 4BDZA 4M3ZA 4DQIA 2HVIA 1DTTA 3ASMA 1QSSA 1U47A 3V4IA 3EYZA 3CFOA 4OKKA 4DFMA 4RW9A 3MEGA 4EZ6A 1RBVA 4FJ5A 3S3OA 4FVMA 3CYMA 4KHUA 5CYQA 4K8ZA 3DLRA 3SV3A 3ZT2A 4DF4A 1BI4B 2B4JA 4M3RA 3VQ8A 3WNFA 1YTUA 4HVJA 4H4MA 3AVBA 3LZJA 1VSDA 1SKRA 4CJ5A 3ZCMA 3VA0A 1HYZA 3OJUA 3ZT3A 4G1QA 1SUQA 3HK2A 1KFDA 4N47A 4F2RA 4NYNA 3SPZA 2QKBA 1CXQA 1IH7A 1N6QA 3VN5A 4AHVA 1KVBA 3F9KA 2O4IA 1KFSA 3V1RA 3AA4A 3VQDA 3ZSQA 1L3VA 3KJVA 1JXBA 3AVKA 3QO9A 2XHBA 4Q5VA 2FBYA 1BL3A 3V9UA 4CHYA 3BDPA 4J2EA 3H08A 3C95A 5SZTA 3NH0A 3OYDA 1KLMA 4CK3A 4OKEA 4FM2A 3OY9A 3CQ8A 4Y1DA 4DF8A 1YVUA 1BCMA 2VG7A 3LP0A 2YHAA 2OPSA 4FK2A 2I5JA 3SPYA 3VQEA 4CJPA 3TANA 1FKPA 1WSFA 1DLOA 4FCYA 1T7PA 4QCLA 4Z4EA 1U04A 5CYMA 3K5LA 5KTQA 4FLXA 3S9HA 3OYEA 3QEXA 4J2AA 3NF9A 4LH4A 3AA2A 4RW4A 3KTQA 4MFBA 4J2BA 1QQCA 3OJSA 1RTDA
chains in the Genus database with same CATH superfamily
4WQ4A 1Y97A 3W0LA 2NRWA 2P9NA 3MEDA 4AQYK 1RT4A 5JMVA 4DG1A 1WSHA 2HHVA 2KQ2A 1D5AA 4YOUA 1J5OA 3CPEA 4FWNA 4BR4A 4KBOA 1CZ9A 1HNZK 3UKUA 3OYCA 2Q31A 4C8NA 3QICA 3DLKA 4KI6A 4YNQA 4H5VA 1HLUA 3PX0A 2E2NA 1A5VA 4BE0A 2RN2A 5C24A 3VEXA 3CM6A 4KHQA 4CECA 2KHOA 2GUIA 4MLHA 4LF6K 2B5JA 3CPWM 2KZZA 3NVMA 1BI4A 4FJLA 4B8CA 3CD6N 3DOKA 2A41A 5HBMA 2BANA 4DMNA 1LAVA 4JKGA 5HROA 3BP8A 4GW6A 3NF6A 1KCFA 3VQAA 3AVLA 1HKBA 3GG4A 4E7LA 1EETA 3CFRA 1R0AA 1TL1A 2DTUA 3T3FA 3NGZA 4GMJB 5M1FA 1HNVA 3QINA 3CQYA 4N56A 4MDAA 4IBNA 2Q1NA 4WQ5A 3K2PA 1QTMA 4B1YB 4CGHA 4EIAA 1YXQA 3JAMO 3ZSRA 2IAJA 2DFFA 3LANA 3EEQA 2BE2A 2QK9A 5A2QO 1HQEA 4MQ3A 4A59A 3KLIA 1JLAA 5H1SQ 4B3RK 3C94A 3PIOL 4UQGA 4NLBA 3LDLA 3UKRA 3NH2A 4DS5A 1X3MA 4FJGA 3TU5A 1GOBA 4I2QA 1T6CA 4CBWA 3L8BA 1GOCA 4CIFA 3VMFB 5HP1A 1NOYA 4FZYA 4BACA 3KLHA 1P8ZA 4BC4A 5CHIA 4KH5A 5AZJA 1Y64A 4CJEA 2A1SA 5JVGL 2AJQA 4OKJA 1SKSA 3TWHA 3N4PA 4R79A 4Q0BA 1NGEA 3DLBA 5AQZA 3TAFA 2QWMA 4LC9B 1C1AA 2JWKA 4GVMA 4HUFA 1GOAA 4JI7K 4H5RA 4H0OA 5DMRA 4FK4A 2P9UA 5HL7L 2E4LA 2YCHA 1VQKN 3ZLJA 4WE1A 1YHQN 2NZTA 1ZBLA 1DGKN 4DV1K 1ILYA 3OYGA 2D0AA 4CFBA 4YHHK 3SQ4A 2HHHK 2GTDA 3AVGA 4K43A 4FLWA 1U45A 1L3SA 4KREA 1UWBA 1YJ9N 3A5NC 3KLGA 3M8QA 3IAYA 2HVHA 2CH6A 4BR9A 3ENOA 4DSKA 4PHTX 5DM7L 5T7BA 1Q7YO 3JS6A 4DR2K 4M7XA 3SBGA 3C6UA 5JS1A 5HOOA 2KW4A 4HTLA 2OTJN 2IGIA 2X74A 4KH6A 1RILA 3SZ2A 3LZIA 1MU2A 2P9SA 3U8XA 3CFPA 3VEWA 3TAMA 1V4TA 3TAQA 1HNWK 2E6LA 5TKWA 1WLJA 3O08A 1QZ6A 4JI3K 3EY1A 1QSYA 3CHWA 4CVNE 1RTIA 5AQQA 3F5TA 3ZEUA 1O13A 1EP4A 2YI1A 3DAWA 1NGFA 3HRGA 3NGYA 1DTQA 4NCBA 2X78A 2VQFK 2BDPA 4PQUA 5M1OA 1ITGA 5EXWA 3BUZB 4A62A 3F2KA 4BRHA 4JS5A 2P9IB 4DV4K 3ENHA 2IVNA 3I0RA 5KGWA 4W5QA 2HF4A 3BGRA 2YKMA 3CJBA 3RR7A 4LF8K 2F4VK 4CGIA 1TL3A 3ZSXA 3ZX0A 1K6YA 3AVJA 3BY5A 4B08A 4CJUA 4DUYK 4OPAA 4F9OA 1SV5A 2UUAK 1CZBA 3K58A 2Y1IA 2NRHA 5CY4A 3HYFA 5AR0A 4DU3A 2A1RA 1NJYA 1JLBA 2O8CB 1OKJA 2IS3A 4G9ZA 3VQ4A 1S1WA 1OH7A 2YHBA 1O1WA 3H3OB 4F2SA 3DRRA 2QWRA 4JRPA 1JXEA 2GEMA 3VQPA 4AH9A 1BWFO 2UXBK 3S3NA 1EWRA 1QHAA 1RTHA 4WQ4C 2Q97A 5AQKA 4KI4A 3AV9A 3AVIA 3VEZA 4FJIA 3LM9A 1QS4A 2EWSA 4FJ7A 3E01A 4B9UA 3V1QA 3OHRA 3E66A 1IBKK 2D0CA 2VG5A 2IC3A 5AQHA 2HNYA 1Q81O 1BDGA 4BRMA 4JRQA 3O3GA 3CJ9A 4BRLA 3VESA 4CE9A 4WFBL 1RT6A 4DTSA 3TAEA 2Y1JA 4JLHA 4YFUA 3CJ1A 4BROA 1NJWA 3S3MA 4Z4IA 1GLJO 4CGJA 1NMNA 1RBSA 4YDUA 4O5BA 4CGGA 3W3DA 3WQUA 5LMNK 3SCXA 1U2VA 4IZ9A 4YOVA 1N36K 5KQ8A 4EFHA 5FRNA 2FBTA 3KLEA 1EO1A 3ATUA 2X6NA 2NLXA 2D0BA 1L3UA 3DRSA 2OPRA 2OZMA 3B8AX 2YNIA 4WQ5C 4A61A 3VQ7A 1UA1A 4W5RA 1RT7A 3CCVN 5J2QA 1IKYA 5KRTA 2F8TA 3BEXA 3NCIA 4I6MA 2QXFA 5KPRA 4DHYA 2QEXN 1BOTO 1RDCA 3PX4A 3ZETB 2Z1HA 3AA5X 5AQGA 2JLEA 3SQ1A 1XC9A 4HCBA 4N5SA 3RWUA 4HCCA 4DV2K 2WFBA 1CXUA 3TABA 3LAKA 1XC3A 3DOLA 2P9NB 3SUNA 1NG9A 2YX6A 3KD1E 4CFCA 3SUQA 2KZMA 3RMCA 3MN9A 1HKCA 4FJ8A 3UKUB 3ALYA 4BWJA 4F4KA 3SUOA 1ATSA 1X9JA 3PLAA 4O0JA 4O5FA 2QTDA 4DQIA 1HJOA 4JKDA 3ASMA 4X62K 3MEGA 3S3OA 3DLLL 5CYQA 4DF4A 1BI4B 3VQ8A 4BQZA 5AQFA 1YTUA 4H4MA 3AVBA 1VSDA 4BRIA 4GY2B 4JKGB 1SUQA 3HK2A 1KFDA 2E20A 3L6QA 1N6QA 1KVBA 2O4IA 3AA4A 1L3VA 4GV9A 3AVKA 4J2EA 2FBYA 1BL3A 5GAEP 3C95A 1NGCA 1KLMA 4FM2A 4FWQA 2OPSA 3I8BA 2Q2RA 1DLOA 2QWOA 4FWPA 4U7BA 4QCLA 3SLCA 4Z4EA 5CYMA 5KTQA 4CZLA 3OYEA 4LH4A 2E2PA 1YIJN 3AA2A 4RW4A 4M7YA 3U6FA 2E8AA 3J7ZO 3MMVA 2YKNA 2RF2A 4CHNA 2DFEA 2XY6A 4BREA 3UKRB 3K5MA 4IJNA 1XWLA 3D7EO 1KRPA 1BGXT 4B8AB 5BRHA 3CCLN 5M1PA 3CCSN 3S41A 4QOZB 1D9FA 3TTFA 4WF9L 5J2MA 3QEPA 3PO5A 2ZD1A 5AJ3K 2W41A 3FZFA 3QERA 5AZJB 2CGJA 2HW3A 1NGHA 3A5OC 2HBLA 3RR8A 4M63C 5E26A 4AHSA 3E9OA 3K0SA 4KB1A 1G15A 2P9PA 1JLFA 4MLEA 4HUGA 3PO4A 1UAXA 3J7YP 4LFCK 4FL9A 4IFVA 4I2PA 4DQPA 2O4GA 2P9UB 2E1YA 3ZSVA 3OW2M 2VWKA 5KPZA 4C8OA 5JS2A 2NUBA 4LFAK 1NGJA 3IRXA 4AHUA 1SS6A 4RTFD 4CW7B 1NK0A 4B9NA 3U3GA 3FFKB 5C42A 1P90A 1TYQB 5BPLA 3AARA 3PY8A 3M1FA 3MECA 3WXIA 3HPOA 4DSEA 2OANA 3DXKA 1YUWA 3QEWA 3QBWA 3WNHA 1RT1A 3AVAA 1C0FA 2KFZA 2VYPA 2O8BA 4Y0WA 3SAFA 4NXNK 3HM9A 1YF5L 4J2DA 3OA9A 3O3FA 1M1KO 1NKEA 1TKZA 4QAGA 3RMAA 1JCEA 3L0QA 3OYAA 4M3WA 2G8FA 4F3TA 5BRFA 3G71N 1TKDA 1VSFA 3N4QA 3IUCA 3P5JA 5JVHL 4JEPA 2OA8A 4KPYA 3HPGA 2P9SB 3EKSA 1ZBIA 3KWIA 4C23A 2YHYA 1IG8A 3G4SN 5AQRA 3BZKA 4BGBA 2UXDK 1S5JA 4AHRA 1NGBA 5ADXA 3ZEUB 1EX4A 3LP1A 4DCHA 4U67L 3KD5E 2PFUA 4BG9A 3ZETA 4CJ4A 1BO5O 1V4SA 5AQMA 3HZ6A 4CF1A 4OPJA 1NJXA 2PBDA 4F8RA 4ELTA 4JNEA 1RDAA 4CJVA 2R7YA 3BZCA 4Z4FA 2D1KA 5EX5A 4CZEA 5C2FA 3OTOK 4FWRA 4HHTA 4H4OA 1HPMA 2HHWA 4CGDA 4BR2A 4YDUC 2O8EA 3DRPA 5MLCQ 3V9WA 3A0IX 3AAQA 3LPTA 1QQCA 1GLEG 4E1NA 1BQMA 2HOEA 3M6GA 3U9ZA 3G25A 1S3XA 1KD1O 2QA4N 4FJHA 2P9KA 2BGGA 5AQPA 3VOVA 3LL3A 2HNZA 3LPUA 1NM1A 3ISNC 4DTUA 4CERA 3O9SA 2ZM6K 5GINA 1RBUA 3J8AA 3HOTA 3CCMN 4DV6K 1WB9A 4CK2A 3WXKA 1S9EA 3QNOA 4CJWA 1C0GA 1NKCA 4B9SA 5KGXA 3C6AA 4CZKA 4CFDA 3CCQN 5C2DA 3VF2A 1ZXOA 5IWAK 3ZSZA 1HX1A 2D0PA 4ILHA 4E1JA 1Q9YA 3NH1A 4JI5K 1J6ZA 1BIZA 4I7FA 4DV5K 4FLVA 3DLEA 4DKWA 3H45C 4BE1A 4LF5K 3AO4A 3L3UA 2CH5A 2P9LB 3NE6A 3SNNA 3THYA 1N5YA 4W5OA 3VQBA 3RVCA 3CJ7A 3FFIA 4QS9A 3KK7A 2JGUA 2E2QA 4FWSA 4L3QA 1HPZA 4CF0A 1T44A 3OS0A 4CJQA 4JYAK 3SYZA 3QIPA 3C6HA 4IXCA 1TK0A 1LV5A 4DV7K 3VQ9A 4CZIA 4CF8A 3RMBA 4CJ3A 3CQXA 3KLFA 1RT3A 4IG3A 3LWLA 4DTMA 3HP6A 2EX3A 3HO1A 2ZGZA 1WSIA 3CERA 4XH4A 1J53A 4K0KK 2PAVA 5LL6Z 3T1AA 2KKZA 3TAGA 1U2VB 3QBXA 5C15A 1RTJA 2PZSA 5GIPA 2W42A 3QDKA 3VA3A 3ZX2A 4FJ9A 4CF2A 1XNRK 2DFHA 3EO3A 1XMOK 1NK7A 1S72N 2G8KA 4BY9C 4E7IA 4O44A 4RW7A 4O8UA 4RW8A 1YJWN 1R59O 3L2VA 4DU1A 5AZIA 3AVCA 4O4GA 1FKOA 4E7HA 4YY3K 3AGKA 4I6MB 1NK8A 2A40A 3VF6A 1NU0A 3FLCO 5ADXH 4CJRA 1D9DA 4ICLA 2HF3A 1NK9A 1TYQA 1MWKA 4PY5A 1FJGK 2QKKA 3H1QA 5J2PA 1VSJA 4FWLA 4AILC 4LF7K 1S22A 1LW2A 4DLGA 3WEEA 1T6DA 3CXCM 4BDPA 1LOTB 4H0YB 2VCPA 4CIGA 1W9HA 5E41A 4JI1K 4PA1A 3R8EA 4Y1CA 1NGDA 1QQNA 1OVQA 4EP5A 1ZBHA 3B6PA 4DTNA 3TAPA 1C0UA 4BVPA 3V9ZA 1MA9B 3AVMA 2OPPA 4FLYA 4OX9K 3TARA 5CZ1A 4R5PA 2ZF5O 4XEIA 3HVRA 1T03A 3LDSA 4FLZA 1L5UA 4NYFA 2XRIA 4DFKA 1CZAN 1VRTA 1TAUA 1VK0A 4X65K 1JL2A 4XH1A 1KAYA 2WOMA 3I33A 2ITGA 3UIQA 2ATQA 4JKAA 2PYJA 1RBTA 2X6SA 3SK3A 4N41A 1J5EK 1B9DA 3L2UA 2G8HA 4FWKA 3ID6A 3EKUA 2FLOA 1I3AA 4CEBA 4FM0A 3VQQA 1SZ2A 1IO2A 2E88A 4BRQA 1IKVA 1BCOA 3SAGA 1BG3A 2IOCA 4KB0A 3G10A 1GLFO 5BN8A 3G6EN 4KKOA 1X3NA 3OBYA 1LCUA 3TI0A 5HLFA 5AQUA 5FRMA 2G8VA 4LF9K 4IFEA 2XY5A 4RW6A 3NHGA 2DY4A 4LD0A 1D4XA 1N8RO 1VHXA 3AO2A 4ISFA 3KIOA 4C8LA 3KHYA 3THXA 1TKXA 1KAZA 3EZ5A 3R1XA 3CC4N 4OLAA 2ETJA 4Z4HA 3DXMA 1RFQA 4B3OA 1N32K 4BDZA 4M3ZA 1QSSA 4B1VA 3KWGA 3GL1A 2P9PB 4B1ZA 4H0TB 2FF6A 3DLRA 3ZT2A 4CBXA 3WNFA 4JHDA 4Z94A 3L4IA 4H0VB 3LZJA 1HYZA 4FXDA 4B9QA 4CI6A 4NYNA 3SPZA 2QKBA 4B1XB 2W6LA 4BRCA 1KFSA 2A6AA 3VQDA 4H5NA 4YOXA 4H0XB 1JXBA 4A57A 3BDPA 3O80A 1VQ7N 2P9LA 3OYDA 4YOYA 4CK3A 4OKEA 3OY9A 1ZBSA 1BCMA 3O8MA 2YHAA 4DR7K 4GNIA 4DR5K 2QWLA 3CCJN 2NRTA 2I7NA 3THWA 4XH5A 3S9HA 4DQ8A 3QEXA 1EWQA 4J2AA 1N34K 3MN5A 4BR0A 3KTQA 1ZYQA 3O4WA 3OJSA 1GLAG 5F0XA 3M3ZA 2VGMA 4GKKK 2RE2A 3DXKB 3I55N 5AQLA 4KHYA 1S1TA 5M1QA 3L2WA 4IFYA 4CJLA 1XUPO 3OYJA 2O8BB 3NBPA 5CE3A 4KV8A 1RBRA 2HNDA 4CJTA 4CESA 1VSEA 1KVAA 2YNHA 2HB5A 4IKFA 3MAQA 1KVCA 3VERA 1F21A 3OYFA 4OVLA 3EL2A 3OBWA 1WOQA 1MDUB 2HHUA 2HBMA 1KSPA 2AA4A 1WAFA 4DWIA 1WSJA 1HNIA 1TV6A 3GE1A 4QS8A 4BR5A 5HRPA 1OVYA 3CG7A 2ZE2A 5HRNA 4BRDA 1S9GA 4ILJA 1RT5A 4CHQA 4CF9A 4HWIA 4M3UA 4KRFA 2NNWA 4EP4A 4JI2K 2ZWHA 1JL1A 3FZHA 5ELZA 4FO0A 3QIOA 1WBBA 1X9WA 3T1HK 4FLUA 5FDLA 3FE1A 2VQEK 1RDUA 1BU6O 3GDQA 3SJHA 2YNGA 1B9FA 4FOEA 4IG0A 1U48A 1XI1A 4FWOA 1M90O 4DTPA 3MXMA 1XHZA 3AA3A 3A8YA 1TUUA 3H6EA 4DSLA 1NMDA 4DS4A 3TPQA 3R3LA 3AO1A 3HJFA 2O8EB 1ATNA 1VAZA 1RGIA 2NRVA 3P4IA 1QHTA 5J2NA 2O8DA 4H5WA 4AHTA 1WSGA 1SL1A 1NGIA 4JN4A 1REVA 3HBTA 3ID8A 5SWMA 4BC5A 2W6KA 4HTUA 1BHLA 2P51A 3GBTA 4IOAL 1I39A 2P9KB 5HRRA 4PWDA 1NK6A 4DQQA 2YJFA 2BUPA 3WUHA 3KVGA 4CEZA 4O0IA 4EHUA 4CJKA 3RTVA 3QESA 1K8AO 1HYSA 4FW2A 1NGAA 3A2FA 3Q7BA 1UA0A 4IWVA 4BG8A 2LSNA 5D3GA 3MWPA 4LY7A 5J1EA 3I8DA 4ID1A 5AQTA 3M8PA 4GV3A 3NMUA 4BE2A 3AVNA 3VF4A 3UE5A 1XMQK 3OYIA 1TKTA 3KK3A 5EVZA 5JLHA 3HM8A 3THYB 3OS2A 1SKWA 4WYBA 3BF1A 1W0HA 3RSEA 2BH1A 5M1KA 2Q0RA 4LSLA 1QQMA 3HVTA 4DUZK 4CJFA 4MO4A 3DLGA 4AHCA 4BRGA 3MK6A 5FPEA 3SMSA 1D8YA 4FM1A 4KFBA 3U9DA 5B8HA 4JK7A 4BQLA 1LWFA 1WAJA 4CHPA 3FZKA 4AM7A 2HBKA 3VQCA 5LY3A 4FPAA 1VRUA 3DWLA 4PUOA 4JV5K 5KI6A 1NNEA 2F7TA 1VQON 4BRAA 1ASUA 1X1PA 3CI5A 4E7JA 3T69A 4O55A 3VETA 4KTWA 2E6MA 2I7PA 1RDDA 3AGRA 3P1GA 1HUXA 5EU7A 4DTXA 2HHXA 1GLLO 2IDOA 4ZHRA 3L2RA 3VTHA 2IVOA 4PL7A 3D2EA 5FPMA 1X9SA 3SQ0A 1S1VA 5K14A 3MXJA 1TGOA 3HI0A 5AZIB 5JICA 1QZ5A 4RCHA 4B9LA 3SBTA 1VSIA 4OGCA 3L2QA 3LDNA 3DJCA 3FZLA 4M42A 3P31A 1QE1A 3NGIA 2NRZA 3PX6A 2PY5A 3CJCA 5I3UA 4KHNA 4FZZA 4RG8A 3J80O 1BQNA 2VGNA 1BA0A 4H03B 5CR4A 2OTLN 1VSMA 4IO8A 3F73A 4JS4A 4C1NI 4WFAL 3O1WA 5E84A 2HBJA 3HT3A 1RDBA 3WEEB 2QWQA 2ZJPL 4CZHA 3D2FA 4LSNA 3VQ5A 2WONA 3OYHA 3R9PA 1Z05A 1FW6A 2A42A 1SL0A 4JAXA 2A3ZA 4H0PA 1BA1A 1H1VA 4ZTFA 5KQDA 1XHXA 1T8EA 2ZGYA 4CJSA 4CZFA 4F3OA 2UXCK 2OPQA 4CEFA 2GX9A 1HNXK 3O5BA 2UUBK 1I94K 1SL2A 5FLXO 3O4NA 4DTOA 1W7AA 2VWBA 1TUYA 3IG1A 1EXQA 3MXIA 4ISGA 4V19S 3ZSYA 5LMUK 3LM2A 5AQOA 3O9QA 2UU9K 3AVHA 4DTJA 4BDYA 4FYDA 1BUPA 5BN9A 2GBZA 3DYAA 3O9RA 4FK0A 3MCPA 3CM5A 5I42A 3TSQA 3OYMA 3MWTA 1VQ8N 4JI0K 5LJWA 2E1ZA 3PSFA 3MN7A 3MX5A 4GKJK 1YVNA 5HRSA 2RPIA 4FZXC 4KHSA 1YJNN 2QXLA 3KK2A 5FROA 4FJKA 1ZBFA 1NBWA 1VQ9N 3Q7CA 1YT3A 4JI8K 4WFNL 1U49A 4OLBA 4ELUA 1HJRA 3A5MC 2FC0A 3NFAA 4E1MA 1LW0A 3THXB 4B1UB 1Q8IA 3EE9A 4OGEA 4NLCA 3K5OA 3EE8A 2E5LK 3DXMB 3CETA 2P5OA 4DLEA 4CHZA 2P1JA 4DSFA 2Q3SA 3IMXA 2HMPA 3LALA 3WT0A 3HSCA 4Z4CA 4XIUA 3QEIA 2ASMA 3LWMA 3MN6A 4JHDB 1CLQA 1NKBA 1DEJA 5IT9O 4AF1A 4KH4A 4W5NA 2F9WA 2QM1A 5F1XA 2ZJRL 1RCHA 4ILGB 1JCGA 3KZBA 4FWMA 1ESVA 3CC2N 3OS1A 4WCEL 3V1OA 1A5XA 1HKGA 1K8KA 4EAHD 4FPBA 1KC8O 3THWB 4UY8O 1S1XA 2GV9A 2D4WA 4MO5A 5AQXA 3OYLA 3DM2A 3WXLA 3VEYA 3OYBA 2RKIA 1VSKA 5C25A 4NXMK 2YV0X 2HHQA 3PUFA 3CCUN 3RMDA 4C8KA 4X64K 3I0SA 2DPNA 2CGKA 1IG9A 2OYQA 2EHGA 3FR0A 3NAEA 5BRDA 3THVA 4FJXA 3BF3A 4CZMA 3KKSA 1T3VA 3ENBA 1EKEA 2WUSA 4AM6A 1U47A 3PSIA 3V4IA 3CFOA 3VGKA 4FVUA 4RW9A 5KPTA 2AP1A 3CYMA 4KHUA 3FZMA 4C1NK 4BC3A 1RDWX 4HVJA 1VQLN 2CGLA 4CJ5A 3ZCMA 3OJUA 4G1QA 3U4LA 4X66K 4IJAA 3VN5A 4AHVA 2O8FA 3F9KA 3ZSQA 4JKCA 5DM6L 3V9UA 3H08A 5SZTA 4K25A 4NB4A 2ITMA 3CQ8A 4Y1DA 4BR7A 4DF8A 4ISEA 3O9TA 2VG7A 4JD2B 3SPYA 3TANA 3VQEA 3TSPA 1WSFA 1T7PA 2V7YA 3K5LA 4PKGA 2YHXA 3ZX3A 4A2AA 1NJIO 4JI4K 3K9JA 5EOYA 4MFBA 4J2BA 3LDPA 5TKYA 5GAGP 2H3GX 3D45A 3QMLA 3ZSOA 1ZBUA 2V7ZA 2O8DB 5AQVA 3L3VA 2GELA 3EN9A 4CHOA 3CF5L 3QLHA 4DSJA 4CZJA 4L8RB 1TK8A 1TAQA 1U4BA 4B3TK 2NRRA 3T7ZA 3DMJA 4CIEA 4DQRA 1NJZA 2P5GA 3E9LA 1WNSA 3LP3A 1NK5A 1JLCA 4KHWA 1DT9A 4BRKA 2QWNA 1GLDG 3K9KA 1IBLK 5AQSA 3ITHA 4EZ9A 4B9VA 1WBDA 2Z1JA 2B6AA 1VQMN 1IJJA 3H46O 4NO7A 5AQWA 4M41A 4CZGA 2WTUA 1J54A 4DU4A 1C1BA 3KKRA 3B6OA 4J8FA 4H5TA 5KRSA 4BC2A 1OH8A 1VQ5N 4LFBK 1NK4A 1C6VA 2HSTA 3VEOA 4FOIA 3WNGA 3ULEA 4BWMA 3RSEB 3MEEA 2PYLA 1B92A 1HQUA 3ZYYX 4IO9L 5BR8K 3HSTB 4IOXA 4DTRA 4OJRA 1YI2N 4JK9A 3HTVA 3CC7N 1GLCG 1HRHA 3QFPA 2XY8A 4EHTA 1HYVA 2V52B 4CJ7A 3U3YA 3DI6A 3IKMA 4CEOA 4DR4K 3VPZA 3LP2A 3NF7A 3VQ6A 4PL8A 1U6ZA 5FPDA 3P38A 4DR3K 2VWJA 3C7NB 4W5TA 2J4RA 3VGLA 4DV3K 2UYTA 4E19A 1IKWA 2VG6A 1JLGA 4B1WB 4CFAA 5M1NA 2G8WA 3SAHA 3D2EB 4CEEA 4CBUA 3SUPA 2KFNA 1BISA 3V9SA 1RT2A 1OH6A 3ZT0A 1N33K 3AAPA 3PIPL 4DFJA 1ASVA 1C1CA 1OH5A 1KLNA 5GIOA 3SV4A 4FJNA 3RRGA 2YJEA 3QNNA 3MCAB 1Q9XA 3OVNA 1ASWA 1YITN 4PKHA 4M3TA 4O8KA 3VEVA 1IBMK 5C12A 3CCEN 3IS9A 4E7KA 3H3NO 1T05A 3D2FB 5CZ2A 4CEAA 3JYTA 4KTZA 4Z0UA 4OPKA 4ELVA 2V51B 5I9EB 2HHSA 3HPHA 4DR6K 2A5XA 1WUAA 2GWJA 4NCAA 3GOIA 4CD3A 1Z6RA 3M5RA 3O6WA 1X9MA 4LH5A 1NLVA 1VQPN 1IV0A 2D5RA 3M8SA 4IEIA 3V6DA 4ZTJA 4CK1A 3VTIA 4E89A 4GV6A 4FJMA 4M3YA 2HMIA 3HL8A 2F8SA 4DFPA 1VSHA 4MDBA 3HXMA 4ID5A 4A2BA 4M3XA 4IDKA 4B9TA 4FSVA 4DB3A 4H8KA 4B3SK 2F96A 2ZQBA 5AQYA 1XNQK 4YOTA 5AFUA 5AQIA 2XY7A 1W97L 2QWPA 1JCFA 2BTFA 2JWLA 2Q36A 4JD2A 3G0ZA 1WN7A 3AVFA 4M45A 4I9QA 1W2BM 4K8XA 1QQOA 1NWKA 4DSIA 1J9AA 4NCGA 4N76A 4TSXA 4BRNA 1HMVA 3LAMA 3AO5A 3TSUA 2ZJQL 3JXUA 2G8UA 1DKGD 3MX2A 5JLFA 5LJVA 3TTCA 1XQSC 1JLEA 2HHTA 3OYNA 4E0DA 4DQSA 2RHKA 2QW9A 1KQSM 2KTQA 3DLHA 3CMAN 4K41A 3NDKA 3CMEN 4CD1A 3J7AP 4BRFA 2GUPA 2Z1IA 3QFUA 3KK1A 1EQYA 2FBXA 2KLAA 3ATVA 3D0PA 3UB5A 1FK9A 4IOCL 3K5NA 4CCHA 1MWMA 3NF8A 1QVFM 5EY4A 5BREA 2ASPA 3V9XA 1WSEA 1QSLA 5GADP 4IDHA 3ZT4A 1JLQA 4FJJA 3C65A 5AQJA 1C0TA 3H1VX 3IDHA 5F2RA 5C0YA 4DV0K 2FBVA 2FSJA 4K42A 1Q18A 3EZWA 1JKHA 4I9LA 5DK5A 3CCRN 4JI6K 1JJ2M 2XO7A 1TVRA 3T1YK 3AO3A 1RNHA 2G8IA 3T19A 1NOZA 1E4GT 3VENA 3K57A 3CJAA 4LF4K 1K8KB 4C8MA 3QETA 3SI6A 4FLTA 1TK5A 3MDQA 1YTAA 1Q82O 2NRXA 2P9IA 2OZSA 1ATRA 1IKXA 1S6QA 3NVKA 1YAGA 2Z1GA 3QEVA 3K59A 3R6MA 4BVOA 1QVGM 1LWEA 3D6RA 3E9PA 5FPNA 3O3HA 1E4FT 3O4QA 2F9TA 1HR0K 1S6PA 3ZSWA 3PV8A 3C7NA 4Z4GA 5GAHP 4KAZA 4KTQA 5BR9A 1SAZA 2WBNA 4A5AA 2IIRA 2O8CA 4B3MK 1VSLA 4HUEA 1Q86O 1VQ4N 4JKBA 4E3SA 3M8RA 3C0BA 3E1YA 4GVEA 3P83D 4JKEA 1KXPA 4KHPK 3SJJA 3OYKA 1E3MA 2FSNA 1C0MA 3O9UA 2O8FB 3FGUA 4OPHA 2WC9A 4RWTA 3A5LC 1LAWA 3TR8A 3SQ2A 3J81O 1Z26A 4CEDA 1VQNN 3C6TA 3WNEA 5AFUH 3TTDA 4CEQA 3JSMA 2YNFA 4FW1A 3ULDA 3HP9A 1BIUA 4JKFA 1K73O 2FSKA 1A5WA 4CGFA 3LDQA 4YORA 3IFRA 2UUCK 4QS7A 1SQKA 1Z25A 3WXMB 4IEEA 1NGGA 4KO0A 3VGMA 1L3TA 1KAXA 3ZT1A 1S1UA 1FXXA 3RRHA 1K9MO 1UOCA 2FF3B 2D0OA 2E2OA 5BPNA 1KTQA 4OO1J 3V81A 3P39A 1LWCA 4BGAA 2HVIA 1DTTA 1ZC6A 3WXJA 3EYZA 4OKKA 4DFMA 3I56N 5BPMA 1VQ6N 4EZ6A 1RBVA 4FJ5A 4FVMA 1G99A 4K8ZA 5C10A 3SV3A 2B4JA 4M3RA 3O1BA 1SKRA 4YOWA 3VA0A 3ZT3A 4PKIA 4JK8A 4N47A 4F2RA 4DR1K 1CXQA 1IH7A 4BRPA 2YHWA 3V1RA 2QI2A 3HOSA 3QB0A 3L4QA 3KJVA 3QO9A 2XHBA 4Q5VA 4CHYA 3NH0A 4B9MA 3WQTA 1GLBG 1YVUA 3LP0A 3ULEB 3CIPA 4FK2A 2I5JA 4CJPA 2FXUA 1FKPA 2IVPA 2OCEA 2W40A 2ASOA 3F9MA 4FCYA 4A5BA 1U04A 4FLXA 5AQNA 3SMPA 2Q0UA 3NF9A 4JKHA 3LDOA 2GWKA 3AY9A 1RTDA
chains in the Genus database with same CATH topology
2YKNA 2RF2A 4CHNA 2DFEA 2XY6A 1Y97A 3MEDA 4KHYA 1S1TA 1RT4A 3D45A 4DG1A 1XWLA 1WSHA 1ZBUA 2KQ2A 4IFYA 1D5AA 3ZSOA 4CJLA 3L2WA 3OYJA 1J5OA 1BGXT 4B8AB 1KRPA 3L3VA 3NBPA 4KV8A 4QOZB 1D9FA 4CHOA 1RBRA 1CZ9A 2HNDA 5J2MA 3QEPA 3OYCA 3PO5A 4CJTA 3QLHA 4CESA 1VSEA 1KVAA 2ZD1A 3DLKA 4C8NA 1ZYQA 4DSJA 4L8RB 4KI6A 2YNHA 2HB5A 3QERA 4YNQA 1TK8A 1TAQA 3PX0A 1U4BA 2HW3A 3DMJA 3RR8A 4CIEA 4IKFA 3MAQA 1A5VA 1KVCA 1F21A 2RN2A 5C24A 4AHSA 3OYFA 4BE0A 3CM6A 4KB1A 1G15A 4OVLA 4DQRA 4KHQA 4CECA 1NJZA 2P5GA 2GUIA 2HHUA 1WNSA 1JLFA 2B5JA 3LP3A 1NK5A 1JLCA 1WAFA 1KSPA 1WSJA 4HUGA 4DWIA 1HNIA 1TV6A 5HRPA 1BI4A 1UAXA 4B8CA 3PO4A 4FJLA 2KZZA 3DOKA 3CG7A 2ZE2A 5HBMA 4IFVA 5HRNA 2BANA 4I2PA 4DQPA 3ITHA 1S9GA 4DMNA 4EZ9A 4B9VA 1RT5A 2O4GA 1LAVA 4CF9A 4CHQA 5HROA 2Z1JA 4M3UA 4GW6A 3ZSVA 3NF6A 4KRFA 2B6AA 1KCFA 4EP4A 4M41A 1J54A 4DU4A 1JL1A 2VWKA 3VQAA 4C8OA 1C1BA 3AVLA 3KKRA 3B6OA 3QIOA 5KRSA 4E7LA 1X9WA 1EETA 3CFRA 1R0AA 5JS2A 2NUBA 1NK4A 4FLUA 5FDLA 1C6VA 1TL1A 2DTUA 3T3FA 3NGZA 4GMJB 3WNGA 3IRXA 4AHUA 1HNVA 2YNGA 3QINA 1B9FA 4BWMA 4IG0A 3MEEA 1U48A 1XI1A 4N56A 1NK0A 4B9NA 4IBNA 3U3GA 4DTPA 3MXMA 2PYLA 1B92A 1XHZA 5C42A 1HQUA 3AA3A 3K2PA 4CGHA 1QTMA 4DSLA 3PY8A 3ZSRA 2IAJA 2DFFA 3LANA 3MECA 3HSTB 4DS4A 3AO1A 2BE2A 2QK9A 3HPOA 4DTRA 3HJFA 4DSEA 1HQEA 4MQ3A 3KLIA 4OJRA 1JLAA 3QEWA 3C94A 3WNHA 1QHTA 4UQGA 4DS5A 3NH2A 5J2NA 4FJGA 1RT1A 3AVAA 2KFZA 1HRHA 1GOBA 4I2QA 3L8BA 4AHTA 1WSGA 1SL1A 1GOCA 2XY8A 3HM9A 1HYVA 1REVA 4CIFA 5SWMA 3U3YA 4J2DA 4HTUA 3DI6A 3O3FA 5HP1A 1BHLA 2P51A 1TKZA 4QAGA 3RMAA 4CEOA 1NKEA 1NOYA 4FZYA 3LP2A 3NF7A 1I39A 3VQ6A 5HRRA 3OYAA 3KLHA 4BACA 1NK6A 4M3WA 4PWDA 4CJEA 2G8FA 4F3TA 4DQQA 2VWJA 4KHWA 2A1SA 1TKDA 1VSFA 2AJQA 4CEZA 4OKJA 4O0IA 4W5TA 1SKSA 3TWHA 4CJKA 3RTVA 3QESA 1HYSA 3P5JA 4FW2A 4E19A 1IKWA 2VG6A 4Q0BA 2OA8A 1JLGA 3DLBA 3A2FA 4CFAA 4KPYA 3HPGA 3TAFA 2G8WA 1ZBIA 1UA0A 4CEEA 3SUPA 2KFNA 1BISA 1C1AA 2LSNA 5D3GA 3V9SA 1RT2A 4LY7A 3ZT0A 4GVMA 5J1EA 3I8DA 1GOAA 1ASVA 4HUFA 1C1CA 4ID1A 4DFJA 5DMRA 3M8PA 4FK4A 4BE2A 3AVNA 1S5JA 1KLNA 4AHRA 2E4LA 1EX4A 3LP1A 3SV4A 4FJNA 3RRGA 4WE1A 3QNNA 3OYIA 3KD5E 1TKTA 3KK3A 4CJ4A 1ZBLA 1Q9XA 3OVNA 1ASWA 3OS2A 3OYGA 1SKWA 2D0AA 4CFBA 4CF1A 4OPJA 4M3TA 1W0HA 1NJXA 4F8RA 4ELTA 3SQ4A 3IS9A 1RDAA 4LSLA 3HVTA 4CJVA 4E7KA 3AVGA 2R7YA 4CJFA 4Z4FA 4FLWA 1U45A 1L3SA 1T05A 1UWBA 3DLGA 4AHCA 4KREA 5CZ2A 1D8YA 4CEAA 4HHTA 3JYTA 4FM1A 4KFBA 4H4OA 4KTZA 2HHWA 4CGDA 4Z0UA 3DRPA 4OPKA 3V9WA 4ELVA 3KLGA 1LWFA 1WAJA 3HPHA 2HHSA 3M8QA 4CHPA 3IAYA 3K5MA 3LPTA 2HVHA 3VQCA 4NCAA 1VRUA 4E1NA 4DSKA 4PUOA 5KI6A 1BQMA 5T7BA 1ASUA 3C6UA 1X1PA 1X9MA 4E7JA 4FJHA 5JS1A 4LH5A 4O55A 2BGGA 2D5RA 2KW4A 2HNZA 3LPUA 4KTWA 3M8SA 2E6MA 3V6DA 3ISNC 4DTUA 1RDDA 4CERA 4ZTJA 3P1GA 4CK1A 4E89A 1RBUA 2IGIA 2X74A 5EU7A 4FJMA 4DTXA 2HMIA 4M3YA 1RILA 3HL8A 3SZ2A 4DFPA 1VSHA 2IDOA 4CK2A 4ZHRA 3L2RA 3LZIA 1MU2A 2F8SA 1S9EA 4ID5A 4CJWA 3HXMA 3QNOA 4M3XA 4IDKA 1NKCA 3CFPA 4B9SA 4B9TA 5KGXA 4H8KA 1X9SA 3TAMA 2F96A 1S1VA 2ZQBA 3SQ0A 3TAQA 4CFDA 2E6LA 5K14A 3ZSZA 1WLJA 3MXJA 1Q9YA 3NH1A 1TGOA 2XY7A 3EY1A 1QSYA 4B9LA 1BIZA 1RTIA 4I7FA 1VSIA 4OGCA 3DLEA 1WN7A 3AVFA 3G0ZA 3L2QA 1EP4A 4BE1A 4FLVA 4M42A 3NGYA 4M45A 4I9QA 1DTQA 3AO4A 3L3UA 4K8XA 4NCBA 1QE1A 2X78A 3NGIA 3NE6A 3PX6A 3SNNA 2BDPA 2PY5A 4DSIA 1J9AA 4NCGA 4N76A 4PQUA 5I3UA 4KHNA 4TSXA 1N5YA 4W5OA 3VQBA 4FZZA 4RG8A 1ITGA 1BQNA 1HMVA 3LAMA 2HHXA 3FFIA 3AO5A 1VSMA 3F73A 4JS5A 4JS4A 2JGUA 2G8UA 3HT3A 1RDBA 3I0RA 1JLEA 5KGWA 4W5QA 1HPZA 4LSNA 2WONA 3VQ5A 4CF0A 3OYHA 2HHTA 3BGRA 2YKMA 3OYNA 1SL0A 3OS0A 3RR7A 4E0DA 4DQSA 4CGIA 4ZTFA 4CJQA 1TL3A 2KTQA 3ZSXA 3DLHA 1XHXA 3SYZA 3QIPA 1T8EA 1TK0A 1K6YA 4CJSA 1LV5A 4F3OA 3AVJA 3NDKA 2OPQA 4B08A 3VQ9A 4CEFA 4CJUA 4CF8A 3RMBA 4CJ3A 3KLFA 2Z1IA 1RT3A 1SV5A 4IG3A 3LWLA 4DTMA 1CZBA 3KK1A 3K58A 2Y1IA 2FBXA 3HP6A 5CY4A 2EX3A 3D0PA 3HO1A 1WSIA 3HYFA 1FK9A 1SL2A 3K5NA 3O4NA 4DU3A 4CCHA 1J53A 4DTOA 2A1RA 1NJYA 1JLBA 3NF8A 3IG1A 3T1AA 3V9XA 1EXQA 1WSEA 3MXIA 3TAGA 1QSLA 2IS3A 3ZT4A 3VQ4A 1JLQA 3ZSYA 4FJJA 1RTJA 1S1WA 2PZSA 2W42A 1C0TA 3VA3A 4FJ9A 2HHVA 4CF2A 2YHBA 2DFHA 3AVHA 4DTJA 4BDYA 4FYDA 1O1WA 1NK7A 2G8KA 2FBVA 2GBZA 4E7IA 4F2SA 3DRRA 3DYAA 4O44A 4FK0A 4I9LA 1JKHA 5DK5A 4JRPA 4RW7A 1JXEA 3CM5A 4RW8A 3VQPA 4AH9A 5I42A 4DU1A 3OYMA 3L2VA 3AVCA 4O4GA 3S3NA 1FKOA 2XO7A 1TVRA 4E7HA 3AO3A 1RTHA 1RNHA 1NK8A 2G8IA 3T19A 1NOZA 4KI4A 3K57A 4CJRA 1D9DA 3AV9A 3AVIA 4C8MA 3QETA 3SI6A 4ICLA 5HRSA 2RPIA 4FZXC 4KHSA 4FLTA 1TK5A 4FJIA 4FXDA 3U6FA 1NK9A 3KK2A 5FROA 4FJKA 1YTAA 4PY5A 1QS4A 2QKKA 1ZBFA 4FJ7A 3E01A 4B9UA 3V1QA 5J2PA 1VSJA 2OZSA 4AILC 2D0CA 2VG5A 1YT3A 1IKXA 1S6QA 1LW2A 2IC3A 4DLGA 1U49A 2Z1GA 4OLBA 2HNYA 3QEVA 1HJRA 4BDPA 3K59A 4ELUA 2FC0A 4JRQA 3O3GA 3NFAA 1LWEA 4CE9A 4E1MA 1LW0A 1RT6A 4CIGA 1W9HA 5E41A 4DTSA 3O3HA 3TAEA 2Y1JA 1Q8IA 4PA1A 3O4QA 4Y1CA 4JLHA 4OGEA 4YFUA 1S6PA 3ZSWA 3K5OA 4EP5A 1ZBHA 3B6PA 4DTNA 3PV8A 1C0UA 3TAPA 4DLEA 4CHZA 2P5OA 3V9ZA 1NJWA 2P1JA 3AVMA 2Q3SA 4DSFA 3S3MA 4Z4IA 2OPPA 4Z4GA 4CGJA 4FLYA 4KAZA 1RBSA 3TARA 4KTQA 3LALA 5CZ1A 4O5BA 4CGGA 4R5PA 4Z4CA 4XIUA 3HVRA 1VSLA 3QEIA 1T03A 3LDSA 4HUEA 3SCXA 4FLZA 4E3SA 1L5UA 4NYFA 2XRIA 3M8RA 4DFKA 3LWMA 5FRNA 1VRTA 1TAUA 1CLQA 3P83D 1VK0A 2FBTA 3KLEA 1JL2A 1NKBA 2X6NA 2D0BA 3SJJA 2WOMA 3OYKA 1L3UA 1C0MA 3DRSA 2OPRA 4W5NA 2OZMA 2YNIA 2ITGA 3UIQA 2ATQA 2PYJA 1RBTA 2X6SA 3VQ7A 1UA1A 1RCHA 4W5RA 4N41A 1LAWA 1RT7A 3TR8A 3SQ2A 1Z26A 1B9DA 4CEDA 3C6TA 3WNEA 3L2UA 5J2QA 1IKYA 3OS1A 5KRTA 2F8TA 2G8HA 3NCIA 2QXFA 3V1OA 4CEQA 3JSMA 1A5XA 2YNFA 1RDCA 1I3AA 4FW1A 4CEBA 3PX4A 3ULDA 4FM0A 3VQQA 1IO2A 3HP9A 1IKVA 1BCOA 2Z1HA 1BIUA 3AA5X 1S1XA 2GV9A 1A5WA 2JLEA 3SQ1A 1XC9A 4HCBA 4CGFA 2IOCA 3DM2A 4N5SA 3OYLA 3RWUA 4KB0A 4HCCA 3OYBA 3G10A 2RKIA 1VSKA 5C25A 1CXUA 4KKOA 3TABA 3LAKA 3TI0A 1Z25A 5HLFA 2YV0X 2HHQA 5FRMA 3DOLA 3PUFA 2G8VA 3RMDA 3SUNA 2XY5A 4C8KA 4RW6A 3I0SA 4KO0A 3NHGA 2DY4A 4LD0A 1L3TA 1IG9A 3KD1E 2OYQA 2EHGA 3AO2A 4CFCA 3ZT1A 3KIOA 3NAEA 3SUQA 3RMCA 3THVA 1S1UA 4C8LA 4FJXA 2KZMA 1FXXA 1TKXA 3RRHA 3KKSA 3EZ5A 4B9MA 4FJ8A 4F4KA 3ALYA 4BWJA 1UOCA 3SUOA 4OLAA 2ETJA 1EKEA 4O0JA 4Z4HA 1KTQA 4B3OA 3V81A 1LWCA 4BDZA 4M3ZA 4DQIA 2HVIA 1DTTA 3ASMA 1QSSA 1U47A 3V4IA 3EYZA 3CFOA 4OKKA 4DFMA 4RW9A 3MEGA 4EZ6A 1RBVA 4FJ5A 3S3OA 4FVMA 3CYMA 4KHUA 5CYQA 4K8ZA 3DLRA 3SV3A 3ZT2A 4DF4A 1BI4B 2B4JA 4M3RA 3VQ8A 3WNFA 1YTUA 4HVJA 4H4MA 3AVBA 3LZJA 1VSDA 1SKRA 4CJ5A 3ZCMA 3VA0A 1HYZA 3OJUA 3ZT3A 4G1QA 1SUQA 3HK2A 1KFDA 4N47A 4F2RA 4NYNA 3SPZA 2QKBA 1CXQA 1IH7A 1N6QA 3VN5A 4AHVA 1KVBA 3F9KA 2O4IA 1KFSA 3V1RA 3AA4A 3VQDA 3ZSQA 1L3VA 3KJVA 1JXBA 3AVKA 3QO9A 2XHBA 4Q5VA 2FBYA 1BL3A 3V9UA 4CHYA 3BDPA 4J2EA 3H08A 3C95A 5SZTA 3NH0A 3OYDA 1KLMA 4CK3A 4OKEA 4FM2A 3OY9A 3CQ8A 4Y1DA 4DF8A 1YVUA 1BCMA 2VG7A 3LP0A 2YHAA 2OPSA 4FK2A 2I5JA 3SPYA 3VQEA 4CJPA 3TANA 1FKPA 1WSFA 1DLOA 4FCYA 1T7PA 4QCLA 4Z4EA 1U04A 5CYMA 3K5LA 5KTQA 4FLXA 3S9HA 3OYEA 3QEXA 4J2AA 3NF9A 4LH4A 3AA2A 4RW4A 3KTQA 4MFBA 4J2BA 1QQCA 3OJSA 1RTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKN A;  2RF2 A;  4CHN A;  2DFE A;  2XY6 A;  1Y97 A;  3MED A;  4KHY A;  1S1T A;  1RT4 A;  3D45 A;  4DG1 A;  1XWL A;  1WSH A;  1ZBU A;  2KQ2 A;  4IFY A;  1D5A A;  3ZSO A;  4CJL A;  3L2W A;  3OYJ A;  1J5O A;  1BGX T;  4B8A B;  1KRP A;  3L3V A;  3NBP A;  4KV8 A;  4QOZ B;  1D9F A;  4CHO A;  1RBR A;  1CZ9 A;  2HND A;  5J2M A;  3QEP A;  3OYC A;  3PO5 A;  4CJT A;  3QLH A;  4CES A;  1VSE A;  1KVA A;  2ZD1 A;  3DLK A;  4C8N A;  1ZYQ A;  4DSJ A;  4L8R B;  4KI6 A;  2YNH A;  2HB5 A;  3QER A;  4YNQ A;  1TK8 A;  1TAQ A;  3PX0 A;  1U4B A;  2HW3 A;  3DMJ A;  3RR8 A;  4CIE A;  4IKF A;  3MAQ A;  1A5V A;  1KVC A;  1F21 A;  2RN2 A;  5C24 A;  4AHS A;  3OYF A;  4BE0 A;  3CM6 A;  4KB1 A;  1G15 A;  4OVL A;  4DQR A;  4KHQ A;  4CEC A;  1NJZ A;  2P5G A;  2GUI A;  2HHU A;  1WNS A;  1JLF A;  2B5J A;  3LP3 A;  1NK5 A;  1JLC A;  1WAF A;  1KSP A;  1WSJ A;  4HUG A;  4DWI A;  1HNI A;  1TV6 A;  5HRP A;  1BI4 A;  1UAX A;  4B8C A;  3PO4 A;  4FJL A;  2KZZ A;  3DOK A;  3CG7 A;  2ZE2 A;  5HBM A;  4IFV A;  5HRN A;  2BAN A;  4I2P A;  4DQP A;  3ITH A;  1S9G A;  4DMN A;  4EZ9 A;  4B9V A;  1RT5 A;  2O4G A;  1LAV A;  4CF9 A;  4CHQ A;  5HRO A;  2Z1J A;  4M3U A;  4GW6 A;  3ZSV A;  3NF6 A;  4KRF A;  2B6A A;  1KCF A;  4EP4 A;  4M41 A;  1J54 A;  4DU4 A;  1JL1 A;  2VWK A;  3VQA A;  4C8O A;  1C1B A;  3AVL A;  3KKR A;  3B6O A;  3QIO A;  5KRS A;  4E7L A;  1X9W A;  1EET A;  3CFR A;  1R0A A;  5JS2 A;  2NUB A;  1NK4 A;  4FLU A;  5FDL A;  1C6V A;  1TL1 A;  2DTU A;  3T3F A;  3NGZ A;  4GMJ B;  3WNG A;  3IRX A;  4AHU A;  1HNV A;  2YNG A;  3QIN A;  1B9F A;  4BWM A;  4IG0 A;  3MEE A;  1U48 A;  1XI1 A;  4N56 A;  1NK0 A;  4B9N A;  4IBN A;  3U3G A;  4DTP A;  3MXM A;  2PYL A;  1B92 A;  1XHZ A;  5C42 A;  1HQU A;  3AA3 A;  3K2P A;  4CGH A;  1QTM A;  4DSL A;  3PY8 A;  3ZSR A;  2IAJ A;  2DFF A;  3LAN A;  3MEC A;  3HST B;  4DS4 A;  3AO1 A;  2BE2 A;  2QK9 A;  3HPO A;  4DTR A;  3HJF A;  4DSE A;  1HQE A;  4MQ3 A;  3KLI A;  4OJR A;  1JLA A;  3QEW A;  3C94 A;  3WNH A;  1QHT A;  4UQG A;  4DS5 A;  3NH2 A;  5J2N A;  4FJG A;  1RT1 A;  3AVA A;  2KFZ A;  1HRH A;  1GOB A;  4I2Q A;  3L8B A;  4AHT A;  1WSG A;  1SL1 A;  1GOC A;  2XY8 A;  3HM9 A;  1HYV A;  1REV A;  4CIF A;  5SWM A;  3U3Y A;  4J2D A;  4HTU A;  3DI6 A;  3O3F A;  5HP1 A;  1BHL A;  2P51 A;  1TKZ A;  4QAG A;  3RMA A;  4CEO A;  1NKE A;  1NOY A;  4FZY A;  3LP2 A;  3NF7 A;  1I39 A;  3VQ6 A;  5HRR A;  3OYA A;  3KLH A;  4BAC A;  1NK6 A;  4M3W A;  4PWD A;  4CJE A;  2G8F A;  4F3T A;  4DQQ A;  2VWJ A;  4KHW A;  2A1S A;  1TKD A;  1VSF A;  2AJQ A;  4CEZ A;  4OKJ A;  4O0I A;  4W5T A;  1SKS A;  3TWH A;  4CJK A;  3RTV A;  3QES A;  1HYS A;  3P5J A;  4FW2 A;  4E19 A;  1IKW A;  2VG6 A;  4Q0B A;  2OA8 A;  1JLG A;  3DLB A;  3A2F A;  4CFA A;  4KPY A;  3HPG A;  3TAF A;  2G8W A;  1ZBI A;  1UA0 A;  4CEE A;  3SUP A;  2KFN A;  1BIS A;  1C1A A;  2LSN A;  5D3G A;  3V9S A;  1RT2 A;  4LY7 A;  3ZT0 A;  4GVM A;  5J1E A;  3I8D A;  1GOA A;  1ASV A;  4HUF A;  1C1C A;  4ID1 A;  4DFJ A;  5DMR A;  3M8P A;  4FK4 A;  4BE2 A;  3AVN A;  1S5J A;  1KLN A;  4AHR A;  2E4L A;  1EX4 A;  3LP1 A;  3SV4 A;  4FJN A;  3RRG A;  4WE1 A;  3QNN A;  3OYI A;  3KD5 E;  1TKT A;  3KK3 A;  4CJ4 A;  1ZBL A;  1Q9X A;  3OVN A;  1ASW A;  3OS2 A;  3OYG A;  1SKW A;  2D0A A;  4CFB A;  4CF1 A;  4OPJ A;  4M3T A;  1W0H A;  1NJX A;  4F8R A;  4ELT A;  3SQ4 A;  3IS9 A;  1RDA A;  4LSL A;  3HVT A;  4CJV A;  4E7K A;  3AVG A;  2R7Y A;  4CJF A;  4Z4F A;  4FLW A;  1U45 A;  1L3S A;  1T05 A;  1UWB A;  3DLG A;  4AHC A;  4KRE A;  5CZ2 A;  1D8Y A;  4CEA A;  4HHT A;  3JYT A;  4FM1 A;  4KFB A;  4H4O A;  4KTZ A;  2HHW A;  4CGD A;  4Z0U A;  3DRP A;  4OPK A;  3V9W A;  4ELV A;  3KLG A;  1LWF A;  1WAJ A;  3HPH A;  2HHS A;  3M8Q A;  4CHP A;  3IAY A;  3K5M A;  3LPT A;  2HVH A;  3VQC A;  4NCA A;  1VRU A;  4E1N A;  4DSK A;  4PUO A;  5KI6 A;  1BQM A;  5T7B A;  1ASU A;  3C6U A;  1X1P A;  1X9M A;  4E7J A;  4FJH A;  5JS1 A;  4LH5 A;  4O55 A;  2BGG A;  2D5R A;  2KW4 A;  2HNZ A;  3LPU A;  4KTW A;  3M8S A;  2E6M A;  3V6D A;  3ISN C;  4DTU A;  1RDD A;  4CER A;  4ZTJ A;  3P1G A;  4CK1 A;  4E89 A;  1RBU A;  2IGI A;  2X74 A;  5EU7 A;  4FJM A;  4DTX A;  2HMI A;  4M3Y A;  1RIL A;  3HL8 A;  3SZ2 A;  4DFP A;  1VSH A;  2IDO A;  4CK2 A;  4ZHR A;  3L2R A;  3LZI A;  1MU2 A;  2F8S A;  1S9E A;  4ID5 A;  4CJW A;  3HXM A;  3QNO A;  4M3X A;  4IDK A;  1NKC A;  3CFP A;  4B9S A;  4B9T A;  5KGX A;  4H8K A;  1X9S A;  3TAM A;  2F96 A;  1S1V A;  2ZQB A;  3SQ0 A;  3TAQ A;  4CFD A;  2E6L A;  5K14 A;  3ZSZ A;  1WLJ A;  3MXJ A;  1Q9Y A;  3NH1 A;  1TGO A;  2XY7 A;  3EY1 A;  1QSY A;  4B9L A;  1BIZ A;  1RTI A;  4I7F A;  1VSI A;  4OGC A;  3DLE A;  1WN7 A;  3AVF A;  3G0Z A;  3L2Q A;  1EP4 A;  4BE1 A;  4FLV A;  4M42 A;  3NGY A;  4M45 A;  4I9Q A;  1DTQ A;  3AO4 A;  3L3U A;  4K8X A;  4NCB A;  1QE1 A;  2X78 A;  3NGI A;  3NE6 A;  3PX6 A;  3SNN A;  2BDP A;  2PY5 A;  4DSI A;  1J9A A;  4NCG A;  4N76 A;  4PQU A;  5I3U A;  4KHN A;  4TSX A;  1N5Y A;  4W5O A;  3VQB A;  4FZZ A;  4RG8 A;  1ITG A;  1BQN A;  1HMV A;  3LAM A;  2HHX A;  3FFI A;  3AO5 A;  1VSM A;  3F73 A;  4JS5 A;  4JS4 A;  2JGU A;  2G8U A;  3HT3 A;  1RDB A;  3I0R A;  1JLE A;  5KGW A;  4W5Q A;  1HPZ A;  4LSN A;  2WON A;  3VQ5 A;  4CF0 A;  3OYH A;  2HHT A;  3BGR A;  2YKM A;  3OYN A;  1SL0 A;  3OS0 A;  3RR7 A;  4E0D A;  4DQS A;  4CGI A;  4ZTF A;  4CJQ A;  1TL3 A;  2KTQ A;  3ZSX A;  3DLH A;  1XHX A;  3SYZ A;  3QIP A;  1T8E A;  1TK0 A;  1K6Y A;  4CJS A;  1LV5 A;  4F3O A;  3AVJ A;  3NDK A;  2OPQ A;  4B08 A;  3VQ9 A;  4CEF A;  4CJU A;  4CF8 A;  3RMB A;  4CJ3 A;  3KLF A;  2Z1I A;  1RT3 A;  1SV5 A;  4IG3 A;  3LWL A;  4DTM A;  1CZB A;  3KK1 A;  3K58 A;  2Y1I A;  2FBX A;  3HP6 A;  5CY4 A;  2EX3 A;  3D0P A;  3HO1 A;  1WSI A;  3HYF A;  1FK9 A;  1SL2 A;  3K5N A;  3O4N A;  4DU3 A;  4CCH A;  1J53 A;  4DTO A;  2A1R A;  1NJY A;  1JLB A;  3NF8 A;  3IG1 A;  3T1A A;  3V9X A;  1EXQ A;  1WSE A;  3MXI A;  3TAG A;  1QSL A;  2IS3 A;  3ZT4 A;  3VQ4 A;  1JLQ A;  3ZSY A;  4FJJ A;  1RTJ A;  1S1W A;  2PZS A;  2W42 A;  1C0T A;  3VA3 A;  4FJ9 A;  2HHV A;  4CF2 A;  2YHB A;  2DFH A;  3AVH A;  4DTJ A;  4BDY A;  4FYD A;  1O1W A;  1NK7 A;  2G8K A;  2FBV A;  2GBZ A;  4E7I A;  4F2S A;  3DRR A;  3DYA A;  4O44 A;  4FK0 A;  4I9L A;  1JKH A;  5DK5 A;  4JRP A;  4RW7 A;  1JXE A;  3CM5 A;  4RW8 A;  3VQP A;  4AH9 A;  5I42 A;  4DU1 A;  3OYM A;  3L2V A;  3AVC A;  4O4G A;  3S3N A;  1FKO A;  2XO7 A;  1TVR A;  4E7H A;  3AO3 A;  1RTH A;  1RNH A;  1NK8 A;  2G8I A;  3T19 A;  1NOZ A;  4KI4 A;  3K57 A;  4CJR A;  1D9D A;  3AV9 A;  3AVI A;  4C8M A;  3QET A;  3SI6 A;  4ICL A;  5HRS A;  2RPI A;  4FZX C;  4KHS A;  4FLT A;  1TK5 A;  4FJI A;  4FXD A;  3U6F A;  1NK9 A;  3KK2 A;  5FRO A;  4FJK A;  1YTA A;  4PY5 A;  1QS4 A;  2QKK A;  1ZBF A;  4FJ7 A;  3E01 A;  4B9U A;  3V1Q A;  5J2P A;  1VSJ A;  2OZS A;  4AIL C;  2D0C A;  2VG5 A;  1YT3 A;  1IKX A;  1S6Q A;  1LW2 A;  2IC3 A;  4DLG A;  1U49 A;  2Z1G A;  4OLB A;  2HNY A;  3QEV A;  1HJR A;  4BDP A;  3K59 A;  4ELU A;  2FC0 A;  4JRQ A;  3O3G A;  3NFA A;  1LWE A;  4CE9 A;  4E1M A;  1LW0 A;  1RT6 A;  4CIG A;  1W9H A;  5E41 A;  4DTS A;  3O3H A;  3TAE A;  2Y1J A;  1Q8I A;  4PA1 A;  3O4Q A;  4Y1C A;  4JLH A;  4OGE A;  4YFU A;  1S6P A;  3ZSW A;  3K5O A;  4EP5 A;  1ZBH A;  3B6P A;  4DTN A;  3PV8 A;  1C0U A;  3TAP A;  4DLE A;  4CHZ A;  2P5O A;  3V9Z A;  1NJW A;  2P1J A;  3AVM A;  2Q3S A;  4DSF A;  3S3M A;  4Z4I A;  2OPP A;  4Z4G A;  4CGJ A;  4FLY A;  4KAZ A;  1RBS A;  3TAR A;  4KTQ A;  3LAL A;  5CZ1 A;  4O5B A;  4CGG A;  4R5P A;  4Z4C A;  4XIU A;  3HVR A;  1VSL A;  3QEI A;  1T03 A;  3LDS A;  4HUE A;  3SCX A;  4FLZ A;  4E3S A;  1L5U A;  4NYF A;  2XRI A;  3M8R A;  4DFK A;  3LWM A;  5FRN A;  1VRT A;  1TAU A;  1CLQ A;  3P83 D;  1VK0 A;  2FBT A;  3KLE A;  1JL2 A;  1NKB A;  2X6N A;  2D0B A;  3SJJ A;  2WOM A;  3OYK A;  1L3U A;  1C0M A;  3DRS A;  2OPR A;  4W5N A;  2OZM A;  2YNI A;  2ITG A;  3UIQ A;  2ATQ A;  2PYJ A;  1RBT A;  2X6S A;  3VQ7 A;  1UA1 A;  1RCH A;  4W5R A;  4N41 A;  1LAW A;  1RT7 A;  3TR8 A;  3SQ2 A;  1Z26 A;  1B9D A;  4CED A;  3C6T A;  3WNE A;  3L2U A;  5J2Q A;  1IKY A;  3OS1 A;  5KRT A;  2F8T A;  2G8H A;  3NCI A;  2QXF A;  3V1O A;  4CEQ A;  3JSM A;  1A5X A;  2YNF A;  1RDC A;  1I3A A;  4FW1 A;  4CEB A;  3PX4 A;  3ULD A;  4FM0 A;  3VQQ A;  1IO2 A;  3HP9 A;  1IKV A;  1BCO A;  2Z1H A;  1BIU A;  3AA5 X;  1S1X A;  2GV9 A;  1A5W A;  2JLE A;  3SQ1 A;  1XC9 A;  4HCB A;  4CGF A;  2IOC A;  3DM2 A;  4N5S A;  3OYL A;  3RWU A;  4KB0 A;  4HCC A;  3OYB A;  3G10 A;  2RKI A;  1VSK A;  5C25 A;  1CXU A;  4KKO A;  3TAB A;  3LAK A;  3TI0 A;  1Z25 A;  5HLF A;  2YV0 X;  2HHQ A;  5FRM A;  3DOL A;  3PUF A;  2G8V A;  3RMD A;  3SUN A;  2XY5 A;  4C8K A;  4RW6 A;  3I0S A;  4KO0 A;  3NHG A;  2DY4 A;  4LD0 A;  1L3T A;  1IG9 A;  3KD1 E;  2OYQ A;  2EHG A;  3AO2 A;  4CFC A;  3ZT1 A;  3KIO A;  3NAE A;  3SUQ A;  3RMC A;  3THV A;  1S1U A;  4C8L A;  4FJX A;  2KZM A;  1FXX A;  1TKX A;  3RRH A;  3KKS A;  3EZ5 A;  4B9M A;  4FJ8 A;  4F4K A;  3ALY A;  4BWJ A;  1UOC A;  3SUO A;  4OLA A;  2ETJ A;  1EKE A;  4O0J A;  4Z4H A;  1KTQ A;  4B3O A;  3V81 A;  1LWC A;  4BDZ A;  4M3Z A;  4DQI A;  2HVI A;  1DTT A;  3ASM A;  1QSS A;  1U47 A;  3V4I A;  3EYZ A;  3CFO A;  4OKK A;  4DFM A;  4RW9 A;  3MEG A;  4EZ6 A;  1RBV A;  4FJ5 A;  3S3O A;  4FVM A;  3CYM A;  4KHU A;  5CYQ A;  4K8Z A;  3DLR A;  3SV3 A;  3ZT2 A;  4DF4 A;  1BI4 B;  2B4J A;  4M3R A;  3VQ8 A;  3WNF A;  1YTU A;  4HVJ A;  4H4M A;  3AVB A;  3LZJ A;  1VSD A;  1SKR A;  4CJ5 A;  3ZCM A;  3VA0 A;  1HYZ A;  3OJU A;  3ZT3 A;  4G1Q A;  1SUQ A;  3HK2 A;  1KFD A;  4N47 A;  4F2R A;  4NYN A;  3SPZ A;  2QKB A;  1CXQ A;  1IH7 A;  1N6Q A;  3VN5 A;  4AHV A;  1KVB A;  3F9K A;  2O4I A;  1KFS A;  3V1R A;  3AA4 A;  3VQD A;  3ZSQ A;  1L3V A;  3KJV A;  1JXB A;  3AVK A;  3QO9 A;  2XHB A;  4Q5V A;  2FBY A;  1BL3 A;  3V9U A;  4CHY A;  3BDP A;  4J2E A;  3H08 A;  3C95 A;  5SZT A;  3NH0 A;  3OYD A;  1KLM A;  4CK3 A;  4OKE A;  4FM2 A;  3OY9 A;  3CQ8 A;  4Y1D A;  4DF8 A;  1YVU A;  1BCM A;  2VG7 A;  3LP0 A;  2YHA A;  2OPS A;  4FK2 A;  2I5J A;  3SPY A;  3VQE A;  4CJP A;  3TAN A;  1FKP A;  1WSF A;  1DLO A;  4FCY A;  1T7P A;  4QCL A;  4Z4E A;  1U04 A;  5CYM A;  3K5L A;  5KTQ A;  4FLX A;  3S9H A;  3OYE A;  3QEX A;  4J2A A;  3NF9 A;  4LH4 A;  3AA2 A;  4RW4 A;  3KTQ A;  4MFB A;  4J2B A;  1QQC A;  3OJS A;  1RTD A; 
#chains in the Genus database with same CATH topology
 4WQ4 A;  1Y97 A;  3W0L A;  2NRW A;  2P9N A;  3MED A;  4AQY K;  1RT4 A;  5JMV A;  4DG1 A;  1WSH A;  2HHV A;  2KQ2 A;  1D5A A;  4YOU A;  1J5O A;  3CPE A;  4FWN A;  4BR4 A;  4KBO A;  1CZ9 A;  1HNZ K;  3UKU A;  3OYC A;  2Q31 A;  4C8N A;  3QIC A;  3DLK A;  4KI6 A;  4YNQ A;  4H5V A;  1HLU A;  3PX0 A;  2E2N A;  1A5V A;  4BE0 A;  2RN2 A;  5C24 A;  3VEX A;  3CM6 A;  4KHQ A;  4CEC A;  2KHO A;  2GUI A;  4MLH A;  4LF6 K;  2B5J A;  3CPW M;  2KZZ A;  3NVM A;  1BI4 A;  4FJL A;  4B8C A;  3CD6 N;  3DOK A;  2A41 A;  5HBM A;  2BAN A;  4DMN A;  1LAV A;  4JKG A;  5HRO A;  3BP8 A;  4GW6 A;  3NF6 A;  1KCF A;  3VQA A;  3AVL A;  1HKB A;  3GG4 A;  4E7L A;  1EET A;  3CFR A;  1R0A A;  1TL1 A;  2DTU A;  3T3F A;  3NGZ A;  4GMJ B;  5M1F A;  1HNV A;  3QIN A;  3CQY A;  4N56 A;  4MDA A;  4IBN A;  2Q1N A;  4WQ5 A;  3K2P A;  1QTM A;  4B1Y B;  4CGH A;  4EIA A;  1YXQ A;  3JAM O;  3ZSR A;  2IAJ A;  2DFF A;  3LAN A;  3EEQ A;  2BE2 A;  2QK9 A;  5A2Q O;  1HQE A;  4MQ3 A;  4A59 A;  3KLI A;  1JLA A;  5H1S Q;  4B3R K;  3C94 A;  3PIO L;  4UQG A;  4NLB A;  3LDL A;  3UKR A;  3NH2 A;  4DS5 A;  1X3M A;  4FJG A;  3TU5 A;  1GOB A;  4I2Q A;  1T6C A;  4CBW A;  3L8B A;  1GOC A;  4CIF A;  3VMF B;  5HP1 A;  1NOY A;  4FZY A;  4BAC A;  3KLH A;  1P8Z A;  4BC4 A;  5CHI A;  4KH5 A;  5AZJ A;  1Y64 A;  4CJE A;  2A1S A;  5JVG L;  2AJQ A;  4OKJ A;  1SKS A;  3TWH A;  3N4P A;  4R79 A;  4Q0B A;  1NGE A;  3DLB A;  5AQZ A;  3TAF A;  2QWM A;  4LC9 B;  1C1A A;  2JWK A;  4GVM A;  4HUF A;  1GOA A;  4JI7 K;  4H5R A;  4H0O A;  5DMR A;  4FK4 A;  2P9U A;  5HL7 L;  2E4L A;  2YCH A;  1VQK N;  3ZLJ A;  4WE1 A;  1YHQ N;  2NZT A;  1ZBL A;  1DGK N;  4DV1 K;  1ILY A;  3OYG A;  2D0A A;  4CFB A;  4YHH K;  3SQ4 A;  2HHH K;  2GTD A;  3AVG A;  4K43 A;  4FLW A;  1U45 A;  1L3S A;  4KRE A;  1UWB A;  1YJ9 N;  3A5N C;  3KLG A;  3M8Q A;  3IAY A;  2HVH A;  2CH6 A;  4BR9 A;  3ENO A;  4DSK A;  4PHT X;  5DM7 L;  5T7B A;  1Q7Y O;  3JS6 A;  4DR2 K;  4M7X A;  3SBG A;  3C6U A;  5JS1 A;  5HOO A;  2KW4 A;  4HTL A;  2OTJ N;  2IGI A;  2X74 A;  4KH6 A;  1RIL A;  3SZ2 A;  3LZI A;  1MU2 A;  2P9S A;  3U8X A;  3CFP A;  3VEW A;  3TAM A;  1V4T A;  3TAQ A;  1HNW K;  2E6L A;  5TKW A;  1WLJ A;  3O08 A;  1QZ6 A;  4JI3 K;  3EY1 A;  1QSY A;  3CHW A;  4CVN E;  1RTI A;  5AQQ A;  3F5T A;  3ZEU A;  1O13 A;  1EP4 A;  2YI1 A;  3DAW A;  1NGF A;  3HRG A;  3NGY A;  1DTQ A;  4NCB A;  2X78 A;  2VQF K;  2BDP A;  4PQU A;  5M1O A;  1ITG A;  5EXW A;  3BUZ B;  4A62 A;  3F2K A;  4BRH A;  4JS5 A;  2P9I B;  4DV4 K;  3ENH A;  2IVN A;  3I0R A;  5KGW A;  4W5Q A;  2HF4 A;  3BGR A;  2YKM A;  3CJB A;  3RR7 A;  4LF8 K;  2F4V K;  4CGI A;  1TL3 A;  3ZSX A;  3ZX0 A;  1K6Y A;  3AVJ A;  3BY5 A;  4B08 A;  4CJU A;  4DUY K;  4OPA A;  4F9O A;  1SV5 A;  2UUA K;  1CZB A;  3K58 A;  2Y1I A;  2NRH A;  5CY4 A;  3HYF A;  5AR0 A;  4DU3 A;  2A1R A;  1NJY A;  1JLB A;  2O8C B;  1OKJ A;  2IS3 A;  4G9Z A;  3VQ4 A;  1S1W A;  1OH7 A;  2YHB A;  1O1W A;  3H3O B;  4F2S A;  3DRR A;  2QWR A;  4JRP A;  1JXE A;  2GEM A;  3VQP A;  4AH9 A;  1BWF O;  2UXB K;  3S3N A;  1EWR A;  1QHA A;  1RTH A;  4WQ4 C;  2Q97 A;  5AQK A;  4KI4 A;  3AV9 A;  3AVI A;  3VEZ A;  4FJI A;  3LM9 A;  1QS4 A;  2EWS A;  4FJ7 A;  3E01 A;  4B9U A;  3V1Q A;  3OHR A;  3E66 A;  1IBK K;  2D0C A;  2VG5 A;  2IC3 A;  5AQH A;  2HNY A;  1Q81 O;  1BDG A;  4BRM A;  4JRQ A;  3O3G A;  3CJ9 A;  4BRL A;  3VES A;  4CE9 A;  4WFB L;  1RT6 A;  4DTS A;  3TAE A;  2Y1J A;  4JLH A;  4YFU A;  3CJ1 A;  4BRO A;  1NJW A;  3S3M A;  4Z4I A;  1GLJ O;  4CGJ A;  1NMN A;  1RBS A;  4YDU A;  4O5B A;  4CGG A;  3W3D A;  3WQU A;  5LMN K;  3SCX A;  1U2V A;  4IZ9 A;  4YOV A;  1N36 K;  5KQ8 A;  4EFH A;  5FRN A;  2FBT A;  3KLE A;  1EO1 A;  3ATU A;  2X6N A;  2NLX A;  2D0B A;  1L3U A;  3DRS A;  2OPR A;  2OZM A;  3B8A X;  2YNI A;  4WQ5 C;  4A61 A;  3VQ7 A;  1UA1 A;  4W5R A;  1RT7 A;  3CCV N;  5J2Q A;  1IKY A;  5KRT A;  2F8T A;  3BEX A;  3NCI A;  4I6M A;  2QXF A;  5KPR A;  4DHY A;  2QEX N;  1BOT O;  1RDC A;  3PX4 A;  3ZET B;  2Z1H A;  3AA5 X;  5AQG A;  2JLE A;  3SQ1 A;  1XC9 A;  4HCB A;  4N5S A;  3RWU A;  4HCC A;  4DV2 K;  2WFB A;  1CXU A;  3TAB A;  3LAK A;  1XC3 A;  3DOL A;  2P9N B;  3SUN A;  1NG9 A;  2YX6 A;  3KD1 E;  4CFC A;  3SUQ A;  2KZM A;  3RMC A;  3MN9 A;  1HKC A;  4FJ8 A;  3UKU B;  3ALY A;  4BWJ A;  4F4K A;  3SUO A;  1ATS A;  1X9J A;  3PLA A;  4O0J A;  4O5F A;  2QTD A;  4DQI A;  1HJO A;  4JKD A;  3ASM A;  4X62 K;  3MEG A;  3S3O A;  3DLL L;  5CYQ A;  4DF4 A;  1BI4 B;  3VQ8 A;  4BQZ A;  5AQF A;  1YTU A;  4H4M A;  3AVB A;  1VSD A;  4BRI A;  4GY2 B;  4JKG B;  1SUQ A;  3HK2 A;  1KFD A;  2E20 A;  3L6Q A;  1N6Q A;  1KVB A;  2O4I A;  3AA4 A;  1L3V A;  4GV9 A;  3AVK A;  4J2E A;  2FBY A;  1BL3 A;  5GAE P;  3C95 A;  1NGC A;  1KLM A;  4FM2 A;  4FWQ A;  2OPS A;  3I8B A;  2Q2R A;  1DLO A;  2QWO A;  4FWP A;  4U7B A;  4QCL A;  3SLC A;  4Z4E A;  5CYM A;  5KTQ A;  4CZL A;  3OYE A;  4LH4 A;  2E2P A;  1YIJ N;  3AA2 A;  4RW4 A;  4M7Y A;  3U6F A;  2E8A A;  3J7Z O;  3MMV A;  2YKN A;  2RF2 A;  4CHN A;  2DFE A;  2XY6 A;  4BRE A;  3UKR B;  3K5M A;  4IJN A;  1XWL A;  3D7E O;  1KRP A;  1BGX T;  4B8A B;  5BRH A;  3CCL N;  5M1P A;  3CCS N;  3S41 A;  4QOZ B;  1D9F A;  3TTF A;  4WF9 L;  5J2M A;  3QEP A;  3PO5 A;  2ZD1 A;  5AJ3 K;  2W41 A;  3FZF A;  3QER A;  5AZJ B;  2CGJ A;  2HW3 A;  1NGH A;  3A5O C;  2HBL A;  3RR8 A;  4M63 C;  5E26 A;  4AHS A;  3E9O A;  3K0S A;  4KB1 A;  1G15 A;  2P9P A;  1JLF A;  4MLE A;  4HUG A;  3PO4 A;  1UAX A;  3J7Y P;  4LFC K;  4FL9 A;  4IFV A;  4I2P A;  4DQP A;  2O4G A;  2P9U B;  2E1Y A;  3ZSV A;  3OW2 M;  2VWK A;  5KPZ A;  4C8O A;  5JS2 A;  2NUB A;  4LFA K;  1NGJ A;  3IRX A;  4AHU A;  1SS6 A;  4RTF D;  4CW7 B;  1NK0 A;  4B9N A;  3U3G A;  3FFK B;  5C42 A;  1P90 A;  1TYQ B;  5BPL A;  3AAR A;  3PY8 A;  3M1F A;  3MEC A;  3WXI A;  3HPO A;  4DSE A;  2OAN A;  3DXK A;  1YUW A;  3QEW A;  3QBW A;  3WNH A;  1RT1 A;  3AVA A;  1C0F A;  2KFZ A;  2VYP A;  2O8B A;  4Y0W A;  3SAF A;  4NXN K;  3HM9 A;  1YF5 L;  4J2D A;  3OA9 A;  3O3F A;  1M1K O;  1NKE A;  1TKZ A;  4QAG A;  3RMA A;  1JCE A;  3L0Q A;  3OYA A;  4M3W A;  2G8F A;  4F3T A;  5BRF A;  3G71 N;  1TKD A;  1VSF A;  3N4Q A;  3IUC A;  3P5J A;  5JVH L;  4JEP A;  2OA8 A;  4KPY A;  3HPG A;  2P9S B;  3EKS A;  1ZBI A;  3KWI A;  4C23 A;  2YHY A;  1IG8 A;  3G4S N;  5AQR A;  3BZK A;  4BGB A;  2UXD K;  1S5J A;  4AHR A;  1NGB A;  5ADX A;  3ZEU B;  1EX4 A;  3LP1 A;  4DCH A;  4U67 L;  3KD5 E;  2PFU A;  4BG9 A;  3ZET A;  4CJ4 A;  1BO5 O;  1V4S A;  5AQM A;  3HZ6 A;  4CF1 A;  4OPJ A;  1NJX A;  2PBD A;  4F8R A;  4ELT A;  4JNE A;  1RDA A;  4CJV A;  2R7Y A;  3BZC A;  4Z4F A;  2D1K A;  5EX5 A;  4CZE A;  5C2F A;  3OTO K;  4FWR A;  4HHT A;  4H4O A;  1HPM A;  2HHW A;  4CGD A;  4BR2 A;  4YDU C;  2O8E A;  3DRP A;  5MLC Q;  3V9W A;  3A0I X;  3AAQ A;  3LPT A;  1QQC A;  1GLE G;  4E1N A;  1BQM A;  2HOE A;  3M6G A;  3U9Z A;  3G25 A;  1S3X A;  1KD1 O;  2QA4 N;  4FJH A;  2P9K A;  2BGG A;  5AQP A;  3VOV A;  3LL3 A;  2HNZ A;  3LPU A;  1NM1 A;  3ISN C;  4DTU A;  4CER A;  3O9S A;  2ZM6 K;  5GIN A;  1RBU A;  3J8A A;  3HOT A;  3CCM N;  4DV6 K;  1WB9 A;  4CK2 A;  3WXK A;  1S9E A;  3QNO A;  4CJW A;  1C0G A;  1NKC A;  4B9S A;  5KGX A;  3C6A A;  4CZK A;  4CFD A;  3CCQ N;  5C2D A;  3VF2 A;  1ZXO A;  5IWA K;  3ZSZ A;  1HX1 A;  2D0P A;  4ILH A;  4E1J A;  1Q9Y A;  3NH1 A;  4JI5 K;  1J6Z A;  1BIZ A;  4I7F A;  4DV5 K;  4FLV A;  3DLE A;  4DKW A;  3H45 C;  4BE1 A;  4LF5 K;  3AO4 A;  3L3U A;  2CH5 A;  2P9L B;  3NE6 A;  3SNN A;  3THY A;  1N5Y A;  4W5O A;  3VQB A;  3RVC A;  3CJ7 A;  3FFI A;  4QS9 A;  3KK7 A;  2JGU A;  2E2Q A;  4FWS A;  4L3Q A;  1HPZ A;  4CF0 A;  1T44 A;  3OS0 A;  4CJQ A;  4JYA K;  3SYZ A;  3QIP A;  3C6H A;  4IXC A;  1TK0 A;  1LV5 A;  4DV7 K;  3VQ9 A;  4CZI A;  4CF8 A;  3RMB A;  4CJ3 A;  3CQX A;  3KLF A;  1RT3 A;  4IG3 A;  3LWL A;  4DTM A;  3HP6 A;  2EX3 A;  3HO1 A;  2ZGZ A;  1WSI A;  3CER A;  4XH4 A;  1J53 A;  4K0K K;  2PAV A;  5LL6 Z;  3T1A A;  2KKZ A;  3TAG A;  1U2V B;  3QBX A;  5C15 A;  1RTJ A;  2PZS A;  5GIP A;  2W42 A;  3QDK A;  3VA3 A;  3ZX2 A;  4FJ9 A;  4CF2 A;  1XNR K;  2DFH A;  3EO3 A;  1XMO K;  1NK7 A;  1S72 N;  2G8K A;  4BY9 C;  4E7I A;  4O44 A;  4RW7 A;  4O8U A;  4RW8 A;  1YJW N;  1R59 O;  3L2V A;  4DU1 A;  5AZI A;  3AVC A;  4O4G A;  1FKO A;  4E7H A;  4YY3 K;  3AGK A;  4I6M B;  1NK8 A;  2A40 A;  3VF6 A;  1NU0 A;  3FLC O;  5ADX H;  4CJR A;  1D9D A;  4ICL A;  2HF3 A;  1NK9 A;  1TYQ A;  1MWK A;  4PY5 A;  1FJG K;  2QKK A;  3H1Q A;  5J2P A;  1VSJ A;  4FWL A;  4AIL C;  4LF7 K;  1S22 A;  1LW2 A;  4DLG A;  3WEE A;  1T6D A;  3CXC M;  4BDP A;  1LOT B;  4H0Y B;  2VCP A;  4CIG A;  1W9H A;  5E41 A;  4JI1 K;  4PA1 A;  3R8E A;  4Y1C A;  1NGD A;  1QQN A;  1OVQ A;  4EP5 A;  1ZBH A;  3B6P A;  4DTN A;  3TAP A;  1C0U A;  4BVP A;  3V9Z A;  1MA9 B;  3AVM A;  2OPP A;  4FLY A;  4OX9 K;  3TAR A;  5CZ1 A;  4R5P A;  2ZF5 O;  4XEI A;  3HVR A;  1T03 A;  3LDS A;  4FLZ A;  1L5U A;  4NYF A;  2XRI A;  4DFK A;  1CZA N;  1VRT A;  1TAU A;  1VK0 A;  4X65 K;  1JL2 A;  4XH1 A;  1KAY A;  2WOM A;  3I33 A;  2ITG A;  3UIQ A;  2ATQ A;  4JKA A;  2PYJ A;  1RBT A;  2X6S A;  3SK3 A;  4N41 A;  1J5E K;  1B9D A;  3L2U A;  2G8H A;  4FWK A;  3ID6 A;  3EKU A;  2FLO A;  1I3A A;  4CEB A;  4FM0 A;  3VQQ A;  1SZ2 A;  1IO2 A;  2E88 A;  4BRQ A;  1IKV A;  1BCO A;  3SAG A;  1BG3 A;  2IOC A;  4KB0 A;  3G10 A;  1GLF O;  5BN8 A;  3G6E N;  4KKO A;  1X3N A;  3OBY A;  1LCU A;  3TI0 A;  5HLF A;  5AQU A;  5FRM A;  2G8V A;  4LF9 K;  4IFE A;  2XY5 A;  4RW6 A;  3NHG A;  2DY4 A;  4LD0 A;  1D4X A;  1N8R O;  1VHX A;  3AO2 A;  4ISF A;  3KIO A;  4C8L A;  3KHY A;  3THX A;  1TKX A;  1KAZ A;  3EZ5 A;  3R1X A;  3CC4 N;  4OLA A;  2ETJ A;  4Z4H A;  3DXM A;  1RFQ A;  4B3O A;  1N32 K;  4BDZ A;  4M3Z A;  1QSS A;  4B1V A;  3KWG A;  3GL1 A;  2P9P B;  4B1Z A;  4H0T B;  2FF6 A;  3DLR A;  3ZT2 A;  4CBX A;  3WNF A;  4JHD A;  4Z94 A;  3L4I A;  4H0V B;  3LZJ A;  1HYZ A;  4FXD A;  4B9Q A;  4CI6 A;  4NYN A;  3SPZ A;  2QKB A;  4B1X B;  2W6L A;  4BRC A;  1KFS A;  2A6A A;  3VQD A;  4H5N A;  4YOX A;  4H0X B;  1JXB A;  4A57 A;  3BDP A;  3O80 A;  1VQ7 N;  2P9L A;  3OYD A;  4YOY A;  4CK3 A;  4OKE A;  3OY9 A;  1ZBS A;  1BCM A;  3O8M A;  2YHA A;  4DR7 K;  4GNI A;  4DR5 K;  2QWL A;  3CCJ N;  2NRT A;  2I7N A;  3THW A;  4XH5 A;  3S9H A;  4DQ8 A;  3QEX A;  1EWQ A;  4J2A A;  1N34 K;  3MN5 A;  4BR0 A;  3KTQ A;  1ZYQ A;  3O4W A;  3OJS A;  1GLA G;  5F0X A;  3M3Z A;  2VGM A;  4GKK K;  2RE2 A;  3DXK B;  3I55 N;  5AQL A;  4KHY A;  1S1T A;  5M1Q A;  3L2W A;  4IFY A;  4CJL A;  1XUP O;  3OYJ A;  2O8B B;  3NBP A;  5CE3 A;  4KV8 A;  1RBR A;  2HND A;  4CJT A;  4CES A;  1VSE A;  1KVA A;  2YNH A;  2HB5 A;  4IKF A;  3MAQ A;  1KVC A;  3VER A;  1F21 A;  3OYF A;  4OVL A;  3EL2 A;  3OBW A;  1WOQ A;  1MDU B;  2HHU A;  2HBM A;  1KSP A;  2AA4 A;  1WAF A;  4DWI A;  1WSJ A;  1HNI A;  1TV6 A;  3GE1 A;  4QS8 A;  4BR5 A;  5HRP A;  1OVY A;  3CG7 A;  2ZE2 A;  5HRN A;  4BRD A;  1S9G A;  4ILJ A;  1RT5 A;  4CHQ A;  4CF9 A;  4HWI A;  4M3U A;  4KRF A;  2NNW A;  4EP4 A;  4JI2 K;  2ZWH A;  1JL1 A;  3FZH A;  5ELZ A;  4FO0 A;  3QIO A;  1WBB A;  1X9W A;  3T1H K;  4FLU A;  5FDL A;  3FE1 A;  2VQE K;  1RDU A;  1BU6 O;  3GDQ A;  3SJH A;  2YNG A;  1B9F A;  4FOE A;  4IG0 A;  1U48 A;  1XI1 A;  4FWO A;  1M90 O;  4DTP A;  3MXM A;  1XHZ A;  3AA3 A;  3A8Y A;  1TUU A;  3H6E A;  4DSL A;  1NMD A;  4DS4 A;  3TPQ A;  3R3L A;  3AO1 A;  3HJF A;  2O8E B;  1ATN A;  1VAZ A;  1RGI A;  2NRV A;  3P4I A;  1QHT A;  5J2N A;  2O8D A;  4H5W A;  4AHT A;  1WSG A;  1SL1 A;  1NGI A;  4JN4 A;  1REV A;  3HBT A;  3ID8 A;  5SWM A;  4BC5 A;  2W6K A;  4HTU A;  1BHL A;  2P51 A;  3GBT A;  4IOA L;  1I39 A;  2P9K B;  5HRR A;  4PWD A;  1NK6 A;  4DQQ A;  2YJF A;  2BUP A;  3WUH A;  3KVG A;  4CEZ A;  4O0I A;  4EHU A;  4CJK A;  3RTV A;  3QES A;  1K8A O;  1HYS A;  4FW2 A;  1NGA A;  3A2F A;  3Q7B A;  1UA0 A;  4IWV A;  4BG8 A;  2LSN A;  5D3G A;  3MWP A;  4LY7 A;  5J1E A;  3I8D A;  4ID1 A;  5AQT A;  3M8P A;  4GV3 A;  3NMU A;  4BE2 A;  3AVN A;  3VF4 A;  3UE5 A;  1XMQ K;  3OYI A;  1TKT A;  3KK3 A;  5EVZ A;  5JLH A;  3HM8 A;  3THY B;  3OS2 A;  1SKW A;  4WYB A;  3BF1 A;  1W0H A;  3RSE A;  2BH1 A;  5M1K A;  2Q0R A;  4LSL A;  1QQM A;  3HVT A;  4DUZ K;  4CJF A;  4MO4 A;  3DLG A;  4AHC A;  4BRG A;  3MK6 A;  5FPE A;  3SMS A;  1D8Y A;  4FM1 A;  4KFB A;  3U9D A;  5B8H A;  4JK7 A;  4BQL A;  1LWF A;  1WAJ A;  4CHP A;  3FZK A;  4AM7 A;  2HBK A;  3VQC A;  5LY3 A;  4FPA A;  1VRU A;  3DWL A;  4PUO A;  4JV5 K;  5KI6 A;  1NNE A;  2F7T A;  1VQO N;  4BRA A;  1ASU A;  1X1P A;  3CI5 A;  4E7J A;  3T69 A;  4O55 A;  3VET A;  4KTW A;  2E6M A;  2I7P A;  1RDD A;  3AGR A;  3P1G A;  1HUX A;  5EU7 A;  4DTX A;  2HHX A;  1GLL O;  2IDO A;  4ZHR A;  3L2R A;  3VTH A;  2IVO A;  4PL7 A;  3D2E A;  5FPM A;  1X9S A;  3SQ0 A;  1S1V A;  5K14 A;  3MXJ A;  1TGO A;  3HI0 A;  5AZI B;  5JIC A;  1QZ5 A;  4RCH A;  4B9L A;  3SBT A;  1VSI A;  4OGC A;  3L2Q A;  3LDN A;  3DJC A;  3FZL A;  4M42 A;  3P31 A;  1QE1 A;  3NGI A;  2NRZ A;  3PX6 A;  2PY5 A;  3CJC A;  5I3U A;  4KHN A;  4FZZ A;  4RG8 A;  3J80 O;  1BQN A;  2VGN A;  1BA0 A;  4H03 B;  5CR4 A;  2OTL N;  1VSM A;  4IO8 A;  3F73 A;  4JS4 A;  4C1N I;  4WFA L;  3O1W A;  5E84 A;  2HBJ A;  3HT3 A;  1RDB A;  3WEE B;  2QWQ A;  2ZJP L;  4CZH A;  3D2F A;  4LSN A;  3VQ5 A;  2WON A;  3OYH A;  3R9P A;  1Z05 A;  1FW6 A;  2A42 A;  1SL0 A;  4JAX A;  2A3Z A;  4H0P A;  1BA1 A;  1H1V A;  4ZTF A;  5KQD A;  1XHX A;  1T8E A;  2ZGY A;  4CJS A;  4CZF A;  4F3O A;  2UXC K;  2OPQ A;  4CEF A;  2GX9 A;  1HNX K;  3O5B A;  2UUB K;  1I94 K;  1SL2 A;  5FLX O;  3O4N A;  4DTO A;  1W7A A;  2VWB A;  1TUY A;  3IG1 A;  1EXQ A;  3MXI A;  4ISG A;  4V19 S;  3ZSY A;  5LMU K;  3LM2 A;  5AQO A;  3O9Q A;  2UU9 K;  3AVH A;  4DTJ A;  4BDY A;  4FYD A;  1BUP A;  5BN9 A;  2GBZ A;  3DYA A;  3O9R A;  4FK0 A;  3MCP A;  3CM5 A;  5I42 A;  3TSQ A;  3OYM A;  3MWT A;  1VQ8 N;  4JI0 K;  5LJW A;  2E1Z A;  3PSF A;  3MN7 A;  3MX5 A;  4GKJ K;  1YVN A;  5HRS A;  2RPI A;  4FZX C;  4KHS A;  1YJN N;  2QXL A;  3KK2 A;  5FRO A;  4FJK A;  1ZBF A;  1NBW A;  1VQ9 N;  3Q7C A;  1YT3 A;  4JI8 K;  4WFN L;  1U49 A;  4OLB A;  4ELU A;  1HJR A;  3A5M C;  2FC0 A;  3NFA A;  4E1M A;  1LW0 A;  3THX B;  4B1U B;  1Q8I A;  3EE9 A;  4OGE A;  4NLC A;  3K5O A;  3EE8 A;  2E5L K;  3DXM B;  3CET A;  2P5O A;  4DLE A;  4CHZ A;  2P1J A;  4DSF A;  2Q3S A;  3IMX A;  2HMP A;  3LAL A;  3WT0 A;  3HSC A;  4Z4C A;  4XIU A;  3QEI A;  2ASM A;  3LWM A;  3MN6 A;  4JHD B;  1CLQ A;  1NKB A;  1DEJ A;  5IT9 O;  4AF1 A;  4KH4 A;  4W5N A;  2F9W A;  2QM1 A;  5F1X A;  2ZJR L;  1RCH A;  4ILG B;  1JCG A;  3KZB A;  4FWM A;  1ESV A;  3CC2 N;  3OS1 A;  4WCE L;  3V1O A;  1A5X A;  1HKG A;  1K8K A;  4EAH D;  4FPB A;  1KC8 O;  3THW B;  4UY8 O;  1S1X A;  2GV9 A;  2D4W A;  4MO5 A;  5AQX A;  3OYL A;  3DM2 A;  3WXL A;  3VEY A;  3OYB A;  2RKI A;  1VSK A;  5C25 A;  4NXM K;  2YV0 X;  2HHQ A;  3PUF A;  3CCU N;  3RMD A;  4C8K A;  4X64 K;  3I0S A;  2DPN A;  2CGK A;  1IG9 A;  2OYQ A;  2EHG A;  3FR0 A;  3NAE A;  5BRD A;  3THV A;  4FJX A;  3BF3 A;  4CZM A;  3KKS A;  1T3V A;  3ENB A;  1EKE A;  2WUS A;  4AM6 A;  1U47 A;  3PSI A;  3V4I A;  3CFO A;  3VGK A;  4FVU A;  4RW9 A;  5KPT A;  2AP1 A;  3CYM A;  4KHU A;  3FZM A;  4C1N K;  4BC3 A;  1RDW X;  4HVJ A;  1VQL N;  2CGL A;  4CJ5 A;  3ZCM A;  3OJU A;  4G1Q A;  3U4L A;  4X66 K;  4IJA A;  3VN5 A;  4AHV A;  2O8F A;  3F9K A;  3ZSQ A;  4JKC A;  5DM6 L;  3V9U A;  3H08 A;  5SZT A;  4K25 A;  4NB4 A;  2ITM A;  3CQ8 A;  4Y1D A;  4BR7 A;  4DF8 A;  4ISE A;  3O9T A;  2VG7 A;  4JD2 B;  3SPY A;  3TAN A;  3VQE A;  3TSP A;  1WSF A;  1T7P A;  2V7Y A;  3K5L A;  4PKG A;  2YHX A;  3ZX3 A;  4A2A A;  1NJI O;  4JI4 K;  3K9J A;  5EOY A;  4MFB A;  4J2B A;  3LDP A;  5TKY A;  5GAG P;  2H3G X;  3D45 A;  3QML A;  3ZSO A;  1ZBU A;  2V7Z A;  2O8D B;  5AQV A;  3L3V A;  2GEL A;  3EN9 A;  4CHO A;  3CF5 L;  3QLH A;  4DSJ A;  4CZJ A;  4L8R B;  1TK8 A;  1TAQ A;  1U4B A;  4B3T K;  2NRR A;  3T7Z A;  3DMJ A;  4CIE A;  4DQR A;  1NJZ A;  2P5G A;  3E9L A;  1WNS A;  3LP3 A;  1NK5 A;  1JLC A;  4KHW A;  1DT9 A;  4BRK A;  2QWN A;  1GLD G;  3K9K A;  1IBL K;  5AQS A;  3ITH A;  4EZ9 A;  4B9V A;  1WBD A;  2Z1J A;  2B6A A;  1VQM N;  1IJJ A;  3H46 O;  4NO7 A;  5AQW A;  4M41 A;  4CZG A;  2WTU A;  1J54 A;  4DU4 A;  1C1B A;  3KKR A;  3B6O A;  4J8F A;  4H5T A;  5KRS A;  4BC2 A;  1OH8 A;  1VQ5 N;  4LFB K;  1NK4 A;  1C6V A;  2HST A;  3VEO A;  4FOI A;  3WNG A;  3ULE A;  4BWM A;  3RSE B;  3MEE A;  2PYL A;  1B92 A;  1HQU A;  3ZYY X;  4IO9 L;  5BR8 K;  3HST B;  4IOX A;  4DTR A;  4OJR A;  1YI2 N;  4JK9 A;  3HTV A;  3CC7 N;  1GLC G;  1HRH A;  3QFP A;  2XY8 A;  4EHT A;  1HYV A;  2V52 B;  4CJ7 A;  3U3Y A;  3DI6 A;  3IKM A;  4CEO A;  4DR4 K;  3VPZ A;  3LP2 A;  3NF7 A;  3VQ6 A;  4PL8 A;  1U6Z A;  5FPD A;  3P38 A;  4DR3 K;  2VWJ A;  3C7N B;  4W5T A;  2J4R A;  3VGL A;  4DV3 K;  2UYT A;  4E19 A;  1IKW A;  2VG6 A;  1JLG A;  4B1W B;  4CFA A;  5M1N A;  2G8W A;  3SAH A;  3D2E B;  4CEE A;  4CBU A;  3SUP A;  2KFN A;  1BIS A;  3V9S A;  1RT2 A;  1OH6 A;  3ZT0 A;  1N33 K;  3AAP A;  3PIP L;  4DFJ A;  1ASV A;  1C1C A;  1OH5 A;  1KLN A;  5GIO A;  3SV4 A;  4FJN A;  3RRG A;  2YJE A;  3QNN A;  3MCA B;  1Q9X A;  3OVN A;  1ASW A;  1YIT N;  4PKH A;  4M3T A;  4O8K A;  3VEV A;  1IBM K;  5C12 A;  3CCE N;  3IS9 A;  4E7K A;  3H3N O;  1T05 A;  3D2F B;  5CZ2 A;  4CEA A;  3JYT A;  4KTZ A;  4Z0U A;  4OPK A;  4ELV A;  2V51 B;  5I9E B;  2HHS A;  3HPH A;  4DR6 K;  2A5X A;  1WUA A;  2GWJ A;  4NCA A;  3GOI A;  4CD3 A;  1Z6R A;  3M5R A;  3O6W A;  1X9M A;  4LH5 A;  1NLV A;  1VQP N;  1IV0 A;  2D5R A;  3M8S A;  4IEI A;  3V6D A;  4ZTJ A;  4CK1 A;  3VTI A;  4E89 A;  4GV6 A;  4FJM A;  4M3Y A;  2HMI A;  3HL8 A;  2F8S A;  4DFP A;  1VSH A;  4MDB A;  3HXM A;  4ID5 A;  4A2B A;  4M3X A;  4IDK A;  4B9T A;  4FSV A;  4DB3 A;  4H8K A;  4B3S K;  2F96 A;  2ZQB A;  5AQY A;  1XNQ K;  4YOT A;  5AFU A;  5AQI A;  2XY7 A;  1W97 L;  2QWP A;  1JCF A;  2BTF A;  2JWL A;  2Q36 A;  4JD2 A;  3G0Z A;  1WN7 A;  3AVF A;  4M45 A;  4I9Q A;  1W2B M;  4K8X A;  1QQO A;  1NWK A;  4DSI A;  1J9A A;  4NCG A;  4N76 A;  4TSX A;  4BRN A;  1HMV A;  3LAM A;  3AO5 A;  3TSU A;  2ZJQ L;  3JXU A;  2G8U A;  1DKG D;  3MX2 A;  5JLF A;  5LJV A;  3TTC A;  1XQS C;  1JLE A;  2HHT A;  3OYN A;  4E0D A;  4DQS A;  2RHK A;  2QW9 A;  1KQS M;  2KTQ A;  3DLH A;  3CMA N;  4K41 A;  3NDK A;  3CME N;  4CD1 A;  3J7A P;  4BRF A;  2GUP A;  2Z1I A;  3QFU A;  3KK1 A;  1EQY A;  2FBX A;  2KLA A;  3ATV A;  3D0P A;  3UB5 A;  1FK9 A;  4IOC L;  3K5N A;  4CCH A;  1MWM A;  3NF8 A;  1QVF M;  5EY4 A;  5BRE A;  2ASP A;  3V9X A;  1WSE A;  1QSL A;  5GAD P;  4IDH A;  3ZT4 A;  1JLQ A;  4FJJ A;  3C65 A;  5AQJ A;  1C0T A;  3H1V X;  3IDH A;  5F2R A;  5C0Y A;  4DV0 K;  2FBV A;  2FSJ A;  4K42 A;  1Q18 A;  3EZW A;  1JKH A;  4I9L A;  5DK5 A;  3CCR N;  4JI6 K;  1JJ2 M;  2XO7 A;  1TVR A;  3T1Y K;  3AO3 A;  1RNH A;  2G8I A;  3T19 A;  1NOZ A;  1E4G T;  3VEN A;  3K57 A;  3CJA A;  4LF4 K;  1K8K B;  4C8M A;  3QET A;  3SI6 A;  4FLT A;  1TK5 A;  3MDQ A;  1YTA A;  1Q82 O;  2NRX A;  2P9I A;  2OZS A;  1ATR A;  1IKX A;  1S6Q A;  3NVK A;  1YAG A;  2Z1G A;  3QEV A;  3K59 A;  3R6M A;  4BVO A;  1QVG M;  1LWE A;  3D6R A;  3E9P A;  5FPN A;  3O3H A;  1E4F T;  3O4Q A;  2F9T A;  1HR0 K;  1S6P A;  3ZSW A;  3PV8 A;  3C7N A;  4Z4G A;  5GAH P;  4KAZ A;  4KTQ A;  5BR9 A;  1SAZ A;  2WBN A;  4A5A A;  2IIR A;  2O8C A;  4B3M K;  1VSL A;  4HUE A;  1Q86 O;  1VQ4 N;  4JKB A;  4E3S A;  3M8R A;  3C0B A;  3E1Y A;  4GVE A;  3P83 D;  4JKE A;  1KXP A;  4KHP K;  3SJJ A;  3OYK A;  1E3M A;  2FSN A;  1C0M A;  3O9U A;  2O8F B;  3FGU A;  4OPH A;  2WC9 A;  4RWT A;  3A5L C;  1LAW A;  3TR8 A;  3SQ2 A;  3J81 O;  1Z26 A;  4CED A;  1VQN N;  3C6T A;  3WNE A;  5AFU H;  3TTD A;  4CEQ A;  3JSM A;  2YNF A;  4FW1 A;  3ULD A;  3HP9 A;  1BIU A;  4JKF A;  1K73 O;  2FSK A;  1A5W A;  4CGF A;  3LDQ A;  4YOR A;  3IFR A;  2UUC K;  4QS7 A;  1SQK A;  1Z25 A;  3WXM B;  4IEE A;  1NGG A;  4KO0 A;  3VGM A;  1L3T A;  1KAX A;  3ZT1 A;  1S1U A;  1FXX A;  3RRH A;  1K9M O;  1UOC A;  2FF3 B;  2D0O A;  2E2O A;  5BPN A;  1KTQ A;  4OO1 J;  3V81 A;  3P39 A;  1LWC A;  4BGA A;  2HVI A;  1DTT A;  1ZC6 A;  3WXJ A;  3EYZ A;  4OKK A;  4DFM A;  3I56 N;  5BPM A;  1VQ6 N;  4EZ6 A;  1RBV A;  4FJ5 A;  4FVM A;  1G99 A;  4K8Z A;  5C10 A;  3SV3 A;  2B4J A;  4M3R A;  3O1B A;  1SKR A;  4YOW A;  3VA0 A;  3ZT3 A;  4PKI A;  4JK8 A;  4N47 A;  4F2R A;  4DR1 K;  1CXQ A;  1IH7 A;  4BRP A;  2YHW A;  3V1R A;  2QI2 A;  3HOS A;  3QB0 A;  3L4Q A;  3KJV A;  3QO9 A;  2XHB A;  4Q5V A;  4CHY A;  3NH0 A;  4B9M A;  3WQT A;  1GLB G;  1YVU A;  3LP0 A;  3ULE B;  3CIP A;  4FK2 A;  2I5J A;  4CJP A;  2FXU A;  1FKP A;  2IVP A;  2OCE A;  2W40 A;  2ASO A;  3F9M A;  4FCY A;  4A5B A;  1U04 A;  4FLX A;  5AQN A;  3SMP A;  2Q0U A;  3NF9 A;  4JKH A;  3LDO A;  2GWK A;  3AY9 A;  1RTD A; 
#chains in the Genus database with same CATH homology
 2YKN A;  2RF2 A;  4CHN A;  2DFE A;  2XY6 A;  1Y97 A;  3MED A;  4KHY A;  1S1T A;  1RT4 A;  3D45 A;  4DG1 A;  1XWL A;  1WSH A;  1ZBU A;  2KQ2 A;  4IFY A;  1D5A A;  3ZSO A;  4CJL A;  3L2W A;  3OYJ A;  1J5O A;  1BGX T;  4B8A B;  1KRP A;  3L3V A;  3NBP A;  4KV8 A;  4QOZ B;  1D9F A;  4CHO A;  1RBR A;  1CZ9 A;  2HND A;  5J2M A;  3QEP A;  3OYC A;  3PO5 A;  4CJT A;  3QLH A;  4CES A;  1VSE A;  1KVA A;  2ZD1 A;  3DLK A;  4C8N A;  1ZYQ A;  4DSJ A;  4L8R B;  4KI6 A;  2YNH A;  2HB5 A;  3QER A;  4YNQ A;  1TK8 A;  1TAQ A;  3PX0 A;  1U4B A;  2HW3 A;  3DMJ A;  3RR8 A;  4CIE A;  4IKF A;  3MAQ A;  1A5V A;  1KVC A;  1F21 A;  2RN2 A;  5C24 A;  4AHS A;  3OYF A;  4BE0 A;  3CM6 A;  4KB1 A;  1G15 A;  4OVL A;  4DQR A;  4KHQ A;  4CEC A;  1NJZ A;  2P5G A;  2GUI A;  2HHU A;  1WNS A;  1JLF A;  2B5J A;  3LP3 A;  1NK5 A;  1JLC A;  1WAF A;  1KSP A;  1WSJ A;  4HUG A;  4DWI A;  1HNI A;  1TV6 A;  5HRP A;  1BI4 A;  1UAX A;  4B8C A;  3PO4 A;  4FJL A;  2KZZ A;  3DOK A;  3CG7 A;  2ZE2 A;  5HBM A;  4IFV A;  5HRN A;  2BAN A;  4I2P A;  4DQP A;  3ITH A;  1S9G A;  4DMN A;  4EZ9 A;  4B9V A;  1RT5 A;  2O4G A;  1LAV A;  4CF9 A;  4CHQ A;  5HRO A;  2Z1J A;  4M3U A;  4GW6 A;  3ZSV A;  3NF6 A;  4KRF A;  2B6A A;  1KCF A;  4EP4 A;  4M41 A;  1J54 A;  4DU4 A;  1JL1 A;  2VWK A;  3VQA A;  4C8O A;  1C1B A;  3AVL A;  3KKR A;  3B6O A;  3QIO A;  5KRS A;  4E7L A;  1X9W A;  1EET A;  3CFR A;  1R0A A;  5JS2 A;  2NUB A;  1NK4 A;  4FLU A;  5FDL A;  1C6V A;  1TL1 A;  2DTU A;  3T3F A;  3NGZ A;  4GMJ B;  3WNG A;  3IRX A;  4AHU A;  1HNV A;  2YNG A;  3QIN A;  1B9F A;  4BWM A;  4IG0 A;  3MEE A;  1U48 A;  1XI1 A;  4N56 A;  1NK0 A;  4B9N A;  4IBN A;  3U3G A;  4DTP A;  3MXM A;  2PYL A;  1B92 A;  1XHZ A;  5C42 A;  1HQU A;  3AA3 A;  3K2P A;  4CGH A;  1QTM A;  4DSL A;  3PY8 A;  3ZSR A;  2IAJ A;  2DFF A;  3LAN A;  3MEC A;  3HST B;  4DS4 A;  3AO1 A;  2BE2 A;  2QK9 A;  3HPO A;  4DTR A;  3HJF A;  4DSE A;  1HQE A;  4MQ3 A;  3KLI A;  4OJR A;  1JLA A;  3QEW A;  3C94 A;  3WNH A;  1QHT A;  4UQG A;  4DS5 A;  3NH2 A;  5J2N A;  4FJG A;  1RT1 A;  3AVA A;  2KFZ A;  1HRH A;  1GOB A;  4I2Q A;  3L8B A;  4AHT A;  1WSG A;  1SL1 A;  1GOC A;  2XY8 A;  3HM9 A;  1HYV A;  1REV A;  4CIF A;  5SWM A;  3U3Y A;  4J2D A;  4HTU A;  3DI6 A;  3O3F A;  5HP1 A;  1BHL A;  2P51 A;  1TKZ A;  4QAG A;  3RMA A;  4CEO A;  1NKE A;  1NOY A;  4FZY A;  3LP2 A;  3NF7 A;  1I39 A;  3VQ6 A;  5HRR A;  3OYA A;  3KLH A;  4BAC A;  1NK6 A;  4M3W A;  4PWD A;  4CJE A;  2G8F A;  4F3T A;  4DQQ A;  2VWJ A;  4KHW A;  2A1S A;  1TKD A;  1VSF A;  2AJQ A;  4CEZ A;  4OKJ A;  4O0I A;  4W5T A;  1SKS A;  3TWH A;  4CJK A;  3RTV A;  3QES A;  1HYS A;  3P5J A;  4FW2 A;  4E19 A;  1IKW A;  2VG6 A;  4Q0B A;  2OA8 A;  1JLG A;  3DLB A;  3A2F A;  4CFA A;  4KPY A;  3HPG A;  3TAF A;  2G8W A;  1ZBI A;  1UA0 A;  4CEE A;  3SUP A;  2KFN A;  1BIS A;  1C1A A;  2LSN A;  5D3G A;  3V9S A;  1RT2 A;  4LY7 A;  3ZT0 A;  4GVM A;  5J1E A;  3I8D A;  1GOA A;  1ASV A;  4HUF A;  1C1C A;  4ID1 A;  4DFJ A;  5DMR A;  3M8P A;  4FK4 A;  4BE2 A;  3AVN A;  1S5J A;  1KLN A;  4AHR A;  2E4L A;  1EX4 A;  3LP1 A;  3SV4 A;  4FJN A;  3RRG A;  4WE1 A;  3QNN A;  3OYI A;  3KD5 E;  1TKT A;  3KK3 A;  4CJ4 A;  1ZBL A;  1Q9X A;  3OVN A;  1ASW A;  3OS2 A;  3OYG A;  1SKW A;  2D0A A;  4CFB A;  4CF1 A;  4OPJ A;  4M3T A;  1W0H A;  1NJX A;  4F8R A;  4ELT A;  3SQ4 A;  3IS9 A;  1RDA A;  4LSL A;  3HVT A;  4CJV A;  4E7K A;  3AVG A;  2R7Y A;  4CJF A;  4Z4F A;  4FLW A;  1U45 A;  1L3S A;  1T05 A;  1UWB A;  3DLG A;  4AHC A;  4KRE A;  5CZ2 A;  1D8Y A;  4CEA A;  4HHT A;  3JYT A;  4FM1 A;  4KFB A;  4H4O A;  4KTZ A;  2HHW A;  4CGD A;  4Z0U A;  3DRP A;  4OPK A;  3V9W A;  4ELV A;  3KLG A;  1LWF A;  1WAJ A;  3HPH A;  2HHS A;  3M8Q A;  4CHP A;  3IAY A;  3K5M A;  3LPT A;  2HVH A;  3VQC A;  4NCA A;  1VRU A;  4E1N A;  4DSK A;  4PUO A;  5KI6 A;  1BQM A;  5T7B A;  1ASU A;  3C6U A;  1X1P A;  1X9M A;  4E7J A;  4FJH A;  5JS1 A;  4LH5 A;  4O55 A;  2BGG A;  2D5R A;  2KW4 A;  2HNZ A;  3LPU A;  4KTW A;  3M8S A;  2E6M A;  3V6D A;  3ISN C;  4DTU A;  1RDD A;  4CER A;  4ZTJ A;  3P1G A;  4CK1 A;  4E89 A;  1RBU A;  2IGI A;  2X74 A;  5EU7 A;  4FJM A;  4DTX A;  2HMI A;  4M3Y A;  1RIL A;  3HL8 A;  3SZ2 A;  4DFP A;  1VSH A;  2IDO A;  4CK2 A;  4ZHR A;  3L2R A;  3LZI A;  1MU2 A;  2F8S A;  1S9E A;  4ID5 A;  4CJW A;  3HXM A;  3QNO A;  4M3X A;  4IDK A;  1NKC A;  3CFP A;  4B9S A;  4B9T A;  5KGX A;  4H8K A;  1X9S A;  3TAM A;  2F96 A;  1S1V A;  2ZQB A;  3SQ0 A;  3TAQ A;  4CFD A;  2E6L A;  5K14 A;  3ZSZ A;  1WLJ A;  3MXJ A;  1Q9Y A;  3NH1 A;  1TGO A;  2XY7 A;  3EY1 A;  1QSY A;  4B9L A;  1BIZ A;  1RTI A;  4I7F A;  1VSI A;  4OGC A;  3DLE A;  1WN7 A;  3AVF A;  3G0Z A;  3L2Q A;  1EP4 A;  4BE1 A;  4FLV A;  4M42 A;  3NGY A;  4M45 A;  4I9Q A;  1DTQ A;  3AO4 A;  3L3U A;  4K8X A;  4NCB A;  1QE1 A;  2X78 A;  3NGI A;  3NE6 A;  3PX6 A;  3SNN A;  2BDP A;  2PY5 A;  4DSI A;  1J9A A;  4NCG A;  4N76 A;  4PQU A;  5I3U A;  4KHN A;  4TSX A;  1N5Y A;  4W5O A;  3VQB A;  4FZZ A;  4RG8 A;  1ITG A;  1BQN A;  1HMV A;  3LAM A;  2HHX A;  3FFI A;  3AO5 A;  1VSM A;  3F73 A;  4JS5 A;  4JS4 A;  2JGU A;  2G8U A;  3HT3 A;  1RDB A;  3I0R A;  1JLE A;  5KGW A;  4W5Q A;  1HPZ A;  4LSN A;  2WON A;  3VQ5 A;  4CF0 A;  3OYH A;  2HHT A;  3BGR A;  2YKM A;  3OYN A;  1SL0 A;  3OS0 A;  3RR7 A;  4E0D A;  4DQS A;  4CGI A;  4ZTF A;  4CJQ A;  1TL3 A;  2KTQ A;  3ZSX A;  3DLH A;  1XHX A;  3SYZ A;  3QIP A;  1T8E A;  1TK0 A;  1K6Y A;  4CJS A;  1LV5 A;  4F3O A;  3AVJ A;  3NDK A;  2OPQ A;  4B08 A;  3VQ9 A;  4CEF A;  4CJU A;  4CF8 A;  3RMB A;  4CJ3 A;  3KLF A;  2Z1I A;  1RT3 A;  1SV5 A;  4IG3 A;  3LWL A;  4DTM A;  1CZB A;  3KK1 A;  3K58 A;  2Y1I A;  2FBX A;  3HP6 A;  5CY4 A;  2EX3 A;  3D0P A;  3HO1 A;  1WSI A;  3HYF A;  1FK9 A;  1SL2 A;  3K5N A;  3O4N A;  4DU3 A;  4CCH A;  1J53 A;  4DTO A;  2A1R A;  1NJY A;  1JLB A;  3NF8 A;  3IG1 A;  3T1A A;  3V9X A;  1EXQ A;  1WSE A;  3MXI A;  3TAG A;  1QSL A;  2IS3 A;  3ZT4 A;  3VQ4 A;  1JLQ A;  3ZSY A;  4FJJ A;  1RTJ A;  1S1W A;  2PZS A;  2W42 A;  1C0T A;  3VA3 A;  4FJ9 A;  2HHV A;  4CF2 A;  2YHB A;  2DFH A;  3AVH A;  4DTJ A;  4BDY A;  4FYD A;  1O1W A;  1NK7 A;  2G8K A;  2FBV A;  2GBZ A;  4E7I A;  4F2S A;  3DRR A;  3DYA A;  4O44 A;  4FK0 A;  4I9L A;  1JKH A;  5DK5 A;  4JRP A;  4RW7 A;  1JXE A;  3CM5 A;  4RW8 A;  3VQP A;  4AH9 A;  5I42 A;  4DU1 A;  3OYM A;  3L2V A;  3AVC A;  4O4G A;  3S3N A;  1FKO A;  2XO7 A;  1TVR A;  4E7H A;  3AO3 A;  1RTH A;  1RNH A;  1NK8 A;  2G8I A;  3T19 A;  1NOZ A;  4KI4 A;  3K57 A;  4CJR A;  1D9D A;  3AV9 A;  3AVI A;  4C8M A;  3QET A;  3SI6 A;  4ICL A;  5HRS A;  2RPI A;  4FZX C;  4KHS A;  4FLT A;  1TK5 A;  4FJI A;  4FXD A;  3U6F A;  1NK9 A;  3KK2 A;  5FRO A;  4FJK A;  1YTA A;  4PY5 A;  1QS4 A;  2QKK A;  1ZBF A;  4FJ7 A;  3E01 A;  4B9U A;  3V1Q A;  5J2P A;  1VSJ A;  2OZS A;  4AIL C;  2D0C A;  2VG5 A;  1YT3 A;  1IKX A;  1S6Q A;  1LW2 A;  2IC3 A;  4DLG A;  1U49 A;  2Z1G A;  4OLB A;  2HNY A;  3QEV A;  1HJR A;  4BDP A;  3K59 A;  4ELU A;  2FC0 A;  4JRQ A;  3O3G A;  3NFA A;  1LWE A;  4CE9 A;  4E1M A;  1LW0 A;  1RT6 A;  4CIG A;  1W9H A;  5E41 A;  4DTS A;  3O3H A;  3TAE A;  2Y1J A;  1Q8I A;  4PA1 A;  3O4Q A;  4Y1C A;  4JLH A;  4OGE A;  4YFU A;  1S6P A;  3ZSW A;  3K5O A;  4EP5 A;  1ZBH A;  3B6P A;  4DTN A;  3PV8 A;  1C0U A;  3TAP A;  4DLE A;  4CHZ A;  2P5O A;  3V9Z A;  1NJW A;  2P1J A;  3AVM A;  2Q3S A;  4DSF A;  3S3M A;  4Z4I A;  2OPP A;  4Z4G A;  4CGJ A;  4FLY A;  4KAZ A;  1RBS A;  3TAR A;  4KTQ A;  3LAL A;  5CZ1 A;  4O5B A;  4CGG A;  4R5P A;  4Z4C A;  4XIU A;  3HVR A;  1VSL A;  3QEI A;  1T03 A;  3LDS A;  4HUE A;  3SCX A;  4FLZ A;  4E3S A;  1L5U A;  4NYF A;  2XRI A;  3M8R A;  4DFK A;  3LWM A;  5FRN A;  1VRT A;  1TAU A;  1CLQ A;  3P83 D;  1VK0 A;  2FBT A;  3KLE A;  1JL2 A;  1NKB A;  2X6N A;  2D0B A;  3SJJ A;  2WOM A;  3OYK A;  1L3U A;  1C0M A;  3DRS A;  2OPR A;  4W5N A;  2OZM A;  2YNI A;  2ITG A;  3UIQ A;  2ATQ A;  2PYJ A;  1RBT A;  2X6S A;  3VQ7 A;  1UA1 A;  1RCH A;  4W5R A;  4N41 A;  1LAW A;  1RT7 A;  3TR8 A;  3SQ2 A;  1Z26 A;  1B9D A;  4CED A;  3C6T A;  3WNE A;  3L2U A;  5J2Q A;  1IKY A;  3OS1 A;  5KRT A;  2F8T A;  2G8H A;  3NCI A;  2QXF A;  3V1O A;  4CEQ A;  3JSM A;  1A5X A;  2YNF A;  1RDC A;  1I3A A;  4FW1 A;  4CEB A;  3PX4 A;  3ULD A;  4FM0 A;  3VQQ A;  1IO2 A;  3HP9 A;  1IKV A;  1BCO A;  2Z1H A;  1BIU A;  3AA5 X;  1S1X A;  2GV9 A;  1A5W A;  2JLE A;  3SQ1 A;  1XC9 A;  4HCB A;  4CGF A;  2IOC A;  3DM2 A;  4N5S A;  3OYL A;  3RWU A;  4KB0 A;  4HCC A;  3OYB A;  3G10 A;  2RKI A;  1VSK A;  5C25 A;  1CXU A;  4KKO A;  3TAB A;  3LAK A;  3TI0 A;  1Z25 A;  5HLF A;  2YV0 X;  2HHQ A;  5FRM A;  3DOL A;  3PUF A;  2G8V A;  3RMD A;  3SUN A;  2XY5 A;  4C8K A;  4RW6 A;  3I0S A;  4KO0 A;  3NHG A;  2DY4 A;  4LD0 A;  1L3T A;  1IG9 A;  3KD1 E;  2OYQ A;  2EHG A;  3AO2 A;  4CFC A;  3ZT1 A;  3KIO A;  3NAE A;  3SUQ A;  3RMC A;  3THV A;  1S1U A;  4C8L A;  4FJX A;  2KZM A;  1FXX A;  1TKX A;  3RRH A;  3KKS A;  3EZ5 A;  4B9M A;  4FJ8 A;  4F4K A;  3ALY A;  4BWJ A;  1UOC A;  3SUO A;  4OLA A;  2ETJ A;  1EKE A;  4O0J A;  4Z4H A;  1KTQ A;  4B3O A;  3V81 A;  1LWC A;  4BDZ A;  4M3Z A;  4DQI A;  2HVI A;  1DTT A;  3ASM A;  1QSS A;  1U47 A;  3V4I A;  3EYZ A;  3CFO A;  4OKK A;  4DFM A;  4RW9 A;  3MEG A;  4EZ6 A;  1RBV A;  4FJ5 A;  3S3O A;  4FVM A;  3CYM A;  4KHU A;  5CYQ A;  4K8Z A;  3DLR A;  3SV3 A;  3ZT2 A;  4DF4 A;  1BI4 B;  2B4J A;  4M3R A;  3VQ8 A;  3WNF A;  1YTU A;  4HVJ A;  4H4M A;  3AVB A;  3LZJ A;  1VSD A;  1SKR A;  4CJ5 A;  3ZCM A;  3VA0 A;  1HYZ A;  3OJU A;  3ZT3 A;  4G1Q A;  1SUQ A;  3HK2 A;  1KFD A;  4N47 A;  4F2R A;  4NYN A;  3SPZ A;  2QKB A;  1CXQ A;  1IH7 A;  1N6Q A;  3VN5 A;  4AHV A;  1KVB A;  3F9K A;  2O4I A;  1KFS A;  3V1R A;  3AA4 A;  3VQD A;  3ZSQ A;  1L3V A;  3KJV A;  1JXB A;  3AVK A;  3QO9 A;  2XHB A;  4Q5V A;  2FBY A;  1BL3 A;  3V9U A;  4CHY A;  3BDP A;  4J2E A;  3H08 A;  3C95 A;  5SZT A;  3NH0 A;  3OYD A;  1KLM A;  4CK3 A;  4OKE A;  4FM2 A;  3OY9 A;  3CQ8 A;  4Y1D A;  4DF8 A;  1YVU A;  1BCM A;  2VG7 A;  3LP0 A;  2YHA A;  2OPS A;  4FK2 A;  2I5J A;  3SPY A;  3VQE A;  4CJP A;  3TAN A;  1FKP A;  1WSF A;  1DLO A;  4FCY A;  1T7P A;  4QCL A;  4Z4E A;  1U04 A;  5CYM A;  3K5L A;  5KTQ A;  4FLX A;  3S9H A;  3OYE A;  3QEX A;  4J2A A;  3NF9 A;  4LH4 A;  3AA2 A;  4RW4 A;  3KTQ A;  4MFB A;  4J2B A;  1QQC A;  3OJS A;  1RTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...