4E1NA

Crystal structure of hiv-1 integrase with a non-catayltic site inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
144
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSATVKAAWWAGIKQEFGIPNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Class of HIV-1 Integrase (IN) Inhibitors with a Dual Mode of Action.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 integrase
total genus 46
structure length 144
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e1nA00
4FM0A 4AILC 1KFSA 5HROA 5HRSA 3QEIA 1RCHA 2A1RA 4CEAA 4FM2A 1HMVA 3HYFA 4BE2A 2PY5A 4KHUA 4KHQA 3V6DA 1WSJA 4C8MA 3TWHA 3H08A 4B9UA 4FJXA 3LP3A 2KFZA 2IDOA 3KLHA 2OPSA 3DM2A 5FROA 4YFUA 4F2SA 4CGFA 1WSIA 1WSEA 3LP2A 3VQ9A 3ZT3A 4W5QA 4PA1A 4FVMA 1T7PA 1NKEA 3O4QA 1RT7A 3AV9A 5KRTA 4FCYA 4DTOA 3QEPA 2XHBA 3DLBA 3KJVA 1S1XA 2G8IA 1SL1A 1Q8IA 3NHGA 3SQ0A 5C24A 1RTHA 1EKEA 4DWIA 3NBPA 3IS9A 4CJUA 4FZYA 3OYDA 3ALYA 3ITHA 3QNOA 4CEZA 1WNSA 4FLZA 1VSKA 2Q3SA 3C6TA 4CE9A 4FLYA 2XY7A 1L3UA 1FKOA 2OZSA 5HRPA 4Z4EA 1QSSA 1RDDA 5J2NA 3TAQA 4M3TA 4CHYA 2A1SA 4WE1A 4RW7A 4C8NA 3HPOA 3KK2A 3EY1A 4HUGA 3V81A 3S3NA 3K58A 3V1RA 4I7FA 1NK8A 1ZBHA 4FJKA 3G10A 3T19A 3NGIA 2G8VA 3E01A 1S5JA 4DFPA 4O5BA 3V9SA 3HT3A 3T1AA 1L3VA 4JS5A 1W0HA 1NKCA 3K5MA 1HYVA 2HHQA 3DLRA 4Z0UA 2FC0A 4M41A 4E19A 1U04A 2ZE2A 1HNIA 3KK3A 2Y1JA 2X74A 2FBXA 3OYAA 4E0DA 4PQUA 4FJJA 3AO3A 1X9MA 4BACA 3RRHA 2HW3A 1IKYA 4KTZA 4DSLA 2YV0X 2B6AA 2D5RA 4Q0BA 3K2PA 1JLBA 1S6PA 2BDPA 3SI6A 3PV8A 2O4GA 1VSDA 1C6VA 1UOCA 1XHZA 1VRUA 3WNFA 1S1UA 1BQNA 2OPQA 1IKWA 1DTQA 3DLEA 3TI0A 4B3OA 4DS4A 4K8ZA 3QERA 3ZT1A 2BANA 5KGWA 3NE6A 4B9TA 1YVUA 1TKTA 3K57A 2HHXA 1KVBA 4CEQA 1LWEA 2KZMA 4I9LA 3HP6A 1RNHA 1RT2A 3RRGA 4KTWA 1TV6A 3IG1A 2WOMA 1HQEA 3AVLA 1EP4A 1LWFA 1BISA 1QHTA 3DOLA 4CFAA 3LALA 3HK2A 2KFNA 1CXUA 1QSLA 3ZCMA 3ZSYA 4B08A 3QO9A 3PX0A 4C8KA 2Z1GA 4Y1CA 4CJKA 2I5JA 3RWUA 2W42A 3RMDA 1BGXT 3LP0A 2O4IA 1MU2A 2JGUA 3U3YA 2KZZA 1IKXA 4W5TA 1CXQA 1RBTA 2RKIA 4CHPA 4FW1A 5K14A 5HRNA 4OPJA 4MQ3A 5CYMA 2F8TA 4BDZA 3VQDA 2ZD1A 3PUFA 4CFCA 4DLEA 3SUNA 3V4IA 3NDKA 3ZT4A 3PY8A 2HHWA 5D3GA 5CYQA 4FZZA 5JS1A 3PO5A 3A2FA 4F8RA 3OYEA 1LWCA 4KHSA 4E7IA 2PYLA 2FBVA 4CK3A 1T8EA 4CFDA 2G8KA 4C8LA 3DMJA 2DFHA 2G8FA 4UQGA 5HBMA 3KLIA 3NF8A 1TAUA 3L2UA 4CERA 2P51A 4CJ5A 3OJSA 1RBSA 4LD0A 1KVCA 4NYNA 5DMRA 4M3XA 3SUOA 4CHOA 3MEEA 2D0AA 1DTTA 3FFIA 4B8CA 3QEWA 3QNNA 4ID1A 5KI6A 4FJHA 3KIOA 4LY7A 3VQ7A 4DSFA 3DLHA 3ASMA 4FYDA 3K5NA 4DS5A 2DTUA 1R0AA 1DLOA 2FBTA 1D9FA 1KTQA 3IRXA 4EP4A 5HP1A 3V9XA 1BI4A 1WAJA 2VWJA 4Y1DA 4IBNA 4DQSA 1JXEA 4LSNA 1VSEA 4J2BA 2G8UA 4DU3A 3AO4A 4E89A 4O55A 3WNEA 4CK1A 5J1EA 4JLHA 4CJWA 2YNIA 1RDAA 1S6QA 2YNFA 3AA2A 4E3SA 4BWMA 4CJPA 1B92A 1VK0A 2RN2A 2X6SA 4O44A 3OS2A 3DRSA 4CJSA 1L5UA 4HUEA 3KD5E 3K5LA 1N5YA 1RILA 3BGRA 4E7HA 2XRIA 4I2QA 1VSHA 1K6YA 1RTJA 4B8AB 4CHNA 4DFKA 3D0PA 3SJJA 4DSJA 4FZXC 4BDYA 3LAMA 1KLMA 3HPGA 1NJWA 4JS4A 2EX3A 3VQCA 3NFAA 1A5WA 1LAVA 2XO7A 2D0BA 3LZJA 1UA1A 1RDBA 1W9HA 4CESA 5KTQA 3MECA 4HTUA 1S1TA 3AVGA 4GMJB 4CF0A 4M45A 3M8PA 4KTQA 3L3VA 1EETA 3L3UA 4HVJA 3QETA 1UA0A 2QXFA 5KRSA 4L8RB 4EP5A 1NKBA 3SV3A 1VSFA 3O3HA 3IAYA 2EHGA 4F3OA 4PWDA 4I2PA 4CGDA 3ZSOA 1NOZA 4LH4A 3V1QA 2OPPA 3RMBA 1X9SA 1S1WA 1X1PA 3S3MA 4LH5A 1IKVA 3ZSXA 4CJ3A 4F4KA 5FDLA 1RTDA 4E7LA 3AVBA 1GOBA 3M8SA 4DQRA 4NCAA 2HNDA 4F2RA 3CM6A 3OJUA 1CLQA 3NCIA 1LV5A 3OYHA 4ZTJA 3I0SA 3ULDA 1RBRA 2F96A 1KCFA 1U48A 4OPKA 4B9VA 4QCLA 3VQ6A 4CGHA 3NGZA 3ZSVA 3SUQA 3V1OA 2B4JA 3DYAA 5CY4A 3HSTB 1A5VA 3QLHA 3MXMA 1QSYA 4DLGA 3M8QA 3ZSRA 4R5PA 3ISNC 3PX6A 3MEGA 1HQUA 4BE0A 4KB1A 4GW6A 3CG7A 5FRMA 3MXIA 3SPZA 2YHAA 3B6OA 4N56A 2E4LA 5J2PA 4AHRA 1A5XA 2B5JA 3T3FA 4CF9A 2P1JA 4N41A 1SKSA 4EZ9A 2E6MA 4DSIA 1WSHA 3I0RA 2AJQA 3TR8A 4OJRA 1SL2A 3AVJA 2VG6A 4DQIA 5SWMA 3K5OA 3SNNA 3BDPA 4J2EA 3LP1A 4H8KA 3JSMA 4OKKA 4FJGA 4DG1A 2YKNA 3QINA 4Z4CA 1O1WA 1NK4A 4KI6A 1FKPA 2F8SA 4YNQA 4HUFA 4CECA 1HYSA 3RMCA 3SYZA 1VSMA 5HRRA 4BE1A 4KHYA 3VQ5A 1RT5A 2JLEA 4M3YA 1VRTA 1NOYA 1BHLA 4KKOA 1RT6A 4E7JA 3TARA 1ITGA 5J2MA 4DQPA 4CFBA 4KB0A 4EZ6A 2IC3A 1LW0A 1ZBFA 5C42A 3OYFA 3VA0A 1NJXA 1JLCA 3RTVA 1G15A 3U6FA 4B9MA 1JL2A 1T03A 2Z1HA 3HVRA 3AVCA 3NGYA 1NK0A 1I3AA 2KTQA 1NJZA 1JLAA 4ICLA 4CCHA 4FLUA 1TK5A 3DOKA 4H4MA 4XIUA 1BQMA 1Z25A 2YKMA 3D45A 1ZBUA 4NCGA 1XI1A 4KAZA 4KRFA 1WSGA 3K59A 1KVAA 2OPRA 3AO5A 4M3ZA 3I8DA 2HHUA 1C1CA 3OYLA 3PO4A 1WSFA 3JYTA 2QKBA 1RT3A 3AA4A 2X6NA 2FBYA 4NCBA 3L2VA 4OLAA 3NF6A 4JRPA 1QQCA 1C0UA 1RBUA 3CFPA 3V9UA 2G8WA 3HVTA 3LPTA 3THVA 1HNVA 3F73A 4CJFA 1UWBA 3C94A 4DMNA 3DRPA 2E6LA 2XY5A 2ATQA 5JS2A 3L2RA 3NH0A 4CGJA 3L8BA 3P83D 3AVFA 4HCCA 3LPUA 3QEVA 3P5JA 4B9LA 2G8HA 4IFYA 4CF8A 2IS3A 4W5RA 4H4OA 1RT1A 3M8RA 4KFBA 2Z1JA 5SZTA 4M3RA 3OS1A 3RR7A 2P5GA 2PYJA 1NK5A 4OLBA 2YNHA 1KSPA 4FJ7A 4CIFA 4ID5A 5C25A 1ASWA 4DTRA 1TK8A 1FK9A 1EX4A 3DLKA 1L3TA 3LWLA 3CFRA 2NUBA 4CEOA 2P5OA 1BI4B 1IO2A 4OKEA 1I39A 5DK5A 3OYNA 4DTPA 4CEEA 1D8YA 2OA8A 3KKRA 3VQ4A 1SKWA 1T05A 4Z4GA 1ASUA 3G0ZA 1KRPA 1JLEA 4BDPA 1S1VA 3CFOA 4AHVA 1SV5A 1VSJA 1LAWA 1FXXA 3AVAA 3ZT0A 2Y1IA 1TK0A 4DSEA 4KREA 1REVA 4AHSA 1TVRA 3OYMA 3HM9A 1J53A 3OYJA 4FM1A 3S3OA 4PY5A 4FJ8A 2HHSA 3AVHA 4O0IA 1U45A 1C0TA 1NK7A 3L2QA 1D9DA 2ZQBA 2X78A 5KGXA 3SCXA 1WAFA 4DTXA 4CJLA 3SQ4A 5EU7A 3AA3A 4B9NA 1JXBA 2GBZA 4RW9A 1TKZA 3S9HA 2OZMA 4TSXA 2RF2A 4FJMA 1GOAA 1TL1A 3CM5A 1TKXA 3DI6A 4CEDA 3NAEA 2R7YA 3V9ZA 3SQ1A 4ELVA 1TAQA 2GV9A 4FK0A 1NJYA 4IDKA 4AHCA 2IOCA 3OS0A 3P1GA 3SQ2A 3B6PA 4Z4HA 1QTMA 2HB5A 4ZTFA 4FJ5A 4FJ9A 1Q9XA 3TAGA 1LW2A 3O3GA 2XY6A 2D0CA 4IFVA 4E7KA 3NH1A 4QOZB 1J54A 3OYGA 3AVKA 2GUIA 2HHVA 1XC9A 4CJRA 4CJTA 4K8XA 1N6QA 1JLGA 5HLFA 4DTSA 3EYZA 2IAJA 4N5SA 2HMIA 4CHQA 4Z4FA 4ZHRA 4CF2A 3CYMA 1HYZA 1GOCA 1SUQA 3OVNA 4W5NA 4M3UA 2Z1IA 1CZ9A 4CK2A 4FJNA 4FLXA 3QIPA 4OKJA 4DFJA 1KFDA 2KW4A 5J2QA 4DF8A 5FRNA 4BWJA 3LZIA 4E1MA 5CZ2A 4M42A 4NYFA 3DLGA 5I3UA 4CIGA 4CGIA 1IG9A 4FJLA 1WLJA 2BE2A 4KHWA 1QE1A 4G1QA 3LANA 1UAXA 3HL8A 4PUOA 1C1BA 4LSLA 3MEDA 3KLGA 4DF4A 2PZSA 2LSNA 3KLEA 3AVIA 4C8OA 1RBVA 3WNHA 3SZ2A 1IH7A 2DFEA 1CZBA 3HXMA 1RT4A 4DSKA 3LAKA 4QAGA 3C95A 3TANA 3AO2A 4DTNA 2QKKA 2KQ2A 4GVMA 1TL3A 3RMAA 1BCOA 1S9GA 3VQEA 4FK2A 3SPYA 1B9FA 1D5AA 4KO0A 3V9WA 2HVIA 1J5OA 2DFFA 1XWLA 3VQBA 4IKFA 2HHTA 2XY8A 4RW6A 1L3SA 1EXQA 3NF7A 4O0JA 3O3FA 1BIUA 3ZSWA 3NF9A 3LDSA 1QS4A 3U3GA 3OYIA 3KTQA 3C6UA 4RW4A 1RDCA 4CF1A 1ZBIA 1TGOA 3ZT2A 4ELTA 1F21A 3AVMA 1JL1A 1HPZA 2RPIA 4OVLA 4RG8A 4FLWA 2VG7A 3VQ8A 1SL0A 1JLFA 4KV8A 1TKDA 4J2AA 4FK4A 4CJVA 3DRRA 3EZ5A 4CJ4A 3VQPA 4IG3A 3LWMA 4DU4A 4CGGA 1ASVA 3HPHA 4N47A 3CQ8A 4AHTA 1ZYQA 4ELUA 3MAQA 1KLNA 1BIZA 3QESA 4N76A 2QK9A 4AH9A 3AVNA 4DU1A 1S9EA 1XHXA 4F3TA 3NH2A 4IG0A 3VA3A 1Z26A 3ZSQA 3KKSA 3OYKA 2BGGA 3WNGA 1WN7A 4HCBA 3TAFA 3KD1E 3KK1A 1B9DA 4RW8A 3QEXA 4FW2A 2OYQA 4DFMA 3AO1A 1Q9YA 2DY4A 4CJQA 3O4NA 3ZSZA 1YT3A 4E1NA 1C1AA 4CJEA 5E41A 4JRQA 1JLQA 3TAEA 4CEBA 3L2WA 3UIQA 4I9QA 3OYBA 4DTUA 3MXJA 4B9SA 2VG5A 5CZ1A 3RR8A 1HRHA 2IGIA 4DTJA 1NK6A 2YNGA 1BL3A 1HJRA 4CIEA 4Q5VA 1RTIA 3VQQA 1NK9A 4FXDA 4DQQA 2WONA 1VSIA 1JKHA 4AHUA 4HHTA 1J9AA 2ETJA 3AA5X 4KHNA 3TAPA 4FJIA 1C0MA 3KLFA 1YTUA 1VSLA 1YTAA 1SKRA 3OYCA 2HVHA 1Y97A 3SUPA 3VQAA 5I42A 4CEFA 4FLVA 4OGCA 3OY9A 3TAMA 4M3WA 1ZBLA 4MFBA 3VN5A 1BCMA 3HP9A 4J2DA 1U47A 3QIOA 2ITGA 1U49A 1X9WA 2HNYA 1U4BA 3HO1A 3F9KA 4FLTA 4Z4IA 4KPYA 2HNZA 4CHZA 4KI4A 3PX4A 4DTMA 4W5OA 3HJFA 4OGEA 2YHBA 3SV4A 4O4GA 2VWKA 3TABA 5T7BA
chains in the Genus database with same CATH superfamily
4AILC 1RCHA 4BE2A 2PY5A 4KHQA 3TWHA 1Q7YO 3KLHA 3DM2A 4H5WA 1SAZA 4CGFA 3QMLA 1N34K 1Z05A 3FLCO 3EKUA 1E4FT 3OTOK 4DTOA 3DLBA 3O8MA 3RVCA 1ESVA 4ISFA 3L4QA 3ZEUA 3VF6A 5A2QO 4FWQA 4CEZA 1VSKA 2XY7A 3FE1A 4CE9A 4FWKA 3ENBA 1RDDA 2WTUA 4CHYA 2A1SA 4C8NA 3HPOA 3O9RA 2QWPA 3G10A 1TYQA 3T19A 3E01A 4O5BA 5E84A 4JS5A 3LDOA 3JS6A 2ZE2A 4BC5A 3OYAA 3O1WA 1X9MA 3RRHA 1FW6A 4LF4K 1S6PA 3PV8A 1C6VA 4IJNA 1VQ8N 3WNFA 4DV5K 1S1UA 4DS4A 3QERA 3C7NA 2BANA 3NE6A 1TKTA 4BC2A 1LWEA 1RNHA 4KTWA 1LOTB 5JMVA 1C0FA 4BC4A 3HK2A 1TUYA 1ATRA 4B08A 3QO9A 4MDAA 4JNEA 5BN8A 2Z1GA 4L3QA 2ZGYA 3RWUA 4JKCA 1BGXT 3HBTA 2O4IA 1MU2A 3GG4A 1HJOA 2F8TA 3VQDA 5BRFA 1LCUA 1LWCA 5C2FA 4A5AA 2NZTA 4JKDA 5HBMA 4YHHK 3NF8A 1VQLN 1TAUA 3H3NO 3CJAA 4CJ5A 3OJSA 5LJWA 2ZGZA 4H0VB 3FFIA 3HTVA 5KI6A 3WXKA 2GEMA 3KIOA 4JI3K 2BTFA 5JLFA 4DV6K 2FBTA 5GAEP 5I9EB 4DV2K 3IRXA 4EP4A 3V9XA 1BI4A 2E1YA 1JXEA 1VSEA 2G8UA 3AO4A 4JLHA 2YNIA 3CCEN 4C23A 4A2BA 4IXCA 3TPQA 4BWMA 2X6SA 1L5UA 4CJSA 1W97L 4HUEA 3KD5E 3K5LA 3BGRA 4PL7A 1VQPN 4E7HA 2XRIA 4B1WB 1K6YA 1KQSM 4FZXC 1IG8A 1R59O 1KLMA 4JS4A 2EX3A 3MK6A 1NGHA 5BREA 3DAWA 3LZJA 4B3SK 3GOIA 4KH6A 4KTQA 1UA0A 1EETA 4HVJA 1NKBA 4F3OA 4GY2B 3ZSOA 1NOZA 4LH4A 2E2OA 5AQWA 1X9SA 4LH5A 1E3MA 1GLAG 3M8SA 4DQRA 4WFNL 2HNDA 5BRHA 3NCIA 3THXB 4ZTJA 4QCLA 3O4WA 3DXMB 3CPEA 1QSYA 3HSTB 3QLHA 5C0YA 1BWFO 3M8QA 5B8HA 2BH1A 4F9OA 3K9JA 1YJWN 2V52B 5FRMA 3MXIA 3SPZA 2UUCK 4JN4A 2E4LA 1K8AO 3OHRA 4A57A 3MN6A 1NGEA 4DSIA 2A6AA 1WSHA 3B8AX 1XQSC 1SL2A 1T6CA 2VG6A 3SNNA 3BDPA 3LP1A 4H8KA 3HOSA 1O1WA 3S41A 1HYSA 1VSMA 2D1KA 5F1XA 2JLEA 4M3YA 1SQKA 2NRWA 1NOYA 4E7JA 1RT6A 3FZMA 1VQ9N 5GAGP 1W2BM 2IC3A 4DUZK 3ID6A 4JD2B 1G15A 2Z1HA 3NGYA 1EWRA 1QZ5A 1JLAA 4CCHA 4XIUA 4NCGA 5C2DA 4KRFA 2NRTA 3ULEA 1QQOA 1EO1A 1KVAA 3AO5A 4YDUA 3CC2N 3NF6A 4BRFA 4JRPA 1RBUA 4A5BA 2G8WA 3U4LA 1HNVA 3C94A 2QTDA 2ATQA 1VHXA 2P9SB 4MLHA 3NH0A 2W41A 3P5JA 2FF3B 4IFYA 3UB5A 4H4OA 3VTIA 4BRKA 5SZTA 3RR7A 2PYJA 5C25A 4H5RA 1VQKN 1FK9A 1EX4A 2HBMA 1BI4B 2D4WA 5DK5A 5AR0A 1YXQA 4CEEA 3CC4N 2HHHK 2OA8A 3A5LC 2KLAA 1ASUA 1NGAA 1LAWA 3LL3A 4DSEA 1RDWX 2Q0UA 2FSKA 3J8AA 3VERA 5GINA 1J53A 3HM9A 1U2VA 4FM1A 3KWIA 2HHSA 4FJ8A 1U45A 1C0TA 2E88A 2F9TA 3SQ4A 4B1UB 1XC3A 1TKZA 2H3GX 3S9HA 2RF2A 2GX9A 1YF5L 1TL1A 4CEDA 1TKXA 1BA0A 3M6GA 3NAEA 2R7YA 5FPMA 1TAQA 4PKIA 2GV9A 3CJ9A 4FK0A 1NJYA 4IDKA 4BY9C 1QTMA 4CD1A 2FF6A 2E20A 1Q9XA 4FJ9A 3O3GA 2D0CA 2Q36A 1N36K 1J5EK 4K8XA 4CJTA 1T3VA 2A3ZA 1K9MO 2HMIA 4BR7A 4N5SA 1O13A 4CF2A 2QWOA 1HYZA 1GOCA 3KHYA 1NMDA 2Z1IA 4DFJA 3QIPA 4OKJA 4GV3A 5FRNA 4BWJA 3LZIA 4DQ8A 1K73O 4CGIA 1IG9A 5EXWA 1QE1A 1YI2N 2YX6A 3LANA 2O8EA 3CF5L 1NMNA 3T69A 1C1BA 4LSLA 2PZSA 4C8OA 3AVIA 4FWSA 2IIRA 2GWJA 4CD3A 4NXMK 1RT4A 1XMOK 4QAGA 3HOTA 3AO2A 4GVMA 1IBKK 3J7AP 4LF5K 1HR0K 3SPYA 3LDLA 4KO0A 2HVIA 1J5OA 2DFFA 2ASOA 2P9PB 3A5MC 4YOYA 3NF7A 4CBXA 4O0JA 3LDSA 3CCMN 1QS4A 4OPAA 5JVHL 1GLEG 3C6UA 3KTQA 5AQKA 3EN9A 2AA4A 3QB0A 5CR4A 4YORA 5DM7L 4H0YB 4RTFD 1JLFA 3PSFA 3ENHA 4XEIA 4CJVA 3EZ5A 4DU4A 4IG3A 4ELUA 3ZETA 1ASVA 3KVGA 1BU6O 4AH9A 3AVNA 1K8KB 5FPEA 4DU1A 3VA3A 3KKSA 2BGGA 3WNGA 3ULEB 1B9DA 3I56N 1Q9YA 2DY4A 2P9IB 3ZSZA 1YT3A 3MDQA 1JLQA 4CEBA 3L2WA 3OYBA 3FZLA 3MXJA 5DM6L 5M1FA 1HRHA 4JI5K 1DT9A 2YNGA 1RTIA 3VQQA 2OANA 4B1YB 4JKFA 1VSIA 3CCVN 1J9AA 2ETJA 3AA5X 4KHNA 2W40A 4CZJA 2QM1A 2GTDA 4BVPA 4U67L 3EKSA 3OYCA 3D2EA 1Y97A 3SUPA 3VQAA 4B3RK 4CEFA 4FLVA 5ADXA 4IO9L 4M3WA 4JK9A 3WXLA 5AQIA 1OH8A 1X9WA 1NG9A 3KWGA 3VGKA 4KPYA 4CHZA 3ZYYX 4KI4A 2FXUA 4M7XA 4OGEA 3SV4A 2O8DA 3TABA 4LFAK 1ATSA 4DFMA 3TTDA 1E4GT 5HROA 4EHTA 4KHUA 3H08A 3LP3A 5FROA 1WSIA 1WSEA 3VQ9A 4W5QA 3WEEA 2VQEK 3O4QA 1RT7A 1BOTO 1S1XA 1Q8IA 3NHGA 3FGUA 3CPWM 3NBPA 4FZYA 3QNOA 4FLZA 3SK3A 4DV1K 3EY1A 4I7FA 2E1ZA 2HSTA 5JICA 4FJKA 4H0XB 1S5JA 2YJEA 1XNRK 3V9SA 3T1AA 3G4SN 1NKCA 1W0HA 1VAZA 3K5MA 1HYVA 3OBYA 2FC0A 4M41A 4E19A 4E0DA 3MCPA 2X74A 2FBXA 2PFUA 3H45C 4JYAK 4K0KK 2RE2A 1IKYA 4DSLA 2YV0X 4DR5K 2B6AA 4Q0BA 2BDPA 1XHZA 1V4TA 1VRUA 1OH7A 4C1NK 3A5NC 1DTQA 3DLEA 4FO0A 3CMEN 4B1ZA 3PIOL 3CCLN 3ZT1A 2A40A 3K57A 2HHXA 4CEQA 3HP6A 1RT2A 5ELZA 1QVFM 1HQEA 1GLLO 3AVLA 5EVZA 4Y0WA 1KAXA 4Y1CA 4BRQA 2UXBK 1N32K 3LP0A 3U3YA 4YOVA 2KZZA 1CXQA 4CHPA 4MQ3A 2QI2A 4CVNE 4ILJA 2ZD1A 4DLEA 3ZT4A 5D3GA 3N4QA 3A2FA 4KHSA 3UKUA 4C8LA 4CFDA 1VQMN 3DMJA 2DFHA 3KLIA 3L2UA 2NRRA 4IEIA 1KVCA 2J4RA 5DMRA 4M3XA 3H6EA 5BPLA 2D0AA 3QEWA 3BZCA 5AFUH 4WQ5C 3M1FA 3VQ7A 3CXCM 3ASMA 4FYDA 5LMUK 2DTUA 1DLOA 3FZHA 3SAFA 5HP1A 4LC9B 1WAJA 3CHWA 4Y1DA 2AP1A 4LSNA 4DR1K 4DU3A 4ILGB 4O55A 4CK1A 5J1EA 1YAGA 3P31A 3AA2A 4CJPA 3T7ZA 2RN2A 3DRSA 2ZWHA 4JKHA 3NVMA 1FJGK 1N5YA 3SMSA 3SJJA 1VSHA 1RTJA 5KQ8A 3D0PA 4DSJA 4BDYA 2UXCK 1XUPO 2XO7A 1A5WA 5BN9A 2O8BA 2D0BA 1UA1A 4JD2A 4CZLA 3MECA 1S1TA 3AVGA 4DR7K 3M8PA 4L8RB 5AQNA 5AZJB 4X66K 3T1HK 1VSFA 3O3HA 4CGDA 5GIOA 3ATVA 3QBXA 1S1WA 1MWMA 4YDUC 5EX5A 4F4KA 2YCHA 5FDLA 3CCQN 2BUPA 4BRCA 4DR3K 4F2RA 3OJUA 3CD6N 3I0SA 3ULDA 3HI0A 4JI7K 3FZFA 2HF3A 3ZSVA 2B4JA 5CY4A 1A5VA 2I7PA 2HBKA 4DLGA 3EE9A 2JWKA 3ISNC 2EWSA 3PX6A 3MEGA 4KB1A 1TYQB 4GW6A 3JAMO 4N56A 5H1SQ 4AHRA 2Q31A 1HNZK 2B5JA 3A0IX 3IFRA 4UY8O 4EZ9A 1NGBA 4IOAL 3I0RA 4H0PA 4DQIA 1NGGA 3K5OA 4J2EA 2KKZA 2YKNA 3CMAN 4YNQA 3RMCA 3SYZA 1KC8O 5HRRA 2ZM6K 4BE1A 1RT5A 5F0XA 3TARA 4IWVA 5J2MA 1ZBFA 4M63C 1U6ZA 1NJXA 3VA0A 1JLCA 2GELA 4PKHA 1JL2A 3E9OA 3HVRA 1XMQK 4X65K 2KTQA 1NJZA 4ICLA 3DOKA 2KHOA 2YJFA 1Z25A 3O1BA 4KAZA 3K59A 4NB4A 2HHUA 1HKCA 3I8DA 1C1CA 3PO4A 4BRDA 1WSFA 4NCBA 2VCPA 2ASPA 4GVEA 3V9UA 3IKMA 4YOXA 3U9ZA 1P8ZA 4BRMA 3DXKB 3O9SA 4DUYK 3DRPA 5JS2A 3WXMB 4MO5A 5JLHA 3P83D 3AVFA 1NLVA 1MWKA 1YIJN 2VWBA 3MWTA 4CF8A 4EIAA 3OS1A 1Q18A 3SMPA 4JI1K 1NK5A 3TTCA 1M1KO 4CIFA 1I94K 1L3TA 4CEOA 4OKEA 2IVPA 3OYNA 4DTPA 3I33A 1ZBSA 4BDPA 3SAHA 3CFOA 4AHVA 3M5RA 1VSJA 3C6HA 1FXXA 3AVAA 3ZT0A 4FWPA 2Y1IA 1TK0A 1TVRA 3THWB 3D6RA 3O9QA 4BRHA 3AVHA 4O0IA 4CJ7A 2ZQBA 5EU7A 4B9NA 2OZMA 4TSXA 3CM5A 4CI6A 2VGNA 3K9KA 1NU0A 3H46O 3WXIA 2IOCA 3OS0A 4K42A 3P1GA 3B6PA 3AAPA 2HB5A 4ZTFA 1QVGM 3MMVA 4PL8A 4BRGA 5AQZA 4QOZB 3OYGA 4FWOA 2GUIA 4CJRA 2NRZA 1N6QA 2P9SA 4B3TK 3UKRB 2IAJA 4CHQA 1G99A 4IOCL 1SUQA 4W5NA 2YHXA 4M3UA 4K43A 1VQNN 4FLXA 5HOOA 3G6EN 4BRPA 1YUWA 4NYFA 2QWQA 2FLOA 5I3UA 4FVUA 1WLJA 4X64K 4PUOA 3MEDA 3WNHA 3GE1A 4DSKA 3LAKA 4BG8A 2QKKA 1T6DA 2KQ2A 3VQEA 4FK2A 1D5AA 3V9WA 4QS8A 3CJ1A 3VQBA 4IKFA 2XY8A 4GKKK 1L3SA 1EXQA 2PAVA 3U3GA 4FL9A 3OYIA 3AAQA 4I6MA 4ELTA 1JL1A 4OVLA 4FPBA 4WF9L 1SL0A 1VQ6N 1TKDA 4FK4A 2Q0RA 2P9KB 5AQQA 4CJ4A 3LWMA 1ZYQA 3H3OB 4AHTA 3MAQA 3QESA 4N76A 5BR8K 2O8CA 1NGDA 3EL2A 3R3LA 1XHXA 4F3TA 3NH2A 4IG0A 1VQ5N 1BG3A 3ZSQA 3OYKA 4HCBA 1WN7A 3KD1E 1TUUA 4RW8A 3QEXA 2OYQA 5GAHP 3VEZA 4FWNA 3VF4A 1X9JA 4XH4A 3O4NA 1DKGD 4E1NA 4CJEA 4JRQA 4ISEA 4DTUA 1S3XA 2IGIA 4DTJA 1ILYA 4KBOA 3BP8A 3MN5A 4BG9A 4FXDA 3R6MA 1NWKA 4B9QA 4WQ4A 4DQQA 3IUCA 4AHUA 1JKHA 1C0MA 1WOQA 1YTAA 1SKRA 5I42A 4BGBA 4BRIA 2Q2RA 3VN5A 4BR9A 3QIOA 2ITGA 2HNYA 1U4BA 3FR0A 4FWRA 2HNZA 3IMXA 3PX4A 2HBLA 1Q82O 2NNWA 2YI1A 2A5XA 1KD1O 1J6ZA 2A1RA 3QEIA 4CEAA 4BGAA 4FM2A 1WSJA 4FWMA 4B9UA 4FJXA 1KXPA 1VQ4N 2KFZA 2IDOA 4F2SA 5KPTA 2F7TA 3LP2A 3ZETB 4PA1A 2HF4A 4FVMA 4OPHA 4CZKA 1WBDA 3AV9A 4FCYA 3KJVA 2G8IA 1SL1A 3D7EO 4IOXA 1RTHA 5C24A 1NM1A 1EKEA 5AQGA 3R9PA 5AQXA 4CJUA 3OYDA 4LF9K 3ITHA 4FLYA 2Q3SA 1FKOA 5BPNA 1QSSA 4M3TA 4WE1A 2E2NA 1IBLK 1YHQN 3V81A 3S3NA 1NK8A 3VEVA 1ZBHA 4ILHA 3CETA 1L3VA 1Y64A 1T44A 2OCEA 1BO5O 3CJBA 4YOUA 3DLRA 4Z0UA 3QDKA 4B1XB 1HUXA 3KK3A 2Y1JA 4PQUA 4FJJA 3J80O 4BC3A 4WFBL 2HW3A 4KTZA 3WUHA 1YVNA 3K2PA 3O5BA 2UYTA 3SI6A 2O4GA 1VSDA 1UOCA 3SBTA 1BQNA 3MN9A 2OPQA 5KGWA 4B9TA 1GLFO 2GWKA 1KVBA 3CC7N 4I9LA 3SBGA 2WUSA 3IG1A 1OVQA 1LWFA 1BISA 4CFAA 3DOLA 3LALA 1CXUA 3ZSYA 3UE5A 2W42A 4DCHA 2JGUA 3AY9A 2IVNA 1IKXA 1HNXK 5HRNA 5K14A 5CYMA 4BDZA 5JS1A 2HHWA 4F8RA 3OYEA 3THYA 4E7IA 2PYLA 3DXKA 2G8FA 4UQGA 5IT9O 3IDHA 4CERA 2P51A 1RBSA 3THXA 4NYNA 4DKWA 2ZJPL 3SUOA 4B8CA 3QNNA 2FSNA 4ID1A 4FJHA 2UUBK 4DSFA 3DLHA 5LMNK 3VPZA 4BQZA 2VWJA 3VENA 3VESA 4E89A 3WNEA 4A61A 1MA9B 4CJWA 1RDAA 1HPMA 2ITMA 1S6QA 2YNFA 4E3SA 1B92A 1VK0A 4CW7B 4O44A 5M1KA 3BUZB 1ZC6A 3R1XA 4DQPA 4DFKA 4CZEA 1NJWA 2NLXA 3VQCA 2QEXN 4H5TA 4LF7K 1RDBA 4IJAA 4CESA 5KTQA 4GMJB 2V7ZA 4CF0A 1M90O 3L3VA 3L3UA 3QETA 2QXFA 3ZX0A 5KRSA 5AQFA 4EP5A 4PWDA 4I2PA 4JK8A 2OPPA 4DR2K 3S3MA 1IKVA 1YITN 4JAXA 1RTDA 3U9DA 2WC9A 3QBWA 3JXUA 3CM6A 3H1QA 3HZ6A 3MX2A 4H0TB 3LM2A 1RBRA 2F96A 4B9VA 3VEOA 3OBWA 3BY5A 4CGHA 3V1OA 1N33K 3MXMA 4DV7K 4R5PA 1S22A 5AJ3K 1HQUA 4AQYK 5BPMA 3CG7A 3VOVA 3B6OA 3EO3A 2O8EB 4CF9A 1SKSA 5F2RA 4IO8A 2P9UB 3AVJA 4AM6A 4OKKA 4KI6A 2F8SA 1NK4A 4Z4CA 1FKPA 4M7YA 1GLBG 4KHYA 3VQ5A 3CQXA 4KB0A 4EZ6A 2Q1NA 3FFKB 5C42A 3U6FA 2GUPA 3KZBA 4B9MA 3Q7CA 3G25A 1I3AA 1K8KA 1TK5A 1QZ6A 1ZBUA 4X62K 3ZLJA 1WSGA 4HTLA 1VQ7N 3QFPA 2QKBA 4EFHA 1RT3A 4NXNK 3M3ZA 1RDUA 3DXMA 5M1QA 3L2VA 1QQCA 3VGLA 1C0UA 3CFPA 3T1YK 4LFBK 3UKUB 3LPTA 3THVA 4CJFA 2DPNA 2E6LA 2XY5A 1YJ9N 3UKRA 2CGLA 4CGJA 4WQ5A 3QEVA 2HOEA 3VTHA 2G8HA 5M1PA 4KFBA 3VEWA 4M3RA 2P5GA 2ASMA 4WCEL 2YNHA 1KSPA 4FJ7A 1P90A 2UXDK 1ASWA 2E2PA 2IVOA 3CFRA 2P5OA 1IO2A 5HL7L 3VF2A 5AQOA 1D8YA 3VQ4A 4BR4A 4V19S 1T05A 1KRPA 1S1VA 2CH6A 4AHSA 4JEPA 4PY5A 4O5FA 1NK7A 3L2QA 5KGXA 3SCXA 1WAFA 4DTXA 4GNIA 3AA3A 3WT0A 1OH6A 4BR0A 2VYPA 3DI6A 1DEJA 4ELVA 4JI4K 3VEYA 4KH5A 3SQ2A 4A2AA 3O08A 2YHWA 2O8CB 2VGMA 2V51B 3TAGA 3OA9A 3P39A 3I8BA 1ATNA 4H5VA 5FPDA 3AVKA 3O9UA 2HHVA 4YOWA 1WBBA 4DB3A 1JLGA 3EYZA 1EQYA 4Z4FA 4ZHRA 1RFQA 1NBWA 4H0OA 4FJNA 3L0QA 1KFDA 2KW4A 3SLCA 4M42A 3CCUN 3DLGA 4FJLA 4CIGA 3HSCA 4BQLA 3AGKA 4GV9A 3CCRN 2ZF5O 4G1QA 4MLEA 2QWLA 1UAXA 3D2FB 1JJ2M 2QWNA 3KLGA 4DF4A 2LSNA 3SZ2A 4J8FA 3TANA 2HBJA 4DTNA 1TL3A 2A41A 4WYBA 4IEEA 1S9GA 1NGFA 4QS9A 1B9FA 4K41A 1XWLA 2HHTA 1OH5A 3O3FA 3ATUA 3ZSWA 1RDCA 1ZBIA 3AVMA 5EY4A 4A59A 5C15A 4RG8A 3PIPL 3VQ8A 4BR5A 4KV8A 4MO4A 3DRRA 3VQPA 3WEEB 4CGGA 2QXLA 3HPHA 4N47A 3CQ8A 3HRGA 1KLNA 1GLCG 1BIZA 2QK9A 3J81O 1ZXOA 1S9EA 2FSJA 1Z26A 5KPRA 4FOEA 3KK1A 2PBDA 4FW2A 4DV3K 3ZEUB 4CJQA 1IBMK 1OVYA 4JHDA 3EZWA 1C1AA 5AQUA 3K0SA 5GADP 2VG5A 5CZ1A 3RR8A 3A5OC 3F2KA 3BZKA 3RSEA 3VETA 1BL3A 4ISGA 1HJRA 4CIEA 3E1YA 3TSUA 1NK9A 4LF6K 2WONA 1Q86O 1YTUA 3LM9A 3EE8A 4E1JA 4OGCA 3TAMA 2QWRA 1ZBLA 5ADXH 1RGIA 1U47A 1U49A 1Z6RA 3HO1A 3F9KA 4FLTA 4Z4IA 4GV6A 3HJFA 4DTMA 4W5OA 3LDPA 2P9PA 3VEXA 1VQON 3ZX2A 4FM0A 1KFSA 5HRSA 1HMVA 3HYFA 5C12A 3V6DA 3THWA 1WB9A 4C8MA 4DV0K 2OPSA 3P4IA 4YFUA 5AQJA 3ZT3A 3LDNA 4O8UA 1T7PA 1NKEA 5KRTA 3QEPA 4CBWA 2XHBA 1KAZA 4B1VA 3SQ0A 4B3MK 4DWIA 1NNEA 1HKBA 3IS9A 3CIPA 1JCFA 3ALYA 2YHYA 1WNSA 1L3UA 3C6TA 4Z4EA 4DHYA 2OZSA 5HRPA 2F4VK 5J2NA 3TAQA 4RW7A 3KK2A 3W3DA 4HUGA 4PHTX 3K58A 3V1RA 3C0BA 5AQTA 4CZGA 1S72N 3L6QA 3NGIA 2G8VA 4DFPA 3HT3A 3HM8A 1HNWK 1YJNN 4JK7A 2HHQA 3J7ZO 1U04A 1NGJA 1HNIA 4OX9K 3SJHA 3AO3A 4BACA 4DR6K 4BREA 1GLDG 2D5RA 3PSIA 1JLBA 4CZHA 2ZJQL 4CZMA 5M1OA 5AZIA 2O8DB 1IKWA 3TI0A 2UU9K 4B3OA 1HX1A 4K8ZA 2ZJRL 1BUPA 4KH4A 4BR2A 1YVUA 2KZMA 3RRGA 1TV6A 1IJJA 4RWTA 3MN7A 5FPNA 2WOMA 5AFUA 1EP4A 1QHTA 2KFNA 4NLCA 1OKJA 3KK7A 1QSLA 3O80A 3ZCMA 4FSVA 3PX0A 4C8KA 4FPAA 4CJKA 2I5JA 2P9NB 3RMDA 4FWLA 4W5TA 1RBTA 2RKIA 4FW1A 4OPJA 4JKAA 4BRLA 4CFCA 3PUFA 3SUNA 3V4IA 3NDKA 3PY8A 4KHPK 5CYQA 4FZZA 3PO5A 2FBVA 4CK3A 1T8EA 2G8KA 4LD0A 1N8RO 4OO1J 4CHOA 3MEEA 1DTTA 4R79A 3CI5A 4MDBA 4LY7A 2P9LA 5AQYA 3K5NA 4DS5A 1R0AA 5JVGL 2UUAK 3NVKA 1D9FA 1BDGA 2O8FA 1KTQA 3E66A 4A62A 4IBNA 4DQSA 5TKWA 4J2BA 2CGJA 5M1NA 5AQPA 3OS2A 4FOIA 4DR4K 3ID8A 1RILA 3CJ7A 4I2QA 4CHNA 4B8AB 1NK0A 2A42A 3LAMA 3HPGA 3NFAA 1LAVA 1W9HA 5CE3A 4HTUA 3AGRA 2CGKA 4M45A 4U7BA 4JI6K 3SV3A 3IAYA 2EHGA 3WQTA 3V1QA 3RMBA 4HWIA 2E2QA 1SS6A 1X1PA 3ZSXA 4CJ3A 4E7LA 3AVBA 5EOYA 1GOBA 4NCAA 3TSPA 3CQYA 1CLQA 4BRNA 1LV5A 3OYHA 1U48A 1KCFA 4OPKA 3VQ6A 3NGZA 3SUQA 3DYAA 3GBTA 3ZSRA 2QW9A 4BE0A 3BEXA 2O8FB 5AQLA 2YHAA 5J2PA 3DLLL 1A5XA 3T3FA 2P1JA 4N41A 2Q97A 5MLCQ 2NRHA 2E6MA 4JI0K 2AJQA 3U8XA 3TR8A 4OJRA 3J7YP 4XH1A 3PLAA 5SWMA 1IV0A 1KAYA 3JSMA 3E9LA 4FJGA 4DG1A 1D4XA 2NRXA 3QINA 3TTFA 3OW2M 4HUFA 4CECA 3AARA 2W6KA 1GLJO 4NO7A 3C7NB 1VRTA 1BHLA 4KKOA 3N4PA 4I6MB 1ITGA 1SZ2A 5FLXO 4CFBA 5AQVA 1LW0A 4JKGA 3BF1A 3OYFA 3RTVA 5AZJA 1T03A 3ZX3A 3AVCA 2P9NA 2RHKA 3CCSN 4FLUA 4H4MA 1BQMA 2YKMA 3D45A 5LY3A 1XI1A 3EEQA 4IDHA 4JI8K 2WBNA 2OPRA 4M3ZA 3OYLA 4IFEA 3JYTA 3AA4A 2X6NA 2FBYA 3O6WA 3VMFB 1XNQK 2NRVA 4OLAA 3THYB 3HVTA 4NLBA 1V4SA 3F73A 4DMNA 1UWBA 3L4IA 4DV4K 3L2RA 3I55N 3L8BA 4HCCA 3LPUA 4B9LA 5KQDA 2IS3A 4W5RA 1RT1A 3M8RA 2Z1JA 3DWLA 4OLBA 1X3MA 2I7NA 1DGKN 1JCEA 4ID5A 3O9TA 4DTRA 1X3NA 1NGCA 4EHUA 1TK8A 5LJVA 3DLKA 3LWLA 2NUBA 5E26A 1I39A 3NMUA 2WFBA 5AQRA 3D2FA 5CHIA 3KKRA 1SKWA 3CERA 4Z4GA 3G0ZA 1JLEA 3ENOA 1SV5A 4BVOA 1NJIO 4RCHA 2D0PA 4KREA 1REVA 4XH5A 3F9MA 3G71N 4IZ9A 3OYMA 3OYJA 4LFCK 3S3OA 4H03B 4K25A 5GIPA 1D9DA 4G9ZA 2X78A 5LL6Z 5AQSA 4CJLA 1BA1A 1JXBA 3DJCA 3GL1A 2GBZA 4RW9A 4C1NI 4FJMA 2O8BB 1GOAA 3V9ZA 1NGIA 3WQUA 3SQ1A 3CCJN 4AHCA 2P9KA 3SAGA 3MWPA 4Z4HA 3A8YA 3CJCA 4FJ5A 3W0LA 1LW2A 4JKEA 2XY6A 3TSQA 2OTLN 4IFVA 4WFAL 4E7KA 3NH1A 1J54A 2VQFK 3F5TA 2QWMA 1XC9A 1CZAN 5TKYA 1HKGA 2P9IA 5HLFA 4DTSA 4JHDB 3CYMA 3OVNA 3VGMA 4LF8K 1CZ9A 3RSEB 4CK2A 5J2QA 4JV5K 3MCAB 4DF8A 4E1MA 5CZ2A 4PKGA 4JI2K 4CZIA 2BE2A 3WXJA 4KHWA 3HL8A 3D2EB 4AM7A 1QHAA 3KLEA 1RBVA 3P38A 1IH7A 1C0GA 2DFEA 1CZBA 2P9UA 3HXMA 1EWQA 3C95A 2CH5A 3RMAA 4JKBA 1BCOA 3GDQA 1QQMA 4AF1A 5C10A 1U2VB 5BRDA 3LDQA 4RW6A 1Q81O 1BIUA 3NF9A 4RW4A 4CF1A 2V7YA 1TGOA 2W6LA 3ZT2A 4CZFA 1F21A 1HPZA 4FLWA 2RPIA 4QS7A 2VG7A 5KPZA 2QA4N 3QFUA 4JKGB 4J2AA 3H1VX 3QICA 1JCGA 2F9WA 2E8AA 1QQNA 2D0OA 4YOTA 1W7AA 4O8KA 3BF3A 3TAFA 1MDUB 4EAHD 3AO1A 4BRAA 5BR9A 3TAEA 5E41A 3E9PA 4H5NA 3R8EA 4I9QA 3Q7BA 3UIQA 4B9SA 3MX5A 1NK6A 2P9LB 4Q5VA 1WUAA 3C6AA 5IWAK 4CBUA 4HHTA 1H1VA 5AQMA 3TAPA 4FJIA 3KLFA 1VSLA 2E5LK 2JWLA 2HVHA 3FZKA 4BROA 3OY9A 3C65A 4MFBA 1BCMA 4YY3K 3HP9A 4J2DA 4GKJK 4Z94A 3TU5A 5AQHA 1HLUA 2OTJN 2HMPA 5AZIB 2YHBA 4O4GA 2VWKA 4WQ4C 5T7BA
chains in the Genus database with same CATH topology
4FM0A 4AILC 1KFSA 5HROA 5HRSA 3QEIA 1RCHA 2A1RA 4CEAA 4FM2A 1HMVA 3HYFA 4BE2A 2PY5A 4KHUA 4KHQA 3V6DA 1WSJA 4C8MA 3TWHA 3H08A 4B9UA 4FJXA 3LP3A 2KFZA 2IDOA 3KLHA 2OPSA 3DM2A 5FROA 4YFUA 4F2SA 4CGFA 1WSIA 1WSEA 3LP2A 3VQ9A 3ZT3A 4W5QA 4PA1A 4FVMA 1T7PA 1NKEA 3O4QA 1RT7A 3AV9A 5KRTA 4FCYA 4DTOA 3QEPA 2XHBA 3DLBA 3KJVA 1S1XA 2G8IA 1SL1A 1Q8IA 3NHGA 3SQ0A 5C24A 1RTHA 1EKEA 4DWIA 3NBPA 3IS9A 4CJUA 4FZYA 3OYDA 3ALYA 3ITHA 3QNOA 4CEZA 1WNSA 4FLZA 1VSKA 2Q3SA 3C6TA 4CE9A 4FLYA 2XY7A 1L3UA 1FKOA 2OZSA 5HRPA 4Z4EA 1QSSA 1RDDA 5J2NA 3TAQA 4M3TA 4CHYA 2A1SA 4WE1A 4RW7A 4C8NA 3HPOA 3KK2A 3EY1A 4HUGA 3V81A 3S3NA 3K58A 3V1RA 4I7FA 1NK8A 1ZBHA 4FJKA 3G10A 3T19A 3NGIA 2G8VA 3E01A 1S5JA 4DFPA 4O5BA 3V9SA 3HT3A 3T1AA 1L3VA 4JS5A 1W0HA 1NKCA 3K5MA 1HYVA 2HHQA 3DLRA 4Z0UA 2FC0A 4M41A 4E19A 1U04A 2ZE2A 1HNIA 3KK3A 2Y1JA 2X74A 2FBXA 3OYAA 4E0DA 4PQUA 4FJJA 3AO3A 1X9MA 4BACA 3RRHA 2HW3A 1IKYA 4KTZA 4DSLA 2YV0X 2B6AA 2D5RA 4Q0BA 3K2PA 1JLBA 1S6PA 2BDPA 3SI6A 3PV8A 2O4GA 1VSDA 1C6VA 1UOCA 1XHZA 1VRUA 3WNFA 1S1UA 1BQNA 2OPQA 1IKWA 1DTQA 3DLEA 3TI0A 4B3OA 4DS4A 4K8ZA 3QERA 3ZT1A 2BANA 5KGWA 3NE6A 4B9TA 1YVUA 1TKTA 3K57A 2HHXA 1KVBA 4CEQA 1LWEA 2KZMA 4I9LA 3HP6A 1RNHA 1RT2A 3RRGA 4KTWA 1TV6A 3IG1A 2WOMA 1HQEA 3AVLA 1EP4A 1LWFA 1BISA 1QHTA 3DOLA 4CFAA 3LALA 3HK2A 2KFNA 1CXUA 1QSLA 3ZCMA 3ZSYA 4B08A 3QO9A 3PX0A 4C8KA 2Z1GA 4Y1CA 4CJKA 2I5JA 3RWUA 2W42A 3RMDA 1BGXT 3LP0A 2O4IA 1MU2A 2JGUA 3U3YA 2KZZA 1IKXA 4W5TA 1CXQA 1RBTA 2RKIA 4CHPA 4FW1A 5K14A 5HRNA 4OPJA 4MQ3A 5CYMA 2F8TA 4BDZA 3VQDA 2ZD1A 3PUFA 4CFCA 4DLEA 3SUNA 3V4IA 3NDKA 3ZT4A 3PY8A 2HHWA 5D3GA 5CYQA 4FZZA 5JS1A 3PO5A 3A2FA 4F8RA 3OYEA 1LWCA 4KHSA 4E7IA 2PYLA 2FBVA 4CK3A 1T8EA 4CFDA 2G8KA 4C8LA 3DMJA 2DFHA 2G8FA 4UQGA 5HBMA 3KLIA 3NF8A 1TAUA 3L2UA 4CERA 2P51A 4CJ5A 3OJSA 1RBSA 4LD0A 1KVCA 4NYNA 5DMRA 4M3XA 3SUOA 4CHOA 3MEEA 2D0AA 1DTTA 3FFIA 4B8CA 3QEWA 3QNNA 4ID1A 5KI6A 4FJHA 3KIOA 4LY7A 3VQ7A 4DSFA 3DLHA 3ASMA 4FYDA 3K5NA 4DS5A 2DTUA 1R0AA 1DLOA 2FBTA 1D9FA 1KTQA 3IRXA 4EP4A 5HP1A 3V9XA 1BI4A 1WAJA 2VWJA 4Y1DA 4IBNA 4DQSA 1JXEA 4LSNA 1VSEA 4J2BA 2G8UA 4DU3A 3AO4A 4E89A 4O55A 3WNEA 4CK1A 5J1EA 4JLHA 4CJWA 2YNIA 1RDAA 1S6QA 2YNFA 3AA2A 4E3SA 4BWMA 4CJPA 1B92A 1VK0A 2RN2A 2X6SA 4O44A 3OS2A 3DRSA 4CJSA 1L5UA 4HUEA 3KD5E 3K5LA 1N5YA 1RILA 3BGRA 4E7HA 2XRIA 4I2QA 1VSHA 1K6YA 1RTJA 4B8AB 4CHNA 4DFKA 3D0PA 3SJJA 4DSJA 4FZXC 4BDYA 3LAMA 1KLMA 3HPGA 1NJWA 4JS4A 2EX3A 3VQCA 3NFAA 1A5WA 1LAVA 2XO7A 2D0BA 3LZJA 1UA1A 1RDBA 1W9HA 4CESA 5KTQA 3MECA 4HTUA 1S1TA 3AVGA 4GMJB 4CF0A 4M45A 3M8PA 4KTQA 3L3VA 1EETA 3L3UA 4HVJA 3QETA 1UA0A 2QXFA 5KRSA 4L8RB 4EP5A 1NKBA 3SV3A 1VSFA 3O3HA 3IAYA 2EHGA 4F3OA 4PWDA 4I2PA 4CGDA 3ZSOA 1NOZA 4LH4A 3V1QA 2OPPA 3RMBA 1X9SA 1S1WA 1X1PA 3S3MA 4LH5A 1IKVA 3ZSXA 4CJ3A 4F4KA 5FDLA 1RTDA 4E7LA 3AVBA 1GOBA 3M8SA 4DQRA 4NCAA 2HNDA 4F2RA 3CM6A 3OJUA 1CLQA 3NCIA 1LV5A 3OYHA 4ZTJA 3I0SA 3ULDA 1RBRA 2F96A 1KCFA 1U48A 4OPKA 4B9VA 4QCLA 3VQ6A 4CGHA 3NGZA 3ZSVA 3SUQA 3V1OA 2B4JA 3DYAA 5CY4A 3HSTB 1A5VA 3QLHA 3MXMA 1QSYA 4DLGA 3M8QA 3ZSRA 4R5PA 3ISNC 3PX6A 3MEGA 1HQUA 4BE0A 4KB1A 4GW6A 3CG7A 5FRMA 3MXIA 3SPZA 2YHAA 3B6OA 4N56A 2E4LA 5J2PA 4AHRA 1A5XA 2B5JA 3T3FA 4CF9A 2P1JA 4N41A 1SKSA 4EZ9A 2E6MA 4DSIA 1WSHA 3I0RA 2AJQA 3TR8A 4OJRA 1SL2A 3AVJA 2VG6A 4DQIA 5SWMA 3K5OA 3SNNA 3BDPA 4J2EA 3LP1A 4H8KA 3JSMA 4OKKA 4FJGA 4DG1A 2YKNA 3QINA 4Z4CA 1O1WA 1NK4A 4KI6A 1FKPA 2F8SA 4YNQA 4HUFA 4CECA 1HYSA 3RMCA 3SYZA 1VSMA 5HRRA 4BE1A 4KHYA 3VQ5A 1RT5A 2JLEA 4M3YA 1VRTA 1NOYA 1BHLA 4KKOA 1RT6A 4E7JA 3TARA 1ITGA 5J2MA 4DQPA 4CFBA 4KB0A 4EZ6A 2IC3A 1LW0A 1ZBFA 5C42A 3OYFA 3VA0A 1NJXA 1JLCA 3RTVA 1G15A 3U6FA 4B9MA 1JL2A 1T03A 2Z1HA 3HVRA 3AVCA 3NGYA 1NK0A 1I3AA 2KTQA 1NJZA 1JLAA 4ICLA 4CCHA 4FLUA 1TK5A 3DOKA 4H4MA 4XIUA 1BQMA 1Z25A 2YKMA 3D45A 1ZBUA 4NCGA 1XI1A 4KAZA 4KRFA 1WSGA 3K59A 1KVAA 2OPRA 3AO5A 4M3ZA 3I8DA 2HHUA 1C1CA 3OYLA 3PO4A 1WSFA 3JYTA 2QKBA 1RT3A 3AA4A 2X6NA 2FBYA 4NCBA 3L2VA 4OLAA 3NF6A 4JRPA 1QQCA 1C0UA 1RBUA 3CFPA 3V9UA 2G8WA 3HVTA 3LPTA 3THVA 1HNVA 3F73A 4CJFA 1UWBA 3C94A 4DMNA 3DRPA 2E6LA 2XY5A 2ATQA 5JS2A 3L2RA 3NH0A 4CGJA 3L8BA 3P83D 3AVFA 4HCCA 3LPUA 3QEVA 3P5JA 4B9LA 2G8HA 4IFYA 4CF8A 2IS3A 4W5RA 4H4OA 1RT1A 3M8RA 4KFBA 2Z1JA 5SZTA 4M3RA 3OS1A 3RR7A 2P5GA 2PYJA 1NK5A 4OLBA 2YNHA 1KSPA 4FJ7A 4CIFA 4ID5A 5C25A 1ASWA 4DTRA 1TK8A 1FK9A 1EX4A 3DLKA 1L3TA 3LWLA 3CFRA 2NUBA 4CEOA 2P5OA 1BI4B 1IO2A 4OKEA 1I39A 5DK5A 3OYNA 4DTPA 4CEEA 1D8YA 2OA8A 3KKRA 3VQ4A 1SKWA 1T05A 4Z4GA 1ASUA 3G0ZA 1KRPA 1JLEA 4BDPA 1S1VA 3CFOA 4AHVA 1SV5A 1VSJA 1LAWA 1FXXA 3AVAA 3ZT0A 2Y1IA 1TK0A 4DSEA 4KREA 1REVA 4AHSA 1TVRA 3OYMA 3HM9A 1J53A 3OYJA 4FM1A 3S3OA 4PY5A 4FJ8A 2HHSA 3AVHA 4O0IA 1U45A 1C0TA 1NK7A 3L2QA 1D9DA 2ZQBA 2X78A 5KGXA 3SCXA 1WAFA 4DTXA 4CJLA 3SQ4A 5EU7A 3AA3A 4B9NA 1JXBA 2GBZA 4RW9A 1TKZA 3S9HA 2OZMA 4TSXA 2RF2A 4FJMA 1GOAA 1TL1A 3CM5A 1TKXA 3DI6A 4CEDA 3NAEA 2R7YA 3V9ZA 3SQ1A 4ELVA 1TAQA 2GV9A 4FK0A 1NJYA 4IDKA 4AHCA 2IOCA 3OS0A 3P1GA 3SQ2A 3B6PA 4Z4HA 1QTMA 2HB5A 4ZTFA 4FJ5A 4FJ9A 1Q9XA 3TAGA 1LW2A 3O3GA 2XY6A 2D0CA 4IFVA 4E7KA 3NH1A 4QOZB 1J54A 3OYGA 3AVKA 2GUIA 2HHVA 1XC9A 4CJRA 4CJTA 4K8XA 1N6QA 1JLGA 5HLFA 4DTSA 3EYZA 2IAJA 4N5SA 2HMIA 4CHQA 4Z4FA 4ZHRA 4CF2A 3CYMA 1HYZA 1GOCA 1SUQA 3OVNA 4W5NA 4M3UA 2Z1IA 1CZ9A 4CK2A 4FJNA 4FLXA 3QIPA 4OKJA 4DFJA 1KFDA 2KW4A 5J2QA 4DF8A 5FRNA 4BWJA 3LZIA 4E1MA 5CZ2A 4M42A 4NYFA 3DLGA 5I3UA 4CIGA 4CGIA 1IG9A 4FJLA 1WLJA 2BE2A 4KHWA 1QE1A 4G1QA 3LANA 1UAXA 3HL8A 4PUOA 1C1BA 4LSLA 3MEDA 3KLGA 4DF4A 2PZSA 2LSNA 3KLEA 3AVIA 4C8OA 1RBVA 3WNHA 3SZ2A 1IH7A 2DFEA 1CZBA 3HXMA 1RT4A 4DSKA 3LAKA 4QAGA 3C95A 3TANA 3AO2A 4DTNA 2QKKA 2KQ2A 4GVMA 1TL3A 3RMAA 1BCOA 1S9GA 3VQEA 4FK2A 3SPYA 1B9FA 1D5AA 4KO0A 3V9WA 2HVIA 1J5OA 2DFFA 1XWLA 3VQBA 4IKFA 2HHTA 2XY8A 4RW6A 1L3SA 1EXQA 3NF7A 4O0JA 3O3FA 1BIUA 3ZSWA 3NF9A 3LDSA 1QS4A 3U3GA 3OYIA 3KTQA 3C6UA 4RW4A 1RDCA 4CF1A 1ZBIA 1TGOA 3ZT2A 4ELTA 1F21A 3AVMA 1JL1A 1HPZA 2RPIA 4OVLA 4RG8A 4FLWA 2VG7A 3VQ8A 1SL0A 1JLFA 4KV8A 1TKDA 4J2AA 4FK4A 4CJVA 3DRRA 3EZ5A 4CJ4A 3VQPA 4IG3A 3LWMA 4DU4A 4CGGA 1ASVA 3HPHA 4N47A 3CQ8A 4AHTA 1ZYQA 4ELUA 3MAQA 1KLNA 1BIZA 3QESA 4N76A 2QK9A 4AH9A 3AVNA 4DU1A 1S9EA 1XHXA 4F3TA 3NH2A 4IG0A 3VA3A 1Z26A 3ZSQA 3KKSA 3OYKA 2BGGA 3WNGA 1WN7A 4HCBA 3TAFA 3KD1E 3KK1A 1B9DA 4RW8A 3QEXA 4FW2A 2OYQA 4DFMA 3AO1A 1Q9YA 2DY4A 4CJQA 3O4NA 3ZSZA 1YT3A 4E1NA 1C1AA 4CJEA 5E41A 4JRQA 1JLQA 3TAEA 4CEBA 3L2WA 3UIQA 4I9QA 3OYBA 4DTUA 3MXJA 4B9SA 2VG5A 5CZ1A 3RR8A 1HRHA 2IGIA 4DTJA 1NK6A 2YNGA 1BL3A 1HJRA 4CIEA 4Q5VA 1RTIA 3VQQA 1NK9A 4FXDA 4DQQA 2WONA 1VSIA 1JKHA 4AHUA 4HHTA 1J9AA 2ETJA 3AA5X 4KHNA 3TAPA 4FJIA 1C0MA 3KLFA 1YTUA 1VSLA 1YTAA 1SKRA 3OYCA 2HVHA 1Y97A 3SUPA 3VQAA 5I42A 4CEFA 4FLVA 4OGCA 3OY9A 3TAMA 4M3WA 1ZBLA 4MFBA 3VN5A 1BCMA 3HP9A 4J2DA 1U47A 3QIOA 2ITGA 1U49A 1X9WA 2HNYA 1U4BA 3HO1A 3F9KA 4FLTA 4Z4IA 4KPYA 2HNZA 4CHZA 4KI4A 3PX4A 4DTMA 4W5OA 3HJFA 4OGEA 2YHBA 3SV4A 4O4GA 2VWKA 3TABA 5T7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FM0 A;  4AIL C;  1KFS A;  5HRO A;  5HRS A;  3QEI A;  1RCH A;  2A1R A;  4CEA A;  4FM2 A;  1HMV A;  3HYF A;  4BE2 A;  2PY5 A;  4KHU A;  4KHQ A;  3V6D A;  1WSJ A;  4C8M A;  3TWH A;  3H08 A;  4B9U A;  4FJX A;  3LP3 A;  2KFZ A;  2IDO A;  3KLH A;  2OPS A;  3DM2 A;  5FRO A;  4YFU A;  4F2S A;  4CGF A;  1WSI A;  1WSE A;  3LP2 A;  3VQ9 A;  3ZT3 A;  4W5Q A;  4PA1 A;  4FVM A;  1T7P A;  1NKE A;  3O4Q A;  1RT7 A;  3AV9 A;  5KRT A;  4FCY A;  4DTO A;  3QEP A;  2XHB A;  3DLB A;  3KJV A;  1S1X A;  2G8I A;  1SL1 A;  1Q8I A;  3NHG A;  3SQ0 A;  5C24 A;  1RTH A;  1EKE A;  4DWI A;  3NBP A;  3IS9 A;  4CJU A;  4FZY A;  3OYD A;  3ALY A;  3ITH A;  3QNO A;  4CEZ A;  1WNS A;  4FLZ A;  1VSK A;  2Q3S A;  3C6T A;  4CE9 A;  4FLY A;  2XY7 A;  1L3U A;  1FKO A;  2OZS A;  5HRP A;  4Z4E A;  1QSS A;  1RDD A;  5J2N A;  3TAQ A;  4M3T A;  4CHY A;  2A1S A;  4WE1 A;  4RW7 A;  4C8N A;  3HPO A;  3KK2 A;  3EY1 A;  4HUG A;  3V81 A;  3S3N A;  3K58 A;  3V1R A;  4I7F A;  1NK8 A;  1ZBH A;  4FJK A;  3G10 A;  3T19 A;  3NGI A;  2G8V A;  3E01 A;  1S5J A;  4DFP A;  4O5B A;  3V9S A;  3HT3 A;  3T1A A;  1L3V A;  4JS5 A;  1W0H A;  1NKC A;  3K5M A;  1HYV A;  2HHQ A;  3DLR A;  4Z0U A;  2FC0 A;  4M41 A;  4E19 A;  1U04 A;  2ZE2 A;  1HNI A;  3KK3 A;  2Y1J A;  2X74 A;  2FBX A;  3OYA A;  4E0D A;  4PQU A;  4FJJ A;  3AO3 A;  1X9M A;  4BAC A;  3RRH A;  2HW3 A;  1IKY A;  4KTZ A;  4DSL A;  2YV0 X;  2B6A A;  2D5R A;  4Q0B A;  3K2P A;  1JLB A;  1S6P A;  2BDP A;  3SI6 A;  3PV8 A;  2O4G A;  1VSD A;  1C6V A;  1UOC A;  1XHZ A;  1VRU A;  3WNF A;  1S1U A;  1BQN A;  2OPQ A;  1IKW A;  1DTQ A;  3DLE A;  3TI0 A;  4B3O A;  4DS4 A;  4K8Z A;  3QER A;  3ZT1 A;  2BAN A;  5KGW A;  3NE6 A;  4B9T A;  1YVU A;  1TKT A;  3K57 A;  2HHX A;  1KVB A;  4CEQ A;  1LWE A;  2KZM A;  4I9L A;  3HP6 A;  1RNH A;  1RT2 A;  3RRG A;  4KTW A;  1TV6 A;  3IG1 A;  2WOM A;  1HQE A;  3AVL A;  1EP4 A;  1LWF A;  1BIS A;  1QHT A;  3DOL A;  4CFA A;  3LAL A;  3HK2 A;  2KFN A;  1CXU A;  1QSL A;  3ZCM A;  3ZSY A;  4B08 A;  3QO9 A;  3PX0 A;  4C8K A;  2Z1G A;  4Y1C A;  4CJK A;  2I5J A;  3RWU A;  2W42 A;  3RMD A;  1BGX T;  3LP0 A;  2O4I A;  1MU2 A;  2JGU A;  3U3Y A;  2KZZ A;  1IKX A;  4W5T A;  1CXQ A;  1RBT A;  2RKI A;  4CHP A;  4FW1 A;  5K14 A;  5HRN A;  4OPJ A;  4MQ3 A;  5CYM A;  2F8T A;  4BDZ A;  3VQD A;  2ZD1 A;  3PUF A;  4CFC A;  4DLE A;  3SUN A;  3V4I A;  3NDK A;  3ZT4 A;  3PY8 A;  2HHW A;  5D3G A;  5CYQ A;  4FZZ A;  5JS1 A;  3PO5 A;  3A2F A;  4F8R A;  3OYE A;  1LWC A;  4KHS A;  4E7I A;  2PYL A;  2FBV A;  4CK3 A;  1T8E A;  4CFD A;  2G8K A;  4C8L A;  3DMJ A;  2DFH A;  2G8F A;  4UQG A;  5HBM A;  3KLI A;  3NF8 A;  1TAU A;  3L2U A;  4CER A;  2P51 A;  4CJ5 A;  3OJS A;  1RBS A;  4LD0 A;  1KVC A;  4NYN A;  5DMR A;  4M3X A;  3SUO A;  4CHO A;  3MEE A;  2D0A A;  1DTT A;  3FFI A;  4B8C A;  3QEW A;  3QNN A;  4ID1 A;  5KI6 A;  4FJH A;  3KIO A;  4LY7 A;  3VQ7 A;  4DSF A;  3DLH A;  3ASM A;  4FYD A;  3K5N A;  4DS5 A;  2DTU A;  1R0A A;  1DLO A;  2FBT A;  1D9F A;  1KTQ A;  3IRX A;  4EP4 A;  5HP1 A;  3V9X A;  1BI4 A;  1WAJ A;  2VWJ A;  4Y1D A;  4IBN A;  4DQS A;  1JXE A;  4LSN A;  1VSE A;  4J2B A;  2G8U A;  4DU3 A;  3AO4 A;  4E89 A;  4O55 A;  3WNE A;  4CK1 A;  5J1E A;  4JLH A;  4CJW A;  2YNI A;  1RDA A;  1S6Q A;  2YNF A;  3AA2 A;  4E3S A;  4BWM A;  4CJP A;  1B92 A;  1VK0 A;  2RN2 A;  2X6S A;  4O44 A;  3OS2 A;  3DRS A;  4CJS A;  1L5U A;  4HUE A;  3KD5 E;  3K5L A;  1N5Y A;  1RIL A;  3BGR A;  4E7H A;  2XRI A;  4I2Q A;  1VSH A;  1K6Y A;  1RTJ A;  4B8A B;  4CHN A;  4DFK A;  3D0P A;  3SJJ A;  4DSJ A;  4FZX C;  4BDY A;  3LAM A;  1KLM A;  3HPG A;  1NJW A;  4JS4 A;  2EX3 A;  3VQC A;  3NFA A;  1A5W A;  1LAV A;  2XO7 A;  2D0B A;  3LZJ A;  1UA1 A;  1RDB A;  1W9H A;  4CES A;  5KTQ A;  3MEC A;  4HTU A;  1S1T A;  3AVG A;  4GMJ B;  4CF0 A;  4M45 A;  3M8P A;  4KTQ A;  3L3V A;  1EET A;  3L3U A;  4HVJ A;  3QET A;  1UA0 A;  2QXF A;  5KRS A;  4L8R B;  4EP5 A;  1NKB A;  3SV3 A;  1VSF A;  3O3H A;  3IAY A;  2EHG A;  4F3O A;  4PWD A;  4I2P A;  4CGD A;  3ZSO A;  1NOZ A;  4LH4 A;  3V1Q A;  2OPP A;  3RMB A;  1X9S A;  1S1W A;  1X1P A;  3S3M A;  4LH5 A;  1IKV A;  3ZSX A;  4CJ3 A;  4F4K A;  5FDL A;  1RTD A;  4E7L A;  3AVB A;  1GOB A;  3M8S A;  4DQR A;  4NCA A;  2HND A;  4F2R A;  3CM6 A;  3OJU A;  1CLQ A;  3NCI A;  1LV5 A;  3OYH A;  4ZTJ A;  3I0S A;  3ULD A;  1RBR A;  2F96 A;  1KCF A;  1U48 A;  4OPK A;  4B9V A;  4QCL A;  3VQ6 A;  4CGH A;  3NGZ A;  3ZSV A;  3SUQ A;  3V1O A;  2B4J A;  3DYA A;  5CY4 A;  3HST B;  1A5V A;  3QLH A;  3MXM A;  1QSY A;  4DLG A;  3M8Q A;  3ZSR A;  4R5P A;  3ISN C;  3PX6 A;  3MEG A;  1HQU A;  4BE0 A;  4KB1 A;  4GW6 A;  3CG7 A;  5FRM A;  3MXI A;  3SPZ A;  2YHA A;  3B6O A;  4N56 A;  2E4L A;  5J2P A;  4AHR A;  1A5X A;  2B5J A;  3T3F A;  4CF9 A;  2P1J A;  4N41 A;  1SKS A;  4EZ9 A;  2E6M A;  4DSI A;  1WSH A;  3I0R A;  2AJQ A;  3TR8 A;  4OJR A;  1SL2 A;  3AVJ A;  2VG6 A;  4DQI A;  5SWM A;  3K5O A;  3SNN A;  3BDP A;  4J2E A;  3LP1 A;  4H8K A;  3JSM A;  4OKK A;  4FJG A;  4DG1 A;  2YKN A;  3QIN A;  4Z4C A;  1O1W A;  1NK4 A;  4KI6 A;  1FKP A;  2F8S A;  4YNQ A;  4HUF A;  4CEC A;  1HYS A;  3RMC A;  3SYZ A;  1VSM A;  5HRR A;  4BE1 A;  4KHY A;  3VQ5 A;  1RT5 A;  2JLE A;  4M3Y A;  1VRT A;  1NOY A;  1BHL A;  4KKO A;  1RT6 A;  4E7J A;  3TAR A;  1ITG A;  5J2M A;  4DQP A;  4CFB A;  4KB0 A;  4EZ6 A;  2IC3 A;  1LW0 A;  1ZBF A;  5C42 A;  3OYF A;  3VA0 A;  1NJX A;  1JLC A;  3RTV A;  1G15 A;  3U6F A;  4B9M A;  1JL2 A;  1T03 A;  2Z1H A;  3HVR A;  3AVC A;  3NGY A;  1NK0 A;  1I3A A;  2KTQ A;  1NJZ A;  1JLA A;  4ICL A;  4CCH A;  4FLU A;  1TK5 A;  3DOK A;  4H4M A;  4XIU A;  1BQM A;  1Z25 A;  2YKM A;  3D45 A;  1ZBU A;  4NCG A;  1XI1 A;  4KAZ A;  4KRF A;  1WSG A;  3K59 A;  1KVA A;  2OPR A;  3AO5 A;  4M3Z A;  3I8D A;  2HHU A;  1C1C A;  3OYL A;  3PO4 A;  1WSF A;  3JYT A;  2QKB A;  1RT3 A;  3AA4 A;  2X6N A;  2FBY A;  4NCB A;  3L2V A;  4OLA A;  3NF6 A;  4JRP A;  1QQC A;  1C0U A;  1RBU A;  3CFP A;  3V9U A;  2G8W A;  3HVT A;  3LPT A;  3THV A;  1HNV A;  3F73 A;  4CJF A;  1UWB A;  3C94 A;  4DMN A;  3DRP A;  2E6L A;  2XY5 A;  2ATQ A;  5JS2 A;  3L2R A;  3NH0 A;  4CGJ A;  3L8B A;  3P83 D;  3AVF A;  4HCC A;  3LPU A;  3QEV A;  3P5J A;  4B9L A;  2G8H A;  4IFY A;  4CF8 A;  2IS3 A;  4W5R A;  4H4O A;  1RT1 A;  3M8R A;  4KFB A;  2Z1J A;  5SZT A;  4M3R A;  3OS1 A;  3RR7 A;  2P5G A;  2PYJ A;  1NK5 A;  4OLB A;  2YNH A;  1KSP A;  4FJ7 A;  4CIF A;  4ID5 A;  5C25 A;  1ASW A;  4DTR A;  1TK8 A;  1FK9 A;  1EX4 A;  3DLK A;  1L3T A;  3LWL A;  3CFR A;  2NUB A;  4CEO A;  2P5O A;  1BI4 B;  1IO2 A;  4OKE A;  1I39 A;  5DK5 A;  3OYN A;  4DTP A;  4CEE A;  1D8Y A;  2OA8 A;  3KKR A;  3VQ4 A;  1SKW A;  1T05 A;  4Z4G A;  1ASU A;  3G0Z A;  1KRP A;  1JLE A;  4BDP A;  1S1V A;  3CFO A;  4AHV A;  1SV5 A;  1VSJ A;  1LAW A;  1FXX A;  3AVA A;  3ZT0 A;  2Y1I A;  1TK0 A;  4DSE A;  4KRE A;  1REV A;  4AHS A;  1TVR A;  3OYM A;  3HM9 A;  1J53 A;  3OYJ A;  4FM1 A;  3S3O A;  4PY5 A;  4FJ8 A;  2HHS A;  3AVH A;  4O0I A;  1U45 A;  1C0T A;  1NK7 A;  3L2Q A;  1D9D A;  2ZQB A;  2X78 A;  5KGX A;  3SCX A;  1WAF A;  4DTX A;  4CJL A;  3SQ4 A;  5EU7 A;  3AA3 A;  4B9N A;  1JXB A;  2GBZ A;  4RW9 A;  1TKZ A;  3S9H A;  2OZM A;  4TSX A;  2RF2 A;  4FJM A;  1GOA A;  1TL1 A;  3CM5 A;  1TKX A;  3DI6 A;  4CED A;  3NAE A;  2R7Y A;  3V9Z A;  3SQ1 A;  4ELV A;  1TAQ A;  2GV9 A;  4FK0 A;  1NJY A;  4IDK A;  4AHC A;  2IOC A;  3OS0 A;  3P1G A;  3SQ2 A;  3B6P A;  4Z4H A;  1QTM A;  2HB5 A;  4ZTF A;  4FJ5 A;  4FJ9 A;  1Q9X A;  3TAG A;  1LW2 A;  3O3G A;  2XY6 A;  2D0C A;  4IFV A;  4E7K A;  3NH1 A;  4QOZ B;  1J54 A;  3OYG A;  3AVK A;  2GUI A;  2HHV A;  1XC9 A;  4CJR A;  4CJT A;  4K8X A;  1N6Q A;  1JLG A;  5HLF A;  4DTS A;  3EYZ A;  2IAJ A;  4N5S A;  2HMI A;  4CHQ A;  4Z4F A;  4ZHR A;  4CF2 A;  3CYM A;  1HYZ A;  1GOC A;  1SUQ A;  3OVN A;  4W5N A;  4M3U A;  2Z1I A;  1CZ9 A;  4CK2 A;  4FJN A;  4FLX A;  3QIP A;  4OKJ A;  4DFJ A;  1KFD A;  2KW4 A;  5J2Q A;  4DF8 A;  5FRN A;  4BWJ A;  3LZI A;  4E1M A;  5CZ2 A;  4M42 A;  4NYF A;  3DLG A;  5I3U A;  4CIG A;  4CGI A;  1IG9 A;  4FJL A;  1WLJ A;  2BE2 A;  4KHW A;  1QE1 A;  4G1Q A;  3LAN A;  1UAX A;  3HL8 A;  4PUO A;  1C1B A;  4LSL A;  3MED A;  3KLG A;  4DF4 A;  2PZS A;  2LSN A;  3KLE A;  3AVI A;  4C8O A;  1RBV A;  3WNH A;  3SZ2 A;  1IH7 A;  2DFE A;  1CZB A;  3HXM A;  1RT4 A;  4DSK A;  3LAK A;  4QAG A;  3C95 A;  3TAN A;  3AO2 A;  4DTN A;  2QKK A;  2KQ2 A;  4GVM A;  1TL3 A;  3RMA A;  1BCO A;  1S9G A;  3VQE A;  4FK2 A;  3SPY A;  1B9F A;  1D5A A;  4KO0 A;  3V9W A;  2HVI A;  1J5O A;  2DFF A;  1XWL A;  3VQB A;  4IKF A;  2HHT A;  2XY8 A;  4RW6 A;  1L3S A;  1EXQ A;  3NF7 A;  4O0J A;  3O3F A;  1BIU A;  3ZSW A;  3NF9 A;  3LDS A;  1QS4 A;  3U3G A;  3OYI A;  3KTQ A;  3C6U A;  4RW4 A;  1RDC A;  4CF1 A;  1ZBI A;  1TGO A;  3ZT2 A;  4ELT A;  1F21 A;  3AVM A;  1JL1 A;  1HPZ A;  2RPI A;  4OVL A;  4RG8 A;  4FLW A;  2VG7 A;  3VQ8 A;  1SL0 A;  1JLF A;  4KV8 A;  1TKD A;  4J2A A;  4FK4 A;  4CJV A;  3DRR A;  3EZ5 A;  4CJ4 A;  3VQP A;  4IG3 A;  3LWM A;  4DU4 A;  4CGG A;  1ASV A;  3HPH A;  4N47 A;  3CQ8 A;  4AHT A;  1ZYQ A;  4ELU A;  3MAQ A;  1KLN A;  1BIZ A;  3QES A;  4N76 A;  2QK9 A;  4AH9 A;  3AVN A;  4DU1 A;  1S9E A;  1XHX A;  4F3T A;  3NH2 A;  4IG0 A;  3VA3 A;  1Z26 A;  3ZSQ A;  3KKS A;  3OYK A;  2BGG A;  3WNG A;  1WN7 A;  4HCB A;  3TAF A;  3KD1 E;  3KK1 A;  1B9D A;  4RW8 A;  3QEX A;  4FW2 A;  2OYQ A;  4DFM A;  3AO1 A;  1Q9Y A;  2DY4 A;  4CJQ A;  3O4N A;  3ZSZ A;  1YT3 A;  4E1N A;  1C1A A;  4CJE A;  5E41 A;  4JRQ A;  1JLQ A;  3TAE A;  4CEB A;  3L2W A;  3UIQ A;  4I9Q A;  3OYB A;  4DTU A;  3MXJ A;  4B9S A;  2VG5 A;  5CZ1 A;  3RR8 A;  1HRH A;  2IGI A;  4DTJ A;  1NK6 A;  2YNG A;  1BL3 A;  1HJR A;  4CIE A;  4Q5V A;  1RTI A;  3VQQ A;  1NK9 A;  4FXD A;  4DQQ A;  2WON A;  1VSI A;  1JKH A;  4AHU A;  4HHT A;  1J9A A;  2ETJ A;  3AA5 X;  4KHN A;  3TAP A;  4FJI A;  1C0M A;  3KLF A;  1YTU A;  1VSL A;  1YTA A;  1SKR A;  3OYC A;  2HVH A;  1Y97 A;  3SUP A;  3VQA A;  5I42 A;  4CEF A;  4FLV A;  4OGC A;  3OY9 A;  3TAM A;  4M3W A;  1ZBL A;  4MFB A;  3VN5 A;  1BCM A;  3HP9 A;  4J2D A;  1U47 A;  3QIO A;  2ITG A;  1U49 A;  1X9W A;  2HNY A;  1U4B A;  3HO1 A;  3F9K A;  4FLT A;  4Z4I A;  4KPY A;  2HNZ A;  4CHZ A;  4KI4 A;  3PX4 A;  4DTM A;  4W5O A;  3HJF A;  4OGE A;  2YHB A;  3SV4 A;  4O4G A;  2VWK A;  3TAB A;  5T7B A; 
#chains in the Genus database with same CATH topology
 4AIL C;  1RCH A;  4BE2 A;  2PY5 A;  4KHQ A;  3TWH A;  1Q7Y O;  3KLH A;  3DM2 A;  4H5W A;  1SAZ A;  4CGF A;  3QML A;  1N34 K;  1Z05 A;  3FLC O;  3EKU A;  1E4F T;  3OTO K;  4DTO A;  3DLB A;  3O8M A;  3RVC A;  1ESV A;  4ISF A;  3L4Q A;  3ZEU A;  3VF6 A;  5A2Q O;  4FWQ A;  4CEZ A;  1VSK A;  2XY7 A;  3FE1 A;  4CE9 A;  4FWK A;  3ENB A;  1RDD A;  2WTU A;  4CHY A;  2A1S A;  4C8N A;  3HPO A;  3O9R A;  2QWP A;  3G10 A;  1TYQ A;  3T19 A;  3E01 A;  4O5B A;  5E84 A;  4JS5 A;  3LDO A;  3JS6 A;  2ZE2 A;  4BC5 A;  3OYA A;  3O1W A;  1X9M A;  3RRH A;  1FW6 A;  4LF4 K;  1S6P A;  3PV8 A;  1C6V A;  4IJN A;  1VQ8 N;  3WNF A;  4DV5 K;  1S1U A;  4DS4 A;  3QER A;  3C7N A;  2BAN A;  3NE6 A;  1TKT A;  4BC2 A;  1LWE A;  1RNH A;  4KTW A;  1LOT B;  5JMV A;  1C0F A;  4BC4 A;  3HK2 A;  1TUY A;  1ATR A;  4B08 A;  3QO9 A;  4MDA A;  4JNE A;  5BN8 A;  2Z1G A;  4L3Q A;  2ZGY A;  3RWU A;  4JKC A;  1BGX T;  3HBT A;  2O4I A;  1MU2 A;  3GG4 A;  1HJO A;  2F8T A;  3VQD A;  5BRF A;  1LCU A;  1LWC A;  5C2F A;  4A5A A;  2NZT A;  4JKD A;  5HBM A;  4YHH K;  3NF8 A;  1VQL N;  1TAU A;  3H3N O;  3CJA A;  4CJ5 A;  3OJS A;  5LJW A;  2ZGZ A;  4H0V B;  3FFI A;  3HTV A;  5KI6 A;  3WXK A;  2GEM A;  3KIO A;  4JI3 K;  2BTF A;  5JLF A;  4DV6 K;  2FBT A;  5GAE P;  5I9E B;  4DV2 K;  3IRX A;  4EP4 A;  3V9X A;  1BI4 A;  2E1Y A;  1JXE A;  1VSE A;  2G8U A;  3AO4 A;  4JLH A;  2YNI A;  3CCE N;  4C23 A;  4A2B A;  4IXC A;  3TPQ A;  4BWM A;  2X6S A;  1L5U A;  4CJS A;  1W97 L;  4HUE A;  3KD5 E;  3K5L A;  3BGR A;  4PL7 A;  1VQP N;  4E7H A;  2XRI A;  4B1W B;  1K6Y A;  1KQS M;  4FZX C;  1IG8 A;  1R59 O;  1KLM A;  4JS4 A;  2EX3 A;  3MK6 A;  1NGH A;  5BRE A;  3DAW A;  3LZJ A;  4B3S K;  3GOI A;  4KH6 A;  4KTQ A;  1UA0 A;  1EET A;  4HVJ A;  1NKB A;  4F3O A;  4GY2 B;  3ZSO A;  1NOZ A;  4LH4 A;  2E2O A;  5AQW A;  1X9S A;  4LH5 A;  1E3M A;  1GLA G;  3M8S A;  4DQR A;  4WFN L;  2HND A;  5BRH A;  3NCI A;  3THX B;  4ZTJ A;  4QCL A;  3O4W A;  3DXM B;  3CPE A;  1QSY A;  3HST B;  3QLH A;  5C0Y A;  1BWF O;  3M8Q A;  5B8H A;  2BH1 A;  4F9O A;  3K9J A;  1YJW N;  2V52 B;  5FRM A;  3MXI A;  3SPZ A;  2UUC K;  4JN4 A;  2E4L A;  1K8A O;  3OHR A;  4A57 A;  3MN6 A;  1NGE A;  4DSI A;  2A6A A;  1WSH A;  3B8A X;  1XQS C;  1SL2 A;  1T6C A;  2VG6 A;  3SNN A;  3BDP A;  3LP1 A;  4H8K A;  3HOS A;  1O1W A;  3S41 A;  1HYS A;  1VSM A;  2D1K A;  5F1X A;  2JLE A;  4M3Y A;  1SQK A;  2NRW A;  1NOY A;  4E7J A;  1RT6 A;  3FZM A;  1VQ9 N;  5GAG P;  1W2B M;  2IC3 A;  4DUZ K;  3ID6 A;  4JD2 B;  1G15 A;  2Z1H A;  3NGY A;  1EWR A;  1QZ5 A;  1JLA A;  4CCH A;  4XIU A;  4NCG A;  5C2D A;  4KRF A;  2NRT A;  3ULE A;  1QQO A;  1EO1 A;  1KVA A;  3AO5 A;  4YDU A;  3CC2 N;  3NF6 A;  4BRF A;  4JRP A;  1RBU A;  4A5B A;  2G8W A;  3U4L A;  1HNV A;  3C94 A;  2QTD A;  2ATQ A;  1VHX A;  2P9S B;  4MLH A;  3NH0 A;  2W41 A;  3P5J A;  2FF3 B;  4IFY A;  3UB5 A;  4H4O A;  3VTI A;  4BRK A;  5SZT A;  3RR7 A;  2PYJ A;  5C25 A;  4H5R A;  1VQK N;  1FK9 A;  1EX4 A;  2HBM A;  1BI4 B;  2D4W A;  5DK5 A;  5AR0 A;  1YXQ A;  4CEE A;  3CC4 N;  2HHH K;  2OA8 A;  3A5L C;  2KLA A;  1ASU A;  1NGA A;  1LAW A;  3LL3 A;  4DSE A;  1RDW X;  2Q0U A;  2FSK A;  3J8A A;  3VER A;  5GIN A;  1J53 A;  3HM9 A;  1U2V A;  4FM1 A;  3KWI A;  2HHS A;  4FJ8 A;  1U45 A;  1C0T A;  2E88 A;  2F9T A;  3SQ4 A;  4B1U B;  1XC3 A;  1TKZ A;  2H3G X;  3S9H A;  2RF2 A;  2GX9 A;  1YF5 L;  1TL1 A;  4CED A;  1TKX A;  1BA0 A;  3M6G A;  3NAE A;  2R7Y A;  5FPM A;  1TAQ A;  4PKI A;  2GV9 A;  3CJ9 A;  4FK0 A;  1NJY A;  4IDK A;  4BY9 C;  1QTM A;  4CD1 A;  2FF6 A;  2E20 A;  1Q9X A;  4FJ9 A;  3O3G A;  2D0C A;  2Q36 A;  1N36 K;  1J5E K;  4K8X A;  4CJT A;  1T3V A;  2A3Z A;  1K9M O;  2HMI A;  4BR7 A;  4N5S A;  1O13 A;  4CF2 A;  2QWO A;  1HYZ A;  1GOC A;  3KHY A;  1NMD A;  2Z1I A;  4DFJ A;  3QIP A;  4OKJ A;  4GV3 A;  5FRN A;  4BWJ A;  3LZI A;  4DQ8 A;  1K73 O;  4CGI A;  1IG9 A;  5EXW A;  1QE1 A;  1YI2 N;  2YX6 A;  3LAN A;  2O8E A;  3CF5 L;  1NMN A;  3T69 A;  1C1B A;  4LSL A;  2PZS A;  4C8O A;  3AVI A;  4FWS A;  2IIR A;  2GWJ A;  4CD3 A;  4NXM K;  1RT4 A;  1XMO K;  4QAG A;  3HOT A;  3AO2 A;  4GVM A;  1IBK K;  3J7A P;  4LF5 K;  1HR0 K;  3SPY A;  3LDL A;  4KO0 A;  2HVI A;  1J5O A;  2DFF A;  2ASO A;  2P9P B;  3A5M C;  4YOY A;  3NF7 A;  4CBX A;  4O0J A;  3LDS A;  3CCM N;  1QS4 A;  4OPA A;  5JVH L;  1GLE G;  3C6U A;  3KTQ A;  5AQK A;  3EN9 A;  2AA4 A;  3QB0 A;  5CR4 A;  4YOR A;  5DM7 L;  4H0Y B;  4RTF D;  1JLF A;  3PSF A;  3ENH A;  4XEI A;  4CJV A;  3EZ5 A;  4DU4 A;  4IG3 A;  4ELU A;  3ZET A;  1ASV A;  3KVG A;  1BU6 O;  4AH9 A;  3AVN A;  1K8K B;  5FPE A;  4DU1 A;  3VA3 A;  3KKS A;  2BGG A;  3WNG A;  3ULE B;  1B9D A;  3I56 N;  1Q9Y A;  2DY4 A;  2P9I B;  3ZSZ A;  1YT3 A;  3MDQ A;  1JLQ A;  4CEB A;  3L2W A;  3OYB A;  3FZL A;  3MXJ A;  5DM6 L;  5M1F A;  1HRH A;  4JI5 K;  1DT9 A;  2YNG A;  1RTI A;  3VQQ A;  2OAN A;  4B1Y B;  4JKF A;  1VSI A;  3CCV N;  1J9A A;  2ETJ A;  3AA5 X;  4KHN A;  2W40 A;  4CZJ A;  2QM1 A;  2GTD A;  4BVP A;  4U67 L;  3EKS A;  3OYC A;  3D2E A;  1Y97 A;  3SUP A;  3VQA A;  4B3R K;  4CEF A;  4FLV A;  5ADX A;  4IO9 L;  4M3W A;  4JK9 A;  3WXL A;  5AQI A;  1OH8 A;  1X9W A;  1NG9 A;  3KWG A;  3VGK A;  4KPY A;  4CHZ A;  3ZYY X;  4KI4 A;  2FXU A;  4M7X A;  4OGE A;  3SV4 A;  2O8D A;  3TAB A;  4LFA K;  1ATS A;  4DFM A;  3TTD A;  1E4G T;  5HRO A;  4EHT A;  4KHU A;  3H08 A;  3LP3 A;  5FRO A;  1WSI A;  1WSE A;  3VQ9 A;  4W5Q A;  3WEE A;  2VQE K;  3O4Q A;  1RT7 A;  1BOT O;  1S1X A;  1Q8I A;  3NHG A;  3FGU A;  3CPW M;  3NBP A;  4FZY A;  3QNO A;  4FLZ A;  3SK3 A;  4DV1 K;  3EY1 A;  4I7F A;  2E1Z A;  2HST A;  5JIC A;  4FJK A;  4H0X B;  1S5J A;  2YJE A;  1XNR K;  3V9S A;  3T1A A;  3G4S N;  1NKC A;  1W0H A;  1VAZ A;  3K5M A;  1HYV A;  3OBY A;  2FC0 A;  4M41 A;  4E19 A;  4E0D A;  3MCP A;  2X74 A;  2FBX A;  2PFU A;  3H45 C;  4JYA K;  4K0K K;  2RE2 A;  1IKY A;  4DSL A;  2YV0 X;  4DR5 K;  2B6A A;  4Q0B A;  2BDP A;  1XHZ A;  1V4T A;  1VRU A;  1OH7 A;  4C1N K;  3A5N C;  1DTQ A;  3DLE A;  4FO0 A;  3CME N;  4B1Z A;  3PIO L;  3CCL N;  3ZT1 A;  2A40 A;  3K57 A;  2HHX A;  4CEQ A;  3HP6 A;  1RT2 A;  5ELZ A;  1QVF M;  1HQE A;  1GLL O;  3AVL A;  5EVZ A;  4Y0W A;  1KAX A;  4Y1C A;  4BRQ A;  2UXB K;  1N32 K;  3LP0 A;  3U3Y A;  4YOV A;  2KZZ A;  1CXQ A;  4CHP A;  4MQ3 A;  2QI2 A;  4CVN E;  4ILJ A;  2ZD1 A;  4DLE A;  3ZT4 A;  5D3G A;  3N4Q A;  3A2F A;  4KHS A;  3UKU A;  4C8L A;  4CFD A;  1VQM N;  3DMJ A;  2DFH A;  3KLI A;  3L2U A;  2NRR A;  4IEI A;  1KVC A;  2J4R A;  5DMR A;  4M3X A;  3H6E A;  5BPL A;  2D0A A;  3QEW A;  3BZC A;  5AFU H;  4WQ5 C;  3M1F A;  3VQ7 A;  3CXC M;  3ASM A;  4FYD A;  5LMU K;  2DTU A;  1DLO A;  3FZH A;  3SAF A;  5HP1 A;  4LC9 B;  1WAJ A;  3CHW A;  4Y1D A;  2AP1 A;  4LSN A;  4DR1 K;  4DU3 A;  4ILG B;  4O55 A;  4CK1 A;  5J1E A;  1YAG A;  3P31 A;  3AA2 A;  4CJP A;  3T7Z A;  2RN2 A;  3DRS A;  2ZWH A;  4JKH A;  3NVM A;  1FJG K;  1N5Y A;  3SMS A;  3SJJ A;  1VSH A;  1RTJ A;  5KQ8 A;  3D0P A;  4DSJ A;  4BDY A;  2UXC K;  1XUP O;  2XO7 A;  1A5W A;  5BN9 A;  2O8B A;  2D0B A;  1UA1 A;  4JD2 A;  4CZL A;  3MEC A;  1S1T A;  3AVG A;  4DR7 K;  3M8P A;  4L8R B;  5AQN A;  5AZJ B;  4X66 K;  3T1H K;  1VSF A;  3O3H A;  4CGD A;  5GIO A;  3ATV A;  3QBX A;  1S1W A;  1MWM A;  4YDU C;  5EX5 A;  4F4K A;  2YCH A;  5FDL A;  3CCQ N;  2BUP A;  4BRC A;  4DR3 K;  4F2R A;  3OJU A;  3CD6 N;  3I0S A;  3ULD A;  3HI0 A;  4JI7 K;  3FZF A;  2HF3 A;  3ZSV A;  2B4J A;  5CY4 A;  1A5V A;  2I7P A;  2HBK A;  4DLG A;  3EE9 A;  2JWK A;  3ISN C;  2EWS A;  3PX6 A;  3MEG A;  4KB1 A;  1TYQ B;  4GW6 A;  3JAM O;  4N56 A;  5H1S Q;  4AHR A;  2Q31 A;  1HNZ K;  2B5J A;  3A0I X;  3IFR A;  4UY8 O;  4EZ9 A;  1NGB A;  4IOA L;  3I0R A;  4H0P A;  4DQI A;  1NGG A;  3K5O A;  4J2E A;  2KKZ A;  2YKN A;  3CMA N;  4YNQ A;  3RMC A;  3SYZ A;  1KC8 O;  5HRR A;  2ZM6 K;  4BE1 A;  1RT5 A;  5F0X A;  3TAR A;  4IWV A;  5J2M A;  1ZBF A;  4M63 C;  1U6Z A;  1NJX A;  3VA0 A;  1JLC A;  2GEL A;  4PKH A;  1JL2 A;  3E9O A;  3HVR A;  1XMQ K;  4X65 K;  2KTQ A;  1NJZ A;  4ICL A;  3DOK A;  2KHO A;  2YJF A;  1Z25 A;  3O1B A;  4KAZ A;  3K59 A;  4NB4 A;  2HHU A;  1HKC A;  3I8D A;  1C1C A;  3PO4 A;  4BRD A;  1WSF A;  4NCB A;  2VCP A;  2ASP A;  4GVE A;  3V9U A;  3IKM A;  4YOX A;  3U9Z A;  1P8Z A;  4BRM A;  3DXK B;  3O9S A;  4DUY K;  3DRP A;  5JS2 A;  3WXM B;  4MO5 A;  5JLH A;  3P83 D;  3AVF A;  1NLV A;  1MWK A;  1YIJ N;  2VWB A;  3MWT A;  4CF8 A;  4EIA A;  3OS1 A;  1Q18 A;  3SMP A;  4JI1 K;  1NK5 A;  3TTC A;  1M1K O;  4CIF A;  1I94 K;  1L3T A;  4CEO A;  4OKE A;  2IVP A;  3OYN A;  4DTP A;  3I33 A;  1ZBS A;  4BDP A;  3SAH A;  3CFO A;  4AHV A;  3M5R A;  1VSJ A;  3C6H A;  1FXX A;  3AVA A;  3ZT0 A;  4FWP A;  2Y1I A;  1TK0 A;  1TVR A;  3THW B;  3D6R A;  3O9Q A;  4BRH A;  3AVH A;  4O0I A;  4CJ7 A;  2ZQB A;  5EU7 A;  4B9N A;  2OZM A;  4TSX A;  3CM5 A;  4CI6 A;  2VGN A;  3K9K A;  1NU0 A;  3H46 O;  3WXI A;  2IOC A;  3OS0 A;  4K42 A;  3P1G A;  3B6P A;  3AAP A;  2HB5 A;  4ZTF A;  1QVG M;  3MMV A;  4PL8 A;  4BRG A;  5AQZ A;  4QOZ B;  3OYG A;  4FWO A;  2GUI A;  4CJR A;  2NRZ A;  1N6Q A;  2P9S A;  4B3T K;  3UKR B;  2IAJ A;  4CHQ A;  1G99 A;  4IOC L;  1SUQ A;  4W5N A;  2YHX A;  4M3U A;  4K43 A;  1VQN N;  4FLX A;  5HOO A;  3G6E N;  4BRP A;  1YUW A;  4NYF A;  2QWQ A;  2FLO A;  5I3U A;  4FVU A;  1WLJ A;  4X64 K;  4PUO A;  3MED A;  3WNH A;  3GE1 A;  4DSK A;  3LAK A;  4BG8 A;  2QKK A;  1T6D A;  2KQ2 A;  3VQE A;  4FK2 A;  1D5A A;  3V9W A;  4QS8 A;  3CJ1 A;  3VQB A;  4IKF A;  2XY8 A;  4GKK K;  1L3S A;  1EXQ A;  2PAV A;  3U3G A;  4FL9 A;  3OYI A;  3AAQ A;  4I6M A;  4ELT A;  1JL1 A;  4OVL A;  4FPB A;  4WF9 L;  1SL0 A;  1VQ6 N;  1TKD A;  4FK4 A;  2Q0R A;  2P9K B;  5AQQ A;  4CJ4 A;  3LWM A;  1ZYQ A;  3H3O B;  4AHT A;  3MAQ A;  3QES A;  4N76 A;  5BR8 K;  2O8C A;  1NGD A;  3EL2 A;  3R3L A;  1XHX A;  4F3T A;  3NH2 A;  4IG0 A;  1VQ5 N;  1BG3 A;  3ZSQ A;  3OYK A;  4HCB A;  1WN7 A;  3KD1 E;  1TUU A;  4RW8 A;  3QEX A;  2OYQ A;  5GAH P;  3VEZ A;  4FWN A;  3VF4 A;  1X9J A;  4XH4 A;  3O4N A;  1DKG D;  4E1N A;  4CJE A;  4JRQ A;  4ISE A;  4DTU A;  1S3X A;  2IGI A;  4DTJ A;  1ILY A;  4KBO A;  3BP8 A;  3MN5 A;  4BG9 A;  4FXD A;  3R6M A;  1NWK A;  4B9Q A;  4WQ4 A;  4DQQ A;  3IUC A;  4AHU A;  1JKH A;  1C0M A;  1WOQ A;  1YTA A;  1SKR A;  5I42 A;  4BGB A;  4BRI A;  2Q2R A;  3VN5 A;  4BR9 A;  3QIO A;  2ITG A;  2HNY A;  1U4B A;  3FR0 A;  4FWR A;  2HNZ A;  3IMX A;  3PX4 A;  2HBL A;  1Q82 O;  2NNW A;  2YI1 A;  2A5X A;  1KD1 O;  1J6Z A;  2A1R A;  3QEI A;  4CEA A;  4BGA A;  4FM2 A;  1WSJ A;  4FWM A;  4B9U A;  4FJX A;  1KXP A;  1VQ4 N;  2KFZ A;  2IDO A;  4F2S A;  5KPT A;  2F7T A;  3LP2 A;  3ZET B;  4PA1 A;  2HF4 A;  4FVM A;  4OPH A;  4CZK A;  1WBD A;  3AV9 A;  4FCY A;  3KJV A;  2G8I A;  1SL1 A;  3D7E O;  4IOX A;  1RTH A;  5C24 A;  1NM1 A;  1EKE A;  5AQG A;  3R9P A;  5AQX A;  4CJU A;  3OYD A;  4LF9 K;  3ITH A;  4FLY A;  2Q3S A;  1FKO A;  5BPN A;  1QSS A;  4M3T A;  4WE1 A;  2E2N A;  1IBL K;  1YHQ N;  3V81 A;  3S3N A;  1NK8 A;  3VEV A;  1ZBH A;  4ILH A;  3CET A;  1L3V A;  1Y64 A;  1T44 A;  2OCE A;  1BO5 O;  3CJB A;  4YOU A;  3DLR A;  4Z0U A;  3QDK A;  4B1X B;  1HUX A;  3KK3 A;  2Y1J A;  4PQU A;  4FJJ A;  3J80 O;  4BC3 A;  4WFB L;  2HW3 A;  4KTZ A;  3WUH A;  1YVN A;  3K2P A;  3O5B A;  2UYT A;  3SI6 A;  2O4G A;  1VSD A;  1UOC A;  3SBT A;  1BQN A;  3MN9 A;  2OPQ A;  5KGW A;  4B9T A;  1GLF O;  2GWK A;  1KVB A;  3CC7 N;  4I9L A;  3SBG A;  2WUS A;  3IG1 A;  1OVQ A;  1LWF A;  1BIS A;  4CFA A;  3DOL A;  3LAL A;  1CXU A;  3ZSY A;  3UE5 A;  2W42 A;  4DCH A;  2JGU A;  3AY9 A;  2IVN A;  1IKX A;  1HNX K;  5HRN A;  5K14 A;  5CYM A;  4BDZ A;  5JS1 A;  2HHW A;  4F8R A;  3OYE A;  3THY A;  4E7I A;  2PYL A;  3DXK A;  2G8F A;  4UQG A;  5IT9 O;  3IDH A;  4CER A;  2P51 A;  1RBS A;  3THX A;  4NYN A;  4DKW A;  2ZJP L;  3SUO A;  4B8C A;  3QNN A;  2FSN A;  4ID1 A;  4FJH A;  2UUB K;  4DSF A;  3DLH A;  5LMN K;  3VPZ A;  4BQZ A;  2VWJ A;  3VEN A;  3VES A;  4E89 A;  3WNE A;  4A61 A;  1MA9 B;  4CJW A;  1RDA A;  1HPM A;  2ITM A;  1S6Q A;  2YNF A;  4E3S A;  1B92 A;  1VK0 A;  4CW7 B;  4O44 A;  5M1K A;  3BUZ B;  1ZC6 A;  3R1X A;  4DQP A;  4DFK A;  4CZE A;  1NJW A;  2NLX A;  3VQC A;  2QEX N;  4H5T A;  4LF7 K;  1RDB A;  4IJA A;  4CES A;  5KTQ A;  4GMJ B;  2V7Z A;  4CF0 A;  1M90 O;  3L3V A;  3L3U A;  3QET A;  2QXF A;  3ZX0 A;  5KRS A;  5AQF A;  4EP5 A;  4PWD A;  4I2P A;  4JK8 A;  2OPP A;  4DR2 K;  3S3M A;  1IKV A;  1YIT N;  4JAX A;  1RTD A;  3U9D A;  2WC9 A;  3QBW A;  3JXU A;  3CM6 A;  3H1Q A;  3HZ6 A;  3MX2 A;  4H0T B;  3LM2 A;  1RBR A;  2F96 A;  4B9V A;  3VEO A;  3OBW A;  3BY5 A;  4CGH A;  3V1O A;  1N33 K;  3MXM A;  4DV7 K;  4R5P A;  1S22 A;  5AJ3 K;  1HQU A;  4AQY K;  5BPM A;  3CG7 A;  3VOV A;  3B6O A;  3EO3 A;  2O8E B;  4CF9 A;  1SKS A;  5F2R A;  4IO8 A;  2P9U B;  3AVJ A;  4AM6 A;  4OKK A;  4KI6 A;  2F8S A;  1NK4 A;  4Z4C A;  1FKP A;  4M7Y A;  1GLB G;  4KHY A;  3VQ5 A;  3CQX A;  4KB0 A;  4EZ6 A;  2Q1N A;  3FFK B;  5C42 A;  3U6F A;  2GUP A;  3KZB A;  4B9M A;  3Q7C A;  3G25 A;  1I3A A;  1K8K A;  1TK5 A;  1QZ6 A;  1ZBU A;  4X62 K;  3ZLJ A;  1WSG A;  4HTL A;  1VQ7 N;  3QFP A;  2QKB A;  4EFH A;  1RT3 A;  4NXN K;  3M3Z A;  1RDU A;  3DXM A;  5M1Q A;  3L2V A;  1QQC A;  3VGL A;  1C0U A;  3CFP A;  3T1Y K;  4LFB K;  3UKU B;  3LPT A;  3THV A;  4CJF A;  2DPN A;  2E6L A;  2XY5 A;  1YJ9 N;  3UKR A;  2CGL A;  4CGJ A;  4WQ5 A;  3QEV A;  2HOE A;  3VTH A;  2G8H A;  5M1P A;  4KFB A;  3VEW A;  4M3R A;  2P5G A;  2ASM A;  4WCE L;  2YNH A;  1KSP A;  4FJ7 A;  1P90 A;  2UXD K;  1ASW A;  2E2P A;  2IVO A;  3CFR A;  2P5O A;  1IO2 A;  5HL7 L;  3VF2 A;  5AQO A;  1D8Y A;  3VQ4 A;  4BR4 A;  4V19 S;  1T05 A;  1KRP A;  1S1V A;  2CH6 A;  4AHS A;  4JEP A;  4PY5 A;  4O5F A;  1NK7 A;  3L2Q A;  5KGX A;  3SCX A;  1WAF A;  4DTX A;  4GNI A;  3AA3 A;  3WT0 A;  1OH6 A;  4BR0 A;  2VYP A;  3DI6 A;  1DEJ A;  4ELV A;  4JI4 K;  3VEY A;  4KH5 A;  3SQ2 A;  4A2A A;  3O08 A;  2YHW A;  2O8C B;  2VGM A;  2V51 B;  3TAG A;  3OA9 A;  3P39 A;  3I8B A;  1ATN A;  4H5V A;  5FPD A;  3AVK A;  3O9U A;  2HHV A;  4YOW A;  1WBB A;  4DB3 A;  1JLG A;  3EYZ A;  1EQY A;  4Z4F A;  4ZHR A;  1RFQ A;  1NBW A;  4H0O A;  4FJN A;  3L0Q A;  1KFD A;  2KW4 A;  3SLC A;  4M42 A;  3CCU N;  3DLG A;  4FJL A;  4CIG A;  3HSC A;  4BQL A;  3AGK A;  4GV9 A;  3CCR N;  2ZF5 O;  4G1Q A;  4MLE A;  2QWL A;  1UAX A;  3D2F B;  1JJ2 M;  2QWN A;  3KLG A;  4DF4 A;  2LSN A;  3SZ2 A;  4J8F A;  3TAN A;  2HBJ A;  4DTN A;  1TL3 A;  2A41 A;  4WYB A;  4IEE A;  1S9G A;  1NGF A;  4QS9 A;  1B9F A;  4K41 A;  1XWL A;  2HHT A;  1OH5 A;  3O3F A;  3ATU A;  3ZSW A;  1RDC A;  1ZBI A;  3AVM A;  5EY4 A;  4A59 A;  5C15 A;  4RG8 A;  3PIP L;  3VQ8 A;  4BR5 A;  4KV8 A;  4MO4 A;  3DRR A;  3VQP A;  3WEE B;  4CGG A;  2QXL A;  3HPH A;  4N47 A;  3CQ8 A;  3HRG A;  1KLN A;  1GLC G;  1BIZ A;  2QK9 A;  3J81 O;  1ZXO A;  1S9E A;  2FSJ A;  1Z26 A;  5KPR A;  4FOE A;  3KK1 A;  2PBD A;  4FW2 A;  4DV3 K;  3ZEU B;  4CJQ A;  1IBM K;  1OVY A;  4JHD A;  3EZW A;  1C1A A;  5AQU A;  3K0S A;  5GAD P;  2VG5 A;  5CZ1 A;  3RR8 A;  3A5O C;  3F2K A;  3BZK A;  3RSE A;  3VET A;  1BL3 A;  4ISG A;  1HJR A;  4CIE A;  3E1Y A;  3TSU A;  1NK9 A;  4LF6 K;  2WON A;  1Q86 O;  1YTU A;  3LM9 A;  3EE8 A;  4E1J A;  4OGC A;  3TAM A;  2QWR A;  1ZBL A;  5ADX H;  1RGI A;  1U47 A;  1U49 A;  1Z6R A;  3HO1 A;  3F9K A;  4FLT A;  4Z4I A;  4GV6 A;  3HJF A;  4DTM A;  4W5O A;  3LDP A;  2P9P A;  3VEX A;  1VQO N;  3ZX2 A;  4FM0 A;  1KFS A;  5HRS A;  1HMV A;  3HYF A;  5C12 A;  3V6D A;  3THW A;  1WB9 A;  4C8M A;  4DV0 K;  2OPS A;  3P4I A;  4YFU A;  5AQJ A;  3ZT3 A;  3LDN A;  4O8U A;  1T7P A;  1NKE A;  5KRT A;  3QEP A;  4CBW A;  2XHB A;  1KAZ A;  4B1V A;  3SQ0 A;  4B3M K;  4DWI A;  1NNE A;  1HKB A;  3IS9 A;  3CIP A;  1JCF A;  3ALY A;  2YHY A;  1WNS A;  1L3U A;  3C6T A;  4Z4E A;  4DHY A;  2OZS A;  5HRP A;  2F4V K;  5J2N A;  3TAQ A;  4RW7 A;  3KK2 A;  3W3D A;  4HUG A;  4PHT X;  3K58 A;  3V1R A;  3C0B A;  5AQT A;  4CZG A;  1S72 N;  3L6Q A;  3NGI A;  2G8V A;  4DFP A;  3HT3 A;  3HM8 A;  1HNW K;  1YJN N;  4JK7 A;  2HHQ A;  3J7Z O;  1U04 A;  1NGJ A;  1HNI A;  4OX9 K;  3SJH A;  3AO3 A;  4BAC A;  4DR6 K;  4BRE A;  1GLD G;  2D5R A;  3PSI A;  1JLB A;  4CZH A;  2ZJQ L;  4CZM A;  5M1O A;  5AZI A;  2O8D B;  1IKW A;  3TI0 A;  2UU9 K;  4B3O A;  1HX1 A;  4K8Z A;  2ZJR L;  1BUP A;  4KH4 A;  4BR2 A;  1YVU A;  2KZM A;  3RRG A;  1TV6 A;  1IJJ A;  4RWT A;  3MN7 A;  5FPN A;  2WOM A;  5AFU A;  1EP4 A;  1QHT A;  2KFN A;  4NLC A;  1OKJ A;  3KK7 A;  1QSL A;  3O80 A;  3ZCM A;  4FSV A;  3PX0 A;  4C8K A;  4FPA A;  4CJK A;  2I5J A;  2P9N B;  3RMD A;  4FWL A;  4W5T A;  1RBT A;  2RKI A;  4FW1 A;  4OPJ A;  4JKA A;  4BRL A;  4CFC A;  3PUF A;  3SUN A;  3V4I A;  3NDK A;  3PY8 A;  4KHP K;  5CYQ A;  4FZZ A;  3PO5 A;  2FBV A;  4CK3 A;  1T8E A;  2G8K A;  4LD0 A;  1N8R O;  4OO1 J;  4CHO A;  3MEE A;  1DTT A;  4R79 A;  3CI5 A;  4MDB A;  4LY7 A;  2P9L A;  5AQY A;  3K5N A;  4DS5 A;  1R0A A;  5JVG L;  2UUA K;  3NVK A;  1D9F A;  1BDG A;  2O8F A;  1KTQ A;  3E66 A;  4A62 A;  4IBN A;  4DQS A;  5TKW A;  4J2B A;  2CGJ A;  5M1N A;  5AQP A;  3OS2 A;  4FOI A;  4DR4 K;  3ID8 A;  1RIL A;  3CJ7 A;  4I2Q A;  4CHN A;  4B8A B;  1NK0 A;  2A42 A;  3LAM A;  3HPG A;  3NFA A;  1LAV A;  1W9H A;  5CE3 A;  4HTU A;  3AGR A;  2CGK A;  4M45 A;  4U7B A;  4JI6 K;  3SV3 A;  3IAY A;  2EHG A;  3WQT A;  3V1Q A;  3RMB A;  4HWI A;  2E2Q A;  1SS6 A;  1X1P A;  3ZSX A;  4CJ3 A;  4E7L A;  3AVB A;  5EOY A;  1GOB A;  4NCA A;  3TSP A;  3CQY A;  1CLQ A;  4BRN A;  1LV5 A;  3OYH A;  1U48 A;  1KCF A;  4OPK A;  3VQ6 A;  3NGZ A;  3SUQ A;  3DYA A;  3GBT A;  3ZSR A;  2QW9 A;  4BE0 A;  3BEX A;  2O8F B;  5AQL A;  2YHA A;  5J2P A;  3DLL L;  1A5X A;  3T3F A;  2P1J A;  4N41 A;  2Q97 A;  5MLC Q;  2NRH A;  2E6M A;  4JI0 K;  2AJQ A;  3U8X A;  3TR8 A;  4OJR A;  3J7Y P;  4XH1 A;  3PLA A;  5SWM A;  1IV0 A;  1KAY A;  3JSM A;  3E9L A;  4FJG A;  4DG1 A;  1D4X A;  2NRX A;  3QIN A;  3TTF A;  3OW2 M;  4HUF A;  4CEC A;  3AAR A;  2W6K A;  1GLJ O;  4NO7 A;  3C7N B;  1VRT A;  1BHL A;  4KKO A;  3N4P A;  4I6M B;  1ITG A;  1SZ2 A;  5FLX O;  4CFB A;  5AQV A;  1LW0 A;  4JKG A;  3BF1 A;  3OYF A;  3RTV A;  5AZJ A;  1T03 A;  3ZX3 A;  3AVC A;  2P9N A;  2RHK A;  3CCS N;  4FLU A;  4H4M A;  1BQM A;  2YKM A;  3D45 A;  5LY3 A;  1XI1 A;  3EEQ A;  4IDH A;  4JI8 K;  2WBN A;  2OPR A;  4M3Z A;  3OYL A;  4IFE A;  3JYT A;  3AA4 A;  2X6N A;  2FBY A;  3O6W A;  3VMF B;  1XNQ K;  2NRV A;  4OLA A;  3THY B;  3HVT A;  4NLB A;  1V4S A;  3F73 A;  4DMN A;  1UWB A;  3L4I A;  4DV4 K;  3L2R A;  3I55 N;  3L8B A;  4HCC A;  3LPU A;  4B9L A;  5KQD A;  2IS3 A;  4W5R A;  1RT1 A;  3M8R A;  2Z1J A;  3DWL A;  4OLB A;  1X3M A;  2I7N A;  1DGK N;  1JCE A;  4ID5 A;  3O9T A;  4DTR A;  1X3N A;  1NGC A;  4EHU A;  1TK8 A;  5LJV A;  3DLK A;  3LWL A;  2NUB A;  5E26 A;  1I39 A;  3NMU A;  2WFB A;  5AQR A;  3D2F A;  5CHI A;  3KKR A;  1SKW A;  3CER A;  4Z4G A;  3G0Z A;  1JLE A;  3ENO A;  1SV5 A;  4BVO A;  1NJI O;  4RCH A;  2D0P A;  4KRE A;  1REV A;  4XH5 A;  3F9M A;  3G71 N;  4IZ9 A;  3OYM A;  3OYJ A;  4LFC K;  3S3O A;  4H03 B;  4K25 A;  5GIP A;  1D9D A;  4G9Z A;  2X78 A;  5LL6 Z;  5AQS A;  4CJL A;  1BA1 A;  1JXB A;  3DJC A;  3GL1 A;  2GBZ A;  4RW9 A;  4C1N I;  4FJM A;  2O8B B;  1GOA A;  3V9Z A;  1NGI A;  3WQU A;  3SQ1 A;  3CCJ N;  4AHC A;  2P9K A;  3SAG A;  3MWP A;  4Z4H A;  3A8Y A;  3CJC A;  4FJ5 A;  3W0L A;  1LW2 A;  4JKE A;  2XY6 A;  3TSQ A;  2OTL N;  4IFV A;  4WFA L;  4E7K A;  3NH1 A;  1J54 A;  2VQF K;  3F5T A;  2QWM A;  1XC9 A;  1CZA N;  5TKY A;  1HKG A;  2P9I A;  5HLF A;  4DTS A;  4JHD B;  3CYM A;  3OVN A;  3VGM A;  4LF8 K;  1CZ9 A;  3RSE B;  4CK2 A;  5J2Q A;  4JV5 K;  3MCA B;  4DF8 A;  4E1M A;  5CZ2 A;  4PKG A;  4JI2 K;  4CZI A;  2BE2 A;  3WXJ A;  4KHW A;  3HL8 A;  3D2E B;  4AM7 A;  1QHA A;  3KLE A;  1RBV A;  3P38 A;  1IH7 A;  1C0G A;  2DFE A;  1CZB A;  2P9U A;  3HXM A;  1EWQ A;  3C95 A;  2CH5 A;  3RMA A;  4JKB A;  1BCO A;  3GDQ A;  1QQM A;  4AF1 A;  5C10 A;  1U2V B;  5BRD A;  3LDQ A;  4RW6 A;  1Q81 O;  1BIU A;  3NF9 A;  4RW4 A;  4CF1 A;  2V7Y A;  1TGO A;  2W6L A;  3ZT2 A;  4CZF A;  1F21 A;  1HPZ A;  4FLW A;  2RPI A;  4QS7 A;  2VG7 A;  5KPZ A;  2QA4 N;  3QFU A;  4JKG B;  4J2A A;  3H1V X;  3QIC A;  1JCG A;  2F9W A;  2E8A A;  1QQN A;  2D0O A;  4YOT A;  1W7A A;  4O8K A;  3BF3 A;  3TAF A;  1MDU B;  4EAH D;  3AO1 A;  4BRA A;  5BR9 A;  3TAE A;  5E41 A;  3E9P A;  4H5N A;  3R8E A;  4I9Q A;  3Q7B A;  3UIQ A;  4B9S A;  3MX5 A;  1NK6 A;  2P9L B;  4Q5V A;  1WUA A;  3C6A A;  5IWA K;  4CBU A;  4HHT A;  1H1V A;  5AQM A;  3TAP A;  4FJI A;  3KLF A;  1VSL A;  2E5L K;  2JWL A;  2HVH A;  3FZK A;  4BRO A;  3OY9 A;  3C65 A;  4MFB A;  1BCM A;  4YY3 K;  3HP9 A;  4J2D A;  4GKJ K;  4Z94 A;  3TU5 A;  5AQH A;  1HLU A;  2OTJ N;  2HMP A;  5AZI B;  2YHB A;  4O4G A;  2VWK A;  4WQ4 C;  5T7B A; 
#chains in the Genus database with same CATH homology
 4FM0 A;  4AIL C;  1KFS A;  5HRO A;  5HRS A;  3QEI A;  1RCH A;  2A1R A;  4CEA A;  4FM2 A;  1HMV A;  3HYF A;  4BE2 A;  2PY5 A;  4KHU A;  4KHQ A;  3V6D A;  1WSJ A;  4C8M A;  3TWH A;  3H08 A;  4B9U A;  4FJX A;  3LP3 A;  2KFZ A;  2IDO A;  3KLH A;  2OPS A;  3DM2 A;  5FRO A;  4YFU A;  4F2S A;  4CGF A;  1WSI A;  1WSE A;  3LP2 A;  3VQ9 A;  3ZT3 A;  4W5Q A;  4PA1 A;  4FVM A;  1T7P A;  1NKE A;  3O4Q A;  1RT7 A;  3AV9 A;  5KRT A;  4FCY A;  4DTO A;  3QEP A;  2XHB A;  3DLB A;  3KJV A;  1S1X A;  2G8I A;  1SL1 A;  1Q8I A;  3NHG A;  3SQ0 A;  5C24 A;  1RTH A;  1EKE A;  4DWI A;  3NBP A;  3IS9 A;  4CJU A;  4FZY A;  3OYD A;  3ALY A;  3ITH A;  3QNO A;  4CEZ A;  1WNS A;  4FLZ A;  1VSK A;  2Q3S A;  3C6T A;  4CE9 A;  4FLY A;  2XY7 A;  1L3U A;  1FKO A;  2OZS A;  5HRP A;  4Z4E A;  1QSS A;  1RDD A;  5J2N A;  3TAQ A;  4M3T A;  4CHY A;  2A1S A;  4WE1 A;  4RW7 A;  4C8N A;  3HPO A;  3KK2 A;  3EY1 A;  4HUG A;  3V81 A;  3S3N A;  3K58 A;  3V1R A;  4I7F A;  1NK8 A;  1ZBH A;  4FJK A;  3G10 A;  3T19 A;  3NGI A;  2G8V A;  3E01 A;  1S5J A;  4DFP A;  4O5B A;  3V9S A;  3HT3 A;  3T1A A;  1L3V A;  4JS5 A;  1W0H A;  1NKC A;  3K5M A;  1HYV A;  2HHQ A;  3DLR A;  4Z0U A;  2FC0 A;  4M41 A;  4E19 A;  1U04 A;  2ZE2 A;  1HNI A;  3KK3 A;  2Y1J A;  2X74 A;  2FBX A;  3OYA A;  4E0D A;  4PQU A;  4FJJ A;  3AO3 A;  1X9M A;  4BAC A;  3RRH A;  2HW3 A;  1IKY A;  4KTZ A;  4DSL A;  2YV0 X;  2B6A A;  2D5R A;  4Q0B A;  3K2P A;  1JLB A;  1S6P A;  2BDP A;  3SI6 A;  3PV8 A;  2O4G A;  1VSD A;  1C6V A;  1UOC A;  1XHZ A;  1VRU A;  3WNF A;  1S1U A;  1BQN A;  2OPQ A;  1IKW A;  1DTQ A;  3DLE A;  3TI0 A;  4B3O A;  4DS4 A;  4K8Z A;  3QER A;  3ZT1 A;  2BAN A;  5KGW A;  3NE6 A;  4B9T A;  1YVU A;  1TKT A;  3K57 A;  2HHX A;  1KVB A;  4CEQ A;  1LWE A;  2KZM A;  4I9L A;  3HP6 A;  1RNH A;  1RT2 A;  3RRG A;  4KTW A;  1TV6 A;  3IG1 A;  2WOM A;  1HQE A;  3AVL A;  1EP4 A;  1LWF A;  1BIS A;  1QHT A;  3DOL A;  4CFA A;  3LAL A;  3HK2 A;  2KFN A;  1CXU A;  1QSL A;  3ZCM A;  3ZSY A;  4B08 A;  3QO9 A;  3PX0 A;  4C8K A;  2Z1G A;  4Y1C A;  4CJK A;  2I5J A;  3RWU A;  2W42 A;  3RMD A;  1BGX T;  3LP0 A;  2O4I A;  1MU2 A;  2JGU A;  3U3Y A;  2KZZ A;  1IKX A;  4W5T A;  1CXQ A;  1RBT A;  2RKI A;  4CHP A;  4FW1 A;  5K14 A;  5HRN A;  4OPJ A;  4MQ3 A;  5CYM A;  2F8T A;  4BDZ A;  3VQD A;  2ZD1 A;  3PUF A;  4CFC A;  4DLE A;  3SUN A;  3V4I A;  3NDK A;  3ZT4 A;  3PY8 A;  2HHW A;  5D3G A;  5CYQ A;  4FZZ A;  5JS1 A;  3PO5 A;  3A2F A;  4F8R A;  3OYE A;  1LWC A;  4KHS A;  4E7I A;  2PYL A;  2FBV A;  4CK3 A;  1T8E A;  4CFD A;  2G8K A;  4C8L A;  3DMJ A;  2DFH A;  2G8F A;  4UQG A;  5HBM A;  3KLI A;  3NF8 A;  1TAU A;  3L2U A;  4CER A;  2P51 A;  4CJ5 A;  3OJS A;  1RBS A;  4LD0 A;  1KVC A;  4NYN A;  5DMR A;  4M3X A;  3SUO A;  4CHO A;  3MEE A;  2D0A A;  1DTT A;  3FFI A;  4B8C A;  3QEW A;  3QNN A;  4ID1 A;  5KI6 A;  4FJH A;  3KIO A;  4LY7 A;  3VQ7 A;  4DSF A;  3DLH A;  3ASM A;  4FYD A;  3K5N A;  4DS5 A;  2DTU A;  1R0A A;  1DLO A;  2FBT A;  1D9F A;  1KTQ A;  3IRX A;  4EP4 A;  5HP1 A;  3V9X A;  1BI4 A;  1WAJ A;  2VWJ A;  4Y1D A;  4IBN A;  4DQS A;  1JXE A;  4LSN A;  1VSE A;  4J2B A;  2G8U A;  4DU3 A;  3AO4 A;  4E89 A;  4O55 A;  3WNE A;  4CK1 A;  5J1E A;  4JLH A;  4CJW A;  2YNI A;  1RDA A;  1S6Q A;  2YNF A;  3AA2 A;  4E3S A;  4BWM A;  4CJP A;  1B92 A;  1VK0 A;  2RN2 A;  2X6S A;  4O44 A;  3OS2 A;  3DRS A;  4CJS A;  1L5U A;  4HUE A;  3KD5 E;  3K5L A;  1N5Y A;  1RIL A;  3BGR A;  4E7H A;  2XRI A;  4I2Q A;  1VSH A;  1K6Y A;  1RTJ A;  4B8A B;  4CHN A;  4DFK A;  3D0P A;  3SJJ A;  4DSJ A;  4FZX C;  4BDY A;  3LAM A;  1KLM A;  3HPG A;  1NJW A;  4JS4 A;  2EX3 A;  3VQC A;  3NFA A;  1A5W A;  1LAV A;  2XO7 A;  2D0B A;  3LZJ A;  1UA1 A;  1RDB A;  1W9H A;  4CES A;  5KTQ A;  3MEC A;  4HTU A;  1S1T A;  3AVG A;  4GMJ B;  4CF0 A;  4M45 A;  3M8P A;  4KTQ A;  3L3V A;  1EET A;  3L3U A;  4HVJ A;  3QET A;  1UA0 A;  2QXF A;  5KRS A;  4L8R B;  4EP5 A;  1NKB A;  3SV3 A;  1VSF A;  3O3H A;  3IAY A;  2EHG A;  4F3O A;  4PWD A;  4I2P A;  4CGD A;  3ZSO A;  1NOZ A;  4LH4 A;  3V1Q A;  2OPP A;  3RMB A;  1X9S A;  1S1W A;  1X1P A;  3S3M A;  4LH5 A;  1IKV A;  3ZSX A;  4CJ3 A;  4F4K A;  5FDL A;  1RTD A;  4E7L A;  3AVB A;  1GOB A;  3M8S A;  4DQR A;  4NCA A;  2HND A;  4F2R A;  3CM6 A;  3OJU A;  1CLQ A;  3NCI A;  1LV5 A;  3OYH A;  4ZTJ A;  3I0S A;  3ULD A;  1RBR A;  2F96 A;  1KCF A;  1U48 A;  4OPK A;  4B9V A;  4QCL A;  3VQ6 A;  4CGH A;  3NGZ A;  3ZSV A;  3SUQ A;  3V1O A;  2B4J A;  3DYA A;  5CY4 A;  3HST B;  1A5V A;  3QLH A;  3MXM A;  1QSY A;  4DLG A;  3M8Q A;  3ZSR A;  4R5P A;  3ISN C;  3PX6 A;  3MEG A;  1HQU A;  4BE0 A;  4KB1 A;  4GW6 A;  3CG7 A;  5FRM A;  3MXI A;  3SPZ A;  2YHA A;  3B6O A;  4N56 A;  2E4L A;  5J2P A;  4AHR A;  1A5X A;  2B5J A;  3T3F A;  4CF9 A;  2P1J A;  4N41 A;  1SKS A;  4EZ9 A;  2E6M A;  4DSI A;  1WSH A;  3I0R A;  2AJQ A;  3TR8 A;  4OJR A;  1SL2 A;  3AVJ A;  2VG6 A;  4DQI A;  5SWM A;  3K5O A;  3SNN A;  3BDP A;  4J2E A;  3LP1 A;  4H8K A;  3JSM A;  4OKK A;  4FJG A;  4DG1 A;  2YKN A;  3QIN A;  4Z4C A;  1O1W A;  1NK4 A;  4KI6 A;  1FKP A;  2F8S A;  4YNQ A;  4HUF A;  4CEC A;  1HYS A;  3RMC A;  3SYZ A;  1VSM A;  5HRR A;  4BE1 A;  4KHY A;  3VQ5 A;  1RT5 A;  2JLE A;  4M3Y A;  1VRT A;  1NOY A;  1BHL A;  4KKO A;  1RT6 A;  4E7J A;  3TAR A;  1ITG A;  5J2M A;  4DQP A;  4CFB A;  4KB0 A;  4EZ6 A;  2IC3 A;  1LW0 A;  1ZBF A;  5C42 A;  3OYF A;  3VA0 A;  1NJX A;  1JLC A;  3RTV A;  1G15 A;  3U6F A;  4B9M A;  1JL2 A;  1T03 A;  2Z1H A;  3HVR A;  3AVC A;  3NGY A;  1NK0 A;  1I3A A;  2KTQ A;  1NJZ A;  1JLA A;  4ICL A;  4CCH A;  4FLU A;  1TK5 A;  3DOK A;  4H4M A;  4XIU A;  1BQM A;  1Z25 A;  2YKM A;  3D45 A;  1ZBU A;  4NCG A;  1XI1 A;  4KAZ A;  4KRF A;  1WSG A;  3K59 A;  1KVA A;  2OPR A;  3AO5 A;  4M3Z A;  3I8D A;  2HHU A;  1C1C A;  3OYL A;  3PO4 A;  1WSF A;  3JYT A;  2QKB A;  1RT3 A;  3AA4 A;  2X6N A;  2FBY A;  4NCB A;  3L2V A;  4OLA A;  3NF6 A;  4JRP A;  1QQC A;  1C0U A;  1RBU A;  3CFP A;  3V9U A;  2G8W A;  3HVT A;  3LPT A;  3THV A;  1HNV A;  3F73 A;  4CJF A;  1UWB A;  3C94 A;  4DMN A;  3DRP A;  2E6L A;  2XY5 A;  2ATQ A;  5JS2 A;  3L2R A;  3NH0 A;  4CGJ A;  3L8B A;  3P83 D;  3AVF A;  4HCC A;  3LPU A;  3QEV A;  3P5J A;  4B9L A;  2G8H A;  4IFY A;  4CF8 A;  2IS3 A;  4W5R A;  4H4O A;  1RT1 A;  3M8R A;  4KFB A;  2Z1J A;  5SZT A;  4M3R A;  3OS1 A;  3RR7 A;  2P5G A;  2PYJ A;  1NK5 A;  4OLB A;  2YNH A;  1KSP A;  4FJ7 A;  4CIF A;  4ID5 A;  5C25 A;  1ASW A;  4DTR A;  1TK8 A;  1FK9 A;  1EX4 A;  3DLK A;  1L3T A;  3LWL A;  3CFR A;  2NUB A;  4CEO A;  2P5O A;  1BI4 B;  1IO2 A;  4OKE A;  1I39 A;  5DK5 A;  3OYN A;  4DTP A;  4CEE A;  1D8Y A;  2OA8 A;  3KKR A;  3VQ4 A;  1SKW A;  1T05 A;  4Z4G A;  1ASU A;  3G0Z A;  1KRP A;  1JLE A;  4BDP A;  1S1V A;  3CFO A;  4AHV A;  1SV5 A;  1VSJ A;  1LAW A;  1FXX A;  3AVA A;  3ZT0 A;  2Y1I A;  1TK0 A;  4DSE A;  4KRE A;  1REV A;  4AHS A;  1TVR A;  3OYM A;  3HM9 A;  1J53 A;  3OYJ A;  4FM1 A;  3S3O A;  4PY5 A;  4FJ8 A;  2HHS A;  3AVH A;  4O0I A;  1U45 A;  1C0T A;  1NK7 A;  3L2Q A;  1D9D A;  2ZQB A;  2X78 A;  5KGX A;  3SCX A;  1WAF A;  4DTX A;  4CJL A;  3SQ4 A;  5EU7 A;  3AA3 A;  4B9N A;  1JXB A;  2GBZ A;  4RW9 A;  1TKZ A;  3S9H A;  2OZM A;  4TSX A;  2RF2 A;  4FJM A;  1GOA A;  1TL1 A;  3CM5 A;  1TKX A;  3DI6 A;  4CED A;  3NAE A;  2R7Y A;  3V9Z A;  3SQ1 A;  4ELV A;  1TAQ A;  2GV9 A;  4FK0 A;  1NJY A;  4IDK A;  4AHC A;  2IOC A;  3OS0 A;  3P1G A;  3SQ2 A;  3B6P A;  4Z4H A;  1QTM A;  2HB5 A;  4ZTF A;  4FJ5 A;  4FJ9 A;  1Q9X A;  3TAG A;  1LW2 A;  3O3G A;  2XY6 A;  2D0C A;  4IFV A;  4E7K A;  3NH1 A;  4QOZ B;  1J54 A;  3OYG A;  3AVK A;  2GUI A;  2HHV A;  1XC9 A;  4CJR A;  4CJT A;  4K8X A;  1N6Q A;  1JLG A;  5HLF A;  4DTS A;  3EYZ A;  2IAJ A;  4N5S A;  2HMI A;  4CHQ A;  4Z4F A;  4ZHR A;  4CF2 A;  3CYM A;  1HYZ A;  1GOC A;  1SUQ A;  3OVN A;  4W5N A;  4M3U A;  2Z1I A;  1CZ9 A;  4CK2 A;  4FJN A;  4FLX A;  3QIP A;  4OKJ A;  4DFJ A;  1KFD A;  2KW4 A;  5J2Q A;  4DF8 A;  5FRN A;  4BWJ A;  3LZI A;  4E1M A;  5CZ2 A;  4M42 A;  4NYF A;  3DLG A;  5I3U A;  4CIG A;  4CGI A;  1IG9 A;  4FJL A;  1WLJ A;  2BE2 A;  4KHW A;  1QE1 A;  4G1Q A;  3LAN A;  1UAX A;  3HL8 A;  4PUO A;  1C1B A;  4LSL A;  3MED A;  3KLG A;  4DF4 A;  2PZS A;  2LSN A;  3KLE A;  3AVI A;  4C8O A;  1RBV A;  3WNH A;  3SZ2 A;  1IH7 A;  2DFE A;  1CZB A;  3HXM A;  1RT4 A;  4DSK A;  3LAK A;  4QAG A;  3C95 A;  3TAN A;  3AO2 A;  4DTN A;  2QKK A;  2KQ2 A;  4GVM A;  1TL3 A;  3RMA A;  1BCO A;  1S9G A;  3VQE A;  4FK2 A;  3SPY A;  1B9F A;  1D5A A;  4KO0 A;  3V9W A;  2HVI A;  1J5O A;  2DFF A;  1XWL A;  3VQB A;  4IKF A;  2HHT A;  2XY8 A;  4RW6 A;  1L3S A;  1EXQ A;  3NF7 A;  4O0J A;  3O3F A;  1BIU A;  3ZSW A;  3NF9 A;  3LDS A;  1QS4 A;  3U3G A;  3OYI A;  3KTQ A;  3C6U A;  4RW4 A;  1RDC A;  4CF1 A;  1ZBI A;  1TGO A;  3ZT2 A;  4ELT A;  1F21 A;  3AVM A;  1JL1 A;  1HPZ A;  2RPI A;  4OVL A;  4RG8 A;  4FLW A;  2VG7 A;  3VQ8 A;  1SL0 A;  1JLF A;  4KV8 A;  1TKD A;  4J2A A;  4FK4 A;  4CJV A;  3DRR A;  3EZ5 A;  4CJ4 A;  3VQP A;  4IG3 A;  3LWM A;  4DU4 A;  4CGG A;  1ASV A;  3HPH A;  4N47 A;  3CQ8 A;  4AHT A;  1ZYQ A;  4ELU A;  3MAQ A;  1KLN A;  1BIZ A;  3QES A;  4N76 A;  2QK9 A;  4AH9 A;  3AVN A;  4DU1 A;  1S9E A;  1XHX A;  4F3T A;  3NH2 A;  4IG0 A;  3VA3 A;  1Z26 A;  3ZSQ A;  3KKS A;  3OYK A;  2BGG A;  3WNG A;  1WN7 A;  4HCB A;  3TAF A;  3KD1 E;  3KK1 A;  1B9D A;  4RW8 A;  3QEX A;  4FW2 A;  2OYQ A;  4DFM A;  3AO1 A;  1Q9Y A;  2DY4 A;  4CJQ A;  3O4N A;  3ZSZ A;  1YT3 A;  4E1N A;  1C1A A;  4CJE A;  5E41 A;  4JRQ A;  1JLQ A;  3TAE A;  4CEB A;  3L2W A;  3UIQ A;  4I9Q A;  3OYB A;  4DTU A;  3MXJ A;  4B9S A;  2VG5 A;  5CZ1 A;  3RR8 A;  1HRH A;  2IGI A;  4DTJ A;  1NK6 A;  2YNG A;  1BL3 A;  1HJR A;  4CIE A;  4Q5V A;  1RTI A;  3VQQ A;  1NK9 A;  4FXD A;  4DQQ A;  2WON A;  1VSI A;  1JKH A;  4AHU A;  4HHT A;  1J9A A;  2ETJ A;  3AA5 X;  4KHN A;  3TAP A;  4FJI A;  1C0M A;  3KLF A;  1YTU A;  1VSL A;  1YTA A;  1SKR A;  3OYC A;  2HVH A;  1Y97 A;  3SUP A;  3VQA A;  5I42 A;  4CEF A;  4FLV A;  4OGC A;  3OY9 A;  3TAM A;  4M3W A;  1ZBL A;  4MFB A;  3VN5 A;  1BCM A;  3HP9 A;  4J2D A;  1U47 A;  3QIO A;  2ITG A;  1U49 A;  1X9W A;  2HNY A;  1U4B A;  3HO1 A;  3F9K A;  4FLT A;  4Z4I A;  4KPY A;  2HNZ A;  4CHZ A;  4KI4 A;  3PX4 A;  4DTM A;  4W5O A;  3HJF A;  4OGE A;  2YHB A;  3SV4 A;  4O4G A;  2VWK A;  3TAB A;  5T7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...