4E1NA

Crystal structure of hiv-1 integrase with a non-catayltic site inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
144
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSATVKAAWWAGIKQEFGIPNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 integrase
publication title New Class of HIV-1 Integrase (IN) Inhibitors with a Dual Mode of Action.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
total genus 46
structure length 144
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e1nA00
4KTZA 1RBTA 2E6MA 3T19A 4KHWA 2ZE2A 2IAJA 4DTUA 1HMVA 1HYZA 4FW2A 4Q5VA 2IGIA 2R7YA 2I5JA 1ASWA 3AVMA 4IFYA 3S9HA 1VSEA 2WOMA 1R0AA 3UIQA 1ASVA 2G8KA 3VA0A 1EP4A 1S6PA 2A1RA 4C8LA 5C25A 3LALA 4LH4A 4FXDA 4AILC 1NK8A 1L5UA 2OZSA 3ZT4A 3BDPA 4DFJA 2OPSA 5HRNA 4IG0A 1CXUA 3AA4A 1A5XA 1LW2A 2BE2A 1EXQA 1L3TA 3P1GA 5HRSA 4DQRA 4F8RA 4FJ9A 1C1CA 4OJRA 1T7PA 2E6LA 3DYAA 2KW4A 2Y1JA 4CJ4A 1BCMA 1ZBFA 4KPYA 4ELVA 4PY5A 2HNYA 3PO4A 4FLTA 1Q9YA 1KFSA 4Z4IA 2HHSA 3RMBA 1HYSA 1LWEA 2E4LA 3V9ZA 3SJJA 4FJ7A 3OYGA 3SYZA 3LAKA 3M8PA 5I42A 4GW6A 4TSXA 2HHXA 3QESA 1WAFA 1KLMA 1D8YA 4CEDA 1C0TA 4WE1A 4N76A 4OKKA 2VWJA 1LW0A 3AO3A 4W5OA 4FLXA 4CEOA 3KLFA 2EX3A 2D0BA 1IKWA 5FDLA 1QSSA 1KCFA 3ASMA 5CYQA 3OYAA 3D0PA 1XC9A 4E0DA 1BL3A 3LZIA 3RTVA 4FZYA 4Z4EA 3C94A 4CFAA 1NJYA 1B9FA 2BDPA 4F3OA 2HHWA 4CGFA 3THVA 4DTPA 5D3GA 1RT5A 4E89A 1XI1A 4KKOA 3TAMA 4M3TA 3DLBA 4EZ9A 4FJNA 3LP2A 1UOCA 3V81A 1N5YA 1BGXT 3DLRA 4ICLA 1BHLA 1WSFA 3K2PA 2P1JA 3ZT1A 3C95A 4CEQA 5KRTA 4CEZA 3LDSA 3V9XA 5FRNA 2X6NA 3L2QA 4LD0A 3OVNA 3TWHA 3SQ1A 1YVUA 3DLHA 4C8MA 3OYCA 1Q9XA 4B8CA 3S3MA 3QINA 2YHAA 1NOZA 3SI6A 5CYMA 3O3GA 4DSLA 5HP1A 4CHZA 3HXMA 4KHQA 4ELUA 4W5QA 3AA5X 3KK1A 3JSMA 4CJKA 4K8ZA 4M42A 3NF8A 3LAMA 4HUEA 5J2PA 3NCIA 2YNFA 3QEWA 4BDPA 4ZTJA 1SKRA 1RBVA 1LWFA 1VSJA 1TAQA 3ISNC 5KGWA 1JLFA 4Z4CA 4E7IA 1DTTA 2HB5A 3O3FA 3OYMA 3OJSA 4B8AB 3L2RA 1I3AA 3NGIA 3VQ5A 3VQCA 3NH1A 3EYZA 4DSIA 4J2AA 4N5SA 4E7HA 4KTWA 5J2QA 1NJZA 1I39A 1TGOA 3KLGA 3TAPA 2PZSA 2O4GA 3LWMA 3OYIA 4OVLA 3VQEA 3RR8A 2HHTA 2JGUA 3NF9A 4CEEA 2BGGA 1Q8IA 5K14A 4DLEA 4NYFA 3VQDA 1TKXA 2B4JA 2F8SA 4M3YA 3IG1A 1WSJA 1EKEA 3K5MA 5DK5A 1SUQA 2FBXA 1J54A 4KFBA 3RRGA 2FBYA 1LAWA 1W9HA 3KIOA 1S1TA 3HVRA 4CHQA 5FRMA 3P5JA 3KKRA 3TAFA 3D45A 4OGCA 1KFDA 1NJXA 4R5PA 4FW1A 3WNEA 1GOAA 2XY7A 4J2EA 4NCAA 2IDOA 1FKOA 1VRUA 3VA3A 5J2MA 1VSHA 3KLHA 4HCCA 1J5OA 1A5WA 1RTHA 1C1BA 3JYTA 4DQIA 4OKJA 4EZ6A 3V1QA 3ZT3A 2PYLA 1S1UA 1VSFA 2B6AA 3ZCMA 3CFPA 4CJVA 3DM2A 5DMRA 3KKSA 1WSHA 1SKWA 3RWUA 4OLBA 1YTAA 3AVNA 4E3SA 3PV8A 3VQ8A 4ZTFA 3VQPA 4GVMA 2ETJA 2W42A 4CJEA 1RT6A 3P83D 1L3VA 5CY4A 4RW8A 1XHXA 1T05A 3NF7A 4LY7A 2VG5A 4HUGA 3HYFA 1JKHA 3MEGA 3PUFA 4M3UA 3G10A 4AH9A 5KTQA 4RW6A 1VSLA 3NF6A 4CESA 4OPKA 4FLUA 1NKEA 1EETA 4E7LA 1WSIA 3K59A 3RMDA 2XO7A 5FROA 4Z0UA 4DG1A 3V1RA 3V9WA 4AHTA 4KREA 3ZT2A 1ZBUA 3QEPA 4BWJA 1VSMA 3AVAA 3ZSYA 4CIEA 3CG7A 3M8SA 4C8KA 5SWMA 4O0JA 3PO5A 3OYDA 2IC3A 3LP1A 4I9LA 3TANA 4DQQA 1T8EA 1TK8A 3PY8A 2G8FA 1QQCA 1QE1A 1NK4A 5HBMA 5E41A 4B9LA 4F4KA 4Y1CA 4DLGA 2YKMA 2G8WA 1J53A 1RTIA 4YFUA 3KK3A 3VQ6A 2G8HA 3M8QA 1JLGA 4E19A 3KLIA 3SUPA 1SL1A 2ITGA 4CFDA 1RT3A 4E7KA 4M41A 4CJ3A 2VWKA 1CZ9A 2RF2A 4CJQA 3AVHA 3V9SA 1TK5A 4E1MA 3AO5A 3TAQA 1T03A 3E01A 2ATQA 4CGGA 3IS9A 3AA3A 3HT3A 3SV4A 4M3ZA 4PWDA 2HHUA 1DLOA 2F96A 4YNQA 4DTOA 1JL2A 3AA2A 3NFAA 1IKXA 3DOKA 4CIFA 4IG3A 3TR8A 4DSEA 1REVA 3PX0A 3F73A 4B9UA 4ELTA 4Z4GA 2RKIA 1QTMA 4XIUA 3MAQA 1NKCA 1TKDA 2F8TA 2HVIA 1JLCA 3CFRA 1HPZA 2HNDA 3HPGA 2HMIA 4HHTA 1U04A 4DTNA 3O4QA 1NK9A 2XY8A 2OA8A 1D9FA 3U3YA 4FJMA 1ASUA 1C1AA 1XWLA 3AVJA 3HP9A 2HW3A 2KQ2A 1TKTA 4LSNA 5CZ2A 1K6YA 3LWLA 4FJIA 2PY5A 4FK2A 4DTJA 4CFCA 1NKBA 5J2NA 2O4IA 1KVBA 3SV3A 3IAYA 4KB0A 1VRTA 3TI0A 4CEFA 1L3SA 5KI6A 3B6PA 4DF4A 4FK4A 4C8OA 2A1SA 3ZSWA 5SZTA 3I0RA 4FZXC 3PX6A 3HPHA 1IO2A 2P5GA 3CQ8A 2P51A 1X1PA 3VQ4A 4MQ3A 3NBPA 4CJUA 4DWIA 4KTQA 1HRHA 3L8BA 1HNIA 4HCBA 2PYJA 3ZT0A 3NE6A 1LWCA 4FJKA 1HQEA 1VSKA 1NK5A 1EX4A 4FJ5A 3KD1E 4B9SA 4BE1A 1RDDA 3L3UA 1S1XA 1WSGA 4CECA 4Z4FA 2GV9A 3TARA 4NCBA 1ITGA 3CM6A 4N56A 1U49A 4DQSA 2YV0X 4NCGA 1UAXA 3LZJA 2KTQA 3O4NA 1ZBIA 2KFNA 3NGYA 1S9EA 4I7FA 4O4GA 3MXJA 1HQUA 4ID5A 4FLZA 5HLFA 4KAZA 2KZZA 1ZBHA 1BI4A 4JRPA 1FK9A 2Z1HA 4BE0A 5I3UA 4W5NA 1CXQA 1HYVA 4Y1DA 4E7JA 1A5VA 4CIGA 4CJTA 4AHSA 4JS4A 4O55A 3H08A 2FC0A 3QIOA 2FBTA 2QK9A 2QXFA 1KVAA 4RG8A 5KRSA 4OLAA 3DMJA 4GMJB 2X6SA 2KZMA 4CFBA 2DY4A 4FJ8A 3MXMA 1G15A 3EZ5A 4BDYA 4FK0A 2OPPA 3OYHA 4PUOA 1TVRA 3KK2A 3U3GA 3OJUA 1B9DA 1UWBA 3DRPA 4O0IA 4JS5A 2Z1IA 2RPIA 3K58A 4BWMA 1WSEA 4CERA 4F3TA 1JLEA 3K5NA 1BCOA 3ZSQA 4M45A 4KO0A 1JXBA 2IOCA 3AVLA 4CF9A 3SQ2A 2D0AA 1BIZA 2DFHA 3QNOA 1SV5A 4CHNA 3C6UA 4FYDA 4CK1A 3K5LA 1D9DA 2RN2A 3OYJA 3PX4A 2LSNA 4BACA 4DU3A 3NH2A 3OYKA 3K57A 4CJPA 4B9TA 1VSDA 3T3FA 3OYLA 1BIUA 2Y1IA 3AVIA 1KVCA 3HVTA 1IKYA 1UA0A 3AO2A 4KI4A 1S1VA 3ZSZA 1RT4A 4E1NA 4DFKA 2IS3A 3DLGA 3ALYA 4IBNA 4DF8A 3EY1A 1IG9A 1FKPA 3L2UA 4RW4A 3I0SA 4FJXA 1TK0A 1RT7A 3CFOA 2QKBA 4BE2A 2AJQA 4DTRA 4HVJA 1Z26A 3V9UA 4DTSA 3QLHA 3MXIA 4W5TA 4FJHA 1IH7A 4IKFA 4PA1A 1BI4B 3F9KA 1RILA 4RW7A 3MEDA 3ZSRA 2Q3SA 4FJJA 4CJ5A 4FLYA 1VK0A 3WNHA 4UQGA 3SNNA 4F2RA 1B92A 4CEAA 1JLQA 4QCLA 1Z25A 5C42A 5T7BA 3HJFA 1WN7A 4FJLA 3QO9A 2HHVA 1RDBA 1BISA 4DFMA 2QKKA 2XHBA 2X78A 3HPOA 4DTMA 4OPJA 3LP0A 4CK2A 3V6DA 3VQ7A 4MFBA 4DFPA 1RDAA 4FM1A 1YTUA 2OPQA 1SKSA 1QSYA 1WNSA 4CJFA 4CK3A 3V1OA 2JLEA 3OS0A 3WNFA 1TAUA 3V4IA 4O44A 3VN5A 1NOYA 3MECA 4LH5A 3NAEA 2YHBA 4G1QA 3WNGA 3SUNA 2BANA 2YNIA 2Z1GA 3BGRA 4LSLA 4B08A 1QS4A 3HM9A 1C6VA 3NDKA 3SUQA 3ITHA 3SPZA 2G8VA 4I9QA 3OS1A 3QIPA 3S3NA 4DMNA 3OYNA 1U48A 4AHUA 3T1AA 3ZSOA 3A2FA 3C6TA 3OYFA 1SL2A 1KRPA 4OKEA 4J2BA 4H4MA 4PQUA 1RBUA 3DRRA 4KRFA 3DRSA 5HROA 1ZYQA 3SCXA 4FJGA 3IRXA 1TL3A 4I2QA 4RW9A 5EU7A 3HL8A 3VQAA 1YT3A 1RNHA 4DS5A 4FZZA 4W5RA 5CZ1A 4QOZB 1W0HA 4CE9A 1QSLA 4M3XA 1BQNA 1SL0A 4L8RB 1RTDA 3L2VA 3VQBA 4N47A 1NK6A 4DU4A 3L3VA 4CHPA 1S5JA 3QNNA 5JS2A 4JLHA 3SQ4A 4BDZA 3QEVA 2YNGA 4OGEA 1CLQA 4EP5A 1RT2A 3OS2A 4Q0BA 3QETA 2DTUA 4CGJA 3SPYA 1RBRA 1HJRA 3B6OA 4HUFA 1RDCA 4M3RA 4CHYA 2FBVA 4AHCA 2XY6A 1NK0A 3CYMA 2DFFA 3QEXA 3AVGA 1QHTA 3SQ0A 1X9SA 1GOBA 4K8XA 3OY9A 1RT1A 1S6QA 4CJLA 4CGHA 2HNZA 4DS4A 3TAGA 1U4BA 3HO1A 3FFIA 3VQ9A 4AHRA 4FCYA 1S9GA 3KJVA 3LPTA 5JS1A 4C8NA 3M8RA 3RR7A 1TL1A 2X74A 4B9VA 3SUOA 2P5OA 1J9AA 1JXEA 1WAJA 3HP6A 4CJSA 4ID1A 4DSJA 2VG6A 1DTQA 2XY5A 1C0UA 1XHZA 1VSIA 3ULDA 3DLEA 2OYQA 2HHQA 1U47A 2Z1JA 3TAEA 1O1WA 1ZBLA 4B9MA 1JLAA 3AVKA 3VQQA 3KTQA 3K5OA 4CJRA 1CZBA 2YNHA 3AVBA 3DLKA 3LANA 4CGIA 5J1EA 4FLWA 1RCHA 4CEBA 1TV6A 4KHUA 2KFZA 4KV8A 3QEIA 1JLBA 2EHGA 4QAGA 4DTXA 1KLNA 1F21A 3HK2A 1KSPA 3L2WA 3SZ2A 4CGDA 4CF2A 4B9NA 2G8IA 5KGXA 1KTQA 1BQMA 4B3OA 4JRQA 4F2SA 2D0CA 3OYBA 1LAVA 3TABA 1N6QA 1NK7A 2GBZA 4H8KA 1RBSA 1HNVA 1U45A 4KB1A 4KI6A 4CF8A 2WONA 3AO1A 2OPRA 3LP3A 4CF1A 4IFVA 3ZSXA 3AVFA 4DSKA 2D5RA 4IDKA 3NHGA 4ZHRA 1S1WA 1X9WA 1RTJA 2ZQBA 2VG7A 4KHNA 3LPUA 4DU1A 3AV9A 1UA1A 3G0ZA 4J2DA 3I8DA 3RRHA 1TKZA 2YKNA 3OYEA 1X9MA 3KD5E 4N41A 2G8UA 3U6FA 3RMCA 3O3HA 3DI6A 4KHSA 4HTUA 3DOLA 1IKVA 3CM5A 2B5JA 3AO4A 5C24A 1LV5A 1NJWA 1C0MA 1FXXA 4M3WA 1JL1A 4FVMA 4H4OA 3QERA 4FLVA 4DQPA 4KHYA 2GUIA 3S3OA 4Z4HA 3RMAA 3NH0A 1L3UA 2DFEA 4I2PA 3AVCA 3HSTB 4NYNA 3ZSVA 4CHOA 2ZD1A 2OZMA 4FM2A 4EP4A 1GOCA 4FM0A 4CJWA 2HVHA 4DSFA 4CCHA 4CF0A 3NGZA 1Y97A 2NUBA 5HRRA 3KLEA 2XRIA 1D5AA 1WLJA 3MEEA 4AHVA 4O5BA 1MU2A 5HRPA
chains in the Genus database with same CATH superfamily
3R9PA 2E6MA 1HMVA 3GE1A 3C7NB 3UIQA 1VSEA 4C8LA 2NRVA 3LALA 3HOSA 4LH4A 1NMDA 1NK8A 4BRIA 3AA4A 1W2BM 1LW2A 1L3TA 1S22A 3MN5A 4DQRA 4F8RA 2D0OA 4GVEA 4R79A 4WFBL 2Y1JA 1BCMA 1ZBFA 4PY5A 4ELVA 3PO4A 2VQEK 1Q9YA 1KD1O 1KFSA 4V19S 1E4GT 1LWEA 3V9ZA 3OYGA 2HBKA 4TSXA 4H0YB 1SS6A 4JI1K 1YI2N 4CEOA 5GIPA 4JD2A 5M1FA 2AA4A 2OCEA 5EXWA 3OHRA 5CYQA 4JI8K 3DXMB 5C15A 3C94A 1NJYA 1B9FA 4C23A 4DTPA 3LP2A 2QW9A 3DLRA 2W6KA 3JXUA 3V9XA 4CEQA 4FWQA 4IDHA 1GLDG 4CEZA 3LDSA 2V7YA 3N4PA 1YVUA 4C8MA 1Q9XA 4B3TK 3S3MA 1NGJA 2UXDK 3HXMA 4ELUA 1K8KB 1E4FT 2H3GX 4FWMA 4M42A 5FPDA 3NCIA 3QEWA 1RBVA 1RGIA 3ULEB 1DTTA 2HB5A 2Q31A 3SBTA 4YOYA 3O3FA 4B8AB 4YOWA 2E8AA 4WYBA 4DSIA 4E7HA 4KTWA 1YIJN 2GEMA 3OYIA 1VQ8N 5K14A 3EE9A 4NYFA 4BG9A 5CR4A 3K5MA 3MWTA 1SUQA 2FBYA 1W9HA 3C6HA 3HVRA 5FRMA 1NJXA 4R5PA 4FW1A 3WNEA 2XY7A 4J2EA 2IVNA 4BRAA 1NGBA 3QDKA 3VA3A 3KLHA 2O8FA 3JYTA 4EZ6A 3D7EO 2PYLA 3ZCMA 1RDWX 4B3RK 2V7ZA 4BC2A 4CBUA 1L3VA 1T05A 2VG5A 4HUGA 3HYFA 1JKHA 3MEGA 4A5AA 2ZF5O 3G10A 5KTQA 1EETA 1TYQA 4PKHA 3CMAN 3PIPL 5FROA 4DG1A 3V9WA 3ZSYA 2HBLA 3CG7A 5SWMA 1HX1A 3PO5A 3TANA 2G8FA 1QE1A 3FR0A 2D0PA 4B9LA 4EIAA 5E41A 4Y1CA 2YKMA 4YFUA 4XH5A 3TSQA 1JLGA 3KLIA 3VOVA 4CFDA 4M41A 1Z05A 3FZKA 4CJ3A 4WQ5A 4CJQA 1CZ9A 4EFHA 3MX2A 3TAQA 1T03A 3E01A 3P31A 3IS9A 3SV4A 2KHOA 3AA2A 4M7YA 3R1XA 3PX0A 2GWJA 4FWNA 2A40A 4FWKA 1NKCA 2E2QA 3HPGA 4F9OA 4B1WB 1VQ9N 1K73O 2HMIA 4DTNA 2FLOA 4BY9C 3ID8A 3AVJA 2UUBK 4LSNA 5CZ2A 5LMUK 2PY5A 4FK2A 4DTJA 1NKBA 3IAYA 3TI0A 4CEFA 1L3SA 4DCHA 3A5MC 4IFEA 2A1SA 3ZSWA 2P5GA 4RCHA 3L4QA 3MN6A 4IO8A 1IG8A 4FJKA 1HQEA 3KD1E 2VWBA 4LFAK 4DUZK 3AAPA 2A3ZA 3L3UA 1S1XA 1WSGA 3O6WA 1FJGK 4CECA 4Z4FA 2GV9A 4J8FA 4NCBA 3CM6A 2YV0X 4NCGA 1UAXA 3LZJA 2KFNA 1ILYA 4BQZA 3UE5A 3MXJA 5HLFA 2QXLA 1ZBHA 3SAFA 5CHIA 3GDQA 1ATRA 3A8YA 1FK9A 2Z1HA 4BE0A 1CXQA 1HYVA 2P9NB 4MLHA 4CZGA 3H08A 3HBTA 3IUCA 5M1OA 2FBTA 3QIOA 4B9QA 5FLXO 3BP8A 3DMJA 4GMJB 2X6SA 4K42A 3E9LA 3EZ5A 4OPAA 2OPPA 5AQZA 1W7AA 3H46O 3OJUA 1UWBA 1YJ9N 3CC2N 2RPIA 2ZJRL 4BWMA 2QWPA 3U9DA 3K5NA 4FPAA 1M90O 2IOCA 3AVLA 3KZBA 2DFHA 3QNOA 3CJCA 3WT0A 3OYKA 2ASOA 5KPZA 3K0SA 3ZEUA 3CF5L 3CCRN 2Y1IA 1IKYA 4C1NI 3A5LC 1R59O 2IS3A 3DLGA 4IBNA 4RW4A 3I0SA 1HNWK 4DR7K 2QKBA 4MO5A 3U9ZA 1HKBA 2AJQA 4HVJA 3CXCM 3QLHA 4FJHA 1U2VB 3O08A 4IKFA 5BPLA 1NGFA 3BZCA 4IO9L 2NRRA 4BRCA 4FLYA 1VK0A 1YVNA 3QO9A 2HHVA 1BISA 2P9PA 2X78A 3HPOA 4ISEA 3GBTA 3VQ7A 4MFBA 1RDAA 4FM1A 1DKGD 1SKSA 5M1QA 2ASPA 3BY5A 4O44A 1NOYA 3O9UA 3MECA 3NAEA 3SUNA 1NBWA 2ITMA 4LSLA 2Z1GA 1QS4A 3HM9A 1Q81O 2VCPA 2F7TA 3MCPA 5AQUA 4DMNA 4AHUA 1SZ2A 3ZSOA 1SL2A 2NRZA 1QVFM 4X64K 1RBUA 3DRSA 3SCXA 2QI2A 1TL3A 3HL8A 5B8HA 4DS5A 1YT3A 1RNHA 3LM2A 4W5RA 3CI5A 1VQ5N 4QOZB 3TTDA 4CE9A 3Q7CA 3VQBA 3UKUA 1NK6A 2UU9K 3L3VA 3VESA 4JI5K 4X65K 3ENOA 4I6MB 1RT2A 3OS2A 4WFAL 4BGAA 4CGJA 3B6OA 4HUFA 5M1KA 1IBKK 1RDCA 2FBVA 1NK0A 4YOXA 4IOCL 5AQWA 3JAMO 1C0GA 3SQ0A 5JICA 1S6QA 4XH1A 4CJLA 1X9JA 5LL6Z 4DS4A 3TAGA 4AHRA 4FCYA 3LPTA 4B9VA 3SUOA 4WQ4A 1J9AA 2O8BB 4JKBA 4CJSA 1BDGA 5A2QO 3CC4N 2VG6A 2FSNA 4BVOA 5GADP 1C0UA 3OTOK 1VSIA 3DLEA 4K43A 2GX9A 1XNRK 3AVKA 2OTLN 3K5OA 4CJRA 1CZBA 4CGIA 4FLWA 2QM1A 4CEBA 1JLBA 4XH4A 4DTXA 4CBXA 4CGDA 5EX5A 4A62A 5CE3A 3OYBA 4BR9A 3TABA 1N6QA 3K9KA 2YHXA 2GBZA 4H8KA 4A2BA 4RWTA 2P9LA 2WONA 4YY3K 4B1ZA 2D5RA 4BRNA 4BRPA 1RTJA 2ZQBA 4KHNA 3AV9A 5BR8K 3G0ZA 1TKZA 3UKRB 2E1YA 4N41A 5AQVA 2YI1A 2OANA 3O3HA 4BC4A 3RMCA 3DOLA 5AFUH 1GLCG 2B5JA 1NJWA 1V4SA 3QERA 4DQPA 1W97L 4K0KK 4BRMA 4NYNA 1GOCA 4XEIA 3SMSA 3NGZA 3HZ6A 1T44A 3P39A 1D5AA 4GY2B 2CH6A 4JI2K 3FLCO 2IAJA 3BUZB 3O8MA 4PL7A 2I5JA 1ASWA 5EVZA 4BR4A 4MO4A 1KXPA 3RSEA 3IDHA 5AZJA 1S6PA 5C25A 2IVPA 4FXDA 3SMPA 4CZHA 1G99A 2OZSA 3E9OA 3BDPA 4IG0A 4B1XB 3F9MA 3AGRA 5HRSA 1C1CA 1T7PA 2E6LA 5KQDA 3VF6A 2HNYA 4FLTA 1HYSA 2E4LA 4FJ7A 3SAHA 3SYZA 5I42A 1KLMA 1S3XA 1YXQA 4WE1A 4N76A 4W5OA 1OVQA 1N33K 5LY3A 1U6ZA 1WOQA 5IWAK 3O1BA 4MLEA 5FDLA 5AQFA 2HBMA 3M1FA 4Z4EA 4DV3K 2BDPA 3THVA 5D3GA 1VQNN 4KKOA 4H5RA 3TAMA 4M3TA 4EZ9A 1EQYA 3P4IA 4FWOA 5BPMA 1WSFA 2P1JA 5KRTA 4DV6K 4IEEA 4JHDB 3OVNA 3O9SA 4NXMK 3DLHA 2UXBK 3QINA 1NOZA 5CYMA 4DSLA 3AA5X 3JSMA 2Q0RA 2Q97A 3KK7A 4JEPA 2O8EB 4DV5K 2GUPA 4BDPA 4ZTJA 1WUAA 3VETA 1VSJA 1TAQA 5KGWA 4BRDA 4Z4CA 1Q82O 3L4IA 2JWLA 3HOTA 3OJSA 3EYZA 3FE1A 3CCMN 5GAEP 5J2QA 1NJZA 1TGOA 4CZJA 4OVLA 3RR8A 1Q8IA 4DLEA 3VQDA 2B4JA 2HOEA 4OX9K 3IG1A 4M3YA 5AQRA 1WSJA 1EKEA 4KFBA 1J54A 5F1XA 3RRGA 4BRGA 1GLLO 2O8CA 1S1TA 4M63C 4CHQA 3THWB 4WF9L 4OGCA 4NCAA 5JVGL 2IDOA 1GLEG 1FKOA 5F2RA 5J2MA 1VSHA 5TKYA 1C1BA 1ESVA 4BRFA 3V1QA 3ZT3A 4BR5A 2WTUA 1S1UA 3CFPA 3KKSA 1WSHA 1YTAA 3AVNA 3PV8A 1XUPO 4JKGA 4B1YB 5H1SQ 3VQPA 4GVMA 2W42A 2O8DB 2V51B 5TKWA 5AJ3K 4JKCA 3TSUA 4LY7A 3PUFA 5AQHA 4FPBA 4WQ4C 3CJBA 4CESA 4OPKA 4FLUA 1WSIA 3KHYA 3RMDA 2A5XA 3V1RA 4AHTA 4KREA 5BN9A 2UYTA 1ZBUA 3AVAA 3H45C 1T8EA 2IC3A 4I9LA 3PY8A 5E26A 1NK4A 4NLBA 4F4KA 2WC9A 4H5TA 3A5NC 1RTIA 2G8HA 3VQ6A 3VEOA 3J81O 3O9TA 3THYB 3I56N 2ITGA 3DXKB 1RT3A 1NU0A 2RF2A 5M1NA 4CGGA 3AA3A 4PWDA 1J6ZA 1DLOA 4YNQA 3NFAA 5F0XA 4O8UA 3DOKA 4DSEA 3TR8A 1N8RO 2BUPA 4XIUA 3MAQA 3EN9A 2HVIA 3CFRA 1QZ5A 3THXB 2QWMA 3H1VX 4JKDA 4HHTA 4H0VB 1BOTO 2OA8A 1D9FA 1QQNA 3W0LA 3CMEN 4FJMA 2HW3A 3LWLA 3ZEUB 2I7NA 2P9UA 4GV3A 1KVBA 4KB0A 4FL9A 1NGHA 5GAHP 3ZYYX 5GAGP 3WXMB 4FZXC 4AM7A 1X1PA 4MQ3A 3NBPA 4CJUA 4LFBK 3WXIA 1QHAA 1HNIA 3H3NO 4LC9B 4HCBA 3L0QA 2F9WA 2E5LK 3ZT0A 3Q7BA 4DQ8A 1EX4A 4JAXA 4FJ5A 4B9SA 1HNXK 1RDDA 3CCSN 2HHHK 4DR4K 1U49A 4DQSA 5AQXA 2KTQA 1S9EA 5FPMA 3H1QA 3HTVA 4YOVA 1QQOA 3CCJN 1HQUA 4FLZA 2KZZA 3SJHA 1NGDA 5EOYA 5I3UA 4Y1DA 1IV0A 4NO7A 1A5VA 1MDUB 1YJWN 4AHSA 1MWKA 3ZLJA 3D2FA 2QK9A 1NM1A 3WEEB 5ADXH 2DY4A 1P8ZA 4FJ8A 3WXLA 1VQ6N 3O9RA 4FK0A 4ILGB 3OYHA 1TVRA 3KK2A 1B9DA 2FF3B 3DRPA 4DR6K 1WSEA 4CERA 1JLEA 1Q86O 2RHKA 1JXBA 4CF9A 4LF4K 1H1VA 1BIZA 2PBDA 3TPQA 1JJ2M 3MWPA 4G9ZA 4UY8O 5C2FA 3NH2A 2RE2A 3WQTA 3T3FA 3OYLA 4CZIA 1HLUA 1BIUA 4NLCA 3E66A 3HVTA 1NGEA 1RT4A 4E1NA 3FZHA 4H0OA 1IG9A 1FKPA 3L2UA 4FJXA 1VQ7N 1JCEA 4DTRA 3HM8A 1Z26A 1Z6RA 2YJEA 4DTSA 3FZFA 4W5TA 3MXIA 1IH7A 4PA1A 1BI4B 1RILA 2P9SA 2WBNA 2QA4N 2Q3SA 5LJVA 4F2RA 3AAQA 4KH6A 3T7ZA 3HJFA 2D4WA 1RDBA 4DFMA 3BF3A 2QKKA 1LOTB 5BREA 5C12A 3DJCA 3LP0A 3PSFA 3V6DA 1WNSA 4CJFA 3V1OA 3T1HK 3WNFA 1TAUA 1NNEA 4QS7A 1IJJA 3VN5A 3CC7N 3AARA 2D1KA 2BANA 2YNIA 4B08A 3SUQA 1YAGA 1DGKN 3ITHA 3OA9A 3F5TA 1HPMA 3GG4A 4AM6A 1HUXA 3OYNA 3HSCA 3JS6A 3WXJA 3ZETA 4H0TB 3C6TA 3OYFA 5KQ8A 1KRPA 1GLBG 4BREA 3DRRA 1QQMA 2JWKA 5HROA 4I2QA 2FSJA 3WXKA 1QSLA 1SL0A 3L2VA 3D2EB 4FWSA 4O5FA 4Z94A 4CHPA 3QNNA 4JLHA 4BDZA 3ID6A 3QETA 2E20A 1RBRA 3R8EA 4IZ9A 1HJRA 4DR5K 2Q1NA 4M3RA 1TUYA 1RDUA 3CYMA 3QEXA 1X9SA 2NLXA 4CGHA 3QFPA 3FFIA 3ZX0A 5EY4A 4C8NA 1TL1A 4JI0K 4ID1A 3VERA 4B3MK 1YF5L 1KQSM 3ULDA 2HHQA 1U47A 2Z1JA 3C7NA 1O1WA 2Q2RA 4B9MA 1JLAA 3I8BA 2YNHA 2YX6A 3AVBA 3DLKA 1QSSA 2QEXN 4KHUA 5KPRA 2CGLA 4QAGA 2I7PA 2IVOA 1KSPA 3SAGA 4WCEL 4B9NA 5AQNA 1BQMA 4B3OA 1OVYA 4CD1A 3MMVA 4CD3A 1VQMN 1NG9A 4RTFD 4DSKA 4KH5A 3NHGA 1BWFO 1S1WA 1X9WA 4DR1K 2VG7A 5BRHA 2VGNA 1UA1A 3I8DA 3RRHA 2YKNA 3OYEA 4KHSA 1OH7A 2QWRA 3CM5A 4JI4K 1LV5A 4DV1K 1FXXA 4M3WA 4CZFA 4LF6K 4Z4HA 1L3UA 3ZSVA 2CH5A 4CHOA 4FM2A 3DXMA 4EP4A 4DSFA 4H0XB 4CF0A 5FPEA 3MEEA 3H3OB 1HR0K 1VQKN 5AZIB 4KTZA 4KHWA 4DTUA 4FW2A 1QVGM 4Q5VA 2IGIA 3AVMA 4IFYA 3S9HA 1R0AA 4LF9K 2E2PA 3VA0A 5GINA 4AILC 1K8KA 2OPSA 5HRNA 1CXUA 1JCFA 5BRDA 3ULEA 4FJ9A 4YDUA 1NGGA 3PIOL 3DYAA 1HKCA 4QS9A 4Z4IA 2HHSA 3RMBA 2F4VK 3SJJA 2P9KB 2HHXA 3O9QA 2WFBA 1D8YA 1C0TA 2PFUA 4CZLA 4FLXA 1O13A 4BQLA 3KLFA 2D0BA 1IKWA 3WUHA 3EZWA 3OYAA 1MWMA 1C0FA 2QTDA 3RTVA 1S72N 4F3OA 2HHWA 4CGFA 4DKWA 1RT5A 1K8AO 3DLBA 3CJ1A 1UOCA 3V81A 1N5YA 1BGXT 1RFQA 4ICLA 1BHLA 3K2PA 2E1ZA 3QFUA 3TWHA 4EHTA 3SQ1A 3OYCA 1NGCA 2NRTA 3SI6A 3O3GA 4C1NK 4KHQA 4K41A 4W5QA 3LDPA 4K8ZA 3F2KA 3TU5A 4HUEA 5J2PA 4JI3K 1HJOA 4CW7B 1LWFA 4IOAL 2QWQA 3EKSA 4E7IA 4B1UB 4AQYK 3CQXA 4CZKA 1I3AA 4ISGA 4WFNL 3VQ5A 3VQCA 3NH1A 4J2AA 4EHUA 4N5SA 1I39A 3LWMA 3VQEA 1NLVA 2JGUA 4CEEA 2F8SA 3OBWA 1VQLN 2NRXA 3VGMA 1BO5O 5DK5A 2FBXA 2ZJQL 4YHHK 5DM7L 3P5JA 1CZAN 3J8AA 4JD2B 1KFDA 5AQSA 1VRUA 1D4XA 3LDNA 1XQSC 1J5OA 1A5WA 1RTHA 1KC8O 1IBLK 4DQIA 4OKJA 4BRKA 2B6AA 4CJVA 3RWUA 5DMRA 1SKWA 4E3SA 4ZTFA 2ETJA 1RT6A 1I94K 3M3ZA 3NF7A 4M3UA 4AH9A 4RW6A 4E0DA 1NGIA 3NF6A 3NMUA 1NKEA 3K59A 4CI6A 2XO7A 4Z0UA 3ZX3A 3R3LA 5JMVA 4CIEA 3M8SA 4C8KA 2HSTA 1X3MA 3HK2A 4DQQA 2DPNA 3U4LA 4H5NA 5HBMA 1M1KO 3CPWM 4DLGA 4O8KA 3M8QA 3SUPA 2V52B 2HF4A 3AVHA 5KPTA 3AO5A 4M3ZA 4E1JA 3HT3A 2P9NA 3IFRA 2F96A 4DTOA 3OW2M 1IKXA 4CIFA 4B9UA 1REVA 2RKIA 1QTMA 4IWVA 1TKDA 2W6LA 2O8FB 1HPZA 1Q7YO 1OH8A 1JCGA 4LF5K 2QWLA 1U04A 2ZJPL 3O4QA 4H0PA 2XY8A 1NK9A 2A6AA 1ASUA 1XWLA 5AR0A 5BRFA 4OPHA 5J2NA 1VRTA 3O1WA 3VPZA 3B6PA 4FO0A 2F9TA 2CGJA 3I0RA 4JN4A 1TYQB 3HPHA 3PX6A 1KAXA 2P51A 3VQ4A 4DWIA 4KTQA 3ENBA 1BA0A 2P9IA 2PYJA 5GIOA 4BE1A 3TARA 4N56A 1N36K 3O4NA 3VEYA 1WBDA 3NGYA 4I7FA 4O4GA 1XNQK 4ID5A 2HBJA 1U2VA 3EL2A 1X3NA 4JRPA 4YDUC 3E1YA 4CIGA 4CJTA 3LDLA 2FC0A 2QXFA 1KVAA 2NZTA 4FSVA 1DT9A 5KRSA 4OLAA 5AQKA 1XMOK 4CVNE 3HI0A 3WQUA 3IKMA 3QICA 4JS5A 2Z1IA 3HRGA 1SAZA 1BCOA 1KAYA 3ZSQA 4M45A 3SQ2A 2GTDA 2D0AA 3QMLA 3C6UA 5AQIA 3BEXA 4CK1A 4DR3K 3DWLA 3PX4A 1ZXOA 4KBOA 2A42A 4FOEA 4BACA 3K57A 4B9TA 3AVIA 1KVCA 2PAVA 4GNIA 4JKEA 3AO2A 3LL3A 3ZSZA 3CCLN 3J7YP 1Q18A 4DF8A 1XC3A 3EY1A 3E9PA 3J7ZO 3CFOA 4BRLA 4A57A 4IOXA 3V9UA 3VF2A 4I6MA 4DR2K 4RW7A 4DV7K 4FJJA 4CJ5A 3SNNA 1B92A 4CEAA 1JLQA 4QCLA 1Z25A 5T7BA 1WN7A 4EAHD 3MN7A 4DUYK 3FZMA 4DFPA 1YTUA 2OPQA 3CIPA 3OS0A 2O8BA 2FF6A 3OBYA 1P90A 4LH5A 2YHBA 4G1QA 3WNGA 3BGRA 3NDKA 3SPZA 4I9QA 3QIPA 5AQTA 3G25A 4BC5A 3EO3A 4BROA 3A2FA 4OKEA 4PQUA 3G6EN 1ZYQA 3GOIA 4FJGA 3T69A 2NRWA 5EU7A 3VQAA 4FZZA 5CZ1A 4BVPA 3QBWA 1RTDA 1WB9A 4DU4A 1NWKA 2W41A 4FWLA 3QEVA 3MCAB 2YNGA 1CLQA 2DTUA 3UKRA 2YCHA 4B1VA 1HNZK 1SQKA 4AHCA 2XY6A 2DFFA 3W3DA 4K8XA 1GOBA 2IIRA 1RT1A 2P9PB 2HNZA 4U67L 1VQON 3HO1A 1S9GA 4A2AA 4KHPK 5C10A 1VAZA 2X74A 5C2DA 2P5OA 3K9JA 3VF4A 1WAJA 3HP6A 4GKJK 4CZMA 4DSJA 4M7XA 1DTQA 3ATVA 3MN9A 2XY5A 4JKAA 1XHZA 4H03B 1ZBLA 3KWIA 3VQQA 4NXNK 3LANA 1TV6A 1EWQA 3RVCA 4CJ7A 3QEIA 1DEJA 1WBBA 1F21A 4A61A 3L2WA 1KTQA 4F2SA 2D0CA 1LAVA 3VEZA 1NK7A 1MA9B 1U45A 1RBSA 4L3QA 4KB1A 4CF8A 3AO1A 3LP3A 2HF3A 4IFVA 3ZSXA 3AVFA 3UKUB 3I55N 4IDKA 2UXCK 3NVKA 4FOIA 3LPUA 3MDQA 3ENHA 4DU1A 5C0YA 1TUUA 4J2DA 1X9MA 3TTFA 2G8UA 3U6FA 4NB4A 3AO4A 5C24A 3VENA 1C0MA 1ATNA 1JL1A 2GUIA 3RMAA 2DFEA 4I2PA 3AVCA 3HSTB 2ZD1A 2OZMA 4FM0A 4CJWA 2HVHA 3DAWA 1Y97A 3CCEN 2KLAA 1WLJA 4AHVA 1XMQK 4O5BA 1MU2A 3T19A 1RBTA 1V4TA 2ZE2A 1HYZA 2R7YA 1N34K 1NMNA 4JHDA 5AQJA 1BA1A 2WOMA 1ASVA 2G8KA 1EP4A 2A1RA 1EO1A 1L5UA 3FZLA 3ZT4A 2O8EA 5AQYA 4DFJA 1A5XA 2BE2A 1EXQA 3P1GA 3J80O 2P9LB 1BG3A 4OJRA 4GV6A 3FFKB 4HWIA 1GLJO 2KW4A 4CJ4A 5I9EB 3G4SN 4KPYA 5BR9A 4DV2K 4BR7A 3LAKA 3M8PA 4GW6A 1FW6A 3QESA 1WAFA 3KWGA 4CEDA 4OKKA 1NJIO 2VWJA 3THWA 1LW0A 4JYAK 3AO3A 5MLCQ 1LCUA 3CCVN 2EX3A 2E88A 1KCFA 3ASMA 5BN8A 5JLHA 3D0PA 1XC9A 1BL3A 3LZIA 4FZYA 4CFAA 4FWPA 4JI7K 4E89A 1XI1A 4JKFA 4FJNA 4B3SK 3ZT1A 2O8DA 3C95A 2X6NA 3L2QA 4LD0A 4YORA 3RSEB 5M1PA 3ZX2A 5AZJB 4JNEA 4B8CA 2YHAA 5HP1A 4CHZA 3KK1A 4CJKA 3NF8A 3LAMA 2YNFA 1SKRA 5E84A 4Y0WA 3ISNC 1JLFA 3MX5A 4CZEA 3EKUA 4ISFA 1T3VA 3OYMA 3L2RA 2FSKA 3NGIA 3KLGA 3TAPA 2PZSA 2O4GA 2HHTA 1E3MA 3NF9A 3THYA 2BGGA 3TSPA 1TKXA 3DXKA 1YJNN 2UUAK 3BZKA 1LAWA 3KIOA 5AQMA 3KKRA 3TAFA 3D45A 4X62K 1GOAA 2ZM6K 4HCCA 3THXA 5AQPA 1BUPA 3EEQA 1QZ6A 5AFUA 4CBWA 4DB3A 1VSFA 3KTQA 2KFZA 3EE8A 3DM2A 4OLBA 3SBGA 3P38A 3VQ8A 4CJEA 3P83D 5CY4A 4RW8A 1XHXA 2P9IB 4MDAA 2NNWA 1VSLA 2YHYA 4E7LA 3VGLA 1J5EK 3CJAA 3ZT2A 3QEPA 4BWJA 1VSMA 3S41A 4IEIA 4X66K 3C0BA 3LDQA 3BF1A 4O0JA 3OYDA 3AGKA 3LP1A 1TK8A 1QQCA 5LMNK 4FWRA 2G8WA 1J53A 3KK3A 3SK3A 1OH6A 5FPNA 4JV5K 3CERA 4E19A 3CCUN 1SL1A 4E7KA 3AY9A 4DHYA 2VWKA 3ATUA 4BR2A 3N4QA 3CCQN 3V9SA 1TK5A 4E1MA 2O8CB 2ATQA 3C65A 4BGBA 3O4WA 2HHUA 1ZC6A 2YJFA 1JL2A 1GLAG 4IG3A 5IT9O 4ELTA 3F73A 4Z4GA 3CQYA 3WEEA 4GV9A 2F8TA 1JLCA 2HMPA 2HNDA 4PKIA 2QWOA 4A5BA 3U3YA 4K25A 1C1AA 3HP9A 2KQ2A 1TKTA 1K6YA 4FJIA 2CGKA 4JKGB 4CFCA 2E2NA 2YHWA 2O4IA 3SV3A 4QS8A 4YOUA 1EWRA 5KI6A 2J4RA 4DF4A 3T1YK 4FK4A 4C8OA 1HKGA 3I33A 5SZTA 2E2OA 1IO2A 3CQ8A 5FRNA 1HRHA 5ELZA 3L8BA 4DV4K 4JKHA 1ZBSA 4BRQA 3NE6A 1LWCA 1VSKA 1NK5A 4FVUA 3VTHA 1ITGA 1ZBIA 1ATSA 3O5BA 4KAZA 4H5VA 5DM6L 3CD6N 1BI4A 3CJ9A 4WQ5C 3VEXA 4W5NA 4E7JA 4BG8A 1VQPN 4JS4A 4O55A 4RG8A 4LF8K 2KZMA 4CFBA 3MXMA 3UB5A 1G15A 4BDYA 1YHQN 4PUOA 2BH1A 3U3GA 3QBXA 4O0IA 3K58A 4F3TA 1VQ4N 5LJWA 4KO0A 3U8XA 4BC3A 2P9UB 2UUCK 4PL8A 2A41A 3VGKA 4JK7A 1SV5A 4CHNA 4ILHA 4FYDA 3K5LA 1D9DA 2RN2A 3OYJA 2LSNA 4DU3A 3CPEA 4CJPA 1VSDA 2ZWHA 3GL1A 4LF7K 1UA0A 2GWKA 4KI4A 4DV0K 1S1VA 3LM9A 3SLCA 4OO1J 4DFKA 3A5OC 3ALYA 5AQQA 2VGMA 1TK0A 1RT7A 1YUWA 4BE2A 2NRHA 3D2EA 1GLFO 3C6AA 4HTLA 3F9KA 3MEDA 5BPNA 3ZSRA 5AQOA 4UQGA 3WNHA 1KAZA 5C42A 3NVMA 2WUSA 2KKZA 3D2FB 4FJLA 3CJ7A 2XHBA 4DTMA 4OPJA 2QWNA 4JK9A 4CK2A 2ZGYA 1OH5A 4PKGA 1QSYA 4CK3A 5HL7L 2JLEA 1T6DA 3V4IA 2FXUA 4BR0A 4KH4A 3M5RA 2G8VA 1C6VA 3OS1A 3S3NA 3O80A 3VEVA 1YITN 2OTJN 1U48A 4A59A 3T1AA 4J2BA 4H4MA 4KRFA 3VEWA 2GELA 3H6EA 3CHWA 3IRXA 3G71N 1NGAA 4RW9A 3B8AX 3DLLL 1W0HA 4M3XA 1BQNA 4L8RB 4AF1A 4N47A 1S5JA 5JLFA 5JS2A 3SQ4A 4OGEA 4EP5A 3QB0A 4JK8A 4Q0BA 2P9SB 4U7BA 2ZGZA 3SPYA 4CHYA 5AQLA 2VYPA 3AVGA 1QHTA 3A0IX 3OY9A 4ILJA 3R6MA 1U4BA 3VQ9A 3D6RA 3KJVA 5JS1A 3M8RA 1IBMK 5JVHL 3RR7A 3VMFB 5AQGA 4LFCK 1JXEA 2Q0UA 4IJAA 5AZIA 3FGUA 5ADXA 3PSIA 3LDOA 2OYQA 3TAEA 3L6QA 3VTIA 3ZETB 5J1EA 1RCHA 1Y64A 3MK6A 4KV8A 2BTFA 2EHGA 1KLNA 3PLAA 3TTCA 3SZ2A 3M6GA 4CF2A 2G8IA 5KGXA 1K9MO 4JRQA 1HNVA 4KI6A 4CF1A 2OPRA 4JI6K 4ZHRA 4IJNA 2AP1A 5HOOA 4MDBA 2ASMA 2P9KA 3CETA 4GKKK 2EWSA 3KD5E 4PHTX 3DI6A 4HTUA 1IKVA 1BU6O 1VHXA 4FVMA 4H4OA 4FLVA 4KHYA 3S3OA 1T6CA 2VQFK 3NH0A 4IXCA 1OKJA 3J7AP 3KVGA 4YOTA 1N32K 4H5WA 4CCHA 2W40A 3IMXA 4BRHA 2NUBA 2Q36A 5HRRA 3KLEA 2XRIA 5HRPA
chains in the Genus database with same CATH topology
4KTZA 1RBTA 2E6MA 3T19A 4KHWA 2ZE2A 2IAJA 4DTUA 1HMVA 1HYZA 4FW2A 4Q5VA 2IGIA 2R7YA 2I5JA 1ASWA 3AVMA 4IFYA 3S9HA 1VSEA 2WOMA 1R0AA 3UIQA 1ASVA 2G8KA 3VA0A 1EP4A 1S6PA 2A1RA 4C8LA 5C25A 3LALA 4LH4A 4FXDA 4AILC 1NK8A 1L5UA 2OZSA 3ZT4A 3BDPA 4DFJA 2OPSA 5HRNA 4IG0A 1CXUA 3AA4A 1A5XA 1LW2A 2BE2A 1EXQA 1L3TA 3P1GA 5HRSA 4DQRA 4F8RA 4FJ9A 1C1CA 4OJRA 1T7PA 2E6LA 3DYAA 2KW4A 2Y1JA 4CJ4A 1BCMA 1ZBFA 4KPYA 4ELVA 4PY5A 2HNYA 3PO4A 4FLTA 1Q9YA 1KFSA 4Z4IA 2HHSA 3RMBA 1HYSA 1LWEA 2E4LA 3V9ZA 3SJJA 4FJ7A 3OYGA 3SYZA 3LAKA 3M8PA 5I42A 4GW6A 4TSXA 2HHXA 3QESA 1WAFA 1KLMA 1D8YA 4CEDA 1C0TA 4WE1A 4N76A 4OKKA 2VWJA 1LW0A 3AO3A 4W5OA 4FLXA 4CEOA 3KLFA 2EX3A 2D0BA 1IKWA 5FDLA 1QSSA 1KCFA 3ASMA 5CYQA 3OYAA 3D0PA 1XC9A 4E0DA 1BL3A 3LZIA 3RTVA 4FZYA 4Z4EA 3C94A 4CFAA 1NJYA 1B9FA 2BDPA 4F3OA 2HHWA 4CGFA 3THVA 4DTPA 5D3GA 1RT5A 4E89A 1XI1A 4KKOA 3TAMA 4M3TA 3DLBA 4EZ9A 4FJNA 3LP2A 1UOCA 3V81A 1N5YA 1BGXT 3DLRA 4ICLA 1BHLA 1WSFA 3K2PA 2P1JA 3ZT1A 3C95A 4CEQA 5KRTA 4CEZA 3LDSA 3V9XA 5FRNA 2X6NA 3L2QA 4LD0A 3OVNA 3TWHA 3SQ1A 1YVUA 3DLHA 4C8MA 3OYCA 1Q9XA 4B8CA 3S3MA 3QINA 2YHAA 1NOZA 3SI6A 5CYMA 3O3GA 4DSLA 5HP1A 4CHZA 3HXMA 4KHQA 4ELUA 4W5QA 3AA5X 3KK1A 3JSMA 4CJKA 4K8ZA 4M42A 3NF8A 3LAMA 4HUEA 5J2PA 3NCIA 2YNFA 3QEWA 4BDPA 4ZTJA 1SKRA 1RBVA 1LWFA 1VSJA 1TAQA 3ISNC 5KGWA 1JLFA 4Z4CA 4E7IA 1DTTA 2HB5A 3O3FA 3OYMA 3OJSA 4B8AB 3L2RA 1I3AA 3NGIA 3VQ5A 3VQCA 3NH1A 3EYZA 4DSIA 4J2AA 4N5SA 4E7HA 4KTWA 5J2QA 1NJZA 1I39A 1TGOA 3KLGA 3TAPA 2PZSA 2O4GA 3LWMA 3OYIA 4OVLA 3VQEA 3RR8A 2HHTA 2JGUA 3NF9A 4CEEA 2BGGA 1Q8IA 5K14A 4DLEA 4NYFA 3VQDA 1TKXA 2B4JA 2F8SA 4M3YA 3IG1A 1WSJA 1EKEA 3K5MA 5DK5A 1SUQA 2FBXA 1J54A 4KFBA 3RRGA 2FBYA 1LAWA 1W9HA 3KIOA 1S1TA 3HVRA 4CHQA 5FRMA 3P5JA 3KKRA 3TAFA 3D45A 4OGCA 1KFDA 1NJXA 4R5PA 4FW1A 3WNEA 1GOAA 2XY7A 4J2EA 4NCAA 2IDOA 1FKOA 1VRUA 3VA3A 5J2MA 1VSHA 3KLHA 4HCCA 1J5OA 1A5WA 1RTHA 1C1BA 3JYTA 4DQIA 4OKJA 4EZ6A 3V1QA 3ZT3A 2PYLA 1S1UA 1VSFA 2B6AA 3ZCMA 3CFPA 4CJVA 3DM2A 5DMRA 3KKSA 1WSHA 1SKWA 3RWUA 4OLBA 1YTAA 3AVNA 4E3SA 3PV8A 3VQ8A 4ZTFA 3VQPA 4GVMA 2ETJA 2W42A 4CJEA 1RT6A 3P83D 1L3VA 5CY4A 4RW8A 1XHXA 1T05A 3NF7A 4LY7A 2VG5A 4HUGA 3HYFA 1JKHA 3MEGA 3PUFA 4M3UA 3G10A 4AH9A 5KTQA 4RW6A 1VSLA 3NF6A 4CESA 4OPKA 4FLUA 1NKEA 1EETA 4E7LA 1WSIA 3K59A 3RMDA 2XO7A 5FROA 4Z0UA 4DG1A 3V1RA 3V9WA 4AHTA 4KREA 3ZT2A 1ZBUA 3QEPA 4BWJA 1VSMA 3AVAA 3ZSYA 4CIEA 3CG7A 3M8SA 4C8KA 5SWMA 4O0JA 3PO5A 3OYDA 2IC3A 3LP1A 4I9LA 3TANA 4DQQA 1T8EA 1TK8A 3PY8A 2G8FA 1QQCA 1QE1A 1NK4A 5HBMA 5E41A 4B9LA 4F4KA 4Y1CA 4DLGA 2YKMA 2G8WA 1J53A 1RTIA 4YFUA 3KK3A 3VQ6A 2G8HA 3M8QA 1JLGA 4E19A 3KLIA 3SUPA 1SL1A 2ITGA 4CFDA 1RT3A 4E7KA 4M41A 4CJ3A 2VWKA 1CZ9A 2RF2A 4CJQA 3AVHA 3V9SA 1TK5A 4E1MA 3AO5A 3TAQA 1T03A 3E01A 2ATQA 4CGGA 3IS9A 3AA3A 3HT3A 3SV4A 4M3ZA 4PWDA 2HHUA 1DLOA 2F96A 4YNQA 4DTOA 1JL2A 3AA2A 3NFAA 1IKXA 3DOKA 4CIFA 4IG3A 3TR8A 4DSEA 1REVA 3PX0A 3F73A 4B9UA 4ELTA 4Z4GA 2RKIA 1QTMA 4XIUA 3MAQA 1NKCA 1TKDA 2F8TA 2HVIA 1JLCA 3CFRA 1HPZA 2HNDA 3HPGA 2HMIA 4HHTA 1U04A 4DTNA 3O4QA 1NK9A 2XY8A 2OA8A 1D9FA 3U3YA 4FJMA 1ASUA 1C1AA 1XWLA 3AVJA 3HP9A 2HW3A 2KQ2A 1TKTA 4LSNA 5CZ2A 1K6YA 3LWLA 4FJIA 2PY5A 4FK2A 4DTJA 4CFCA 1NKBA 5J2NA 2O4IA 1KVBA 3SV3A 3IAYA 4KB0A 1VRTA 3TI0A 4CEFA 1L3SA 5KI6A 3B6PA 4DF4A 4FK4A 4C8OA 2A1SA 3ZSWA 5SZTA 3I0RA 4FZXC 3PX6A 3HPHA 1IO2A 2P5GA 3CQ8A 2P51A 1X1PA 3VQ4A 4MQ3A 3NBPA 4CJUA 4DWIA 4KTQA 1HRHA 3L8BA 1HNIA 4HCBA 2PYJA 3ZT0A 3NE6A 1LWCA 4FJKA 1HQEA 1VSKA 1NK5A 1EX4A 4FJ5A 3KD1E 4B9SA 4BE1A 1RDDA 3L3UA 1S1XA 1WSGA 4CECA 4Z4FA 2GV9A 3TARA 4NCBA 1ITGA 3CM6A 4N56A 1U49A 4DQSA 2YV0X 4NCGA 1UAXA 3LZJA 2KTQA 3O4NA 1ZBIA 2KFNA 3NGYA 1S9EA 4I7FA 4O4GA 3MXJA 1HQUA 4ID5A 4FLZA 5HLFA 4KAZA 2KZZA 1ZBHA 1BI4A 4JRPA 1FK9A 2Z1HA 4BE0A 5I3UA 4W5NA 1CXQA 1HYVA 4Y1DA 4E7JA 1A5VA 4CIGA 4CJTA 4AHSA 4JS4A 4O55A 3H08A 2FC0A 3QIOA 2FBTA 2QK9A 2QXFA 1KVAA 4RG8A 5KRSA 4OLAA 3DMJA 4GMJB 2X6SA 2KZMA 4CFBA 2DY4A 4FJ8A 3MXMA 1G15A 3EZ5A 4BDYA 4FK0A 2OPPA 3OYHA 4PUOA 1TVRA 3KK2A 3U3GA 3OJUA 1B9DA 1UWBA 3DRPA 4O0IA 4JS5A 2Z1IA 2RPIA 3K58A 4BWMA 1WSEA 4CERA 4F3TA 1JLEA 3K5NA 1BCOA 3ZSQA 4M45A 4KO0A 1JXBA 2IOCA 3AVLA 4CF9A 3SQ2A 2D0AA 1BIZA 2DFHA 3QNOA 1SV5A 4CHNA 3C6UA 4FYDA 4CK1A 3K5LA 1D9DA 2RN2A 3OYJA 3PX4A 2LSNA 4BACA 4DU3A 3NH2A 3OYKA 3K57A 4CJPA 4B9TA 1VSDA 3T3FA 3OYLA 1BIUA 2Y1IA 3AVIA 1KVCA 3HVTA 1IKYA 1UA0A 3AO2A 4KI4A 1S1VA 3ZSZA 1RT4A 4E1NA 4DFKA 2IS3A 3DLGA 3ALYA 4IBNA 4DF8A 3EY1A 1IG9A 1FKPA 3L2UA 4RW4A 3I0SA 4FJXA 1TK0A 1RT7A 3CFOA 2QKBA 4BE2A 2AJQA 4DTRA 4HVJA 1Z26A 3V9UA 4DTSA 3QLHA 3MXIA 4W5TA 4FJHA 1IH7A 4IKFA 4PA1A 1BI4B 3F9KA 1RILA 4RW7A 3MEDA 3ZSRA 2Q3SA 4FJJA 4CJ5A 4FLYA 1VK0A 3WNHA 4UQGA 3SNNA 4F2RA 1B92A 4CEAA 1JLQA 4QCLA 1Z25A 5C42A 5T7BA 3HJFA 1WN7A 4FJLA 3QO9A 2HHVA 1RDBA 1BISA 4DFMA 2QKKA 2XHBA 2X78A 3HPOA 4DTMA 4OPJA 3LP0A 4CK2A 3V6DA 3VQ7A 4MFBA 4DFPA 1RDAA 4FM1A 1YTUA 2OPQA 1SKSA 1QSYA 1WNSA 4CJFA 4CK3A 3V1OA 2JLEA 3OS0A 3WNFA 1TAUA 3V4IA 4O44A 3VN5A 1NOYA 3MECA 4LH5A 3NAEA 2YHBA 4G1QA 3WNGA 3SUNA 2BANA 2YNIA 2Z1GA 3BGRA 4LSLA 4B08A 1QS4A 3HM9A 1C6VA 3NDKA 3SUQA 3ITHA 3SPZA 2G8VA 4I9QA 3OS1A 3QIPA 3S3NA 4DMNA 3OYNA 1U48A 4AHUA 3T1AA 3ZSOA 3A2FA 3C6TA 3OYFA 1SL2A 1KRPA 4OKEA 4J2BA 4H4MA 4PQUA 1RBUA 3DRRA 4KRFA 3DRSA 5HROA 1ZYQA 3SCXA 4FJGA 3IRXA 1TL3A 4I2QA 4RW9A 5EU7A 3HL8A 3VQAA 1YT3A 1RNHA 4DS5A 4FZZA 4W5RA 5CZ1A 4QOZB 1W0HA 4CE9A 1QSLA 4M3XA 1BQNA 1SL0A 4L8RB 1RTDA 3L2VA 3VQBA 4N47A 1NK6A 4DU4A 3L3VA 4CHPA 1S5JA 3QNNA 5JS2A 4JLHA 3SQ4A 4BDZA 3QEVA 2YNGA 4OGEA 1CLQA 4EP5A 1RT2A 3OS2A 4Q0BA 3QETA 2DTUA 4CGJA 3SPYA 1RBRA 1HJRA 3B6OA 4HUFA 1RDCA 4M3RA 4CHYA 2FBVA 4AHCA 2XY6A 1NK0A 3CYMA 2DFFA 3QEXA 3AVGA 1QHTA 3SQ0A 1X9SA 1GOBA 4K8XA 3OY9A 1RT1A 1S6QA 4CJLA 4CGHA 2HNZA 4DS4A 3TAGA 1U4BA 3HO1A 3FFIA 3VQ9A 4AHRA 4FCYA 1S9GA 3KJVA 3LPTA 5JS1A 4C8NA 3M8RA 3RR7A 1TL1A 2X74A 4B9VA 3SUOA 2P5OA 1J9AA 1JXEA 1WAJA 3HP6A 4CJSA 4ID1A 4DSJA 2VG6A 1DTQA 2XY5A 1C0UA 1XHZA 1VSIA 3ULDA 3DLEA 2OYQA 2HHQA 1U47A 2Z1JA 3TAEA 1O1WA 1ZBLA 4B9MA 1JLAA 3AVKA 3VQQA 3KTQA 3K5OA 4CJRA 1CZBA 2YNHA 3AVBA 3DLKA 3LANA 4CGIA 5J1EA 4FLWA 1RCHA 4CEBA 1TV6A 4KHUA 2KFZA 4KV8A 3QEIA 1JLBA 2EHGA 4QAGA 4DTXA 1KLNA 1F21A 3HK2A 1KSPA 3L2WA 3SZ2A 4CGDA 4CF2A 4B9NA 2G8IA 5KGXA 1KTQA 1BQMA 4B3OA 4JRQA 4F2SA 2D0CA 3OYBA 1LAVA 3TABA 1N6QA 1NK7A 2GBZA 4H8KA 1RBSA 1HNVA 1U45A 4KB1A 4KI6A 4CF8A 2WONA 3AO1A 2OPRA 3LP3A 4CF1A 4IFVA 3ZSXA 3AVFA 4DSKA 2D5RA 4IDKA 3NHGA 4ZHRA 1S1WA 1X9WA 1RTJA 2ZQBA 2VG7A 4KHNA 3LPUA 4DU1A 3AV9A 1UA1A 3G0ZA 4J2DA 3I8DA 3RRHA 1TKZA 2YKNA 3OYEA 1X9MA 3KD5E 4N41A 2G8UA 3U6FA 3RMCA 3O3HA 3DI6A 4KHSA 4HTUA 3DOLA 1IKVA 3CM5A 2B5JA 3AO4A 5C24A 1LV5A 1NJWA 1C0MA 1FXXA 4M3WA 1JL1A 4FVMA 4H4OA 3QERA 4FLVA 4DQPA 4KHYA 2GUIA 3S3OA 4Z4HA 3RMAA 3NH0A 1L3UA 2DFEA 4I2PA 3AVCA 3HSTB 4NYNA 3ZSVA 4CHOA 2ZD1A 2OZMA 4FM2A 4EP4A 1GOCA 4FM0A 4CJWA 2HVHA 4DSFA 4CCHA 4CF0A 3NGZA 1Y97A 2NUBA 5HRRA 3KLEA 2XRIA 1D5AA 1WLJA 3MEEA 4AHVA 4O5BA 1MU2A 5HRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTZ A;  1RBT A;  2E6M A;  3T19 A;  4KHW A;  2ZE2 A;  2IAJ A;  4DTU A;  1HMV A;  1HYZ A;  4FW2 A;  4Q5V A;  2IGI A;  2R7Y A;  2I5J A;  1ASW A;  3AVM A;  4IFY A;  3S9H A;  1VSE A;  2WOM A;  1R0A A;  3UIQ A;  1ASV A;  2G8K A;  3VA0 A;  1EP4 A;  1S6P A;  2A1R A;  4C8L A;  5C25 A;  3LAL A;  4LH4 A;  4FXD A;  4AIL C;  1NK8 A;  1L5U A;  2OZS A;  3ZT4 A;  3BDP A;  4DFJ A;  2OPS A;  5HRN A;  4IG0 A;  1CXU A;  3AA4 A;  1A5X A;  1LW2 A;  2BE2 A;  1EXQ A;  1L3T A;  3P1G A;  5HRS A;  4DQR A;  4F8R A;  4FJ9 A;  1C1C A;  4OJR A;  1T7P A;  2E6L A;  3DYA A;  2KW4 A;  2Y1J A;  4CJ4 A;  1BCM A;  1ZBF A;  4KPY A;  4ELV A;  4PY5 A;  2HNY A;  3PO4 A;  4FLT A;  1Q9Y A;  1KFS A;  4Z4I A;  2HHS A;  3RMB A;  1HYS A;  1LWE A;  2E4L A;  3V9Z A;  3SJJ A;  4FJ7 A;  3OYG A;  3SYZ A;  3LAK A;  3M8P A;  5I42 A;  4GW6 A;  4TSX A;  2HHX A;  3QES A;  1WAF A;  1KLM A;  1D8Y A;  4CED A;  1C0T A;  4WE1 A;  4N76 A;  4OKK A;  2VWJ A;  1LW0 A;  3AO3 A;  4W5O A;  4FLX A;  4CEO A;  3KLF A;  2EX3 A;  2D0B A;  1IKW A;  5FDL A;  1QSS A;  1KCF A;  3ASM A;  5CYQ A;  3OYA A;  3D0P A;  1XC9 A;  4E0D A;  1BL3 A;  3LZI A;  3RTV A;  4FZY A;  4Z4E A;  3C94 A;  4CFA A;  1NJY A;  1B9F A;  2BDP A;  4F3O A;  2HHW A;  4CGF A;  3THV A;  4DTP A;  5D3G A;  1RT5 A;  4E89 A;  1XI1 A;  4KKO A;  3TAM A;  4M3T A;  3DLB A;  4EZ9 A;  4FJN A;  3LP2 A;  1UOC A;  3V81 A;  1N5Y A;  1BGX T;  3DLR A;  4ICL A;  1BHL A;  1WSF A;  3K2P A;  2P1J A;  3ZT1 A;  3C95 A;  4CEQ A;  5KRT A;  4CEZ A;  3LDS A;  3V9X A;  5FRN A;  2X6N A;  3L2Q A;  4LD0 A;  3OVN A;  3TWH A;  3SQ1 A;  1YVU A;  3DLH A;  4C8M A;  3OYC A;  1Q9X A;  4B8C A;  3S3M A;  3QIN A;  2YHA A;  1NOZ A;  3SI6 A;  5CYM A;  3O3G A;  4DSL A;  5HP1 A;  4CHZ A;  3HXM A;  4KHQ A;  4ELU A;  4W5Q A;  3AA5 X;  3KK1 A;  3JSM A;  4CJK A;  4K8Z A;  4M42 A;  3NF8 A;  3LAM A;  4HUE A;  5J2P A;  3NCI A;  2YNF A;  3QEW A;  4BDP A;  4ZTJ A;  1SKR A;  1RBV A;  1LWF A;  1VSJ A;  1TAQ A;  3ISN C;  5KGW A;  1JLF A;  4Z4C A;  4E7I A;  1DTT A;  2HB5 A;  3O3F A;  3OYM A;  3OJS A;  4B8A B;  3L2R A;  1I3A A;  3NGI A;  3VQ5 A;  3VQC A;  3NH1 A;  3EYZ A;  4DSI A;  4J2A A;  4N5S A;  4E7H A;  4KTW A;  5J2Q A;  1NJZ A;  1I39 A;  1TGO A;  3KLG A;  3TAP A;  2PZS A;  2O4G A;  3LWM A;  3OYI A;  4OVL A;  3VQE A;  3RR8 A;  2HHT A;  2JGU A;  3NF9 A;  4CEE A;  2BGG A;  1Q8I A;  5K14 A;  4DLE A;  4NYF A;  3VQD A;  1TKX A;  2B4J A;  2F8S A;  4M3Y A;  3IG1 A;  1WSJ A;  1EKE A;  3K5M A;  5DK5 A;  1SUQ A;  2FBX A;  1J54 A;  4KFB A;  3RRG A;  2FBY A;  1LAW A;  1W9H A;  3KIO A;  1S1T A;  3HVR A;  4CHQ A;  5FRM A;  3P5J A;  3KKR A;  3TAF A;  3D45 A;  4OGC A;  1KFD A;  1NJX A;  4R5P A;  4FW1 A;  3WNE A;  1GOA A;  2XY7 A;  4J2E A;  4NCA A;  2IDO A;  1FKO A;  1VRU A;  3VA3 A;  5J2M A;  1VSH A;  3KLH A;  4HCC A;  1J5O A;  1A5W A;  1RTH A;  1C1B A;  3JYT A;  4DQI A;  4OKJ A;  4EZ6 A;  3V1Q A;  3ZT3 A;  2PYL A;  1S1U A;  1VSF A;  2B6A A;  3ZCM A;  3CFP A;  4CJV A;  3DM2 A;  5DMR A;  3KKS A;  1WSH A;  1SKW A;  3RWU A;  4OLB A;  1YTA A;  3AVN A;  4E3S A;  3PV8 A;  3VQ8 A;  4ZTF A;  3VQP A;  4GVM A;  2ETJ A;  2W42 A;  4CJE A;  1RT6 A;  3P83 D;  1L3V A;  5CY4 A;  4RW8 A;  1XHX A;  1T05 A;  3NF7 A;  4LY7 A;  2VG5 A;  4HUG A;  3HYF A;  1JKH A;  3MEG A;  3PUF A;  4M3U A;  3G10 A;  4AH9 A;  5KTQ A;  4RW6 A;  1VSL A;  3NF6 A;  4CES A;  4OPK A;  4FLU A;  1NKE A;  1EET A;  4E7L A;  1WSI A;  3K59 A;  3RMD A;  2XO7 A;  5FRO A;  4Z0U A;  4DG1 A;  3V1R A;  3V9W A;  4AHT A;  4KRE A;  3ZT2 A;  1ZBU A;  3QEP A;  4BWJ A;  1VSM A;  3AVA A;  3ZSY A;  4CIE A;  3CG7 A;  3M8S A;  4C8K A;  5SWM A;  4O0J A;  3PO5 A;  3OYD A;  2IC3 A;  3LP1 A;  4I9L A;  3TAN A;  4DQQ A;  1T8E A;  1TK8 A;  3PY8 A;  2G8F A;  1QQC A;  1QE1 A;  1NK4 A;  5HBM A;  5E41 A;  4B9L A;  4F4K A;  4Y1C A;  4DLG A;  2YKM A;  2G8W A;  1J53 A;  1RTI A;  4YFU A;  3KK3 A;  3VQ6 A;  2G8H A;  3M8Q A;  1JLG A;  4E19 A;  3KLI A;  3SUP A;  1SL1 A;  2ITG A;  4CFD A;  1RT3 A;  4E7K A;  4M41 A;  4CJ3 A;  2VWK A;  1CZ9 A;  2RF2 A;  4CJQ A;  3AVH A;  3V9S A;  1TK5 A;  4E1M A;  3AO5 A;  3TAQ A;  1T03 A;  3E01 A;  2ATQ A;  4CGG A;  3IS9 A;  3AA3 A;  3HT3 A;  3SV4 A;  4M3Z A;  4PWD A;  2HHU A;  1DLO A;  2F96 A;  4YNQ A;  4DTO A;  1JL2 A;  3AA2 A;  3NFA A;  1IKX A;  3DOK A;  4CIF A;  4IG3 A;  3TR8 A;  4DSE A;  1REV A;  3PX0 A;  3F73 A;  4B9U A;  4ELT A;  4Z4G A;  2RKI A;  1QTM A;  4XIU A;  3MAQ A;  1NKC A;  1TKD A;  2F8T A;  2HVI A;  1JLC A;  3CFR A;  1HPZ A;  2HND A;  3HPG A;  2HMI A;  4HHT A;  1U04 A;  4DTN A;  3O4Q A;  1NK9 A;  2XY8 A;  2OA8 A;  1D9F A;  3U3Y A;  4FJM A;  1ASU A;  1C1A A;  1XWL A;  3AVJ A;  3HP9 A;  2HW3 A;  2KQ2 A;  1TKT A;  4LSN A;  5CZ2 A;  1K6Y A;  3LWL A;  4FJI A;  2PY5 A;  4FK2 A;  4DTJ A;  4CFC A;  1NKB A;  5J2N A;  2O4I A;  1KVB A;  3SV3 A;  3IAY A;  4KB0 A;  1VRT A;  3TI0 A;  4CEF A;  1L3S A;  5KI6 A;  3B6P A;  4DF4 A;  4FK4 A;  4C8O A;  2A1S A;  3ZSW A;  5SZT A;  3I0R A;  4FZX C;  3PX6 A;  3HPH A;  1IO2 A;  2P5G A;  3CQ8 A;  2P51 A;  1X1P A;  3VQ4 A;  4MQ3 A;  3NBP A;  4CJU A;  4DWI A;  4KTQ A;  1HRH A;  3L8B A;  1HNI A;  4HCB A;  2PYJ A;  3ZT0 A;  3NE6 A;  1LWC A;  4FJK A;  1HQE A;  1VSK A;  1NK5 A;  1EX4 A;  4FJ5 A;  3KD1 E;  4B9S A;  4BE1 A;  1RDD A;  3L3U A;  1S1X A;  1WSG A;  4CEC A;  4Z4F A;  2GV9 A;  3TAR A;  4NCB A;  1ITG A;  3CM6 A;  4N56 A;  1U49 A;  4DQS A;  2YV0 X;  4NCG A;  1UAX A;  3LZJ A;  2KTQ A;  3O4N A;  1ZBI A;  2KFN A;  3NGY A;  1S9E A;  4I7F A;  4O4G A;  3MXJ A;  1HQU A;  4ID5 A;  4FLZ A;  5HLF A;  4KAZ A;  2KZZ A;  1ZBH A;  1BI4 A;  4JRP A;  1FK9 A;  2Z1H A;  4BE0 A;  5I3U A;  4W5N A;  1CXQ A;  1HYV A;  4Y1D A;  4E7J A;  1A5V A;  4CIG A;  4CJT A;  4AHS A;  4JS4 A;  4O55 A;  3H08 A;  2FC0 A;  3QIO A;  2FBT A;  2QK9 A;  2QXF A;  1KVA A;  4RG8 A;  5KRS A;  4OLA A;  3DMJ A;  4GMJ B;  2X6S A;  2KZM A;  4CFB A;  2DY4 A;  4FJ8 A;  3MXM A;  1G15 A;  3EZ5 A;  4BDY A;  4FK0 A;  2OPP A;  3OYH A;  4PUO A;  1TVR A;  3KK2 A;  3U3G A;  3OJU A;  1B9D A;  1UWB A;  3DRP A;  4O0I A;  4JS5 A;  2Z1I A;  2RPI A;  3K58 A;  4BWM A;  1WSE A;  4CER A;  4F3T A;  1JLE A;  3K5N A;  1BCO A;  3ZSQ A;  4M45 A;  4KO0 A;  1JXB A;  2IOC A;  3AVL A;  4CF9 A;  3SQ2 A;  2D0A A;  1BIZ A;  2DFH A;  3QNO A;  1SV5 A;  4CHN A;  3C6U A;  4FYD A;  4CK1 A;  3K5L A;  1D9D A;  2RN2 A;  3OYJ A;  3PX4 A;  2LSN A;  4BAC A;  4DU3 A;  3NH2 A;  3OYK A;  3K57 A;  4CJP A;  4B9T A;  1VSD A;  3T3F A;  3OYL A;  1BIU A;  2Y1I A;  3AVI A;  1KVC A;  3HVT A;  1IKY A;  1UA0 A;  3AO2 A;  4KI4 A;  1S1V A;  3ZSZ A;  1RT4 A;  4E1N A;  4DFK A;  2IS3 A;  3DLG A;  3ALY A;  4IBN A;  4DF8 A;  3EY1 A;  1IG9 A;  1FKP A;  3L2U A;  4RW4 A;  3I0S A;  4FJX A;  1TK0 A;  1RT7 A;  3CFO A;  2QKB A;  4BE2 A;  2AJQ A;  4DTR A;  4HVJ A;  1Z26 A;  3V9U A;  4DTS A;  3QLH A;  3MXI A;  4W5T A;  4FJH A;  1IH7 A;  4IKF A;  4PA1 A;  1BI4 B;  3F9K A;  1RIL A;  4RW7 A;  3MED A;  3ZSR A;  2Q3S A;  4FJJ A;  4CJ5 A;  4FLY A;  1VK0 A;  3WNH A;  4UQG A;  3SNN A;  4F2R A;  1B92 A;  4CEA A;  1JLQ A;  4QCL A;  1Z25 A;  5C42 A;  5T7B A;  3HJF A;  1WN7 A;  4FJL A;  3QO9 A;  2HHV A;  1RDB A;  1BIS A;  4DFM A;  2QKK A;  2XHB A;  2X78 A;  3HPO A;  4DTM A;  4OPJ A;  3LP0 A;  4CK2 A;  3V6D A;  3VQ7 A;  4MFB A;  4DFP A;  1RDA A;  4FM1 A;  1YTU A;  2OPQ A;  1SKS A;  1QSY A;  1WNS A;  4CJF A;  4CK3 A;  3V1O A;  2JLE A;  3OS0 A;  3WNF A;  1TAU A;  3V4I A;  4O44 A;  3VN5 A;  1NOY A;  3MEC A;  4LH5 A;  3NAE A;  2YHB A;  4G1Q A;  3WNG A;  3SUN A;  2BAN A;  2YNI A;  2Z1G A;  3BGR A;  4LSL A;  4B08 A;  1QS4 A;  3HM9 A;  1C6V A;  3NDK A;  3SUQ A;  3ITH A;  3SPZ A;  2G8V A;  4I9Q A;  3OS1 A;  3QIP A;  3S3N A;  4DMN A;  3OYN A;  1U48 A;  4AHU A;  3T1A A;  3ZSO A;  3A2F A;  3C6T A;  3OYF A;  1SL2 A;  1KRP A;  4OKE A;  4J2B A;  4H4M A;  4PQU A;  1RBU A;  3DRR A;  4KRF A;  3DRS A;  5HRO A;  1ZYQ A;  3SCX A;  4FJG A;  3IRX A;  1TL3 A;  4I2Q A;  4RW9 A;  5EU7 A;  3HL8 A;  3VQA A;  1YT3 A;  1RNH A;  4DS5 A;  4FZZ A;  4W5R A;  5CZ1 A;  4QOZ B;  1W0H A;  4CE9 A;  1QSL A;  4M3X A;  1BQN A;  1SL0 A;  4L8R B;  1RTD A;  3L2V A;  3VQB A;  4N47 A;  1NK6 A;  4DU4 A;  3L3V A;  4CHP A;  1S5J A;  3QNN A;  5JS2 A;  4JLH A;  3SQ4 A;  4BDZ A;  3QEV A;  2YNG A;  4OGE A;  1CLQ A;  4EP5 A;  1RT2 A;  3OS2 A;  4Q0B A;  3QET A;  2DTU A;  4CGJ A;  3SPY A;  1RBR A;  1HJR A;  3B6O A;  4HUF A;  1RDC A;  4M3R A;  4CHY A;  2FBV A;  4AHC A;  2XY6 A;  1NK0 A;  3CYM A;  2DFF A;  3QEX A;  3AVG A;  1QHT A;  3SQ0 A;  1X9S A;  1GOB A;  4K8X A;  3OY9 A;  1RT1 A;  1S6Q A;  4CJL A;  4CGH A;  2HNZ A;  4DS4 A;  3TAG A;  1U4B A;  3HO1 A;  3FFI A;  3VQ9 A;  4AHR A;  4FCY A;  1S9G A;  3KJV A;  3LPT A;  5JS1 A;  4C8N A;  3M8R A;  3RR7 A;  1TL1 A;  2X74 A;  4B9V A;  3SUO A;  2P5O A;  1J9A A;  1JXE A;  1WAJ A;  3HP6 A;  4CJS A;  4ID1 A;  4DSJ A;  2VG6 A;  1DTQ A;  2XY5 A;  1C0U A;  1XHZ A;  1VSI A;  3ULD A;  3DLE A;  2OYQ A;  2HHQ A;  1U47 A;  2Z1J A;  3TAE A;  1O1W A;  1ZBL A;  4B9M A;  1JLA A;  3AVK A;  3VQQ A;  3KTQ A;  3K5O A;  4CJR A;  1CZB A;  2YNH A;  3AVB A;  3DLK A;  3LAN A;  4CGI A;  5J1E A;  4FLW A;  1RCH A;  4CEB A;  1TV6 A;  4KHU A;  2KFZ A;  4KV8 A;  3QEI A;  1JLB A;  2EHG A;  4QAG A;  4DTX A;  1KLN A;  1F21 A;  3HK2 A;  1KSP A;  3L2W A;  3SZ2 A;  4CGD A;  4CF2 A;  4B9N A;  2G8I A;  5KGX A;  1KTQ A;  1BQM A;  4B3O A;  4JRQ A;  4F2S A;  2D0C A;  3OYB A;  1LAV A;  3TAB A;  1N6Q A;  1NK7 A;  2GBZ A;  4H8K A;  1RBS A;  1HNV A;  1U45 A;  4KB1 A;  4KI6 A;  4CF8 A;  2WON A;  3AO1 A;  2OPR A;  3LP3 A;  4CF1 A;  4IFV A;  3ZSX A;  3AVF A;  4DSK A;  2D5R A;  4IDK A;  3NHG A;  4ZHR A;  1S1W A;  1X9W A;  1RTJ A;  2ZQB A;  2VG7 A;  4KHN A;  3LPU A;  4DU1 A;  3AV9 A;  1UA1 A;  3G0Z A;  4J2D A;  3I8D A;  3RRH A;  1TKZ A;  2YKN A;  3OYE A;  1X9M A;  3KD5 E;  4N41 A;  2G8U A;  3U6F A;  3RMC A;  3O3H A;  3DI6 A;  4KHS A;  4HTU A;  3DOL A;  1IKV A;  3CM5 A;  2B5J A;  3AO4 A;  5C24 A;  1LV5 A;  1NJW A;  1C0M A;  1FXX A;  4M3W A;  1JL1 A;  4FVM A;  4H4O A;  3QER A;  4FLV A;  4DQP A;  4KHY A;  2GUI A;  3S3O A;  4Z4H A;  3RMA A;  3NH0 A;  1L3U A;  2DFE A;  4I2P A;  3AVC A;  3HST B;  4NYN A;  3ZSV A;  4CHO A;  2ZD1 A;  2OZM A;  4FM2 A;  4EP4 A;  1GOC A;  4FM0 A;  4CJW A;  2HVH A;  4DSF A;  4CCH A;  4CF0 A;  3NGZ A;  1Y97 A;  2NUB A;  5HRR A;  3KLE A;  2XRI A;  1D5A A;  1WLJ A;  3MEE A;  4AHV A;  4O5B A;  1MU2 A;  5HRP A; 
#chains in the Genus database with same CATH topology
 3R9P A;  2E6M A;  1HMV A;  3GE1 A;  3C7N B;  3UIQ A;  1VSE A;  4C8L A;  2NRV A;  3LAL A;  3HOS A;  4LH4 A;  1NMD A;  1NK8 A;  4BRI A;  3AA4 A;  1W2B M;  1LW2 A;  1L3T A;  1S22 A;  3MN5 A;  4DQR A;  4F8R A;  2D0O A;  4GVE A;  4R79 A;  4WFB L;  2Y1J A;  1BCM A;  1ZBF A;  4PY5 A;  4ELV A;  3PO4 A;  2VQE K;  1Q9Y A;  1KD1 O;  1KFS A;  4V19 S;  1E4G T;  1LWE A;  3V9Z A;  3OYG A;  2HBK A;  4TSX A;  4H0Y B;  1SS6 A;  4JI1 K;  1YI2 N;  4CEO A;  5GIP A;  4JD2 A;  5M1F A;  2AA4 A;  2OCE A;  5EXW A;  3OHR A;  5CYQ A;  4JI8 K;  3DXM B;  5C15 A;  3C94 A;  1NJY A;  1B9F A;  4C23 A;  4DTP A;  3LP2 A;  2QW9 A;  3DLR A;  2W6K A;  3JXU A;  3V9X A;  4CEQ A;  4FWQ A;  4IDH A;  1GLD G;  4CEZ A;  3LDS A;  2V7Y A;  3N4P A;  1YVU A;  4C8M A;  1Q9X A;  4B3T K;  3S3M A;  1NGJ A;  2UXD K;  3HXM A;  4ELU A;  1K8K B;  1E4F T;  2H3G X;  4FWM A;  4M42 A;  5FPD A;  3NCI A;  3QEW A;  1RBV A;  1RGI A;  3ULE B;  1DTT A;  2HB5 A;  2Q31 A;  3SBT A;  4YOY A;  3O3F A;  4B8A B;  4YOW A;  2E8A A;  4WYB A;  4DSI A;  4E7H A;  4KTW A;  1YIJ N;  2GEM A;  3OYI A;  1VQ8 N;  5K14 A;  3EE9 A;  4NYF A;  4BG9 A;  5CR4 A;  3K5M A;  3MWT A;  1SUQ A;  2FBY A;  1W9H A;  3C6H A;  3HVR A;  5FRM A;  1NJX A;  4R5P A;  4FW1 A;  3WNE A;  2XY7 A;  4J2E A;  2IVN A;  4BRA A;  1NGB A;  3QDK A;  3VA3 A;  3KLH A;  2O8F A;  3JYT A;  4EZ6 A;  3D7E O;  2PYL A;  3ZCM A;  1RDW X;  4B3R K;  2V7Z A;  4BC2 A;  4CBU A;  1L3V A;  1T05 A;  2VG5 A;  4HUG A;  3HYF A;  1JKH A;  3MEG A;  4A5A A;  2ZF5 O;  3G10 A;  5KTQ A;  1EET A;  1TYQ A;  4PKH A;  3CMA N;  3PIP L;  5FRO A;  4DG1 A;  3V9W A;  3ZSY A;  2HBL A;  3CG7 A;  5SWM A;  1HX1 A;  3PO5 A;  3TAN A;  2G8F A;  1QE1 A;  3FR0 A;  2D0P A;  4B9L A;  4EIA A;  5E41 A;  4Y1C A;  2YKM A;  4YFU A;  4XH5 A;  3TSQ A;  1JLG A;  3KLI A;  3VOV A;  4CFD A;  4M41 A;  1Z05 A;  3FZK A;  4CJ3 A;  4WQ5 A;  4CJQ A;  1CZ9 A;  4EFH A;  3MX2 A;  3TAQ A;  1T03 A;  3E01 A;  3P31 A;  3IS9 A;  3SV4 A;  2KHO A;  3AA2 A;  4M7Y A;  3R1X A;  3PX0 A;  2GWJ A;  4FWN A;  2A40 A;  4FWK A;  1NKC A;  2E2Q A;  3HPG A;  4F9O A;  4B1W B;  1VQ9 N;  1K73 O;  2HMI A;  4DTN A;  2FLO A;  4BY9 C;  3ID8 A;  3AVJ A;  2UUB K;  4LSN A;  5CZ2 A;  5LMU K;  2PY5 A;  4FK2 A;  4DTJ A;  1NKB A;  3IAY A;  3TI0 A;  4CEF A;  1L3S A;  4DCH A;  3A5M C;  4IFE A;  2A1S A;  3ZSW A;  2P5G A;  4RCH A;  3L4Q A;  3MN6 A;  4IO8 A;  1IG8 A;  4FJK A;  1HQE A;  3KD1 E;  2VWB A;  4LFA K;  4DUZ K;  3AAP A;  2A3Z A;  3L3U A;  1S1X A;  1WSG A;  3O6W A;  1FJG K;  4CEC A;  4Z4F A;  2GV9 A;  4J8F A;  4NCB A;  3CM6 A;  2YV0 X;  4NCG A;  1UAX A;  3LZJ A;  2KFN A;  1ILY A;  4BQZ A;  3UE5 A;  3MXJ A;  5HLF A;  2QXL A;  1ZBH A;  3SAF A;  5CHI A;  3GDQ A;  1ATR A;  3A8Y A;  1FK9 A;  2Z1H A;  4BE0 A;  1CXQ A;  1HYV A;  2P9N B;  4MLH A;  4CZG A;  3H08 A;  3HBT A;  3IUC A;  5M1O A;  2FBT A;  3QIO A;  4B9Q A;  5FLX O;  3BP8 A;  3DMJ A;  4GMJ B;  2X6S A;  4K42 A;  3E9L A;  3EZ5 A;  4OPA A;  2OPP A;  5AQZ A;  1W7A A;  3H46 O;  3OJU A;  1UWB A;  1YJ9 N;  3CC2 N;  2RPI A;  2ZJR L;  4BWM A;  2QWP A;  3U9D A;  3K5N A;  4FPA A;  1M90 O;  2IOC A;  3AVL A;  3KZB A;  2DFH A;  3QNO A;  3CJC A;  3WT0 A;  3OYK A;  2ASO A;  5KPZ A;  3K0S A;  3ZEU A;  3CF5 L;  3CCR N;  2Y1I A;  1IKY A;  4C1N I;  3A5L C;  1R59 O;  2IS3 A;  3DLG A;  4IBN A;  4RW4 A;  3I0S A;  1HNW K;  4DR7 K;  2QKB A;  4MO5 A;  3U9Z A;  1HKB A;  2AJQ A;  4HVJ A;  3CXC M;  3QLH A;  4FJH A;  1U2V B;  3O08 A;  4IKF A;  5BPL A;  1NGF A;  3BZC A;  4IO9 L;  2NRR A;  4BRC A;  4FLY A;  1VK0 A;  1YVN A;  3QO9 A;  2HHV A;  1BIS A;  2P9P A;  2X78 A;  3HPO A;  4ISE A;  3GBT A;  3VQ7 A;  4MFB A;  1RDA A;  4FM1 A;  1DKG D;  1SKS A;  5M1Q A;  2ASP A;  3BY5 A;  4O44 A;  1NOY A;  3O9U A;  3MEC A;  3NAE A;  3SUN A;  1NBW A;  2ITM A;  4LSL A;  2Z1G A;  1QS4 A;  3HM9 A;  1Q81 O;  2VCP A;  2F7T A;  3MCP A;  5AQU A;  4DMN A;  4AHU A;  1SZ2 A;  3ZSO A;  1SL2 A;  2NRZ A;  1QVF M;  4X64 K;  1RBU A;  3DRS A;  3SCX A;  2QI2 A;  1TL3 A;  3HL8 A;  5B8H A;  4DS5 A;  1YT3 A;  1RNH A;  3LM2 A;  4W5R A;  3CI5 A;  1VQ5 N;  4QOZ B;  3TTD A;  4CE9 A;  3Q7C A;  3VQB A;  3UKU A;  1NK6 A;  2UU9 K;  3L3V A;  3VES A;  4JI5 K;  4X65 K;  3ENO A;  4I6M B;  1RT2 A;  3OS2 A;  4WFA L;  4BGA A;  4CGJ A;  3B6O A;  4HUF A;  5M1K A;  1IBK K;  1RDC A;  2FBV A;  1NK0 A;  4YOX A;  4IOC L;  5AQW A;  3JAM O;  1C0G A;  3SQ0 A;  5JIC A;  1S6Q A;  4XH1 A;  4CJL A;  1X9J A;  5LL6 Z;  4DS4 A;  3TAG A;  4AHR A;  4FCY A;  3LPT A;  4B9V A;  3SUO A;  4WQ4 A;  1J9A A;  2O8B B;  4JKB A;  4CJS A;  1BDG A;  5A2Q O;  3CC4 N;  2VG6 A;  2FSN A;  4BVO A;  5GAD P;  1C0U A;  3OTO K;  1VSI A;  3DLE A;  4K43 A;  2GX9 A;  1XNR K;  3AVK A;  2OTL N;  3K5O A;  4CJR A;  1CZB A;  4CGI A;  4FLW A;  2QM1 A;  4CEB A;  1JLB A;  4XH4 A;  4DTX A;  4CBX A;  4CGD A;  5EX5 A;  4A62 A;  5CE3 A;  3OYB A;  4BR9 A;  3TAB A;  1N6Q A;  3K9K A;  2YHX A;  2GBZ A;  4H8K A;  4A2B A;  4RWT A;  2P9L A;  2WON A;  4YY3 K;  4B1Z A;  2D5R A;  4BRN A;  4BRP A;  1RTJ A;  2ZQB A;  4KHN A;  3AV9 A;  5BR8 K;  3G0Z A;  1TKZ A;  3UKR B;  2E1Y A;  4N41 A;  5AQV A;  2YI1 A;  2OAN A;  3O3H A;  4BC4 A;  3RMC A;  3DOL A;  5AFU H;  1GLC G;  2B5J A;  1NJW A;  1V4S A;  3QER A;  4DQP A;  1W97 L;  4K0K K;  4BRM A;  4NYN A;  1GOC A;  4XEI A;  3SMS A;  3NGZ A;  3HZ6 A;  1T44 A;  3P39 A;  1D5A A;  4GY2 B;  2CH6 A;  4JI2 K;  3FLC O;  2IAJ A;  3BUZ B;  3O8M A;  4PL7 A;  2I5J A;  1ASW A;  5EVZ A;  4BR4 A;  4MO4 A;  1KXP A;  3RSE A;  3IDH A;  5AZJ A;  1S6P A;  5C25 A;  2IVP A;  4FXD A;  3SMP A;  4CZH A;  1G99 A;  2OZS A;  3E9O A;  3BDP A;  4IG0 A;  4B1X B;  3F9M A;  3AGR A;  5HRS A;  1C1C A;  1T7P A;  2E6L A;  5KQD A;  3VF6 A;  2HNY A;  4FLT A;  1HYS A;  2E4L A;  4FJ7 A;  3SAH A;  3SYZ A;  5I42 A;  1KLM A;  1S3X A;  1YXQ A;  4WE1 A;  4N76 A;  4W5O A;  1OVQ A;  1N33 K;  5LY3 A;  1U6Z A;  1WOQ A;  5IWA K;  3O1B A;  4MLE A;  5FDL A;  5AQF A;  2HBM A;  3M1F A;  4Z4E A;  4DV3 K;  2BDP A;  3THV A;  5D3G A;  1VQN N;  4KKO A;  4H5R A;  3TAM A;  4M3T A;  4EZ9 A;  1EQY A;  3P4I A;  4FWO A;  5BPM A;  1WSF A;  2P1J A;  5KRT A;  4DV6 K;  4IEE A;  4JHD B;  3OVN A;  3O9S A;  4NXM K;  3DLH A;  2UXB K;  3QIN A;  1NOZ A;  5CYM A;  4DSL A;  3AA5 X;  3JSM A;  2Q0R A;  2Q97 A;  3KK7 A;  4JEP A;  2O8E B;  4DV5 K;  2GUP A;  4BDP A;  4ZTJ A;  1WUA A;  3VET A;  1VSJ A;  1TAQ A;  5KGW A;  4BRD A;  4Z4C A;  1Q82 O;  3L4I A;  2JWL A;  3HOT A;  3OJS A;  3EYZ A;  3FE1 A;  3CCM N;  5GAE P;  5J2Q A;  1NJZ A;  1TGO A;  4CZJ A;  4OVL A;  3RR8 A;  1Q8I A;  4DLE A;  3VQD A;  2B4J A;  2HOE A;  4OX9 K;  3IG1 A;  4M3Y A;  5AQR A;  1WSJ A;  1EKE A;  4KFB A;  1J54 A;  5F1X A;  3RRG A;  4BRG A;  1GLL O;  2O8C A;  1S1T A;  4M63 C;  4CHQ A;  3THW B;  4WF9 L;  4OGC A;  4NCA A;  5JVG L;  2IDO A;  1GLE G;  1FKO A;  5F2R A;  5J2M A;  1VSH A;  5TKY A;  1C1B A;  1ESV A;  4BRF A;  3V1Q A;  3ZT3 A;  4BR5 A;  2WTU A;  1S1U A;  3CFP A;  3KKS A;  1WSH A;  1YTA A;  3AVN A;  3PV8 A;  1XUP O;  4JKG A;  4B1Y B;  5H1S Q;  3VQP A;  4GVM A;  2W42 A;  2O8D B;  2V51 B;  5TKW A;  5AJ3 K;  4JKC A;  3TSU A;  4LY7 A;  3PUF A;  5AQH A;  4FPB A;  4WQ4 C;  3CJB A;  4CES A;  4OPK A;  4FLU A;  1WSI A;  3KHY A;  3RMD A;  2A5X A;  3V1R A;  4AHT A;  4KRE A;  5BN9 A;  2UYT A;  1ZBU A;  3AVA A;  3H45 C;  1T8E A;  2IC3 A;  4I9L A;  3PY8 A;  5E26 A;  1NK4 A;  4NLB A;  4F4K A;  2WC9 A;  4H5T A;  3A5N C;  1RTI A;  2G8H A;  3VQ6 A;  3VEO A;  3J81 O;  3O9T A;  3THY B;  3I56 N;  2ITG A;  3DXK B;  1RT3 A;  1NU0 A;  2RF2 A;  5M1N A;  4CGG A;  3AA3 A;  4PWD A;  1J6Z A;  1DLO A;  4YNQ A;  3NFA A;  5F0X A;  4O8U A;  3DOK A;  4DSE A;  3TR8 A;  1N8R O;  2BUP A;  4XIU A;  3MAQ A;  3EN9 A;  2HVI A;  3CFR A;  1QZ5 A;  3THX B;  2QWM A;  3H1V X;  4JKD A;  4HHT A;  4H0V B;  1BOT O;  2OA8 A;  1D9F A;  1QQN A;  3W0L A;  3CME N;  4FJM A;  2HW3 A;  3LWL A;  3ZEU B;  2I7N A;  2P9U A;  4GV3 A;  1KVB A;  4KB0 A;  4FL9 A;  1NGH A;  5GAH P;  3ZYY X;  5GAG P;  3WXM B;  4FZX C;  4AM7 A;  1X1P A;  4MQ3 A;  3NBP A;  4CJU A;  4LFB K;  3WXI A;  1QHA A;  1HNI A;  3H3N O;  4LC9 B;  4HCB A;  3L0Q A;  2F9W A;  2E5L K;  3ZT0 A;  3Q7B A;  4DQ8 A;  1EX4 A;  4JAX A;  4FJ5 A;  4B9S A;  1HNX K;  1RDD A;  3CCS N;  2HHH K;  4DR4 K;  1U49 A;  4DQS A;  5AQX A;  2KTQ A;  1S9E A;  5FPM A;  3H1Q A;  3HTV A;  4YOV A;  1QQO A;  3CCJ N;  1HQU A;  4FLZ A;  2KZZ A;  3SJH A;  1NGD A;  5EOY A;  5I3U A;  4Y1D A;  1IV0 A;  4NO7 A;  1A5V A;  1MDU B;  1YJW N;  4AHS A;  1MWK A;  3ZLJ A;  3D2F A;  2QK9 A;  1NM1 A;  3WEE B;  5ADX H;  2DY4 A;  1P8Z A;  4FJ8 A;  3WXL A;  1VQ6 N;  3O9R A;  4FK0 A;  4ILG B;  3OYH A;  1TVR A;  3KK2 A;  1B9D A;  2FF3 B;  3DRP A;  4DR6 K;  1WSE A;  4CER A;  1JLE A;  1Q86 O;  2RHK A;  1JXB A;  4CF9 A;  4LF4 K;  1H1V A;  1BIZ A;  2PBD A;  3TPQ A;  1JJ2 M;  3MWP A;  4G9Z A;  4UY8 O;  5C2F A;  3NH2 A;  2RE2 A;  3WQT A;  3T3F A;  3OYL A;  4CZI A;  1HLU A;  1BIU A;  4NLC A;  3E66 A;  3HVT A;  1NGE A;  1RT4 A;  4E1N A;  3FZH A;  4H0O A;  1IG9 A;  1FKP A;  3L2U A;  4FJX A;  1VQ7 N;  1JCE A;  4DTR A;  3HM8 A;  1Z26 A;  1Z6R A;  2YJE A;  4DTS A;  3FZF A;  4W5T A;  3MXI A;  1IH7 A;  4PA1 A;  1BI4 B;  1RIL A;  2P9S A;  2WBN A;  2QA4 N;  2Q3S A;  5LJV A;  4F2R A;  3AAQ A;  4KH6 A;  3T7Z A;  3HJF A;  2D4W A;  1RDB A;  4DFM A;  3BF3 A;  2QKK A;  1LOT B;  5BRE A;  5C12 A;  3DJC A;  3LP0 A;  3PSF A;  3V6D A;  1WNS A;  4CJF A;  3V1O A;  3T1H K;  3WNF A;  1TAU A;  1NNE A;  4QS7 A;  1IJJ A;  3VN5 A;  3CC7 N;  3AAR A;  2D1K A;  2BAN A;  2YNI A;  4B08 A;  3SUQ A;  1YAG A;  1DGK N;  3ITH A;  3OA9 A;  3F5T A;  1HPM A;  3GG4 A;  4AM6 A;  1HUX A;  3OYN A;  3HSC A;  3JS6 A;  3WXJ A;  3ZET A;  4H0T B;  3C6T A;  3OYF A;  5KQ8 A;  1KRP A;  1GLB G;  4BRE A;  3DRR A;  1QQM A;  2JWK A;  5HRO A;  4I2Q A;  2FSJ A;  3WXK A;  1QSL A;  1SL0 A;  3L2V A;  3D2E B;  4FWS A;  4O5F A;  4Z94 A;  4CHP A;  3QNN A;  4JLH A;  4BDZ A;  3ID6 A;  3QET A;  2E20 A;  1RBR A;  3R8E A;  4IZ9 A;  1HJR A;  4DR5 K;  2Q1N A;  4M3R A;  1TUY A;  1RDU A;  3CYM A;  3QEX A;  1X9S A;  2NLX A;  4CGH A;  3QFP A;  3FFI A;  3ZX0 A;  5EY4 A;  4C8N A;  1TL1 A;  4JI0 K;  4ID1 A;  3VER A;  4B3M K;  1YF5 L;  1KQS M;  3ULD A;  2HHQ A;  1U47 A;  2Z1J A;  3C7N A;  1O1W A;  2Q2R A;  4B9M A;  1JLA A;  3I8B A;  2YNH A;  2YX6 A;  3AVB A;  3DLK A;  1QSS A;  2QEX N;  4KHU A;  5KPR A;  2CGL A;  4QAG A;  2I7P A;  2IVO A;  1KSP A;  3SAG A;  4WCE L;  4B9N A;  5AQN A;  1BQM A;  4B3O A;  1OVY A;  4CD1 A;  3MMV A;  4CD3 A;  1VQM N;  1NG9 A;  4RTF D;  4DSK A;  4KH5 A;  3NHG A;  1BWF O;  1S1W A;  1X9W A;  4DR1 K;  2VG7 A;  5BRH A;  2VGN A;  1UA1 A;  3I8D A;  3RRH A;  2YKN A;  3OYE A;  4KHS A;  1OH7 A;  2QWR A;  3CM5 A;  4JI4 K;  1LV5 A;  4DV1 K;  1FXX A;  4M3W A;  4CZF A;  4LF6 K;  4Z4H A;  1L3U A;  3ZSV A;  2CH5 A;  4CHO A;  4FM2 A;  3DXM A;  4EP4 A;  4DSF A;  4H0X B;  4CF0 A;  5FPE A;  3MEE A;  3H3O B;  1HR0 K;  1VQK N;  5AZI B;  4KTZ A;  4KHW A;  4DTU A;  4FW2 A;  1QVG M;  4Q5V A;  2IGI A;  3AVM A;  4IFY A;  3S9H A;  1R0A A;  4LF9 K;  2E2P A;  3VA0 A;  5GIN A;  4AIL C;  1K8K A;  2OPS A;  5HRN A;  1CXU A;  1JCF A;  5BRD A;  3ULE A;  4FJ9 A;  4YDU A;  1NGG A;  3PIO L;  3DYA A;  1HKC A;  4QS9 A;  4Z4I A;  2HHS A;  3RMB A;  2F4V K;  3SJJ A;  2P9K B;  2HHX A;  3O9Q A;  2WFB A;  1D8Y A;  1C0T A;  2PFU A;  4CZL A;  4FLX A;  1O13 A;  4BQL A;  3KLF A;  2D0B A;  1IKW A;  3WUH A;  3EZW A;  3OYA A;  1MWM A;  1C0F A;  2QTD A;  3RTV A;  1S72 N;  4F3O A;  2HHW A;  4CGF A;  4DKW A;  1RT5 A;  1K8A O;  3DLB A;  3CJ1 A;  1UOC A;  3V81 A;  1N5Y A;  1BGX T;  1RFQ A;  4ICL A;  1BHL A;  3K2P A;  2E1Z A;  3QFU A;  3TWH A;  4EHT A;  3SQ1 A;  3OYC A;  1NGC A;  2NRT A;  3SI6 A;  3O3G A;  4C1N K;  4KHQ A;  4K41 A;  4W5Q A;  3LDP A;  4K8Z A;  3F2K A;  3TU5 A;  4HUE A;  5J2P A;  4JI3 K;  1HJO A;  4CW7 B;  1LWF A;  4IOA L;  2QWQ A;  3EKS A;  4E7I A;  4B1U B;  4AQY K;  3CQX A;  4CZK A;  1I3A A;  4ISG A;  4WFN L;  3VQ5 A;  3VQC A;  3NH1 A;  4J2A A;  4EHU A;  4N5S A;  1I39 A;  3LWM A;  3VQE A;  1NLV A;  2JGU A;  4CEE A;  2F8S A;  3OBW A;  1VQL N;  2NRX A;  3VGM A;  1BO5 O;  5DK5 A;  2FBX A;  2ZJQ L;  4YHH K;  5DM7 L;  3P5J A;  1CZA N;  3J8A A;  4JD2 B;  1KFD A;  5AQS A;  1VRU A;  1D4X A;  3LDN A;  1XQS C;  1J5O A;  1A5W A;  1RTH A;  1KC8 O;  1IBL K;  4DQI A;  4OKJ A;  4BRK A;  2B6A A;  4CJV A;  3RWU A;  5DMR A;  1SKW A;  4E3S A;  4ZTF A;  2ETJ A;  1RT6 A;  1I94 K;  3M3Z A;  3NF7 A;  4M3U A;  4AH9 A;  4RW6 A;  4E0D A;  1NGI A;  3NF6 A;  3NMU A;  1NKE A;  3K59 A;  4CI6 A;  2XO7 A;  4Z0U A;  3ZX3 A;  3R3L A;  5JMV A;  4CIE A;  3M8S A;  4C8K A;  2HST A;  1X3M A;  3HK2 A;  4DQQ A;  2DPN A;  3U4L A;  4H5N A;  5HBM A;  1M1K O;  3CPW M;  4DLG A;  4O8K A;  3M8Q A;  3SUP A;  2V52 B;  2HF4 A;  3AVH A;  5KPT A;  3AO5 A;  4M3Z A;  4E1J A;  3HT3 A;  2P9N A;  3IFR A;  2F96 A;  4DTO A;  3OW2 M;  1IKX A;  4CIF A;  4B9U A;  1REV A;  2RKI A;  1QTM A;  4IWV A;  1TKD A;  2W6L A;  2O8F B;  1HPZ A;  1Q7Y O;  1OH8 A;  1JCG A;  4LF5 K;  2QWL A;  1U04 A;  2ZJP L;  3O4Q A;  4H0P A;  2XY8 A;  1NK9 A;  2A6A A;  1ASU A;  1XWL A;  5AR0 A;  5BRF A;  4OPH A;  5J2N A;  1VRT A;  3O1W A;  3VPZ A;  3B6P A;  4FO0 A;  2F9T A;  2CGJ A;  3I0R A;  4JN4 A;  1TYQ B;  3HPH A;  3PX6 A;  1KAX A;  2P51 A;  3VQ4 A;  4DWI A;  4KTQ A;  3ENB A;  1BA0 A;  2P9I A;  2PYJ A;  5GIO A;  4BE1 A;  3TAR A;  4N56 A;  1N36 K;  3O4N A;  3VEY A;  1WBD A;  3NGY A;  4I7F A;  4O4G A;  1XNQ K;  4ID5 A;  2HBJ A;  1U2V A;  3EL2 A;  1X3N A;  4JRP A;  4YDU C;  3E1Y A;  4CIG A;  4CJT A;  3LDL A;  2FC0 A;  2QXF A;  1KVA A;  2NZT A;  4FSV A;  1DT9 A;  5KRS A;  4OLA A;  5AQK A;  1XMO K;  4CVN E;  3HI0 A;  3WQU A;  3IKM A;  3QIC A;  4JS5 A;  2Z1I A;  3HRG A;  1SAZ A;  1BCO A;  1KAY A;  3ZSQ A;  4M45 A;  3SQ2 A;  2GTD A;  2D0A A;  3QML A;  3C6U A;  5AQI A;  3BEX A;  4CK1 A;  4DR3 K;  3DWL A;  3PX4 A;  1ZXO A;  4KBO A;  2A42 A;  4FOE A;  4BAC A;  3K57 A;  4B9T A;  3AVI A;  1KVC A;  2PAV A;  4GNI A;  4JKE A;  3AO2 A;  3LL3 A;  3ZSZ A;  3CCL N;  3J7Y P;  1Q18 A;  4DF8 A;  1XC3 A;  3EY1 A;  3E9P A;  3J7Z O;  3CFO A;  4BRL A;  4A57 A;  4IOX A;  3V9U A;  3VF2 A;  4I6M A;  4DR2 K;  4RW7 A;  4DV7 K;  4FJJ A;  4CJ5 A;  3SNN A;  1B92 A;  4CEA A;  1JLQ A;  4QCL A;  1Z25 A;  5T7B A;  1WN7 A;  4EAH D;  3MN7 A;  4DUY K;  3FZM A;  4DFP A;  1YTU A;  2OPQ A;  3CIP A;  3OS0 A;  2O8B A;  2FF6 A;  3OBY A;  1P90 A;  4LH5 A;  2YHB A;  4G1Q A;  3WNG A;  3BGR A;  3NDK A;  3SPZ A;  4I9Q A;  3QIP A;  5AQT A;  3G25 A;  4BC5 A;  3EO3 A;  4BRO A;  3A2F A;  4OKE A;  4PQU A;  3G6E N;  1ZYQ A;  3GOI A;  4FJG A;  3T69 A;  2NRW A;  5EU7 A;  3VQA A;  4FZZ A;  5CZ1 A;  4BVP A;  3QBW A;  1RTD A;  1WB9 A;  4DU4 A;  1NWK A;  2W41 A;  4FWL A;  3QEV A;  3MCA B;  2YNG A;  1CLQ A;  2DTU A;  3UKR A;  2YCH A;  4B1V A;  1HNZ K;  1SQK A;  4AHC A;  2XY6 A;  2DFF A;  3W3D A;  4K8X A;  1GOB A;  2IIR A;  1RT1 A;  2P9P B;  2HNZ A;  4U67 L;  1VQO N;  3HO1 A;  1S9G A;  4A2A A;  4KHP K;  5C10 A;  1VAZ A;  2X74 A;  5C2D A;  2P5O A;  3K9J A;  3VF4 A;  1WAJ A;  3HP6 A;  4GKJ K;  4CZM A;  4DSJ A;  4M7X A;  1DTQ A;  3ATV A;  3MN9 A;  2XY5 A;  4JKA A;  1XHZ A;  4H03 B;  1ZBL A;  3KWI A;  3VQQ A;  4NXN K;  3LAN A;  1TV6 A;  1EWQ A;  3RVC A;  4CJ7 A;  3QEI A;  1DEJ A;  1WBB A;  1F21 A;  4A61 A;  3L2W A;  1KTQ A;  4F2S A;  2D0C A;  1LAV A;  3VEZ A;  1NK7 A;  1MA9 B;  1U45 A;  1RBS A;  4L3Q A;  4KB1 A;  4CF8 A;  3AO1 A;  3LP3 A;  2HF3 A;  4IFV A;  3ZSX A;  3AVF A;  3UKU B;  3I55 N;  4IDK A;  2UXC K;  3NVK A;  4FOI A;  3LPU A;  3MDQ A;  3ENH A;  4DU1 A;  5C0Y A;  1TUU A;  4J2D A;  1X9M A;  3TTF A;  2G8U A;  3U6F A;  4NB4 A;  3AO4 A;  5C24 A;  3VEN A;  1C0M A;  1ATN A;  1JL1 A;  2GUI A;  3RMA A;  2DFE A;  4I2P A;  3AVC A;  3HST B;  2ZD1 A;  2OZM A;  4FM0 A;  4CJW A;  2HVH A;  3DAW A;  1Y97 A;  3CCE N;  2KLA A;  1WLJ A;  4AHV A;  1XMQ K;  4O5B A;  1MU2 A;  3T19 A;  1RBT A;  1V4T A;  2ZE2 A;  1HYZ A;  2R7Y A;  1N34 K;  1NMN A;  4JHD A;  5AQJ A;  1BA1 A;  2WOM A;  1ASV A;  2G8K A;  1EP4 A;  2A1R A;  1EO1 A;  1L5U A;  3FZL A;  3ZT4 A;  2O8E A;  5AQY A;  4DFJ A;  1A5X A;  2BE2 A;  1EXQ A;  3P1G A;  3J80 O;  2P9L B;  1BG3 A;  4OJR A;  4GV6 A;  3FFK B;  4HWI A;  1GLJ O;  2KW4 A;  4CJ4 A;  5I9E B;  3G4S N;  4KPY A;  5BR9 A;  4DV2 K;  4BR7 A;  3LAK A;  3M8P A;  4GW6 A;  1FW6 A;  3QES A;  1WAF A;  3KWG A;  4CED A;  4OKK A;  1NJI O;  2VWJ A;  3THW A;  1LW0 A;  4JYA K;  3AO3 A;  5MLC Q;  1LCU A;  3CCV N;  2EX3 A;  2E88 A;  1KCF A;  3ASM A;  5BN8 A;  5JLH A;  3D0P A;  1XC9 A;  1BL3 A;  3LZI A;  4FZY A;  4CFA A;  4FWP A;  4JI7 K;  4E89 A;  1XI1 A;  4JKF A;  4FJN A;  4B3S K;  3ZT1 A;  2O8D A;  3C95 A;  2X6N A;  3L2Q A;  4LD0 A;  4YOR A;  3RSE B;  5M1P A;  3ZX2 A;  5AZJ B;  4JNE A;  4B8C A;  2YHA A;  5HP1 A;  4CHZ A;  3KK1 A;  4CJK A;  3NF8 A;  3LAM A;  2YNF A;  1SKR A;  5E84 A;  4Y0W A;  3ISN C;  1JLF A;  3MX5 A;  4CZE A;  3EKU A;  4ISF A;  1T3V A;  3OYM A;  3L2R A;  2FSK A;  3NGI A;  3KLG A;  3TAP A;  2PZS A;  2O4G A;  2HHT A;  1E3M A;  3NF9 A;  3THY A;  2BGG A;  3TSP A;  1TKX A;  3DXK A;  1YJN N;  2UUA K;  3BZK A;  1LAW A;  3KIO A;  5AQM A;  3KKR A;  3TAF A;  3D45 A;  4X62 K;  1GOA A;  2ZM6 K;  4HCC A;  3THX A;  5AQP A;  1BUP A;  3EEQ A;  1QZ6 A;  5AFU A;  4CBW A;  4DB3 A;  1VSF A;  3KTQ A;  2KFZ A;  3EE8 A;  3DM2 A;  4OLB A;  3SBG A;  3P38 A;  3VQ8 A;  4CJE A;  3P83 D;  5CY4 A;  4RW8 A;  1XHX A;  2P9I B;  4MDA A;  2NNW A;  1VSL A;  2YHY A;  4E7L A;  3VGL A;  1J5E K;  3CJA A;  3ZT2 A;  3QEP A;  4BWJ A;  1VSM A;  3S41 A;  4IEI A;  4X66 K;  3C0B A;  3LDQ A;  3BF1 A;  4O0J A;  3OYD A;  3AGK A;  3LP1 A;  1TK8 A;  1QQC A;  5LMN K;  4FWR A;  2G8W A;  1J53 A;  3KK3 A;  3SK3 A;  1OH6 A;  5FPN A;  4JV5 K;  3CER A;  4E19 A;  3CCU N;  1SL1 A;  4E7K A;  3AY9 A;  4DHY A;  2VWK A;  3ATU A;  4BR2 A;  3N4Q A;  3CCQ N;  3V9S A;  1TK5 A;  4E1M A;  2O8C B;  2ATQ A;  3C65 A;  4BGB A;  3O4W A;  2HHU A;  1ZC6 A;  2YJF A;  1JL2 A;  1GLA G;  4IG3 A;  5IT9 O;  4ELT A;  3F73 A;  4Z4G A;  3CQY A;  3WEE A;  4GV9 A;  2F8T A;  1JLC A;  2HMP A;  2HND A;  4PKI A;  2QWO A;  4A5B A;  3U3Y A;  4K25 A;  1C1A A;  3HP9 A;  2KQ2 A;  1TKT A;  1K6Y A;  4FJI A;  2CGK A;  4JKG B;  4CFC A;  2E2N A;  2YHW A;  2O4I A;  3SV3 A;  4QS8 A;  4YOU A;  1EWR A;  5KI6 A;  2J4R A;  4DF4 A;  3T1Y K;  4FK4 A;  4C8O A;  1HKG A;  3I33 A;  5SZT A;  2E2O A;  1IO2 A;  3CQ8 A;  5FRN A;  1HRH A;  5ELZ A;  3L8B A;  4DV4 K;  4JKH A;  1ZBS A;  4BRQ A;  3NE6 A;  1LWC A;  1VSK A;  1NK5 A;  4FVU A;  3VTH A;  1ITG A;  1ZBI A;  1ATS A;  3O5B A;  4KAZ A;  4H5V A;  5DM6 L;  3CD6 N;  1BI4 A;  3CJ9 A;  4WQ5 C;  3VEX A;  4W5N A;  4E7J A;  4BG8 A;  1VQP N;  4JS4 A;  4O55 A;  4RG8 A;  4LF8 K;  2KZM A;  4CFB A;  3MXM A;  3UB5 A;  1G15 A;  4BDY A;  1YHQ N;  4PUO A;  2BH1 A;  3U3G A;  3QBX A;  4O0I A;  3K58 A;  4F3T A;  1VQ4 N;  5LJW A;  4KO0 A;  3U8X A;  4BC3 A;  2P9U B;  2UUC K;  4PL8 A;  2A41 A;  3VGK A;  4JK7 A;  1SV5 A;  4CHN A;  4ILH A;  4FYD A;  3K5L A;  1D9D A;  2RN2 A;  3OYJ A;  2LSN A;  4DU3 A;  3CPE A;  4CJP A;  1VSD A;  2ZWH A;  3GL1 A;  4LF7 K;  1UA0 A;  2GWK A;  4KI4 A;  4DV0 K;  1S1V A;  3LM9 A;  3SLC A;  4OO1 J;  4DFK A;  3A5O C;  3ALY A;  5AQQ A;  2VGM A;  1TK0 A;  1RT7 A;  1YUW A;  4BE2 A;  2NRH A;  3D2E A;  1GLF O;  3C6A A;  4HTL A;  3F9K A;  3MED A;  5BPN A;  3ZSR A;  5AQO A;  4UQG A;  3WNH A;  1KAZ A;  5C42 A;  3NVM A;  2WUS A;  2KKZ A;  3D2F B;  4FJL A;  3CJ7 A;  2XHB A;  4DTM A;  4OPJ A;  2QWN A;  4JK9 A;  4CK2 A;  2ZGY A;  1OH5 A;  4PKG A;  1QSY A;  4CK3 A;  5HL7 L;  2JLE A;  1T6D A;  3V4I A;  2FXU A;  4BR0 A;  4KH4 A;  3M5R A;  2G8V A;  1C6V A;  3OS1 A;  3S3N A;  3O80 A;  3VEV A;  1YIT N;  2OTJ N;  1U48 A;  4A59 A;  3T1A A;  4J2B A;  4H4M A;  4KRF A;  3VEW A;  2GEL A;  3H6E A;  3CHW A;  3IRX A;  3G71 N;  1NGA A;  4RW9 A;  3B8A X;  3DLL L;  1W0H A;  4M3X A;  1BQN A;  4L8R B;  4AF1 A;  4N47 A;  1S5J A;  5JLF A;  5JS2 A;  3SQ4 A;  4OGE A;  4EP5 A;  3QB0 A;  4JK8 A;  4Q0B A;  2P9S B;  4U7B A;  2ZGZ A;  3SPY A;  4CHY A;  5AQL A;  2VYP A;  3AVG A;  1QHT A;  3A0I X;  3OY9 A;  4ILJ A;  3R6M A;  1U4B A;  3VQ9 A;  3D6R A;  3KJV A;  5JS1 A;  3M8R A;  1IBM K;  5JVH L;  3RR7 A;  3VMF B;  5AQG A;  4LFC K;  1JXE A;  2Q0U A;  4IJA A;  5AZI A;  3FGU A;  5ADX A;  3PSI A;  3LDO A;  2OYQ A;  3TAE A;  3L6Q A;  3VTI A;  3ZET B;  5J1E A;  1RCH A;  1Y64 A;  3MK6 A;  4KV8 A;  2BTF A;  2EHG A;  1KLN A;  3PLA A;  3TTC A;  3SZ2 A;  3M6G A;  4CF2 A;  2G8I A;  5KGX A;  1K9M O;  4JRQ A;  1HNV A;  4KI6 A;  4CF1 A;  2OPR A;  4JI6 K;  4ZHR A;  4IJN A;  2AP1 A;  5HOO A;  4MDB A;  2ASM A;  2P9K A;  3CET A;  4GKK K;  2EWS A;  3KD5 E;  4PHT X;  3DI6 A;  4HTU A;  1IKV A;  1BU6 O;  1VHX A;  4FVM A;  4H4O A;  4FLV A;  4KHY A;  3S3O A;  1T6C A;  2VQF K;  3NH0 A;  4IXC A;  1OKJ A;  3J7A P;  3KVG A;  4YOT A;  1N32 K;  4H5W A;  4CCH A;  2W40 A;  3IMX A;  4BRH A;  2NUB A;  2Q36 A;  5HRR A;  3KLE A;  2XRI A;  5HRP A; 
#chains in the Genus database with same CATH homology
 4KTZ A;  1RBT A;  2E6M A;  3T19 A;  4KHW A;  2ZE2 A;  2IAJ A;  4DTU A;  1HMV A;  1HYZ A;  4FW2 A;  4Q5V A;  2IGI A;  2R7Y A;  2I5J A;  1ASW A;  3AVM A;  4IFY A;  3S9H A;  1VSE A;  2WOM A;  1R0A A;  3UIQ A;  1ASV A;  2G8K A;  3VA0 A;  1EP4 A;  1S6P A;  2A1R A;  4C8L A;  5C25 A;  3LAL A;  4LH4 A;  4FXD A;  4AIL C;  1NK8 A;  1L5U A;  2OZS A;  3ZT4 A;  3BDP A;  4DFJ A;  2OPS A;  5HRN A;  4IG0 A;  1CXU A;  3AA4 A;  1A5X A;  1LW2 A;  2BE2 A;  1EXQ A;  1L3T A;  3P1G A;  5HRS A;  4DQR A;  4F8R A;  4FJ9 A;  1C1C A;  4OJR A;  1T7P A;  2E6L A;  3DYA A;  2KW4 A;  2Y1J A;  4CJ4 A;  1BCM A;  1ZBF A;  4KPY A;  4ELV A;  4PY5 A;  2HNY A;  3PO4 A;  4FLT A;  1Q9Y A;  1KFS A;  4Z4I A;  2HHS A;  3RMB A;  1HYS A;  1LWE A;  2E4L A;  3V9Z A;  3SJJ A;  4FJ7 A;  3OYG A;  3SYZ A;  3LAK A;  3M8P A;  5I42 A;  4GW6 A;  4TSX A;  2HHX A;  3QES A;  1WAF A;  1KLM A;  1D8Y A;  4CED A;  1C0T A;  4WE1 A;  4N76 A;  4OKK A;  2VWJ A;  1LW0 A;  3AO3 A;  4W5O A;  4FLX A;  4CEO A;  3KLF A;  2EX3 A;  2D0B A;  1IKW A;  5FDL A;  1QSS A;  1KCF A;  3ASM A;  5CYQ A;  3OYA A;  3D0P A;  1XC9 A;  4E0D A;  1BL3 A;  3LZI A;  3RTV A;  4FZY A;  4Z4E A;  3C94 A;  4CFA A;  1NJY A;  1B9F A;  2BDP A;  4F3O A;  2HHW A;  4CGF A;  3THV A;  4DTP A;  5D3G A;  1RT5 A;  4E89 A;  1XI1 A;  4KKO A;  3TAM A;  4M3T A;  3DLB A;  4EZ9 A;  4FJN A;  3LP2 A;  1UOC A;  3V81 A;  1N5Y A;  1BGX T;  3DLR A;  4ICL A;  1BHL A;  1WSF A;  3K2P A;  2P1J A;  3ZT1 A;  3C95 A;  4CEQ A;  5KRT A;  4CEZ A;  3LDS A;  3V9X A;  5FRN A;  2X6N A;  3L2Q A;  4LD0 A;  3OVN A;  3TWH A;  3SQ1 A;  1YVU A;  3DLH A;  4C8M A;  3OYC A;  1Q9X A;  4B8C A;  3S3M A;  3QIN A;  2YHA A;  1NOZ A;  3SI6 A;  5CYM A;  3O3G A;  4DSL A;  5HP1 A;  4CHZ A;  3HXM A;  4KHQ A;  4ELU A;  4W5Q A;  3AA5 X;  3KK1 A;  3JSM A;  4CJK A;  4K8Z A;  4M42 A;  3NF8 A;  3LAM A;  4HUE A;  5J2P A;  3NCI A;  2YNF A;  3QEW A;  4BDP A;  4ZTJ A;  1SKR A;  1RBV A;  1LWF A;  1VSJ A;  1TAQ A;  3ISN C;  5KGW A;  1JLF A;  4Z4C A;  4E7I A;  1DTT A;  2HB5 A;  3O3F A;  3OYM A;  3OJS A;  4B8A B;  3L2R A;  1I3A A;  3NGI A;  3VQ5 A;  3VQC A;  3NH1 A;  3EYZ A;  4DSI A;  4J2A A;  4N5S A;  4E7H A;  4KTW A;  5J2Q A;  1NJZ A;  1I39 A;  1TGO A;  3KLG A;  3TAP A;  2PZS A;  2O4G A;  3LWM A;  3OYI A;  4OVL A;  3VQE A;  3RR8 A;  2HHT A;  2JGU A;  3NF9 A;  4CEE A;  2BGG A;  1Q8I A;  5K14 A;  4DLE A;  4NYF A;  3VQD A;  1TKX A;  2B4J A;  2F8S A;  4M3Y A;  3IG1 A;  1WSJ A;  1EKE A;  3K5M A;  5DK5 A;  1SUQ A;  2FBX A;  1J54 A;  4KFB A;  3RRG A;  2FBY A;  1LAW A;  1W9H A;  3KIO A;  1S1T A;  3HVR A;  4CHQ A;  5FRM A;  3P5J A;  3KKR A;  3TAF A;  3D45 A;  4OGC A;  1KFD A;  1NJX A;  4R5P A;  4FW1 A;  3WNE A;  1GOA A;  2XY7 A;  4J2E A;  4NCA A;  2IDO A;  1FKO A;  1VRU A;  3VA3 A;  5J2M A;  1VSH A;  3KLH A;  4HCC A;  1J5O A;  1A5W A;  1RTH A;  1C1B A;  3JYT A;  4DQI A;  4OKJ A;  4EZ6 A;  3V1Q A;  3ZT3 A;  2PYL A;  1S1U A;  1VSF A;  2B6A A;  3ZCM A;  3CFP A;  4CJV A;  3DM2 A;  5DMR A;  3KKS A;  1WSH A;  1SKW A;  3RWU A;  4OLB A;  1YTA A;  3AVN A;  4E3S A;  3PV8 A;  3VQ8 A;  4ZTF A;  3VQP A;  4GVM A;  2ETJ A;  2W42 A;  4CJE A;  1RT6 A;  3P83 D;  1L3V A;  5CY4 A;  4RW8 A;  1XHX A;  1T05 A;  3NF7 A;  4LY7 A;  2VG5 A;  4HUG A;  3HYF A;  1JKH A;  3MEG A;  3PUF A;  4M3U A;  3G10 A;  4AH9 A;  5KTQ A;  4RW6 A;  1VSL A;  3NF6 A;  4CES A;  4OPK A;  4FLU A;  1NKE A;  1EET A;  4E7L A;  1WSI A;  3K59 A;  3RMD A;  2XO7 A;  5FRO A;  4Z0U A;  4DG1 A;  3V1R A;  3V9W A;  4AHT A;  4KRE A;  3ZT2 A;  1ZBU A;  3QEP A;  4BWJ A;  1VSM A;  3AVA A;  3ZSY A;  4CIE A;  3CG7 A;  3M8S A;  4C8K A;  5SWM A;  4O0J A;  3PO5 A;  3OYD A;  2IC3 A;  3LP1 A;  4I9L A;  3TAN A;  4DQQ A;  1T8E A;  1TK8 A;  3PY8 A;  2G8F A;  1QQC A;  1QE1 A;  1NK4 A;  5HBM A;  5E41 A;  4B9L A;  4F4K A;  4Y1C A;  4DLG A;  2YKM A;  2G8W A;  1J53 A;  1RTI A;  4YFU A;  3KK3 A;  3VQ6 A;  2G8H A;  3M8Q A;  1JLG A;  4E19 A;  3KLI A;  3SUP A;  1SL1 A;  2ITG A;  4CFD A;  1RT3 A;  4E7K A;  4M41 A;  4CJ3 A;  2VWK A;  1CZ9 A;  2RF2 A;  4CJQ A;  3AVH A;  3V9S A;  1TK5 A;  4E1M A;  3AO5 A;  3TAQ A;  1T03 A;  3E01 A;  2ATQ A;  4CGG A;  3IS9 A;  3AA3 A;  3HT3 A;  3SV4 A;  4M3Z A;  4PWD A;  2HHU A;  1DLO A;  2F96 A;  4YNQ A;  4DTO A;  1JL2 A;  3AA2 A;  3NFA A;  1IKX A;  3DOK A;  4CIF A;  4IG3 A;  3TR8 A;  4DSE A;  1REV A;  3PX0 A;  3F73 A;  4B9U A;  4ELT A;  4Z4G A;  2RKI A;  1QTM A;  4XIU A;  3MAQ A;  1NKC A;  1TKD A;  2F8T A;  2HVI A;  1JLC A;  3CFR A;  1HPZ A;  2HND A;  3HPG A;  2HMI A;  4HHT A;  1U04 A;  4DTN A;  3O4Q A;  1NK9 A;  2XY8 A;  2OA8 A;  1D9F A;  3U3Y A;  4FJM A;  1ASU A;  1C1A A;  1XWL A;  3AVJ A;  3HP9 A;  2HW3 A;  2KQ2 A;  1TKT A;  4LSN A;  5CZ2 A;  1K6Y A;  3LWL A;  4FJI A;  2PY5 A;  4FK2 A;  4DTJ A;  4CFC A;  1NKB A;  5J2N A;  2O4I A;  1KVB A;  3SV3 A;  3IAY A;  4KB0 A;  1VRT A;  3TI0 A;  4CEF A;  1L3S A;  5KI6 A;  3B6P A;  4DF4 A;  4FK4 A;  4C8O A;  2A1S A;  3ZSW A;  5SZT A;  3I0R A;  4FZX C;  3PX6 A;  3HPH A;  1IO2 A;  2P5G A;  3CQ8 A;  2P51 A;  1X1P A;  3VQ4 A;  4MQ3 A;  3NBP A;  4CJU A;  4DWI A;  4KTQ A;  1HRH A;  3L8B A;  1HNI A;  4HCB A;  2PYJ A;  3ZT0 A;  3NE6 A;  1LWC A;  4FJK A;  1HQE A;  1VSK A;  1NK5 A;  1EX4 A;  4FJ5 A;  3KD1 E;  4B9S A;  4BE1 A;  1RDD A;  3L3U A;  1S1X A;  1WSG A;  4CEC A;  4Z4F A;  2GV9 A;  3TAR A;  4NCB A;  1ITG A;  3CM6 A;  4N56 A;  1U49 A;  4DQS A;  2YV0 X;  4NCG A;  1UAX A;  3LZJ A;  2KTQ A;  3O4N A;  1ZBI A;  2KFN A;  3NGY A;  1S9E A;  4I7F A;  4O4G A;  3MXJ A;  1HQU A;  4ID5 A;  4FLZ A;  5HLF A;  4KAZ A;  2KZZ A;  1ZBH A;  1BI4 A;  4JRP A;  1FK9 A;  2Z1H A;  4BE0 A;  5I3U A;  4W5N A;  1CXQ A;  1HYV A;  4Y1D A;  4E7J A;  1A5V A;  4CIG A;  4CJT A;  4AHS A;  4JS4 A;  4O55 A;  3H08 A;  2FC0 A;  3QIO A;  2FBT A;  2QK9 A;  2QXF A;  1KVA A;  4RG8 A;  5KRS A;  4OLA A;  3DMJ A;  4GMJ B;  2X6S A;  2KZM A;  4CFB A;  2DY4 A;  4FJ8 A;  3MXM A;  1G15 A;  3EZ5 A;  4BDY A;  4FK0 A;  2OPP A;  3OYH A;  4PUO A;  1TVR A;  3KK2 A;  3U3G A;  3OJU A;  1B9D A;  1UWB A;  3DRP A;  4O0I A;  4JS5 A;  2Z1I A;  2RPI A;  3K58 A;  4BWM A;  1WSE A;  4CER A;  4F3T A;  1JLE A;  3K5N A;  1BCO A;  3ZSQ A;  4M45 A;  4KO0 A;  1JXB A;  2IOC A;  3AVL A;  4CF9 A;  3SQ2 A;  2D0A A;  1BIZ A;  2DFH A;  3QNO A;  1SV5 A;  4CHN A;  3C6U A;  4FYD A;  4CK1 A;  3K5L A;  1D9D A;  2RN2 A;  3OYJ A;  3PX4 A;  2LSN A;  4BAC A;  4DU3 A;  3NH2 A;  3OYK A;  3K57 A;  4CJP A;  4B9T A;  1VSD A;  3T3F A;  3OYL A;  1BIU A;  2Y1I A;  3AVI A;  1KVC A;  3HVT A;  1IKY A;  1UA0 A;  3AO2 A;  4KI4 A;  1S1V A;  3ZSZ A;  1RT4 A;  4E1N A;  4DFK A;  2IS3 A;  3DLG A;  3ALY A;  4IBN A;  4DF8 A;  3EY1 A;  1IG9 A;  1FKP A;  3L2U A;  4RW4 A;  3I0S A;  4FJX A;  1TK0 A;  1RT7 A;  3CFO A;  2QKB A;  4BE2 A;  2AJQ A;  4DTR A;  4HVJ A;  1Z26 A;  3V9U A;  4DTS A;  3QLH A;  3MXI A;  4W5T A;  4FJH A;  1IH7 A;  4IKF A;  4PA1 A;  1BI4 B;  3F9K A;  1RIL A;  4RW7 A;  3MED A;  3ZSR A;  2Q3S A;  4FJJ A;  4CJ5 A;  4FLY A;  1VK0 A;  3WNH A;  4UQG A;  3SNN A;  4F2R A;  1B92 A;  4CEA A;  1JLQ A;  4QCL A;  1Z25 A;  5C42 A;  5T7B A;  3HJF A;  1WN7 A;  4FJL A;  3QO9 A;  2HHV A;  1RDB A;  1BIS A;  4DFM A;  2QKK A;  2XHB A;  2X78 A;  3HPO A;  4DTM A;  4OPJ A;  3LP0 A;  4CK2 A;  3V6D A;  3VQ7 A;  4MFB A;  4DFP A;  1RDA A;  4FM1 A;  1YTU A;  2OPQ A;  1SKS A;  1QSY A;  1WNS A;  4CJF A;  4CK3 A;  3V1O A;  2JLE A;  3OS0 A;  3WNF A;  1TAU A;  3V4I A;  4O44 A;  3VN5 A;  1NOY A;  3MEC A;  4LH5 A;  3NAE A;  2YHB A;  4G1Q A;  3WNG A;  3SUN A;  2BAN A;  2YNI A;  2Z1G A;  3BGR A;  4LSL A;  4B08 A;  1QS4 A;  3HM9 A;  1C6V A;  3NDK A;  3SUQ A;  3ITH A;  3SPZ A;  2G8V A;  4I9Q A;  3OS1 A;  3QIP A;  3S3N A;  4DMN A;  3OYN A;  1U48 A;  4AHU A;  3T1A A;  3ZSO A;  3A2F A;  3C6T A;  3OYF A;  1SL2 A;  1KRP A;  4OKE A;  4J2B A;  4H4M A;  4PQU A;  1RBU A;  3DRR A;  4KRF A;  3DRS A;  5HRO A;  1ZYQ A;  3SCX A;  4FJG A;  3IRX A;  1TL3 A;  4I2Q A;  4RW9 A;  5EU7 A;  3HL8 A;  3VQA A;  1YT3 A;  1RNH A;  4DS5 A;  4FZZ A;  4W5R A;  5CZ1 A;  4QOZ B;  1W0H A;  4CE9 A;  1QSL A;  4M3X A;  1BQN A;  1SL0 A;  4L8R B;  1RTD A;  3L2V A;  3VQB A;  4N47 A;  1NK6 A;  4DU4 A;  3L3V A;  4CHP A;  1S5J A;  3QNN A;  5JS2 A;  4JLH A;  3SQ4 A;  4BDZ A;  3QEV A;  2YNG A;  4OGE A;  1CLQ A;  4EP5 A;  1RT2 A;  3OS2 A;  4Q0B A;  3QET A;  2DTU A;  4CGJ A;  3SPY A;  1RBR A;  1HJR A;  3B6O A;  4HUF A;  1RDC A;  4M3R A;  4CHY A;  2FBV A;  4AHC A;  2XY6 A;  1NK0 A;  3CYM A;  2DFF A;  3QEX A;  3AVG A;  1QHT A;  3SQ0 A;  1X9S A;  1GOB A;  4K8X A;  3OY9 A;  1RT1 A;  1S6Q A;  4CJL A;  4CGH A;  2HNZ A;  4DS4 A;  3TAG A;  1U4B A;  3HO1 A;  3FFI A;  3VQ9 A;  4AHR A;  4FCY A;  1S9G A;  3KJV A;  3LPT A;  5JS1 A;  4C8N A;  3M8R A;  3RR7 A;  1TL1 A;  2X74 A;  4B9V A;  3SUO A;  2P5O A;  1J9A A;  1JXE A;  1WAJ A;  3HP6 A;  4CJS A;  4ID1 A;  4DSJ A;  2VG6 A;  1DTQ A;  2XY5 A;  1C0U A;  1XHZ A;  1VSI A;  3ULD A;  3DLE A;  2OYQ A;  2HHQ A;  1U47 A;  2Z1J A;  3TAE A;  1O1W A;  1ZBL A;  4B9M A;  1JLA A;  3AVK A;  3VQQ A;  3KTQ A;  3K5O A;  4CJR A;  1CZB A;  2YNH A;  3AVB A;  3DLK A;  3LAN A;  4CGI A;  5J1E A;  4FLW A;  1RCH A;  4CEB A;  1TV6 A;  4KHU A;  2KFZ A;  4KV8 A;  3QEI A;  1JLB A;  2EHG A;  4QAG A;  4DTX A;  1KLN A;  1F21 A;  3HK2 A;  1KSP A;  3L2W A;  3SZ2 A;  4CGD A;  4CF2 A;  4B9N A;  2G8I A;  5KGX A;  1KTQ A;  1BQM A;  4B3O A;  4JRQ A;  4F2S A;  2D0C A;  3OYB A;  1LAV A;  3TAB A;  1N6Q A;  1NK7 A;  2GBZ A;  4H8K A;  1RBS A;  1HNV A;  1U45 A;  4KB1 A;  4KI6 A;  4CF8 A;  2WON A;  3AO1 A;  2OPR A;  3LP3 A;  4CF1 A;  4IFV A;  3ZSX A;  3AVF A;  4DSK A;  2D5R A;  4IDK A;  3NHG A;  4ZHR A;  1S1W A;  1X9W A;  1RTJ A;  2ZQB A;  2VG7 A;  4KHN A;  3LPU A;  4DU1 A;  3AV9 A;  1UA1 A;  3G0Z A;  4J2D A;  3I8D A;  3RRH A;  1TKZ A;  2YKN A;  3OYE A;  1X9M A;  3KD5 E;  4N41 A;  2G8U A;  3U6F A;  3RMC A;  3O3H A;  3DI6 A;  4KHS A;  4HTU A;  3DOL A;  1IKV A;  3CM5 A;  2B5J A;  3AO4 A;  5C24 A;  1LV5 A;  1NJW A;  1C0M A;  1FXX A;  4M3W A;  1JL1 A;  4FVM A;  4H4O A;  3QER A;  4FLV A;  4DQP A;  4KHY A;  2GUI A;  3S3O A;  4Z4H A;  3RMA A;  3NH0 A;  1L3U A;  2DFE A;  4I2P A;  3AVC A;  3HST B;  4NYN A;  3ZSV A;  4CHO A;  2ZD1 A;  2OZM A;  4FM2 A;  4EP4 A;  1GOC A;  4FM0 A;  4CJW A;  2HVH A;  4DSF A;  4CCH A;  4CF0 A;  3NGZ A;  1Y97 A;  2NUB A;  5HRR A;  3KLE A;  2XRI A;  1D5A A;  1WLJ A;  3MEE A;  4AHV A;  4O5B A;  1MU2 A;  5HRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...