4E1NA

Crystal structure of hiv-1 integrase with a non-catayltic site inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
152
structure length
144
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSATVKAAWWAGIKQEFGIPNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Class of HIV-1 Integrase (IN) Inhibitors with a Dual Mode of Action.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/transferase inhibitor
molecule keywords HIV-1 integrase
total genus 46
structure length 144
sequence length 152
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e1nA00
1TL3A 2D0AA 4FM1A 4B9TA 3U6FA 4FLUA 2OA8A 3B6PA 3WNGA 5KRSA 4Y1DA 4DLGA 4O0JA 1NK5A 4JRQA 1NK6A 3OYLA 3PO5A 3RWUA 2YHAA 3VQ4A 2YNIA 3AVGA 2RN2A 4DG1A 4EP5A 4KTQA 3V1OA 4DFMA 3TAFA 2AJQA 3AVFA 4XIUA 3KKSA 1TK0A 1VSJA 3IRXA 2VG6A 4CEBA 3HPOA 2D5RA 1VSFA 3G10A 4RW4A 2OPSA 5J2NA 4E0DA 4I9LA 4CGIA 3AVIA 1BI4A 3NHGA 4IKFA 4CHQA 4BE0A 3PX6A 3LWLA 4KHSA 2FBYA 5KI6A 3L2QA 4B9VA 1Z26A 3V9UA 3HK2A 1BI4B 1SKRA 3SV4A 4KB1A 4RW6A 1HNIA 1RT5A 3NGIA 4LD0A 3MAQA 4E7LA 1X9WA 4ELUA 4F4KA 3OS0A 3PY8A 4FLYA 1S6QA 1RT2A 3VQEA 4M3UA 2HHSA 2DTUA 2Z1GA 1QQCA 3L2WA 1O1WA 2W42A 4RW7A 1BCMA 1HYVA 4FJJA 1FKPA 3DMJA 4JS5A 3AVAA 3FFIA 1WSEA 2O4GA 4ZTFA 4CJPA 1VSIA 4B9NA 1WAFA 4DTUA 1L3TA 4KI6A 3VQQA 4BE1A 2KFZA 1LAVA 4AHCA 3AO1A 1NK4A 4I9QA 4FJ7A 2HVIA 4FZYA 4CFAA 4HHTA 3ZSVA 2IAJA 1FK9A 2DFHA 3ZT1A 4CGDA 3SCXA 3OS1A 1CZBA 3NF8A 1HMVA 3V9XA 4F2RA 3ZT2A 3LP0A 3NF7A 3PX0A 2ATQA 3V9WA 1LAWA 1F21A 4CHPA 4JS4A 2Z1HA 3O3HA 4FJNA 3DRRA 4B9MA 5FRNA 3RRGA 2RF2A 2FBTA 4RG8A 2HHUA 1TKTA 3B6OA 1U48A 1NJXA 4Z4HA 3MEGA 1WAJA 4KHNA 4AHTA 1BHLA 3AVMA 4J2EA 5SZTA 3CFRA 4PY5A 1IG9A 2OPPA 2X6SA 1A5VA 4CEDA 3HJFA 1QSSA 2X6NA 1S5JA 3SNNA 2YNFA 4M3RA 2R7YA 3O3GA 2ZE2A 3K2PA 3QESA 4CJLA 2JLEA 2A1RA 1HQEA 2QKKA 1SL2A 3PV8A 1KLNA 4FJ9A 4KI4A 1RTDA 4B9UA 3DLRA 1U45A 1C0TA 1NK7A 4CEEA 4DTJA 3AVKA 1XHZA 1Q9XA 3KTQA 3AVBA 4O4GA 4CHZA 1IKVA 1DTTA 4IDKA 2KZMA 4J2AA 2ETJA 1Q9YA 4DTMA 4OLBA 3SZ2A 3SPZA 4JRPA 3K58A 3PX4A 3KLGA 2HVHA 3OJUA 3CFOA 1IKWA 2HHWA 4DLEA 4C8MA 4FJIA 3HVTA 3ZSXA 4E19A 1LV5A 1YTAA 1NJYA 3KK1A 4DFKA 4FK4A 3QIOA 2F8TA 2WOMA 4W5NA 4CF0A 1U47A 5K14A 5CZ1A 4FLVA 3SJJA 4PQUA 2OZMA 4E7JA 4KFBA 4PA1A 5SWMA 4DF8A 4DSKA 4M3TA 1JLQA 4QAGA 4FVMA 4CFDA 4CK1A 4DQRA 1VSHA 3OYIA 1WSFA 3HXMA 4FCYA 4E7KA 4NCGA 4FJHA 4FK2A 2P51A 3TAGA 4ID5A 3K5MA 3C95A 3NF9A 4IG0A 4CJ5A 3EY1A 2YNGA 4IFYA 4YNQA 3OYCA 1D9FA 4NCAA 3ZT4A 4LH4A 4FJMA 3MEEA 3ZSQA 4M41A 3V1QA 4CJEA 4H4OA 3JSMA 3AVLA 2IGIA 5KRTA 4Y1CA 1DTQA 2FBVA 3A2FA 5HP1A 3BGRA 2F8SA 3VQPA 3S3MA 3OVNA 3C94A 4DWIA 3NBPA 1HPZA 1RDCA 2X78A 4BACA 1T7PA 3OYKA 1KLMA 1ZBUA 4KHWA 1JLGA 3ZSZA 4O55A 1K6YA 4FJKA 1XI1A 4Z4CA 1HYSA 2FBXA 1A5WA 1B92A 1LW2A 2F96A 4GW6A 2KW4A 3KLFA 4RW9A 3I8DA 4W5OA 4Q5VA 4BE2A 4E7HA 3I0RA 4QCLA 1BISA 1JXEA 4E1MA 3CM5A 4KTWA 4KHQA 4AILC 2QXFA 4GVMA 4LSNA 3V9ZA 1T05A 4CGFA 1NK8A 4J2BA 2HHQA 1GOAA 4CJFA 1NK9A 1NOYA 4FLWA 1JLCA 4DTPA 2ZD1A 4I2PA 3O4QA 4DS5A 2OYQA 3LZJA 2WONA 3OYBA 4BWJA 1RTJA 3SQ4A 2VWKA 3QEVA 4AH9A 1ZBLA 2XY7A 4KB0A 1I3AA 4CESA 4C8LA 3QIPA 3LP3A 4OGCA 2IDOA 2DFEA 3I0SA 4UQGA 1B9DA 2P5GA 4CE9A 4KHYA 3F9KA 4FK0A 1IH7A 2QKBA 3BDPA 2DFFA 4DS4A 4DSLA 2HHVA 3ISNC 5E41A 3NGZA 3ZCMA 4L8RB 1MU2A 3SUQA 3M8SA 4AHUA 1QS4A 3LP2A 3MECA 4ID1A 3RR7A 3H08A 1VSKA 4OPJA 1RDBA 4HUEA 1I39A 4R5PA 3T1AA 3L8BA 4ZTJA 1L3VA 4F2SA 3P1GA 1TKZA 5J2MA 4O5BA 3NAEA 3SQ1A 1VRUA 4H4MA 4B3OA 3DYAA 3QLHA 4CF2A 3DI6A 4OPKA 2YKMA 3QEWA 1UAXA 1UA0A 2PZSA 2EHGA 4FM2A 4HUGA 3DM2A 1RT1A 1JLBA 1BCOA 3OYHA 4NCBA 1G15A 1KTQA 1WSJA 3SV3A 1RBTA 3NH1A 2XO7A 1C1AA 1RILA 1JXBA 4CF1A 2BGGA 4M3WA 4FYDA 3VQ5A 3EYZA 4OKKA 5C25A 2YKNA 3MXJA 3DLBA 2VG5A 2ZQBA 3LALA 4LH5A 2VWJA 5I42A 1J5OA 2BDPA 4CIGA 4QOZB 2G8FA 2LSNA 4C8NA 1JLAA 3AVCA 3L2UA 1CZ9A 1KRPA 4ICLA 5C24A 5J2PA 1SL0A 1CLQA 3ZSYA 1RBRA 4CF8A 3KJVA 3MXMA 1VSEA 3DLEA 5DK5A 3RMDA 2DY4A 1D5AA 1R0AA 3NGYA 4BDZA 1S1UA 3ITHA 4G1QA 4B08A 2Y1IA 2XY8A 1TKDA 3SUPA 3HP6A 4FZZA 4FXDA 3SQ2A 4HCCA 5HRRA 3RR8A 4N41A 4ZHRA 4Z4IA 3HPHA 1W0HA 4J2DA 5C42A 3AVHA 2D0CA 1Q8IA 2P5OA 3PUFA 4DF4A 2XY6A 2OPQA 4I7FA 4KTZA 2PY5A 3IS9A 3K5NA 4DQSA 1BQNA 3CM6A 2YHBA 3G0ZA 1ASUA 4OGEA 3SYZA 2G8WA 4CGGA 3ZSRA 1KSPA 2E4LA 2KTQA 1NKCA 1RBVA 1XHXA 2HNYA 3TAMA 5CZ2A 5HRPA 1C1BA 3VQ8A 3ZSWA 4CFBA 3HL8A 3K57A 4LY7A 3ULDA 4FLTA 1WNSA 3CYMA 3QERA 2OZSA 4DSIA 3QNNA 1YTUA 3DLGA 3C6TA 4CIFA 1LWFA 3HPGA 2OPRA 4F3OA 1BQMA 3S3OA 1S1VA 3M8QA 1LW0A 3DLHA 4FJXA 1ZBHA 1XWLA 1ZYQA 3AA5X 3AVJA 3DLKA 4FW2A 3ASMA 3KKRA 1TKXA 3LAKA 3OYEA 3NCIA 4DQQA 5D3GA 1L3UA 3K5OA 1X1PA 1ASWA 1XC9A 4CJKA 1UWBA 1CXUA 1U4BA 4C8OA 1QHTA 5J2QA 2HNDA 3D45A 4B8CA 1U04A 4N5SA 3OJSA 2Z1IA 4CK3A 1KVCA 3HSTB 3QEPA 5EU7A 3VN5A 1QE1A 2XY5A 4IBNA 3HO1A 4AHRA 2HB5A 1QTMA 1EKEA 4K8ZA 1IKYA 3NFAA 4IG3A 3NE6A 3QINA 4DTNA 1U49A 4FZXC 4K8XA 1EXQA 2GV9A 3V1RA 4W5RA 3QO9A 3RRHA 4Z4FA 4Z4EA 3VQAA 5J1EA 3LZIA 1FXXA 5JS2A 1HQUA 1LWCA 3VQ7A 3S9HA 4CJWA 1D9DA 2GBZA 4HTUA 3TI0A 2EX3A 4Q0BA 4KKOA 1REVA 2KQ2A 3L3VA 4DU3A 1TK5A 1HRHA 1TV6A 1S9GA 2PYJA 1RT7A 2G8IA 1TAQA 1SL1A 3AVNA 1CXQA 1EP4A 1ASVA 4WE1A 4DSFA 3LPUA 3LWMA 3V81A 1D8YA 1RT4A 1JL2A 3KLIA 1C1CA 2G8UA 1HJRA 1RT3A 3DRSA 3OS2A 4PUOA 1JKHA 4BWMA 1TK8A 4DTRA 3JYTA 4ELTA 3M8PA 1RBSA 3OYDA 2E6MA 4H8KA 1BIUA 1C0UA 1S1WA 1WN7A 4HUFA 4FLXA 3P83D 1L5UA 1SKWA 1KFSA 4PWDA 5HBMA 1TAUA 4EZ6A 2X74A 3O4NA 1SUQA 1NKBA 2YV0X 3L2VA 1GOCA 3RMAA 1KFDA 4EP4A 5HRNA 1JL1A 3TR8A 4DSEA 1T8EA 4KAZA 4N76A 4DFJA 4M45A 3PO4A 3HT3A 3OYFA 2YNHA 2A1SA 4HCBA 3UIQA 4F8RA 2Y1JA 2HW3A 4EZ9A 3OYNA 1YVUA 3EZ5A 4LSLA 4W5TA 1T03A 1N5YA 2JGUA 2B6AA 4CFCA 2HHXA 4Z0UA 2KZZA 2GUIA 3KK2A 1NJWA 3TAEA 4OKEA 1A5XA 4F3TA 4N47A 5CYQA 4DFPA 1LWEA 3L2RA 3AO4A 1BIZA 3C6UA 1GOBA 3LP1A 2VG7A 3VQ9A 4CEOA 1IKXA 3ALYA 4CGJA 4E89A 2BE2A 1RDDA 1ZBFA 3THVA 1BL3A 3K5LA 3V4IA 3U3GA 3OYMA 3SUNA 3IG1A 1TVRA 3L3UA 3SPYA 3VQCA 3LANA 4CERA 4ELVA 3VQBA 4FW1A 3DOLA 3U3YA 2BANA 4OVLA 3DRPA 1QSYA 5T7BA 1SV5A 1C0MA 5CYMA 1QSLA 4IFVA 3AA3A 4CJRA 1C6VA 2HNZA 4O0IA 3NF6A 5HROA 1X9SA 1TGOA 1L3SA 4DTSA 4M42A 1VSMA 3WNHA 4KV8A 4MFBA 2IC3A 2G8VA 3IAYA 4BDPA 4CEFA 5KGWA 4BDYA 2D0BA 2HMIA 1S1TA 4FJGA 1Y97A 1RBUA 4CJSA 5FRMA 4Z4GA 4CIEA 3TAPA 2XRIA 4N56A 3HM9A 3VA3A 5KTQA 3P5JA 1N6QA 3VQDA 1BGXT 1RTHA 4YFUA 3LDSA 1J9AA 3SUOA 3NH2A 2Q3SA 3AO2A 2XHBA 3TABA 3TAQA 1Z25A 3OYAA 1WSGA 4CEQA 3MEDA 4AHSA 1VK0A 4E3SA 4CK2A 3LAMA 3QEIA 1RNHA 4OKJA 1EX4A 4DQIA 1S6PA 2NUBA 2FC0A 3DOKA 5HLFA 2QK9A 3S3NA 4KRFA 2G8KA 4M3XA 4M3YA 2HHTA 1JLEA 4JLHA 1RDAA 3NH0A 2G8HA 3AO3A 3OYJA 4CJVA 3LPTA 3O3FA 3MXIA 3OYGA 3KLHA 3TARA 4NYFA 4OLAA 3SI6A 2KFNA 4AHVA 4CJQA 3AV9A 3QEXA 3NDKA 2RPIA 3HVRA 1HYZA 3ZT0A 4CJTA 5CY4A 2RKIA 3SQ0A 1J54A 4MQ3A 4CEZA 4FJ8A 3T3FA 2IS3A 3AO5A 1DLOA 1WSHA 1KVBA 5KGXA 3V9SA 1FKOA 3KIOA 5FROA 1HNVA 4HVJA 5HRSA 1UOCA 1IO2A 2B5JA 3KK3A 2B4JA 3K59A 3RMCA 4CHYA 1ITGA 3TANA 1KVAA 4FJ5A 1TL1A 1EETA 3E01A 4DU1A 4E7IA 4FJLA 4KO0A 3CFPA 1J53A 4FM0A 2PYLA 4CHOA 3VA0A 4CHNA 4B8AB 1VSDA 4CF9A 3KLEA 1KCFA 3WNEA 1B9FA 1UA1A 4CCHA 3QETA 3D0PA 1RTIA 4CJ3A 4CGHA 3AA2A 4CECA 4CJUA 4FLZA 3RMBA 4I2QA 4OJRA 1SKSA 4O44A 1NOZA 1S9EA 4DMNA 3V6DA 4KREA 3M8RA 5JS1A 3VQ6A 1W9HA 2I5JA 4C8KA 1JLFA 3RTVA 2IOCA 4CEAA 4KPYA 4DTOA 2ITGA 3HYFA 3T19A 3ZSOA 1NJZA 4W5QA 4M3ZA 1VSLA 1RT6A 3ZT3A 1X9MA 3OY9A 3TWHA 1NK0A 4DTXA 4KHUA 3QNOA 4CJ4A 1VRTA 2P1JA 3F73A 1NKEA 4DSJA 2E6LA 5FDLA 4B9SA 2O4IA 3KD5E 1S1XA 3WNFA 3KD1E 3CG7A 4NYNA 4GMJB 5I3UA 4DQPA 1ZBIA 1WLJA 1RCHA 5DMRA 4TSXA 4E1NA 2Z1JA 1WSIA 3CQ8A 3AA4A 4RW8A 4DU4A 4B9LA 3HP9A 1YT3A
chains in the Genus database with same CATH superfamily
4IO9L 2OA8A 5M1KA 5KRSA 2YHAA 3V1OA 4BR5A 4DFMA 3TAFA 1OH7A 3OA9A 4Z94A 3HPOA 3SPYA 2Q31A 1BI4A 3NHGA 4IKFA 5JLFA 1NLVA 3FE1A 1WOQA 3TPQA 4A5AA 3LWLA 4KHSA 3L2QA 4B9VA 3V9UA 4KB1A 4ELUA 3NGIA 4LD0A 4F4KA 3CJCA 1RT2A 4XH4A 2Z1GA 3J81O 1O1WA 3H3NO 4RW7A 3FFIA 3FZMA 4CJPA 5EX5A 2E2NA 1L3TA 2VYPA 3VPZA 1VQNN 4FZYA 4CZJA 3PSFA 3ZSVA 1FK9A 5C2DA 3V9XA 3ZT2A 3NF7A 2ATQA 4IEIA 4CHPA 1F21A 4PL8A 2A40A 4FJNA 3C7NB 4B9MA 1H1VA 2ASOA 3RRGA 4RG8A 2HMPA 4Z4HA 1OKJA 3MEGA 1SQKA 1BHLA 4J2EA 3G71N 4PY5A 2OPPA 2X6SA 4CEDA 5AQTA 2P9LB 5AQXA 3S41A 4M3RA 2R7YA 1ZBSA 2ZE2A 3VGMA 2JLEA 4YDUA 3TTDA 2QKKA 2CGJA 1RTDA 2NRHA 4B9UA 4JKGB 3AVBA 4O4GA 2KZMA 4J2AA 3P39A 4O8UA 3SZ2A 4DR5K 3K58A 3C0BA 3OJUA 2OANA 3C6AA 1IKWA 4MLHA 5JMVA 5CR4A 4DLEA 4E19A 4FJIA 4LF9K 2QWMA 3KK1A 2E88A 4W5NA 5M1QA 4CW7B 4WCEL 5CZ1A 3CMEN 3M5RA 4PA1A 1JLQA 1WSFA 1ZC6A 3E9OA 1HNWK 4NCGA 4X64K 3TAGA 3ZEUA 3C95A 3NF9A 3EY1A 3FR0A 2YNGA 3HRGA 4IFYA 3OYCA 3UKRA 4LH4A 3FLCO 5BN8A 3CERA 3V1QA 4H4OA 5F1XA 3JSMA 2P9IA 4X65K 1DTQA 2FBVA 2V7YA 5AQHA 3S3MA 4BACA 1HPZA 5BPNA 1T7PA 1KLMA 3MK6A 1JJ2M 1XI1A 1HYSA 1A5WA 2F96A 3KLFA 4GW6A 4RW9A 4W5OA 1CZAN 4ILHA 1JXEA 3THWB 2QWQA 4GVMA 1MWMA 4CGFA 4J2BA 4CZFA 2QW9A 3OYBA 2VQEK 4BWJA 3SAHA 4C23A 2QWRA 1I3AA 1E4FT 3O4WA 3I0SA 1ZXOA 5GAHP 2WUSA 2P5GA 5BPLA 4KHYA 3F9KA 1QHAA 4FK0A 3MN6A 2DFFA 4LF4K 4BY9C 4DSLA 3FGUA 5E41A 4H5TA 3BF1A 1MU2A 1RFQA 5EY4A 1MDUB 3SAFA 5CE3A 4RCHA 3O5BA 2I7NA 5KQ8A 2NRZA 3NAEA 4AF1A 4MDAA 4BQZA 1GLLO 1UA0A 2EHGA 3DM2A 2NZTA 1JLBA 4GY2B 3NH1A 1C1AA 1JXBA 3VQ5A 3MXJA 3QBWA 5I42A 2BDPA 1FJGK 2LSNA 1KRPA 1JLAA 4DV0K 5ADXA 1RBRA 1RDWX 3R9PA 2DY4A 4LF5K 4FWSA 1S1UA 3SUPA 4IJAA 1N34K 4FZZA 5HRRA 4N41A 4A5BA 5AQUA 2P5OA 4BRPA 4XEIA 3EO3A 2YJEA 2PY5A 3KZBA 3HI0A 4JI2K 3CQXA 4CGGA 2KTQA 2E1YA 1NKCA 3VF4A 3TAMA 2HNYA 1GLBG 4CFBA 3LDQA 2W6LA 1Y64A 5KQDA 4DSIA 3QERA 3HZ6A 1YTUA 3DLGA 1LWFA 3HPGA 4UY8O 1LOTB 4BRLA 1BQMA 1YITN 3M8QA 2UUAK 3AVJA 4FW2A 5D3GA 1NGHA 3SMSA 3EE9A 1XQSC 4CJKA 4K43A 1U4BA 3LL3A 1VHXA 3D45A 4B8CA 3OJSA 3QEPA 2Z1IA 5C2FA 5EU7A 2HB5A 4WYBA 5AQOA 1IKYA 4JNEA 3NE6A 1U49A 3GOIA 4K25A 3VQAA 5J1EA 3FZKA 3O9RA 5JS2A 3VQ7A 3S9HA 1BA0A 4HTUA 4DU3A 2KQ2A 1RT7A 1TAQA 3AVNA 4NB4A 1DEJA 3LWMA 3KLIA 3WQUA 1C1CA 1HJRA 3OS2A 3JYTA 5AQJA 1RBSA 4A62A 3OYDA 2E6MA 4RTFD 2IVOA 4H8KA 1KFSA 1L5UA 4PWDA 2BH1A 5HBMA 4EZ6A 3O4NA 2VQFK 3I56N 4JI6K 3RMAA 5HRNA 1T8EA 3RSEB 4DFJA 1WBDA 3HT3A 1DKGD 3F9MA 3BEXA 1N36K 3OYNA 2HBMA 4W5TA 1N5YA 1VQON 2HBJA 2HHXA 2CGKA 2O8CA 4OKEA 1LWEA 3C6UA 1GOBA 3EKSA 5M1PA 4CEOA 2FXUA 4JD2B 1BL3A 3K5LA 3SUNA 1VQKN 1XC3A 4E1JA 4ELVA 3DOLA 4DR2K 2BANA 4BC4A 5T7BA 4HTLA 5F0XA 3AA3A 2HNZA 1ATRA 2YHWA 1X9SA 4K42A 1VSMA 3WNHA 3UKRB 4AM6A 5KGWA 4CBUA 4B3TK 5FPEA 4Z4GA 1S1TA 1RBUA 4BR9A 4FL9A 1C0GA 4MLEA 4JN4A 1N6QA 3VQDA 3LDSA 2XHBA 3OYAA 3D7EO 3MEDA 5AQVA 4CK2A 2VGNA 5M1FA 3QEIA 1RNHA 4OKJA 2P9IB 2QK9A 2G8KA 1JLEA 4JLHA 2G8HA 4DB3A 4FWPA 3MCAB 3HOTA 3O3FA 3MXIA 3KLHA 3WXKA 1Q86O 4NYFA 3SI6A 4AHVA 3R3LA 3AV9A 3VESA 2A5XA 4CEZA 1DLOA 5JVHL 1YHQN 5TKYA 5JICA 3KIOA 5FROA 3K59A 4R79A 4DU1A 4LC9B 2PYLA 2FSKA 3OBYA 4CHNA 1VSDA 5AQQA 4CF9A 3CF5L 2P9LA 4FLZA 3FZLA 4CJUA 3CCLN 4I2QA 3A5LC 1NOZA 4DR6K 2VGMA 3VQ6A 3GG4A 1BA1A 4PL7A 3T19A 4M3ZA 4W5QA 2GWJA 1NK0A 4KHUA 5AQLA 4JKGA 4FWQA 1NKEA 4B9SA 3VGLA 1S1XA 3CG7A 4GMJB 5I3UA 4A57A 2GX9A 4DR3K 2WFBA 1WSIA 2Z1JA 2QKBA 1YT3A 1TL3A 3WNGA 4Y1DA 4DLGA 4O0JA 3RWUA 2ZWHA 3AVGA 2E2PA 4KTQA 2OTJN 2WTUA 4H0TB 4YOVA 5J2NA 1YI2N 2D5RA 4RW4A 1IBKK 3Q7CA 4I9LA 4WQ4A 4CGIA 3C7NA 4E0DA 3IUCA 1VQPN 4LFCK 2FBYA 5KI6A 4BRGA 4K0KK 3UKUA 1BI4B 3SV4A 4RW6A 1X9WA 3MAQA 5AR0A 3K9JA 4FLYA 3L2WA 2W42A 4BRAA 4FJJA 3DMJA 4ISFA 3CIPA 3O1WA 4H5VA 1WSEA 4L3QA 5HL7L 1LAVA 5LMUK 4I9QA 4FJ7A 2Q1NA 4CFAA 4CGDA 2DFHA 3ZT1A 4F2RA 1HKCA 4PKIA 1LAWA 4JS4A 3O3HA 3DRRA 2FBTA 1TKTA 1NJXA 2Q0RA 1Q18A 4FOEA 3AGRA 5SZTA 4BRHA 3CFRA 4G9ZA 2KHOA 3P31A 3CC7N 1ATNA 1IJJA 1EQYA 1S5JA 1W97L 3K2PA 4CJLA 1KLNA 3PV8A 4J8FA 1KC8O 4CZMA 4YDUC 3R8EA 2O8FA 1U45A 2P9UB 1NK7A 4CEEA 3KTQA 5IWAK 1IKVA 1DTTA 4JHDB 2ETJA 3D6RA 4DTMA 1RGIA 5AQRA 5AQFA 4QS9A 1SAZA 4JRPA 1NM1A 1T3VA 4BRQA 2O8DB 3KLGA 5AZIB 3CFOA 1T44A 2HHWA 4C8MA 3ZSXA 5GINA 1NJYA 3QIOA 2O8EA 1SZ2A 5K14A 3ENBA 4EHTA 5AQGA 4PQUA 4E7JA 4KFBA 5BR8K 3TTCA 4QAGA 4CFDA 4CK1A 2BTFA 3OYIA 1IBLK 4KH6A 3UKUB 1VQ8N 4FK2A 5EOYA 4IG0A 5AZJB 3HSCA 3QFUA 1D9FA 3ZT4A 4FJMA 2W41A 2A42A 3ZSQA 3E9PA 1WB9A 5KRTA 4BC5A 4B1WB 2F8SA 3E1YA 3C94A 3WQTA 2ASMA 3OYKA 3ATUA 1K6YA 3AAPA 4BRDA 1B92A 5FLXO 2ITMA 4B1YB 2W6KA 4CZKA 4DKWA 4Q5VA 3ID8A 4KHQA 3VTHA 4AILC 3ZX3A 5GADP 1N32K 4LSNA 4EIAA 3V9ZA 1NK8A 2HHQA 1NOYA 2ZD1A 2OYQA 2WONA 3D2EB 3SQ4A 1EWQA 3L4IA 5C0YA 3QEVA 4AH9A 3QIPA 4OGCA 4UQGA 1B9DA 1OVYA 4CE9A 2E20A 3E9LA 3CCEN 4L8RB 3ZCMA 3M8SA 4JK8A 2AA4A 3LP2A 3F2KA 4BVPA 4HUEA 1I39A 3T1AA 4ZTJA 3P1GA 3VTIA 1TKZA 3DYAA 3DI6A 1VQ9N 3THYA 1RT1A 3OYHA 4F9OA 3SV3A 3OHRA 1RBTA 2F9TA 4CF1A 4M3WA 4FYDA 1BWFO 3EYZA 4OKKA 5C25A 2YKNA 3CC2N 3DLBA 1J5OA 3DXMB 3TSPA 4CIGA 5GAEP 2NRTA 2G8FA 4QOZB 3DAWA 3L2UA 5BRDA 2IVNA 5AQZA 5J2PA 1CLQA 3ZSYA 5JLHA 5KPTA 4CF8A 4JK9A 1D5AA 1S3XA 4XH1A 2HHHK 1NNEA 1QQOA 5DM7L 4B08A 2Y1IA 3W3DA 3HP6A 1T6DA 3SQ2A 4Z4IA 2Q0UA 2D0CA 4KHPK 1M1KO 3F5TA 4KTZA 3K5NA 4DQSA 1BQNA 3CM6A 4WQ4C 2YHBA 2G8WA 3SYZA 1KSPA 3ZSRA 1RBVA 5CZ2A 1C1BA 3VQ8A 1KAZA 2F4VK 5FPNA 1DT9A 3ULDA 4FLTA 4FSVA 4Y0WA 2OPRA 1XWLA 5B8HA 3DLKA 3LAKA 4DQQA 1U2VA 3WXIA 1ASWA 1O13A 2UYTA 2FSNA 1UWBA 5J2QA 4B1VA 5GAGP 4N5SA 2P9PB 1KVCA 3NMUA 1QE1A 3HO1A 4AHRA 3NFAA 4JKAA 2OCEA 3P38A 1EXQA 2GV9A 4W5RA 3RRHA 1YJWN 4Z4FA 2HF3A 1FXXA 1LWCA 1YUWA 4DV2K 4CJWA 1GLDG 2GBZA 1TUUA 2P9NB 2EX3A 1ILYA 1REVA 1BU6O 1ESVA 1OVQA 3SBGA 1TV6A 1S9GA 2Q36A 3VEXA 1EP4A 4WE1A 4CZIA 5KPRA 3LPUA 3ZETA 4DSFA 3V81A 1N33K 1RT4A 2AP1A 1JKHA 4BWMA 1TK8A 3M8PA 4BRKA 4YOWA 1YIJN 3HBTA 4FLXA 1S1WA 3P83D 4JI5K 4H5WA 2OTLN 3DXKA 2X74A 3L2VA 4EP4A 4WFBL 3EL2A 1NBWA 3U4LA 4KAZA 1QVFM 3OYFA 2YNHA 4HCBA 1NGDA 3UIQA 1YAGA 4F8RA 2HW3A 3VERA 1YVUA 1TUYA 2KKZA 4Z0UA 2GUIA 4N47A 5CYQA 3CJAA 5AZJA 3L2RA 3LP1A 2YI1A 2HF4A 4CGJA 3ALYA 4E89A 1ZBFA 3THVA 5JVGL 3U3GA 3CCUN 3IG1A 1TVRA 3AARA 3VQCA 3LANA 3H46O 3VQBA 3MDQA 3G6EN 3DRPA 1QSYA 2F7TA 1C0MA 1R59O 3NF6A 1TGOA 1L3SA 4DTSA 1J5EK 2IC3A 3HOSA 4BDPA 4LFBK 1DGKN 1Z05A 2HMIA 2O8DA 1OH5A 4FO0A 5C15A 4OO1J 4N56A 5BRHA 3VA3A 5KTQA 3QDKA 3PIPL 1BGXT 1RTHA 2Q97A 3SUOA 2Q3SA 3AO2A 1Z25A 3D2FA 3IKMA 4AHSA 3VGKA 4MO5A 2O8BB 3KHYA 4DQIA 1TYQB 1S6PA 3CQYA 3Q7BA 4M3XA 4OPHA 3NH0A 5BRFA 1P8ZA 2ASPA 1YJNN 1XNRK 3EN9A 1HPMA 2KFNA 3LDNA 3QEXA 4U67L 4JKFA 3HVRA 5CY4A 3J7ZO 3NVKA 2IS3A 1OH6A 1WSHA 1KVBA 5BPMA 5KGXA 1FKOA 2OZSA 4HVJA 1UOCA 4FJ5A 3KK3A 3RMCA 4CHYA 4FJLA 1KVAA 4CBWA 4E7IA 4FM0A 2P9SA 4B8AB 1KCFA 3QETA 4KBOA 3D0PA 3JAMO 3VEVA 4CECA 4OJRA 1K8AO 5JS1A 1W9HA 2I5JA 1JLFA 3FZHA 4CEAA 4KPYA 4DTOA 3ZSOA 2ITGA 4BR7A 1RT6A 1X9MA 3OY9A 4GV3A 3WT0A 3MN5A 3QNOA 3JS6A 3THXB 3F73A 4DSJA 1KAYA 3WNFA 3MN9A 4NYNA 1ZBIA 4DQPA 1NMNA 4YOUA 4CHOA 3AA4A 3ULEA 4M42A 4B9LA 4FWOA 2D0AA 4M7YA 5ADXH 4B9TA 5IT9O 1NK5A 4JRQA 3OYLA 3WXMB 3VQ4A 2W40A 2YNIA 4YHHK 3ENOA 3GL1A 5GIPA 2AJQA 4XIUA 3R1XA 3KKSA 5BR9A 1TK0A 2VG6A 4CEBA 1VSFA 3QB0A 1NWKA 3AVIA 3CCJN 3TTFA 3LM9A 4CHQA 4BE0A 3PX6A 3ZEUB 4BROA 4FWMA 3BF3A 3U9ZA 3HK2A 2GUPA 3WXLA 1SKRA 4B1ZA 4E7LA 1V4SA 3IMXA 1K73O 1S6QA 4BR4A 4M3UA 4IZ9A 2DTUA 4FPAA 1BCMA 3FZFA 1FKPA 3CXCM 4B9NA 3CCQN 1K9MO 1Q81O 1VSIA 4BC3A 4KI6A 4JI1K 3WUHA 3VQQA 4AHCA 4HHTA 2IAJA 3NF8A 1HMVA 3PX0A 3J80O 5BREA 3A5MC 3V9WA 2Z1HA 4CBXA 5FRNA 2RF2A 3B8AX 2HHUA 4H0YB 4KHNA 1WAJA 3MCPA 3A8YA 4MO4A 2A3ZA 3AVMA 4NXMK 1MA9B 1T6CA 1A5VA 3HJFA 1QSSA 4GVEA 4LFAK 1MWKA 2HOEA 3SNNA 3O3GA 3CHWA 1RDUA 2A1RA 1HQEA 1SL2A 3RVCA 4FVUA 4YY3K 4BG9A 2F9WA 4DTJA 1XUPO 4CHZA 1Q9YA 4OLBA 3SPZA 2FF6A 3PX4A 3J7AP 4JKEA 5MLCQ 2HVHA 4DR1K 3UE5A 1ATSA 5DM6L 4DFKA 4FK4A 2F8TA 4PKHA 3CMAN 4FLVA 3SJJA 1VQMN 4YOYA 2OZMA 5SWMA 4DSKA 4M3TA 4FVMA 4KH4A 4DQRA 1VSHA 3HXMA 4FCYA 4E7KA 3GBTA 1WBBA 2P51A 4BRNA 4CD3A 4YNQA 3O08A 1Z6RA 2P9NA 4NCAA 2NRWA 5AQSA 3MEEA 4CJEA 4H0PA 3R6MA 3AGKA 3AVLA 2IGIA 5KPZA 4Y1CA 3A2FA 3BGRA 3WEEA 5AQNA 4NLCA 3CJ9A 1ZBUA 4KHWA 2IIRA 3U8XA 3ZSZA 1TYQA 3SK3A 4FJKA 4Z4CA 1WUAA 3O9QA 3LDOA 1M90O 2KW4A 2D4WA 4E7HA 4FPBA 3I0RA 3O1BA 3CM5A 4KTWA 3I8BA 2QXFA 4IWVA 4CJFA 4X66K 4WQ5C 1NK9A 4FLWA 4DTPA 3EE8A 4I2PA 1OH8A 1RTJA 2HSTA 4BRFA 1ZBLA 2PAVA 4CZLA 3QBXA 2XY7A 4KB0A 4CESA 4C8LA 3LP3A 2IDOA 2DFEA 1K8KB 4DV6K 1E3MA 1NGBA 4MDBA 3BDPA 1QQMA 3LDPA 3ISNC 1GLEG 3SUQA 3D2FB 4LF8K 1XNQK 4AHUA 3MECA 1HX1A 4ID1A 3H08A 4OPJA 1L3VA 4R5PA 3KWIA 3L8BA 2QA4N 4O5BA 4O5FA 4H4MA 4OPAA 4OPKA 4JV5K 3QEWA 1UAXA 2PZSA 4FM2A 3DXMA 3FFKB 3QFPA 1KTQA 2BGGA 3IDHA 2J4RA 5LY3A 3TU5A 2ZQBA 3THYB 3SBTA 4C8NA 4BGBA 5C24A 1SL0A 3MXMA 3CD6N 1VSEA 5DK5A 3RMDA 3H3OB 3ITHA 4G1QA 2XY8A 1NGFA 4HCCA 3HPHA 1W0HA 3AVHA 1Q8IA 1HKGA 2FLOA 3QMLA 3PUFA 4DF4A 4DCHA 4GNIA 2XY6A 3IS9A 5AFUA 3G0ZA 3PIOL 5LL6Z 2E4LA 2QWPA 1XHXA 4LF6K 1NJIO 4JKDA 3HL8A 5M1OA 4WF9L 2EWSA 3VEYA 2HBLA 1S1VA 2YHYA 3AA5X 3NCIA 3ASMA 3KKRA 1TKXA 2QWLA 1X1PA 1XC9A 1G99A 3OBWA 4C8OA 1QZ6A 3VEWA 2HNDA 4H5NA 4JI4K 1U04A 3HSTB 3VN5A 1IV0A 2XY5A 1EKEA 4DV1K 2KLAA 4K8XA 3V1RA 4JKBA 2P9KA 3LZIA 3I33A 1X3MA 2P9PA 1HKBA 2UXDK 4B1UB 3TI0A 4KKOA 1TK5A 3L3VA 1P90A 3H1VX 1SL1A 1CXQA 3DJCA 1ASVA 1HJOA 3G25A 4B3SK 4BG8A 1RT3A 4PUOA 5EXWA 1QZ5A 4DTRA 4ELTA 1BIUA 3BP8A 3H1QA 1SKWA 3WXJA 1K8KA 1SUQA 1NKBA 3P4IA 2YV0X 2O8EB 2ZGYA 2UUCK 1JL1A 3TR8A 4DSEA 4N76A 4M45A 1GLAG 5AQKA 3PO4A 2A1SA 5A2QO 3IFRA 4EZ9A 3LDLA 3EZ5A 3OTOK 2CH5A 2B6AA 3KK2A 4JHDA 1NJWA 3TAEA 2GELA 1A5XA 1U6ZA 4DFPA 4FWNA 1BIZA 4BC2A 2VG7A 3VQ9A 4ILGB 1IKXA 3L4QA 2BE2A 1RDDA 4BREA 3V4IA 3L3UA 5GIOA 3WEEB 2GTDA 1C6VA 4IDHA 1EWRA 3ZLJA 4KV8A 2G8VA 5AQMA 4B9QA 4CEFA 4ILJA 2D0BA 3HTVA 1Y97A 5FRMA 2XRIA 3P5JA 3CCMN 1J9AA 3VETA 3TAQA 4IFEA 4CEQA 1WSGA 3TSUA 1NGEA 5AJ3K 1VK0A 2NUBA 2IVPA 2FC0A 5HLFA 4KRFA 2HHTA 3AO3A 4CJVA 4CZGA 5CHIA 2I7PA 4OLAA 2GEMA 4CJQA 3MWPA 2RPIA 1HYZA 2QWOA 3ZT0A 4CJTA 3CCVN 1J54A 4YORA 4MQ3A 4FJ8A 1D4XA 3AO5A 4A59A 5AQPA 3V9SA 2Y1JA 1HNVA 2B5JA 2KZZA 3CPEA 2B4JA 1HUXA 4JKHA 1TL1A 1EETA 3E01A 3J7YP 1EO1A 1X3NA 4KO0A 4QS8A 3VA0A 1GLCG 3KLEA 3WNEA 1UA1A 1B9FA 4CCHA 1HNZK 3H45C 2QEXN 1BG3A 4CGHA 3AA2A 3RMBA 1S9EA 4DMNA 4NXNK 3JXUA 3M8RA 2RHKA 4KH5A 3N4PA 3CI5A 2IOCA 3VEOA 3CETA 1N8RO 2FSJA 1NJZA 2A41A 3HYFA 4EFHA 2FF3B 3L6QA 2YX6A 3W0LA 2NNWA 4CJ4A 3A5NC 2QM1A 5FDLA 4A61A 4DV3K 3KD1E 1RCHA 1KQSM 4M63C 4E1NA 2CGLA 4DU4A 1BOTO 3HP9A 4FM1A 3UB5A 3U6FA 4FLUA 3B6PA 1NK6A 3PO5A 3O9SA 1KD1O 1LCUA 5LJWA 2VCPA 3KK7A 2RN2A 4DG1A 4EP5A 4JKCA 2NLXA 3AVFA 3M1FA 1VSJA 3IRXA 1T05A 3EZWA 3PLAA 3G10A 2OPSA 1XMQK 1HNXK 1Z26A 3GE1A 3E66A 1HNIA 1RT5A 4RWTA 3OS0A 2E2QA 3PY8A 3VOVA 3VQEA 2GWKA 2HHSA 1QQCA 4BVOA 1HYVA 1E4GT 4JS5A 3AVAA 2PFUA 3VF2A 2O4GA 4ZTFA 4O8KA 1WAFA 3ID6A 4QS7A 4DTUA 4FWLA 4JEPA 4BE1A 2KFZA 3AO1A 1NK4A 2HVIA 4JI7K 2PBDA 5AQYA 3SCXA 3OS1A 1CZBA 2G8IA 3LP0A 3CJ1A 1NGAA 3TSQA 1NGIA 3B6OA 1U48A 3T69A 4V19S 4AHTA 1IG9A 1KXPA 4JK7A 1XMOK 2X6NA 1BUPA 3QICA 1YXQA 4WFNL 4BRMA 2YNFA 3QESA 4DQ8A 4AM7A 2E1ZA 4FJ9A 4KI4A 3SAGA 3CJBA 4I6MB 3THXA 2D1KA 3DLRA 4IOCL 1VQ4N 1C0TA 3AVKA 4H0OA 4ISEA 1XHZA 1Q9XA 4IDKA 1NGGA 3VEZA 4K41A 3ZYYX 2ZJQL 1QVGM 1Q82O 1BO5O 3RSEA 3HVTA 1LV5A 1YTAA 4CZHA 2WOMA 4CF0A 1U47A 4H0VB 3HM8A 1VQ5N 4BGAA 1VAZA 2P9SB 4DF8A 2JWKA 4FJHA 3EKUA 1YVNA 4ID5A 3KVGA 3K5MA 4CJ5A 2QTDA 4BRCA 2ZJRL 3T1HK 3O9UA 1C0FA 2ZF5O 4M41A 1X9JA 4HWIA 5HP1A 3O8MA 3N4QA 4XH5A 3VQPA 5ELZA 3OVNA 4FWKA 4DWIA 1KAXA 2E8AA 1RDCA 2X78A 3NBPA 1JLGA 4O55A 4IXCA 4A2BA 4H0XB 5BN9A 3VMFB 3VF6A 2FBXA 1LW2A 3I8DA 1GLJO 3A5OC 4BR0A 4BE2A 4FWRA 4QCLA 1BISA 4E1MA 2RE2A 1NGCA 3VENA 1GOAA 2D0OA 1JLCA 1QQNA 3O4QA 4DS5A 3LZJA 4WQ5A 2VWKA 2UU9K 4B3RK 4GV6A 2A6AA 4WFAL 1V4TA 4YOXA 1IH7A 3SJHA 4DS4A 4IOXA 3O6WA 3O80A 3AY9A 3ULEB 2HHVA 3NGZA 2QWNA 1QS4A 3RR7A 3NVMA 4JD2A 1VSKA 4DUZK 4F2SA 1RDBA 3MX5A 3M6GA 5J2MA 3SQ1A 4B3OA 1VRUA 4DV4K 5LJVA 3QLHA 4CF2A 2YKMA 4DV7K 4HUGA 4IOAL 4NCBA 1BCOA 1G15A 1WSJA 2XO7A 4NO7A 1RILA 3J8AA 3DXKB 4JI8K 4EHUA 4PHTX 2HBKA 5H1SQ 3ENHA 2VG5A 3LALA 4LH5A 2VWJA 3AVCA 1CZ9A 3ZETB 4ICLA 1SS6A 3KJVA 4DUYK 3DLEA 5FPDA 5I9EB 1R0AA 3NGYA 4CJ7A 4BDZA 2CH6A 3T7ZA 1TKDA 2O8CB 3T1YK 1JCGA 3PSIA 4FXDA 3RR8A 4ZHRA 4J2DA 5C42A 2ZJPL 3OW2M 4IO8A 2OPQA 1Q7YO 4I7FA 2WBNA 1NG9A 5F2RA 4GKKK 5AFUH 1ASUA 4OGEA 4OX9K 1GLFO 5C12A 4X62K 5HRPA 3ZSWA 4CI6A 2O8BA 3K57A 4LY7A 1U2VB 1WNSA 3CYMA 3QNNA 3C6TA 4CIFA 3MWTA 5E26A 4F3OA 4H5RA 2ZGZA 4FOIA 3SMPA 3S3OA 1ZBHA 1LW0A 3DLHA 3THWA 4FJXA 1ZYQA 3OYEA 1L3UA 3K5OA 1FW6A 1CXUA 1QHTA 1W2BM 4PKGA 2Q2RA 4CK3A 3MN7A 4IBNA 1QTMA 4K8ZA 4IG3A 4DTNA 3QINA 1HR0K 4FZXC 3CC4N 3QO9A 4DHYA 4Z4EA 3K9KA 5M1NA 1HQUA 2YCHA 4JI3K 3CCRN 1D9DA 4DV5K 4Q0BA 5E84A 1HRHA 2QI2A 2PYJA 3I55N 4YOTA 1YJ9N 1D8YA 3BZKA 1JL2A 2G8UA 3DRSA 3LM2A 3MX2A 2P9KB 4B1XB 1C0UA 1WN7A 4C1NI 4HUFA 1IG8A 1YF5L 3KWGA 4JYAK 1TAUA 2D0PA 2DPNA 1J6ZA 1GOCA 1KFDA 4AQYK 5LMNK 3D2EA 5AQIA 3BZCA 3DLLL 2H3GX 1NGJA 4M7XA 2E5LK 4LSLA 1T03A 2JGUA 4CFCA 2WC9A 4F3TA 2ZM6K 3U9DA 2NRRA 3K0SA 3AO4A 3H6EA 2V7ZA 4DR7K 3CCSN 3GDQA 5HOOA 1W7AA 3OYMA 4GV9A 4CERA 3ATVA 4DR4K 4FW1A 3U3YA 4OVLA 1SV5A 5CYMA 5C10A 1QSLA 4IFVA 4CJRA 4O0IA 2UXCK 5HROA 2V51B 3A0IX 3BUZB 4MFBA 1I94K 3IAYA 3C65A 3M3ZA 4EAHD 4BDYA 4CZEA 5AQWA 2YHXA 4CJSA 4FJGA 4JI0K 5FPMA 4CIEA 3TAPA 3CJ7A 4A2AA 5EVZA 2QXLA 3HM9A 1IBMK 4YFUA 2NRVA 1S22A 3NH2A 3TABA 4BQLA 3O9TA 5TKWA 3G4SN 4E3SA 3LAMA 4I6MA 3SLCA 1HLUA 1EX4A 1NMDA 4U7BA 3DOKA 3S3NA 4M3YA 1RDAA 3OYJA 2VWBA 3LPTA 5AZIA 3OYGA 3TARA 4CVNE 4IJNA 2BUPA 3ZX0A 3NDKA 4CD1A 2RKIA 3SQ0A 3DWLA 3T3FA 3MMVA 4NLBA 2YJFA 5HRSA 1IO2A 2O8FB 3TANA 1ITGA 4JAXA 1BDGA 3CFPA 1J53A 4B3MK 3ZX2A 2NRXA 1VQLN 3BY5A 1VQ6N 3C6HA 1VQ7N 4BRIA 4GKJK 2UXBK 1RTIA 4CJ3A 2E2OA 1SKSA 4O44A 3V6DA 4KREA 4BR2A 1JCEA 1JCFA 4C8KA 4IEEA 3RTVA 3AAQA 4ISGA 3CPWM 1S72N 1NU0A 1VSLA 3ZT3A 2JWLA 3TWHA 4DTXA 2P9UA 1VRTA 2V52B 4LF7K 2P1JA 3L0QA 4C1NK 2E6LA 2O4IA 3KD5E 1WLJA 5DMRA 3EEQA 4TSXA 3CQ8A 4RW8A 4H03B 2UUBK
chains in the Genus database with same CATH topology
1TL3A 2D0AA 4FM1A 4B9TA 3U6FA 4FLUA 2OA8A 3B6PA 3WNGA 5KRSA 4Y1DA 4DLGA 4O0JA 1NK5A 4JRQA 1NK6A 3OYLA 3PO5A 3RWUA 2YHAA 3VQ4A 2YNIA 3AVGA 2RN2A 4DG1A 4EP5A 4KTQA 3V1OA 4DFMA 3TAFA 2AJQA 3AVFA 4XIUA 3KKSA 1TK0A 1VSJA 3IRXA 2VG6A 4CEBA 3HPOA 2D5RA 1VSFA 3G10A 4RW4A 2OPSA 5J2NA 4E0DA 4I9LA 4CGIA 3AVIA 1BI4A 3NHGA 4IKFA 4CHQA 4BE0A 3PX6A 3LWLA 4KHSA 2FBYA 5KI6A 3L2QA 4B9VA 1Z26A 3V9UA 3HK2A 1BI4B 1SKRA 3SV4A 4KB1A 4RW6A 1HNIA 1RT5A 3NGIA 4LD0A 3MAQA 4E7LA 1X9WA 4ELUA 4F4KA 3OS0A 3PY8A 4FLYA 1S6QA 1RT2A 3VQEA 4M3UA 2HHSA 2DTUA 2Z1GA 1QQCA 3L2WA 1O1WA 2W42A 4RW7A 1BCMA 1HYVA 4FJJA 1FKPA 3DMJA 4JS5A 3AVAA 3FFIA 1WSEA 2O4GA 4ZTFA 4CJPA 1VSIA 4B9NA 1WAFA 4DTUA 1L3TA 4KI6A 3VQQA 4BE1A 2KFZA 1LAVA 4AHCA 3AO1A 1NK4A 4I9QA 4FJ7A 2HVIA 4FZYA 4CFAA 4HHTA 3ZSVA 2IAJA 1FK9A 2DFHA 3ZT1A 4CGDA 3SCXA 3OS1A 1CZBA 3NF8A 1HMVA 3V9XA 4F2RA 3ZT2A 3LP0A 3NF7A 3PX0A 2ATQA 3V9WA 1LAWA 1F21A 4CHPA 4JS4A 2Z1HA 3O3HA 4FJNA 3DRRA 4B9MA 5FRNA 3RRGA 2RF2A 2FBTA 4RG8A 2HHUA 1TKTA 3B6OA 1U48A 1NJXA 4Z4HA 3MEGA 1WAJA 4KHNA 4AHTA 1BHLA 3AVMA 4J2EA 5SZTA 3CFRA 4PY5A 1IG9A 2OPPA 2X6SA 1A5VA 4CEDA 3HJFA 1QSSA 2X6NA 1S5JA 3SNNA 2YNFA 4M3RA 2R7YA 3O3GA 2ZE2A 3K2PA 3QESA 4CJLA 2JLEA 2A1RA 1HQEA 2QKKA 1SL2A 3PV8A 1KLNA 4FJ9A 4KI4A 1RTDA 4B9UA 3DLRA 1U45A 1C0TA 1NK7A 4CEEA 4DTJA 3AVKA 1XHZA 1Q9XA 3KTQA 3AVBA 4O4GA 4CHZA 1IKVA 1DTTA 4IDKA 2KZMA 4J2AA 2ETJA 1Q9YA 4DTMA 4OLBA 3SZ2A 3SPZA 4JRPA 3K58A 3PX4A 3KLGA 2HVHA 3OJUA 3CFOA 1IKWA 2HHWA 4DLEA 4C8MA 4FJIA 3HVTA 3ZSXA 4E19A 1LV5A 1YTAA 1NJYA 3KK1A 4DFKA 4FK4A 3QIOA 2F8TA 2WOMA 4W5NA 4CF0A 1U47A 5K14A 5CZ1A 4FLVA 3SJJA 4PQUA 2OZMA 4E7JA 4KFBA 4PA1A 5SWMA 4DF8A 4DSKA 4M3TA 1JLQA 4QAGA 4FVMA 4CFDA 4CK1A 4DQRA 1VSHA 3OYIA 1WSFA 3HXMA 4FCYA 4E7KA 4NCGA 4FJHA 4FK2A 2P51A 3TAGA 4ID5A 3K5MA 3C95A 3NF9A 4IG0A 4CJ5A 3EY1A 2YNGA 4IFYA 4YNQA 3OYCA 1D9FA 4NCAA 3ZT4A 4LH4A 4FJMA 3MEEA 3ZSQA 4M41A 3V1QA 4CJEA 4H4OA 3JSMA 3AVLA 2IGIA 5KRTA 4Y1CA 1DTQA 2FBVA 3A2FA 5HP1A 3BGRA 2F8SA 3VQPA 3S3MA 3OVNA 3C94A 4DWIA 3NBPA 1HPZA 1RDCA 2X78A 4BACA 1T7PA 3OYKA 1KLMA 1ZBUA 4KHWA 1JLGA 3ZSZA 4O55A 1K6YA 4FJKA 1XI1A 4Z4CA 1HYSA 2FBXA 1A5WA 1B92A 1LW2A 2F96A 4GW6A 2KW4A 3KLFA 4RW9A 3I8DA 4W5OA 4Q5VA 4BE2A 4E7HA 3I0RA 4QCLA 1BISA 1JXEA 4E1MA 3CM5A 4KTWA 4KHQA 4AILC 2QXFA 4GVMA 4LSNA 3V9ZA 1T05A 4CGFA 1NK8A 4J2BA 2HHQA 1GOAA 4CJFA 1NK9A 1NOYA 4FLWA 1JLCA 4DTPA 2ZD1A 4I2PA 3O4QA 4DS5A 2OYQA 3LZJA 2WONA 3OYBA 4BWJA 1RTJA 3SQ4A 2VWKA 3QEVA 4AH9A 1ZBLA 2XY7A 4KB0A 1I3AA 4CESA 4C8LA 3QIPA 3LP3A 4OGCA 2IDOA 2DFEA 3I0SA 4UQGA 1B9DA 2P5GA 4CE9A 4KHYA 3F9KA 4FK0A 1IH7A 2QKBA 3BDPA 2DFFA 4DS4A 4DSLA 2HHVA 3ISNC 5E41A 3NGZA 3ZCMA 4L8RB 1MU2A 3SUQA 3M8SA 4AHUA 1QS4A 3LP2A 3MECA 4ID1A 3RR7A 3H08A 1VSKA 4OPJA 1RDBA 4HUEA 1I39A 4R5PA 3T1AA 3L8BA 4ZTJA 1L3VA 4F2SA 3P1GA 1TKZA 5J2MA 4O5BA 3NAEA 3SQ1A 1VRUA 4H4MA 4B3OA 3DYAA 3QLHA 4CF2A 3DI6A 4OPKA 2YKMA 3QEWA 1UAXA 1UA0A 2PZSA 2EHGA 4FM2A 4HUGA 3DM2A 1RT1A 1JLBA 1BCOA 3OYHA 4NCBA 1G15A 1KTQA 1WSJA 3SV3A 1RBTA 3NH1A 2XO7A 1C1AA 1RILA 1JXBA 4CF1A 2BGGA 4M3WA 4FYDA 3VQ5A 3EYZA 4OKKA 5C25A 2YKNA 3MXJA 3DLBA 2VG5A 2ZQBA 3LALA 4LH5A 2VWJA 5I42A 1J5OA 2BDPA 4CIGA 4QOZB 2G8FA 2LSNA 4C8NA 1JLAA 3AVCA 3L2UA 1CZ9A 1KRPA 4ICLA 5C24A 5J2PA 1SL0A 1CLQA 3ZSYA 1RBRA 4CF8A 3KJVA 3MXMA 1VSEA 3DLEA 5DK5A 3RMDA 2DY4A 1D5AA 1R0AA 3NGYA 4BDZA 1S1UA 3ITHA 4G1QA 4B08A 2Y1IA 2XY8A 1TKDA 3SUPA 3HP6A 4FZZA 4FXDA 3SQ2A 4HCCA 5HRRA 3RR8A 4N41A 4ZHRA 4Z4IA 3HPHA 1W0HA 4J2DA 5C42A 3AVHA 2D0CA 1Q8IA 2P5OA 3PUFA 4DF4A 2XY6A 2OPQA 4I7FA 4KTZA 2PY5A 3IS9A 3K5NA 4DQSA 1BQNA 3CM6A 2YHBA 3G0ZA 1ASUA 4OGEA 3SYZA 2G8WA 4CGGA 3ZSRA 1KSPA 2E4LA 2KTQA 1NKCA 1RBVA 1XHXA 2HNYA 3TAMA 5CZ2A 5HRPA 1C1BA 3VQ8A 3ZSWA 4CFBA 3HL8A 3K57A 4LY7A 3ULDA 4FLTA 1WNSA 3CYMA 3QERA 2OZSA 4DSIA 3QNNA 1YTUA 3DLGA 3C6TA 4CIFA 1LWFA 3HPGA 2OPRA 4F3OA 1BQMA 3S3OA 1S1VA 3M8QA 1LW0A 3DLHA 4FJXA 1ZBHA 1XWLA 1ZYQA 3AA5X 3AVJA 3DLKA 4FW2A 3ASMA 3KKRA 1TKXA 3LAKA 3OYEA 3NCIA 4DQQA 5D3GA 1L3UA 3K5OA 1X1PA 1ASWA 1XC9A 4CJKA 1UWBA 1CXUA 1U4BA 4C8OA 1QHTA 5J2QA 2HNDA 3D45A 4B8CA 1U04A 4N5SA 3OJSA 2Z1IA 4CK3A 1KVCA 3HSTB 3QEPA 5EU7A 3VN5A 1QE1A 2XY5A 4IBNA 3HO1A 4AHRA 2HB5A 1QTMA 1EKEA 4K8ZA 1IKYA 3NFAA 4IG3A 3NE6A 3QINA 4DTNA 1U49A 4FZXC 4K8XA 1EXQA 2GV9A 3V1RA 4W5RA 3QO9A 3RRHA 4Z4FA 4Z4EA 3VQAA 5J1EA 3LZIA 1FXXA 5JS2A 1HQUA 1LWCA 3VQ7A 3S9HA 4CJWA 1D9DA 2GBZA 4HTUA 3TI0A 2EX3A 4Q0BA 4KKOA 1REVA 2KQ2A 3L3VA 4DU3A 1TK5A 1HRHA 1TV6A 1S9GA 2PYJA 1RT7A 2G8IA 1TAQA 1SL1A 3AVNA 1CXQA 1EP4A 1ASVA 4WE1A 4DSFA 3LPUA 3LWMA 3V81A 1D8YA 1RT4A 1JL2A 3KLIA 1C1CA 2G8UA 1HJRA 1RT3A 3DRSA 3OS2A 4PUOA 1JKHA 4BWMA 1TK8A 4DTRA 3JYTA 4ELTA 3M8PA 1RBSA 3OYDA 2E6MA 4H8KA 1BIUA 1C0UA 1S1WA 1WN7A 4HUFA 4FLXA 3P83D 1L5UA 1SKWA 1KFSA 4PWDA 5HBMA 1TAUA 4EZ6A 2X74A 3O4NA 1SUQA 1NKBA 2YV0X 3L2VA 1GOCA 3RMAA 1KFDA 4EP4A 5HRNA 1JL1A 3TR8A 4DSEA 1T8EA 4KAZA 4N76A 4DFJA 4M45A 3PO4A 3HT3A 3OYFA 2YNHA 2A1SA 4HCBA 3UIQA 4F8RA 2Y1JA 2HW3A 4EZ9A 3OYNA 1YVUA 3EZ5A 4LSLA 4W5TA 1T03A 1N5YA 2JGUA 2B6AA 4CFCA 2HHXA 4Z0UA 2KZZA 2GUIA 3KK2A 1NJWA 3TAEA 4OKEA 1A5XA 4F3TA 4N47A 5CYQA 4DFPA 1LWEA 3L2RA 3AO4A 1BIZA 3C6UA 1GOBA 3LP1A 2VG7A 3VQ9A 4CEOA 1IKXA 3ALYA 4CGJA 4E89A 2BE2A 1RDDA 1ZBFA 3THVA 1BL3A 3K5LA 3V4IA 3U3GA 3OYMA 3SUNA 3IG1A 1TVRA 3L3UA 3SPYA 3VQCA 3LANA 4CERA 4ELVA 3VQBA 4FW1A 3DOLA 3U3YA 2BANA 4OVLA 3DRPA 1QSYA 5T7BA 1SV5A 1C0MA 5CYMA 1QSLA 4IFVA 3AA3A 4CJRA 1C6VA 2HNZA 4O0IA 3NF6A 5HROA 1X9SA 1TGOA 1L3SA 4DTSA 4M42A 1VSMA 3WNHA 4KV8A 4MFBA 2IC3A 2G8VA 3IAYA 4BDPA 4CEFA 5KGWA 4BDYA 2D0BA 2HMIA 1S1TA 4FJGA 1Y97A 1RBUA 4CJSA 5FRMA 4Z4GA 4CIEA 3TAPA 2XRIA 4N56A 3HM9A 3VA3A 5KTQA 3P5JA 1N6QA 3VQDA 1BGXT 1RTHA 4YFUA 3LDSA 1J9AA 3SUOA 3NH2A 2Q3SA 3AO2A 2XHBA 3TABA 3TAQA 1Z25A 3OYAA 1WSGA 4CEQA 3MEDA 4AHSA 1VK0A 4E3SA 4CK2A 3LAMA 3QEIA 1RNHA 4OKJA 1EX4A 4DQIA 1S6PA 2NUBA 2FC0A 3DOKA 5HLFA 2QK9A 3S3NA 4KRFA 2G8KA 4M3XA 4M3YA 2HHTA 1JLEA 4JLHA 1RDAA 3NH0A 2G8HA 3AO3A 3OYJA 4CJVA 3LPTA 3O3FA 3MXIA 3OYGA 3KLHA 3TARA 4NYFA 4OLAA 3SI6A 2KFNA 4AHVA 4CJQA 3AV9A 3QEXA 3NDKA 2RPIA 3HVRA 1HYZA 3ZT0A 4CJTA 5CY4A 2RKIA 3SQ0A 1J54A 4MQ3A 4CEZA 4FJ8A 3T3FA 2IS3A 3AO5A 1DLOA 1WSHA 1KVBA 5KGXA 3V9SA 1FKOA 3KIOA 5FROA 1HNVA 4HVJA 5HRSA 1UOCA 1IO2A 2B5JA 3KK3A 2B4JA 3K59A 3RMCA 4CHYA 1ITGA 3TANA 1KVAA 4FJ5A 1TL1A 1EETA 3E01A 4DU1A 4E7IA 4FJLA 4KO0A 3CFPA 1J53A 4FM0A 2PYLA 4CHOA 3VA0A 4CHNA 4B8AB 1VSDA 4CF9A 3KLEA 1KCFA 3WNEA 1B9FA 1UA1A 4CCHA 3QETA 3D0PA 1RTIA 4CJ3A 4CGHA 3AA2A 4CECA 4CJUA 4FLZA 3RMBA 4I2QA 4OJRA 1SKSA 4O44A 1NOZA 1S9EA 4DMNA 3V6DA 4KREA 3M8RA 5JS1A 3VQ6A 1W9HA 2I5JA 4C8KA 1JLFA 3RTVA 2IOCA 4CEAA 4KPYA 4DTOA 2ITGA 3HYFA 3T19A 3ZSOA 1NJZA 4W5QA 4M3ZA 1VSLA 1RT6A 3ZT3A 1X9MA 3OY9A 3TWHA 1NK0A 4DTXA 4KHUA 3QNOA 4CJ4A 1VRTA 2P1JA 3F73A 1NKEA 4DSJA 2E6LA 5FDLA 4B9SA 2O4IA 3KD5E 1S1XA 3WNFA 3KD1E 3CG7A 4NYNA 4GMJB 5I3UA 4DQPA 1ZBIA 1WLJA 1RCHA 5DMRA 4TSXA 4E1NA 2Z1JA 1WSIA 3CQ8A 3AA4A 4RW8A 4DU4A 4B9LA 3HP9A 1YT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TL3 A;  2D0A A;  4FM1 A;  4B9T A;  3U6F A;  4FLU A;  2OA8 A;  3B6P A;  3WNG A;  5KRS A;  4Y1D A;  4DLG A;  4O0J A;  1NK5 A;  4JRQ A;  1NK6 A;  3OYL A;  3PO5 A;  3RWU A;  2YHA A;  3VQ4 A;  2YNI A;  3AVG A;  2RN2 A;  4DG1 A;  4EP5 A;  4KTQ A;  3V1O A;  4DFM A;  3TAF A;  2AJQ A;  3AVF A;  4XIU A;  3KKS A;  1TK0 A;  1VSJ A;  3IRX A;  2VG6 A;  4CEB A;  3HPO A;  2D5R A;  1VSF A;  3G10 A;  4RW4 A;  2OPS A;  5J2N A;  4E0D A;  4I9L A;  4CGI A;  3AVI A;  1BI4 A;  3NHG A;  4IKF A;  4CHQ A;  4BE0 A;  3PX6 A;  3LWL A;  4KHS A;  2FBY A;  5KI6 A;  3L2Q A;  4B9V A;  1Z26 A;  3V9U A;  3HK2 A;  1BI4 B;  1SKR A;  3SV4 A;  4KB1 A;  4RW6 A;  1HNI A;  1RT5 A;  3NGI A;  4LD0 A;  3MAQ A;  4E7L A;  1X9W A;  4ELU A;  4F4K A;  3OS0 A;  3PY8 A;  4FLY A;  1S6Q A;  1RT2 A;  3VQE A;  4M3U A;  2HHS A;  2DTU A;  2Z1G A;  1QQC A;  3L2W A;  1O1W A;  2W42 A;  4RW7 A;  1BCM A;  1HYV A;  4FJJ A;  1FKP A;  3DMJ A;  4JS5 A;  3AVA A;  3FFI A;  1WSE A;  2O4G A;  4ZTF A;  4CJP A;  1VSI A;  4B9N A;  1WAF A;  4DTU A;  1L3T A;  4KI6 A;  3VQQ A;  4BE1 A;  2KFZ A;  1LAV A;  4AHC A;  3AO1 A;  1NK4 A;  4I9Q A;  4FJ7 A;  2HVI A;  4FZY A;  4CFA A;  4HHT A;  3ZSV A;  2IAJ A;  1FK9 A;  2DFH A;  3ZT1 A;  4CGD A;  3SCX A;  3OS1 A;  1CZB A;  3NF8 A;  1HMV A;  3V9X A;  4F2R A;  3ZT2 A;  3LP0 A;  3NF7 A;  3PX0 A;  2ATQ A;  3V9W A;  1LAW A;  1F21 A;  4CHP A;  4JS4 A;  2Z1H A;  3O3H A;  4FJN A;  3DRR A;  4B9M A;  5FRN A;  3RRG A;  2RF2 A;  2FBT A;  4RG8 A;  2HHU A;  1TKT A;  3B6O A;  1U48 A;  1NJX A;  4Z4H A;  3MEG A;  1WAJ A;  4KHN A;  4AHT A;  1BHL A;  3AVM A;  4J2E A;  5SZT A;  3CFR A;  4PY5 A;  1IG9 A;  2OPP A;  2X6S A;  1A5V A;  4CED A;  3HJF A;  1QSS A;  2X6N A;  1S5J A;  3SNN A;  2YNF A;  4M3R A;  2R7Y A;  3O3G A;  2ZE2 A;  3K2P A;  3QES A;  4CJL A;  2JLE A;  2A1R A;  1HQE A;  2QKK A;  1SL2 A;  3PV8 A;  1KLN A;  4FJ9 A;  4KI4 A;  1RTD A;  4B9U A;  3DLR A;  1U45 A;  1C0T A;  1NK7 A;  4CEE A;  4DTJ A;  3AVK A;  1XHZ A;  1Q9X A;  3KTQ A;  3AVB A;  4O4G A;  4CHZ A;  1IKV A;  1DTT A;  4IDK A;  2KZM A;  4J2A A;  2ETJ A;  1Q9Y A;  4DTM A;  4OLB A;  3SZ2 A;  3SPZ A;  4JRP A;  3K58 A;  3PX4 A;  3KLG A;  2HVH A;  3OJU A;  3CFO A;  1IKW A;  2HHW A;  4DLE A;  4C8M A;  4FJI A;  3HVT A;  3ZSX A;  4E19 A;  1LV5 A;  1YTA A;  1NJY A;  3KK1 A;  4DFK A;  4FK4 A;  3QIO A;  2F8T A;  2WOM A;  4W5N A;  4CF0 A;  1U47 A;  5K14 A;  5CZ1 A;  4FLV A;  3SJJ A;  4PQU A;  2OZM A;  4E7J A;  4KFB A;  4PA1 A;  5SWM A;  4DF8 A;  4DSK A;  4M3T A;  1JLQ A;  4QAG A;  4FVM A;  4CFD A;  4CK1 A;  4DQR A;  1VSH A;  3OYI A;  1WSF A;  3HXM A;  4FCY A;  4E7K A;  4NCG A;  4FJH A;  4FK2 A;  2P51 A;  3TAG A;  4ID5 A;  3K5M A;  3C95 A;  3NF9 A;  4IG0 A;  4CJ5 A;  3EY1 A;  2YNG A;  4IFY A;  4YNQ A;  3OYC A;  1D9F A;  4NCA A;  3ZT4 A;  4LH4 A;  4FJM A;  3MEE A;  3ZSQ A;  4M41 A;  3V1Q A;  4CJE A;  4H4O A;  3JSM A;  3AVL A;  2IGI A;  5KRT A;  4Y1C A;  1DTQ A;  2FBV A;  3A2F A;  5HP1 A;  3BGR A;  2F8S A;  3VQP A;  3S3M A;  3OVN A;  3C94 A;  4DWI A;  3NBP A;  1HPZ A;  1RDC A;  2X78 A;  4BAC A;  1T7P A;  3OYK A;  1KLM A;  1ZBU A;  4KHW A;  1JLG A;  3ZSZ A;  4O55 A;  1K6Y A;  4FJK A;  1XI1 A;  4Z4C A;  1HYS A;  2FBX A;  1A5W A;  1B92 A;  1LW2 A;  2F96 A;  4GW6 A;  2KW4 A;  3KLF A;  4RW9 A;  3I8D A;  4W5O A;  4Q5V A;  4BE2 A;  4E7H A;  3I0R A;  4QCL A;  1BIS A;  1JXE A;  4E1M A;  3CM5 A;  4KTW A;  4KHQ A;  4AIL C;  2QXF A;  4GVM A;  4LSN A;  3V9Z A;  1T05 A;  4CGF A;  1NK8 A;  4J2B A;  2HHQ A;  1GOA A;  4CJF A;  1NK9 A;  1NOY A;  4FLW A;  1JLC A;  4DTP A;  2ZD1 A;  4I2P A;  3O4Q A;  4DS5 A;  2OYQ A;  3LZJ A;  2WON A;  3OYB A;  4BWJ A;  1RTJ A;  3SQ4 A;  2VWK A;  3QEV A;  4AH9 A;  1ZBL A;  2XY7 A;  4KB0 A;  1I3A A;  4CES A;  4C8L A;  3QIP A;  3LP3 A;  4OGC A;  2IDO A;  2DFE A;  3I0S A;  4UQG A;  1B9D A;  2P5G A;  4CE9 A;  4KHY A;  3F9K A;  4FK0 A;  1IH7 A;  2QKB A;  3BDP A;  2DFF A;  4DS4 A;  4DSL A;  2HHV A;  3ISN C;  5E41 A;  3NGZ A;  3ZCM A;  4L8R B;  1MU2 A;  3SUQ A;  3M8S A;  4AHU A;  1QS4 A;  3LP2 A;  3MEC A;  4ID1 A;  3RR7 A;  3H08 A;  1VSK A;  4OPJ A;  1RDB A;  4HUE A;  1I39 A;  4R5P A;  3T1A A;  3L8B A;  4ZTJ A;  1L3V A;  4F2S A;  3P1G A;  1TKZ A;  5J2M A;  4O5B A;  3NAE A;  3SQ1 A;  1VRU A;  4H4M A;  4B3O A;  3DYA A;  3QLH A;  4CF2 A;  3DI6 A;  4OPK A;  2YKM A;  3QEW A;  1UAX A;  1UA0 A;  2PZS A;  2EHG A;  4FM2 A;  4HUG A;  3DM2 A;  1RT1 A;  1JLB A;  1BCO A;  3OYH A;  4NCB A;  1G15 A;  1KTQ A;  1WSJ A;  3SV3 A;  1RBT A;  3NH1 A;  2XO7 A;  1C1A A;  1RIL A;  1JXB A;  4CF1 A;  2BGG A;  4M3W A;  4FYD A;  3VQ5 A;  3EYZ A;  4OKK A;  5C25 A;  2YKN A;  3MXJ A;  3DLB A;  2VG5 A;  2ZQB A;  3LAL A;  4LH5 A;  2VWJ A;  5I42 A;  1J5O A;  2BDP A;  4CIG A;  4QOZ B;  2G8F A;  2LSN A;  4C8N A;  1JLA A;  3AVC A;  3L2U A;  1CZ9 A;  1KRP A;  4ICL A;  5C24 A;  5J2P A;  1SL0 A;  1CLQ A;  3ZSY A;  1RBR A;  4CF8 A;  3KJV A;  3MXM A;  1VSE A;  3DLE A;  5DK5 A;  3RMD A;  2DY4 A;  1D5A A;  1R0A A;  3NGY A;  4BDZ A;  1S1U A;  3ITH A;  4G1Q A;  4B08 A;  2Y1I A;  2XY8 A;  1TKD A;  3SUP A;  3HP6 A;  4FZZ A;  4FXD A;  3SQ2 A;  4HCC A;  5HRR A;  3RR8 A;  4N41 A;  4ZHR A;  4Z4I A;  3HPH A;  1W0H A;  4J2D A;  5C42 A;  3AVH A;  2D0C A;  1Q8I A;  2P5O A;  3PUF A;  4DF4 A;  2XY6 A;  2OPQ A;  4I7F A;  4KTZ A;  2PY5 A;  3IS9 A;  3K5N A;  4DQS A;  1BQN A;  3CM6 A;  2YHB A;  3G0Z A;  1ASU A;  4OGE A;  3SYZ A;  2G8W A;  4CGG A;  3ZSR A;  1KSP A;  2E4L A;  2KTQ A;  1NKC A;  1RBV A;  1XHX A;  2HNY A;  3TAM A;  5CZ2 A;  5HRP A;  1C1B A;  3VQ8 A;  3ZSW A;  4CFB A;  3HL8 A;  3K57 A;  4LY7 A;  3ULD A;  4FLT A;  1WNS A;  3CYM A;  3QER A;  2OZS A;  4DSI A;  3QNN A;  1YTU A;  3DLG A;  3C6T A;  4CIF A;  1LWF A;  3HPG A;  2OPR A;  4F3O A;  1BQM A;  3S3O A;  1S1V A;  3M8Q A;  1LW0 A;  3DLH A;  4FJX A;  1ZBH A;  1XWL A;  1ZYQ A;  3AA5 X;  3AVJ A;  3DLK A;  4FW2 A;  3ASM A;  3KKR A;  1TKX A;  3LAK A;  3OYE A;  3NCI A;  4DQQ A;  5D3G A;  1L3U A;  3K5O A;  1X1P A;  1ASW A;  1XC9 A;  4CJK A;  1UWB A;  1CXU A;  1U4B A;  4C8O A;  1QHT A;  5J2Q A;  2HND A;  3D45 A;  4B8C A;  1U04 A;  4N5S A;  3OJS A;  2Z1I A;  4CK3 A;  1KVC A;  3HST B;  3QEP A;  5EU7 A;  3VN5 A;  1QE1 A;  2XY5 A;  4IBN A;  3HO1 A;  4AHR A;  2HB5 A;  1QTM A;  1EKE A;  4K8Z A;  1IKY A;  3NFA A;  4IG3 A;  3NE6 A;  3QIN A;  4DTN A;  1U49 A;  4FZX C;  4K8X A;  1EXQ A;  2GV9 A;  3V1R A;  4W5R A;  3QO9 A;  3RRH A;  4Z4F A;  4Z4E A;  3VQA A;  5J1E A;  3LZI A;  1FXX A;  5JS2 A;  1HQU A;  1LWC A;  3VQ7 A;  3S9H A;  4CJW A;  1D9D A;  2GBZ A;  4HTU A;  3TI0 A;  2EX3 A;  4Q0B A;  4KKO A;  1REV A;  2KQ2 A;  3L3V A;  4DU3 A;  1TK5 A;  1HRH A;  1TV6 A;  1S9G A;  2PYJ A;  1RT7 A;  2G8I A;  1TAQ A;  1SL1 A;  3AVN A;  1CXQ A;  1EP4 A;  1ASV A;  4WE1 A;  4DSF A;  3LPU A;  3LWM A;  3V81 A;  1D8Y A;  1RT4 A;  1JL2 A;  3KLI A;  1C1C A;  2G8U A;  1HJR A;  1RT3 A;  3DRS A;  3OS2 A;  4PUO A;  1JKH A;  4BWM A;  1TK8 A;  4DTR A;  3JYT A;  4ELT A;  3M8P A;  1RBS A;  3OYD A;  2E6M A;  4H8K A;  1BIU A;  1C0U A;  1S1W A;  1WN7 A;  4HUF A;  4FLX A;  3P83 D;  1L5U A;  1SKW A;  1KFS A;  4PWD A;  5HBM A;  1TAU A;  4EZ6 A;  2X74 A;  3O4N A;  1SUQ A;  1NKB A;  2YV0 X;  3L2V A;  1GOC A;  3RMA A;  1KFD A;  4EP4 A;  5HRN A;  1JL1 A;  3TR8 A;  4DSE A;  1T8E A;  4KAZ A;  4N76 A;  4DFJ A;  4M45 A;  3PO4 A;  3HT3 A;  3OYF A;  2YNH A;  2A1S A;  4HCB A;  3UIQ A;  4F8R A;  2Y1J A;  2HW3 A;  4EZ9 A;  3OYN A;  1YVU A;  3EZ5 A;  4LSL A;  4W5T A;  1T03 A;  1N5Y A;  2JGU A;  2B6A A;  4CFC A;  2HHX A;  4Z0U A;  2KZZ A;  2GUI A;  3KK2 A;  1NJW A;  3TAE A;  4OKE A;  1A5X A;  4F3T A;  4N47 A;  5CYQ A;  4DFP A;  1LWE A;  3L2R A;  3AO4 A;  1BIZ A;  3C6U A;  1GOB A;  3LP1 A;  2VG7 A;  3VQ9 A;  4CEO A;  1IKX A;  3ALY A;  4CGJ A;  4E89 A;  2BE2 A;  1RDD A;  1ZBF A;  3THV A;  1BL3 A;  3K5L A;  3V4I A;  3U3G A;  3OYM A;  3SUN A;  3IG1 A;  1TVR A;  3L3U A;  3SPY A;  3VQC A;  3LAN A;  4CER A;  4ELV A;  3VQB A;  4FW1 A;  3DOL A;  3U3Y A;  2BAN A;  4OVL A;  3DRP A;  1QSY A;  5T7B A;  1SV5 A;  1C0M A;  5CYM A;  1QSL A;  4IFV A;  3AA3 A;  4CJR A;  1C6V A;  2HNZ A;  4O0I A;  3NF6 A;  5HRO A;  1X9S A;  1TGO A;  1L3S A;  4DTS A;  4M42 A;  1VSM A;  3WNH A;  4KV8 A;  4MFB A;  2IC3 A;  2G8V A;  3IAY A;  4BDP A;  4CEF A;  5KGW A;  4BDY A;  2D0B A;  2HMI A;  1S1T A;  4FJG A;  1Y97 A;  1RBU A;  4CJS A;  5FRM A;  4Z4G A;  4CIE A;  3TAP A;  2XRI A;  4N56 A;  3HM9 A;  3VA3 A;  5KTQ A;  3P5J A;  1N6Q A;  3VQD A;  1BGX T;  1RTH A;  4YFU A;  3LDS A;  1J9A A;  3SUO A;  3NH2 A;  2Q3S A;  3AO2 A;  2XHB A;  3TAB A;  3TAQ A;  1Z25 A;  3OYA A;  1WSG A;  4CEQ A;  3MED A;  4AHS A;  1VK0 A;  4E3S A;  4CK2 A;  3LAM A;  3QEI A;  1RNH A;  4OKJ A;  1EX4 A;  4DQI A;  1S6P A;  2NUB A;  2FC0 A;  3DOK A;  5HLF A;  2QK9 A;  3S3N A;  4KRF A;  2G8K A;  4M3X A;  4M3Y A;  2HHT A;  1JLE A;  4JLH A;  1RDA A;  3NH0 A;  2G8H A;  3AO3 A;  3OYJ A;  4CJV A;  3LPT A;  3O3F A;  3MXI A;  3OYG A;  3KLH A;  3TAR A;  4NYF A;  4OLA A;  3SI6 A;  2KFN A;  4AHV A;  4CJQ A;  3AV9 A;  3QEX A;  3NDK A;  2RPI A;  3HVR A;  1HYZ A;  3ZT0 A;  4CJT A;  5CY4 A;  2RKI A;  3SQ0 A;  1J54 A;  4MQ3 A;  4CEZ A;  4FJ8 A;  3T3F A;  2IS3 A;  3AO5 A;  1DLO A;  1WSH A;  1KVB A;  5KGX A;  3V9S A;  1FKO A;  3KIO A;  5FRO A;  1HNV A;  4HVJ A;  5HRS A;  1UOC A;  1IO2 A;  2B5J A;  3KK3 A;  2B4J A;  3K59 A;  3RMC A;  4CHY A;  1ITG A;  3TAN A;  1KVA A;  4FJ5 A;  1TL1 A;  1EET A;  3E01 A;  4DU1 A;  4E7I A;  4FJL A;  4KO0 A;  3CFP A;  1J53 A;  4FM0 A;  2PYL A;  4CHO A;  3VA0 A;  4CHN A;  4B8A B;  1VSD A;  4CF9 A;  3KLE A;  1KCF A;  3WNE A;  1B9F A;  1UA1 A;  4CCH A;  3QET A;  3D0P A;  1RTI A;  4CJ3 A;  4CGH A;  3AA2 A;  4CEC A;  4CJU A;  4FLZ A;  3RMB A;  4I2Q A;  4OJR A;  1SKS A;  4O44 A;  1NOZ A;  1S9E A;  4DMN A;  3V6D A;  4KRE A;  3M8R A;  5JS1 A;  3VQ6 A;  1W9H A;  2I5J A;  4C8K A;  1JLF A;  3RTV A;  2IOC A;  4CEA A;  4KPY A;  4DTO A;  2ITG A;  3HYF A;  3T19 A;  3ZSO A;  1NJZ A;  4W5Q A;  4M3Z A;  1VSL A;  1RT6 A;  3ZT3 A;  1X9M A;  3OY9 A;  3TWH A;  1NK0 A;  4DTX A;  4KHU A;  3QNO A;  4CJ4 A;  1VRT A;  2P1J A;  3F73 A;  1NKE A;  4DSJ A;  2E6L A;  5FDL A;  4B9S A;  2O4I A;  3KD5 E;  1S1X A;  3WNF A;  3KD1 E;  3CG7 A;  4NYN A;  4GMJ B;  5I3U A;  4DQP A;  1ZBI A;  1WLJ A;  1RCH A;  5DMR A;  4TSX A;  4E1N A;  2Z1J A;  1WSI A;  3CQ8 A;  3AA4 A;  4RW8 A;  4DU4 A;  4B9L A;  3HP9 A;  1YT3 A; 
#chains in the Genus database with same CATH topology
 4IO9 L;  2OA8 A;  5M1K A;  5KRS A;  2YHA A;  3V1O A;  4BR5 A;  4DFM A;  3TAF A;  1OH7 A;  3OA9 A;  4Z94 A;  3HPO A;  3SPY A;  2Q31 A;  1BI4 A;  3NHG A;  4IKF A;  5JLF A;  1NLV A;  3FE1 A;  1WOQ A;  3TPQ A;  4A5A A;  3LWL A;  4KHS A;  3L2Q A;  4B9V A;  3V9U A;  4KB1 A;  4ELU A;  3NGI A;  4LD0 A;  4F4K A;  3CJC A;  1RT2 A;  4XH4 A;  2Z1G A;  3J81 O;  1O1W A;  3H3N O;  4RW7 A;  3FFI A;  3FZM A;  4CJP A;  5EX5 A;  2E2N A;  1L3T A;  2VYP A;  3VPZ A;  1VQN N;  4FZY A;  4CZJ A;  3PSF A;  3ZSV A;  1FK9 A;  5C2D A;  3V9X A;  3ZT2 A;  3NF7 A;  2ATQ A;  4IEI A;  4CHP A;  1F21 A;  4PL8 A;  2A40 A;  4FJN A;  3C7N B;  4B9M A;  1H1V A;  2ASO A;  3RRG A;  4RG8 A;  2HMP A;  4Z4H A;  1OKJ A;  3MEG A;  1SQK A;  1BHL A;  4J2E A;  3G71 N;  4PY5 A;  2OPP A;  2X6S A;  4CED A;  5AQT A;  2P9L B;  5AQX A;  3S41 A;  4M3R A;  2R7Y A;  1ZBS A;  2ZE2 A;  3VGM A;  2JLE A;  4YDU A;  3TTD A;  2QKK A;  2CGJ A;  1RTD A;  2NRH A;  4B9U A;  4JKG B;  3AVB A;  4O4G A;  2KZM A;  4J2A A;  3P39 A;  4O8U A;  3SZ2 A;  4DR5 K;  3K58 A;  3C0B A;  3OJU A;  2OAN A;  3C6A A;  1IKW A;  4MLH A;  5JMV A;  5CR4 A;  4DLE A;  4E19 A;  4FJI A;  4LF9 K;  2QWM A;  3KK1 A;  2E88 A;  4W5N A;  5M1Q A;  4CW7 B;  4WCE L;  5CZ1 A;  3CME N;  3M5R A;  4PA1 A;  1JLQ A;  1WSF A;  1ZC6 A;  3E9O A;  1HNW K;  4NCG A;  4X64 K;  3TAG A;  3ZEU A;  3C95 A;  3NF9 A;  3EY1 A;  3FR0 A;  2YNG A;  3HRG A;  4IFY A;  3OYC A;  3UKR A;  4LH4 A;  3FLC O;  5BN8 A;  3CER A;  3V1Q A;  4H4O A;  5F1X A;  3JSM A;  2P9I A;  4X65 K;  1DTQ A;  2FBV A;  2V7Y A;  5AQH A;  3S3M A;  4BAC A;  1HPZ A;  5BPN A;  1T7P A;  1KLM A;  3MK6 A;  1JJ2 M;  1XI1 A;  1HYS A;  1A5W A;  2F96 A;  3KLF A;  4GW6 A;  4RW9 A;  4W5O A;  1CZA N;  4ILH A;  1JXE A;  3THW B;  2QWQ A;  4GVM A;  1MWM A;  4CGF A;  4J2B A;  4CZF A;  2QW9 A;  3OYB A;  2VQE K;  4BWJ A;  3SAH A;  4C23 A;  2QWR A;  1I3A A;  1E4F T;  3O4W A;  3I0S A;  1ZXO A;  5GAH P;  2WUS A;  2P5G A;  5BPL A;  4KHY A;  3F9K A;  1QHA A;  4FK0 A;  3MN6 A;  2DFF A;  4LF4 K;  4BY9 C;  4DSL A;  3FGU A;  5E41 A;  4H5T A;  3BF1 A;  1MU2 A;  1RFQ A;  5EY4 A;  1MDU B;  3SAF A;  5CE3 A;  4RCH A;  3O5B A;  2I7N A;  5KQ8 A;  2NRZ A;  3NAE A;  4AF1 A;  4MDA A;  4BQZ A;  1GLL O;  1UA0 A;  2EHG A;  3DM2 A;  2NZT A;  1JLB A;  4GY2 B;  3NH1 A;  1C1A A;  1JXB A;  3VQ5 A;  3MXJ A;  3QBW A;  5I42 A;  2BDP A;  1FJG K;  2LSN A;  1KRP A;  1JLA A;  4DV0 K;  5ADX A;  1RBR A;  1RDW X;  3R9P A;  2DY4 A;  4LF5 K;  4FWS A;  1S1U A;  3SUP A;  4IJA A;  1N34 K;  4FZZ A;  5HRR A;  4N41 A;  4A5B A;  5AQU A;  2P5O A;  4BRP A;  4XEI A;  3EO3 A;  2YJE A;  2PY5 A;  3KZB A;  3HI0 A;  4JI2 K;  3CQX A;  4CGG A;  2KTQ A;  2E1Y A;  1NKC A;  3VF4 A;  3TAM A;  2HNY A;  1GLB G;  4CFB A;  3LDQ A;  2W6L A;  1Y64 A;  5KQD A;  4DSI A;  3QER A;  3HZ6 A;  1YTU A;  3DLG A;  1LWF A;  3HPG A;  4UY8 O;  1LOT B;  4BRL A;  1BQM A;  1YIT N;  3M8Q A;  2UUA K;  3AVJ A;  4FW2 A;  5D3G A;  1NGH A;  3SMS A;  3EE9 A;  1XQS C;  4CJK A;  4K43 A;  1U4B A;  3LL3 A;  1VHX A;  3D45 A;  4B8C A;  3OJS A;  3QEP A;  2Z1I A;  5C2F A;  5EU7 A;  2HB5 A;  4WYB A;  5AQO A;  1IKY A;  4JNE A;  3NE6 A;  1U49 A;  3GOI A;  4K25 A;  3VQA A;  5J1E A;  3FZK A;  3O9R A;  5JS2 A;  3VQ7 A;  3S9H A;  1BA0 A;  4HTU A;  4DU3 A;  2KQ2 A;  1RT7 A;  1TAQ A;  3AVN A;  4NB4 A;  1DEJ A;  3LWM A;  3KLI A;  3WQU A;  1C1C A;  1HJR A;  3OS2 A;  3JYT A;  5AQJ A;  1RBS A;  4A62 A;  3OYD A;  2E6M A;  4RTF D;  2IVO A;  4H8K A;  1KFS A;  1L5U A;  4PWD A;  2BH1 A;  5HBM A;  4EZ6 A;  3O4N A;  2VQF K;  3I56 N;  4JI6 K;  3RMA A;  5HRN A;  1T8E A;  3RSE B;  4DFJ A;  1WBD A;  3HT3 A;  1DKG D;  3F9M A;  3BEX A;  1N36 K;  3OYN A;  2HBM A;  4W5T A;  1N5Y A;  1VQO N;  2HBJ A;  2HHX A;  2CGK A;  2O8C A;  4OKE A;  1LWE A;  3C6U A;  1GOB A;  3EKS A;  5M1P A;  4CEO A;  2FXU A;  4JD2 B;  1BL3 A;  3K5L A;  3SUN A;  1VQK N;  1XC3 A;  4E1J A;  4ELV A;  3DOL A;  4DR2 K;  2BAN A;  4BC4 A;  5T7B A;  4HTL A;  5F0X A;  3AA3 A;  2HNZ A;  1ATR A;  2YHW A;  1X9S A;  4K42 A;  1VSM A;  3WNH A;  3UKR B;  4AM6 A;  5KGW A;  4CBU A;  4B3T K;  5FPE A;  4Z4G A;  1S1T A;  1RBU A;  4BR9 A;  4FL9 A;  1C0G A;  4MLE A;  4JN4 A;  1N6Q A;  3VQD A;  3LDS A;  2XHB A;  3OYA A;  3D7E O;  3MED A;  5AQV A;  4CK2 A;  2VGN A;  5M1F A;  3QEI A;  1RNH A;  4OKJ A;  2P9I B;  2QK9 A;  2G8K A;  1JLE A;  4JLH A;  2G8H A;  4DB3 A;  4FWP A;  3MCA B;  3HOT A;  3O3F A;  3MXI A;  3KLH A;  3WXK A;  1Q86 O;  4NYF A;  3SI6 A;  4AHV A;  3R3L A;  3AV9 A;  3VES A;  2A5X A;  4CEZ A;  1DLO A;  5JVH L;  1YHQ N;  5TKY A;  5JIC A;  3KIO A;  5FRO A;  3K59 A;  4R79 A;  4DU1 A;  4LC9 B;  2PYL A;  2FSK A;  3OBY A;  4CHN A;  1VSD A;  5AQQ A;  4CF9 A;  3CF5 L;  2P9L A;  4FLZ A;  3FZL A;  4CJU A;  3CCL N;  4I2Q A;  3A5L C;  1NOZ A;  4DR6 K;  2VGM A;  3VQ6 A;  3GG4 A;  1BA1 A;  4PL7 A;  3T19 A;  4M3Z A;  4W5Q A;  2GWJ A;  1NK0 A;  4KHU A;  5AQL A;  4JKG A;  4FWQ A;  1NKE A;  4B9S A;  3VGL A;  1S1X A;  3CG7 A;  4GMJ B;  5I3U A;  4A57 A;  2GX9 A;  4DR3 K;  2WFB A;  1WSI A;  2Z1J A;  2QKB A;  1YT3 A;  1TL3 A;  3WNG A;  4Y1D A;  4DLG A;  4O0J A;  3RWU A;  2ZWH A;  3AVG A;  2E2P A;  4KTQ A;  2OTJ N;  2WTU A;  4H0T B;  4YOV A;  5J2N A;  1YI2 N;  2D5R A;  4RW4 A;  1IBK K;  3Q7C A;  4I9L A;  4WQ4 A;  4CGI A;  3C7N A;  4E0D A;  3IUC A;  1VQP N;  4LFC K;  2FBY A;  5KI6 A;  4BRG A;  4K0K K;  3UKU A;  1BI4 B;  3SV4 A;  4RW6 A;  1X9W A;  3MAQ A;  5AR0 A;  3K9J A;  4FLY A;  3L2W A;  2W42 A;  4BRA A;  4FJJ A;  3DMJ A;  4ISF A;  3CIP A;  3O1W A;  4H5V A;  1WSE A;  4L3Q A;  5HL7 L;  1LAV A;  5LMU K;  4I9Q A;  4FJ7 A;  2Q1N A;  4CFA A;  4CGD A;  2DFH A;  3ZT1 A;  4F2R A;  1HKC A;  4PKI A;  1LAW A;  4JS4 A;  3O3H A;  3DRR A;  2FBT A;  1TKT A;  1NJX A;  2Q0R A;  1Q18 A;  4FOE A;  3AGR A;  5SZT A;  4BRH A;  3CFR A;  4G9Z A;  2KHO A;  3P31 A;  3CC7 N;  1ATN A;  1IJJ A;  1EQY A;  1S5J A;  1W97 L;  3K2P A;  4CJL A;  1KLN A;  3PV8 A;  4J8F A;  1KC8 O;  4CZM A;  4YDU C;  3R8E A;  2O8F A;  1U45 A;  2P9U B;  1NK7 A;  4CEE A;  3KTQ A;  5IWA K;  1IKV A;  1DTT A;  4JHD B;  2ETJ A;  3D6R A;  4DTM A;  1RGI A;  5AQR A;  5AQF A;  4QS9 A;  1SAZ A;  4JRP A;  1NM1 A;  1T3V A;  4BRQ A;  2O8D B;  3KLG A;  5AZI B;  3CFO A;  1T44 A;  2HHW A;  4C8M A;  3ZSX A;  5GIN A;  1NJY A;  3QIO A;  2O8E A;  1SZ2 A;  5K14 A;  3ENB A;  4EHT A;  5AQG A;  4PQU A;  4E7J A;  4KFB A;  5BR8 K;  3TTC A;  4QAG A;  4CFD A;  4CK1 A;  2BTF A;  3OYI A;  1IBL K;  4KH6 A;  3UKU B;  1VQ8 N;  4FK2 A;  5EOY A;  4IG0 A;  5AZJ B;  3HSC A;  3QFU A;  1D9F A;  3ZT4 A;  4FJM A;  2W41 A;  2A42 A;  3ZSQ A;  3E9P A;  1WB9 A;  5KRT A;  4BC5 A;  4B1W B;  2F8S A;  3E1Y A;  3C94 A;  3WQT A;  2ASM A;  3OYK A;  3ATU A;  1K6Y A;  3AAP A;  4BRD A;  1B92 A;  5FLX O;  2ITM A;  4B1Y B;  2W6K A;  4CZK A;  4DKW A;  4Q5V A;  3ID8 A;  4KHQ A;  3VTH A;  4AIL C;  3ZX3 A;  5GAD P;  1N32 K;  4LSN A;  4EIA A;  3V9Z A;  1NK8 A;  2HHQ A;  1NOY A;  2ZD1 A;  2OYQ A;  2WON A;  3D2E B;  3SQ4 A;  1EWQ A;  3L4I A;  5C0Y A;  3QEV A;  4AH9 A;  3QIP A;  4OGC A;  4UQG A;  1B9D A;  1OVY A;  4CE9 A;  2E20 A;  3E9L A;  3CCE N;  4L8R B;  3ZCM A;  3M8S A;  4JK8 A;  2AA4 A;  3LP2 A;  3F2K A;  4BVP A;  4HUE A;  1I39 A;  3T1A A;  4ZTJ A;  3P1G A;  3VTI A;  1TKZ A;  3DYA A;  3DI6 A;  1VQ9 N;  3THY A;  1RT1 A;  3OYH A;  4F9O A;  3SV3 A;  3OHR A;  1RBT A;  2F9T A;  4CF1 A;  4M3W A;  4FYD A;  1BWF O;  3EYZ A;  4OKK A;  5C25 A;  2YKN A;  3CC2 N;  3DLB A;  1J5O A;  3DXM B;  3TSP A;  4CIG A;  5GAE P;  2NRT A;  2G8F A;  4QOZ B;  3DAW A;  3L2U A;  5BRD A;  2IVN A;  5AQZ A;  5J2P A;  1CLQ A;  3ZSY A;  5JLH A;  5KPT A;  4CF8 A;  4JK9 A;  1D5A A;  1S3X A;  4XH1 A;  2HHH K;  1NNE A;  1QQO A;  5DM7 L;  4B08 A;  2Y1I A;  3W3D A;  3HP6 A;  1T6D A;  3SQ2 A;  4Z4I A;  2Q0U A;  2D0C A;  4KHP K;  1M1K O;  3F5T A;  4KTZ A;  3K5N A;  4DQS A;  1BQN A;  3CM6 A;  4WQ4 C;  2YHB A;  2G8W A;  3SYZ A;  1KSP A;  3ZSR A;  1RBV A;  5CZ2 A;  1C1B A;  3VQ8 A;  1KAZ A;  2F4V K;  5FPN A;  1DT9 A;  3ULD A;  4FLT A;  4FSV A;  4Y0W A;  2OPR A;  1XWL A;  5B8H A;  3DLK A;  3LAK A;  4DQQ A;  1U2V A;  3WXI A;  1ASW A;  1O13 A;  2UYT A;  2FSN A;  1UWB A;  5J2Q A;  4B1V A;  5GAG P;  4N5S A;  2P9P B;  1KVC A;  3NMU A;  1QE1 A;  3HO1 A;  4AHR A;  3NFA A;  4JKA A;  2OCE A;  3P38 A;  1EXQ A;  2GV9 A;  4W5R A;  3RRH A;  1YJW N;  4Z4F A;  2HF3 A;  1FXX A;  1LWC A;  1YUW A;  4DV2 K;  4CJW A;  1GLD G;  2GBZ A;  1TUU A;  2P9N B;  2EX3 A;  1ILY A;  1REV A;  1BU6 O;  1ESV A;  1OVQ A;  3SBG A;  1TV6 A;  1S9G A;  2Q36 A;  3VEX A;  1EP4 A;  4WE1 A;  4CZI A;  5KPR A;  3LPU A;  3ZET A;  4DSF A;  3V81 A;  1N33 K;  1RT4 A;  2AP1 A;  1JKH A;  4BWM A;  1TK8 A;  3M8P A;  4BRK A;  4YOW A;  1YIJ N;  3HBT A;  4FLX A;  1S1W A;  3P83 D;  4JI5 K;  4H5W A;  2OTL N;  3DXK A;  2X74 A;  3L2V A;  4EP4 A;  4WFB L;  3EL2 A;  1NBW A;  3U4L A;  4KAZ A;  1QVF M;  3OYF A;  2YNH A;  4HCB A;  1NGD A;  3UIQ A;  1YAG A;  4F8R A;  2HW3 A;  3VER A;  1YVU A;  1TUY A;  2KKZ A;  4Z0U A;  2GUI A;  4N47 A;  5CYQ A;  3CJA A;  5AZJ A;  3L2R A;  3LP1 A;  2YI1 A;  2HF4 A;  4CGJ A;  3ALY A;  4E89 A;  1ZBF A;  3THV A;  5JVG L;  3U3G A;  3CCU N;  3IG1 A;  1TVR A;  3AAR A;  3VQC A;  3LAN A;  3H46 O;  3VQB A;  3MDQ A;  3G6E N;  3DRP A;  1QSY A;  2F7T A;  1C0M A;  1R59 O;  3NF6 A;  1TGO A;  1L3S A;  4DTS A;  1J5E K;  2IC3 A;  3HOS A;  4BDP A;  4LFB K;  1DGK N;  1Z05 A;  2HMI A;  2O8D A;  1OH5 A;  4FO0 A;  5C15 A;  4OO1 J;  4N56 A;  5BRH A;  3VA3 A;  5KTQ A;  3QDK A;  3PIP L;  1BGX T;  1RTH A;  2Q97 A;  3SUO A;  2Q3S A;  3AO2 A;  1Z25 A;  3D2F A;  3IKM A;  4AHS A;  3VGK A;  4MO5 A;  2O8B B;  3KHY A;  4DQI A;  1TYQ B;  1S6P A;  3CQY A;  3Q7B A;  4M3X A;  4OPH A;  3NH0 A;  5BRF A;  1P8Z A;  2ASP A;  1YJN N;  1XNR K;  3EN9 A;  1HPM A;  2KFN A;  3LDN A;  3QEX A;  4U67 L;  4JKF A;  3HVR A;  5CY4 A;  3J7Z O;  3NVK A;  2IS3 A;  1OH6 A;  1WSH A;  1KVB A;  5BPM A;  5KGX A;  1FKO A;  2OZS A;  4HVJ A;  1UOC A;  4FJ5 A;  3KK3 A;  3RMC A;  4CHY A;  4FJL A;  1KVA A;  4CBW A;  4E7I A;  4FM0 A;  2P9S A;  4B8A B;  1KCF A;  3QET A;  4KBO A;  3D0P A;  3JAM O;  3VEV A;  4CEC A;  4OJR A;  1K8A O;  5JS1 A;  1W9H A;  2I5J A;  1JLF A;  3FZH A;  4CEA A;  4KPY A;  4DTO A;  3ZSO A;  2ITG A;  4BR7 A;  1RT6 A;  1X9M A;  3OY9 A;  4GV3 A;  3WT0 A;  3MN5 A;  3QNO A;  3JS6 A;  3THX B;  3F73 A;  4DSJ A;  1KAY A;  3WNF A;  3MN9 A;  4NYN A;  1ZBI A;  4DQP A;  1NMN A;  4YOU A;  4CHO A;  3AA4 A;  3ULE A;  4M42 A;  4B9L A;  4FWO A;  2D0A A;  4M7Y A;  5ADX H;  4B9T A;  5IT9 O;  1NK5 A;  4JRQ A;  3OYL A;  3WXM B;  3VQ4 A;  2W40 A;  2YNI A;  4YHH K;  3ENO A;  3GL1 A;  5GIP A;  2AJQ A;  4XIU A;  3R1X A;  3KKS A;  5BR9 A;  1TK0 A;  2VG6 A;  4CEB A;  1VSF A;  3QB0 A;  1NWK A;  3AVI A;  3CCJ N;  3TTF A;  3LM9 A;  4CHQ A;  4BE0 A;  3PX6 A;  3ZEU B;  4BRO A;  4FWM A;  3BF3 A;  3U9Z A;  3HK2 A;  2GUP A;  3WXL A;  1SKR A;  4B1Z A;  4E7L A;  1V4S A;  3IMX A;  1K73 O;  1S6Q A;  4BR4 A;  4M3U A;  4IZ9 A;  2DTU A;  4FPA A;  1BCM A;  3FZF A;  1FKP A;  3CXC M;  4B9N A;  3CCQ N;  1K9M O;  1Q81 O;  1VSI A;  4BC3 A;  4KI6 A;  4JI1 K;  3WUH A;  3VQQ A;  4AHC A;  4HHT A;  2IAJ A;  3NF8 A;  1HMV A;  3PX0 A;  3J80 O;  5BRE A;  3A5M C;  3V9W A;  2Z1H A;  4CBX A;  5FRN A;  2RF2 A;  3B8A X;  2HHU A;  4H0Y B;  4KHN A;  1WAJ A;  3MCP A;  3A8Y A;  4MO4 A;  2A3Z A;  3AVM A;  4NXM K;  1MA9 B;  1T6C A;  1A5V A;  3HJF A;  1QSS A;  4GVE A;  4LFA K;  1MWK A;  2HOE A;  3SNN A;  3O3G A;  3CHW A;  1RDU A;  2A1R A;  1HQE A;  1SL2 A;  3RVC A;  4FVU A;  4YY3 K;  4BG9 A;  2F9W A;  4DTJ A;  1XUP O;  4CHZ A;  1Q9Y A;  4OLB A;  3SPZ A;  2FF6 A;  3PX4 A;  3J7A P;  4JKE A;  5MLC Q;  2HVH A;  4DR1 K;  3UE5 A;  1ATS A;  5DM6 L;  4DFK A;  4FK4 A;  2F8T A;  4PKH A;  3CMA N;  4FLV A;  3SJJ A;  1VQM N;  4YOY A;  2OZM A;  5SWM A;  4DSK A;  4M3T A;  4FVM A;  4KH4 A;  4DQR A;  1VSH A;  3HXM A;  4FCY A;  4E7K A;  3GBT A;  1WBB A;  2P51 A;  4BRN A;  4CD3 A;  4YNQ A;  3O08 A;  1Z6R A;  2P9N A;  4NCA A;  2NRW A;  5AQS A;  3MEE A;  4CJE A;  4H0P A;  3R6M A;  3AGK A;  3AVL A;  2IGI A;  5KPZ A;  4Y1C A;  3A2F A;  3BGR A;  3WEE A;  5AQN A;  4NLC A;  3CJ9 A;  1ZBU A;  4KHW A;  2IIR A;  3U8X A;  3ZSZ A;  1TYQ A;  3SK3 A;  4FJK A;  4Z4C A;  1WUA A;  3O9Q A;  3LDO A;  1M90 O;  2KW4 A;  2D4W A;  4E7H A;  4FPB A;  3I0R A;  3O1B A;  3CM5 A;  4KTW A;  3I8B A;  2QXF A;  4IWV A;  4CJF A;  4X66 K;  4WQ5 C;  1NK9 A;  4FLW A;  4DTP A;  3EE8 A;  4I2P A;  1OH8 A;  1RTJ A;  2HST A;  4BRF A;  1ZBL A;  2PAV A;  4CZL A;  3QBX A;  2XY7 A;  4KB0 A;  4CES A;  4C8L A;  3LP3 A;  2IDO A;  2DFE A;  1K8K B;  4DV6 K;  1E3M A;  1NGB A;  4MDB A;  3BDP A;  1QQM A;  3LDP A;  3ISN C;  1GLE G;  3SUQ A;  3D2F B;  4LF8 K;  1XNQ K;  4AHU A;  3MEC A;  1HX1 A;  4ID1 A;  3H08 A;  4OPJ A;  1L3V A;  4R5P A;  3KWI A;  3L8B A;  2QA4 N;  4O5B A;  4O5F A;  4H4M A;  4OPA A;  4OPK A;  4JV5 K;  3QEW A;  1UAX A;  2PZS A;  4FM2 A;  3DXM A;  3FFK B;  3QFP A;  1KTQ A;  2BGG A;  3IDH A;  2J4R A;  5LY3 A;  3TU5 A;  2ZQB A;  3THY B;  3SBT A;  4C8N A;  4BGB A;  5C24 A;  1SL0 A;  3MXM A;  3CD6 N;  1VSE A;  5DK5 A;  3RMD A;  3H3O B;  3ITH A;  4G1Q A;  2XY8 A;  1NGF A;  4HCC A;  3HPH A;  1W0H A;  3AVH A;  1Q8I A;  1HKG A;  2FLO A;  3QML A;  3PUF A;  4DF4 A;  4DCH A;  4GNI A;  2XY6 A;  3IS9 A;  5AFU A;  3G0Z A;  3PIO L;  5LL6 Z;  2E4L A;  2QWP A;  1XHX A;  4LF6 K;  1NJI O;  4JKD A;  3HL8 A;  5M1O A;  4WF9 L;  2EWS A;  3VEY A;  2HBL A;  1S1V A;  2YHY A;  3AA5 X;  3NCI A;  3ASM A;  3KKR A;  1TKX A;  2QWL A;  1X1P A;  1XC9 A;  1G99 A;  3OBW A;  4C8O A;  1QZ6 A;  3VEW A;  2HND A;  4H5N A;  4JI4 K;  1U04 A;  3HST B;  3VN5 A;  1IV0 A;  2XY5 A;  1EKE A;  4DV1 K;  2KLA A;  4K8X A;  3V1R A;  4JKB A;  2P9K A;  3LZI A;  3I33 A;  1X3M A;  2P9P A;  1HKB A;  2UXD K;  4B1U B;  3TI0 A;  4KKO A;  1TK5 A;  3L3V A;  1P90 A;  3H1V X;  1SL1 A;  1CXQ A;  3DJC A;  1ASV A;  1HJO A;  3G25 A;  4B3S K;  4BG8 A;  1RT3 A;  4PUO A;  5EXW A;  1QZ5 A;  4DTR A;  4ELT A;  1BIU A;  3BP8 A;  3H1Q A;  1SKW A;  3WXJ A;  1K8K A;  1SUQ A;  1NKB A;  3P4I A;  2YV0 X;  2O8E B;  2ZGY A;  2UUC K;  1JL1 A;  3TR8 A;  4DSE A;  4N76 A;  4M45 A;  1GLA G;  5AQK A;  3PO4 A;  2A1S A;  5A2Q O;  3IFR A;  4EZ9 A;  3LDL A;  3EZ5 A;  3OTO K;  2CH5 A;  2B6A A;  3KK2 A;  4JHD A;  1NJW A;  3TAE A;  2GEL A;  1A5X A;  1U6Z A;  4DFP A;  4FWN A;  1BIZ A;  4BC2 A;  2VG7 A;  3VQ9 A;  4ILG B;  1IKX A;  3L4Q A;  2BE2 A;  1RDD A;  4BRE A;  3V4I A;  3L3U A;  5GIO A;  3WEE B;  2GTD A;  1C6V A;  4IDH A;  1EWR A;  3ZLJ A;  4KV8 A;  2G8V A;  5AQM A;  4B9Q A;  4CEF A;  4ILJ A;  2D0B A;  3HTV A;  1Y97 A;  5FRM A;  2XRI A;  3P5J A;  3CCM N;  1J9A A;  3VET A;  3TAQ A;  4IFE A;  4CEQ A;  1WSG A;  3TSU A;  1NGE A;  5AJ3 K;  1VK0 A;  2NUB A;  2IVP A;  2FC0 A;  5HLF A;  4KRF A;  2HHT A;  3AO3 A;  4CJV A;  4CZG A;  5CHI A;  2I7P A;  4OLA A;  2GEM A;  4CJQ A;  3MWP A;  2RPI A;  1HYZ A;  2QWO A;  3ZT0 A;  4CJT A;  3CCV N;  1J54 A;  4YOR A;  4MQ3 A;  4FJ8 A;  1D4X A;  3AO5 A;  4A59 A;  5AQP A;  3V9S A;  2Y1J A;  1HNV A;  2B5J A;  2KZZ A;  3CPE A;  2B4J A;  1HUX A;  4JKH A;  1TL1 A;  1EET A;  3E01 A;  3J7Y P;  1EO1 A;  1X3N A;  4KO0 A;  4QS8 A;  3VA0 A;  1GLC G;  3KLE A;  3WNE A;  1UA1 A;  1B9F A;  4CCH A;  1HNZ K;  3H45 C;  2QEX N;  1BG3 A;  4CGH A;  3AA2 A;  3RMB A;  1S9E A;  4DMN A;  4NXN K;  3JXU A;  3M8R A;  2RHK A;  4KH5 A;  3N4P A;  3CI5 A;  2IOC A;  3VEO A;  3CET A;  1N8R O;  2FSJ A;  1NJZ A;  2A41 A;  3HYF A;  4EFH A;  2FF3 B;  3L6Q A;  2YX6 A;  3W0L A;  2NNW A;  4CJ4 A;  3A5N C;  2QM1 A;  5FDL A;  4A61 A;  4DV3 K;  3KD1 E;  1RCH A;  1KQS M;  4M63 C;  4E1N A;  2CGL A;  4DU4 A;  1BOT O;  3HP9 A;  4FM1 A;  3UB5 A;  3U6F A;  4FLU A;  3B6P A;  1NK6 A;  3PO5 A;  3O9S A;  1KD1 O;  1LCU A;  5LJW A;  2VCP A;  3KK7 A;  2RN2 A;  4DG1 A;  4EP5 A;  4JKC A;  2NLX A;  3AVF A;  3M1F A;  1VSJ A;  3IRX A;  1T05 A;  3EZW A;  3PLA A;  3G10 A;  2OPS A;  1XMQ K;  1HNX K;  1Z26 A;  3GE1 A;  3E66 A;  1HNI A;  1RT5 A;  4RWT A;  3OS0 A;  2E2Q A;  3PY8 A;  3VOV A;  3VQE A;  2GWK A;  2HHS A;  1QQC A;  4BVO A;  1HYV A;  1E4G T;  4JS5 A;  3AVA A;  2PFU A;  3VF2 A;  2O4G A;  4ZTF A;  4O8K A;  1WAF A;  3ID6 A;  4QS7 A;  4DTU A;  4FWL A;  4JEP A;  4BE1 A;  2KFZ A;  3AO1 A;  1NK4 A;  2HVI A;  4JI7 K;  2PBD A;  5AQY A;  3SCX A;  3OS1 A;  1CZB A;  2G8I A;  3LP0 A;  3CJ1 A;  1NGA A;  3TSQ A;  1NGI A;  3B6O A;  1U48 A;  3T69 A;  4V19 S;  4AHT A;  1IG9 A;  1KXP A;  4JK7 A;  1XMO K;  2X6N A;  1BUP A;  3QIC A;  1YXQ A;  4WFN L;  4BRM A;  2YNF A;  3QES A;  4DQ8 A;  4AM7 A;  2E1Z A;  4FJ9 A;  4KI4 A;  3SAG A;  3CJB A;  4I6M B;  3THX A;  2D1K A;  3DLR A;  4IOC L;  1VQ4 N;  1C0T A;  3AVK A;  4H0O A;  4ISE A;  1XHZ A;  1Q9X A;  4IDK A;  1NGG A;  3VEZ A;  4K41 A;  3ZYY X;  2ZJQ L;  1QVG M;  1Q82 O;  1BO5 O;  3RSE A;  3HVT A;  1LV5 A;  1YTA A;  4CZH A;  2WOM A;  4CF0 A;  1U47 A;  4H0V B;  3HM8 A;  1VQ5 N;  4BGA A;  1VAZ A;  2P9S B;  4DF8 A;  2JWK A;  4FJH A;  3EKU A;  1YVN A;  4ID5 A;  3KVG A;  3K5M A;  4CJ5 A;  2QTD A;  4BRC A;  2ZJR L;  3T1H K;  3O9U A;  1C0F A;  2ZF5 O;  4M41 A;  1X9J A;  4HWI A;  5HP1 A;  3O8M A;  3N4Q A;  4XH5 A;  3VQP A;  5ELZ A;  3OVN A;  4FWK A;  4DWI A;  1KAX A;  2E8A A;  1RDC A;  2X78 A;  3NBP A;  1JLG A;  4O55 A;  4IXC A;  4A2B A;  4H0X B;  5BN9 A;  3VMF B;  3VF6 A;  2FBX A;  1LW2 A;  3I8D A;  1GLJ O;  3A5O C;  4BR0 A;  4BE2 A;  4FWR A;  4QCL A;  1BIS A;  4E1M A;  2RE2 A;  1NGC A;  3VEN A;  1GOA A;  2D0O A;  1JLC A;  1QQN A;  3O4Q A;  4DS5 A;  3LZJ A;  4WQ5 A;  2VWK A;  2UU9 K;  4B3R K;  4GV6 A;  2A6A A;  4WFA L;  1V4T A;  4YOX A;  1IH7 A;  3SJH A;  4DS4 A;  4IOX A;  3O6W A;  3O80 A;  3AY9 A;  3ULE B;  2HHV A;  3NGZ A;  2QWN A;  1QS4 A;  3RR7 A;  3NVM A;  4JD2 A;  1VSK A;  4DUZ K;  4F2S A;  1RDB A;  3MX5 A;  3M6G A;  5J2M A;  3SQ1 A;  4B3O A;  1VRU A;  4DV4 K;  5LJV A;  3QLH A;  4CF2 A;  2YKM A;  4DV7 K;  4HUG A;  4IOA L;  4NCB A;  1BCO A;  1G15 A;  1WSJ A;  2XO7 A;  4NO7 A;  1RIL A;  3J8A A;  3DXK B;  4JI8 K;  4EHU A;  4PHT X;  2HBK A;  5H1S Q;  3ENH A;  2VG5 A;  3LAL A;  4LH5 A;  2VWJ A;  3AVC A;  1CZ9 A;  3ZET B;  4ICL A;  1SS6 A;  3KJV A;  4DUY K;  3DLE A;  5FPD A;  5I9E B;  1R0A A;  3NGY A;  4CJ7 A;  4BDZ A;  2CH6 A;  3T7Z A;  1TKD A;  2O8C B;  3T1Y K;  1JCG A;  3PSI A;  4FXD A;  3RR8 A;  4ZHR A;  4J2D A;  5C42 A;  2ZJP L;  3OW2 M;  4IO8 A;  2OPQ A;  1Q7Y O;  4I7F A;  2WBN A;  1NG9 A;  5F2R A;  4GKK K;  5AFU H;  1ASU A;  4OGE A;  4OX9 K;  1GLF O;  5C12 A;  4X62 K;  5HRP A;  3ZSW A;  4CI6 A;  2O8B A;  3K57 A;  4LY7 A;  1U2V B;  1WNS A;  3CYM A;  3QNN A;  3C6T A;  4CIF A;  3MWT A;  5E26 A;  4F3O A;  4H5R A;  2ZGZ A;  4FOI A;  3SMP A;  3S3O A;  1ZBH A;  1LW0 A;  3DLH A;  3THW A;  4FJX A;  1ZYQ A;  3OYE A;  1L3U A;  3K5O A;  1FW6 A;  1CXU A;  1QHT A;  1W2B M;  4PKG A;  2Q2R A;  4CK3 A;  3MN7 A;  4IBN A;  1QTM A;  4K8Z A;  4IG3 A;  4DTN A;  3QIN A;  1HR0 K;  4FZX C;  3CC4 N;  3QO9 A;  4DHY A;  4Z4E A;  3K9K A;  5M1N A;  1HQU A;  2YCH A;  4JI3 K;  3CCR N;  1D9D A;  4DV5 K;  4Q0B A;  5E84 A;  1HRH A;  2QI2 A;  2PYJ A;  3I55 N;  4YOT A;  1YJ9 N;  1D8Y A;  3BZK A;  1JL2 A;  2G8U A;  3DRS A;  3LM2 A;  3MX2 A;  2P9K B;  4B1X B;  1C0U A;  1WN7 A;  4C1N I;  4HUF A;  1IG8 A;  1YF5 L;  3KWG A;  4JYA K;  1TAU A;  2D0P A;  2DPN A;  1J6Z A;  1GOC A;  1KFD A;  4AQY K;  5LMN K;  3D2E A;  5AQI A;  3BZC A;  3DLL L;  2H3G X;  1NGJ A;  4M7X A;  2E5L K;  4LSL A;  1T03 A;  2JGU A;  4CFC A;  2WC9 A;  4F3T A;  2ZM6 K;  3U9D A;  2NRR A;  3K0S A;  3AO4 A;  3H6E A;  2V7Z A;  4DR7 K;  3CCS N;  3GDQ A;  5HOO A;  1W7A A;  3OYM A;  4GV9 A;  4CER A;  3ATV A;  4DR4 K;  4FW1 A;  3U3Y A;  4OVL A;  1SV5 A;  5CYM A;  5C10 A;  1QSL A;  4IFV A;  4CJR A;  4O0I A;  2UXC K;  5HRO A;  2V51 B;  3A0I X;  3BUZ B;  4MFB A;  1I94 K;  3IAY A;  3C65 A;  3M3Z A;  4EAH D;  4BDY A;  4CZE A;  5AQW A;  2YHX A;  4CJS A;  4FJG A;  4JI0 K;  5FPM A;  4CIE A;  3TAP A;  3CJ7 A;  4A2A A;  5EVZ A;  2QXL A;  3HM9 A;  1IBM K;  4YFU A;  2NRV A;  1S22 A;  3NH2 A;  3TAB A;  4BQL A;  3O9T A;  5TKW A;  3G4S N;  4E3S A;  3LAM A;  4I6M A;  3SLC A;  1HLU A;  1EX4 A;  1NMD A;  4U7B A;  3DOK A;  3S3N A;  4M3Y A;  1RDA A;  3OYJ A;  2VWB A;  3LPT A;  5AZI A;  3OYG A;  3TAR A;  4CVN E;  4IJN A;  2BUP A;  3ZX0 A;  3NDK A;  4CD1 A;  2RKI A;  3SQ0 A;  3DWL A;  3T3F A;  3MMV A;  4NLB A;  2YJF A;  5HRS A;  1IO2 A;  2O8F B;  3TAN A;  1ITG A;  4JAX A;  1BDG A;  3CFP A;  1J53 A;  4B3M K;  3ZX2 A;  2NRX A;  1VQL N;  3BY5 A;  1VQ6 N;  3C6H A;  1VQ7 N;  4BRI A;  4GKJ K;  2UXB K;  1RTI A;  4CJ3 A;  2E2O A;  1SKS A;  4O44 A;  3V6D A;  4KRE A;  4BR2 A;  1JCE A;  1JCF A;  4C8K A;  4IEE A;  3RTV A;  3AAQ A;  4ISG A;  3CPW M;  1S72 N;  1NU0 A;  1VSL A;  3ZT3 A;  2JWL A;  3TWH A;  4DTX A;  2P9U A;  1VRT A;  2V52 B;  4LF7 K;  2P1J A;  3L0Q A;  4C1N K;  2E6L A;  2O4I A;  3KD5 E;  1WLJ A;  5DMR A;  3EEQ A;  4TSX A;  3CQ8 A;  4RW8 A;  4H03 B;  2UUB K; 
#chains in the Genus database with same CATH homology
 1TL3 A;  2D0A A;  4FM1 A;  4B9T A;  3U6F A;  4FLU A;  2OA8 A;  3B6P A;  3WNG A;  5KRS A;  4Y1D A;  4DLG A;  4O0J A;  1NK5 A;  4JRQ A;  1NK6 A;  3OYL A;  3PO5 A;  3RWU A;  2YHA A;  3VQ4 A;  2YNI A;  3AVG A;  2RN2 A;  4DG1 A;  4EP5 A;  4KTQ A;  3V1O A;  4DFM A;  3TAF A;  2AJQ A;  3AVF A;  4XIU A;  3KKS A;  1TK0 A;  1VSJ A;  3IRX A;  2VG6 A;  4CEB A;  3HPO A;  2D5R A;  1VSF A;  3G10 A;  4RW4 A;  2OPS A;  5J2N A;  4E0D A;  4I9L A;  4CGI A;  3AVI A;  1BI4 A;  3NHG A;  4IKF A;  4CHQ A;  4BE0 A;  3PX6 A;  3LWL A;  4KHS A;  2FBY A;  5KI6 A;  3L2Q A;  4B9V A;  1Z26 A;  3V9U A;  3HK2 A;  1BI4 B;  1SKR A;  3SV4 A;  4KB1 A;  4RW6 A;  1HNI A;  1RT5 A;  3NGI A;  4LD0 A;  3MAQ A;  4E7L A;  1X9W A;  4ELU A;  4F4K A;  3OS0 A;  3PY8 A;  4FLY A;  1S6Q A;  1RT2 A;  3VQE A;  4M3U A;  2HHS A;  2DTU A;  2Z1G A;  1QQC A;  3L2W A;  1O1W A;  2W42 A;  4RW7 A;  1BCM A;  1HYV A;  4FJJ A;  1FKP A;  3DMJ A;  4JS5 A;  3AVA A;  3FFI A;  1WSE A;  2O4G A;  4ZTF A;  4CJP A;  1VSI A;  4B9N A;  1WAF A;  4DTU A;  1L3T A;  4KI6 A;  3VQQ A;  4BE1 A;  2KFZ A;  1LAV A;  4AHC A;  3AO1 A;  1NK4 A;  4I9Q A;  4FJ7 A;  2HVI A;  4FZY A;  4CFA A;  4HHT A;  3ZSV A;  2IAJ A;  1FK9 A;  2DFH A;  3ZT1 A;  4CGD A;  3SCX A;  3OS1 A;  1CZB A;  3NF8 A;  1HMV A;  3V9X A;  4F2R A;  3ZT2 A;  3LP0 A;  3NF7 A;  3PX0 A;  2ATQ A;  3V9W A;  1LAW A;  1F21 A;  4CHP A;  4JS4 A;  2Z1H A;  3O3H A;  4FJN A;  3DRR A;  4B9M A;  5FRN A;  3RRG A;  2RF2 A;  2FBT A;  4RG8 A;  2HHU A;  1TKT A;  3B6O A;  1U48 A;  1NJX A;  4Z4H A;  3MEG A;  1WAJ A;  4KHN A;  4AHT A;  1BHL A;  3AVM A;  4J2E A;  5SZT A;  3CFR A;  4PY5 A;  1IG9 A;  2OPP A;  2X6S A;  1A5V A;  4CED A;  3HJF A;  1QSS A;  2X6N A;  1S5J A;  3SNN A;  2YNF A;  4M3R A;  2R7Y A;  3O3G A;  2ZE2 A;  3K2P A;  3QES A;  4CJL A;  2JLE A;  2A1R A;  1HQE A;  2QKK A;  1SL2 A;  3PV8 A;  1KLN A;  4FJ9 A;  4KI4 A;  1RTD A;  4B9U A;  3DLR A;  1U45 A;  1C0T A;  1NK7 A;  4CEE A;  4DTJ A;  3AVK A;  1XHZ A;  1Q9X A;  3KTQ A;  3AVB A;  4O4G A;  4CHZ A;  1IKV A;  1DTT A;  4IDK A;  2KZM A;  4J2A A;  2ETJ A;  1Q9Y A;  4DTM A;  4OLB A;  3SZ2 A;  3SPZ A;  4JRP A;  3K58 A;  3PX4 A;  3KLG A;  2HVH A;  3OJU A;  3CFO A;  1IKW A;  2HHW A;  4DLE A;  4C8M A;  4FJI A;  3HVT A;  3ZSX A;  4E19 A;  1LV5 A;  1YTA A;  1NJY A;  3KK1 A;  4DFK A;  4FK4 A;  3QIO A;  2F8T A;  2WOM A;  4W5N A;  4CF0 A;  1U47 A;  5K14 A;  5CZ1 A;  4FLV A;  3SJJ A;  4PQU A;  2OZM A;  4E7J A;  4KFB A;  4PA1 A;  5SWM A;  4DF8 A;  4DSK A;  4M3T A;  1JLQ A;  4QAG A;  4FVM A;  4CFD A;  4CK1 A;  4DQR A;  1VSH A;  3OYI A;  1WSF A;  3HXM A;  4FCY A;  4E7K A;  4NCG A;  4FJH A;  4FK2 A;  2P51 A;  3TAG A;  4ID5 A;  3K5M A;  3C95 A;  3NF9 A;  4IG0 A;  4CJ5 A;  3EY1 A;  2YNG A;  4IFY A;  4YNQ A;  3OYC A;  1D9F A;  4NCA A;  3ZT4 A;  4LH4 A;  4FJM A;  3MEE A;  3ZSQ A;  4M41 A;  3V1Q A;  4CJE A;  4H4O A;  3JSM A;  3AVL A;  2IGI A;  5KRT A;  4Y1C A;  1DTQ A;  2FBV A;  3A2F A;  5HP1 A;  3BGR A;  2F8S A;  3VQP A;  3S3M A;  3OVN A;  3C94 A;  4DWI A;  3NBP A;  1HPZ A;  1RDC A;  2X78 A;  4BAC A;  1T7P A;  3OYK A;  1KLM A;  1ZBU A;  4KHW A;  1JLG A;  3ZSZ A;  4O55 A;  1K6Y A;  4FJK A;  1XI1 A;  4Z4C A;  1HYS A;  2FBX A;  1A5W A;  1B92 A;  1LW2 A;  2F96 A;  4GW6 A;  2KW4 A;  3KLF A;  4RW9 A;  3I8D A;  4W5O A;  4Q5V A;  4BE2 A;  4E7H A;  3I0R A;  4QCL A;  1BIS A;  1JXE A;  4E1M A;  3CM5 A;  4KTW A;  4KHQ A;  4AIL C;  2QXF A;  4GVM A;  4LSN A;  3V9Z A;  1T05 A;  4CGF A;  1NK8 A;  4J2B A;  2HHQ A;  1GOA A;  4CJF A;  1NK9 A;  1NOY A;  4FLW A;  1JLC A;  4DTP A;  2ZD1 A;  4I2P A;  3O4Q A;  4DS5 A;  2OYQ A;  3LZJ A;  2WON A;  3OYB A;  4BWJ A;  1RTJ A;  3SQ4 A;  2VWK A;  3QEV A;  4AH9 A;  1ZBL A;  2XY7 A;  4KB0 A;  1I3A A;  4CES A;  4C8L A;  3QIP A;  3LP3 A;  4OGC A;  2IDO A;  2DFE A;  3I0S A;  4UQG A;  1B9D A;  2P5G A;  4CE9 A;  4KHY A;  3F9K A;  4FK0 A;  1IH7 A;  2QKB A;  3BDP A;  2DFF A;  4DS4 A;  4DSL A;  2HHV A;  3ISN C;  5E41 A;  3NGZ A;  3ZCM A;  4L8R B;  1MU2 A;  3SUQ A;  3M8S A;  4AHU A;  1QS4 A;  3LP2 A;  3MEC A;  4ID1 A;  3RR7 A;  3H08 A;  1VSK A;  4OPJ A;  1RDB A;  4HUE A;  1I39 A;  4R5P A;  3T1A A;  3L8B A;  4ZTJ A;  1L3V A;  4F2S A;  3P1G A;  1TKZ A;  5J2M A;  4O5B A;  3NAE A;  3SQ1 A;  1VRU A;  4H4M A;  4B3O A;  3DYA A;  3QLH A;  4CF2 A;  3DI6 A;  4OPK A;  2YKM A;  3QEW A;  1UAX A;  1UA0 A;  2PZS A;  2EHG A;  4FM2 A;  4HUG A;  3DM2 A;  1RT1 A;  1JLB A;  1BCO A;  3OYH A;  4NCB A;  1G15 A;  1KTQ A;  1WSJ A;  3SV3 A;  1RBT A;  3NH1 A;  2XO7 A;  1C1A A;  1RIL A;  1JXB A;  4CF1 A;  2BGG A;  4M3W A;  4FYD A;  3VQ5 A;  3EYZ A;  4OKK A;  5C25 A;  2YKN A;  3MXJ A;  3DLB A;  2VG5 A;  2ZQB A;  3LAL A;  4LH5 A;  2VWJ A;  5I42 A;  1J5O A;  2BDP A;  4CIG A;  4QOZ B;  2G8F A;  2LSN A;  4C8N A;  1JLA A;  3AVC A;  3L2U A;  1CZ9 A;  1KRP A;  4ICL A;  5C24 A;  5J2P A;  1SL0 A;  1CLQ A;  3ZSY A;  1RBR A;  4CF8 A;  3KJV A;  3MXM A;  1VSE A;  3DLE A;  5DK5 A;  3RMD A;  2DY4 A;  1D5A A;  1R0A A;  3NGY A;  4BDZ A;  1S1U A;  3ITH A;  4G1Q A;  4B08 A;  2Y1I A;  2XY8 A;  1TKD A;  3SUP A;  3HP6 A;  4FZZ A;  4FXD A;  3SQ2 A;  4HCC A;  5HRR A;  3RR8 A;  4N41 A;  4ZHR A;  4Z4I A;  3HPH A;  1W0H A;  4J2D A;  5C42 A;  3AVH A;  2D0C A;  1Q8I A;  2P5O A;  3PUF A;  4DF4 A;  2XY6 A;  2OPQ A;  4I7F A;  4KTZ A;  2PY5 A;  3IS9 A;  3K5N A;  4DQS A;  1BQN A;  3CM6 A;  2YHB A;  3G0Z A;  1ASU A;  4OGE A;  3SYZ A;  2G8W A;  4CGG A;  3ZSR A;  1KSP A;  2E4L A;  2KTQ A;  1NKC A;  1RBV A;  1XHX A;  2HNY A;  3TAM A;  5CZ2 A;  5HRP A;  1C1B A;  3VQ8 A;  3ZSW A;  4CFB A;  3HL8 A;  3K57 A;  4LY7 A;  3ULD A;  4FLT A;  1WNS A;  3CYM A;  3QER A;  2OZS A;  4DSI A;  3QNN A;  1YTU A;  3DLG A;  3C6T A;  4CIF A;  1LWF A;  3HPG A;  2OPR A;  4F3O A;  1BQM A;  3S3O A;  1S1V A;  3M8Q A;  1LW0 A;  3DLH A;  4FJX A;  1ZBH A;  1XWL A;  1ZYQ A;  3AA5 X;  3AVJ A;  3DLK A;  4FW2 A;  3ASM A;  3KKR A;  1TKX A;  3LAK A;  3OYE A;  3NCI A;  4DQQ A;  5D3G A;  1L3U A;  3K5O A;  1X1P A;  1ASW A;  1XC9 A;  4CJK A;  1UWB A;  1CXU A;  1U4B A;  4C8O A;  1QHT A;  5J2Q A;  2HND A;  3D45 A;  4B8C A;  1U04 A;  4N5S A;  3OJS A;  2Z1I A;  4CK3 A;  1KVC A;  3HST B;  3QEP A;  5EU7 A;  3VN5 A;  1QE1 A;  2XY5 A;  4IBN A;  3HO1 A;  4AHR A;  2HB5 A;  1QTM A;  1EKE A;  4K8Z A;  1IKY A;  3NFA A;  4IG3 A;  3NE6 A;  3QIN A;  4DTN A;  1U49 A;  4FZX C;  4K8X A;  1EXQ A;  2GV9 A;  3V1R A;  4W5R A;  3QO9 A;  3RRH A;  4Z4F A;  4Z4E A;  3VQA A;  5J1E A;  3LZI A;  1FXX A;  5JS2 A;  1HQU A;  1LWC A;  3VQ7 A;  3S9H A;  4CJW A;  1D9D A;  2GBZ A;  4HTU A;  3TI0 A;  2EX3 A;  4Q0B A;  4KKO A;  1REV A;  2KQ2 A;  3L3V A;  4DU3 A;  1TK5 A;  1HRH A;  1TV6 A;  1S9G A;  2PYJ A;  1RT7 A;  2G8I A;  1TAQ A;  1SL1 A;  3AVN A;  1CXQ A;  1EP4 A;  1ASV A;  4WE1 A;  4DSF A;  3LPU A;  3LWM A;  3V81 A;  1D8Y A;  1RT4 A;  1JL2 A;  3KLI A;  1C1C A;  2G8U A;  1HJR A;  1RT3 A;  3DRS A;  3OS2 A;  4PUO A;  1JKH A;  4BWM A;  1TK8 A;  4DTR A;  3JYT A;  4ELT A;  3M8P A;  1RBS A;  3OYD A;  2E6M A;  4H8K A;  1BIU A;  1C0U A;  1S1W A;  1WN7 A;  4HUF A;  4FLX A;  3P83 D;  1L5U A;  1SKW A;  1KFS A;  4PWD A;  5HBM A;  1TAU A;  4EZ6 A;  2X74 A;  3O4N A;  1SUQ A;  1NKB A;  2YV0 X;  3L2V A;  1GOC A;  3RMA A;  1KFD A;  4EP4 A;  5HRN A;  1JL1 A;  3TR8 A;  4DSE A;  1T8E A;  4KAZ A;  4N76 A;  4DFJ A;  4M45 A;  3PO4 A;  3HT3 A;  3OYF A;  2YNH A;  2A1S A;  4HCB A;  3UIQ A;  4F8R A;  2Y1J A;  2HW3 A;  4EZ9 A;  3OYN A;  1YVU A;  3EZ5 A;  4LSL A;  4W5T A;  1T03 A;  1N5Y A;  2JGU A;  2B6A A;  4CFC A;  2HHX A;  4Z0U A;  2KZZ A;  2GUI A;  3KK2 A;  1NJW A;  3TAE A;  4OKE A;  1A5X A;  4F3T A;  4N47 A;  5CYQ A;  4DFP A;  1LWE A;  3L2R A;  3AO4 A;  1BIZ A;  3C6U A;  1GOB A;  3LP1 A;  2VG7 A;  3VQ9 A;  4CEO A;  1IKX A;  3ALY A;  4CGJ A;  4E89 A;  2BE2 A;  1RDD A;  1ZBF A;  3THV A;  1BL3 A;  3K5L A;  3V4I A;  3U3G A;  3OYM A;  3SUN A;  3IG1 A;  1TVR A;  3L3U A;  3SPY A;  3VQC A;  3LAN A;  4CER A;  4ELV A;  3VQB A;  4FW1 A;  3DOL A;  3U3Y A;  2BAN A;  4OVL A;  3DRP A;  1QSY A;  5T7B A;  1SV5 A;  1C0M A;  5CYM A;  1QSL A;  4IFV A;  3AA3 A;  4CJR A;  1C6V A;  2HNZ A;  4O0I A;  3NF6 A;  5HRO A;  1X9S A;  1TGO A;  1L3S A;  4DTS A;  4M42 A;  1VSM A;  3WNH A;  4KV8 A;  4MFB A;  2IC3 A;  2G8V A;  3IAY A;  4BDP A;  4CEF A;  5KGW A;  4BDY A;  2D0B A;  2HMI A;  1S1T A;  4FJG A;  1Y97 A;  1RBU A;  4CJS A;  5FRM A;  4Z4G A;  4CIE A;  3TAP A;  2XRI A;  4N56 A;  3HM9 A;  3VA3 A;  5KTQ A;  3P5J A;  1N6Q A;  3VQD A;  1BGX T;  1RTH A;  4YFU A;  3LDS A;  1J9A A;  3SUO A;  3NH2 A;  2Q3S A;  3AO2 A;  2XHB A;  3TAB A;  3TAQ A;  1Z25 A;  3OYA A;  1WSG A;  4CEQ A;  3MED A;  4AHS A;  1VK0 A;  4E3S A;  4CK2 A;  3LAM A;  3QEI A;  1RNH A;  4OKJ A;  1EX4 A;  4DQI A;  1S6P A;  2NUB A;  2FC0 A;  3DOK A;  5HLF A;  2QK9 A;  3S3N A;  4KRF A;  2G8K A;  4M3X A;  4M3Y A;  2HHT A;  1JLE A;  4JLH A;  1RDA A;  3NH0 A;  2G8H A;  3AO3 A;  3OYJ A;  4CJV A;  3LPT A;  3O3F A;  3MXI A;  3OYG A;  3KLH A;  3TAR A;  4NYF A;  4OLA A;  3SI6 A;  2KFN A;  4AHV A;  4CJQ A;  3AV9 A;  3QEX A;  3NDK A;  2RPI A;  3HVR A;  1HYZ A;  3ZT0 A;  4CJT A;  5CY4 A;  2RKI A;  3SQ0 A;  1J54 A;  4MQ3 A;  4CEZ A;  4FJ8 A;  3T3F A;  2IS3 A;  3AO5 A;  1DLO A;  1WSH A;  1KVB A;  5KGX A;  3V9S A;  1FKO A;  3KIO A;  5FRO A;  1HNV A;  4HVJ A;  5HRS A;  1UOC A;  1IO2 A;  2B5J A;  3KK3 A;  2B4J A;  3K59 A;  3RMC A;  4CHY A;  1ITG A;  3TAN A;  1KVA A;  4FJ5 A;  1TL1 A;  1EET A;  3E01 A;  4DU1 A;  4E7I A;  4FJL A;  4KO0 A;  3CFP A;  1J53 A;  4FM0 A;  2PYL A;  4CHO A;  3VA0 A;  4CHN A;  4B8A B;  1VSD A;  4CF9 A;  3KLE A;  1KCF A;  3WNE A;  1B9F A;  1UA1 A;  4CCH A;  3QET A;  3D0P A;  1RTI A;  4CJ3 A;  4CGH A;  3AA2 A;  4CEC A;  4CJU A;  4FLZ A;  3RMB A;  4I2Q A;  4OJR A;  1SKS A;  4O44 A;  1NOZ A;  1S9E A;  4DMN A;  3V6D A;  4KRE A;  3M8R A;  5JS1 A;  3VQ6 A;  1W9H A;  2I5J A;  4C8K A;  1JLF A;  3RTV A;  2IOC A;  4CEA A;  4KPY A;  4DTO A;  2ITG A;  3HYF A;  3T19 A;  3ZSO A;  1NJZ A;  4W5Q A;  4M3Z A;  1VSL A;  1RT6 A;  3ZT3 A;  1X9M A;  3OY9 A;  3TWH A;  1NK0 A;  4DTX A;  4KHU A;  3QNO A;  4CJ4 A;  1VRT A;  2P1J A;  3F73 A;  1NKE A;  4DSJ A;  2E6L A;  5FDL A;  4B9S A;  2O4I A;  3KD5 E;  1S1X A;  3WNF A;  3KD1 E;  3CG7 A;  4NYN A;  4GMJ B;  5I3U A;  4DQP A;  1ZBI A;  1WLJ A;  1RCH A;  5DMR A;  4TSX A;  4E1N A;  2Z1J A;  1WSI A;  3CQ8 A;  3AA4 A;  4RW8 A;  4DU4 A;  4B9L A;  3HP9 A;  1YT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...