3V6DA

Crystal structure of hiv-1 reverse transcriptase (rt) cross-linked with azt-terminated dna
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
total genus 147
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v6dA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v6dA05
1TKZA 1UWBB 1DTQA 3TAPA 3OYIA 5KT6A 4QWDA 3SUPA 2OYQA 1NJYA 3OYAA 2HHWA 3DRPA 4H54A 3RB3A 3G6VA 5L1IA 2YHBA 3I0RB 4Q0BB 1HPZA 1L3TA 3F73A 2HW3A 3RB0A 1VRTA 2BQ3A 2UUTA 1BQMB 3DLKB 2WONA 3AO1A 3OJSA 2PY5A 2I1RA 2WRMA 4J9SA 2B6AA 1U47A 3ALYA 1BI4A 1S1TB 2DPJA 5KG2A 4BE0A 4B9MA 1I39A 4M3YA 2V0NA 4CJTA 5KFXA 4Q8EA 3Q8PB 1UA1A 3OVNA 5HLFB 5DQIA 3LWLA 4KI4A 3QNOA 2D5RA 4J2AA 3WNGA 1LW0A 1KVBA 4RW9B 1SV5A 5JXSA 5KFQA 3RAXA 2GV9A 1UWBA 4NLQA 2P1JA 3BJYA 1WN7A 3V1QA 1S0MA 4Y2CA 4AHRA 3NBPB 1VRUB 4N41A 1IH7A 4O3SA 3MTKA 2IGIA 4DTXA 3LP2A 3AVMA 3KK2A 4GC6A 3O3HA 2UVUA 3OJUA 4WXOA 4CGFA 3HJFA 3H5XA 1NOYA 3TAQA 1J5OB 2GIQA 4M41A 4IKFA 2OH2A 2B6AB 3QERA 4E7HA 4TY9A 4DL2A 2YKNB 3QZ8A 4FM0A 4X2BA 1JL2A 3IG1A 1RT2B 1RNHA 5KFIA 3AO5A 5KFPA 1X9SA 3QLHB 2QKKA 4Z4FA 4O3QA 4E1MA 2B5JA 3HXMA 2AX0A 4Z4EA 2YNHB 2GBZA 3LDSA 5SWMA 4Y3CA 1R0AA 3FQKA 3AO2A 4J2BA 1B9DA 2FBTA 1O1WA 5KFYA 3CM5A 4HCCA 4ECRA 3WNEA 3RRGA 2OPPB 5KRTA 3MEEA 4TLRA 4RW7B 3KLFA 3LPTA 1WNSA 4BDYA 4K4VA 1RT7A 1C1CB 4J2DA 3K2PA 4JLHA 1S0NA 3ZT3A 5HROB 3TQ1A 1TL1A 1FKOA 2VWJA 4KO0A 2VWKA 1QE1A 3Q8QB 2C22A 4BE1A 2AX1A 3IS9B 1UAXA 3QEPA 4I2QA 4B08A 1NKBA 1HJRA 2OPQB 1RTIA 4GVMA 4F2SA 1JLEB 1LAVA 1VRUA 2HB5A 1J54A 2E9RX 4FZXC 4O0JA 3ZT4A 1TK5A 4CIFA 1S10A 3E01B 1HQUB 5EWGA 4E89A 3EPGA 2B5JB 1XR6A 4ZP7A 1IM4A 4IRKA 3ZSZA 3C6UA 1CLQA 1KSPA 3ZSWA 1RT7B 1BHLA 3T5KA 3VQSA 4ZHRA 4EP4A 4N56A 3TWHA 4HUGA 1TL3A 1T94A 3MAQA 4DTMA 2W9CB 3NH0A 2ETJA 4CEBA 4W5OA 1OS5A 3IRXB 4OPJA 4ZPDA 1BISA 2FLPA 3NBPA 1QUVA 4J9QA 4EO8A 4DS5A 4DTUA 1CXQA 3I8DA 4PWDB 1HQEA 3T5LA 3HO1A 4ZP8A 1LW0B 5HP1B 4O4GA 4LH5A 3TAEA 1B9FA 1S9GB 4YP3A 1RT6B 4CJPA 2BE2B 3CFRA 5KGXA 4KREA 3TAFA 3CDUA 3O4NA 5KTQA 1S6QA 4KHQA 5KFGA 3OHAA 3IGVA 1KCFA 2FJWA 1KLMB 3TVKA 4KBIA 3I5AA 2IM1A 2HWIA 2VG7B 5KG0A 2FBYA 4CK2A 2Z1IA 3VQ8A 2PYJA 3NF8A 3T5HA 3S3MA 1WSGA 4RNNA 4Y2AA 1T8EA 1TKXB 3SUNA 1KFDA 4QW8A 1WAJA 3T3FA 3OLBA 1L3UA 1X9MA 5EWFA 3OS2A 4EBDA 2BE2A 2F8TA 3KLGA 4FJ5A 2A1SA 4MH8A 4NLVA 4TYAA 3HM9A 1NJWA 5KFKA 3MF5A 3AV9A 2B43A 5HP1A 4DQSA 3JYTB 2VG6B 2JEIA 1UOCA 3SV4A 3H59A 4GC7A 1BI4B 2DFEA 2HHUA 1D9DA 1FKPB 5L1LA 4NLWA 4O44B 2XWYA 2FVSA 1RDRA 1WNEA 2ILZA 4RNFA 4C8MA 3SYZA 2XCPA 3L3UA 3U3GA 3RRHA 3LPUA 3H08A 4I7FA 3KHRA 2XRIA 3KLEA 3UDLA 4CE9A 2R2SA 4NYFA 3ULDA 4FJLA 3IAYA 4M3ZA 3T5JA 1TGOA 3V1RA 4FM2A 3NAIA 1EXQA 4DF8A 1S5JA 2X78A 4EBCA 4JS4A 1N56A 4DTRA 4IFVA 1EP4A 4CFDA 3JSMA 4FLTA 4F2RA 5C24A 4IRCA 4IQXA 1DLOA 4HUFA 2FLLA 3AVIA 3V4IA 4CF2A 3CFPA 2JEGA 4QWCA 4LH4A 4CGIA 3OLAA 4J9NA 5HROA 4KV8B 1HMVB 4NLXA 3KD5E 4ECUA 1S1XB 2YNGB 2CJQA 3K5MA 3ZT1A 2PYLA 1A5XA 2YV0X 4DG1B 2C2EA 1NKCA 5JS1A 4E7KA 3LANA 1KFSA 4RG8A 4Y1CA 4RW4B 3V6DB 3OL7A 4HTUA 4H4MA 1R0AB 1NJXA 3QIDA 4KHYA 1ASUA 4NLUA 1ZBFA 3SI8A 1RT5A 1ZYQA 5J2NB 4DSEA 2UUWA 2D3ZA 3HSTB 5HRRA 3LP0A 2WHOA 1NK6A 4CHZA 1RT6A 1KHWA 5CYMB 2O4GA 3G86A 4NRUA 4QWBA 5KG5A 4M3UA 5K14A 2G8KA 5FRMA 4LQ9A 1J5OA 2XY8A 3VQDA 5EU7A 4AHTA 4C8OA 5KFJA 3G6XA 4G1QA 3AVAA 2WONB 4FJJA 4FLWA 4EO6A 1VSKA 3M9MB 1NK9A 2AU0A 1TAUA 2IM0A 1ASVA 3NF7A 3DI6B 3SNNA 3SUQA 3LP1A 3DDKA 3VQAA 3LP1B 4Q5VA 2OPRA 4RNMA 5L1JA 3K5LA 5HBMA 5KFAA 4WYWA 4DFMA 1GX6A 4E1NA 4FLZA 1X1PA 3KLIA 2ASJA 3EZ5A 3TABA 1KLNA 5KG6A 5F8LA 1S9EB 3AVFA 3DRRB 4DSKA 4R5PB 4K4YA 2E4LA 4HKQA 2Y1JA 1Z26A 4NLYA 4PQUA 4Q8FA 1JLQB 1IG9A 4ZHRB 2YNGA 4KAZA 3GIKA 3L2WA 4RU9A 2IC3B 4HCBA 3RWUA 3DYAA 2XY6A 5E41A 4IDKB 4DTJA 3F9KA 3OYLA 3QEXA 2JC0A 4DLEA 2HNDA 3HT3A 2J6UA 4FJKA 4NLDA 1S1WA 3MEEB 1MU2B 2C2RA 4KFBB 1REVB 3KD1E 4DTNA 4RNHA 4KSEB 2QE5A 4OPKA 1S1UB 3CVKA 4Y34A 4NLGA 4LSLA 4K50A 4GMJB 4O3OA 3KLGB 1TVRB 3P83D 1N6QA 1IKYB 4ECXA 2IM3A 5CZ1A 4IOBA 3RR7A 2W9CA 2BQUA 4QCLA 2YNIA 3NL0A 4EEYA 3IS9A 4CJ3A 4OKEA 4NYZA 4K8ZA 3SQ2A 5KFDA 3NMAA 4HUEA 1HRHA 2FJXA 1J53A 5KFZA 1VSMA 3TI0A 3IN5A 3DLHA 4C8NA 5C25A 1CXUA 4KHMA 2YKNA 4NLOA 2ASDA 4ECSA 3KIOA 3THVA 1SKWA 3KKRA 1RT3B 4KB1A 3K57A 3OY9A 4J9RA 3VQ9A 3QESA 1IKWB 5F9LA 4JV2A 3LZIA 1LWFA 3O3FA 2G8VA 4ED7A 3DLEB 1NNDA 3BGRB 4QPXA 4CF9A 1K1QA 2AGQA 1JXBA 4CEOA 3O3GA 1QAIA 2IDOA 4CGJA 2XI2A 4RUCA 2OPRB 4ZVFA 4J9MA 5D3GA 3RMBA 1HQEB 3DLGB 4F3TA 3DYAB 4F4XA 5CY4A 5CZ2A 4F3OA 1C0UB 3SUOA 2HMIB 3RMAA 4CEZA 4LQ3A 3CYMA 4FZZA 4O3RA 1NK8A 1RT2A 4OL8A 1YTAA 3O4QA 5KFCA 5F8GA 2R2TA 4H4OA 4RW6A 4W5TA 1C1BA 5DQGA 2ZE2B 3MEGB 3RBDA 4B9UA 1RBRA 3HL8A 4M3RA 2OA8A 1U45A 4M94A 4Q45A 3DMJA 2R8JA 1S6QB 1L3SA 3SQ1A 1S1UA 4ED0A 4CF8A 2F96A 4TY8B 3KNAA 2ZKUA 3C94A 4JV1A 4ZTFA 3HK2A 4DU1A 5HRNA 4OVLA 2XY5A 4CJWA 1HARA 2IM2A 3QGIA 5C42A 1RYRA 1RT5B 5L1KA 4DTOA 1RT1B 3HKWA 5DG9A 3MEGA 4M3TA 3NH1A 1WSJA 3V9WA 3KJVA 2P5OA 2ATLA 4FJIA 1JLBA 3I0SB 3AVNA 2HMIA 3OHBA 2KTQA 4B8AB 4F8RA 3U3YA 4KE5A 4IR1A 3H40A 1XWLA 4RZRA 2HNZA 4FLYA 4CGGA 5K14B 2IAJB 1ZBIA 2HHXA 4PUOB 4JS5A 3N6LA 4B8CA 1LWCA 2FVQA 3EY1A 4KHUA 4IG3A 3RBEA 5J1EB 2FLNA 2ZE2A 1REVA 1LV5A 1Z4UA 4CEDA 4HHTA 2WCXA 2P5GA 4URGA 1WSHA 1S48A 5HRPA 5J2MB 1Q9YA 1C0UA 5KFEA 1TV6B 2YNFA 1XR5A 4E7IA 4CEAA 4NLTA 4O5BA 3MECB 1BCOA 4DTSA 1HYVA 2YNIB 2HWHA 1SH2A 4CHOA 1T05B 4ID1A 5KT7A 4RW8B 4CJKA 1HNIA 1S49A 4ED1A 4U7CA 2KQ2A 2RKIA 3S3OA 3H98A 2X74A 4NLRA 4ED6A 1HYZA 4ELTA 3NH2A 1IKXA 1TVRA 2BGGA 4AHSA 4CJVA 1JLAA 4K4SA 4R8UA 2Z1HA 3MR6A 2Z1JA 1L5UA 2J6SA 4BDPA 5HBMB 1NOZA 4PA1A 3ZT0A 4KRFA 2WOMB 4O3NA 4MKAA 1W25A 2EC0A 2V4QA 4YMEA 3CJ4A 1YTUA 1C2PA 3HP6A 4PY5A 1N5YA 3V9ZA 3DLRA 4KTWA 4ZPAA 4QWEA 1SH3A 4URSA 3KLHA 4LSNA 2D7SA 4AH9A 3IG1B 2IC3A 2XI3A 1N4LA 5KFTA 4XPCA 1BGXT 4OGEA 4L8RB 1IKYA 2XGPA 1TV6A 2KZMA 2RPIA 3NAEA 3RTVA 4E7LA 1EETB 4FJXA 5KFUA 3SZ2A 4O44A 3ZSYA 2PZSA 4LD0A 3JYTA 5DLFA 1GOCA 4IG3B 5KT3A 2D3UA 1MMLA 2V9WA 4KI6A 4KKOA 3HVTA 3FFIB 1VSDA 3SQ0A 1RT4A 5C42B 3SFUA 4DLGA 1FXXA 4IG0A 4YNQA 1Q9XA 2BR0A 3PUFA 1VSFA 4IBNA 2R2RA 5F9NA 2G8IA 3P1GA 1U09A 3BSOA 4K4UA 3PW0A 3L2UA 4F4WA 3G10A 3BQ2A 3OYCA 1S1TA 4NZ0A 2QV6A 3K59A 1NHUA 4ZPBA 1RDDA 4QW9A 2IJNA 1N48A 4TSXA 3Q8RB 3DLBA 4YQWA 1RT1A 3CDWA 3GYNA 1VSLA 4CESA 4CJLA 4FJHA 4XO0A 3KK1B 4FJ8A 4CGDA 4IH6A 1DLOB 4W5NA 4Z4CA 3HVTB 2OZSA 3CWJA 2W8KA 4ECQA 3QO9A 3BSCA 1CZBA 1T03B 4F4KA 2ZQBA 3L8BA 3Q8SB 3QNNA 4WFZA 4J9KA 4YR0A 3FFIA 1JLFA 2KW4A 1NK0A 1JLCB 2FVRA 1LAWA 1JLEA 2JC1A 3OYEA 1EETA 3IRXA 4PWDA 1C0TB 3VQ6A 2HVHA 1XC9A 2EHGA 4DU4A 4R0EA 3KJVB 4CECA 4OKJA 4KB0A 3DOLA 2JEFA 2ALZA 4FW1A 3C6UB 2IJFA 3GIJA 4FBTA 3M8SA 3TARA 3H4DA 3BREA 1C1CA 3K5NA 4O55A 1K6YA 1L3VA 4C8KA 4M42A 3QEVA 4K4XA 1GOBA 1A5WA 3HVAA 3JSMB 3GV5B 2C28A 2VG6A 2FVCA 5SZTA 2HNYB 4MK8A 3PW4A 4CEQA 3KKSA 3MEDB 4MK7A 4YR2A 3AA2A 3UIQA 4KHRA 3AVKA 3VA0A 3QYYA 1TK0A 3OYHA 4OKKA 4I2QB 1HYSB 4RW6B 4TQRA 1QSLA 4CCHA 1RDBA 5EWEA 1D9FA 3HYFA 3ISND 1QE1B 2OZMA 3QIPB 4LSNB 3D0PA 3V6HA 3ZSOA 4TYBA 1FKOB 4FJ9A 3L2VA 2AJQA 3ZSXA 1RBSA 4IFYB 2C2DA 4FVMA 4NLPA 1Y97A 2KZZA 2AGOA 1SKRA 1YVUA 4J2EA 1JKHB 3RMCA 3DRSB 1KRPA 4FJMA 2OPSB 5F8MA 3OYJA 3C6TB 1FK9B 4R8UB 4R5PA 4DF4A 3T1AA 1RTIB 3H4BA 5J2QA 1Q8IA 2IAJA 1KHVA 3PJWA 1MU2A 3HVRA 4CJEA 1XR7A 1JLCA 2VG5A 3AA3A 1TKXA 4OLAA 3BSNA 3VQCA 3E51A 1WAFA 4CJ5A 2WB4A 2XC9A 3QGHA 4FW2A 1LW2B 4BDZA 1ZBLA 1QHTA 2VG7A 3OYDA 2BANA 2BRLA 2AWZA 3PW2A 1SKSA 3ZSRA 1EKEA 3TAGA 4DQPA 4WE1A 2RN2A 4IH7A 1B92A 5KG4A 1U04A 2E9TA 4ZVEA 4KAIA 2DFHA 2BDPA 4J9PA 2G8UA 2HAIA 4EYIB 4ZPCA 4LSLB 5CYQB 4PUOA 4B9NA 3V1OA 4TXSA 4EZ9A 3E01A 3HPGA 4CF0A 1RT4B 3M9OB 3NF9A 3MXJA 1GX5A 4MFBA 4BACA 3BDPA 3KMSA 2RDJA 3ITHB 4J9OA 3BQ0A 4B9LA 3OL9A 5JUMA 3AVJA 4OJRA 4DL6A 4O3PA 4W5QA 3AO4A 4ED3A 4WXWA 1VSEA 3DRSA 1S1VA 4ID5B 5KG7A 1ZETA 3VQ5A 3NAHA 4CIGA 3V81A 4FM1A 4F4YA 1HQUA 1GOAA 4B9SA 1KTQA 4CHNA 4JRPA 4Z4GA 2IBKA 1S1XA 3SPYA 1JLGA 3V6KA 2FBXA 3MR3A 1RILA 1HPZB 5KG3A 1LWEA 3KMQA 3HVWA 3LP0B 1QTMA 1RA6A 3EYZA 2ILYA 3SCXA 5HLFA 2CKWA 3OSNA 2RF2B 3D5MA 1RTJA 1S6PA 3EPIA 2FBVA 1XHZA 1RTDA 1C1BB 1ZTTA 2O5DA 1TKZB 4DSFA 1CZ9A 4H8KA 1RTHB 4DFKA 3SFGA 4CJSA 3CIZA 5KRSA 4KO0B 1WSFA 1A5VA 4XPEA 3H5SA 4G1QB 3CQ8A 2BANB 1JKHA 1J9AA 4B9VA 4ZP6A 4FK2A 2FJVA 2YNFB 2X6NA 3DOKA 1XHXA 2OPPA 4Q0BA 5EDWA 4DFPA 4YR3A 3QIPA 3KLFB 4MKBA 4AHVA 3SJJA 3V9XA 1I3AA 3HP9A 3FSIA 4O4RA 1HNVA 2HNYA 3MXMA 5J2QB 4TQSA 4U6PA 3M8RA 5KFSA 3U6FA 3C6TA 1QSYA 3M8QA 2HHVA 1JL1A 5KT5A 4TN2A 4FZYA 4RW9A 5J1EA 4UQGA 4CIEA 3KLEB 4IRDA 1CSJA 3CJ0A 1YT3A 3PZPA 4DU3A 1Z25A 2P51A 1BL3A 1VSIA 1S97A 5KFMA 2GC8A 3VA3A 3I0SA 3G6YA 1U4BA 3OYMA 2A1RA 1UA0A 5KFBA 1RYSA 1KVCA 2RDIA 3K5OA 4MK9A 1D8YA 2ATQA 3T19A 2QK9A 4ICLA 1VK0A 4M95A 4XIUA 4FCYA 3LP3A 3PW5A 1JLFB 4IFVB 1SV5B 4KHWA 4MIBA 5KI6A 2R7YA 3ITHA 1I6JA 1SL1A 1S6PB 3MFIA 1IKVB 2B4JA 3H5YA 2HNDB 2AQ4A 4E0DA 4IG0B 3TAMA 2ZD1B 3KK3A 4E3SA 2W42A 3V81B 3VQ4A 4CFAA 2W9BB 3AVCA 3PX0A 4ED2A 1WSEA 2WTFA 3KK1A 2E6LA 5DMRA 3VQEA 4H4MB 1W9HA 4PQUB 3FDSA 4AILC 1VSJA 4WE1B 3S9HA 3PO4A 3RB4A 5KFOA 3AVLA 3LP2B 4I9QA 3KOAA 5JS2A 4I2PB 3B6OA 5C5JA 4CHYA 4WZMA 2BRKA 4DTPA 3NKYA 1TL3B 4ECZA 5FRNA 4BWJA 4EYHB 1SL2A 5I3UA 2FVPA 5KT2A 1RCHA 1N5YB 3PJXA 4ELUA 5FDLB 4O4GB 5DQHA 3KK3B 3H5UA 5KFVA 3DI6A 4CJ4A 5KFHA 3PY8A 4CEEA 3D45A 1SUQA 5DGAA 3RB6A 3SV3A 4KTQA 4DS4A 1RBVA 2E9ZA 1SH0A 2EX3A 1VRTB 1D5AA 1RT3A 1D0EA 2F8EX 4FS1A 3N6NA 4IKAA 2X6SA 4CFCA 3GILA 2HHQA 3DOKB 4IH5A 2DTUA 5C24B 1TKTB 3CFOA 1BIZA 5KFLA 4CHPA 4FLXA 5L9XA 4E7JA 5KFNA 4YFUA 3CM6A 1QAJA 4W5RA 2XY7A 3I5CA 4Z0UA 3BQ1A 1S9FA 1T7PA 2J6TA 4KKOB 2HHTA 1RTHA 5EUHA 2W7PA 3PX6A 2YHAA 3LALA 3CJ5A 4DFJA 3QIOA 1N6QB 1ZBUA 3BGRA 1BCMA 4ECVA 4NRTA 4EP5A 4IFYA 4Q44A 3RMDA 4DG1A 1HNIB 1IKXB 3PO5A 5F8HA 5KFFA 1S1WB 1WSIA 1TP7A 4RW8A 3VQBA 2WK4A 4NYNA 4I9LA 5J2MA 3K58A 1NKEA 3ZSQA 3B6PA 1BQNB 4Z4HA 4CFBA 3WNFA 2XGQA 3MR2A 3OYNA 4CGHA 3DM2B 4K8XA 4DL7A 4HYKA 1C1AA 5HRSA 5DLGA 3KLVA 2QXFA 2GIRA 4QAGA 5KT4A 4CJRA 2JGUA 3DRRA 2GUIA 5DG7A 2XO7A 4M45A 3CG7A 2I5JA 4K4WA 1TKDA 2RF2A 5I3UB 2DPIA 3ICLA 3SPZA 3DOLB 1T05A 1S0OA 2HNZB 3S3NA 4AHUA 3BSAA 3QEIA 4IR9A 3HPHA 3QZ7A 3AA4A 4AHCA 1FKPA 1JXLA 4QWAA 2XHBA 3NCIA 2IMWP 4FBUA 2VA2A 4H4OB 4FK0A 4FJGA 4KPYA 1XI1A 1ZBHA 2IA6A 3VQPA 1BIUA 5FDLA 1LWCB 3OYBA 4FLVA 3NGDA 5CYMA 1BQMA 2W9BA 2DFFA 2E6MA 2UVVA 3HPOA 2ITGA 3OL6A 4ECYA 5D3GB 4BE2A 4RUAA 2Z1GA 1TQLA 4NCBA 4Y1DA 3LAMA 4NCGA 4FXDA 2XCAA 3MR5A 4F4ZA 4WZQA 3V9SA 2QKBA 1DTQB 2G8HA 1NJZA 4WFXA 4ICLB 3NHGA 3BR9A 2D0BA 3OYGA 3M8PA 5DGBA 4N47A 4ZVGA 4DEZA 1LW2A 4KV8A 4K4TA 2AGPA 5DK5A 5J2PB 4G3IA 1TK8A 3ISNC 2R8KA 3TAMB 1QS4A 3UQSA 4ECTA 3D28A 3G0ZA 2R2UA 1X9WA 2D41A 3SI6A 3VQ7A 4DL4A 3AVGA 3KHHA 1RTDB 3QGGA 2OPQA 4GW6A 3N6MA 5KFRA 1VSHA 3SQ4A 4Z4IA 1KVAA 5CYQA 1RTJB 5KFWA 3LWMA 4JV0A 3V9UA 1LWFB 3ZSVA 4B3OB 3GIMA 3DLEA 1LWEB 2YKMB 3KHGA 3PHEA 4QOZB 3PVXA 4MQ3A 4KTZA 4DL3A 4KB7A 3CDEA 5F8JA 3RAQA 2BQRA 3TANA 1C6VA 1C0MA 4CERA 3QEWA 4WFYA 3DM2A 5T7BA 2NUBA 4N76A 1NK5A 4JRQA 3DLGA 3GV8B 4E19A 3M9NB 1HMVA 4ELVA 1JIHA 3L3VA 1DTTB 3PR5B 1S1VB 3KLHB 1SL0A 3AVHA 4OLBA 3V4IB 1JLQA 3M8QB 2R8HA 3H2LA 2R8IA 3NE6A 2I5JB 2D0CA 2G8FA 1NK4A 1HNVB 4CF1A 3KLIB 4EZ6A 4KFBA 3GV7B 3WNHA 4M3WA 3AVBA 4MFBB 2Q3SA 1U48A 4FK4A 4MIAA 5C25B 3CO9A 1RBUA 5T14A 1RAJA 3OSPA 4JUZA 3NGZA 5J2PA 1QSSA 2RKIB 1JXEA 1IO2A 4NCAA 1U49A 4FS2A 4IDKA 3M8PB 3OL8A 4RW7A 4DQQA 3MXIA 4O0IA 3ASMA 3CJ3A 5FROA 4DSJA 2IOCA 3NDKA 1S9EA 2V4RA 3C95A 4B3OA 1TAQA 1G15A 4HVJA 1F21A 3MEDA 3PW7A 3OS1A 2G8WA 4CK1A 4CEFA 1ITGA 1KLMA 4NCGB 3QO9B 1S9GA 5DG8A 3LAKA 4M3XA 3GQCA 3I0RA 2UVRA 1ASWA 4URQU 3PV8A 1RDAA 2W8LA 3DRPB 4KHSA 2KFZA 3QLHA 1NHVA 3L2QA 5F8IA 4TY8A 1WLJA 5J2NA 1D1UA 1YVFA 3AA5X 2D0AA 3VN5A 3RR8A 3OYFA 4ID5A 4CHQA 4DQRA 4B9TA 1EX4A 2VA3A 3GIIA 2ASLA 4Q43A 1QQCA 4ZTJA 3PR4A 4CJQA 4ZVHA 1C0TA 1BQNA 1JLBB 4ECWA 3NGIA 4N5SA 3A2FA 3EZUA 1RA7A 5F8NA 3DLKA 2KFNA 4EBEA 4FLUA 1W0HA 1T03A 3HHKA 2VG5B 4CJUA 2ZD1A 2R8GA 3ZCMA 1IKVA 3NGYA 5I42B 2IS3A 3OYKA 4NLSA 4DSLA 3QINA 1FK9A 4RW4A 3V6DA 1K1SA 3PX4A 3DMJB 3FRZA 2OPSA 3LZJA 3L2RA 1JLAB 3KTQA 1TL1B 3FQLA 5KGWA 4DL5A 2W7OA 1S4FA 3V6JA 4C8LA 2HVIA 2JLEA 3CJ2A 4ZP9A 1RDCA 1DTTA 3I5BA 4ED8A 3ZT2A 4FJ7A 3MECA 3VQQA 4WYLA 4RNOA 3P5JA 1HYSA 1RBTA 2DY4A 3NFAA 3KHLA 3IGNA 4K4ZA 1NK7A 4J9LA 5KG1A 1IKWA 1EP4B 2FC0A 2YKMA 2WOMA 4FJNA 5I42A 3OS0A 1TKTA 1JX4A 4DSIA 4CJFA 4I7FB 3NF6A 1ZTWA 3TR8A 4CK3A 3UR0A 4DMNA 3AO3A 4OGCA 1T3NA 4F50A 2Y1IA 4LY7A 2W9AA 3QETA 2YNHA 1JLGB 3UPFA 2HHSA 2O4IA 4I2PA 2JEJA 2F8SA 3KK2B 1SUQB 2UVWA 4KHNA 3MFHA 4BWMA 4FYDA 4ZMMA 4DQIA 4DWIA 2LSNA
chains in the Genus database with same CATH superfamily
1ZH5A 2XMUA 3DHXA 2VC0A 3SUPA 4F04B 1IBLF 2PMHA 2JL9A 5L1IA 4ES2A 3EGNA 1Y7PA 4BR4A 3DOMA 1HPZA 2HW3A 3BYRA 1G3OA 1VRTA 3MN5A 5LMUF 2LQJA 1BQMB 3DLKB 1YHQS 3QFWA 2MJNA 3OJSA 4ZPVR 1FJGF 2WRMA 5AQYA 5CCLA 1S1TB 2B9YA 1XNQF 4FVUA 4RUBA 4M3YA 2XTJP 4NLBA 2KXNB 4CH7A 1UA1A 3OVNA 1X8DA 3J7YU 3WXMB 2B4VA 4J2AA 2VBZA 3WNGA 4RW9B 2ZH5A 2N82B 3H2UB 4UOFA 1WN7A 1S0MA 4AHRA 3NBPB 3A8KA 1NGEA 1IH7A 2DHGA 2VQFJ 2QWQA 1FRHA 3MTKA 3AVMA 4WXOA 2RE1A 4CGFA 1J5OB 2GIQA 4EHUA 2OH2A 3QERA 4TY9A 3VERA 4WFNQ 4DN9A 3QZ8A 1RT2B 2K1RA 4IJAA 3AO5A 4DV6F 5AQGA 5KFPA 3UO0A 3EWGA 4Z4FA 2E20A 3ZTSA 2AX0A 4Z4EA 1N34K 4PG6A 2YI1A 5IT4A 4LFCK 5SWMA 3KUEA 5HL7L 3D68A 3GMGA 4H03B 1DQ9A 2QTWA 5KPTA 3L0QA 1RAIB 3IBWA 3DN9A 3GR1A 1FRKA 1U0SA 3R97A 3OR2B 5HK4A 4B17A 3UCGA 4YB5A 2QT7A 2OPPB 4IOAL 1WNSA 1ULRA 4YY3K 1HBOB 2ZH3A 2CWKA 4OI4A 3JXOA 4WCEL 2A6OA 1YJTA 5CABA 4K59A 2KJWA 3IS9B 2V2VA 3NCPA 3T1YF 2EK1A 4GKKJ 2KRBA 1UAXA 1TUWA 4I2QA 4GVMA 2UV8A 2PMZD 1X0FA 1JLEB 1UKUA 1J54A 1G7CB 1FHTA 1I5OB 4Y2IA 4O0JA 4GV9A 2GFFA 2OHDA 1S10A 2FYXA 3E01B 1VQ5S 1IM6A 1CULB 1X3NA 5ETNA 2VFSA 3R2CJ 3ZSZA 3POTB 2LXIA 5B0EA 4N56A 4EP4A 4C0OC 3TWHA 4KGKA 4JI3F 3R7SB 1TL3A 3MUTP 2AF6A 4W5OA 2ZVSA 1RQ0A 4B3RF 1BISA 1NMDA 2LQ9A 3G4SS 3FZFA 2UU9F 1QUVA 3PTWA 4F67A 4J9QA 1NH8A 3ZETA 1CXQA 3ENOA 3I8DA 5D6GA 2IVMA 3QJJA 3T5LA 1FJCA 4P52A 1LW0B 3QGPA 5HP1B 4O4GA 3NS6A 2Q0UA 3P31A 2IVYA 3RSEB 3Q22A 4YP3A 2QZ8A 2EG2A 1MROB 2NUHA 2BE2B 3CDUA 5DETA 1WHYA 2R4FA 3PCOB 4KHQA 1KCFA 5H9FJ 1KLMB 2HWIA 4HHHA 5KG0A 4CK2A 1UFWA 3VQ8A 3NOGA 3NF8A 4A5BA 2GMLA 1S57A 5B0DA 1TKXB 1HWLA 2BYCA 4DR6F 4A8MP 4C1NI 2NS1B 5EWFA 3O6WA 3OS2A 2ALYB 4EBDA 1S4EA 2QFJA 1W26A 3FZKA 3PRVA 4TYAA 2FHOB 5KFKA 1N88A 3MF5A 1NGJA 2RHSB 5JJBA 5JLHA 3JYTB 3OTOF 2OANA 2VG6B 1UOCA 5HQ8A 1SPBP 4JOUA 2NLWA 2ZH9A 3HSCA 2YXLA 1UFLA 5L1LA 4NLWA 2JZ5A 4Y2KA 4CZEA 3RGIA 2K7KA 2LU2A 2G2YA 3MCNA 2JWLA 4C8MA 3SYZA 2L3MA 1OQ3A 5EGYA 3KHRA 2ZOMA 3OR1A 3ULDA 2CFXA 2GO8A 3IAYA 4IZ9A 4DF8A 3IAS9 4DR7K 2X78A 4EBCA 1CG2A 3TJ9A 2RDDA 2DO4A 4ZCKA 4CFDA 3JSMA 1RCXB 5L46A 2AP6A 3UKRA 4F2RA 5C24A 1YZ7A 2O8FB 2FDNA 1DLOA 1KC8O 3V4IA 4CF2A 5LMUK 4LH4A 4JKGA 2QJ3A 3BBFA 2GCFA 4ECUA 3MCPA 2H1YA 3K5MA 4DG1B 1BWVA 3PKYA 2PAVA 2AA4A 3TA0A 4RG8A 9ATCB 4UZBA 1VBXA 4P6QA 1AFIA 2V5HG 1ZPVA 1SIZA 1NJXA 4UY8O 1UMJA 2ZEJA 3SMSA 3NGTA 1ZYQA 5J2NB 2HKEA 4WFAQ 4DSEA 2BJ8A 2D3ZA 1NK6A 2AT1B 3LDLA 4CHZA 1YJUA 4X65F 3KDOA 2ZH7A 2KI2A 2QLFB 4LF8J 2H3GX 3HFKA 2YKAA 4Z2XA 3VQDA 5EU7A 2QLJB 4AHTA 3HF5A 2UU9J 4MDBA 1XMBA 4UZCA 3D2EA 3G6XA 3HM8A 1U24A 4FJJA 1RHJB 4F3QA 4ENOA 4EO6A 1VSKA 2OTJN 3HFZB 1TAUA 3J80O 4L6V3 3A8EA 3SNNA 2IVOA 2NRZA 2B9EA 5IQQA 4FWMA 3P4IA 4QPTA 1VQ5N 4OZJA 3K5LA 3VVUA 2OUGA 1FDBA 4OYOA 1X1PA 5B0AA 1KLNA 3MCMA 5KG6A 5D15A 1S9EB 2XMKA 4DR5J 2Y1JA 5DDRC 2GAHC 4RPFA 3VR1A 1V3RA 2RRAA 4Q8FA 3UI3A 1JJ4A 3MM8A 4RU9A 2HHPA 3WZ0A 3NLCA 2A40A 3DYAA 3CCES 4DTJA 3M8WA 2C3OA 3QEXA 2GVDA 2GHVC 4DLEA 1IBLJ 4F9OA 2J6UA 1HHTP 4FJKA 1MSWD 2MLYA 2C2RA 1NGBA 3OUYB 3KD1E 4OPKA 4U67Q 3CVKA 4HH0A 4HTJA 4Y34A 2C3YA 5ITHA 3LDQA 4GMJB 3H25A 1WUUA 1R0CB 5DM7L 2IM3A 2W9CA 1SIWB 5K8OA 1F9EB 5M2PA 5E3CA 5KFDA 1BLUA 1GLFO 4HI1A 4H0TB 1VI7A 4ZJLA 3IN5A 4HVZA 2FF3B 3CMAN 3KIOA 2RRNA 4XH1A 1RT3B 2KT5A 1IKWB 2HVEA 4JV2A 3LZIA 3CCQN 3NWRA 2G8VA 1Y3JA 4ED7A 2F9TA 3MX2A 3DLEB 5F3TA 1K1QA 2AGQA 4CZGA 2J9CA 2P6SA 3OBIA 4HHUA 2XI2A 2R7QA 5LSRA 1F5BA 5ADXH 4F3TA 4ER8A 3VGLA 3CTRA 2LQBA 4DBQA 2DCUB 1C0GA 3R3LA 2GTDA 4H0VB 3EL2A 4C98A 4FZZA 4O3RA 4F0KA 4OL8A 1YTAA 2UXDK 1SJRA 5DQGA 1PBAA 1HWIA 2YQ3A 2FIUA 2YHWA 1RBRA 1Q79A 1P9YA 4M94A 2BJ1A 1DT9A 2CNKB 3SLCA 3FR0A 3SQ1A 1S1UA 4X65J 1YZ6A 4XK8C 4LF9J 3MMVA 3ZYYX 5BREA 3DOMB 3CDAA 4EAHD 3GFZA 3MM6B 5CYJA 2OD6A 4PYAA 3MN9A 4OJ3A 4TU7A 3IM9A 2FJEB 1APSA 2IM2A 2LA6A 1WC3A 3BY5A 2NXNA 2KL8A 1FD8A 5GADI 5L1KA 2OAUA 3QJPA 1RT1B 1JNZB 3MEGA 4M3TA 5ADZA 2ATLA 1WSRA 1P9QC 4FJIA 3AVNA 2HQIA 4FXVA 3PJ9A 4GVLA 1MN9A 3RG6A 3PSFA 1ZM4A 4B8AB 1GLDG 1VQNN 4F8RA 3U3YA 4KE5A 4QZVB 1NGHA 4QIGA 4IR1A 1XWLA 1EWQA 2HNZA 3LDOA 4PKDB 2VOOA 4PUOB 5B0CA 3L9ZA 4IEEA 2J8AA 4JS5A 3N6LA 4CZMA 4OLPA 4KHUA 4DPTA 1X31C 2CDQA 5HOOA 5H1SV 3PIPQ 2ZHBA 2YWGA 1TYQB 1BWEA 5DS7A 4URGA 1Q9YA 1C0UA 4N77A 4C0BA 4ZIWA 4E7IA 2B9WA 2IA0A 4NLTA 4O5BA 3J7AN 2YNIB 3KWIA 1T05B 3QICA 3WUHA 5KT7A 3D4JA 4RW8B 1OPZA 4OZ5A 4NEZA 1Y0HA 2RKIA 3M7VA 2B56A 4NLRA 4WU2A 5CXTA 4ELTA 1HFEL 2QXLA 4FZVA 2MGZA 1PYOB 3MDFA 4R8UA 3SQGB 3MR6A 2J6SA 5E33A 3GCXP 4CH0S 4PA1A 4KRFA 4QU7A 2EC0A 4MKAA 2VH7A 5HO4A 2XMTA 2ITMA 3HP6A 4PY5A 1WBBA 2RAQA 1CJUB 4QWEA 2LYVA 2F7VA 3R8EA 4AH9A 5I3PA 3JQMA 3D1HA 4QOTA 3GG4A 4XPCA 1N36F 4DV0K 1EETB 3N4WA 1X7VA 4L72B 3QBCA 2OEMA 3UDEA 5BYSA 3ZSYA 3CMES 4J37A 1Z6RA 4AQYK 1VQON 1QM9A 5BRHA 2DRBA 5GAGP 4DCHA 3TJ8A 1ZA2B 4J5OA 5C42B 3SFUA 4ATNA 1FEHA 5KOWA 2M2BA 3SMPA 2K8GA 2DY9A 1X5TA 1K0TA 2BR0A 4N8NA 3BM7A 1WDDA 3BQ2A 5JVHL 5DM7Q 4H5RA 1NHUA 4K0KK 1RDDA 3Q8RB 1RT1A 1UETA 4ILLA 4CJLA 4XO0A 3VEZA 1UWAA 1U6BA 4CLWA 1SJ3P 1HNXF 1DLOB 4CLYA 5CZVA 2OZSA 4ECQA 1SC6A 1CZBA 4F4KA 1VRQC 2ZQBA 3THYB 4J9KA 4YR0A 1JLFA 1NK0A 3F5TA 2YQ0A 1M90T 1VLOA 2PD1A 3LM9A 4PG8A 1U2VA 2F63A 4YDXA 3KJVB 3ZLJA 3GOIA 4KB0A 2ALZA 3GJQB 1NDKA 3GIJA 3M8SA 1SC1B 2YJEA 4DV7K 3H4DA 1C1CA 2XZDB 3AJ1A 3OFHA 1CJUA 4C8KA 4K4XA 3J81Y 3HVAA 2VPZB 2C28A 4JV5J 2VG6A 3G8QA 4LF6F 5DDPC 1VQPS 3ZTRA 3UR3C 4MK7A 2C2KB 3L09A 1QQOA 3QWPA 1ZZFA 2NYIA 3AA2A 3GSIA 3UIQA 3TW0A 2OEKA 1N5VA 4OKKA 4I2QB 3AQPA 5GINA 4RW6B 3J7AP 1QSLA 1RDBA 4ILHA 3M2UB 1RHUB 3AGRA 4LSNB 3V6HA 3ZSOA 2RD5C 2ZUGA 4IFYB 4NLPA 4JI2J 4X84A 3HULA 3VETA 1CPZA 2ZBCA 1M1KT 2M4MA 1I94J 2DNRA 3IMXA 4MLEA 3IR7B 2AJ4A 3D7SB 2OPSB 5F8MA 3C6TB 1FK9B 1M5HA 1RTIB 2J7UA 2HIYA 1RAFB 3PJWA 1RU1A 4C7QA 5BR8K 1B70B 4CJEA 2YX7A 4UY85 5C15A 3ZZ0A 2GMHA 2E2OA 2XC9A 2KHOA 1TL4A 5D4OA 3QGHA 1XMQJ 2CWXA 2OFGX 1MWZA 3PW2A 2PEBA 4V1Ak 3Q83A 4WE1A 2RN2A 4IH7A 1B92A 1Q7YO 5KG4A 4FF2A 4MAKA 4ZVEA 6FD1A 5H9EK 1YRTA 2DHAA 4ZPCA 4LSLB 4B9NA 4X4VA 4HACA 4JI1J 4C11A 2DR8A 1LQ9A 3E01A 3M9OB 3NF9A 1EQMA 2EG1A 3IR5B 4C11B 2BJ9A 4JKCA 3BDPA 4FPAA 2RDJA 3Q2TC 4J9OA 1QZ5A 3I96A 4OJRA 3D0GE 1Q81T 4BROA 4DL6A 2I38A 4IUFA 4DV3K 1LFPA 3EE3A 4ZLLA 2DT9A 2X3GA 1MN7A 4HT5A 1N5TA 1DBDA 1T6CA 3MWPA 3EVWA 5MLCV 5GAGI 1HHSA 4V19S 3DCAA 5J1NA 4CIGA 5DJBA 4JKEA 4F4YA 3CD5A 5EHHA 4NA2A 5HAOA 3IBCB 2A6AA 3G2XA 3MR3A 2EKNA 5K8PA 1HPZB 1WC0A 3VMFB 3W3SA 1RDUA 3SCXA 4NL5A 2ZVIA 5GADU 1RKIA 2RF2B 2ZH6A 2XG8A 1RTJA 2PO4A 4DV2F 1S6PA 3WXIA 1Q8LA 4IQMA 5GAEP 4X66K 1C1BB 3D6RA 1RTHB 4DFKA 4CJSA 3CIZA 5AXLA 2O8CA 1JJCB 1A5VA 4XPEA 3CJKB 3ZX0A 4G1QB 3S41A 1KN6A 2BANB 3CCQS 4A2AA 2N7YA 5AQNA 3G96A 5KQ8A 4KJIA 2FJVA 2YNFB 2OKQA 2X6NA 1XHXA 3KLFB 4DV4K 2ZBIA 4XDDA 5M1KA 3HP9A 3FSIA 3TNVA 2MSSA 2ZNZA 5E3QA 3NGKA 1EIYB 3PACA 4WQ4C 3U6FA 2DYAA 1QVFR 2MPUA 2QA1A 2P9PB 5KT5A 4TN2A 2J8SA 3I55N 4RW9A 4NE9C 4USWA 1CSJA 3CJ0A 1DQAA 3PZPA 2D74B 4NASA 3C6HA 2P51A 3VGMA 1S97A 3ZZYA 5KFMA 2GC8A 2IDEA 2B4PA 3VA3A 1PG5B 4A59A 1R8PA 2QMWA 3LO3A 4CZFA 1KNZA 1WDTA 1U26A 4MK9A 2ADCA 2Z57B 2NRHA 2HSTA 3CCLS 3AARA 1JLFB 3F41A 4KHWA 5KI6A 5B0GA 4I56A 4RX6A 1GMWD 3N01A 2BMBA 1YTYA 5AQVA 4E0DA 1XMQF 4IG0B 3TAMA 2XS2A 2ZD1B 3KK3A 2MKSA 4HACB 2W42A 4WTYA 3VQ4A 1KOHA 2W9BB 3FCWA 3AVCA 3VTIA 1F5CA 2BUNA 4ED2A 2LEAA 3HD1A 4Q2LA 5A8RA 2RUGA 4DKWA 3SBGA 3OXLA 5DMRA 4H4MB 4B3MK 4DOZA 2SXLA 4WE1B 1VQPN 3IM8A 3HHLA 5KQDA 1FD2A 2OTLN 2JRSA 4YHHF 3G71N 3AA9A 4DTPA 2UUBJ 2OFHX 5ETQA 4CZLA 4WQ5A 1E4FT 1NU4A 4PWWA 4NXMK 5U47A 1FESA 4LVOP 2YKQA 1WTFA 4UUWA 1XNRJ 5KT2A 3M8YA 4O4GB 5AXKA 4X62K 3DI6A 2QC3A 3D45A 1SUQA 1Y00A 2PA8D 5DGAA 1PC5A 3T69A 2ROPA 2KKHA 3HSJA 4LF6J 1SZ2A 3JTOA 2VGNA 1D5AA 2NZCA 1D0EA 5BPMA 4JN4A 4IKAA 2VBXA 5B7WA 2EK6A 3GILA 3W3DA 4IH5A 3CPWR 4QR2A 2B4OA 4CHPA 4YOEA 3CPWM 3CF5L 5L9XA 2CQGA 5KFNA 1U7LA 4W5RA 1QAJA 4Z0UA 2J6TA 4KKOB 2BW2A 2W7PA 3GZ7A 2YHAA 3CJ5A 3OXFA 1E6VB 1P8ZA 2YPZA 1RWKB 3QIOA 5BR8F 3BGRA 2CVIA 2DBBA 5SUHA 5B0BA 4EP5A 2NREA 3E2EA 4WFNL 3TEHB 3MMJA 2KJVA 1O5JA 4W92B 2CJKA 1WSIA 1TP7A 4XH5A 2IBOA 3DKDA 4OYAA 1SC4B 4DR2K 1U2VB 2D4WA 3B6PA 3DC2A 1ILYA 4CFBA 1WORA 1YSJA 4K8XA 1NDPA 2WW4A 3I9V9 1SQGA 2B7CB 2QXFA 4WF9L 4QAGA 5KT4A 2CJBA 4QQBA 4GKKF 4DR4J 1LXJA 2XO7A 1S5ZA 5IOLA 3CG7A 2I5JA 3BH6B 3DAWA 1VQSA 2CPDA 1RUSA 3BKUA 3TVYA 2FSKA 3SPZA 2F4VK 3VGVA 2Z30B 5LXRA 5EVZA 4DPWA 3BSAA 1UVJA 1N8RO 1X4AA 1N33J 3AA4A 3WC2A 1LWXA 2CJYB 4QWAA 3HHNB 2XHBA 2VA2A 3BBCA 3C19A 3FBFA 3ZZRA 4C4WA 1LWCB 3SCIE 4FLVA 2DFFA 8RUCA 1RHQB 3WQPA 4K5RA 1OQ6A 1D4XA 5LY3A 1LK7A 2NRVA 2O8DB 4ZJQA 4W4MA 3RZAA 4BE2A 3BZQA 2DH9A 3BV8A 3O44A 1TQLA 3SCLE 4DV2K 1XQSC 2PSZA 1X9JA 4X66F 4F3MA 5CQGA 2EFGA 3V9SA 3MN7A 2QKBA 5FPMA 1DTQB 1CJVA 3DU5A 3KJNB 4H4KC 3NHGA 1K9MO 3FBBA 2VDHA 2D0BA 2FJAB 2EFOA 1X4CA 3OYGA 3M8PA 2HGLA 4N47A 1S72S 4ZVGA 1FJGK 3HD2A 2NR0A 1LW2A 4K4TA 2AGPA 2CPXA 1TUVA 6FDRA 3Q24A 4KGXB 1TK8A 1A0OB 3ISNC 2E1CA 1QS4A 7FD1A 3UQSA 1EJ7L 3D28A 3G0ZA 1X9WA 2D69A 4W98A 3M1FA 2CUYA 2D41A 1QLNA 1ICEB 1JJ2R 3SI6A 1RTDB 4WK3A 3N6MA 1VSHA 1VC0A 3SQ4A 3WEEA 3P39A 4M5MA 4M1KA 3JS6A 2YHXA 2ERRA 4KPCA 2YKMB 2QA2A 3PHEA 3W1YC 3O4WA 3O9RA 4KTZA 3TSPA 5F8JA 4M5DA 1SC3B 2XHWA 3DM2A 1E4GT 2ZZNA 2I8EA 1NK5A 4IWVA 3U1NA 4E19A 1TL7B 2QA4G 1HMVA 2AZ1A 3DFEA 1WC4A 5DDQC 3VAJA 1S1VB 1SL0A 4AYBD 3AVHA 4M63A 4UY8T 2GHWA 3M8QB 2E2QA 1A7GE 2ZBPA 3NE6A 3E66A 2G8FA 3D2FA 4XDCA 1NK4A 1HNVB 3KLIB 3ZEUB 5LMNK 4CLKA 1FTRA 1YI2N 3WNHA 4B3SK 2HMPA 3PIOL 4OI2A 2XLKA 4FK4A 2G9OA 4GY2B 3CO9A 2O3DA 4N8OA 2J0WA 1RAJA 3QT5A 5AQPA 3AQOA 3NGZA 5J2PA 1QSSA 3CJSA 4QS7A 4B3MF 3EM1A 2IVPA 4X4OA 1HHQA 4JYAK 1X60A 3QFHA 3OL8A 1OSCA 3ASMA 2MKJA 1FEEA 2XM3A 3FZHA 4DSJA 2NXCA 4GNIA 2IOCA 3NDKA 1S9EA 2V4RA 4L73A 1G15A 2DJWA 4FWRA 3CCUN 2MQLA 3OS1A 4CK1A 1E3MA 3T1YK 3FJ2A 2Y8WA 4P7TA 1LCUA 2J7KA 4EU0A 4RWXA 3QO9B 4M3XA 4TU9A 4URQU 3DRPB 5ELZA 1NHVA 3L2QA 2QN6B 2GIFA 1NZAA 1D1UA 1YVFA 4BRPA 3AA5X 2QA4N 4BRGA 3JAMU 2F9DA 1KC8T 2DHSA 4ID5A 2MZQA 3LL3A 4DQRA 3GIIA 3W8PA 2E5HA 3VWSA 4ZVHA 3C3LA 3THWB 4QYRA 1JLBB 1MG7A 3AA8A 4FWSA 2GJ2A 3ISZA 4G1IA 3WX4A 3C2PA 2CQDA 1GMWA 3DLKA 4GMKA 2HBZB 4U7UD 3WC0A 3R9LA 2U2FA 2VG5B 1I94F 4DU7A 1GLBG 4DCPB 2A5XA 3ZCMA 5EX3A 2IS3A 1KBRA 3TSUA 4DSLA 1S12A 4I68A 3FRZA 4PR6A 2HFUA 2XYHB 2QMUB 2CQCA 1TL1B 3IWLA 1ZXOA 3S8SA 1S4FA 2G2OA 2VYPA 2F7TA 1YJ7A 3I55S 1RDCA 3GSDA 3JSRA 2YVSA 1X5PA 3ZT2A 4OX8A 3UKRB 3VQQA 1V4SA 4RNOA 4B3SJ 1H38A 2P9UB 4F25A 1NGFA 3Q89A 4BRAA 1G2EA 1NK7A 3OBWA 1VBKA 2HZAA 3WXLA 3BP8A 3SSRA 3TP2A 3DXBA 1TMMA 2WOMA 1PCAA 2DEJA 2CJ9A 3OR1B 1JX4A 4CJFA 3NF6A 1ZTWA 3MM7A 3VEOA 2QLBB 4U9RA 1HNWK 5D4LA 4A57A 1T9TA 2UUBF 1NCLA 4LY7A 2I0XA 2RNEA 5JICA 2HHSA 3H46O 3FC9A 2NSBA 1CC8A 1YJVA 1J27A 4I2PA 3PYFA 2N4DA 2QL5B 3UW1A 4JB8B 2UXBF 2G0CA 3OW2M 1TUYA 2RU9A 3KUHA 4FYDA 4DQIA 4PKGA 5M2UA 4DWIA 1H2VZ 3CCWA 4WKYA 3SBTA 1UWBB 2WTUA 3TAPA 3VESA 2XYGB 3CCJS 1N32K 2M3DA 1GLLO 5HQLA 2DPNA 5LJVA 3DRPA 1EB0A 4H54A 2KT2A 3MPDA 5E3PA 1KAXA 1WEXA 4Q0BB 5AFUA 5C2DA 3F73A 5BRDA 4UOCA 2HFNA 2XS7A 2BQ3A 1IBMK 4J9SA 2B6AA 3FSYA 4KQZA 3ALYA 2W4CA 3MM5B 2DPJA 2VODA 1GXLA 4B9MA 1Q0NA 1I39A 4CYUB 3W7BA 3Q8PB 1ZPWX 2HQGA 5DQIA 4KI4A 3QNOA 2D5RA 1YHQN 2KKZA 1LW0A 2BABA 5LL6d 5JXSA 3JSBA 3RAXA 3RBXA 4ALZA 4K2XA 2P2CB 3FNNA 3CE8A 4Y2CA 1NSAA 1VRUB 3SIPB 2CZ9A 3DU6A 1VK8A 1TTHB 3NRBA 3G71S 4CIOA 2BE7D 4GC6A 4DI6A 3H5XA 3TAQA 4IKFA 2ZH2A 2B6AB 1Q16B 4OLOA 2YKNB 4HL9A 1O51A 5AQOA 2Z58B 1JL2A 3KDNA 2E88A 1UL3A 3IUCA 2QKKA 4DUYF 2OELA 4O3QA 5E0OA 3CI5A 1S0VA 3I9ZA 2HBQB 4DV6J 3PG9A 3ADAC 4Y3CA 3FQKA 2DY1A 3A5OC 3AO2A 4J2BA 1B9DA 2FBTA 3M1VB 5KFYA 1O1WA 4QIVA 3WNEA 3RAMA 3CCLN 1U0HA 3B78A 3MMAA 1FTCA 4LRFA 2PFFB 2WVFA 3IP0A 4FKYA 1C1CB 2GWKA 4J2DA 3K2PA 4JLHA 2AYEA 1S0NA 3ZT3A 3ZXWA 2CH6A 5HROB 1FWPA 3HHDA 5AJ3K 2AJ1A 4PZVA 3RU0A 2VWJA 1WC1A 2VWKA 3Q8QB 3QATA 3N4QA 2WZ1A 1RSCA 2E5GA 1KAYA 1N54B 2HBRB 4NXNF 4B08A 3W64A 2OPQB 4F2SA 2ZITA 3M1VA 2GQCA 2E9RX 4FZXC 4CIFA 2QSWA 3THYA 5E7OB 3TWZA 2QWMA 1HQUB 2BKPA 1VQ8N 1KQSM 5EWGA 4IRKA 4ZP7A 1PILA 2MKKA 1CLQA 1KSPA 1KQSR 3ZSWA 1RT7B 1VQKN 2LMIA 4ZS6A 3T5KA 1ELOA 4ZHRA 2MHNA 4PYDA 2ZJPL 3MAQA 3FSXA 2W9CB 2ETJA 5FJ4A 1OS5A 3R7BB 3IRXB 5HATA 4ZPDA 2FLPA 1IR0A 3NBPA 4FVCA 1JMTA 4DS5A 2YBVA 3D9BA 4PWDB 1HQEA 3BEXA 1I94K 3HO1A 1XC3A 2WSEC 4OYMA 2E1MC 1ZAVA 4BRIA 4YOYA 1M5SA 1S9GB 1WG4A 2MKCA 4DJBA 2W01A 5KGXA 2IFXA 3I6PA 2CPYA 5KTQA 1S6QA 3DXSX 1FJ7A 4A8KA 3GFXA 4KBIA 2IM1A 2VG7B 3MWTA 2J9EA 2HAFA 4CDIA 4FF1A 4DR4K 3T5HA 2X1AA 1V4TA 3D1QA 2KH9A 4GV6A 3J81j 1KFDA 2UXCK 3CB4A 4QW8A 3T3FA 1WAJA 1L3UA 3A5MC 4LF2A 4ED4A 3SJHA 2W41A 4BG9A 1ZM9A 2NXEA 3HM9A 1NJWA 2RJZA 2EBEA 2B43A 4DQSA 1FXDA 3DGPB 4BS2A 1IBKF 3KNGA 4DUZF 5A2QO 3N9UC 5KAKA 3BF3A 2FVSA 4LR8A 2ILZA 1XTZA 2LDIA 1SJQA 3CC7S 3L3UA 1E6YA 4USHA 2AZ3A 3MMBB 1FDAA 4FYWB 1TUGB 1RWOB 4EWTA 1U1NA 2DEIA 2O66A 2K3KA 3KLEA 1EAYC 4NYFA 2DGSA 2VCPA 4FJLA 4M3ZA 4JAXA 1TGOA 3W65A 4FM2A 1YRUA 2B9XA 3R9PA 2I2YA 5C12A 4IFVA 2Z2YB 3FEXB 1IBLK 3UDCA 3EDRB 1XNRF 3QWUA 4HUFA 2FLLA 1UAWA 2UUCF 2JEGA 5CD4A 3AHPA 5DM6Q 2VBWA 4A47A 4QWCA 4OHXA 4KV8B 1HMVB 4NLXA 3R5AA 3FRYA 3O5TB 3ZZPA 3ZT1A 2PYLA 1A5XA 2YV0X 1K0VA 1RAGB 2C2EA 1NKCA 3W2WA 4E7KA 1SXLA 2HFSA 4CD3A 3OL7A 4USTA 1JB0C 4H4MA 1R0AB 1UZDA 3WDOA 2CQ1A 4KHYA 1PC4A 4NLUA 3SI8A 2KDOA 2UUWA 5HRRA 4LBIA 1KONA 4X4NA 1MDUB 2WHOA 5EY4A 1KHWA 5CYMB 3G86A 3ETOA 2B0GA 1LEOA 5GMEA 2RUSA 4C8OA 1U1KA 4BR2A 1QD1A 2C2ZB 4ISEA 3AVAA 2FD2A 1SJ4P 4DV0F 2GAGC 4QR0A 4M5NA 2IM0A 3LP1A 2VKRA 2CADA 3JAMY 3MD3A 3TZYA 3VQAA 2BKOA 3PSIA 4A61A 2GGPA 2CPZA 4GKJJ 4RNMA 4DR6J 4U96A 3TPQA 2AJ0A 5HBMA 2YHYA 4WYWA 3P49B 2A0FB 1RLCL 2MSTA 3EZ5A 3TABA 2QEXS 5F8LA 2DGXA 3DRRB 4DSKA 2BXJA 3GCWP 2B8QA 4K4YA 2E4LA 2Q43A 1R8HA 3M3ZA 5BN9A 3VEXA 3C8YA 4NLYA 4PQUA 1YJRA 3K5PA 4ZHRB 3PKMA 4KAZA 2BUPA 2IC3B 4HCBA 1WHVA 4WP3A 5AJ3F 2XY6A 1HWUA 3ATVA 2OMOA 4LR7A 4AF1A 7AT1B 2HNDA 1T44A 4LF7K 4NLDA 4OJHA 3PEHA 1MU2B 3UD3P 4EIAA 1REVB 2BE9B 3KWMA 4RNHA 4KSEB 2QE5A 4ILRA 3M2VB 1P90A 3HDSA 1C0FA 2CQ2A 3OW2R 1RGVA 3KLGB 2ROEA 2HGNA 4PEOA 3GE1A 3P83D 1N6QA 4ECXA 4Y0FA 3C7NA 2BQUA 1BA0A 1Q5VA 2GWJA 4DB3A 4NYZA 2R7XA 1VLYA 4ANDA 3NMAA 4QU6A 2CXEA 2FJXA 4KY3A 5GAHI 1NZ8A 3TI0A 3DLHA 1KQGB 2BJ3A 4Q7AA 1VIOA 1CXUA 2C42A 2XNQA 4B1VA 4OYZA 4Y00A 3VENA 3K57A 1OSDA 3O3FA 3SQGA 2RT3A 3A3PB 1IN0A 3BGRB 2N3OA 4QPXA 2HBKA 4H5WA 3BGOP 2W4PA 1JXBA 2G4BA 1IBMJ 4LF4J 4CGJA 3KZBA 4RUCA 5D3GA 1KR4A 2HIQA 5CY4A 4F3OA 1C0UB 4ZPWR 4DUYJ 3A5LC 5AQWA 2HMIB 3RMAA 2XSFA 3B4DA 4FNHA 2Z8QA 1NK8A 3VF4A 1GXTA 2G2ZA 3W0LA 4H4OA 2XMWA 3RBDA 4B9UA 3HL8A 1U45A 4DR6K 4M7XA 1S6QB 4FPRA 2BKNA 4ED0A 3B6BA 4TY8B 3C16A 3C94A 3LGHA 1RU2A 3HK2A 5F0XA 2OCEA 1R27B 3L4QA 3OTOK 2E66A 2XY5A 4CJWA 3N4PA 2MQOA 3Q7BA 3UE2A 3WHIA 1RYRA 4DUZK 3MDQA 3BUZB 2V8DA 4DTOA 1NO8A 2PBDA 4ZK7M 3HKWA 5DG9A 4CZKA 3K8WA 1H73A 1WSJA 1W97L 3KG0A 3H20A 4OZ1A 3LOUA 2QLWA 3IDHA 1C4CA 3OHBA 2B51A 2KTQA 2XQCA 3TOQA 1B0TA 4RZRA 4FLYA 5FPDA 2EFPA 4CGGA 5K14B 1M5OC 1OY9A 3DDNA 1ZBIA 2DNZA 3SXLA 4B8CA 5D0RA 4IG3A 1WD6A 3IXQA 4KC5A 2OI2A 2LEPA 4CJ7A 3O8MA 2OJ3A 4TLQA 3CXCR 2EI5A 2HBJA 1Z4UA 4FF4A 1J5EK 2I7NA 2P5GA 5GIPA 1BG3A 5CZXA 2V94A 1U1MA 1S48A 1WSHA 5J2MB 1IBCB 3MECB 2VPYB 1HYVA 1IR1A 3CCZA 2HWHA 2DR9A 4CJKA 4DPYA 4DZDA 2V63A 4U7CA 4OHWA 3MMAB 2X74A 2LU1A 4ED6A 1HYZA 2KM8C 4RLEA 3NNAA 1TVRA 4AHSA 4CJVA 3FEZA 3P3DA 2Y0BB 2AV5A 5HJYA 1NOZA 4LC9B 2CIMA 2P6TA 4BR0A 3FGVA 1W25A 3NMUA 1EQYA 2P9UA 1C2PA 4KT0C 2G13A 2GVZB 3V9ZA 5DO2A 3CD7A 1CZAN 3KLHA 2D7SA 5K5MA 1IUJA 1NSPA 3DRYA 3NAEA 3RTVA 4LJMA 3AODA 1WACA 2HG4A 3T1HJ 3BB5A 1RHMB 2DNNA 4O44A 5JVGL 2PZSA 2DNHA 1T9XA 2GGPB 5DLFA 3I33A 1MMLA 2V9WA 4RBVA 4KI6A 4JHDA 4C3LA 3HVTA 1VSDA 1RT4A 4DLGA 3QAUA 2RMLA 2V34A 2BM1A 2VPXB 4YNQA 2JDJA 4IBNA 2FY8A 4LIRA 2G8IA 1VQYA 1YRXA 3TZXA 1U25A 3CJ1A 2J0XA 1Z1ZA 4DV3J 4IOCQ 4I6YA 2XMAA 4ZPBA 4TSXA 3GYXB 1H2TZ 2ZGYA 3CDWA 4GO7X 1VSLA 3FCHA 4FJHA 1T9VA 2UUAK 4FJ8A 3QDKA 2HHHF 3ZZUA 4Z4CA 4TNOA 1NPPA 3CWJA 4JI6J 3QO9A 3BSCA 3VEWA 3CHWA 2RQCA 1YWXA 3LPYA 4WFZA 2KW4A 1T9YA 2FVRA 1JLEA 2JC1A 2RH3A 3QNWB 2OGUA 4DDFA 2AP1A 2P9SA 3VQ6A 2DR6A 3NCQA 1XC9A 2HVHA 2EHGA 2I6WA 4CECA 4ZVSB 1HX1A 2JEFA 4FDFA 4YHHK 2W40A 1VFJA 3C6UB 2WVBA 4M5IA 3K5NA 4O55A 3W2VA 1F2GA 1L3VA 4NXMF 3VAKA 3VGKA 4OX9J 4ILJA 2VFRA 3C14B 4OYPA 4F4AA 3W9IA 2AMCB 3Q8YA 4EK2A 5AQRA 2DNMA 4MK8A 4CEQA 1HBUB 3MEDB 5K20B 5LM7E 4YR2A 4PCQA 5E2QA 3LGNA 4KHRA 3M30B 3A8JA 3FCVA 2V7ZA 1YXQA 4TQRA 1H98A 5EWEA 5IWAJ 1GQEA 3ISND 1QE1B 4JI2F 4X64F 4JI8J 2OZMA 3V2UC 2O8BB 5IT9U 2B7BB 2C2DA 1VQ4S 2AGOA 1YVUA 3TUPA 4PG5A 1UVNA 1URNA 1QHAA 3RRKA 3RMCA 3UNGC 1KRPA 1UEUA 2ZC4A 1F2HA 2Q79A 4ETXA 5K8NA 3DLLQ 3EX7B 5J2QA 2HHHJ 2IAJA 1KHVA 2JJ4D 3EGWB 1EWRA 3HVRA 4I69A 1H2UX 2GV1A 1GXUA 1JLCA 2F9WA 2VG5A 3UNYA 3O80A 2QWOA 4DHVA 1G1XA 1KOOA 1MWYA 4FW2A 2ZF5O 1LW2B 4BDZA 1ZBLA 1QVFM 3JXUA 2VG7A 2BRLA 1NPKA 3O9UA 1FWKA 1SKSA 4H0YB 3ZSRA 2QWLA 1ESVA 2WVEA 2JH3A 2E9TA 4P10A 5M1QA 2BDPA 4J9PA 4QIWD 2HAIA 4KHPJ 2KM8B 2W7AA 1VQLN 5CYQB 2IRYA 2QEXN 2Q97A 2V8VA 4TXSA 1WBDA 3M4XA 3FZ2A 5TKWA 2M5YA 2KN4A 1GX5A 4MFBA 3FZMA 1VCTA 4L3QA 5L9NA 5ETOA 1WJ9A 5RUBA 5F2RA 1HKAA 3KMSA 2UUCJ 2X1BA 3JSYA 1T9UA 3BQ0A 5JUMA 3CSKA 2IYIA 1H6KX 2CNLB 2UZAA 4AFFA 1M5VC 4HDGA 4O3PA 3AO4A 2P9EA 5CR4A 4P2XA 4WXWA 2CQPA 1M5PC 1S7HA 5KG7A 3C65A 2JWKA 2KB2A 4DMZA 1IJEB 3LUYA 3V81A 1Y4ZB 2E1YA 1HQUA 1DURA 3MUMP 4OYWA 3Q86A 2F5GA 4BCAA 4B1ZA 4OX9F 4Z4GA 2LQ8A 3ZTPA 3SPYA 2YX4A 5KG3A 4ZN1A 3HVWA 3LP0B 2ILYA 2EWHA 3M30A 5HSPA 1XNQJ 3QFPA 2ZJRQ 1IVZA 1RK8A 3OSNA 2MQNA 2JLGA 3EMTA 1XN9A 1AB8A 1TKZB 2X1GA 1CZ9A 1M90O 2LA4A 3A13A 3CJRA 1S79A 1DARA 4KO0B 4WWSA 2XBPA 4CT9A 4F0HA 4CO0A 3ZC4A 3BKFA 4FK2A 2WBMA 4ZCMA 1N36K 4Q0BA 5EDWA 5D0EA 3SQOP 4YR3A 1DEJA 4BVPA 3VAGA 3W8GA 1H0HB 1PAUB 4AHVA 1F9HA 3NVMA 2FC9A 4O4RA 1RISA 4AQYF 3I32A 4LFAJ 3TEGA 1BO5O 2PDAA 4ES1A 2JNJA 4U6PA 5KFSA 1DHMA 3SEOA 1QSYA 2MQ8A 1JL1A 5ETLA 1FXRA 2VQFF 2M8HA 5J1EA 4CIEA 1SI9A 2GS8A 5HVHA 3A8YA 1AZSB 3H2VE 4PWUA 4AL5A 1Z25A 2E7WA 3G25A 3I4HX 3S01A 2VV5A 3I0SA 2LECA 5D77A 1HD0A 1CC7A 4CM2A 1U4BA 3OYMA 2Z2LA 1PJ7A 1UA0A 2JX2A 1Q7YT 1HR0J 4LF9K 3K5OA 1D8YA 2ATQA 2HRTA 1VC5A 1D09B 3AJ2A 4FCYA 1M1KO 4CH1A 1YKWA 3PW5A 2R7YA 3ITHA 1SL1A 1ROFA 2B8PA 5LMNF 3SK3A 4K25A 3RJMB 4HDHA 2HNDB 3QRQA 2AQ4A 3MMCB 3V81B 1A6LA 4Z37A 1JK9B 3UVJB 1WSEA 1TL5A 4YS2A 2WTFA 5GAHP 1N5SA 1W9HA 3JTNA 4PQUB 1VYAA 1VSJA 3M5RA 3RB4A 2XMVA 2IY5B 2V68A 4I9QA 3KOAA 4YUDA 3B6OA 4DCOB 5C5JA 3M6UA 4JV5F 2BRKA 5AQXA 2HS3A 2V8GA 4GVEA 4WK1A 2IDLA 4PL7A 4B3TF 4C1NK 2CG8A 4OHZA 3QFUA 2VFTA 1B0VA 1RFQA 2LKZA 4CTAB 4QYZK 2NCKL 3ENHA 3FFKB 1Q53A 4RCHA 3R2DJ 5FDLB 5GIOA 3FUYA 2FZKB 4CJ4A 2KRRA 4MMOA 4P72A 5AQZA 4NZ6A 3SV3A 1WG1A 3CJ7A 4DS4A 3VV2B 4A8OA 4JI2K 1VRTB 1KD1O 5LOQA 2F8EX 1OH8A 3N6NA 5JMVA 3I4PA 2HHQA 2R3VA 4DUTA 3DOKB 1CS4B 4IFEA 3VEYA 1VQ9S 5LT5A 4B02A 4P7VA 3HKZD 4E7JA 2Q36A 1S9FA 1T7PA 4CLFA 3D7EO 2X3DA 3I87A 4I0WA 1K8KA 5KPZA 3NOCA 2IIHA 1XMOF 4C3MA 4CNZA 2ZBRA 4RKUC 3LA0A 3SSSA 4ANEA 2RQMA 1YBAA 2ZHAA 2L48A 1K44A 4ILMA 1ITPA 3O5BA 3M32A 5DM6L 1BUPA 4X4TA 5F8HA 3MOJB 4ANCA 2YWWA 1YJNS 1S1WB 3NGUA 3SCJE 4RW8A 2DO0A 2WK4A 2GJIA 1IQTA 1NKEA 4I9LA 3ZSQA 3BEGB 3TX0A 5EOYA 3T41A 1P8GA 4Z4HA 3MR2A 3OYNA 3FE1A 4FN5A 4HYKA 1PKUA 2KHDA 3KLVA 4RU2A 2GIRA 1NGAA 2WBRA 4ZVOB 1VGYA 5DG7A 1ZS6A 4DX6A 2C3MA 4K4WA 1JCEA 2ACYA 3UFCX 4ZVRB 4DR3F 2DPIA 3A0IX 3SCKE 3ICLA 2HNZB 1OPIA 3AY9A 4YOTA 2E8AA 3QEIA 4ZLNA 3ZETB 5LL6Z 3UN3A 5MAOA 2CZ4A 2BBEA 2P5VA 1Y5IB 3CQXA 2AD9A 2P9NB 2P9IB 4H4OB 3KUGA 1SQFA 4FK0A 4FJGA 4JI6K 5HL7Q 1MA9B 1PJ6A 2F65A 5IXUA 3VQPA 1HNXJ 1BIUA 2UXBK 3OYBA 5AQQA 3NGDA 2W9BA 1FO1A 1XEZA 2E7VA 4PXBA 3ZNUA 5E26A 3GP9A 5A8WB 1YUWA 2ITGA 1U8SA 3QT6A 1M0SA 5D3GB 3OL6A 3M6GA 4JI5J 1M5KC 4RUAA 4RTFD 2FJDB 3HTVA 2ZH4A 4PPDA 4LREA 3T1YJ 4FPIA 3D6FB 2XCAA 3MR5A 5LJ5Y 4L3KA 3TA1A 3P8BB 2CQIA 2PFUA 1T11A 2EBGA 2GMJA 1JJ2M 1QQNA 5IM0B 3D2EB 4V19J 5J2PB 3QT8A 2N7CA 5LSLA 2DGWA 4DU8A 4ECTA 4OMFG 2CPIA 1RWPB 3R5CA 1TMJA 1Q82O 4E2FB 3KHYA 3KHHA 2H51B 4GW6A 5KFRA 3TYTA 4Z4IA 2YH0A 3OR2A 4FYYB 4WBFA 2O1PA 3LWMA 1QZ6A 3V9UA 1LWFB 1MMDA 1YJWN 5IWAK 3FMBA 3DLEA 3HZGA 3EE9A 4QOZB 3PVXA 4YB6A 3IFEA 3RAQA 4E98A 3OHRA 2BX6A 1OVQA 3QEWA 3BO2A 1BA1A 1H72C 3R1HA 4JRQA 1M1HA 3DLGA 2MQMA 3M9NB 1JIHA 4LF9F 3EKUA 5ETPA 3KLHB 4O0NA 5C2GA 3V4IB 2FUG9 4WIQA 4BC7A 4HT7A 1FRXA 3H2LA 2R8IA 2I5JB 2A1BA 3F0NA 4KFBA 3GV7B 3M8ZA 1XMQK 3AVBA 4MFBB 3IO1A 2MLZA 2VHGA 1Y3KA 1HNWJ 5C25B 4B3MJ 3U9ZA 3OSPA 2J0SD 3ULEB 2OEJA 1JXEA 2Y1RI 1IO2A 3AOAA 4A62A 1U49A 1HI1A 4FS2A 4AXJA 4GKJK 3UD5A 3M8PB 4DQQA 3CJ3A 3AD9C 4B3OA 4M5GA 3RBZA 3MCOA 4HVJA 3THWA 4FWOA 3Q0AA 4PKIA 1F0XA 2YWFA 4H4KA 1BMQB 1RABB 1E6VA 4Y0WA 1F1BB 5DG8A 3GQCA 4C8YA 1YITN 1ASWA 1RDAA 3VAIA 3SAGA 3UCUP 3TR5A 2MXYA 4USIA 1RLDA 3RR8A 4BC4A 2R7UA 3KG1A 3CW2C 4B9TA 5HMXA 4BRCA 4ZTJA 3PR4A 1BQNA 4ECWA 2OIHA 3CD6N 3ENWA 3AFGA 2KFNA 3WIUA 4WFAL 2VFVA 2QL9B 4J8FA 2LXFA 2J0QD 1GK8A 3HHKA 4CJUA 3U02A 1XMOK 3A5NC 3OYKA 2ZOGA 2PT0A 5ETTA 4M63C 1FK9A 1YF5L 3V6DA 1K1SA 2BW7A 2OPSA 2VB6A 4CQ1A 1I3OB 2FY1A 1RACB 2HK3A 3L2RA 1JLAB 1N0UA 4E8UA 3FQLA 3CCUS 4OHYA 1UPMB 5LJ3Y 3BF1A 2V67A 1G4CA 2E1ZA 1BQXA 5JLFA 1K73O 3P5JA 3CCJN 2QYGA 2DY4A 1M1GA 4IEIA 2QA4S 3KHLA 2MY8A 1Y5NB 3TTDA 2NRXA 4GKKK 2PIIA 3J7A1 2FC0A 2YKMA 2DIUA 2UP1A 4JI0F 3OVAA 2NPFA 4A8FA 1UVKA 4BC9A 3TR8A 4CK3A 4BREA 2CNOB 4DMNA 5GAEI 4DR1F 2VC1A 3X1LB 4F50A 2Y1IA 3IMQJ 2W9AA 3QETA 2YNHA 1JLGB 2DITA 3C7NB 5CH7B 2F9JA 1AW0A 2F8SA 1VJWA 5I3QA 3KK2B 1HBMB 1TYQA 1SUQB 2VF3A 4WCEQ 1BOTO 1N0VC 3R3TA 1S7IA 1UP1A 1WEZA 2DISA 1DTQA 3ENAA 3OYIA 5KT6A 3CCMN 2XZWA 4QWDA 2OYQA 3KYLA 4JHDB 3G6VA 2XS5A 2HGMA 4U7BA 3I0RB 5E84A 2HQFA 3A1YG 3FBEA 5FD1A 3P5TL 1Q1KA 4XH4A 1HBNA 3O1LA 4CZCA 2WONA 3AO1A 3EO3A 1GFWB 1MNEA 4ZN3A 1BI4A 1NLKL 3KJFB 3CXCM 4EHTA 4CLSA 5KFXA 4Q8EA 4YDDB 4H0PA 1U2FA 3C15A 3DJCA 3PYEA 3H90A 2MMYA 3MMCA 4WIIA 3CCTA 2GV9A 3THXB 3RSEA 3BJYA 3M05A 3Q23A 1R8BA 2PE8A 4OX7A 3AY0A 3V5RA 2XMJA 4O3SA 2IGIA 3LP2A 2MZTA 3KK2A 3H0PA 4X4SA 3BH7B 2UVUA 3OJUA 1WF1A 3HJFA 5BRFA 1NOYA 3DXKB 4YDUC 3OT9A 4PPZA 4E7HA 3ENQA 4DL2A 1CQNA 2MZJA 4FM0A 2GA7A 3U9DA 2MB0B 1V5VA 3R5GA 4HTLA 4KGVB 3HBTA 1X9SA 2CDRB 1HR0F 4G65A 1NB7A 3HXMA 2P9PA 3H3NO 2YNHB 3B54A 3GWCA 2GBZA 3LDSA 1R0AA 3O3LA 3PYGA 4L76A 5TKYA 4ZCIA 1VS3A 1CVJA 4B3SF 2JFDA 2Y1LB 4HCCA 5BYRA 4ECRA 1W2BR 3MI7X 3R1XA 5IV4A 1LNQA 1K9MT 5KRTA 3MEEA 2P9IA 4TLRA 1OKJA 2AYMA 1Q86T 2W2NP 3LPTA 3O1BA 4GKJF 4BDYA 2KYZA 4K4VA 3FZLA 3H1VX 4BLGA 2W2QP 2HRYA 3JQJA 3MX5A 2Y0SD 3GYGA 3TQ1A 1FKOA 3K0JA 1LXNA 4KO0A 1RGIA 1JXVA 2WSFC 4WJBA 1Q82T 1J2VA 4DR7J 2DXEA 1KEKA 3FGUA 1HJRA 1RTIA 2A42A 1LAVA 1VRUA 1XUPO 5EX0A 2UV8G 4LRAA 3ZT4A 2MEWA 3GG1A 1TK5A 3S6EA 1A9NB 2HLUA 4E89A 3EPGA 4H5VA 1KXPA 1IM4A 3C6UA 2AIRB 4IOAQ 1T95A 3M2UA 2ASYA 4G9ZA 4NWBA 1T94A 4DTMA 3DNCA 4OPJA 4J90A 3G8TA 1R7IA 1GTHA 1AT1B 3EGVA 4DTUA 2VU5A 1CJKA 4YOVA 3CCSS 4ZP8A 4PXEA 2UYTA 4LH5A 2M7SA 3BO3A 3TAEA 2HF4A 4KH6A 1RT6B 4LF8K 5C7PA 2X1FA 4CJPA 3CFRA 1PJ5A 4OJ1A 1GLCG 3O4NA 2DGOA 5KFGA 4LBHA 3CIPA 2FJWA 1UVMA 3DXKA 3TVKA 3QT7A 3VEVA 3WQUA 3CERA 1TELA 2Z1IA 2PYJA 2UXDF 3S3MA 3EXYA 4Y2AA 1T8EA 2YKPA 2WBNA 2QI2A 4GVBB 3O1WA 2GO9A 1X9MA 2O8DA 4ITSA 4O5FA 2E5LF 1GLAG 2F8TA 3KLGA 4QBUA 3MM7B 4NLVA 2RILA 3G4SN 4WTOB 3J81O 3ILOA 3AD7C 4BC3A 3EVMA 2JEIA 3HRGA 1BI4B 3H59A 4GC7A 5D8HB 2IYGA 2JVOA 2FGOA 1YAGA 2XWYA 3BPDA 1AXQA 4PQAA 1VQ7S 2QFIA 3G6ES 3CEDA 4HTIA 4OI1A 3O8WA 3U3GA 4C8ZA 1CQMA 1WF0A 4I7FA 2YWHA 2GVZA 2R2SA 4H5NA 3H8YA 2ZC3A 1N32F 1N56A 4DTRA 4P75A 3R27A 1EP4A 2MKHA 2Q1LA 1FA0A 1FWLA 1DJ0A 1S77D 4F0MA 4FLTA 1J5EF 4DN0A 3CFPA 3QPIA 2KXHA 3TQEA 3OLAA 4J9NA 5HROA 3OFGA 1FFWB 2CA9A 2MKYA 3J7ZO 2D1CA 4OZLA 4LUBA 5JS1A 2APOA 3LANA 3ET6B 1HQ2A 2UXDJ 2Y8YA 2QO3A 4RW4B 4HTUA 2PI5A 3U7JA 3QIDA 1ASUA 3IA0A 4FYXB 1RB0A 1JQGA 5GAEU 3W5XA 5BYQA 3NGRA 2MYFA 4FPBA 1BD6A 1RT6A 5HANA 4QWBA 3R6GB 5M2RA 2D9PA 5KG5A 4P71A 4M3UA 5FRMA 4LQ9A 1WTBA 3FKBA 1FVQA 2GX9A 4P73A 1LOTB 1P1TA 2HQ3A 3CPEA 3L4IA 5KFJA 2XEXA 3GJTB 3ILIA 2VBYA 5AQTA 4OO1J 1NK9A 4DV6K 3NMRA 1JCFA 3DI6B 4DUYK 4DV1K 5A2QY 3CCSN 3DDKA 1BUXA 4PKHA 3D3CJ 4OI3A 3US5A 3C16B 2OPRA 5AZIA 5L1JA 1YBTA 3C0BA 1NHKL 5KFAA 4NEYA 1KKHA 3G87A 3VAHA 3E3XA 4E1NA 4JK8A 3KLIA 2ASJA 3TSQA 4BRLA 4DX8H 1WKKA 3AVFA 4O23A 1J5EJ 3M6XA 3GJRB 4HKQA 1CLFA 2V4JB 3MM5A 4OZ2A 1IG9A 4TU8A 2KU7A 3GIKA 3L2WA 2ADBA 4KRWA 3RWUA 2FSJA 5E41A 3GL1A 3F9KA 3WBZA 2JC0A 4ZLJA 4ZVPB 2UUAF 1KVIA 1S1WA 2Q3PA 5AQLA 3MEEB 3AT1B 2NXJA 3DGPA 1OWXA 5AXNA 4DTNA 1S1UB 4OJGA 4F02A 1OIAA 3GE9A 2WVDA 3THTA 1TVRB 5G0RA 1IKYB 3QMLA 5E3RA 4QCLA 3OV7A 3MTJA 2D3O1 2YNIA 3NL0A 1CS4A 3T9ZA 4OV1A 5CHIA 4K8ZA 5AQUA 1IWGA 1ZBSA 3SQ2A 1K47A 4OX6A 5KFZA 1VSMA 3KKFA 5C25A 3J8AA 3DLLL 4KHMA 4NLOA 3THVA 2ASDA 1SKWA 4F7VA 3KKRA 1N32J 1HNZK 2P9LB 4KB1A 3VQ9A 5CD4H 4JI3J 4TKTA 5AXMA 4WF9Q 4AQYJ 4CF9A 2IIRA 4LF6K 4U7UK 4LF8F 3CC2S 2VASA 3O3GA 1QAIA 4BR5A 2IDOA 4CTAA 4J9MA 1GLJO 2NUUG 1HQEB 3RMBA 3DLGB 5E3AA 4F4XA 4X4PA 1OY8A 4CEZA 4LQ3A 1WI6A 3CYMA 5C0YA 1IJFB 3A8IA 1F60B 1WG5A 5F8GA 2R2TA 3MM9A 2DRAA 4W5TA 1C1BA 2ZE2B 3OD2A 3VPZA 2HURA 4M3RA 4LFAF 2UXCF 1YIJN 4Q45A 2V4JA 4USMA 4NI2A 2R8JA 1L3SA 4CF8A 2UUAJ 2ZJPQ 2ZKUA 2AW0A 2P8IA 1Q8BA 4JV1A 2RQKA 4ZTFA 2BOPA 2HPUA 1QAYA 1NMNA 5HRNA 2GVDB 4OVLA 2XLJA 1HARA 2A3JA 5C42A 1RT5B 4R25A 2DGTA 1HWKA 3BYPA 2VICA 1Q5YA 3EVOA 2MZSA 3NH1A 3V9WA 2N3LA 2P5OA 1JLBA 4LBPA 1GAOA 3I0SB 4CBUA 2HMIA 1HW9A 1OJ4A 2VKZG 2C2OB 1UTAA 2E5LJ 2CH5A 3PYDA 1TR0A 3H40A 5FPEA 1QVGM 4YN3B 4UTGA 4GRSA 1FKAF 4O8KA 2IAJB 1NWKA 2ZM6K 2HHXA 3I8BA 5H9EJ 4Z7CA 4IO9L 3UKUB 2YCHA 3I82A 1Y11A 2K7JA 3G9CA 5J1EB 2FLNA 3S7RA 4HHTA 2NSCA 2L9DA 3IWNC 5HRPA 2DKOB 3PM9A 3D67A 1TV6B 1XR5A 1HNZJ 1UJ6A 3CC4S 3CDBA 4QS8A 3PIPL 1BCOA 3CF5Q 4ID1A 1YLXA 3JTPA 1HNIA 3I56N 1VQ6S 4DQ8A 4MLHA 4ED1A 2A10A 2KQ2A 3OBYA 1BY9A 3UN2A 3NH2A 1IKXA 4KBOA 3PRDA 3ILLA 4QIFA 1JLAA 4KR0B 2PFDA 4K4SA 2Z1JA 1FFSB 1GT8A 3ZT0A 4CM0A 2WOMB 4O3NA 3ENVA 2MZ1A 4IXCA 2V4QA 2HVZA 3CJ4A 2LDYA 4BRFA 4HR2A 4M8LA 2JSXA 3DLRA 1GH8A 3TJAA 1DFDA 4LSNA 4UT4A 1K8AO 4P2MA 2IC3A 2AEFA 5KFTA 2E29A 3AAPA 4L8RB 3VTHA 2KZMA 1TV6A 4E7LA 2PC6A 2RB7A 4FJXA 5KFUA 2CPEA 2NXUA 3HHLB 2BEFA 2IVFB 4LD0A 3Q7CA 5EXWA 4AL7A 1UJ4A 3JS9A 3OA9A 1GOCA 2CVEA 4NZ7A 1CEZA 2VPWB 3FFIB 2EWSA 3VGUA 3H1QA 1FJEB 3A3OB 3SSQA 3CC4N 4IG0A 1Q9XA 2M70A 5F9NA 1LFWA 1U09A 1PO6A 4EMDA 1IBKJ 1UVIA 4KGZB 4K4UA 3OYCA 5HMWA 1S1TA 4NZ0A 5BR9A 3K59A 3W5YA 3E9PA 4QW9A 1VBYA 2IJNA 5IT9O 4WQ4A 1NM2A 3GYNA 2KT3A 2GQQA 5CE3A 4CESA 2J76E 2CAJA 1B0PA 4CGDA 4ZITA 3KFWX 4LF7F 1OYEA 2HLTA 4IH6A 2CQBA 2R9LA 2C3PA 1WOPA 1W2IA 3HVTB 3ID6A 3GU0A 2W8KA 2QWRA 4NLCA 1NBWA 1T03B 1NSKL 2POKA 3P96A 3Q8SB 3HHEA 2R42A 3FFIA 1JLCB 4NO7A 1LAWA 1VJQA 5BN8A 2QLXA 2Q31A 3IRXA 1CJKB 1C0TB 1FCAA 3LDPA 4DU4A 4R0EA 4OKJA 1UZHA 1YITS 2O8BA 4FWKA 4OYIA 4JK7A 2IJFA 1MWMA 2XSJA 4FBTA 1S6UA 3TARA 1N36J 2DR7A 3BREA 2DVIA 4NYOA 3RYLA 4CO3A 1T9WA 3O08A 4M5LA 1RAAB 3HCXA 5AFUH 5MLCQ 1IR2A 1GOBA 1A5WA 3GFYA 2AKWB 1RWVB 2JWNA 5L38A 5SZTA 4LT6A 3IKMA 2HNYB 4D3GA 3KKSA 3GG0A 4ZVTB 1U6ZA 2VWBA 1MW7A 1TK0A 3W60A 2P9LA 3U27A 3OYHA 1HYSB 3AAQA 5IC4B 2DNLA 3KG4A 4R0JA 1D9FA 3HYFA 3J80U 3QIPB 1HIYA 1FKOB 3L2VA 4A46A 2AJQA 3ZSXA 1RBSA 4FVMA 1EZZB 1AZSA 2GUPA 1T0TV 1SKRA 4JI0J 1JKHB 4B1WB 3P5BP 3EKSA 3BN7A 3M6VA 5H9FK 3B8HA 4LFAK 4CWBA 2KVIA 5KOXA 3CMAS 1U2RA 4R8UB 4DF4A 2M8DB 1DZ5A 3H4BA 2M9KA 5IT0A 1RDWX 5AQHA 2MY7A 1NDLA 3UKUA 3L95X 1I51B 1XR7A 1TKXA 4OLAA 3E51A 2NNWA 4CJ5A 2WB4A 4CLZA 3ZX2A 5BPLA 3O9QA 3OYDA 1OVYA 3BGFA 2AWZA 3LH2S 3VZHA 4KIAA 3G82A 3J7Z5 4HLBA 2Q6CA 4OZ3A 3TAGA 2VUGA 4KHPF 4DQPA 3MN6A 5T7LA 2KG0A 4K0KJ 2WB1D 4KAIA 2DFHA