3V6DA

Crystal structure of hiv-1 reverse transcriptase (rt) cross-linked with azt-terminated dna
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
total genus 147
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v6dA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v6dA05
2QK9A 5CZ2A 3CIZA 2Z1GA 4N56A 4B9VA 1DTQB 3NGDA 2WTFA 4CJLA 4IBNA 3BDPA 4IH7A 4J9QA 1HQUA 2OA8A 2FJWA 4CGJA 3K5OA 3HO1A 4O5BA 2ATLA 5KT6A 1TKZA 1FKPB 5JS2A 4IDKA 4H4MB 4MFBA 3CO9A 4K8XA 1C1CB 3AO5A 1RT4A 1RA6A 5FDLA 1LAVA 3RMDA 5CYMA 1WSJA 3SI8A 2A1RA 3EYZA 4CEQA 1TK5A 1RT3B 3MXMA 2P5GA 1RT6A 3LALA 3KNAA 5KFEA 3U6FA 2AGPA 4O55A 3K5MA 5J2PA 5EDWA 3O3GA 1IKXB 3OHBA 4W5QA 5HROB 4ZPCA 4FLXA 3OYAA 4FCYA 2EC0A 2IM3A 2R8IA 3SUPA 2YNHA 3QINA 1CZ9A 4I7FB 4CECA 5CYQB 4LSLB 3DRPA 4O3SA 1BIZA 4ZP8A 2IJFA 2XO7A 3GYNA 2HHSA 5KFLA 1LW0B 4RW8A 3MEGB 3E51A 3KIOA 4CEZA 4R0EA 4WFYA 1D9FA 3VN5A 4LSNA 4M3RA 2QV6A 3S3OA 3BQ1A 3QESA 2XWYA 4NCBA 4KAIA 4NLPA 1MU2B 2D0CA 4OL8A 1IKYB 3BREA 4DMNA 1KVAA 3QYYA 1ZBIA 3LWMA 3SQ2A 1NK4A 1UA0A 4FZXC 4RW7A 4JRQA 4ECYA 5KGXA 4KHQA 2ILYA 2FLPA 3VQDA 1RTIB 3BSNA 2HB5A 3UDLA 3ZSQA 2FBYA 3M8RA 4DTPA 2XCAA 4U7CA 2R2UA 3RB3A 4F3TA 4OLBA 1DTTA 4EBEA 3IGVA 2QKBA 4B9SA 2DPIA 3M8PA 1N5YB 4ZTFA 4R8UA 1S10A 5EWGA 3ZT0A 1WNSA 2AWZA 2BQ3A 1N4LA 1UWBB 3T5KA 2HNDA 2G8WA 4DF4A 3SJJA 4LQ9A 3CFOA 4QWBA 3I0SB 3HVRA 1KSPA 1KHWA 3PJXA 1TKXB 2G8IA 3C6TA 3GIMA 1N56A 4F3OA 4FZZA 5DGBA 2OPQA 4QWEA 1CZBA 3T5HA 4NCGB 1T3NA 3THVA 3V9ZA 1IG9A 1LW0A 1RTDB 4KE5A 1S0OA 2V0NA 3TVKA 3JSMA 1L3TA 3Q8QB 1RTHA 4AILC 4CESA 4TY8A 1RILA 4ECQA 1VSKA 4K4WA 4ECRA 3PW5A 1Z4UA 4O0JA 3EY1A 3AVNA 3MFHA 4I9QA 4FBTA 2X6SA 4MIAA 1UOCA 4FK2A 4Y2CA 1Z26A 4H8KA 2E9TA 4KTQA 4RW9B 3V6DB 4MIBA 1ZETA 4ZTJA 2YNIB 2XY6A 3AO2A 3DYAA 5CZ1A 3RB4A 2JEIA 4Z0UA 3OYDA 2VG7A 5CY4A 1YT3A 4C8NA 3QETA 4BDYA 4NLSA 1ASWA 1RTJA 4FJ9A 4IFVA 4JRPA 2Z1JA 1C1AA 2R8GA 4RUCA 2YNGA 1L3UA 2YNFB 3S3MA 1NKEA 5L9XA 4DTNA 1RYSA 2YHAA 3HVAA 4Z4GA 3LP2A 3KK2B 3JYTB 4J2BA 4ED0A 2Y1IA 1Q9XA 1VSJA 4M42A 1SV5B 4OKEA 3NHGA 4FYDA 5DG8A 1T05A 3VQ9A 4JLHA 4QPXA 2D0AA 3P83D 4EP4A 3DRRA 2X6NA 1Y97A 4M95A 2Q3SA 1R0AA 1LWEB 2HMIB 1RTDA 4M45A 5J1EB 3VQQA 4CEEA 3HYFA 2AX0A 4YR2A 4E7HA 3DI6B 4KB7A 4G1QB 3T19A 4PA1A 4RNFA 4RNOA 3RMCA 1MMLA 4HTUA 4IOBA 4NLXA 3VA0A 3IS9B 2E9RX 1S1TA 4CEDA 3I5AA 4N76A 1HMVB 3OYJA 3IN5A 5EWEA 4J9OA 2P1JA 5KFVA 3KMQA 4L8RB 3DLRA 3ZT2A 3RRGA 3NGZA 1NJZA 2YNIA 2HW3A 4YP3A 3QEXA 4ED7A 1NKCA 3PX0A 3DLGB 4AH9A 3GILA 2J6TA 3AVHA 3RAXA 1NHUA 4N47A 3TAMA 3ZSWA 1Z25A 1NJXA 2IDOA 4GMJB 1RT7B 4BDZA 3RMAA 1TK8A 3CJ5A 4CF8A 5KG7A 3NH2A 2ZKUA 4FK4A 3QGHA 3VQ4A 4DFKA 3I0RA 3NF6A 4M3UA 4Y1CA 1JLCA 3MECA 3AA4A 4IFYA 1ASUA 5D3GB 4HYKA 4CJFA 2WHOA 2NUBA 4O3OA 4E7LA 4AHTA 1GX6A 1NK6A 5KG0A 4XIUA 1HNIA 4ECWA 3MXJA 1S6QA 1T03B 4QAGA 4DQRA 1WAJA 3QLHB 4WXOA 1U04A 2OPRA 3DOKB 1JLGA 2ZE2B 3QZ7A 1YVFA 3OLAA 4OPJA 2HHUA 4EZ9A 5DGAA 3LDSA 1QAJA 2V9WA 2IM1A 5KFSA 5F8MA 1C1BB 2JC1A 3DRSA 4MQ3A 3OYLA 4PQUB 1S1VB 1XR5A 4DEZA 1XWLA 4WFXA 4I2QB 2XRIA 2QKKA 2IOCA 4FW2A 3NGYA 4UQGA 4FLWA 2JEJA 1GOCA 3DLGA 4O3PA 1IO2A 4WZMA 1T8EA 3PUFA 1RBTA 3SV4A 1K1QA 3ZSOA 1RT2A 3H5XA 3QNNA 4Q8FA 4KO0B 1RA7A 3LP1B 1IH7A 3V81B 2AX1A 4MKBA 4ECSA 4ZVEA 2BR0A 4Z4EA 5KG4A 3Q8RB 1L3SA 3PO4A 5C5JA 4CEBA 1VSIA 5E41A 4EEYA 4JV2A 4IG3B 3DM2B 5I3UA 3NGIA 4KV8B 1TKDA 4URGA 4IQXA 4H4OB 3SQ0A 3GV7B 1HYSB 5L1JA 1IKVA 4PUOB 3VQEA 4W5OA 4HUFA 1LV5A 4YNQA 5KG2A 1BI4B 2KW4A 4DTOA 3H40A 5JS1A 3MF5A 2IGIA 3SCXA 3CYMA 1RBVA 3SUOA 4AHVA 2W9CB 3LP0B 3HHKA 3HVWA 1RT1A 1C0UB 3QO9B 2WOMB 4ECXA 3KLIA 4LD0A 1KLNA 3L3UA 3SYZA 4Y3CA 1NK0A 3MR6A 2F8EX 5KFBA 2Z1HA 1ITGA 4YFUA 3I5CA 3LWLA 3BSCA 3NF8A 3NAHA 3KHGA 1QHTA 5KFFA 4DL2A 1RDDA 4FVMA 5J2NA 4CJVA 3OYIA 4WE1B 1S1XA 5F8IA 4DSLA 1LWCA 1VSDA 3L2UA 3OS2A 4Q5VA 4I2QA 4PWDB 3V4IA 1S9EA 2ASJA 1TVRB 2W8KA 2BE2A 1TL3B 1CSJA 1SUQA 4DS5A 4ZHRA 2V4RA 5J2QA 4FS2A 4GW6A 3OYGA 2D41A 2FBTA 3PR4A 2XHBA 5KT4A 4EBDA 3WNGA 1UAXA 1S1WA 3G6YA 1B9DA 1X9MA 1BIUA 2I5JA 3AVLA 1LWFA 4NLRA 1LAWA 4F8RA 5KFXA 4CJ3A 3AV9A 4CIEA 4RW6A 2GIRA 1S49A 4K4YA 3VQBA 1SH0A 3SUQA 1BCOA 3DLBA 4DG1B 5DLFA 2UVWA 5KFPA 4NYNA 4KHWA 5JXSA 4TY9A 4AHRA 2F8SA 1TKTA 4JV0A 1ASVA 4IR9A 2VA2A 3IRXB 3KJVB 4KKOB 2LSNA 3NAIA 4FJ8A 3HVTB 1S0MA 5F8LA 3SPZA 4IG0A 2AQ4A 4M94A 2WOMA 4F4KA 5KFTA 1TL1B 3KKRA 4MK7A 1HNVB 4ID5B 4J2EA 3S3NA 3H5YA 4DTMA 2W8LA 1HYZA 4MKAA 1LW2A 3CVKA 1C0TA 4LH5A 1S0NA 3PW0A 2FVRA 1S6PB 2W9BA 3B6PA 4CE9A 2FJXA 1C2PA 1BQNA 2VG6A 1RBUA 2RKIA 3ZSVA 5KFKA 4TLRA 4FXDA 1S4FA 2PY5A 1EETA 3OVNA 2B6AA 3SFGA 2FC0A 3ALYA 1RT5A 4C8LA 4M3WA 3LP3A 2AGOA 3CWJA 4CFAA 3KK3A 2DFFA 1SH3A 2IJNA 5HRSA 2UVUA 1X9WA 2HAIA 2YKNB 3RWUA 1S9FA 4HKQA 3M8QA 4DTXA 3MEEB 4GC6A 1D8YA 5DQHA 3SFUA 4N5SA 4B3OB 4DTRA 3N6NA 4E0DA 4O0IA 3RAQA 1KLMB 5HP1A 3MEDA 1JXBA 4KI6A 1JLEB 3OYBA 5F8NA 3E01A 2KTQA 3D28A 3T5JA 1G15A 1U45A 3ISND 3SI6A 4Q0BB 2HNZB 4CEAA 4CF0A 1YVUA 4I2PB 1RAJA 1I3AA 3MTKA 1QTMA 2WB4A 4FJ7A 5EUHA 1SH2A 2AJQA 3DOLB 3HXMA 4ECTA 3KHHA 2ZD1B 3NBPA 4CFDA 2B5JB 5KFJA 1A5VA 2FVSA 3V9UA 3ASMA 1DTQA 1VRUB 1VSMA 2E6MA 4CJUA 1KVBA 1UA1A 2O4IA 1SL1A 3PV8A 4FJGA 4C8MA 1FKPA 4OGCA 3C94A 4H4MA 4ZPDA 5SZTA 1C1CA 3QEIA 2GUIA 2J6UA 4QOZB 5KFQA 5KFWA 5HLFB 3AO4A 4X2BA 1RT3A 2XY8A 3P1GA 1RBRA 4DTJA 3DLHA 2IC3B 3ITHB 1J53A 3RBDA 2YKNA 4Q44A 5I42B 2HHWA 3K58A 1IKXA 2FVQA 5HROA 1QSSA 4HVJA 1T7PA 1XR7A 4F4ZA 1KHVA 4QCLA 4ZP9A 4I7FA 1JXLA 4CJTA 5CYQA 4LSLA 4TYAA 4DSEA 3QIPB 4F50A 2ATQA 4JS4A 3WNHA 4ED6A 2OH2A 4I9LA 4KB0A 2ETJA 3MEGA 4BE0A 4OLAA 4W5NA 1WSFA 4B8CA 2HNZA 1D9DA 1NK9A 4I2PA 1MU2A 3SNNA 3NMAA 4NLWA 4IR1A 5KG6A 1IKYA 4TXSA 4CF9A 2Y1JA 5KFOA 2ZD1A 1JLAB 4E19A 4NRUA 4OKKA 1NJYA 4EZ6A 3OJUA 4BE2A 3KLEB 4R5PB 3CM6A 4RW4B 2WONB 4H54A 5KG1A 4OPKA 1RTIA 3KLGB 4CJWA 3AO3A 5F8HA 3KHLA 3V9WA 4Z4FA 2OPSB 1S1UB 4QWCA 3Q8SB 3PO5A 1FKOB 2OZSA 1JLBB 2HVIA 3V6HA 3DLEB 5C24B 3PVXA 3HM9A 3T3FA 2EX3A 1HYVA 3ZSRA 1N5YA 4YQWA 4CERA 2PYJA 4DL5A 1YTUA 2W7PA 3LANA 3IG1B 4JV1A 2HNYB 4ELUA 3AVMA 1UWBA 4F4YA 3K5LA 1N48A 1S9GB 3I0SA 2XY7A 2ZQBA 3QGGA 2FLLA 1TKXA 3G86A 1GX5A 5C25B 3FFIB 5KFCA 5F9LA 4NCGA 1NOYA 4OGEA 3BGRB 4KI4A 3OSNA 1HQEB 1KTQA 3CJ3A 3C6UB 4MH8A 4J2AA 3L2QA 3PW7A 3V1OA 1BQMB 5EWFA 4GC7A 4O3QA 5DQGA 3RB6A 3CM5A 5KGWA 5KFNA 1D5AA 3KD1E 4Y1DA 2BQRA 3LPUA 3VQSA 3HK2A 4RW9A 5HRPA 4NCAA 4B9NA 3V6DA 3N6MA 2C2RA 2UUTA 2FVPA 4CHNA 4DSFA 2D3ZA 1U4BA 4FK0A 1JLFB 5L1LA 2P5OA 4CK3A 3FQKA 2G8FA 3BSAA 1FKOA 2XY5A 2G8UA 3K2PA 4CGGA 4CIFA 3U3GA 1IM4A 2O4GA 3PW4A 4M3TA 3OHAA 4HHTA 1RDRA 1RDBA 2YNFA 3V1RA 4FS1A 4DQSA 4GVMA 2KZZA 3UPFA 3KK2A 3JYTA 1GOAA 1RYRA 1RDAA 4FLTA 3QEWA 4Q43A 4RNMA 4DLGA 4FJ5A 4F2RA 4FJLA 4M41A 1J5OB 3PY8A 1SV5A 4IKAA 3HJFA 1XHXA 1DLOB 3TAQA 4KFBB 5K14B 4CHYA 1BHLA 5HBMB 3MXIA 2O5DA 4QWAA 4CF2A 2V4QA 2ALZA 4FM0A 4DQQA 3DLKB 2C28A 5DMRA 1HJRA 4C8OA 1LWEA 2HMIA 3OLBA 3QIDA 5J1EA 3CDEA 1HQEA 4OJRA 3C6UA 4B08A 1REVB 3DI6A 4G1QA 2YKMB 4WYLA 1IKWB 4DL4A 3OYFA 3NF9A 4KTWA 3H4DA 4KSEB 3AA3A 3AVBA 4URQU 4ZVGA 3IS9A 1TV6B 1HMVA 2IM2A 5SWMA 5F8GA 1FK9B 2IBKA 2IAJB 1WNEA 4FJNA 2BQUA 2WRMA 5KI6A 1NOZA 1QSLA 4U6PA 2D3UA 2UVRA 3RTVA 4IH6A 4K4SA 4E89A 2IA6A 4Y2AA 4IH5A 3OYKA 2HHQA 2UUWA 4B9TA 1W9HA 1KFSA 2C22A 3HPHA 3RB0A 4C8KA 3IGNA 3G0ZA 1RT7A 4NYFA 3O4NA 3KK1B 4KB1A 4Q45A 4Q8EA 4ZPAA 4HUEA 4J9MA 2GC8A 5D3GA 1DLOA 4NLGA 4RUAA 4J9RA 4TSXA 3KLFB 5KT2A 2BANB 4O44B 4DTUA 3LAKA 4IKFA 2PZSA 1JKHB 3DLKA 2RDJA 3SQ4A 1T03A 4NLDA 3QLHA 3DOKA 2ZE2A 3TWHA 1EX4A 3BJYA 4WFZA 1REVA 4EP5A 4EYHB 3KLHB 3ZT3A 3HP6A 1A5WA 3TAGA 4O4GB 3CG7A 1C0MA 3TAEA 1L5UA 4CJEA 5C42B 2ITGA 3ZT1A 3GIKA 2R2RA 1C1BA 1ZBFA 4HUGA 2ILZA 3OYNA 5KG5A 3VA3A 3M8SA 4PQUA 2A1SA 1S1VA 1U09A 3FQLA 4CCHA 4CGIA 3BQ2A 5DLGA 1EP4B 2X74A 1N6QB 3L3VA 4DQPA 2JEFA 5KFMA 5L1IA 3VQ7A 4M3YA 2B43A 3BR9A 2R7YA 5EU7A 4CHZA 4KO0A 3LP1A 4CEOA 3CDUA 1TKZB 3V81A 1TAUA 4IDKB 3LZJA 4MFBB 2D7SA 4RNHA 1RT4B 4O4RA 5FROA 2D5RA 2HHTA 5FDLB 2BDPA 5CYMB 1CLQA 2IS3A 1NK7A 4NLVA 4IG3A 4KTZA 3DM2A 2OPPB 4KV8A 4H4OA 3K57A 1VSLA 1HYSA 1RT6B 3O3FA 4PUOA 1WSIA 4RNNA 1NKBA 1A5XA 1X9SA 2JGUA 4FJXA 2FBVA 5KRTA 5J2PB 4DU4A 1BI4A 1XHZA 4KHYA 1JKHA 2EHGA 3OYHA 1WSHA 1SKWA 5T7BA 1B9FA 4F4WA 3QERA 2W9CA 3LP0A 1W25A 3VQPA 1U48A 1ZBUA 1C0UA 3QO9A 2YNHB 3FRZA 4K4ZA 2UVVA 2KFNA 2WCXA 1BCMA 3H5UA 1S5JA 3U3YA 1RDCA 3DRPB 4XO0A 3H4BA 4DTSA 3H2LA 4AHSA 2BRLA 3AVGA 4DU1A 1D0EA 4RW8B 3T1AA 1VRTB 4LSNB 3RR7A 3HL8A 1NK5A 4WE1A 4NYZA 4K4VA 4HCBA 5L1KA 4PWDA 1QSYA 3VQAA 3GIJA 1TVRA 4KHUA 2C2DA 2ASDA 4DSIA 3G10A 1N6QA 1TL3A 1B92A 3V6JA 4FJJA 2JEGA 4RW7B 4CJKA 5KFDA 2G8KA 3OL8A 3PX4A 4QW9A 2WK4A 4ECVA 2F96A 4Y34A 2IMWP 3TABA 3DDKA 1OS5A 2DTUA 2BGGA 3TI0A 1DTTB 1CXQA 1BGXT 4DG1A 4NLYA 3KOAA 4DL7A 3O4QA 3M8PB 1U47A 4BDPA 3OYMA 2OPPA 3OL9A 1VK0A 4FM2A 2OZMA 4R8UB 4K4XA 3G6XA 4ZMMA 4TQSA 3QIOA 3CDWA 2KFZA 4AHCA 3IRXA 3KJVA 2DFHA 4KKOA 5KFIA 4CJQA 2HNDB 4CGDA 1J9AA 4FLUA 3HVTA 3D45A 2E4LA 3C95A 2HVHA 4DLEA 3GV5B 4DFPA 4ICLB 3BQ0A 2KZMA 3C6TB 3O3HA 3AVIA 4TYBA 4KHNA 1EKEA 2C2EA 4NLTA 4LQ3A 2OPQB 3H08A 3RR8A 1TL1A 3AVKA 4KBIA 1QAIA 1HNVA 1KVCA 4ID5A 3H5SA 1QE1B 1VRTA 2YV0X 1SKSA 5DQIA 3TQ1A 3JSMB 4CJSA 1I6JA 4JUZA 1S6PA 2B4JA 1RTHB 4FJHA 4TY8B 2W9AA 1K6YA 1ZBLA 1EXQA 4J9SA 4E7KA 2G8VA 2RDIA 2GV9A 4OKJA 3OY9A 3T5LA 4DF8A 4CHPA 4KRFA 2R2TA 3L8BA 4DFMA 3NE6A 1RBSA 1ZYQA 1VSHA 4KHMA 4XPEA 3LAMA 4EO6A 1S97A 1FXXA 2HWHA 4FJKA 3DYAB 3QEPA 4J9PA 1KRPA 3PR5B 1WLJA 4J9NA 4CJRA 2VG7B 1X1PA 2JLEA 3I8DA 3ZSZA 1RTJB 2W42A 4IFVB 3MEEA 4BWMA 3SUNA 4FW1A 5DK5A 2FBXA 2YNGB 3VQ6A 4B3OA 2QE5A 3LP2B 4F2SA 1KLMA 2FVCA 2QXFA 3OL6A 1JLEA 3ZCMA 3KTQA 3V6KA 1NJWA 1JIHA 3UQSA 1KFDA 4KHRA 4KPYA 4CFCA 4Q0BA 1XC9A 1WSEA 4ICLA 4J9LA 1T05B 2XC9A 3PJWA 3TAFA 4O3RA 3MR2A 3S9HA 3DOLA 4XPCA 1Q8IA 3DRRB 4WZQA 3L2WA 4IRDA 1TAQA 2RF2B 4CIGA 5KFUA 1R0AB 3WNFA 3PX6A 1SKRA 1QE1A 3NFAA 2B5JA 2E9ZA 3ZT4A 2W7OA 1VRUA 1HRHA 3L2VA 4K4UA 3H59A 3NH1A 5KFZA 4K50A 2HHXA 3HT3A 1GOBA 2F8TA 3P5JA 3L2RA 1S1TB 1K1SA 4FJMA 4ED3A 3CQ8A 3FDSA 1QS4A 5F9NA 3WNEA 1JL2A 4TN2A 4ECZA 4J2DA 5HLFA 3K59A 4B9UA 1D1UA 4URSA 2VWKA 2IC3A 3TARA 4ELVA 3ITHA 1VSEA 3NDKA 5I42A 1JLQB 1NK8A 3EZ5A 3TAMB 4F4XA 4HCCA 5FRMA 4CJ4A 5DG7A 5JUMA 3M9NB 3HPGA 4Z4IA 1HARA 2KQ2A 3NF7A 5KTQA 3UIQA 4LY7A 3V9XA 3VQ8A 4DS4A 4DSJA 5KFYA 3MR5A 3QIPA 2ASLA 4WYWA 3OJSA 3AVJA 3I0RB 3OS1A 1JLCB 3SPYA 3MECB 3EPGA 4IFYB 1C6VA 1QQCA 3VQ5A 3RRHA 3KHRA 3H98A 3PZPA 3ULDA 1I39A 1HNIB 1S6QB 1JLAA 5KG3A 5KRSA 2RF2A 2OPRB 3SV3A 1JLGB 3KLEA 4R5PA 4CFBA 1RNHA 4RW4A 2WONA 3F73A 4RU9A 3KLGA 2VG5B 2GIQA 1YTAA 2CKWA 4IRCA 2OPSA 1S1UA 1QUVA 2XI2A 4WXWA 5KFHA 1JLBA 3DRSB 3DLEA 5C24A 1HPZB 4NLQA 4ZVHA 3HPOA 2DFEA 4E7IA 2YHBA 4CK2A 1VSFA 4FM1A 3KKSA 3HP9A 3OL7A 3IG1A 4K4TA 2HNYA 2R8HA 2FLNA 1JLQA 5FRNA 1RT2B 1S9GA 3K5NA 4ID1A 4MK9A 4RG8A 4DWIA 5KFRA 3Q8PB 3F9KA 3D5MA 1TGOA 4TQRA 5C25A 3FFIA 3GV8B 3PW2A 4FLZA 3DMJB 2DY4A 4J9KA 1KCFA 3BGRA 4NRTA 2R2SA 3OSPA 2XI3A 5I3UB 3ISNC 2Z1IA 1IKVB 2G8HA 4DQIA 3SQ1A 3AVFA 5KT5A 1BQMA 3M9MB 1JXEA 4NLUA 1NHVA 2XGQA 4BWJA 3NKYA 1RT1B 2D0BA 2X78A 3LPTA 3TR8A 3QEVA 3V9SA 2HHVA 3KLIB 5HRNA 3AA5X 3OYCA 4ZP6A 3KD5E 2VG5A 3GIIA 4CJPA 3UR0A 3HSTB 1JLFA 3NH0A 3PHEA 4ZPBA 5J2MB 3KLVA 3EZUA 4OVLA 5J2NB 1S48A 4E1MA 3CJ4A 1S1XB 2I1RA 2CJQA 3MFIA 1LWCB 3D0PA 1XI1A 1HPZA 4EYIB 2RPIA 3ZSYA 2R8JA 4E1NA 3LZIA 4BE1A 2BRKA 3V4IB 1S9EB 3CFRA 3ICLA 2P51A 2BE2B 1ZTTA 4G3IA 1SUQB 1CXUA 1RCHA 4ZHRB 4PY5A 5J2QB 1WAFA 3AVCA 4N41A 3GQCA 3BSOA 1W0HA 1S1WB 5HRRA 1J5OA 2I5JB 3CJ0A 4CJ5A 4KFBA 1LWFB 5K14A 3MR3A 3OS0A 5HBMA 4RW6B 3CJ2A 5KT7A 4ELTA 4RZRA 3DMJA 4QWDA 3NL0A 2J6SA 5DG9A 1NNDA 1L3VA 4E3SA 4Z4HA 4CF1A 4ZP7A 1TKTB 4M3ZA 2AGQA 2VA3A 1O1WA 2YKMA 1TQLA 1IKWA 3I5BA 4YR0A 3KMSA 4B9MA 4ED2A 3CFPA 4JS5A 4BACA 3MAQA 4DFJA 4K8ZA 4EO8A 4CK1A 1WSGA 4IG0B 1TV6A 4CHOA 2IM0A 5T14A 3AVAA 1ZTWA 4B9LA 4QW8A 1TK0A 1FK9A 4DL3A 2IAJA 1Q9YA 2E6LA 4ED1A 4M3XA 3RMBA 4EBCA 2DPJA 5J2MA 3HKWA 4YR3A 1WN7A 1JX4A 4AHUA 1LW2B 4CHQA 2XCPA 1C0TB 4CGFA 3AA2A 3G6VA 4YMEA 2W9BB 1HQUB 3EPIA 1BQNB 2VG6B 3TAPA 3N6LA 2RKIB 5KT3A 4W5RA 3M9OB 4DL6A 1JL1A 2VWJA 4B8AB 2XGPA 5KFAA 3RBEA 1F21A 1BISA 1EETB 2B6AB 3A2FA 3KK1A 4E7JA 1RT5B 4FZYA 3ZSXA 1U49A 1SL2A 3IAYA 1J54A 4DSKA 3KK3B 3AO1A 1XR6A 4O3NA 4FLVA 3KLFA 3QGIA 2BANA 4O44A 2OYQA 4DU3A 2GBZA 4NLOA 3FSIA 4ECUA 4CGHA 3NCIA 3M8QB 4KREA 4CEFA 1T94A 3NAEA 3B6OA 3TANA 2HWIA 4KHSA 3QNOA 1SL0A 4NZ0A 3KLHA 5HP1B 3MEDB 4O4GA 2FJVA 1TP7A 3E01B 1ZBHA 5C42A 4FLYA 2PYLA 2JC0A 3VQCA 4Z4CA 2RN2A 3SZ2A 4FBUA 3QZ8A 5F8JA 4ED8A 3OYEA 4FJIA 1BL3A 4W5TA 4LH4A 4ZVFA 2R8KA 4KAZA 3V1QA 4IRKA 1EP4A 3NBPB 4MK8A 5KFGA 2AU0A
chains in the Genus database with same CATH superfamily
2P9IA 2QK9A 2LA4A 5K9FA 2QRRA 3NGDA 2WTFA 4CJLA 2HGLA 4IBNA 3DFEA 4IH7A 4C98A 2WVBA 3M7VA 1HQUA 1HWKA 1RLDA 1NM2A 1VQ4S 4C3LA 3RBXA 1AYEA 3MM8B 4H4MB 3CO9A 1O5JA 5D0RA 3K5PA 1RA6A 2LKZA 3C15B 2CQDA 1WSJA 3EYZA 2Y0SD 2ZZTA 2XLKA 1BLUA 1RT6A 5KFEA 4Y65A 5LSLA 2KJVA 3K5MA 1AROP 4LF9F 5EDWA 3EZWA 1FX4A 4LF1A 2ZC4A 5DM6L 3UB5A 4FCYA 2IM3A 4BVPA 3TRGA 5G4DA 2HG4A 2PE8A 1XNRF 3BP8A 4I7FB 1WJ9A 4G6VB 3P39A 4O3SA 3ZZOA 3GYNA 3E51A 4R0EA 4WFYA 2GS8A 1D9FA 3P4IA 4LSNA 4CO3A 4CBUA 2DB1A 3BQ1A 1F5AA 1N8RT 3WEEB 3BREA 3E2EA 1I1GA 1VQ5N 1ZBIA 3SQ2A 3J81Y 2CQ4A 2Q79A 1U6FA 4JI2F 2H5EA 5KGXA 2EG2A 4BVOA 3VQDA 5IQQA 4WQ4A 3BSNA 2BM1A 2ADCA 4OI0A 1MMNA 5A8RB 3Q2TC 3KVGA 1PJ5A 1N36J 4LF7J 4OLBA 2UUCK 1JNZB 2QJ3A 3LDLA 2DPIA 1N5YB 4MKVA 4X4TA 3TTCA 4OYXA 4DL0C 4FNHA 3NS6A 1N4LA 5AQPA 4M5LA 4RX6A 3R9LA 2HNDA 3SJJA 2Q31A 3I0SB 3PACA 1KHWA 3PJXA 2G8IA 2E2OA 3M30A 2ZJRL 2M70A 3GIMA 4IFEA 2VCPA 4M63C 1NGDA 3I6PA 3THVA 1T3NA 3C2PA 3THTA 4DPXA 4WTYA 2BJ8A 1S0OA 3NRBA 3CPEA 2V0NA 3G82B 3RZAA 1D3WA 2Z57B 3LM2A 1NLVA 3SSRA 3B4MA 1VSKA 4ECRA 3PW5A 5AQQA 4O0JA 4PXBA 3AVNA 4DR1J 5LJ5Y 2X6SA 3T6BA 3OT9A 2GO9A 4YOXA 3CCUS 5EVZA 4KTQA 2E9TA 1U2VB 4RW9B 3V6DB 2DH9A 4MIBA 1ZETA 3E9LA 4ZTJA 3R3TA 3UN2A 3CGIA 3HHLA 3FEYB 4CLTA 3OYDA 3W5YA 3QETA 2GFFA 2UUAK 4BDYA 1ASWA 8AT1B 5E7OB 1RTJA 4CM0A 4IFVA 3M32A 1NLKL 4RUCA 4BC9A 4CH0S 5D6GA 1L3UA 1NKEA 5L9XA 4Z4GA 3KK2B 3CJKB 3I96A 3R6GB 2CH5A 1Q9XA 1SQKA 1CPZA 3PXGa 2DO4A 4UUWA 4M5NA 2DIVA 1ULRA 1KAXA 2KDOA 4EP4A 3DRRA 2QA4G 3HX9A 2HVEA 2Q3SA 5JLFA 3MPWA 1RTDA 4DU7A 2V51B 3LGHA 4CEEA 2AX0A 4DUTA 4G1QB 3MOZA 1KC8T 2AKWB 2KL8A 4RNOA 3CMES 2XMWA 2LQJA 4ZCLA 2CPIA 4DV0F 2WW8A 4PL7A 2FLOA 2X7IA 3R7SB 1K0TA 3QJLA 3I5AA 1HMVB 2PC6A 5AQZA 3OYJA 4M5JA 3IN5A 5EWEA 4M8LA 3RG6A 2HS0A 3ZT2A 3DLLQ 1BWEA 2YNIA 3CD0A 4KGKA 1VLYA 4NWBA 3AVHA 2J0SD 2YJFA 2GX8A 4M5IA 3R9PA 5BRHA 1Z25A 2MQOA 1XJWB 3AD8C 2KRBA 1IJEB 3OXFA 4GMJB 1RT7B 2RQ4A 3NH2A 4FK4A 1SQGA 3ZETA 4M3UA 3SEOA 3MECA 1UMJA 2Z2LA 4IFYA 3R1XA 5D3GB 1GX6A 2QX0A 1NK6A 4FVCA 2G1DA 4BR4A 4J90A 1HR0J 4PKHA 3H25A 4ISGA 4PG7A 4G9ZA 4DQRA 2P9LB 4QAGA 3QLHB 1JLGA 2ZE2B 3QZ7A 1VQSA 1YVFA 4OPJA 4DBQA 2C2MB 4EZ9A 4LF6K 4DR5K 1UVIA 1QUPA 4B1VA 2GAGC 3KG4A 4YY3F 2IM1A 3EN9A 3H42A 4WFAL 1P1TA 2YX6A 3FCHA 2YKOA 2AV5A 4PQUB 1XWLA 2ROGA 4I2QB 3K8VA 4A2BA 2XRIA 3D0HE 3GL1A 2IOCA 4M5DB 3CCTA 4UQGA 3NGYA 4FLWA 2DHSA 5FPMA 3IMXA 3VTIA 3NGUA 3A12A 1K1QA 2ZITA 2A1BA 3LW5C 3H5XA 3QNNA 3LP1B 3KUHA 4CI6A 3V81B 2BR0A 4XDDA 5KG4A 3Q8RB 4DV6K 5GAEU 1Z6RA 5C5JA 4CEBA 4QIWD 4EEYA 1YVNA 3CIPA 1TKDA 4URGA 3SQ0A 4JYAJ 1IKVA 2DGQA 1EARA 4FN5A 3VQEA 3GDQA 1B3TA 1BI4B 2XSFA 4QU6A 3D4JA 3GSDA 1RBVA 5B0CA 4AHVA 1IN0A 4WQ5C 1CULB 2WOMB 4ECXA 3L3UA 2YKAA 3CF5L 2Z1HA 3MUMP 3SMSA 3SBTA 4A46A 2K2PA 3I5CA 1VQPN 2QL7B 3NF8A 3QBWA 3NAHA 1IBKK 5KFFA 4RCHA 2MSTA 2CH6A 1VIOA 1Z2LA 4DSLA 4FP9A 1K9MO 1WBDA 4Z7CA 1SKUB 4BR2A 4Q5VA 2ASJA 4H0YB 4DCPB 3D7SB 1HKCA 1SUQA 3KUGA 4CZGA 3OYGA 2FBTA 3MUTP 3PR4A 2H4YB 3BR8A 2OTJS 2MB0B 5KT4A 4BC2A 2HEKA 1X9MA 2XYGB 2I5JA 1WI6A 4ZLNA 2CNLB 3AVLA 3UE5A 1TTHB 3NWRA 5KFXA 4DR3K 3AV9A 2VOOA 3UN3A 2NUUG 2GIRA 1S49A 3OW2R 3MN7A 1BQXA 1SAZA 1HFEL 3D2EB 3VEXA 1SH0A 4B3RJ 4J37A 3CMAS 3GZ7A 1RWOB 2V8VA 2QSWA 1V9OA 4OX7A 3ZTQA 2F8SA 2JL9A 4FWNA 4IR9A 2FHMA 1VGYA 4EMDA 5A0YB 1O6XA 3VEYA 3D66A 2LSNA 3H6EA 4B3TK 3DXMB 2AEFA 2DHHA 4JI6J 1LKZA 3A5LC 4M94A 5IFMA 5KFTA 4TKTA 3GWCA 4HHJA 5M2RA 1HNVB 1IM6A 4DV1K 4DTMA 1P8GA 2KH9A 4NL5A 1RBUA 1QY7A 4LRCA 2RKIA 4CT8A 5JMNA 4USIA 1UEUA 3L9ZA 4GY2B 1FE0A 1FDNA 4M5GA 5KFKA 1Q8KA 3SDEB 2NSCA 3Q89A 2RE1A 2B6AA 3IC1A 4J7CA 2D3OR 2HOEA 4BRCA 3JQJA 5L39A 3A1YG 5AQIA 3EKUA 3KK3A 3TEGA 2UVUA 2IY5B 2DVIA 2R3VA 3KNGA 4NXNF 5GAEP 3GPAA 3QRQA 5LY3A 4GV3A 5E3CA 3OQ2A 2AT1B 5AT1B 3VEWA 2FDNA 1MN7A 3PRVA 4NYOA 4DTRA 3N6NA 3CCVN 1KLMB 1JXBA 2BJ7A 2OD4A 1SC3B 2P8IA 4BRKA 1H38A 3IXQA 4X62J 4WBFA 1VIXA 1I3AA 4DX7A 2WB4A 1WUAA 4RKUC 5EUHA 3Q2SC 1SH2A 2E5HA 3BN7A 1CLFA 2CZ9A 4P75A 4OZ0A 1VQMS 1VQ9S 2ZD1B 4BROA 3JAMO 2V34A 5KFJA 1A5VA 1WSVA 1VQ4N 3ASMA 2CNKB 3CB4A 3ZC4A 3FFKB 2ZOMA 1UA1A 3SK3A 3MWTA 4GKKK 2O4IA 1ITPA 1UJ5A 2ASMA 3DC2A 4OGCA 4LF8F 2PI4A 1C1CA 3U1NA 3QEIA 2GUIA 3F41A 1M5OC 4QOZB 1KR4A 2RSQA 5KFQA 1SJFA 1NPKA 3L6QA 2BW7A 1WG4A 4J9UE 3P1GA 3CTRA 4LRBA 4DTJA 3DLHA 1RCXB 1FXRA 1X4FA 1S76D 4Q44A 3IFEA 3QFUA 4FYVB 2FVQA 2QWMA 1QSSA 4HVJA 2MQQA 2AP6A 1OMSA 2MKJA 2DHXA 2F8MA 1KHVA 4ZP9A 4U7UK 5CYQA 3K7RA 4TYAA 4DSEA 3UFCX 4K0KJ 3GFYA 4I9LA 2ETJA 2HWTA 3MEGA 1F2GA 1NJIT 1Q7YT 1WSFA 4B8CA 3P96A 2HNZA 1D9DA 3GJRB 4I2PA 1YJRA 3A8JA 4FPRA 2N4CA 1VHIA 1XN9A 1IBLJ 2DPNA 3PJ9A 5AXKA 3NS5A 5HSPA 5C2GA 5AQGA 3CJCA 1EWQA 2IVPA 3CM6A 5I9EB 2YH1A 4RW4B 4H54A 2ALYB 3HSGA 3FEZA 3KHLA 5IWAK 2OPSB 2EK1A 1LEOA 3JXOA 4ZVPB 1FKOB 1UTAA 5AXLA 2P9KB 5LJWA 1VQLS 4BLGA 2HVIA 3DLEB 2EFVA 3PVXA 4C11A 4NLBA 1DQAA 2EX3A 1KNZA 2DR9A 4ZIWA 3D6FB 3WXJA 5AJ3F 2YHXA 3F0NA 3OW2M 3C3LA 3LANA 3IG1B 3BB5A 4ELUA 1N48A 3CI5A 1REGX 3QGGA 1VBXA 2VJUA 3G86A 3B4DA 4KHPK 2N3LA 3F9MA 3IKMA 5E33A 2XSJB 1FESA 4A8OA 1HQEB 3KJNB 5A6WA 3CJ3A 2EFOA 3NGSA 4DX8H 2IPOB 4MH8A 4I6AA 2OHDA 3NS7B 3L2QA 4J2AA 3T69A 5BRDA 2A3JA 4G65A 1BQMB 4GC7A 4DR7F 3CCUN 2IVOA 4C6AA 3CM5A 4E8UA 5HK4A 2HBZB 3KD1E 3OTOJ 4Y1DA 1KQKA 4NXMJ 1NGIA 3EGWB 3LPUA 2XMKA 1TELA 3HK2A 2C2ZB 3N6MA 4WKRA 4DSFA 1JLFB 1TL5A 5B0AA 3O08A 3BKTA 3BSAA 3OR1A 3K2PA 2KT3A 4C8YA 2C2OB 3K2YA 1TL7B 3OHAA 4HHTA 2B8PA 1RDRA 4LF9K 1U0HB 3SCIE 1RDBA 4DJBA 1DJ0A 3O9TA 1YWXA 2QWNA 2GA7A 1GOAA 1RYRA 4GO5X 5FIIA 4FLTA 4DLGA 4FJLA 4M41A 1SV5A 4IKAA 4P9SA 4EGLA 1T95A 4OZ2A 4QWAA 3W9HA 4RBVA 1RKIA 1KQSM 2V4QA 4FM0A 3ZZRA 5DMRA 2ZHAA 1X7VA 3CMEN 5J1EA 2M8DB 4AUKA 3C6UA 4B08A 1REVB 2MJUA 4OHXA 4CZKA 4WYLA 1NU0A 4HVZA 5DZ6A 5IS2A 1WEZA 1W2IA 4KTWA 3H4DA 2VKRA 3DRYA 4URQU 1KAYA 3HHEA 3WQTA 1GXTA 2IM2A 4LF4J 2O8FA 4KGZB 3MOJB 9RUBA 1O8BA 4FJNA 2BQUA 2LP4A 1NOZA 1QSLA 4U6PA 3F2KA 3JAMY 1X5PA 2V52B 2QA4S 2W4PA 4AL5A 3FC9A 1ATRA 3HPHA 4C48A 3OHRA 3TSQA 3B54A 2ZKTA 3O4NA 5M1OA 4QR2A 2EFPA 3BYRA 3CD5A 4Q45A 4HH1A 4OJHA 1RHRB 5IZHA 4RUAA 3NMRA 4OYBA 4LRDA 2I9SA 3EX7B 4BG8A 2BANB 1SVDA 5AQLA 3DLKA 3SQ4A 1T03A 3LF0A 2AA4A 3TWHA 5GADU 3M8YA 3D0IE 3KLHB 3ID6A 3QPIA 3H1QA 2Z30B 3C6HA 2D74B 1FJGK 4ZA1A 1U0SA 5A8KB 3J7YI 3X3UA 1RACB 2R2RA 4MLEA 2XULA 4JP8A 1TYQA 2O8DA 3OYNA 1RI7A 5BR9A 1O51A 3VA3A 3M8SA 3DN9A 2A1SA 1S1VA 2JLFA 4JKFA 3GE9A 4CCHA 2RB7A 2K3KA 2X74A 1N6QB 2P9IB 2HFOA 5GVQA 2DNQA 5ETNA 5M1QA 3WDOA 3O9SA 3C65A 3VQ7A 2B43A 2E2PA 4CLLA 4L3NA 2UV8G 1HBNA 1K8KA 3U4LA 4NYPA 5A2QO 3TJ9A 3CDUA 2YWEA 4L76A 4U8YA 1TAUA 4FWRA 3LZJA 1GEHA 4WK3A 2IRUA 2DRBA 1RAOA 4Y2IA 5KQ8A 3PYGA 3ZX0A 1RUSA 1CLQA 4QBUA 3R5JB 3J7ZT 3MDQA 4IG3A 1HYSA 1RT6B 3CQYA 1NKBA 4RNNA 3MPVA 4FJXA 4DV2F 1HBMA 4DU4A 1ZC6A 2EHGA 3UW1A 1B9FA 3QERA 3VESA 2ROEA 1S79A 3VQPA 2G0CA 4JKCA 3CQXA 5GAHI 2I7NA 5F2RA 2FHOB 2WCXA 2MDAA 2BA9A 3H5UA 2N3OA 3MUVP 3IM9A 3TO8A 4BR0A 4XO0A 3K8WA 3PEJA 1JB0C 3LPYA 2BRLA 3AVGA 4XH5A 4DU1A 3T1AA 3H20A 2P6SA 4LSNB 2DR5A 5HO4A 3HL8A 2QYGA 2R7VA 4PWDA 5DJBA 3VQAA 4JI7K 4DSIA 2APOA 2ASDA 4B3SF 1WTBA 3G10A 2OTJN 2PMHA 2JEGA 2B9YA 1ZOTA 2VIHA 2G8KA 3OL8A 4PHTX 2WK4A 1ZZFA 4ECVA 1JQGA 4CZEA 1YHQS 4Y34A 2PA8D 5LMUK 1OH5A 3CMAN 2DNKA 4AE5A 4JI2J 2W1BA 4H0TB 3V4MA 4DG1A 1FRIA 4LR8A 3OYMA 1RADB 1VK0A 4FM2A 4OX9J 1XMQJ 3THXB 4ZMMA 2B0GA 3MCPA 4BC5A 3FMBA 4AHCA 3KJVA 4JD2A 2DFHA 5CZVA 3TQEA 3AH6A 4CJQA 2HNDB 1J9AA 4FLUA 2E4LA 1N5TA 2Q36A 4DFPA 4ICLB 5GADP 3BQ0A 2KZMA 4CNYA 3M30B 3O3HA 2MY7A 1TR0A 3GCXP 3IA0A 4OPHA 4YY3K 1Q86T 3FZBA 3H08A 1SCJB 4ZLJA 3AVKA 3P8BB 2FJAB 3J7Z5 3NG8A 2ASPA 5T7LA 2YV0X 1V6HA 1I6JA 2ZM6F 4TLQA 5HVHA 4EFHA 1K47A 1RISA 1VFJA 4ANEA 4FJHA 2W9AA 2NS1B 3MAAB 4TU9A 4JI5F 2DGUA 4MIWA 1TMJA 2RDIA 5FD1A 2O01C 4DF8A 3GR0A 1T0TV 4BY9C 2FC8A 4OYIA 4C1NK 3L8BA 2RRNA 5CH7B 3ADAC 3RW7A 1RBSA 3NE6A 2NQPA 2IA0A 2FHJD 4NI2B 1HD1A 2YHWA 3LAMA 3CC4S 2MKCA 5LXYA 3FBEA 3HHLB 4ZLPA 3AGKA 3PR5B 4CJRA 4J9NA 5DM6Q 1RTJB 1EQYA 4IFVB 3M32B 4ZVQB 1N34J 5AFUA 2FBXA 2H51B 4B3OA 3W0LA 4F7VA 2GJIA 2QE5A 3UKUB 2FVCA 3WQUA 1F9HA 3WC0A 1KFDA 3QRRA 4KPYA 1WSEA 1AUDA 1VQ9N 1VQMN 3TAFA 4O3RA 2YKQA 1FXLA 4ILGB 4I67A 2E66A 1B0PA 2BOPA 4PL8A 2DKOB 3DRRB 1OY9A 1TAQA 3SQOP 2M9KA 3VGMA 5KFUA 2NSBA 3PX6A 1SKRA 3NEKA 1QE1A 3I31A 4A5BA 4I6YA 3L2VA 3T1YJ 2MZ1A 1FNMA 3J80Y 3G6ES 3WBZA 2HHXA 4IEIA 4M63A 1K1SA 2HURA 2CPFA 3FDSA 3FGUA 2LXFA 1RGIA 3C7NB 4BGBA 3WNEA 1EWRA 4ECZA 4J2DA 4AQYJ 3JXUA 1BU6O 2KM8C 3CULA 1XBWA 2N7CA 2VWKA 1S72S 1KONA 3FZKA 3NDKA 1NK8A 3EZ5A 2CZVC 4F4XA 3DXBA 3JSBA 2ZJRQ 1ZM3A 5FRMA 1FTRA 5DG7A 5HQMA 5HMYA 3HPGA 2VFRA 1HARA 1JK9B 1DFDA 2KQ2A 5A2QY 2KJWA 3PNIA 1CJVA 2MLXA 3CCJS 3D1HA 4DS4A 4DSJA 2VJVA 3ZETB 2HZVA 3OJSA 3OS1A 3GLJA 3SPYA 3MECB 3EPGA 5AQNA 4IFYB 4ZS6A 1VK8A 1F5CA 2NXJA 3EEQA 4EWTA 1I39A 3M6UA 2K7KA 3EE3A 4B3RK 1KEKA 3A8KA 1JLGB 2DK2A 2HIYA 2Q6BA 2PFUA 1VBKA 2CQHA 3KLEA 2W2QP 5LSOA 2ZH2A 3KLGA 1VQLN 4K5RA 3RRKA 2FF3B 4IRCA 2WSCC 5K5MA 1S1UA 4YDDB 5C2FA 4PG6A 4WXWA 1RHMB 1JLBA 4NLQA 4X64F 3VAHA 2YHBA 1VSFA 2JVRA 3GSIA 2B4OA 1H72C 4CBWA 5C12A 3P4UB 3C6AA 2R8HA 3CXCM 1GAOA 2LQ9A 2V8HA 1S9GA 4F25A 2FQQB 4MK9A 2WUSA 4I6MA 2CPXA 4OZJA 2F8HA 4ZCIA 1QHAA 1YJWS 2V8DA 2WVCA 2NRVA 4LFAF 2NREA 2R2SA 3QT7A 3NWGA 1IKVB 2H1YA 1CEZA 1AFIA 1VHXA 4LMZA 5KT5A 4USJC 3EO3A 1Q81O 1M90T 2HHVA 4EAHD 1KKHA 3AA5X 3OYCA 1E6VA 2LCWA 4ZP6A 2VG5A 3GIIA 3R5AA 4ES2A 3DDNA 4GVLA 3PHEA 4JBCA 4WPAA 5J2MB 1WG1A 4B1UB 1UVKA 5LMNF 1FWPA 4E1MA 4X62K 5LJVA 3ZSYA 3PCOB 2ZJPL 2BRKA 3HF5A 2E7VA 3W3SA 5IC4B 3BZKA 5EHHA 5G0RA 1SUQB 1RHQB 2B9WA 2NLXA 3AY0A 4CO1A 3BSOA 1JCGA 2FJEB 5LJ3Y 2FXUA 2I5JB 2F4VJ 3MD1A 4TU7A 3FZHA 3O6WA 3DMJA 2R7SA 2HLTA 4F02A 4ZP7A 4U7UD 4QS8A 3GMGA 1TQLA 1IKWA 4B9MA 2HK3A 5CR4A 1D8ZA 2EBEA 4Z2XA 1OQ6A 4ZIVA 4DFJA 1IG8A 4EO8A 1FNOA 2J0XA 4DR6J 4CK1A 2GUPA 3CCEN 1TV6A 4CHOA 1NDPA 2IM0A 2RU3A 4HDGA 4UOGA 4DV7F 2QA4N 2E6LA 3RMBA 1OSCA 4JI0F 2MZQA 4K0KK 2DPJA 4QIEA 4YR3A 1WN7A 2CWKA 2Q3PA 2LLZA 2GGPA 3AA2A 3JTPA 1WBBA 3O6QA 3ENVA 2WZ1A 3EPIA 3TAPA 3N6LA 2RKIB 4H5VA 4WQ5A 5KT3A 3AB2B 1XMOJ 2VWJA 4U67L 4PYAA 1ESVA 2F1FA 2PT0A 1BISA 2B6AB 4ALZA 3AA9A 4E7JA 3VHQA 4CBXA 1LNQA 3W60A 1J54A 1RAFB 3KK3B 2VV5A 3AO1A 2YWGA 1UWAA 4XAKA 4O3NA 4FLVA 1NZ8A 3G8TA 5D0HA 2UU9J 4O44A 3FKBA 2DH8A 2Z2MA 4ZVUB 4CGHA 4EIAA 4KREA 4AL7A 2JRSA 1T94A 3CERA 1K8AO 4DR7K 4NXNJ 1SL0A 3QNOA 3CF5Q 2CXEA 5BR8F 1W2BR 1TP7A 4F0HA 1U24A 2CGKA 2PYLA 2JC0A 4UOHA 3K0JA 1Q78A 2XEXA 4FBUA 4KPCA 3A0IX 2QT7A 4ED5A 5ADZA 1XC3A 3OYEA 2R7TA 1Q5VA 1YX2A 4LH4A 2MJNA 2HFNA 4KAZA 4Y28C 2ZWOA 2D1KA 4MK8A 3N5BA 4QU7A 2Z1GA 4DXLA 4YOUA 4A8XA 1LK7A 2CVEA 5B8HA 3B78A 4CGJA 3K5OA 3HO1A 4O5BA 3AQOA 5BPLA 2ZOGA 5JS2A 4QS9A 4MFBA 1UPPA 2HQ3A 1C1CB 3AO5A 5DO2A 1RT4A 2CQCA 1UP1A 3OTOK 2YY3A 1LAVA 5CABA 3U9ZA 3VGSA 1TK5A 2B7CB 2ADBA 3HBTA 3EGNA 4IOAQ 2HHPA 3WIUA 4JEPA 3U6FA 1U2CA 2PFFB 1G7CB 3VGLA 4JHDA 5FPDA 1YJVA 3AHPA 4ZPCA 4FLXA 4NA1A 4ZVSB 4P71A 3SQGA 3ZTPA 5HMXA 3SUPA 4RO0A 4DV4J 4CI0B 2B51A 4JI1K 3QINA 1H2VZ 4CECA 5CYQB 2DNLA 6FD1A 1BE4A 5CZXA 2C42A 1FRXA 1BWVA 4DHVA 2DRDA 1LW0B 3MEGB 1L3KA 5H1SQ 2CJBA 2YQ0A 4ZPVR 3S3OA 4P10A 4CLPA 2XWYA 1U1KA 4KAIA 3D0GE 4OL8A 3D67A 1OH7A 4F26A 3LWMA 2MZJA 2NRWA 4FZXC 1ATNA 2QN6B 1YHQN 4ECYA 1H2UX 3VPZA 4KHQA 2ILYA 3BV8A 2FLPA 3R1HA 2YWKA 5HVFA 1J6ZA 3L7UA 1U2RA 4NEZA 1MDUB 3MM8A 2IVFB 3OFHA 1RZMA 2XCAA 3RB3A 1EZZB 1NGHA 2BE7D 4C11B 3IGVA 1PBUA 4B9SA 1Y11A 2Q0RA 1YKWA 2A6OA 1RWMB 3ENAA 4RBUA 1NWKA 2AEMA 2ZF5O 2AJ0A 3UD4P 3HTVA 3KJQB 3T5KA 4HH0A 4PZVA 3HVRA 3M6GA 2QWQA 5AJ3J 4KR0B 4CDIA 4Y0WA 1N56A 4FZZA 2OPQA 1CJTA 3CDBA 4QWEA 1CZBA 2VPZB 1CVJA 3V9ZA 2UXBF 4R79A 2VL1A 4NA2A 2MQLA 2NPIA 4KE5A 3H3NO 1HKGA 3FZ2A 3TVKA 3JSMA 1LOUA 2AW0A 2YPYA 4CO0A 3Q8QB 1RTHA 1RWWB 1QLNA 4TY8A 1RILA 4ECQA 2AYBA 4K4WA 4YB7A 1ZH5A 3EY1A 4I9QA 3POTA 1T44A 4MIAA 3CC4N 5B0EA 1UOCA 4FK2A 5L46A 4DN0A 3S41A 4P2MA 2G2OA 4DUYJ 2IDEA 3MM7B 2RDDA 1GTEA 2JEIA 3NOCA 2XZDB 3OR1B 5CY4A 4C8NA 3DU6A 1TMMA 3THYA 3UCUP 4FJ9A 1S6OA 3H2VE 2Z1JA 1NMDA 3Q8VA 2BKOA 5M1PA 1BC6A 1RYSA 2YHAA 5AQFA 3LP2A 1RLCL 4PQAA 4DUZF 4C0OC 4ED0A 2QGFB 1VSJA 3GFZA 4M42A 1SV5B 4OKEA 2CYYA 2E1RA 1T05A 2DEJA 2YTCA 4JLHA 4QPXA 3P83D 2HVZA 3MAHA 1NGGA 4IO8A 1W2BM 3A3PB 3SAHA 1HBOA 3BGFA 2X6NA 1Y97A 4M95A 5HOOA 4YOVA 1R0AA 4FWLA 1AB8A 1PO6A 4FF2A 4C7QA 4FXVA 5J1EB 1RWPB 4X4QA 1DEJA 4E7HA 3C14A 3PKMA 5AQYA 4K59A 2A2DA 2E9RX 4CEDA 4N76A 2GZOA 4F04B 3P49B 4J9OA 1DZ5A 2O8FB 1Y3JA 1NJZA 1DHMA 4CLFA 2W40A 3N0VA 4ED7A 1NKCA 3PX0A 3DLGB 5HATA 2J6TA 1HLWA 3P5TL 3CO0P 4YHHF 1S7HA 1O0PA 3IWNC 3CCJN 3PYEA 1D09B 2WAQD 1M1KO 2R4FA 3VTHA 2IDOA 2RS2A 2CPYA 3QNWB 1TK8A 4P2SA 1J2VA 3QGHA 4ZJLA 3VQ4A 2I38A 4DFKA 3NF6A 4YOYA 3AA4A 3T41A 4M5HA 1NG9A 2BYCA 4I56A 3IWXA 2VQFF 4PPDA 4E7LA 4AHTA 3W8PA 3EKSA 5KG0A 4XIUA 1FJCA 3MXJA 1S6QA 1T03B 2M0GB 1U04A 3NVMA 3DXSX 3W3DA 1MWMA 2RQKA 2DR6A 2ZH7A 5DGAA 1XMQK 2WBRA 3FRYA 3LDSA 1QAJA 1NGCA 5KFSA 2O8DB 4Z37A 3DRSA 3OYLA 2K7JA 1S1VB 1XR5A 4DEZA 4WFXA 2KXNB 2QKKA 1GXLA 2JEJA 5D4PA 1GOCA 3TOQA 3JTOA 1EHWA 4WZMA 1T8EA 2HQGA 2ZBRA 4OZNA 3SV4A 3ZSOA 1RT2A 1YJWN 1F6TA 1RA7A 1K8KB 2E5JA 3ID8A 5ETOA 4G1PA 4MKBA 1F9FA 5DM7Q 3EGZA 2VD3A 2QYCA 1IJJA 1TL4A 2ZNYA 5HL7Q 4JV2A 1KVIA 4IG3B 5I3UA 3NGIA 1HYSB 5L1JA 4B1XB 2UUCF 4HUFA 1LV5A 4J91A 2EC2A 4YNQA 5KG2A 1YQHA 1M0SA 3E8OA 1RU2A 3SCXA 3HHKA 3E9PA 1GLLO 4CZFA 1N34K 3KLIA 4LD0A 2GELA 1U2FA 3MR6A 1X5TA 3D6RA 3HT0A 2MKKA 3MEKA 4L74A 4CVNE 3AOCA 2BJDA 4DL2A 3RW6A 2Y3YA 3CHWA 3W2VB 4Y0FA 3EE9A 4QPTA 3L2UA 3ULHA 4I2QA 3WXLA 5AQVA 4PWDB 2W2PP 1FF2A 2W8KA 2HBQB 2AJ4A 4CRJA 4ZHRA 2V4RA 1RP5A 5J2QA 1YJNN 2D41A 4LF5F 4BRFA 2NRXA 3I82A 4EBDA 3WNGA 1UAXA 2UZAA 3T1YK 4ETXA 4NLRA 4CLZA 4LBIA 3MN5A 4RW6A 2GMJA 3NCPA 4K4YA 2LYVA 1I5OB 1M5HA 3DLBA 4H0VB 4CQ1A 4DG1B 4LJMA 1F9EB 5DLFA 5AE1A 1YUWA 2UUAF 4KHWA 4TY9A 1N0VC 4AQYK 1ASVA 2B4UA 3ZZ0A 4CIOA 3KJVB 3GB0A 4JD2B 2XNQA 4GNIA 5FLXU 3NAIA 1S22A 4DV5K 1YRUA 1HX1A 2MHEA 2WW4A 3BO3A 3WC2A 3SPZA 1CULA 4KBOA 5EGYA 2XG8A 5CA5A 1DAXA 1QQNA 2WOMA 3LO3A 5DZ7A 2L3MA 3MMVA 3IR5B 4MK7A 2E1YA 1U1QA 4X64K 4J2EA 3HSCA 5T7LB 3M5RA 3MMAA 3PEHA 1S0NA 3M6XA 1R6VA 4O5FA 1TUYA 3FK4A 2FVRA 2GIFA 1U8WA 4CE9A 5K8MA 3K9KA 1BUPA 3I4HX 1T6CA 3ZSVA 5C7PA 4TLRA 1S4FA 3EDRB 2PY5A 5D4NA 1T9YA 1ZBTA 1HNWJ 3VALA 3LP3A 3CWJA 1CS4A 4QIFA 1CBKA 4DQ8A 3ZZPA 2AJ1A 5CHIA 1BDGA 2H65B 2PO4A 1IBMJ 4DOZA 1X9WA 1D4XA 1H7XA 1NO8A 1N32J 3M8QA 1UJ4A 4JKDA 3MMBB 2CDRB 4Y6IA 3SFUA 4N5SA 1NB2A 1T6DA 4B3OB 5I4MA 4E0DA 4O0IA 3BGOP 5HP1A 2WB1D 1VR6A 5BXIA 1T9TA 3E01A 1CG2A 1MROA 1U45A 3OPKA 4C2MA 1HA1A 2V6AA 1OPIA 3KK7A 4CEAA 3VZHA 1YVUA 3TA2A 1KD1T 1DURA 1DQ9A 3GG0A 1QZ5A 4ECTA 4ZDNA 4DZ6A 1LXNA 1WD6A 3J81U 3VAGA 4PXEA 2A2CA 1DTQA 1BA0A 4PKGA 3ILOA 3J81j 4CLYA 5KPZA 2ZUAA 4FJGA 5EN1A 4JKEA 2BJ9A 4LF6F 4DR5F 3SDEA 3WXKA 4K43A 4RJVA 2E5LJ 5KFWA 3EJMA 3ZEUA 2J9CA 1RT3A 4LVOP 2XY8A 1XTZA 5LL6d 1T3OA 1DT9A 1J53A 1NU4A 4BQZA 2DNMA 3R8EA 2DGTA 2HHWA 5GINA 3SSSA 1T7PA 3CEDA 1XR7A 2OFGX 4F4ZA 2ZBQA 4IO9L 1WOPA 1R89A 2HIQA 2LVWA 4QCLA 2L41A 4ED4A 1CJVB 1RQ0A 1JXLA 1FO1A 4C0HA 5KPRA 4JS4A 3IMQJ 4BRNA 3TTFA 3QWPA 4BE0A 2JH3A 1SIWB 4X66J 4USVA 3J7YP 5B08A 4NO7A 1Q1KA 2UXCF 7FD1A 4OQJA 2YH0A 3FSYA 4NLWA 4IOCQ 5KG6A 1VLOA 3C0BA 5KFOA 2ZD1A 5FJ4A 2YHYA 3I87A 1F0XA 3VENA 4EZ6A 3OJUA 2NR0A 3KLEB 3VCDA 4H5NA 1S6UA 5T41A 3PYFA 4OPKA 5KOWA 2CG4A 4WIIA 2QWPA 3KLGB 4NOHA 3AO3A 1HWUA 4Z4FA 1S1UB 2OZSA 1JLBB 2IIRA 2A6MA 4DR6K 4B3MF 2HHHJ 1M5PC 1F3VA 2POKA 3HM9A 2ZGZA 2YWHA 1ATSA 3OVBA 2NRTA 3G25A 4YQWA 2XQCA 1CC8A 5GAGI 2ZDPA 3KWIA 3JTNA 3HZEA 3AVMA 1UWBA 4F4YA 4DPOA 3K5LA 4AF1A 1S9GB 4I6MB 3TEHB 4PCQA 4CZCA 1TKXA 3P6YC 2VWBA 3CCQS 3HI0A 1SXLA 4JI8F 5F9LA 5GAHP 1XMOK 4NCGA 2KVQE 5K8PA 3UKRA 4DR3F 4KI4A 2M2BA 1EIYB 1TZ0A 3TWZA 1E6YB 1YI2S 1MN9A 4LFAJ 1LFPA 3Q24A 4O3QA 2UU9K 2Q1NA 3RB6A 2R7UA 1VDHA 2GVDA 5KGWA 3AQPA 5E0OA 5KFNA 1D5AA 2P9SA 3GJQB 2C3UA 4DPUA 4B3TF 1N33J 3VAJA 2UUTA 2FVPA 1E6VB 4CHNA 3OBWA 2O8CA 2P5OA 3SXLA 4CK3A 3O44A 2IFXA 3QT6A 4A8MP 3PTWA 1FKOA 2P9KA 3ZNUA 2LA6A 3U3GA 4OZLA 4DV1F 1XEZA 2MZRA 4GV6A 5BPNA 3DDIA 5EOYA 3V1RA 5G0RB 5LMNJ 4DQSA 4JK7A 4GVMA 1EO1A 1QZ6A 1FE4A 3GYXB 2W41A 2VU5A 4RTFD 1Q82O 3QEWA 4Q43A 2KHDA 2VF3A 3HJFA 1RHKB 1DLOB 2F5GA 2KXHA 1B70B 2HS3A 3T1HJ 3Q7CA 4DR2J 1ILYA 4CF2A 2ZFHA 2EFQA 2C28A 1HJRA 3MMJA 2XSJA 5C0YA 1LWEA 2HMIA 3CDEA 1HQEA 4BG9A 4OJRA 2M4MA 3DI6A 2L48A 3GG1A 3BGLA 3F56A 1IKWB 3NF9A 3B82A 4FOIA 2DTJA 4LRAA 4LIWA 3EL2A 4KSEB 1S7IA 3MPYA 2DHGA 3EZOA 4ZVGA 4DI6A 1TV6B 3LUYA 2ZDOA 4DV4K 5D8HB 2ZBPA 1PCAA 2IBKA 2ZZNA 1XK8A 1WNEA 2FTRA 2GQQA 5JLHA 2OIHA 4CZHA 2D3UA 1J5EJ 2H48B 2GGPB 3RTVA 4IH6A 4DV7J 5D4OA 1ZXOA 5HJYA 1S3XA 4MLHA 1KFSA 4JI0J 3JQKA 5AE3A 1X4DA 3OTDA 2VZ9A 2IVNA 2MYFA 5ITHA 3L7PA 3D1OA 3BKUA 4GKKF 3AXMA 4LFBJ 2QWRA 4OI6A 2P9NA 4ZPAA 2OCEA 2GC8A 4MKYA 4J9RA 1LWXA 1HL6A 5KOXA 4O44B 3LAKA 1JKHB 3RGIA 4NMXA 3H1VX 5IT9O 2A3ZA 5AQOA 1X60A 5F41A 1VQYA 1Q4RA 2DCUB 2XHWA 1REVA 4EP5A 4M7XA 3VAKA 3CG7A 3TAEA 1AZSB 2DNOA 1L5UA 4CJEA 3MCOA 3N4PA 3ZT1A 3L4BC 3CIMA 3OR2B 2G4BA 1C1BA 1ZBFA 3A5MC 1FFSB 3G71S 5E26A 2KRRA 2L08A 3L3VA 3S8SA 2HSEB 4I6WA 3TZWA 4ZKAA 2P9PA 4IDHA 2IVYA 5EX5A 2R7YA 5EU7A 4CHZA 3AXKA 5H1SV 4IO1A 2DISA 1KN6A 2LXIA 2R7WA 4MFBB 3SMPA 2LMIA 1RT4B 5FROA 2D5RA 5IWAF 2W6LA 2HHTA 1UCNA 5B0BA 1NSAA 2IS3A 1NK7A 2OPPB 2X3GA 4H4OA 2FZCB 4WF9L 2JNJA 2XMTA 3O3FA 4DUYK 5KRTA 4JHDB 1XHZA 4HWIA 4PG5A 3H46O 5T7BA 1NBWA 3SQGB 5JICA 4F4WA 2KU7A 2W9CA 1C0UA 3QO9A 2UVVA 2KFNA 2DNPA 3HOTA 1RDCA 2XS2A 2RILA 3TNVA 4AHSA 4M5KA 4Z7YA 2HZAA 4KHPF 5A8KA 1HHQA 5B09A 1C4CA 3RR7A 2XS5A 4MDBA 2XBPA 1NK5A 4WE1A 2MKSA 4PABA 3AY9A 4K4VA 4HCBA 1WG5A 2OD6A 4IQMA 4UZBA 2LDIA 4A8FA 3GIJA 2EBGA 1TVRA 2JX2A 4U67Q 1N6QA 1SJQA 4QIVA 3MWBA 2Q97A 1X3NA 3PX4A 3HHDA 2O1PA 4NZ7A 2F96A 3TABA 1NGJA 4V19X 2HFSA 1WTFA 1MWZA 1FEEA 2BGGA 1NGBA 2CQIA 4B1YB 2VQFK 2RVJA 1CXQA 1DGKN 4KGXB 1YG0A 4ZCMA 2KKHA 1YK9A 3IAS9 4OI4A 2DY1A 3OL9A 1RAHB 3G6XA 3OFEA 3KJFB 3G8QA 3R5BA 3QIOA 2KFZA 3KWMA 1FDAA 3OFFA 3HSJA 4KKOA 5AQMA 4LFCJ 4XH4A 3HVTA 3MI7X 2ZBCA 2ASOA 3TUZC 1NUEA 3L3CA 3AVIA 4TYBA 1EKEA 2C2EA 5IT4A 4NLTA 3MDFA 3OFGA 3ZZYA 4AL6A 2OPQB 1CJTB 3RR8A 3IDHA 5DDRC 4ID5A 2LQ5A 5DQIA 1JMTA 3JSMB 3TUIC 9ATCB 3D68A 2G9OA 2B4JA 1RTHB 4H4KC 1ZA1B 3N79A 1VCTA 2CQ3A 1HHTP 1YGYA 3FMWA 4TY8B 1ZBLA 3ETOA 4OKJA 2OLWA 3POTB 3T5LA 2BKPA 3AB4B 4CHPA 4KRFA 4Q7AA 1W7WA 4HTIA 3O2IA 3VAIA 2F63A 3AJ2A 4CD1A 1S97A 1UETA 1IJFB 4BQLA 4QR1A 1KRPA 4CP5A 3MM6B 1WLJA 2XLJA 5CXTA 4L72B 3I8DA 3THYB 2W42A 2KVIA 2W25A 2G0JA 5JMVA 4PXCA 2DITA 4ILLA 1RHJB 2OAUA 1MMDA 3THXA 3VF4A 2VBYA 3UNYA 3H7HB 3WXMB 3LP2B 5DDOC 2B9XA 4QS7A 2QXFA 1JLEA 3V6KA 5B0DA 2YI1A 1T9XA 1U26A 1QTNB 2LEBA 1JIHA 3SBMA 3VR1A 4CFCA 4Q0BA 4OHYA 2NNWA 4ICLA 3DGVA 2AEJA 1T05B 3PJWA 3HHLC 4JI3J 4PWWA 2PI5A 2YCHA 3CUNA 1EQ0A 3DOLA 4BRLA 4DU8A 1HBOB 1Q8IA 4WZQA 3KZBA 1FDBA 2R9LA 3W7BA 4YOWA 1R0AB 1RWXB 3NFAA 5IT9Y 1OPZA 2E9ZA 3ZT4A 4OLPA 2W7OA 4K4UA 3C14B 1VK3A 5HMZA 4ERDA 4LF5K 3MAAA 2F8TA 1GOBA 3BF1A 4QYZK 4A61A 1AT1B 5F9NA 1FJGF 4UQTA 2IRXA 1JL2A 2QM1A 4TN2A 4NI2A 4B9UA 1D1UA 5HJXA 2IC3A 3TARA 2Z56B 3ITHA 1HWJA 2LU1A 2C1EB 1U1RA 4JV5J 1HNXJ 2VQEJ 4KQZA 5I42A 1JLQB 1M1HA 3L0QA 1V3ZA 3VEVA 3VOVA 4HCCA 3OA9A 5JUMA 4Z4IA 2BACA 4HHUA 3NF7A 1ELOA 4H5RA 1PYOB 2X51A 2IHR1 4LY7A 3UKUA 5GIOA 3V9XA 5KFYA 2VOPA 3QIPA 3SMZA 4WYWA 4AD6A 3AVJA 4CZJA 4X4VA 4I69A 2XMUA 1HI8A 3GE1A 1H7WA 4DR1F 3D3CJ 3H98A 3ULDA 3BO4A 3WZ0A 5K20B 4CO2A 2GCFA 4QYRA 1S6QB 1FRJA 5AXNA 3O9UA 1JLAA 2JLGA 3I4PA 4CZIA 3SV3A 3H45C 3NNAA 1ZA2B 1ROFA 5E3RA 2WONA 1I94K 4RU9A 3FZLA 3VERA 3PDNA 2ZVSA 2J5AA 2JWLA 1FTCA 2D4WA 4ZJQA 4J8FA 3O1LA 1S12A 2FIUA 1WKKA 2BJ1A 3ZXWA 5M2PA 1Y0HA 4JK8A 3A4TA 3DRSB 1HPZB 4ZVHA 3C7NA 3ATVA 1Y9OA 4YDUC 2HFVA 2DFEA 2AP1A 2Q1LA 2IMOA 2O8EA 1DY3A 4JI7F 2HNYA 2FLNA 3CCQN 5FRNA 1RT2B 3K5NA 2RS8A 4ID1A 3BDEA 3CCWA 2C2NA 4WCEL 2UV8A 1LOTB 3CJBA 3RU0A 3CCMS 6AT1B 3ATUA 3ULEA 3LL3A 4KY3A 1TGOA 4Y00A 4TQRA 1SJ4P 3IBFB 4DR4J 5CCMA 5TKWA 5LMUF 4J9KA 1OKJA 2RRAA 1YI2N 1CQNA 5F0WA 2RHSB 1HNWK 1G2EA 5I3UB 2L9DA 1Y3KA 3ISNC 2Z1IA 1N5SA 3SQ1A 2R7QA 4BRGA 5IXUA 1IBMK 1JXEA 1WHVA 5THWA 3VWSA 4RPFA 1N32K 3NKYA 2JSXA 3LPTA 3V9SA 3KLIB 1UZDA 4F3QA 1RHUB 2PMZD 3KD5E 4CJPA 3D6HB 2COLA 2RT3A 1RU1A 3NH0A 4ZPBA 1RCOB 3CJSA 3WUHA 3KLVA 3EZUA 3A3NB 3MFIA 2W01A 3MX2A 2XNRA 4E1NA 2OTLN 4ES3A 3LZIA 4BE1A 1N5QA 3HLUA 3ICLA 4J9VA 1MSWD 2P51A 5J1NA 1F60B 1RCHA 4ZHRB 2G1HA 5J2QB 1WAFA 3AVCA 3IR6B 1HR0F 5CD4H 2GW8A 4KFBA 3LA0A 2F9TA 3KG1A 1HQ2A 5HBMA 1I51B 4RW6B 5BRFA 1VQ8S 1YF5L 1DKGD 1RWUA 4QWDA 4DHYA 2UXCK 2IRYA 1XNQJ 2F7VA 4Z4HA 4M3ZA 2VA3A 1HKAA 4FF4A 4ED2A 1UFKA 4JS5A 4BACA 4K8RA 1SS6A 4K8ZA 2ZH8A 1VYAA 2UUAJ 1WEXA 3ZX2A 4RBTA 2UXDK 5T14A 3QWUA 4DL3A 3VEOA 1NSQA 4CZMA 1Q9YA 4B3MK 4CO4A 3UR3C 3SBGA 5J2MA 4L73A 1NCLA 3BEXA 2ERRA 1GQEA 3MMAB 4X66K 4BS2A 5AZIB 3DU5A 4W5RA 3M9OB 5KFAA 4JYAF 3RBEA 3SCLE 3KK1A 4CLWA 3EICA 5ADXH 4KIAA 1BG3A 1YJTA 2PA3A 1U49A 1CS4B 2YPZA 4JI4J 4JI8K 3IAYA 1PJ7A 3ZTRA 1UVMA 3CJ9A 1AA1B 3TUJC 2DT9A 2OYQA 2E5IA 4NLOA 5AFUH 3SSQA 3M8QB 1OIAA 2UP1A 4CEFA 1O13A 2HHHK 2MEWA 2OGUA 2CNOB 3NAEA 3O80A 4KHSA 2BBEA 2OEJA 4IOAL 2ZHOA 5HP1B 1T9UA 1S77D 3E01B 1MROB 1ZBHA 3G71N 1S0VA 4YB6A 3SZ2A 2AJFE 4ED8A 3TA1A 3BKFA 4W5TA 1GT8A 3V1QA 1FVSA 1EP4A 3QT5A 4IRKA 1A9NB 2Y0BB 4N56A 4B9VA 1DTQB 3JSRA 4B3RF 4QQBA 1DRZA 2OA8A 2MMYA 2FJWA 4C3KA 2P9CA 3EE8A 3FE1A 4RUBA 4LT6A 1TKZA 2BJEA 4IDKA 4YORA 4K8XA 5EX3A 3RMDA 1NH8A 3SI8A 2A1RA 4QOTA 1N33K 4CEQA 3ZEUB 1RT3B 4DPYA 2P5GA 4JI6F 2QFJA 5AQWA 2AGPA 4CT9A 5J2PA 2B56A 3O3GA 2AF6A 2NXCA 3OYAA 2EC0A 3SAFA 2NZCA 2VBZA 3D6TB 2ZWHA 1BY9A 1KQSR 2V2QA 1BIZA 1R27B 4IJNA 4FPIA 2HPUA 5KFLA 1E3MA 4OI3A 5HMWA 4CEZA 3VN5A 2QV6A 1WC0A 3QESA 5JJBA 2O8BA 4NLPA 2MQMA 3OBIA 2D0CA 3W8GA 2OI2A 4KH4A 4DMNA 1KVAA 4DV6J 1RDUA 5MLCQ 2BMBA 1NK4A 2HBLA 3I56S 3GG4A 4RW7A 3AT1B 2QMUB 4JRQA 1G6BA 2GJ2A 3M2UB 4DV3K 1K73O 2IYIA 5F1XA 1QVGR 1FA0A 1NDKA 1IR1A 5IQ6A 3LDPA 2EI5A 2CWXA 4C8ZA 4U7CA 3AAWB 3FUYA 2NPFA 2R2UA 1U25A 8RUCA 5BYQA 4F3TA 1DTTA 4EBEA 3IUCA 4KRWA 4CLSA 4U95A 1WHWA 1URRA 4EI2A 3AJ1A 3M8PA 4GKJK 1UFWA 4ZTFA 4X62F 4EK2A 1UZHA 2M8HA 2ZUGA 3EVMA 5EWGA 3ZT0A 2ZWPA 4USUA 2BQ3A 1UWBB 1WOOA 3QFPA 1IBKJ 2G8WA 4DF4A 4LQ9A 3NCQA 4CJ7A 3ILLA 5JVGQ 1TKXB 3C6TA 1GLFO 4DCOB 3BPSP 5DGBA 2EWHA 1VQNS 4HTJA 3T5HA 1UW4A 4NCGB 4DCHA 3UKRB 2KM8B 4LR7A 1LW0A 5D4LA 4OHWA 1VQKS 3X1LB 1L3TA 2D1CA 2MY8A 2WC9A 3J80U 4X4NA 3FR0A 4DR3J 3MM5A 3KWGA 3IM8A 2GHPA 3KUEA 3GR1A 2ACYA 1Z4UA 2GVDB 2V2KA 3MFHA 5B7WA 4E1JA 1Q5YA 3Q8YA 2P9SB 3Q83A 1Z26A 3AD7C 2A10A 2ZEJA 4BGAA 2O8CB 5D0EA 1UL3A 5A6PA 3AO2A 3DYAA 2ASYA 4ZJOA 5GIPA 1QDUB 1H1VA 4BRPA 4Z0UA 5I3QA 2VG7A 1YT3A 4B3TJ 4NLSA 1JNRB 3OXGA 1HI1A 2V9KA 2E8AA 4X65K 5ETKA 3VEZA 2EPIA 4K0KF 4M1KA 2PMWA 4JRPA 1UKUA 4IO9Q 2DR7A 2VUGA 1C1AA 1WDTA 1YRXA 2YNGA 3S3MA 2YJEA 2ATCB 2QIFA 4DTNA 1HI0P 5FLXO 2P5VA 5D0GA 2HBRB 4JKAA 1IBLF 3O9RA 3AGRA 4CLKA 4HI2A 5DG8A 2CJAA 4NB4A 5FPNA 4UY8O 3VQ9A 2J9EA 1GLBG 1FRHA 1RE1B 3I33A 5AZJA 1NHKL 2BOAA 3GOIA 5F0XA 1C4AA 2HKEA 1LWEB 2HMIB 4M45A 3VQQA 3TU5A 4ANCA 3DI6B 4KB7A 2VFTA 3MCAB 2CADA 4PA1A 4Q2MA 2E1PA 4FWPA 1XIQA 3JB9k 2J76E 4UZCA 4ETZA 5EXWA 1MMLA 3HSZA 4FYXB 3AARA 4IOBA 4NLXA 3VA0A 4AYBD 1S1TA 1R8AA 2HSTA 4H0PA 2UUBJ 5BYRA 3EGVA 2DYAA 1IQZA 2QSFA 3KMQA 4L8RB 3ZX3A 3NGZA 1BUXA 2HW3A 4YP3A 3MM7A 4C23A 4AH9A 2N7YA 4ITSA 3RAXA 1NHUA 4PKDB 1F2HA 3A8EA 3DCAA 4N47A 5GAGU 3D6MB 1YIJS 5BYSA 1V5VA 1FEHA 2QZ8A 2AHOB 4BDZA 4X4RA 3O5TB 5KG7A 4Y1CA 2N82B 2P9NB 4RL1A 2W2MP 4HYKA 3OTOF 4GKKJ 2NUBA 4O3OA 1P8ZA 4W98A 5DM7L 1HNIA 4WFBQ 4M7YA 5I3PA 2WSEC 3OTCA 4F0MA 1XUPO 1NNEA 5HL7L 2Y9HA 2CIMA 1K44A 2XB2D 2HHUA 3QDKA 4FPBA 3HFKA 2RU9A 4JI1F 3L4IA 5F8MA 2ZNZA 3G96A 1C1BB 1UPMB 2JC1A 4XEIA 3H0PA 4JKGA 1QVGM 3OUYA 2V63A 5J1PA 5C2CA 3CCES 1G4CA 1NSPA 3DLGA 1QM9A 5ETQA 1IO2A 3ENBA 2M52A 1RBOB 2GQ2A 2P9PB 3CCMN 2Z2YB 1YSJA 4HL9A 2Y1LB 1HNZJ 4WFNL 2FZGB 4Q8FA 1IH7A 2HMPA 3M8ZA 4ECSA 2RAQA 5EY4A 2RUSA 3QFWA 3PO4A 1IR0A 5E3QA 2OMOA 5E41A 2B4PA 2Y8YA 4IQXA 4H4OB 4OYMA 2GWKA 4Y2KA 3MR7A 4BREA 4A4JA 2KW4A 3U27A 3DWLA 4DTOA 3H40A 1E4FT 5JS1A 1N36K 3MF5A 4LF7K 3HHLD 2XZTB 3CYMA 3R7NB 2W9CB 1RT1A 1C0UB 5M2UA 3QO9B 3UI3A 1KLNA 5E5NA 3SYZA 3DGPA 1T3VA 4PRFA 4OI2A 3LWLA 3BSCA 3KHGA 1DBDA 2FC9A 4FVMA 1HLUA 3OYIA 1BHNA 4WE1B 4RWWA 2A0FB 1S1XA 1LWCA 2GEMA 3DNCA 2JFDA 5FPEA 4FWQA 4WK1A 4KHPJ 1S9EA 5LT5A 1TVRB 3TX8A 3I9V9 3O8WA 2QI2A 2BE2A 2DNYA 4GW6A 1T11A 5GAGP 2XHBA 3LGNA 2V8PA 1VQ8N 3J7AP 4PAAA 1LWFA 2HAFA 1LAWA 4F8RA 4CIEA 2YX4A 3T9ZA 3UVJA 4DR1K 2UVWA 2Q6CA 4NA3A 1R0BG 3NXZA 3ET6A 4AHRA 3E3XA 1TKTA 4JV0A 1WF1A 2L9WA 3UDCA 3GBTA 3OVSA 4KKOB 1N8RO 5FLXY 4JV5K 5CAAA 2VQEK 3HVTB 1S0MA 5F8LA 1B64A 4IG0A 3D7EO 2AQ4A 3BBBA 1QJHA 4TU8A 4F4KA 4LF9J 1FKAF 1WDDA 1D9AA 2XWXA 2FY8A 3KKRA 4ID5B 3S3NA 3H5YA 2W8LA 2OP5A 4MKAA 1LW2A 1XNRJ 1C0TA 4A8YA 2A5XA 2XZWA 3W2VA 2W9BA 1BQNA 2L9NA 1RAIB 4FXDA 2BEFA 1R43A 1WI8A 4OO1J 1EETA 3SFGA 3ALYA 5H9EJ 1RT5A 3KYLA 3ILJA 4U96A 4C8LA 2AGOA 4WIQA 2Z4PA 2QXLA 4CFAA 3TJ8A 4WF9Q 5HRSA 1DQ8A 3KXDA 2YKNB 3CXCR 2VODA 2ZC3A 4F4AA 2CG8A 4DTXA 2ZH1A 4GC6A 1D8YA 5DQHA 4OYWA 3I55S 1CJKA 1J27A 3RAQA 3MEDA 2J7UA 4KI6A 1JLEB 4ZK7M 1UFLA 3OVAA 3OYBA 5F8NA 2CGJA 3D28A 3T5JA 1G15A 3ISND 4Q0BB 1VJWA 2EKNA 3GONA 1U7LA 3EXCX 3LGMA 1RAJA 3MTKA 1QTMA 1UVLA 2BUNA 4UUXA 3SIPB 2V7YA 5ETLA 3DOLB 3HXMA 2HYIB 2KO1A 4ZPTR 3KHHA 3QJJA 2M3DA 4DR4K 3NBPA 4CFDA 2BX6A 2FVSA 1U1MA 2KLAA 1X4EA 2E6MA 1KBRA 4CJUA 2KT2A 2DGSA 3CCLN 1SL1A 3PV8A 2AD9A 1VS3A 4I68A 4IOCL 1FKPA 4OX9F 4A8KA 1HR0K 1XMQF 4ZPDA 5SZTA 5CQGA 1JCEA 3N28A 2J6UA 3FJ2A 3P31A 4CO5A 2XO6A 3BO2A 1RBRA 4DPTA 2IC3B 2ABYA 3ITHB 3LPEA 4EHUA 1FJGJ 4H4KA 3RBDA 5I42B 3THPA 3K58A 3UN5A 1IKXA 5HROA 3Q22A 3DRXA 2MQPA 2BV3A 5BREA 3MMBA 4IJAA 4BR5A 5D15A 4IYQA 2C3MA 4OHVA 4CJTA 4LSLA 1WC4A 4KT0C 3QIPB 2A18A 5BN9A 4F50A 1KC8O 2ATQA 1N5VA 4HHHA 1ZBSA 4ZVRB 4OLAA 4KGMA 3BZCA 3ZTOA 1NK9A 1Q53A 3J7A1 1LFWA 3I56N 1MU2A 3TR5A 3NMAA 2U1AA 4IR1A 3W65A 2NXUA 1KP6A 1IKYA 4TXSA 2Y1JA 1JLAB 4E19A 3QAEA 2P9UA 3W64A 4YB1P 4BE2A 1XNQK 3TX0A 4A5AA 2WONB 2NRRA 1RTIA 4JYAK 4WP8A 5GMEA 3GP9A 4OX8A 5F8HA 2HK2A 3V9WA 1N34F 2X1GA 4DCJB 3CT9A 2RQCA 3PO5A 5ETMA 1RAAB 2CQ1A 1QVFM 4F3MA 1NMEB 3ENQA 3V6HA 1YJ9S 3AOAA 2WSFC 1OVYA 3T3FA 2EFGA 1F3FA 2G2ZA 1MWYA 3ZSRA 4DV0J 3K17A 1H98A 2O67A 4CERA 2O8EB 5E84A 1QQMA 2ZH6A 1YTUA 4CM2A 2WTUA 2HNYB 2CUYA 4P52A 2VASA 2P9EA 5ETTA 2Z0GA 3TW0A 1VQNN 3ZYYX 2FLLA 4R25A 5BJRA 3OXLA 1Z05A 3ULEB 1URNA 1UJ6A 4JI7J 4QZVB 1OVQA 2QEXS 3T1YF 1VQKN 4U7BA 1NOYA 3CD6S 4OGEA 1PILA 3ILIA 1MW7A 5DRKA 3R6LB 2QLWA 1CC7A 3OSNA 3QRPA 2VBWA 3BH7B 1QAXA 4JI4K 2W4DA 1SPBP 2ZH5A 1FCAA 4CTAA 3PW7A 3V1OA 3CJAA 5LMUJ 4FWMA 1Y64A 4AQYF 3W9IA 2KI2A 5DQGA 2E1MC 3TA0A 2X1AA 2DCLA 1IXKA 4ER8A 3HCXA 2GAHC 3MPDA 2QL5B 4DV5F 2J8AA 4NCAA 4B9NA 1B7YB 1EX8A 3VETA 3UD3P 4OMFG 1UVJA 4P72A 3D9BA 5CE3A 4PKIA 2OSRA 2XYPB 5AQJA 4JB8B 1HJOA 2G8FA 3RUBL 4KJIA 2XY5A 1PYTA 4CIFA 4JI6K 1NSKL 1IM4A 2LQBA 4YY3J 2GHWA 2YNFA 4FS1A 3WX4A 4CD3A 3JYTA 2QWOA 3VVTA 3J7AN 3DHXA 1EKSA 4UT4A 4LBHA 1VQ6N 3CCRS 4KFBB 4CHYA 5HBMB 2D9OA 4YDUA 3K9JA 5H9FJ 1ZM4A 2J7WA 4C8OA 3OLBA 4C0BA 2K1RA 4N77A 1VC6A 4H5TA 2VONA 1E6YA 4ENOA 4DL4A 2OEMA 2PIIA 2BKNA 2M88A 3D1QA 1X3MA 4J5OA 1NM1A 3IS9A 1X0PA 5SWMA 5DDPC 1YBAA 5F8GA 2QL9B 1U6BA 2GX9A 2XTJP 5HI7A 5KI6A 3IP0A 4BRDA 3QSIA 1YIJN 1YLXA 2YBVA 3THWB 2Y8WA 4E89A 2DR8A 2IA6A 4WCEQ 4Y2AA 3O1WA 8ATCB 3OYKA 2UUWA 4B9TA 1W9HA 2C22A 1OYDA 2HLUA 4B02A 3B6BA 3IGNA 2IYGA 2QTWA 3O9QA 2AYMA 3KK1B 2DXFA 4KB1A 5HAOA 4B1WB 3A5OC 4HUEA 1X4CA 5IT0A 4J9MA 1YJNS 4LBPA 1DLOA 1I3OB 3WHIA 4TNOA 1OJ4A 4DTUA 1FD8A