3V6DA

Crystal structure of hiv-1 reverse transcriptase (rt) cross-linked with azt-terminated dna
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 147
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v6dA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v6dA05
4DTMA 3HO1A 3KK3A 1NK8A 3I0SB 4IDKA 4CJSA 4DU1A 1LAWA 2B5JA 5KFOA 3SQ4A 3M8QA 2BQ3A 2HHWA 3DMJB 5KFGA 3OS2A 1JLGB 1QE1A 4TLRA 3IRXA 4CJVA 3RB4A 4J9NA 3CO9A 1SKWA 3B6OA 1U09A 3M8PB 1S10A 1QAJA 4M3YA 3ZSOA 3AV9A 4NLDA 3QGGA 4Y1CA 2DPJA 1S6QB 3V81A 1S6PA 4IOBA 4K8ZA 2ASLA 3S3OA 4O3PA 3TAPA 4FLXA 3QLHA 4CFAA 1QSSA 3TABA 1ITGA 2JLEA 5KI6A 2YNIB 2FVPA 4DF8A 4F2SA 3DRPA 4C8LA 3VQAA 4FW2A 3H98A 4CIGA 1WNSA 1NOYA 3F9KA 4KI4A 4QWAA 1N6QA 3VQPA 1WSIA 1IKYB 3E01B 2NUBA 2YNFA 5D3GA 4M94A 1LWFB 3T5JA 4Y2CA 4J9OA 1ZETA 4DSEA 4W5OA 2X6SA 2XI2A 1CLQA 1JKHA 2W9CA 3OL9A 2A1SA 2PZSA 1SL0A 1J5OB 5J2QA 3ZSZA 3LAMA 3BREA 1C1CB 4NCGB 3FFIB 4TN2A 3KK3B 5CYMA 3OYIA 4IDKB 4NLPA 4ECZA 2HNYA 3MECB 2W7OA 4CESA 3S9HA 2B5JB 1KVAA 4H8KA 1NK0A 2JC1A 3NL0A 3ZCMA 4M3UA 3M8QB 4HUEA 1NHUA 2ZE2A 2W8KA 4E7LA 2BGGA 4CJRA 1RT5A 3IRXB 3EYZA 4FJNA 2YV0X 2OZMA 1HQEA 3DLGB 5HRPA 5DK5A 3V6DB 4MQ3A 5EWGA 3G6YA 2VA2A 4CEBA 4CJ3A 2C2DA 4BE1A 1BCOA 3OS0A 3U3YA 5KG1A 3THVA 2WRMA 1HYSB 1U48A 3RMCA 2WONA 1HARA 2D5RA 2DFHA 3C6UB 3VQSA 1BIUA 1VK0A 3AVNA 3QLHB 4FJKA 3H5SA 3BGRA 3G6VA 1S9FA 1LWEA 2O4IA 5KFVA 4IFVA 3ZT2A 2C2EA 1T8EA 1WLJA 5DG7A 3AA3A 3PW4A 5HRSA 5DGBA 3PX0A 1TKTA 2RKIB 3BQ2A 4M42A 1N6QB 2G8KA 1Q9XA 3WNHA 4QOZB 3RBEA 2YNFB 3OYEA 4M41A 5D3GB 5KG5A 4ECVA 2UUWA 1RT6A 3MEGB 5KFTA 4EO6A 3AO5A 2DPIA 3NE6A 3LALA 1S1UA 5KFSA 5EWFA 5J2QB 3DI6B 1BHLA 3GIJA 3DOLA 3M8RA 4F4ZA 4BACA 2HNYB 3DRSA 1JLCB 1NK9A 4R5PA 4K4YA 2B43A 4LQ9A 2E6MA 1N48A 4RZRA 5DGAA 4DQIA 3NMAA 4KE5A 2ZE2B 3KLGA 4JRPA 1RT5B 1TAQA 1RT4A 1SUQB 3L2VA 3SFUA 4CGIA 2G8HA 4JRQA 1HQEB 1SKSA 3AVMA 4CJTA 3V6KA 4KRFA 1BQNA 5C5JA 3SCXA 4DL2A 1JLAA 1RDRA 2X74A 4N56A 3HVAA 2KQ2A 3UPFA 3KHGA 4B3OA 2WONB 3MR6A 4LH4A 4DFKA 4NLWA 3BSCA 4FJIA 1O1WA 2FLNA 3BGRB 4EP5A 5EU7A 1NJWA 4IFVB 4OLBA 3KKSA 2KZMA 4AHRA 2ATLA 1TKTB 3CM6A 1VSEA 2YNHB 4O44A 4QPXA 3SQ0A 2JC0A 4CEZA 2FC0A 2AGQA 1XR6A 3MEEB 4TYAA 1RT6B 4B08A 4ICLA 5T7BA 4UQGA 1RT3A 2HHSA 1C0TB 2EX3A 4J9KA 3PVXA 3QGHA 1S1UB 1REVA 3OY9A 1KLMA 2IDOA 1VRTA 3DOLB 3DYAA 4DU3A 3ITHA 4DSKA 4LSLA 4ED2A 1MU2A 3PR4A 3QNOA 3HJFA 4K4XA 4J9RA 5K14A 2VG5A 4ECWA 1RT4B 3QEPA 3SPYA 4F4YA 4IFYA 4ED6A 3TAGA 4OKEA 2XWYA 4KHUA 3UR0A 3TI0A 4FBTA 3L2WA 4FLTA 2XCAA 1KHWA 1NJZA 4OKJA 1JLAB 4GW6A 2G8IA 3QETA 1JLFA 3IS9A 4ECYA 4ED7A 4K4SA 3ISNC 1UWBA 4B3OB 4N76A 4WFXA 3VQ5A 2AX1A 2IM2A 4ZP7A 4HTUA 4FXDA 3RAQA 1NKEA 1S9GB 1ZBUA 3GV5B 1Z26A 4MH8A 4DTPA 3H5YA 1NK6A 3QEXA 4CGHA 4DTSA 4FBUA 4X2BA 4H4MA 4DL3A 4O44B 4OJRA 4ED8A 3Q8SB 1VRUA 1KCFA 3HVTA 4DQRA 4ZP6A 1JLQA 3JYTA 5CZ1A 3SV3A 2BQRA 2YNGA 3LZIA 5J1EA 3OYJA 1VSJA 4HCBA 1RT3B 4IH7A 1XR7A 1BCMA 1LW0A 1JL1A 1GOCA 4KB1A 1KLMB 4NZ0A 1VRTB 3HPHA 4DTNA 3DYAB 3ITHB 4KHRA 4WE1A 4LSLB 5F8LA 3BQ0A 1MU2B 1T3NA 1SH2A 4TQSA 3SFGA 2JEJA 4DSFA 3NAEA 1S0NA 2W7PA 1CXQA 5K14B 2VG5B 1U45A 2R2SA 4MIBA 1N56A 3V9WA 3VQBA 4J9PA 2EC0A 3BJYA 4AHTA 2WB4A 3ZT1A 2D0CA 4DFPA 1XHXA 3QINA 5L1IA 1TV6A 5DLGA 1RBRA 3JSMA 1JLFB 3IS9B 4ELTA 4URGA 1UWBB 4WXWA 1RAJA 4CIEA 1S97A 1QSLA 5KFBA 3AO1A 3HKWA 2BANA 5FROA 1RA6A 3MFIA 4JV0A 3CFOA 1RILA 4NLSA 1JLBA 3PR5B 4IRDA 3B6PA 3EZ5A 4FLUA 2XC9A 4KI6A 1D5AA 4MFBA 5SZTA 3RTVA 4H4MB 2OPPA 3KD5E 2IM3A 3I5AA 2WOMA 1IM4A 4LY7A 5DQGA 4CHZA 1VRUB 1WSJA 1TKZA 2B4JA 3T5HA 4G1QA 1JLQB 3LZJA 5J1EB 4OGCA 3PHEA 5EWEA 4K8XA 4WYLA 3CFRA 4Q8EA 5CYQA 4EYIB 3UIQA 5KG4A 1TGOA 4I2PB 5L1LA 4CJWA 2KW4A 4IH6A 4HHTA 2R2RA 3TVKA 4YR3A 1QTMA 3CVKA 2Z1HA 4F4XA 5KFZA 4QW9A 1YVUA 4XIUA 1SH0A 4NLXA 4KBIA 2OPQB 2GIRA 4KAZA 4ZHRA 3U6FA 3V9XA 4J2EA 1RT1B 1Z4UA 1VSIA 4CEFA 1W0HA 1T7PA 3T5KA 1LW2A 2ASDA 1ZTWA 1XWLA 4ED1A 1G15A 3DLEA 4DL4A 2I5JA 3JSMB 3SNNA 4TY9A 2AU0A 3T19A 4QWCA 4FK2A 5F8HA 4CJUA 5F9LA 4PA1A 1UAXA 5F9NA 2B6AB 2F8SA 1JL2A 5FRMA 1BGXT 3ZSQA 2BE2B 1JLBB 5KFXA 1HJRA 3KIOA 2Y1JA 4O3NA 2VWJA 4DWIA 4NCAA 3NAIA 2YKMA 3SI6A 3GYNA 1TKDA 4LH5A 2W9BA 2WOMB 3PX6A 1NK5A 1TKZB 4J9SA 2CJQA 5KFFA 4G1QB 1RTHA 2D41A 3OYKA 3OL7A 1EETB 3IGNA 1FK9A 2VA3A 2E9ZA 3DLHA 1CXUA 4DEZA 5KG6A 3TAMA 2R8GA 3K5OA 1NNDA 2FJWA 2HWIA 4IR9A 4ZP8A 3KK1B 4B9UA 4Q8FA 1KFSA 1NKBA 1GOBA 4I7FA 3ZSVA 1KVCA 2F8EX 2HNDA 1CZBA 3I5CA 4FJXA 4ZHRB 1F21A 1Q8IA 3MF5A 3TWHA 4IG3A 4CF2A 3ULDA 3NKYA 2XRIA 1QQCA 1EP4A 5KFPA 2FJXA 2IBKA 4TY8B 1RTDA 1LW2B 4IRKA 3VQ7A 3DLEB 3H4BA 4KTWA 2I5JB 5KG3A 2WTFA 1SH3A 1NJYA 3P5JA 4FM1A 4F3OA 3UDLA 4NYFA 4PUOB 1WSHA 1LAVA 4KKOA 2J6UA 3V9UA 3RB0A 3I0RA 1FXXA 2ILZA 1LV5A 4O3RA 3QNNA 3LAKA 5C42A 4RNMA 4HUFA 2RDIA 3MR2A 3N6NA 4DL7A 2HNZA 2YKMB 5I42A 3OHBA 2KTQA 4DU4A 2W9BB 1TL1A 2G8FA 2QE5A 5KFNA 3V1OA 5KT7A 4WXOA 2G8VA 3OS1A 1DLOB 2ATQA 4IRCA 4CFDA 3TAEA 3CJ0A 5HLFA 3QO9A 1B9DA 2R7YA 3MR5A 1FK9B 3RMAA 1L3SA 2R8KA 3O4NA 1W9HA 1S49A 2PYLA 4OPKA 5JS2A 3V9ZA 4NYZA 3T3FA 3LP2A 3VQDA 1QE1B 5KT4A 3PZPA 4NLVA 1RBTA 4OVLA 5E41A 4W5QA 1TQLA 3BSNA 4IR1A 4CF8A 5KTQA 4K4ZA 4URQU 2E4LA 2HNDB 2HHXA 3RB3A 3CWJA 1B92A 1KTQA 5DG8A 5KFRA 4CGDA 2RDJA 4N47A 3AO2A 2ZD1A 1SV5A 4OL8A 1RTDB 1J9AA 2IOCA 3V81B 1S6PB 4IKAA 4MKAA 1S1XA 4DL6A 1VSMA 4ZVFA 2QKKA 1J54A 3MXIA 4F50A 3G0ZA 1RYRA 4AH9A 1UA1A 4DFMA 4B9LA 3DRPB 1RT7A 3IGVA 4KKOB 3I0RB 5C42B 3I8DA 4OGEA 4CEQA 2VG6A 4BWJA 4MIAA 2ILYA 3UQSA 5I42B 4CE9A 4DMNA 2AQ4A 3K5MA 4BWMA 3CJ2A 1JKHB 3N6LA 3O3FA 1TL1B 2W9CB 1DTQA 4CERA 4AHVA 3ZT4A 4CIFA 1SL2A 2QV6A 3H2LA 4HKQA 1HNIA 4AHCA 4CFBA 1RA7A 1GX5A 3PO4A 3DLKA 4E7IA 2KFNA 3TQ1A 2OPSA 5CYMB 3QYYA 3O4QA 4DQSA 3KK2A 1IH7A 3K57A 3CJ4A 4I2QA 4JUZA 5HROA 4C8NA 1IG9A 3GILA 4DG1A 1QHTA 4U7CA 4F4KA 3G10A 4URSA 3PJXA 4ZVHA 4Q43A 3M9OB 1X9WA 3RR8A 4KPYA 2HHQA 4EBCA 3IN5A 3NF7A 3DRRA 1K1SA 2UVRA 4O0JA 4E7HA 5KFEA 5SWMA 3SPZA 1SV5B 2E6LA 4EBDA 5KFKA 3T1AA 3H5UA 3Q8RB 1S1XB 3ASMA 4KV8A 3NGYA 5EDWA 2WHOA 1T94A 4ZTFA 1LWEB 2JEGA 3HM9A 4ZTJA 2DTUA 3GQCA 1SL1A 3SZ2A 1RT7B 4ZMMA 1L3TA 1C1AA 1HPZA 2V4QA 3KJVA 3LPUA 1K1QA 4XPCA 3D5MA 2VG6B 4O5BA 4FLYA 3AVBA 2ASJA 2IC3A 3SUQA 1TKXA 4M95A 3BQ1A 1LWCA 5KFJA 3HT3A 3NAHA 4RNNA 3AA2A 2VWKA 3P1GA 3O3GA 3AVJA 1YT3A 1DTQB 2IAJA 5KG2A 3LP3A 4E19A 3AVKA 2BR0A 4HUGA 3IAYA 5KG0A 3TR8A 3DLKB 3GV7B 4F3TA 2AWZA 3KMQA 1T05A 4TYBA 5JXSA 3KK2B 3DRSB 4I2QB 1A5VA 5HBMA 1RDDA 1TVRA 4CJQA 5HROB 4R5PB 2V0NA 4NLYA 3QEIA 3KLGB 4ZVGA 4IG0A 2A1RA 3Q8PB 1TL3A 4Z4GA 4XO0A 4YFUA 4ELVA 1YVFA 4JV1A 3ZT0A 1BQNB 3RRGA 3VQ6A 3DRRB 3SV4A 3OLAA 1QSYA 4KFBA 2YKNA 1S48A 3M9MB 5KT3A 4CHOA 3MAQA 2AJQA 2WCXA 5FDLA 3DLRA 3H08A 4CGJA 4O4GA 2GUIA 4B9TA 1D0EA 2R8HA 4K50A 2I1RA 3NBPA 4KV8B 5J2PA 4OKKA 4MK9A 1JXBA 5I3UA 3C6TA 4EZ6A 5J2NA 1S1TA 3GIMA 3HPGA 5DMRA 3V4IA 4FJ8A 1DTTA 1HPZB 3KJVB 1XC9A 1JLEA 3HL8A 1YTAA 4NLGA 2KZZA 2IC3B 2OH2A 1UOCA 4B9MA 1XR5A 4B9NA 3AVLA 1KFDA 2AGPA 1LWCB 5HRNA 3DOKA 2D0AA 4IKFA 4ICLB 3EPIA 4EEYA 4N41A 3OYNA 1NHVA 1S5JA 3PW0A 3HPOA 2IAJB 3OYHA 2D0BA 1JXLA 4HCCA 4QWEA 1REVB 4YMEA 2IM1A 5KRSA 4E1MA 5DQHA 4CF1A 3H5XA 1L3UA 3RR7A 1T05B 3ISND 3MXJA 4LD0A 3SQ1A 5HBMB 2FBVA 4H4OA 1TVRB 1VSLA 3L3VA 4YP3A 1BI4A 4Z0UA 4CJ5A 4BDZA 4NRTA 2GV9A 5KT2A 1TL3B 4N5SA 3KHLA 1WAJA 3FRZA 5EUHA 4FYDA 4IFYB 3AVAA 1RDAA 1R0AA 4KHWA 4ECTA 3QEWA 2RPIA 2CKWA 3I5BA 2W42A 4CGGA 1HMVA 4FS1A 1VSKA 4ZPDA 1N5YA 4KFBB 1KLNA 4CJEA 3VQQA 5FDLB 5J2MA 2FBTA 4O4GB 4W5TA 4CGFA 2AX0A 4ED3A 1WAFA 3NBPB 3AVCA 4FJ5A 1WNEA 1S0MA 5I3UB 3C6TB 4PY5A 5J2NB 2XHBA 4FCYA 4J9MA 3ZSXA 3OYBA 4KHNA 2P5OA 2IA6A 1C0UA 4Q44A 3VQ4A 4EP4A 3H40A 1A5XA 3D0PA 4FW1A 1DTTB 3N6MA 3KLHA 3NH1A 4G3IA 4JLHA 3HK2A 1JLEB 5KFAA 4CJ4A 1C0MA 3KLEA 2HB5A 3QIPA 5C24A 3MXMA 1A5WA 5KFUA 1J53A 2XGQA 3KTQA 4WYWA 4E7JA 3HVTB 5L1KA 4FJJA 3AVGA 3JYTB 3NGDA 3DOKB 2C2RA 2YNGB 2XO7A 4DLGA 3KOAA 3M9NB 3SI8A 3DLBA 1LW0B 4CEEA 3HP6A 3LWLA 2IGIA 2DY4A 3RBDA 4CECA 1RDBA 2XY6A 4ZVEA 1KSPA 4WE1B 3DM2A 4CEAA 2R2UA 1RBVA 3PV8A 2BRLA 2IS3A 1BI4B 4RNFA 3KKRA 4W5NA 2YHBA 1B9FA 4CEOA 3CJ5A 4DQPA 4ECXA 3FQLA 3DMJA 2J6TA 4FVMA 1R0AB 2LSNA 4K4VA 1JLGA 1WSFA 2HVHA 4RUCA 4ECQA 1NKCA 4JS5A 3PUFA 1HMVB 1BIZA 4KO0A 3NF8A 1TV6B 4B8AB 1N5YB 4ECSA 3SQ2A 3CQ8A 3QIOA 5J2MB 4QCLA 3VQ9A 4YQWA 3L3UA 3WNGA 4DLEA 3NGIA 2BANB 2HVIA 1I3AA 1T03A 3D28A 1MMLA 3KLIA 3OYMA 4YNQA 4MFBB 4FM0A 2OYQA 2OPPB 4YR2A 3AVFA 4GMJB 3KLEB 3PW5A 3QIPB 2ZKUA 5C24B 4QWBA 2QK9A 3CYMA 2JEFA 3OSNA 3OL8A 3E01A 4KHQA 4PWDA 1I6JA 5CYQB 4C8OA 4E3SA 2IJNA 4TSXA 3ZSYA 3L2UA 4NLOA 2HW3A 4DTUA 4W5RA 3LP1A 4JV2A 5FRNA 1JXEA 4C8MA 3LP0A 1CSJA 2FVCA 1C1CA 5F8JA 2QXFA 4O55A 1VSDA 4CJLA 4FZZA 5C25A 4ECRA 3SYZA 2Z1GA 3MECA 2P51A 3OYGA 1NK7A 2FVSA 4Z4CA 4WZQA 2F8TA 3QZ7A 1EKEA 1RT2A 2WK4A 4Q45A 3OLBA 2J6SA 3PO5A 4KO0B 3BSAA 3NF6A 4E89A 4DSJA 2W9AA 3DLGA 1FKPA 3EY1A 3V6DA 2UVWA 4M3RA 3HVRA 1ASWA 3QIDA 4FLZA 2R2TA 3K5LA 3AO4A 1WSGA 4WFZA 1HYSA 1X9MA 2C28A 1T03B 3NCIA 2V9WA 4O3OA 3C6UA 2P5GA 2IM0A 1TK5A 3KLIB 4Q5VA 4HVJA 1TAUA 1RBUA 4BE0A 2HMIA 4MKBA 4CF9A 5KFCA 4KB0A 4F4WA 2FBXA 3HXMA 2BRKA 3OYLA 4J2DA 3TARA 4JS4A 5CY4A 3LANA 4FK4A 1ASUA 3AVIA 2RKIA 4Y34A 3P83D 5DG9A 3L8BA 1RTHB 4O3SA 1RBSA 4PWDB 4AHSA 1S1WA 3PY8A 3MEGA 3LP1B 4RW7A 3HHKA 3RMBA 1S9EA 1BL3A 1X9SA 3TAMB 4FLWA 1U47A 3LP0B 3ZT3A 3DI6A 3ALYA 3PW7A 4IBNA 3NGZA 5C25B 1Q9YA 4I7FB 1TK0A 3QERA 1HRHA 3TAQA 4DTXA 1S1VA 1JLCA 4I9LA 1RTJA 2EHGA 4IG3B 1HYZA 3M8SA 4L8RB 3QGIA 3OL6A 4KSEB 1EP4B 3KHHA 1RT2B 4BDYA 1SUQA 1RYSA 1S0OA 2E9RX 4DTRA 2DFFA 3S3NA 2JEIA 1JIHA 1FKPB 2R8IA 1D8YA 4NYNA 3OYDA 3K2PA 4AHUA 4FJHA 3F73A 1ZBLA 3GIIA 1RNHA 4O0IA 2HWHA 2XY7A 4DTJA 3OYCA 4CJPA 2OPRA 2HMIB 4B9SA 2HNZB 2DFEA 1I39A 4M3TA 3CDWA 4RU9A 1L5UA 4NLQA 2HAIA 4ID1A 3NF9A 1IKVA 4IH5A 2YNHA 3C94A 4FJLA 2F96A 2HHVA 5HLFB 3QO9B 1WN7A 3T5LA 1S1WB 3EPGA 3V6HA 3MEEA 5KGWA 3OYAA 4CHPA 3CDUA 4MK7A 4CF0A 3NDKA 1HYVA 4KREA 1C0TA 4RW7B 1S9EB 5KGXA 4M3ZA 1UA0A 4M3XA 3LP2B 2C22A 3SUPA 4J2BA 2W8LA 2XGPA 3VQ8A 4Q0BA 4Z4HA 2XY5A 3SUOA 1S1VB 1RTJB 4ZPBA 3H59A 3BDPA 4FJ9A 2Z1JA 2OZSA 2ZD1B 4E1NA 1L3VA 2GIQA 2D3ZA 1BISA 3TAFA 2R8JA 4WFYA 2IJFA 3VA3A 3LPTA 1JX4A 2RF2A 4DS4A 2FBYA 2X78A 5KFWA 2BDPA 1ZYQA 5KFHA 3BR9A 3Q8QB 3PX4A 3CG7A 3KD1E 5KFQA 4OPJA 3SJJA 2QKBA 3NH0A 2P1JA 4EZ9A 3QESA 5HP1A 1SKRA 3GV8B 3S3MA 4DTOA 4CEDA 2OPRB 4HYKA 1ZTTA 1S9GA 3K59A 3G86A 4QWDA 3OHAA 1BQMA 5KFIA 3RAXA 1ASVA 3ZSWA 4K4TA 3TANA 4F2RA 4KHMA 3O3HA 1IKVB 1HNIB 2XY8A 3HSTB 3AA5X 2OPSB 2V4RA 5F8IA 4WZMA 4CHQA 4H54A 1K6YA 3GIKA 2Z1IA 4RW8A 5KRTA 3CIZA 1EX4A 2GC8A 4DG1B 3RWUA 3AA4A 1OS5A 5L9XA 1HQUA 1NOZA 4F8RA 3HP9A 4M3WA 3KHRA 3ICLA 3MFHA 4B9VA 1D1UA 4Q0BB 4GC7A 4KTZA 5JS1A 4M45A 3L2RA 4LQ3A 2ETJA 5KFMA 1U04A 1GOAA 3CFPA 4BDPA 1FKOA 1CZ9A 3V1QA 3OJUA 4DQQA 3WNFA 4AILC 2RF2B 3IG1A 4Y2AA 3FQKA 4RUAA 1NJXA 3AVHA 2FLLA 1TK8A 2PYJA 2HHTA 4ECUA 3G6XA 2ITGA 4C8KA 2D3UA 4FS2A 4R8UA 1X1PA 4QAGA 1RCHA 4BE2A 5HP1B 1RTIA 4KB7A 1TKXB 4KHSA 3U3GA 4FZYA 1N4LA 3A2FA 1EXQA 3LWMA 1Y97A 1BQMB 4RW9A 3CJ3A 4QW8A 4FM2A 1D9DA 2G8WA 4MK8A 3ZSRA 4CJKA 5DLFA 2E9TA 2G8UA 4FK0A 2O4GA 1KHVA 4RNHA 4E0DA 4CK2A 1IKWA 3VQCA 2UUTA 3BSOA 5JUMA 1WSEA 4RW4A 3OVNA 1IO2A 4FJGA 4RW8B 3EZUA 3WNEA 1QS4A 2UVUA 3KMSA 4CJFA 1HNVA 4IG0B 4ELUA 4LSNA 4ZP9A 1HQUB 4I2PA 5KFDA 1QAIA 1D9FA 1VSFA 3HVWA 4EBEA 2AGOA 4NCBA 3PJWA 2FLPA 4KAIA 1NK4A 1YTUA 3V9SA 5T14A 4B8CA 4CCHA 3LDSA 2BQUA 3H4DA 1C2PA 1IKXA 2YKNB 4J2AA 2OPQA 1ZBIA 1FKOB 1RDCA 1W25A 1RT1A 2JGUA 4PQUA 3NFAA 4ID5A 3QZ8A 2FVRA 4Z4EA 1S4FA 5J2PB 5L1JA 3VQEA 4ZPCA 4CK3A 3IG1B 3CM5A 4CHYA 4CHNA 1C1BA 4KHYA 2ZQBA 2D7SA 1S1TB 4TXSA 3SUNA 3OJSA 2HHUA 4EYHB 3V4IB 1C6VA 1QUVA 1Z25A 4Y3CA 3DDKA 5DQIA 4R8UB 5F8GA 3K5NA 3CDEA 4IQXA 1RTIB 2ALZA 2B6AA 2XI3A 2BE2A 3VN5A 4FJ7A 4ZPAA 4O3QA 3MTKA 4CK1A 3OYFA 2VG7A 4DS5A 4O4RA 4FZXC 4RW9B 3KLFA 1KVBA 3C95A 3MEDA 2YHAA 4CFCA 1IKWB 4EO8A 3HYFA 4RW4B 2FJVA 2Y1IA 4H4OB 3RRHA 4Y1DA 4RW6A 4K4UA 4R0EA 5KT6A 4YR0A 3L2QA 1U49A 3I0SA 1EETA 1HNVB 5CZ2A 1GX6A 3E51A 4LSNB 1KRPA 5F8NA 1ZBFA 4FJMA 2RN2A 4DSIA 3D45A 1TP7A 4GVMA 4DL5A 5KFLA 3V1RA 3V6JA 3KK1A 3KLVA 4DF4A 5F8MA 4XPEA 3RB6A 1IKXB 5KG7A 4ED0A 3M8PA 3NHGA 4Z4FA 4PQUB 4ID5B 3NH2A 2UVVA 2X6NA 2O5DA 4NLUA 1S6QA 4TY8A 2KFZA 1C1BB 4DSLA 4TQRA 4K4WA 1C0UB 1XHZA 4KTQA 3VA0A 4Z4IA 2YNIA 2Q3SA 3KLHB 3PW2A 4DFJA 4OLAA 4NLTA 4J9LA 3AO3A 4PUOA 4RG8A 4GC6A 2PY5A 5HRRA 3QEVA 1U4BA 4I9QA 3FDSA 3OSPA 3KNAA 2VG7B 1IKYA 2GBZA 1ZBHA 4FLVA 3KLFB 3MR3A 3K58A 1LWFA 3MEDB 3FSIA 2IMWP 4E7KA 4NLRA 2FVQA 1XI1A 2XCPA 2OA8A 1VSHA 4RNOA 1J5OA 3RMDA 5KFYA 4NRUA 3DM2B 4NCGA 3FFIA 1DLOA 5KT5A 4RW6B 4U6PA 4J9QA
chains in the Genus database with same CATH superfamily
2V68A 3HO1A 2I8EA 2BJDA 4ZPWR 4OX7A 4CW7B 1U2VA 4HTLA 3MOJB 3CJ9A 2HHWA 3DMJB 1JNRB 5IS2A 3RW7A 3UD3P 4JI7K 2GO8A 3TUPA 4ANDA 3I6PA 1QE1A 4JHDB 1KQKA 3AB2B 3MM7A 4B1WB 1EWQA 3KJQB 3GLJA 1HBUB 1QVFM 3ZSOA 4JI2F 4DV6K 3QGGA 3HLUA 2ZH2A 4LF5K 2R7UA 2DNHA 2DPJA 1R43A 4JI2J 4K8ZA 5HAOA 3QLHA 4CFAA 4C23A 4XDCA 2F9WA 2PI5A 4RU2A 1N32F 3N0VA 4C3LA 3CJ8A 4X64F 3UN3A 5ADXA 4PXCA 4EUVA 1RAIB 5AQPA 2DBBA 1FJGJ 4CIGA 3GB0A 2NYIA 3VQPA 3CW2C 3HHDA 2WBRA 1WSIA 3KFWX 1H72C 1T0TV 4XTTA 1LWFB 2QM1A 2L9DA 4J9OA 1CLQA 1S0VA 2W9CA 3GFHA 1TFWA 1J5OB 3SCIE 4BLGA 3IFRA 3BREA 3FFIB 2RHKA 2RQKA 5K8MA 1IBKK 1OMSA 5D4OA 2GFFA 5H1SQ 4ECZA 2HNYA 2W7OA 4CESA 2RB7A 3ZCMA 4BR7A 1VR6A 1MSWD 4IO9L 1U2VB 4M3UA 1AA1B 4JI7F 3GDQA 2W8KA 5CD4H 4CJRA 1RT5A 5HANA 5I3QA 4CNYA 3CPWR 3EO3A 1R0BG 1HNXF 1NDKA 2YV0X 2OZMA 4HWIA 3O8WA 5EWGA 1HNXJ 4BE1A 3CD6S 3U3YA 1VQLS 3JQJA 1U48A 2UV8G 3RMCA 2WONA 1HARA 3QLHB 3H5SA 2IVNA 2HQDA 1LWEA 2O4IA 2C3UA 1F3VA 4XK8C 3ZX0A 2GVZA 4LMZA 4LF4F 4PAAA 5M1KA 3K0SA 1UCNA 5DG7A 5HRSA 1FT8A 4H0TB 1TKTA 3BQ2A 4LF4J 3CCZA 2GMHA 3RBEA 1RGIA 3OYEA 6FDRA 5KG5A 1TYQA 1R8CA 1AFJA 4NYPA 1R6VA 2EFQA 5KFTA 1SIZA 2ZJQQ 5EWFA 2BKOA 1FESA 3C65A 3DI6B 3QSIA 1TUYA 3GIJA 3O5TB 3NGKA 3LDPA 2OFHX 4BACA 5MAOA 2HNYB 1HBOB 4ANCA 2EFVA 1NK9A 3Q83A 5HJYA 4R5PA 4K4YA 9RUBA 4LQ9A 1G7CB 1ZAXA 2WBNA 3NMAA 3KLGA 3UKRA 4JRPA 1RT5B 1TAQA 2LDYA 1IN0A 2RHQB 1NB2A 3FZKA 3JQKA 3NP5A 5I4MA 4CGIA 2B9WA 4HI2A 4H5TA 3W2WA 3EGZA 2QG9B 3AVMA 4PYDA 2V52B 3W0LA 5AQZA 2KVIA 2X74A 2KQ2A 3KHGA 2WONB 4M5LA 4YY3K 3D4JA 2QL9B 2F9JA 4LREA 3BSCA 1O1WA 4CH1A 2YX4A 5CE3A 4KGZB 5B0FA 2R7VA 1NJWA 2G9OA 1N5QA 2BJEA 2GVZB 4DDFA 4FPBA 4LF9F 1OWXA 5M1FA 1TKTB 3CM6A 4O44A 4E8UA 1YBAA 4WBFA 1RUSA 4LF9J 2YWWA 5IM0B 5D0EA 2AGQA 3W66A 3MEEB 2APOA 4U7UK 1RU1A 3ZTOA 1WC0A 4ICLA 2VFSA 3MK6A 2EX3A 1RSCA 4J9KA 2XHCA 5L9NA 4WQ4C 4ILRA 3FBFA 5DDOC 1RWNB 3DWLA 3DYAA 3ITHA 4DSKA 1RBOB 5CZXA 4BRHA 1YSJA 3GYXB 3FBCA 5CR4A 1PJ6A 2YH0A 3QNOA 1SVDA 3KWMA 4K4XA 1WF2A 3Q7CA 5K14A 2VG5A 3ZX2A 2XEXA 3UKRB 5C15A 1NGDA 1JCEA 3ZTRA 2E1YA 1B0VA 2CPDA 3CD7A 4KHUA 3ZETA 3W2WB 3UR0A 1VQMN 3FJ2A 1NJZA 4OKJA 4GW6A 2E1PA 3O80A 3W8PA 4ECYA 4HLBA 3ISNC 2OMLA 4N76A 4WFXA 3R1HA 2DGTA 1F9FA 1F1BB 4JK7A 1X0FA 1ZBUA 1OY8A 3Q8YA 4UZBA 3H5YA 3J7YU 1NK6A 3QEXA 1M0SA 4FBUA 2VHGA 1EQYA 4O44B 4ED8A 3Q8SB 1VRUA 3J81Y 1U1OA 3HVTA 1JLQA 3JYTA 1WOPA 5CZ1A 2YNGA 3LZIA 3EKUA 4F7VA 4A2BA 1BCMA 4NZ0A 2LEBA 2WAQD 1M1HA 3HPHA 4WTOB 3DYAB 3ITHB 1TL7A 2V2QA 2DIVA 3SFGA 2MPUA 2JEJA 4OHWA 1B7FA 2HVDA 1VQPN 2VQEJ 2DGQA 5K14B 2VG5B 1U45A 1HNWF 2R2SA 4MIBA 3V9WA 3SBMA 4UY8T 4TLQA 4J9PA 1HNWJ 5LL6d 2WB4A 3ZT1A 4CLUA 3ZETB 1TTHB 2ZITA 4PCQA 4BG8A 5L1IA 1RHQB 4LR9A 1EARA 3EWGA 2VGNA 1AYEA 3C3LA 3EE9A 1S97A 4YUDA 4A5AA 1QSLA 2HFNA 4X65K 4JV0A 1YITN 1JLBA 2M70A 2UXBJ 3D6HB 2XC9A 4UUWA 1XIQA 1X3NA 4WP3A 4MFBA 3NMUA 4UT4A 2M7SA 1IBLF 2OPPA 2KHDA 2HGMA 1IJEB 4LY7A 2LCWA 4CHZA 2KYZA 1VRUB 4OMFG 2VDIA 2B4JA 4YDUC 1JLQB 3H2UB 4FWPA 4ZOSA 3PHEA 1D8ZA 3MM9A 4WYLA 2BH1A 2P9PA 1ITPA 4AF1A 4CJWA 4EIAA 5IWAF 1TL7B 1V5IB 5B09A 3W5XA 2ZJPL 2UV8A 3CVKA 5IWAJ 2ZZNA 4F4XA 4QW9A 1YVUA 2X3DA 2OPQB 1WORA 2VC1A 2WFBA 3V9XA 4J2EA 4CEFA 4JEPA 1FD2A 2V9KA 2CJXB 3KWIA 4B1VA 1XWLA 1IR2A 4ED1A 5ITHA 1N33F 4X4OA 4DL4A 4CYUA 2WC9A 1PCAA 2MQLA 1HKBA 1HI0P 1N33J 1RFQA 2IYGA 1UAXA 4PA1A 2GAGC 1JL2A 5DM7L 2CH6A 4ED5A 3PG9A 1JLBB 3BO4A 3U9ZA 1HJRA 3KIOA 1QZ5A 2Y1JA 3M8ZA 4J7CA 2VWJA 4IEEA 1RZMA 4PKHA 2E7WA 3MGJA 4M5GA 5EX0A 3TUJC 2PFDA 4DV7F 2CQPA 1NK5A 3JS6A 4RLEA 1K0TA 3SAFA 4DV7J 1BMQB 4GVBB 3MM9B 2P9PB 1VQMS 2W1BA 2VA3A 1RDUA 1HD1A 2P9SA 3DLHA 1ZZFA 2E20A 2V94A 2VKZG 5KG6A 5IT9Y 3TAMA 3SMZA 1TFYA 1MWKA 4J37A 5IZHA 2ABYA 4ZP8A 2EKYA 2XM3A 4Q8FA 2RUSA 4I7FA 2HNDA 5ETSA 3I5CA 4FJXA 1MW7A 1F21A 3I56N 2PEBA 2H51B 4IG3A 3NS6A 2L9WA 1OH6A 3AARA 2XRIA 3GU0A 5SUHA 4U8VA 4IRKA 1NGFA 4C3MA 4KTWA 2WTFA 1YJUA 3C16A 4CYUB 1NJYA 3P5JA 4FM1A 3GIRA 1CJUA 3RB0A 3I0RA 1U1MA 1LV5A 3QNNA 2MSTA 3J81j 5FPEA 2RDIA 3MR2A 3MCMA 1GTEA 2KL8A 4DL7A 4CZIA 4WK1A 3UI3A 1VQPS 1HWLA 4UOFA 3M7VA 2MXYA 3GP9A 2HIQA 2UUCF 4J90A 4JI0F 1FEHA 1UETA 3CEDA 2V8VA 1R6YA 2ATQA 2CQBA 2UUCJ 3TAEA 3CJ0A 5HLFA 4IYQA 4JI0J 3MR5A 4BC4A 3B8AX 3O4NA 4K59A 4C8YA 3Q89A 4NLVA 2XMAA 1YITS 4IR1A 2NRRA 1JB0C 5AXKA 2HNDB 2M8DB 4CGDA 3K17A 3THXB 2J8SA 3L9ZA 2FC9A 3AO2A 4YOWA 3Q8VA 3HMJG 4Q2MA 2PGCA 1R59O 2VFTA 3V81B 4U96A 1S6PB 4MKAA 4DL6A 1VSMA 4ZVFA 2VZ9A 3IR5B 4DUYK 3TNVA 3BKUA 3UN2A 1JJHA 4DFMA 3DRPB 1XN9A 5KPRA 4OLOA 1CJUB 2LDIA 1ICEB 1HA1A 3I0RB 1PILA 2GCFA 4DPYA 5IT4A 1QHAA 3RUBL 2J0WA 5A8KA 1RKJA 2EFNA 3O1LA 3OTBA 4DMNA 2AQ4A 1FERA 3RVCA 4YDDB 5FPNA 3N6LA 4P73A 1FKAF 3HI9A 4RCHA 4CERA 3ZT4A 4CIFA 1HNIA 3FMWA 4CFBA 3FZ2A 4OQJA 1DT9A 5CYMB 3KK2A 3CJ4A 4JUZA 4LF6F 1X31C 2GMLA 1IG9A 4NO7A 4DG1A 1Y5NB 1F5AA 4F4KA 4M7XA 1JXVA 4LF6J 2EXUA 2PE8A 3S6EA 2QWRA 3PJXA 3KJFB 2H4YB 4ZVHA 5AQUA 1KC8T 3L3CA 1X9WA 3RR8A 4KPYA 5E5NA 5D0HA 2IYIA 4FVCA 5EHHA 5KFEA 3QJPA 4AE5A 4KR0B 4M5HA 4DV4K 3RRKA 1S79A 4V19X 4ZVTB 2Q66A 2WHOA 2QA2A 1S72N 3FNNA 4H0PA 2XYPB 2ZUAA 3EX7B 3TZZA 2LQ5A 3LPUA 1Q79A 2Y1RI 1K1QA 2JVRA 3D5MA 4FLYA 3AVBA 2ASJA 2AZ1A 4F3QA 4A5BA 2MZQA 3PYEA 5T7LA 2L41A 3BQ1A 4ISFA 1LWCA 3NAHA 3AA2A 3D2WA 3O3GA 3AVJA 2ZH9A 1HW8A 2VL1A 2DNGA 1YT3A 3I56S 3RG6A 4E19A 3T69A 3P49B 3VV2B 2BR0A 3HSZA 1KAYA 3TR8A 4BC5A 3KMQA 1T05A 5DS7A 4OX9F 3KK2B 2YWKA 2ADCA 3R8YA 1SC1B 4OX9J 3QRPA 4NI2A 2PD1A 4OYZA 1WJ9A 3HSGA 4CLWA 2ZVIA 3CD5A 3IMXA 2BX6A 2BJ8A 3BGFA 2YTCA 2J4RA 4WK3A 1YVFA 3CIMA 3OHRA 2NRWA 4G65A 4JV1A 1N54B 3A8YA 3PHTA 3H3NO 3VQ6A 3SV4A 3W3SA 3KKFA 1QSYA 2YPZA 4KFBA 5BR8J 3EKSA 5EX5A 3MAQA 3RW6A 2FD2A 3GJTB 3W3DA 4O4GA 1APSA 2GUIA 2Q3PA 2KM8B 1YJNN 1D0EA 2ASYA 2FB0A 2C2OB 4R25A 2Z2YB 3E1YA 3O9TA 3SAGA 5DMRA 3V4IA 3QFWA 3HHNB 3HL8A 3AA8A 4NLGA 2GEMA 4B9MA 1XR5A 4A61A 3AVLA 3G8QA 3F2KA 3DOMA 1KFDA 2CADA 1LWCB 1HHSA 2M88A 2D0AA 4IKFA 3EPIA 4EEYA 2R7RA 4CQ1A 1VQ8N 1S5JA 1SS6A 3HPOA 4M1KA 1G2EA 3OYHA 5D4LA 4CT9A 1BD6A 4I1TA 1REVB 5GAHP 5DQHA 3RR7A 1T05B 2P9LB 3CE8A 3ISND 1EX8A 5BJRA 3MXJA 4LD0A 1LXJA 3DCAA 4H4OA 3L3VA 1BI4A 1JJCB 2K3IA 4BDZA 5KT2A 3P5TL 4N5SA 3FRZA 1FX4A 1MROB 2CJ9A 1C0FA 4OLPA 1R0AA 3QEWA 3VZHA 3POTA 1PGZA 2GS8A 4KFBB 4L74A 3VQQA 4O4GB 4CGFA 4OV6A 5KPTA 1I94F 2HAFA 1WAFA 4CZKA 1OYEA 2QI2A 1S99A 3GOIA 1S0MA 1IG8A 4AT1B 1I94J 4FCYA 3ZSXA 3OYBA 4NL5A 1KOHA 5AZIA 1A7GE 4LBIA 3UCUP 1Y7PA 4Q44A 3OFEA 3D0PA 4H5WA 3HK2A 4CJ4A 5JMVA 2QWLA 1C0MA 4C0OC 1PJ7A 1V4TA 2HB5A 4NMXA 5C24A 3MXMA 1A5WA 1J53A 2XGQA 3DOMB 4E7JA 5L1KA 3QAUA 3W2VA 4YOVA 4C4WA 4DV2F 3CCEN 3HP6A 3LWLA 3TZWA 4OPHA 1RDBA 4ZVEA 2SXLA 4DV2J 1RBVA 3EGNA 3PV8A 3E9LA 2IS3A 2CQ0A 4MLHA 2GV1A 1BI4B 3PIOQ 1S72S 4W5NA 2YWFA 3EXCX 3FQLA 1DEJA 1R0AB 1FXRA 5D15A 2BOPA 5K8OA 3POTB 1NKCA 3PACA 4JS5A 1T95A 3LGHA 4KO0A 3E9OA 2G2ZA 3M6UA 4B8AB 1IBMF 2IA0A 2F7VA 1F5CA 2VFUA 3CCJN 2E7VA 2ZF5O 4DR7K 2BANB 1ZC6A 3D28A 2QW9A 3U27A 4X62F 2WB1D 3HDSA 1OVYA 4MYTA 3DLLL 3HD1A 1DGKN 2NYHA 3S41A 4X62J 2OSQA 4TVAB 1MWMA 2B8QA 4ED4A 3LDLA 2P8IA 2V69A 3AVFA 4YR2A 4GMJB 2K8GA 4PG6A 2R9LA 4C0BA 5FJ4A 5C24B 2D1CA 2QK9A 1AZSB 5HMYA 4OI1A 3OL8A 3E01A 4CZEA 4KHQA 3W2VB 3LUYA 4PWDA 3DXKA 3H7HB 4C8OA 4E3SA 3L2UA 3MX2A 3LP1A 1Y00A 4YOEA 1YJNS 4WF9Q 1C0GA 1CSJA 3HJVA 5F8JA 2AJ4A 2CGLA 3GCXP 2EI5A 5C25A 5E2QA 2VQFF 5AQTA 5A6WA 1Q5VA 3MECA 2RT3A 3OYGA 2FJDB 1NK7A 1VLOA 3T7ZA 3VF2A 2VQFJ 4BR2A 1RAFB 3RBZA 4DR1K 2MKCA 2F8TA 3QZ7A 3A3OB 1VC6A 1RT2A 4WWSA 3FSYA 2WK4A 2J6SA 4KO0B 3GWCA 1WTFA 1Q8BA 4E89A 3H6EA 3DLGA 1FKPA 3EY1A 3V6DA 1VQ8S 1ASWA 2M5YA 2V8HA 3QIDA 4OZ2A 3VHQA 1UVNA 1WDDA 2HOEA 4AL7A 2FHKA 1UJ5A 3AD9C 3WXJA 1Y3JA 3NCIA 3R3TA 4MLEA 2BUNA 2IM0A 5A76A 4Q5VA 3NGSA 1X4FA 2I7PA 4YOYA 4CF9A 4PXBA 2FBXA 3TARA 3M2RA 5CY4A 3A0IX 1FTCA 2C2ZB 2W4DA 4O8UA 2RS8A 1RTHB 2OCEA 4PWDB 3DXKB 1T9YA 4AHSA 1S1WA 3UFCX 3PY8A 4KGVB 3LP1B 2MQNA 3HHKA 1X9SA 2NQPA 4FLWA 4J91A 1U47A 2P9CA 3M6VA 3HFVA 3NGZA 5C25B 3WX4A 1TK0A 2V34A 1HRHA 3IBCB 4DTXA 1S1VA 1VK8A 3T1HK 4DX8H 3GE1A 3M8SA 2F8MA 4ZS6A 1HR0K 4HTJA 4PKGA 2OIHA 5EX3A 1EP4B 2NZ4A 1RT2B 3CETA 4BDYA 2OO4A 4YB5A 1SUQA 5EGYA 1RYSA 1R31A 3OD2A 3B54A 3UVJA 3BEGB 1FKPB 2R8IA 4DCJB 1GLAG 1GMUA 3KWGA 3K2PA 4CZCA 3WQTA 5D77A 2VBZA 3CCES 1ZBLA 4LRAA 1YF5L 3ZC4A 2PA8D 3GIIA 4LF7K 4U67L 4O0IA 2XY7A 5B0DA 3OYCA 4CJPA 4BR5A 1I39A 4EAHD 4NZ6A 2V8GA 2QZ8A 1S7IA 4NLQA 6FD1A 2HAIA 3M2RB 4ID1A 3NF9A 3O6WA 5CABA 2XLKA 4B3RF 5FIIA 3SLCA 2YNHA 2EFGA 3QT7A 2IIHA 2W2PP 5LMUF 2NR0A 4QIVA 2LXUA 4B3RJ 1M1KO 1WN7A 1S1WB 4F4AA 4CHPA 1OQ3A 1KS2A 4CF0A 4A62A 4U7UD 5GAHI 2NLXA 3R2CJ 3CCJS 1RHKB 3LM9A 4M3ZA 1UA0A 2MYFA 1I51B 3LP2B 4X66F 1J27A 4J2BA 4R0JA 1ZAWA 1RB0A 3D2FA 2KG1A 2XY5A 1NBWA 1S1VB 4X66J 2C1EB 1OPZA 1MN7A 3A3PB 3H59A 2CAJA 1L3VA 2CPFA 1BISA 3TAFA 1B99A 3GBTA 4I67A 1BO5O 2EFOA 2DR9A 2VDHA 3UVJB 2IPOB 3CCVN 4X4SA 5GAGU 3DDNA 5KFWA 4HHJA 1ZYQA 3BR9A 5IC6B 3MPVA 4OYPA 3PX4A 3VAMA 3SJJA 2QKBA 5D6GA 3NH0A 4EZ9A 1VGYA 2NXUA 2O1PA 1SKRA 3J7Z5 1XQIA 3UE2A 2W2MP 1U24A 1ZTTA 2ZUGA 3G86A 3OHAA 1UJ6A 5KFIA 3RAXA 1YUWA 3CCLN 4KHMA 4NYOA 1NBEB 2E5GA 2XY8A 4JI1K 5GINA 1T3OA 1WOQA 2F65A 2OPSB 3MPWA 2D0OA 1RWUA 2M4MA 3AA5X 3G6EN 2LEPA 1A6LA 3IWXA 4RW8A 5CHIA 1X4DA 2ZWPA 2GC8A 3UDCA 2HQIA 3RWUA 3JSRA 5L9XA 2GAHC 4PPZA 3Q2TC 4M3WA 1K73T 3V5RA 2RRBA 4FKYA 3EM1A 1F60B 2DEJA 3JSBA 4M45A 2DNPA 2PEHA 2V67A 1O8BA 3OTEA 4B3TF 1GOAA 3NVMA 2EG1A 1PYSB 1FKOA 1CZ9A 5U47A 3IAM9 3OJUA 3IWNC 2HEKA 3SAHA 4CIOA 4B3TJ 3H3OB 3AQOA 1NJXA 2C3YA 1U6FA 3AVHA 4LBHA 3FSXA 1TK8A 3G6XA 3TSUA 4AUKA 2QC3A 4QAGA 2C2NA 3AY0A 3CULA 4KB7A 3GJSB 3ZFVA 3U3GA 3QDKA 3LF0A 4ZJQA 2LXIA 1S6UA 3SCLE 4FM2A 2G8WA 1NGEA 4MK8A 3IA0A 3T41A 2E9TA 1NU4A 4BC9A 1VQ4N 3SXLA 1VBKA 3VQCA 1S4EA 2UUTA 2VB6A 1WKJA 3BSOA 3OXLA 2GX8A 3BEXA 4RW8B 4D3HA 1UW9A 3AB4B 4I6MA 1QS4A 5F0XA 2UVUA 2HFVA 3LPYA 3O5BA 4LSNA 5KFDA 4FOIA 5BREA 4ILLA 1VSFA 2W2OP 2RD5C 2O8BA 4RKUC 3R1LA 2F9TA 2WW4A 3V9SA 1YDLA 4B8CA 2YKAA 3LDSA 4AL6A 3H4DA 1FRMA 4J2AA 4DMZA 1TELA 4UY85 1ZBIA 3MM8B 1FKOB 3NFAA 4PQUA 3MHYA 4RO0A 3QZ8A 3MMBA 3ZZRA 2F63A 5L1JA 4DV1F 4ZPCA 3LQVA 4CHYA 3CM5A 4NA2A 1WOOA 1FRIA 1VJWA 1LOTB 4JI6F 3CF5Q 5CD4A 2D7SA 2R3VA 4DV1J 3AODA 4GKJK 1KD1O 2KT5A 3K5PA 2ZZTA 4JI6J 1P8ZA 2B6AA 2BE2A 2YHXA 3ZNJ1 3VN5A 2AV5A 4CK1A 3GR0A 2FZKB 2VG7A 1KONA 1KVBA 4DR2J 2DHHA 3VGVA 2DNKA 4RWXA 2W01A 1U6ZA 2YXLA 1CG2A 2RE2A 3EXYA 2JLFA 3SJHA 2ZH4A 3R6MA 2Y1IA 1BC6A 1Y64A 1NO8A 4R0EA 3CGIA 3CCVS 4YR0A 1LOUA 2IVYA 3ID6A 4LSNB 1ZBTA 5F8NA 1ZBFA 3N4PA 2RN2A 4C6AA 2A40A 1Q82O 1VYAA 3D45A 5EXWA 2I2YA 2O8BB 2BW7A 2E1ZA 1VRQC 5KFLA 3V1RA 3KK1A 1Z6RA 1SJ3P 2DNNA 4LF2A 3O9SA 5CCLA 5F8MA 1WKLA 4TKTA 5KG7A 1B64A 4ED0A 3M8PA 1IXKA 3NHGA 3JSYA 2QWMA 2YJEA 3CCLS 4PQUB 3MMBB 1N88A 3NH2A 1UPPA 2UUAK 5RUBA 4DUZF 4HI1A 2KFZA 3LA0A 3G6ES 4P2XA 5HI7A 1C0UB 4DUZJ 3J7ZO 3VA0A 1O0PA 4CTAA 1EB0A 3KLHB 2Z2LA 3B78A 1RWMB 4OLAA 3AO3A 2ASPA 3A12A 3F9MA 5KQ8A 2JRSA 2HKEA 2HWTA 3QFHA 3OSPA 2FSJA 2VG7B 1S3XA 4ZITA 4WFBL 2QLFB 5E0OA 3FSIA 1GLEG 2E5LF 2QWQA 1XI1A 4RNOA 3RMDA 1VQON 5KT5A 1RWKB 3R5AA 4J9QA 2DNQA 4J9VA 4DTMA 3KK3A 1NK8A 2POKA 4DU1A 1LAWA 3MWPA 3M8QA 1ATNA 4ANEA 3K7RA 2P9IB 1GXLA 3OS2A 1QY7A 3KUEA 2X1BA 3VESA 3RB4A 4J9NA 2LP4A 3WX8A 3HTVA 3CO9A 3B6OA 1U09A 3M8PB 1S10A 4WIQA 3TZYA 3BDEA 4JYAF 1SQGA 1VQ4S 1FF2A 2C3OA 3R5GA 3PCOB 4JYAJ 3S3OA 1RISA 3TAPA 4FLXA 5K20B 1QSSA 3TABA 3TO8A 1ITGA 4CTAB 2JLEA 4KH5A 4W98A 2NPIA 4Z94A 2XYGB 3FKBA 5IQQA 1SJRA 1WC5A 4B3SK 3ZZOA 1UTAA 4MDBA 4KI4A 4YHHF 3VGLA 4QWAA 4MJKA 1N6QA 3ULEA 3A8IA 4YOXA 2UU9K 2NUBA 2GA7A 1B70B 4YHHJ 3CJTA 4M94A 2O8DA 3N79A 2X6SA 4Q2LA 2NZTA 1JKHA 3GE9A 2H65B 3FBEA 3CF5L 3SK3A 4CBXA 1C1CB 1KAXA 3KK3B 2AYEA 3RSEA 3OUYA 2ZBIA 1KVAA 3NL0A 4B1XB 3M8QB 1F9EB 4MIWA 3THYB 5HQ8A 2IVOA 1NHUA 3QPIA 1PC5A 3AJ2A 5ETTA 4CH0S 1N8RO 3NCPA 2LVWA 4FJNA 3ENQA 3FEXB 4IWVA 4UOCA 3C15A 1HQEA 1Q86T 1SQKA 2LKZA 2VA2A 2GX9A 1F2HA 2C2DA 3ENHA 1BCOA 1P27B 3THVA 2R7TA 2MY7A 1HLWA 2KG0A 3I87A 3C6UB 3VQSA 2UP1A 3BGRA 3G6VA 1S9FA 1FVQA 3EVMA 4IFVA 3VAFA 1XJWB 3AA3A 3HZEA 2X1GA 4WQ5A 2O8EA 2IRUA 1N6QB 2HFSA 2QLBB 2G8KA 2UU9F 3ULEB 3WNHA 2C2MB 5MLCV 3D9BA 4C11B 4M41A 1GLBG 2DHSA 5HMZA 1RT6A 2OMOA 2O8DB 3KUHA 3ENVA 1NMNA 3OV7A 4EO6A 4QYZK 3ILLA 4DV5K 1XBWA 3O6QA 3PIPL 3NE6A 1S1UA 3VOVA 1BHLA 1LWXA 4ALZA 3MAAB 2G13A 3DOLA 2ZH7A 3WXLA 4DXLA 4Y2IA 1T44A 2VICA 1HBNB 1OPIA 2CWKA 2VUGA 5DGAA 1N0UA 5LM7E 1LNQA 2K3KA 1ZA2B 3TRGA 4K0KK 2A6MA 2C42A 3D68A 5AQLA 4JKGA 2ZNZA 2G8HA 1OSDA 4JRQA 1HQEB 1SKSA 2G2OA 3VAJA 4QYRA 3V6KA 2EK6A 4AM6A 1SC6A 3AXMA 2XS2A 1HNZK 1E6VA 3CCUN 4ILHA 2P5VA 4DFKA 1VQOS 1CQNA 3BGRB 2WSCC 4EP5A 1HJOA 4JI8K 2CXEA 2GQCA 1K44A 4IFVB 4U9RA 5JVHQ 2HF3A 1KKHA 1WWHA 4ES2A 1RAEB 3MDQA 3KKSA 4AHRA 4B1ZA 5K8NA 2O8EB 2E5HA 3MMVA 1MA9B 4QPXA 5BYQA 3GZ7A 1XR6A 2LQ8A 4TYAA 1RT6B 4FNIA 4B08A 3B4MA 4ZJOA 5T7BA 2CDQA 4YOUA 3R97A 3ET6A 4I6AA 3PVXA 1DHMA 3QGHA 1S1UB 4A8KA 3OY9A 2IDOA 5LT5A 3NS7B 4RL1A 4ZLLA 3DOLB 2HBRB 2M8HA 4HH0A 2HBJA 4DU3A 6AT1B 3Q2SC 4LSLA 1R8AA 4ED2A 1MU2A 1VBYA 2A2CA 3QJJA 1LXNA 2XMJA 3HJFA 2D9OA 5DM6L 1WI8A 1CVJA 3MN7A 2K06A 1NDCA 1GXTA 4IFYA 1YJ7A 5JMNA 4DV4J 1SZ2A 3TAGA 4OKEA 3US5A 2XWYA 3UNGC 1F9HA 5G0RA 4P72A 1KHWA 2UUBK 1HNZF 3QETA 1N5VA 1JLFA 1SJFA 2DNZA 2B4VA 2QYGA 5B0EA 3MCAB 2GJFA 4JB8B 2AX1A 2WSEC 4JI8F 3TTFA 1FI4A 1NKEA 1VQ5N 2FQQB 4Q7AA 4CT8A 3GV5B 2AP6A 2QL5B 4MH8A 4AFFA 1CC7A 2PO4A 1RHMB 2DGWA 4X2BA 2CJKA 2HZAA 3HSDA 3W61A 4PL8A 4A4JA 4USIA 5J1EA 1VSJA 3ET6B 4IH7A 3A5MC 1YIJN 3V4MA 4P74A 1LW0A 1GOCA 1ZS6A 3O9UA 4WE1A 4LSLB 3BQ0A 1MU2B 1T3NA 4W92B 1WHVA 1SH2A 4TQSA 3ULHA 4LF1A 3NAEA 2ZM6F 1CXQA 2ATCB 4DR5K 4DZDA 1N56A 1FNOA 3T6JA 1F6TA 2ZM6J 3VQBA 1K47A 2EC0A 3BB5A 3UR3C 4FWNA 3L7UA 3HKZD 4DFPA 4YB7A 4OI2A 3QINA 3VEVA 3HT0A 3JSMA 1JLFB 5IOLA 4LRCA 4KGKA 3FBBA 2ZOFA 1T11A 1H7XA 3AO1A 3EZOA 3D0GE 5FROA 1RA6A 2WZ1A 4JKAA 1RHUB 2HHHK 3PR5B 2FC8A 3EZ5A 3P3DA 2QYCA 2R7OA 1SQFA 2A10A 1K8AT 3RTVA 4IXCA 1UFWA 2IM3A 5HQLA 2WOMA 1U0HB 3MN6A 2GWJA 1IM4A 4C8ZA 1YRXA 4TU8A 1TKZA 4DBQA 2D74B 2IBOA 3M2VB 4XAKA 1QQNA 5J1EB 2IVMA 4Q8EA 3UIQA 4EYIB 4KC5A 1XNRK 1FE4A 4I2PB 5L1LA 2KW4A 4IH6A 5HQMA 2R2RA 3BBBA 2V8PA 3CCUS 4D3GA 3ATUA 1QVFR 1XUPO 4LUBA 4WCEL 5KFZA 3O44A 3U6FA 4KAZA 3RBXA 2MLZA 1OY6A 1Z4UA 2X1AA 5EN1A 3WZ0A 2RHSB 1LW2A 4FYYB 2JNJA 4IOCQ 3JSMB 1ACMB 4TY9A 2AU0A 2Q31A 4X4TA 4FK2A 3NGTA 2MEWA 3PFOA 2FSKA 2CNNB 5AXNA 4GKKK 1BGXT 3ZSQA 2B56A 2HHHF 1E4GT 2R7SA 1C4AA 4O3NA 1JCFA 3WDOA 3THTA 2AJ2A 3L4IA 3EEQA 2HVEA 3NAIA 1VLYA 4LH5A 2WOMB 2RQ4A 4FN5A 1TKZB 4J9SA 2CJQA 3TJ9A 2MZRA 4WU3A 3DRXA 3UCGA 4CZGA 1EETB 3IGNA 1FK9A 2Q6CA 3TZXA 3H90A 2L9NA 2Q1LA 2NRXA 4BRCA 4DEZA 3O1BA 2B0GA 4JV5F 1M90O 2R8GA 2HRTA 1FRJA 3F56A 4FP9A 2HWIA 3C19A 4B9UA 3VGTA 4JV5J 1VQ5S 2CPIA 5I9EB 4MKYA 1FRLA 2DR7A 1Q8IA 1BOTO 3ENAA 3EUNA 1VK3A 3NKYA 4MT1A 1WEZA 2VOOA 4NXMK 1XC3A 2DT9A 4XH5A 5DRKA 2VU5A 4TY8B 1PAUB 1LW2B 2FHMA 5E3CA 2HQGA 2N3OA 1X5SA 2CIMA 3CPEA 3DC2A 1NPPA 1YIJS 1U2CA 1TUGB 4ILMA 4EHUA 3UDLA 1WSHA 1LAVA 2J6UA 2ILZA 3IP0A 1Y10A 4C9DA 3LAKA 3PEJA 5M1OA 4UQTA 4CO5A 2BA9A 1RAOA 2QMUB 2F9DA 2V50A 3OHBA 4DU4A 1TL1A 3FZBA 3MTJA 5ETRA 5KFNA 5IXUA 1XMQF 2G8VA 3A8KA 4HDGA 1DLOB 2EC2A 4IRCA 5KPZA 4CFDA 5GADU 4C7QA 1B9DA 4HR2A 3TA2A 2CDRB 1FK9B 3RMAA 1WF1A 5A6PA 2R8KA 2NXEA 2PYLA 5JS2A 2V8DA 1T6DA 3V9ZA 3R5BA 5KOWA 3R8EA 4L75A 3T3FA 4CZJA 5KT4A 1R0CB 2OEMA 4PG7A 5E41A 1TQLA 4QS7A 4JI5J 5KTQA 1YQHA 3ETOA 1WBDA 4BHQA 3RB3A 2F8HA 4OI4A 4LRBA 4LJMA 2DHGA 3BM7A 1QQMA 5GMKa 2ZD1A 4HVZA 4NXMF 1GXUA 4OL8A 4PG8A 1J9AA 2IOCA 1S1XA 2QKKA 4ZCKA 3G0ZA 4AH9A 1Q81T 4I64A 4CD1A 4H0OA 1RT7A 4JI3K 4FPIA 1HKGA 5KAKA 2AF6A 1RWPB 3OBWA 3AY9A 3EVOA 5K5MA 1GMWA 3UQSA 4NLCA 1TL4A 3S8SA 3CJ2A 1TL1B 1DTQA 3ZZZA 3UE5A 3H2LA 4HKQA 1AROP 4IOCL 3CJ1A 1RA7A 1SC4B 3ILOA 4Z37A 3PO4A 2A3JA 3TQ1A 4DQSA 4I2QA 2VH7A 1E6YB 5HROA 4Y65A 4C8NA 2QA4G 3D7SB 4U7CA 2Q1NA 2GJ2A 3H20A 1HR0J 2DTJA 4ZK7M 5EY4A 4EWTA 2RH3A 3PRVA 5HMXA 4BR0A 1ZXOA 4DL0C 2G0JA 4EBCA 3ZXWA 3IN5A 3DRRA 2HS4A 2OD4A 4E7HA 2D4WA 3SPZA 3PSIA 3KJNB 1CQMA 3H5UA 4MDAA 1S1XB 3SDEA 1BUXA 4A8SA 3OR1B 3OBIA 1WTBA 3VETA 1QLNA 4AQYF 3AH6A 2DTUA 4BQLA 3GQCA 3SZ2A 1RT7B 2JL9A 1U1LA 4QR1A 3KJVA 4M5JA 2F3JA 1WEYA 3CT9A 3SUQA 1TKXA 2NRZA 4A2AA 1UWAA 3HT3A 1GNKA 5E3AA 2J7UA 1Q8LA 3NMRA 1DTQB 3CJRA 2IAJA 4IO8A 5KG2A 3C2PA 3IAYA 5KG0A 2DXFA 3X3UA 1P90A 1N34K 4TYBA 3DRSB 4I2QB 2K7JA 1NJIO 5HBMA 2MTLA 4JBCA 4CJQA 5HROB 4Y6IA 3TA0A 4USJC 2BBEA 4H0YB 4NLYA 4JI4K 3QEIA 4IG0A 3H45C 2PFUA 1TL3A 3S01A 2M0GB 2R7WA 5AQVA 4YFUA 5AJ3F 1SB6A 4ELVA 4LIRA 3HZGA 2AHOB 1CJKA 4BY9C 3P96A 1KEKA 5KQDA 2ZHBA 5AJ3J 1T6CA 3ZT0A 1BQNB 2KT2A 3DRRB 2HPUA 4LFAF 5C0YA 1LK5A 2YKNA 1S48A 3M9MB 2AJQA 3H08A 5FDLA 3LM2A 4ID8A 3FCVA 4B9TA 4OHVA 2YQ3A 4LFAJ 3ATVA 1Q95G 5LSRA 5L39A 3SDEB 4OKKA 4MK9A 1SBRA 3M1VA 5I3UA 1T02A 4F3MA 2CFXA 4O8KA 2QWOA 5A0YA 2FLOA 1VC0A 1NSAA 3EVWA 3KJVB 1XC9A 2YKOA 4BR9A 5A8RB 1YTAA 3M6WA 1MWQA 2QSWA 2KZZA 4B9NA 4E2FB 2RUGA 2Y9HA 5LMNF 4NLBA 3NNCA 3J81O 4N41A 1WC3A 3OYNA 1NHVA 3DAWA 2R7XA 2IAJB 2WW8A 2D0BA 1N36F 5M2UA 5LMNJ 4YMEA 2IM1A 2HBQB 4E1MA 1N34F 3H5XA 1L3UA 5ETQA 5G4DA 1N36J 2YWHA 5HBMB 1HFEL 5FPDA 1VSLA 4YP3A 4H5NA 2QWPA 4Z0UA 2FYXA 4NEZA 2PMZD 2F4VF 2CPEA 1TL3B 1YGYA 1NPKA 1OJ4A 2CPYA 3VAIA 3I9V9 5FD1A 2M2BA 3RYLA 4LFBK 4ECTA 1CJKB 2F4VJ 2RPIA 4CO4A 4LF8K 1AFIA 4CGGA 4FS1A 4ZPDA 3I8BA 1FXDA 1HHQA 5FDLB 1UVIA 1FNMA 2VV5A 1VDHA 1DBDA 3D54A 4K2JA 3HHLA 3OA9A 3MR7A 5I3UB 3RGIA 4PY5A 4J9MA 2P5OA 2DH9A 3VQ4A 4A46A 4EP4A 1NDPA 5H9FK 4BRFA 4ZIVA 2XMTA 3CJSA 4CNZA 3NH1A 5KFAA 4XH4A 1U1KA 4IO9Q 1NWKA 4WYWA 2OJ3A 5B0CA 4FKXA 3AVGA 5BRHA 1S59A 4NA3A 3M9NB 2MB0B 4F25A 3WT0A 1BDGA 1F2GA 3OT9A 1VQ9N 2DY4A 1B0PA 4CECA 2XY6A 2F4FA 3DM2A 4CEAA 3DDIA 2DEIA 2ZH3A 3D1OA 2RIJA 3SMSA 3CJ5A 4DQPA 4ECXA 2OLWA 4BG9A 1DQ9A 3WXIA 3DMJA 2BZ2A 5JVGL 4DI6A 4K4VA 5AR0A 5IV4A 1WSFA 4RUCA 2HGLA 3C6HA 1H7WA 5C2CA 2HBZB 5HL7L 5LJ3Y 1TV6B 3QB0A 2YPYA 1I5OB 2ZOGA 4DCHA 2AYBA 3SQ2A 3R9LA 3IKMA 4EGLA 1HX1A 5IT0A 2I9SA 3VQ9A 4YQWA 4JI2K 4DLEA 3HHLB 2GHVC 3FGVA 1I3AA 3AAQA 1T03A 2N82B 4TU9A 3MPUB 1WBBA 2RMLA 1FJGK 1NH7A 2B51A 2MKSA 3PW5A 1IV0A 4K25A 1WD6A 3UDVA 5AQIA 3CYMA 2EBGA 3DRYA 2JEFA 4HL9A 2YX6A 3G4SN 4PABA 5CYQB 4TSXA 3ZSYA 4NLOA 1M5KC 3O3LA 4W5RA 5FRNA 1TR0A 2KXFA 2M3DA 1JXEA 5IT9O 4XEIA 3ISZA 3PRDA 4IQMA 1IVZA 3SYZA 2P51A 4B9QA 3TUZC 1K8KB 1JJ2M 2MZ1A 2FVSA 3N5FA 4Z4CA 4ETXA 1UVMA 4DR4F 2CUYA 1EKEA 4EFAC 4IOAL 4Q45A 1OKJA 4P2SA 4C1NI 4DR4J 1HNXK 3CC7N 2L3MA 3BN4A 1SI9A 4A47A 1PYTA 1E3MA 2UVWA 4M3RA 2G1HA 2R2TA 3R9PA 2KHOA 2RDDA 3IC1A 1T03B 2GTDA 2V9WA 4O3OA 2P5GA 1PIEA 1WUUA 3BY5A 3T1YF 3VF4A 1YXQA 1RBUA 1IQTA 2HMIA 1FJGF 4F26A 2Z58B 2E1RA 3T1YJ 3C6AA 4LF4K 3OYLA 3U02A 2I7NA 4FK4A 4ILGB 3AVIA 4FYXB 2IDLA 2BMBA 5DG9A 3L8BA 4CO1A 1NGJA 4U95A 2RS2A 1Q78A 5HO4A 2G1DA 2JFDA 1F0XA 3PYGA 4ZVSB 2O3DA 5A8WB 3DI6A 3ALYA 5E33A 2HRYA 3GL1A 4HDHA 4KH0B 1Q9YA 5F1XA 3QERA 3TAQA 2CA9A 1HBOA 3Q23A 4BRGA 2DKOB 2YY3A 1K9MO 1RTJA 2V7ZA 1HYZA 5AQNA 1X4CA 3X1LB 4KSEB 3OW2M 3KHHA 3OVAA 1UVLA 5B8HA 1U02A 4DTRA 5CZVA 2GGPA 4KGMA 2HS3A 2Z2MA 1JIHA 4KJIA 3OYDA 4FJHA 3W64A 2PFFB 1VQ9S 2K7KA 2B9XA 2C3MA 4A57A 3M32A 4NXNF 5LSLA 1RNHA 1P1TA 1YJVA 2HMIB 4ISEA 4DR6F 2FY1A 2HNZB 1HPMA 4NXNJ 1BQXA 2DFEA 4M3TA 1L5UA 1L3KA 4DR6J 4LF9K 1RU2A 4FJLA 2F96A 5IM0A 3QO9B 3ONQA 4FYVB 3ZZ0A 1XNQJ 3T5LA 2PA3A 3EPGA 5KGWA 3MEEA 3CDUA 4MK7A 2W24A 3H2VE 1FDNA 3JTNA 3NDKA 4KREA 5KGXA 4BRDA 2CNLB 1J5EJ 2OTLN 1MWZA 1U25A 2ZH5A 4FO0A 3G9CA 2XMKA 1NSQA 3J80O 1CJTA 4FZVA 1RTJB 2B7BB 3JTPA 2KN4A 2Z1JA 2OZSA 2GIQA 4C48A 1I3OB 2D3ZA 2LXFA 2R8JA 4ENOA 5HOOA 2IJFA 4XH1A 3LPTA 2GGPB 1AB8A 3N9UC 5AQGA 1RGVA 3W7BA 3G4SS 1JNZB 2YJFA 3CG7A 4OYMA 2GNKA 3M32B 3MMJA 3QESA 1VFJA 3QRRA 1LFPA 3R6GB 3FMBA 3S3MA 4DTOA 3L6QA 3DN9A 3K59A 4K4TA 2ZJPQ 3G87A 3QMQA 4JNEA 1KOOA 5T41A 5C7PA 3S1TA 1ZOTA 5GIPA 1IWGA 2BM0A 3FCHA 2MMYA 3ZTSA 2YX1A 4L6V3 5GMEA 2V4RA 5F8IA 4WZMA 1DJ0A 2HBYB 3CC7S 2B9YA 1FRXA 3OTOF 2LFVA 2RILA 4KHPF 3OTOJ 1NOZA 3HP9A 3KHRA 3ICLA 3M3ZA 4KHPJ 1GEHA 4MAKA 4JD2A 2CGJA 2VQEK 3CUNA 4KTZA 1V5VA 1CJTB 5DM7Q 3L2RA 2JDJA 4CLLA 4LQ3A 1HLUA 2CPXA 3VEWA 2O66A 4Z7YA 1HNWK 4P52A 1ZBSA 4OX6A 2ACYA 4OIXA 2QLWA 3KNGA 2EWSA 3IG1A 3W60A 1IBCB 2HK3A 1SIWB 2FJBB 2ITGA 4C8KA 1QUPA 4FS2A 2GIFA 1S12A 2HLTA 3ZZUA 2Y8YA 4V19J 5BXIA 1RCHA 2UXBK 2Z57B 2MJNA 1S57A 2HZCA 3QBXA 1RWWB 1N4LA 5D0GA 2N4DA 1Y97A 3SQOP 4S0MA 4RW9A 3TQEA 3ZSRA 4CJKA 2ZKTA 4BRPA 3L7OA 4FK0A 1IBLK 2O4GA 5AQRA 4E0DA 2CQIA 3E9PA 1IKWA 2FDNA 1RP5A 1X60A 3PSFA 1UKUA 3BGLA 3EZUA 3AAWB 3WNEA 4JK9A 4OYAA 1NM1A 4CLZA 3P8BB 3F0NA 1D9FA 5ADZA 3IO1A 4EBEA 5IWAK 4JD2B 2AGOA 2VQEF 2FLPA 4KAIA 1TU0B 4CCHA 3MM5A 2A2DA 4WFNL 3AAPA 1O51A 2OPQA 1NHKL 4FYWB 5AQWA 1S4FA 5J2PB 4IFEA 3IG1B 1H0HB 2LU1A 2OUGA 2A41A 2BACA 5C12A 1S1TB 4Y2KA 3SUNA 1XEZA 4BR4A 1N33K 1BWEA 1Z25A 3OXGA 2UXBF 5F8GA 3CDEA 4IQXA 2MKYA 2B7CB 2OTLS 4JK8A 5H9EJ 2F40A 8AT1B 1VBXA 2XI3A 5GAEP 2I38A 3TX8A 4FJ7A 3U1NA 5HSPA 1RAAB 4DS5A 4RW9B 2IFXA 5DZ6A 1I1GA 4DV7K 2DY1A 3CJBA 1IKWB 2CWXA 1X4GA 4EO8A 2DITA 2FJVA 4PL7A 4M63A 4CM2A 3R7SB 4GVBA 5LXYA 2YWEA 1U49A 3I0SA 4Y0WA 1AT1B 5CZ2A 1GX6A 3E51A 2IY5B 2MQMA 1MNEA 3A5LC 5BPNA 5HK4A 2CPJA 3ETMA 3DHXA 3BV8A 4DL5A 3W65A 4EMDA 3V6JA 5F3TA 3MM5B 4DF4A 3W62A 4XPEA 3FK4A 3FVYA 2DGUA 4LVNP 3CI5A 2MQOA 1RLDA 1GH8A 3WC0A 2CZ4A 1S6QA 3WIUA 2MSSA 4G1PA 1QAYA 4KTQA 1G4CA 2Q3SA 4DFJA 2OI2A 3QEVA 3KNAA 2GBZA 4FLVA 3FRYA 4NEYA 3VEZA 2NSBA 3MR3A 2NUHA 4UZCA 1RACB 2IMWP 1WOSA 1Y3KA 1RWXB 4NLRA 2FZGB 2OA8A 1VSHA 2UUCK 2J8AA 3FZHA 3UW1A 4RWTA 4JI0K 4NCGA 5ETMA 2V2VA 1RBLA 1Y11A 5D8HB 4U6PA 1IR1A 2CPHA 3I0SB 4CJSA 2J0SD 2VASA 3SQ4A 1X4HA 1S6OA 1U26A 4P71A 2OKQA 3QATA 2BQ3A 3BBFA 3BP8A 3OTCA 5H1SV 1JLGB 4DPXA 4TLRA 1WACA 3IRXA 1H73A 4OYBA 1SKWA 3TVYA 2CQ1A 1U2FA 2QT7A 4GV6A 2FF3B 4M3YA 3I4HX 4L3NA 3AV9A 1Q7YO 4NLDA 3THXA 4GV3A 4PEOA 4GVEA 4NPOA 1S6QB 2ZEJA 3V81A 1S6PA 3QGPA 4IOBA 4ZIWA 3QWUA 3BBCA 3CHWA 2BKPA 2DO4A 4DF8A 2OAUA 5KI6A 4F2SA 3DRPA 4DKWA 3VQAA 4FW2A 2NRVA 1WNSA 3QMLA 2PN6A 3TTCA 4YEAA 2ZGYA 4AD6A 1IQZA 1U0SA 4N8NA 5AFUH 5D3GA 4LIWA 2RAQA 2ITMA 1ZETA 4DSEA 4W5OA 4O5FA 1PJ5A 2XI2A 1V3ZA 2P9UB 1J2VA 3SSRA 3BUZB 5LOQA 2YQ0A 2A1SA 2PZSA 1NAQA 1SL0A 3ZSZA 4NCGB 2P9GA 4TN2A 2XB2D 3R5CA 2MHNA 3VTIA 1NMEB 5CYMA 3M1FA 1NZ8A 3S9HA 2NRTA 1NK0A 2JC1A 3FZMA 4LF6K 2DR5A 2VWBA 2GVDA 4BRKA 4E7LA 3TJ8A 2WVBA 4PYAA 1BWFO 1X4BA 3IRXB 2CRLA 3EYZA 3CO0P 4PHTX 1FFSB 4NMLA 5DK5A 4MQ3A 2XZWA 3IUCA 1HUXA 3OS0A 2WRMA 1HYSB 1NCLA 2DIUA 1GMWD 2D5RA 2DFHA 2HSTA 4HT5A 4FJKA 2QGFB 4K42A 4I56A 4H0XB 4B1UB 4I0WA 2C2EA 4JAXA 2XTJP 1T8EA 3PW4A 1RWVB 4CVNE 1SPBP 5DGBA 3PX0A 2RKIB 4G6VB 1Q9XA 5ETLA 4Z2XA 1GTHA 2BVZA 5JICA 5D3GB 2UUWA 1IJFB 2CZVC 2DRBA 3MEGB 3EDRB 2DPIA 3LALA 5KFSA 1FNXH 1W2BM 1R27B 4F4ZA 2DB1A 4ZN3A 4OX9K 1JLCB 4ZCIA 1UVJA 2MZTA 1QM9A 1XMBA 2GVDB 3A5OC 1N48A 4RZRA 4DQIA 4KE5A 1RT4A 4PXEA 4CBWA 2JSXA 4FWMA 3SFUA 3KZBA 3EL2A 2X1FA 4KRFA 5C5JA 2VIHA 3QWPA 4PKDB 3UPFA 1P6TA 1NPRA 3E8OA 2VGMA 4B3OA 3MR6A 1NNEA 1T9XA 1Q7LB 2OEJA 4NLWA 4FJIA 3WIVA 2Q0UA 2YHYA 4ZCMA 2O01C 1X4EA 2DH7A 4P9SA 2FIUA 4UTGA 3M2UB 4OLBA 2I0XA 4F9OA 1MLAA 5HVHA 3CXCM 5GAEI 2ATLA 5IV3A 3NS5A 3SQ0A 1OQ6A 5DDQC 1U1PA 1PAEX 4J9UE 5D4PA 2NPFA 4CZMA 3PDNA 2P6TA 4J5OA 4FWKA 3C8YA 4X4VA 4DV0F 4QR2A 2NREA 1RT3A 1QZ6A 5C2DA 1C0TB 1REVA 4CI0B 4DV0J 2HK2A 3V2UC 2P9LA 2ZBPA 3M6XA 3SBTA 3VALA 4NZ7A 3PR4A 2UZAA 3R7NB 2I6WA 1HHTP 4J9RA 4ECWA 3DLLQ 2XMMA 4DJBA 4RBVA 1RT4B 3SPYA 1G6BA 1MROA 3R3LA 4IUFA 3LGNA 5BR8F 4B3MF 2Q97A 4ES3A 4JKFA 4DV3F 3L2WA 4FLTA 3HCXA 2FY8A 4B3MJ 2G8IA 3IS9A 4DV3J 1G1XA 5C2GA 4K4SA 4B3OB 3QFUA 1TUWA 3VQ5A 2DCLA 1I94K 2RSQA 4ZP7A 4HTUA 3RAQA 3NGUA 1S9GB 4WQ4A 1Z26A 4USTA 3DJCA 4KQZA 4DL3A 4ER8A 1VOMA 3VVTA 4OJRA 9ATCB 4A8OA 1T9UA 2RU3A 4WIIA 2U1AA 2HS0A 3SV3A 1RT3B 1SCJB 3BGOP 2YX7A 1XR7A 1X5OA 4LSZB 1JL1A 1ZZNA 1OH5A 4DV2K 4DX7A 4DTNA 1S76D 4K2XA 3HOTA 4KHRA 5F8LA 2QX0A 4CI6A 1N0VC 1HWJA 1S0NA 4QU7A 4M63C 3DXMB 2XSFA 3HHLD 4CH7A 2Z8QA 1GLLO 3G71N 2DXEA 2QIFA 2FHJA 2LEAA 3GFXA 4MKVA 2VC0A 2O8FA 2GELA 1DQAA 3IS9B 1IBMK 2FJEB 4NA1A 4ELTA 4FWOA 4WXWA 3N01A 4CIEA 5J1PA 3VERA 3W1YC 2BANA 4FF2A 3MFIA 5M1NA 2HG4A 3CFOA 4NLSA 2OHDA 4BC7A 4DPUA 4X62K 2QA1A 4IRDA 3B6PA 3F44A 4FLUA 1C4CA 4L72B 3CD0A 3VEOA 2KT3A 2GZOA 2DNYA 3VEYA 2EKNA 5SZTA 2H9ZA 3I5AA 4H0VB 5A2QO 2W2NP 3ID8A 1FRKA 5DQGA 5JLFA 4LFCF 2ZOMA 3DFEA 3T5HA 1M1KT 1XQSC 1AZSA 3ENBA 3WXMB 1U1NA 4DR3F 3I4PA 4OGCA 1DY3A 4LFCJ 3L4BC 3CFRA 3CCTA 2DK2A 2BEFA 4DR3J 3ZEUA 1BG3A 4HHTA 4CRJA 2V4JA 2RRAA 1QTMA 1IJJA 1YJWN 1LEOA 2OTJN 1SJ4P 2Z1HA 2VQFK 1NGBA 4U67Q 4BC2A 4KBIA 2KO1A 2GIRA 4WU2A 2R4FA 3TTDA 1RT1B 2KI2A 2UXDF 1RADB 4NASA 3BO3A 3T5KA 1GLCG 2YHWA 2FPHX 4OYOA 1VMBA 2UXDJ 1G15A 5AQHA 2O8FB 2I5JA 4QWCA 4YDUA 1RAGB 4CJUA 2W4CA 5F9LA 1YRUA 5LY3A 2F8SA 5KFXA 3VF0B 4FXVA 2BTFA 3Q8UA 4NCAA 1GK8A 1M1GA 2EK1A 3FGUA 2UXCF 4HHUA 1KTVA 3GYNA 1EWRA 3J7A1 4HHHA 2W9BA 3OR2A 2WVEA 2UXCJ 4X4UA 4AXIA 3JAMO 5IQ6A 2PIIA 1R3NA 1RTHA 2D41A 2XZDB 3CSKA 1H74A 4ETZA 4YB1P 3CDAA 3OFFA 5F0WA 1OSCA 3AA9A 2E9ZA 3ZEUB 1CXUA 3HSJA 4HEA9 2V4JB 3K5OA 1NNDA 2FJWA 2AP1A 2VD3A 4IR9A 3A5NC 1KFSA 2WVDA 1NKBA 3ZSVA 3NRBA 1KVCA 1CZBA 1QVGM 3M30A 3TX0A 1R8PA 3TWHA 3MF5A 1W2IA 5E3PA 4CF2A 2XG8A 3ZX3A 1QQCA 1EP4A 1YZ7A 5KFPA 2IBKA 1CS4A 4WJBA 3KDOA 2IVPA 3H4BA 1BE4A 2I5JB 4NB4A 2IHR1 5KG3A 1U1RA 3BR8A 4RUBA 3G8SA 3GFYA 4F3OA 1RHRB 4PUOB 3PNIA 4KKOA 1FXXA 1N32J 4KH1B 4O3RA 4X64J 1X5TA 5C42A 1SJQA 4RNMA 2W25A 1UJ4A 1DRZA 2Q79A 3QBCA 4C3KA 3QT8A 2F5GA 1U7LA 5I42A 1WELA 2LQBA 1M5SA 2HLUA 1V3SA 3OR2B 2W9BB 4R79A 2G8FA 5KT7A 1XMOF 1VI7A 4WXOA 4B3RK 3G71S 3ENWA 4FSVA 5LMUK 1X0PA 1NGGA 5EOYA 1XMOJ 1UVKA 2A6AA 2QN6B 2BV3A 2ZWOA 1EQ0A 3LP2A 1QE1B 5DJBA 3A1YG 4OVLA 1RBTA 2BE9B 4X66K 3BSNA 3MM7B 1KWMA 4JI7J 4CF8A 3J8AA 2HHXA 2F1FA 1WC6A 2IRYA 4P10A 3CWJA 3M30B 5E3QA 1B92A 5DG8A 5KFRA 4DV6F 2RDJA 4N47A 5L46A 4A8MP 7FDRA 4LF5F 1SV5A 4DV6J 1R8HA 3U4LA 1K0VA 4IKAA 1CS4B 1KDNA 4LF5J 3NG8A 1J54A 3MXIA 3NXZA 1RYRA 1UA1A 1KD1T 4ERDA 2KJWA 4P7VA 3QFPA 2RVJA 4KKOB 2KJVA 4DN0A 1EO1A 1RJJA 2LMIA 5C42B 2QFJA 3LOUA 4OGEA 2ZC4A 2VG6A 1NH8A 1YJWS 2OTJS 4HACA 4MIAA 1M5PC 2DHAA 5I42B 2KM8C 4DCPB 4BWMA 4BS2A 3O3FA 2W9CB 1ZA1B 1SL2A 2QV6A 3H8YA 1DAXA 1GX5A 3DLKA 1F5BA 2KFNA 1IBKF 2OPSA 3QYYA 3O4QA 3RZAA 1IH7A 4WFAQ 4ZVPB 2ZH1A 1M5HA 4E98A 2AA4A 1T9VA 2LQ9A 1IBKJ 1QHTA 3VF6A 1Q82T 1UAWA 2A1BA 4URSA 2ZHAA 4JN4A 4Q43A 5ELZA 1LK7A 5BYRA 1CC8A 5B7WA 4ZJLA 2GUPA 1QD1A 2KH9A 1FWPA 1FD8A 1H98A 3H42A 1EZZB 2J9CA 3NF7A 4BRMA 1K1SA 2UVRA 4O0JA 4Y2MA 5SWMA 1SV5B 4B3TK 4QQBA 1WG1A 3U7JA 4ZLJA 3Q8RB 4KV8A 3NGYA 3Q0AA 1MG7A 3J7ZT 4ZTFA 4USMA 2FZCB 1LWEB 4ZPTR 2DPNA 5IC4B 4BVPA 3H46O 2CQ4A 1RK8A 2V4QA 2XMWA 4XPCA 5F3ZA 2VG6B 4O5BA 3MUVP 2IC3A 2JLGA 5FPMA 2HSEB 4HACB 4JKBA 1WDTA 1TYQB 2DISA 5DDRC 3CERA 4G9ZA 4RNNA 3P1GA 2YWGA 5GAGP 3LP3A 1LQ9A 3AVKA 4HUGA 3DLKB 3GV7B 3FZFA 1OO0B 3JQMA 5HVGA 1A5VA 1YTYA 2FGOA 4FL9A 2C2KB 4JP8A 3E66A 2COLA 3AD7C 4LR7A 4R5PB 2EFPA 1JK9B 3KLGB 4ZVGA 4QS8A 2A1RA 3B6BA 4OZNA 3MPYA 1EHWA 2QSFA 4XO0A 3B8HA 4IO1A 3K9JA 2WVFA 4M5DA 2ZDOA 1WC1A 4QIWD 3VGKA 4K41A 3UO0A 4EI2A 1UFKA 5KT3A 2WCXA 4WFBQ 4CGJA 3MM8A 4YY3F 4RR5A 1GLFO 2ZDPA 1H6KX 4KV8B 4DV1K 1JXBA 4EZ6A 5J2NA 2AYMA 4YY3J 4JI6K 4CWBA 3GIMA 5AQXA 3ILIA 2FXUA 3HPGA 4FJ8A 1DTTA 2H5JB 2B4UA 4DPTA 2LU2A 3CNQP 2IC3B 2OH2A 1UOCA 4LR8A 3D0HE 3W9JA 2RQCA 4BROA 4DR2K 3HSCA 1OH8A 3M8YA 1MDUB 3DOKA 4ICLB 3FE1A 3MCNA 3PW0A 1Y0HA 3QT5A 3TVZA 1JXLA 4HCCA 2MQQA 4QWEA 3MUMP 5KRSA 2H3EB 2MKJA 4MMOA 2JHEA 1HKAA 5HVFA 2FBVA 1RHJB 4WKRA 1BA0A 4DN9A 4CJ5A 2KXHA 1YJTA 4NRTA 2GV9A 4DUTA 2GJIA 4OI3A 2DRDA 2ZHOA 3NEKA 3KHLA 1WAJA 1N8RT 5EUHA 5GAEU