3V6DA

Crystal structure of hiv-1 reverse transcriptase (rt) cross-linked with azt-terminated dna
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
555
structure length
555
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
total genus 147
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v6dA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v6dA05
1EETA 3Q8QB 2JEJA 3G6XA 1Z26A 1WSIA 4NLPA 3OYLA 4NLGA 3LP3A 4TXSA 2UVUA 3T5LA 4KREA 4CJUA 2P5OA 3HYFA 3NKYA 3SCXA 5KFRA 2XHBA 2OPPB 4IG3B 2D3ZA 4N5SA 1ZBFA 2WOMA 1S0MA 4H8KA 3VA3A 3LP2B 2B5JB 3V6DA 5KFDA 4CJFA 1RTHB 4R0EA 1N6QB 3AA5X 3JSMB 1R0AA 3HXMA 4EO8A 4ECQA 4CHQA 4CEZA 4FLXA 4NLYA 3PUFA 3VQ4A 3G10A 2I5JB 4TQRA 4CGHA 2G8HA 4JS5A 3FQKA 3O3FA 1RBTA 2XY6A 4PUOA 3OYNA 4Z4FA 4B8CA 2PY5A 3NE6A 2ASDA 1VSIA 3QNOA 2D3UA 4K4ZA 4K4UA 3ZSQA 4Q5VA 4WFYA 2IAJB 3LPUA 3SV4A 3LP0B 5KFUA 4AHVA 5C25B 1S1VB 3NGIA 3KLFA 4PWDA 3BGRA 5CYMB 5KFCA 3KK1A 3V6DB 4MIBA 4FXDA 1RT6A 4G1QA 1RDRA 2KZMA 4RW9A 2W8LA 1REVA 3SQ0A 4DTUA 3ZT1A 2R8IA 5DG9A 4CJLA 3OYCA 1KSPA 3LDSA 3OYEA 3P5JA 2D41A 1XHXA 4AHUA 1KRPA 4FLVA 4OLBA 4KTWA 4KHQA 1KLMA 2P5GA 4ECSA 1BISA 3RAQA 1IKYA 3DYAB 4WZQA 3I5BA 1RT1B 1TL1A 2YKMB 5DLFA 2ILYA 1QHTA 1HQUA 1QUVA 4ZVEA 5KFMA 3OYBA 3SUQA 3PW0A 4OVLA 3DRPB 4DTJA 1VRUB 4BDYA 5KFWA 3AA3A 3ITHB 4F3OA 5KFFA 1RTJB 3M9NB 2FBXA 1RTDA 4NLRA 4FK4A 3KK3B 1EKEA 5KG1A 1YVFA 3PJWA 4DQPA 4WXWA 2OPQA 5C42B 1FK9B 1HYSA 4TSXA 1IKWA 2RKIB 2XRIA 3DM2A 3IRXB 3V9UA 4MKAA 1L3SA 4CIGA 2BDPA 1HNIB 1MU2A 4QWCA 1TQLA 3AA4A 1JXLA 3KLFB 4DL4A 4O3OA 2R8JA 4RW8B 3MR5A 3AV9A 2DPIA 4B9UA 2W9CB 4JS4A 3KLHB 1LW2B 3IS9A 1RNHA 1TK8A 1VSLA 4J9LA 4WE1A 2V4QA 2YHAA 3EZUA 3I0RA 4H4OA 4FW2A 4IR9A 1XC9A 3VQ7A 4DSFA 4ZVFA 4DQRA 3MECB 3NH1A 3HPHA 3ZSOA 4CJ5A 3QYYA 3SI8A 4O4RA 2D0BA 2EHGA 4AHCA 4ED0A 2WONA 4FJGA 3OL9A 4ID5A 5E41A 4YFUA 4KHMA 1D5AA 4WYWA 2ALZA 4YMEA 3IG1B 2W9BA 2XY7A 2WCXA 3V81A 4CF0A 2BR0A 2E9TA 3V6HA 3OYMA 4RW7A 3T5JA 4KI6A 3ZSXA 4IQXA 1QSLA 3LP1A 5I42A 1S1TA 3M9MB 2RDIA 1S1WB 5F8LA 4CJVA 4DU1A 4BDZA 2HW3A 4K8ZA 3RTVA 4NCGA 1QE1B 4FJKA 1JX4A 5DQHA 4DS5A 2AQ4A 4B9SA 4CEAA 2HWIA 3MFHA 4CGIA 1TKXB 4O3QA 4CK1A 1NK7A 3PVXA 4NLOA 1JLCB 4FZYA 4YR3A 4ZHRA 3HT3A 4CJQA 5DK5A 4WE1B 1C0TA 4DG1B 1RAJA 2G8VA 4Y3CA 4QPXA 1RT3A 4ECRA 1EXQA 3OSPA 2IA6A 4TQSA 4BACA 4E0DA 2HWHA 4JRQA 3PX6A 5J2QA 4L8RB 3GIKA 1RTIA 3RB3A 2GC8A 3QO9B 4YNQA 4R8UB 5EU7A 5HROA 3SUPA 3BJYA 4E1MA 1VSMA 4CFAA 4K4TA 3BREA 1OS5A 4PY5A 4ED7A 4KHSA 3L2UA 2YV0X 4BE2A 2DPJA 1TKTA 3SI6A 2HNYB 4LSLA 1ZTWA 1S97A 4J2EA 3LP1B 2I1RA 1S1TB 4C8MA 4RW6B 2HVIA 4ELVA 4DTOA 2KZZA 4KO0A 4O3SA 4B8AB 1BL3A 4CJ3A 3FQLA 2AX1A 4EZ6A 5HP1A 2RPIA 1NJYA 1XR5A 2UVRA 4J2DA 4TYBA 1S48A 4DF8A 3SFUA 4GMJB 3AO2A 4AHTA 3HKWA 4B3OA 4KTQA 2BRLA 3MXJA 3SYZA 4J2BA 2EX3A 4X2BA 4KHNA 3KD5E 1VSKA 5KGXA 3GIJA 4IOBA 1HQEA 5J1EA 1C0UA 2J6UA 1QS4A 4KBIA 1KHWA 2QV6A 2IM0A 1RDCA 4N56A 4MFBA 4EYIB 3BR9A 2HAIA 3NF7A 3MXIA 2DFFA 3PV8A 2YNHB 4H4MA 1NK5A 2BANA 3N6LA 3L3VA 4CESA 5L1KA 4G3IA 3NBPA 1I39A 4CIEA 5DGBA 4QW9A 1VSJA 3DRRA 1WN7A 1U47A 4JV2A 2G8IA 4ZPBA 3C95A 2C2RA 2XY5A 5J2MA 3PX0A 1WAJA 3OVNA 2BE2A 4IFVA 1WAFA 1TKTB 2V0NA 5KT7A 2R8GA 3OYKA 4KHWA 1F21A 3NF6A 1JLBB 4NLWA 1NNDA 1JLFA 3BQ2A 3E01B 3GV7B 1UOCA 3LWMA 2LSNA 1QSSA 3OLAA 1S1XB 5K14A 5HLFB 1I6JA 2F8EX 3I0SA 2FJXA 4Y2AA 5DGAA 1S9EB 2C2DA 2VWJA 3C6UA 4J9NA 1NKCA 2EC0A 1BQMB 4KB1A 3AVLA 4Q0BA 4ZVGA 1RBRA 1S9GB 4CF9A 1RCHA 4O44B 4CF8A 3T19A 1QTMA 2B4JA 3QEXA 1X1PA 4KKOB 4N41A 5DG8A 3H5SA 3DLEA 1S5JA 3BSOA 4CGDA 5FRMA 1B9FA 3M8PA 1UWBB 2FBYA 2WK4A 1ITGA 4DFKA 3TARA 1S10A 2KTQA 4FLTA 1IG9A 3ZSYA 3ZSWA 3K5MA 2IM1A 1LWCA 3PR4A 3ZT0A 2IJNA 1NHUA 1IKXA 4NCAA 4Q43A 4XO0A 5CYQA 3QZ7A 3MEGB 4LH5A 4CHOA 1ZBUA 2GIRA 1SH2A 5J2MB 5DQIA 2D7SA 4I7FB 2BE2B 4I2PA 5F8JA 3DMJA 4YR0A 2IDOA 4JUZA 3NMAA 1RDBA 3KTQA 4F3TA 5F8GA 1MMLA 3E51A 3NGDA 1FKPA 3O4NA 2AGOA 2OPRA 1TVRB 5KFSA 2V9WA 1L3UA 2FBVA 1YTUA 3N6MA 4FZXC 1A5VA 2BQ3A 3C6UB 4FJXA 3QEPA 3HK2A 3JYTB 3MEEB 1S0OA 2RF2A 1TAQA 3OL7A 2OA8A 1CZ9A 2Z1IA 5KRSA 3HHKA 2ATLA 3RR7A 1JLGB 2IC3A 3KK2B 2VG6B 4ED6A 2ZD1A 4ECUA 2F8SA 4F4YA 1S6QA 2DY4A 2HNZA 3AA2A 3M8PB 4KTZA 2B43A 3H08A 5L1JA 4RNMA 3L2VA 1KLNA 3RB6A 4KFBB 3HVTB 1RYSA 1J53A 3V6KA 3GQCA 1JKHB 4FM2A 4CCHA 2IM2A 1UA1A 5EWFA 4DSLA 1WLJA 1JLQB 4FJHA 4O4GB 4OLAA 4IFYB 4DL3A 3L8BA 1XR6A 3IGVA 1DTQA 2O5DA 3K5OA 1W25A 4DQQA 4U7CA 1IKVB 3L2RA 2WTFA 2KW4A 4Q8FA 3WNFA 1KTQA 1HPZA 2QKBA 3AO3A 5T7BA 4DSJA 4DL6A 2FVQA 4U6PA 3V1QA 2HHUA 4DSIA 4CGFA 3CG7A 1HNVA 2YNFA 2HMIB 1TL3B 4FJ9A 3G6VA 4QWBA 4EEYA 1K6YA 5CZ1A 2IJFA 1JLEB 3MEDA 2ZD1B 1DLOA 5KFNA 1IO2A 4IDKA 3MR6A 2YNGB 1DTTA 3KLIB 1SH0A 4HHTA 3DLBA 4QWEA 3T3FA 3P83D 4CJSA 1EETB 4F4XA 1KVCA 5FDLA 3VQ8A 4ZTJA 4DTNA 4E1NA 1W9HA 4Y2CA 1RDAA 3KKRA 4F2RA 2ZE2A 2R2RA 1CXUA 3AVFA 3OJUA 3SQ4A 2XI3A 3CVKA 3M8QA 1N48A 1VRTA 2WOMB 4QWDA 4CIFA 4ZTFA 2R8KA 5KTQA 1GOAA 1ZBLA 4EP4A 4FM0A 3DRSA 3G6YA 1RT2A 4CGGA 4EYHB 1EX4A 4E7IA 4DF4A 3CWJA 4AHSA 5KFZA 3SQ1A 1R0AB 3HM9A 3QGGA 3H98A 3DLKA 3D45A 2P51A 3LZIA 2KQ2A 5KG5A 4IRCA 4K50A 4RNOA 1T03A 3TAMA 1EP4A 4KHYA 2IM3A 4I2QA 2AGQA 1S6PA 4O3RA 4Z4GA 1GX5A 4C8OA 3H59A 4PUOB 2E9RX 1XI1A 3H40A 3MEDB 2UVVA 4DL2A 1LW0A 2AGPA 4R5PA 2ATQA 5DQGA 5J2PA 3I8DA 4TN2A 1T3NA 3SPYA 2DFHA 2B6AA 2DFEA 2CJQA 5HBMA 3PW5A 3EYZA 1XR7A 5D3GA 3AVNA 2V4RA 3KHRA 4IG0A 2X74A 3OJSA 5KI6A 4ECVA 4PQUA 5C24A 2ZE2B 4LQ9A 4Z4IA 3AVMA 1WNEA 2C22A 4PWDB 3DOLA 3BGRB 3N6NA 3QIDA 5EWGA 3MR3A 3V9SA 3LALA 3KLVA 3KK1B 4LQ3A 4HTUA 4N47A 1C1BA 3UR0A 4B9VA 1RT6B 4G1QB 2JEGA 5KFGA 4RW9B 1KVAA 2GV9A 3QGHA 3QIOA 2Y1IA 1REVB 4CGJA 1X9SA 1LAWA 3NF9A 4CJRA 2FVPA 2E4LA 3FFIA 3OYDA 2BGGA 3NGYA 1RYRA 5JS2A 1KLMB 2R8HA 3D5MA 1NOYA 3V1RA 4E89A 1IKYB 3KIOA 3S3NA 2VA3A 1S6PB 4XPCA 1TL1B 2G8KA 4KAIA 4FS2A 1ASVA 4DTPA 3PO5A 1A5XA 1HQUB 4ID1A 3SUOA 3MTKA 3LWLA 3BSNA 2RN2A 3GYNA 1C2PA 1TKZA 3UPFA 2XY8A 3K2PA 4CFCA 2P1JA 1FXXA 5F9LA 3QLHA 1WSFA 3KHLA 1RTDB 3K59A 2B6AB 2FBTA 3VQSA 3SQ2A 4J2AA 2PYJA 3KOAA 4CEEA 2OPQB 1HYSB 3K58A 5T14A 1IKWB 3Q8RB 4RNNA 1TK5A 1NOZA 4W5QA 4FJNA 5JUMA 3DM2B 3SPZA 4FLZA 1MU2B 3TAGA 1I3AA 5KFEA 3OYIA 1BQNA 4J9OA 1Q9YA 2OPSA 2XCPA 3VQ6A 3IS9B 1ZTTA 3SJJA 2O4IA 4ED1A 4I9QA 3I0RB 4H4OB 3QEVA 5KFYA 3AVCA 4LSNA 4CJKA 1SUQA 4FVMA 4OJRA 4MIAA 3QGIA 2WONB 4C8NA 4ID5B 4EBDA 1WSGA 2HHWA 2W9BB 2X6SA 1FKOA 1LWFA 3V81B 4IH5A 1SKWA 4ED8A 4M3UA 2HHVA 1VSDA 3AVBA 2R7YA 4MK8A 4ECXA 3SZ2A 5CY4A 2Z1GA 4RW7B 3F9KA 4F50A 3AO4A 4KV8A 3U6FA 4WFXA 2VWKA 4F4KA 1J5OA 4J9PA 1U04A 4M3WA 5I42B 4O0IA 5FRNA 1SKSA 3TAQA 3S3MA 2GUIA 2E9ZA 4GVMA 1QAJA 1S1UA 2YNIA 4AH9A 1JLAA 4NCGB 3RR8A 2RDJA 3GILA 2HNDA 1U48A 5CZ2A 4RG8A 4CJPA 4YQWA 3AVAA 3PJXA 1TV6A 3AO1A 4NLVA 5JS1A 5L9XA 3VQDA 1T05A 5KRTA 3OYAA 2OPSB 2E6LA 4NLSA 5HRSA 3RBEA 2ILZA 1TKDA 1C1CA 4ZHRB 2YHBA 3H2LA 3OYJA 3TWHA 1Z25A 1C0TB 3U3GA 3PZPA 1RT4A 4ICLA 1RT3B 3V6JA 4OGCA 3TI0A 3OSNA 4OL8A 4DFPA 4CERA 1WSEA 1YT3A 1J54A 5I3UA 3LANA 3OS1A 1WSJA 4HCBA 4MK9A 1SUQB 3QEIA 4RNHA 5J2QB 3WNEA 1RTIB 2FJVA 3CJ0A 2GIQA 4FBTA 3B6OA 4B9NA 1JL1A 5HRPA 2ITGA 1S49A 3VN5A 1SL2A 2VG7A 1FKOB 5HROB 4ZP6A 3OL6A 3H5YA 4CHZA 1LWFB 3K5NA 4CJEA 3VQPA 4WXOA 4CEBA 3CJ2A 4OKJA 1RA6A 5F8MA 4EZ9A 4O0JA 4NLTA 4FBUA 1B92A 1C0MA 2QK9A 1HYZA 4LSLB 4QAGA 2FJWA 1Y97A 2QE5A 4KO0B 2CKWA 3L2QA 2R2TA 4EBCA 3KD1E 3OHBA 3OY9A 1S9FA 5HP1B 3C6TA 3LAKA 4HUFA 1RBUA 1J9AA 4OGEA 1N56A 1LWEA 3TR8A 3T5HA 3RB0A 3KKSA 4RW4A 4B3OB 4FM1A 1RT7A 3UQSA 1HMVA 4K4VA 2ETJA 3L3UA 3HVAA 3NGZA 3KLEA 2KFNA 2KFZA 3H5XA 4HUGA 3NAIA 2R2SA 4FJ8A 1HQEB 5J1EB 1C0UB 4TY8A 3MAQA 4OKEA 1TK0A 3RB4A 2J6TA 2AU0A 1L3VA 1HARA 4MFBB 4MH8A 1BHLA 3L2WA 1RA7A 1K1SA 4W5RA 3DLGA 4J9RA 2VG5A 4GC7A 4CFDA 5F8NA 2BRKA 4H4MB 4DU3A 2BANB 3CJ4A 4IKFA 1CXQA 3OS0A 2G8FA 4CEFA 4Z4EA 2D0CA 3HP6A 4KI4A 2JGUA 2QKKA 3NBPB 2JEFA 2VG7B 3DRRB 1BI4A 5KFTA 2UUTA 3A2FA 2JC1A 2AJQA 1YVUA 3DLHA 3OLBA 1RT5A 4IFVB 1NJXA 4EO6A 4URQU 4N76A 3LAMA 3Q8SB 2X78A 1JLFB 2OPPA 2UVWA 4IG3A 3OYGA 1SV5A 4Q8EA 4NLQA 1D8YA 4K4YA 3CFRA 5K14B 4ED3A 4WZMA 3ASMA 3LP2A 2B5JA 3I0SB 1LV5A 4DWIA 4BE0A 3BSAA 1RTHA 1N6QA 3T1AA 4MK7A 3DLRA 1Q8IA 4Q0BB 2F96A 1HMVB 5KFKA 3JSMA 3NFAA 2W8KA 4Q44A 3TAEA 4YP3A 4M41A 4IH6A 4FK2A 1N5YA 4DQIA 4BE1A 1C1AA 3KHHA 3DLEB 5KT3A 4WFZA 4CK3A 4FW1A 1BGXT 4KAZA 3O3HA 1KVBA 3CFPA 2I5JA 3NHGA 4O55A 3CM6A 3ZSVA 2JC0A 1T8EA 5HRNA 4LH4A 1YTAA 2Z1HA 5KG2A 3WNGA 3PW7A 1LWCB 3V9WA 1IKXB 3VQCA 2R2UA 4W5OA 3I5AA 1S4FA 5CYQB 1TGOA 3ULDA 4AILC 3PY8A 3VQQA 2D5RA 2WB4A 3PW2A 4ELUA 5J2NA 3PO4A 2IAJA 1RT5B 4I2PB 1HRHA 2A1SA 3DMJB 3LP0A 1IM4A 4NLDA 3SV3A 3GV5B 5C25A 1SV5B 1S1VA 3EY1A 4CHYA 3AVGA 1FKPB 3KNAA 4B9TA 5CYMA 3CDWA 4BDPA 4E3SA 4URSA 2OPRB 4KHRA 4GW6A 3VA0A 2FC0A 3UDLA 4NLUA 2Y1JA 3DI6A 1RBVA 4BWJA 2RF2B 3CM5A 4FLUA 3T5KA 4CHPA 2FLPA 2OH2A 4FZZA 1O1WA 2IC3B 1BIUA 1N5YB 1VSEA 3MF5A 5KT5A 1S6QB 3RMCA 3V1OA 2HNZB 4KB7A 3AVHA 4MQ3A 1QSYA 3DYAA 3KMSA 1RT1A 2G8WA 2YKMA 2IS3A 3ALYA 1ASUA 3TANA 3NCIA 1TP7A 1NKEA 3DOKA 3DRPA 4ZP8A 3HPOA 3D28A 4IRDA 1VRUA 4FS1A 3M9OB 2IBKA 3ITHA 4E7JA 1RTJA 1DTQB 1GX6A 2BQRA 3VQEA 3QESA 4QWAA 3CJ5A 3HP9A 1S0NA 1NK6A 3Q8PB 3KK3A 1SL1A 1CSJA 1VK0A 5J2NB 3HL8A 3NH0A 4JLHA 4CHNA 5C42A 4IKAA 5F8HA 2Z1JA 1FK9A 1ZBIA 2FVCA 3HVWA 2RKIA 2G8UA 1HPZB 3IRXA 2Q3SA 4LD0A 4GC6A 3QZ8A 1HNIA 4Y34A 4ECYA 2DTUA 3IGNA 4CEOA 4ZPDA 4DLEA 3ISND 3G86A 4K4SA 2ZKUA 4RW8A 3FRZA 3ICLA 1HNVB 5HRRA 2YNFB 2W9CA 3KLHA 1LW2A 4XIUA 3DI6B 4W5NA 3ZT2A 4M3ZA 3OYHA 5EWEA 1NJWA 3DDKA 3GIMA 4C8KA 3TAFA 2JEIA 3MECA 4J9QA 1X9WA 4DU4A 3TQ1A 4E7LA 1D0EA 1CLQA 1DLOB 3VQBA 4IDKB 4DLGA 3IN5A 1DTTB 5SZTA 3EZ5A 3PX4A 4FJJA 4FYDA 2XGPA 3IG1A 3OYFA 2FLNA 1WNSA 3PHEA 1JXBA 5FDLB 1NJZA 5KT4A 3VQ9A 1Z4UA 4E7HA 2FVRA 4NYNA 4IR1A 4KE5A 3DOKB 2FLLA 4XPEA 3OL8A 1GOBA 1U49A 3V4IA 4F2SA 4K4WA 4M45A 2HHQA 4NCBA 4RZRA 3M8QB 1ZYQA 1VRTB 1W0HA 3ZSZA 3NDKA 4FJMA 3ISNC 5L1LA 1HJRA 4E19A 4KHUA 1S1WA 4O3NA 3PW4A 3ZCMA 3DRSB 4NYZA 5EUHA 4JV1A 1QE1A 1RT2B 4TY9A 4J9MA 1RDDA 3V9ZA 4DFMA 3TABA 2UUWA 3RMDA 4W5TA 3NH2A 3FDSA 1TKXA 4YR2A 3V9XA 3DLKB 2HVHA 4KSEB 4CF1A 2HB5A 3CJ3A 1JLCA 1KCFA 3MXMA 1U4BA 1Q9XA 3NAEA 1T03B 3TAMB 3KMQA 4DQSA 1EP4B 1L5UA 4RUCA 4DG1A 4I2QB 4NRTA 4RUAA 5KFQA 5KG0A 3CYMA 3KJVA 1SH3A 4J9SA 4FJ5A 1LW0B 4R5PB 4ECZA 3B6PA 5J2PB 1JXEA 5KFLA 4NYFA 4ZVHA 5L1IA 2OYQA 1NK8A 3CDUA 1CZBA 4OKKA 3QO9A 4JV0A 4R8UA 1D9FA 3RAXA 1U09A 5HBMB 4M3YA 4O5BA 3RRGA 5KFJA 1JIHA 5D3GB 3H4BA 4IG0B 1ASWA 3NL0A 2F8TA 3H4DA 4PQUB 1L3TA 5C24B 4HYKA 3V4IB 2XI2A 3O4QA 2J6SA 4ZMMA 4K4XA 4DEZA 2HNYA 4ECWA 3CIZA 3UIQA 3DOLB 4EP5A 4TYAA 5KFHA 4RW6A 1VSHA 4M42A 2YKNA 4Z4CA 2ASJA 1VSFA 1LAVA 1C1BB 2IMWP 4JRPA 1ZETA 2QXFA 2W7OA 5JXSA 3EPGA 4OPJA 3HVRA 4ECTA 1SL0A 4CE9A 3HO1A 1KFSA 3VQ5A 3P1GA 3RMBA 5DLGA 3OS2A 1A5WA 4CJWA 5KFXA 2PZSA 3FFIB 3QETA 3CFOA 3I5CA 2XGQA 4K8XA 5FROA 2JLEA 3M8SA 3NAHA 1BCOA 4CF2A 2A1RA 3S3OA 1GOCA 3QINA 5DMRA 3AVIA 3RRHA 3KJVB 3PR5B 5KT2A 4ZPCA 3BQ0A 4LY7A 1TKZB 2AX0A 3K57A 2YNHA 3QLHB 3KLGA 4F4ZA 4E7KA 1KFDA 4CEDA 4HVJA 3CO9A 3GV8B 4M3XA 2W9AA 4M94A 3ZT3A 3QEWA 4CK2A 2HHTA 5KG4A 3TVKA 4IH7A 2PYLA 3MFIA 4CFBA 1BCMA 4C8LA 4CJTA 2OZMA 4B08A 1BQNB 4IRKA 1QQCA 1JLBA 4H54A 5KG3A 1RILA 1N4LA 5DG7A 2HHSA 4NZ0A 2YKNB 1RBSA 3K5LA 1NK9A 4FLYA 3E01A 3M8RA 2XO7A 1S1XA 4HUEA 4FK0A 5HLFA 4HKQA 5KFBA 1X9MA 3BDPA 1S9EA 1B9DA 4BWMA 1JL2A 2ZQBA 5KFVA 1C6VA 4OPKA 1BQMA 4CJ4A 4DSEA 4LSNB 1S9GA 4FLWA 4O44A 1NK0A 3BQ1A 1NHVA 3VQAA 4F4WA 1IH7A 4KKOA 5EDWA 4DTRA 4DTXA 1ZBHA 3SFGA 5KFOA 3FSIA 1HYVA 1UWBA 4NLXA 4EBEA 3LPTA 4IBNA 3HJFA 2GBZA 4UQGA 2HHXA 4MKBA 2E6MA 4ZP7A 3OHAA 4KV8B 4QW8A 1J5OB 3KLGB 1SKRA 4FJ7A 2WRMA 2ASLA 3WNHA 3MEGA 1S1UB 2YNIB 2O4GA 1JLAB 4ZPAA 3THVA 4HCCA 3RWUA 4WYLA 2HNDB 4O3PA 4I7FA 2C2EA 4DL5A 3BSCA 1TV6B 1NKBA 3KHGA 5KFAA 3IAYA 4M95A 1T05B 5SWMA 3CDEA 4KPYA 1D9DA 5KFIA 1TAUA 2FVSA 3LZJA 1C1CB 1TVRA 3QERA 4Z4HA 4DTSA 1RT4B 4ICLB 1G15A 3O3GA 1D1UA 2X6NA 4Y1CA 4DL7A 3JYTA 3MEEA 1T94A 5I3UB 1XHZA 3QIPA 3TAPA 2W7PA 2NUBA 4F8RA 4RNFA 3ZSRA 1XWLA 4QCLA 1JLGA 3KK2A 2VG6A 3SUNA 2W42A 5KG7A 1WSHA 2WHOA 2XWYA 3AO5A 3EPIA 2XCAA 3CQ8A 4KFBA 4Y1DA 3HVTA 4NRUA 1JKHA 3RMAA 4CEQA 4B9MA 4DFJA 1JLQA 2IGIA 4O4GA 3MR2A 5F8IA 1QAIA 1BIZA 4IFYA 3NF8A 3S9HA 4B9LA 4KB0A 2AWZA 3U3YA 4URGA 4DTMA 4DSKA 4PA1A 3C6TB 1IKVA 4ZP9A 3F73A 1T7PA 4DMNA 1LWEB 4RU9A 5C5JA 5KFPA 4RW4B 2OZSA 2XC9A 1RT7B 3D0PA 3RBDA 3C94A 4FJLA 3SNNA 1NK4A 3AVJA 3QNNA 3KLEB 5KT6A 3GIIA 1KHVA 2HMIA 5F9NA 2VA2A 4TY8B 1TL3A 4M3TA 4ELTA 3G0ZA 4Q45A 2BQUA 4I9LA 2D0AA 4CECA 4TLRA 5KG6A 3AVKA 4QOZB 3QIPB 3DLGB 4FCYA 1U45A 2VG5B 4FJIA 4Z0UA 4J9KA 5KGWA 4M3RA 1JLEA 1UA0A 1K1QA 3H5UA 3HPGA 4ED2A 2YNGA 4DS4A 1BI4B 3HSTB 3ZT4A 1UAXA 3KLIA 4KRFA 2IOCA 2C28A 4AHRA
chains in the Genus database with same CATH superfamily
1TYQB 4CW7B 1ZBSA 2KHDA 1N5TA 2O8BB 4NLGA 4AL7A 1RBAA 3T5LA 2DGXA 3NKYA 3SCXA 3QATA 2VASA 1WI8A 2OPPB 3LDNA 3OXGA 2QLJB 2V94A 3DRXA 3GJSB 2IYGA 2YX1A 2DO0A 2GJIA 4H8KA 3VA3A 3LP2B 4A8OA 2G0JA 5KFDA 4JI6F 4CJFA 3QQCD 2E5LF 4OX8A 4CD1A 2G13A 4FYXB 3VEOA 3UD4P 4DPWA 4NOHA 4X4SA 4P9SA 4EO8A 2QC3A 4JOUA 2QW9A 1RUSA 2BV3A 3CCQN 4FLXA 2EXUA 3G10A 4TQRA 4CGHA 2KO1A 4JS5A 1I1GA 2GNKA 4AD6A 1N5QA 4P73A 4XK8C 2LXFA 4CO2A 4WFYA 1FJGK 5A8WB 2KVIA 2BM0A 4IO9Q 1MWZA 3LP0B 2H4YB 4OYAA 5AQFA 3MURP 3B78A 4X64K 3NGIA 3C8YA 1SC3B 2DHHA 5HQ8A 2DO4A 4UUXA 2DVIA 3V6DB 1JQGA 2AZ1A 2R4FA 4FXDA 1RT6A 4B3SK 1HWLA 1OJ4A 1BWFO 2W8LA 3ZT1A 1RLDA 3TZXA 2MQQA 4R25A 4CJLA 3OYCA 3ENVA 2R7WA 1P6TA 3CCSS 1XHXA 4AHUA 2O8CA 1OY9A 4FPAA 4KHQA 1GNKA 5ETTA 1HL6A 4NA1A 3RAQA 4UY85 5FLXY 3I5BA 1TL1A 2CJ9A 4LF2A 1VQPN 4BY9C 1Q78A 1QUVA 2IDLA 4ZVEA 4LF8J 3OYBA 3SUQA 4YOUA 2NXEA 1FTCA 4BDYA 3A3PB 3ITHB 1U26A 1RTJB 3O9TA 1RTDA 1UVLA 2F1FA 4NLRA 3UVJB 1VDHA 3PJWA 5C42B 3CC4N 3JSBA 2Q3PA 3K0JA 2NREA 3O6WA 3DM2A 1Q5YA 5FPEA 2P9LA 2M5YA 3AA4A 2UXBK 4ISEA 3P5TL 1JXLA 4ES1A 4HR2A 2OP5A 2BH1A 1LW2B 2DNQA 1RABB 1RNHA 4WE1A 2V4QA 1VIXA 3CJ8A 2KKZA 4H4OA 2BJ9A 2DHAA 1SVDA 4FW2A 1XC9A 4E98A 1SJ1A 4F4AA 1EIYB 1QAYA 4F67A 2P9NA 2MGZA 3HPHA 3ZSOA 2N7YA 4ZCMA 4AHCA 3HBTA 2WONA 3QSIA 4ID5A 4YFUA 4KHMA 1D5AA 2W9BA 2XY7A 4CTAB 1YWXA 6FDRA 3V81A 2BR0A 4JKFA 2OFGX 1WOQA 4A2AA 2C42A 4OX9J 1JWWA 2D9PA 4KI6A 4WIIA 2DHGA 2OGUA 4IQXA 3OVSA 1QSLA 2OHDA 2A6AA 3NNCA 4WTOB 4YY3F 4S0MA 2QWQA 2Q31A 1QE1B 1KD1O 1CG2A 3D6MB 4FJKA 2AQ4A 3QSYB 4DV6K 4NA3A 4OYPA 1R6VA 4GVLA 4O3QA 2E5HA 1NK7A 1HFEL 2BACA 2KG1A 1JLCB 4JKAA 2Q97A 4YR3A 4CJQA 1RAJA 3AY9A 2G8VA 1QQOA 4Y3CA 1RT3A 4ECRA 3OSPA 2NRHA 2IA6A 1EB0A 2BJDA 4LVOP 4OV6A 2P9CA 4O8KA 2V8GA 1Y7PA 3UI3A 4UF4A 3O3LA 2Y0BB 2QM1A 5J2QA 4L8RB 4L76A 4UTGA 3ENWA 2O3DA 3SMSA 1T11A 2B4VA 3THXB 3VGUA 5EU7A 1VSMA 4CFAA 4USIA 4BR5A 4PY5A 1CBKA 4IFEA 2YV0X 4BE2A 1TUVA 2BABA 1TZ0A 4ES3A 2MQMA 5AQMA 1VAZA 3LP1B 1WB9A 1S1TB 2W4PA 4RW6B 2HVIA 4KO0A 4B8AB 1UFLA 1KNZA 1KS2A 3WXLA 3GE9A 4QBUA 2NRXA 4FF3A 2RPIA 1XR5A 3DOMA 2DR7A 1Q79A 4TYBA 3MUVP 3BH7B 2ZF5O 2UUAF 3J7YP 4NI2B 4KTQA 4X65K 4DR4K 3MXJA 3BBFA 4DV1K 4KHNA 5E2QA 2DHSA 1K47A 5KPZA 1U6BA 3M8WA 1TU0B 5CHIA 2QTDA 2HG4A 1QS4A 2K8GA 4KBIA 2OMOA 1W7WA 2IY5B 1UVIA 1RWKB 2SXLA 4ILRA 1NWKA 2DKOB 5JVGL 3MXIA 4A8XA 5HVHA 5AQSA 2W1BA 3M1VA 3N6LA 3L3VA 2VGNA 1MROA 4P74A 2MTLA 4J8FA 1VC0A 3SCJE 3L9ZA 4K8RA 4JI6J 1U47A 2MZ1A 2G8IA 2E5LJ 2XY5A 2AF6A 4JAXA 2VQEF 1HA1A 5J2MA 3CC7S 3U02A 3OVNA 4IFVA 1WAFA 1TKTB 4K7QA 3OYKA 2GQQA 3P3DA 1F21A 1JLBB 3NF6A 8AT1B 1RKJA 1NNDA 5AZIB 1EWQA 3LWMA 1UOCA 1RHQB 2D74B 1QSSA 2BTFA 4A62A 3OLAA 5E3QA 1N5SA 5IWAF 3GSIA 2F5GA 1X31C 2J9DE 2C2DA 3CMAN 3C6UA 2EC0A 2LEBA 1DHMA 3ATUA 3F0NA 3OQ2A 1S9GB 4CF9A 3T19A 1QTMA 2B4JA 3QEXA 4DPUA 2ZWOA 2F3JA 2V2VA 1JMTA 1GLCG 2BBEA 2FJBB 3DLEA 2IMOA 3MM8B 1OIAA 2DGWA 3TRGA 1B9FA 1UWBB 3LGNA 2QTWA 4YB5A 3R7NB 2V8PA 2JWLA 3ZSYA 2EFQA 3ZSWA 3CJSA 3K5MA 3KDNA 3ZTOA 2HMPA 1LWCA 1Y5NB 2N82B 4NB4A 4OIXA 4NCAA 3MXHP 4JI8K 2AJ1A 4F36A 2ROPA 4RUBA 1RWMB 5DQIA 2D7SA 4HT5A 2BE2B 4C0OC 1WG5A 3LF0A 3NMAA 1JJ2R 3ZNUA 1K73O 1BD6A 4BRNA 1FKPA 4BRPA 2AGOA 3A13A 2H5IB 1DAXA 4FJXA 1F5BA 2P6SA 2KYZA 3P49B 1MDUB 5MLCV 2OA8A 4JK7A 4PG7A 2JRSA 5MAOA 3KK2B 1CC7A 3D9BA 2VG6B 4ED6A 2J7WA 2GCFA 2F8SA 4FNIA 4USTA 1OH5A 2E1AA 3AA2A 3M8PB 2B43A 3BPDA 2XWXA 3R5GA 2ZH7A 1SPBP 4RNMA 1VQ5N 1KLNA 1WC1A 3O8MA 1DZ5A 5LL6d 1J53A 3EEQA 1WWHA 2CGKA 2AJ0A 4DSLA 1WLJA 3HSGA 5B08A 1ZAVA 4J90A 4O4GB 5AQZA 4FJHA 2LA6A 4MLEA 3IGVA 2O5DA 5LM7E 3IP0A 3AOCA 2E44A 1CC8A 3ENAA 1IKVB 4CI0B 2LU1A 3PHTA 3L2RA 2WTFA 1GQEA 2W7AA 3O2IA 4OZNA 1U7LA 1APSA 1HPZA 2KT2A 2FZGB 4JV5F 2LP4A 1VQ9N 1K44A 3LGMA 2YHWA 1OSDA 2FVQA 1R43A 3V1QA 3HHLD 4CGFA 3UO0A 2B8PA 4A2BA 4OYBA 2FHJD 4FJ9A 4TLQA 5JLFA 2IVFB 1OY8A 1ZAXA 3N0VA 2PMZD 2BMBA 4DR2F 2YPZA 5CZ1A 3IBCB 1QD1A 3HZ6A 3G4SN 1PJ7A 2HLUA 4YY3J 5CD4A 3N4QA 3E9OA 3J7ZT 4JKHA 4QWEA 4OYZA 1CJVB 3P83D 4CJSA 1EETB 3TPQA 1OPZA 3G6EN 3IR5B 5IT9Y 3IM9A 3CXCR 2F4VK 3W7BA 3PKYA 1W9HA 4OO1J 2MLXA 2RQ4A 4Y2CA 4BROA 4F2RA 4CNYA 4Y2KA 1VQKS 3AVFA 4H0XB 3OJUA 4MO5A 3GL1A 1N48A 4Z2XA 2WOMB 1X4EA 4CIFA 4ZTFA 2R8KA 2LECA 2FJDB 2X1FA 1WJ9A 1P9YA 4DF4A 4GV9A 2QX0A 3GR0A 1WOPA 4P71A 1AZSA 2P51A 4K2JA 3LZIA 1DRZA 2I8EA 1WC5A 5KG5A 3G9CA 4DN9A 4GNIA 3I55N 1CQNA 2O01C 4I2QA 4FL9A 2AGQA 2D1KA 3R1LA 5CH7B 3J80Y 3H59A 4PUOB 1FI4A 3ZYYX 3LM9A 2QSWA 2DNNA 3MWBA 3UW1A 3K17A 2V68A 1IBKF 1QHAA 3W66A 4ER8A 1RP5A 1H6KX 1T3NA 3SLCA 3MM7B 2AEMA 4DZDA 2IVPA 2DFHA 5BN9A 2LKZA 3MGJA 3J8AA 1V3ZA 3PXGa 3SBTA 3DXKB 3TYTA 3A1YG 2UUAJ 1XR7A 3BBCA 4IG0A 2GMHA 4PQUA 1P27B 3C3LA 2BKOA 1VQ7S 3C0BA 2HBMA 3MR3A 1Y4ZB 2Y0SD 2CJAA 4DR7F 4N47A 2X51A 2XMKA 3E1YA 5KFGA 4RW9B 3QGHA 2Y1IA 3QIOA 5M1NA 2DY9A 2M3DA 4FKYA 3JXUA 2FVPA 4DR1F 4JKDA 2BGGA 2GHPA 1RYRA 5BRFA 3UCZP 1N5VA 1KLMB 2R8HA 4OZ1A 2VQEK 4KGZB 2BYCA 3LA0A 1RAHB 4KHPK 4E89A 3QMQA 3DN9A 4YN3B 1XN9A 4XPCA 1Y3KA 3GG1A 5A0YA 1YX2A 1H74A 4WK3A 2H9ZA 1URRA 1BMQB 3D6HB 1C2PA 5B0FA 4ZPVR 4YDXA 3FZKA 3KUHA 4KC5A 3KHLA 2B6AB 1VMBA 4DCJB 5IWAJ 4PYDA 1H3DA 3VQSA 5AQGA 3CO0P 2WVCA 2OPQB 1YJTA 1HYSB 2BKPA 5T14A 1RWOB 1IKWB 3Q8RB 1TK5A 1KDNA 4FJNA 4JNEA 1FDAA 1UVKA 3NXZA 2E20A 1I3AA 2B9EA 4WWSA 3OYIA 2Z2LA 4J9OA 2MHNA 2YWEA 4H5RA 5IQ6A 2X7IA 3VQ6A 3IS9B 2N4DA 1HNWF 1VIOA 4DV2F 3SJJA 2FC9A 3MX5A 2ZZMA 4Q2LA 1LWXA 3I0RB 3NRBA 2FJAB 3QEVA 3J81Y 2YPYA 2E88A 2KRBA 3L0QA 4LFAF 4FVMA 1GMWD 2OD6A 4MIAA 4EFAC 2VV5A 2ZOFA 2HOEA 4EBDA 1VC6A 3SCKE 1TUGB 2A5XA 4NYPA 2V2KA 1NGAA 2HHHK 4QIEA 4ED8A 3RJMB 5AT1B 2V51B 2Z1GA 4F50A 1IBMF 5G0RB 3U6FA 4WFXA 2KRRA 5KQ8A 3D0HE 4M3WA 3NGKA 5I42B 1YIJS 3TOQA 4JYAK 2OTJN 4OPHA 4AH9A 2YNIA 1JLAA 1FRMA 3RR8A 3GILA 2HNDA 2IYIA 1IBLF 5CZ2A 4BR0A 2PBDA 1FDDA 2HRTA 1HLUA 3ZC4A 5A8KA 3PJXA 4NLVA 2W25A 2Z2MA 5KRTA 4CZEA 1Z2ZA 1TKDA 4WFNQ 3HDSA 3THTA 3R7BB 4FYWB 1HR0K 1REGX 3W5ZA 3PZPA 4OGCA 2L48A 1YQHA 1UVNA 3HJVA 2FHKA 3D2WA 4OL8A 4BBYA 4DR5K 1YT3A 3VVUA 1BOTO 1WSJA 4MK9A 1SUQB 4RNHA 4DX6A 3JXOA 3PSIA 2FJVA 3Q8VA 1UZDA 3F41A 3IFRA 1XIQA 4FBTA 2NUHA 5HRPA 1AXQA 1LWFB 1RCOB 4A46A 4K2XA 1PYOB 3LDLA 3CJ2A 4CYUB 2RT3A 1RA6A 1Z6RA 4JV5J 2I7PA 4EZ9A 2YX6A 3N5BA 1HBMB 2QK9A 1HYZA 4LSLB 3KZBA 2ZNYA 2M8HA 5JVHQ 1RFQA 3HHLA 2CKWA 3L3CA 2Y8YA 3KD1E 3SAHA 3VTHA 2IIRA 4DR2J 4HUFA 4OGEA 4M5IA 2GO8A 1SJ4P 3T5HA 2NRVA 3VAGA 1RT7A 3UQSA 4LF4K 1X0FA 4K4VA 3SK3A 2ETJA 3EVOA 3NGZA 4OI0A 3IWXA 2XSJB 3H5XA 3C46A 3UCUP 5GAEU 1HQEB 1BE4A 1C0UB 4AQYF 1D3WA 3MAQA 2HS3A 1PJ5A 3OTCA 2AU0A 1L3VA 2R9LA 4MFBB 4WFAQ 3MCAB 3OBIA 3DLGA 2LFVA 3S6EA 5CABA 4XAKA 3KDOA 5F8NA 1XNRF 1T44A 4IKFA 4CEFA 4Z4EA 2D0CA 1JNZB 2VG7B 1OH7A 1BI4A 2UUTA 1P9QC 4KGMA 1YGYA 5D4NA 1TYQA 1PBAA 2JC1A 4OI6A 2AJQA 1TMJA 3OLBA 2O8BA 2IJRA 3UNYA 1RT5A 5IS2A 4CLZA 2YCHA 3NGUA 4LIRA 2OPPA 2KU7A 2UVWA 1Q7YT 2O66A 3DXBA 1D8YA 4G6VB 4P75A 4K4YA 3CFRA 1ZPWX 4OLPA 1K9MT 4ED3A 3LP2A 4RLEA 3BYPA 4I6MB 2M2BA 1YBUA 1T9XA 3BSAA 4CBXA 1WF2A 5E5NA 2F96A 4Q0BB 5B0GA 3BF1A 1IBKJ 5C2FA 4MKYA 4Q44A 4BRIA 3AA8A 4YP3A 1U8WA 4IH6A 1N5YA 4BE1A 2DNPA 5KT3A 1JJHA 5AQQA 1PAUB 2HBZB 3VVTA 4JEPA 4WFZA 3D68A 1HLWA 3L6QA 2O1PA 3O3HA 2NZTA 3FBFA 5HMZA 4AXJA 4LJMA 4XDCA 2NXUA 2F8HA 2A40A 5E33A 3PW7A 2W2PP 3WQPA 4EHUA 4DR7J 1S4FA 1TGOA 2G1DA 2G9OA 2H5JB 1VK3A 5BRHA 1N33K 3QFUA 1FE0A 4RWXA 4I2PB 1XTZA 1Q0NA 5A8WA 4LF6K 2WFBA 3DMJB 2FB0A 3LP0A 3DCAA 1IM4A 4DR1J 3EGWB 2CZ9A 4KBOA 4DR6F 5AJ3F 3ONQA 1F2GA 2XYGB 3C16B 2BJ1A 4CHYA 1U8SA 3KNAA 3IDHA 4BDPA 2OPRB 3UDLA 3FRYA 2J0WA 3EE9A 2VPXB 3SIPB 2GS8A 4QS8A 4ZDNA 1R0BG 2OH2A 1O1WA 1HNZF 3D6TB 3IWNC 2MJUA 5IC6B 3MF5A 4EGLA 2FHMA 4L75A 3QNWB 4KB7A 2V4JB 4DCOB 4WCEQ 4Y0WA 3DGPB 3ALYA 4CWBA 3TANA 1VQ4S 3EICA 4DR3F 1JCFA 1G1XA 3I32A 3VEZA 4KGVB 2KHOA 4P7VA 3PIPQ 4DV2K 1HNWJ 3ITHA 4E7JA 4DV2J 1RTJA 2GHWA 1GX6A 3T1YK 4QWAA 3CJ5A 3HP9A 3MN9A 3UVJA 5D77A 3HL8A 1HWIA 4JLHA 4DV5F 5C42A 5F8HA 4C9DA 2V8VA 3OFEA 2FVCA 3LTOA 3VAMA 4LFAJ 4GC6A 4Y34A 4CEOA 5K8PA 1YK9A 4K4SA 2ZKUA 3TA2A 1HNVB 3VWSA 2YNFB 4RPFA 1LW2A 3AAWB 3RBXA 3DI6B 4W5NA 4C3MA 5EY4A 4M3ZA 2LVWA 3VAJA 1RWUA 4LFCK 2JWNA 4DX8H 1IBMJ 4C8KA 3EXYA 3W65A 3QWPA 4J9QA 1A9NB 3LPEA 3TQ1A 4E7LA 3G87A 1CLQA 1RISA 3DWLA 1MN7A 5F3TA 3RSEB 2CNOB 1WNSA 3PHEA 2DISA 1IBLJ 3L7OA 4CTAA 2OD4A 3GLJA 3UNGC 1Z4UA 4E7HA 1VISA 4BLGA 2LYVA 3R8YA 2MLZA 3RG6A 2P9SB 2OLWA 2HYIB 1IBCB 3OL8A 3Q22A 3HMJG 2B4OA 1GOBA 4F2SA 1LXJA 2B7CB 4M45A 2Q79A 1VRTB 5JLHA 3NDKA 3ISNC 3LL3A 2Y9HA 5LJWA 4KHUA 4O3NA 4IWVA 4MDBA 3ZCMA 1QE1A 1FWLA 2GAGC 2MY8A 4TY9A 3BO4A 2QYGA 1N34F 1GTHA 1RDDA 4P72A 4J37A 4OZ5A 4W5TA 1V3RA 1NH8A 4DZ6A 3NH2A 2HVHA 2NSBA 2BA9A 1JLCA 3R27A 1Q9XA 3TAMB 4DQSA 3KMQA 1EP4B 1OYEA 5ADZA 4RUCA 1S57A 1G2EA 1FX4A 2VJVA 1NPRA 3R7SB 1XMQK 5E3AA 3EJMA 2ATCB 1KVJA 1LW0B 4WKRA 4R5PB 3U9DA 2HHPA 1PGZA 2HFNA 2MMYA 2LQBA 2QA4N 4ZVHA 3S1TA 1SCJB 3CDUA 3THXA 2PO4A 2UU9F 3CCMS 1D9FA 3PRVA 1OH6A 5A2QY 4O5BA 4KYZA 2WSEC 1B7YB 4CZLA 2CQGA 1S72N 1ZM2A 2F8TA 1L3TA 5C24B 4HYKA 3HRGA 3V4IB 5E84A 2J6SA 4X4RA 4YDDB 4ECWA 2AYGA 1T9TA 1YJNN 4EP5A 5KFHA 1TUWA 3BKFA 4RW6A 1VSHA 4DUZK 1Q7LB 4AQYJ 2Y1LB 4M42A 2YKNA 1OY6A 2ZJRL 2ASJA 2WVDA 3C19A 2O67A 1OPIA 3HKZD 3PYDA 3EPGA 4LR9A 4CE9A 2P9GA 1M1KT 3LM2A 4NXMF 3RMBA 1XNRJ 4H0TB 3H90A 4NI2A 2PZSA 4QYZK 5FROA 3M8SA 2ZC4A 3NAHA 2A1RA 1BA1A 5DMRA 2ZHOA 3RRHA 4I6AA 2JLGA 3PR5B 1E6YB 5KT2A 5LL6Z 5A6WA 1ILYA 1T95A 4H5VA 3PEHA 5ELZA 1FRIA 2R7TA 4B3RK 2VFTA 3QLHB 1YTYA 3VCDA 4F4ZA 4CEDA 3GJTB 3N4PA 2CPDA 4M3XA 3J7ZO 1W2BR 4PL8A 4CBUA 4CK2A 2J0SD 4BS2A 4OHZA 4IH7A 1QJHA 1EQMA 5ETKA 3MFIA 3O6QA 2BVZA 2YWKA 4W4MA 1JLBA 4H54A 5AZIA 5DG7A 4FLYA 3IM8A 4LR8A 1OVYA 5CZVA 1AA1B 1JL2A 1C6VA 3CJCA 3WXJA 4LSNB 1S9GA 2XLJA 3I31A 3CJ1A 4FLWA 2QJ3A 2ZJRQ 3CCUN 1NHVA 1UPPA 1Q82T 2EPIA 3L4QA 3F5TA 5EDWA 3WUHA 3MR7A 4YORA 2HBJA 3MM8A 4CLKA 1UWBA 1M90T 2HHXA 4DR6J 5AJ3J 1KQSM 1YJRA 4KV8B 5EOYA 1VQNN 3KLGB 1FDNA 2C3OA 2R7QA 2CH6A 1ZH5A 4L3NA 2WRMA 2ASLA 1S1UB 4ZPAA 3H3NO 4O3PA 4ZCLA 3B6BA 4X4NA 2ZJQL 2IRXA 1NHKL 2ZKTA 3DKDA 1TV6B 1NKBA 1HNZJ 3GONA 5KFAA 1EWRA 1D8ZA 1H7XA 1FEEA 2QMWA 4HLBA 4OLOA 2FVSA 3LZJA 3PKMA 4DKWA 4YUDA 4GKJK 2DGTA 2A6OA 4QIWD 4DTSA 3O3GA 1G15A 1UW4A 1S6OA 4DL7A 1KVKA 4DR3J 4YHHF 5C15A 1Y00A 1T9YA 3S8SA 3FFKB 4UW2A 2DH7A 3KK2A 2VG6A 3TTFA 2W42A 2IVYA 2X1AA 4CO1A 4OI3A 3CUNA 4DV5J 3BEXA 3EPIA 2XCAA 1TFYA 1S59A 3CQ8A 2POKA 1H2TZ 3AGRA 2ERRA 4JKGA 3CE8A 3AQOA 5CXTA 3UKUB 3D0GE 2MQOA 1WUAA 2L9NA 4DFJA 4YOWA 2XNQA 4O4GA 3QBCA 3TX0A 5F8IA 1QAIA 1BIZA 2W6LA 3WXKA 1Q8LA 4I68A 1NGEA 2V5HG 3C6TB 1IKVA 1FWPA 1HBOB 4DMNA 4I67A 4C0BA 3SCLE 3L4IA 4Q2MA 4Y28C 1G7CB 5F9NA 2ASOA 3HZGA 2ZJQQ 1E6VB 4ELTA 2BQUA 2D0AA 5GIOA 1H2VZ 3AVKA 5M1PA 1IJFB 2VG5B 1F9EB 4FJIA 4LF9K 4J9KA 1JXVA 4M3RA 4KH4A 1K1QA 2RQKA 3WXMB 1U1NA 2AYMA 1UAXA 2C28A 5GAGU 1N34J 1CJVA 1EETA 4OX7A 2JEJA 3G6XA 3QJJA 1FVQA 5DO2A 2VYPA 3N9UC 1YZ6A 4FF2A 4HVZA 4JI4F 1EARA 3VMFB 4CJUA 2P5OA 1UFWA 4RKUC 3HYFA 1DKGD 1CEZA 2XHBA 4IG3B 2D3ZA 1HQ2A 5H9EK 2YJEA 2WOMA 2V50A 4X66K 3HHNB 2N3LA 1GLDG 2DRBA 1NGJA 1RTHB 4R0EA 5IXUA 3H7HB 2UXDK 2RHKA 4MJKA 5M1KA 3T1HF 3JSMB 3VGSA 1S22A 1YRXA 3H1VX 2HRYA 1FX2A 2UU9J 1GLAG 3C7NB 4CEZA 4ZCIA 2XM3A 1F5CA 3C15A 3PUFA 1WKKA 1HHTP 3TU5A 5HOOA 1RHRB 3FQKA 2P9IB 4PUOA 2WVEA 3MZIA 2HURA 3NE6A 2DGUA 3EDQB 3R5CA 1HKBA 3MM7A 1EX8A 4A5AA 4BG8A 1UJ6A 3KJQB 1VCTA 4Q5VA 4R79A 3DXKA 4NXMJ 3TJ8A 1XMOK 4DU7A 4OYIA 3JB9k 5L38A 4WK1A 2AA4A 2G2OA 3FR0A 1ZAWA 4PKHA 1U2VB 2BW7A 1RB0A 7AT1B 3A3OB 2B56A 2ASMA 2CIMA 2XMWA 2IRUA 3NOCA 2QFIA 5AQWA 2A18A 4RW9A 4KQZA 1IQTA 2R8IA 5DG9A 5CYJA 3LDSA 4IJNA 2XULA 1WTFA 5ETVA 3A8EA 3G71N 2DIUA 4OLBA 3VAHA 1KLMA 1M5HA 1BISA 1NM2A 2ILYA 2Z30B 1Q86O 2VPWB 2DNRA 4CO0A 3WT0A 2IFXA 2WC9A 3J7YI 3M9NB 2FBXA 2HZVA 2KKHA 4B3MF 4FWLA 2M70A 4OHVA 5KG1A 3L95X 3UDVA 2L41A 2OPQA 1FK9B 1HYSA 1IKWA 4BR2A 3R3TA 1DBDA 3FBEA 1N36K 2ZNZA 1RK8A 3V9UA 4MKAA 1L3SA 1W97L 3GIRA 2AMCB 1HNIB 4I64A 1UW9A 4O3OA 3BGLA 1LQ9A 4RW8B 3B8HA 4BQLA 3MR5A 2DPIA 4RR5A 1FFGB 2W9CB 4JS4A 4ZKAA 3IS9A 1Q7YO 1I94F 4J9LA 2HBYB 3T9ZA 1K9MO 3EZUA 4H0OA 3I0RA 4DV4K 5LMNF 2R7XA 3VQ7A 3QFHA 4DQRA 2JLFA 4ZVUB 5AXKA 1RGIA 1CZAN 2UV8A 2JJ4D 2HFUA 4CJ5A 2AP6A 2EHGA 4J9VA 3JSRA 5E41A 2ALZA 1UZHA 4CI6A 2PGCA 2I7NA 2AV5A 2CGLA 3I56S 2GAHC 3K8VA 5G0RA 3T5JA 4CO4A 1R27B 4TU7A 3WX4A 2O8DB 3OFFA 5I42A 2FC8A 3MD3A 2RDIA 3NCPA 1R3NA 1S1WB 2Z8QA 4CJVA 4DU1A 4GO7X 3DDIA 3VAIA 4YHHJ 3CTRA 5DQHA 5GMKa 4DS5A 4B9SA 2P9LB 4HEA9 2MKHA 1TKXB 3NGSA 1RACB 4ES2A 1BO5O 3AB4B 4WIQA 5AQNA 4NEZA 4NMLA 3HT3A 3JSYA 4WE1B 2JFKA 4O0NA 2AT1B 4DG1B 1IWGA 3FCWA 1UEUA 5M2PA 1U1KA 4QPXA 4D3HA 1EXQA 2MLYA 2J7KA 2XEXA 1OYDA 2RUGA 1Y5LB 4E0DA 3KWIA 4JRQA 1LOTB 3GIKA 3Q2SC 2VICA 1K0TA 2VJUA 4FVUA 5B7WA 3GJQB 4K5RA 4O23A 2R7RA 2GMLA 3KYLA 3EGVA 4GVBB 3R97A 2ZFHA 3BREA 4K4TA 5H9FK 4KHSA 4CYUA 3SBMA 1HBMA 3P31A 2DPJA 4LSLA 1ZTWA 1O6XA 2GIFA 4J2EA 4USJC 2RQCA 2NRZA 1GXTA 3IAS9 2KZZA 2B3TB 4O3SA 2FXUA 1BL3A 1MNEA 1X3NA 4ZPWR 3ELHA 4DF8A 5AQPA 2OEJA 4GMJB 3P5BP 4EMDA 3AO2A 3HKWA 3MK6A 4K0KF 4JKEA 4MYTA 4J2BA 4X2BA 3A8YA 5BPLA 3KD5E 2XSJA 3GIJA 1U1OA 4IOBA 1HQEA 1C0UA 4ILGB 2HZCA 1KHWA 2CQ2A 1SJRA 2IM0A 3GJRB 4MFBA 4JI4J 1MWKA 4EYIB 2HIYA 3BR9A 5BR8F 1J2VA 3NF7A 4TKTA 1S99A 3VR1A 2PIIA 2YNHB 3OPKA 1NK5A 4ENOA 3QRRA 1T3VA 4CESA 2EK6A 1I39A 4CIEA 2FSKA 1RHKB 2YKAA 1G3OA 4CT8A 3C95A 5IM0A 2D69A 3T1HJ 5KQDA 4C2MA 3PX0A 4KHWA 4NLWA 4JI7F 1X4GA 2P9PB 4WKYA 3MM9B 4I4BA 1N32K 4FPRA 3PFEA 5HLFB 1I6JA 2FHOB 2F8EX 2N3OA 3UR3C 5DGAA 2GELA 2QWMA 3IR6B 2RB7A 2B4UA 4Q0BA 4IO1A 1RCHA 3H1QA 4O44B 1SC6A 1Y0HA 1R0CB 4KKOB 1IWAA 3FMWA 2EG1A 3H5SA 1B3TA 1M5PC 1C4AA 1GH8A 1YUWA 2FBYA 2WK4A 1S10A 5M1QA 1HNXK 2UXCK 3DFEA 1H98A 1MROB 4C8ZA 2CPIA 3PR4A 3ULHA 1NHUA 2D3O1 4NX9A 3TVYA 3MEGB 4CHOA 2GV1A 4M5JA 2NNWA 2GIRA 1XK8A 1SH2A 5J2MB 4ERDA 2OSRA 1UWAA 2KDOA 4I2PA 1MLAA 5F8JA 3DMJA 4BCAA 2X1BA 2A6MA 2AZ3A 4X62F 2YHYA 4F3MA 2XMUA 5GVQA 1J6ZA 1RDBA 5F8GA 1MMLA 3C16A 3VZHA 3D7SB 3E51A 2OPRA 2V9WA 3ZZPA 3OTOK 4FZXC 1A5VA 4EU0A 3C6UB 3QEPA 1RAOA 5E26A 1X0PA 1TAQA 3OL7A 3NP5A 3E66A 1WBDA 1M1KO 3HHKA 3RR7A 2P9UB 2DR9A 2MKJA 3OTBA 4ZITA 1T9UA 2GMJA 4B3MJ 4F4YA 5D4OA 1RWVB 4IOAL 2Z4PA 2V4JA 4B1VA 2Y3YA 4ILMA 3DGPA 5DS7A 3RB6A 3NMRA 3CCJS 3OTEA 5ETSA 1UA1A 3M5RA 1JLQB 1QVFR 4DL3A 3U1MA 3DAWA 1I94J 4FWKA 3HCXA 4DQQA 4N8NA 5LMNJ 2VL1A 2VQFK 3NWRA 2FD2A 3AO3A 3KFWX 3VEXA 1XEZA 3CJBA 4DSJA 4U6PA 1UFKA 4ZIWA 4DSIA 2CPXA 1HNVA 3CDAA 1K8AT 2MJNA 2YNFA 5A76A 2HF4A 2O8EB 1OMSA 3RU0A 2Z57B 3TSPA 1K6YA 4MKVA 2D3OR 2IJFA 3MEDA 1SJFA 2GW8A 3FEYB 2DB1A 1SS6A 1WHYA 1IO2A 1Q82O 3D6RA 3AT1B 3VEWA 1HW8A 4Z37A 3T3FA 4Y0FA 3IUCA 4F4XA 1KVCA 4ZTJA 3CCVS 2NCKL 2ASPA 4E1NA 4PXCA 1MG7A 3OVBA 2ZE2A 4P10A 1CXUA 4IOAQ 4F0HA 4GVEA 2XS7A 3CVKA 1VRTA 4QWDA 1FD2A 3AJDA 1FNMA 3D6FB 4LBPA 5F41A 6AT1B 4JI1F 3HLUA 4G1IA 2NPIA 2CQ1A 4CGGA 3UDCA 5GADP 2A10A 1NB2A 3I8BA 4CJ7A 2MHEA 1WSVA 3HM9A 5D6GA 4FDFA 5D8HB 1NB7A 3VEVA 4P2MA 2KQ2A 2VF3A 2ZHAA 2CDQA 2GA7A 1DT9A 2FSNA 1RDWX 3TAMA 1CJUB 3AD9C 1EP4A 1YI2S 4ATNA 2UUBK 2CXEA 3VAFA 3W61A 2BX6A 2LMIA 1R7IA 1S6PA 1ZC6A 4ZN1A 2FF3B 2E9RX 2F9DA 1XI1A 3H40A 3IKMA 3FUYA 3R5BA 1LW0A 1X5OA 4R5PA 5L9NA 1JNRB 2CQ3A 1SBRA 1Z05A 1YHQS 4P7TA 5HJYA 4LF1A 2KFYA 1HBNB 3PRBA 3AGKA 3HHDA 2A3JA 1FDBA 2CJQA 2F7TA 2DXDA 2PAVA 4QIFA 1WKJA 2V4RA 1N88A 4F9OA 4K0KJ 1Y11A 4ZVQB 5HJXA 3KG0A 4ECVA 5C24A 4BQZA 1NGHA 3CJ9A 2XB2D 4MLHA 1CS4B 2ITMA 4U7UK 3QIDA 5EWGA 3LALA 3KLVA 4LQ3A 3GDQA 4HTUA 3UR0A 4A8MP 4ZOSA 2JEGA 5BR8J 2GV9A 3CJAA 4CGJA 2EG2A 1KN6A 4LREA 4WF9L 1FFWB 2CNNB 1WSRA 4CZCA 1TL7B 2OO4A 4U9RA 3NGYA 5JS2A 3M2RB 2GO9A 4WP3A 3D5MA 3V1RA 3AOBA 3MN6A 3ZZTA 1HKAA 2G8KA 1RHMB 1ASVA 3PO5A 1A5XA 4RBUA 5HVGA 3SUOA 1NGCA 3LWLA 4JI7J 2RN2A 3UPFA 5KAKA 4E1JA 2E7XA 3K2PA 2P1JA 4K42A 5F9LA 2RHQB 4UZBA 3BV8A 4V19J 3QLHA 4HHJA 2NR0A 4C11B 3SQ2A 2PFUA 3KOAA 4CEEA 1W2IA 3IBWA 1HIYA 1YJUA 4FWSA 1UPMB 4W5QA 4MT1A 2ZM6K 4FLZA 1MU2B 2UYTA 1ULRA 2ZBCA 5KFEA 4DV3K 4BRDA 1RAAB 1RTZA 1VQOS 4I9QA 1TL4A 3KXDA 1FJGF 2J4RA 4EWTA 5C2DA 1R89A 1WHXA 5F0UA 4LSNA 2GVDB 2QZ8A 3VQTA 4X64F 2HQIA 3CCEN 3K2YA 4FOEA 1NM1A 1FKOA 4WF9Q 2HHVA 1VSDA 2R7YA 5CY4A 4B3SF 4RW7B 4X62J 3F9KA 3AO4A 3EL2A 4KV8A 4F4KA 4OJ1A 4Y65A 5CZXA 3PACA 2LQJA 4CZGA 1CVJA 3TZYA 3OT9A 1S1UA 4M63A 5H1SV 4NCGB 2RDJA 3SSRA 1E4GT 4CJPA 3I6PA 1AROP 4XTTA 4YQWA 1HD0A 1NMNA 1TV6A 1NNEA 5JS1A 2IVMA 2LXIA 4QYRA 3NCRA 2DNOA 3RBEA 1SQKA 1X4BA 1HW9A 3H2LA 2M88A 1Z25A 1C0TB 3U3GA 4C6AA 3TWZA 2NQPA 5AR0A 4YEAA 2Q0RA 2DRDA 4CERA 1WSEA 3Q89A 4OYMA 5AQJA 1PJ6A 3LANA 4HCBA 2ZH6A 1ELOA 3A5OC 3TA1A 1RTIB 2LXUA 5GAHP 2UXBF 3GTYX 2GIQA 4B9NA 4C4WA 2ITGA 1S49A 3SDEB 1SL2A 5HROB 4ZP6A 5CCMA 3H5YA 2W01A 4AL5A 3VQPA 4WXOA 2LDIA 4CEBA 4HI2A 3CJ7A 2ZH3A 4O0JA 3DHWC 4FBUA 1C0MA 5BRDA 4U8YA 3PRDA 3AXKA 1GXUA 1Y97A 3GFYA 3VETA 1V4SA 4ZLPA 2QE5A 2DH8A 3L2QA 2R2TA 3VGTA 3EN9A 4WJBA 4B1WB 4X4PA 1S9FA 3C6TA 3LAKA 3QDKA 1N56A 1QDUB 3RB0A 4EUVA 3KKSA 4B3OB 3E3XA 3FNNA 1JJ4A 4FM1A 1HMVA 4HDHA 2FGCA 2YX4A 2KFNA 2KFZA 3LPYA 4AYBD 2XZDB 4CH0S 2R2SA 2NRTA 5J1EB 2KJWA 4PZVA 1F0XA 2UP1A 4OKEA 1M5OC 1E6VA 4M5KA 5LT5A 1HARA 2DH9A 3FC9A 1RA7A 4J9RA 2VG5A 2BRKA 4H4MB 4DU3A 4DV6F 1VQPS 1CXQA 3M3ZA 4KI4A 5D15A 3NBPB 3X3UA 5KFTA 3GG0A 2HSTA 4JI1J 2IBOA 2OI2A 4WP8A 3EMTA 1RAIB 4BRMA 4NLCA 4NPOA 3SSQA 3ZZYA 1NJXA 4URQU 4N76A 4RBVA 4OJHA 4V19X 4KR0B 5DM6L 2X78A 2LEAA 4IG3A 4JBCA 2VC0A 4NEYA 5LSLA 3PLAA 5K14B 3DGVA 1TL5A 3EO3A 2ZH5A 4IOCL 3I0SB 4DWIA 4BE0A 1RTHA 1F6TA 5AQYA 3BYRA 3JSMA 2RS8A 2VFVA 3M6WA 1Q81T 3TAEA 1M5VC 4M41A 1RWNB 3CDBA 3KHHA 1R8BA 3C7NA 5BPNA 4YOXA 1ATRA 1BGXT 5J1PA 1NDKA 3NHGA 1SZ2A 3ZSVA 2C2OB 2JC0A 2P9IA 1NMDA 4BRAA 1T6DA 1YTAA 4EAHD 2JVOA 3UB5A 2Q0UA 1DQ8A 4X65F 4DR4F 1HWUA 1WUUA 3A5LC 1IKXB 1FJ7A 4DV1F 3MMCB 3VQQA 1VJQA 2W4CA 3LO3A 3PW2A 4ELUA 5J2NA 4G1PA 2PC6A 1RT5B 3V2UC 3VGVA 1SKUB 3GR1A 3I4HX 1ATNA 3P45B 3ENOA 1C4CA 2QG9B 1E3MA 5AQKA 1DEJA 3M1FA 1GLBG 3EY1A 4PAAA 3HM8A 1U2VA 1AFIA 3AVGA 3CDWA 2RRAA 4URSA 4E3SA 2OKQA 3DXMB 1YITN 2FC0A 4NLUA 2BJ3A 1NAQA 2YQ3A 1RBVA 4I56A 4BWJA 5HO4A 5DM6Q 4A5BA 2EC2A 2WSCC 1F3VA 2FLPA 2ZDOA 4AXIA 2QEXN 1BIUA 1N5YB 4CZIA 4UOFA 1VSEA 4ZVOB 5KT5A 1S6QB 4IOCQ 3RMCA 1IUJA 5LJ5Y 2MZTA 3AVHA 1ZZNA 1SC1B 3EVWA 1VHIA 2E2PA 3NCIA 1TP7A 1NKEA 1DARA 4PXEA 3DOKA 3IC1A 1NDPA 4H5NA 2ZC3A 3D28A 4TVAB 4IRDA 3GE1A 4FS1A 3M9OB 3VQEA 2BQRA 3D0IE 2YH0A 3PEJA 4JB8B 1S0NA 4BC2A 1CSJA 1VK0A 5A8RB 5AQUA 3GWCA 3DLJA 1RSCA 4IKAA 2Z1JA 1FK9A 1FJGJ 1CPZA 3MDQA 2E2NA 3F56A 2EWSA 2Q3SA 4U96A 4LD0A 3QZ8A 1HNIA 2B7BB 3IGNA 1A6LA 4X64J 3NVKA 3ISND 1WELA 4RW8A 3ICLA 5HRRA 2W9CA 2MKKA 3L7PA 1J5EK 4NXNK 3WX8A 1A7GE 3OYHA 4B3SJ 4JI8F 1NJWA 5J1NA 3J80U 2QL7B 1TMMA 1KKHA 4JKBA 3QGPA 3CCRN 1X9WA 1B0PA 4DU4A 2LDYA 2BUNA 1DLOB 3VQBA 1VGYA 3IN5A 1DTTB 1LFPA 4FJJA 2GJFA 4FYDA 2XGPA 2MEWA 3HFVA 4ID8A 1F5AA 1CJKA 4UY8T 5KT4A 5LOQA 4KE5A 3FEZA 4ITSA 4PG6A 4XPEA 1U49A 3W3SA 4RZRA 3M8QB 4RU2A 2O8DA 4HWIA 3ZSZA 5L1LA 3KWGA 1S1WA 3Q8UA 1Q95G 3PW4A 3DRSB 4NYZA 5EUHA 4JV1A 2E2OA 4BRFA 3W62A 4DUYK 3J7AN 1EHWA 2UUWA 2XZTB 2UXBJ 1TKXA 5B09A 4L74A 4YR2A 3CMAS 3RVCA 3V9XA 1GTEA 4ILJA 4CF1A 5ETNA 1LXNA 3CEDA 3CJ3A 3B4MA 1L5UA 1T03B 1VQYA 4M7XA 4DG1A 3OUYB 4NRTA 4UOCA 5HN0A 5HK4A 1HBUB 3CYMA 3KJVA 4FJ5A 1FNXH 1WI6A 3U7JA 3WEEB 3WHIA 4ECZA 2MPUA 3B6PA 4KRWA 3S41A 1NK8A 3VF4A 3H2VE 4JV0A 1M5SA 2B0GA 2K3KA 1U09A 4M3YA 5B0CA 4GVBA 2HGMA 5FD1A 3ZX3A 2W2OP 5KFJA 1NGBA 1EKRA 5D3GB 3H4BA 4BVOA 1YSJA 2YTCA 3KK7A 3B4DA 2F63A 3IAM9 3HSDA 4ZMMA 3DOLB 1YBTA 2Y1RI 3D7EO 2HS4A 4Z4CA 1RWWB 4HI1A 2YWHA 2IMWP 2W7OA 4OPJA 3HVRA 3CF5L 1Q8BA 1SL0A 3HO1A 5IT4A 3P1GA 5H1SQ 4DV6J 3OS2A 1VS3A 1IQZA 4JI0K 2F4VF 3FFIB 4K8XA 2JLEA 2YWWA 1KQFB 1FHTA 3S3OA 1IJEB 3GSDA 1GOCA 1K8AO 1PCAA 3AVIA 1LCUA 2UZAA 2BW2A 3R1XA 3PG9A 5LY3A 1U24A 2FDNA 3S01A 3RBZA 1U2FA 1TKZB 4Z7YA 1VQ5S 2YNHA 2FTRA 4E7KA 3K9KA 1FCAA 2NSCA 1VHFA 3MCMA 2J8SA 4DMZA 3GV8B 3W2VB 2E1CA 4M94A 3Q8YA 4LF7K 2XYPB 3R5JB 3MMJA 4WQ5C 3TVKA 2V63A 4IDHA 2GWJA 1BCMA 4C8LA 1GLFO 3CIPA 4B08A 1BQNB 4IRKA 1QQCA 3P39A 3ILIA 1LOUA 3G8TA 1N4LA 2HHSA 2P9PA 2YKNB 1RBSA 3MM9A 2EFGA 3IBFB 1JCGA 3UE2A 5HLFA 4HKQA 4OPAA 5ETOA 3GU0A 3P6YC 3BDPA 3ILLA 4L73A 4BWMA 2ZQBA 1RHJB 4CLUA 4CJ4A 4DR4J 4X65J 3AD7C 4O44A 3SBGA 2K2PA 3MOJB 4DV1J 2W40A 4KKOA 4HL9A 4DTRA 2H1YA 4LVNP 3CF5Q 1OH8A 1QQNA 3FSIA 2D1CA 5TKWA 3G4SS 2HBRB 3ID8A 1B0VA 4NLXA 2J0QD 2C1EB 2GBZA 1H7WA 4MKBA 2E6MA 1WD6A 2PMHA 2NYIA 1D4XA 3CD7A 3P4UB 4QW8A 4F25A 3G6ES 1J5OB 1U2CA 3NOGA 5CR4A 1SKRA 4DCPB 1PC5A 2HVDA 5HL7L 3MEGA 2ZBIA 2O4GA 3FZHA 2V69A 4KHPF 3G82B 3BN7A 4DL5A 4M5DB 4PPDA 1NJIO 1NMEB 3IAYA 5SWMA 1T05B 4EFHA 1R8PA 4OX6A 1ITPA 1PG5B 1C1CB 2PMWA 1CULB 2KYXA 1RT4B 3IR7B 3GFHA 4Y1CA 3TO8A 3I55S 3QIPA 5BN8A 1V9OA 4RWTA 2NUBA 4F8RA 4RNFA 2P9UA 2CQ4A 2LCWA 4QCLA 3SUNA 4XEIA 3NCQA 1VBZA 1IN0A 2V67A 4DV7K 2DR8A 2XWYA 2CYYA 5BJRA 4GY2B 2NPFA 3SSSA 2DNGA 3SQGB 4CEQA 1ZOTA 2NRWA 1O5JA 1JLQA 1EO1A 3NF8A 3BF3A 4KB0A 1Q8KA 2EK1A 2CWKA 4URGA 1HHQA 4DTMA 4JI8J 2A2CA 1VQ8S 4OYOA 1NEEA 2HHHF 2OTLN 2ZH8A 3MM5B 4XH4A 5KFPA 4RW4B 5IV3A 4FWQA 2XC9A 4FJLA 5HL7Q 1W7AA 3SNNA 3AVJA 3QNNA 2N4CA 1EAYC 4HACB 5EX0A 2XS5A 3GIIA 3L09A 2H65B 2OSQA 4TY8B 2P8IA 3I9V9 4JYAF 2O8EA 3G0ZA 4Q45A 5BXIA 4PR6A 4CECA 5KG6A 5IT0A 2YKQA 4QOZB 5BR9A 2OFHX 4KPCA 2DGQA 2XG8A 2V7YA 5DDRC 3HPGA 4GKKK 4ED2A 5ADXH 3ZT4A 3HSTB 1VYAA 5HVFA 2IOCA 4AHRA 2HKEA 3Q8QB 1WORA 4JKGB 1WSIA 1HR0F 3CC2N 3OYLA 1MMNA 2FZCB 3LP3A 3FZLA 4F04B 2CJBA 4DR5F 2UVUA 4KREA 2G2ZA 3M4XA 2M8DB 2CAJA 3D3BJ 2P9KB 4N5SA 3R6MA 4CH1A 2OEKA 2DITA 3G2XA 4BGAA 3MM6B 1S0MA 4RL1A 4WU3A 4M63C 2VOOA 2F8MA 2VWBA 4JK8A 2W2MP 4K59A 4IEEA 3AA5X 2MKCA 4N77A 3HXMA 4UQTA 2DGOA 3ZZOA 4ECQA 2D0PA 4TU8A 4DHVA 3O9UA 5EXWA 2ZGZA 1CJUA 4LFBK 4WP9A 4NLYA 3VQ4A 2CQ0A 3NWGA 5GMDA 1RKIA 2E7WA 2PEBA 1XJWB 2UV8G 1RBTA 3O1LA 1GT8A 3OYNA 4BRCA 4B8CA 3E8OA 3MN7A 1HWJA 3FCVA 2YQ1A 1HPMA 4LF4F 2VOPA 4U8VA 2ASDA 1NSQA 4BG9A 3QNOA 4K4ZA 1HBNA 2CJYB 3H42A 3ZSQA 4BRHA 2MQLA 3EE8A 3LDQA 2V2ZA 3LPUA 1VRQC 3SV4A 2XMVA 2F4VJ 4JI3F 5KFUA 1UAWA 4J5OA 2ASYA 3L7UA 5C25B 1CS4A 3ZZRA 3C65A 3KLFA 1RU2A 1NGIA 3P8BB 3W9JA 4HTIA 3WQTA 5KFCA 4MIBA 3OVAA 4UT4A 3RGIA 1WG4A 4KGXB 2WAQD 3M32B 4NLBA 3D4JA 2GVZB 4DTUA 3CMEN 3VPZA 4BC9A 2XMMA 4FF1A 3OYEA 1DQAA 4ZVPB 3P5JA 2D41A 1TL7A 3GG4A 1WEYA 3TUJC 1KRPA 3M2RA 4KTWA 3C15B 3HOTA 2P5GA 4ECSA 4FVCA 3LGHA 5ETRA 2VDHA 4H0YB 3AAQA 2R7OA 4JP8A 4OV1A 3O9QA 3PW0A 2JFDA 3PFOA 2R3VA 4F3OA 3VHQA 4A57A 1EKEA 1AUDA 2GX9A 4C11A 3CD0A 4WXWA 1D9AA 4BC7A 4TSXA 1YVNA 4BC4A 1G4CA 4CIGA 1MU2A 2E1YA 4OZJA 1C0FA 2QIFA 1KWMA 5FPMA 3R6GB 4ZVSB 1AT1B 2NXNA 4QPTA 3KLHB 1WOSA 3I4PA 1TK8A 2V34A 1JCEA 1SQEA 1P8GA 1N33F 1RGVA 2MQNA 1U25A 2C3UA 3MECB 4LF6F 3L4BC 5HMYA 2GVDA 3NH1A 4U67L 5LXYA 1YRTA 3QYYA 1Q81O 2KL8A 4O4RA 2D0BA 4ED0A 4L72B 4FJGA 5K5MA 3H25A 2VQEJ 4HT7A 4YMEA 4KHPJ 4PL7A 4L3KA 3ZETA 4JK9A 1XQIA 3DU5A 1W2BM 3R1HA 1YJVA 4CF0A 3I9ZA 2E9TA 3V6HA 3OYMA 4RW7A 1I3OB 1DY3A 3R8EA 3ZSXA 4EIAA 3MPUB 3JQKA 1OKJA 4B3TK 3EZOA 1XC3A 5F8LA 3J7YU 3QAEA 2HW3A 4BDZA 2NLXA 3RTVA 4WFNL 4NCGA 2GHVC 2CA9A 5FJ4A 1JX4A 2UUCK 2J9DA 3MFHA 2U1AA 3W64A 4CGIA 2Z0GA 4FZYA 1GMUA 4RWWA 1C0TA 3T1YF 5CAAA 1VQ6N 2QGFB 2Z2ZA 2WW8A 3MMBB 3CCTA 3VEYA 5TKYA 4NL5A 3FGVA 2DNMA 3ID6A 3PX6A 1RTIA 3RB3A 4C8YA 3CQYA 2M4MA 3QO9B 4O5FA 4USWA 3SDEA 4R8UB 5BREA 3WZ0A 5HROA 1VQSA 5JVHL 2HHHJ 3BJYA 3CCLN 4DOZA 3L2UA 2HVZA 4U67Q 3LH2S 2KHCA 4LFCF 3PTWA 1H2UX 3QB0A 3SI6A 3BEGB 2HNYB 2W6KA 1TFWA 1SJ3P 3KJFB 3ET6B 1CLFA 3AAPA 1HI1A 4OJGA 3QRPA 4JYAJ 4ED5A 3FQLA 4EZ6A 1NJYA 2UVRA 2C2MB 5DETA 4NO7A 1FRXA 3SFUA 4WFAL 1HWKA 4B3OA 3O5TB 1BDGA 4FWOA 3SYZA 2EX3A 1BC6A 2CPFA 5KGXA 3H46O 4F26A 4DB3A 5J1EA 1HR0J 4OI2A 4QIVA 2QV6A 1RDCA 1VQMN 1PO6A 4DR5J 4ZJQA 2HAIA 1BG3A 2XTJP 1D09B 3OBWA 3D54A 3SMPA 4H4MA 4JI2F 1WOOA 2A2DA 5L1KA 2QWRA 3NBPA 3TUZC 5DGBA 4QW9A 1VSJA 3PIOL 4AM6A 2V8HA 2RUSA 4JV2A 4ZVRB 4LRDA 3IA0A 2H3GX 1U1LA 1SC4B 3MUMP 1UVJA 1WC3A 2Q1LA 2V2QA 4LC9B 1WAJA 4B9QA 1DGKN 3J7A1 4UY8O 3SMZA 1XMQF 3VGLA 2R8GA 4C48A 5L46A 1UKUA 2GGPA 3BQ2A 2CPEA 2RDDA 3E01B 2DCLA 1MWQA 3I87A 2LSNA 3CD6N 3HHEA 3QT5A 2OELA 5K14A 3PDNA 3I0SA 2FJXA 3W3DA 3OA9A 2VWJA 3QMLA 1NH7A 1UL3A 4ANEA 4KB1A 2IVOA 1ZZFA 3U4LA 3AVLA 4ZVGA 4DI6A 4ISGA 2B9XA 4LF4J 1X1PA 2CPYA 4QIGA 1VFJA 1IR1A 3AHPA 3JQMA 1S5JA 4GV3A 5LMUK 4DUZF 5FRMA 1FO1A 4JI3K 1Q86T 4JI3J 1IJJA 3LDPA 3SAFA 4H5WA 2QA1A 4FLTA 2JH3A 1IG9A 1ZM3A 1AFJA 5GADI 2MKIA 5ETMA 5MLCQ 3IO1A 1SXLA 1IKXA 1FE4A 4Q43A 3NGRA 3MMCA 3QZ7A 3RZAA 2XHWA 1FRHA 1ZBUA 2VHGA 5IM0B 2IVNA 4UOHA 3C66A 1M1GA 4P6QA 2K1RB 1S7HA 1XMBA 4DV0K 5HQMA 3DJCA 4YR0A 4JUZA 2JOQA 5AQRA 3PIOQ 4F3TA 2I38A 4OQJA 2XMAA 3NGDA 4NWBA 3O4NA 5K9FA 4B3RF 5B0BA 5KFSA 1L3UA 3E2EA 4IXCA 3DXMA 3R3LA 2QA4G 3MEEB 3BN4A 4PRFA 1F9FA 4WCEL 3N4WA 2KT5A 4FXWA 5KRSA 1X5SA 2ACYA 3A8IA 2RRBA 1JLGB 4X4UA 2ZHBA 3ZNJ1 4LSZB 3A8KA 1WTBA 4QZVB 2ZD1A 1R8CA 1S6QA 3PIPL 2DY4A 2Q6CA 3C6HA 4JN4A 3VENA 4JI5K 3H08A 4KH6A 5L1JA 1BHNA 4BVPA 1RI7A 2QA4S 2YJFA 2EW9A 3L2VA 3HVTB 3V6KA 3GQCA 4FM2A 4M5NA 5EWFA 3EKUA 1S72S 4UZCA 3MTJA 5LSRA 3KJNB 3K5OA 5FPNA 3TVZA 1RAFB 4U7CA 1N33J 3FKBA 5A8RA 1YJNS 4ANCA 4Q8FA 3WNFA 1NPPA 4F0KA 1KTQA 2QXLA 4LF6J 2QKBA 1VJWA 1U1MA 3MMVA 3VF0B 4K41A 2BEFA 2HHUA 2DPNA 2HMIB 2H4WB 2HFZA 1TL3B 4MDAA 4J9UE 4OI4A 3ILOA 3ZZ0A 1SQGA 4A8FA 4U95A 4YOVA 1IR0A 3CJQA 4FO0A 1JLEB 2MKYA 4YOYA 2XMTA 2VBYA 4BGBA 5AFUA 3W8PA 2CNLB 1DLOA 3EDRB 5KFNA 4A8QA 4OFZA 1DTTA 5E3PA 4DPOA 4HHTA 3DLBA 4C3KA 3KKFA 4GKJF 4P2SA 4PABA 4WTYA 4G65A 2ALYB 1LFWA 1RDAA 2PT0A 2R2RA 1Z1ZA 3BZQA 3TEHB 2AEJA 2XI3A 3SQ4A 3M8QA 3MHYA 3T1YJ 5KTQA 1MMDA 1GOAA 3M6XA 4EP4A 1A0OB 3DRSA 4PG5A 1Y9OA 4EYHB 1EX4A 3QFWA 4E7IA 3CWJA 1FW6A 2GQ2A 2Z56B 3SQ1A 3N5FA 4PKDB 1R0AB 2W24A 5K8MA 4ZK7M 4I0WA 4FNHA 3QGGA 3VALA 2BOAA 5C10A 3FZMA 1T03A 4CLLA 4NASA 3CCUS 4KHYA 2QA2A 4OI1A 3BH6B 1XUPO 2IM3A 3OUYA 2VGMA 4OHWA 2DBBA 2HEKA 2VPYB 1SI9A 1HBUA 1GX5A 2PA3A 4LFCJ 4Z4GA 4C8OA 2R42A 4LT6A 3OR2B 4LF8K 1G99A 3MEDB 5AZJB 2HLTA 3WEEA 4DL2A 1V6HA 2AGPA 5AQVA 2XS2A 5I9EB 5DQGA 1W26A 3I8DA 1QQMA 1VQNS 3QBXA 5C0YA 2KM8B 2VH7A 3BM7A 3PW5A 4AF1A 1Q18A 2XLIA 3MWPA 3EYZA 1VBXA 5D3GA 3ULEA 3QPIA 3D67A 4JHDB 5KI6A 1RADB 2ZE2B 4LMZA 4LQ9A 2FSJA 2AYEA 1BWEA 3BY5A 4LF9F 3OXLA 2C22A 4PWDB 4M1KA 3DOLA 3BGRB 2NZCA 3N6NA 4FF4A 3CERA 5EX3A 3KK1B 5GAHI 3BF4A 4FXVA 5JMNA 5C2GA 3QJPA 3BO2A 1RU1A 4B9VA 4G1QB 1RBLA 7FD1A 4B1UB 2YWGA 2RNEA 3UN3A 1REVB 4FSVA 3DHXA 4KH0B 3PSFA 4JI2K 1S12A 4JI2J 1LAWA 3NF9A 3M6VA 2E4LA 3FFIA 4Y00A 3OYDA 1XQSC 1DJ0A 2FJEB 2I0XA 2GWKA 1SJQA 5JICA 4CLWA 1IKYB 3S3NA 2VA3A 1S6PB 4X66F 3E9PA 1LEOA 4USMA 1KC8T 1XMQJ 1HQUB 5AQHA 1VR6A 3RW6A 4OX9K 1KQKA 5LJVA 3VF6A 3MTKA 2UXDF 3BSNA 2HFVA 2QT7A 3UN2A 3GYNA 1TKZA 1FXXA 2KG0A 1N8RO 2WBNA 3OW2M 2IIHA 5IOLA 3CB4A 4IQMA 2PYJA 3W2VA 3K58A 1SIZA 1UEKA 1Z2LA 4RNNA 1HUXA 5JUMA 1H0HB 3I82A 1YF5L 3SPZA 2A0FB 2Q66A 3FJ2A 4RUHA 2YKOA 1BQNA 1BU6O 3CJKB 2OPSA 5AE1A 4CZFA 3Q7BA 4DUZJ 2O4IA 4ED1A 3LOUA 4DDFA 4CBWA 3MPDA 2LQ5A 5KFYA 2YY3A 3MCSA 3K5PA 1XMOF 3TX8A 2KJVA 4OJRA 4FZVA 4QYZJ 3MOZA 4LIWA 2BE9B 4V1Ak 1QVGM 2CG4A 4DBQA 3ZEUB 3JAMU 3NMUA 1WSGA 2HWTA 2X6SA 2H3EB 4IH5A 5T7LB 4ETZA 2GEMA 3AVBA 2QSFA 4MK8A 2MDAA 1SQFA 2X1GA 1FKAF 3C14B 1R8HA 2CJKA 1J5OA 2RRNA 4J9PA 1U04A 4B3RJ 2KVQE 1U0HB 3MUTP 1SKSA 1I51B 2XNRA 2GUIA 2ZH4A 3MPVA 4GVMA 4N7TA 1QAJA 3NY0A 4AT1B 1U48A 2AYBA 2W2NP 2P9EA 3G82A 2IPOB 3AVAA 4M5DA 2B51A 2YX7A 5LSOA 1NBWA 3HSZA 2R7SA 3VQDA 2HQGA 1T05A 3OYAA 2E6LA 4NLSA 3AH6A 1OQ6A 2ILZA 1C1CA 2RJZA 4ZHRB 3GBTA 3OYJA 1ACMB 4KH1B 2LEPA 4QR1A 1CULA 1NG9A 3ZLJA 1NZ8A 1ATSA 1RT4A 4WQ4C 3V6JA 3TI0A 4DJBA 3OSNA 1WBBA 3CCSN 2DEJA 2E1PA 2DNKA </