3V6DA

Crystal structure of hiv-1 reverse transcriptase (rt) cross-linked with azt-terminated dna
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTNSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
total genus 147
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v6dA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v6dA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v6dA05
4KV8A 5L1LA 3DI6A 4IR1A 5KGXA 4N5SA 4M3RA 2D3UA 3IS9A 2WOMA 3UR0A 1RT1B 4NLSA 3PJWA 2BQUA 3KLIB 3AA2A 1HPZA 3AA4A 5KFNA 4NLTA 2WK4A 4C8KA 1EXQA 1BQMB 4ZPBA 4CEQA 5KG4A 3KLIA 3CJ3A 2VG6B 5SZTA 2OYQA 2VG7B 4DWIA 4F8RA 1RT6A 3NGIA 1LW2B 4JV0A 1HQEB 3S3MA 5F9LA 3LDSA 3HKWA 3PV8A 4DS4A 3QESA 2XGQA 3CDUA 4ED0A 3C94A 4JRQA 3ALYA 4ED2A 3KLEA 4CGGA 2QKKA 4NYFA 4E3SA 1RBSA 1KSPA 3AVFA 2UVUA 2C28A 3PX6A 2WONB 4NCGA 1C6VA 4M3UA 3ISND 3RB4A 2JLEA 2AQ4A 4O3QA 4URGA 3GV7B 2R8IA 3ULDA 3LP1A 1Z4UA 4H54A 3BQ2A 3V1OA 3H08A 4FLYA 5KFOA 4DL3A 2ALZA 3QEXA 3NH0A 1HYZA 4TY9A 1S1UA 4E7JA 1U48A 2R8HA 2XO7A 1UA1A 4EYIB 3KK1A 5KT2A 4NLYA 5F8JA 4O5BA 1B9DA 2ASDA 2BRKA 2BR0A 4YQWA 1ASWA 3M9OB 1IH7A 2BE2B 5CZ1A 5DK5A 3K5LA 2D7SA 1T7PA 5DG9A 1EX4A 1S1TA 2BDPA 3VQ7A 3QETA 4HUGA 1UOCA 4TY8A 4ZPCA 4C8LA 3QZ8A 5T7BA 1HARA 4O3OA 3RRHA 3QEWA 1QQCA 4LD0A 4XIUA 4PUOB 4GMJB 3QIPB 1TAUA 2A1RA 4FLWA 4OPJA 4LQ9A 4OKJA 5KI6A 1BISA 2FJWA 4QWDA 3T5KA 2XY5A 4FZXC 4FXDA 1VSMA 3CJ2A 3NE6A 4MFBB 4CFDA 4Y2CA 3DOLA 3E51A 4JS5A 1NK6A 4RUCA 4DTRA 4HHTA 4CHOA 1L5UA 3LWLA 5KFFA 4QPXA 4FJ7A 3VQCA 4ZVFA 2KTQA 3LP2B 4J9SA 3KLVA 2KFNA 2HHWA 3Q8PB 4QW9A 3NGZA 3TWHA 4DS5A 4KTZA 2DFEA 5C25A 3PR5B 4KHNA 3KHLA 2R2TA 1FKPA 5J2NB 2E6MA 4B3OA 1K1SA 4EBCA 2OZSA 5KG1A 1Q9XA 3MXIA 1ZYQA 3BSNA 4CJSA 3HVRA 1LW0A 5KFDA 3KK3B 2XY8A 4PA1A 4NZ0A 5HBMA 3RBEA 5KFZA 1TKXB 4IH5A 4DQQA 4CIEA 3SQ2A 3TI0A 4J9OA 3OL9A 3AVCA 1U4BA 3KHGA 3AVLA 5KFSA 2B6AB 4Q8FA 3NBPB 5C24A 3L2RA 4HVJA 4I2QB 1SV5A 4TY8B 1WSEA 4B9SA 4K4VA 2OPPA 1KHWA 4MH8A 3G6YA 2QXFA 2YNIA 3LANA 5KFLA 4B9VA 4F2RA 2FBXA 3KLHA 1RT7A 3LP3A 3L2UA 1QAIA 2HNDA 3HP6A 4J2EA 4YR0A 4Z4IA 2HVIA 3KLFA 1R0AB 3SV4A 2IM3A 4Y1DA 4FS1A 4WYLA 4KRFA 4DL6A 3OSPA 3K59A 3VA0A 3LP2A 3H4BA 1VSIA 1TKTB 1WSGA 2YKNB 1WSIA 2PZSA 2ZKUA 3SUQA 1L3VA 5KFGA 4CF2A 4RW4A 3T5HA 3OS0A 4EBEA 5KFHA 3QGHA 4O44A 2XGPA 1LAWA 4R8UB 1TVRB 1Y97A 4MFBA 4ECWA 4K8ZA 4WYWA 4ICLA 4KO0A 1WAFA 4W5RA 3S3OA 2W8KA 2IAJA 4ECQA 3FSIA 1JLCA 1VRUA 4Z4CA 3D28A 4KI4A 1JLQA 2JEJA 4HUFA 2BQ3A 2YNFA 1VSKA 4RW8B 1I3AA 3SQ1A 2X78A 2DY4A 4ZHRA 3MTKA 1LW2A 3DYAB 4IQXA 3GV8B 5F8GA 4RZRA 1JX4A 2Z1JA 5JUMA 1NK9A 1NK8A 1S1TB 4HTUA 4RW9A 4X2BA 1LWEB 1VRTB 1GX5A 1T05B 2RN2A 2AGQA 3I5CA 2HWIA 4CHQA 1HMVB 3V9ZA 3VQ8A 3SI8A 3GIJA 1HMVA 3T3FA 4NLOA 2D3ZA 1DLOB 3OJSA 2RKIB 3DLEB 3LZIA 1RBVA 5J2PA 2OPPB 1QAJA 3P83D 3IRXB 3LP0A 4Q8EA 2B4JA 4FJLA 4FLTA 1NJYA 3U3YA 1TL3B 4E89A 3FFIB 4Q44A 3QIDA 3FQKA 4ZVGA 3NAHA 3PX0A 5F8IA 2IAJB 1C1CB 3BSCA 3WNFA 3RMDA 4NCGB 3SCXA 2IC3B 1EP4B 3L2WA 3HYFA 4BWJA 3NH1A 3DLGB 3ITHA 4LSLB 2HHQA 1QSSA 1TKZA 1SUQB 5FRNA 4CFBA 2PY5A 4EYHB 4EO6A 1LWFB 4IOBA 3BJYA 1IKXA 3OL8A 3OYJA 4G1QA 4W5OA 3CDEA 4DL5A 1EETB 4CEBA 4R5PA 3V4IA 2ILYA 3KTQA 4JV1A 3MEEB 5F9NA 2JC1A 3NGYA 2Z1HA 2FVPA 3NL0A 1ZBIA 4KFBA 3F73A 4CFCA 1L3UA 3I5BA 1VSEA 4Z4HA 2VWKA 4CJKA 4O3PA 2HHVA 3HK2A 3NF6A 2YV0X 3SUOA 4IFYA 1X9MA 2W7PA 4RNOA 4M42A 3T5JA 4CFAA 1HNVB 4MKAA 5KG2A 1Z26A 4IDKB 3GV5B 4CEAA 3PZPA 5HBMB 4CJUA 2HMIB 4KAZA 1NJZA 3NH2A 4QWBA 2W9BB 4M95A 4CK3A 1WN7A 1S1VB 5CYQB 2FVCA 3JSMA 3TAMB 2W9CA 2G8UA 3TABA 1VSLA 4J9PA 3DRPB 2XY6A 5KG3A 1SH0A 4YR3A 3SQ0A 4B3OB 4KSEB 2Z1GA 3N6NA 4DTNA 2IJNA 1RT5A 4NRUA 5KT4A 1QUVA 4FJ8A 4FJKA 2DPJA 2E9ZA 2CKWA 4ZTFA 5K14B 2ZD1A 4LSLA 3V9UA 2C2DA 4IG3A 1S49A 1TGOA 3ZT4A 4CHZA 1KRPA 3K5MA 3QINA 1YTUA 1S6QB 5KRSA 3JYTA 3K2PA 4B8AB 3LWMA 3TR8A 4DTOA 1C1BA 1JLBB 4LSNB 4LQ3A 3L2VA 4I2PA 3MR3A 2WHOA 1WAJA 2G8FA 2R7YA 4JS4A 4JLHA 4HUEA 4CHYA 4KB0A 3RB0A 1C0TB 3V81A 4RG8A 3HO1A 1JIHA 1RT2A 4TQRA 1KLNA 3LAMA 5KFRA 3QO9B 4WFZA 4ECVA 1LV5A 3OL7A 5KGWA 3PW2A 2IS3A 1WSFA 2FC0A 3V6JA 3PO5A 3ZT3A 1KVBA 1XR6A 3CQ8A 3THVA 4DQIA 1D1UA 4KTWA 2WB4A 2KFZA 1O1WA 3HJFA 1FXXA 1BI4B 1HQUA 4H4MB 1VSDA 1IO2A 4IH7A 1BQMA 1JXEA 4QW8A 5L1IA 4C8OA 1LWEA 2BE2A 3T1AA 1JXLA 1T03B 1SL0A 1HQUB 4DFKA 2IM1A 2ATLA 4Q0BB 1MU2B 1JLEB 3AA5X 4CHNA 3K5OA 2YNGB 4CF8A 3IG1B 1RT1A 1LWFA 4CERA 1S1WB 3ZSWA 2HNYA 5HLFA 1RTHB 1VSJA 5I42A 4QWEA 4ECUA 2VA2A 4O3SA 1ZTWA 3LPTA 1JLAA 3AO1A 1TK5A 2RF2A 2V0NA 4KHYA 1BCOA 3I5AA 3GYNA 4FJ9A 1SKWA 5J2MB 3HL8A 2YKNA 5L1KA 3WNHA 4ZP8A 2ATQA 3RAQA 4CGIA 2XHBA 5KFBA 3M9NB 3ZSXA 1R0AA 1A5WA 3DRRB 4N56A 3GIKA 5JS1A 3OL6A 4BE0A 3QERA 2FLNA 4U6PA 4FZZA 3CJ5A 1QS4A 1N56A 1RT7B 4MIAA 4FM2A 5FROA 1NHVA 4CJWA 3VQDA 1GOCA 2ETJA 1BI4A 4RNMA 4DL7A 1S0MA 4DSJA 4E19A 3CFPA 1YVFA 3PO4A 4I2QA 1LWCB 2HHXA 3AO2A 4KHSA 4RW8A 1NNDA 1CXQA 1JLQB 3VQ6A 4ECTA 3AVIA 4FCYA 3BGRB 1RCHA 1J5OB 4NYZA 3MF5A 3HVWA 2E9TA 2EC0A 1KFSA 2G8IA 3VQAA 2R8JA 4CEDA 4HCCA 2I5JA 5KFYA 3H5SA 3LALA 3IN5A 4J9MA 2YHBA 1I6JA 3UDLA 1D8YA 4L8RB 2AX1A 3KLGA 1A5VA 4DG1A 2O4GA 4DLGA 2P1JA 1MU2A 1RNHA 4Q0BA 3ZCMA 4DLEA 3RB6A 3DMJA 4B9MA 5HRPA 1IKXB 3TARA 4XPCA 3CM6A 3IGNA 4B9TA 4DU4A 2IA6A 3OJUA 3CM5A 4DSIA 3M8PA 4TYAA 4ECZA 2FJXA 4F4KA 2XCPA 3MEGA 1SKRA 1FKOB 5CYMA 3DRRA 3NF9A 4FLVA 5HRSA 4DSEA 4JUZA 4FM1A 3L3VA 2Y1IA 4CJFA 4FK2A 4CGFA 3QO9A 4CJTA 2R2UA 1BCMA 2KQ2A 3KD1E 3OYMA 5KFTA 4B8CA 3MECB 4TXSA 3QIPA 5DMRA 1S0NA 4H4OA 5FDLA 4IKAA 1QSYA 1ZBHA 1G15A 4CESA 4I7FB 2W8LA 2HNZA 4F3TA 4DQPA 4F4YA 3OYCA 1LW0B 1JKHB 4C8NA 1N4LA 2RDIA 1RAJA 1TK8A 1NKBA 3UPFA 3SNNA 5DGBA 2R8KA 4DFPA 4O55A 3ZSQA 4WXOA 4KHRA 2V4RA 5L9XA 4AHCA 4J2DA 4KFBB 4NLWA 1WNEA 1XHXA 2Q3SA 2HHSA 1QTMA 4AHUA 1L3SA 4HYKA 5KFVA 1RBRA 1T05A 3H59A 1ZBLA 4RW9B 1WSHA 3IG1A 3SUNA 3V4IB 4BACA 2PYLA 2YKMB 3NDKA 3GILA 3A2FA 3QLHB 4J9NA 4F50A 4G1QB 3I0RA 4K4WA 2Z1IA 4FW2A 1T94A 4ZVHA 2YNFB 3AO3A 3I0SA 3BREA 4ZP6A 3K57A 2XY7A 4W5QA 4YMEA 5HP1A 3MEDA 2J6TA 2D0BA 4ICLB 4EO8A 2Y1JA 3HM9A 5KFWA 1ZETA 4FJGA 4WE1A 4NLGA 2HNZB 4I7FA 4GC7A 2HB5A 3AO5A 5KFUA 2EX3A 1D9FA 1JL1A 3L3UA 4FJMA 4JV2A 3N6LA 4IBNA 3AO4A 2IBKA 3ZT0A 1NK4A 2VG7A 2GIQA 3HT3A 4ELUA 5KFJA 5C5JA 3GIIA 4F3OA 1S6QA 2XC9A 3CG7A 3O3FA 1U09A 3QIOA 2P5GA 3SJJA 2ZD1B 5KT6A 2B5JA 3NAIA 2UUWA 4Y1CA 1KFDA 1A5XA 1U49A 4DFJA 4ZVEA 4PWDA 3PR4A 3OS1A 3VQ4A 4GC6A 3GQCA 2F8TA 4FJIA 1S9GB 4FJHA 4OGEA 2ZE2A 1IKVA 3DYAA 4RW7B 3MAQA 2W9CB 3NGDA 5C24B 5KFMA 2LSNA 1W0HA 2IM2A 3H5UA 3OS2A 4WFYA 3OHAA 1BGXT 1RILA 2I5JB 2OPRA 2QV6A 3CO9A 3H5XA 3KK3A 1JLAB 1WLJA 4DTJA 4DF8A 4CK1A 4CJLA 3OSNA 2IDOA 1BHLA 4YR2A 5EWGA 5HROA 3BGRA 4I9QA 3NHGA 3LP0B 3IRXA 4O0IA 4M41A 5F8MA 1NOZA 2GIRA 3E01A 3FRZA 2HWHA 5KG0A 1S1WA 1GOAA 5HRRA 1LWCA 3OYDA 1GOBA 1TV6A 3KIOA 4AHSA 3D45A 1RDRA 3OLAA 4DTMA 4KHMA 4CEOA 4KTQA 2UVWA 4Q5VA 3I8DA 4OJRA 2ILZA 5KFKA 3OHBA 1T8EA 4Z4FA 1SH2A 3RTVA 3SI6A 3OYGA 2FBTA 4CE9A 4FBUA 4M3ZA 1ZBFA 4AH9A 4ED7A 3K5NA 3DOLB 3M8SA 4E7KA 4WFXA 1SUQA 4EBDA 4N41A 3LZJA 1VRUB 1SV5B 3CJ4A 2CJQA 3PY8A 1RT2B 4KKOA 3DLGA 1NKCA 4QWAA 3O3HA 3V81B 4BWMA 3QGIA 2FBVA 5HP1B 4J9QA 1J54A 3V9WA 3RMCA 3OY9A 4KB7A 3QZ7A 1UA0A 4NLDA 3FQLA 1TL1B 2A1SA 1JLGA 1TL3A 2HHTA 3AV9A 4IG3B 3I0RB 5I42B 4OLAA 1IKYB 3C6UB 4DTPA 1S1XA 1FK9A 3DOKB 4N47A 2BRLA 1C1AA 4BE2A 5FRMA 2JEGA 4EZ9A 3NCIA 4FLUA 1NK0A 4QAGA 1TP7A 1HYVA 1T03A 4QOZB 1W25A 4ZPDA 4WZMA 1RYSA 3KLHB 2F8SA 3RR7A 3JSMB 1JLGB 5CYQA 4Y34A 2AJQA 4H4MA 4ID5A 4FM0A 3QEIA 4DL4A 3ZSRA 4CJPA 1N6QB 3AVGA 4AHRA 4IKFA 3U3GA 2QKBA 4MQ3A 3V6DA 4FJXA 3MECA 4YP3A 1TKXA 4E7IA 2HAIA 4FVMA 3ZSOA 4KO0B 1UAXA 3Q8SB 2C2EA 4ED8A 3VN5A 4R8UA 2OPSB 1U47A 4O44B 3DM2B 1B92A 4I2PB 2V9WA 1IM4A 3O4QA 4LSNA 1C1BB 1JLBA 2AU0A 4OL8A 3AVKA 2OH2A 1TKTA 4OKEA 3T5LA 4DMNA 4FK4A 2G8HA 5KFIA 5D3GB 3DMJB 1S4FA 1S97A 1HPZB 1JLFA 4U7CA 4RUAA 3CVKA 3DLRA 4ECRA 1MMLA 4N76A 1JLFB 2QE5A 3IS9B 3KJVA 4FJJA 3CFOA 4M94A 3KOAA 1IKWB 4K4ZA 1IKYA 3C6UA 2R8GA 4E0DA 2D41A 4LH5A 5J1EB 3O4NA 4F4WA 3DLKA 1D9DA 1EP4A 1YTAA 3V6HA 5EUHA 2HMIA 4HKQA 4CF1A 3OYBA 5DQIA 2DPIA 4IDKA 1ZTTA 4RNFA 2BANA 2YNHB 1NJWA 4CF9A 3RWUA 2EHGA 4WZQA 4OKKA 4CIGA 4KHWA 3V6KA 4CEZA 3KLEB 3PX4A 1N6QA 1RDAA 3LAKA 1LAVA 1ZBUA 2FVQA 3C6TB 4QCLA 4CJEA 3HPOA 4B9LA 2UUTA 1DTQA 1RT3A 3RAXA 1NK7A 1YT3A 4O3RA 3NF7A 2ZQBA 4K4TA 3L2QA 1K1QA 2IJFA 4CJRA 4FBTA 1DTTB 5DQGA 2VWJA 2D5RA 1FKPB 4RNHA 4G3IA 4GVMA 5C25B 2P5OA 2P51A 5KG5A 3HVAA 1T3NA 4DG1B 3CJ0A 4KBIA 2XCAA 5E41A 3E01B 1XHZA 3EYZA 3BQ1A 2X74A 5EWEA 3G0ZA 4UQGA 5HROB 1SH3A 4NLVA 3QNOA 1CZ9A 2DFFA 3MR5A 3MEDB 4CGDA 3HHKA 3U6FA 1C1CA 4B9UA 4URSA 1SL2A 1J5OA 3SFGA 5HLFB 5J2QB 3EPIA 3NFAA 4IH6A 3B6OA 4I9LA 1RTDB 1ASVA 3PW4A 3VQ5A 2V4QA 1D5AA 4DEZA 4E7HA 3RBDA 4RNNA 2G8VA 1IKVB 2PYJA 1RT6B 1S9GA 5EU7A 1B9FA 2OZMA 3TAGA 5DLFA 2YKMA 5J2PB 3SZ2A 4PY5A 5DLGA 1QE1A 3OYAA 4Z4EA 1QHTA 3HVTA 1QSLA 3KK2B 3VQEA 2B5JB 3CFRA 1S6PB 1DTQB 2BGGA 1VSHA 1W9HA 2KZMA 4LH4A 3AVJA 3K58A 4KI6A 3HPHA 4BDPA 1UWBB 1TL1A 2J6UA 2NUBA 5JXSA 2E9RX 1GX6A 5J2QA 4NLPA 1JLCB 1S10A 4Q43A 3BQ0A 3KD5E 3H5YA 1S5JA 1JL2A 5DQHA 4FJ5A 4PQUA 4KAIA 3MEGB 1RBTA 5DG8A 3D0PA 2UVRA 2I1RA 3OYKA 4FS2A 4FJNA 2O4IA 3PHEA 3GIMA 4ECSA 1RT5B 4M3WA 3KJVB 3H4DA 5J2NA 2KZZA 1U04A 4HCBA 4DQRA 1XWLA 1C0UA 5KFPA 2IMWP 3M9MB 4CHPA 3ZT2A 3KLFB 1RTJB 2DTUA 5KFCA 1XI1A 2AGPA 3EPGA 1VSFA 4K4YA 4EEYA 3MR2A 1F21A 1KCFA 3AVMA 3SV3A 4Y3CA 5KTQA 1RYRA 4IR9A 3OYHA 2WOMB 2D0CA 5F8NA 3V9XA 2OA8A 4NLUA 4KV8B 3DRSA 5KT7A 4CEEA 4ZTJA 1HJRA 2XI3A 4WE1B 2AGOA 4CIFA 3V1RA 4IFVA 3V6DB 1S48A 1C0TA 2X6SA 4FYDA 3VQQA 1NHUA 2JEIA 3AVHA 4TN2A 3VA3A 3D5MA 4E1NA 4XO0A 4B9NA 1X1PA 4F4XA 2OPQA 3PVXA 4J9LA 2AX0A 3P1GA 3M8PB 3PUFA 3CWJA 3HP9A 1RBUA 4RW7A 3RRGA 2QK9A 3B6PA 4O4GB 5JS2A 4NLRA 2ASLA 3MFIA 3VQBA 1U45A 3AVAA 1SL1A 4YNQA 3M8QA 2JEFA 4K4SA 4NCBA 1J9AA 1REVA 3NMAA 2RPIA 2F8EX 2B43A 3T19A 3OYNA 3AVBA 2O5DA 2D0AA 1K6YA 3PW5A 2C22A 3KNAA 1CLQA 2JGUA 5D3GA 3TAMA 1RT4B 1S1VA 2W9BA 4M45A 3LP1B 1RDBA 4R0EA 5KG6A 3DM2A 5EWFA 4ELTA 5C42A 4OGCA 4IFVB 3QYYA 3L8BA 5KFEA 3PJXA 4FLZA 4J9KA 3QGGA 3BDPA 3H40A 1KVCA 5SWMA 4FK0A 3C95A 4KE5A 1HQEA 3SPYA 4DTSA 3KK2A 4O4RA 4IRKA 3DLHA 3AVNA 4ID5B 3BR9A 3EZ5A 4CJ5A 3HVTB 4CGJA 4MK7A 3VQSA 4O0JA 3KHHA 5CY4A 1KVAA 3TVKA 2F96A 3VQ9A 2DFHA 3OLBA 4W5TA 3G86A 3QNNA 1CSJA 5KFQA 3G6VA 4C8MA 1TV6B 1C0UB 3G10A 4ECYA 2RDJA 3SYZA 3S9HA 4GW6A 4AHVA 4DQSA 3EZUA 1BQNB 1FK9B 1S1UB 4CJ4A 4NYNA 3RMAA 4K50A 4OPKA 1L3TA 4DF4A 4PQUB 4E1MA 4J2BA 2IC3A 3ZSVA 4MK9A 4Z4GA 1KLMB 4IG0A 4RU9A 5KT5A 1XR7A 4M3TA 4IG0B 3NF8A 5FDLB 3QEVA 1UWBA 4FLXA 1IG9A 3QEPA 3CDWA 4TQSA 4ID1A 4AHTA 3HXMA 3KMQA 1BQNA 1FKOA 5CYMB 2IM0A 4MKBA 1WNSA 3DLEA 2RKIA 1S6PA 1DLOA 1HYSA 1NJXA 2HNDB 3M8QB 2YNGA 4DSKA 4PWDB 2WCXA 1JLEA 1HNIA 2E6LA 3TAQA 1ITGA 4J2AA 2VG6A 4YFUA 1HNIB 1D0EA 1RA7A 1QE1B 4O3NA 1VRTA 3RB3A 4ELVA 4F4ZA 2YNIB 2OPQB 2HVHA 3V9SA 2WRMA 3HSTB 1RA6A 2E4LA 4ZHRB 4ED3A 4ED6A 5KG7A 3RMBA 1RTDA 4URQU 2BANB 2AWZA 4IRDA 3OYFA 4KHQA 1S9EB 4ZPAA 3F9KA 4CF0A 3OYIA 3TAFA 3KMSA 3MFHA 1NK5A 4MK8A 5CZ2A 2XRIA 1TVRA 4RW6B 2W7OA 4CCHA 3NKYA 4NRTA 2R2SA 3TQ1A 4EP5A 3UQSA 5J1EA 3S3NA 1X9WA 1RTHA 2IOCA 4K8XA 5KFXA 4Z0UA 3FDSA 3I0SB 3RR8A 4ECXA 2GUIA 3BSAA 4TYBA 3MEEA 5KFAA 2C2RA 4ZP7A 1CXUA 4BE1A 1Z25A 4CJQA 2ZE2B 2FJVA 4J9RA 2X6NA 3TAEA 4FZYA 4W5NA 3NAEA 1CZBA 2WTFA 5F8LA 2W42A 4NLQA 1OS5A 4O4GA 1RTIB 5I3UB 4DU3A 1NKEA 1BIZA 3N6MA 1RT3B 4WXWA 4NCAA 3ITHB 2ASJA 3SUPA 4DL2A 3P5JA 3C6TA 4FW1A 1JKHA 4ED1A 5HRNA 2YHAA 3DDKA 3TAPA 5F8HA 3M8RA 4F2SA 4XPEA 3NBPA 3FFIA 2YNHA 5J2MA 4H4OB 2FLLA 1XR5A 2VG5B 1N5YA 4OLBA 3EY1A 3G6XA 4LY7A 5KRTA 1KLMA 3DRSB 1TQLA 3DLKB 5L1JA 1BIUA 1I39A 2HW3A 2HNYB 1SKSA 1ASUA 4DTUA 3ASMA 2GBZA 1RTJA 3ZSZA 3QLHA 4R5PB 3OYEA 1S1XB 3DOKA 1EETA 3DRPA 2JC0A 3DLBA 1RDDA 3H98A 3ICLA 4CEFA 4ZP9A 1N48A 2FLPA 3PW0A 3KLGB 4MIBA 2R2RA 5EDWA 4DTXA 3IGVA 4EP4A 3UIQA 1VK0A 4CJ3A 1EKEA 1YVUA 3ZT1A 2OPSA 1TAQA 3Q8RB 3VQPA 2XWYA 4CECA 4TSXA 4Q45A 4IFYB 2VG5A 1N5YB 3OYLA 4DSFA 1S9FA 4PUOA 2IGIA 2KW4A 4KREA 1KTQA 4KB1A 3HPGA 1Q9YA 4B08A 4IRCA 1NOYA 4AILC 4TLRA 1RDCA 5KT3A 2VA3A 3PW7A 5C42B 4JRPA 3KKRA 4OVLA 3MXJA 4BDZA 3Q8QB 2HHUA 1J53A 3BSOA 2BQRA 1S0OA 1TKDA 3JYTB 3AA3A 1Q8IA 3O3GA 4H8KA 3IAYA 1RT4A 5T14A 3V1QA 4DSLA 5K14A 2FVSA 1BL3A 4CJVA 1DTTA 2FBYA 4E7LA 4M3YA 1RTIA 5I3UA 4Y2AA 3CIZA 4NLXA 4K4XA 1REVB 3KKSA 5DG7A 2XI2A 3MR6A 3KK1B 1HYSB 3SFUA 1WSJA 2ITGA 2GC8A 3DI6B 2G8WA 4BDYA 3OVNA 4K4UA 3SPZA 3WNEA 1TKZB 2GV9A 3WNGA 3H2LA 1HRHA 1JXBA 3MXMA 4DFMA 2B6AA 4M3XA 1C2PA 4CK2A 1XC9A 3SQ4A 2J6SA 2UVVA 2OPRB 4CGHA 1TK0A 4KPYA 1KHVA 3CYMA 2RF2B 4DU1A 4ZMMA 4RW6A 3TANA 4EZ6A 2WONA 3LPUA 1HNVA 3ZSYA 3KHRA 3ISNC 4QWCA 2FVRA 4KKOB 4RW4B 4KHUA 1S9EA 2G8KA 1C0MA 1IKWA 2W9AA 5DGAA 1X9SA
chains in the Genus database with same CATH superfamily
5L1LA 3DI6A 1Y5IB 4C97A 4N5SA 4JI5K 2D3UA 3IS9A 2JOQA 1B64A 2WOMA 3UR0A 2YH1A 4CZLA 2QEXN 3AA2A 3J7AN 4LF4J 1M90O 3AA4A 4C8KA 1EXQA 3MWTA 4HTJA 2D3OR 4NMXA 2HWTA 3P5TL 2VG7B 2I7PA 4K0KK 4OI3A 3VAGA 2W7AA 3R7BB 3LDSA 5LM7E 2RT3A 1F3VA 3BR8A 3CJAA 3C94A 3MMCB 3PEHA 5K5MA 1TZ0A 1KSPA 1RBSA 3AVFA 4N8NA 4B3RK 2WONB 1C6VA 4M3UA 4QIGA 2CQ1A 2AQ4A 2Q6BA 1E6VB 4N8OA 4URGA 2AJFE 2R8IA 1T6DA 3FSXA 4LBPA 2E5LJ 1U1LA 1OMSA 4OX9F 4DL3A 5ETLA 3OXGA 1NGEA 4QBUA 4E7JA 1AROP 3MN9A 2BXJA 5EX3A 3KK1A 4LJMA 1NO8A 4MDAA 1PCAA 2ZZNA 1B9DA 1IUJA 2ASDA 4DV1K 3VGLA 1KVKA 1RXOB 4FYYB 3M9OB 3IR5B 1N36F 1VQKS 1IH7A 1DQAA 2CJAA 1NGAA 1Q5VA 1T7PA 1EX4A 2XEXA 4WKRA 3HBTA 4HACB 4WK1A 3NY0A 4TY8A 4D3GA 3L0QA 3QZ8A 1OY8A 5T7BA 1VQLN 2PBDA 1OY6A 2LU1A 3ZTQA 1TR0A 3RRHA 1QQCA 3QIPB 1SZ2A 4LT6A 2A1RA 4FLWA 1FD2A 2BBEA 3PRVA 3KDOA 1TTHB 2FJWA 3ZLJA 4FZXC 4FXDA 1VSMA 3MOJB 4X4NA 4PAAA 4G65A 3E51A 2EG1A 2VQEJ 4RUCA 4TU7A 1VQ6N 3FCWA 3A8JA 5CXTA 4DV3J 4TU9A 3VQCA 3AHPA 1MN9A 2KTQA 2HHWA 5LJVA 3AD7C 2ZFHA 5J1NA 4ZPTR 3BO3A 1UL3A 4OX7A 1F1BB 2XMTA 3M2UB 3ZZZA 2HBKA 5J2NB 2E6MA 1H98A 1RLDA 4JI3J 3TSQA 1X9JA 2E2NA 5AQFA 5KG1A 1Y3JA 3G8QA 3J80O 3BSNA 4I6MB 5A2QU 3KK3B 2XY8A 4DV5K 3VF6A 5A6PA 5M2RA 4IH5A 1K0TA 3SQ2A 3DXSX 1U4BA 2NXJA 4L74A 1JJ2R 2YKQA 4DDFA 3TTCA 4CTAB 1SV5A 4TY8B 1WSEA 4J91A 4HACA 3D0HE 4M63A 4MH8A 3G6YA 2A6MA 1K9MT 3O3LA 1HIYA 2MLYA 4F2RA 1EWQA 4X4RA 3MM5B 5HMWA 1JJCB 3O2IA 4J2EA 3HDSA 2RQKA 3KLFA 4Y1DA 4DR7K 3QT8A 3H6EA 4A57A 3GIRA 4MDBA 3OSPA 3MM9A 1P1LA 4NA3A 1YF5L 4FN5A 3MMBB 3THYB 1WSGA 2ZKUA 3U9DA 5KFGA 3P6YC 4JI0K 2CNLB 4BBYA 2XGPA 4O44A 1WC6A 3ENWA 4YOXA 1Y97A 2HYIB 3DRYA 3MGJA 2J0SD 4K8ZA 3IXQA 2C42A 1WAFA 2HLUA 2CQBA 1YBUA 3MMCA 1JLCA 1UVNA 3SK3A 1VRUA 1W26A 4XEIA 3NCQA 2CJKA 4HUFA 3UFCX 3A3PB 2YNFA 2LEPA 3CULA 4P72A 4CZIA 2ROEA 3MTKA 4KH5A 3DYAB 4IQXA 5F8GA 4QU7A 2Z1JA 2C2NA 1VIOA 1NZAA 4RW9A 1GX5A 4K59A 2HWIA 3V9ZA 2RUSA 3TO8A 1HMVA 4NLOA 4QJVA 3UR3C 1FERA 1UJ5A 1RDWX 3GSDA 2CJXB 2OPPB 2VWBA 4U7BA 3BH7B 3IRXB 4RUBA 3VEYA 4Q8EA 5DO2A 3BKFA 3D7EO 4PRFA 4E89A 2C2KB 1S6UA 4FWKA 5E84A 3SLCA 3NAHA 3PX0A 5F8IA 2IAJB 1NHKL 3WXKA 1C1CB 4KH0B 2IC3B 3HYFA 5JVHQ 4OZ5A 3QWUA 4CWBA 3OT9A 3QJPA 2O8DA 3PYFA 3R6LB 4EO6A 1LWFB 3T69A 3W9HA 2Z57B 3BJYA 5D8HB 3SIPB 3OL8A 3OYJA 3CDEA 2CGJA 3O80A 2VODA 5IM0B 3V4IA 1RAGB 1NAQA 4LFBF 2AYMA 5F9NA 1XMQK 1X5OA 3NGYA 1WJ9A 2Z1HA 4TLQA 1L3UA 2E1YA 3I5BA 2M52A 2QMWA 4CJKA 2HQIA 4O3PA 3CXCR 1HI0P 2VFRA 4WQ4A 2FJBB 2GMHA 2IDLA 3ET6A 4J37A 4MYTA 4XK8C 5LMUJ 4JI0F 1EWRA 3SUOA 1IWGA 1PAUB 1X9MA 2HRYA 2B7BB 3CCSN 2V5HG 3H8YA 5AQUA 2UXBK 3GV5B 2FHOB 1NJZA 4LFAF 2EG2A 4CK3A 1WN7A 1XMOF 2V2KA 3TAMB 3K2YA 1ZXOA 2HHPA 3TABA 3JTOA 3BKTA 5IM0A 2MKIA 3DRPB 3SQ0A 2HQ3A 4B3OB 3NGTA 1M90T 3HZGA 4AYBD 2BVZA 3TTFA 1N33J 5G4DA 4NRUA 1N52B 2ATCB 4YDUA 2BV3A 1MA9B 2KH9A 5K14B 1KRPA 4M5MA 3QINA 2E1ZA 1YTUA 4JI1F 3JYTA 3K2PA 2NLWA 1K0VA 1JLBB 4LSNB 3AB2B 3CJKB 3L2VA 2WHOA 2WFBA 4E98A 3T7ZA 3HMJG 4FXWA 3CW2C 3V81A 2XHWA 2YH0A 3WUHA 2FGCA 2ZHAA 4RG8A 3HO1A 1VQ9S 2ADCA 1JIHA 4TQRA 4JBCA 4D3HA 3QO9B 3PIPL 3VGSA 1Y3KA 3H45C 2H48B 3PW2A 4H5RA 3DKDA 1WSFA 3M1FA 5GAEI 1O1WA 3CC7S 2PC6A 3ZTOA 1FXXA 4DV3F 2LQ8A 1IO2A 2U1AA 2RHSB 3KXDA 5HQMA 4B3TF 4DUYJ 3T1AA 4DUZJ 2EEYA 4BC9A 3LO3A 1X4BA 1MU2B 1JLEB 4DPOA 3IG1B 3AB4B 4B3SF 1A7GE 2RQ4A 2X1BA 1DY3A 3GG4A 1Q7YT 2HNYA 4YHHJ 5HLFA 2ZM6F 3KZBA 1X5PA 4QWEA 4U96A 3NMUA 4O3SA 1ZTWA 2B56A 4JI4J 2LKZA 3IWNC 2E1AA 1SKWA 1S0VA 5BR8J 4ZP8A 3V2UC 5D78A 5AJ3K 2XHBA 5A8RA 5C2DA 3IMQJ 1FO1A 3ZZPA 3GIKA 5JS1A 4BHQA 4JKGA 3QT6A 3OL6A 4BE0A 2FLNA 4EU0A 1LFPA 4JI0J 1QS4A 1N0UA 4GVBB 1KVJA 2F4VJ 2ZH4A 3WC2A 3VTIA 3VF0B 4CJWA 3G8SA 3MMVA 3O1LA 1BI4A 4U9RA 4WF9L 4DL7A 3R5JB 3J7A1 4E19A 1N54B 4JI7F 1YVFA 2GQ2A 4RU2A 2ZH5A 1CXQA 4NO7A 2M4MA 1U2VB 3VQ6A 4ECTA 4FCYA 4PG5A 2FXUA 4NYZA 4P2FA 3MF5A 4JD2A 5BR8K 2E9TA 4CZFA 2RQCA 1W2BR 2DY1A 3VQAA 1X31C 3AGRA 4NX9A 2CRLA 2G2OA 2CZ4A 1RWXB 3H5SA 4WTOB 3IN5A 2YHBA 3GU0A 1I6JA 3JTNA 3UDLA 4F04B 2VUGA 4BVPA 2V7ZA 3UVJA 3GB0A 3WBZA 1UWAA 4RJVA 3R1HA 3CD7A 2E5HA 2P1JA 4NZ7A 3ZCMA 2DGWA 5A8KB 3UE5A 1ACMB 4GRSA 4JKEA 2NRHA 5CH7B 1IKXB 4O0NA 3SBTA 3CM6A 2CG4A 2DGQA 3TA0A 4B9TA 1HNXJ 2F9WA 5LMNF 2FJXA 2HFUA 1WI8A 5D0GA 1PC4A 4CJFA 4FK2A 2R2UA 1BCMA 2KQ2A 4KR0B 1K8KB 3U1LA 2CWKA 2BKPA 3CJCA 4B8CA 1YBAA 3QIPA 2R7UA 1VQ5S 4IKAA 2A1BA 4UZBA 3CQYA 2HFOA 2QG9B 2ZH2A 3UD4P 4A8FA 4OYZA 4NXNJ 4P7VA 2RDIA 2NZTA 4KHRA 5L9XA 4J2DA 2OSQA 1WNEA 2Q3SA 2QYGA 2IIRA 2Z56B 5JLFA 5KFVA 3NGKA 3H59A 2FC9A 1WDTA 4LF1A 1WSHA 3KG1A 4PG4A 3M7VA 2UU9F 3O1BA 1OH5A 4AL6A 1T94A 2LEAA 4ZVHA 2AA4A 3QBCA 2Z2ZA 1FRLA 4FF4A 4IZ9A 3K57A 2BKOA 2YKPA 4ICLB 2PA3A 2CWXA 3TRGA 1BUPA 1B3TA 2HNZB 2OANA 4EWTA 1BMQB 5KFUA 2W6LA 2VFSA 3AD9C 2WUSA 1XK8A 3NMRA 2VG7A 1ZZNA 2GNKA 5C5JA 2HBRB 5AE2A 1WOQA 1RABB 2B5JA 1Q16B 3G71N 1C0FA 2RSQA 4XDCA 3VCDA 1HD1A 5HMYA 4WQ5C 3EZOA 2HBYB 2EFPA 3NCRA 1CJTA 4DR2J 2G1DA 2F8TA 1S9GB 2ZE2A 4K41A 3C66A 2W2PP 1PYOB 2QMXA 5RUBA 1TUGB 2W9CB 3EGZA 5C24B 5KFMA 2LSNA 2IM2A 2D1KA 3D2WA 1T0TV 3VZHA 1IVZA 4OI4A 2R3VA 1JLAB 4CK1A 3OSNA 1DAXA 2IDOA 5DZ6A 5EWGA 3BGRA 3LP0B 4O0IA 5LMNJ 2Q31A 1NEEA 1YGYA 1NOZA 3EO3A 2GIRA 3FRZA 1S1WA 4Y00A 2KDOA 1TMJA 2EFGA 4DV6K 1GOBA 4M5NA 1HWLA 3BF3A 2GHVC 2YCHA 4OJRA 2ILZA 5BJRA 1T8EA 3K7RA 3U4LA 3RTVA 4DX7A 3SI6A 2XMKA 2EFOA 2J9DA 5IT9U 4AH9A 1CG2A 4DV6F 4ED7A 3VEVA 2JDJA 3M8SA 4X4QA 1ZM4A 1QJHA 1G6BA 4EBDA 4N41A 5EX5A 1LFWA 1XMOK 2PIIA 3O9TA 1NBWA 3OTCA 1RT2B 4EAHD 3DLGA 2LYVA 4B3RF 1NKCA 4QWAA 5CE3A 2P2CB 2O8CB 1Y64A 3V9WA 3QZ7A 4NLDA 2XSJB 4DV1J 1TL1B 1H0HB 1TL3A 2QJ3A 3CF5L 2B9EA 1VQ4S 5M1PA 3FNNA 1X4DA 5I42B 2VONA 4MT1A 2NNWA 1IKYB 1S1XA 1FK9A 3DOKB 4JK9A 2BRLA 2OLWA 1C1AA 3UD3P 5FRMA 2JEGA 2QN6B 1OVYA 3C65A 2V51B 3R6MA 2JNJA 5DS7A 4EHUA 1QZ5A 2QA1A 4JN4A 5ETOA 4QOZB 1W25A 3TR5A 2F8SA 3R5CA 3RR7A 3JSMB 1JLGB 4X64F 4Y34A 2AJQA 3AFGA 4ID5A 4H0XB 3ZSRA 1ATNA 5H9FK 1NXIA 2MJNA 1NGHA 4LF5K 2CZ9A 3V6DA 3HRGA 4CD1A 2H4WB 2XZTB 1D3WA 5G0RB 5BPNA 4LF6F 1Y10A 3NVKA 4ED8A 4MMOA 1ILYA 3BEGB 2KB2A 3VV2B 1U47A 6FDRA 2V9WA 4FP9A 3AXMA 3TQEA 1FRIA 3AVKA 1TKTA 4OKEA 3T5LA 3G82A 1VQPN 5D3GB 5GINA 3FMBA 1XTZA 3DMJB 1S97A 1HPZB 1WORA 2Z4PA 1MMLA 1LEOA 2L3MA 4KY3A 2QT7A 2BJDA 3WIVA 1IBLF 3CFOA 3KOAA 2D41A 2OTJS 4OMFG 2X1GA 1WUAA 5TKYA 3DLKA 2OTLS 1M0SA 2WTUA 1D9DA 1EP4A 1YTAA 3EVWA 1N34F 1S99A 5DQIA 2AJ1A 3CMES 1C4AA 2XWXA 3H25A 2YNHB 2EHGA 4WZQA 4OKKA 2K1RB 3KLEB 1GTHA 1N6QA 4FYXB 3Q7BA 3C6TB 2HZAA 3N5FA 2O67A 4C3KA 4BR9A 4DOZA 5AQZA 3RAXA 1N0VC 1PO6A 1F5CA 1NK7A 2V69A 2ZQBA 3SSSA 2ZJPQ 5DQGA 2VWJA 4USJC 2D5RA 4IXCA 3E66A 4G3IA 1S79A 2R7SA 4GVMA 3HHLB 4C48A 4JOUA 2P51A 1GLEG 3ZETA 1WKKA 4YUDA 4XH5A 3NS5A 1NGIA 3I56S 4UOGA 5AXNA 4M5DB 2XCAA 4CT9A 3E01B 4AL5A 1IQZA 5E3RA 3T1HJ 1CZ9A 5E3CA 1VJWA 2LMIA 1CEZA 1FX2A 3MEDB 3NG8A 2WBNA 1SL2A 1J5OA 4M5LA 4JB8B 2E66A 2VC1A 4BQZA 1IN0A 3NFAA 2O1PA 4QPTA 1UVJA 4ZK7M 2V4QA 5K9FA 5U47A 4AQYJ 4W92B 4E7HA 3RBDA 2G8VA 3J7YU 3D66A 2PYJA 1RT6B 5EU7A 2YKMA 3SZ2A 2NRXA 1KEKA 2LQ5A 3KVGA 3DU6A 3HVTA 1G4CA 2VFVA 5IXUA 3VQEA 4K42A 2XMWA 3ZTPA 3MOZA 4DMZA 3B6BA 1FNOA 4DBQA 2KZMA 4LH4A 5A8WA 1AUSL 1NB2A 5EX0A 2G9OA 2J6UA 1BC6A 3KWIA 2KKZA 1Y5LB 4CM2A 4FF1A 3CPWM 4U8YA 2ZBPA 3DLJA 4FJ5A 4KAIA 4KHPF 4MO4A 1RBTA 4OYIA 3CMQA 3LDPA 2GA7A 4JYAJ 1S72S 1H2VZ 2PI5A 1MLAA 4FS2A 3OYKA 2IDEA 2MZTA 4ZIWA 4IO9Q 4H4KA 3GIMA 1RT5B 5AFUA 3WXIA 4GMKA 4CDIA 4JI7J 3C14B 3QSYB 1HNZF 4CHPA 3QQCD 3ZT2A 1RTJB 4FPRA 5KFCA 4X4TA 4LFBK 1FXRA 5I9EB 1XI1A 5DM6Q 3B8AX 1BUXA 2NUUG 4EEYA 3MR2A 4KGZB 2NXUA 4IR9A 2UV8G 4X62F 5F8NA 2AJ0A 4NLUA 2CQDA 1SBRA 4B1WB 4ZTJA 2XI3A 1FWPA 1OO0B 1RB0A 4CIFA 3V1RA 1F60B 2JVOA 3V6DB 1S48A 1C0TA 2H9ZA 4FYDA 1HA1A 3S01A 2CPFA 2JEIA 4TN2A 2V8VA 4E1NA 1CZAN 3J7Z5 4LF5F 3UCZP 2CGKA 4F4XA 2OPQA 3W5YA 3PVXA 4J9LA 1HLWA 1JJ2M 3TA2A 2ZC4A 2F1FA 3DXKA 3P1GA 3M8PB 3RRGA 3HP9A 1VQ7N 4RW7A 4A2AA 4NLRA 3W2WB 3VQBA 3P96A 3TJ8A 4YNQA 3OTOK 3H0PA 4OZ3A 1VS3A 1AFIA 4QYRA 5KQ8A 3UNGC 7FDRA 3KNAA 3G6ES 5D3GA 3LDLA 1RT4B 2Y0BB 1WSRA 3RU0A 4BC4A 4DCHA 2W9BA 4M45A 5CR4A 3LP1B 2MLXA 2B4VA 4JYAF 3W2VA 3HSZA 4ILRA 5EWFA 3MWBA 4OGCA 4AM7A 3LGHA 3U9ZA 4JKBA 3A3OB 3QYYA 4JI8F 4QU6A 2V52B 3R8EA 3L8BA 4ERDA 5KFEA 3PJXA 3J81O 3ZEUB 1ZA2B 2V7YA 5E26A 3N4PA 3C95A 5LY3A 4LFBJ 3MXHP 3K89A 3DLHA 4IRKA 3AVNA 3Q2SC 3NWGA 3D2EB 4ID5B 4CJ5A 3KYLA 3WXLA 4CLUA 4DR1F 2ZBQA 1UVKA 4MK7A 3FGUA 5IT9Y 4FL9A 1IBLK 5CY4A 2F96A 3FGVA 2MKSA 3S8SA 2DFHA 3IBFB 1SC4B 5B0FA 3TX0A 3RZAA 3DOMA 4I0WA 5HJXA 4FWQA 3S9HA 4F26A 3EZUA 4NYOA 2K7JA 5KQDA 1FK9B 2KG0A 1S6OA 2EWSA 4YB6A 2G0CA 1L3TA 3FC9A 3O08A 3VVUA 4AXIA 2HGMA 1ATRA 1NSPA 2VICA 4Z4GA 1KLMB 3UDVA 4C0BA 5KT5A 1GXTA 4M3TA 4WIIA 2XYHB 1VQMN 3DDIA 1UFWA 4BR7A 4YOVA 1UEKA 2XYPB 4FLXA 1IG9A 5AZIB 2DKOB 3H90A 3TZZA 4TQSA 3JSRA 3HXMA 2Y9HA 1QQOA 3KMQA 2IM0A 2RKIA 1DLOA 5AQGA 4AD6A 3K0SA 5LJWA 2WCXA 1HNIA 1N5SA 1ITGA 4JI1K 5M1NA 5LSLA 1HNIB 3AAQA 4E2FB 2DHSA 3ELHA 3E2EA 1VRTA 3RB3A 4FPBA 4JI6J 2YNIB 2MEWA 2OPQB 2HVHA 3MD3A 4WU3A 5KPRA 3EM1A 3CC2S 1RTDA 3NLCA 4URQU 4LF9F 1Y9OA 3RW7A 4KHQA 1S9EB 5ETVA 1YJNS 1YRTA 5BR8F 2FF6A 4GKKF 1U2FA 3M6WA 1RHMB 4RW6B 1ZPWX 2W7OA 2VPZB 1T6CA 3NKYA 4NRTA 3TQ1A 1IBCB 1KD1O 5E3QA 4LF9K 1QVGM 2IOCA 2A2DA 1KAYA 3AAWB 3EN9A 4CLTA 3FDSA 1FT8A 1N5VA 2GUIA 3MEEA 4Z7CA 3DOMB 4CJQA 2ZE2B 5BXIA 1RI7A 2MZSA 3NAEA 2ZM6K 2UZAA 1R59O 2AEJA 3GP9A 4DU3A 4DJBA 2HRUA 3N6MA 3LDQA 3DGPB 4NCAA 3QSIA 4DL2A 3P5JA 5ETPA 5L46A 5HRNA 2YHAA 3VEZA 3N4QA 5HVFA 5F8HA 4F2SA 4ATNA 3FFIA 3SCKE 3ZO7A 5J2MA 3BN4A 4LF8J 3S41A 2DO4A 2VASA 3W2VB 1B7FA 1KLMA 1TQLA 3X3UA 3JXOA 3CCUS 1KS2A 1FTRA 2APOA 1Q95G 2EVZA 1I39A 4A5BA 5EHHA 4QYZJ 2ZJRQ 1WF1A 4J9UE 1ASUA 4DTUA 2QZ8A 4NZ6A 1RTJA 3ZSZA 3OYEA 1QUPA 2FDNA 1YTYA 1RDDA 3GFZA 3H98A 3CB4A 2CQ3A 1FI4A 2LECA 1P6TA 2F9DA 4UW2A 5EDWA 3EVOA 4P6QA 5E3AA 3UIQA 1YVUA 3I8BA 2OPSA 3VQPA 4DHYA 1K8AT 3L3CA 4CZCA 1SIWB 3M32A 2XWYA 4KT0C 3DHWC 1H7XA 2KVIA 2P6TA 4CRJA 4IFYB 1GTEA 2L48A 4DSFA 1GMVA 4KPCA 4KREA 4KB1A 3FSYA 3CCES 2FYXA 3UN2A 1JNRB 4JRPA 3ZYYX 3Q8QB 2I6WA 5A8WB 2HHUA 3W5XA 1TKDA 3IAYA 1RT4A 3R8YA 1F2HA 3CUNA 2JWNA 1RQ0A 1F9EB 4ETZA 2FJAB 2MQQA 2GGPB 3KJFB 2GEMA 1CJVB 5DG7A 1HHSA 1I1GA 2ITGA 4H5WA 4BDYA 4DHVA 2QFJA 3WNGA 3H2LA 3QATA 3HD2A 1D09B 4DV2K 1C2PA 3BKUA 2PFUA 5EOYA 2UVVA 1KHVA 1UP1A 3TANA 2MYFA 3O6QA 2FVRA 4KKOB 1NH7A 2CPEA 4KHUA 2VQFK 2G8KA 2QA2A 1RHJB 3P45B 2J7WA 2QRRA 3VF4A 4MYUA 3PJWA 3MCPA 1HPZA 2QWPA 3QRQA 2WK4A 3BB5A 2GTDA 3CTRA 5KG4A 4O5FA 3CJ3A 3CCMN 3HHLC 3WDOA 5SZTA 3AY0A 2OYQA 4DWIA 4F8RA 1RT6A 3MMAB 3NGIA 3C14A 1HQEB 4MIWA 4I6YA 5C2GA 1CC7A 3MR7A 4IUFA 5IFMA 2DCLA 5GIPA 2ZWPA 3CDUA 3ALYA 4JI5F 3KLEA 2QKKA 2VPYB 4Q2MA 3HHDA 3O4WA 1AZSA 2UVUA 1X4CA 5A2QO 5D0RA 2C28A 3ISND 4Y0WA 3ULDA 1GLAG 1Z4UA 2HF3A 5D0HA 1GLCG 5KFOA 4HWIA 3WX4A 3QEXA 2ABYA 2F7VA 4CZHA 7FD1A 2OHDA 4TY9A 1S1UA 3TZYA 2R8HA 2EFVA 2NSCA 2CNKB 4O5BA 2RUGA 4J9VA 3IA0A 4LRAA 2BRKA 4PABA 4YQWA 3SAHA 3ENOA 2JLFA 5DK5A 3K5LA 1S1TA 5ADXH 2BDPA 4L3KA 1YJRA 4HUGA 4C8LA 2R7VA 5FPNA 3VAJA 3QEWA 1FXDA 2JX2A 4XIUA 4GMJB 3WC0A 3VAMA 2XS5A 2QTWA 3C0BA 4YORA 5KI6A 3MZIA 1R8AA 2XY5A 4CYUA 3LGNA 1RCXB 3O8MA 4EMDA 4CFDA 4JS5A 4X66J 4DTRA 1OYDA 4HI1A 4YDXA 3MCSA 1S3XA 4YY3J 3OD2A 1T11A 1N33F 1XNRJ 4DCPB 2HGNA 3PEJA 4DS5A 4KTZA 2VHGA 1GH8A 2DFEA 4BRIA 3KHLA 4FNHA 3JAMY 4Z2XA 5BN9A 2OMLA 4PR6A 1TL5A 1ZZFA 3K9JA 4B3OA 2F4VK 4N77A 1BA1A 1OH7A 3CC4N 1IQTA 2OZSA 2FZGB 2W1BA 2RS8A 2BW7A 4C98A 1UVMA 3OR2A 5KFDA 1RGVA 1YBTA 3QAUA 1LQ9A 4DR4F 4DQQA 4CIEA 1HD0A 4O8UA 1FFSB 4XAKA 3AVLA 5KFSA 2B6AB 4Q8FA 4HL9A 5C24A 3FKBA 2VDIA 2D3O1 4I2QB 3SQGA 4B9SA 4LC9B 4J5OA 2OPPA 3OXFA 2QXFA 2YNIA 2F8MA 5KFLA 2FZKB 1VQLS 5ETKA 4USUA 4IJAA 2KHDA 3EUNA 2VL1A 3L2UA 1P1TA 1YG0A 3WEEB 4B3SJ 2R42A 1A6LA 3CJQA 4YR0A 4FO0A 2IM3A 4FS1A 1NDPA 2V63A 3Q8YA 4FWPA 3LP2A 4G6VB 1VSIA 2DEJA 1TKTB 1L3VA 4RW4A 3T5HA 1DEJA 3OS0A 4M5JA 4AQYK 1VBXA 1NSAA 2ZZMA 4MFBA 3OPKA 4ECWA 3ZNJ1 4ICLA 4GKJK 4EFHA 4BC3A 2IAJA 4ECQA 3IFEA 1MROA 3QWPA 2W4DA 4Z4CA 1JLQA 3I56N 2RILA 3MMBA 4ITSA 4RW8B 3SQ1A 2WSCC 4JI2F 1M5VC 2X78A 3GONA 2DY4A 1LW2A 2NRRA 3GV8B 1R27B 3Q8VA 4DX5A 3N79A 2K7KA 2P9PB 2COLA 4HTUA 4X2BA 4F3MA 1VRTB 3GJSB 5K8MA 1T95A 2CUYA 1FJ7A 3BP8A 1FRKA 4CHQA 1HMVB 3QBXA 3OUYB 3VQ8A 4DPXA 4DPWA 2UUCK 1I94F 3T3FA 2MTLA 1GT8A 1DLOB 3OJSA 2V4JB 2KO1A 2O01C 2RKIB 3LZIA 2MQMA 4LR7A 3HOSA 5J2PA 1QAJA 2V50A 2LXFA 3LP0A 4M5IA 4FJLA 3U3YA 4KRWA 4ZKAA 1TL3B 3JB9k 2XSJA 1VQYA 3AQOA 3DGVA 1KN6A 4OJ1A 4WTYA 3OA9A 4OPAA 2MZQA 4I64A 2ZHOA 1RP5A 3DDNA 3BSCA 3WNFA 3RMDA 3FE1A 4NCGB 1X5TA 3L2WA 1IR2A 1UVIA 3LPEA 3DLGB 4UT4A 4LSLB 2HHQA 5C2FA 1QSSA 5AQNA 1SIZA 2JLGA 1TKZA 2PY5A 3G4SS 1RBOB 3OVAA 1IKXA 2GVDA 3CCRS 1EETB 4DUTA 1Y7PA 2LQBA 4JV1A 1RAOA 2Q2RA 4LBHA 5MLCV 1UPPA 3M2RA 4CFCA 2I8EA 3LW5C 1HLUA 4Z4HA 2B0GA 1BE4A 2AF6A 3OW2M 5ETQA 4ILGB 3J7ZO 1H72C 4PKDB 1S77D 3HK2A 5GAEU 2YV0X 4LFCF 4B17A 2W7PA 4USMA 1Q86O 4M42A 3ETMA 4CFAA 1HNVB 3W61A 1Z26A 1RCOB 3CD6S 1V3ZA 1QM9A 4B3MK 1V9OA 4CEAA 2AKWB 2UUAJ 3PZPA 3OTBA 1H38A 3UI3A 4CJUA 2HMIB 3UWTA 3MI7X 2W9BB 3BGLA 1G7CB 4M95A 1KAZA 4LF2A 2XNQA 2R7QA 1QVFM 2YWEA 2W9CA 4B3TK 6AT1B 2Q43A 3BZQA 7AT1B 1VSLA 4J9PA 3EX7B 4K0KF 1SH0A 5AFUH 4RWTA 4OFZA 3N6NA 3CD5A 1RT5A 5KT4A 2E2PA 3UKUA 4K25A 3BS9A 3QGPA 2DR8A 2X3GA 2E9ZA 2CQPA 4ZTFA 2C2DA 4CH7A 1TGOA 2DRAA 2B3TB 4TKTA 5TKWA 4LIWA 1C1BA 4UY8O 4LQ3A 2HPUA 4WP8A 1WAJA 1Z1ZA 2G8FA 2H3GX 9RUBA 4NI2B 4HUEA 4C4WA 4CHYA 4K5SA 4ZLPA 1C0TB 5ADZA 2QGFB 1KLNA 2DGUA 4CJ7A 3LAMA 1LV5A 3OL7A 3UDEA 5KGWA 3DXMA 2OI2A 1HR0K 2FC0A 1N5TA 3ZT3A 3KFWX 1KVBA 1PJ7A 1X0FA 3D6MB 3CQ8A 3THVA 4KTWA 2KFZA 4RWWA 3HJFA 4L76A 3NS7B 3BYRA 1BI4B 4H4MB 1JXEA 2UV8A 4QW8A 4CO1A 1LWEA 3W63A 3FBEA 2C2MB 3TZXA 3O9SA 3RSEA 3T41A 1SL0A 2C3PA 1L3KA 4CHNA 4LFCJ 1YK9A 4AFFA 5CQGA 3WQUA 2E1CA 1Q79A 3CQXA 4FWRA 2ZH1A 3OFGA 2DRDA 1VQMS 1RTHB 4DCJB 2QTDA 1AXQA 2NREA 2BABA 2G13A 1EQ0A 4DZDA 2Q6CA 3UKRA 4LF5J 2RF2A 1NRKA 3AJ1A 4KHYA 3GYNA 4IEEA 1DHMA 3MM6B 2RNEA 5B0BA 4CGIA 2A5XA 4OIXA 3GSIA 4I4BA 2J5AA 4DR5F 1R0AA 1WHXA 3H1QA 4CZEA 5HANA 2M70A 4L3QA 4BRDA 2O8FB 3D9BA 2H5EA 1RT7B 4MIAA 4JI2K 4FM2A 1UZHA 3G71S 2CPIA 4FNIA 1GOCA 5AQPA 1E3MA 1S0MA 3BPSP 5IC6B 4Z37A 1LWCB 4ZCLA 4GY2B 3AO2A 4KHSA 2GO9A 1U1NA 5AR0A 3KNGA 2AV5A 1SJ4P 4NLCA 3MK6A 1B4SA 3EEQA 3AGKA 3KWMA 1J5OB 4DR4J 2VF3A 2P9GA 2BJ9A 3ET6B 4H5VA 4LSZB 1GLBG 2R8JA 4HCCA 2O8BA 2I5JA 4EUVA 4NEZA 4G1IA 3IP0A 4J9MA 4BRQA 2XMUA 4M5DA 4YOUA 4P75A 2XSFA 2ITMA 1A5VA 4WFNL 1RKIA 2DISA 1CQNA 4A8KA 1MU2A 4ZITA 4DLEA 4UUXA 4BRNA 3DMJA 3C19A 3P39A 3TUIC 4OLOA 4PXDA 4JI5J 4NLBA 3IGNA 3RAMA 1AA1B 3CM5A 2UXDK 2HBZB 4TYAA 4ECZA 3CCVN 5EN1A 3MEGA 2OFHX 1FKOB 5CYMA 4FLVA 2QWRA 4DSEA 4FM1A 2GS8A 4CGFA 3QO9A 4CJTA 3KDNA 4TXSA 1BY9A 2A0FB 4HLBA 1S0NA 4KH6A 1G15A 4ZPVR 2W8LA 5F2RA 2PEHA 4F4YA 2DNGA 1LW0B 1JKHB 4C8NA 4IOCQ 1NKBA 2CGLA 5GAGP 5DGBA 1H7WA 1Q4RA 2V4RA 2J76E 5E0OA 1WC3A 2PMHA 2HHSA 2Y8WA 5HQLA 3W8PA 1X4EA 4Y2MA 3OBYA 4HYKA 3LDNA 2GFFA 4CP5A 2NPIA 4HTIA 4RW9B 3IG1A 3V4IB 1B0VA 4C7QA 4Z7YA 1UCNA 1RAIB 2CH5A 5M2UA 4J9NA 1A0OB 2Z1IA 1ESVA 1IJFB 2YNFB 3AO3A 3I0SA 2Y1LB 3BREA 4P2SA 4ZP6A 4LF6K 2B4UA 5C0YA 2KL8A 2E2QA 4WKYA 4M5GA 2XY7A 4W5QA 1VC6A 2J6TA 1NGDA 1RACB 4EO8A 1S7IA 4O23A 1WACA 5KFWA 1ZETA 4FJGA 1QQMA 4NLGA 2LQJA 1IWAA 4GC7A 2RRAA 2DBBA 2WAQD 5GVQA 2EX3A 1X60A 2UUCF 4JV2A 1VI7A 4IBNA 3AOBA 3A4TA 1P9YA 3QFHA 1RWWB 1NK4A 4C9DA 3R7SB 3GIIA 2OSRA 4I67A 3UD5A 2IRYA 3T1YK 2UUBK 1SPBP 5T7LB 3ENHA 3AH6A 1WF0A 3SJJA 4RPFA 5KT6A 4A8YA 4QIVA 3PSFA 3NAIA 3VEXA 1VHIA 2UUWA 3L7OA 1A5XA 1U49A 4HT7A 3D7SB 3CMAN 3VR1A 4NASA 3PR4A 3BO2A 2QLFB 5AQVA 3KUGA 1IKVA 2ZC3A 3DYAA 1UJ6A 2M8DB 3J7ZT 4GKJJ 4X65J 5IV3A 3H5UA 2KJVA 5HN0A 5A0YB 3OS2A 3EGNA 3OHAA 2KRRA 2DNNA 4WF9Q 2E8AA 2I5JB 2OPRA 1NM2A 3CO9A 2NRZA 3SBGA 3KK3A 2K3IA 4I6MA 1WLJA 1BHLA 4YR2A 1YHQN 2VPWB 5HROA 3H42A 4I9QA 3NHGA 3IRXA 2Q3PA 1HNWK 5F8MA 2Q66A 3THXB 1CJTB 1FX4A 1CPZA 1LWCA 4BVOA 3JSYA 1RU2A 1TV6A 1Q81O 2A42A 3BY5A 3J81j 2ZJQQ 1RKJA 3D45A 2ZWOA 1RDRA 3OLAA 4CNYA 2DGOA 3MPYA 4Q5VA 4OJ3A 3K9KA 3CJ1A 1X4GA 5FLXU 1SH2A 2J0XA 3OYGA 4A8OA 1VC5A 2HSTA 2LDIA 2V8PA 2WVCA 2VQEF 2P9UA 3J81Y 1CULB 4GKJF 3BYPA 1NGGA 5AZJB 3MMJA 2ZJQL 1VRUB 1SV5B 1SJRA 3K17A 3CXCM 4DR3J 3QGIA 4ZVQB 4P10A 3F5TA 1UA0A 4DV5F 3FQLA 3ZTRA 5BYRA 3JS6A 4IG3B 1PBAA 2HS0A 3C6UB 2YWFA 1SJ1A 1NGJA 3P31A 1U1PA 1Z05A 4CVNE 4IWVA 4LF6J 2D0OA 4CZGA 3CJRA 1TP7A 1HYVA 4LIRA 2QL9B 3C16B 2W2MP 2ACMA 3PG9A 3BBBA 2UUCJ 5CYQA 5DDOC 4H4MA 1N34K 1JMTA 3TU5A 2CPYA 3P5BP 4MQ3A 4DV4J 3U1MA 4YP3A 1DRZA 4E7IA 2CAJA 2GX8A 2P9KA 4DR4K 4NI2A 2VDHA 4O44B 3Q83A 5LL6Z 1IM4A 1C1BB 2NXEA 3BBCA 2AU0A 4CLSA 4LRDA 4OI2A 1EAYC 1KQGB 2A2CA 2FHJD 3L9ZA 4PPDA 1JLFA 4RUAA 3CVKA 3DLRA 4N76A 2NXNA 2H4YB 3IAS9 2QE5A 1A9NB 2IPOB 3IS9B 1OQ6A 1HNXK 2CJYB 1H74A 4K5RA 4M94A 3C6UA 2R8GA 4LH5A 3EVMA 5DJBA 3PNIA 3HHEA 4OJGA 2RH3A 3GJQB 3GE1A 5DM7Q 3V6HA 5EUHA 1PILA 2HMIA 2YX6A 3OYBA 3UN5A 2J8SA 1AW0A 1EJ7L 2BANA 1FXLA 4C3MA 1Q8LA 3PJ9A 1PSDA 1BA0A 4PYDA 2YXLA 1ZBUA 2DK2A 1FDBA 4C1NI 1FRMA 4JV5J 4MKYA 3HPOA 3JQKA 1RT3A 3HFVA 1IBKK 1IXKA 1GK8A 4AM6A 4O3RA 1V5VA 2BOAA 2XLJA 1QAYA 4CJRA 1VQNN 4X65K 2NRWA 3M2UA 4RNHA 5L9NA 2BX6A 5L39A 3W66A 1FNXH 5IZHA 4ES2A 2K3KA 1M1KT 5KG5A 1RAEB 1ZH5A 2AYBA 3PIOL 1T3NA 5D4OA 1ZC6A 3CJ0A 3HSDA 2C2ZB 2UUAF 4A8QA 2XS7A 3VMFB 3THXA 3EYZA 1XHZA 2I7NA 4M5KA 3BQ1A 2X74A 4NMLA 5EWEA 2ASMA 2AJ2A 3MM8A 4IOCL 5HROB 1WBDA 2OD6A 3QNOA 3VAKA 1O6XA 2WVEA 2DFFA 3FZFA 4ANCA 2HZVA 1YRUA 3CJSA 4URSA 1J2VA 2W2QP 1YJTA 4ZVTB 5ELZA 1M5SA 4RWXA 5E33A 5HLFB 2MQPA 5J2QB 2Y0SD 3EPIA 4JNEA 3PTWA 3CJBA 1ASVA 2VYPA 4HTLA 3VQ5A 1MWYA 1W2BM 4DCOB 1IKVB 4O8KA 3C6AA 2MZJA 2E2OA 2OZMA 3TAGA 3EE9A 1XC3A 5J2PB 1SJFA 1RWKB 2LCWA 3G9CA 2N4DA 1QVGR 3AODA 1P27B 4NXNK 1JCFA 3KK2B 3O5TB 1SC1B 1DTQB 2KT3A 2BGGA 1VSHA 1W9HA 1NPPA 4CT8A 4GVLA 4N7TA 3TYTA 5BYSA 1HNXF 3AVJA 2KFYA 2BM1A 2ZOFA 3HPHA 3RJMB 4DV0J 4I69A 1UWBB 2DIUA 2NUBA 1EKSA 2ZF5O 2IYIA 9ATCB 3UCUP 1S10A 1UTAA 3KD5E 2JVRA 1S5JA 1JL2A 4CLLA 4JKHA 1U8SA 4AF1A 3D0PA 2UVRA 2RJZA 1HBNA 3M8WA 1YITN 2C3OA 2MPUA 4A59A 1S7HA 4IO1A 5HL7L 3X1LB 2O8EB 3NOCA 1FRJA 2KKHA 3IBCB 5M2PA 4LF7K 4HCBA 3MCOA 1C0UA 2AEFA 5KFPA 3M2VA 1E6YB 4TU8A 2GELA 2RB7A 2DTUA 4GV9A 2PAVA 1TUUA 4PPZA 3MUVP 4J7CA 3TWZA 2DNQA 1GNKA 1VQ6S 3SV3A 4QIEA 3TP2A 5KTQA 4LFAJ 3OYHA 1FDAA 3HF5A 1XJWB 2WOMB 1WC5A 2Y8YA 4JV5F 2D0CA 4L6V3 1H2UX 1D8ZA 4DR5J 3DRSA 4JI8K 4BRHA 4CEEA 4FWOA 1SKUB 4ZLLA 4P52A 1RWMB 3HTVA 1FRXA 2XLIA 4DQ8A 2H51B 1R0BG 4WE1B 4IFVA 3Q24A 2JHEA 1NHUA 3D0IE 2WVBA 4XO0A 1YWXA 3CE8A 2EFQA 2J7KA 1KQFB 3OBWA 4OZJA 3T6JA 2QK9A 3B6PA 1XMQF 1ZM9A 5JS2A 2ASLA 3MFIA 5FIIA 3M8QA 3Q22A 1VOMA 4K4SA 4NCBA 1J9AA 2VKRA 1REVA 3NMAA 4PWUA 3THTA 2O5DA 2DRBA 2AMCB 3PW5A 1CLQA 2JGUA 1J27A 3TAMA 2LA6A 3QNWB 3HKZD 3C7NB 4OV6A 2PD1A 1JNZB 1W97L 2ZGZA 3RW6A 1WTFA 2OP5A 3I96A 4R0EA 5C42A 2GJ2A 1RUSA 4IFVB 4C6AA 2IHR1 3MN7A 2AD9A 4OYAA 3FZHA 4H03B 4DN9A 4ZJOA 2F4VF 2LP4A 4FSVA 1OJ4A 2J8AA 3W3DA 3MPUB 2F7TA 2FB0A 2M2BA 4YHHF 2VZ9A 3MCMA 4M7XA 1ELOA 3EXYA 2VGMA 2F40A 2DXEA 1YI2S 5D4LA 3BR9A 2LA4A 1BD6A 2EC2A 4X66F 1P90A 3J80U 3VEWA 3VQSA 1KVAA 3TVKA 3OLBA 4M7YA 3QNNA 1CSJA 3ZZUA 5KFQA 2PFFB 1C0UB 4ECYA 2RDJA 4ZIVA 4B3SK 5AJ3J 4GW6A 3O6WA 3GL1A 4JHDA 1VAZA 4LFCK 5BR9A 1FJGK 1BQNB 4LUBA 5KOXA 1S1UB 1OWXA 4OPKA 1R8HA 4DF4A 3SBMA 4JI4K 4E1MA 2IC3A 4RBUA 4IDHA 3THPA 3GLJA 4F36A 4F25A 4MK9A 4A46A 3GJRB 4PL8A 1U6FA 3GFHA 4ILHA 2J0QD 1ITPA 2YKAA 3PDNA 2AT1B 5BREA 1UWBA 4ZJQA 2YX1A 3THWA 1BG3A 2I9SA 4R25A 3TZWA 1FKOA 5CYMB 1VK3A 1XERA 4J8FA 3I55N 1HYSA 1Z6RA 2B9XA 4PWDB 1RA7A 4O3NA 3EJMA 2B7CB 2WRMA 2CJBA 4CTAA 1UEVA 4ED3A 4ED6A 5KG7A 1PJ6A 5LMUK 4DU8A 3H1VX 3DLLL 3OXLA 4M63C 4ZPAA 1IBKJ 3F9KA 3OYIA 3TAFA 5KPTA 4CO4A 3MFHA 4WYBA 5CZ2A 1PYTA 4LF9J 2ZJRL 3JQMA 2R2SA 4EP5A 5J1EA 3Q89A 4X64K 1BO5O 3W7BA 3THYA 1UEUA 3FZKA 3RR8A 1N33K 5KFAA 1U1MA 3I9V9 1K47A 2DCUB 4ZS6A 2R7OA 4AXJA 4LMZA 2AW0A 4LF8F 4J9RA 4DKWA 1NMDA 3VVTA 4IFEA 3CSKA 5F8LA 1VJQA 5B0AA 2ZBIA 3L95X 4PWWA 5GAGI 1YJNN 1R3NA 4O4GA 4Y65A 4DUZF 3ILLA 3P3DA 1NKEA 1UKUA 2RU9A 1IBMF 2EI5A 1RT3B 3ITHB 2PFDA 4YS2A 2XM3A 3CCVS 3CT9A 4ED1A 5EXWA 1PJ5A 3DDKA 3TAPA 4ZJLA 3M8RA 5B08A 2HFSA 4H0YB 4A62A 4DL0C 1N34J 2J9CA 4H4OB 1XR5A 2BEFA 4OLBA 3G6XA 2BE7D 4OZLA 4BROA 3VHQA 1I5OB 4K2XA 3UKRB 2UXCF 4DR2F 2DGSA 1WG1A 2RDDA 2VPXB 2CG8A 5D15A 4F7VA 3M2RB 4F3QA 1Q8KA 5M1OA 4ENOA 1VDHA 3OVBA 1Q82O 1WKJA 1TU0B 1CS4B 3QLHA 1EETA 1G3OA 3QRRA 4CZJA 5MLCQ 4OZ2A 1F9FA 1YXQA 5DDQC 2GHPA 3NNHA 2FLPA 3PW0A 4MIBA 2R2RA 3IGVA 5EGYA 4LRCA 4CBWA 1B0PA 2GJIA 1VK0A 3ULEA 2F9TA 1E6VA 3I87A 4BR2A 2RRBA 3ZXWA 3ZT1A 4BRLA 2QWLA 2VGNA 1HW9A 3AA9A 2VC0A 1WTBA 4CECA 4Q45A 2AYGA 3VZIA 3B4MA 2W4PA 3GJTB 1S9FA 2QWOA 1KTQA 1S5ZA 5CD4H 3HPGA 1W2IA 1NOYA 5AXKA 3CCMS 4PEOA 5KT3A 2QW9A 2VA3A 1N5QA 3OTDA 4DR1J 4OVLA 2BQRA 3EL2A 3HHNB 1NBEB 4L72B 3ZZYA 3AA3A 1TUVA 4BG9A 2FVSA 1BL3A 4CJVA 5IQ6A 1LK7A 3B78A 2WW4A 4FWSA 3CCQS 1FHTA 2A3ZA 4DV4F 1R89A 3ZX0A 4K4XA 3KKSA 1XMQJ 2XNRA 1OVQA 1UFLA 3KK1B 1HYSB 3SFUA 2CPHA 3DI6B 1FESA 2E88A 3SPZA 2Z58B 3WNEA 2GV9A 3N01A 2VOPA 2EBGA 4BQLA 2FHMA 1ICEB 5B0GA 1PIEA 3THWB 3MXMA 3GFXA 1WDDA 1DARA 3EE8A 4DFMA 2VD3A 4U67L 1FDDA 1U1QA 3D54A 3TUJC 4OYPA 4JKFA 3GR0A 2J6SA 4CGHA 2QLJB 2A6OA 4DU1A 4ZMMA 1QAXA 4RW6A 4EZ6A 2WONA 3LPUA 1HNVA 3W60A 4CLWA 3ZSYA 3ZX2A 3KHRA 2YPZA 4QWCA 2MZ1A 4C11A 4A8MP 1U26A 1J5EJ 3JAMU 4RW4B 3D6FB 1S9EA 4GNIA 1C0MA 3MDQA 1IKWA 2W9AA 5DGAA 4FKXA 1GLJO 4IR1A 4FWNA 5KGXA 2H5JB 3A5LC 4JHDB 1RT1B 3ZZOA 1H6KX 2MQOA 3ID6A 3VGVA 4NLTA 1NPRA 2ALYB 3WEEA 3A3NB 4C1NK 4ZPBA 1HNZJ 2MKYA 4PG6A 3CDAA 4DV7K 3P49B 4JV0A 1WG4A 2AYEA 3S3MA 3M1VB 3L4QA 1FRHA 4H0TB 3HKWA 4QR2A 5DM6L 2DNZA 5BRDA 3QESA 5JJBA 2XGQA 2H65B 4ED0A 3H3NO 1YJWN 4QS9A 4E3SA 3R97A 3CDBA 3UW1A 1HKAA 3P8BB 3PX6A 4DV7F 4NCGA 3BBFA 4PG8A 4B3MF 3M6VA 3RB4A 3E8OA 2YI1A 4O3QA 5ETRA 2OO4A 3GV7B 1UPMB 5KAKA 2ZVSA 4H54A 3BQ2A 3V1OA 4FLYA 1YDLA 3PKMA 3NH0A 2H54B 2M8HA 1HYZA 4B1UB 1UA1A 4USVA 5KT2A 2V4JA 3KWGA 3MAAA 1OY9A 2H1YA 2BR0A 4QS8A 1ASWA 3E3XA 3SCLE 2MY7A 2BE2B 5CZ1A 2D7SA 5CHCB 2P9PA 4X62J 3HI0A 2HLTA 3CCLN 2YQ3A 1UOCA 2DH9A 4YDDB 4O3OA 3MPWA 4LD0A 3M8YA 1FFWB 1U24A 1TAUA 2GMJA 3BF1A 4OPJA 4LQ9A 4OKJA 2FSKA 4B3MJ 1NM1A 3M30B 1YJVA 1Y4ZB 3CCRN 2HHHF 3NE6A 2F9JA 4MFBB 3TOQA 4U7UD 2W4CA 4UUWA 2DNPA 2DXFA 5AQJA 4HHTA 4CHOA 3LWLA 1YHQS 4FJ7A 2V94A 4W98A 3LP2B 3KLVA 4K2JA 3JS9A 3RRKA 4QW9A 2J9DE 4UQTA 3TWHA 3M6XA 1FFGB 4DR2K 5C25A 3PR5B 3LGMA 2R2TA 3HD1A 4YB7A 3M3ZA 2CQ4A 2NLXA 5HK4A 1XNRF 2B51A 1K1SA 4EBCA 2QM1A 2XBPA 5IQQA 1Q9XA 1QD1A 2K06A 1ZYQA 3QICA 4USTA 4CJSA 3HVRA 1LW0A 3Q0AA 4OYBA 5HBMA 3RBEA 1B70B 4DR1K 1C0GA 3RG6A 2E29A 1HBUA 3OL9A 4I6WA 3AVCA 3KHGA 4MLEA 3MCAB 3NBPB 5LMNK 4B1VA 3K5PA 4F67A 2RD5C 4K4VA 3OR2B 3LANA 3VQTA 4WK3A 1GLFO 5SUHA 3TSPA 4YY3K 2FBXA 3WXMB 4RUHA 3MMAA 3LP3A 1WHWA 3D1OA 2HNDA 3VGMA 2HKEA 1HBMB 3LDOA 4ZN1A 4Z4IA 3G2XA 3MDFA 3I33A 4WYLA 1TYQB 2HQDA 3VA0A 4B9QA 1APSA 4PHTX 3H4BA 1OH8A 3SMSA 2YKNB 1WSIA 2HS3A 2PZSA 2C1EB 3SUQA 5IT9O 4CF2A 1FJCA 3BGUA 3LM9A 3TNVA 3G4SN 1LAWA 1TMMA 2E5LK 2XB2D 4B1ZA 2BJ7A 1NJIT 4WYWA 4CYUB 3R9LA 4X62K 1EZZB 3S3OA 2W8KA 1BWVA 4MLHA 1HFEL 2HK3A 1EX8A 2JRSA 1F0XA 3D28A 2UYTA 4KI4A 4DUZK 1VSKA 1I3AA 3SXLA 2ZNZA 5AQHA 2CYYA 3OFFA 3A5NC 4BR5A 1CC8A 1JX4A 1NK9A 5JUMA 2ZBCA 1SQKA 1R6VA 5IOLA 3GE9A 1NK8A 1YI2N 1S1TB 2FY1A 2M0GB 3SAFA 4JI7K 1Q82T 2XMJA 1X8DA 2KU7A 3I5CA 3GCWP 1IM6A 1ZM3A 3CCJS 3KJNB 3PLAA 1VFJA 4FPIA 3GIJA 3TX8A 3SI8A 2D3ZA 1NDCA 3ILOA 1RBVA 3J8AA 3HZEA 2B4JA 1NJYA 2ERRA 2WBRA 3MM6A 1K8AO 2HIYA 1HWJA 5M1KA 2P9IA 3R3TA 3QIDA 3FQKA 4ZVGA 2DB1A 5CAAA 3QAEA 1TUYA 4BWJA 3ITHA 1H73A 2HFNA 1NMNA 2HAFA 3GG1A 4F9OA 1AT1B 3QJJA 3O5BA 4CFBA 2X7IA 4EYHB 5FRNA 1ZS6A 1VBKA 2DGVA 4W5OA 4DL5A 2DNLA 4G9ZA 4WP3A 3ZETB 1OYEA 4AL7A 4OX9K 2ILYA 3HHLA 4CO2A 1TELA 2DNMA 3D3BJ 3C3LA 2FVPA 5EVZA 2GW8A 3NL0A 1ZBIA 3W0LA 3R5GA 1KNZA 2CPDA 2CQGA 2KVQE 4Z94A 2GHWA 1O8BA 4L3NA 2KT2A 3JQJA 3NF6A 3CIMA 2FJEB 1EKRA 1MMNA 3OR1A 3MM7B 3T5JA 4OZ0A 1FWKA 4Y2IA 4MKAA 2HK2A 4P71A 5KG2A 3HI9A 2NYIA 4LF4F 1QTNB 3ULEB 4QWBA 1ZA1B 2D9OA 4C2MA 1R8CA 1S1VB 5CYQB 5AQKA 4IYQA 4KC5A 4LF7J 2G8UA 1TL4A 2NRTA 2XY6A 5KG3A 4YHHK 4HEA9 1U2CA 1QVFR 4KSEB 2LVWA 4XDDA 4DTNA 3IR7B 4W90B 2IJNA 3MTJA 1QUVA 2DJWA 2Z2LA 1RZMA 2CKWA 2F8HA 2MQLA 4IG3A 1IR1A 3CJ7A 2ZOGA 2HVEA 4B8AB 3LWMA 3TR8A 4WFAQ 5BPMA 5C15A 2R7YA 4JLHA 4KB0A 4FZVA 3RB0A 1QLNA 1YAGA 4LR8A 1X4AA 5KFRA 4WFZA 1BOTO 2A10A 2O3DA 2MKKA 2IS3A 2QO3A 3PO5A 4ILJA 2K8GA 4UOHA 3T1HK 1XR6A 8AT1B 3D67A 2NQPA 4R79A 2CJ9A 1HQUA 4X4VA 1AYEA 5HMXA 3J7YI 1RBAA 4PZVA 1BQMA 5L1IA 5GMKa 4DFKA 2IM1A 2GUPA 4Q0BB 2B9YA 3AA5X 4CLYA 3K5OA 4CF8A 1UW4A 4WFBL 1HKCA 2BOPA 1URNA 2GAHC 1Z2ZA 3UDCA 3ZSWA 3V5RA 5I42A 3R5BA 3LQVA 4L73A 1KC8T 1VQ8S 1KQSM 3GFYA 1RU1A 3CI5A 3PIOQ 4ECUA 3LPTA 5LXYA 3FMWA 3AO1A 5JICA 4NE9C 4KIAA 3JTPA 1BCOA 4PCQA 2DHHA 3VF2A 5J2MB 2YKNA 5L1KA 5A0YA 3WNHA 4ILMA 2YJFA 2XG8A 3RAQA 4YDUC 1LOTB 1S72N 5KFBA 1A5WA 1T3VA 3DRRB 4N56A 5IC4B 2F63A 2IVYA 5BPLA 2AHOB 3QERA 2Q97A 1RLCL 4FZZA 2HF4A 3WIUA 1YVNA 3IDHA 3CJ5A 1N56A 1M1HA 1SI9A 3FEYB 1RJJA 3TJ9A 3VQDA 3GYGA 2QA4S 5T7LA 2ETJA 1HR0J 3D2EA 3CFPA 2AJ4A 4RW8A 4X4PA 4P2MA 1J5EF 3CCZA 2GIFA 2IVMA 4U7UK 1JLQB 4DR3F 3HZ6A 5IS2A 4RLEA 1U1RA 3HFKA 3BGRB 4KH1B 3W65A 2OD4A 3HULA 3HVWA 4M5HA 4KGVB 4JI6K 4BRMA 4CEDA 2CNOB 2E5GA 4PXEA 5DM7L 3LALA 2ACYA 3BGFA 1D8YA 2R7XA 4L8RB 1XNRK 1NSQA 3KLGA 3N28A 2O4GA 3VERA 1M1GA 2QL7B 1RNHA 1X4HA 4DR5K 4FXVA 2C2OB 4B9MA 2BW2A 4JK8A 3TARA 1V4SA 1KWMA 2LDYA 3AAPA 2IA6A 2QL5B 4DSIA 4S0MA 3M8PA 5IT4A 2U2FA 4F4KA 2UXBJ 3L3VA 1NGCA 3PRBA 2BH1A 1OSCA 5D4PA 1U6BA 3CCWA 5KFTA 3CCJN 3MECB 1G2EA 3EWGA 5CCLA 1NJIO 5A6WA 2MKHA 1TFYA 1X3MA 2PSZA 3G8TA 2HNZA 3AY9A 1U0HB 4IEIA 3KG4A 2W6KA 1ROFA 4CH0S 1BHNA 1TK8A 3UPFA 3SNNA 4DR7F 2QIFA 3F2KA 4O55A 2W2OP 3ZSQA 4WXOA 3DCAA 2DGTA 3ISZA 4KFBB 1XHXA 3O44A 1WOSA 2UP1A 2QEXS 1RBRA 1T05A 2VQFF 5KPZA 3NGRA 3LF0A 3A2FA 3K8VA 2NCKL 4F50A 4G1QB 4K4WA 3DLLQ 3CD0A 5M1FA 4CI0B 4OJHA 1WSVA 2R7TA 2KM8C 2UUBF 2CXEA 5A76A 4DUYK 2QX0A 3HM9A 2ROPA 4WE1A 2M3DA 2HB5A 4B02A 4XH4A 5AQXA 3LH2S 1D9FA 2VOOA 3PIPQ 2IBKA 3QB0A 2GIQA 2WSEC 3HT3A 4ELUA 4I56A 5KFJA 1S6QA 2XC9A 4QR1A 1U09A 2MSTA 5C7PA 1FJGF 2ZD1B 3RBZA 2EFNA 4Y1CA 2BYCA 1N8RT 1I51B 1KFDA 1DKGD 2GZOA 4Y6IA 2EK6A 4DFJA 1NUEA 1Z2LA 2KXFA 3P4IA 3OS1A 3VQ4A 3I6PA 2HBJA 1WF2A 3IM9A 3QT5A 4FJIA 2IYGA 2O8EA 2NYHA 4RW7B 3RGIA 1AUDA 1HBNB 2JZ5A 5H1SQ 3MAQA 1PAEX 4OYXA 3SQOP 4C11B 4ANEA 4GVEA 4OQJA 1SJ3P 1W0HA 2GVZA 4IQMA 3B4DA 4WFYA 1XNQF 1BGXT 3IWLA 2IIHA 2OUGA 3OTOF 2JFKA 2UXCK 3H5XA 4EGLA 3U1NA 4DF8A 4CJLA 4ZCIA 1AZSB 2VQFJ 2BA9A 1URRA 4USIA 4M41A 1T44A 4IOXA 3E01A 1VCTA 5K8PA 2HWHA 3TW0A 3LPYA 3ZZRA 1W7WA 1GOAA 3KHYA 3OYDA 3T1YJ 3KIOA 4AHSA 4ZVRB 2HFZA 2N3OA 2CQHA 3M8ZA 4KHMA 5F0XA 2J0WA 3R5DA 5ETMA 3HFZB 3SDEA 2HQCA 4FKYA 4C0HA 3A5OC 3R1XA 4IOAQ 1ZBTA 4CE9A 4ETXA 2DYAA 2QMUB 3DOLB 4E7KA 4NXMK 2P9KB 1SUQA 4FF2A 5H9EJ 5A8RB 3LZJA 4H4KC 3H46O 4KGXB 5L8RC 3PY8A 4KKOA 3HX9A 4M1KA 2VFUA 1OH6A 3OW2R 3UN3A 2JSXA 2OTLN 5HP1B 2DR7A 3EMTA 4GV6A 3RMCA 3OY9A 3J7YP 3TVYA 5HJYA 1ZAXA 1VQ7S 3H2UB 2WZ1A 2HHTA 3AV9A 3VAIA 3LOUA 4FPAA 3N0VA 1WD6A 4H0VB 3I0RB 5B0CA 3L6QA 3B54A 4DTPA 1GMWD 5AQIA 1MDUB 3NCIA 1CJVA 3F56A 1HPMA 1NK0A 4X84A 3E9OA 4QAGA 1R0CB 4Y2KA 3A8YA 2FHJA 2MHEA 5LJ5Y 1HKGA 2BE9B 4ZPDA 4WZMA 1RYSA 1GAOA 3KLHB 4U67Q 3I82A 1R31A 1Q7YO 1WB9A 4FM0A 3QEIA 2PO4A 4CJPA 1XQSC 3NOGA 5CZVA 1VQSA 4UF4A 4PYAA 3VEOA 2QKBA 4FJXA 1JK9B 1TKXA 3CEDA 1CULA 4KO0B 1QY7A 2QLBB 3G96A 1UAXA 5AZJA 4OO1J 2C2EA 3VGKA 3A1YG 3Q7CA 4R8UA 2OPSB 1IBKF 2ROGA 1V3RA 3SMPA 3DM2B 4WFNQ 1H2TZ 4CH1A