3VQEA

Hiv-1 in core domain in complex with [1-(4-fluorophenyl)-5-methyl-1h-pyrazol-4-yl]methanol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
136
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 49
structure length 136
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqeA00
1L3UA 1TKXA 4B9NA 3MXIA 4EZ9A 1RT6A 3QLHA 1NJWA 3NGIA 1NKBA 3S3OA 4MQ3A 1ASWA 4O0JA 3L2RA 1NJXA 4DFJA 4FJJA 3VQQA 2OA8A 4AHTA 3AO1A 4DLGA 4ZHRA 1YVUA 4UQGA 4E19A 3AO3A 2IC3A 1S6QA 4OLBA 1L3TA 3PX4A 5KGWA 3VQAA 4KPYA 4KRFA 3LP3A 4FK2A 4PA1A 3ZSVA 4OPKA 4DFKA 4ZTFA 4E7JA 2EX3A 3TAMA 4O55A 1WSJA 3TAPA 2RF2A 4Z4GA 4WE1A 4HCBA 1Z25A 1TGOA 2E4LA 5HRSA 1RDDA 4I2QA 4CHYA 4NCAA 4HCCA 3SUOA 2DY4A 4Z4CA 3SV3A 4LD0A 4DTXA 2YKMA 1HRHA 4B9VA 5HP1A 4CFCA 1VSMA 2JGUA 1BCMA 3KLHA 2YKNA 4FLZA 2XY5A 4RW9A 1CZBA 3P1GA 4C8OA 3HPGA 4DSKA 4CJPA 4KB0A 4FJ7A 1U45A 3NH1A 1VSFA 3NF8A 3HYFA 4Z4FA 2EHGA 3NCIA 3E01A 4O0IA 3EYZA 2WOMA 4DU4A 4FJXA 4W5TA 5JS1A 3ZT4A 1ZBUA 1EP4A 2JLEA 4BE2A 4NCBA 4E1NA 4PWDA 2HNDA 4B08A 2OPRA 3SV4A 3O3FA 4KI4A 4DMNA 1TAQA 5E41A 3DRPA 2WONA 2HHWA 4JS4A 2G8VA 4CECA 2OZMA 1CZ9A 1FKOA 1U49A 4B9UA 4IKFA 4CJEA 1KCFA 3ASMA 1I39A 1IH7A 5K14A 1RBRA 3SPYA 1RBSA 3AVGA 4CEQA 2OPSA 2YNFA 4CESA 4HUGA 4DFPA 3OYBA 4FZYA 4BDYA 3HPOA 1QE1A 3L2UA 2HHVA 2E6MA 3BGRA 3VQ5A 3SQ2A 1R0AA 4YFUA 1RTJA 4FK4A 1C6VA 3QESA 1XI1A 3DM2A 1SL1A 4IFYA 3ULDA 4DQRA 3QEPA 4YNQA 3MAQA 4JRQA 4DSJA 3AVJA 1J53A 1BI4A 1GOBA 4MFBA 3LALA 3VQ6A 4CFBA 4FJIA 2PYLA 1DLOA 4AILC 2B5JA 5HRRA 3VQ8A 1X9SA 1FXXA 4ZTJA 3LAKA 3NHGA 3TAFA 1W0HA 1TV6A 5SZTA 5J2PA 2QKKA 4J2EA 3EY1A 1XHXA 4CJFA 2FBXA 1ZBFA 3AA5X 3OYKA 4O5BA 4O44A 2VG5A 2IGIA 1HQUA 1LWFA 3OYMA 3HT3A 4FXDA 3K5OA 3SYZA 3V1QA 1IKYA 2HHSA 1JL2A 4C8NA 1SUQA 2FBVA 3CM6A 1UA0A 3RMBA 3BDPA 3SNNA 5I3UA 2KFZA 3B6OA 5DMRA 1LAVA 1FKPA 4FM2A 3S9HA 3AA2A 3DLGA 1ZBIA 3NFAA 1WSEA 1XWLA 4M3UA 1D9DA 1VSDA 3L3UA 3VQDA 1NK6A 4J2DA 2G8HA 3TANA 1BIUA 4E7HA 4FLYA 1F21A 2ETJA 1DTTA 1VSHA 1QQCA 4CGGA 1Y97A 4FJLA 2GUIA 1LV5A 1HNVA 1U04A 3MEDA 3OYAA 3HVRA 4CJLA 1KTQA 3AVAA 4KAZA 2VWKA 3OYNA 4OLAA 4KO0A 4M3TA 4LSLA 2XY7A 3VQCA 4FW2A 2HHXA 2VWJA 1IKXA 1ASUA 1LWCA 4B9LA 4M3XA 1XC9A 1VRTA 4F2SA 3V9UA 2E6LA 3QINA 4DTRA 4M3WA 4Z0UA 3OYFA 4N5SA 3KIOA 5D3GA 2KQ2A 4CFAA 3NF6A 4J2AA 4NYFA 3KK3A 2BDPA 4ELVA 1MU2A 4CFDA 4DTNA 3DI6A 3QETA 4OPJA 3PY8A 3C95A 3IAYA 4RG8A 1JLCA 1JXBA 2Z1GA 1QHTA 4KKOA 3T19A 4KHYA 2OPPA 5DK5A 3T1AA 1NJYA 3QIOA 1WN7A 3IS9A 4F2RA 3HM9A 1C0MA 1T03A 3AA3A 5HLFA 1Z26A 2F96A 4F3TA 4LY7A 1KVAA 1BISA 2YNGA 3D0PA 1BHLA 3MECA 2X74A 4CJ4A 1UAXA 1KFDA 3AO2A 3JYTA 4LSNA 4KHSA 2PY5A 4GVMA 1S9EA 4EZ6A 3THVA 3U3YA 1B92A 1DTQA 1S5JA 1TL1A 4CGIA 4CHNA 1EETA 3HL8A 3NF9A 1NK5A 2D0AA 4BDPA 3O4NA 4BWMA 3LZJA 3HXMA 3RTVA 4FLVA 1CLQA 1IKVA 3HPHA 1NOZA 3RMDA 1TL3A 3OYDA 4RW6A 2OYQA 4OKEA 3HK2A 3K2PA 1VRUA 2F8TA 3NF7A 3OS0A 1D8YA 3ISNC 3F9KA 1YTAA 1Q8IA 4W5RA 3HP6A 4HHTA 1RILA 3OVNA 2Y1JA 4FJNA 4C8KA 4KHWA 1HJRA 2DFEA 4CGHA 3WNGA 1C1AA 1O1WA 4IG0A 4CJKA 4DSLA 3HSTB 1VSEA 2KZMA 1KVBA 4QOZB 1X1PA 1UOCA 2O4IA 2Z1JA 4ID5A 3KLIA 3DRSA 1A5XA 2PZSA 1K6YA 1NK8A 1NKCA 1C0UA 4E7LA 5EU7A 4FK0A 3B6PA 1NK9A 1T05A 4GW6A 4M41A 3M8RA 4DU3A 2XY8A 4BE1A 3HO1A 3DMJA 4OGCA 4DS5A 4CEFA 3VQ7A 2QK9A 3S3NA 1N5YA 2D0BA 3LWLA 1C1BA 3SQ0A 4IG3A 1WAJA 1X9WA 2IAJA 1QS4A 3LP1A 1UWBA 5KRTA 3HJFA 1L3SA 2DTUA 1HQEA 3SUQA 2G8FA 2X78A 4CJ3A 4Z4IA 1D5AA 4DQQA 2R7YA 2Y1IA 3AO4A 3OYCA 4HUFA 4E3SA 5J2QA 1RTDA 3MXJA 4L8RB 4M3ZA 3O4QA 2Z1IA 4M3RA 1CXUA 1JL1A 3NBPA 3ZSWA 1QSLA 3V9WA 3CQ8A 2DFHA 4Q5VA 1U48A 3ZT1A 3NDKA 1VSLA 1RBTA 4CF9A 1KFSA 3MXMA 3QERA 2ATQA 3KD5E 2KTQA 1NJZA 3DLEA 4DFMA 4CJWA 3L8BA 1G15A 4DU1A 2A1RA 2Z1HA 4K8ZA 2P5OA 4FJ9A 3LP0A 1KVCA 3C6TA 2D5RA 4Y1DA 2YV0X 4KREA 4AHSA 2O4GA 1LW2A 3RWUA 3ZSXA 1SKRA 4DSIA 4HVJA 4B8CA 3AA4A 5C25A 4W5OA 1IG9A 3KK2A 3AVNA 1IKWA 3ZCMA 3ALYA 4I2PA 4DF8A 3KKRA 3DOKA 3I0SA 3NGZA 4CHPA 3OY9A 4JRPA 2IS3A 5FDLA 3ZSQA 4C8MA 3ZSZA 1NK4A 1VSIA 4W5NA 3DYAA 4IDKA 4FM1A 4CF2A 3SJJA 3DLRA 4GMJB 4CHQA 4B9MA 5HBMA 1JLBA 3OS2A 1QTMA 3TI0A 1HYZA 4KHQA 1S1WA 3ZSOA 1U47A 3O3GA 1T8EA 1GOCA 5HROA 2IOCA 3SUPA 2YNIA 1W9HA 4LH4A 3KTQA 4OKKA 3QEXA 4AHRA 3VQPA 3V6DA 1RBUA 1SKSA 4FW1A 4AHCA 2I5JA 3L2QA 1TKDA 4K8XA 2HVIA 3SUNA 2BGGA 4CF1A 4R5PA 2ITGA 4DTUA 1RT7A 3NH0A 1X9MA 5CZ1A 3U3GA 4ELUA 1TK5A 1WSGA 2GBZA 1REVA 2GV9A 4HTUA 4DLEA 3JSMA 2HW3A 1WNSA 3RR8A 4FLTA 3L2WA 1BL3A 1ASVA 4CK2A 3ZT3A 1WAFA 4FLUA 3U6FA 5CY4A 4CJTA 1RBVA 3LAMA 3CFRA 3VQBA 3QEIA 1NK0A 3CM5A 3NGYA 3I8DA 5I42A 1SL0A 3T3FA 4CJ5A 2XO7A 3WNFA 3OYIA 4I9QA 1HMVA 2OZSA 2HHQA 5KTQA 4EP4A 2B4JA 1TKTA 3QNNA 4Z4HA 4DTSA 3OS1A 1NKEA 1I3AA 2XRIA 5J2NA 3CYMA 4CGDA 3SCXA 3V9ZA 1BGXT 1WSHA 4CJVA 4OKJA 1KLMA 3PX6A 4FJKA 5HRNA 3NE6A 1WLJA 5C24A 1J5OA 3SI6A 1SKWA 3DLBA 4PUOA 2YHAA 1WSFA 3SPZA 3QNOA 4Q0BA 4RW4A 2HHUA 3ZT0A 2KW4A 2X6NA 5JS2A 4F8RA 1ZBLA 4QCLA 1KRPA 3IRXA 3P5JA 2P1JA 3DLKA 4KI6A 3OYJA 1RDCA 1RT1A 3VQ9A 3OYLA 3HP9A 1RNHA 4EP5A 4OVLA 4KB1A 3AVIA 2HHTA 3ITHA 4CEAA 4N56A 3TABA 4LH5A 3AVFA 3PO5A 3MEGA 3AVHA 3UIQA 4CERA 1LWEA 1BIZA 1BI4B 3AVMA 1A5WA 5KI6A 3VQ4A 4B8AB 3K57A 4DTMA 1NOYA 1KSPA 2G8UA 2D0CA 2P51A 4CJSA 4E7KA 3TAGA 3S3MA 5SWMA 3LZIA 2XY6A 4F3OA 1B9FA 1T7PA 3TWHA 1HNIA 1VK0A 3KLFA 3FFIA 2YHBA 1RDAA 2A1SA 2HNYA 2HB5A 1JXEA 1A5VA 3L3VA 3TAQA 1UA1A 4ELTA 4N41A 1ZYQA 2HMIA 1GOAA 3DRRA 3V9XA 3KLGA 4CCHA 5FRNA 4CEBA 4Z4EA 4IFVA 1ITGA 1RDBA 2P5GA 1ZBHA 4B3OA 4DTOA 3PX0A 5J1EA 1XHZA 3DOLA 3V9SA 1JLGA 1IO2A 1S9GA 3TAEA 4CHOA 3TARA 4KV8A 2HNZA 3OYHA 4OGEA 3VQEA 3DLHA 2G8KA 3ZSYA 2RKIA 1NK7A 3SQ4A 4N47A 4FLWA 2YNHA 1RT5A 4NCGA 1S1VA 1QSSA 4O4GA 3MEEA 4KFBA 4AH9A 2QKBA 3K5MA 3A2FA 4CEDA 4KTZA 4BWJA 3IG1A 3V1OA 1S1UA 2QXFA 4RW7A 4CIGA 3OJUA 3K59A 1J9AA 3WNEA 2PYJA 4CHZA 4ID1A 4FZXC 4M3YA 3K58A 3VA3A 1RTIA 3PO4A 1EX4A 2ZE2A 2B6AA 1U4BA 5CYMA 4DSFA 3PUFA 3M8QA 1TKZA 1VSKA 4PY5A 2HVHA 4AHVA 4CE9A 3P83D 2ZD1A 4TSXA 1Q9YA 4PQUA 3VN5A 4JLHA 3I0RA 4I9LA 4KTQA 4M45A 1YTUA 4DQPA 4H4OA 1B9DA 2W42A 4FJ5A 4Y1CA 1CXQA 2VG6A 3LPUA 2XHBA 4CIFA 2X6SA 3RRGA 2KZZA 5FRMA 4FJHA 2G8IA 3F73A 1D9FA 4H8KA 4CK1A 5J2MA 3C94A 3KK1A 3ZSRA 3QEWA 1JLFA 3M8PA 3LWMA 1C1CA 3K5NA 4N76A 4CEZA 5KGXA 1EXQA 1RT3A 3SZ2A 4E7IA 1KLNA 2IDOA 1SV5A 2RN2A 4XIUA 1S1TA 4HUEA 4FYDA 4NYNA 1VSJA 4DF4A 3OYEA 4DTPA 1RCHA 1Q9XA 1HYSA 2OPQA 1L5UA 3RMCA 3V81A 3LANA 3V4IA 2F8SA 4E1MA 1L3VA 3NH2A 4FZZA 2NUBA 3CFOA 1JLAA 1BQNA 2RPIA 3AVBA 3TR8A 4CGFA 4DG1A 4FCYA 4FM0A 5HRPA 1RTHA 2FBTA 4DSEA 4I7FA 4DWIA 3H08A 4KTWA 3NAEA 4F4KA 3RR7A 4BDZA 1JLQA 1RT2A 3AVLA 3KLEA 3KJVA 3L2VA 4FVMA 4J2BA 4BE0A 1TAUA 1JLEA 4BACA 3SQ1A 3HVTA 2G8WA 4DS4A 3OYGA 1S6PA 3PV8A 1TK0A 5C42A 4JS5A 1RT4A 5T7BA 2FC0A 4CEOA 4ICLA 3O3HA 3RRHA 3CG7A 4QAGA 2Q3SA 4CJQA 2VG7A 3EZ5A 3LDSA 2ZQBA 3ZT2A 4CJRA 3AV9A 4FLXA 4B9TA 3AVKA 1S1XA 4CIEA 5CZ2A 4KHNA 1LAWA 3M8SA 5FROA 2BE2A 3VA0A 3RMAA 1SL2A 3KD1E 4E89A 1TK8A 4E0DA 3WNHA 1FK9A 1C0TA 4IBNA 1EKEA 4C8LA 4FJ8A 4CEEA 3D45A 3K5LA 1HPZA 4DQSA 3AO5A 4M42A 2KFNA 4DQIA 3G10A 2LSNA 4W5QA 3OJSA 4CGJA 4OJRA 5CYQA 1BCOA 1JKHA 5KRSA 3QIPA 3KKSA 3QEVA 4CJUA 3QO9A 1WSIA 2BANA 2FBYA 4CF8A 1J54A 1BQMA 4H4MA 3LP2A 4G1QA 4AHUA 3LPTA 4FJMA 1LW0A 3V1RA 1TVRA 1YT3A 3G0ZA 2DFFA 1N6QA 4FJGA 1QSYA 4B9SA 2AJQA 4CF0A 3C6UA 4RW8A 4KHUA 4CK3A 4DTJA 3AVCA 3CFPA 1HYVA
chains in the Genus database with same CATH superfamily
4IFEA 1L3UA 1K8KB 4EZ9A 1RT6A 3MCPA 3T69A 1IG8A 4MQ3A 4O0JA 4DFJA 4IEIA 1WOQA 1TUYA 5AQVA 4ZHRA 4B1ZA 4FWQA 4UQGA 2P9UB 3LP3A 2ZJRL 1N34K 1SQKA 1WSJA 3TAPA 4WE1A 3AGKA 1KAZA 1RDDA 4JI3K 4I2QA 1E3MA 3CJAA 3CETA 2YKMA 3TSPA 4NLBA 4FLZA 2BTFA 4ISEA 4BR9A 4FJ7A 1HNWK 3NH1A 1VSFA 1YXQA 4Z4FA 2EHGA 3EYZA 4W5TA 3ID6A 2GX9A 2JLEA 5KQDA 1XNQK 2HNDA 4B08A 3SV4A 3PIOL 3HRGA 1TAQA 3M6GA 4V19S 2WONA 4FWNA 2VCPA 5K14A 4H0TB 1NGHA 2YNFA 2P9LA 1RTJA 1VHXA 1C6VA 4MO4A 3DM2A 4AF1A 3QEPA 1Y64A 4GNIA 4DSJA 3CF5L 4MFBA 1DT9A 3VQ8A 1FJGK 1RDUA 5J2PA 4CZMA 4J2EA 5IWAK 1XNRK 1XHXA 4CJFA 1ZBFA 3AA5X 3VGKA 4O44A 2IGIA 2E2QA 3SYZA 2HHSA 1IKYA 2FBVA 3CM6A 1W97L 2VYPA 2KFZA 3B6OA 1JCGA 5DMRA 1E4GT 1FKPA 2P9SA 2GWKA 1ZBIA 1D9DA 1VSDA 2O8CB 3FZKA 3VQDA 1NWKA 3TANA 1NGFA 1K8AO 1T3VA 4BRDA 1HNVA 4A5BA 4DHYA 3HVRA 3AVAA 4B1UB 2XY7A 4FW2A 2HHXA 1IKXA 1ASUA 3C7NA 4Z0UA 1NNEA 1NU0A 4N5SA 4GV3A 4CFAA 3NF6A 3QBWA 2I7PA 2WC9A 4DTNA 3DI6A 3C95A 3IAYA 2PFUA 3T1AA 1VQ6N 3IS9A 2P9PB 3HM9A 3AA3A 4LY7A 1BISA 3D0PA 3MECA 4H5NA 5AQSA 1UAXA 3AO2A 4KHSA 2Q0RA 1DTQA 2VQFK 1TL1A 1T6DA 3OW2M 3O4NA 3KZBA 2RE2A 3QMLA 4A2BA 5AFUH 4RW6A 5GADP 3SLCA 5AQZA 3HK2A 3MWPA 3O1WA 1D8YA 4BY9C 3VF6A 3HP6A 2Y1JA 4KHWA 3WNGA 5AQJA 4CJKA 4DSLA 4NLCA 2Q0UA 1XMQK 1VSEA 2O4IA 2Z1JA 3R1XA 2PZSA 3DXMA 1NK8A 4FK0A 1C0UA 4E7LA 5EU7A 4EHUA 4DU3A 3HO1A 1GLCG 3DMJA 4OX9K 4K42A 1Q7YO 3VQ7A 2QK9A 3TU5A 3CJCA 3SQ0A 1WAJA 1X9WA 2FXUA 1QS4A 3LP1A 1UWBA 2NRXA 5HOOA 3SK3A 4DR7K 5KRTA 2UXDK 1HQEA 3CMAN 4CJ3A 1D5AA 1M1KO 4HUFA 4L8RB 2Z1IA 4M3RA 3LDOA 3HOTA 4BC2A 3K0SA 3CQ8A 4Q5VA 5BR8K 1RBTA 1KFSA 2NRZA 3KD5E 2KTQA 3DLEA 2ASOA 3C6TA 5BPNA 4KREA 4LFCK 3RWUA 1LW2A 3MWTA 4A57A 3ZSXA 4DSIA 4B8CA 3KK2A 3AVNA 3ZCMA 1I94K 4DF8A 4BR4A 4BC3A 3KKRA 3NVMA 3H3NO 4CHPA 5LJWA 1NK4A 1VSIA 4YOTA 4K41A 3B8AX 4WYBA 3OS2A 5CHIA 4LF4K 3CJ9A 4IOAL 3CCLN 2YNIA 4R79A 1FW6A 5JLFA 4DR2K 4JK8A 3D6RA 3O80A 3VQPA 3V6DA 1SKSA 4FW1A 2I5JA 2HVIA 4CF1A 4JN4A 4OPHA 2GBZA 2GV9A 3JSMA 3EE8A 2HW3A 2BH1A 1ASVA 4YOUA 4A59A 3BZKA 4CJTA 1NK0A 3QEIA 4CJ5A 3OHRA 2HHQA 2OZSA 1TKTA 3W3DA 4DTSA 3AY9A 1I3AA 2UYTA 2V7YA 1W2BM 1O13A 1BGXT 3CXCM 3PX6A 3NE6A 5C24A 3WXJA 3SI6A 2YHAA 1WSFA 2ZGYA 3SPZA 3QNOA 5AQYA 4QS9A 2HBJA 4QCLA 2P1JA 4ILGB 4H0VB 2P9LB 2ZWHA 3OYJA 3VQ9A 3HP9A 1MDUB 4H03B 4KB1A 3C0BA 3VEOA 3R3LA 2F4VK 4JEPA 3TABA 3AVFA 4YORA 3MEGA 2P9IA 4CERA 1LWEA 5KI6A 2OTLN 4MLEA 1P90A 4CD3A 4Z94A 3LZIA 1B9FA 4FOIA 3KVGA 3QBXA 2ZJQL 1QVGM 4N41A 3N4PA 1YITN 3D2FA 3WQUA 5FRNA 3DRRA 1IBMK 1E4FT 3CC7N 2HHHK 4BRQA 3V9SA 1IO2A 4CHOA 4BQZA 4KV8A 4WQ5C 3TTCA 3DLHA 3QDKA 2I7NA 2G8KA 3SQ4A 3DAWA 4N47A 1RT5A 5AQHA 4NCGA 2P9SB 1S1VA 4AM7A 2E2NA 4O4GA 3VEXA 5AFUA 1QSSA 4KFBA 4AH9A 1VQ4N 3I33A 4B1YB 4M3YA 4CHZA 3K58A 1RTIA 1HUXA 2ZE2A 1U4BA 3MCAB 2HVHA 4JI7K 1Q9YA 3SMSA 3VN5A 3I0RA 1YTUA 2W42A 3C7NB 4Y1CA 2FF6A 2WTUA 4DV2K 3F73A 4H8KA 2GUPA 4CZKA 3C94A 1V4SA 3LL3A 1JLFA 1YAGA 1RT3A 4E7IA 1KLNA 2RN2A 4XIUA 4NYNA 1GLJO 2OPQA 3O9UA 5AQTA 1L5UA 1ATNA 3RMCA 3LANA 1VQLN 4IO9L 3MN7A 2KKZA 4H5VA 3TR8A 1HPMA 5GAEP 1Z05A 5HRPA 1RTHA 2FBTA 2O8FA 4F4KA 4GV9A 1JLQA 3VTHA 4BE0A 4J2BA 4BACA 3DXKA 2E1YA 1TK0A 3RVCA 3QFUA 3O3HA 2FC0A 3RRHA 3P31A 4B3RK 1QQOA 1ZBLA 2Q3SA 4FJIA 4K25A 2FF3B 3T1HK 4CIEA 1S1XA 1XMOK 5CZ2A 4KHNA 3M8SA 1TK8A 1X3NA 1FK9A 3MX5A 3D45A 4DQSA 3EE9A 3LDPA 1X3MA 3DXMB 4OJRA 4JI1K 3VERA 1NM1A 3TPQA 2FBYA 1BQMA 4FJMA 3F2KA 1QSYA 2AJQA 3AVCA 4YOWA 1HYVA 3UB5A 1VQ7N 1WBDA 4WQ5A 3L2RA 4FJJA 3VQQA 4X62K 5DM7L 3PX4A 3VQAA 4KPYA 2ZF5O 4FK2A 4OPKA 4E7JA 4O55A 3ZX3A 3KWIA 5HRSA 1QQMA 5GAHP 1D4XA 4CHYA 1NGGA 3SUOA 1U6ZA 4Z4CA 3A8YA 2DY4A 2NLXA 1LCUA 4DTXA 3GDQA 1HRHA 1K9MO 1VQ9N 4CFCA 1VSMA 2JGUA 2RHKA 3KLHA 4U7BA 2XY5A 3ZLJA 1HX1A 2CH6A 4KB0A 4CZHA 5AZJA 2KHOA 1T44A 1YF5L 3E01A 4O0IA 2WOMA 4FJXA 2W41A 3ZT4A 1ZBUA 1EP4A 4E1NA 3O9TA 4DMNA 1MA9B 3DRPA 4JS4A 2G8VA 4CECA 3THWA 3D7EO 4IKFA 4EFHA 1I39A 2VGNA 5FPMA 1VAZA 3KHYA 2OPSA 3H46O 3SBTA 2F7TA 3AAPA 4HUGA 2HHVA 1QE1A 3SQ2A 1R0AA 3L4QA 1SL1A 3I8BA 3AVJA 3U8XA 4GKJK 3MDQA 4ISGA 3VQ6A 1J6ZA 4CFBA 4AILC 1NG9A 5BRDA 5HRRA 3BF3A 2CGKA 5AQFA 1FXXA 2D1KA 4ZTJA 3LAKA 1W0HA 1TV6A 2QTDA 3VF4A 4BRIA 2VG5A 4C8NA 1UA0A 3BDPA 3SNNA 5I3UA 4FWMA 3M3ZA 5DM6L 3AA2A 2E20A 5JVGL 1WSEA 1XWLA 4GVEA 3G6EN 2HMPA 2D4WA 2V7ZA 3NMUA 2P9IB 1BIUA 4BRKA 3H45C 4FLYA 4CGGA 2ETJA 5LMNK 1Y97A 2GUIA 4B1VA 4JHDA 4OLAA 5AQIA 3ZYYX 4LSLA 3VQCA 4CZEA 1VRTA 3SBGA 5MLCQ 1XC9A 3V9UA 4MDAA 4F2SA 3D2FB 2E6LA 4BGAA 4DTRA 4M3WA 4H0XB 3KIOA 2D0OA 2BDPA 3SAHA 3HOSA 4ELVA 4BRFA 4CZGA 1JLCA 3A0IX 3HI0A 2Z1GA 3T19A 2PBDA 4KHYA 1K73O 3U4LA 1NJYA 5C12A 1RFQA 4H5RA 5BPMA 1C0MA 2GWJA 4DKWA 5HLFA 4F3TA 3FLCO 1KFDA 4GVMA 1S9EA 1OH8A 1B92A 3CD6N 2NRRA 5KQ8A 1HKCA 4CHNA 3D2EA 1NK5A 1OH7A 4BDPA 3VTIA 3RTVA 2VQEK 1IKVA 2OYQA 3O9QA 3CPEA 4X65K 3K2PA 3NF7A 3OS0A 3DWLA 4FWLA 4B3SK 4HHTA 4C8KA 2EWSA 3S41A 1HJRA 4LF8K 1C1AA 1NBWA 3VF2A 4IG0A 3HSTB 4QOZB 1RGIA 3MX2A 2YI1A 4A2AA 4ID5A 2E2OA 3KLIA 3WEEA 1NKCA 4LF9K 4JD2A 1XUPO 4DUYK 4M41A 2XY8A 4DS5A 2O8FB 3VGMA 4CEFA 2O8EA 4H5WA 2D0BA 5AR0A 4IG3A 2IAJA 4BROA 3JAMO 5AQGA 3DXKB 3KWGA 4Z4IA 4DQQA 4WQ4A 3AO4A 4F9OA 3P38A 4FWSA 3ZSWA 3NDKA 4FO0A 3MXMA 3QERA 2ATQA 1DEJA 3LDNA 3J7YP 2A1RA 3TTDA 3GE1A 2V52B 3LP0A 3UE5A 2D5RA 2YV0X 2OCEA 4HVJA 5C25A 5M1QA 1G99A 3ALYA 3BEXA 4JRPA 3ZSQA 3C6AA 4C8MA 4W5NA 1YJNN 2YHWA 1BDGA 1JLBA 4DR6K 1QTMA 1HYZA 3TSQA 4BG8A 5FPEA 1QQNA 4KHQA 1U47A 3U9DA 1T8EA 5HROA 4IZ9A 3WXIA 3SUPA 1W9HA 4YDUC 3CCVN 5IT9O 3BUZB 4K8XA 3O1BA 2BGGA 1EO1A 3G25A 3IFRA 1TYQA 4M7YA 3CQXA 3CCRN 1EQYA 1WNSA 3RR8A 1BL3A 4CK2A 4FLUA 3VEWA 5CY4A 1ESVA 1RBVA 3LM2A 3CFRA 1QZ5A 3I8DA 1SL0A 5AZJB 4NB4A 5EXWA 4I9QA 1HMVA 5KTQA 2FSNA 3QNNA 5LJVA 1S3XA 3SJHA 4CJVA 3BZCA 3THWB 1V4TA 4RW4A 2HHUA 1BG3A 1YI2N 4KI6A 3OYLA 4OVLA 2A40A 3AVIA 3PO5A 4LH5A 2UUBK 4LF6K 3AVHA 1CZAN 3VQ4A 4B8AB 1NMDA 4IEEA 2XY6A 4F3OA 1T7PA 1VK0A 1YUWA 1RDAA 2HBKA 1JXEA 3TAQA 2AA4A 4ILHA 1ZYQA 1GOAA 3V9XA 4CCHA 3BP8A 2NRVA 3MN5A 2A5XA 3CCUN 4DTOA 3O9SA 4PL8A 4FL9A 1JLGA 3QICA 1IV0A 1OVYA 3TARA 1BWFO 3OYHA 1ATRA 3ZSYA 2RKIA 2A42A 1NK7A 4FLWA 4E1JA 1WBBA 3FZHA 4A61A 4CEDA 3AARA 3V1OA 3IG1A 3E66A 5M1OA 3PO4A 3E9OA 5BRHA 3T7ZA 4BVPA 4H5TA 4DSFA 1VQNN 4JHDB 4M7XA 1VSKA 4PY5A 4CE9A 2ZD1A 4TSXA 1GLLO 4I9LA 2UUCK 4DQPA 2NNWA 4LFAK 1B9DA 3C65A 4FJ5A 1W7AA 3VOVA 4CD1A 2KZZA 3QB0A 5AQXA 1NLVA 3CIPA 3T1YK 1D9FA 3VGLA 5J2MA 1T6CA 5JLHA 3ZSRA 3K5NA 4N76A 5KGXA 1SV5A 2Q1NA 1VSJA 1RCHA 4U67L 3V4IA 2F8SA 3OA9A 1L3VA 3CFOA 5ELZA 1BQNA 1BOTO 2YHXA 3OBYA 3VENA 3H08A 3NAEA 3CCMN 3D2EB 3RR7A 2OTJN 4PKIA 1TAUA 4JKFA 3OYGA 4BRLA 2W6LA 4XH4A 3C6HA 1RT4A 3K9KA 2HSTA 5T7BA 3CG7A 4B9TA 2VG7A 4CZFA 4FVUA 5FROA 3KD1E 3DJCA 5ADXH 2QEXN 4E0DA 3WNHA 1C0TA 4RCHA 1EKEA 3K5LA 3AO5A 1YIJN 4M42A 3WXLA 3G10A 2Q97A 3WEEB 5CR4A 5C2FA 5KRSA 4JD2B 3QIPA 3KKSA 5C15A 5C2DA 1J54A 3V1RA 1TVRA 2A3ZA 2O8EB 1YT3A 1N6QA 4GY2B 4CF0A 3C6UA 4CK3A 3THYA 3CFPA 4BC5A 4CZJA 1TKXA 4B9NA 3MXIA 3MN6A 1NJWA 3NGIA 1NKBA 4BRCA 2E1ZA 1ASWA 1NJXA 3AO1A 1VQKN 1YVUA 2W40A 3P39A 2IC3A 3AAQA 1L3TA 2NRWA 1HKGA 1KXPA 5KGWA 3ENHA 4PA1A 4DFKA 3O8MA 2EX3A 1KQSM 2QWMA 3L0QA 4HCBA 1Z25A 1TGOA 2E4LA 3K9JA 3ENOA 4NCAA 4HCCA 3SV3A 4OPAA 3CJ1A 4LD0A 3FZFA 5HP1A 1VQ5N 3O5BA 3J7ZO 2YKNA 1CZBA 3P1GA 1DKGD 3HPGA 4DSKA 4CJPA 2QWQA 1SS6A 3Q7CA 5JICA 3NCIA 2YCHA 2OANA 3A5NC 5JS1A 1X9JA 3IUCA 4PWDA 1EWRA 4KI4A 3H3OB 3I55N 3THXA 5E41A 2HHWA 2YX6A 2OZMA 1CZ9A 1KCFA 1RBRA 3SPYA 1RBSA 3AVGA 5AZIA 1TYQB 4CESA 4DFPA 4B1WB 3BGRA 3ZETA 3VQ5A 4C1NK 4YFUA 4IFYA 4B9QA 4DQRA 4JRQA 2ITMA 1GOBA 1N32K 4XH5A 2PYLA 2E5LK 3CERA 4MDBA 4PKGA 1X9SA 4GV6A 3EY1A 2FBXA 1GLDG 4O5BA 3DLLL 2JWKA 4FXDA 4X66K 3K5OA 5AQMA 3V1QA 1JL2A 1JCFA 3RMBA 4DQ8A 4MLHA 3CCQN 3ID8A 3ZEUA 4FM2A 4JI2K 3M1FA 3NFAA 4JI8K 4J2DA 2G8HA 1Q81O 1N36K 1F21A 1VSHA 1NGDA 3Q7BA 4KAZA 1U04A 4CJLA 1KTQA 2ASPA 4KH4A 2F9TA 4BRNA 2HF4A 4M3TA 3L4IA 2VWJA 3GOIA 1LWCA 4B9LA 2YJEA 3WQTA 2WFBA 4CBXA 3WT0A 4JKCA 2KQ2A 4J2AA 3A5LC 4NYFA 2QWRA 3KK3A 1MU2A 3QETA 1NGBA 2ZGZA 2CH5A 5TKYA 4JKGA 2YHYA 2JWLA 1QHTA 4IOCL 5DK5A 1WN7A 5C0YA 4F2RA 5GINA 4FPBA 4LC9B 1KVAA 1BHLA 5AQPA 3ZX2A 3JYTA 4LSNA 2PY5A 2E8AA 2HBMA 3THVA 3U3YA 5AQLA 4BR7A 4CBWA 3HZ6A 2HBLA 1S5JA 5ADXA 1EETA 3NF9A 3LZJA 3J80O 1S72N 3RMDA 3HPHA 1NOZA 1ZXOA 3OYDA 1VRUA 4BQLA 3SAFA 4CVNE 3F9KA 4W5RA 1RILA 3OVNA 4FJNA 5M1KA 1O1WA 3LDQA 5F2RA 3NVKA 2KZMA 3A5MC 2HF3A 1KVBA 1X1PA 4BRPA 1QVFM 4JAXA 3GBTA 3CI5A 4B1XB 1A5XA 1GLEG 2CGLA 2QA4N 1NK9A 4GW6A 3ATVA 3M8RA 4NXNK 4OGCA 2P9KA 1EWQA 1ZBSA 1ATSA 4JKHA 3LWLA 4A62A 2ASMA 3FZLA 4CJ7A 5AQOA 4O8KA 3R8EA 3ZX0A 2Y1IA 3CCJN 3OYCA 4E3SA 1OVQA 4O8UA 4DUZK 1RTDA 3MXJA 3CC4N 1JL1A 1QSLA 1HKBA 3EZWA 2DFHA 3EEQA 2P9NA 3E9PA 3HM8A 4ISFA 1U48A 5AQWA 4YOXA 1VSLA 1YJ9N 4DFMA 1GLFO 4CJWA 1G15A 4J8FA 4DU1A 3WUHA 3O9RA 4K8ZA 4FJ9A 2O4GA 3P4IA 1SKRA 3AA4A 1IKWA 4DV0K 4B3TK 3THYB 4I2PA 1SAZA 4WCEL 3DOKA 3NGZA 4PHTX 2IS3A 2UXCK 4IWVA 1OH6A 3ZSZA 3DYAA 4HTLA 4CF2A 3SJJA 4GMJB 4CHQA 5F0XA 4B9MA 3RSEA 3M5RA 4QS7A 2IOCA 4LH4A 3KTQA 5EOYA 4OKKA 1BUPA 3GL1A 4AHRA 1RBUA 4AHCA 4MO5A 3F9MA 3SUNA 4R5PA 4FWRA 2ITGA 4DTUA 3NH0A 3GG4A 4H0YB 5CZ1A 4ELUA 3CMEN 1TK5A 4HTUA 1REVA 5AQRA 3MMVA 1J5EK 3J7AP 5LY3A 4BR5A 4FLTA 3L2WA 5AQNA 4B3MK 4X64K 3TTFA 3LAMA 3VQBA 3CM5A 1U2VA 5I42A 4IDHA 3T3FA 2XO7A 3WNFA 2Q2RA 4EP4A 2Q31A 3ATUA 4Z4HA 3OS1A 3H1VX 3CYMA 3V9ZA 3THXB 4OKJA 1KLMA 4FJKA 1TUUA 5HRNA 1WLJA 1SKWA 3DLBA 4Q0BA 4DR5K 2KW4A 5JS2A 1KRPA 3P5JA 3DLKA 1WUAA 5AZIB 3OTOK 5C10A 1RDCA 3ZETB 4H0OA 1IBKK 5KPTA 3ITHA 4CEAA 4N56A 4KH6A 1A5WA 5LL6Z 3VEZA 1NOYA 2G8UA 3EO3A 1VQPN 2P51A 4CJSA 4E7KA 3OBWA 3TAGA 5SWMA 4I6MA 2V51B 4DCHA 4WFNL 3KLFA 3FFIA 2A1SA 5B8HA 2UXBK 1A5VA 4ELTA 4CEBA 4Z4EA 4IFVA 1GLAG 3BY5A 5J1EA 3DOLA 1S9GA 4NXMK 4OGEA 3VQEA 4A5AA 4KH5A 3O6WA 4EIAA 3ZEUB 1Q18A 2BUPA 4FWKA 5BN8A 3EKUA 2QKBA 4BREA 1S1UA 2QXFA 4RW7A 4CIGA 3K59A 2PYJA 3WNEA 4CI6A 3VA3A 4BR0A 3FE1A 2B6AA 4IJNA 3M8QA 4CBUA 3E1YA 3P83D 1Q86O 2GELA 4PQUA 4JLHA 4H4OA 4C1NI 4IOXA 1C0GA 3LPUA 2VG6A 2XHBA 4FWOA 2X6SA 4AQYK 3RRGA 5FRMA 4FJHA 2G8IA 3PSIA 1NGEA 4JKGB 3KK1A 5AQQA 3QEWA 3LWMA 4BRHA 1C1CA 1NGJA 1EXQA 3SZ2A 3E9LA 5EVZA 2IVPA 2UU9K 2H3GX 4DF4A 3OYEA 1R59O 3CCSN 1H1VA 4AM6A 3V81A 4E1MA 4PL7A 5AJ3K 2RPIA 3AVBA 4FCYA 4BVOA 4DWIA 1KAYA 5AQKA 5BR9A 3L2VA 4FVMA 3MK6A 1JLEA 3SQ1A 3HVTA 3VESA 4CW7B 1MWMA 2G8WA 2UUAK 4DS4A 1ILYA 3PV8A 4DV1K 2FSJA 4FOEA 4JYAK 5GAGP 3J8AA 4CJQA 3EZ5A 4Y0WA 4FLXA 4CJRA 1LAWA 3RMAA 2BE2A 3VA0A 5M1PA 3UKRA 4E89A 4IBNA 4FJ8A 4CEEA 1LOTB 1HPZA 2KFNA 4W5QA 3OJSA 5CYQA 1JKHA 4BRAA 3QEVA 3CHWA 4JKBA 5HL7L 4CF8A 1VQMN 4EAHD 2P9KB 3LM9A 3G0ZA 4BR2A 4KHUA 4DTJA 4H0PA 2NRTA 5KPZA 3EN9A 3QLHA 5GIPA 1JCEA 3S3OA 2OA8A 5TKWA 4AHTA 4DLGA 2O8BA 4E19A 3AO3A 1S6QA 4OLBA 2P9NB 4KRFA 3ZSVA 4ZTFA 3TAMA 2A6AA 4JKEA 2RF2A 4Z4GA 3KK7A 1MWKA 4XH1A 1WB9A 3FFKB 3HTVA 4B9VA 1NGIA 1BCMA 4RW9A 4C8OA 2QWLA 1KD1O 1U45A 3NF8A 3HYFA 3AGRA 4DU4A 1XQSC 4BE2A 4NCBA 3RSEB 2FLOA 1NGAA 2OPRA 3O3FA 3FZMA 5H1SQ 2QW9A 1FKOA 1U49A 4B9UA 4CJEA 3ASMA 1IH7A 4CEQA 4FZYA 3OYBA 4HWIA 4BDYA 3HPOA 3R6MA 3L2UA 2E6MA 3HBTA 4YDUA 4BRGA 4FK4A 1XI1A 3QESA 4LFBK 4BRMA 3ULDA 4YNQA 3MAQA 1J53A 1BI4A 3LALA 1U2VB 4JNEA 4CZLA 1DLOA 2PAVA 2B5JA 5EY4A 5BREA 5CE3A 5JVHL 3TAFA 3NHGA 5SZTA 2QKKA 4DR3K 4GKKK 4KBOA 3OYKA 2J4RA 1HQUA 1LWFA 4M63C 3OYMA 3HT3A 2O8DA 5LMUK 1SUQA 1LAVA 3H6EA 3VEYA 3S9HA 3DLGA 4M3UA 4QS8A 3EKSA 2KLAA 3L3UA 1NK6A 1IBLK 5JMVA 4E7HA 2YJFA 1DTTA 1QQCA 3VETA 4FJLA 1JJ2M 1LV5A 3MEDA 3OYAA 4I6MB 2VWKA 3OYNA 4KO0A 3JXUA 4M3XA 3VEVA 3IKMA 4DV7K 3QINA 3VMFB 3OYFA 5D3GA 4DV6K 1NJIO 4G9ZA 4CFDA 3PY8A 4OPJA 4RG8A 3UKUA 1JXBA 4KKOA 4DV5K 2OPPA 3QIOA 1VQ8N 2CGJA 1T03A 4JV5K 1Z26A 2F96A 3TSUA 5FPNA 2YNGA 5BRFA 4DR4K 2X74A 5I9EB 1Z6RA 4CJ4A 1Q82O 4EZ6A 2DPNA 4CGIA 3HL8A 2D0AA 3VPZA 4BWMA 4BC4A 3HXMA 4FLVA 1CLQA 5FPDA 3CPWM 1TL3A 4OKEA 3O4WA 2F8TA 3ULEA 1N33K 3ISNC 4JKAA 1YTAA 1Q8IA 2QWOA 2DFEA 3W0LA 4CGHA 4IJAA 4JK7A 1HLUA 4ILJA 4DV4K 2IVOA 1UOCA 3G4SN 2NRHA 3FGUA 4YHHK 3DRSA 1RDWX 1K6YA 3B6PA 2GEMA 1T05A 4BE1A 3U9ZA 1BA1A 2F9WA 3S3NA 1N5YA 4BG9A 1C1BA 2VGMA 2D0PA 4XEIA 4RTFD 3HJFA 1L3SA 2DTUA 5M1NA 1OKJA 5F1XA 3SUQA 3CJ7A 2G8FA 1K8KA 2X78A 4C23A 2R7YA 5J2QA 4M3ZA 3O4QA 1CXUA 3NBPA 3EL2A 3V9WA 3UKRB 3BF1A 4IXCA 3ZT1A 2P9UA 4BGBA 4CF9A 4JK9A 1NJZA 4JI4K 3L8BA 2Z1HA 2P5OA 1M90O 2IIRA 1KVCA 2HOEA 4Y1DA 4AHSA 3MN9A 3PIPL 4YOYA 1IG9A 4W5OA 3O08A 5E84A 4NO7A 3I0SA 3OY9A 5FDLA 4IDKA 4FM1A 4KHPK 3WXKA 2A41A 3DLRA 3LDLA 5HBMA 2WUSA 2O8BB 2IVNA 3TI0A 3WXMB 4FWPA 1DGKN 4JKDA 1S1WA 3ZSOA 5E26A 3O3GA 1GOCA 3QFPA 4LF7K 4FPAA 3QEXA 1BO5O 4EHTA 3SAGA 1HNXK 2GTDA 1S22A 1P8ZA 3L2QA 1TKDA 4DB3A 1RT7A 1X9MA 3U3GA 1WSGA 4DLEA 4YOVA 2VWBA 1QZ6A 3J81O 4JI5K 3ZT3A 1WAFA 3U6FA 3R9PA 3NGYA 3IMXA 1C0FA 2QXLA 3OYIA 2B4JA 4FSVA 3CJBA 4CZIA 1NKEA 4WF9L 4JI0K 2XRIA 5J2NA 4CGDA 3L6QA 3SCXA 4WFBL 3CCEN 1WSHA 1ZC6A 4PUOA 1J5OA 4PKHA 3ZT0A 2X6NA 4F8RA 3IRXA 5FLXO 1RT1A 1NGCA 1RNHA 4EP5A 4YY3K 2ZJPL 4DV3K 2HHTA 2O8CA 3HSCA 3UIQA 1BIZA 1BI4B 3AVMA 4DTMA 3K57A 1KSPA 2E2PA 4RWTA 2D0CA 2E88A 1HNZK 3SMPA 3S3MA 3TWHA 1HNIA 1BA0A 1KAXA 1XC3A 2YHBA 3A5OC 5KPRA 2HNYA 1OH5A 2HB5A 3JS6A 3L3VA 1UA1A 4OO1J 2NZTA 2HMIA 3KLGA 4B3OA 3CC2N 1ZBHA 1ITGA 1RDBA 2P5GA 3PX0A 1YHQN 2O8DB 1XHZA 3TAEA 2HNZA 2QWNA 2FSKA 2YNHA 3MEEA 2P9PA 3K5MA 3A2FA 4KTZA 4BWJA 3OJUA 1J9AA 1KC8O 4FZXC 4ID1A 2QI2A 3I56N 4LF5K 1EX4A 5CYMA 5EX5A 3PUFA 1TKZA 2QWPA 4AHVA 3N4QA 5AQUA 5M1FA 3H1QA 1VQON 4KTQA 5BN9A 4M45A 5A2QO 1CXQA 4CIFA 1HJOA 4CK1A 3UKUB 2ZM6K 3M8PA 1NMNA 3G71N 4WFAL 3IDHA 4CEZA 5GIOA 2IDOA 4HUEA 1S1TA 4FYDA 1Q9XA 4DTPA 1HYSA 2QM1A 4O5FA 3PSFA 1HR0K 4FZZA 3NH2A 2NUBA 1JLAA 4CGFA 4DG1A 4FM0A 1GLBG 4WQ4C 4DSEA 4I7FA 4K0KK 4KTWA 4BDZA 1RT2A 3AVLA 3KLEA 3KJVA 3PLAA 3ENBA 3ULEB 1S6PA 1N8RO 5C42A 4JS5A 4CEOA 4UY8O 4ICLA 3CQYA 4QAGA 1IJJA 3LDSA 1YJWN 2ZQBA 3ZT2A 3AV9A 3AVKA 2W6KA 3FR0A 1SL2A 4IO8A 4C8LA 1QHAA 5BPLA 4DQIA 2LSNA 3F5TA 4CGJA 1BCOA 4K43A 4CJUA 3QO9A 1WSIA 2BANA 4DR1K 4H4MA 3LP2A 2WBNA 4G1QA 3LPTA 1YVNA 4AHUA 1LW0A 4JI6K 2AP1A 2DFFA 1SZ2A 4FJGA 4B9SA 4RW8A 2Q36A 4L3QA 1BU6O
chains in the Genus database with same CATH topology
1L3UA 1TKXA 4B9NA 3MXIA 4EZ9A 1RT6A 3QLHA 1NJWA 3NGIA 1NKBA 3S3OA 4MQ3A 1ASWA 4O0JA 3L2RA 1NJXA 4DFJA 4FJJA 3VQQA 2OA8A 4AHTA 3AO1A 4DLGA 4ZHRA 1YVUA 4UQGA 4E19A 3AO3A 2IC3A 1S6QA 4OLBA 1L3TA 3PX4A 5KGWA 3VQAA 4KPYA 4KRFA 3LP3A 4FK2A 4PA1A 3ZSVA 4OPKA 4DFKA 4ZTFA 4E7JA 2EX3A 3TAMA 4O55A 1WSJA 3TAPA 2RF2A 4Z4GA 4WE1A 4HCBA 1Z25A 1TGOA 2E4LA 5HRSA 1RDDA 4I2QA 4CHYA 4NCAA 4HCCA 3SUOA 2DY4A 4Z4CA 3SV3A 4LD0A 4DTXA 2YKMA 1HRHA 4B9VA 5HP1A 4CFCA 1VSMA 2JGUA 1BCMA 3KLHA 2YKNA 4FLZA 2XY5A 4RW9A 1CZBA 3P1GA 4C8OA 3HPGA 4DSKA 4CJPA 4KB0A 4FJ7A 1U45A 3NH1A 1VSFA 3NF8A 3HYFA 4Z4FA 2EHGA 3NCIA 3E01A 4O0IA 3EYZA 2WOMA 4DU4A 4FJXA 4W5TA 5JS1A 3ZT4A 1ZBUA 1EP4A 2JLEA 4BE2A 4NCBA 4E1NA 4PWDA 2HNDA 4B08A 2OPRA 3SV4A 3O3FA 4KI4A 4DMNA 1TAQA 5E41A 3DRPA 2WONA 2HHWA 4JS4A 2G8VA 4CECA 2OZMA 1CZ9A 1FKOA 1U49A 4B9UA 4IKFA 4CJEA 1KCFA 3ASMA 1I39A 1IH7A 5K14A 1RBRA 3SPYA 1RBSA 3AVGA 4CEQA 2OPSA 2YNFA 4CESA 4HUGA 4DFPA 3OYBA 4FZYA 4BDYA 3HPOA 1QE1A 3L2UA 2HHVA 2E6MA 3BGRA 3VQ5A 3SQ2A 1R0AA 4YFUA 1RTJA 4FK4A 1C6VA 3QESA 1XI1A 3DM2A 1SL1A 4IFYA 3ULDA 4DQRA 3QEPA 4YNQA 3MAQA 4JRQA 4DSJA 3AVJA 1J53A 1BI4A 1GOBA 4MFBA 3LALA 3VQ6A 4CFBA 4FJIA 2PYLA 1DLOA 4AILC 2B5JA 5HRRA 3VQ8A 1X9SA 1FXXA 4ZTJA 3LAKA 3NHGA 3TAFA 1W0HA 1TV6A 5SZTA 5J2PA 2QKKA 4J2EA 3EY1A 1XHXA 4CJFA 2FBXA 1ZBFA 3AA5X 3OYKA 4O5BA 4O44A 2VG5A 2IGIA 1HQUA 1LWFA 3OYMA 3HT3A 4FXDA 3K5OA 3SYZA 3V1QA 1IKYA 2HHSA 1JL2A 4C8NA 1SUQA 2FBVA 3CM6A 1UA0A 3RMBA 3BDPA 3SNNA 5I3UA 2KFZA 3B6OA 5DMRA 1LAVA 1FKPA 4FM2A 3S9HA 3AA2A 3DLGA 1ZBIA 3NFAA 1WSEA 1XWLA 4M3UA 1D9DA 1VSDA 3L3UA 3VQDA 1NK6A 4J2DA 2G8HA 3TANA 1BIUA 4E7HA 4FLYA 1F21A 2ETJA 1DTTA 1VSHA 1QQCA 4CGGA 1Y97A 4FJLA 2GUIA 1LV5A 1HNVA 1U04A 3MEDA 3OYAA 3HVRA 4CJLA 1KTQA 3AVAA 4KAZA 2VWKA 3OYNA 4OLAA 4KO0A 4M3TA 4LSLA 2XY7A 3VQCA 4FW2A 2HHXA 2VWJA 1IKXA 1ASUA 1LWCA 4B9LA 4M3XA 1XC9A 1VRTA 4F2SA 3V9UA 2E6LA 3QINA 4DTRA 4M3WA 4Z0UA 3OYFA 4N5SA 3KIOA 5D3GA 2KQ2A 4CFAA 3NF6A 4J2AA 4NYFA 3KK3A 2BDPA 4ELVA 1MU2A 4CFDA 4DTNA 3DI6A 3QETA 4OPJA 3PY8A 3C95A 3IAYA 4RG8A 1JLCA 1JXBA 2Z1GA 1QHTA 4KKOA 3T19A 4KHYA 2OPPA 5DK5A 3T1AA 1NJYA 3QIOA 1WN7A 3IS9A 4F2RA 3HM9A 1C0MA 1T03A 3AA3A 5HLFA 1Z26A 2F96A 4F3TA 4LY7A 1KVAA 1BISA 2YNGA 3D0PA 1BHLA 3MECA 2X74A 4CJ4A 1UAXA 1KFDA 3AO2A 3JYTA 4LSNA 4KHSA 2PY5A 4GVMA 1S9EA 4EZ6A 3THVA 3U3YA 1B92A 1DTQA 1S5JA 1TL1A 4CGIA 4CHNA 1EETA 3HL8A 3NF9A 1NK5A 2D0AA 4BDPA 3O4NA 4BWMA 3LZJA 3HXMA 3RTVA 4FLVA 1CLQA 1IKVA 3HPHA 1NOZA 3RMDA 1TL3A 3OYDA 4RW6A 2OYQA 4OKEA 3HK2A 3K2PA 1VRUA 2F8TA 3NF7A 3OS0A 1D8YA 3ISNC 3F9KA 1YTAA 1Q8IA 4W5RA 3HP6A 4HHTA 1RILA 3OVNA 2Y1JA 4FJNA 4C8KA 4KHWA 1HJRA 2DFEA 4CGHA 3WNGA 1C1AA 1O1WA 4IG0A 4CJKA 4DSLA 3HSTB 1VSEA 2KZMA 1KVBA 4QOZB 1X1PA 1UOCA 2O4IA 2Z1JA 4ID5A 3KLIA 3DRSA 1A5XA 2PZSA 1K6YA 1NK8A 1NKCA 1C0UA 4E7LA 5EU7A 4FK0A 3B6PA 1NK9A 1T05A 4GW6A 4M41A 3M8RA 4DU3A 2XY8A 4BE1A 3HO1A 3DMJA 4OGCA 4DS5A 4CEFA 3VQ7A 2QK9A 3S3NA 1N5YA 2D0BA 3LWLA 1C1BA 3SQ0A 4IG3A 1WAJA 1X9WA 2IAJA 1QS4A 3LP1A 1UWBA 5KRTA 3HJFA 1L3SA 2DTUA 1HQEA 3SUQA 2G8FA 2X78A 4CJ3A 4Z4IA 1D5AA 4DQQA 2R7YA 2Y1IA 3AO4A 3OYCA 4HUFA 4E3SA 5J2QA 1RTDA 3MXJA 4L8RB 4M3ZA 3O4QA 2Z1IA 4M3RA 1CXUA 1JL1A 3NBPA 3ZSWA 1QSLA 3V9WA 3CQ8A 2DFHA 4Q5VA 1U48A 3ZT1A 3NDKA 1VSLA 1RBTA 4CF9A 1KFSA 3MXMA 3QERA 2ATQA 3KD5E 2KTQA 1NJZA 3DLEA 4DFMA 4CJWA 3L8BA 1G15A 4DU1A 2A1RA 2Z1HA 4K8ZA 2P5OA 4FJ9A 3LP0A 1KVCA 3C6TA 2D5RA 4Y1DA 2YV0X 4KREA 4AHSA 2O4GA 1LW2A 3RWUA 3ZSXA 1SKRA 4DSIA 4HVJA 4B8CA 3AA4A 5C25A 4W5OA 1IG9A 3KK2A 3AVNA 1IKWA 3ZCMA 3ALYA 4I2PA 4DF8A 3KKRA 3DOKA 3I0SA 3NGZA 4CHPA 3OY9A 4JRPA 2IS3A 5FDLA 3ZSQA 4C8MA 3ZSZA 1NK4A 1VSIA 4W5NA 3DYAA 4IDKA 4FM1A 4CF2A 3SJJA 3DLRA 4GMJB 4CHQA 4B9MA 5HBMA 1JLBA 3OS2A 1QTMA 3TI0A 1HYZA 4KHQA 1S1WA 3ZSOA 1U47A 3O3GA 1T8EA 1GOCA 5HROA 2IOCA 3SUPA 2YNIA 1W9HA 4LH4A 3KTQA 4OKKA 3QEXA 4AHRA 3VQPA 3V6DA 1RBUA 1SKSA 4FW1A 4AHCA 2I5JA 3L2QA 1TKDA 4K8XA 2HVIA 3SUNA 2BGGA 4CF1A 4R5PA 2ITGA 4DTUA 1RT7A 3NH0A 1X9MA 5CZ1A 3U3GA 4ELUA 1TK5A 1WSGA 2GBZA 1REVA 2GV9A 4HTUA 4DLEA 3JSMA 2HW3A 1WNSA 3RR8A 4FLTA 3L2WA 1BL3A 1ASVA 4CK2A 3ZT3A 1WAFA 4FLUA 3U6FA 5CY4A 4CJTA 1RBVA 3LAMA 3CFRA 3VQBA 3QEIA 1NK0A 3CM5A 3NGYA 3I8DA 5I42A 1SL0A 3T3FA 4CJ5A 2XO7A 3WNFA 3OYIA 4I9QA 1HMVA 2OZSA 2HHQA 5KTQA 4EP4A 2B4JA 1TKTA 3QNNA 4Z4HA 4DTSA 3OS1A 1NKEA 1I3AA 2XRIA 5J2NA 3CYMA 4CGDA 3SCXA 3V9ZA 1BGXT 1WSHA 4CJVA 4OKJA 1KLMA 3PX6A 4FJKA 5HRNA 3NE6A 1WLJA 5C24A 1J5OA 3SI6A 1SKWA 3DLBA 4PUOA 2YHAA 1WSFA 3SPZA 3QNOA 4Q0BA 4RW4A 2HHUA 3ZT0A 2KW4A 2X6NA 5JS2A 4F8RA 1ZBLA 4QCLA 1KRPA 3IRXA 3P5JA 2P1JA 3DLKA 4KI6A 3OYJA 1RDCA 1RT1A 3VQ9A 3OYLA 3HP9A 1RNHA 4EP5A 4OVLA 4KB1A 3AVIA 2HHTA 3ITHA 4CEAA 4N56A 3TABA 4LH5A 3AVFA 3PO5A 3MEGA 3AVHA 3UIQA 4CERA 1LWEA 1BIZA 1BI4B 3AVMA 1A5WA 5KI6A 3VQ4A 4B8AB 3K57A 4DTMA 1NOYA 1KSPA 2G8UA 2D0CA 2P51A 4CJSA 4E7KA 3TAGA 3S3MA 5SWMA 3LZIA 2XY6A 4F3OA 1B9FA 1T7PA 3TWHA 1HNIA 1VK0A 3KLFA 3FFIA 2YHBA 1RDAA 2A1SA 2HNYA 2HB5A 1JXEA 1A5VA 3L3VA 3TAQA 1UA1A 4ELTA 4N41A 1ZYQA 2HMIA 1GOAA 3DRRA 3V9XA 3KLGA 4CCHA 5FRNA 4CEBA 4Z4EA 4IFVA 1ITGA 1RDBA 2P5GA 1ZBHA 4B3OA 4DTOA 3PX0A 5J1EA 1XHZA 3DOLA 3V9SA 1JLGA 1IO2A 1S9GA 3TAEA 4CHOA 3TARA 4KV8A 2HNZA 3OYHA 4OGEA 3VQEA 3DLHA 2G8KA 3ZSYA 2RKIA 1NK7A 3SQ4A 4N47A 4FLWA 2YNHA 1RT5A 4NCGA 1S1VA 1QSSA 4O4GA 3MEEA 4KFBA 4AH9A 2QKBA 3K5MA 3A2FA 4CEDA 4KTZA 4BWJA 3IG1A 3V1OA 1S1UA 2QXFA 4RW7A 4CIGA 3OJUA 3K59A 1J9AA 3WNEA 2PYJA 4CHZA 4ID1A 4FZXC 4M3YA 3K58A 3VA3A 1RTIA 3PO4A 1EX4A 2ZE2A 2B6AA 1U4BA 5CYMA 4DSFA 3PUFA 3M8QA 1TKZA 1VSKA 4PY5A 2HVHA 4AHVA 4CE9A 3P83D 2ZD1A 4TSXA 1Q9YA 4PQUA 3VN5A 4JLHA 3I0RA 4I9LA 4KTQA 4M45A 1YTUA 4DQPA 4H4OA 1B9DA 2W42A 4FJ5A 4Y1CA 1CXQA 2VG6A 3LPUA 2XHBA 4CIFA 2X6SA 3RRGA 2KZZA 5FRMA 4FJHA 2G8IA 3F73A 1D9FA 4H8KA 4CK1A 5J2MA 3C94A 3KK1A 3ZSRA 3QEWA 1JLFA 3M8PA 3LWMA 1C1CA 3K5NA 4N76A 4CEZA 5KGXA 1EXQA 1RT3A 3SZ2A 4E7IA 1KLNA 2IDOA 1SV5A 2RN2A 4XIUA 1S1TA 4HUEA 4FYDA 4NYNA 1VSJA 4DF4A 3OYEA 4DTPA 1RCHA 1Q9XA 1HYSA 2OPQA 1L5UA 3RMCA 3V81A 3LANA 3V4IA 2F8SA 4E1MA 1L3VA 3NH2A 4FZZA 2NUBA 3CFOA 1JLAA 1BQNA 2RPIA 3AVBA 3TR8A 4CGFA 4DG1A 4FCYA 4FM0A 5HRPA 1RTHA 2FBTA 4DSEA 4I7FA 4DWIA 3H08A 4KTWA 3NAEA 4F4KA 3RR7A 4BDZA 1JLQA 1RT2A 3AVLA 3KLEA 3KJVA 3L2VA 4FVMA 4J2BA 4BE0A 1TAUA 1JLEA 4BACA 3SQ1A 3HVTA 2G8WA 4DS4A 3OYGA 1S6PA 3PV8A 1TK0A 5C42A 4JS5A 1RT4A 5T7BA 2FC0A 4CEOA 4ICLA 3O3HA 3RRHA 3CG7A 4QAGA 2Q3SA 4CJQA 2VG7A 3EZ5A 3LDSA 2ZQBA 3ZT2A 4CJRA 3AV9A 4FLXA 4B9TA 3AVKA 1S1XA 4CIEA 5CZ2A 4KHNA 1LAWA 3M8SA 5FROA 2BE2A 3VA0A 3RMAA 1SL2A 3KD1E 4E89A 1TK8A 4E0DA 3WNHA 1FK9A 1C0TA 4IBNA 1EKEA 4C8LA 4FJ8A 4CEEA 3D45A 3K5LA 1HPZA 4DQSA 3AO5A 4M42A 2KFNA 4DQIA 3G10A 2LSNA 4W5QA 3OJSA 4CGJA 4OJRA 5CYQA 1BCOA 1JKHA 5KRSA 3QIPA 3KKSA 3QEVA 4CJUA 3QO9A 1WSIA 2BANA 2FBYA 4CF8A 1J54A 1BQMA 4H4MA 3LP2A 4G1QA 4AHUA 3LPTA 4FJMA 1LW0A 3V1RA 1TVRA 1YT3A 3G0ZA 2DFFA 1N6QA 4FJGA 1QSYA 4B9SA 2AJQA 4CF0A 3C6UA 4RW8A 4KHUA 4CK3A 4DTJA 3AVCA 3CFPA 1HYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3U A;  1TKX A;  4B9N A;  3MXI A;  4EZ9 A;  1RT6 A;  3QLH A;  1NJW A;  3NGI A;  1NKB A;  3S3O A;  4MQ3 A;  1ASW A;  4O0J A;  3L2R A;  1NJX A;  4DFJ A;  4FJJ A;  3VQQ A;  2OA8 A;  4AHT A;  3AO1 A;  4DLG A;  4ZHR A;  1YVU A;  4UQG A;  4E19 A;  3AO3 A;  2IC3 A;  1S6Q A;  4OLB A;  1L3T A;  3PX4 A;  5KGW A;  3VQA A;  4KPY A;  4KRF A;  3LP3 A;  4FK2 A;  4PA1 A;  3ZSV A;  4OPK A;  4DFK A;  4ZTF A;  4E7J A;  2EX3 A;  3TAM A;  4O55 A;  1WSJ A;  3TAP A;  2RF2 A;  4Z4G A;  4WE1 A;  4HCB A;  1Z25 A;  1TGO A;  2E4L A;  5HRS A;  1RDD A;  4I2Q A;  4CHY A;  4NCA A;  4HCC A;  3SUO A;  2DY4 A;  4Z4C A;  3SV3 A;  4LD0 A;  4DTX A;  2YKM A;  1HRH A;  4B9V A;  5HP1 A;  4CFC A;  1VSM A;  2JGU A;  1BCM A;  3KLH A;  2YKN A;  4FLZ A;  2XY5 A;  4RW9 A;  1CZB A;  3P1G A;  4C8O A;  3HPG A;  4DSK A;  4CJP A;  4KB0 A;  4FJ7 A;  1U45 A;  3NH1 A;  1VSF A;  3NF8 A;  3HYF A;  4Z4F A;  2EHG A;  3NCI A;  3E01 A;  4O0I A;  3EYZ A;  2WOM A;  4DU4 A;  4FJX A;  4W5T A;  5JS1 A;  3ZT4 A;  1ZBU A;  1EP4 A;  2JLE A;  4BE2 A;  4NCB A;  4E1N A;  4PWD A;  2HND A;  4B08 A;  2OPR A;  3SV4 A;  3O3F A;  4KI4 A;  4DMN A;  1TAQ A;  5E41 A;  3DRP A;  2WON A;  2HHW A;  4JS4 A;  2G8V A;  4CEC A;  2OZM A;  1CZ9 A;  1FKO A;  1U49 A;  4B9U A;  4IKF A;  4CJE A;  1KCF A;  3ASM A;  1I39 A;  1IH7 A;  5K14 A;  1RBR A;  3SPY A;  1RBS A;  3AVG A;  4CEQ A;  2OPS A;  2YNF A;  4CES A;  4HUG A;  4DFP A;  3OYB A;  4FZY A;  4BDY A;  3HPO A;  1QE1 A;  3L2U A;  2HHV A;  2E6M A;  3BGR A;  3VQ5 A;  3SQ2 A;  1R0A A;  4YFU A;  1RTJ A;  4FK4 A;  1C6V A;  3QES A;  1XI1 A;  3DM2 A;  1SL1 A;  4IFY A;  3ULD A;  4DQR A;  3QEP A;  4YNQ A;  3MAQ A;  4JRQ A;  4DSJ A;  3AVJ A;  1J53 A;  1BI4 A;  1GOB A;  4MFB A;  3LAL A;  3VQ6 A;  4CFB A;  4FJI A;  2PYL A;  1DLO A;  4AIL C;  2B5J A;  5HRR A;  3VQ8 A;  1X9S A;  1FXX A;  4ZTJ A;  3LAK A;  3NHG A;  3TAF A;  1W0H A;  1TV6 A;  5SZT A;  5J2P A;  2QKK A;  4J2E A;  3EY1 A;  1XHX A;  4CJF A;  2FBX A;  1ZBF A;  3AA5 X;  3OYK A;  4O5B A;  4O44 A;  2VG5 A;  2IGI A;  1HQU A;  1LWF A;  3OYM A;  3HT3 A;  4FXD A;  3K5O A;  3SYZ A;  3V1Q A;  1IKY A;  2HHS A;  1JL2 A;  4C8N A;  1SUQ A;  2FBV A;  3CM6 A;  1UA0 A;  3RMB A;  3BDP A;  3SNN A;  5I3U A;  2KFZ A;  3B6O A;  5DMR A;  1LAV A;  1FKP A;  4FM2 A;  3S9H A;  3AA2 A;  3DLG A;  1ZBI A;  3NFA A;  1WSE A;  1XWL A;  4M3U A;  1D9D A;  1VSD A;  3L3U A;  3VQD A;  1NK6 A;  4J2D A;  2G8H A;  3TAN A;  1BIU A;  4E7H A;  4FLY A;  1F21 A;  2ETJ A;  1DTT A;  1VSH A;  1QQC A;  4CGG A;  1Y97 A;  4FJL A;  2GUI A;  1LV5 A;  1HNV A;  1U04 A;  3MED A;  3OYA A;  3HVR A;  4CJL A;  1KTQ A;  3AVA A;  4KAZ A;  2VWK A;  3OYN A;  4OLA A;  4KO0 A;  4M3T A;  4LSL A;  2XY7 A;  3VQC A;  4FW2 A;  2HHX A;  2VWJ A;  1IKX A;  1ASU A;  1LWC A;  4B9L A;  4M3X A;  1XC9 A;  1VRT A;  4F2S A;  3V9U A;  2E6L A;  3QIN A;  4DTR A;  4M3W A;  4Z0U A;  3OYF A;  4N5S A;  3KIO A;  5D3G A;  2KQ2 A;  4CFA A;  3NF6 A;  4J2A A;  4NYF A;  3KK3 A;  2BDP A;  4ELV A;  1MU2 A;  4CFD A;  4DTN A;  3DI6 A;  3QET A;  4OPJ A;  3PY8 A;  3C95 A;  3IAY A;  4RG8 A;  1JLC A;  1JXB A;  2Z1G A;  1QHT A;  4KKO A;  3T19 A;  4KHY A;  2OPP A;  5DK5 A;  3T1A A;  1NJY A;  3QIO A;  1WN7 A;  3IS9 A;  4F2R A;  3HM9 A;  1C0M A;  1T03 A;  3AA3 A;  5HLF A;  1Z26 A;  2F96 A;  4F3T A;  4LY7 A;  1KVA A;  1BIS A;  2YNG A;  3D0P A;  1BHL A;  3MEC A;  2X74 A;  4CJ4 A;  1UAX A;  1KFD A;  3AO2 A;  3JYT A;  4LSN A;  4KHS A;  2PY5 A;  4GVM A;  1S9E A;  4EZ6 A;  3THV A;  3U3Y A;  1B92 A;  1DTQ A;  1S5J A;  1TL1 A;  4CGI A;  4CHN A;  1EET A;  3HL8 A;  3NF9 A;  1NK5 A;  2D0A A;  4BDP A;  3O4N A;  4BWM A;  3LZJ A;  3HXM A;  3RTV A;  4FLV A;  1CLQ A;  1IKV A;  3HPH A;  1NOZ A;  3RMD A;  1TL3 A;  3OYD A;  4RW6 A;  2OYQ A;  4OKE A;  3HK2 A;  3K2P A;  1VRU A;  2F8T A;  3NF7 A;  3OS0 A;  1D8Y A;  3ISN C;  3F9K A;  1YTA A;  1Q8I A;  4W5R A;  3HP6 A;  4HHT A;  1RIL A;  3OVN A;  2Y1J A;  4FJN A;  4C8K A;  4KHW A;  1HJR A;  2DFE A;  4CGH A;  3WNG A;  1C1A A;  1O1W A;  4IG0 A;  4CJK A;  4DSL A;  3HST B;  1VSE A;  2KZM A;  1KVB A;  4QOZ B;  1X1P A;  1UOC A;  2O4I A;  2Z1J A;  4ID5 A;  3KLI A;  3DRS A;  1A5X A;  2PZS A;  1K6Y A;  1NK8 A;  1NKC A;  1C0U A;  4E7L A;  5EU7 A;  4FK0 A;  3B6P A;  1NK9 A;  1T05 A;  4GW6 A;  4M41 A;  3M8R A;  4DU3 A;  2XY8 A;  4BE1 A;  3HO1 A;  3DMJ A;  4OGC A;  4DS5 A;  4CEF A;  3VQ7 A;  2QK9 A;  3S3N A;  1N5Y A;  2D0B A;  3LWL A;  1C1B A;  3SQ0 A;  4IG3 A;  1WAJ A;  1X9W A;  2IAJ A;  1QS4 A;  3LP1 A;  1UWB A;  5KRT A;  3HJF A;  1L3S A;  2DTU A;  1HQE A;  3SUQ A;  2G8F A;  2X78 A;  4CJ3 A;  4Z4I A;  1D5A A;  4DQQ A;  2R7Y A;  2Y1I A;  3AO4 A;  3OYC A;  4HUF A;  4E3S A;  5J2Q A;  1RTD A;  3MXJ A;  4L8R B;  4M3Z A;  3O4Q A;  2Z1I A;  4M3R A;  1CXU A;  1JL1 A;  3NBP A;  3ZSW A;  1QSL A;  3V9W A;  3CQ8 A;  2DFH A;  4Q5V A;  1U48 A;  3ZT1 A;  3NDK A;  1VSL A;  1RBT A;  4CF9 A;  1KFS A;  3MXM A;  3QER A;  2ATQ A;  3KD5 E;  2KTQ A;  1NJZ A;  3DLE A;  4DFM A;  4CJW A;  3L8B A;  1G15 A;  4DU1 A;  2A1R A;  2Z1H A;  4K8Z A;  2P5O A;  4FJ9 A;  3LP0 A;  1KVC A;  3C6T A;  2D5R A;  4Y1D A;  2YV0 X;  4KRE A;  4AHS A;  2O4G A;  1LW2 A;  3RWU A;  3ZSX A;  1SKR A;  4DSI A;  4HVJ A;  4B8C A;  3AA4 A;  5C25 A;  4W5O A;  1IG9 A;  3KK2 A;  3AVN A;  1IKW A;  3ZCM A;  3ALY A;  4I2P A;  4DF8 A;  3KKR A;  3DOK A;  3I0S A;  3NGZ A;  4CHP A;  3OY9 A;  4JRP A;  2IS3 A;  5FDL A;  3ZSQ A;  4C8M A;  3ZSZ A;  1NK4 A;  1VSI A;  4W5N A;  3DYA A;  4IDK A;  4FM1 A;  4CF2 A;  3SJJ A;  3DLR A;  4GMJ B;  4CHQ A;  4B9M A;  5HBM A;  1JLB A;  3OS2 A;  1QTM A;  3TI0 A;  1HYZ A;  4KHQ A;  1S1W A;  3ZSO A;  1U47 A;  3O3G A;  1T8E A;  1GOC A;  5HRO A;  2IOC A;  3SUP A;  2YNI A;  1W9H A;  4LH4 A;  3KTQ A;  4OKK A;  3QEX A;  4AHR A;  3VQP A;  3V6D A;  1RBU A;  1SKS A;  4FW1 A;  4AHC A;  2I5J A;  3L2Q A;  1TKD A;  4K8X A;  2HVI A;  3SUN A;  2BGG A;  4CF1 A;  4R5P A;  2ITG A;  4DTU A;  1RT7 A;  3NH0 A;  1X9M A;  5CZ1 A;  3U3G A;  4ELU A;  1TK5 A;  1WSG A;  2GBZ A;  1REV A;  2GV9 A;  4HTU A;  4DLE A;  3JSM A;  2HW3 A;  1WNS A;  3RR8 A;  4FLT A;  3L2W A;  1BL3 A;  1ASV A;  4CK2 A;  3ZT3 A;  1WAF A;  4FLU A;  3U6F A;  5CY4 A;  4CJT A;  1RBV A;  3LAM A;  3CFR A;  3VQB A;  3QEI A;  1NK0 A;  3CM5 A;  3NGY A;  3I8D A;  5I42 A;  1SL0 A;  3T3F A;  4CJ5 A;  2XO7 A;  3WNF A;  3OYI A;  4I9Q A;  1HMV A;  2OZS A;  2HHQ A;  5KTQ A;  4EP4 A;  2B4J A;  1TKT A;  3QNN A;  4Z4H A;  4DTS A;  3OS1 A;  1NKE A;  1I3A A;  2XRI A;  5J2N A;  3CYM A;  4CGD A;  3SCX A;  3V9Z A;  1BGX T;  1WSH A;  4CJV A;  4OKJ A;  1KLM A;  3PX6 A;  4FJK A;  5HRN A;  3NE6 A;  1WLJ A;  5C24 A;  1J5O A;  3SI6 A;  1SKW A;  3DLB A;  4PUO A;  2YHA A;  1WSF A;  3SPZ A;  3QNO A;  4Q0B A;  4RW4 A;  2HHU A;  3ZT0 A;  2KW4 A;  2X6N A;  5JS2 A;  4F8R A;  1ZBL A;  4QCL A;  1KRP A;  3IRX A;  3P5J A;  2P1J A;  3DLK A;  4KI6 A;  3OYJ A;  1RDC A;  1RT1 A;  3VQ9 A;  3OYL A;  3HP9 A;  1RNH A;  4EP5 A;  4OVL A;  4KB1 A;  3AVI A;  2HHT A;  3ITH A;  4CEA A;  4N56 A;  3TAB A;  4LH5 A;  3AVF A;  3PO5 A;  3MEG A;  3AVH A;  3UIQ A;  4CER A;  1LWE A;  1BIZ A;  1BI4 B;  3AVM A;  1A5W A;  5KI6 A;  3VQ4 A;  4B8A B;  3K57 A;  4DTM A;  1NOY A;  1KSP A;  2G8U A;  2D0C A;  2P51 A;  4CJS A;  4E7K A;  3TAG A;  3S3M A;  5SWM A;  3LZI A;  2XY6 A;  4F3O A;  1B9F A;  1T7P A;  3TWH A;  1HNI A;  1VK0 A;  3KLF A;  3FFI A;  2YHB A;  1RDA A;  2A1S A;  2HNY A;  2HB5 A;  1JXE A;  1A5V A;  3L3V A;  3TAQ A;  1UA1 A;  4ELT A;  4N41 A;  1ZYQ A;  2HMI A;  1GOA A;  3DRR A;  3V9X A;  3KLG A;  4CCH A;  5FRN A;  4CEB A;  4Z4E A;  4IFV A;  1ITG A;  1RDB A;  2P5G A;  1ZBH A;  4B3O A;  4DTO A;  3PX0 A;  5J1E A;  1XHZ A;  3DOL A;  3V9S A;  1JLG A;  1IO2 A;  1S9G A;  3TAE A;  4CHO A;  3TAR A;  4KV8 A;  2HNZ A;  3OYH A;  4OGE A;  3VQE A;  3DLH A;  2G8K A;  3ZSY A;  2RKI A;  1NK7 A;  3SQ4 A;  4N47 A;  4FLW A;  2YNH A;  1RT5 A;  4NCG A;  1S1V A;  1QSS A;  4O4G A;  3MEE A;  4KFB A;  4AH9 A;  2QKB A;  3K5M A;  3A2F A;  4CED A;  4KTZ A;  4BWJ A;  3IG1 A;  3V1O A;  1S1U A;  2QXF A;  4RW7 A;  4CIG A;  3OJU A;  3K59 A;  1J9A A;  3WNE A;  2PYJ A;  4CHZ A;  4ID1 A;  4FZX C;  4M3Y A;  3K58 A;  3VA3 A;  1RTI A;  3PO4 A;  1EX4 A;  2ZE2 A;  2B6A A;  1U4B A;  5CYM A;  4DSF A;  3PUF A;  3M8Q A;  1TKZ A;  1VSK A;  4PY5 A;  2HVH A;  4AHV A;  4CE9 A;  3P83 D;  2ZD1 A;  4TSX A;  1Q9Y A;  4PQU A;  3VN5 A;  4JLH A;  3I0R A;  4I9L A;  4KTQ A;  4M45 A;  1YTU A;  4DQP A;  4H4O A;  1B9D A;  2W42 A;  4FJ5 A;  4Y1C A;  1CXQ A;  2VG6 A;  3LPU A;  2XHB A;  4CIF A;  2X6S A;  3RRG A;  2KZZ A;  5FRM A;  4FJH A;  2G8I A;  3F73 A;  1D9F A;  4H8K A;  4CK1 A;  5J2M A;  3C94 A;  3KK1 A;  3ZSR A;  3QEW A;  1JLF A;  3M8P A;  3LWM A;  1C1C A;  3K5N A;  4N76 A;  4CEZ A;  5KGX A;  1EXQ A;  1RT3 A;  3SZ2 A;  4E7I A;  1KLN A;  2IDO A;  1SV5 A;  2RN2 A;  4XIU A;  1S1T A;  4HUE A;  4FYD A;  4NYN A;  1VSJ A;  4DF4 A;  3OYE A;  4DTP A;  1RCH A;  1Q9X A;  1HYS A;  2OPQ A;  1L5U A;  3RMC A;  3V81 A;  3LAN A;  3V4I A;  2F8S A;  4E1M A;  1L3V A;  3NH2 A;  4FZZ A;  2NUB A;  3CFO A;  1JLA A;  1BQN A;  2RPI A;  3AVB A;  3TR8 A;  4CGF A;  4DG1 A;  4FCY A;  4FM0 A;  5HRP A;  1RTH A;  2FBT A;  4DSE A;  4I7F A;  4DWI A;  3H08 A;  4KTW A;  3NAE A;  4F4K A;  3RR7 A;  4BDZ A;  1JLQ A;  1RT2 A;  3AVL A;  3KLE A;  3KJV A;  3L2V A;  4FVM A;  4J2B A;  4BE0 A;  1TAU A;  1JLE A;  4BAC A;  3SQ1 A;  3HVT A;  2G8W A;  4DS4 A;  3OYG A;  1S6P A;  3PV8 A;  1TK0 A;  5C42 A;  4JS5 A;  1RT4 A;  5T7B A;  2FC0 A;  4CEO A;  4ICL A;  3O3H A;  3RRH A;  3CG7 A;  4QAG A;  2Q3S A;  4CJQ A;  2VG7 A;  3EZ5 A;  3LDS A;  2ZQB A;  3ZT2 A;  4CJR A;  3AV9 A;  4FLX A;  4B9T A;  3AVK A;  1S1X A;  4CIE A;  5CZ2 A;  4KHN A;  1LAW A;  3M8S A;  5FRO A;  2BE2 A;  3VA0 A;  3RMA A;  1SL2 A;  3KD1 E;  4E89 A;  1TK8 A;  4E0D A;  3WNH A;  1FK9 A;  1C0T A;  4IBN A;  1EKE A;  4C8L A;  4FJ8 A;  4CEE A;  3D45 A;  3K5L A;  1HPZ A;  4DQS A;  3AO5 A;  4M42 A;  2KFN A;  4DQI A;  3G10 A;  2LSN A;  4W5Q A;  3OJS A;  4CGJ A;  4OJR A;  5CYQ A;  1BCO A;  1JKH A;  5KRS A;  3QIP A;  3KKS A;  3QEV A;  4CJU A;  3QO9 A;  1WSI A;  2BAN A;  2FBY A;  4CF8 A;  1J54 A;  1BQM A;  4H4M A;  3LP2 A;  4G1Q A;  4AHU A;  3LPT A;  4FJM A;  1LW0 A;  3V1R A;  1TVR A;  1YT3 A;  3G0Z A;  2DFF A;  1N6Q A;  4FJG A;  1QSY A;  4B9S A;  2AJQ A;  4CF0 A;  3C6U A;  4RW8 A;  4KHU A;  4CK3 A;  4DTJ A;  3AVC A;  3CFP A;  1HYV A; 
#chains in the Genus database with same CATH topology
 4IFE A;  1L3U A;  1K8K B;  4EZ9 A;  1RT6 A;  3MCP A;  3T69 A;  1IG8 A;  4MQ3 A;  4O0J A;  4DFJ A;  4IEI A;  1WOQ A;  1TUY A;  5AQV A;  4ZHR A;  4B1Z A;  4FWQ A;  4UQG A;  2P9U B;  3LP3 A;  2ZJR L;  1N34 K;  1SQK A;  1WSJ A;  3TAP A;  4WE1 A;  3AGK A;  1KAZ A;  1RDD A;  4JI3 K;  4I2Q A;  1E3M A;  3CJA A;  3CET A;  2YKM A;  3TSP A;  4NLB A;  4FLZ A;  2BTF A;  4ISE A;  4BR9 A;  4FJ7 A;  1HNW K;  3NH1 A;  1VSF A;  1YXQ A;  4Z4F A;  2EHG A;  3EYZ A;  4W5T A;  3ID6 A;  2GX9 A;  2JLE A;  5KQD A;  1XNQ K;  2HND A;  4B08 A;  3SV4 A;  3PIO L;  3HRG A;  1TAQ A;  3M6G A;  4V19 S;  2WON A;  4FWN A;  2VCP A;  5K14 A;  4H0T B;  1NGH A;  2YNF A;  2P9L A;  1RTJ A;  1VHX A;  1C6V A;  4MO4 A;  3DM2 A;  4AF1 A;  3QEP A;  1Y64 A;  4GNI A;  4DSJ A;  3CF5 L;  4MFB A;  1DT9 A;  3VQ8 A;  1FJG K;  1RDU A;  5J2P A;  4CZM A;  4J2E A;  5IWA K;  1XNR K;  1XHX A;  4CJF A;  1ZBF A;  3AA5 X;  3VGK A;  4O44 A;  2IGI A;  2E2Q A;  3SYZ A;  2HHS A;  1IKY A;  2FBV A;  3CM6 A;  1W97 L;  2VYP A;  2KFZ A;  3B6O A;  1JCG A;  5DMR A;  1E4G T;  1FKP A;  2P9S A;  2GWK A;  1ZBI A;  1D9D A;  1VSD A;  2O8C B;  3FZK A;  3VQD A;  1NWK A;  3TAN A;  1NGF A;  1K8A O;  1T3V A;  4BRD A;  1HNV A;  4A5B A;  4DHY A;  3HVR A;  3AVA A;  4B1U B;  2XY7 A;  4FW2 A;  2HHX A;  1IKX A;  1ASU A;  3C7N A;  4Z0U A;  1NNE A;  1NU0 A;  4N5S A;  4GV3 A;  4CFA A;  3NF6 A;  3QBW A;  2I7P A;  2WC9 A;  4DTN A;  3DI6 A;  3C95 A;  3IAY A;  2PFU A;  3T1A A;  1VQ6 N;  3IS9 A;  2P9P B;  3HM9 A;  3AA3 A;  4LY7 A;  1BIS A;  3D0P A;  3MEC A;  4H5N A;  5AQS A;  1UAX A;  3AO2 A;  4KHS A;  2Q0R A;  1DTQ A;  2VQF K;  1TL1 A;  1T6D A;  3OW2 M;  3O4N A;  3KZB A;  2RE2 A;  3QML A;  4A2B A;  5AFU H;  4RW6 A;  5GAD P;  3SLC A;  5AQZ A;  3HK2 A;  3MWP A;  3O1W A;  1D8Y A;  4BY9 C;  3VF6 A;  3HP6 A;  2Y1J A;  4KHW A;  3WNG A;  5AQJ A;  4CJK A;  4DSL A;  4NLC A;  2Q0U A;  1XMQ K;  1VSE A;  2O4I A;  2Z1J A;  3R1X A;  2PZS A;  3DXM A;  1NK8 A;  4FK0 A;  1C0U A;  4E7L A;  5EU7 A;  4EHU A;  4DU3 A;  3HO1 A;  1GLC G;  3DMJ A;  4OX9 K;  4K42 A;  1Q7Y O;  3VQ7 A;  2QK9 A;  3TU5 A;  3CJC A;  3SQ0 A;  1WAJ A;  1X9W A;  2FXU A;  1QS4 A;  3LP1 A;  1UWB A;  2NRX A;  5HOO A;  3SK3 A;  4DR7 K;  5KRT A;  2UXD K;  1HQE A;  3CMA N;  4CJ3 A;  1D5A A;  1M1K O;  4HUF A;  4L8R B;  2Z1I A;  4M3R A;  3LDO A;  3HOT A;  4BC2 A;  3K0S A;  3CQ8 A;  4Q5V A;  5BR8 K;  1RBT A;  1KFS A;  2NRZ A;  3KD5 E;  2KTQ A;  3DLE A;  2ASO A;  3C6T A;  5BPN A;  4KRE A;  4LFC K;  3RWU A;  1LW2 A;  3MWT A;  4A57 A;  3ZSX A;  4DSI A;  4B8C A;  3KK2 A;  3AVN A;  3ZCM A;  1I94 K;  4DF8 A;  4BR4 A;  4BC3 A;  3KKR A;  3NVM A;  3H3N O;  4CHP A;  5LJW A;  1NK4 A;  1VSI A;  4YOT A;  4K41 A;  3B8A X;  4WYB A;  3OS2 A;  5CHI A;  4LF4 K;  3CJ9 A;  4IOA L;  3CCL N;  2YNI A;  4R79 A;  1FW6 A;  5JLF A;  4DR2 K;  4JK8 A;  3D6R A;  3O80 A;  3VQP A;  3V6D A;  1SKS A;  4FW1 A;  2I5J A;  2HVI A;  4CF1 A;  4JN4 A;  4OPH A;  2GBZ A;  2GV9 A;  3JSM A;  3EE8 A;  2HW3 A;  2BH1 A;  1ASV A;  4YOU A;  4A59 A;  3BZK A;  4CJT A;  1NK0 A;  3QEI A;  4CJ5 A;  3OHR A;  2HHQ A;  2OZS A;  1TKT A;  3W3D A;  4DTS A;  3AY9 A;  1I3A A;  2UYT A;  2V7Y A;  1W2B M;  1O13 A;  1BGX T;  3CXC M;  3PX6 A;  3NE6 A;  5C24 A;  3WXJ A;  3SI6 A;  2YHA A;  1WSF A;  2ZGY A;  3SPZ A;  3QNO A;  5AQY A;  4QS9 A;  2HBJ A;  4QCL A;  2P1J A;  4ILG B;  4H0V B;  2P9L B;  2ZWH A;  3OYJ A;  3VQ9 A;  3HP9 A;  1MDU B;  4H03 B;  4KB1 A;  3C0B A;  3VEO A;  3R3L A;  2F4V K;  4JEP A;  3TAB A;  3AVF A;  4YOR A;  3MEG A;  2P9I A;  4CER A;  1LWE A;  5KI6 A;  2OTL N;  4MLE A;  1P90 A;  4CD3 A;  4Z94 A;  3LZI A;  1B9F A;  4FOI A;  3KVG A;  3QBX A;  2ZJQ L;  1QVG M;  4N41 A;  3N4P A;  1YIT N;  3D2F A;  3WQU A;  5FRN A;  3DRR A;  1IBM K;  1E4F T;  3CC7 N;  2HHH K;  4BRQ A;  3V9S A;  1IO2 A;  4CHO A;  4BQZ A;  4KV8 A;  4WQ5 C;  3TTC A;  3DLH A;  3QDK A;  2I7N A;  2G8K A;  3SQ4 A;  3DAW A;  4N47 A;  1RT5 A;  5AQH A;  4NCG A;  2P9S B;  1S1V A;  4AM7 A;  2E2N A;  4O4G A;  3VEX A;  5AFU A;  1QSS A;  4KFB A;  4AH9 A;  1VQ4 N;  3I33 A;  4B1Y B;  4M3Y A;  4CHZ A;  3K58 A;  1RTI A;  1HUX A;  2ZE2 A;  1U4B A;  3MCA B;  2HVH A;  4JI7 K;  1Q9Y A;  3SMS A;  3VN5 A;  3I0R A;  1YTU A;  2W42 A;  3C7N B;  4Y1C A;  2FF6 A;  2WTU A;  4DV2 K;  3F73 A;  4H8K A;  2GUP A;  4CZK A;  3C94 A;  1V4S A;  3LL3 A;  1JLF A;  1YAG A;  1RT3 A;  4E7I A;  1KLN A;  2RN2 A;  4XIU A;  4NYN A;  1GLJ O;  2OPQ A;  3O9U A;  5AQT A;  1L5U A;  1ATN A;  3RMC A;  3LAN A;  1VQL N;  4IO9 L;  3MN7 A;  2KKZ A;  4H5V A;  3TR8 A;  1HPM A;  5GAE P;  1Z05 A;  5HRP A;  1RTH A;  2FBT A;  2O8F A;  4F4K A;  4GV9 A;  1JLQ A;  3VTH A;  4BE0 A;  4J2B A;  4BAC A;  3DXK A;  2E1Y A;  1TK0 A;  3RVC A;  3QFU A;  3O3H A;  2FC0 A;  3RRH A;  3P31 A;  4B3R K;  1QQO A;  1ZBL A;  2Q3S A;  4FJI A;  4K25 A;  2FF3 B;  3T1H K;  4CIE A;  1S1X A;  1XMO K;  5CZ2 A;  4KHN A;  3M8S A;  1TK8 A;  1X3N A;  1FK9 A;  3MX5 A;  3D45 A;  4DQS A;  3EE9 A;  3LDP A;  1X3M A;  3DXM B;  4OJR A;  4JI1 K;  3VER A;  1NM1 A;  3TPQ A;  2FBY A;  1BQM A;  4FJM A;  3F2K A;  1QSY A;  2AJQ A;  3AVC A;  4YOW A;  1HYV A;  3UB5 A;  1VQ7 N;  1WBD A;  4WQ5 A;  3L2R A;  4FJJ A;  3VQQ A;  4X62 K;  5DM7 L;  3PX4 A;  3VQA A;  4KPY A;  2ZF5 O;  4FK2 A;  4OPK A;  4E7J A;  4O55 A;  3ZX3 A;  3KWI A;  5HRS A;  1QQM A;  5GAH P;  1D4X A;  4CHY A;  1NGG A;  3SUO A;  1U6Z A;  4Z4C A;  3A8Y A;  2DY4 A;  2NLX A;  1LCU A;  4DTX A;  3GDQ A;  1HRH A;  1K9M O;  1VQ9 N;  4CFC A;  1VSM A;  2JGU A;  2RHK A;  3KLH A;  4U7B A;  2XY5 A;  3ZLJ A;  1HX1 A;  2CH6 A;  4KB0 A;  4CZH A;  5AZJ A;  2KHO A;  1T44 A;  1YF5 L;  3E01 A;  4O0I A;  2WOM A;  4FJX A;  2W41 A;  3ZT4 A;  1ZBU A;  1EP4 A;  4E1N A;  3O9T A;  4DMN A;  1MA9 B;  3DRP A;  4JS4 A;  2G8V A;  4CEC A;  3THW A;  3D7E O;  4IKF A;  4EFH A;  1I39 A;  2VGN A;  5FPM A;  1VAZ A;  3KHY A;  2OPS A;  3H46 O;  3SBT A;  2F7T A;  3AAP A;  4HUG A;  2HHV A;  1QE1 A;  3SQ2 A;  1R0A A;  3L4Q A;  1SL1 A;  3I8B A;  3AVJ A;  3U8X A;  4GKJ K;  3MDQ A;  4ISG A;  3VQ6 A;  1J6Z A;  4CFB A;  4AIL C;  1NG9 A;  5BRD A;  5HRR A;  3BF3 A;  2CGK A;  5AQF A;  1FXX A;  2D1K A;  4ZTJ A;  3LAK A;  1W0H A;  1TV6 A;  2QTD A;  3VF4 A;  4BRI A;  2VG5 A;  4C8N A;  1UA0 A;  3BDP A;  3SNN A;  5I3U A;  4FWM A;  3M3Z A;  5DM6 L;  3AA2 A;  2E20 A;  5JVG L;  1WSE A;  1XWL A;  4GVE A;  3G6E N;  2HMP A;  2D4W A;  2V7Z A;  3NMU A;  2P9I B;  1BIU A;  4BRK A;  3H45 C;  4FLY A;  4CGG A;  2ETJ A;  5LMN K;  1Y97 A;  2GUI A;  4B1V A;  4JHD A;  4OLA A;  5AQI A;  3ZYY X;  4LSL A;  3VQC A;  4CZE A;  1VRT A;  3SBG A;  5MLC Q;  1XC9 A;  3V9U A;  4MDA A;  4F2S A;  3D2F B;  2E6L A;  4BGA A;  4DTR A;  4M3W A;  4H0X B;  3KIO A;  2D0O A;  2BDP A;  3SAH A;  3HOS A;  4ELV A;  4BRF A;  4CZG A;  1JLC A;  3A0I X;  3HI0 A;  2Z1G A;  3T19 A;  2PBD A;  4KHY A;  1K73 O;  3U4L A;  1NJY A;  5C12 A;  1RFQ A;  4H5R A;  5BPM A;  1C0M A;  2GWJ A;  4DKW A;  5HLF A;  4F3T A;  3FLC O;  1KFD A;  4GVM A;  1S9E A;  1OH8 A;  1B92 A;  3CD6 N;  2NRR A;  5KQ8 A;  1HKC A;  4CHN A;  3D2E A;  1NK5 A;  1OH7 A;  4BDP A;  3VTI A;  3RTV A;  2VQE K;  1IKV A;  2OYQ A;  3O9Q A;  3CPE A;  4X65 K;  3K2P A;  3NF7 A;  3OS0 A;  3DWL A;  4FWL A;  4B3S K;  4HHT A;  4C8K A;  2EWS A;  3S41 A;  1HJR A;  4LF8 K;  1C1A A;  1NBW A;  3VF2 A;  4IG0 A;  3HST B;  4QOZ B;  1RGI A;  3MX2 A;  2YI1 A;  4A2A A;  4ID5 A;  2E2O A;  3KLI A;  3WEE A;  1NKC A;  4LF9 K;  4JD2 A;  1XUP O;  4DUY K;  4M41 A;  2XY8 A;  4DS5 A;  2O8F B;  3VGM A;  4CEF A;  2O8E A;  4H5W A;  2D0B A;  5AR0 A;  4IG3 A;  2IAJ A;  4BRO A;  3JAM O;  5AQG A;  3DXK B;  3KWG A;  4Z4I A;  4DQQ A;  4WQ4 A;  3AO4 A;  4F9O A;  3P38 A;  4FWS A;  3ZSW A;  3NDK A;  4FO0 A;  3MXM A;  3QER A;  2ATQ A;  1DEJ A;  3LDN A;  3J7Y P;  2A1R A;  3TTD A;  3GE1 A;  2V52 B;  3LP0 A;  3UE5 A;  2D5R A;  2YV0 X;  2OCE A;  4HVJ A;  5C25 A;  5M1Q A;  1G99 A;  3ALY A;  3BEX A;  4JRP A;  3ZSQ A;  3C6A A;  4C8M A;  4W5N A;  1YJN N;  2YHW A;  1BDG A;  1JLB A;  4DR6 K;  1QTM A;  1HYZ A;  3TSQ A;  4BG8 A;  5FPE A;  1QQN A;  4KHQ A;  1U47 A;  3U9D A;  1T8E A;  5HRO A;  4IZ9 A;  3WXI A;  3SUP A;  1W9H A;  4YDU C;  3CCV N;  5IT9 O;  3BUZ B;  4K8X A;  3O1B A;  2BGG A;  1EO1 A;  3G25 A;  3IFR A;  1TYQ A;  4M7Y A;  3CQX A;  3CCR N;  1EQY A;  1WNS A;  3RR8 A;  1BL3 A;  4CK2 A;  4FLU A;  3VEW A;  5CY4 A;  1ESV A;  1RBV A;  3LM2 A;  3CFR A;  1QZ5 A;  3I8D A;  1SL0 A;  5AZJ B;  4NB4 A;  5EXW A;  4I9Q A;  1HMV A;  5KTQ A;  2FSN A;  3QNN A;  5LJV A;  1S3X A;  3SJH A;  4CJV A;  3BZC A;  3THW B;  1V4T A;  4RW4 A;  2HHU A;  1BG3 A;  1YI2 N;  4KI6 A;  3OYL A;  4OVL A;  2A40 A;  3AVI A;  3PO5 A;  4LH5 A;  2UUB K;  4LF6 K;  3AVH A;  1CZA N;  3VQ4 A;  4B8A B;  1NMD A;  4IEE A;  2XY6 A;  4F3O A;  1T7P A;  1VK0 A;  1YUW A;  1RDA A;  2HBK A;  1JXE A;  3TAQ A;  2AA4 A;  4ILH A;  1ZYQ A;  1GOA A;  3V9X A;  4CCH A;  3BP8 A;  2NRV A;  3MN5 A;  2A5X A;  3CCU N;  4DTO A;  3O9S A;  4PL8 A;  4FL9 A;  1JLG A;  3QIC A;  1IV0 A;  1OVY A;  3TAR A;  1BWF O;  3OYH A;  1ATR A;  3ZSY A;  2RKI A;  2A42 A;  1NK7 A;  4FLW A;  4E1J A;  1WBB A;  3FZH A;  4A61 A;  4CED A;  3AAR A;  3V1O A;  3IG1 A;  3E66 A;  5M1O A;  3PO4 A;  3E9O A;  5BRH A;  3T7Z A;  4BVP A;  4H5T A;  4DSF A;  1VQN N;  4JHD B;  4M7X A;  1VSK A;  4PY5 A;  4CE9 A;  2ZD1 A;  4TSX A;  1GLL O;  4I9L A;  2UUC K;  4DQP A;  2NNW A;  4LFA K;  1B9D A;  3C65 A;  4FJ5 A;  1W7A A;  3VOV A;  4CD1 A;  2KZZ A;  3QB0 A;  5AQX A;  1NLV A;  3CIP A;  3T1Y K;  1D9F A;  3VGL A;  5J2M A;  1T6C A;  5JLH A;  3ZSR A;  3K5N A;  4N76 A;  5KGX A;  1SV5 A;  2Q1N A;  1VSJ A;  1RCH A;  4U67 L;  3V4I A;  2F8S A;  3OA9 A;  1L3V A;  3CFO A;  5ELZ A;  1BQN A;  1BOT O;  2YHX A;  3OBY A;  3VEN A;  3H08 A;  3NAE A;  3CCM N;  3D2E B;  3RR7 A;  2OTJ N;  4PKI A;  1TAU A;  4JKF A;  3OYG A;  4BRL A;  2W6L A;  4XH4 A;  3C6H A;  1RT4 A;  3K9K A;  2HST A;  5T7B A;  3CG7 A;  4B9T A;  2VG7 A;  4CZF A;  4FVU A;  5FRO A;  3KD1 E;  3DJC A;  5ADX H;  2QEX N;  4E0D A;  3WNH A;  1C0T A;  4RCH A;  1EKE A;  3K5L A;  3AO5 A;  1YIJ N;  4M42 A;  3WXL A;  3G10 A;  2Q97 A;  3WEE B;  5CR4 A;  5C2F A;  5KRS A;  4JD2 B;  3QIP A;  3KKS A;  5C15 A;  5C2D A;  1J54 A;  3V1R A;  1TVR A;  2A3Z A;  2O8E B;  1YT3 A;  1N6Q A;  4GY2 B;  4CF0 A;  3C6U A;  4CK3 A;  3THY A;  3CFP A;  4BC5 A;  4CZJ A;  1TKX A;  4B9N A;  3MXI A;  3MN6 A;  1NJW A;  3NGI A;  1NKB A;  4BRC A;  2E1Z A;  1ASW A;  1NJX A;  3AO1 A;  1VQK N;  1YVU A;  2W40 A;  3P39 A;  2IC3 A;  3AAQ A;  1L3T A;  2NRW A;  1HKG A;  1KXP A;  5KGW A;  3ENH A;  4PA1 A;  4DFK A;  3O8M A;  2EX3 A;  1KQS M;  2QWM A;  3L0Q A;  4HCB A;  1Z25 A;  1TGO A;  2E4L A;  3K9J A;  3ENO A;  4NCA A;  4HCC A;  3SV3 A;  4OPA A;  3CJ1 A;  4LD0 A;  3FZF A;  5HP1 A;  1VQ5 N;  3O5B A;  3J7Z O;  2YKN A;  1CZB A;  3P1G A;  1DKG D;  3HPG A;  4DSK A;  4CJP A;  2QWQ A;  1SS6 A;  3Q7C A;  5JIC A;  3NCI A;  2YCH A;  2OAN A;  3A5N C;  5JS1 A;  1X9J A;  3IUC A;  4PWD A;  1EWR A;  4KI4 A;  3H3O B;  3I55 N;  3THX A;  5E41 A;  2HHW A;  2YX6 A;  2OZM A;  1CZ9 A;  1KCF A;  1RBR A;  3SPY A;  1RBS A;  3AVG A;  5AZI A;  1TYQ B;  4CES A;  4DFP A;  4B1W B;  3BGR A;  3ZET A;  3VQ5 A;  4C1N K;  4YFU A;  4IFY A;  4B9Q A;  4DQR A;  4JRQ A;  2ITM A;  1GOB A;  1N32 K;  4XH5 A;  2PYL A;  2E5L K;  3CER A;  4MDB A;  4PKG A;  1X9S A;  4GV6 A;  3EY1 A;  2FBX A;  1GLD G;  4O5B A;  3DLL L;  2JWK A;  4FXD A;  4X66 K;  3K5O A;  5AQM A;  3V1Q A;  1JL2 A;  1JCF A;  3RMB A;  4DQ8 A;  4MLH A;  3CCQ N;  3ID8 A;  3ZEU A;  4FM2 A;  4JI2 K;  3M1F A;  3NFA A;  4JI8 K;  4J2D A;  2G8H A;  1Q81 O;  1N36 K;  1F21 A;  1VSH A;  1NGD A;  3Q7B A;  4KAZ A;  1U04 A;  4CJL A;  1KTQ A;  2ASP A;  4KH4 A;  2F9T A;  4BRN A;  2HF4 A;  4M3T A;  3L4I A;  2VWJ A;  3GOI A;  1LWC A;  4B9L A;  2YJE A;  3WQT A;  2WFB A;  4CBX A;  3WT0 A;  4JKC A;  2KQ2 A;  4J2A A;  3A5L C;  4NYF A;  2QWR A;  3KK3 A;  1MU2 A;  3QET A;  1NGB A;  2ZGZ A;  2CH5 A;  5TKY A;  4JKG A;  2YHY A;  2JWL A;  1QHT A;  4IOC L;  5DK5 A;  1WN7 A;  5C0Y A;  4F2R A;  5GIN A;  4FPB A;  4LC9 B;  1KVA A;  1BHL A;  5AQP A;  3ZX2 A;  3JYT A;  4LSN A;  2PY5 A;  2E8A A;  2HBM A;  3THV A;  3U3Y A;  5AQL A;  4BR7 A;  4CBW A;  3HZ6 A;  2HBL A;  1S5J A;  5ADX A;  1EET A;  3NF9 A;  3LZJ A;  3J80 O;  1S72 N;  3RMD A;  3HPH A;  1NOZ A;  1ZXO A;  3OYD A;  1VRU A;  4BQL A;  3SAF A;  4CVN E;  3F9K A;  4W5R A;  1RIL A;  3OVN A;  4FJN A;  5M1K A;  1O1W A;  3LDQ A;  5F2R A;  3NVK A;  2KZM A;  3A5M C;  2HF3 A;  1KVB A;  1X1P A;  4BRP A;  1QVF M;  4JAX A;  3GBT A;  3CI5 A;  4B1X B;  1A5X A;  1GLE G;  2CGL A;  2QA4 N;  1NK9 A;  4GW6 A;  3ATV A;  3M8R A;  4NXN K;  4OGC A;  2P9K A;  1EWQ A;  1ZBS A;  1ATS A;  4JKH A;  3LWL A;  4A62 A;  2ASM A;  3FZL A;  4CJ7 A;  5AQO A;  4O8K A;  3R8E A;  3ZX0 A;  2Y1I A;  3CCJ N;  3OYC A;  4E3S A;  1OVQ A;  4O8U A;  4DUZ K;  1RTD A;  3MXJ A;  3CC4 N;  1JL1 A;  1QSL A;  1HKB A;  3EZW A;  2DFH A;  3EEQ A;  2P9N A;  3E9P A;  3HM8 A;  4ISF A;  1U48 A;  5AQW A;  4YOX A;  1VSL A;  1YJ9 N;  4DFM A;  1GLF O;  4CJW A;  1G15 A;  4J8F A;  4DU1 A;  3WUH A;  3O9R A;  4K8Z A;  4FJ9 A;  2O4G A;  3P4I A;  1SKR A;  3AA4 A;  1IKW A;  4DV0 K;  4B3T K;  3THY B;  4I2P A;  1SAZ A;  4WCE L;  3DOK A;  3NGZ A;  4PHT X;  2IS3 A;  2UXC K;  4IWV A;  1OH6 A;  3ZSZ A;  3DYA A;  4HTL A;  4CF2 A;  3SJJ A;  4GMJ B;  4CHQ A;  5F0X A;  4B9M A;  3RSE A;  3M5R A;  4QS7 A;  2IOC A;  4LH4 A;  3KTQ A;  5EOY A;  4OKK A;  1BUP A;  3GL1 A;  4AHR A;  1RBU A;  4AHC A;  4MO5 A;  3F9M A;  3SUN A;  4R5P A;  4FWR A;  2ITG A;  4DTU A;  3NH0 A;  3GG4 A;  4H0Y B;  5CZ1 A;  4ELU A;  3CME N;  1TK5 A;  4HTU A;  1REV A;  5AQR A;  3MMV A;  1J5E K;  3J7A P;  5LY3 A;  4BR5 A;  4FLT A;  3L2W A;  5AQN A;  4B3M K;  4X64 K;  3TTF A;  3LAM A;  3VQB A;  3CM5 A;  1U2V A;  5I42 A;  4IDH A;  3T3F A;  2XO7 A;  3WNF A;  2Q2R A;  4EP4 A;  2Q31 A;  3ATU A;  4Z4H A;  3OS1 A;  3H1V X;  3CYM A;  3V9Z A;  3THX B;  4OKJ A;  1KLM A;  4FJK A;  1TUU A;  5HRN A;  1WLJ A;  1SKW A;  3DLB A;  4Q0B A;  4DR5 K;  2KW4 A;  5JS2 A;  1KRP A;  3P5J A;  3DLK A;  1WUA A;  5AZI B;  3OTO K;  5C10 A;  1RDC A;  3ZET B;  4H0O A;  1IBK K;  5KPT A;  3ITH A;  4CEA A;  4N56 A;  4KH6 A;  1A5W A;  5LL6 Z;  3VEZ A;  1NOY A;  2G8U A;  3EO3 A;  1VQP N;  2P51 A;  4CJS A;  4E7K A;  3OBW A;  3TAG A;  5SWM A;  4I6M A;  2V51 B;  4DCH A;  4WFN L;  3KLF A;  3FFI A;  2A1S A;  5B8H A;  2UXB K;  1A5V A;  4ELT A;  4CEB A;  4Z4E A;  4IFV A;  1GLA G;  3BY5 A;  5J1E A;  3DOL A;  1S9G A;  4NXM K;  4OGE A;  3VQE A;  4A5A A;  4KH5 A;  3O6W A;  4EIA A;  3ZEU B;  1Q18 A;  2BUP A;  4FWK A;  5BN8 A;  3EKU A;  2QKB A;  4BRE A;  1S1U A;  2QXF A;  4RW7 A;  4CIG A;  3K59 A;  2PYJ A;  3WNE A;  4CI6 A;  3VA3 A;  4BR0 A;  3FE1 A;  2B6A A;  4IJN A;  3M8Q A;  4CBU A;  3E1Y A;  3P83 D;  1Q86 O;  2GEL A;  4PQU A;  4JLH A;  4H4O A;  4C1N I;  4IOX A;  1C0G A;  3LPU A;  2VG6 A;  2XHB A;  4FWO A;  2X6S A;  4AQY K;  3RRG A;  5FRM A;  4FJH A;  2G8I A;  3PSI A;  1NGE A;  4JKG B;  3KK1 A;  5AQQ A;  3QEW A;  3LWM A;  4BRH A;  1C1C A;  1NGJ A;  1EXQ A;  3SZ2 A;  3E9L A;  5EVZ A;  2IVP A;  2UU9 K;  2H3G X;  4DF4 A;  3OYE A;  1R59 O;  3CCS N;  1H1V A;  4AM6 A;  3V81 A;  4E1M A;  4PL7 A;  5AJ3 K;  2RPI A;  3AVB A;  4FCY A;  4BVO A;  4DWI A;  1KAY A;  5AQK A;  5BR9 A;  3L2V A;  4FVM A;  3MK6 A;  1JLE A;  3SQ1 A;  3HVT A;  3VES A;  4CW7 B;  1MWM A;  2G8W A;  2UUA K;  4DS4 A;  1ILY A;  3PV8 A;  4DV1 K;  2FSJ A;  4FOE A;  4JYA K;  5GAG P;  3J8A A;  4CJQ A;  3EZ5 A;  4Y0W A;  4FLX A;  4CJR A;  1LAW A;  3RMA A;  2BE2 A;  3VA0 A;  5M1P A;  3UKR A;  4E89 A;  4IBN A;  4FJ8 A;  4CEE A;  1LOT B;  1HPZ A;  2KFN A;  4W5Q A;  3OJS A;  5CYQ A;  1JKH A;  4BRA A;  3QEV A;  3CHW A;  4JKB A;  5HL7 L;  4CF8 A;  1VQM N;  4EAH D;  2P9K B;  3LM9 A;  3G0Z A;  4BR2 A;  4KHU A;  4DTJ A;  4H0P A;  2NRT A;  5KPZ A;  3EN9 A;  3QLH A;  5GIP A;  1JCE A;  3S3O A;  2OA8 A;  5TKW A;  4AHT A;  4DLG A;  2O8B A;  4E19 A;  3AO3 A;  1S6Q A;  4OLB A;  2P9N B;  4KRF A;  3ZSV A;  4ZTF A;  3TAM A;  2A6A A;  4JKE A;  2RF2 A;  4Z4G A;  3KK7 A;  1MWK A;  4XH1 A;  1WB9 A;  3FFK B;  3HTV A;  4B9V A;  1NGI A;  1BCM A;  4RW9 A;  4C8O A;  2QWL A;  1KD1 O;  1U45 A;  3NF8 A;  3HYF A;  3AGR A;  4DU4 A;  1XQS C;  4BE2 A;  4NCB A;  3RSE B;  2FLO A;  1NGA A;  2OPR A;  3O3F A;  3FZM A;  5H1S Q;  2QW9 A;  1FKO A;  1U49 A;  4B9U A;  4CJE A;  3ASM A;  1IH7 A;  4CEQ A;  4FZY A;  3OYB A;  4HWI A;  4BDY A;  3HPO A;  3R6M A;  3L2U A;  2E6M A;  3HBT A;  4YDU A;  4BRG A;  4FK4 A;  1XI1 A;  3QES A;  4LFB K;  4BRM A;  3ULD A;  4YNQ A;  3MAQ A;  1J53 A;  1BI4 A;  3LAL A;  1U2V B;  4JNE A;  4CZL A;  1DLO A;  2PAV A;  2B5J A;  5EY4 A;  5BRE A;  5CE3 A;  5JVH L;  3TAF A;  3NHG A;  5SZT A;  2QKK A;  4DR3 K;  4GKK K;  4KBO A;  3OYK A;  2J4R A;  1HQU A;  1LWF A;  4M63 C;  3OYM A;  3HT3 A;  2O8D A;  5LMU K;  1SUQ A;  1LAV A;  3H6E A;  3VEY A;  3S9H A;  3DLG A;  4M3U A;  4QS8 A;  3EKS A;  2KLA A;  3L3U A;  1NK6 A;  1IBL K;  5JMV A;  4E7H A;  2YJF A;  1DTT A;  1QQC A;  3VET A;  4FJL A;  1JJ2 M;  1LV5 A;  3MED A;  3OYA A;  4I6M B;  2VWK A;  3OYN A;  4KO0 A;  3JXU A;  4M3X A;  3VEV A;  3IKM A;  4DV7 K;  3QIN A;  3VMF B;  3OYF A;  5D3G A;  4DV6 K;  1NJI O;  4G9Z A;  4CFD A;  3PY8 A;  4OPJ A;  4RG8 A;  3UKU A;  1JXB A;  4KKO A;  4DV5 K;  2OPP A;  3QIO A;  1VQ8 N;  2CGJ A;  1T03 A;  4JV5 K;  1Z26 A;  2F96 A;  3TSU A;  5FPN A;  2YNG A;  5BRF A;  4DR4 K;  2X74 A;  5I9E B;  1Z6R A;  4CJ4 A;  1Q82 O;  4EZ6 A;  2DPN A;  4CGI A;  3HL8 A;  2D0A A;  3VPZ A;  4BWM A;  4BC4 A;  3HXM A;  4FLV A;  1CLQ A;  5FPD A;  3CPW M;  1TL3 A;  4OKE A;  3O4W A;  2F8T A;  3ULE A;  1N33 K;  3ISN C;  4JKA A;  1YTA A;  1Q8I A;  2QWO A;  2DFE A;  3W0L A;  4CGH A;  4IJA A;  4JK7 A;  1HLU A;  4ILJ A;  4DV4 K;  2IVO A;  1UOC A;  3G4S N;  2NRH A;  3FGU A;  4YHH K;  3DRS A;  1RDW X;  1K6Y A;  3B6P A;  2GEM A;  1T05 A;  4BE1 A;  3U9Z A;  1BA1 A;  2F9W A;  3S3N A;  1N5Y A;  4BG9 A;  1C1B A;  2VGM A;  2D0P A;  4XEI A;  4RTF D;  3HJF A;  1L3S A;  2DTU A;  5M1N A;  1OKJ A;  5F1X A;  3SUQ A;  3CJ7 A;  2G8F A;  1K8K A;  2X78 A;  4C23 A;  2R7Y A;  5J2Q A;  4M3Z A;  3O4Q A;  1CXU A;  3NBP A;  3EL2 A;  3V9W A;  3UKR B;  3BF1 A;  4IXC A;  3ZT1 A;  2P9U A;  4BGB A;  4CF9 A;  4JK9 A;  1NJZ A;  4JI4 K;  3L8B A;  2Z1H A;  2P5O A;  1M90 O;  2IIR A;  1KVC A;  2HOE A;  4Y1D A;  4AHS A;  3MN9 A;  3PIP L;  4YOY A;  1IG9 A;  4W5O A;  3O08 A;  5E84 A;  4NO7 A;  3I0S A;  3OY9 A;  5FDL A;  4IDK A;  4FM1 A;  4KHP K;  3WXK A;  2A41 A;  3DLR A;  3LDL A;  5HBM A;  2WUS A;  2O8B B;  2IVN A;  3TI0 A;  3WXM B;  4FWP A;  1DGK N;  4JKD A;  1S1W A;  3ZSO A;  5E26 A;  3O3G A;  1GOC A;  3QFP A;  4LF7 K;  4FPA A;  3QEX A;  1BO5 O;  4EHT A;  3SAG A;  1HNX K;  2GTD A;  1S22 A;  1P8Z A;  3L2Q A;  1TKD A;  4DB3 A;  1RT7 A;  1X9M A;  3U3G A;  1WSG A;  4DLE A;  4YOV A;  2VWB A;  1QZ6 A;  3J81 O;  4JI5 K;  3ZT3 A;  1WAF A;  3U6F A;  3R9P A;  3NGY A;  3IMX A;  1C0F A;  2QXL A;  3OYI A;  2B4J A;  4FSV A;  3CJB A;  4CZI A;  1NKE A;  4WF9 L;  4JI0 K;  2XRI A;  5J2N A;  4CGD A;  3L6Q A;  3SCX A;  4WFB L;  3CCE N;  1WSH A;  1ZC6 A;  4PUO A;  1J5O A;  4PKH A;  3ZT0 A;  2X6N A;  4F8R A;  3IRX A;  5FLX O;  1RT1 A;  1NGC A;  1RNH A;  4EP5 A;  4YY3 K;  2ZJP L;  4DV3 K;  2HHT A;  2O8C A;  3HSC A;  3UIQ A;  1BIZ A;  1BI4 B;  3AVM A;  4DTM A;  3K57 A;  1KSP A;  2E2P A;  4RWT A;  2D0C A;  2E88 A;  1HNZ K;  3SMP A;  3S3M A;  3TWH A;  1HNI A;  1BA0 A;  1KAX A;  1XC3 A;  2YHB A;  3A5O C;  5KPR A;  2HNY A;  1OH5 A;  2HB5 A;  3JS6 A;  3L3V A;  1UA1 A;  4OO1 J;  2NZT A;  2HMI A;  3KLG A;  4B3O A;  3CC2 N;  1ZBH A;  1ITG A;  1RDB A;  2P5G A;  3PX0 A;  1YHQ N;  2O8D B;  1XHZ A;  3TAE A;  2HNZ A;  2QWN A;  2FSK A;  2YNH A;  3MEE A;  2P9P A;  3K5M A;  3A2F A;  4KTZ A;  4BWJ A;  3OJU A;  1J9A A;  1KC8 O;  4FZX C;  4ID1 A;  2QI2 A;  3I56 N;  4LF5 K;  1EX4 A;  5CYM A;  5EX5 A;  3PUF A;  1TKZ A;  2QWP A;  4AHV A;  3N4Q A;  5AQU A;  5M1F A;  3H1Q A;  1VQO N;  4KTQ A;  5BN9 A;  4M45 A;  5A2Q O;  1CXQ A;  4CIF A;  1HJO A;  4CK1 A;  3UKU B;  2ZM6 K;  3M8P A;  1NMN A;  3G71 N;  4WFA L;  3IDH A;  4CEZ A;  5GIO A;  2IDO A;  4HUE A;  1S1T A;  4FYD A;  1Q9X A;  4DTP A;  1HYS A;  2QM1 A;  4O5F A;  3PSF A;  1HR0 K;  4FZZ A;  3NH2 A;  2NUB A;  1JLA A;  4CGF A;  4DG1 A;  4FM0 A;  1GLB G;  4WQ4 C;  4DSE A;  4I7F A;  4K0K K;  4KTW A;  4BDZ A;  1RT2 A;  3AVL A;  3KLE A;  3KJV A;  3PLA A;  3ENB A;  3ULE B;  1S6P A;  1N8R O;  5C42 A;  4JS5 A;  4CEO A;  4UY8 O;  4ICL A;  3CQY A;  4QAG A;  1IJJ A;  3LDS A;  1YJW N;  2ZQB A;  3ZT2 A;  3AV9 A;  3AVK A;  2W6K A;  3FR0 A;  1SL2 A;  4IO8 A;  4C8L A;  1QHA A;  5BPL A;  4DQI A;  2LSN A;  3F5T A;  4CGJ A;  1BCO A;  4K43 A;  4CJU A;  3QO9 A;  1WSI A;  2BAN A;  4DR1 K;  4H4M A;  3LP2 A;  2WBN A;  4G1Q A;  3LPT A;  1YVN A;  4AHU A;  1LW0 A;  4JI6 K;  2AP1 A;  2DFF A;  1SZ2 A;  4FJG A;  4B9S A;  4RW8 A;  2Q36 A;  4L3Q A;  1BU6 O; 
#chains in the Genus database with same CATH homology
 1L3U A;  1TKX A;  4B9N A;  3MXI A;  4EZ9 A;  1RT6 A;  3QLH A;  1NJW A;  3NGI A;  1NKB A;  3S3O A;  4MQ3 A;  1ASW A;  4O0J A;  3L2R A;  1NJX A;  4DFJ A;  4FJJ A;  3VQQ A;  2OA8 A;  4AHT A;  3AO1 A;  4DLG A;  4ZHR A;  1YVU A;  4UQG A;  4E19 A;  3AO3 A;  2IC3 A;  1S6Q A;  4OLB A;  1L3T A;  3PX4 A;  5KGW A;  3VQA A;  4KPY A;  4KRF A;  3LP3 A;  4FK2 A;  4PA1 A;  3ZSV A;  4OPK A;  4DFK A;  4ZTF A;  4E7J A;  2EX3 A;  3TAM A;  4O55 A;  1WSJ A;  3TAP A;  2RF2 A;  4Z4G A;  4WE1 A;  4HCB A;  1Z25 A;  1TGO A;  2E4L A;  5HRS A;  1RDD A;  4I2Q A;  4CHY A;  4NCA A;  4HCC A;  3SUO A;  2DY4 A;  4Z4C A;  3SV3 A;  4LD0 A;  4DTX A;  2YKM A;  1HRH A;  4B9V A;  5HP1 A;  4CFC A;  1VSM A;  2JGU A;  1BCM A;  3KLH A;  2YKN A;  4FLZ A;  2XY5 A;  4RW9 A;  1CZB A;  3P1G A;  4C8O A;  3HPG A;  4DSK A;  4CJP A;  4KB0 A;  4FJ7 A;  1U45 A;  3NH1 A;  1VSF A;  3NF8 A;  3HYF A;  4Z4F A;  2EHG A;  3NCI A;  3E01 A;  4O0I A;  3EYZ A;  2WOM A;  4DU4 A;  4FJX A;  4W5T A;  5JS1 A;  3ZT4 A;  1ZBU A;  1EP4 A;  2JLE A;  4BE2 A;  4NCB A;  4E1N A;  4PWD A;  2HND A;  4B08 A;  2OPR A;  3SV4 A;  3O3F A;  4KI4 A;  4DMN A;  1TAQ A;  5E41 A;  3DRP A;  2WON A;  2HHW A;  4JS4 A;  2G8V A;  4CEC A;  2OZM A;  1CZ9 A;  1FKO A;  1U49 A;  4B9U A;  4IKF A;  4CJE A;  1KCF A;  3ASM A;  1I39 A;  1IH7 A;  5K14 A;  1RBR A;  3SPY A;  1RBS A;  3AVG A;  4CEQ A;  2OPS A;  2YNF A;  4CES A;  4HUG A;  4DFP A;  3OYB A;  4FZY A;  4BDY A;  3HPO A;  1QE1 A;  3L2U A;  2HHV A;  2E6M A;  3BGR A;  3VQ5 A;  3SQ2 A;  1R0A A;  4YFU A;  1RTJ A;  4FK4 A;  1C6V A;  3QES A;  1XI1 A;  3DM2 A;  1SL1 A;  4IFY A;  3ULD A;  4DQR A;  3QEP A;  4YNQ A;  3MAQ A;  4JRQ A;  4DSJ A;  3AVJ A;  1J53 A;  1BI4 A;  1GOB A;  4MFB A;  3LAL A;  3VQ6 A;  4CFB A;  4FJI A;  2PYL A;  1DLO A;  4AIL C;  2B5J A;  5HRR A;  3VQ8 A;  1X9S A;  1FXX A;  4ZTJ A;  3LAK A;  3NHG A;  3TAF A;  1W0H A;  1TV6 A;  5SZT A;  5J2P A;  2QKK A;  4J2E A;  3EY1 A;  1XHX A;  4CJF A;  2FBX A;  1ZBF A;  3AA5 X;  3OYK A;  4O5B A;  4O44 A;  2VG5 A;  2IGI A;  1HQU A;  1LWF A;  3OYM A;  3HT3 A;  4FXD A;  3K5O A;  3SYZ A;  3V1Q A;  1IKY A;  2HHS A;  1JL2 A;  4C8N A;  1SUQ A;  2FBV A;  3CM6 A;  1UA0 A;  3RMB A;  3BDP A;  3SNN A;  5I3U A;  2KFZ A;  3B6O A;  5DMR A;  1LAV A;  1FKP A;  4FM2 A;  3S9H A;  3AA2 A;  3DLG A;  1ZBI A;  3NFA A;  1WSE A;  1XWL A;  4M3U A;  1D9D A;  1VSD A;  3L3U A;  3VQD A;  1NK6 A;  4J2D A;  2G8H A;  3TAN A;  1BIU A;  4E7H A;  4FLY A;  1F21 A;  2ETJ A;  1DTT A;  1VSH A;  1QQC A;  4CGG A;  1Y97 A;  4FJL A;  2GUI A;  1LV5 A;  1HNV A;  1U04 A;  3MED A;  3OYA A;  3HVR A;  4CJL A;  1KTQ A;  3AVA A;  4KAZ A;  2VWK A;  3OYN A;  4OLA A;  4KO0 A;  4M3T A;  4LSL A;  2XY7 A;  3VQC A;  4FW2 A;  2HHX A;  2VWJ A;  1IKX A;  1ASU A;  1LWC A;  4B9L A;  4M3X A;  1XC9 A;  1VRT A;  4F2S A;  3V9U A;  2E6L A;  3QIN A;  4DTR A;  4M3W A;  4Z0U A;  3OYF A;  4N5S A;  3KIO A;  5D3G A;  2KQ2 A;  4CFA A;  3NF6 A;  4J2A A;  4NYF A;  3KK3 A;  2BDP A;  4ELV A;  1MU2 A;  4CFD A;  4DTN A;  3DI6 A;  3QET A;  4OPJ A;  3PY8 A;  3C95 A;  3IAY A;  4RG8 A;  1JLC A;  1JXB A;  2Z1G A;  1QHT A;  4KKO A;  3T19 A;  4KHY A;  2OPP A;  5DK5 A;  3T1A A;  1NJY A;  3QIO A;  1WN7 A;  3IS9 A;  4F2R A;  3HM9 A;  1C0M A;  1T03 A;  3AA3 A;  5HLF A;  1Z26 A;  2F96 A;  4F3T A;  4LY7 A;  1KVA A;  1BIS A;  2YNG A;  3D0P A;  1BHL A;  3MEC A;  2X74 A;  4CJ4 A;  1UAX A;  1KFD A;  3AO2 A;  3JYT A;  4LSN A;  4KHS A;  2PY5 A;  4GVM A;  1S9E A;  4EZ6 A;  3THV A;  3U3Y A;  1B92 A;  1DTQ A;  1S5J A;  1TL1 A;  4CGI A;  4CHN A;  1EET A;  3HL8 A;  3NF9 A;  1NK5 A;  2D0A A;  4BDP A;  3O4N A;  4BWM A;  3LZJ A;  3HXM A;  3RTV A;  4FLV A;  1CLQ A;  1IKV A;  3HPH A;  1NOZ A;  3RMD A;  1TL3 A;  3OYD A;  4RW6 A;  2OYQ A;  4OKE A;  3HK2 A;  3K2P A;  1VRU A;  2F8T A;  3NF7 A;  3OS0 A;  1D8Y A;  3ISN C;  3F9K A;  1YTA A;  1Q8I A;  4W5R A;  3HP6 A;  4HHT A;  1RIL A;  3OVN A;  2Y1J A;  4FJN A;  4C8K A;  4KHW A;  1HJR A;  2DFE A;  4CGH A;  3WNG A;  1C1A A;  1O1W A;  4IG0 A;  4CJK A;  4DSL A;  3HST B;  1VSE A;  2KZM A;  1KVB A;  4QOZ B;  1X1P A;  1UOC A;  2O4I A;  2Z1J A;  4ID5 A;  3KLI A;  3DRS A;  1A5X A;  2PZS A;  1K6Y A;  1NK8 A;  1NKC A;  1C0U A;  4E7L A;  5EU7 A;  4FK0 A;  3B6P A;  1NK9 A;  1T05 A;  4GW6 A;  4M41 A;  3M8R A;  4DU3 A;  2XY8 A;  4BE1 A;  3HO1 A;  3DMJ A;  4OGC A;  4DS5 A;  4CEF A;  3VQ7 A;  2QK9 A;  3S3N A;  1N5Y A;  2D0B A;  3LWL A;  1C1B A;  3SQ0 A;  4IG3 A;  1WAJ A;  1X9W A;  2IAJ A;  1QS4 A;  3LP1 A;  1UWB A;  5KRT A;  3HJF A;  1L3S A;  2DTU A;  1HQE A;  3SUQ A;  2G8F A;  2X78 A;  4CJ3 A;  4Z4I A;  1D5A A;  4DQQ A;  2R7Y A;  2Y1I A;  3AO4 A;  3OYC A;  4HUF A;  4E3S A;  5J2Q A;  1RTD A;  3MXJ A;  4L8R B;  4M3Z A;  3O4Q A;  2Z1I A;  4M3R A;  1CXU A;  1JL1 A;  3NBP A;  3ZSW A;  1QSL A;  3V9W A;  3CQ8 A;  2DFH A;  4Q5V A;  1U48 A;  3ZT1 A;  3NDK A;  1VSL A;  1RBT A;  4CF9 A;  1KFS A;  3MXM A;  3QER A;  2ATQ A;  3KD5 E;  2KTQ A;  1NJZ A;  3DLE A;  4DFM A;  4CJW A;  3L8B A;  1G15 A;  4DU1 A;  2A1R A;  2Z1H A;  4K8Z A;  2P5O A;  4FJ9 A;  3LP0 A;  1KVC A;  3C6T A;  2D5R A;  4Y1D A;  2YV0 X;  4KRE A;  4AHS A;  2O4G A;  1LW2 A;  3RWU A;  3ZSX A;  1SKR A;  4DSI A;  4HVJ A;  4B8C A;  3AA4 A;  5C25 A;  4W5O A;  1IG9 A;  3KK2 A;  3AVN A;  1IKW A;  3ZCM A;  3ALY A;  4I2P A;  4DF8 A;  3KKR A;  3DOK A;  3I0S A;  3NGZ A;  4CHP A;  3OY9 A;  4JRP A;  2IS3 A;  5FDL A;  3ZSQ A;  4C8M A;  3ZSZ A;  1NK4 A;  1VSI A;  4W5N A;  3DYA A;  4IDK A;  4FM1 A;  4CF2 A;  3SJJ A;  3DLR A;  4GMJ B;  4CHQ A;  4B9M A;  5HBM A;  1JLB A;  3OS2 A;  1QTM A;  3TI0 A;  1HYZ A;  4KHQ A;  1S1W A;  3ZSO A;  1U47 A;  3O3G A;  1T8E A;  1GOC A;  5HRO A;  2IOC A;  3SUP A;  2YNI A;  1W9H A;  4LH4 A;  3KTQ A;  4OKK A;  3QEX A;  4AHR A;  3VQP A;  3V6D A;  1RBU A;  1SKS A;  4FW1 A;  4AHC A;  2I5J A;  3L2Q A;  1TKD A;  4K8X A;  2HVI A;  3SUN A;  2BGG A;  4CF1 A;  4R5P A;  2ITG A;  4DTU A;  1RT7 A;  3NH0 A;  1X9M A;  5CZ1 A;  3U3G A;  4ELU A;  1TK5 A;  1WSG A;  2GBZ A;  1REV A;  2GV9 A;  4HTU A;  4DLE A;  3JSM A;  2HW3 A;  1WNS A;  3RR8 A;  4FLT A;  3L2W A;  1BL3 A;  1ASV A;  4CK2 A;  3ZT3 A;  1WAF A;  4FLU A;  3U6F A;  5CY4 A;  4CJT A;  1RBV A;  3LAM A;  3CFR A;  3VQB A;  3QEI A;  1NK0 A;  3CM5 A;  3NGY A;  3I8D A;  5I42 A;  1SL0 A;  3T3F A;  4CJ5 A;  2XO7 A;  3WNF A;  3OYI A;  4I9Q A;  1HMV A;  2OZS A;  2HHQ A;  5KTQ A;  4EP4 A;  2B4J A;  1TKT A;  3QNN A;  4Z4H A;  4DTS A;  3OS1 A;  1NKE A;  1I3A A;  2XRI A;  5J2N A;  3CYM A;  4CGD A;  3SCX A;  3V9Z A;  1BGX T;  1WSH A;  4CJV A;  4OKJ A;  1KLM A;  3PX6 A;  4FJK A;  5HRN A;  3NE6 A;  1WLJ A;  5C24 A;  1J5O A;  3SI6 A;  1SKW A;  3DLB A;  4PUO A;  2YHA A;  1WSF A;  3SPZ A;  3QNO A;  4Q0B A;  4RW4 A;  2HHU A;  3ZT0 A;  2KW4 A;  2X6N A;  5JS2 A;  4F8R A;  1ZBL A;  4QCL A;  1KRP A;  3IRX A;  3P5J A;  2P1J A;  3DLK A;  4KI6 A;  3OYJ A;  1RDC A;  1RT1 A;  3VQ9 A;  3OYL A;  3HP9 A;  1RNH A;  4EP5 A;  4OVL A;  4KB1 A;  3AVI A;  2HHT A;  3ITH A;  4CEA A;  4N56 A;  3TAB A;  4LH5 A;  3AVF A;  3PO5 A;  3MEG A;  3AVH A;  3UIQ A;  4CER A;  1LWE A;  1BIZ A;  1BI4 B;  3AVM A;  1A5W A;  5KI6 A;  3VQ4 A;  4B8A B;  3K57 A;  4DTM A;  1NOY A;  1KSP A;  2G8U A;  2D0C A;  2P51 A;  4CJS A;  4E7K A;  3TAG A;  3S3M A;  5SWM A;  3LZI A;  2XY6 A;  4F3O A;  1B9F A;  1T7P A;  3TWH A;  1HNI A;  1VK0 A;  3KLF A;  3FFI A;  2YHB A;  1RDA A;  2A1S A;  2HNY A;  2HB5 A;  1JXE A;  1A5V A;  3L3V A;  3TAQ A;  1UA1 A;  4ELT A;  4N41 A;  1ZYQ A;  2HMI A;  1GOA A;  3DRR A;  3V9X A;  3KLG A;  4CCH A;  5FRN A;  4CEB A;  4Z4E A;  4IFV A;  1ITG A;  1RDB A;  2P5G A;  1ZBH A;  4B3O A;  4DTO A;  3PX0 A;  5J1E A;  1XHZ A;  3DOL A;  3V9S A;  1JLG A;  1IO2 A;  1S9G A;  3TAE A;  4CHO A;  3TAR A;  4KV8 A;  2HNZ A;  3OYH A;  4OGE A;  3VQE A;  3DLH A;  2G8K A;  3ZSY A;  2RKI A;  1NK7 A;  3SQ4 A;  4N47 A;  4FLW A;  2YNH A;  1RT5 A;  4NCG A;  1S1V A;  1QSS A;  4O4G A;  3MEE A;  4KFB A;  4AH9 A;  2QKB A;  3K5M A;  3A2F A;  4CED A;  4KTZ A;  4BWJ A;  3IG1 A;  3V1O A;  1S1U A;  2QXF A;  4RW7 A;  4CIG A;  3OJU A;  3K59 A;  1J9A A;  3WNE A;  2PYJ A;  4CHZ A;  4ID1 A;  4FZX C;  4M3Y A;  3K58 A;  3VA3 A;  1RTI A;  3PO4 A;  1EX4 A;  2ZE2 A;  2B6A A;  1U4B A;  5CYM A;  4DSF A;  3PUF A;  3M8Q A;  1TKZ A;  1VSK A;  4PY5 A;  2HVH A;  4AHV A;  4CE9 A;  3P83 D;  2ZD1 A;  4TSX A;  1Q9Y A;  4PQU A;  3VN5 A;  4JLH A;  3I0R A;  4I9L A;  4KTQ A;  4M45 A;  1YTU A;  4DQP A;  4H4O A;  1B9D A;  2W42 A;  4FJ5 A;  4Y1C A;  1CXQ A;  2VG6 A;  3LPU A;  2XHB A;  4CIF A;  2X6S A;  3RRG A;  2KZZ A;  5FRM A;  4FJH A;  2G8I A;  3F73 A;  1D9F A;  4H8K A;  4CK1 A;  5J2M A;  3C94 A;  3KK1 A;  3ZSR A;  3QEW A;  1JLF A;  3M8P A;  3LWM A;  1C1C A;  3K5N A;  4N76 A;  4CEZ A;  5KGX A;  1EXQ A;  1RT3 A;  3SZ2 A;  4E7I A;  1KLN A;  2IDO A;  1SV5 A;  2RN2 A;  4XIU A;  1S1T A;  4HUE A;  4FYD A;  4NYN A;  1VSJ A;  4DF4 A;  3OYE A;  4DTP A;  1RCH A;  1Q9X A;  1HYS A;  2OPQ A;  1L5U A;  3RMC A;  3V81 A;  3LAN A;  3V4I A;  2F8S A;  4E1M A;  1L3V A;  3NH2 A;  4FZZ A;  2NUB A;  3CFO A;  1JLA A;  1BQN A;  2RPI A;  3AVB A;  3TR8 A;  4CGF A;  4DG1 A;  4FCY A;  4FM0 A;  5HRP A;  1RTH A;  2FBT A;  4DSE A;  4I7F A;  4DWI A;  3H08 A;  4KTW A;  3NAE A;  4F4K A;  3RR7 A;  4BDZ A;  1JLQ A;  1RT2 A;  3AVL A;  3KLE A;  3KJV A;  3L2V A;  4FVM A;  4J2B A;  4BE0 A;  1TAU A;  1JLE A;  4BAC A;  3SQ1 A;  3HVT A;  2G8W A;  4DS4 A;  3OYG A;  1S6P A;  3PV8 A;  1TK0 A;  5C42 A;  4JS5 A;  1RT4 A;  5T7B A;  2FC0 A;  4CEO A;  4ICL A;  3O3H A;  3RRH A;  3CG7 A;  4QAG A;  2Q3S A;  4CJQ A;  2VG7 A;  3EZ5 A;  3LDS A;  2ZQB A;  3ZT2 A;  4CJR A;  3AV9 A;  4FLX A;  4B9T A;  3AVK A;  1S1X A;  4CIE A;  5CZ2 A;  4KHN A;  1LAW A;  3M8S A;  5FRO A;  2BE2 A;  3VA0 A;  3RMA A;  1SL2 A;  3KD1 E;  4E89 A;  1TK8 A;  4E0D A;  3WNH A;  1FK9 A;  1C0T A;  4IBN A;  1EKE A;  4C8L A;  4FJ8 A;  4CEE A;  3D45 A;  3K5L A;  1HPZ A;  4DQS A;  3AO5 A;  4M42 A;  2KFN A;  4DQI A;  3G10 A;  2LSN A;  4W5Q A;  3OJS A;  4CGJ A;  4OJR A;  5CYQ A;  1BCO A;  1JKH A;  5KRS A;  3QIP A;  3KKS A;  3QEV A;  4CJU A;  3QO9 A;  1WSI A;  2BAN A;  2FBY A;  4CF8 A;  1J54 A;  1BQM A;  4H4M A;  3LP2 A;  4G1Q A;  4AHU A;  3LPT A;  4FJM A;  1LW0 A;  3V1R A;  1TVR A;  1YT3 A;  3G0Z A;  2DFF A;  1N6Q A;  4FJG A;  1QSY A;  4B9S A;  2AJQ A;  4CF0 A;  3C6U A;  4RW8 A;  4KHU A;  4CK3 A;  4DTJ A;  3AVC A;  3CFP A;  1HYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...