3VQEA

Hiv-1 in core domain in complex with [1-(4-fluorophenyl)-5-methyl-1h-pyrazol-4-yl]methanol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
136
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 49
structure length 136
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqeA00
2Z1HA 4CJWA 1QSLA 5HRPA 4KPYA 2ITGA 5FRMA 2PY5A 1ITGA 1VSIA 1U04A 1VSKA 3AVLA 3NAEA 1HNIA 1TK5A 2PYJA 1L3SA 4CERA 1DTQA 1XHZA 2QK9A 3RRGA 4DTOA 1NK4A 3QEWA 3T1AA 3VA0A 1BGXT 2Y1JA 3HVTA 1WNSA 1BQMA 2IS3A 2HHTA 1T03A 3NHGA 3ZCMA 3DLRA 3NCIA 2VWJA 4DQRA 3OYLA 1BCMA 4KAZA 1U47A 4OPJA 2E4LA 4GVMA 2VG7A 3CG7A 4CHZA 3OYEA 1NJYA 1KRPA 1LW0A 4PQUA 1JLBA 2RN2A 3ISNC 1RBRA 4HVJA 3ZSQA 4FLZA 1KSPA 4FLWA 3KK2A 4E7JA 4O5BA 1JXBA 4KKOA 1KLMA 4CJ3A 4Y1DA 4JRPA 2RPIA 3LWLA 3O4NA 1D9FA 4CEDA 3TAMA 4N5SA 4FZZA 1BIZA 1T8EA 3NH2A 3LP2A 1N5YA 1IG9A 3PO5A 4DSJA 1D5AA 4CEFA 4FJHA 2RF2A 4KI4A 3V1QA 4RG8A 3QNOA 2D0AA 3AVKA 4HUGA 3RR8A 4EZ6A 3RRHA 4KHYA 4DQPA 1VSHA 4FJGA 4DQQA 3KIOA 3OYNA 5DK5A 2I5JA 4OKJA 3G10A 1HPZA 3AVAA 2IDOA 2OZSA 2XY7A 3CFRA 4LH5A 1NJXA 1C6VA 2OA8A 5JS2A 4L8RB 3VA3A 4CJPA 4B3OA 3KD5E 1QE1A 1JL1A 5HROA 4CHQA 3L2RA 3BDPA 4EZ9A 4KHQA 4DF4A 4W5QA 1BIUA 4QCLA 3OYJA 2XHBA 3IAYA 2XRIA 4ICLA 1TL1A 1BHLA 4Z4HA 3OS2A 4DTPA 1B9FA 4FLXA 1Z25A 3LWMA 3AVHA 3ITHA 2PZSA 5C24A 1TKZA 2B4JA 4IFYA 5HRRA 4CHYA 2BGGA 5J2NA 2X74A 4GMJB 1ZBIA 3MECA 3UIQA 2IAJA 3MXIA 3DLKA 2HVHA 4G1QA 4FJ5A 3VQ8A 4CF8A 3SUQA 1Q9XA 1JLAA 1RTDA 5KI6A 1NK9A 1TAUA 4KB0A 4M3YA 3C94A 1DLOA 2KFZA 1J53A 4B9UA 4CFCA 2ATQA 5J2MA 1LWCA 1T7PA 1S6QA 5J2QA 4N47A 1NK6A 1VSEA 4AHRA 4CFAA 3KTQA 4KTQA 1A5VA 5KTQA 4BE1A 1BI4A 4NCAA 1BCOA 3P5JA 2NUBA 3RWUA 2HHXA 1L5UA 1QSYA 4JRQA 3MXJA 3DMJA 1IKVA 3AA3A 2GBZA 5DMRA 1RDAA 3L3VA 5KGWA 3VQ6A 1TV6A 4CK1A 4BDZA 2YNIA 5CYMA 1UA0A 4F2SA 1J9AA 3TANA 1KTQA 3D45A 4O4GA 1XI1A 1EP4A 4FM1A 1WSJA 3C95A 4E1MA 3CFOA 3HSTB 2OPSA 3VQ5A 3HP9A 4DF8A 4F3TA 1S1TA 1C1CA 3TARA 3U3YA 3NE6A 3RMDA 2F8TA 2IOCA 1U49A 4DLEA 2YNHA 1NKCA 4AHUA 3DRRA 1DTTA 4FW2A 3OVNA 5CY4A 3ZSXA 4DG1A 3T3FA 1BISA 4IDKA 4FK4A 3KJVA 4CK2A 4C8KA 3LALA 1LAWA 4HTUA 1RNHA 4DTMA 1NKBA 4FJIA 3SYZA 1Q8IA 4IBNA 2HNYA 4ZTFA 3QIOA 3LDSA 3LP3A 3O3HA 1QTMA 3VQAA 1ZBLA 4OKEA 2HHQA 1C1BA 4M3TA 2YNGA 3T19A 1X9SA 4E0DA 3AVJA 4E7LA 1W9HA 3AVMA 4HCCA 3ZSOA 1LWFA 1NOZA 1TGOA 2DFHA 3LPTA 4OKKA 3AVIA 3P83D 1WN7A 3OYFA 2X78A 4DTNA 4ELVA 3DI6A 2QKKA 3O3GA 4O0JA 3TAPA 5HLFA 5I42A 3RMAA 1CXUA 5K14A 2G8KA 5HRSA 2VG5A 4CJ4A 3G0ZA 4CGJA 2HVIA 2HNDA 4KTWA 2WOMA 4E3SA 3PX6A 3SV3A 4O0IA 4BWMA 3LPUA 2A1RA 4KRFA 1W0HA 4LD0A 3OYKA 1S6PA 1TKTA 3VQ4A 4CJTA 4M3UA 3QNNA 4H8KA 3QEXA 1F21A 1NK7A 3DM2A 3IRXA 3OJUA 1O1WA 3HO1A 1WSEA 3OYGA 4RW9A 4CJVA 3SV4A 2HW3A 4BDYA 1UOCA 4FJ7A 1TKXA 2YKMA 2OYQA 4DSFA 3AVNA 4WE1A 3F73A 1IH7A 4FXDA 3HPGA 3OS0A 4CJUA 3OYMA 3D0PA 1YTAA 4LY7A 3OS1A 2PYLA 2JGUA 1HYZA 1VSLA 1Z26A 4TSXA 4KHSA 4ID5A 1JLCA 5EU7A 5KRSA 4W5OA 4C8LA 3QEPA 4QOZB 3RMCA 1NJWA 1TVRA 2YV0X 3L3UA 4Y1CA 3ZSVA 1SL2A 3LAMA 3VQBA 4ZHRA 4DSEA 4K8XA 1EKEA 3ZT0A 4CEBA 4C8NA 4CJSA 5J1EA 4FYDA 2G8VA 3ZSRA 3CYMA 2JLEA 1CXQA 4DTSA 3S3MA 2G8HA 4JS5A 2FC0A 1RBUA 3QEVA 3V9WA 4B9MA 3NFAA 3L2VA 3RR7A 3QEIA 2X6NA 3TAFA 1CZBA 3IG1A 3F9KA 3BGRA 3U3GA 4CJKA 4RW6A 3I0SA 2XO7A 1IKWA 1R0AA 3ASMA 2YHBA 2EHGA 1G15A 1RDBA 1RT3A 4DU3A 4FJ9A 3QO9A 3ZT3A 1U4BA 4I2QA 3ZSZA 4IKFA 1BI4B 4E7HA 1ASUA 1NK5A 4DLGA 1XHXA 1C0UA 4I7FA 1QHTA 3KLGA 3KK1A 3DOKA 5CZ1A 4FLVA 3AA4A 1NJZA 3ZT2A 4Z4EA 2R7YA 3SQ1A 4FW1A 1SKWA 4BACA 4FM0A 2P1JA 2Z1JA 2G8UA 2A1SA 3AVFA 4RW7A 4B9VA 1LAVA 3L2UA 4BE2A 4AHSA 3V81A 4B9SA 2DFFA 2QKBA 3THVA 4AHCA 4KV8A 3WNGA 4CGHA 3KLEA 5SWMA 1HMVA 1S1WA 4XIUA 4KHNA 1FKPA 2XY8A 4HUEA 4CJ5A 3ULDA 4DTRA 4R5PA 1D8YA 3PX0A 3S3OA 3V6DA 1RT5A 4KTZA 5CYQA 3OYAA 3KLIA 1RT7A 4DSIA 3V9ZA 1X9MA 3HT3A 2HHUA 1REVA 3V1OA 3K59A 3QETA 1L3UA 4HHTA 1VSFA 3SQ4A 4FK0A 4OLBA 1S5JA 4I9QA 1IO2A 1UWBA 2BE2A 1VRUA 1YVUA 2D0CA 2YKNA 3KKSA 4FVMA 3M8RA 1RDDA 2KQ2A 1LWEA 1RILA 1MU2A 3KK3A 1WLJA 4FJKA 4Z4FA 3AVCA 2BANA 3VN5A 3V4IA 3SPYA 2YHAA 3SZ2A 1ZBFA 4E89A 4CEEA 3AVBA 3QERA 1C0MA 1YT3A 1FKOA 2Y1IA 4LH4A 4DFPA 3AO1A 4FJ8A 5FRNA 4DSKA 1SKSA 2HMIA 3LZIA 4J2BA 4EP5A 4B9TA 4CJRA 3KKRA 3B6OA 5T7BA 2KW4A 3HPOA 1QSSA 3WNEA 4CEAA 4F4KA 1BQNA 3HVRA 4Z4GA 1YTUA 3K5LA 4OJRA 3DLBA 4CFBA 3JSMA 1QS4A 3VQDA 4FJMA 3NDKA 5JS1A 3RMBA 1ZBUA 4QAGA 5D3GA 4J2EA 1TL3A 4N76A 4M3WA 1RT6A 1S1XA 4DU1A 4IG0A 4CEQA 4GW6A 4JLHA 2HNZA 3QESA 3VQPA 1RT4A 4ZTJA 2OZMA 3SJJA 4PA1A 1WSGA 3I8DA 1UA1A 2FBVA 4CF9A 3DRPA 3OYHA 3M8PA 1NKEA 3WNHA 4CHOA 1JXEA 2HHSA 4H4OA 4M3ZA 3AA5X 3PO4A 1TK8A 4KI6A 2Z1IA 3NH1A 4CEZA 4CCHA 4HCBA 3IS9A 4AH9A 3M8QA 3OY9A 4C8OA 4F3OA 3OYBA 1TKDA 4Z0UA 3K58A 4AHTA 2EX3A 4DTUA 2Q3SA 2AJQA 4F8RA 2VG6A 4KFBA 4DMNA 4YNQA 3DLGA 3TWHA 4FLTA 4BDPA 4B9LA 3TI0A 1A5XA 1X1PA 1EETA 1SV5A 1Q9YA 4M42A 3DRSA 4CEOA 4KB1A 3CFPA 2YNFA 4FJLA 1ASVA 4CHNA 4M3RA 1FXXA 3K2PA 2ZQBA 3PX4A 1JLEA 1XC9A 1WAJA 3V9XA 3L2WA 1L3TA 4NCBA 3OYDA 1KVBA 5I3UA 2IGIA 5C42A 4LSLA 1VK0A 4FZYA 1IKXA 1S1UA 2ZD1A 2FBYA 1IKYA 1WAFA 1KCFA 3L2QA 1RDCA 4RW4A 4Q5VA 3ZSWA 3SQ2A 3NGIA 3HK2A 3B6PA 4W5TA 3FFIA 4CIEA 3K5MA 2O4GA 4YFUA 2P51A 4C8MA 1NOYA 3K5NA 3TR8A 4OGEA 1L3VA 4B8CA 1TK0A 2G8IA 3A2FA 3VQEA 1SL1A 1EX4A 4JS4A 2FBTA 3HYFA 4DTJA 3EZ5A 4CHPA 2IC3A 4CECA 4E7KA 3SPZA 4Z4CA 4CF0A 1X9WA 5J2PA 3HP6A 3NF7A 1JKHA 1KVCA 4CJEA 3LANA 3P1GA 3NGZA 1CLQA 1Y97A 5KGXA 3KD1E 4K8ZA 1BL3A 1JLQA 1RCHA 3VQ7A 3DLHA 2F8SA 4DFMA 1SUQA 3MEDA 3HXMA 2DTUA 3NF6A 1LV5A 1C1AA 4KHWA 1J5OA 4Q0BA 3AO5A 4I2PA 2G8WA 4CESA 1LW2A 2ETJA 3MEGA 3OYCA 1KFDA 2E6MA 4DFJA 4FLUA 1S9EA 3O4QA 4CJLA 1UAXA 1B9DA 1VSMA 4AHVA 2D5RA 1RTIA 2P5GA 5HRNA 3ZSYA 1N6QA 1VSJA 3K57A 4KHUA 3OJSA 2LSNA 2RKIA 4DQSA 4DTXA 4IFVA 3SI6A 1SL0A 2XY5A 1ZBHA 3S3NA 4DS5A 4CGFA 2WONA 4CJQA 3LP1A 3LZJA 3CQ8A 3KLHA 4E1NA 4KO0A 4UQGA 1JLGA 3AA2A 5FROA 4FM2A 3SUPA 3V9SA 5HBMA 2XY6A 3TAEA 1HNVA 3C6UA 4OPKA 2BDPA 4DQIA 2G8FA 2B5JA 4E19A 2KTQA 3VQCA 4EP4A 1J54A 4CK3A 1SKRA 1GOBA 3HPHA 2OPPA 4CF1A 2Z1GA 4N41A 4M45A 1KFSA 2X6SA 2GUIA 2OPQA 3WNFA 4RW8A 1C0TA 4DS4A 4DFKA 4FJJA 4J2DA 3QINA 1RBVA 1WSFA 3LP0A 1T05A 3NBPA 2DFEA 4LSNA 3SQ0A 5CZ2A 3QIPA 4CGGA 1NK8A 3TABA 3V1RA 1EXQA 4IG3A 2W42A 4FK2A 2HHVA 3NGYA 4NYFA 1A5WA 3AV9A 2DY4A 1XWLA 1ZYQA 4FJXA 4MQ3A 3SCXA 4CIFA 3JYTA 2ZE2A 3AVGA 3E01A 3O3FA 2HB5A 5C25A 3MXMA 4N56A 3M8SA 1KVAA 2OPRA 3HM9A 4CJFA 5E41A 3HJFA 1S9GA 3ALYA 3TAGA 4CIGA 3SUOA 1RTHA 1GOAA 4CFDA 5KRTA 4H4MA 4FCYA 3SUNA 1HJRA 1VSDA 3EY1A 1D9DA 3MEEA 4BE0A 3PV8A 4ID1A 1NK0A 5SZTA 3TAQA 4ELUA 5HP1A 2D0BA 4B08A 4PUOA 3NH0A 2HHWA 1ASWA 3VQQA 4M41A 4PWDA 4KREA 3HL8A 4FJNA 2B6AA 4W5NA 4B9NA 1JL2A 3ZT4A 4OLAA 1I3AA 1I39A 3LAKA 4CE9A 4CGDA 4OGCA 4BWJA 2KFNA 1WSHA 1B92A 2GV9A 3U6FA 2F96A 3VQ9A 4B8AB 1RT1A 4W5RA 1RBSA 1FK9A 4NCGA 3MAQA 3V9UA 2O4IA 2KZZA 3AO4A 2E6LA 4ELTA 3CM6A 3PY8A 1CZ9A 3CM5A 3C6TA 2P5OA 1S1VA 1WSIA 3DLEA 3L8BA 1HYSA 1HYVA 4O55A 4AILC 3RTVA 1QQCA 4F2RA 4FZXC 4M3XA 4Z4IA 3DOLA 2KZMA 4O44A 3AO3A 3OYIA 3K5OA 4CGIA 1HQEA 1K6YA 2QXFA 4I9LA 4MFBA 4FLYA 1U48A 3DYAA 4DSLA 4PY5A 4DWIA 1U45A 1HQUA 3I0RA 1RTJA 3S9HA 1VRTA 3NF8A 3ZT1A 1RBTA 3KLFA 4CF2A 3SNNA 3PUFA 4DU4A 1KLNA 4NYNA 1GOCA 1TAQA 1JLFA 3NF9A 4HUFA 1RT2A 3EYZA 2VWKA 3QLHA 4J2AA 2FBXA 3H08A 5FDLA 4OVLA 1HRHA 3AO2A 4E7IA
chains in the Genus database with same CATH superfamily
1OH8A 3CCLN 3T7ZA 4CJWA 4JD2B 3QBWA 2PY5A 1ITGA 2V7YA 3AVLA 1TK5A 1QQNA 4GY2B 2QWOA 3VETA 3CCRN 2HHTA 3NHGA 4BVPA 2VWJA 4Y0WA 1BCMA 1U47A 4GVMA 3CG7A 1JLBA 3LDQA 2ASPA 2RN2A 1RBRA 4FLZA 4JRPA 4H0VB 4CEDA 2A41A 3TAMA 3WXLA 4FZZA 1X9JA 5EOYA 1BIZA 1T8EA 1N5YA 3LP2A 4KI4A 1D5AA 1Q82O 2I7PA 3RRHA 2P9LB 4DQQA 3C6AA 4WQ5C 4CZKA 3OYNA 3SMPA 2ZM6K 3G10A 1HPZA 1GLEG 2IDOA 4B1YB 4JI5K 1C6VA 2OA8A 3QBXA 3KD5E 1MWMA 3L2RA 4JN4A 4DF4A 5LY3A 3OYJA 2XHBA 2UXDK 2D1KA 3LWMA 2PZSA 5KPRA 4IFYA 3ENHA 2BGGA 5J2NA 2ZWHA 1ZBIA 2CGJA 3DLKA 4B1ZA 4BRKA 1Q9XA 3E66A 1DLOA 2KFZA 4DHYA 1T7PA 4YDUC 3W3DA 1NK6A 1BI4A 3P5JA 1E4FT 1L5UA 5H1SQ 5DMRA 3VQ6A 2E2OA 2GBZA 4BDZA 2YNIA 4O4GA 1G99A 3PIPL 2Q31A 4JKGB 3WXMB 2IOCA 3KK7A 3Q7BA 1U49A 2YNHA 4AHUA 1DTTA 3THYB 2QWMA 3O9QA 4DB3A 5AQGA 2O8BB 4DTMA 2F9TA 5GADP 4ZTFA 3SBTA 3LP3A 3J80O 3CC2N 4IOCL 1C1BA 5FPEA 2GX9A 1YI2N 2QWLA 4E0DA 4JV5K 3AVMA 3BY5A 1TGOA 2DFHA 1WN7A 3GOIA 2X78A 4A5BA 3TAPA 5I42A 3BZKA 4BRIA 5BR8K 1CXUA 5K14A 3ZLJA 5I9EB 3ZETB 4CGJA 4X65K 1YUWA 3O9SA 3M6GA 4E3SA 1H1VA 3PX6A 1Q7YO 4CZHA 2HF3A 1W2BM 1W0HA 4LD0A 1TKTA 3VEYA 1F21A 4PHTX 1WSEA 4CJVA 2YHXA 1J6ZA 1XNRK 2CH5A 2HBMA 4YHHK 5IT9O 3AVNA 3BF3A 4MO5A 1IH7A 3HPGA 4KHSA 2JGUA 1VSLA 2ZGZA 1NU0A 4ID5A 5EU7A 4HWIA 4W5OA 4C8LA 3QEPA 4QOZB 1TVRA 2WBNA 3ZSVA 3THWB 3CCQN 4BRDA 4ILHA 3R9PA 3WXKA 3ZT0A 4C8NA 4FWLA 3CYMA 2JLEA 4DTSA 4BREA 2FC0A 5LMNK 1T3VA 5BPNA 3ATUA 2A5XA 3UKRA 5AQHA 4CJKA 4RW6A 3I0SA 4FWRA 1R0AA 2YHBA 1YF5L 3RSEA 3ZT3A 4I2QA 3KK1A 3AA4A 3SAGA 4DR2K 3ZT2A 1SKWA 2G8UA 1KC8O 3V81A 1KQSM 3WNGA 4KHNA 4BRHA 3DJCA 3VTHA 3ULDA 1SAZA 4R5PA 1C0FA 2YHWA 3S3OA 5CYQA 3EN9A 3OYAA 3PIOL 1REVA 3ZEUA 1QQMA 4CZJA 3T69A 1UWBA 2BE2A 3E9OA 1IBKK 1MU2A 1WLJA 3AVCA 2ZGYA 5FPDA 3E9PA 3AVBA 1C0MA 4LH4A 4FJ8A 2HMIA 4J2BA 4B9TA 1U6ZA 1D4XA 4F4KA 3B6OA 5T7BA 1YTUA 3FLCO 2GUPA 1NG9A 3A5LC 1QS4A 4FJMA 3NDKA 3MCPA 4OPAA 1OH6A 4ISEA 4JLHA 4ZTJA 3VQPA 1U2VB 4PA1A 3SJJA 4GV3A 3I8DA 4BR7A 1KD1O 4CF9A 4LF9K 4WFNL 1S72N 4B9QA 4M3ZA 3AA5X 1X3MA 1TUUA 3CPWM 1QHAA 4AH9A 3M8QA 1DGKN 3K58A 4DTUA 4AHTA 1YHQN 4YOWA 2VG6A 4DMNA 3DLGA 1VQ4N 1X1PA 1FW6A 1QVFM 2NRTA 3DXKB 3CFPA 5AQOA 4DV3K 2OTJN 1U2VA 4CHNA 3FR0A 3CERA 3MCAB 4LFCK 3O9RA 5AQNA 4CD1A 4JKFA 3THXA 2FBYA 3I56N 2NRRA 1NGEA 3NGIA 3EO3A 5AQIA 3VGLA 4DR5K 3B6PA 1GLFO 1QZ6A 1T44A 4CIEA 4OGEA 3A2FA 1EX4A 4BRAA 4WYBA 2IC3A 2E1YA 3CJBA 3NF7A 4KH4A 1JKHA 3LANA 4IO9L 1WB9A 1Y97A 2FSNA 2F8SA 5AQLA 3VESA 3ID8A 2QA4N 3LL3A 3CCJN 1N8RO 3ULEB 4CESA 5IWAK 4DV7K 1N34K 2YJEA 4FLUA 4FWMA 3AAPA 1B9DA 3BUZB 3OJSA 3J7YP 2E88A 4GKJK 4DTXA 4IFVA 3SI6A 4K43A 1MDUB 2P9UB 4CJQA 3LP1A 4BRQA 4LF4K 4E1NA 4KO0A 4UQGA 2YJFA 3A5MC 5AZJB 4FM2A 5HBMA 2D4WA 1Q86O 2BDPA 5M1NA 3VTIA 5BRFA 4KBOA 3O8MA 3EZWA 5AQQA 1VAZA 4M45A 4DFKA 2GUIA 3QFUA 4DS4A 3QINA 4JHDB 3LP0A 3CJ1A 1T05A 1QZ5A 2DFEA 2KLAA 4BC5A 4CGGA 3G25A 2O8FB 2QWRA 1XMOK 3NGYA 4NYFA 5LL6Z 4QS8A 2ZE2A 3E01A 4IJNA 4BR2A 3MXMA 1XUPO 1KVAA 3SUOA 4CFDA 5KRTA 4JI4K 4BE0A 4ID1A 4J8FA 1NK0A 1BOTO 2HHWA 3HL8A 3CQYA 2I7NA 2B6AA 2QM1A 1JL2A 5TKWA 4CGDA 4OGCA 3U6FA 3GL1A 5DM6L 5EY4A 3V9UA 4WCEL 2KZZA 3AO4A 3PY8A 1CZ9A 4X62K 3C6TA 4JK9A 1S1VA 1WSIA 1HYVA 1ESVA 4AILC 4M3XA 4IZ9A 1EO1A 3AO3A 2UXBK 4FLYA 4PY5A 4DWIA 2QWPA 5BR9A 4B1UB 3S9HA 1VRTA 4JAXA 2HBKA 3PUFA 2V51B 2W40A 4HUFA 3EYZA 4H03B 1HKCA 1HRHA 4DTOA 2P9SA 2Z1HA 5FRMA 2CGLA 1VSIA 2PYJA 4LF8K 3A0IX 4LFAK 2QK9A 1NK4A 3VA0A 2Y1JA 2GELA 4AQYK 2NRXA 4JI3K 4FWSA 4DQRA 4OPJA 1NJYA 4CHZA 3OYEA 5AQYA 4CZLA 4UY8O 3ZSQA 4FLWA 2WC9A 3THXB 5F2RA 1JXBA 4JI8K 3LWLA 3NH2A 4DSJA 1IG9A 3PO5A 1TYQB 4CEFA 2RF2A 4RWTA 2JWLA 4RG8A 2F4VK 3QNOA 1ATSA 4EZ6A 3N4QA 4CI6A 5DK5A 4OKJA 1HX1A 3AVAA 2XY7A 3M5RA 3AY9A 4DUYK 3D6RA 4B3MK 1VQ8N 5JS2A 2HSTA 5AR0A 3VA3A 4BGBA 2F9WA 4DR4K 1JL1A 5HROA 3VERA 3BDPA 4EZ9A 4JKBA 4WF9L 3A8YA 3IAYA 2XRIA 4ICLA 4YOXA 3OS2A 4Z4HA 1B9FA 4FLXA 5KPTA 5C24A 5A2QO 5HRRA 4CHYA 2X74A 4GMJB 3MECA 4G1QA 1NNEA 1JLAA 1S3XA 3WEEB 1NK9A 4FPAA 4KB0A 4M3YA 3C94A 4B9UA 3IKMA 5J2MA 5AQFA 4B1XB 5J2QA 4N47A 3AGRA 4CFAA 4BE1A 1BCOA 2NUBA 2HHXA 3EKUA 5ELZA 1DEJA 2WUSA 4DUZK 2O8CB 1QSYA 4JRQA 1VQPN 4CK1A 3L3VA 1UA0A 1J9AA 1KTQA 3D45A 5GIPA 1WSJA 3C95A 4E1MA 3VGMA 4BRCA 4F3TA 1C1CA 3RMDA 3U4LA 3LDPA 3OVNA 3T3FA 4FK4A 1HNWK 3H46O 4BRMA 1NKBA 3SYZA 2Q0UA 2HNYA 3QIOA 3O3HA 1VQ5N 3VQAA 4DKWA 1OKJA 4DV5K 1X9SA 3F5TA 3LM2A 1XNQK 1W9HA 2QEXN 2E2PA 1LWFA 3BP8A 4BGAA 2QI2A 4K42A 2IVPA 1CZAN 3MDQA 3O3GA 3ENOA 3RMAA 4CJ4A 2HVIA 4MLEA 3TSPA 4R79A 3OHRA 4DQ8A 4A2AA 4BWMA 4KRFA 4CJTA 3CMEN 1JCEA 3QNNA 5BPMA 1NK7A 2GTDA 1O1WA 1YAGA 3EE8A 1UOCA 5C15A 2YKMA 3TTDA 4FJ7A 4DSFA 3DAWA 4BC3A 4MLHA 4FSVA 1YTAA 4V19S 1HYZA 1FJGK 1BWFO 2O8BA 1V4SA 4PL7A 4ISGA 3L3UA 1SL2A 3VQBA 4ZHRA 5DM7L 1EKEA 4CEBA 4CJSA 1O13A 2O8FA 3ZSRA 3KWGA 3NFAA 3UKUB 3G6EN 2HOEA 2GWJA 1J5EK 5C0YA 2P9IB 1HR0K 1NM1A 2XO7A 2ASMA 3ASMA 4BC2A 2EHGA 1G15A 4BRFA 1RDBA 4FJ9A 4PKIA 4CZIA 3MK6A 1K8KA 3DOKA 4FLVA 3VENA 3MN9A 1HNZK 2Q1NA 3BZCA 4BACA 2P9NB 3ZX0A 2P1JA 2Z1JA 2RHKA 2Q36A 4RW7A 4B9VA 4AHCA 4KV8A 3O1BA 5AQUA 3SLCA 1S1WA 3KLEA 2XY8A 1ATRA 1D8YA 3V6DA 3U8XA 3KLIA 3B8AX 3V9ZA 2HHUA 4BRPA 4FL9A 2A42A 4OLBA 4I9QA 3JXUA 1IO2A 4E1JA 2YKNA 3HO1A 2P9KB 3KKSA 4WQ4C 2YX6A 3V4IA 4BR5A 3PSIA 2O8EA 2YHAA 1ZBFA 3QERA 3C65A 1WBBA 1YT3A 3AARA 5FRNA 4DSKA 3LZIA 5BRHA 4JKAA 3VPZA 4DR3K 2KW4A 4X64K 4IOXA 4OJRA 3DLBA 4CFBA 3JSMA 2NZTA 4J2EA 4JK8A 3ZX3A 3N4PA 4ILJA 4M3WA 1RT6A 4DU1A 3K9KA 1RT4A 5M1QA 3LDNA 2ITMA 1UA1A 1RDUA 3DLLL 3OYHA 2VQEK 3O4WA 2HHSA 3VEZA 3NMUA 3VF2A 4KI6A 5BRDA 4EAHD 5AQPA 2W6KA 4C8OA 4F3OA 1QVGM 4A57A 4WFBL 3TWHA 4JHDA 3FZMA 3E1YA 3TI0A 1SV5A 2HBJA 1Q81O 4KB1A 1NGHA 1Q18A 1ASVA 4NLBA 5AZJA 3PX4A 1XC9A 2ZQBA 4NCBA 1WAJA 5ADXA 1KVBA 5I3UA 4CVNE 4LSLA 5E84A 4X66K 1KCFA 3L2QA 1RDCA 1GLBG 4RW4A 2A3ZA 3FZFA 3HK2A 1ILYA 2Q2RA 2NRWA 2O4GA 1YIJN 2P51A 4C8MA 3K5NA 1L3VA 3QMLA 1SL1A 2FBTA 4DTJA 4GVEA 4E7KA 5J2PA 1NGDA 3ULEA 4CJEA 3CETA 2HMPA 2WFBA 1SZ2A 4B3TK 4FOIA 1RCHA 3VQ7A 2VQFK 1WUAA 3FE1A 1VQLN 5AQKA 3NF6A 4HTLA 3AO5A 3AAQA 2G8WA 3MEGA 3OYCA 4H5VA 4DFJA 2ZJRL 1BG3A 3O4QA 4AHVA 2D5RA 1RTIA 2BH1A 3P31A 2GWKA 2RKIA 1ZBHA 2XY5A 3GDQA 2CGKA 3S3NA 2WONA 2OANA 3LZJA 3CPEA 3SMSA 2QWQA 1HLUA 1HKGA 3SUPA 3V9SA 2IVOA 3C6UA 4M7XA 1J54A 3AGKA 1GOBA 3HPHA 4CF1A 1YJWN 2X6SA 3WNFA 1C0TA 4J2DA 1WSFA 4GKKK 3NBPA 3UKRB 4LSNA 3SQ0A 1NMNA 3ID6A 2J4RA 3H3NO 2W42A 3OBWA 1A5WA 1XWLA 3H1QA 1ZYQA 4FJXA 3SCXA 5AQXA 3AVGA 2HB5A 4BR9A 2AP1A 5E41A 1YXQA 3ALYA 5BN8A 4DV6K 1RTHA 3SUNA 2V7ZA 4H4MA 1HJRA 1VSDA 2VWBA 4MDAA 3KVGA 3H1VX 3L0QA 4ELUA 5HP1A 3NH0A 3HSCA 3KZBA 4FJNA 3G4SN 4B9NA 3ZT4A 1I3AA 1I39A 1SQKA 4H5NA 4CE9A 4BWJA 4CBXA 2D0OA 2GV9A 5LJWA 1FK9A 4NCGA 5HL7L 5AFUA 4F2RA 4FZXC 3RTVA 2VYPA 3DOLA 1IBMK 3DXMA 4B3SK 1CLQA 4MFBA 2QXFA 4I9LA 5E26A 3HBTA 5CHIA 1DKGD 1HQUA 3CCVN 3ZT1A 3SNNA 1JCFA 4DU4A 4H5RA 4EHUA 3NF9A 3OW2M 1RT2A 4JYAK 3CCMN 4OVLA 1IJJA 4IDHA 1NGAA 1QSLA 5HRPA 1VSKA 1U04A 3NAEA 1HNIA 4CERA 1DTQA 1XHZA 3RRGA 1BGXT 1BQMA 2IS3A 3R6MA 4NO7A 1T03A 1K73O 3ZCMA 4G9ZA 4XEIA 3DLRA 3NCIA 4KAZA 2VG7A 4JK7A 2O8CA 3ISNC 1KSPA 1NGFA 3KK2A 4YOTA 2P9IA 4KKOA 1D9FA 3ZYYX 4M3TA 2OCEA 5TKYA 3V1QA 2D0AA 3AVKA 4H0TB 4HUGA 4KHYA 4DQPA 1VSHA 4FJGA 1HJOA 1M1KO 3R8EA 2W6LA 2OZSA 4LF6K 3CFRA 2E20A 4LH5A 1NJXA 1C0GA 4L8RB 4CJPA 4B3OA 4CZFA 4CHQA 4KHQA 1W7AA 4LF7K 3GG4A 5ADXH 1BHLA 3WXJA 4DTPA 3TTCA 1Z25A 4BRLA 4EIAA 3AVHA 4B1WB 1YITN 3UIQA 2V52B 1YJ9N 4FJ5A 4K41A 3QFPA 5KI6A 1TAUA 3RVCA 4DR6K 3I8BA 4CFCA 3GBTA 2O8DB 1S6QA 1HNXK 3ATVA 1BU6O 3NVMA 2UUCK 3L4IA 3TANA 1XI1A 1EP4A 3CFOA 3U3YA 3VGKA 3NE6A 2F8TA 3GE1A 4DLEA 2G8VA 4FW2A 4DG1A 4A62A 1BISA 4IDKA 4CK2A 4JD2A 1LAWA 3VEWA 4FJIA 5GAHP 1ZBLA 1EQYA 2HHQA 2FLOA 2YNGA 3TPQA 2HF4A 4HCCA 3ZSOA 1NOZA 5M1OA 1NWKA 3LPTA 1VQKN 3AVIA 3VOVA 4DTNA 1S22A 3DI6A 2QKKA 4ELVA 1E3MA 4FO0A 2G8KA 2OTLN 2UU9K 5HRSA 2VG5A 4IXCA 1MA9B 2HNDA 4KTWA 5EVZA 4BR0A 3SV3A 4FWQA 3WEEA 3OYKA 2E2NA 2NLXA 4M3UA 4IO8A 3QDKA 4H8KA 3QEXA 3DM2A 3IRXA 3OJUA 4RW9A 2HW3A 2ZF5O 4WE1A 4FXDA 3OS0A 3D0PA 2PYLA 3OS1A 3WXIA 1Z26A 4TSXA 4XH5A 1JLCA 1N33K 1NJWA 2YV0X 4DSEA 4K8XA 4YOYA 1SS6A 4FYDA 3S3MA 2G8HA 4BC4A 3V9WA 3QEVA 4B9MA 3QEIA 2X6NA 1NGBA 1IKWA 3JS6A 4JKDA 1RT3A 3PSFA 2AA4A 3QO9A 2YHYA 3ZSZA 4IKFA 1BI4B 2BTFA 1XHXA 1C0UA 3KLGA 1BA1A 3CC7N 5CZ1A 2P9UA 1R59O 3DXKA 4LC9B 1NJZA 2R7YA 4I6MB 4PKHA 4FM0A 3AVFA 1LAVA 4XH4A 2DFFA 1GLDG 2NRVA 5AQRA 5SWMA 1HMVA 2BUPA 3THYA 3M3ZA 4OX9K 3QB0A 4DTRA 4A59A 3PX0A 3L4QA 1RT5A 4KTZA 3I55N 1VQ7N 1X9MA 3HT3A 3V1OA 3L6QA 4H0PA 3SQ4A 1VSFA 1S5JA 5AQMA 2D0CA 1VRUA 1RDDA 1LWEA 1RILA 1E4GT 4DV1K 4L3QA 2QW9A 1OH7A 5BPLA 2BANA 3VN5A 3F2KA 3SZ2A 4E89A 4QS7A 1FKOA 5AQSA 2Y1IA 3TSQA 3AO1A 2QTDA 1T6DA 4EP5A 1WOQA 4CJRA 1QSSA 4O5FA 4B3RK 3Q7CA 4AM6A 3HVRA 1QQOA 3K5LA 2ZJQL 3O6WA 3VQDA 4C1NI 3D7EO 5JS1A 3RMBA 1V4TA 5D3GA 4M7YA 1ZC6A 1S1XA 4FWKA 4IG0A 4CEQA 4GW6A 2H3GX 1WSGA 5CR4A 3C7NB 1P8ZA 2FBVA 1P90A 3DRPA 5HOOA 1NKEA 3M8PA 3WNHA 4CHOA 1JXEA 2PBDA 3NH1A 4IFEA 5C10A 4BR4A 3OY9A 1M90O 5JVGL 4Z0UA 2E8AA 2EX3A 1XQSC 4BDPA 4FLTA 3D2FB 5C2DA 2P9LA 4M42A 3DRSA 2YNFA 4A5AA 4FJLA 4WQ5A 3K2PA 1L3TA 3V9XA 3L2WA 3OYDA 2IGIA 5C42A 1KAZA 1IKXA 1S1UA 2ZD1A 1IKYA 1WAFA 3CHWA 3HOSA 1W97L 3OBYA 3FFIA 2F7TA 3K5MA 4YFUA 1GLCG 2FXUA 3TR8A 4Z94A 4FWPA 4XH1A 2G8IA 4LFBK 5BREA 3HYFA 3EZ5A 3SPZA 4Z4CA 1X9WA 4WQ4A 3A5NC 3HM8A 1KVCA 3SAHA 5KGXA 3KD1E 4K8ZA 2DPNA 3PLAA 3D2EB 3MEDA 3HXMA 1C1AA 5GAEP 3DXMB 1OVQA 1LW2A 2ETJA 3EKSA 2A40A 4CZMA 1KFDA 2E6MA 4CJLA 1UAXA 1VSMA 3VEXA 2P5GA 3ZSYA 1VSJA 1NMDA 4BQZA 2LSNA 4DQSA 1SL0A 4B1VA 3MX5A 3EE9A 2HBLA 4DS5A 4CGFA 2E5LK 1DT9A 3AA2A 5FROA 2Q97A 1HNVA 1ZBSA 4GNIA 4OPKA 5AJ3K 4DQIA 4CJ7A 2KTQA 3RSEB 3U9ZA 1SKRA 4N41A 1VQON 1Z05A 2Z1GA 1VQMN 4DR7K 5CZ2A 3QIPA 3P39A 3TABA 3V1RA 4IG3A 2HHVA 2DY4A 3AV9A 4FPBA 4CIFA 3JYTA 3O3FA 5C25A 4M63C 2P9SB 2KHOA 3M8SA 3HM9A 2OPRA 4CJFA 1S9GA 4YOUA 4BROA 1GOAA 1RDWX 3CD6N 4FCYA 1HUXA 3EY1A 4PKGA 3HOTA 3MEEA 4YORA 3G71N 3PV8A 3TAQA 2ASOA 2D0BA 2VGMA 4B08A 4PUOA 1ASWA 5KQDA 3VQQA 1Z6RA 4M41A 4KREA 3CJ7A 4OPHA 2PAVA 4NXNK 4OLAA 4IEEA 3LAKA 2KFNA 1WSHA 1B92A 2F96A 4W5RA 1RT1A 3MAQA 1NGJA 3LDOA 2E6LA 5JICA 3CM6A 3R3LA 1K9MO 1GLAG 4O55A 4Z4IA 4EFHA 3WUHA 4AM7A 3K5OA 1HQEA 1K6YA 3DYAA 1U45A 3WQTA 4IWVA 2QWNA 1RTJA 3SBGA 3KLFA 2RE2A 1KLNA 4NYNA 1BUPA 1TAQA 1JLFA 4J2AA 2VWKA 1JJ2M 2FBXA 3H08A 3J8AA 5FDLA 4H5TA 4KPYA 2ITGA 4CBWA 5BN9A 2FF3B 1VQ6N 1L3SA 3WT0A 3QEWA 3T1AA 3CCUN 3ZX2A 3HVTA 1WNSA 3C7NA 4LF5K 2VCPA 1RGIA 3VF6A 3OYLA 2E4LA 1KRPA 4PQUA 1LW0A 1K8KB 4HVJA 4PL8A 4E7JA 4O5BA 4CJ3A 1KLMA 4Y1DA 4EHTA 2RPIA 2NRZA 3O4NA 1NJIO 3TTFA 4NLCA 3DWLA 4N5SA 3LM9A 4FJHA 2Q0RA 5LJVA 5FPMA 3LDLA 5KQ8A 3RR8A 2NNWA 3M1FA 5GAGP 3P4IA 1BA0A 4CD3A 3EL2A 3KIOA 2I5JA 3MWTA 1K8AO 1I94K 4IJAA 1QE1A 4JKEA 5AZIB 4W5QA 4H5WA 1BIUA 3OA9A 4JEPA 4QCLA 1TL1A 1BO5O 2W41A 3ITHA 2QXLA 1TKZA 2B4JA 4U67L 2P9PB 1WBDA 4JKHA 2IAJA 4O8UA 3MXIA 2HVHA 2WTUA 3VQ8A 4CF8A 3SUQA 1XMQK 1NGIA 1RTDA 5C2FA 2UUAK 2KKZA 2FF6A 1J53A 4JI6K 2ATQA 3WQUA 1LWCA 4WFAL 4U7BA 3ZETA 1VSEA 4AHRA 3KTQA 4KTQA 1A5VA 5KTQA 1YJNN 4YOVA 4NCAA 1IG8A 3RWUA 5KPZA 2VGNA 2E1ZA 2E2QA 3MXJA 3DMJA 1IKVA 3AA3A 5KGWA 1RDAA 1TV6A 4F2SA 5CYMA 3ZEUB 5AQTA 3H6EA 4FM1A 4BQLA 3HSTB 2OPSA 3VQ5A 3HP9A 4DF8A 1S1TA 3TARA 2D0PA 3J7ZO 1NKCA 3DRRA 5CY4A 3ZSXA 4CZGA 3KJVA 4C8KA 3UB5A 3LALA 3F9MA 4HTUA 1N32K 1RNHA 3TSUA 4BRGA 1Q8IA 4IBNA 4JI1K 3LDSA 1QTMA 4C23A 1TYQA 4OKEA 3MX2A 4RTFD 3T19A 3AVJA 4E7LA 1ATNA 1NGCA 4OKKA 3OYFA 3P83D 4DV4K 4O0JA 5HLFA 3BEXA 4KH5A 3G0ZA 3HTVA 5AQZA 2WOMA 4DR1K 4O0IA 3LPUA 2A1RA 1S6PA 4JI2K 3UKUA 5GINA 3MMVA 4JI0K 3VQ4A 4BY9C 3FGUA 3OYGA 3SV4A 4JNEA 3K9JA 3KWIA 4BDYA 1TKXA 5AQJA 2OYQA 3F73A 3OYMA 4CJUA 4LY7A 1KAYA 2EWSA 5KRSA 5B8HA 3RMCA 4Y1CA 3LAMA 2FSJA 5GIOA 4JKGA 5J1EA 3JAMO 1CXQA 2P9NA 4JS5A 4MO4A 3UE5A 1RBUA 4BRNA 3L2VA 3O1WA 3RR7A 3BF1A 3TAFA 2A6AA 1CZBA 3IG1A 3F9KA 3BGRA 3O80A 3U3GA 2HHHK 3A5OC 3FFKB 3I33A 4I6MA 4DU3A 3KHYA 4CW7B 3MN7A 3CMAN 1U4BA 4FVUA 4E7HA 1ASUA 5JMVA 1NK5A 4DLGA 4I7FA 1QHTA 4F9OA 3E9LA 4Z4EA 3SQ1A 3HRGA 4FW1A 4BVOA 4OO1J 2A1SA 3CIPA 5M1FA 2QKBA 3L2UA 3CCSN 1KAXA 3VF4A 4AHSA 4BE2A 4B9SA 3CXCM 3SK3A 3THVA 4GV6A 4CGHA 4XIUA 3VEVA 1FKPA 4HUEA 1Y64A 4CJ5A 4ILGB 2GEMA 4K25A 5AZIA 1RT7A 4DSIA 4JI7K 4YY3K 4CZEA 3K59A 3IFRA 3QETA 1L3UA 4HHTA 4FK0A 3ENBA 1YVNA 3FZLA 3O9TA 1HPMA 1YVUA 4FVMA 3M8RA 2KQ2A 4JKCA 3KK3A 4FJKA 4Z4FA 2YI1A 1VQ9N 3SPYA 1LOTB 4CEEA 3QICA 4MDBA 3IUCA 4DFPA 1SKSA 4DV0K 3KKRA 3HPOA 3FZHA 1N36K 4Z4GA 3WNEA 4CEAA 1BQNA 1KXPA 4H0YB 3MN6A 4C1NK 3NVKA 1ZBUA 4QAGA 3SJHA 3VMFB 1TL3A 4N76A 2ZJPL 4AF1A 4BG9A 1GLLO 2HNZA 2CH6A 3QESA 2OZMA 2P9KA 3HI0A 3D2EA 3O9UA 3W0LA 5AFUH 3D2FA 1EWQA 4H4OA 4BG8A 1VQNN 3PO4A 2IIRA 4H0OA 3U9DA 1TK8A 2Z1IA 4CEZA 4CCHA 4HCBA 3IS9A 1RFQA 3OYBA 1TKDA 3H3OB 5C12A 2Q3SA 2AJQA 4F8RA 4KFBA 4YNQA 4B9LA 4FOEA 1A5XA 1EETA 1Q9YA 3P38A 4CEOA 1IBLK 4M3RA 1FXXA 3C6HA 3CC4N 1JLEA 1NGGA 3C0BA 3J81O 2O8DA 1VK0A 5JLHA 4FZYA 3TU5A 3SAFA 1NBWA 4Q5VA 3ZSWA 3SQ2A 4W5TA 5EX5A 4O8KA 1NOYA 4B8CA 1TK0A 3VQEA 4DV2K 4JS4A 4KH6A 1BDGA 4CHPA 4CECA 3J7AP 3S41A 4CF0A 3T1YK 3HP6A 2P9PA 4ISFA 4GV9A 2O8EB 3THWA 3P1GA 3NGZA 3H45C 1BL3A 1JLQA 4K0KK 3DLHA 1VHXA 1IV0A 4DFMA 1SUQA 2DTUA 1LV5A 4KHWA 1J5OA 4Q0BA 4I2PA 1HKBA 4FWOA 3EEQA 4RCHA 3T1HK 1S9EA 3VEOA 4A2BA 5HRNA 1N6QA 3K57A 4KHUA 3MN5A 2UYTA 3O08A 1ZXOA 2FSKA 2JWKA 3HZ6A 5FLXO 1JCGA 3CQ8A 5FPNA 3KLHA 5AQVA 3CJAA 5M1KA 1JLGA 2XY6A 3TAEA 1GLJO 1NLVA 2G8FA 2B5JA 4E19A 4H0XB 3VQCA 4EP4A 4CK3A 2OPPA 1KFSA 2OPQA 2YCHA 1OH5A 4RW8A 4FJJA 4CBUA 1RBVA 3O5BA 1XC3A 4DCHA 1NK8A 4IOAL 3IMXA 1EXQA 4FK2A 4A61A 1TUYA 2UUBK 4MQ3A 3CF5L 1X3NA 5AQWA 3R1XA 4N56A 5LMUK 2PFUA 4KHPK 3CQXA 3HJFA 4NXMK 2UXCK 3TAGA 4CIGA 5M1PA 1D9DA 1LCUA 5SZTA 5JLFA 1MWKA 3CCEN 2IVNA 4PWDA 3IDHA 4FWNA 1EWRA 4W5NA 5EXWA 3CI5A 1OVYA 3VQ9A 4B8AB 1RBSA 3K0SA 2O4IA 5F1XA 1T6CA 5MLCQ 4ELTA 3CM5A 4QS9A 2P5OA 3DLEA 3FZKA 3L8BA 1HYSA 1QQCA 2KZMA 5JVHL 4O44A 4NB4A 3OYIA 4CGIA 1U48A 4DSLA 3CJCA 5CE3A 4IEIA 3CJ9A 3I0RA 3NF8A 1RBTA 3MWPA 4YDUA 4CF2A 5F0XA 2NRHA 1GOCA 3QLHA 3OTOK 3AO2A 4E7IA
chains in the Genus database with same CATH topology
2Z1HA 4CJWA 1QSLA 5HRPA 4KPYA 2ITGA 5FRMA 2PY5A 1ITGA 1VSIA 1U04A 1VSKA 3AVLA 3NAEA 1HNIA 1TK5A 2PYJA 1L3SA 4CERA 1DTQA 1XHZA 2QK9A 3RRGA 4DTOA 1NK4A 3QEWA 3T1AA 3VA0A 1BGXT 2Y1JA 3HVTA 1WNSA 1BQMA 2IS3A 2HHTA 1T03A 3NHGA 3ZCMA 3DLRA 3NCIA 2VWJA 4DQRA 3OYLA 1BCMA 4KAZA 1U47A 4OPJA 2E4LA 4GVMA 2VG7A 3CG7A 4CHZA 3OYEA 1NJYA 1KRPA 1LW0A 4PQUA 1JLBA 2RN2A 3ISNC 1RBRA 4HVJA 3ZSQA 4FLZA 1KSPA 4FLWA 3KK2A 4E7JA 4O5BA 1JXBA 4KKOA 1KLMA 4CJ3A 4Y1DA 4JRPA 2RPIA 3LWLA 3O4NA 1D9FA 4CEDA 3TAMA 4N5SA 4FZZA 1BIZA 1T8EA 3NH2A 3LP2A 1N5YA 1IG9A 3PO5A 4DSJA 1D5AA 4CEFA 4FJHA 2RF2A 4KI4A 3V1QA 4RG8A 3QNOA 2D0AA 3AVKA 4HUGA 3RR8A 4EZ6A 3RRHA 4KHYA 4DQPA 1VSHA 4FJGA 4DQQA 3KIOA 3OYNA 5DK5A 2I5JA 4OKJA 3G10A 1HPZA 3AVAA 2IDOA 2OZSA 2XY7A 3CFRA 4LH5A 1NJXA 1C6VA 2OA8A 5JS2A 4L8RB 3VA3A 4CJPA 4B3OA 3KD5E 1QE1A 1JL1A 5HROA 4CHQA 3L2RA 3BDPA 4EZ9A 4KHQA 4DF4A 4W5QA 1BIUA 4QCLA 3OYJA 2XHBA 3IAYA 2XRIA 4ICLA 1TL1A 1BHLA 4Z4HA 3OS2A 4DTPA 1B9FA 4FLXA 1Z25A 3LWMA 3AVHA 3ITHA 2PZSA 5C24A 1TKZA 2B4JA 4IFYA 5HRRA 4CHYA 2BGGA 5J2NA 2X74A 4GMJB 1ZBIA 3MECA 3UIQA 2IAJA 3MXIA 3DLKA 2HVHA 4G1QA 4FJ5A 3VQ8A 4CF8A 3SUQA 1Q9XA 1JLAA 1RTDA 5KI6A 1NK9A 1TAUA 4KB0A 4M3YA 3C94A 1DLOA 2KFZA 1J53A 4B9UA 4CFCA 2ATQA 5J2MA 1LWCA 1T7PA 1S6QA 5J2QA 4N47A 1NK6A 1VSEA 4AHRA 4CFAA 3KTQA 4KTQA 1A5VA 5KTQA 4BE1A 1BI4A 4NCAA 1BCOA 3P5JA 2NUBA 3RWUA 2HHXA 1L5UA 1QSYA 4JRQA 3MXJA 3DMJA 1IKVA 3AA3A 2GBZA 5DMRA 1RDAA 3L3VA 5KGWA 3VQ6A 1TV6A 4CK1A 4BDZA 2YNIA 5CYMA 1UA0A 4F2SA 1J9AA 3TANA 1KTQA 3D45A 4O4GA 1XI1A 1EP4A 4FM1A 1WSJA 3C95A 4E1MA 3CFOA 3HSTB 2OPSA 3VQ5A 3HP9A 4DF8A 4F3TA 1S1TA 1C1CA 3TARA 3U3YA 3NE6A 3RMDA 2F8TA 2IOCA 1U49A 4DLEA 2YNHA 1NKCA 4AHUA 3DRRA 1DTTA 4FW2A 3OVNA 5CY4A 3ZSXA 4DG1A 3T3FA 1BISA 4IDKA 4FK4A 3KJVA 4CK2A 4C8KA 3LALA 1LAWA 4HTUA 1RNHA 4DTMA 1NKBA 4FJIA 3SYZA 1Q8IA 4IBNA 2HNYA 4ZTFA 3QIOA 3LDSA 3LP3A 3O3HA 1QTMA 3VQAA 1ZBLA 4OKEA 2HHQA 1C1BA 4M3TA 2YNGA 3T19A 1X9SA 4E0DA 3AVJA 4E7LA 1W9HA 3AVMA 4HCCA 3ZSOA 1LWFA 1NOZA 1TGOA 2DFHA 3LPTA 4OKKA 3AVIA 3P83D 1WN7A 3OYFA 2X78A 4DTNA 4ELVA 3DI6A 2QKKA 3O3GA 4O0JA 3TAPA 5HLFA 5I42A 3RMAA 1CXUA 5K14A 2G8KA 5HRSA 2VG5A 4CJ4A 3G0ZA 4CGJA 2HVIA 2HNDA 4KTWA 2WOMA 4E3SA 3PX6A 3SV3A 4O0IA 4BWMA 3LPUA 2A1RA 4KRFA 1W0HA 4LD0A 3OYKA 1S6PA 1TKTA 3VQ4A 4CJTA 4M3UA 3QNNA 4H8KA 3QEXA 1F21A 1NK7A 3DM2A 3IRXA 3OJUA 1O1WA 3HO1A 1WSEA 3OYGA 4RW9A 4CJVA 3SV4A 2HW3A 4BDYA 1UOCA 4FJ7A 1TKXA 2YKMA 2OYQA 4DSFA 3AVNA 4WE1A 3F73A 1IH7A 4FXDA 3HPGA 3OS0A 4CJUA 3OYMA 3D0PA 1YTAA 4LY7A 3OS1A 2PYLA 2JGUA 1HYZA 1VSLA 1Z26A 4TSXA 4KHSA 4ID5A 1JLCA 5EU7A 5KRSA 4W5OA 4C8LA 3QEPA 4QOZB 3RMCA 1NJWA 1TVRA 2YV0X 3L3UA 4Y1CA 3ZSVA 1SL2A 3LAMA 3VQBA 4ZHRA 4DSEA 4K8XA 1EKEA 3ZT0A 4CEBA 4C8NA 4CJSA 5J1EA 4FYDA 2G8VA 3ZSRA 3CYMA 2JLEA 1CXQA 4DTSA 3S3MA 2G8HA 4JS5A 2FC0A 1RBUA 3QEVA 3V9WA 4B9MA 3NFAA 3L2VA 3RR7A 3QEIA 2X6NA 3TAFA 1CZBA 3IG1A 3F9KA 3BGRA 3U3GA 4CJKA 4RW6A 3I0SA 2XO7A 1IKWA 1R0AA 3ASMA 2YHBA 2EHGA 1G15A 1RDBA 1RT3A 4DU3A 4FJ9A 3QO9A 3ZT3A 1U4BA 4I2QA 3ZSZA 4IKFA 1BI4B 4E7HA 1ASUA 1NK5A 4DLGA 1XHXA 1C0UA 4I7FA 1QHTA 3KLGA 3KK1A 3DOKA 5CZ1A 4FLVA 3AA4A 1NJZA 3ZT2A 4Z4EA 2R7YA 3SQ1A 4FW1A 1SKWA 4BACA 4FM0A 2P1JA 2Z1JA 2G8UA 2A1SA 3AVFA 4RW7A 4B9VA 1LAVA 3L2UA 4BE2A 4AHSA 3V81A 4B9SA 2DFFA 2QKBA 3THVA 4AHCA 4KV8A 3WNGA 4CGHA 3KLEA 5SWMA 1HMVA 1S1WA 4XIUA 4KHNA 1FKPA 2XY8A 4HUEA 4CJ5A 3ULDA 4DTRA 4R5PA 1D8YA 3PX0A 3S3OA 3V6DA 1RT5A 4KTZA 5CYQA 3OYAA 3KLIA 1RT7A 4DSIA 3V9ZA 1X9MA 3HT3A 2HHUA 1REVA 3V1OA 3K59A 3QETA 1L3UA 4HHTA 1VSFA 3SQ4A 4FK0A 4OLBA 1S5JA 4I9QA 1IO2A 1UWBA 2BE2A 1VRUA 1YVUA 2D0CA 2YKNA 3KKSA 4FVMA 3M8RA 1RDDA 2KQ2A 1LWEA 1RILA 1MU2A 3KK3A 1WLJA 4FJKA 4Z4FA 3AVCA 2BANA 3VN5A 3V4IA 3SPYA 2YHAA 3SZ2A 1ZBFA 4E89A 4CEEA 3AVBA 3QERA 1C0MA 1YT3A 1FKOA 2Y1IA 4LH4A 4DFPA 3AO1A 4FJ8A 5FRNA 4DSKA 1SKSA 2HMIA 3LZIA 4J2BA 4EP5A 4B9TA 4CJRA 3KKRA 3B6OA 5T7BA 2KW4A 3HPOA 1QSSA 3WNEA 4CEAA 4F4KA 1BQNA 3HVRA 4Z4GA 1YTUA 3K5LA 4OJRA 3DLBA 4CFBA 3JSMA 1QS4A 3VQDA 4FJMA 3NDKA 5JS1A 3RMBA 1ZBUA 4QAGA 5D3GA 4J2EA 1TL3A 4N76A 4M3WA 1RT6A 1S1XA 4DU1A 4IG0A 4CEQA 4GW6A 4JLHA 2HNZA 3QESA 3VQPA 1RT4A 4ZTJA 2OZMA 3SJJA 4PA1A 1WSGA 3I8DA 1UA1A 2FBVA 4CF9A 3DRPA 3OYHA 3M8PA 1NKEA 3WNHA 4CHOA 1JXEA 2HHSA 4H4OA 4M3ZA 3AA5X 3PO4A 1TK8A 4KI6A 2Z1IA 3NH1A 4CEZA 4CCHA 4HCBA 3IS9A 4AH9A 3M8QA 3OY9A 4C8OA 4F3OA 3OYBA 1TKDA 4Z0UA 3K58A 4AHTA 2EX3A 4DTUA 2Q3SA 2AJQA 4F8RA 2VG6A 4KFBA 4DMNA 4YNQA 3DLGA 3TWHA 4FLTA 4BDPA 4B9LA 3TI0A 1A5XA 1X1PA 1EETA 1SV5A 1Q9YA 4M42A 3DRSA 4CEOA 4KB1A 3CFPA 2YNFA 4FJLA 1ASVA 4CHNA 4M3RA 1FXXA 3K2PA 2ZQBA 3PX4A 1JLEA 1XC9A 1WAJA 3V9XA 3L2WA 1L3TA 4NCBA 3OYDA 1KVBA 5I3UA 2IGIA 5C42A 4LSLA 1VK0A 4FZYA 1IKXA 1S1UA 2ZD1A 2FBYA 1IKYA 1WAFA 1KCFA 3L2QA 1RDCA 4RW4A 4Q5VA 3ZSWA 3SQ2A 3NGIA 3HK2A 3B6PA 4W5TA 3FFIA 4CIEA 3K5MA 2O4GA 4YFUA 2P51A 4C8MA 1NOYA 3K5NA 3TR8A 4OGEA 1L3VA 4B8CA 1TK0A 2G8IA 3A2FA 3VQEA 1SL1A 1EX4A 4JS4A 2FBTA 3HYFA 4DTJA 3EZ5A 4CHPA 2IC3A 4CECA 4E7KA 3SPZA 4Z4CA 4CF0A 1X9WA 5J2PA 3HP6A 3NF7A 1JKHA 1KVCA 4CJEA 3LANA 3P1GA 3NGZA 1CLQA 1Y97A 5KGXA 3KD1E 4K8ZA 1BL3A 1JLQA 1RCHA 3VQ7A 3DLHA 2F8SA 4DFMA 1SUQA 3MEDA 3HXMA 2DTUA 3NF6A 1LV5A 1C1AA 4KHWA 1J5OA 4Q0BA 3AO5A 4I2PA 2G8WA 4CESA 1LW2A 2ETJA 3MEGA 3OYCA 1KFDA 2E6MA 4DFJA 4FLUA 1S9EA 3O4QA 4CJLA 1UAXA 1B9DA 1VSMA 4AHVA 2D5RA 1RTIA 2P5GA 5HRNA 3ZSYA 1N6QA 1VSJA 3K57A 4KHUA 3OJSA 2LSNA 2RKIA 4DQSA 4DTXA 4IFVA 3SI6A 1SL0A 2XY5A 1ZBHA 3S3NA 4DS5A 4CGFA 2WONA 4CJQA 3LP1A 3LZJA 3CQ8A 3KLHA 4E1NA 4KO0A 4UQGA 1JLGA 3AA2A 5FROA 4FM2A 3SUPA 3V9SA 5HBMA 2XY6A 3TAEA 1HNVA 3C6UA 4OPKA 2BDPA 4DQIA 2G8FA 2B5JA 4E19A 2KTQA 3VQCA 4EP4A 1J54A 4CK3A 1SKRA 1GOBA 3HPHA 2OPPA 4CF1A 2Z1GA 4N41A 4M45A 1KFSA 2X6SA 2GUIA 2OPQA 3WNFA 4RW8A 1C0TA 4DS4A 4DFKA 4FJJA 4J2DA 3QINA 1RBVA 1WSFA 3LP0A 1T05A 3NBPA 2DFEA 4LSNA 3SQ0A 5CZ2A 3QIPA 4CGGA 1NK8A 3TABA 3V1RA 1EXQA 4IG3A 2W42A 4FK2A 2HHVA 3NGYA 4NYFA 1A5WA 3AV9A 2DY4A 1XWLA 1ZYQA 4FJXA 4MQ3A 3SCXA 4CIFA 3JYTA 2ZE2A 3AVGA 3E01A 3O3FA 2HB5A 5C25A 3MXMA 4N56A 3M8SA 1KVAA 2OPRA 3HM9A 4CJFA 5E41A 3HJFA 1S9GA 3ALYA 3TAGA 4CIGA 3SUOA 1RTHA 1GOAA 4CFDA 5KRTA 4H4MA 4FCYA 3SUNA 1HJRA 1VSDA 3EY1A 1D9DA 3MEEA 4BE0A 3PV8A 4ID1A 1NK0A 5SZTA 3TAQA 4ELUA 5HP1A 2D0BA 4B08A 4PUOA 3NH0A 2HHWA 1ASWA 3VQQA 4M41A 4PWDA 4KREA 3HL8A 4FJNA 2B6AA 4W5NA 4B9NA 1JL2A 3ZT4A 4OLAA 1I3AA 1I39A 3LAKA 4CE9A 4CGDA 4OGCA 4BWJA 2KFNA 1WSHA 1B92A 2GV9A 3U6FA 2F96A 3VQ9A 4B8AB 1RT1A 4W5RA 1RBSA 1FK9A 4NCGA 3MAQA 3V9UA 2O4IA 2KZZA 3AO4A 2E6LA 4ELTA 3CM6A 3PY8A 1CZ9A 3CM5A 3C6TA 2P5OA 1S1VA 1WSIA 3DLEA 3L8BA 1HYSA 1HYVA 4O55A 4AILC 3RTVA 1QQCA 4F2RA 4FZXC 4M3XA 4Z4IA 3DOLA 2KZMA 4O44A 3AO3A 3OYIA 3K5OA 4CGIA 1HQEA 1K6YA 2QXFA 4I9LA 4MFBA 4FLYA 1U48A 3DYAA 4DSLA 4PY5A 4DWIA 1U45A 1HQUA 3I0RA 1RTJA 3S9HA 1VRTA 3NF8A 3ZT1A 1RBTA 3KLFA 4CF2A 3SNNA 3PUFA 4DU4A 1KLNA 4NYNA 1GOCA 1TAQA 1JLFA 3NF9A 4HUFA 1RT2A 3EYZA 2VWKA 3QLHA 4J2AA 2FBXA 3H08A 5FDLA 4OVLA 1HRHA 3AO2A 4E7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1H A;  4CJW A;  1QSL A;  5HRP A;  4KPY A;  2ITG A;  5FRM A;  2PY5 A;  1ITG A;  1VSI A;  1U04 A;  1VSK A;  3AVL A;  3NAE A;  1HNI A;  1TK5 A;  2PYJ A;  1L3S A;  4CER A;  1DTQ A;  1XHZ A;  2QK9 A;  3RRG A;  4DTO A;  1NK4 A;  3QEW A;  3T1A A;  3VA0 A;  1BGX T;  2Y1J A;  3HVT A;  1WNS A;  1BQM A;  2IS3 A;  2HHT A;  1T03 A;  3NHG A;  3ZCM A;  3DLR A;  3NCI A;  2VWJ A;  4DQR A;  3OYL A;  1BCM A;  4KAZ A;  1U47 A;  4OPJ A;  2E4L A;  4GVM A;  2VG7 A;  3CG7 A;  4CHZ A;  3OYE A;  1NJY A;  1KRP A;  1LW0 A;  4PQU A;  1JLB A;  2RN2 A;  3ISN C;  1RBR A;  4HVJ A;  3ZSQ A;  4FLZ A;  1KSP A;  4FLW A;  3KK2 A;  4E7J A;  4O5B A;  1JXB A;  4KKO A;  1KLM A;  4CJ3 A;  4Y1D A;  4JRP A;  2RPI A;  3LWL A;  3O4N A;  1D9F A;  4CED A;  3TAM A;  4N5S A;  4FZZ A;  1BIZ A;  1T8E A;  3NH2 A;  3LP2 A;  1N5Y A;  1IG9 A;  3PO5 A;  4DSJ A;  1D5A A;  4CEF A;  4FJH A;  2RF2 A;  4KI4 A;  3V1Q A;  4RG8 A;  3QNO A;  2D0A A;  3AVK A;  4HUG A;  3RR8 A;  4EZ6 A;  3RRH A;  4KHY A;  4DQP A;  1VSH A;  4FJG A;  4DQQ A;  3KIO A;  3OYN A;  5DK5 A;  2I5J A;  4OKJ A;  3G10 A;  1HPZ A;  3AVA A;  2IDO A;  2OZS A;  2XY7 A;  3CFR A;  4LH5 A;  1NJX A;  1C6V A;  2OA8 A;  5JS2 A;  4L8R B;  3VA3 A;  4CJP A;  4B3O A;  3KD5 E;  1QE1 A;  1JL1 A;  5HRO A;  4CHQ A;  3L2R A;  3BDP A;  4EZ9 A;  4KHQ A;  4DF4 A;  4W5Q A;  1BIU A;  4QCL A;  3OYJ A;  2XHB A;  3IAY A;  2XRI A;  4ICL A;  1TL1 A;  1BHL A;  4Z4H A;  3OS2 A;  4DTP A;  1B9F A;  4FLX A;  1Z25 A;  3LWM A;  3AVH A;  3ITH A;  2PZS A;  5C24 A;  1TKZ A;  2B4J A;  4IFY A;  5HRR A;  4CHY A;  2BGG A;  5J2N A;  2X74 A;  4GMJ B;  1ZBI A;  3MEC A;  3UIQ A;  2IAJ A;  3MXI A;  3DLK A;  2HVH A;  4G1Q A;  4FJ5 A;  3VQ8 A;  4CF8 A;  3SUQ A;  1Q9X A;  1JLA A;  1RTD A;  5KI6 A;  1NK9 A;  1TAU A;  4KB0 A;  4M3Y A;  3C94 A;  1DLO A;  2KFZ A;  1J53 A;  4B9U A;  4CFC A;  2ATQ A;  5J2M A;  1LWC A;  1T7P A;  1S6Q A;  5J2Q A;  4N47 A;  1NK6 A;  1VSE A;  4AHR A;  4CFA A;  3KTQ A;  4KTQ A;  1A5V A;  5KTQ A;  4BE1 A;  1BI4 A;  4NCA A;  1BCO A;  3P5J A;  2NUB A;  3RWU A;  2HHX A;  1L5U A;  1QSY A;  4JRQ A;  3MXJ A;  3DMJ A;  1IKV A;  3AA3 A;  2GBZ A;  5DMR A;  1RDA A;  3L3V A;  5KGW A;  3VQ6 A;  1TV6 A;  4CK1 A;  4BDZ A;  2YNI A;  5CYM A;  1UA0 A;  4F2S A;  1J9A A;  3TAN A;  1KTQ A;  3D45 A;  4O4G A;  1XI1 A;  1EP4 A;  4FM1 A;  1WSJ A;  3C95 A;  4E1M A;  3CFO A;  3HST B;  2OPS A;  3VQ5 A;  3HP9 A;  4DF8 A;  4F3T A;  1S1T A;  1C1C A;  3TAR A;  3U3Y A;  3NE6 A;  3RMD A;  2F8T A;  2IOC A;  1U49 A;  4DLE A;  2YNH A;  1NKC A;  4AHU A;  3DRR A;  1DTT A;  4FW2 A;  3OVN A;  5CY4 A;  3ZSX A;  4DG1 A;  3T3F A;  1BIS A;  4IDK A;  4FK4 A;  3KJV A;  4CK2 A;  4C8K A;  3LAL A;  1LAW A;  4HTU A;  1RNH A;  4DTM A;  1NKB A;  4FJI A;  3SYZ A;  1Q8I A;  4IBN A;  2HNY A;  4ZTF A;  3QIO A;  3LDS A;  3LP3 A;  3O3H A;  1QTM A;  3VQA A;  1ZBL A;  4OKE A;  2HHQ A;  1C1B A;  4M3T A;  2YNG A;  3T19 A;  1X9S A;  4E0D A;  3AVJ A;  4E7L A;  1W9H A;  3AVM A;  4HCC A;  3ZSO A;  1LWF A;  1NOZ A;  1TGO A;  2DFH A;  3LPT A;  4OKK A;  3AVI A;  3P83 D;  1WN7 A;  3OYF A;  2X78 A;  4DTN A;  4ELV A;  3DI6 A;  2QKK A;  3O3G A;  4O0J A;  3TAP A;  5HLF A;  5I42 A;  3RMA A;  1CXU A;  5K14 A;  2G8K A;  5HRS A;  2VG5 A;  4CJ4 A;  3G0Z A;  4CGJ A;  2HVI A;  2HND A;  4KTW A;  2WOM A;  4E3S A;  3PX6 A;  3SV3 A;  4O0I A;  4BWM A;  3LPU A;  2A1R A;  4KRF A;  1W0H A;  4LD0 A;  3OYK A;  1S6P A;  1TKT A;  3VQ4 A;  4CJT A;  4M3U A;  3QNN A;  4H8K A;  3QEX A;  1F21 A;  1NK7 A;  3DM2 A;  3IRX A;  3OJU A;  1O1W A;  3HO1 A;  1WSE A;  3OYG A;  4RW9 A;  4CJV A;  3SV4 A;  2HW3 A;  4BDY A;  1UOC A;  4FJ7 A;  1TKX A;  2YKM A;  2OYQ A;  4DSF A;  3AVN A;  4WE1 A;  3F73 A;  1IH7 A;  4FXD A;  3HPG A;  3OS0 A;  4CJU A;  3OYM A;  3D0P A;  1YTA A;  4LY7 A;  3OS1 A;  2PYL A;  2JGU A;  1HYZ A;  1VSL A;  1Z26 A;  4TSX A;  4KHS A;  4ID5 A;  1JLC A;  5EU7 A;  5KRS A;  4W5O A;  4C8L A;  3QEP A;  4QOZ B;  3RMC A;  1NJW A;  1TVR A;  2YV0 X;  3L3U A;  4Y1C A;  3ZSV A;  1SL2 A;  3LAM A;  3VQB A;  4ZHR A;  4DSE A;  4K8X A;  1EKE A;  3ZT0 A;  4CEB A;  4C8N A;  4CJS A;  5J1E A;  4FYD A;  2G8V A;  3ZSR A;  3CYM A;  2JLE A;  1CXQ A;  4DTS A;  3S3M A;  2G8H A;  4JS5 A;  2FC0 A;  1RBU A;  3QEV A;  3V9W A;  4B9M A;  3NFA A;  3L2V A;  3RR7 A;  3QEI A;  2X6N A;  3TAF A;  1CZB A;  3IG1 A;  3F9K A;  3BGR A;  3U3G A;  4CJK A;  4RW6 A;  3I0S A;  2XO7 A;  1IKW A;  1R0A A;  3ASM A;  2YHB A;  2EHG A;  1G15 A;  1RDB A;  1RT3 A;  4DU3 A;  4FJ9 A;  3QO9 A;  3ZT3 A;  1U4B A;  4I2Q A;  3ZSZ A;  4IKF A;  1BI4 B;  4E7H A;  1ASU A;  1NK5 A;  4DLG A;  1XHX A;  1C0U A;  4I7F A;  1QHT A;  3KLG A;  3KK1 A;  3DOK A;  5CZ1 A;  4FLV A;  3AA4 A;  1NJZ A;  3ZT2 A;  4Z4E A;  2R7Y A;  3SQ1 A;  4FW1 A;  1SKW A;  4BAC A;  4FM0 A;  2P1J A;  2Z1J A;  2G8U A;  2A1S A;  3AVF A;  4RW7 A;  4B9V A;  1LAV A;  3L2U A;  4BE2 A;  4AHS A;  3V81 A;  4B9S A;  2DFF A;  2QKB A;  3THV A;  4AHC A;  4KV8 A;  3WNG A;  4CGH A;  3KLE A;  5SWM A;  1HMV A;  1S1W A;  4XIU A;  4KHN A;  1FKP A;  2XY8 A;  4HUE A;  4CJ5 A;  3ULD A;  4DTR A;  4R5P A;  1D8Y A;  3PX0 A;  3S3O A;  3V6D A;  1RT5 A;  4KTZ A;  5CYQ A;  3OYA A;  3KLI A;  1RT7 A;  4DSI A;  3V9Z A;  1X9M A;  3HT3 A;  2HHU A;  1REV A;  3V1O A;  3K59 A;  3QET A;  1L3U A;  4HHT A;  1VSF A;  3SQ4 A;  4FK0 A;  4OLB A;  1S5J A;  4I9Q A;  1IO2 A;  1UWB A;  2BE2 A;  1VRU A;  1YVU A;  2D0C A;  2YKN A;  3KKS A;  4FVM A;  3M8R A;  1RDD A;  2KQ2 A;  1LWE A;  1RIL A;  1MU2 A;  3KK3 A;  1WLJ A;  4FJK A;  4Z4F A;  3AVC A;  2BAN A;  3VN5 A;  3V4I A;  3SPY A;  2YHA A;  3SZ2 A;  1ZBF A;  4E89 A;  4CEE A;  3AVB A;  3QER A;  1C0M A;  1YT3 A;  1FKO A;  2Y1I A;  4LH4 A;  4DFP A;  3AO1 A;  4FJ8 A;  5FRN A;  4DSK A;  1SKS A;  2HMI A;  3LZI A;  4J2B A;  4EP5 A;  4B9T A;  4CJR A;  3KKR A;  3B6O A;  5T7B A;  2KW4 A;  3HPO A;  1QSS A;  3WNE A;  4CEA A;  4F4K A;  1BQN A;  3HVR A;  4Z4G A;  1YTU A;  3K5L A;  4OJR A;  3DLB A;  4CFB A;  3JSM A;  1QS4 A;  3VQD A;  4FJM A;  3NDK A;  5JS1 A;  3RMB A;  1ZBU A;  4QAG A;  5D3G A;  4J2E A;  1TL3 A;  4N76 A;  4M3W A;  1RT6 A;  1S1X A;  4DU1 A;  4IG0 A;  4CEQ A;  4GW6 A;  4JLH A;  2HNZ A;  3QES A;  3VQP A;  1RT4 A;  4ZTJ A;  2OZM A;  3SJJ A;  4PA1 A;  1WSG A;  3I8D A;  1UA1 A;  2FBV A;  4CF9 A;  3DRP A;  3OYH A;  3M8P A;  1NKE A;  3WNH A;  4CHO A;  1JXE A;  2HHS A;  4H4O A;  4M3Z A;  3AA5 X;  3PO4 A;  1TK8 A;  4KI6 A;  2Z1I A;  3NH1 A;  4CEZ A;  4CCH A;  4HCB A;  3IS9 A;  4AH9 A;  3M8Q A;  3OY9 A;  4C8O A;  4F3O A;  3OYB A;  1TKD A;  4Z0U A;  3K58 A;  4AHT A;  2EX3 A;  4DTU A;  2Q3S A;  2AJQ A;  4F8R A;  2VG6 A;  4KFB A;  4DMN A;  4YNQ A;  3DLG A;  3TWH A;  4FLT A;  4BDP A;  4B9L A;  3TI0 A;  1A5X A;  1X1P A;  1EET A;  1SV5 A;  1Q9Y A;  4M42 A;  3DRS A;  4CEO A;  4KB1 A;  3CFP A;  2YNF A;  4FJL A;  1ASV A;  4CHN A;  4M3R A;  1FXX A;  3K2P A;  2ZQB A;  3PX4 A;  1JLE A;  1XC9 A;  1WAJ A;  3V9X A;  3L2W A;  1L3T A;  4NCB A;  3OYD A;  1KVB A;  5I3U A;  2IGI A;  5C42 A;  4LSL A;  1VK0 A;  4FZY A;  1IKX A;  1S1U A;  2ZD1 A;  2FBY A;  1IKY A;  1WAF A;  1KCF A;  3L2Q A;  1RDC A;  4RW4 A;  4Q5V A;  3ZSW A;  3SQ2 A;  3NGI A;  3HK2 A;  3B6P A;  4W5T A;  3FFI A;  4CIE A;  3K5M A;  2O4G A;  4YFU A;  2P51 A;  4C8M A;  1NOY A;  3K5N A;  3TR8 A;  4OGE A;  1L3V A;  4B8C A;  1TK0 A;  2G8I A;  3A2F A;  3VQE A;  1SL1 A;  1EX4 A;  4JS4 A;  2FBT A;  3HYF A;  4DTJ A;  3EZ5 A;  4CHP A;  2IC3 A;  4CEC A;  4E7K A;  3SPZ A;  4Z4C A;  4CF0 A;  1X9W A;  5J2P A;  3HP6 A;  3NF7 A;  1JKH A;  1KVC A;  4CJE A;  3LAN A;  3P1G A;  3NGZ A;  1CLQ A;  1Y97 A;  5KGX A;  3KD1 E;  4K8Z A;  1BL3 A;  1JLQ A;  1RCH A;  3VQ7 A;  3DLH A;  2F8S A;  4DFM A;  1SUQ A;  3MED A;  3HXM A;  2DTU A;  3NF6 A;  1LV5 A;  1C1A A;  4KHW A;  1J5O A;  4Q0B A;  3AO5 A;  4I2P A;  2G8W A;  4CES A;  1LW2 A;  2ETJ A;  3MEG A;  3OYC A;  1KFD A;  2E6M A;  4DFJ A;  4FLU A;  1S9E A;  3O4Q A;  4CJL A;  1UAX A;  1B9D A;  1VSM A;  4AHV A;  2D5R A;  1RTI A;  2P5G A;  5HRN A;  3ZSY A;  1N6Q A;  1VSJ A;  3K57 A;  4KHU A;  3OJS A;  2LSN A;  2RKI A;  4DQS A;  4DTX A;  4IFV A;  3SI6 A;  1SL0 A;  2XY5 A;  1ZBH A;  3S3N A;  4DS5 A;  4CGF A;  2WON A;  4CJQ A;  3LP1 A;  3LZJ A;  3CQ8 A;  3KLH A;  4E1N A;  4KO0 A;  4UQG A;  1JLG A;  3AA2 A;  5FRO A;  4FM2 A;  3SUP A;  3V9S A;  5HBM A;  2XY6 A;  3TAE A;  1HNV A;  3C6U A;  4OPK A;  2BDP A;  4DQI A;  2G8F A;  2B5J A;  4E19 A;  2KTQ A;  3VQC A;  4EP4 A;  1J54 A;  4CK3 A;  1SKR A;  1GOB A;  3HPH A;  2OPP A;  4CF1 A;  2Z1G A;  4N41 A;  4M45 A;  1KFS A;  2X6S A;  2GUI A;  2OPQ A;  3WNF A;  4RW8 A;  1C0T A;  4DS4 A;  4DFK A;  4FJJ A;  4J2D A;  3QIN A;  1RBV A;  1WSF A;  3LP0 A;  1T05 A;  3NBP A;  2DFE A;  4LSN A;  3SQ0 A;  5CZ2 A;  3QIP A;  4CGG A;  1NK8 A;  3TAB A;  3V1R A;  1EXQ A;  4IG3 A;  2W42 A;  4FK2 A;  2HHV A;  3NGY A;  4NYF A;  1A5W A;  3AV9 A;  2DY4 A;  1XWL A;  1ZYQ A;  4FJX A;  4MQ3 A;  3SCX A;  4CIF A;  3JYT A;  2ZE2 A;  3AVG A;  3E01 A;  3O3F A;  2HB5 A;  5C25 A;  3MXM A;  4N56 A;  3M8S A;  1KVA A;  2OPR A;  3HM9 A;  4CJF A;  5E41 A;  3HJF A;  1S9G A;  3ALY A;  3TAG A;  4CIG A;  3SUO A;  1RTH A;  1GOA A;  4CFD A;  5KRT A;  4H4M A;  4FCY A;  3SUN A;  1HJR A;  1VSD A;  3EY1 A;  1D9D A;  3MEE A;  4BE0 A;  3PV8 A;  4ID1 A;  1NK0 A;  5SZT A;  3TAQ A;  4ELU A;  5HP1 A;  2D0B A;  4B08 A;  4PUO A;  3NH0 A;  2HHW A;  1ASW A;  3VQQ A;  4M41 A;  4PWD A;  4KRE A;  3HL8 A;  4FJN A;  2B6A A;  4W5N A;  4B9N A;  1JL2 A;  3ZT4 A;  4OLA A;  1I3A A;  1I39 A;  3LAK A;  4CE9 A;  4CGD A;  4OGC A;  4BWJ A;  2KFN A;  1WSH A;  1B92 A;  2GV9 A;  3U6F A;  2F96 A;  3VQ9 A;  4B8A B;  1RT1 A;  4W5R A;  1RBS A;  1FK9 A;  4NCG A;  3MAQ A;  3V9U A;  2O4I A;  2KZZ A;  3AO4 A;  2E6L A;  4ELT A;  3CM6 A;  3PY8 A;  1CZ9 A;  3CM5 A;  3C6T A;  2P5O A;  1S1V A;  1WSI A;  3DLE A;  3L8B A;  1HYS A;  1HYV A;  4O55 A;  4AIL C;  3RTV A;  1QQC A;  4F2R A;  4FZX C;  4M3X A;  4Z4I A;  3DOL A;  2KZM A;  4O44 A;  3AO3 A;  3OYI A;  3K5O A;  4CGI A;  1HQE A;  1K6Y A;  2QXF A;  4I9L A;  4MFB A;  4FLY A;  1U48 A;  3DYA A;  4DSL A;  4PY5 A;  4DWI A;  1U45 A;  1HQU A;  3I0R A;  1RTJ A;  3S9H A;  1VRT A;  3NF8 A;  3ZT1 A;  1RBT A;  3KLF A;  4CF2 A;  3SNN A;  3PUF A;  4DU4 A;  1KLN A;  4NYN A;  1GOC A;  1TAQ A;  1JLF A;  3NF9 A;  4HUF A;  1RT2 A;  3EYZ A;  2VWK A;  3QLH A;  4J2A A;  2FBX A;  3H08 A;  5FDL A;  4OVL A;  1HRH A;  3AO2 A;  4E7I A; 
#chains in the Genus database with same CATH topology
 1OH8 A;  3CCL N;  3T7Z A;  4CJW A;  4JD2 B;  3QBW A;  2PY5 A;  1ITG A;  2V7Y A;  3AVL A;  1TK5 A;  1QQN A;  4GY2 B;  2QWO A;  3VET A;  3CCR N;  2HHT A;  3NHG A;  4BVP A;  2VWJ A;  4Y0W A;  1BCM A;  1U47 A;  4GVM A;  3CG7 A;  1JLB A;  3LDQ A;  2ASP A;  2RN2 A;  1RBR A;  4FLZ A;  4JRP A;  4H0V B;  4CED A;  2A41 A;  3TAM A;  3WXL A;  4FZZ A;  1X9J A;  5EOY A;  1BIZ A;  1T8E A;  1N5Y A;  3LP2 A;  4KI4 A;  1D5A A;  1Q82 O;  2I7P A;  3RRH A;  2P9L B;  4DQQ A;  3C6A A;  4WQ5 C;  4CZK A;  3OYN A;  3SMP A;  2ZM6 K;  3G10 A;  1HPZ A;  1GLE G;  2IDO A;  4B1Y B;  4JI5 K;  1C6V A;  2OA8 A;  3QBX A;  3KD5 E;  1MWM A;  3L2R A;  4JN4 A;  4DF4 A;  5LY3 A;  3OYJ A;  2XHB A;  2UXD K;  2D1K A;  3LWM A;  2PZS A;  5KPR A;  4IFY A;  3ENH A;  2BGG A;  5J2N A;  2ZWH A;  1ZBI A;  2CGJ A;  3DLK A;  4B1Z A;  4BRK A;  1Q9X A;  3E66 A;  1DLO A;  2KFZ A;  4DHY A;  1T7P A;  4YDU C;  3W3D A;  1NK6 A;  1BI4 A;  3P5J A;  1E4F T;  1L5U A;  5H1S Q;  5DMR A;  3VQ6 A;  2E2O A;  2GBZ A;  4BDZ A;  2YNI A;  4O4G A;  1G99 A;  3PIP L;  2Q31 A;  4JKG B;  3WXM B;  2IOC A;  3KK7 A;  3Q7B A;  1U49 A;  2YNH A;  4AHU A;  1DTT A;  3THY B;  2QWM A;  3O9Q A;  4DB3 A;  5AQG A;  2O8B B;  4DTM A;  2F9T A;  5GAD P;  4ZTF A;  3SBT A;  3LP3 A;  3J80 O;  3CC2 N;  4IOC L;  1C1B A;  5FPE A;  2GX9 A;  1YI2 N;  2QWL A;  4E0D A;  4JV5 K;  3AVM A;  3BY5 A;  1TGO A;  2DFH A;  1WN7 A;  3GOI A;  2X78 A;  4A5B A;  3TAP A;  5I42 A;  3BZK A;  4BRI A;  5BR8 K;  1CXU A;  5K14 A;  3ZLJ A;  5I9E B;  3ZET B;  4CGJ A;  4X65 K;  1YUW A;  3O9S A;  3M6G A;  4E3S A;  1H1V A;  3PX6 A;  1Q7Y O;  4CZH A;  2HF3 A;  1W2B M;  1W0H A;  4LD0 A;  1TKT A;  3VEY A;  1F21 A;  4PHT X;  1WSE A;  4CJV A;  2YHX A;  1J6Z A;  1XNR K;  2CH5 A;  2HBM A;  4YHH K;  5IT9 O;  3AVN A;  3BF3 A;  4MO5 A;  1IH7 A;  3HPG A;  4KHS A;  2JGU A;  1VSL A;  2ZGZ A;  1NU0 A;  4ID5 A;  5EU7 A;  4HWI A;  4W5O A;  4C8L A;  3QEP A;  4QOZ B;  1TVR A;  2WBN A;  3ZSV A;  3THW B;  3CCQ N;  4BRD A;  4ILH A;  3R9P A;  3WXK A;  3ZT0 A;  4C8N A;  4FWL A;  3CYM A;  2JLE A;  4DTS A;  4BRE A;  2FC0 A;  5LMN K;  1T3V A;  5BPN A;  3ATU A;  2A5X A;  3UKR A;  5AQH A;  4CJK A;  4RW6 A;  3I0S A;  4FWR A;  1R0A A;  2YHB A;  1YF5 L;  3RSE A;  3ZT3 A;  4I2Q A;  3KK1 A;  3AA4 A;  3SAG A;  4DR2 K;  3ZT2 A;  1SKW A;  2G8U A;  1KC8 O;  3V81 A;  1KQS M;  3WNG A;  4KHN A;  4BRH A;  3DJC A;  3VTH A;  3ULD A;  1SAZ A;  4R5P A;  1C0F A;  2YHW A;  3S3O A;  5CYQ A;  3EN9 A;  3OYA A;  3PIO L;  1REV A;  3ZEU A;  1QQM A;  4CZJ A;  3T69 A;  1UWB A;  2BE2 A;  3E9O A;  1IBK K;  1MU2 A;  1WLJ A;  3AVC A;  2ZGY A;  5FPD A;  3E9P A;  3AVB A;  1C0M A;  4LH4 A;  4FJ8 A;  2HMI A;  4J2B A;  4B9T A;  1U6Z A;  1D4X A;  4F4K A;  3B6O A;  5T7B A;  1YTU A;  3FLC O;  2GUP A;  1NG9 A;  3A5L C;  1QS4 A;  4FJM A;  3NDK A;  3MCP A;  4OPA A;  1OH6 A;  4ISE A;  4JLH A;  4ZTJ A;  3VQP A;  1U2V B;  4PA1 A;  3SJJ A;  4GV3 A;  3I8D A;  4BR7 A;  1KD1 O;  4CF9 A;  4LF9 K;  4WFN L;  1S72 N;  4B9Q A;  4M3Z A;  3AA5 X;  1X3M A;  1TUU A;  3CPW M;  1QHA A;  4AH9 A;  3M8Q A;  1DGK N;  3K58 A;  4DTU A;  4AHT A;  1YHQ N;  4YOW A;  2VG6 A;  4DMN A;  3DLG A;  1VQ4 N;  1X1P A;  1FW6 A;  1QVF M;  2NRT A;  3DXK B;  3CFP A;  5AQO A;  4DV3 K;  2OTJ N;  1U2V A;  4CHN A;  3FR0 A;  3CER A;  3MCA B;  4LFC K;  3O9R A;  5AQN A;  4CD1 A;  4JKF A;  3THX A;  2FBY A;  3I56 N;  2NRR A;  1NGE A;  3NGI A;  3EO3 A;  5AQI A;  3VGL A;  4DR5 K;  3B6P A;  1GLF O;  1QZ6 A;  1T44 A;  4CIE A;  4OGE A;  3A2F A;  1EX4 A;  4BRA A;  4WYB A;  2IC3 A;  2E1Y A;  3CJB A;  3NF7 A;  4KH4 A;  1JKH A;  3LAN A;  4IO9 L;  1WB9 A;  1Y97 A;  2FSN A;  2F8S A;  5AQL A;  3VES A;  3ID8 A;  2QA4 N;  3LL3 A;  3CCJ N;  1N8R O;  3ULE B;  4CES A;  5IWA K;  4DV7 K;  1N34 K;  2YJE A;  4FLU A;  4FWM A;  3AAP A;  1B9D A;  3BUZ B;  3OJS A;  3J7Y P;  2E88 A;  4GKJ K;  4DTX A;  4IFV A;  3SI6 A;  4K43 A;  1MDU B;  2P9U B;  4CJQ A;  3LP1 A;  4BRQ A;  4LF4 K;  4E1N A;  4KO0 A;  4UQG A;  2YJF A;  3A5M C;  5AZJ B;  4FM2 A;  5HBM A;  2D4W A;  1Q86 O;  2BDP A;  5M1N A;  3VTI A;  5BRF A;  4KBO A;  3O8M A;  3EZW A;  5AQQ A;  1VAZ A;  4M45 A;  4DFK A;  2GUI A;  3QFU A;  4DS4 A;  3QIN A;  4JHD B;  3LP0 A;  3CJ1 A;  1T05 A;  1QZ5 A;  2DFE A;  2KLA A;  4BC5 A;  4CGG A;  3G25 A;  2O8F B;  2QWR A;  1XMO K;  3NGY A;  4NYF A;  5LL6 Z;  4QS8 A;  2ZE2 A;  3E01 A;  4IJN A;  4BR2 A;  3MXM A;  1XUP O;  1KVA A;  3SUO A;  4CFD A;  5KRT A;  4JI4 K;  4BE0 A;  4ID1 A;  4J8F A;  1NK0 A;  1BOT O;  2HHW A;  3HL8 A;  3CQY A;  2I7N A;  2B6A A;  2QM1 A;  1JL2 A;  5TKW A;  4CGD A;  4OGC A;  3U6F A;  3GL1 A;  5DM6 L;  5EY4 A;  3V9U A;  4WCE L;  2KZZ A;  3AO4 A;  3PY8 A;  1CZ9 A;  4X62 K;  3C6T A;  4JK9 A;  1S1V A;  1WSI A;  1HYV A;  1ESV A;  4AIL C;  4M3X A;  4IZ9 A;  1EO1 A;  3AO3 A;  2UXB K;  4FLY A;  4PY5 A;  4DWI A;  2QWP A;  5BR9 A;  4B1U B;  3S9H A;  1VRT A;  4JAX A;  2HBK A;  3PUF A;  2V51 B;  2W40 A;  4HUF A;  3EYZ A;  4H03 B;  1HKC A;  1HRH A;  4DTO A;  2P9S A;  2Z1H A;  5FRM A;  2CGL A;  1VSI A;  2PYJ A;  4LF8 K;  3A0I X;  4LFA K;  2QK9 A;  1NK4 A;  3VA0 A;  2Y1J A;  2GEL A;  4AQY K;  2NRX A;  4JI3 K;  4FWS A;  4DQR A;  4OPJ A;  1NJY A;  4CHZ A;  3OYE A;  5AQY A;  4CZL A;  4UY8 O;  3ZSQ A;  4FLW A;  2WC9 A;  3THX B;  5F2R A;  1JXB A;  4JI8 K;  3LWL A;  3NH2 A;  4DSJ A;  1IG9 A;  3PO5 A;  1TYQ B;  4CEF A;  2RF2 A;  4RWT A;  2JWL A;  4RG8 A;  2F4V K;  3QNO A;  1ATS A;  4EZ6 A;  3N4Q A;  4CI6 A;  5DK5 A;  4OKJ A;  1HX1 A;  3AVA A;  2XY7 A;  3M5R A;  3AY9 A;  4DUY K;  3D6R A;  4B3M K;  1VQ8 N;  5JS2 A;  2HST A;  5AR0 A;  3VA3 A;  4BGB A;  2F9W A;  4DR4 K;  1JL1 A;  5HRO A;  3VER A;  3BDP A;  4EZ9 A;  4JKB A;  4WF9 L;  3A8Y A;  3IAY A;  2XRI A;  4ICL A;  4YOX A;  3OS2 A;  4Z4H A;  1B9F A;  4FLX A;  5KPT A;  5C24 A;  5A2Q O;  5HRR A;  4CHY A;  2X74 A;  4GMJ B;  3MEC A;  4G1Q A;  1NNE A;  1JLA A;  1S3X A;  3WEE B;  1NK9 A;  4FPA A;  4KB0 A;  4M3Y A;  3C94 A;  4B9U A;  3IKM A;  5J2M A;  5AQF A;  4B1X B;  5J2Q A;  4N47 A;  3AGR A;  4CFA A;  4BE1 A;  1BCO A;  2NUB A;  2HHX A;  3EKU A;  5ELZ A;  1DEJ A;  2WUS A;  4DUZ K;  2O8C B;  1QSY A;  4JRQ A;  1VQP N;  4CK1 A;  3L3V A;  1UA0 A;  1J9A A;  1KTQ A;  3D45 A;  5GIP A;  1WSJ A;  3C95 A;  4E1M A;  3VGM A;  4BRC A;  4F3T A;  1C1C A;  3RMD A;  3U4L A;  3LDP A;  3OVN A;  3T3F A;  4FK4 A;  1HNW K;  3H46 O;  4BRM A;  1NKB A;  3SYZ A;  2Q0U A;  2HNY A;  3QIO A;  3O3H A;  1VQ5 N;  3VQA A;  4DKW A;  1OKJ A;  4DV5 K;  1X9S A;  3F5T A;  3LM2 A;  1XNQ K;  1W9H A;  2QEX N;  2E2P A;  1LWF A;  3BP8 A;  4BGA A;  2QI2 A;  4K42 A;  2IVP A;  1CZA N;  3MDQ A;  3O3G A;  3ENO A;  3RMA A;  4CJ4 A;  2HVI A;  4MLE A;  3TSP A;  4R79 A;  3OHR A;  4DQ8 A;  4A2A A;  4BWM A;  4KRF A;  4CJT A;  3CME N;  1JCE A;  3QNN A;  5BPM A;  1NK7 A;  2GTD A;  1O1W A;  1YAG A;  3EE8 A;  1UOC A;  5C15 A;  2YKM A;  3TTD A;  4FJ7 A;  4DSF A;  3DAW A;  4BC3 A;  4MLH A;  4FSV A;  1YTA A;  4V19 S;  1HYZ A;  1FJG K;  1BWF O;  2O8B A;  1V4S A;  4PL7 A;  4ISG A;  3L3U A;  1SL2 A;  3VQB A;  4ZHR A;  5DM7 L;  1EKE A;  4CEB A;  4CJS A;  1O13 A;  2O8F A;  3ZSR A;  3KWG A;  3NFA A;  3UKU B;  3G6E N;  2HOE A;  2GWJ A;  1J5E K;  5C0Y A;  2P9I B;  1HR0 K;  1NM1 A;  2XO7 A;  2ASM A;  3ASM A;  4BC2 A;  2EHG A;  1G15 A;  4BRF A;  1RDB A;  4FJ9 A;  4PKI A;  4CZI A;  3MK6 A;  1K8K A;  3DOK A;  4FLV A;  3VEN A;  3MN9 A;  1HNZ K;  2Q1N A;  3BZC A;  4BAC A;  2P9N B;  3ZX0 A;  2P1J A;  2Z1J A;  2RHK A;  2Q36 A;  4RW7 A;  4B9V A;  4AHC A;  4KV8 A;  3O1B A;  5AQU A;  3SLC A;  1S1W A;  3KLE A;  2XY8 A;  1ATR A;  1D8Y A;  3V6D A;  3U8X A;  3KLI A;  3B8A X;  3V9Z A;  2HHU A;  4BRP A;  4FL9 A;  2A42 A;  4OLB A;  4I9Q A;  3JXU A;  1IO2 A;  4E1J A;  2YKN A;  3HO1 A;  2P9K B;  3KKS A;  4WQ4 C;  2YX6 A;  3V4I A;  4BR5 A;  3PSI A;  2O8E A;  2YHA A;  1ZBF A;  3QER A;  3C65 A;  1WBB A;  1YT3 A;  3AAR A;  5FRN A;  4DSK A;  3LZI A;  5BRH A;  4JKA A;  3VPZ A;  4DR3 K;  2KW4 A;  4X64 K;  4IOX A;  4OJR A;  3DLB A;  4CFB A;  3JSM A;  2NZT A;  4J2E A;  4JK8 A;  3ZX3 A;  3N4P A;  4ILJ A;  4M3W A;  1RT6 A;  4DU1 A;  3K9K A;  1RT4 A;  5M1Q A;  3LDN A;  2ITM A;  1UA1 A;  1RDU A;  3DLL L;  3OYH A;  2VQE K;  3O4W A;  2HHS A;  3VEZ A;  3NMU A;  3VF2 A;  4KI6 A;  5BRD A;  4EAH D;  5AQP A;  2W6K A;  4C8O A;  4F3O A;  1QVG M;  4A57 A;  4WFB L;  3TWH A;  4JHD A;  3FZM A;  3E1Y A;  3TI0 A;  1SV5 A;  2HBJ A;  1Q81 O;  4KB1 A;  1NGH A;  1Q18 A;  1ASV A;  4NLB A;  5AZJ A;  3PX4 A;  1XC9 A;  2ZQB A;  4NCB A;  1WAJ A;  5ADX A;  1KVB A;  5I3U A;  4CVN E;  4LSL A;  5E84 A;  4X66 K;  1KCF A;  3L2Q A;  1RDC A;  1GLB G;  4RW4 A;  2A3Z A;  3FZF A;  3HK2 A;  1ILY A;  2Q2R A;  2NRW A;  2O4G A;  1YIJ N;  2P51 A;  4C8M A;  3K5N A;  1L3V A;  3QML A;  1SL1 A;  2FBT A;  4DTJ A;  4GVE A;  4E7K A;  5J2P A;  1NGD A;  3ULE A;  4CJE A;  3CET A;  2HMP A;  2WFB A;  1SZ2 A;  4B3T K;  4FOI A;  1RCH A;  3VQ7 A;  2VQF K;  1WUA A;  3FE1 A;  1VQL N;  5AQK A;  3NF6 A;  4HTL A;  3AO5 A;  3AAQ A;  2G8W A;  3MEG A;  3OYC A;  4H5V A;  4DFJ A;  2ZJR L;  1BG3 A;  3O4Q A;  4AHV A;  2D5R A;  1RTI A;  2BH1 A;  3P31 A;  2GWK A;  2RKI A;  1ZBH A;  2XY5 A;  3GDQ A;  2CGK A;  3S3N A;  2WON A;  2OAN A;  3LZJ A;  3CPE A;  3SMS A;  2QWQ A;  1HLU A;  1HKG A;  3SUP A;  3V9S A;  2IVO A;  3C6U A;  4M7X A;  1J54 A;  3AGK A;  1GOB A;  3HPH A;  4CF1 A;  1YJW N;  2X6S A;  3WNF A;  1C0T A;  4J2D A;  1WSF A;  4GKK K;  3NBP A;  3UKR B;  4LSN A;  3SQ0 A;  1NMN A;  3ID6 A;  2J4R A;  3H3N O;  2W42 A;  3OBW A;  1A5W A;  1XWL A;  3H1Q A;  1ZYQ A;  4FJX A;  3SCX A;  5AQX A;  3AVG A;  2HB5 A;  4BR9 A;  2AP1 A;  5E41 A;  1YXQ A;  3ALY A;  5BN8 A;  4DV6 K;  1RTH A;  3SUN A;  2V7Z A;  4H4M A;  1HJR A;  1VSD A;  2VWB A;  4MDA A;  3KVG A;  3H1V X;  3L0Q A;  4ELU A;  5HP1 A;  3NH0 A;  3HSC A;  3KZB A;  4FJN A;  3G4S N;  4B9N A;  3ZT4 A;  1I3A A;  1I39 A;  1SQK A;  4H5N A;  4CE9 A;  4BWJ A;  4CBX A;  2D0O A;  2GV9 A;  5LJW A;  1FK9 A;  4NCG A;  5HL7 L;  5AFU A;  4F2R A;  4FZX C;  3RTV A;  2VYP A;  3DOL A;  1IBM K;  3DXM A;  4B3S K;  1CLQ A;  4MFB A;  2QXF A;  4I9L A;  5E26 A;  3HBT A;  5CHI A;  1DKG D;  1HQU A;  3CCV N;  3ZT1 A;  3SNN A;  1JCF A;  4DU4 A;  4H5R A;  4EHU A;  3NF9 A;  3OW2 M;  1RT2 A;  4JYA K;  3CCM N;  4OVL A;  1IJJ A;  4IDH A;  1NGA A;  1QSL A;  5HRP A;  1VSK A;  1U04 A;  3NAE A;  1HNI A;  4CER A;  1DTQ A;  1XHZ A;  3RRG A;  1BGX T;  1BQM A;  2IS3 A;  3R6M A;  4NO7 A;  1T03 A;  1K73 O;  3ZCM A;  4G9Z A;  4XEI A;  3DLR A;  3NCI A;  4KAZ A;  2VG7 A;  4JK7 A;  2O8C A;  3ISN C;  1KSP A;  1NGF A;  3KK2 A;  4YOT A;  2P9I A;  4KKO A;  1D9F A;  3ZYY X;  4M3T A;  2OCE A;  5TKY A;  3V1Q A;  2D0A A;  3AVK A;  4H0T B;  4HUG A;  4KHY A;  4DQP A;  1VSH A;  4FJG A;  1HJO A;  1M1K O;  3R8E A;  2W6L A;  2OZS A;  4LF6 K;  3CFR A;  2E20 A;  4LH5 A;  1NJX A;  1C0G A;  4L8R B;  4CJP A;  4B3O A;  4CZF A;  4CHQ A;  4KHQ A;  1W7A A;  4LF7 K;  3GG4 A;  5ADX H;  1BHL A;  3WXJ A;  4DTP A;  3TTC A;  1Z25 A;  4BRL A;  4EIA A;  3AVH A;  4B1W B;  1YIT N;  3UIQ A;  2V52 B;  1YJ9 N;  4FJ5 A;  4K41 A;  3QFP A;  5KI6 A;  1TAU A;  3RVC A;  4DR6 K;  3I8B A;  4CFC A;  3GBT A;  2O8D B;  1S6Q A;  1HNX K;  3ATV A;  1BU6 O;  3NVM A;  2UUC K;  3L4I A;  3TAN A;  1XI1 A;  1EP4 A;  3CFO A;  3U3Y A;  3VGK A;  3NE6 A;  2F8T A;  3GE1 A;  4DLE A;  2G8V A;  4FW2 A;  4DG1 A;  4A62 A;  1BIS A;  4IDK A;  4CK2 A;  4JD2 A;  1LAW A;  3VEW A;  4FJI A;  5GAH P;  1ZBL A;  1EQY A;  2HHQ A;  2FLO A;  2YNG A;  3TPQ A;  2HF4 A;  4HCC A;  3ZSO A;  1NOZ A;  5M1O A;  1NWK A;  3LPT A;  1VQK N;  3AVI A;  3VOV A;  4DTN A;  1S22 A;  3DI6 A;  2QKK A;  4ELV A;  1E3M A;  4FO0 A;  2G8K A;  2OTL N;  2UU9 K;  5HRS A;  2VG5 A;  4IXC A;  1MA9 B;  2HND A;  4KTW A;  5EVZ A;  4BR0 A;  3SV3 A;  4FWQ A;  3WEE A;  3OYK A;  2E2N A;  2NLX A;  4M3U A;  4IO8 A;  3QDK A;  4H8K A;  3QEX A;  3DM2 A;  3IRX A;  3OJU A;  4RW9 A;  2HW3 A;  2ZF5 O;  4WE1 A;  4FXD A;  3OS0 A;  3D0P A;  2PYL A;  3OS1 A;  3WXI A;  1Z26 A;  4TSX A;  4XH5 A;  1JLC A;  1N33 K;  1NJW A;  2YV0 X;  4DSE A;  4K8X A;  4YOY A;  1SS6 A;  4FYD A;  3S3M A;  2G8H A;  4BC4 A;  3V9W A;  3QEV A;  4B9M A;  3QEI A;  2X6N A;  1NGB A;  1IKW A;  3JS6 A;  4JKD A;  1RT3 A;  3PSF A;  2AA4 A;  3QO9 A;  2YHY A;  3ZSZ A;  4IKF A;  1BI4 B;  2BTF A;  1XHX A;  1C0U A;  3KLG A;  1BA1 A;  3CC7 N;  5CZ1 A;  2P9U A;  1R59 O;  3DXK A;  4LC9 B;  1NJZ A;  2R7Y A;  4I6M B;  4PKH A;  4FM0 A;  3AVF A;  1LAV A;  4XH4 A;  2DFF A;  1GLD G;  2NRV A;  5AQR A;  5SWM A;  1HMV A;  2BUP A;  3THY A;  3M3Z A;  4OX9 K;  3QB0 A;  4DTR A;  4A59 A;  3PX0 A;  3L4Q A;  1RT5 A;  4KTZ A;  3I55 N;  1VQ7 N;  1X9M A;  3HT3 A;  3V1O A;  3L6Q A;  4H0P A;  3SQ4 A;  1VSF A;  1S5J A;  5AQM A;  2D0C A;  1VRU A;  1RDD A;  1LWE A;  1RIL A;  1E4G T;  4DV1 K;  4L3Q A;  2QW9 A;  1OH7 A;  5BPL A;  2BAN A;  3VN5 A;  3F2K A;  3SZ2 A;  4E89 A;  4QS7 A;  1FKO A;  5AQS A;  2Y1I A;  3TSQ A;  3AO1 A;  2QTD A;  1T6D A;  4EP5 A;  1WOQ A;  4CJR A;  1QSS A;  4O5F A;  4B3R K;  3Q7C A;  4AM6 A;  3HVR A;  1QQO A;  3K5L A;  2ZJQ L;  3O6W A;  3VQD A;  4C1N I;  3D7E O;  5JS1 A;  3RMB A;  1V4T A;  5D3G A;  4M7Y A;  1ZC6 A;  1S1X A;  4FWK A;  4IG0 A;  4CEQ A;  4GW6 A;  2H3G X;  1WSG A;  5CR4 A;  3C7N B;  1P8Z A;  2FBV A;  1P90 A;  3DRP A;  5HOO A;  1NKE A;  3M8P A;  3WNH A;  4CHO A;  1JXE A;  2PBD A;  3NH1 A;  4IFE A;  5C10 A;  4BR4 A;  3OY9 A;  1M90 O;  5JVG L;  4Z0U A;  2E8A A;  2EX3 A;  1XQS C;  4BDP A;  4FLT A;  3D2F B;  5C2D A;  2P9L A;  4M42 A;  3DRS A;  2YNF A;  4A5A A;  4FJL A;  4WQ5 A;  3K2P A;  1L3T A;  3V9X A;  3L2W A;  3OYD A;  2IGI A;  5C42 A;  1KAZ A;  1IKX A;  1S1U A;  2ZD1 A;  1IKY A;  1WAF A;  3CHW A;  3HOS A;  1W97 L;  3OBY A;  3FFI A;  2F7T A;  3K5M A;  4YFU A;  1GLC G;  2FXU A;  3TR8 A;  4Z94 A;  4FWP A;  4XH1 A;  2G8I A;  4LFB K;  5BRE A;  3HYF A;  3EZ5 A;  3SPZ A;  4Z4C A;  1X9W A;  4WQ4 A;  3A5N C;  3HM8 A;  1KVC A;  3SAH A;  5KGX A;  3KD1 E;  4K8Z A;  2DPN A;  3PLA A;  3D2E B;  3MED A;  3HXM A;  1C1A A;  5GAE P;  3DXM B;  1OVQ A;  1LW2 A;  2ETJ A;  3EKS A;  2A40 A;  4CZM A;  1KFD A;  2E6M A;  4CJL A;  1UAX A;  1VSM A;  3VEX A;  2P5G A;  3ZSY A;  1VSJ A;  1NMD A;  4BQZ A;  2LSN A;  4DQS A;  1SL0 A;  4B1V A;  3MX5 A;  3EE9 A;  2HBL A;  4DS5 A;  4CGF A;  2E5L K;  1DT9 A;  3AA2 A;  5FRO A;  2Q97 A;  1HNV A;  1ZBS A;  4GNI A;  4OPK A;  5AJ3 K;  4DQI A;  4CJ7 A;  2KTQ A;  3RSE B;  3U9Z A;  1SKR A;  4N41 A;  1VQO N;  1Z05 A;  2Z1G A;  1VQM N;  4DR7 K;  5CZ2 A;  3QIP A;  3P39 A;  3TAB A;  3V1R A;  4IG3 A;  2HHV A;  2DY4 A;  3AV9 A;  4FPB A;  4CIF A;  3JYT A;  3O3F A;  5C25 A;  4M63 C;  2P9S B;  2KHO A;  3M8S A;  3HM9 A;  2OPR A;  4CJF A;  1S9G A;  4YOU A;  4BRO A;  1GOA A;  1RDW X;  3CD6 N;  4FCY A;  1HUX A;  3EY1 A;  4PKG A;  3HOT A;  3MEE A;  4YOR A;  3G71 N;  3PV8 A;  3TAQ A;  2ASO A;  2D0B A;  2VGM A;  4B08 A;  4PUO A;  1ASW A;  5KQD A;  3VQQ A;  1Z6R A;  4M41 A;  4KRE A;  3CJ7 A;  4OPH A;  2PAV A;  4NXN K;  4OLA A;  4IEE A;  3LAK A;  2KFN A;  1WSH A;  1B92 A;  2F96 A;  4W5R A;  1RT1 A;  3MAQ A;  1NGJ A;  3LDO A;  2E6L A;  5JIC A;  3CM6 A;  3R3L A;  1K9M O;  1GLA G;  4O55 A;  4Z4I A;  4EFH A;  3WUH A;  4AM7 A;  3K5O A;  1HQE A;  1K6Y A;  3DYA A;  1U45 A;  3WQT A;  4IWV A;  2QWN A;  1RTJ A;  3SBG A;  3KLF A;  2RE2 A;  1KLN A;  4NYN A;  1BUP A;  1TAQ A;  1JLF A;  4J2A A;  2VWK A;  1JJ2 M;  2FBX A;  3H08 A;  3J8A A;  5FDL A;  4H5T A;  4KPY A;  2ITG A;  4CBW A;  5BN9 A;  2FF3 B;  1VQ6 N;  1L3S A;  3WT0 A;  3QEW A;  3T1A A;  3CCU N;  3ZX2 A;  3HVT A;  1WNS A;  3C7N A;  4LF5 K;  2VCP A;  1RGI A;  3VF6 A;  3OYL A;  2E4L A;  1KRP A;  4PQU A;  1LW0 A;  1K8K B;  4HVJ A;  4PL8 A;  4E7J A;  4O5B A;  4CJ3 A;  1KLM A;  4Y1D A;  4EHT A;  2RPI A;  2NRZ A;  3O4N A;  1NJI O;  3TTF A;  4NLC A;  3DWL A;  4N5S A;  3LM9 A;  4FJH A;  2Q0R A;  5LJV A;  5FPM A;  3LDL A;  5KQ8 A;  3RR8 A;  2NNW A;  3M1F A;  5GAG P;  3P4I A;  1BA0 A;  4CD3 A;  3EL2 A;  3KIO A;  2I5J A;  3MWT A;  1K8A O;  1I94 K;  4IJA A;  1QE1 A;  4JKE A;  5AZI B;  4W5Q A;  4H5W A;  1BIU A;  3OA9 A;  4JEP A;  4QCL A;  1TL1 A;  1BO5 O;  2W41 A;  3ITH A;  2QXL A;  1TKZ A;  2B4J A;  4U67 L;  2P9P B;  1WBD A;  4JKH A;  2IAJ A;  4O8U A;  3MXI A;  2HVH A;  2WTU A;  3VQ8 A;  4CF8 A;  3SUQ A;  1XMQ K;  1NGI A;  1RTD A;  5C2F A;  2UUA K;  2KKZ A;  2FF6 A;  1J53 A;  4JI6 K;  2ATQ A;  3WQU A;  1LWC A;  4WFA L;  4U7B A;  3ZET A;  1VSE A;  4AHR A;  3KTQ A;  4KTQ A;  1A5V A;  5KTQ A;  1YJN N;  4YOV A;  4NCA A;  1IG8 A;  3RWU A;  5KPZ A;  2VGN A;  2E1Z A;  2E2Q A;  3MXJ A;  3DMJ A;  1IKV A;  3AA3 A;  5KGW A;  1RDA A;  1TV6 A;  4F2S A;  5CYM A;  3ZEU B;  5AQT A;  3H6E A;  4FM1 A;  4BQL A;  3HST B;  2OPS A;  3VQ5 A;  3HP9 A;  4DF8 A;  1S1T A;  3TAR A;  2D0P A;  3J7Z O;  1NKC A;  3DRR A;  5CY4 A;  3ZSX A;  4CZG A;  3KJV A;  4C8K A;  3UB5 A;  3LAL A;  3F9M A;  4HTU A;  1N32 K;  1RNH A;  3TSU A;  4BRG A;  1Q8I A;  4IBN A;  4JI1 K;  3LDS A;  1QTM A;  4C23 A;  1TYQ A;  4OKE A;  3MX2 A;  4RTF D;  3T19 A;  3AVJ A;  4E7L A;  1ATN A;  1NGC A;  4OKK A;  3OYF A;  3P83 D;  4DV4 K;  4O0J A;  5HLF A;  3BEX A;  4KH5 A;  3G0Z A;  3HTV A;  5AQZ A;  2WOM A;  4DR1 K;  4O0I A;  3LPU A;  2A1R A;  1S6P A;  4JI2 K;  3UKU A;  5GIN A;  3MMV A;  4JI0 K;  3VQ4 A;  4BY9 C;  3FGU A;  3OYG A;  3SV4 A;  4JNE A;  3K9J A;  3KWI A;  4BDY A;  1TKX A;  5AQJ A;  2OYQ A;  3F73 A;  3OYM A;  4CJU A;  4LY7 A;  1KAY A;  2EWS A;  5KRS A;  5B8H A;  3RMC A;  4Y1C A;  3LAM A;  2FSJ A;  5GIO A;  4JKG A;  5J1E A;  3JAM O;  1CXQ A;  2P9N A;  4JS5 A;  4MO4 A;  3UE5 A;  1RBU A;  4BRN A;  3L2V A;  3O1W A;  3RR7 A;  3BF1 A;  3TAF A;  2A6A A;  1CZB A;  3IG1 A;  3F9K A;  3BGR A;  3O80 A;  3U3G A;  2HHH K;  3A5O C;  3FFK B;  3I33 A;  4I6M A;  4DU3 A;  3KHY A;  4CW7 B;  3MN7 A;  3CMA N;  1U4B A;  4FVU A;  4E7H A;  1ASU A;  5JMV A;  1NK5 A;  4DLG A;  4I7F A;  1QHT A;  4F9O A;  3E9L A;  4Z4E A;  3SQ1 A;  3HRG A;  4FW1 A;  4BVO A;  4OO1 J;  2A1S A;  3CIP A;  5M1F A;  2QKB A;  3L2U A;  3CCS N;  1KAX A;  3VF4 A;  4AHS A;  4BE2 A;  4B9S A;  3CXC M;  3SK3 A;  3THV A;  4GV6 A;  4CGH A;  4XIU A;  3VEV A;  1FKP A;  4HUE A;  1Y64 A;  4CJ5 A;  4ILG B;  2GEM A;  4K25 A;  5AZI A;  1RT7 A;  4DSI A;  4JI7 K;  4YY3 K;  4CZE A;  3K59 A;  3IFR A;  3QET A;  1L3U A;  4HHT A;  4FK0 A;  3ENB A;  1YVN A;  3FZL A;  3O9T A;  1HPM A;  1YVU A;  4FVM A;  3M8R A;  2KQ2 A;  4JKC A;  3KK3 A;  4FJK A;  4Z4F A;  2YI1 A;  1VQ9 N;  3SPY A;  1LOT B;  4CEE A;  3QIC A;  4MDB A;  3IUC A;  4DFP A;  1SKS A;  4DV0 K;  3KKR A;  3HPO A;  3FZH A;  1N36 K;  4Z4G A;  3WNE A;  4CEA A;  1BQN A;  1KXP A;  4H0Y B;  3MN6 A;  4C1N K;  3NVK A;  1ZBU A;  4QAG A;  3SJH A;  3VMF B;  1TL3 A;  4N76 A;  2ZJP L;  4AF1 A;  4BG9 A;  1GLL O;  2HNZ A;  2CH6 A;  3QES A;  2OZM A;  2P9K A;  3HI0 A;  3D2E A;  3O9U A;  3W0L A;  5AFU H;  3D2F A;  1EWQ A;  4H4O A;  4BG8 A;  1VQN N;  3PO4 A;  2IIR A;  4H0O A;  3U9D A;  1TK8 A;  2Z1I A;  4CEZ A;  4CCH A;  4HCB A;  3IS9 A;  1RFQ A;  3OYB A;  1TKD A;  3H3O B;  5C12 A;  2Q3S A;  2AJQ A;  4F8R A;  4KFB A;  4YNQ A;  4B9L A;  4FOE A;  1A5X A;  1EET A;  1Q9Y A;  3P38 A;  4CEO A;  1IBL K;  4M3R A;  1FXX A;  3C6H A;  3CC4 N;  1JLE A;  1NGG A;  3C0B A;  3J81 O;  2O8D A;  1VK0 A;  5JLH A;  4FZY A;  3TU5 A;  3SAF A;  1NBW A;  4Q5V A;  3ZSW A;  3SQ2 A;  4W5T A;  5EX5 A;  4O8K A;  1NOY A;  4B8C A;  1TK0 A;  3VQE A;  4DV2 K;  4JS4 A;  4KH6 A;  1BDG A;  4CHP A;  4CEC A;  3J7A P;  3S41 A;  4CF0 A;  3T1Y K;  3HP6 A;  2P9P A;  4ISF A;  4GV9 A;  2O8E B;  3THW A;  3P1G A;  3NGZ A;  3H45 C;  1BL3 A;  1JLQ A;  4K0K K;  3DLH A;  1VHX A;  1IV0 A;  4DFM A;  1SUQ A;  2DTU A;  1LV5 A;  4KHW A;  1J5O A;  4Q0B A;  4I2P A;  1HKB A;  4FWO A;  3EEQ A;  4RCH A;  3T1H K;  1S9E A;  3VEO A;  4A2B A;  5HRN A;  1N6Q A;  3K57 A;  4KHU A;  3MN5 A;  2UYT A;  3O08 A;  1ZXO A;  2FSK A;  2JWK A;  3HZ6 A;  5FLX O;  1JCG A;  3CQ8 A;  5FPN A;  3KLH A;  5AQV A;  3CJA A;  5M1K A;  1JLG A;  2XY6 A;  3TAE A;  1GLJ O;  1NLV A;  2G8F A;  2B5J A;  4E19 A;  4H0X B;  3VQC A;  4EP4 A;  4CK3 A;  2OPP A;  1KFS A;  2OPQ A;  2YCH A;  1OH5 A;  4RW8 A;  4FJJ A;  4CBU A;  1RBV A;  3O5B A;  1XC3 A;  4DCH A;  1NK8 A;  4IOA L;  3IMX A;  1EXQ A;  4FK2 A;  4A61 A;  1TUY A;  2UUB K;  4MQ3 A;  3CF5 L;  1X3N A;  5AQW A;  3R1X A;  4N56 A;  5LMU K;  2PFU A;  4KHP K;  3CQX A;  3HJF A;  4NXM K;  2UXC K;  3TAG A;  4CIG A;  5M1P A;  1D9D A;  1LCU A;  5SZT A;  5JLF A;  1MWK A;  3CCE N;  2IVN A;  4PWD A;  3IDH A;  4FWN A;  1EWR A;  4W5N A;  5EXW A;  3CI5 A;  1OVY A;  3VQ9 A;  4B8A B;  1RBS A;  3K0S A;  2O4I A;  5F1X A;  1T6C A;  5MLC Q;  4ELT A;  3CM5 A;  4QS9 A;  2P5O A;  3DLE A;  3FZK A;  3L8B A;  1HYS A;  1QQC A;  2KZM A;  5JVH L;  4O44 A;  4NB4 A;  3OYI A;  4CGI A;  1U48 A;  4DSL A;  3CJC A;  5CE3 A;  4IEI A;  3CJ9 A;  3I0R A;  3NF8 A;  1RBT A;  3MWP A;  4YDU A;  4CF2 A;  5F0X A;  2NRH A;  1GOC A;  3QLH A;  3OTO K;  3AO2 A;  4E7I A; 
#chains in the Genus database with same CATH homology
 2Z1H A;  4CJW A;  1QSL A;  5HRP A;  4KPY A;  2ITG A;  5FRM A;  2PY5 A;  1ITG A;  1VSI A;  1U04 A;  1VSK A;  3AVL A;  3NAE A;  1HNI A;  1TK5 A;  2PYJ A;  1L3S A;  4CER A;  1DTQ A;  1XHZ A;  2QK9 A;  3RRG A;  4DTO A;  1NK4 A;  3QEW A;  3T1A A;  3VA0 A;  1BGX T;  2Y1J A;  3HVT A;  1WNS A;  1BQM A;  2IS3 A;  2HHT A;  1T03 A;  3NHG A;  3ZCM A;  3DLR A;  3NCI A;  2VWJ A;  4DQR A;  3OYL A;  1BCM A;  4KAZ A;  1U47 A;  4OPJ A;  2E4L A;  4GVM A;  2VG7 A;  3CG7 A;  4CHZ A;  3OYE A;  1NJY A;  1KRP A;  1LW0 A;  4PQU A;  1JLB A;  2RN2 A;  3ISN C;  1RBR A;  4HVJ A;  3ZSQ A;  4FLZ A;  1KSP A;  4FLW A;  3KK2 A;  4E7J A;  4O5B A;  1JXB A;  4KKO A;  1KLM A;  4CJ3 A;  4Y1D A;  4JRP A;  2RPI A;  3LWL A;  3O4N A;  1D9F A;  4CED A;  3TAM A;  4N5S A;  4FZZ A;  1BIZ A;  1T8E A;  3NH2 A;  3LP2 A;  1N5Y A;  1IG9 A;  3PO5 A;  4DSJ A;  1D5A A;  4CEF A;  4FJH A;  2RF2 A;  4KI4 A;  3V1Q A;  4RG8 A;  3QNO A;  2D0A A;  3AVK A;  4HUG A;  3RR8 A;  4EZ6 A;  3RRH A;  4KHY A;  4DQP A;  1VSH A;  4FJG A;  4DQQ A;  3KIO A;  3OYN A;  5DK5 A;  2I5J A;  4OKJ A;  3G10 A;  1HPZ A;  3AVA A;  2IDO A;  2OZS A;  2XY7 A;  3CFR A;  4LH5 A;  1NJX A;  1C6V A;  2OA8 A;  5JS2 A;  4L8R B;  3VA3 A;  4CJP A;  4B3O A;  3KD5 E;  1QE1 A;  1JL1 A;  5HRO A;  4CHQ A;  3L2R A;  3BDP A;  4EZ9 A;  4KHQ A;  4DF4 A;  4W5Q A;  1BIU A;  4QCL A;  3OYJ A;  2XHB A;  3IAY A;  2XRI A;  4ICL A;  1TL1 A;  1BHL A;  4Z4H A;  3OS2 A;  4DTP A;  1B9F A;  4FLX A;  1Z25 A;  3LWM A;  3AVH A;  3ITH A;  2PZS A;  5C24 A;  1TKZ A;  2B4J A;  4IFY A;  5HRR A;  4CHY A;  2BGG A;  5J2N A;  2X74 A;  4GMJ B;  1ZBI A;  3MEC A;  3UIQ A;  2IAJ A;  3MXI A;  3DLK A;  2HVH A;  4G1Q A;  4FJ5 A;  3VQ8 A;  4CF8 A;  3SUQ A;  1Q9X A;  1JLA A;  1RTD A;  5KI6 A;  1NK9 A;  1TAU A;  4KB0 A;  4M3Y A;  3C94 A;  1DLO A;  2KFZ A;  1J53 A;  4B9U A;  4CFC A;  2ATQ A;  5J2M A;  1LWC A;  1T7P A;  1S6Q A;  5J2Q A;  4N47 A;  1NK6 A;  1VSE A;  4AHR A;  4CFA A;  3KTQ A;  4KTQ A;  1A5V A;  5KTQ A;  4BE1 A;  1BI4 A;  4NCA A;  1BCO A;  3P5J A;  2NUB A;  3RWU A;  2HHX A;  1L5U A;  1QSY A;  4JRQ A;  3MXJ A;  3DMJ A;  1IKV A;  3AA3 A;  2GBZ A;  5DMR A;  1RDA A;  3L3V A;  5KGW A;  3VQ6 A;  1TV6 A;  4CK1 A;  4BDZ A;  2YNI A;  5CYM A;  1UA0 A;  4F2S A;  1J9A A;  3TAN A;  1KTQ A;  3D45 A;  4O4G A;  1XI1 A;  1EP4 A;  4FM1 A;  1WSJ A;  3C95 A;  4E1M A;  3CFO A;  3HST B;  2OPS A;  3VQ5 A;  3HP9 A;  4DF8 A;  4F3T A;  1S1T A;  1C1C A;  3TAR A;  3U3Y A;  3NE6 A;  3RMD A;  2F8T A;  2IOC A;  1U49 A;  4DLE A;  2YNH A;  1NKC A;  4AHU A;  3DRR A;  1DTT A;  4FW2 A;  3OVN A;  5CY4 A;  3ZSX A;  4DG1 A;  3T3F A;  1BIS A;  4IDK A;  4FK4 A;  3KJV A;  4CK2 A;  4C8K A;  3LAL A;  1LAW A;  4HTU A;  1RNH A;  4DTM A;  1NKB A;  4FJI A;  3SYZ A;  1Q8I A;  4IBN A;  2HNY A;  4ZTF A;  3QIO A;  3LDS A;  3LP3 A;  3O3H A;  1QTM A;  3VQA A;  1ZBL A;  4OKE A;  2HHQ A;  1C1B A;  4M3T A;  2YNG A;  3T19 A;  1X9S A;  4E0D A;  3AVJ A;  4E7L A;  1W9H A;  3AVM A;  4HCC A;  3ZSO A;  1LWF A;  1NOZ A;  1TGO A;  2DFH A;  3LPT A;  4OKK A;  3AVI A;  3P83 D;  1WN7 A;  3OYF A;  2X78 A;  4DTN A;  4ELV A;  3DI6 A;  2QKK A;  3O3G A;  4O0J A;  3TAP A;  5HLF A;  5I42 A;  3RMA A;  1CXU A;  5K14 A;  2G8K A;  5HRS A;  2VG5 A;  4CJ4 A;  3G0Z A;  4CGJ A;  2HVI A;  2HND A;  4KTW A;  2WOM A;  4E3S A;  3PX6 A;  3SV3 A;  4O0I A;  4BWM A;  3LPU A;  2A1R A;  4KRF A;  1W0H A;  4LD0 A;  3OYK A;  1S6P A;  1TKT A;  3VQ4 A;  4CJT A;  4M3U A;  3QNN A;  4H8K A;  3QEX A;  1F21 A;  1NK7 A;  3DM2 A;  3IRX A;  3OJU A;  1O1W A;  3HO1 A;  1WSE A;  3OYG A;  4RW9 A;  4CJV A;  3SV4 A;  2HW3 A;  4BDY A;  1UOC A;  4FJ7 A;  1TKX A;  2YKM A;  2OYQ A;  4DSF A;  3AVN A;  4WE1 A;  3F73 A;  1IH7 A;  4FXD A;  3HPG A;  3OS0 A;  4CJU A;  3OYM A;  3D0P A;  1YTA A;  4LY7 A;  3OS1 A;  2PYL A;  2JGU A;  1HYZ A;  1VSL A;  1Z26 A;  4TSX A;  4KHS A;  4ID5 A;  1JLC A;  5EU7 A;  5KRS A;  4W5O A;  4C8L A;  3QEP A;  4QOZ B;  3RMC A;  1NJW A;  1TVR A;  2YV0 X;  3L3U A;  4Y1C A;  3ZSV A;  1SL2 A;  3LAM A;  3VQB A;  4ZHR A;  4DSE A;  4K8X A;  1EKE A;  3ZT0 A;  4CEB A;  4C8N A;  4CJS A;  5J1E A;  4FYD A;  2G8V A;  3ZSR A;  3CYM A;  2JLE A;  1CXQ A;  4DTS A;  3S3M A;  2G8H A;  4JS5 A;  2FC0 A;  1RBU A;  3QEV A;  3V9W A;  4B9M A;  3NFA A;  3L2V A;  3RR7 A;  3QEI A;  2X6N A;  3TAF A;  1CZB A;  3IG1 A;  3F9K A;  3BGR A;  3U3G A;  4CJK A;  4RW6 A;  3I0S A;  2XO7 A;  1IKW A;  1R0A A;  3ASM A;  2YHB A;  2EHG A;  1G15 A;  1RDB A;  1RT3 A;  4DU3 A;  4FJ9 A;  3QO9 A;  3ZT3 A;  1U4B A;  4I2Q A;  3ZSZ A;  4IKF A;  1BI4 B;  4E7H A;  1ASU A;  1NK5 A;  4DLG A;  1XHX A;  1C0U A;  4I7F A;  1QHT A;  3KLG A;  3KK1 A;  3DOK A;  5CZ1 A;  4FLV A;  3AA4 A;  1NJZ A;  3ZT2 A;  4Z4E A;  2R7Y A;  3SQ1 A;  4FW1 A;  1SKW A;  4BAC A;  4FM0 A;  2P1J A;  2Z1J A;  2G8U A;  2A1S A;  3AVF A;  4RW7 A;  4B9V A;  1LAV A;  3L2U A;  4BE2 A;  4AHS A;  3V81 A;  4B9S A;  2DFF A;  2QKB A;  3THV A;  4AHC A;  4KV8 A;  3WNG A;  4CGH A;  3KLE A;  5SWM A;  1HMV A;  1S1W A;  4XIU A;  4KHN A;  1FKP A;  2XY8 A;  4HUE A;  4CJ5 A;  3ULD A;  4DTR A;  4R5P A;  1D8Y A;  3PX0 A;  3S3O A;  3V6D A;  1RT5 A;  4KTZ A;  5CYQ A;  3OYA A;  3KLI A;  1RT7 A;  4DSI A;  3V9Z A;  1X9M A;  3HT3 A;  2HHU A;  1REV A;  3V1O A;  3K59 A;  3QET A;  1L3U A;  4HHT A;  1VSF A;  3SQ4 A;  4FK0 A;  4OLB A;  1S5J A;  4I9Q A;  1IO2 A;  1UWB A;  2BE2 A;  1VRU A;  1YVU A;  2D0C A;  2YKN A;  3KKS A;  4FVM A;  3M8R A;  1RDD A;  2KQ2 A;  1LWE A;  1RIL A;  1MU2 A;  3KK3 A;  1WLJ A;  4FJK A;  4Z4F A;  3AVC A;  2BAN A;  3VN5 A;  3V4I A;  3SPY A;  2YHA A;  3SZ2 A;  1ZBF A;  4E89 A;  4CEE A;  3AVB A;  3QER A;  1C0M A;  1YT3 A;  1FKO A;  2Y1I A;  4LH4 A;  4DFP A;  3AO1 A;  4FJ8 A;  5FRN A;  4DSK A;  1SKS A;  2HMI A;  3LZI A;  4J2B A;  4EP5 A;  4B9T A;  4CJR A;  3KKR A;  3B6O A;  5T7B A;  2KW4 A;  3HPO A;  1QSS A;  3WNE A;  4CEA A;  4F4K A;  1BQN A;  3HVR A;  4Z4G A;  1YTU A;  3K5L A;  4OJR A;  3DLB A;  4CFB A;  3JSM A;  1QS4 A;  3VQD A;  4FJM A;  3NDK A;  5JS1 A;  3RMB A;  1ZBU A;  4QAG A;  5D3G A;  4J2E A;  1TL3 A;  4N76 A;  4M3W A;  1RT6 A;  1S1X A;  4DU1 A;  4IG0 A;  4CEQ A;  4GW6 A;  4JLH A;  2HNZ A;  3QES A;  3VQP A;  1RT4 A;  4ZTJ A;  2OZM A;  3SJJ A;  4PA1 A;  1WSG A;  3I8D A;  1UA1 A;  2FBV A;  4CF9 A;  3DRP A;  3OYH A;  3M8P A;  1NKE A;  3WNH A;  4CHO A;  1JXE A;  2HHS A;  4H4O A;  4M3Z A;  3AA5 X;  3PO4 A;  1TK8 A;  4KI6 A;  2Z1I A;  3NH1 A;  4CEZ A;  4CCH A;  4HCB A;  3IS9 A;  4AH9 A;  3M8Q A;  3OY9 A;  4C8O A;  4F3O A;  3OYB A;  1TKD A;  4Z0U A;  3K58 A;  4AHT A;  2EX3 A;  4DTU A;  2Q3S A;  2AJQ A;  4F8R A;  2VG6 A;  4KFB A;  4DMN A;  4YNQ A;  3DLG A;  3TWH A;  4FLT A;  4BDP A;  4B9L A;  3TI0 A;  1A5X A;  1X1P A;  1EET A;  1SV5 A;  1Q9Y A;  4M42 A;  3DRS A;  4CEO A;  4KB1 A;  3CFP A;  2YNF A;  4FJL A;  1ASV A;  4CHN A;  4M3R A;  1FXX A;  3K2P A;  2ZQB A;  3PX4 A;  1JLE A;  1XC9 A;  1WAJ A;  3V9X A;  3L2W A;  1L3T A;  4NCB A;  3OYD A;  1KVB A;  5I3U A;  2IGI A;  5C42 A;  4LSL A;  1VK0 A;  4FZY A;  1IKX A;  1S1U A;  2ZD1 A;  2FBY A;  1IKY A;  1WAF A;  1KCF A;  3L2Q A;  1RDC A;  4RW4 A;  4Q5V A;  3ZSW A;  3SQ2 A;  3NGI A;  3HK2 A;  3B6P A;  4W5T A;  3FFI A;  4CIE A;  3K5M A;  2O4G A;  4YFU A;  2P51 A;  4C8M A;  1NOY A;  3K5N A;  3TR8 A;  4OGE A;  1L3V A;  4B8C A;  1TK0 A;  2G8I A;  3A2F A;  3VQE A;  1SL1 A;  1EX4 A;  4JS4 A;  2FBT A;  3HYF A;  4DTJ A;  3EZ5 A;  4CHP A;  2IC3 A;  4CEC A;  4E7K A;  3SPZ A;  4Z4C A;  4CF0 A;  1X9W A;  5J2P A;  3HP6 A;  3NF7 A;  1JKH A;  1KVC A;  4CJE A;  3LAN A;  3P1G A;  3NGZ A;  1CLQ A;  1Y97 A;  5KGX A;  3KD1 E;  4K8Z A;  1BL3 A;  1JLQ A;  1RCH A;  3VQ7 A;  3DLH A;  2F8S A;  4DFM A;  1SUQ A;  3MED A;  3HXM A;  2DTU A;  3NF6 A;  1LV5 A;  1C1A A;  4KHW A;  1J5O A;  4Q0B A;  3AO5 A;  4I2P A;  2G8W A;  4CES A;  1LW2 A;  2ETJ A;  3MEG A;  3OYC A;  1KFD A;  2E6M A;  4DFJ A;  4FLU A;  1S9E A;  3O4Q A;  4CJL A;  1UAX A;  1B9D A;  1VSM A;  4AHV A;  2D5R A;  1RTI A;  2P5G A;  5HRN A;  3ZSY A;  1N6Q A;  1VSJ A;  3K57 A;  4KHU A;  3OJS A;  2LSN A;  2RKI A;  4DQS A;  4DTX A;  4IFV A;  3SI6 A;  1SL0 A;  2XY5 A;  1ZBH A;  3S3N A;  4DS5 A;  4CGF A;  2WON A;  4CJQ A;  3LP1 A;  3LZJ A;  3CQ8 A;  3KLH A;  4E1N A;  4KO0 A;  4UQG A;  1JLG A;  3AA2 A;  5FRO A;  4FM2 A;  3SUP A;  3V9S A;  5HBM A;  2XY6 A;  3TAE A;  1HNV A;  3C6U A;  4OPK A;  2BDP A;  4DQI A;  2G8F A;  2B5J A;  4E19 A;  2KTQ A;  3VQC A;  4EP4 A;  1J54 A;  4CK3 A;  1SKR A;  1GOB A;  3HPH A;  2OPP A;  4CF1 A;  2Z1G A;  4N41 A;  4M45 A;  1KFS A;  2X6S A;  2GUI A;  2OPQ A;  3WNF A;  4RW8 A;  1C0T A;  4DS4 A;  4DFK A;  4FJJ A;  4J2D A;  3QIN A;  1RBV A;  1WSF A;  3LP0 A;  1T05 A;  3NBP A;  2DFE A;  4LSN A;  3SQ0 A;  5CZ2 A;  3QIP A;  4CGG A;  1NK8 A;  3TAB A;  3V1R A;  1EXQ A;  4IG3 A;  2W42 A;  4FK2 A;  2HHV A;  3NGY A;  4NYF A;  1A5W A;  3AV9 A;  2DY4 A;  1XWL A;  1ZYQ A;  4FJX A;  4MQ3 A;  3SCX A;  4CIF A;  3JYT A;  2ZE2 A;  3AVG A;  3E01 A;  3O3F A;  2HB5 A;  5C25 A;  3MXM A;  4N56 A;  3M8S A;  1KVA A;  2OPR A;  3HM9 A;  4CJF A;  5E41 A;  3HJF A;  1S9G A;  3ALY A;  3TAG A;  4CIG A;  3SUO A;  1RTH A;  1GOA A;  4CFD A;  5KRT A;  4H4M A;  4FCY A;  3SUN A;  1HJR A;  1VSD A;  3EY1 A;  1D9D A;  3MEE A;  4BE0 A;  3PV8 A;  4ID1 A;  1NK0 A;  5SZT A;  3TAQ A;  4ELU A;  5HP1 A;  2D0B A;  4B08 A;  4PUO A;  3NH0 A;  2HHW A;  1ASW A;  3VQQ A;  4M41 A;  4PWD A;  4KRE A;  3HL8 A;  4FJN A;  2B6A A;  4W5N A;  4B9N A;  1JL2 A;  3ZT4 A;  4OLA A;  1I3A A;  1I39 A;  3LAK A;  4CE9 A;  4CGD A;  4OGC A;  4BWJ A;  2KFN A;  1WSH A;  1B92 A;  2GV9 A;  3U6F A;  2F96 A;  3VQ9 A;  4B8A B;  1RT1 A;  4W5R A;  1RBS A;  1FK9 A;  4NCG A;  3MAQ A;  3V9U A;  2O4I A;  2KZZ A;  3AO4 A;  2E6L A;  4ELT A;  3CM6 A;  3PY8 A;  1CZ9 A;  3CM5 A;  3C6T A;  2P5O A;  1S1V A;  1WSI A;  3DLE A;  3L8B A;  1HYS A;  1HYV A;  4O55 A;  4AIL C;  3RTV A;  1QQC A;  4F2R A;  4FZX C;  4M3X A;  4Z4I A;  3DOL A;  2KZM A;  4O44 A;  3AO3 A;  3OYI A;  3K5O A;  4CGI A;  1HQE A;  1K6Y A;  2QXF A;  4I9L A;  4MFB A;  4FLY A;  1U48 A;  3DYA A;  4DSL A;  4PY5 A;  4DWI A;  1U45 A;  1HQU A;  3I0R A;  1RTJ A;  3S9H A;  1VRT A;  3NF8 A;  3ZT1 A;  1RBT A;  3KLF A;  4CF2 A;  3SNN A;  3PUF A;  4DU4 A;  1KLN A;  4NYN A;  1GOC A;  1TAQ A;  1JLF A;  3NF9 A;  4HUF A;  1RT2 A;  3EYZ A;  2VWK A;  3QLH A;  4J2A A;  2FBX A;  3H08 A;  5FDL A;  4OVL A;  1HRH A;  3AO2 A;  4E7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...