3VQEA

Hiv-1 in core domain in complex with [1-(4-fluorophenyl)-5-methyl-1h-pyrazol-4-yl]methanol
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
136
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 49
structure length 136
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqeA00
2E4LA 1EX4A 3C95A 3O4QA 1RDCA 3B6OA 4IG0A 1L3TA 4CF0A 3HXMA 4N56A 3SUOA 4E1NA 3OYLA 3DLBA 4FVMA 1WSIA 4CF8A 1S6QA 3OYAA 3EY1A 4ID1A 4OJRA 3V6DA 4DTNA 3VA0A 3TAGA 1RT6A 3TAFA 1IKVA 4H4MA 3ZT3A 5FRMA 2HHUA 2FBXA 3BDPA 4DU1A 3DI6A 3MXJA 3OYFA 3L2WA 3V1QA 4FLWA 3LALA 1J5OA 1S1UA 3ULDA 2DTUA 2D5RA 3OYCA 2DY4A 1CZ9A 4DS5A 2YNGA 4W5NA 3DLRA 4O44A 4BE2A 2OZSA 1XWLA 3K5LA 4JS5A 4CIFA 4K8ZA 5C42A 1BHLA 2Z1GA 4CJEA 2G8UA 3TWHA 1VSDA 4EZ6A 4FZZA 2XY7A 3AA4A 3V9SA 2D0BA 3NH2A 2YNFA 1SKRA 3AVJA 4QCLA 3KKRA 1TVRA 3P1GA 3S3NA 1VSEA 1RDBA 4KHWA 3S9HA 1WSFA 4W5QA 3F73A 1WAJA 4LH5A 3NF9A 4KHYA 4PA1A 3LWLA 1ZBUA 2DFHA 3O3HA 1GOCA 1L5UA 1BGXT 1JLEA 4FYDA 3CFPA 4FJXA 1W0HA 1D9FA 3SQ1A 1YT3A 3VQ7A 3ZSOA 4FJLA 3MXMA 4BWMA 1LW0A 1VSMA 2IS3A 1BI4B 3VQAA 4B08A 2EX3A 3DOKA 4J2EA 4N76A 1CLQA 2E6MA 1TL3A 5KGWA 2Z1HA 4CF9A 2JLEA 1A5WA 1TKXA 2FBYA 3MAQA 1KCFA 1VK0A 1RT1A 1C0UA 4CJ5A 3VQCA 4CJTA 3NGIA 2Y1JA 2OPRA 1SUQA 3LP0A 4CJFA 4CJSA 2HHTA 1WSEA 4E1MA 3OYDA 3RRHA 4DF8A 3QERA 3C6TA 4CJ3A 4J2BA 1HQEA 1VSIA 3OYMA 4DSEA 4Y1DA 5J2PA 1KLMA 1VSKA 1BISA 4E19A 3QETA 3RMBA 1QSLA 4F2RA 3CYMA 1CXUA 3LP1A 1C0TA 3D45A 1I3AA 1BIZA 1QS4A 3P83D 4CEOA 4CJVA 4N47A 4EP5A 4DFMA 2A1RA 4IKFA 4W5TA 4KHNA 3AVLA 2G8IA 1HYSA 3U3GA 1LAWA 3M8RA 2G8FA 1TKDA 4E0DA 4BDZA 4JRQA 4KAZA 2HVIA 2WONA 4RW6A 3NFAA 3THVA 1VSLA 1T05A 3TI0A 2PYJA 3VA3A 4O55A 1YTAA 3DLGA 4GW6A 4C8KA 1ASWA 1NKEA 4FJKA 4NYFA 3O3FA 3K2PA 3FFIA 4DS4A 3QEPA 2HVHA 2XHBA 4LH4A 1VRTA 1TAQA 2YNIA 4M3WA 4DTMA 4CFAA 1S1XA 3ASMA 2YNHA 3V9WA 2HHVA 4DWIA 4FJIA 4DQPA 4CJLA 1B9FA 3NH0A 2R7YA 4CJKA 1U49A 1HJRA 5DMRA 4OLAA 1JXEA 1Q8IA 3VQ4A 3MECA 3HM9A 4FLVA 3V81A 3TAEA 4O0JA 4DSIA 4F3TA 4I9LA 2FBTA 3QNOA 4KB1A 3AVMA 3K59A 2HNYA 1TKZA 3SUPA 1QE1A 4MQ3A 3SZ2A 2IOCA 4KFBA 4ELTA 3UIQA 4DTJA 2Z1JA 4I7FA 2KQ2A 1X9MA 3KLIA 1KVBA 3TARA 3SNNA 2IGIA 4JLHA 4DU3A 3WNEA 5I3UA 4C8OA 5CZ1A 4E3SA 4DG1A 3CFRA 4E7JA 3OYKA 1SL2A 4B9VA 3ITHA 3SUNA 1UOCA 4LSLA 3HP6A 1C1CA 1RTDA 1KTQA 4FJ5A 3RMDA 3RR7A 3QEXA 3OYHA 4FLTA 3HP9A 4CF2A 4RW7A 4E7HA 1GOBA 5DK5A 1BCOA 1QHTA 2YHBA 3OYIA 5HRPA 4HUGA 3L3UA 1XHZA 3T19A 3H08A 5JS1A 4Q0BA 1NJYA 3SV3A 1L3UA 4E89A 3VQDA 3AO1A 3VQEA 1ZBIA 3IRXA 2X6NA 4QOZB 4HVJA 3EZ5A 3AVAA 4CFBA 2HHSA 2FBVA 4DMNA 3NDKA 4FCYA 1HYVA 4CHZA 2I5JA 4M3ZA 3HO1A 1S5JA 4IG3A 3S3OA 3M8PA 4DQIA 3M8QA 4M42A 4IBNA 1RILA 3OS2A 4KHQA 4W5OA 1U48A 4HUFA 2XY8A 1NK8A 2IC3A 3DRRA 4DTUA 3DOLA 1NJWA 4DSLA 2KTQA 4ID5A 1ASUA 4FK0A 4CJUA 5KGXA 4DTXA 5HLFA 2XY5A 4ZTFA 3LZJA 3C94A 2HHWA 1TGOA 5EU7A 3AA2A 4DSKA 4CHYA 1LWEA 3SPZA 1VSFA 3HVTA 4B9UA 1T7PA 3AO2A 3WNFA 3SQ4A 1RTIA 4UQGA 2P5OA 4PUOA 1BCMA 3OS1A 5D3GA 1N6QA 3HT3A 4HCBA 1SKSA 4I9QA 4Z4EA 2HW3A 3QINA 4FJMA 2IDOA 1IKWA 3ZT0A 4BDYA 1SV5A 1RBVA 2DFEA 1FK9A 3VQ8A 3HYFA 1JLQA 3QIPA 1ZBLA 4LSNA 1Q9XA 4Z4FA 1BL3A 4DTSA 4Z4GA 1RNHA 1QQCA 1BIUA 1RCHA 3LP3A 5HRRA 3SYZA 2G8VA 1HYZA 3SCXA 1C0MA 3SPYA 5JS2A 3TAQA 1A5VA 4DTPA 2BE2A 4CFDA 5HRNA 1RT5A 3WNHA 4RW9A 1LV5A 3OYGA 4FJ8A 4FLXA 1XHXA 4B8AB 4OVLA 4RW8A 3ZSRA 1QSSA 3OVNA 4AHVA 1QSYA 5CY4A 3RWUA 5K14A 4FJHA 3KK1A 1WSJA 1I39A 3AO5A 2OPSA 1JL1A 2PZSA 4FJ7A 1KLNA 1HNVA 2O4GA 3CM5A 3S3MA 4KTWA 1REVA 1ZYQA 4OKKA 3QO9A 1KVCA 3O3GA 2P1JA 4M3XA 3HK2A 5HRSA 3ISNC 2GUIA 3AVKA 4QAGA 3KLFA 2XO7A 5T7BA 3JSMA 1Z26A 1UA0A 1TL1A 2OPQA 4IDKA 4OGCA 4CIEA 3OS0A 1R0AA 3PY8A 4ELUA 3V9XA 2GV9A 1JLFA 3MXIA 1U4BA 1EKEA 3AA3A 2BDPA 4J2DA 4FJ9A 3K58A 4FLUA 3L8BA 2KZMA 2YV0X 4FLZA 2KW4A 5KRSA 3KLHA 4KRFA 1LW2A 4OKEA 4AHUA 3RR8A 1WSHA 4JRPA 4NCBA 4LY7A 4KI6A 1Z25A 3SQ0A 3D0PA 3M8SA 3QESA 1NK6A 3LP2A 2Y1IA 2YKMA 3VQBA 4CK3A 3EYZA 3B6PA 4OGEA 1U04A 4E7LA 3HJFA 4HCCA 3SUQA 4EP4A 3VQPA 1RBTA 4FJJA 1XI1A 3AVCA 4RW4A 1RBSA 2RKIA 3DRSA 4CJ4A 1JKHA 4ZHRA 3SQ2A 3T3FA 1L3SA 4CHPA 3HPHA 4M41A 4IFVA 1QTMA 1JXBA 2D0AA 5J2QA 2EHGA 2VG5A 3VN5A 1KFSA 4MFBA 4GMJB 1RT3A 4M3YA 3PX6A 4DFPA 4N5SA 1G15A 4J2AA 4AILC 3V9UA 3V1OA 3ZSVA 1WNSA 2NUBA 4O0IA 4ELVA 5CYMA 3ZSXA 2ETJA 1A5XA 1TAUA 1B92A 1FKOA 3E01A 5C25A 1TK5A 4O5BA 4DFKA 4FZXC 1DTQA 5CYQA 5FDLA 4CEAA 4ZTJA 4C8MA 1SL1A 1NK9A 1D9DA 4PQUA 3NE6A 4K8XA 1VRUA 3LZIA 2KZZA 4N41A 1UAXA 3KD5E 3A2FA 1S9EA 3PX0A 1XC9A 3LWMA 5J1EA 3NBPA 4Z4IA 1RBRA 1RTHA 4KO0A 3L2QA 4EZ9A 4KTZA 1KVAA 3T1AA 1NKBA 3ZT2A 2B5JA 3AVFA 3TAPA 1VSHA 4FM2A 2RN2A 3NF8A 1B9DA 2X74A 3LAMA 4NCGA 4CHNA 4O4GA 3NF7A 4AHCA 4DU4A 2OA8A 3KK3A 4M3UA 4CEDA 2KFZA 1JL2A 4Q5VA 4CFCA 3NHGA 1T03A 2G8KA 4DF4A 1NKCA 1TK8A 5FROA 2P5GA 2QXFA 2RPIA 3QLHA 3VQ9A 4W5RA 1NK7A 4YNQA 4CGFA 5HBMA 4CHQA 5KRTA 4F3OA 4KI4A 4PY5A 2VWJA 3CFOA 1YTUA 2DFFA 1DTTA 2Z1IA 3CM6A 3TANA 1S1WA 3KIOA 3MEGA 3C6UA 3AO4A 3RMAA 1JLGA 1NOZA 2VWKA 4HHTA 3O4NA 3RMCA 1U45A 3V9ZA 4DLEA 4CJQA 2LSNA 4FJNA 2F96A 2RF2A 1RT7A 3ZSZA 5I42A 4CGJA 1SKWA 4YFUA 4JS4A 4HTUA 3P5JA 3QEVA 4OPKA 1KRPA 3KD1E 4E7IA 4CCHA 2G8WA 3L2UA 4OKJA 3HL8A 3AVIA 5KI6A 4E7KA 1K6YA 3L3VA 4CHOA 3MEDA 3LAKA 4M3TA 3MEEA 1C6VA 1RBUA 2ATQA 2G8HA 2F8SA 3DM2A 4GVMA 4H4OA 4B8CA 4CEEA 3KLGA 4F2SA 3TABA 4CGDA 1WN7A 3DMJA 3LPUA 5C24A 5HP1A 4LD0A 4CGIA 4AHSA 1KSPA 1IH7A 4I2QA 3KK2A 4BE0A 2HHXA 2FC0A 5J2MA 3PO4A 3SI6A 1IG9A 3BGRA 3OY9A 2HNDA 3HVRA 1F21A 1C1AA 2B4JA 1SL0A 1BQMA 1WSGA 4M3RA 3ZSYA 1HMVA 1UA1A 4DQRA 3AV9A 3KLEA 3TAMA 2ZE2A 3NH1A 3ZSQA 3PO5A 4NYNA 3U3YA 4RG8A 4XIUA 4DQSA 3DYAA 3L2RA 4CEBA 2ITGA 2BGGA 3IS9A 4WE1A 4CGGA 1S6PA 2IAJA 4FM0A 1GOAA 4BDPA 5SWMA 1NK5A 1CXQA 4CECA 2HB5A 4FK2A 3ZT4A 3QEWA 3NGZA 3OYBA 3PV8A 1D5AA 3AVBA 2PY5A 1JLCA 3AVHA 3DRPA 1FKPA 3CG7A 3K5OA 5CZ2A 1C1BA 1X1PA 4CK1A 2WOMA 1WLJA 3VQ6A 4OPJA 3JYTA 3I0RA 4KPYA 4CEZA 4PWDA 1X9SA 5HROA 2BANA 1NK4A 1D8YA 1RDDA 1NK0A 1HQUA 2JGUA 2OPPA 4CESA 4NCAA 4I2PA 4FM1A 4CEFA 4OLBA 4KTQA 1U47A 4BE1A 1VSJA 4TSXA 3WNGA 3CQ8A 1KFDA 4IFYA 4R5PA 2O4IA 1EETA 4FW1A 1ZBHA 2X6SA 1JLAA 1IKYA 1HNIA 4CJRA 1Y97A 4DSJA 4B3OA 3AO3A 4CK2A 3HSTB 5KTQA 3OYJA 4B9TA 4FXDA 4F4KA 3TR8A 4G1QA 2AJQA 5SZTA 5FRNA 1EP4A 2D0CA 2X78A 3KKSA 4B9SA 1BQNA 4CEQA 4AHTA 4BACA 4DTOA 4CJPA 4CF1A 1ASVA 1N5YA 1ITGA 1FXXA 3NAEA 2E6LA 3G0ZA 1X9WA 3NGYA 4B9NA 1NJXA 3NCIA 3ALYA 4ICLA 1LAVA 1W9HA 2YHAA 2ZD1A 3AVNA 2XY6A 2F8TA 3K5MA 3QIOA 4DSFA 4KHUA 4KREA 1JLBA 1DLOA 1HRHA 3OYNA 4FZYA 3KTQA 2HNZA 3K5NA 1TK0A 2GBZA 4C8NA 3AVGA 4M45A 4CE9A 2KFNA 2QKBA 3PUFA 4H8KA 4B9MA 3QEIA 3PX4A 2VG7A 4Z4HA 3DLKA 1NJZA 3I0SA 1TV6A 2HMIA 3ZSWA 1MU2A 4Y1CA 3RTVA 1J53A 4FLYA 3VQ5A 2Q3SA 3RRGA 2OYQA 1ZBFA 3IG1A 3VQQA 3LANA 3OJUA 4KKOA 3QNNA 2W42A 1IKXA 1RT2A 2P51A 1IO2A 1BI4A 4CJWA 1NOYA 4KHSA 3KJVA 4AH9A 3L2VA 3LPTA 3ZCMA 3OJSA 4CGHA 1RDAA 4FW2A 3LDSA 5J2NA 4AHRA 5E41A 3OYEA 1LWCA 2A1SA 2XRIA 3V1RA 1J54A 1Q9YA 2B6AA 4FJGA 4HUEA 3SJJA 4FK4A 4CIGA 2VG6A 4KB0A 1LWFA 3I8DA 4DQQA 1O1WA 4DLGA 3AA5X 4Z4CA 3NF6A 1RT4A 1S1TA 1TKTA 1S9GA 3HPGA 2PYLA 3HPOA 2QKKA 2HHQA 4CERA 1CZBA 3V4IA 4B9LA 4Z0UA 1T8EA 1HPZA 3F9KA 3ZT1A 1YVUA 3DLHA 2OZMA 3IAYA 1L3VA 3SV4A 4DTRA 3U6FA 4KV8A 1J9AA 1S1VA 3G10A 4BWJA 4DFJA 2QK9A 1UWBA 4L8RB 2YKNA 4C8LA 1RTJA 3DLEA 4F8RA 2ZQBA 1EXQA 1WAFA 3K57A
chains in the Genus database with same CATH superfamily
1L3TA 3B6OA 3BZKA 4N56A 3P38A 3OYLA 3DLBA 1WSIA 4ISFA 3EY1A 4V19S 2WTUA 4DTNA 3FZKA 3VEYA 3J8AA 3M3ZA 4JKEA 3J7AP 2HHUA 3BF3A 3OYFA 3L2WA 5LMNK 1MWMA 3ULDA 4JI4K 1YI2N 3OYCA 1CZ9A 2YNGA 2OZSA 2O8FB 3K5LA 1BHLA 2G8UA 4FZZA 1VSDA 2XY7A 3AA4A 2D0BA 2YNFA 4QCLA 1TVRA 3P1GA 4CZJA 1VSEA 4BQZA 4EAHD 4MDAA 3S9HA 1WSFA 3DXKB 4W5QA 3CCUN 3LDQA 3W3DA 1GOCA 1HKCA 4FJXA 1D9FA 3VQ7A 4FJLA 1LW0A 1VSMA 4N76A 3VQAA 2EX3A 3DOKA 1CLQA 2ZGZA 3I8BA 1DT9A 2JLEA 3MMVA 3MAQA 1JCGA 2Y1JA 4BVOA 4CJSA 4CJ3A 4JKGB 1X3NA 1VSIA 1TUUA 4X64K 1VQLN 5J2PA 1BISA 4E19A 4Z94A 3QETA 2YCHA 4B1VA 5KQDA 3CJCA 3LDLA 4DFMA 4EP5A 2A1RA 4K25A 1P8ZA 4W5TA 3PSIA 1TKDA 4E0DA 4FOIA 4KAZA 5LL6Z 1T05A 3TI0A 4O55A 3DLGA 4C8KA 4WQ4C 2D1KA 1VRTA 4IO9L 4CFAA 3V9WA 4FJIA 4A5AA 5C15A 4DHYA 2P9PB 4CJKA 1Q8IA 4DUZK 2QTDA 4H03B 5C12A 3HM9A 4DR6K 4F3TA 4B1XB 2A3ZA 3AVMA 3K59A 2HNYA 4BRIA 3CXCM 1XQSC 5BRHA 4I7FA 1VQ7N 2Q36A 1KVBA 3CC4N 2IGIA 4DU3A 4C8OA 4E3SA 3CFRA 1SL2A 3OYKA 1IBLK 3ITHA 1UOCA 3S41A 3HP6A 4FJ5A 3HP9A 4E7HA 5DK5A 1QHTA 3I33A 2YHBA 1XHZA 2FSKA 3L3UA 2YHXA 3FZHA 3IRXA 2X6NA 3OTOK 3CCEN 4QOZB 4HVJA 4YOVA 4DMNA 3NDKA 4FCYA 2E8AA 1ZC6A 3A5LC 4A61A 2E2NA 4IO8A 3M8QA 4M42A 1NGEA 3G4SN 2IC3A 5AZJB 4HWIA 2HF4A 4FK0A 4DUYK 4DTXA 4UY8O 3CC7N 3OW2M 5BN9A 2XY5A 4ZTFA 2I7PA 4AM7A 4CHYA 2VGMA 1VSFA 3SPZA 3WNFA 1MA9B 1BCMA 5M1NA 3HT3A 4I9QA 1G99A 4FJMA 5DM7L 1VQPN 1SV5A 1RBVA 1VQ9N 2DFEA 3ZX3A 4IOAL 2P9KA 1JLQA 3QIPA 4Z4FA 4CZIA 3LP3A 1QQCA 1RCHA 2O8FA 5JS2A 3TAQA 1A5VA 4DTPA 5GAHP 2IVNA 3OYGA 4FJ8A 1RDUA 4M7YA 4NO7A 1V4SA 3RWUA 2P9UB 4FJHA 3FLCO 3P39A 4CZFA 1KLNA 3CM5A 4KTWA 1ZYQA 2OANA 3HK2A 3VGKA 2BTFA 3ISNC 2GUIA 3AVKA 3KLFA 5T7BA 3JSMA 1HNWK 1TL1A 2EWSA 3H3NO 4CIEA 3OS0A 3FFKB 4BGBA 3MXIA 1YAGA 3K58A 4KH4A 4MLHA 1EWRA 3AY9A 1VAZA 4AHUA 1GLFO 4IXCA 1Z25A 2KHOA 1NK6A 3AGRA 3VQBA 4WQ4A 4OGEA 4O5FA 4E7LA 3HJFA 4EP4A 1RBTA 1RBSA 4YOWA 1JCEA 4U7BA 3T1HK 2P9NB 2VG5A 1SQKA 3NMUA 4MFBA 1RT3A 4M3YA 4AF1A 4NB4A 5EVZA 3VEVA 4AILC 4ELVA 1A5XA 4H5RA 4IJNA 1B92A 4IWVA 1TK5A 5CYQA 3GDQA 4PQUA 4BREA 4K8XA 2KZZA 1UAXA 3JXUA 1S9EA 4X65K 3UKRB 1BA0A 4EZ9A 2B5JA 3PIOL 1C0FA 4NLCA 3TAPA 4FM2A 2RN2A 3NF8A 2PBDA 3RSEA 4BRNA 3D6RA 4BG8A 4BC2A 1WB9A 4M3UA 4NXNK 3NHGA 3DJCA 5FROA 4A57A 1Q18A 3SLCA 1YIJN 1IJJA 3CQYA 2H3GX 1T6DA 4PY5A 4XH5A 3MDQA 3G25A 4YOTA 3CM6A 1S1WA 5LJVA 3MEGA 3CPWM 2VWKA 4HHTA 4CJQA 2LSNA 4FJNA 2P9IB 2F96A 2RF2A 3VERA 3LDNA 4OPKA 1KRPA 5BPLA 4CCHA 3HL8A 5KI6A 1K6YA 4JI2K 3MEEA 3PLAA 2ATQA 4H4OA 3WXLA 4BC5A 3TABA 4CGDA 1WN7A 4FOEA 5C24A 5HP1A 4LD0A 4JI3K 4JAXA 3VESA 1IH7A 3THXA 2FC0A 2HHXA 3PO4A 3D2FA 3OY9A 4IEIA 1F21A 1C1AA 5TKWA 4M3RA 1EWQA 3Q7CA 4XIUA 4DQSA 3DXMA 4CEBA 1NGCA 4FWMA 1S6PA 1IV0A 1NK5A 4CECA 3OYBA 3PV8A 1V4TA 3K5OA 2HBJA 3VA0A 3JYTA 3TAGA 1X1PA 4O8UA 1WLJA 1IBMK 1RDDA 4H0PA 4BC4A 2OPPA 4CBUA 5KQ8A 4I2PA 4DV4K 4NCAA 4BE1A 4FVUA 3WNGA 5JMVA 1KFDA 4FW1A 1NWKA 3WXKA 3CCJN 1JLAA 1HNIA 4OPHA 3HSTB 4FWRA 3R6MA 3KKSA 2BH1A 1BQNA 3D7EO 1N33K 3CERA 2E6LA 1YJNN 4B9NA 3TSUA 4H0YB 5AQRA 3CCVN 1RDWX 3KTQA 1TK0A 3SMSA 3AVGA 4M45A 3DXKA 3PUFA 1QQNA 2VG7A 3PX4A 5AQVA 3RTVA 4FLYA 3VQ5A 1LOTB 3OJUA 3CHWA 1WBBA 2YJFA 3KJVA 3CETA 3PSFA 4FW2A 1LWCA 3VEWA 2B6AA 3G71N 3MN7A 1QQOA 4FK4A 2O8BB 3KWGA 3AA5X 4Z4CA 3RSEB 1S1TA 2PYLA 3HPOA 2QWMA 1XUPO 2P9PA 2QA4N 2QKKA 1CZBA 4JN4A 3I56N 1KD1O 1T8EA 1OVQA 2WBNA 2HBMA 1VQNN 2O8DB 1L3VA 3U6FA 1NM1A 2D4WA 1GLLO 1ZBSA 1RTJA 3UKUA 1EXQA 3C6TA 4EIAA 3K57A 2E4LA 5DM6L 4IG0A 3HXMA 3SUOA 5GAEP 3R8EA 4CZLA 2P9IA 2Q1NA 3J81O 1RT6A 3TAFA 1BOTO 4H4MA 3ZT3A 5FRMA 3K0SA 5LMUK 4DU1A 1OVYA 4MO5A 3LALA 1J5OA 4BR2A 1S1UA 2NLXA 4W5NA 4O44A 4BE2A 3LDOA 3TWHA 3BP8A 3JS6A 3AVJA 4KHWA 2HHHK 5HL7L 2F9TA 4FO0A 4KHYA 1ZBUA 2DFHA 3O3HA 1BGXT 1JLEA 2YJEA 4H0XB 2Q0RA 3QB0A 3SQ1A 1GLBG 2E6MA 1TL3A 2Z1HA 3C7NB 1A5WA 1NBWA 5AQHA 1KCFA 1VK0A 4LF9K 4CJTA 2OPRA 4CD3A 1SUQA 3LP0A 3W0LA 4DR1K 2D0OA 1RFQA 3VF2A 4J2BA 3OYMA 4DSEA 3EE9A 1VSKA 1QSLA 3THWB 1C0TA 3MK6A 2E1ZA 1QS4A 2KZMA 1NGAA 1LAWA 1BA1A 4BDZA 5KPTA 3H45C 3CJ9A 5M1KA 1NGJA 3BUZB 1BO5O 2VWBA 2IIRA 5F1XA 5JLFA 3DLLL 1XNRK 2HSTA 3K2PA 2XHBA 4LH4A 1TAQA 3C6HA 2QWRA 2P9LA 3NVKA 3SBTA 3ASMA 2YNHA 1OKJA 3FZLA 4DQPA 4JKHA 4CZKA 3EE8A 3KWIA 3NH0A 1JXEA 3V81A 4I9LA 3QNOA 1TKZA 1N34K 2IOCA 3QMLA 2Z1JA 3L4QA 2KQ2A 1X9MA 3CJ7A 2UXDK 4DG1A 4E7JA 4B9VA 1YUWA 4ISEA 3SBGA 1LCUA 2QW9A 4H5VA 1HKBA 2V7YA 4Q0BA 3EEQA 2FF6A 4XH1A 5JVHL 1T44A 3EZ5A 3AVAA 3DAWA 4CHZA 4M3ZA 4IG3A 3M8PA 3HTVA 5C2FA 5AQQA 3ATUA 4WQ5C 3AARA 3OS2A 1HUXA 4HUFA 3HOTA 1NK8A 4DSLA 4QS9A 5EU7A 1LWEA 3M6GA 1RTIA 4UQGA 4PUOA 5D3GA 1SKSA 4Z4EA 3MCAB 1IKWA 4JD2B 4YORA 3VMFB 1U2VA 1FK9A 3VQ8A 3UKRA 1OH6A 3SYZA 2G8VA 3SCXA 3SPYA 3ID6A 2BE2A 1GLJO 2P9NA 3AGKA 4FLXA 3BF1A 3HI0A 1QSYA 4BRFA 3VF6A 5CY4A 3THYB 3J7YP 3KK1A 1I39A 3AO5A 4M63C 1XMQK 1HNVA 1K73O 4JI8K 1VQ4N 4OKKA 1NMNA 4QAGA 3CQXA 1Z26A 2IVOA 1UA0A 2HBKA 3WQTA 1U4BA 4J2DA 3AA3A 4FLUA 3L8BA 2HBLA 4DR5K 4KRFA 1LW2A 3RR8A 4FWNA 3THWA 4DCHA 3D0PA 3QESA 2Y1IA 1SAZA 3O80A 4CK3A 1U04A 3VENA 3SUQA 2HOEA 2NRXA 4RW4A 4CZHA 2RKIA 3PIPL 1XNQK 4IDHA 4BRAA 4CHPA 4M41A 5IT9O 4IFVA 1QTMA 4FPAA 2D0AA 4OPAA 3C65A 4GMJB 3PX6A 3ENOA 1WNSA 2NUBA 2GWJA 5CYMA 3ZSXA 1FKOA 3E01A 4DFKA 4FZXC 1SL1A 1D9DA 4GV6A 3NE6A 3H1QA 1QVFM 1YXQA 3LWMA 4DKWA 1GLCG 4CBWA 2AA4A 1RBRA 3H46O 2E1YA 1KVAA 1NKBA 3ZT2A 3ZX0A 2CH5A 3R9PA 3AVFA 3CMAN 1VSHA 3LAMA 4CI6A 4O4GA 3CCQN 1VQON 4DU4A 4CEDA 2KFZA 4M7XA 4GY2B 2NRTA 4Q5VA 1T03A 2G8KA 3T69A 1TK8A 4H0VB 1VHXA 5AQMA 3SAFA 1NK7A 4W5RA 5HBMA 4CHQA 3HM8A 5KRTA 1YITN 3O1WA 5E26A 3GL1A 4LFAK 1DTTA 5C10A 5JVGL 2Q97A 4DR7K 4RCHA 3AO4A 3RMAA 1H1VA 1NLVA 5B8HA 2OTLN 3TU5A 2GELA 4BRKA 4DLEA 1CZAN 4GKKK 1RT7A 3ZSZA 5I42A 4CGJA 4CZMA 4YFUA 4HTUA 3QEVA 3KD1E 2G8WA 2GX9A 3MEDA 4LFBK 2G8HA 5AQZA 2F8SA 3DM2A 4GVMA 3SK3A 1X9JA 4CEEA 2O8CA 4CGIA 2O8DA 5EXWA 4BE0A 5J2MA 1IG9A 2HNDA 3VEOA 3HVRA 3EKUA 2B4JA 4GV3A 1SL0A 1BQMA 1U2VB 3O1BA 3D2EB 1WSGA 3ZSYA 1HMVA 3CJAA 4DQRA 2FXUA 2ZE2A 4XH4A 3PO5A 4BVPA 3DYAA 3U9DA 3VF4A 2ITGA 3ATVA 3C0BA 4WE1A 2IAJA 4JKDA 1GOAA 2WC9A 3ZT4A 3AVHA 5CZ2A 3CG7A 3KK7A 4KPYA 1NK4A 1Z05A 5AZIB 1HQUA 2JGUA 1KXPA 4OLBA 4KTQA 1U47A 2ASPA 4K43A 1VSJA 5ELZA 1Y64A 4CJRA 4DSJA 3AO3A 4B9TA 3R3LA 4BG9A 4G1QA 3MWTA 3IUCA 3SAGA 2X78A 4IOCL 5EOYA 3EN9A 4DTOA 4CJPA 1ASVA 1N5YA 2ZF5O 1NGGA 3G0ZA 4WQ5A 1X9WA 4JV5K 4JI5K 3NCIA 2J4RA 1LAVA 2XY6A 2ZD1A 1Z6RA 5BPNA 2F8TA 3TSQA 3K5MA 4DSFA 1W97L 5MLCQ 4KHUA 4KREA 3UKUB 4RWTA 4FZYA 3VEXA 2HNZA 2UUCK 2GBZA 4BC3A 4X66K 1U6ZA 4Z4HA 3DLKA 2HMIA 3CF5L 1YJ9N 3AAQA 3RRGA 2OYQA 1K8KA 3IG1A 3LANA 2PFUA 3QNNA 4IOXA 2P51A 1RT2A 4CJWA 1NOYA 4AH9A 3L2VA 3ENBA 3LPTA 5J2NA 5E41A 3V1RA 2OTJN 4HUEA 3J7ZO 3SJJA 4CIGA 1W2BM 3I8DA 2ASMA 1BDGA 4DLGA 2P9SB 4PKHA 2E88A 3NF6A 4IJAA 3DWLA 3HPGA 3WQUA 2VQFK 5AQIA 5BRDA 5AQOA 2HHQA 2E2OA 3QDKA 3F9KA 1YVUA 2OZMA 3IAYA 3VTHA 4KV8A 2QK9A 4WFAL 2YKNA 1D4XA 4C8LA 1S3XA 4F8RA 1BU6O 3CCSN 4YDUC 4EHUA 4WCEL 1EX4A 1Q82O 3C95A 3O4QA 3BY5A 3KZBA 4CF0A 4B3TK 1S6QA 3OYAA 3V6DA 4ID1A 1T3VA 3RVCA 1HX1A 2QWOA 1S72N 3FZFA 3O9RA 2FBXA 4YY3K 3DI6A 3F2KA 2DTUA 4PKIA 2D5RA 2DY4A 2YX6A 2NRZA 1XWLA 5C42A 4CJEA 3V9SA 3NH2A 1SKRA 2QWPA 3F5TA 3KKRA 2ZGYA 1WAJA 3T1YK 4YDUA 1J5EK 3K9KA 3NF9A 4PA1A 3LWLA 4DV1K 1N32K 4OO1J 4FYDA 4JKCA 3CFPA 1YVNA 4FL9A 1YT3A 3ZSOA 4WYBA 3MXMA 4BWMA 5FPEA 2IS3A 1BI4B 2Q2RA 4J2EA 2DPNA 2UYTA 4CF9A 1TKXA 4JD2A 2UXBK 5BREA 3VQCA 3O9SA 2HHTA 4JKBA 4E1MA 3OYDA 3QERA 1P90A 2W6KA 4EFHA 1KLMA 2QWNA 3SJHA 2NZTA 1BIZA 4DB3A 5CR4A 4N47A 1JCFA 3CPEA 2G8IA 1HYSA 4XEIA 2Q31A 4BRLA 3O08A 3M8RA 5GAGP 2G8FA 3TPQA 3LDPA 2HVIA 2WONA 3NFAA 1VSLA 2PYJA 3VA3A 5FPDA 2WUSA 3QEPA 4DS4A 4A2AA 4O8KA 4DTMA 1S1XA 1R59O 2ZWHA 4CJLA 1B9FA 2JWLA 1U49A 1HJRA 5DMRA 1TUYA 3E1YA 3VQ4A 4O0JA 5M1QA 4DSIA 2FBTA 4KB1A 3SUPA 3TSPA 3SZ2A 5E84A 4ELTA 4KH5A 3O6WA 1IG8A 3KLIA 3TARA 3WXMB 5I3UA 4A5BA 5CZ1A 1VQ6N 3SUNA 1C1CA 3RMDA 3RR7A 4QS8A 3OYHA 4FLTA 4CF2A 3T7ZA 4GVEA 1GOBA 3OYIA 5AQKA 4FWKA 3T19A 4JI0K 3GG4A 2ZM6K 2HHSA 2FBVA 1HYVA 3HO1A 1T6CA 1S5JA 1NNEA 3O5BA 1BUPA 1NMDA 1RILA 4KHQA 4B1UB 4PHTX 1U48A 1S22A 2XY8A 3L4IA 1OH5A 3DRRA 3DOLA 3CC2N 1NGBA 2KTQA 4ID5A 1ASUA 4CJUA 3QBWA 3CJ1A 4JNEA 3LZJA 3C94A 2ZJQL 3WUHA 1TGOA 3AA2A 4DSKA 3VGMA 3ZETA 3HVTA 4B9UA 3AO2A 3SMPA 3SQ4A 4WFBL 2P5OA 1EQYA 5GIOA 2F7TA 2HW3A 3ZT0A 4BDYA 4BR9A 5M1PA 3HYFA 5AQFA 5CHIA 1ZBLA 4LSNA 1BL3A 4FWLA 5GINA 1BIUA 5HRRA 1HYZA 2YHWA 1JJ2M 2Q0UA 4CFDA 5HRNA 3EO3A 1LV5A 1XHXA 4OVLA 4RW8A 4AHVA 4J8FA 4R79A 5K14A 2A41A 1Q7YO 4CBXA 1O13A 1WSJA 1K8AO 2PZSA 3CI5A 2O4GA 5BR9A 4JK9A 5HRSA 2VCPA 2F4VK 1N36K 5JLHA 2OPQA 3PY8A 4ELUA 1R0AA 3H6EA 1JLFA 2BDPA 4FLZA 5KRSA 1DEJA 1HNXK 5ADXH 3HRGA 4OKEA 1WSHA 4JRPA 4LY7A 4GNIA 3SQ0A 3M8SA 2CGKA 2YKMA 5A2QO 3B6PA 4HCCA 2FSNA 2I7NA 3VQPA 5F0XA 1XI1A 2V51B 4FJJA 4CJ4A 3UE5A 1JKHA 1E4FT 3T3FA 1JXBA 5J2QA 1KFSA 2UXCK 4KBOA 5AJ3K 4N5SA 2P9UA 3D2EA 1VQMN 4J2AA 3O9UA 3H1VX 4BRGA 4CD1A 4FWQA 4O5BA 5FDLA 4CEAA 4ZTJA 1NK9A 1ILYA 5AR0A 3BEXA 3A5NC 1XC9A 5J1EA 2A42A 1RTHA 4KTZA 5BR8K 3T1AA 3WXJA 4BGAA 4NCGA 4CHNA 3M5RA 3NF7A 3ENHA 4AHCA 3KK3A 4JKAA 4DF4A 2A5XA 3CCRN 2QXFA 2RPIA 3QLHA 4CGFA 3QFUA 4LC9B 4KI4A 2VWJA 3CFOA 1YTUA 5I9EB 2QM1A 3ULEB 2DFFA 4BRCA 3TANA 3A0IX 3KIOA 3O9QA 3C6UA 4LF7K 1JLGA 3FR0A 3O4NA 2CH6A 4KH6A 1U45A 3V9ZA 1ESVA 1SKWA 3B8AX 3TTFA 4JS4A 3N4QA 3L2UA 4OKJA 3AVIA 4E7KA 3IKMA 4FPBA 4MO4A 4CHOA 3LAKA 1C6VA 4F2SA 4B8CA 4BRDA 3AAPA 4QS7A 2A40A 4AHSA 1GLAG 4I2QA 2QI2A 4DV5K 4YOYA 1QQMA 3VEZA 1UA1A 1NGHA 4MLEA 3G6EN 3KLEA 3NH1A 4L3QA 3ZSQA 4NYNA 3U3YA 4RG8A 2BGGA 4F9OA 3IS9A 1VQ5N 4FM0A 5SWMA 5TKYA 4CZGA 1CXQA 2FSJA 1HPMA 2HB5A 3QEWA 4DV3K 3AVBA 5AZJA 3DRPA 1FKPA 4W5OA 2QEXN 4CK1A 2WOMA 3VQ6A 3L0QA 4CEZA 2AP1A 5KPZA 1X9SA 4PWDA 2BANA 1D8YA 3QFPA 1NGFA 4CEFA 1XC3A 3CQ8A 2O4IA 1EETA 2GEMA 2W41A 1IKYA 2F9WA 3VGLA 4K42A 4CK2A 4X62K 4FXDA 4F4KA 3TR8A 4HTLA 4CEQA 1HNZK 4BACA 3EKSA 4CF1A 4BY9C 3NAEA 1TYQA 2FLOA 3CCMN 2GWKA 2ASOA 1M90O 3ALYA 2QWLA 4H5NA 3AVNA 3CCLN 2RHKA 2V52B 4LF8K 1JLBA 1DLOA 3FE1A 3K5NA 3H3OB 1GLEG 4H8KA 4C1NI 4E1JA 3I0SA 3ZSWA 2NRVA 4PKGA 4Y1CA 1DKGD 4KKOA 2OCEA 3A5OC 4K41A 1IKXA 4ISGA 1BI4A 4DV2K 5EX5A 3ZCMA 3JAMO 4CW7B 3OJSA 4CGHA 1RDAA 3LDSA 5M1OA 5AFUH 4AHRA 2A1SA 2XRIA 1Q9YA 1NG9A 2WFBA 2RE2A 4FJGA 5AQSA 1QHAA 4KB0A 3FGUA 4DQQA 5LY3A 4B1ZA 1S9GA 3E9PA 4IFEA 4H0OA 4Z0UA 1Q81O 3GE1A 3ZT1A 3DLHA 2HMPA 3CMEN 3SV4A 4CVNE 5C0YA 4DFJA 3G10A 2PAVA 3IFRA 3OA9A 5AFUA 4L8RB 4JI6K 2ITMA 3TTDA 5AQNA 3ULEA 1WAFA 3THYA 1RDCA 4Y0WA 3ZEUA 3HOSA 4C23A 4E1NA 4FVMA 4CF8A 4OJRA 2UUAK 3C6AA 5BRFA 1IKVA 1ZXOA 5AQTA 1BWFO 5H1SQ 3BDPA 3MXJA 3V1QA 4FLWA 2IVPA 2O8BA 4DS5A 3DLRA 1NGDA 2W40A 5FLXO 4JS5A 4CIFA 4K8ZA 2Z1GA 4EZ6A 4DR4K 3C7NA 3S3NA 1RDBA 1W7AA 4WF9L 4BRQA 3EZWA 3F73A 1HJOA 4LH5A 4WFNL 4JK7A 3MCPA 4PL7A 3Q7BA 4C1NK 1L5UA 1W0HA 4BR7A 2P9LB 3HZ6A 2E2PA 4B08A 1E3MA 5AQGA 5KGWA 2A6AA 4DR3K 2FBYA 1SZ2A 3NGIA 1RT1A 1C0UA 4I6MB 4CJ5A 2ZJRL 3QICA 1ATSA 5C2DA 4CJFA 1WSEA 3HSCA 4DF8A 3RRHA 4GKJK 1QZ5A 4ILHA 4B1YB 1HQEA 4JHDA 4Y1DA 3RMBA 4B3SK 4F2RA 3CYMA 1CXUA 3LP1A 4PL8A 3D45A 1I3AA 4BRHA 3P83D 4CEOA 4CJVA 5AQYA 4DV6K 4IKFA 4KHNA 3AVLA 3U3GA 1QZ6A 4FWPA 2E2QA 4JRQA 1YHQN 1MWKA 3WEEA 4RW6A 3THVA 4AQYK 2NRRA 3QBXA 5BPMA 1YTAA 4GW6A 1C0GA 1ASWA 3ID8A 4U67L 1NKEA 4FJKA 4NYFA 3O3FA 3FFIA 2HVHA 2QXLA 2YNIA 4M3WA 5AQPA 3IDHA 3O9TA 2HHVA 4DWIA 2R7YA 4IZ9A 4OLAA 4AM6A 3KHYA 4FSVA 3GOIA 3MECA 4FLVA 3TAEA 3MN9A 1KAZA 1VQKN 1QE1A 4MQ3A 4KFBA 3UIQA 1NGIA 4DTJA 4JKGA 4DQ8A 1YJWN 4BQLA 3SNNA 4JLHA 3WNEA 3MN5A 5AQWA 3SAHA 2VGNA 3LL3A 4LSLA 5ADXA 1RTDA 1KTQA 5IWAK 3QEXA 1Q86O 3LM9A 3MWPA 4RW7A 1BCOA 5HRPA 4HUGA 5HOOA 3H08A 3J80O 5JS1A 5EY4A 1NJYA 3SV3A 1ATRA 3VPZA 1L3UA 4E89A 5M1FA 3VQDA 3AO1A 3L6QA 3VQEA 1ZBIA 4CFBA 3O4WA 3E66A 1YF5L 2I5JA 1RGIA 2W6LA 3S3OA 1OH8A 4DQIA 4IBNA 2GTDA 4MDBA 3WT0A 1FJGK 3A8YA 4GV9A 4DTUA 1NJWA 5KGXA 5HLFA 2CGLA 2HHWA 3E9LA 3FZMA 1KAYA 1T7PA 3R1XA 1ATNA 5CE3A 3OS1A 1N6QA 5FPMA 4HCBA 3QINA 2IDOA 5FPNA 1QVGM 4A59A 1OH7A 1Q9XA 4DTSA 4Z4GA 1RNHA 2YI1A 5AQJA 1C0MA 3NVMA 1RT5A 3WNHA 4RW9A 3CD6N 2BUPA 4B8AB 1E4GT 3ZSRA 1QSSA 3OVNA 4K0KK 4DV0K 2OPSA 1JL1A 2YHYA 4ILGB 4FJ7A 3HBTA 2HF3A 1VQ8N 3S3MA 4B1WB 1REVA 2GUPA 3QO9A 1KVCA 3N4PA 2P1JA 3O3GA 4OX9K 4M3XA 2XO7A 4I6MA 4FWOA 4IDKA 4OGCA 4JI1K 5GADP 2GV9A 3V9XA 3O8MA 1HLUA 1EKEA 1DGKN 3WXIA 4FJ9A 4YOUA 1NU0A 2YV0X 3F9MA 2KW4A 3KLHA 2D0PA 4KI6A 4NCBA 3E9OA 1HKGA 3LP2A 2V7ZA 2O8EB 2P9KB 3EYZA 3AVCA 3DRSA 4ZHRA 3SQ2A 1L3SA 1WBDA 2P9SA 3HPHA 4EHTA 2EHGA 4JKFA 3VN5A 4DFPA 1G15A 4DR2K 1N8RO 3V9UA 3V1OA 3ZSVA 4O0IA 1TAUA 2ETJA 3U9ZA 1HR0K 5C25A 2NRHA 4LF6K 1DTQA 4C8MA 2JWKA 1VRUA 3OBYA 3LZIA 4N41A 3KD5E 3A2FA 3PX0A 3VTIA 1KAXA 4CJ7A 3M1FA 3NBPA 4BR4A 4Z4IA 4KO0A 1TYQB 3L2QA 4LFCK 3OHRA 1EO1A 3P31A 4B3RK 1X3MA 3MX5A 1B9DA 2X74A 4NXMK 4LF5K 5BN8A 2KLAA 2OA8A 3CIPA 2VYPA 1JL2A 2QWQA 4CFCA 1NKCA 2P5GA 3U4LA 3VQ9A 4YNQA 2ZJPL 1SS6A 4F3OA 1GLDG 2Z1IA 4A2BA 3GBTA 4H5WA 1WUAA 2UUBK 1NOZA 3RMCA 3K9JA 3I55N 4JYAK 5AZIA 3P5JA 1XMOK 4E7IA 4BROA 5AQXA 2VQEK 2E20A 3L3VA 4M3TA 2UU9K 1RBUA 4YOXA 3KLGA 4RTFD 3DMJA 3LPUA 4IEEA 1M1KO 3VOVA 1MDUB 1KSPA 3TTCA 3KK2A 3U8XA 5JICA 3SI6A 2NNWA 3BGRA 1WOQA 1NJIO 5AQLA 3BZCA 3AV9A 3TAMA 3UB5A 4KHPK 3ZEUB 5LJWA 3L2RA 4G9ZA 4JEPA 4CGGA 4FWSA 4BDPA 1BG3A 4FK2A 3NGZA 3ZX2A 1D5AA 5F2RA 2PY5A 1JLCA 1C1BA 4OPJA 4NLBA 3MX2A 3I0RA 5HROA 1KQSM 1NK0A 3P4IA 4CESA 4B3MK 4FM1A 3MN6A 4ILJA 4TSXA 4IFYA 4R5PA 1ZBHA 4BRPA 2X6SA 1I94K 2O8CB 2E5LK 1Y97A 4B3OA 5KTQA 3OYJA 4A62A 2AJQA 3ZYYX 5SZTA 5FRNA 2CGJA 1EP4A 2D0CA 4B9SA 4AHTA 3LM2A 4H5TA 1ITGA 1FXXA 3IMXA 1K9MO 3NGYA 1NJXA 4ICLA 1W9HA 3CJBA 2YHAA 3DXMB 1K8KB 3QIOA 4JK8A 3OYNA 1HRHA 1J6ZA 4CZEA 5GIPA 5KPRA 4C8NA 4CE9A 2KFNA 2QKBA 4B9MA 3QEIA 1NJZA 4B9QA 1TV6A 2NRWA 3VETA 1MU2A 1J53A 3KVGA 2Q3SA 1ZBFA 3VQQA 3THXB 2W42A 2FF3B 1IO2A 4KHSA 4H0TB 3A5MC 2O8EA 4YHHK 3OYEA 5AQUA 3ZLJA 1J54A 3ZETB 4BR5A 4BRMA 2VG6A 1LWFA 1O1WA 4JHDB 1RT4A 1TKTA 4LF4K 1IBKK 3OBWA 4CERA 1KC8O 3V4IA 4B9LA 4JI7K 2KKZA 1HPZA 3EL2A 1FW6A 4DTRA 4BR0A 4BWJA 1J9AA 1S1VA 1UWBA 3D2FB 3DLEA 4DV7K 2ZQBA 3WEEB
chains in the Genus database with same CATH topology
2E4LA 1EX4A 3C95A 3O4QA 1RDCA 3B6OA 4IG0A 1L3TA 4CF0A 3HXMA 4N56A 3SUOA 4E1NA 3OYLA 3DLBA 4FVMA 1WSIA 4CF8A 1S6QA 3OYAA 3EY1A 4ID1A 4OJRA 3V6DA 4DTNA 3VA0A 3TAGA 1RT6A 3TAFA 1IKVA 4H4MA 3ZT3A 5FRMA 2HHUA 2FBXA 3BDPA 4DU1A 3DI6A 3MXJA 3OYFA 3L2WA 3V1QA 4FLWA 3LALA 1J5OA 1S1UA 3ULDA 2DTUA 2D5RA 3OYCA 2DY4A 1CZ9A 4DS5A 2YNGA 4W5NA 3DLRA 4O44A 4BE2A 2OZSA 1XWLA 3K5LA 4JS5A 4CIFA 4K8ZA 5C42A 1BHLA 2Z1GA 4CJEA 2G8UA 3TWHA 1VSDA 4EZ6A 4FZZA 2XY7A 3AA4A 3V9SA 2D0BA 3NH2A 2YNFA 1SKRA 3AVJA 4QCLA 3KKRA 1TVRA 3P1GA 3S3NA 1VSEA 1RDBA 4KHWA 3S9HA 1WSFA 4W5QA 3F73A 1WAJA 4LH5A 3NF9A 4KHYA 4PA1A 3LWLA 1ZBUA 2DFHA 3O3HA 1GOCA 1L5UA 1BGXT 1JLEA 4FYDA 3CFPA 4FJXA 1W0HA 1D9FA 3SQ1A 1YT3A 3VQ7A 3ZSOA 4FJLA 3MXMA 4BWMA 1LW0A 1VSMA 2IS3A 1BI4B 3VQAA 4B08A 2EX3A 3DOKA 4J2EA 4N76A 1CLQA 2E6MA 1TL3A 5KGWA 2Z1HA 4CF9A 2JLEA 1A5WA 1TKXA 2FBYA 3MAQA 1KCFA 1VK0A 1RT1A 1C0UA 4CJ5A 3VQCA 4CJTA 3NGIA 2Y1JA 2OPRA 1SUQA 3LP0A 4CJFA 4CJSA 2HHTA 1WSEA 4E1MA 3OYDA 3RRHA 4DF8A 3QERA 3C6TA 4CJ3A 4J2BA 1HQEA 1VSIA 3OYMA 4DSEA 4Y1DA 5J2PA 1KLMA 1VSKA 1BISA 4E19A 3QETA 3RMBA 1QSLA 4F2RA 3CYMA 1CXUA 3LP1A 1C0TA 3D45A 1I3AA 1BIZA 1QS4A 3P83D 4CEOA 4CJVA 4N47A 4EP5A 4DFMA 2A1RA 4IKFA 4W5TA 4KHNA 3AVLA 2G8IA 1HYSA 3U3GA 1LAWA 3M8RA 2G8FA 1TKDA 4E0DA 4BDZA 4JRQA 4KAZA 2HVIA 2WONA 4RW6A 3NFAA 3THVA 1VSLA 1T05A 3TI0A 2PYJA 3VA3A 4O55A 1YTAA 3DLGA 4GW6A 4C8KA 1ASWA 1NKEA 4FJKA 4NYFA 3O3FA 3K2PA 3FFIA 4DS4A 3QEPA 2HVHA 2XHBA 4LH4A 1VRTA 1TAQA 2YNIA 4M3WA 4DTMA 4CFAA 1S1XA 3ASMA 2YNHA 3V9WA 2HHVA 4DWIA 4FJIA 4DQPA 4CJLA 1B9FA 3NH0A 2R7YA 4CJKA 1U49A 1HJRA 5DMRA 4OLAA 1JXEA 1Q8IA 3VQ4A 3MECA 3HM9A 4FLVA 3V81A 3TAEA 4O0JA 4DSIA 4F3TA 4I9LA 2FBTA 3QNOA 4KB1A 3AVMA 3K59A 2HNYA 1TKZA 3SUPA 1QE1A 4MQ3A 3SZ2A 2IOCA 4KFBA 4ELTA 3UIQA 4DTJA 2Z1JA 4I7FA 2KQ2A 1X9MA 3KLIA 1KVBA 3TARA 3SNNA 2IGIA 4JLHA 4DU3A 3WNEA 5I3UA 4C8OA 5CZ1A 4E3SA 4DG1A 3CFRA 4E7JA 3OYKA 1SL2A 4B9VA 3ITHA 3SUNA 1UOCA 4LSLA 3HP6A 1C1CA 1RTDA 1KTQA 4FJ5A 3RMDA 3RR7A 3QEXA 3OYHA 4FLTA 3HP9A 4CF2A 4RW7A 4E7HA 1GOBA 5DK5A 1BCOA 1QHTA 2YHBA 3OYIA 5HRPA 4HUGA 3L3UA 1XHZA 3T19A 3H08A 5JS1A 4Q0BA 1NJYA 3SV3A 1L3UA 4E89A 3VQDA 3AO1A 3VQEA 1ZBIA 3IRXA 2X6NA 4QOZB 4HVJA 3EZ5A 3AVAA 4CFBA 2HHSA 2FBVA 4DMNA 3NDKA 4FCYA 1HYVA 4CHZA 2I5JA 4M3ZA 3HO1A 1S5JA 4IG3A 3S3OA 3M8PA 4DQIA 3M8QA 4M42A 4IBNA 1RILA 3OS2A 4KHQA 4W5OA 1U48A 4HUFA 2XY8A 1NK8A 2IC3A 3DRRA 4DTUA 3DOLA 1NJWA 4DSLA 2KTQA 4ID5A 1ASUA 4FK0A 4CJUA 5KGXA 4DTXA 5HLFA 2XY5A 4ZTFA 3LZJA 3C94A 2HHWA 1TGOA 5EU7A 3AA2A 4DSKA 4CHYA 1LWEA 3SPZA 1VSFA 3HVTA 4B9UA 1T7PA 3AO2A 3WNFA 3SQ4A 1RTIA 4UQGA 2P5OA 4PUOA 1BCMA 3OS1A 5D3GA 1N6QA 3HT3A 4HCBA 1SKSA 4I9QA 4Z4EA 2HW3A 3QINA 4FJMA 2IDOA 1IKWA 3ZT0A 4BDYA 1SV5A 1RBVA 2DFEA 1FK9A 3VQ8A 3HYFA 1JLQA 3QIPA 1ZBLA 4LSNA 1Q9XA 4Z4FA 1BL3A 4DTSA 4Z4GA 1RNHA 1QQCA 1BIUA 1RCHA 3LP3A 5HRRA 3SYZA 2G8VA 1HYZA 3SCXA 1C0MA 3SPYA 5JS2A 3TAQA 1A5VA 4DTPA 2BE2A 4CFDA 5HRNA 1RT5A 3WNHA 4RW9A 1LV5A 3OYGA 4FJ8A 4FLXA 1XHXA 4B8AB 4OVLA 4RW8A 3ZSRA 1QSSA 3OVNA 4AHVA 1QSYA 5CY4A 3RWUA 5K14A 4FJHA 3KK1A 1WSJA 1I39A 3AO5A 2OPSA 1JL1A 2PZSA 4FJ7A 1KLNA 1HNVA 2O4GA 3CM5A 3S3MA 4KTWA 1REVA 1ZYQA 4OKKA 3QO9A 1KVCA 3O3GA 2P1JA 4M3XA 3HK2A 5HRSA 3ISNC 2GUIA 3AVKA 4QAGA 3KLFA 2XO7A 5T7BA 3JSMA 1Z26A 1UA0A 1TL1A 2OPQA 4IDKA 4OGCA 4CIEA 3OS0A 1R0AA 3PY8A 4ELUA 3V9XA 2GV9A 1JLFA 3MXIA 1U4BA 1EKEA 3AA3A 2BDPA 4J2DA 4FJ9A 3K58A 4FLUA 3L8BA 2KZMA 2YV0X 4FLZA 2KW4A 5KRSA 3KLHA 4KRFA 1LW2A 4OKEA 4AHUA 3RR8A 1WSHA 4JRPA 4NCBA 4LY7A 4KI6A 1Z25A 3SQ0A 3D0PA 3M8SA 3QESA 1NK6A 3LP2A 2Y1IA 2YKMA 3VQBA 4CK3A 3EYZA 3B6PA 4OGEA 1U04A 4E7LA 3HJFA 4HCCA 3SUQA 4EP4A 3VQPA 1RBTA 4FJJA 1XI1A 3AVCA 4RW4A 1RBSA 2RKIA 3DRSA 4CJ4A 1JKHA 4ZHRA 3SQ2A 3T3FA 1L3SA 4CHPA 3HPHA 4M41A 4IFVA 1QTMA 1JXBA 2D0AA 5J2QA 2EHGA 2VG5A 3VN5A 1KFSA 4MFBA 4GMJB 1RT3A 4M3YA 3PX6A 4DFPA 4N5SA 1G15A 4J2AA 4AILC 3V9UA 3V1OA 3ZSVA 1WNSA 2NUBA 4O0IA 4ELVA 5CYMA 3ZSXA 2ETJA 1A5XA 1TAUA 1B92A 1FKOA 3E01A 5C25A 1TK5A 4O5BA 4DFKA 4FZXC 1DTQA 5CYQA 5FDLA 4CEAA 4ZTJA 4C8MA 1SL1A 1NK9A 1D9DA 4PQUA 3NE6A 4K8XA 1VRUA 3LZIA 2KZZA 4N41A 1UAXA 3KD5E 3A2FA 1S9EA 3PX0A 1XC9A 3LWMA 5J1EA 3NBPA 4Z4IA 1RBRA 1RTHA 4KO0A 3L2QA 4EZ9A 4KTZA 1KVAA 3T1AA 1NKBA 3ZT2A 2B5JA 3AVFA 3TAPA 1VSHA 4FM2A 2RN2A 3NF8A 1B9DA 2X74A 3LAMA 4NCGA 4CHNA 4O4GA 3NF7A 4AHCA 4DU4A 2OA8A 3KK3A 4M3UA 4CEDA 2KFZA 1JL2A 4Q5VA 4CFCA 3NHGA 1T03A 2G8KA 4DF4A 1NKCA 1TK8A 5FROA 2P5GA 2QXFA 2RPIA 3QLHA 3VQ9A 4W5RA 1NK7A 4YNQA 4CGFA 5HBMA 4CHQA 5KRTA 4F3OA 4KI4A 4PY5A 2VWJA 3CFOA 1YTUA 2DFFA 1DTTA 2Z1IA 3CM6A 3TANA 1S1WA 3KIOA 3MEGA 3C6UA 3AO4A 3RMAA 1JLGA 1NOZA 2VWKA 4HHTA 3O4NA 3RMCA 1U45A 3V9ZA 4DLEA 4CJQA 2LSNA 4FJNA 2F96A 2RF2A 1RT7A 3ZSZA 5I42A 4CGJA 1SKWA 4YFUA 4JS4A 4HTUA 3P5JA 3QEVA 4OPKA 1KRPA 3KD1E 4E7IA 4CCHA 2G8WA 3L2UA 4OKJA 3HL8A 3AVIA 5KI6A 4E7KA 1K6YA 3L3VA 4CHOA 3MEDA 3LAKA 4M3TA 3MEEA 1C6VA 1RBUA 2ATQA 2G8HA 2F8SA 3DM2A 4GVMA 4H4OA 4B8CA 4CEEA 3KLGA 4F2SA 3TABA 4CGDA 1WN7A 3DMJA 3LPUA 5C24A 5HP1A 4LD0A 4CGIA 4AHSA 1KSPA 1IH7A 4I2QA 3KK2A 4BE0A 2HHXA 2FC0A 5J2MA 3PO4A 3SI6A 1IG9A 3BGRA 3OY9A 2HNDA 3HVRA 1F21A 1C1AA 2B4JA 1SL0A 1BQMA 1WSGA 4M3RA 3ZSYA 1HMVA 1UA1A 4DQRA 3AV9A 3KLEA 3TAMA 2ZE2A 3NH1A 3ZSQA 3PO5A 4NYNA 3U3YA 4RG8A 4XIUA 4DQSA 3DYAA 3L2RA 4CEBA 2ITGA 2BGGA 3IS9A 4WE1A 4CGGA 1S6PA 2IAJA 4FM0A 1GOAA 4BDPA 5SWMA 1NK5A 1CXQA 4CECA 2HB5A 4FK2A 3ZT4A 3QEWA 3NGZA 3OYBA 3PV8A 1D5AA 3AVBA 2PY5A 1JLCA 3AVHA 3DRPA 1FKPA 3CG7A 3K5OA 5CZ2A 1C1BA 1X1PA 4CK1A 2WOMA 1WLJA 3VQ6A 4OPJA 3JYTA 3I0RA 4KPYA 4CEZA 4PWDA 1X9SA 5HROA 2BANA 1NK4A 1D8YA 1RDDA 1NK0A 1HQUA 2JGUA 2OPPA 4CESA 4NCAA 4I2PA 4FM1A 4CEFA 4OLBA 4KTQA 1U47A 4BE1A 1VSJA 4TSXA 3WNGA 3CQ8A 1KFDA 4IFYA 4R5PA 2O4IA 1EETA 4FW1A 1ZBHA 2X6SA 1JLAA 1IKYA 1HNIA 4CJRA 1Y97A 4DSJA 4B3OA 3AO3A 4CK2A 3HSTB 5KTQA 3OYJA 4B9TA 4FXDA 4F4KA 3TR8A 4G1QA 2AJQA 5SZTA 5FRNA 1EP4A 2D0CA 2X78A 3KKSA 4B9SA 1BQNA 4CEQA 4AHTA 4BACA 4DTOA 4CJPA 4CF1A 1ASVA 1N5YA 1ITGA 1FXXA 3NAEA 2E6LA 3G0ZA 1X9WA 3NGYA 4B9NA 1NJXA 3NCIA 3ALYA 4ICLA 1LAVA 1W9HA 2YHAA 2ZD1A 3AVNA 2XY6A 2F8TA 3K5MA 3QIOA 4DSFA 4KHUA 4KREA 1JLBA 1DLOA 1HRHA 3OYNA 4FZYA 3KTQA 2HNZA 3K5NA 1TK0A 2GBZA 4C8NA 3AVGA 4M45A 4CE9A 2KFNA 2QKBA 3PUFA 4H8KA 4B9MA 3QEIA 3PX4A 2VG7A 4Z4HA 3DLKA 1NJZA 3I0SA 1TV6A 2HMIA 3ZSWA 1MU2A 4Y1CA 3RTVA 1J53A 4FLYA 3VQ5A 2Q3SA 3RRGA 2OYQA 1ZBFA 3IG1A 3VQQA 3LANA 3OJUA 4KKOA 3QNNA 2W42A 1IKXA 1RT2A 2P51A 1IO2A 1BI4A 4CJWA 1NOYA 4KHSA 3KJVA 4AH9A 3L2VA 3LPTA 3ZCMA 3OJSA 4CGHA 1RDAA 4FW2A 3LDSA 5J2NA 4AHRA 5E41A 3OYEA 1LWCA 2A1SA 2XRIA 3V1RA 1J54A 1Q9YA 2B6AA 4FJGA 4HUEA 3SJJA 4FK4A 4CIGA 2VG6A 4KB0A 1LWFA 3I8DA 4DQQA 1O1WA 4DLGA 3AA5X 4Z4CA 3NF6A 1RT4A 1S1TA 1TKTA 1S9GA 3HPGA 2PYLA 3HPOA 2QKKA 2HHQA 4CERA 1CZBA 3V4IA 4B9LA 4Z0UA 1T8EA 1HPZA 3F9KA 3ZT1A 1YVUA 3DLHA 2OZMA 3IAYA 1L3VA 3SV4A 4DTRA 3U6FA 4KV8A 1J9AA 1S1VA 3G10A 4BWJA 4DFJA 2QK9A 1UWBA 4L8RB 2YKNA 4C8LA 1RTJA 3DLEA 4F8RA 2ZQBA 1EXQA 1WAFA 3K57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4L A;  1EX4 A;  3C95 A;  3O4Q A;  1RDC A;  3B6O A;  4IG0 A;  1L3T A;  4CF0 A;  3HXM A;  4N56 A;  3SUO A;  4E1N A;  3OYL A;  3DLB A;  4FVM A;  1WSI A;  4CF8 A;  1S6Q A;  3OYA A;  3EY1 A;  4ID1 A;  4OJR A;  3V6D A;  4DTN A;  3VA0 A;  3TAG A;  1RT6 A;  3TAF A;  1IKV A;  4H4M A;  3ZT3 A;  5FRM A;  2HHU A;  2FBX A;  3BDP A;  4DU1 A;  3DI6 A;  3MXJ A;  3OYF A;  3L2W A;  3V1Q A;  4FLW A;  3LAL A;  1J5O A;  1S1U A;  3ULD A;  2DTU A;  2D5R A;  3OYC A;  2DY4 A;  1CZ9 A;  4DS5 A;  2YNG A;  4W5N A;  3DLR A;  4O44 A;  4BE2 A;  2OZS A;  1XWL A;  3K5L A;  4JS5 A;  4CIF A;  4K8Z A;  5C42 A;  1BHL A;  2Z1G A;  4CJE A;  2G8U A;  3TWH A;  1VSD A;  4EZ6 A;  4FZZ A;  2XY7 A;  3AA4 A;  3V9S A;  2D0B A;  3NH2 A;  2YNF A;  1SKR A;  3AVJ A;  4QCL A;  3KKR A;  1TVR A;  3P1G A;  3S3N A;  1VSE A;  1RDB A;  4KHW A;  3S9H A;  1WSF A;  4W5Q A;  3F73 A;  1WAJ A;  4LH5 A;  3NF9 A;  4KHY A;  4PA1 A;  3LWL A;  1ZBU A;  2DFH A;  3O3H A;  1GOC A;  1L5U A;  1BGX T;  1JLE A;  4FYD A;  3CFP A;  4FJX A;  1W0H A;  1D9F A;  3SQ1 A;  1YT3 A;  3VQ7 A;  3ZSO A;  4FJL A;  3MXM A;  4BWM A;  1LW0 A;  1VSM A;  2IS3 A;  1BI4 B;  3VQA A;  4B08 A;  2EX3 A;  3DOK A;  4J2E A;  4N76 A;  1CLQ A;  2E6M A;  1TL3 A;  5KGW A;  2Z1H A;  4CF9 A;  2JLE A;  1A5W A;  1TKX A;  2FBY A;  3MAQ A;  1KCF A;  1VK0 A;  1RT1 A;  1C0U A;  4CJ5 A;  3VQC A;  4CJT A;  3NGI A;  2Y1J A;  2OPR A;  1SUQ A;  3LP0 A;  4CJF A;  4CJS A;  2HHT A;  1WSE A;  4E1M A;  3OYD A;  3RRH A;  4DF8 A;  3QER A;  3C6T A;  4CJ3 A;  4J2B A;  1HQE A;  1VSI A;  3OYM A;  4DSE A;  4Y1D A;  5J2P A;  1KLM A;  1VSK A;  1BIS A;  4E19 A;  3QET A;  3RMB A;  1QSL A;  4F2R A;  3CYM A;  1CXU A;  3LP1 A;  1C0T A;  3D45 A;  1I3A A;  1BIZ A;  1QS4 A;  3P83 D;  4CEO A;  4CJV A;  4N47 A;  4EP5 A;  4DFM A;  2A1R A;  4IKF A;  4W5T A;  4KHN A;  3AVL A;  2G8I A;  1HYS A;  3U3G A;  1LAW A;  3M8R A;  2G8F A;  1TKD A;  4E0D A;  4BDZ A;  4JRQ A;  4KAZ A;  2HVI A;  2WON A;  4RW6 A;  3NFA A;  3THV A;  1VSL A;  1T05 A;  3TI0 A;  2PYJ A;  3VA3 A;  4O55 A;  1YTA A;  3DLG A;  4GW6 A;  4C8K A;  1ASW A;  1NKE A;  4FJK A;  4NYF A;  3O3F A;  3K2P A;  3FFI A;  4DS4 A;  3QEP A;  2HVH A;  2XHB A;  4LH4 A;  1VRT A;  1TAQ A;  2YNI A;  4M3W A;  4DTM A;  4CFA A;  1S1X A;  3ASM A;  2YNH A;  3V9W A;  2HHV A;  4DWI A;  4FJI A;  4DQP A;  4CJL A;  1B9F A;  3NH0 A;  2R7Y A;  4CJK A;  1U49 A;  1HJR A;  5DMR A;  4OLA A;  1JXE A;  1Q8I A;  3VQ4 A;  3MEC A;  3HM9 A;  4FLV A;  3V81 A;  3TAE A;  4O0J A;  4DSI A;  4F3T A;  4I9L A;  2FBT A;  3QNO A;  4KB1 A;  3AVM A;  3K59 A;  2HNY A;  1TKZ A;  3SUP A;  1QE1 A;  4MQ3 A;  3SZ2 A;  2IOC A;  4KFB A;  4ELT A;  3UIQ A;  4DTJ A;  2Z1J A;  4I7F A;  2KQ2 A;  1X9M A;  3KLI A;  1KVB A;  3TAR A;  3SNN A;  2IGI A;  4JLH A;  4DU3 A;  3WNE A;  5I3U A;  4C8O A;  5CZ1 A;  4E3S A;  4DG1 A;  3CFR A;  4E7J A;  3OYK A;  1SL2 A;  4B9V A;  3ITH A;  3SUN A;  1UOC A;  4LSL A;  3HP6 A;  1C1C A;  1RTD A;  1KTQ A;  4FJ5 A;  3RMD A;  3RR7 A;  3QEX A;  3OYH A;  4FLT A;  3HP9 A;  4CF2 A;  4RW7 A;  4E7H A;  1GOB A;  5DK5 A;  1BCO A;  1QHT A;  2YHB A;  3OYI A;  5HRP A;  4HUG A;  3L3U A;  1XHZ A;  3T19 A;  3H08 A;  5JS1 A;  4Q0B A;  1NJY A;  3SV3 A;  1L3U A;  4E89 A;  3VQD A;  3AO1 A;  3VQE A;  1ZBI A;  3IRX A;  2X6N A;  4QOZ B;  4HVJ A;  3EZ5 A;  3AVA A;  4CFB A;  2HHS A;  2FBV A;  4DMN A;  3NDK A;  4FCY A;  1HYV A;  4CHZ A;  2I5J A;  4M3Z A;  3HO1 A;  1S5J A;  4IG3 A;  3S3O A;  3M8P A;  4DQI A;  3M8Q A;  4M42 A;  4IBN A;  1RIL A;  3OS2 A;  4KHQ A;  4W5O A;  1U48 A;  4HUF A;  2XY8 A;  1NK8 A;  2IC3 A;  3DRR A;  4DTU A;  3DOL A;  1NJW A;  4DSL A;  2KTQ A;  4ID5 A;  1ASU A;  4FK0 A;  4CJU A;  5KGX A;  4DTX A;  5HLF A;  2XY5 A;  4ZTF A;  3LZJ A;  3C94 A;  2HHW A;  1TGO A;  5EU7 A;  3AA2 A;  4DSK A;  4CHY A;  1LWE A;  3SPZ A;  1VSF A;  3HVT A;  4B9U A;  1T7P A;  3AO2 A;  3WNF A;  3SQ4 A;  1RTI A;  4UQG A;  2P5O A;  4PUO A;  1BCM A;  3OS1 A;  5D3G A;  1N6Q A;  3HT3 A;  4HCB A;  1SKS A;  4I9Q A;  4Z4E A;  2HW3 A;  3QIN A;  4FJM A;  2IDO A;  1IKW A;  3ZT0 A;  4BDY A;  1SV5 A;  1RBV A;  2DFE A;  1FK9 A;  3VQ8 A;  3HYF A;  1JLQ A;  3QIP A;  1ZBL A;  4LSN A;  1Q9X A;  4Z4F A;  1BL3 A;  4DTS A;  4Z4G A;  1RNH A;  1QQC A;  1BIU A;  1RCH A;  3LP3 A;  5HRR A;  3SYZ A;  2G8V A;  1HYZ A;  3SCX A;  1C0M A;  3SPY A;  5JS2 A;  3TAQ A;  1A5V A;  4DTP A;  2BE2 A;  4CFD A;  5HRN A;  1RT5 A;  3WNH A;  4RW9 A;  1LV5 A;  3OYG A;  4FJ8 A;  4FLX A;  1XHX A;  4B8A B;  4OVL A;  4RW8 A;  3ZSR A;  1QSS A;  3OVN A;  4AHV A;  1QSY A;  5CY4 A;  3RWU A;  5K14 A;  4FJH A;  3KK1 A;  1WSJ A;  1I39 A;  3AO5 A;  2OPS A;  1JL1 A;  2PZS A;  4FJ7 A;  1KLN A;  1HNV A;  2O4G A;  3CM5 A;  3S3M A;  4KTW A;  1REV A;  1ZYQ A;  4OKK A;  3QO9 A;  1KVC A;  3O3G A;  2P1J A;  4M3X A;  3HK2 A;  5HRS A;  3ISN C;  2GUI A;  3AVK A;  4QAG A;  3KLF A;  2XO7 A;  5T7B A;  3JSM A;  1Z26 A;  1UA0 A;  1TL1 A;  2OPQ A;  4IDK A;  4OGC A;  4CIE A;  3OS0 A;  1R0A A;  3PY8 A;  4ELU A;  3V9X A;  2GV9 A;  1JLF A;  3MXI A;  1U4B A;  1EKE A;  3AA3 A;  2BDP A;  4J2D A;  4FJ9 A;  3K58 A;  4FLU A;  3L8B A;  2KZM A;  2YV0 X;  4FLZ A;  2KW4 A;  5KRS A;  3KLH A;  4KRF A;  1LW2 A;  4OKE A;  4AHU A;  3RR8 A;  1WSH A;  4JRP A;  4NCB A;  4LY7 A;  4KI6 A;  1Z25 A;  3SQ0 A;  3D0P A;  3M8S A;  3QES A;  1NK6 A;  3LP2 A;  2Y1I A;  2YKM A;  3VQB A;  4CK3 A;  3EYZ A;  3B6P A;  4OGE A;  1U04 A;  4E7L A;  3HJF A;  4HCC A;  3SUQ A;  4EP4 A;  3VQP A;  1RBT A;  4FJJ A;  1XI1 A;  3AVC A;  4RW4 A;  1RBS A;  2RKI A;  3DRS A;  4CJ4 A;  1JKH A;  4ZHR A;  3SQ2 A;  3T3F A;  1L3S A;  4CHP A;  3HPH A;  4M41 A;  4IFV A;  1QTM A;  1JXB A;  2D0A A;  5J2Q A;  2EHG A;  2VG5 A;  3VN5 A;  1KFS A;  4MFB A;  4GMJ B;  1RT3 A;  4M3Y A;  3PX6 A;  4DFP A;  4N5S A;  1G15 A;  4J2A A;  4AIL C;  3V9U A;  3V1O A;  3ZSV A;  1WNS A;  2NUB A;  4O0I A;  4ELV A;  5CYM A;  3ZSX A;  2ETJ A;  1A5X A;  1TAU A;  1B92 A;  1FKO A;  3E01 A;  5C25 A;  1TK5 A;  4O5B A;  4DFK A;  4FZX C;  1DTQ A;  5CYQ A;  5FDL A;  4CEA A;  4ZTJ A;  4C8M A;  1SL1 A;  1NK9 A;  1D9D A;  4PQU A;  3NE6 A;  4K8X A;  1VRU A;  3LZI A;  2KZZ A;  4N41 A;  1UAX A;  3KD5 E;  3A2F A;  1S9E A;  3PX0 A;  1XC9 A;  3LWM A;  5J1E A;  3NBP A;  4Z4I A;  1RBR A;  1RTH A;  4KO0 A;  3L2Q A;  4EZ9 A;  4KTZ A;  1KVA A;  3T1A A;  1NKB A;  3ZT2 A;  2B5J A;  3AVF A;  3TAP A;  1VSH A;  4FM2 A;  2RN2 A;  3NF8 A;  1B9D A;  2X74 A;  3LAM A;  4NCG A;  4CHN A;  4O4G A;  3NF7 A;  4AHC A;  4DU4 A;  2OA8 A;  3KK3 A;  4M3U A;  4CED A;  2KFZ A;  1JL2 A;  4Q5V A;  4CFC A;  3NHG A;  1T03 A;  2G8K A;  4DF4 A;  1NKC A;  1TK8 A;  5FRO A;  2P5G A;  2QXF A;  2RPI A;  3QLH A;  3VQ9 A;  4W5R A;  1NK7 A;  4YNQ A;  4CGF A;  5HBM A;  4CHQ A;  5KRT A;  4F3O A;  4KI4 A;  4PY5 A;  2VWJ A;  3CFO A;  1YTU A;  2DFF A;  1DTT A;  2Z1I A;  3CM6 A;  3TAN A;  1S1W A;  3KIO A;  3MEG A;  3C6U A;  3AO4 A;  3RMA A;  1JLG A;  1NOZ A;  2VWK A;  4HHT A;  3O4N A;  3RMC A;  1U45 A;  3V9Z A;  4DLE A;  4CJQ A;  2LSN A;  4FJN A;  2F96 A;  2RF2 A;  1RT7 A;  3ZSZ A;  5I42 A;  4CGJ A;  1SKW A;  4YFU A;  4JS4 A;  4HTU A;  3P5J A;  3QEV A;  4OPK A;  1KRP A;  3KD1 E;  4E7I A;  4CCH A;  2G8W A;  3L2U A;  4OKJ A;  3HL8 A;  3AVI A;  5KI6 A;  4E7K A;  1K6Y A;  3L3V A;  4CHO A;  3MED A;  3LAK A;  4M3T A;  3MEE A;  1C6V A;  1RBU A;  2ATQ A;  2G8H A;  2F8S A;  3DM2 A;  4GVM A;  4H4O A;  4B8C A;  4CEE A;  3KLG A;  4F2S A;  3TAB A;  4CGD A;  1WN7 A;  3DMJ A;  3LPU A;  5C24 A;  5HP1 A;  4LD0 A;  4CGI A;  4AHS A;  1KSP A;  1IH7 A;  4I2Q A;  3KK2 A;  4BE0 A;  2HHX A;  2FC0 A;  5J2M A;  3PO4 A;  3SI6 A;  1IG9 A;  3BGR A;  3OY9 A;  2HND A;  3HVR A;  1F21 A;  1C1A A;  2B4J A;  1SL0 A;  1BQM A;  1WSG A;  4M3R A;  3ZSY A;  1HMV A;  1UA1 A;  4DQR A;  3AV9 A;  3KLE A;  3TAM A;  2ZE2 A;  3NH1 A;  3ZSQ A;  3PO5 A;  4NYN A;  3U3Y A;  4RG8 A;  4XIU A;  4DQS A;  3DYA A;  3L2R A;  4CEB A;  2ITG A;  2BGG A;  3IS9 A;  4WE1 A;  4CGG A;  1S6P A;  2IAJ A;  4FM0 A;  1GOA A;  4BDP A;  5SWM A;  1NK5 A;  1CXQ A;  4CEC A;  2HB5 A;  4FK2 A;  3ZT4 A;  3QEW A;  3NGZ A;  3OYB A;  3PV8 A;  1D5A A;  3AVB A;  2PY5 A;  1JLC A;  3AVH A;  3DRP A;  1FKP A;  3CG7 A;  3K5O A;  5CZ2 A;  1C1B A;  1X1P A;  4CK1 A;  2WOM A;  1WLJ A;  3VQ6 A;  4OPJ A;  3JYT A;  3I0R A;  4KPY A;  4CEZ A;  4PWD A;  1X9S A;  5HRO A;  2BAN A;  1NK4 A;  1D8Y A;  1RDD A;  1NK0 A;  1HQU A;  2JGU A;  2OPP A;  4CES A;  4NCA A;  4I2P A;  4FM1 A;  4CEF A;  4OLB A;  4KTQ A;  1U47 A;  4BE1 A;  1VSJ A;  4TSX A;  3WNG A;  3CQ8 A;  1KFD A;  4IFY A;  4R5P A;  2O4I A;  1EET A;  4FW1 A;  1ZBH A;  2X6S A;  1JLA A;  1IKY A;  1HNI A;  4CJR A;  1Y97 A;  4DSJ A;  4B3O A;  3AO3 A;  4CK2 A;  3HST B;  5KTQ A;  3OYJ A;  4B9T A;  4FXD A;  4F4K A;  3TR8 A;  4G1Q A;  2AJQ A;  5SZT A;  5FRN A;  1EP4 A;  2D0C A;  2X78 A;  3KKS A;  4B9S A;  1BQN A;  4CEQ A;  4AHT A;  4BAC A;  4DTO A;  4CJP A;  4CF1 A;  1ASV A;  1N5Y A;  1ITG A;  1FXX A;  3NAE A;  2E6L A;  3G0Z A;  1X9W A;  3NGY A;  4B9N A;  1NJX A;  3NCI A;  3ALY A;  4ICL A;  1LAV A;  1W9H A;  2YHA A;  2ZD1 A;  3AVN A;  2XY6 A;  2F8T A;  3K5M A;  3QIO A;  4DSF A;  4KHU A;  4KRE A;  1JLB A;  1DLO A;  1HRH A;  3OYN A;  4FZY A;  3KTQ A;  2HNZ A;  3K5N A;  1TK0 A;  2GBZ A;  4C8N A;  3AVG A;  4M45 A;  4CE9 A;  2KFN A;  2QKB A;  3PUF A;  4H8K A;  4B9M A;  3QEI A;  3PX4 A;  2VG7 A;  4Z4H A;  3DLK A;  1NJZ A;  3I0S A;  1TV6 A;  2HMI A;  3ZSW A;  1MU2 A;  4Y1C A;  3RTV A;  1J53 A;  4FLY A;  3VQ5 A;  2Q3S A;  3RRG A;  2OYQ A;  1ZBF A;  3IG1 A;  3VQQ A;  3LAN A;  3OJU A;  4KKO A;  3QNN A;  2W42 A;  1IKX A;  1RT2 A;  2P51 A;  1IO2 A;  1BI4 A;  4CJW A;  1NOY A;  4KHS A;  3KJV A;  4AH9 A;  3L2V A;  3LPT A;  3ZCM A;  3OJS A;  4CGH A;  1RDA A;  4FW2 A;  3LDS A;  5J2N A;  4AHR A;  5E41 A;  3OYE A;  1LWC A;  2A1S A;  2XRI A;  3V1R A;  1J54 A;  1Q9Y A;  2B6A A;  4FJG A;  4HUE A;  3SJJ A;  4FK4 A;  4CIG A;  2VG6 A;  4KB0 A;  1LWF A;  3I8D A;  4DQQ A;  1O1W A;  4DLG A;  3AA5 X;  4Z4C A;  3NF6 A;  1RT4 A;  1S1T A;  1TKT A;  1S9G A;  3HPG A;  2PYL A;  3HPO A;  2QKK A;  2HHQ A;  4CER A;  1CZB A;  3V4I A;  4B9L A;  4Z0U A;  1T8E A;  1HPZ A;  3F9K A;  3ZT1 A;  1YVU A;  3DLH A;  2OZM A;  3IAY A;  1L3V A;  3SV4 A;  4DTR A;  3U6F A;  4KV8 A;  1J9A A;  1S1V A;  3G10 A;  4BWJ A;  4DFJ A;  2QK9 A;  1UWB A;  4L8R B;  2YKN A;  4C8L A;  1RTJ A;  3DLE A;  4F8R A;  2ZQB A;  1EXQ A;  1WAF A;  3K57 A; 
#chains in the Genus database with same CATH topology
 1L3T A;  3B6O A;  3BZK A;  4N56 A;  3P38 A;  3OYL A;  3DLB A;  1WSI A;  4ISF A;  3EY1 A;  4V19 S;  2WTU A;  4DTN A;  3FZK A;  3VEY A;  3J8A A;  3M3Z A;  4JKE A;  3J7A P;  2HHU A;  3BF3 A;  3OYF A;  3L2W A;  5LMN K;  1MWM A;  3ULD A;  4JI4 K;  1YI2 N;  3OYC A;  1CZ9 A;  2YNG A;  2OZS A;  2O8F B;  3K5L A;  1BHL A;  2G8U A;  4FZZ A;  1VSD A;  2XY7 A;  3AA4 A;  2D0B A;  2YNF A;  4QCL A;  1TVR A;  3P1G A;  4CZJ A;  1VSE A;  4BQZ A;  4EAH D;  4MDA A;  3S9H A;  1WSF A;  3DXK B;  4W5Q A;  3CCU N;  3LDQ A;  3W3D A;  1GOC A;  1HKC A;  4FJX A;  1D9F A;  3VQ7 A;  4FJL A;  1LW0 A;  1VSM A;  4N76 A;  3VQA A;  2EX3 A;  3DOK A;  1CLQ A;  2ZGZ A;  3I8B A;  1DT9 A;  2JLE A;  3MMV A;  3MAQ A;  1JCG A;  2Y1J A;  4BVO A;  4CJS A;  4CJ3 A;  4JKG B;  1X3N A;  1VSI A;  1TUU A;  4X64 K;  1VQL N;  5J2P A;  1BIS A;  4E19 A;  4Z94 A;  3QET A;  2YCH A;  4B1V A;  5KQD A;  3CJC A;  3LDL A;  4DFM A;  4EP5 A;  2A1R A;  4K25 A;  1P8Z A;  4W5T A;  3PSI A;  1TKD A;  4E0D A;  4FOI A;  4KAZ A;  5LL6 Z;  1T05 A;  3TI0 A;  4O55 A;  3DLG A;  4C8K A;  4WQ4 C;  2D1K A;  1VRT A;  4IO9 L;  4CFA A;  3V9W A;  4FJI A;  4A5A A;  5C15 A;  4DHY A;  2P9P B;  4CJK A;  1Q8I A;  4DUZ K;  2QTD A;  4H03 B;  5C12 A;  3HM9 A;  4DR6 K;  4F3T A;  4B1X B;  2A3Z A;  3AVM A;  3K59 A;  2HNY A;  4BRI A;  3CXC M;  1XQS C;  5BRH A;  4I7F A;  1VQ7 N;  2Q36 A;  1KVB A;  3CC4 N;  2IGI A;  4DU3 A;  4C8O A;  4E3S A;  3CFR A;  1SL2 A;  3OYK A;  1IBL K;  3ITH A;  1UOC A;  3S41 A;  3HP6 A;  4FJ5 A;  3HP9 A;  4E7H A;  5DK5 A;  1QHT A;  3I33 A;  2YHB A;  1XHZ A;  2FSK A;  3L3U A;  2YHX A;  3FZH A;  3IRX A;  2X6N A;  3OTO K;  3CCE N;  4QOZ B;  4HVJ A;  4YOV A;  4DMN A;  3NDK A;  4FCY A;  2E8A A;  1ZC6 A;  3A5L C;  4A61 A;  2E2N A;  4IO8 A;  3M8Q A;  4M42 A;  1NGE A;  3G4S N;  2IC3 A;  5AZJ B;  4HWI A;  2HF4 A;  4FK0 A;  4DUY K;  4DTX A;  4UY8 O;  3CC7 N;  3OW2 M;  5BN9 A;  2XY5 A;  4ZTF A;  2I7P A;  4AM7 A;  4CHY A;  2VGM A;  1VSF A;  3SPZ A;  3WNF A;  1MA9 B;  1BCM A;  5M1N A;  3HT3 A;  4I9Q A;  1G99 A;  4FJM A;  5DM7 L;  1VQP N;  1SV5 A;  1RBV A;  1VQ9 N;  2DFE A;  3ZX3 A;  4IOA L;  2P9K A;  1JLQ A;  3QIP A;  4Z4F A;  4CZI A;  3LP3 A;  1QQC A;  1RCH A;  2O8F A;  5JS2 A;  3TAQ A;  1A5V A;  4DTP A;  5GAH P;  2IVN A;  3OYG A;  4FJ8 A;  1RDU A;  4M7Y A;  4NO7 A;  1V4S A;  3RWU A;  2P9U B;  4FJH A;  3FLC O;  3P39 A;  4CZF A;  1KLN A;  3CM5 A;  4KTW A;  1ZYQ A;  2OAN A;  3HK2 A;  3VGK A;  2BTF A;  3ISN C;  2GUI A;  3AVK A;  3KLF A;  5T7B A;  3JSM A;  1HNW K;  1TL1 A;  2EWS A;  3H3N O;  4CIE A;  3OS0 A;  3FFK B;  4BGB A;  3MXI A;  1YAG A;  3K58 A;  4KH4 A;  4MLH A;  1EWR A;  3AY9 A;  1VAZ A;  4AHU A;  1GLF O;  4IXC A;  1Z25 A;  2KHO A;  1NK6 A;  3AGR A;  3VQB A;  4WQ4 A;  4OGE A;  4O5F A;  4E7L A;  3HJF A;  4EP4 A;  1RBT A;  1RBS A;  4YOW A;  1JCE A;  4U7B A;  3T1H K;  2P9N B;  2VG5 A;  1SQK A;  3NMU A;  4MFB A;  1RT3 A;  4M3Y A;  4AF1 A;  4NB4 A;  5EVZ A;  3VEV A;  4AIL C;  4ELV A;  1A5X A;  4H5R A;  4IJN A;  1B92 A;  4IWV A;  1TK5 A;  5CYQ A;  3GDQ A;  4PQU A;  4BRE A;  4K8X A;  2KZZ A;  1UAX A;  3JXU A;  1S9E A;  4X65 K;  3UKR B;  1BA0 A;  4EZ9 A;  2B5J A;  3PIO L;  1C0F A;  4NLC A;  3TAP A;  4FM2 A;  2RN2 A;  3NF8 A;  2PBD A;  3RSE A;  4BRN A;  3D6R A;  4BG8 A;  4BC2 A;  1WB9 A;  4M3U A;  4NXN K;  3NHG A;  3DJC A;  5FRO A;  4A57 A;  1Q18 A;  3SLC A;  1YIJ N;  1IJJ A;  3CQY A;  2H3G X;  1T6D A;  4PY5 A;  4XH5 A;  3MDQ A;  3G25 A;  4YOT A;  3CM6 A;  1S1W A;  5LJV A;  3MEG A;  3CPW M;  2VWK A;  4HHT A;  4CJQ A;  2LSN A;  4FJN A;  2P9I B;  2F96 A;  2RF2 A;  3VER A;  3LDN A;  4OPK A;  1KRP A;  5BPL A;  4CCH A;  3HL8 A;  5KI6 A;  1K6Y A;  4JI2 K;  3MEE A;  3PLA A;  2ATQ A;  4H4O A;  3WXL A;  4BC5 A;  3TAB A;  4CGD A;  1WN7 A;  4FOE A;  5C24 A;  5HP1 A;  4LD0 A;  4JI3 K;  4JAX A;  3VES A;  1IH7 A;  3THX A;  2FC0 A;  2HHX A;  3PO4 A;  3D2F A;  3OY9 A;  4IEI A;  1F21 A;  1C1A A;  5TKW A;  4M3R A;  1EWQ A;  3Q7C A;  4XIU A;  4DQS A;  3DXM A;  4CEB A;  1NGC A;  4FWM A;  1S6P A;  1IV0 A;  1NK5 A;  4CEC A;  3OYB A;  3PV8 A;  1V4T A;  3K5O A;  2HBJ A;  3VA0 A;  3JYT A;  3TAG A;  1X1P A;  4O8U A;  1WLJ A;  1IBM K;  1RDD A;  4H0P A;  4BC4 A;  2OPP A;  4CBU A;  5KQ8 A;  4I2P A;  4DV4 K;  4NCA A;  4BE1 A;  4FVU A;  3WNG A;  5JMV A;  1KFD A;  4FW1 A;  1NWK A;  3WXK A;  3CCJ N;  1JLA A;  1HNI A;  4OPH A;  3HST B;  4FWR A;  3R6M A;  3KKS A;  2BH1 A;  1BQN A;  3D7E O;  1N33 K;  3CER A;  2E6L A;  1YJN N;  4B9N A;  3TSU A;  4H0Y B;  5AQR A;  3CCV N;  1RDW X;  3KTQ A;  1TK0 A;  3SMS A;  3AVG A;  4M45 A;  3DXK A;  3PUF A;  1QQN A;  2VG7 A;  3PX4 A;  5AQV A;  3RTV A;  4FLY A;  3VQ5 A;  1LOT B;  3OJU A;  3CHW A;  1WBB A;  2YJF A;  3KJV A;  3CET A;  3PSF A;  4FW2 A;  1LWC A;  3VEW A;  2B6A A;  3G71 N;  3MN7 A;  1QQO A;  4FK4 A;  2O8B B;  3KWG A;  3AA5 X;  4Z4C A;  3RSE B;  1S1T A;  2PYL A;  3HPO A;  2QWM A;  1XUP O;  2P9P A;  2QA4 N;  2QKK A;  1CZB A;  4JN4 A;  3I56 N;  1KD1 O;  1T8E A;  1OVQ A;  2WBN A;  2HBM A;  1VQN N;  2O8D B;  1L3V A;  3U6F A;  1NM1 A;  2D4W A;  1GLL O;  1ZBS A;  1RTJ A;  3UKU A;  1EXQ A;  3C6T A;  4EIA A;  3K57 A;  2E4L A;  5DM6 L;  4IG0 A;  3HXM A;  3SUO A;  5GAE P;  3R8E A;  4CZL A;  2P9I A;  2Q1N A;  3J81 O;  1RT6 A;  3TAF A;  1BOT O;  4H4M A;  3ZT3 A;  5FRM A;  3K0S A;  5LMU K;  4DU1 A;  1OVY A;  4MO5 A;  3LAL A;  1J5O A;  4BR2 A;  1S1U A;  2NLX A;  4W5N A;  4O44 A;  4BE2 A;  3LDO A;  3TWH A;  3BP8 A;  3JS6 A;  3AVJ A;  4KHW A;  2HHH K;  5HL7 L;  2F9T A;  4FO0 A;  4KHY A;  1ZBU A;  2DFH A;  3O3H A;  1BGX T;  1JLE A;  2YJE A;  4H0X B;  2Q0R A;  3QB0 A;  3SQ1 A;  1GLB G;  2E6M A;  1TL3 A;  2Z1H A;  3C7N B;  1A5W A;  1NBW A;  5AQH A;  1KCF A;  1VK0 A;  4LF9 K;  4CJT A;  2OPR A;  4CD3 A;  1SUQ A;  3LP0 A;  3W0L A;  4DR1 K;  2D0O A;  1RFQ A;  3VF2 A;  4J2B A;  3OYM A;  4DSE A;  3EE9 A;  1VSK A;  1QSL A;  3THW B;  1C0T A;  3MK6 A;  2E1Z A;  1QS4 A;  2KZM A;  1NGA A;  1LAW A;  1BA1 A;  4BDZ A;  5KPT A;  3H45 C;  3CJ9 A;  5M1K A;  1NGJ A;  3BUZ B;  1BO5 O;  2VWB A;  2IIR A;  5F1X A;  5JLF A;  3DLL L;  1XNR K;  2HST A;  3K2P A;  2XHB A;  4LH4 A;  1TAQ A;  3C6H A;  2QWR A;  2P9L A;  3NVK A;  3SBT A;  3ASM A;  2YNH A;  1OKJ A;  3FZL A;  4DQP A;  4JKH A;  4CZK A;  3EE8 A;  3KWI A;  3NH0 A;  1JXE A;  3V81 A;  4I9L A;  3QNO A;  1TKZ A;  1N34 K;  2IOC A;  3QML A;  2Z1J A;  3L4Q A;  2KQ2 A;  1X9M A;  3CJ7 A;  2UXD K;  4DG1 A;  4E7J A;  4B9V A;  1YUW A;  4ISE A;  3SBG A;  1LCU A;  2QW9 A;  4H5V A;  1HKB A;  2V7Y A;  4Q0B A;  3EEQ A;  2FF6 A;  4XH1 A;  5JVH L;  1T44 A;  3EZ5 A;  3AVA A;  3DAW A;  4CHZ A;  4M3Z A;  4IG3 A;  3M8P A;  3HTV A;  5C2F A;  5AQQ A;  3ATU A;  4WQ5 C;  3AAR A;  3OS2 A;  1HUX A;  4HUF A;  3HOT A;  1NK8 A;  4DSL A;  4QS9 A;  5EU7 A;  1LWE A;  3M6G A;  1RTI A;  4UQG A;  4PUO A;  5D3G A;  1SKS A;  4Z4E A;  3MCA B;  1IKW A;  4JD2 B;  4YOR A;  3VMF B;  1U2V A;  1FK9 A;  3VQ8 A;  3UKR A;  1OH6 A;  3SYZ A;  2G8V A;  3SCX A;  3SPY A;  3ID6 A;  2BE2 A;  1GLJ O;  2P9N A;  3AGK A;  4FLX A;  3BF1 A;  3HI0 A;  1QSY A;  4BRF A;  3VF6 A;  5CY4 A;  3THY B;  3J7Y P;  3KK1 A;  1I39 A;  3AO5 A;  4M63 C;  1XMQ K;  1HNV A;  1K73 O;  4JI8 K;  1VQ4 N;  4OKK A;  1NMN A;  4QAG A;  3CQX A;  1Z26 A;  2IVO A;  1UA0 A;  2HBK A;  3WQT A;  1U4B A;  4J2D A;  3AA3 A;  4FLU A;  3L8B A;  2HBL A;  4DR5 K;  4KRF A;  1LW2 A;  3RR8 A;  4FWN A;  3THW A;  4DCH A;  3D0P A;  3QES A;  2Y1I A;  1SAZ A;  3O80 A;  4CK3 A;  1U04 A;  3VEN A;  3SUQ A;  2HOE A;  2NRX A;  4RW4 A;  4CZH A;  2RKI A;  3PIP L;  1XNQ K;  4IDH A;  4BRA A;  4CHP A;  4M41 A;  5IT9 O;  4IFV A;  1QTM A;  4FPA A;  2D0A A;  4OPA A;  3C65 A;  4GMJ B;  3PX6 A;  3ENO A;  1WNS A;  2NUB A;  2GWJ A;  5CYM A;  3ZSX A;  1FKO A;  3E01 A;  4DFK A;  4FZX C;  1SL1 A;  1D9D A;  4GV6 A;  3NE6 A;  3H1Q A;  1QVF M;  1YXQ A;  3LWM A;  4DKW A;  1GLC G;  4CBW A;  2AA4 A;  1RBR A;  3H46 O;  2E1Y A;  1KVA A;  1NKB A;  3ZT2 A;  3ZX0 A;  2CH5 A;  3R9P A;  3AVF A;  3CMA N;  1VSH A;  3LAM A;  4CI6 A;  4O4G A;  3CCQ N;  1VQO N;  4DU4 A;  4CED A;  2KFZ A;  4M7X A;  4GY2 B;  2NRT A;  4Q5V A;  1T03 A;  2G8K A;  3T69 A;  1TK8 A;  4H0V B;  1VHX A;  5AQM A;  3SAF A;  1NK7 A;  4W5R A;  5HBM A;  4CHQ A;  3HM8 A;  5KRT A;  1YIT N;  3O1W A;  5E26 A;  3GL1 A;  4LFA K;  1DTT A;  5C10 A;  5JVG L;  2Q97 A;  4DR7 K;  4RCH A;  3AO4 A;  3RMA A;  1H1V A;  1NLV A;  5B8H A;  2OTL N;  3TU5 A;  2GEL A;  4BRK A;  4DLE A;  1CZA N;  4GKK K;  1RT7 A;  3ZSZ A;  5I42 A;  4CGJ A;  4CZM A;  4YFU A;  4HTU A;  3QEV A;  3KD1 E;  2G8W A;  2GX9 A;  3MED A;  4LFB K;  2G8H A;  5AQZ A;  2F8S A;  3DM2 A;  4GVM A;  3SK3 A;  1X9J A;  4CEE A;  2O8C A;  4CGI A;  2O8D A;  5EXW A;  4BE0 A;  5J2M A;  1IG9 A;  2HND A;  3VEO A;  3HVR A;  3EKU A;  2B4J A;  4GV3 A;  1SL0 A;  1BQM A;  1U2V B;  3O1B A;  3D2E B;  1WSG A;  3ZSY A;  1HMV A;  3CJA A;  4DQR A;  2FXU A;  2ZE2 A;  4XH4 A;  3PO5 A;  4BVP A;  3DYA A;  3U9D A;  3VF4 A;  2ITG A;  3ATV A;  3C0B A;  4WE1 A;  2IAJ A;  4JKD A;  1GOA A;  2WC9 A;  3ZT4 A;  3AVH A;  5CZ2 A;  3CG7 A;  3KK7 A;  4KPY A;  1NK4 A;  1Z05 A;  5AZI B;  1HQU A;  2JGU A;  1KXP A;  4OLB A;  4KTQ A;  1U47 A;  2ASP A;  4K43 A;  1VSJ A;  5ELZ A;  1Y64 A;  4CJR A;  4DSJ A;  3AO3 A;  4B9T A;  3R3L A;  4BG9 A;  4G1Q A;  3MWT A;  3IUC A;  3SAG A;  2X78 A;  4IOC L;  5EOY A;  3EN9 A;  4DTO A;  4CJP A;  1ASV A;  1N5Y A;  2ZF5 O;  1NGG A;  3G0Z A;  4WQ5 A;  1X9W A;  4JV5 K;  4JI5 K;  3NCI A;  2J4R A;  1LAV A;  2XY6 A;  2ZD1 A;  1Z6R A;  5BPN A;  2F8T A;  3TSQ A;  3K5M A;  4DSF A;  1W97 L;  5MLC Q;  4KHU A;  4KRE A;  3UKU B;  4RWT A;  4FZY A;  3VEX A;  2HNZ A;  2UUC K;  2GBZ A;  4BC3 A;  4X66 K;  1U6Z A;  4Z4H A;  3DLK A;  2HMI A;  3CF5 L;  1YJ9 N;  3AAQ A;  3RRG A;  2OYQ A;  1K8K A;  3IG1 A;  3LAN A;  2PFU A;  3QNN A;  4IOX A;  2P51 A;  1RT2 A;  4CJW A;  1NOY A;  4AH9 A;  3L2V A;  3ENB A;  3LPT A;  5J2N A;  5E41 A;  3V1R A;  2OTJ N;  4HUE A;  3J7Z O;  3SJJ A;  4CIG A;  1W2B M;  3I8D A;  2ASM A;  1BDG A;  4DLG A;  2P9S B;  4PKH A;  2E88 A;  3NF6 A;  4IJA A;  3DWL A;  3HPG A;  3WQU A;  2VQF K;  5AQI A;  5BRD A;  5AQO A;  2HHQ A;  2E2O A;  3QDK A;  3F9K A;  1YVU A;  2OZM A;  3IAY A;  3VTH A;  4KV8 A;  2QK9 A;  4WFA L;  2YKN A;  1D4X A;  4C8L A;  1S3X A;  4F8R A;  1BU6 O;  3CCS N;  4YDU C;  4EHU A;  4WCE L;  1EX4 A;  1Q82 O;  3C95 A;  3O4Q A;  3BY5 A;  3KZB A;  4CF0 A;  4B3T K;  1S6Q A;  3OYA A;  3V6D A;  4ID1 A;  1T3V A;  3RVC A;  1HX1 A;  2QWO A;  1S72 N;  3FZF A;  3O9R A;  2FBX A;  4YY3 K;  3DI6 A;  3F2K A;  2DTU A;  4PKI A;  2D5R A;  2DY4 A;  2YX6 A;  2NRZ A;  1XWL A;  5C42 A;  4CJE A;  3V9S A;  3NH2 A;  1SKR A;  2QWP A;  3F5T A;  3KKR A;  2ZGY A;  1WAJ A;  3T1Y K;  4YDU A;  1J5E K;  3K9K A;  3NF9 A;  4PA1 A;  3LWL A;  4DV1 K;  1N32 K;  4OO1 J;  4FYD A;  4JKC A;  3CFP A;  1YVN A;  4FL9 A;  1YT3 A;  3ZSO A;  4WYB A;  3MXM A;  4BWM A;  5FPE A;  2IS3 A;  1BI4 B;  2Q2R A;  4J2E A;  2DPN A;  2UYT A;  4CF9 A;  1TKX A;  4JD2 A;  2UXB K;  5BRE A;  3VQC A;  3O9S A;  2HHT A;  4JKB A;  4E1M A;  3OYD A;  3QER A;  1P90 A;  2W6K A;  4EFH A;  1KLM A;  2QWN A;  3SJH A;  2NZT A;  1BIZ A;  4DB3 A;  5CR4 A;  4N47 A;  1JCF A;  3CPE A;  2G8I A;  1HYS A;  4XEI A;  2Q31 A;  4BRL A;  3O08 A;  3M8R A;  5GAG P;  2G8F A;  3TPQ A;  3LDP A;  2HVI A;  2WON A;  3NFA A;  1VSL A;  2PYJ A;  3VA3 A;  5FPD A;  2WUS A;  3QEP A;  4DS4 A;  4A2A A;  4O8K A;  4DTM A;  1S1X A;  1R59 O;  2ZWH A;  4CJL A;  1B9F A;  2JWL A;  1U49 A;  1HJR A;  5DMR A;  1TUY A;  3E1Y A;  3VQ4 A;  4O0J A;  5M1Q A;  4DSI A;  2FBT A;  4KB1 A;  3SUP A;  3TSP A;  3SZ2 A;  5E84 A;  4ELT A;  4KH5 A;  3O6W A;  1IG8 A;  3KLI A;  3TAR A;  3WXM B;  5I3U A;  4A5B A;  5CZ1 A;  1VQ6 N;  3SUN A;  1C1C A;  3RMD A;  3RR7 A;  4QS8 A;  3OYH A;  4FLT A;  4CF2 A;  3T7Z A;  4GVE A;  1GOB A;  3OYI A;  5AQK A;  4FWK A;  3T19 A;  4JI0 K;  3GG4 A;  2ZM6 K;  2HHS A;  2FBV A;  1HYV A;  3HO1 A;  1T6C A;  1S5J A;  1NNE A;  3O5B A;  1BUP A;  1NMD A;  1RIL A;  4KHQ A;  4B1U B;  4PHT X;  1U48 A;  1S22 A;  2XY8 A;  3L4I A;  1OH5 A;  3DRR A;  3DOL A;  3CC2 N;  1NGB A;  2KTQ A;  4ID5 A;  1ASU A;  4CJU A;  3QBW A;  3CJ1 A;  4JNE A;  3LZJ A;  3C94 A;  2ZJQ L;  3WUH A;  1TGO A;  3AA2 A;  4DSK A;  3VGM A;  3ZET A;  3HVT A;  4B9U A;  3AO2 A;  3SMP A;  3SQ4 A;  4WFB L;  2P5O A;  1EQY A;  5GIO A;  2F7T A;  2HW3 A;  3ZT0 A;  4BDY A;  4BR9 A;  5M1P A;  3HYF A;  5AQF A;  5CHI A;  1ZBL A;  4LSN A;  1BL3 A;  4FWL A;  5GIN A;  1BIU A;  5HRR A;  1HYZ A;  2YHW A;  1JJ2 M;  2Q0U A;  4CFD A;  5HRN A;  3EO3 A;  1LV5 A;  1XHX A;  4OVL A;  4RW8 A;  4AHV A;  4J8F A;  4R79 A;  5K14 A;  2A41 A;  1Q7Y O;  4CBX A;  1O13 A;  1WSJ A;  1K8A O;  2PZS A;  3CI5 A;  2O4G A;  5BR9 A;  4JK9 A;  5HRS A;  2VCP A;  2F4V K;  1N36 K;  5JLH A;  2OPQ A;  3PY8 A;  4ELU A;  1R0A A;  3H6E A;  1JLF A;  2BDP A;  4FLZ A;  5KRS A;  1DEJ A;  1HNX K;  5ADX H;  3HRG A;  4OKE A;  1WSH A;  4JRP A;  4LY7 A;  4GNI A;  3SQ0 A;  3M8S A;  2CGK A;  2YKM A;  5A2Q O;  3B6P A;  4HCC A;  2FSN A;  2I7N A;  3VQP A;  5F0X A;  1XI1 A;  2V51 B;  4FJJ A;  4CJ4 A;  3UE5 A;  1JKH A;  1E4F T;  3T3F A;  1JXB A;  5J2Q A;  1KFS A;  2UXC K;  4KBO A;  5AJ3 K;  4N5S A;  2P9U A;  3D2E A;  1VQM N;  4J2A A;  3O9U A;  3H1V X;  4BRG A;  4CD1 A;  4FWQ A;  4O5B A;  5FDL A;  4CEA A;  4ZTJ A;  1NK9 A;  1ILY A;  5AR0 A;  3BEX A;  3A5N C;  1XC9 A;  5J1E A;  2A42 A;  1RTH A;  4KTZ A;  5BR8 K;  3T1A A;  3WXJ A;  4BGA A;  4NCG A;  4CHN A;  3M5R A;  3NF7 A;  3ENH A;  4AHC A;  3KK3 A;  4JKA A;  4DF4 A;  2A5X A;  3CCR N;  2QXF A;  2RPI A;  3QLH A;  4CGF A;  3QFU A;  4LC9 B;  4KI4 A;  2VWJ A;  3CFO A;  1YTU A;  5I9E B;  2QM1 A;  3ULE B;  2DFF A;  4BRC A;  3TAN A;  3A0I X;  3KIO A;  3O9Q A;  3C6U A;  4LF7 K;  1JLG A;  3FR0 A;  3O4N A;  2CH6 A;  4KH6 A;  1U45 A;  3V9Z A;  1ESV A;  1SKW A;  3B8A X;  3TTF A;  4JS4 A;  3N4Q A;  3L2U A;  4OKJ A;  3AVI A;  4E7K A;  3IKM A;  4FPB A;  4MO4 A;  4CHO A;  3LAK A;  1C6V A;  4F2S A;  4B8C A;  4BRD A;  3AAP A;  4QS7 A;  2A40 A;  4AHS A;  1GLA G;  4I2Q A;  2QI2 A;  4DV5 K;  4YOY A;  1QQM A;  3VEZ A;  1UA1 A;  1NGH A;  4MLE A;  3G6E N;  3KLE A;  3NH1 A;  4L3Q A;  3ZSQ A;  4NYN A;  3U3Y A;  4RG8 A;  2BGG A;  4F9O A;  3IS9 A;  1VQ5 N;  4FM0 A;  5SWM A;  5TKY A;  4CZG A;  1CXQ A;  2FSJ A;  1HPM A;  2HB5 A;  3QEW A;  4DV3 K;  3AVB A;  5AZJ A;  3DRP A;  1FKP A;  4W5O A;  2QEX N;  4CK1 A;  2WOM A;  3VQ6 A;  3L0Q A;  4CEZ A;  2AP1 A;  5KPZ A;  1X9S A;  4PWD A;  2BAN A;  1D8Y A;  3QFP A;  1NGF A;  4CEF A;  1XC3 A;  3CQ8 A;  2O4I A;  1EET A;  2GEM A;  2W41 A;  1IKY A;  2F9W A;  3VGL A;  4K42 A;  4CK2 A;  4X62 K;  4FXD A;  4F4K A;  3TR8 A;  4HTL A;  4CEQ A;  1HNZ K;  4BAC A;  3EKS A;  4CF1 A;  4BY9 C;  3NAE A;  1TYQ A;  2FLO A;  3CCM N;  2GWK A;  2ASO A;  1M90 O;  3ALY A;  2QWL A;  4H5N A;  3AVN A;  3CCL N;  2RHK A;  2V52 B;  4LF8 K;  1JLB A;  1DLO A;  3FE1 A;  3K5N A;  3H3O B;  1GLE G;  4H8K A;  4C1N I;  4E1J A;  3I0S A;  3ZSW A;  2NRV A;  4PKG A;  4Y1C A;  1DKG D;  4KKO A;  2OCE A;  3A5O C;  4K41 A;  1IKX A;  4ISG A;  1BI4 A;  4DV2 K;  5EX5 A;  3ZCM A;  3JAM O;  4CW7 B;  3OJS A;  4CGH A;  1RDA A;  3LDS A;  5M1O A;  5AFU H;  4AHR A;  2A1S A;  2XRI A;  1Q9Y A;  1NG9 A;  2WFB A;  2RE2 A;  4FJG A;  5AQS A;  1QHA A;  4KB0 A;  3FGU A;  4DQQ A;  5LY3 A;  4B1Z A;  1S9G A;  3E9P A;  4IFE A;  4H0O A;  4Z0U A;  1Q81 O;  3GE1 A;  3ZT1 A;  3DLH A;  2HMP A;  3CME N;  3SV4 A;  4CVN E;  5C0Y A;  4DFJ A;  3G10 A;  2PAV A;  3IFR A;  3OA9 A;  5AFU A;  4L8R B;  4JI6 K;  2ITM A;  3TTD A;  5AQN A;  3ULE A;  1WAF A;  3THY A;  1RDC A;  4Y0W A;  3ZEU A;  3HOS A;  4C23 A;  4E1N A;  4FVM A;  4CF8 A;  4OJR A;  2UUA K;  3C6A A;  5BRF A;  1IKV A;  1ZXO A;  5AQT A;  1BWF O;  5H1S Q;  3BDP A;  3MXJ A;  3V1Q A;  4FLW A;  2IVP A;  2O8B A;  4DS5 A;  3DLR A;  1NGD A;  2W40 A;  5FLX O;  4JS5 A;  4CIF A;  4K8Z A;  2Z1G A;  4EZ6 A;  4DR4 K;  3C7N A;  3S3N A;  1RDB A;  1W7A A;  4WF9 L;  4BRQ A;  3EZW A;  3F73 A;  1HJO A;  4LH5 A;  4WFN L;  4JK7 A;  3MCP A;  4PL7 A;  3Q7B A;  4C1N K;  1L5U A;  1W0H A;  4BR7 A;  2P9L B;  3HZ6 A;  2E2P A;  4B08 A;  1E3M A;  5AQG A;  5KGW A;  2A6A A;  4DR3 K;  2FBY A;  1SZ2 A;  3NGI A;  1RT1 A;  1C0U A;  4I6M B;  4CJ5 A;  2ZJR L;  3QIC A;  1ATS A;  5C2D A;  4CJF A;  1WSE A;  3HSC A;  4DF8 A;  3RRH A;  4GKJ K;  1QZ5 A;  4ILH A;  4B1Y B;  1HQE A;  4JHD A;  4Y1D A;  3RMB A;  4B3S K;  4F2R A;  3CYM A;  1CXU A;  3LP1 A;  4PL8 A;  3D45 A;  1I3A A;  4BRH A;  3P83 D;  4CEO A;  4CJV A;  5AQY A;  4DV6 K;  4IKF A;  4KHN A;  3AVL A;  3U3G A;  1QZ6 A;  4FWP A;  2E2Q A;  4JRQ A;  1YHQ N;  1MWK A;  3WEE A;  4RW6 A;  3THV A;  4AQY K;  2NRR A;  3QBX A;  5BPM A;  1YTA A;  4GW6 A;  1C0G A;  1ASW A;  3ID8 A;  4U67 L;  1NKE A;  4FJK A;  4NYF A;  3O3F A;  3FFI A;  2HVH A;  2QXL A;  2YNI A;  4M3W A;  5AQP A;  3IDH A;  3O9T A;  2HHV A;  4DWI A;  2R7Y A;  4IZ9 A;  4OLA A;  4AM6 A;  3KHY A;  4FSV A;  3GOI A;  3MEC A;  4FLV A;  3TAE A;  3MN9 A;  1KAZ A;  1VQK N;  1QE1 A;  4MQ3 A;  4KFB A;  3UIQ A;  1NGI A;  4DTJ A;  4JKG A;  4DQ8 A;  1YJW N;  4BQL A;  3SNN A;  4JLH A;  3WNE A;  3MN5 A;  5AQW A;  3SAH A;  2VGN A;  3LL3 A;  4LSL A;  5ADX A;  1RTD A;  1KTQ A;  5IWA K;  3QEX A;  1Q86 O;  3LM9 A;  3MWP A;  4RW7 A;  1BCO A;  5HRP A;  4HUG A;  5HOO A;  3H08 A;  3J80 O;  5JS1 A;  5EY4 A;  1NJY A;  3SV3 A;  1ATR A;  3VPZ A;  1L3U A;  4E89 A;  5M1F A;  3VQD A;  3AO1 A;  3L6Q A;  3VQE A;  1ZBI A;  4CFB A;  3O4W A;  3E66 A;  1YF5 L;  2I5J A;  1RGI A;  2W6L A;  3S3O A;  1OH8 A;  4DQI A;  4IBN A;  2GTD A;  4MDB A;  3WT0 A;  1FJG K;  3A8Y A;  4GV9 A;  4DTU A;  1NJW A;  5KGX A;  5HLF A;  2CGL A;  2HHW A;  3E9L A;  3FZM A;  1KAY A;  1T7P A;  3R1X A;  1ATN A;  5CE3 A;  3OS1 A;  1N6Q A;  5FPM A;  4HCB A;  3QIN A;  2IDO A;  5FPN A;  1QVG M;  4A59 A;  1OH7 A;  1Q9X A;  4DTS A;  4Z4G A;  1RNH A;  2YI1 A;  5AQJ A;  1C0M A;  3NVM A;  1RT5 A;  3WNH A;  4RW9 A;  3CD6 N;  2BUP A;  4B8A B;  1E4G T;  3ZSR A;  1QSS A;  3OVN A;  4K0K K;  4DV0 K;  2OPS A;  1JL1 A;  2YHY A;  4ILG B;  4FJ7 A;  3HBT A;  2HF3 A;  1VQ8 N;  3S3M A;  4B1W B;  1REV A;  2GUP A;  3QO9 A;  1KVC A;  3N4P A;  2P1J A;  3O3G A;  4OX9 K;  4M3X A;  2XO7 A;  4I6M A;  4FWO A;  4IDK A;  4OGC A;  4JI1 K;  5GAD P;  2GV9 A;  3V9X A;  3O8M A;  1HLU A;  1EKE A;  1DGK N;  3WXI A;  4FJ9 A;  4YOU A;  1NU0 A;  2YV0 X;  3F9M A;  2KW4 A;  3KLH A;  2D0P A;  4KI6 A;  4NCB A;  3E9O A;  1HKG A;  3LP2 A;  2V7Z A;  2O8E B;  2P9K B;  3EYZ A;  3AVC A;  3DRS A;  4ZHR A;  3SQ2 A;  1L3S A;  1WBD A;  2P9S A;  3HPH A;  4EHT A;  2EHG A;  4JKF A;  3VN5 A;  4DFP A;  1G15 A;  4DR2 K;  1N8R O;  3V9U A;  3V1O A;  3ZSV A;  4O0I A;  1TAU A;  2ETJ A;  3U9Z A;  1HR0 K;  5C25 A;  2NRH A;  4LF6 K;  1DTQ A;  4C8M A;  2JWK A;  1VRU A;  3OBY A;  3LZI A;  4N41 A;  3KD5 E;  3A2F A;  3PX0 A;  3VTI A;  1KAX A;  4CJ7 A;  3M1F A;  3NBP A;  4BR4 A;  4Z4I A;  4KO0 A;  1TYQ B;  3L2Q A;  4LFC K;  3OHR A;  1EO1 A;  3P31 A;  4B3R K;  1X3M A;  3MX5 A;  1B9D A;  2X74 A;  4NXM K;  4LF5 K;  5BN8 A;  2KLA A;  2OA8 A;  3CIP A;  2VYP A;  1JL2 A;  2QWQ A;  4CFC A;  1NKC A;  2P5G A;  3U4L A;  3VQ9 A;  4YNQ A;  2ZJP L;  1SS6 A;  4F3O A;  1GLD G;  2Z1I A;  4A2B A;  3GBT A;  4H5W A;  1WUA A;  2UUB K;  1NOZ A;  3RMC A;  3K9J A;  3I55 N;  4JYA K;  5AZI A;  3P5J A;  1XMO K;  4E7I A;  4BRO A;  5AQX A;  2VQE K;  2E20 A;  3L3V A;  4M3T A;  2UU9 K;  1RBU A;  4YOX A;  3KLG A;  4RTF D;  3DMJ A;  3LPU A;  4IEE A;  1M1K O;  3VOV A;  1MDU B;  1KSP A;  3TTC A;  3KK2 A;  3U8X A;  5JIC A;  3SI6 A;  2NNW A;  3BGR A;  1WOQ A;  1NJI O;  5AQL A;  3BZC A;  3AV9 A;  3TAM A;  3UB5 A;  4KHP K;  3ZEU B;  5LJW A;  3L2R A;  4G9Z A;  4JEP A;  4CGG A;  4FWS A;  4BDP A;  1BG3 A;  4FK2 A;  3NGZ A;  3ZX2 A;  1D5A A;  5F2R A;  2PY5 A;  1JLC A;  1C1B A;  4OPJ A;  4NLB A;  3MX2 A;  3I0R A;  5HRO A;  1KQS M;  1NK0 A;  3P4I A;  4CES A;  4B3M K;  4FM1 A;  3MN6 A;  4ILJ A;  4TSX A;  4IFY A;  4R5P A;  1ZBH A;  4BRP A;  2X6S A;  1I94 K;  2O8C B;  2E5L K;  1Y97 A;  4B3O A;  5KTQ A;  3OYJ A;  4A62 A;  2AJQ A;  3ZYY X;  5SZT A;  5FRN A;  2CGJ A;  1EP4 A;  2D0C A;  4B9S A;  4AHT A;  3LM2 A;  4H5T A;  1ITG A;  1FXX A;  3IMX A;  1K9M O;  3NGY A;  1NJX A;  4ICL A;  1W9H A;  3CJB A;  2YHA A;  3DXM B;  1K8K B;  3QIO A;  4JK8 A;  3OYN A;  1HRH A;  1J6Z A;  4CZE A;  5GIP A;  5KPR A;  4C8N A;  4CE9 A;  2KFN A;  2QKB A;  4B9M A;  3QEI A;  1NJZ A;  4B9Q A;  1TV6 A;  2NRW A;  3VET A;  1MU2 A;  1J53 A;  3KVG A;  2Q3S A;  1ZBF A;  3VQQ A;  3THX B;  2W42 A;  2FF3 B;  1IO2 A;  4KHS A;  4H0T B;  3A5M C;  2O8E A;  4YHH K;  3OYE A;  5AQU A;  3ZLJ A;  1J54 A;  3ZET B;  4BR5 A;  4BRM A;  2VG6 A;  1LWF A;  1O1W A;  4JHD B;  1RT4 A;  1TKT A;  4LF4 K;  1IBK K;  3OBW A;  4CER A;  1KC8 O;  3V4I A;  4B9L A;  4JI7 K;  2KKZ A;  1HPZ A;  3EL2 A;  1FW6 A;  4DTR A;  4BR0 A;  4BWJ A;  1J9A A;  1S1V A;  1UWB A;  3D2F B;  3DLE A;  4DV7 K;  2ZQB A;  3WEE B; 
#chains in the Genus database with same CATH homology
 2E4L A;  1EX4 A;  3C95 A;  3O4Q A;  1RDC A;  3B6O A;  4IG0 A;  1L3T A;  4CF0 A;  3HXM A;  4N56 A;  3SUO A;  4E1N A;  3OYL A;  3DLB A;  4FVM A;  1WSI A;  4CF8 A;  1S6Q A;  3OYA A;  3EY1 A;  4ID1 A;  4OJR A;  3V6D A;  4DTN A;  3VA0 A;  3TAG A;  1RT6 A;  3TAF A;  1IKV A;  4H4M A;  3ZT3 A;  5FRM A;  2HHU A;  2FBX A;  3BDP A;  4DU1 A;  3DI6 A;  3MXJ A;  3OYF A;  3L2W A;  3V1Q A;  4FLW A;  3LAL A;  1J5O A;  1S1U A;  3ULD A;  2DTU A;  2D5R A;  3OYC A;  2DY4 A;  1CZ9 A;  4DS5 A;  2YNG A;  4W5N A;  3DLR A;  4O44 A;  4BE2 A;  2OZS A;  1XWL A;  3K5L A;  4JS5 A;  4CIF A;  4K8Z A;  5C42 A;  1BHL A;  2Z1G A;  4CJE A;  2G8U A;  3TWH A;  1VSD A;  4EZ6 A;  4FZZ A;  2XY7 A;  3AA4 A;  3V9S A;  2D0B A;  3NH2 A;  2YNF A;  1SKR A;  3AVJ A;  4QCL A;  3KKR A;  1TVR A;  3P1G A;  3S3N A;  1VSE A;  1RDB A;  4KHW A;  3S9H A;  1WSF A;  4W5Q A;  3F73 A;  1WAJ A;  4LH5 A;  3NF9 A;  4KHY A;  4PA1 A;  3LWL A;  1ZBU A;  2DFH A;  3O3H A;  1GOC A;  1L5U A;  1BGX T;  1JLE A;  4FYD A;  3CFP A;  4FJX A;  1W0H A;  1D9F A;  3SQ1 A;  1YT3 A;  3VQ7 A;  3ZSO A;  4FJL A;  3MXM A;  4BWM A;  1LW0 A;  1VSM A;  2IS3 A;  1BI4 B;  3VQA A;  4B08 A;  2EX3 A;  3DOK A;  4J2E A;  4N76 A;  1CLQ A;  2E6M A;  1TL3 A;  5KGW A;  2Z1H A;  4CF9 A;  2JLE A;  1A5W A;  1TKX A;  2FBY A;  3MAQ A;  1KCF A;  1VK0 A;  1RT1 A;  1C0U A;  4CJ5 A;  3VQC A;  4CJT A;  3NGI A;  2Y1J A;  2OPR A;  1SUQ A;  3LP0 A;  4CJF A;  4CJS A;  2HHT A;  1WSE A;  4E1M A;  3OYD A;  3RRH A;  4DF8 A;  3QER A;  3C6T A;  4CJ3 A;  4J2B A;  1HQE A;  1VSI A;  3OYM A;  4DSE A;  4Y1D A;  5J2P A;  1KLM A;  1VSK A;  1BIS A;  4E19 A;  3QET A;  3RMB A;  1QSL A;  4F2R A;  3CYM A;  1CXU A;  3LP1 A;  1C0T A;  3D45 A;  1I3A A;  1BIZ A;  1QS4 A;  3P83 D;  4CEO A;  4CJV A;  4N47 A;  4EP5 A;  4DFM A;  2A1R A;  4IKF A;  4W5T A;  4KHN A;  3AVL A;  2G8I A;  1HYS A;  3U3G A;  1LAW A;  3M8R A;  2G8F A;  1TKD A;  4E0D A;  4BDZ A;  4JRQ A;  4KAZ A;  2HVI A;  2WON A;  4RW6 A;  3NFA A;  3THV A;  1VSL A;  1T05 A;  3TI0 A;  2PYJ A;  3VA3 A;  4O55 A;  1YTA A;  3DLG A;  4GW6 A;  4C8K A;  1ASW A;  1NKE A;  4FJK A;  4NYF A;  3O3F A;  3K2P A;  3FFI A;  4DS4 A;  3QEP A;  2HVH A;  2XHB A;  4LH4 A;  1VRT A;  1TAQ A;  2YNI A;  4M3W A;  4DTM A;  4CFA A;  1S1X A;  3ASM A;  2YNH A;  3V9W A;  2HHV A;  4DWI A;  4FJI A;  4DQP A;  4CJL A;  1B9F A;  3NH0 A;  2R7Y A;  4CJK A;  1U49 A;  1HJR A;  5DMR A;  4OLA A;  1JXE A;  1Q8I A;  3VQ4 A;  3MEC A;  3HM9 A;  4FLV A;  3V81 A;  3TAE A;  4O0J A;  4DSI A;  4F3T A;  4I9L A;  2FBT A;  3QNO A;  4KB1 A;  3AVM A;  3K59 A;  2HNY A;  1TKZ A;  3SUP A;  1QE1 A;  4MQ3 A;  3SZ2 A;  2IOC A;  4KFB A;  4ELT A;  3UIQ A;  4DTJ A;  2Z1J A;  4I7F A;  2KQ2 A;  1X9M A;  3KLI A;  1KVB A;  3TAR A;  3SNN A;  2IGI A;  4JLH A;  4DU3 A;  3WNE A;  5I3U A;  4C8O A;  5CZ1 A;  4E3S A;  4DG1 A;  3CFR A;  4E7J A;  3OYK A;  1SL2 A;  4B9V A;  3ITH A;  3SUN A;  1UOC A;  4LSL A;  3HP6 A;  1C1C A;  1RTD A;  1KTQ A;  4FJ5 A;  3RMD A;  3RR7 A;  3QEX A;  3OYH A;  4FLT A;  3HP9 A;  4CF2 A;  4RW7 A;  4E7H A;  1GOB A;  5DK5 A;  1BCO A;  1QHT A;  2YHB A;  3OYI A;  5HRP A;  4HUG A;  3L3U A;  1XHZ A;  3T19 A;  3H08 A;  5JS1 A;  4Q0B A;  1NJY A;  3SV3 A;  1L3U A;  4E89 A;  3VQD A;  3AO1 A;  3VQE A;  1ZBI A;  3IRX A;  2X6N A;  4QOZ B;  4HVJ A;  3EZ5 A;  3AVA A;  4CFB A;  2HHS A;  2FBV A;  4DMN A;  3NDK A;  4FCY A;  1HYV A;  4CHZ A;  2I5J A;  4M3Z A;  3HO1 A;  1S5J A;  4IG3 A;  3S3O A;  3M8P A;  4DQI A;  3M8Q A;  4M42 A;  4IBN A;  1RIL A;  3OS2 A;  4KHQ A;  4W5O A;  1U48 A;  4HUF A;  2XY8 A;  1NK8 A;  2IC3 A;  3DRR A;  4DTU A;  3DOL A;  1NJW A;  4DSL A;  2KTQ A;  4ID5 A;  1ASU A;  4FK0 A;  4CJU A;  5KGX A;  4DTX A;  5HLF A;  2XY5 A;  4ZTF A;  3LZJ A;  3C94 A;  2HHW A;  1TGO A;  5EU7 A;  3AA2 A;  4DSK A;  4CHY A;  1LWE A;  3SPZ A;  1VSF A;  3HVT A;  4B9U A;  1T7P A;  3AO2 A;  3WNF A;  3SQ4 A;  1RTI A;  4UQG A;  2P5O A;  4PUO A;  1BCM A;  3OS1 A;  5D3G A;  1N6Q A;  3HT3 A;  4HCB A;  1SKS A;  4I9Q A;  4Z4E A;  2HW3 A;  3QIN A;  4FJM A;  2IDO A;  1IKW A;  3ZT0 A;  4BDY A;  1SV5 A;  1RBV A;  2DFE A;  1FK9 A;  3VQ8 A;  3HYF A;  1JLQ A;  3QIP A;  1ZBL A;  4LSN A;  1Q9X A;  4Z4F A;  1BL3 A;  4DTS A;  4Z4G A;  1RNH A;  1QQC A;  1BIU A;  1RCH A;  3LP3 A;  5HRR A;  3SYZ A;  2G8V A;  1HYZ A;  3SCX A;  1C0M A;  3SPY A;  5JS2 A;  3TAQ A;  1A5V A;  4DTP A;  2BE2 A;  4CFD A;  5HRN A;  1RT5 A;  3WNH A;  4RW9 A;  1LV5 A;  3OYG A;  4FJ8 A;  4FLX A;  1XHX A;  4B8A B;  4OVL A;  4RW8 A;  3ZSR A;  1QSS A;  3OVN A;  4AHV A;  1QSY A;  5CY4 A;  3RWU A;  5K14 A;  4FJH A;  3KK1 A;  1WSJ A;  1I39 A;  3AO5 A;  2OPS A;  1JL1 A;  2PZS A;  4FJ7 A;  1KLN A;  1HNV A;  2O4G A;  3CM5 A;  3S3M A;  4KTW A;  1REV A;  1ZYQ A;  4OKK A;  3QO9 A;  1KVC A;  3O3G A;  2P1J A;  4M3X A;  3HK2 A;  5HRS A;  3ISN C;  2GUI A;  3AVK A;  4QAG A;  3KLF A;  2XO7 A;  5T7B A;  3JSM A;  1Z26 A;  1UA0 A;  1TL1 A;  2OPQ A;  4IDK A;  4OGC A;  4CIE A;  3OS0 A;  1R0A A;  3PY8 A;  4ELU A;  3V9X A;  2GV9 A;  1JLF A;  3MXI A;  1U4B A;  1EKE A;  3AA3 A;  2BDP A;  4J2D A;  4FJ9 A;  3K58 A;  4FLU A;  3L8B A;  2KZM A;  2YV0 X;  4FLZ A;  2KW4 A;  5KRS A;  3KLH A;  4KRF A;  1LW2 A;  4OKE A;  4AHU A;  3RR8 A;  1WSH A;  4JRP A;  4NCB A;  4LY7 A;  4KI6 A;  1Z25 A;  3SQ0 A;  3D0P A;  3M8S A;  3QES A;  1NK6 A;  3LP2 A;  2Y1I A;  2YKM A;  3VQB A;  4CK3 A;  3EYZ A;  3B6P A;  4OGE A;  1U04 A;  4E7L A;  3HJF A;  4HCC A;  3SUQ A;  4EP4 A;  3VQP A;  1RBT A;  4FJJ A;  1XI1 A;  3AVC A;  4RW4 A;  1RBS A;  2RKI A;  3DRS A;  4CJ4 A;  1JKH A;  4ZHR A;  3SQ2 A;  3T3F A;  1L3S A;  4CHP A;  3HPH A;  4M41 A;  4IFV A;  1QTM A;  1JXB A;  2D0A A;  5J2Q A;  2EHG A;  2VG5 A;  3VN5 A;  1KFS A;  4MFB A;  4GMJ B;  1RT3 A;  4M3Y A;  3PX6 A;  4DFP A;  4N5S A;  1G15 A;  4J2A A;  4AIL C;  3V9U A;  3V1O A;  3ZSV A;  1WNS A;  2NUB A;  4O0I A;  4ELV A;  5CYM A;  3ZSX A;  2ETJ A;  1A5X A;  1TAU A;  1B92 A;  1FKO A;  3E01 A;  5C25 A;  1TK5 A;  4O5B A;  4DFK A;  4FZX C;  1DTQ A;  5CYQ A;  5FDL A;  4CEA A;  4ZTJ A;  4C8M A;  1SL1 A;  1NK9 A;  1D9D A;  4PQU A;  3NE6 A;  4K8X A;  1VRU A;  3LZI A;  2KZZ A;  4N41 A;  1UAX A;  3KD5 E;  3A2F A;  1S9E A;  3PX0 A;  1XC9 A;  3LWM A;  5J1E A;  3NBP A;  4Z4I A;  1RBR A;  1RTH A;  4KO0 A;  3L2Q A;  4EZ9 A;  4KTZ A;  1KVA A;  3T1A A;  1NKB A;  3ZT2 A;  2B5J A;  3AVF A;  3TAP A;  1VSH A;  4FM2 A;  2RN2 A;  3NF8 A;  1B9D A;  2X74 A;  3LAM A;  4NCG A;  4CHN A;  4O4G A;  3NF7 A;  4AHC A;  4DU4 A;  2OA8 A;  3KK3 A;  4M3U A;  4CED A;  2KFZ A;  1JL2 A;  4Q5V A;  4CFC A;  3NHG A;  1T03 A;  2G8K A;  4DF4 A;  1NKC A;  1TK8 A;  5FRO A;  2P5G A;  2QXF A;  2RPI A;  3QLH A;  3VQ9 A;  4W5R A;  1NK7 A;  4YNQ A;  4CGF A;  5HBM A;  4CHQ A;  5KRT A;  4F3O A;  4KI4 A;  4PY5 A;  2VWJ A;  3CFO A;  1YTU A;  2DFF A;  1DTT A;  2Z1I A;  3CM6 A;  3TAN A;  1S1W A;  3KIO A;  3MEG A;  3C6U A;  3AO4 A;  3RMA A;  1JLG A;  1NOZ A;  2VWK A;  4HHT A;  3O4N A;  3RMC A;  1U45 A;  3V9Z A;  4DLE A;  4CJQ A;  2LSN A;  4FJN A;  2F96 A;  2RF2 A;  1RT7 A;  3ZSZ A;  5I42 A;  4CGJ A;  1SKW A;  4YFU A;  4JS4 A;  4HTU A;  3P5J A;  3QEV A;  4OPK A;  1KRP A;  3KD1 E;  4E7I A;  4CCH A;  2G8W A;  3L2U A;  4OKJ A;  3HL8 A;  3AVI A;  5KI6 A;  4E7K A;  1K6Y A;  3L3V A;  4CHO A;  3MED A;  3LAK A;  4M3T A;  3MEE A;  1C6V A;  1RBU A;  2ATQ A;  2G8H A;  2F8S A;  3DM2 A;  4GVM A;  4H4O A;  4B8C A;  4CEE A;  3KLG A;  4F2S A;  3TAB A;  4CGD A;  1WN7 A;  3DMJ A;  3LPU A;  5C24 A;  5HP1 A;  4LD0 A;  4CGI A;  4AHS A;  1KSP A;  1IH7 A;  4I2Q A;  3KK2 A;  4BE0 A;  2HHX A;  2FC0 A;  5J2M A;  3PO4 A;  3SI6 A;  1IG9 A;  3BGR A;  3OY9 A;  2HND A;  3HVR A;  1F21 A;  1C1A A;  2B4J A;  1SL0 A;  1BQM A;  1WSG A;  4M3R A;  3ZSY A;  1HMV A;  1UA1 A;  4DQR A;  3AV9 A;  3KLE A;  3TAM A;  2ZE2 A;  3NH1 A;  3ZSQ A;  3PO5 A;  4NYN A;  3U3Y A;  4RG8 A;  4XIU A;  4DQS A;  3DYA A;  3L2R A;  4CEB A;  2ITG A;  2BGG A;  3IS9 A;  4WE1 A;  4CGG A;  1S6P A;  2IAJ A;  4FM0 A;  1GOA A;  4BDP A;  5SWM A;  1NK5 A;  1CXQ A;  4CEC A;  2HB5 A;  4FK2 A;  3ZT4 A;  3QEW A;  3NGZ A;  3OYB A;  3PV8 A;  1D5A A;  3AVB A;  2PY5 A;  1JLC A;  3AVH A;  3DRP A;  1FKP A;  3CG7 A;  3K5O A;  5CZ2 A;  1C1B A;  1X1P A;  4CK1 A;  2WOM A;  1WLJ A;  3VQ6 A;  4OPJ A;  3JYT A;  3I0R A;  4KPY A;  4CEZ A;  4PWD A;  1X9S A;  5HRO A;  2BAN A;  1NK4 A;  1D8Y A;  1RDD A;  1NK0 A;  1HQU A;  2JGU A;  2OPP A;  4CES A;  4NCA A;  4I2P A;  4FM1 A;  4CEF A;  4OLB A;  4KTQ A;  1U47 A;  4BE1 A;  1VSJ A;  4TSX A;  3WNG A;  3CQ8 A;  1KFD A;  4IFY A;  4R5P A;  2O4I A;  1EET A;  4FW1 A;  1ZBH A;  2X6S A;  1JLA A;  1IKY A;  1HNI A;  4CJR A;  1Y97 A;  4DSJ A;  4B3O A;  3AO3 A;  4CK2 A;  3HST B;  5KTQ A;  3OYJ A;  4B9T A;  4FXD A;  4F4K A;  3TR8 A;  4G1Q A;  2AJQ A;  5SZT A;  5FRN A;  1EP4 A;  2D0C A;  2X78 A;  3KKS A;  4B9S A;  1BQN A;  4CEQ A;  4AHT A;  4BAC A;  4DTO A;  4CJP A;  4CF1 A;  1ASV A;  1N5Y A;  1ITG A;  1FXX A;  3NAE A;  2E6L A;  3G0Z A;  1X9W A;  3NGY A;  4B9N A;  1NJX A;  3NCI A;  3ALY A;  4ICL A;  1LAV A;  1W9H A;  2YHA A;  2ZD1 A;  3AVN A;  2XY6 A;  2F8T A;  3K5M A;  3QIO A;  4DSF A;  4KHU A;  4KRE A;  1JLB A;  1DLO A;  1HRH A;  3OYN A;  4FZY A;  3KTQ A;  2HNZ A;  3K5N A;  1TK0 A;  2GBZ A;  4C8N A;  3AVG A;  4M45 A;  4CE9 A;  2KFN A;  2QKB A;  3PUF A;  4H8K A;  4B9M A;  3QEI A;  3PX4 A;  2VG7 A;  4Z4H A;  3DLK A;  1NJZ A;  3I0S A;  1TV6 A;  2HMI A;  3ZSW A;  1MU2 A;  4Y1C A;  3RTV A;  1J53 A;  4FLY A;  3VQ5 A;  2Q3S A;  3RRG A;  2OYQ A;  1ZBF A;  3IG1 A;  3VQQ A;  3LAN A;  3OJU A;  4KKO A;  3QNN A;  2W42 A;  1IKX A;  1RT2 A;  2P51 A;  1IO2 A;  1BI4 A;  4CJW A;  1NOY A;  4KHS A;  3KJV A;  4AH9 A;  3L2V A;  3LPT A;  3ZCM A;  3OJS A;  4CGH A;  1RDA A;  4FW2 A;  3LDS A;  5J2N A;  4AHR A;  5E41 A;  3OYE A;  1LWC A;  2A1S A;  2XRI A;  3V1R A;  1J54 A;  1Q9Y A;  2B6A A;  4FJG A;  4HUE A;  3SJJ A;  4FK4 A;  4CIG A;  2VG6 A;  4KB0 A;  1LWF A;  3I8D A;  4DQQ A;  1O1W A;  4DLG A;  3AA5 X;  4Z4C A;  3NF6 A;  1RT4 A;  1S1T A;  1TKT A;  1S9G A;  3HPG A;  2PYL A;  3HPO A;  2QKK A;  2HHQ A;  4CER A;  1CZB A;  3V4I A;  4B9L A;  4Z0U A;  1T8E A;  1HPZ A;  3F9K A;  3ZT1 A;  1YVU A;  3DLH A;  2OZM A;  3IAY A;  1L3V A;  3SV4 A;  4DTR A;  3U6F A;  4KV8 A;  1J9A A;  1S1V A;  3G10 A;  4BWJ A;  4DFJ A;  2QK9 A;  1UWB A;  4L8R B;  2YKN A;  4C8L A;  1RTJ A;  3DLE A;  4F8R A;  2ZQB A;  1EXQ A;  1WAF A;  3K57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...