3VQBA

Hiv-1 in core domain in complex with 6-fluoro-4h-1,3-benzodioxine-8-carboxylic acid
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 51
structure length 142
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqbA00
3VN5A 2E4LA 5J1EA 4M3UA 4M3YA 1ZBIA 3OYBA 1LAVA 3ZT0A 1Q9YA 1EP4A 1RTHA 3P5JA 4B9SA 3AA4A 2OZSA 1HYZA 3V9WA 3KIOA 1NKEA 4HVJA 3ZSXA 1YTAA 1RT1A 1KRPA 4O5BA 3V1QA 4O4GA 2BGGA 5FDLA 3OYCA 3P1GA 5J2QA 1L3TA 4FJJA 1SUQA 3AO2A 1HQEA 3L3VA 4W5QA 3OYFA 4B3OA 4OJRA 3NH0A 3D45A 4N5SA 1NOZA 4CEAA 4DTJA 4CECA 3RR7A 1Z25A 4CFCA 2P1JA 1JKHA 4FZXC 3S3MA 3EYZA 2KZZA 2IC3A 1HQUA 2YNHA 1RBRA 4DU4A 1KVCA 1FK9A 3UIQA 4CJVA 1HMVA 3MEGA 3PX0A 2X74A 4QOZB 2HHVA 3C95A 5DK5A 4CF1A 1HYVA 4B9UA 1X1PA 3CFPA 5C42A 1TGOA 1D8YA 3SYZA 1JL2A 4PQUA 3SV4A 3EZ5A 1WSJA 3NDKA 4E7JA 3U3GA 1S9EA 3KLIA 3DYAA 3PO5A 4IDKA 3KKSA 4HUFA 3AVLA 1UAXA 1RT7A 4HCBA 3MXJA 1HPZA 3LP1A 5SWMA 2XO7A 1CZ9A 3HXMA 3F73A 2KQ2A 1NJWA 4KTWA 4KHNA 2O4IA 4WE1A 3SQ2A 4CERA 4NYFA 3PO4A 4OKKA 4AHUA 3TR8A 1VSIA 1J5OA 1F21A 4CJFA 3MAQA 5HROA 1RTDA 4EZ6A 4DTNA 4FJMA 3NGIA 3T1AA 4R5PA 1BCMA 4OGEA 1T8EA 2Y1JA 3L8BA 4IG3A 1TV6A 4BWJA 3SPZA 1XI1A 4FLZA 1C0TA 4DQPA 3L2RA 1JLEA 4E7KA 2X78A 4BDZA 2OA8A 4N76A 2IOCA 3CFOA 4FZZA 2KFZA 3QLHA 4KKOA 3C6UA 4CJLA 3QEPA 3RR8A 1ZYQA 1X9SA 1XC9A 2JLEA 1NK5A 3M8SA 3RTVA 1HYSA 3T3FA 1BCOA 2BANA 3K5OA 1KFDA 2XY6A 2IAJA 4ELTA 3VQ9A 4ID1A 2OPPA 3ZSQA 3ZT4A 1RILA 3VQ8A 5J2NA 1T03A 1S6PA 4XIUA 1IKWA 3F9KA 1WSEA 3OYEA 1GOCA 1J53A 4CEOA 2NUBA 3OS0A 3HJFA 1Z26A 2ATQA 3DRPA 1TKXA 5CYQA 3KLHA 4M3ZA 2XHBA 2HVHA 1QSLA 3KD1E 3SV3A 4LSNA 4FLUA 2ZQBA 3NH2A 1RDCA 4J2DA 3AVGA 2F96A 1RT4A 1YT3A 1TL1A 4KTZA 4PY5A 3AO1A 3V1RA 3NCIA 2B5JA 4Z4IA 3IRXA 4B9NA 3ZT1A 4QAGA 1WSFA 5KGWA 1X9MA 3ZT3A 3U6FA 4CHOA 3DRRA 5T7BA 1L3SA 3DRSA 1ITGA 1RT6A 3TAGA 3LP0A 1MU2A 1QE1A 2D5RA 3KK3A 4J2AA 1U49A 2A1RA 4Z4EA 4CJQA 2XRIA 5FRMA 2P51A 2YKMA 4CF8A 2ITGA 4HCCA 5J2PA 4G1QA 1S1XA 3SUPA 3OYAA 3EY1A 4O0JA 3THVA 1WN7A 4CGIA 3TI0A 1CZBA 1S1WA 4B9LA 5K14A 3OYLA 4B9MA 2YHBA 3ITHA 4CF9A 3NAEA 4I2QA 4L8RB 4UQGA 4DTMA 1VSEA 3QETA 1SV5A 2DFFA 3K59A 1L3UA 3BDPA 3LZIA 3LWMA 1WAJA 3NF7A 1A5VA 2OPRA 3I0RA 3LAMA 3MXIA 1IG9A 3DLKA 3HVTA 1Q8IA 5HRSA 1DTTA 1I3AA 3DLRA 2HHTA 5E41A 3HO1A 3ZT2A 5JS1A 3LWLA 3OYMA 4F2RA 4KI4A 4FJLA 1C1BA 3OVNA 3TAFA 3L2QA 4DSJA 3TWHA 4IG0A 4Z0UA 4E7HA 3CM5A 1VSHA 3HP9A 4FK0A 1D5AA 2HHQA 3NFAA 4BDYA 3OJSA 3OS1A 1JL1A 1RBSA 4RW9A 4FJ7A 3K5NA 3SUOA 4CJPA 2OZMA 5KTQA 4FM1A 2YNIA 2Z1HA 1TKTA 4M3RA 3KK1A 1LAWA 2QXFA 4FLYA 3TAEA 1SKSA 4OLBA 4M3XA 4B9TA 3DLHA 2BE2A 3AO5A 3QEIA 4ZTFA 2YKNA 4K8ZA 4CJKA 3SQ4A 3OYIA 4JS5A 4Z4GA 2GV9A 3HVRA 4BE0A 4CF0A 4KHUA 3KK2A 2F8TA 2EX3A 4ZHRA 1U4BA 3QO9A 4LSLA 3AA3A 2D0BA 2W42A 3RMCA 5HRPA 3VQBA 2VG6A 4FW2A 4CE9A 1KLMA 4DFJA 3IAYA 5KGXA 4FJKA 4JLHA 5I42A 3QIPA 1S5JA 2FBYA 3OYNA 1BISA 3ZSZA 4RW6A 2Y1IA 4FLXA 3VQ4A 3MEDA 3K5MA 4O44A 3SCXA 4W5OA 3S3NA 1QSYA 1KFSA 4M3WA 1HJRA 4Y1CA 3SQ0A 1BIZA 3VQ5A 2IS3A 2KTQA 1RDDA 3U3YA 4DU3A 4CJ4A 3JYTA 1RBTA 2XY5A 1DLOA 4HUGA 3WNHA 4E7IA 2P5OA 2HNDA 4E7LA 1BQMA 2IDOA 3VQPA 1TK8A 3AA2A 2PYLA 4CJUA 2OYQA 1T7PA 5EU7A 3LALA 5SZTA 3DM2A 4B9VA 1TAQA 4CHPA 2HVIA 2XY7A 2HHUA 4CHZA 3HM9A 3VQCA 1NK7A 1ASUA 1A5WA 3RMDA 4E1NA 1NK4A 4B08A 3HK2A 3K5LA 4Z4CA 4FJ5A 1RNHA 3NGZA 2D0CA 3QIOA 2ETJA 4DSIA 1UOCA 3QEWA 4KHYA 3LDSA 2YNGA 1IO2A 1YVUA 4DU1A 2HHXA 1QSSA 3LPUA 4CGGA 3DLGA 1B9FA 2B6AA 4CK3A 5C25A 1HNVA 1JLAA 4M3TA 1SL2A 4HTUA 1VRTA 4C8MA 2PYJA 1WSGA 3S9HA 3KLEA 4DS5A 4E1MA 3P83D 2PZSA 1BHLA 3SI6A 1ZBLA 4QCLA 3ALYA 4CEFA 4AHCA 4PUOA 4W5RA 3CQ8A 1QS4A 1TL3A 4H4OA 2VG7A 4BE2A 4ELUA 4J2EA 1D9DA 2BDPA 5C24A 4FJGA 4PWDA 4AHVA 3L2WA 1RT5A 4CJ5A 1SL1A 2P5GA 2KFNA 1G15A 4CHYA 4CFBA 2QKBA 5CYMA 1S9GA 4DSKA 3E01A 4C8LA 3TARA 3HPGA 2VWKA 1VSJA 1XHXA 2HB5A 1CLQA 2FBVA 4KV8A 3HPOA 1NKCA 4EZ9A 3JSMA 3TABA 4KRFA 1IKVA 3PX6A 1LW2A 3V4IA 1A5XA 1KSPA 3MEEA 1S6QA 3AA5X 3AO3A 1C1CA 4KFBA 1HNIA 4Y1DA 3VQ7A 4E89A 3QINA 2R7YA 4H4MA 4YNQA 3PV8A 1C1AA 4N41A 1ASVA 4M42A 1U45A 4FJHA 5CY4A 2Z1IA 5HRNA 1TK0A 1ZBHA 1WAFA 2G8UA 4CCHA 3DOLA 4FM0A 4YFUA 4IKFA 1VSKA 1JLGA 2DFHA 4CJTA 1UWBA 4KI6A 4FZYA 1NOYA 3O3GA 3KD5E 1EX4A 2X6NA 4PA1A 3O4NA 4DTUA 3VQAA 3DLEA 1BIUA 4LH4A 2OPSA 4IBNA 1SKWA 3O4QA 4BWMA 4CJRA 1BQNA 2ZE2A 4F8RA 2WONA 3SUNA 1IH7A 5FROA 3RMBA 1JLCA 4AHSA 3O3HA 4CFDA 3RRGA 4FJIA 1VK0A 4OLAA 3WNEA 4JRPA 1NK8A 1S1TA 4CGJA 1RT3A 3ZSYA 4GVMA 4CEBA 4FJ9A 3WNFA 4IFYA 1R0AA 1VSLA 3DMJA 1NK6A 1N5YA 4KREA 4CHNA 1KTQA 3AVJA 3G10A 1VSMA 4N56A 3TAQA 4DFPA 2RN2A 3AVMA 4JRQA 3MXMA 1REVA 1UA1A 3M8RA 4CJWA 1QHTA 4I2PA 4RG8A 2JGUA 1U04A 3QEXA 4DSLA 3HYFA 3KLFA 2HMIA 4DS4A 4FM2A 1BI4B 1RTIA 4CEQA 4CK1A 3LANA 4KAZA 4J2BA 3HL8A 3K2PA 1LWFA 2E6MA 4DG1A 2YV0X 1ASWA 4ID5A 3ZSRA 3PUFA 1JLBA 1LWEA 4KB1A 4JS4A 4LD0A 3T19A 1RDAA 3DI6A 3NE6A 3SUQA 3I0SA 4N47A 3LZJA 4DF4A 4DQIA 5FRNA 1RBUA 4CESA 4CJSA 3KLGA 2X6SA 3ZCMA 3I8DA 3VA0A 4FXDA 1EKEA 5HRRA 2HW3A 1W0HA 4FLVA 4DWIA 1WNSA 3LPTA 4OVLA 4ELVA 4LH5A 4CJ3A 4FK2A 1JXEA 4DQSA 4I9LA 3QNOA 4NYNA 4MQ3A 1CXUA 1RBVA 1RCHA 4DTSA 4HHTA 4CF2A 3HT3A 1RTJA 2YNFA 3VQ6A 4DQRA 1IKXA 1JLQA 2G8VA 3V6DA 2RKIA 4F2SA 2Z1GA 1GOBA 2Q3SA 4M41A 4FLWA 3NBPA 1B92A 1XHZA 4Z4HA 1KCFA 4OPJA 5J2MA 1W9HA 4FCYA 2RF2A 4DFMA 1BGXT 4DTPA 3QEVA 1RDBA 2A1SA 1N6QA 4OKJA 4DTXA 2GBZA 1J9AA 3ZSWA 5JS2A 3V81A 4CFAA 2D0AA 3IG1A 4DLGA 2VG5A 4C8OA 4ICLA 2KW4A 3DLBA 3NHGA 1L3VA 2ZD1A 1IKYA 4Q5VA 1U48A 2QKKA 4IFVA 2LSNA 4FLTA 1L5UA 3TAPA 3KKRA 1UA0A 5HP1A 3L3UA 3K58A 3TANA 1NJXA 1C0MA 4I7FA 4GW6A 3CFRA 2FBXA 4DTRA 4FJNA 1HRHA 4NCAA 2XY8A 4CEDA 5KRTA 1FKPA 3V9UA 3KTQA 1S1VA 1TKZA 3OYJA 4DSFA 4KHQA 3HSTB 2G8IA 1QTMA 3SPYA 3IS9A 3AVCA 1KVAA 3L2UA 3NF9A 1TKDA 4Q0BA 4FYDA 2O4GA 3SQ1A 1I39A 1WSHA 1NK9A 4BDPA 3VQDA 4RW4A 2VWJA 2PY5A 1U47A 4FVMA 2HHWA 3D0PA 3H08A 1FKOA 2FBTA 5HBMA 1LV5A 3V9ZA 3B6PA 4DQQA 2G8HA 2DFEA 3BGRA 3AO4A 2G8WA 4F3TA 1ZBUA 3ASMA 3CYMA 2G8KA 3AVHA 2DY4A 4W5NA 3SZ2A 1EETA 2WOMA 4CIGA 4K8XA 4CIFA 4CGHA 4CK2A 4BE1A 4EP4A 4EP5A 4HUEA 2HNZA 4AILC 1K6YA 3M8QA 1JXBA 1EXQA 4E19A 3OY9A 3OJUA 4C8KA 4FJ8A 4O0IA 4FK4A 3ZSOA 3OS2A 1QQCA 4DLEA 1NJYA 2HHSA 3FFIA 3B6OA 1NJZA 4NCGA 3SJJA 3QNNA 5KI6A 1O1WA 3LP3A 3MECA 3NF6A 2KZMA 5I3UA 4MFBA 4CHQA 1TAUA 3TAMA 3ZSVA 1TVRA 1WSIA 3AVAA 4OKEA 2GUIA 4KB0A 3CM6A 3QESA 2QK9A 3ULDA 4FW1A 4DF8A 3LAKA 3AVIA 5CZ2A 3V9SA 4FJXA 5DMRA 3PX4A 2G8FA 3NGYA 2IGIA 3AVBA 4DFKA 3C94A 3OYKA 1D9FA 1J54A 4OPKA 3A2FA 4B8AB 1SKRA 4F4KA 3VQQA 5HLFA 5D3GA 4O55A 1C6VA 4KHSA 3RWUA 1CXQA 3OYHA 4CIEA 4BACA 4I9QA 2B4JA 3S3OA 3OYDA 3NF8A 4LY7A 4E0DA 4CEZA 4RW7A 1ZBFA 3ISNC 2E6LA 4NCBA 4DMNA 1JLFA 3HPHA 3M8PA 5CZ1A 3NH1A 3SNNA 3V9XA 1XWLA 3G0ZA 3PY8A 4E3SA 1VRUA 3CG7A 2F8SA 4CJEA 4KPYA 4B8CA 1B9DA 2I5JA 2YHAA 1LWCA 3VQEA 4AH9A 1WLJA 4M45A 4GMJB 2AJQA 4Z4FA 1DTQA 3KJVA 2EHGA 2Z1JA 3DOKA 1X9WA 1YTUA 3VA3A 1FXXA 4KTQA 4H8KA 1GOAA 4W5TA 3V1OA 3RMAA 4TSXA 3K57A 3RRHA 3C6TA 1VSFA 4C8NA 1T05A 1SL0A 1BL3A 4OGCA 3OYGA 2HNYA 4CGFA 3AVNA 3L2VA 1NKBA 4RW8A 1Q9XA 4KHWA 2DTUA 1KVBA 1KLNA 4DTOA 4AHTA 1BI4A 4ZTJA 3O3FA 4AHRA 4CGDA 3WNGA 3HP6A 3LP2A 3QERA 5KRSA 3AVKA 1NK0A 1S1UA 1TK5A 1RT2A 4DSEA 1Y97A 2FC0A 3AVFA 3AV9A 4KO0A 4F3OA 1C0UA 4CEEA 1LW0A 1VSDA 2OPQA 2RPIA
chains in the Genus database with same CATH superfamily
4IO9L 3ZT0A 2VGNA 1RTHA 3P5JA 2E1YA 3ENBA 3V9WA 3KIOA 3ZSXA 1YTAA 3SMSA 5BRDA 1OH6A 4FPAA 3OYCA 5JICA 3M1FA 1L3TA 1IV0A 5EXWA 4N5SA 1QVFM 4CECA 4CFCA 4BRCA 3DJCA 2KZZA 1KVCA 4B1YB 4JKBA 5AQRA 3W0LA 3SLCA 2GX9A 1TGOA 1D8YA 4IFEA 2Q0UA 3RVCA 4E7JA 1RGIA 3TTCA 1S9EA 3SBGA 1UAXA 1RT7A 1P8ZA 1HPZA 1WBBA 4KHNA 4WE1A 2FSNA 2O8FA 4RTFD 5EX5A 1VSIA 1F21A 3VMFB 5HROA 4WCEL 1RTDA 4EZ6A 3THWA 3T1AA 4OGEA 3K9KA 2YX6A 4A5BA 2P9IB 4DUYK 3L8BA 3SPZA 3BY5A 1BG3A 4BWJA 2YJEA 1KAZA 1S3XA 2NRHA 4E7KA 4BDZA 1ATSA 4DV1K 4N76A 1OH8A 1JJ2M 3QLHA 2Q0RA 3C6UA 4JI2K 4B1WB 4CJLA 2JLEA 1XNRK 3ATUA 1BA0A 2OPPA 5LY3A 1T03A 1VQ5N 5E26A 4KH6A 2NUBA 3OA9A 4BRMA 1TKXA 4M3ZA 3CF5L 1WB9A 4X66K 3M5RA 1GLDG 1RDCA 4O8KA 3O8MA 1YVNA 3O4WA 3V1RA 2E2OA 1Y64A 3P4IA 4Z4IA 4BR0A 4CHOA 4A5AA 1L3SA 1RT6A 3TAGA 1QE1A 4WQ4C 5GIOA 3VETA 4CJQA 2XRIA 1U49A 3BF3A 3LDQA 5J2PA 4G1QA 1S1XA 2QWPA 3AGRA 3K0SA 3I55N 4O0JA 4BRAA 4CGIA 3KK7A 3H45C 1S1WA 3W3DA 1MWMA 3J7ZO 3NAEA 4PL8A 4I2QA 4FWRA 4BG8A 3K59A 3L6QA 3LZIA 2OPRA 2HBKA 2NLXA 4DCHA 3CI5A 3TU5A 1DTTA 5AFUA 3P31A 4DV3K 3OVNA 4DSJA 1C0GA 4IG0A 3TWHA 3GG4A 3HP9A 3NFAA 4BDYA 3ATVA 3OJSA 1VQMN 4C1NK 5CE3A 4FM1A 2YNIA 3SK3A 2E8AA 4M3RA 4H0TB 2QXFA 1SKSA 3CC7N 4H5VA 2BE2A 4CJKA 3HVRA 4CF0A 3KK2A 2F8TA 4NLBA 3QO9A 4LSLA 3AA3A 3A5MC 2W42A 3D2FB 2V7ZA 3VQBA 1KLMA 5KGXA 1DT9A 4JLHA 2FXUA 3HOTA 2Y1IA 3VQ4A 4O44A 3O9RA 1HJRA 2HF4A 4JAXA 4NO7A 2O8EA 4CI6A 4CJ4A 4HUGA 4E7IA 2HNDA 4E7LA 1BQMA 2IDOA 1BOTO 1TK8A 3AA2A 4CJUA 3DM2A 1GLAG 1TAQA 2HVIA 4CHZA 1ASUA 3LDLA 1A5WA 4BROA 2GWJA 1HKGA 3HK2A 3K5LA 5M1KA 2ETJA 4DSIA 4BGBA 1UOCA 4KHYA 1NGDA 2HHXA 3GBTA 3LPUA 4JI1K 1IBKK 3MWTA 4LF9K 1B9FA 3IMXA 4C8MA 4DS5A 3SJHA 3ZX3A 2DPNA 4LFBK 4BR9A 4U67L 3BF1A 2VG7A 5AZIA 4J2EA 5C24A 4I6MB 4AHVA 4CD1A 3H46O 2P5GA 1S9GA 4BC5A 2QA4N 5JLFA 1XHXA 4GVEA 3TABA 1KSPA 1HX1A 4F2RA 4KFBA 2R7YA 1HNIA 4N41A 3PV8A 4YNQA 1C1AA 1ZBHA 5CY4A 4CCHA 4FM0A 4YFUA 3UKRA 4CJTA 4IXCA 3O3GA 4FSVA 3VEVA 4CJRA 1T6DA 2ZF5O 2UXDK 1TUUA 2WONA 5FROA 3FR0A 3O3HA 2UYTA 3GDQA 4FJIA 3HM8A 3QB0A 4DV2K 1N5YA 5ADXA 3AVJA 3O9UA 3TAQA 4DFPA 2D0OA 1U04A 1LCUA 2FSJA 2ASPA 2W40A 3IUCA 4DSLA 1SAZA 4DS4A 1BI4B 3KHYA 1LWFA 2YV0X 4IZ9A 3PUFA 1LWEA 4JS4A 3UKUA 4DQIA 4DF4A 3E66A 5C10A 4FLVA 4CJ3A 4NYNA 2P9UB 4BRDA 4CZLA 4IEIA 3MDQA 2Z1GA 1NG9A 4M41A 1XHZA 1W9HA 3FZKA 1BGXT 3R6MA 4DTPA 1RDBA 5ELZA 3P39A 4OKJA 4JD2B 4NXMK 3ZX0A 3ZSWA 4LF8K 4IJNA 4A57A 3IG1A 3ENHA 5BN9A 4G9ZA 2UUCK 4Q5VA 4F9OA 1U48A 2QKKA 2BTFA 2LSNA 1NNEA 1L5UA 3R8EA 3TAPA 5KQ8A 5HP1A 1NJXA 4YOWA 4KHPK 1C0MA 3M6GA 2FBXA 1HRHA 4CEDA 1TKZA 4BQZA 4MDBA 1RDWX 3SPYA 4Q0BA 4MO4A 1I39A 5LL6Z 1YJNN 4FO0A 2PY5A 3THWB 2QWQA 2F9TA 3H08A 1FKOA 4BQLA 3V9ZA 3B6PA 4BC3A 3BGRA 2G8WA 4F3TA 3IDHA 5FPEA 2DY4A 1EETA 2I7NA 2WOMA 4CK2A 4EP5A 3ID6A 4JI0K 4WYBA 2WFBA 2O8CA 3OJUA 4FK4A 4O0IA 4DLEA 4NCGA 3SJJA 3QNNA 5KI6A 1O1WA 3O5BA 1W7AA 3NF6A 4OX9K 3ZSVA 1TVRA 2QW9A 1DEJA 3A5LC 2QK9A 2YI1A 3QESA 3GOIA 3ULDA 1YHQN 4DR1K 2G8FA 3PX4A 1VQKN 3C94A 3VEWA 5HOOA 3OYKA 1J54A 4OPKA 5D3GA 2HSTA 5JMVA 4H5NA 3VEZA 4BACA 4CIEA 4WQ4A 3A8YA 3EZWA 3OYDA 3WXJA 4RW7A 3KWIA 1ZBFA 2PFUA 1ZC6A 4WF9L 5CZ1A 3SNNA 1XWLA 3CG7A 4DHYA 5FPMA 5AQIA 3EO3A 2AJQA 3FZFA 1RDUA 2EHGA 3FE1A 3VEOA 4KTQA 1GOAA 4C8NA 3FZLA 4OGCA 2HNYA 3AVNA 1Q9XA 4KHWA 2DTUA 1KLNA 4ZTJA 3L4QA 4YOYA 3O3FA 4BC2A 3HP6A 3O6WA 1NK0A 1S1UA 4IWVA 1TK5A 5EY4A 4DKWA 3AV9A 4KO0A 2QWLA 2RPIA 2E4LA 1ZBIA 3OYBA 3BZKA 3AA4A 4YY3K 1HYZA 3QBXA 1NKEA 4HVJA 4V19S 3D2FA 4EFHA 1RT1A 5BN8A 3V1QA 2IVPA 3CCRN 5J2QA 1HQEA 3L3VA 3D45A 1NOZA 3CHWA 3RR7A 2P1JA 4DR5K 3S3MA 4JHDB 3EKUA 4DQ8A 3EYZA 2IC3A 2ITMA 2YNHA 5EOYA 2E20A 4DU4A 3FLCO 1FK9A 3UB5A 1HMVA 2HHVA 2X74A 2O8EB 3C95A 4B9UA 3CFPA 5CR4A 5C0YA 3SYZA 3SV4A 1XUPO 2Q1NA 5M1QA 4HUFA 3NVKA 4H5TA 4XH1A 1X9JA 3LP1A 2XO7A 3HXMA 3F73A 1NJWA 4KTWA 5AJ3K 4AHUA 4DTNA 4HTLA 2QWMA 4CBWA 2HBLA 3EN9A 3NGIA 3J7YP 1XNQK 1JLEA 2X78A 4FL9A 3CFOA 5AZIB 4NLCA 4H0XB 1NGAA 3QEPA 1X9SA 3C0BA 1NK5A 3M8SA 3RTVA 2D0PA 3JAMO 3T3FA 3K5OA 2VQEK 3ZSQA 1RILA 3VQ8A 4XIUA 1IKWA 3F9KA 1WSEA 4BRIA 1J53A 1GOCA 5KQDA 4CEOA 2A41A 3OS0A 2ATQA 5CYQA 1NGJA 2XHBA 3SV3A 1HLUA 4GY2B 2P9NB 3NH2A 5DM7L 1QQOA 1TYQA 2F96A 3UKRB 3AO1A 3ZEUA 2B5JA 2D1KA 4B9NA 3ZT1A 1NGFA 1WSFA 5KGWA 3EKSA 3ZT3A 1ITGA 1TUYA 4Z4EA 4J2AA 1E3MA 2WTUA 4HCCA 2O8BA 3OBWA 3SUPA 4BRPA 3THVA 1CZBA 3T1HK 1NMDA 4H5WA 5K14A 4JI6K 4ILHA 1L3UA 4DTMA 1VSEA 3QETA 1SV5A 3M3ZA 3OTOK 3AAPA 2YJFA 5IWAK 3LWMA 1A5VA 3LAMA 3MXIA 3DLKA 3HVTA 1Q8IA 5HRSA 4B3RK 5GINA 3D6RA 3ZT2A 3WQUA 1D4XA 2CH5A 4FJLA 3UKUB 2E88A 4E7HA 4Z0UA 3FZMA 1D5AA 2HHQA 1RBSA 3K5NA 3ZYYX 4CJPA 2OZMA 5KTQA 1WUAA 2Z1HA 1QQNA 2P9UA 3KK1A 3DLLL 1LAWA 3CIPA 4FLYA 4M3XA 5GAGP 1X3NA 2QTDA 3VEXA 4ZTFA 4K8ZA 3DAWA 3WEEA 4BGAA 3SQ4A 4Z4GA 5GADP 2GV9A 4KHUA 4MDAA 3LDPA 2D0BA 4BRLA 3RMCA 1YITN 5HRPA 4JD2A 4CE9A 4DFJA 3IAYA 4BG9A 4CVNE 4FJKA 5I42A 1Q7YO 3MN7A 2JWKA 1S5JA 2FBYA 5E84A 4X62K 3ZSZA 4FLXA 3MEDA 3K5MA 3SCXA 4M3WA 1MA9B 1IJJA 4Y1CA 1SQKA 3QICA 1RDDA 3U3YA 5AQPA 1RBTA 1DLOA 3WNHA 1YF5L 5EU7A 3LALA 1WBDA 3CCJN 3O80A 2WBNA 4K43A 4JKGB 3VQCA 3SAHA 4H0YB 3RMDA 4E1NA 1NK4A 3BP8A 4B08A 1FW6A 1Q86O 2HHHK 1RNHA 4BR4A 3F2KA 3LDSA 2YNGA 3EE8A 4OPHA 1ATRA 2B6AA 3CJ9A 5C25A 4MO5A 1SL2A 1OKJA 2BH1A 1VRTA 3KLEA 2O8CB 4DV5K 4QCLA 5M1PA 4PUOA 1QS4A 3BEXA 4BE2A 2W6LA 1D9DA 2BDPA 3ZX2A 4PWDA 4PL7A 1RT5A 1DKGD 1SL1A 2KFNA 4GKJK 1G15A 5AQGA 4CFBA 3HTVA 5CYMA 3E01A 4AM7A 4U7BA 1GLFO 2HB5A 4FWKA 4KV8A 3HPOA 1NKCA 4CZJA 4KRFA 3PX6A 4Y1DA 3VQ7A 1ASVA 4FJHA 2Z1IA 1TK0A 3MN9A 2EWSA 4KI6A 3E9PA 3VQAA 3T69A 2F7TA 2W41A 4BWMA 1N8RO 1BQNA 3SUNA 3RMBA 4AHSA 2OANA 2OTJN 3P38A 1VK0A 5HL7L 4FJ9A 1S1TA 3ENOA 1RT3A 3ZSYA 3WNFA 1R0AA 3DMJA 5AQTA 1T6CA 3GE1A 4CHNA 1KTQA 3HZ6A 4BR7A 3VF4A 3WT0A 3QDKA 4CW7B 2JGUA 3QEXA 3MX2A 3KLFA 4FM2A 1RTIA 4CEQA 3LANA 4ID5A 1LOTB 3ZSRA 4KB1A 4XH4A 4LD0A 1YIJN 3SUQA 1EKEA 1JXEA 4I9LA 3QNOA 4MQ3A 4FVUA 2I7PA 4DTSA 4HHTA 1HNWK 3LDOA 3HT3A 1RTJA 2YNFA 3Q7BA 1JLQA 3V6DA 2RKIA 4ISEA 2Q3SA 4FLWA 2UXCK 1B92A 4OPJA 4NXNK 3QEVA 2H3GX 3F9MA 4JHDA 4GV9A 2A1SA 1N6QA 4JN4A 2GBZA 4DTXA 1X3MA 4CZFA 4DLGA 2VG5A 4YOTA 4ICLA 1OH7A 4QS7A 3DLBA 2RE2A 3L0QA 3MMVA 4YOVA 4UY8O 4FLTA 3KKRA 1UA0A 1VQ4N 3L3UA 3PSIA 4GW6A 3CFRA 4DTRA 2UUAK 1KAYA 2O8DA 3R1XA 3OYJA 4AQYK 4DSFA 3HSTB 1QTMA 1SS6A 3CETA 4FWOA 1NK9A 4RW4A 5FPDA 3VPZA 1S22A 2FBTA 2W6KA 5BPLA 1XMQK 3VF6A 2G8HA 3AO4A 3MCAB 1ZBUA 2YHWA 3H6EA 2G8KA 4PKIA 4HUEA 3M8QA 3EE9A 1JXBA 3CQYA 4DUZK 3L4IA 3MECA 2P9PB 3AVAA 4KB0A 3CM6A 4JYAK 4FW1A 4DF8A 3AVIA 1QZ6A 4FJXA 2P9NA 3PSFA 1TYQB 3O9SA 3A2FA 4H5RA 3ZEUB 4O55A 3BUZB 3G25A 4B9QA 3NF8A 4IO8A 1K8AO 4E0DA 4CEZA 3ISNC 4DMNA 1VQ8N 2O8BB 3G0ZA 4FWMA 4CJEA 4B8CA 4PKGA 1K9MO 1QVGM 1I94K 1LWCA 3HOSA 1VQ6N 1DTQA 3KJVA 2Z1JA 3CC2N 3VA3A 4XEIA 3U9DA 4H8KA 3V1OA 3RRHA 4FZYA 1T05A 1BL3A 2Q97A 4IOAL 3H1VX 1KVBA 4DTOA 4AHTA 3Q7CA 4XH5A 4CGDA 3AY9A 1Y97A 4C1NI 4X64K 3H1QA 1V4TA 5AQHA 3VGMA 3PIPL 4CHPA 3GL1A 3VN5A 5AQMA 2P9KB 5J1EA 4M3YA 1N33K 3S41A 1Q9YA 3WEEB 2OZSA 4M7XA 1KRPA 2BGGA 3P1GA 3VOVA 5M1FA 3AO2A 3TTFA 4W5QA 4B3OA 4YDUC 4DTJA 1BA1A 1Z25A 5LMNK 4CZEA 1HPMA 4HWIA 4A2AA 1JKHA 2KKZA 4FZXC 5H1SQ 3JS6A 3TSPA 5AQSA 3WXIA 4LFCK 4FOIA 4QOZB 3PX0A 4K41A 4CF1A 1HYVA 2HF3A 5C42A 4PQUA 1JL2A 1WSJA 2V51B 3U3GA 4JKGA 3DYAA 3PO5A 2WUSA 4IDKA 3KKSA 3AVLA 4BREA 3CCVN 3MXJA 1CZ9A 4BR5A 4CZKA 2KQ2A 4YOXA 4CERA 3PO4A 1HKBA 5AQYA 3TR8A 3MN5A 1QQMA 3THYB 2QWRA 2F4VK 3FFKB 3CCUN 2KHOA 4R5PA 1BCMA 2Y1JA 3J7AP 1NGHA 4JKEA 1TV6A 1C0TA 4DQPA 5TKWA 4CBUA 5KPTA 2OA8A 4FZZA 3AAQA 2KFZA 2GELA 4KKOA 3RR8A 1ZYQA 1XC9A 3O1BA 5AZJA 2IIRA 4GKKK 1BCOA 2BANA 1KFDA 2E1ZA 4ELTA 3VQ9A 4JKCA 4ID1A 3ZT4A 5J2NA 1S6PA 3OYEA 1IBMK 4JI4K 3WXLA 1Z26A 4BVPA 5CHIA 2CGKA 1NWKA 4LF7K 2NNWA 1QSLA 3KD1E 2ZQBA 4FWPA 2Q36A 3I56N 1J6ZA 1RT4A 1YT3A 4KTZA 1EWQA 3U9ZA 3D2EA 3IRXA 4GV6A 1X9MA 3U6FA 3IKMA 3LP0A 5BPMA 2P51A 2YKMA 4CF8A 2ITGA 5BPNA 3TSQA 1WN7A 1S72N 1U6ZA 1H1VA 4B9LA 4K0KK 2YHBA 3ITHA 1NMNA 1QHAA 2YHXA 1HYSA 4UQGA 4H0PA 3BDPA 4FWSA 1WAJA 3NF7A 3I0RA 3LM9A 3VGKA 1I3AA 5BR8K 1VQ7N 5E41A 2HHTA 3HO1A 2GWKA 2D4WA 3LWLA 3OYMA 4KI4A 1C1BA 4BVOA 3L2QA 3CM5A 1VSHA 4FK0A 3VTHA 2ZGZA 4FJ7A 3SUOA 2HBJA 3TAEA 4OLBA 4B9TA 1T3VA 1YXQA 3AO5A 3QEIA 4JS5A 4BE0A 3CD6N 2EX3A 3LL3A 4ZHRA 1U4BA 4FW2A 3CPWM 4FWNA 2OTLN 3QIPA 1BISA 4RW6A 4EHTA 3SBTA 3S3NA 1QSYA 3SQ0A 5C2FA 1BIZA 1HUXA 4BRQA 3BZCA 3JYTA 2P5OA 2XY5A 1VQNN 3VQPA 2PYLA 2P9LA 1NM1A 1T7PA 4B9VA 5SZTA 1W2BM 2O8DB 4JK9A 3HM9A 1XC3A 2J4RA 1HJOA 2D0CA 3QIOA 1BUPA 1IO2A 3CJCA 2E5LK 1HNVA 4M3TA 2PYJA 1YJ9N 5M1NA 4E1MA 3TSUA 4GNIA 2PZSA 5AQOA 1BHLA 1ZBLA 3ALYA 4AHCA 3EEQA 4H4OA 3MN6A 4B1VA 3T1YK 4FJGA 1IG8A 1JCGA 2P9PA 4DSKA 3EL2A 4A61A 3THXB 2VWKA 1VSJA 3A5NC 1CLQA 3JSMA 4DV7K 1A5XA 1QZ5A 3MEEA 1S6QA 3AO3A 4H4MA 3LM2A 4M42A 1U45A 1WAFA 2PAVA 4A2BA 1JLGA 2DFHA 1K8KA 2E2NA 3KD5E 3G6EN 4PA1A 2P9SB 3O4NA 3J8AA 3DLEA 4LH4A 4IBNA 3O4QA 2ZE2A 4JK7A 2UUBK 1JLCA 3RRGA 4CFDA 3SMPA 4B1XB 1YI2N 1O13A 2OCEA 1NK8A 4CGJA 5JS1A 4IFYA 1NK6A 4ILGB 5EVZA 3U4LA 3KWGA 4FJMA 2RN2A 3AVMA 4JRQA 1UA1A 1REVA 3M8RA 1SZ2A 4RG8A 4CZGA 3HYFA 4DB3A 3HSCA 4MLHA 4CK1A 2NRZA 3HL8A 3K2PA 4DG1A 1ASWA 3NE6A 4N47A 3LZJA 1RBUA 4CESA 4CJSA 2X6SA 5HRRA 1Q81O 4DWIA 2P9KA 4OVLA 4BRHA 4LH5A 4FK2A 2ASMA 4DQSA 5LMUK 4ISGA 1RBVA 1RCHA 1NGEA 1W97L 4CF2A 2YHYA 5AQZA 1G99A 1VHXA 1GLJO 4DQRA 1IKXA 4F2SA 4FPBA 2G8VA 3OHRA 4YDUA 3NBPA 1KCFA 5J2MA 4FCYA 2RF2A 4DFMA 4DR4K 2QWNA 1BWFO 4BRFA 1EO1A 4JI7K 3KVGA 1J9AA 2VCPA 2VYPA 1BDGA 5JS2A 4CFAA 3KZBA 4JEPA 2D0AA 2NRXA 1VQ9N 1IKYA 1E4FT 3DXKA 5C15A 4IFVA 3VESA 3JXUA 3ID8A 3K58A 2GTDA 1YAGA 4I7FA 3RSEA 4FJNA 4NCAA 3OBYA 5KRTA 3V9UA 3CJ7A 3C7NA 3THYA 4DV0K 3AVCA 1KVAA 3L2UA 3NF9A 4FYDA 3VTIA 1WSHA 4BDPA 1MDUB 3VQDA 3CPEA 1HNXK 1U47A 4FVMA 5HBMA 5B8HA 2DFEA 4DR3K 3CYMA 2A42A 3HI0A 3O08A 4CIGA 3MK6A 3UE5A 4K8XA 4BE1A 4EP4A 4AILC 1K6YA 2HBMA 1EXQA 4C8KA 3OS2A 1QQCA 5AZJB 1NJYA 2FLOA 2VWBA 2HHSA 3FFIA 2V7YA 5A2QO 1BU6O 3LP3A 1P90A 4CHQA 1U2VB 1E4GT 2GUIA 3HRGA 4CZMA 3V9SA 5DMRA 1MWKA 4H03B 4DFKA 3CJ1A 4F4KA 3D2EB 1CXQA 2BUPA 4I9QA 2AP1A 3C6AA 4MLEA 3FZHA 3H3OB 3QBWA 1JLFA 5JLHA 4E3SA 1VRUA 4BY9C 4M63C 3HBTA 4YOUA 2F9WA 2YHAA 3IFRA 3VQEA 4AH9A 4EAHD 3TTDA 1FJGK 3CCLN 1X9WA 3DOKA 1FXXA 1Z05A 2ZWHA 2VGMA 4W5TA 3RMAA 3QMLA 4TSXA 3K57A 1ILYA 4WFAL 4CGFA 3L2VA 4RW8A 1NGIA 3QERA 1OVQA 3AVKA 3R3LA 4B1ZA 5M1OA 3U8XA 3AVFA 4B3TK 4F3OA 4CEEA 3E1YA 3CXCM 1VSDA 2OPQA 1GLLO 4M3UA 1EWRA 1LAVA 1EP4A 1KC8O 4B9SA 3ZLJA 2ZJPL 4H0OA 1M90O 4O5BA 4O4GA 5FDLA 1VAZA 3CC4N 4FJJA 1SUQA 4JI5K 3OYFA 4QS9A 4CZIA 4JKDA 4OJRA 4EIAA 3NH0A 4CEAA 1HR0K 5AQJA 1VQLN 4KH4A 1T44A 1HQUA 1K73O 1RBRA 3UIQA 4CJVA 3PIOL 3MEGA 4RWTA 5DK5A 1ATNA 1X1PA 4DR7K 1N36K 5F1XA 4DR6K 2P9LB 3EZ5A 2IVNA 3NDKA 3KLIA 4HCBA 5SWMA 2O4IA 4PKHA 3SQ2A 4NYFA 4OKKA 1KQSM 4X65K 1J5OA 3O9QA 5AQXA 4CJFA 3MAQA 3A0IX 3C6HA 3CCMN 4JI8K 3AGKA 2PBDA 1T8EA 3O1WA 4IG3A 1XI1A 4FLZA 3L2RA 2IOCA 5F0XA 2VQFK 4BR2A 4WQ5A 2NRVA 4FWLA 2XY6A 3THXA 2IAJA 3MWPA 4CBXA 5JVGL 5AQWA 2V52B 3ULEB 3F5TA 4IDHA 5AQNA 1NJIO 2E2PA 5LJVA 3A5OC 4ISFA 1ESVA 4PHTX 3HJFA 4IEEA 3DRPA 3T7ZA 3KLHA 2ZJQL 2HVHA 4LSNA 4FLUA 4J2DA 3AVGA 4PY5A 1TL1A 4JKAA 1XQSC 3NCIA 1K8KB 2P9SA 5BRFA 4IOXA 4QAGA 1BO5O 5AFUH 3DRRA 5T7BA 3DRSA 1RFQA 1MU2A 2D5RA 3WQTA 3KK3A 2A1RA 5FRMA 4OPAA 4O5FA 3OYAA 3EY1A 5BREA 3DXMB 3TI0A 3ZETA 3OYLA 3R9PA 4CF9A 4L8RB 5AQVA 2DFFA 4K42A 1IG9A 5C2DA 1GLCG 1ZXOA 4AM6A 2FSKA 3DLRA 1DGKN 4FWQA 3N4QA 5FPNA 4L3QA 3TAFA 2QI2A 4Y0WA 1C0FA 3OS1A 1JL1A 4JNEA 4EHUA 4RW9A 4K25A 5TKYA 1TKTA 4LC9B 2Q31A 1ZBSA 4M7YA 4A59A 3DLHA 5AQKA 2YKNA 3OYIA 1JCEA 5KPRA 2VG6A 3MX5A 1HKCA 3TPQA 3OYNA 4OO1J 3G4SN 4LF4K 4FXDA 4W5OA 1KFSA 5AQLA 3SAGA 3WUHA 3DXKB 3VQ5A 3NMUA 1Q18A 2IS3A 2QXLA 3O9TA 2KTQA 5FLXO 4DU3A 5AQQA 4LF6K 3D7EO 5AR0A 4JI3K 3RSEB 2OYQA 3E9LA 3C7NB 2NZTA 1VQPN 2XY7A 4LF5K 2HHUA 1NK7A 2YCHA 1HNZK 2RHKA 4Z4CA 4FJ5A 1GLEG 3NGZA 3PLAA 1KD1O 1EQYA 2O8FB 2IVOA 3QEWA 1YVUA 4DU1A 1YUWA 1QSSA 4B3MK 3I33A 1GLBG 4CGGA 3DLGA 2HOEA 4CK3A 1JLAA 1OH5A 4HTUA 2QEXN 1WSGA 2P9IA 3S9HA 4CD3A 3I8BA 2FF6A 3P83D 1N32K 3SI6A 4CEFA 4YORA 4W5RA 3CQ8A 1TL3A 4ELUA 4BRGA 5LJWA 3L2WA 2HMPA 4CJ5A 4BRKA 1U2VA 4YHHK 4CHYA 3J80O 2QKBA 5GAEP 4C8LA 2ASOA 3TARA 3HPGA 1R59O 1NGGA 2FBVA 2CGJA 4EZ9A 1IKVA 1LW2A 3V4IA 5KPZA 3G71N 4WFBL 1J5EK 3AA5X 3K9JA 1C1CA 3VEYA 4E89A 3QINA 1NGCA 5ADXH 2CGLA 3CJAA 5HRNA 2G8UA 3DOLA 2A6AA 4GV3A 4IKFA 1VSKA 1UWBA 4QS8A 1NOYA 1EX4A 2X6NA 4DTUA 1BIUA 2OPSA 1SKWA 4DV6K 4F8RA 4E1JA 1IH7A 4Z94A 2UXBK 1VQON 3WNEA 4JRPA 4CEBA 4GVMA 1VSLA 4KREA 4O8UA 2QM1A 5JVHL 3G10A 1VSMA 4N56A 4B3SK 4B9MA 3CCQN 3MXMA 4CJWA 1QHTA 3CCSN 4I2PA 3CERA 5BRHA 5GAHP 1YJWN 4CZHA 4H0VB 4R79A 5GIPA 2HMIA 2JWLA 4KAZA 4J2BA 2E6MA 3VENA 3J81O 1JLBA 2QWOA 4NB4A 3T19A 1RDAA 3DI6A 1OVYA 3I0SA 5FRNA 3KLGA 3ZCMA 3I8DA 3VA0A 2HW3A 1W0HA 1WNSA 3LPTA 4JV5K 4ELVA 2ZJRL 1XMOK 1Z6RA 1CXUA 3QFPA 1KAXA 3E9OA 2GUPA 3VQ6A 2ZGYA 1GOBA 4Z4HA 1JCFA 4KBOA 3V81A 1Q82O 1NGBA 4C8OA 2KW4A 3NHGA 1L3VA 2ZD1A 2AA4A 4IOCL 4ILJA 3CMAN 3TANA 1V4SA 5BR9A 2FF3B 1CZAN 2XY8A 3KTQA 2NRWA 1FKPA 2Q2RA 3NVMA 1S1VA 3CJBA 4KHQA 2G8IA 3IS9A 1TKDA 3LDNA 2O4GA 3SQ1A 4IJAA 3DWLA 4WFNL 2VWJA 3H3NO 3VERA 2HHWA 2E2QA 3D0PA 5AQFA 1LV5A 4DQQA 4DR2K 3ASMA 3AVHA 2ZM6K 4W5NA 3SZ2A 3MCPA 3N4PA 4CIFA 4CGHA 4LFAK 2HNZA 1NBWA 4E19A 3SAFA 3OY9A 4OLAA 1WOQA 4FJ8A 3ZSOA 4WQ5C 3VF2A 3B6OA 1NJZA 4KH5A 4I6MA 3ULEA 2KZMA 5I3UA 4MFBA 3CMEN 1TAUA 3TAMA 5C12A 1WSIA 4OKEA 3CQXA 5MLCQ 3LAKA 5CZ2A 3VGLA 3NGYA 2IGIA 3AVBA 5I9EB 1N34K 1NLVA 5F2RA 1D9FA 4B8AB 1SKRA 3VQQA 5HLFA 2UU9K 2WC9A 1C6VA 2KLAA 4KHSA 3RWUA 3OYHA 1M1KO 2B4JA 5DM6L 3S3OA 4LY7A 4RCHA 2E6LA 4NCBA 3NH1A 3HPHA 3M8PA 3V9XA 3PY8A 3DXMA 3WXMB 2F8SA 3WXKA 1IBLK 4KPYA 1B9DA 2I5JA 3ZETB 3QFUA 1WLJA 4BC4A 4DV4K 4M45A 4GMJB 4Z4FA 2NRRA 1YTUA 4A62A 5IT9O 5AQUA 3C6TA 1VSFA 1SL0A 3C65A 3OYGA 1NKBA 1KXPA 4JK8A 4BRNA 2A40A 1BI4A 4J8FA 4AHRA 2NRTA 3WNGA 3LP2A 5KRSA 3CCEN 3B8AX 4FOEA 1RT2A 4CJ7A 4DSEA 2A3ZA 2FC0A 4AF1A 2CH6A 3FGUA 4JKHA 4B1UB 1C0UA 1NU0A 4JKFA 3AARA 4C23A 2GEMA 2A5XA 3OW2M 1LW0A
chains in the Genus database with same CATH topology
3VN5A 2E4LA 5J1EA 4M3UA 4M3YA 1ZBIA 3OYBA 1LAVA 3ZT0A 1Q9YA 1EP4A 1RTHA 3P5JA 4B9SA 3AA4A 2OZSA 1HYZA 3V9WA 3KIOA 1NKEA 4HVJA 3ZSXA 1YTAA 1RT1A 1KRPA 4O5BA 3V1QA 4O4GA 2BGGA 5FDLA 3OYCA 3P1GA 5J2QA 1L3TA 4FJJA 1SUQA 3AO2A 1HQEA 3L3VA 4W5QA 3OYFA 4B3OA 4OJRA 3NH0A 3D45A 4N5SA 1NOZA 4CEAA 4DTJA 4CECA 3RR7A 1Z25A 4CFCA 2P1JA 1JKHA 4FZXC 3S3MA 3EYZA 2KZZA 2IC3A 1HQUA 2YNHA 1RBRA 4DU4A 1KVCA 1FK9A 3UIQA 4CJVA 1HMVA 3MEGA 3PX0A 2X74A 4QOZB 2HHVA 3C95A 5DK5A 4CF1A 1HYVA 4B9UA 1X1PA 3CFPA 5C42A 1TGOA 1D8YA 3SYZA 1JL2A 4PQUA 3SV4A 3EZ5A 1WSJA 3NDKA 4E7JA 3U3GA 1S9EA 3KLIA 3DYAA 3PO5A 4IDKA 3KKSA 4HUFA 3AVLA 1UAXA 1RT7A 4HCBA 3MXJA 1HPZA 3LP1A 5SWMA 2XO7A 1CZ9A 3HXMA 3F73A 2KQ2A 1NJWA 4KTWA 4KHNA 2O4IA 4WE1A 3SQ2A 4CERA 4NYFA 3PO4A 4OKKA 4AHUA 3TR8A 1VSIA 1J5OA 1F21A 4CJFA 3MAQA 5HROA 1RTDA 4EZ6A 4DTNA 4FJMA 3NGIA 3T1AA 4R5PA 1BCMA 4OGEA 1T8EA 2Y1JA 3L8BA 4IG3A 1TV6A 4BWJA 3SPZA 1XI1A 4FLZA 1C0TA 4DQPA 3L2RA 1JLEA 4E7KA 2X78A 4BDZA 2OA8A 4N76A 2IOCA 3CFOA 4FZZA 2KFZA 3QLHA 4KKOA 3C6UA 4CJLA 3QEPA 3RR8A 1ZYQA 1X9SA 1XC9A 2JLEA 1NK5A 3M8SA 3RTVA 1HYSA 3T3FA 1BCOA 2BANA 3K5OA 1KFDA 2XY6A 2IAJA 4ELTA 3VQ9A 4ID1A 2OPPA 3ZSQA 3ZT4A 1RILA 3VQ8A 5J2NA 1T03A 1S6PA 4XIUA 1IKWA 3F9KA 1WSEA 3OYEA 1GOCA 1J53A 4CEOA 2NUBA 3OS0A 3HJFA 1Z26A 2ATQA 3DRPA 1TKXA 5CYQA 3KLHA 4M3ZA 2XHBA 2HVHA 1QSLA 3KD1E 3SV3A 4LSNA 4FLUA 2ZQBA 3NH2A 1RDCA 4J2DA 3AVGA 2F96A 1RT4A 1YT3A 1TL1A 4KTZA 4PY5A 3AO1A 3V1RA 3NCIA 2B5JA 4Z4IA 3IRXA 4B9NA 3ZT1A 4QAGA 1WSFA 5KGWA 1X9MA 3ZT3A 3U6FA 4CHOA 3DRRA 5T7BA 1L3SA 3DRSA 1ITGA 1RT6A 3TAGA 3LP0A 1MU2A 1QE1A 2D5RA 3KK3A 4J2AA 1U49A 2A1RA 4Z4EA 4CJQA 2XRIA 5FRMA 2P51A 2YKMA 4CF8A 2ITGA 4HCCA 5J2PA 4G1QA 1S1XA 3SUPA 3OYAA 3EY1A 4O0JA 3THVA 1WN7A 4CGIA 3TI0A 1CZBA 1S1WA 4B9LA 5K14A 3OYLA 4B9MA 2YHBA 3ITHA 4CF9A 3NAEA 4I2QA 4L8RB 4UQGA 4DTMA 1VSEA 3QETA 1SV5A 2DFFA 3K59A 1L3UA 3BDPA 3LZIA 3LWMA 1WAJA 3NF7A 1A5VA 2OPRA 3I0RA 3LAMA 3MXIA 1IG9A 3DLKA 3HVTA 1Q8IA 5HRSA 1DTTA 1I3AA 3DLRA 2HHTA 5E41A 3HO1A 3ZT2A 5JS1A 3LWLA 3OYMA 4F2RA 4KI4A 4FJLA 1C1BA 3OVNA 3TAFA 3L2QA 4DSJA 3TWHA 4IG0A 4Z0UA 4E7HA 3CM5A 1VSHA 3HP9A 4FK0A 1D5AA 2HHQA 3NFAA 4BDYA 3OJSA 3OS1A 1JL1A 1RBSA 4RW9A 4FJ7A 3K5NA 3SUOA 4CJPA 2OZMA 5KTQA 4FM1A 2YNIA 2Z1HA 1TKTA 4M3RA 3KK1A 1LAWA 2QXFA 4FLYA 3TAEA 1SKSA 4OLBA 4M3XA 4B9TA 3DLHA 2BE2A 3AO5A 3QEIA 4ZTFA 2YKNA 4K8ZA 4CJKA 3SQ4A 3OYIA 4JS5A 4Z4GA 2GV9A 3HVRA 4BE0A 4CF0A 4KHUA 3KK2A 2F8TA 2EX3A 4ZHRA 1U4BA 3QO9A 4LSLA 3AA3A 2D0BA 2W42A 3RMCA 5HRPA 3VQBA 2VG6A 4FW2A 4CE9A 1KLMA 4DFJA 3IAYA 5KGXA 4FJKA 4JLHA 5I42A 3QIPA 1S5JA 2FBYA 3OYNA 1BISA 3ZSZA 4RW6A 2Y1IA 4FLXA 3VQ4A 3MEDA 3K5MA 4O44A 3SCXA 4W5OA 3S3NA 1QSYA 1KFSA 4M3WA 1HJRA 4Y1CA 3SQ0A 1BIZA 3VQ5A 2IS3A 2KTQA 1RDDA 3U3YA 4DU3A 4CJ4A 3JYTA 1RBTA 2XY5A 1DLOA 4HUGA 3WNHA 4E7IA 2P5OA 2HNDA 4E7LA 1BQMA 2IDOA 3VQPA 1TK8A 3AA2A 2PYLA 4CJUA 2OYQA 1T7PA 5EU7A 3LALA 5SZTA 3DM2A 4B9VA 1TAQA 4CHPA 2HVIA 2XY7A 2HHUA 4CHZA 3HM9A 3VQCA 1NK7A 1ASUA 1A5WA 3RMDA 4E1NA 1NK4A 4B08A 3HK2A 3K5LA 4Z4CA 4FJ5A 1RNHA 3NGZA 2D0CA 3QIOA 2ETJA 4DSIA 1UOCA 3QEWA 4KHYA 3LDSA 2YNGA 1IO2A 1YVUA 4DU1A 2HHXA 1QSSA 3LPUA 4CGGA 3DLGA 1B9FA 2B6AA 4CK3A 5C25A 1HNVA 1JLAA 4M3TA 1SL2A 4HTUA 1VRTA 4C8MA 2PYJA 1WSGA 3S9HA 3KLEA 4DS5A 4E1MA 3P83D 2PZSA 1BHLA 3SI6A 1ZBLA 4QCLA 3ALYA 4CEFA 4AHCA 4PUOA 4W5RA 3CQ8A 1QS4A 1TL3A 4H4OA 2VG7A 4BE2A 4ELUA 4J2EA 1D9DA 2BDPA 5C24A 4FJGA 4PWDA 4AHVA 3L2WA 1RT5A 4CJ5A 1SL1A 2P5GA 2KFNA 1G15A 4CHYA 4CFBA 2QKBA 5CYMA 1S9GA 4DSKA 3E01A 4C8LA 3TARA 3HPGA 2VWKA 1VSJA 1XHXA 2HB5A 1CLQA 2FBVA 4KV8A 3HPOA 1NKCA 4EZ9A 3JSMA 3TABA 4KRFA 1IKVA 3PX6A 1LW2A 3V4IA 1A5XA 1KSPA 3MEEA 1S6QA 3AA5X 3AO3A 1C1CA 4KFBA 1HNIA 4Y1DA 3VQ7A 4E89A 3QINA 2R7YA 4H4MA 4YNQA 3PV8A 1C1AA 4N41A 1ASVA 4M42A 1U45A 4FJHA 5CY4A 2Z1IA 5HRNA 1TK0A 1ZBHA 1WAFA 2G8UA 4CCHA 3DOLA 4FM0A 4YFUA 4IKFA 1VSKA 1JLGA 2DFHA 4CJTA 1UWBA 4KI6A 4FZYA 1NOYA 3O3GA 3KD5E 1EX4A 2X6NA 4PA1A 3O4NA 4DTUA 3VQAA 3DLEA 1BIUA 4LH4A 2OPSA 4IBNA 1SKWA 3O4QA 4BWMA 4CJRA 1BQNA 2ZE2A 4F8RA 2WONA 3SUNA 1IH7A 5FROA 3RMBA 1JLCA 4AHSA 3O3HA 4CFDA 3RRGA 4FJIA 1VK0A 4OLAA 3WNEA 4JRPA 1NK8A 1S1TA 4CGJA 1RT3A 3ZSYA 4GVMA 4CEBA 4FJ9A 3WNFA 4IFYA 1R0AA 1VSLA 3DMJA 1NK6A 1N5YA 4KREA 4CHNA 1KTQA 3AVJA 3G10A 1VSMA 4N56A 3TAQA 4DFPA 2RN2A 3AVMA 4JRQA 3MXMA 1REVA 1UA1A 3M8RA 4CJWA 1QHTA 4I2PA 4RG8A 2JGUA 1U04A 3QEXA 4DSLA 3HYFA 3KLFA 2HMIA 4DS4A 4FM2A 1BI4B 1RTIA 4CEQA 4CK1A 3LANA 4KAZA 4J2BA 3HL8A 3K2PA 1LWFA 2E6MA 4DG1A 2YV0X 1ASWA 4ID5A 3ZSRA 3PUFA 1JLBA 1LWEA 4KB1A 4JS4A 4LD0A 3T19A 1RDAA 3DI6A 3NE6A 3SUQA 3I0SA 4N47A 3LZJA 4DF4A 4DQIA 5FRNA 1RBUA 4CESA 4CJSA 3KLGA 2X6SA 3ZCMA 3I8DA 3VA0A 4FXDA 1EKEA 5HRRA 2HW3A 1W0HA 4FLVA 4DWIA 1WNSA 3LPTA 4OVLA 4ELVA 4LH5A 4CJ3A 4FK2A 1JXEA 4DQSA 4I9LA 3QNOA 4NYNA 4MQ3A 1CXUA 1RBVA 1RCHA 4DTSA 4HHTA 4CF2A 3HT3A 1RTJA 2YNFA 3VQ6A 4DQRA 1IKXA 1JLQA 2G8VA 3V6DA 2RKIA 4F2SA 2Z1GA 1GOBA 2Q3SA 4M41A 4FLWA 3NBPA 1B92A 1XHZA 4Z4HA 1KCFA 4OPJA 5J2MA 1W9HA 4FCYA 2RF2A 4DFMA 1BGXT 4DTPA 3QEVA 1RDBA 2A1SA 1N6QA 4OKJA 4DTXA 2GBZA 1J9AA 3ZSWA 5JS2A 3V81A 4CFAA 2D0AA 3IG1A 4DLGA 2VG5A 4C8OA 4ICLA 2KW4A 3DLBA 3NHGA 1L3VA 2ZD1A 1IKYA 4Q5VA 1U48A 2QKKA 4IFVA 2LSNA 4FLTA 1L5UA 3TAPA 3KKRA 1UA0A 5HP1A 3L3UA 3K58A 3TANA 1NJXA 1C0MA 4I7FA 4GW6A 3CFRA 2FBXA 4DTRA 4FJNA 1HRHA 4NCAA 2XY8A 4CEDA 5KRTA 1FKPA 3V9UA 3KTQA 1S1VA 1TKZA 3OYJA 4DSFA 4KHQA 3HSTB 2G8IA 1QTMA 3SPYA 3IS9A 3AVCA 1KVAA 3L2UA 3NF9A 1TKDA 4Q0BA 4FYDA 2O4GA 3SQ1A 1I39A 1WSHA 1NK9A 4BDPA 3VQDA 4RW4A 2VWJA 2PY5A 1U47A 4FVMA 2HHWA 3D0PA 3H08A 1FKOA 2FBTA 5HBMA 1LV5A 3V9ZA 3B6PA 4DQQA 2G8HA 2DFEA 3BGRA 3AO4A 2G8WA 4F3TA 1ZBUA 3ASMA 3CYMA 2G8KA 3AVHA 2DY4A 4W5NA 3SZ2A 1EETA 2WOMA 4CIGA 4K8XA 4CIFA 4CGHA 4CK2A 4BE1A 4EP4A 4EP5A 4HUEA 2HNZA 4AILC 1K6YA 3M8QA 1JXBA 1EXQA 4E19A 3OY9A 3OJUA 4C8KA 4FJ8A 4O0IA 4FK4A 3ZSOA 3OS2A 1QQCA 4DLEA 1NJYA 2HHSA 3FFIA 3B6OA 1NJZA 4NCGA 3SJJA 3QNNA 5KI6A 1O1WA 3LP3A 3MECA 3NF6A 2KZMA 5I3UA 4MFBA 4CHQA 1TAUA 3TAMA 3ZSVA 1TVRA 1WSIA 3AVAA 4OKEA 2GUIA 4KB0A 3CM6A 3QESA 2QK9A 3ULDA 4FW1A 4DF8A 3LAKA 3AVIA 5CZ2A 3V9SA 4FJXA 5DMRA 3PX4A 2G8FA 3NGYA 2IGIA 3AVBA 4DFKA 3C94A 3OYKA 1D9FA 1J54A 4OPKA 3A2FA 4B8AB 1SKRA 4F4KA 3VQQA 5HLFA 5D3GA 4O55A 1C6VA 4KHSA 3RWUA 1CXQA 3OYHA 4CIEA 4BACA 4I9QA 2B4JA 3S3OA 3OYDA 3NF8A 4LY7A 4E0DA 4CEZA 4RW7A 1ZBFA 3ISNC 2E6LA 4NCBA 4DMNA 1JLFA 3HPHA 3M8PA 5CZ1A 3NH1A 3SNNA 3V9XA 1XWLA 3G0ZA 3PY8A 4E3SA 1VRUA 3CG7A 2F8SA 4CJEA 4KPYA 4B8CA 1B9DA 2I5JA 2YHAA 1LWCA 3VQEA 4AH9A 1WLJA 4M45A 4GMJB 2AJQA 4Z4FA 1DTQA 3KJVA 2EHGA 2Z1JA 3DOKA 1X9WA 1YTUA 3VA3A 1FXXA 4KTQA 4H8KA 1GOAA 4W5TA 3V1OA 3RMAA 4TSXA 3K57A 3RRHA 3C6TA 1VSFA 4C8NA 1T05A 1SL0A 1BL3A 4OGCA 3OYGA 2HNYA 4CGFA 3AVNA 3L2VA 1NKBA 4RW8A 1Q9XA 4KHWA 2DTUA 1KVBA 1KLNA 4DTOA 4AHTA 1BI4A 4ZTJA 3O3FA 4AHRA 4CGDA 3WNGA 3HP6A 3LP2A 3QERA 5KRSA 3AVKA 1NK0A 1S1UA 1TK5A 1RT2A 4DSEA 1Y97A 2FC0A 3AVFA 3AV9A 4KO0A 4F3OA 1C0UA 4CEEA 1LW0A 1VSDA 2OPQA 2RPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VN5 A;  2E4L A;  5J1E A;  4M3U A;  4M3Y A;  1ZBI A;  3OYB A;  1LAV A;  3ZT0 A;  1Q9Y A;  1EP4 A;  1RTH A;  3P5J A;  4B9S A;  3AA4 A;  2OZS A;  1HYZ A;  3V9W A;  3KIO A;  1NKE A;  4HVJ A;  3ZSX A;  1YTA A;  1RT1 A;  1KRP A;  4O5B A;  3V1Q A;  4O4G A;  2BGG A;  5FDL A;  3OYC A;  3P1G A;  5J2Q A;  1L3T A;  4FJJ A;  1SUQ A;  3AO2 A;  1HQE A;  3L3V A;  4W5Q A;  3OYF A;  4B3O A;  4OJR A;  3NH0 A;  3D45 A;  4N5S A;  1NOZ A;  4CEA A;  4DTJ A;  4CEC A;  3RR7 A;  1Z25 A;  4CFC A;  2P1J A;  1JKH A;  4FZX C;  3S3M A;  3EYZ A;  2KZZ A;  2IC3 A;  1HQU A;  2YNH A;  1RBR A;  4DU4 A;  1KVC A;  1FK9 A;  3UIQ A;  4CJV A;  1HMV A;  3MEG A;  3PX0 A;  2X74 A;  4QOZ B;  2HHV A;  3C95 A;  5DK5 A;  4CF1 A;  1HYV A;  4B9U A;  1X1P A;  3CFP A;  5C42 A;  1TGO A;  1D8Y A;  3SYZ A;  1JL2 A;  4PQU A;  3SV4 A;  3EZ5 A;  1WSJ A;  3NDK A;  4E7J A;  3U3G A;  1S9E A;  3KLI A;  3DYA A;  3PO5 A;  4IDK A;  3KKS A;  4HUF A;  3AVL A;  1UAX A;  1RT7 A;  4HCB A;  3MXJ A;  1HPZ A;  3LP1 A;  5SWM A;  2XO7 A;  1CZ9 A;  3HXM A;  3F73 A;  2KQ2 A;  1NJW A;  4KTW A;  4KHN A;  2O4I A;  4WE1 A;  3SQ2 A;  4CER A;  4NYF A;  3PO4 A;  4OKK A;  4AHU A;  3TR8 A;  1VSI A;  1J5O A;  1F21 A;  4CJF A;  3MAQ A;  5HRO A;  1RTD A;  4EZ6 A;  4DTN A;  4FJM A;  3NGI A;  3T1A A;  4R5P A;  1BCM A;  4OGE A;  1T8E A;  2Y1J A;  3L8B A;  4IG3 A;  1TV6 A;  4BWJ A;  3SPZ A;  1XI1 A;  4FLZ A;  1C0T A;  4DQP A;  3L2R A;  1JLE A;  4E7K A;  2X78 A;  4BDZ A;  2OA8 A;  4N76 A;  2IOC A;  3CFO A;  4FZZ A;  2KFZ A;  3QLH A;  4KKO A;  3C6U A;  4CJL A;  3QEP A;  3RR8 A;  1ZYQ A;  1X9S A;  1XC9 A;  2JLE A;  1NK5 A;  3M8S A;  3RTV A;  1HYS A;  3T3F A;  1BCO A;  2BAN A;  3K5O A;  1KFD A;  2XY6 A;  2IAJ A;  4ELT A;  3VQ9 A;  4ID1 A;  2OPP A;  3ZSQ A;  3ZT4 A;  1RIL A;  3VQ8 A;  5J2N A;  1T03 A;  1S6P A;  4XIU A;  1IKW A;  3F9K A;  1WSE A;  3OYE A;  1GOC A;  1J53 A;  4CEO A;  2NUB A;  3OS0 A;  3HJF A;  1Z26 A;  2ATQ A;  3DRP A;  1TKX A;  5CYQ A;  3KLH A;  4M3Z A;  2XHB A;  2HVH A;  1QSL A;  3KD1 E;  3SV3 A;  4LSN A;  4FLU A;  2ZQB A;  3NH2 A;  1RDC A;  4J2D A;  3AVG A;  2F96 A;  1RT4 A;  1YT3 A;  1TL1 A;  4KTZ A;  4PY5 A;  3AO1 A;  3V1R A;  3NCI A;  2B5J A;  4Z4I A;  3IRX A;  4B9N A;  3ZT1 A;  4QAG A;  1WSF A;  5KGW A;  1X9M A;  3ZT3 A;  3U6F A;  4CHO A;  3DRR A;  5T7B A;  1L3S A;  3DRS A;  1ITG A;  1RT6 A;  3TAG A;  3LP0 A;  1MU2 A;  1QE1 A;  2D5R A;  3KK3 A;  4J2A A;  1U49 A;  2A1R A;  4Z4E A;  4CJQ A;  2XRI A;  5FRM A;  2P51 A;  2YKM A;  4CF8 A;  2ITG A;  4HCC A;  5J2P A;  4G1Q A;  1S1X A;  3SUP A;  3OYA A;  3EY1 A;  4O0J A;  3THV A;  1WN7 A;  4CGI A;  3TI0 A;  1CZB A;  1S1W A;  4B9L A;  5K14 A;  3OYL A;  4B9M A;  2YHB A;  3ITH A;  4CF9 A;  3NAE A;  4I2Q A;  4L8R B;  4UQG A;  4DTM A;  1VSE A;  3QET A;  1SV5 A;  2DFF A;  3K59 A;  1L3U A;  3BDP A;  3LZI A;  3LWM A;  1WAJ A;  3NF7 A;  1A5V A;  2OPR A;  3I0R A;  3LAM A;  3MXI A;  1IG9 A;  3DLK A;  3HVT A;  1Q8I A;  5HRS A;  1DTT A;  1I3A A;  3DLR A;  2HHT A;  5E41 A;  3HO1 A;  3ZT2 A;  5JS1 A;  3LWL A;  3OYM A;  4F2R A;  4KI4 A;  4FJL A;  1C1B A;  3OVN A;  3TAF A;  3L2Q A;  4DSJ A;  3TWH A;  4IG0 A;  4Z0U A;  4E7H A;  3CM5 A;  1VSH A;  3HP9 A;  4FK0 A;  1D5A A;  2HHQ A;  3NFA A;  4BDY A;  3OJS A;  3OS1 A;  1JL1 A;  1RBS A;  4RW9 A;  4FJ7 A;  3K5N A;  3SUO A;  4CJP A;  2OZM A;  5KTQ A;  4FM1 A;  2YNI A;  2Z1H A;  1TKT A;  4M3R A;  3KK1 A;  1LAW A;  2QXF A;  4FLY A;  3TAE A;  1SKS A;  4OLB A;  4M3X A;  4B9T A;  3DLH A;  2BE2 A;  3AO5 A;  3QEI A;  4ZTF A;  2YKN A;  4K8Z A;  4CJK A;  3SQ4 A;  3OYI A;  4JS5 A;  4Z4G A;  2GV9 A;  3HVR A;  4BE0 A;  4CF0 A;  4KHU A;  3KK2 A;  2F8T A;  2EX3 A;  4ZHR A;  1U4B A;  3QO9 A;  4LSL A;  3AA3 A;  2D0B A;  2W42 A;  3RMC A;  5HRP A;  3VQB A;  2VG6 A;  4FW2 A;  4CE9 A;  1KLM A;  4DFJ A;  3IAY A;  5KGX A;  4FJK A;  4JLH A;  5I42 A;  3QIP A;  1S5J A;  2FBY A;  3OYN A;  1BIS A;  3ZSZ A;  4RW6 A;  2Y1I A;  4FLX A;  3VQ4 A;  3MED A;  3K5M A;  4O44 A;  3SCX A;  4W5O A;  3S3N A;  1QSY A;  1KFS A;  4M3W A;  1HJR A;  4Y1C A;  3SQ0 A;  1BIZ A;  3VQ5 A;  2IS3 A;  2KTQ A;  1RDD A;  3U3Y A;  4DU3 A;  4CJ4 A;  3JYT A;  1RBT A;  2XY5 A;  1DLO A;  4HUG A;  3WNH A;  4E7I A;  2P5O A;  2HND A;  4E7L A;  1BQM A;  2IDO A;  3VQP A;  1TK8 A;  3AA2 A;  2PYL A;  4CJU A;  2OYQ A;  1T7P A;  5EU7 A;  3LAL A;  5SZT A;  3DM2 A;  4B9V A;  1TAQ A;  4CHP A;  2HVI A;  2XY7 A;  2HHU A;  4CHZ A;  3HM9 A;  3VQC A;  1NK7 A;  1ASU A;  1A5W A;  3RMD A;  4E1N A;  1NK4 A;  4B08 A;  3HK2 A;  3K5L A;  4Z4C A;  4FJ5 A;  1RNH A;  3NGZ A;  2D0C A;  3QIO A;  2ETJ A;  4DSI A;  1UOC A;  3QEW A;  4KHY A;  3LDS A;  2YNG A;  1IO2 A;  1YVU A;  4DU1 A;  2HHX A;  1QSS A;  3LPU A;  4CGG A;  3DLG A;  1B9F A;  2B6A A;  4CK3 A;  5C25 A;  1HNV A;  1JLA A;  4M3T A;  1SL2 A;  4HTU A;  1VRT A;  4C8M A;  2PYJ A;  1WSG A;  3S9H A;  3KLE A;  4DS5 A;  4E1M A;  3P83 D;  2PZS A;  1BHL A;  3SI6 A;  1ZBL A;  4QCL A;  3ALY A;  4CEF A;  4AHC A;  4PUO A;  4W5R A;  3CQ8 A;  1QS4 A;  1TL3 A;  4H4O A;  2VG7 A;  4BE2 A;  4ELU A;  4J2E A;  1D9D A;  2BDP A;  5C24 A;  4FJG A;  4PWD A;  4AHV A;  3L2W A;  1RT5 A;  4CJ5 A;  1SL1 A;  2P5G A;  2KFN A;  1G15 A;  4CHY A;  4CFB A;  2QKB A;  5CYM A;  1S9G A;  4DSK A;  3E01 A;  4C8L A;  3TAR A;  3HPG A;  2VWK A;  1VSJ A;  1XHX A;  2HB5 A;  1CLQ A;  2FBV A;  4KV8 A;  3HPO A;  1NKC A;  4EZ9 A;  3JSM A;  3TAB A;  4KRF A;  1IKV A;  3PX6 A;  1LW2 A;  3V4I A;  1A5X A;  1KSP A;  3MEE A;  1S6Q A;  3AA5 X;  3AO3 A;  1C1C A;  4KFB A;  1HNI A;  4Y1D A;  3VQ7 A;  4E89 A;  3QIN A;  2R7Y A;  4H4M A;  4YNQ A;  3PV8 A;  1C1A A;  4N41 A;  1ASV A;  4M42 A;  1U45 A;  4FJH A;  5CY4 A;  2Z1I A;  5HRN A;  1TK0 A;  1ZBH A;  1WAF A;  2G8U A;  4CCH A;  3DOL A;  4FM0 A;  4YFU A;  4IKF A;  1VSK A;  1JLG A;  2DFH A;  4CJT A;  1UWB A;  4KI6 A;  4FZY A;  1NOY A;  3O3G A;  3KD5 E;  1EX4 A;  2X6N A;  4PA1 A;  3O4N A;  4DTU A;  3VQA A;  3DLE A;  1BIU A;  4LH4 A;  2OPS A;  4IBN A;  1SKW A;  3O4Q A;  4BWM A;  4CJR A;  1BQN A;  2ZE2 A;  4F8R A;  2WON A;  3SUN A;  1IH7 A;  5FRO A;  3RMB A;  1JLC A;  4AHS A;  3O3H A;  4CFD A;  3RRG A;  4FJI A;  1VK0 A;  4OLA A;  3WNE A;  4JRP A;  1NK8 A;  1S1T A;  4CGJ A;  1RT3 A;  3ZSY A;  4GVM A;  4CEB A;  4FJ9 A;  3WNF A;  4IFY A;  1R0A A;  1VSL A;  3DMJ A;  1NK6 A;  1N5Y A;  4KRE A;  4CHN A;  1KTQ A;  3AVJ A;  3G10 A;  1VSM A;  4N56 A;  3TAQ A;  4DFP A;  2RN2 A;  3AVM A;  4JRQ A;  3MXM A;  1REV A;  1UA1 A;  3M8R A;  4CJW A;  1QHT A;  4I2P A;  4RG8 A;  2JGU A;  1U04 A;  3QEX A;  4DSL A;  3HYF A;  3KLF A;  2HMI A;  4DS4 A;  4FM2 A;  1BI4 B;  1RTI A;  4CEQ A;  4CK1 A;  3LAN A;  4KAZ A;  4J2B A;  3HL8 A;  3K2P A;  1LWF A;  2E6M A;  4DG1 A;  2YV0 X;  1ASW A;  4ID5 A;  3ZSR A;  3PUF A;  1JLB A;  1LWE A;  4KB1 A;  4JS4 A;  4LD0 A;  3T19 A;  1RDA A;  3DI6 A;  3NE6 A;  3SUQ A;  3I0S A;  4N47 A;  3LZJ A;  4DF4 A;  4DQI A;  5FRN A;  1RBU A;  4CES A;  4CJS A;  3KLG A;  2X6S A;  3ZCM A;  3I8D A;  3VA0 A;  4FXD A;  1EKE A;  5HRR A;  2HW3 A;  1W0H A;  4FLV A;  4DWI A;  1WNS A;  3LPT A;  4OVL A;  4ELV A;  4LH5 A;  4CJ3 A;  4FK2 A;  1JXE A;  4DQS A;  4I9L A;  3QNO A;  4NYN A;  4MQ3 A;  1CXU A;  1RBV A;  1RCH A;  4DTS A;  4HHT A;  4CF2 A;  3HT3 A;  1RTJ A;  2YNF A;  3VQ6 A;  4DQR A;  1IKX A;  1JLQ A;  2G8V A;  3V6D A;  2RKI A;  4F2S A;  2Z1G A;  1GOB A;  2Q3S A;  4M41 A;  4FLW A;  3NBP A;  1B92 A;  1XHZ A;  4Z4H A;  1KCF A;  4OPJ A;  5J2M A;  1W9H A;  4FCY A;  2RF2 A;  4DFM A;  1BGX T;  4DTP A;  3QEV A;  1RDB A;  2A1S A;  1N6Q A;  4OKJ A;  4DTX A;  2GBZ A;  1J9A A;  3ZSW A;  5JS2 A;  3V81 A;  4CFA A;  2D0A A;  3IG1 A;  4DLG A;  2VG5 A;  4C8O A;  4ICL A;  2KW4 A;  3DLB A;  3NHG A;  1L3V A;  2ZD1 A;  1IKY A;  4Q5V A;  1U48 A;  2QKK A;  4IFV A;  2LSN A;  4FLT A;  1L5U A;  3TAP A;  3KKR A;  1UA0 A;  5HP1 A;  3L3U A;  3K58 A;  3TAN A;  1NJX A;  1C0M A;  4I7F A;  4GW6 A;  3CFR A;  2FBX A;  4DTR A;  4FJN A;  1HRH A;  4NCA A;  2XY8 A;  4CED A;  5KRT A;  1FKP A;  3V9U A;  3KTQ A;  1S1V A;  1TKZ A;  3OYJ A;  4DSF A;  4KHQ A;  3HST B;  2G8I A;  1QTM A;  3SPY A;  3IS9 A;  3AVC A;  1KVA A;  3L2U A;  3NF9 A;  1TKD A;  4Q0B A;  4FYD A;  2O4G A;  3SQ1 A;  1I39 A;  1WSH A;  1NK9 A;  4BDP A;  3VQD A;  4RW4 A;  2VWJ A;  2PY5 A;  1U47 A;  4FVM A;  2HHW A;  3D0P A;  3H08 A;  1FKO A;  2FBT A;  5HBM A;  1LV5 A;  3V9Z A;  3B6P A;  4DQQ A;  2G8H A;  2DFE A;  3BGR A;  3AO4 A;  2G8W A;  4F3T A;  1ZBU A;  3ASM A;  3CYM A;  2G8K A;  3AVH A;  2DY4 A;  4W5N A;  3SZ2 A;  1EET A;  2WOM A;  4CIG A;  4K8X A;  4CIF A;  4CGH A;  4CK2 A;  4BE1 A;  4EP4 A;  4EP5 A;  4HUE A;  2HNZ A;  4AIL C;  1K6Y A;  3M8Q A;  1JXB A;  1EXQ A;  4E19 A;  3OY9 A;  3OJU A;  4C8K A;  4FJ8 A;  4O0I A;  4FK4 A;  3ZSO A;  3OS2 A;  1QQC A;  4DLE A;  1NJY A;  2HHS A;  3FFI A;  3B6O A;  1NJZ A;  4NCG A;  3SJJ A;  3QNN A;  5KI6 A;  1O1W A;  3LP3 A;  3MEC A;  3NF6 A;  2KZM A;  5I3U A;  4MFB A;  4CHQ A;  1TAU A;  3TAM A;  3ZSV A;  1TVR A;  1WSI A;  3AVA A;  4OKE A;  2GUI A;  4KB0 A;  3CM6 A;  3QES A;  2QK9 A;  3ULD A;  4FW1 A;  4DF8 A;  3LAK A;  3AVI A;  5CZ2 A;  3V9S A;  4FJX A;  5DMR A;  3PX4 A;  2G8F A;  3NGY A;  2IGI A;  3AVB A;  4DFK A;  3C94 A;  3OYK A;  1D9F A;  1J54 A;  4OPK A;  3A2F A;  4B8A B;  1SKR A;  4F4K A;  3VQQ A;  5HLF A;  5D3G A;  4O55 A;  1C6V A;  4KHS A;  3RWU A;  1CXQ A;  3OYH A;  4CIE A;  4BAC A;  4I9Q A;  2B4J A;  3S3O A;  3OYD A;  3NF8 A;  4LY7 A;  4E0D A;  4CEZ A;  4RW7 A;  1ZBF A;  3ISN C;  2E6L A;  4NCB A;  4DMN A;  1JLF A;  3HPH A;  3M8P A;  5CZ1 A;  3NH1 A;  3SNN A;  3V9X A;  1XWL A;  3G0Z A;  3PY8 A;  4E3S A;  1VRU A;  3CG7 A;  2F8S A;  4CJE A;  4KPY A;  4B8C A;  1B9D A;  2I5J A;  2YHA A;  1LWC A;  3VQE A;  4AH9 A;  1WLJ A;  4M45 A;  4GMJ B;  2AJQ A;  4Z4F A;  1DTQ A;  3KJV A;  2EHG A;  2Z1J A;  3DOK A;  1X9W A;  1YTU A;  3VA3 A;  1FXX A;  4KTQ A;  4H8K A;  1GOA A;  4W5T A;  3V1O A;  3RMA A;  4TSX A;  3K57 A;  3RRH A;  3C6T A;  1VSF A;  4C8N A;  1T05 A;  1SL0 A;  1BL3 A;  4OGC A;  3OYG A;  2HNY A;  4CGF A;  3AVN A;  3L2V A;  1NKB A;  4RW8 A;  1Q9X A;  4KHW A;  2DTU A;  1KVB A;  1KLN A;  4DTO A;  4AHT A;  1BI4 A;  4ZTJ A;  3O3F A;  4AHR A;  4CGD A;  3WNG A;  3HP6 A;  3LP2 A;  3QER A;  5KRS A;  3AVK A;  1NK0 A;  1S1U A;  1TK5 A;  1RT2 A;  4DSE A;  1Y97 A;  2FC0 A;  3AVF A;  3AV9 A;  4KO0 A;  4F3O A;  1C0U A;  4CEE A;  1LW0 A;  1VSD A;  2OPQ A;  2RPI A; 
#chains in the Genus database with same CATH topology
 4IO9 L;  3ZT0 A;  2VGN A;  1RTH A;  3P5J A;  2E1Y A;  3ENB A;  3V9W A;  3KIO A;  3ZSX A;  1YTA A;  3SMS A;  5BRD A;  1OH6 A;  4FPA A;  3OYC A;  5JIC A;  3M1F A;  1L3T A;  1IV0 A;  5EXW A;  4N5S A;  1QVF M;  4CEC A;  4CFC A;  4BRC A;  3DJC A;  2KZZ A;  1KVC A;  4B1Y B;  4JKB A;  5AQR A;  3W0L A;  3SLC A;  2GX9 A;  1TGO A;  1D8Y A;  4IFE A;  2Q0U A;  3RVC A;  4E7J A;  1RGI A;  3TTC A;  1S9E A;  3SBG A;  1UAX A;  1RT7 A;  1P8Z A;  1HPZ A;  1WBB A;  4KHN A;  4WE1 A;  2FSN A;  2O8F A;  4RTF D;  5EX5 A;  1VSI A;  1F21 A;  3VMF B;  5HRO A;  4WCE L;  1RTD A;  4EZ6 A;  3THW A;  3T1A A;  4OGE A;  3K9K A;  2YX6 A;  4A5B A;  2P9I B;  4DUY K;  3L8B A;  3SPZ A;  3BY5 A;  1BG3 A;  4BWJ A;  2YJE A;  1KAZ A;  1S3X A;  2NRH A;  4E7K A;  4BDZ A;  1ATS A;  4DV1 K;  4N76 A;  1OH8 A;  1JJ2 M;  3QLH A;  2Q0R A;  3C6U A;  4JI2 K;  4B1W B;  4CJL A;  2JLE A;  1XNR K;  3ATU A;  1BA0 A;  2OPP A;  5LY3 A;  1T03 A;  1VQ5 N;  5E26 A;  4KH6 A;  2NUB A;  3OA9 A;  4BRM A;  1TKX A;  4M3Z A;  3CF5 L;  1WB9 A;  4X66 K;  3M5R A;  1GLD G;  1RDC A;  4O8K A;  3O8M A;  1YVN A;  3O4W A;  3V1R A;  2E2O A;  1Y64 A;  3P4I A;  4Z4I A;  4BR0 A;  4CHO A;  4A5A A;  1L3S A;  1RT6 A;  3TAG A;  1QE1 A;  4WQ4 C;  5GIO A;  3VET A;  4CJQ A;  2XRI A;  1U49 A;  3BF3 A;  3LDQ A;  5J2P A;  4G1Q A;  1S1X A;  2QWP A;  3AGR A;  3K0S A;  3I55 N;  4O0J A;  4BRA A;  4CGI A;  3KK7 A;  3H45 C;  1S1W A;  3W3D A;  1MWM A;  3J7Z O;  3NAE A;  4PL8 A;  4I2Q A;  4FWR A;  4BG8 A;  3K59 A;  3L6Q A;  3LZI A;  2OPR A;  2HBK A;  2NLX A;  4DCH A;  3CI5 A;  3TU5 A;  1DTT A;  5AFU A;  3P31 A;  4DV3 K;  3OVN A;  4DSJ A;  1C0G A;  4IG0 A;  3TWH A;  3GG4 A;  3HP9 A;  3NFA A;  4BDY A;  3ATV A;  3OJS A;  1VQM N;  4C1N K;  5CE3 A;  4FM1 A;  2YNI A;  3SK3 A;  2E8A A;  4M3R A;  4H0T B;  2QXF A;  1SKS A;  3CC7 N;  4H5V A;  2BE2 A;  4CJK A;  3HVR A;  4CF0 A;  3KK2 A;  2F8T A;  4NLB A;  3QO9 A;  4LSL A;  3AA3 A;  3A5M C;  2W42 A;  3D2F B;  2V7Z A;  3VQB A;  1KLM A;  5KGX A;  1DT9 A;  4JLH A;  2FXU A;  3HOT A;  2Y1I A;  3VQ4 A;  4O44 A;  3O9R A;  1HJR A;  2HF4 A;  4JAX A;  4NO7 A;  2O8E A;  4CI6 A;  4CJ4 A;  4HUG A;  4E7I A;  2HND A;  4E7L A;  1BQM A;  2IDO A;  1BOT O;  1TK8 A;  3AA2 A;  4CJU A;  3DM2 A;  1GLA G;  1TAQ A;  2HVI A;  4CHZ A;  1ASU A;  3LDL A;  1A5W A;  4BRO A;  2GWJ A;  1HKG A;  3HK2 A;  3K5L A;  5M1K A;  2ETJ A;  4DSI A;  4BGB A;  1UOC A;  4KHY A;  1NGD A;  2HHX A;  3GBT A;  3LPU A;  4JI1 K;  1IBK K;  3MWT A;  4LF9 K;  1B9F A;  3IMX A;  4C8M A;  4DS5 A;  3SJH A;  3ZX3 A;  2DPN A;  4LFB K;  4BR9 A;  4U67 L;  3BF1 A;  2VG7 A;  5AZI A;  4J2E A;  5C24 A;  4I6M B;  4AHV A;  4CD1 A;  3H46 O;  2P5G A;  1S9G A;  4BC5 A;  2QA4 N;  5JLF A;  1XHX A;  4GVE A;  3TAB A;  1KSP A;  1HX1 A;  4F2R A;  4KFB A;  2R7Y A;  1HNI A;  4N41 A;  3PV8 A;  4YNQ A;  1C1A A;  1ZBH A;  5CY4 A;  4CCH A;  4FM0 A;  4YFU A;  3UKR A;  4CJT A;  4IXC A;  3O3G A;  4FSV A;  3VEV A;  4CJR A;  1T6D A;  2ZF5 O;  2UXD K;  1TUU A;  2WON A;  5FRO A;  3FR0 A;  3O3H A;  2UYT A;  3GDQ A;  4FJI A;  3HM8 A;  3QB0 A;  4DV2 K;  1N5Y A;  5ADX A;  3AVJ A;  3O9U A;  3TAQ A;  4DFP A;  2D0O A;  1U04 A;  1LCU A;  2FSJ A;  2ASP A;  2W40 A;  3IUC A;  4DSL A;  1SAZ A;  4DS4 A;  1BI4 B;  3KHY A;  1LWF A;  2YV0 X;  4IZ9 A;  3PUF A;  1LWE A;  4JS4 A;  3UKU A;  4DQI A;  4DF4 A;  3E66 A;  5C10 A;  4FLV A;  4CJ3 A;  4NYN A;  2P9U B;  4BRD A;  4CZL A;  4IEI A;  3MDQ A;  2Z1G A;  1NG9 A;  4M41 A;  1XHZ A;  1W9H A;  3FZK A;  1BGX T;  3R6M A;  4DTP A;  1RDB A;  5ELZ A;  3P39 A;  4OKJ A;  4JD2 B;  4NXM K;  3ZX0 A;  3ZSW A;  4LF8 K;  4IJN A;  4A57 A;  3IG1 A;  3ENH A;  5BN9 A;  4G9Z A;  2UUC K;  4Q5V A;  4F9O A;  1U48 A;  2QKK A;  2BTF A;  2LSN A;  1NNE A;  1L5U A;  3R8E A;  3TAP A;  5KQ8 A;  5HP1 A;  1NJX A;  4YOW A;  4KHP K;  1C0M A;  3M6G A;  2FBX A;  1HRH A;  4CED A;  1TKZ A;  4BQZ A;  4MDB A;  1RDW X;  3SPY A;  4Q0B A;  4MO4 A;  1I39 A;  5LL6 Z;  1YJN N;  4FO0 A;  2PY5 A;  3THW B;  2QWQ A;  2F9T A;  3H08 A;  1FKO A;  4BQL A;  3V9Z A;  3B6P A;  4BC3 A;  3BGR A;  2G8W A;  4F3T A;  3IDH A;  5FPE A;  2DY4 A;  1EET A;  2I7N A;  2WOM A;  4CK2 A;  4EP5 A;  3ID6 A;  4JI0 K;  4WYB A;  2WFB A;  2O8C A;  3OJU A;  4FK4 A;  4O0I A;  4DLE A;  4NCG A;  3SJJ A;  3QNN A;  5KI6 A;  1O1W A;  3O5B A;  1W7A A;  3NF6 A;  4OX9 K;  3ZSV A;  1TVR A;  2QW9 A;  1DEJ A;  3A5L C;  2QK9 A;  2YI1 A;  3QES A;  3GOI A;  3ULD A;  1YHQ N;  4DR1 K;  2G8F A;  3PX4 A;  1VQK N;  3C94 A;  3VEW A;  5HOO A;  3OYK A;  1J54 A;  4OPK A;  5D3G A;  2HST A;  5JMV A;  4H5N A;  3VEZ A;  4BAC A;  4CIE A;  4WQ4 A;  3A8Y A;  3EZW A;  3OYD A;  3WXJ A;  4RW7 A;  3KWI A;  1ZBF A;  2PFU A;  1ZC6 A;  4WF9 L;  5CZ1 A;  3SNN A;  1XWL A;  3CG7 A;  4DHY A;  5FPM A;  5AQI A;  3EO3 A;  2AJQ A;  3FZF A;  1RDU A;  2EHG A;  3FE1 A;  3VEO A;  4KTQ A;  1GOA A;  4C8N A;  3FZL A;  4OGC A;  2HNY A;  3AVN A;  1Q9X A;  4KHW A;  2DTU A;  1KLN A;  4ZTJ A;  3L4Q A;  4YOY A;  3O3F A;  4BC2 A;  3HP6 A;  3O6W A;  1NK0 A;  1S1U A;  4IWV A;  1TK5 A;  5EY4 A;  4DKW A;  3AV9 A;  4KO0 A;  2QWL A;  2RPI A;  2E4L A;  1ZBI A;  3OYB A;  3BZK A;  3AA4 A;  4YY3 K;  1HYZ A;  3QBX A;  1NKE A;  4HVJ A;  4V19 S;  3D2F A;  4EFH A;  1RT1 A;  5BN8 A;  3V1Q A;  2IVP A;  3CCR N;  5J2Q A;  1HQE A;  3L3V A;  3D45 A;  1NOZ A;  3CHW A;  3RR7 A;  2P1J A;  4DR5 K;  3S3M A;  4JHD B;  3EKU A;  4DQ8 A;  3EYZ A;  2IC3 A;  2ITM A;  2YNH A;  5EOY A;  2E20 A;  4DU4 A;  3FLC O;  1FK9 A;  3UB5 A;  1HMV A;  2HHV A;  2X74 A;  2O8E B;  3C95 A;  4B9U A;  3CFP A;  5CR4 A;  5C0Y A;  3SYZ A;  3SV4 A;  1XUP O;  2Q1N A;  5M1Q A;  4HUF A;  3NVK A;  4H5T A;  4XH1 A;  1X9J A;  3LP1 A;  2XO7 A;  3HXM A;  3F73 A;  1NJW A;  4KTW A;  5AJ3 K;  4AHU A;  4DTN A;  4HTL A;  2QWM A;  4CBW A;  2HBL A;  3EN9 A;  3NGI A;  3J7Y P;  1XNQ K;  1JLE A;  2X78 A;  4FL9 A;  3CFO A;  5AZI B;  4NLC A;  4H0X B;  1NGA A;  3QEP A;  1X9S A;  3C0B A;  1NK5 A;  3M8S A;  3RTV A;  2D0P A;  3JAM O;  3T3F A;  3K5O A;  2VQE K;  3ZSQ A;  1RIL A;  3VQ8 A;  4XIU A;  1IKW A;  3F9K A;  1WSE A;  4BRI A;  1J53 A;  1GOC A;  5KQD A;  4CEO A;  2A41 A;  3OS0 A;  2ATQ A;  5CYQ A;  1NGJ A;  2XHB A;  3SV3 A;  1HLU A;  4GY2 B;  2P9N B;  3NH2 A;  5DM7 L;  1QQO A;  1TYQ A;  2F96 A;  3UKR B;  3AO1 A;  3ZEU A;  2B5J A;  2D1K A;  4B9N A;  3ZT1 A;  1NGF A;  1WSF A;  5KGW A;  3EKS A;  3ZT3 A;  1ITG A;  1TUY A;  4Z4E A;  4J2A A;  1E3M A;  2WTU A;  4HCC A;  2O8B A;  3OBW A;  3SUP A;  4BRP A;  3THV A;  1CZB A;  3T1H K;  1NMD A;  4H5W A;  5K14 A;  4JI6 K;  4ILH A;  1L3U A;  4DTM A;  1VSE A;  3QET A;  1SV5 A;  3M3Z A;  3OTO K;  3AAP A;  2YJF A;  5IWA K;  3LWM A;  1A5V A;  3LAM A;  3MXI A;  3DLK A;  3HVT A;  1Q8I A;  5HRS A;  4B3R K;  5GIN A;  3D6R A;  3ZT2 A;  3WQU A;  1D4X A;  2CH5 A;  4FJL A;  3UKU B;  2E88 A;  4E7H A;  4Z0U A;  3FZM A;  1D5A A;  2HHQ A;  1RBS A;  3K5N A;  3ZYY X;  4CJP A;  2OZM A;  5KTQ A;  1WUA A;  2Z1H A;  1QQN A;  2P9U A;  3KK1 A;  3DLL L;  1LAW A;  3CIP A;  4FLY A;  4M3X A;  5GAG P;  1X3N A;  2QTD A;  3VEX A;  4ZTF A;  4K8Z A;  3DAW A;  3WEE A;  4BGA A;  3SQ4 A;  4Z4G A;  5GAD P;  2GV9 A;  4KHU A;  4MDA A;  3LDP A;  2D0B A;  4BRL A;  3RMC A;  1YIT N;  5HRP A;  4JD2 A;  4CE9 A;  4DFJ A;  3IAY A;  4BG9 A;  4CVN E;  4FJK A;  5I42 A;  1Q7Y O;  3MN7 A;  2JWK A;  1S5J A;  2FBY A;  5E84 A;  4X62 K;  3ZSZ A;  4FLX A;  3MED A;  3K5M A;  3SCX A;  4M3W A;  1MA9 B;  1IJJ A;  4Y1C A;  1SQK A;  3QIC A;  1RDD A;  3U3Y A;  5AQP A;  1RBT A;  1DLO A;  3WNH A;  1YF5 L;  5EU7 A;  3LAL A;  1WBD A;  3CCJ N;  3O80 A;  2WBN A;  4K43 A;  4JKG B;  3VQC A;  3SAH A;  4H0Y B;  3RMD A;  4E1N A;  1NK4 A;  3BP8 A;  4B08 A;  1FW6 A;  1Q86 O;  2HHH K;  1RNH A;  4BR4 A;  3F2K A;  3LDS A;  2YNG A;  3EE8 A;  4OPH A;  1ATR A;  2B6A A;  3CJ9 A;  5C25 A;  4MO5 A;  1SL2 A;  1OKJ A;  2BH1 A;  1VRT A;  3KLE A;  2O8C B;  4DV5 K;  4QCL A;  5M1P A;  4PUO A;  1QS4 A;  3BEX A;  4BE2 A;  2W6L A;  1D9D A;  2BDP A;  3ZX2 A;  4PWD A;  4PL7 A;  1RT5 A;  1DKG D;  1SL1 A;  2KFN A;  4GKJ K;  1G15 A;  5AQG A;  4CFB A;  3HTV A;  5CYM A;  3E01 A;  4AM7 A;  4U7B A;  1GLF O;  2HB5 A;  4FWK A;  4KV8 A;  3HPO A;  1NKC A;  4CZJ A;  4KRF A;  3PX6 A;  4Y1D A;  3VQ7 A;  1ASV A;  4FJH A;  2Z1I A;  1TK0 A;  3MN9 A;  2EWS A;  4KI6 A;  3E9P A;  3VQA A;  3T69 A;  2F7T A;  2W41 A;  4BWM A;  1N8R O;  1BQN A;  3SUN A;  3RMB A;  4AHS A;  2OAN A;  2OTJ N;  3P38 A;  1VK0 A;  5HL7 L;  4FJ9 A;  1S1T A;  3ENO A;  1RT3 A;  3ZSY A;  3WNF A;  1R0A A;  3DMJ A;  5AQT A;  1T6C A;  3GE1 A;  4CHN A;  1KTQ A;  3HZ6 A;  4BR7 A;  3VF4 A;  3WT0 A;  3QDK A;  4CW7 B;  2JGU A;  3QEX A;  3MX2 A;  3KLF A;  4FM2 A;  1RTI A;  4CEQ A;  3LAN A;  4ID5 A;  1LOT B;  3ZSR A;  4KB1 A;  4XH4 A;  4LD0 A;  1YIJ N;  3SUQ A;  1EKE A;  1JXE A;  4I9L A;  3QNO A;  4MQ3 A;  4FVU A;  2I7P A;  4DTS A;  4HHT A;  1HNW K;  3LDO A;  3HT3 A;  1RTJ A;  2YNF A;  3Q7B A;  1JLQ A;  3V6D A;  2RKI A;  4ISE A;  2Q3S A;  4FLW A;  2UXC K;  1B92 A;  4OPJ A;  4NXN K;  3QEV A;  2H3G X;  3F9M A;  4JHD A;  4GV9 A;  2A1S A;  1N6Q A;  4JN4 A;  2GBZ A;  4DTX A;  1X3M A;  4CZF A;  4DLG A;  2VG5 A;  4YOT A;  4ICL A;  1OH7 A;  4QS7 A;  3DLB A;  2RE2 A;  3L0Q A;  3MMV A;  4YOV A;  4UY8 O;  4FLT A;  3KKR A;  1UA0 A;  1VQ4 N;  3L3U A;  3PSI A;  4GW6 A;  3CFR A;  4DTR A;  2UUA K;  1KAY A;  2O8D A;  3R1X A;  3OYJ A;  4AQY K;  4DSF A;  3HST B;  1QTM A;  1SS6 A;  3CET A;  4FWO A;  1NK9 A;  4RW4 A;  5FPD A;  3VPZ A;  1S22 A;  2FBT A;  2W6K A;  5BPL A;  1XMQ K;  3VF6 A;  2G8H A;  3AO4 A;  3MCA B;  1ZBU A;  2YHW A;  3H6E A;  2G8K A;  4PKI A;  4HUE A;  3M8Q A;  3EE9 A;  1JXB A;  3CQY A;  4DUZ K;  3L4I A;  3MEC A;  2P9P B;  3AVA A;  4KB0 A;  3CM6 A;  4JYA K;  4FW1 A;  4DF8 A;  3AVI A;  1QZ6 A;  4FJX A;  2P9N A;  3PSF A;  1TYQ B;  3O9S A;  3A2F A;  4H5R A;  3ZEU B;  4O55 A;  3BUZ B;  3G25 A;  4B9Q A;  3NF8 A;  4IO8 A;  1K8A O;  4E0D A;  4CEZ A;  3ISN C;  4DMN A;  1VQ8 N;  2O8B B;  3G0Z A;  4FWM A;  4CJE A;  4B8C A;  4PKG A;  1K9M O;  1QVG M;  1I94 K;  1LWC A;  3HOS A;  1VQ6 N;  1DTQ A;  3KJV A;  2Z1J A;  3CC2 N;  3VA3 A;  4XEI A;  3U9D A;  4H8K A;  3V1O A;  3RRH A;  4FZY A;  1T05 A;  1BL3 A;  2Q97 A;  4IOA L;  3H1V X;  1KVB A;  4DTO A;  4AHT A;  3Q7C A;  4XH5 A;  4CGD A;  3AY9 A;  1Y97 A;  4C1N I;  4X64 K;  3H1Q A;  1V4T A;  5AQH A;  3VGM A;  3PIP L;  4CHP A;  3GL1 A;  3VN5 A;  5AQM A;  2P9K B;  5J1E A;  4M3Y A;  1N33 K;  3S41 A;  1Q9Y A;  3WEE B;  2OZS A;  4M7X A;  1KRP A;  2BGG A;  3P1G A;  3VOV A;  5M1F A;  3AO2 A;  3TTF A;  4W5Q A;  4B3O A;  4YDU C;  4DTJ A;  1BA1 A;  1Z25 A;  5LMN K;  4CZE A;  1HPM A;  4HWI A;  4A2A A;  1JKH A;  2KKZ A;  4FZX C;  5H1S Q;  3JS6 A;  3TSP A;  5AQS A;  3WXI A;  4LFC K;  4FOI A;  4QOZ B;  3PX0 A;  4K41 A;  4CF1 A;  1HYV A;  2HF3 A;  5C42 A;  4PQU A;  1JL2 A;  1WSJ A;  2V51 B;  3U3G A;  4JKG A;  3DYA A;  3PO5 A;  2WUS A;  4IDK A;  3KKS A;  3AVL A;  4BRE A;  3CCV N;  3MXJ A;  1CZ9 A;  4BR5 A;  4CZK A;  2KQ2 A;  4YOX A;  4CER A;  3PO4 A;  1HKB A;  5AQY A;  3TR8 A;  3MN5 A;  1QQM A;  3THY B;  2QWR A;  2F4V K;  3FFK B;  3CCU N;  2KHO A;  4R5P A;  1BCM A;  2Y1J A;  3J7A P;  1NGH A;  4JKE A;  1TV6 A;  1C0T A;  4DQP A;  5TKW A;  4CBU A;  5KPT A;  2OA8 A;  4FZZ A;  3AAQ A;  2KFZ A;  2GEL A;  4KKO A;  3RR8 A;  1ZYQ A;  1XC9 A;  3O1B A;  5AZJ A;  2IIR A;  4GKK K;  1BCO A;  2BAN A;  1KFD A;  2E1Z A;  4ELT A;  3VQ9 A;  4JKC A;  4ID1 A;  3ZT4 A;  5J2N A;  1S6P A;  3OYE A;  1IBM K;  4JI4 K;  3WXL A;  1Z26 A;  4BVP A;  5CHI A;  2CGK A;  1NWK A;  4LF7 K;  2NNW A;  1QSL A;  3KD1 E;  2ZQB A;  4FWP A;  2Q36 A;  3I56 N;  1J6Z A;  1RT4 A;  1YT3 A;  4KTZ A;  1EWQ A;  3U9Z A;  3D2E A;  3IRX A;  4GV6 A;  1X9M A;  3U6F A;  3IKM A;  3LP0 A;  5BPM A;  2P51 A;  2YKM A;  4CF8 A;  2ITG A;  5BPN A;  3TSQ A;  1WN7 A;  1S72 N;  1U6Z A;  1H1V A;  4B9L A;  4K0K K;  2YHB A;  3ITH A;  1NMN A;  1QHA A;  2YHX A;  1HYS A;  4UQG A;  4H0P A;  3BDP A;  4FWS A;  1WAJ A;  3NF7 A;  3I0R A;  3LM9 A;  3VGK A;  1I3A A;  5BR8 K;  1VQ7 N;  5E41 A;  2HHT A;  3HO1 A;  2GWK A;  2D4W A;  3LWL A;  3OYM A;  4KI4 A;  1C1B A;  4BVO A;  3L2Q A;  3CM5 A;  1VSH A;  4FK0 A;  3VTH A;  2ZGZ A;  4FJ7 A;  3SUO A;  2HBJ A;  3TAE A;  4OLB A;  4B9T A;  1T3V A;  1YXQ A;  3AO5 A;  3QEI A;  4JS5 A;  4BE0 A;  3CD6 N;  2EX3 A;  3LL3 A;  4ZHR A;  1U4B A;  4FW2 A;  3CPW M;  4FWN A;  2OTL N;  3QIP A;  1BIS A;  4RW6 A;  4EHT A;  3SBT A;  3S3N A;  1QSY A;  3SQ0 A;  5C2F A;  1BIZ A;  1HUX A;  4BRQ A;  3BZC A;  3JYT A;  2P5O A;  2XY5 A;  1VQN N;  3VQP A;  2PYL A;  2P9L A;  1NM1 A;  1T7P A;  4B9V A;  5SZT A;  1W2B M;  2O8D B;  4JK9 A;  3HM9 A;  1XC3 A;  2J4R A;  1HJO A;  2D0C A;  3QIO A;  1BUP A;  1IO2 A;  3CJC A;  2E5L K;  1HNV A;  4M3T A;  2PYJ A;  1YJ9 N;  5M1N A;  4E1M A;  3TSU A;  4GNI A;  2PZS A;  5AQO A;  1BHL A;  1ZBL A;  3ALY A;  4AHC A;  3EEQ A;  4H4O A;  3MN6 A;  4B1V A;  3T1Y K;  4FJG A;  1IG8 A;  1JCG A;  2P9P A;  4DSK A;  3EL2 A;  4A61 A;  3THX B;  2VWK A;  1VSJ A;  3A5N C;  1CLQ A;  3JSM A;  4DV7 K;  1A5X A;  1QZ5 A;  3MEE A;  1S6Q A;  3AO3 A;  4H4M A;  3LM2 A;  4M42 A;  1U45 A;  1WAF A;  2PAV A;  4A2B A;  1JLG A;  2DFH A;  1K8K A;  2E2N A;  3KD5 E;  3G6E N;  4PA1 A;  2P9S B;  3O4N A;  3J8A A;  3DLE A;  4LH4 A;  4IBN A;  3O4Q A;  2ZE2 A;  4JK7 A;  2UUB K;  1JLC A;  3RRG A;  4CFD A;  3SMP A;  4B1X B;  1YI2 N;  1O13 A;  2OCE A;  1NK8 A;  4CGJ A;  5JS1 A;  4IFY A;  1NK6 A;  4ILG B;  5EVZ A;  3U4L A;  3KWG A;  4FJM A;  2RN2 A;  3AVM A;  4JRQ A;  1UA1 A;  1REV A;  3M8R A;  1SZ2 A;  4RG8 A;  4CZG A;  3HYF A;  4DB3 A;  3HSC A;  4MLH A;  4CK1 A;  2NRZ A;  3HL8 A;  3K2P A;  4DG1 A;  1ASW A;  3NE6 A;  4N47 A;  3LZJ A;  1RBU A;  4CES A;  4CJS A;  2X6S A;  5HRR A;  1Q81 O;  4DWI A;  2P9K A;  4OVL A;  4BRH A;  4LH5 A;  4FK2 A;  2ASM A;  4DQS A;  5LMU K;  4ISG A;  1RBV A;  1RCH A;  1NGE A;  1W97 L;  4CF2 A;  2YHY A;  5AQZ A;  1G99 A;  1VHX A;  1GLJ O;  4DQR A;  1IKX A;  4F2S A;  4FPB A;  2G8V A;  3OHR A;  4YDU A;  3NBP A;  1KCF A;  5J2M A;  4FCY A;  2RF2 A;  4DFM A;  4DR4 K;  2QWN A;  1BWF O;  4BRF A;  1EO1 A;  4JI7 K;  3KVG A;  1J9A A;  2VCP A;  2VYP A;  1BDG A;  5JS2 A;  4CFA A;  3KZB A;  4JEP A;  2D0A A;  2NRX A;  1VQ9 N;  1IKY A;  1E4F T;  3DXK A;  5C15 A;  4IFV A;  3VES A;  3JXU A;  3ID8 A;  3K58 A;  2GTD A;  1YAG A;  4I7F A;  3RSE A;  4FJN A;  4NCA A;  3OBY A;  5KRT A;  3V9U A;  3CJ7 A;  3C7N A;  3THY A;  4DV0 K;  3AVC A;  1KVA A;  3L2U A;  3NF9 A;  4FYD A;  3VTI A;  1WSH A;  4BDP A;  1MDU B;  3VQD A;  3CPE A;  1HNX K;  1U47 A;  4FVM A;  5HBM A;  5B8H A;  2DFE A;  4DR3 K;  3CYM A;  2A42 A;  3HI0 A;  3O08 A;  4CIG A;  3MK6 A;  3UE5 A;  4K8X A;  4BE1 A;  4EP4 A;  4AIL C;  1K6Y A;  2HBM A;  1EXQ A;  4C8K A;  3OS2 A;  1QQC A;  5AZJ B;  1NJY A;  2FLO A;  2VWB A;  2HHS A;  3FFI A;  2V7Y A;  5A2Q O;  1BU6 O;  3LP3 A;  1P90 A;  4CHQ A;  1U2V B;  1E4G T;  2GUI A;  3HRG A;  4CZM A;  3V9S A;  5DMR A;  1MWK A;  4H03 B;  4DFK A;  3CJ1 A;  4F4K A;  3D2E B;  1CXQ A;  2BUP A;  4I9Q A;  2AP1 A;  3C6A A;  4MLE A;  3FZH A;  3H3O B;  3QBW A;  1JLF A;  5JLH A;  4E3S A;  1VRU A;  4BY9 C;  4M63 C;  3HBT A;  4YOU A;  2F9W A;  2YHA A;  3IFR A;  3VQE A;  4AH9 A;  4EAH D;  3TTD A;  1FJG K;  3CCL N;  1X9W A;  3DOK A;  1FXX A;  1Z05 A;  2ZWH A;  2VGM A;  4W5T A;  3RMA A;  3QML A;  4TSX A;  3K57 A;  1ILY A;  4WFA L;  4CGF A;  3L2V A;  4RW8 A;  1NGI A;  3QER A;  1OVQ A;  3AVK A;  3R3L A;  4B1Z A;  5M1O A;  3U8X A;  3AVF A;  4B3T K;  4F3O A;  4CEE A;  3E1Y A;  3CXC M;  1VSD A;  2OPQ A;  1GLL O;  4M3U A;  1EWR A;  1LAV A;  1EP4 A;  1KC8 O;  4B9S A;  3ZLJ A;  2ZJP L;  4H0O A;  1M90 O;  4O5B A;  4O4G A;  5FDL A;  1VAZ A;  3CC4 N;  4FJJ A;  1SUQ A;  4JI5 K;  3OYF A;  4QS9 A;  4CZI A;  4JKD A;  4OJR A;  4EIA A;  3NH0 A;  4CEA A;  1HR0 K;  5AQJ A;  1VQL N;  4KH4 A;  1T44 A;  1HQU A;  1K73 O;  1RBR A;  3UIQ A;  4CJV A;  3PIO L;  3MEG A;  4RWT A;  5DK5 A;  1ATN A;  1X1P A;  4DR7 K;  1N36 K;  5F1X A;  4DR6 K;  2P9L B;  3EZ5 A;  2IVN A;  3NDK A;  3KLI A;  4HCB A;  5SWM A;  2O4I A;  4PKH A;  3SQ2 A;  4NYF A;  4OKK A;  1KQS M;  4X65 K;  1J5O A;  3O9Q A;  5AQX A;  4CJF A;  3MAQ A;  3A0I X;  3C6H A;  3CCM N;  4JI8 K;  3AGK A;  2PBD A;  1T8E A;  3O1W A;  4IG3 A;  1XI1 A;  4FLZ A;  3L2R A;  2IOC A;  5F0X A;  2VQF K;  4BR2 A;  4WQ5 A;  2NRV A;  4FWL A;  2XY6 A;  3THX A;  2IAJ A;  3MWP A;  4CBX A;  5JVG L;  5AQW A;  2V52 B;  3ULE B;  3F5T A;  4IDH A;  5AQN A;  1NJI O;  2E2P A;  5LJV A;  3A5O C;  4ISF A;  1ESV A;  4PHT X;  3HJF A;  4IEE A;  3DRP A;  3T7Z A;  3KLH A;  2ZJQ L;  2HVH A;  4LSN A;  4FLU A;  4J2D A;  3AVG A;  4PY5 A;  1TL1 A;  4JKA A;  1XQS C;  3NCI A;  1K8K B;  2P9S A;  5BRF A;  4IOX A;  4QAG A;  1BO5 O;  5AFU H;  3DRR A;  5T7B A;  3DRS A;  1RFQ A;  1MU2 A;  2D5R A;  3WQT A;  3KK3 A;  2A1R A;  5FRM A;  4OPA A;  4O5F A;  3OYA A;  3EY1 A;  5BRE A;  3DXM B;  3TI0 A;  3ZET A;  3OYL A;  3R9P A;  4CF9 A;  4L8R B;  5AQV A;  2DFF A;  4K42 A;  1IG9 A;  5C2D A;  1GLC G;  1ZXO A;  4AM6 A;  2FSK A;  3DLR A;  1DGK N;  4FWQ A;  3N4Q A;  5FPN A;  4L3Q A;  3TAF A;  2QI2 A;  4Y0W A;  1C0F A;  3OS1 A;  1JL1 A;  4JNE A;  4EHU A;  4RW9 A;  4K25 A;  5TKY A;  1TKT A;  4LC9 B;  2Q31 A;  1ZBS A;  4M7Y A;  4A59 A;  3DLH A;  5AQK A;  2YKN A;  3OYI A;  1JCE A;  5KPR A;  2VG6 A;  3MX5 A;  1HKC A;  3TPQ A;  3OYN A;  4OO1 J;  3G4S N;  4LF4 K;  4FXD A;  4W5O A;  1KFS A;  5AQL A;  3SAG A;  3WUH A;  3DXK B;  3VQ5 A;  3NMU A;  1Q18 A;  2IS3 A;  2QXL A;  3O9T A;  2KTQ A;  5FLX O;  4DU3 A;  5AQQ A;  4LF6 K;  3D7E O;  5AR0 A;  4JI3 K;  3RSE B;  2OYQ A;  3E9L A;  3C7N B;  2NZT A;  1VQP N;  2XY7 A;  4LF5 K;  2HHU A;  1NK7 A;  2YCH A;  1HNZ K;  2RHK A;  4Z4C A;  4FJ5 A;  1GLE G;  3NGZ A;  3PLA A;  1KD1 O;  1EQY A;  2O8F B;  2IVO A;  3QEW A;  1YVU A;  4DU1 A;  1YUW A;  1QSS A;  4B3M K;  3I33 A;  1GLB G;  4CGG A;  3DLG A;  2HOE A;  4CK3 A;  1JLA A;  1OH5 A;  4HTU A;  2QEX N;  1WSG A;  2P9I A;  3S9H A;  4CD3 A;  3I8B A;  2FF6 A;  3P83 D;  1N32 K;  3SI6 A;  4CEF A;  4YOR A;  4W5R A;  3CQ8 A;  1TL3 A;  4ELU A;  4BRG A;  5LJW A;  3L2W A;  2HMP A;  4CJ5 A;  4BRK A;  1U2V A;  4YHH K;  4CHY A;  3J80 O;  2QKB A;  5GAE P;  4C8L A;  2ASO A;  3TAR A;  3HPG A;  1R59 O;  1NGG A;  2FBV A;  2CGJ A;  4EZ9 A;  1IKV A;  1LW2 A;  3V4I A;  5KPZ A;  3G71 N;  4WFB L;  1J5E K;  3AA5 X;  3K9J A;  1C1C A;  3VEY A;  4E89 A;  3QIN A;  1NGC A;  5ADX H;  2CGL A;  3CJA A;  5HRN A;  2G8U A;  3DOL A;  2A6A A;  4GV3 A;  4IKF A;  1VSK A;  1UWB A;  4QS8 A;  1NOY A;  1EX4 A;  2X6N A;  4DTU A;  1BIU A;  2OPS A;  1SKW A;  4DV6 K;  4F8R A;  4E1J A;  1IH7 A;  4Z94 A;  2UXB K;  1VQO N;  3WNE A;  4JRP A;  4CEB A;  4GVM A;  1VSL A;  4KRE A;  4O8U A;  2QM1 A;  5JVH L;  3G10 A;  1VSM A;  4N56 A;  4B3S K;  4B9M A;  3CCQ N;  3MXM A;  4CJW A;  1QHT A;  3CCS N;  4I2P A;  3CER A;  5BRH A;  5GAH P;  1YJW N;  4CZH A;  4H0V B;  4R79 A;  5GIP A;  2HMI A;  2JWL A;  4KAZ A;  4J2B A;  2E6M A;  3VEN A;  3J81 O;  1JLB A;  2QWO A;  4NB4 A;  3T19 A;  1RDA A;  3DI6 A;  1OVY A;  3I0S A;  5FRN A;  3KLG A;  3ZCM A;  3I8D A;  3VA0 A;  2HW3 A;  1W0H A;  1WNS A;  3LPT A;  4JV5 K;  4ELV A;  2ZJR L;  1XMO K;  1Z6R A;  1CXU A;  3QFP A;  1KAX A;  3E9O A;  2GUP A;  3VQ6 A;  2ZGY A;  1GOB A;  4Z4H A;  1JCF A;  4KBO A;  3V81 A;  1Q82 O;  1NGB A;  4C8O A;  2KW4 A;  3NHG A;  1L3V A;  2ZD1 A;  2AA4 A;  4IOC L;  4ILJ A;  3CMA N;  3TAN A;  1V4S A;  5BR9 A;  2FF3 B;  1CZA N;  2XY8 A;  3KTQ A;  2NRW A;  1FKP A;  2Q2R A;  3NVM A;  1S1V A;  3CJB A;  4KHQ A;  2G8I A;  3IS9 A;  1TKD A;  3LDN A;  2O4G A;  3SQ1 A;  4IJA A;  3DWL A;  4WFN L;  2VWJ A;  3H3N O;  3VER A;  2HHW A;  2E2Q A;  3D0P A;  5AQF A;  1LV5 A;  4DQQ A;  4DR2 K;  3ASM A;  3AVH A;  2ZM6 K;  4W5N A;  3SZ2 A;  3MCP A;  3N4P A;  4CIF A;  4CGH A;  4LFA K;  2HNZ A;  1NBW A;  4E19 A;  3SAF A;  3OY9 A;  4OLA A;  1WOQ A;  4FJ8 A;  3ZSO A;  4WQ5 C;  3VF2 A;  3B6O A;  1NJZ A;  4KH5 A;  4I6M A;  3ULE A;  2KZM A;  5I3U A;  4MFB A;  3CME N;  1TAU A;  3TAM A;  5C12 A;  1WSI A;  4OKE A;  3CQX A;  5MLC Q;  3LAK A;  5CZ2 A;  3VGL A;  3NGY A;  2IGI A;  3AVB A;  5I9E B;  1N34 K;  1NLV A;  5F2R A;  1D9F A;  4B8A B;  1SKR A;  3VQQ A;  5HLF A;  2UU9 K;  2WC9 A;  1C6V A;  2KLA A;  4KHS A;  3RWU A;  3OYH A;  1M1K O;  2B4J A;  5DM6 L;  3S3O A;  4LY7 A;  4RCH A;  2E6L A;  4NCB A;  3NH1 A;  3HPH A;  3M8P A;  3V9X A;  3PY8 A;  3DXM A;  3WXM B;  2F8S A;  3WXK A;  1IBL K;  4KPY A;  1B9D A;  2I5J A;  3ZET B;  3QFU A;  1WLJ A;  4BC4 A;  4DV4 K;  4M45 A;  4GMJ B;  4Z4F A;  2NRR A;  1YTU A;  4A62 A;  5IT9 O;  5AQU A;  3C6T A;  1VSF A;  1SL0 A;  3C65 A;  3OYG A;  1NKB A;  1KXP A;  4JK8 A;  4BRN A;  2A40 A;  1BI4 A;  4J8F A;  4AHR A;  2NRT A;  3WNG A;  3LP2 A;  5KRS A;  3CCE N;  3B8A X;  4FOE A;  1RT2 A;  4CJ7 A;  4DSE A;  2A3Z A;  2FC0 A;  4AF1 A;  2CH6 A;  3FGU A;  4JKH A;  4B1U B;  1C0U A;  1NU0 A;  4JKF A;  3AAR A;  4C23 A;  2GEM A;  2A5X A;  3OW2 M;  1LW0 A; 
#chains in the Genus database with same CATH homology
 3VN5 A;  2E4L A;  5J1E A;  4M3U A;  4M3Y A;  1ZBI A;  3OYB A;  1LAV A;  3ZT0 A;  1Q9Y A;  1EP4 A;  1RTH A;  3P5J A;  4B9S A;  3AA4 A;  2OZS A;  1HYZ A;  3V9W A;  3KIO A;  1NKE A;  4HVJ A;  3ZSX A;  1YTA A;  1RT1 A;  1KRP A;  4O5B A;  3V1Q A;  4O4G A;  2BGG A;  5FDL A;  3OYC A;  3P1G A;  5J2Q A;  1L3T A;  4FJJ A;  1SUQ A;  3AO2 A;  1HQE A;  3L3V A;  4W5Q A;  3OYF A;  4B3O A;  4OJR A;  3NH0 A;  3D45 A;  4N5S A;  1NOZ A;  4CEA A;  4DTJ A;  4CEC A;  3RR7 A;  1Z25 A;  4CFC A;  2P1J A;  1JKH A;  4FZX C;  3S3M A;  3EYZ A;  2KZZ A;  2IC3 A;  1HQU A;  2YNH A;  1RBR A;  4DU4 A;  1KVC A;  1FK9 A;  3UIQ A;  4CJV A;  1HMV A;  3MEG A;  3PX0 A;  2X74 A;  4QOZ B;  2HHV A;  3C95 A;  5DK5 A;  4CF1 A;  1HYV A;  4B9U A;  1X1P A;  3CFP A;  5C42 A;  1TGO A;  1D8Y A;  3SYZ A;  1JL2 A;  4PQU A;  3SV4 A;  3EZ5 A;  1WSJ A;  3NDK A;  4E7J A;  3U3G A;  1S9E A;  3KLI A;  3DYA A;  3PO5 A;  4IDK A;  3KKS A;  4HUF A;  3AVL A;  1UAX A;  1RT7 A;  4HCB A;  3MXJ A;  1HPZ A;  3LP1 A;  5SWM A;  2XO7 A;  1CZ9 A;  3HXM A;  3F73 A;  2KQ2 A;  1NJW A;  4KTW A;  4KHN A;  2O4I A;  4WE1 A;  3SQ2 A;  4CER A;  4NYF A;  3PO4 A;  4OKK A;  4AHU A;  3TR8 A;  1VSI A;  1J5O A;  1F21 A;  4CJF A;  3MAQ A;  5HRO A;  1RTD A;  4EZ6 A;  4DTN A;  4FJM A;  3NGI A;  3T1A A;  4R5P A;  1BCM A;  4OGE A;  1T8E A;  2Y1J A;  3L8B A;  4IG3 A;  1TV6 A;  4BWJ A;  3SPZ A;  1XI1 A;  4FLZ A;  1C0T A;  4DQP A;  3L2R A;  1JLE A;  4E7K A;  2X78 A;  4BDZ A;  2OA8 A;  4N76 A;  2IOC A;  3CFO A;  4FZZ A;  2KFZ A;  3QLH A;  4KKO A;  3C6U A;  4CJL A;  3QEP A;  3RR8 A;  1ZYQ A;  1X9S A;  1XC9 A;  2JLE A;  1NK5 A;  3M8S A;  3RTV A;  1HYS A;  3T3F A;  1BCO A;  2BAN A;  3K5O A;  1KFD A;  2XY6 A;  2IAJ A;  4ELT A;  3VQ9 A;  4ID1 A;  2OPP A;  3ZSQ A;  3ZT4 A;  1RIL A;  3VQ8 A;  5J2N A;  1T03 A;  1S6P A;  4XIU A;  1IKW A;  3F9K A;  1WSE A;  3OYE A;  1GOC A;  1J53 A;  4CEO A;  2NUB A;  3OS0 A;  3HJF A;  1Z26 A;  2ATQ A;  3DRP A;  1TKX A;  5CYQ A;  3KLH A;  4M3Z A;  2XHB A;  2HVH A;  1QSL A;  3KD1 E;  3SV3 A;  4LSN A;  4FLU A;  2ZQB A;  3NH2 A;  1RDC A;  4J2D A;  3AVG A;  2F96 A;  1RT4 A;  1YT3 A;  1TL1 A;  4KTZ A;  4PY5 A;  3AO1 A;  3V1R A;  3NCI A;  2B5J A;  4Z4I A;  3IRX A;  4B9N A;  3ZT1 A;  4QAG A;  1WSF A;  5KGW A;  1X9M A;  3ZT3 A;  3U6F A;  4CHO A;  3DRR A;  5T7B A;  1L3S A;  3DRS A;  1ITG A;  1RT6 A;  3TAG A;  3LP0 A;  1MU2 A;  1QE1 A;  2D5R A;  3KK3 A;  4J2A A;  1U49 A;  2A1R A;  4Z4E A;  4CJQ A;  2XRI A;  5FRM A;  2P51 A;  2YKM A;  4CF8 A;  2ITG A;  4HCC A;  5J2P A;  4G1Q A;  1S1X A;  3SUP A;  3OYA A;  3EY1 A;  4O0J A;  3THV A;  1WN7 A;  4CGI A;  3TI0 A;  1CZB A;  1S1W A;  4B9L A;  5K14 A;  3OYL A;  4B9M A;  2YHB A;  3ITH A;  4CF9 A;  3NAE A;  4I2Q A;  4L8R B;  4UQG A;  4DTM A;  1VSE A;  3QET A;  1SV5 A;  2DFF A;  3K59 A;  1L3U A;  3BDP A;  3LZI A;  3LWM A;  1WAJ A;  3NF7 A;  1A5V A;  2OPR A;  3I0R A;  3LAM A;  3MXI A;  1IG9 A;  3DLK A;  3HVT A;  1Q8I A;  5HRS A;  1DTT A;  1I3A A;  3DLR A;  2HHT A;  5E41 A;  3HO1 A;  3ZT2 A;  5JS1 A;  3LWL A;  3OYM A;  4F2R A;  4KI4 A;  4FJL A;  1C1B A;  3OVN A;  3TAF A;  3L2Q A;  4DSJ A;  3TWH A;  4IG0 A;  4Z0U A;  4E7H A;  3CM5 A;  1VSH A;  3HP9 A;  4FK0 A;  1D5A A;  2HHQ A;  3NFA A;  4BDY A;  3OJS A;  3OS1 A;  1JL1 A;  1RBS A;  4RW9 A;  4FJ7 A;  3K5N A;  3SUO A;  4CJP A;  2OZM A;  5KTQ A;  4FM1 A;  2YNI A;  2Z1H A;  1TKT A;  4M3R A;  3KK1 A;  1LAW A;  2QXF A;  4FLY A;  3TAE A;  1SKS A;  4OLB A;  4M3X A;  4B9T A;  3DLH A;  2BE2 A;  3AO5 A;  3QEI A;  4ZTF A;  2YKN A;  4K8Z A;  4CJK A;  3SQ4 A;  3OYI A;  4JS5 A;  4Z4G A;  2GV9 A;  3HVR A;  4BE0 A;  4CF0 A;  4KHU A;  3KK2 A;  2F8T A;  2EX3 A;  4ZHR A;  1U4B A;  3QO9 A;  4LSL A;  3AA3 A;  2D0B A;  2W42 A;  3RMC A;  5HRP A;  3VQB A;  2VG6 A;  4FW2 A;  4CE9 A;  1KLM A;  4DFJ A;  3IAY A;  5KGX A;  4FJK A;  4JLH A;  5I42 A;  3QIP A;  1S5J A;  2FBY A;  3OYN A;  1BIS A;  3ZSZ A;  4RW6 A;  2Y1I A;  4FLX A;  3VQ4 A;  3MED A;  3K5M A;  4O44 A;  3SCX A;  4W5O A;  3S3N A;  1QSY A;  1KFS A;  4M3W A;  1HJR A;  4Y1C A;  3SQ0 A;  1BIZ A;  3VQ5 A;  2IS3 A;  2KTQ A;  1RDD A;  3U3Y A;  4DU3 A;  4CJ4 A;  3JYT A;  1RBT A;  2XY5 A;  1DLO A;  4HUG A;  3WNH A;  4E7I A;  2P5O A;  2HND A;  4E7L A;  1BQM A;  2IDO A;  3VQP A;  1TK8 A;  3AA2 A;  2PYL A;  4CJU A;  2OYQ A;  1T7P A;  5EU7 A;  3LAL A;  5SZT A;  3DM2 A;  4B9V A;  1TAQ A;  4CHP A;  2HVI A;  2XY7 A;  2HHU A;  4CHZ A;  3HM9 A;  3VQC A;  1NK7 A;  1ASU A;  1A5W A;  3RMD A;  4E1N A;  1NK4 A;  4B08 A;  3HK2 A;  3K5L A;  4Z4C A;  4FJ5 A;  1RNH A;  3NGZ A;  2D0C A;  3QIO A;  2ETJ A;  4DSI A;  1UOC A;  3QEW A;  4KHY A;  3LDS A;  2YNG A;  1IO2 A;  1YVU A;  4DU1 A;  2HHX A;  1QSS A;  3LPU A;  4CGG A;  3DLG A;  1B9F A;  2B6A A;  4CK3 A;  5C25 A;  1HNV A;  1JLA A;  4M3T A;  1SL2 A;  4HTU A;  1VRT A;  4C8M A;  2PYJ A;  1WSG A;  3S9H A;  3KLE A;  4DS5 A;  4E1M A;  3P83 D;  2PZS A;  1BHL A;  3SI6 A;  1ZBL A;  4QCL A;  3ALY A;  4CEF A;  4AHC A;  4PUO A;  4W5R A;  3CQ8 A;  1QS4 A;  1TL3 A;  4H4O A;  2VG7 A;  4BE2 A;  4ELU A;  4J2E A;  1D9D A;  2BDP A;  5C24 A;  4FJG A;  4PWD A;  4AHV A;  3L2W A;  1RT5 A;  4CJ5 A;  1SL1 A;  2P5G A;  2KFN A;  1G15 A;  4CHY A;  4CFB A;  2QKB A;  5CYM A;  1S9G A;  4DSK A;  3E01 A;  4C8L A;  3TAR A;  3HPG A;  2VWK A;  1VSJ A;  1XHX A;  2HB5 A;  1CLQ A;  2FBV A;  4KV8 A;  3HPO A;  1NKC A;  4EZ9 A;  3JSM A;  3TAB A;  4KRF A;  1IKV A;  3PX6 A;  1LW2 A;  3V4I A;  1A5X A;  1KSP A;  3MEE A;  1S6Q A;  3AA5 X;  3AO3 A;  1C1C A;  4KFB A;  1HNI A;  4Y1D A;  3VQ7 A;  4E89 A;  3QIN A;  2R7Y A;  4H4M A;  4YNQ A;  3PV8 A;  1C1A A;  4N41 A;  1ASV A;  4M42 A;  1U45 A;  4FJH A;  5CY4 A;  2Z1I A;  5HRN A;  1TK0 A;  1ZBH A;  1WAF A;  2G8U A;  4CCH A;  3DOL A;  4FM0 A;  4YFU A;  4IKF A;  1VSK A;  1JLG A;  2DFH A;  4CJT A;  1UWB A;  4KI6 A;  4FZY A;  1NOY A;  3O3G A;  3KD5 E;  1EX4 A;  2X6N A;  4PA1 A;  3O4N A;  4DTU A;  3VQA A;  3DLE A;  1BIU A;  4LH4 A;  2OPS A;  4IBN A;  1SKW A;  3O4Q A;  4BWM A;  4CJR A;  1BQN A;  2ZE2 A;  4F8R A;  2WON A;  3SUN A;  1IH7 A;  5FRO A;  3RMB A;  1JLC A;  4AHS A;  3O3H A;  4CFD A;  3RRG A;  4FJI A;  1VK0 A;  4OLA A;  3WNE A;  4JRP A;  1NK8 A;  1S1T A;  4CGJ A;  1RT3 A;  3ZSY A;  4GVM A;  4CEB A;  4FJ9 A;  3WNF A;  4IFY A;  1R0A A;  1VSL A;  3DMJ A;  1NK6 A;  1N5Y A;  4KRE A;  4CHN A;  1KTQ A;  3AVJ A;  3G10 A;  1VSM A;  4N56 A;  3TAQ A;  4DFP A;  2RN2 A;  3AVM A;  4JRQ A;  3MXM A;  1REV A;  1UA1 A;  3M8R A;  4CJW A;  1QHT A;  4I2P A;  4RG8 A;  2JGU A;  1U04 A;  3QEX A;  4DSL A;  3HYF A;  3KLF A;  2HMI A;  4DS4 A;  4FM2 A;  1BI4 B;  1RTI A;  4CEQ A;  4CK1 A;  3LAN A;  4KAZ A;  4J2B A;  3HL8 A;  3K2P A;  1LWF A;  2E6M A;  4DG1 A;  2YV0 X;  1ASW A;  4ID5 A;  3ZSR A;  3PUF A;  1JLB A;  1LWE A;  4KB1 A;  4JS4 A;  4LD0 A;  3T19 A;  1RDA A;  3DI6 A;  3NE6 A;  3SUQ A;  3I0S A;  4N47 A;  3LZJ A;  4DF4 A;  4DQI A;  5FRN A;  1RBU A;  4CES A;  4CJS A;  3KLG A;  2X6S A;  3ZCM A;  3I8D A;  3VA0 A;  4FXD A;  1EKE A;  5HRR A;  2HW3 A;  1W0H A;  4FLV A;  4DWI A;  1WNS A;  3LPT A;  4OVL A;  4ELV A;  4LH5 A;  4CJ3 A;  4FK2 A;  1JXE A;  4DQS A;  4I9L A;  3QNO A;  4NYN A;  4MQ3 A;  1CXU A;  1RBV A;  1RCH A;  4DTS A;  4HHT A;  4CF2 A;  3HT3 A;  1RTJ A;  2YNF A;  3VQ6 A;  4DQR A;  1IKX A;  1JLQ A;  2G8V A;  3V6D A;  2RKI A;  4F2S A;  2Z1G A;  1GOB A;  2Q3S A;  4M41 A;  4FLW A;  3NBP A;  1B92 A;  1XHZ A;  4Z4H A;  1KCF A;  4OPJ A;  5J2M A;  1W9H A;  4FCY A;  2RF2 A;  4DFM A;  1BGX T;  4DTP A;  3QEV A;  1RDB A;  2A1S A;  1N6Q A;  4OKJ A;  4DTX A;  2GBZ A;  1J9A A;  3ZSW A;  5JS2 A;  3V81 A;  4CFA A;  2D0A A;  3IG1 A;  4DLG A;  2VG5 A;  4C8O A;  4ICL A;  2KW4 A;  3DLB A;  3NHG A;  1L3V A;  2ZD1 A;  1IKY A;  4Q5V A;  1U48 A;  2QKK A;  4IFV A;  2LSN A;  4FLT A;  1L5U A;  3TAP A;  3KKR A;  1UA0 A;  5HP1 A;  3L3U A;  3K58 A;  3TAN A;  1NJX A;  1C0M A;  4I7F A;  4GW6 A;  3CFR A;  2FBX A;  4DTR A;  4FJN A;  1HRH A;  4NCA A;  2XY8 A;  4CED A;  5KRT A;  1FKP A;  3V9U A;  3KTQ A;  1S1V A;  1TKZ A;  3OYJ A;  4DSF A;  4KHQ A;  3HST B;  2G8I A;  1QTM A;  3SPY A;  3IS9 A;  3AVC A;  1KVA A;  3L2U A;  3NF9 A;  1TKD A;  4Q0B A;  4FYD A;  2O4G A;  3SQ1 A;  1I39 A;  1WSH A;  1NK9 A;  4BDP A;  3VQD A;  4RW4 A;  2VWJ A;  2PY5 A;  1U47 A;  4FVM A;  2HHW A;  3D0P A;  3H08 A;  1FKO A;  2FBT A;  5HBM A;  1LV5 A;  3V9Z A;  3B6P A;  4DQQ A;  2G8H A;  2DFE A;  3BGR A;  3AO4 A;  2G8W A;  4F3T A;  1ZBU A;  3ASM A;  3CYM A;  2G8K A;  3AVH A;  2DY4 A;  4W5N A;  3SZ2 A;  1EET A;  2WOM A;  4CIG A;  4K8X A;  4CIF A;  4CGH A;  4CK2 A;  4BE1 A;  4EP4 A;  4EP5 A;  4HUE A;  2HNZ A;  4AIL C;  1K6Y A;  3M8Q A;  1JXB A;  1EXQ A;  4E19 A;  3OY9 A;  3OJU A;  4C8K A;  4FJ8 A;  4O0I A;  4FK4 A;  3ZSO A;  3OS2 A;  1QQC A;  4DLE A;  1NJY A;  2HHS A;  3FFI A;  3B6O A;  1NJZ A;  4NCG A;  3SJJ A;  3QNN A;  5KI6 A;  1O1W A;  3LP3 A;  3MEC A;  3NF6 A;  2KZM A;  5I3U A;  4MFB A;  4CHQ A;  1TAU A;  3TAM A;  3ZSV A;  1TVR A;  1WSI A;  3AVA A;  4OKE A;  2GUI A;  4KB0 A;  3CM6 A;  3QES A;  2QK9 A;  3ULD A;  4FW1 A;  4DF8 A;  3LAK A;  3AVI A;  5CZ2 A;  3V9S A;  4FJX A;  5DMR A;  3PX4 A;  2G8F A;  3NGY A;  2IGI A;  3AVB A;  4DFK A;  3C94 A;  3OYK A;  1D9F A;  1J54 A;  4OPK A;  3A2F A;  4B8A B;  1SKR A;  4F4K A;  3VQQ A;  5HLF A;  5D3G A;  4O55 A;  1C6V A;  4KHS A;  3RWU A;  1CXQ A;  3OYH A;  4CIE A;  4BAC A;  4I9Q A;  2B4J A;  3S3O A;  3OYD A;  3NF8 A;  4LY7 A;  4E0D A;  4CEZ A;  4RW7 A;  1ZBF A;  3ISN C;  2E6L A;  4NCB A;  4DMN A;  1JLF A;  3HPH A;  3M8P A;  5CZ1 A;  3NH1 A;  3SNN A;  3V9X A;  1XWL A;  3G0Z A;  3PY8 A;  4E3S A;  1VRU A;  3CG7 A;  2F8S A;  4CJE A;  4KPY A;  4B8C A;  1B9D A;  2I5J A;  2YHA A;  1LWC A;  3VQE A;  4AH9 A;  1WLJ A;  4M45 A;  4GMJ B;  2AJQ A;  4Z4F A;  1DTQ A;  3KJV A;  2EHG A;  2Z1J A;  3DOK A;  1X9W A;  1YTU A;  3VA3 A;  1FXX A;  4KTQ A;  4H8K A;  1GOA A;  4W5T A;  3V1O A;  3RMA A;  4TSX A;  3K57 A;  3RRH A;  3C6T A;  1VSF A;  4C8N A;  1T05 A;  1SL0 A;  1BL3 A;  4OGC A;  3OYG A;  2HNY A;  4CGF A;  3AVN A;  3L2V A;  1NKB A;  4RW8 A;  1Q9X A;  4KHW A;  2DTU A;  1KVB A;  1KLN A;  4DTO A;  4AHT A;  1BI4 A;  4ZTJ A;  3O3F A;  4AHR A;  4CGD A;  3WNG A;  3HP6 A;  3LP2 A;  3QER A;  5KRS A;  3AVK A;  1NK0 A;  1S1U A;  1TK5 A;  1RT2 A;  4DSE A;  1Y97 A;  2FC0 A;  3AVF A;  3AV9 A;  4KO0 A;  4F3O A;  1C0U A;  4CEE A;  1LW0 A;  1VSD A;  2OPQ A;  2RPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...