3VQBA

Hiv-1 in core domain in complex with 6-fluoro-4h-1,3-benzodioxine-8-carboxylic acid
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 51
structure length 142
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqbA00
4G1QA 2YNIA 4DTMA 1VSKA 3F73A 1T8EA 3MEGA 4CEDA 1JLQA 1KVBA 1RBRA 1GOAA 1RBVA 4CIFA 3LP2A 5KI6A 1Q9XA 2G8KA 3HO1A 3ZT4A 4Z4CA 3ZSYA 1SKSA 5CYQA 3NF7A 2O4GA 5KGXA 1KTQA 3OYLA 2YNHA 1NK4A 1RT6A 4FLWA 1WSGA 3SPZA 4LH4A 3PY8A 4OPKA 3QIPA 4CFAA 1ITGA 3DLRA 1JLCA 4BACA 1LWFA 5J2QA 3LANA 1R0AA 1L3TA 3VQPA 3TWHA 1B9DA 1DTTA 1N6QA 2B5JA 2B6AA 3IG1A 2Z1HA 4DLGA 4CJSA 4B9SA 5T7BA 4KHUA 1X9SA 2OZSA 5C42A 1HPZA 3SV4A 4OPJA 1UA0A 3CM6A 1X9WA 2FC0A 1T7PA 3AVJA 5HRRA 3EZ5A 5FRMA 3TAMA 4CHQA 3OYHA 3RRGA 1BI4A 4KREA 3OJSA 1S1VA 4CIGA 1RTHA 4BDYA 1UAXA 3TABA 3VQ9A 3QNNA 4CJPA 3MXIA 1NK6A 3BDPA 1JLAA 4B9MA 3SCXA 3KD5E 1A5WA 1VSMA 3L2QA 4EZ6A 1RTIA 4OKEA 1O1WA 2P5OA 1HRHA 1UOCA 2IC3A 2OPPA 4CJRA 3VQ7A 3QIOA 2HMIA 3OYJA 4FLZA 3KJVA 3ZSQA 1ZBFA 5J2NA 1RILA 3SQ2A 3HP6A 4Q0BA 3A2FA 5HP1A 3K5MA 2OPSA 3OY9A 4DQPA 3VN5A 4DLEA 2OYQA 4CGDA 2HVIA 1G15A 3NF6A 3M8QA 1FKPA 4I9QA 4CJFA 1LAWA 5HRNA 2OZMA 4CHZA 5JS1A 4DFPA 4FJ7A 2VG7A 4E89A 1D5AA 5HROA 3S3OA 1KVCA 3OS0A 4DTJA 1QSLA 4MFBA 3ZT0A 3KLEA 3KKSA 2P5GA 4FJIA 2RF2A 3KK2A 4FVMA 4DFMA 3LDSA 4OLAA 4J2EA 2IGIA 1WSEA 3AVGA 1SL0A 1NKEA 1EETA 4JS4A 3OYCA 2E6MA 3SQ0A 1XI1A 1D8YA 1CZ9A 4E7IA 2G8IA 4CF9A 1WNSA 4CFDA 5SWMA 3HXMA 3WNFA 2A1RA 5DK5A 5E41A 1ASVA 1TV6A 3LPUA 3ASMA 3NHGA 4FJHA 4CFBA 4HUGA 1X9MA 5CY4A 2PY5A 1KRPA 2FBXA 3HPGA 1U4BA 3TAQA 4CEOA 4FJMA 1ZBLA 2IAJA 1BISA 4CK3A 4O55A 3VQ6A 3K57A 1N5YA 5FDLA 3OYFA 4AILC 3HK2A 3DOKA 1JL1A 3K58A 4Z4HA 2YV0X 3C95A 3H08A 1RDAA 3AVAA 1YVUA 2D0AA 4OKJA 4CFCA 4E1MA 1QTMA 4FJ8A 1LWCA 3QERA 1DLOA 2HNYA 2FBVA 4O44A 3MEDA 3MXJA 1Q8IA 1RDCA 3L2RA 1TKTA 1WAJA 1TL1A 4KV8A 2YNGA 1IKVA 2GV9A 2KQ2A 4WE1A 4F3TA 4N56A 1W0HA 2DFEA 4M3WA 4DTRA 4CF8A 2IDOA 1REVA 3CFPA 2RKIA 5I42A 1VRTA 3L2VA 2KTQA 3QEWA 3V6DA 4DQQA 1C0MA 3QETA 3C6TA 4CEBA 3SUPA 3KIOA 3KTQA 3ALYA 4DU3A 5HBMA 2YHAA 1B92A 1BHLA 1KLNA 4Z4FA 4I2QA 1QS4A 3SUQA 1JL2A 2DFFA 3L2UA 3D0PA 3S3MA 4C8NA 2G8WA 4B9NA 1BIZA 3ZT3A 3DLBA 2G8HA 4FLXA 4IFYA 1RT1A 3OYDA 3DRSA 4BE1A 1SKWA 2HHTA 1RTJA 2D0CA 4R5PA 3L2WA 2YHBA 3K5OA 3SI6A 4K8ZA 2XY7A 4CHOA 4CJKA 1VSHA 2JLEA 4DF8A 5CYMA 2W42A 1IKWA 3QEPA 4KO0A 3K5NA 2Y1JA 3RR7A 4NCAA 3HM9A 3E01A 4DFJA 3IS9A 4FW2A 1HNIA 4IBNA 1IG9A 3AA4A 3I8DA 1X1PA 4JLHA 4DF4A 1YTAA 3NH2A 3P1GA 1A5VA 4HVJA 3OYIA 2P1JA 4DTPA 1LW2A 1LAVA 4MQ3A 5KTQA 1Z25A 3ZT1A 3OS2A 4FLUA 3HJFA 3NAEA 3TAPA 3AVBA 3IAYA 3AVNA 1QQCA 2VG6A 4AHUA 4FLYA 2BANA 3C94A 3DLGA 2ZE2A 1SKRA 4CEEA 3RMCA 2KZMA 4FLVA 3LPTA 3ZCMA 4KHWA 4PQUA 3VA0A 3KKRA 1XHXA 1L5UA 4B9LA 3SQ4A 1CXQA 4J2BA 2LSNA 3VQDA 4H4MA 3OS1A 4QAGA 1RBUA 1NOZA 4Q5VA 1D9DA 1BQMA 1RT4A 2KFZA 4Z0UA 4TSXA 3RR8A 3TR8A 4HTUA 4CGHA 4CF2A 4H4OA 2NUBA 4Y1CA 4H8KA 3TAFA 1TKXA 4DFKA 3B6OA 4KHSA 1FXXA 2JGUA 1ZBIA 3NFAA 3HVRA 4J2AA 4W5TA 2X6NA 4Z4EA 4CGJA 4GVMA 1BIUA 1TK5A 4FJKA 2ATQA 4DTNA 4M42A 4O0IA 3AA3A 2OPRA 1RT5A 4FJ5A 1S6QA 1HYSA 2AJQA 4CJ5A 5C25A 1ASUA 1TKDA 2R7YA 2HHWA 1NK9A 4E7JA 3FFIA 1FKOA 1JXBA 3C6UA 3HYFA 3M8PA 4CK2A 3QEIA 1XHZA 2F8SA 3KLGA 3SV3A 3QEVA 1GOBA 5J2MA 1C0TA 4KFBA 3PV8A 2YKNA 3NF8A 4FXDA 3KK1A 3LWMA 3O4NA 2BE2A 2P51A 4CEFA 1TKZA 4BE2A 2ZQBA 4NYFA 4E7KA 1A5XA 4LSLA 3MXMA 3AVFA 1WSJA 3SQ1A 5KRSA 2XY6A 1K6YA 2HB5A 4IDKA 3SNNA 3BGRA 3CG7A 3AO5A 2X6SA 4CGGA 4M3YA 3VQAA 2G8FA 4PY5A 4C8OA 3HSTB 3RMAA 4Z4GA 3V1RA 4ICLA 4DMNA 4M3ZA 4HUFA 3OYNA 5JS2A 3CYMA 3L8BA 2EHGA 3LP3A 4JRQA 1RTDA 4B9TA 4Z4IA 3F9KA 4XIUA 2PYJA 3LP0A 3LZIA 4DU1A 3DI6A 3V1OA 2PYLA 4FJ9A 4B3OA 3CFOA 2YNFA 3L3UA 4CESA 4GW6A 4BWMA 4FJLA 3NDKA 3DLKA 3EY1A 3LZJA 3RMDA 1T03A 4W5OA 3DLEA 1S6PA 4DSFA 4UQGA 3T1AA 3ITHA 1SV5A 1TVRA 1RBSA 3ZT2A 1IKYA 4YFUA 5HRSA 3V9ZA 1NJZA 5SZTA 3OYEA 2HNZA 1VK0A 4DG1A 1BGXT 3WNGA 3OYBA 1UWBA 4FM1A 3S3NA 2VWJA 2WOMA 4CJVA 1HNVA 2WONA 4OGEA 4NCBA 3VQCA 1HQUA 4E3SA 2KW4A 4ZTFA 1U45A 3KK3A 1JXEA 4B9UA 4IG0A 3O3FA 4F2SA 3CQ8A 3ZSOA 4M3TA 5I3UA 4RW6A 5D3GA 3SZ2A 3THVA 3VQ8A 4M45A 2DY4A 1C1AA 2QXFA 3DRPA 3M8SA 1NKCA 1VSDA 4FZXC 1HJRA 1RT2A 4W5NA 1JLBA 2QKBA 2D5RA 2D0BA 5HRPA 3V9UA 3CM5A 1VSIA 4CEQA 3L3VA 3HPHA 4DTSA 1TK8A 4M3UA 3TAEA 1C6VA 3LALA 3K5LA 1S1XA 3P5JA 4ZTJA 4EZ9A 1IO2A 1EP4A 1MU2A 2OPQA 2Z1JA 1GOCA 2E4LA 3NBPA 3RTVA 4LH5A 2G8UA 3OYMA 2DTUA 3V1QA 3TARA 3G10A 1KVAA 4RG8A 2OA8A 4M3RA 4AHRA 3P83D 4ELUA 3QLHA 3ISNC 4LY7A 3DM2A 3T19A 1TL3A 1SUQA 4E7HA 4DSLA 1RNHA 3AO4A 3OYAA 4JRPA 4DSJA 1KSPA 3DMJA 3U6FA 1U48A 3ZSZA 3TI0A 5KRTA 4CERA 1L3VA 3AVLA 4CEAA 2XRIA 4DSKA 3OYGA 4AHSA 4F4KA 1CLQA 1C1CA 1CZBA 1TAQA 1RDDA 5CZ2A 1KFSA 2B4JA 4I7FA 4PA1A 4CEZA 4CIEA 3PO4A 2EX3A 1RDBA 2FBTA 5J1EA 3NGZA 1XWLA 3DLHA 4K8XA 1RT3A 4E0DA 2ETJA 1WN7A 4FJGA 2GBZA 3G0ZA 1F21A 3NCIA 3SPYA 1BCMA 4FCYA 2PZSA 4LSNA 4N47A 1EKEA 4PUOA 4KHQA 4CK1A 4JS5A 1S5JA 3NH1A 4CHPA 2HW3A 1U47A 3KLHA 3DYAA 4FZZA 3D45A 2E6LA 4CHNA 1J5OA 1KLMA 4CECA 1LWEA 4DS5A 4IKFA 1NOYA 3HVTA 4CF1A 1JKHA 4RW4A 3PX4A 4KI6A 3NGIA 1NK0A 1S1TA 1DTQA 3QEXA 1NK8A 3KD1E 3MECA 4BWJA 1HYVA 4QCLA 2HHXA 2RPIA 3AVHA 3AVIA 4CHYA 5K14A 3AVCA 4M41A 4B9VA 1VSEA 1L3UA 1VRUA 3AA2A 1C1BA 4OGCA 4CJQA 3O3GA 4KI4A 3HT3A 3DOLA 4RW7A 3I0SA 4M3XA 4ID1A 1U49A 4FZYA 3ZSVA 4OKKA 4CJWA 4E19A 2F96A 4ELTA 5FRNA 4KRFA 1I39A 3T3FA 4KTQA 1VSFA 1NK5A 3AA5X 4CJLA 1JLFA 3PUFA 5J2PA 4N76A 4FYDA 1J9AA 4DTUA 4FM2A 1D9FA 2VWKA 3AVMA 3UIQA 4FJNA 1EXQA 3HP9A 3LWLA 4KB1A 1EX4A 2IOCA 4N5SA 3S9HA 3PO5A 4NCGA 5DMRA 3MAQA 2ZD1A 3ZSWA 3O3HA 1WSIA 4RW9A 1RCHA 3VQ5A 1YTUA 4F3OA 3NF9A 3EYZA 4BDPA 4B08A 4CJUA 3KLFA 3QNOA 3HL8A 4FLTA 3LAMA 2G8VA 2Z1GA 2ITGA 4B8CA 4HHTA 1KCFA 1CXUA 5HLFA 4ELVA 3MEEA 4KKOA 1Y97A 1WAFA 3VQEA 3V9SA 4KB0A 4YNQA 4J2DA 4QOZB 3ULDA 1C0UA 4DQIA 1NKBA 4DQRA 4HCBA 4OLBA 5KGWA 4CGFA 3ZSXA 2RN2A 4BE0A 3TANA 4DU4A 1QSSA 3SUOA 4C8KA 1NJXA 3NE6A 1FK9A 1KFDA 3SUNA 3ZSRA 1QE1A 2HHQA 1JLGA 3VQBA 1LW0A 1J53A 4HUEA 1B9FA 2X78A 4B8AB 4AHVA 2FBYA 4FM0A 4KTZA 4O4GA 5CZ1A 4CCHA 3QO9A 3JYTA 4DS4A 4PWDA 2Q3SA 4KHYA 1BQNA 1Z26A 1QSYA 3V9WA 3HPOA 1YT3A 4Y1DA 4IFVA 3U3YA 2A1SA 3V9XA 4FJJA 4DTOA 1S9GA 4C8MA 1L3SA 2KZZA 4LD0A 4EP5A 1Q9YA 4HCCA 4W5RA 1J54A 3OVNA 4KHNA 1ZBHA 2X74A 1HQEA 4FK0A 3V81A 3VA3A 3RWUA 3AO1A 2F8TA 3B6PA 3RRHA 4DSIA 2GUIA 4CJ4A 4DTXA 3QINA 1TAUA 1S1UA 3LAKA 4FK2A 4AHCA 1HMVA 1RBTA 1XC9A 3AO3A 5FROA 1BL3A 2XHBA 2HHUA 3PX6A 1WLJA 1NK7A 2YKMA 3NH0A 4O5BA 1SL1A 2KFNA 4BDZA 1U04A 4ID5A 3WNHA 4KTWA 3K59A 1ZYQA 1TGOA 3SYZA 4CGIA 3AVKA 2XO7A 3SJJA 4C8LA 4OVLA 1W9HA 4CE9A 1S1WA 3TAGA 4AHTA 1ASWA 2BGGA 4ZHRA 2HHSA 4KPYA 1UA1A 4I2PA 4L8RB 3K2PA 4E1NA 2VG5A 4FJXA 1BI4B 4EP4A 1RT7A 4OJRA 2QKKA 3DRRA 3CFRA 2XY8A 3O4QA 4CJTA 4E7LA 2Y1IA 2Z1IA 4I9LA 3OJUA 1WSFA 4DWIA 1WSHA 4CF0A 1VSLA 4DQSA 3KLIA 4N41A 1QHTA 2I5JA 3IRXA 2IS3A 3WNEA 1SL2A 4F8RA 3NGYA 3U3GA 1ZBUA 3RMBA 2DFHA 3M8RA 2QK9A 4IG3A 1IH7A 4FW1A 3VQ4A 2XY5A 4F2RA 4RW8A 2BDPA 2HVHA 2O4IA 3JSMA 1VSJA 3AV9A 4GMJB 4O0JA 5EU7A 5C24A 4KAZA 1JLEA 4W5QA 1BCOA 1S9EA 2HNDA 3AO2A 1IKXA 4AH9A 3I0RA 1I3AA 3QESA 3PX0A 1T05A 1HYZA 3VQQA 3V4IA 3LP1A 4CJ3A 3OYKA 4FK4A 1NJWA 1NJYA 2HHVA 1TK0A 4CJEA 4NYNA 1LV5A 4DSEA
chains in the Genus database with same CATH superfamily
5F0XA 3JAMO 2OANA 3F73A 1T8EA 3CCSN 2NZTA 3CD6N 2YI1A 3NF7A 5I9EB 4U7BA 3U9DA 4FLWA 3SPZA 4LH4A 4CFAA 3DLRA 3M6GA 1L3TA 1L3UA 1LWFA 1KQSM 2KHOA 3FZMA 3TWHA 4B1WB 5C2DA 2B5JA 2QI2A 3IG1A 3SAGA 4DLGA 4B9SA 4LFBK 2QWOA 4KHUA 3K0SA 3VPZA 4NXNK 2HF4A 1HPZA 1V4SA 3TTCA 2D0PA 1X9WA 1X3NA 2FC0A 4MLEA 1DEJA 3VEZA 1T7PA 4BRCA 3N4QA 3EZ5A 3OYHA 1BI4A 1RTHA 5BRFA 1BA0A 2HF3A 3TABA 3VQ9A 4CJ7A 3UE5A 4B3MK 4F9OA 3CCUN 1O1WA 1HYSA 4C23A 3QIOA 5J2NA 1ZBFA 3HP6A 1IV0A 3BF3A 3THYB 3VETA 2HBKA 4IWVA 1FKPA 1LAWA 4CHZA 4ILHA 5HROA 3GBTA 1QSLA 1XUPO 2RF2A 4FVMA 4FWNA 4J2EA 4NLBA 1XI1A 3OYCA 1D8YA 4E7IA 3O4WA 1WNSA 4CFDA 1FJGK 5DK5A 1TV6A 4FJHA 2NRRA 3NHGA 4HUGA 1X9MA 5CY4A 1KRPA 2AP1A 3QFPA 3KHYA 1BISA 3U4LA 5FDLA 5LMUK 5EVZA 3C95A 3H08A 1QTMA 1RDAA 4CFCA 4BVOA 4FOIA 2FBVA 4O44A 3MEDA 3VGMA 1VAZA 3CJ1A 4GV6A 1TL1A 2GV9A 2V7YA 4CF8A 3FGUA 2IDOA 2P9KA 3P38A 3TTDA 3L2VA 2KTQA 3V6DA 5LJWA 3QETA 3C6TA 5AQQA 3KTQA 3QICA 3CCQN 2YHAA 1JL2A 2DFFA 3D0PA 4O8KA 5M1QA 4C8NA 3ZT3A 4CW7B 4NLCA 1M90O 4JKEA 1NGEA 4BR5A 5GIPA 3K5OA 4BQLA 2XY7A 4CHOA 4CJKA 5IT9O 5CYMA 2W42A 3RR7A 5EOYA 3K5NA 3E01A 3IS9A 4FW2A 1HNIA 1IG9A 4MO5A 3VF6A 2ZGYA 4JLHA 1YTAA 4MDAA 3P1GA 2A6AA 5JLHA 1Z25A 3THXA 4LC9B 1SKRA 3LPTA 4PQUA 2QWLA 4WQ4A 3SMPA 1XHXA 4KBOA 2P9SB 1L5UA 1V4TA 3C6AA 3SQ4A 4B9LA 4DV4K 4MO4A 2LSNA 4FL9A 3IFRA 2AA4A 1RBUA 4Q5VA 3RR8A 4CF2A 3LM9A 3VTIA 4H8KA 1TKXA 2I7NA 2QW9A 3VEYA 4DUZK 1FXXA 4W5TA 2X6NA 3KVGA 3CF5L 2OPRA 4FJ5A 1S6QA 2A5XA 4BREA 4E7JA 4NXMK 3C6UA 3HYFA 3VENA 3KLGA 3SV3A 1E4FT 5AQUA 4FXDA 3KK1A 1GLAG 2P51A 1VQ8N 2P9IB 4CI6A 4LSLA 3MXMA 4BRLA 3NVMA 3SNNA 3BGRA 3CG7A 3AO5A 2X6SA 3I55N 3L4IA 3TSUA 2P9LA 1GLLO 3HSTB 4ICLA 4DMNA 3OYNA 2F4VK 1OKJA 4IO9L 4XIUA 3VESA 4DU1A 4YHHK 3DI6A 1ZXOA 3IDHA 1KAZA 4DKWA 3L3UA 4GW6A 3VEVA 3H3OB 1OH7A 3LZJA 3RMDA 4YORA 4WFNL 1VQLN 2V7ZA 1TVRA 1RBSA 3ZT2A 4YFUA 1LOTB 2E1ZA 3S3NA 1BGXT 4IEIA 4ZTFA 4DV1K 2KW4A 4DR4K 5CE3A 3O3FA 2NLXA 4XH1A 4OX9K 4H0YB 3SZ2A 1ESVA 5JVHL 1C1AA 4CZJA 3D7EO 4FPBA 1YAGA 4BRDA 1HLUA 1HJRA 3E9LA 1JLBA 4BGBA 3I8BA 4BROA 5HRPA 4DTSA 3F9MA 1VSIA 4CEQA 4BC5A 3TAEA 5BREA 2OPQA 4LH5A 3ZLJA 3V1QA 1WOQA 2BUPA 1HNZK 4LY7A 3QB0A 3DM2A 3VEOA 4A59A 2ZWHA 3E1YA 1SUQA 4E7HA 4BRAA 3AO4A 3A5LC 2ASMA 1KSPA 3U6FA 1U48A 3SMSA 2OCEA 3OYGA 2HBMA 1CLQA 1KFSA 3GG4A 5AQJA 3R9PA 4PA1A 4CIEA 3NCIA 1BCMA 4H5RA 2E2NA 3CJBA 4PUOA 2A42A 1NWKA 4IOAL 5AR0A 4B1VA 5LL6Z 2UU9K 3DYAA 3D45A 2E6LA 4CHNA 1BG3A 4IKFA 1NOYA 2QWQA 3CJCA 1JKHA 1HPMA 4CF1A 4EAHD 3PX4A 4KI6A 1S1TA 4I6MB 1NK8A 1HYVA 5C15A 3AVHA 3AVIA 3AVCA 3AAPA 1NGHA 3CJ9A 4OGCA 3O3GA 3OA9A 4KI4A 3HT3A 3DOLA 3I0SA 3CHWA 4ID1A 4FZYA 4KRFA 5FRNA 2F96A 5KQ8A 4IJAA 1I39A 1VSFA 4A57A 3RSEB 3MN5A 1QQMA 4DTUA 2IVOA 1M1KO 4FM2A 1D9FA 3AVMA 4J8FA 3PO5A 4NCGA 1WSIA 3VQ5A 4GV3A 4B08A 3KLFA 3MMVA 4HHTA 5HLFA 4ELVA 3VQEA 1WAFA 1X3MA 2FF6A 3EN9A 4DQRA 4BRNA 5KGWA 3ZSXA 3MX2A 1NGAA 1NGIA 1KFDA 3D2EB 4ILGB 3VQBA 2X78A 4FVUA 2V51B 4YOVA 2H3GX 5B8HA 3PIOL 2Q3SA 3V9WA 2W6KA 4Y1DA 3WUHA 4JD2A 2A1SA 4DV5K 3V9XA 4FJJA 4PKIA 1NG9A 1OH5A 1BDGA 4LD0A 4KHNA 1ZBHA 4DQ8A 2HSTA 3RWUA 1E3MA 4DTXA 4DR3K 3LAKA 4FK2A 3U8XA 3BUZB 1VQ4N 5FROA 4OO1J 3FLCO 1N34K 2HHUA 1WLJA 3BZCA 4O8UA 1NK7A 2YKMA 3NH0A 1MDUB 3WNHA 3WXKA 1ZYQA 3EE8A 2VWBA 1SS6A 4BR9A 4CE9A 4AHTA 4ZHRA 4KPYA 1NNEA 3FZHA 5KQDA 5LMNK 1W2BM 3D2FA 4CJTA 2Z1IA 4I9LA 1WSHA 2D0OA 3DJCA 3O9TA 2IS3A 1OH6A 3RMBA 3ZYYX 3M8RA 3JS6A 3ENHA 3VQ4A 2HVHA 3JSMA 1Z6RA 3AV9A 1QQOA 1T05A 2PBDA 1VQ9N 3LP1A 4CJ3A 5A2QO 4CZLA 3T1HK 2HHVA 3OW2M 4QOZB 4DSEA 3CPWM 1VSKA 1O13A 1NGBA 1MA9B 2P9PB 4U67L 1GOAA 4CIFA 3HO1A 1RFQA 4WFAL 3ZT4A 1TYQB 3ULEB 1SKSA 5KGXA 3OYLA 3SAFA 4OPKA 1JLCA 5J2QA 3LANA 3VQPA 5BN9A 2RE2A 1YJWN 3H46O 4CJSA 4EFHA 5T7BA 2OZSA 1UA0A 2PFUA 4JKHA 5AFUA 5FRMA 3B8AX 4BG8A 3OJSA 1S1VA 3BDPA 3HOSA 4CJPA 3QNNA 3MXIA 1JLAA 3KD5E 3A8YA 1VSMA 4IJNA 2P5OA 1HRHA 2ZJRL 2OPPA 3VQ7A 3OYJA 1YHQN 4FLZA 3KJVA 4Q0BA 4A5BA 1RILA 5AQGA 3SQ2A 2OPSA 3GOIA 3OY9A 2O8FA 4PL7A 2Q97A 3VN5A 5JLFA 4H0OA 4CGDA 1G15A 3M8QA 4IDHA 4X66K 5JS1A 4H5VA 1ZBSA 3TSPA 5AJ3K 3S3OA 4DTJA 3OS0A 3KLEA 3KKSA 4DFMA 3LDSA 3H1VX 1WSEA 3AVGA 1NKEA 1EETA 2E6MA 1TUUA 1N8RO 1CZ9A 4CF9A 4GVEA 5SWMA 1ASVA 3LL3A 3J7YP 4LF9K 1GLFO 4JNEA 3AGRA 2PY5A 5FLXO 4JK7A 4CEOA 1N5YA 4AILC 1HX1A 1IG8A 2Q31A 1YVUA 1ZBIA 3ZX3A 3QERA 1DLOA 3MXJA 1TKTA 4B1ZA 5E84A 4KHPK 4F3TA 4BR0A 5TKYA 5FPNA 4LF7K 1DT9A 2V52B 5LJVA 4JKGB 5BPNA 5HBMA 1B92A 1JCEA 4Z4FA 3CETA 4I2QA 3SUQA 3S3MA 2NNWA 1BIZA 2YX6A 4FLXA 3THWB 3DRSA 4H5WA 3THYA 3SI6A 2YHBA 2UUCK 4BY9C 1VSHA 3H3NO 4IXCA 4DF8A 4DR6K 2VCPA 1VQMN 1IKWA 3I33A 2CH5A 3HRGA 3P31A 4DFJA 4PL8A 1Q18A 3IMXA 1XMOK 3I8DA 1X1PA 2D4WA 4DF4A 1SQKA 4X62K 3OS2A 2HMPA 5AZJB 3NAEA 3H6EA 3IAYA 3AVNA 4B1UB 4A2BA 2E2QA 4YDUC 4FLVA 3VA0A 3KKRA 4V19S 3J81O 4FWPA 2Q1NA 2PAVA 3VQDA 1CZAN 1NOZA 1BQMA 3TR8A 4CGHA 1VQNN 2NUBA 4CZFA 5ADXA 4Y1CA 3TAFA 5AQPA 5AQHA 5KPZA 3C7NA 1RDUA 4JYAK 4CGJA 4GVMA 2ZJQL 4FJKA 4BC2A 5C25A 2R7YA 1HKGA 1NK9A 4B3SK 4DR2K 3FFIA 3JXUA 3LDQA 4YY3K 1XHZA 4CK2A 3M8PA 2F8SA 5LY3A 3HOTA 5J2MA 1P90A 3NF8A 3SK3A 3O4NA 4CEFA 1TKZA 4BE2A 2ZQBA 3MCAB 1Z05A 1WSJA 5F2RA 4CGGA 4K43A 3VQAA 4PY5A 4Z4GA 3CYMA 3L8BA 2KLAA 4JRQA 4B9TA 3BF1A 1BWFO 3LP0A 4IO8A 3V1OA 4CESA 1LCUA 3CCJN 3EY1A 4UQGA 3M5RA 3LDOA 3OYEA 1D4XA 4JHDA 4JKAA 4JI0K 4JI8K 4CJVA 2WONA 4OGEA 1HQUA 4E3SA 4B9UA 2WC9A 2ASOA 4IG0A 4JI2K 3THVA 2W6LA 3M8SA 1NKCA 1RGIA 3QMLA 4H0XB 5EX5A 3D6RA 1TK8A 3LALA 3DWLA 4EZ9A 1IO2A 2Z1JA 1Q81O 3NBPA 3RTVA 2G8UA 3CCVN 2DTUA 4DV2K 3TARA 1NGDA 3C0BA 3M3ZA 4ELUA 3ISNC 3T19A 4PKHA 4FOEA 3OYAA 1T3VA 4JRPA 1NGGA 2NRWA 5KRTA 4FWQA 4CERA 3A5MC 1R59O 2E2OA 4F4KA 3G25A 1TAQA 1RDDA 5CZ2A 2CH6A 3NGZA 1RT3A 4E0DA 1TUYA 1YUWA 3H45C 1F21A 4YOUA 1EKEA 4CK1A 4JS5A 4YOWA 4PHTX 2ITMA 3J8AA 4GV9A 4CZGA 5KPRA 3DXKB 1LWEA 4YOTA 5BPMA 3HVTA 3SJHA 3NGIA 4GY2B 1DTQA 3QEXA 3KD1E 2HHXA 3MECA 4BWJA 4QCLA 2RPIA 3O08A 3VGKA 1NBWA 1C1BA 3AA2A 5AQWA 1K8KB 4RW7A 1U49A 3VERA 4OKKA 3WEEA 1DKGD 4DR5K 5M1OA 3AA5X 3PUFA 1J9AA 5DM6L 2VWKA 3UIQA 4FJNA 4N5SA 1IJJA 3ZSWA 4WYBA 3F2KA 1RCHA 1YTUA 2P9KB 3FFKB 1NJIO 3HL8A 2OTJN 4FLTA 2G8VA 3J7AP 3CXCM 1CXUA 1HNWK 3HSCA 4BGAA 3MEEA 4KB0A 4J2DA 3ULDA 1IBKK 1I94K 2RN2A 3ATVA 4DU4A 1C0FA 1P8ZA 1JLGA 4H0PA 5CR4A 4LF8K 4QS9A 4XH4A 4KTZA 3EL2A 2QA4N 4CBWA 1VQKN 3VOVA 4I6MA 3HBTA 4K25A 3W3DA 3EKUA 1YT3A 3U3YA 1NGCA 4C8MA 2KZZA 1YJNN 2A40A 4G9ZA 3OVNA 2X74A 1HQEA 4DR7K 2F8TA 3RRHA 2GUIA 2HBJA 3QINA 1S1UA 3RSEA 1KXPA 1RBTA 3AO3A 2QWMA 4YOYA 1BL3A 1YJ9N 4ILJA 2KFNA 4BDZA 4ID5A 4KTWA 3K59A 1TGOA 3AVKA 2XO7A 3SJJA 3ZX2A 4OVLA 4E1JA 1VHXA 2BGGA 1ASWA 2WUSA 3O9RA 4I2PA 3K2PA 5EY4A 2VG5A 5IWAK 3I56N 1RT7A 2XY8A 3VEWA 3G4SN 3O4QA 2Y1IA 2QXLA 1WSFA 4CF0A 3CJ7A 3KLIA 2I5JA 1SL2A 3U3GA 1ZBUA 2CGJA 2DFHA 3D2EA 3MK6A 4Y0WA 2XY5A 2GWKA 4X65K 3O80A 5EU7A 1U2VB 4W5QA 2HNDA 3I0RA 1GLDG 1I3AA 3DXMB 4QS8A 1HYZA 3Q7CA 3L4QA 5GAEP 4HWIA 4AM7A 2FF3B 4NYNA 4G1QA 2YNIA 1T6DA 4CD3A 2YJFA 3E66A 3MEGA 1JLQA 1KVBA 2QWRA 5KPTA 1J5EK 3LP2A 5KI6A 2O8CA 2G8KA 3ZSYA 5CYQA 4CZIA 1DGKN 2O4GA 1WSGA 3CCLN 1ITGA 4BACA 4BQZA 2GELA 4H0TB 3MWTA 2W40A 2QEXN 5H1SQ 3CCRN 2J4RA 3HM8A 2Z1HA 2NRTA 1X9SA 1HR0K 3SBTA 5C42A 3CM6A 3AVJA 5HRRA 4GKKK 1EWRA 3RVCA 3TAMA 4CHQA 2VQFK 3OBWA 4BDYA 1UAXA 1NK6A 3SCXA 5E26A 3L2QA 4EZ6A 3A5OC 5BPLA 2HMIA 3ZSQA 5HP1A 3K5MA 4DQPA 3UKRA 4DLEA 2HVIA 5BR8K 3NF6A 2OZMA 3F5TA 4FJ7A 4C1NI 2VG7A 4E89A 2P5GA 4FJIA 3SBGA 4OLAA 4JK9A 1QHAA 4WCEL 2IGIA 3R8EA 3SQ0A 3ID6A 1HJOA 2P9PA 2WFBA 2A1RA 3LPUA 3ASMA 4CFBA 1TYQA 4CVNE 3ULEA 4IOCL 4FJMA 1HKCA 3HPGA 5EXWA 3TAQA 3VQ6A 3K57A 4H0VB 3QBXA 3DOKA 2YV0X 4OKJA 4FJ8A 2GUPA 4LF5K 4FO0A 4GNIA 3KK7A 4IZ9A 1Q8IA 1WAJA 1JCGA 2YNGA 1W0HA 2DFEA 5JICA 3AAQA 4JI7K 4DTRA 3T1YK 4MLHA 2FSKA 3CFPA 2RKIA 4FSVA 3ZEUA 1VRTA 5BR9A 1C0MA 1J6ZA 3SUPA 3KIOA 3ALYA 4DU3A 5C12A 3EO3A 4RWTA 4B9NA 2G8WA 3KZBA 4CD1A 2G8HA 2HHTA 2D0CA 2HBLA 4R5PA 3FZKA 4JAXA 3K9JA 3QEPA 2Y1JA 1S72N 5FPEA 3HM9A 4BR4A 4IBNA 3AA4A 1Q7YO 2D1KA 3BEXA 3CI5A 3OYIA 1LW2A 3BZKA 5KTQA 3E9PA 3ZT1A 2F9TA 3HJFA 3VGLA 4JN4A 3AVBA 5AQFA 1QQCA 2VG6A 5M1FA 2BANA 4JKFA 3DLGA 2ZE2A 4LFCK 5BN8A 4J2BA 4H4MA 4QAGA 1RT4A 2KFZA 4HTUA 5M1KA 3ATUA 3EKSA 4DFKA 3B6OA 2O8EA 3HVRA 1NGJA 4Z4EA 1TK5A 5FPDA 2ATQA 4M42A 4BRGA 3AA3A 1RT5A 4JKGA 5C10A 4JEPA 2AJQA 3A0IX 4CJ5A 1EWQA 3WXMB 1ASUA 2HHWA 1YF5L 1FKOA 1JXBA 2NRVA 3QEIA 2QK9A 3QEVA 1C0TA 4PKGA 4DB3A 3J7ZO 3LWMA 2HOEA 1ILYA 3O5BA 1YITN 4AF1A 4E7KA 1A5XA 2XY6A 1K6YA 2HB5A 4IDKA 3GE1A 4M3YA 5FPMA 3TTFA 2G8FA 2IIRA 4C8OA 3V1RA 4M3ZA 4HUFA 5JS2A 2EHGA 3LP3A 5AZJA 1RTDA 5AQMA 4Z4IA 4DCHA 3LZIA 2PYLA 2QWNA 3CFOA 4JV5K 1ATSA 2YNFA 3G71N 4BWMA 4FJLA 3NDKA 1T03A 1U6ZA 3DLEA 5AQZA 1S6PA 2O8BB 3ITHA 1SV5A 4CZHA 2E8AA 1IKYA 2UXCK 3V9ZA 3CERA 1NGFA 1NJZA 2UYTA 1VK0A 4JKCA 3L6QA 3WNGA 4BG9A 1UWBA 2O8DB 4A61A 4M7XA 3W0LA 4HTLA 4YDUA 4NCBA 3VQCA 1U45A 3KK3A 1JXEA 4M7YA 3A5NC 1NLVA 4F2SA 3ZSOA 5I3UA 3ZETB 5D3GA 4MDBA 3VQ8A 4M45A 5M1NA 3CPEA 1VSDA 3O1WA 4FZXC 5AZIB 4BRIA 2D5RA 2NRHA 3MDQA 3E9OA 3V9UA 3O9QA 3GL1A 3L3VA 4JI4K 2NRXA 4UY8O 1C6VA 3K5LA 1S1XA 4ZTJA 3VEXA 4O5FA 1MU2A 2P9NB 3G10A 4ISEA 4RG8A 5AQLA 2OA8A 4M3RA 2BH1A 4AHRA 3MWPA 4Z94A 3ENBA 4FWLA 4DSLA 5ELZA 4M63C 4XH5A 3DMJA 3CC7N 3TI0A 1L3VA 4CEAA 4DSKA 1VQPN 4AHSA 2ZJPL 1NMNA 4CBXA 2B4JA 4B1YB 4I7FA 3PO4A 5J1EA 1N36K 1XWLA 3PSIA 2ETJA 4FJGA 2GBZA 4BR7A 4FCYA 4IOXA 2PZSA 4WF9L 4FWSA 3BP8A 4LSNA 4N47A 4KHQA 2HW3A 1IBLK 3P4IA 4ISFA 3O9SA 4FZZA 1KLMA 4DS5A 3J80O 3GDQA 1OVYA 1NK0A 3ID8A 3EZWA 4B9VA 1VSEA 4WFBL 1VRUA 4CZKA 4CJQA 4LFAK 4M3XA 1HKBA 4ELTA 4CJWA 1FW6A 3T3FA 1QZ6A 1NK5A 4ISGA 4N76A 3CMAN 1JLFA 5J2PA 4FYDA 3AARA 3TPQA 1EXQA 3HP9A 4KB1A 3FR0A 1EX4A 2IOCA 3S9HA 3WXIA 5DMRA 3MAQA 5AQIA 3O3HA 1QVGM 3EYZA 3MN7A 4CJUA 1QQNA 2P9UB 2Z1GA 2ITGA 1KAYA 3H1QA 4B8CA 1KCFA 4BRHA 3V9SA 1NKBA 4HCBA 3O1BA 4BE0A 1OVQA 4C8KA 3SUOA 3CIPA 1FK9A 2P9SA 3CJAA 4WQ5C 3ZSRA 3IKMA 3SUNA 2HHQA 1VQ6N 4FWOA 1LW0A 4AQYK 1J53A 4HUEA 5AQOA 4OPAA 3IUCA 2FBYA 3UKUB 4FM0A 5CZ1A 3DXKA 4BRMA 4CCHA 3QO9A 1BQNA 1Z26A 1T44A 3HPOA 4RCHA 4IEEA 1XNQK 3PIPL 2BTFA 4IFVA 4DTOA 1S9GA 3FZFA 1L3SA 4EP5A 1Q9YA 1K8KA 4W5RA 4HCCA 2FXUA 4FK0A 3V81A 3VA3A 3AO1A 1BUPA 1X9JA 3B6PA 4FWMA 4NB4A 1S3XA 1TAUA 3KWGA 1Q82O 1W7AA 1HMVA 3MCPA 1ATRA 2P9IA 2XHBA 3CC4N 4BRQA 3C7NB 3SYZA 4C8LA 1EO1A 2FSJA 2HHSA 2VGMA 1G99A 3HZ6A 1UA1A 4E1NA 4FJXA 1BI4B 2YHXA 3DLLL 4OJRA 3O6WA 4E7LA 1SAZA 3P39A 4DWIA 2WBNA 4DQSA 3IRXA 4F8RA 4XEIA 4B3RK 4IG3A 1IH7A 3BY5A 1GLCG 2BDPA 2YHYA 1VSJA 4GMJB 4L3QA 4KAZA 3QESA 3PX0A 3VF2A 4FK4A 3EEQA 1NJYA 1TK0A 1GLEG 4CJEA 1LV5A 5BRHA 4DTMA 1VQ5N 4CEDA 2I7PA 4QS7A 1RBRA 1RBVA 5MLCQ 3NVKA 3U9ZA 1Q9XA 4Z4CA 1RDWX 3WXLA 1KTQA 2YNHA 1NK4A 1YVNA 1RT6A 3PY8A 3QIPA 5HOOA 4JHDB 4FWKA 1R0AA 1MWMA 1B9DA 1DTTA 1N6QA 2B6AA 4BRFA 4KH4A 4CZMA 2Q2RA 3SAHA 3SV4A 1NU0A 3SLCA 4OPJA 4RTFD 1WBDA 5AQSA 2ZM6K 3RRGA 4KREA 1E4GT 4CIGA 4K41A 4B9MA 3M1FA 3R6MA 1A5WA 4NO7A 2IVNA 1BA1A 1RTIA 4OKEA 1UOCA 2IC3A 4CJRA 2F9WA 3A2FA 4BRPA 2OYQA 4I9QA 4CJFA 1XMQK 4H5TA 5M1PA 5HRNA 1U2VA 4A62A 2HHHK 2UUBK 4DFPA 4WQ4C 3DXMA 1D5AA 1KVCA 3CCEN 4MFBA 3ZT0A 3KK2A 3MN6A 1SL0A 1K8AO 4JS4A 1MWKA 5GIOA 2G8IA 2YJEA 4LF4K 3HXMA 3WNFA 5TKWA 5E41A 1N33K 3THXB 1VQON 3PSFA 2FBXA 1U4BA 1ZBLA 2IAJA 4CK3A 4O55A 3OYFA 3HK2A 3K58A 1JL1A 4Z4HA 4E1MA 2D0AA 3AVAA 3T69A 1LWCA 3R3LA 2HNYA 1K9MO 3L2RA 1RDCA 3EE9A 3VF4A 4KV8A 1IKVA 2KQ2A 1NMDA 3QBWA 4WE1A 4A5AA 4N56A 4LF6K 4M3WA 3OBYA 1REVA 5I42A 3QEWA 4DQQA 4B3TK 3CMEN 4CEBA 3OTOK 3LDPA 1KLNA 1BHLA 3K9KA 1QS4A 3L2UA 3WEEB 3DLBA 4IFYA 1RT1A 3OYDA 4BE1A 1SKWA 1RTJA 3L2WA 4K8ZA 2FLOA 2Q0RA 3CQYA 2JLEA 4JKBA 4KO0A 4NCAA 4C1NK 5AQYA 3MN9A 2P9LB 4BC4A 3NH2A 4HVJA 1A5VA 4DTPA 2P1JA 1LAVA 4MQ3A 4FLUA 3WT0A 3TAPA 3QDKA 2WTUA 4FPAA 4AHUA 4FLYA 1WBBA 3LDLA 3C94A 4H5NA 4CEEA 3RMCA 2KZMA 2Q36A 1WB9A 3C6HA 2VYPA 3ZCMA 4KHWA 1ZC6A 2RHKA 1CXQA 3AY9A 4FWRA 3C65A 1JJ2M 3OS1A 3O8MA 1GLJO 1D9DA 3ENOA 4Z0UA 4TSXA 4H4OA 4KHSA 5AQTA 2JGUA 3NFAA 2GTDA 4J2AA 1BIUA 4BC3A 4DTNA 4O0IA 2E88A 3Q7BA 1TKDA 2UXBK 1VQ7N 1S22A 1GOBA 4KFBA 3PV8A 3QFUA 3FZLA 2YKNA 2BE2A 3WXJA 3CCMN 4X64K 5BRDA 4NYFA 1BO5O 3AVFA 4IFEA 3SQ1A 5KRSA 4K0KK 1OH8A 4B9QA 5F1XA 3RMAA 1QVFM 2JWLA 3UB5A 4DUYK 3F9KA 2PYJA 4B3OA 4FJ9A 3HI0A 1N32K 3HTVA 4EHUA 3N4PA 4DR1K 3DLKA 4W5OA 2E1YA 2JWKA 4DSFA 3T1AA 5AFUH 5HRSA 5SZTA 4FM1A 2HNZA 4DG1A 5GINA 3OYBA 3MX5A 2VWJA 1YI2N 1YXQA 2WOMA 1HUXA 1HNVA 3WQTA 2E2PA 3CQ8A 4M3TA 4RW6A 5AQNA 2DY4A 3DRPA 2QXFA 3R1XA 5GAHP 1RT2A 2E5LK 4W5NA 3LDNA 2QKBA 1BU6O 1T6CA 2D0BA 5AQXA 3CM5A 4M3UA 2O8CB 3HPHA 2NRZA 2ASPA 3P5JA 4CZEA 1BOTO 1EP4A 1GOCA 2ZGZA 2E4LA 1XC3A 4DV3K 5AQVA 3OYMA 1IBMK 1KVAA 3G6EN 3P83D 3QLHA 1TL3A 3CQXA 1RNHA 4JI5K 2VGNA 4DSJA 3KWIA 3ZSZA 4AM6A 3ZX0A 3AVLA 2XRIA 1KD1O 5GADP 3OHRA 1GLBG 1W97L 1C1CA 1CZBA 4CEZA 2EX3A 3AGKA 1RDBA 2FBTA 4B1XB 3DLHA 4K8XA 2O8BA 1WN7A 3G0ZA 3SPYA 2IVPA 5DM7L 1EQYA 3UKRB 2F7TA 1S5JA 3NH1A 2O8DA 4JKDA 4CHPA 1U47A 3KLHA 1JCFA 3NMUA 1J5OA 4CECA 3TU5A 1NM1A 1XQSC 2CGLA 1HNXK 4RW4A 4OPHA 2ZF5O 3ZETA 4DHYA 3O9UA 4JD2B 5AZIA 5K14A 4M41A 2QWPA 4CHYA 3FE1A 2QTDA 2UUAK 2YHWA 1K73O 3VTHA 4GKJK 3ZSVA 4E19A 4KTQA 3TSQA 2P9NA 3THWA 2DPNA 2CGKA 4CJLA 4EHTA 2YCHA 3LWLA 3T7ZA 2ZD1A 4DV7K 4JI3K 4RW9A 4F3OA 3NF9A 4BDPA 1SZ2A 3ZEUB 3QNOA 3LAMA 4DV0K 1KAXA 4BRKA 4KKOA 1Y97A 4R79A 4YNQA 1C0UA 4DV6K 3D2FB 3S41A 4DQIA 4OLBA 5ADXH 4CGFA 3TANA 1QZ5A 1QSSA 3VMFB 1NJXA 1ATNA 3NE6A 3L0QA 1QE1A 4CBUA 3CC2N 4H03B 1B9FA 4B8AB 5GAGP 4AHVA 3WQUA 4O4GA 2GX9A 4BR2A 3JYTA 4DS4A 4PWDA 3PLAA 4KHYA 1QSYA 2GWJA 1Y64A 5CHIA 4KH6A 2Q0UA 2FSNA 2W41A 5AQRA 2A3ZA 4YOXA 1J54A 2QM1A 5AQKA 1H1VA 4DSIA 4CJ4A 5C0YA 2KKZA 4AHCA 1XC9A 1WUAA 4KH5A 4K42A 1KC8O 3PX6A 4O5BA 1YIJN 1SL1A 1U04A 4BVPA 4EIAA 2O8EB 1C0GA 4CGIA 4JI6K 2E20A 1W9HA 2UXDK 1S1WA 3TAGA 2P9UA 5JMVA 2GEMA 4L8RB 1XNRK 1Q86O 4A2AA 4EP4A 2QKKA 3DRRA 3CFRA 2EWSA 4JK8A 3OJUA 2A41A 1VSLA 4N41A 1QHTA 3WNEA 3NGYA 5HL7L 4FW1A 5JVGL 2O8FB 4F2RA 4RW8A 2O4IA 3UKUA 4O0JA 4JI1K 5C24A 1JLEA 1BCOA 1S9EA 3AO2A 4AH9A 1IKXA 2OTLN 3VQQA 3V4IA 3OYKA 3DAWA 1NJWA 3LM2A 5C2FA 2VQEK 4WQ5A
chains in the Genus database with same CATH topology
4G1QA 2YNIA 4DTMA 1VSKA 3F73A 1T8EA 3MEGA 4CEDA 1JLQA 1KVBA 1RBRA 1GOAA 1RBVA 4CIFA 3LP2A 5KI6A 1Q9XA 2G8KA 3HO1A 3ZT4A 4Z4CA 3ZSYA 1SKSA 5CYQA 3NF7A 2O4GA 5KGXA 1KTQA 3OYLA 2YNHA 1NK4A 1RT6A 4FLWA 1WSGA 3SPZA 4LH4A 3PY8A 4OPKA 3QIPA 4CFAA 1ITGA 3DLRA 1JLCA 4BACA 1LWFA 5J2QA 3LANA 1R0AA 1L3TA 3VQPA 3TWHA 1B9DA 1DTTA 1N6QA 2B5JA 2B6AA 3IG1A 2Z1HA 4DLGA 4CJSA 4B9SA 5T7BA 4KHUA 1X9SA 2OZSA 5C42A 1HPZA 3SV4A 4OPJA 1UA0A 3CM6A 1X9WA 2FC0A 1T7PA 3AVJA 5HRRA 3EZ5A 5FRMA 3TAMA 4CHQA 3OYHA 3RRGA 1BI4A 4KREA 3OJSA 1S1VA 4CIGA 1RTHA 4BDYA 1UAXA 3TABA 3VQ9A 3QNNA 4CJPA 3MXIA 1NK6A 3BDPA 1JLAA 4B9MA 3SCXA 3KD5E 1A5WA 1VSMA 3L2QA 4EZ6A 1RTIA 4OKEA 1O1WA 2P5OA 1HRHA 1UOCA 2IC3A 2OPPA 4CJRA 3VQ7A 3QIOA 2HMIA 3OYJA 4FLZA 3KJVA 3ZSQA 1ZBFA 5J2NA 1RILA 3SQ2A 3HP6A 4Q0BA 3A2FA 5HP1A 3K5MA 2OPSA 3OY9A 4DQPA 3VN5A 4DLEA 2OYQA 4CGDA 2HVIA 1G15A 3NF6A 3M8QA 1FKPA 4I9QA 4CJFA 1LAWA 5HRNA 2OZMA 4CHZA 5JS1A 4DFPA 4FJ7A 2VG7A 4E89A 1D5AA 5HROA 3S3OA 1KVCA 3OS0A 4DTJA 1QSLA 4MFBA 3ZT0A 3KLEA 3KKSA 2P5GA 4FJIA 2RF2A 3KK2A 4FVMA 4DFMA 3LDSA 4OLAA 4J2EA 2IGIA 1WSEA 3AVGA 1SL0A 1NKEA 1EETA 4JS4A 3OYCA 2E6MA 3SQ0A 1XI1A 1D8YA 1CZ9A 4E7IA 2G8IA 4CF9A 1WNSA 4CFDA 5SWMA 3HXMA 3WNFA 2A1RA 5DK5A 5E41A 1ASVA 1TV6A 3LPUA 3ASMA 3NHGA 4FJHA 4CFBA 4HUGA 1X9MA 5CY4A 2PY5A 1KRPA 2FBXA 3HPGA 1U4BA 3TAQA 4CEOA 4FJMA 1ZBLA 2IAJA 1BISA 4CK3A 4O55A 3VQ6A 3K57A 1N5YA 5FDLA 3OYFA 4AILC 3HK2A 3DOKA 1JL1A 3K58A 4Z4HA 2YV0X 3C95A 3H08A 1RDAA 3AVAA 1YVUA 2D0AA 4OKJA 4CFCA 4E1MA 1QTMA 4FJ8A 1LWCA 3QERA 1DLOA 2HNYA 2FBVA 4O44A 3MEDA 3MXJA 1Q8IA 1RDCA 3L2RA 1TKTA 1WAJA 1TL1A 4KV8A 2YNGA 1IKVA 2GV9A 2KQ2A 4WE1A 4F3TA 4N56A 1W0HA 2DFEA 4M3WA 4DTRA 4CF8A 2IDOA 1REVA 3CFPA 2RKIA 5I42A 1VRTA 3L2VA 2KTQA 3QEWA 3V6DA 4DQQA 1C0MA 3QETA 3C6TA 4CEBA 3SUPA 3KIOA 3KTQA 3ALYA 4DU3A 5HBMA 2YHAA 1B92A 1BHLA 1KLNA 4Z4FA 4I2QA 1QS4A 3SUQA 1JL2A 2DFFA 3L2UA 3D0PA 3S3MA 4C8NA 2G8WA 4B9NA 1BIZA 3ZT3A 3DLBA 2G8HA 4FLXA 4IFYA 1RT1A 3OYDA 3DRSA 4BE1A 1SKWA 2HHTA 1RTJA 2D0CA 4R5PA 3L2WA 2YHBA 3K5OA 3SI6A 4K8ZA 2XY7A 4CHOA 4CJKA 1VSHA 2JLEA 4DF8A 5CYMA 2W42A 1IKWA 3QEPA 4KO0A 3K5NA 2Y1JA 3RR7A 4NCAA 3HM9A 3E01A 4DFJA 3IS9A 4FW2A 1HNIA 4IBNA 1IG9A 3AA4A 3I8DA 1X1PA 4JLHA 4DF4A 1YTAA 3NH2A 3P1GA 1A5VA 4HVJA 3OYIA 2P1JA 4DTPA 1LW2A 1LAVA 4MQ3A 5KTQA 1Z25A 3ZT1A 3OS2A 4FLUA 3HJFA 3NAEA 3TAPA 3AVBA 3IAYA 3AVNA 1QQCA 2VG6A 4AHUA 4FLYA 2BANA 3C94A 3DLGA 2ZE2A 1SKRA 4CEEA 3RMCA 2KZMA 4FLVA 3LPTA 3ZCMA 4KHWA 4PQUA 3VA0A 3KKRA 1XHXA 1L5UA 4B9LA 3SQ4A 1CXQA 4J2BA 2LSNA 3VQDA 4H4MA 3OS1A 4QAGA 1RBUA 1NOZA 4Q5VA 1D9DA 1BQMA 1RT4A 2KFZA 4Z0UA 4TSXA 3RR8A 3TR8A 4HTUA 4CGHA 4CF2A 4H4OA 2NUBA 4Y1CA 4H8KA 3TAFA 1TKXA 4DFKA 3B6OA 4KHSA 1FXXA 2JGUA 1ZBIA 3NFAA 3HVRA 4J2AA 4W5TA 2X6NA 4Z4EA 4CGJA 4GVMA 1BIUA 1TK5A 4FJKA 2ATQA 4DTNA 4M42A 4O0IA 3AA3A 2OPRA 1RT5A 4FJ5A 1S6QA 1HYSA 2AJQA 4CJ5A 5C25A 1ASUA 1TKDA 2R7YA 2HHWA 1NK9A 4E7JA 3FFIA 1FKOA 1JXBA 3C6UA 3HYFA 3M8PA 4CK2A 3QEIA 1XHZA 2F8SA 3KLGA 3SV3A 3QEVA 1GOBA 5J2MA 1C0TA 4KFBA 3PV8A 2YKNA 3NF8A 4FXDA 3KK1A 3LWMA 3O4NA 2BE2A 2P51A 4CEFA 1TKZA 4BE2A 2ZQBA 4NYFA 4E7KA 1A5XA 4LSLA 3MXMA 3AVFA 1WSJA 3SQ1A 5KRSA 2XY6A 1K6YA 2HB5A 4IDKA 3SNNA 3BGRA 3CG7A 3AO5A 2X6SA 4CGGA 4M3YA 3VQAA 2G8FA 4PY5A 4C8OA 3HSTB 3RMAA 4Z4GA 3V1RA 4ICLA 4DMNA 4M3ZA 4HUFA 3OYNA 5JS2A 3CYMA 3L8BA 2EHGA 3LP3A 4JRQA 1RTDA 4B9TA 4Z4IA 3F9KA 4XIUA 2PYJA 3LP0A 3LZIA 4DU1A 3DI6A 3V1OA 2PYLA 4FJ9A 4B3OA 3CFOA 2YNFA 3L3UA 4CESA 4GW6A 4BWMA 4FJLA 3NDKA 3DLKA 3EY1A 3LZJA 3RMDA 1T03A 4W5OA 3DLEA 1S6PA 4DSFA 4UQGA 3T1AA 3ITHA 1SV5A 1TVRA 1RBSA 3ZT2A 1IKYA 4YFUA 5HRSA 3V9ZA 1NJZA 5SZTA 3OYEA 2HNZA 1VK0A 4DG1A 1BGXT 3WNGA 3OYBA 1UWBA 4FM1A 3S3NA 2VWJA 2WOMA 4CJVA 1HNVA 2WONA 4OGEA 4NCBA 3VQCA 1HQUA 4E3SA 2KW4A 4ZTFA 1U45A 3KK3A 1JXEA 4B9UA 4IG0A 3O3FA 4F2SA 3CQ8A 3ZSOA 4M3TA 5I3UA 4RW6A 5D3GA 3SZ2A 3THVA 3VQ8A 4M45A 2DY4A 1C1AA 2QXFA 3DRPA 3M8SA 1NKCA 1VSDA 4FZXC 1HJRA 1RT2A 4W5NA 1JLBA 2QKBA 2D5RA 2D0BA 5HRPA 3V9UA 3CM5A 1VSIA 4CEQA 3L3VA 3HPHA 4DTSA 1TK8A 4M3UA 3TAEA 1C6VA 3LALA 3K5LA 1S1XA 3P5JA 4ZTJA 4EZ9A 1IO2A 1EP4A 1MU2A 2OPQA 2Z1JA 1GOCA 2E4LA 3NBPA 3RTVA 4LH5A 2G8UA 3OYMA 2DTUA 3V1QA 3TARA 3G10A 1KVAA 4RG8A 2OA8A 4M3RA 4AHRA 3P83D 4ELUA 3QLHA 3ISNC 4LY7A 3DM2A 3T19A 1TL3A 1SUQA 4E7HA 4DSLA 1RNHA 3AO4A 3OYAA 4JRPA 4DSJA 1KSPA 3DMJA 3U6FA 1U48A 3ZSZA 3TI0A 5KRTA 4CERA 1L3VA 3AVLA 4CEAA 2XRIA 4DSKA 3OYGA 4AHSA 4F4KA 1CLQA 1C1CA 1CZBA 1TAQA 1RDDA 5CZ2A 1KFSA 2B4JA 4I7FA 4PA1A 4CEZA 4CIEA 3PO4A 2EX3A 1RDBA 2FBTA 5J1EA 3NGZA 1XWLA 3DLHA 4K8XA 1RT3A 4E0DA 2ETJA 1WN7A 4FJGA 2GBZA 3G0ZA 1F21A 3NCIA 3SPYA 1BCMA 4FCYA 2PZSA 4LSNA 4N47A 1EKEA 4PUOA 4KHQA 4CK1A 4JS5A 1S5JA 3NH1A 4CHPA 2HW3A 1U47A 3KLHA 3DYAA 4FZZA 3D45A 2E6LA 4CHNA 1J5OA 1KLMA 4CECA 1LWEA 4DS5A 4IKFA 1NOYA 3HVTA 4CF1A 1JKHA 4RW4A 3PX4A 4KI6A 3NGIA 1NK0A 1S1TA 1DTQA 3QEXA 1NK8A 3KD1E 3MECA 4BWJA 1HYVA 4QCLA 2HHXA 2RPIA 3AVHA 3AVIA 4CHYA 5K14A 3AVCA 4M41A 4B9VA 1VSEA 1L3UA 1VRUA 3AA2A 1C1BA 4OGCA 4CJQA 3O3GA 4KI4A 3HT3A 3DOLA 4RW7A 3I0SA 4M3XA 4ID1A 1U49A 4FZYA 3ZSVA 4OKKA 4CJWA 4E19A 2F96A 4ELTA 5FRNA 4KRFA 1I39A 3T3FA 4KTQA 1VSFA 1NK5A 3AA5X 4CJLA 1JLFA 3PUFA 5J2PA 4N76A 4FYDA 1J9AA 4DTUA 4FM2A 1D9FA 2VWKA 3AVMA 3UIQA 4FJNA 1EXQA 3HP9A 3LWLA 4KB1A 1EX4A 2IOCA 4N5SA 3S9HA 3PO5A 4NCGA 5DMRA 3MAQA 2ZD1A 3ZSWA 3O3HA 1WSIA 4RW9A 1RCHA 3VQ5A 1YTUA 4F3OA 3NF9A 3EYZA 4BDPA 4B08A 4CJUA 3KLFA 3QNOA 3HL8A 4FLTA 3LAMA 2G8VA 2Z1GA 2ITGA 4B8CA 4HHTA 1KCFA 1CXUA 5HLFA 4ELVA 3MEEA 4KKOA 1Y97A 1WAFA 3VQEA 3V9SA 4KB0A 4YNQA 4J2DA 4QOZB 3ULDA 1C0UA 4DQIA 1NKBA 4DQRA 4HCBA 4OLBA 5KGWA 4CGFA 3ZSXA 2RN2A 4BE0A 3TANA 4DU4A 1QSSA 3SUOA 4C8KA 1NJXA 3NE6A 1FK9A 1KFDA 3SUNA 3ZSRA 1QE1A 2HHQA 1JLGA 3VQBA 1LW0A 1J53A 4HUEA 1B9FA 2X78A 4B8AB 4AHVA 2FBYA 4FM0A 4KTZA 4O4GA 5CZ1A 4CCHA 3QO9A 3JYTA 4DS4A 4PWDA 2Q3SA 4KHYA 1BQNA 1Z26A 1QSYA 3V9WA 3HPOA 1YT3A 4Y1DA 4IFVA 3U3YA 2A1SA 3V9XA 4FJJA 4DTOA 1S9GA 4C8MA 1L3SA 2KZZA 4LD0A 4EP5A 1Q9YA 4HCCA 4W5RA 1J54A 3OVNA 4KHNA 1ZBHA 2X74A 1HQEA 4FK0A 3V81A 3VA3A 3RWUA 3AO1A 2F8TA 3B6PA 3RRHA 4DSIA 2GUIA 4CJ4A 4DTXA 3QINA 1TAUA 1S1UA 3LAKA 4FK2A 4AHCA 1HMVA 1RBTA 1XC9A 3AO3A 5FROA 1BL3A 2XHBA 2HHUA 3PX6A 1WLJA 1NK7A 2YKMA 3NH0A 4O5BA 1SL1A 2KFNA 4BDZA 1U04A 4ID5A 3WNHA 4KTWA 3K59A 1ZYQA 1TGOA 3SYZA 4CGIA 3AVKA 2XO7A 3SJJA 4C8LA 4OVLA 1W9HA 4CE9A 1S1WA 3TAGA 4AHTA 1ASWA 2BGGA 4ZHRA 2HHSA 4KPYA 1UA1A 4I2PA 4L8RB 3K2PA 4E1NA 2VG5A 4FJXA 1BI4B 4EP4A 1RT7A 4OJRA 2QKKA 3DRRA 3CFRA 2XY8A 3O4QA 4CJTA 4E7LA 2Y1IA 2Z1IA 4I9LA 3OJUA 1WSFA 4DWIA 1WSHA 4CF0A 1VSLA 4DQSA 3KLIA 4N41A 1QHTA 2I5JA 3IRXA 2IS3A 3WNEA 1SL2A 4F8RA 3NGYA 3U3GA 1ZBUA 3RMBA 2DFHA 3M8RA 2QK9A 4IG3A 1IH7A 4FW1A 3VQ4A 2XY5A 4F2RA 4RW8A 2BDPA 2HVHA 2O4IA 3JSMA 1VSJA 3AV9A 4GMJB 4O0JA 5EU7A 5C24A 4KAZA 1JLEA 4W5QA 1BCOA 1S9EA 2HNDA 3AO2A 1IKXA 4AH9A 3I0RA 1I3AA 3QESA 3PX0A 1T05A 1HYZA 3VQQA 3V4IA 3LP1A 4CJ3A 3OYKA 4FK4A 1NJWA 1NJYA 2HHVA 1TK0A 4CJEA 4NYNA 1LV5A 4DSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G1Q A;  2YNI A;  4DTM A;  1VSK A;  3F73 A;  1T8E A;  3MEG A;  4CED A;  1JLQ A;  1KVB A;  1RBR A;  1GOA A;  1RBV A;  4CIF A;  3LP2 A;  5KI6 A;  1Q9X A;  2G8K A;  3HO1 A;  3ZT4 A;  4Z4C A;  3ZSY A;  1SKS A;  5CYQ A;  3NF7 A;  2O4G A;  5KGX A;  1KTQ A;  3OYL A;  2YNH A;  1NK4 A;  1RT6 A;  4FLW A;  1WSG A;  3SPZ A;  4LH4 A;  3PY8 A;  4OPK A;  3QIP A;  4CFA A;  1ITG A;  3DLR A;  1JLC A;  4BAC A;  1LWF A;  5J2Q A;  3LAN A;  1R0A A;  1L3T A;  3VQP A;  3TWH A;  1B9D A;  1DTT A;  1N6Q A;  2B5J A;  2B6A A;  3IG1 A;  2Z1H A;  4DLG A;  4CJS A;  4B9S A;  5T7B A;  4KHU A;  1X9S A;  2OZS A;  5C42 A;  1HPZ A;  3SV4 A;  4OPJ A;  1UA0 A;  3CM6 A;  1X9W A;  2FC0 A;  1T7P A;  3AVJ A;  5HRR A;  3EZ5 A;  5FRM A;  3TAM A;  4CHQ A;  3OYH A;  3RRG A;  1BI4 A;  4KRE A;  3OJS A;  1S1V A;  4CIG A;  1RTH A;  4BDY A;  1UAX A;  3TAB A;  3VQ9 A;  3QNN A;  4CJP A;  3MXI A;  1NK6 A;  3BDP A;  1JLA A;  4B9M A;  3SCX A;  3KD5 E;  1A5W A;  1VSM A;  3L2Q A;  4EZ6 A;  1RTI A;  4OKE A;  1O1W A;  2P5O A;  1HRH A;  1UOC A;  2IC3 A;  2OPP A;  4CJR A;  3VQ7 A;  3QIO A;  2HMI A;  3OYJ A;  4FLZ A;  3KJV A;  3ZSQ A;  1ZBF A;  5J2N A;  1RIL A;  3SQ2 A;  3HP6 A;  4Q0B A;  3A2F A;  5HP1 A;  3K5M A;  2OPS A;  3OY9 A;  4DQP A;  3VN5 A;  4DLE A;  2OYQ A;  4CGD A;  2HVI A;  1G15 A;  3NF6 A;  3M8Q A;  1FKP A;  4I9Q A;  4CJF A;  1LAW A;  5HRN A;  2OZM A;  4CHZ A;  5JS1 A;  4DFP A;  4FJ7 A;  2VG7 A;  4E89 A;  1D5A A;  5HRO A;  3S3O A;  1KVC A;  3OS0 A;  4DTJ A;  1QSL A;  4MFB A;  3ZT0 A;  3KLE A;  3KKS A;  2P5G A;  4FJI A;  2RF2 A;  3KK2 A;  4FVM A;  4DFM A;  3LDS A;  4OLA A;  4J2E A;  2IGI A;  1WSE A;  3AVG A;  1SL0 A;  1NKE A;  1EET A;  4JS4 A;  3OYC A;  2E6M A;  3SQ0 A;  1XI1 A;  1D8Y A;  1CZ9 A;  4E7I A;  2G8I A;  4CF9 A;  1WNS A;  4CFD A;  5SWM A;  3HXM A;  3WNF A;  2A1R A;  5DK5 A;  5E41 A;  1ASV A;  1TV6 A;  3LPU A;  3ASM A;  3NHG A;  4FJH A;  4CFB A;  4HUG A;  1X9M A;  5CY4 A;  2PY5 A;  1KRP A;  2FBX A;  3HPG A;  1U4B A;  3TAQ A;  4CEO A;  4FJM A;  1ZBL A;  2IAJ A;  1BIS A;  4CK3 A;  4O55 A;  3VQ6 A;  3K57 A;  1N5Y A;  5FDL A;  3OYF A;  4AIL C;  3HK2 A;  3DOK A;  1JL1 A;  3K58 A;  4Z4H A;  2YV0 X;  3C95 A;  3H08 A;  1RDA A;  3AVA A;  1YVU A;  2D0A A;  4OKJ A;  4CFC A;  4E1M A;  1QTM A;  4FJ8 A;  1LWC A;  3QER A;  1DLO A;  2HNY A;  2FBV A;  4O44 A;  3MED A;  3MXJ A;  1Q8I A;  1RDC A;  3L2R A;  1TKT A;  1WAJ A;  1TL1 A;  4KV8 A;  2YNG A;  1IKV A;  2GV9 A;  2KQ2 A;  4WE1 A;  4F3T A;  4N56 A;  1W0H A;  2DFE A;  4M3W A;  4DTR A;  4CF8 A;  2IDO A;  1REV A;  3CFP A;  2RKI A;  5I42 A;  1VRT A;  3L2V A;  2KTQ A;  3QEW A;  3V6D A;  4DQQ A;  1C0M A;  3QET A;  3C6T A;  4CEB A;  3SUP A;  3KIO A;  3KTQ A;  3ALY A;  4DU3 A;  5HBM A;  2YHA A;  1B92 A;  1BHL A;  1KLN A;  4Z4F A;  4I2Q A;  1QS4 A;  3SUQ A;  1JL2 A;  2DFF A;  3L2U A;  3D0P A;  3S3M A;  4C8N A;  2G8W A;  4B9N A;  1BIZ A;  3ZT3 A;  3DLB A;  2G8H A;  4FLX A;  4IFY A;  1RT1 A;  3OYD A;  3DRS A;  4BE1 A;  1SKW A;  2HHT A;  1RTJ A;  2D0C A;  4R5P A;  3L2W A;  2YHB A;  3K5O A;  3SI6 A;  4K8Z A;  2XY7 A;  4CHO A;  4CJK A;  1VSH A;  2JLE A;  4DF8 A;  5CYM A;  2W42 A;  1IKW A;  3QEP A;  4KO0 A;  3K5N A;  2Y1J A;  3RR7 A;  4NCA A;  3HM9 A;  3E01 A;  4DFJ A;  3IS9 A;  4FW2 A;  1HNI A;  4IBN A;  1IG9 A;  3AA4 A;  3I8D A;  1X1P A;  4JLH A;  4DF4 A;  1YTA A;  3NH2 A;  3P1G A;  1A5V A;  4HVJ A;  3OYI A;  2P1J A;  4DTP A;  1LW2 A;  1LAV A;  4MQ3 A;  5KTQ A;  1Z25 A;  3ZT1 A;  3OS2 A;  4FLU A;  3HJF A;  3NAE A;  3TAP A;  3AVB A;  3IAY A;  3AVN A;  1QQC A;  2VG6 A;  4AHU A;  4FLY A;  2BAN A;  3C94 A;  3DLG A;  2ZE2 A;  1SKR A;  4CEE A;  3RMC A;  2KZM A;  4FLV A;  3LPT A;  3ZCM A;  4KHW A;  4PQU A;  3VA0 A;  3KKR A;  1XHX A;  1L5U A;  4B9L A;  3SQ4 A;  1CXQ A;  4J2B A;  2LSN A;  3VQD A;  4H4M A;  3OS1 A;  4QAG A;  1RBU A;  1NOZ A;  4Q5V A;  1D9D A;  1BQM A;  1RT4 A;  2KFZ A;  4Z0U A;  4TSX A;  3RR8 A;  3TR8 A;  4HTU A;  4CGH A;  4CF2 A;  4H4O A;  2NUB A;  4Y1C A;  4H8K A;  3TAF A;  1TKX A;  4DFK A;  3B6O A;  4KHS A;  1FXX A;  2JGU A;  1ZBI A;  3NFA A;  3HVR A;  4J2A A;  4W5T A;  2X6N A;  4Z4E A;  4CGJ A;  4GVM A;  1BIU A;  1TK5 A;  4FJK A;  2ATQ A;  4DTN A;  4M42 A;  4O0I A;  3AA3 A;  2OPR A;  1RT5 A;  4FJ5 A;  1S6Q A;  1HYS A;  2AJQ A;  4CJ5 A;  5C25 A;  1ASU A;  1TKD A;  2R7Y A;  2HHW A;  1NK9 A;  4E7J A;  3FFI A;  1FKO A;  1JXB A;  3C6U A;  3HYF A;  3M8P A;  4CK2 A;  3QEI A;  1XHZ A;  2F8S A;  3KLG A;  3SV3 A;  3QEV A;  1GOB A;  5J2M A;  1C0T A;  4KFB A;  3PV8 A;  2YKN A;  3NF8 A;  4FXD A;  3KK1 A;  3LWM A;  3O4N A;  2BE2 A;  2P51 A;  4CEF A;  1TKZ A;  4BE2 A;  2ZQB A;  4NYF A;  4E7K A;  1A5X A;  4LSL A;  3MXM A;  3AVF A;  1WSJ A;  3SQ1 A;  5KRS A;  2XY6 A;  1K6Y A;  2HB5 A;  4IDK A;  3SNN A;  3BGR A;  3CG7 A;  3AO5 A;  2X6S A;  4CGG A;  4M3Y A;  3VQA A;  2G8F A;  4PY5 A;  4C8O A;  3HST B;  3RMA A;  4Z4G A;  3V1R A;  4ICL A;  4DMN A;  4M3Z A;  4HUF A;  3OYN A;  5JS2 A;  3CYM A;  3L8B A;  2EHG A;  3LP3 A;  4JRQ A;  1RTD A;  4B9T A;  4Z4I A;  3F9K A;  4XIU A;  2PYJ A;  3LP0 A;  3LZI A;  4DU1 A;  3DI6 A;  3V1O A;  2PYL A;  4FJ9 A;  4B3O A;  3CFO A;  2YNF A;  3L3U A;  4CES A;  4GW6 A;  4BWM A;  4FJL A;  3NDK A;  3DLK A;  3EY1 A;  3LZJ A;  3RMD A;  1T03 A;  4W5O A;  3DLE A;  1S6P A;  4DSF A;  4UQG A;  3T1A A;  3ITH A;  1SV5 A;  1TVR A;  1RBS A;  3ZT2 A;  1IKY A;  4YFU A;  5HRS A;  3V9Z A;  1NJZ A;  5SZT A;  3OYE A;  2HNZ A;  1VK0 A;  4DG1 A;  1BGX T;  3WNG A;  3OYB A;  1UWB A;  4FM1 A;  3S3N A;  2VWJ A;  2WOM A;  4CJV A;  1HNV A;  2WON A;  4OGE A;  4NCB A;  3VQC A;  1HQU A;  4E3S A;  2KW4 A;  4ZTF A;  1U45 A;  3KK3 A;  1JXE A;  4B9U A;  4IG0 A;  3O3F A;  4F2S A;  3CQ8 A;  3ZSO A;  4M3T A;  5I3U A;  4RW6 A;  5D3G A;  3SZ2 A;  3THV A;  3VQ8 A;  4M45 A;  2DY4 A;  1C1A A;  2QXF A;  3DRP A;  3M8S A;  1NKC A;  1VSD A;  4FZX C;  1HJR A;  1RT2 A;  4W5N A;  1JLB A;  2QKB A;  2D5R A;  2D0B A;  5HRP A;  3V9U A;  3CM5 A;  1VSI A;  4CEQ A;  3L3V A;  3HPH A;  4DTS A;  1TK8 A;  4M3U A;  3TAE A;  1C6V A;  3LAL A;  3K5L A;  1S1X A;  3P5J A;  4ZTJ A;  4EZ9 A;  1IO2 A;  1EP4 A;  1MU2 A;  2OPQ A;  2Z1J A;  1GOC A;  2E4L A;  3NBP A;  3RTV A;  4LH5 A;  2G8U A;  3OYM A;  2DTU A;  3V1Q A;  3TAR A;  3G10 A;  1KVA A;  4RG8 A;  2OA8 A;  4M3R A;  4AHR A;  3P83 D;  4ELU A;  3QLH A;  3ISN C;  4LY7 A;  3DM2 A;  3T19 A;  1TL3 A;  1SUQ A;  4E7H A;  4DSL A;  1RNH A;  3AO4 A;  3OYA A;  4JRP A;  4DSJ A;  1KSP A;  3DMJ A;  3U6F A;  1U48 A;  3ZSZ A;  3TI0 A;  5KRT A;  4CER A;  1L3V A;  3AVL A;  4CEA A;  2XRI A;  4DSK A;  3OYG A;  4AHS A;  4F4K A;  1CLQ A;  1C1C A;  1CZB A;  1TAQ A;  1RDD A;  5CZ2 A;  1KFS A;  2B4J A;  4I7F A;  4PA1 A;  4CEZ A;  4CIE A;  3PO4 A;  2EX3 A;  1RDB A;  2FBT A;  5J1E A;  3NGZ A;  1XWL A;  3DLH A;  4K8X A;  1RT3 A;  4E0D A;  2ETJ A;  1WN7 A;  4FJG A;  2GBZ A;  3G0Z A;  1F21 A;  3NCI A;  3SPY A;  1BCM A;  4FCY A;  2PZS A;  4LSN A;  4N47 A;  1EKE A;  4PUO A;  4KHQ A;  4CK1 A;  4JS5 A;  1S5J A;  3NH1 A;  4CHP A;  2HW3 A;  1U47 A;  3KLH A;  3DYA A;  4FZZ A;  3D45 A;  2E6L A;  4CHN A;  1J5O A;  1KLM A;  4CEC A;  1LWE A;  4DS5 A;  4IKF A;  1NOY A;  3HVT A;  4CF1 A;  1JKH A;  4RW4 A;  3PX4 A;  4KI6 A;  3NGI A;  1NK0 A;  1S1T A;  1DTQ A;  3QEX A;  1NK8 A;  3KD1 E;  3MEC A;  4BWJ A;  1HYV A;  4QCL A;  2HHX A;  2RPI A;  3AVH A;  3AVI A;  4CHY A;  5K14 A;  3AVC A;  4M41 A;  4B9V A;  1VSE A;  1L3U A;  1VRU A;  3AA2 A;  1C1B A;  4OGC A;  4CJQ A;  3O3G A;  4KI4 A;  3HT3 A;  3DOL A;  4RW7 A;  3I0S A;  4M3X A;  4ID1 A;  1U49 A;  4FZY A;  3ZSV A;  4OKK A;  4CJW A;  4E19 A;  2F96 A;  4ELT A;  5FRN A;  4KRF A;  1I39 A;  3T3F A;  4KTQ A;  1VSF A;  1NK5 A;  3AA5 X;  4CJL A;  1JLF A;  3PUF A;  5J2P A;  4N76 A;  4FYD A;  1J9A A;  4DTU A;  4FM2 A;  1D9F A;  2VWK A;  3AVM A;  3UIQ A;  4FJN A;  1EXQ A;  3HP9 A;  3LWL A;  4KB1 A;  1EX4 A;  2IOC A;  4N5S A;  3S9H A;  3PO5 A;  4NCG A;  5DMR A;  3MAQ A;  2ZD1 A;  3ZSW A;  3O3H A;  1WSI A;  4RW9 A;  1RCH A;  3VQ5 A;  1YTU A;  4F3O A;  3NF9 A;  3EYZ A;  4BDP A;  4B08 A;  4CJU A;  3KLF A;  3QNO A;  3HL8 A;  4FLT A;  3LAM A;  2G8V A;  2Z1G A;  2ITG A;  4B8C A;  4HHT A;  1KCF A;  1CXU A;  5HLF A;  4ELV A;  3MEE A;  4KKO A;  1Y97 A;  1WAF A;  3VQE A;  3V9S A;  4KB0 A;  4YNQ A;  4J2D A;  4QOZ B;  3ULD A;  1C0U A;  4DQI A;  1NKB A;  4DQR A;  4HCB A;  4OLB A;  5KGW A;  4CGF A;  3ZSX A;  2RN2 A;  4BE0 A;  3TAN A;  4DU4 A;  1QSS A;  3SUO A;  4C8K A;  1NJX A;  3NE6 A;  1FK9 A;  1KFD A;  3SUN A;  3ZSR A;  1QE1 A;  2HHQ A;  1JLG A;  3VQB A;  1LW0 A;  1J53 A;  4HUE A;  1B9F A;  2X78 A;  4B8A B;  4AHV A;  2FBY A;  4FM0 A;  4KTZ A;  4O4G A;  5CZ1 A;  4CCH A;  3QO9 A;  3JYT A;  4DS4 A;  4PWD A;  2Q3S A;  4KHY A;  1BQN A;  1Z26 A;  1QSY A;  3V9W A;  3HPO A;  1YT3 A;  4Y1D A;  4IFV A;  3U3Y A;  2A1S A;  3V9X A;  4FJJ A;  4DTO A;  1S9G A;  4C8M A;  1L3S A;  2KZZ A;  4LD0 A;  4EP5 A;  1Q9Y A;  4HCC A;  4W5R A;  1J54 A;  3OVN A;  4KHN A;  1ZBH A;  2X74 A;  1HQE A;  4FK0 A;  3V81 A;  3VA3 A;  3RWU A;  3AO1 A;  2F8T A;  3B6P A;  3RRH A;  4DSI A;  2GUI A;  4CJ4 A;  4DTX A;  3QIN A;  1TAU A;  1S1U A;  3LAK A;  4FK2 A;  4AHC A;  1HMV A;  1RBT A;  1XC9 A;  3AO3 A;  5FRO A;  1BL3 A;  2XHB A;  2HHU A;  3PX6 A;  1WLJ A;  1NK7 A;  2YKM A;  3NH0 A;  4O5B A;  1SL1 A;  2KFN A;  4BDZ A;  1U04 A;  4ID5 A;  3WNH A;  4KTW A;  3K59 A;  1ZYQ A;  1TGO A;  3SYZ A;  4CGI A;  3AVK A;  2XO7 A;  3SJJ A;  4C8L A;  4OVL A;  1W9H A;  4CE9 A;  1S1W A;  3TAG A;  4AHT A;  1ASW A;  2BGG A;  4ZHR A;  2HHS A;  4KPY A;  1UA1 A;  4I2P A;  4L8R B;  3K2P A;  4E1N A;  2VG5 A;  4FJX A;  1BI4 B;  4EP4 A;  1RT7 A;  4OJR A;  2QKK A;  3DRR A;  3CFR A;  2XY8 A;  3O4Q A;  4CJT A;  4E7L A;  2Y1I A;  2Z1I A;  4I9L A;  3OJU A;  1WSF A;  4DWI A;  1WSH A;  4CF0 A;  1VSL A;  4DQS A;  3KLI A;  4N41 A;  1QHT A;  2I5J A;  3IRX A;  2IS3 A;  3WNE A;  1SL2 A;  4F8R A;  3NGY A;  3U3G A;  1ZBU A;  3RMB A;  2DFH A;  3M8R A;  2QK9 A;  4IG3 A;  1IH7 A;  4FW1 A;  3VQ4 A;  2XY5 A;  4F2R A;  4RW8 A;  2BDP A;  2HVH A;  2O4I A;  3JSM A;  1VSJ A;  3AV9 A;  4GMJ B;  4O0J A;  5EU7 A;  5C24 A;  4KAZ A;  1JLE A;  4W5Q A;  1BCO A;  1S9E A;  2HND A;  3AO2 A;  1IKX A;  4AH9 A;  3I0R A;  1I3A A;  3QES A;  3PX0 A;  1T05 A;  1HYZ A;  3VQQ A;  3V4I A;  3LP1 A;  4CJ3 A;  3OYK A;  4FK4 A;  1NJW A;  1NJY A;  2HHV A;  1TK0 A;  4CJE A;  4NYN A;  1LV5 A;  4DSE A; 
#chains in the Genus database with same CATH topology
 5F0X A;  3JAM O;  2OAN A;  3F73 A;  1T8E A;  3CCS N;  2NZT A;  3CD6 N;  2YI1 A;  3NF7 A;  5I9E B;  4U7B A;  3U9D A;  4FLW A;  3SPZ A;  4LH4 A;  4CFA A;  3DLR A;  3M6G A;  1L3T A;  1L3U A;  1LWF A;  1KQS M;  2KHO A;  3FZM A;  3TWH A;  4B1W B;  5C2D A;  2B5J A;  2QI2 A;  3IG1 A;  3SAG A;  4DLG A;  4B9S A;  4LFB K;  2QWO A;  4KHU A;  3K0S A;  3VPZ A;  4NXN K;  2HF4 A;  1HPZ A;  1V4S A;  3TTC A;  2D0P A;  1X9W A;  1X3N A;  2FC0 A;  4MLE A;  1DEJ A;  3VEZ A;  1T7P A;  4BRC A;  3N4Q A;  3EZ5 A;  3OYH A;  1BI4 A;  1RTH A;  5BRF A;  1BA0 A;  2HF3 A;  3TAB A;  3VQ9 A;  4CJ7 A;  3UE5 A;  4B3M K;  4F9O A;  3CCU N;  1O1W A;  1HYS A;  4C23 A;  3QIO A;  5J2N A;  1ZBF A;  3HP6 A;  1IV0 A;  3BF3 A;  3THY B;  3VET A;  2HBK A;  4IWV A;  1FKP A;  1LAW A;  4CHZ A;  4ILH A;  5HRO A;  3GBT A;  1QSL A;  1XUP O;  2RF2 A;  4FVM A;  4FWN A;  4J2E A;  4NLB A;  1XI1 A;  3OYC A;  1D8Y A;  4E7I A;  3O4W A;  1WNS A;  4CFD A;  1FJG K;  5DK5 A;  1TV6 A;  4FJH A;  2NRR A;  3NHG A;  4HUG A;  1X9M A;  5CY4 A;  1KRP A;  2AP1 A;  3QFP A;  3KHY A;  1BIS A;  3U4L A;  5FDL A;  5LMU K;  5EVZ A;  3C95 A;  3H08 A;  1QTM A;  1RDA A;  4CFC A;  4BVO A;  4FOI A;  2FBV A;  4O44 A;  3MED A;  3VGM A;  1VAZ A;  3CJ1 A;  4GV6 A;  1TL1 A;  2GV9 A;  2V7Y A;  4CF8 A;  3FGU A;  2IDO A;  2P9K A;  3P38 A;  3TTD A;  3L2V A;  2KTQ A;  3V6D A;  5LJW A;  3QET A;  3C6T A;  5AQQ A;  3KTQ A;  3QIC A;  3CCQ N;  2YHA A;  1JL2 A;  2DFF A;  3D0P A;  4O8K A;  5M1Q A;  4C8N A;  3ZT3 A;  4CW7 B;  4NLC A;  1M90 O;  4JKE A;  1NGE A;  4BR5 A;  5GIP A;  3K5O A;  4BQL A;  2XY7 A;  4CHO A;  4CJK A;  5IT9 O;  5CYM A;  2W42 A;  3RR7 A;  5EOY A;  3K5N A;  3E01 A;  3IS9 A;  4FW2 A;  1HNI A;  1IG9 A;  4MO5 A;  3VF6 A;  2ZGY A;  4JLH A;  1YTA A;  4MDA A;  3P1G A;  2A6A A;  5JLH A;  1Z25 A;  3THX A;  4LC9 B;  1SKR A;  3LPT A;  4PQU A;  2QWL A;  4WQ4 A;  3SMP A;  1XHX A;  4KBO A;  2P9S B;  1L5U A;  1V4T A;  3C6A A;  3SQ4 A;  4B9L A;  4DV4 K;  4MO4 A;  2LSN A;  4FL9 A;  3IFR A;  2AA4 A;  1RBU A;  4Q5V A;  3RR8 A;  4CF2 A;  3LM9 A;  3VTI A;  4H8K A;  1TKX A;  2I7N A;  2QW9 A;  3VEY A;  4DUZ K;  1FXX A;  4W5T A;  2X6N A;  3KVG A;  3CF5 L;  2OPR A;  4FJ5 A;  1S6Q A;  2A5X A;  4BRE A;  4E7J A;  4NXM K;  3C6U A;  3HYF A;  3VEN A;  3KLG A;  3SV3 A;  1E4F T;  5AQU A;  4FXD A;  3KK1 A;  1GLA G;  2P51 A;  1VQ8 N;  2P9I B;  4CI6 A;  4LSL A;  3MXM A;  4BRL A;  3NVM A;  3SNN A;  3BGR A;  3CG7 A;  3AO5 A;  2X6S A;  3I55 N;  3L4I A;  3TSU A;  2P9L A;  1GLL O;  3HST B;  4ICL A;  4DMN A;  3OYN A;  2F4V K;  1OKJ A;  4IO9 L;  4XIU A;  3VES A;  4DU1 A;  4YHH K;  3DI6 A;  1ZXO A;  3IDH A;  1KAZ A;  4DKW A;  3L3U A;  4GW6 A;  3VEV A;  3H3O B;  1OH7 A;  3LZJ A;  3RMD A;  4YOR A;  4WFN L;  1VQL N;  2V7Z A;  1TVR A;  1RBS A;  3ZT2 A;  4YFU A;  1LOT B;  2E1Z A;  3S3N A;  1BGX T;  4IEI A;  4ZTF A;  4DV1 K;  2KW4 A;  4DR4 K;  5CE3 A;  3O3F A;  2NLX A;  4XH1 A;  4OX9 K;  4H0Y B;  3SZ2 A;  1ESV A;  5JVH L;  1C1A A;  4CZJ A;  3D7E O;  4FPB A;  1YAG A;  4BRD A;  1HLU A;  1HJR A;  3E9L A;  1JLB A;  4BGB A;  3I8B A;  4BRO A;  5HRP A;  4DTS A;  3F9M A;  1VSI A;  4CEQ A;  4BC5 A;  3TAE A;  5BRE A;  2OPQ A;  4LH5 A;  3ZLJ A;  3V1Q A;  1WOQ A;  2BUP A;  1HNZ K;  4LY7 A;  3QB0 A;  3DM2 A;  3VEO A;  4A59 A;  2ZWH A;  3E1Y A;  1SUQ A;  4E7H A;  4BRA A;  3AO4 A;  3A5L C;  2ASM A;  1KSP A;  3U6F A;  1U48 A;  3SMS A;  2OCE A;  3OYG A;  2HBM A;  1CLQ A;  1KFS A;  3GG4 A;  5AQJ A;  3R9P A;  4PA1 A;  4CIE A;  3NCI A;  1BCM A;  4H5R A;  2E2N A;  3CJB A;  4PUO A;  2A42 A;  1NWK A;  4IOA L;  5AR0 A;  4B1V A;  5LL6 Z;  2UU9 K;  3DYA A;  3D45 A;  2E6L A;  4CHN A;  1BG3 A;  4IKF A;  1NOY A;  2QWQ A;  3CJC A;  1JKH A;  1HPM A;  4CF1 A;  4EAH D;  3PX4 A;  4KI6 A;  1S1T A;  4I6M B;  1NK8 A;  1HYV A;  5C15 A;  3AVH A;  3AVI A;  3AVC A;  3AAP A;  1NGH A;  3CJ9 A;  4OGC A;  3O3G A;  3OA9 A;  4KI4 A;  3HT3 A;  3DOL A;  3I0S A;  3CHW A;  4ID1 A;  4FZY A;  4KRF A;  5FRN A;  2F96 A;  5KQ8 A;  4IJA A;  1I39 A;  1VSF A;  4A57 A;  3RSE B;  3MN5 A;  1QQM A;  4DTU A;  2IVO A;  1M1K O;  4FM2 A;  1D9F A;  3AVM A;  4J8F A;  3PO5 A;  4NCG A;  1WSI A;  3VQ5 A;  4GV3 A;  4B08 A;  3KLF A;  3MMV A;  4HHT A;  5HLF A;  4ELV A;  3VQE A;  1WAF A;  1X3M A;  2FF6 A;  3EN9 A;  4DQR A;  4BRN A;  5KGW A;  3ZSX A;  3MX2 A;  1NGA A;  1NGI A;  1KFD A;  3D2E B;  4ILG B;  3VQB A;  2X78 A;  4FVU A;  2V51 B;  4YOV A;  2H3G X;  5B8H A;  3PIO L;  2Q3S A;  3V9W A;  2W6K A;  4Y1D A;  3WUH A;  4JD2 A;  2A1S A;  4DV5 K;  3V9X A;  4FJJ A;  4PKI A;  1NG9 A;  1OH5 A;  1BDG A;  4LD0 A;  4KHN A;  1ZBH A;  4DQ8 A;  2HST A;  3RWU A;  1E3M A;  4DTX A;  4DR3 K;  3LAK A;  4FK2 A;  3U8X A;  3BUZ B;  1VQ4 N;  5FRO A;  4OO1 J;  3FLC O;  1N34 K;  2HHU A;  1WLJ A;  3BZC A;  4O8U A;  1NK7 A;  2YKM A;  3NH0 A;  1MDU B;  3WNH A;  3WXK A;  1ZYQ A;  3EE8 A;  2VWB A;  1SS6 A;  4BR9 A;  4CE9 A;  4AHT A;  4ZHR A;  4KPY A;  1NNE A;  3FZH A;  5KQD A;  5LMN K;  1W2B M;  3D2F A;  4CJT A;  2Z1I A;  4I9L A;  1WSH A;  2D0O A;  3DJC A;  3O9T A;  2IS3 A;  1OH6 A;  3RMB A;  3ZYY X;  3M8R A;  3JS6 A;  3ENH A;  3VQ4 A;  2HVH A;  3JSM A;  1Z6R A;  3AV9 A;  1QQO A;  1T05 A;  2PBD A;  1VQ9 N;  3LP1 A;  4CJ3 A;  5A2Q O;  4CZL A;  3T1H K;  2HHV A;  3OW2 M;  4QOZ B;  4DSE A;  3CPW M;  1VSK A;  1O13 A;  1NGB A;  1MA9 B;  2P9P B;  4U67 L;  1GOA A;  4CIF A;  3HO1 A;  1RFQ A;  4WFA L;  3ZT4 A;  1TYQ B;  3ULE B;  1SKS A;  5KGX A;  3OYL A;  3SAF A;  4OPK A;  1JLC A;  5J2Q A;  3LAN A;  3VQP A;  5BN9 A;  2RE2 A;  1YJW N;  3H46 O;  4CJS A;  4EFH A;  5T7B A;  2OZS A;  1UA0 A;  2PFU A;  4JKH A;  5AFU A;  5FRM A;  3B8A X;  4BG8 A;  3OJS A;  1S1V A;  3BDP A;  3HOS A;  4CJP A;  3QNN A;  3MXI A;  1JLA A;  3KD5 E;  3A8Y A;  1VSM A;  4IJN A;  2P5O A;  1HRH A;  2ZJR L;  2OPP A;  3VQ7 A;  3OYJ A;  1YHQ N;  4FLZ A;  3KJV A;  4Q0B A;  4A5B A;  1RIL A;  5AQG A;  3SQ2 A;  2OPS A;  3GOI A;  3OY9 A;  2O8F A;  4PL7 A;  2Q97 A;  3VN5 A;  5JLF A;  4H0O A;  4CGD A;  1G15 A;  3M8Q A;  4IDH A;  4X66 K;  5JS1 A;  4H5V A;  1ZBS A;  3TSP A;  5AJ3 K;  3S3O A;  4DTJ A;  3OS0 A;  3KLE A;  3KKS A;  4DFM A;  3LDS A;  3H1V X;  1WSE A;  3AVG A;  1NKE A;  1EET A;  2E6M A;  1TUU A;  1N8R O;  1CZ9 A;  4CF9 A;  4GVE A;  5SWM A;  1ASV A;  3LL3 A;  3J7Y P;  4LF9 K;  1GLF O;  4JNE A;  3AGR A;  2PY5 A;  5FLX O;  4JK7 A;  4CEO A;  1N5Y A;  4AIL C;  1HX1 A;  1IG8 A;  2Q31 A;  1YVU A;  1ZBI A;  3ZX3 A;  3QER A;  1DLO A;  3MXJ A;  1TKT A;  4B1Z A;  5E84 A;  4KHP K;  4F3T A;  4BR0 A;  5TKY A;  5FPN A;  4LF7 K;  1DT9 A;  2V52 B;  5LJV A;  4JKG B;  5BPN A;  5HBM A;  1B92 A;  1JCE A;  4Z4F A;  3CET A;  4I2Q A;  3SUQ A;  3S3M A;  2NNW A;  1BIZ A;  2YX6 A;  4FLX A;  3THW B;  3DRS A;  4H5W A;  3THY A;  3SI6 A;  2YHB A;  2UUC K;  4BY9 C;  1VSH A;  3H3N O;  4IXC A;  4DF8 A;  4DR6 K;  2VCP A;  1VQM N;  1IKW A;  3I33 A;  2CH5 A;  3HRG A;  3P31 A;  4DFJ A;  4PL8 A;  1Q18 A;  3IMX A;  1XMO K;  3I8D A;  1X1P A;  2D4W A;  4DF4 A;  1SQK A;  4X62 K;  3OS2 A;  2HMP A;  5AZJ B;  3NAE A;  3H6E A;  3IAY A;  3AVN A;  4B1U B;  4A2B A;  2E2Q A;  4YDU C;  4FLV A;  3VA0 A;  3KKR A;  4V19 S;  3J81 O;  4FWP A;  2Q1N A;  2PAV A;  3VQD A;  1CZA N;  1NOZ A;  1BQM A;  3TR8 A;  4CGH A;  1VQN N;  2NUB A;  4CZF A;  5ADX A;  4Y1C A;  3TAF A;  5AQP A;  5AQH A;  5KPZ A;  3C7N A;  1RDU A;  4JYA K;  4CGJ A;  4GVM A;  2ZJQ L;  4FJK A;  4BC2 A;  5C25 A;  2R7Y A;  1HKG A;  1NK9 A;  4B3S K;  4DR2 K;  3FFI A;  3JXU A;  3LDQ A;  4YY3 K;  1XHZ A;  4CK2 A;  3M8P A;  2F8S A;  5LY3 A;  3HOT A;  5J2M A;  1P90 A;  3NF8 A;  3SK3 A;  3O4N A;  4CEF A;  1TKZ A;  4BE2 A;  2ZQB A;  3MCA B;  1Z05 A;  1WSJ A;  5F2R A;  4CGG A;  4K43 A;  3VQA A;  4PY5 A;  4Z4G A;  3CYM A;  3L8B A;  2KLA A;  4JRQ A;  4B9T A;  3BF1 A;  1BWF O;  3LP0 A;  4IO8 A;  3V1O A;  4CES A;  1LCU A;  3CCJ N;  3EY1 A;  4UQG A;  3M5R A;  3LDO A;  3OYE A;  1D4X A;  4JHD A;  4JKA A;  4JI0 K;  4JI8 K;  4CJV A;  2WON A;  4OGE A;  1HQU A;  4E3S A;  4B9U A;  2WC9 A;  2ASO A;  4IG0 A;  4JI2 K;  3THV A;  2W6L A;  3M8S A;  1NKC A;  1RGI A;  3QML A;  4H0X B;  5EX5 A;  3D6R A;  1TK8 A;  3LAL A;  3DWL A;  4EZ9 A;  1IO2 A;  2Z1J A;  1Q81 O;  3NBP A;  3RTV A;  2G8U A;  3CCV N;  2DTU A;  4DV2 K;  3TAR A;  1NGD A;  3C0B A;  3M3Z A;  4ELU A;  3ISN C;  3T19 A;  4PKH A;  4FOE A;  3OYA A;  1T3V A;  4JRP A;  1NGG A;  2NRW A;  5KRT A;  4FWQ A;  4CER A;  3A5M C;  1R59 O;  2E2O A;  4F4K A;  3G25 A;  1TAQ A;  1RDD A;  5CZ2 A;  2CH6 A;  3NGZ A;  1RT3 A;  4E0D A;  1TUY A;  1YUW A;  3H45 C;  1F21 A;  4YOU A;  1EKE A;  4CK1 A;  4JS5 A;  4YOW A;  4PHT X;  2ITM A;  3J8A A;  4GV9 A;  4CZG A;  5KPR A;  3DXK B;  1LWE A;  4YOT A;  5BPM A;  3HVT A;  3SJH A;  3NGI A;  4GY2 B;  1DTQ A;  3QEX A;  3KD1 E;  2HHX A;  3MEC A;  4BWJ A;  4QCL A;  2RPI A;  3O08 A;  3VGK A;  1NBW A;  1C1B A;  3AA2 A;  5AQW A;  1K8K B;  4RW7 A;  1U49 A;  3VER A;  4OKK A;  3WEE A;  1DKG D;  4DR5 K;  5M1O A;  3AA5 X;  3PUF A;  1J9A A;  5DM6 L;  2VWK A;  3UIQ A;  4FJN A;  4N5S A;  1IJJ A;  3ZSW A;  4WYB A;  3F2K A;  1RCH A;  1YTU A;  2P9K B;  3FFK B;  1NJI O;  3HL8 A;  2OTJ N;  4FLT A;  2G8V A;  3J7A P;  3CXC M;  1CXU A;  1HNW K;  3HSC A;  4BGA A;  3MEE A;  4KB0 A;  4J2D A;  3ULD A;  1IBK K;  1I94 K;  2RN2 A;  3ATV A;  4DU4 A;  1C0F A;  1P8Z A;  1JLG A;  4H0P A;  5CR4 A;  4LF8 K;  4QS9 A;  4XH4 A;  4KTZ A;  3EL2 A;  2QA4 N;  4CBW A;  1VQK N;  3VOV A;  4I6M A;  3HBT A;  4K25 A;  3W3D A;  3EKU A;  1YT3 A;  3U3Y A;  1NGC A;  4C8M A;  2KZZ A;  1YJN N;  2A40 A;  4G9Z A;  3OVN A;  2X74 A;  1HQE A;  4DR7 K;  2F8T A;  3RRH A;  2GUI A;  2HBJ A;  3QIN A;  1S1U A;  3RSE A;  1KXP A;  1RBT A;  3AO3 A;  2QWM A;  4YOY A;  1BL3 A;  1YJ9 N;  4ILJ A;  2KFN A;  4BDZ A;  4ID5 A;  4KTW A;  3K59 A;  1TGO A;  3AVK A;  2XO7 A;  3SJJ A;  3ZX2 A;  4OVL A;  4E1J A;  1VHX A;  2BGG A;  1ASW A;  2WUS A;  3O9R A;  4I2P A;  3K2P A;  5EY4 A;  2VG5 A;  5IWA K;  3I56 N;  1RT7 A;  2XY8 A;  3VEW A;  3G4S N;  3O4Q A;  2Y1I A;  2QXL A;  1WSF A;  4CF0 A;  3CJ7 A;  3KLI A;  2I5J A;  1SL2 A;  3U3G A;  1ZBU A;  2CGJ A;  2DFH A;  3D2E A;  3MK6 A;  4Y0W A;  2XY5 A;  2GWK A;  4X65 K;  3O80 A;  5EU7 A;  1U2V B;  4W5Q A;  2HND A;  3I0R A;  1GLD G;  1I3A A;  3DXM B;  4QS8 A;  1HYZ A;  3Q7C A;  3L4Q A;  5GAE P;  4HWI A;  4AM7 A;  2FF3 B;  4NYN A;  4G1Q A;  2YNI A;  1T6D A;  4CD3 A;  2YJF A;  3E66 A;  3MEG A;  1JLQ A;  1KVB A;  2QWR A;  5KPT A;  1J5E K;  3LP2 A;  5KI6 A;  2O8C A;  2G8K A;  3ZSY A;  5CYQ A;  4CZI A;  1DGK N;  2O4G A;  1WSG A;  3CCL N;  1ITG A;  4BAC A;  4BQZ A;  2GEL A;  4H0T B;  3MWT A;  2W40 A;  2QEX N;  5H1S Q;  3CCR N;  2J4R A;  3HM8 A;  2Z1H A;  2NRT A;  1X9S A;  1HR0 K;  3SBT A;  5C42 A;  3CM6 A;  3AVJ A;  5HRR A;  4GKK K;  1EWR A;  3RVC A;  3TAM A;  4CHQ A;  2VQF K;  3OBW A;  4BDY A;  1UAX A;  1NK6 A;  3SCX A;  5E26 A;  3L2Q A;  4EZ6 A;  3A5O C;  5BPL A;  2HMI A;  3ZSQ A;  5HP1 A;  3K5M A;  4DQP A;  3UKR A;  4DLE A;  2HVI A;  5BR8 K;  3NF6 A;  2OZM A;  3F5T A;  4FJ7 A;  4C1N I;  2VG7 A;  4E89 A;  2P5G A;  4FJI A;  3SBG A;  4OLA A;  4JK9 A;  1QHA A;  4WCE L;  2IGI A;  3R8E A;  3SQ0 A;  3ID6 A;  1HJO A;  2P9P A;  2WFB A;  2A1R A;  3LPU A;  3ASM A;  4CFB A;  1TYQ A;  4CVN E;  3ULE A;  4IOC L;  4FJM A;  1HKC A;  3HPG A;  5EXW A;  3TAQ A;  3VQ6 A;  3K57 A;  4H0V B;  3QBX A;  3DOK A;  2YV0 X;  4OKJ A;  4FJ8 A;  2GUP A;  4LF5 K;  4FO0 A;  4GNI A;  3KK7 A;  4IZ9 A;  1Q8I A;  1WAJ A;  1JCG A;  2YNG A;  1W0H A;  2DFE A;  5JIC A;  3AAQ A;  4JI7 K;  4DTR A;  3T1Y K;  4MLH A;  2FSK A;  3CFP A;  2RKI A;  4FSV A;  3ZEU A;  1VRT A;  5BR9 A;  1C0M A;  1J6Z A;  3SUP A;  3KIO A;  3ALY A;  4DU3 A;  5C12 A;  3EO3 A;  4RWT A;  4B9N A;  2G8W A;  3KZB A;  4CD1 A;  2G8H A;  2HHT A;  2D0C A;  2HBL A;  4R5P A;  3FZK A;  4JAX A;  3K9J A;  3QEP A;  2Y1J A;  1S72 N;  5FPE A;  3HM9 A;  4BR4 A;  4IBN A;  3AA4 A;  1Q7Y O;  2D1K A;  3BEX A;  3CI5 A;  3OYI A;  1LW2 A;  3BZK A;  5KTQ A;  3E9P A;  3ZT1 A;  2F9T A;  3HJF A;  3VGL A;  4JN4 A;  3AVB A;  5AQF A;  1QQC A;  2VG6 A;  5M1F A;  2BAN A;  4JKF A;  3DLG A;  2ZE2 A;  4LFC K;  5BN8 A;  4J2B A;  4H4M A;  4QAG A;  1RT4 A;  2KFZ A;  4HTU A;  5M1K A;  3ATU A;  3EKS A;  4DFK A;  3B6O A;  2O8E A;  3HVR A;  1NGJ A;  4Z4E A;  1TK5 A;  5FPD A;  2ATQ A;  4M42 A;  4BRG A;  3AA3 A;  1RT5 A;  4JKG A;  5C10 A;  4JEP A;  2AJQ A;  3A0I X;  4CJ5 A;  1EWQ A;  3WXM B;  1ASU A;  2HHW A;  1YF5 L;  1FKO A;  1JXB A;  2NRV A;  3QEI A;  2QK9 A;  3QEV A;  1C0T A;  4PKG A;  4DB3 A;  3J7Z O;  3LWM A;  2HOE A;  1ILY A;  3O5B A;  1YIT N;  4AF1 A;  4E7K A;  1A5X A;  2XY6 A;  1K6Y A;  2HB5 A;  4IDK A;  3GE1 A;  4M3Y A;  5FPM A;  3TTF A;  2G8F A;  2IIR A;  4C8O A;  3V1R A;  4M3Z A;  4HUF A;  5JS2 A;  2EHG A;  3LP3 A;  5AZJ A;  1RTD A;  5AQM A;  4Z4I A;  4DCH A;  3LZI A;  2PYL A;  2QWN A;  3CFO A;  4JV5 K;  1ATS A;  2YNF A;  3G71 N;  4BWM A;  4FJL A;  3NDK A;  1T03 A;  1U6Z A;  3DLE A;  5AQZ A;  1S6P A;  2O8B B;  3ITH A;  1SV5 A;  4CZH A;  2E8A A;  1IKY A;  2UXC K;  3V9Z A;  3CER A;  1NGF A;  1NJZ A;  2UYT A;  1VK0 A;  4JKC A;  3L6Q A;  3WNG A;  4BG9 A;  1UWB A;  2O8D B;  4A61 A;  4M7X A;  3W0L A;  4HTL A;  4YDU A;  4NCB A;  3VQC A;  1U45 A;  3KK3 A;  1JXE A;  4M7Y A;  3A5N C;  1NLV A;  4F2S A;  3ZSO A;  5I3U A;  3ZET B;  5D3G A;  4MDB A;  3VQ8 A;  4M45 A;  5M1N A;  3CPE A;  1VSD A;  3O1W A;  4FZX C;  5AZI B;  4BRI A;  2D5R A;  2NRH A;  3MDQ A;  3E9O A;  3V9U A;  3O9Q A;  3GL1 A;  3L3V A;  4JI4 K;  2NRX A;  4UY8 O;  1C6V A;  3K5L A;  1S1X A;  4ZTJ A;  3VEX A;  4O5F A;  1MU2 A;  2P9N B;  3G10 A;  4ISE A;  4RG8 A;  5AQL A;  2OA8 A;  4M3R A;  2BH1 A;  4AHR A;  3MWP A;  4Z94 A;  3ENB A;  4FWL A;  4DSL A;  5ELZ A;  4M63 C;  4XH5 A;  3DMJ A;  3CC7 N;  3TI0 A;  1L3V A;  4CEA A;  4DSK A;  1VQP N;  4AHS A;  2ZJP L;  1NMN A;  4CBX A;  2B4J A;  4B1Y B;  4I7F A;  3PO4 A;  5J1E A;  1N36 K;  1XWL A;  3PSI A;  2ETJ A;  4FJG A;  2GBZ A;  4BR7 A;  4FCY A;  4IOX A;  2PZS A;  4WF9 L;  4FWS A;  3BP8 A;  4LSN A;  4N47 A;  4KHQ A;  2HW3 A;  1IBL K;  3P4I A;  4ISF A;  3O9S A;  4FZZ A;  1KLM A;  4DS5 A;  3J80 O;  3GDQ A;  1OVY A;  1NK0 A;  3ID8 A;  3EZW A;  4B9V A;  1VSE A;  4WFB L;  1VRU A;  4CZK A;  4CJQ A;  4LFA K;  4M3X A;  1HKB A;  4ELT A;  4CJW A;  1FW6 A;  3T3F A;  1QZ6 A;  1NK5 A;  4ISG A;  4N76 A;  3CMA N;  1JLF A;  5J2P A;  4FYD A;  3AAR A;  3TPQ A;  1EXQ A;  3HP9 A;  4KB1 A;  3FR0 A;  1EX4 A;  2IOC A;  3S9H A;  3WXI A;  5DMR A;  3MAQ A;  5AQI A;  3O3H A;  1QVG M;  3EYZ A;  3MN7 A;  4CJU A;  1QQN A;  2P9U B;  2Z1G A;  2ITG A;  1KAY A;  3H1Q A;  4B8C A;  1KCF A;  4BRH A;  3V9S A;  1NKB A;  4HCB A;  3O1B A;  4BE0 A;  1OVQ A;  4C8K A;  3SUO A;  3CIP A;  1FK9 A;  2P9S A;  3CJA A;  4WQ5 C;  3ZSR A;  3IKM A;  3SUN A;  2HHQ A;  1VQ6 N;  4FWO A;  1LW0 A;  4AQY K;  1J53 A;  4HUE A;  5AQO A;  4OPA A;  3IUC A;  2FBY A;  3UKU B;  4FM0 A;  5CZ1 A;  3DXK A;  4BRM A;  4CCH A;  3QO9 A;  1BQN A;  1Z26 A;  1T44 A;  3HPO A;  4RCH A;  4IEE A;  1XNQ K;  3PIP L;  2BTF A;  4IFV A;  4DTO A;  1S9G A;  3FZF A;  1L3S A;  4EP5 A;  1Q9Y A;  1K8K A;  4W5R A;  4HCC A;  2FXU A;  4FK0 A;  3V81 A;  3VA3 A;  3AO1 A;  1BUP A;  1X9J A;  3B6P A;  4FWM A;  4NB4 A;  1S3X A;  1TAU A;  3KWG A;  1Q82 O;  1W7A A;  1HMV A;  3MCP A;  1ATR A;  2P9I A;  2XHB A;  3CC4 N;  4BRQ A;  3C7N B;  3SYZ A;  4C8L A;  1EO1 A;  2FSJ A;  2HHS A;  2VGM A;  1G99 A;  3HZ6 A;  1UA1 A;  4E1N A;  4FJX A;  1BI4 B;  2YHX A;  3DLL L;  4OJR A;  3O6W A;  4E7L A;  1SAZ A;  3P39 A;  4DWI A;  2WBN A;  4DQS A;  3IRX A;  4F8R A;  4XEI A;  4B3R K;  4IG3 A;  1IH7 A;  3BY5 A;  1GLC G;  2BDP A;  2YHY A;  1VSJ A;  4GMJ B;  4L3Q A;  4KAZ A;  3QES A;  3PX0 A;  3VF2 A;  4FK4 A;  3EEQ A;  1NJY A;  1TK0 A;  1GLE G;  4CJE A;  1LV5 A;  5BRH A;  4DTM A;  1VQ5 N;  4CED A;  2I7P A;  4QS7 A;  1RBR A;  1RBV A;  5MLC Q;  3NVK A;  3U9Z A;  1Q9X A;  4Z4C A;  1RDW X;  3WXL A;  1KTQ A;  2YNH A;  1NK4 A;  1YVN A;  1RT6 A;  3PY8 A;  3QIP A;  5HOO A;  4JHD B;  4FWK A;  1R0A A;  1MWM A;  1B9D A;  1DTT A;  1N6Q A;  2B6A A;  4BRF A;  4KH4 A;  4CZM A;  2Q2R A;  3SAH A;  3SV4 A;  1NU0 A;  3SLC A;  4OPJ A;  4RTF D;  1WBD A;  5AQS A;  2ZM6 K;  3RRG A;  4KRE A;  1E4G T;  4CIG A;  4K41 A;  4B9M A;  3M1F A;  3R6M A;  1A5W A;  4NO7 A;  2IVN A;  1BA1 A;  1RTI A;  4OKE A;  1UOC A;  2IC3 A;  4CJR A;  2F9W A;  3A2F A;  4BRP A;  2OYQ A;  4I9Q A;  4CJF A;  1XMQ K;  4H5T A;  5M1P A;  5HRN A;  1U2V A;  4A62 A;  2HHH K;  2UUB K;  4DFP A;  4WQ4 C;  3DXM A;  1D5A A;  1KVC A;  3CCE N;  4MFB A;  3ZT0 A;  3KK2 A;  3MN6 A;  1SL0 A;  1K8A O;  4JS4 A;  1MWK A;  5GIO A;  2G8I A;  2YJE A;  4LF4 K;  3HXM A;  3WNF A;  5TKW A;  5E41 A;  1N33 K;  3THX B;  1VQO N;  3PSF A;  2FBX A;  1U4B A;  1ZBL A;  2IAJ A;  4CK3 A;  4O55 A;  3OYF A;  3HK2 A;  3K58 A;  1JL1 A;  4Z4H A;  4E1M A;  2D0A A;  3AVA A;  3T69 A;  1LWC A;  3R3L A;  2HNY A;  1K9M O;  3L2R A;  1RDC A;  3EE9 A;  3VF4 A;  4KV8 A;  1IKV A;  2KQ2 A;  1NMD A;  3QBW A;  4WE1 A;  4A5A A;  4N56 A;  4LF6 K;  4M3W A;  3OBY A;  1REV A;  5I42 A;  3QEW A;  4DQQ A;  4B3T K;  3CME N;  4CEB A;  3OTO K;  3LDP A;  1KLN A;  1BHL A;  3K9K A;  1QS4 A;  3L2U A;  3WEE B;  3DLB A;  4IFY A;  1RT1 A;  3OYD A;  4BE1 A;  1SKW A;  1RTJ A;  3L2W A;  4K8Z A;  2FLO A;  2Q0R A;  3CQY A;  2JLE A;  4JKB A;  4KO0 A;  4NCA A;  4C1N K;  5AQY A;  3MN9 A;  2P9L B;  4BC4 A;  3NH2 A;  4HVJ A;  1A5V A;  4DTP A;  2P1J A;  1LAV A;  4MQ3 A;  4FLU A;  3WT0 A;  3TAP A;  3QDK A;  2WTU A;  4FPA A;  4AHU A;  4FLY A;  1WBB A;  3LDL A;  3C94 A;  4H5N A;  4CEE A;  3RMC A;  2KZM A;  2Q36 A;  1WB9 A;  3C6H A;  2VYP A;  3ZCM A;  4KHW A;  1ZC6 A;  2RHK A;  1CXQ A;  3AY9 A;  4FWR A;  3C65 A;  1JJ2 M;  3OS1 A;  3O8M A;  1GLJ O;  1D9D A;  3ENO A;  4Z0U A;  4TSX A;  4H4O A;  4KHS A;  5AQT A;  2JGU A;  3NFA A;  2GTD A;  4J2A A;  1BIU A;  4BC3 A;  4DTN A;  4O0I A;  2E88 A;  3Q7B A;  1TKD A;  2UXB K;  1VQ7 N;  1S22 A;  1GOB A;  4KFB A;  3PV8 A;  3QFU A;  3FZL A;  2YKN A;  2BE2 A;  3WXJ A;  3CCM N;  4X64 K;  5BRD A;  4NYF A;  1BO5 O;  3AVF A;  4IFE A;  3SQ1 A;  5KRS A;  4K0K K;  1OH8 A;  4B9Q A;  5F1X A;  3RMA A;  1QVF M;  2JWL A;  3UB5 A;  4DUY K;  3F9K A;  2PYJ A;  4B3O A;  4FJ9 A;  3HI0 A;  1N32 K;  3HTV A;  4EHU A;  3N4P A;  4DR1 K;  3DLK A;  4W5O A;  2E1Y A;  2JWK A;  4DSF A;  3T1A A;  5AFU H;  5HRS A;  5SZT A;  4FM1 A;  2HNZ A;  4DG1 A;  5GIN A;  3OYB A;  3MX5 A;  2VWJ A;  1YI2 N;  1YXQ A;  2WOM A;  1HUX A;  1HNV A;  3WQT A;  2E2P A;  3CQ8 A;  4M3T A;  4RW6 A;  5AQN A;  2DY4 A;  3DRP A;  2QXF A;  3R1X A;  5GAH P;  1RT2 A;  2E5L K;  4W5N A;  3LDN A;  2QKB A;  1BU6 O;  1T6C A;  2D0B A;  5AQX A;  3CM5 A;  4M3U A;  2O8C B;  3HPH A;  2NRZ A;  2ASP A;  3P5J A;  4CZE A;  1BOT O;  1EP4 A;  1GOC A;  2ZGZ A;  2E4L A;  1XC3 A;  4DV3 K;  5AQV A;  3OYM A;  1IBM K;  1KVA A;  3G6E N;  3P83 D;  3QLH A;  1TL3 A;  3CQX A;  1RNH A;  4JI5 K;  2VGN A;  4DSJ A;  3KWI A;  3ZSZ A;  4AM6 A;  3ZX0 A;  3AVL A;  2XRI A;  1KD1 O;  5GAD P;  3OHR A;  1GLB G;  1W97 L;  1C1C A;  1CZB A;  4CEZ A;  2EX3 A;  3AGK A;  1RDB A;  2FBT A;  4B1X B;  3DLH A;  4K8X A;  2O8B A;  1WN7 A;  3G0Z A;  3SPY A;  2IVP A;  5DM7 L;  1EQY A;  3UKR B;  2F7T A;  1S5J A;  3NH1 A;  2O8D A;  4JKD A;  4CHP A;  1U47 A;  3KLH A;  1JCF A;  3NMU A;  1J5O A;  4CEC A;  3TU5 A;  1NM1 A;  1XQS C;  2CGL A;  1HNX K;  4RW4 A;  4OPH A;  2ZF5 O;  3ZET A;  4DHY A;  3O9U A;  4JD2 B;  5AZI A;  5K14 A;  4M41 A;  2QWP A;  4CHY A;  3FE1 A;  2QTD A;  2UUA K;  2YHW A;  1K73 O;  3VTH A;  4GKJ K;  3ZSV A;  4E19 A;  4KTQ A;  3TSQ A;  2P9N A;  3THW A;  2DPN A;  2CGK A;  4CJL A;  4EHT A;  2YCH A;  3LWL A;  3T7Z A;  2ZD1 A;  4DV7 K;  4JI3 K;  4RW9 A;  4F3O A;  3NF9 A;  4BDP A;  1SZ2 A;  3ZEU B;  3QNO A;  3LAM A;  4DV0 K;  1KAX A;  4BRK A;  4KKO A;  1Y97 A;  4R79 A;  4YNQ A;  1C0U A;  4DV6 K;  3D2F B;  3S41 A;  4DQI A;  4OLB A;  5ADX H;  4CGF A;  3TAN A;  1QZ5 A;  1QSS A;  3VMF B;  1NJX A;  1ATN A;  3NE6 A;  3L0Q A;  1QE1 A;  4CBU A;  3CC2 N;  4H03 B;  1B9F A;  4B8A B;  5GAG P;  4AHV A;  3WQU A;  4O4G A;  2GX9 A;  4BR2 A;  3JYT A;  4DS4 A;  4PWD A;  3PLA A;  4KHY A;  1QSY A;  2GWJ A;  1Y64 A;  5CHI A;  4KH6 A;  2Q0U A;  2FSN A;  2W41 A;  5AQR A;  2A3Z A;  4YOX A;  1J54 A;  2QM1 A;  5AQK A;  1H1V A;  4DSI A;  4CJ4 A;  5C0Y A;  2KKZ A;  4AHC A;  1XC9 A;  1WUA A;  4KH5 A;  4K42 A;  1KC8 O;  3PX6 A;  4O5B A;  1YIJ N;  1SL1 A;  1U04 A;  4BVP A;  4EIA A;  2O8E B;  1C0G A;  4CGI A;  4JI6 K;  2E20 A;  1W9H A;  2UXD K;  1S1W A;  3TAG A;  2P9U A;  5JMV A;  2GEM A;  4L8R B;  1XNR K;  1Q86 O;  4A2A A;  4EP4 A;  2QKK A;  3DRR A;  3CFR A;  2EWS A;  4JK8 A;  3OJU A;  2A41 A;  1VSL A;  4N41 A;  1QHT A;  3WNE A;  3NGY A;  5HL7 L;  4FW1 A;  5JVG L;  2O8F B;  4F2R A;  4RW8 A;  2O4I A;  3UKU A;  4O0J A;  4JI1 K;  5C24 A;  1JLE A;  1BCO A;  1S9E A;  3AO2 A;  4AH9 A;  1IKX A;  2OTL N;  3VQQ A;  3V4I A;  3OYK A;  3DAW A;  1NJW A;  3LM2 A;  5C2F A;  2VQE K;  4WQ5 A; 
#chains in the Genus database with same CATH homology
 4G1Q A;  2YNI A;  4DTM A;  1VSK A;  3F73 A;  1T8E A;  3MEG A;  4CED A;  1JLQ A;  1KVB A;  1RBR A;  1GOA A;  1RBV A;  4CIF A;  3LP2 A;  5KI6 A;  1Q9X A;  2G8K A;  3HO1 A;  3ZT4 A;  4Z4C A;  3ZSY A;  1SKS A;  5CYQ A;  3NF7 A;  2O4G A;  5KGX A;  1KTQ A;  3OYL A;  2YNH A;  1NK4 A;  1RT6 A;  4FLW A;  1WSG A;  3SPZ A;  4LH4 A;  3PY8 A;  4OPK A;  3QIP A;  4CFA A;  1ITG A;  3DLR A;  1JLC A;  4BAC A;  1LWF A;  5J2Q A;  3LAN A;  1R0A A;  1L3T A;  3VQP A;  3TWH A;  1B9D A;  1DTT A;  1N6Q A;  2B5J A;  2B6A A;  3IG1 A;  2Z1H A;  4DLG A;  4CJS A;  4B9S A;  5T7B A;  4KHU A;  1X9S A;  2OZS A;  5C42 A;  1HPZ A;  3SV4 A;  4OPJ A;  1UA0 A;  3CM6 A;  1X9W A;  2FC0 A;  1T7P A;  3AVJ A;  5HRR A;  3EZ5 A;  5FRM A;  3TAM A;  4CHQ A;  3OYH A;  3RRG A;  1BI4 A;  4KRE A;  3OJS A;  1S1V A;  4CIG A;  1RTH A;  4BDY A;  1UAX A;  3TAB A;  3VQ9 A;  3QNN A;  4CJP A;  3MXI A;  1NK6 A;  3BDP A;  1JLA A;  4B9M A;  3SCX A;  3KD5 E;  1A5W A;  1VSM A;  3L2Q A;  4EZ6 A;  1RTI A;  4OKE A;  1O1W A;  2P5O A;  1HRH A;  1UOC A;  2IC3 A;  2OPP A;  4CJR A;  3VQ7 A;  3QIO A;  2HMI A;  3OYJ A;  4FLZ A;  3KJV A;  3ZSQ A;  1ZBF A;  5J2N A;  1RIL A;  3SQ2 A;  3HP6 A;  4Q0B A;  3A2F A;  5HP1 A;  3K5M A;  2OPS A;  3OY9 A;  4DQP A;  3VN5 A;  4DLE A;  2OYQ A;  4CGD A;  2HVI A;  1G15 A;  3NF6 A;  3M8Q A;  1FKP A;  4I9Q A;  4CJF A;  1LAW A;  5HRN A;  2OZM A;  4CHZ A;  5JS1 A;  4DFP A;  4FJ7 A;  2VG7 A;  4E89 A;  1D5A A;  5HRO A;  3S3O A;  1KVC A;  3OS0 A;  4DTJ A;  1QSL A;  4MFB A;  3ZT0 A;  3KLE A;  3KKS A;  2P5G A;  4FJI A;  2RF2 A;  3KK2 A;  4FVM A;  4DFM A;  3LDS A;  4OLA A;  4J2E A;  2IGI A;  1WSE A;  3AVG A;  1SL0 A;  1NKE A;  1EET A;  4JS4 A;  3OYC A;  2E6M A;  3SQ0 A;  1XI1 A;  1D8Y A;  1CZ9 A;  4E7I A;  2G8I A;  4CF9 A;  1WNS A;  4CFD A;  5SWM A;  3HXM A;  3WNF A;  2A1R A;  5DK5 A;  5E41 A;  1ASV A;  1TV6 A;  3LPU A;  3ASM A;  3NHG A;  4FJH A;  4CFB A;  4HUG A;  1X9M A;  5CY4 A;  2PY5 A;  1KRP A;  2FBX A;  3HPG A;  1U4B A;  3TAQ A;  4CEO A;  4FJM A;  1ZBL A;  2IAJ A;  1BIS A;  4CK3 A;  4O55 A;  3VQ6 A;  3K57 A;  1N5Y A;  5FDL A;  3OYF A;  4AIL C;  3HK2 A;  3DOK A;  1JL1 A;  3K58 A;  4Z4H A;  2YV0 X;  3C95 A;  3H08 A;  1RDA A;  3AVA A;  1YVU A;  2D0A A;  4OKJ A;  4CFC A;  4E1M A;  1QTM A;  4FJ8 A;  1LWC A;  3QER A;  1DLO A;  2HNY A;  2FBV A;  4O44 A;  3MED A;  3MXJ A;  1Q8I A;  1RDC A;  3L2R A;  1TKT A;  1WAJ A;  1TL1 A;  4KV8 A;  2YNG A;  1IKV A;  2GV9 A;  2KQ2 A;  4WE1 A;  4F3T A;  4N56 A;  1W0H A;  2DFE A;  4M3W A;  4DTR A;  4CF8 A;  2IDO A;  1REV A;  3CFP A;  2RKI A;  5I42 A;  1VRT A;  3L2V A;  2KTQ A;  3QEW A;  3V6D A;  4DQQ A;  1C0M A;  3QET A;  3C6T A;  4CEB A;  3SUP A;  3KIO A;  3KTQ A;  3ALY A;  4DU3 A;  5HBM A;  2YHA A;  1B92 A;  1BHL A;  1KLN A;  4Z4F A;  4I2Q A;  1QS4 A;  3SUQ A;  1JL2 A;  2DFF A;  3L2U A;  3D0P A;  3S3M A;  4C8N A;  2G8W A;  4B9N A;  1BIZ A;  3ZT3 A;  3DLB A;  2G8H A;  4FLX A;  4IFY A;  1RT1 A;  3OYD A;  3DRS A;  4BE1 A;  1SKW A;  2HHT A;  1RTJ A;  2D0C A;  4R5P A;  3L2W A;  2YHB A;  3K5O A;  3SI6 A;  4K8Z A;  2XY7 A;  4CHO A;  4CJK A;  1VSH A;  2JLE A;  4DF8 A;  5CYM A;  2W42 A;  1IKW A;  3QEP A;  4KO0 A;  3K5N A;  2Y1J A;  3RR7 A;  4NCA A;  3HM9 A;  3E01 A;  4DFJ A;  3IS9 A;  4FW2 A;  1HNI A;  4IBN A;  1IG9 A;  3AA4 A;  3I8D A;  1X1P A;  4JLH A;  4DF4 A;  1YTA A;  3NH2 A;  3P1G A;  1A5V A;  4HVJ A;  3OYI A;  2P1J A;  4DTP A;  1LW2 A;  1LAV A;  4MQ3 A;  5KTQ A;  1Z25 A;  3ZT1 A;  3OS2 A;  4FLU A;  3HJF A;  3NAE A;  3TAP A;  3AVB A;  3IAY A;  3AVN A;  1QQC A;  2VG6 A;  4AHU A;  4FLY A;  2BAN A;  3C94 A;  3DLG A;  2ZE2 A;  1SKR A;  4CEE A;  3RMC A;  2KZM A;  4FLV A;  3LPT A;  3ZCM A;  4KHW A;  4PQU A;  3VA0 A;  3KKR A;  1XHX A;  1L5U A;  4B9L A;  3SQ4 A;  1CXQ A;  4J2B A;  2LSN A;  3VQD A;  4H4M A;  3OS1 A;  4QAG A;  1RBU A;  1NOZ A;  4Q5V A;  1D9D A;  1BQM A;  1RT4 A;  2KFZ A;  4Z0U A;  4TSX A;  3RR8 A;  3TR8 A;  4HTU A;  4CGH A;  4CF2 A;  4H4O A;  2NUB A;  4Y1C A;  4H8K A;  3TAF A;  1TKX A;  4DFK A;  3B6O A;  4KHS A;  1FXX A;  2JGU A;  1ZBI A;  3NFA A;  3HVR A;  4J2A A;  4W5T A;  2X6N A;  4Z4E A;  4CGJ A;  4GVM A;  1BIU A;  1TK5 A;  4FJK A;  2ATQ A;  4DTN A;  4M42 A;  4O0I A;  3AA3 A;  2OPR A;  1RT5 A;  4FJ5 A;  1S6Q A;  1HYS A;  2AJQ A;  4CJ5 A;  5C25 A;  1ASU A;  1TKD A;  2R7Y A;  2HHW A;  1NK9 A;  4E7J A;  3FFI A;  1FKO A;  1JXB A;  3C6U A;  3HYF A;  3M8P A;  4CK2 A;  3QEI A;  1XHZ A;  2F8S A;  3KLG A;  3SV3 A;  3QEV A;  1GOB A;  5J2M A;  1C0T A;  4KFB A;  3PV8 A;  2YKN A;  3NF8 A;  4FXD A;  3KK1 A;  3LWM A;  3O4N A;  2BE2 A;  2P51 A;  4CEF A;  1TKZ A;  4BE2 A;  2ZQB A;  4NYF A;  4E7K A;  1A5X A;  4LSL A;  3MXM A;  3AVF A;  1WSJ A;  3SQ1 A;  5KRS A;  2XY6 A;  1K6Y A;  2HB5 A;  4IDK A;  3SNN A;  3BGR A;  3CG7 A;  3AO5 A;  2X6S A;  4CGG A;  4M3Y A;  3VQA A;  2G8F A;  4PY5 A;  4C8O A;  3HST B;  3RMA A;  4Z4G A;  3V1R A;  4ICL A;  4DMN A;  4M3Z A;  4HUF A;  3OYN A;  5JS2 A;  3CYM A;  3L8B A;  2EHG A;  3LP3 A;  4JRQ A;  1RTD A;  4B9T A;  4Z4I A;  3F9K A;  4XIU A;  2PYJ A;  3LP0 A;  3LZI A;  4DU1 A;  3DI6 A;  3V1O A;  2PYL A;  4FJ9 A;  4B3O A;  3CFO A;  2YNF A;  3L3U A;  4CES A;  4GW6 A;  4BWM A;  4FJL A;  3NDK A;  3DLK A;  3EY1 A;  3LZJ A;  3RMD A;  1T03 A;  4W5O A;  3DLE A;  1S6P A;  4DSF A;  4UQG A;  3T1A A;  3ITH A;  1SV5 A;  1TVR A;  1RBS A;  3ZT2 A;  1IKY A;  4YFU A;  5HRS A;  3V9Z A;  1NJZ A;  5SZT A;  3OYE A;  2HNZ A;  1VK0 A;  4DG1 A;  1BGX T;  3WNG A;  3OYB A;  1UWB A;  4FM1 A;  3S3N A;  2VWJ A;  2WOM A;  4CJV A;  1HNV A;  2WON A;  4OGE A;  4NCB A;  3VQC A;  1HQU A;  4E3S A;  2KW4 A;  4ZTF A;  1U45 A;  3KK3 A;  1JXE A;  4B9U A;  4IG0 A;  3O3F A;  4F2S A;  3CQ8 A;  3ZSO A;  4M3T A;  5I3U A;  4RW6 A;  5D3G A;  3SZ2 A;  3THV A;  3VQ8 A;  4M45 A;  2DY4 A;  1C1A A;  2QXF A;  3DRP A;  3M8S A;  1NKC A;  1VSD A;  4FZX C;  1HJR A;  1RT2 A;  4W5N A;  1JLB A;  2QKB A;  2D5R A;  2D0B A;  5HRP A;  3V9U A;  3CM5 A;  1VSI A;  4CEQ A;  3L3V A;  3HPH A;  4DTS A;  1TK8 A;  4M3U A;  3TAE A;  1C6V A;  3LAL A;  3K5L A;  1S1X A;  3P5J A;  4ZTJ A;  4EZ9 A;  1IO2 A;  1EP4 A;  1MU2 A;  2OPQ A;  2Z1J A;  1GOC A;  2E4L A;  3NBP A;  3RTV A;  4LH5 A;  2G8U A;  3OYM A;  2DTU A;  3V1Q A;  3TAR A;  3G10 A;  1KVA A;  4RG8 A;  2OA8 A;  4M3R A;  4AHR A;  3P83 D;  4ELU A;  3QLH A;  3ISN C;  4LY7 A;  3DM2 A;  3T19 A;  1TL3 A;  1SUQ A;  4E7H A;  4DSL A;  1RNH A;  3AO4 A;  3OYA A;  4JRP A;  4DSJ A;  1KSP A;  3DMJ A;  3U6F A;  1U48 A;  3ZSZ A;  3TI0 A;  5KRT A;  4CER A;  1L3V A;  3AVL A;  4CEA A;  2XRI A;  4DSK A;  3OYG A;  4AHS A;  4F4K A;  1CLQ A;  1C1C A;  1CZB A;  1TAQ A;  1RDD A;  5CZ2 A;  1KFS A;  2B4J A;  4I7F A;  4PA1 A;  4CEZ A;  4CIE A;  3PO4 A;  2EX3 A;  1RDB A;  2FBT A;  5J1E A;  3NGZ A;  1XWL A;  3DLH A;  4K8X A;  1RT3 A;  4E0D A;  2ETJ A;  1WN7 A;  4FJG A;  2GBZ A;  3G0Z A;  1F21 A;  3NCI A;  3SPY A;  1BCM A;  4FCY A;  2PZS A;  4LSN A;  4N47 A;  1EKE A;  4PUO A;  4KHQ A;  4CK1 A;  4JS5 A;  1S5J A;  3NH1 A;  4CHP A;  2HW3 A;  1U47 A;  3KLH A;  3DYA A;  4FZZ A;  3D45 A;  2E6L A;  4CHN A;  1J5O A;  1KLM A;  4CEC A;  1LWE A;  4DS5 A;  4IKF A;  1NOY A;  3HVT A;  4CF1 A;  1JKH A;  4RW4 A;  3PX4 A;  4KI6 A;  3NGI A;  1NK0 A;  1S1T A;  1DTQ A;  3QEX A;  1NK8 A;  3KD1 E;  3MEC A;  4BWJ A;  1HYV A;  4QCL A;  2HHX A;  2RPI A;  3AVH A;  3AVI A;  4CHY A;  5K14 A;  3AVC A;  4M41 A;  4B9V A;  1VSE A;  1L3U A;  1VRU A;  3AA2 A;  1C1B A;  4OGC A;  4CJQ A;  3O3G A;  4KI4 A;  3HT3 A;  3DOL A;  4RW7 A;  3I0S A;  4M3X A;  4ID1 A;  1U49 A;  4FZY A;  3ZSV A;  4OKK A;  4CJW A;  4E19 A;  2F96 A;  4ELT A;  5FRN A;  4KRF A;  1I39 A;  3T3F A;  4KTQ A;  1VSF A;  1NK5 A;  3AA5 X;  4CJL A;  1JLF A;  3PUF A;  5J2P A;  4N76 A;  4FYD A;  1J9A A;  4DTU A;  4FM2 A;  1D9F A;  2VWK A;  3AVM A;  3UIQ A;  4FJN A;  1EXQ A;  3HP9 A;  3LWL A;  4KB1 A;  1EX4 A;  2IOC A;  4N5S A;  3S9H A;  3PO5 A;  4NCG A;  5DMR A;  3MAQ A;  2ZD1 A;  3ZSW A;  3O3H A;  1WSI A;  4RW9 A;  1RCH A;  3VQ5 A;  1YTU A;  4F3O A;  3NF9 A;  3EYZ A;  4BDP A;  4B08 A;  4CJU A;  3KLF A;  3QNO A;  3HL8 A;  4FLT A;  3LAM A;  2G8V A;  2Z1G A;  2ITG A;  4B8C A;  4HHT A;  1KCF A;  1CXU A;  5HLF A;  4ELV A;  3MEE A;  4KKO A;  1Y97 A;  1WAF A;  3VQE A;  3V9S A;  4KB0 A;  4YNQ A;  4J2D A;  4QOZ B;  3ULD A;  1C0U A;  4DQI A;  1NKB A;  4DQR A;  4HCB A;  4OLB A;  5KGW A;  4CGF A;  3ZSX A;  2RN2 A;  4BE0 A;  3TAN A;  4DU4 A;  1QSS A;  3SUO A;  4C8K A;  1NJX A;  3NE6 A;  1FK9 A;  1KFD A;  3SUN A;  3ZSR A;  1QE1 A;  2HHQ A;  1JLG A;  3VQB A;  1LW0 A;  1J53 A;  4HUE A;  1B9F A;  2X78 A;  4B8A B;  4AHV A;  2FBY A;  4FM0 A;  4KTZ A;  4O4G A;  5CZ1 A;  4CCH A;  3QO9 A;  3JYT A;  4DS4 A;  4PWD A;  2Q3S A;  4KHY A;  1BQN A;  1Z26 A;  1QSY A;  3V9W A;  3HPO A;  1YT3 A;  4Y1D A;  4IFV A;  3U3Y A;  2A1S A;  3V9X A;  4FJJ A;  4DTO A;  1S9G A;  4C8M A;  1L3S A;  2KZZ A;  4LD0 A;  4EP5 A;  1Q9Y A;  4HCC A;  4W5R A;  1J54 A;  3OVN A;  4KHN A;  1ZBH A;  2X74 A;  1HQE A;  4FK0 A;  3V81 A;  3VA3 A;  3RWU A;  3AO1 A;  2F8T A;  3B6P A;  3RRH A;  4DSI A;  2GUI A;  4CJ4 A;  4DTX A;  3QIN A;  1TAU A;  1S1U A;  3LAK A;  4FK2 A;  4AHC A;  1HMV A;  1RBT A;  1XC9 A;  3AO3 A;  5FRO A;  1BL3 A;  2XHB A;  2HHU A;  3PX6 A;  1WLJ A;  1NK7 A;  2YKM A;  3NH0 A;  4O5B A;  1SL1 A;  2KFN A;  4BDZ A;  1U04 A;  4ID5 A;  3WNH A;  4KTW A;  3K59 A;  1ZYQ A;  1TGO A;  3SYZ A;  4CGI A;  3AVK A;  2XO7 A;  3SJJ A;  4C8L A;  4OVL A;  1W9H A;  4CE9 A;  1S1W A;  3TAG A;  4AHT A;  1ASW A;  2BGG A;  4ZHR A;  2HHS A;  4KPY A;  1UA1 A;  4I2P A;  4L8R B;  3K2P A;  4E1N A;  2VG5 A;  4FJX A;  1BI4 B;  4EP4 A;  1RT7 A;  4OJR A;  2QKK A;  3DRR A;  3CFR A;  2XY8 A;  3O4Q A;  4CJT A;  4E7L A;  2Y1I A;  2Z1I A;  4I9L A;  3OJU A;  1WSF A;  4DWI A;  1WSH A;  4CF0 A;  1VSL A;  4DQS A;  3KLI A;  4N41 A;  1QHT A;  2I5J A;  3IRX A;  2IS3 A;  3WNE A;  1SL2 A;  4F8R A;  3NGY A;  3U3G A;  1ZBU A;  3RMB A;  2DFH A;  3M8R A;  2QK9 A;  4IG3 A;  1IH7 A;  4FW1 A;  3VQ4 A;  2XY5 A;  4F2R A;  4RW8 A;  2BDP A;  2HVH A;  2O4I A;  3JSM A;  1VSJ A;  3AV9 A;  4GMJ B;  4O0J A;  5EU7 A;  5C24 A;  4KAZ A;  1JLE A;  4W5Q A;  1BCO A;  1S9E A;  2HND A;  3AO2 A;  1IKX A;  4AH9 A;  3I0R A;  1I3A A;  3QES A;  3PX0 A;  1T05 A;  1HYZ A;  3VQQ A;  3V4I A;  3LP1 A;  4CJ3 A;  3OYK A;  4FK4 A;  1NJW A;  1NJY A;  2HHV A;  1TK0 A;  4CJE A;  4NYN A;  1LV5 A;  4DSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...