3VQBA

Hiv-1 in core domain in complex with 6-fluoro-4h-1,3-benzodioxine-8-carboxylic acid
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 51
structure length 142
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqbA00
4OLBA 4E7IA 3SQ2A 5C42A 4KI6A 3HYFA 4DQRA 1VSDA 1WSGA 4ZHRA 3U6FA 4DQQA 4KV8A 5SZTA 1JLGA 4OKJA 4OKKA 3VQAA 4CCHA 3LP0A 1RTIA 3TI0A 1VRUA 3VA3A 3OJSA 1REVA 1VSLA 3L3VA 1K6YA 3TAFA 1NKCA 1J5OA 4CGFA 4CGHA 1EX4A 1YTUA 1R0AA 3RWUA 3LAKA 4BE0A 2F96A 4OJRA 1I3AA 4UQGA 3OYKA 2ITGA 4RW6A 4DTUA 4N41A 1BCOA 3MXMA 1ZYQA 3HO1A 4CJUA 5J2PA 4LY7A 4E1MA 4DMNA 3OYEA 3NDKA 1S5JA 1VSFA 3KD1E 2P51A 1TK5A 2XRIA 3VQCA 4FW2A 1WSIA 1JLCA 1SUQA 4FJ8A 3MECA 1NKBA 1TKDA 1S6QA 1L5UA 1TGOA 3DLHA 1RT7A 2KQ2A 3DRSA 1Z26A 4DSIA 4W5OA 4IG0A 1QHTA 5HRNA 4FJ9A 3AVJA 3L2VA 3VQ9A 4EZ6A 3LANA 4QAGA 4AHRA 3SZ2A 1HNIA 4OVLA 1QSLA 5HP1A 3NGYA 2XHBA 5J2NA 1ASWA 5J1EA 2HHSA 1WSJA 1KFSA 4IFVA 4FJXA 4CEFA 5JS2A 1T03A 4C8NA 4B8AB 3HXMA 1NOYA 4RW4A 4YNQA 4HCBA 4J2DA 1C0MA 2IC3A 3VQBA 3O4NA 2XO7A 3LZJA 2OPQA 4JS4A 4B9UA 1RT2A 3CM5A 2X6NA 4TSXA 4BDPA 3HVRA 3SV3A 4FK2A 5D3GA 4EP5A 3HP6A 4CECA 1I39A 3C6UA 2LSNA 3DYAA 3EZ5A 1RCHA 3LP3A 3AVLA 4YFUA 4CESA 4DS4A 4FK4A 2B4JA 4L8RB 2F8TA 3TAQA 3VQDA 2IOCA 3SUPA 1WSFA 3DOLA 3H08A 3CFRA 3S3OA 4KTQA 5CY4A 5I42A 3ZSZA 1SL1A 3TAEA 3AO5A 1HYVA 4CJPA 4F8RA 3AO4A 3AA2A 2HHTA 3SJJA 2KZZA 3P5JA 4LH4A 4E1NA 4DTRA 1RBTA 1ZBFA 2ZD1A 3NH1A 4DSJA 3ZSWA 4OGEA 4RW8A 1LV5A 2X78A 4CF1A 3HT3A 4MFBA 2HNDA 2XY6A 3RR8A 1EP4A 2YNIA 4AHUA 2RPIA 3SI6A 3K5LA 3UIQA 5SWMA 2RN2A 3TR8A 3ZT0A 4K8XA 4AILC 3T19A 3DI6A 2HB5A 3K5NA 4FLXA 4XIUA 1C1AA 3ALYA 4WE1A 1NK7A 4F2RA 4W5TA 4FJ5A 3NBPA 4FJLA 2WOMA 4ICLA 4FJIA 2OPRA 2YNGA 1SKWA 4HUFA 1U49A 4F3OA 3RMCA 2KTQA 1N6QA 3VN5A 1TK8A 3P83D 2A1RA 1J9AA 4KB0A 1BCMA 4CEDA 3OY9A 3V9WA 3THVA 4IKFA 1Z25A 4CIEA 4DQIA 4KRFA 3L2WA 1LWEA 4M41A 1TAQA 3ZSYA 2YKMA 3LAMA 3TABA 2G8HA 2KFZA 4LD0A 1DTTA 1JL1A 4M3RA 1JLBA 3AVMA 3KIOA 4DTOA 2DY4A 1BHLA 4KHUA 3ZSVA 4GMJB 3I8DA 4CGIA 3T1AA 3AA4A 3WNFA 3WNGA 4HHTA 1NK4A 4PA1A 3OYMA 4E7LA 2BDPA 2X6SA 4E3SA 4HVJA 3LP1A 4B8CA 2OPPA 4BDZA 4BWMA 3RMBA 1U4BA 1X9MA 3LDSA 3HL8A 4EP4A 3ITHA 4FZZA 3K5MA 4DTXA 3L2UA 4FZXC 1JXEA 1XHZA 4N47A 4H8KA 2F8SA 2RKIA 2R7YA 4O5BA 3AVKA 4OPJA 1T8EA 1CZ9A 3QESA 3CQ8A 2YHAA 3TWHA 1C1BA 1FKOA 1S6PA 1HRHA 4KO0A 4KAZA 2G8IA 4FCYA 3PO4A 4BE1A 5J2QA 2O4GA 3C6TA 3OS1A 4DF4A 2XY7A 4CHYA 2D0BA 2Y1IA 1G15A 3DRRA 3I0RA 3ZCMA 4ELUA 1VSHA 3AO1A 3RMAA 3RRGA 4DLEA 1W0HA 4I2QA 1IKVA 4FYDA 1ZBLA 2G8VA 3RTVA 3KLHA 4KHNA 2G8KA 3KD5E 4Z4CA 2PZSA 2VG7A 3OYLA 2FBXA 1XWLA 5HBMA 4DLGA 3TANA 4ZTFA 3JSMA 1XI1A 2VG5A 4AHCA 2BANA 3AO3A 3TARA 4O55A 3O3HA 3G0ZA 3DLKA 4KTWA 4GW6A 3AVAA 4BWJA 1S1VA 3SYZA 2P1JA 3VQ8A 3RR7A 3F9KA 4NYNA 3TAPA 4AHSA 1RTJA 4AHVA 1LW2A 3AA5X 3VQ6A 5KGWA 2AJQA 3QEVA 4CK1A 3AA3A 3OYJA 3PX4A 1D8YA 3QNNA 4DSFA 1W9HA 1XHXA 4BACA 4FM2A 4KHQA 1MU2A 1RT5A 3ZT4A 3RMDA 5T7BA 4KTZA 2HNYA 4W5QA 5J2MA 4LH5A 5CYQA 5K14A 2XY5A 1RDDA 2IAJA 2Q3SA 4I9QA 4NCAA 3AVCA 3MEGA 1QSSA 4F2SA 1S9GA 1SKRA 4F3TA 1X9SA 4Z4GA 4DTMA 3V1OA 1TL1A 3ASMA 4DG1A 3SNNA 4PQUA 5DK5A 2X74A 1VRTA 3VQEA 4B9SA 3AO2A 1RT4A 1U04A 1RDAA 1JLAA 1RBUA 4H4OA 1JLFA 1WLJA 4CFCA 3LWMA 2VWJA 1XC9A 4DQPA 4M3YA 3WNHA 1TKTA 2Z1HA 1JLQA 3G10A 3HPHA 3QIOA 3OYIA 4DU3A 2XY8A 2DTUA 4CHNA 1GOCA 2OZSA 5HRRA 3IG1A 3MEDA 3MXIA 4JLHA 4FJ7A 1CZBA 2PY5A 4PY5A 1LWCA 2G8UA 1JL2A 3QEIA 1WAFA 4LSLA 3V4IA 2HHQA 3HP9A 4CFDA 1L3VA 2KZMA 1HNVA 3EY1A 4FJKA 3IS9A 3NGZA 1YT3A 1TKXA 1VSKA 3DLRA 1ITGA 1C0TA 4DTSA 3SQ1A 4IFYA 1YVUA 1IG9A 3O3GA 1RILA 4CEZA 1Q9YA 4FLTA 1BISA 2YV0X 3QIPA 1NJWA 3V1RA 4CJTA 2QK9A 3L8BA 4CF8A 4CHPA 2PYLA 4NCBA 1NK9A 4FVMA 4CK3A 2A1SA 3LPUA 2HHUA 4H4MA 3K58A 3S3MA 1CLQA 3SPZA 3PX0A 1T05A 1SL2A 2D0AA 4RG8A 4IG3A 5KRSA 3IAYA 4K8ZA 3AV9A 3BGRA 3DRPA 4GVMA 3O3FA 4DFJA 4FZYA 1ZBUA 3U3GA 2OA8A 3OS0A 4DSLA 3K57A 4CEAA 4KI4A 1HMVA 2B5JA 3PUFA 4LSNA 2FC0A 1B9DA 1TVRA 1HPZA 4CJWA 2ATQA 2W42A 3HPGA 3NCIA 1IKWA 4FJNA 5FRNA 3RRHA 2IS3A 4KKOA 1IKYA 4FJJA 2E4LA 1X1PA 5E41A 3SUNA 4Z4FA 1VK0A 1QTMA 3TAMA 3NH0A 3LZIA 1QE1A 2E6MA 4KB1A 4KHSA 2HW3A 2HHXA 2WONA 1CXUA 4C8MA 1KLNA 2PYJA 1UA0A 3VQ7A 4CHOA 1RT3A 3S9HA 4FW1A 2FBVA 4Z4IA 4HUGA 1LW0A 5HRSA 4FXDA 1U45A 3V1QA 4ZTJA 2HVIA 1JKHA 4Q5VA 4CGJA 4HTUA 3M8SA 4DSEA 1RTDA 4OPKA 4CJLA 3SQ4A 1KCFA 3PY8A 1NJZA 1RBSA 1RNHA 3NF6A 1NK0A 3LP2A 5HROA 4Z4EA 1J54A 4AHTA 3ZSRA 2OYQA 2G8FA 1BL3A 4FJHA 4DTNA 3I0SA 4E7KA 1EETA 3AVIA 3PO5A 3B6OA 3LPTA 3B6PA 3KKRA 3LALA 4CJRA 1GOBA 4DTJA 4DF8A 3KK3A 4E19A 2BE2A 3NFAA 2NUBA 4JS5A 1S1XA 1UWBA 4DTPA 4E89A 3NE6A 4CEQA 1T7PA 1TV6A 2HHVA 1BI4A 4Q0BA 4ELTA 4M45A 2DFEA 4KHYA 1UOCA 3KLGA 3NGIA 1WSEA 3NF7A 1SKSA 1WN7A 3O4QA 3OYBA 3TAGA 4QCLA 3ZT3A 4CJ3A 4Z4HA 4DU1A 3DMJA 1IKXA 3DLEA 1RT6A 1NKEA 1WNSA 1JLEA 3V9UA 2Y1JA 5CZ1A 4CGGA 1HQUA 1RBRA 2O4IA 2FBTA 4W5RA 3HM9A 3DM2A 3OVNA 4M42A 4ELVA 5DMRA 1NJYA 3KJVA 3SUOA 3EYZA 4N76A 5JS1A 1ZBHA 1VSEA 1NK6A 1TKZA 4J2EA 2HNZA 3FFIA 4DFPA 3V9ZA 3OYHA 1RDCA 3OYFA 4E7JA 4CJQA 4OKEA 3SV4A 3QEWA 4DU4A 3DOKA 3ZSXA 5FROA 1S9EA 3KLIA 3F73A 4JRQA 1BI4B 3PV8A 1VSMA 3K5OA 2Z1GA 1UAXA 3JYTA 3T3FA 3OJUA 4B9NA 3M8PA 4R5PA 4O4GA 4C8OA 3MAQA 2D0CA 3SPYA 2VG6A 1NJXA 1B9FA 1KTQA 1S1WA 4CJ4A 4HUEA 1FKPA 3NH2A 2P5OA 3L2RA 3KLFA 4DFKA 3E01A 4IDKA 4DFMA 1VSIA 4I2PA 3ULDA 4W5NA 2I5JA 1LAVA 3P1GA 4KFBA 2QKKA 4J2BA 5HRPA 3KKSA 4B3OA 2ZQBA 3AVBA 4NYFA 3QO9A 1HQEA 4O0JA 3CFPA 2HMIA 2HHWA 1B92A 4HCCA 1KSPA 1SV5A 1ASUA 3WNEA 3VQ5A 4CHZA 2YNFA 1RBVA 4NCGA 4FLWA 1BQNA 4B9MA 4O0IA 3PX6A 3CFOA 2P5GA 4CERA 4C8LA 4J2AA 4M3UA 2RF2A 5KI6A 2GV9A 5HLFA 1CXQA 4Y1CA 3VQPA 2OZMA 3NF8A 3QNOA 1U47A 3AVHA 5FDLA 4CF0A 4CE9A 3L2QA 1KVAA 2VWKA 3ZT1A 3C95A 2IDOA 4AH9A 1D5AA 1TAUA 2KFNA 3SUQA 1EKEA 2YHBA 1S1TA 3MEEA 4CIGA 3NAEA 1ZBIA 1C0UA 4C8KA 1WAJA 4DSKA 4CEOA 3CYMA 4CEEA 4BDYA 3V9SA 5I3UA 3KK2A 1KRPA 3CM6A 5C24A 2ETJA 1JXBA 2GUIA 1LWFA 1KVBA 3OYCA 3K59A 3U3YA 1D9FA 4IBNA 4CEBA 1S1UA 1C1CA 4QOZB 4CFBA 2EHGA 1KVCA 1FK9A 3AVFA 4Y1DA 3CG7A 1HYSA 4DQSA 5KTQA 4EZ9A 4CJVA 1Y97A 4CJKA 1BIZA 4OGCA 3C94A 4F4KA 1QS4A 4CGDA 3S3NA 4B9LA 4CHQA 3OS2A 3QERA 4PUOA 4M3WA 2ZE2A 4FJMA 2FBYA 3HPOA 4B9VA 1KFDA 1RDBA 3HSTB 3BDPA 2IGIA 2JLEA 1C6VA 5FRMA 2B6AA 3QEXA 4OLAA 1DLOA 1A5VA 1Q9XA 1L3SA 2Z1JA 1ASVA 3MXJA 4N5SA 1HYZA 1DTQA 1GOAA 4KPYA 4KHWA 2G8WA 2DFFA 4FLVA 4I9LA 4JRPA 1IH7A 2YKNA 1Q8IA 4DWIA 3AVNA 3M8RA 5EU7A 4CK2A 5C25A 1WSHA 1NK5A 4FK0A 4E7HA 4RW7A 4CF9A 3NF9A 2JGUA 5KRTA 1QSYA 4M3ZA 4CF2A 1BQMA 1HJRA 3L3UA 2Z1IA 3KK1A 4BE2A 2YNHA 3KLEA 1FXXA 4RW9A 2HVHA 3KTQA 3HK2A 2GBZA 4G1QA 3ZSOA 3ISNC 1NOZA 3LWLA 1QQCA 3K2PA 1UA1A 3VQ4A 3NHGA 1IO2A 2QKBA 4O44A 3ZSQA 1SL0A 1RTHA 4CFAA 3V81A 3IRXA 1EXQA 4FLUA 1N5YA 4CJ5A 4FM0A 4B9TA 3ZT2A 3M8QA 4CIFA 4FJGA 1BIUA 4CJFA 4FM1A 4E0DA 1VSJA 1TK0A 4M3TA 3QINA 3OYGA 1LAWA 4DS5A 3QEPA 1X9WA 3QETA 1YTAA 5CYMA 4FLYA 3SCXA 3A2FA 4N56A 2BGGA 2EX3A 1F21A 1A5WA 2KW4A 2OPSA 5KGXA 3V6DA 3DLBA 2E6LA 4ID5A 3HJFA 4B08A 3VA0A 3VQQA 3OYNA 1U48A 2D5RA 1O1WA 3QLHA 4CJEA 1KLMA 1J53A 3HVTA 4Z0UA 3OYAA 3D0PA 2DFHA 4ID1A 1NK8A 3D45A 2QXFA 4MQ3A 3OYDA 1L3UA 1D9DA 4KREA 5CZ2A 1L3TA 4PWDA 3AVGA 1A5XA 1TL3A 1BGXT 3V9XA 4FLZA 3SQ0A 4M3XA 1RT1A 3DLGA 4I7FA 4CJSA
chains in the Genus database with same CATH superfamily
4OLBA 1N32K 3VEZA 4PL7A 4CCHA 2A5XA 3H6EA 4OKJA 4FWRA 1VRUA 1REVA 1VSLA 3TAFA 1R0AA 4NO7A 4RW6A 4DTUA 5AQZA 1U6ZA 1YAGA 3SLCA 3ZYYX 5FLXO 2YJEA 4E1MA 3OBWA 3NDKA 3I56N 1VSFA 4V19S 3B8AX 1SUQA 3MECA 1N34K 1S6QA 1L5UA 2YX6A 4JN4A 2E1YA 3CC4N 3L2VA 4YOXA 4AHRA 4OVLA 4JHDB 5J2NA 1K73O 1K8AO 1NGCA 4GY2B 1T03A 1EWRA 4CVNE 3O9RA 4HTLA 3VQBA 3QMLA 3O4NA 4FWLA 3J7YP 2HBLA 3CM5A 5D3GA 5E26A 1TUYA 3HP6A 4CECA 3C6UA 2LSNA 4H5TA 5LMNK 4F9OA 2F8TA 3W0LA 3S3OA 3T1YK 2E88A 4JK9A 3P5JA 2ZD1A 3NH1A 4DSJA 1WB9A 1NWKA 4RW8A 1LV5A 4CF1A 2HNDA 3RR8A 3K5NA 4FLXA 1NK7A 3ALYA 4F2RA 4FJ5A 3DXKB 3NBPA 1KC8O 4ICLA 4DR1K 4XH1A 5B8HA 3SAHA 1E3MA 2Q36A 4ISFA 3RMCA 1N6QA 4KB0A 4A61A 4UY8O 3VEXA 4M41A 5JVHL 2G8HA 1OVYA 4IO8A 4LD0A 4LF6K 3AVMA 4DTOA 4Y0WA 2DY4A 4KHUA 2J4RA 4GMJB 4CGIA 3T1AA 3K9JA 2D4WA 2O8DA 1NK4A 2X6SA 4E3SA 1E4GT 5BR9A 4HVJA 3LP1A 3CCQN 5EOYA 4BDZA 2FSJA 5H1SQ 1X9MA 3HTVA 3QBWA 4FZZA 4DTXA 4BY9C 4FZXC 4OPHA 3PIPL 1XNQK 2IVNA 4H8KA 1YJNN 3AVKA 1CZ9A 4PKGA 4GV9A 4DF4A 2D0BA 1G15A 4ELUA 3GOIA 4HWIA 4BRHA 1VSHA 4DLEA 2UU9K 1IKVA 4K41A 3RTVA 4R79A 3OYLA 1XWLA 3ENOA 4DLGA 3TANA 4EAHD 3FZKA 5M1PA 1XI1A 4AHCA 2BANA 3TARA 3WXKA 4O55A 2FSNA 1YHQN 3O3HA 4GW6A 3TAPA 4IXCA 1RTJA 5EVZA 1T3VA 2UXCK 3AA3A 3OYJA 4DSFA 1XHXA 4BACA 3MN7A 3ZT4A 4LF5K 3G25A 2QWOA 4W5QA 4JV5K 5CYQA 2IAJA 3SMSA 3CHWA 3I33A 1X9SA 1H1VA 3WQUA 3O4WA 5DK5A 1VRTA 2P9IA 1NJIO 1U04A 3ZLJA 3LWMA 2A6AA 3L0QA 5GAGP 3CCSN 2WC9A 2F9TA 4DU3A 2OTJN 4BR2A 4IDHA 3AGRA 3I8BA 4JLHA 1I94K 1JL2A 5GADP 2KZMA 1HNVA 3LM9A 4O8UA 4JI1K 1YT3A 5AQPA 1ILYA 2HF4A 1ITGA 3THXB 4JKDA 4PKHA 4CEZA 4BVPA 3KK7A 2FF3B 2E20A 2P9PA 1XMOK 2QWNA 4CHPA 4FVMA 4CK3A 3LPUA 3S3MA 2VCPA 4BR5A 1ZC6A 2D0AA 4RG8A 1XNRK 4JHDA 4MO4A 4QS9A 2BTFA 1HNXK 4K8ZA 1QQNA 3DRPA 4GVMA 4FZYA 2OA8A 3EKSA 3OS0A 4RWTA 1HMVA 3T1HK 3PUFA 4M3XA 1B9DA 4A5BA 2Q0RA 3EE8A 3CERA 3RRHA 4KKOA 2IVPA 2E4LA 2CGKA 5E41A 5TKYA 1OVQA 1QTMA 3TAMA 3LZIA 1QE1A 2E6MA 3WXJA 1CXUA 2WTUA 1KAZA 3DWLA 4CHOA 1RT3A 2FBVA 5HRSA 4FXDA 3S41A 3O08A 3CCUN 3VPZA 4Q5VA 3ATVA 4DSEA 4OPKA 1ESVA 3SQ4A 1KCFA 5BRFA 5LMUK 1NK0A 3EZWA 2G8FA 4FJHA 4DTNA 3I0SA 1EETA 1BWFO 2P9UA 3B6OA 1MWMA 3QICA 1GOBA 3KK3A 2BE2A 4YORA 3EKUA 1S1XA 1UWBA 3WEEA 3NE6A 1MA9B 2HHVA 1TV6A 4K0KK 4H5RA 4Q0BA 4BC4A 4M45A 2DFEA 4KHYA 1UOCA 5FPEA 1W7AA 3NF7A 1SKSA 1WBBA 4DV0K 3TAGA 4QCLA 1NNEA 1RT6A 3SAFA 2O4IA 3CCEN 4CZJA 3U4LA 3HM9A 5ADXA 5DMRA 4ELVA 3KJVA 3SUOA 3A8YA 4H0PA 1VSEA 2HNZA 4BROA 1YIJN 1RDCA 3OYFA 4CJQA 4H5VA 3KHYA 2UYTA 3VEOA 4DU4A 3DOKA 4IOXA 4WQ4A 3KLIA 1LOTB 2P5OA 3KWIA 5AQOA 3MAQA 3AGKA 4BVOA 1S1WA 4HUEA 3NH2A 4DFKA 3FLCO 4DFMA 1VSIA 1HNWK 4W5NA 3WT0A 2W6LA 4U67L 2ZQBA 4WFNL 3BZCA 3CFPA 2HHWA 1B92A 3CJ9A 1VQ5N 4MDAA 4CHZA 1ASUA 3WNEA 2YNFA 4M3UA 5KI6A 3O1WA 5HLFA 3VQPA 3DAWA 3FZFA 4ILGB 4IJAA 5FDLA 1KVAA 2VWKA 3C95A 4CZGA 1TAUA 2KFNA 3P38A 5BPLA 1EKEA 3SUQA 4JI2K 2JWKA 3H1QA 4CIGA 2ZJRL 1WAJA 5M1QA 4CEOA 3V9SA 4BC5A 4JKGB 1KRPA 5AQYA 2GUIA 1LWFA 1KVBA 1S1UA 1HYSA 4JD2A 4X62K 4OGCA 2PBDA 4FSVA 3H3OB 1QQOA 4B9LA 4PUOA 3VGKA 3HPOA 1RDBA 3QEXA 3CCVN 4GVEA 2FF6A 1ASVA 1DTQA 1GOAA 2G8WA 2DFFA 1IH7A 3L6QA 3BF3A 5EU7A 4CK2A 2HOEA 1NK5A 1P90A 1IJJA 1HKCA 4RW7A 1BDGA 5AR0A 5A2QO 3G6EN 3KK1A 1JCEA 4RW9A 3WXLA 2GBZA 5CR4A 4G1QA 1NOZA 3HSCA 3LWLA 1QQCA 3K2PA 3MWTA 1UA1A 4JNEA 5C2DA 4O44A 3ZSQA 4JI3K 1Z6RA 4CFAA 2NLXA 3D2EA 1EXQA 2P9IB 4CJ5A 1J6ZA 3QB0A 3GE1A 4CIFA 2D0OA 3MX2A 1LAWA 3QEPA 1YTAA 2ZJPL 2NNWA 3A2FA 4N56A 3D2EB 2BGGA 1DGKN 4XEIA 2W6KA 4ID5A 3VQQA 4CJEA 4Z0UA 4IZ9A 1NK8A 2QXFA 3BP8A 1D9DA 4PWDA 4DR6K 1A5XA 1BGXT 1RT1A 3ID8A 2NRZA 1IBKK 3HYFA 2O8FA 4ZHRA 3VEVA 1VQ9N 4DQQA 1JLGA 4YDUC 3UKUA 4EIAA 1RTIA 3OJSA 3L3VA 1NKCA 3ULEA 1EX4A 1S72N 3RWUA 4BE0A 2F96A 3R9PA 1I3AA 2ITGA 2Q1NA 1ZYQA 3HO1A 2P51A 1TK5A 2XRIA 3VQCA 4LFCK 2GX9A 3ULEB 1TKDA 4H5NA 1GLCG 1RT7A 1C0FA 3EO3A 2YI1A 4GKJK 1QHTA 5HRNA 4LF4K 3THYA 5GIOA 4QS8A 3LANA 4QAGA 4X64K 4L3QA 5J1EA 2HHSA 4IFVA 4CEFA 1TYQA 3HXMA 2I7NA 3D2FB 2IIRA 2XO7A 3TSQA 3DLLL 4H03B 2X6NA 4TSXA 4GKKK 4CD3A 4BRKA 3HVRA 1VQ7N 3TTDA 2E5LK 3LP3A 3J80O 2B4JA 3VQDA 2IOCA 1WSFA 3H08A 4KTQA 3OTOK 4JEPA 3CCLN 3TAEA 3AA2A 2I7PA 3BZKA 1ZBFA 2X78A 4L8RB 2XY6A 4MFBA 3SI6A 2RPIA 3UIQA 3K5LA 5SWMA 2RN2A 3ZT0A 3K0SA 4AILC 2HB5A 3A5MC 3CF5L 4WE1A 3QFUA 2QA4N 4FJLA 2VWBA 2YNGA 1SKWA 3VN5A 4CJ7A 4RCHA 4CEDA 4KBOA 4CIEA 1T6DA 3C7NA 3ZETA 3ZSYA 2YKMA 3LAMA 5AQUA 3TABA 3UKRA 1VHXA 4M3RA 3F9MA 1BHLA 2O8FB 3WNGA 4HHTA 3U9ZA 4PHTX 3BUZB 3O5BA 4CZMA 2OPPA 4H5WA 4QS7A 3RMBA 4EP4A 3ITHA 3JXUA 3K5MA 5ADXH 1XHZA 4N47A 4EHUA 1NMDA 2UUCK 2RKIA 4OPJA 3QESA 3CQ8A 2YHAA 2VQFK 3TWHA 4XH5A 1C1BA 1FKOA 1Q18A 4FCYA 3PO4A 3C6TA 2Y1IA 4CHYA 3DRRA 4FWKA 3ZCMA 2E2QA 4JD2B 1ZBLA 2G8VA 4A62A 3KLHA 1YJ9N 2YHWA 2QEXN 3CC7N 1NU0A 3TTCA 3G0ZA 4KTWA 3AVAA 3VTHA 1S1VA 3RR7A 2P1JA 1FW6A 2P9LA 3VOVA 4NYNA 2ASPA 3IKMA 3ATUA 4PL8A 1LW2A 2AJQA 3QEVA 3PX4A 1BG3A 2RHKA 4DUZK 5AQFA 4FM2A 1YITN 1MU2A 3CETA 4CBWA 2XY5A 1RDDA 1T44A 4NCAA 1JCGA 3L4IA 1QSSA 4F3TA 3LDPA 3K9KA 4PQUA 4JKHA 3VQEA 1QVGM 4NLBA 4CI6A 1RDAA 1QZ6A 4H4OA 3MN5A 3SBGA 4CZKA 4DV3K 3QIOA 3SK3A 1VQ8N 4JKAA 2XY8A 4AF1A 4CHNA 2DTUA 3F2KA 5M1KA 3MXIA 4YOVA 4BG8A 4FJ7A 2PY5A 2G8UA 3QEIA 1WAFA 4BQLA 4FJKA 1TKXA 3DLGA 1C0TA 4JI4K 1RILA 1Z05A 3HZ6A 1BISA 3QIPA 4CZLA 2PAVA 2QK9A 4CF8A 2UUBK 4DR3K 2A1SA 3R1XA 1SL2A 4IO9L 3VENA 2UXDK 4IG3A 2BUPA 2ASOA 4K43A 3IAYA 2GWJA 3N4PA 1BA0A 3U3GA 3G71N 1OH5A 3K57A 4DB3A 3O1BA 5BRDA 1TVRA 1HPZA 4LFBK 5FRNA 1HNZK 2IS3A 4FJJA 3AAQA 3E1YA 1X1PA 4Z4FA 1VK0A 3ID6A 4CZHA 4KB1A 4KHSA 3CJAA 1W2BM 4OO1J 2ZGYA 4HUGA 2JWLA 4WF9L 5IWAK 2O8CA 1TYQB 1RBSA 4IEEA 3NF6A 1DT9A 5HROA 4Z4EA 3ZSRA 1BL3A 4JI0K 4B3SK 1WOQA 2NUBA 5FPDA 3I55N 5KQ8A 4B1XB 1T7PA 5AQHA 5AQXA 2W41A 5AZIB 3KLGA 3OYBA 5E84A 3CC2N 3N4QA 4M7YA 4DU1A 3DMJA 3DLEA 4DV5K 3U8XA 1RBRA 4XH4A 1YF5L 3R6MA 3DM2A 2ZF5O 4N76A 5JS1A 3EE9A 3THWA 1P8ZA 4C23A 2NRVA 4E1JA 1HKBA 3ZSXA 3F73A 4BRQA 1BI4B 4O8KA 3JYTA 2Z1GA 4JKGA 3KZBA 4C8OA 2D0CA 1KTQA 4CJ4A 5BRHA 1FKPA 3L2RA 2ZJQL 2I5JA 3P1GA 5HRPA 4B3OA 3GL1A 3QO9A 5BREA 2HMIA 1X9JA 4HCCA 4FJ9A 4J8FA 3H1VX 2P5GA 1BQNA 4O0IA 4BR0A 2RF2A 2GV9A 4JKFA 2OZMA 3NF8A 1U47A 1KAXA 4DR7K 5AFUA 4CF0A 2P9NB 4AH9A 1D5AA 3HI0A 1BUPA 1S1TA 2YHBA 4JKBA 3TU5A 4C8KA 1G99A 2NZTA 3KK2A 5C24A 3U3YA 3OYCA 1C1CA 4QOZB 2EHGA 1KVCA 3AVFA 3CG7A 4JK8A 2WFBA 2GELA 4CJVA 3D7EO 4WCEL 4ILJA 3C94A 3S3NA 3O9QA 4CHQA 3OS2A 4M3WA 3LL3A 4B9QA 4B9VA 4YY3K 3HSTB 3BDPA 4JAXA 1VQKN 5FRMA 1DLOA 4OPAA 2KKZA 1HYZA 4KPYA 1Q8IA 3OW2M 3AVNA 3CJBA 3NVKA 3MN6A 3NF9A 5KRTA 2O8BA 1QSYA 4CF2A 1HJRA 3L3UA 2Z1IA 3M5RA 4BE2A 2YNHA 3KLEA 3QDKA 2HVHA 3KTQA 3HK2A 4IFEA 3ZSOA 3VQ4A 3NHGA 1IO2A 2QKBA 1Q82O 3IDHA 3V81A 3VTIA 1BU6O 1MDUB 4BGBA 4B9TA 1QVFM 5GAEP 4FJGA 4CJFA 4E0DA 4ILHA 1TK0A 3OYGA 4KH6A 4A2AA 4FLYA 3SCXA 3HM8A 2OPSA 5KGXA 5EXWA 2E6LA 2FSKA 3LDQA 4AQYK 5AZIA 2HSTA 3QLHA 5KPRA 1KLMA 3HVTA 4FJIA 2CGLA 1V4SA 3UB5A 1GLEG 3O9SA 3AVGA 3C0BA 3PLAA 4BRCA 4DQ8A 4WFAL 4I7FA 1VQ6N 4E7IA 3SQ2A 4KI6A 4U7BA 1WSGA 3U6FA 4KV8A 3VQAA 4OKKA 3CI5A 3LP0A 4B1YB 2HF3A 5BN8A 2VYPA 4M63C 4CGFA 4CGHA 1YTUA 3LAKA 4OJRA 3OYKA 3EN9A 4DV1K 2Q2RA 4N41A 4DR2K 4CJUA 4BRLA 4LY7A 5J2PA 5AQRA 1S5JA 3KD1E 4NLCA 1N8RO 1WSIA 4BRAA 3O9UA 1VQPN 3DLHA 3FGUA 3UE5A 3CCMN 1Q81O 4H0OA 4BR9A 2KQ2A 1IV0A 1Z26A 4DSIA 3J81O 1K9MO 1X3MA 3SZ2A 5HP1A 2XHBA 1ASWA 1WSJA 1GLAG 4FJXA 1V4TA 5JS2A 2QWQA 3GDQA 1NOYA 4C1NI 3A0IX 4RW4A 4YNQA 4HCBA 4J2DA 1C0MA 1SAZA 2DPNA 5C2FA 3LZJA 4JS4A 1RT2A 2ZM6K 4BDPA 4FK2A 3AAPA 4EP5A 3DYAA 2QXLA 3AVLA 4YFUA 4CESA 4FK4A 2V52B 3SUPA 3DOLA 3CFRA 5LJWA 1SL1A 3AO5A 3E9LA 3AO4A 1KXPA 2KZZA 4LH4A 4DTRA 4FPBA 2H3GX 3TTFA 3HBTA 4NB4A 4WQ4C 2WBNA 3HOSA 1EP4A 2YNIA 2YHXA 4AHUA 5IT9O 1M90O 3TR8A 4K8XA 3DI6A 4XIUA 1C1AA 4MLEA 3C6AA 4YDUA 5EY4A 3A5NC 2OPRA 4B1ZA 1NBWA 4F3OA 2KTQA 1TK8A 3P39A 3P83D 4IKFA 1BCMA 2P9NA 4ISGA 1Z25A 4KRFA 3L2WA 1VQNN 5F2RA 1TAQA 3T7ZA 2KFZA 1NGDA 3WEEB 2QWMA 3KIOA 1VQON 3ZSVA 1SZ2A 1Q86O 3GG4A 5AQGA 2BDPA 4JI8K 3UKUB 2P9LB 4CBUA 2VQEK 3LDSA 3HL8A 3ZEUA 2E2PA 1JXEA 1ZBSA 4FWOA 4BR4A 3CMAN 3R3LA 1QHAA 4GNIA 4KO0A 1S6PA 1HRHA 3Q7CA 4KAZA 2G8IA 5DM6L 2XY7A 2HBMA 1VQLN 1NGFA 3F5TA 3RRGA 4I2QA 4FYDA 5AQQA 4YOUA 2PZSA 4ZTFA 3JSMA 2VG5A 3AO3A 4BRPA 3DLKA 5LJVA 4BWJA 3SYZA 3VQ8A 4FOIA 4BRNA 3DXMA 2VGNA 4AHVA 3WQTA 3VQ6A 5KGWA 3OBYA 1WUAA 3QNNA 1W9HA 2FLOA 1JJ2M 1YUWA 1RT5A 3RMDA 5T7BA 2NRXA 4KTZA 3WXIA 2HNYA 5AQIA 4BREA 4I9QA 3CPWM 3AVCA 5AQWA 3CJCA 5HOOA 1SKRA 1TL1A 3SNNA 4DG1A 4FVUA 2X74A 2P9SB 1RBUA 1XC9A 4DQPA 4M3YA 4NXMK 2Z1HA 1JLQA 2HBJA 3G10A 3OYIA 3FZLA 1GOCA 2OZSA 5HRRA 3MEDA 3MMVA 1CZBA 4PY5A 1LWCA 2CH6A 2HHQA 3HP9A 1L3VA 2D1KA 2FXUA 3EY1A 1XMQK 3DLRA 2Q31A 3SQ1A 4IFYA 1NG9A 1Q9YA 4FLTA 2YV0X 2QW9A 1NMNA 2OCEA 1NJWA 3V1RA 4CJTA 1RGIA 2W40A 2PYLA 4NCBA 4H4MA 1CLQA 1T05A 3ZEUB 1VAZA 5KRSA 3AV9A 3BGRA 4FO0A 4JI5K 1ZBUA 1E4FT 4CEAA 4KI4A 4CJWA 4LSNA 2FC0A 2W42A 2ATQA 1HPMA 1HLUA 2Q0UA 2P9UB 1IKYA 1MWKA 1YJWN 3SUNA 5C10A 2HW3A 2HHXA 2PYJA 4JKEA 3VQ7A 4CZEA 5ELZA 4FW1A 5AQMA 3CIPA 3V1QA 1EWQA 3OA9A 4LF8K 4CGJA 1HKGA 2NRHA 1RTDA 4CJLA 3DXKA 1BA1A 5TKWA 3PY8A 1NJZA 3LP2A 4AHTA 1T6CA 2OYQA 2EWSA 3LPTA 3CD6N 3B6PA 4EFHA 4DF8A 1NGIA 3NFAA 2OTLN 4E89A 4FL9A 4CEQA 1W97L 3FR0A 3SAGA 1QZ5A 3NGIA 4EHTA 3CMEN 1WN7A 2P9SA 3TSUA 2QTDA 3ZT3A 3L4QA 4Z4HA 1IKXA 1NKEA 4B3MK 1JLEA 3V9UA 1HUXA 4PKIA 2FBTA 5AQTA 4YHHK 3Q7BA 4W5RA 1NM1A 1NJYA 3MX5A 1ZBHA 1NK6A 1TKZA 3FFIA 3V9ZA 1BOTO 3OYHA 1HJOA 4CZFA 1NGBA 3QEWA 5FROA 1S9EA 4BC3A 1NGGA 2F8SA 1VSMA 3K5OA 4B9NA 1ATSA 4WFBL 3R8EA 3M8PA 4BRGA 3SPYA 2VG6A 4KHPK 3KLFA 3TPQA 2E8AA 3ULDA 5AQSA 1LAVA 4J2BA 3CXCM 4NYFA 3ZX2A 5BPNA 1HQEA 2V7YA 3O6WA 5JVGL 1SV5A 1KSPA 3VQ5A 4BG9A 4C8LA 3PX6A 3CFOA 4CERA 4J2AA 1CXQA 4Y1CA 3QNOA 3D2FA 3AVHA 2E1ZA 3OHRA 5AZJA 1YXQA 1S22A 3KVGA 2HBKA 5M1OA 3NAEA 3MEEA 1ZBIA 2AP1A 4DSKA 3CYMA 4CEEA 4BDYA 4IOAL 5I3UA 2ETJA 2NRWA 1FK9A 4EZ9A 5KTQA 1Y97A 4CJKA 1BIZA 4CGDA 3M1FA 4IJNA 4I6MA 4CZIA 3J7AP 4FJMA 5F0XA 1KFDA 4B1UB 2P9KA 4H0XB 2JLEA 2UXBK 2B6AA 4OLAA 1HR0K 1DEJA 2Z1JA 5AJ3K 1HX1A 4I9LA 4JRPA 4A2BA 3SBTA 3M8RA 1RDUA 5C25A 3VERA 1WSHA 2P9KB 2GWKA 4M3ZA 2YJFA 1BQMA 2HHHK 1IG8A 3VGLA 3MDQA 3CCJN 4CW7B 3ISNC 2QI2A 4K42A 1SL0A 1OH8A 4BC2A 3C6HA 2NRRA 4FM0A 3ZT2A 3VESA 3PSFA 3M8QA 2Q97A 1U2VA 1BIUA 4H0YB 3QINA 3QETA 1GLLO 4LFAK 2EX3A 1F21A 1A5WA 1R59O 3D6RA 3VA0A 4OX9K 2V51B 1U48A 1O1WA 2D5RA 3E9PA 3OYAA 3D0PA 1J53A 3H3NO 4DQIA 1L3UA 3D45A 5BR8K 5CZ2A 4X66K 1TL3A 3V9XA 4FLZA 5GINA 3SQ0A 5C0YA 3E66A 4CJSA 5C42A 3HOTA 4DQRA 1VSDA 5SZTA 4BR7A 4MDBA 3TI0A 3VA3A 1K6YA 3BEXA 1J5OA 4MLHA 1XUPO 4C1NK 3A5LC 4UQGA 3VEWA 4X65K 1YVNA 3EEQA 3VMFB 4FWPA 1BCOA 2VGMA 3U9DA 3MXMA 5AQLA 4FWQA 4FJNA 3OYEA 4DMNA 2RE2A 4FW2A 1JLCA 3HRGA 4A59A 4FJ8A 1NKBA 1TGOA 5GIPA 4KH5A 2A41A 1CZAN 3JAMO 3DRSA 2PFUA 4W5OA 4IG0A 4B3TK 1C0GA 5JLHA 3QFPA 3AVJA 1Q7YO 3VQ9A 4EZ6A 2A3ZA 4I6MB 3KWGA 2QWRA 3THYB 1HNIA 1QSLA 4FPAA 3NGYA 4C8NA 1RDWX 4B8AB 2IC3A 1VQMN 2OPQA 4B9UA 4A57A 1BO5O 3SV3A 4DV2K 1I39A 3EZ5A 5I9EB 1RCHA 3ZX0A 4WQ5A 2ZWHA 4O5FA 4DS4A 3TAQA 5CY4A 5I42A 3DXMB 3ZSZA 4ISEA 2HHTA 1HYVA 4CJPA 4F8RA 1GLFO 3SJJA 4E1NA 1RBTA 4JI6K 3ZSWA 4OGEA 4BRIA 3HT3A 1EQYA 4GV6A 4FWNA 3T19A 5C15A 4GV3A 1IBLK 4W5TA 5JMVA 4LF9K 2WOMA 3NVMA 4HUFA 1U49A 3VF2A 2A1RA 1J9AA 2KHOA 3V9WA 3OY9A 3THVA 5EX5A 1KQSM 1LWEA 3THXA 3DJCA 1DTTA 1JL1A 1JLBA 4H0VB 4NXNK 3I8DA 3AA4A 3WNFA 4PA1A 3OYMA 4KH4A 4E7LA 1NGHA 4B8CA 3C65A 3M3ZA 1KD1O 4BWMA 1U4BA 2YCHA 4JYAK 3CQXA 3L2UA 3C7NB 3J8AA 1N36K 1O13A 1SS6A 2R7YA 4O5BA 3FZHA 1T8EA 3VEYA 2NRTA 4BE1A 5J2QA 2O4GA 3EL2A 3OS1A 3I0RA 4BGAA 2V7ZA 3AO1A 3BF1A 3RMAA 1W0HA 4RTFD 4KHNA 2G8KA 3KD5E 1N33K 2E2OA 4Z4CA 4DR4K 2VG7A 2FBXA 5HBMA 3PIOL 3F9KA 4AHSA 5FPNA 3AA5X 4CK1A 2F4VK 4JK7A 1D8YA 4KHQA 2A40A 5J2MA 4LH5A 5K14A 2ITMA 2AA4A 2Q3SA 5HL7L 3MEGA 3AY9A 4F2SA 1S9GA 3FZMA 4Z4GA 4DTMA 3V1OA 1KAYA 3ASMA 3RSEB 4WYBA 2E2NA 2QM1A 4B9SA 1RT4A 3AO2A 4IEIA 1JLAA 1JLFA 1WLJA 4CFCA 2VWJA 2GUPA 3ZX3A 4B1VA 3WNHA 1TKTA 3HPHA 3ENBA 1VQ4N 2KLAA 3G4SN 1JCFA 1GLDG 3IG1A 3CCRN 1M1KO 3H46O 4LSLA 4CFDA 1XC3A 3IS9A 3NGZA 2GEMA 1VSKA 5FPMA 4DTSA 1YVUA 1IG9A 3O3GA 1NLVA 3CQYA 4MO5A 3L8BA 5KPZA 1NK9A 2HHUA 5CE3A 3K58A 3SPZA 3PX0A 3TSPA 4BRMA 4BRDA 3T69A 1K8KB 4DV4K 3JS6A 4G9ZA 1J5EK 1OH7A 3O3FA 4DFJA 1FJGK 3MWPA 2O8DB 3CJ7A 4DSLA 3H45C 2B5JA 3O80A 3V4IA 1WBDA 1KFSA 3NCIA 4B1WB 5JICA 2O8BB 3HPGA 1IKWA 4A5AA 2ZGZA 1K8KA 5M1NA 3BY5A 1NGEA 5AZJB 2CH5A 3RVCA 3MN9A 3UKRB 3NH0A 1S3XA 2WONA 5KPTA 4C8MA 1KLNA 1UA0A 3S9HA 4Z4IA 4YOTA 4AM6A 1LW0A 4BRFA 1U45A 5AFUH 4FWMA 4ZTJA 2HVIA 1JKHA 5LY3A 4CBXA 4HTUA 3M8SA 1NGJA 5MLCQ 1QQMA 1RNHA 3LDNA 1J54A 2BH1A 3O8MA 4E7KA 3AVIA 3PO5A 4FOEA 3ENHA 4CD1A 3KKRA 3LALA 4CJRA 4DTJA 5CHIA 4E19A 4LC9B 4JS5A 4DTPA 1YI2N 1EO1A 1BI4A 2GTDA 2UUAK 4ELTA 3RSEA 1WSEA 2O8CB 3O4QA 4DKWA 4CJ3A 1WNSA 2Y1JA 5CZ1A 3VF4A 4CGGA 1HQUA 1Y64A 4JKCA 5BPMA 3OVNA 4M42A 1ATRA 3EYZA 3GBTA 4J2EA 4DFPA 4E7JA 4OKEA 3SV4A 1GLBG 3VETA 3PV8A 4JRQA 1UAXA 3T3FA 3OJUA 1D4XA 4R5PA 4O4GA 1GLJO 1NJXA 1B9FA 3E01A 4IDKA 5BN9A 4I2PA 4KFBA 2QKKA 5F1XA 2O8EB 3KKSA 1TUUA 3AVBA 4O0JA 5M1FA 4WQ5C 3W3DA 3VF6A 4B9MA 4FLWA 4NCGA 1RBVA 3ZETB 1NGAA 1OKJA 4FWSA 2HMPA 5KQDA 3THWB 5AQJA 3WUHA 4Z94A 3SMPA 1DKGD 4JI7K 4CE9A 2O8EA 3L2QA 2P9PB 3ZT1A 3NMUA 1ZXOA 2IDOA 1ATNA 1RFQA 4H0TB 1LCUA 3P31A 1C0UA 2F7TA 3M6GA 5C12A 3CM6A 1JXBA 3K59A 3PSIA 1D9FA 4IBNA 4CEBA 4CFBA 3IMXA 4Y1DA 4DQSA 4F4KA 1QS4A 2D0PA 3QBXA 3QERA 2ZE2A 2FBYA 3LDOA 5JLFA 3CPEA 3IFRA 2IGIA 3O9TA 1C6VA 3LDLA 1U2VB 3J7ZO 4LF7K 1Q9XA 1A5VA 3E9OA 1L3SA 3MXJA 4N5SA 4KHWA 4FLVA 4AM7A 3WXMB 2YKNA 1SQKA 4DHYA 4DWIA 3IUCA 4DV7K 4FK0A 3SJHA 4E7HA 4CF9A 4DCHA 2JGUA 3FFKB 5DM7L 4YOYA 4B3RK 1FXXA 4K25A 3LM2A 2QWLA 5AQNA 5LL6Z 4BQZA 4DV6K 3FE1A 3AARA 1RTHA 3P4IA 3MK6A 3IRXA 4M7XA 4FLUA 1N5YA 2IVOA 3A5OC 3CJ1A 5AQKA 1IBMK 5GAHP 4FM1A 3MCPA 2A42A 1VSJA 4M3TA 1X9WA 4DS5A 1OH6A 5CYMA 1XQSC 2CGJA 4YOWA 2KW4A 4IOCL 3V6DA 3DLBA 3HJFA 2YHYA 4B08A 4DUYK 2ASMA 4IWVA 2OANA 5AQVA 1X3NA 2QWPA 3OYNA 4DR5K 2DFHA 4ID1A 3OYDA 4MQ3A 4KREA 2F9WA 1L3TA 2WUSA 3VGMA 3MCAB
chains in the Genus database with same CATH topology
4OLBA 4E7IA 3SQ2A 5C42A 4KI6A 3HYFA 4DQRA 1VSDA 1WSGA 4ZHRA 3U6FA 4DQQA 4KV8A 5SZTA 1JLGA 4OKJA 4OKKA 3VQAA 4CCHA 3LP0A 1RTIA 3TI0A 1VRUA 3VA3A 3OJSA 1REVA 1VSLA 3L3VA 1K6YA 3TAFA 1NKCA 1J5OA 4CGFA 4CGHA 1EX4A 1YTUA 1R0AA 3RWUA 3LAKA 4BE0A 2F96A 4OJRA 1I3AA 4UQGA 3OYKA 2ITGA 4RW6A 4DTUA 4N41A 1BCOA 3MXMA 1ZYQA 3HO1A 4CJUA 5J2PA 4LY7A 4E1MA 4DMNA 3OYEA 3NDKA 1S5JA 1VSFA 3KD1E 2P51A 1TK5A 2XRIA 3VQCA 4FW2A 1WSIA 1JLCA 1SUQA 4FJ8A 3MECA 1NKBA 1TKDA 1S6QA 1L5UA 1TGOA 3DLHA 1RT7A 2KQ2A 3DRSA 1Z26A 4DSIA 4W5OA 4IG0A 1QHTA 5HRNA 4FJ9A 3AVJA 3L2VA 3VQ9A 4EZ6A 3LANA 4QAGA 4AHRA 3SZ2A 1HNIA 4OVLA 1QSLA 5HP1A 3NGYA 2XHBA 5J2NA 1ASWA 5J1EA 2HHSA 1WSJA 1KFSA 4IFVA 4FJXA 4CEFA 5JS2A 1T03A 4C8NA 4B8AB 3HXMA 1NOYA 4RW4A 4YNQA 4HCBA 4J2DA 1C0MA 2IC3A 3VQBA 3O4NA 2XO7A 3LZJA 2OPQA 4JS4A 4B9UA 1RT2A 3CM5A 2X6NA 4TSXA 4BDPA 3HVRA 3SV3A 4FK2A 5D3GA 4EP5A 3HP6A 4CECA 1I39A 3C6UA 2LSNA 3DYAA 3EZ5A 1RCHA 3LP3A 3AVLA 4YFUA 4CESA 4DS4A 4FK4A 2B4JA 4L8RB 2F8TA 3TAQA 3VQDA 2IOCA 3SUPA 1WSFA 3DOLA 3H08A 3CFRA 3S3OA 4KTQA 5CY4A 5I42A 3ZSZA 1SL1A 3TAEA 3AO5A 1HYVA 4CJPA 4F8RA 3AO4A 3AA2A 2HHTA 3SJJA 2KZZA 3P5JA 4LH4A 4E1NA 4DTRA 1RBTA 1ZBFA 2ZD1A 3NH1A 4DSJA 3ZSWA 4OGEA 4RW8A 1LV5A 2X78A 4CF1A 3HT3A 4MFBA 2HNDA 2XY6A 3RR8A 1EP4A 2YNIA 4AHUA 2RPIA 3SI6A 3K5LA 3UIQA 5SWMA 2RN2A 3TR8A 3ZT0A 4K8XA 4AILC 3T19A 3DI6A 2HB5A 3K5NA 4FLXA 4XIUA 1C1AA 3ALYA 4WE1A 1NK7A 4F2RA 4W5TA 4FJ5A 3NBPA 4FJLA 2WOMA 4ICLA 4FJIA 2OPRA 2YNGA 1SKWA 4HUFA 1U49A 4F3OA 3RMCA 2KTQA 1N6QA 3VN5A 1TK8A 3P83D 2A1RA 1J9AA 4KB0A 1BCMA 4CEDA 3OY9A 3V9WA 3THVA 4IKFA 1Z25A 4CIEA 4DQIA 4KRFA 3L2WA 1LWEA 4M41A 1TAQA 3ZSYA 2YKMA 3LAMA 3TABA 2G8HA 2KFZA 4LD0A 1DTTA 1JL1A 4M3RA 1JLBA 3AVMA 3KIOA 4DTOA 2DY4A 1BHLA 4KHUA 3ZSVA 4GMJB 3I8DA 4CGIA 3T1AA 3AA4A 3WNFA 3WNGA 4HHTA 1NK4A 4PA1A 3OYMA 4E7LA 2BDPA 2X6SA 4E3SA 4HVJA 3LP1A 4B8CA 2OPPA 4BDZA 4BWMA 3RMBA 1U4BA 1X9MA 3LDSA 3HL8A 4EP4A 3ITHA 4FZZA 3K5MA 4DTXA 3L2UA 4FZXC 1JXEA 1XHZA 4N47A 4H8KA 2F8SA 2RKIA 2R7YA 4O5BA 3AVKA 4OPJA 1T8EA 1CZ9A 3QESA 3CQ8A 2YHAA 3TWHA 1C1BA 1FKOA 1S6PA 1HRHA 4KO0A 4KAZA 2G8IA 4FCYA 3PO4A 4BE1A 5J2QA 2O4GA 3C6TA 3OS1A 4DF4A 2XY7A 4CHYA 2D0BA 2Y1IA 1G15A 3DRRA 3I0RA 3ZCMA 4ELUA 1VSHA 3AO1A 3RMAA 3RRGA 4DLEA 1W0HA 4I2QA 1IKVA 4FYDA 1ZBLA 2G8VA 3RTVA 3KLHA 4KHNA 2G8KA 3KD5E 4Z4CA 2PZSA 2VG7A 3OYLA 2FBXA 1XWLA 5HBMA 4DLGA 3TANA 4ZTFA 3JSMA 1XI1A 2VG5A 4AHCA 2BANA 3AO3A 3TARA 4O55A 3O3HA 3G0ZA 3DLKA 4KTWA 4GW6A 3AVAA 4BWJA 1S1VA 3SYZA 2P1JA 3VQ8A 3RR7A 3F9KA 4NYNA 3TAPA 4AHSA 1RTJA 4AHVA 1LW2A 3AA5X 3VQ6A 5KGWA 2AJQA 3QEVA 4CK1A 3AA3A 3OYJA 3PX4A 1D8YA 3QNNA 4DSFA 1W9HA 1XHXA 4BACA 4FM2A 4KHQA 1MU2A 1RT5A 3ZT4A 3RMDA 5T7BA 4KTZA 2HNYA 4W5QA 5J2MA 4LH5A 5CYQA 5K14A 2XY5A 1RDDA 2IAJA 2Q3SA 4I9QA 4NCAA 3AVCA 3MEGA 1QSSA 4F2SA 1S9GA 1SKRA 4F3TA 1X9SA 4Z4GA 4DTMA 3V1OA 1TL1A 3ASMA 4DG1A 3SNNA 4PQUA 5DK5A 2X74A 1VRTA 3VQEA 4B9SA 3AO2A 1RT4A 1U04A 1RDAA 1JLAA 1RBUA 4H4OA 1JLFA 1WLJA 4CFCA 3LWMA 2VWJA 1XC9A 4DQPA 4M3YA 3WNHA 1TKTA 2Z1HA 1JLQA 3G10A 3HPHA 3QIOA 3OYIA 4DU3A 2XY8A 2DTUA 4CHNA 1GOCA 2OZSA 5HRRA 3IG1A 3MEDA 3MXIA 4JLHA 4FJ7A 1CZBA 2PY5A 4PY5A 1LWCA 2G8UA 1JL2A 3QEIA 1WAFA 4LSLA 3V4IA 2HHQA 3HP9A 4CFDA 1L3VA 2KZMA 1HNVA 3EY1A 4FJKA 3IS9A 3NGZA 1YT3A 1TKXA 1VSKA 3DLRA 1ITGA 1C0TA 4DTSA 3SQ1A 4IFYA 1YVUA 1IG9A 3O3GA 1RILA 4CEZA 1Q9YA 4FLTA 1BISA 2YV0X 3QIPA 1NJWA 3V1RA 4CJTA 2QK9A 3L8BA 4CF8A 4CHPA 2PYLA 4NCBA 1NK9A 4FVMA 4CK3A 2A1SA 3LPUA 2HHUA 4H4MA 3K58A 3S3MA 1CLQA 3SPZA 3PX0A 1T05A 1SL2A 2D0AA 4RG8A 4IG3A 5KRSA 3IAYA 4K8ZA 3AV9A 3BGRA 3DRPA 4GVMA 3O3FA 4DFJA 4FZYA 1ZBUA 3U3GA 2OA8A 3OS0A 4DSLA 3K57A 4CEAA 4KI4A 1HMVA 2B5JA 3PUFA 4LSNA 2FC0A 1B9DA 1TVRA 1HPZA 4CJWA 2ATQA 2W42A 3HPGA 3NCIA 1IKWA 4FJNA 5FRNA 3RRHA 2IS3A 4KKOA 1IKYA 4FJJA 2E4LA 1X1PA 5E41A 3SUNA 4Z4FA 1VK0A 1QTMA 3TAMA 3NH0A 3LZIA 1QE1A 2E6MA 4KB1A 4KHSA 2HW3A 2HHXA 2WONA 1CXUA 4C8MA 1KLNA 2PYJA 1UA0A 3VQ7A 4CHOA 1RT3A 3S9HA 4FW1A 2FBVA 4Z4IA 4HUGA 1LW0A 5HRSA 4FXDA 1U45A 3V1QA 4ZTJA 2HVIA 1JKHA 4Q5VA 4CGJA 4HTUA 3M8SA 4DSEA 1RTDA 4OPKA 4CJLA 3SQ4A 1KCFA 3PY8A 1NJZA 1RBSA 1RNHA 3NF6A 1NK0A 3LP2A 5HROA 4Z4EA 1J54A 4AHTA 3ZSRA 2OYQA 2G8FA 1BL3A 4FJHA 4DTNA 3I0SA 4E7KA 1EETA 3AVIA 3PO5A 3B6OA 3LPTA 3B6PA 3KKRA 3LALA 4CJRA 1GOBA 4DTJA 4DF8A 3KK3A 4E19A 2BE2A 3NFAA 2NUBA 4JS5A 1S1XA 1UWBA 4DTPA 4E89A 3NE6A 4CEQA 1T7PA 1TV6A 2HHVA 1BI4A 4Q0BA 4ELTA 4M45A 2DFEA 4KHYA 1UOCA 3KLGA 3NGIA 1WSEA 3NF7A 1SKSA 1WN7A 3O4QA 3OYBA 3TAGA 4QCLA 3ZT3A 4CJ3A 4Z4HA 4DU1A 3DMJA 1IKXA 3DLEA 1RT6A 1NKEA 1WNSA 1JLEA 3V9UA 2Y1JA 5CZ1A 4CGGA 1HQUA 1RBRA 2O4IA 2FBTA 4W5RA 3HM9A 3DM2A 3OVNA 4M42A 4ELVA 5DMRA 1NJYA 3KJVA 3SUOA 3EYZA 4N76A 5JS1A 1ZBHA 1VSEA 1NK6A 1TKZA 4J2EA 2HNZA 3FFIA 4DFPA 3V9ZA 3OYHA 1RDCA 3OYFA 4E7JA 4CJQA 4OKEA 3SV4A 3QEWA 4DU4A 3DOKA 3ZSXA 5FROA 1S9EA 3KLIA 3F73A 4JRQA 1BI4B 3PV8A 1VSMA 3K5OA 2Z1GA 1UAXA 3JYTA 3T3FA 3OJUA 4B9NA 3M8PA 4R5PA 4O4GA 4C8OA 3MAQA 2D0CA 3SPYA 2VG6A 1NJXA 1B9FA 1KTQA 1S1WA 4CJ4A 4HUEA 1FKPA 3NH2A 2P5OA 3L2RA 3KLFA 4DFKA 3E01A 4IDKA 4DFMA 1VSIA 4I2PA 3ULDA 4W5NA 2I5JA 1LAVA 3P1GA 4KFBA 2QKKA 4J2BA 5HRPA 3KKSA 4B3OA 2ZQBA 3AVBA 4NYFA 3QO9A 1HQEA 4O0JA 3CFPA 2HMIA 2HHWA 1B92A 4HCCA 1KSPA 1SV5A 1ASUA 3WNEA 3VQ5A 4CHZA 2YNFA 1RBVA 4NCGA 4FLWA 1BQNA 4B9MA 4O0IA 3PX6A 3CFOA 2P5GA 4CERA 4C8LA 4J2AA 4M3UA 2RF2A 5KI6A 2GV9A 5HLFA 1CXQA 4Y1CA 3VQPA 2OZMA 3NF8A 3QNOA 1U47A 3AVHA 5FDLA 4CF0A 4CE9A 3L2QA 1KVAA 2VWKA 3ZT1A 3C95A 2IDOA 4AH9A 1D5AA 1TAUA 2KFNA 3SUQA 1EKEA 2YHBA 1S1TA 3MEEA 4CIGA 3NAEA 1ZBIA 1C0UA 4C8KA 1WAJA 4DSKA 4CEOA 3CYMA 4CEEA 4BDYA 3V9SA 5I3UA 3KK2A 1KRPA 3CM6A 5C24A 2ETJA 1JXBA 2GUIA 1LWFA 1KVBA 3OYCA 3K59A 3U3YA 1D9FA 4IBNA 4CEBA 1S1UA 1C1CA 4QOZB 4CFBA 2EHGA 1KVCA 1FK9A 3AVFA 4Y1DA 3CG7A 1HYSA 4DQSA 5KTQA 4EZ9A 4CJVA 1Y97A 4CJKA 1BIZA 4OGCA 3C94A 4F4KA 1QS4A 4CGDA 3S3NA 4B9LA 4CHQA 3OS2A 3QERA 4PUOA 4M3WA 2ZE2A 4FJMA 2FBYA 3HPOA 4B9VA 1KFDA 1RDBA 3HSTB 3BDPA 2IGIA 2JLEA 1C6VA 5FRMA 2B6AA 3QEXA 4OLAA 1DLOA 1A5VA 1Q9XA 1L3SA 2Z1JA 1ASVA 3MXJA 4N5SA 1HYZA 1DTQA 1GOAA 4KPYA 4KHWA 2G8WA 2DFFA 4FLVA 4I9LA 4JRPA 1IH7A 2YKNA 1Q8IA 4DWIA 3AVNA 3M8RA 5EU7A 4CK2A 5C25A 1WSHA 1NK5A 4FK0A 4E7HA 4RW7A 4CF9A 3NF9A 2JGUA 5KRTA 1QSYA 4M3ZA 4CF2A 1BQMA 1HJRA 3L3UA 2Z1IA 3KK1A 4BE2A 2YNHA 3KLEA 1FXXA 4RW9A 2HVHA 3KTQA 3HK2A 2GBZA 4G1QA 3ZSOA 3ISNC 1NOZA 3LWLA 1QQCA 3K2PA 1UA1A 3VQ4A 3NHGA 1IO2A 2QKBA 4O44A 3ZSQA 1SL0A 1RTHA 4CFAA 3V81A 3IRXA 1EXQA 4FLUA 1N5YA 4CJ5A 4FM0A 4B9TA 3ZT2A 3M8QA 4CIFA 4FJGA 1BIUA 4CJFA 4FM1A 4E0DA 1VSJA 1TK0A 4M3TA 3QINA 3OYGA 1LAWA 4DS5A 3QEPA 1X9WA 3QETA 1YTAA 5CYMA 4FLYA 3SCXA 3A2FA 4N56A 2BGGA 2EX3A 1F21A 1A5WA 2KW4A 2OPSA 5KGXA 3V6DA 3DLBA 2E6LA 4ID5A 3HJFA 4B08A 3VA0A 3VQQA 3OYNA 1U48A 2D5RA 1O1WA 3QLHA 4CJEA 1KLMA 1J53A 3HVTA 4Z0UA 3OYAA 3D0PA 2DFHA 4ID1A 1NK8A 3D45A 2QXFA 4MQ3A 3OYDA 1L3UA 1D9DA 4KREA 5CZ2A 1L3TA 4PWDA 3AVGA 1A5XA 1TL3A 1BGXT 3V9XA 4FLZA 3SQ0A 4M3XA 1RT1A 3DLGA 4I7FA 4CJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLB A;  4E7I A;  3SQ2 A;  5C42 A;  4KI6 A;  3HYF A;  4DQR A;  1VSD A;  1WSG A;  4ZHR A;  3U6F A;  4DQQ A;  4KV8 A;  5SZT A;  1JLG A;  4OKJ A;  4OKK A;  3VQA A;  4CCH A;  3LP0 A;  1RTI A;  3TI0 A;  1VRU A;  3VA3 A;  3OJS A;  1REV A;  1VSL A;  3L3V A;  1K6Y A;  3TAF A;  1NKC A;  1J5O A;  4CGF A;  4CGH A;  1EX4 A;  1YTU A;  1R0A A;  3RWU A;  3LAK A;  4BE0 A;  2F96 A;  4OJR A;  1I3A A;  4UQG A;  3OYK A;  2ITG A;  4RW6 A;  4DTU A;  4N41 A;  1BCO A;  3MXM A;  1ZYQ A;  3HO1 A;  4CJU A;  5J2P A;  4LY7 A;  4E1M A;  4DMN A;  3OYE A;  3NDK A;  1S5J A;  1VSF A;  3KD1 E;  2P51 A;  1TK5 A;  2XRI A;  3VQC A;  4FW2 A;  1WSI A;  1JLC A;  1SUQ A;  4FJ8 A;  3MEC A;  1NKB A;  1TKD A;  1S6Q A;  1L5U A;  1TGO A;  3DLH A;  1RT7 A;  2KQ2 A;  3DRS A;  1Z26 A;  4DSI A;  4W5O A;  4IG0 A;  1QHT A;  5HRN A;  4FJ9 A;  3AVJ A;  3L2V A;  3VQ9 A;  4EZ6 A;  3LAN A;  4QAG A;  4AHR A;  3SZ2 A;  1HNI A;  4OVL A;  1QSL A;  5HP1 A;  3NGY A;  2XHB A;  5J2N A;  1ASW A;  5J1E A;  2HHS A;  1WSJ A;  1KFS A;  4IFV A;  4FJX A;  4CEF A;  5JS2 A;  1T03 A;  4C8N A;  4B8A B;  3HXM A;  1NOY A;  4RW4 A;  4YNQ A;  4HCB A;  4J2D A;  1C0M A;  2IC3 A;  3VQB A;  3O4N A;  2XO7 A;  3LZJ A;  2OPQ A;  4JS4 A;  4B9U A;  1RT2 A;  3CM5 A;  2X6N A;  4TSX A;  4BDP A;  3HVR A;  3SV3 A;  4FK2 A;  5D3G A;  4EP5 A;  3HP6 A;  4CEC A;  1I39 A;  3C6U A;  2LSN A;  3DYA A;  3EZ5 A;  1RCH A;  3LP3 A;  3AVL A;  4YFU A;  4CES A;  4DS4 A;  4FK4 A;  2B4J A;  4L8R B;  2F8T A;  3TAQ A;  3VQD A;  2IOC A;  3SUP A;  1WSF A;  3DOL A;  3H08 A;  3CFR A;  3S3O A;  4KTQ A;  5CY4 A;  5I42 A;  3ZSZ A;  1SL1 A;  3TAE A;  3AO5 A;  1HYV A;  4CJP A;  4F8R A;  3AO4 A;  3AA2 A;  2HHT A;  3SJJ A;  2KZZ A;  3P5J A;  4LH4 A;  4E1N A;  4DTR A;  1RBT A;  1ZBF A;  2ZD1 A;  3NH1 A;  4DSJ A;  3ZSW A;  4OGE A;  4RW8 A;  1LV5 A;  2X78 A;  4CF1 A;  3HT3 A;  4MFB A;  2HND A;  2XY6 A;  3RR8 A;  1EP4 A;  2YNI A;  4AHU A;  2RPI A;  3SI6 A;  3K5L A;  3UIQ A;  5SWM A;  2RN2 A;  3TR8 A;  3ZT0 A;  4K8X A;  4AIL C;  3T19 A;  3DI6 A;  2HB5 A;  3K5N A;  4FLX A;  4XIU A;  1C1A A;  3ALY A;  4WE1 A;  1NK7 A;  4F2R A;  4W5T A;  4FJ5 A;  3NBP A;  4FJL A;  2WOM A;  4ICL A;  4FJI A;  2OPR A;  2YNG A;  1SKW A;  4HUF A;  1U49 A;  4F3O A;  3RMC A;  2KTQ A;  1N6Q A;  3VN5 A;  1TK8 A;  3P83 D;  2A1R A;  1J9A A;  4KB0 A;  1BCM A;  4CED A;  3OY9 A;  3V9W A;  3THV A;  4IKF A;  1Z25 A;  4CIE A;  4DQI A;  4KRF A;  3L2W A;  1LWE A;  4M41 A;  1TAQ A;  3ZSY A;  2YKM A;  3LAM A;  3TAB A;  2G8H A;  2KFZ A;  4LD0 A;  1DTT A;  1JL1 A;  4M3R A;  1JLB A;  3AVM A;  3KIO A;  4DTO A;  2DY4 A;  1BHL A;  4KHU A;  3ZSV A;  4GMJ B;  3I8D A;  4CGI A;  3T1A A;  3AA4 A;  3WNF A;  3WNG A;  4HHT A;  1NK4 A;  4PA1 A;  3OYM A;  4E7L A;  2BDP A;  2X6S A;  4E3S A;  4HVJ A;  3LP1 A;  4B8C A;  2OPP A;  4BDZ A;  4BWM A;  3RMB A;  1U4B A;  1X9M A;  3LDS A;  3HL8 A;  4EP4 A;  3ITH A;  4FZZ A;  3K5M A;  4DTX A;  3L2U A;  4FZX C;  1JXE A;  1XHZ A;  4N47 A;  4H8K A;  2F8S A;  2RKI A;  2R7Y A;  4O5B A;  3AVK A;  4OPJ A;  1T8E A;  1CZ9 A;  3QES A;  3CQ8 A;  2YHA A;  3TWH A;  1C1B A;  1FKO A;  1S6P A;  1HRH A;  4KO0 A;  4KAZ A;  2G8I A;  4FCY A;  3PO4 A;  4BE1 A;  5J2Q A;  2O4G A;  3C6T A;  3OS1 A;  4DF4 A;  2XY7 A;  4CHY A;  2D0B A;  2Y1I A;  1G15 A;  3DRR A;  3I0R A;  3ZCM A;  4ELU A;  1VSH A;  3AO1 A;  3RMA A;  3RRG A;  4DLE A;  1W0H A;  4I2Q A;  1IKV A;  4FYD A;  1ZBL A;  2G8V A;  3RTV A;  3KLH A;  4KHN A;  2G8K A;  3KD5 E;  4Z4C A;  2PZS A;  2VG7 A;  3OYL A;  2FBX A;  1XWL A;  5HBM A;  4DLG A;  3TAN A;  4ZTF A;  3JSM A;  1XI1 A;  2VG5 A;  4AHC A;  2BAN A;  3AO3 A;  3TAR A;  4O55 A;  3O3H A;  3G0Z A;  3DLK A;  4KTW A;  4GW6 A;  3AVA A;  4BWJ A;  1S1V A;  3SYZ A;  2P1J A;  3VQ8 A;  3RR7 A;  3F9K A;  4NYN A;  3TAP A;  4AHS A;  1RTJ A;  4AHV A;  1LW2 A;  3AA5 X;  3VQ6 A;  5KGW A;  2AJQ A;  3QEV A;  4CK1 A;  3AA3 A;  3OYJ A;  3PX4 A;  1D8Y A;  3QNN A;  4DSF A;  1W9H A;  1XHX A;  4BAC A;  4FM2 A;  4KHQ A;  1MU2 A;  1RT5 A;  3ZT4 A;  3RMD A;  5T7B A;  4KTZ A;  2HNY A;  4W5Q A;  5J2M A;  4LH5 A;  5CYQ A;  5K14 A;  2XY5 A;  1RDD A;  2IAJ A;  2Q3S A;  4I9Q A;  4NCA A;  3AVC A;  3MEG A;  1QSS A;  4F2S A;  1S9G A;  1SKR A;  4F3T A;  1X9S A;  4Z4G A;  4DTM A;  3V1O A;  1TL1 A;  3ASM A;  4DG1 A;  3SNN A;  4PQU A;  5DK5 A;  2X74 A;  1VRT A;  3VQE A;  4B9S A;  3AO2 A;  1RT4 A;  1U04 A;  1RDA A;  1JLA A;  1RBU A;  4H4O A;  1JLF A;  1WLJ A;  4CFC A;  3LWM A;  2VWJ A;  1XC9 A;  4DQP A;  4M3Y A;  3WNH A;  1TKT A;  2Z1H A;  1JLQ A;  3G10 A;  3HPH A;  3QIO A;  3OYI A;  4DU3 A;  2XY8 A;  2DTU A;  4CHN A;  1GOC A;  2OZS A;  5HRR A;  3IG1 A;  3MED A;  3MXI A;  4JLH A;  4FJ7 A;  1CZB A;  2PY5 A;  4PY5 A;  1LWC A;  2G8U A;  1JL2 A;  3QEI A;  1WAF A;  4LSL A;  3V4I A;  2HHQ A;  3HP9 A;  4CFD A;  1L3V A;  2KZM A;  1HNV A;  3EY1 A;  4FJK A;  3IS9 A;  3NGZ A;  1YT3 A;  1TKX A;  1VSK A;  3DLR A;  1ITG A;  1C0T A;  4DTS A;  3SQ1 A;  4IFY A;  1YVU A;  1IG9 A;  3O3G A;  1RIL A;  4CEZ A;  1Q9Y A;  4FLT A;  1BIS A;  2YV0 X;  3QIP A;  1NJW A;  3V1R A;  4CJT A;  2QK9 A;  3L8B A;  4CF8 A;  4CHP A;  2PYL A;  4NCB A;  1NK9 A;  4FVM A;  4CK3 A;  2A1S A;  3LPU A;  2HHU A;  4H4M A;  3K58 A;  3S3M A;  1CLQ A;  3SPZ A;  3PX0 A;  1T05 A;  1SL2 A;  2D0A A;  4RG8 A;  4IG3 A;  5KRS A;  3IAY A;  4K8Z A;  3AV9 A;  3BGR A;  3DRP A;  4GVM A;  3O3F A;  4DFJ A;  4FZY A;  1ZBU A;  3U3G A;  2OA8 A;  3OS0 A;  4DSL A;  3K57 A;  4CEA A;  4KI4 A;  1HMV A;  2B5J A;  3PUF A;  4LSN A;  2FC0 A;  1B9D A;  1TVR A;  1HPZ A;  4CJW A;  2ATQ A;  2W42 A;  3HPG A;  3NCI A;  1IKW A;  4FJN A;  5FRN A;  3RRH A;  2IS3 A;  4KKO A;  1IKY A;  4FJJ A;  2E4L A;  1X1P A;  5E41 A;  3SUN A;  4Z4F A;  1VK0 A;  1QTM A;  3TAM A;  3NH0 A;  3LZI A;  1QE1 A;  2E6M A;  4KB1 A;  4KHS A;  2HW3 A;  2HHX A;  2WON A;  1CXU A;  4C8M A;  1KLN A;  2PYJ A;  1UA0 A;  3VQ7 A;  4CHO A;  1RT3 A;  3S9H A;  4FW1 A;  2FBV A;  4Z4I A;  4HUG A;  1LW0 A;  5HRS A;  4FXD A;  1U45 A;  3V1Q A;  4ZTJ A;  2HVI A;  1JKH A;  4Q5V A;  4CGJ A;  4HTU A;  3M8S A;  4DSE A;  1RTD A;  4OPK A;  4CJL A;  3SQ4 A;  1KCF A;  3PY8 A;  1NJZ A;  1RBS A;  1RNH A;  3NF6 A;  1NK0 A;  3LP2 A;  5HRO A;  4Z4E A;  1J54 A;  4AHT A;  3ZSR A;  2OYQ A;  2G8F A;  1BL3 A;  4FJH A;  4DTN A;  3I0S A;  4E7K A;  1EET A;  3AVI A;  3PO5 A;  3B6O A;  3LPT A;  3B6P A;  3KKR A;  3LAL A;  4CJR A;  1GOB A;  4DTJ A;  4DF8 A;  3KK3 A;  4E19 A;  2BE2 A;  3NFA A;  2NUB A;  4JS5 A;  1S1X A;  1UWB A;  4DTP A;  4E89 A;  3NE6 A;  4CEQ A;  1T7P A;  1TV6 A;  2HHV A;  1BI4 A;  4Q0B A;  4ELT A;  4M45 A;  2DFE A;  4KHY A;  1UOC A;  3KLG A;  3NGI A;  1WSE A;  3NF7 A;  1SKS A;  1WN7 A;  3O4Q A;  3OYB A;  3TAG A;  4QCL A;  3ZT3 A;  4CJ3 A;  4Z4H A;  4DU1 A;  3DMJ A;  1IKX A;  3DLE A;  1RT6 A;  1NKE A;  1WNS A;  1JLE A;  3V9U A;  2Y1J A;  5CZ1 A;  4CGG A;  1HQU A;  1RBR A;  2O4I A;  2FBT A;  4W5R A;  3HM9 A;  3DM2 A;  3OVN A;  4M42 A;  4ELV A;  5DMR A;  1NJY A;  3KJV A;  3SUO A;  3EYZ A;  4N76 A;  5JS1 A;  1ZBH A;  1VSE A;  1NK6 A;  1TKZ A;  4J2E A;  2HNZ A;  3FFI A;  4DFP A;  3V9Z A;  3OYH A;  1RDC A;  3OYF A;  4E7J A;  4CJQ A;  4OKE A;  3SV4 A;  3QEW A;  4DU4 A;  3DOK A;  3ZSX A;  5FRO A;  1S9E A;  3KLI A;  3F73 A;  4JRQ A;  1BI4 B;  3PV8 A;  1VSM A;  3K5O A;  2Z1G A;  1UAX A;  3JYT A;  3T3F A;  3OJU A;  4B9N A;  3M8P A;  4R5P A;  4O4G A;  4C8O A;  3MAQ A;  2D0C A;  3SPY A;  2VG6 A;  1NJX A;  1B9F A;  1KTQ A;  1S1W A;  4CJ4 A;  4HUE A;  1FKP A;  3NH2 A;  2P5O A;  3L2R A;  3KLF A;  4DFK A;  3E01 A;  4IDK A;  4DFM A;  1VSI A;  4I2P A;  3ULD A;  4W5N A;  2I5J A;  1LAV A;  3P1G A;  4KFB A;  2QKK A;  4J2B A;  5HRP A;  3KKS A;  4B3O A;  2ZQB A;  3AVB A;  4NYF A;  3QO9 A;  1HQE A;  4O0J A;  3CFP A;  2HMI A;  2HHW A;  1B92 A;  4HCC A;  1KSP A;  1SV5 A;  1ASU A;  3WNE A;  3VQ5 A;  4CHZ A;  2YNF A;  1RBV A;  4NCG A;  4FLW A;  1BQN A;  4B9M A;  4O0I A;  3PX6 A;  3CFO A;  2P5G A;  4CER A;  4C8L A;  4J2A A;  4M3U A;  2RF2 A;  5KI6 A;  2GV9 A;  5HLF A;  1CXQ A;  4Y1C A;  3VQP A;  2OZM A;  3NF8 A;  3QNO A;  1U47 A;  3AVH A;  5FDL A;  4CF0 A;  4CE9 A;  3L2Q A;  1KVA A;  2VWK A;  3ZT1 A;  3C95 A;  2IDO A;  4AH9 A;  1D5A A;  1TAU A;  2KFN A;  3SUQ A;  1EKE A;  2YHB A;  1S1T A;  3MEE A;  4CIG A;  3NAE A;  1ZBI A;  1C0U A;  4C8K A;  1WAJ A;  4DSK A;  4CEO A;  3CYM A;  4CEE A;  4BDY A;  3V9S A;  5I3U A;  3KK2 A;  1KRP A;  3CM6 A;  5C24 A;  2ETJ A;  1JXB A;  2GUI A;  1LWF A;  1KVB A;  3OYC A;  3K59 A;  3U3Y A;  1D9F A;  4IBN A;  4CEB A;  1S1U A;  1C1C A;  4QOZ B;  4CFB A;  2EHG A;  1KVC A;  1FK9 A;  3AVF A;  4Y1D A;  3CG7 A;  1HYS A;  4DQS A;  5KTQ A;  4EZ9 A;  4CJV A;  1Y97 A;  4CJK A;  1BIZ A;  4OGC A;  3C94 A;  4F4K A;  1QS4 A;  4CGD A;  3S3N A;  4B9L A;  4CHQ A;  3OS2 A;  3QER A;  4PUO A;  4M3W A;  2ZE2 A;  4FJM A;  2FBY A;  3HPO A;  4B9V A;  1KFD A;  1RDB A;  3HST B;  3BDP A;  2IGI A;  2JLE A;  1C6V A;  5FRM A;  2B6A A;  3QEX A;  4OLA A;  1DLO A;  1A5V A;  1Q9X A;  1L3S A;  2Z1J A;  1ASV A;  3MXJ A;  4N5S A;  1HYZ A;  1DTQ A;  1GOA A;  4KPY A;  4KHW A;  2G8W A;  2DFF A;  4FLV A;  4I9L A;  4JRP A;  1IH7 A;  2YKN A;  1Q8I A;  4DWI A;  3AVN A;  3M8R A;  5EU7 A;  4CK2 A;  5C25 A;  1WSH A;  1NK5 A;  4FK0 A;  4E7H A;  4RW7 A;  4CF9 A;  3NF9 A;  2JGU A;  5KRT A;  1QSY A;  4M3Z A;  4CF2 A;  1BQM A;  1HJR A;  3L3U A;  2Z1I A;  3KK1 A;  4BE2 A;  2YNH A;  3KLE A;  1FXX A;  4RW9 A;  2HVH A;  3KTQ A;  3HK2 A;  2GBZ A;  4G1Q A;  3ZSO A;  3ISN C;  1NOZ A;  3LWL A;  1QQC A;  3K2P A;  1UA1 A;  3VQ4 A;  3NHG A;  1IO2 A;  2QKB A;  4O44 A;  3ZSQ A;  1SL0 A;  1RTH A;  4CFA A;  3V81 A;  3IRX A;  1EXQ A;  4FLU A;  1N5Y A;  4CJ5 A;  4FM0 A;  4B9T A;  3ZT2 A;  3M8Q A;  4CIF A;  4FJG A;  1BIU A;  4CJF A;  4FM1 A;  4E0D A;  1VSJ A;  1TK0 A;  4M3T A;  3QIN A;  3OYG A;  1LAW A;  4DS5 A;  3QEP A;  1X9W A;  3QET A;  1YTA A;  5CYM A;  4FLY A;  3SCX A;  3A2F A;  4N56 A;  2BGG A;  2EX3 A;  1F21 A;  1A5W A;  2KW4 A;  2OPS A;  5KGX A;  3V6D A;  3DLB A;  2E6L A;  4ID5 A;  3HJF A;  4B08 A;  3VA0 A;  3VQQ A;  3OYN A;  1U48 A;  2D5R A;  1O1W A;  3QLH A;  4CJE A;  1KLM A;  1J53 A;  3HVT A;  4Z0U A;  3OYA A;  3D0P A;  2DFH A;  4ID1 A;  1NK8 A;  3D45 A;  2QXF A;  4MQ3 A;  3OYD A;  1L3U A;  1D9D A;  4KRE A;  5CZ2 A;  1L3T A;  4PWD A;  3AVG A;  1A5X A;  1TL3 A;  1BGX T;  3V9X A;  4FLZ A;  3SQ0 A;  4M3X A;  1RT1 A;  3DLG A;  4I7F A;  4CJS A; 
#chains in the Genus database with same CATH topology
 4OLB A;  1N32 K;  3VEZ A;  4PL7 A;  4CCH A;  2A5X A;  3H6E A;  4OKJ A;  4FWR A;  1VRU A;  1REV A;  1VSL A;  3TAF A;  1R0A A;  4NO7 A;  4RW6 A;  4DTU A;  5AQZ A;  1U6Z A;  1YAG A;  3SLC A;  3ZYY X;  5FLX O;  2YJE A;  4E1M A;  3OBW A;  3NDK A;  3I56 N;  1VSF A;  4V19 S;  3B8A X;  1SUQ A;  3MEC A;  1N34 K;  1S6Q A;  1L5U A;  2YX6 A;  4JN4 A;  2E1Y A;  3CC4 N;  3L2V A;  4YOX A;  4AHR A;  4OVL A;  4JHD B;  5J2N A;  1K73 O;  1K8A O;  1NGC A;  4GY2 B;  1T03 A;  1EWR A;  4CVN E;  3O9R A;  4HTL A;  3VQB A;  3QML A;  3O4N A;  4FWL A;  3J7Y P;  2HBL A;  3CM5 A;  5D3G A;  5E26 A;  1TUY A;  3HP6 A;  4CEC A;  3C6U A;  2LSN A;  4H5T A;  5LMN K;  4F9O A;  2F8T A;  3W0L A;  3S3O A;  3T1Y K;  2E88 A;  4JK9 A;  3P5J A;  2ZD1 A;  3NH1 A;  4DSJ A;  1WB9 A;  1NWK A;  4RW8 A;  1LV5 A;  4CF1 A;  2HND A;  3RR8 A;  3K5N A;  4FLX A;  1NK7 A;  3ALY A;  4F2R A;  4FJ5 A;  3DXK B;  3NBP A;  1KC8 O;  4ICL A;  4DR1 K;  4XH1 A;  5B8H A;  3SAH A;  1E3M A;  2Q36 A;  4ISF A;  3RMC A;  1N6Q A;  4KB0 A;  4A61 A;  4UY8 O;  3VEX A;  4M41 A;  5JVH L;  2G8H A;  1OVY A;  4IO8 A;  4LD0 A;  4LF6 K;  3AVM A;  4DTO A;  4Y0W A;  2DY4 A;  4KHU A;  2J4R A;  4GMJ B;  4CGI A;  3T1A A;  3K9J A;  2D4W A;  2O8D A;  1NK4 A;  2X6S A;  4E3S A;  1E4G T;  5BR9 A;  4HVJ A;  3LP1 A;  3CCQ N;  5EOY A;  4BDZ A;  2FSJ A;  5H1S Q;  1X9M A;  3HTV A;  3QBW A;  4FZZ A;  4DTX A;  4BY9 C;  4FZX C;  4OPH A;  3PIP L;  1XNQ K;  2IVN A;  4H8K A;  1YJN N;  3AVK A;  1CZ9 A;  4PKG A;  4GV9 A;  4DF4 A;  2D0B A;  1G15 A;  4ELU A;  3GOI A;  4HWI A;  4BRH A;  1VSH A;  4DLE A;  2UU9 K;  1IKV A;  4K41 A;  3RTV A;  4R79 A;  3OYL A;  1XWL A;  3ENO A;  4DLG A;  3TAN A;  4EAH D;  3FZK A;  5M1P A;  1XI1 A;  4AHC A;  2BAN A;  3TAR A;  3WXK A;  4O55 A;  2FSN A;  1YHQ N;  3O3H A;  4GW6 A;  3TAP A;  4IXC A;  1RTJ A;  5EVZ A;  1T3V A;  2UXC K;  3AA3 A;  3OYJ A;  4DSF A;  1XHX A;  4BAC A;  3MN7 A;  3ZT4 A;  4LF5 K;  3G25 A;  2QWO A;  4W5Q A;  4JV5 K;  5CYQ A;  2IAJ A;  3SMS A;  3CHW A;  3I33 A;  1X9S A;  1H1V A;  3WQU A;  3O4W A;  5DK5 A;  1VRT A;  2P9I A;  1NJI O;  1U04 A;  3ZLJ A;  3LWM A;  2A6A A;  3L0Q A;  5GAG P;  3CCS N;  2WC9 A;  2F9T A;  4DU3 A;  2OTJ N;  4BR2 A;  4IDH A;  3AGR A;  3I8B A;  4JLH A;  1I94 K;  1JL2 A;  5GAD P;  2KZM A;  1HNV A;  3LM9 A;  4O8U A;  4JI1 K;  1YT3 A;  5AQP A;  1ILY A;  2HF4 A;  1ITG A;  3THX B;  4JKD A;  4PKH A;  4CEZ A;  4BVP A;  3KK7 A;  2FF3 B;  2E20 A;  2P9P A;  1XMO K;  2QWN A;  4CHP A;  4FVM A;  4CK3 A;  3LPU A;  3S3M A;  2VCP A;  4BR5 A;  1ZC6 A;  2D0A A;  4RG8 A;  1XNR K;  4JHD A;  4MO4 A;  4QS9 A;  2BTF A;  1HNX K;  4K8Z A;  1QQN A;  3DRP A;  4GVM A;  4FZY A;  2OA8 A;  3EKS A;  3OS0 A;  4RWT A;  1HMV A;  3T1H K;  3PUF A;  4M3X A;  1B9D A;  4A5B A;  2Q0R A;  3EE8 A;  3CER A;  3RRH A;  4KKO A;  2IVP A;  2E4L A;  2CGK A;  5E41 A;  5TKY A;  1OVQ A;  1QTM A;  3TAM A;  3LZI A;  1QE1 A;  2E6M A;  3WXJ A;  1CXU A;  2WTU A;  1KAZ A;  3DWL A;  4CHO A;  1RT3 A;  2FBV A;  5HRS A;  4FXD A;  3S41 A;  3O08 A;  3CCU N;  3VPZ A;  4Q5V A;  3ATV A;  4DSE A;  4OPK A;  1ESV A;  3SQ4 A;  1KCF A;  5BRF A;  5LMU K;  1NK0 A;  3EZW A;  2G8F A;  4FJH A;  4DTN A;  3I0S A;  1EET A;  1BWF O;  2P9U A;  3B6O A;  1MWM A;  3QIC A;  1GOB A;  3KK3 A;  2BE2 A;  4YOR A;  3EKU A;  1S1X A;  1UWB A;  3WEE A;  3NE6 A;  1MA9 B;  2HHV A;  1TV6 A;  4K0K K;  4H5R A;  4Q0B A;  4BC4 A;  4M45 A;  2DFE A;  4KHY A;  1UOC A;  5FPE A;  1W7A A;  3NF7 A;  1SKS A;  1WBB A;  4DV0 K;  3TAG A;  4QCL A;  1NNE A;  1RT6 A;  3SAF A;  2O4I A;  3CCE N;  4CZJ A;  3U4L A;  3HM9 A;  5ADX A;  5DMR A;  4ELV A;  3KJV A;  3SUO A;  3A8Y A;  4H0P A;  1VSE A;  2HNZ A;  4BRO A;  1YIJ N;  1RDC A;  3OYF A;  4CJQ A;  4H5V A;  3KHY A;  2UYT A;  3VEO A;  4DU4 A;  3DOK A;  4IOX A;  4WQ4 A;  3KLI A;  1LOT B;  2P5O A;  3KWI A;  5AQO A;  3MAQ A;  3AGK A;  4BVO A;  1S1W A;  4HUE A;  3NH2 A;  4DFK A;  3FLC O;  4DFM A;  1VSI A;  1HNW K;  4W5N A;  3WT0 A;  2W6L A;  4U67 L;  2ZQB A;  4WFN L;  3BZC A;  3CFP A;  2HHW A;  1B92 A;  3CJ9 A;  1VQ5 N;  4MDA A;  4CHZ A;  1ASU A;  3WNE A;  2YNF A;  4M3U A;  5KI6 A;  3O1W A;  5HLF A;  3VQP A;  3DAW A;  3FZF A;  4ILG B;  4IJA A;  5FDL A;  1KVA A;  2VWK A;  3C95 A;  4CZG A;  1TAU A;  2KFN A;  3P38 A;  5BPL A;  1EKE A;  3SUQ A;  4JI2 K;  2JWK A;  3H1Q A;  4CIG A;  2ZJR L;  1WAJ A;  5M1Q A;  4CEO A;  3V9S A;  4BC5 A;  4JKG B;  1KRP A;  5AQY A;  2GUI A;  1LWF A;  1KVB A;  1S1U A;  1HYS A;  4JD2 A;  4X62 K;  4OGC A;  2PBD A;  4FSV A;  3H3O B;  1QQO A;  4B9L A;  4PUO A;  3VGK A;  3HPO A;  1RDB A;  3QEX A;  3CCV N;  4GVE A;  2FF6 A;  1ASV A;  1DTQ A;  1GOA A;  2G8W A;  2DFF A;  1IH7 A;  3L6Q A;  3BF3 A;  5EU7 A;  4CK2 A;  2HOE A;  1NK5 A;  1P90 A;  1IJJ A;  1HKC A;  4RW7 A;  1BDG A;  5AR0 A;  5A2Q O;  3G6E N;  3KK1 A;  1JCE A;  4RW9 A;  3WXL A;  2GBZ A;  5CR4 A;  4G1Q A;  1NOZ A;  3HSC A;  3LWL A;  1QQC A;  3K2P A;  3MWT A;  1UA1 A;  4JNE A;  5C2D A;  4O44 A;  3ZSQ A;  4JI3 K;  1Z6R A;  4CFA A;  2NLX A;  3D2E A;  1EXQ A;  2P9I B;  4CJ5 A;  1J6Z A;  3QB0 A;  3GE1 A;  4CIF A;  2D0O A;  3MX2 A;  1LAW A;  3QEP A;  1YTA A;  2ZJP L;  2NNW A;  3A2F A;  4N56 A;  3D2E B;  2BGG A;  1DGK N;  4XEI A;  2W6K A;  4ID5 A;  3VQQ A;  4CJE A;  4Z0U A;  4IZ9 A;  1NK8 A;  2QXF A;  3BP8 A;  1D9D A;  4PWD A;  4DR6 K;  1A5X A;  1BGX T;  1RT1 A;  3ID8 A;  2NRZ A;  1IBK K;  3HYF A;  2O8F A;  4ZHR A;  3VEV A;  1VQ9 N;  4DQQ A;  1JLG A;  4YDU C;  3UKU A;  4EIA A;  1RTI A;  3OJS A;  3L3V A;  1NKC A;  3ULE A;  1EX4 A;  1S72 N;  3RWU A;  4BE0 A;  2F96 A;  3R9P A;  1I3A A;  2ITG A;  2Q1N A;  1ZYQ A;  3HO1 A;  2P51 A;  1TK5 A;  2XRI A;  3VQC A;  4LFC K;  2GX9 A;  3ULE B;  1TKD A;  4H5N A;  1GLC G;  1RT7 A;  1C0F A;  3EO3 A;  2YI1 A;  4GKJ K;  1QHT A;  5HRN A;  4LF4 K;  3THY A;  5GIO A;  4QS8 A;  3LAN A;  4QAG A;  4X64 K;  4L3Q A;  5J1E A;  2HHS A;  4IFV A;  4CEF A;  1TYQ A;  3HXM A;  2I7N A;  3D2F B;  2IIR A;  2XO7 A;  3TSQ A;  3DLL L;  4H03 B;  2X6N A;  4TSX A;  4GKK K;  4CD3 A;  4BRK A;  3HVR A;  1VQ7 N;  3TTD A;  2E5L K;  3LP3 A;  3J80 O;  2B4J A;  3VQD A;  2IOC A;  1WSF A;  3H08 A;  4KTQ A;  3OTO K;  4JEP A;  3CCL N;  3TAE A;  3AA2 A;  2I7P A;  3BZK A;  1ZBF A;  2X78 A;  4L8R B;  2XY6 A;  4MFB A;  3SI6 A;  2RPI A;  3UIQ A;  3K5L A;  5SWM A;  2RN2 A;  3ZT0 A;  3K0S A;  4AIL C;  2HB5 A;  3A5M C;  3CF5 L;  4WE1 A;  3QFU A;  2QA4 N;  4FJL A;  2VWB A;  2YNG A;  1SKW A;  3VN5 A;  4CJ7 A;  4RCH A;  4CED A;  4KBO A;  4CIE A;  1T6D A;  3C7N A;  3ZET A;  3ZSY A;  2YKM A;  3LAM A;  5AQU A;  3TAB A;  3UKR A;  1VHX A;  4M3R A;  3F9M A;  1BHL A;  2O8F B;  3WNG A;  4HHT A;  3U9Z A;  4PHT X;  3BUZ B;  3O5B A;  4CZM A;  2OPP A;  4H5W A;  4QS7 A;  3RMB A;  4EP4 A;  3ITH A;  3JXU A;  3K5M A;  5ADX H;  1XHZ A;  4N47 A;  4EHU A;  1NMD A;  2UUC K;  2RKI A;  4OPJ A;  3QES A;  3CQ8 A;  2YHA A;  2VQF K;  3TWH A;  4XH5 A;  1C1B A;  1FKO A;  1Q18 A;  4FCY A;  3PO4 A;  3C6T A;  2Y1I A;  4CHY A;  3DRR A;  4FWK A;  3ZCM A;  2E2Q A;  4JD2 B;  1ZBL A;  2G8V A;  4A62 A;  3KLH A;  1YJ9 N;  2YHW A;  2QEX N;  3CC7 N;  1NU0 A;  3TTC A;  3G0Z A;  4KTW A;  3AVA A;  3VTH A;  1S1V A;  3RR7 A;  2P1J A;  1FW6 A;  2P9L A;  3VOV A;  4NYN A;  2ASP A;  3IKM A;  3ATU A;  4PL8 A;  1LW2 A;  2AJQ A;  3QEV A;  3PX4 A;  1BG3 A;  2RHK A;  4DUZ K;  5AQF A;  4FM2 A;  1YIT N;  1MU2 A;  3CET A;  4CBW A;  2XY5 A;  1RDD A;  1T44 A;  4NCA A;  1JCG A;  3L4I A;  1QSS A;  4F3T A;  3LDP A;  3K9K A;  4PQU A;  4JKH A;  3VQE A;  1QVG M;  4NLB A;  4CI6 A;  1RDA A;  1QZ6 A;  4H4O A;  3MN5 A;  3SBG A;  4CZK A;  4DV3 K;  3QIO A;  3SK3 A;  1VQ8 N;  4JKA A;  2XY8 A;  4AF1 A;  4CHN A;  2DTU A;  3F2K A;  5M1K A;  3MXI A;  4YOV A;  4BG8 A;  4FJ7 A;  2PY5 A;  2G8U A;  3QEI A;  1WAF A;  4BQL A;  4FJK A;  1TKX A;  3DLG A;  1C0T A;  4JI4 K;  1RIL A;  1Z05 A;  3HZ6 A;  1BIS A;  3QIP A;  4CZL A;  2PAV A;  2QK9 A;  4CF8 A;  2UUB K;  4DR3 K;  2A1S A;  3R1X A;  1SL2 A;  4IO9 L;  3VEN A;  2UXD K;  4IG3 A;  2BUP A;  2ASO A;  4K43 A;  3IAY A;  2GWJ A;  3N4P A;  1BA0 A;  3U3G A;  3G71 N;  1OH5 A;  3K57 A;  4DB3 A;  3O1B A;  5BRD A;  1TVR A;  1HPZ A;  4LFB K;  5FRN A;  1HNZ K;  2IS3 A;  4FJJ A;  3AAQ A;  3E1Y A;  1X1P A;  4Z4F A;  1VK0 A;  3ID6 A;  4CZH A;  4KB1 A;  4KHS A;  3CJA A;  1W2B M;  4OO1 J;  2ZGY A;  4HUG A;  2JWL A;  4WF9 L;  5IWA K;  2O8C A;  1TYQ B;  1RBS A;  4IEE A;  3NF6 A;  1DT9 A;  5HRO A;  4Z4E A;  3ZSR A;  1BL3 A;  4JI0 K;  4B3S K;  1WOQ A;  2NUB A;  5FPD A;  3I55 N;  5KQ8 A;  4B1X B;  1T7P A;  5AQH A;  5AQX A;  2W41 A;  5AZI B;  3KLG A;  3OYB A;  5E84 A;  3CC2 N;  3N4Q A;  4M7Y A;  4DU1 A;  3DMJ A;  3DLE A;  4DV5 K;  3U8X A;  1RBR A;  4XH4 A;  1YF5 L;  3R6M A;  3DM2 A;  2ZF5 O;  4N76 A;  5JS1 A;  3EE9 A;  3THW A;  1P8Z A;  4C23 A;  2NRV A;  4E1J A;  1HKB A;  3ZSX A;  3F73 A;  4BRQ A;  1BI4 B;  4O8K A;  3JYT A;  2Z1G A;  4JKG A;  3KZB A;  4C8O A;  2D0C A;  1KTQ A;  4CJ4 A;  5BRH A;  1FKP A;  3L2R A;  2ZJQ L;  2I5J A;  3P1G A;  5HRP A;  4B3O A;  3GL1 A;  3QO9 A;  5BRE A;  2HMI A;  1X9J A;  4HCC A;  4FJ9 A;  4J8F A;  3H1V X;  2P5G A;  1BQN A;  4O0I A;  4BR0 A;  2RF2 A;  2GV9 A;  4JKF A;  2OZM A;  3NF8 A;  1U47 A;  1KAX A;  4DR7 K;  5AFU A;  4CF0 A;  2P9N B;  4AH9 A;  1D5A A;  3HI0 A;  1BUP A;  1S1T A;  2YHB A;  4JKB A;  3TU5 A;  4C8K A;  1G99 A;  2NZT A;  3KK2 A;  5C24 A;  3U3Y A;  3OYC A;  1C1C A;  4QOZ B;  2EHG A;  1KVC A;  3AVF A;  3CG7 A;  4JK8 A;  2WFB A;  2GEL A;  4CJV A;  3D7E O;  4WCE L;  4ILJ A;  3C94 A;  3S3N A;  3O9Q A;  4CHQ A;  3OS2 A;  4M3W A;  3LL3 A;  4B9Q A;  4B9V A;  4YY3 K;  3HST B;  3BDP A;  4JAX A;  1VQK N;  5FRM A;  1DLO A;  4OPA A;  2KKZ A;  1HYZ A;  4KPY A;  1Q8I A;  3OW2 M;  3AVN A;  3CJB A;  3NVK A;  3MN6 A;  3NF9 A;  5KRT A;  2O8B A;  1QSY A;  4CF2 A;  1HJR A;  3L3U A;  2Z1I A;  3M5R A;  4BE2 A;  2YNH A;  3KLE A;  3QDK A;  2HVH A;  3KTQ A;  3HK2 A;  4IFE A;  3ZSO A;  3VQ4 A;  3NHG A;  1IO2 A;  2QKB A;  1Q82 O;  3IDH A;  3V81 A;  3VTI A;  1BU6 O;  1MDU B;  4BGB A;  4B9T A;  1QVF M;  5GAE P;  4FJG A;  4CJF A;  4E0D A;  4ILH A;  1TK0 A;  3OYG A;  4KH6 A;  4A2A A;  4FLY A;  3SCX A;  3HM8 A;  2OPS A;  5KGX A;  5EXW A;  2E6L A;  2FSK A;  3LDQ A;  4AQY K;  5AZI A;  2HST A;  3QLH A;  5KPR A;  1KLM A;  3HVT A;  4FJI A;  2CGL A;  1V4S A;  3UB5 A;  1GLE G;  3O9S A;  3AVG A;  3C0B A;  3PLA A;  4BRC A;  4DQ8 A;  4WFA L;  4I7F A;  1VQ6 N;  4E7I A;  3SQ2 A;  4KI6 A;  4U7B A;  1WSG A;  3U6F A;  4KV8 A;  3VQA A;  4OKK A;  3CI5 A;  3LP0 A;  4B1Y B;  2HF3 A;  5BN8 A;  2VYP A;  4M63 C;  4CGF A;  4CGH A;  1YTU A;  3LAK A;  4OJR A;  3OYK A;  3EN9 A;  4DV1 K;  2Q2R A;  4N41 A;  4DR2 K;  4CJU A;  4BRL A;  4LY7 A;  5J2P A;  5AQR A;  1S5J A;  3KD1 E;  4NLC A;  1N8R O;  1WSI A;  4BRA A;  3O9U A;  1VQP N;  3DLH A;  3FGU A;  3UE5 A;  3CCM N;  1Q81 O;  4H0O A;  4BR9 A;  2KQ2 A;  1IV0 A;  1Z26 A;  4DSI A;  3J81 O;  1K9M O;  1X3M A;  3SZ2 A;  5HP1 A;  2XHB A;  1ASW A;  1WSJ A;  1GLA G;  4FJX A;  1V4T A;  5JS2 A;  2QWQ A;  3GDQ A;  1NOY A;  4C1N I;  3A0I X;  4RW4 A;  4YNQ A;  4HCB A;  4J2D A;  1C0M A;  1SAZ A;  2DPN A;  5C2F A;  3LZJ A;  4JS4 A;  1RT2 A;  2ZM6 K;  4BDP A;  4FK2 A;  3AAP A;  4EP5 A;  3DYA A;  2QXL A;  3AVL A;  4YFU A;  4CES A;  4FK4 A;  2V52 B;  3SUP A;  3DOL A;  3CFR A;  5LJW A;  1SL1 A;  3AO5 A;  3E9L A;  3AO4 A;  1KXP A;  2KZZ A;  4LH4 A;  4DTR A;  4FPB A;  2H3G X;  3TTF A;  3HBT A;  4NB4 A;  4WQ4 C;  2WBN A;  3HOS A;  1EP4 A;  2YNI A;  2YHX A;  4AHU A;  5IT9 O;  1M90 O;  3TR8 A;  4K8X A;  3DI6 A;  4XIU A;  1C1A A;  4MLE A;  3C6A A;  4YDU A;  5EY4 A;  3A5N C;  2OPR A;  4B1Z A;  1NBW A;  4F3O A;  2KTQ A;  1TK8 A;  3P39 A;  3P83 D;  4IKF A;  1BCM A;  2P9N A;  4ISG A;  1Z25 A;  4KRF A;  3L2W A;  1VQN N;  5F2R A;  1TAQ A;  3T7Z A;  2KFZ A;  1NGD A;  3WEE B;  2QWM A;  3KIO A;  1VQO N;  3ZSV A;  1SZ2 A;  1Q86 O;  3GG4 A;  5AQG A;  2BDP A;  4JI8 K;  3UKU B;  2P9L B;  4CBU A;  2VQE K;  3LDS A;  3HL8 A;  3ZEU A;  2E2P A;  1JXE A;  1ZBS A;  4FWO A;  4BR4 A;  3CMA N;  3R3L A;  1QHA A;  4GNI A;  4KO0 A;  1S6P A;  1HRH A;  3Q7C A;  4KAZ A;  2G8I A;  5DM6 L;  2XY7 A;  2HBM A;  1VQL N;  1NGF A;  3F5T A;  3RRG A;  4I2Q A;  4FYD A;  5AQQ A;  4YOU A;  2PZS A;  4ZTF A;  3JSM A;  2VG5 A;  3AO3 A;  4BRP A;  3DLK A;  5LJV A;  4BWJ A;  3SYZ A;  3VQ8 A;  4FOI A;  4BRN A;  3DXM A;  2VGN A;  4AHV A;  3WQT A;  3VQ6 A;  5KGW A;  3OBY A;  1WUA A;  3QNN A;  1W9H A;  2FLO A;  1JJ2 M;  1YUW A;  1RT5 A;  3RMD A;  5T7B A;  2NRX A;  4KTZ A;  3WXI A;  2HNY A;  5AQI A;  4BRE A;  4I9Q A;  3CPW M;  3AVC A;  5AQW A;  3CJC A;  5HOO A;  1SKR A;  1TL1 A;  3SNN A;  4DG1 A;  4FVU A;  2X74 A;  2P9S B;  1RBU A;  1XC9 A;  4DQP A;  4M3Y A;  4NXM K;  2Z1H A;  1JLQ A;  2HBJ A;  3G10 A;  3OYI A;  3FZL A;  1GOC A;  2OZS A;  5HRR A;  3MED A;  3MMV A;  1CZB A;  4PY5 A;  1LWC A;  2CH6 A;  2HHQ A;  3HP9 A;  1L3V A;  2D1K A;  2FXU A;  3EY1 A;  1XMQ K;  3DLR A;  2Q31 A;  3SQ1 A;  4IFY A;  1NG9 A;  1Q9Y A;  4FLT A;  2YV0 X;  2QW9 A;  1NMN A;  2OCE A;  1NJW A;  3V1R A;  4CJT A;  1RGI A;  2W40 A;  2PYL A;  4NCB A;  4H4M A;  1CLQ A;  1T05 A;  3ZEU B;  1VAZ A;  5KRS A;  3AV9 A;  3BGR A;  4FO0 A;  4JI5 K;  1ZBU A;  1E4F T;  4CEA A;  4KI4 A;  4CJW A;  4LSN A;  2FC0 A;  2W42 A;  2ATQ A;  1HPM A;  1HLU A;  2Q0U A;  2P9U B;  1IKY A;  1MWK A;  1YJW N;  3SUN A;  5C10 A;  2HW3 A;  2HHX A;  2PYJ A;  4JKE A;  3VQ7 A;  4CZE A;  5ELZ A;  4FW1 A;  5AQM A;  3CIP A;  3V1Q A;  1EWQ A;  3OA9 A;  4LF8 K;  4CGJ A;  1HKG A;  2NRH A;  1RTD A;  4CJL A;  3DXK A;  1BA1 A;  5TKW A;  3PY8 A;  1NJZ A;  3LP2 A;  4AHT A;  1T6C A;  2OYQ A;  2EWS A;  3LPT A;  3CD6 N;  3B6P A;  4EFH A;  4DF8 A;  1NGI A;  3NFA A;  2OTL N;  4E89 A;  4FL9 A;  4CEQ A;  1W97 L;  3FR0 A;  3SAG A;  1QZ5 A;  3NGI A;  4EHT A;  3CME N;  1WN7 A;  2P9S A;  3TSU A;  2QTD A;  3ZT3 A;  3L4Q A;  4Z4H A;  1IKX A;  1NKE A;  4B3M K;  1JLE A;  3V9U A;  1HUX A;  4PKI A;  2FBT A;  5AQT A;  4YHH K;  3Q7B A;  4W5R A;  1NM1 A;  1NJY A;  3MX5 A;  1ZBH A;  1NK6 A;  1TKZ A;  3FFI A;  3V9Z A;  1BOT O;  3OYH A;  1HJO A;  4CZF A;  1NGB A;  3QEW A;  5FRO A;  1S9E A;  4BC3 A;  1NGG A;  2F8S A;  1VSM A;  3K5O A;  4B9N A;  1ATS A;  4WFB L;  3R8E A;  3M8P A;  4BRG A;  3SPY A;  2VG6 A;  4KHP K;  3KLF A;  3TPQ A;  2E8A A;  3ULD A;  5AQS A;  1LAV A;  4J2B A;  3CXC M;  4NYF A;  3ZX2 A;  5BPN A;  1HQE A;  2V7Y A;  3O6W A;  5JVG L;  1SV5 A;  1KSP A;  3VQ5 A;  4BG9 A;  4C8L A;  3PX6 A;  3CFO A;  4CER A;  4J2A A;  1CXQ A;  4Y1C A;  3QNO A;  3D2F A;  3AVH A;  2E1Z A;  3OHR A;  5AZJ A;  1YXQ A;  1S22 A;  3KVG A;  2HBK A;  5M1O A;  3NAE A;  3MEE A;  1ZBI A;  2AP1 A;  4DSK A;  3CYM A;  4CEE A;  4BDY A;  4IOA L;  5I3U A;  2ETJ A;  2NRW A;  1FK9 A;  4EZ9 A;  5KTQ A;  1Y97 A;  4CJK A;  1BIZ A;  4CGD A;  3M1F A;  4IJN A;  4I6M A;  4CZI A;  3J7A P;  4FJM A;  5F0X A;  1KFD A;  4B1U B;  2P9K A;  4H0X B;  2JLE A;  2UXB K;  2B6A A;  4OLA A;  1HR0 K;  1DEJ A;  2Z1J A;  5AJ3 K;  1HX1 A;  4I9L A;  4JRP A;  4A2B A;  3SBT A;  3M8R A;  1RDU A;  5C25 A;  3VER A;  1WSH A;  2P9K B;  2GWK A;  4M3Z A;  2YJF A;  1BQM A;  2HHH K;  1IG8 A;  3VGL A;  3MDQ A;  3CCJ N;  4CW7 B;  3ISN C;  2QI2 A;  4K42 A;  1SL0 A;  1OH8 A;  4BC2 A;  3C6H A;  2NRR A;  4FM0 A;  3ZT2 A;  3VES A;  3PSF A;  3M8Q A;  2Q97 A;  1U2V A;  1BIU A;  4H0Y B;  3QIN A;  3QET A;  1GLL O;  4LFA K;  2EX3 A;  1F21 A;  1A5W A;  1R59 O;  3D6R A;  3VA0 A;  4OX9 K;  2V51 B;  1U48 A;  1O1W A;  2D5R A;  3E9P A;  3OYA A;  3D0P A;  1J53 A;  3H3N O;  4DQI A;  1L3U A;  3D45 A;  5BR8 K;  5CZ2 A;  4X66 K;  1TL3 A;  3V9X A;  4FLZ A;  5GIN A;  3SQ0 A;  5C0Y A;  3E66 A;  4CJS A;  5C42 A;  3HOT A;  4DQR A;  1VSD A;  5SZT A;  4BR7 A;  4MDB A;  3TI0 A;  3VA3 A;  1K6Y A;  3BEX A;  1J5O A;  4MLH A;  1XUP O;  4C1N K;  3A5L C;  4UQG A;  3VEW A;  4X65 K;  1YVN A;  3EEQ A;  3VMF B;  4FWP A;  1BCO A;  2VGM A;  3U9D A;  3MXM A;  5AQL A;  4FWQ A;  4FJN A;  3OYE A;  4DMN A;  2RE2 A;  4FW2 A;  1JLC A;  3HRG A;  4A59 A;  4FJ8 A;  1NKB A;  1TGO A;  5GIP A;  4KH5 A;  2A41 A;  1CZA N;  3JAM O;  3DRS A;  2PFU A;  4W5O A;  4IG0 A;  4B3T K;  1C0G A;  5JLH A;  3QFP A;  3AVJ A;  1Q7Y O;  3VQ9 A;  4EZ6 A;  2A3Z A;  4I6M B;  3KWG A;  2QWR A;  3THY B;  1HNI A;  1QSL A;  4FPA A;  3NGY A;  4C8N A;  1RDW X;  4B8A B;  2IC3 A;  1VQM N;  2OPQ A;  4B9U A;  4A57 A;  1BO5 O;  3SV3 A;  4DV2 K;  1I39 A;  3EZ5 A;  5I9E B;  1RCH A;  3ZX0 A;  4WQ5 A;  2ZWH A;  4O5F A;  4DS4 A;  3TAQ A;  5CY4 A;  5I42 A;  3DXM B;  3ZSZ A;  4ISE A;  2HHT A;  1HYV A;  4CJP A;  4F8R A;  1GLF O;  3SJJ A;  4E1N A;  1RBT A;  4JI6 K;  3ZSW A;  4OGE A;  4BRI A;  3HT3 A;  1EQY A;  4GV6 A;  4FWN A;  3T19 A;  5C15 A;  4GV3 A;  1IBL K;  4W5T A;  5JMV A;  4LF9 K;  2WOM A;  3NVM A;  4HUF A;  1U49 A;  3VF2 A;  2A1R A;  1J9A A;  2KHO A;  3V9W A;  3OY9 A;  3THV A;  5EX5 A;  1KQS M;  1LWE A;  3THX A;  3DJC A;  1DTT A;  1JL1 A;  1JLB A;  4H0V B;  4NXN K;  3I8D A;  3AA4 A;  3WNF A;  4PA1 A;  3OYM A;  4KH4 A;  4E7L A;  1NGH A;  4B8C A;  3C65 A;  3M3Z A;  1KD1 O;  4BWM A;  1U4B A;  2YCH A;  4JYA K;  3CQX A;  3L2U A;  3C7N B;  3J8A A;  1N36 K;  1O13 A;  1SS6 A;  2R7Y A;  4O5B A;  3FZH A;  1T8E A;  3VEY A;  2NRT A;  4BE1 A;  5J2Q A;  2O4G A;  3EL2 A;  3OS1 A;  3I0R A;  4BGA A;  2V7Z A;  3AO1 A;  3BF1 A;  3RMA A;  1W0H A;  4RTF D;  4KHN A;  2G8K A;  3KD5 E;  1N33 K;  2E2O A;  4Z4C A;  4DR4 K;  2VG7 A;  2FBX A;  5HBM A;  3PIO L;  3F9K A;  4AHS A;  5FPN A;  3AA5 X;  4CK1 A;  2F4V K;  4JK7 A;  1D8Y A;  4KHQ A;  2A40 A;  5J2M A;  4LH5 A;  5K14 A;  2ITM A;  2AA4 A;  2Q3S A;  5HL7 L;  3MEG A;  3AY9 A;  4F2S A;  1S9G A;  3FZM A;  4Z4G A;  4DTM A;  3V1O A;  1KAY A;  3ASM A;  3RSE B;  4WYB A;  2E2N A;  2QM1 A;  4B9S A;  1RT4 A;  3AO2 A;  4IEI A;  1JLA A;  1JLF A;  1WLJ A;  4CFC A;  2VWJ A;  2GUP A;  3ZX3 A;  4B1V A;  3WNH A;  1TKT A;  3HPH A;  3ENB A;  1VQ4 N;  2KLA A;  3G4S N;  1JCF A;  1GLD G;  3IG1 A;  3CCR N;  1M1K O;  3H46 O;  4LSL A;  4CFD A;  1XC3 A;  3IS9 A;  3NGZ A;  2GEM A;  1VSK A;  5FPM A;  4DTS A;  1YVU A;  1IG9 A;  3O3G A;  1NLV A;  3CQY A;  4MO5 A;  3L8B A;  5KPZ A;  1NK9 A;  2HHU A;  5CE3 A;  3K58 A;  3SPZ A;  3PX0 A;  3TSP A;  4BRM A;  4BRD A;  3T69 A;  1K8K B;  4DV4 K;  3JS6 A;  4G9Z A;  1J5E K;  1OH7 A;  3O3F A;  4DFJ A;  1FJG K;  3MWP A;  2O8D B;  3CJ7 A;  4DSL A;  3H45 C;  2B5J A;  3O80 A;  3V4I A;  1WBD A;  1KFS A;  3NCI A;  4B1W B;  5JIC A;  2O8B B;  3HPG A;  1IKW A;  4A5A A;  2ZGZ A;  1K8K A;  5M1N A;  3BY5 A;  1NGE A;  5AZJ B;  2CH5 A;  3RVC A;  3MN9 A;  3UKR B;  3NH0 A;  1S3X A;  2WON A;  5KPT A;  4C8M A;  1KLN A;  1UA0 A;  3S9H A;  4Z4I A;  4YOT A;  4AM6 A;  1LW0 A;  4BRF A;  1U45 A;  5AFU H;  4FWM A;  4ZTJ A;  2HVI A;  1JKH A;  5LY3 A;  4CBX A;  4HTU A;  3M8S A;  1NGJ A;  5MLC Q;  1QQM A;  1RNH A;  3LDN A;  1J54 A;  2BH1 A;  3O8M A;  4E7K A;  3AVI A;  3PO5 A;  4FOE A;  3ENH A;  4CD1 A;  3KKR A;  3LAL A;  4CJR A;  4DTJ A;  5CHI A;  4E19 A;  4LC9 B;  4JS5 A;  4DTP A;  1YI2 N;  1EO1 A;  1BI4 A;  2GTD A;  2UUA K;  4ELT A;  3RSE A;  1WSE A;  2O8C B;  3O4Q A;  4DKW A;  4CJ3 A;  1WNS A;  2Y1J A;  5CZ1 A;  3VF4 A;  4CGG A;  1HQU A;  1Y64 A;  4JKC A;  5BPM A;  3OVN A;  4M42 A;  1ATR A;  3EYZ A;  3GBT A;  4J2E A;  4DFP A;  4E7J A;  4OKE A;  3SV4 A;  1GLB G;  3VET A;  3PV8 A;  4JRQ A;  1UAX A;  3T3F A;  3OJU A;  1D4X A;  4R5P A;  4O4G A;  1GLJ O;  1NJX A;  1B9F A;  3E01 A;  4IDK A;  5BN9 A;  4I2P A;  4KFB A;  2QKK A;  5F1X A;  2O8E B;  3KKS A;  1TUU A;  3AVB A;  4O0J A;  5M1F A;  4WQ5 C;  3W3D A;  3VF6 A;  4B9M A;  4FLW A;  4NCG A;  1RBV A;  3ZET B;  1NGA A;  1OKJ A;  4FWS A;  2HMP A;  5KQD A;  3THW B;  5AQJ A;  3WUH A;  4Z94 A;  3SMP A;  1DKG D;  4JI7 K;  4CE9 A;  2O8E A;  3L2Q A;  2P9P B;  3ZT1 A;  3NMU A;  1ZXO A;  2IDO A;  1ATN A;  1RFQ A;  4H0T B;  1LCU A;  3P31 A;  1C0U A;  2F7T A;  3M6G A;  5C12 A;  3CM6 A;  1JXB A;  3K59 A;  3PSI A;  1D9F A;  4IBN A;  4CEB A;  4CFB A;  3IMX A;  4Y1D A;  4DQS A;  4F4K A;  1QS4 A;  2D0P A;  3QBX A;  3QER A;  2ZE2 A;  2FBY A;  3LDO A;  5JLF A;  3CPE A;  3IFR A;  2IGI A;  3O9T A;  1C6V A;  3LDL A;  1U2V B;  3J7Z O;  4LF7 K;  1Q9X A;  1A5V A;  3E9O A;  1L3S A;  3MXJ A;  4N5S A;  4KHW A;  4FLV A;  4AM7 A;  3WXM B;  2YKN A;  1SQK A;  4DHY A;  4DWI A;  3IUC A;  4DV7 K;  4FK0 A;  3SJH A;  4E7H A;  4CF9 A;  4DCH A;  2JGU A;  3FFK B;  5DM7 L;  4YOY A;  4B3R K;  1FXX A;  4K25 A;  3LM2 A;  2QWL A;  5AQN A;  5LL6 Z;  4BQZ A;  4DV6 K;  3FE1 A;  3AAR A;  1RTH A;  3P4I A;  3MK6 A;  3IRX A;  4M7X A;  4FLU A;  1N5Y A;  2IVO A;  3A5O C;  3CJ1 A;  5AQK A;  1IBM K;  5GAH P;  4FM1 A;  3MCP A;  2A42 A;  1VSJ A;  4M3T A;  1X9W A;  4DS5 A;  1OH6 A;  5CYM A;  1XQS C;  2CGJ A;  4YOW A;  2KW4 A;  4IOC L;  3V6D A;  3DLB A;  3HJF A;  2YHY A;  4B08 A;  4DUY K;  2ASM A;  4IWV A;  2OAN A;  5AQV A;  1X3N A;  2QWP A;  3OYN A;  4DR5 K;  2DFH A;  4ID1 A;  3OYD A;  4MQ3 A;  4KRE A;  2F9W A;  1L3T A;  2WUS A;  3VGM A;  3MCA B; 
#chains in the Genus database with same CATH homology
 4OLB A;  4E7I A;  3SQ2 A;  5C42 A;  4KI6 A;  3HYF A;  4DQR A;  1VSD A;  1WSG A;  4ZHR A;  3U6F A;  4DQQ A;  4KV8 A;  5SZT A;  1JLG A;  4OKJ A;  4OKK A;  3VQA A;  4CCH A;  3LP0 A;  1RTI A;  3TI0 A;  1VRU A;  3VA3 A;  3OJS A;  1REV A;  1VSL A;  3L3V A;  1K6Y A;  3TAF A;  1NKC A;  1J5O A;  4CGF A;  4CGH A;  1EX4 A;  1YTU A;  1R0A A;  3RWU A;  3LAK A;  4BE0 A;  2F96 A;  4OJR A;  1I3A A;  4UQG A;  3OYK A;  2ITG A;  4RW6 A;  4DTU A;  4N41 A;  1BCO A;  3MXM A;  1ZYQ A;  3HO1 A;  4CJU A;  5J2P A;  4LY7 A;  4E1M A;  4DMN A;  3OYE A;  3NDK A;  1S5J A;  1VSF A;  3KD1 E;  2P51 A;  1TK5 A;  2XRI A;  3VQC A;  4FW2 A;  1WSI A;  1JLC A;  1SUQ A;  4FJ8 A;  3MEC A;  1NKB A;  1TKD A;  1S6Q A;  1L5U A;  1TGO A;  3DLH A;  1RT7 A;  2KQ2 A;  3DRS A;  1Z26 A;  4DSI A;  4W5O A;  4IG0 A;  1QHT A;  5HRN A;  4FJ9 A;  3AVJ A;  3L2V A;  3VQ9 A;  4EZ6 A;  3LAN A;  4QAG A;  4AHR A;  3SZ2 A;  1HNI A;  4OVL A;  1QSL A;  5HP1 A;  3NGY A;  2XHB A;  5J2N A;  1ASW A;  5J1E A;  2HHS A;  1WSJ A;  1KFS A;  4IFV A;  4FJX A;  4CEF A;  5JS2 A;  1T03 A;  4C8N A;  4B8A B;  3HXM A;  1NOY A;  4RW4 A;  4YNQ A;  4HCB A;  4J2D A;  1C0M A;  2IC3 A;  3VQB A;  3O4N A;  2XO7 A;  3LZJ A;  2OPQ A;  4JS4 A;  4B9U A;  1RT2 A;  3CM5 A;  2X6N A;  4TSX A;  4BDP A;  3HVR A;  3SV3 A;  4FK2 A;  5D3G A;  4EP5 A;  3HP6 A;  4CEC A;  1I39 A;  3C6U A;  2LSN A;  3DYA A;  3EZ5 A;  1RCH A;  3LP3 A;  3AVL A;  4YFU A;  4CES A;  4DS4 A;  4FK4 A;  2B4J A;  4L8R B;  2F8T A;  3TAQ A;  3VQD A;  2IOC A;  3SUP A;  1WSF A;  3DOL A;  3H08 A;  3CFR A;  3S3O A;  4KTQ A;  5CY4 A;  5I42 A;  3ZSZ A;  1SL1 A;  3TAE A;  3AO5 A;  1HYV A;  4CJP A;  4F8R A;  3AO4 A;  3AA2 A;  2HHT A;  3SJJ A;  2KZZ A;  3P5J A;  4LH4 A;  4E1N A;  4DTR A;  1RBT A;  1ZBF A;  2ZD1 A;  3NH1 A;  4DSJ A;  3ZSW A;  4OGE A;  4RW8 A;  1LV5 A;  2X78 A;  4CF1 A;  3HT3 A;  4MFB A;  2HND A;  2XY6 A;  3RR8 A;  1EP4 A;  2YNI A;  4AHU A;  2RPI A;  3SI6 A;  3K5L A;  3UIQ A;  5SWM A;  2RN2 A;  3TR8 A;  3ZT0 A;  4K8X A;  4AIL C;  3T19 A;  3DI6 A;  2HB5 A;  3K5N A;  4FLX A;  4XIU A;  1C1A A;  3ALY A;  4WE1 A;  1NK7 A;  4F2R A;  4W5T A;  4FJ5 A;  3NBP A;  4FJL A;  2WOM A;  4ICL A;  4FJI A;  2OPR A;  2YNG A;  1SKW A;  4HUF A;  1U49 A;  4F3O A;  3RMC A;  2KTQ A;  1N6Q A;  3VN5 A;  1TK8 A;  3P83 D;  2A1R A;  1J9A A;  4KB0 A;  1BCM A;  4CED A;  3OY9 A;  3V9W A;  3THV A;  4IKF A;  1Z25 A;  4CIE A;  4DQI A;  4KRF A;  3L2W A;  1LWE A;  4M41 A;  1TAQ A;  3ZSY A;  2YKM A;  3LAM A;  3TAB A;  2G8H A;  2KFZ A;  4LD0 A;  1DTT A;  1JL1 A;  4M3R A;  1JLB A;  3AVM A;  3KIO A;  4DTO A;  2DY4 A;  1BHL A;  4KHU A;  3ZSV A;  4GMJ B;  3I8D A;  4CGI A;  3T1A A;  3AA4 A;  3WNF A;  3WNG A;  4HHT A;  1NK4 A;  4PA1 A;  3OYM A;  4E7L A;  2BDP A;  2X6S A;  4E3S A;  4HVJ A;  3LP1 A;  4B8C A;  2OPP A;  4BDZ A;  4BWM A;  3RMB A;  1U4B A;  1X9M A;  3LDS A;  3HL8 A;  4EP4 A;  3ITH A;  4FZZ A;  3K5M A;  4DTX A;  3L2U A;  4FZX C;  1JXE A;  1XHZ A;  4N47 A;  4H8K A;  2F8S A;  2RKI A;  2R7Y A;  4O5B A;  3AVK A;  4OPJ A;  1T8E A;  1CZ9 A;  3QES A;  3CQ8 A;  2YHA A;  3TWH A;  1C1B A;  1FKO A;  1S6P A;  1HRH A;  4KO0 A;  4KAZ A;  2G8I A;  4FCY A;  3PO4 A;  4BE1 A;  5J2Q A;  2O4G A;  3C6T A;  3OS1 A;  4DF4 A;  2XY7 A;  4CHY A;  2D0B A;  2Y1I A;  1G15 A;  3DRR A;  3I0R A;  3ZCM A;  4ELU A;  1VSH A;  3AO1 A;  3RMA A;  3RRG A;  4DLE A;  1W0H A;  4I2Q A;  1IKV A;  4FYD A;  1ZBL A;  2G8V A;  3RTV A;  3KLH A;  4KHN A;  2G8K A;  3KD5 E;  4Z4C A;  2PZS A;  2VG7 A;  3OYL A;  2FBX A;  1XWL A;  5HBM A;  4DLG A;  3TAN A;  4ZTF A;  3JSM A;  1XI1 A;  2VG5 A;  4AHC A;  2BAN A;  3AO3 A;  3TAR A;  4O55 A;  3O3H A;  3G0Z A;  3DLK A;  4KTW A;  4GW6 A;  3AVA A;  4BWJ A;  1S1V A;  3SYZ A;  2P1J A;  3VQ8 A;  3RR7 A;  3F9K A;  4NYN A;  3TAP A;  4AHS A;  1RTJ A;  4AHV A;  1LW2 A;  3AA5 X;  3VQ6 A;  5KGW A;  2AJQ A;  3QEV A;  4CK1 A;  3AA3 A;  3OYJ A;  3PX4 A;  1D8Y A;  3QNN A;  4DSF A;  1W9H A;  1XHX A;  4BAC A;  4FM2 A;  4KHQ A;  1MU2 A;  1RT5 A;  3ZT4 A;  3RMD A;  5T7B A;  4KTZ A;  2HNY A;  4W5Q A;  5J2M A;  4LH5 A;  5CYQ A;  5K14 A;  2XY5 A;  1RDD A;  2IAJ A;  2Q3S A;  4I9Q A;  4NCA A;  3AVC A;  3MEG A;  1QSS A;  4F2S A;  1S9G A;  1SKR A;  4F3T A;  1X9S A;  4Z4G A;  4DTM A;  3V1O A;  1TL1 A;  3ASM A;  4DG1 A;  3SNN A;  4PQU A;  5DK5 A;  2X74 A;  1VRT A;  3VQE A;  4B9S A;  3AO2 A;  1RT4 A;  1U04 A;  1RDA A;  1JLA A;  1RBU A;  4H4O A;  1JLF A;  1WLJ A;  4CFC A;  3LWM A;  2VWJ A;  1XC9 A;  4DQP A;  4M3Y A;  3WNH A;  1TKT A;  2Z1H A;  1JLQ A;  3G10 A;  3HPH A;  3QIO A;  3OYI A;  4DU3 A;  2XY8 A;  2DTU A;  4CHN A;  1GOC A;  2OZS A;  5HRR A;  3IG1 A;  3MED A;  3MXI A;  4JLH A;  4FJ7 A;  1CZB A;  2PY5 A;  4PY5 A;  1LWC A;  2G8U A;  1JL2 A;  3QEI A;  1WAF A;  4LSL A;  3V4I A;  2HHQ A;  3HP9 A;  4CFD A;  1L3V A;  2KZM A;  1HNV A;  3EY1 A;  4FJK A;  3IS9 A;  3NGZ A;  1YT3 A;  1TKX A;  1VSK A;  3DLR A;  1ITG A;  1C0T A;  4DTS A;  3SQ1 A;  4IFY A;  1YVU A;  1IG9 A;  3O3G A;  1RIL A;  4CEZ A;  1Q9Y A;  4FLT A;  1BIS A;  2YV0 X;  3QIP A;  1NJW A;  3V1R A;  4CJT A;  2QK9 A;  3L8B A;  4CF8 A;  4CHP A;  2PYL A;  4NCB A;  1NK9 A;  4FVM A;  4CK3 A;  2A1S A;  3LPU A;  2HHU A;  4H4M A;  3K58 A;  3S3M A;  1CLQ A;  3SPZ A;  3PX0 A;  1T05 A;  1SL2 A;  2D0A A;  4RG8 A;  4IG3 A;  5KRS A;  3IAY A;  4K8Z A;  3AV9 A;  3BGR A;  3DRP A;  4GVM A;  3O3F A;  4DFJ A;  4FZY A;  1ZBU A;  3U3G A;  2OA8 A;  3OS0 A;  4DSL A;  3K57 A;  4CEA A;  4KI4 A;  1HMV A;  2B5J A;  3PUF A;  4LSN A;  2FC0 A;  1B9D A;  1TVR A;  1HPZ A;  4CJW A;  2ATQ A;  2W42 A;  3HPG A;  3NCI A;  1IKW A;  4FJN A;  5FRN A;  3RRH A;  2IS3 A;  4KKO A;  1IKY A;  4FJJ A;  2E4L A;  1X1P A;  5E41 A;  3SUN A;  4Z4F A;  1VK0 A;  1QTM A;  3TAM A;  3NH0 A;  3LZI A;  1QE1 A;  2E6M A;  4KB1 A;  4KHS A;  2HW3 A;  2HHX A;  2WON A;  1CXU A;  4C8M A;  1KLN A;  2PYJ A;  1UA0 A;  3VQ7 A;  4CHO A;  1RT3 A;  3S9H A;  4FW1 A;  2FBV A;  4Z4I A;  4HUG A;  1LW0 A;  5HRS A;  4FXD A;  1U45 A;  3V1Q A;  4ZTJ A;  2HVI A;  1JKH A;  4Q5V A;  4CGJ A;  4HTU A;  3M8S A;  4DSE A;  1RTD A;  4OPK A;  4CJL A;  3SQ4 A;  1KCF A;  3PY8 A;  1NJZ A;  1RBS A;  1RNH A;  3NF6 A;  1NK0 A;  3LP2 A;  5HRO A;  4Z4E A;  1J54 A;  4AHT A;  3ZSR A;  2OYQ A;  2G8F A;  1BL3 A;  4FJH A;  4DTN A;  3I0S A;  4E7K A;  1EET A;  3AVI A;  3PO5 A;  3B6O A;  3LPT A;  3B6P A;  3KKR A;  3LAL A;  4CJR A;  1GOB A;  4DTJ A;  4DF8 A;  3KK3 A;  4E19 A;  2BE2 A;  3NFA A;  2NUB A;  4JS5 A;  1S1X A;  1UWB A;  4DTP A;  4E89 A;  3NE6 A;  4CEQ A;  1T7P A;  1TV6 A;  2HHV A;  1BI4 A;  4Q0B A;  4ELT A;  4M45 A;  2DFE A;  4KHY A;  1UOC A;  3KLG A;  3NGI A;  1WSE A;  3NF7 A;  1SKS A;  1WN7 A;  3O4Q A;  3OYB A;  3TAG A;  4QCL A;  3ZT3 A;  4CJ3 A;  4Z4H A;  4DU1 A;  3DMJ A;  1IKX A;  3DLE A;  1RT6 A;  1NKE A;  1WNS A;  1JLE A;  3V9U A;  2Y1J A;  5CZ1 A;  4CGG A;  1HQU A;  1RBR A;  2O4I A;  2FBT A;  4W5R A;  3HM9 A;  3DM2 A;  3OVN A;  4M42 A;  4ELV A;  5DMR A;  1NJY A;  3KJV A;  3SUO A;  3EYZ A;  4N76 A;  5JS1 A;  1ZBH A;  1VSE A;  1NK6 A;  1TKZ A;  4J2E A;  2HNZ A;  3FFI A;  4DFP A;  3V9Z A;  3OYH A;  1RDC A;  3OYF A;  4E7J A;  4CJQ A;  4OKE A;  3SV4 A;  3QEW A;  4DU4 A;  3DOK A;  3ZSX A;  5FRO A;  1S9E A;  3KLI A;  3F73 A;  4JRQ A;  1BI4 B;  3PV8 A;  1VSM A;  3K5O A;  2Z1G A;  1UAX A;  3JYT A;  3T3F A;  3OJU A;  4B9N A;  3M8P A;  4R5P A;  4O4G A;  4C8O A;  3MAQ A;  2D0C A;  3SPY A;  2VG6 A;  1NJX A;  1B9F A;  1KTQ A;  1S1W A;  4CJ4 A;  4HUE A;  1FKP A;  3NH2 A;  2P5O A;  3L2R A;  3KLF A;  4DFK A;  3E01 A;  4IDK A;  4DFM A;  1VSI A;  4I2P A;  3ULD A;  4W5N A;  2I5J A;  1LAV A;  3P1G A;  4KFB A;  2QKK A;  4J2B A;  5HRP A;  3KKS A;  4B3O A;  2ZQB A;  3AVB A;  4NYF A;  3QO9 A;  1HQE A;  4O0J A;  3CFP A;  2HMI A;  2HHW A;  1B92 A;  4HCC A;  1KSP A;  1SV5 A;  1ASU A;  3WNE A;  3VQ5 A;  4CHZ A;  2YNF A;  1RBV A;  4NCG A;  4FLW A;  1BQN A;  4B9M A;  4O0I A;  3PX6 A;  3CFO A;  2P5G A;  4CER A;  4C8L A;  4J2A A;  4M3U A;  2RF2 A;  5KI6 A;  2GV9 A;  5HLF A;  1CXQ A;  4Y1C A;  3VQP A;  2OZM A;  3NF8 A;  3QNO A;  1U47 A;  3AVH A;  5FDL A;  4CF0 A;  4CE9 A;  3L2Q A;  1KVA A;  2VWK A;  3ZT1 A;  3C95 A;  2IDO A;  4AH9 A;  1D5A A;  1TAU A;  2KFN A;  3SUQ A;  1EKE A;  2YHB A;  1S1T A;  3MEE A;  4CIG A;  3NAE A;  1ZBI A;  1C0U A;  4C8K A;  1WAJ A;  4DSK A;  4CEO A;  3CYM A;  4CEE A;  4BDY A;  3V9S A;  5I3U A;  3KK2 A;  1KRP A;  3CM6 A;  5C24 A;  2ETJ A;  1JXB A;  2GUI A;  1LWF A;  1KVB A;  3OYC A;  3K59 A;  3U3Y A;  1D9F A;  4IBN A;  4CEB A;  1S1U A;  1C1C A;  4QOZ B;  4CFB A;  2EHG A;  1KVC A;  1FK9 A;  3AVF A;  4Y1D A;  3CG7 A;  1HYS A;  4DQS A;  5KTQ A;  4EZ9 A;  4CJV A;  1Y97 A;  4CJK A;  1BIZ A;  4OGC A;  3C94 A;  4F4K A;  1QS4 A;  4CGD A;  3S3N A;  4B9L A;  4CHQ A;  3OS2 A;  3QER A;  4PUO A;  4M3W A;  2ZE2 A;  4FJM A;  2FBY A;  3HPO A;  4B9V A;  1KFD A;  1RDB A;  3HST B;  3BDP A;  2IGI A;  2JLE A;  1C6V A;  5FRM A;  2B6A A;  3QEX A;  4OLA A;  1DLO A;  1A5V A;  1Q9X A;  1L3S A;  2Z1J A;  1ASV A;  3MXJ A;  4N5S A;  1HYZ A;  1DTQ A;  1GOA A;  4KPY A;  4KHW A;  2G8W A;  2DFF A;  4FLV A;  4I9L A;  4JRP A;  1IH7 A;  2YKN A;  1Q8I A;  4DWI A;  3AVN A;  3M8R A;  5EU7 A;  4CK2 A;  5C25 A;  1WSH A;  1NK5 A;  4FK0 A;  4E7H A;  4RW7 A;  4CF9 A;  3NF9 A;  2JGU A;  5KRT A;  1QSY A;  4M3Z A;  4CF2 A;  1BQM A;  1HJR A;  3L3U A;  2Z1I A;  3KK1 A;  4BE2 A;  2YNH A;  3KLE A;  1FXX A;  4RW9 A;  2HVH A;  3KTQ A;  3HK2 A;  2GBZ A;  4G1Q A;  3ZSO A;  3ISN C;  1NOZ A;  3LWL A;  1QQC A;  3K2P A;  1UA1 A;  3VQ4 A;  3NHG A;  1IO2 A;  2QKB A;  4O44 A;  3ZSQ A;  1SL0 A;  1RTH A;  4CFA A;  3V81 A;  3IRX A;  1EXQ A;  4FLU A;  1N5Y A;  4CJ5 A;  4FM0 A;  4B9T A;  3ZT2 A;  3M8Q A;  4CIF A;  4FJG A;  1BIU A;  4CJF A;  4FM1 A;  4E0D A;  1VSJ A;  1TK0 A;  4M3T A;  3QIN A;  3OYG A;  1LAW A;  4DS5 A;  3QEP A;  1X9W A;  3QET A;  1YTA A;  5CYM A;  4FLY A;  3SCX A;  3A2F A;  4N56 A;  2BGG A;  2EX3 A;  1F21 A;  1A5W A;  2KW4 A;  2OPS A;  5KGX A;  3V6D A;  3DLB A;  2E6L A;  4ID5 A;  3HJF A;  4B08 A;  3VA0 A;  3VQQ A;  3OYN A;  1U48 A;  2D5R A;  1O1W A;  3QLH A;  4CJE A;  1KLM A;  1J53 A;  3HVT A;  4Z0U A;  3OYA A;  3D0P A;  2DFH A;  4ID1 A;  1NK8 A;  3D45 A;  2QXF A;  4MQ3 A;  3OYD A;  1L3U A;  1D9D A;  4KRE A;  5CZ2 A;  1L3T A;  4PWD A;  3AVG A;  1A5X A;  1TL3 A;  1BGX T;  3V9X A;  4FLZ A;  3SQ0 A;  4M3X A;  1RT1 A;  3DLG A;  4I7F A;  4CJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...