2RN2A

Structural details of ribonuclease h from escherichia coli as refined to an atomic resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural details of ribonuclease H from Escherichia coli as refined to an atomic resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1992-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rn2A00
4NCAA 4PWDA 3L3UA 1C1CA 4BDYA 1KVCA 4DLGA 4FYDA 4KI6A 4FJ5A 3QEVA 4KB1A 2XO7A 1A5WA 1GOBA 1GOCA 1ZBLA 2VWJA 3FFIA 1F21A 3NH0A 1KRPA 2E6LA 3AA5X 1R0AA 4CK1A 4O5BA 2IC3A 3S3NA 1SL2A 1HQEA 4HTUA 2Q3SA 3VQPA 1WN7A 3SQ4A 1ZBHA 2F96A 3IRXA 4CCHA 1JLCA 1EETA 1O1WA 2PYLA 2XY8A 3MECA 4CGDA 4KTZA 4ELTA 3D45A 3I0SA 2G8WA 3OYCA 4KAZA 3KLEA 4M3TA 3NAEA 4FCYA 4CE9A 1NK9A 3U3YA 1RBTA 3S3MA 1B9FA 4LSLA 4DQQA 4E7IA 4E7KA 2X78A 1WSEA 2HHXA 3M8RA 3DRPA 2GBZA 1S1TA 2QKKA 4B9TA 1VK0A 3MEDA 1N6QA 4DG1A 5HRSA 4M3WA 4Z4GA 2HHWA 1RT7A 3L2QA 4J2DA 1BCMA 2HHQA 1JLAA 1NKEA 4FK0A 4M3XA 4CEAA 4DTXA 5CZ1A 1XHXA 3PX6A 2F8SA 2FBVA 4FLTA 3S3OA 1RNHA 3OJSA 4DFJA 4FK4A 1Q8IA 1QSSA 2HHSA 3IG1A 3K57A 4MQ3A 4DTSA 3HL8A 1JXBA 4EZ6A 4I7FA 4BDZA 2G8VA 4FJMA 3VQDA 1WSIA 1HYVA 4Z0UA 4B9SA 5CYMA 1HJRA 4KPYA 4FJXA 1RCHA 4M42A 4KHSA 1QE1A 1S1VA 3P1GA 3RWUA 3CYMA 3K59A 5C42A 4EP4A 1IKYA 4W5TA 1BCOA 2E4LA 2B4JA 1REVA 4KTWA 3AO3A 3L3VA 2HVIA 4CJSA 2IAJA 3ZT0A 4B9VA 1TGOA 3DRSA 1CXUA 4DTJA 1Q9YA 1S5JA 3QEWA 3SPZA 1TAQA 2RN2A 4IFYA 3VA3A 2FBYA 4W5OA 1VRUA 3AVLA 1D5AA 3HP9A 3SNNA 1VSFA 2DFEA 3WNEA 4DSFA 1L3VA 5FRNA 3AA2A 1VSHA 3G0ZA 4E1NA 4EZ9A 1HQUA 5HBMA 3ULDA 1WSFA 3EZ5A 4CHZA 3KK1A 3L2WA 1C0UA 2D5RA 3K58A 1TKXA 1LW2A 4CGGA 4LH5A 2FBXA 1ASVA 2Z1GA 4RW4A 3OY9A 3MAQA 3DLBA 4HHTA 1C6VA 1JL2A 4B9MA 3VQAA 4JS4A 2DFFA 4RG8A 5C25A 3AO5A 3TAFA 3KD1E 3RMBA 4Q0BA 3VQ8A 1JLEA 4KV8A 3HO1A 1JL1A 4C8MA 2R7YA 5J2NA 1RT2A 2HHVA 3QESA 3OYDA 3AO2A 2HMIA 5HRNA 4MFBA 3PY8A 4UQGA 3O3HA 2ZQBA 1S6PA 4CJKA 3ASMA 4KHQA 2WOMA 3OYHA 3B6OA 1RDBA 3RR8A 2BE2A 4JLHA 3OYNA 4HUGA 1BIUA 4DTPA 3SQ0A 2HHTA 3OYIA 1CLQA 4BDPA 3CM6A 3I0RA 1MU2A 3V9WA 1SL1A 1VSEA 1RTJA 1RT5A 4O55A 3DRRA 3VQBA 4LY7A 1LAWA 1N5YA 1RT3A 4DWIA 1L5UA 1L3TA 1JXEA 4FXDA 4ZTJA 4KKOA 4FJLA 3TARA 1ZBFA 4CJQA 1UOCA 1LV5A 1S1UA 4FLZA 1L3SA 4B8CA 3C6TA 4I2QA 3AV9A 1FKOA 1TVRA 2KQ2A 2HVHA 3AA4A 4CHQA 3RMCA 3TAGA 4CJLA 3SPYA 4FW1A 3OS2A 3EY1A 1J5OA 3F73A 3LWLA 4IG0A 3ZSOA 4R5PA 1SKWA 4OPKA 1SKSA 3OYAA 1J53A 1UA1A 2D0BA 1D9DA 2PZSA 1CZ9A 4Z4CA 3NH2A 1U47A 1RT4A 1IKXA 5KTQA 4OLBA 4BWMA 4K8ZA 1WSJA 3AA3A 3MEEA 1Z25A 4CEQA 4CHYA 4DLEA 2P51A 3MXJA 1NKBA 2G8KA 1RILA 4KHNA 3IS9A 4F4KA 4NCBA 4E0DA 3WNHA 3CFPA 3DOLA 3ZSZA 3HT3A 1JLGA 3AVAA 4CFCA 3L2RA 4BE2A 1KLNA 3HK2A 4M45A 2ETJA 4BE1A 2HW3A 4FJHA 4FJGA 3U3GA 3ZT2A 3HPGA 4WE1A 3VQ4A 3RMAA 2KZZA 1I3AA 2OZMA 3OS0A 3AVKA 4J2EA 2W42A 3QNOA 5KI6A 1RBUA 2RKIA 4NYFA 3SI6A 2KFZA 3QIOA 4CESA 1BQMA 1TL3A 3ZT3A 4C8OA 3ITHA 3OYGA 2ATQA 1BQNA 3K5OA 5SZTA 1NJYA 1NK4A 1S9EA 4CGHA 4F2SA 3JYTA 4LH4A 5FDLA 4FLXA 3V9ZA 4F2RA 2EHGA 4IFVA 4CJTA 1J9AA 2X74A 1D9FA 4B9LA 1BI4B 3V9XA 3VQ5A 3TAPA 4FVMA 5CY4A 4CF2A 3U6FA 1KFSA 3K5MA 4KB0A 4IBNA 3VN5A 4CEZA 1W0HA 5CYQA 4N47A 2NUBA 3PX0A 3NCIA 4ELVA 2Z1HA 4I9LA 3WNFA 3BGRA 2XHBA 4CEEA 3AVNA 3QIPA 3CM5A 2I5JA 3NGYA 3RRGA 2B6AA 1DTQA 3AVBA 1RDDA 1FK9A 3M8QA 3V4IA 1KVBA 2A1SA 1HMVA 1FKPA 1JLQA 1S1WA 5DK5A 4CJUA 3OVNA 3S9HA 4E7JA 1UA0A 3PO5A 1KLMA 4M3RA 1KTQA 3CFRA 4H8KA 4FJ9A 4FM1A 1EXQA 1W9HA 2HHUA 5C24A 1DTTA 3KLFA 4CEOA 3AO1A 5HROA 3THVA 1TKDA 1L3UA 2PYJA 3SYZA 3UIQA 2JLEA 3F9KA 2XY6A 3NGIA 4DF8A 4DU4A 4PUOA 4G1QA 3SV4A 4AHCA 3LZIA 4LD0A 4W5RA 4CHOA 3D0PA 3KKRA 4Z4FA 2IDOA 1RDAA 3HJFA 1HRHA 5HRRA 1C0MA 2IOCA 4BWJA 2G8UA 1IO2A 1DLOA 5SWMA 1A5VA 3SUQA 4C8LA 2ZE2A 2YNHA 4AH9A 3OYJA 1CXQA 3RTVA 3NHGA 4FM0A 1RT1A 3WNGA 3ZCMA 4B3OA 3KD5E 4QCLA 3AVGA 4HUFA 4N41A 2Z1JA 2FC0A 3KKSA 3VQEA 3RRHA 1SV5A 1FXXA 3DLRA 4DU3A 3PO4A 1S1XA 2DFHA 2E6MA 1IKVA 2P1JA 4I2PA 1WAJA 3OYMA 2KZMA 3AVHA 3ZSQA 2F8TA 1T8EA 4FLVA 4DTUA 3V6DA 1CZBA 4O4GA 4FZXC 4FJIA 4M3YA 3HXMA 4W5QA 4OGEA 5HRPA 2RF2A 4NCGA 4QAGA 1VSKA 1HYSA 2GUIA 1TK5A 1XHZA 1SKRA 4C8KA 3TAEA 3NF8A 4YFUA 1XWLA 4DSJA 3V81A 4Z4IA 2HNYA 4KFBA 3CQ8A 4E89A 4DFMA 3LANA 2G8IA 3HVRA 1JLBA 1GOAA 4J2BA 4CIEA 2EX3A 3L8BA 4N56A 1J54A 3ZSVA 4HCCA 4KHUA 5JS1A 4EP5A 5KGWA 1NJXA 3SUPA 1ZBUA 4FZYA 4E7LA 1NKCA 1YTAA 4C8NA 4FLUA 1BISA 1LW0A 4QOZB 3O4NA 3IAYA 3K5NA 3QLHA 1BGXT 3V9UA 1QHTA 1YVUA 3DYAA 3H08A 4OGCA 1QSYA 1B9DA 1TL1A 2Y1IA 2Z1IA 3CFOA 3SCXA 1RDCA 4FJJA 4L8RB 3SQ2A 3EYZA 1RBRA 1RTIA 1U04A 4CF8A 3KJVA 4OKEA 1IG9A 2OYQA 2YNIA 4DQSA 2QKBA 3ALYA 1TKZA 4ELUA 2XY7A 3HP6A 4FJNA 3OYBA 4DSIA 1ITGA 4DS4A 1IH7A 4JRQA 3LP2A 4JS5A 4ID1A 1HNIA 2YHAA 5DMRA 4E1MA 2YKMA 4PY5A 4IG3A 3JSMA 1U49A 1NK8A 3RR7A 4H4MA 4BE0A 4DSEA 1QSLA 2RPIA 4OVLA 4TSXA 1WLJA 1YT3A 3NF7A 1NOZA 5K14A 4DF4A 3NE6A 1RTDA 3T19A 1D8YA 2IGIA 3HYFA 1X1PA 1U45A 3ZT1A 2OPPA 3HSTB 2DTUA 3E01A 3TI0A 4CERA 2VWKA 2G8FA 2FBTA 2WONA 4CGJA 4DS5A 1KFDA 4AILC 3QEXA 4W5NA 2B5JA 4ICLA 3LAMA 4CECA 3SJJA 1NJZA 4Y1CA 4PQUA 1C0TA 4AHUA 4CJFA 4CJPA 3AO4A 4K8XA 3DLKA 3LP3A 1RBVA 3LDSA 5FRMA 3C94A 1EP4A 4CJEA 2VG6A 1ZYQA 5FROA 4CF0A 1WSGA 4F3TA 3LPTA 3OYFA 3L2VA 4RW7A 4KO0A 3SZ2A 1B92A 3DMJA 4DMNA 5I42A 4B08A 1RBSA 3ZSYA 3QEIA 1TK8A 1ASWA 3OS1A 3QETA 3K2PA 3B6PA 3NF9A 5E41A 3TAQA 1SUQA 3HPOA 4E7HA 2VG5A 4DQPA 3DLEA 3KLIA 4CIGA 1ASUA 2YKNA 1EX4A 3DOKA 3LAKA 3M8SA 4DFKA 2HNZA 3TABA 1X9SA 1Q9XA 4KRFA 1T03A 2YHBA 3OYEA 3AVMA 1QQCA 3QINA 4LSNA 4IDKA 1UAXA 2OPSA 4ZTFA 3TAMA 2OZSA 4DTMA 1X9WA 3LP0A 4HCBA 3TANA 1G15A 1LWFA 4B8AB 3QERA 3SQ1A 3LP1A 3AVCA 3VQ7A 3P83D 3C6UA 4Y1DA 1VRTA 3O4QA 3V1RA 3ZSRA 4CF1A 2QXFA 4CHNA 3SUOA 4CF9A 4CFDA 2BDPA 1TKTA 3OJUA 1HPZA 3K5LA 3QEPA 4CJ3A 5J2MA 3O3FA 3VQQA 3ISNC 1WAFA 4YNQA 1A5XA 5J2PA 4H4OA 3C95A 4CEBA 4CIFA 2XY5A 1WSHA 2YNGA 1ZBIA 1QTMA 1RTHA 4FK2A 4RW8A 3TR8A 1NK6A 4DTOA 4CFAA 4O0IA 3TWHA 4FJ7A 1YTUA 1VSDA 3PUFA 2DY4A 1T7PA 3AVFA 4CJ4A 3LALA 2P5GA 1TK0A 2YNFA 2X6NA 4CEDA 4FZZA 3M8PA 1K6YA 4OPJA 3AVJA 4N5SA 3NFAA 3SUNA 4FLWA 4DFPA 3KK3A 3ZT4A 4M41A 3VQ6A 3LZJA 3PX4A 4OLAA 2KW4A 3T3FA 2YV0X 2BANA 1KCFA 3LPUA 4O0JA 4BACA 2PY5A 3T1AA 4N76A 4CJVA 2Y1JA 3ZSWA 3NGZA 1NJWA 1TAUA 1XI1A 1UWBA 4HUEA 4RW9A 4M3UA 4FJ8A 4O44A 1KSPA 3BDPA 3CG7A 4I9QA 1TV6A 4KTQA 2KTQA 2VG7A 1HYZA 3L2UA 4FLYA 5T7BA 2JGUA 4DU1A 3VQCA 1NOYA 4J2AA 4E19A 4NYNA 1VSJA 2O4IA 4FJKA 3OYLA 3LWMA 1BI4A 3ZSXA 4KREA 4F8RA 3HVTA 3DM2A 4CK3A 1LWEA 4GW6A 4OKJA 3G10A 3NBPA 2X6SA 3VQ9A 1BIZA 1NK5A 2HNDA 5EU7A 1C1BA 3AVIA 3HM9A 1LWCA 4DTNA 1KVAA 5J2QA 5JS2A 4CGFA 1EKEA 4Z4EA 2HB5A 2OPRA 1NK7A 4CGIA 3QO9A 4KI4A 1Y97A 3A2FA 4B9NA 4GMJB 1JKHA 1S9GA 4ID5A 5CZ2A 4RW6A 1HNVA 4AHTA 4CJ5A 5HLFA 1X9MA 1QS4A 3QNNA 2D0AA 3MXMA 3DLHA 4CK2A 3DI6A 3MXIA 2A1RA 4AHRA 3MEGA 4FW2A 5D3GA 3DLGA 2AJQA 4OJRA 1I39A 3P5JA 2ITGA 3V1OA 4DQRA 4IKFA 3V1QA 3KTQA 5KRTA 1U48A 4DQIA 2D0CA 3KLGA 4CJWA 3KK2A 4CJRA 3NDKA 3VA0A 3PV8A 1JLFA 5I3UA 2P5OA 1VSIA 3OYKA 3KLHA 1U4BA 3O3GA 3NH1A 4DSLA 5HP1A 1C1AA 1LAVA 4XIUA 3HPHA 4CHPA 4F3OA 4KHWA 2IS3A 4AHSA 5J1EA 3SV3A 4E3SA 2LSNA 2OA8A 4FM2A 1IKWA 5KGXA 4CEFA 1VSMA 1NK0A 2XRIA 2O4GA 4DTRA 2BGGA 1BL3A 1SL0A 1XC9A 2ZD1A 4OKKA 1T05A 3V9SA 4ZHRA 1S6QA 1RT6A 4JRPA 1BHLA 1Z26A 4Z4HA 2G8HA 4DSKA 1VSLA 5KRSA 4HVJA 4CFBA 1WNSA 3I8DA 3RMDA 4KHYA 4M3ZA 3NF6A 2OPQA 4GVMA 4AHVA 2QK9A 2GV9A 2KFNA 3KIOA 4PA1A 4Q5VA 4B9UA
chains in the Genus database with same CATH superfamily
4CZMA 2F4VK 4PWDA 3R9PA 4YDUC 1GOBA 1GOCA 5AQOA 3G71N 1F21A 2YJFA 1E3MA 4O5BA 4IOXA 5I9EB 3VPZA 4CI6A 4HTUA 3VQPA 1ZBHA 3DXKA 4QS8A 1M1KO 2PYLA 4CGDA 3I0SA 4KAZA 3NAEA 5TKWA 4FCYA 1Z05A 3U3YA 1RBTA 2P9LA 3C6HA 2P9KA 2HHXA 3S41A 3W0LA 3DRPA 2GBZA 2E2NA 3ZX0A 4B9TA 3H46O 3MEDA 1XMOK 4M3WA 1RT7A 4IO9L 2GUPA 3L4QA 4BRDA 3L2QA 1NKEA 4M3XA 3O9QA 4GNIA 1NGHA 4DTXA 5CZ1A 2FBVA 3U4LA 1Q8IA 3K57A 4MQ3A 5MLCQ 4EZ6A 4I7FA 3LDQA 3VQDA 1WSIA 4B9SA 3CQYA 5M1PA 1Q18A 5C42A 1BCOA 1REVA 2HVIA 2IAJA 3ZT0A 5AQMA 3DRSA 4YOUA 3QEWA 3SPZA 4K25A 1ILYA 3VA3A 1QZ5A 5TKYA 4Z4GA 1D5AA 3WNEA 5FRNA 4E1NA 3G0ZA 5FPEA 4JI3K 3EZWA 4CHZA 2GWJA 1WOQA 4BRPA 1TKXA 1LW2A 4LH5A 2FBXA 5GIPA 3U8XA 3OY9A 4C1NI 5EOYA 3DLBA 4B9MA 2P9UB 3VQAA 2DFFA 3TAFA 1NWKA 2IVPA 1W2BM 5J2NA 1RT2A 1GLLO 3FGUA 2A6AA 4DR2K 2YJEA 1S6PA 3E66A 4K42A 3B6OA 2BE2A 4JNEA 2HBJA 3SQ0A 2HHTA 2VGNA 3CM6A 4ILHA 3V9WA 4B3TK 3D2FB 4CD3A 3CHWA 3JAMO 4KKOA 1UOCA 4B8CA 3CCQN 1FKOA 2KQ2A 2QI2A 2HVHA 3EKUA 3EY1A 4IG0A 4IJAA 1TUUA 1SKSA 2UUBK 3CPWM 4V19S 4OLBA 1NGJA 3AA3A 2P51A 3IS9A 4BRIA 3WXKA 4WCEL 4YOVA 3DOLA 3ZSZA 4KI6A 3AVAA 4CFCA 4DV2K 2HW3A 2ETJA 4A57A 5BR9A 3EL2A 2P9NB 1JCEA 4WE1A 3VTIA 3AVKA 4DR6K 5KI6A 1RBUA 3KZBA 5JLHA 3THXA 4CESA 5AQUA 4DR1K 3ATVA 3ITHA 3K5OA 5SZTA 5C2DA 3CXCM 4F2RA 4CJTA 4B9LA 2CGKA 1BI4B 4U7BA 3VQ5A 3TAPA 2QEXN 3O9RA 1WB9A 4KB0A 4CEZA 1KAZA 5CYQA 3OHRA 4AM6A 2XHBA 3AVNA 3KK7A 3NGYA 2B6AA 4BGBA 3F2KA 1HMVA 4NLCA 3FZHA 3HRGA 4H0XB 2NRHA 3PO5A 3I33A 3A5NC 1KTQA 5BR8K 4H8KA 4KH5A 5BN9A 4BG9A 1E4GT 3DXMB 4DKWA 2O8BA 3F9KA 3NGIA 4DF8A 5AZIB 4G1QA 3CPEA 3SV4A 4WFNL 4LD0A 4CJ7A 4JHDA 4Z4FA 3HJFA 1IO2A 4KH6A 4BRAA 3SUQA 2ZE2A 2YNHA 1CXQA 5AQXA 4JI8K 1RT1A 2HMPA 2OANA 2WC9A 4HUFA 3VQEA 2Z1JA 3QDKA 3RRHA 4DU3A 2E6MA 1IKVA 3OYMA 3N4PA 2KZMA 4DTUA 1CZBA 2A3ZA 1BWFO 4IOAL 4IFEA 4QAGA 1HYSA 4C8KA 1X3MA 3EE9A 1YIJN 3TAEA 2FSNA 1MWKA 4E89A 1YJ9N 2O8DB 4IO8A 2G8IA 2EX3A 3DXKB 3O6WA 4FWLA 2D1KA 5HL7L 4H5TA 1FW6A 1BA1A 1SZ2A 2P9LB 2P9KB 2WTUA 4JKFA 2H3GX 1BGXT 4OGCA 1QSYA 3ZEUB 2Z1IA 3SCXA 3SQ2A 3EYZA 4FVUA 2YNIA 4DQSA 2XY7A 3HP6A 3OYBA 1ITGA 3EE8A 5JLFA 4L3QA 5AJ3K 3LP2A 4E1MA 4PY5A 2YKMA 2ZGZA 3CI5A 3PIPL 4CBWA 1QSLA 1WLJA 5M1FA 1RTDA 1D8YA 3LDPA 1GLBG 1X3NA 3LDOA 3E01A 4CERA 1EQYA 4CGJA 1YXQA 5F1XA 4CECA 3SJJA 1NJZA 4Y1CA 4AHUA 4CJFA 3I56N 3DLKA 3LP3A 3LDSA 3C94A 4CF0A 5AFUH 3VGMA 3SZ2A 3DMJA 1ASWA 2PAVA 3OS1A 3K2PA 5E41A 4KHUA 1OH7A 4CIGA 3TPQA 5LJWA 1Q9XA 4DR7K 1T03A 1QQCA 5E26A 1T6CA 4IDKA 3HSCA 4IXCA 4LF6K 3M3ZA 4DTMA 4HCBA 3CCSN 3TANA 3I55N 1G15A 3SJHA 3R8EA 1QQOA 4JKBA 4Y1DA 3ZSRA 2QXFA 2BDPA 3OJUA 3K5LA 2O8FA 5J2MA 3VQQA 5J2PA 1IJJA 3VF6A 4CEBA 4F9OA 4FJ7A 4O0IA 1YTUA 1T7PA 5AQZA 2P5GA 3LL3A 1TK0A 4JD2A 3M8PA 1K6YA 3A0IX 3HBTA 1T44A 3NFAA 5BPNA 1GLAG 3T3FA 2UXDK 4EHUA 1KCFA 3LPUA 1YHQN 5FLXO 4BACA 4BGAA 2HHHK 4CJVA 5DM6L 1TAUA 4M3UA 1KSPA 3GL1A 1HYZA 5T7BA 2JGUA 4E19A 4F8RA 1GLDG 1LWEA 4OKJA 1NK5A 3A5LC 1I94K 3HM9A 1LWCA 1KVAA 5J2QA 1EKEA 3THXB 3QMLA 3QO9A 3A2FA 4ID5A 1QS4A 4CK2A 3DI6A 2A1RA 4JI5K 3K9KA 4AHRA 3MEGA 1GLCG 3U9ZA 5F2RA 2ITGA 3CJCA 4IKFA 2P9PB 5I3UA 4O5FA 2NRZA 3AGKA 2F9TA 3NH1A 4LF4K 1C1AA 1K8KA 5KQDA 4ISFA 4QS7A 4F3OA 3SV3A 5J1EA 2OA8A 1VQ6N 5KGXA 1BL3A 2YI1A 5CE3A 3V9SA 3ULEA 1S6QA 4Z4HA 1EWQA 1VSLA 3MDQA 1WNSA 4KHYA 3NF6A 4GVMA 2KFNA 4PA1A 4BRQA 4B9UA 3NMUA 4B1WB 4JHDB 3QICA 4EFHA 4NCAA 4JK7A 1QQMA 2F7TA 3FFIA 1QQNA 2FF3B 3AA5X 3O08A 3SAGA 5DM7L 2Q3SA 1WN7A 4CW7B 4CCHA 1O1WA 1QZ6A 4WQ5C 3MECA 1XNRK 3ENHA 2A5XA 3C0BA 3D6RA 3SMSA 5AQLA 1ESVA 5C10A 3S3MA 1B9FA 2WUSA 4H5RA 3FLCO 5ADXA 3DWLA 4JYAK 3WQUA 3CMAN 4B3MK 4JN4A 2HHQA 4FK0A 3KWGA 1XHXA 4FLTA 2HHSA 3S3OA 1RNHA 2O8EA 3E9OA 3UKUB 4DTSA 1YAGA 3Q7BA 4BDZA 2G8VA 2QTDA 3SAFA 3O5BA 4Z0UA 1HJRA 3P1GA 4FPAA 2OTLN 4MO5A 3K59A 4I6MA 2B4JA 4KTWA 2AA4A 1HJOA 1TAQA 2RN2A 1SAZA 4YOWA 3SNNA 1VSFA 3AA2A 1VQMN 3HOTA 4MLEA 4QS9A 3EZ5A 3L2WA 3K58A 2D5RA 3VEXA 3CCEN 4CGGA 2P9SA 5JVHL 5LMNK 2I7PA 3MAQA 3RMBA 4Q0BA 3K0SA 3IFRA 3HO1A 3UB5A 4IZ9A 4AQYK 3OYDA 3AO2A 4C1NK 4MFBA 5AQKA 3E1YA 2ZQBA 4KHQA 3JXUA 4DTPA 2OTJN 4GY2B 4BDPA 1MU2A 3VERA 1VSEA 4YORA 4PL7A 3VQBA 3DRRA 4LY7A 1RT3A 2Q36A 4FJLA 1LV5A 1DKGD 4FLZA 2ZJQL 3C6TA 1HKGA 1TVRA 4CHQA 4FW1A 3OS2A 3LWLA 3ZSOA 3O1BA 3M5RA 4R5PA 2GELA 2D0BA 1D9DA 1OH5A 2PZSA 1YI2N 1IKXA 5KTQA 4K8ZA 3AARA 2D4WA 4CEQA 3MEEA 1Z25A 4DLEA 4CHYA 1TUYA 4NCBA 2ZJRL 3CFPA 4BE2A 3HT3A 1NGEA 4JD2B 2NNWA 3VF4A 4BE1A 3ZT2A 3HPGA 4A62A 4JKEA 2W42A 5JICA 1N8RO 3NVMA 2KFZA 1BQMA 3ZT3A 3D2EA 2ATQA 4LFCK 3FZKA 4JEPA 4IJNA 4CGHA 1P8ZA 5FDLA 3CJ9A 4IFVA 2X74A 1D9FA 4DCHA 5LMUK 4FVMA 5CY4A 1J6ZA 1KFSA 4IBNA 5M1OA 2NUBA 5EX5A 1HKBA 4B9QA 3NCIA 1RFQA 2Z1HA 4H0YB 3WNFA 1OVYA 4DV0K 1DTQA 5M1KA 3V4IA 5DK5A 3S9HA 1JLQA 3CC4N 4DV1K 2CGLA 2KHOA 4EHTA 4X62K 2GX9A 2NRRA 4FM1A 3GOIA 2O8CA 1S22A 3KLFA 4WQ4A 3THVA 3MX2A 1DEJA 4PUOA 2VWBA 2QWPA 4W5RA 4GV3A 4CHOA 3D0PA 2F9WA 3CERA 3CCRN 3J8AA 1XC3A 4BR9A 5BPMA 4AM7A 3BY5A 3OA9A 1DLOA 3UKRA 4BR7A 2KKZA 3FFKB 3H45C 3MCAB 3QFPA 3ZCMA 3AVGA 2ASOA 4N41A 2FC0A 3LM9A 3ULEB 2PFUA 2HSTA 4DR5K 2P1JA 4I2PA 2GWKA 1WAJA 4FLVA 1M90O 4O4GA 4FZXC 1VQ4N 1ZXOA 4OGEA 4NCGA 1N34K 2RE2A 1VSKA 2GUIA 3J7AP 5C0YA 1KD1O 4DV4K 3LANA 3BF3A 4DV5K 3HVRA 3G25A 1EWRA 4BRNA 5JS1A 3ZSVA 3W3DA 4EP5A 5KGWA 1NJXA 1K73O 4FZYA 1OKJA 1NKCA 1YTAA 4C8NA 1BISA 3O4NA 3K5NA 1IBMK 1QHTA 3DYAA 3TTDA 3UE5A 3KVGA 4L8RB 3QBWA 1RBRA 5AQTA 4CF8A 4OKEA 4PL8A 1TKZA 3MN7A 4DSIA 4ISGA 2QWOA 4XH1A 1IH7A 2E20A 3JSMA 3OBWA 4HTLA 4DSEA 4YHHK 4DF4A 3HYFA 3HSTB 3TI0A 2VWKA 3P38A 2G8FA 2FBTA 2YHWA 4AILC 3LAMA 1RBVA 4F3TA 5FROA 3L2VA 4PHTX 4B3RK 4DB3A 2J4RA 1D4XA 3C7NB 5I42A 4B08A 3P31A 4LC9B 2P9SB 4DQPA 3HPOA 4E7HA 3M8SA 1X9SA 2HNZA 4GVEA 4JKGB 2YHBA 4BQLA 4JV5K 3CJAA 4LSNA 3LP0A 3TSPA 2ZGYA 3SQ1A 3LP1A 3AVCA 3MN6A 3VEYA 2Q2RA 4WFBL 3C6UA 1VRTA 3SUOA 4CFDA 5FPNA 1HPZA 3QEPA 5ADXH 4CIFA 3QFUA 2YNGA 4FK2A 4XH4A 1NK6A 4CFAA 3SMPA 1Y64A 1KXPA 1NGDA 5AR0A 2DY4A 4CJ4A 2AP1A 3AVJA 1T6DA 2W41A 4DFPA 3O80A 3ZT4A 4M41A 3VQ6A 3Q7CA 3FZMA 4O0JA 3MCPA 2V7ZA 2PY5A 3IUCA 2UUAK 4LF7K 2Y1JA 1UWBA 1VQ7N 3HOSA 3CG7A 1TV6A 5BN8A 4KTQA 2VG7A 3WQTA 1U2VA 4DU1A 1VQ9N 2JWLA 1NOYA 3L4IA 4JKDA 4A2AA 1SQKA 3WEEA 3N4QA 3ZSXA 2E2QA 3ZLJA 4KREA 4CK3A 1KC8O 1BIZA 2IVOA 4E1JA 4IDHA 1C1BA 3AVIA 4JI7K 5JS2A 4CGFA 2HB5A 5A2QO 4CGIA 3TSQA 4KI4A 2HBMA 2QW9A 1S9GA 4CJ5A 5HLFA 2YCHA 1X9MA 2D0AA 2VYPA 3MXMA 3DLHA 3MXIA 5AQIA 2QWQA 5AQHA 3ID8A 4FW2A 4H0OA 1VQPN 4JKHA 3V1OA 4DQRA 4LF8K 5EXWA 5KRTA 2D0CA 3O8MA 3HM8A 4CJWA 3KK2A 3SBGA 3VA0A 4FWMA 3QBXA 3TTFA 3O3GA 3CCVN 4BRLA 5F0XA 3CJBA 2A42A 3TU5A 4AHSA 2GTDA 4CEFA 1NK0A 4JI6K 3CF5L 2XRIA 2O4GA 3ENOA 2W40A 2O8CB 3VMFB 4JRPA 5FPDA 5KRSA 4CFBA 3I8DA 2QK9A 4AHVA 2GV9A 3KIOA 4IWVA 4CBUA 4EZ9A 5AQNA 1WUAA 1FJGK 4CD1A 1KVCA 3BP8A 4FYDA 3QEVA 2XO7A 3THWA 1ZBLA 1WBBA 3ZX3A 2VWJA 3NH0A 2E6LA 4H5NA 4FWKA 5JMVA 1XUPO 4OPHA 4CK1A 1C0FA 1N32K 2OCEA 1JLCA 1EETA 1DT9A 2XY8A 4BRHA 3D45A 2G8WA 1RDWX 3OYCA 3KLEA 3CCUN 1BA0A 4CE9A 4M63C 4LSLA 4DQQA 4E7KA 2X78A 1TYQA 3M8RA 1S1TA 1NNEA 3AAQA 2QKKA 1VK0A 1N6QA 5HRSA 2HHWA 3KHYA 3A8YA 4JAXA 4CEAA 1HNWK 5BPLA 4BC3A 1QSSA 3EN9A 4IEEA 3J7ZO 1JXBA 4BRMA 1HYVA 4H0PA 1HLUA 2BUPA 4KPYA 4M42A 1S1VA 1ATRA 4EP4A 1IKYA 3GBTA 2E4LA 4B1UB 3L3VA 4CJSA 2ASMA 4B9VA 1TGOA 2QWNA 1Q9YA 2FBYA 4A5BA 4W5OA 1VRUA 3TSUA 4DSFA 1VSHA 4OPAA 3J81O 1HQUA 4MLHA 1WSFA 3R3LA 3KK1A 1JJ2M 1C0UA 5ELZA 2Z1GA 1Q7YO 3HTVA 1C6VA 3THYA 4RG8A 1JLEA 4B1VA 1JL1A 4C8MA 2HHVA 5JVGL 2HMIA 4UQGA 1ATNA 3O3HA 4CJKA 1H1VA 3OYHA 1RDBA 4M7XA 4R79A 4JLHA 4H0VB 4HUGA 1VQ8N 1BIUA 2VCPA 5KPRA 3EEQA 4DR3K 3OYIA 1CLQA 3I0RA 1G99A 4LFAK 1SL1A 1RT5A 4O55A 4DWIA 4UY8O 3CJ1A 1N5YA 1L5UA 4FO0A 1L3TA 1HUXA 3LM2A 3WXLA 4FXDA 1NGAA 1IG8A 3TARA 4JI2K 4CJQA 3TTCA 1S1UA 1L3SA 4I2QA 3AV9A 3G6EN 5EVZA 4BR5A 3AA4A 2QWMA 4YDUA 4CJLA 3T1YK 1J5OA 1IV0A 3F73A 4LF5K 1ZC6A 4MDBA 2O8BB 3OYAA 1J53A 1UA1A 5M1NA 4DV3K 1U47A 1RT4A 1IBLK 3CJ7A 3WXIA 1NKBA 2G8KA 4KHNA 4F4KA 1VQKN 4E0DA 4EAHD 4CZFA 1JLGA 1KLNA 2RHKA 4M45A 1XQSC 4FJHA 4M7YA 2ASPA 4JK8A 4BVPA 4FJGA 2KZZA 3OS0A 2Q31A 4J2EA 2P9UA 3QNOA 3FZFA 2RKIA 3SI6A 1BO5O 2W6KA 4C8OA 3OYGA 3AAPA 1NJYA 4NB4A 3ENBA 4F2SA 1U2VB 3SK3A 3JYTA 3P39A 4FLXA 3V9ZA 5AZJA 1J9AA 3VOVA 3WEEB 3GE1A 3BUZB 3HI0A 3K5MA 4K43A 3VN5A 2E88A 1W0HA 4PKIA 4N47A 3OBYA 5LY3A 1XMQK 3QIPA 3CM5A 1RDDA 1KVBA 2A1SA 3KTQA 4JI4K 4CJUA 3OVNA 5GINA 4E7JA 1UA0A 1KLMA 3F5TA 4M3RA 1EXQA 3SBTA 1W9HA 2HHUA 5C24A 1DTTA 3J7YP 2Q97A 4CEOA 3AO1A 3OTOK 1TKDA 1L3UA 2PYJA 3SYZA 4JI1K 5E84A 4AHCA 2V7YA 1MA9B 4RTFD 3KKRA 1RGIA 2IDOA 4LFBK 3H6EA 3VTHA 1HRHA 5HRRA 1C0MA 1NU0A 2WFBA 4AH9A 5GADP 3RTVA 1HR0K 1NMDA 4FM0A 3WNGA 3OW2M 3KD5E 2HBLA 2UYTA 3L0QA 3MK6A 3KKSA 1KAYA 1YITN 1FXXA 3PO4A 2DFHA 4FWOA 2ZF5O 3AVHA 3ZSQA 2NRTA 1T8EA 3IDHA 5KPZA 3V6DA 4FJIA 4M3YA 3CC7N 4W5QA 5AQJA 3WUHA 1XHZA 2QA4N 1TK5A 1SKRA 3NF8A 4YFUA 2V52B 4DSJA 4K41A 3V81A 1BDGA 5AQQA 3CQ8A 4DFMA 2WBNA 3CQXA 1JLBA 1GOAA 3L8BA 4N56A 4HCCA 2VQFK 1ZBUA 4JK9A 4E7LA 4CZHA 2A41A 4OX9K 4H5VA 4DUYK 3DAWA 3L6QA 4QOZB 4XEIA 1TYQB 3IAYA 3QLHA 3V9UA 1LOTB 1YVUA 4DQ8A 1TL1A 2Y1IA 3CFOA 4FJJA 3KJVA 1RTIA 1U04A 2O8FB 3G4SN 2QKBA 3ALYA 4O8KA 3T1HK 4ELUA 2Q0RA 4FJNA 2E5LK 1ZBSA 4CZEA 4A61A 1XNQK 4ID1A 5CHIA 2YHAA 5DMRA 1NK8A 5AQWA 1U49A 2HF4A 4BRKA 3RR7A 3IKMA 2RPIA 2BTFA 1YT3A 3NF7A 1NOZA 2E2OA 3BEXA 3FE1A 3NE6A 3U9DA 1X1PA 2DTUA 3O1WA 4XH5A 4FWSA 4DS5A 4FSVA 3QEXA 4W5NA 2IVNA 4ICLA 3PSFA 4CJPA 4FL9A 3H1VX 5FRMA 1ZYQA 3OYFA 5AQFA 4RW7A 1B92A 1VQLN 3DLLL 5KPTA 4GKJK 2O8DA 3ZSYA 1TK8A 4CZLA 3QETA 3TAQA 2QWRA 2VG5A 3DLEA 3KLIA 1EX4A 3DOKA 4DFKA 4KRFA 3THYB 3R6MA 3QINA 1HNXK 4LF9K 4ZTFA 5H1SQ 2OZSA 2E8AA 4DHYA 3R1XA 4KBOA 1VHXA 4FPBA 1NBWA 3P83D 4CHNA 3O4QA 3ZEUA 5GIOA 4CF9A 5HOOA 4YNQA 3B8AX 1WAFA 1A5XA 2XY5A 4BY9C 2UU9K 1GLEG 1RTHA 1C0GA 4RW8A 4DTOA 3PUFA 3AVFA 2UXCK 2YNFA 1K8KB 4NXMK 4CEDA 3H1QA 4OPJA 4RCHA 4N5SA 3RSEA 3SUNA 2YX6A 3T69A 4FLWA 2ITMA 1NGFA 2NRWA 4OLAA 2KW4A 3VEZA 3T7ZA 4A2BA 4B1YB 4BRGA 4N76A 1QVGM 3K9JA 1XI1A 4HUEA 4RW9A 1JCGA 4BC5A 3BZCA 2KTQA 3L2UA 4FLYA 4BRCA 1HKCA 3VQCA 3WXJA 4NYNA 2O4IA 1WBDA 3OYLA 2FXUA 4NXNK 4GW6A 4DR4K 2CGJA 3G10A 3NBPA 5EU7A 1BOTO 4DV7K 4Z4EA 2OPRA 1Y97A 4B9NA 1RDUA 1JKHA 4GMJB 5CZ2A 3QNNA 4OO1J 3CCMN 1KAXA 4PKGA 5AZJB 4A59A 3I8BA 4BREA 3DLGA 3P4IA 4OJRA 1I39A 1W7AA 5LJVA 4FOIA 4IEIA 3NDKA 2P5OA 2D0PA 5CR4A 4B1XB 2QXLA 4KH4A 4BVOA 4DSLA 1LAVA 2O8EB 4XIUA 3O9UA 3ZX2A 3HPHA 4CHPA 1O13A 4KHWA 4E3SA 2LSNA 4FM2A 1VSMA 2BGGA 1SL0A 2ZD1A 4OKKA 1T05A 4ZHRA 1NG9A 1RT6A 2E1YA 1BHLA 1Z26A 4IOCL 2I7NA 3CETA 4DSKA 2ZWHA 4HVJA 4BRFA 4BR0A 2OPQA 4I6MB 2CH5A 3ID6A 5KQ8A 2P9IA 2E2PA 3JS6A 1HPMA 3VEOA 3L3UA 1C1CA 4BDYA 4DLGA 2HF3A 4Y0WA 4FJ5A 4KB1A 1A5WA 1W97L 1KRPA 1R0AA 2IC3A 3S3NA 4BR4A 1SL2A 5AQGA 1HQEA 3SQ4A 2F96A 3IRXA 1DGKN 4ELTA 4KTZA 2CH6A 3GG4A 4M3TA 4DV6K 4B3SK 1NK9A 4FOEA 4E7IA 3A5OC 3VEWA 1WSEA 1BG3A 3EO3A 2ZM6K 2Q0UA 4DUZK 4DG1A 2P9PA 3NVKA 4J2DA 1BCMA 1JLAA 2QM1A 3C65A 2F8SA 3PX6A 1VQNN 3OJSA 4FK4A 4DFJA 3IG1A 3EKSA 3O9SA 3HL8A 1OVQA 4FJMA 1VAZA 3VF2A 5CYMA 5GAGP 4FJXA 1RCHA 4KHSA 1QE1A 3RWUA 2DPNA 3CYMA 4B1ZA 4W5TA 4Z94A 1YF5L 3AO3A 4FWNA 4H0TB 2JWKA 4O8UA 3MN9A 1CXUA 3J80O 4DTJA 1S5JA 4IFYA 4NO7A 2NRVA 3HP9A 3AVLA 2DFEA 4NLBA 1L3VA 3PSIA 2NLXA 4WQ4C 5HBMA 3ULDA 1NGIA 2E1ZA 4A5AA 1GLJO 1NLVA 4RW4A 1ASVA 1YJWN 4ISEA 4HHTA 1JL2A 3M6GA 1K9MO 4JS4A 5C25A 3AO5A 3KD1E 4FWRA 3VQ8A 4BQZA 4CZIA 4KV8A 2R7YA 3D2EB 3QESA 4BC2A 5HRNA 3PY8A 1BU6O 4J8FA 3ASMA 2WOMA 3RR8A 3OYNA 4CZJA 4CZGA 5B8HA 2FF6A 1RTJA 3UIQA 2VGMA 4WYBA 1LAWA 3UKUA 1JXEA 3SAHA 4ZTJA 1ZBFA 1N33K 1OH6A 3CD6N 5AQPA 4BROA 4KHPK 3RMCA 4CVNE 1U6ZA 3TAGA 3SPYA 1SKWA 4OPKA 3IMXA 1CZ9A 1J5EK 4Z4CA 3NH2A 2UUCK 4WQ5A 4BWMA 4H5WA 2V51B 1WSJA 3AGRA 3MXJA 1RILA 4X65K 3WNHA 3CCJN 3HK2A 3L2RA 3H3NO 3UKRB 2VQEK 3RSEB 3O9TA 3U3GA 3VESA 3VEVA 3VQ4A 5BRDA 3RMAA 1I3AA 2EWSA 2OZMA 4GV9A 4JI0K 4NYFA 4BR2A 2IIRA 3QIOA 3ZETA 1K8AO 1TL3A 4AF1A 1BQNA 1NK4A 5AQSA 1S9EA 4LH4A 1QHAA 2EHGA 5BRFA 1V4TA 3V9XA 4YOTA 3U6FA 4CF2A 3PX0A 4ELVA 4I9LA 1S3XA 2HBKA 3BGRA 3MX5A 4CEEA 2I5JA 3RRGA 3AVBA 1YUWA 1FK9A 3M8QA 1FKPA 1S1WA 1X9JA 1IBKK 1EO1A 1VQ5N 3CFRA 4FJ9A 3WXMB 3PLAA 5HROA 3CIPA 4CZKA 2JLEA 1Q81O 2XY6A 1NGGA 4DU4A 1KQSM 1Z6RA 3LZIA 5AQVA 3M1FA 4RWTA 2ZJPL 1RDAA 2G8UA 4BWJA 2IOCA 3QB0A 4C8LA 5SWMA 1A5VA 1E4FT 3OYJA 3NHGA 1N36K 4B3OA 4QCLA 2A40A 3DJCA 3VGLA 1SV5A 3DLRA 1S1XA 2D0OA 5C2FA 2F8TA 4FWPA 1P90A 5FPMA 3HXMA 2P9IB 2FLOA 3MWTA 5AQYA 5HRPA 2RF2A 4X64K 1HNZK 3CMEN 3WT0A 1V4SA 2BH1A 3MN5A 1XWLA 4Z4IA 2HNYA 4KFBA 3A5MC 4J2BA 4CIEA 1J54A 3RVCA 3VENA 3SUPA 4MO4A 1BUPA 5M1QA 1NGBA 4FLUA 1LW0A 3FR0A 4H03B 1Q86O 2YHXA 3H08A 3AY9A 1B9DA 4X66K 1T3VA 3E9PA 1RDCA 1HX1A 1IG9A 2OYQA 4DS4A 4JRQA 4BG8A 3PIOL 4JS5A 1HNIA 3ATUA 4PKHA 3ZYYX 4IG3A 3CC2N 4H4MA 4BE0A 5GAHP 4OVLA 4TSXA 5AQRA 1QVFM 5K14A 3T19A 4C23A 2IGIA 1U45A 3ZT1A 1NMNA 2OPPA 3VETA 3D7EO 1MDUB 2WONA 5IWAK 1KFDA 2B5JA 2FSKA 4PQUA 4CBXA 1C0TA 3AO4A 4K8XA 1EP4A 4CJEA 2VG6A 1WSGA 3LPTA 4KO0A 4WF9L 2NRXA 4DMNA 4WFAL 1RBSA 1OH8A 3QEIA 3D2FA 3NF9A 3B6PA 1SUQA 4YOXA 3TABA 1ASUA 2YKNA 3LAKA 5IT9O 2UXBK 3OYEA 3AVMA 2QWLA 1UAXA 2OPSA 3TAMA 5GAEP 1X9WA 1LWFA 4B8AB 3QERA 3CCLN 1MWMA 3VQ7A 3C6AA 3V1RA 4CF1A 5BRHA 1TKTA 1NGCA 4CJ3A 3O3FA 3ISNC 3BF1A 4H4OA 3C95A 3GDQA 4K0KK 1WSHA 1ZBIA 1QTMA 4YOYA 4HWIA 3TR8A 3TWHA 3FZLA 2HOEA 3KWIA 1VSDA 1SS6A 3LALA 4ILGB 2X6NA 5C12A 4FZZA 4G9ZA 4EIAA 2P9NA 1R59O 3MMVA 3KK3A 3LZJA 3HZ6A 3PX4A 2YV0X 2BANA 4U67L 3T1AA 2NZTA 3ZSWA 3NGZA 1NJWA 4JKAA 2FSJA 4FJ8A 4O44A 3BDPA 3E9LA 5BREA 4I9QA 4J2AA 1VSJA 4FJKA 3LWMA 1BI4A 3HVTA 3C7NA 3DM2A 3THWB 1YVNA 3LDNA 2X6SA 3VQ9A 5EY4A 2HNDA 3O4WA 1Q82O 2PBDA 4DTNA 4FWQA 4JKGA 1LCUA 1YJNN 4BC4A 3ZETB 1NK7A 1NM1A 2GEMA 3H3OB 2W6LA 4AHTA 2KLAA 1HNVA 4ILJA 4RW6A 1GLFO 2YHYA 1VQON 5C15A 3DXMA 3F9MA 5D3GA 2AJQA 3P5JA 5AZIA 3V1QA 1U48A 4DQIA 3KLGA 4CJRA 3PV8A 1JLFA 1VSIA 3OYKA 3KLHA 1U4BA 5HP1A 2Q1NA 1ATSA 3BZKA 3MWPA 2IS3A 1NJIO 1IKWA 1CZAN 4DTRA 1S72N 1JCFA 1XC9A 4YY3K 4JKCA 2G8HA 3SLCA 3RMDA 4M3ZA 4MDAA 3VGKA 4GKKK 5LL6Z 4Q5VA 4GV6A 5AFUA 3LDLA
chains in the Genus database with same CATH topology
4NCAA 4PWDA 3L3UA 1C1CA 4BDYA 1KVCA 4DLGA 4FYDA 4KI6A 4FJ5A 3QEVA 4KB1A 2XO7A 1A5WA 1GOBA 1GOCA 1ZBLA 2VWJA 3FFIA 1F21A 3NH0A 1KRPA 2E6LA 3AA5X 1R0AA 4CK1A 4O5BA 2IC3A 3S3NA 1SL2A 1HQEA 4HTUA 2Q3SA 3VQPA 1WN7A 3SQ4A 1ZBHA 2F96A 3IRXA 4CCHA 1JLCA 1EETA 1O1WA 2PYLA 2XY8A 3MECA 4CGDA 4KTZA 4ELTA 3D45A 3I0SA 2G8WA 3OYCA 4KAZA 3KLEA 4M3TA 3NAEA 4FCYA 4CE9A 1NK9A 3U3YA 1RBTA 3S3MA 1B9FA 4LSLA 4DQQA 4E7IA 4E7KA 2X78A 1WSEA 2HHXA 3M8RA 3DRPA 2GBZA 1S1TA 2QKKA 4B9TA 1VK0A 3MEDA 1N6QA 4DG1A 5HRSA 4M3WA 4Z4GA 2HHWA 1RT7A 3L2QA 4J2DA 1BCMA 2HHQA 1JLAA 1NKEA 4FK0A 4M3XA 4CEAA 4DTXA 5CZ1A 1XHXA 3PX6A 2F8SA 2FBVA 4FLTA 3S3OA 1RNHA 3OJSA 4DFJA 4FK4A 1Q8IA 1QSSA 2HHSA 3IG1A 3K57A 4MQ3A 4DTSA 3HL8A 1JXBA 4EZ6A 4I7FA 4BDZA 2G8VA 4FJMA 3VQDA 1WSIA 1HYVA 4Z0UA 4B9SA 5CYMA 1HJRA 4KPYA 4FJXA 1RCHA 4M42A 4KHSA 1QE1A 1S1VA 3P1GA 3RWUA 3CYMA 3K59A 5C42A 4EP4A 1IKYA 4W5TA 1BCOA 2E4LA 2B4JA 1REVA 4KTWA 3AO3A 3L3VA 2HVIA 4CJSA 2IAJA 3ZT0A 4B9VA 1TGOA 3DRSA 1CXUA 4DTJA 1Q9YA 1S5JA 3QEWA 3SPZA 1TAQA 2RN2A 4IFYA 3VA3A 2FBYA 4W5OA 1VRUA 3AVLA 1D5AA 3HP9A 3SNNA 1VSFA 2DFEA 3WNEA 4DSFA 1L3VA 5FRNA 3AA2A 1VSHA 3G0ZA 4E1NA 4EZ9A 1HQUA 5HBMA 3ULDA 1WSFA 3EZ5A 4CHZA 3KK1A 3L2WA 1C0UA 2D5RA 3K58A 1TKXA 1LW2A 4CGGA 4LH5A 2FBXA 1ASVA 2Z1GA 4RW4A 3OY9A 3MAQA 3DLBA 4HHTA 1C6VA 1JL2A 4B9MA 3VQAA 4JS4A 2DFFA 4RG8A 5C25A 3AO5A 3TAFA 3KD1E 3RMBA 4Q0BA 3VQ8A 1JLEA 4KV8A 3HO1A 1JL1A 4C8MA 2R7YA 5J2NA 1RT2A 2HHVA 3QESA 3OYDA 3AO2A 2HMIA 5HRNA 4MFBA 3PY8A 4UQGA 3O3HA 2ZQBA 1S6PA 4CJKA 3ASMA 4KHQA 2WOMA 3OYHA 3B6OA 1RDBA 3RR8A 2BE2A 4JLHA 3OYNA 4HUGA 1BIUA 4DTPA 3SQ0A 2HHTA 3OYIA 1CLQA 4BDPA 3CM6A 3I0RA 1MU2A 3V9WA 1SL1A 1VSEA 1RTJA 1RT5A 4O55A 3DRRA 3VQBA 4LY7A 1LAWA 1N5YA 1RT3A 4DWIA 1L5UA 1L3TA 1JXEA 4FXDA 4ZTJA 4KKOA 4FJLA 3TARA 1ZBFA 4CJQA 1UOCA 1LV5A 1S1UA 4FLZA 1L3SA 4B8CA 3C6TA 4I2QA 3AV9A 1FKOA 1TVRA 2KQ2A 2HVHA 3AA4A 4CHQA 3RMCA 3TAGA 4CJLA 3SPYA 4FW1A 3OS2A 3EY1A 1J5OA 3F73A 3LWLA 4IG0A 3ZSOA 4R5PA 1SKWA 4OPKA 1SKSA 3OYAA 1J53A 1UA1A 2D0BA 1D9DA 2PZSA 1CZ9A 4Z4CA 3NH2A 1U47A 1RT4A 1IKXA 5KTQA 4OLBA 4BWMA 4K8ZA 1WSJA 3AA3A 3MEEA 1Z25A 4CEQA 4CHYA 4DLEA 2P51A 3MXJA 1NKBA 2G8KA 1RILA 4KHNA 3IS9A 4F4KA 4NCBA 4E0DA 3WNHA 3CFPA 3DOLA 3ZSZA 3HT3A 1JLGA 3AVAA 4CFCA 3L2RA 4BE2A 1KLNA 3HK2A 4M45A 2ETJA 4BE1A 2HW3A 4FJHA 4FJGA 3U3GA 3ZT2A 3HPGA 4WE1A 3VQ4A 3RMAA 2KZZA 1I3AA 2OZMA 3OS0A 3AVKA 4J2EA 2W42A 3QNOA 5KI6A 1RBUA 2RKIA 4NYFA 3SI6A 2KFZA 3QIOA 4CESA 1BQMA 1TL3A 3ZT3A 4C8OA 3ITHA 3OYGA 2ATQA 1BQNA 3K5OA 5SZTA 1NJYA 1NK4A 1S9EA 4CGHA 4F2SA 3JYTA 4LH4A 5FDLA 4FLXA 3V9ZA 4F2RA 2EHGA 4IFVA 4CJTA 1J9AA 2X74A 1D9FA 4B9LA 1BI4B 3V9XA 3VQ5A 3TAPA 4FVMA 5CY4A 4CF2A 3U6FA 1KFSA 3K5MA 4KB0A 4IBNA 3VN5A 4CEZA 1W0HA 5CYQA 4N47A 2NUBA 3PX0A 3NCIA 4ELVA 2Z1HA 4I9LA 3WNFA 3BGRA 2XHBA 4CEEA 3AVNA 3QIPA 3CM5A 2I5JA 3NGYA 3RRGA 2B6AA 1DTQA 3AVBA 1RDDA 1FK9A 3M8QA 3V4IA 1KVBA 2A1SA 1HMVA 1FKPA 1JLQA 1S1WA 5DK5A 4CJUA 3OVNA 3S9HA 4E7JA 1UA0A 3PO5A 1KLMA 4M3RA 1KTQA 3CFRA 4H8KA 4FJ9A 4FM1A 1EXQA 1W9HA 2HHUA 5C24A 1DTTA 3KLFA 4CEOA 3AO1A 5HROA 3THVA 1TKDA 1L3UA 2PYJA 3SYZA 3UIQA 2JLEA 3F9KA 2XY6A 3NGIA 4DF8A 4DU4A 4PUOA 4G1QA 3SV4A 4AHCA 3LZIA 4LD0A 4W5RA 4CHOA 3D0PA 3KKRA 4Z4FA 2IDOA 1RDAA 3HJFA 1HRHA 5HRRA 1C0MA 2IOCA 4BWJA 2G8UA 1IO2A 1DLOA 5SWMA 1A5VA 3SUQA 4C8LA 2ZE2A 2YNHA 4AH9A 3OYJA 1CXQA 3RTVA 3NHGA 4FM0A 1RT1A 3WNGA 3ZCMA 4B3OA 3KD5E 4QCLA 3AVGA 4HUFA 4N41A 2Z1JA 2FC0A 3KKSA 3VQEA 3RRHA 1SV5A 1FXXA 3DLRA 4DU3A 3PO4A 1S1XA 2DFHA 2E6MA 1IKVA 2P1JA 4I2PA 1WAJA 3OYMA 2KZMA 3AVHA 3ZSQA 2F8TA 1T8EA 4FLVA 4DTUA 3V6DA 1CZBA 4O4GA 4FZXC 4FJIA 4M3YA 3HXMA 4W5QA 4OGEA 5HRPA 2RF2A 4NCGA 4QAGA 1VSKA 1HYSA 2GUIA 1TK5A 1XHZA 1SKRA 4C8KA 3TAEA 3NF8A 4YFUA 1XWLA 4DSJA 3V81A 4Z4IA 2HNYA 4KFBA 3CQ8A 4E89A 4DFMA 3LANA 2G8IA 3HVRA 1JLBA 1GOAA 4J2BA 4CIEA 2EX3A 3L8BA 4N56A 1J54A 3ZSVA 4HCCA 4KHUA 5JS1A 4EP5A 5KGWA 1NJXA 3SUPA 1ZBUA 4FZYA 4E7LA 1NKCA 1YTAA 4C8NA 4FLUA 1BISA 1LW0A 4QOZB 3O4NA 3IAYA 3K5NA 3QLHA 1BGXT 3V9UA 1QHTA 1YVUA 3DYAA 3H08A 4OGCA 1QSYA 1B9DA 1TL1A 2Y1IA 2Z1IA 3CFOA 3SCXA 1RDCA 4FJJA 4L8RB 3SQ2A 3EYZA 1RBRA 1RTIA 1U04A 4CF8A 3KJVA 4OKEA 1IG9A 2OYQA 2YNIA 4DQSA 2QKBA 3ALYA 1TKZA 4ELUA 2XY7A 3HP6A 4FJNA 3OYBA 4DSIA 1ITGA 4DS4A 1IH7A 4JRQA 3LP2A 4JS5A 4ID1A 1HNIA 2YHAA 5DMRA 4E1MA 2YKMA 4PY5A 4IG3A 3JSMA 1U49A 1NK8A 3RR7A 4H4MA 4BE0A 4DSEA 1QSLA 2RPIA 4OVLA 4TSXA 1WLJA 1YT3A 3NF7A 1NOZA 5K14A 4DF4A 3NE6A 1RTDA 3T19A 1D8YA 2IGIA 3HYFA 1X1PA 1U45A 3ZT1A 2OPPA 3HSTB 2DTUA 3E01A 3TI0A 4CERA 2VWKA 2G8FA 2FBTA 2WONA 4CGJA 4DS5A 1KFDA 4AILC 3QEXA 4W5NA 2B5JA 4ICLA 3LAMA 4CECA 3SJJA 1NJZA 4Y1CA 4PQUA 1C0TA 4AHUA 4CJFA 4CJPA 3AO4A 4K8XA 3DLKA 3LP3A 1RBVA 3LDSA 5FRMA 3C94A 1EP4A 4CJEA 2VG6A 1ZYQA 5FROA 4CF0A 1WSGA 4F3TA 3LPTA 3OYFA 3L2VA 4RW7A 4KO0A 3SZ2A 1B92A 3DMJA 4DMNA 5I42A 4B08A 1RBSA 3ZSYA 3QEIA 1TK8A 1ASWA 3OS1A 3QETA 3K2PA 3B6PA 3NF9A 5E41A 3TAQA 1SUQA 3HPOA 4E7HA 2VG5A 4DQPA 3DLEA 3KLIA 4CIGA 1ASUA 2YKNA 1EX4A 3DOKA 3LAKA 3M8SA 4DFKA 2HNZA 3TABA 1X9SA 1Q9XA 4KRFA 1T03A 2YHBA 3OYEA 3AVMA 1QQCA 3QINA 4LSNA 4IDKA 1UAXA 2OPSA 4ZTFA 3TAMA 2OZSA 4DTMA 1X9WA 3LP0A 4HCBA 3TANA 1G15A 1LWFA 4B8AB 3QERA 3SQ1A 3LP1A 3AVCA 3VQ7A 3P83D 3C6UA 4Y1DA 1VRTA 3O4QA 3V1RA 3ZSRA 4CF1A 2QXFA 4CHNA 3SUOA 4CF9A 4CFDA 2BDPA 1TKTA 3OJUA 1HPZA 3K5LA 3QEPA 4CJ3A 5J2MA 3O3FA 3VQQA 3ISNC 1WAFA 4YNQA 1A5XA 5J2PA 4H4OA 3C95A 4CEBA 4CIFA 2XY5A 1WSHA 2YNGA 1ZBIA 1QTMA 1RTHA 4FK2A 4RW8A 3TR8A 1NK6A 4DTOA 4CFAA 4O0IA 3TWHA 4FJ7A 1YTUA 1VSDA 3PUFA 2DY4A 1T7PA 3AVFA 4CJ4A 3LALA 2P5GA 1TK0A 2YNFA 2X6NA 4CEDA 4FZZA 3M8PA 1K6YA 4OPJA 3AVJA 4N5SA 3NFAA 3SUNA 4FLWA 4DFPA 3KK3A 3ZT4A 4M41A 3VQ6A 3LZJA 3PX4A 4OLAA 2KW4A 3T3FA 2YV0X 2BANA 1KCFA 3LPUA 4O0JA 4BACA 2PY5A 3T1AA 4N76A 4CJVA 2Y1JA 3ZSWA 3NGZA 1NJWA 1TAUA 1XI1A 1UWBA 4HUEA 4RW9A 4M3UA 4FJ8A 4O44A 1KSPA 3BDPA 3CG7A 4I9QA 1TV6A 4KTQA 2KTQA 2VG7A 1HYZA 3L2UA 4FLYA 5T7BA 2JGUA 4DU1A 3VQCA 1NOYA 4J2AA 4E19A 4NYNA 1VSJA 2O4IA 4FJKA 3OYLA 3LWMA 1BI4A 3ZSXA 4KREA 4F8RA 3HVTA 3DM2A 4CK3A 1LWEA 4GW6A 4OKJA 3G10A 3NBPA 2X6SA 3VQ9A 1BIZA 1NK5A 2HNDA 5EU7A 1C1BA 3AVIA 3HM9A 1LWCA 4DTNA 1KVAA 5J2QA 5JS2A 4CGFA 1EKEA 4Z4EA 2HB5A 2OPRA 1NK7A 4CGIA 3QO9A 4KI4A 1Y97A 3A2FA 4B9NA 4GMJB 1JKHA 1S9GA 4ID5A 5CZ2A 4RW6A 1HNVA 4AHTA 4CJ5A 5HLFA 1X9MA 1QS4A 3QNNA 2D0AA 3MXMA 3DLHA 4CK2A 3DI6A 3MXIA 2A1RA 4AHRA 3MEGA 4FW2A 5D3GA 3DLGA 2AJQA 4OJRA 1I39A 3P5JA 2ITGA 3V1OA 4DQRA 4IKFA 3V1QA 3KTQA 5KRTA 1U48A 4DQIA 2D0CA 3KLGA 4CJWA 3KK2A 4CJRA 3NDKA 3VA0A 3PV8A 1JLFA 5I3UA 2P5OA 1VSIA 3OYKA 3KLHA 1U4BA 3O3GA 3NH1A 4DSLA 5HP1A 1C1AA 1LAVA 4XIUA 3HPHA 4CHPA 4F3OA 4KHWA 2IS3A 4AHSA 5J1EA 3SV3A 4E3SA 2LSNA 2OA8A 4FM2A 1IKWA 5KGXA 4CEFA 1VSMA 1NK0A 2XRIA 2O4GA 4DTRA 2BGGA 1BL3A 1SL0A 1XC9A 2ZD1A 4OKKA 1T05A 3V9SA 4ZHRA 1S6QA 1RT6A 4JRPA 1BHLA 1Z26A 4Z4HA 2G8HA 4DSKA 1VSLA 5KRSA 4HVJA 4CFBA 1WNSA 3I8DA 3RMDA 4KHYA 4M3ZA 3NF6A 2OPQA 4GVMA 4AHVA 2QK9A 2GV9A 2KFNA 3KIOA 4PA1A 4Q5VA 4B9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCA A;  4PWD A;  3L3U A;  1C1C A;  4BDY A;  1KVC A;  4DLG A;  4FYD A;  4KI6 A;  4FJ5 A;  3QEV A;  4KB1 A;  2XO7 A;  1A5W A;  1GOB A;  1GOC A;  1ZBL A;  2VWJ A;  3FFI A;  1F21 A;  3NH0 A;  1KRP A;  2E6L A;  3AA5 X;  1R0A A;  4CK1 A;  4O5B A;  2IC3 A;  3S3N A;  1SL2 A;  1HQE A;  4HTU A;  2Q3S A;  3VQP A;  1WN7 A;  3SQ4 A;  1ZBH A;  2F96 A;  3IRX A;  4CCH A;  1JLC A;  1EET A;  1O1W A;  2PYL A;  2XY8 A;  3MEC A;  4CGD A;  4KTZ A;  4ELT A;  3D45 A;  3I0S A;  2G8W A;  3OYC A;  4KAZ A;  3KLE A;  4M3T A;  3NAE A;  4FCY A;  4CE9 A;  1NK9 A;  3U3Y A;  1RBT A;  3S3M A;  1B9F A;  4LSL A;  4DQQ A;  4E7I A;  4E7K A;  2X78 A;  1WSE A;  2HHX A;  3M8R A;  3DRP A;  2GBZ A;  1S1T A;  2QKK A;  4B9T A;  1VK0 A;  3MED A;  1N6Q A;  4DG1 A;  5HRS A;  4M3W A;  4Z4G A;  2HHW A;  1RT7 A;  3L2Q A;  4J2D A;  1BCM A;  2HHQ A;  1JLA A;  1NKE A;  4FK0 A;  4M3X A;  4CEA A;  4DTX A;  5CZ1 A;  1XHX A;  3PX6 A;  2F8S A;  2FBV A;  4FLT A;  3S3O A;  1RNH A;  3OJS A;  4DFJ A;  4FK4 A;  1Q8I A;  1QSS A;  2HHS A;  3IG1 A;  3K57 A;  4MQ3 A;  4DTS A;  3HL8 A;  1JXB A;  4EZ6 A;  4I7F A;  4BDZ A;  2G8V A;  4FJM A;  3VQD A;  1WSI A;  1HYV A;  4Z0U A;  4B9S A;  5CYM A;  1HJR A;  4KPY A;  4FJX A;  1RCH A;  4M42 A;  4KHS A;  1QE1 A;  1S1V A;  3P1G A;  3RWU A;  3CYM A;  3K59 A;  5C42 A;  4EP4 A;  1IKY A;  4W5T A;  1BCO A;  2E4L A;  2B4J A;  1REV A;  4KTW A;  3AO3 A;  3L3V A;  2HVI A;  4CJS A;  2IAJ A;  3ZT0 A;  4B9V A;  1TGO A;  3DRS A;  1CXU A;  4DTJ A;  1Q9Y A;  1S5J A;  3QEW A;  3SPZ A;  1TAQ A;  2RN2 A;  4IFY A;  3VA3 A;  2FBY A;  4W5O A;  1VRU A;  3AVL A;  1D5A A;  3HP9 A;  3SNN A;  1VSF A;  2DFE A;  3WNE A;  4DSF A;  1L3V A;  5FRN A;  3AA2 A;  1VSH A;  3G0Z A;  4E1N A;  4EZ9 A;  1HQU A;  5HBM A;  3ULD A;  1WSF A;  3EZ5 A;  4CHZ A;  3KK1 A;  3L2W A;  1C0U A;  2D5R A;  3K58 A;  1TKX A;  1LW2 A;  4CGG A;  4LH5 A;  2FBX A;  1ASV A;  2Z1G A;  4RW4 A;  3OY9 A;  3MAQ A;  3DLB A;  4HHT A;  1C6V A;  1JL2 A;  4B9M A;  3VQA A;  4JS4 A;  2DFF A;  4RG8 A;  5C25 A;  3AO5 A;  3TAF A;  3KD1 E;  3RMB A;  4Q0B A;  3VQ8 A;  1JLE A;  4KV8 A;  3HO1 A;  1JL1 A;  4C8M A;  2R7Y A;  5J2N A;  1RT2 A;  2HHV A;  3QES A;  3OYD A;  3AO2 A;  2HMI A;  5HRN A;  4MFB A;  3PY8 A;  4UQG A;  3O3H A;  2ZQB A;  1S6P A;  4CJK A;  3ASM A;  4KHQ A;  2WOM A;  3OYH A;  3B6O A;  1RDB A;  3RR8 A;  2BE2 A;  4JLH A;  3OYN A;  4HUG A;  1BIU A;  4DTP A;  3SQ0 A;  2HHT A;  3OYI A;  1CLQ A;  4BDP A;  3CM6 A;  3I0R A;  1MU2 A;  3V9W A;  1SL1 A;  1VSE A;  1RTJ A;  1RT5 A;  4O55 A;  3DRR A;  3VQB A;  4LY7 A;  1LAW A;  1N5Y A;  1RT3 A;  4DWI A;  1L5U A;  1L3T A;  1JXE A;  4FXD A;  4ZTJ A;  4KKO A;  4FJL A;  3TAR A;  1ZBF A;  4CJQ A;  1UOC A;  1LV5 A;  1S1U A;  4FLZ A;  1L3S A;  4B8C A;  3C6T A;  4I2Q A;  3AV9 A;  1FKO A;  1TVR A;  2KQ2 A;  2HVH A;  3AA4 A;  4CHQ A;  3RMC A;  3TAG A;  4CJL A;  3SPY A;  4FW1 A;  3OS2 A;  3EY1 A;  1J5O A;  3F73 A;  3LWL A;  4IG0 A;  3ZSO A;  4R5P A;  1SKW A;  4OPK A;  1SKS A;  3OYA A;  1J53 A;  1UA1 A;  2D0B A;  1D9D A;  2PZS A;  1CZ9 A;  4Z4C A;  3NH2 A;  1U47 A;  1RT4 A;  1IKX A;  5KTQ A;  4OLB A;  4BWM A;  4K8Z A;  1WSJ A;  3AA3 A;  3MEE A;  1Z25 A;  4CEQ A;  4CHY A;  4DLE A;  2P51 A;  3MXJ A;  1NKB A;  2G8K A;  1RIL A;  4KHN A;  3IS9 A;  4F4K A;  4NCB A;  4E0D A;  3WNH A;  3CFP A;  3DOL A;  3ZSZ A;  3HT3 A;  1JLG A;  3AVA A;  4CFC A;  3L2R A;  4BE2 A;  1KLN A;  3HK2 A;  4M45 A;  2ETJ A;  4BE1 A;  2HW3 A;  4FJH A;  4FJG A;  3U3G A;  3ZT2 A;  3HPG A;  4WE1 A;  3VQ4 A;  3RMA A;  2KZZ A;  1I3A A;  2OZM A;  3OS0 A;  3AVK A;  4J2E A;  2W42 A;  3QNO A;  5KI6 A;  1RBU A;  2RKI A;  4NYF A;  3SI6 A;  2KFZ A;  3QIO A;  4CES A;  1BQM A;  1TL3 A;  3ZT3 A;  4C8O A;  3ITH A;  3OYG A;  2ATQ A;  1BQN A;  3K5O A;  5SZT A;  1NJY A;  1NK4 A;  1S9E A;  4CGH A;  4F2S A;  3JYT A;  4LH4 A;  5FDL A;  4FLX A;  3V9Z A;  4F2R A;  2EHG A;  4IFV A;  4CJT A;  1J9A A;  2X74 A;  1D9F A;  4B9L A;  1BI4 B;  3V9X A;  3VQ5 A;  3TAP A;  4FVM A;  5CY4 A;  4CF2 A;  3U6F A;  1KFS A;  3K5M A;  4KB0 A;  4IBN A;  3VN5 A;  4CEZ A;  1W0H A;  5CYQ A;  4N47 A;  2NUB A;  3PX0 A;  3NCI A;  4ELV A;  2Z1H A;  4I9L A;  3WNF A;  3BGR A;  2XHB A;  4CEE A;  3AVN A;  3QIP A;  3CM5 A;  2I5J A;  3NGY A;  3RRG A;  2B6A A;  1DTQ A;  3AVB A;  1RDD A;  1FK9 A;  3M8Q A;  3V4I A;  1KVB A;  2A1S A;  1HMV A;  1FKP A;  1JLQ A;  1S1W A;  5DK5 A;  4CJU A;  3OVN A;  3S9H A;  4E7J A;  1UA0 A;  3PO5 A;  1KLM A;  4M3R A;  1KTQ A;  3CFR A;  4H8K A;  4FJ9 A;  4FM1 A;  1EXQ A;  1W9H A;  2HHU A;  5C24 A;  1DTT A;  3KLF A;  4CEO A;  3AO1 A;  5HRO A;  3THV A;  1TKD A;  1L3U A;  2PYJ A;  3SYZ A;  3UIQ A;  2JLE A;  3F9K A;  2XY6 A;  3NGI A;  4DF8 A;  4DU4 A;  4PUO A;  4G1Q A;  3SV4 A;  4AHC A;  3LZI A;  4LD0 A;  4W5R A;  4CHO A;  3D0P A;  3KKR A;  4Z4F A;  2IDO A;  1RDA A;  3HJF A;  1HRH A;  5HRR A;  1C0M A;  2IOC A;  4BWJ A;  2G8U A;  1IO2 A;  1DLO A;  5SWM A;  1A5V A;  3SUQ A;  4C8L A;  2ZE2 A;  2YNH A;  4AH9 A;  3OYJ A;  1CXQ A;  3RTV A;  3NHG A;  4FM0 A;  1RT1 A;  3WNG A;  3ZCM A;  4B3O A;  3KD5 E;  4QCL A;  3AVG A;  4HUF A;  4N41 A;  2Z1J A;  2FC0 A;  3KKS A;  3VQE A;  3RRH A;  1SV5 A;  1FXX A;  3DLR A;  4DU3 A;  3PO4 A;  1S1X A;  2DFH A;  2E6M A;  1IKV A;  2P1J A;  4I2P A;  1WAJ A;  3OYM A;  2KZM A;  3AVH A;  3ZSQ A;  2F8T A;  1T8E A;  4FLV A;  4DTU A;  3V6D A;  1CZB A;  4O4G A;  4FZX C;  4FJI A;  4M3Y A;  3HXM A;  4W5Q A;  4OGE A;  5HRP A;  2RF2 A;  4NCG A;  4QAG A;  1VSK A;  1HYS A;  2GUI A;  1TK5 A;  1XHZ A;  1SKR A;  4C8K A;  3TAE A;  3NF8 A;  4YFU A;  1XWL A;  4DSJ A;  3V81 A;  4Z4I A;  2HNY A;  4KFB A;  3CQ8 A;  4E89 A;  4DFM A;  3LAN A;  2G8I A;  3HVR A;  1JLB A;  1GOA A;  4J2B A;  4CIE A;  2EX3 A;  3L8B A;  4N56 A;  1J54 A;  3ZSV A;  4HCC A;  4KHU A;  5JS1 A;  4EP5 A;  5KGW A;  1NJX A;  3SUP A;  1ZBU A;  4FZY A;  4E7L A;  1NKC A;  1YTA A;  4C8N A;  4FLU A;  1BIS A;  1LW0 A;  4QOZ B;  3O4N A;  3IAY A;  3K5N A;  3QLH A;  1BGX T;  3V9U A;  1QHT A;  1YVU A;  3DYA A;  3H08 A;  4OGC A;  1QSY A;  1B9D A;  1TL1 A;  2Y1I A;  2Z1I A;  3CFO A;  3SCX A;  1RDC A;  4FJJ A;  4L8R B;  3SQ2 A;  3EYZ A;  1RBR A;  1RTI A;  1U04 A;  4CF8 A;  3KJV A;  4OKE A;  1IG9 A;  2OYQ A;  2YNI A;  4DQS A;  2QKB A;  3ALY A;  1TKZ A;  4ELU A;  2XY7 A;  3HP6 A;  4FJN A;  3OYB A;  4DSI A;  1ITG A;  4DS4 A;  1IH7 A;  4JRQ A;  3LP2 A;  4JS5 A;  4ID1 A;  1HNI A;  2YHA A;  5DMR A;  4E1M A;  2YKM A;  4PY5 A;  4IG3 A;  3JSM A;  1U49 A;  1NK8 A;  3RR7 A;  4H4M A;  4BE0 A;  4DSE A;  1QSL A;  2RPI A;  4OVL A;  4TSX A;  1WLJ A;  1YT3 A;  3NF7 A;  1NOZ A;  5K14 A;  4DF4 A;  3NE6 A;  1RTD A;  3T19 A;  1D8Y A;  2IGI A;  3HYF A;  1X1P A;  1U45 A;  3ZT1 A;  2OPP A;  3HST B;  2DTU A;  3E01 A;  3TI0 A;  4CER A;  2VWK A;  2G8F A;  2FBT A;  2WON A;  4CGJ A;  4DS5 A;  1KFD A;  4AIL C;  3QEX A;  4W5N A;  2B5J A;  4ICL A;  3LAM A;  4CEC A;  3SJJ A;  1NJZ A;  4Y1C A;  4PQU A;  1C0T A;  4AHU A;  4CJF A;  4CJP A;  3AO4 A;  4K8X A;  3DLK A;  3LP3 A;  1RBV A;  3LDS A;  5FRM A;  3C94 A;  1EP4 A;  4CJE A;  2VG6 A;  1ZYQ A;  5FRO A;  4CF0 A;  1WSG A;  4F3T A;  3LPT A;  3OYF A;  3L2V A;  4RW7 A;  4KO0 A;  3SZ2 A;  1B92 A;  3DMJ A;  4DMN A;  5I42 A;  4B08 A;  1RBS A;  3ZSY A;  3QEI A;  1TK8 A;  1ASW A;  3OS1 A;  3QET A;  3K2P A;  3B6P A;  3NF9 A;  5E41 A;  3TAQ A;  1SUQ A;  3HPO A;  4E7H A;  2VG5 A;  4DQP A;  3DLE A;  3KLI A;  4CIG A;  1ASU A;  2YKN A;  1EX4 A;  3DOK A;  3LAK A;  3M8S A;  4DFK A;  2HNZ A;  3TAB A;  1X9S A;  1Q9X A;  4KRF A;  1T03 A;  2YHB A;  3OYE A;  3AVM A;  1QQC A;  3QIN A;  4LSN A;  4IDK A;  1UAX A;  2OPS A;  4ZTF A;  3TAM A;  2OZS A;  4DTM A;  1X9W A;  3LP0 A;  4HCB A;  3TAN A;  1G15 A;  1LWF A;  4B8A B;  3QER A;  3SQ1 A;  3LP1 A;  3AVC A;  3VQ7 A;  3P83 D;  3C6U A;  4Y1D A;  1VRT A;  3O4Q A;  3V1R A;  3ZSR A;  4CF1 A;  2QXF A;  4CHN A;  3SUO A;  4CF9 A;  4CFD A;  2BDP A;  1TKT A;  3OJU A;  1HPZ A;  3K5L A;  3QEP A;  4CJ3 A;  5J2M A;  3O3F A;  3VQQ A;  3ISN C;  1WAF A;  4YNQ A;  1A5X A;  5J2P A;  4H4O A;  3C95 A;  4CEB A;  4CIF A;  2XY5 A;  1WSH A;  2YNG A;  1ZBI A;  1QTM A;  1RTH A;  4FK2 A;  4RW8 A;  3TR8 A;  1NK6 A;  4DTO A;  4CFA A;  4O0I A;  3TWH A;  4FJ7 A;  1YTU A;  1VSD A;  3PUF A;  2DY4 A;  1T7P A;  3AVF A;  4CJ4 A;  3LAL A;  2P5G A;  1TK0 A;  2YNF A;  2X6N A;  4CED A;  4FZZ A;  3M8P A;  1K6Y A;  4OPJ A;  3AVJ A;  4N5S A;  3NFA A;  3SUN A;  4FLW A;  4DFP A;  3KK3 A;  3ZT4 A;  4M41 A;  3VQ6 A;  3LZJ A;  3PX4 A;  4OLA A;  2KW4 A;  3T3F A;  2YV0 X;  2BAN A;  1KCF A;  3LPU A;  4O0J A;  4BAC A;  2PY5 A;  3T1A A;  4N76 A;  4CJV A;  2Y1J A;  3ZSW A;  3NGZ A;  1NJW A;  1TAU A;  1XI1 A;  1UWB A;  4HUE A;  4RW9 A;  4M3U A;  4FJ8 A;  4O44 A;  1KSP A;  3BDP A;  3CG7 A;  4I9Q A;  1TV6 A;  4KTQ A;  2KTQ A;  2VG7 A;  1HYZ A;  3L2U A;  4FLY A;  5T7B A;  2JGU A;  4DU1 A;  3VQC A;  1NOY A;  4J2A A;  4E19 A;  4NYN A;  1VSJ A;  2O4I A;  4FJK A;  3OYL A;  3LWM A;  1BI4 A;  3ZSX A;  4KRE A;  4F8R A;  3HVT A;  3DM2 A;  4CK3 A;  1LWE A;  4GW6 A;  4OKJ A;  3G10 A;  3NBP A;  2X6S A;  3VQ9 A;  1BIZ A;  1NK5 A;  2HND A;  5EU7 A;  1C1B A;  3AVI A;  3HM9 A;  1LWC A;  4DTN A;  1KVA A;  5J2Q A;  5JS2 A;  4CGF A;  1EKE A;  4Z4E A;  2HB5 A;  2OPR A;  1NK7 A;  4CGI A;  3QO9 A;  4KI4 A;  1Y97 A;  3A2F A;  4B9N A;  4GMJ B;  1JKH A;  1S9G A;  4ID5 A;  5CZ2 A;  4RW6 A;  1HNV A;  4AHT A;  4CJ5 A;  5HLF A;  1X9M A;  1QS4 A;  3QNN A;  2D0A A;  3MXM A;  3DLH A;  4CK2 A;  3DI6 A;  3MXI A;  2A1R A;  4AHR A;  3MEG A;  4FW2 A;  5D3G A;  3DLG A;  2AJQ A;  4OJR A;  1I39 A;  3P5J A;  2ITG A;  3V1O A;  4DQR A;  4IKF A;  3V1Q A;  3KTQ A;  5KRT A;  1U48 A;  4DQI A;  2D0C A;  3KLG A;  4CJW A;  3KK2 A;  4CJR A;  3NDK A;  3VA0 A;  3PV8 A;  1JLF A;  5I3U A;  2P5O A;  1VSI A;  3OYK A;  3KLH A;  1U4B A;  3O3G A;  3NH1 A;  4DSL A;  5HP1 A;  1C1A A;  1LAV A;  4XIU A;  3HPH A;  4CHP A;  4F3O A;  4KHW A;  2IS3 A;  4AHS A;  5J1E A;  3SV3 A;  4E3S A;  2LSN A;  2OA8 A;  4FM2 A;  1IKW A;  5KGX A;  4CEF A;  1VSM A;  1NK0 A;  2XRI A;  2O4G A;  4DTR A;  2BGG A;  1BL3 A;  1SL0 A;  1XC9 A;  2ZD1 A;  4OKK A;  1T05 A;  3V9S A;  4ZHR A;  1S6Q A;  1RT6 A;  4JRP A;  1BHL A;  1Z26 A;  4Z4H A;  2G8H A;  4DSK A;  1VSL A;  5KRS A;  4HVJ A;  4CFB A;  1WNS A;  3I8D A;  3RMD A;  4KHY A;  4M3Z A;  3NF6 A;  2OPQ A;  4GVM A;  4AHV A;  2QK9 A;  2GV9 A;  2KFN A;  3KIO A;  4PA1 A;  4Q5V A;  4B9U A; 
#chains in the Genus database with same CATH topology
 4CZM A;  2F4V K;  4PWD A;  3R9P A;  4YDU C;  1GOB A;  1GOC A;  5AQO A;  3G71 N;  1F21 A;  2YJF A;  1E3M A;  4O5B A;  4IOX A;  5I9E B;  3VPZ A;  4CI6 A;  4HTU A;  3VQP A;  1ZBH A;  3DXK A;  4QS8 A;  1M1K O;  2PYL A;  4CGD A;  3I0S A;  4KAZ A;  3NAE A;  5TKW A;  4FCY A;  1Z05 A;  3U3Y A;  1RBT A;  2P9L A;  3C6H A;  2P9K A;  2HHX A;  3S41 A;  3W0L A;  3DRP A;  2GBZ A;  2E2N A;  3ZX0 A;  4B9T A;  3H46 O;  3MED A;  1XMO K;  4M3W A;  1RT7 A;  4IO9 L;  2GUP A;  3L4Q A;  4BRD A;  3L2Q A;  1NKE A;  4M3X A;  3O9Q A;  4GNI A;  1NGH A;  4DTX A;  5CZ1 A;  2FBV A;  3U4L A;  1Q8I A;  3K57 A;  4MQ3 A;  5MLC Q;  4EZ6 A;  4I7F A;  3LDQ A;  3VQD A;  1WSI A;  4B9S A;  3CQY A;  5M1P A;  1Q18 A;  5C42 A;  1BCO A;  1REV A;  2HVI A;  2IAJ A;  3ZT0 A;  5AQM A;  3DRS A;  4YOU A;  3QEW A;  3SPZ A;  4K25 A;  1ILY A;  3VA3 A;  1QZ5 A;  5TKY A;  4Z4G A;  1D5A A;  3WNE A;  5FRN A;  4E1N A;  3G0Z A;  5FPE A;  4JI3 K;  3EZW A;  4CHZ A;  2GWJ A;  1WOQ A;  4BRP A;  1TKX A;  1LW2 A;  4LH5 A;  2FBX A;  5GIP A;  3U8X A;  3OY9 A;  4C1N I;  5EOY A;  3DLB A;  4B9M A;  2P9U B;  3VQA A;  2DFF A;  3TAF A;  1NWK A;  2IVP A;  1W2B M;  5J2N A;  1RT2 A;  1GLL O;  3FGU A;  2A6A A;  4DR2 K;  2YJE A;  1S6P A;  3E66 A;  4K42 A;  3B6O A;  2BE2 A;  4JNE A;  2HBJ A;  3SQ0 A;  2HHT A;  2VGN A;  3CM6 A;  4ILH A;  3V9W A;  4B3T K;  3D2F B;  4CD3 A;  3CHW A;  3JAM O;  4KKO A;  1UOC A;  4B8C A;  3CCQ N;  1FKO A;  2KQ2 A;  2QI2 A;  2HVH A;  3EKU A;  3EY1 A;  4IG0 A;  4IJA A;  1TUU A;  1SKS A;  2UUB K;  3CPW M;  4V19 S;  4OLB A;  1NGJ A;  3AA3 A;  2P51 A;  3IS9 A;  4BRI A;  3WXK A;  4WCE L;  4YOV A;  3DOL A;  3ZSZ A;  4KI6 A;  3AVA A;  4CFC A;  4DV2 K;  2HW3 A;  2ETJ A;  4A57 A;  5BR9 A;  3EL2 A;  2P9N B;  1JCE A;  4WE1 A;  3VTI A;  3AVK A;  4DR6 K;  5KI6 A;  1RBU A;  3KZB A;  5JLH A;  3THX A;  4CES A;  5AQU A;  4DR1 K;  3ATV A;  3ITH A;  3K5O A;  5SZT A;  5C2D A;  3CXC M;  4F2R A;  4CJT A;  4B9L A;  2CGK A;  1BI4 B;  4U7B A;  3VQ5 A;  3TAP A;  2QEX N;  3O9R A;  1WB9 A;  4KB0 A;  4CEZ A;  1KAZ A;  5CYQ A;  3OHR A;  4AM6 A;  2XHB A;  3AVN A;  3KK7 A;  3NGY A;  2B6A A;  4BGB A;  3F2K A;  1HMV A;  4NLC A;  3FZH A;  3HRG A;  4H0X B;  2NRH A;  3PO5 A;  3I33 A;  3A5N C;  1KTQ A;  5BR8 K;  4H8K A;  4KH5 A;  5BN9 A;  4BG9 A;  1E4G T;  3DXM B;  4DKW A;  2O8B A;  3F9K A;  3NGI A;  4DF8 A;  5AZI B;  4G1Q A;  3CPE A;  3SV4 A;  4WFN L;  4LD0 A;  4CJ7 A;  4JHD A;  4Z4F A;  3HJF A;  1IO2 A;  4KH6 A;  4BRA A;  3SUQ A;  2ZE2 A;  2YNH A;  1CXQ A;  5AQX A;  4JI8 K;  1RT1 A;  2HMP A;  2OAN A;  2WC9 A;  4HUF A;  3VQE A;  2Z1J A;  3QDK A;  3RRH A;  4DU3 A;  2E6M A;  1IKV A;  3OYM A;  3N4P A;  2KZM A;  4DTU A;  1CZB A;  2A3Z A;  1BWF O;  4IOA L;  4IFE A;  4QAG A;  1HYS A;  4C8K A;  1X3M A;  3EE9 A;  1YIJ N;  3TAE A;  2FSN A;  1MWK A;  4E89 A;  1YJ9 N;  2O8D B;  4IO8 A;  2G8I A;  2EX3 A;  3DXK B;  3O6W A;  4FWL A;  2D1K A;  5HL7 L;  4H5T A;  1FW6 A;  1BA1 A;  1SZ2 A;  2P9L B;  2P9K B;  2WTU A;  4JKF A;  2H3G X;  1BGX T;  4OGC A;  1QSY A;  3ZEU B;  2Z1I A;  3SCX A;  3SQ2 A;  3EYZ A;  4FVU A;  2YNI A;  4DQS A;  2XY7 A;  3HP6 A;  3OYB A;  1ITG A;  3EE8 A;  5JLF A;  4L3Q A;  5AJ3 K;  3LP2 A;  4E1M A;  4PY5 A;  2YKM A;  2ZGZ A;  3CI5 A;  3PIP L;  4CBW A;  1QSL A;  1WLJ A;  5M1F A;  1RTD A;  1D8Y A;  3LDP A;  1GLB G;  1X3N A;  3LDO A;  3E01 A;  4CER A;  1EQY A;  4CGJ A;  1YXQ A;  5F1X A;  4CEC A;  3SJJ A;  1NJZ A;  4Y1C A;  4AHU A;  4CJF A;  3I56 N;  3DLK A;  3LP3 A;  3LDS A;  3C94 A;  4CF0 A;  5AFU H;  3VGM A;  3SZ2 A;  3DMJ A;  1ASW A;  2PAV A;  3OS1 A;  3K2P A;  5E41 A;  4KHU A;  1OH7 A;  4CIG A;  3TPQ A;  5LJW A;  1Q9X A;  4DR7 K;  1T03 A;  1QQC A;  5E26 A;  1T6C A;  4IDK A;  3HSC A;  4IXC A;  4LF6 K;  3M3Z A;  4DTM A;  4HCB A;  3CCS N;  3TAN A;  3I55 N;  1G15 A;  3SJH A;  3R8E A;  1QQO A;  4JKB A;  4Y1D A;  3ZSR A;  2QXF A;  2BDP A;  3OJU A;  3K5L A;  2O8F A;  5J2M A;  3VQQ A;  5J2P A;  1IJJ A;  3VF6 A;  4CEB A;  4F9O A;  4FJ7 A;  4O0I A;  1YTU A;  1T7P A;  5AQZ A;  2P5G A;  3LL3 A;  1TK0 A;  4JD2 A;  3M8P A;  1K6Y A;  3A0I X;  3HBT A;  1T44 A;  3NFA A;  5BPN A;  1GLA G;  3T3F A;  2UXD K;  4EHU A;  1KCF A;  3LPU A;  1YHQ N;  5FLX O;  4BAC A;  4BGA A;  2HHH K;  4CJV A;  5DM6 L;  1TAU A;  4M3U A;  1KSP A;  3GL1 A;  1HYZ A;  5T7B A;  2JGU A;  4E19 A;  4F8R A;  1GLD G;  1LWE A;  4OKJ A;  1NK5 A;  3A5L C;  1I94 K;  3HM9 A;  1LWC A;  1KVA A;  5J2Q A;  1EKE A;  3THX B;  3QML A;  3QO9 A;  3A2F A;  4ID5 A;  1QS4 A;  4CK2 A;  3DI6 A;  2A1R A;  4JI5 K;  3K9K A;  4AHR A;  3MEG A;  1GLC G;  3U9Z A;  5F2R A;  2ITG A;  3CJC A;  4IKF A;  2P9P B;  5I3U A;  4O5F A;  2NRZ A;  3AGK A;  2F9T A;  3NH1 A;  4LF4 K;  1C1A A;  1K8K A;  5KQD A;  4ISF A;  4QS7 A;  4F3O A;  3SV3 A;  5J1E A;  2OA8 A;  1VQ6 N;  5KGX A;  1BL3 A;  2YI1 A;  5CE3 A;  3V9S A;  3ULE A;  1S6Q A;  4Z4H A;  1EWQ A;  1VSL A;  3MDQ A;  1WNS A;  4KHY A;  3NF6 A;  4GVM A;  2KFN A;  4PA1 A;  4BRQ A;  4B9U A;  3NMU A;  4B1W B;  4JHD B;  3QIC A;  4EFH A;  4NCA A;  4JK7 A;  1QQM A;  2F7T A;  3FFI A;  1QQN A;  2FF3 B;  3AA5 X;  3O08 A;  3SAG A;  5DM7 L;  2Q3S A;  1WN7 A;  4CW7 B;  4CCH A;  1O1W A;  1QZ6 A;  4WQ5 C;  3MEC A;  1XNR K;  3ENH A;  2A5X A;  3C0B A;  3D6R A;  3SMS A;  5AQL A;  1ESV A;  5C10 A;  3S3M A;  1B9F A;  2WUS A;  4H5R A;  3FLC O;  5ADX A;  3DWL A;  4JYA K;  3WQU A;  3CMA N;  4B3M K;  4JN4 A;  2HHQ A;  4FK0 A;  3KWG A;  1XHX A;  4FLT A;  2HHS A;  3S3O A;  1RNH A;  2O8E A;  3E9O A;  3UKU B;  4DTS A;  1YAG A;  3Q7B A;  4BDZ A;  2G8V A;  2QTD A;  3SAF A;  3O5B A;  4Z0U A;  1HJR A;  3P1G A;  4FPA A;  2OTL N;  4MO5 A;  3K59 A;  4I6M A;  2B4J A;  4KTW A;  2AA4 A;  1HJO A;  1TAQ A;  2RN2 A;  1SAZ A;  4YOW A;  3SNN A;  1VSF A;  3AA2 A;  1VQM N;  3HOT A;  4MLE A;  4QS9 A;  3EZ5 A;  3L2W A;  3K58 A;  2D5R A;  3VEX A;  3CCE N;  4CGG A;  2P9S A;  5JVH L;  5LMN K;  2I7P A;  3MAQ A;  3RMB A;  4Q0B A;  3K0S A;  3IFR A;  3HO1 A;  3UB5 A;  4IZ9 A;  4AQY K;  3OYD A;  3AO2 A;  4C1N K;  4MFB A;  5AQK A;  3E1Y A;  2ZQB A;  4KHQ A;  3JXU A;  4DTP A;  2OTJ N;  4GY2 B;  4BDP A;  1MU2 A;  3VER A;  1VSE A;  4YOR A;  4PL7 A;  3VQB A;  3DRR A;  4LY7 A;  1RT3 A;  2Q36 A;  4FJL A;  1LV5 A;  1DKG D;  4FLZ A;  2ZJQ L;  3C6T A;  1HKG A;  1TVR A;  4CHQ A;  4FW1 A;  3OS2 A;  3LWL A;  3ZSO A;  3O1B A;  3M5R A;  4R5P A;  2GEL A;  2D0B A;  1D9D A;  1OH5 A;  2PZS A;  1YI2 N;  1IKX A;  5KTQ A;  4K8Z A;  3AAR A;  2D4W A;  4CEQ A;  3MEE A;  1Z25 A;  4DLE A;  4CHY A;  1TUY A;  4NCB A;  2ZJR L;  3CFP A;  4BE2 A;  3HT3 A;  1NGE A;  4JD2 B;  2NNW A;  3VF4 A;  4BE1 A;  3ZT2 A;  3HPG A;  4A62 A;  4JKE A;  2W42 A;  5JIC A;  1N8R O;  3NVM A;  2KFZ A;  1BQM A;  3ZT3 A;  3D2E A;  2ATQ A;  4LFC K;  3FZK A;  4JEP A;  4IJN A;  4CGH A;  1P8Z A;  5FDL A;  3CJ9 A;  4IFV A;  2X74 A;  1D9F A;  4DCH A;  5LMU K;  4FVM A;  5CY4 A;  1J6Z A;  1KFS A;  4IBN A;  5M1O A;  2NUB A;  5EX5 A;  1HKB A;  4B9Q A;  3NCI A;  1RFQ A;  2Z1H A;  4H0Y B;  3WNF A;  1OVY A;  4DV0 K;  1DTQ A;  5M1K A;  3V4I A;  5DK5 A;  3S9H A;  1JLQ A;  3CC4 N;  4DV1 K;  2CGL A;  2KHO A;  4EHT A;  4X62 K;  2GX9 A;  2NRR A;  4FM1 A;  3GOI A;  2O8C A;  1S22 A;  3KLF A;  4WQ4 A;  3THV A;  3MX2 A;  1DEJ A;  4PUO A;  2VWB A;  2QWP A;  4W5R A;  4GV3 A;  4CHO A;  3D0P A;  2F9W A;  3CER A;  3CCR N;  3J8A A;  1XC3 A;  4BR9 A;  5BPM A;  4AM7 A;  3BY5 A;  3OA9 A;  1DLO A;  3UKR A;  4BR7 A;  2KKZ A;  3FFK B;  3H45 C;  3MCA B;  3QFP A;  3ZCM A;  3AVG A;  2ASO A;  4N41 A;  2FC0 A;  3LM9 A;  3ULE B;  2PFU A;  2HST A;  4DR5 K;  2P1J A;  4I2P A;  2GWK A;  1WAJ A;  4FLV A;  1M90 O;  4O4G A;  4FZX C;  1VQ4 N;  1ZXO A;  4OGE A;  4NCG A;  1N34 K;  2RE2 A;  1VSK A;  2GUI A;  3J7A P;  5C0Y A;  1KD1 O;  4DV4 K;  3LAN A;  3BF3 A;  4DV5 K;  3HVR A;  3G25 A;  1EWR A;  4BRN A;  5JS1 A;  3ZSV A;  3W3D A;  4EP5 A;  5KGW A;  1NJX A;  1K73 O;  4FZY A;  1OKJ A;  1NKC A;  1YTA A;  4C8N A;  1BIS A;  3O4N A;  3K5N A;  1IBM K;  1QHT A;  3DYA A;  3TTD A;  3UE5 A;  3KVG A;  4L8R B;  3QBW A;  1RBR A;  5AQT A;  4CF8 A;  4OKE A;  4PL8 A;  1TKZ A;  3MN7 A;  4DSI A;  4ISG A;  2QWO A;  4XH1 A;  1IH7 A;  2E20 A;  3JSM A;  3OBW A;  4HTL A;  4DSE A;  4YHH K;  4DF4 A;  3HYF A;  3HST B;  3TI0 A;  2VWK A;  3P38 A;  2G8F A;  2FBT A;  2YHW A;  4AIL C;  3LAM A;  1RBV A;  4F3T A;  5FRO A;  3L2V A;  4PHT X;  4B3R K;  4DB3 A;  2J4R A;  1D4X A;  3C7N B;  5I42 A;  4B08 A;  3P31 A;  4LC9 B;  2P9S B;  4DQP A;  3HPO A;  4E7H A;  3M8S A;  1X9S A;  2HNZ A;  4GVE A;  4JKG B;  2YHB A;  4BQL A;  4JV5 K;  3CJA A;  4LSN A;  3LP0 A;  3TSP A;  2ZGY A;  3SQ1 A;  3LP1 A;  3AVC A;  3MN6 A;  3VEY A;  2Q2R A;  4WFB L;  3C6U A;  1VRT A;  3SUO A;  4CFD A;  5FPN A;  1HPZ A;  3QEP A;  5ADX H;  4CIF A;  3QFU A;  2YNG A;  4FK2 A;  4XH4 A;  1NK6 A;  4CFA A;  3SMP A;  1Y64 A;  1KXP A;  1NGD A;  5AR0 A;  2DY4 A;  4CJ4 A;  2AP1 A;  3AVJ A;  1T6D A;  2W41 A;  4DFP A;  3O80 A;  3ZT4 A;  4M41 A;  3VQ6 A;  3Q7C A;  3FZM A;  4O0J A;  3MCP A;  2V7Z A;  2PY5 A;  3IUC A;  2UUA K;  4LF7 K;  2Y1J A;  1UWB A;  1VQ7 N;  3HOS A;  3CG7 A;  1TV6 A;  5BN8 A;  4KTQ A;  2VG7 A;  3WQT A;  1U2V A;  4DU1 A;  1VQ9 N;  2JWL A;  1NOY A;  3L4I A;  4JKD A;  4A2A A;  1SQK A;  3WEE A;  3N4Q A;  3ZSX A;  2E2Q A;  3ZLJ A;  4KRE A;  4CK3 A;  1KC8 O;  1BIZ A;  2IVO A;  4E1J A;  4IDH A;  1C1B A;  3AVI A;  4JI7 K;  5JS2 A;  4CGF A;  2HB5 A;  5A2Q O;  4CGI A;  3TSQ A;  4KI4 A;  2HBM A;  2QW9 A;  1S9G A;  4CJ5 A;  5HLF A;  2YCH A;  1X9M A;  2D0A A;  2VYP A;  3MXM A;  3DLH A;  3MXI A;  5AQI A;  2QWQ A;  5AQH A;  3ID8 A;  4FW2 A;  4H0O A;  1VQP N;  4JKH A;  3V1O A;  4DQR A;  4LF8 K;  5EXW A;  5KRT A;  2D0C A;  3O8M A;  3HM8 A;  4CJW A;  3KK2 A;  3SBG A;  3VA0 A;  4FWM A;  3QBX A;  3TTF A;  3O3G A;  3CCV N;  4BRL A;  5F0X A;  3CJB A;  2A42 A;  3TU5 A;  4AHS A;  2GTD A;  4CEF A;  1NK0 A;  4JI6 K;  3CF5 L;  2XRI A;  2O4G A;  3ENO A;  2W40 A;  2O8C B;  3VMF B;  4JRP A;  5FPD A;  5KRS A;  4CFB A;  3I8D A;  2QK9 A;  4AHV A;  2GV9 A;  3KIO A;  4IWV A;  4CBU A;  4EZ9 A;  5AQN A;  1WUA A;  1FJG K;  4CD1 A;  1KVC A;  3BP8 A;  4FYD A;  3QEV A;  2XO7 A;  3THW A;  1ZBL A;  1WBB A;  3ZX3 A;  2VWJ A;  3NH0 A;  2E6L A;  4H5N A;  4FWK A;  5JMV A;  1XUP O;  4OPH A;  4CK1 A;  1C0F A;  1N32 K;  2OCE A;  1JLC A;  1EET A;  1DT9 A;  2XY8 A;  4BRH A;  3D45 A;  2G8W A;  1RDW X;  3OYC A;  3KLE A;  3CCU N;  1BA0 A;  4CE9 A;  4M63 C;  4LSL A;  4DQQ A;  4E7K A;  2X78 A;  1TYQ A;  3M8R A;  1S1T A;  1NNE A;  3AAQ A;  2QKK A;  1VK0 A;  1N6Q A;  5HRS A;  2HHW A;  3KHY A;  3A8Y A;  4JAX A;  4CEA A;  1HNW K;  5BPL A;  4BC3 A;  1QSS A;  3EN9 A;  4IEE A;  3J7Z O;  1JXB A;  4BRM A;  1HYV A;  4H0P A;  1HLU A;  2BUP A;  4KPY A;  4M42 A;  1S1V A;  1ATR A;  4EP4 A;  1IKY A;  3GBT A;  2E4L A;  4B1U B;  3L3V A;  4CJS A;  2ASM A;  4B9V A;  1TGO A;  2QWN A;  1Q9Y A;  2FBY A;  4A5B A;  4W5O A;  1VRU A;  3TSU A;  4DSF A;  1VSH A;  4OPA A;  3J81 O;  1HQU A;  4MLH A;  1WSF A;  3R3L A;  3KK1 A;  1JJ2 M;  1C0U A;  5ELZ A;  2Z1G A;  1Q7Y O;  3HTV A;  1C6V A;  3THY A;  4RG8 A;  1JLE A;  4B1V A;  1JL1 A;  4C8M A;  2HHV A;  5JVG L;  2HMI A;  4UQG A;  1ATN A;  3O3H A;  4CJK A;  1H1V A;  3OYH A;  1RDB A;  4M7X A;  4R79 A;  4JLH A;  4H0V B;  4HUG A;  1VQ8 N;  1BIU A;  2VCP A;  5KPR A;  3EEQ A;  4DR3 K;  3OYI A;  1CLQ A;  3I0R A;  1G99 A;  4LFA K;  1SL1 A;  1RT5 A;  4O55 A;  4DWI A;  4UY8 O;  3CJ1 A;  1N5Y A;  1L5U A;  4FO0 A;  1L3T A;  1HUX A;  3LM2 A;  3WXL A;  4FXD A;  1NGA A;  1IG8 A;  3TAR A;  4JI2 K;  4CJQ A;  3TTC A;  1S1U A;  1L3S A;  4I2Q A;  3AV9 A;  3G6E N;  5EVZ A;  4BR5 A;  3AA4 A;  2QWM A;  4YDU A;  4CJL A;  3T1Y K;  1J5O A;  1IV0 A;  3F73 A;  4LF5 K;  1ZC6 A;  4MDB A;  2O8B B;  3OYA A;  1J53 A;  1UA1 A;  5M1N A;  4DV3 K;  1U47 A;  1RT4 A;  1IBL K;  3CJ7 A;  3WXI A;  1NKB A;  2G8K A;  4KHN A;  4F4K A;  1VQK N;  4E0D A;  4EAH D;  4CZF A;  1JLG A;  1KLN A;  2RHK A;  4M45 A;  1XQS C;  4FJH A;  4M7Y A;  2ASP A;  4JK8 A;  4BVP A;  4FJG A;  2KZZ A;  3OS0 A;  2Q31 A;  4J2E A;  2P9U A;  3QNO A;  3FZF A;  2RKI A;  3SI6 A;  1BO5 O;  2W6K A;  4C8O A;  3OYG A;  3AAP A;  1NJY A;  4NB4 A;  3ENB A;  4F2S A;  1U2V B;  3SK3 A;  3JYT A;  3P39 A;  4FLX A;  3V9Z A;  5AZJ A;  1J9A A;  3VOV A;  3WEE B;  3GE1 A;  3BUZ B;  3HI0 A;  3K5M A;  4K43 A;  3VN5 A;  2E88 A;  1W0H A;  4PKI A;  4N47 A;  3OBY A;  5LY3 A;  1XMQ K;  3QIP A;  3CM5 A;  1RDD A;  1KVB A;  2A1S A;  3KTQ A;  4JI4 K;  4CJU A;  3OVN A;  5GIN A;  4E7J A;  1UA0 A;  1KLM A;  3F5T A;  4M3R A;  1EXQ A;  3SBT A;  1W9H A;  2HHU A;  5C24 A;  1DTT A;  3J7Y P;  2Q97 A;  4CEO A;  3AO1 A;  3OTO K;  1TKD A;  1L3U A;  2PYJ A;  3SYZ A;  4JI1 K;  5E84 A;  4AHC A;  2V7Y A;  1MA9 B;  4RTF D;  3KKR A;  1RGI A;  2IDO A;  4LFB K;  3H6E A;  3VTH A;  1HRH A;  5HRR A;  1C0M A;  1NU0 A;  2WFB A;  4AH9 A;  5GAD P;  3RTV A;  1HR0 K;  1NMD A;  4FM0 A;  3WNG A;  3OW2 M;  3KD5 E;  2HBL A;  2UYT A;  3L0Q A;  3MK6 A;  3KKS A;  1KAY A;  1YIT N;  1FXX A;  3PO4 A;  2DFH A;  4FWO A;  2ZF5 O;  3AVH A;  3ZSQ A;  2NRT A;  1T8E A;  3IDH A;  5KPZ A;  3V6D A;  4FJI A;  4M3Y A;  3CC7 N;  4W5Q A;  5AQJ A;  3WUH A;  1XHZ A;  2QA4 N;  1TK5 A;  1SKR A;  3NF8 A;  4YFU A;  2V52 B;  4DSJ A;  4K41 A;  3V81 A;  1BDG A;  5AQQ A;  3CQ8 A;  4DFM A;  2WBN A;  3CQX A;  1JLB A;  1GOA A;  3L8B A;  4N56 A;  4HCC A;  2VQF K;  1ZBU A;  4JK9 A;  4E7L A;  4CZH A;  2A41 A;  4OX9 K;  4H5V A;  4DUY K;  3DAW A;  3L6Q A;  4QOZ B;  4XEI A;  1TYQ B;  3IAY A;  3QLH A;  3V9U A;  1LOT B;  1YVU A;  4DQ8 A;  1TL1 A;  2Y1I A;  3CFO A;  4FJJ A;  3KJV A;  1RTI A;  1U04 A;  2O8F B;  3G4S N;  2QKB A;  3ALY A;  4O8K A;  3T1H K;  4ELU A;  2Q0R A;  4FJN A;  2E5L K;  1ZBS A;  4CZE A;  4A61 A;  1XNQ K;  4ID1 A;  5CHI A;  2YHA A;  5DMR A;  1NK8 A;  5AQW A;  1U49 A;  2HF4 A;  4BRK A;  3RR7 A;  3IKM A;  2RPI A;  2BTF A;  1YT3 A;  3NF7 A;  1NOZ A;  2E2O A;  3BEX A;  3FE1 A;  3NE6 A;  3U9D A;  1X1P A;  2DTU A;  3O1W A;  4XH5 A;  4FWS A;  4DS5 A;  4FSV A;  3QEX A;  4W5N A;  2IVN A;  4ICL A;  3PSF A;  4CJP A;  4FL9 A;  3H1V X;  5FRM A;  1ZYQ A;  3OYF A;  5AQF A;  4RW7 A;  1B92 A;  1VQL N;  3DLL L;  5KPT A;  4GKJ K;  2O8D A;  3ZSY A;  1TK8 A;  4CZL A;  3QET A;  3TAQ A;  2QWR A;  2VG5 A;  3DLE A;  3KLI A;  1EX4 A;  3DOK A;  4DFK A;  4KRF A;  3THY B;  3R6M A;  3QIN A;  1HNX K;  4LF9 K;  4ZTF A;  5H1S Q;  2OZS A;  2E8A A;  4DHY A;  3R1X A;  4KBO A;  1VHX A;  4FPB A;  1NBW A;  3P83 D;  4CHN A;  3O4Q A;  3ZEU A;  5GIO A;  4CF9 A;  5HOO A;  4YNQ A;  3B8A X;  1WAF A;  1A5X A;  2XY5 A;  4BY9 C;  2UU9 K;  1GLE G;  1RTH A;  1C0G A;  4RW8 A;  4DTO A;  3PUF A;  3AVF A;  2UXC K;  2YNF A;  1K8K B;  4NXM K;  4CED A;  3H1Q A;  4OPJ A;  4RCH A;  4N5S A;  3RSE A;  3SUN A;  2YX6 A;  3T69 A;  4FLW A;  2ITM A;  1NGF A;  2NRW A;  4OLA A;  2KW4 A;  3VEZ A;  3T7Z A;  4A2B A;  4B1Y B;  4BRG A;  4N76 A;  1QVG M;  3K9J A;  1XI1 A;  4HUE A;  4RW9 A;  1JCG A;  4BC5 A;  3BZC A;  2KTQ A;  3L2U A;  4FLY A;  4BRC A;  1HKC A;  3VQC A;  3WXJ A;  4NYN A;  2O4I A;  1WBD A;  3OYL A;  2FXU A;  4NXN K;  4GW6 A;  4DR4 K;  2CGJ A;  3G10 A;  3NBP A;  5EU7 A;  1BOT O;  4DV7 K;  4Z4E A;  2OPR A;  1Y97 A;  4B9N A;  1RDU A;  1JKH A;  4GMJ B;  5CZ2 A;  3QNN A;  4OO1 J;  3CCM N;  1KAX A;  4PKG A;  5AZJ B;  4A59 A;  3I8B A;  4BRE A;  3DLG A;  3P4I A;  4OJR A;  1I39 A;  1W7A A;  5LJV A;  4FOI A;  4IEI A;  3NDK A;  2P5O A;  2D0P A;  5CR4 A;  4B1X B;  2QXL A;  4KH4 A;  4BVO A;  4DSL A;  1LAV A;  2O8E B;  4XIU A;  3O9U A;  3ZX2 A;  3HPH A;  4CHP A;  1O13 A;  4KHW A;  4E3S A;  2LSN A;  4FM2 A;  1VSM A;  2BGG A;  1SL0 A;  2ZD1 A;  4OKK A;  1T05 A;  4ZHR A;  1NG9 A;  1RT6 A;  2E1Y A;  1BHL A;  1Z26 A;  4IOC L;  2I7N A;  3CET A;  4DSK A;  2ZWH A;  4HVJ A;  4BRF A;  4BR0 A;  2OPQ A;  4I6M B;  2CH5 A;  3ID6 A;  5KQ8 A;  2P9I A;  2E2P A;  3JS6 A;  1HPM A;  3VEO A;  3L3U A;  1C1C A;  4BDY A;  4DLG A;  2HF3 A;  4Y0W A;  4FJ5 A;  4KB1 A;  1A5W A;  1W97 L;  1KRP A;  1R0A A;  2IC3 A;  3S3N A;  4BR4 A;  1SL2 A;  5AQG A;  1HQE A;  3SQ4 A;  2F96 A;  3IRX A;  1DGK N;  4ELT A;  4KTZ A;  2CH6 A;  3GG4 A;  4M3T A;  4DV6 K;  4B3S K;  1NK9 A;  4FOE A;  4E7I A;  3A5O C;  3VEW A;  1WSE A;  1BG3 A;  3EO3 A;  2ZM6 K;  2Q0U A;  4DUZ K;  4DG1 A;  2P9P A;  3NVK A;  4J2D A;  1BCM A;  1JLA A;  2QM1 A;  3C65 A;  2F8S A;  3PX6 A;  1VQN N;  3OJS A;  4FK4 A;  4DFJ A;  3IG1 A;  3EKS A;  3O9S A;  3HL8 A;  1OVQ A;  4FJM A;  1VAZ A;  3VF2 A;  5CYM A;  5GAG P;  4FJX A;  1RCH A;  4KHS A;  1QE1 A;  3RWU A;  2DPN A;  3CYM A;  4B1Z A;  4W5T A;  4Z94 A;  1YF5 L;  3AO3 A;  4FWN A;  4H0T B;  2JWK A;  4O8U A;  3MN9 A;  1CXU A;  3J80 O;  4DTJ A;  1S5J A;  4IFY A;  4NO7 A;  2NRV A;  3HP9 A;  3AVL A;  2DFE A;  4NLB A;  1L3V A;  3PSI A;  2NLX A;  4WQ4 C;  5HBM A;  3ULD A;  1NGI A;  2E1Z A;  4A5A A;  1GLJ O;  1NLV A;  4RW4 A;  1ASV A;  1YJW N;  4ISE A;  4HHT A;  1JL2 A;  3M6G A;  1K9M O;  4JS4 A;  5C25 A;  3AO5 A;  3KD1 E;  4FWR A;  3VQ8 A;  4BQZ A;  4CZI A;  4KV8 A;  2R7Y A;  3D2E B;  3QES A;  4BC2 A;  5HRN A;  3PY8 A;  1BU6 O;  4J8F A;  3ASM A;  2WOM A;  3RR8 A;  3OYN A;  4CZJ A;  4CZG A;  5B8H A;  2FF6 A;  1RTJ A;  3UIQ A;  2VGM A;  4WYB A;  1LAW A;  3UKU A;  1JXE A;  3SAH A;  4ZTJ A;  1ZBF A;  1N33 K;  1OH6 A;  3CD6 N;  5AQP A;  4BRO A;  4KHP K;  3RMC A;  4CVN E;  1U6Z A;  3TAG A;  3SPY A;  1SKW A;  4OPK A;  3IMX A;  1CZ9 A;  1J5E K;  4Z4C A;  3NH2 A;  2UUC K;  4WQ5 A;  4BWM A;  4H5W A;  2V51 B;  1WSJ A;  3AGR A;  3MXJ A;  1RIL A;  4X65 K;  3WNH A;  3CCJ N;  3HK2 A;  3L2R A;  3H3N O;  3UKR B;  2VQE K;  3RSE B;  3O9T A;  3U3G A;  3VES A;  3VEV A;  3VQ4 A;  5BRD A;  3RMA A;  1I3A A;  2EWS A;  2OZM A;  4GV9 A;  4JI0 K;  4NYF A;  4BR2 A;  2IIR A;  3QIO A;  3ZET A;  1K8A O;  1TL3 A;  4AF1 A;  1BQN A;  1NK4 A;  5AQS A;  1S9E A;  4LH4 A;  1QHA A;  2EHG A;  5BRF A;  1V4T A;  3V9X A;  4YOT A;  3U6F A;  4CF2 A;  3PX0 A;  4ELV A;  4I9L A;  1S3X A;  2HBK A;  3BGR A;  3MX5 A;  4CEE A;  2I5J A;  3RRG A;  3AVB A;  1YUW A;  1FK9 A;  3M8Q A;  1FKP A;  1S1W A;  1X9J A;  1IBK K;  1EO1 A;  1VQ5 N;  3CFR A;  4FJ9 A;  3WXM B;  3PLA A;  5HRO A;  3CIP A;  4CZK A;  2JLE A;  1Q81 O;  2XY6 A;  1NGG A;  4DU4 A;  1KQS M;  1Z6R A;  3LZI A;  5AQV A;  3M1F A;  4RWT A;  2ZJP L;  1RDA A;  2G8U A;  4BWJ A;  2IOC A;  3QB0 A;  4C8L A;  5SWM A;  1A5V A;  1E4F T;  3OYJ A;  3NHG A;  1N36 K;  4B3O A;  4QCL A;  2A40 A;  3DJC A;  3VGL A;  1SV5 A;  3DLR A;  1S1X A;  2D0O A;  5C2F A;  2F8T A;  4FWP A;  1P90 A;  5FPM A;  3HXM A;  2P9I B;  2FLO A;  3MWT A;  5AQY A;  5HRP A;  2RF2 A;  4X64 K;  1HNZ K;  3CME N;  3WT0 A;  1V4S A;  2BH1 A;  3MN5 A;  1XWL A;  4Z4I A;  2HNY A;  4KFB A;  3A5M C;  4J2B A;  4CIE A;  1J54 A;  3RVC A;  3VEN A;  3SUP A;  4MO4 A;  1BUP A;  5M1Q A;  1NGB A;  4FLU A;  1LW0 A;  3FR0 A;  4H03 B;  1Q86 O;  2YHX A;  3H08 A;  3AY9 A;  1B9D A;  4X66 K;  1T3V A;  3E9P A;  1RDC A;  1HX1 A;  1IG9 A;  2OYQ A;  4DS4 A;  4JRQ A;  4BG8 A;  3PIO L;  4JS5 A;  1HNI A;  3ATU A;  4PKH A;  3ZYY X;  4IG3 A;  3CC2 N;  4H4M A;  4BE0 A;  5GAH P;  4OVL A;  4TSX A;  5AQR A;  1QVF M;  5K14 A;  3T19 A;  4C23 A;  2IGI A;  1U45 A;  3ZT1 A;  1NMN A;  2OPP A;  3VET A;  3D7E O;  1MDU B;  2WON A;  5IWA K;  1KFD A;  2B5J A;  2FSK A;  4PQU A;  4CBX A;  1C0T A;  3AO4 A;  4K8X A;  1EP4 A;  4CJE A;  2VG6 A;  1WSG A;  3LPT A;  4KO0 A;  4WF9 L;  2NRX A;  4DMN A;  4WFA L;  1RBS A;  1OH8 A;  3QEI A;  3D2F A;  3NF9 A;  3B6P A;  1SUQ A;  4YOX A;  3TAB A;  1ASU A;  2YKN A;  3LAK A;  5IT9 O;  2UXB K;  3OYE A;  3AVM A;  2QWL A;  1UAX A;  2OPS A;  3TAM A;  5GAE P;  1X9W A;  1LWF A;  4B8A B;  3QER A;  3CCL N;  1MWM A;  3VQ7 A;  3C6A A;  3V1R A;  4CF1 A;  5BRH A;  1TKT A;  1NGC A;  4CJ3 A;  3O3F A;  3ISN C;  3BF1 A;  4H4O A;  3C95 A;  3GDQ A;  4K0K K;  1WSH A;  1ZBI A;  1QTM A;  4YOY A;  4HWI A;  3TR8 A;  3TWH A;  3FZL A;  2HOE A;  3KWI A;  1VSD A;  1SS6 A;  3LAL A;  4ILG B;  2X6N A;  5C12 A;  4FZZ A;  4G9Z A;  4EIA A;  2P9N A;  1R59 O;  3MMV A;  3KK3 A;  3LZJ A;  3HZ6 A;  3PX4 A;  2YV0 X;  2BAN A;  4U67 L;  3T1A A;  2NZT A;  3ZSW A;  3NGZ A;  1NJW A;  4JKA A;  2FSJ A;  4FJ8 A;  4O44 A;  3BDP A;  3E9L A;  5BRE A;  4I9Q A;  4J2A A;  1VSJ A;  4FJK A;  3LWM A;  1BI4 A;  3HVT A;  3C7N A;  3DM2 A;  3THW B;  1YVN A;  3LDN A;  2X6S A;  3VQ9 A;  5EY4 A;  2HND A;  3O4W A;  1Q82 O;  2PBD A;  4DTN A;  4FWQ A;  4JKG A;  1LCU A;  1YJN N;  4BC4 A;  3ZET B;  1NK7 A;  1NM1 A;  2GEM A;  3H3O B;  2W6L A;  4AHT A;  2KLA A;  1HNV A;  4ILJ A;  4RW6 A;  1GLF O;  2YHY A;  1VQO N;  5C15 A;  3DXM A;  3F9M A;  5D3G A;  2AJQ A;  3P5J A;  5AZI A;  3V1Q A;  1U48 A;  4DQI A;  3KLG A;  4CJR A;  3PV8 A;  1JLF A;  1VSI A;  3OYK A;  3KLH A;  1U4B A;  5HP1 A;  2Q1N A;  1ATS A;  3BZK A;  3MWP A;  2IS3 A;  1NJI O;  1IKW A;  1CZA N;  4DTR A;  1S72 N;  1JCF A;  1XC9 A;  4YY3 K;  4JKC A;  2G8H A;  3SLC A;  3RMD A;  4M3Z A;  4MDA A;  3VGK A;  4GKK K;  5LL6 Z;  4Q5V A;  4GV6 A;  5AFU A;  3LDL A; 
#chains in the Genus database with same CATH homology
 4NCA A;  4PWD A;  3L3U A;  1C1C A;  4BDY A;  1KVC A;  4DLG A;  4FYD A;  4KI6 A;  4FJ5 A;  3QEV A;  4KB1 A;  2XO7 A;  1A5W A;  1GOB A;  1GOC A;  1ZBL A;  2VWJ A;  3FFI A;  1F21 A;  3NH0 A;  1KRP A;  2E6L A;  3AA5 X;  1R0A A;  4CK1 A;  4O5B A;  2IC3 A;  3S3N A;  1SL2 A;  1HQE A;  4HTU A;  2Q3S A;  3VQP A;  1WN7 A;  3SQ4 A;  1ZBH A;  2F96 A;  3IRX A;  4CCH A;  1JLC A;  1EET A;  1O1W A;  2PYL A;  2XY8 A;  3MEC A;  4CGD A;  4KTZ A;  4ELT A;  3D45 A;  3I0S A;  2G8W A;  3OYC A;  4KAZ A;  3KLE A;  4M3T A;  3NAE A;  4FCY A;  4CE9 A;  1NK9 A;  3U3Y A;  1RBT A;  3S3M A;  1B9F A;  4LSL A;  4DQQ A;  4E7I A;  4E7K A;  2X78 A;  1WSE A;  2HHX A;  3M8R A;  3DRP A;  2GBZ A;  1S1T A;  2QKK A;  4B9T A;  1VK0 A;  3MED A;  1N6Q A;  4DG1 A;  5HRS A;  4M3W A;  4Z4G A;  2HHW A;  1RT7 A;  3L2Q A;  4J2D A;  1BCM A;  2HHQ A;  1JLA A;  1NKE A;  4FK0 A;  4M3X A;  4CEA A;  4DTX A;  5CZ1 A;  1XHX A;  3PX6 A;  2F8S A;  2FBV A;  4FLT A;  3S3O A;  1RNH A;  3OJS A;  4DFJ A;  4FK4 A;  1Q8I A;  1QSS A;  2HHS A;  3IG1 A;  3K57 A;  4MQ3 A;  4DTS A;  3HL8 A;  1JXB A;  4EZ6 A;  4I7F A;  4BDZ A;  2G8V A;  4FJM A;  3VQD A;  1WSI A;  1HYV A;  4Z0U A;  4B9S A;  5CYM A;  1HJR A;  4KPY A;  4FJX A;  1RCH A;  4M42 A;  4KHS A;  1QE1 A;  1S1V A;  3P1G A;  3RWU A;  3CYM A;  3K59 A;  5C42 A;  4EP4 A;  1IKY A;  4W5T A;  1BCO A;  2E4L A;  2B4J A;  1REV A;  4KTW A;  3AO3 A;  3L3V A;  2HVI A;  4CJS A;  2IAJ A;  3ZT0 A;  4B9V A;  1TGO A;  3DRS A;  1CXU A;  4DTJ A;  1Q9Y A;  1S5J A;  3QEW A;  3SPZ A;  1TAQ A;  2RN2 A;  4IFY A;  3VA3 A;  2FBY A;  4W5O A;  1VRU A;  3AVL A;  1D5A A;  3HP9 A;  3SNN A;  1VSF A;  2DFE A;  3WNE A;  4DSF A;  1L3V A;  5FRN A;  3AA2 A;  1VSH A;  3G0Z A;  4E1N A;  4EZ9 A;  1HQU A;  5HBM A;  3ULD A;  1WSF A;  3EZ5 A;  4CHZ A;  3KK1 A;  3L2W A;  1C0U A;  2D5R A;  3K58 A;  1TKX A;  1LW2 A;  4CGG A;  4LH5 A;  2FBX A;  1ASV A;  2Z1G A;  4RW4 A;  3OY9 A;  3MAQ A;  3DLB A;  4HHT A;  1C6V A;  1JL2 A;  4B9M A;  3VQA A;  4JS4 A;  2DFF A;  4RG8 A;  5C25 A;  3AO5 A;  3TAF A;  3KD1 E;  3RMB A;  4Q0B A;  3VQ8 A;  1JLE A;  4KV8 A;  3HO1 A;  1JL1 A;  4C8M A;  2R7Y A;  5J2N A;  1RT2 A;  2HHV A;  3QES A;  3OYD A;  3AO2 A;  2HMI A;  5HRN A;  4MFB A;  3PY8 A;  4UQG A;  3O3H A;  2ZQB A;  1S6P A;  4CJK A;  3ASM A;  4KHQ A;  2WOM A;  3OYH A;  3B6O A;  1RDB A;  3RR8 A;  2BE2 A;  4JLH A;  3OYN A;  4HUG A;  1BIU A;  4DTP A;  3SQ0 A;  2HHT A;  3OYI A;  1CLQ A;  4BDP A;  3CM6 A;  3I0R A;  1MU2 A;  3V9W A;  1SL1 A;  1VSE A;  1RTJ A;  1RT5 A;  4O55 A;  3DRR A;  3VQB A;  4LY7 A;  1LAW A;  1N5Y A;  1RT3 A;  4DWI A;  1L5U A;  1L3T A;  1JXE A;  4FXD A;  4ZTJ A;  4KKO A;  4FJL A;  3TAR A;  1ZBF A;  4CJQ A;  1UOC A;  1LV5 A;  1S1U A;  4FLZ A;  1L3S A;  4B8C A;  3C6T A;  4I2Q A;  3AV9 A;  1FKO A;  1TVR A;  2KQ2 A;  2HVH A;  3AA4 A;  4CHQ A;  3RMC A;  3TAG A;  4CJL A;  3SPY A;  4FW1 A;  3OS2 A;  3EY1 A;  1J5O A;  3F73 A;  3LWL A;  4IG0 A;  3ZSO A;  4R5P A;  1SKW A;  4OPK A;  1SKS A;  3OYA A;  1J53 A;  1UA1 A;  2D0B A;  1D9D A;  2PZS A;  1CZ9 A;  4Z4C A;  3NH2 A;  1U47 A;  1RT4 A;  1IKX A;  5KTQ A;  4OLB A;  4BWM A;  4K8Z A;  1WSJ A;  3AA3 A;  3MEE A;  1Z25 A;  4CEQ A;  4CHY A;  4DLE A;  2P51 A;  3MXJ A;  1NKB A;  2G8K A;  1RIL A;  4KHN A;  3IS9 A;  4F4K A;  4NCB A;  4E0D A;  3WNH A;  3CFP A;  3DOL A;  3ZSZ A;  3HT3 A;  1JLG A;  3AVA A;  4CFC A;  3L2R A;  4BE2 A;  1KLN A;  3HK2 A;  4M45 A;  2ETJ A;  4BE1 A;  2HW3 A;  4FJH A;  4FJG A;  3U3G A;  3ZT2 A;  3HPG A;  4WE1 A;  3VQ4 A;  3RMA A;  2KZZ A;  1I3A A;  2OZM A;  3OS0 A;  3AVK A;  4J2E A;  2W42 A;  3QNO A;  5KI6 A;  1RBU A;  2RKI A;  4NYF A;  3SI6 A;  2KFZ A;  3QIO A;  4CES A;  1BQM A;  1TL3 A;  3ZT3 A;  4C8O A;  3ITH A;  3OYG A;  2ATQ A;  1BQN A;  3K5O A;  5SZT A;  1NJY A;  1NK4 A;  1S9E A;  4CGH A;  4F2S A;  3JYT A;  4LH4 A;  5FDL A;  4FLX A;  3V9Z A;  4F2R A;  2EHG A;  4IFV A;  4CJT A;  1J9A A;  2X74 A;  1D9F A;  4B9L A;  1BI4 B;  3V9X A;  3VQ5 A;  3TAP A;  4FVM A;  5CY4 A;  4CF2 A;  3U6F A;  1KFS A;  3K5M A;  4KB0 A;  4IBN A;  3VN5 A;  4CEZ A;  1W0H A;  5CYQ A;  4N47 A;  2NUB A;  3PX0 A;  3NCI A;  4ELV A;  2Z1H A;  4I9L A;  3WNF A;  3BGR A;  2XHB A;  4CEE A;  3AVN A;  3QIP A;  3CM5 A;  2I5J A;  3NGY A;  3RRG A;  2B6A A;  1DTQ A;  3AVB A;  1RDD A;  1FK9 A;  3M8Q A;  3V4I A;  1KVB A;  2A1S A;  1HMV A;  1FKP A;  1JLQ A;  1S1W A;  5DK5 A;  4CJU A;  3OVN A;  3S9H A;  4E7J A;  1UA0 A;  3PO5 A;  1KLM A;  4M3R A;  1KTQ A;  3CFR A;  4H8K A;  4FJ9 A;  4FM1 A;  1EXQ A;  1W9H A;  2HHU A;  5C24 A;  1DTT A;  3KLF A;  4CEO A;  3AO1 A;  5HRO A;  3THV A;  1TKD A;  1L3U A;  2PYJ A;  3SYZ A;  3UIQ A;  2JLE A;  3F9K A;  2XY6 A;  3NGI A;  4DF8 A;  4DU4 A;  4PUO A;  4G1Q A;  3SV4 A;  4AHC A;  3LZI A;  4LD0 A;  4W5R A;  4CHO A;  3D0P A;  3KKR A;  4Z4F A;  2IDO A;  1RDA A;  3HJF A;  1HRH A;  5HRR A;  1C0M A;  2IOC A;  4BWJ A;  2G8U A;  1IO2 A;  1DLO A;  5SWM A;  1A5V A;  3SUQ A;  4C8L A;  2ZE2 A;  2YNH A;  4AH9 A;  3OYJ A;  1CXQ A;  3RTV A;  3NHG A;  4FM0 A;  1RT1 A;  3WNG A;  3ZCM A;  4B3O A;  3KD5 E;  4QCL A;  3AVG A;  4HUF A;  4N41 A;  2Z1J A;  2FC0 A;  3KKS A;  3VQE A;  3RRH A;  1SV5 A;  1FXX A;  3DLR A;  4DU3 A;  3PO4 A;  1S1X A;  2DFH A;  2E6M A;  1IKV A;  2P1J A;  4I2P A;  1WAJ A;  3OYM A;  2KZM A;  3AVH A;  3ZSQ A;  2F8T A;  1T8E A;  4FLV A;  4DTU A;  3V6D A;  1CZB A;  4O4G A;  4FZX C;  4FJI A;  4M3Y A;  3HXM A;  4W5Q A;  4OGE A;  5HRP A;  2RF2 A;  4NCG A;  4QAG A;  1VSK A;  1HYS A;  2GUI A;  1TK5 A;  1XHZ A;  1SKR A;  4C8K A;  3TAE A;  3NF8 A;  4YFU A;  1XWL A;  4DSJ A;  3V81 A;  4Z4I A;  2HNY A;  4KFB A;  3CQ8 A;  4E89 A;  4DFM A;  3LAN A;  2G8I A;  3HVR A;  1JLB A;  1GOA A;  4J2B A;  4CIE A;  2EX3 A;  3L8B A;  4N56 A;  1J54 A;  3ZSV A;  4HCC A;  4KHU A;  5JS1 A;  4EP5 A;  5KGW A;  1NJX A;  3SUP A;  1ZBU A;  4FZY A;  4E7L A;  1NKC A;  1YTA A;  4C8N A;  4FLU A;  1BIS A;  1LW0 A;  4QOZ B;  3O4N A;  3IAY A;  3K5N A;  3QLH A;  1BGX T;  3V9U A;  1QHT A;  1YVU A;  3DYA A;  3H08 A;  4OGC A;  1QSY A;  1B9D A;  1TL1 A;  2Y1I A;  2Z1I A;  3CFO A;  3SCX A;  1RDC A;  4FJJ A;  4L8R B;  3SQ2 A;  3EYZ A;  1RBR A;  1RTI A;  1U04 A;  4CF8 A;  3KJV A;  4OKE A;  1IG9 A;  2OYQ A;  2YNI A;  4DQS A;  2QKB A;  3ALY A;  1TKZ A;  4ELU A;  2XY7 A;  3HP6 A;  4FJN A;  3OYB A;  4DSI A;  1ITG A;  4DS4 A;  1IH7 A;  4JRQ A;  3LP2 A;  4JS5 A;  4ID1 A;  1HNI A;  2YHA A;  5DMR A;  4E1M A;  2YKM A;  4PY5 A;  4IG3 A;  3JSM A;  1U49 A;  1NK8 A;  3RR7 A;  4H4M A;  4BE0 A;  4DSE A;  1QSL A;  2RPI A;  4OVL A;  4TSX A;  1WLJ A;  1YT3 A;  3NF7 A;  1NOZ A;  5K14 A;  4DF4 A;  3NE6 A;  1RTD A;  3T19 A;  1D8Y A;  2IGI A;  3HYF A;  1X1P A;  1U45 A;  3ZT1 A;  2OPP A;  3HST B;  2DTU A;  3E01 A;  3TI0 A;  4CER A;  2VWK A;  2G8F A;  2FBT A;  2WON A;  4CGJ A;  4DS5 A;  1KFD A;  4AIL C;  3QEX A;  4W5N A;  2B5J A;  4ICL A;  3LAM A;  4CEC A;  3SJJ A;  1NJZ A;  4Y1C A;  4PQU A;  1C0T A;  4AHU A;  4CJF A;  4CJP A;  3AO4 A;  4K8X A;  3DLK A;  3LP3 A;  1RBV A;  3LDS A;  5FRM A;  3C94 A;  1EP4 A;  4CJE A;  2VG6 A;  1ZYQ A;  5FRO A;  4CF0 A;  1WSG A;  4F3T A;  3LPT A;  3OYF A;  3L2V A;  4RW7 A;  4KO0 A;  3SZ2 A;  1B92 A;  3DMJ A;  4DMN A;  5I42 A;  4B08 A;  1RBS A;  3ZSY A;  3QEI A;  1TK8 A;  1ASW A;  3OS1 A;  3QET A;  3K2P A;  3B6P A;  3NF9 A;  5E41 A;  3TAQ A;  1SUQ A;  3HPO A;  4E7H A;  2VG5 A;  4DQP A;  3DLE A;  3KLI A;  4CIG A;  1ASU A;  2YKN A;  1EX4 A;  3DOK A;  3LAK A;  3M8S A;  4DFK A;  2HNZ A;  3TAB A;  1X9S A;  1Q9X A;  4KRF A;  1T03 A;  2YHB A;  3OYE A;  3AVM A;  1QQC A;  3QIN A;  4LSN A;  4IDK A;  1UAX A;  2OPS A;  4ZTF A;  3TAM A;  2OZS A;  4DTM A;  1X9W A;  3LP0 A;  4HCB A;  3TAN A;  1G15 A;  1LWF A;  4B8A B;  3QER A;  3SQ1 A;  3LP1 A;  3AVC A;  3VQ7 A;  3P83 D;  3C6U A;  4Y1D A;  1VRT A;  3O4Q A;  3V1R A;  3ZSR A;  4CF1 A;  2QXF A;  4CHN A;  3SUO A;  4CF9 A;  4CFD A;  2BDP A;  1TKT A;  3OJU A;  1HPZ A;  3K5L A;  3QEP A;  4CJ3 A;  5J2M A;  3O3F A;  3VQQ A;  3ISN C;  1WAF A;  4YNQ A;  1A5X A;  5J2P A;  4H4O A;  3C95 A;  4CEB A;  4CIF A;  2XY5 A;  1WSH A;  2YNG A;  1ZBI A;  1QTM A;  1RTH A;  4FK2 A;  4RW8 A;  3TR8 A;  1NK6 A;  4DTO A;  4CFA A;  4O0I A;  3TWH A;  4FJ7 A;  1YTU A;  1VSD A;  3PUF A;  2DY4 A;  1T7P A;  3AVF A;  4CJ4 A;  3LAL A;  2P5G A;  1TK0 A;  2YNF A;  2X6N A;  4CED A;  4FZZ A;  3M8P A;  1K6Y A;  4OPJ A;  3AVJ A;  4N5S A;  3NFA A;  3SUN A;  4FLW A;  4DFP A;  3KK3 A;  3ZT4 A;  4M41 A;  3VQ6 A;  3LZJ A;  3PX4 A;  4OLA A;  2KW4 A;  3T3F A;  2YV0 X;  2BAN A;  1KCF A;  3LPU A;  4O0J A;  4BAC A;  2PY5 A;  3T1A A;  4N76 A;  4CJV A;  2Y1J A;  3ZSW A;  3NGZ A;  1NJW A;  1TAU A;  1XI1 A;  1UWB A;  4HUE A;  4RW9 A;  4M3U A;  4FJ8 A;  4O44 A;  1KSP A;  3BDP A;  3CG7 A;  4I9Q A;  1TV6 A;  4KTQ A;  2KTQ A;  2VG7 A;  1HYZ A;  3L2U A;  4FLY A;  5T7B A;  2JGU A;  4DU1 A;  3VQC A;  1NOY A;  4J2A A;  4E19 A;  4NYN A;  1VSJ A;  2O4I A;  4FJK A;  3OYL A;  3LWM A;  1BI4 A;  3ZSX A;  4KRE A;  4F8R A;  3HVT A;  3DM2 A;  4CK3 A;  1LWE A;  4GW6 A;  4OKJ A;  3G10 A;  3NBP A;  2X6S A;  3VQ9 A;  1BIZ A;  1NK5 A;  2HND A;  5EU7 A;  1C1B A;  3AVI A;  3HM9 A;  1LWC A;  4DTN A;  1KVA A;  5J2Q A;  5JS2 A;  4CGF A;  1EKE A;  4Z4E A;  2HB5 A;  2OPR A;  1NK7 A;  4CGI A;  3QO9 A;  4KI4 A;  1Y97 A;  3A2F A;  4B9N A;  4GMJ B;  1JKH A;  1S9G A;  4ID5 A;  5CZ2 A;  4RW6 A;  1HNV A;  4AHT A;  4CJ5 A;  5HLF A;  1X9M A;  1QS4 A;  3QNN A;  2D0A A;  3MXM A;  3DLH A;  4CK2 A;  3DI6 A;  3MXI A;  2A1R A;  4AHR A;  3MEG A;  4FW2 A;  5D3G A;  3DLG A;  2AJQ A;  4OJR A;  1I39 A;  3P5J A;  2ITG A;  3V1O A;  4DQR A;  4IKF A;  3V1Q A;  3KTQ A;  5KRT A;  1U48 A;  4DQI A;  2D0C A;  3KLG A;  4CJW A;  3KK2 A;  4CJR A;  3NDK A;  3VA0 A;  3PV8 A;  1JLF A;  5I3U A;  2P5O A;  1VSI A;  3OYK A;  3KLH A;  1U4B A;  3O3G A;  3NH1 A;  4DSL A;  5HP1 A;  1C1A A;  1LAV A;  4XIU A;  3HPH A;  4CHP A;  4F3O A;  4KHW A;  2IS3 A;  4AHS A;  5J1E A;  3SV3 A;  4E3S A;  2LSN A;  2OA8 A;  4FM2 A;  1IKW A;  5KGX A;  4CEF A;  1VSM A;  1NK0 A;  2XRI A;  2O4G A;  4DTR A;  2BGG A;  1BL3 A;  1SL0 A;  1XC9 A;  2ZD1 A;  4OKK A;  1T05 A;  3V9S A;  4ZHR A;  1S6Q A;  1RT6 A;  4JRP A;  1BHL A;  1Z26 A;  4Z4H A;  2G8H A;  4DSK A;  1VSL A;  5KRS A;  4HVJ A;  4CFB A;  1WNS A;  3I8D A;  3RMD A;  4KHY A;  4M3Z A;  3NF6 A;  2OPQ A;  4GVM A;  4AHV A;  2QK9 A;  2GV9 A;  2KFN A;  3KIO A;  4PA1 A;  4Q5V A;  4B9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...