2RN2A

Structural details of ribonuclease h from escherichia coli as refined to an atomic resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural details of ribonuclease H from Escherichia coli as refined to an atomic resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1992-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rn2A00
4Z4FA 4CEEA 4HCCA 4FLYA 4K8XA 4F4KA 5C25A 1ZBUA 3CM5A 3DOKA 3VQ5A 3OJSA 4CJWA 3KK3A 3RRHA 5SWMA 1GOAA 4DTXA 3RMAA 4KV8A 4PA1A 1R0AA 1KSPA 4AHCA 4MFBA 1J5OA 3QINA 1F21A 1KCFA 4DSLA 1YT3A 3QETA 3OYNA 3CFPA 3AO3A 3WNGA 2Y1JA 1Q9XA 5J2QA 3U3GA 1SV5A 1VSHA 4YNQA 3T3FA 3AVIA 3LZIA 3VN5A 1LWEA 1RNHA 1VSMA 2XO7A 3PY8A 1RDAA 2G8WA 1WN7A 2D0CA 3AVHA 3TAGA 1GOBA 2PYJA 4FW1A 1NOYA 3HPHA 2BANA 4H4OA 5KRSA 1HQUA 4DTNA 3DI6A 1RTDA 2A1RA 4FZYA 1RT6A 5DK5A 3U3YA 1U45A 3LPUA 3UIQA 4M3ZA 2X6SA 4M42A 1NK6A 4CEZA 4DS4A 4H8KA 3CG7A 3ZT4A 1W0HA 3K2PA 4DLGA 4Z4GA 3V9UA 1KLNA 1TL1A 3ASMA 4Q0BA 4E3SA 2GUIA 4IFVA 3TWHA 3VA0A 1Q8IA 3HT3A 4GVMA 3KLIA 4FZXC 3O4NA 1UOCA 4FYDA 1DLOA 4B9NA 3QNOA 1A5WA 3DRRA 3V9WA 2PY5A 1X9SA 3WNFA 1S1VA 3TAQA 3L2WA 1RT5A 2P5GA 3I8DA 4KHNA 2OPQA 3L2UA 1CLQA 1ZBFA 3JSMA 4DTRA 4DFPA 5J2NA 1RTHA 3IRXA 1KFDA 4IG0A 4KTWA 3F73A 1FXXA 2E6LA 1NK7A 4B3OA 3RRGA 3OY9A 3PX4A 4IBNA 3HL8A 4CHQA 4F2RA 4NYNA 1JLGA 3RMBA 3NF9A 4LH4A 3L8BA 3KJVA 3SV3A 2HVIA 4CJUA 3SQ4A 1BI4A 4F2SA 3DMJA 1LW0A 4F3TA 3LALA 1U49A 4CJLA 4NCAA 3K5LA 2HNZA 2FBYA 1S9GA 3D0PA 4E19A 1RT7A 4JLHA 3LP0A 1WSGA 4BACA 4FCYA 4ZHRA 4DTMA 4AILC 2B5JA 3SUPA 4E0DA 3KLGA 4QOZB 1FKOA 5FDLA 1SKRA 4CEOA 2ITGA 4CF0A 2W42A 4JS5A 4FLWA 4CEDA 3IAYA 1RBRA 4I9LA 2RKIA 1D9FA 3ZSYA 4CEFA 1NJZA 3OYBA 1CXUA 1RDCA 2G8UA 3NH0A 4AH9A 1BIUA 3MEEA 4O5BA 4CGJA 4KI6A 3LWMA 2DTUA 3PV8A 2BDPA 2ATQA 5HRRA 2IOCA 4CK1A 5KTQA 4DQIA 1WSIA 4OKKA 4AHUA 4Z4IA 1RCHA 1RBVA 3ALYA 2ETJA 3MEGA 3VQAA 2FBVA 4CESA 4I2PA 4E7IA 1ASUA 1D9DA 4CGGA 2YNFA 3NGIA 3VA3A 3K57A 4O4GA 2G8FA 1NK0A 4LH5A 1IKWA 3QEIA 3NF8A 2GBZA 1CXQA 4B08A 5I42A 1QSLA 3RR8A 4E1NA 4DSEA 2OZSA 2DFFA 3EY1A 3ZSVA 3OYIA 3EYZA 4M3YA 2QKBA 1SKSA 2JGUA 5CYMA 4B9TA 2F8TA 3DM2A 3ZSWA 1J53A 2QXFA 4ID5A 5C24A 1QSYA 1TK0A 4E7LA 4CF2A 4M3UA 3SUOA 4PQUA 1VSDA 3AVKA 4J2BA 4OLBA 4PWDA 3OS0A 1IKYA 1RTJA 3OYAA 2XHBA 3RR7A 4QCLA 3KK1A 1C1AA 3LWLA 1HMVA 4AHVA 1KVAA 4FZZA 4PY5A 4UQGA 1TGOA 4F8RA 3RTVA 1S6PA 4ZTFA 2E6MA 3NHGA 3P83D 3ZT1A 5HRPA 4CHYA 3KLHA 1W9HA 3VQEA 1L3SA 4MQ3A 1TKXA 2YHAA 3CM6A 1D8YA 3C6UA 3L2RA 4KHQA 4HTUA 2Z1JA 2KTQA 2P1JA 1DTQA 4DTSA 1T05A 5JS2A 3SCXA 3BDPA 1I3AA 3IG1A 4C8NA 1EP4A 3K58A 4CCHA 2YKMA 4RW9A 1CZ9A 3M8QA 2HHXA 1JLCA 3PX0A 4CECA 1VSKA 2X74A 3CFOA 3ZCMA 2X78A 3L2VA 4KTQA 4KPYA 1TL3A 1J9AA 3B6PA 2A1SA 4FK4A 1D5AA 1EX4A 1U4BA 2BGGA 1WSJA 4L8RB 1EETA 2O4GA 3HSTB 4CJSA 1DTTA 4B8AB 3AVCA 2P51A 5JS1A 2B4JA 3T1AA 1BQNA 3K5MA 3NGZA 1VSIA 4IFYA 3OYDA 3HK2A 2IDOA 2VG5A 3F9KA 4FJ8A 3AA4A 1C6VA 4DTUA 1X9WA 5HBMA 1T7PA 4FJHA 4RW4A 4BE1A 4CF9A 1WAFA 4Q5VA 3SNNA 3OVNA 3AA2A 4DQRA 2XY8A 5T7BA 2EHGA 3HO1A 2VG6A 1C0MA 3P5JA 3QO9A 1JL1A 3AO2A 3TAMA 4DS5A 4M3WA 4B9MA 2WOMA 3QESA 2OZMA 4KB0A 1RT2A 2OYQA 1NJWA 4LSLA 3HXMA 5HP1A 3LZJA 2IAJA 4FJGA 2AJQA 4E1MA 5FRNA 1HYSA 1BQMA 3OYHA 3THVA 4FK0A 4JRPA 4DQQA 4CHPA 1YTUA 5HRNA 1S5JA 2KW4A 4EZ9A 3I0RA 3WNEA 4N76A 3VQ4A 2YNGA 1ITGA 5KGXA 3MECA 2XY7A 1NK8A 3VQ8A 4CJ5A 3SYZA 1RBTA 1NK4A 3D45A 1ASVA 1HYZA 1NKBA 1N6QA 3S9HA 3AA5X 4FK2A 4O0IA 3V9ZA 4CEBA 1TKTA 3K59A 3AO1A 3PUFA 1WSFA 3VQDA 1S1UA 1X9MA 3DLGA 1C1CA 3LP2A 1LW2A 4IG3A 4CJRA 3LDSA 3AVGA 4O0JA 4DSJA 3SI6A 2G8KA 4BE2A 2VG7A 1HQEA 3OYEA 3QEWA 5EU7A 3QIPA 4CFCA 4KHUA 3B6OA 1VSLA 2RF2A 2OPSA 1BHLA 1SL1A 1TK8A 1REVA 3HPGA 2YNIA 3DLRA 1ASWA 3V1QA 5E41A 3TANA 2IS3A 1JLEA 1RBSA 2HNDA 3LAMA 2NUBA 4FM2A 3C6TA 3QNNA 1NKCA 1XC9A 4J2AA 1RDDA 2RPIA 3ZSXA 4B9LA 3E01A 3LP3A 3CFRA 3ZSZA 1IH7A 4OJRA 5CZ2A 4HHTA 1QQCA 4W5OA 1XHZA 3C94A 1SL2A 4DQPA 1B92A 1B9FA 3FFIA 3T19A 3DOLA 4CERA 4CJ3A 5D3GA 4KB1A 2IC3A 1JXEA 2XRIA 4OPKA 4BDYA 4DF4A 2HB5A 1L3TA 1IKXA 2PZSA 5KRTA 1U04A 5KGWA 2KZZA 4NCBA 4FLXA 2LSNA 4R5PA 4DG1A 4B8CA 5SZTA 3V6DA 3RWUA 2BE2A 3RMDA 3I0SA 4CK2A 1EKEA 3VQQA 2G8HA 1LAVA 4HUGA 3PX6A 4M3RA 3V81A 4OKJA 4ICLA 1L3UA 3NDKA 1RT3A 1JLQA 4DTPA 4DU3A 1K6YA 1L3VA 2Z1GA 4RG8A 4CEQA 4EP5A 3V9SA 4DSFA 4KKOA 1LWFA 1JXBA 2HHTA 1RILA 4CE9A 4W5RA 1LV5A 4CHZA 1VRUA 2R7YA 4CJTA 3KKRA 2RN2A 3O3GA 1NJYA 1T8EA 4E7KA 1Z26A 2HHSA 3OYFA 4FLVA 1RDBA 2HNYA 3QLHA 4CHOA 1JKHA 2DFHA 4LY7A 1RBUA 4E89A 3S3OA 3DLBA 2D0AA 2ZD1A 4DFKA 2WONA 4B9SA 1HNIA 2X6NA 1VSJA 1Y97A 3A2FA 4AHRA 2HW3A 4HVJA 2KQ2A 3WNHA 4CGFA 3KLFA 3KD5E 4IDKA 3KKSA 3SUQA 3SUNA 2HHUA 3ZSOA 3BGRA 1NK5A 3LANA 4W5QA 2D5RA 3LPTA 3S3MA 1S6QA 5C42A 4DFJA 1QHTA 5CY4A 1MU2A 4FJNA 1N5YA 4DU4A 3QEPA 3HVRA 1IG9A 4BWMA 4N5SA 1BISA 1GOCA 1RT4A 1XI1A 1SKWA 4O55A 3OYLA 3NBPA 3V1OA 3VQBA 4JS4A 4B9VA 2GV9A 2OA8A 3OYGA 3AA3A 1ZBIA 4Y1DA 1C0UA 3VQPA 4CIEA 4PUOA 1Z25A 2ZQBA 1J54A 3L3VA 2G8IA 4ELTA 1TVRA 4N47A 5J2PA 3M8SA 3DRSA 1S1XA 4CFBA 4I2QA 4M41A 1UA0A 4JRQA 3SQ0A 3DLHA 4ELUA 2I5JA 1B9DA 2YKNA 4F3OA 1VRTA 3AO5A 1JLAA 3MXJA 3ZT2A 3RMCA 4I9QA 4KTZA 2O4IA 3NE6A 4B9UA 3KTQA 1VSFA 1WAJA 4W5NA 2ZE2A 3AVJA 5KI6A 2VWKA 3K5NA 3L3UA 5HROA 3TABA 4KO0A 1TK5A 1NKEA 3AVMA 1L5UA 4OGCA 4CFDA 3PO4A 3M8PA 1YVUA 1ZBHA 1TAQA 3ZT3A 1HNVA 1HYVA 3KK2A 1I39A 4DF8A 1QSSA 3OS2A 4KREA 2HHVA 2KFNA 1BIZA 4OPJA 3DLKA 4J2EA 1FK9A 2XY6A 4DMNA 1KFSA 3V1RA 2Y1IA 1WNSA 4BDZA 2HHQA 4LSNA 4C8KA 1C0TA 1WSEA 3NFAA 5CYQA 1KVCA 2DFEA 4DQSA 1NOZA 3QERA 2YNHA 3K5OA 1HPZA 4CHNA 4CJ4A 4KFBA 2KZMA 1BGXT 1QTMA 4FJ9A 1RT1A 1VK0A 3C95A 3AO4A 4FJKA 1UAXA 3O3FA 4KHYA 4GMJB 4CGIA 4RW7A 1JLFA 5FRMA 3TAFA 1TAUA 1Q9YA 3LAKA 4FLTA 1U48A 4CF1A 3OYKA 1A5VA 1KVBA 4YFUA 4C8LA 3U6FA 3NF6A 3DRPA 1BI4B 3LP1A 4EP4A 3HPOA 1SL0A 3NF7A 4NYFA 4CFAA 2F96A 2D0BA 1HRHA 2F8SA 4BE0A 1KTQA 4CF8A 2HVHA 4E7JA 1SUQA 4E7HA 1QS4A 1XWLA 3AV9A 3AVAA 5K14A 5HRSA 3HP6A 4CJKA 2P5OA 3SZ2A 4EZ6A 3JYTA 2Z1IA 3OYCA 3H08A 4KHSA 4ELVA 5CZ1A 3DLEA 4FJLA 4AHTA 4G1QA 1WLJA 3HP9A 4CJVA 3OYMA 4RW8A 4OVLA 3OS1A 2IGIA 4ZTJA 1NJXA 3OJUA 1U47A 4FXDA 3CYMA 1VSEA 5J1EA 4OGEA 3OYJA 2KFZA 2YV0X 3NAEA 4FLUA 1EXQA 4IKFA 4GW6A 1IO2A 2G8VA 4N41A 4CIGA 4CK3A 4HUEA 2EX3A 2OPRA 4CJPA 3KLEA 1YTAA 2OPPA 4BWJA 2HMIA 4FJ5A 1C1BA 4I7FA 3S3NA 3P1GA 4H4MA 4FJMA 3VQ9A 4OLAA 1FKPA 2YHBA 4M45A 4KRFA 3SJJA 3NCIA 4DU1A 5HLFA 3ZT0A 3VQ7A 3QEVA 1X1PA 4W5TA 4FJXA 4M3XA 3VQCA 3TR8A 1A5XA 2QKKA 3HVTA 3ZSRA 1KRPA 4ID1A 4HCBA 4BDPA 3ISNC 2FBTA 3M8RA 4Z0UA 3DYAA 3AVBA 3V4IA 4DWIA 4CGDA 4K8ZA 3KIOA 4DFMA 3SPYA 4KHWA 4NCGA 2FC0A 1TKDA 1S9EA 4DTOA 4J2DA 2B6AA 4N56A 4TSXA 1BCOA 4WE1A 4CEAA 1WSHA 3KD1E 3HJFA 3MXMA 4Z4HA 1RTIA 4DLEA 3SV4A 3ITHA 3AVLA 4C8MA 4AHSA 3SQ2A 4HUFA 4FVMA 5FROA 2Z1HA 3L2QA 4DSKA 2FBXA 3MAQA 3V9XA 4CJFA 4CGHA 3SPZA 4FJ7A 4FLZA 4KI4A 4O44A 1CZBA 3ULDA 4FJJA 5I3UA 3G0ZA 3EZ5A 1QE1A 3CQ8A 5DMRA 4FM0A 1LWCA 4DTJA 1ZYQA 3HM9A 4FM1A 3TARA 3ZSQA 1KLMA 2Q3SA 1O1WA 2PYLA 1JL2A 1UA1A 3PO5A 4DSIA 1S1WA 1T03A 1UWBA 3AVFA 4C8OA 4CIFA 3G10A 1TV6A 2VWJA 3MXIA 1S1TA 1G15A 3AVNA 3MEDA 4Y1CA 2XY5A 4RW6A 3TAEA 3TAPA 3NH2A 5J2MA 4QAGA 3QEXA 1TKZA 1BCMA 1IKVA 3IS9A 2DY4A 3HYFA 3NGYA 3VQ6A 1NK9A 4FW2A 4M3TA 2HHWA 3O4QA 2E4LA 4CJQA 4CJEA 3SQ1A 2JLEA 1HJRA 1ZBLA 1JLBA 4Z4CA 1XHXA 2QK9A 1LAWA 3QIOA 4OKEA 4XIUA 4KAZA 4FJIA 4Z4EA 3NH1A 4LD0A 1BL3A 3O3HA 3TI0A
chains in the Genus database with same CATH superfamily
4CEEA 4HCCA 4K8XA 4PWDA 3KK3A 4WFBL 4DR2K 4KV8A 1R0AA 1HKBA 1IV0A 5LMUK 2BH1A 4CZKA 1SAZA 3WNGA 4DUYK 3PSFA 2VCPA 1OH6A 1SV5A 3T3FA 4B1YB 4DCHA 3LZIA 4B9QA 4H0OA 3PY8A 1RDAA 1NOYA 3O9UA 5KRSA 1RTDA 1BUPA 5BRFA 1G99A 3LPUA 3FZMA 2X6SA 4FWRA 4DS4A 3TSUA 1TL1A 2FF6A 2PAVA 3MWPA 1Q18A 3HT3A 1HJOA 2O8DB 4KH5A 2QWOA 4BROA 1YJ9N 1A5WA 4PL8A 1S1VA 3TAQA 2P5GA 1VQPN 2OPQA 1ZBFA 1NU0A 3ZX2A 3WQTA 3VEZA 3WT0A 3TSPA 4AM6A 3IRXA 5J2NA 1BU6O 5GIPA 1K8AO 4JKDA 1JLGA 4BR5A 3RMBA 1ILYA 4LH4A 1NG9A 3K5LA 4HWIA 5EVZA 4BR9A 1RT7A 3LP0A 3PLAA 5IWAK 1GLFO 3SUPA 5FDLA 4BRAA 3LM9A 5GINA 2ITGA 5C0YA 4CEDA 1RBRA 2RKIA 5BRHA 2G8UA 1RDCA 3THYB 4CGJA 3C65A 2DTUA 5KTQA 1WSIA 4Z4IA 1RBVA 4E7IA 4CESA 3MDQA 2ZJQL 4B1WB 4CGGA 3E9LA 2IVPA 2ASMA 4IZ9A 4X65K 2YHWA 2OZSA 3EY1A 3ZSVA 2QKBA 5CYMA 5C24A 4E7LA 3SUOA 4PQUA 4M63C 3UB5A 5AQSA 1KD1O 4AHVA 1TGOA 1S72N 3P83D 4CHYA 3VQEA 3ZYYX 4MDAA 5KPTA 3CM6A 4KHQA 3C6UA 4HTUA 3O1BA 2KTQA 4BQZA 1DTQA 3QDKA 5JS2A 5AQRA 1EP4A 3WXLA 2ZJPL 4RW9A 5BN9A 1CZ9A 3CC7N 3CPEA 2V7ZA 2JWKA 1TUYA 1WB9A 3CFOA 1QZ5A 1HR0K 5AR0A 4KTQA 3M3ZA 1TL3A 1FW6A 2ZM6K 3B6PA 1EX4A 1WSJA 3HSTB 4B8AB 2E20A 3H45C 3T1YK 3ATVA 3K5MA 4OO1J 4K41A 3NGZA 5I9EB 1D4XA 4BGAA 1HNXK 4OPAA 1C6VA 3R8EA 4DTUA 1X9WA 5HBMA 3AAPA 5TKWA 4Q5VA 3SNNA 2QWRA 3OVNA 4CZLA 4DS5A 2HOEA 1KQSM 4LFBK 2YJFA 4PKGA 3VMFB 3QESA 2OZMA 4KB0A 1OVYA 1RT2A 4LSLA 3ZX0A 2IAJA 2AJQA 2FSKA 4DR4K 1YTUA 3MN9A 1X3MA 5KGXA 3MECA 3VQ8A 5JICA 1N6QA 3S9HA 4FK2A 4O0IA 4CEBA 2A6AA 4U67L 4JYAK 3K59A 4FWOA 2RHKA 3GG4A 3LP2A 4BRFA 4CJRA 1XMOK 1BO5O 4O0JA 3SI6A 2V52B 1OKJA 5FPEA 3OYEA 1HQEA 1K9MO 1VSLA 3HPGA 1ASWA 3V1QA 2P9UA 5AQUA 1JLEA 1RBSA 3LAMA 2NUBA 4FM2A 2FSNA 5FLXO 1XC9A 3ZSXA 4B9LA 4JAXA 2E5LK 2O8EB 4DQPA 4BRNA 3DOLA 4CJ3A 2IC3A 1JXEA 3F2KA 4KB1A 2OANA 1U04A 3M5RA 3CETA 4NCBA 4R5PA 3CIPA 1EKEA 4JEPA 1LAVA 4IO9L 3V81A 4OKJA 1K6YA 3AAQA 2Z1GA 4CEQA 4JHDB 4KKOA 1JCEA 1RILA 4NXMK 1NJYA 3SMPA 5M1NA 3OYFA 1ESVA 2HNYA 3QLHA 3DXKB 3S3OA 4DFKA 1BWFO 1HNIA 3GE1A 2HW3A 2Q0UA 5BR8K 3WNHA 1NJIO 3KKSA 3BGRA 3CHWA 3PIPL 1N8RO 3HZ6A 4DFJA 1EWRA 4N5SA 1RT4A 4O55A 3NBPA 3HOTA 1CZAN 4FPBA 3OYGA 4Y1DA 2CGJA 3VQPA 1Z25A 5AQPA 3G6EN 2G8IA 4YDUA 2NNWA 1NWKA 3CMAN 4I2QA 5FPDA 4M41A 4BRCA 4F3OA 2YKNA 3O5BA 1JLAA 2O4IA 3KWIA 1WAJA 4B1UB 3AVJA 1TK5A 5KI6A 3TABA 5JVGL 3WXKA 3M8PA 1S3XA 3ZT3A 2NLXA 3DLKA 5TKYA 4DMNA 3FFKB 4YOWA 5CR4A 1QQNA 4XH1A 2HHQA 2NRZA 4C8KA 5CYQA 4DQSA 5EX5A 4FJ9A 1RT1A 2DPNA 2OCEA 4CGIA 4RW7A 1JLFA 5FRMA 3E1YA 4CF1A 2YI1A 3OYKA 3HTVA 4YFUA 2NRXA 4NYFA 4CFAA 2VYPA 2F96A 4YOTA 3C6AA 4E7JA 1SUQA 4BQLA 3O1WA 3AVAA 5HRSA 3HP6A 2P5OA 3EKUA 2ZF5O 3H08A 5CE3A 2P9PA 4AHTA 1WLJA 3HP9A 4RW8A 2IGIA 1U47A 1N33K 5EXWA 1I94K 4OGEA 3NAEA 3FR0A 4K0KK 3JS6A 4GW6A 5EY4A 4CIGA 2EX3A 3KLEA 3TTDA 5AQJA 3Q7CA 1FKPA 4M45A 4IWVA 3ZT0A 3ULEB 1X1PA 4ILGB 3VQCA 1A5XA 2QKKA 4ID1A 3ISNC 3M8RA 3V4IA 2VQEK 2P9KA 4CGDA 4K8ZA 3TSQA 3KIOA 3J7AP 1TKDA 4JKBA 5AQLA 1S9EA 1KC8O 4FWQA 4DLEA 3ITHA 2D4WA 4FVMA 3L2QA 4DSKA 2FBXA 4GVEA 3MAQA 4CJFA 4YORA 4MLHA 1CZBA 1E4FT 4FJJA 1LWCA 2IVOA 4K43A 3ZSQA 4WFNL 3DLLL 2Q3SA 4DQ8A 1O1WA 2PYLA 2UXCK 3AVFA 4CIFA 4DB3A 1DKGD 3AVNA 3I8BA 3TAEA 1OH8A 4JK7A 3U9ZA 3CCQN 4CBWA 4FW2A 4M3TA 4CJEA 3SQ1A 4IOCL 1XHXA 2QM1A 4IJAA 3NH1A 2JWLA 4I6MA 3C7NB 2ITMA 4F4KA 1UA0A 2G8HA 3CM5A 1GLAG 3DOKA 3VQ5A 3RRHA 1KSPA 4PA1A 2P9SA 2QWLA 3NMUA 1F21A 3OYNA 2UUAK 3A5OC 1Q9XA 3LDPA 4IOXA 3NVMA 1HNWK 4YNQA 3AVIA 3VN5A 1LWEA 3D2FA 1RNHA 1VSMA 1E4GT 4H0PA 3AVHA 1GOBA 2D1KA 4WYBA 3HPHA 2BANA 3EKSA 5HOOA 3DI6A 4BR4A 1U45A 4M42A 4H8KA 4DLGA 4B3RK 4CW7B 3V9UA 4FOEA 1W7AA 4JHDA 3VTHA 4JI2K 2GUIA 3GL1A 4DR1K 4GVMA 4XEIA 4FZXC 3O4NA 1UOCA 3CXCM 4A57A 3QNOA 2PY5A 5BR9A 2W6KA 3L2WA 4IEIA 3BEXA 1KAXA 4KHNA 2F9WA 1GLLO 3JSMA 4DTRA 1RTHA 1FXXA 3ENOA 1RGIA 3FZLA 4IBNA 4F2RA 3FZHA 4JD2B 3SV3A 2HVIA 3MCAB 1VQ9N 3R9PA 5F2RA 3DMJA 4F2SA 2HNZA 4E19A 4AILC 4E0DA 4GKKK 3KLGA 4CZEA 1FKOA 4QOZB 1SKRA 2UXDK 3CERA 2O8CB 1YHQN 3NVKA 4I9LA 3ZSYA 4B1XB 1P90A 1TUUA 4CBUA 2BDPA 2ATQA 3HBTA 2IOCA 4CK1A 4DQIA 5LJVA 1ZXOA 2CH6A 2NRHA 3ENBA 3BZKA 3SBGA 2H3GX 4O4GA 1T6CA 3ZX3A 3QEIA 3NF8A 5I42A 4B08A 1QSLA 4FWNA 4DV7K 3ENHA 4M3YA 1QSYA 1J53A 4ID5A 4JK8A 5M1PA 1TK0A 1N36K 3U4LA 4J2BA 2QI2A 1IBKK 2UYTA 3RR7A 1C1AA 5AQFA 1HMVA 1Q7YO 4MO4A 4UQGA 3SBTA 3RTVA 3A0IX 2E6MA 3DWLA 3NHGA 2HHHK 5HRPA 1W9HA 5LMNK 3L2RA 3BZCA 2P1JA 4ISEA 4DTSA 1T05A 1QVFM 4C8NA 5KQDA 1YXQA 4B1ZA 4X62K 5AQNA 4CD1A 3PX0A 3CCLN 2X78A 3L2VA 4A61A 4B1VA 4C1NI 3IUCA 2A1SA 4WQ4C 3WXJA 1KXPA 3EZWA 4ISGA 3ZEUB 2B4JA 1BQNA 3HK2A 1VSIA 4IFYA 3EE8A 3F9KA 4A59A 4F9OA 2A41A 3AA4A 5CHIA 1T7PA 4BE1A 3D2EA 1J5EK 4BRGA 4DQRA 5ADXA 5T7BA 1C0MA 3P5JA 1JL1A 4DR6K 3VESA 4DUZK 2Q0RA 4YOUA 1NJWA 3HXMA 3LZJA 1SS6A 3THVA 4JRPA 3THWA 3VQ4A 2YNGA 2XY7A 2CGLA 2E2OA 3SYZA 3D45A 1TKTA 3VF2A 3AO1A 1WSFA 3VQDA 5AQHA 4BR2A 3DLGA 1C1CA 4IG3A 3AVGA 2G8KA 5EU7A 3A8YA 1TK8A 1BHLA 5HL7L 1SL1A 3TANA 2IS3A 1SZ2A 2HNDA 3QNNA 3E01A 3L0QA 3CFRA 2I7NA 1Z6RA 4EIAA 1QQCA 4W5OA 3MCPA 1XHZA 1DT9A 3H1VX 4G9ZA 1B92A 3ID6A 3R6MA 2QW9A 3KWGA 4BDYA 2HB5A 1NGAA 3KVGA 4JI5K 3HSCA 4B8CA 5SZTA 3V6DA 5LL6Z 3VQQA 4HUGA 5C12A 4M3RA 1L3UA 1JLQA 4JV5K 4JKGA 3W0LA 4FO0A 4CJTA 3O3GA 4PKHA 4E7KA 4JKAA 1Z26A 1XMQK 2HHSA 4L3QA 1Z05A 3LDNA 1YJWN 5E84A 4AF1A 4CHOA 1RBUA 3BUZB 3QBWA 4B9SA 2WONA 3O80A 3RVCA 4BRLA 1Y97A 3IFRA 5KPRA 3KD5E 4CGFA 4GKJK 3KLFA 2HHUA 3SUNA 2J4RA 3ZSOA 3LANA 4W5QA 1X3NA 1S6QA 4AQYK 5CY4A 1IG9A 1VQ7N 3E9OA 1BISA 1GOCA 3VGMA 4K42A 3CJ7A 3V1OA 3VQBA 4JS4A 3CC2N 4B9VA 3LDQA 4DV4K 1XQSC 5AZJB 1ZBIA 4CIEA 4MDBA 2ZQBA 3L3VA 4JI0K 1K8KB 1U6ZA 1TVRA 4N47A 3VEYA 5J2PA 2Q97A 1S1XA 4JRQA 3SQ0A 4ELUA 1B9DA 3AGRA 3MXJA 3ZT2A 3F5TA 3NE6A 4YDUC 2WTUA 5HROA 3P38A 4FK0A 3PO4A 5LY3A 1ZBHA 3KK2A 1I39A 4H5RA 1BIZA 4OPJA 3MN6A 1KFSA 5EOYA 3V1RA 4BDZA 4BVPA 3MN7A 1KVCA 3VGLA 1NOZA 2YNHA 4CJ4A 4KFBA 2KZMA 1VK0A 4GMJB 3TAFA 3M1FA 4M7XA 3HRGA 1H1VA 3J7ZO 4FLTA 1U48A 1KVBA 4C8LA 3KK7A 1BI4B 3LP1A 3HPOA 1SL0A 3NF7A 4JKHA 1HRHA 2HVHA 2AA4A 3AV9A 4FOIA 5FPNA 5K14A 2P9PB 4EZ6A 3JYTA 3OYCA 2BTFA 4X64K 2F9TA 3DLEA 4A5AA 4LF8K 3E9PA 3OS1A 2O8CA 4H5NA 5J1EA 2YV0X 3QFUA 3I56N 1IO2A 2G8VA 2VGNA 1JCFA 4FJ5A 1YTAA 4J2DA 4DHYA 1C1BA 3P1GA 4H4MA 2YHBA 3MMVA 3SJJA 1GLJO 3QEVA 4FJXA 4K25A 1OVQA 4ISFA 1LOTB 3ZSRA 4BDPA 1NGGA 3DYAA 3AVBA 1IBLK 3G4SN 3UKRA 3BP8A 4V19S 1WUAA 3U8XA 2KKZA 4EHTA 2B6AA 2UUBK 2YJEA 1BCOA 1VQLN 3KD1E 3HJFA 3G25A 4AHSA 3AVLA 4HUFA 3ATUA 3F9MA 3C6HA 4CGHA 3SPZA 4FJ7A 5I3UA 4BY9C 4BRKA 3TARA 1QHAA 3CPWM 1NGDA 3CF5L 1UA1A 1S1WA 1T03A 4CZHA 2I7PA 4C8OA 2IVNA 5AFUH 4BRMA 2VWJA 3CI5A 4Y1CA 1G15A 4RW6A 4MLEA 3P39A 1BCMA 1IKVA 3IS9A 3P4IA 3HYFA 3VQ6A 4BRQA 1NK9A 3J80O 2HHWA 4DV0K 5IT9O 2JLEA 4EFHA 1JLBA 4XIUA 4O8KA 4KAZA 2YHXA 3PSIA 3CCVN 4LD0A 2E88A 3K9KA 1YIJN 4Z4FA 4FLYA 1ZBUA 3OJSA 1NBWA 4CJWA 5SWMA 5AQTA 1YF5L 4AHCA 4MFBA 1J5OA 3L4QA 1YT3A 2GX9A 3CFPA 4LC9B 3AO3A 2P9IB 5C10A 3U3GA 5J2QA 1QQOA 4YY3K 5AZJA 4CZJA 5C15A 2G8WA 1WN7A 3VEXA 3TAGA 2PYJA 3H6EA 4DTNA 4FZYA 3U3YA 1QZ6A 1NK6A 4CEZA 3ZT4A 4Q0BA 3K2PA 3ASMA 1IG8A 5AQVA 4E3SA 3CCJN 4A2AA 3DAWA 3VOVA 3TWHA 2GTDA 1Q8IA 3H46O 3B8AX 4FWLA 3N4PA 3DRRA 3Q7BA 3V9WA 3WNFA 1RT5A 2P9NB 2WFBA 1V4SA 5BREA 1VQNN 3UKUB 4IJNA 4DFPA 3BY5A 3F73A 4B3OA 4LF6K 2E6LA 3OY9A 1XC3A 4NYNA 4B3TK 3NF9A 3L8BA 3QICA 4A5BA 4CJUA 3CCEN 1BI4A 1LW0A 4NLCA 3LALA 4CJLA 4NCAA 4JKGB 2FBYA 2E1ZA 2GWJA 1WSGA 1Y64A 1HUXA 3O08A 3CCMN 4ILHA 5M1KA 4B3SK 4CEOA 2PFUA 4CF0A 4JS5A 4FLWA 3IAYA 1W97L 3OW2M 1D9FA 4AH9A 1VQMN 1BIUA 5C2FA 3MEEA 4O5BA 3CD6N 3PV8A 1VQON 5HRRA 4DR3K 2RE2A 1RCHA 2ETJA 3MEGA 3BF3A 1ASUA 4DV6K 3VA3A 2G8FA 3NGIA 1EWQA 1BG3A 2FXUA 4DKWA 1CXQA 4LF5K 4E1NA 4DSEA 2DFFA 5MLCQ 3EYZA 3O6WA 4FWKA 2JGUA 1SKSA 3DM2A 3ZSWA 4AM7A 4M3UA 4JD2A 3MX2A 1VSDA 3AVKA 4OLBA 2D0OA 1NLVA 3CJCA 3OYAA 4QCLA 1ZC6A 4FZZA 2WC9A 4PY5A 1RFQA 4ZTFA 3R3LA 3KLHA 3ZT1A 1L3SA 2YHAA 5F1XA 4BC3A 1C0FA 3PIOL 3T1HK 1I3AA 3IG1A 5AQXA 2O8BA 3THWB 3TTFA 2YKMA 4BC2A 3ZETB 3T69A 1VSKA 3O9QA 5KQ8A 3ZCMA 4KPYA 1N32K 1J9AA 5M1QA 3M6GA 4WF9L 2GEMA 4FK4A 1D5AA 1U4BA 2BGGA 2O4GA 4CJSA 4C23A 2PBDA 5JS1A 3OBYA 3T1AA 3OYDA 1BOTO 2VG5A 4PL7A 4EHUA 3THXB 2QWQA 4FJ8A 1V4TA 4FJHA 4RW4A 5JVHL 3LDOA 3RSEB 1SQKA 1Q86O 3HO1A 3TAMA 3AO2A 4WQ5C 3JAMO 1C0GA 3AARA 4B9MA 4HTLA 3KHYA 4FJGA 4E1MA 5FRNA 1HYSA 1BQMA 3OYHA 4GNIA 4DQQA 4CHPA 5HRNA 1S5JA 4EZ9A 3I0RA 4N76A 5AQOA 3VF4A 1ITGA 3ZETA 1NK8A 4CJ5A 1NK4A 1ASVA 1HYZA 4GV9A 4BRHA 2GUPA 3V9ZA 4H0XB 2ZGYA 1VQKN 2KLAA 3PUFA 3UE5A 1S1UA 4IXCA 1X9MA 3EO3A 3LDSA 1LW2A 1XUPO 3MN5A 3QEWA 5ADXH 3G71N 2W6LA 3LDLA 3DLRA 3THXA 4PHTX 2VGMA 1KAZA 3LM2A 2E2QA 3IMXA 4WFAL 2RPIA 3LP3A 5F0XA 3ZSZA 1IH7A 4OJRA 3I55N 3A5NC 1SL2A 3C94A 3UKUA 4CERA 1B9FA 3T19A 3VEWA 5D3GA 2XRIA 2PZSA 3R1XA 1IKXA 3L6QA 4YOVA 1NGJA 4FLXA 2LSNA 5GADP 3J81O 5A2QO 2BE2A 4H03B 3RMDA 1TYQB 3I0SA 4CK2A 4C1NK 4JKFA 3I33A 3WEEB 4ICLA 4QS8A 4DU3A 3OHRA 4CZMA 5JMVA 3J7YP 1L3VA 4RG8A 4E1JA 4EP5A 3EE9A 1JXBA 3TU5A 4CE9A 4H0TB 4CHZA 1VRUA 2R7YA 1T8EA 2RN2A 3VEVA 1JJ2M 4FLVA 1RDBA 4YOYA 3DLBA 4LY7A 1JKHA 2DFHA 2UXBK 1YUWA 1HNZK 5M1FA 2ZD1A 3VPZA 2Q36A 2X6NA 3DXMB 4I6MB 1VSJA 3GBTA 3A2FA 1VHXA 4HVJA 4DR5K 4IDKA 3W3DA 1YJNN 2P9SB 2D5RA 3LPTA 1HKGA 1U2VA 5C42A 4FJNA 4DU4A 4A62A 3HVRA 2P9NA 4M7YA 4BWMA 1SKWA 4OPHA 4LF7K 2GV9A 4LF9K 2FSJA 4BGBA 2OA8A 4BRDA 3AA3A 1OH7A 3D2FB 4JN4A 4PUOA 1J54A 3WEEA 5BPNA 4ELTA 5B8HA 3FLCO 3DRSA 4CFBA 1YVNA 3SLCA 3DLHA 2I5JA 1VRTA 3RMCA 2HBKA 4I9QA 4KTZA 3EN9A 4B9UA 3O4WA 1VSFA 1W2BM 2ZE2A 3UIQA 1NKEA 1L5UA 4OGCA 4CFDA 1YVUA 5AFUA 1TAQA 2HMPA 2O8DA 1HNVA 1HYVA 4DF8A 1QSSA 3OS2A 2GWKA 4NB4A 4J2EA 1FK9A 2XY6A 1WOQA 1K73O 2HSTA 2Y1IA 4LSNA 2YCHA 1WSEA 2QTDA 2ZWHA 3K5OA 2Q2RA 1ATNA 1QTMA 4YHHK 1XNQK 4O8UA 4FJKA 3O3FA 3AGKA 4OX9K 3SJHA 3QBXA 4XH4A 1Q9YA 3LAKA 1A5VA 3QMLA 3DRPA 4QS7A 1ATSA 4NLBA 3O8MA 2VQFK 2D0BA 3QB0A 2F8SA 3MX5A 2NRTA 1QS4A 1XWLA 4CJKA 3P31A 3SZ2A 2QWMA 2Z1IA 4R79A 2FLOA 4ELVA 3WQUA 3TPQA 5CZ1A 4KHSA 4G1QA 4CJVA 3CJAA 3OYMA 1NJXA 4BVOA 4FXDA 3OJUA 3CYMA 1EXQA 4IKFA 5AZIA 4N41A 4HUEA 4CJPA 3ZLJA 2OPPA 4FJMA 3S3NA 1RDUA 5BN8A 1S22A 2FF3B 1GLEG 2V51B 4B3MK 4DV3K 4M3XA 3TR8A 4HCBA 4JI8K 3E66A 4DV1K 4GV6A 3SPYA 2FC0A 3C7NA 4J8FA 4DTOA 4WE1A 2OTJN 1WSHA 3MXMA 4Z4HA 3SV4A 3SQ2A 4CZGA 2HBMA 5FROA 3V9XA 3OA9A 4KI4A 4FLZA 2HF4A 3G0ZA 3CQ8A 1QE1A 4DTJA 2W41A 3HM9A 4FM1A 4FWSA 3VTIA 1IBMK 3K0SA 1KLMA 5AZIB 3PO5A 4DSIA 2WUSA 4JI6K 1BA1A 3MXIA 1S1TA 5GAGP 3KZBA 3MEDA 3TAPA 3ID8A 3QEXA 3CQYA 3ULEA 1DGKN 3O4QA 2E4LA 1E3MA 2NZTA 1ZBLA 4Z4CA 3QIOA 4OKEA 4Z4EA 3BF1A 3TTCA 5AQWA 5C25A 3RMAA 1GOAA 4DTXA 3QINA 2CH5A 1KCFA 4DSLA 3QETA 1VQ8N 1M1KO 2BUPA 4H5WA 2Y1JA 4GY2B 1VSHA 4LFCK 3CJ1A 2XO7A 2A40A 1NGHA 1T3VA 2HBJA 3EEQA 2D0CA 4CZFA 3JXUA 4FW1A 4KH6A 4H4OA 1HQUA 2A1RA 1RT6A 3FZKA 4FWMA 5DK5A 4BC4A 4M3ZA 2EWSA 3CG7A 1W0HA 5DM7L 4Z4GA 1KLNA 3A5MC 1N34K 4IFVA 4XH5A 5M1OA 3VA0A 1NGCA 3KLIA 4FYDA 3DJCA 1DLOA 4B9NA 3DXKA 1X9SA 5GAHP 5LJWA 4X66K 2O8EA 3DXMA 3I8DA 4IFEA 1CLQA 3L2UA 3MWTA 5AQGA 1KFDA 4IG0A 4KTWA 1NK7A 3IKMA 3RRGA 4JI7K 4FPAA 4CHQA 3HL8A 3PX4A 1WBBA 1TYQA 3D6RA 5AQMA 3KJVA 1MWMA 3SQ4A 3D7EO 4F3TA 1U49A 3S41A 4RCHA 1GLBG 1S9GA 3LL3A 3D0PA 4BACA 4FCYA 4JLHA 4WQ5A 4RTFD 4DTMA 4ZHRA 2B5JA 1EO1A 3HM8A 3CMEN 2W42A 1MA9B 1T6DA 3CJBA 3O9TA 4Z94A 4CEFA 2HF3A 1P8ZA 1HLUA 1NJZA 3OYBA 1CXUA 4BRPA 4BRIA 3NH0A 4ILJA 4KI6A 3LWMA 4OKKA 4AHUA 3ALYA 3VQAA 2FBVA 4I2PA 4BR7A 1D9DA 3O9RA 2YNFA 3K57A 1NK0A 4LH5A 1IKWA 2HBLA 2GBZA 4GV3A 4LF4K 5AQKA 2ZJRL 3RR8A 2W40A 5GAEP 3OYIA 4B9TA 2F8TA 2QXFA 4IDHA 4CF2A 3CCRN 4JI3K 1YITN 4FL9A 3OS0A 4EAHD 1IKYA 1RTJA 2XHBA 3KK1A 4H0YB 3LWLA 1BA0A 1KVAA 2A3ZA 4F8RA 1S6PA 1NGFA 2QWPA 4CZIA 1LCUA 4MQ3A 1TKXA 1D8YA 2Z1JA 3FZFA 2Q31A 4IEEA 4YOXA 3SCXA 3BDPA 3K58A 3VERA 4CCHA 5AQQA 2YX6A 3THYA 3M8QA 2HHXA 3H3NO 1JLCA 2QXLA 3A5LC 1HKCA 4CECA 1KAYA 2X74A 2UU9K 1QQMA 4UY8O 2ZGZA 4KBOA 4Y0WA 4QS9A 4L8RB 1EETA 1DTTA 5BPLA 2QA4N 1Q81O 2QEXN 3AVCA 2P51A 2E1YA 1FJGK 4FVUA 2IDOA 4JI1K 3EL2A 3SAFA 5DM6L 4CF9A 1WAFA 3SAGA 3AA2A 2XY8A 1JCGA 2EHGA 4JKEA 2VG6A 1IJJA 3QO9A 1YAGA 2GELA 2OTLN 4CBXA 4M3WA 1J6ZA 2WOMA 4KH4A 2OYQA 5HP1A 2YHYA 1VAZA 5AQIA 3QFPA 3WXIA 2KW4A 3WNEA 3H1QA 3HI0A 4CJ7A 4U7BA 1RBTA 4FWPA 1NKBA 3AA5X 2A5XA 1NMNA 5JLFA 4DSJA 2ASPA 4BE2A 2VG7A 3ZEUA 1VQ4N 3QIPA 4CFCA 4KHUA 3B6OA 3HOSA 2E2PA 2OPSA 2RF2A 3CCSN 1REVA 2YNIA 4CD3A 4NO7A 5E41A 3UKRB 3VEOA 3C6TA 3WXMB 1O13A 1NKCA 4J2AA 3OBWA 1RDDA 2A42A 5JLHA 4BC5A 3N4QA 3IDHA 5CZ2A 4HHTA 2VWBA 1NNEA 3FGUA 3FFIA 4BG8A 2F4VK 4OPKA 4DF4A 1L3TA 4H5TA 2D0PA 2AP1A 5KRTA 5KGWA 2KZZA 4DG1A 3RWUA 2P9IA 1NGBA 3PX6A 4LFAK 1K8KA 4WQ4A 3NDKA 1RT3A 4DTPA 1WBDA 4DSFA 3V9SA 2NRRA 1LWFA 5AJ3K 2HHTA 5AQYA 5GIOA 2O8FB 4W5RA 1LV5A 1HPMA 3KKRA 3O9SA 4WCEL 5H1SQ 3CC4N 5BPMA 2WBNA 3J8AA 4E89A 3L4IA 4IO8A 2D0AA 1NMDA 3WUHA 1OH5A 2F7TA 4AHRA 4BREA 2KQ2A 3SUQA 2P9LB 1NK5A 4H5VA 3S3MA 1QHTA 1MU2A 1N5YA 3T7ZA 3QEPA 1XNRK 5AQZA 1XI1A 3CCUN 1U2VB 3OYLA 2NRWA 3VETA 1M90O 3SMSA 1C0UA 4JKCA 5FPMA 3M8SA 3SK3A 3AO5A 1X9JA 4DV2K 3KTQA 4W5NA 2VWKA 3K5NA 3L3UA 4CI6A 4KO0A 3AVMA 4DR7K 2NRVA 2KFNA 2HHVA 4KREA 4JI4K 1WNSA 4FSVA 2IIRA 2P9LA 1C0TA 3NFAA 3QERA 2DFEA 1ZBSA 4BG9A 1HPZA 5E26A 4CHNA 2KHOA 1BGXT 4DV5K 3C95A 3AO4A 1UAXA 4KHYA 1TAUA 3VF6A 2E2NA 1YI2N 3U6FA 3NF6A 2P9KB 4EP4A 3D2EB 3MK6A 4BE0A 1KTQA 4KHPK 4H0VB 1RDWX 4CF8A 4E7HA 1DEJA 1NM1A 3VGKA 2V7YA 2O8BB 4FJLA 1ATRA 3GDQA 4IOAL 4ZTJA 4OVLA 1VQ5N 4A2BA 1VSEA 5ELZA 1NGEA 3OYJA 2E8AA 2KFZA 1MDUB 3FE1A 4FLUA 3VENA 3CQXA 2ASOA 4CK3A 2OPRA 1T44A 1GLCG 2HMIA 4BWJA 4I7FA 4MO5A 3VQ9A 4OLAA 4KRFA 3NCIA 4DU1A 5HLFA 5KPZA 3VQ7A 4W5TA 1NGIA 4BR0A 3HVTA 1KRPA 2FBTA 3RSEA 5C2DA 3AY9A 4Z0UA 4DWIA 2P9UB 4NXNK 4DFMA 4KHWA 4NCGA 2Q1NA 3GOIA 2UUCK 1Q82O 4N56A 1MWKA 4TSXA 4CEAA 2CGKA 4RWTA 1RTIA 4C8MA 4CVNE 3K9JA 2Z1HA 4O44A 3ULDA 3EZ5A 4FM0A 5DMRA 1ZYQA 1VQ6N 4JNEA 1HX1A 3OTOK 1QVGM 1JL2A 1R59O 5BRDA 1UWBA 3G10A 1TV6A 4PKIA 2XY5A 1EQYA 3NH2A 5J2MA 4QAGA 1TKZA 2O8FA 2DY4A 3NGYA 3U9DA 3CJ9A 4CJQA 1GLDG 1HJRA 3H3OB 2QWNA 4JK9A 2QK9A 1LAWA 4FJIA 3C0BA 1BL3A 3O3HA 4O5FA 3TI0A 3SAHA 1BDGA
chains in the Genus database with same CATH topology
4Z4FA 4CEEA 4HCCA 4FLYA 4K8XA 4F4KA 5C25A 1ZBUA 3CM5A 3DOKA 3VQ5A 3OJSA 4CJWA 3KK3A 3RRHA 5SWMA 1GOAA 4DTXA 3RMAA 4KV8A 4PA1A 1R0AA 1KSPA 4AHCA 4MFBA 1J5OA 3QINA 1F21A 1KCFA 4DSLA 1YT3A 3QETA 3OYNA 3CFPA 3AO3A 3WNGA 2Y1JA 1Q9XA 5J2QA 3U3GA 1SV5A 1VSHA 4YNQA 3T3FA 3AVIA 3LZIA 3VN5A 1LWEA 1RNHA 1VSMA 2XO7A 3PY8A 1RDAA 2G8WA 1WN7A 2D0CA 3AVHA 3TAGA 1GOBA 2PYJA 4FW1A 1NOYA 3HPHA 2BANA 4H4OA 5KRSA 1HQUA 4DTNA 3DI6A 1RTDA 2A1RA 4FZYA 1RT6A 5DK5A 3U3YA 1U45A 3LPUA 3UIQA 4M3ZA 2X6SA 4M42A 1NK6A 4CEZA 4DS4A 4H8KA 3CG7A 3ZT4A 1W0HA 3K2PA 4DLGA 4Z4GA 3V9UA 1KLNA 1TL1A 3ASMA 4Q0BA 4E3SA 2GUIA 4IFVA 3TWHA 3VA0A 1Q8IA 3HT3A 4GVMA 3KLIA 4FZXC 3O4NA 1UOCA 4FYDA 1DLOA 4B9NA 3QNOA 1A5WA 3DRRA 3V9WA 2PY5A 1X9SA 3WNFA 1S1VA 3TAQA 3L2WA 1RT5A 2P5GA 3I8DA 4KHNA 2OPQA 3L2UA 1CLQA 1ZBFA 3JSMA 4DTRA 4DFPA 5J2NA 1RTHA 3IRXA 1KFDA 4IG0A 4KTWA 3F73A 1FXXA 2E6LA 1NK7A 4B3OA 3RRGA 3OY9A 3PX4A 4IBNA 3HL8A 4CHQA 4F2RA 4NYNA 1JLGA 3RMBA 3NF9A 4LH4A 3L8BA 3KJVA 3SV3A 2HVIA 4CJUA 3SQ4A 1BI4A 4F2SA 3DMJA 1LW0A 4F3TA 3LALA 1U49A 4CJLA 4NCAA 3K5LA 2HNZA 2FBYA 1S9GA 3D0PA 4E19A 1RT7A 4JLHA 3LP0A 1WSGA 4BACA 4FCYA 4ZHRA 4DTMA 4AILC 2B5JA 3SUPA 4E0DA 3KLGA 4QOZB 1FKOA 5FDLA 1SKRA 4CEOA 2ITGA 4CF0A 2W42A 4JS5A 4FLWA 4CEDA 3IAYA 1RBRA 4I9LA 2RKIA 1D9FA 3ZSYA 4CEFA 1NJZA 3OYBA 1CXUA 1RDCA 2G8UA 3NH0A 4AH9A 1BIUA 3MEEA 4O5BA 4CGJA 4KI6A 3LWMA 2DTUA 3PV8A 2BDPA 2ATQA 5HRRA 2IOCA 4CK1A 5KTQA 4DQIA 1WSIA 4OKKA 4AHUA 4Z4IA 1RCHA 1RBVA 3ALYA 2ETJA 3MEGA 3VQAA 2FBVA 4CESA 4I2PA 4E7IA 1ASUA 1D9DA 4CGGA 2YNFA 3NGIA 3VA3A 3K57A 4O4GA 2G8FA 1NK0A 4LH5A 1IKWA 3QEIA 3NF8A 2GBZA 1CXQA 4B08A 5I42A 1QSLA 3RR8A 4E1NA 4DSEA 2OZSA 2DFFA 3EY1A 3ZSVA 3OYIA 3EYZA 4M3YA 2QKBA 1SKSA 2JGUA 5CYMA 4B9TA 2F8TA 3DM2A 3ZSWA 1J53A 2QXFA 4ID5A 5C24A 1QSYA 1TK0A 4E7LA 4CF2A 4M3UA 3SUOA 4PQUA 1VSDA 3AVKA 4J2BA 4OLBA 4PWDA 3OS0A 1IKYA 1RTJA 3OYAA 2XHBA 3RR7A 4QCLA 3KK1A 1C1AA 3LWLA 1HMVA 4AHVA 1KVAA 4FZZA 4PY5A 4UQGA 1TGOA 4F8RA 3RTVA 1S6PA 4ZTFA 2E6MA 3NHGA 3P83D 3ZT1A 5HRPA 4CHYA 3KLHA 1W9HA 3VQEA 1L3SA 4MQ3A 1TKXA 2YHAA 3CM6A 1D8YA 3C6UA 3L2RA 4KHQA 4HTUA 2Z1JA 2KTQA 2P1JA 1DTQA 4DTSA 1T05A 5JS2A 3SCXA 3BDPA 1I3AA 3IG1A 4C8NA 1EP4A 3K58A 4CCHA 2YKMA 4RW9A 1CZ9A 3M8QA 2HHXA 1JLCA 3PX0A 4CECA 1VSKA 2X74A 3CFOA 3ZCMA 2X78A 3L2VA 4KTQA 4KPYA 1TL3A 1J9AA 3B6PA 2A1SA 4FK4A 1D5AA 1EX4A 1U4BA 2BGGA 1WSJA 4L8RB 1EETA 2O4GA 3HSTB 4CJSA 1DTTA 4B8AB 3AVCA 2P51A 5JS1A 2B4JA 3T1AA 1BQNA 3K5MA 3NGZA 1VSIA 4IFYA 3OYDA 3HK2A 2IDOA 2VG5A 3F9KA 4FJ8A 3AA4A 1C6VA 4DTUA 1X9WA 5HBMA 1T7PA 4FJHA 4RW4A 4BE1A 4CF9A 1WAFA 4Q5VA 3SNNA 3OVNA 3AA2A 4DQRA 2XY8A 5T7BA 2EHGA 3HO1A 2VG6A 1C0MA 3P5JA 3QO9A 1JL1A 3AO2A 3TAMA 4DS5A 4M3WA 4B9MA 2WOMA 3QESA 2OZMA 4KB0A 1RT2A 2OYQA 1NJWA 4LSLA 3HXMA 5HP1A 3LZJA 2IAJA 4FJGA 2AJQA 4E1MA 5FRNA 1HYSA 1BQMA 3OYHA 3THVA 4FK0A 4JRPA 4DQQA 4CHPA 1YTUA 5HRNA 1S5JA 2KW4A 4EZ9A 3I0RA 3WNEA 4N76A 3VQ4A 2YNGA 1ITGA 5KGXA 3MECA 2XY7A 1NK8A 3VQ8A 4CJ5A 3SYZA 1RBTA 1NK4A 3D45A 1ASVA 1HYZA 1NKBA 1N6QA 3S9HA 3AA5X 4FK2A 4O0IA 3V9ZA 4CEBA 1TKTA 3K59A 3AO1A 3PUFA 1WSFA 3VQDA 1S1UA 1X9MA 3DLGA 1C1CA 3LP2A 1LW2A 4IG3A 4CJRA 3LDSA 3AVGA 4O0JA 4DSJA 3SI6A 2G8KA 4BE2A 2VG7A 1HQEA 3OYEA 3QEWA 5EU7A 3QIPA 4CFCA 4KHUA 3B6OA 1VSLA 2RF2A 2OPSA 1BHLA 1SL1A 1TK8A 1REVA 3HPGA 2YNIA 3DLRA 1ASWA 3V1QA 5E41A 3TANA 2IS3A 1JLEA 1RBSA 2HNDA 3LAMA 2NUBA 4FM2A 3C6TA 3QNNA 1NKCA 1XC9A 4J2AA 1RDDA 2RPIA 3ZSXA 4B9LA 3E01A 3LP3A 3CFRA 3ZSZA 1IH7A 4OJRA 5CZ2A 4HHTA 1QQCA 4W5OA 1XHZA 3C94A 1SL2A 4DQPA 1B92A 1B9FA 3FFIA 3T19A 3DOLA 4CERA 4CJ3A 5D3GA 4KB1A 2IC3A 1JXEA 2XRIA 4OPKA 4BDYA 4DF4A 2HB5A 1L3TA 1IKXA 2PZSA 5KRTA 1U04A 5KGWA 2KZZA 4NCBA 4FLXA 2LSNA 4R5PA 4DG1A 4B8CA 5SZTA 3V6DA 3RWUA 2BE2A 3RMDA 3I0SA 4CK2A 1EKEA 3VQQA 2G8HA 1LAVA 4HUGA 3PX6A 4M3RA 3V81A 4OKJA 4ICLA 1L3UA 3NDKA 1RT3A 1JLQA 4DTPA 4DU3A 1K6YA 1L3VA 2Z1GA 4RG8A 4CEQA 4EP5A 3V9SA 4DSFA 4KKOA 1LWFA 1JXBA 2HHTA 1RILA 4CE9A 4W5RA 1LV5A 4CHZA 1VRUA 2R7YA 4CJTA 3KKRA 2RN2A 3O3GA 1NJYA 1T8EA 4E7KA 1Z26A 2HHSA 3OYFA 4FLVA 1RDBA 2HNYA 3QLHA 4CHOA 1JKHA 2DFHA 4LY7A 1RBUA 4E89A 3S3OA 3DLBA 2D0AA 2ZD1A 4DFKA 2WONA 4B9SA 1HNIA 2X6NA 1VSJA 1Y97A 3A2FA 4AHRA 2HW3A 4HVJA 2KQ2A 3WNHA 4CGFA 3KLFA 3KD5E 4IDKA 3KKSA 3SUQA 3SUNA 2HHUA 3ZSOA 3BGRA 1NK5A 3LANA 4W5QA 2D5RA 3LPTA 3S3MA 1S6QA 5C42A 4DFJA 1QHTA 5CY4A 1MU2A 4FJNA 1N5YA 4DU4A 3QEPA 3HVRA 1IG9A 4BWMA 4N5SA 1BISA 1GOCA 1RT4A 1XI1A 1SKWA 4O55A 3OYLA 3NBPA 3V1OA 3VQBA 4JS4A 4B9VA 2GV9A 2OA8A 3OYGA 3AA3A 1ZBIA 4Y1DA 1C0UA 3VQPA 4CIEA 4PUOA 1Z25A 2ZQBA 1J54A 3L3VA 2G8IA 4ELTA 1TVRA 4N47A 5J2PA 3M8SA 3DRSA 1S1XA 4CFBA 4I2QA 4M41A 1UA0A 4JRQA 3SQ0A 3DLHA 4ELUA 2I5JA 1B9DA 2YKNA 4F3OA 1VRTA 3AO5A 1JLAA 3MXJA 3ZT2A 3RMCA 4I9QA 4KTZA 2O4IA 3NE6A 4B9UA 3KTQA 1VSFA 1WAJA 4W5NA 2ZE2A 3AVJA 5KI6A 2VWKA 3K5NA 3L3UA 5HROA 3TABA 4KO0A 1TK5A 1NKEA 3AVMA 1L5UA 4OGCA 4CFDA 3PO4A 3M8PA 1YVUA 1ZBHA 1TAQA 3ZT3A 1HNVA 1HYVA 3KK2A 1I39A 4DF8A 1QSSA 3OS2A 4KREA 2HHVA 2KFNA 1BIZA 4OPJA 3DLKA 4J2EA 1FK9A 2XY6A 4DMNA 1KFSA 3V1RA 2Y1IA 1WNSA 4BDZA 2HHQA 4LSNA 4C8KA 1C0TA 1WSEA 3NFAA 5CYQA 1KVCA 2DFEA 4DQSA 1NOZA 3QERA 2YNHA 3K5OA 1HPZA 4CHNA 4CJ4A 4KFBA 2KZMA 1BGXT 1QTMA 4FJ9A 1RT1A 1VK0A 3C95A 3AO4A 4FJKA 1UAXA 3O3FA 4KHYA 4GMJB 4CGIA 4RW7A 1JLFA 5FRMA 3TAFA 1TAUA 1Q9YA 3LAKA 4FLTA 1U48A 4CF1A 3OYKA 1A5VA 1KVBA 4YFUA 4C8LA 3U6FA 3NF6A 3DRPA 1BI4B 3LP1A 4EP4A 3HPOA 1SL0A 3NF7A 4NYFA 4CFAA 2F96A 2D0BA 1HRHA 2F8SA 4BE0A 1KTQA 4CF8A 2HVHA 4E7JA 1SUQA 4E7HA 1QS4A 1XWLA 3AV9A 3AVAA 5K14A 5HRSA 3HP6A 4CJKA 2P5OA 3SZ2A 4EZ6A 3JYTA 2Z1IA 3OYCA 3H08A 4KHSA 4ELVA 5CZ1A 3DLEA 4FJLA 4AHTA 4G1QA 1WLJA 3HP9A 4CJVA 3OYMA 4RW8A 4OVLA 3OS1A 2IGIA 4ZTJA 1NJXA 3OJUA 1U47A 4FXDA 3CYMA 1VSEA 5J1EA 4OGEA 3OYJA 2KFZA 2YV0X 3NAEA 4FLUA 1EXQA 4IKFA 4GW6A 1IO2A 2G8VA 4N41A 4CIGA 4CK3A 4HUEA 2EX3A 2OPRA 4CJPA 3KLEA 1YTAA 2OPPA 4BWJA 2HMIA 4FJ5A 1C1BA 4I7FA 3S3NA 3P1GA 4H4MA 4FJMA 3VQ9A 4OLAA 1FKPA 2YHBA 4M45A 4KRFA 3SJJA 3NCIA 4DU1A 5HLFA 3ZT0A 3VQ7A 3QEVA 1X1PA 4W5TA 4FJXA 4M3XA 3VQCA 3TR8A 1A5XA 2QKKA 3HVTA 3ZSRA 1KRPA 4ID1A 4HCBA 4BDPA 3ISNC 2FBTA 3M8RA 4Z0UA 3DYAA 3AVBA 3V4IA 4DWIA 4CGDA 4K8ZA 3KIOA 4DFMA 3SPYA 4KHWA 4NCGA 2FC0A 1TKDA 1S9EA 4DTOA 4J2DA 2B6AA 4N56A 4TSXA 1BCOA 4WE1A 4CEAA 1WSHA 3KD1E 3HJFA 3MXMA 4Z4HA 1RTIA 4DLEA 3SV4A 3ITHA 3AVLA 4C8MA 4AHSA 3SQ2A 4HUFA 4FVMA 5FROA 2Z1HA 3L2QA 4DSKA 2FBXA 3MAQA 3V9XA 4CJFA 4CGHA 3SPZA 4FJ7A 4FLZA 4KI4A 4O44A 1CZBA 3ULDA 4FJJA 5I3UA 3G0ZA 3EZ5A 1QE1A 3CQ8A 5DMRA 4FM0A 1LWCA 4DTJA 1ZYQA 3HM9A 4FM1A 3TARA 3ZSQA 1KLMA 2Q3SA 1O1WA 2PYLA 1JL2A 1UA1A 3PO5A 4DSIA 1S1WA 1T03A 1UWBA 3AVFA 4C8OA 4CIFA 3G10A 1TV6A 2VWJA 3MXIA 1S1TA 1G15A 3AVNA 3MEDA 4Y1CA 2XY5A 4RW6A 3TAEA 3TAPA 3NH2A 5J2MA 4QAGA 3QEXA 1TKZA 1BCMA 1IKVA 3IS9A 2DY4A 3HYFA 3NGYA 3VQ6A 1NK9A 4FW2A 4M3TA 2HHWA 3O4QA 2E4LA 4CJQA 4CJEA 3SQ1A 2JLEA 1HJRA 1ZBLA 1JLBA 4Z4CA 1XHXA 2QK9A 1LAWA 3QIOA 4OKEA 4XIUA 4KAZA 4FJIA 4Z4EA 3NH1A 4LD0A 1BL3A 3O3HA 3TI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4F A;  4CEE A;  4HCC A;  4FLY A;  4K8X A;  4F4K A;  5C25 A;  1ZBU A;  3CM5 A;  3DOK A;  3VQ5 A;  3OJS A;  4CJW A;  3KK3 A;  3RRH A;  5SWM A;  1GOA A;  4DTX A;  3RMA A;  4KV8 A;  4PA1 A;  1R0A A;  1KSP A;  4AHC A;  4MFB A;  1J5O A;  3QIN A;  1F21 A;  1KCF A;  4DSL A;  1YT3 A;  3QET A;  3OYN A;  3CFP A;  3AO3 A;  3WNG A;  2Y1J A;  1Q9X A;  5J2Q A;  3U3G A;  1SV5 A;  1VSH A;  4YNQ A;  3T3F A;  3AVI A;  3LZI A;  3VN5 A;  1LWE A;  1RNH A;  1VSM A;  2XO7 A;  3PY8 A;  1RDA A;  2G8W A;  1WN7 A;  2D0C A;  3AVH A;  3TAG A;  1GOB A;  2PYJ A;  4FW1 A;  1NOY A;  3HPH A;  2BAN A;  4H4O A;  5KRS A;  1HQU A;  4DTN A;  3DI6 A;  1RTD A;  2A1R A;  4FZY A;  1RT6 A;  5DK5 A;  3U3Y A;  1U45 A;  3LPU A;  3UIQ A;  4M3Z A;  2X6S A;  4M42 A;  1NK6 A;  4CEZ A;  4DS4 A;  4H8K A;  3CG7 A;  3ZT4 A;  1W0H A;  3K2P A;  4DLG A;  4Z4G A;  3V9U A;  1KLN A;  1TL1 A;  3ASM A;  4Q0B A;  4E3S A;  2GUI A;  4IFV A;  3TWH A;  3VA0 A;  1Q8I A;  3HT3 A;  4GVM A;  3KLI A;  4FZX C;  3O4N A;  1UOC A;  4FYD A;  1DLO A;  4B9N A;  3QNO A;  1A5W A;  3DRR A;  3V9W A;  2PY5 A;  1X9S A;  3WNF A;  1S1V A;  3TAQ A;  3L2W A;  1RT5 A;  2P5G A;  3I8D A;  4KHN A;  2OPQ A;  3L2U A;  1CLQ A;  1ZBF A;  3JSM A;  4DTR A;  4DFP A;  5J2N A;  1RTH A;  3IRX A;  1KFD A;  4IG0 A;  4KTW A;  3F73 A;  1FXX A;  2E6L A;  1NK7 A;  4B3O A;  3RRG A;  3OY9 A;  3PX4 A;  4IBN A;  3HL8 A;  4CHQ A;  4F2R A;  4NYN A;  1JLG A;  3RMB A;  3NF9 A;  4LH4 A;  3L8B A;  3KJV A;  3SV3 A;  2HVI A;  4CJU A;  3SQ4 A;  1BI4 A;  4F2S A;  3DMJ A;  1LW0 A;  4F3T A;  3LAL A;  1U49 A;  4CJL A;  4NCA A;  3K5L A;  2HNZ A;  2FBY A;  1S9G A;  3D0P A;  4E19 A;  1RT7 A;  4JLH A;  3LP0 A;  1WSG A;  4BAC A;  4FCY A;  4ZHR A;  4DTM A;  4AIL C;  2B5J A;  3SUP A;  4E0D A;  3KLG A;  4QOZ B;  1FKO A;  5FDL A;  1SKR A;  4CEO A;  2ITG A;  4CF0 A;  2W42 A;  4JS5 A;  4FLW A;  4CED A;  3IAY A;  1RBR A;  4I9L A;  2RKI A;  1D9F A;  3ZSY A;  4CEF A;  1NJZ A;  3OYB A;  1CXU A;  1RDC A;  2G8U A;  3NH0 A;  4AH9 A;  1BIU A;  3MEE A;  4O5B A;  4CGJ A;  4KI6 A;  3LWM A;  2DTU A;  3PV8 A;  2BDP A;  2ATQ A;  5HRR A;  2IOC A;  4CK1 A;  5KTQ A;  4DQI A;  1WSI A;  4OKK A;  4AHU A;  4Z4I A;  1RCH A;  1RBV A;  3ALY A;  2ETJ A;  3MEG A;  3VQA A;  2FBV A;  4CES A;  4I2P A;  4E7I A;  1ASU A;  1D9D A;  4CGG A;  2YNF A;  3NGI A;  3VA3 A;  3K57 A;  4O4G A;  2G8F A;  1NK0 A;  4LH5 A;  1IKW A;  3QEI A;  3NF8 A;  2GBZ A;  1CXQ A;  4B08 A;  5I42 A;  1QSL A;  3RR8 A;  4E1N A;  4DSE A;  2OZS A;  2DFF A;  3EY1 A;  3ZSV A;  3OYI A;  3EYZ A;  4M3Y A;  2QKB A;  1SKS A;  2JGU A;  5CYM A;  4B9T A;  2F8T A;  3DM2 A;  3ZSW A;  1J53 A;  2QXF A;  4ID5 A;  5C24 A;  1QSY A;  1TK0 A;  4E7L A;  4CF2 A;  4M3U A;  3SUO A;  4PQU A;  1VSD A;  3AVK A;  4J2B A;  4OLB A;  4PWD A;  3OS0 A;  1IKY A;  1RTJ A;  3OYA A;  2XHB A;  3RR7 A;  4QCL A;  3KK1 A;  1C1A A;  3LWL A;  1HMV A;  4AHV A;  1KVA A;  4FZZ A;  4PY5 A;  4UQG A;  1TGO A;  4F8R A;  3RTV A;  1S6P A;  4ZTF A;  2E6M A;  3NHG A;  3P83 D;  3ZT1 A;  5HRP A;  4CHY A;  3KLH A;  1W9H A;  3VQE A;  1L3S A;  4MQ3 A;  1TKX A;  2YHA A;  3CM6 A;  1D8Y A;  3C6U A;  3L2R A;  4KHQ A;  4HTU A;  2Z1J A;  2KTQ A;  2P1J A;  1DTQ A;  4DTS A;  1T05 A;  5JS2 A;  3SCX A;  3BDP A;  1I3A A;  3IG1 A;  4C8N A;  1EP4 A;  3K58 A;  4CCH A;  2YKM A;  4RW9 A;  1CZ9 A;  3M8Q A;  2HHX A;  1JLC A;  3PX0 A;  4CEC A;  1VSK A;  2X74 A;  3CFO A;  3ZCM A;  2X78 A;  3L2V A;  4KTQ A;  4KPY A;  1TL3 A;  1J9A A;  3B6P A;  2A1S A;  4FK4 A;  1D5A A;  1EX4 A;  1U4B A;  2BGG A;  1WSJ A;  4L8R B;  1EET A;  2O4G A;  3HST B;  4CJS A;  1DTT A;  4B8A B;  3AVC A;  2P51 A;  5JS1 A;  2B4J A;  3T1A A;  1BQN A;  3K5M A;  3NGZ A;  1VSI A;  4IFY A;  3OYD A;  3HK2 A;  2IDO A;  2VG5 A;  3F9K A;  4FJ8 A;  3AA4 A;  1C6V A;  4DTU A;  1X9W A;  5HBM A;  1T7P A;  4FJH A;  4RW4 A;  4BE1 A;  4CF9 A;  1WAF A;  4Q5V A;  3SNN A;  3OVN A;  3AA2 A;  4DQR A;  2XY8 A;  5T7B A;  2EHG A;  3HO1 A;  2VG6 A;  1C0M A;  3P5J A;  3QO9 A;  1JL1 A;  3AO2 A;  3TAM A;  4DS5 A;  4M3W A;  4B9M A;  2WOM A;  3QES A;  2OZM A;  4KB0 A;  1RT2 A;  2OYQ A;  1NJW A;  4LSL A;  3HXM A;  5HP1 A;  3LZJ A;  2IAJ A;  4FJG A;  2AJQ A;  4E1M A;  5FRN A;  1HYS A;  1BQM A;  3OYH A;  3THV A;  4FK0 A;  4JRP A;  4DQQ A;  4CHP A;  1YTU A;  5HRN A;  1S5J A;  2KW4 A;  4EZ9 A;  3I0R A;  3WNE A;  4N76 A;  3VQ4 A;  2YNG A;  1ITG A;  5KGX A;  3MEC A;  2XY7 A;  1NK8 A;  3VQ8 A;  4CJ5 A;  3SYZ A;  1RBT A;  1NK4 A;  3D45 A;  1ASV A;  1HYZ A;  1NKB A;  1N6Q A;  3S9H A;  3AA5 X;  4FK2 A;  4O0I A;  3V9Z A;  4CEB A;  1TKT A;  3K59 A;  3AO1 A;  3PUF A;  1WSF A;  3VQD A;  1S1U A;  1X9M A;  3DLG A;  1C1C A;  3LP2 A;  1LW2 A;  4IG3 A;  4CJR A;  3LDS A;  3AVG A;  4O0J A;  4DSJ A;  3SI6 A;  2G8K A;  4BE2 A;  2VG7 A;  1HQE A;  3OYE A;  3QEW A;  5EU7 A;  3QIP A;  4CFC A;  4KHU A;  3B6O A;  1VSL A;  2RF2 A;  2OPS A;  1BHL A;  1SL1 A;  1TK8 A;  1REV A;  3HPG A;  2YNI A;  3DLR A;  1ASW A;  3V1Q A;  5E41 A;  3TAN A;  2IS3 A;  1JLE A;  1RBS A;  2HND A;  3LAM A;  2NUB A;  4FM2 A;  3C6T A;  3QNN A;  1NKC A;  1XC9 A;  4J2A A;  1RDD A;  2RPI A;  3ZSX A;  4B9L A;  3E01 A;  3LP3 A;  3CFR A;  3ZSZ A;  1IH7 A;  4OJR A;  5CZ2 A;  4HHT A;  1QQC A;  4W5O A;  1XHZ A;  3C94 A;  1SL2 A;  4DQP A;  1B92 A;  1B9F A;  3FFI A;  3T19 A;  3DOL A;  4CER A;  4CJ3 A;  5D3G A;  4KB1 A;  2IC3 A;  1JXE A;  2XRI A;  4OPK A;  4BDY A;  4DF4 A;  2HB5 A;  1L3T A;  1IKX A;  2PZS A;  5KRT A;  1U04 A;  5KGW A;  2KZZ A;  4NCB A;  4FLX A;  2LSN A;  4R5P A;  4DG1 A;  4B8C A;  5SZT A;  3V6D A;  3RWU A;  2BE2 A;  3RMD A;  3I0S A;  4CK2 A;  1EKE A;  3VQQ A;  2G8H A;  1LAV A;  4HUG A;  3PX6 A;  4M3R A;  3V81 A;  4OKJ A;  4ICL A;  1L3U A;  3NDK A;  1RT3 A;  1JLQ A;  4DTP A;  4DU3 A;  1K6Y A;  1L3V A;  2Z1G A;  4RG8 A;  4CEQ A;  4EP5 A;  3V9S A;  4DSF A;  4KKO A;  1LWF A;  1JXB A;  2HHT A;  1RIL A;  4CE9 A;  4W5R A;  1LV5 A;  4CHZ A;  1VRU A;  2R7Y A;  4CJT A;  3KKR A;  2RN2 A;  3O3G A;  1NJY A;  1T8E A;  4E7K A;  1Z26 A;  2HHS A;  3OYF A;  4FLV A;  1RDB A;  2HNY A;  3QLH A;  4CHO A;  1JKH A;  2DFH A;  4LY7 A;  1RBU A;  4E89 A;  3S3O A;  3DLB A;  2D0A A;  2ZD1 A;  4DFK A;  2WON A;  4B9S A;  1HNI A;  2X6N A;  1VSJ A;  1Y97 A;  3A2F A;  4AHR A;  2HW3 A;  4HVJ A;  2KQ2 A;  3WNH A;  4CGF A;  3KLF A;  3KD5 E;  4IDK A;  3KKS A;  3SUQ A;  3SUN A;  2HHU A;  3ZSO A;  3BGR A;  1NK5 A;  3LAN A;  4W5Q A;  2D5R A;  3LPT A;  3S3M A;  1S6Q A;  5C42 A;  4DFJ A;  1QHT A;  5CY4 A;  1MU2 A;  4FJN A;  1N5Y A;  4DU4 A;  3QEP A;  3HVR A;  1IG9 A;  4BWM A;  4N5S A;  1BIS A;  1GOC A;  1RT4 A;  1XI1 A;  1SKW A;  4O55 A;  3OYL A;  3NBP A;  3V1O A;  3VQB A;  4JS4 A;  4B9V A;  2GV9 A;  2OA8 A;  3OYG A;  3AA3 A;  1ZBI A;  4Y1D A;  1C0U A;  3VQP A;  4CIE A;  4PUO A;  1Z25 A;  2ZQB A;  1J54 A;  3L3V A;  2G8I A;  4ELT A;  1TVR A;  4N47 A;  5J2P A;  3M8S A;  3DRS A;  1S1X A;  4CFB A;  4I2Q A;  4M41 A;  1UA0 A;  4JRQ A;  3SQ0 A;  3DLH A;  4ELU A;  2I5J A;  1B9D A;  2YKN A;  4F3O A;  1VRT A;  3AO5 A;  1JLA A;  3MXJ A;  3ZT2 A;  3RMC A;  4I9Q A;  4KTZ A;  2O4I A;  3NE6 A;  4B9U A;  3KTQ A;  1VSF A;  1WAJ A;  4W5N A;  2ZE2 A;  3AVJ A;  5KI6 A;  2VWK A;  3K5N A;  3L3U A;  5HRO A;  3TAB A;  4KO0 A;  1TK5 A;  1NKE A;  3AVM A;  1L5U A;  4OGC A;  4CFD A;  3PO4 A;  3M8P A;  1YVU A;  1ZBH A;  1TAQ A;  3ZT3 A;  1HNV A;  1HYV A;  3KK2 A;  1I39 A;  4DF8 A;  1QSS A;  3OS2 A;  4KRE A;  2HHV A;  2KFN A;  1BIZ A;  4OPJ A;  3DLK A;  4J2E A;  1FK9 A;  2XY6 A;  4DMN A;  1KFS A;  3V1R A;  2Y1I A;  1WNS A;  4BDZ A;  2HHQ A;  4LSN A;  4C8K A;  1C0T A;  1WSE A;  3NFA A;  5CYQ A;  1KVC A;  2DFE A;  4DQS A;  1NOZ A;  3QER A;  2YNH A;  3K5O A;  1HPZ A;  4CHN A;  4CJ4 A;  4KFB A;  2KZM A;  1BGX T;  1QTM A;  4FJ9 A;  1RT1 A;  1VK0 A;  3C95 A;  3AO4 A;  4FJK A;  1UAX A;  3O3F A;  4KHY A;  4GMJ B;  4CGI A;  4RW7 A;  1JLF A;  5FRM A;  3TAF A;  1TAU A;  1Q9Y A;  3LAK A;  4FLT A;  1U48 A;  4CF1 A;  3OYK A;  1A5V A;  1KVB A;  4YFU A;  4C8L A;  3U6F A;  3NF6 A;  3DRP A;  1BI4 B;  3LP1 A;  4EP4 A;  3HPO A;  1SL0 A;  3NF7 A;  4NYF A;  4CFA A;  2F96 A;  2D0B A;  1HRH A;  2F8S A;  4BE0 A;  1KTQ A;  4CF8 A;  2HVH A;  4E7J A;  1SUQ A;  4E7H A;  1QS4 A;  1XWL A;  3AV9 A;  3AVA A;  5K14 A;  5HRS A;  3HP6 A;  4CJK A;  2P5O A;  3SZ2 A;  4EZ6 A;  3JYT A;  2Z1I A;  3OYC A;  3H08 A;  4KHS A;  4ELV A;  5CZ1 A;  3DLE A;  4FJL A;  4AHT A;  4G1Q A;  1WLJ A;  3HP9 A;  4CJV A;  3OYM A;  4RW8 A;  4OVL A;  3OS1 A;  2IGI A;  4ZTJ A;  1NJX A;  3OJU A;  1U47 A;  4FXD A;  3CYM A;  1VSE A;  5J1E A;  4OGE A;  3OYJ A;  2KFZ A;  2YV0 X;  3NAE A;  4FLU A;  1EXQ A;  4IKF A;  4GW6 A;  1IO2 A;  2G8V A;  4N41 A;  4CIG A;  4CK3 A;  4HUE A;  2EX3 A;  2OPR A;  4CJP A;  3KLE A;  1YTA A;  2OPP A;  4BWJ A;  2HMI A;  4FJ5 A;  1C1B A;  4I7F A;  3S3N A;  3P1G A;  4H4M A;  4FJM A;  3VQ9 A;  4OLA A;  1FKP A;  2YHB A;  4M45 A;  4KRF A;  3SJJ A;  3NCI A;  4DU1 A;  5HLF A;  3ZT0 A;  3VQ7 A;  3QEV A;  1X1P A;  4W5T A;  4FJX A;  4M3X A;  3VQC A;  3TR8 A;  1A5X A;  2QKK A;  3HVT A;  3ZSR A;  1KRP A;  4ID1 A;  4HCB A;  4BDP A;  3ISN C;  2FBT A;  3M8R A;  4Z0U A;  3DYA A;  3AVB A;  3V4I A;  4DWI A;  4CGD A;  4K8Z A;  3KIO A;  4DFM A;  3SPY A;  4KHW A;  4NCG A;  2FC0 A;  1TKD A;  1S9E A;  4DTO A;  4J2D A;  2B6A A;  4N56 A;  4TSX A;  1BCO A;  4WE1 A;  4CEA A;  1WSH A;  3KD1 E;  3HJF A;  3MXM A;  4Z4H A;  1RTI A;  4DLE A;  3SV4 A;  3ITH A;  3AVL A;  4C8M A;  4AHS A;  3SQ2 A;  4HUF A;  4FVM A;  5FRO A;  2Z1H A;  3L2Q A;  4DSK A;  2FBX A;  3MAQ A;  3V9X A;  4CJF A;  4CGH A;  3SPZ A;  4FJ7 A;  4FLZ A;  4KI4 A;  4O44 A;  1CZB A;  3ULD A;  4FJJ A;  5I3U A;  3G0Z A;  3EZ5 A;  1QE1 A;  3CQ8 A;  5DMR A;  4FM0 A;  1LWC A;  4DTJ A;  1ZYQ A;  3HM9 A;  4FM1 A;  3TAR A;  3ZSQ A;  1KLM A;  2Q3S A;  1O1W A;  2PYL A;  1JL2 A;  1UA1 A;  3PO5 A;  4DSI A;  1S1W A;  1T03 A;  1UWB A;  3AVF A;  4C8O A;  4CIF A;  3G10 A;  1TV6 A;  2VWJ A;  3MXI A;  1S1T A;  1G15 A;  3AVN A;  3MED A;  4Y1C A;  2XY5 A;  4RW6 A;  3TAE A;  3TAP A;  3NH2 A;  5J2M A;  4QAG A;  3QEX A;  1TKZ A;  1BCM A;  1IKV A;  3IS9 A;  2DY4 A;  3HYF A;  3NGY A;  3VQ6 A;  1NK9 A;  4FW2 A;  4M3T A;  2HHW A;  3O4Q A;  2E4L A;  4CJQ A;  4CJE A;  3SQ1 A;  2JLE A;  1HJR A;  1ZBL A;  1JLB A;  4Z4C A;  1XHX A;  2QK9 A;  1LAW A;  3QIO A;  4OKE A;  4XIU A;  4KAZ A;  4FJI A;  4Z4E A;  3NH1 A;  4LD0 A;  1BL3 A;  3O3H A;  3TI0 A; 
#chains in the Genus database with same CATH topology
 4CEE A;  4HCC A;  4K8X A;  4PWD A;  3KK3 A;  4WFB L;  4DR2 K;  4KV8 A;  1R0A A;  1HKB A;  1IV0 A;  5LMU K;  2BH1 A;  4CZK A;  1SAZ A;  3WNG A;  4DUY K;  3PSF A;  2VCP A;  1OH6 A;  1SV5 A;  3T3F A;  4B1Y B;  4DCH A;  3LZI A;  4B9Q A;  4H0O A;  3PY8 A;  1RDA A;  1NOY A;  3O9U A;  5KRS A;  1RTD A;  1BUP A;  5BRF A;  1G99 A;  3LPU A;  3FZM A;  2X6S A;  4FWR A;  4DS4 A;  3TSU A;  1TL1 A;  2FF6 A;  2PAV A;  3MWP A;  1Q18 A;  3HT3 A;  1HJO A;  2O8D B;  4KH5 A;  2QWO A;  4BRO A;  1YJ9 N;  1A5W A;  4PL8 A;  1S1V A;  3TAQ A;  2P5G A;  1VQP N;  2OPQ A;  1ZBF A;  1NU0 A;  3ZX2 A;  3WQT A;  3VEZ A;  3WT0 A;  3TSP A;  4AM6 A;  3IRX A;  5J2N A;  1BU6 O;  5GIP A;  1K8A O;  4JKD A;  1JLG A;  4BR5 A;  3RMB A;  1ILY A;  4LH4 A;  1NG9 A;  3K5L A;  4HWI A;  5EVZ A;  4BR9 A;  1RT7 A;  3LP0 A;  3PLA A;  5IWA K;  1GLF O;  3SUP A;  5FDL A;  4BRA A;  3LM9 A;  5GIN A;  2ITG A;  5C0Y A;  4CED A;  1RBR A;  2RKI A;  5BRH A;  2G8U A;  1RDC A;  3THY B;  4CGJ A;  3C65 A;  2DTU A;  5KTQ A;  1WSI A;  4Z4I A;  1RBV A;  4E7I A;  4CES A;  3MDQ A;  2ZJQ L;  4B1W B;  4CGG A;  3E9L A;  2IVP A;  2ASM A;  4IZ9 A;  4X65 K;  2YHW A;  2OZS A;  3EY1 A;  3ZSV A;  2QKB A;  5CYM A;  5C24 A;  4E7L A;  3SUO A;  4PQU A;  4M63 C;  3UB5 A;  5AQS A;  1KD1 O;  4AHV A;  1TGO A;  1S72 N;  3P83 D;  4CHY A;  3VQE A;  3ZYY X;  4MDA A;  5KPT A;  3CM6 A;  4KHQ A;  3C6U A;  4HTU A;  3O1B A;  2KTQ A;  4BQZ A;  1DTQ A;  3QDK A;  5JS2 A;  5AQR A;  1EP4 A;  3WXL A;  2ZJP L;  4RW9 A;  5BN9 A;  1CZ9 A;  3CC7 N;  3CPE A;  2V7Z A;  2JWK A;  1TUY A;  1WB9 A;  3CFO A;  1QZ5 A;  1HR0 K;  5AR0 A;  4KTQ A;  3M3Z A;  1TL3 A;  1FW6 A;  2ZM6 K;  3B6P A;  1EX4 A;  1WSJ A;  3HST B;  4B8A B;  2E20 A;  3H45 C;  3T1Y K;  3ATV A;  3K5M A;  4OO1 J;  4K41 A;  3NGZ A;  5I9E B;  1D4X A;  4BGA A;  1HNX K;  4OPA A;  1C6V A;  3R8E A;  4DTU A;  1X9W A;  5HBM A;  3AAP A;  5TKW A;  4Q5V A;  3SNN A;  2QWR A;  3OVN A;  4CZL A;  4DS5 A;  2HOE A;  1KQS M;  4LFB K;  2YJF A;  4PKG A;  3VMF B;  3QES A;  2OZM A;  4KB0 A;  1OVY A;  1RT2 A;  4LSL A;  3ZX0 A;  2IAJ A;  2AJQ A;  2FSK A;  4DR4 K;  1YTU A;  3MN9 A;  1X3M A;  5KGX A;  3MEC A;  3VQ8 A;  5JIC A;  1N6Q A;  3S9H A;  4FK2 A;  4O0I A;  4CEB A;  2A6A A;  4U67 L;  4JYA K;  3K59 A;  4FWO A;  2RHK A;  3GG4 A;  3LP2 A;  4BRF A;  4CJR A;  1XMO K;  1BO5 O;  4O0J A;  3SI6 A;  2V52 B;  1OKJ A;  5FPE A;  3OYE A;  1HQE A;  1K9M O;  1VSL A;  3HPG A;  1ASW A;  3V1Q A;  2P9U A;  5AQU A;  1JLE A;  1RBS A;  3LAM A;  2NUB A;  4FM2 A;  2FSN A;  5FLX O;  1XC9 A;  3ZSX A;  4B9L A;  4JAX A;  2E5L K;  2O8E B;  4DQP A;  4BRN A;  3DOL A;  4CJ3 A;  2IC3 A;  1JXE A;  3F2K A;  4KB1 A;  2OAN A;  1U04 A;  3M5R A;  3CET A;  4NCB A;  4R5P A;  3CIP A;  1EKE A;  4JEP A;  1LAV A;  4IO9 L;  3V81 A;  4OKJ A;  1K6Y A;  3AAQ A;  2Z1G A;  4CEQ A;  4JHD B;  4KKO A;  1JCE A;  1RIL A;  4NXM K;  1NJY A;  3SMP A;  5M1N A;  3OYF A;  1ESV A;  2HNY A;  3QLH A;  3DXK B;  3S3O A;  4DFK A;  1BWF O;  1HNI A;  3GE1 A;  2HW3 A;  2Q0U A;  5BR8 K;  3WNH A;  1NJI O;  3KKS A;  3BGR A;  3CHW A;  3PIP L;  1N8R O;  3HZ6 A;  4DFJ A;  1EWR A;  4N5S A;  1RT4 A;  4O55 A;  3NBP A;  3HOT A;  1CZA N;  4FPB A;  3OYG A;  4Y1D A;  2CGJ A;  3VQP A;  1Z25 A;  5AQP A;  3G6E N;  2G8I A;  4YDU A;  2NNW A;  1NWK A;  3CMA N;  4I2Q A;  5FPD A;  4M41 A;  4BRC A;  4F3O A;  2YKN A;  3O5B A;  1JLA A;  2O4I A;  3KWI A;  1WAJ A;  4B1U B;  3AVJ A;  1TK5 A;  5KI6 A;  3TAB A;  5JVG L;  3WXK A;  3M8P A;  1S3X A;  3ZT3 A;  2NLX A;  3DLK A;  5TKY A;  4DMN A;  3FFK B;  4YOW A;  5CR4 A;  1QQN A;  4XH1 A;  2HHQ A;  2NRZ A;  4C8K A;  5CYQ A;  4DQS A;  5EX5 A;  4FJ9 A;  1RT1 A;  2DPN A;  2OCE A;  4CGI A;  4RW7 A;  1JLF A;  5FRM A;  3E1Y A;  4CF1 A;  2YI1 A;  3OYK A;  3HTV A;  4YFU A;  2NRX A;  4NYF A;  4CFA A;  2VYP A;  2F96 A;  4YOT A;  3C6A A;  4E7J A;  1SUQ A;  4BQL A;  3O1W A;  3AVA A;  5HRS A;  3HP6 A;  2P5O A;  3EKU A;  2ZF5 O;  3H08 A;  5CE3 A;  2P9P A;  4AHT A;  1WLJ A;  3HP9 A;  4RW8 A;  2IGI A;  1U47 A;  1N33 K;  5EXW A;  1I94 K;  4OGE A;  3NAE A;  3FR0 A;  4K0K K;  3JS6 A;  4GW6 A;  5EY4 A;  4CIG A;  2EX3 A;  3KLE A;  3TTD A;  5AQJ A;  3Q7C A;  1FKP A;  4M45 A;  4IWV A;  3ZT0 A;  3ULE B;  1X1P A;  4ILG B;  3VQC A;  1A5X A;  2QKK A;  4ID1 A;  3ISN C;  3M8R A;  3V4I A;  2VQE K;  2P9K A;  4CGD A;  4K8Z A;  3TSQ A;  3KIO A;  3J7A P;  1TKD A;  4JKB A;  5AQL A;  1S9E A;  1KC8 O;  4FWQ A;  4DLE A;  3ITH A;  2D4W A;  4FVM A;  3L2Q A;  4DSK A;  2FBX A;  4GVE A;  3MAQ A;  4CJF A;  4YOR A;  4MLH A;  1CZB A;  1E4F T;  4FJJ A;  1LWC A;  2IVO A;  4K43 A;  3ZSQ A;  4WFN L;  3DLL L;  2Q3S A;  4DQ8 A;  1O1W A;  2PYL A;  2UXC K;  3AVF A;  4CIF A;  4DB3 A;  1DKG D;  3AVN A;  3I8B A;  3TAE A;  1OH8 A;  4JK7 A;  3U9Z A;  3CCQ N;  4CBW A;  4FW2 A;  4M3T A;  4CJE A;  3SQ1 A;  4IOC L;  1XHX A;  2QM1 A;  4IJA A;  3NH1 A;  2JWL A;  4I6M A;  3C7N B;  2ITM A;  4F4K A;  1UA0 A;  2G8H A;  3CM5 A;  1GLA G;  3DOK A;  3VQ5 A;  3RRH A;  1KSP A;  4PA1 A;  2P9S A;  2QWL A;  3NMU A;  1F21 A;  3OYN A;  2UUA K;  3A5O C;  1Q9X A;  3LDP A;  4IOX A;  3NVM A;  1HNW K;  4YNQ A;  3AVI A;  3VN5 A;  1LWE A;  3D2F A;  1RNH A;  1VSM A;  1E4G T;  4H0P A;  3AVH A;  1GOB A;  2D1K A;  4WYB A;  3HPH A;  2BAN A;  3EKS A;  5HOO A;  3DI6 A;  4BR4 A;  1U45 A;  4M42 A;  4H8K A;  4DLG A;  4B3R K;  4CW7 B;  3V9U A;  4FOE A;  1W7A A;  4JHD A;  3VTH A;  4JI2 K;  2GUI A;  3GL1 A;  4DR1 K;  4GVM A;  4XEI A;  4FZX C;  3O4N A;  1UOC A;  3CXC M;  4A57 A;  3QNO A;  2PY5 A;  5BR9 A;  2W6K A;  3L2W A;  4IEI A;  3BEX A;  1KAX A;  4KHN A;  2F9W A;  1GLL O;  3JSM A;  4DTR A;  1RTH A;  1FXX A;  3ENO A;  1RGI A;  3FZL A;  4IBN A;  4F2R A;  3FZH A;  4JD2 B;  3SV3 A;  2HVI A;  3MCA B;  1VQ9 N;  3R9P A;  5F2R A;  3DMJ A;  4F2S A;  2HNZ A;  4E19 A;  4AIL C;  4E0D A;  4GKK K;  3KLG A;  4CZE A;  1FKO A;  4QOZ B;  1SKR A;  2UXD K;  3CER A;  2O8C B;  1YHQ N;  3NVK A;  4I9L A;  3ZSY A;  4B1X B;  1P90 A;  1TUU A;  4CBU A;  2BDP A;  2ATQ A;  3HBT A;  2IOC A;  4CK1 A;  4DQI A;  5LJV A;  1ZXO A;  2CH6 A;  2NRH A;  3ENB A;  3BZK A;  3SBG A;  2H3G X;  4O4G A;  1T6C A;  3ZX3 A;  3QEI A;  3NF8 A;  5I42 A;  4B08 A;  1QSL A;  4FWN A;  4DV7 K;  3ENH A;  4M3Y A;  1QSY A;  1J53 A;  4ID5 A;  4JK8 A;  5M1P A;  1TK0 A;  1N36 K;  3U4L A;  4J2B A;  2QI2 A;  1IBK K;  2UYT A;  3RR7 A;  1C1A A;  5AQF A;  1HMV A;  1Q7Y O;  4MO4 A;  4UQG A;  3SBT A;  3RTV A;  3A0I X;  2E6M A;  3DWL A;  3NHG A;  2HHH K;  5HRP A;  1W9H A;  5LMN K;  3L2R A;  3BZC A;  2P1J A;  4ISE A;  4DTS A;  1T05 A;  1QVF M;  4C8N A;  5KQD A;  1YXQ A;  4B1Z A;  4X62 K;  5AQN A;  4CD1 A;  3PX0 A;  3CCL N;  2X78 A;  3L2V A;  4A61 A;  4B1V A;  4C1N I;  3IUC A;  2A1S A;  4WQ4 C;  3WXJ A;  1KXP A;  3EZW A;  4ISG A;  3ZEU B;  2B4J A;  1BQN A;  3HK2 A;  1VSI A;  4IFY A;  3EE8 A;  3F9K A;  4A59 A;  4F9O A;  2A41 A;  3AA4 A;  5CHI A;  1T7P A;  4BE1 A;  3D2E A;  1J5E K;  4BRG A;  4DQR A;  5ADX A;  5T7B A;  1C0M A;  3P5J A;  1JL1 A;  4DR6 K;  3VES A;  4DUZ K;  2Q0R A;  4YOU A;  1NJW A;  3HXM A;  3LZJ A;  1SS6 A;  3THV A;  4JRP A;  3THW A;  3VQ4 A;  2YNG A;  2XY7 A;  2CGL A;  2E2O A;  3SYZ A;  3D45 A;  1TKT A;  3VF2 A;  3AO1 A;  1WSF A;  3VQD A;  5AQH A;  4BR2 A;  3DLG A;  1C1C A;  4IG3 A;  3AVG A;  2G8K A;  5EU7 A;  3A8Y A;  1TK8 A;  1BHL A;  5HL7 L;  1SL1 A;  3TAN A;  2IS3 A;  1SZ2 A;  2HND A;  3QNN A;  3E01 A;  3L0Q A;  3CFR A;  2I7N A;  1Z6R A;  4EIA A;  1QQC A;  4W5O A;  3MCP A;  1XHZ A;  1DT9 A;  3H1V X;  4G9Z A;  1B92 A;  3ID6 A;  3R6M A;  2QW9 A;  3KWG A;  4BDY A;  2HB5 A;  1NGA A;  3KVG A;  4JI5 K;  3HSC A;  4B8C A;  5SZT A;  3V6D A;  5LL6 Z;  3VQQ A;  4HUG A;  5C12 A;  4M3R A;  1L3U A;  1JLQ A;  4JV5 K;  4JKG A;  3W0L A;  4FO0 A;  4CJT A;  3O3G A;  4PKH A;  4E7K A;  4JKA A;  1Z26 A;  1XMQ K;  2HHS A;  4L3Q A;  1Z05 A;  3LDN A;  1YJW N;  5E84 A;  4AF1 A;  4CHO A;  1RBU A;  3BUZ B;  3QBW A;  4B9S A;  2WON A;  3O80 A;  3RVC A;  4BRL A;  1Y97 A;  3IFR A;  5KPR A;  3KD5 E;  4CGF A;  4GKJ K;  3KLF A;  2HHU A;  3SUN A;  2J4R A;  3ZSO A;  3LAN A;  4W5Q A;  1X3N A;  1S6Q A;  4AQY K;  5CY4 A;  1IG9 A;  1VQ7 N;  3E9O A;  1BIS A;  1GOC A;  3VGM A;  4K42 A;  3CJ7 A;  3V1O A;  3VQB A;  4JS4 A;  3CC2 N;  4B9V A;  3LDQ A;  4DV4 K;  1XQS C;  5AZJ B;  1ZBI A;  4CIE A;  4MDB A;  2ZQB A;  3L3V A;  4JI0 K;  1K8K B;  1U6Z A;  1TVR A;  4N47 A;  3VEY A;  5J2P A;  2Q97 A;  1S1X A;  4JRQ A;  3SQ0 A;  4ELU A;  1B9D A;  3AGR A;  3MXJ A;  3ZT2 A;  3F5T A;  3NE6 A;  4YDU C;  2WTU A;  5HRO A;  3P38 A;  4FK0 A;  3PO4 A;  5LY3 A;  1ZBH A;  3KK2 A;  1I39 A;  4H5R A;  1BIZ A;  4OPJ A;  3MN6 A;  1KFS A;  5EOY A;  3V1R A;  4BDZ A;  4BVP A;  3MN7 A;  1KVC A;  3VGL A;  1NOZ A;  2YNH A;  4CJ4 A;  4KFB A;  2KZM A;  1VK0 A;  4GMJ B;  3TAF A;  3M1F A;  4M7X A;  3HRG A;  1H1V A;  3J7Z O;  4FLT A;  1U48 A;  1KVB A;  4C8L A;  3KK7 A;  1BI4 B;  3LP1 A;  3HPO A;  1SL0 A;  3NF7 A;  4JKH A;  1HRH A;  2HVH A;  2AA4 A;  3AV9 A;  4FOI A;  5FPN A;  5K14 A;  2P9P B;  4EZ6 A;  3JYT A;  3OYC A;  2BTF A;  4X64 K;  2F9T A;  3DLE A;  4A5A A;  4LF8 K;  3E9P A;  3OS1 A;  2O8C A;  4H5N A;  5J1E A;  2YV0 X;  3QFU A;  3I56 N;  1IO2 A;  2G8V A;  2VGN A;  1JCF A;  4FJ5 A;  1YTA A;  4J2D A;  4DHY A;  1C1B A;  3P1G A;  4H4M A;  2YHB A;  3MMV A;  3SJJ A;  1GLJ O;  3QEV A;  4FJX A;  4K25 A;  1OVQ A;  4ISF A;  1LOT B;  3ZSR A;  4BDP A;  1NGG A;  3DYA A;  3AVB A;  1IBL K;  3G4S N;  3UKR A;  3BP8 A;  4V19 S;  1WUA A;  3U8X A;  2KKZ A;  4EHT A;  2B6A A;  2UUB K;  2YJE A;  1BCO A;  1VQL N;  3KD1 E;  3HJF A;  3G25 A;  4AHS A;  3AVL A;  4HUF A;  3ATU A;  3F9M A;  3C6H A;  4CGH A;  3SPZ A;  4FJ7 A;  5I3U A;  4BY9 C;  4BRK A;  3TAR A;  1QHA A;  3CPW M;  1NGD A;  3CF5 L;  1UA1 A;  1S1W A;  1T03 A;  4CZH A;  2I7P A;  4C8O A;  2IVN A;  5AFU H;  4BRM A;  2VWJ A;  3CI5 A;  4Y1C A;  1G15 A;  4RW6 A;  4MLE A;  3P39 A;  1BCM A;  1IKV A;  3IS9 A;  3P4I A;  3HYF A;  3VQ6 A;  4BRQ A;  1NK9 A;  3J80 O;  2HHW A;  4DV0 K;  5IT9 O;  2JLE A;  4EFH A;  1JLB A;  4XIU A;  4O8K A;  4KAZ A;  2YHX A;  3PSI A;  3CCV N;  4LD0 A;  2E88 A;  3K9K A;  1YIJ N;  4Z4F A;  4FLY A;  1ZBU A;  3OJS A;  1NBW A;  4CJW A;  5SWM A;  5AQT A;  1YF5 L;  4AHC A;  4MFB A;  1J5O A;  3L4Q A;  1YT3 A;  2GX9 A;  3CFP A;  4LC9 B;  3AO3 A;  2P9I B;  5C10 A;  3U3G A;  5J2Q A;  1QQO A;  4YY3 K;  5AZJ A;  4CZJ A;  5C15 A;  2G8W A;  1WN7 A;  3VEX A;  3TAG A;  2PYJ A;  3H6E A;  4DTN A;  4FZY A;  3U3Y A;  1QZ6 A;  1NK6 A;  4CEZ A;  3ZT4 A;  4Q0B A;  3K2P A;  3ASM A;  1IG8 A;  5AQV A;  4E3S A;  3CCJ N;  4A2A A;  3DAW A;  3VOV A;  3TWH A;  2GTD A;  1Q8I A;  3H46 O;  3B8A X;  4FWL A;  3N4P A;  3DRR A;  3Q7B A;  3V9W A;  3WNF A;  1RT5 A;  2P9N B;  2WFB A;  1V4S A;  5BRE A;  1VQN N;  3UKU B;  4IJN A;  4DFP A;  3BY5 A;  3F73 A;  4B3O A;  4LF6 K;  2E6L A;  3OY9 A;  1XC3 A;  4NYN A;  4B3T K;  3NF9 A;  3L8B A;  3QIC A;  4A5B A;  4CJU A;  3CCE N;  1BI4 A;  1LW0 A;  4NLC A;  3LAL A;  4CJL A;  4NCA A;  4JKG B;  2FBY A;  2E1Z A;  2GWJ A;  1WSG A;  1Y64 A;  1HUX A;  3O08 A;  3CCM N;  4ILH A;  5M1K A;  4B3S K;  4CEO A;  2PFU A;  4CF0 A;  4JS5 A;  4FLW A;  3IAY A;  1W97 L;  3OW2 M;  1D9F A;  4AH9 A;  1VQM N;  1BIU A;  5C2F A;  3MEE A;  4O5B A;  3CD6 N;  3PV8 A;  1VQO N;  5HRR A;  4DR3 K;  2RE2 A;  1RCH A;  2ETJ A;  3MEG A;  3BF3 A;  1ASU A;  4DV6 K;  3VA3 A;  2G8F A;  3NGI A;  1EWQ A;  1BG3 A;  2FXU A;  4DKW A;  1CXQ A;  4LF5 K;  4E1N A;  4DSE A;  2DFF A;  5MLC Q;  3EYZ A;  3O6W A;  4FWK A;  2JGU A;  1SKS A;  3DM2 A;  3ZSW A;  4AM7 A;  4M3U A;  4JD2 A;  3MX2 A;  1VSD A;  3AVK A;  4OLB A;  2D0O A;  1NLV A;  3CJC A;  3OYA A;  4QCL A;  1ZC6 A;  4FZZ A;  2WC9 A;  4PY5 A;  1RFQ A;  4ZTF A;  3R3L A;  3KLH A;  3ZT1 A;  1L3S A;  2YHA A;  5F1X A;  4BC3 A;  1C0F A;  3PIO L;  3T1H K;  1I3A A;  3IG1 A;  5AQX A;  2O8B A;  3THW B;  3TTF A;  2YKM A;  4BC2 A;  3ZET B;  3T69 A;  1VSK A;  3O9Q A;  5KQ8 A;  3ZCM A;  4KPY A;  1N32 K;  1J9A A;  5M1Q A;  3M6G A;  4WF9 L;  2GEM A;  4FK4 A;  1D5A A;  1U4B A;  2BGG A;  2O4G A;  4CJS A;  4C23 A;  2PBD A;  5JS1 A;  3OBY A;  3T1A A;  3OYD A;  1BOT O;  2VG5 A;  4PL7 A;  4EHU A;  3THX B;  2QWQ A;  4FJ8 A;  1V4T A;  4FJH A;  4RW4 A;  5JVH L;  3LDO A;  3RSE B;  1SQK A;  1Q86 O;  3HO1 A;  3TAM A;  3AO2 A;  4WQ5 C;  3JAM O;  1C0G A;  3AAR A;  4B9M A;  4HTL A;  3KHY A;  4FJG A;  4E1M A;  5FRN A;  1HYS A;  1BQM A;  3OYH A;  4GNI A;  4DQQ A;  4CHP A;  5HRN A;  1S5J A;  4EZ9 A;  3I0R A;  4N76 A;  5AQO A;  3VF4 A;  1ITG A;  3ZET A;  1NK8 A;  4CJ5 A;  1NK4 A;  1ASV A;  1HYZ A;  4GV9 A;  4BRH A;  2GUP A;  3V9Z A;  4H0X B;  2ZGY A;  1VQK N;  2KLA A;  3PUF A;  3UE5 A;  1S1U A;  4IXC A;  1X9M A;  3EO3 A;  3LDS A;  1LW2 A;  1XUP O;  3MN5 A;  3QEW A;  5ADX H;  3G71 N;  2W6L A;  3LDL A;  3DLR A;  3THX A;  4PHT X;  2VGM A;  1KAZ A;  3LM2 A;  2E2Q A;  3IMX A;  4WFA L;  2RPI A;  3LP3 A;  5F0X A;  3ZSZ A;  1IH7 A;  4OJR A;  3I55 N;  3A5N C;  1SL2 A;  3C94 A;  3UKU A;  4CER A;  1B9F A;  3T19 A;  3VEW A;  5D3G A;  2XRI A;  2PZS A;  3R1X A;  1IKX A;  3L6Q A;  4YOV A;  1NGJ A;  4FLX A;  2LSN A;  5GAD P;  3J81 O;  5A2Q O;  2BE2 A;  4H03 B;  3RMD A;  1TYQ B;  3I0S A;  4CK2 A;  4C1N K;  4JKF A;  3I33 A;  3WEE B;  4ICL A;  4QS8 A;  4DU3 A;  3OHR A;  4CZM A;  5JMV A;  3J7Y P;  1L3V A;  4RG8 A;  4E1J A;  4EP5 A;  3EE9 A;  1JXB A;  3TU5 A;  4CE9 A;  4H0T B;  4CHZ A;  1VRU A;  2R7Y A;  1T8E A;  2RN2 A;  3VEV A;  1JJ2 M;  4FLV A;  1RDB A;  4YOY A;  3DLB A;  4LY7 A;  1JKH A;  2DFH A;  2UXB K;  1YUW A;  1HNZ K;  5M1F A;  2ZD1 A;  3VPZ A;  2Q36 A;  2X6N A;  3DXM B;  4I6M B;  1VSJ A;  3GBT A;  3A2F A;  1VHX A;  4HVJ A;  4DR5 K;  4IDK A;  3W3D A;  1YJN N;  2P9S B;  2D5R A;  3LPT A;  1HKG A;  1U2V A;  5C42 A;  4FJN A;  4DU4 A;  4A62 A;  3HVR A;  2P9N A;  4M7Y A;  4BWM A;  1SKW A;  4OPH A;  4LF7 K;  2GV9 A;  4LF9 K;  2FSJ A;  4BGB A;  2OA8 A;  4BRD A;  3AA3 A;  1OH7 A;  3D2F B;  4JN4 A;  4PUO A;  1J54 A;  3WEE A;  5BPN A;  4ELT A;  5B8H A;  3FLC O;  3DRS A;  4CFB A;  1YVN A;  3SLC A;  3DLH A;  2I5J A;  1VRT A;  3RMC A;  2HBK A;  4I9Q A;  4KTZ A;  3EN9 A;  4B9U A;  3O4W A;  1VSF A;  1W2B M;  2ZE2 A;  3UIQ A;  1NKE A;  1L5U A;  4OGC A;  4CFD A;  1YVU A;  5AFU A;  1TAQ A;  2HMP A;  2O8D A;  1HNV A;  1HYV A;  4DF8 A;  1QSS A;  3OS2 A;  2GWK A;  4NB4 A;  4J2E A;  1FK9 A;  2XY6 A;  1WOQ A;  1K73 O;  2HST A;  2Y1I A;  4LSN A;  2YCH A;  1WSE A;  2QTD A;  2ZWH A;  3K5O A;  2Q2R A;  1ATN A;  1QTM A;  4YHH K;  1XNQ K;  4O8U A;  4FJK A;  3O3F A;  3AGK A;  4OX9 K;  3SJH A;  3QBX A;  4XH4 A;  1Q9Y A;  3LAK A;  1A5V A;  3QML A;  3DRP A;  4QS7 A;  1ATS A;  4NLB A;  3O8M A;  2VQF K;  2D0B A;  3QB0 A;  2F8S A;  3MX5 A;  2NRT A;  1QS4 A;  1XWL A;  4CJK A;  3P31 A;  3SZ2 A;  2QWM A;  2Z1I A;  4R79 A;  2FLO A;  4ELV A;  3WQU A;  3TPQ A;  5CZ1 A;  4KHS A;  4G1Q A;  4CJV A;  3CJA A;  3OYM A;  1NJX A;  4BVO A;  4FXD A;  3OJU A;  3CYM A;  1EXQ A;  4IKF A;  5AZI A;  4N41 A;  4HUE A;  4CJP A;  3ZLJ A;  2OPP A;  4FJM A;  3S3N A;  1RDU A;  5BN8 A;  1S22 A;  2FF3 B;  1GLE G;  2V51 B;  4B3M K;  4DV3 K;  4M3X A;  3TR8 A;  4HCB A;  4JI8 K;  3E66 A;  4DV1 K;  4GV6 A;  3SPY A;  2FC0 A;  3C7N A;  4J8F A;  4DTO A;  4WE1 A;  2OTJ N;  1WSH A;  3MXM A;  4Z4H A;  3SV4 A;  3SQ2 A;  4CZG A;  2HBM A;  5FRO A;  3V9X A;  3OA9 A;  4KI4 A;  4FLZ A;  2HF4 A;  3G0Z A;  3CQ8 A;  1QE1 A;  4DTJ A;  2W41 A;  3HM9 A;  4FM1 A;  4FWS A;  3VTI A;  1IBM K;  3K0S A;  1KLM A;  5AZI B;  3PO5 A;  4DSI A;  2WUS A;  4JI6 K;  1BA1 A;  3MXI A;  1S1T A;  5GAG P;  3KZB A;  3MED A;  3TAP A;  3ID8 A;  3QEX A;  3CQY A;  3ULE A;  1DGK N;  3O4Q A;  2E4L A;  1E3M A;  2NZT A;  1ZBL A;  4Z4C A;  3QIO A;  4OKE A;  4Z4E A;  3BF1 A;  3TTC A;  5AQW A;  5C25 A;  3RMA A;  1GOA A;  4DTX A;  3QIN A;  2CH5 A;  1KCF A;  4DSL A;  3QET A;  1VQ8 N;  1M1K O;  2BUP A;  4H5W A;  2Y1J A;  4GY2 B;  1VSH A;  4LFC K;  3CJ1 A;  2XO7 A;  2A40 A;  1NGH A;  1T3V A;  2HBJ A;  3EEQ A;  2D0C A;  4CZF A;  3JXU A;  4FW1 A;  4KH6 A;  4H4O A;  1HQU A;  2A1R A;  1RT6 A;  3FZK A;  4FWM A;  5DK5 A;  4BC4 A;  4M3Z A;  2EWS A;  3CG7 A;  1W0H A;  5DM7 L;  4Z4G A;  1KLN A;  3A5M C;  1N34 K;  4IFV A;  4XH5 A;  5M1O A;  3VA0 A;  1NGC A;  3KLI A;  4FYD A;  3DJC A;  1DLO A;  4B9N A;  3DXK A;  1X9S A;  5GAH P;  5LJW A;  4X66 K;  2O8E A;  3DXM A;  3I8D A;  4IFE A;  1CLQ A;  3L2U A;  3MWT A;  5AQG A;  1KFD A;  4IG0 A;  4KTW A;  1NK7 A;  3IKM A;  3RRG A;  4JI7 K;  4FPA A;  4CHQ A;  3HL8 A;  3PX4 A;  1WBB A;  1TYQ A;  3D6R A;  5AQM A;  3KJV A;  1MWM A;  3SQ4 A;  3D7E O;  4F3T A;  1U49 A;  3S41 A;  4RCH A;  1GLB G;  1S9G A;  3LL3 A;  3D0P A;  4BAC A;  4FCY A;  4JLH A;  4WQ5 A;  4RTF D;  4DTM A;  4ZHR A;  2B5J A;  1EO1 A;  3HM8 A;  3CME N;  2W42 A;  1MA9 B;  1T6D A;  3CJB A;  3O9T A;  4Z94 A;  4CEF A;  2HF3 A;  1P8Z A;  1HLU A;  1NJZ A;  3OYB A;  1CXU A;  4BRP A;  4BRI A;  3NH0 A;  4ILJ A;  4KI6 A;  3LWM A;  4OKK A;  4AHU A;  3ALY A;  3VQA A;  2FBV A;  4I2P A;  4BR7 A;  1D9D A;  3O9R A;  2YNF A;  3K57 A;  1NK0 A;  4LH5 A;  1IKW A;  2HBL A;  2GBZ A;  4GV3 A;  4LF4 K;  5AQK A;  2ZJR L;  3RR8 A;  2W40 A;  5GAE P;  3OYI A;  4B9T A;  2F8T A;  2QXF A;  4IDH A;  4CF2 A;  3CCR N;  4JI3 K;  1YIT N;  4FL9 A;  3OS0 A;  4EAH D;  1IKY A;  1RTJ A;  2XHB A;  3KK1 A;  4H0Y B;  3LWL A;  1BA0 A;  1KVA A;  2A3Z A;  4F8R A;  1S6P A;  1NGF A;  2QWP A;  4CZI A;  1LCU A;  4MQ3 A;  1TKX A;  1D8Y A;  2Z1J A;  3FZF A;  2Q31 A;  4IEE A;  4YOX A;  3SCX A;  3BDP A;  3K58 A;  3VER A;  4CCH A;  5AQQ A;  2YX6 A;  3THY A;  3M8Q A;  2HHX A;  3H3N O;  1JLC A;  2QXL A;  3A5L C;  1HKC A;  4CEC A;  1KAY A;  2X74 A;  2UU9 K;  1QQM A;  4UY8 O;  2ZGZ A;  4KBO A;  4Y0W A;  4QS9 A;  4L8R B;  1EET A;  1DTT A;  5BPL A;  2QA4 N;  1Q81 O;  2QEX N;  3AVC A;  2P51 A;  2E1Y A;  1FJG K;  4FVU A;  2IDO A;  4JI1 K;  3EL2 A;  3SAF A;  5DM6 L;  4CF9 A;  1WAF A;  3SAG A;  3AA2 A;  2XY8 A;  1JCG A;  2EHG A;  4JKE A;  2VG6 A;  1IJJ A;  3QO9 A;  1YAG A;  2GEL A;  2OTL N;  4CBX A;  4M3W A;  1J6Z A;  2WOM A;  4KH4 A;  2OYQ A;  5HP1 A;  2YHY A;  1VAZ A;  5AQI A;  3QFP A;  3WXI A;  2KW4 A;  3WNE A;  3H1Q A;  3HI0 A;  4CJ7 A;  4U7B A;  1RBT A;  4FWP A;  1NKB A;  3AA5 X;  2A5X A;  1NMN A;  5JLF A;  4DSJ A;  2ASP A;  4BE2 A;  2VG7 A;  3ZEU A;  1VQ4 N;  3QIP A;  4CFC A;  4KHU A;  3B6O A;  3HOS A;  2E2P A;  2OPS A;  2RF2 A;  3CCS N;  1REV A;  2YNI A;  4CD3 A;  4NO7 A;  5E41 A;  3UKR B;  3VEO A;  3C6T A;  3WXM B;  1O13 A;  1NKC A;  4J2A A;  3OBW A;  1RDD A;  2A42 A;  5JLH A;  4BC5 A;  3N4Q A;  3IDH A;  5CZ2 A;  4HHT A;  2VWB A;  1NNE A;  3FGU A;  3FFI A;  4BG8 A;  2F4V K;  4OPK A;  4DF4 A;  1L3T A;  4H5T A;  2D0P A;  2AP1 A;  5KRT A;  5KGW A;  2KZZ A;  4DG1 A;  3RWU A;  2P9I A;  1NGB A;  3PX6 A;  4LFA K;  1K8K A;  4WQ4 A;  3NDK A;  1RT3 A;  4DTP A;  1WBD A;  4DSF A;  3V9S A;  2NRR A;  1LWF A;  5AJ3 K;  2HHT A;  5AQY A;  5GIO A;  2O8F B;  4W5R A;  1LV5 A;  1HPM A;  3KKR A;  3O9S A;  4WCE L;  5H1S Q;  3CC4 N;  5BPM A;  2WBN A;  3J8A A;  4E89 A;  3L4I A;  4IO8 A;  2D0A A;  1NMD A;  3WUH A;  1OH5 A;  2F7T A;  4AHR A;  4BRE A;  2KQ2 A;  3SUQ A;  2P9L B;  1NK5 A;  4H5V A;  3S3M A;  1QHT A;  1MU2 A;  1N5Y A;  3T7Z A;  3QEP A;  1XNR K;  5AQZ A;  1XI1 A;  3CCU N;  1U2V B;  3OYL A;  2NRW A;  3VET A;  1M90 O;  3SMS A;  1C0U A;  4JKC A;  5FPM A;  3M8S A;  3SK3 A;  3AO5 A;  1X9J A;  4DV2 K;  3KTQ A;  4W5N A;  2VWK A;  3K5N A;  3L3U A;  4CI6 A;  4KO0 A;  3AVM A;  4DR7 K;  2NRV A;  2KFN A;  2HHV A;  4KRE A;  4JI4 K;  1WNS A;  4FSV A;  2IIR A;  2P9L A;  1C0T A;  3NFA A;  3QER A;  2DFE A;  1ZBS A;  4BG9 A;  1HPZ A;  5E26 A;  4CHN A;  2KHO A;  1BGX T;  4DV5 K;  3C95 A;  3AO4 A;  1UAX A;  4KHY A;  1TAU A;  3VF6 A;  2E2N A;  1YI2 N;  3U6F A;  3NF6 A;  2P9K B;  4EP4 A;  3D2E B;  3MK6 A;  4BE0 A;  1KTQ A;  4KHP K;  4H0V B;  1RDW X;  4CF8 A;  4E7H A;  1DEJ A;  1NM1 A;  3VGK A;  2V7Y A;  2O8B B;  4FJL A;  1ATR A;  3GDQ A;  4IOA L;  4ZTJ A;  4OVL A;  1VQ5 N;  4A2B A;  1VSE A;  5ELZ A;  1NGE A;  3OYJ A;  2E8A A;  2KFZ A;  1MDU B;  3FE1 A;  4FLU A;  3VEN A;  3CQX A;  2ASO A;  4CK3 A;  2OPR A;  1T44 A;  1GLC G;  2HMI A;  4BWJ A;  4I7F A;  4MO5 A;  3VQ9 A;  4OLA A;  4KRF A;  3NCI A;  4DU1 A;  5HLF A;  5KPZ A;  3VQ7 A;  4W5T A;  1NGI A;  4BR0 A;  3HVT A;  1KRP A;  2FBT A;  3RSE A;  5C2D A;  3AY9 A;  4Z0U A;  4DWI A;  2P9U B;  4NXN K;  4DFM A;  4KHW A;  4NCG A;  2Q1N A;  3GOI A;  2UUC K;  1Q82 O;  4N56 A;  1MWK A;  4TSX A;  4CEA A;  2CGK A;  4RWT A;  1RTI A;  4C8M A;  4CVN E;  3K9J A;  2Z1H A;  4O44 A;  3ULD A;  3EZ5 A;  4FM0 A;  5DMR A;  1ZYQ A;  1VQ6 N;  4JNE A;  1HX1 A;  3OTO K;  1QVG M;  1JL2 A;  1R59 O;  5BRD A;  1UWB A;  3G10 A;  1TV6 A;  4PKI A;  2XY5 A;  1EQY A;  3NH2 A;  5J2M A;  4QAG A;  1TKZ A;  2O8F A;  2DY4 A;  3NGY A;  3U9D A;  3CJ9 A;  4CJQ A;  1GLD G;  1HJR A;  3H3O B;  2QWN A;  4JK9 A;  2QK9 A;  1LAW A;  4FJI A;  3C0B A;  1BL3 A;  3O3H A;  4O5F A;  3TI0 A;  3SAH A;  1BDG A; 
#chains in the Genus database with same CATH homology
 4Z4F A;  4CEE A;  4HCC A;  4FLY A;  4K8X A;  4F4K A;  5C25 A;  1ZBU A;  3CM5 A;  3DOK A;  3VQ5 A;  3OJS A;  4CJW A;  3KK3 A;  3RRH A;  5SWM A;  1GOA A;  4DTX A;  3RMA A;  4KV8 A;  4PA1 A;  1R0A A;  1KSP A;  4AHC A;  4MFB A;  1J5O A;  3QIN A;  1F21 A;  1KCF A;  4DSL A;  1YT3 A;  3QET A;  3OYN A;  3CFP A;  3AO3 A;  3WNG A;  2Y1J A;  1Q9X A;  5J2Q A;  3U3G A;  1SV5 A;  1VSH A;  4YNQ A;  3T3F A;  3AVI A;  3LZI A;  3VN5 A;  1LWE A;  1RNH A;  1VSM A;  2XO7 A;  3PY8 A;  1RDA A;  2G8W A;  1WN7 A;  2D0C A;  3AVH A;  3TAG A;  1GOB A;  2PYJ A;  4FW1 A;  1NOY A;  3HPH A;  2BAN A;  4H4O A;  5KRS A;  1HQU A;  4DTN A;  3DI6 A;  1RTD A;  2A1R A;  4FZY A;  1RT6 A;  5DK5 A;  3U3Y A;  1U45 A;  3LPU A;  3UIQ A;  4M3Z A;  2X6S A;  4M42 A;  1NK6 A;  4CEZ A;  4DS4 A;  4H8K A;  3CG7 A;  3ZT4 A;  1W0H A;  3K2P A;  4DLG A;  4Z4G A;  3V9U A;  1KLN A;  1TL1 A;  3ASM A;  4Q0B A;  4E3S A;  2GUI A;  4IFV A;  3TWH A;  3VA0 A;  1Q8I A;  3HT3 A;  4GVM A;  3KLI A;  4FZX C;  3O4N A;  1UOC A;  4FYD A;  1DLO A;  4B9N A;  3QNO A;  1A5W A;  3DRR A;  3V9W A;  2PY5 A;  1X9S A;  3WNF A;  1S1V A;  3TAQ A;  3L2W A;  1RT5 A;  2P5G A;  3I8D A;  4KHN A;  2OPQ A;  3L2U A;  1CLQ A;  1ZBF A;  3JSM A;  4DTR A;  4DFP A;  5J2N A;  1RTH A;  3IRX A;  1KFD A;  4IG0 A;  4KTW A;  3F73 A;  1FXX A;  2E6L A;  1NK7 A;  4B3O A;  3RRG A;  3OY9 A;  3PX4 A;  4IBN A;  3HL8 A;  4CHQ A;  4F2R A;  4NYN A;  1JLG A;  3RMB A;  3NF9 A;  4LH4 A;  3L8B A;  3KJV A;  3SV3 A;  2HVI A;  4CJU A;  3SQ4 A;  1BI4 A;  4F2S A;  3DMJ A;  1LW0 A;  4F3T A;  3LAL A;  1U49 A;  4CJL A;  4NCA A;  3K5L A;  2HNZ A;  2FBY A;  1S9G A;  3D0P A;  4E19 A;  1RT7 A;  4JLH A;  3LP0 A;  1WSG A;  4BAC A;  4FCY A;  4ZHR A;  4DTM A;  4AIL C;  2B5J A;  3SUP A;  4E0D A;  3KLG A;  4QOZ B;  1FKO A;  5FDL A;  1SKR A;  4CEO A;  2ITG A;  4CF0 A;  2W42 A;  4JS5 A;  4FLW A;  4CED A;  3IAY A;  1RBR A;  4I9L A;  2RKI A;  1D9F A;  3ZSY A;  4CEF A;  1NJZ A;  3OYB A;  1CXU A;  1RDC A;  2G8U A;  3NH0 A;  4AH9 A;  1BIU A;  3MEE A;  4O5B A;  4CGJ A;  4KI6 A;  3LWM A;  2DTU A;  3PV8 A;  2BDP A;  2ATQ A;  5HRR A;  2IOC A;  4CK1 A;  5KTQ A;  4DQI A;  1WSI A;  4OKK A;  4AHU A;  4Z4I A;  1RCH A;  1RBV A;  3ALY A;  2ETJ A;  3MEG A;  3VQA A;  2FBV A;  4CES A;  4I2P A;  4E7I A;  1ASU A;  1D9D A;  4CGG A;  2YNF A;  3NGI A;  3VA3 A;  3K57 A;  4O4G A;  2G8F A;  1NK0 A;  4LH5 A;  1IKW A;  3QEI A;  3NF8 A;  2GBZ A;  1CXQ A;  4B08 A;  5I42 A;  1QSL A;  3RR8 A;  4E1N A;  4DSE A;  2OZS A;  2DFF A;  3EY1 A;  3ZSV A;  3OYI A;  3EYZ A;  4M3Y A;  2QKB A;  1SKS A;  2JGU A;  5CYM A;  4B9T A;  2F8T A;  3DM2 A;  3ZSW A;  1J53 A;  2QXF A;  4ID5 A;  5C24 A;  1QSY A;  1TK0 A;  4E7L A;  4CF2 A;  4M3U A;  3SUO A;  4PQU A;  1VSD A;  3AVK A;  4J2B A;  4OLB A;  4PWD A;  3OS0 A;  1IKY A;  1RTJ A;  3OYA A;  2XHB A;  3RR7 A;  4QCL A;  3KK1 A;  1C1A A;  3LWL A;  1HMV A;  4AHV A;  1KVA A;  4FZZ A;  4PY5 A;  4UQG A;  1TGO A;  4F8R A;  3RTV A;  1S6P A;  4ZTF A;  2E6M A;  3NHG A;  3P83 D;  3ZT1 A;  5HRP A;  4CHY A;  3KLH A;  1W9H A;  3VQE A;  1L3S A;  4MQ3 A;  1TKX A;  2YHA A;  3CM6 A;  1D8Y A;  3C6U A;  3L2R A;  4KHQ A;  4HTU A;  2Z1J A;  2KTQ A;  2P1J A;  1DTQ A;  4DTS A;  1T05 A;  5JS2 A;  3SCX A;  3BDP A;  1I3A A;  3IG1 A;  4C8N A;  1EP4 A;  3K58 A;  4CCH A;  2YKM A;  4RW9 A;  1CZ9 A;  3M8Q A;  2HHX A;  1JLC A;  3PX0 A;  4CEC A;  1VSK A;  2X74 A;  3CFO A;  3ZCM A;  2X78 A;  3L2V A;  4KTQ A;  4KPY A;  1TL3 A;  1J9A A;  3B6P A;  2A1S A;  4FK4 A;  1D5A A;  1EX4 A;  1U4B A;  2BGG A;  1WSJ A;  4L8R B;  1EET A;  2O4G A;  3HST B;  4CJS A;  1DTT A;  4B8A B;  3AVC A;  2P51 A;  5JS1 A;  2B4J A;  3T1A A;  1BQN A;  3K5M A;  3NGZ A;  1VSI A;  4IFY A;  3OYD A;  3HK2 A;  2IDO A;  2VG5 A;  3F9K A;  4FJ8 A;  3AA4 A;  1C6V A;  4DTU A;  1X9W A;  5HBM A;  1T7P A;  4FJH A;  4RW4 A;  4BE1 A;  4CF9 A;  1WAF A;  4Q5V A;  3SNN A;  3OVN A;  3AA2 A;  4DQR A;  2XY8 A;  5T7B A;  2EHG A;  3HO1 A;  2VG6 A;  1C0M A;  3P5J A;  3QO9 A;  1JL1 A;  3AO2 A;  3TAM A;  4DS5 A;  4M3W A;  4B9M A;  2WOM A;  3QES A;  2OZM A;  4KB0 A;  1RT2 A;  2OYQ A;  1NJW A;  4LSL A;  3HXM A;  5HP1 A;  3LZJ A;  2IAJ A;  4FJG A;  2AJQ A;  4E1M A;  5FRN A;  1HYS A;  1BQM A;  3OYH A;  3THV A;  4FK0 A;  4JRP A;  4DQQ A;  4CHP A;  1YTU A;  5HRN A;  1S5J A;  2KW4 A;  4EZ9 A;  3I0R A;  3WNE A;  4N76 A;  3VQ4 A;  2YNG A;  1ITG A;  5KGX A;  3MEC A;  2XY7 A;  1NK8 A;  3VQ8 A;  4CJ5 A;  3SYZ A;  1RBT A;  1NK4 A;  3D45 A;  1ASV A;  1HYZ A;  1NKB A;  1N6Q A;  3S9H A;  3AA5 X;  4FK2 A;  4O0I A;  3V9Z A;  4CEB A;  1TKT A;  3K59 A;  3AO1 A;  3PUF A;  1WSF A;  3VQD A;  1S1U A;  1X9M A;  3DLG A;  1C1C A;  3LP2 A;  1LW2 A;  4IG3 A;  4CJR A;  3LDS A;  3AVG A;  4O0J A;  4DSJ A;  3SI6 A;  2G8K A;  4BE2 A;  2VG7 A;  1HQE A;  3OYE A;  3QEW A;  5EU7 A;  3QIP A;  4CFC A;  4KHU A;  3B6O A;  1VSL A;  2RF2 A;  2OPS A;  1BHL A;  1SL1 A;  1TK8 A;  1REV A;  3HPG A;  2YNI A;  3DLR A;  1ASW A;  3V1Q A;  5E41 A;  3TAN A;  2IS3 A;  1JLE A;  1RBS A;  2HND A;  3LAM A;  2NUB A;  4FM2 A;  3C6T A;  3QNN A;  1NKC A;  1XC9 A;  4J2A A;  1RDD A;  2RPI A;  3ZSX A;  4B9L A;  3E01 A;  3LP3 A;  3CFR A;  3ZSZ A;  1IH7 A;  4OJR A;  5CZ2 A;  4HHT A;  1QQC A;  4W5O A;  1XHZ A;  3C94 A;  1SL2 A;  4DQP A;  1B92 A;  1B9F A;  3FFI A;  3T19 A;  3DOL A;  4CER A;  4CJ3 A;  5D3G A;  4KB1 A;  2IC3 A;  1JXE A;  2XRI A;  4OPK A;  4BDY A;  4DF4 A;  2HB5 A;  1L3T A;  1IKX A;  2PZS A;  5KRT A;  1U04 A;  5KGW A;  2KZZ A;  4NCB A;  4FLX A;  2LSN A;  4R5P A;  4DG1 A;  4B8C A;  5SZT A;  3V6D A;  3RWU A;  2BE2 A;  3RMD A;  3I0S A;  4CK2 A;  1EKE A;  3VQQ A;  2G8H A;  1LAV A;  4HUG A;  3PX6 A;  4M3R A;  3V81 A;  4OKJ A;  4ICL A;  1L3U A;  3NDK A;  1RT3 A;  1JLQ A;  4DTP A;  4DU3 A;  1K6Y A;  1L3V A;  2Z1G A;  4RG8 A;  4CEQ A;  4EP5 A;  3V9S A;  4DSF A;  4KKO A;  1LWF A;  1JXB A;  2HHT A;  1RIL A;  4CE9 A;  4W5R A;  1LV5 A;  4CHZ A;  1VRU A;  2R7Y A;  4CJT A;  3KKR A;  2RN2 A;  3O3G A;  1NJY A;  1T8E A;  4E7K A;  1Z26 A;  2HHS A;  3OYF A;  4FLV A;  1RDB A;  2HNY A;  3QLH A;  4CHO A;  1JKH A;  2DFH A;  4LY7 A;  1RBU A;  4E89 A;  3S3O A;  3DLB A;  2D0A A;  2ZD1 A;  4DFK A;  2WON A;  4B9S A;  1HNI A;  2X6N A;  1VSJ A;  1Y97 A;  3A2F A;  4AHR A;  2HW3 A;  4HVJ A;  2KQ2 A;  3WNH A;  4CGF A;  3KLF A;  3KD5 E;  4IDK A;  3KKS A;  3SUQ A;  3SUN A;  2HHU A;  3ZSO A;  3BGR A;  1NK5 A;  3LAN A;  4W5Q A;  2D5R A;  3LPT A;  3S3M A;  1S6Q A;  5C42 A;  4DFJ A;  1QHT A;  5CY4 A;  1MU2 A;  4FJN A;  1N5Y A;  4DU4 A;  3QEP A;  3HVR A;  1IG9 A;  4BWM A;  4N5S A;  1BIS A;  1GOC A;  1RT4 A;  1XI1 A;  1SKW A;  4O55 A;  3OYL A;  3NBP A;  3V1O A;  3VQB A;  4JS4 A;  4B9V A;  2GV9 A;  2OA8 A;  3OYG A;  3AA3 A;  1ZBI A;  4Y1D A;  1C0U A;  3VQP A;  4CIE A;  4PUO A;  1Z25 A;  2ZQB A;  1J54 A;  3L3V A;  2G8I A;  4ELT A;  1TVR A;  4N47 A;  5J2P A;  3M8S A;  3DRS A;  1S1X A;  4CFB A;  4I2Q A;  4M41 A;  1UA0 A;  4JRQ A;  3SQ0 A;  3DLH A;  4ELU A;  2I5J A;  1B9D A;  2YKN A;  4F3O A;  1VRT A;  3AO5 A;  1JLA A;  3MXJ A;  3ZT2 A;  3RMC A;  4I9Q A;  4KTZ A;  2O4I A;  3NE6 A;  4B9U A;  3KTQ A;  1VSF A;  1WAJ A;  4W5N A;  2ZE2 A;  3AVJ A;  5KI6 A;  2VWK A;  3K5N A;  3L3U A;  5HRO A;  3TAB A;  4KO0 A;  1TK5 A;  1NKE A;  3AVM A;  1L5U A;  4OGC A;  4CFD A;  3PO4 A;  3M8P A;  1YVU A;  1ZBH A;  1TAQ A;  3ZT3 A;  1HNV A;  1HYV A;  3KK2 A;  1I39 A;  4DF8 A;  1QSS A;  3OS2 A;  4KRE A;  2HHV A;  2KFN A;  1BIZ A;  4OPJ A;  3DLK A;  4J2E A;  1FK9 A;  2XY6 A;  4DMN A;  1KFS A;  3V1R A;  2Y1I A;  1WNS A;  4BDZ A;  2HHQ A;  4LSN A;  4C8K A;  1C0T A;  1WSE A;  3NFA A;  5CYQ A;  1KVC A;  2DFE A;  4DQS A;  1NOZ A;  3QER A;  2YNH A;  3K5O A;  1HPZ A;  4CHN A;  4CJ4 A;  4KFB A;  2KZM A;  1BGX T;  1QTM A;  4FJ9 A;  1RT1 A;  1VK0 A;  3C95 A;  3AO4 A;  4FJK A;  1UAX A;  3O3F A;  4KHY A;  4GMJ B;  4CGI A;  4RW7 A;  1JLF A;  5FRM A;  3TAF A;  1TAU A;  1Q9Y A;  3LAK A;  4FLT A;  1U48 A;  4CF1 A;  3OYK A;  1A5V A;  1KVB A;  4YFU A;  4C8L A;  3U6F A;  3NF6 A;  3DRP A;  1BI4 B;  3LP1 A;  4EP4 A;  3HPO A;  1SL0 A;  3NF7 A;  4NYF A;  4CFA A;  2F96 A;  2D0B A;  1HRH A;  2F8S A;  4BE0 A;  1KTQ A;  4CF8 A;  2HVH A;  4E7J A;  1SUQ A;  4E7H A;  1QS4 A;  1XWL A;  3AV9 A;  3AVA A;  5K14 A;  5HRS A;  3HP6 A;  4CJK A;  2P5O A;  3SZ2 A;  4EZ6 A;  3JYT A;  2Z1I A;  3OYC A;  3H08 A;  4KHS A;  4ELV A;  5CZ1 A;  3DLE A;  4FJL A;  4AHT A;  4G1Q A;  1WLJ A;  3HP9 A;  4CJV A;  3OYM A;  4RW8 A;  4OVL A;  3OS1 A;  2IGI A;  4ZTJ A;  1NJX A;  3OJU A;  1U47 A;  4FXD A;  3CYM A;  1VSE A;  5J1E A;  4OGE A;  3OYJ A;  2KFZ A;  2YV0 X;  3NAE A;  4FLU A;  1EXQ A;  4IKF A;  4GW6 A;  1IO2 A;  2G8V A;  4N41 A;  4CIG A;  4CK3 A;  4HUE A;  2EX3 A;  2OPR A;  4CJP A;  3KLE A;  1YTA A;  2OPP A;  4BWJ A;  2HMI A;  4FJ5 A;  1C1B A;  4I7F A;  3S3N A;  3P1G A;  4H4M A;  4FJM A;  3VQ9 A;  4OLA A;  1FKP A;  2YHB A;  4M45 A;  4KRF A;  3SJJ A;  3NCI A;  4DU1 A;  5HLF A;  3ZT0 A;  3VQ7 A;  3QEV A;  1X1P A;  4W5T A;  4FJX A;  4M3X A;  3VQC A;  3TR8 A;  1A5X A;  2QKK A;  3HVT A;  3ZSR A;  1KRP A;  4ID1 A;  4HCB A;  4BDP A;  3ISN C;  2FBT A;  3M8R A;  4Z0U A;  3DYA A;  3AVB A;  3V4I A;  4DWI A;  4CGD A;  4K8Z A;  3KIO A;  4DFM A;  3SPY A;  4KHW A;  4NCG A;  2FC0 A;  1TKD A;  1S9E A;  4DTO A;  4J2D A;  2B6A A;  4N56 A;  4TSX A;  1BCO A;  4WE1 A;  4CEA A;  1WSH A;  3KD1 E;  3HJF A;  3MXM A;  4Z4H A;  1RTI A;  4DLE A;  3SV4 A;  3ITH A;  3AVL A;  4C8M A;  4AHS A;  3SQ2 A;  4HUF A;  4FVM A;  5FRO A;  2Z1H A;  3L2Q A;  4DSK A;  2FBX A;  3MAQ A;  3V9X A;  4CJF A;  4CGH A;  3SPZ A;  4FJ7 A;  4FLZ A;  4KI4 A;  4O44 A;  1CZB A;  3ULD A;  4FJJ A;  5I3U A;  3G0Z A;  3EZ5 A;  1QE1 A;  3CQ8 A;  5DMR A;  4FM0 A;  1LWC A;  4DTJ A;  1ZYQ A;  3HM9 A;  4FM1 A;  3TAR A;  3ZSQ A;  1KLM A;  2Q3S A;  1O1W A;  2PYL A;  1JL2 A;  1UA1 A;  3PO5 A;  4DSI A;  1S1W A;  1T03 A;  1UWB A;  3AVF A;  4C8O A;  4CIF A;  3G10 A;  1TV6 A;  2VWJ A;  3MXI A;  1S1T A;  1G15 A;  3AVN A;  3MED A;  4Y1C A;  2XY5 A;  4RW6 A;  3TAE A;  3TAP A;  3NH2 A;  5J2M A;  4QAG A;  3QEX A;  1TKZ A;  1BCM A;  1IKV A;  3IS9 A;  2DY4 A;  3HYF A;  3NGY A;  3VQ6 A;  1NK9 A;  4FW2 A;  4M3T A;  2HHW A;  3O4Q A;  2E4L A;  4CJQ A;  4CJE A;  3SQ1 A;  2JLE A;  1HJR A;  1ZBL A;  1JLB A;  4Z4C A;  1XHX A;  2QK9 A;  1LAW A;  3QIO A;  4OKE A;  4XIU A;  4KAZ A;  4FJI A;  4Z4E A;  3NH1 A;  4LD0 A;  1BL3 A;  3O3H A;  3TI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...