2RN2A

Structural details of ribonuclease h from escherichia coli as refined to an atomic resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
b'MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural details of ribonuclease H from Escherichia coli as refined to an atomic resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1992-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rn2A00
3U3YA 3VQ9A 2B5JA 5J1EA 3ZCMA 3KLIA 5C25A 1XI1A 5CZ2A 3LP1A 4JRPA 4Q5VA 4M3YA 4W5TA 2DFFA 4FLZA 3O3FA 1YTUA 1S6QA 4OKKA 2Q3SA 3DOKA 2D0BA 2P5OA 4KAZA 4KHUA 4F3TA 1EP4A 4M41A 1TAUA 1JKHA 1QSSA 4CHQA 2F8TA 2QKKA 2IDOA 1C1BA 2BE2A 1TV6A 1JLEA 1KTQA 3ZT0A 2X6NA 4BE1A 2WOMA 3PY8A 1I3AA 3ALYA 3HSTB 4CF1A 3DOLA 4FVMA 1ZBUA 2IAJA 4HUGA 3TARA 2HHSA 2QKBA 2O4GA 3B6OA 3ASMA 4B9VA 1A5VA 4Z0UA 1LWFA 3V1RA 3NGZA 4DSJA 2XY6A 1BIUA 4FM0A 3KLGA 1R0AA 3HVRA 3SV4A 2KFZA 3VQPA 4KHYA 3QERA 4YFUA 4DSLA 3PO4A 4LH5A 4AHRA 2XY8A 1RT7A 4CGFA 2FBTA 2B6AA 4DTUA 4M3TA 3TI0A 1RDBA 4RW9A 4FJGA 4L8RB 3SUOA 1JL1A 2G8IA 1Z25A 4OPKA 4HTUA 3IRXA 4E7KA 4DQQA 1SV5A 2Z1JA 1ASUA 1BGXT 5CY4A 4CK1A 1U47A 3RRGA 4EZ9A 1BI4A 1JLGA 4FJ9A 3KKRA 3K2PA 5CYQA 3ZSZA 1VSJA 3VQQA 4CGIA 5CZ1A 1RTJA 4CFBA 3LP3A 1GOBA 3ZSRA 3NH2A 1ZYQA 1KFSA 2VWJA 1ZBLA 4FJMA 3K5LA 4M3XA 2BGGA 1NK6A 4DF8A 4FJIA 2G8WA 4ZHRA 2X74A 3MECA 1U49A 4XIUA 2AJQA 1KVBA 4HUEA 3NE6A 3LP0A 3NAEA 3EZ5A 4DS4A 5J2NA 1NOYA 4N41A 1C0TA 1RTIA 3NH0A 2DY4A 2F96A 4BDPA 4OLBA 5C42A 3K58A 3VQ6A 4KHNA 4GMJB 4FK2A 3S3NA 4CHOA 4FYDA 1NK9A 1HYSA 1ASVA 4IBNA 1YT3A 5KI6A 3V9WA 3S3OA 1NOZA 3NH1A 4HHTA 4K8XA 3HO1A 1LWCA 4MFBA 1SKRA 4CEQA 4HUFA 4DTJA 2FBYA 1RILA 4DQSA 5D3GA 4KTZA 4GVMA 1RNHA 4FK0A 2P51A 1NJYA 4KTQA 3EYZA 4CJUA 1S6PA 5HP1A 3PUFA 1T05A 2ITGA 4B8CA 3SQ1A 1XWLA 5KRTA 1GOAA 3S3MA 1HRHA 1JLBA 4C8NA 3CM5A 4B9LA 1VK0A 4W5RA 1QS4A 5J2QA 3OYBA 1GOCA 1IO2A 1NJZA 1NKCA 4FZYA 3AVIA 3DLRA 4PUOA 4KI4A 4Q0BA 4DU4A 3O3GA 3V6DA 3SUNA 1HQUA 2HMIA 4O0JA 4CJ3A 2ZE2A 4H4OA 1U4BA 3RR7A 5J2PA 1HMVA 4FJ7A 4O5BA 3RMDA 2OPSA 4E1MA 4E7JA 3AO1A 1TKTA 4OPJA 4FCYA 3CM6A 4CF0A 1WN7A 3VQDA 3LALA 3I8DA 3T19A 1X1PA 1TKXA 3LAMA 3SZ2A 3ZSVA 4CGGA 4DFJA 1KSPA 2B4JA 3DRSA 1SL2A 3QEVA 1O1WA 3I0SA 3KJVA 3AV9A 4B9TA 4B3OA 2D5RA 2RPIA 3DLBA 2HVIA 3QNNA 1KVAA 2JGUA 3LANA 2HW3A 2DFEA 3THVA 4DTNA 4FXDA 1WSFA 1QHTA 2Y1JA 3TAFA 1RT1A 1FXXA 3LZIA 4FJKA 1UA1A 3AO3A 5KGXA 2Z1IA 4I7FA 3QNOA 4H8KA 1KRPA 4DS5A 2YNHA 3C95A 3KLHA 4BE2A 2KZMA 1JXBA 2YKMA 5HRPA 1BQNA 1HYZA 5K14A 1NK8A 4NCAA 3K59A 1RCHA 4BACA 3V9SA 1ZBHA 4CECA 1WSJA 2JLEA 5FDLA 2XY7A 3OJUA 1XC9A 4DSKA 2QXFA 2HHXA 3KLEA 3QEWA 4FLXA 3AVGA 1TK8A 1CLQA 4FZZA 1VSDA 1DTTA 3C6UA 1BQMA 1HNIA 4M3WA 2F8SA 4KV8A 5JS2A 3EY1A 4DLEA 1FK9A 3TAEA 4CJLA 5DMRA 4NYFA 3MEDA 1QTMA 2YV0X 4DSFA 4Z4HA 1IKYA 3L2UA 3HPHA 4JLHA 4W5QA 4FJ5A 3AA4A 4F2SA 3KKSA 2FBVA 3TAGA 1D5AA 3H08A 2OZMA 3AVCA 2KW4A 1BL3A 3NCIA 4W5OA 4DG1A 3IG1A 3QEPA 1TK5A 2KTQA 4N56A 4ZTJA 1S9GA 3KD1E 3F73A 3V9ZA 2G8KA 5DK5A 3SQ2A 1RBVA 3VQBA 1NJWA 1RDDA 3CQ8A 4FJJA 2HNYA 4CJFA 4ID1A 3SQ4A 1S1TA 3OVNA 4CESA 2FBXA 3RMBA 1SKWA 1N6QA 4JS4A 2FC0A 2G8UA 3AVAA 5FRNA 1WSHA 3RMAA 4CEZA 1KLNA 3OS1A 3AVMA 3OYEA 4FLVA 4LH4A 3LPUA 3SUQA 5I3UA 2Z1HA 4ELTA 4DSEA 1YVUA 3ZSWA 1RT5A 3IS9A 3M8RA 3SYZA 4J2EA 1S9EA 1IKVA 1UA0A 3P5JA 2D0AA 1NK4A 4M3RA 4I9QA 3L2WA 3OYKA 3KTQA 4Z4EA 1QSYA 1SUQA 2P5GA 4KKOA 1A5XA 1DLOA 1LW2A 2IS3A 3NGYA 4FLWA 4CFCA 3VA0A 3LWLA 1J9AA 4GW6A 3CFOA 4F2RA 1HQEA 3OS2A 3SUPA 3K5NA 3QIOA 4CK2A 2GUIA 1NJXA 4C8LA 4DTOA 1NK7A 4KI6A 4OKJA 4QOZB 1UOCA 1WSEA 3L3VA 1REVA 1S1XA 4CJ4A 3RRHA 4ZTFA 1ZBFA 2RN2A 3K5OA 4NCBA 3D45A 1S1WA 3TABA 2NUBA 2HHVA 3MXJA 4DF4A 4R5PA 2VG6A 4CIGA 2G8FA 4CCHA 3DYAA 1RDAA 4N76A 2ATQA 4Z4FA 3OYJA 2D0CA 3VQ5A 1VSFA 3QO9A 3WNHA 4AHTA 1VSMA 1NK0A 2YNGA 4Z4GA 3NHGA 1RBUA 1CZ9A 1S1VA 3L2QA 4I2PA 3PO5A 4FJXA 1J5OA 4OGCA 3DRRA 5T7BA 1BCOA 1LW0A 3HM9A 4Y1DA 4BDZA 4CEFA 4IG0A 1BCMA 3O4NA 3ZT4A 4LSLA 1T7PA 3KD5E 4DTRA 4FJNA 3MAQA 1NK5A 2PYLA 4CHYA 1RBRA 2X6SA 1F21A 4IFVA 3VQEA 4M3ZA 2VG5A 1L5UA 1D9DA 5KGWA 3U3GA 3QLHA 5SZTA 4QAGA 4BDYA 4DSIA 3TAQA 2WONA 1JL2A 3OYNA 1ZBIA 4IDKA 1LAWA 1TKDA 2HHQA 5EU7A 3OYIA 3AVLA 3KIOA 4CJPA 1A5WA 1BHLA 1ITGA 4M45A 1VSEA 4Z4CA 3V9UA 1KLMA 1C1CA 4CHNA 4DLGA 4B9UA 3DLGA 2YNIA 2QK9A 4BWMA 3DI6A 4RW7A 3K57A 1CXUA 4CEOA 4TSXA 5E41A 2KZZA 4CF8A 1KFDA 4KREA 3QINA 3KLFA 1HJRA 1TVRA 3DMJA 4FJLA 4OVLA 4CK3A 4CE9A 1W0HA 4KFBA 5HRRA 3KK3A 3V1QA 4OKEA 3OYMA 4EP5A 3RMCA 3F9KA 5FROA 4W5NA 4DQRA 1VRTA 4DU1A 1SL0A 4DTMA 2OZSA 1BI4B 2IC3A 1QE1A 3LP2A 3M8PA 4E19A 5KRSA 1U48A 3G10A 4DFKA 4I9LA 1UWBA 2YNFA 1TL3A 4KRFA 4BWJA 4O55A 4H4MA 2OYQA 1B9DA 2ETJA 4LD0A 3CG7A 1KVCA 4B9SA 2RKIA 1RDCA 1X9SA 3C94A 3V81A 1VSKA 3QEXA 4C8OA 3MXIA 3NBPA 4O0IA 4FLTA 3T3FA 1ASWA 4RW6A 2Y1IA 4QCLA 3G0ZA 1KCFA 2HNZA 1HPZA 4NYNA 4CF9A 4F3OA 2A1SA 4IFYA 4E0DA 4K8ZA 4OLAA 4LSNA 3PX6A 1I39A 3HL8A 3HP9A 3VQCA 4FW1A 3OYHA 3D0PA 4FLUA 2OA8A 4J2BA 1L3TA 1VSLA 3VQAA 3RTVA 4RW4A 1T8EA 1TL1A 1IKWA 1DTQA 1QSLA 5FRMA 1NKBA 3DLHA 2OPPA 1X9MA 4CEBA 3L3UA 1RBTA 5HBMA 1EX4A 2Z1GA 3WNGA 3OYGA 2EHGA 3TR8A 2GV9A 3HYFA 1T03A 4PA1A 3LZJA 2LSNA 1IG9A 3V4IA 2XY5A 3RR8A 1RT6A 2E6LA 3NF9A 4CHZA 1JLAA 3OS0A 4DWIA 4DFMA 3O4QA 4KHQA 3LPTA 4FJHA 1TK0A 4CHPA 2ZD1A 4CIEA 4F8RA 3DLKA 4EZ6A 3AVHA 3SPZA 3BGRA 3OYLA 4AILC 4J2AA 2E4LA 2PYJA 2VWKA 4E89A 1LWEA 4I2QA 1JLQA 3TWHA 4FM2A 3HXMA 2DFHA 4CJSA 1Q8IA 4B9NA 4C8KA 4KB0A 1Q9XA 1YTAA 2OPQA 3JYTA 2PY5A 3ZSOA 1TKZA 1N5YA 4KPYA 4J2DA 1CZBA 1X9WA 1TAQA 4CFDA 4AHCA 4PWDA 4AHSA 2XHBA 1W9HA 3LAKA 2R7YA 4ELUA 1K6YA 5I42A 4RG8A 3AA3A 4C8MA 1C0UA 3MEGA 2G8VA 4CJ5A 3VQ4A 1WLJA 4KHWA 4CGHA 4CEEA 1WAJA 4CIFA 5JS1A 3QIPA 2A1RA 1EETA 1B9FA 1JXEA 1WSGA 4CEDA 3A2FA 1RTDA 1D8YA 3AA2A 3OY9A 3AVKA 1C0MA 2HHTA 2KFNA 1WAFA 2IOCA 4O4GA 4Y1CA 1XHXA 4N47A 5HROA 4DQPA 4DQIA 3B6PA 1RTHA 3PV8A 3S9HA 1HNVA 3JSMA 3SNNA 4FW2A 3SQ0A 1SKSA 1B92A 3OYDA 3M8SA 3QETA 3SPYA 1VSIA 4CF2A 1RT3A 2XO7A 1IH7A 3HPOA 3CFRA 4B8AB 4FM1A 5HLFA 2HNDA 4OGEA 3TAMA 1LAVA 1NKEA 3AO4A 4AHUA 1QQCA 3HP6A 3TAPA 2I5JA 4CGDA 1CXQA 4DTXA 3AVJA 4FJ8A 3ZT2A 3HPGA 3LWMA 4CEAA 3QESA 3SI6A 3SJJA 1UAXA 3AVNA 3PX0A 4KO0A 5SWMA 4JS5A 1S5JA 3SV3A 3SCXA 2HVHA 4E3SA 3L8BA 3ITHA 2HB5A 1S1UA 1U04A 2RF2A 4PY5A 1L3SA 3OJSA 3CYMA 1C6VA 1L3UA 4FK4A 4CJRA 4KB1A 1RT4A 3NFAA 4DFPA 5C24A 4EP4A 3L2RA 2KQ2A 1FKPA 1LV5A 2GBZA 3ZT3A 5CYMA 4CJWA 3LDSA 1EXQA 1Q9YA 4PQUA 1BISA 2BANA 4KTWA 4M42A 2VG7A 1RT2A 4Z4IA 3E01A 1U45A 4NCGA 4HVJA 1C1AA 4HCCA 1VSHA 1FKOA 3ISNC 3ZSXA 1EKEA 2EX3A 3HK2A 3DM2A 1MU2A 3P1GA 2PZSA 3FFIA 2YHBA 3NF6A 3NDKA 4E7LA 3VA3A 1VRUA 4CGJA 1J53A 3M8QA 3AVBA 4ICLA 3P83D 4B08A 2O4IA 4OJRA 3ZSQA 4M3UA 4MQ3A 3VQ8A 2BDPA 1J54A 3OYCA 1XHZA 4FLYA 2HHWA 2OPRA 3WNFA 4DU3A 3WNEA 3ZT1A 4E7IA 1RBSA 4O44A 5J2MA 4N5SA 3U6FA 3MEEA 3TANA 4G1QA 1G15A 2P1JA 1WSIA 4DTSA 4B9MA 1BIZA 3OYAA 3K5MA 2IGIA 4LY7A 4CJVA 4UQGA 3V1OA 4E7HA 4WE1A 4YNQA 3AVFA 2YHAA 3V9XA 4IKFA 2G8HA 2E6MA 3C6TA 3O3HA 4ELVA 1TGOA 2XRIA 3NF8A 1Z26A 3AA5X 3PX4A 3T1AA 1WNSA 4BE0A 3KK1A 3AO5A 4F4KA 5HRNA 4JRQA 2X78A 5HRSA 3MXMA 4KHSA 1JLCA 1Y97A 3NF7A 3HT3A 3L2VA 3CFPA 3IAYA 3AO2A 3ZSYA 3RWUA 3VN5A 4CJEA 3DLEA 4DTPA 1SL1A 3HJFA 3ULDA 4ID5A 4AHVA 1L3VA 4E1NA 4CJTA 3QEIA 3DRPA 3I0RA 3VQ7A 1HYVA 3OYFA 2W42A 2ZQBA 3NGIA 4FZXC 4IG3A 4RW8A 4AH9A 3HVTA 4CERA 1D9FA 3BDPA 5KTQA 1JLFA 3UIQA 4DMNA 4CFAA 2YKNA 4CJQA 4HCBA 2HHUA 2DTUA 3KK2A 4CJKA 1IKXA
chains in the Genus database with same CATH superfamily
5GINA 3HZ6A 3KLIA 3LP1A 2QWMA 4JRPA 4Q5VA 1HJOA 2DFFA 4H0YB 3QFUA 1JKHA 3QBXA 1C1BA 1KTQA 4BRIA 2D1KA 2GELA 3TARA 3DOLA 4MO5A 2IAJA 4NLCA 2FLOA 3R9PA 3B6OA 1ILYA 3ASMA 4Z0UA 4M7XA 1SQKA 3SV4A 4KHYA 4YOXA 3QERA 4YFUA 3PO4A 4LH5A 4M3TA 2HF4A 4CGFA 5GADP 2Q0RA 4DTUA 2V51B 3M3ZA 4RW9A 4FJGA 1WOQA 4G9ZA 1WB9A 4BRQA 3BZCA 2Z1JA 1U47A 2O8DB 1JLGA 3OBYA 3KKRA 4CGIA 5CZ1A 4CFBA 3NH2A 3DLLL 1ZYQA 2BGGA 1NK6A 1IBMK 4C23A 4YY3K 4DHYA 4R79A 1HX1A 1NGEA 4JD2A 3LP0A 3IMXA 3EZ5A 4N41A 1C0TA 5C42A 4X62K 4FWMA 4H5WA 1QVGM 4GMJB 5AQJA 3S3NA 4CZEA 1OKJA 3AY9A 1RGIA 1HYSA 4IBNA 3V9WA 3S3OA 4MFBA 2WUSA 3J8AA 4GVMA 4JI8K 3HM8A 4CJUA 1Q81O 3FLCO 2ITGA 3SQ1A 4FWRA 4B9LA 1QS4A 3CQXA 5J2QA 1NJZA 2GEMA 4H5VA 5C2DA 4I6MB 2ZJQL 3DAWA 3GOIA 3SUNA 1HQUA 4H4OA 3RR7A 2W6KA 2QW9A 3RMDA 4A61A 3I8DA 4EHTA 3MCAB 2P9LB 4PHTX 3GL1A 4BQZA 3H45C 2HVIA 2JGUA 2JWKA 4CZJA 4JKBA 1WSFA 3LZIA 1YUWA 2ZF5O 5CHIA 1UA1A 2UXBK 4B3SK 5KQ8A 4NCAA 1RCHA 5IWAK 1ZBHA 5FDLA 3WXLA 2HHXA 2Q2RA 1CLQA 1TK8A 1W2BM 3ZYYX 2F8SA 1BQMA 2GTDA 5AQMA 4LF4K 3ZETB 1QTMA 2VQEK 3O9RA 4DSFA 4KHPK 1IKYA 4W5QA 2FBVA 4BC4A 3G6EN 1D5AA 2P9NB 4ISEA 2KW4A 3NCIA 4W5OA 2KTQA 3AGRA 1T3VA 2V7ZA 3SAHA 3AGKA 4J8FA 2G8KA 2D4WA 1NJWA 1SKWA 3RMBA 4CESA 1N6QA 3L4QA 1WSHA 4CEZA 5M1QA 3SUQA 4ELTA 2HMPA 4DV0K 4GNIA 4J2EA 1KAXA 4BR5A 1IKVA 4I9QA 3L2WA 4Z4EA 1QZ6A 1BWFO 5KQDA 4KKOA 1A5XA 2IS3A 3NGYA 1WBBA 5JMVA 2QWQA 1HNZK 3VA0A 4FWPA 3E9OA 3W0LA 4JKAA 5LJWA 5LMNK 1NJXA 4CBUA 4C8LA 4QOZB 4X66K 2KHOA 5AQZA 4ZTFA 3PSIA 2NUBA 3OHRA 3MXJA 2VG6A 4CIGA 4DR3K 3DYAA 4JV5K 2ZM6K 3WNHA 4CVNE 4AHTA 1RBUA 3E9PA 2WTUA 4I2PA 5DM6L 4CEFA 2P9KA 2GX9A 1BCMA 3KD5E 4DTRA 1RBRA 2X6SA 3A5LC 3VQEA 4M3ZA 1L5UA 1D9DA 1NMNA 3EE8A 4DSIA 4BDYA 2WONA 1JL2A 3OYNA 3DXKB 3LL3A 4YOWA 1ZBIA 3ATUA 1YI2N 1LAWA 5EU7A 3AVLA 4RWTA 4DKWA 4M45A 3C7NA 3ATVA 1C1CA 4CHNA 4B1XB 4DLGA 4BWMA 3K57A 3O9QA 1RFQA 3TPQA 1TUYA 4QS8A 3N4PA 4KREA 2QWNA 3I56N 4CE9A 4KFBA 3KK3A 4EP5A 3RMCA 3CC7N 3R6MA 3UKRA 1VRTA 5AQVA 2CGKA 2IC3A 1QE1A 3CPEA 3FZLA 3LP2A 3E1YA 4H0XB 2VQFK 3D7EO 2PAVA 4XH1A 5BN8A 1TL3A 1Y64A 4FWOA 4LFAK 1B9DA 5AQOA 5C0YA 4WQ4C 3L4IA 1VQPN 2ITMA 4NXNK 1ASWA 4QCLA 3P31A 4PL8A 3G0ZA 4JI6K 4E0DA 4K8ZA 4GKKK 4CBXA 1SAZA 2O8DA 1BA1A 3VQAA 4RW4A 1T8EA 1DTQA 4HWIA 4U67L 3D2EA 3DLHA 4GV9A 3QB0A 5HBMA 3WNGA 2EHGA 2GV9A 1U6ZA 1EO1A 4DFMA 4AF1A 2UUBK 3BY5A 2UXCK 1EWRA 3EKSA 2Q97A 4CHPA 4CIEA 3DLKA 2CGLA 3TSPA 1ATRA 4BR7A 4BRLA 1NM1A 2PYJA 4E89A 2O8FB 4C8KA 3HXMA 2DFHA 2E20A 3ID8A 1YTAA 3JYTA 1N5YA 4J2DA 1CZBA 4DV3K 1OH5A 4FSVA 4PWDA 1KD1O 3MEGA 5H1SQ 3R8EA 4EIAA 2A1RA 4CEDA 2HHTA 2IOCA 2E5LK 5HROA 4DQIA 5F2RA 3DJCA 3AAQA 4FW2A 3HOSA 3SPYA 1VSIA 4CF2A 3VF4A 3CCQN 3HPOA 1HNWK 3TAMA 5ADXA 1LAVA 5LL6Z 4KH4A 2A42A 1QQCA 1VQ8N 3WXMB 4FJ8A 3J80O 4B1UB 3HPGA 3QESA 3SJJA 1SL2A 1KSPA 1NGFA 4JS5A 3EO3A 3SCXA 1Z05A 4JK8A 1YAGA 3L8BA 1S1UA 1JCEA 3M5RA 4FK4A 4OO1J 4H0VB 1RT4A 5AQGA 5C24A 3L2RA 4DFPA 2KQ2A 1K73O 4PKHA 4OX9K 3H46O 5CYMA 4CJWA 3LDSA 1EXQA 4PQUA 2UXDK 2OTLN 4KTWA 1RT2A 1NGBA 1NG9A 1U45A 4HCCA 1C1AA 1I94K 1FKOA 1GLJO 1EKEA 3A5OC 3H1VX 4CZIA 3FFIA 3NDKA 1VRUA 4CBWA 4WFAL 4GY2B 1HR0K 2RE2A 5AQSA 2BDPA 1VHXA 4JN4A 3WNEA 3ZT1A 2FSNA 4N5SA 5ADXH 3ID6A 5AQNA 1G15A 1WSIA 4H5TA 3OYAA 3SMSA 2YHAA 4ELVA 3VEVA 2AA4A 3KK1A 4LF6K 3HSCA 4JRQA 2X78A 3HT3A 3ZSYA 3RWUA 2RHKA 4DTPA 3HJFA 3ULDA 1L3VA 5BPNA 4E1NA 4CJTA 3I0RA 1Q18A 3VQ7A 4Y0WA 3EN9A 1D9FA 3UIQA 2ZJPL 4CFAA 1YJWN 3T69A 3UE5A 3KK2A 3LM2A 4O8UA 3U3YA 2A5XA 5C25A 1XI1A 3HI0A 1QQMA 2O8BA 1NGAA 3I33A 4M3YA 4W5TA 4FLZA 3IDHA 2Q3SA 5CE3A 4KAZA 4KHUA 4M41A 1QSSA 2F8TA 1NGJA 2QKKA 1IBKK 1TV6A 1JLEA 3SBGA 4CZFA 3PY8A 2Q0UA 3HSTB 1IBLK 2HHSA 1ZBUA 3DXKA 4WFBL 3PSFA 3CIPA 4BC5A 1LWFA 3BEXA 4DR7K 3THXB 3V1RA 2XY6A 3TTFA 3CCSN 3TSUA 3HVRA 3VQPA 3A5MC 2HBMA 2GWKA 1RDBA 1DKGD 1JL1A 4BRHA 4OPKA 1SV5A 2FF3B 1ASUA 3RRGA 4FWQA 5A2QO 3K2PA 1KXPA 4YOTA 1KFSA 2BH1A 3VGLA 1QVFM 2VCPA 4JKEA 2NRHA 2X74A 3RSEA 2AJQA 4GVEA 4HUEA 1NBWA 3ZEUA 1T44A 3NH0A 2FSKA 4OLBA 3K58A 1ASVA 5KI6A 5BRHA 5C2FA 4DUYK 1V4SA 4B1YB 4HHTA 3HO1A 1LWCA 3GE1A 4CEQA 4DQSA 5D3GA 3SBTA 1NJYA 3EYZA 3PUFA 2BTFA 5M1FA 5AQIA 3H3NO 1XQSC 1VK0A 3LM9A 1GOCA 4BG8A 4BRAA 5JLHA 4O0JA 1U4BA 2ZE2A 4O5BA 5BR9A 2O8FA 4EFHA 3BF3A 4E7JA 3AO1A 4CF0A 4IEEA 3T19A 1X1PA 2HBLA 4IJNA 2B4JA 3I0SA 4B9TA 2D5RA 1X9JA 3DLBA 3EKUA 4JEPA 5AR0A 3QBWA 4FXDA 1VQON 1FXXA 3AO3A 5KGXA 1GLCG 3QNOA 5IT9O 2YNHA 3C95A 4BE2A 2KZMA 1LCUA 1IJJA 3K59A 3SK3A 3PIOL 4QS7A 1XC9A 4DSKA 1M1KO 4FLXA 3AVGA 4FZZA 1DTTA 4V19S 4B3TK 5JS2A 4DLEA 3QFPA 1FK9A 2E8AA 5KPTA 3TAEA 4AM6A 1ZBSA 3HRGA 1XC3A 4JLHA 4FJ5A 4A57A 3CERA 4F2SA 3UKRB 2V7YA 3M1FA 1YJ9N 2OZMA 3PLAA 4JYAK 1BL3A 4DG1A 3CCLN 1NGCA 3AAPA 2QWRA 5DK5A 3VQBA 2FXUA 1ZXOA 4DR5K 4JS4A 2G8UA 2A40A 3AVMA 4FLVA 5I3UA 2Z1HA 4DSEA 1YVUA 1RT5A 3IS9A 5AZIB 3TTCA 3CHWA 3JXUA 5JVGL 4FPBA 1N33K 4PL7A 1S22A 1J9AA 4GW6A 3LWLA 1HQEA 3OS2A 3SUPA 3K5NA 4CK2A 4KI6A 4OKJA 3BZKA 1REVA 3D2EB 4H5RA 3RRHA 1ZBFA 2RN2A 3K5OA 4DB3A 4DF4A 4CCHA 4JKFA 4N76A 3OYJA 5AQWA 3QO9A 1NK0A 2YNGA 3NHGA 2UYTA 1OH8A 4DR6K 5EXWA 3ZT4A 4FJNA 3MAQA 1NK5A 2PYLA 1KC8O 5KGWA 3THWB 3WXKA 3TAQA 4BVOA 5LY3A 5BR8K 4JKCA 4BG9A 1ITGA 1BHLA 1VSEA 1EWQA 3GDQA 2E1YA 1IG8A 1M90O 1QQOA 3OA9A 4JKHA 1KFDA 3B8AX 3QINA 3KLFA 4DV5K 2IIRA 3SJHA 3VTHA 2HF3A 4JK7A 4L3QA 1W0HA 5HRRA 3ZX3A 3V1QA 3IUCA 4MLHA 4W5NA 3CMAN 4DTMA 1IV0A 4JKDA 2OZSA 1U48A 1YIJN 1E3MA 4CZKA 4X65K 3WXIA 4I9LA 3THXA 4O55A 2ETJA 3I55N 4B9SA 2RKIA 1RDCA 1K9MO 3C94A 4O8KA 3CCMN 3AARA 1VSKA 4BGBA 4C8OA 3MXIA 3NBPA 4DR1K 4RW6A 3ENOA 4CZHA 1KCFA 5C10A 4NYNA 4JNEA 3HL8A 3OYHA 3CMEN 2ZGZA 5FRMA 5F0XA 1NKBA 2CH5A 4CEBA 3OYGA 1T03A 2Z1GA 3HYFA 4A62A 1IG9A 3V4IA 2XY5A 1NLVA 2E6LA 3NF9A 1JLAA 3O4QA 4KHQA 4A2BA 1TK0A 1J5EK 2ZD1A 4F8RA 3HOTA 3UKUA 3AVHA 1XUPO 4FVUA 3BGRA 3OYLA 4AILC 4J2AA 2E4LA 4FM2A 2P9SA 5M1PA 1HKGA 4A2AA 3KZBA 1TKZA 4NLBA 3OW2M 2XHBA 3LAKA 4ELUA 5I42A 4RG8A 5LJVA 1NGDA 2YHWA 4CEEA 1D8YA 1EETA 1B9FA 1JXEA 4IO9L 3ZX2A 3A2FA 3FGUA 3AA2A 3OY9A 4CZLA 1C0MA 4N47A 5HOOA 4Y1CA 1X3MA 1RTHA 2F7TA 3M8SA 4DCHA 1N36K 2W40A 1RT3A 2HBJA 2QWLA 3FZHA 3NMUA 3J81O 3HP6A 1GLEG 4K25A 4CGDA 1CXQA 4DTXA 3AVJA 3ZT2A 1NNEA 2O8BB 5DM7L 3LWMA 4CEAA 3SI6A 1XMQK 5BPMA 3PX0A 3KWGA 4KO0A 2NRVA 5TKWA 4LF7K 1U04A 3E9LA 2RF2A 4PY5A 2O8EB 1L3SA 1QHAA 4GV6A 1NU0A 3ZX0A 3NFAA 2I7NA 1E4GT 3O08A 2GBZA 4GV3A 3ZT3A 4B1VA 1BISA 4M42A 5EY4A 3T7ZA 3K9JA 3VTIA 3ISNC 4PKIA 3ZSXA 2F9WA 3CF5L 4B3MK 3R3LA 5AFUA 3T1HK 2YHBA 1W97L 4MDAA 2Q1NA 3VA3A 4BRCA 4ICLA 1XHZA 4FLYA 2HHWA 2H3GX 3O5BA 1ATSA 2OPRA 3WNFA 1YJNN 4E7IA 1RBSA 5J2MA 1T6DA 3TANA 3MWTA 3O4WA 4JAXA 4UQGA 2QWOA 4E7HA 4NXMK 3RSEB 2G8HA 2E6MA 2KLAA 1TGOA 3WEEA 4LFBK 3E66A 2XRIA 3PX4A 5FPDA 3ZEUB 4DV6K 5C15A 4BE0A 5AZIA 3AO5A 3A5NC 4LFCK 3GBTA 3GG4A 3MXMA 3FE1A 3P39A 4JI7K 4B9QA 4CJEA 1SL1A 3THYA 3OYFA 2OANA 2ZQBA 3NGIA 4FZXC 4IG3A 4RW8A 4AH9A 4DV7K 1YVNA 3BDPA 1CZAN 1JLFA 2YKNA 4DV1K 5AFUH 4HCBA 3U9ZA 1W7AA 4JKGA 4JK9A 1MWMA 4QS9A 3ZCMA 4IJAA 5CZ2A 2GWJA 4RCHA 1YTUA 4OKKA 2V52B 2D0BA 4A5BA 1TAUA 2OCEA 3MWPA 4C1NK 2IDOA 3OBWA 2BE2A 4BE1A 3ZT0A 3THWA 2X6NA 2Q36A 2WOMA 2HHHK 3H1QA 1GLBG 3MCPA 3RVCA 4CF1A 2QKBA 2O4GA 1BDGA 3O8MA 4GKJK 4DV2K 3OTOK 1ZC6A 1V4TA 1VQ9N 5KPRA 3NGZA 4BREA 1BIUA 4FM0A 1BU6O 3WQUA 3K9KA 4DSLA 3DXMB 3O9UA 2XY8A 1RT7A 5AQKA 2B6AA 4NB4A 3TI0A 4L8RB 3SUOA 2G8IA 5HL7L 2I7PA 4HTUA 4DQQA 4E7KA 1BGXT 3LDNA 3SAGA 1RTJA 1GOBA 1HLUA 2Q31A 3JAMO 1ZBLA 4RTFD 4WFNL 4WYBA 2G8WA 3MECA 4XIUA 4M7YA 1BOTO 1KVBA 3G25A 3NAEA 1VQ7N 5J2NA 1NOYA 1RTIA 2DY4A 2F96A 4FOIA 4AM7A 3UB5A 2YX6A 3VQ6A 4KHNA 4FK2A 4CHOA 1MA9B 2DPNA 1NK9A 2VYPA 3NH1A 4K8XA 4XH4A 1SKRA 3VF6A 2FBYA 5AQXA 1RILA 3J7ZO 5AZJA 5MLCQ 2QWPA 4KTQA 4LF5K 1S6PA 2ZJRL 5HP1A 1T05A 4B8CA 3S41A 1XWLA 1GOAA 4C8NA 3CM5A 3OYBA 5FLXO 1IO2A 4FZYA 1NKCA 1KAYA 3AVIA 3DLRA 2FF6A 4OPHA 4BRFA 3K0SA 3DWLA 4DU4A 4KI4A 3V6DA 4CJ3A 4JI0K 3CJ9A 3Q7BA 2GUPA 3D2FB 3CQYA 3LALA 3VQDA 5AQFA 3LAMA 5JLFA 4DFJA 3ZSVA 2IVOA 3DRSA 1O1WA 3KJVA 3AV9A 4B3OA 1NGHA 1KVAA 3LANA 3N4QA 2DFEA 1HKCA 4DTNA 3KVGA 2CH6A 1QHTA 2Y1JA 3TAFA 1RT1A 4FJKA 1KRPA 3O1WA 4I7FA 4DS5A 3KLHA 2YKMA 1BQNA 1HYZA 1NK8A 2XY7A 4JHDA 1HPMA 2QXFA 1N34K 3QEWA 4H0TB 1DGKN 3CJBA 3VOVA 5JICA 1VSDA 3VPZA 3C6UA 4PKGA 4YDUC 3EY1A 4CJLA 3T1YK 2NRRA 4NYFA 4BRMA 5KPZA 5M1KA 3L2UA 5ELZA 2O8EA 2D0PA 4MLEA 3WUHA 4BRPA 2UUCK 3AVCA 4CW7B 3IG1A 2QA4N 4N56A 1HNXK 1RDWX 2EWSA 3F73A 1NGIA 3SQ2A 4FJJA 3CQ8A 2HNYA 4CJFA 1MDUB 1S1TA 2FBXA 4WQ5A 3F2KA 2FC0A 5FRNA 4U7BA 3RMAA 1KLNA 3CJCA 3LPUA 4AQYK 3ZSWA 1N32K 1R59O 2P9PB 2QXLA 3M8RA 1S9EA 3P5JA 1NK4A 2NRZA 2ZGYA 1QSYA 2P5GA 1J6ZA 2E2QA 4WCEL 4FWSA 3CJAA 4CFCA 3WXJA 1BO5O 3QIOA 2GUIA 3VEOA 4BRGA 2A41A 5AJ3K 1WSEA 2E2PA 4CJ4A 4BC3A 1OVQA 3L0QA 3TABA 3MX5A 4FWLA 2G8FA 5AQUA 2YHYA 1GLLO 3VEYA 4Z4FA 2D0CA 3VQ5A 1VSFA 3UKUB 3CCJN 1VSMA 4Z4GA 1Q82O 3CCEN 1CZ9A 3PO5A 4ILJA 2ASOA 1J5OA 1JJ2M 4FJXA 3DRRA 1BCOA 4Y1DA 4BDZA 2P9SB 2QTDA 3TSQA 3O4NA 1T7PA 4LSLA 2YJFA 3U3GA 3QLHA 5SZTA 4QAGA 3VENA 4XEIA 4IDKA 1YXQA 1TKDA 2HHQA 3OYIA 1A5WA 4Z4CA 3O9TA 1KLMA 4DQ8A 4B9UA 4YHHK 2QK9A 4RW7A 5BN9A 1CXUA 4CZMA 3LDOA 4TSXA 5E41A 2KZZA 5AQPA 4CF8A 1HJRA 1TVRA 1H1VA 4CK3A 4OKEA 2P9IA 3CJ7A 3MN6A 5FROA 4DQRA 4CJ7A 1G99A 3QDKA 1BI4B 5KRSA 4DFKA 2P9UB 5GAEP 2NRXA 4KRFA 2OYQA 5FPMA 3O6WA 4LD0A 2WBNA 3V81A 3DXMA 4K0KK 4LF8K 4FLTA 3T3FA 3CJ1A 2YHXA 4JI4K 2Y1IA 1SS6A 2HNZA 1HPZA 5AQHA 4IFYA 4OLAA 4BROA 1OVYA 4LSNA 3PX6A 1I39A 2OA8A 4FW1A 4FLUA 1L3TA 3RTVA 1IKWA 1X9MA 3TR8A 4BY9C 4PA1A 3LZJA 3RR8A 3O80A 4DWIA 5I9EB 4CHZA 3OS0A 3QICA 3LPTA 2NRWA 4K42A 2W6LA 2A6AA 3VGMA 3SPZA 5TKYA 5B8HA 1VQKN 2VWKA 1LWEA 4I2QA 3TWHA 4B9NA 4KB0A 3WEEB 4CJSA 1VQ5N 4E1JA 1Q9XA 2PY5A 2OPQA 4KPYA 4C1NI 3O9SA 4AHSA 1K6YA 2ASMA 2IVPA 4CJ5A 3VQ4A 1WLJA 4KHWA 5JS1A 1RTDA 4BR2A 2QM1A 3CC4N 4DV4K 3MK6A 2NNWA 2AP1A 2KFNA 1XHXA 3THYB 3PV8A 3S9HA 1SKSA 3JSMA 3SQ0A 3QETA 3OYDA 2XO7A 1IH7A 2HNDA 4OGEA 2UU9K 3D2FA 1NKEA 4JKGB 4BQLA 4AHUA 1NGGA 3D6RA 3TAPA 2I5JA 3MN7A 4DR2K 1VAZA 5FPEA 2HVHA 4E3SA 5LMUK 1U2VA 1L3UA 2YCHA 3PIPL 1YF5L 4EP4A 3FR0A 4IZ9A 5BRDA 3P38A 5AQRA 3TTDA 3ULEA 2BANA 3VEZA 2VG7A 3E01A 4FOEA 4BR4A 1VSHA 3VESA 3WQTA 4JI3K 3HK2A 4B1ZA 1MU2A 5EOYA 4CGJA 4NO7A 1VQLN 1J53A 3M8QA 3AVBA 4B08A 3P83D 4OJRA 3ZSQA 2WFBA 3VQ8A 1P8ZA 3VERA 3G71N 3OYCA 4O44A 3MEEA 3C6HA 4G1QA 2P1JA 4DTSA 4B9MA 1BIZA 3K5MA 4LY7A 3V1OA 4YNQA 3AVFA 1E4FT 3O3HA 4IOXA 2BUPA 2WC9A 1WNSA 3FFKB 4FWKA 2P9PA 4B3RK 2KKZA 5HRNA 4BRKA 5BPLA 3KHYA 4YDUA 1JLCA 1Y97A 3NF7A 3L2VA 3IAYA 3ZLJA 4OPAA 3AO2A 3ENBA 2JWLA 1GLAG 3VN5A 3DLEA 1FW6A 3FZMA 2F4VK 3J7YP 4ID5A 4AHVA 5AZJB 4CI6A 2W42A 3MN5A 1QZ5A 4CERA 3U8XA 5CR4A 2DTUA 2VGNA 1NWKA 4CJKA 1LV5A 2YI1A 1IKXA 3O1BA 3VQ9A 1S3XA 4BRNA 2B5JA 5J1EA 5AQLA 2E2NA 2UUAK 3O3FA 1S6QA 3DOKA 2HOEA 2P5OA 4F3TA 1EP4A 1ESVA 3W3DA 4CHQA 2O8CB 1I3AA 3ALYA 4HUGA 3I8BA 4FVMA 4A59A 4X64K 3MN9A 5AQQA 4B9VA 1A5VA 4Z94A 4DSJA 3SMPA 3KLGA 4M63C 1R0AA 2KFZA 4WQ5C 4AHRA 3A8YA 4JHDB 2FBTA 1Z25A 3IRXA 4CK1A 5CY4A 4EZ9A 3F5TA 1BI4A 5CYQA 3ZSZA 1VSJA 3VQQA 3LP3A 3ZSRA 2P9UA 2VWJA 4FJMA 3K5LA 4M3XA 4DF8A 4FJIA 1K8KA 4ZHRA 4BRDA 1U49A 3MMVA 3NE6A 4H5NA 5M1OA 5BRFA 3BF1A 4DS4A 2OTJN 4BDPA 4IOAL 2F9TA 2HSTA 2ASPA 4KBOA 2PFUA 3CPWM 4FYDA 3BUZB 1YT3A 3CD6N 1NOZA 4HUFA 4DTJA 2VWBA 4MO4A 3MX2A 1KAZA 4KTZA 1RNHA 4FK0A 2P51A 5KRTA 3S3MA 1HRHA 1JLBA 4W5RA 4YOUA 4Q0BA 4PUOA 3MDQA 3O3GA 3C6AA 4CD1A 2HMIA 1C0GA 3VETA 5J2PA 1HMVA 4FJ7A 4BGAA 4ILHA 2OPSA 4E1MA 1TKTA 4OPJA 4FCYA 2IVNA 3CM6A 3NVKA 1WN7A 1TKXA 3SZ2A 1VQNN 4CGGA 3QEVA 2YJEA 2RPIA 3QNNA 2HW3A 1D4XA 3THVA 3SLCA 4ILGB 2Z1IA 2HBKA 4H8KA 1DEJA 3IKMA 1RDUA 1JXBA 4JI2K 5HRPA 4IOCL 5K14A 4DR4K 3V9SA 4BACA 2PBDA 4CECA 1WSJA 2JLEA 3OJUA 3KLEA 4BVPA 4M3WA 1HNIA 4KV8A 4BR0A 2E88A 1S72N 5DMRA 3MEDA 2YV0X 4Z4HA 3HPHA 2P9IB 3AA4A 3KKSA 4IWVA 3TAGA 1TYQB 1T6CA 3H08A 1JCGA 2ZWHA 3QEPA 1TK5A 4BC2A 4ZTJA 4XH5A 1S9GA 3KD1E 3V9ZA 1RBVA 1RDDA 3SQ4A 4ID1A 3KK7A 3OVNA 1OH6A 1C0FA 3AVAA 3OS1A 3OYEA 4LH4A 5AQYA 5FPNA 3SYZA 1EQYA 3VEWA 1UA0A 2D0AA 4M3RA 3OYKA 3KTQA 3JS6A 1SUQA 1DLOA 1LW2A 4FLWA 5E84A 4F2RA 3CFOA 4FJ9A 4ISGA 1NMDA 4DTOA 1NK7A 4I6MA 1UOCA 3L3VA 1S1XA 4NCBA 3D45A 1HUXA 1S1WA 3VF2A 2HHVA 4R5PA 3LDLA 1YHQN 3A0IX 4HTLA 1RDAA 3P4IA 2ATQA 4CZGA 3C0BA 2VGMA 4YORA 2P9LA 1S1VA 3L2QA 4OGCA 5T7BA 1LW0A 3HM9A 1FJGK 4IG0A 4YOVA 4CHYA 1F21A 4IFVA 2VG5A 5AQTA 3EL2A 1BA0A 5GAHP 1LOTB 3C65A 1VQMN 4KH6A 2NZTA 3KIOA 4CJPA 3V9UA 3U9DA 3DLGA 2YNIA 3ENHA 3DI6A 2D0OA 4CEOA 5GIPA 3ZETA 5JVHL 4FJLA 3DMJA 1Q7YO 4OVLA 5EVZA 3L6QA 3LDPA 3OYMA 1WUAA 3F9KA 3FZKA 5C12A 4DU1A 1SL0A 2P9NA 2O8CA 2W41A 4E19A 3M8PA 3CETA 4UY8O 1DT9A 3G10A 3Q7CA 1UWBA 2YNFA 3R1XA 4BR9A 1Z6RA 1U2VB 5F1XA 4BWJA 1SZ2A 4JD2B 4H4MA 1VQ6N 2FSJA 3CG7A 1KVCA 1X9SA 3QEXA 4IXCA 4O0IA 3ULEB 3VEXA 4CF9A 4F3OA 2A1SA 3HP9A 3D0PA 3VQCA 4A5AA 1VSLA 1TL1A 1QSLA 2OPPA 3L3UA 1RBTA 4FO0A 1EX4A 5GIOA 2LSNA 4F9OA 1BG3A 4EAHD 1RT6A 1YITN 4JI5K 3CCUN 4IEIA 3U4LA 4FJHA 4EHUA 4K41A 4H0PA 4EZ6A 3WT0A 4B1WB 4IFEA 3NVMA 1JLQA 1Q8IA 1KQSM 3ZSOA 4ISFA 1X9WA 1TAQA 4CFDA 3HTVA 4AHCA 3HBTA 2R7YA 1W9HA 2J4RA 1NJIO 3QMLA 4WF9L 3AA3A 4C8MA 1C0UA 2G8VA 1JCFA 4H03B 4CGHA 1WAJA 4CIFA 3QIPA 3M6GA 1WSGA 4DUZK 1P90A 4LF9K 4FWNA 3H6EA 3AVKA 3H3OB 1WAFA 4O4GA 4J2BA 4DQPA 3B6PA 1HNVA 3SNNA 1B92A 1GLDG 3LDQA 3CFRA 4B8AB 4FM1A 5HLFA 5GAGP 3CC2N 3AO4A 1VQ4N 4IO8A 2NLXA 1UAXA 3AVNA 4IDHA 5SWMA 1S5JA 3SV3A 1K8AO 3VGKA 3ITHA 2HB5A 4MDBA 3VMFB 1XNQK 4O5FA 2A3ZA 3OJSA 3CYMA 1C6VA 1QQNA 4CJRA 4KB1A 1GLFO 5E26A 1FKPA 5EX5A 3CCVN 3TU5A 1Q9YA 4Z4IA 1HKBA 4NCGA 4HVJA 4K43A 3EEQA 1N8RO 2EX3A 3DM2A 3P1GA 1OH7A 2PZSA 4E7LA 3NF6A 4FL9A 3J7AP 4LC9B 1TUUA 2O4IA 5BREA 1Q86O 1MWKA 4M3UA 1TYQA 4MQ3A 1J54A 4JI1K 4DU3A 3FZFA 3U6FA 3IFRA 4FPAA 2IGIA 3CI5A 1XMOK 4CJVA 1K8KB 5M1NA 3F9MA 4WE1A 3V9XA 2NRTA 4IKFA 3C6TA 4WQ4A 3KWIA 3NF8A 1Z26A 3AA5X 2QEXN 3T1AA 4F4KA 3BP8A 5HRSA 4CD3A 2QI2A 4KHSA 1X3NA 1XNRK 2P9KB 3CFPA 3EZWA 1O13A 1ATNA 3QEIA 3DRPA 2E2OA 4YOYA 1HYVA 1BUPA 3EE9A 4H0OA 3CXCM 4KH5A 3SAFA 2CGJA 2E1ZA 3HVTA 5KTQA 4DMNA 3G4SN 4CJQA 2HHUA 1WBDA 3C7NB 3CCRN
chains in the Genus database with same CATH topology
3U3YA 3VQ9A 2B5JA 5J1EA 3ZCMA 3KLIA 5C25A 1XI1A 5CZ2A 3LP1A 4JRPA 4Q5VA 4M3YA 4W5TA 2DFFA 4FLZA 3O3FA 1YTUA 1S6QA 4OKKA 2Q3SA 3DOKA 2D0BA 2P5OA 4KAZA 4KHUA 4F3TA 1EP4A 4M41A 1TAUA 1JKHA 1QSSA 4CHQA 2F8TA 2QKKA 2IDOA 1C1BA 2BE2A 1TV6A 1JLEA 1KTQA 3ZT0A 2X6NA 4BE1A 2WOMA 3PY8A 1I3AA 3ALYA 3HSTB 4CF1A 3DOLA 4FVMA 1ZBUA 2IAJA 4HUGA 3TARA 2HHSA 2QKBA 2O4GA 3B6OA 3ASMA 4B9VA 1A5VA 4Z0UA 1LWFA 3V1RA 3NGZA 4DSJA 2XY6A 1BIUA 4FM0A 3KLGA 1R0AA 3HVRA 3SV4A 2KFZA 3VQPA 4KHYA 3QERA 4YFUA 4DSLA 3PO4A 4LH5A 4AHRA 2XY8A 1RT7A 4CGFA 2FBTA 2B6AA 4DTUA 4M3TA 3TI0A 1RDBA 4RW9A 4FJGA 4L8RB 3SUOA 1JL1A 2G8IA 1Z25A 4OPKA 4HTUA 3IRXA 4E7KA 4DQQA 1SV5A 2Z1JA 1ASUA 1BGXT 5CY4A 4CK1A 1U47A 3RRGA 4EZ9A 1BI4A 1JLGA 4FJ9A 3KKRA 3K2PA 5CYQA 3ZSZA 1VSJA 3VQQA 4CGIA 5CZ1A 1RTJA 4CFBA 3LP3A 1GOBA 3ZSRA 3NH2A 1ZYQA 1KFSA 2VWJA 1ZBLA 4FJMA 3K5LA 4M3XA 2BGGA 1NK6A 4DF8A 4FJIA 2G8WA 4ZHRA 2X74A 3MECA 1U49A 4XIUA 2AJQA 1KVBA 4HUEA 3NE6A 3LP0A 3NAEA 3EZ5A 4DS4A 5J2NA 1NOYA 4N41A 1C0TA 1RTIA 3NH0A 2DY4A 2F96A 4BDPA 4OLBA 5C42A 3K58A 3VQ6A 4KHNA 4GMJB 4FK2A 3S3NA 4CHOA 4FYDA 1NK9A 1HYSA 1ASVA 4IBNA 1YT3A 5KI6A 3V9WA 3S3OA 1NOZA 3NH1A 4HHTA 4K8XA 3HO1A 1LWCA 4MFBA 1SKRA 4CEQA 4HUFA 4DTJA 2FBYA 1RILA 4DQSA 5D3GA 4KTZA 4GVMA 1RNHA 4FK0A 2P51A 1NJYA 4KTQA 3EYZA 4CJUA 1S6PA 5HP1A 3PUFA 1T05A 2ITGA 4B8CA 3SQ1A 1XWLA 5KRTA 1GOAA 3S3MA 1HRHA 1JLBA 4C8NA 3CM5A 4B9LA 1VK0A 4W5RA 1QS4A 5J2QA 3OYBA 1GOCA 1IO2A 1NJZA 1NKCA 4FZYA 3AVIA 3DLRA 4PUOA 4KI4A 4Q0BA 4DU4A 3O3GA 3V6DA 3SUNA 1HQUA 2HMIA 4O0JA 4CJ3A 2ZE2A 4H4OA 1U4BA 3RR7A 5J2PA 1HMVA 4FJ7A 4O5BA 3RMDA 2OPSA 4E1MA 4E7JA 3AO1A 1TKTA 4OPJA 4FCYA 3CM6A 4CF0A 1WN7A 3VQDA 3LALA 3I8DA 3T19A 1X1PA 1TKXA 3LAMA 3SZ2A 3ZSVA 4CGGA 4DFJA 1KSPA 2B4JA 3DRSA 1SL2A 3QEVA 1O1WA 3I0SA 3KJVA 3AV9A 4B9TA 4B3OA 2D5RA 2RPIA 3DLBA 2HVIA 3QNNA 1KVAA 2JGUA 3LANA 2HW3A 2DFEA 3THVA 4DTNA 4FXDA 1WSFA 1QHTA 2Y1JA 3TAFA 1RT1A 1FXXA 3LZIA 4FJKA 1UA1A 3AO3A 5KGXA 2Z1IA 4I7FA 3QNOA 4H8KA 1KRPA 4DS5A 2YNHA 3C95A 3KLHA 4BE2A 2KZMA 1JXBA 2YKMA 5HRPA 1BQNA 1HYZA 5K14A 1NK8A 4NCAA 3K59A 1RCHA 4BACA 3V9SA 1ZBHA 4CECA 1WSJA 2JLEA 5FDLA 2XY7A 3OJUA 1XC9A 4DSKA 2QXFA 2HHXA 3KLEA 3QEWA 4FLXA 3AVGA 1TK8A 1CLQA 4FZZA 1VSDA 1DTTA 3C6UA 1BQMA 1HNIA 4M3WA 2F8SA 4KV8A 5JS2A 3EY1A 4DLEA 1FK9A 3TAEA 4CJLA 5DMRA 4NYFA 3MEDA 1QTMA 2YV0X 4DSFA 4Z4HA 1IKYA 3L2UA 3HPHA 4JLHA 4W5QA 4FJ5A 3AA4A 4F2SA 3KKSA 2FBVA 3TAGA 1D5AA 3H08A 2OZMA 3AVCA 2KW4A 1BL3A 3NCIA 4W5OA 4DG1A 3IG1A 3QEPA 1TK5A 2KTQA 4N56A 4ZTJA 1S9GA 3KD1E 3F73A 3V9ZA 2G8KA 5DK5A 3SQ2A 1RBVA 3VQBA 1NJWA 1RDDA 3CQ8A 4FJJA 2HNYA 4CJFA 4ID1A 3SQ4A 1S1TA 3OVNA 4CESA 2FBXA 3RMBA 1SKWA 1N6QA 4JS4A 2FC0A 2G8UA 3AVAA 5FRNA 1WSHA 3RMAA 4CEZA 1KLNA 3OS1A 3AVMA 3OYEA 4FLVA 4LH4A 3LPUA 3SUQA 5I3UA 2Z1HA 4ELTA 4DSEA 1YVUA 3ZSWA 1RT5A 3IS9A 3M8RA 3SYZA 4J2EA 1S9EA 1IKVA 1UA0A 3P5JA 2D0AA 1NK4A 4M3RA 4I9QA 3L2WA 3OYKA 3KTQA 4Z4EA 1QSYA 1SUQA 2P5GA 4KKOA 1A5XA 1DLOA 1LW2A 2IS3A 3NGYA 4FLWA 4CFCA 3VA0A 3LWLA 1J9AA 4GW6A 3CFOA 4F2RA 1HQEA 3OS2A 3SUPA 3K5NA 3QIOA 4CK2A 2GUIA 1NJXA 4C8LA 4DTOA 1NK7A 4KI6A 4OKJA 4QOZB 1UOCA 1WSEA 3L3VA 1REVA 1S1XA 4CJ4A 3RRHA 4ZTFA 1ZBFA 2RN2A 3K5OA 4NCBA 3D45A 1S1WA 3TABA 2NUBA 2HHVA 3MXJA 4DF4A 4R5PA 2VG6A 4CIGA 2G8FA 4CCHA 3DYAA 1RDAA 4N76A 2ATQA 4Z4FA 3OYJA 2D0CA 3VQ5A 1VSFA 3QO9A 3WNHA 4AHTA 1VSMA 1NK0A 2YNGA 4Z4GA 3NHGA 1RBUA 1CZ9A 1S1VA 3L2QA 4I2PA 3PO5A 4FJXA 1J5OA 4OGCA 3DRRA 5T7BA 1BCOA 1LW0A 3HM9A 4Y1DA 4BDZA 4CEFA 4IG0A 1BCMA 3O4NA 3ZT4A 4LSLA 1T7PA 3KD5E 4DTRA 4FJNA 3MAQA 1NK5A 2PYLA 4CHYA 1RBRA 2X6SA 1F21A 4IFVA 3VQEA 4M3ZA 2VG5A 1L5UA 1D9DA 5KGWA 3U3GA 3QLHA 5SZTA 4QAGA 4BDYA 4DSIA 3TAQA 2WONA 1JL2A 3OYNA 1ZBIA 4IDKA 1LAWA 1TKDA 2HHQA 5EU7A 3OYIA 3AVLA 3KIOA 4CJPA 1A5WA 1BHLA 1ITGA 4M45A 1VSEA 4Z4CA 3V9UA 1KLMA 1C1CA 4CHNA 4DLGA 4B9UA 3DLGA 2YNIA 2QK9A 4BWMA 3DI6A 4RW7A 3K57A 1CXUA 4CEOA 4TSXA 5E41A 2KZZA 4CF8A 1KFDA 4KREA 3QINA 3KLFA 1HJRA 1TVRA 3DMJA 4FJLA 4OVLA 4CK3A 4CE9A 1W0HA 4KFBA 5HRRA 3KK3A 3V1QA 4OKEA 3OYMA 4EP5A 3RMCA 3F9KA 5FROA 4W5NA 4DQRA 1VRTA 4DU1A 1SL0A 4DTMA 2OZSA 1BI4B 2IC3A 1QE1A 3LP2A 3M8PA 4E19A 5KRSA 1U48A 3G10A 4DFKA 4I9LA 1UWBA 2YNFA 1TL3A 4KRFA 4BWJA 4O55A 4H4MA 2OYQA 1B9DA 2ETJA 4LD0A 3CG7A 1KVCA 4B9SA 2RKIA 1RDCA 1X9SA 3C94A 3V81A 1VSKA 3QEXA 4C8OA 3MXIA 3NBPA 4O0IA 4FLTA 3T3FA 1ASWA 4RW6A 2Y1IA 4QCLA 3G0ZA 1KCFA 2HNZA 1HPZA 4NYNA 4CF9A 4F3OA 2A1SA 4IFYA 4E0DA 4K8ZA 4OLAA 4LSNA 3PX6A 1I39A 3HL8A 3HP9A 3VQCA 4FW1A 3OYHA 3D0PA 4FLUA 2OA8A 4J2BA 1L3TA 1VSLA 3VQAA 3RTVA 4RW4A 1T8EA 1TL1A 1IKWA 1DTQA 1QSLA 5FRMA 1NKBA 3DLHA 2OPPA 1X9MA 4CEBA 3L3UA 1RBTA 5HBMA 1EX4A 2Z1GA 3WNGA 3OYGA 2EHGA 3TR8A 2GV9A 3HYFA 1T03A 4PA1A 3LZJA 2LSNA 1IG9A 3V4IA 2XY5A 3RR8A 1RT6A 2E6LA 3NF9A 4CHZA 1JLAA 3OS0A 4DWIA 4DFMA 3O4QA 4KHQA 3LPTA 4FJHA 1TK0A 4CHPA 2ZD1A 4CIEA 4F8RA 3DLKA 4EZ6A 3AVHA 3SPZA 3BGRA 3OYLA 4AILC 4J2AA 2E4LA 2PYJA 2VWKA 4E89A 1LWEA 4I2QA 1JLQA 3TWHA 4FM2A 3HXMA 2DFHA 4CJSA 1Q8IA 4B9NA 4C8KA 4KB0A 1Q9XA 1YTAA 2OPQA 3JYTA 2PY5A 3ZSOA 1TKZA 1N5YA 4KPYA 4J2DA 1CZBA 1X9WA 1TAQA 4CFDA 4AHCA 4PWDA 4AHSA 2XHBA 1W9HA 3LAKA 2R7YA 4ELUA 1K6YA 5I42A 4RG8A 3AA3A 4C8MA 1C0UA 3MEGA 2G8VA 4CJ5A 3VQ4A 1WLJA 4KHWA 4CGHA 4CEEA 1WAJA 4CIFA 5JS1A 3QIPA 2A1RA 1EETA 1B9FA 1JXEA 1WSGA 4CEDA 3A2FA 1RTDA 1D8YA 3AA2A 3OY9A 3AVKA 1C0MA 2HHTA 2KFNA 1WAFA 2IOCA 4O4GA 4Y1CA 1XHXA 4N47A 5HROA 4DQPA 4DQIA 3B6PA 1RTHA 3PV8A 3S9HA 1HNVA 3JSMA 3SNNA 4FW2A 3SQ0A 1SKSA 1B92A 3OYDA 3M8SA 3QETA 3SPYA 1VSIA 4CF2A 1RT3A 2XO7A 1IH7A 3HPOA 3CFRA 4B8AB 4FM1A 5HLFA 2HNDA 4OGEA 3TAMA 1LAVA 1NKEA 3AO4A 4AHUA 1QQCA 3HP6A 3TAPA 2I5JA 4CGDA 1CXQA 4DTXA 3AVJA 4FJ8A 3ZT2A 3HPGA 3LWMA 4CEAA 3QESA 3SI6A 3SJJA 1UAXA 3AVNA 3PX0A 4KO0A 5SWMA 4JS5A 1S5JA 3SV3A 3SCXA 2HVHA 4E3SA 3L8BA 3ITHA 2HB5A 1S1UA 1U04A 2RF2A 4PY5A 1L3SA 3OJSA 3CYMA 1C6VA 1L3UA 4FK4A 4CJRA 4KB1A 1RT4A 3NFAA 4DFPA 5C24A 4EP4A 3L2RA 2KQ2A 1FKPA 1LV5A 2GBZA 3ZT3A 5CYMA 4CJWA 3LDSA 1EXQA 1Q9YA 4PQUA 1BISA 2BANA 4KTWA 4M42A 2VG7A 1RT2A 4Z4IA 3E01A 1U45A 4NCGA 4HVJA 1C1AA 4HCCA 1VSHA 1FKOA 3ISNC 3ZSXA 1EKEA 2EX3A 3HK2A 3DM2A 1MU2A 3P1GA 2PZSA 3FFIA 2YHBA 3NF6A 3NDKA 4E7LA 3VA3A 1VRUA 4CGJA 1J53A 3M8QA 3AVBA 4ICLA 3P83D 4B08A 2O4IA 4OJRA 3ZSQA 4M3UA 4MQ3A 3VQ8A 2BDPA 1J54A 3OYCA 1XHZA 4FLYA 2HHWA 2OPRA 3WNFA 4DU3A 3WNEA 3ZT1A 4E7IA 1RBSA 4O44A 5J2MA 4N5SA 3U6FA 3MEEA 3TANA 4G1QA 1G15A 2P1JA 1WSIA 4DTSA 4B9MA 1BIZA 3OYAA 3K5MA 2IGIA 4LY7A 4CJVA 4UQGA 3V1OA 4E7HA 4WE1A 4YNQA 3AVFA 2YHAA 3V9XA 4IKFA 2G8HA 2E6MA 3C6TA 3O3HA 4ELVA 1TGOA 2XRIA 3NF8A 1Z26A 3AA5X 3PX4A 3T1AA 1WNSA 4BE0A 3KK1A 3AO5A 4F4KA 5HRNA 4JRQA 2X78A 5HRSA 3MXMA 4KHSA 1JLCA 1Y97A 3NF7A 3HT3A 3L2VA 3CFPA 3IAYA 3AO2A 3ZSYA 3RWUA 3VN5A 4CJEA 3DLEA 4DTPA 1SL1A 3HJFA 3ULDA 4ID5A 4AHVA 1L3VA 4E1NA 4CJTA 3QEIA 3DRPA 3I0RA 3VQ7A 1HYVA 3OYFA 2W42A 2ZQBA 3NGIA 4FZXC 4IG3A 4RW8A 4AH9A 3HVTA 4CERA 1D9FA 3BDPA 5KTQA 1JLFA 3UIQA 4DMNA 4CFAA 2YKNA 4CJQA 4HCBA 2HHUA 2DTUA 3KK2A 4CJKA 1IKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3Y A;  3VQ9 A;  2B5J A;  5J1E A;  3ZCM A;  3KLI A;  5C25 A;  1XI1 A;  5CZ2 A;  3LP1 A;  4JRP A;  4Q5V A;  4M3Y A;  4W5T A;  2DFF A;  4FLZ A;  3O3F A;  1YTU A;  1S6Q A;  4OKK A;  2Q3S A;  3DOK A;  2D0B A;  2P5O A;  4KAZ A;  4KHU A;  4F3T A;  1EP4 A;  4M41 A;  1TAU A;  1JKH A;  1QSS A;  4CHQ A;  2F8T A;  2QKK A;  2IDO A;  1C1B A;  2BE2 A;  1TV6 A;  1JLE A;  1KTQ A;  3ZT0 A;  2X6N A;  4BE1 A;  2WOM A;  3PY8 A;  1I3A A;  3ALY A;  3HST B;  4CF1 A;  3DOL A;  4FVM A;  1ZBU A;  2IAJ A;  4HUG A;  3TAR A;  2HHS A;  2QKB A;  2O4G A;  3B6O A;  3ASM A;  4B9V A;  1A5V A;  4Z0U A;  1LWF A;  3V1R A;  3NGZ A;  4DSJ A;  2XY6 A;  1BIU A;  4FM0 A;  3KLG A;  1R0A A;  3HVR A;  3SV4 A;  2KFZ A;  3VQP A;  4KHY A;  3QER A;  4YFU A;  4DSL A;  3PO4 A;  4LH5 A;  4AHR A;  2XY8 A;  1RT7 A;  4CGF A;  2FBT A;  2B6A A;  4DTU A;  4M3T A;  3TI0 A;  1RDB A;  4RW9 A;  4FJG A;  4L8R B;  3SUO A;  1JL1 A;  2G8I A;  1Z25 A;  4OPK A;  4HTU A;  3IRX A;  4E7K A;  4DQQ A;  1SV5 A;  2Z1J A;  1ASU A;  1BGX T;  5CY4 A;  4CK1 A;  1U47 A;  3RRG A;  4EZ9 A;  1BI4 A;  1JLG A;  4FJ9 A;  3KKR A;  3K2P A;  5CYQ A;  3ZSZ A;  1VSJ A;  3VQQ A;  4CGI A;  5CZ1 A;  1RTJ A;  4CFB A;  3LP3 A;  1GOB A;  3ZSR A;  3NH2 A;  1ZYQ A;  1KFS A;  2VWJ A;  1ZBL A;  4FJM A;  3K5L A;  4M3X A;  2BGG A;  1NK6 A;  4DF8 A;  4FJI A;  2G8W A;  4ZHR A;  2X74 A;  3MEC A;  1U49 A;  4XIU A;  2AJQ A;  1KVB A;  4HUE A;  3NE6 A;  3LP0 A;  3NAE A;  3EZ5 A;  4DS4 A;  5J2N A;  1NOY A;  4N41 A;  1C0T A;  1RTI A;  3NH0 A;  2DY4 A;  2F96 A;  4BDP A;  4OLB A;  5C42 A;  3K58 A;  3VQ6 A;  4KHN A;  4GMJ B;  4FK2 A;  3S3N A;  4CHO A;  4FYD A;  1NK9 A;  1HYS A;  1ASV A;  4IBN A;  1YT3 A;  5KI6 A;  3V9W A;  3S3O A;  1NOZ A;  3NH1 A;  4HHT A;  4K8X A;  3HO1 A;  1LWC A;  4MFB A;  1SKR A;  4CEQ A;  4HUF A;  4DTJ A;  2FBY A;  1RIL A;  4DQS A;  5D3G A;  4KTZ A;  4GVM A;  1RNH A;  4FK0 A;  2P51 A;  1NJY A;  4KTQ A;  3EYZ A;  4CJU A;  1S6P A;  5HP1 A;  3PUF A;  1T05 A;  2ITG A;  4B8C A;  3SQ1 A;  1XWL A;  5KRT A;  1GOA A;  3S3M A;  1HRH A;  1JLB A;  4C8N A;  3CM5 A;  4B9L A;  1VK0 A;  4W5R A;  1QS4 A;  5J2Q A;  3OYB A;  1GOC A;  1IO2 A;  1NJZ A;  1NKC A;  4FZY A;  3AVI A;  3DLR A;  4PUO A;  4KI4 A;  4Q0B A;  4DU4 A;  3O3G A;  3V6D A;  3SUN A;  1HQU A;  2HMI A;  4O0J A;  4CJ3 A;  2ZE2 A;  4H4O A;  1U4B A;  3RR7 A;  5J2P A;  1HMV A;  4FJ7 A;  4O5B A;  3RMD A;  2OPS A;  4E1M A;  4E7J A;  3AO1 A;  1TKT A;  4OPJ A;  4FCY A;  3CM6 A;  4CF0 A;  1WN7 A;  3VQD A;  3LAL A;  3I8D A;  3T19 A;  1X1P A;  1TKX A;  3LAM A;  3SZ2 A;  3ZSV A;  4CGG A;  4DFJ A;  1KSP A;  2B4J A;  3DRS A;  1SL2 A;  3QEV A;  1O1W A;  3I0S A;  3KJV A;  3AV9 A;  4B9T A;  4B3O A;  2D5R A;  2RPI A;  3DLB A;  2HVI A;  3QNN A;  1KVA A;  2JGU A;  3LAN A;  2HW3 A;  2DFE A;  3THV A;  4DTN A;  4FXD A;  1WSF A;  1QHT A;  2Y1J A;  3TAF A;  1RT1 A;  1FXX A;  3LZI A;  4FJK A;  1UA1 A;  3AO3 A;  5KGX A;  2Z1I A;  4I7F A;  3QNO A;  4H8K A;  1KRP A;  4DS5 A;  2YNH A;  3C95 A;  3KLH A;  4BE2 A;  2KZM A;  1JXB A;  2YKM A;  5HRP A;  1BQN A;  1HYZ A;  5K14 A;  1NK8 A;  4NCA A;  3K59 A;  1RCH A;  4BAC A;  3V9S A;  1ZBH A;  4CEC A;  1WSJ A;  2JLE A;  5FDL A;  2XY7 A;  3OJU A;  1XC9 A;  4DSK A;  2QXF A;  2HHX A;  3KLE A;  3QEW A;  4FLX A;  3AVG A;  1TK8 A;  1CLQ A;  4FZZ A;  1VSD A;  1DTT A;  3C6U A;  1BQM A;  1HNI A;  4M3W A;  2F8S A;  4KV8 A;  5JS2 A;  3EY1 A;  4DLE A;  1FK9 A;  3TAE A;  4CJL A;  5DMR A;  4NYF A;  3MED A;  1QTM A;  2YV0 X;  4DSF A;  4Z4H A;  1IKY A;  3L2U A;  3HPH A;  4JLH A;  4W5Q A;  4FJ5 A;  3AA4 A;  4F2S A;  3KKS A;  2FBV A;  3TAG A;  1D5A A;  3H08 A;  2OZM A;  3AVC A;  2KW4 A;  1BL3 A;  3NCI A;  4W5O A;  4DG1 A;  3IG1 A;  3QEP A;  1TK5 A;  2KTQ A;  4N56 A;  4ZTJ A;  1S9G A;  3KD1 E;  3F73 A;  3V9Z A;  2G8K A;  5DK5 A;  3SQ2 A;  1RBV A;  3VQB A;  1NJW A;  1RDD A;  3CQ8 A;  4FJJ A;  2HNY A;  4CJF A;  4ID1 A;  3SQ4 A;  1S1T A;  3OVN A;  4CES A;  2FBX A;  3RMB A;  1SKW A;  1N6Q A;  4JS4 A;  2FC0 A;  2G8U A;  3AVA A;  5FRN A;  1WSH A;  3RMA A;  4CEZ A;  1KLN A;  3OS1 A;  3AVM A;  3OYE A;  4FLV A;  4LH4 A;  3LPU A;  3SUQ A;  5I3U A;  2Z1H A;  4ELT A;  4DSE A;  1YVU A;  3ZSW A;  1RT5 A;  3IS9 A;  3M8R A;  3SYZ A;  4J2E A;  1S9E A;  1IKV A;  1UA0 A;  3P5J A;  2D0A A;  1NK4 A;  4M3R A;  4I9Q A;  3L2W A;  3OYK A;  3KTQ A;  4Z4E A;  1QSY A;  1SUQ A;  2P5G A;  4KKO A;  1A5X A;  1DLO A;  1LW2 A;  2IS3 A;  3NGY A;  4FLW A;  4CFC A;  3VA0 A;  3LWL A;  1J9A A;  4GW6 A;  3CFO A;  4F2R A;  1HQE A;  3OS2 A;  3SUP A;  3K5N A;  3QIO A;  4CK2 A;  2GUI A;  1NJX A;  4C8L A;  4DTO A;  1NK7 A;  4KI6 A;  4OKJ A;  4QOZ B;  1UOC A;  1WSE A;  3L3V A;  1REV A;  1S1X A;  4CJ4 A;  3RRH A;  4ZTF A;  1ZBF A;  2RN2 A;  3K5O A;  4NCB A;  3D45 A;  1S1W A;  3TAB A;  2NUB A;  2HHV A;  3MXJ A;  4DF4 A;  4R5P A;  2VG6 A;  4CIG A;  2G8F A;  4CCH A;  3DYA A;  1RDA A;  4N76 A;  2ATQ A;  4Z4F A;  3OYJ A;  2D0C A;  3VQ5 A;  1VSF A;  3QO9 A;  3WNH A;  4AHT A;  1VSM A;  1NK0 A;  2YNG A;  4Z4G A;  3NHG A;  1RBU A;  1CZ9 A;  1S1V A;  3L2Q A;  4I2P A;  3PO5 A;  4FJX A;  1J5O A;  4OGC A;  3DRR A;  5T7B A;  1BCO A;  1LW0 A;  3HM9 A;  4Y1D A;  4BDZ A;  4CEF A;  4IG0 A;  1BCM A;  3O4N A;  3ZT4 A;  4LSL A;  1T7P A;  3KD5 E;  4DTR A;  4FJN A;  3MAQ A;  1NK5 A;  2PYL A;  4CHY A;  1RBR A;  2X6S A;  1F21 A;  4IFV A;  3VQE A;  4M3Z A;  2VG5 A;  1L5U A;  1D9D A;  5KGW A;  3U3G A;  3QLH A;  5SZT A;  4QAG A;  4BDY A;  4DSI A;  3TAQ A;  2WON A;  1JL2 A;  3OYN A;  1ZBI A;  4IDK A;  1LAW A;  1TKD A;  2HHQ A;  5EU7 A;  3OYI A;  3AVL A;  3KIO A;  4CJP A;  1A5W A;  1BHL A;  1ITG A;  4M45 A;  1VSE A;  4Z4C A;  3V9U A;  1KLM A;  1C1C A;  4CHN A;  4DLG A;  4B9U A;  3DLG A;  2YNI A;  2QK9 A;  4BWM A;  3DI6 A;  4RW7 A;  3K57 A;  1CXU A;  4CEO A;  4TSX A;  5E41 A;  2KZZ A;  4CF8 A;  1KFD A;  4KRE A;  3QIN A;  3KLF A;  1HJR A;  1TVR A;  3DMJ A;  4FJL A;  4OVL A;  4CK3 A;  4CE9 A;  1W0H A;  4KFB A;  5HRR A;  3KK3 A;  3V1Q A;  4OKE A;  3OYM A;  4EP5 A;  3RMC A;  3F9K A;  5FRO A;  4W5N A;  4DQR A;  1VRT A;  4DU1 A;  1SL0 A;  4DTM A;  2OZS A;  1BI4 B;  2IC3 A;  1QE1 A;  3LP2 A;  3M8P A;  4E19 A;  5KRS A;  1U48 A;  3G10 A;  4DFK A;  4I9L A;  1UWB A;  2YNF A;  1TL3 A;  4KRF A;  4BWJ A;  4O55 A;  4H4M A;  2OYQ A;  1B9D A;  2ETJ A;  4LD0 A;  3CG7 A;  1KVC A;  4B9S A;  2RKI A;  1RDC A;  1X9S A;  3C94 A;  3V81 A;  1VSK A;  3QEX A;  4C8O A;  3MXI A;  3NBP A;  4O0I A;  4FLT A;  3T3F A;  1ASW A;  4RW6 A;  2Y1I A;  4QCL A;  3G0Z A;  1KCF A;  2HNZ A;  1HPZ A;  4NYN A;  4CF9 A;  4F3O A;  2A1S A;  4IFY A;  4E0D A;  4K8Z A;  4OLA A;  4LSN A;  3PX6 A;  1I39 A;  3HL8 A;  3HP9 A;  3VQC A;  4FW1 A;  3OYH A;  3D0P A;  4FLU A;  2OA8 A;  4J2B A;  1L3T A;  1VSL A;  3VQA A;  3RTV A;  4RW4 A;  1T8E A;  1TL1 A;  1IKW A;  1DTQ A;  1QSL A;  5FRM A;  1NKB A;  3DLH A;  2OPP A;  1X9M A;  4CEB A;  3L3U A;  1RBT A;  5HBM A;  1EX4 A;  2Z1G A;  3WNG A;  3OYG A;  2EHG A;  3TR8 A;  2GV9 A;  3HYF A;  1T03 A;  4PA1 A;  3LZJ A;  2LSN A;  1IG9 A;  3V4I A;  2XY5 A;  3RR8 A;  1RT6 A;  2E6L A;  3NF9 A;  4CHZ A;  1JLA A;  3OS0 A;  4DWI A;  4DFM A;  3O4Q A;  4KHQ A;  3LPT A;  4FJH A;  1TK0 A;  4CHP A;  2ZD1 A;  4CIE A;  4F8R A;  3DLK A;  4EZ6 A;  3AVH A;  3SPZ A;  3BGR A;  3OYL A;  4AIL C;  4J2A A;  2E4L A;  2PYJ A;  2VWK A;  4E89 A;  1LWE A;  4I2Q A;  1JLQ A;  3TWH A;  4FM2 A;  3HXM A;  2DFH A;  4CJS A;  1Q8I A;  4B9N A;  4C8K A;  4KB0 A;  1Q9X A;  1YTA A;  2OPQ A;  3JYT A;  2PY5 A;  3ZSO A;  1TKZ A;  1N5Y A;  4KPY A;  4J2D A;  1CZB A;  1X9W A;  1TAQ A;  4CFD A;  4AHC A;  4PWD A;  4AHS A;  2XHB A;  1W9H A;  3LAK A;  2R7Y A;  4ELU A;  1K6Y A;  5I42 A;  4RG8 A;  3AA3 A;  4C8M A;  1C0U A;  3MEG A;  2G8V A;  4CJ5 A;  3VQ4 A;  1WLJ A;  4KHW A;  4CGH A;  4CEE A;  1WAJ A;  4CIF A;  5JS1 A;  3QIP A;  2A1R A;  1EET A;  1B9F A;  1JXE A;  1WSG A;  4CED A;  3A2F A;  1RTD A;  1D8Y A;  3AA2 A;  3OY9 A;  3AVK A;  1C0M A;  2HHT A;  2KFN A;  1WAF A;  2IOC A;  4O4G A;  4Y1C A;  1XHX A;  4N47 A;  5HRO A;  4DQP A;  4DQI A;  3B6P A;  1RTH A;  3PV8 A;  3S9H A;  1HNV A;  3JSM A;  3SNN A;  4FW2 A;  3SQ0 A;  1SKS A;  1B92 A;  3OYD A;  3M8S A;  3QET A;  3SPY A;  1VSI A;  4CF2 A;  1RT3 A;  2XO7 A;  1IH7 A;  3HPO A;  3CFR A;  4B8A B;  4FM1 A;  5HLF A;  2HND A;  4OGE A;  3TAM A;  1LAV A;  1NKE A;  3AO4 A;  4AHU A;  1QQC A;  3HP6 A;  3TAP A;  2I5J A;  4CGD A;  1CXQ A;  4DTX A;  3AVJ A;  4FJ8 A;  3ZT2 A;  3HPG A;  3LWM A;  4CEA A;  3QES A;  3SI6 A;  3SJJ A;  1UAX A;  3AVN A;  3PX0 A;  4KO0 A;  5SWM A;  4JS5 A;  1S5J A;  3SV3 A;  3SCX A;  2HVH A;  4E3S A;  3L8B A;  3ITH A;  2HB5 A;  1S1U A;  1U04 A;  2RF2 A;  4PY5 A;  1L3S A;  3OJS A;  3CYM A;  1C6V A;  1L3U A;  4FK4 A;  4CJR A;  4KB1 A;  1RT4 A;  3NFA A;  4DFP A;  5C24 A;  4EP4 A;  3L2R A;  2KQ2 A;  1FKP A;  1LV5 A;  2GBZ A;  3ZT3 A;  5CYM A;  4CJW A;  3LDS A;  1EXQ A;  1Q9Y A;  4PQU A;  1BIS A;  2BAN A;  4KTW A;  4M42 A;  2VG7 A;  1RT2 A;  4Z4I A;  3E01 A;  1U45 A;  4NCG A;  4HVJ A;  1C1A A;  4HCC A;  1VSH A;  1FKO A;  3ISN C;  3ZSX A;  1EKE A;  2EX3 A;  3HK2 A;  3DM2 A;  1MU2 A;  3P1G A;  2PZS A;  3FFI A;  2YHB A;  3NF6 A;  3NDK A;  4E7L A;  3VA3 A;  1VRU A;  4CGJ A;  1J53 A;  3M8Q A;  3AVB A;  4ICL A;  3P83 D;  4B08 A;  2O4I A;  4OJR A;  3ZSQ A;  4M3U A;  4MQ3 A;  3VQ8 A;  2BDP A;  1J54 A;  3OYC A;  1XHZ A;  4FLY A;  2HHW A;  2OPR A;  3WNF A;  4DU3 A;  3WNE A;  3ZT1 A;  4E7I A;  1RBS A;  4O44 A;  5J2M A;  4N5S A;  3U6F A;  3MEE A;  3TAN A;  4G1Q A;  1G15 A;  2P1J A;  1WSI A;  4DTS A;  4B9M A;  1BIZ A;  3OYA A;  3K5M A;  2IGI A;  4LY7 A;  4CJV A;  4UQG A;  3V1O A;  4E7H A;  4WE1 A;  4YNQ A;  3AVF A;  2YHA A;  3V9X A;  4IKF A;  2G8H A;  2E6M A;  3C6T A;  3O3H A;  4ELV A;  1TGO A;  2XRI A;  3NF8 A;  1Z26 A;  3AA5 X;  3PX4 A;  3T1A A;  1WNS A;  4BE0 A;  3KK1 A;  3AO5 A;  4F4K A;  5HRN A;  4JRQ A;  2X78 A;  5HRS A;  3MXM A;  4KHS A;  1JLC A;  1Y97 A;  3NF7 A;  3HT3 A;  3L2V A;  3CFP A;  3IAY A;  3AO2 A;  3ZSY A;  3RWU A;  3VN5 A;  4CJE A;  3DLE A;  4DTP A;  1SL1 A;  3HJF A;  3ULD A;  4ID5 A;  4AHV A;  1L3V A;  4E1N A;  4CJT A;  3QEI A;  3DRP A;  3I0R A;  3VQ7 A;  1HYV A;  3OYF A;  2W42 A;  2ZQB A;  3NGI A;  4FZX C;  4IG3 A;  4RW8 A;  4AH9 A;  3HVT A;  4CER A;  1D9F A;  3BDP A;  5KTQ A;  1JLF A;  3UIQ A;  4DMN A;  4CFA A;  2YKN A;  4CJQ A;  4HCB A;  2HHU A;  2DTU A;  3KK2 A;  4CJK A;  1IKX A; 
#chains in the Genus database with same CATH topology
 5GIN A;  3HZ6 A;  3KLI A;  3LP1 A;  2QWM A;  4JRP A;  4Q5V A;  1HJO A;  2DFF A;  4H0Y B;  3QFU A;  1JKH A;  3QBX A;  1C1B A;  1KTQ A;  4BRI A;  2D1K A;  2GEL A;  3TAR A;  3DOL A;  4MO5 A;  2IAJ A;  4NLC A;  2FLO A;  3R9P A;  3B6O A;  1ILY A;  3ASM A;  4Z0U A;  4M7X A;  1SQK A;  3SV4 A;  4KHY A;  4YOX A;  3QER A;  4YFU A;  3PO4 A;  4LH5 A;  4M3T A;  2HF4 A;  4CGF A;  5GAD P;  2Q0R A;  4DTU A;  2V51 B;  3M3Z A;  4RW9 A;  4FJG A;  1WOQ A;  4G9Z A;  1WB9 A;  4BRQ A;  3BZC A;  2Z1J A;  1U47 A;  2O8D B;  1JLG A;  3OBY A;  3KKR A;  4CGI A;  5CZ1 A;  4CFB A;  3NH2 A;  3DLL L;  1ZYQ A;  2BGG A;  1NK6 A;  1IBM K;  4C23 A;  4YY3 K;  4DHY A;  4R79 A;  1HX1 A;  1NGE A;  4JD2 A;  3LP0 A;  3IMX A;  3EZ5 A;  4N41 A;  1C0T A;  5C42 A;  4X62 K;  4FWM A;  4H5W A;  1QVG M;  4GMJ B;  5AQJ A;  3S3N A;  4CZE A;  1OKJ A;  3AY9 A;  1RGI A;  1HYS A;  4IBN A;  3V9W A;  3S3O A;  4MFB A;  2WUS A;  3J8A A;  4GVM A;  4JI8 K;  3HM8 A;  4CJU A;  1Q81 O;  3FLC O;  2ITG A;  3SQ1 A;  4FWR A;  4B9L A;  1QS4 A;  3CQX A;  5J2Q A;  1NJZ A;  2GEM A;  4H5V A;  5C2D A;  4I6M B;  2ZJQ L;  3DAW A;  3GOI A;  3SUN A;  1HQU A;  4H4O A;  3RR7 A;  2W6K A;  2QW9 A;  3RMD A;  4A61 A;  3I8D A;  4EHT A;  3MCA B;  2P9L B;  4PHT X;  3GL1 A;  4BQZ A;  3H45 C;  2HVI A;  2JGU A;  2JWK A;  4CZJ A;  4JKB A;  1WSF A;  3LZI A;  1YUW A;  2ZF5 O;  5CHI A;  1UA1 A;  2UXB K;  4B3S K;  5KQ8 A;  4NCA A;  1RCH A;  5IWA K;  1ZBH A;  5FDL A;  3WXL A;  2HHX A;  2Q2R A;  1CLQ A;  1TK8 A;  1W2B M;  3ZYY X;  2F8S A;  1BQM A;  2GTD A;  5AQM A;  4LF4 K;  3ZET B;  1QTM A;  2VQE K;  3O9R A;  4DSF A;  4KHP K;  1IKY A;  4W5Q A;  2FBV A;  4BC4 A;  3G6E N;  1D5A A;  2P9N B;  4ISE A;  2KW4 A;  3NCI A;  4W5O A;  2KTQ A;  3AGR A;  1T3V A;  2V7Z A;  3SAH A;  3AGK A;  4J8F A;  2G8K A;  2D4W A;  1NJW A;  1SKW A;  3RMB A;  4CES A;  1N6Q A;  3L4Q A;  1WSH A;  4CEZ A;  5M1Q A;  3SUQ A;  4ELT A;  2HMP A;  4DV0 K;  4GNI A;  4J2E A;  1KAX A;  4BR5 A;  1IKV A;  4I9Q A;  3L2W A;  4Z4E A;  1QZ6 A;  1BWF O;  5KQD A;  4KKO A;  1A5X A;  2IS3 A;  3NGY A;  1WBB A;  5JMV A;  2QWQ A;  1HNZ K;  3VA0 A;  4FWP A;  3E9O A;  3W0L A;  4JKA A;  5LJW A;  5LMN K;  1NJX A;  4CBU A;  4C8L A;  4QOZ B;  4X66 K;  2KHO A;  5AQZ A;  4ZTF A;  3PSI A;  2NUB A;  3OHR A;  3MXJ A;  2VG6 A;  4CIG A;  4DR3 K;  3DYA A;  4JV5 K;  2ZM6 K;  3WNH A;  4CVN E;  4AHT A;  1RBU A;  3E9P A;  2WTU A;  4I2P A;  5DM6 L;  4CEF A;  2P9K A;  2GX9 A;  1BCM A;  3KD5 E;  4DTR A;  1RBR A;  2X6S A;  3A5L C;  3VQE A;  4M3Z A;  1L5U A;  1D9D A;  1NMN A;  3EE8 A;  4DSI A;  4BDY A;  2WON A;  1JL2 A;  3OYN A;  3DXK B;  3LL3 A;  4YOW A;  1ZBI A;  3ATU A;  1YI2 N;  1LAW A;  5EU7 A;  3AVL A;  4RWT A;  4DKW A;  4M45 A;  3C7N A;  3ATV A;  1C1C A;  4CHN A;  4B1X B;  4DLG A;  4BWM A;  3K57 A;  3O9Q A;  1RFQ A;  3TPQ A;  1TUY A;  4QS8 A;  3N4P A;  4KRE A;  2QWN A;  3I56 N;  4CE9 A;  4KFB A;  3KK3 A;  4EP5 A;  3RMC A;  3CC7 N;  3R6M A;  3UKR A;  1VRT A;  5AQV A;  2CGK A;  2IC3 A;  1QE1 A;  3CPE A;  3FZL A;  3LP2 A;  3E1Y A;  4H0X B;  2VQF K;  3D7E O;  2PAV A;  4XH1 A;  5BN8 A;  1TL3 A;  1Y64 A;  4FWO A;  4LFA K;  1B9D A;  5AQO A;  5C0Y A;  4WQ4 C;  3L4I A;  1VQP N;  2ITM A;  4NXN K;  1ASW A;  4QCL A;  3P31 A;  4PL8 A;  3G0Z A;  4JI6 K;  4E0D A;  4K8Z A;  4GKK K;  4CBX A;  1SAZ A;  2O8D A;  1BA1 A;  3VQA A;  4RW4 A;  1T8E A;  1DTQ A;  4HWI A;  4U67 L;  3D2E A;  3DLH A;  4GV9 A;  3QB0 A;  5HBM A;  3WNG A;  2EHG A;  2GV9 A;  1U6Z A;  1EO1 A;  4DFM A;  4AF1 A;  2UUB K;  3BY5 A;  2UXC K;  1EWR A;  3EKS A;  2Q97 A;  4CHP A;  4CIE A;  3DLK A;  2CGL A;  3TSP A;  1ATR A;  4BR7 A;  4BRL A;  1NM1 A;  2PYJ A;  4E89 A;  2O8F B;  4C8K A;  3HXM A;  2DFH A;  2E20 A;  3ID8 A;  1YTA A;  3JYT A;  1N5Y A;  4J2D A;  1CZB A;  4DV3 K;  1OH5 A;  4FSV A;  4PWD A;  1KD1 O;  3MEG A;  5H1S Q;  3R8E A;  4EIA A;  2A1R A;  4CED A;  2HHT A;  2IOC A;  2E5L K;  5HRO A;  4DQI A;  5F2R A;  3DJC A;  3AAQ A;  4FW2 A;  3HOS A;  3SPY A;  1VSI A;  4CF2 A;  3VF4 A;  3CCQ N;  3HPO A;  1HNW K;  3TAM A;  5ADX A;  1LAV A;  5LL6 Z;  4KH4 A;  2A42 A;  1QQC A;  1VQ8 N;  3WXM B;  4FJ8 A;  3J80 O;  4B1U B;  3HPG A;  3QES A;  3SJJ A;  1SL2 A;  1KSP A;  1NGF A;  4JS5 A;  3EO3 A;  3SCX A;  1Z05 A;  4JK8 A;  1YAG A;  3L8B A;  1S1U A;  1JCE A;  3M5R A;  4FK4 A;  4OO1 J;  4H0V B;  1RT4 A;  5AQG A;  5C24 A;  3L2R A;  4DFP A;  2KQ2 A;  1K73 O;  4PKH A;  4OX9 K;  3H46 O;  5CYM A;  4CJW A;  3LDS A;  1EXQ A;  4PQU A;  2UXD K;  2OTL N;  4KTW A;  1RT2 A;  1NGB A;  1NG9 A;  1U45 A;  4HCC A;  1C1A A;  1I94 K;  1FKO A;  1GLJ O;  1EKE A;  3A5O C;  3H1V X;  4CZI A;  3FFI A;  3NDK A;  1VRU A;  4CBW A;  4WFA L;  4GY2 B;  1HR0 K;  2RE2 A;  5AQS A;  2BDP A;  1VHX A;  4JN4 A;  3WNE A;  3ZT1 A;  2FSN A;  4N5S A;  5ADX H;  3ID6 A;  5AQN A;  1G15 A;  1WSI A;  4H5T A;  3OYA A;  3SMS A;  2YHA A;  4ELV A;  3VEV A;  2AA4 A;  3KK1 A;  4LF6 K;  3HSC A;  4JRQ A;  2X78 A;  3HT3 A;  3ZSY A;  3RWU A;  2RHK A;  4DTP A;  3HJF A;  3ULD A;  1L3V A;  5BPN A;  4E1N A;  4CJT A;  3I0R A;  1Q18 A;  3VQ7 A;  4Y0W A;  3EN9 A;  1D9F A;  3UIQ A;  2ZJP L;  4CFA A;  1YJW N;  3T69 A;  3UE5 A;  3KK2 A;  3LM2 A;  4O8U A;  3U3Y A;  2A5X A;  5C25 A;  1XI1 A;  3HI0 A;  1QQM A;  2O8B A;  1NGA A;  3I33 A;  4M3Y A;  4W5T A;  4FLZ A;  3IDH A;  2Q3S A;  5CE3 A;  4KAZ A;  4KHU A;  4M41 A;  1QSS A;  2F8T A;  1NGJ A;  2QKK A;  1IBK K;  1TV6 A;  1JLE A;  3SBG A;  4CZF A;  3PY8 A;  2Q0U A;  3HST B;  1IBL K;  2HHS A;  1ZBU A;  3DXK A;  4WFB L;  3PSF A;  3CIP A;  4BC5 A;  1LWF A;  3BEX A;  4DR7 K;  3THX B;  3V1R A;  2XY6 A;  3TTF A;  3CCS N;  3TSU A;  3HVR A;  3VQP A;  3A5M C;  2HBM A;  2GWK A;  1RDB A;  1DKG D;  1JL1 A;  4BRH A;  4OPK A;  1SV5 A;  2FF3 B;  1ASU A;  3RRG A;  4FWQ A;  5A2Q O;  3K2P A;  1KXP A;  4YOT A;  1KFS A;  2BH1 A;  3VGL A;  1QVF M;  2VCP A;  4JKE A;  2NRH A;  2X74 A;  3RSE A;  2AJQ A;  4GVE A;  4HUE A;  1NBW A;  3ZEU A;  1T44 A;  3NH0 A;  2FSK A;  4OLB A;  3K58 A;  1ASV A;  5KI6 A;  5BRH A;  5C2F A;  4DUY K;  1V4S A;  4B1Y B;  4HHT A;  3HO1 A;  1LWC A;  3GE1 A;  4CEQ A;  4DQS A;  5D3G A;  3SBT A;  1NJY A;  3EYZ A;  3PUF A;  2BTF A;  5M1F A;  5AQI A;  3H3N O;  1XQS C;  1VK0 A;  3LM9 A;  1GOC A;  4BG8 A;  4BRA A;  5JLH A;  4O0J A;  1U4B A;  2ZE2 A;  4O5B A;  5BR9 A;  2O8F A;  4EFH A;  3BF3 A;  4E7J A;  3AO1 A;  4CF0 A;  4IEE A;  3T19 A;  1X1P A;  2HBL A;  4IJN A;  2B4J A;  3I0S A;  4B9T A;  2D5R A;  1X9J A;  3DLB A;  3EKU A;  4JEP A;  5AR0 A;  3QBW A;  4FXD A;  1VQO N;  1FXX A;  3AO3 A;  5KGX A;  1GLC G;  3QNO A;  5IT9 O;  2YNH A;  3C95 A;  4BE2 A;  2KZM A;  1LCU A;  1IJJ A;  3K59 A;  3SK3 A;  3PIO L;  4QS7 A;  1XC9 A;  4DSK A;  1M1K O;  4FLX A;  3AVG A;  4FZZ A;  1DTT A;  4V19 S;  4B3T K;  5JS2 A;  4DLE A;  3QFP A;  1FK9 A;  2E8A A;  5KPT A;  3TAE A;  4AM6 A;  1ZBS A;  3HRG A;  1XC3 A;  4JLH A;  4FJ5 A;  4A57 A;  3CER A;  4F2S A;  3UKR B;  2V7Y A;  3M1F A;  1YJ9 N;  2OZM A;  3PLA A;  4JYA K;  1BL3 A;  4DG1 A;  3CCL N;  1NGC A;  3AAP A;  2QWR A;  5DK5 A;  3VQB A;  2FXU A;  1ZXO A;  4DR5 K;  4JS4 A;  2G8U A;  2A40 A;  3AVM A;  4FLV A;  5I3U A;  2Z1H A;  4DSE A;  1YVU A;  1RT5 A;  3IS9 A;  5AZI B;  3TTC A;  3CHW A;  3JXU A;  5JVG L;  4FPB A;  1N33 K;  4PL7 A;  1S22 A;  1J9A A;  4GW6 A;  3LWL A;  1HQE A;  3OS2 A;  3SUP A;  3K5N A;  4CK2 A;  4KI6 A;  4OKJ A;  3BZK A;  1REV A;  3D2E B;  4H5R A;  3RRH A;  1ZBF A;  2RN2 A;  3K5O A;  4DB3 A;  4DF4 A;  4CCH A;  4JKF A;  4N76 A;  3OYJ A;  5AQW A;  3QO9 A;  1NK0 A;  2YNG A;  3NHG A;  2UYT A;  1OH8 A;  4DR6 K;  5EXW A;  3ZT4 A;  4FJN A;  3MAQ A;  1NK5 A;  2PYL A;  1KC8 O;  5KGW A;  3THW B;  3WXK A;  3TAQ A;  4BVO A;  5LY3 A;  5BR8 K;  4JKC A;  4BG9 A;  1ITG A;  1BHL A;  1VSE A;  1EWQ A;  3GDQ A;  2E1Y A;  1IG8 A;  1M90 O;  1QQO A;  3OA9 A;  4JKH A;  1KFD A;  3B8A X;  3QIN A;  3KLF A;  4DV5 K;  2IIR A;  3SJH A;  3VTH A;  2HF3 A;  4JK7 A;  4L3Q A;  1W0H A;  5HRR A;  3ZX3 A;  3V1Q A;  3IUC A;  4MLH A;  4W5N A;  3CMA N;  4DTM A;  1IV0 A;  4JKD A;  2OZS A;  1U48 A;  1YIJ N;  1E3M A;  4CZK A;  4X65 K;  3WXI A;  4I9L A;  3THX A;  4O55 A;  2ETJ A;  3I55 N;  4B9S A;  2RKI A;  1RDC A;  1K9M O;  3C94 A;  4O8K A;  3CCM N;  3AAR A;  1VSK A;  4BGB A;  4C8O A;  3MXI A;  3NBP A;  4DR1 K;  4RW6 A;  3ENO A;  4CZH A;  1KCF A;  5C10 A;  4NYN A;  4JNE A;  3HL8 A;  3OYH A;  3CME N;  2ZGZ A;  5FRM A;  5F0X A;  1NKB A;  2CH5 A;  4CEB A;  3OYG A;  1T03 A;  2Z1G A;  3HYF A;  4A62 A;  1IG9 A;  3V4I A;  2XY5 A;  1NLV A;  2E6L A;  3NF9 A;  1JLA A;  3O4Q A;  4KHQ A;  4A2B A;  1TK0 A;  1J5E K;  2ZD1 A;  4F8R A;  3HOT A;  3UKU A;  3AVH A;  1XUP O;  4FVU A;  3BGR A;  3OYL A;  4AIL C;  4J2A A;  2E4L A;  4FM2 A;  2P9S A;  5M1P A;  1HKG A;  4A2A A;  3KZB A;  1TKZ A;  4NLB A;  3OW2 M;  2XHB A;  3LAK A;  4ELU A;  5I42 A;  4RG8 A;  5LJV A;  1NGD A;  2YHW A;  4CEE A;  1D8Y A;  1EET A;  1B9F A;  1JXE A;  4IO9 L;  3ZX2 A;  3A2F A;  3FGU A;  3AA2 A;  3OY9 A;  4CZL A;  1C0M A;  4N47 A;  5HOO A;  4Y1C A;  1X3M A;  1RTH A;  2F7T A;  3M8S A;  4DCH A;  1N36 K;  2W40 A;  1RT3 A;  2HBJ A;  2QWL A;  3FZH A;  3NMU A;  3J81 O;  3HP6 A;  1GLE G;  4K25 A;  4CGD A;  1CXQ A;  4DTX A;  3AVJ A;  3ZT2 A;  1NNE A;  2O8B B;  5DM7 L;  3LWM A;  4CEA A;  3SI6 A;  1XMQ K;  5BPM A;  3PX0 A;  3KWG A;  4KO0 A;  2NRV A;  5TKW A;  4LF7 K;  1U04 A;  3E9L A;  2RF2 A;  4PY5 A;  2O8E B;  1L3S A;  1QHA A;  4GV6 A;  1NU0 A;  3ZX0 A;  3NFA A;  2I7N A;  1E4G T;  3O08 A;  2GBZ A;  4GV3 A;  3ZT3 A;  4B1V A;  1BIS A;  4M42 A;  5EY4 A;  3T7Z A;  3K9J A;  3VTI A;  3ISN C;  4PKI A;  3ZSX A;  2F9W A;  3CF5 L;  4B3M K;  3R3L A;  5AFU A;  3T1H K;  2YHB A;  1W97 L;  4MDA A;  2Q1N A;  3VA3 A;  4BRC A;  4ICL A;  1XHZ A;  4FLY A;  2HHW A;  2H3G X;  3O5B A;  1ATS A;  2OPR A;  3WNF A;  1YJN N;  4E7I A;  1RBS A;  5J2M A;  1T6D A;  3TAN A;  3MWT A;  3O4W A;  4JAX A;  4UQG A;  2QWO A;  4E7H A;  4NXM K;  3RSE B;  2G8H A;  2E6M A;  2KLA A;  1TGO A;  3WEE A;  4LFB K;  3E66 A;  2XRI A;  3PX4 A;  5FPD A;  3ZEU B;  4DV6 K;  5C15 A;  4BE0 A;  5AZI A;  3AO5 A;  3A5N C;  4LFC K;  3GBT A;  3GG4 A;  3MXM A;  3FE1 A;  3P39 A;  4JI7 K;  4B9Q A;  4CJE A;  1SL1 A;  3THY A;  3OYF A;  2OAN A;  2ZQB A;  3NGI A;  4FZX C;  4IG3 A;  4RW8 A;  4AH9 A;  4DV7 K;  1YVN A;  3BDP A;  1CZA N;  1JLF A;  2YKN A;  4DV1 K;  5AFU H;  4HCB A;  3U9Z A;  1W7A A;  4JKG A;  4JK9 A;  1MWM A;  4QS9 A;  3ZCM A;  4IJA A;  5CZ2 A;  2GWJ A;  4RCH A;  1YTU A;  4OKK A;  2V52 B;  2D0B A;  4A5B A;  1TAU A;  2OCE A;  3MWP A;  4C1N K;  2IDO A;  3OBW A;  2BE2 A;  4BE1 A;  3ZT0 A;  3THW A;  2X6N A;  2Q36 A;  2WOM A;  2HHH K;  3H1Q A;  1GLB G;  3MCP A;  3RVC A;  4CF1 A;  2QKB A;  2O4G A;  1BDG A;  3O8M A;  4GKJ K;  4DV2 K;  3OTO K;  1ZC6 A;  1V4T A;  1VQ9 N;  5KPR A;  3NGZ A;  4BRE A;  1BIU A;  4FM0 A;  1BU6 O;  3WQU A;  3K9K A;  4DSL A;  3DXM B;  3O9U A;  2XY8 A;  1RT7 A;  5AQK A;  2B6A A;  4NB4 A;  3TI0 A;  4L8R B;  3SUO A;  2G8I A;  5HL7 L;  2I7P A;  4HTU A;  4DQQ A;  4E7K A;  1BGX T;  3LDN A;  3SAG A;  1RTJ A;  1GOB A;  1HLU A;  2Q31 A;  3JAM O;  1ZBL A;  4RTF D;  4WFN L;  4WYB A;  2G8W A;  3MEC A;  4XIU A;  4M7Y A;  1BOT O;  1KVB A;  3G25 A;  3NAE A;  1VQ7 N;  5J2N A;  1NOY A;  1RTI A;  2DY4 A;  2F96 A;  4FOI A;  4AM7 A;  3UB5 A;  2YX6 A;  3VQ6 A;  4KHN A;  4FK2 A;  4CHO A;  1MA9 B;  2DPN A;  1NK9 A;  2VYP A;  3NH1 A;  4K8X A;  4XH4 A;  1SKR A;  3VF6 A;  2FBY A;  5AQX A;  1RIL A;  3J7Z O;  5AZJ A;  5MLC Q;  2QWP A;  4KTQ A;  4LF5 K;  1S6P A;  2ZJR L;  5HP1 A;  1T05 A;  4B8C A;  3S41 A;  1XWL A;  1GOA A;  4C8N A;  3CM5 A;  3OYB A;  5FLX O;  1IO2 A;  4FZY A;  1NKC A;  1KAY A;  3AVI A;  3DLR A;  2FF6 A;  4OPH A;  4BRF A;  3K0S A;  3DWL A;  4DU4 A;  4KI4 A;  3V6D A;  4CJ3 A;  4JI0 K;  3CJ9 A;  3Q7B A;  2GUP A;  3D2F B;  3CQY A;  3LAL A;  3VQD A;  5AQF A;  3LAM A;  5JLF A;  4DFJ A;  3ZSV A;  2IVO A;  3DRS A;  1O1W A;  3KJV A;  3AV9 A;  4B3O A;  1NGH A;  1KVA A;  3LAN A;  3N4Q A;  2DFE A;  1HKC A;  4DTN A;  3KVG A;  2CH6 A;  1QHT A;  2Y1J A;  3TAF A;  1RT1 A;  4FJK A;  1KRP A;  3O1W A;  4I7F A;  4DS5 A;  3KLH A;  2YKM A;  1BQN A;  1HYZ A;  1NK8 A;  2XY7 A;  4JHD A;  1HPM A;  2QXF A;  1N34 K;  3QEW A;  4H0T B;  1DGK N;  3CJB A;  3VOV A;  5JIC A;  1VSD A;  3VPZ A;  3C6U A;  4PKG A;  4YDU C;  3EY1 A;  4CJL A;  3T1Y K;  2NRR A;  4NYF A;  4BRM A;  5KPZ A;  5M1K A;  3L2U A;  5ELZ A;  2O8E A;  2D0P A;  4MLE A;  3WUH A;  4BRP A;  2UUC K;  3AVC A;  4CW7 B;  3IG1 A;  2QA4 N;  4N56 A;  1HNX K;  1RDW X;  2EWS A;  3F73 A;  1NGI A;  3SQ2 A;  4FJJ A;  3CQ8 A;  2HNY A;  4CJF A;  1MDU B;  1S1T A;  2FBX A;  4WQ5 A;  3F2K A;  2FC0 A;  5FRN A;  4U7B A;  3RMA A;  1KLN A;  3CJC A;  3LPU A;  4AQY K;  3ZSW A;  1N32 K;  1R59 O;  2P9P B;  2QXL A;  3M8R A;  1S9E A;  3P5J A;  1NK4 A;  2NRZ A;  2ZGY A;  1QSY A;  2P5G A;  1J6Z A;  2E2Q A;  4WCE L;  4FWS A;  3CJA A;  4CFC A;  3WXJ A;  1BO5 O;  3QIO A;  2GUI A;  3VEO A;  4BRG A;  2A41 A;  5AJ3 K;  1WSE A;  2E2P A;  4CJ4 A;  4BC3 A;  1OVQ A;  3L0Q A;  3TAB A;  3MX5 A;  4FWL A;  2G8F A;  5AQU A;  2YHY A;  1GLL O;  3VEY A;  4Z4F A;  2D0C A;  3VQ5 A;  1VSF A;  3UKU B;  3CCJ N;  1VSM A;  4Z4G A;  1Q82 O;  3CCE N;  1CZ9 A;  3PO5 A;  4ILJ A;  2ASO A;  1J5O A;  1JJ2 M;  4FJX A;  3DRR A;  1BCO A;  4Y1D A;  4BDZ A;  2P9S B;  2QTD A;  3TSQ A;  3O4N A;  1T7P A;  4LSL A;  2YJF A;  3U3G A;  3QLH A;  5SZT A;  4QAG A;  3VEN A;  4XEI A;  4IDK A;  1YXQ A;  1TKD A;  2HHQ A;  3OYI A;  1A5W A;  4Z4C A;  3O9T A;  1KLM A;  4DQ8 A;  4B9U A;  4YHH K;  2QK9 A;  4RW7 A;  5BN9 A;  1CXU A;  4CZM A;  3LDO A;  4TSX A;  5E41 A;  2KZZ A;  5AQP A;  4CF8 A;  1HJR A;  1TVR A;  1H1V A;  4CK3 A;  4OKE A;  2P9I A;  3CJ7 A;  3MN6 A;  5FRO A;  4DQR A;  4CJ7 A;  1G99 A;  3QDK A;  1BI4 B;  5KRS A;  4DFK A;  2P9U B;  5GAE P;  2NRX A;  4KRF A;  2OYQ A;  5FPM A;  3O6W A;  4LD0 A;  2WBN A;  3V81 A;  3DXM A;  4K0K K;  4LF8 K;  4FLT A;  3T3F A;  3CJ1 A;  2YHX A;  4JI4 K;  2Y1I A;  1SS6 A;  2HNZ A;  1HPZ A;  5AQH A;  4IFY A;  4OLA A;  4BRO A;  1OVY A;  4LSN A;  3PX6 A;  1I39 A;  2OA8 A;  4FW1 A;  4FLU A;  1L3T A;  3RTV A;  1IKW A;  1X9M A;  3TR8 A;  4BY9 C;  4PA1 A;  3LZJ A;  3RR8 A;  3O80 A;  4DWI A;  5I9E B;  4CHZ A;  3OS0 A;  3QIC A;  3LPT A;  2NRW A;  4K42 A;  2W6L A;  2A6A A;  3VGM A;  3SPZ A;  5TKY A;  5B8H A;  1VQK N;  2VWK A;  1LWE A;  4I2Q A;  3TWH A;  4B9N A;  4KB0 A;  3WEE B;  4CJS A;  1VQ5 N;  4E1J A;  1Q9X A;  2PY5 A;  2OPQ A;  4KPY A;  4C1N I;  3O9S A;  4AHS A;  1K6Y A;  2ASM A;  2IVP A;  4CJ5 A;  3VQ4 A;  1WLJ A;  4KHW A;  5JS1 A;  1RTD A;  4BR2 A;  2QM1 A;  3CC4 N;  4DV4 K;  3MK6 A;  2NNW A;  2AP1 A;  2KFN A;  1XHX A;  3THY B;  3PV8 A;  3S9H A;  1SKS A;  3JSM A;  3SQ0 A;  3QET A;  3OYD A;  2XO7 A;  1IH7 A;  2HND A;  4OGE A;  2UU9 K;  3D2F A;  1NKE A;  4JKG B;  4BQL A;  4AHU A;  1NGG A;  3D6R A;  3TAP A;  2I5J A;  3MN7 A;  4DR2 K;  1VAZ A;  5FPE A;  2HVH A;  4E3S A;  5LMU K;  1U2V A;  1L3U A;  2YCH A;  3PIP L;  1YF5 L;  4EP4 A;  3FR0 A;  4IZ9 A;  5BRD A;  3P38 A;  5AQR A;  3TTD A;  3ULE A;  2BAN A;  3VEZ A;  2VG7 A;  3E01 A;  4FOE A;  4BR4 A;  1VSH A;  3VES A;  3WQT A;  4JI3 K;  3HK2 A;  4B1Z A;  1MU2 A;  5EOY A;  4CGJ A;  4NO7 A;  1VQL N;  1J53 A;  3M8Q A;  3AVB A;  4B08 A;  3P83 D;  4OJR A;  3ZSQ A;  2WFB A;  3VQ8 A;  1P8Z A;  3VER A;  3G71 N;  3OYC A;  4O44 A;  3MEE A;  3C6H A;  4G1Q A;  2P1J A;  4DTS A;  4B9M A;  1BIZ A;  3K5M A;  4LY7 A;  3V1O A;  4YNQ A;  3AVF A;  1E4F T;  3O3H A;  4IOX A;  2BUP A;  2WC9 A;  1WNS A;  3FFK B;  4FWK A;  2P9P A;  4B3R K;  2KKZ A;  5HRN A;  4BRK A;  5BPL A;  3KHY A;  4YDU A;  1JLC A;  1Y97 A;  3NF7 A;  3L2V A;  3IAY A;  3ZLJ A;  4OPA A;  3AO2 A;  3ENB A;  2JWL A;  1GLA G;  3VN5 A;  3DLE A;  1FW6 A;  3FZM A;  2F4V K;  3J7Y P;  4ID5 A;  4AHV A;  5AZJ B;  4CI6 A;  2W42 A;  3MN5 A;  1QZ5 A;  4CER A;  3U8X A;  5CR4 A;  2DTU A;  2VGN A;  1NWK A;  4CJK A;  1LV5 A;  2YI1 A;  1IKX A;  3O1B A;  3VQ9 A;  1S3X A;  4BRN A;  2B5J A;  5J1E A;  5AQL A;  2E2N A;  2UUA K;  3O3F A;  1S6Q A;  3DOK A;  2HOE A;  2P5O A;  4F3T A;  1EP4 A;  1ESV A;  3W3D A;  4CHQ A;  2O8C B;  1I3A A;  3ALY A;  4HUG A;  3I8B A;  4FVM A;  4A59 A;  4X64 K;  3MN9 A;  5AQQ A;  4B9V A;  1A5V A;  4Z94 A;  4DSJ A;  3SMP A;  3KLG A;  4M63 C;  1R0A A;  2KFZ A;  4WQ5 C;  4AHR A;  3A8Y A;  4JHD B;  2FBT A;  1Z25 A;  3IRX A;  4CK1 A;  5CY4 A;  4EZ9 A;  3F5T A;  1BI4 A;  5CYQ A;  3ZSZ A;  1VSJ A;  3VQQ A;  3LP3 A;  3ZSR A;  2P9U A;  2VWJ A;  4FJM A;  3K5L A;  4M3X A;  4DF8 A;  4FJI A;  1K8K A;  4ZHR A;  4BRD A;  1U49 A;  3MMV A;  3NE6 A;  4H5N A;  5M1O A;  5BRF A;  3BF1 A;  4DS4 A;  2OTJ N;  4BDP A;  4IOA L;  2F9T A;  2HST A;  2ASP A;  4KBO A;  2PFU A;  3CPW M;  4FYD A;  3BUZ B;  1YT3 A;  3CD6 N;  1NOZ A;  4HUF A;  4DTJ A;  2VWB A;  4MO4 A;  3MX2 A;  1KAZ A;  4KTZ A;  1RNH A;  4FK0 A;  2P51 A;  5KRT A;  3S3M A;  1HRH A;  1JLB A;  4W5R A;  4YOU A;  4Q0B A;  4PUO A;  3MDQ A;  3O3G A;  3C6A A;  4CD1 A;  2HMI A;  1C0G A;  3VET A;  5J2P A;  1HMV A;  4FJ7 A;  4BGA A;  4ILH A;  2OPS A;  4E1M A;  1TKT A;  4OPJ A;  4FCY A;  2IVN A;  3CM6 A;  3NVK A;  1WN7 A;  1TKX A;  3SZ2 A;  1VQN N;  4CGG A;  3QEV A;  2YJE A;  2RPI A;  3QNN A;  2HW3 A;  1D4X A;  3THV A;  3SLC A;  4ILG B;  2Z1I A;  2HBK A;  4H8K A;  1DEJ A;  3IKM A;  1RDU A;  1JXB A;  4JI2 K;  5HRP A;  4IOC L;  5K14 A;  4DR4 K;  3V9S A;  4BAC A;  2PBD A;  4CEC A;  1WSJ A;  2JLE A;  3OJU A;  3KLE A;  4BVP A;  4M3W A;  1HNI A;  4KV8 A;  4BR0 A;  2E88 A;  1S72 N;  5DMR A;  3MED A;  2YV0 X;  4Z4H A;  3HPH A;  2P9I B;  3AA4 A;  3KKS A;  4IWV A;  3TAG A;  1TYQ B;  1T6C A;  3H08 A;  1JCG A;  2ZWH A;  3QEP A;  1TK5 A;  4BC2 A;  4ZTJ A;  4XH5 A;  1S9G A;  3KD1 E;  3V9Z A;  1RBV A;  1RDD A;  3SQ4 A;  4ID1 A;  3KK7 A;  3OVN A;  1OH6 A;  1C0F A;  3AVA A;  3OS1 A;  3OYE A;  4LH4 A;  5AQY A;  5FPN A;  3SYZ A;  1EQY A;  3VEW A;  1UA0 A;  2D0A A;  4M3R A;  3OYK A;  3KTQ A;  3JS6 A;  1SUQ A;  1DLO A;  1LW2 A;  4FLW A;  5E84 A;  4F2R A;  3CFO A;  4FJ9 A;  4ISG A;  1NMD A;  4DTO A;  1NK7 A;  4I6M A;  1UOC A;  3L3V A;  1S1X A;  4NCB A;  3D45 A;  1HUX A;  1S1W A;  3VF2 A;  2HHV A;  4R5P A;  3LDL A;  1YHQ N;  3A0I X;  4HTL A;  1RDA A;  3P4I A;  2ATQ A;  4CZG A;  3C0B A;  2VGM A;  4YOR A;  2P9L A;  1S1V A;  3L2Q A;  4OGC A;  5T7B A;  1LW0 A;  3HM9 A;  1FJG K;  4IG0 A;  4YOV A;  4CHY A;  1F21 A;  4IFV A;  2VG5 A;  5AQT A;  3EL2 A;  1BA0 A;  5GAH P;  1LOT B;  3C65 A;  1VQM N;  4KH6 A;  2NZT A;  3KIO A;  4CJP A;  3V9U A;  3U9D A;  3DLG A;  2YNI A;  3ENH A;  3DI6 A;  2D0O A;  4CEO A;  5GIP A;  3ZET A;  5JVH L;  4FJL A;  3DMJ A;  1Q7Y O;  4OVL A;  5EVZ A;  3L6Q A;  3LDP A;  3OYM A;  1WUA A;  3F9K A;  3FZK A;  5C12 A;  4DU1 A;  1SL0 A;  2P9N A;  2O8C A;  2W41 A;  4E19 A;  3M8P A;  3CET A;  4UY8 O;  1DT9 A;  3G10 A;  3Q7C A;  1UWB A;  2YNF A;  3R1X A;  4BR9 A;  1Z6R A;  1U2V B;  5F1X A;  4BWJ A;  1SZ2 A;  4JD2 B;  4H4M A;  1VQ6 N;  2FSJ A;  3CG7 A;  1KVC A;  1X9S A;  3QEX A;  4IXC A;  4O0I A;  3ULE B;  3VEX A;  4CF9 A;  4F3O A;  2A1S A;  3HP9 A;  3D0P A;  3VQC A;  4A5A A;  1VSL A;  1TL1 A;  1QSL A;  2OPP A;  3L3U A;  1RBT A;  4FO0 A;  1EX4 A;  5GIO A;  2LSN A;  4F9O A;  1BG3 A;  4EAH D;  1RT6 A;  1YIT N;  4JI5 K;  3CCU N;  4IEI A;  3U4L A;  4FJH A;  4EHU A;  4K41 A;  4H0P A;  4EZ6 A;  3WT0 A;  4B1W B;  4IFE A;  3NVM A;  1JLQ A;  1Q8I A;  1KQS M;  3ZSO A;  4ISF A;  1X9W A;  1TAQ A;  4CFD A;  3HTV A;  4AHC A;  3HBT A;  2R7Y A;  1W9H A;  2J4R A;  1NJI O;  3QML A;  4WF9 L;  3AA3 A;  4C8M A;  1C0U A;  2G8V A;  1JCF A;  4H03 B;  4CGH A;  1WAJ A;  4CIF A;  3QIP A;  3M6G A;  1WSG A;  4DUZ K;  1P90 A;  4LF9 K;  4FWN A;  3H6E A;  3AVK A;  3H3O B;  1WAF A;  4O4G A;  4J2B A;  4DQP A;  3B6P A;  1HNV A;  3SNN A;  1B92 A;  1GLD G;  3LDQ A;  3CFR A;  4B8A B;  4FM1 A;  5HLF A;  5GAG P;  3CC2 N;  3AO4 A;  1VQ4 N;  4IO8 A;  2NLX A;  1UAX A;  3AVN A;  4IDH A;  5SWM A;  1S5J A;  3SV3 A;  1K8A O;  3VGK A;  3ITH A;  2HB5 A;  4MDB A;  3VMF B;  1XNQ K;  4O5F A;  2A3Z A;  3OJS A;  3CYM A;  1C6V A;  1QQN A;  4CJR A;  4KB1 A;  1GLF O;  5E26 A;  1FKP A;  5EX5 A;  3CCV N;  3TU5 A;  1Q9Y A;  4Z4I A;  1HKB A;  4NCG A;  4HVJ A;  4K43 A;  3EEQ A;  1N8R O;  2EX3 A;  3DM2 A;  3P1G A;  1OH7 A;  2PZS A;  4E7L A;  3NF6 A;  4FL9 A;  3J7A P;  4LC9 B;  1TUU A;  2O4I A;  5BRE A;  1Q86 O;  1MWK A;  4M3U A;  1TYQ A;  4MQ3 A;  1J54 A;  4JI1 K;  4DU3 A;  3FZF A;  3U6F A;  3IFR A;  4FPA A;  2IGI A;  3CI5 A;  1XMO K;  4CJV A;  1K8K B;  5M1N A;  3F9M A;  4WE1 A;  3V9X A;  2NRT A;  4IKF A;  3C6T A;  4WQ4 A;  3KWI A;  3NF8 A;  1Z26 A;  3AA5 X;  2QEX N;  3T1A A;  4F4K A;  3BP8 A;  5HRS A;  4CD3 A;  2QI2 A;  4KHS A;  1X3N A;  1XNR K;  2P9K B;  3CFP A;  3EZW A;  1O13 A;  1ATN A;  3QEI A;  3DRP A;  2E2O A;  4YOY A;  1HYV A;  1BUP A;  3EE9 A;  4H0O A;  3CXC M;  4KH5 A;  3SAF A;  2CGJ A;  2E1Z A;  3HVT A;  5KTQ A;  4DMN A;  3G4S N;  4CJQ A;  2HHU A;  1WBD A;  3C7N B;  3CCR N; 
#chains in the Genus database with same CATH homology
 3U3Y A;  3VQ9 A;  2B5J A;  5J1E A;  3ZCM A;  3KLI A;  5C25 A;  1XI1 A;  5CZ2 A;  3LP1 A;  4JRP A;  4Q5V A;  4M3Y A;  4W5T A;  2DFF A;  4FLZ A;  3O3F A;  1YTU A;  1S6Q A;  4OKK A;  2Q3S A;  3DOK A;  2D0B A;  2P5O A;  4KAZ A;  4KHU A;  4F3T A;  1EP4 A;  4M41 A;  1TAU A;  1JKH A;  1QSS A;  4CHQ A;  2F8T A;  2QKK A;  2IDO A;  1C1B A;  2BE2 A;  1TV6 A;  1JLE A;  1KTQ A;  3ZT0 A;  2X6N A;  4BE1 A;  2WOM A;  3PY8 A;  1I3A A;  3ALY A;  3HST B;  4CF1 A;  3DOL A;  4FVM A;  1ZBU A;  2IAJ A;  4HUG A;  3TAR A;  2HHS A;  2QKB A;  2O4G A;  3B6O A;  3ASM A;  4B9V A;  1A5V A;  4Z0U A;  1LWF A;  3V1R A;  3NGZ A;  4DSJ A;  2XY6 A;  1BIU A;  4FM0 A;  3KLG A;  1R0A A;  3HVR A;  3SV4 A;  2KFZ A;  3VQP A;  4KHY A;  3QER A;  4YFU A;  4DSL A;  3PO4 A;  4LH5 A;  4AHR A;  2XY8 A;  1RT7 A;  4CGF A;  2FBT A;  2B6A A;  4DTU A;  4M3T A;  3TI0 A;  1RDB A;  4RW9 A;  4FJG A;  4L8R B;  3SUO A;  1JL1 A;  2G8I A;  1Z25 A;  4OPK A;  4HTU A;  3IRX A;  4E7K A;  4DQQ A;  1SV5 A;  2Z1J A;  1ASU A;  1BGX T;  5CY4 A;  4CK1 A;  1U47 A;  3RRG A;  4EZ9 A;  1BI4 A;  1JLG A;  4FJ9 A;  3KKR A;  3K2P A;  5CYQ A;  3ZSZ A;  1VSJ A;  3VQQ A;  4CGI A;  5CZ1 A;  1RTJ A;  4CFB A;  3LP3 A;  1GOB A;  3ZSR A;  3NH2 A;  1ZYQ A;  1KFS A;  2VWJ A;  1ZBL A;  4FJM A;  3K5L A;  4M3X A;  2BGG A;  1NK6 A;  4DF8 A;  4FJI A;  2G8W A;  4ZHR A;  2X74 A;  3MEC A;  1U49 A;  4XIU A;  2AJQ A;  1KVB A;  4HUE A;  3NE6 A;  3LP0 A;  3NAE A;  3EZ5 A;  4DS4 A;  5J2N A;  1NOY A;  4N41 A;  1C0T A;  1RTI A;  3NH0 A;  2DY4 A;  2F96 A;  4BDP A;  4OLB A;  5C42 A;  3K58 A;  3VQ6 A;  4KHN A;  4GMJ B;  4FK2 A;  3S3N A;  4CHO A;  4FYD A;  1NK9 A;  1HYS A;  1ASV A;  4IBN A;  1YT3 A;  5KI6 A;  3V9W A;  3S3O A;  1NOZ A;  3NH1 A;  4HHT A;  4K8X A;  3HO1 A;  1LWC A;  4MFB A;  1SKR A;  4CEQ A;  4HUF A;  4DTJ A;  2FBY A;  1RIL A;  4DQS A;  5D3G A;  4KTZ A;  4GVM A;  1RNH A;  4FK0 A;  2P51 A;  1NJY A;  4KTQ A;  3EYZ A;  4CJU A;  1S6P A;  5HP1 A;  3PUF A;  1T05 A;  2ITG A;  4B8C A;  3SQ1 A;  1XWL A;  5KRT A;  1GOA A;  3S3M A;  1HRH A;  1JLB A;  4C8N A;  3CM5 A;  4B9L A;  1VK0 A;  4W5R A;  1QS4 A;  5J2Q A;  3OYB A;  1GOC A;  1IO2 A;  1NJZ A;  1NKC A;  4FZY A;  3AVI A;  3DLR A;  4PUO A;  4KI4 A;  4Q0B A;  4DU4 A;  3O3G A;  3V6D A;  3SUN A;  1HQU A;  2HMI A;  4O0J A;  4CJ3 A;  2ZE2 A;  4H4O A;  1U4B A;  3RR7 A;  5J2P A;  1HMV A;  4FJ7 A;  4O5B A;  3RMD A;  2OPS A;  4E1M A;  4E7J A;  3AO1 A;  1TKT A;  4OPJ A;  4FCY A;  3CM6 A;  4CF0 A;  1WN7 A;  3VQD A;  3LAL A;  3I8D A;  3T19 A;  1X1P A;  1TKX A;  3LAM A;  3SZ2 A;  3ZSV A;  4CGG A;  4DFJ A;  1KSP A;  2B4J A;  3DRS A;  1SL2 A;  3QEV A;  1O1W A;  3I0S A;  3KJV A;  3AV9 A;  4B9T A;  4B3O A;  2D5R A;  2RPI A;  3DLB A;  2HVI A;  3QNN A;  1KVA A;  2JGU A;  3LAN A;  2HW3 A;  2DFE A;  3THV A;  4DTN A;  4FXD A;  1WSF A;  1QHT A;  2Y1J A;  3TAF A;  1RT1 A;  1FXX A;  3LZI A;  4FJK A;  1UA1 A;  3AO3 A;  5KGX A;  2Z1I A;  4I7F A;  3QNO A;  4H8K A;  1KRP A;  4DS5 A;  2YNH A;  3C95 A;  3KLH A;  4BE2 A;  2KZM A;  1JXB A;  2YKM A;  5HRP A;  1BQN A;  1HYZ A;  5K14 A;  1NK8 A;  4NCA A;  3K59 A;  1RCH A;  4BAC A;  3V9S A;  1ZBH A;  4CEC A;  1WSJ A;  2JLE A;  5FDL A;  2XY7 A;  3OJU A;  1XC9 A;  4DSK A;  2QXF A;  2HHX A;  3KLE A;  3QEW A;  4FLX A;  3AVG A;  1TK8 A;  1CLQ A;  4FZZ A;  1VSD A;  1DTT A;  3C6U A;  1BQM A;  1HNI A;  4M3W A;  2F8S A;  4KV8 A;  5JS2 A;  3EY1 A;  4DLE A;  1FK9 A;  3TAE A;  4CJL A;  5DMR A;  4NYF A;  3MED A;  1QTM A;  2YV0 X;  4DSF A;  4Z4H A;  1IKY A;  3L2U A;  3HPH A;  4JLH A;  4W5Q A;  4FJ5 A;  3AA4 A;  4F2S A;  3KKS A;  2FBV A;  3TAG A;  1D5A A;  3H08 A;  2OZM A;  3AVC A;  2KW4 A;  1BL3 A;  3NCI A;  4W5O A;  4DG1 A;  3IG1 A;  3QEP A;  1TK5 A;  2KTQ A;  4N56 A;  4ZTJ A;  1S9G A;  3KD1 E;  3F73 A;  3V9Z A;  2G8K A;  5DK5 A;  3SQ2 A;  1RBV A;  3VQB A;  1NJW A;  1RDD A;  3CQ8 A;  4FJJ A;  2HNY A;  4CJF A;  4ID1 A;  3SQ4 A;  1S1T A;  3OVN A;  4CES A;  2FBX A;  3RMB A;  1SKW A;  1N6Q A;  4JS4 A;  2FC0 A;  2G8U A;  3AVA A;  5FRN A;  1WSH A;  3RMA A;  4CEZ A;  1KLN A;  3OS1 A;  3AVM A;  3OYE A;  4FLV A;  4LH4 A;  3LPU A;  3SUQ A;  5I3U A;  2Z1H A;  4ELT A;  4DSE A;  1YVU A;  3ZSW A;  1RT5 A;  3IS9 A;  3M8R A;  3SYZ A;  4J2E A;  1S9E A;  1IKV A;  1UA0 A;  3P5J A;  2D0A A;  1NK4 A;  4M3R A;  4I9Q A;  3L2W A;  3OYK A;  3KTQ A;  4Z4E A;  1QSY A;  1SUQ A;  2P5G A;  4KKO A;  1A5X A;  1DLO A;  1LW2 A;  2IS3 A;  3NGY A;  4FLW A;  4CFC A;  3VA0 A;  3LWL A;  1J9A A;  4GW6 A;  3CFO A;  4F2R A;  1HQE A;  3OS2 A;  3SUP A;  3K5N A;  3QIO A;  4CK2 A;  2GUI A;  1NJX A;  4C8L A;  4DTO A;  1NK7 A;  4KI6 A;  4OKJ A;  4QOZ B;  1UOC A;  1WSE A;  3L3V A;  1REV A;  1S1X A;  4CJ4 A;  3RRH A;  4ZTF A;  1ZBF A;  2RN2 A;  3K5O A;  4NCB A;  3D45 A;  1S1W A;  3TAB A;  2NUB A;  2HHV A;  3MXJ A;  4DF4 A;  4R5P A;  2VG6 A;  4CIG A;  2G8F A;  4CCH A;  3DYA A;  1RDA A;  4N76 A;  2ATQ A;  4Z4F A;  3OYJ A;  2D0C A;  3VQ5 A;  1VSF A;  3QO9 A;  3WNH A;  4AHT A;  1VSM A;  1NK0 A;  2YNG A;  4Z4G A;  3NHG A;  1RBU A;  1CZ9 A;  1S1V A;  3L2Q A;  4I2P A;  3PO5 A;  4FJX A;  1J5O A;  4OGC A;  3DRR A;  5T7B A;  1BCO A;  1LW0 A;  3HM9 A;  4Y1D A;  4BDZ A;  4CEF A;  4IG0 A;  1BCM A;  3O4N A;  3ZT4 A;  4LSL A;  1T7P A;  3KD5 E;  4DTR A;  4FJN A;  3MAQ A;  1NK5 A;  2PYL A;  4CHY A;  1RBR A;  2X6S A;  1F21 A;  4IFV A;  3VQE A;  4M3Z A;  2VG5 A;  1L5U A;  1D9D A;  5KGW A;  3U3G A;  3QLH A;  5SZT A;  4QAG A;  4BDY A;  4DSI A;  3TAQ A;  2WON A;  1JL2 A;  3OYN A;  1ZBI A;  4IDK A;  1LAW A;  1TKD A;  2HHQ A;  5EU7 A;  3OYI A;  3AVL A;  3KIO A;  4CJP A;  1A5W A;  1BHL A;  1ITG A;  4M45 A;  1VSE A;  4Z4C A;  3V9U A;  1KLM A;  1C1C A;  4CHN A;  4DLG A;  4B9U A;  3DLG A;  2YNI A;  2QK9 A;  4BWM A;  3DI6 A;  4RW7 A;  3K57 A;  1CXU A;  4CEO A;  4TSX A;  5E41 A;  2KZZ A;  4CF8 A;  1KFD A;  4KRE A;  3QIN A;  3KLF A;  1HJR A;  1TVR A;  3DMJ A;  4FJL A;  4OVL A;  4CK3 A;  4CE9 A;  1W0H A;  4KFB A;  5HRR A;  3KK3 A;  3V1Q A;  4OKE A;  3OYM A;  4EP5 A;  3RMC A;  3F9K A;  5FRO A;  4W5N A;  4DQR A;  1VRT A;  4DU1 A;  1SL0 A;  4DTM A;  2OZS A;  1BI4 B;  2IC3 A;  1QE1 A;  3LP2 A;  3M8P A;  4E19 A;  5KRS A;  1U48 A;  3G10 A;  4DFK A;  4I9L A;  1UWB A;  2YNF A;  1TL3 A;  4KRF A;  4BWJ A;  4O55 A;  4H4M A;  2OYQ A;  1B9D A;  2ETJ A;  4LD0 A;  3CG7 A;  1KVC A;  4B9S A;  2RKI A;  1RDC A;  1X9S A;  3C94 A;  3V81 A;  1VSK A;  3QEX A;  4C8O A;  3MXI A;  3NBP A;  4O0I A;  4FLT A;  3T3F A;  1ASW A;  4RW6 A;  2Y1I A;  4QCL A;  3G0Z A;  1KCF A;  2HNZ A;  1HPZ A;  4NYN A;  4CF9 A;  4F3O A;  2A1S A;  4IFY A;  4E0D A;  4K8Z A;  4OLA A;  4LSN A;  3PX6 A;  1I39 A;  3HL8 A;  3HP9 A;  3VQC A;  4FW1 A;  3OYH A;  3D0P A;  4FLU A;  2OA8 A;  4J2B A;  1L3T A;  1VSL A;  3VQA A;  3RTV A;  4RW4 A;  1T8E A;  1TL1 A;  1IKW A;  1DTQ A;  1QSL A;  5FRM A;  1NKB A;  3DLH A;  2OPP A;  1X9M A;  4CEB A;  3L3U A;  1RBT A;  5HBM A;  1EX4 A;  2Z1G A;  3WNG A;  3OYG A;  2EHG A;  3TR8 A;  2GV9 A;  3HYF A;  1T03 A;  4PA1 A;  3LZJ A;  2LSN A;  1IG9 A;  3V4I A;  2XY5 A;  3RR8 A;  1RT6 A;  2E6L A;  3NF9 A;  4CHZ A;  1JLA A;  3OS0 A;  4DWI A;  4DFM A;  3O4Q A;  4KHQ A;  3LPT A;  4FJH A;  1TK0 A;  4CHP A;  2ZD1 A;  4CIE A;  4F8R A;  3DLK A;  4EZ6 A;  3AVH A;  3SPZ A;  3BGR A;  3OYL A;  4AIL C;  4J2A A;  2E4L A;  2PYJ A;  2VWK A;  4E89 A;  1LWE A;  4I2Q A;  1JLQ A;  3TWH A;  4FM2 A;  3HXM A;  2DFH A;  4CJS A;  1Q8I A;  4B9N A;  4C8K A;  4KB0 A;  1Q9X A;  1YTA A;  2OPQ A;  3JYT A;  2PY5 A;  3ZSO A;  1TKZ A;  1N5Y A;  4KPY A;  4J2D A;  1CZB A;  1X9W A;  1TAQ A;  4CFD A;  4AHC A;  4PWD A;  4AHS A;  2XHB A;  1W9H A;  3LAK A;  2R7Y A;  4ELU A;  1K6Y A;  5I42 A;  4RG8 A;  3AA3 A;  4C8M A;  1C0U A;  3MEG A;  2G8V A;  4CJ5 A;  3VQ4 A;  1WLJ A;  4KHW A;  4CGH A;  4CEE A;  1WAJ A;  4CIF A;  5JS1 A;  3QIP A;  2A1R A;  1EET A;  1B9F A;  1JXE A;  1WSG A;  4CED A;  3A2F A;  1RTD A;  1D8Y A;  3AA2 A;  3OY9 A;  3AVK A;  1C0M A;  2HHT A;  2KFN A;  1WAF A;  2IOC A;  4O4G A;  4Y1C A;  1XHX A;  4N47 A;  5HRO A;  4DQP A;  4DQI A;  3B6P A;  1RTH A;  3PV8 A;  3S9H A;  1HNV A;  3JSM A;  3SNN A;  4FW2 A;  3SQ0 A;  1SKS A;  1B92 A;  3OYD A;  3M8S A;  3QET A;  3SPY A;  1VSI A;  4CF2 A;  1RT3 A;  2XO7 A;  1IH7 A;  3HPO A;  3CFR A;  4B8A B;  4FM1 A;  5HLF A;  2HND A;  4OGE A;  3TAM A;  1LAV A;  1NKE A;  3AO4 A;  4AHU A;  1QQC A;  3HP6 A;  3TAP A;  2I5J A;  4CGD A;  1CXQ A;  4DTX A;  3AVJ A;  4FJ8 A;  3ZT2 A;  3HPG A;  3LWM A;  4CEA A;  3QES A;  3SI6 A;  3SJJ A;  1UAX A;  3AVN A;  3PX0 A;  4KO0 A;  5SWM A;  4JS5 A;  1S5J A;  3SV3 A;  3SCX A;  2HVH A;  4E3S A;  3L8B A;  3ITH A;  2HB5 A;  1S1U A;  1U04 A;  2RF2 A;  4PY5 A;  1L3S A;  3OJS A;  3CYM A;  1C6V A;  1L3U A;  4FK4 A;  4CJR A;  4KB1 A;  1RT4 A;  3NFA A;  4DFP A;  5C24 A;  4EP4 A;  3L2R A;  2KQ2 A;  1FKP A;  1LV5 A;  2GBZ A;  3ZT3 A;  5CYM A;  4CJW A;  3LDS A;  1EXQ A;  1Q9Y A;  4PQU A;  1BIS A;  2BAN A;  4KTW A;  4M42 A;  2VG7 A;  1RT2 A;  4Z4I A;  3E01 A;  1U45 A;  4NCG A;  4HVJ A;  1C1A A;  4HCC A;  1VSH A;  1FKO A;  3ISN C;  3ZSX A;  1EKE A;  2EX3 A;  3HK2 A;  3DM2 A;  1MU2 A;  3P1G A;  2PZS A;  3FFI A;  2YHB A;  3NF6 A;  3NDK A;  4E7L A;  3VA3 A;  1VRU A;  4CGJ A;  1J53 A;  3M8Q A;  3AVB A;  4ICL A;  3P83 D;  4B08 A;  2O4I A;  4OJR A;  3ZSQ A;  4M3U A;  4MQ3 A;  3VQ8 A;  2BDP A;  1J54 A;  3OYC A;  1XHZ A;  4FLY A;  2HHW A;  2OPR A;  3WNF A;  4DU3 A;  3WNE A;  3ZT1 A;  4E7I A;  1RBS A;  4O44 A;  5J2M A;  4N5S A;  3U6F A;  3MEE A;  3TAN A;  4G1Q A;  1G15 A;  2P1J A;  1WSI A;  4DTS A;  4B9M A;  1BIZ A;  3OYA A;  3K5M A;  2IGI A;  4LY7 A;  4CJV A;  4UQG A;  3V1O A;  4E7H A;  4WE1 A;  4YNQ A;  3AVF A;  2YHA A;  3V9X A;  4IKF A;  2G8H A;  2E6M A;  3C6T A;  3O3H A;  4ELV A;  1TGO A;  2XRI A;  3NF8 A;  1Z26 A;  3AA5 X;  3PX4 A;  3T1A A;  1WNS A;  4BE0 A;  3KK1 A;  3AO5 A;  4F4K A;  5HRN A;  4JRQ A;  2X78 A;  5HRS A;  3MXM A;  4KHS A;  1JLC A;  1Y97 A;  3NF7 A;  3HT3 A;  3L2V A;  3CFP A;  3IAY A;  3AO2 A;  3ZSY A;  3RWU A;  3VN5 A;  4CJE A;  3DLE A;  4DTP A;  1SL1 A;  3HJF A;  3ULD A;  4ID5 A;  4AHV A;  1L3V A;  4E1N A;  4CJT A;  3QEI A;  3DRP A;  3I0R A;  3VQ7 A;  1HYV A;  3OYF A;  2W42 A;  2ZQB A;  3NGI A;  4FZX C;  4IG3 A;  4RW8 A;  4AH9 A;  3HVT A;  4CER A;  1D9F A;  3BDP A;  5KTQ A;  1JLF A;  3UIQ A;  4DMN A;  4CFA A;  2YKN A;  4CJQ A;  4HCB A;  2HHU A;  2DTU A;  3KK2 A;  4CJK A;  1IKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...