2RN2A

Structural details of ribonuclease h from escherichia coli as refined to an atomic resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural details of ribonuclease H from Escherichia coli as refined to an atomic resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1992-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rn2A00
3E01A 1O1WA 1D9FA 4CJWA 1RBVA 3M8RA 1RT5A 1WLJA 4DTXA 3O3GA 3OYLA 4RW4A 1QHTA 3OYEA 4F8RA 3OS0A 1EETA 3MEEA 5DK5A 4M45A 4DF4A 2HHWA 5J2QA 3VQ7A 3TWHA 4I2PA 1YTAA 4PQUA 4QCLA 3VQBA 3LP3A 5KTQA 4ZTJA 4FJXA 4KI4A 1UOCA 3LP1A 2VG6A 4CFBA 4E89A 3LPTA 1RBSA 4PUOA 3G10A 2IDOA 3SUNA 3LAKA 3DLHA 5EU7A 3TAQA 4FZYA 1TAUA 3ITHA 5DMRA 2I5JA 3OJUA 2DFEA 3T1AA 4BWMA 3O3HA 4CFCA 1NK8A 1HYSA 2HHUA 2YNGA 4C8OA 3I0SA 1I3AA 3PUFA 1RILA 1RDDA 3U6FA 4DSEA 4I9LA 3JYTA 3ZSYA 2XY5A 3RWUA 3NBPA 4HUGA 1WSHA 4GW6A 3ZSOA 1RT6A 4CFDA 4E7HA 3QO9A 4OLAA 4I9QA 5FRNA 1RTDA 3NAEA 3OS2A 3HK2A 2HNYA 4YFUA 1T7PA 1IH7A 3TAEA 4CJTA 1VSMA 3LPUA 4FVMA 4CHQA 4W5TA 1HYZA 1BQMA 2XY7A 4B9TA 4W5NA 3NDKA 2A1SA 4PA1A 5J2NA 2ZQBA 1X9MA 4FK2A 3OVNA 1FKOA 3AO2A 3ASMA 4DTJA 1U47A 3KJVA 1JLQA 1KTQA 1RDBA 4N56A 4Z4GA 4CEOA 3QIPA 4CIGA 4O44A 3SUQA 2E6LA 3DLKA 3S3OA 2RN2A 2XHBA 1QQCA 1EP4A 3B6OA 3L2WA 3V9UA 1Y97A 5C42A 3OYHA 4CGHA 2OA8A 2FC0A 2KFZA 4IG3A 4EZ6A 3NGYA 4CJQA 3RMCA 1JXBA 1GOAA 5FROA 4NCGA 3DRSA 1QSSA 4FM2A 1DLOA 4DQPA 2D0CA 1J53A 5T7BA 3KD1E 1YVUA 3KKSA 3RRHA 3S9HA 5HP1A 1EX4A 2R7YA 3QNNA 1K6YA 1KFDA 3LWLA 1NJXA 3SPZA 1T05A 2VWJA 3HJFA 4F4KA 4WE1A 4E7KA 3SI6A 4CK1A 2G8IA 5CY4A 1JLFA 3OYNA 5KRSA 3O4NA 1KRPA 4FJHA 1HYVA 4W5QA 1NK4A 1Q9YA 1IO2A 4DWIA 4M3UA 1VSFA 3OYCA 3I8DA 3VN5A 1L5UA 2HW3A 3PX4A 3K57A 1S6PA 4CHOA 3ZSQA 5HRPA 2BDPA 4GVMA 1ZBIA 1ZBHA 2YNIA 4DTMA 2FBXA 4R5PA 4KI6A 4LH4A 1HQEA 1TVRA 2PYJA 3ZSVA 3MAQA 4E3SA 1NKCA 3KD5E 3OYGA 1BISA 1JL1A 1RT3A 4CF1A 4ZHRA 4OPJA 4AHRA 3K5LA 4CHYA 1HNVA 3PX0A 4CJ5A 1BCOA 1QSLA 1SUQA 2JLEA 2OPQA 2YKMA 2IGIA 3OYAA 4QAGA 4DMNA 1ZYQA 4CCHA 5J1EA 5CYMA 2HHQA 4OKEA 2ZD1A 3AA4A 3MXMA 3SNNA 1TK5A 3NHGA 1RT7A 2KZZA 1WSGA 1TV6A 3TAPA 3HT3A 1L3VA 2Z1GA 3M8QA 1TKZA 4CJSA 4KB0A 4NYNA 1IG9A 3U3GA 3JSMA 1YTUA 3CFPA 1BHLA 4YNQA 3HL8A 4OKKA 2E4LA 2BE2A 3VQPA 4OPKA 1NK5A 1SKRA 1B9FA 1RT2A 1A5XA 3V9WA 4DG1A 3HYFA 4CGFA 3OYBA 4FLZA 4N41A 4FW2A 1S1VA 3L8BA 3LZJA 4E1NA 1QSYA 4J2EA 4Z4IA 4DLEA 1TK0A 4HCCA 1C1AA 3KLIA 4RW8A 3QERA 4J2BA 3T19A 4CF2A 4FJMA 4N76A 1U49A 4HUEA 4RG8A 3V1OA 2VWKA 4DQQA 1J5OA 1C0MA 3C6UA 4I2QA 3WNEA 4BACA 1LV5A 3VQEA 3M8SA 4ZTFA 1KVCA 1KCFA 3KK2A 2WONA 3V6DA 1TKTA 2ZE2A 3NGIA 4FM0A 3DLRA 4DTNA 3I0RA 1RDAA 4G1QA 4KREA 2HHXA 4H8KA 2P51A 3HPOA 3PY8A 4I7FA 4J2AA 2IC3A 3DLGA 4FJLA 1X9SA 4CK2A 3KLFA 2B6AA 4FLUA 1B92A 4FJJA 1IKXA 2O4IA 1W0HA 5KGWA 2OPSA 1S9GA 4CGDA 3P1GA 1D8YA 2OPRA 4KAZA 1A5VA 1N6QA 3ZT0A 4FW1A 2X78A 2Z1IA 4Z4EA 2KZMA 3EYZA 2EHGA 2G8FA 3ZSXA 4DFPA 1CLQA 2D0AA 4O0JA 1A5WA 1WSIA 3VQQA 4Q5VA 2B5JA 1Z25A 4LY7A 4CJPA 3SV3A 1RT4A 3V4IA 1F21A 1FXXA 1LAWA 1RCHA 4ELUA 3L2VA 3C94A 1GOBA 1JLEA 3IAYA 1XWLA 3IG1A 3RTVA 5J2PA 3K2PA 4NCBA 4IKFA 1QE1A 4JRPA 3AVHA 4JS5A 3OYDA 1WN7A 4M3WA 2WOMA 1VRTA 4M3RA 1ASWA 1Q8IA 3NF9A 4KFBA 5KI6A 4CJ4A 3RMBA 3SQ1A 1JLBA 4HCBA 1S1UA 3C95A 2P5OA 4E1MA 1NK9A 4CERA 2HHTA 4CK3A 3WNHA 3DRRA 4ICLA 4KKOA 3EZ5A 4DTSA 2RPIA 1J9AA 1D9DA 1BIZA 4B9NA 4IFVA 2VG5A 4OKJA 4N5SA 4FJ7A 4B9LA 4OGEA 3CQ8A 3PX6A 3LP0A 3VQ9A 3NF8A 3KKRA 4CJFA 1S9EA 4DQSA 4AHTA 1NKBA 5CYQA 5JS1A 3AVLA 1VSDA 4FZXC 2HB5A 4KHNA 4DFJA 1WSEA 4KTZA 4XIUA 3LANA 3RRGA 1JXEA 4DSIA 4KHWA 4KHYA 1RBRA 2YNFA 4FLVA 4F2SA 3KK1A 4CJUA 1U4BA 4DFMA 4O0IA 4DQRA 3K5NA 2A1RA 3NH2A 1BIUA 4QOZB 4B08A 3F73A 4FK4A 2F8TA 5SZTA 4B9UA 4FJ8A 1RT1A 3ZT4A 4CJEA 2LSNA 2HNZA 2P1JA 3RMDA 1XI1A 1SL2A 3V1QA 1BI4B 1KLMA 3BGRA 4C8KA 3NH1A 3AVIA 2QKBA 4DU3A 4AHUA 4HTUA 4ELVA 1NOYA 3D0PA 3ZT3A 4E7IA 4Z4FA 1D5AA 2IOCA 1LW2A 4HVJA 1BGXT 4BE0A 4CGGA 5D3GA 4DSFA 3OY9A 3VQ4A 2YKNA 4OJRA 4M3XA 5J2MA 4W5OA 4FJ9A 4DTUA 1CZ9A 4CJVA 3S3NA 3CFOA 1GOCA 1SKWA 3AVBA 3QLHA 3VA3A 3K5MA 3ZSZA 2YNHA 4DTPA 1VSIA 4ID5A 4C8MA 4CESA 3S3MA 4FZZA 3AVKA 1TKDA 2HHVA 3V1RA 2Y1IA 3NH0A 1NJWA 4CJ3A 3V9XA 3QEIA 4KO0A 1VSLA 2KTQA 3DOKA 2FBTA 2KFNA 3K5OA 4CFAA 4FLTA 3KK3A 1FKPA 4KV8A 1RBUA 4B9SA 3NE6A 2X6SA 3SJJA 5HRNA 3OS1A 3WNFA 2ITGA 4FCYA 3VQ5A 3TANA 3AA3A 1WSFA 3V81A 4CF9A 2PY5A 1ZBFA 1KLNA 3AVFA 3DLBA 3VA0A 1ITGA 3CM6A 4Z0UA 1NK0A 1NK6A 3KLEA 3MEDA 1CXQA 4DU4A 3RMAA 2KQ2A 3FFIA 4DSLA 2BANA 3L2UA 3LALA 2OZMA 1Z26A 4KHUA 3QIOA 1WSJA 4FM1A 1G15A 1WAFA 5CZ2A 3QEPA 1UA1A 4Q0BA 4O4GA 2X6NA 4W5RA 4DF8A 1DTTA 1LAVA 4IBNA 4CEDA 3AVNA 1NJZA 4KHSA 2OZSA 3NGZA 5HRSA 4FLXA 3ULDA 4C8NA 3DI6A 1EXQA 4B8CA 3BDPA 3MECA 4EP5A 3SUPA 3MXJA 4LSLA 3RR7A 4FJ5A 2Y1JA 3L2RA 1S5JA 1IKVA 4MQ3A 3UIQA 3CM5A 3HP9A 2HNDA 3DMJA 1UA0A 1NKEA 2RKIA 1JLAA 2G8HA 1DTQA 4O5BA 1KSPA 3PV8A 3K59A 3TARA 2QKKA 1QTMA 1VSEA 2YV0X 1QS4A 1C1CA 3ZT1A 3OJSA 3NFAA 3ZSRA 3L3VA 3M8PA 4BDZA 2DY4A 1WAJA 1TL3A 5SWMA 4CEBA 2Q3SA 3CFRA 4M3YA 1UAXA 4M3ZA 4KHQA 2FBVA 4GMJB 1RBTA 4RW6A 5HBMA 4CEQA 1KFSA 4ELTA 4FJKA 4JS4A 3A2FA 1RTHA 2EX3A 1VSHA 4CHPA 1KVBA 1BQNA 4DFKA 2D5RA 4KRFA 4ID1A 3AVJA 3SZ2A 4DS4A 1Q9XA 1VSJA 1VRUA 3QINA 3OYJA 1WNSA 1X9WA 2G8KA 3TABA 3AO5A 2HHSA 2NUBA 3RR8A 3O4QA 3AV9A 1C0TA 3KLGA 4FLWA 4KB1A 2ATQA 4AH9A 3NCIA 4C8LA 3SYZA 4CJKA 4DSKA 4PWDA 3LP2A 3WNGA 4DQIA 2BGGA 3KTQA 4AHCA 3VQDA 5FRMA 3B6PA 1IKWA 1TAQA 3ALYA 4CHNA 4BE1A 4B9VA 2E6MA 4H4OA 1REVA 3ZT2A 2OYQA 1R0AA 4Z4HA 3LZIA 3D45A 3PO5A 4HUFA 3QEWA 4FJNA 4AILC 1HQUA 1CXUA 4CEZA 1ZBUA 1TGOA 2IS3A 2XY8A 3T3FA 2F96A 5K14A 1B9DA 5C25A 3F9KA 3OYMA 3SQ2A 2ETJA 1LWFA 4LD0A 3HXMA 3HVRA 3HPHA 3KIOA 3P5JA 4JLHA 4KTWA 3VQ6A 3VQAA 4CF0A 4CJLA 4BDPA 4DS5A 3HPGA 1SV5A 4DTOA 2IAJA 4JRQA 1RNHA 1LWCA 1EKEA 3ISNC 5HROA 3TAMA 1RDCA 3MEGA 2F8SA 1JLGA 1TL1A 3AVGA 3P83D 4Y1CA 3CG7A 4Z4CA 4CIEA 3V9ZA 3L3UA 5JS2A 2PYLA 1JL2A 5I3UA 4OLBA 4CGIA 5E41A 2G8WA 1SL1A 4E7JA 2XO7A 3TI0A 1T03A 4E19A 3NF6A 3QESA 4N47A 1L3UA 4BWJA 3HSTB 1S1WA 2HVIA 4B9MA 3H08A 1J54A 1U04A 3DM2A 3DOLA 2YHBA 3DLEA 4OVLA 1TKXA 3TAFA 3SQ0A 4FYDA 1RTIA 1S1TA 4CGJA 3TAGA 4CEFA 5KGXA 1XC9A 4E7LA 4M3TA 1BL3A 2D0BA 4B8AB 3ZSWA 3IS9A 5HRRA 1LWEA 3SPYA 1YT3A 2FBYA 3OYFA 3AVMA 4CHZA 1JKHA 4BE2A 3DYAA 4L8RB 3KLHA 2QK9A 1RTJA 3NF7A 4CJRA 3HVTA 4PY5A 1JLCA 4B3OA 1BI4A 1FK9A 1HRHA 4CF8A 2GUIA 4MFBA 1NJYA 2QXFA 2XY6A 4H4MA 4BDYA 2DFHA 3C6TA 3DRPA 3OYIA 3V9SA 3AO3A 1XHXA 4CEAA 2Z1JA 3SCXA 4F3OA 3PO4A 1KVAA 3K58A 1BCMA 4NCAA 4HHTA 3AA5X 2AJQA 1S6QA 2RF2A 4OGCA 5I42A 4O55A 5C24A 4KPYA 1HPZA 4K8XA 4RW7A 3L2QA 4TSXA 3AO4A 3VQCA 2B4JA 4FXDA 3EY1A 4CIFA 3LWMA 1SKSA 3QEXA 4M41A 4CE9A 4AHVA 1L3TA 4F3TA 2G8VA 4DLGA 1C0UA 2HMIA 1HNIA 5CZ1A 3AVCA 3ZCMA 4KTQA 2HVHA 5HLFA 3IRXA 2DTUA 1ASUA 2JGUA 2X74A 4EZ9A 3HO1A 3AA2A 1I39A 1U48A 1C6VA 2G8UA 2GBZA 3AO1A 1SL0A 2P5GA 4CEEA 1IKYA 3G0ZA 1ASVA 1X1PA 3CYMA 1CZBA 2O4GA 2OPPA 3SV4A 3LAMA 1VSKA 3U3YA 3MXIA 1VK0A 5FDLA 1W9HA 3QETA 3AVAA 4DTRA 4K8ZA 4Y1DA 2VG7A 2KW4A 5KRTA 4E0DA 1NK7A 3QEVA 4IFYA 2Z1HA 3HM9A 3HP6A 3LDSA 4NYFA 4M42A 1S1XA 3VQ8A 1HMVA 4IG0A 2PZSA 4RW9A 4J2DA 3SUOA 2XRIA 4FJGA 1TK8A 1MU2A 2DFFA 2GV9A 2W42A 3SQ4A 1HJRA 2YHAA 1L3SA 3OYKA 4FLYA 1C1BA 3O3FA 3QNOA 4DSJA 4AHSA 4EP4A 1ZBLA 4DU1A 4FJIA 3THVA 1U45A 4LSNA 1N5YA 4FK0A 1LW0A 4CECA 3TR8A 4LH5A 4UQGA 4IDKA 1UWBA 1NOZA 1XHZA 1T8EA 4F2RA
chains in the Genus database with same CATH superfamily
1O1WA 2NLXA 4CJWA 5AQQA 2P9LA 5CHIA 1RT5A 4RW4A 3OS0A 1ILYA 4M45A 4I2PA 1YTAA 3C6AA 4QCLA 4KI4A 4FJXA 5BREA 5KQ8A 3THYA 4JNEA 3LPTA 2IDOA 3SUNA 3DLHA 1TAUA 3ITHA 2YNGA 1I3AA 3VPZA 1RILA 3O9SA 3U6FA 3QFUA 4U7BA 3MX5A 3ZSYA 3RWUA 1GLLO 2IVOA 3MN6A 3QO9A 3VEYA 3A8YA 1T7PA 1IH7A 3TAEA 1VQ7N 4CJTA 5JLHA 3SMSA 4CHQA 4W5TA 2V7YA 1HYZA 3O1BA 1HNWK 2A1SA 4DB3A 2ZWHA 2O8DB 1U47A 1JLQA 2A6AA 2E6LA 3DLKA 1QQCA 3OYHA 4CGHA 2FC0A 1GLAG 4FWKA 3RMCA 1JXBA 1W7AA 3DRSA 3QDKA 3DXKA 4DQPA 2D0CA 1J53A 5T7BA 1VQMN 1YVUA 1C0GA 5HP1A 3QNNA 3LWLA 5BR9A 1SZ2A 3SI6A 3ENOA 4CK1A 3MWPA 3O4NA 3TU5A 3GG4A 1NK4A 1IO2A 4MLHA 4KH5A 3MMVA 3L0QA 3VN5A 1S6PA 3LDOA 1SAZA 4M7YA 4QS9A 2FBXA 4EIAA 4KHPK 2ASPA 1TVRA 4X62K 3K5LA 4AHRA 1OVYA 1HNVA 3PX0A 1QSLA 2OPQA 2IGIA 3OYAA 1ZYQA 1TUUA 5J1EA 2HHQA 4OKEA 3MXMA 1WSGA 3VF6A 3HT3A 4ISGA 4BROA 4KB0A 3U3GA 1YTUA 5AJ3K 3VQPA 2ASOA 5EY4A 1YF5L 3HYFA 3OYBA 3E66A 1G99A 1S1VA 4FW2A 3L8BA 4Z4IA 1HJOA 4HCCA 4RW8A 4BVPA 3T19A 3EZWA 3TPQA 3VEVA 1W97L 3FGUA 1S22A 2P9UB 2HBKA 3M8SA 4ZTFA 1KVCA 1KCFA 1VQ8N 3UKUB 2ZE2A 2V7ZA 3DLRA 1RDAA 4G1QA 2P51A 4DV4K 3KK7A 1T3VA 4JD2A 1X9SA 1YJWN 4FLUA 1B92A 3BZCA 3C7NB 4CGDA 4PL7A 2GUPA 4BG8A 4CBWA 4ISEA 3EYZA 2E8AA 2F9TA 2NRWA 3G25A 4DFPA 2E1YA 2FF6A 3WEEB 1F21A 5LY3A 1LAWA 3CMEN 1XWLA 5DM6L 3GE1A 1QE1A 3HM8A 3OYDA 4M3WA 4LF6K 2WOMA 4BGAA 4CJ4A 1X3MA 3C95A 4CK3A 3DRRA 4BREA 4DTSA 4JHDA 3CXCM 1BIZA 4IDHA 1RFQA 4N5SA 4B9LA 3CCUN 3NF8A 4DR3K 4DQSA 4FSVA 1Y64A 3O9QA 1VSDA 5F2RA 4DFJA 4XIUA 3LANA 4DSIA 1JXEA 4KHYA 3KK1A 4JEPA 4DFMA 4DQRA 4DR6K 2O8CB 5GIOA 4FK4A 2F8TA 5SZTA 3M1FA 4FJ8A 3ZT4A 4H5NA 2UUBK 4YDUA 3V1QA 1BI4B 4DU3A 4HTUA 3ZYYX 4LFBK 3WQTA 3J8AA 3JS6A 5F1XA 3CD6N 4BE0A 4DSFA 1M1KO 2YKNA 3ENBA 2W6KA 4OJRA 5AQXA 3RSEB 1VQON 5F0XA 3MDQA 1N8RO 3FZLA 3T69A 2F9WA 3AVBA 3QLHA 3VA3A 2YNHA 4ID5A 4C8MA 3AVKA 4A2BA 3NH0A 1OH7A 1YVNA 4KO0A 1VSLA 4IXCA 3F9MA 5HRNA 3CCVN 5FLXO 1WSFA 2QWMA 1KLNA 3CM6A 2QTDA 2YHWA 1NK6A 3I56N 4DU4A 3RMAA 4DSLA 3H45C 4H5TA 1UA1A 4FPAA 2X6NA 4DF8A 4IBNA 2QM1A 2H3GX 4FWLA 2KLAA 1M90O 5TKWA 3L2RA 3WXMB 1W2BM 4MQ3A 4K42A 1VQNN 2HNDA 3CJ1A 1D4XA 3TTFA 3AAPA 4O5BA 4OO1J 3K59A 1GLFO 2QKKA 1QTMA 1VSEA 3ZSRA 4H03B 1ZXOA 4BRNA 1WAJA 1YAGA 5SWMA 4CBXA 4M3ZA 4KHQA 4RW6A 5HBMA 4DR2K 4FJKA 1DGKN 1YXQA 3VTIA 4JS4A 2P9NB 1KVBA 1BQNA 4K43A 4DFKA 3DJCA 4KRFA 4ID1A 1BWFO 1Q9XA 4KAZA 3MX2A 3QINA 3OYJA 1X9WA 2HHSA 2QW9A 3ZETA 4GY2B 3O4WA 4YDUC 4X66K 3R9PA 2VCPA 2BGGA 2OTLN 3KTQA 4AHCA 5FRMA 1TAQA 2E6MA 3L4IA 3T7ZA 1R0AA 4Z4HA 3D45A 4H0XB 5AQUA 3KVGA 3QEWA 1HQUA 4FJNA 3CJ7A 1HNXK 3FR0A 5K14A 1B9DA 3F9KA 4B3RK 3HXMA 3VQAA 3P5JA 4CF0A 4CJLA 4C1NI 3J7YP 3VGMA 1RNHA 3QFPA 1LWCA 1IV0A 4GV6A 3FZHA 1TL1A 4WCEL 4JV5K 1VQPN 4CIEA 3L3UA 4LC9B 2WTUA 4OLBA 3EO3A 5AQWA 4CGIA 2P9PA 2HBLA 4B1ZA 4IFEA 3NF6A 1LCUA 1E4FT 4BWJA 3HSTB 1KXPA 3CPWM 4LF4K 2CH5A 1J54A 4CZFA 3TAGA 1J6ZA 2PFUA 1XC9A 3ZSWA 5AQSA 4A61A 2UYTA 1YT3A 2FBYA 3BZKA 4CHZA 3KLHA 2QK9A 1RTJA 4I6MB 4CJRA 4DR4K 1OH8A 4B3OA 4LF9K 1NJYA 4I6MA 2DFHA 3DRPA 3V9SA 5GIPA 3SCXA 3K58A 2A41A 4HHTA 4OGCA 4EAHD 4TSXA 3AO4A 3OBYA 4C23A 3A5LC 2PAVA 4AHVA 1NU0A 2G8VA 1Q7YO 4CZMA 4DLGA 1C0UA 5CZ1A 2X74A 3PIOL 4EZ9A 1I39A 1C6VA 3AO1A 1SL0A 1NGIA 3A5OC 4CEEA 3D2EA 1IKYA 1X1PA 3CCRN 3W3DA 1LOTB 2OPPA 3SV4A 1RDWX 1VSKA 1VK0A 5FDLA 3WXKA 5EOYA 3D2EB 1S72N 3RSEA 4DTRA 4XH4A 5KRTA 2GELA 4Y0WA 4X64K 3QEVA 3HM9A 1S1XA 4IG0A 2IVNA 3SUOA 4FJGA 1TK8A 4L3QA 2DFFA 2W42A 5EVZA 3SQ4A 3CCEN 4DQ8A 3SAHA 5LMUK 3R8EA 3M6GA 4GV3A 3VGKA 5AQIA 3TR8A 3N4QA 4IDKA 1UWBA 3HSCA 1NOZA 4NB4A 3LDPA 4F2RA 3E01A 1RBVA 5M1KA 4DTXA 5GAHP 3OYEA 4F8RA 1EETA 2HHWA 5J2QA 2W41A 3TWHA 5E26A 2VWBA 3VQBA 5KTQA 3FZKA 3A5MC 5AQHA 5BRFA 2VQFK 5EU7A 5DMRA 2A40A 2DFEA 4A57A 5FPDA 3T1AA 4O8KA 5E84A 3O3HA 3N4PA 1NK8A 2NRVA 4C8OA 3RVCA 4BRIA 4DUZK 1CZAN 4OLAA 5FRNA 1RTDA 3OS2A 4YFUA 3K9KA 2NRXA 3CJBA 3LPUA 4FVMA 4WQ5C 4W5NA 3NDKA 4PA1A 4E1JA 1Q82O 3AO2A 3Q7BA 2ZGZA 2WC9A 3WXIA 3S3OA 3B6OA 1EP4A 3IFRA 1YUWA 1BG3A 2OA8A 1HLUA 3LDQA 4FWOA 4EZ6A 3NGYA 4CZHA 2KFZA 1EO1A 4FM2A 4F9OA 3KD1E 3KKSA 4BY9C 1E3MA 4CD3A 2GEMA 3THWB 1KFDA 1T05A 1U6ZA 3L4QA 2Q31A 1WB9A 4FJHA 5M1NA 1HYVA 4DWIA 1VSFA 1MA9B 1ZBHA 3K57A 2BDPA 5HRPA 3HRGA 4WFNL 4BVOA 1ZBIA 2YNIA 3G71N 4R5PA 3C0BA 1HQEA 1OKJA 3U8XA 3ZSVA 3MAQA 4E3SA 5AQFA 3AAQA 1BISA 4ZHRA 1RT3A 2HOEA 2YCHA 4CF1A 3JAMO 4OPJA 4YOXA 4FWNA 4FVUA 2JLEA 4JI5K 2YKMA 5AQZA 4CCHA 2ZD1A 4PKIA 4DUYK 1TK5A 1L3VA 2Z1GA 1TKZA 4NYNA 1IG9A 3CFPA 4CZKA 1BHLA 2E4LA 2BE2A 1JCGA 1B9FA 1ATRA 4A59A 1Z05A 4DG1A 4N41A 1E4GT 4BR2A 3CCMN 3E1YA 4DLEA 1MDUB 3KLIA 3W0LA 1GLCG 2ASMA 4FJMA 5CR4A 3BP8A 4HUEA 1J5EK 3ID6A 3V1OA 3IUCA 1C0MA 3C6UA 4I2QA 1LV5A 3E9LA 4BC4A 3KK2A 3V6DA 1NGEA 3O1WA 3CERA 4B1YB 2YHXA 3U4LA 1BU6O 3DLGA 2B6AA 2UUCK 1IKXA 4DV2K 5KGWA 4B3SK 2OPSA 4LFAK 3P1GA 2OPRA 2HBJA 1N6QA 3A5NC 3DXKB 2X78A 2Z1IA 3ZLJA 4Z4EA 2KZMA 2EHGA 2G8FA 1A5WA 4MDBA 1Z25A 1S3XA 1RT4A 2FF3B 3V4IA 1RCHA 3SJHA 1GOBA 3SLCA 4NCBA 4BRAA 4JRPA 1QQNA 1ASWA 1Q8IA 2AA4A 4KFBA 5KI6A 4LFCK 3KWGA 3VMFB 4HCBA 1S1UA 3Q7CA 2P5OA 4E1MA 2HHTA 2UXBK 1NGGA 3EZ5A 2RPIA 1J9AA 2E2OA 3J7ZO 2O8CA 2A5XA 4IFVA 2VG5A 4FJ7A 4B9QA 3LP0A 3VQ9A 4WFBL 3KKRA 5CYQA 4JI8K 2HB5A 3VESA 1WSEA 4KTZA 4PKHA 3I33A 2YNFA 3C6HA 5EX5A 4H0TB 1BIUA 3F73A 4OX9K 4B9UA 2LSNA 2Q0RA 3BGRA 4BR9A 3NH1A 4AHUA 3D0PA 3ZT3A 2IOCA 1NM1A 4CGGA 4W5OA 1SKWA 3CFOA 1GOCA 1IBKK 4LF7K 4BR7A 4JYAK 1VSIA 2JWKA 4FZZA 2Q97A 3DWLA 4MLEA 4AQYK 3K5OA 4CFAA 1IG8A 1RBUA 1KC8O 3NE6A 4JI3K 2GX9A 2ITGA 3TANA 3AA3A 1ZBFA 3AVFA 1NGBA 3O5BA 1NK0A 5IWAK 1VQLN 3DLLL 3MN9A 3FFIA 3LALA 1Z26A 4KHUA 3UKRA 1WSJA 4FM1A 1G15A 5TKYA 4Q0BA 1LAVA 5ADXH 3ZEUA 3AVNA 3NGZA 5HRSA 2VGNA 2CGJA 1EXQA 1NG9A 2FXUA 4EP5A 3THXA 2O8EB 1S5JA 1IKVA 4B3TK 3WXJA 1BO5O 1JLAA 2G8HA 3TARA 4EFHA 3SAFA 3ZETB 4JN4A 4BDZA 3NFAA 2P9KA 3HOTA 1TL3A 3MWTA 2QWRA 2P9NA 2FBVA 4NXMK 3E9PA 3THYB 2D5RA 3AVJA 3SZ2A 1VSJA 1JJ2M 1WNSA 5AQPA 3RR8A 3O4QA 3KLGA 3M3ZA 5BR8K 2P9LB 4WF9L 3SYZA 4CJKA 4PWDA 2FSKA 3B6PA 3TSPA 2V51B 4BE1A 1REVA 3ZT2A 2A3ZA 4H5RA 1NLVA 4HUFA 4NLCA 4CEZA 1ZBUA 2IS3A 5JVGL 2F96A 1ZBSA 3OYMA 3SAGA 3QICA 5LJVA 2UU9K 3HPHA 3KIOA 3CF5L 4BDPA 1ESVA 2EWSA 4DS5A 2CGLA 4JAXA 3HPGA 2IAJA 2VGMA 3ISNC 5HROA 4JKCA 3VERA 2P9IB 2F4VK 4OPAA 3P83D 1QVFM 4Y1CA 4Z4CA 3V9ZA 5JS2A 2YX6A 4BC5A 2G8WA 1V4SA 1SL1A 2KHOA 4E7JA 3WXLA 3NMUA 4A62A 4E19A 3NVKA 1VQKN 1S1WA 2HVIA 3F2KA 4BRKA 2A42A 3CPEA 1YJNN 3TAFA 1QQMA 3DLEA 1TKXA 3SQ0A 4FYDA 4DR5K 4BR4A 4E7LA 4B8AB 4FOEA 3JXUA 5HRRA 1Z6RA 3AVMA 3HVTA 1BI4A 1FK9A 5LMNK 3QMLA 3FE1A 3O08A 2QXFA 3ULEB 1EQYA 2NRHA 4BDYA 3H3NO 3AO3A 4CEAA 3BUZB 2QWQA 2Z1JA 1V4TA 4NCAA 5LL6Z 2P9KB 3PLAA 2RF2A 2UUAK 5C24A 1TYQB 2B4JA 2P9SB 3LL3A 5AQMA 2HF4A 3EEQA 1HKCA 5GAEP 4F3TA 4G9ZA 4ILJA 2HMIA 1HNIA 3ZCMA 1EWRA 1YITN 1ASUA 1U48A 5BPLA 2D1KA 4M7XA 2DPNA 4A2AA 4K8ZA 1NK7A 2Z1HA 4MO4A 1HX1A 5AR0A 3F5TA 5A2QO 4FWSA 4NYFA 2D0PA 3HP6A 4IO9L 4M42A 3M5RA 1HMVA 3CMAN 2PZSA 3P39A 2XRIA 1VQ6N 1MU2A 3NVMA 1HJRA 1C1BA 3CJ9A 4WQ4A 2HBMA 4AHSA 4YOTA 1KD1O 3LM2A 1Q86O 3EKUA 1QZ5A 3LDLA 4LSNA 5JICA 1N5YA 4MDAA 1XHZA 1YIJN 4H5WA 1D9FA 5JVHL 3OYLA 4MO5A 4B1WB 5DM7L 4J8FA 1XQSC 5DK5A 4DF4A 1GLDG 3ULEA 4XEIA 1VQ4N 4ZTJA 1UOCA 3LP1A 4PUOA 2E2PA 3G10A 3CQXA 3LAKA 3CQYA 1HYSA 3HI0A 3I0SA 5KPZA 2O8EA 4AM6A 3WT0A 4DV3K 4DSEA 4I9LA 3JYTA 4BRGA 2XY5A 4HUGA 1WSHA 1RT6A 4JKDA 1HR0K 4I9QA 3HK2A 2D0OA 4YOUA 2HF3A 5IT9O 2XY7A 1BQMA 4B9TA 2IIRA 1QZ6A 4FK2A 2HMPA 4YOWA 1FKOA 3ASMA 1XUPO 1MWKA 3EE8A 1KTQA 1RDBA 3OHRA 4Z4GA 2O8BB 3QIPA 4O44A 3SBTA 3P31A 3SUQA 2XHBA 3UKRB 3L2WA 4IG3A 5BPMA 5FROA 4BQLA 1DLOA 4WFAL 3S9HA 4KH6A 2R7YA 1HKBA 3BY5A 1NJXA 4JI6K 2QA4N 3H1QA 4F4KA 4E7KA 4V19S 2G8IA 2E88A 5CY4A 5C10A 3OYNA 1KRPA 4IOAL 4JD2B 3I8DA 1YI2N 4CHOA 3ZSQA 1N34K 4DTMA 3UB5A 1IJJA 4KI6A 4LH4A 3MN7A 2GWKA 2PYJA 1ATNA 2YI1A 2WUSA 1JL1A 1HPMA 3OW2M 4OPHA 4CJ5A 1BCOA 3BEXA 1SUQA 5LJWA 3CCQN 4BRFA 4QAGA 4DMNA 2OTJN 3AA4A 3EN9A 1Q81O 3M8QA 4YORA 4CJSA 1SKRA 4YNQA 3HL8A 4OPKA 1RT2A 1A5XA 4JI0K 3V9WA 4CGFA 1QSYA 1TK0A 3QERA 4J2BA 4CF2A 4O5FA 5KPTA 2VWKA 4BACA 3CCLN 4BRCA 3KWIA 1TKTA 5AQOA 3ID8A 4DCHA 4KREA 4FPBA 4H8KA 5MLCQ 3HPOA 2HHXA 2IC3A 3OA9A 4M63C 1WUAA 1W0HA 3FZFA 1S9GA 4FL9A 2BUPA 1D8YA 1H1VA 4CW7B 4FW1A 1P8ZA 2WFBA 1ZC6A 2QWOA 5C2DA 3H3OB 2D0AA 2KKZA 4BRDA 3IMXA 4O0JA 3AGKA 4Q5VA 4LY7A 4WQ5A 1FXXA 4ELUA 3L2VA 3C94A 3U9ZA 1JLEA 3IAYA 3RTVA 5J2PA 3K2PA 5FPMA 4ISFA 2WBNA 1VRTA 2QWPA 3NF9A 3WUHA 1JLBA 3CETA 1IBMK 1NGDA 1NK9A 4CERA 4RTFD 5KQDA 3WNHA 3UE5A 4OKJA 2QEXN 4OGEA 3DXMB 3CQ8A 3PX6A 3TSQA 4AHTA 5AQGA 5JS1A 3AVLA 4FZXC 1EWQA 4KHWA 4FLVA 3ENHA 3CJAA 3LM9A 3K5NA 3NH2A 4QOZB 4B08A 3T1YK 4IZ9A 3E9OA 1WOQA 4BC3A 1XI1A 3VEXA 1KLMA 4C1NK 3AVIA 4ELVA 1NOYA 4E7IA 1FW6A 1LW2A 4HVJA 4JKEA 2BTFA 4FWRA 3VETA 5J2MA 4DTUA 3TTDA 4IEEA 5BN8A 4FOIA 3FFKB 3K5MA 2D4WA 3HOSA 4CESA 4JI4K 2HHVA 3V1RA 2Y1IA 3THXB 1NJWA 4CJ3A 3O8MA 1NNEA 2I7NA 3IKMA 3G4SN 2FBTA 2KFNA 1FKPA 2NZTA 1T6CA 1BUPA 3OS1A 1XMOK 4JKGA 3VQ5A 3TTCA 4CF9A 2PY5A 1X9JA 2VQEK 3KLEA 1IBLK 5AQYA 4IJNA 1CXQA 1P90A 4BR5A 2IVPA 2OZMA 3L2UA 3A0IX 3WQUA 3QEPA 1WAFA 5CZ2A 4O4GA 4XH5A 4W5RA 2P9UA 1DTTA 4CEDA 4KHSA 4O8UA 3PSFA 2OZSA 3AGRA 1K73O 3ULDA 3SBGA 3DI6A 1N36K 4B8CA 3MECA 3MXJA 4LSLA 1YJ9N 3RR7A 4FJ5A 2Y1JA 1ATSA 3CM5A 1NGAA 2Q0UA 2P9SA 1UA0A 1NKEA 2RKIA 2ZJQL 3O9TA 3B8AX 3PV8A 4R79A 2QWNA 1HKGA 2YV0X 2VYPA 1C1CA 3ZT1A 3OJSA 2DY4A 3M8PA 5I9EB 1QQOA 4M3YA 3CFRA 1UAXA 5GAGP 4GMJB 1RBTA 1KFSA 2RHKA 3A2FA 1RTHA 2EX3A 2PBDA 4QS8A 1C0FA 1O13A 2JWLA 4DS4A 1VRUA 2G8KA 3AO5A 4GNIA 5ADXA 3AV9A 1C0TA 4FLWA 1NMDA 1QHAA 2ATQA 3NCIA 4BRMA 3LP2A 4JK9A 1IKWA 3ALYA 4CHNA 5BPNA 4B9VA 4H4OA 4IJAA 3AY9A 3PO5A 3D6RA 1CXUA 4CZJA 4B3MK 1TGOA 1RDUA 2XY8A 4IOXA 2ETJA 4LD0A 3VQ6A 4KTWA 2P9IA 1OH5A 5EXWA 4BRHA 3J81O 1SV5A 4DTOA 1XMQK 1EKEA 3TAMA 3MEGA 3KZBA 2F8SA 2FLOA 3AVGA 4JK7A 3H6EA 2RE2A 3CG7A 3CC4N 2AP1A 3HZ6A 1JL2A 4JKBA 5I3UA 5E41A 1T03A 3VGLA 1L3UA 4B9MA 3H08A 1U04A 3ZX2A 1Q18A 4OVLA 4CGJA 5KGXA 5JMVA 2YHYA 3IS9A 1LWEA 3OYFA 2GTDA 2Q36A 3EL2A 4GKJK 1NJIO 3DYAA 4L8RB 5AFUA 1HNZK 4PY5A 1NWKA 4FWMA 1NGHA 5M1QA 2XY6A 3C6TA 3SK3A 1XHXA 1KVAA 3AA5X 2AJQA 1S6QA 1U2VB 4YOVA 5I42A 3VQCA 4CZIA 4IWVA 3LWMA 3THWA 2P9PB 1L3TA 4JI7K 2ZJRL 3DXMA 4AF1A 3EKSA 2JGUA 3HO1A 3AA2A 2NNWA 4H0VB 2P5GA 4HTLA 1ASVA 1CZBA 3D2FB 5AZJA 3LAMA 3U3YA 1W9HA 3AVAA 4FXDA 4Y1DA 4E0DA 2KW4A 4IOCL 2Q2RA 3VQ8A 2J4RA 4RW9A 4YHHK 4NLBA 1YHQN 1L3SA 3OYKA 3VF2A 4FLYA 3O3FA 2E2QA 3QNOA 3OTOK 4DU1A 1U2VA 1TYQA 4DKWA 4FJIA 1U45A 4CECA 1VAZA 4UQGA 4WQ4C 4CJEA 1T8EA 3M8RA 4AM7A 1WLJA 3O3GA 4X65K 1QHTA 5GADP 4CVNE 3MEEA 3VF4A 3VQ7A 3GDQA 4B1VA 4PQUA 3LP3A 3R1XA 3DAWA 3PSIA 2VG6A 5AQLA 4CFBA 4E89A 1RBSA 5CE3A 2ZM6K 1QVGM 2FSNA 4FZYA 3TAQA 2I5JA 3OJUA 1DEJA 3HBTA 4BWMA 4BGBA 4CFCA 1WBBA 1KAYA 2HHUA 4NO7A 3PUFA 1XNQK 1K8AO 1RDDA 1NGJA 5M1PA 3NBPA 4GW6A 1OH6A 3ZSOA 4E7HA 4CFDA 4H0PA 3NAEA 2HNYA 2OCEA 3C65A 1K8KB 1R59O 1VSMA 4JHDB 1X9MA 5J2NA 2ZQBA 3OVNA 5C2FA 4DV7K 4DTJA 3KJVA 4N56A 4CEOA 4CIGA 3QBWA 1KQSM 4WYBA 2RN2A 3V9UA 1Y97A 5C42A 3AARA 4CJQA 2CH6A 1GOAA 4NCGA 1QSSA 1BA0A 4CD1A 4DV1K 3RRHA 1EX4A 1K6YA 4BRLA 3R6MA 3R3LA 3SPZA 3KHYA 2VWJA 3HJFA 4WE1A 1JLFA 5KRSA 3FLCO 1NGFA 4DV0K 4W5QA 1Q9YA 4M3UA 2W6LA 4ILHA 3OYCA 2HW3A 1L5UA 3PX4A 4GVMA 4BRQA 3D2FA 3BF1A 5AZJB 5AQTA 4Z94A 1NKCA 3KD5E 3OYGA 3G6EN 4CZGA 5ELZA 4CHYA 4LF8K 4A5AA 2UXCK 5CYMA 3SNNA 3NHGA 1RT7A 2KZZA 1TV6A 3TAPA 1NBWA 1NGCA 1OVQA 3JSMA 3GOIA 1NK5A 4OKKA 5C0YA 3OBWA 4FLZA 4J2EA 4IEIA 3LZJA 4E1NA 3ATUA 4H0YB 1C1AA 4GKKK 1T6DA 4N76A 3QBXA 2I7PA 1U49A 3O6WA 4RG8A 4CBUA 4DQQA 1J5OA 3H46O 3WNEA 3VQEA 5H1SQ 1KAZA 2WONA 3NGIA 4FM0A 4DTNA 3I0RA 4JKGB 3PY8A 1FJGK 4I7FA 4J2AA 4FJLA 4CK2A 3KLFA 4FJJA 2O4IA 3I55N 4JKHA 1A5VA 3ZT0A 5BN9A 3C7NA 1T44A 3ZSXA 3U9DA 1CLQA 3VQQA 1WSIA 2B5JA 4CJPA 3SV3A 3IG1A 1N32K 4CI6A 4IKFA 3AVHA 4JS5A 4DR1K 4KH4A 1WN7A 2ITMA 4M3RA 4CJ7A 3RMBA 3SQ1A 1XNRK 4JI2K 4ICLA 4KKOA 1DT9A 1D9DA 3CC7N 1BA1A 1NMNA 4B9NA 4HWIA 4UY8O 5AFUH 4K0KK 5HOOA 4CJFA 1S9EA 1NKBA 3O80A 1VHXA 4EHTA 4KHNA 3RRGA 1RBRA 4F2SA 4CJUA 4DHYA 1U4BA 4JKAA 4O0IA 2A1RA 2HSTA 1RT1A 2HNZA 2E2NA 2P1JA 3RMDA 1SL2A 4C8KA 4CZEA 2QKBA 4IO8A 3L6QA 4Z4FA 1D5AA 1BGXT 1DKGD 3D7EO 5D3GA 3OY9A 4B1XB 4YOYA 3VQ4A 2Q1NA 4M3XA 4FJ9A 2W40A 3IDHA 3CI5A 1CZ9A 4CJVA 4JKFA 3QB0A 3S3NA 3CHWA 3ZSZA 4DTPA 2FSJA 3S3MA 3CC2N 4CZLA 4H5VA 3K9JA 1TKDA 5BRDA 3V9XA 3QEIA 3P38A 2KTQA 2BH1A 1TUYA 3DOKA 5C12A 4FLTA 3GBTA 3KK3A 3EE9A 5B8HA 4KV8A 4B9SA 2X6SA 3SJJA 4PHTX 5AQJA 3WNFA 4FCYA 4GVEA 3V81A 4GV9A 4ILGB 3DLBA 5AQRA 3VA0A 1ITGA 4Z0UA 3MEDA 1KAXA 5BRHA 2KQ2A 3VENA 2BANA 3QIOA 4FWQA 1BOTO 2QI2A 4YY3K 1NJZA 3UKUA 5HL7L 3PIPL 4K25A 4FLXA 4C8NA 3VOVA 5JLFA 3BDPA 3ZX3A 3SUPA 3HTVA 5KPRA 3VTHA 5AQKA 4BC2A 3UIQA 3HP9A 3DMJA 2O8FB 1DTQA 1KSPA 5GINA 3GL1A 4U67L 1QS4A 3SMPA 1X3NA 3L3VA 2YJFA 2ZF5O 4CEBA 2Q3SA 3VEOA 4CEQA 4ELTA 5FPNA 5AQNA 4CHPA 1VSHA 3H1VX 1BDGA 3LDNA 3TABA 1GLJO 1GLBG 2NUBA 4JI1K 3VEWA 3MCPA 4KB1A 1MWMA 3WEEA 3ZX0A 4AH9A 4C8LA 4DSKA 2ZGYA 4PL8A 3WNGA 4DQIA 3MK6A 5AZIB 3VQDA 2QXLA 4DV6K 3TSUA 2CGKA 2OYQA 3LZIA 4LF5K 4AILC 5M1FA 3T3FA 4BQZA 5C25A 3SQ2A 1LWFA 3HVRA 4JLHA 4A5BA 4FWPA 4JRQA 4RWTA 3MCAB 5M1OA 1RDCA 4PKGA 1JLGA 1GLEG 4QS7A 3I8BA 2PYLA 3TI0A 2XO7A 3ATVA 3QESA 4N47A 4NXNK 2UXDK 3DM2A 3DOLA 2NRRA 2YHBA 1RTIA 1S1TA 3FZMA 1JCFA 4CEFA 2O8FA 4FO0A 4M3TA 1BL3A 2D0BA 2O8DA 2YJEA 3BF3A 3K0SA 3SPYA 4RCHA 1JKHA 4BE2A 3NF7A 1VQ5N 1HUXA 1JLCA 1HRHA 3ZEUB 4CF8A 2GUIA 4MFBA 4H4MA 2E5LK 3OYIA 2E1ZA 4DV5K 4F3OA 3PO4A 1BCMA 4O55A 4KPYA 1HPZA 4K8XA 4RW7A 3L2QA 4XH1A 1SS6A 4BR0A 4KBOA 3EY1A 4BG9A 4CIFA 1SKSA 3QEXA 4M41A 4CE9A 2V52B 4KTQA 2OANA 3O9RA 3AVCA 2HHHK 2HVHA 5AQVA 5HLFA 3IRXA 2DTUA 3O9UA 2NRZA 2G8UA 4DR7K 2GBZA 1K9MO 4K41A 3CJCA 3CYMA 3G0ZA 2O4GA 3MXIA 3T1HK 3QETA 2VG7A 1JCEA 4IFYA 1VQ9N 1RGIA 3LDSA 4H0OA 4EHUA 3VEZA 2ZJPL 4J2DA 3J7AP 2QWLA 1XC3A 2NRTA 2F7TA 1K8KA 2GWJA 2GV9A 2YHAA 3P4IA 2E20A 3J80O 4DSJA 5FPEA 4EP4A 1WBDA 3MN5A 3CCJN 1ZBLA 1SQKA 3CCSN 4JK8A 1N33K 3THVA 1I94K 3S41A 4FK0A 1LW0A 5C15A 3CIPA 4LH5A 5AZIA 4BRPA 2O8BA 4B1UB
chains in the Genus database with same CATH topology
3E01A 1O1WA 1D9FA 4CJWA 1RBVA 3M8RA 1RT5A 1WLJA 4DTXA 3O3GA 3OYLA 4RW4A 1QHTA 3OYEA 4F8RA 3OS0A 1EETA 3MEEA 5DK5A 4M45A 4DF4A 2HHWA 5J2QA 3VQ7A 3TWHA 4I2PA 1YTAA 4PQUA 4QCLA 3VQBA 3LP3A 5KTQA 4ZTJA 4FJXA 4KI4A 1UOCA 3LP1A 2VG6A 4CFBA 4E89A 3LPTA 1RBSA 4PUOA 3G10A 2IDOA 3SUNA 3LAKA 3DLHA 5EU7A 3TAQA 4FZYA 1TAUA 3ITHA 5DMRA 2I5JA 3OJUA 2DFEA 3T1AA 4BWMA 3O3HA 4CFCA 1NK8A 1HYSA 2HHUA 2YNGA 4C8OA 3I0SA 1I3AA 3PUFA 1RILA 1RDDA 3U6FA 4DSEA 4I9LA 3JYTA 3ZSYA 2XY5A 3RWUA 3NBPA 4HUGA 1WSHA 4GW6A 3ZSOA 1RT6A 4CFDA 4E7HA 3QO9A 4OLAA 4I9QA 5FRNA 1RTDA 3NAEA 3OS2A 3HK2A 2HNYA 4YFUA 1T7PA 1IH7A 3TAEA 4CJTA 1VSMA 3LPUA 4FVMA 4CHQA 4W5TA 1HYZA 1BQMA 2XY7A 4B9TA 4W5NA 3NDKA 2A1SA 4PA1A 5J2NA 2ZQBA 1X9MA 4FK2A 3OVNA 1FKOA 3AO2A 3ASMA 4DTJA 1U47A 3KJVA 1JLQA 1KTQA 1RDBA 4N56A 4Z4GA 4CEOA 3QIPA 4CIGA 4O44A 3SUQA 2E6LA 3DLKA 3S3OA 2RN2A 2XHBA 1QQCA 1EP4A 3B6OA 3L2WA 3V9UA 1Y97A 5C42A 3OYHA 4CGHA 2OA8A 2FC0A 2KFZA 4IG3A 4EZ6A 3NGYA 4CJQA 3RMCA 1JXBA 1GOAA 5FROA 4NCGA 3DRSA 1QSSA 4FM2A 1DLOA 4DQPA 2D0CA 1J53A 5T7BA 3KD1E 1YVUA 3KKSA 3RRHA 3S9HA 5HP1A 1EX4A 2R7YA 3QNNA 1K6YA 1KFDA 3LWLA 1NJXA 3SPZA 1T05A 2VWJA 3HJFA 4F4KA 4WE1A 4E7KA 3SI6A 4CK1A 2G8IA 5CY4A 1JLFA 3OYNA 5KRSA 3O4NA 1KRPA 4FJHA 1HYVA 4W5QA 1NK4A 1Q9YA 1IO2A 4DWIA 4M3UA 1VSFA 3OYCA 3I8DA 3VN5A 1L5UA 2HW3A 3PX4A 3K57A 1S6PA 4CHOA 3ZSQA 5HRPA 2BDPA 4GVMA 1ZBIA 1ZBHA 2YNIA 4DTMA 2FBXA 4R5PA 4KI6A 4LH4A 1HQEA 1TVRA 2PYJA 3ZSVA 3MAQA 4E3SA 1NKCA 3KD5E 3OYGA 1BISA 1JL1A 1RT3A 4CF1A 4ZHRA 4OPJA 4AHRA 3K5LA 4CHYA 1HNVA 3PX0A 4CJ5A 1BCOA 1QSLA 1SUQA 2JLEA 2OPQA 2YKMA 2IGIA 3OYAA 4QAGA 4DMNA 1ZYQA 4CCHA 5J1EA 5CYMA 2HHQA 4OKEA 2ZD1A 3AA4A 3MXMA 3SNNA 1TK5A 3NHGA 1RT7A 2KZZA 1WSGA 1TV6A 3TAPA 3HT3A 1L3VA 2Z1GA 3M8QA 1TKZA 4CJSA 4KB0A 4NYNA 1IG9A 3U3GA 3JSMA 1YTUA 3CFPA 1BHLA 4YNQA 3HL8A 4OKKA 2E4LA 2BE2A 3VQPA 4OPKA 1NK5A 1SKRA 1B9FA 1RT2A 1A5XA 3V9WA 4DG1A 3HYFA 4CGFA 3OYBA 4FLZA 4N41A 4FW2A 1S1VA 3L8BA 3LZJA 4E1NA 1QSYA 4J2EA 4Z4IA 4DLEA 1TK0A 4HCCA 1C1AA 3KLIA 4RW8A 3QERA 4J2BA 3T19A 4CF2A 4FJMA 4N76A 1U49A 4HUEA 4RG8A 3V1OA 2VWKA 4DQQA 1J5OA 1C0MA 3C6UA 4I2QA 3WNEA 4BACA 1LV5A 3VQEA 3M8SA 4ZTFA 1KVCA 1KCFA 3KK2A 2WONA 3V6DA 1TKTA 2ZE2A 3NGIA 4FM0A 3DLRA 4DTNA 3I0RA 1RDAA 4G1QA 4KREA 2HHXA 4H8KA 2P51A 3HPOA 3PY8A 4I7FA 4J2AA 2IC3A 3DLGA 4FJLA 1X9SA 4CK2A 3KLFA 2B6AA 4FLUA 1B92A 4FJJA 1IKXA 2O4IA 1W0HA 5KGWA 2OPSA 1S9GA 4CGDA 3P1GA 1D8YA 2OPRA 4KAZA 1A5VA 1N6QA 3ZT0A 4FW1A 2X78A 2Z1IA 4Z4EA 2KZMA 3EYZA 2EHGA 2G8FA 3ZSXA 4DFPA 1CLQA 2D0AA 4O0JA 1A5WA 1WSIA 3VQQA 4Q5VA 2B5JA 1Z25A 4LY7A 4CJPA 3SV3A 1RT4A 3V4IA 1F21A 1FXXA 1LAWA 1RCHA 4ELUA 3L2VA 3C94A 1GOBA 1JLEA 3IAYA 1XWLA 3IG1A 3RTVA 5J2PA 3K2PA 4NCBA 4IKFA 1QE1A 4JRPA 3AVHA 4JS5A 3OYDA 1WN7A 4M3WA 2WOMA 1VRTA 4M3RA 1ASWA 1Q8IA 3NF9A 4KFBA 5KI6A 4CJ4A 3RMBA 3SQ1A 1JLBA 4HCBA 1S1UA 3C95A 2P5OA 4E1MA 1NK9A 4CERA 2HHTA 4CK3A 3WNHA 3DRRA 4ICLA 4KKOA 3EZ5A 4DTSA 2RPIA 1J9AA 1D9DA 1BIZA 4B9NA 4IFVA 2VG5A 4OKJA 4N5SA 4FJ7A 4B9LA 4OGEA 3CQ8A 3PX6A 3LP0A 3VQ9A 3NF8A 3KKRA 4CJFA 1S9EA 4DQSA 4AHTA 1NKBA 5CYQA 5JS1A 3AVLA 1VSDA 4FZXC 2HB5A 4KHNA 4DFJA 1WSEA 4KTZA 4XIUA 3LANA 3RRGA 1JXEA 4DSIA 4KHWA 4KHYA 1RBRA 2YNFA 4FLVA 4F2SA 3KK1A 4CJUA 1U4BA 4DFMA 4O0IA 4DQRA 3K5NA 2A1RA 3NH2A 1BIUA 4QOZB 4B08A 3F73A 4FK4A 2F8TA 5SZTA 4B9UA 4FJ8A 1RT1A 3ZT4A 4CJEA 2LSNA 2HNZA 2P1JA 3RMDA 1XI1A 1SL2A 3V1QA 1BI4B 1KLMA 3BGRA 4C8KA 3NH1A 3AVIA 2QKBA 4DU3A 4AHUA 4HTUA 4ELVA 1NOYA 3D0PA 3ZT3A 4E7IA 4Z4FA 1D5AA 2IOCA 1LW2A 4HVJA 1BGXT 4BE0A 4CGGA 5D3GA 4DSFA 3OY9A 3VQ4A 2YKNA 4OJRA 4M3XA 5J2MA 4W5OA 4FJ9A 4DTUA 1CZ9A 4CJVA 3S3NA 3CFOA 1GOCA 1SKWA 3AVBA 3QLHA 3VA3A 3K5MA 3ZSZA 2YNHA 4DTPA 1VSIA 4ID5A 4C8MA 4CESA 3S3MA 4FZZA 3AVKA 1TKDA 2HHVA 3V1RA 2Y1IA 3NH0A 1NJWA 4CJ3A 3V9XA 3QEIA 4KO0A 1VSLA 2KTQA 3DOKA 2FBTA 2KFNA 3K5OA 4CFAA 4FLTA 3KK3A 1FKPA 4KV8A 1RBUA 4B9SA 3NE6A 2X6SA 3SJJA 5HRNA 3OS1A 3WNFA 2ITGA 4FCYA 3VQ5A 3TANA 3AA3A 1WSFA 3V81A 4CF9A 2PY5A 1ZBFA 1KLNA 3AVFA 3DLBA 3VA0A 1ITGA 3CM6A 4Z0UA 1NK0A 1NK6A 3KLEA 3MEDA 1CXQA 4DU4A 3RMAA 2KQ2A 3FFIA 4DSLA 2BANA 3L2UA 3LALA 2OZMA 1Z26A 4KHUA 3QIOA 1WSJA 4FM1A 1G15A 1WAFA 5CZ2A 3QEPA 1UA1A 4Q0BA 4O4GA 2X6NA 4W5RA 4DF8A 1DTTA 1LAVA 4IBNA 4CEDA 3AVNA 1NJZA 4KHSA 2OZSA 3NGZA 5HRSA 4FLXA 3ULDA 4C8NA 3DI6A 1EXQA 4B8CA 3BDPA 3MECA 4EP5A 3SUPA 3MXJA 4LSLA 3RR7A 4FJ5A 2Y1JA 3L2RA 1S5JA 1IKVA 4MQ3A 3UIQA 3CM5A 3HP9A 2HNDA 3DMJA 1UA0A 1NKEA 2RKIA 1JLAA 2G8HA 1DTQA 4O5BA 1KSPA 3PV8A 3K59A 3TARA 2QKKA 1QTMA 1VSEA 2YV0X 1QS4A 1C1CA 3ZT1A 3OJSA 3NFAA 3ZSRA 3L3VA 3M8PA 4BDZA 2DY4A 1WAJA 1TL3A 5SWMA 4CEBA 2Q3SA 3CFRA 4M3YA 1UAXA 4M3ZA 4KHQA 2FBVA 4GMJB 1RBTA 4RW6A 5HBMA 4CEQA 1KFSA 4ELTA 4FJKA 4JS4A 3A2FA 1RTHA 2EX3A 1VSHA 4CHPA 1KVBA 1BQNA 4DFKA 2D5RA 4KRFA 4ID1A 3AVJA 3SZ2A 4DS4A 1Q9XA 1VSJA 1VRUA 3QINA 3OYJA 1WNSA 1X9WA 2G8KA 3TABA 3AO5A 2HHSA 2NUBA 3RR8A 3O4QA 3AV9A 1C0TA 3KLGA 4FLWA 4KB1A 2ATQA 4AH9A 3NCIA 4C8LA 3SYZA 4CJKA 4DSKA 4PWDA 3LP2A 3WNGA 4DQIA 2BGGA 3KTQA 4AHCA 3VQDA 5FRMA 3B6PA 1IKWA 1TAQA 3ALYA 4CHNA 4BE1A 4B9VA 2E6MA 4H4OA 1REVA 3ZT2A 2OYQA 1R0AA 4Z4HA 3LZIA 3D45A 3PO5A 4HUFA 3QEWA 4FJNA 4AILC 1HQUA 1CXUA 4CEZA 1ZBUA 1TGOA 2IS3A 2XY8A 3T3FA 2F96A 5K14A 1B9DA 5C25A 3F9KA 3OYMA 3SQ2A 2ETJA 1LWFA 4LD0A 3HXMA 3HVRA 3HPHA 3KIOA 3P5JA 4JLHA 4KTWA 3VQ6A 3VQAA 4CF0A 4CJLA 4BDPA 4DS5A 3HPGA 1SV5A 4DTOA 2IAJA 4JRQA 1RNHA 1LWCA 1EKEA 3ISNC 5HROA 3TAMA 1RDCA 3MEGA 2F8SA 1JLGA 1TL1A 3AVGA 3P83D 4Y1CA 3CG7A 4Z4CA 4CIEA 3V9ZA 3L3UA 5JS2A 2PYLA 1JL2A 5I3UA 4OLBA 4CGIA 5E41A 2G8WA 1SL1A 4E7JA 2XO7A 3TI0A 1T03A 4E19A 3NF6A 3QESA 4N47A 1L3UA 4BWJA 3HSTB 1S1WA 2HVIA 4B9MA 3H08A 1J54A 1U04A 3DM2A 3DOLA 2YHBA 3DLEA 4OVLA 1TKXA 3TAFA 3SQ0A 4FYDA 1RTIA 1S1TA 4CGJA 3TAGA 4CEFA 5KGXA 1XC9A 4E7LA 4M3TA 1BL3A 2D0BA 4B8AB 3ZSWA 3IS9A 5HRRA 1LWEA 3SPYA 1YT3A 2FBYA 3OYFA 3AVMA 4CHZA 1JKHA 4BE2A 3DYAA 4L8RB 3KLHA 2QK9A 1RTJA 3NF7A 4CJRA 3HVTA 4PY5A 1JLCA 4B3OA 1BI4A 1FK9A 1HRHA 4CF8A 2GUIA 4MFBA 1NJYA 2QXFA 2XY6A 4H4MA 4BDYA 2DFHA 3C6TA 3DRPA 3OYIA 3V9SA 3AO3A 1XHXA 4CEAA 2Z1JA 3SCXA 4F3OA 3PO4A 1KVAA 3K58A 1BCMA 4NCAA 4HHTA 3AA5X 2AJQA 1S6QA 2RF2A 4OGCA 5I42A 4O55A 5C24A 4KPYA 1HPZA 4K8XA 4RW7A 3L2QA 4TSXA 3AO4A 3VQCA 2B4JA 4FXDA 3EY1A 4CIFA 3LWMA 1SKSA 3QEXA 4M41A 4CE9A 4AHVA 1L3TA 4F3TA 2G8VA 4DLGA 1C0UA 2HMIA 1HNIA 5CZ1A 3AVCA 3ZCMA 4KTQA 2HVHA 5HLFA 3IRXA 2DTUA 1ASUA 2JGUA 2X74A 4EZ9A 3HO1A 3AA2A 1I39A 1U48A 1C6VA 2G8UA 2GBZA 3AO1A 1SL0A 2P5GA 4CEEA 1IKYA 3G0ZA 1ASVA 1X1PA 3CYMA 1CZBA 2O4GA 2OPPA 3SV4A 3LAMA 1VSKA 3U3YA 3MXIA 1VK0A 5FDLA 1W9HA 3QETA 3AVAA 4DTRA 4K8ZA 4Y1DA 2VG7A 2KW4A 5KRTA 4E0DA 1NK7A 3QEVA 4IFYA 2Z1HA 3HM9A 3HP6A 3LDSA 4NYFA 4M42A 1S1XA 3VQ8A 1HMVA 4IG0A 2PZSA 4RW9A 4J2DA 3SUOA 2XRIA 4FJGA 1TK8A 1MU2A 2DFFA 2GV9A 2W42A 3SQ4A 1HJRA 2YHAA 1L3SA 3OYKA 4FLYA 1C1BA 3O3FA 3QNOA 4DSJA 4AHSA 4EP4A 1ZBLA 4DU1A 4FJIA 3THVA 1U45A 4LSNA 1N5YA 4FK0A 1LW0A 4CECA 3TR8A 4LH5A 4UQGA 4IDKA 1UWBA 1NOZA 1XHZA 1T8EA 4F2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E01 A;  1O1W A;  1D9F A;  4CJW A;  1RBV A;  3M8R A;  1RT5 A;  1WLJ A;  4DTX A;  3O3G A;  3OYL A;  4RW4 A;  1QHT A;  3OYE A;  4F8R A;  3OS0 A;  1EET A;  3MEE A;  5DK5 A;  4M45 A;  4DF4 A;  2HHW A;  5J2Q A;  3VQ7 A;  3TWH A;  4I2P A;  1YTA A;  4PQU A;  4QCL A;  3VQB A;  3LP3 A;  5KTQ A;  4ZTJ A;  4FJX A;  4KI4 A;  1UOC A;  3LP1 A;  2VG6 A;  4CFB A;  4E89 A;  3LPT A;  1RBS A;  4PUO A;  3G10 A;  2IDO A;  3SUN A;  3LAK A;  3DLH A;  5EU7 A;  3TAQ A;  4FZY A;  1TAU A;  3ITH A;  5DMR A;  2I5J A;  3OJU A;  2DFE A;  3T1A A;  4BWM A;  3O3H A;  4CFC A;  1NK8 A;  1HYS A;  2HHU A;  2YNG A;  4C8O A;  3I0S A;  1I3A A;  3PUF A;  1RIL A;  1RDD A;  3U6F A;  4DSE A;  4I9L A;  3JYT A;  3ZSY A;  2XY5 A;  3RWU A;  3NBP A;  4HUG A;  1WSH A;  4GW6 A;  3ZSO A;  1RT6 A;  4CFD A;  4E7H A;  3QO9 A;  4OLA A;  4I9Q A;  5FRN A;  1RTD A;  3NAE A;  3OS2 A;  3HK2 A;  2HNY A;  4YFU A;  1T7P A;  1IH7 A;  3TAE A;  4CJT A;  1VSM A;  3LPU A;  4FVM A;  4CHQ A;  4W5T A;  1HYZ A;  1BQM A;  2XY7 A;  4B9T A;  4W5N A;  3NDK A;  2A1S A;  4PA1 A;  5J2N A;  2ZQB A;  1X9M A;  4FK2 A;  3OVN A;  1FKO A;  3AO2 A;  3ASM A;  4DTJ A;  1U47 A;  3KJV A;  1JLQ A;  1KTQ A;  1RDB A;  4N56 A;  4Z4G A;  4CEO A;  3QIP A;  4CIG A;  4O44 A;  3SUQ A;  2E6L A;  3DLK A;  3S3O A;  2RN2 A;  2XHB A;  1QQC A;  1EP4 A;  3B6O A;  3L2W A;  3V9U A;  1Y97 A;  5C42 A;  3OYH A;  4CGH A;  2OA8 A;  2FC0 A;  2KFZ A;  4IG3 A;  4EZ6 A;  3NGY A;  4CJQ A;  3RMC A;  1JXB A;  1GOA A;  5FRO A;  4NCG A;  3DRS A;  1QSS A;  4FM2 A;  1DLO A;  4DQP A;  2D0C A;  1J53 A;  5T7B A;  3KD1 E;  1YVU A;  3KKS A;  3RRH A;  3S9H A;  5HP1 A;  1EX4 A;  2R7Y A;  3QNN A;  1K6Y A;  1KFD A;  3LWL A;  1NJX A;  3SPZ A;  1T05 A;  2VWJ A;  3HJF A;  4F4K A;  4WE1 A;  4E7K A;  3SI6 A;  4CK1 A;  2G8I A;  5CY4 A;  1JLF A;  3OYN A;  5KRS A;  3O4N A;  1KRP A;  4FJH A;  1HYV A;  4W5Q A;  1NK4 A;  1Q9Y A;  1IO2 A;  4DWI A;  4M3U A;  1VSF A;  3OYC A;  3I8D A;  3VN5 A;  1L5U A;  2HW3 A;  3PX4 A;  3K57 A;  1S6P A;  4CHO A;  3ZSQ A;  5HRP A;  2BDP A;  4GVM A;  1ZBI A;  1ZBH A;  2YNI A;  4DTM A;  2FBX A;  4R5P A;  4KI6 A;  4LH4 A;  1HQE A;  1TVR A;  2PYJ A;  3ZSV A;  3MAQ A;  4E3S A;  1NKC A;  3KD5 E;  3OYG A;  1BIS A;  1JL1 A;  1RT3 A;  4CF1 A;  4ZHR A;  4OPJ A;  4AHR A;  3K5L A;  4CHY A;  1HNV A;  3PX0 A;  4CJ5 A;  1BCO A;  1QSL A;  1SUQ A;  2JLE A;  2OPQ A;  2YKM A;  2IGI A;  3OYA A;  4QAG A;  4DMN A;  1ZYQ A;  4CCH A;  5J1E A;  5CYM A;  2HHQ A;  4OKE A;  2ZD1 A;  3AA4 A;  3MXM A;  3SNN A;  1TK5 A;  3NHG A;  1RT7 A;  2KZZ A;  1WSG A;  1TV6 A;  3TAP A;  3HT3 A;  1L3V A;  2Z1G A;  3M8Q A;  1TKZ A;  4CJS A;  4KB0 A;  4NYN A;  1IG9 A;  3U3G A;  3JSM A;  1YTU A;  3CFP A;  1BHL A;  4YNQ A;  3HL8 A;  4OKK A;  2E4L A;  2BE2 A;  3VQP A;  4OPK A;  1NK5 A;  1SKR A;  1B9F A;  1RT2 A;  1A5X A;  3V9W A;  4DG1 A;  3HYF A;  4CGF A;  3OYB A;  4FLZ A;  4N41 A;  4FW2 A;  1S1V A;  3L8B A;  3LZJ A;  4E1N A;  1QSY A;  4J2E A;  4Z4I A;  4DLE A;  1TK0 A;  4HCC A;  1C1A A;  3KLI A;  4RW8 A;  3QER A;  4J2B A;  3T19 A;  4CF2 A;  4FJM A;  4N76 A;  1U49 A;  4HUE A;  4RG8 A;  3V1O A;  2VWK A;  4DQQ A;  1J5O A;  1C0M A;  3C6U A;  4I2Q A;  3WNE A;  4BAC A;  1LV5 A;  3VQE A;  3M8S A;  4ZTF A;  1KVC A;  1KCF A;  3KK2 A;  2WON A;  3V6D A;  1TKT A;  2ZE2 A;  3NGI A;  4FM0 A;  3DLR A;  4DTN A;  3I0R A;  1RDA A;  4G1Q A;  4KRE A;  2HHX A;  4H8K A;  2P51 A;  3HPO A;  3PY8 A;  4I7F A;  4J2A A;  2IC3 A;  3DLG A;  4FJL A;  1X9S A;  4CK2 A;  3KLF A;  2B6A A;  4FLU A;  1B92 A;  4FJJ A;  1IKX A;  2O4I A;  1W0H A;  5KGW A;  2OPS A;  1S9G A;  4CGD A;  3P1G A;  1D8Y A;  2OPR A;  4KAZ A;  1A5V A;  1N6Q A;  3ZT0 A;  4FW1 A;  2X78 A;  2Z1I A;  4Z4E A;  2KZM A;  3EYZ A;  2EHG A;  2G8F A;  3ZSX A;  4DFP A;  1CLQ A;  2D0A A;  4O0J A;  1A5W A;  1WSI A;  3VQQ A;  4Q5V A;  2B5J A;  1Z25 A;  4LY7 A;  4CJP A;  3SV3 A;  1RT4 A;  3V4I A;  1F21 A;  1FXX A;  1LAW A;  1RCH A;  4ELU A;  3L2V A;  3C94 A;  1GOB A;  1JLE A;  3IAY A;  1XWL A;  3IG1 A;  3RTV A;  5J2P A;  3K2P A;  4NCB A;  4IKF A;  1QE1 A;  4JRP A;  3AVH A;  4JS5 A;  3OYD A;  1WN7 A;  4M3W A;  2WOM A;  1VRT A;  4M3R A;  1ASW A;  1Q8I A;  3NF9 A;  4KFB A;  5KI6 A;  4CJ4 A;  3RMB A;  3SQ1 A;  1JLB A;  4HCB A;  1S1U A;  3C95 A;  2P5O A;  4E1M A;  1NK9 A;  4CER A;  2HHT A;  4CK3 A;  3WNH A;  3DRR A;  4ICL A;  4KKO A;  3EZ5 A;  4DTS A;  2RPI A;  1J9A A;  1D9D A;  1BIZ A;  4B9N A;  4IFV A;  2VG5 A;  4OKJ A;  4N5S A;  4FJ7 A;  4B9L A;  4OGE A;  3CQ8 A;  3PX6 A;  3LP0 A;  3VQ9 A;  3NF8 A;  3KKR A;  4CJF A;  1S9E A;  4DQS A;  4AHT A;  1NKB A;  5CYQ A;  5JS1 A;  3AVL A;  1VSD A;  4FZX C;  2HB5 A;  4KHN A;  4DFJ A;  1WSE A;  4KTZ A;  4XIU A;  3LAN A;  3RRG A;  1JXE A;  4DSI A;  4KHW A;  4KHY A;  1RBR A;  2YNF A;  4FLV A;  4F2S A;  3KK1 A;  4CJU A;  1U4B A;  4DFM A;  4O0I A;  4DQR A;  3K5N A;  2A1R A;  3NH2 A;  1BIU A;  4QOZ B;  4B08 A;  3F73 A;  4FK4 A;  2F8T A;  5SZT A;  4B9U A;  4FJ8 A;  1RT1 A;  3ZT4 A;  4CJE A;  2LSN A;  2HNZ A;  2P1J A;  3RMD A;  1XI1 A;  1SL2 A;  3V1Q A;  1BI4 B;  1KLM A;  3BGR A;  4C8K A;  3NH1 A;  3AVI A;  2QKB A;  4DU3 A;  4AHU A;  4HTU A;  4ELV A;  1NOY A;  3D0P A;  3ZT3 A;  4E7I A;  4Z4F A;  1D5A A;  2IOC A;  1LW2 A;  4HVJ A;  1BGX T;  4BE0 A;  4CGG A;  5D3G A;  4DSF A;  3OY9 A;  3VQ4 A;  2YKN A;  4OJR A;  4M3X A;  5J2M A;  4W5O A;  4FJ9 A;  4DTU A;  1CZ9 A;  4CJV A;  3S3N A;  3CFO A;  1GOC A;  1SKW A;  3AVB A;  3QLH A;  3VA3 A;  3K5M A;  3ZSZ A;  2YNH A;  4DTP A;  1VSI A;  4ID5 A;  4C8M A;  4CES A;  3S3M A;  4FZZ A;  3AVK A;  1TKD A;  2HHV A;  3V1R A;  2Y1I A;  3NH0 A;  1NJW A;  4CJ3 A;  3V9X A;  3QEI A;  4KO0 A;  1VSL A;  2KTQ A;  3DOK A;  2FBT A;  2KFN A;  3K5O A;  4CFA A;  4FLT A;  3KK3 A;  1FKP A;  4KV8 A;  1RBU A;  4B9S A;  3NE6 A;  2X6S A;  3SJJ A;  5HRN A;  3OS1 A;  3WNF A;  2ITG A;  4FCY A;  3VQ5 A;  3TAN A;  3AA3 A;  1WSF A;  3V81 A;  4CF9 A;  2PY5 A;  1ZBF A;  1KLN A;  3AVF A;  3DLB A;  3VA0 A;  1ITG A;  3CM6 A;  4Z0U A;  1NK0 A;  1NK6 A;  3KLE A;  3MED A;  1CXQ A;  4DU4 A;  3RMA A;  2KQ2 A;  3FFI A;  4DSL A;  2BAN A;  3L2U A;  3LAL A;  2OZM A;  1Z26 A;  4KHU A;  3QIO A;  1WSJ A;  4FM1 A;  1G15 A;  1WAF A;  5CZ2 A;  3QEP A;  1UA1 A;  4Q0B A;  4O4G A;  2X6N A;  4W5R A;  4DF8 A;  1DTT A;  1LAV A;  4IBN A;  4CED A;  3AVN A;  1NJZ A;  4KHS A;  2OZS A;  3NGZ A;  5HRS A;  4FLX A;  3ULD A;  4C8N A;  3DI6 A;  1EXQ A;  4B8C A;  3BDP A;  3MEC A;  4EP5 A;  3SUP A;  3MXJ A;  4LSL A;  3RR7 A;  4FJ5 A;  2Y1J A;  3L2R A;  1S5J A;  1IKV A;  4MQ3 A;  3UIQ A;  3CM5 A;  3HP9 A;  2HND A;  3DMJ A;  1UA0 A;  1NKE A;  2RKI A;  1JLA A;  2G8H A;  1DTQ A;  4O5B A;  1KSP A;  3PV8 A;  3K59 A;  3TAR A;  2QKK A;  1QTM A;  1VSE A;  2YV0 X;  1QS4 A;  1C1C A;  3ZT1 A;  3OJS A;  3NFA A;  3ZSR A;  3L3V A;  3M8P A;  4BDZ A;  2DY4 A;  1WAJ A;  1TL3 A;  5SWM A;  4CEB A;  2Q3S A;  3CFR A;  4M3Y A;  1UAX A;  4M3Z A;  4KHQ A;  2FBV A;  4GMJ B;  1RBT A;  4RW6 A;  5HBM A;  4CEQ A;  1KFS A;  4ELT A;  4FJK A;  4JS4 A;  3A2F A;  1RTH A;  2EX3 A;  1VSH A;  4CHP A;  1KVB A;  1BQN A;  4DFK A;  2D5R A;  4KRF A;  4ID1 A;  3AVJ A;  3SZ2 A;  4DS4 A;  1Q9X A;  1VSJ A;  1VRU A;  3QIN A;  3OYJ A;  1WNS A;  1X9W A;  2G8K A;  3TAB A;  3AO5 A;  2HHS A;  2NUB A;  3RR8 A;  3O4Q A;  3AV9 A;  1C0T A;  3KLG A;  4FLW A;  4KB1 A;  2ATQ A;  4AH9 A;  3NCI A;  4C8L A;  3SYZ A;  4CJK A;  4DSK A;  4PWD A;  3LP2 A;  3WNG A;  4DQI A;  2BGG A;  3KTQ A;  4AHC A;  3VQD A;  5FRM A;  3B6P A;  1IKW A;  1TAQ A;  3ALY A;  4CHN A;  4BE1 A;  4B9V A;  2E6M A;  4H4O A;  1REV A;  3ZT2 A;  2OYQ A;  1R0A A;  4Z4H A;  3LZI A;  3D45 A;  3PO5 A;  4HUF A;  3QEW A;  4FJN A;  4AIL C;  1HQU A;  1CXU A;  4CEZ A;  1ZBU A;  1TGO A;  2IS3 A;  2XY8 A;  3T3F A;  2F96 A;  5K14 A;  1B9D A;  5C25 A;  3F9K A;  3OYM A;  3SQ2 A;  2ETJ A;  1LWF A;  4LD0 A;  3HXM A;  3HVR A;  3HPH A;  3KIO A;  3P5J A;  4JLH A;  4KTW A;  3VQ6 A;  3VQA A;  4CF0 A;  4CJL A;  4BDP A;  4DS5 A;  3HPG A;  1SV5 A;  4DTO A;  2IAJ A;  4JRQ A;  1RNH A;  1LWC A;  1EKE A;  3ISN C;  5HRO A;  3TAM A;  1RDC A;  3MEG A;  2F8S A;  1JLG A;  1TL1 A;  3AVG A;  3P83 D;  4Y1C A;  3CG7 A;  4Z4C A;  4CIE A;  3V9Z A;  3L3U A;  5JS2 A;  2PYL A;  1JL2 A;  5I3U A;  4OLB A;  4CGI A;  5E41 A;  2G8W A;  1SL1 A;  4E7J A;  2XO7 A;  3TI0 A;  1T03 A;  4E19 A;  3NF6 A;  3QES A;  4N47 A;  1L3U A;  4BWJ A;  3HST B;  1S1W A;  2HVI A;  4B9M A;  3H08 A;  1J54 A;  1U04 A;  3DM2 A;  3DOL A;  2YHB A;  3DLE A;  4OVL A;  1TKX A;  3TAF A;  3SQ0 A;  4FYD A;  1RTI A;  1S1T A;  4CGJ A;  3TAG A;  4CEF A;  5KGX A;  1XC9 A;  4E7L A;  4M3T A;  1BL3 A;  2D0B A;  4B8A B;  3ZSW A;  3IS9 A;  5HRR A;  1LWE A;  3SPY A;  1YT3 A;  2FBY A;  3OYF A;  3AVM A;  4CHZ A;  1JKH A;  4BE2 A;  3DYA A;  4L8R B;  3KLH A;  2QK9 A;  1RTJ A;  3NF7 A;  4CJR A;  3HVT A;  4PY5 A;  1JLC A;  4B3O A;  1BI4 A;  1FK9 A;  1HRH A;  4CF8 A;  2GUI A;  4MFB A;  1NJY A;  2QXF A;  2XY6 A;  4H4M A;  4BDY A;  2DFH A;  3C6T A;  3DRP A;  3OYI A;  3V9S A;  3AO3 A;  1XHX A;  4CEA A;  2Z1J A;  3SCX A;  4F3O A;  3PO4 A;  1KVA A;  3K58 A;  1BCM A;  4NCA A;  4HHT A;  3AA5 X;  2AJQ A;  1S6Q A;  2RF2 A;  4OGC A;  5I42 A;  4O55 A;  5C24 A;  4KPY A;  1HPZ A;  4K8X A;  4RW7 A;  3L2Q A;  4TSX A;  3AO4 A;  3VQC A;  2B4J A;  4FXD A;  3EY1 A;  4CIF A;  3LWM A;  1SKS A;  3QEX A;  4M41 A;  4CE9 A;  4AHV A;  1L3T A;  4F3T A;  2G8V A;  4DLG A;  1C0U A;  2HMI A;  1HNI A;  5CZ1 A;  3AVC A;  3ZCM A;  4KTQ A;  2HVH A;  5HLF A;  3IRX A;  2DTU A;  1ASU A;  2JGU A;  2X74 A;  4EZ9 A;  3HO1 A;  3AA2 A;  1I39 A;  1U48 A;  1C6V A;  2G8U A;  2GBZ A;  3AO1 A;  1SL0 A;  2P5G A;  4CEE A;  1IKY A;  3G0Z A;  1ASV A;  1X1P A;  3CYM A;  1CZB A;  2O4G A;  2OPP A;  3SV4 A;  3LAM A;  1VSK A;  3U3Y A;  3MXI A;  1VK0 A;  5FDL A;  1W9H A;  3QET A;  3AVA A;  4DTR A;  4K8Z A;  4Y1D A;  2VG7 A;  2KW4 A;  5KRT A;  4E0D A;  1NK7 A;  3QEV A;  4IFY A;  2Z1H A;  3HM9 A;  3HP6 A;  3LDS A;  4NYF A;  4M42 A;  1S1X A;  3VQ8 A;  1HMV A;  4IG0 A;  2PZS A;  4RW9 A;  4J2D A;  3SUO A;  2XRI A;  4FJG A;  1TK8 A;  1MU2 A;  2DFF A;  2GV9 A;  2W42 A;  3SQ4 A;  1HJR A;  2YHA A;  1L3S A;  3OYK A;  4FLY A;  1C1B A;  3O3F A;  3QNO A;  4DSJ A;  4AHS A;  4EP4 A;  1ZBL A;  4DU1 A;  4FJI A;  3THV A;  1U45 A;  4LSN A;  1N5Y A;  4FK0 A;  1LW0 A;  4CEC A;  3TR8 A;  4LH5 A;  4UQG A;  4IDK A;  1UWB A;  1NOZ A;  1XHZ A;  1T8E A;  4F2R A; 
#chains in the Genus database with same CATH topology
 1O1W A;  2NLX A;  4CJW A;  5AQQ A;  2P9L A;  5CHI A;  1RT5 A;  4RW4 A;  3OS0 A;  1ILY A;  4M45 A;  4I2P A;  1YTA A;  3C6A A;  4QCL A;  4KI4 A;  4FJX A;  5BRE A;  5KQ8 A;  3THY A;  4JNE A;  3LPT A;  2IDO A;  3SUN A;  3DLH A;  1TAU A;  3ITH A;  2YNG A;  1I3A A;  3VPZ A;  1RIL A;  3O9S A;  3U6F A;  3QFU A;  4U7B A;  3MX5 A;  3ZSY A;  3RWU A;  1GLL O;  2IVO A;  3MN6 A;  3QO9 A;  3VEY A;  3A8Y A;  1T7P A;  1IH7 A;  3TAE A;  1VQ7 N;  4CJT A;  5JLH A;  3SMS A;  4CHQ A;  4W5T A;  2V7Y A;  1HYZ A;  3O1B A;  1HNW K;  2A1S A;  4DB3 A;  2ZWH A;  2O8D B;  1U47 A;  1JLQ A;  2A6A A;  2E6L A;  3DLK A;  1QQC A;  3OYH A;  4CGH A;  2FC0 A;  1GLA G;  4FWK A;  3RMC A;  1JXB A;  1W7A A;  3DRS A;  3QDK A;  3DXK A;  4DQP A;  2D0C A;  1J53 A;  5T7B A;  1VQM N;  1YVU A;  1C0G A;  5HP1 A;  3QNN A;  3LWL A;  5BR9 A;  1SZ2 A;  3SI6 A;  3ENO A;  4CK1 A;  3MWP A;  3O4N A;  3TU5 A;  3GG4 A;  1NK4 A;  1IO2 A;  4MLH A;  4KH5 A;  3MMV A;  3L0Q A;  3VN5 A;  1S6P A;  3LDO A;  1SAZ A;  4M7Y A;  4QS9 A;  2FBX A;  4EIA A;  4KHP K;  2ASP A;  1TVR A;  4X62 K;  3K5L A;  4AHR A;  1OVY A;  1HNV A;  3PX0 A;  1QSL A;  2OPQ A;  2IGI A;  3OYA A;  1ZYQ A;  1TUU A;  5J1E A;  2HHQ A;  4OKE A;  3MXM A;  1WSG A;  3VF6 A;  3HT3 A;  4ISG A;  4BRO A;  4KB0 A;  3U3G A;  1YTU A;  5AJ3 K;  3VQP A;  2ASO A;  5EY4 A;  1YF5 L;  3HYF A;  3OYB A;  3E66 A;  1G99 A;  1S1V A;  4FW2 A;  3L8B A;  4Z4I A;  1HJO A;  4HCC A;  4RW8 A;  4BVP A;  3T19 A;  3EZW A;  3TPQ A;  3VEV A;  1W97 L;  3FGU A;  1S22 A;  2P9U B;  2HBK A;  3M8S A;  4ZTF A;  1KVC A;  1KCF A;  1VQ8 N;  3UKU B;  2ZE2 A;  2V7Z A;  3DLR A;  1RDA A;  4G1Q A;  2P51 A;  4DV4 K;  3KK7 A;  1T3V A;  4JD2 A;  1X9S A;  1YJW N;  4FLU A;  1B92 A;  3BZC A;  3C7N B;  4CGD A;  4PL7 A;  2GUP A;  4BG8 A;  4CBW A;  4ISE A;  3EYZ A;  2E8A A;  2F9T A;  2NRW A;  3G25 A;  4DFP A;  2E1Y A;  2FF6 A;  3WEE B;  1F21 A;  5LY3 A;  1LAW A;  3CME N;  1XWL A;  5DM6 L;  3GE1 A;  1QE1 A;  3HM8 A;  3OYD A;  4M3W A;  4LF6 K;  2WOM A;  4BGA A;  4CJ4 A;  1X3M A;  3C95 A;  4CK3 A;  3DRR A;  4BRE A;  4DTS A;  4JHD A;  3CXC M;  1BIZ A;  4IDH A;  1RFQ A;  4N5S A;  4B9L A;  3CCU N;  3NF8 A;  4DR3 K;  4DQS A;  4FSV A;  1Y64 A;  3O9Q A;  1VSD A;  5F2R A;  4DFJ A;  4XIU A;  3LAN A;  4DSI A;  1JXE A;  4KHY A;  3KK1 A;  4JEP A;  4DFM A;  4DQR A;  4DR6 K;  2O8C B;  5GIO A;  4FK4 A;  2F8T A;  5SZT A;  3M1F A;  4FJ8 A;  3ZT4 A;  4H5N A;  2UUB K;  4YDU A;  3V1Q A;  1BI4 B;  4DU3 A;  4HTU A;  3ZYY X;  4LFB K;  3WQT A;  3J8A A;  3JS6 A;  5F1X A;  3CD6 N;  4BE0 A;  4DSF A;  1M1K O;  2YKN A;  3ENB A;  2W6K A;  4OJR A;  5AQX A;  3RSE B;  1VQO N;  5F0X A;  3MDQ A;  1N8R O;  3FZL A;  3T69 A;  2F9W A;  3AVB A;  3QLH A;  3VA3 A;  2YNH A;  4ID5 A;  4C8M A;  3AVK A;  4A2B A;  3NH0 A;  1OH7 A;  1YVN A;  4KO0 A;  1VSL A;  4IXC A;  3F9M A;  5HRN A;  3CCV N;  5FLX O;  1WSF A;  2QWM A;  1KLN A;  3CM6 A;  2QTD A;  2YHW A;  1NK6 A;  3I56 N;  4DU4 A;  3RMA A;  4DSL A;  3H45 C;  4H5T A;  1UA1 A;  4FPA A;  2X6N A;  4DF8 A;  4IBN A;  2QM1 A;  2H3G X;  4FWL A;  2KLA A;  1M90 O;  5TKW A;  3L2R A;  3WXM B;  1W2B M;  4MQ3 A;  4K42 A;  1VQN N;  2HND A;  3CJ1 A;  1D4X A;  3TTF A;  3AAP A;  4O5B A;  4OO1 J;  3K59 A;  1GLF O;  2QKK A;  1QTM A;  1VSE A;  3ZSR A;  4H03 B;  1ZXO A;  4BRN A;  1WAJ A;  1YAG A;  5SWM A;  4CBX A;  4M3Z A;  4KHQ A;  4RW6 A;  5HBM A;  4DR2 K;  4FJK A;  1DGK N;  1YXQ A;  3VTI A;  4JS4 A;  2P9N B;  1KVB A;  1BQN A;  4K43 A;  4DFK A;  3DJC A;  4KRF A;  4ID1 A;  1BWF O;  1Q9X A;  4KAZ A;  3MX2 A;  3QIN A;  3OYJ A;  1X9W A;  2HHS A;  2QW9 A;  3ZET A;  4GY2 B;  3O4W A;  4YDU C;  4X66 K;  3R9P A;  2VCP A;  2BGG A;  2OTL N;  3KTQ A;  4AHC A;  5FRM A;  1TAQ A;  2E6M A;  3L4I A;  3T7Z A;  1R0A A;  4Z4H A;  3D45 A;  4H0X B;  5AQU A;  3KVG A;  3QEW A;  1HQU A;  4FJN A;  3CJ7 A;  1HNX K;  3FR0 A;  5K14 A;  1B9D A;  3F9K A;  4B3R K;  3HXM A;  3VQA A;  3P5J A;  4CF0 A;  4CJL A;  4C1N I;  3J7Y P;  3VGM A;  1RNH A;  3QFP A;  1LWC A;  1IV0 A;  4GV6 A;  3FZH A;  1TL1 A;  4WCE L;  4JV5 K;  1VQP N;  4CIE A;  3L3U A;  4LC9 B;  2WTU A;  4OLB A;  3EO3 A;  5AQW A;  4CGI A;  2P9P A;  2HBL A;  4B1Z A;  4IFE A;  3NF6 A;  1LCU A;  1E4F T;  4BWJ A;  3HST B;  1KXP A;  3CPW M;  4LF4 K;  2CH5 A;  1J54 A;  4CZF A;  3TAG A;  1J6Z A;  2PFU A;  1XC9 A;  3ZSW A;  5AQS A;  4A61 A;  2UYT A;  1YT3 A;  2FBY A;  3BZK A;  4CHZ A;  3KLH A;  2QK9 A;  1RTJ A;  4I6M B;  4CJR A;  4DR4 K;  1OH8 A;  4B3O A;  4LF9 K;  1NJY A;  4I6M A;  2DFH A;  3DRP A;  3V9S A;  5GIP A;  3SCX A;  3K58 A;  2A41 A;  4HHT A;  4OGC A;  4EAH D;  4TSX A;  3AO4 A;  3OBY A;  4C23 A;  3A5L C;  2PAV A;  4AHV A;  1NU0 A;  2G8V A;  1Q7Y O;  4CZM A;  4DLG A;  1C0U A;  5CZ1 A;  2X74 A;  3PIO L;  4EZ9 A;  1I39 A;  1C6V A;  3AO1 A;  1SL0 A;  1NGI A;  3A5O C;  4CEE A;  3D2E A;  1IKY A;  1X1P A;  3CCR N;  3W3D A;  1LOT B;  2OPP A;  3SV4 A;  1RDW X;  1VSK A;  1VK0 A;  5FDL A;  3WXK A;  5EOY A;  3D2E B;  1S72 N;  3RSE A;  4DTR A;  4XH4 A;  5KRT A;  2GEL A;  4Y0W A;  4X64 K;  3QEV A;  3HM9 A;  1S1X A;  4IG0 A;  2IVN A;  3SUO A;  4FJG A;  1TK8 A;  4L3Q A;  2DFF A;  2W42 A;  5EVZ A;  3SQ4 A;  3CCE N;  4DQ8 A;  3SAH A;  5LMU K;  3R8E A;  3M6G A;  4GV3 A;  3VGK A;  5AQI A;  3TR8 A;  3N4Q A;  4IDK A;  1UWB A;  3HSC A;  1NOZ A;  4NB4 A;  3LDP A;  4F2R A;  3E01 A;  1RBV A;  5M1K A;  4DTX A;  5GAH P;  3OYE A;  4F8R A;  1EET A;  2HHW A;  5J2Q A;  2W41 A;  3TWH A;  5E26 A;  2VWB A;  3VQB A;  5KTQ A;  3FZK A;  3A5M C;  5AQH A;  5BRF A;  2VQF K;  5EU7 A;  5DMR A;  2A40 A;  2DFE A;  4A57 A;  5FPD A;  3T1A A;  4O8K A;  5E84 A;  3O3H A;  3N4P A;  1NK8 A;  2NRV A;  4C8O A;  3RVC A;  4BRI A;  4DUZ K;  1CZA N;  4OLA A;  5FRN A;  1RTD A;  3OS2 A;  4YFU A;  3K9K A;  2NRX A;  3CJB A;  3LPU A;  4FVM A;  4WQ5 C;  4W5N A;  3NDK A;  4PA1 A;  4E1J A;  1Q82 O;  3AO2 A;  3Q7B A;  2ZGZ A;  2WC9 A;  3WXI A;  3S3O A;  3B6O A;  1EP4 A;  3IFR A;  1YUW A;  1BG3 A;  2OA8 A;  1HLU A;  3LDQ A;  4FWO A;  4EZ6 A;  3NGY A;  4CZH A;  2KFZ A;  1EO1 A;  4FM2 A;  4F9O A;  3KD1 E;  3KKS A;  4BY9 C;  1E3M A;  4CD3 A;  2GEM A;  3THW B;  1KFD A;  1T05 A;  1U6Z A;  3L4Q A;  2Q31 A;  1WB9 A;  4FJH A;  5M1N A;  1HYV A;  4DWI A;  1VSF A;  1MA9 B;  1ZBH A;  3K57 A;  2BDP A;  5HRP A;  3HRG A;  4WFN L;  4BVO A;  1ZBI A;  2YNI A;  3G71 N;  4R5P A;  3C0B A;  1HQE A;  1OKJ A;  3U8X A;  3ZSV A;  3MAQ A;  4E3S A;  5AQF A;  3AAQ A;  1BIS A;  4ZHR A;  1RT3 A;  2HOE A;  2YCH A;  4CF1 A;  3JAM O;  4OPJ A;  4YOX A;  4FWN A;  4FVU A;  2JLE A;  4JI5 K;  2YKM A;  5AQZ A;  4CCH A;  2ZD1 A;  4PKI A;  4DUY K;  1TK5 A;  1L3V A;  2Z1G A;  1TKZ A;  4NYN A;  1IG9 A;  3CFP A;  4CZK A;  1BHL A;  2E4L A;  2BE2 A;  1JCG A;  1B9F A;  1ATR A;  4A59 A;  1Z05 A;  4DG1 A;  4N41 A;  1E4G T;  4BR2 A;  3CCM N;  3E1Y A;  4DLE A;  1MDU B;  3KLI A;  3W0L A;  1GLC G;  2ASM A;  4FJM A;  5CR4 A;  3BP8 A;  4HUE A;  1J5E K;  3ID6 A;  3V1O A;  3IUC A;  1C0M A;  3C6U A;  4I2Q A;  1LV5 A;  3E9L A;  4BC4 A;  3KK2 A;  3V6D A;  1NGE A;  3O1W A;  3CER A;  4B1Y B;  2YHX A;  3U4L A;  1BU6 O;  3DLG A;  2B6A A;  2UUC K;  1IKX A;  4DV2 K;  5KGW A;  4B3S K;  2OPS A;  4LFA K;  3P1G A;  2OPR A;  2HBJ A;  1N6Q A;  3A5N C;  3DXK B;  2X78 A;  2Z1I A;  3ZLJ A;  4Z4E A;  2KZM A;  2EHG A;  2G8F A;  1A5W A;  4MDB A;  1Z25 A;  1S3X A;  1RT4 A;  2FF3 B;  3V4I A;  1RCH A;  3SJH A;  1GOB A;  3SLC A;  4NCB A;  4BRA A;  4JRP A;  1QQN A;  1ASW A;  1Q8I A;  2AA4 A;  4KFB A;  5KI6 A;  4LFC K;  3KWG A;  3VMF B;  4HCB A;  1S1U A;  3Q7C A;  2P5O A;  4E1M A;  2HHT A;  2UXB K;  1NGG A;  3EZ5 A;  2RPI A;  1J9A A;  2E2O A;  3J7Z O;  2O8C A;  2A5X A;  4IFV A;  2VG5 A;  4FJ7 A;  4B9Q A;  3LP0 A;  3VQ9 A;  4WFB L;  3KKR A;  5CYQ A;  4JI8 K;  2HB5 A;  3VES A;  1WSE A;  4KTZ A;  4PKH A;  3I33 A;  2YNF A;  3C6H A;  5EX5 A;  4H0T B;  1BIU A;  3F73 A;  4OX9 K;  4B9U A;  2LSN A;  2Q0R A;  3BGR A;  4BR9 A;  3NH1 A;  4AHU A;  3D0P A;  3ZT3 A;  2IOC A;  1NM1 A;  4CGG A;  4W5O A;  1SKW A;  3CFO A;  1GOC A;  1IBK K;  4LF7 K;  4BR7 A;  4JYA K;  1VSI A;  2JWK A;  4FZZ A;  2Q97 A;  3DWL A;  4MLE A;  4AQY K;  3K5O A;  4CFA A;  1IG8 A;  1RBU A;  1KC8 O;  3NE6 A;  4JI3 K;  2GX9 A;  2ITG A;  3TAN A;  3AA3 A;  1ZBF A;  3AVF A;  1NGB A;  3O5B A;  1NK0 A;  5IWA K;  1VQL N;  3DLL L;  3MN9 A;  3FFI A;  3LAL A;  1Z26 A;  4KHU A;  3UKR A;  1WSJ A;  4FM1 A;  1G15 A;  5TKY A;  4Q0B A;  1LAV A;  5ADX H;  3ZEU A;  3AVN A;  3NGZ A;  5HRS A;  2VGN A;  2CGJ A;  1EXQ A;  1NG9 A;  2FXU A;  4EP5 A;  3THX A;  2O8E B;  1S5J A;  1IKV A;  4B3T K;  3WXJ A;  1BO5 O;  1JLA A;  2G8H A;  3TAR A;  4EFH A;  3SAF A;  3ZET B;  4JN4 A;  4BDZ A;  3NFA A;  2P9K A;  3HOT A;  1TL3 A;  3MWT A;  2QWR A;  2P9N A;  2FBV A;  4NXM K;  3E9P A;  3THY B;  2D5R A;  3AVJ A;  3SZ2 A;  1VSJ A;  1JJ2 M;  1WNS A;  5AQP A;  3RR8 A;  3O4Q A;  3KLG A;  3M3Z A;  5BR8 K;  2P9L B;  4WF9 L;  3SYZ A;  4CJK A;  4PWD A;  2FSK A;  3B6P A;  3TSP A;  2V51 B;  4BE1 A;  1REV A;  3ZT2 A;  2A3Z A;  4H5R A;  1NLV A;  4HUF A;  4NLC A;  4CEZ A;  1ZBU A;  2IS3 A;  5JVG L;  2F96 A;  1ZBS A;  3OYM A;  3SAG A;  3QIC A;  5LJV A;  2UU9 K;  3HPH A;  3KIO A;  3CF5 L;  4BDP A;  1ESV A;  2EWS A;  4DS5 A;  2CGL A;  4JAX A;  3HPG A;  2IAJ A;  2VGM A;  3ISN C;  5HRO A;  4JKC A;  3VER A;  2P9I B;  2F4V K;  4OPA A;  3P83 D;  1QVF M;  4Y1C A;  4Z4C A;  3V9Z A;  5JS2 A;  2YX6 A;  4BC5 A;  2G8W A;  1V4S A;  1SL1 A;  2KHO A;  4E7J A;  3WXL A;  3NMU A;  4A62 A;  4E19 A;  3NVK A;  1VQK N;  1S1W A;  2HVI A;  3F2K A;  4BRK A;  2A42 A;  3CPE A;  1YJN N;  3TAF A;  1QQM A;  3DLE A;  1TKX A;  3SQ0 A;  4FYD A;  4DR5 K;  4BR4 A;  4E7L A;  4B8A B;  4FOE A;  3JXU A;  5HRR A;  1Z6R A;  3AVM A;  3HVT A;  1BI4 A;  1FK9 A;  5LMN K;  3QML A;  3FE1 A;  3O08 A;  2QXF A;  3ULE B;  1EQY A;  2NRH A;  4BDY A;  3H3N O;  3AO3 A;  4CEA A;  3BUZ B;  2QWQ A;  2Z1J A;  1V4T A;  4NCA A;  5LL6 Z;  2P9K B;  3PLA A;  2RF2 A;  2UUA K;  5C24 A;  1TYQ B;  2B4J A;  2P9S B;  3LL3 A;  5AQM A;  2HF4 A;  3EEQ A;  1HKC A;  5GAE P;  4F3T A;  4G9Z A;  4ILJ A;  2HMI A;  1HNI A;  3ZCM A;  1EWR A;  1YIT N;  1ASU A;  1U48 A;  5BPL A;  2D1K A;  4M7X A;  2DPN A;  4A2A A;  4K8Z A;  1NK7 A;  2Z1H A;  4MO4 A;  1HX1 A;  5AR0 A;  3F5T A;  5A2Q O;  4FWS A;  4NYF A;  2D0P A;  3HP6 A;  4IO9 L;  4M42 A;  3M5R A;  1HMV A;  3CMA N;  2PZS A;  3P39 A;  2XRI A;  1VQ6 N;  1MU2 A;  3NVM A;  1HJR A;  1C1B A;  3CJ9 A;  4WQ4 A;  2HBM A;  4AHS A;  4YOT A;  1KD1 O;  3LM2 A;  1Q86 O;  3EKU A;  1QZ5 A;  3LDL A;  4LSN A;  5JIC A;  1N5Y A;  4MDA A;  1XHZ A;  1YIJ N;  4H5W A;  1D9F A;  5JVH L;  3OYL A;  4MO5 A;  4B1W B;  5DM7 L;  4J8F A;  1XQS C;  5DK5 A;  4DF4 A;  1GLD G;  3ULE A;  4XEI A;  1VQ4 N;  4ZTJ A;  1UOC A;  3LP1 A;  4PUO A;  2E2P A;  3G10 A;  3CQX A;  3LAK A;  3CQY A;  1HYS A;  3HI0 A;  3I0S A;  5KPZ A;  2O8E A;  4AM6 A;  3WT0 A;  4DV3 K;  4DSE A;  4I9L A;  3JYT A;  4BRG A;  2XY5 A;  4HUG A;  1WSH A;  1RT6 A;  4JKD A;  1HR0 K;  4I9Q A;  3HK2 A;  2D0O A;  4YOU A;  2HF3 A;  5IT9 O;  2XY7 A;  1BQM A;  4B9T A;  2IIR A;  1QZ6 A;  4FK2 A;  2HMP A;  4YOW A;  1FKO A;  3ASM A;  1XUP O;  1MWK A;  3EE8 A;  1KTQ A;  1RDB A;  3OHR A;  4Z4G A;  2O8B B;  3QIP A;  4O44 A;  3SBT A;  3P31 A;  3SUQ A;  2XHB A;  3UKR B;  3L2W A;  4IG3 A;  5BPM A;  5FRO A;  4BQL A;  1DLO A;  4WFA L;  3S9H A;  4KH6 A;  2R7Y A;  1HKB A;  3BY5 A;  1NJX A;  4JI6 K;  2QA4 N;  3H1Q A;  4F4K A;  4E7K A;  4V19 S;  2G8I A;  2E88 A;  5CY4 A;  5C10 A;  3OYN A;  1KRP A;  4IOA L;  4JD2 B;  3I8D A;  1YI2 N;  4CHO A;  3ZSQ A;  1N34 K;  4DTM A;  3UB5 A;  1IJJ A;  4KI6 A;  4LH4 A;  3MN7 A;  2GWK A;  2PYJ A;  1ATN A;  2YI1 A;  2WUS A;  1JL1 A;  1HPM A;  3OW2 M;  4OPH A;  4CJ5 A;  1BCO A;  3BEX A;  1SUQ A;  5LJW A;  3CCQ N;  4BRF A;  4QAG A;  4DMN A;  2OTJ N;  3AA4 A;  3EN9 A;  1Q81 O;  3M8Q A;  4YOR A;  4CJS A;  1SKR A;  4YNQ A;  3HL8 A;  4OPK A;  1RT2 A;  1A5X A;  4JI0 K;  3V9W A;  4CGF A;  1QSY A;  1TK0 A;  3QER A;  4J2B A;  4CF2 A;  4O5F A;  5KPT A;  2VWK A;  4BAC A;  3CCL N;  4BRC A;  3KWI A;  1TKT A;  5AQO A;  3ID8 A;  4DCH A;  4KRE A;  4FPB A;  4H8K A;  5MLC Q;  3HPO A;  2HHX A;  2IC3 A;  3OA9 A;  4M63 C;  1WUA A;  1W0H A;  3FZF A;  1S9G A;  4FL9 A;  2BUP A;  1D8Y A;  1H1V A;  4CW7 B;  4FW1 A;  1P8Z A;  2WFB A;  1ZC6 A;  2QWO A;  5C2D A;  3H3O B;  2D0A A;  2KKZ A;  4BRD A;  3IMX A;  4O0J A;  3AGK A;  4Q5V A;  4LY7 A;  4WQ5 A;  1FXX A;  4ELU A;  3L2V A;  3C94 A;  3U9Z A;  1JLE A;  3IAY A;  3RTV A;  5J2P A;  3K2P A;  5FPM A;  4ISF A;  2WBN A;  1VRT A;  2QWP A;  3NF9 A;  3WUH A;  1JLB A;  3CET A;  1IBM K;  1NGD A;  1NK9 A;  4CER A;  4RTF D;  5KQD A;  3WNH A;  3UE5 A;  4OKJ A;  2QEX N;  4OGE A;  3DXM B;  3CQ8 A;  3PX6 A;  3TSQ A;  4AHT A;  5AQG A;  5JS1 A;  3AVL A;  4FZX C;  1EWQ A;  4KHW A;  4FLV A;  3ENH A;  3CJA A;  3LM9 A;  3K5N A;  3NH2 A;  4QOZ B;  4B08 A;  3T1Y K;  4IZ9 A;  3E9O A;  1WOQ A;  4BC3 A;  1XI1 A;  3VEX A;  1KLM A;  4C1N K;  3AVI A;  4ELV A;  1NOY A;  4E7I A;  1FW6 A;  1LW2 A;  4HVJ A;  4JKE A;  2BTF A;  4FWR A;  3VET A;  5J2M A;  4DTU A;  3TTD A;  4IEE A;  5BN8 A;  4FOI A;  3FFK B;  3K5M A;  2D4W A;  3HOS A;  4CES A;  4JI4 K;  2HHV A;  3V1R A;  2Y1I A;  3THX B;  1NJW A;  4CJ3 A;  3O8M A;  1NNE A;  2I7N A;  3IKM A;  3G4S N;  2FBT A;  2KFN A;  1FKP A;  2NZT A;  1T6C A;  1BUP A;  3OS1 A;  1XMO K;  4JKG A;  3VQ5 A;  3TTC A;  4CF9 A;  2PY5 A;  1X9J A;  2VQE K;  3KLE A;  1IBL K;  5AQY A;  4IJN A;  1CXQ A;  1P90 A;  4BR5 A;  2IVP A;  2OZM A;  3L2U A;  3A0I X;  3WQU A;  3QEP A;  1WAF A;  5CZ2 A;  4O4G A;  4XH5 A;  4W5R A;  2P9U A;  1DTT A;  4CED A;  4KHS A;  4O8U A;  3PSF A;  2OZS A;  3AGR A;  1K73 O;  3ULD A;  3SBG A;  3DI6 A;  1N36 K;  4B8C A;  3MEC A;  3MXJ A;  4LSL A;  1YJ9 N;  3RR7 A;  4FJ5 A;  2Y1J A;  1ATS A;  3CM5 A;  1NGA A;  2Q0U A;  2P9S A;  1UA0 A;  1NKE A;  2RKI A;  2ZJQ L;  3O9T A;  3B8A X;  3PV8 A;  4R79 A;  2QWN A;  1HKG A;  2YV0 X;  2VYP A;  1C1C A;  3ZT1 A;  3OJS A;  2DY4 A;  3M8P A;  5I9E B;  1QQO A;  4M3Y A;  3CFR A;  1UAX A;  5GAG P;  4GMJ B;  1RBT A;  1KFS A;  2RHK A;  3A2F A;  1RTH A;  2EX3 A;  2PBD A;  4QS8 A;  1C0F A;  1O13 A;  2JWL A;  4DS4 A;  1VRU A;  2G8K A;  3AO5 A;  4GNI A;  5ADX A;  3AV9 A;  1C0T A;  4FLW A;  1NMD A;  1QHA A;  2ATQ A;  3NCI A;  4BRM A;  3LP2 A;  4JK9 A;  1IKW A;  3ALY A;  4CHN A;  5BPN A;  4B9V A;  4H4O A;  4IJA A;  3AY9 A;  3PO5 A;  3D6R A;  1CXU A;  4CZJ A;  4B3M K;  1TGO A;  1RDU A;  2XY8 A;  4IOX A;  2ETJ A;  4LD0 A;  3VQ6 A;  4KTW A;  2P9I A;  1OH5 A;  5EXW A;  4BRH A;  3J81 O;  1SV5 A;  4DTO A;  1XMQ K;  1EKE A;  3TAM A;  3MEG A;  3KZB A;  2F8S A;  2FLO A;  3AVG A;  4JK7 A;  3H6E A;  2RE2 A;  3CG7 A;  3CC4 N;  2AP1 A;  3HZ6 A;  1JL2 A;  4JKB A;  5I3U A;  5E41 A;  1T03 A;  3VGL A;  1L3U A;  4B9M A;  3H08 A;  1U04 A;  3ZX2 A;  1Q18 A;  4OVL A;  4CGJ A;  5KGX A;  5JMV A;  2YHY A;  3IS9 A;  1LWE A;  3OYF A;  2GTD A;  2Q36 A;  3EL2 A;  4GKJ K;  1NJI O;  3DYA A;  4L8R B;  5AFU A;  1HNZ K;  4PY5 A;  1NWK A;  4FWM A;  1NGH A;  5M1Q A;  2XY6 A;  3C6T A;  3SK3 A;  1XHX A;  1KVA A;  3AA5 X;  2AJQ A;  1S6Q A;  1U2V B;  4YOV A;  5I42 A;  3VQC A;  4CZI A;  4IWV A;  3LWM A;  3THW A;  2P9P B;  1L3T A;  4JI7 K;  2ZJR L;  3DXM A;  4AF1 A;  3EKS A;  2JGU A;  3HO1 A;  3AA2 A;  2NNW A;  4H0V B;  2P5G A;  4HTL A;  1ASV A;  1CZB A;  3D2F B;  5AZJ A;  3LAM A;  3U3Y A;  1W9H A;  3AVA A;  4FXD A;  4Y1D A;  4E0D A;  2KW4 A;  4IOC L;  2Q2R A;  3VQ8 A;  2J4R A;  4RW9 A;  4YHH K;  4NLB A;  1YHQ N;  1L3S A;  3OYK A;  3VF2 A;  4FLY A;  3O3F A;  2E2Q A;  3QNO A;  3OTO K;  4DU1 A;  1U2V A;  1TYQ A;  4DKW A;  4FJI A;  1U45 A;  4CEC A;  1VAZ A;  4UQG A;  4WQ4 C;  4CJE A;  1T8E A;  3M8R A;  4AM7 A;  1WLJ A;  3O3G A;  4X65 K;  1QHT A;  5GAD P;  4CVN E;  3MEE A;  3VF4 A;  3VQ7 A;  3GDQ A;  4B1V A;  4PQU A;  3LP3 A;  3R1X A;  3DAW A;  3PSI A;  2VG6 A;  5AQL A;  4CFB A;  4E89 A;  1RBS A;  5CE3 A;  2ZM6 K;  1QVG M;  2FSN A;  4FZY A;  3TAQ A;  2I5J A;  3OJU A;  1DEJ A;  3HBT A;  4BWM A;  4BGB A;  4CFC A;  1WBB A;  1KAY A;  2HHU A;  4NO7 A;  3PUF A;  1XNQ K;  1K8A O;  1RDD A;  1NGJ A;  5M1P A;  3NBP A;  4GW6 A;  1OH6 A;  3ZSO A;  4E7H A;  4CFD A;  4H0P A;  3NAE A;  2HNY A;  2OCE A;  3C65 A;  1K8K B;  1R59 O;  1VSM A;  4JHD B;  1X9M A;  5J2N A;  2ZQB A;  3OVN A;  5C2F A;  4DV7 K;  4DTJ A;  3KJV A;  4N56 A;  4CEO A;  4CIG A;  3QBW A;  1KQS M;  4WYB A;  2RN2 A;  3V9U A;  1Y97 A;  5C42 A;  3AAR A;  4CJQ A;  2CH6 A;  1GOA A;  4NCG A;  1QSS A;  1BA0 A;  4CD1 A;  4DV1 K;  3RRH A;  1EX4 A;  1K6Y A;  4BRL A;  3R6M A;  3R3L A;  3SPZ A;  3KHY A;  2VWJ A;  3HJF A;  4WE1 A;  1JLF A;  5KRS A;  3FLC O;  1NGF A;  4DV0 K;  4W5Q A;  1Q9Y A;  4M3U A;  2W6L A;  4ILH A;  3OYC A;  2HW3 A;  1L5U A;  3PX4 A;  4GVM A;  4BRQ A;  3D2F A;  3BF1 A;  5AZJ B;  5AQT A;  4Z94 A;  1NKC A;  3KD5 E;  3OYG A;  3G6E N;  4CZG A;  5ELZ A;  4CHY A;  4LF8 K;  4A5A A;  2UXC K;  5CYM A;  3SNN A;  3NHG A;  1RT7 A;  2KZZ A;  1TV6 A;  3TAP A;  1NBW A;  1NGC A;  1OVQ A;  3JSM A;  3GOI A;  1NK5 A;  4OKK A;  5C0Y A;  3OBW A;  4FLZ A;  4J2E A;  4IEI A;  3LZJ A;  4E1N A;  3ATU A;  4H0Y B;  1C1A A;  4GKK K;  1T6D A;  4N76 A;  3QBX A;  2I7P A;  1U49 A;  3O6W A;  4RG8 A;  4CBU A;  4DQQ A;  1J5O A;  3H46 O;  3WNE A;  3VQE A;  5H1S Q;  1KAZ A;  2WON A;  3NGI A;  4FM0 A;  4DTN A;  3I0R A;  4JKG B;  3PY8 A;  1FJG K;  4I7F A;  4J2A A;  4FJL A;  4CK2 A;  3KLF A;  4FJJ A;  2O4I A;  3I55 N;  4JKH A;  1A5V A;  3ZT0 A;  5BN9 A;  3C7N A;  1T44 A;  3ZSX A;  3U9D A;  1CLQ A;  3VQQ A;  1WSI A;  2B5J A;  4CJP A;  3SV3 A;  3IG1 A;  1N32 K;  4CI6 A;  4IKF A;  3AVH A;  4JS5 A;  4DR1 K;  4KH4 A;  1WN7 A;  2ITM A;  4M3R A;  4CJ7 A;  3RMB A;  3SQ1 A;  1XNR K;  4JI2 K;  4ICL A;  4KKO A;  1DT9 A;  1D9D A;  3CC7 N;  1BA1 A;  1NMN A;  4B9N A;  4HWI A;  4UY8 O;  5AFU H;  4K0K K;  5HOO A;  4CJF A;  1S9E A;  1NKB A;  3O80 A;  1VHX A;  4EHT A;  4KHN A;  3RRG A;  1RBR A;  4F2S A;  4CJU A;  4DHY A;  1U4B A;  4JKA A;  4O0I A;  2A1R A;  2HST A;  1RT1 A;  2HNZ A;  2E2N A;  2P1J A;  3RMD A;  1SL2 A;  4C8K A;  4CZE A;  2QKB A;  4IO8 A;  3L6Q A;  4Z4F A;  1D5A A;  1BGX T;  1DKG D;  3D7E O;  5D3G A;  3OY9 A;  4B1X B;  4YOY A;  3VQ4 A;  2Q1N A;  4M3X A;  4FJ9 A;  2W40 A;  3IDH A;  3CI5 A;  1CZ9 A;  4CJV A;  4JKF A;  3QB0 A;  3S3N A;  3CHW A;  3ZSZ A;  4DTP A;  2FSJ A;  3S3M A;  3CC2 N;  4CZL A;  4H5V A;  3K9J A;  1TKD A;  5BRD A;  3V9X A;  3QEI A;  3P38 A;  2KTQ A;  2BH1 A;  1TUY A;  3DOK A;  5C12 A;  4FLT A;  3GBT A;  3KK3 A;  3EE9 A;  5B8H A;  4KV8 A;  4B9S A;  2X6S A;  3SJJ A;  4PHT X;  5AQJ A;  3WNF A;  4FCY A;  4GVE A;  3V81 A;  4GV9 A;  4ILG B;  3DLB A;  5AQR A;  3VA0 A;  1ITG A;  4Z0U A;  3MED A;  1KAX A;  5BRH A;  2KQ2 A;  3VEN A;  2BAN A;  3QIO A;  4FWQ A;  1BOT O;  2QI2 A;  4YY3 K;  1NJZ A;  3UKU A;  5HL7 L;  3PIP L;  4K25 A;  4FLX A;  4C8N A;  3VOV A;  5JLF A;  3BDP A;  3ZX3 A;  3SUP A;  3HTV A;  5KPR A;  3VTH A;  5AQK A;  4BC2 A;  3UIQ A;  3HP9 A;  3DMJ A;  2O8F B;  1DTQ A;  1KSP A;  5GIN A;  3GL1 A;  4U67 L;  1QS4 A;  3SMP A;  1X3N A;  3L3V A;  2YJF A;  2ZF5 O;  4CEB A;  2Q3S A;  3VEO A;  4CEQ A;  4ELT A;  5FPN A;  5AQN A;  4CHP A;  1VSH A;  3H1V X;  1BDG A;  3LDN A;  3TAB A;  1GLJ O;  1GLB G;  2NUB A;  4JI1 K;  3VEW A;  3MCP A;  4KB1 A;  1MWM A;  3WEE A;  3ZX0 A;  4AH9 A;  4C8L A;  4DSK A;  2ZGY A;  4PL8 A;  3WNG A;  4DQI A;  3MK6 A;  5AZI B;  3VQD A;  2QXL A;  4DV6 K;  3TSU A;  2CGK A;  2OYQ A;  3LZI A;  4LF5 K;  4AIL C;  5M1F A;  3T3F A;  4BQZ A;  5C25 A;  3SQ2 A;  1LWF A;  3HVR A;  4JLH A;  4A5B A;  4FWP A;  4JRQ A;  4RWT A;  3MCA B;  5M1O A;  1RDC A;  4PKG A;  1JLG A;  1GLE G;  4QS7 A;  3I8B A;  2PYL A;  3TI0 A;  2XO7 A;  3ATV A;  3QES A;  4N47 A;  4NXN K;  2UXD K;  3DM2 A;  3DOL A;  2NRR A;  2YHB A;  1RTI A;  1S1T A;  3FZM A;  1JCF A;  4CEF A;  2O8F A;  4FO0 A;  4M3T A;  1BL3 A;  2D0B A;  2O8D A;  2YJE A;  3BF3 A;  3K0S A;  3SPY A;  4RCH A;  1JKH A;  4BE2 A;  3NF7 A;  1VQ5 N;  1HUX A;  1JLC A;  1HRH A;  3ZEU B;  4CF8 A;  2GUI A;  4MFB A;  4H4M A;  2E5L K;  3OYI A;  2E1Z A;  4DV5 K;  4F3O A;  3PO4 A;  1BCM A;  4O55 A;  4KPY A;  1HPZ A;  4K8X A;  4RW7 A;  3L2Q A;  4XH1 A;  1SS6 A;  4BR0 A;  4KBO A;  3EY1 A;  4BG9 A;  4CIF A;  1SKS A;  3QEX A;  4M41 A;  4CE9 A;  2V52 B;  4KTQ A;  2OAN A;  3O9R A;  3AVC A;  2HHH K;  2HVH A;  5AQV A;  5HLF A;  3IRX A;  2DTU A;  3O9U A;  2NRZ A;  2G8U A;  4DR7 K;  2GBZ A;  1K9M O;  4K41 A;  3CJC A;  3CYM A;  3G0Z A;  2O4G A;  3MXI A;  3T1H K;  3QET A;  2VG7 A;  1JCE A;  4IFY A;  1VQ9 N;  1RGI A;  3LDS A;  4H0O A;  4EHU A;  3VEZ A;  2ZJP L;  4J2D A;  3J7A P;  2QWL A;  1XC3 A;  2NRT A;  2F7T A;  1K8K A;  2GWJ A;  2GV9 A;  2YHA A;  3P4I A;  2E20 A;  3J80 O;  4DSJ A;  5FPE A;  4EP4 A;  1WBD A;  3MN5 A;  3CCJ N;  1ZBL A;  1SQK A;  3CCS N;  4JK8 A;  1N33 K;  3THV A;  1I94 K;  3S41 A;  4FK0 A;  1LW0 A;  5C15 A;  3CIP A;  4LH5 A;  5AZI A;  4BRP A;  2O8B A;  4B1U B; 
#chains in the Genus database with same CATH homology
 3E01 A;  1O1W A;  1D9F A;  4CJW A;  1RBV A;  3M8R A;  1RT5 A;  1WLJ A;  4DTX A;  3O3G A;  3OYL A;  4RW4 A;  1QHT A;  3OYE A;  4F8R A;  3OS0 A;  1EET A;  3MEE A;  5DK5 A;  4M45 A;  4DF4 A;  2HHW A;  5J2Q A;  3VQ7 A;  3TWH A;  4I2P A;  1YTA A;  4PQU A;  4QCL A;  3VQB A;  3LP3 A;  5KTQ A;  4ZTJ A;  4FJX A;  4KI4 A;  1UOC A;  3LP1 A;  2VG6 A;  4CFB A;  4E89 A;  3LPT A;  1RBS A;  4PUO A;  3G10 A;  2IDO A;  3SUN A;  3LAK A;  3DLH A;  5EU7 A;  3TAQ A;  4FZY A;  1TAU A;  3ITH A;  5DMR A;  2I5J A;  3OJU A;  2DFE A;  3T1A A;  4BWM A;  3O3H A;  4CFC A;  1NK8 A;  1HYS A;  2HHU A;  2YNG A;  4C8O A;  3I0S A;  1I3A A;  3PUF A;  1RIL A;  1RDD A;  3U6F A;  4DSE A;  4I9L A;  3JYT A;  3ZSY A;  2XY5 A;  3RWU A;  3NBP A;  4HUG A;  1WSH A;  4GW6 A;  3ZSO A;  1RT6 A;  4CFD A;  4E7H A;  3QO9 A;  4OLA A;  4I9Q A;  5FRN A;  1RTD A;  3NAE A;  3OS2 A;  3HK2 A;  2HNY A;  4YFU A;  1T7P A;  1IH7 A;  3TAE A;  4CJT A;  1VSM A;  3LPU A;  4FVM A;  4CHQ A;  4W5T A;  1HYZ A;  1BQM A;  2XY7 A;  4B9T A;  4W5N A;  3NDK A;  2A1S A;  4PA1 A;  5J2N A;  2ZQB A;  1X9M A;  4FK2 A;  3OVN A;  1FKO A;  3AO2 A;  3ASM A;  4DTJ A;  1U47 A;  3KJV A;  1JLQ A;  1KTQ A;  1RDB A;  4N56 A;  4Z4G A;  4CEO A;  3QIP A;  4CIG A;  4O44 A;  3SUQ A;  2E6L A;  3DLK A;  3S3O A;  2RN2 A;  2XHB A;  1QQC A;  1EP4 A;  3B6O A;  3L2W A;  3V9U A;  1Y97 A;  5C42 A;  3OYH A;  4CGH A;  2OA8 A;  2FC0 A;  2KFZ A;  4IG3 A;  4EZ6 A;  3NGY A;  4CJQ A;  3RMC A;  1JXB A;  1GOA A;  5FRO A;  4NCG A;  3DRS A;  1QSS A;  4FM2 A;  1DLO A;  4DQP A;  2D0C A;  1J53 A;  5T7B A;  3KD1 E;  1YVU A;  3KKS A;  3RRH A;  3S9H A;  5HP1 A;  1EX4 A;  2R7Y A;  3QNN A;  1K6Y A;  1KFD A;  3LWL A;  1NJX A;  3SPZ A;  1T05 A;  2VWJ A;  3HJF A;  4F4K A;  4WE1 A;  4E7K A;  3SI6 A;  4CK1 A;  2G8I A;  5CY4 A;  1JLF A;  3OYN A;  5KRS A;  3O4N A;  1KRP A;  4FJH A;  1HYV A;  4W5Q A;  1NK4 A;  1Q9Y A;  1IO2 A;  4DWI A;  4M3U A;  1VSF A;  3OYC A;  3I8D A;  3VN5 A;  1L5U A;  2HW3 A;  3PX4 A;  3K57 A;  1S6P A;  4CHO A;  3ZSQ A;  5HRP A;  2BDP A;  4GVM A;  1ZBI A;  1ZBH A;  2YNI A;  4DTM A;  2FBX A;  4R5P A;  4KI6 A;  4LH4 A;  1HQE A;  1TVR A;  2PYJ A;  3ZSV A;  3MAQ A;  4E3S A;  1NKC A;  3KD5 E;  3OYG A;  1BIS A;  1JL1 A;  1RT3 A;  4CF1 A;  4ZHR A;  4OPJ A;  4AHR A;  3K5L A;  4CHY A;  1HNV A;  3PX0 A;  4CJ5 A;  1BCO A;  1QSL A;  1SUQ A;  2JLE A;  2OPQ A;  2YKM A;  2IGI A;  3OYA A;  4QAG A;  4DMN A;  1ZYQ A;  4CCH A;  5J1E A;  5CYM A;  2HHQ A;  4OKE A;  2ZD1 A;  3AA4 A;  3MXM A;  3SNN A;  1TK5 A;  3NHG A;  1RT7 A;  2KZZ A;  1WSG A;  1TV6 A;  3TAP A;  3HT3 A;  1L3V A;  2Z1G A;  3M8Q A;  1TKZ A;  4CJS A;  4KB0 A;  4NYN A;  1IG9 A;  3U3G A;  3JSM A;  1YTU A;  3CFP A;  1BHL A;  4YNQ A;  3HL8 A;  4OKK A;  2E4L A;  2BE2 A;  3VQP A;  4OPK A;  1NK5 A;  1SKR A;  1B9F A;  1RT2 A;  1A5X A;  3V9W A;  4DG1 A;  3HYF A;  4CGF A;  3OYB A;  4FLZ A;  4N41 A;  4FW2 A;  1S1V A;  3L8B A;  3LZJ A;  4E1N A;  1QSY A;  4J2E A;  4Z4I A;  4DLE A;  1TK0 A;  4HCC A;  1C1A A;  3KLI A;  4RW8 A;  3QER A;  4J2B A;  3T19 A;  4CF2 A;  4FJM A;  4N76 A;  1U49 A;  4HUE A;  4RG8 A;  3V1O A;  2VWK A;  4DQQ A;  1J5O A;  1C0M A;  3C6U A;  4I2Q A;  3WNE A;  4BAC A;  1LV5 A;  3VQE A;  3M8S A;  4ZTF A;  1KVC A;  1KCF A;  3KK2 A;  2WON A;  3V6D A;  1TKT A;  2ZE2 A;  3NGI A;  4FM0 A;  3DLR A;  4DTN A;  3I0R A;  1RDA A;  4G1Q A;  4KRE A;  2HHX A;  4H8K A;  2P51 A;  3HPO A;  3PY8 A;  4I7F A;  4J2A A;  2IC3 A;  3DLG A;  4FJL A;  1X9S A;  4CK2 A;  3KLF A;  2B6A A;  4FLU A;  1B92 A;  4FJJ A;  1IKX A;  2O4I A;  1W0H A;  5KGW A;  2OPS A;  1S9G A;  4CGD A;  3P1G A;  1D8Y A;  2OPR A;  4KAZ A;  1A5V A;  1N6Q A;  3ZT0 A;  4FW1 A;  2X78 A;  2Z1I A;  4Z4E A;  2KZM A;  3EYZ A;  2EHG A;  2G8F A;  3ZSX A;  4DFP A;  1CLQ A;  2D0A A;  4O0J A;  1A5W A;  1WSI A;  3VQQ A;  4Q5V A;  2B5J A;  1Z25 A;  4LY7 A;  4CJP A;  3SV3 A;  1RT4 A;  3V4I A;  1F21 A;  1FXX A;  1LAW A;  1RCH A;  4ELU A;  3L2V A;  3C94 A;  1GOB A;  1JLE A;  3IAY A;  1XWL A;  3IG1 A;  3RTV A;  5J2P A;  3K2P A;  4NCB A;  4IKF A;  1QE1 A;  4JRP A;  3AVH A;  4JS5 A;  3OYD A;  1WN7 A;  4M3W A;  2WOM A;  1VRT A;  4M3R A;  1ASW A;  1Q8I A;  3NF9 A;  4KFB A;  5KI6 A;  4CJ4 A;  3RMB A;  3SQ1 A;  1JLB A;  4HCB A;  1S1U A;  3C95 A;  2P5O A;  4E1M A;  1NK9 A;  4CER A;  2HHT A;  4CK3 A;  3WNH A;  3DRR A;  4ICL A;  4KKO A;  3EZ5 A;  4DTS A;  2RPI A;  1J9A A;  1D9D A;  1BIZ A;  4B9N A;  4IFV A;  2VG5 A;  4OKJ A;  4N5S A;  4FJ7 A;  4B9L A;  4OGE A;  3CQ8 A;  3PX6 A;  3LP0 A;  3VQ9 A;  3NF8 A;  3KKR A;  4CJF A;  1S9E A;  4DQS A;  4AHT A;  1NKB A;  5CYQ A;  5JS1 A;  3AVL A;  1VSD A;  4FZX C;  2HB5 A;  4KHN A;  4DFJ A;  1WSE A;  4KTZ A;  4XIU A;  3LAN A;  3RRG A;  1JXE A;  4DSI A;  4KHW A;  4KHY A;  1RBR A;  2YNF A;  4FLV A;  4F2S A;  3KK1 A;  4CJU A;  1U4B A;  4DFM A;  4O0I A;  4DQR A;  3K5N A;  2A1R A;  3NH2 A;  1BIU A;  4QOZ B;  4B08 A;  3F73 A;  4FK4 A;  2F8T A;  5SZT A;  4B9U A;  4FJ8 A;  1RT1 A;  3ZT4 A;  4CJE A;  2LSN A;  2HNZ A;  2P1J A;  3RMD A;  1XI1 A;  1SL2 A;  3V1Q A;  1BI4 B;  1KLM A;  3BGR A;  4C8K A;  3NH1 A;  3AVI A;  2QKB A;  4DU3 A;  4AHU A;  4HTU A;  4ELV A;  1NOY A;  3D0P A;  3ZT3 A;  4E7I A;  4Z4F A;  1D5A A;  2IOC A;  1LW2 A;  4HVJ A;  1BGX T;  4BE0 A;  4CGG A;  5D3G A;  4DSF A;  3OY9 A;  3VQ4 A;  2YKN A;  4OJR A;  4M3X A;  5J2M A;  4W5O A;  4FJ9 A;  4DTU A;  1CZ9 A;  4CJV A;  3S3N A;  3CFO A;  1GOC A;  1SKW A;  3AVB A;  3QLH A;  3VA3 A;  3K5M A;  3ZSZ A;  2YNH A;  4DTP A;  1VSI A;  4ID5 A;  4C8M A;  4CES A;  3S3M A;  4FZZ A;  3AVK A;  1TKD A;  2HHV A;  3V1R A;  2Y1I A;  3NH0 A;  1NJW A;  4CJ3 A;  3V9X A;  3QEI A;  4KO0 A;  1VSL A;  2KTQ A;  3DOK A;  2FBT A;  2KFN A;  3K5O A;  4CFA A;  4FLT A;  3KK3 A;  1FKP A;  4KV8 A;  1RBU A;  4B9S A;  3NE6 A;  2X6S A;  3SJJ A;  5HRN A;  3OS1 A;  3WNF A;  2ITG A;  4FCY A;  3VQ5 A;  3TAN A;  3AA3 A;  1WSF A;  3V81 A;  4CF9 A;  2PY5 A;  1ZBF A;  1KLN A;  3AVF A;  3DLB A;  3VA0 A;  1ITG A;  3CM6 A;  4Z0U A;  1NK0 A;  1NK6 A;  3KLE A;  3MED A;  1CXQ A;  4DU4 A;  3RMA A;  2KQ2 A;  3FFI A;  4DSL A;  2BAN A;  3L2U A;  3LAL A;  2OZM A;  1Z26 A;  4KHU A;  3QIO A;  1WSJ A;  4FM1 A;  1G15 A;  1WAF A;  5CZ2 A;  3QEP A;  1UA1 A;  4Q0B A;  4O4G A;  2X6N A;  4W5R A;  4DF8 A;  1DTT A;  1LAV A;  4IBN A;  4CED A;  3AVN A;  1NJZ A;  4KHS A;  2OZS A;  3NGZ A;  5HRS A;  4FLX A;  3ULD A;  4C8N A;  3DI6 A;  1EXQ A;  4B8C A;  3BDP A;  3MEC A;  4EP5 A;  3SUP A;  3MXJ A;  4LSL A;  3RR7 A;  4FJ5 A;  2Y1J A;  3L2R A;  1S5J A;  1IKV A;  4MQ3 A;  3UIQ A;  3CM5 A;  3HP9 A;  2HND A;  3DMJ A;  1UA0 A;  1NKE A;  2RKI A;  1JLA A;  2G8H A;  1DTQ A;  4O5B A;  1KSP A;  3PV8 A;  3K59 A;  3TAR A;  2QKK A;  1QTM A;  1VSE A;  2YV0 X;  1QS4 A;  1C1C A;  3ZT1 A;  3OJS A;  3NFA A;  3ZSR A;  3L3V A;  3M8P A;  4BDZ A;  2DY4 A;  1WAJ A;  1TL3 A;  5SWM A;  4CEB A;  2Q3S A;  3CFR A;  4M3Y A;  1UAX A;  4M3Z A;  4KHQ A;  2FBV A;  4GMJ B;  1RBT A;  4RW6 A;  5HBM A;  4CEQ A;  1KFS A;  4ELT A;  4FJK A;  4JS4 A;  3A2F A;  1RTH A;  2EX3 A;  1VSH A;  4CHP A;  1KVB A;  1BQN A;  4DFK A;  2D5R A;  4KRF A;  4ID1 A;  3AVJ A;  3SZ2 A;  4DS4 A;  1Q9X A;  1VSJ A;  1VRU A;  3QIN A;  3OYJ A;  1WNS A;  1X9W A;  2G8K A;  3TAB A;  3AO5 A;  2HHS A;  2NUB A;  3RR8 A;  3O4Q A;  3AV9 A;  1C0T A;  3KLG A;  4FLW A;  4KB1 A;  2ATQ A;  4AH9 A;  3NCI A;  4C8L A;  3SYZ A;  4CJK A;  4DSK A;  4PWD A;  3LP2 A;  3WNG A;  4DQI A;  2BGG A;  3KTQ A;  4AHC A;  3VQD A;  5FRM A;  3B6P A;  1IKW A;  1TAQ A;  3ALY A;  4CHN A;  4BE1 A;  4B9V A;  2E6M A;  4H4O A;  1REV A;  3ZT2 A;  2OYQ A;  1R0A A;  4Z4H A;  3LZI A;  3D45 A;  3PO5 A;  4HUF A;  3QEW A;  4FJN A;  4AIL C;  1HQU A;  1CXU A;  4CEZ A;  1ZBU A;  1TGO A;  2IS3 A;  2XY8 A;  3T3F A;  2F96 A;  5K14 A;  1B9D A;  5C25 A;  3F9K A;  3OYM A;  3SQ2 A;  2ETJ A;  1LWF A;  4LD0 A;  3HXM A;  3HVR A;  3HPH A;  3KIO A;  3P5J A;  4JLH A;  4KTW A;  3VQ6 A;  3VQA A;  4CF0 A;  4CJL A;  4BDP A;  4DS5 A;  3HPG A;  1SV5 A;  4DTO A;  2IAJ A;  4JRQ A;  1RNH A;  1LWC A;  1EKE A;  3ISN C;  5HRO A;  3TAM A;  1RDC A;  3MEG A;  2F8S A;  1JLG A;  1TL1 A;  3AVG A;  3P83 D;  4Y1C A;  3CG7 A;  4Z4C A;  4CIE A;  3V9Z A;  3L3U A;  5JS2 A;  2PYL A;  1JL2 A;  5I3U A;  4OLB A;  4CGI A;  5E41 A;  2G8W A;  1SL1 A;  4E7J A;  2XO7 A;  3TI0 A;  1T03 A;  4E19 A;  3NF6 A;  3QES A;  4N47 A;  1L3U A;  4BWJ A;  3HST B;  1S1W A;  2HVI A;  4B9M A;  3H08 A;  1J54 A;  1U04 A;  3DM2 A;  3DOL A;  2YHB A;  3DLE A;  4OVL A;  1TKX A;  3TAF A;  3SQ0 A;  4FYD A;  1RTI A;  1S1T A;  4CGJ A;  3TAG A;  4CEF A;  5KGX A;  1XC9 A;  4E7L A;  4M3T A;  1BL3 A;  2D0B A;  4B8A B;  3ZSW A;  3IS9 A;  5HRR A;  1LWE A;  3SPY A;  1YT3 A;  2FBY A;  3OYF A;  3AVM A;  4CHZ A;  1JKH A;  4BE2 A;  3DYA A;  4L8R B;  3KLH A;  2QK9 A;  1RTJ A;  3NF7 A;  4CJR A;  3HVT A;  4PY5 A;  1JLC A;  4B3O A;  1BI4 A;  1FK9 A;  1HRH A;  4CF8 A;  2GUI A;  4MFB A;  1NJY A;  2QXF A;  2XY6 A;  4H4M A;  4BDY A;  2DFH A;  3C6T A;  3DRP A;  3OYI A;  3V9S A;  3AO3 A;  1XHX A;  4CEA A;  2Z1J A;  3SCX A;  4F3O A;  3PO4 A;  1KVA A;  3K58 A;  1BCM A;  4NCA A;  4HHT A;  3AA5 X;  2AJQ A;  1S6Q A;  2RF2 A;  4OGC A;  5I42 A;  4O55 A;  5C24 A;  4KPY A;  1HPZ A;  4K8X A;  4RW7 A;  3L2Q A;  4TSX A;  3AO4 A;  3VQC A;  2B4J A;  4FXD A;  3EY1 A;  4CIF A;  3LWM A;  1SKS A;  3QEX A;  4M41 A;  4CE9 A;  4AHV A;  1L3T A;  4F3T A;  2G8V A;  4DLG A;  1C0U A;  2HMI A;  1HNI A;  5CZ1 A;  3AVC A;  3ZCM A;  4KTQ A;  2HVH A;  5HLF A;  3IRX A;  2DTU A;  1ASU A;  2JGU A;  2X74 A;  4EZ9 A;  3HO1 A;  3AA2 A;  1I39 A;  1U48 A;  1C6V A;  2G8U A;  2GBZ A;  3AO1 A;  1SL0 A;  2P5G A;  4CEE A;  1IKY A;  3G0Z A;  1ASV A;  1X1P A;  3CYM A;  1CZB A;  2O4G A;  2OPP A;  3SV4 A;  3LAM A;  1VSK A;  3U3Y A;  3MXI A;  1VK0 A;  5FDL A;  1W9H A;  3QET A;  3AVA A;  4DTR A;  4K8Z A;  4Y1D A;  2VG7 A;  2KW4 A;  5KRT A;  4E0D A;  1NK7 A;  3QEV A;  4IFY A;  2Z1H A;  3HM9 A;  3HP6 A;  3LDS A;  4NYF A;  4M42 A;  1S1X A;  3VQ8 A;  1HMV A;  4IG0 A;  2PZS A;  4RW9 A;  4J2D A;  3SUO A;  2XRI A;  4FJG A;  1TK8 A;  1MU2 A;  2DFF A;  2GV9 A;  2W42 A;  3SQ4 A;  1HJR A;  2YHA A;  1L3S A;  3OYK A;  4FLY A;  1C1B A;  3O3F A;  3QNO A;  4DSJ A;  4AHS A;  4EP4 A;  1ZBL A;  4DU1 A;  4FJI A;  3THV A;  1U45 A;  4LSN A;  1N5Y A;  4FK0 A;  1LW0 A;  4CEC A;  3TR8 A;  4LH5 A;  4UQG A;  4IDK A;  1UWB A;  1NOZ A;  1XHZ A;  1T8E A;  4F2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...