2RN2A

Structural details of ribonuclease h from escherichia coli as refined to an atomic resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE H
publication title Structural details of ribonuclease H from Escherichia coli as refined to an atomic resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1992-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rn2A00
1CXUA 3C95A 3NGZA 4EZ6A 3RRHA 4FZZA 4DMNA 4E7KA 3HO1A 5JS1A 4CFCA 1X1PA 1KVBA 3AO5A 3TWHA 1CZ9A 4BE2A 4FCYA 3VA3A 3G0ZA 4DS5A 1IG9A 3AA5X 4O0JA 1XWLA 3O4NA 2Z1IA 2YHBA 4RG8A 2FC0A 4CF1A 1RT2A 1RDDA 3THVA 4M3WA 4B9VA 2KFZA 4CJKA 3SQ0A 2OPQA 5I42A 1TGOA 1YVUA 3SCXA 3DLEA 1WSFA 2Y1IA 4Z4GA 4FLVA 5C25A 4JLHA 4KAZA 3MEGA 1RTHA 3ZSYA 4AHCA 4FJKA 2QK9A 1TKTA 1KVCA 2VWKA 3SUQA 2F96A 4QOZB 1BIUA 1TVRA 5SZTA 1VRUA 3EYZA 4KHSA 3AVKA 3QEPA 3VA0A 3L2WA 4CEOA 4ELUA 4LH4A 3B6PA 1R0AA 3TAEA 3SYZA 3JYTA 1DTQA 1L3SA 3ZCMA 2I5JA 3QNOA 4FZYA 1S1WA 2RF2A 4KREA 3C6UA 1L3TA 3DI6A 2YNIA 3P83D 3OYHA 4F4KA 4EZ9A 4FXDA 1B9FA 1SV5A 1CXQA 3ZSZA 4BWJA 3SZ2A 4OGCA 2HHUA 3OYIA 4LSNA 1BCOA 1NKEA 2PYLA 1NKCA 2HMIA 5CZ2A 3V1RA 3ITHA 4K8ZA 3VQ9A 1TV6A 3SJJA 3T1AA 1J5OA 3LALA 2E6MA 3OYMA 3WNHA 4W5TA 4NCBA 4FLWA 3SNNA 1JLFA 5FRMA 2O4GA 3NH2A 3RRGA 3NGIA 3RWUA 4Z0UA 3DRPA 1J54A 4NCGA 4E19A 3PX6A 4ID5A 4NCAA 1WSEA 2GV9A 4CHZA 4AH9A 1ZBIA 2B6AA 4M3TA 2ATQA 1BIZA 1LW0A 3I8DA 3SPYA 3SQ1A 4DTXA 4E7LA 3V81A 3RR7A 2EHGA 3WNFA 1L3UA 3AV9A 2D0BA 1UA0A 2HVHA 4FJ8A 3VQ5A 3ZSXA 4DSLA 4GMJB 3M8PA 1ZBUA 3NDKA 1WSJA 1C0TA 1U04A 3AVFA 3LPTA 3ZT4A 1X9MA 3ZT1A 4KHUA 3HPHA 3O3FA 3PY8A 3LWMA 4O0IA 3K57A 3MEEA 1EETA 1RT4A 1LWEA 3MECA 4CIGA 2G8UA 2DFFA 1B9DA 2ZQBA 4KV8A 1W0HA 1WAJA 3CFRA 2R7YA 1S1UA 4OPJA 3V9WA 4E7IA 4ZTJA 3E01A 4KTWA 4OLBA 3KK1A 4Z4FA 4CFAA 2HHVA 4I2QA 1C1CA 2RN2A 3F73A 3AVBA 4KI4A 3OS1A 1C0MA 1J9AA 3OYNA 3KK2A 3S3NA 4KHYA 3DLGA 5E41A 1WSIA 3LZJA 1GOCA 5I3UA 1ASVA 2X78A 4M3RA 1JLCA 5HRSA 3DOLA 4I7FA 1LAWA 4LH5A 1RBUA 3AVCA 3NH1A 1HPZA 2G8WA 2F8SA 4CJFA 1Z25A 4DS4A 4DTSA 1BI4A 1W9HA 1N6QA 2Z1GA 1Y97A 2XHBA 3V1QA 2X6SA 2IAJA 3SUNA 2G8FA 4B9LA 4YFUA 1RTIA 3K5LA 3AO2A 1JL1A 5HRNA 4FLXA 3T19A 3OJUA 1HNVA 4DSIA 4PWDA 4HTUA 5J2MA 4DU4A 1BI4B 3WNGA 3NH0A 2LSNA 5HRPA 1WN7A 4NYNA 1VRTA 1IKYA 4CEAA 3L2RA 3RMAA 1XC9A 1Q9YA 4Q0BA 1JKHA 3C94A 3VQ8A 4Q5VA 3KD1E 4CJTA 4LY7A 1Q8IA 1QHTA 3LANA 1JXEA 3K58A 1S6QA 2PY5A 2HHXA 3NGYA 1B92A 1NK0A 4NYFA 1YTAA 4FJJA 3KKSA 4AHVA 3L3VA 4DQIA 4J2AA 4O4GA 1FXXA 4I2PA 3M8QA 3K59A 1ZYQA 1U49A 4I9QA 3VQDA 4DLEA 3ZT0A 1NK8A 1C1AA 3IRXA 4CJQA 1RT6A 5C24A 5J1EA 1RTJA 3ZSVA 1WAFA 3CG7A 5J2NA 4DSFA 4W5OA 3VQ7A 4CF2A 2Y1JA 4FJ9A 1RBTA 2YNFA 4ICLA 1WLJA 3S3MA 3TARA 1LAVA 4CJEA 4BACA 1SKWA 4B9UA 4FK2A 4FLZA 3P1GA 4KTZA 4CFDA 3DMJA 3P5JA 3KLEA 2KQ2A 4IFVA 4Y1DA 1DLOA 3ZSWA 1BCMA 3TR8A 1QSSA 2B4JA 3VN5A 3KKRA 3QO9A 4CEEA 4CHNA 2YKNA 4JS5A 4DU3A 2FBXA 4DTNA 3PX4A 3SI6A 1HQUA 3OVNA 1DTTA 2HVIA 3MEDA 4LSLA 4CERA 3QEXA 4F3OA 3LZIA 4CJVA 4HVJA 1NJZA 2IDOA 3CYMA 1SKSA 1RBSA 1HYVA 4CF8A 3TANA 3VQEA 3TAGA 1IKWA 3DYAA 4CIFA 1BHLA 3KJVA 2IGIA 3ZSRA 2D5RA 2ZD1A 1EX4A 4FJGA 3ULDA 1RDCA 1S9GA 1CZBA 4CF9A 1RDBA 3VQBA 4KRFA 4W5NA 3QIPA 4DWIA 4XIUA 3SPZA 4ELVA 2BE2A 4H8KA 4IDKA 4J2DA 1JLBA 1FKPA 2GBZA 4KB0A 4FJ7A 2XY6A 1KVAA 4O44A 4E1MA 2RKIA 2OYQA 4CJUA 3QESA 2O4IA 3S9HA 2YNGA 4OPKA 1RBRA 1XHZA 1LV5A 4FZXC 4E89A 1A5VA 1SL2A 4F3TA 3LP3A 3O4QA 3DLKA 4Z4HA 1BQNA 1LWCA 3S3OA 1J53A 1TL3A 1S5JA 4FW2A 4GVMA 1UAXA 5HRRA 1UA1A 1NK4A 4DTJA 2HNDA 3C6TA 1C0UA 3HVTA 4M3XA 1RILA 3HYFA 1WNSA 4CESA 5KRTA 1VSFA 2HB5A 2JLEA 3NF7A 4DG1A 3BDPA 4FK0A 3TAFA 3WNEA 5K14A 3KLHA 3I0SA 1TKDA 4CGDA 3OYKA 1HJRA 3RMBA 3TAPA 3SQ4A 2YHAA 1ASUA 2ITGA 3OJSA 1S9EA 3IS9A 4C8MA 3VQQA 3D45A 1SKRA 2G8VA 4DQPA 1JLQA 4C8KA 3K5NA 1D8YA 4N47A 3ZT2A 4CK2A 3NFAA 1HRHA 3PUFA 3KIOA 1HQEA 3CM5A 2BANA 1O1WA 2IOCA 2BGGA 3HPOA 4DTUA 4FJHA 4MQ3A 3TABA 3H08A 4JRQA 2HHSA 1YT3A 2QKKA 1GOAA 1IO2A 1BGXT 3LPUA 1D5AA 4B8AB 1A5XA 2IS3A 1RT3A 4H4MA 3LWLA 3IAYA 4FYDA 1HYSA 5KRSA 1ZBFA 4KO0A 5HP1A 1SUQA 1LW2A 5EU7A 1TKZA 4CHPA 3RMCA 1RT5A 3D0PA 3AVNA 2VG6A 3CFPA 3OYDA 1HMVA 1JL2A 3AA2A 4EP4A 3AO3A 3NF8A 2G8HA 1T7PA 4KPYA 1BL3A 3VQPA 4R5PA 2X6NA 1QQCA 2VG7A 3AVLA 1C6VA 4TSXA 3HP6A 2PYJA 3RR8A 2IC3A 4KHWA 4M3YA 4FM2A 2WOMA 3AO1A 1NKBA 4B3OA 3CFOA 4PY5A 1U48A 1NK7A 1XHXA 2P5GA 2WONA 1ASWA 2P51A 4G1QA 2FBYA 4RW9A 4HHTA 3T3FA 3RTVA 3V4IA 3TAMA 1C1BA 1VSKA 1KFDA 2B5JA 1UOCA 3HPGA 4KKOA 4CGFA 3M8RA 4CK3A 4E7HA 1X9SA 1L5UA 4Z4IA 4H4OA 3MAQA 4CIEA 3AA4A 5KTQA 4OJRA 4HCCA 4B9NA 3NAEA 2DFHA 4ID1A 2OZSA 1N5YA 4RW6A 4JS4A 2QXFA 2YKMA 3VQ6A 2Z1HA 1FKOA 2JGUA 4IKFA 2KFNA 1BQMA 3SQ2A 3HVRA 3F9KA 3V1OA 4BE0A 2HHWA 1REVA 2P5OA 3ISNC 4EP5A 2XRIA 4I9LA 3QLHA 1RTDA 3CM6A 4ZTFA 4M41A 4BE1A 5KI6A 4KI6A 5D3GA 3L2QA 4DQRA 1RT7A 4Z4CA 4CK1A 4CGGA 4DLGA 1LWFA 3OYLA 4J2EA 4PQUA 4B9TA 3KLIA 4YNQA 2E6LA 4MFBA 3PV8A 1GOBA 2DFEA 5SWMA 4GW6A 2W42A 3AO4A 4B9SA 4FJMA 5C42A 1HYZA 5DK5A 3HM9A 1ZBHA 4FJIA 3HP9A 4FK4A 4E0DA 3CQ8A 3O3GA 3JSMA 1BISA 3HK2A 4DQQA 2PZSA 5FRNA 4HCBA 2OPSA 4PA1A 1KLMA 1T8EA 3BGRA 1IH7A 2P1JA 3OYEA 4DFKA 1JXBA 3KTQA 4DSKA 4KB1A 4W5QA 3M8SA 3HJFA 1D9DA 5CY4A 1VSJA 1QSYA 4OGEA 1VSIA 3ASMA 4WE1A 4CJSA 4CCHA 3NHGA 4BDYA 2VG5A 3G10A 4BWMA 4N5SA 2OPRA 4DTPA 3MXMA 4M3ZA 3KLGA 4IG0A 1RBVA 1TAUA 5HLFA 4E1NA 1WSHA 4N56A 1TAQA 4CFBA 1VSHA 4C8OA 4K8XA 1S1TA 4OKKA 2XO7A 4OKEA 1NK5A 3QETA 4N76A 2ETJA 4DFMA 1JLAA 3HXMA 1JLGA 1JLEA 5KGXA 3LP0A 1I39A 3NE6A 2E4LA 3ZSQA 2XY5A 1Q9XA 4HUGA 1CLQA 1A5WA 1U45A 4CHQA 4IFYA 1XI1A 3A2FA 4DTMA 4CF0A 4CEDA 2NUBA 1RT1A 4RW8A 3U3GA 1QSLA 3V9ZA 4KHNA 2KTQA 3OYCA 3LAMA 2F8TA 1VK0A 4FLUA 3NCIA 1I3AA 1KCFA 3FFIA 5CYQA 4CJ3A 3UIQA 4CECA 4C8LA 2VWJA 1WSGA 2Z1JA 1SL0A 3AVIA 3HSTB 4DFJA 3OYAA 1SL1A 3LDSA 4L8RB 4CJRA 4FLYA 1MU2A 3OY9A 4DU1A 3RMDA 3U3YA 3OYFA 3MXIA 2FBVA 4CJ4A 2BDPA 3DRSA 2OA8A 3LAKA 1QS4A 3B6OA 1S1VA 2ZE2A 3NBPA 5JS2A 4E3SA 2KZZA 4CEQA 2A1RA 3DLBA 3AVMA 5CYMA 3ZSOA 1UWBA 4DTRA 5J2QA 3L8BA 4RW7A 4B08A 4CGHA 3AVAA 3KK3A 4J2BA 5T7BA 2HW3A 1RDAA 4DSEA 3PO5A 3SV4A 4CHOA 2YV0X 3TAQA 1NOYA 3DRRA 2XY8A 4OKJA 3OYBA 3V9UA 4FM1A 2OPPA 4N41A 4CEFA 3IG1A 1S1XA 2D0AA 3U6FA 4CJWA 4W5RA 1VSDA 3OYJA 4FM0A 3SUOA 4CHYA 4F2RA 4DFPA 3ZT3A 1RCHA 5DMRA 1ITGA 1U4BA 1S6PA 3DLRA 4CJLA 4AHSA 3QEWA 3LP1A 1T05A 4FW1A 1EP4A 4C8NA 3VQCA 3V9XA 3NF6A 3V6DA 4FJ5A 5FROA 3EY1A 4AILC 2OZMA 1TK8A 4CEZA 3K5MA 1KRPA 4BDZA 3QINA 1QE1A 4HUEA 2G8KA 4RW4A 2A1SA 3L2VA 4O55A 3K2PA 1EXQA 1TK5A 3LP2A 3KLFA 1IKXA 4FLTA 1TK0A 3DOKA 4OVLA 4F2SA 3L3UA 4FJXA 4HUFA 1RNHA 1NK9A 3PO4A 4M42A 2HHQA 3OS2A 4Z4EA 4AHRA 3I0RA 3HL8A 2HNZA 3ALYA 4UQGA 4OLAA 5CZ1A 2HHTA 1NJWA 3OYGA 4M45A 2KZMA 1NJXA 3SUPA 1EKEA 4QAGA 4CE9A 3V9SA 3QNNA 4F8RA 2DY4A 2FBTA 4O5BA 1VSMA 4FVMA 4DF4A 4PUOA 3QEIA 4KTQA 2X74A 3OS0A 4IBNA 1NOZA 3HT3A 1KLNA 3DM2A 4LD0A 1U47A 1KFSA 3DLHA 4M3UA 1TL1A 1L3VA 2DTUA 4ELTA 4E7JA 3NF9A 4Y1CA 1KSPA 2GUIA 2QKBA 1KTQA 1T03A 1IKVA 2XY7A 1ZBLA 5J2PA 3VQAA 4CEBA 3KD5E 1D9FA 3QERA 1Z26A 2HNYA 4AHUA 3PX0A 4KFBA 4QCLA 3AVHA 1FK9A 3K5OA 4JRPA 2AJQA 2KW4A 3SV3A 2RPIA 4DF8A 2YNHA 1F21A 5FDLA 1K6YA 3VQ4A 4FJNA 4DTOA 4ZHRA 1X9WA 4DSJA 2EX3A 1TKXA 2D0CA 3AA3A 4B9MA 5HROA 4CGJA 4CGIA 2Q3SA 1YTUA 4IG3A 4CJPA 2G8IA 1VSEA 4AHTA 3O3HA 1G15A 1HNIA 4DQSA 3L2UA 1VSLA 3QEVA 4B8CA 3AVGA 4FJLA 4KHQA 1NK6A 3EZ5A 1NJYA 3TI0A 4CJ5A 3AVJA 5KGWA 3MXJA 4BDPA 1QTMA 5HBMA 3QIOA
chains in the Genus database with same CATH superfamily
3EL2A 5JS1A 2E1ZA 3TWHA 4FCYA 1KD1O 1NJYA 2Z1IA 2YHBA 2FC0A 1RT2A 1RDDA 1HJOA 4B9VA 4CJKA 4AM7A 2OPQA 5I42A 1TGOA 1YVUA 4ILJA 3DLEA 3LDNA 2Y1IA 3G71N 4KAZA 3MEGA 2F4VK 4AHCA 1IBKK 4FJKA 1KVCA 2DPNA 3SUQA 1OVQA 2F96A 5H1SQ 1GLDG 1ZBSA 1VRUA 2V7ZA 3C7NA 2E5LK 4CEOA 1YVNA 3ID6A 1HKBA 4FZYA 1VQ9N 5AQVA 2RF2A 4KREA 3C6UA 1L3TA 3DI6A 4F4KA 3HSCA 3UE5A 1CXQA 4LFBK 3U9DA 2A6AA 4BRMA 3V1RA 2PBDA 2P9PA 1VQLN 4LF4K 4NCBA 1XMQK 1M1KO 2NRVA 5FRMA 3NH2A 3RRGA 3PX6A 2GV9A 4CHZA 2P9PB 2GWJA 2B6AA 3UKUA 1LW0A 4JNEA 3ZETA 4E7LA 3AV9A 2ZM6K 4FJ8A 2ZJRL 3CXCM 1WSJA 1X9MA 1U04A 2UXBK 3UKUB 3A8YA 1GLJO 4YOXA 3O3FA 1YAGA 1MDUB 4BR2A 3K57A 3GBTA 3MECA 2G8UA 2DFFA 1B9DA 4KV8A 4X62K 1WAJA 4KH5A 2R7YA 4F8RA 4IZ9A 3E01A 3KK1A 4I2QA 4KH4A 3OS1A 3CD6N 4K42A 4BQLA 1K73O 4NO7A 5I3UA 2OANA 4M3RA 3AY9A 1LOTB 4JKCA 3CJCA 4LH5A 1RBUA 2W6LA 1Y97A 4H0PA 3SUNA 3O9QA 2CGLA 1T6CA 3K5LA 5AJ3K 1JL1A 2HBJA 1HNVA 1Q86O 2VQEK 3RSEA 3PSFA 3LM2A 3C94A 4Q5VA 1OH5A 1O13A 4LY7A 3LANA 3RSEB 3NGYA 3R1XA 4FJJA 4AHVA 3VEVA 3THYA 4J2AA 3LDLA 1FXXA 3K59A 3M8QA 4EAHD 3T69A 3VQDA 4EHTA 1C1AA 3IRXA 4CJQA 3ZSVA 1WAFA 5J2NA 1VQMN 4GVEA 4H03B 4DSFA 4CF2A 1RBTA 4B1UB 4FWRA 2E88A 4B9UA 3O5BA 3P1GA 3P5JA 4QS7A 1N36K 1GLFO 3TR8A 1QSSA 3CQXA 2KKZA 1ATRA 2B4JA 3O8MA 3SMPA 4CEEA 3SI6A 3BZCA 5JLHA 2E20A 3MEDA 4CJVA 2QI2A 1SKSA 1GLEG 2H3GX 3VQEA 3DYAA 4ISGA 1WBDA 4ILGB 2ZD1A 2FSJA 3EKSA 3CJ1A 4AQYK 3C65A 2GTDA 4KB0A 4O44A 4JKAA 5LY3A 1HLUA 4CJUA 3QESA 2O4IA 5EX5A 1LV5A 4OPKA 1RBRA 4FZXC 2P9UA 3O4QA 3DLKA 4Z4HA 2D0OA 3S3OA 4OLAA 2CH6A 2WTUA 1NK4A 3WQUA 1C0UA 4CESA 3QFUA 4DG1A 3NF7A 2P9UB 3WNEA 3KLHA 3OYKA 1HJRA 3R6MA 1XMOK 3SQ4A 4GKJK 1BOTO 1BUPA 2ASMA 2G8VA 1NGGA 4DQPA 1JLQA 4C8KA 3NFAA 3PUFA 3CM5A 1K8KA 3HPOA 1NMDA 3EZWA 1IO2A 3THWA 1V4SA 4FSVA 1ZC6A 4FYDA 4IEIA 1K8KB 4BR4A 4JI1K 4K25A 1LW2A 4CHPA 3CCLN 1I94K 3RMCA 3D0PA 3THWB 1EO1A 3T1YK 1HMVA 4BRAA 3AA2A 3O1BA 1HNXK 4EP4A 4Y0WA 3AGKA 1Z6RA 1XNRK 4CBUA 4TSXA 4IWVA 3U9ZA 4FPAA 1NK7A 2P5GA 4HHTA 2FBYA 4GV3A 3TAMA 3M8RA 1L5UA 4KKOA 1NGHA 4Z4IA 4H4OA 3MAQA 4CIEA 3PIOL 1Z05A 4HCCA 3NAEA 2QXFA 3VQ6A 3DAWA 4QS8A 3C6AA 3P31A 2HHWA 2FSKA 3ISNC 3VERA 1RTDA 3P4IA 4BE1A 4KI6A 3L2QA 1RT7A 2FLOA 4CGGA 4PQUA 4BRKA 2JWLA 3SAFA 3PV8A 1W2BM 1ILYA 5SWMA 2W42A 3AO4A 1KQSM 3HM9A 1E4GT 3AARA 5C0YA 3JSMA 1BISA 4HCBA 3BGRA 4OO1J 2QWPA 2OTLN 4W5QA 5C15A 2AP1A 5AQZA 5CY4A 4CBXA 3KWGA 4CJSA 1YJWN 4LF9K 3NHGA 4BDYA 2VG5A 4BWMA 3VGMA 3MXMA 5LMNK 1N32K 4JI6K 5C2DA 1WSHA 4CFBA 4C8OA 3ENHA 3OTOK 3QETA 4DR6K 1JLEA 5KGXA 1I39A 3MN7A 1YHQN 4CZFA 1U45A 2F7TA 4CHQA 4M7XA 1JCFA 1XI1A 4CBWA 1RT1A 3U3GA 4KHNA 2OTJN 1SS6A 3OHRA 1LCUA 5CYQA 1NG9A 4CECA 1SL1A 1DGKN 3LDSA 4CJRA 3BEXA 4FLYA 4BC4A 3MXIA 2FBVA 4G9ZA 3DRSA 3K9JA 1S1VA 5CYMA 4YOUA 2KLAA 4J2BA 4DSEA 3SV4A 4JK9A 4CHOA 4H0TB 5KPRA 3TAQA 1NOYA 4OKJA 2XY8A 3C0BA 4CD1A 4W5RA 5GAEP 3LDPA 3SUOA 4YHHK 5HOOA 4DFPA 1U4BA 5DMRA 1ITGA 1S6PA 4BG9A 4FW1A 3VEYA 2BTFA 4C1NK 3G6EN 4FJ5A 2OZMA 1HKCA 4BDZA 1QE1A 4PL7A 3QFPA 3EN9A 4PHTX 1TK5A 1IKXA 2YCHA 4OVLA 4F2SA 4FJXA 2UXCK 1RNHA 4OPAA 3CCMN 1NK9A 4M42A 4IJNA 3VPZA 4IJAA 3ALYA 4UQGA 3J8AA 2Q0UA 3WUHA 3GG4A 1RDUA 2FBTA 4O5BA 3QEIA 4KTQA 4IBNA 1NOZA 3DM2A 2I7NA 4H5WA 4MDAA 4E7JA 4YOTA 3A5LC 2XY7A 1ZBLA 1NGJA 5HL7L 1T6DA 3KD5E 1D9FA 3QERA 1Z26A 2HNYA 4AHUA 1ESVA 3DXKA 4L3QA 4JI0K 2RPIA 4DF8A 2NRTA 3G4SN 2D0CA 3DXKB 3FGUA 2QTDA 2QW9A 1VSEA 1G15A 3NVMA 2HBLA 3QEVA 3E9PA 3ZX2A 2O8CA 3VESA 3RVCA 4BRHA 3EZ5A 3TI0A 3CPWM 2NRRA 1QTMA 3NGZA 4EZ6A 2W40A 2CH5A 2UU9K 2D4WA 3Q7BA 5F0XA 3OA9A 1X1PA 2O8CB 1KVBA 3VA3A 3G0ZA 1YUWA 4DS5A 5M1KA 2QWOA 1U6ZA 3AA5X 4O0JA 4CF1A 3THVA 2ITMA 2KFZA 3HOTA 3SCXA 4Z4GA 4JI7K 4JLHA 4H0VB 1BA1A 3QB0A 5A2QO 1TVRA 3H45C 3O1WA 3QEPA 3VA0A 2GWKA 4ELUA 4A5AA 4LH4A 3JYTA 1DTQA 2HMPA 3ZCMA 2I5JA 3QNOA 2YNIA 4YOVA 3WEEA 3OYHA 3N4QA 4A5BA 4YORA 3AAQA 4V19S 2HHUA 2VYPA 5FLXO 1NKEA 5GAGP 1TV6A 3T1AA 2UYTA 5BREA 3WEEB 2NRWA 4BRCA 1JLFA 4IFEA 3C6HA 4Z0UA 4KBOA 5DM7L 3QDKA 1ZBIA 4M3TA 1HKGA 1BIZA 2ATQA 3SPYA 3SQ1A 2GELA 3V81A 3RR7A 1L3UA 2HVHA 3ZSXA 3CC7N 3CMEN 3NDKA 3LPTA 3ZT1A 3FZFA 3PY8A 1EETA 1RT4A 2A42A 2GUPA 3VEXA 3V9WA 1S1UA 4PKHA 3J7AP 4CFAA 4KI4A 3AVBA 2BH1A 3OYNA 4KHYA 1QZ6A 5CE3A 3MN5A 3O6WA 1ASVA 4Z94A 2ZGZA 4I7FA 1LAWA 1D4XA 5JVHL 3SAHA 4DTSA 1BI4A 4B1VA 1N6QA 4PL8A 2G8FA 4B9LA 5MLCQ 5KQDA 4PWDA 1BI4B 3NH0A 4NYNA 1VRTA 1IKYA 5AQIA 4CEAA 3RMAA 4Q0BA 1JKHA 4BRGA 1M90O 3Q7CA 2WC9A 2PY5A 3ENOA 2HHXA 3O4WA 4BRIA 1B92A 1T44A 4WF9L 1NK0A 3PLAA 4A2BA 3KKSA 1NWKA 3L3VA 4DQIA 1ZYQA 1U49A 4DLEA 3VTIA 3ZT0A 3WXIA 5C24A 5J1EA 1X3NA 3H1VX 4W5OA 3VQ7A 3T7ZA 1WLJA 1LAVA 4CJEA 3I33A 4KTZA 4CFDA 1ZXOA 3LM9A 5GIOA 4Y1DA 4LF5K 1YI2N 3O9SA 3VN5A 4DU3A 3QO9A 4DTNA 2FBXA 3OVNA 4CERA 1NGAA 4JKBA 1NJZA 2IDOA 3CYMA 1FJGK 1HYVA 3CJAA 4CF8A 3TANA 1BHLA 1JCEA 3FZMA 4FJGA 1RDCA 1S9GA 1CZBA 3CCQN 4CF9A 1RDBA 4W5NA 3QIPA 1XQSC 1MWMA 4YDUC 3SPZA 3KK7A 5EOYA 5CHIA 4H8KA 3C7NB 4FJ7A 1KVAA 2BUPA 4CZKA 1EWQA 3S9HA 3SK3A 5JVGL 1BO5O 4R79A 4E89A 4F3TA 2J4RA 4CJ7A 1LWCA 2YJEA 4B3TK 4JI3K 1UA1A 1TL3A 1S5JA 4GVMA 3HVTA 4M3XA 1WNSA 4CW7B 1Q7YO 3KWIA 2HB5A 4FK0A 4X65K 2P9IA 1TKDA 2ASOA 3FZKA 3I0SA 4CGDA 2E2OA 4EHUA 1WBBA 3MWTA 2YHAA 1ASUA 4ISFA 4WQ4C 4B1ZA 4C8MA 3D45A 4N47A 1ATSA 2P9IB 4DV5K 3HRGA 3L0QA 4MDBA 4DR1K 3ZETB 3CC2N 2HHSA 5ADXA 1D5AA 1A5XA 5ADXH 3WXKA 3LWLA 4H4MA 4FWMA 5M1QA 5KRSA 2YHYA 4FPBA 3CFPA 3VQPA 4IO9L 2HSTA 3ID8A 1KXPA 3W3DA 2O8BA 3RR8A 4KHWA 4M3YA 3SAGA 3L6QA 3CFOA 1U48A 1XHXA 1ASWA 2P51A 4G1QA 4JV5K 3RTVA 3VF4A 3HPGA 2O8BB 4CK3A 3CHWA 3IFRA 5KTQA 2UUAK 2E8AA 2OZSA 2P9NA 2YKMA 1Q18A 1FKOA 2Z1HA 4IKFA 3WXMB 3HVRA 3V1OA 4BE0A 1REVA 3BY5A 4WYBA 2P9NB 3CM6A 4M41A 5D3GA 4DQRA 1XUPO 1QQOA 3OYLA 4J2EA 3KLIA 4YNQA 2E6LA 4GW6A 3O9RA 3THYB 1K9MO 1VQ8N 4FJMA 5C42A 4JYAK 1HYZA 4FJIA 3HP9A 3CQ8A 3HK2A 4DQQA 1IH7A 3KTQA 1JXBA 4KB1A 1VSJA 1U2VA 1N33K 2OPRA 4DTPA 4M3ZA 3KLGA 1TAUA 4E1NA 4BR7A 4N56A 4BY9C 2NZTA 4OKKA 1U2VB 4DFMA 1JLGA 3LP0A 3DLLL 2E4LA 4H0XB 4BC5A 2XY5A 1CLQA 2QXLA 1A5WA 4IFYA 2YJFA 4DTMA 3EE9A 3CC4N 4PKGA 2KTQA 4RCHA 3OYCA 1HR0K 1I3AA 1KCFA 4DV7K 1QVFM 3UIQA 4QS9A 3ULEA 5FPEA 5JMVA 1SL0A 4DFJA 1BDGA 3LDOA 3MX2A 1NBWA 4DV3K 3ULEB 4CJ4A 2KZZA 3LAKA 1QS4A 3B6OA 5JS2A 2ZE2A 3CJ7A 1NGFA 2RHKA 3DLBA 3AVMA 3J80O 4NLBA 3V9UA 5TKYA 4FM1A 2OPPA 4CEFA 3L4IA 3IG1A 2D0AA 3U6FA 4CJWA 4CHYA 4F2RA 1S22A 3DLRA 3LP1A 1BA0A 1EP4A 3A5MC 1TYQA 5GINA 2QWLA 1TK8A 4X66K 5BPLA 1XNQK 2IVNA 2V51B 2G8KA 3F9MA 3L2VA 4EIAA 3WXJA 1TYQB 3LP2A 4GY2B 5M1OA 4FLTA 1S3XA 4C1NI 3DOKA 4HUFA 1JJ2M 2HHQA 4M63C 3BUZB 3M3ZA 2HHTA 3OYGA 5AQXA 5KQ8A 4XH1A 4M45A 1EKEA 4QAGA 4CE9A 1HPMA 3QNNA 2DY4A 4BR5A 4FVMA 1KFSA 5AZIA 4LD0A 3MWPA 1U47A 4M3UA 3DLHA 1TL1A 1OKJA 1L3VA 4YOYA 5EVZA 4BR9A 1SZ2A 1V4TA 3A0IX 4BVPA 2W41A 1IG8A 2QKBA 1IKVA 1P90A 4A62A 5AZIB 3K0SA 5J2PA 1IBLK 4LC9B 4GV9A 3K5OA 4JRPA 2AJQA 4JI8K 3DWLA 2YNHA 1F21A 3CIPA 5FDLA 1K6YA 3VQ4A 4CZGA 4FWPA 2EX3A 4CGJA 2QEXN 2Q3SA 1YTUA 4CJPA 5AQRA 3D2FA 1HNIA 3L2UA 4DR5K 2NRXA 4FWNA 4C23A 1NK6A 5KGWA 3MXJA 1T3VA 4BDPA 3QIOA 1CXUA 3C95A 4OKEA 3RRHA 3D2FB 4FZZA 4DMNA 4E7KA 1EWRA 3R8EA 4DQ8A 3HO1A 1QVGM 4CFCA 2A3ZA 4KH6A 1CZ9A 3THXA 1NJIO 1IG9A 4A2AA 4M3WA 3SQ0A 3MDQA 3WT0A 5AQYA 4WFBL 2ZWHA 4FLVA 3THXB 5C25A 1RTHA 3JAMO 2VWKA 4WQ5A 3EYZA 1HNZK 4KHSA 3AVKA 3UKRA 4A61A 4X64K 3GE1A 3SYZA 4CZMA 1L3SA 5BN9A 4RTFD 3M6GA 3UKRB 4XEIA 4H0YB 3ZSZA 3QBXA 1YJNN 4OGCA 4LSNA 2PYLA 1NKCA 2HMIA 5CZ2A 5CR4A 3ITHA 4K8ZA 2E6MA 4GNIA 2QWNA 4W5TA 3SNNA 3MCAB 2O4GA 1DEJA 5LJVA 2E2QA 4NCAA 1WSEA 3I8DA 4DTXA 2Q0RA 2EHGA 5FPNA 3H46O 2D0BA 1UA0A 3O80A 3VQ5A 4GMJB 5EXWA 1ZBUA 2FXUA 1C0TA 3AVFA 4KHUA 3HPHA 4B1YB 4O0IA 3U8XA 1KAYA 2ZQBA 4IDHA 4E7IA 2HHVA 4DCHA 1C1CA 2RN2A 5AQTA 1J9AA 3S3NA 3DLGA 3LZJA 2QA4N 4DKWA 3DOLA 3AVCA 1HPZA 4CJFA 3HOSA 1Z25A 2XHBA 2UUCK 2X6SA 4XH4A 1BG3A 5F1XA 2A41A 5AQNA 1HNWK 3AO2A 5HRNA 3T19A 4DSIA 1RFQA 5AQUA 5J2MA 3OBWA 4GV6A 1WN7A 3L2RA 1Q9YA 5AQJA 3KD1E 3CCUN 4JAXA 1JXEA 3K58A 4YOWA 3EO3A 4NYFA 1YTAA 5AR0A 3H3NO 3VTHA 2WBNA 4O4GA 4I2PA 5GIPA 4I9QA 2WUSA 4RWTA 5FPDA 1RT6A 1RTJA 3CG7A 4FJ9A 2Y1JA 4DV4K 4ICLA 3TARA 3A5OC 2KQ2A 4FWQA 4IFVA 3ZSWA 3AGRA 1BCMA 3PSIA 3GDQA 4CZIA 4CHNA 2YKNA 4FOIA 4IEEA 1DTTA 4DV6K 4F3OA 1GLLO 2O8EA 3FZLA 3KZBA 1JCGA 1IKWA 2PFUA 5GAHP 1E3MA 3KJVA 3K9KA 2D5RA 3UB5A 1EX4A 4DUYK 1S72N 3ULDA 2HOEA 2RE2A 3VQBA 4KRFA 1RDWX 1J5EK 3ATVA 3M1FA 4FWOA 4ELVA 1VHXA 3QBWA 3O9UA 4J2DA 1JLBA 2GBZA 5LJWA 2XY6A 4MLEA 4FWLA 2OYQA 2YNGA 1XHZA 2FSNA 5M1NA 1SL2A 5AQFA 1VQ6N 4FOEA 4ISEA 1BQNA 1J53A 4FW2A 5HRRA 1UAXA 2F8SA 4DTJA 2HNDA 3C6TA 1RILA 3HYFA 5KRTA 1VSFA 2JLEA 1H1VA 3TAFA 5E26A 5K14A 3PIPL 2P9LA 3IS9A 3VQQA 3K5NA 3ZT2A 1O1WA 2BGGA 3BZKA 2P9LB 4FJHA 1NGCA 4MQ3A 3H08A 1XC3A 3A5NC 5AQWA 1VQPN 1YT3A 2QKKA 1GOAA 5I9EB 4B8AB 1HYSA 1NGDA 4LFCK 4KO0A 1WOQA 5EU7A 1RT5A 1OVYA 3CPEA 3AAPA 3ZYYX 3P38A 3TPQA 3LDQA 3NF8A 1T7PA 5AZJA 1E4FT 2UUBK 4R5PA 4FWSA 4O8KA 2X6NA 2VG7A 2HHHK 3HP6A 2IC3A 3HI0A 2QWQA 2NRHA 2NNWA 4RW9A 3IUCA 1C1BA 1VSKA 2B5JA 1UOCA 4OJRA 3FZHA 4B9NA 1GLBG 1N5YA 2Q31A 3ZEUA 3FR0A 4JD2A 2JGUA 5LMUK 1BQMA 3QICA 5C10A 3ZEUB 4JD2B 3E9LA 4OX9K 3MK6A 4Z4CA 4JHDA 5JICA 4B9TA 4MFBA 2DFEA 2AA4A 3O9TA 4B9SA 4DR2K 5DK5A 3H6EA 2YI1A 1YXQA 4JHDB 2V52B 3O3GA 4PA1A 1KLMA 2PAVA 2P1JA 3OYEA 4DSKA 4A57A 1D9DA 1VSIA 4WE1A 4JKDA 4N5SA 1QQNA 5HLFA 3J7ZO 1TAQA 1VSHA 4K8XA 1S1TA 2XO7A 1NK5A 5DM6L 3ZSQA 5IT9O 4HUGA 4CF0A 4CEDA 4IOAL 4B3SK 1KAXA 1TUYA 5AQQA 3V9ZA 3LL3A 2F8TA 3NCIA 2GEMA 4BGBA 2VWJA 2Z1JA 3AVIA 4BQZA 4L8RB 4NB4A 1MU2A 3GL1A 3IKMA 4CI6A 3OYFA 4Z4FA 2OA8A 3NBPA 4FL9A 4AF1A 4CEQA 2A1RA 4DV1K 3ZSOA 1UWBA 4DTRA 5J2QA 1OH7A 4H5NA 4RW7A 4B08A 3KVGA 3AVAA 4CGHA 3KK3A 5BPMA 5T7BA 1NLVA 2HW3A 4F9OA 1VQ4N 3DRRA 4N41A 1SQKA 4FM0A 1RCHA 3VMFB 3I8BA 3E66A 3ZX3A 1T05A 2Q97A 4C8NA 3VQCA 5ELZA 3NF6A 5FROA 3EY1A 4IO8A 1KRPA 3QINA 3HTVA 2F9TA 4RW4A 2A1SA 4O55A 3K2PA 1EXQA 2QM1A 1TK0A 4H5RA 3E9OA 3L3UA 3PO4A 4Z4EA 4AHRA 3I0RA 3HL8A 4NXNK 2HNZA 4GKKK 1QHAA 5CZ1A 2VWBA 1NJWA 2KZMA 1NJXA 3SUPA 3H1QA 4DF4A 4BRLA 4CVNE 2X74A 3OS0A 2YHXA 3HT3A 2W6KA 1KLNA 2DTUA 4JEPA 1X9JA 3F2KA 4ELTA 4Y1CA 1KSPA 1Q81O 3VQAA 4CEBA 2EWSA 4QCLA 3AVHA 1FK9A 1N8RO 2KW4A 3SV3A 1MA9B 3TTFA 3W0LA 3WXLA 4LFAK 5AQGA 1TKXA 4B9MA 1P8ZA 1K8AO 4BC2A 1MWKA 1CZAN 4IG3A 2G8IA 5BN8A 3VENA 3O3HA 3CQYA 4DQSA 4JI4K 1VSLA 5LL6Z 4DR7K 1W97L 3S41A 4KHQA 3JXUA 3AVJA 4AM6A 5HBMA 4MO4A 2VQFK 3CJBA 1QZ5A 2NRZA 4B1WB 3CETA 2VGNA 3AO5A 4BE2A 4FVUA 1WUAA 3OW2M 3DJCA 3E1YA 2KFNA 1XWLA 3O4NA 4RG8A 3ZLJA 3CCVN 3MCPA 4DR3K 4JN4A 2ZGYA 1WSFA 4DR4K 2QK9A 4YDUA 3ZSYA 1TKTA 5C2FA 4QOZB 2CGJA 1BIUA 5SZTA 2Q2RA 3L2WA 3B6PA 1R0AA 4HWIA 3TAEA 3TU5A 1IBMK 4I6MA 4K41A 3EEQA 1S1WA 4WQ5C 2Q36A 3P83D 5BPNA 2VGMA 4FXDA 4EZ9A 1B9FA 1SV5A 4BWJA 4FO0A 3SZ2A 1GLAG 1R59O 4I6MB 3OYIA 1BCOA 1VQ5N 3VQ9A 4CZHA 3SJJA 1J5OA 3ENBA 3LALA 4WQ4A 3OYMA 3WNHA 4FLWA 4BRPA 2FF3B 3NGIA 3RWUA 3DRPA 1J54A 1DT9A 4NCGA 4E19A 1VQ7N 4ID5A 4H0OA 1QQMA 4MLHA 4AH9A 5JLFA 2D0PA 3SBTA 2UXDK 4JK8A 3WNFA 2ZF5O 3EKUA 5BRDA 4YY3K 4DSLA 3M8PA 3ZT4A 4IXCA 4LF8K 3VF2A 3SLCA 3VGKA 3LWMA 3MEEA 1LWEA 4CZJA 4NXMK 4CIGA 3U4LA 3CFRA 1W0HA 4ZTJA 4OPJA 4OLBA 4KTWA 4B3MK 3F73A 2YHWA 1C0MA 3KK2A 5FPMA 5E41A 1WSIA 5AFUA 1GOCA 3FLCO 5AFUH 1YITN 4JI5K 1OH8A 2X78A 3VEZA 1JLCA 5HRSA 3MN9A 3NH1A 2G8WA 4DS4A 1W9HA 5AQSA 3CI5A 2Z1GA 4U7BA 3V1QA 2IAJA 4DUZK 4YFUA 1RTIA 2Q1NA 4IOXA 1ATNA 4DV0K 4FLXA 1OH6A 3OJUA 4HTUA 4DU4A 3WNGA 2LSNA 5HRPA 3BP8A 1XC9A 3VQ8A 1J6ZA 4CJTA 3WQTA 1Q8IA 5BRFA 1QHTA 2CGKA 4O5FA 3VOVA 5IWAK 1S6QA 1IJJA 2HBKA 4HTLA 2NLXA 3HBTA 3CMAN 2A5XA 4K43A 2HF3A 4BRFA 4WCEL 1GLCG 1YJ9N 1NK8A 1NNEA 1NGEA 3J81O 1FW6A 3FFKB 3NVKA 3OBYA 4JK7A 2YNFA 3S3MA 1SKWA 4BACA 4FK2A 3IMXA 3MMVA 4FLZA 3VEOA 3DMJA 3KLEA 1DLOA 3D7EO 3KKRA 4JS5A 2ZJPL 3PX4A 3CCJN 2HVIA 4M7YA 1HQUA 3D6RA 4BC3A 4LSLA 3QEXA 3LZIA 4HVJA 3P39A 4BG8A 1RBSA 3TAGA 4CIFA 3ZX0A 3CJ9A 2IGIA 3ZSRA 5KPTA 2E2NA 1HX1A 2V7YA 3TTCA 4B3RK 3D2EA 5AQMA 5AQOA 4DWIA 4XIUA 2OCEA 2BE2A 4IDKA 4IOCL 2P9KA 1FKPA 4ILHA 5BR9A 4J8FA 3D2EB 4E1MA 2RKIA 4WFAL 4JKFA 4WFNL 1A5VA 2P9KB 3LP3A 4JKEA 1VAZA 2YX6A 5F2RA 5GADP 3I55N 4BVOA 3FE1A 2O8DA 3DXMA 4CZLA 3BDPA 5AQKA 3MX5A 3TAPA 3RMBA 3J7YP 3KHYA 1NMNA 2QWRA 2ITGA 3OJSA 1S9EA 3DXMB 3EE8A 1SKRA 2O8DB 2E2PA 5E84A 1D8YA 4LF6K 4CK2A 1HRHA 2VCPA 1HQEA 2F9WA 3BF1A 3KIOA 2BANA 2WFBA 2IOCA 4DTUA 1BWFO 3TABA 4JRQA 2HF4A 1YIJN 1SAZA 5EY4A 3M5RA 3LPUA 1BGXT 2IS3A 3CCRN 1RT3A 4OPHA 5KPZA 3IAYA 1ZBFA 5HP1A 1SUQA 1TKZA 5BR8K 4JKHA 2ASPA 3AVNA 2VG6A 3OYDA 1JL2A 3AO3A 2P9SA 4B9QA 2G8HA 4KPYA 1G99A 1BL3A 1QQCA 3AVLA 1C6VA 2PYJA 3IDHA 4DB3A 3VGLA 1VQNN 4FM2A 2WOMA 1NGBA 3AO1A 1NKBA 4B3OA 4PY5A 2P9SB 5M1FA 2WONA 3T3FA 1Q82O 3V4IA 4CGFA 1KFDA 2KHOA 1X9SA 4MO5A 4E7HA 2QWMA 3AA4A 2DFHA 4ID1A 4RW6A 4JS4A 4JKGA 5AQHA 3CERA 5AQPA 3SQ2A 3F9KA 2P5OA 4EP5A 2ZJQL 2XRIA 4I9LA 1NU0A 3QLHA 4ZTFA 5KI6A 4JKGB 3HZ6A 4CK1A 2IVPA 4B1XB 1LWFA 4DLGA 4CD3A 3VETA 1GOBA 3TSUA 3CCEN 1IV0A 5TKWA 1ZBHA 2E1YA 4FK4A 3F5TA 4E0DA 5FRNA 2PZSA 2OPSA 3CCSN 1T8EA 3SJHA 4DFKA 3M8SA 3GOIA 4BRDA 3HJFA 1QSYA 4OGEA 3ASMA 4CCHA 1VQON 3G10A 4CZEA 1NM1A 4IG0A 1RBVA 4PKIA 4XH5A 4N76A 3SBGA 2O8EB 3R3LA 3VF6A 2ETJA 1JLAA 3HXMA 3NE6A 5BRHA 4LF7K 4BGAA 1Q9XA 1C0GA 1WB9A 3A2FA 2A40A 2HBMA 4KHPK 1KC8O 2NUBA 4RW8A 1QSLA 3TSQA 3LAMA 1VK0A 3ATUA 4FLUA 4H5VA 3NMUA 3I56N 3SMSA 3FFIA 4CJ3A 1WSGA 4BROA 3HSTB 3OYAA 3VEWA 2GX9A 3OY9A 4DU1A 3RMDA 3U3YA 2JWKA 4E1JA 1X3MA 1KAZA 2I7PA 2BDPA 4E3SA 3TTDA 4H5TA 4DV2K 5B8HA 1VQKN 3HM8A 3G25A 3L8BA 3MN6A 4A59A 1RDAA 3PO5A 4EFHA 2YV0X 3OYBA 2O8FA 1BU6O 1RGIA 1S1XA 4DHYA 1VSDA 2IIRA 4BRNA 3OYJA 3ZT3A 1W7AA 4CJLA 4AHSA 3QEWA 2O8FB 4NLCA 4BR0A 3V9XA 2D1KA 3V6DA 4AILC 4CEZA 4JI2K 3N4PA 3O08A 2FF6A 1TUUA 3K5MA 4HUEA 3QMLA 1NGIA 3KLFA 3TSPA 5AZJB 3OS2A 1DKGD 3CF5L 4UY8O 4K0KK 3V9SA 1VSMA 4PUOA 5M1PA 1Y64A 5AQLA 3L4QA 3NF9A 3T1HK 1HUXA 2GUIA 1KTQA 1T03A 4U67L 3JS6A 3PX0A 4KFBA 1YF5L 4BREA 4O8UA 4FJNA 4DTOA 4ZHRA 5C12A 1X9WA 4DSJA 3AA3A 4FWKA 5HROA 3R9PA 1EQYA 4CGIA 1C0FA 4BRQA 4AHTA 1N34K 3H3OB 4B8CA 3AVGA 4FJLA 3B8AX 4CJ5A 2IVOA 4C8LA 3BF3A
chains in the Genus database with same CATH topology
1CXUA 3C95A 3NGZA 4EZ6A 3RRHA 4FZZA 4DMNA 4E7KA 3HO1A 5JS1A 4CFCA 1X1PA 1KVBA 3AO5A 3TWHA 1CZ9A 4BE2A 4FCYA 3VA3A 3G0ZA 4DS5A 1IG9A 3AA5X 4O0JA 1XWLA 3O4NA 2Z1IA 2YHBA 4RG8A 2FC0A 4CF1A 1RT2A 1RDDA 3THVA 4M3WA 4B9VA 2KFZA 4CJKA 3SQ0A 2OPQA 5I42A 1TGOA 1YVUA 3SCXA 3DLEA 1WSFA 2Y1IA 4Z4GA 4FLVA 5C25A 4JLHA 4KAZA 3MEGA 1RTHA 3ZSYA 4AHCA 4FJKA 2QK9A 1TKTA 1KVCA 2VWKA 3SUQA 2F96A 4QOZB 1BIUA 1TVRA 5SZTA 1VRUA 3EYZA 4KHSA 3AVKA 3QEPA 3VA0A 3L2WA 4CEOA 4ELUA 4LH4A 3B6PA 1R0AA 3TAEA 3SYZA 3JYTA 1DTQA 1L3SA 3ZCMA 2I5JA 3QNOA 4FZYA 1S1WA 2RF2A 4KREA 3C6UA 1L3TA 3DI6A 2YNIA 3P83D 3OYHA 4F4KA 4EZ9A 4FXDA 1B9FA 1SV5A 1CXQA 3ZSZA 4BWJA 3SZ2A 4OGCA 2HHUA 3OYIA 4LSNA 1BCOA 1NKEA 2PYLA 1NKCA 2HMIA 5CZ2A 3V1RA 3ITHA 4K8ZA 3VQ9A 1TV6A 3SJJA 3T1AA 1J5OA 3LALA 2E6MA 3OYMA 3WNHA 4W5TA 4NCBA 4FLWA 3SNNA 1JLFA 5FRMA 2O4GA 3NH2A 3RRGA 3NGIA 3RWUA 4Z0UA 3DRPA 1J54A 4NCGA 4E19A 3PX6A 4ID5A 4NCAA 1WSEA 2GV9A 4CHZA 4AH9A 1ZBIA 2B6AA 4M3TA 2ATQA 1BIZA 1LW0A 3I8DA 3SPYA 3SQ1A 4DTXA 4E7LA 3V81A 3RR7A 2EHGA 3WNFA 1L3UA 3AV9A 2D0BA 1UA0A 2HVHA 4FJ8A 3VQ5A 3ZSXA 4DSLA 4GMJB 3M8PA 1ZBUA 3NDKA 1WSJA 1C0TA 1U04A 3AVFA 3LPTA 3ZT4A 1X9MA 3ZT1A 4KHUA 3HPHA 3O3FA 3PY8A 3LWMA 4O0IA 3K57A 3MEEA 1EETA 1RT4A 1LWEA 3MECA 4CIGA 2G8UA 2DFFA 1B9DA 2ZQBA 4KV8A 1W0HA 1WAJA 3CFRA 2R7YA 1S1UA 4OPJA 3V9WA 4E7IA 4ZTJA 3E01A 4KTWA 4OLBA 3KK1A 4Z4FA 4CFAA 2HHVA 4I2QA 1C1CA 2RN2A 3F73A 3AVBA 4KI4A 3OS1A 1C0MA 1J9AA 3OYNA 3KK2A 3S3NA 4KHYA 3DLGA 5E41A 1WSIA 3LZJA 1GOCA 5I3UA 1ASVA 2X78A 4M3RA 1JLCA 5HRSA 3DOLA 4I7FA 1LAWA 4LH5A 1RBUA 3AVCA 3NH1A 1HPZA 2G8WA 2F8SA 4CJFA 1Z25A 4DS4A 4DTSA 1BI4A 1W9HA 1N6QA 2Z1GA 1Y97A 2XHBA 3V1QA 2X6SA 2IAJA 3SUNA 2G8FA 4B9LA 4YFUA 1RTIA 3K5LA 3AO2A 1JL1A 5HRNA 4FLXA 3T19A 3OJUA 1HNVA 4DSIA 4PWDA 4HTUA 5J2MA 4DU4A 1BI4B 3WNGA 3NH0A 2LSNA 5HRPA 1WN7A 4NYNA 1VRTA 1IKYA 4CEAA 3L2RA 3RMAA 1XC9A 1Q9YA 4Q0BA 1JKHA 3C94A 3VQ8A 4Q5VA 3KD1E 4CJTA 4LY7A 1Q8IA 1QHTA 3LANA 1JXEA 3K58A 1S6QA 2PY5A 2HHXA 3NGYA 1B92A 1NK0A 4NYFA 1YTAA 4FJJA 3KKSA 4AHVA 3L3VA 4DQIA 4J2AA 4O4GA 1FXXA 4I2PA 3M8QA 3K59A 1ZYQA 1U49A 4I9QA 3VQDA 4DLEA 3ZT0A 1NK8A 1C1AA 3IRXA 4CJQA 1RT6A 5C24A 5J1EA 1RTJA 3ZSVA 1WAFA 3CG7A 5J2NA 4DSFA 4W5OA 3VQ7A 4CF2A 2Y1JA 4FJ9A 1RBTA 2YNFA 4ICLA 1WLJA 3S3MA 3TARA 1LAVA 4CJEA 4BACA 1SKWA 4B9UA 4FK2A 4FLZA 3P1GA 4KTZA 4CFDA 3DMJA 3P5JA 3KLEA 2KQ2A 4IFVA 4Y1DA 1DLOA 3ZSWA 1BCMA 3TR8A 1QSSA 2B4JA 3VN5A 3KKRA 3QO9A 4CEEA 4CHNA 2YKNA 4JS5A 4DU3A 2FBXA 4DTNA 3PX4A 3SI6A 1HQUA 3OVNA 1DTTA 2HVIA 3MEDA 4LSLA 4CERA 3QEXA 4F3OA 3LZIA 4CJVA 4HVJA 1NJZA 2IDOA 3CYMA 1SKSA 1RBSA 1HYVA 4CF8A 3TANA 3VQEA 3TAGA 1IKWA 3DYAA 4CIFA 1BHLA 3KJVA 2IGIA 3ZSRA 2D5RA 2ZD1A 1EX4A 4FJGA 3ULDA 1RDCA 1S9GA 1CZBA 4CF9A 1RDBA 3VQBA 4KRFA 4W5NA 3QIPA 4DWIA 4XIUA 3SPZA 4ELVA 2BE2A 4H8KA 4IDKA 4J2DA 1JLBA 1FKPA 2GBZA 4KB0A 4FJ7A 2XY6A 1KVAA 4O44A 4E1MA 2RKIA 2OYQA 4CJUA 3QESA 2O4IA 3S9HA 2YNGA 4OPKA 1RBRA 1XHZA 1LV5A 4FZXC 4E89A 1A5VA 1SL2A 4F3TA 3LP3A 3O4QA 3DLKA 4Z4HA 1BQNA 1LWCA 3S3OA 1J53A 1TL3A 1S5JA 4FW2A 4GVMA 1UAXA 5HRRA 1UA1A 1NK4A 4DTJA 2HNDA 3C6TA 1C0UA 3HVTA 4M3XA 1RILA 3HYFA 1WNSA 4CESA 5KRTA 1VSFA 2HB5A 2JLEA 3NF7A 4DG1A 3BDPA 4FK0A 3TAFA 3WNEA 5K14A 3KLHA 3I0SA 1TKDA 4CGDA 3OYKA 1HJRA 3RMBA 3TAPA 3SQ4A 2YHAA 1ASUA 2ITGA 3OJSA 1S9EA 3IS9A 4C8MA 3VQQA 3D45A 1SKRA 2G8VA 4DQPA 1JLQA 4C8KA 3K5NA 1D8YA 4N47A 3ZT2A 4CK2A 3NFAA 1HRHA 3PUFA 3KIOA 1HQEA 3CM5A 2BANA 1O1WA 2IOCA 2BGGA 3HPOA 4DTUA 4FJHA 4MQ3A 3TABA 3H08A 4JRQA 2HHSA 1YT3A 2QKKA 1GOAA 1IO2A 1BGXT 3LPUA 1D5AA 4B8AB 1A5XA 2IS3A 1RT3A 4H4MA 3LWLA 3IAYA 4FYDA 1HYSA 5KRSA 1ZBFA 4KO0A 5HP1A 1SUQA 1LW2A 5EU7A 1TKZA 4CHPA 3RMCA 1RT5A 3D0PA 3AVNA 2VG6A 3CFPA 3OYDA 1HMVA 1JL2A 3AA2A 4EP4A 3AO3A 3NF8A 2G8HA 1T7PA 4KPYA 1BL3A 3VQPA 4R5PA 2X6NA 1QQCA 2VG7A 3AVLA 1C6VA 4TSXA 3HP6A 2PYJA 3RR8A 2IC3A 4KHWA 4M3YA 4FM2A 2WOMA 3AO1A 1NKBA 4B3OA 3CFOA 4PY5A 1U48A 1NK7A 1XHXA 2P5GA 2WONA 1ASWA 2P51A 4G1QA 2FBYA 4RW9A 4HHTA 3T3FA 3RTVA 3V4IA 3TAMA 1C1BA 1VSKA 1KFDA 2B5JA 1UOCA 3HPGA 4KKOA 4CGFA 3M8RA 4CK3A 4E7HA 1X9SA 1L5UA 4Z4IA 4H4OA 3MAQA 4CIEA 3AA4A 5KTQA 4OJRA 4HCCA 4B9NA 3NAEA 2DFHA 4ID1A 2OZSA 1N5YA 4RW6A 4JS4A 2QXFA 2YKMA 3VQ6A 2Z1HA 1FKOA 2JGUA 4IKFA 2KFNA 1BQMA 3SQ2A 3HVRA 3F9KA 3V1OA 4BE0A 2HHWA 1REVA 2P5OA 3ISNC 4EP5A 2XRIA 4I9LA 3QLHA 1RTDA 3CM6A 4ZTFA 4M41A 4BE1A 5KI6A 4KI6A 5D3GA 3L2QA 4DQRA 1RT7A 4Z4CA 4CK1A 4CGGA 4DLGA 1LWFA 3OYLA 4J2EA 4PQUA 4B9TA 3KLIA 4YNQA 2E6LA 4MFBA 3PV8A 1GOBA 2DFEA 5SWMA 4GW6A 2W42A 3AO4A 4B9SA 4FJMA 5C42A 1HYZA 5DK5A 3HM9A 1ZBHA 4FJIA 3HP9A 4FK4A 4E0DA 3CQ8A 3O3GA 3JSMA 1BISA 3HK2A 4DQQA 2PZSA 5FRNA 4HCBA 2OPSA 4PA1A 1KLMA 1T8EA 3BGRA 1IH7A 2P1JA 3OYEA 4DFKA 1JXBA 3KTQA 4DSKA 4KB1A 4W5QA 3M8SA 3HJFA 1D9DA 5CY4A 1VSJA 1QSYA 4OGEA 1VSIA 3ASMA 4WE1A 4CJSA 4CCHA 3NHGA 4BDYA 2VG5A 3G10A 4BWMA 4N5SA 2OPRA 4DTPA 3MXMA 4M3ZA 3KLGA 4IG0A 1RBVA 1TAUA 5HLFA 4E1NA 1WSHA 4N56A 1TAQA 4CFBA 1VSHA 4C8OA 4K8XA 1S1TA 4OKKA 2XO7A 4OKEA 1NK5A 3QETA 4N76A 2ETJA 4DFMA 1JLAA 3HXMA 1JLGA 1JLEA 5KGXA 3LP0A 1I39A 3NE6A 2E4LA 3ZSQA 2XY5A 1Q9XA 4HUGA 1CLQA 1A5WA 1U45A 4CHQA 4IFYA 1XI1A 3A2FA 4DTMA 4CF0A 4CEDA 2NUBA 1RT1A 4RW8A 3U3GA 1QSLA 3V9ZA 4KHNA 2KTQA 3OYCA 3LAMA 2F8TA 1VK0A 4FLUA 3NCIA 1I3AA 1KCFA 3FFIA 5CYQA 4CJ3A 3UIQA 4CECA 4C8LA 2VWJA 1WSGA 2Z1JA 1SL0A 3AVIA 3HSTB 4DFJA 3OYAA 1SL1A 3LDSA 4L8RB 4CJRA 4FLYA 1MU2A 3OY9A 4DU1A 3RMDA 3U3YA 3OYFA 3MXIA 2FBVA 4CJ4A 2BDPA 3DRSA 2OA8A 3LAKA 1QS4A 3B6OA 1S1VA 2ZE2A 3NBPA 5JS2A 4E3SA 2KZZA 4CEQA 2A1RA 3DLBA 3AVMA 5CYMA 3ZSOA 1UWBA 4DTRA 5J2QA 3L8BA 4RW7A 4B08A 4CGHA 3AVAA 3KK3A 4J2BA 5T7BA 2HW3A 1RDAA 4DSEA 3PO5A 3SV4A 4CHOA 2YV0X 3TAQA 1NOYA 3DRRA 2XY8A 4OKJA 3OYBA 3V9UA 4FM1A 2OPPA 4N41A 4CEFA 3IG1A 1S1XA 2D0AA 3U6FA 4CJWA 4W5RA 1VSDA 3OYJA 4FM0A 3SUOA 4CHYA 4F2RA 4DFPA 3ZT3A 1RCHA 5DMRA 1ITGA 1U4BA 1S6PA 3DLRA 4CJLA 4AHSA 3QEWA 3LP1A 1T05A 4FW1A 1EP4A 4C8NA 3VQCA 3V9XA 3NF6A 3V6DA 4FJ5A 5FROA 3EY1A 4AILC 2OZMA 1TK8A 4CEZA 3K5MA 1KRPA 4BDZA 3QINA 1QE1A 4HUEA 2G8KA 4RW4A 2A1SA 3L2VA 4O55A 3K2PA 1EXQA 1TK5A 3LP2A 3KLFA 1IKXA 4FLTA 1TK0A 3DOKA 4OVLA 4F2SA 3L3UA 4FJXA 4HUFA 1RNHA 1NK9A 3PO4A 4M42A 2HHQA 3OS2A 4Z4EA 4AHRA 3I0RA 3HL8A 2HNZA 3ALYA 4UQGA 4OLAA 5CZ1A 2HHTA 1NJWA 3OYGA 4M45A 2KZMA 1NJXA 3SUPA 1EKEA 4QAGA 4CE9A 3V9SA 3QNNA 4F8RA 2DY4A 2FBTA 4O5BA 1VSMA 4FVMA 4DF4A 4PUOA 3QEIA 4KTQA 2X74A 3OS0A 4IBNA 1NOZA 3HT3A 1KLNA 3DM2A 4LD0A 1U47A 1KFSA 3DLHA 4M3UA 1TL1A 1L3VA 2DTUA 4ELTA 4E7JA 3NF9A 4Y1CA 1KSPA 2GUIA 2QKBA 1KTQA 1T03A 1IKVA 2XY7A 1ZBLA 5J2PA 3VQAA 4CEBA 3KD5E 1D9FA 3QERA 1Z26A 2HNYA 4AHUA 3PX0A 4KFBA 4QCLA 3AVHA 1FK9A 3K5OA 4JRPA 2AJQA 2KW4A 3SV3A 2RPIA 4DF8A 2YNHA 1F21A 5FDLA 1K6YA 3VQ4A 4FJNA 4DTOA 4ZHRA 1X9WA 4DSJA 2EX3A 1TKXA 2D0CA 3AA3A 4B9MA 5HROA 4CGJA 4CGIA 2Q3SA 1YTUA 4IG3A 4CJPA 2G8IA 1VSEA 4AHTA 3O3HA 1G15A 1HNIA 4DQSA 3L2UA 1VSLA 3QEVA 4B8CA 3AVGA 4FJLA 4KHQA 1NK6A 3EZ5A 1NJYA 3TI0A 4CJ5A 3AVJA 5KGWA 3MXJA 4BDPA 1QTMA 5HBMA 3QIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CXU A;  3C95 A;  3NGZ A;  4EZ6 A;  3RRH A;  4FZZ A;  4DMN A;  4E7K A;  3HO1 A;  5JS1 A;  4CFC A;  1X1P A;  1KVB A;  3AO5 A;  3TWH A;  1CZ9 A;  4BE2 A;  4FCY A;  3VA3 A;  3G0Z A;  4DS5 A;  1IG9 A;  3AA5 X;  4O0J A;  1XWL A;  3O4N A;  2Z1I A;  2YHB A;  4RG8 A;  2FC0 A;  4CF1 A;  1RT2 A;  1RDD A;  3THV A;  4M3W A;  4B9V A;  2KFZ A;  4CJK A;  3SQ0 A;  2OPQ A;  5I42 A;  1TGO A;  1YVU A;  3SCX A;  3DLE A;  1WSF A;  2Y1I A;  4Z4G A;  4FLV A;  5C25 A;  4JLH A;  4KAZ A;  3MEG A;  1RTH A;  3ZSY A;  4AHC A;  4FJK A;  2QK9 A;  1TKT A;  1KVC A;  2VWK A;  3SUQ A;  2F96 A;  4QOZ B;  1BIU A;  1TVR A;  5SZT A;  1VRU A;  3EYZ A;  4KHS A;  3AVK A;  3QEP A;  3VA0 A;  3L2W A;  4CEO A;  4ELU A;  4LH4 A;  3B6P A;  1R0A A;  3TAE A;  3SYZ A;  3JYT A;  1DTQ A;  1L3S A;  3ZCM A;  2I5J A;  3QNO A;  4FZY A;  1S1W A;  2RF2 A;  4KRE A;  3C6U A;  1L3T A;  3DI6 A;  2YNI A;  3P83 D;  3OYH A;  4F4K A;  4EZ9 A;  4FXD A;  1B9F A;  1SV5 A;  1CXQ A;  3ZSZ A;  4BWJ A;  3SZ2 A;  4OGC A;  2HHU A;  3OYI A;  4LSN A;  1BCO A;  1NKE A;  2PYL A;  1NKC A;  2HMI A;  5CZ2 A;  3V1R A;  3ITH A;  4K8Z A;  3VQ9 A;  1TV6 A;  3SJJ A;  3T1A A;  1J5O A;  3LAL A;  2E6M A;  3OYM A;  3WNH A;  4W5T A;  4NCB A;  4FLW A;  3SNN A;  1JLF A;  5FRM A;  2O4G A;  3NH2 A;  3RRG A;  3NGI A;  3RWU A;  4Z0U A;  3DRP A;  1J54 A;  4NCG A;  4E19 A;  3PX6 A;  4ID5 A;  4NCA A;  1WSE A;  2GV9 A;  4CHZ A;  4AH9 A;  1ZBI A;  2B6A A;  4M3T A;  2ATQ A;  1BIZ A;  1LW0 A;  3I8D A;  3SPY A;  3SQ1 A;  4DTX A;  4E7L A;  3V81 A;  3RR7 A;  2EHG A;  3WNF A;  1L3U A;  3AV9 A;  2D0B A;  1UA0 A;  2HVH A;  4FJ8 A;  3VQ5 A;  3ZSX A;  4DSL A;  4GMJ B;  3M8P A;  1ZBU A;  3NDK A;  1WSJ A;  1C0T A;  1U04 A;  3AVF A;  3LPT A;  3ZT4 A;  1X9M A;  3ZT1 A;  4KHU A;  3HPH A;  3O3F A;  3PY8 A;  3LWM A;  4O0I A;  3K57 A;  3MEE A;  1EET A;  1RT4 A;  1LWE A;  3MEC A;  4CIG A;  2G8U A;  2DFF A;  1B9D A;  2ZQB A;  4KV8 A;  1W0H A;  1WAJ A;  3CFR A;  2R7Y A;  1S1U A;  4OPJ A;  3V9W A;  4E7I A;  4ZTJ A;  3E01 A;  4KTW A;  4OLB A;  3KK1 A;  4Z4F A;  4CFA A;  2HHV A;  4I2Q A;  1C1C A;  2RN2 A;  3F73 A;  3AVB A;  4KI4 A;  3OS1 A;  1C0M A;  1J9A A;  3OYN A;  3KK2 A;  3S3N A;  4KHY A;  3DLG A;  5E41 A;  1WSI A;  3LZJ A;  1GOC A;  5I3U A;  1ASV A;  2X78 A;  4M3R A;  1JLC A;  5HRS A;  3DOL A;  4I7F A;  1LAW A;  4LH5 A;  1RBU A;  3AVC A;  3NH1 A;  1HPZ A;  2G8W A;  2F8S A;  4CJF A;  1Z25 A;  4DS4 A;  4DTS A;  1BI4 A;  1W9H A;  1N6Q A;  2Z1G A;  1Y97 A;  2XHB A;  3V1Q A;  2X6S A;  2IAJ A;  3SUN A;  2G8F A;  4B9L A;  4YFU A;  1RTI A;  3K5L A;  3AO2 A;  1JL1 A;  5HRN A;  4FLX A;  3T19 A;  3OJU A;  1HNV A;  4DSI A;  4PWD A;  4HTU A;  5J2M A;  4DU4 A;  1BI4 B;  3WNG A;  3NH0 A;  2LSN A;  5HRP A;  1WN7 A;  4NYN A;  1VRT A;  1IKY A;  4CEA A;  3L2R A;  3RMA A;  1XC9 A;  1Q9Y A;  4Q0B A;  1JKH A;  3C94 A;  3VQ8 A;  4Q5V A;  3KD1 E;  4CJT A;  4LY7 A;  1Q8I A;  1QHT A;  3LAN A;  1JXE A;  3K58 A;  1S6Q A;  2PY5 A;  2HHX A;  3NGY A;  1B92 A;  1NK0 A;  4NYF A;  1YTA A;  4FJJ A;  3KKS A;  4AHV A;  3L3V A;  4DQI A;  4J2A A;  4O4G A;  1FXX A;  4I2P A;  3M8Q A;  3K59 A;  1ZYQ A;  1U49 A;  4I9Q A;  3VQD A;  4DLE A;  3ZT0 A;  1NK8 A;  1C1A A;  3IRX A;  4CJQ A;  1RT6 A;  5C24 A;  5J1E A;  1RTJ A;  3ZSV A;  1WAF A;  3CG7 A;  5J2N A;  4DSF A;  4W5O A;  3VQ7 A;  4CF2 A;  2Y1J A;  4FJ9 A;  1RBT A;  2YNF A;  4ICL A;  1WLJ A;  3S3M A;  3TAR A;  1LAV A;  4CJE A;  4BAC A;  1SKW A;  4B9U A;  4FK2 A;  4FLZ A;  3P1G A;  4KTZ A;  4CFD A;  3DMJ A;  3P5J A;  3KLE A;  2KQ2 A;  4IFV A;  4Y1D A;  1DLO A;  3ZSW A;  1BCM A;  3TR8 A;  1QSS A;  2B4J A;  3VN5 A;  3KKR A;  3QO9 A;  4CEE A;  4CHN A;  2YKN A;  4JS5 A;  4DU3 A;  2FBX A;  4DTN A;  3PX4 A;  3SI6 A;  1HQU A;  3OVN A;  1DTT A;  2HVI A;  3MED A;  4LSL A;  4CER A;  3QEX A;  4F3O A;  3LZI A;  4CJV A;  4HVJ A;  1NJZ A;  2IDO A;  3CYM A;  1SKS A;  1RBS A;  1HYV A;  4CF8 A;  3TAN A;  3VQE A;  3TAG A;  1IKW A;  3DYA A;  4CIF A;  1BHL A;  3KJV A;  2IGI A;  3ZSR A;  2D5R A;  2ZD1 A;  1EX4 A;  4FJG A;  3ULD A;  1RDC A;  1S9G A;  1CZB A;  4CF9 A;  1RDB A;  3VQB A;  4KRF A;  4W5N A;  3QIP A;  4DWI A;  4XIU A;  3SPZ A;  4ELV A;  2BE2 A;  4H8K A;  4IDK A;  4J2D A;  1JLB A;  1FKP A;  2GBZ A;  4KB0 A;  4FJ7 A;  2XY6 A;  1KVA A;  4O44 A;  4E1M A;  2RKI A;  2OYQ A;  4CJU A;  3QES A;  2O4I A;  3S9H A;  2YNG A;  4OPK A;  1RBR A;  1XHZ A;  1LV5 A;  4FZX C;  4E89 A;  1A5V A;  1SL2 A;  4F3T A;  3LP3 A;  3O4Q A;  3DLK A;  4Z4H A;  1BQN A;  1LWC A;  3S3O A;  1J53 A;  1TL3 A;  1S5J A;  4FW2 A;  4GVM A;  1UAX A;  5HRR A;  1UA1 A;  1NK4 A;  4DTJ A;  2HND A;  3C6T A;  1C0U A;  3HVT A;  4M3X A;  1RIL A;  3HYF A;  1WNS A;  4CES A;  5KRT A;  1VSF A;  2HB5 A;  2JLE A;  3NF7 A;  4DG1 A;  3BDP A;  4FK0 A;  3TAF A;  3WNE A;  5K14 A;  3KLH A;  3I0S A;  1TKD A;  4CGD A;  3OYK A;  1HJR A;  3RMB A;  3TAP A;  3SQ4 A;  2YHA A;  1ASU A;  2ITG A;  3OJS A;  1S9E A;  3IS9 A;  4C8M A;  3VQQ A;  3D45 A;  1SKR A;  2G8V A;  4DQP A;  1JLQ A;  4C8K A;  3K5N A;  1D8Y A;  4N47 A;  3ZT2 A;  4CK2 A;  3NFA A;  1HRH A;  3PUF A;  3KIO A;  1HQE A;  3CM5 A;  2BAN A;  1O1W A;  2IOC A;  2BGG A;  3HPO A;  4DTU A;  4FJH A;  4MQ3 A;  3TAB A;  3H08 A;  4JRQ A;  2HHS A;  1YT3 A;  2QKK A;  1GOA A;  1IO2 A;  1BGX T;  3LPU A;  1D5A A;  4B8A B;  1A5X A;  2IS3 A;  1RT3 A;  4H4M A;  3LWL A;  3IAY A;  4FYD A;  1HYS A;  5KRS A;  1ZBF A;  4KO0 A;  5HP1 A;  1SUQ A;  1LW2 A;  5EU7 A;  1TKZ A;  4CHP A;  3RMC A;  1RT5 A;  3D0P A;  3AVN A;  2VG6 A;  3CFP A;  3OYD A;  1HMV A;  1JL2 A;  3AA2 A;  4EP4 A;  3AO3 A;  3NF8 A;  2G8H A;  1T7P A;  4KPY A;  1BL3 A;  3VQP A;  4R5P A;  2X6N A;  1QQC A;  2VG7 A;  3AVL A;  1C6V A;  4TSX A;  3HP6 A;  2PYJ A;  3RR8 A;  2IC3 A;  4KHW A;  4M3Y A;  4FM2 A;  2WOM A;  3AO1 A;  1NKB A;  4B3O A;  3CFO A;  4PY5 A;  1U48 A;  1NK7 A;  1XHX A;  2P5G A;  2WON A;  1ASW A;  2P51 A;  4G1Q A;  2FBY A;  4RW9 A;  4HHT A;  3T3F A;  3RTV A;  3V4I A;  3TAM A;  1C1B A;  1VSK A;  1KFD A;  2B5J A;  1UOC A;  3HPG A;  4KKO A;  4CGF A;  3M8R A;  4CK3 A;  4E7H A;  1X9S A;  1L5U A;  4Z4I A;  4H4O A;  3MAQ A;  4CIE A;  3AA4 A;  5KTQ A;  4OJR A;  4HCC A;  4B9N A;  3NAE A;  2DFH A;  4ID1 A;  2OZS A;  1N5Y A;  4RW6 A;  4JS4 A;  2QXF A;  2YKM A;  3VQ6 A;  2Z1H A;  1FKO A;  2JGU A;  4IKF A;  2KFN A;  1BQM A;  3SQ2 A;  3HVR A;  3F9K A;  3V1O A;  4BE0 A;  2HHW A;  1REV A;  2P5O A;  3ISN C;  4EP5 A;  2XRI A;  4I9L A;  3QLH A;  1RTD A;  3CM6 A;  4ZTF A;  4M41 A;  4BE1 A;  5KI6 A;  4KI6 A;  5D3G A;  3L2Q A;  4DQR A;  1RT7 A;  4Z4C A;  4CK1 A;  4CGG A;  4DLG A;  1LWF A;  3OYL A;  4J2E A;  4PQU A;  4B9T A;  3KLI A;  4YNQ A;  2E6L A;  4MFB A;  3PV8 A;  1GOB A;  2DFE A;  5SWM A;  4GW6 A;  2W42 A;  3AO4 A;  4B9S A;  4FJM A;  5C42 A;  1HYZ A;  5DK5 A;  3HM9 A;  1ZBH A;  4FJI A;  3HP9 A;  4FK4 A;  4E0D A;  3CQ8 A;  3O3G A;  3JSM A;  1BIS A;  3HK2 A;  4DQQ A;  2PZS A;  5FRN A;  4HCB A;  2OPS A;  4PA1 A;  1KLM A;  1T8E A;  3BGR A;  1IH7 A;  2P1J A;  3OYE A;  4DFK A;  1JXB A;  3KTQ A;  4DSK A;  4KB1 A;  4W5Q A;  3M8S A;  3HJF A;  1D9D A;  5CY4 A;  1VSJ A;  1QSY A;  4OGE A;  1VSI A;  3ASM A;  4WE1 A;  4CJS A;  4CCH A;  3NHG A;  4BDY A;  2VG5 A;  3G10 A;  4BWM A;  4N5S A;  2OPR A;  4DTP A;  3MXM A;  4M3Z A;  3KLG A;  4IG0 A;  1RBV A;  1TAU A;  5HLF A;  4E1N A;  1WSH A;  4N56 A;  1TAQ A;  4CFB A;  1VSH A;  4C8O A;  4K8X A;  1S1T A;  4OKK A;  2XO7 A;  4OKE A;  1NK5 A;  3QET A;  4N76 A;  2ETJ A;  4DFM A;  1JLA A;  3HXM A;  1JLG A;  1JLE A;  5KGX A;  3LP0 A;  1I39 A;  3NE6 A;  2E4L A;  3ZSQ A;  2XY5 A;  1Q9X A;  4HUG A;  1CLQ A;  1A5W A;  1U45 A;  4CHQ A;  4IFY A;  1XI1 A;  3A2F A;  4DTM A;  4CF0 A;  4CED A;  2NUB A;  1RT1 A;  4RW8 A;  3U3G A;  1QSL A;  3V9Z A;  4KHN A;  2KTQ A;  3OYC A;  3LAM A;  2F8T A;  1VK0 A;  4FLU A;  3NCI A;  1I3A A;  1KCF A;  3FFI A;  5CYQ A;  4CJ3 A;  3UIQ A;  4CEC A;  4C8L A;  2VWJ A;  1WSG A;  2Z1J A;  1SL0 A;  3AVI A;  3HST B;  4DFJ A;  3OYA A;  1SL1 A;  3LDS A;  4L8R B;  4CJR A;  4FLY A;  1MU2 A;  3OY9 A;  4DU1 A;  3RMD A;  3U3Y A;  3OYF A;  3MXI A;  2FBV A;  4CJ4 A;  2BDP A;  3DRS A;  2OA8 A;  3LAK A;  1QS4 A;  3B6O A;  1S1V A;  2ZE2 A;  3NBP A;  5JS2 A;  4E3S A;  2KZZ A;  4CEQ A;  2A1R A;  3DLB A;  3AVM A;  5CYM A;  3ZSO A;  1UWB A;  4DTR A;  5J2Q A;  3L8B A;  4RW7 A;  4B08 A;  4CGH A;  3AVA A;  3KK3 A;  4J2B A;  5T7B A;  2HW3 A;  1RDA A;  4DSE A;  3PO5 A;  3SV4 A;  4CHO A;  2YV0 X;  3TAQ A;  1NOY A;  3DRR A;  2XY8 A;  4OKJ A;  3OYB A;  3V9U A;  4FM1 A;  2OPP A;  4N41 A;  4CEF A;  3IG1 A;  1S1X A;  2D0A A;  3U6F A;  4CJW A;  4W5R A;  1VSD A;  3OYJ A;  4FM0 A;  3SUO A;  4CHY A;  4F2R A;  4DFP A;  3ZT3 A;  1RCH A;  5DMR A;  1ITG A;  1U4B A;  1S6P A;  3DLR A;  4CJL A;  4AHS A;  3QEW A;  3LP1 A;  1T05 A;  4FW1 A;  1EP4 A;  4C8N A;  3VQC A;  3V9X A;  3NF6 A;  3V6D A;  4FJ5 A;  5FRO A;  3EY1 A;  4AIL C;  2OZM A;  1TK8 A;  4CEZ A;  3K5M A;  1KRP A;  4BDZ A;  3QIN A;  1QE1 A;  4HUE A;  2G8K A;  4RW4 A;  2A1S A;  3L2V A;  4O55 A;  3K2P A;  1EXQ A;  1TK5 A;  3LP2 A;  3KLF A;  1IKX A;  4FLT A;  1TK0 A;  3DOK A;  4OVL A;  4F2S A;  3L3U A;  4FJX A;  4HUF A;  1RNH A;  1NK9 A;  3PO4 A;  4M42 A;  2HHQ A;  3OS2 A;  4Z4E A;  4AHR A;  3I0R A;  3HL8 A;  2HNZ A;  3ALY A;  4UQG A;  4OLA A;  5CZ1 A;  2HHT A;  1NJW A;  3OYG A;  4M45 A;  2KZM A;  1NJX A;  3SUP A;  1EKE A;  4QAG A;  4CE9 A;  3V9S A;  3QNN A;  4F8R A;  2DY4 A;  2FBT A;  4O5B A;  1VSM A;  4FVM A;  4DF4 A;  4PUO A;  3QEI A;  4KTQ A;  2X74 A;  3OS0 A;  4IBN A;  1NOZ A;  3HT3 A;  1KLN A;  3DM2 A;  4LD0 A;  1U47 A;  1KFS A;  3DLH A;  4M3U A;  1TL1 A;  1L3V A;  2DTU A;  4ELT A;  4E7J A;  3NF9 A;  4Y1C A;  1KSP A;  2GUI A;  2QKB A;  1KTQ A;  1T03 A;  1IKV A;  2XY7 A;  1ZBL A;  5J2P A;  3VQA A;  4CEB A;  3KD5 E;  1D9F A;  3QER A;  1Z26 A;  2HNY A;  4AHU A;  3PX0 A;  4KFB A;  4QCL A;  3AVH A;  1FK9 A;  3K5O A;  4JRP A;  2AJQ A;  2KW4 A;  3SV3 A;  2RPI A;  4DF8 A;  2YNH A;  1F21 A;  5FDL A;  1K6Y A;  3VQ4 A;  4FJN A;  4DTO A;  4ZHR A;  1X9W A;  4DSJ A;  2EX3 A;  1TKX A;  2D0C A;  3AA3 A;  4B9M A;  5HRO A;  4CGJ A;  4CGI A;  2Q3S A;  1YTU A;  4IG3 A;  4CJP A;  2G8I A;  1VSE A;  4AHT A;  3O3H A;  1G15 A;  1HNI A;  4DQS A;  3L2U A;  1VSL A;  3QEV A;  4B8C A;  3AVG A;  4FJL A;  4KHQ A;  1NK6 A;  3EZ5 A;  1NJY A;  3TI0 A;  4CJ5 A;  3AVJ A;  5KGW A;  3MXJ A;  4BDP A;  1QTM A;  5HBM A;  3QIO A; 
#chains in the Genus database with same CATH topology
 3EL2 A;  5JS1 A;  2E1Z A;  3TWH A;  4FCY A;  1KD1 O;  1NJY A;  2Z1I A;  2YHB A;  2FC0 A;  1RT2 A;  1RDD A;  1HJO A;  4B9V A;  4CJK A;  4AM7 A;  2OPQ A;  5I42 A;  1TGO A;  1YVU A;  4ILJ A;  3DLE A;  3LDN A;  2Y1I A;  3G71 N;  4KAZ A;  3MEG A;  2F4V K;  4AHC A;  1IBK K;  4FJK A;  1KVC A;  2DPN A;  3SUQ A;  1OVQ A;  2F96 A;  5H1S Q;  1GLD G;  1ZBS A;  1VRU A;  2V7Z A;  3C7N A;  2E5L K;  4CEO A;  1YVN A;  3ID6 A;  1HKB A;  4FZY A;  1VQ9 N;  5AQV A;  2RF2 A;  4KRE A;  3C6U A;  1L3T A;  3DI6 A;  4F4K A;  3HSC A;  3UE5 A;  1CXQ A;  4LFB K;  3U9D A;  2A6A A;  4BRM A;  3V1R A;  2PBD A;  2P9P A;  1VQL N;  4LF4 K;  4NCB A;  1XMQ K;  1M1K O;  2NRV A;  5FRM A;  3NH2 A;  3RRG A;  3PX6 A;  2GV9 A;  4CHZ A;  2P9P B;  2GWJ A;  2B6A A;  3UKU A;  1LW0 A;  4JNE A;  3ZET A;  4E7L A;  3AV9 A;  2ZM6 K;  4FJ8 A;  2ZJR L;  3CXC M;  1WSJ A;  1X9M A;  1U04 A;  2UXB K;  3UKU B;  3A8Y A;  1GLJ O;  4YOX A;  3O3F A;  1YAG A;  1MDU B;  4BR2 A;  3K57 A;  3GBT A;  3MEC A;  2G8U A;  2DFF A;  1B9D A;  4KV8 A;  4X62 K;  1WAJ A;  4KH5 A;  2R7Y A;  4F8R A;  4IZ9 A;  3E01 A;  3KK1 A;  4I2Q A;  4KH4 A;  3OS1 A;  3CD6 N;  4K42 A;  4BQL A;  1K73 O;  4NO7 A;  5I3U A;  2OAN A;  4M3R A;  3AY9 A;  1LOT B;  4JKC A;  3CJC A;  4LH5 A;  1RBU A;  2W6L A;  1Y97 A;  4H0P A;  3SUN A;  3O9Q A;  2CGL A;  1T6C A;  3K5L A;  5AJ3 K;  1JL1 A;  2HBJ A;  1HNV A;  1Q86 O;  2VQE K;  3RSE A;  3PSF A;  3LM2 A;  3C94 A;  4Q5V A;  1OH5 A;  1O13 A;  4LY7 A;  3LAN A;  3RSE B;  3NGY A;  3R1X A;  4FJJ A;  4AHV A;  3VEV A;  3THY A;  4J2A A;  3LDL A;  1FXX A;  3K59 A;  3M8Q A;  4EAH D;  3T69 A;  3VQD A;  4EHT A;  1C1A A;  3IRX A;  4CJQ A;  3ZSV A;  1WAF A;  5J2N A;  1VQM N;  4GVE A;  4H03 B;  4DSF A;  4CF2 A;  1RBT A;  4B1U B;  4FWR A;  2E88 A;  4B9U A;  3O5B A;  3P1G A;  3P5J A;  4QS7 A;  1N36 K;  1GLF O;  3TR8 A;  1QSS A;  3CQX A;  2KKZ A;  1ATR A;  2B4J A;  3O8M A;  3SMP A;  4CEE A;  3SI6 A;  3BZC A;  5JLH A;  2E20 A;  3MED A;  4CJV A;  2QI2 A;  1SKS A;  1GLE G;  2H3G X;  3VQE A;  3DYA A;  4ISG A;  1WBD A;  4ILG B;  2ZD1 A;  2FSJ A;  3EKS A;  3CJ1 A;  4AQY K;  3C65 A;  2GTD A;  4KB0 A;  4O44 A;  4JKA A;  5LY3 A;  1HLU A;  4CJU A;  3QES A;  2O4I A;  5EX5 A;  1LV5 A;  4OPK A;  1RBR A;  4FZX C;  2P9U A;  3O4Q A;  3DLK A;  4Z4H A;  2D0O A;  3S3O A;  4OLA A;  2CH6 A;  2WTU A;  1NK4 A;  3WQU A;  1C0U A;  4CES A;  3QFU A;  4DG1 A;  3NF7 A;  2P9U B;  3WNE A;  3KLH A;  3OYK A;  1HJR A;  3R6M A;  1XMO K;  3SQ4 A;  4GKJ K;  1BOT O;  1BUP A;  2ASM A;  2G8V A;  1NGG A;  4DQP A;  1JLQ A;  4C8K A;  3NFA A;  3PUF A;  3CM5 A;  1K8K A;  3HPO A;  1NMD A;  3EZW A;  1IO2 A;  3THW A;  1V4S A;  4FSV A;  1ZC6 A;  4FYD A;  4IEI A;  1K8K B;  4BR4 A;  4JI1 K;  4K25 A;  1LW2 A;  4CHP A;  3CCL N;  1I94 K;  3RMC A;  3D0P A;  3THW B;  1EO1 A;  3T1Y K;  1HMV A;  4BRA A;  3AA2 A;  3O1B A;  1HNX K;  4EP4 A;  4Y0W A;  3AGK A;  1Z6R A;  1XNR K;  4CBU A;  4TSX A;  4IWV A;  3U9Z A;  4FPA A;  1NK7 A;  2P5G A;  4HHT A;  2FBY A;  4GV3 A;  3TAM A;  3M8R A;  1L5U A;  4KKO A;  1NGH A;  4Z4I A;  4H4O A;  3MAQ A;  4CIE A;  3PIO L;  1Z05 A;  4HCC A;  3NAE A;  2QXF A;  3VQ6 A;  3DAW A;  4QS8 A;  3C6A A;  3P31 A;  2HHW A;  2FSK A;  3ISN C;  3VER A;  1RTD A;  3P4I A;  4BE1 A;  4KI6 A;  3L2Q A;  1RT7 A;  2FLO A;  4CGG A;  4PQU A;  4BRK A;  2JWL A;  3SAF A;  3PV8 A;  1W2B M;  1ILY A;  5SWM A;  2W42 A;  3AO4 A;  1KQS M;  3HM9 A;  1E4G T;  3AAR A;  5C0Y A;  3JSM A;  1BIS A;  4HCB A;  3BGR A;  4OO1 J;  2QWP A;  2OTL N;  4W5Q A;  5C15 A;  2AP1 A;  5AQZ A;  5CY4 A;  4CBX A;  3KWG A;  4CJS A;  1YJW N;  4LF9 K;  3NHG A;  4BDY A;  2VG5 A;  4BWM A;  3VGM A;  3MXM A;  5LMN K;  1N32 K;  4JI6 K;  5C2D A;  1WSH A;  4CFB A;  4C8O A;  3ENH A;  3OTO K;  3QET A;  4DR6 K;  1JLE A;  5KGX A;  1I39 A;  3MN7 A;  1YHQ N;  4CZF A;  1U45 A;  2F7T A;  4CHQ A;  4M7X A;  1JCF A;  1XI1 A;  4CBW A;  1RT1 A;  3U3G A;  4KHN A;  2OTJ N;  1SS6 A;  3OHR A;  1LCU A;  5CYQ A;  1NG9 A;  4CEC A;  1SL1 A;  1DGK N;  3LDS A;  4CJR A;  3BEX A;  4FLY A;  4BC4 A;  3MXI A;  2FBV A;  4G9Z A;  3DRS A;  3K9J A;  1S1V A;  5CYM A;  4YOU A;  2KLA A;  4J2B A;  4DSE A;  3SV4 A;  4JK9 A;  4CHO A;  4H0T B;  5KPR A;  3TAQ A;  1NOY A;  4OKJ A;  2XY8 A;  3C0B A;  4CD1 A;  4W5R A;  5GAE P;  3LDP A;  3SUO A;  4YHH K;  5HOO A;  4DFP A;  1U4B A;  5DMR A;  1ITG A;  1S6P A;  4BG9 A;  4FW1 A;  3VEY A;  2BTF A;  4C1N K;  3G6E N;  4FJ5 A;  2OZM A;  1HKC A;  4BDZ A;  1QE1 A;  4PL7 A;  3QFP A;  3EN9 A;  4PHT X;  1TK5 A;  1IKX A;  2YCH A;  4OVL A;  4F2S A;  4FJX A;  2UXC K;  1RNH A;  4OPA A;  3CCM N;  1NK9 A;  4M42 A;  4IJN A;  3VPZ A;  4IJA A;  3ALY A;  4UQG A;  3J8A A;  2Q0U A;  3WUH A;  3GG4 A;  1RDU A;  2FBT A;  4O5B A;  3QEI A;  4KTQ A;  4IBN A;  1NOZ A;  3DM2 A;  2I7N A;  4H5W A;  4MDA A;  4E7J A;  4YOT A;  3A5L C;  2XY7 A;  1ZBL A;  1NGJ A;  5HL7 L;  1T6D A;  3KD5 E;  1D9F A;  3QER A;  1Z26 A;  2HNY A;  4AHU A;  1ESV A;  3DXK A;  4L3Q A;  4JI0 K;  2RPI A;  4DF8 A;  2NRT A;  3G4S N;  2D0C A;  3DXK B;  3FGU A;  2QTD A;  2QW9 A;  1VSE A;  1G15 A;  3NVM A;  2HBL A;  3QEV A;  3E9P A;  3ZX2 A;  2O8C A;  3VES A;  3RVC A;  4BRH A;  3EZ5 A;  3TI0 A;  3CPW M;  2NRR A;  1QTM A;  3NGZ A;  4EZ6 A;  2W40 A;  2CH5 A;  2UU9 K;  2D4W A;  3Q7B A;  5F0X A;  3OA9 A;  1X1P A;  2O8C B;  1KVB A;  3VA3 A;  3G0Z A;  1YUW A;  4DS5 A;  5M1K A;  2QWO A;  1U6Z A;  3AA5 X;  4O0J A;  4CF1 A;  3THV A;  2ITM A;  2KFZ A;  3HOT A;  3SCX A;  4Z4G A;  4JI7 K;  4JLH A;  4H0V B;  1BA1 A;  3QB0 A;  5A2Q O;  1TVR A;  3H45 C;  3O1W A;  3QEP A;  3VA0 A;  2GWK A;  4ELU A;  4A5A A;  4LH4 A;  3JYT A;  1DTQ A;  2HMP A;  3ZCM A;  2I5J A;  3QNO A;  2YNI A;  4YOV A;  3WEE A;  3OYH A;  3N4Q A;  4A5B A;  4YOR A;  3AAQ A;  4V19 S;  2HHU A;  2VYP A;  5FLX O;  1NKE A;  5GAG P;  1TV6 A;  3T1A A;  2UYT A;  5BRE A;  3WEE B;  2NRW A;  4BRC A;  1JLF A;  4IFE A;  3C6H A;  4Z0U A;  4KBO A;  5DM7 L;  3QDK A;  1ZBI A;  4M3T A;  1HKG A;  1BIZ A;  2ATQ A;  3SPY A;  3SQ1 A;  2GEL A;  3V81 A;  3RR7 A;  1L3U A;  2HVH A;  3ZSX A;  3CC7 N;  3CME N;  3NDK A;  3LPT A;  3ZT1 A;  3FZF A;  3PY8 A;  1EET A;  1RT4 A;  2A42 A;  2GUP A;  3VEX A;  3V9W A;  1S1U A;  4PKH A;  3J7A P;  4CFA A;  4KI4 A;  3AVB A;  2BH1 A;  3OYN A;  4KHY A;  1QZ6 A;  5CE3 A;  3MN5 A;  3O6W A;  1ASV A;  4Z94 A;  2ZGZ A;  4I7F A;  1LAW A;  1D4X A;  5JVH L;  3SAH A;  4DTS A;  1BI4 A;  4B1V A;  1N6Q A;  4PL8 A;  2G8F A;  4B9L A;  5MLC Q;  5KQD A;  4PWD A;  1BI4 B;  3NH0 A;  4NYN A;  1VRT A;  1IKY A;  5AQI A;  4CEA A;  3RMA A;  4Q0B A;  1JKH A;  4BRG A;  1M90 O;  3Q7C A;  2WC9 A;  2PY5 A;  3ENO A;  2HHX A;  3O4W A;  4BRI A;  1B92 A;  1T44 A;  4WF9 L;  1NK0 A;  3PLA A;  4A2B A;  3KKS A;  1NWK A;  3L3V A;  4DQI A;  1ZYQ A;  1U49 A;  4DLE A;  3VTI A;  3ZT0 A;  3WXI A;  5C24 A;  5J1E A;  1X3N A;  3H1V X;  4W5O A;  3VQ7 A;  3T7Z A;  1WLJ A;  1LAV A;  4CJE A;  3I33 A;  4KTZ A;  4CFD A;  1ZXO A;  3LM9 A;  5GIO A;  4Y1D A;  4LF5 K;  1YI2 N;  3O9S A;  3VN5 A;  4DU3 A;  3QO9 A;  4DTN A;  2FBX A;  3OVN A;  4CER A;  1NGA A;  4JKB A;  1NJZ A;  2IDO A;  3CYM A;  1FJG K;  1HYV A;  3CJA A;  4CF8 A;  3TAN A;  1BHL A;  1JCE A;  3FZM A;  4FJG A;  1RDC A;  1S9G A;  1CZB A;  3CCQ N;  4CF9 A;  1RDB A;  4W5N A;  3QIP A;  1XQS C;  1MWM A;  4YDU C;  3SPZ A;  3KK7 A;  5EOY A;  5CHI A;  4H8K A;  3C7N B;  4FJ7 A;  1KVA A;  2BUP A;  4CZK A;  1EWQ A;  3S9H A;  3SK3 A;  5JVG L;  1BO5 O;  4R79 A;  4E89 A;  4F3T A;  2J4R A;  4CJ7 A;  1LWC A;  2YJE A;  4B3T K;  4JI3 K;  1UA1 A;  1TL3 A;  1S5J A;  4GVM A;  3HVT A;  4M3X A;  1WNS A;  4CW7 B;  1Q7Y O;  3KWI A;  2HB5 A;  4FK0 A;  4X65 K;  2P9I A;  1TKD A;  2ASO A;  3FZK A;  3I0S A;  4CGD A;  2E2O A;  4EHU A;  1WBB A;  3MWT A;  2YHA A;  1ASU A;  4ISF A;  4WQ4 C;  4B1Z A;  4C8M A;  3D45 A;  4N47 A;  1ATS A;  2P9I B;  4DV5 K;  3HRG A;  3L0Q A;  4MDB A;  4DR1 K;  3ZET B;  3CC2 N;  2HHS A;  5ADX A;  1D5A A;  1A5X A;  5ADX H;  3WXK A;  3LWL A;  4H4M A;  4FWM A;  5M1Q A;  5KRS A;  2YHY A;  4FPB A;  3CFP A;  3VQP A;  4IO9 L;  2HST A;  3ID8 A;  1KXP A;  3W3D A;  2O8B A;  3RR8 A;  4KHW A;  4M3Y A;  3SAG A;  3L6Q A;  3CFO A;  1U48 A;  1XHX A;  1ASW A;  2P51 A;  4G1Q A;  4JV5 K;  3RTV A;  3VF4 A;  3HPG A;  2O8B B;  4CK3 A;  3CHW A;  3IFR A;  5KTQ A;  2UUA K;  2E8A A;  2OZS A;  2P9N A;  2YKM A;  1Q18 A;  1FKO A;  2Z1H A;  4IKF A;  3WXM B;  3HVR A;  3V1O A;  4BE0 A;  1REV A;  3BY5 A;  4WYB A;  2P9N B;  3CM6 A;  4M41 A;  5D3G A;  4DQR A;  1XUP O;  1QQO A;  3OYL A;  4J2E A;  3KLI A;  4YNQ A;  2E6L A;  4GW6 A;  3O9R A;  3THY B;  1K9M O;  1VQ8 N;  4FJM A;  5C42 A;  4JYA K;  1HYZ A;  4FJI A;  3HP9 A;  3CQ8 A;  3HK2 A;  4DQQ A;  1IH7 A;  3KTQ A;  1JXB A;  4KB1 A;  1VSJ A;  1U2V A;  1N33 K;  2OPR A;  4DTP A;  4M3Z A;  3KLG A;  1TAU A;  4E1N A;  4BR7 A;  4N56 A;  4BY9 C;  2NZT A;  4OKK A;  1U2V B;  4DFM A;  1JLG A;  3LP0 A;  3DLL L;  2E4L A;  4H0X B;  4BC5 A;  2XY5 A;  1CLQ A;  2QXL A;  1A5W A;  4IFY A;  2YJF A;  4DTM A;  3EE9 A;  3CC4 N;  4PKG A;  2KTQ A;  4RCH A;  3OYC A;  1HR0 K;  1I3A A;  1KCF A;  4DV7 K;  1QVF M;  3UIQ A;  4QS9 A;  3ULE A;  5FPE A;  5JMV A;  1SL0 A;  4DFJ A;  1BDG A;  3LDO A;  3MX2 A;  1NBW A;  4DV3 K;  3ULE B;  4CJ4 A;  2KZZ A;  3LAK A;  1QS4 A;  3B6O A;  5JS2 A;  2ZE2 A;  3CJ7 A;  1NGF A;  2RHK A;  3DLB A;  3AVM A;  3J80 O;  4NLB A;  3V9U A;  5TKY A;  4FM1 A;  2OPP A;  4CEF A;  3L4I A;  3IG1 A;  2D0A A;  3U6F A;  4CJW A;  4CHY A;  4F2R A;  1S22 A;  3DLR A;  3LP1 A;  1BA0 A;  1EP4 A;  3A5M C;  1TYQ A;  5GIN A;  2QWL A;  1TK8 A;  4X66 K;  5BPL A;  1XNQ K;  2IVN A;  2V51 B;  2G8K A;  3F9M A;  3L2V A;  4EIA A;  3WXJ A;  1TYQ B;  3LP2 A;  4GY2 B;  5M1O A;  4FLT A;  1S3X A;  4C1N I;  3DOK A;  4HUF A;  1JJ2 M;  2HHQ A;  4M63 C;  3BUZ B;  3M3Z A;  2HHT A;  3OYG A;  5AQX A;  5KQ8 A;  4XH1 A;  4M45 A;  1EKE A;  4QAG A;  4CE9 A;  1HPM A;  3QNN A;  2DY4 A;  4BR5 A;  4FVM A;  1KFS A;  5AZI A;  4LD0 A;  3MWP A;  1U47 A;  4M3U A;  3DLH A;  1TL1 A;  1OKJ A;  1L3V A;  4YOY A;  5EVZ A;  4BR9 A;  1SZ2 A;  1V4T A;  3A0I X;  4BVP A;  2W41 A;  1IG8 A;  2QKB A;  1IKV A;  1P90 A;  4A62 A;  5AZI B;  3K0S A;  5J2P A;  1IBL K;  4LC9 B;  4GV9 A;  3K5O A;  4JRP A;  2AJQ A;  4JI8 K;  3DWL A;  2YNH A;  1F21 A;  3CIP A;  5FDL A;  1K6Y A;  3VQ4 A;  4CZG A;  4FWP A;  2EX3 A;  4CGJ A;  2QEX N;  2Q3S A;  1YTU A;  4CJP A;  5AQR A;  3D2F A;  1HNI A;  3L2U A;  4DR5 K;  2NRX A;  4FWN A;  4C23 A;  1NK6 A;  5KGW A;  3MXJ A;  1T3V A;  4BDP A;  3QIO A;  1CXU A;  3C95 A;  4OKE A;  3RRH A;  3D2F B;  4FZZ A;  4DMN A;  4E7K A;  1EWR A;  3R8E A;  4DQ8 A;  3HO1 A;  1QVG M;  4CFC A;  2A3Z A;  4KH6 A;  1CZ9 A;  3THX A;  1NJI O;  1IG9 A;  4A2A A;  4M3W A;  3SQ0 A;  3MDQ A;  3WT0 A;  5AQY A;  4WFB L;  2ZWH A;  4FLV A;  3THX B;  5C25 A;  1RTH A;  3JAM O;  2VWK A;  4WQ5 A;  3EYZ A;  1HNZ K;  4KHS A;  3AVK A;  3UKR A;  4A61 A;  4X64 K;  3GE1 A;  3SYZ A;  4CZM A;  1L3S A;  5BN9 A;  4RTF D;  3M6G A;  3UKR B;  4XEI A;  4H0Y B;  3ZSZ A;  3QBX A;  1YJN N;  4OGC A;  4LSN A;  2PYL A;  1NKC A;  2HMI A;  5CZ2 A;  5CR4 A;  3ITH A;  4K8Z A;  2E6M A;  4GNI A;  2QWN A;  4W5T A;  3SNN A;  3MCA B;  2O4G A;  1DEJ A;  5LJV A;  2E2Q A;  4NCA A;  1WSE A;  3I8D A;  4DTX A;  2Q0R A;  2EHG A;  5FPN A;  3H46 O;  2D0B A;  1UA0 A;  3O80 A;  3VQ5 A;  4GMJ B;  5EXW A;  1ZBU A;  2FXU A;  1C0T A;  3AVF A;  4KHU A;  3HPH A;  4B1Y B;  4O0I A;  3U8X A;  1KAY A;  2ZQB A;  4IDH A;  4E7I A;  2HHV A;  4DCH A;  1C1C A;  2RN2 A;  5AQT A;  1J9A A;  3S3N A;  3DLG A;  3LZJ A;  2QA4 N;  4DKW A;  3DOL A;  3AVC A;  1HPZ A;  4CJF A;  3HOS A;  1Z25 A;  2XHB A;  2UUC K;  2X6S A;  4XH4 A;  1BG3 A;  5F1X A;  2A41 A;  5AQN A;  1HNW K;  3AO2 A;  5HRN A;  3T19 A;  4DSI A;  1RFQ A;  5AQU A;  5J2M A;  3OBW A;  4GV6 A;  1WN7 A;  3L2R A;  1Q9Y A;  5AQJ A;  3KD1 E;  3CCU N;  4JAX A;  1JXE A;  3K58 A;  4YOW A;  3EO3 A;  4NYF A;  1YTA A;  5AR0 A;  3H3N O;  3VTH A;  2WBN A;  4O4G A;  4I2P A;  5GIP A;  4I9Q A;  2WUS A;  4RWT A;  5FPD A;  1RT6 A;  1RTJ A;  3CG7 A;  4FJ9 A;  2Y1J A;  4DV4 K;  4ICL A;  3TAR A;  3A5O C;  2KQ2 A;  4FWQ A;  4IFV A;  3ZSW A;  3AGR A;  1BCM A;  3PSI A;  3GDQ A;  4CZI A;  4CHN A;  2YKN A;  4FOI A;  4IEE A;  1DTT A;  4DV6 K;  4F3O A;  1GLL O;  2O8E A;  3FZL A;  3KZB A;  1JCG A;  1IKW A;  2PFU A;  5GAH P;  1E3M A;  3KJV A;  3K9K A;  2D5R A;  3UB5 A;  1EX4 A;  4DUY K;  1S72 N;  3ULD A;  2HOE A;  2RE2 A;  3VQB A;  4KRF A;  1RDW X;  1J5E K;  3ATV A;  3M1F A;  4FWO A;  4ELV A;  1VHX A;  3QBW A;  3O9U A;  4J2D A;  1JLB A;  2GBZ A;  5LJW A;  2XY6 A;  4MLE A;  4FWL A;  2OYQ A;  2YNG A;  1XHZ A;  2FSN A;  5M1N A;  1SL2 A;  5AQF A;  1VQ6 N;  4FOE A;  4ISE A;  1BQN A;  1J53 A;  4FW2 A;  5HRR A;  1UAX A;  2F8S A;  4DTJ A;  2HND A;  3C6T A;  1RIL A;  3HYF A;  5KRT A;  1VSF A;  2JLE A;  1H1V A;  3TAF A;  5E26 A;  5K14 A;  3PIP L;  2P9L A;  3IS9 A;  3VQQ A;  3K5N A;  3ZT2 A;  1O1W A;  2BGG A;  3BZK A;  2P9L B;  4FJH A;  1NGC A;  4MQ3 A;  3H08 A;  1XC3 A;  3A5N C;  5AQW A;  1VQP N;  1YT3 A;  2QKK A;  1GOA A;  5I9E B;  4B8A B;  1HYS A;  1NGD A;  4LFC K;  4KO0 A;  1WOQ A;  5EU7 A;  1RT5 A;  1OVY A;  3CPE A;  3AAP A;  3ZYY X;  3P38 A;  3TPQ A;  3LDQ A;  3NF8 A;  1T7P A;  5AZJ A;  1E4F T;  2UUB K;  4R5P A;  4FWS A;  4O8K A;  2X6N A;  2VG7 A;  2HHH K;  3HP6 A;  2IC3 A;  3HI0 A;  2QWQ A;  2NRH A;  2NNW A;  4RW9 A;  3IUC A;  1C1B A;  1VSK A;  2B5J A;  1UOC A;  4OJR A;  3FZH A;  4B9N A;  1GLB G;  1N5Y A;  2Q31 A;  3ZEU A;  3FR0 A;  4JD2 A;  2JGU A;  5LMU K;  1BQM A;  3QIC A;  5C10 A;  3ZEU B;  4JD2 B;  3E9L A;  4OX9 K;  3MK6 A;  4Z4C A;  4JHD A;  5JIC A;  4B9T A;  4MFB A;  2DFE A;  2AA4 A;  3O9T A;  4B9S A;  4DR2 K;  5DK5 A;  3H6E A;  2YI1 A;  1YXQ A;  4JHD B;  2V52 B;  3O3G A;  4PA1 A;  1KLM A;  2PAV A;  2P1J A;  3OYE A;  4DSK A;  4A57 A;  1D9D A;  1VSI A;  4WE1 A;  4JKD A;  4N5S A;  1QQN A;  5HLF A;  3J7Z O;  1TAQ A;  1VSH A;  4K8X A;  1S1T A;  2XO7 A;  1NK5 A;  5DM6 L;  3ZSQ A;  5IT9 O;  4HUG A;  4CF0 A;  4CED A;  4IOA L;  4B3S K;  1KAX A;  1TUY A;  5AQQ A;  3V9Z A;  3LL3 A;  2F8T A;  3NCI A;  2GEM A;  4BGB A;  2VWJ A;  2Z1J A;  3AVI A;  4BQZ A;  4L8R B;  4NB4 A;  1MU2 A;  3GL1 A;  3IKM A;  4CI6 A;  3OYF A;  4Z4F A;  2OA8 A;  3NBP A;  4FL9 A;  4AF1 A;  4CEQ A;  2A1R A;  4DV1 K;  3ZSO A;  1UWB A;  4DTR A;  5J2Q A;  1OH7 A;  4H5N A;  4RW7 A;  4B08 A;  3KVG A;  3AVA A;  4CGH A;  3KK3 A;  5BPM A;  5T7B A;  1NLV A;  2HW3 A;  4F9O A;  1VQ4 N;  3DRR A;  4N41 A;  1SQK A;  4FM0 A;  1RCH A;  3VMF B;  3I8B A;  3E66 A;  3ZX3 A;  1T05 A;  2Q97 A;  4C8N A;  3VQC A;  5ELZ A;  3NF6 A;  5FRO A;  3EY1 A;  4IO8 A;  1KRP A;  3QIN A;  3HTV A;  2F9T A;  4RW4 A;  2A1S A;  4O55 A;  3K2P A;  1EXQ A;  2QM1 A;  1TK0 A;  4H5R A;  3E9O A;  3L3U A;  3PO4 A;  4Z4E A;  4AHR A;  3I0R A;  3HL8 A;  4NXN K;  2HNZ A;  4GKK K;  1QHA A;  5CZ1 A;  2VWB A;  1NJW A;  2KZM A;  1NJX A;  3SUP A;  3H1Q A;  4DF4 A;  4BRL A;  4CVN E;  2X74 A;  3OS0 A;  2YHX A;  3HT3 A;  2W6K A;  1KLN A;  2DTU A;  4JEP A;  1X9J A;  3F2K A;  4ELT A;  4Y1C A;  1KSP A;  1Q81 O;  3VQA A;  4CEB A;  2EWS A;  4QCL A;  3AVH A;  1FK9 A;  1N8R O;  2KW4 A;  3SV3 A;  1MA9 B;  3TTF A;  3W0L A;  3WXL A;  4LFA K;  5AQG A;  1TKX A;  4B9M A;  1P8Z A;  1K8A O;  4BC2 A;  1MWK A;  1CZA N;  4IG3 A;  2G8I A;  5BN8 A;  3VEN A;  3O3H A;  3CQY A;  4DQS A;  4JI4 K;  1VSL A;  5LL6 Z;  4DR7 K;  1W97 L;  3S41 A;  4KHQ A;  3JXU A;  3AVJ A;  4AM6 A;  5HBM A;  4MO4 A;  2VQF K;  3CJB A;  1QZ5 A;  2NRZ A;  4B1W B;  3CET A;  2VGN A;  3AO5 A;  4BE2 A;  4FVU A;  1WUA A;  3OW2 M;  3DJC A;  3E1Y A;  2KFN A;  1XWL A;  3O4N A;  4RG8 A;  3ZLJ A;  3CCV N;  3MCP A;  4DR3 K;  4JN4 A;  2ZGY A;  1WSF A;  4DR4 K;  2QK9 A;  4YDU A;  3ZSY A;  1TKT A;  5C2F A;  4QOZ B;  2CGJ A;  1BIU A;  5SZT A;  2Q2R A;  3L2W A;  3B6P A;  1R0A A;  4HWI A;  3TAE A;  3TU5 A;  1IBM K;  4I6M A;  4K41 A;  3EEQ A;  1S1W A;  4WQ5 C;  2Q36 A;  3P83 D;  5BPN A;  2VGM A;  4FXD A;  4EZ9 A;  1B9F A;  1SV5 A;  4BWJ A;  4FO0 A;  3SZ2 A;  1GLA G;  1R59 O;  4I6M B;  3OYI A;  1BCO A;  1VQ5 N;  3VQ9 A;  4CZH A;  3SJJ A;  1J5O A;  3ENB A;  3LAL A;  4WQ4 A;  3OYM A;  3WNH A;  4FLW A;  4BRP A;  2FF3 B;  3NGI A;  3RWU A;  3DRP A;  1J54 A;  1DT9 A;  4NCG A;  4E19 A;  1VQ7 N;  4ID5 A;  4H0O A;  1QQM A;  4MLH A;  4AH9 A;  5JLF A;  2D0P A;  3SBT A;  2UXD K;  4JK8 A;  3WNF A;  2ZF5 O;  3EKU A;  5BRD A;  4YY3 K;  4DSL A;  3M8P A;  3ZT4 A;  4IXC A;  4LF8 K;  3VF2 A;  3SLC A;  3VGK A;  3LWM A;  3MEE A;  1LWE A;  4CZJ A;  4NXM K;  4CIG A;  3U4L A;  3CFR A;  1W0H A;  4ZTJ A;  4OPJ A;  4OLB A;  4KTW A;  4B3M K;  3F73 A;  2YHW A;  1C0M A;  3KK2 A;  5FPM A;  5E41 A;  1WSI A;  5AFU A;  1GOC A;  3FLC O;  5AFU H;  1YIT N;  4JI5 K;  1OH8 A;  2X78 A;  3VEZ A;  1JLC A;  5HRS A;  3MN9 A;  3NH1 A;  2G8W A;  4DS4 A;  1W9H A;  5AQS A;  3CI5 A;  2Z1G A;  4U7B A;  3V1Q A;  2IAJ A;  4DUZ K;  4YFU A;  1RTI A;  2Q1N A;  4IOX A;  1ATN A;  4DV0 K;  4FLX A;  1OH6 A;  3OJU A;  4HTU A;  4DU4 A;  3WNG A;  2LSN A;  5HRP A;  3BP8 A;  1XC9 A;  3VQ8 A;  1J6Z A;  4CJT A;  3WQT A;  1Q8I A;  5BRF A;  1QHT A;  2CGK A;  4O5F A;  3VOV A;  5IWA K;  1S6Q A;  1IJJ A;  2HBK A;  4HTL A;  2NLX A;  3HBT A;  3CMA N;  2A5X A;  4K43 A;  2HF3 A;  4BRF A;  4WCE L;  1GLC G;  1YJ9 N;  1NK8 A;  1NNE A;  1NGE A;  3J81 O;  1FW6 A;  3FFK B;  3NVK A;  3OBY A;  4JK7 A;  2YNF A;  3S3M A;  1SKW A;  4BAC A;  4FK2 A;  3IMX A;  3MMV A;  4FLZ A;  3VEO A;  3DMJ A;  3KLE A;  1DLO A;  3D7E O;  3KKR A;  4JS5 A;  2ZJP L;  3PX4 A;  3CCJ N;  2HVI A;  4M7Y A;  1HQU A;  3D6R A;  4BC3 A;  4LSL A;  3QEX A;  3LZI A;  4HVJ A;  3P39 A;  4BG8 A;  1RBS A;  3TAG A;  4CIF A;  3ZX0 A;  3CJ9 A;  2IGI A;  3ZSR A;  5KPT A;  2E2N A;  1HX1 A;  2V7Y A;  3TTC A;  4B3R K;  3D2E A;  5AQM A;  5AQO A;  4DWI A;  4XIU A;  2OCE A;  2BE2 A;  4IDK A;  4IOC L;  2P9K A;  1FKP A;  4ILH A;  5BR9 A;  4J8F A;  3D2E B;  4E1M A;  2RKI A;  4WFA L;  4JKF A;  4WFN L;  1A5V A;  2P9K B;  3LP3 A;  4JKE A;  1VAZ A;  2YX6 A;  5F2R A;  5GAD P;  3I55 N;  4BVO A;  3FE1 A;  2O8D A;  3DXM A;  4CZL A;  3BDP A;  5AQK A;  3MX5 A;  3TAP A;  3RMB A;  3J7Y P;  3KHY A;  1NMN A;  2QWR A;  2ITG A;  3OJS A;  1S9E A;  3DXM B;  3EE8 A;  1SKR A;  2O8D B;  2E2P A;  5E84 A;  1D8Y A;  4LF6 K;  4CK2 A;  1HRH A;  2VCP A;  1HQE A;  2F9W A;  3BF1 A;  3KIO A;  2BAN A;  2WFB A;  2IOC A;  4DTU A;  1BWF O;  3TAB A;  4JRQ A;  2HF4 A;  1YIJ N;  1SAZ A;  5EY4 A;  3M5R A;  3LPU A;  1BGX T;  2IS3 A;  3CCR N;  1RT3 A;  4OPH A;  5KPZ A;  3IAY A;  1ZBF A;  5HP1 A;  1SUQ A;  1TKZ A;  5BR8 K;  4JKH A;  2ASP A;  3AVN A;  2VG6 A;  3OYD A;  1JL2 A;  3AO3 A;  2P9S A;  4B9Q A;  2G8H A;  4KPY A;  1G99 A;  1BL3 A;  1QQC A;  3AVL A;  1C6V A;  2PYJ A;  3IDH A;  4DB3 A;  3VGL A;  1VQN N;  4FM2 A;  2WOM A;  1NGB A;  3AO1 A;  1NKB A;  4B3O A;  4PY5 A;  2P9S B;  5M1F A;  2WON A;  3T3F A;  1Q82 O;  3V4I A;  4CGF A;  1KFD A;  2KHO A;  1X9S A;  4MO5 A;  4E7H A;  2QWM A;  3AA4 A;  2DFH A;  4ID1 A;  4RW6 A;  4JS4 A;  4JKG A;  5AQH A;  3CER A;  5AQP A;  3SQ2 A;  3F9K A;  2P5O A;  4EP5 A;  2ZJQ L;  2XRI A;  4I9L A;  1NU0 A;  3QLH A;  4ZTF A;  5KI6 A;  4JKG B;  3HZ6 A;  4CK1 A;  2IVP A;  4B1X B;  1LWF A;  4DLG A;  4CD3 A;  3VET A;  1GOB A;  3TSU A;  3CCE N;  1IV0 A;  5TKW A;  1ZBH A;  2E1Y A;  4FK4 A;  3F5T A;  4E0D A;  5FRN A;  2PZS A;  2OPS A;  3CCS N;  1T8E A;  3SJH A;  4DFK A;  3M8S A;  3GOI A;  4BRD A;  3HJF A;  1QSY A;  4OGE A;  3ASM A;  4CCH A;  1VQO N;  3G10 A;  4CZE A;  1NM1 A;  4IG0 A;  1RBV A;  4PKI A;  4XH5 A;  4N76 A;  3SBG A;  2O8E B;  3R3L A;  3VF6 A;  2ETJ A;  1JLA A;  3HXM A;  3NE6 A;  5BRH A;  4LF7 K;  4BGA A;  1Q9X A;  1C0G A;  1WB9 A;  3A2F A;  2A40 A;  2HBM A;  4KHP K;  1KC8 O;  2NUB A;  4RW8 A;  1QSL A;  3TSQ A;  3LAM A;  1VK0 A;  3ATU A;  4FLU A;  4H5V A;  3NMU A;  3I56 N;  3SMS A;  3FFI A;  4CJ3 A;  1WSG A;  4BRO A;  3HST B;  3OYA A;  3VEW A;  2GX9 A;  3OY9 A;  4DU1 A;  3RMD A;  3U3Y A;  2JWK A;  4E1J A;  1X3M A;  1KAZ A;  2I7P A;  2BDP A;  4E3S A;  3TTD A;  4H5T A;  4DV2 K;  5B8H A;  1VQK N;  3HM8 A;  3G25 A;  3L8B A;  3MN6 A;  4A59 A;  1RDA A;  3PO5 A;  4EFH A;  2YV0 X;  3OYB A;  2O8F A;  1BU6 O;  1RGI A;  1S1X A;  4DHY A;  1VSD A;  2IIR A;  4BRN A;  3OYJ A;  3ZT3 A;  1W7A A;  4CJL A;  4AHS A;  3QEW A;  2O8F B;  4NLC A;  4BR0 A;  3V9X A;  2D1K A;  3V6D A;  4AIL C;  4CEZ A;  4JI2 K;  3N4P A;  3O08 A;  2FF6 A;  1TUU A;  3K5M A;  4HUE A;  3QML A;  1NGI A;  3KLF A;  3TSP A;  5AZJ B;  3OS2 A;  1DKG D;  3CF5 L;  4UY8 O;  4K0K K;  3V9S A;  1VSM A;  4PUO A;  5M1P A;  1Y64 A;  5AQL A;  3L4Q A;  3NF9 A;  3T1H K;  1HUX A;  2GUI A;  1KTQ A;  1T03 A;  4U67 L;  3JS6 A;  3PX0 A;  4KFB A;  1YF5 L;  4BRE A;  4O8U A;  4FJN A;  4DTO A;  4ZHR A;  5C12 A;  1X9W A;  4DSJ A;  3AA3 A;  4FWK A;  5HRO A;  3R9P A;  1EQY A;  4CGI A;  1C0F A;  4BRQ A;  4AHT A;  1N34 K;  3H3O B;  4B8C A;  3AVG A;  4FJL A;  3B8A X;  4CJ5 A;  2IVO A;  4C8L A;  3BF3 A; 
#chains in the Genus database with same CATH homology
 1CXU A;  3C95 A;  3NGZ A;  4EZ6 A;  3RRH A;  4FZZ A;  4DMN A;  4E7K A;  3HO1 A;  5JS1 A;  4CFC A;  1X1P A;  1KVB A;  3AO5 A;  3TWH A;  1CZ9 A;  4BE2 A;  4FCY A;  3VA3 A;  3G0Z A;  4DS5 A;  1IG9 A;  3AA5 X;  4O0J A;  1XWL A;  3O4N A;  2Z1I A;  2YHB A;  4RG8 A;  2FC0 A;  4CF1 A;  1RT2 A;  1RDD A;  3THV A;  4M3W A;  4B9V A;  2KFZ A;  4CJK A;  3SQ0 A;  2OPQ A;  5I42 A;  1TGO A;  1YVU A;  3SCX A;  3DLE A;  1WSF A;  2Y1I A;  4Z4G A;  4FLV A;  5C25 A;  4JLH A;  4KAZ A;  3MEG A;  1RTH A;  3ZSY A;  4AHC A;  4FJK A;  2QK9 A;  1TKT A;  1KVC A;  2VWK A;  3SUQ A;  2F96 A;  4QOZ B;  1BIU A;  1TVR A;  5SZT A;  1VRU A;  3EYZ A;  4KHS A;  3AVK A;  3QEP A;  3VA0 A;  3L2W A;  4CEO A;  4ELU A;  4LH4 A;  3B6P A;  1R0A A;  3TAE A;  3SYZ A;  3JYT A;  1DTQ A;  1L3S A;  3ZCM A;  2I5J A;  3QNO A;  4FZY A;  1S1W A;  2RF2 A;  4KRE A;  3C6U A;  1L3T A;  3DI6 A;  2YNI A;  3P83 D;  3OYH A;  4F4K A;  4EZ9 A;  4FXD A;  1B9F A;  1SV5 A;  1CXQ A;  3ZSZ A;  4BWJ A;  3SZ2 A;  4OGC A;  2HHU A;  3OYI A;  4LSN A;  1BCO A;  1NKE A;  2PYL A;  1NKC A;  2HMI A;  5CZ2 A;  3V1R A;  3ITH A;  4K8Z A;  3VQ9 A;  1TV6 A;  3SJJ A;  3T1A A;  1J5O A;  3LAL A;  2E6M A;  3OYM A;  3WNH A;  4W5T A;  4NCB A;  4FLW A;  3SNN A;  1JLF A;  5FRM A;  2O4G A;  3NH2 A;  3RRG A;  3NGI A;  3RWU A;  4Z0U A;  3DRP A;  1J54 A;  4NCG A;  4E19 A;  3PX6 A;  4ID5 A;  4NCA A;  1WSE A;  2GV9 A;  4CHZ A;  4AH9 A;  1ZBI A;  2B6A A;  4M3T A;  2ATQ A;  1BIZ A;  1LW0 A;  3I8D A;  3SPY A;  3SQ1 A;  4DTX A;  4E7L A;  3V81 A;  3RR7 A;  2EHG A;  3WNF A;  1L3U A;  3AV9 A;  2D0B A;  1UA0 A;  2HVH A;  4FJ8 A;  3VQ5 A;  3ZSX A;  4DSL A;  4GMJ B;  3M8P A;  1ZBU A;  3NDK A;  1WSJ A;  1C0T A;  1U04 A;  3AVF A;  3LPT A;  3ZT4 A;  1X9M A;  3ZT1 A;  4KHU A;  3HPH A;  3O3F A;  3PY8 A;  3LWM A;  4O0I A;  3K57 A;  3MEE A;  1EET A;  1RT4 A;  1LWE A;  3MEC A;  4CIG A;  2G8U A;  2DFF A;  1B9D A;  2ZQB A;  4KV8 A;  1W0H A;  1WAJ A;  3CFR A;  2R7Y A;  1S1U A;  4OPJ A;  3V9W A;  4E7I A;  4ZTJ A;  3E01 A;  4KTW A;  4OLB A;  3KK1 A;  4Z4F A;  4CFA A;  2HHV A;  4I2Q A;  1C1C A;  2RN2 A;  3F73 A;  3AVB A;  4KI4 A;  3OS1 A;  1C0M A;  1J9A A;  3OYN A;  3KK2 A;  3S3N A;  4KHY A;  3DLG A;  5E41 A;  1WSI A;  3LZJ A;  1GOC A;  5I3U A;  1ASV A;  2X78 A;  4M3R A;  1JLC A;  5HRS A;  3DOL A;  4I7F A;  1LAW A;  4LH5 A;  1RBU A;  3AVC A;  3NH1 A;  1HPZ A;  2G8W A;  2F8S A;  4CJF A;  1Z25 A;  4DS4 A;  4DTS A;  1BI4 A;  1W9H A;  1N6Q A;  2Z1G A;  1Y97 A;  2XHB A;  3V1Q A;  2X6S A;  2IAJ A;  3SUN A;  2G8F A;  4B9L A;  4YFU A;  1RTI A;  3K5L A;  3AO2 A;  1JL1 A;  5HRN A;  4FLX A;  3T19 A;  3OJU A;  1HNV A;  4DSI A;  4PWD A;  4HTU A;  5J2M A;  4DU4 A;  1BI4 B;  3WNG A;  3NH0 A;  2LSN A;  5HRP A;  1WN7 A;  4NYN A;  1VRT A;  1IKY A;  4CEA A;  3L2R A;  3RMA A;  1XC9 A;  1Q9Y A;  4Q0B A;  1JKH A;  3C94 A;  3VQ8 A;  4Q5V A;  3KD1 E;  4CJT A;  4LY7 A;  1Q8I A;  1QHT A;  3LAN A;  1JXE A;  3K58 A;  1S6Q A;  2PY5 A;  2HHX A;  3NGY A;  1B92 A;  1NK0 A;  4NYF A;  1YTA A;  4FJJ A;  3KKS A;  4AHV A;  3L3V A;  4DQI A;  4J2A A;  4O4G A;  1FXX A;  4I2P A;  3M8Q A;  3K59 A;  1ZYQ A;  1U49 A;  4I9Q A;  3VQD A;  4DLE A;  3ZT0 A;  1NK8 A;  1C1A A;  3IRX A;  4CJQ A;  1RT6 A;  5C24 A;  5J1E A;  1RTJ A;  3ZSV A;  1WAF A;  3CG7 A;  5J2N A;  4DSF A;  4W5O A;  3VQ7 A;  4CF2 A;  2Y1J A;  4FJ9 A;  1RBT A;  2YNF A;  4ICL A;  1WLJ A;  3S3M A;  3TAR A;  1LAV A;  4CJE A;  4BAC A;  1SKW A;  4B9U A;  4FK2 A;  4FLZ A;  3P1G A;  4KTZ A;  4CFD A;  3DMJ A;  3P5J A;  3KLE A;  2KQ2 A;  4IFV A;  4Y1D A;  1DLO A;  3ZSW A;  1BCM A;  3TR8 A;  1QSS A;  2B4J A;  3VN5 A;  3KKR A;  3QO9 A;  4CEE A;  4CHN A;  2YKN A;  4JS5 A;  4DU3 A;  2FBX A;  4DTN A;  3PX4 A;  3SI6 A;  1HQU A;  3OVN A;  1DTT A;  2HVI A;  3MED A;  4LSL A;  4CER A;  3QEX A;  4F3O A;  3LZI A;  4CJV A;  4HVJ A;  1NJZ A;  2IDO A;  3CYM A;  1SKS A;  1RBS A;  1HYV A;  4CF8 A;  3TAN A;  3VQE A;  3TAG A;  1IKW A;  3DYA A;  4CIF A;  1BHL A;  3KJV A;  2IGI A;  3ZSR A;  2D5R A;  2ZD1 A;  1EX4 A;  4FJG A;  3ULD A;  1RDC A;  1S9G A;  1CZB A;  4CF9 A;  1RDB A;  3VQB A;  4KRF A;  4W5N A;  3QIP A;  4DWI A;  4XIU A;  3SPZ A;  4ELV A;  2BE2 A;  4H8K A;  4IDK A;  4J2D A;  1JLB A;  1FKP A;  2GBZ A;  4KB0 A;  4FJ7 A;  2XY6 A;  1KVA A;  4O44 A;  4E1M A;  2RKI A;  2OYQ A;  4CJU A;  3QES A;  2O4I A;  3S9H A;  2YNG A;  4OPK A;  1RBR A;  1XHZ A;  1LV5 A;  4FZX C;  4E89 A;  1A5V A;  1SL2 A;  4F3T A;  3LP3 A;  3O4Q A;  3DLK A;  4Z4H A;  1BQN A;  1LWC A;  3S3O A;  1J53 A;  1TL3 A;  1S5J A;  4FW2 A;  4GVM A;  1UAX A;  5HRR A;  1UA1 A;  1NK4 A;  4DTJ A;  2HND A;  3C6T A;  1C0U A;  3HVT A;  4M3X A;  1RIL A;  3HYF A;  1WNS A;  4CES A;  5KRT A;  1VSF A;  2HB5 A;  2JLE A;  3NF7 A;  4DG1 A;  3BDP A;  4FK0 A;  3TAF A;  3WNE A;  5K14 A;  3KLH A;  3I0S A;  1TKD A;  4CGD A;  3OYK A;  1HJR A;  3RMB A;  3TAP A;  3SQ4 A;  2YHA A;  1ASU A;  2ITG A;  3OJS A;  1S9E A;  3IS9 A;  4C8M A;  3VQQ A;  3D45 A;  1SKR A;  2G8V A;  4DQP A;  1JLQ A;  4C8K A;  3K5N A;  1D8Y A;  4N47 A;  3ZT2 A;  4CK2 A;  3NFA A;  1HRH A;  3PUF A;  3KIO A;  1HQE A;  3CM5 A;  2BAN A;  1O1W A;  2IOC A;  2BGG A;  3HPO A;  4DTU A;  4FJH A;  4MQ3 A;  3TAB A;  3H08 A;  4JRQ A;  2HHS A;  1YT3 A;  2QKK A;  1GOA A;  1IO2 A;  1BGX T;  3LPU A;  1D5A A;  4B8A B;  1A5X A;  2IS3 A;  1RT3 A;  4H4M A;  3LWL A;  3IAY A;  4FYD A;  1HYS A;  5KRS A;  1ZBF A;  4KO0 A;  5HP1 A;  1SUQ A;  1LW2 A;  5EU7 A;  1TKZ A;  4CHP A;  3RMC A;  1RT5 A;  3D0P A;  3AVN A;  2VG6 A;  3CFP A;  3OYD A;  1HMV A;  1JL2 A;  3AA2 A;  4EP4 A;  3AO3 A;  3NF8 A;  2G8H A;  1T7P A;  4KPY A;  1BL3 A;  3VQP A;  4R5P A;  2X6N A;  1QQC A;  2VG7 A;  3AVL A;  1C6V A;  4TSX A;  3HP6 A;  2PYJ A;  3RR8 A;  2IC3 A;  4KHW A;  4M3Y A;  4FM2 A;  2WOM A;  3AO1 A;  1NKB A;  4B3O A;  3CFO A;  4PY5 A;  1U48 A;  1NK7 A;  1XHX A;  2P5G A;  2WON A;  1ASW A;  2P51 A;  4G1Q A;  2FBY A;  4RW9 A;  4HHT A;  3T3F A;  3RTV A;  3V4I A;  3TAM A;  1C1B A;  1VSK A;  1KFD A;  2B5J A;  1UOC A;  3HPG A;  4KKO A;  4CGF A;  3M8R A;  4CK3 A;  4E7H A;  1X9S A;  1L5U A;  4Z4I A;  4H4O A;  3MAQ A;  4CIE A;  3AA4 A;  5KTQ A;  4OJR A;  4HCC A;  4B9N A;  3NAE A;  2DFH A;  4ID1 A;  2OZS A;  1N5Y A;  4RW6 A;  4JS4 A;  2QXF A;  2YKM A;  3VQ6 A;  2Z1H A;  1FKO A;  2JGU A;  4IKF A;  2KFN A;  1BQM A;  3SQ2 A;  3HVR A;  3F9K A;  3V1O A;  4BE0 A;  2HHW A;  1REV A;  2P5O A;  3ISN C;  4EP5 A;  2XRI A;  4I9L A;  3QLH A;  1RTD A;  3CM6 A;  4ZTF A;  4M41 A;  4BE1 A;  5KI6 A;  4KI6 A;  5D3G A;  3L2Q A;  4DQR A;  1RT7 A;  4Z4C A;  4CK1 A;  4CGG A;  4DLG A;  1LWF A;  3OYL A;  4J2E A;  4PQU A;  4B9T A;  3KLI A;  4YNQ A;  2E6L A;  4MFB A;  3PV8 A;  1GOB A;  2DFE A;  5SWM A;  4GW6 A;  2W42 A;  3AO4 A;  4B9S A;  4FJM A;  5C42 A;  1HYZ A;  5DK5 A;  3HM9 A;  1ZBH A;  4FJI A;  3HP9 A;  4FK4 A;  4E0D A;  3CQ8 A;  3O3G A;  3JSM A;  1BIS A;  3HK2 A;  4DQQ A;  2PZS A;  5FRN A;  4HCB A;  2OPS A;  4PA1 A;  1KLM A;  1T8E A;  3BGR A;  1IH7 A;  2P1J A;  3OYE A;  4DFK A;  1JXB A;  3KTQ A;  4DSK A;  4KB1 A;  4W5Q A;  3M8S A;  3HJF A;  1D9D A;  5CY4 A;  1VSJ A;  1QSY A;  4OGE A;  1VSI A;  3ASM A;  4WE1 A;  4CJS A;  4CCH A;  3NHG A;  4BDY A;  2VG5 A;  3G10 A;  4BWM A;  4N5S A;  2OPR A;  4DTP A;  3MXM A;  4M3Z A;  3KLG A;  4IG0 A;  1RBV A;  1TAU A;  5HLF A;  4E1N A;  1WSH A;  4N56 A;  1TAQ A;  4CFB A;  1VSH A;  4C8O A;  4K8X A;  1S1T A;  4OKK A;  2XO7 A;  4OKE A;  1NK5 A;  3QET A;  4N76 A;  2ETJ A;  4DFM A;  1JLA A;  3HXM A;  1JLG A;  1JLE A;  5KGX A;  3LP0 A;  1I39 A;  3NE6 A;  2E4L A;  3ZSQ A;  2XY5 A;  1Q9X A;  4HUG A;  1CLQ A;  1A5W A;  1U45 A;  4CHQ A;  4IFY A;  1XI1 A;  3A2F A;  4DTM A;  4CF0 A;  4CED A;  2NUB A;  1RT1 A;  4RW8 A;  3U3G A;  1QSL A;  3V9Z A;  4KHN A;  2KTQ A;  3OYC A;  3LAM A;  2F8T A;  1VK0 A;  4FLU A;  3NCI A;  1I3A A;  1KCF A;  3FFI A;  5CYQ A;  4CJ3 A;  3UIQ A;  4CEC A;  4C8L A;  2VWJ A;  1WSG A;  2Z1J A;  1SL0 A;  3AVI A;  3HST B;  4DFJ A;  3OYA A;  1SL1 A;  3LDS A;  4L8R B;  4CJR A;  4FLY A;  1MU2 A;  3OY9 A;  4DU1 A;  3RMD A;  3U3Y A;  3OYF A;  3MXI A;  2FBV A;  4CJ4 A;  2BDP A;  3DRS A;  2OA8 A;  3LAK A;  1QS4 A;  3B6O A;  1S1V A;  2ZE2 A;  3NBP A;  5JS2 A;  4E3S A;  2KZZ A;  4CEQ A;  2A1R A;  3DLB A;  3AVM A;  5CYM A;  3ZSO A;  1UWB A;  4DTR A;  5J2Q A;  3L8B A;  4RW7 A;  4B08 A;  4CGH A;  3AVA A;  3KK3 A;  4J2B A;  5T7B A;  2HW3 A;  1RDA A;  4DSE A;  3PO5 A;  3SV4 A;  4CHO A;  2YV0 X;  3TAQ A;  1NOY A;  3DRR A;  2XY8 A;  4OKJ A;  3OYB A;  3V9U A;  4FM1 A;  2OPP A;  4N41 A;  4CEF A;  3IG1 A;  1S1X A;  2D0A A;  3U6F A;  4CJW A;  4W5R A;  1VSD A;  3OYJ A;  4FM0 A;  3SUO A;  4CHY A;  4F2R A;  4DFP A;  3ZT3 A;  1RCH A;  5DMR A;  1ITG A;  1U4B A;  1S6P A;  3DLR A;  4CJL A;  4AHS A;  3QEW A;  3LP1 A;  1T05 A;  4FW1 A;  1EP4 A;  4C8N A;  3VQC A;  3V9X A;  3NF6 A;  3V6D A;  4FJ5 A;  5FRO A;  3EY1 A;  4AIL C;  2OZM A;  1TK8 A;  4CEZ A;  3K5M A;  1KRP A;  4BDZ A;  3QIN A;  1QE1 A;  4HUE A;  2G8K A;  4RW4 A;  2A1S A;  3L2V A;  4O55 A;  3K2P A;  1EXQ A;  1TK5 A;  3LP2 A;  3KLF A;  1IKX A;  4FLT A;  1TK0 A;  3DOK A;  4OVL A;  4F2S A;  3L3U A;  4FJX A;  4HUF A;  1RNH A;  1NK9 A;  3PO4 A;  4M42 A;  2HHQ A;  3OS2 A;  4Z4E A;  4AHR A;  3I0R A;  3HL8 A;  2HNZ A;  3ALY A;  4UQG A;  4OLA A;  5CZ1 A;  2HHT A;  1NJW A;  3OYG A;  4M45 A;  2KZM A;  1NJX A;  3SUP A;  1EKE A;  4QAG A;  4CE9 A;  3V9S A;  3QNN A;  4F8R A;  2DY4 A;  2FBT A;  4O5B A;  1VSM A;  4FVM A;  4DF4 A;  4PUO A;  3QEI A;  4KTQ A;  2X74 A;  3OS0 A;  4IBN A;  1NOZ A;  3HT3 A;  1KLN A;  3DM2 A;  4LD0 A;  1U47 A;  1KFS A;  3DLH A;  4M3U A;  1TL1 A;  1L3V A;  2DTU A;  4ELT A;  4E7J A;  3NF9 A;  4Y1C A;  1KSP A;  2GUI A;  2QKB A;  1KTQ A;  1T03 A;  1IKV A;  2XY7 A;  1ZBL A;  5J2P A;  3VQA A;  4CEB A;  3KD5 E;  1D9F A;  3QER A;  1Z26 A;  2HNY A;  4AHU A;  3PX0 A;  4KFB A;  4QCL A;  3AVH A;  1FK9 A;  3K5O A;  4JRP A;  2AJQ A;  2KW4 A;  3SV3 A;  2RPI A;  4DF8 A;  2YNH A;  1F21 A;  5FDL A;  1K6Y A;  3VQ4 A;  4FJN A;  4DTO A;  4ZHR A;  1X9W A;  4DSJ A;  2EX3 A;  1TKX A;  2D0C A;  3AA3 A;  4B9M A;  5HRO A;  4CGJ A;  4CGI A;  2Q3S A;  1YTU A;  4IG3 A;  4CJP A;  2G8I A;  1VSE A;  4AHT A;  3O3H A;  1G15 A;  1HNI A;  4DQS A;  3L2U A;  1VSL A;  3QEV A;  4B8C A;  3AVG A;  4FJL A;  4KHQ A;  1NK6 A;  3EZ5 A;  1NJY A;  3TI0 A;  4CJ5 A;  3AVJ A;  5KGW A;  3MXJ A;  4BDP A;  1QTM A;  5HBM A;  3QIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...