2RN2A

Structural details of ribonuclease h from escherichia coli as refined to an atomic resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Structural details of ribonuclease H from Escherichia coli as refined to an atomic resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase(endoribonuclease)
total genus 51
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1992-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2rn2A00
1TKXA 4GVMA 4KTQA 3DRPA 4Y1DA 1RT7A 4O55A 3OYIA 1X9WA 1Z25A 3NAEA 3TABA 1BI4B 2XRIA 3L3VA 1Q9XA 4AHTA 3L2QA 1BHLA 1ITGA 2X6SA 1S1UA 3VQ6A 4DMNA 3TI0A 3V1QA 3LWMA 5JS2A 3ZT2A 3MECA 4FJKA 5CY4A 4DQQA 2KZMA 4F3OA 3OS1A 3FFIA 3PUFA 3VA0A 2D5RA 3QO9A 4E89A 1NK6A 3MAQA 3G10A 5CZ2A 1SL1A 3LAMA 1ASUA 3CYMA 1GOBA 1D8YA 3KLGA 1VSLA 1RCHA 2ATQA 2NUBA 5HRPA 4TSXA 3NCIA 1ZYQA 1BISA 1HNVA 2IS3A 4OJRA 1YTAA 2HNYA 4CJEA 1HQUA 1CZBA 1YT3A 3V9UA 2O4GA 4RW7A 1JLBA 4CJVA 3SQ4A 2ETJA 3ZSVA 1TAQA 4OKKA 5CYMA 4FJXA 3SV4A 3SJJA 3SYZA 1RDCA 5HROA 3NFAA 1XHXA 3QETA 1X9MA 3B6OA 3AVIA 2FBTA 2JLEA 3JSMA 4DQRA 5CZ1A 4C8MA 4CE9A 5DMRA 3TAEA 3RR7A 3C94A 1Y97A 4HCCA 4IKFA 5FROA 1BCOA 3CM6A 4RW6A 1C1BA 4QOZB 2HNDA 1S1TA 3S3MA 3TWHA 4Z4GA 2KFZA 4HUGA 1JLGA 2A1SA 1A5VA 4CJ5A 2HHXA 3NE6A 3P1GA 3K5OA 1BGXT 1I39A 1D5AA 3ZSWA 5KRSA 1CZ9A 1QQCA 1L5UA 4B9VA 2QKKA 3DLGA 3IG1A 1T05A 4H8KA 4RW4A 3AVBA 1KVAA 1TK8A 4BDPA 4M45A 2HW3A 1JL2A 4IDKA 4LSNA 4FM1A 2GBZA 4DG1A 1RBVA 4Z0UA 4CEEA 3QLHA 2G8IA 1U04A 3BGRA 3ITHA 4M3WA 1KFDA 5EU7A 3ZT0A 4CHNA 3AVKA 4DWIA 1T7PA 4CK1A 2HHWA 3VQ4A 3AO3A 5I3UA 3V1OA 4J2AA 1JXBA 2KQ2A 3NH0A 4M3ZA 3OYEA 3TAPA 4H4OA 3THVA 1KSPA 1QSYA 4ELUA 4CEQA 1LWEA 3AO5A 3RTVA 1HRHA 5KRTA 2Q3SA 3RRGA 4CJ3A 3RMAA 1SKWA 1FXXA 1HPZA 3ZSQA 2Z1GA 4FM2A 2ZE2A 2G8KA 1RBTA 1J53A 1RT2A 4DQSA 3U6FA 4B9LA 1LAWA 4HUFA 1S1XA 2B5JA 2W42A 3K59A 3HL8A 1VSFA 5J2NA 1WAFA 3F73A 4ELVA 4IG3A 2YNGA 3V6DA 3LWLA 1FK9A 3L8BA 4DSEA 3S9HA 1IKXA 1Z26A 2EHGA 2P5GA 4CFBA 4E1MA 1NKEA 3LPUA 4EP4A 3L2UA 3T3FA 4FVMA 3KLIA 1ZBUA 3HT3A 4DF4A 4M3XA 4JS5A 4I7FA 4M42A 2HHQA 1UWBA 3NF9A 1YTUA 2PY5A 1HNIA 5KTQA 4Z4HA 4PWDA 1VK0A 2X6NA 4FYDA 1YVUA 1BI4A 5C42A 5HRNA 1ZBHA 1NK0A 2OPPA 1KTQA 4KAZA 3M8RA 5J2MA 1ZBLA 2KTQA 4OGEA 2FBYA 4CERA 4DFPA 1UAXA 2OPQA 5FRNA 3LP3A 4FK2A 4CEZA 4Z4CA 2YV0X 3AA4A 1KCFA 3NDKA 4J2DA 1N6QA 4GMJB 2YKMA 3U3YA 2BGGA 4Q5VA 4CGJA 3CFRA 2YKNA 1NK5A 1W9HA 4C8LA 2P51A 1DTTA 1ZBIA 1NOYA 4B8AB 5I42A 3QINA 4O5BA 1DTQA 2DY4A 4DFMA 3I0RA 4CK2A 3QNNA 5KGWA 4N56A 4FZXC 4CF9A 3V9WA 1NJWA 3UIQA 1RTHA 3VQDA 1C1AA 3LZIA 2OZMA 4OKEA 4IBNA 4RG8A 2OZSA 3WNEA 1S9GA 1VSIA 4CGIA 3RRHA 3MEDA 3LP1A 1KVCA 1VSKA 3KK2A 4KREA 4F2RA 3DOKA 2GUIA 3QEWA 2HHUA 3U3GA 3VQQA 4CIEA 3MEGA 3ZT4A 3ZSYA 5SZTA 4WE1A 4DLGA 1X1PA 1T03A 1NK4A 4CJPA 4KTZA 4LY7A 4N41A 4CIFA 2VWJA 2D0AA 1VSDA 1QHTA 3PV8A 1J5OA 4Z4IA 5DK5A 1GOCA 4F2SA 2E6MA 3LP2A 1TKTA 3VQBA 3TAMA 4AHVA 3ULDA 2E6LA 1SL0A 4B9MA 4DTUA 5T7BA 2F8TA 4DU1A 3KLHA 1JLQA 2R7YA 4FLUA 4DSLA 4FJ9A 4E3SA 1RTDA 1KLNA 1C1CA 1KFSA 2RPIA 4CJWA 1NJZA 1VRTA 1J9AA 2VG7A 4OKJA 1WAJA 1ASVA 3EYZA 4DTMA 2QKBA 3AVLA 1RT1A 4CHPA 3KLFA 1L3TA 1D9DA 1SV5A 2B6AA 4M3TA 3OYBA 3OYJA 2QXFA 3HO1A 1CXQA 3D0PA 3AA2A 3DLRA 3L2RA 4CK3A 2G8VA 4FJJA 2HHVA 1XC9A 3PO4A 2OPRA 4DTSA 2HNZA 3ZT3A 1A5XA 4Y1CA 4DU4A 2XY6A 3ZSOA 3T19A 4B3OA 3HJFA 1FKPA 4R5PA 4E7LA 3SPZA 2ITGA 3LANA 4RW9A 2F8SA 4G1QA 4KRFA 3AVCA 2G8UA 1IO2A 3S3OA 1BQNA 1HYZA 3QEXA 1LWCA 2G8WA 4EZ9A 3DMJA 4CIGA 3SZ2A 1RTJA 3S3NA 4CF2A 4K8ZA 1SL2A 3MXMA 2HMIA 4NCBA 3HYFA 3O4NA 4FJ7A 4KTWA 4B8CA 3EY1A 4IFVA 4OGCA 3V9SA 4DS5A 4CECA 3SUNA 1VSMA 4B9TA 3CG7A 4NCGA 4BACA 3V9ZA 4KV8A 1K6YA 4FJ8A 2XHBA 3KTQA 3NH2A 4ZTJA 4ID1A 1ZBFA 4CJUA 3AVGA 3CFOA 1NJYA 4HTUA 3E01A 3AVJA 4B08A 3OJUA 4FLXA 3PX4A 2YNFA 1LAVA 3MEEA 3HK2A 1U45A 1GOAA 3ALYA 1G15A 3CQ8A 4OPKA 3MXJA 5FRMA 2DFEA 3NGZA 1CLQA 2OPSA 1JLAA 4C8NA 1RDAA 4O4GA 1IH7A 1S1VA 4CHYA 4FW2A 2JGUA 4CJRA 1EX4A 4CFCA 2VG5A 3NF6A 2I5JA 3ZSXA 4HUEA 1NJXA 3C6UA 4DQIA 3QEIA 1C0TA 5KGXA 2A1RA 3HPHA 2ZD1A 1RDBA 4IG0A 1KRPA 3KK1A 3ZSRA 4F8RA 2P1JA 2Y1JA 4NCAA 1LWFA 3ISNC 3SV3A 3OYAA 2KZZA 3AO1A 3M8SA 3PY8A 3RWUA 3HSTB 3WNHA 3HP9A 2X74A 4DTOA 1TL3A 1TKDA 1JLEA 4E0DA 4KHWA 4MFBA 3OYKA 3RMDA 1NK8A 1KLMA 5HP1A 4Z4FA 1C0UA 4FK4A 4CEAA 2X78A 4C8KA 2PYLA 2QK9A 3L2WA 1U47A 3SUQA 1RT6A 3AV9A 1XI1A 4N76A 4KB0A 4NYNA 1W0HA 1QSSA 1VSJA 3DLEA 3KLEA 4FCYA 1HMVA 3QIOA 4KHUA 3DLKA 3KKRA 4E7HA 4HVJA 4FJGA 4CJ4A 3OYCA 4FLTA 2XY5A 4BDYA 1S1WA 3IRXA 1RT4A 5C24A 4H4MA 3VQAA 1L3UA 4FZYA 3AVMA 1NK7A 5D3GA 3KIOA 3VQCA 3T1AA 2PZSA 4KI4A 3B6PA 4DS4A 2BANA 3G0ZA 2FBVA 3K5LA 3OS0A 1IKVA 2FC0A 4W5OA 3OYLA 4CF8A 3SUPA 3HVTA 4CGFA 2YHAA 4JS4A 3AO4A 2XO7A 5J2QA 2FBXA 3NGIA 4YNQA 3A2FA 4I2PA 3AVHA 2OYQA 4FZZA 2BE2A 1I3AA 2Z1HA 1ASWA 1BIZA 3K2PA 4PA1A 3OYGA 1S9EA 4MQ3A 1A5WA 1WSEA 3QERA 1TL1A 4J2EA 4FJLA 4LD0A 3VQ8A 2IOCA 4CHQA 4FLVA 1L3VA 3DLHA 3RR8A 2XY7A 4DFKA 1RTIA 4NYFA 3K57A 3LALA 3L2VA 3SQ0A 4CJQA 4PQUA 3DRSA 2HVHA 2DTUA 3DI6A 4I2QA 3K58A 5HLFA 1T8EA 1RT3A 3I8DA 4CEFA 3OJSA 2IAJA 4CGDA 4CF1A 4FJMA 3NGYA 4RW8A 3ZCMA 3OYHA 3DRRA 3KD1E 1EP4A 1KVBA 4LSLA 3LAKA 4DF8A 3OY9A 1JKHA 4F3TA 2F96A 3NBPA 4I9LA 3QIPA 3ZSZA 4O0IA 2DFHA 4O44A 2WONA 3LPTA 4E7KA 3WNGA 4DTXA 4FXDA 1TK5A 4FJHA 4K8XA 3NF8A 4M3RA 1BL3A 1EXQA 1JLFA 4CHOA 1HYSA 4M41A 4N5SA 5J2PA 3SCXA 4DFJA 4DSIA 1WSIA 2G8FA 3OYNA 4M3YA 4CCHA 5FDLA 1XHZA 2Y1IA 3DM2A 1C0MA 3EZ5A 4DSKA 2RN2A 3AO2A 4QCLA 3DOLA 1NOZA 1TK0A 2P5OA 3O4QA 4E7JA 2HHTA 4FLWA 2Z1JA 3VQPA 4ELTA 3TANA 2B4JA 3HP6A 3V1RA 3LP0A 2IDOA 5JS1A 1VSEA 5CYQA 3DLBA 4KHYA 4PUOA 1HJRA 2HB5A 4AH9A 2G8HA 2RF2A 1TVRA 2RKIA 3M8PA 3V81A 4J2BA 1JLCA 4I9QA 4CGHA 1DLOA 4BWMA 4KI6A 1RILA 3SQ2A 4N47A 2ZQBA 4JRPA 1WNSA 4BE1A 4DTPA 3CM5A 4FW1A 1IG9A 3MXIA 4HCBA 3RMBA 3OYFA 1D9FA 1WSFA 1N5YA 2EX3A 1BIUA 4AHRA 4FLZA 4AILC 2BDPA 1LW2A 3NF7A 3RMCA 1F21A 4FJ5A 4DQPA 4CJSA 4FM0A 3SI6A 4KPYA 3AVAA 1TAUA 4CJTA 4DTRA 4ID5A 4KB1A 4OLAA 4HHTA 4Q0BA 3O3FA 3VQ9A 4CEDA 3PO5A 2KFNA 1JL1A 4E7IA 2VWKA 4KHQA 4QAGA 3KJVA 3O3GA 1WSJA 4B9NA 4KHSA 3SUOA 1HYVA 4IFYA 3HPOA 3AVFA 3PX6A 1LV5A 4ZTFA 4DSJA 1O1WA 3P83D 3QEPA 2D0CA 4CJFA 4B9UA 1RBUA 4FLYA 3HXMA 3LDSA 1QTMA 1TGOA 3OYMA 4FJIA 3ZT1A 2HVIA 3F9KA 1U49A 4BDZA 3HVRA 1IKYA 1B9FA 3AA5X 2XY8A 1SUQA 4W5RA 5KI6A 3TR8A 4E19A 4DLEA 3IS9A 3OYDA 4GW6A 3HM9A 1UOCA 4PY5A 3NH1A 2D0BA 1EETA 1TV6A 3KKSA 2VG6A 1RNHA 4LH5A 1S5JA 5HBMA 1UA0A 4CFDA 5C25A 1Q9YA 1TKZA 1B9DA 4OLBA 1NK9A 1BCMA 4DTJA 1UA1A 3P5JA 4EP5A 3QESA 3KK3A 4YFUA 3VQ7A 3TAGA 3BDPA 1L3SA 4B9SA 3TARA 3I0SA 3IAYA 4BE0A 1XWLA 5K14A 3V9XA 3NHGA 1SKRA 5HRRA 5J1EA 4CFAA 1NKBA 3CFPA 2E4LA 1R0AA 3D45A 2AJQA 1C6VA 4KKOA 1U48A 2DFFA 4E1NA 2LSNA 4W5QA 2YHBA 1U4BA 4M3UA 2PYJA 2Z1IA 1VRUA 3VQEA 4BWJA 3QEVA 1QE1A 4OPJA 2HHSA 1VSHA 4ZHRA 2YNHA 3AVNA 4W5NA 4JLHA 4C8OA 3OS2A 4CEBA 1RBRA 4ICLA 3VQ5A 1JXEA 4FJNA 3M8QA 1WLJA 1HQEA 4W5TA 4KO0A 3SQ1A 3ASMA 4CGGA 4AHCA 3TAQA 2GV9A 2IC3A 1S6QA 5E41A 4Z4EA 4CHZA 4EZ6A 4UQGA 4DU3A 3AA3A 3K5NA 1WSHA 1IKWA 3HPGA 5SWMA 3PX0A 4L8RB 1EKEA 1X9SA 4CJKA 1J54A 5HRSA 3C95A 1B92A 2WOMA 1BQMA 3KD5E 3LZJA 3JYTA 1QSLA 4CEOA 4CF0A 4JRQA 1WN7A 2OA8A 3TAFA 4LH4A 4CESA 1RDDA 4KHNA 1LW0A 3QNOA 1FKOA 1SKSA 1QS4A 3SNNA 1S6PA 3WNFA 3VA3A 3VN5A 4DTNA 3SPYA 1Q8IA 2KW4A 3O3HA 4AHUA 4DSFA 3C6TA 3V4IA 4FK0A 2O4IA 3H08A 3K5MA 1RBSA 4O0JA 1MU2A 1NKCA 4AHSA 2YNIA 3DYAA 4F4KA 4KFBA 1CXUA 1RT5A 3OVNA 2IGIA 4XIUA 4OVLA 3L3UA 1REVA 4BE2A 4CJLA 1WSGA
chains in the Genus database with same CATH superfamily
1BWFO 4GVMA 1D4XA 3MN9A 4O55A 3TABA 4BRQA 1YI2N 3JS6A 3R3LA 2D0PA 3LWMA 4DQQA 1YIJN 3O9QA 3PUFA 3VA0A 4E89A 3B8AX 3MMVA 5F0XA 1GOBA 3OA9A 3NCIA 5HRPA 1ZYQA 1HNVA 4OJRA 3IDHA 1YT3A 1CZBA 3GE1A 3SQ4A 2ETJA 4OKKA 4PKIA 4YDUC 2A40A 3B6OA 4BR2A 4C23A 2RE2A 3TAEA 3C94A 4IKFA 3CM6A 4RW6A 4JKHA 4QOZB 3S3MA 1S1TA 3D2EA 4HUGA 2HHXA 3CCQN 5C2FA 4DV1K 3D7EO 2JWLA 1CZ9A 1QQCA 1YHQN 3IG1A 4RW4A 3AVBA 1KVAA 5BRDA 2GBZA 4DG1A 1RBVA 2VGMA 2W41A 4CEEA 3MX5A 3TSUA 3VEWA 4BRHA 4CHNA 3ID6A 4CK1A 2HHWA 3AO3A 2ASMA 1JXBA 5C12A 2KQ2A 1WB9A 4WQ5A 1GLJO 1LWEA 3QBXA 1HRHA 5GAHP 5B8HA 1HPZA 4DV6K 3J7YP 4DQSA 1RT2A 3U6FA 4JI4K 1BA1A 3M5RA 4DHYA 3CMAN 2ZWHA 3K59A 1WAFA 4IG3A 1LCUA 1IKXA 3O1BA 2EHGA 4CD1A 3HI0A 4YORA 5ADXA 2WC9A 4DF4A 4JS5A 4I7FA 4M42A 1UWBA 3VGLA 4H5VA 4Z4HA 4PWDA 1DKGD 1YVUA 1ATNA 4WFNL 1KC8O 3M8RA 4CERA 2YX6A 4CEZA 2P9NB 3UE5A 4IDHA 3G25A 2O8CB 5GINA 2HF4A 2ZGZA 2UXDK 2BGGA 1VQ8N 1QZ5A 5GIOA 1W9HA 4C8LA 1DTTA 1ZBIA 5JICA 3KZBA 1ZC6A 1W2BM 1DTQA 3CJAA 5KQ8A 4CK2A 4JI6K 5KGWA 1NG9A 4CF9A 1NJWA 3UIQA 3J7ZO 3RVCA 5BPLA 2QEXN 2UUBK 2OZMA 4OKEA 4DUZK 4IBNA 3RRHA 1KVCA 3VEYA 3DOKA 2GUIA 3QEWA 2HHUA 4CIEA 3MEGA 1GLLO 3O6WA 3ZSYA 1N34K 4WE1A 4EIAA 4X65K 4KTZA 4BR4A 2VWJA 3PV8A 4Z4IA 2P9IA 2E6MA 3VQBA 3HSCA 3ULDA 1X9JA 2E6LA 2F8TA 5CR4A 5T7BA 4JAXA 3KLHA 5KPTA 4DSLA 4FJ9A 3KK7A 1C1CA 4KH5A 1KFSA 4C1NI 3THXB 2F7TA 1D9DA 1WUAA 3OYBA 1CXQA 3AA2A 4B3SK 2G8VA 4I6MB 4DTSA 1OKJA 1RDWX 3T19A 1FKPA 4R5PA 4E7LA 3SPZA 2ITGA 3F2KA 2F8SA 1LOTB 1V4TA 4Z94A 1HYZA 2CGKA 5EVZA 4EZ9A 4A5AA 4JEPA 3ZETA 3VESA 1HNXK 4GNIA 2ZJRL 3V9SA 3J80O 1YITN 3J81O 3C65A 4FJ8A 2XHBA 4JKGB 4ID1A 4CJUA 4B9QA 3UB5A 3ALYA 5AZIB 2DFEA 2YJEA 3SLCA 2GWKA 2NRWA 1S72N 4O4GA 1IH7A 4CHYA 4FW2A 2JGUA 2O8EB 4HUEA 2ZD1A 4IG0A 3KK1A 2HBKA 5AQIA 3W3DA 3AO1A 1Q81O 4E0DA 4KHWA 3OYKA 1KLMA 5HP1A 4Z4FA 1C0UA 4DR1K 3P4IA 3AV9A 4KB0A 4FL9A 3KLEA 4B1YB 4KHUA 3DLKA 5LL6Z 2UYTA 2GWJA 3VQAA 1EWQA 3ZX0A 5D3GA 3CCJN 3U9DA 3QB0A 4ILHA 3OS0A 4WQ5C 4CZKA 4OPHA 2Q2RA 4JS4A 2YHAA 2FBXA 3NGIA 4BRMA 3A2FA 4I2PA 3VTHA 3A5LC 1I3AA 2Z1HA 1VQ5N 3L4IA 3GL1A 1M1KO 1L3VA 3DLHA 4K43A 1K8AO 4NYFA 3K57A 1TUYA 1GLFO 2W6LA 4CJQA 3DI6A 4CF1A 5I9EB 5DM6L 4IOXA 1RFQA 4LSLA 1YAGA 4F3TA 2VQFK 3CMEN 3K9KA 3AGRA 4O44A 3LL3A 5BN8A 4DTXA 4YY3K 4BRIA 1TK5A 4CHOA 4CZEA 4N5SA 4DFJA 4M3YA 5FDLA 1XHZA 4DV4K 3EZ5A 4DSKA 2RN2A 2ITMA 3WXMB 1TK0A 2HF3A 1GLBG 3VQPA 4ELTA 2B4JA 3HP6A 3LP0A 2IDOA 4DUYK 1S3XA 4DB3A 3O08A 3RMBA 1WSFA 2EX3A 4AILC 3IUCA 1E4GT 2ZF5O 4DCHA 3AVAA 1TAUA 4H5NA 4ID5A 3ATUA 5JMVA 2NRZA 3EE9A 3TSPA 3VQ9A 4K0KK 1JL1A 4KHQA 1CZAN 1WSJA 4IFYA 2W6KA 2P9UB 4CJFA 4FLYA 3HXMA 4FJIA 2E2OA 1IBMK 4JKDA 4DV3K 1IKYA 3P31A 3H3NO 1BA0A 3EL2A 3KHYA 3TR8A 4Y0WA 2PFUA 1RNHA 4J8FA 3ULEB 4JI2K 5C25A 4OLBA 1BCMA 1M90O 3VQ7A 3BDPA 3I0SA 2P9LA 1XWLA 3CJBA 5J1EA 4CFAA 2A3ZA 5C0YA 4KKOA 2WFBA 4E1NA 4W5QA 2YHBA 4M3UA 2Z1IA 3MCAB 4BWJA 3W0LA 4CZHA 1U6ZA 3DWLA 4CEBA 5AQXA 4FJNA 3G4SN 4KO0A 2IC3A 1HJOA 1YVNA 4FOEA 5LJWA 1VQ9N 4X62K 1P90A 2O8FB 2WBNA 4FPAA 1QSLA 3NVKA 4CEOA 4JRQA 1WN7A 4IEIA 4CESA 1FKOA 4KHPK 1SKSA 4DR2K 3C0BA 4FWOA 3SPYA 4M3TA 1Q8IA 2KW4A 3C6TA 3H46O 3EKUA 4KFBA 1ATRA 1CXUA 1BO5O 3BZCA 4F8RA 4KTQA 3DRPA 1RT7A 4PKHA 4R79A 1NM1A 1HKBA 1Q9XA 3UKUB 3L2QA 1FJGK 3H6EA 2EWSA 3VQ6A 3V1QA 5JS2A 4DV5K 3E1YA 5CY4A 4YOYA 2KZMA 4JNEA 2D5RA 3BF3A 3QO9A 5FPNA 3FZLA 4BRDA 5CZ2A 1ASUA 3CYMA 5JVHL 1VSLA 1HKGA 3VEZA 3F5TA 1N36K 2IS3A 1BOTO 2FXUA 2E2NA 4RW7A 1JLBA 3TTFA 4FPBA 3H1VX 4A57A 3SJJA 3SYZA 1RDCA 3SBGA 3EEQA 1X9MA 1HUXA 3AVIA 4CD3A 2FBTA 2JLEA 4CE9A 3DJCA 5FROA 3BP8A 1C1BA 1VHXA 4O5FA 4BC3A 2A41A 2KFZA 3M3ZA 2A1SA 1A5VA 3MDQA 3K5OA 5AQRA 2RHKA 1L5UA 5FPDA 4B9VA 3DLGA 3DLLL 2V52B 1TK8A 2HW3A 3BUZB 4LSNA 4DR4K 3BGRA 5M1PA 3VTIA 3ZT0A 4DWIA 3VQ4A 4H4OA 3THVA 3JAMO 2UUCK 3AO5A 3RTVA 3RRGA 4CJ3A 3RMAA 1SKWA 1FXXA 2PBDA 1VQMN 4GV9A 1RBTA 4WFAL 3I8BA 3MX2A 4ELVA 2P9SA 1FK9A 4XEIA 1W7AA 1VQNN 3L2UA 3KLIA 1ZBUA 2OANA 5AFUH 1KD1O 2X6NA 3WXKA 4FYDA 1HNWK 3LM9A 5C42A 4NXMK 4KAZA 4NXNK 2KTQA 4OGEA 2FBYA 3O80A 4DFPA 1MA9B 4FK2A 1NLVA 1GLDG 3CC7N 1T3VA 1N6QA 3KVGA 3U3YA 5AQSA 3U8XA 1NK5A 4CVNE 3QINA 2DY4A 3CCRN 4LF5K 3VENA 4FZXC 3V9WA 2FSJA 2KLAA 4FWRA 5AQZA 4XH4A 4E1JA 3SJHA 2OZSA 3MEDA 4KREA 1Q18A 4F2RA 3U3GA 3VQQA 3ZT4A 3MWPA 2NRTA 4DLGA 5BR8K 3CC2N 2HOEA 1VQON 1MDUB 3U4LA 3FR0A 3TAMA 4B9MA 4DU1A 3D2FB 4FLUA 2AP1A 4E3SA 3OHRA 3R8EA 2VQEK 2RPIA 5E26A 1VRTA 1J9AA 3EYZA 4CBUA 1RT1A 1L3TA 3ID8A 3VEVA 1SV5A 2B6AA 2ZJPL 3THYB 3HO1A 3D0PA 2A6AA 4FJJA 2NRVA 2HNZA 1A5XA 4Y1CA 5BPMA 5BN9A 4G1QA 5EY4A 5M1OA 1BQNA 3UKRB 4BRLA 2G8WA 3DMJA 4CIGA 4JI3K 3S3NA 4CF2A 3GDQA 4NCBA 2HMIA 3HYFA 4IFVA 3FZMA 3CCEN 4B1XB 4NCGA 4XH5A 2Q97A 2PAVA 3VPZA 3VOVA 1KAYA 3NH2A 1NJYA 4OX9K 1J5EK 4HTUA 5AQKA 4FLXA 3OJUA 3PX4A 2YNFA 2NRRA 4EHUA 1G15A 2FSNA 1CLQA 1RDAA 2P9NA 2YI1A 2F9WA 4YOWA 2P9KB 2VG5A 2I5JA 2O8CA 4QS8A 4DQIA 1C0TA 1RDBA 5AQQA 1ZXOA 3ZSRA 2YHXA 3SV3A 2KZZA 3OYAA 3WNHA 1TKDA 4DTOA 1T44A 4C8KA 2X78A 2QK9A 2YCHA 3SUQA 1RT6A 1XI1A 4NYNA 3LDLA 1VSJA 4FCYA 2E8AA 3KKRA 3M1FA 4E7HA 4FJGA 4FLTA 2XY5A 3IRXA 2QWRA 1L3UA 4H4MA 2QWLA 3L6QA 4FZYA 1NK7A 1ILYA 2OTJN 3KIOA 3VQCA 1HX1A 2AA4A 2NRHA 3T1AA 5C2DA 4KI4A 3B6PA 2BANA 3NVMA 2O8DB 4H0PA 1IKVA 2FC0A 4W5OA 3O8MA 4CF8A 3OYLA 3SUPA 5JLFA 3AO4A 5J2QA 4BG9A 2OYQA 1ASWA 4IZ9A 4PA1A 3THXA 3R9PA 2GX9A 3QERA 1NJIO 4FJLA 4CHQA 3VQ8A 4FLVA 4BG8A 3RR8A 4LFBK 2O8BA 1RTIA 3CD6N 4ISEA 4JD2B 3L2VA 4PQUA 2FF3B 4I2QA 3K58A 5HLFA 1RT3A 2E2PA 4I6MA 1QHAA 1SQKA 1IV0A 1DT9A 3OYHA 4NLCA 2FF6A 3LAKA 3NBPA 4XH1A 2WONA 3LPTA 3WNGA 4NO7A 3VETA 1BL3A 1EXQA 1JLFA 5J2PA 3SCXA 4DSIA 1WSIA 2G8FA 3SAGA 4JI5K 4CCHA 2GUPA 2Y1IA 3DM2A 1C0MA 3ENHA 4JKGA 4BGAA 4RWTA 1HNZK 4E7JA 4IFEA 4FLWA 1RGIA 2Z1JA 3V1RA 3J7AP 1VSEA 3QDKA 4WQ4A 4CBXA 3DLBA 5AZIA 4PUOA 1HJRA 2O8BB 2G8HA 2RKIA 4JKCA 4J2BA 1JLCA 4MLEA 4I9QA 3CF5L 3QICA 4BWMA 2O8EA 4KI6A 1RILA 3SQ2A 3Q7CA 4JKBA 4BRAA 2VYPA 3HOSA 3PLAA 4PHTX 1F21A 1K8KB 1BG3A 2Q36A 4OLAA 4KB1A 1E4FT 3I33A 3O3GA 3SUOA 1BUPA 3PX6A 1O1WA 3P83D 4NLBA 3QEPA 3LDSA 3OYMA 3T1HK 3EN9A 3ZT1A 2OCEA 2HVIA 1U49A 4BDZA 1NWKA 1QQNA 3VGKA 4W5RA 4MDBA 1OH8A 5KI6A 4H5WA 4A5BA 3IS9A 1UOCA 3NH1A 2P9PA 2D0BA 4JI1K 5JLHA 3KKSA 4LH5A 1S5JA 3A8YA 4IJNA 1B9DA 4FOIA 5M1KA 1QQMA 3P5JA 4EP5A 4YFUA 4JK9A 4U67L 3V9XA 3NHGA 1NBWA 3CFPA 2E4LA 3A5MC 3D45A 3QFPA 4PL7A 1U48A 2LSNA 1U4BA 3TSQA 1N8RO 1GLEG 4JV5K 1BU6O 4OPJA 2HMPA 3MN5A 2QWPA 2IIRA 1RBRA 1NGDA 3IKMA 4CZIA 1JXEA 1KAXA 1WLJA 1MWMA 2OTLN 4AHCA 4YHHK 3VERA 2GV9A 4CZMA 2P9PB 4V19S 4EZ6A 2HBMA 3AA3A 3K5NA 1WSHA 4BC5A 2Q0RA 2UXBK 4CJKA 3KD5E 3C95A 3DAWA 4YOVA 5CHIA 3LZJA 3JYTA 3O9SA 3TAFA 1MWKA 2VGNA 1QS4A 3T1YK 3VA3A 1OH7A 4FK0A 4L3QA 2O4IA 3H08A 3K5MA 3O4WA 1EWRA 2GELA 3DYAA 1KQSM 4F4KA 1RT5A 3SMSA 4BE2A 4CJLA 3C7NB 2FLOA 2ASPA 3OYIA 5KPRA 1X9WA 1Z25A 2NRXA 1BI4B 1TUUA 2XRIA 2P9UA 1ITGA 2X6SA 3CI5A 4FJKA 5AQFA 4CZFA 4PKGA 4LF8K 3OS1A 1HR0K 2D4WA 2YHYA 5M1FA 1NK6A 1Q82O 2A42A 5AFUA 3G10A 3CCMN 3CQXA 1D8YA 3KLGA 2ATQA 1ATSA 2NUBA 5KRSA 2Q1NA 5LJVA 1YTAA 4CJEA 3DXMB 3V9UA 2O4GA 3ULEA 3OW2M 3FGUA 4CJVA 3ZSVA 4FJXA 3MN6A 1HLUA 5HROA 3Q7BA 1XHXA 4K25A 4DQ8A 3JSMA 4CZLA 5CZ1A 4C8MA 1Z05A 4JHDB 5KQDA 5DMRA 3RSEB 1IJJA 5AQGA 4JK8A 4NB4A 1H1VA 3OBWA 2QA4N 3WXJA 2HNDA 1NGIA 4O8UA 1JLGA 3TPQA 3WEEB 1IBLK 3CCVN 1BGXT 3ZSWA 4WQ4C 4FWMA 2QKKA 5C15A 1T05A 4H8KA 4BDPA 4M45A 1JL2A 4FM1A 4B3MK 4KBOA 4M3WA 1KFDA 5EU7A 3AVKA 1T7PA 3THWB 1T6DA 3NH0A 4M3ZA 3AAPA 2O8FA 1QSYA 2NLXA 3HRGA 2Q3SA 5ELZA 5AQJA 2Z1GA 4FM2A 2ZE2A 4CW7B 4B9LA 3VGMA 3LDQA 4LF7K 1S1XA 2B5JA 2W42A 1YF5L 3HL8A 1VSFA 5J2NA 3F73A 2YNGA 3LWLA 4DSEA 2P5GA 3LPUA 4BRCA 3CJ1A 3T3FA 4FVMA 4IWVA 3PIOL 4M3XA 4MDAA 3NF9A 2D0OA 4JN4A 1YTUA 3FZKA 3TTDA 3UKUA 5GAEP 1BDGA 1Q7YO 3EKSA 4H03B 1UAXA 2OPQA 3DXKB 2YV0X 1NGBA 3AA4A 5AQUA 5LY3A 4GMJB 3VF2A 4CGJA 2P51A 4IOAL 4B8AB 2QWQA 4H0VB 4DFMA 4FWKA 3QNNA 4N56A 3FLCO 4DV0K 1Q86O 3FZHA 4M7XA 1RTHA 3VQDA 3ENOA 3LZIA 4X66K 1S22A 1S9GA 1VSIA 3WNEA 3LP1A 1VSKA 3TTCA 3SMPA 3A5OC 5F1XA 2UXCK 3R1XA 4BRKA 1T03A 4YDUA 4N41A 4BR9A 3IFRA 2D0AA 1VSDA 2E1YA 1GOCA 4F2SA 3LP2A 3WQTA 4AHVA 1DGKN 2NNWA 1R59O 1KAZA 1G99A 1RTDA 4JK7A 3K9JA 4CJWA 1NJZA 1IBKK 1WAJA 1ASVA 4K42A 2QKBA 3KLFA 4EAHD 3CHWA 3OYJA 2QXFA 4LFAK 4DR6K 3L2RA 4CK3A 4JYAK 2HHVA 1XC9A 3PO4A 3CJ9A 2I7PA 3HJFA 4KRFA 4RW9A 3LANA 3AVCA 3S3OA 3QEXA 3E9PA 3SZ2A 1RTJA 4HTLA 1SL2A 3L4QA 4GKKK 4OGCA 4CECA 3SUNA 1VSMA 3CG7A 4B1WB 4KV8A 4RCHA 4H0YB 3KTQA 4ZTJA 3E9LA 2ZM6K 3AVJA 1VQ6N 4FWPA 1LAVA 1HKCA 4WYBA 3MEEA 3HK2A 4IJAA 1T6CA 3L0QA 3CQ8A 4OPKA 3MXJA 5FRMA 1JLAA 4A59A 1S1VA 5KRTA 1O13A 2YJFA 4CJRA 4CFCA 3NF6A 2F9TA 2A1RA 3HPHA 1KRPA 2Y1JA 4NCAA 4HWIA 1LWFA 3RWUA 3PY8A 3ZYYX 3HSTB 2X74A 1TL3A 1JLEA 3RMDA 1NK8A 1K73O 4LF9K 4B1UB 5BREA 2PYLA 1W0HA 1QSSA 5AZJB 1XNQK 4CI6A 3CJ7A 1U2VB 4CZJA 4BQZA 3OYCA 4BR5A 4LF4K 2PZSA 4DS4A 3AARA 2FBVA 4IO8A 2NZTA 3K5LA 4U7BA 3HVTA 3VF4A 5FLXO 4YNQA 3D2FA 1BIZA 3K2PA 1RDUA 4MQ3A 4FVUA 1A5WA 1WSEA 1TL1A 3CPWM 3O1WA 4LD0A 3THYA 2W40A 2XY7A 4BR0A 4AM6A 1SS6A 2HVHA 3LALA 5F2RA 4C1NK 4BY9C 1QVFM 2DTUA 3ZX3A 1T8EA 3I8DA 1YJNN 4CGDA 4FJMA 2QWNA 4RW8A 3NGYA 4BVOA 5A2QO 4DR7K 1EP4A 4DF8A 3OY9A 1JKHA 4FWQA 4I9LA 3UKRA 1VQ4N 3ZSZA 5AQVA 3N4PA 3SK3A 1NGAA 4FXDA 4MO4A 4FJHA 4K8XA 4M3RA 3QMLA 2KHOA 3FE1A 4M41A 4FWNA 3OYNA 1TYQA 1NGFA 1NU0A 3ZEUA 3AO2A 4QCLA 3DOLA 1NOZA 2QM1A 3O4QA 3TANA 5CYQA 1WBDA 1XMQK 5GIPA 1XQSC 2P9KA 1DLOA 4N47A 4DTPA 3CM5A 4FW1A 1IG9A 3MXIA 3CIPA 2ZJQL 4PL8A 2YHWA 4AHRA 4FLZA 3CCSN 3J8AA 3NF7A 4FJ5A 1ESVA 2KKZA 2GEMA 5H1SQ 4FM0A 4QS7A 4CJTA 4DTRA 3ATVA 1NGCA 5M1QA 3O3FA 1TYQB 2KFNA 4E7IA 3MN7A 2VWKA 3KJVA 1N33K 3ZEUB 4B9NA 3C6AA 1LV5A 5BR9A 4IEEA 4CJ7A 1RBUA 1QTMA 2IVOA 3F9KA 2O8DA 3TU5A 3HVRA 3AA5X 3LDPA 2XY8A 1SUQA 1VQKN 2QXLA 3OYDA 3HM9A 4GW6A 1TV6A 2VG6A 4O8KA 4RTFD 5HBMA 3BF1A 4JD2A 1Q9YA 1TKZA 1UA1A 3KK3A 5AR0A 4B9SA 3CXCM 4GKJK 3TARA 3S41A 4IOCL 1NKBA 2AJQA 1C6VA 1NGHA 4YOXA 3AY9A 3WXIA 4JI0K 2DFFA 3D2EB 3VQEA 3QEVA 1QE1A 2HHSA 4ZHRA 4B3TK 4W5NA 1P8ZA 3C6HA 4C8OA 4QS9A 1XNRK 4ICLA 3VQ5A 5AQNA 3M8QA 4W5TA 3TAQA 1S6QA 2FSKA 4UQGA 5BPNA 1X3MA 3E9OA 4A2BA 5SWMA 3PX0A 1EKEA 1X9SA 1J54A 1B92A 1BQMA 3MK6A 5FPEA 4YOTA 3VEXA 5FPMA 4CBWA 1RDDA 2WTUA 2V51B 3SNNA 3PSIA 3V4IA 3O3HA 1NMNA 4FSVA 4DSFA 1QVGM 2UUAK 1K8KA 1NKCA 4AHSA 2YNIA 3CCUN 3WT0A 4BC2A 4XIUA 1YJ9N 1K9MO 4OVLA 1REVA 3SV4A 4KHNA 1WSGA 1NGJA 1TKXA 4Y1DA 4GVEA 4F9OA 4WCEL 3NAEA 4DV2K 3L3VA 4AHTA 1BHLA 1S1UA 1GLCG 4DMNA 3TI0A 3ZT2A 3MECA 3FZFA 4A62A 4F3OA 3FFIA 5AQLA 3MAQA 4JI7K 1SL1A 1OH5A 3LAMA 5AQHA 4LC9B 1RCHA 1EO1A 4TSXA 1BISA 2HNYA 1HQUA 3G6EN 1ZBSA 3GG4A 3LDNA 1TAQA 5CYMA 5HOOA 3NFAA 3CPEA 3QETA 1EQYA 1GLAG 4DQRA 3O9RA 3RR7A 1Y97A 5AJ3K 4HCCA 1BCOA 3PIPL 4YOUA 4AQYK 2BH1A 4ILGB 3TWHA 4Z4GA 3QBWA 4CJ5A 1OVYA 3NE6A 3KWGA 3P1GA 5AQWA 4DR5K 1I39A 1D5AA 4FO0A 2IVNA 2P9IB 3ZLJA 2H3GX 4IDKA 4Z0UA 3QLHA 4ISFA 3CETA 5EX5A 2G8IA 1U04A 5E84A 3ITHA 5MLCQ 5I3UA 3V1OA 4J2AA 3OYEA 3TAPA 1KSPA 2HSTA 4ELUA 4CEQA 3D6RA 3ZSQA 2G8KA 4G9ZA 1J53A 5GAGP 1LAWA 4HUFA 4AM7A 3SAFA 2QWOA 1JCFA 2HBLA 2DPNA 2J4RA 3V6DA 3L8BA 2WUSA 3S9HA 1Z26A 4CFBA 4E1MA 1NKEA 4EP4A 3ZETB 2CGLA 4BREA 5IWAK 3HT3A 1YUWA 2QTDA 2HHQA 2PY5A 1HNIA 3C7NA 5KTQA 5IT9O 4BROA 1VK0A 1BI4A 4M7YA 5HRNA 1ZBHA 1NK0A 2OPPA 1KTQA 5J2MA 1ZBLA 5FRNA 3LP3A 4Z4CA 4A2AA 1KCFA 3SAHA 3NDKA 1YJWN 4J2DA 1SAZA 2YKMA 4Q5VA 3CFRA 2YKNA 4H5TA 4LFCK 1NOYA 5I42A 3DXMA 4O5BA 4DR3K 5EXWA 3I0RA 5AQYA 2BUPA 4BC4A 1C1AA 2HHHK 4RG8A 4CGIA 4JHDA 4H0TB 3RSEA 3KK2A 2F4VK 3VMFB 3FFKB 4LF6K 5LMNK 2CH5A 3O9UA 4K41A 5SZTA 1E3MA 1X1PA 3WEEA 3CC4N 1NK4A 3HTVA 4CJPA 2E1ZA 3O5BA 4LY7A 5DM7L 4CIFA 4IXCA 1QHTA 1J5OA 2E88A 5DK5A 3F9MA 1TKTA 4B1VA 4KH4A 3G71N 2A5XA 4DKWA 1JLQA 2R7YA 3OBYA 4JI8K 1KLNA 2UU9K 2VG7A 4OKJA 3THWA 4DTMA 4GV3A 1JCEA 3AVLA 4CHPA 3BEXA 2Q31A 1QZ6A 1Z6RA 3E66A 4H0OA 3P38A 5ADXH 4WF9L 5M1NA 3DLRA 4BRFA 2OPRA 3ZT3A 4DU4A 2XY6A 3ZSOA 4B3OA 2QW9A 4JKEA 3EE8A 4B3RK 3WXLA 2G8UA 1IO2A 1V4SA 1LWCA 4BR7A 3HM8A 1VQ7N 3KWIA 4K8ZA 5GADP 3MXMA 2V7YA 4FJ7A 3O4NA 4KTWA 4B8CA 1FW6A 3EY1A 3WQUA 4X64K 4DS5A 4ISGA 3I56N 3K0SA 3ENBA 4B9TA 4BACA 4JKAA 3V9ZA 1K6YA 4FWLA 3A0IX 3OTOK 1IG8A 1N32K 1ZBFA 3AVGA 3CFOA 3E01A 4B08A 2HBJA 1XC3A 1U45A 1GOAA 2I7NA 3HZ6A 4GY2B 3NGZA 2OPSA 3DXKA 4C8NA 1VAZA 5JVGL 4PY5A 1EX4A 3JXUA 1NJXA 3ZSXA 2GTDA 4ILJA 3C6UA 4BGBA 3QEIA 5KGXA 4H0XB 4MLHA 2P1JA 1VQLN 3H45C 2BTFA 3ISNC 3AGKA 3M8SA 1KXPA 3P39A 3HP9A 4MFBA 4FK4A 1XUPO 2Q0UA 4CEAA 3O9TA 3L2WA 1U47A 1WBBA 4N76A 1QQOA 1XMOK 1SZ2A 3DLEA 1HMVA 3QIOA 4HVJA 4CJ4A 4BDYA 5LMUK 1S1WA 5C24A 1RT4A 4UY8O 3BY5A 3AVMA 3R6MA 5BRFA 2CGJA 3G0ZA 5TKYA 1DEJA 4CGFA 2XO7A 3AAQA 3AVHA 4FZZA 2BE2A 3OYGA 1S9EA 4J2EA 5AQPA 2IOCA 4IO9L 1WOQA 4DFKA 1NGEA 3SQ0A 3DRSA 3CERA 4CEFA 3OJSA 2IAJA 2QWMA 3QFUA 3ZCMA 3DRRA 3VF6A 2P9LB 3KD1E 1KVBA 3MWTA 4A61A 5CE3A 3H3OB 2F96A 5EOYA 3QIPA 4O0IA 4BQLA 2DFHA 4E7KA 3VEOA 3NF8A 2V7ZA 1HYSA 3BZKA 4BRGA 2ASOA 4EFHA 3CCLN 2P5OA 1NMDA 3EO3A 3H1QA 2HHTA 5HL7L 3LM2A 5JS1A 4KHYA 2HB5A 1OH6A 4AH9A 2RF2A 1TVRA 3M8PA 3V81A 3NMUA 4CGHA 2ZQBA 4JRPA 1WNSA 4BE1A 3PSFA 4HCBA 3OYFA 1J6ZA 1D9FA 2BDPA 1N5YA 1BIUA 1NGGA 2JWKA 1C0GA 1LW2A 3RMCA 1Y64A 4OO1J 4DQPA 4CJSA 3MCPA 3SI6A 4KPYA 3T7ZA 4BVPA 4HHTA 1NNEA 4Q0BA 5AZJA 4CEDA 4M63C 3PO5A 1U2VA 4QAGA 4KHSA 1HYVA 3HPOA 3AVFA 2E5LK 4ZTFA 4EHTA 4DSJA 2D0CA 3LDOA 3M6GA 4B9UA 1TGOA 3GBTA 3CJCA 5KPZA 1JCGA 3I55N 1B9FA 2E2QA 3T69A 1YXQA 4AF1A 5TKWA 3HOTA 2E20A 4DLEA 4E19A 3U9ZA 4DV7K 1EETA 4BRPA 3SBTA 1JJ2M 1UA0A 4CFDA 2D1KA 3EZWA 1NK9A 4DTJA 4BRNA 3QESA 3WUHA 2VWBA 3TAGA 1L3SA 3IAYA 3GOIA 4BE0A 5K14A 1SKRA 5HRRA 5AQTA 1R0AA 3ZX2A 5AQMA 4WFBL 5BRHA 2PYJA 1VRUA 1VSHA 2YNHA 3AVNA 4JLHA 3OS2A 4KH6A 1HPMA 1HQEA 5AQOA 3SQ1A 3ASMA 2IVPA 4CGGA 5C10A 5E41A 1I94K 4Z4EA 4CHZA 3A5NC 4OPAA 4DU3A 1W97L 1IKWA 3HPGA 4L8RB 1X3NA 1C0FA 5HRSA 2WOMA 2CH6A 4B1ZA 3CQYA 4FWSA 4MO5A 4CF0A 2OA8A 4H5RA 4LH4A 1LW0A 3QNOA 3IMXA 3N4QA 1S6PA 3WNFA 3VN5A 4DTNA 2ZGYA 4AHUA 1OVQA 2P9SB 1VQPN 1RBSA 2QI2A 1MU2A 4O0JA 4CZGA 2VCPA 4GV6A 4JKFA 3OVNA 2IGIA 3L3UA 1SL0A 4DTUA 3HBTA
chains in the Genus database with same CATH topology
1TKXA 4GVMA 4KTQA 3DRPA 4Y1DA 1RT7A 4O55A 3OYIA 1X9WA 1Z25A 3NAEA 3TABA 1BI4B 2XRIA 3L3VA 1Q9XA 4AHTA 3L2QA 1BHLA 1ITGA 2X6SA 1S1UA 3VQ6A 4DMNA 3TI0A 3V1QA 3LWMA 5JS2A 3ZT2A 3MECA 4FJKA 5CY4A 4DQQA 2KZMA 4F3OA 3OS1A 3FFIA 3PUFA 3VA0A 2D5RA 3QO9A 4E89A 1NK6A 3MAQA 3G10A 5CZ2A 1SL1A 3LAMA 1ASUA 3CYMA 1GOBA 1D8YA 3KLGA 1VSLA 1RCHA 2ATQA 2NUBA 5HRPA 4TSXA 3NCIA 1ZYQA 1BISA 1HNVA 2IS3A 4OJRA 1YTAA 2HNYA 4CJEA 1HQUA 1CZBA 1YT3A 3V9UA 2O4GA 4RW7A 1JLBA 4CJVA 3SQ4A 2ETJA 3ZSVA 1TAQA 4OKKA 5CYMA 4FJXA 3SV4A 3SJJA 3SYZA 1RDCA 5HROA 3NFAA 1XHXA 3QETA 1X9MA 3B6OA 3AVIA 2FBTA 2JLEA 3JSMA 4DQRA 5CZ1A 4C8MA 4CE9A 5DMRA 3TAEA 3RR7A 3C94A 1Y97A 4HCCA 4IKFA 5FROA 1BCOA 3CM6A 4RW6A 1C1BA 4QOZB 2HNDA 1S1TA 3S3MA 3TWHA 4Z4GA 2KFZA 4HUGA 1JLGA 2A1SA 1A5VA 4CJ5A 2HHXA 3NE6A 3P1GA 3K5OA 1BGXT 1I39A 1D5AA 3ZSWA 5KRSA 1CZ9A 1QQCA 1L5UA 4B9VA 2QKKA 3DLGA 3IG1A 1T05A 4H8KA 4RW4A 3AVBA 1KVAA 1TK8A 4BDPA 4M45A 2HW3A 1JL2A 4IDKA 4LSNA 4FM1A 2GBZA 4DG1A 1RBVA 4Z0UA 4CEEA 3QLHA 2G8IA 1U04A 3BGRA 3ITHA 4M3WA 1KFDA 5EU7A 3ZT0A 4CHNA 3AVKA 4DWIA 1T7PA 4CK1A 2HHWA 3VQ4A 3AO3A 5I3UA 3V1OA 4J2AA 1JXBA 2KQ2A 3NH0A 4M3ZA 3OYEA 3TAPA 4H4OA 3THVA 1KSPA 1QSYA 4ELUA 4CEQA 1LWEA 3AO5A 3RTVA 1HRHA 5KRTA 2Q3SA 3RRGA 4CJ3A 3RMAA 1SKWA 1FXXA 1HPZA 3ZSQA 2Z1GA 4FM2A 2ZE2A 2G8KA 1RBTA 1J53A 1RT2A 4DQSA 3U6FA 4B9LA 1LAWA 4HUFA 1S1XA 2B5JA 2W42A 3K59A 3HL8A 1VSFA 5J2NA 1WAFA 3F73A 4ELVA 4IG3A 2YNGA 3V6DA 3LWLA 1FK9A 3L8BA 4DSEA 3S9HA 1IKXA 1Z26A 2EHGA 2P5GA 4CFBA 4E1MA 1NKEA 3LPUA 4EP4A 3L2UA 3T3FA 4FVMA 3KLIA 1ZBUA 3HT3A 4DF4A 4M3XA 4JS5A 4I7FA 4M42A 2HHQA 1UWBA 3NF9A 1YTUA 2PY5A 1HNIA 5KTQA 4Z4HA 4PWDA 1VK0A 2X6NA 4FYDA 1YVUA 1BI4A 5C42A 5HRNA 1ZBHA 1NK0A 2OPPA 1KTQA 4KAZA 3M8RA 5J2MA 1ZBLA 2KTQA 4OGEA 2FBYA 4CERA 4DFPA 1UAXA 2OPQA 5FRNA 3LP3A 4FK2A 4CEZA 4Z4CA 2YV0X 3AA4A 1KCFA 3NDKA 4J2DA 1N6QA 4GMJB 2YKMA 3U3YA 2BGGA 4Q5VA 4CGJA 3CFRA 2YKNA 1NK5A 1W9HA 4C8LA 2P51A 1DTTA 1ZBIA 1NOYA 4B8AB 5I42A 3QINA 4O5BA 1DTQA 2DY4A 4DFMA 3I0RA 4CK2A 3QNNA 5KGWA 4N56A 4FZXC 4CF9A 3V9WA 1NJWA 3UIQA 1RTHA 3VQDA 1C1AA 3LZIA 2OZMA 4OKEA 4IBNA 4RG8A 2OZSA 3WNEA 1S9GA 1VSIA 4CGIA 3RRHA 3MEDA 3LP1A 1KVCA 1VSKA 3KK2A 4KREA 4F2RA 3DOKA 2GUIA 3QEWA 2HHUA 3U3GA 3VQQA 4CIEA 3MEGA 3ZT4A 3ZSYA 5SZTA 4WE1A 4DLGA 1X1PA 1T03A 1NK4A 4CJPA 4KTZA 4LY7A 4N41A 4CIFA 2VWJA 2D0AA 1VSDA 1QHTA 3PV8A 1J5OA 4Z4IA 5DK5A 1GOCA 4F2SA 2E6MA 3LP2A 1TKTA 3VQBA 3TAMA 4AHVA 3ULDA 2E6LA 1SL0A 4B9MA 4DTUA 5T7BA 2F8TA 4DU1A 3KLHA 1JLQA 2R7YA 4FLUA 4DSLA 4FJ9A 4E3SA 1RTDA 1KLNA 1C1CA 1KFSA 2RPIA 4CJWA 1NJZA 1VRTA 1J9AA 2VG7A 4OKJA 1WAJA 1ASVA 3EYZA 4DTMA 2QKBA 3AVLA 1RT1A 4CHPA 3KLFA 1L3TA 1D9DA 1SV5A 2B6AA 4M3TA 3OYBA 3OYJA 2QXFA 3HO1A 1CXQA 3D0PA 3AA2A 3DLRA 3L2RA 4CK3A 2G8VA 4FJJA 2HHVA 1XC9A 3PO4A 2OPRA 4DTSA 2HNZA 3ZT3A 1A5XA 4Y1CA 4DU4A 2XY6A 3ZSOA 3T19A 4B3OA 3HJFA 1FKPA 4R5PA 4E7LA 3SPZA 2ITGA 3LANA 4RW9A 2F8SA 4G1QA 4KRFA 3AVCA 2G8UA 1IO2A 3S3OA 1BQNA 1HYZA 3QEXA 1LWCA 2G8WA 4EZ9A 3DMJA 4CIGA 3SZ2A 1RTJA 3S3NA 4CF2A 4K8ZA 1SL2A 3MXMA 2HMIA 4NCBA 3HYFA 3O4NA 4FJ7A 4KTWA 4B8CA 3EY1A 4IFVA 4OGCA 3V9SA 4DS5A 4CECA 3SUNA 1VSMA 4B9TA 3CG7A 4NCGA 4BACA 3V9ZA 4KV8A 1K6YA 4FJ8A 2XHBA 3KTQA 3NH2A 4ZTJA 4ID1A 1ZBFA 4CJUA 3AVGA 3CFOA 1NJYA 4HTUA 3E01A 3AVJA 4B08A 3OJUA 4FLXA 3PX4A 2YNFA 1LAVA 3MEEA 3HK2A 1U45A 1GOAA 3ALYA 1G15A 3CQ8A 4OPKA 3MXJA 5FRMA 2DFEA 3NGZA 1CLQA 2OPSA 1JLAA 4C8NA 1RDAA 4O4GA 1IH7A 1S1VA 4CHYA 4FW2A 2JGUA 4CJRA 1EX4A 4CFCA 2VG5A 3NF6A 2I5JA 3ZSXA 4HUEA 1NJXA 3C6UA 4DQIA 3QEIA 1C0TA 5KGXA 2A1RA 3HPHA 2ZD1A 1RDBA 4IG0A 1KRPA 3KK1A 3ZSRA 4F8RA 2P1JA 2Y1JA 4NCAA 1LWFA 3ISNC 3SV3A 3OYAA 2KZZA 3AO1A 3M8SA 3PY8A 3RWUA 3HSTB 3WNHA 3HP9A 2X74A 4DTOA 1TL3A 1TKDA 1JLEA 4E0DA 4KHWA 4MFBA 3OYKA 3RMDA 1NK8A 1KLMA 5HP1A 4Z4FA 1C0UA 4FK4A 4CEAA 2X78A 4C8KA 2PYLA 2QK9A 3L2WA 1U47A 3SUQA 1RT6A 3AV9A 1XI1A 4N76A 4KB0A 4NYNA 1W0HA 1QSSA 1VSJA 3DLEA 3KLEA 4FCYA 1HMVA 3QIOA 4KHUA 3DLKA 3KKRA 4E7HA 4HVJA 4FJGA 4CJ4A 3OYCA 4FLTA 2XY5A 4BDYA 1S1WA 3IRXA 1RT4A 5C24A 4H4MA 3VQAA 1L3UA 4FZYA 3AVMA 1NK7A 5D3GA 3KIOA 3VQCA 3T1AA 2PZSA 4KI4A 3B6PA 4DS4A 2BANA 3G0ZA 2FBVA 3K5LA 3OS0A 1IKVA 2FC0A 4W5OA 3OYLA 4CF8A 3SUPA 3HVTA 4CGFA 2YHAA 4JS4A 3AO4A 2XO7A 5J2QA 2FBXA 3NGIA 4YNQA 3A2FA 4I2PA 3AVHA 2OYQA 4FZZA 2BE2A 1I3AA 2Z1HA 1ASWA 1BIZA 3K2PA 4PA1A 3OYGA 1S9EA 4MQ3A 1A5WA 1WSEA 3QERA 1TL1A 4J2EA 4FJLA 4LD0A 3VQ8A 2IOCA 4CHQA 4FLVA 1L3VA 3DLHA 3RR8A 2XY7A 4DFKA 1RTIA 4NYFA 3K57A 3LALA 3L2VA 3SQ0A 4CJQA 4PQUA 3DRSA 2HVHA 2DTUA 3DI6A 4I2QA 3K58A 5HLFA 1T8EA 1RT3A 3I8DA 4CEFA 3OJSA 2IAJA 4CGDA 4CF1A 4FJMA 3NGYA 4RW8A 3ZCMA 3OYHA 3DRRA 3KD1E 1EP4A 1KVBA 4LSLA 3LAKA 4DF8A 3OY9A 1JKHA 4F3TA 2F96A 3NBPA 4I9LA 3QIPA 3ZSZA 4O0IA 2DFHA 4O44A 2WONA 3LPTA 4E7KA 3WNGA 4DTXA 4FXDA 1TK5A 4FJHA 4K8XA 3NF8A 4M3RA 1BL3A 1EXQA 1JLFA 4CHOA 1HYSA 4M41A 4N5SA 5J2PA 3SCXA 4DFJA 4DSIA 1WSIA 2G8FA 3OYNA 4M3YA 4CCHA 5FDLA 1XHZA 2Y1IA 3DM2A 1C0MA 3EZ5A 4DSKA 2RN2A 3AO2A 4QCLA 3DOLA 1NOZA 1TK0A 2P5OA 3O4QA 4E7JA 2HHTA 4FLWA 2Z1JA 3VQPA 4ELTA 3TANA 2B4JA 3HP6A 3V1RA 3LP0A 2IDOA 5JS1A 1VSEA 5CYQA 3DLBA 4KHYA 4PUOA 1HJRA 2HB5A 4AH9A 2G8HA 2RF2A 1TVRA 2RKIA 3M8PA 3V81A 4J2BA 1JLCA 4I9QA 4CGHA 1DLOA 4BWMA 4KI6A 1RILA 3SQ2A 4N47A 2ZQBA 4JRPA 1WNSA 4BE1A 4DTPA 3CM5A 4FW1A 1IG9A 3MXIA 4HCBA 3RMBA 3OYFA 1D9FA 1WSFA 1N5YA 2EX3A 1BIUA 4AHRA 4FLZA 4AILC 2BDPA 1LW2A 3NF7A 3RMCA 1F21A 4FJ5A 4DQPA 4CJSA 4FM0A 3SI6A 4KPYA 3AVAA 1TAUA 4CJTA 4DTRA 4ID5A 4KB1A 4OLAA 4HHTA 4Q0BA 3O3FA 3VQ9A 4CEDA 3PO5A 2KFNA 1JL1A 4E7IA 2VWKA 4KHQA 4QAGA 3KJVA 3O3GA 1WSJA 4B9NA 4KHSA 3SUOA 1HYVA 4IFYA 3HPOA 3AVFA 3PX6A 1LV5A 4ZTFA 4DSJA 1O1WA 3P83D 3QEPA 2D0CA 4CJFA 4B9UA 1RBUA 4FLYA 3HXMA 3LDSA 1QTMA 1TGOA 3OYMA 4FJIA 3ZT1A 2HVIA 3F9KA 1U49A 4BDZA 3HVRA 1IKYA 1B9FA 3AA5X 2XY8A 1SUQA 4W5RA 5KI6A 3TR8A 4E19A 4DLEA 3IS9A 3OYDA 4GW6A 3HM9A 1UOCA 4PY5A 3NH1A 2D0BA 1EETA 1TV6A 3KKSA 2VG6A 1RNHA 4LH5A 1S5JA 5HBMA 1UA0A 4CFDA 5C25A 1Q9YA 1TKZA 1B9DA 4OLBA 1NK9A 1BCMA 4DTJA 1UA1A 3P5JA 4EP5A 3QESA 3KK3A 4YFUA 3VQ7A 3TAGA 3BDPA 1L3SA 4B9SA 3TARA 3I0SA 3IAYA 4BE0A 1XWLA 5K14A 3V9XA 3NHGA 1SKRA 5HRRA 5J1EA 4CFAA 1NKBA 3CFPA 2E4LA 1R0AA 3D45A 2AJQA 1C6VA 4KKOA 1U48A 2DFFA 4E1NA 2LSNA 4W5QA 2YHBA 1U4BA 4M3UA 2PYJA 2Z1IA 1VRUA 3VQEA 4BWJA 3QEVA 1QE1A 4OPJA 2HHSA 1VSHA 4ZHRA 2YNHA 3AVNA 4W5NA 4JLHA 4C8OA 3OS2A 4CEBA 1RBRA 4ICLA 3VQ5A 1JXEA 4FJNA 3M8QA 1WLJA 1HQEA 4W5TA 4KO0A 3SQ1A 3ASMA 4CGGA 4AHCA 3TAQA 2GV9A 2IC3A 1S6QA 5E41A 4Z4EA 4CHZA 4EZ6A 4UQGA 4DU3A 3AA3A 3K5NA 1WSHA 1IKWA 3HPGA 5SWMA 3PX0A 4L8RB 1EKEA 1X9SA 4CJKA 1J54A 5HRSA 3C95A 1B92A 2WOMA 1BQMA 3KD5E 3LZJA 3JYTA 1QSLA 4CEOA 4CF0A 4JRQA 1WN7A 2OA8A 3TAFA 4LH4A 4CESA 1RDDA 4KHNA 1LW0A 3QNOA 1FKOA 1SKSA 1QS4A 3SNNA 1S6PA 3WNFA 3VA3A 3VN5A 4DTNA 3SPYA 1Q8IA 2KW4A 3O3HA 4AHUA 4DSFA 3C6TA 3V4IA 4FK0A 2O4IA 3H08A 3K5MA 1RBSA 4O0JA 1MU2A 1NKCA 4AHSA 2YNIA 3DYAA 4F4KA 4KFBA 1CXUA 1RT5A 3OVNA 2IGIA 4XIUA 4OVLA 3L3UA 1REVA 4BE2A 4CJLA 1WSGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKX A;  4GVM A;  4KTQ A;  3DRP A;  4Y1D A;  1RT7 A;  4O55 A;  3OYI A;  1X9W A;  1Z25 A;  3NAE A;  3TAB A;  1BI4 B;  2XRI A;  3L3V A;  1Q9X A;  4AHT A;  3L2Q A;  1BHL A;  1ITG A;  2X6S A;  1S1U A;  3VQ6 A;  4DMN A;  3TI0 A;  3V1Q A;  3LWM A;  5JS2 A;  3ZT2 A;  3MEC A;  4FJK A;  5CY4 A;  4DQQ A;  2KZM A;  4F3O A;  3OS1 A;  3FFI A;  3PUF A;  3VA0 A;  2D5R A;  3QO9 A;  4E89 A;  1NK6 A;  3MAQ A;  3G10 A;  5CZ2 A;  1SL1 A;  3LAM A;  1ASU A;  3CYM A;  1GOB A;  1D8Y A;  3KLG A;  1VSL A;  1RCH A;  2ATQ A;  2NUB A;  5HRP A;  4TSX A;  3NCI A;  1ZYQ A;  1BIS A;  1HNV A;  2IS3 A;  4OJR A;  1YTA A;  2HNY A;  4CJE A;  1HQU A;  1CZB A;  1YT3 A;  3V9U A;  2O4G A;  4RW7 A;  1JLB A;  4CJV A;  3SQ4 A;  2ETJ A;  3ZSV A;  1TAQ A;  4OKK A;  5CYM A;  4FJX A;  3SV4 A;  3SJJ A;  3SYZ A;  1RDC A;  5HRO A;  3NFA A;  1XHX A;  3QET A;  1X9M A;  3B6O A;  3AVI A;  2FBT A;  2JLE A;  3JSM A;  4DQR A;  5CZ1 A;  4C8M A;  4CE9 A;  5DMR A;  3TAE A;  3RR7 A;  3C94 A;  1Y97 A;  4HCC A;  4IKF A;  5FRO A;  1BCO A;  3CM6 A;  4RW6 A;  1C1B A;  4QOZ B;  2HND A;  1S1T A;  3S3M A;  3TWH A;  4Z4G A;  2KFZ A;  4HUG A;  1JLG A;  2A1S A;  1A5V A;  4CJ5 A;  2HHX A;  3NE6 A;  3P1G A;  3K5O A;  1BGX T;  1I39 A;  1D5A A;  3ZSW A;  5KRS A;  1CZ9 A;  1QQC A;  1L5U A;  4B9V A;  2QKK A;  3DLG A;  3IG1 A;  1T05 A;  4H8K A;  4RW4 A;  3AVB A;  1KVA A;  1TK8 A;  4BDP A;  4M45 A;  2HW3 A;  1JL2 A;  4IDK A;  4LSN A;  4FM1 A;  2GBZ A;  4DG1 A;  1RBV A;  4Z0U A;  4CEE A;  3QLH A;  2G8I A;  1U04 A;  3BGR A;  3ITH A;  4M3W A;  1KFD A;  5EU7 A;  3ZT0 A;  4CHN A;  3AVK A;  4DWI A;  1T7P A;  4CK1 A;  2HHW A;  3VQ4 A;  3AO3 A;  5I3U A;  3V1O A;  4J2A A;  1JXB A;  2KQ2 A;  3NH0 A;  4M3Z A;  3OYE A;  3TAP A;  4H4O A;  3THV A;  1KSP A;  1QSY A;  4ELU A;  4CEQ A;  1LWE A;  3AO5 A;  3RTV A;  1HRH A;  5KRT A;  2Q3S A;  3RRG A;  4CJ3 A;  3RMA A;  1SKW A;  1FXX A;  1HPZ A;  3ZSQ A;  2Z1G A;  4FM2 A;  2ZE2 A;  2G8K A;  1RBT A;  1J53 A;  1RT2 A;  4DQS A;  3U6F A;  4B9L A;  1LAW A;  4HUF A;  1S1X A;  2B5J A;  2W42 A;  3K59 A;  3HL8 A;  1VSF A;  5J2N A;  1WAF A;  3F73 A;  4ELV A;  4IG3 A;  2YNG A;  3V6D A;  3LWL A;  1FK9 A;  3L8B A;  4DSE A;  3S9H A;  1IKX A;  1Z26 A;  2EHG A;  2P5G A;  4CFB A;  4E1M A;  1NKE A;  3LPU A;  4EP4 A;  3L2U A;  3T3F A;  4FVM A;  3KLI A;  1ZBU A;  3HT3 A;  4DF4 A;  4M3X A;  4JS5 A;  4I7F A;  4M42 A;  2HHQ A;  1UWB A;  3NF9 A;  1YTU A;  2PY5 A;  1HNI A;  5KTQ A;  4Z4H A;  4PWD A;  1VK0 A;  2X6N A;  4FYD A;  1YVU A;  1BI4 A;  5C42 A;  5HRN A;  1ZBH A;  1NK0 A;  2OPP A;  1KTQ A;  4KAZ A;  3M8R A;  5J2M A;  1ZBL A;  2KTQ A;  4OGE A;  2FBY A;  4CER A;  4DFP A;  1UAX A;  2OPQ A;  5FRN A;  3LP3 A;  4FK2 A;  4CEZ A;  4Z4C A;  2YV0 X;  3AA4 A;  1KCF A;  3NDK A;  4J2D A;  1N6Q A;  4GMJ B;  2YKM A;  3U3Y A;  2BGG A;  4Q5V A;  4CGJ A;  3CFR A;  2YKN A;  1NK5 A;  1W9H A;  4C8L A;  2P51 A;  1DTT A;  1ZBI A;  1NOY A;  4B8A B;  5I42 A;  3QIN A;  4O5B A;  1DTQ A;  2DY4 A;  4DFM A;  3I0R A;  4CK2 A;  3QNN A;  5KGW A;  4N56 A;  4FZX C;  4CF9 A;  3V9W A;  1NJW A;  3UIQ A;  1RTH A;  3VQD A;  1C1A A;  3LZI A;  2OZM A;  4OKE A;  4IBN A;  4RG8 A;  2OZS A;  3WNE A;  1S9G A;  1VSI A;  4CGI A;  3RRH A;  3MED A;  3LP1 A;  1KVC A;  1VSK A;  3KK2 A;  4KRE A;  4F2R A;  3DOK A;  2GUI A;  3QEW A;  2HHU A;  3U3G A;  3VQQ A;  4CIE A;  3MEG A;  3ZT4 A;  3ZSY A;  5SZT A;  4WE1 A;  4DLG A;  1X1P A;  1T03 A;  1NK4 A;  4CJP A;  4KTZ A;  4LY7 A;  4N41 A;  4CIF A;  2VWJ A;  2D0A A;  1VSD A;  1QHT A;  3PV8 A;  1J5O A;  4Z4I A;  5DK5 A;  1GOC A;  4F2S A;  2E6M A;  3LP2 A;  1TKT A;  3VQB A;  3TAM A;  4AHV A;  3ULD A;  2E6L A;  1SL0 A;  4B9M A;  4DTU A;  5T7B A;  2F8T A;  4DU1 A;  3KLH A;  1JLQ A;  2R7Y A;  4FLU A;  4DSL A;  4FJ9 A;  4E3S A;  1RTD A;  1KLN A;  1C1C A;  1KFS A;  2RPI A;  4CJW A;  1NJZ A;  1VRT A;  1J9A A;  2VG7 A;  4OKJ A;  1WAJ A;  1ASV A;  3EYZ A;  4DTM A;  2QKB A;  3AVL A;  1RT1 A;  4CHP A;  3KLF A;  1L3T A;  1D9D A;  1SV5 A;  2B6A A;  4M3T A;  3OYB A;  3OYJ A;  2QXF A;  3HO1 A;  1CXQ A;  3D0P A;  3AA2 A;  3DLR A;  3L2R A;  4CK3 A;  2G8V A;  4FJJ A;  2HHV A;  1XC9 A;  3PO4 A;  2OPR A;  4DTS A;  2HNZ A;  3ZT3 A;  1A5X A;  4Y1C A;  4DU4 A;  2XY6 A;  3ZSO A;  3T19 A;  4B3O A;  3HJF A;  1FKP A;  4R5P A;  4E7L A;  3SPZ A;  2ITG A;  3LAN A;  4RW9 A;  2F8S A;  4G1Q A;  4KRF A;  3AVC A;  2G8U A;  1IO2 A;  3S3O A;  1BQN A;  1HYZ A;  3QEX A;  1LWC A;  2G8W A;  4EZ9 A;  3DMJ A;  4CIG A;  3SZ2 A;  1RTJ A;  3S3N A;  4CF2 A;  4K8Z A;  1SL2 A;  3MXM A;  2HMI A;  4NCB A;  3HYF A;  3O4N A;  4FJ7 A;  4KTW A;  4B8C A;  3EY1 A;  4IFV A;  4OGC A;  3V9S A;  4DS5 A;  4CEC A;  3SUN A;  1VSM A;  4B9T A;  3CG7 A;  4NCG A;  4BAC A;  3V9Z A;  4KV8 A;  1K6Y A;  4FJ8 A;  2XHB A;  3KTQ A;  3NH2 A;  4ZTJ A;  4ID1 A;  1ZBF A;  4CJU A;  3AVG A;  3CFO A;  1NJY A;  4HTU A;  3E01 A;  3AVJ A;  4B08 A;  3OJU A;  4FLX A;  3PX4 A;  2YNF A;  1LAV A;  3MEE A;  3HK2 A;  1U45 A;  1GOA A;  3ALY A;  1G15 A;  3CQ8 A;  4OPK A;  3MXJ A;  5FRM A;  2DFE A;  3NGZ A;  1CLQ A;  2OPS A;  1JLA A;  4C8N A;  1RDA A;  4O4G A;  1IH7 A;  1S1V A;  4CHY A;  4FW2 A;  2JGU A;  4CJR A;  1EX4 A;  4CFC A;  2VG5 A;  3NF6 A;  2I5J A;  3ZSX A;  4HUE A;  1NJX A;  3C6U A;  4DQI A;  3QEI A;  1C0T A;  5KGX A;  2A1R A;  3HPH A;  2ZD1 A;  1RDB A;  4IG0 A;  1KRP A;  3KK1 A;  3ZSR A;  4F8R A;  2P1J A;  2Y1J A;  4NCA A;  1LWF A;  3ISN C;  3SV3 A;  3OYA A;  2KZZ A;  3AO1 A;  3M8S A;  3PY8 A;  3RWU A;  3HST B;  3WNH A;  3HP9 A;  2X74 A;  4DTO A;  1TL3 A;  1TKD A;  1JLE A;  4E0D A;  4KHW A;  4MFB A;  3OYK A;  3RMD A;  1NK8 A;  1KLM A;  5HP1 A;  4Z4F A;  1C0U A;  4FK4 A;  4CEA A;  2X78 A;  4C8K A;  2PYL A;  2QK9 A;  3L2W A;  1U47 A;  3SUQ A;  1RT6 A;  3AV9 A;  1XI1 A;  4N76 A;  4KB0 A;  4NYN A;  1W0H A;  1QSS A;  1VSJ A;  3DLE A;  3KLE A;  4FCY A;  1HMV A;  3QIO A;  4KHU A;  3DLK A;  3KKR A;  4E7H A;  4HVJ A;  4FJG A;  4CJ4 A;  3OYC A;  4FLT A;  2XY5 A;  4BDY A;  1S1W A;  3IRX A;  1RT4 A;  5C24 A;  4H4M A;  3VQA A;  1L3U A;  4FZY A;  3AVM A;  1NK7 A;  5D3G A;  3KIO A;  3VQC A;  3T1A A;  2PZS A;  4KI4 A;  3B6P A;  4DS4 A;  2BAN A;  3G0Z A;  2FBV A;  3K5L A;  3OS0 A;  1IKV A;  2FC0 A;  4W5O A;  3OYL A;  4CF8 A;  3SUP A;  3HVT A;  4CGF A;  2YHA A;  4JS4 A;  3AO4 A;  2XO7 A;  5J2Q A;  2FBX A;  3NGI A;  4YNQ A;  3A2F A;  4I2P A;  3AVH A;  2OYQ A;  4FZZ A;  2BE2 A;  1I3A A;  2Z1H A;  1ASW A;  1BIZ A;  3K2P A;  4PA1 A;  3OYG A;  1S9E A;  4MQ3 A;  1A5W A;  1WSE A;  3QER A;  1TL1 A;  4J2E A;  4FJL A;  4LD0 A;  3VQ8 A;  2IOC A;  4CHQ A;  4FLV A;  1L3V A;  3DLH A;  3RR8 A;  2XY7 A;  4DFK A;  1RTI A;  4NYF A;  3K57 A;  3LAL A;  3L2V A;  3SQ0 A;  4CJQ A;  4PQU A;  3DRS A;  2HVH A;  2DTU A;  3DI6 A;  4I2Q A;  3K58 A;  5HLF A;  1T8E A;  1RT3 A;  3I8D A;  4CEF A;  3OJS A;  2IAJ A;  4CGD A;  4CF1 A;  4FJM A;  3NGY A;  4RW8 A;  3ZCM A;  3OYH A;  3DRR A;  3KD1 E;  1EP4 A;  1KVB A;  4LSL A;  3LAK A;  4DF8 A;  3OY9 A;  1JKH A;  4F3T A;  2F96 A;  3NBP A;  4I9L A;  3QIP A;  3ZSZ A;  4O0I A;  2DFH A;  4O44 A;  2WON A;  3LPT A;  4E7K A;  3WNG A;  4DTX A;  4FXD A;  1TK5 A;  4FJH A;  4K8X A;  3NF8 A;  4M3R A;  1BL3 A;  1EXQ A;  1JLF A;  4CHO A;  1HYS A;  4M41 A;  4N5S A;  5J2P A;  3SCX A;  4DFJ A;  4DSI A;  1WSI A;  2G8F A;  3OYN A;  4M3Y A;  4CCH A;  5FDL A;  1XHZ A;  2Y1I A;  3DM2 A;  1C0M A;  3EZ5 A;  4DSK A;  2RN2 A;  3AO2 A;  4QCL A;  3DOL A;  1NOZ A;  1TK0 A;  2P5O A;  3O4Q A;  4E7J A;  2HHT A;  4FLW A;  2Z1J A;  3VQP A;  4ELT A;  3TAN A;  2B4J A;  3HP6 A;  3V1R A;  3LP0 A;  2IDO A;  5JS1 A;  1VSE A;  5CYQ A;  3DLB A;  4KHY A;  4PUO A;  1HJR A;  2HB5 A;  4AH9 A;  2G8H A;  2RF2 A;  1TVR A;  2RKI A;  3M8P A;  3V81 A;  4J2B A;  1JLC A;  4I9Q A;  4CGH A;  1DLO A;  4BWM A;  4KI6 A;  1RIL A;  3SQ2 A;  4N47 A;  2ZQB A;  4JRP A;  1WNS A;  4BE1 A;  4DTP A;  3CM5 A;  4FW1 A;  1IG9 A;  3MXI A;  4HCB A;  3RMB A;  3OYF A;  1D9F A;  1WSF A;  1N5Y A;  2EX3 A;  1BIU A;  4AHR A;  4FLZ A;  4AIL C;  2BDP A;  1LW2 A;  3NF7 A;  3RMC A;  1F21 A;  4FJ5 A;  4DQP A;  4CJS A;  4FM0 A;  3SI6 A;  4KPY A;  3AVA A;  1TAU A;  4CJT A;  4DTR A;  4ID5 A;  4KB1 A;  4OLA A;  4HHT A;  4Q0B A;  3O3F A;  3VQ9 A;  4CED A;  3PO5 A;  2KFN A;  1JL1 A;  4E7I A;  2VWK A;  4KHQ A;  4QAG A;  3KJV A;  3O3G A;  1WSJ A;  4B9N A;  4KHS A;  3SUO A;  1HYV A;  4IFY A;  3HPO A;  3AVF A;  3PX6 A;  1LV5 A;  4ZTF A;  4DSJ A;  1O1W A;  3P83 D;  3QEP A;  2D0C A;  4CJF A;  4B9U A;  1RBU A;  4FLY A;  3HXM A;  3LDS A;  1QTM A;  1TGO A;  3OYM A;  4FJI A;  3ZT1 A;  2HVI A;  3F9K A;  1U49 A;  4BDZ A;  3HVR A;  1IKY A;  1B9F A;  3AA5 X;  2XY8 A;  1SUQ A;  4W5R A;  5KI6 A;  3TR8 A;  4E19 A;  4DLE A;  3IS9 A;  3OYD A;  4GW6 A;  3HM9 A;  1UOC A;  4PY5 A;  3NH1 A;  2D0B A;  1EET A;  1TV6 A;  3KKS A;  2VG6 A;  1RNH A;  4LH5 A;  1S5J A;  5HBM A;  1UA0 A;  4CFD A;  5C25 A;  1Q9Y A;  1TKZ A;  1B9D A;  4OLB A;  1NK9 A;  1BCM A;  4DTJ A;  1UA1 A;  3P5J A;  4EP5 A;  3QES A;  3KK3 A;  4YFU A;  3VQ7 A;  3TAG A;  3BDP A;  1L3S A;  4B9S A;  3TAR A;  3I0S A;  3IAY A;  4BE0 A;  1XWL A;  5K14 A;  3V9X A;  3NHG A;  1SKR A;  5HRR A;  5J1E A;  4CFA A;  1NKB A;  3CFP A;  2E4L A;  1R0A A;  3D45 A;  2AJQ A;  1C6V A;  4KKO A;  1U48 A;  2DFF A;  4E1N A;  2LSN A;  4W5Q A;  2YHB A;  1U4B A;  4M3U A;  2PYJ A;  2Z1I A;  1VRU A;  3VQE A;  4BWJ A;  3QEV A;  1QE1 A;  4OPJ A;  2HHS A;  1VSH A;  4ZHR A;  2YNH A;  3AVN A;  4W5N A;  4JLH A;  4C8O A;  3OS2 A;  4CEB A;  1RBR A;  4ICL A;  3VQ5 A;  1JXE A;  4FJN A;  3M8Q A;  1WLJ A;  1HQE A;  4W5T A;  4KO0 A;  3SQ1 A;  3ASM A;  4CGG A;  4AHC A;  3TAQ A;  2GV9 A;  2IC3 A;  1S6Q A;  5E41 A;  4Z4E A;  4CHZ A;  4EZ6 A;  4UQG A;  4DU3 A;  3AA3 A;  3K5N A;  1WSH A;  1IKW A;  3HPG A;  5SWM A;  3PX0 A;  4L8R B;  1EKE A;  1X9S A;  4CJK A;  1J54 A;  5HRS A;  3C95 A;  1B92 A;  2WOM A;  1BQM A;  3KD5 E;  3LZJ A;  3JYT A;  1QSL A;  4CEO A;  4CF0 A;  4JRQ A;  1WN7 A;  2OA8 A;  3TAF A;  4LH4 A;  4CES A;  1RDD A;  4KHN A;  1LW0 A;  3QNO A;  1FKO A;  1SKS A;  1QS4 A;  3SNN A;  1S6P A;  3WNF A;  3VA3 A;  3VN5 A;  4DTN A;  3SPY A;  1Q8I A;  2KW4 A;  3O3H A;  4AHU A;  4DSF A;  3C6T A;  3V4I A;  4FK0 A;  2O4I A;  3H08 A;  3K5M A;  1RBS A;  4O0J A;  1MU2 A;  1NKC A;  4AHS A;  2YNI A;  3DYA A;  4F4K A;  4KFB A;  1CXU A;  1RT5 A;  3OVN A;  2IGI A;  4XIU A;  4OVL A;  3L3U A;  1REV A;  4BE2 A;  4CJL A;  1WSG A; 
#chains in the Genus database with same CATH topology
 1BWF O;  4GVM A;  1D4X A;  3MN9 A;  4O55 A;  3TAB A;  4BRQ A;  1YI2 N;  3JS6 A;  3R3L A;  2D0P A;  3LWM A;  4DQQ A;  1YIJ N;  3O9Q A;  3PUF A;  3VA0 A;  4E89 A;  3B8A X;  3MMV A;  5F0X A;  1GOB A;  3OA9 A;  3NCI A;  5HRP A;  1ZYQ A;  1HNV A;  4OJR A;  3IDH A;  1YT3 A;  1CZB A;  3GE1 A;  3SQ4 A;  2ETJ A;  4OKK A;  4PKI A;  4YDU C;  2A40 A;  3B6O A;  4BR2 A;  4C23 A;  2RE2 A;  3TAE A;  3C94 A;  4IKF A;  3CM6 A;  4RW6 A;  4JKH A;  4QOZ B;  3S3M A;  1S1T A;  3D2E A;  4HUG A;  2HHX A;  3CCQ N;  5C2F A;  4DV1 K;  3D7E O;  2JWL A;  1CZ9 A;  1QQC A;  1YHQ N;  3IG1 A;  4RW4 A;  3AVB A;  1KVA A;  5BRD A;  2GBZ A;  4DG1 A;  1RBV A;  2VGM A;  2W41 A;  4CEE A;  3MX5 A;  3TSU A;  3VEW A;  4BRH A;  4CHN A;  3ID6 A;  4CK1 A;  2HHW A;  3AO3 A;  2ASM A;  1JXB A;  5C12 A;  2KQ2 A;  1WB9 A;  4WQ5 A;  1GLJ O;  1LWE A;  3QBX A;  1HRH A;  5GAH P;  5B8H A;  1HPZ A;  4DV6 K;  3J7Y P;  4DQS A;  1RT2 A;  3U6F A;  4JI4 K;  1BA1 A;  3M5R A;  4DHY A;  3CMA N;  2ZWH A;  3K59 A;  1WAF A;  4IG3 A;  1LCU A;  1IKX A;  3O1B A;  2EHG A;  4CD1 A;  3HI0 A;  4YOR A;  5ADX A;  2WC9 A;  4DF4 A;  4JS5 A;  4I7F A;  4M42 A;  1UWB A;  3VGL A;  4H5V A;  4Z4H A;  4PWD A;  1DKG D;  1YVU A;  1ATN A;  4WFN L;  1KC8 O;  3M8R A;  4CER A;  2YX6 A;  4CEZ A;  2P9N B;  3UE5 A;  4IDH A;  3G25 A;  2O8C B;  5GIN A;  2HF4 A;  2ZGZ A;  2UXD K;  2BGG A;  1VQ8 N;  1QZ5 A;  5GIO A;  1W9H A;  4C8L A;  1DTT A;  1ZBI A;  5JIC A;  3KZB A;  1ZC6 A;  1W2B M;  1DTQ A;  3CJA A;  5KQ8 A;  4CK2 A;  4JI6 K;  5KGW A;  1NG9 A;  4CF9 A;  1NJW A;  3UIQ A;  3J7Z O;  3RVC A;  5BPL A;  2QEX N;  2UUB K;  2OZM A;  4OKE A;  4DUZ K;  4IBN A;  3RRH A;  1KVC A;  3VEY A;  3DOK A;  2GUI A;  3QEW A;  2HHU A;  4CIE A;  3MEG A;  1GLL O;  3O6W A;  3ZSY A;  1N34 K;  4WE1 A;  4EIA A;  4X65 K;  4KTZ A;  4BR4 A;  2VWJ A;  3PV8 A;  4Z4I A;  2P9I A;  2E6M A;  3VQB A;  3HSC A;  3ULD A;  1X9J A;  2E6L A;  2F8T A;  5CR4 A;  5T7B A;  4JAX A;  3KLH A;  5KPT A;  4DSL A;  4FJ9 A;  3KK7 A;  1C1C A;  4KH5 A;  1KFS A;  4C1N I;  3THX B;  2F7T A;  1D9D A;  1WUA A;  3OYB A;  1CXQ A;  3AA2 A;  4B3S K;  2G8V A;  4I6M B;  4DTS A;  1OKJ A;  1RDW X;  3T19 A;  1FKP A;  4R5P A;  4E7L A;  3SPZ A;  2ITG A;  3F2K A;  2F8S A;  1LOT B;  1V4T A;  4Z94 A;  1HYZ A;  2CGK A;  5EVZ A;  4EZ9 A;  4A5A A;  4JEP A;  3ZET A;  3VES A;  1HNX K;  4GNI A;  2ZJR L;  3V9S A;  3J80 O;  1YIT N;  3J81 O;  3C65 A;  4FJ8 A;  2XHB A;  4JKG B;  4ID1 A;  4CJU A;  4B9Q A;  3UB5 A;  3ALY A;  5AZI B;  2DFE A;  2YJE A;  3SLC A;  2GWK A;  2NRW A;  1S72 N;  4O4G A;  1IH7 A;  4CHY A;  4FW2 A;  2JGU A;  2O8E B;  4HUE A;  2ZD1 A;  4IG0 A;  3KK1 A;  2HBK A;  5AQI A;  3W3D A;  3AO1 A;  1Q81 O;  4E0D A;  4KHW A;  3OYK A;  1KLM A;  5HP1 A;  4Z4F A;  1C0U A;  4DR1 K;  3P4I A;  3AV9 A;  4KB0 A;  4FL9 A;  3KLE A;  4B1Y B;  4KHU A;  3DLK A;  5LL6 Z;  2UYT A;  2GWJ A;  3VQA A;  1EWQ A;  3ZX0 A;  5D3G A;  3CCJ N;  3U9D A;  3QB0 A;  4ILH A;  3OS0 A;  4WQ5 C;  4CZK A;  4OPH A;  2Q2R A;  4JS4 A;  2YHA A;  2FBX A;  3NGI A;  4BRM A;  3A2F A;  4I2P A;  3VTH A;  3A5L C;  1I3A A;  2Z1H A;  1VQ5 N;  3L4I A;  3GL1 A;  1M1K O;  1L3V A;  3DLH A;  4K43 A;  1K8A O;  4NYF A;  3K57 A;  1TUY A;  1GLF O;  2W6L A;  4CJQ A;  3DI6 A;  4CF1 A;  5I9E B;  5DM6 L;  4IOX A;  1RFQ A;  4LSL A;  1YAG A;  4F3T A;  2VQF K;  3CME N;  3K9K A;  3AGR A;  4O44 A;  3LL3 A;  5BN8 A;  4DTX A;  4YY3 K;  4BRI A;  1TK5 A;  4CHO A;  4CZE A;  4N5S A;  4DFJ A;  4M3Y A;  5FDL A;  1XHZ A;  4DV4 K;  3EZ5 A;  4DSK A;  2RN2 A;  2ITM A;  3WXM B;  1TK0 A;  2HF3 A;  1GLB G;  3VQP A;  4ELT A;  2B4J A;  3HP6 A;  3LP0 A;  2IDO A;  4DUY K;  1S3X A;  4DB3 A;  3O08 A;  3RMB A;  1WSF A;  2EX3 A;  4AIL C;  3IUC A;  1E4G T;  2ZF5 O;  4DCH A;  3AVA A;  1TAU A;  4H5N A;  4ID5 A;  3ATU A;  5JMV A;  2NRZ A;  3EE9 A;  3TSP A;  3VQ9 A;  4K0K K;  1JL1 A;  4KHQ A;  1CZA N;  1WSJ A;  4IFY A;  2W6K A;  2P9U B;  4CJF A;  4FLY A;  3HXM A;  4FJI A;  2E2O A;  1IBM K;  4JKD A;  4DV3 K;  1IKY A;  3P31 A;  3H3N O;  1BA0 A;  3EL2 A;  3KHY A;  3TR8 A;  4Y0W A;  2PFU A;  1RNH A;  4J8F A;  3ULE B;  4JI2 K;  5C25 A;  4OLB A;  1BCM A;  1M90 O;  3VQ7 A;  3BDP A;  3I0S A;  2P9L A;  1XWL A;  3CJB A;  5J1E A;  4CFA A;  2A3Z A;  5C0Y A;  4KKO A;  2WFB A;  4E1N A;  4W5Q A;  2YHB A;  4M3U A;  2Z1I A;  3MCA B;  4BWJ A;  3W0L A;  4CZH A;  1U6Z A;  3DWL A;  4CEB A;  5AQX A;  4FJN A;  3G4S N;  4KO0 A;  2IC3 A;  1HJO A;  1YVN A;  4FOE A;  5LJW A;  1VQ9 N;  4X62 K;  1P90 A;  2O8F B;  2WBN A;  4FPA A;  1QSL A;  3NVK A;  4CEO A;  4JRQ A;  1WN7 A;  4IEI A;  4CES A;  1FKO A;  4KHP K;  1SKS A;  4DR2 K;  3C0B A;  4FWO A;  3SPY A;  4M3T A;  1Q8I A;  2KW4 A;  3C6T A;  3H46 O;  3EKU A;  4KFB A;  1ATR A;  1CXU A;  1BO5 O;  3BZC A;  4F8R A;  4KTQ A;  3DRP A;  1RT7 A;  4PKH A;  4R79 A;  1NM1 A;  1HKB A;  1Q9X A;  3UKU B;  3L2Q A;  1FJG K;  3H6E A;  2EWS A;  3VQ6 A;  3V1Q A;  5JS2 A;  4DV5 K;  3E1Y A;  5CY4 A;  4YOY A;  2KZM A;  4JNE A;  2D5R A;  3BF3 A;  3QO9 A;  5FPN A;  3FZL A;  4BRD A;  5CZ2 A;  1ASU A;  3CYM A;  5JVH L;  1VSL A;  1HKG A;  3VEZ A;  3F5T A;  1N36 K;  2IS3 A;  1BOT O;  2FXU A;  2E2N A;  4RW7 A;  1JLB A;  3TTF A;  4FPB A;  3H1V X;  4A57 A;  3SJJ A;  3SYZ A;  1RDC A;  3SBG A;  3EEQ A;  1X9M A;  1HUX A;  3AVI A;  4CD3 A;  2FBT A;  2JLE A;  4CE9 A;  3DJC A;  5FRO A;  3BP8 A;  1C1B A;  1VHX A;  4O5F A;  4BC3 A;  2A41 A;  2KFZ A;  3M3Z A;  2A1S A;  1A5V A;  3MDQ A;  3K5O A;  5AQR A;  2RHK A;  1L5U A;  5FPD A;  4B9V A;  3DLG A;  3DLL L;  2V52 B;  1TK8 A;  2HW3 A;  3BUZ B;  4LSN A;  4DR4 K;  3BGR A;  5M1P A;  3VTI A;  3ZT0 A;  4DWI A;  3VQ4 A;  4H4O A;  3THV A;  3JAM O;  2UUC K;  3AO5 A;  3RTV A;  3RRG A;  4CJ3 A;  3RMA A;  1SKW A;  1FXX A;  2PBD A;  1VQM N;  4GV9 A;  1RBT A;  4WFA L;  3I8B A;  3MX2 A;  4ELV A;  2P9S A;  1FK9 A;  4XEI A;  1W7A A;  1VQN N;  3L2U A;  3KLI A;  1ZBU A;  2OAN A;  5AFU H;  1KD1 O;  2X6N A;  3WXK A;  4FYD A;  1HNW K;  3LM9 A;  5C42 A;  4NXM K;  4KAZ A;  4NXN K;  2KTQ A;  4OGE A;  2FBY A;  3O80 A;  4DFP A;  1MA9 B;  4FK2 A;  1NLV A;  1GLD G;  3CC7 N;  1T3V A;  1N6Q A;  3KVG A;  3U3Y A;  5AQS A;  3U8X A;  1NK5 A;  4CVN E;  3QIN A;  2DY4 A;  3CCR N;  4LF5 K;  3VEN A;  4FZX C;  3V9W A;  2FSJ A;  2KLA A;  4FWR A;  5AQZ A;  4XH4 A;  4E1J A;  3SJH A;  2OZS A;  3MED A;  4KRE A;  1Q18 A;  4F2R A;  3U3G A;  3VQQ A;  3ZT4 A;  3MWP A;  2NRT A;  4DLG A;  5BR8 K;  3CC2 N;  2HOE A;  1VQO N;  1MDU B;  3U4L A;  3FR0 A;  3TAM A;  4B9M A;  4DU1 A;  3D2F B;  4FLU A;  2AP1 A;  4E3S A;  3OHR A;  3R8E A;  2VQE K;  2RPI A;  5E26 A;  1VRT A;  1J9A A;  3EYZ A;  4CBU A;  1RT1 A;  1L3T A;  3ID8 A;  3VEV A;  1SV5 A;  2B6A A;  2ZJP L;  3THY B;  3HO1 A;  3D0P A;  2A6A A;  4FJJ A;  2NRV A;  2HNZ A;  1A5X A;  4Y1C A;  5BPM A;  5BN9 A;  4G1Q A;  5EY4 A;  5M1O A;  1BQN A;  3UKR B;  4BRL A;  2G8W A;  3DMJ A;  4CIG A;  4JI3 K;  3S3N A;  4CF2 A;  3GDQ A;  4NCB A;  2HMI A;  3HYF A;  4IFV A;  3FZM A;  3CCE N;  4B1X B;  4NCG A;  4XH5 A;  2Q97 A;  2PAV A;  3VPZ A;  3VOV A;  1KAY A;  3NH2 A;  1NJY A;  4OX9 K;  1J5E K;  4HTU A;  5AQK A;  4FLX A;  3OJU A;  3PX4 A;  2YNF A;  2NRR A;  4EHU A;  1G15 A;  2FSN A;  1CLQ A;  1RDA A;  2P9N A;  2YI1 A;  2F9W A;  4YOW A;  2P9K B;  2VG5 A;  2I5J A;  2O8C A;  4QS8 A;  4DQI A;  1C0T A;  1RDB A;  5AQQ A;  1ZXO A;  3ZSR A;  2YHX A;  3SV3 A;  2KZZ A;  3OYA A;  3WNH A;  1TKD A;  4DTO A;  1T44 A;  4C8K A;  2X78 A;  2QK9 A;  2YCH A;  3SUQ A;  1RT6 A;  1XI1 A;  4NYN A;  3LDL A;  1VSJ A;  4FCY A;  2E8A A;  3KKR A;  3M1F A;  4E7H A;  4FJG A;  4FLT A;  2XY5 A;  3IRX A;  2QWR A;  1L3U A;  4H4M A;  2QWL A;  3L6Q A;  4FZY A;  1NK7 A;  1ILY A;  2OTJ N;  3KIO A;  3VQC A;  1HX1 A;  2AA4 A;  2NRH A;  3T1A A;  5C2D A;  4KI4 A;  3B6P A;  2BAN A;  3NVM A;  2O8D B;  4H0P A;  1IKV A;  2FC0 A;  4W5O A;  3O8M A;  4CF8 A;  3OYL A;  3SUP A;  5JLF A;  3AO4 A;  5J2Q A;  4BG9 A;  2OYQ A;  1ASW A;  4IZ9 A;  4PA1 A;  3THX A;  3R9P A;  2GX9 A;  3QER A;  1NJI O;  4FJL A;  4CHQ A;  3VQ8 A;  4FLV A;  4BG8 A;  3RR8 A;  4LFB K;  2O8B A;  1RTI A;  3CD6 N;  4ISE A;  4JD2 B;  3L2V A;  4PQU A;  2FF3 B;  4I2Q A;  3K58 A;  5HLF A;  1RT3 A;  2E2P A;  4I6M A;  1QHA A;  1SQK A;  1IV0 A;  1DT9 A;  3OYH A;  4NLC A;  2FF6 A;  3LAK A;  3NBP A;  4XH1 A;  2WON A;  3LPT A;  3WNG A;  4NO7 A;  3VET A;  1BL3 A;  1EXQ A;  1JLF A;  5J2P A;  3SCX A;  4DSI A;  1WSI A;  2G8F A;  3SAG A;  4JI5 K;  4CCH A;  2GUP A;  2Y1I A;  3DM2 A;  1C0M A;  3ENH A;  4JKG A;  4BGA A;  4RWT A;  1HNZ K;  4E7J A;  4IFE A;  4FLW A;  1RGI A;  2Z1J A;  3V1R A;  3J7A P;  1VSE A;  3QDK A;  4WQ4 A;  4CBX A;  3DLB A;  5AZI A;  4PUO A;  1HJR A;  2O8B B;  2G8H A;  2RKI A;  4JKC A;  4J2B A;  1JLC A;  4MLE A;  4I9Q A;  3CF5 L;  3QIC A;  4BWM A;  2O8E A;  4KI6 A;  1RIL A;  3SQ2 A;  3Q7C A;  4JKB A;  4BRA A;  2VYP A;  3HOS A;  3PLA A;  4PHT X;  1F21 A;  1K8K B;  1BG3 A;  2Q36 A;  4OLA A;  4KB1 A;  1E4F T;  3I33 A;  3O3G A;  3SUO A;  1BUP A;  3PX6 A;  1O1W A;  3P83 D;  4NLB A;  3QEP A;  3LDS A;  3OYM A;  3T1H K;  3EN9 A;  3ZT1 A;  2OCE A;  2HVI A;  1U49 A;  4BDZ A;  1NWK A;  1QQN A;  3VGK A;  4W5R A;  4MDB A;  1OH8 A;  5KI6 A;  4H5W A;  4A5B A;  3IS9 A;  1UOC A;  3NH1 A;  2P9P A;  2D0B A;  4JI1 K;  5JLH A;  3KKS A;  4LH5 A;  1S5J A;  3A8Y A;  4IJN A;  1B9D A;  4FOI A;  5M1K A;  1QQM A;  3P5J A;  4EP5 A;  4YFU A;  4JK9 A;  4U67 L;  3V9X A;  3NHG A;  1NBW A;  3CFP A;  2E4L A;  3A5M C;  3D45 A;  3QFP A;  4PL7 A;  1U48 A;  2LSN A;  1U4B A;  3TSQ A;  1N8R O;  1GLE G;  4JV5 K;  1BU6 O;  4OPJ A;  2HMP A;  3MN5 A;  2QWP A;  2IIR A;  1RBR A;  1NGD A;  3IKM A;  4CZI A;  1JXE A;  1KAX A;  1WLJ A;  1MWM A;  2OTL N;  4AHC A;  4YHH K;  3VER A;  2GV9 A;  4CZM A;  2P9P B;  4V19 S;  4EZ6 A;  2HBM A;  3AA3 A;  3K5N A;  1WSH A;  4BC5 A;  2Q0R A;  2UXB K;  4CJK A;  3KD5 E;  3C95 A;  3DAW A;  4YOV A;  5CHI A;  3LZJ A;  3JYT A;  3O9S A;  3TAF A;  1MWK A;  2VGN A;  1QS4 A;  3T1Y K;  3VA3 A;  1OH7 A;  4FK0 A;  4L3Q A;  2O4I A;  3H08 A;  3K5M A;  3O4W A;  1EWR A;  2GEL A;  3DYA A;  1KQS M;  4F4K A;  1RT5 A;  3SMS A;  4BE2 A;  4CJL A;  3C7N B;  2FLO A;  2ASP A;  3OYI A;  5KPR A;  1X9W A;  1Z25 A;  2NRX A;  1BI4 B;  1TUU A;  2XRI A;  2P9U A;  1ITG A;  2X6S A;  3CI5 A;  4FJK A;  5AQF A;  4CZF A;  4PKG A;  4LF8 K;  3OS1 A;  1HR0 K;  2D4W A;  2YHY A;  5M1F A;  1NK6 A;  1Q82 O;  2A42 A;  5AFU A;  3G10 A;  3CCM N;  3CQX A;  1D8Y A;  3KLG A;  2ATQ A;  1ATS A;  2NUB A;  5KRS A;  2Q1N A;  5LJV A;  1YTA A;  4CJE A;  3DXM B;  3V9U A;  2O4G A;  3ULE A;  3OW2 M;  3FGU A;  4CJV A;  3ZSV A;  4FJX A;  3MN6 A;  1HLU A;  5HRO A;  3Q7B A;  1XHX A;  4K25 A;  4DQ8 A;  3JSM A;  4CZL A;  5CZ1 A;  4C8M A;  1Z05 A;  4JHD B;  5KQD A;  5DMR A;  3RSE B;  1IJJ A;  5AQG A;  4JK8 A;  4NB4 A;  1H1V A;  3OBW A;  2QA4 N;  3WXJ A;  2HND A;  1NGI A;  4O8U A;  1JLG A;  3TPQ A;  3WEE B;  1IBL K;  3CCV N;  1BGX T;  3ZSW A;  4WQ4 C;  4FWM A;  2QKK A;  5C15 A;  1T05 A;  4H8K A;  4BDP A;  4M45 A;  1JL2 A;  4FM1 A;  4B3M K;  4KBO A;  4M3W A;  1KFD A;  5EU7 A;  3AVK A;  1T7P A;  3THW B;  1T6D A;  3NH0 A;  4M3Z A;  3AAP A;  2O8F A;  1QSY A;  2NLX A;  3HRG A;  2Q3S A;  5ELZ A;  5AQJ A;  2Z1G A;  4FM2 A;  2ZE2 A;  4CW7 B;  4B9L A;  3VGM A;  3LDQ A;  4LF7 K;  1S1X A;  2B5J A;  2W42 A;  1YF5 L;  3HL8 A;  1VSF A;  5J2N A;  3F73 A;  2YNG A;  3LWL A;  4DSE A;  2P5G A;  3LPU A;  4BRC A;  3CJ1 A;  3T3F A;  4FVM A;  4IWV A;  3PIO L;  4M3X A;  4MDA A;  3NF9 A;  2D0O A;  4JN4 A;  1YTU A;  3FZK A;  3TTD A;  3UKU A;  5GAE P;  1BDG A;  1Q7Y O;  3EKS A;  4H03 B;  1UAX A;  2OPQ A;  3DXK B;  2YV0 X;  1NGB A;  3AA4 A;  5AQU A;  5LY3 A;  4GMJ B;  3VF2 A;  4CGJ A;  2P51 A;  4IOA L;  4B8A B;  2QWQ A;  4H0V B;  4DFM A;  4FWK A;  3QNN A;  4N56 A;  3FLC O;  4DV0 K;  1Q86 O;  3FZH A;  4M7X A;  1RTH A;  3VQD A;  3ENO A;  3LZI A;  4X66 K;  1S22 A;  1S9G A;  1VSI A;  3WNE A;  3LP1 A;  1VSK A;  3TTC A;  3SMP A;  3A5O C;  5F1X A;  2UXC K;  3R1X A;  4BRK A;  1T03 A;  4YDU A;  4N41 A;  4BR9 A;  3IFR A;  2D0A A;  1VSD A;  2E1Y A;  1GOC A;  4F2S A;  3LP2 A;  3WQT A;  4AHV A;  1DGK N;  2NNW A;  1R59 O;  1KAZ A;  1G99 A;  1RTD A;  4JK7 A;  3K9J A;  4CJW A;  1NJZ A;  1IBK K;  1WAJ A;  1ASV A;  4K42 A;  2QKB A;  3KLF A;  4EAH D;  3CHW A;  3OYJ A;  2QXF A;  4LFA K;  4DR6 K;  3L2R A;  4CK3 A;  4JYA K;  2HHV A;  1XC9 A;  3PO4 A;  3CJ9 A;  2I7P A;  3HJF A;  4KRF A;  4RW9 A;  3LAN A;  3AVC A;  3S3O A;  3QEX A;  3E9P A;  3SZ2 A;  1RTJ A;  4HTL A;  1SL2 A;  3L4Q A;  4GKK K;  4OGC A;  4CEC A;  3SUN A;  1VSM A;  3CG7 A;  4B1W B;  4KV8 A;  4RCH A;  4H0Y B;  3KTQ A;  4ZTJ A;  3E9L A;  2ZM6 K;  3AVJ A;  1VQ6 N;  4FWP A;  1LAV A;  1HKC A;  4WYB A;  3MEE A;  3HK2 A;  4IJA A;  1T6C A;  3L0Q A;  3CQ8 A;  4OPK A;  3MXJ A;  5FRM A;  1JLA A;  4A59 A;  1S1V A;  5KRT A;  1O13 A;  2YJF A;  4CJR A;  4CFC A;  3NF6 A;  2F9T A;  2A1R A;  3HPH A;  1KRP A;  2Y1J A;  4NCA A;  4HWI A;  1LWF A;  3RWU A;  3PY8 A;  3ZYY X;  3HST B;  2X74 A;  1TL3 A;  1JLE A;  3RMD A;  1NK8 A;  1K73 O;  4LF9 K;  4B1U B;  5BRE A;  2PYL A;  1W0H A;  1QSS A;  5AZJ B;  1XNQ K;  4CI6 A;  3CJ7 A;  1U2V B;  4CZJ A;  4BQZ A;  3OYC A;  4BR5 A;  4LF4 K;  2PZS A;  4DS4 A;  3AAR A;  2FBV A;  4IO8 A;  2NZT A;  3K5L A;  4U7B A;  3HVT A;  3VF4 A;  5FLX O;  4YNQ A;  3D2F A;  1BIZ A;  3K2P A;  1RDU A;  4MQ3 A;  4FVU A;  1A5W A;  1WSE A;  1TL1 A;  3CPW M;  3O1W A;  4LD0 A;  3THY A;  2W40 A;  2XY7 A;  4BR0 A;  4AM6 A;  1SS6 A;  2HVH A;  3LAL A;  5F2R A;  4C1N K;  4BY9 C;  1QVF M;  2DTU A;  3ZX3 A;  1T8E A;  3I8D A;  1YJN N;  4CGD A;  4FJM A;  2QWN A;  4RW8 A;  3NGY A;  4BVO A;  5A2Q O;  4DR7 K;  1EP4 A;  4DF8 A;  3OY9 A;  1JKH A;  4FWQ A;  4I9L A;  3UKR A;  1VQ4 N;  3ZSZ A;  5AQV A;  3N4P A;  3SK3 A;  1NGA A;  4FXD A;  4MO4 A;  4FJH A;  4K8X A;  4M3R A;  3QML A;  2KHO A;  3FE1 A;  4M41 A;  4FWN A;  3OYN A;  1TYQ A;  1NGF A;  1NU0 A;  3ZEU A;  3AO2 A;  4QCL A;  3DOL A;  1NOZ A;  2QM1 A;  3O4Q A;  3TAN A;  5CYQ A;  1WBD A;  1XMQ K;  5GIP A;  1XQS C;  2P9K A;  1DLO A;  4N47 A;  4DTP A;  3CM5 A;  4FW1 A;  1IG9 A;  3MXI A;  3CIP A;  2ZJQ L;  4PL8 A;  2YHW A;  4AHR A;  4FLZ A;  3CCS N;  3J8A A;  3NF7 A;  4FJ5 A;  1ESV A;  2KKZ A;  2GEM A;  5H1S Q;  4FM0 A;  4QS7 A;  4CJT A;  4DTR A;  3ATV A;  1NGC A;  5M1Q A;  3O3F A;  1TYQ B;  2KFN A;  4E7I A;  3MN7 A;  2VWK A;  3KJV A;  1N33 K;  3ZEU B;  4B9N A;  3C6A A;  1LV5 A;  5BR9 A;  4IEE A;  4CJ7 A;  1RBU A;  1QTM A;  2IVO A;  3F9K A;  2O8D A;  3TU5 A;  3HVR A;  3AA5 X;  3LDP A;  2XY8 A;  1SUQ A;  1VQK N;  2QXL A;  3OYD A;  3HM9 A;  4GW6 A;  1TV6 A;  2VG6 A;  4O8K A;  4RTF D;  5HBM A;  3BF1 A;  4JD2 A;  1Q9Y A;  1TKZ A;  1UA1 A;  3KK3 A;  5AR0 A;  4B9S A;  3CXC M;  4GKJ K;  3TAR A;  3S41 A;  4IOC L;  1NKB A;  2AJQ A;  1C6V A;  1NGH A;  4YOX A;  3AY9 A;  3WXI A;  4JI0 K;  2DFF A;  3D2E B;  3VQE A;  3QEV A;  1QE1 A;  2HHS A;  4ZHR A;  4B3T K;  4W5N A;  1P8Z A;  3C6H A;  4C8O A;  4QS9 A;  1XNR K;  4ICL A;  3VQ5 A;  5AQN A;  3M8Q A;  4W5T A;  3TAQ A;  1S6Q A;  2FSK A;  4UQG A;  5BPN A;  1X3M A;  3E9O A;  4A2B A;  5SWM A;  3PX0 A;  1EKE A;  1X9S A;  1J54 A;  1B92 A;  1BQM A;  3MK6 A;  5FPE A;  4YOT A;  3VEX A;  5FPM A;  4CBW A;  1RDD A;  2WTU A;  2V51 B;  3SNN A;  3PSI A;  3V4I A;  3O3H A;  1NMN A;  4FSV A;  4DSF A;  1QVG M;  2UUA K;  1K8K A;  1NKC A;  4AHS A;  2YNI A;  3CCU N;  3WT0 A;  4BC2 A;  4XIU A;  1YJ9 N;  1K9M O;  4OVL A;  1REV A;  3SV4 A;  4KHN A;  1WSG A;  1NGJ A;  1TKX A;  4Y1D A;  4GVE A;  4F9O A;  4WCE L;  3NAE A;  4DV2 K;  3L3V A;  4AHT A;  1BHL A;  1S1U A;  1GLC G;  4DMN A;  3TI0 A;  3ZT2 A;  3MEC A;  3FZF A;  4A62 A;  4F3O A;  3FFI A;  5AQL A;  3MAQ A;  4JI7 K;  1SL1 A;  1OH5 A;  3LAM A;  5AQH A;  4LC9 B;  1RCH A;  1EO1 A;  4TSX A;  1BIS A;  2HNY A;  1HQU A;  3G6E N;  1ZBS A;  3GG4 A;  3LDN A;  1TAQ A;  5CYM A;  5HOO A;  3NFA A;  3CPE A;  3QET A;  1EQY A;  1GLA G;  4DQR A;  3O9R A;  3RR7 A;  1Y97 A;  5AJ3 K;  4HCC A;  1BCO A;  3PIP L;  4YOU A;  4AQY K;  2BH1 A;  4ILG B;  3TWH A;  4Z4G A;  3QBW A;  4CJ5 A;  1OVY A;  3NE6 A;  3KWG A;  3P1G A;  5AQW A;  4DR5 K;  1I39 A;  1D5A A;  4FO0 A;  2IVN A;  2P9I B;  3ZLJ A;  2H3G X;  4IDK A;  4Z0U A;  3QLH A;  4ISF A;  3CET A;  5EX5 A;  2G8I A;  1U04 A;  5E84 A;  3ITH A;  5MLC Q;  5I3U A;  3V1O A;  4J2A A;  3OYE A;  3TAP A;  1KSP A;  2HST A;  4ELU A;  4CEQ A;  3D6R A;  3ZSQ A;  2G8K A;  4G9Z A;  1J53 A;  5GAG P;  1LAW A;  4HUF A;  4AM7 A;  3SAF A;  2QWO A;  1JCF A;  2HBL A;  2DPN A;  2J4R A;  3V6D A;  3L8B A;  2WUS A;  3S9H A;  1Z26 A;  4CFB A;  4E1M A;  1NKE A;  4EP4 A;  3ZET B;  2CGL A;  4BRE A;  5IWA K;  3HT3 A;  1YUW A;  2QTD A;  2HHQ A;  2PY5 A;  1HNI A;  3C7N A;  5KTQ A;  5IT9 O;  4BRO A;  1VK0 A;  1BI4 A;  4M7Y A;  5HRN A;  1ZBH A;  1NK0 A;  2OPP A;  1KTQ A;  5J2M A;  1ZBL A;  5FRN A;  3LP3 A;  4Z4C A;  4A2A A;  1KCF A;  3SAH A;  3NDK A;  1YJW N;  4J2D A;  1SAZ A;  2YKM A;  4Q5V A;  3CFR A;  2YKN A;  4H5T A;  4LFC K;  1NOY A;  5I42 A;  3DXM A;  4O5B A;  4DR3 K;  5EXW A;  3I0R A;  5AQY A;  2BUP A;  4BC4 A;  1C1A A;  2HHH K;  4RG8 A;  4CGI A;  4JHD A;  4H0T B;  3RSE A;  3KK2 A;  2F4V K;  3VMF B;  3FFK B;  4LF6 K;  5LMN K;  2CH5 A;  3O9U A;  4K41 A;  5SZT A;  1E3M A;  1X1P A;  3WEE A;  3CC4 N;  1NK4 A;  3HTV A;  4CJP A;  2E1Z A;  3O5B A;  4LY7 A;  5DM7 L;  4CIF A;  4IXC A;  1QHT A;  1J5O A;  2E88 A;  5DK5 A;  3F9M A;  1TKT A;  4B1V A;  4KH4 A;  3G71 N;  2A5X A;  4DKW A;  1JLQ A;  2R7Y A;  3OBY A;  4JI8 K;  1KLN A;  2UU9 K;  2VG7 A;  4OKJ A;  3THW A;  4DTM A;  4GV3 A;  1JCE A;  3AVL A;  4CHP A;  3BEX A;  2Q31 A;  1QZ6 A;  1Z6R A;  3E66 A;  4H0O A;  3P38 A;  5ADX H;  4WF9 L;  5M1N A;  3DLR A;  4BRF A;  2OPR A;  3ZT3 A;  4DU4 A;  2XY6 A;  3ZSO A;  4B3O A;  2QW9 A;  4JKE A;  3EE8 A;  4B3R K;  3WXL A;  2G8U A;  1IO2 A;  1V4S A;  1LWC A;  4BR7 A;  3HM8 A;  1VQ7 N;  3KWI A;  4K8Z A;  5GAD P;  3MXM A;  2V7Y A;  4FJ7 A;  3O4N A;  4KTW A;  4B8C A;  1FW6 A;  3EY1 A;  3WQU A;  4X64 K;  4DS5 A;  4ISG A;  3I56 N;  3K0S A;  3ENB A;  4B9T A;  4BAC A;  4JKA A;  3V9Z A;  1K6Y A;  4FWL A;  3A0I X;  3OTO K;  1IG8 A;  1N32 K;  1ZBF A;  3AVG A;  3CFO A;  3E01 A;  4B08 A;  2HBJ A;  1XC3 A;  1U45 A;  1GOA A;  2I7N A;  3HZ6 A;  4GY2 B;  3NGZ A;  2OPS A;  3DXK A;  4C8N A;  1VAZ A;  5JVG L;  4PY5 A;  1EX4 A;  3JXU A;  1NJX A;  3ZSX A;  2GTD A;  4ILJ A;  3C6U A;  4BGB A;  3QEI A;  5KGX A;  4H0X B;  4MLH A;  2P1J A;  1VQL N;  3H45 C;  2BTF A;  3ISN C;  3AGK A;  3M8S A;  1KXP A;  3P39 A;  3HP9 A;  4MFB A;  4FK4 A;  1XUP O;  2Q0U A;  4CEA A;  3O9T A;  3L2W A;  1U47 A;  1WBB A;  4N76 A;  1QQO A;  1XMO K;  1SZ2 A;  3DLE A;  1HMV A;  3QIO A;  4HVJ A;  4CJ4 A;  4BDY A;  5LMU K;  1S1W A;  5C24 A;  1RT4 A;  4UY8 O;  3BY5 A;  3AVM A;  3R6M A;  5BRF A;  2CGJ A;  3G0Z A;  5TKY A;  1DEJ A;  4CGF A;  2XO7 A;  3AAQ A;  3AVH A;  4FZZ A;  2BE2 A;  3OYG A;  1S9E A;  4J2E A;  5AQP A;  2IOC A;  4IO9 L;  1WOQ A;  4DFK A;  1NGE A;  3SQ0 A;  3DRS A;  3CER A;  4CEF A;  3OJS A;  2IAJ A;  2QWM A;  3QFU A;  3ZCM A;  3DRR A;  3VF6 A;  2P9L B;  3KD1 E;  1KVB A;  3MWT A;  4A61 A;  5CE3 A;  3H3O B;  2F96 A;  5EOY A;  3QIP A;  4O0I A;  4BQL A;  2DFH A;  4E7K A;  3VEO A;  3NF8 A;  2V7Z A;  1HYS A;  3BZK A;  4BRG A;  2ASO A;  4EFH A;  3CCL N;  2P5O A;  1NMD A;  3EO3 A;  3H1Q A;  2HHT A;  5HL7 L;  3LM2 A;  5JS1 A;  4KHY A;  2HB5 A;  1OH6 A;  4AH9 A;  2RF2 A;  1TVR A;  3M8P A;  3V81 A;  3NMU A;  4CGH A;  2ZQB A;  4JRP A;  1WNS A;  4BE1 A;  3PSF A;  4HCB A;  3OYF A;  1J6Z A;  1D9F A;  2BDP A;  1N5Y A;  1BIU A;  1NGG A;  2JWK A;  1C0G A;  1LW2 A;  3RMC A;  1Y64 A;  4OO1 J;  4DQP A;  4CJS A;  3MCP A;  3SI6 A;  4KPY A;  3T7Z A;  4BVP A;  4HHT A;  1NNE A;  4Q0B A;  5AZJ A;  4CED A;  4M63 C;  3PO5 A;  1U2V A;  4QAG A;  4KHS A;  1HYV A;  3HPO A;  3AVF A;  2E5L K;  4ZTF A;  4EHT A;  4DSJ A;  2D0C A;  3LDO A;  3M6G A;  4B9U A;  1TGO A;  3GBT A;  3CJC A;  5KPZ A;  1JCG A;  3I55 N;  1B9F A;  2E2Q A;  3T69 A;  1YXQ A;  4AF1 A;  5TKW A;  3HOT A;  2E20 A;  4DLE A;  4E19 A;  3U9Z A;  4DV7 K;  1EET A;  4BRP A;  3SBT A;  1JJ2 M;  1UA0 A;  4CFD A;  2D1K A;  3EZW A;  1NK9 A;  4DTJ A;  4BRN A;  3QES A;  3WUH A;  2VWB A;  3TAG A;  1L3S A;  3IAY A;  3GOI A;  4BE0 A;  5K14 A;  1SKR A;  5HRR A;  5AQT A;  1R0A A;  3ZX2 A;  5AQM A;  4WFB L;  5BRH A;  2PYJ A;  1VRU A;  1VSH A;  2YNH A;  3AVN A;  4JLH A;  3OS2 A;  4KH6 A;  1HPM A;  1HQE A;  5AQO A;  3SQ1 A;  3ASM A;  2IVP A;  4CGG A;  5C10 A;  5E41 A;  1I94 K;  4Z4E A;  4CHZ A;  3A5N C;  4OPA A;  4DU3 A;  1W97 L;  1IKW A;  3HPG A;  4L8R B;  1X3N A;  1C0F A;  5HRS A;  2WOM A;  2CH6 A;  4B1Z A;  3CQY A;  4FWS A;  4MO5 A;  4CF0 A;  2OA8 A;  4H5R A;  4LH4 A;  1LW0 A;  3QNO A;  3IMX A;  3N4Q A;  1S6P A;  3WNF A;  3VN5 A;  4DTN A;  2ZGY A;  4AHU A;  1OVQ A;  2P9S B;  1VQP N;  1RBS A;  2QI2 A;  1MU2 A;  4O0J A;  4CZG A;  2VCP A;  4GV6 A;  4JKF A;  3OVN A;  2IGI A;  3L3U A;  1SL0 A;  4DTU A;  3HBT A; 
#chains in the Genus database with same CATH homology
 1TKX A;  4GVM A;  4KTQ A;  3DRP A;  4Y1D A;  1RT7 A;  4O55 A;  3OYI A;  1X9W A;  1Z25 A;  3NAE A;  3TAB A;  1BI4 B;  2XRI A;  3L3V A;  1Q9X A;  4AHT A;  3L2Q A;  1BHL A;  1ITG A;  2X6S A;  1S1U A;  3VQ6 A;  4DMN A;  3TI0 A;  3V1Q A;  3LWM A;  5JS2 A;  3ZT2 A;  3MEC A;  4FJK A;  5CY4 A;  4DQQ A;  2KZM A;  4F3O A;  3OS1 A;  3FFI A;  3PUF A;  3VA0 A;  2D5R A;  3QO9 A;  4E89 A;  1NK6 A;  3MAQ A;  3G10 A;  5CZ2 A;  1SL1 A;  3LAM A;  1ASU A;  3CYM A;  1GOB A;  1D8Y A;  3KLG A;  1VSL A;  1RCH A;  2ATQ A;  2NUB A;  5HRP A;  4TSX A;  3NCI A;  1ZYQ A;  1BIS A;  1HNV A;  2IS3 A;  4OJR A;  1YTA A;  2HNY A;  4CJE A;  1HQU A;  1CZB A;  1YT3 A;  3V9U A;  2O4G A;  4RW7 A;  1JLB A;  4CJV A;  3SQ4 A;  2ETJ A;  3ZSV A;  1TAQ A;  4OKK A;  5CYM A;  4FJX A;  3SV4 A;  3SJJ A;  3SYZ A;  1RDC A;  5HRO A;  3NFA A;  1XHX A;  3QET A;  1X9M A;  3B6O A;  3AVI A;  2FBT A;  2JLE A;  3JSM A;  4DQR A;  5CZ1 A;  4C8M A;  4CE9 A;  5DMR A;  3TAE A;  3RR7 A;  3C94 A;  1Y97 A;  4HCC A;  4IKF A;  5FRO A;  1BCO A;  3CM6 A;  4RW6 A;  1C1B A;  4QOZ B;  2HND A;  1S1T A;  3S3M A;  3TWH A;  4Z4G A;  2KFZ A;  4HUG A;  1JLG A;  2A1S A;  1A5V A;  4CJ5 A;  2HHX A;  3NE6 A;  3P1G A;  3K5O A;  1BGX T;  1I39 A;  1D5A A;  3ZSW A;  5KRS A;  1CZ9 A;  1QQC A;  1L5U A;  4B9V A;  2QKK A;  3DLG A;  3IG1 A;  1T05 A;  4H8K A;  4RW4 A;  3AVB A;  1KVA A;  1TK8 A;  4BDP A;  4M45 A;  2HW3 A;  1JL2 A;  4IDK A;  4LSN A;  4FM1 A;  2GBZ A;  4DG1 A;  1RBV A;  4Z0U A;  4CEE A;  3QLH A;  2G8I A;  1U04 A;  3BGR A;  3ITH A;  4M3W A;  1KFD A;  5EU7 A;  3ZT0 A;  4CHN A;  3AVK A;  4DWI A;  1T7P A;  4CK1 A;  2HHW A;  3VQ4 A;  3AO3 A;  5I3U A;  3V1O A;  4J2A A;  1JXB A;  2KQ2 A;  3NH0 A;  4M3Z A;  3OYE A;  3TAP A;  4H4O A;  3THV A;  1KSP A;  1QSY A;  4ELU A;  4CEQ A;  1LWE A;  3AO5 A;  3RTV A;  1HRH A;  5KRT A;  2Q3S A;  3RRG A;  4CJ3 A;  3RMA A;  1SKW A;  1FXX A;  1HPZ A;  3ZSQ A;  2Z1G A;  4FM2 A;  2ZE2 A;  2G8K A;  1RBT A;  1J53 A;  1RT2 A;  4DQS A;  3U6F A;  4B9L A;  1LAW A;  4HUF A;  1S1X A;  2B5J A;  2W42 A;  3K59 A;  3HL8 A;  1VSF A;  5J2N A;  1WAF A;  3F73 A;  4ELV A;  4IG3 A;  2YNG A;  3V6D A;  3LWL A;  1FK9 A;  3L8B A;  4DSE A;  3S9H A;  1IKX A;  1Z26 A;  2EHG A;  2P5G A;  4CFB A;  4E1M A;  1NKE A;  3LPU A;  4EP4 A;  3L2U A;  3T3F A;  4FVM A;  3KLI A;  1ZBU A;  3HT3 A;  4DF4 A;  4M3X A;  4JS5 A;  4I7F A;  4M42 A;  2HHQ A;  1UWB A;  3NF9 A;  1YTU A;  2PY5 A;  1HNI A;  5KTQ A;  4Z4H A;  4PWD A;  1VK0 A;  2X6N A;  4FYD A;  1YVU A;  1BI4 A;  5C42 A;  5HRN A;  1ZBH A;  1NK0 A;  2OPP A;  1KTQ A;  4KAZ A;  3M8R A;  5J2M A;  1ZBL A;  2KTQ A;  4OGE A;  2FBY A;  4CER A;  4DFP A;  1UAX A;  2OPQ A;  5FRN A;  3LP3 A;  4FK2 A;  4CEZ A;  4Z4C A;  2YV0 X;  3AA4 A;  1KCF A;  3NDK A;  4J2D A;  1N6Q A;  4GMJ B;  2YKM A;  3U3Y A;  2BGG A;  4Q5V A;  4CGJ A;  3CFR A;  2YKN A;  1NK5 A;  1W9H A;  4C8L A;  2P51 A;  1DTT A;  1ZBI A;  1NOY A;  4B8A B;  5I42 A;  3QIN A;  4O5B A;  1DTQ A;  2DY4 A;  4DFM A;  3I0R A;  4CK2 A;  3QNN A;  5KGW A;  4N56 A;  4FZX C;  4CF9 A;  3V9W A;  1NJW A;  3UIQ A;  1RTH A;  3VQD A;  1C1A A;  3LZI A;  2OZM A;  4OKE A;  4IBN A;  4RG8 A;  2OZS A;  3WNE A;  1S9G A;  1VSI A;  4CGI A;  3RRH A;  3MED A;  3LP1 A;  1KVC A;  1VSK A;  3KK2 A;  4KRE A;  4F2R A;  3DOK A;  2GUI A;  3QEW A;  2HHU A;  3U3G A;  3VQQ A;  4CIE A;  3MEG A;  3ZT4 A;  3ZSY A;  5SZT A;  4WE1 A;  4DLG A;  1X1P A;  1T03 A;  1NK4 A;  4CJP A;  4KTZ A;  4LY7 A;  4N41 A;  4CIF A;  2VWJ A;  2D0A A;  1VSD A;  1QHT A;  3PV8 A;  1J5O A;  4Z4I A;  5DK5 A;  1GOC A;  4F2S A;  2E6M A;  3LP2 A;  1TKT A;  3VQB A;  3TAM A;  4AHV A;  3ULD A;  2E6L A;  1SL0 A;  4B9M A;  4DTU A;  5T7B A;  2F8T A;  4DU1 A;  3KLH A;  1JLQ A;  2R7Y A;  4FLU A;  4DSL A;  4FJ9 A;  4E3S A;  1RTD A;  1KLN A;  1C1C A;  1KFS A;  2RPI A;  4CJW A;  1NJZ A;  1VRT A;  1J9A A;  2VG7 A;  4OKJ A;  1WAJ A;  1ASV A;  3EYZ A;  4DTM A;  2QKB A;  3AVL A;  1RT1 A;  4CHP A;  3KLF A;  1L3T A;  1D9D A;  1SV5 A;  2B6A A;  4M3T A;  3OYB A;  3OYJ A;  2QXF A;  3HO1 A;  1CXQ A;  3D0P A;  3AA2 A;  3DLR A;  3L2R A;  4CK3 A;  2G8V A;  4FJJ A;  2HHV A;  1XC9 A;  3PO4 A;  2OPR A;  4DTS A;  2HNZ A;  3ZT3 A;  1A5X A;  4Y1C A;  4DU4 A;  2XY6 A;  3ZSO A;  3T19 A;  4B3O A;  3HJF A;  1FKP A;  4R5P A;  4E7L A;  3SPZ A;  2ITG A;  3LAN A;  4RW9 A;  2F8S A;  4G1Q A;  4KRF A;  3AVC A;  2G8U A;  1IO2 A;  3S3O A;  1BQN A;  1HYZ A;  3QEX A;  1LWC A;  2G8W A;  4EZ9 A;  3DMJ A;  4CIG A;  3SZ2 A;  1RTJ A;  3S3N A;  4CF2 A;  4K8Z A;  1SL2 A;  3MXM A;  2HMI A;  4NCB A;  3HYF A;  3O4N A;  4FJ7 A;  4KTW A;  4B8C A;  3EY1 A;  4IFV A;  4OGC A;  3V9S A;  4DS5 A;  4CEC A;  3SUN A;  1VSM A;  4B9T A;  3CG7 A;  4NCG A;  4BAC A;  3V9Z A;  4KV8 A;  1K6Y A;  4FJ8 A;  2XHB A;  3KTQ A;  3NH2 A;  4ZTJ A;  4ID1 A;  1ZBF A;  4CJU A;  3AVG A;  3CFO A;  1NJY A;  4HTU A;  3E01 A;  3AVJ A;  4B08 A;  3OJU A;  4FLX A;  3PX4 A;  2YNF A;  1LAV A;  3MEE A;  3HK2 A;  1U45 A;  1GOA A;  3ALY A;  1G15 A;  3CQ8 A;  4OPK A;  3MXJ A;  5FRM A;  2DFE A;  3NGZ A;  1CLQ A;  2OPS A;  1JLA A;  4C8N A;  1RDA A;  4O4G A;  1IH7 A;  1S1V A;  4CHY A;  4FW2 A;  2JGU A;  4CJR A;  1EX4 A;  4CFC A;  2VG5 A;  3NF6 A;  2I5J A;  3ZSX A;  4HUE A;  1NJX A;  3C6U A;  4DQI A;  3QEI A;  1C0T A;  5KGX A;  2A1R A;  3HPH A;  2ZD1 A;  1RDB A;  4IG0 A;  1KRP A;  3KK1 A;  3ZSR A;  4F8R A;  2P1J A;  2Y1J A;  4NCA A;  1LWF A;  3ISN C;  3SV3 A;  3OYA A;  2KZZ A;  3AO1 A;  3M8S A;  3PY8 A;  3RWU A;  3HST B;  3WNH A;  3HP9 A;  2X74 A;  4DTO A;  1TL3 A;  1TKD A;  1JLE A;  4E0D A;  4KHW A;  4MFB A;  3OYK A;  3RMD A;  1NK8 A;  1KLM A;  5HP1 A;  4Z4F A;  1C0U A;  4FK4 A;  4CEA A;  2X78 A;  4C8K A;  2PYL A;  2QK9 A;  3L2W A;  1U47 A;  3SUQ A;  1RT6 A;  3AV9 A;  1XI1 A;  4N76 A;  4KB0 A;  4NYN A;  1W0H A;  1QSS A;  1VSJ A;  3DLE A;  3KLE A;  4FCY A;  1HMV A;  3QIO A;  4KHU A;  3DLK A;  3KKR A;  4E7H A;  4HVJ A;  4FJG A;  4CJ4 A;  3OYC A;  4FLT A;  2XY5 A;  4BDY A;  1S1W A;  3IRX A;  1RT4 A;  5C24 A;  4H4M A;  3VQA A;  1L3U A;  4FZY A;  3AVM A;  1NK7 A;  5D3G A;  3KIO A;  3VQC A;  3T1A A;  2PZS A;  4KI4 A;  3B6P A;  4DS4 A;  2BAN A;  3G0Z A;  2FBV A;  3K5L A;  3OS0 A;  1IKV A;  2FC0 A;  4W5O A;  3OYL A;  4CF8 A;  3SUP A;  3HVT A;  4CGF A;  2YHA A;  4JS4 A;  3AO4 A;  2XO7 A;  5J2Q A;  2FBX A;  3NGI A;  4YNQ A;  3A2F A;  4I2P A;  3AVH A;  2OYQ A;  4FZZ A;  2BE2 A;  1I3A A;  2Z1H A;  1ASW A;  1BIZ A;  3K2P A;  4PA1 A;  3OYG A;  1S9E A;  4MQ3 A;  1A5W A;  1WSE A;  3QER A;  1TL1 A;  4J2E A;  4FJL A;  4LD0 A;  3VQ8 A;  2IOC A;  4CHQ A;  4FLV A;  1L3V A;  3DLH A;  3RR8 A;  2XY7 A;  4DFK A;  1RTI A;  4NYF A;  3K57 A;  3LAL A;  3L2V A;  3SQ0 A;  4CJQ A;  4PQU A;  3DRS A;  2HVH A;  2DTU A;  3DI6 A;  4I2Q A;  3K58 A;  5HLF A;  1T8E A;  1RT3 A;  3I8D A;  4CEF A;  3OJS A;  2IAJ A;  4CGD A;  4CF1 A;  4FJM A;  3NGY A;  4RW8 A;  3ZCM A;  3OYH A;  3DRR A;  3KD1 E;  1EP4 A;  1KVB A;  4LSL A;  3LAK A;  4DF8 A;  3OY9 A;  1JKH A;  4F3T A;  2F96 A;  3NBP A;  4I9L A;  3QIP A;  3ZSZ A;  4O0I A;  2DFH A;  4O44 A;  2WON A;  3LPT A;  4E7K A;  3WNG A;  4DTX A;  4FXD A;  1TK5 A;  4FJH A;  4K8X A;  3NF8 A;  4M3R A;  1BL3 A;  1EXQ A;  1JLF A;  4CHO A;  1HYS A;  4M41 A;  4N5S A;  5J2P A;  3SCX A;  4DFJ A;  4DSI A;  1WSI A;  2G8F A;  3OYN A;  4M3Y A;  4CCH A;  5FDL A;  1XHZ A;  2Y1I A;  3DM2 A;  1C0M A;  3EZ5 A;  4DSK A;  2RN2 A;  3AO2 A;  4QCL A;  3DOL A;  1NOZ A;  1TK0 A;  2P5O A;  3O4Q A;  4E7J A;  2HHT A;  4FLW A;  2Z1J A;  3VQP A;  4ELT A;  3TAN A;  2B4J A;  3HP6 A;  3V1R A;  3LP0 A;  2IDO A;  5JS1 A;  1VSE A;  5CYQ A;  3DLB A;  4KHY A;  4PUO A;  1HJR A;  2HB5 A;  4AH9 A;  2G8H A;  2RF2 A;  1TVR A;  2RKI A;  3M8P A;  3V81 A;  4J2B A;  1JLC A;  4I9Q A;  4CGH A;  1DLO A;  4BWM A;  4KI6 A;  1RIL A;  3SQ2 A;  4N47 A;  2ZQB A;  4JRP A;  1WNS A;  4BE1 A;  4DTP A;  3CM5 A;  4FW1 A;  1IG9 A;  3MXI A;  4HCB A;  3RMB A;  3OYF A;  1D9F A;  1WSF A;  1N5Y A;  2EX3 A;  1BIU A;  4AHR A;  4FLZ A;  4AIL C;  2BDP A;  1LW2 A;  3NF7 A;  3RMC A;  1F21 A;  4FJ5 A;  4DQP A;  4CJS A;  4FM0 A;  3SI6 A;  4KPY A;  3AVA A;  1TAU A;  4CJT A;  4DTR A;  4ID5 A;  4KB1 A;  4OLA A;  4HHT A;  4Q0B A;  3O3F A;  3VQ9 A;  4CED A;  3PO5 A;  2KFN A;  1JL1 A;  4E7I A;  2VWK A;  4KHQ A;  4QAG A;  3KJV A;  3O3G A;  1WSJ A;  4B9N A;  4KHS A;  3SUO A;  1HYV A;  4IFY A;  3HPO A;  3AVF A;  3PX6 A;  1LV5 A;  4ZTF A;  4DSJ A;  1O1W A;  3P83 D;  3QEP A;  2D0C A;  4CJF A;  4B9U A;  1RBU A;  4FLY A;  3HXM A;  3LDS A;  1QTM A;  1TGO A;  3OYM A;  4FJI A;  3ZT1 A;  2HVI A;  3F9K A;  1U49 A;  4BDZ A;  3HVR A;  1IKY A;  1B9F A;  3AA5 X;  2XY8 A;  1SUQ A;  4W5R A;  5KI6 A;  3TR8 A;  4E19 A;  4DLE A;  3IS9 A;  3OYD A;  4GW6 A;  3HM9 A;  1UOC A;  4PY5 A;  3NH1 A;  2D0B A;  1EET A;  1TV6 A;  3KKS A;  2VG6 A;  1RNH A;  4LH5 A;  1S5J A;  5HBM A;  1UA0 A;  4CFD A;  5C25 A;  1Q9Y A;  1TKZ A;  1B9D A;  4OLB A;  1NK9 A;  1BCM A;  4DTJ A;  1UA1 A;  3P5J A;  4EP5 A;  3QES A;  3KK3 A;  4YFU A;  3VQ7 A;  3TAG A;  3BDP A;  1L3S A;  4B9S A;  3TAR A;  3I0S A;  3IAY A;  4BE0 A;  1XWL A;  5K14 A;  3V9X A;  3NHG A;  1SKR A;  5HRR A;  5J1E A;  4CFA A;  1NKB A;  3CFP A;  2E4L A;  1R0A A;  3D45 A;  2AJQ A;  1C6V A;  4KKO A;  1U48 A;  2DFF A;  4E1N A;  2LSN A;  4W5Q A;  2YHB A;  1U4B A;  4M3U A;  2PYJ A;  2Z1I A;  1VRU A;  3VQE A;  4BWJ A;  3QEV A;  1QE1 A;  4OPJ A;  2HHS A;  1VSH A;  4ZHR A;  2YNH A;  3AVN A;  4W5N A;  4JLH A;  4C8O A;  3OS2 A;  4CEB A;  1RBR A;  4ICL A;  3VQ5 A;  1JXE A;  4FJN A;  3M8Q A;  1WLJ A;  1HQE A;  4W5T A;  4KO0 A;  3SQ1 A;  3ASM A;  4CGG A;  4AHC A;  3TAQ A;  2GV9 A;  2IC3 A;  1S6Q A;  5E41 A;  4Z4E A;  4CHZ A;  4EZ6 A;  4UQG A;  4DU3 A;  3AA3 A;  3K5N A;  1WSH A;  1IKW A;  3HPG A;  5SWM A;  3PX0 A;  4L8R B;  1EKE A;  1X9S A;  4CJK A;  1J54 A;  5HRS A;  3C95 A;  1B92 A;  2WOM A;  1BQM A;  3KD5 E;  3LZJ A;  3JYT A;  1QSL A;  4CEO A;  4CF0 A;  4JRQ A;  1WN7 A;  2OA8 A;  3TAF A;  4LH4 A;  4CES A;  1RDD A;  4KHN A;  1LW0 A;  3QNO A;  1FKO A;  1SKS A;  1QS4 A;  3SNN A;  1S6P A;  3WNF A;  3VA3 A;  3VN5 A;  4DTN A;  3SPY A;  1Q8I A;  2KW4 A;  3O3H A;  4AHU A;  4DSF A;  3C6T A;  3V4I A;  4FK0 A;  2O4I A;  3H08 A;  3K5M A;  1RBS A;  4O0J A;  1MU2 A;  1NKC A;  4AHS A;  2YNI A;  3DYA A;  4F4K A;  4KFB A;  1CXU A;  1RT5 A;  3OVN A;  2IGI A;  4XIU A;  4OVL A;  3L3U A;  1REV A;  4BE2 A;  4CJL A;  1WSG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...