3KJVA

Hiv-1 reverse transcriptase in complex with dna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
556
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
total genus 128
structure length 549
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kjvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kjvA05
3PX0A 2GIRA 5EWEA 3K5MA 3K5LA 3MECB 1TL1A 3VQDA 1KCFA 4LSNA 1WN7A 4DMNA 4JV2A 3LP2A 4O3SA 2KZMA 3BREA 2JEGA 5KFZA 5K14B 4IH6A 5T14A 2HNDA 2KFNA 1JKHA 1KHVA 4CHPA 3HHKA 4TSXA 1KVCA 2R2TA 4BE1A 1RTDA 4YR2A 3CFOA 3SQ1A 3SQ4A 5D3GB 4K4WA 3U3YA 4JRQA 1DTQB 3LANA 3TQ1A 4Q0BB 3RMAA 1B9FA 3TVKA 1DLOA 4ZP9A 2A1RA 1TVRA 3AO4A 5JS1A 3KKRA 4DS4A 1J5OA 4ECQA 3MFIA 2ITGA 3DYAA 4YMEA 1BHLA 4DTJA 4O0IA 5F9NA 4ZMMA 3C6UA 3PW5A 5C5JA 3OY9A 3CDUA 2WK4A 3OYGA 3NBPB 3AVMA 4KREA 1JLFA 4B9MA 2WONA 4KKOA 3K57A 1NK6A 4CEEA 5FDLA 1HQUB 4QWEA 1HNIA 3PVXA 4R8UA 4EEYA 3PUFA 5HLFB 2BQ3A 3HYFA 4O5BA 4CEAA 4B9UA 4ZPAA 1U48A 3O4QA 1HYVA 3VQPA 5KFIA 2RDIA 2WB4A 4NCBA 2YNGB 2B5JB 2WCXA 4FJIA 3KHHA 3ITHA 2R8HA 3FFIA 4CJFA 1ASWA 3PJWA 5JUMA 3IG1B 3MF5A 4J9QA 3T1AA 1TKXB 3OSNA 1JXEA 3NGIA 2XC9A 3MAQA 4O3OA 4FJ7A 1RTHA 1D8YA 4FM1A 5J2PA 4W5RA 3DOLA 4PY5A 3H4DA 2YKMA 4DTOA 4CFDA 4WYLA 1QSYA 2EC0A 2CJQA 4YQWA 2YNHA 4M41A 3H2LA 2QXFA 4QWBA 1LWEB 5C24B 3UDLA 4CERA 5KI6A 4IFVA 1CZ9A 3QO9B 3G6XA 4ZP7A 4NRTA 1BCOA 4H4MA 1MMLA 4KB7A 3UIQA 5EDWA 4KAZA 1U49A 4FS1A 2HWHA 4WE1B 4CESA 2XI3A 4CJKA 4DG1A 5KG0A 4CJUA 3NFAA 4KFBB 5F8HA 3H98A 1DTTB 4M3TA 3ZSOA 4DSIA 1C1AA 2XO7A 4H4OB 4ED0A 1VSIA 3PO5A 4Q43A 2W9CA 3DLGB 3GV8B 2QK9A 3OS0A 4DS5A 3LP3A 1N48A 4EP4A 2HHSA 4KHMA 3DLHA 1RT4B 4FCYA 3V9UA 3VQ6A 3D5MA 2P51A 4QW8A 4ZP6A 3ICLA 4N56A 3KJVB 2FC0A 3G6VA 2HMIB 1FXXA 4FLTA 1ASUA 1KRPA 3HP6A 3CIZA 4N76A 4TY8A 3TAMA 3HVTA 3O3FA 4FJNA 4OL8A 1RBTA 4NRUA 3DM2A 4LSNB 4DSEA 3HKWA 3LP2B 4QWAA 2HNDB 1JKHB 1FK9A 3UPFA 4M3ZA 2G8KA 4DQIA 2ZE2A 4KHUA 3CDWA 4EBEA 1QQCA 3VQ5A 3NH0A 4ZTJA 3L3VA 3NHGA 4J9OA 3QINA 1BIZA 1VSHA 1NKCA 1S9EA 3QGHA 4KHNA 3DI6A 3S3NA 4ZP8A 3H4BA 1DLOB 3QZ8A 1K1SA 1TVRB 2BQRA 4Z4FA 1J5OB 5L1JA 3DYAB 3SYZA 3C6UB 4DL7A 3SUQA 4F50A 1ZYQA 4RNOA 1W25A 2VG7A 2WONB 4KKOB 3BSCA 4NCGA 4NLXA 3V9SA 5FDLB 5KG5A 4TXSA 1NKBA 1HNIB 3KOAA 5HBMB 3QIDA 4DU4A 2X6SA 3Q8SB 4ECRA 4FBTA 3SNNA 1S9GB 4WFYA 4NYZA 3SQ2A 5F8NA 1NNDA 4CGFA 4AHVA 4NLTA 3V1QA 4CIFA 3ITHB 2F8SA 4C8MA 3FFIB 3SUOA 3JSMA 4AHTA 3K5NA 3O3GA 4FJ9A 1ZBIA 4KV8A 3ZSVA 4HUFA 1SKRA 1RTHB 5J2PB 1RT3B 1R0AA 5DG9A 4F4KA 4WFXA 4FZYA 2YKMB 1JXBA 4ECUA 1N56A 4DEZA 4F8RA 4N41A 1C0MA 3PX6A 3SI6A 4ID5A 2BGGA 4URQU 4ZPCA 1XHZA 3BSAA 2WOMA 4H4MB 5CZ1A 4E7LA 3H08A 3QNNA 1REVA 2FLLA 1KTQA 1RBRA 1UA0A 3OYJA 3BR9A 3B6OA 3OYIA 3QEWA 5KGWA 1S5JA 3M9NB 4DG1B 1U09A 3RBEA 3VA0A 3O3HA 4O4RA 3KMQA 4CHNA 4NLWA 3QYYA 4FJHA 1L5UA 4QW9A 5DK5A 1K1QA 1QSLA 3NL0A 5J2MB 3DRRA 2W9CB 3O4NA 4ZPDA 3HP9A 4NLGA 4J9MA 3NF7A 4KTQA 3N6LA 3AVFA 3N6MA 5KFYA 3I5AA 3AA4A 3ISNC 2PYLA 2WHOA 4AHSA 5J1EB 1D5AA 1TK0A 1BIUA 1HJRA 4KB0A 4FLWA 4IFYA 3AV9A 3LALA 2V4RA 2UVUA 3EZ5A 3RB6A 1FKOA 4WYWA 3MR2A 4LH4A 4CHYA 1Q9YA 1IO2A 4KPYA 4K4ZA 3CM6A 3KLEA 2V9WA 2G8FA 4TY8B 4QWDA 3TAMB 1SKWA 3HVTB 3GV7B 4G3IA 1C1CA 4YFUA 3DM2B 5KFKA 1C0TB 4C8OA 3C94A 1UA1A 4BDZA 4PQUA 1GX6A 1FK9B 2RPIA 4TLRA 2ZE2B 1HQEA 2ZD1B 3L3UA 4EP5A 3M8QA 4JS4A 2IDOA 5C42A 4FJXA 3GIKA 2OPPA 2VG6B 2HNYB 1RBUA 1S6PA 3ZSZA 3AA3A 4FJ5A 3KLFA 3FQKA 1S9EB 1JLEA 5HRRA 3RMDA 3DI6B 5EWGA 4IRDA 1HYSA 2C2DA 3LP1B 4EYHB 3LPUA 4K4TA 1IKXA 1FKPA 3KNAA 2IM1A 2XCPA 1D0EA 1YTAA 5DQGA 2FBYA 3QGGA 1UAXA 2P5GA 4ECTA 4OGCA 5DQIA 2XY5A 2VG7B 3IGNA 4NCGB 1B92A 5T7BA 1U47A 2WTFA 3LWMA 1BI4A 3NH2A 2BQUA 4KTZA 3CVKA 5J2QA 5KFTA 4CE9A 2XI2A 2IM2A 3JSMB 3T3FA 2UVVA 5EUHA 1NJZA 4KV8B 3HO1A 3DOKA 1D9FA 4QCLA 4LSLA 4B8AB 2YNIA 3RBDA 1R0AB 4FJMA 1MU2A 3I5BA 1RBVA 1WNEA 1KHWA 4CHQA 4F2SA 5KFNA 3SPZA 4OLBA 3RR8A 2DY4A 3PY8A 4BE2A 4Y2CA 4ID5B 3HPHA 1NK4A 1NK0A 2PY5A 2WOMB 2P5OA 2AU0A 4N47A 1REVB 2HHUA 2OYQA 5DGBA 3VQAA 2Q3SA 3SUPA 3WNEA 5KFXA 4Q45A 3WNHA 3UQSA 4KE5A 3ASMA 5DLGA 5DGAA 2YV0X 2B43A 4KBIA 3L2WA 3QEIA 2YKNA 1HMVA 4AILC 1CLQA 3MEGB 2G8WA 3UR0A 4Z4EA 2PYJA 1RNHA 3G0ZA 2R8GA 1LAWA 1T7PA 3H59A 3FSIA 3D45A 3OS2A 1RT1A 3OYBA 1IKVA 2XRIA 1WAJA 1WSFA 3RAXA 1TV6A 2DPJA 5KT5A 4IFYB 2BANA 1LAVA 1S6QA 3IRXA 4FJ8A 4LQ3A 1FKOB 1S1TA 3HSTB 4E19A 3KHGA 2QKBA 4M3XA 4CJTA 4MK8A 4RW6A 4F2RA 4CJEA 4I2PB 1HARA 2D3ZA 1C1CB 4DF8A 4DSFA 2G8VA 1TL3A 1RYSA 2GUIA 4DFMA 3VQSA 3OSPA 4O3QA 4MFBA 4NLOA 4NLSA 2W7PA 4J9NA 4PQUB 3V6DA 1SKSA 2Z1GA 3DLBA 2DFEA 1HQEB 3M8QB 4EBDA 4L8RB 5C42B 4QPXA 4JLHA 4F4XA 4KHQA 1NJWA 4EZ9A 3V9XA 1QAIA 1S6PB 2FJVA 4CF1A 3HXMA 3AVJA 3KLFB 2JLEA 1JLEB 4ECVA 4ED1A 2HHTA 3NAEA 4HUGA 3TR8A 5FRNA 1JLQA 1HYSB 4F3TA 4PA1A 2V0NA 2UVWA 4Q8FA 2Y1IA 4Y1DA 1IKXB 1FKPB 2C2RA 4FYDA 2IA6A 3VQ7A 4DTXA 2LSNA 2R2UA 3DDKA 3KLHA 2O4GA 3KTQA 2XY8A 1VSDA 3PR5B 2O4IA 3RR7A 5KFMA 1IG9A 1JXLA 4MIBA 4NLRA 1S0OA 4RG8A 3C6TA 4TY9A 2A1SA 3ISND 1S1VA 3F9KA 5I42A 1TGOA 4FJKA 3CFRA 1KLNA 4J9LA 4M94A 3OYLA 5J2QB 1L3UA 3HVAA 3NF8A 2AGOA 2E9TA 2QV6A 1TKTA 1KSPA 1C0UB 4CK2A 2IS3A 4JV1A 3DOKB 2FBXA 1J9AA 1JIHA 3QZ7A 3PJXA 1MU2B 4I2QA 4M3YA 4ICLB 4CJ3A 3BGRA 4OPJA 2O5DA 4Z4GA 3I0SA 3OHAA 2R2RA 2QE5A 4HYKA 5KG4A 3KD5E 4E1MA 2PZSA 4DL3A 4XPCA 3LZIA 3HT3A 1S1UA 4DFKA 2R8IA 1EETA 3NGDA 1VSKA 2AX0A 2X6NA 1HRHA 2VG5A 1YVUA 2B6AA 5CY4A 2F96A 1TKZA 3MR6A 5KT3A 3DLRA 1NOZA 3HL8A 1HYZA 1CZBA 3HPGA 1TK8A 2VA3A 3DLEA 4U7CA 5KT4A 4K4UA 4G1QB 2ILYA 3ULDA 3SZ2A 1UWBA 5HRNA 1N5YA 2J6SA 3AVIA 4RW9B 2G8HA 4URGA 1XR5A 1Z4UA 4FXDA 2AWZA 1TAQA 2XY6A 1RT1B 1IKVB 2W9BA 5KG2A 2JEFA 1TV6B 2FVRA 2BANB 4K8XA 3CJ5A 3OL6A 1IH7A 1S6QB 2IOCA 3IRXB 1S1TB 1VRTA 4RW7A 1JL2A 3MEDA 3OYNA 1L3VA 4CEBA 4Q44A 2ZQBA 3FRZA 1S4FA 4DL6A 2E6MA 2D3UA 1G15A 4RW6B 3RAQA 3AO5A 4FLYA 3P83D 3HK2A 2UUWA 2NUBA 1LV5A 1TL1B 4MFBB 3RWUA 1IKYA 3V6DB 4AHCA 5HRSA 1IM4A 4CF2A 3KLGA 1RTIA 4IRKA 3NDKA 1U45A 3V9ZA 4DTNA 3TWHA 4ED8A 3SFGA 4F4WA 4E7JA 3TI0A 1RT7A 5KT2A 2DFFA 1RTDB 3ZCMA 2OPQA 4CEFA 4FLVA 4QWCA 4FW2A 3TABA 4ELVA 5F8IA 3T5LA 3M8SA 4CCHA 3MXJA 3GQCA 1JLQB 4B9SA 4IH7A 4K4SA 1C1BA 2HHWA 4F4ZA 3KIOA 3KLHB 5DG8A 1RILA 4RU9A 1VSJA 2ATLA 3NCIA 5KGXA 2CKWA 1NJYA 3DRSA 4GC6A 4M42A 3TAQA 4B9NA 3OYKA 4MH8A 2AQ4A 4CJSA 5KFUA 1JLFB 3AVKA 1S1XA 3QGIA 5KT7A 3SCXA 1J53A 4R8UB 1S1VB 5I42B 3U6FA 1VK0A 1NJXA 3QEXA 4K4YA 4ZPBA 2JGUA 1TKTB 1C2PA 5FRMA 4RUAA 4DQPA 5KFCA 4KI4A 4DU3A 1S48A 2JEIA 1CXQA 3OLAA 4O3NA 5KFHA 4TN2A 5HP1A 2ILZA 5EWFA 2W8LA 1RTJA 3DOLB 3HM9A 1WLJA 4I2QB 1QHTA 4MIAA 3I0SB 5DQHA 4IBNA 4OKEA 5HROA 4IH5A 4N5SA 2F8EX 3PW2A 3VQ8A 3CJ0A 1KFSA 2YNHB 4J2BA 4IFVB 3M9MB 2RF2A 1S1UB 4J9RA 5I3UA 1EETB 4X2BA 5KFSA 5KFJA 4R0EA 4Z4CA 2B6AB 4HCBA 4B3OA 4H54A 2VWJA 4KB1A 1LWFA 3PHEA 2KFZA 4FZZA 3QESA 4FK0A 3TAGA 4BACA 3VQ9A 2J6UA 2BRKA 3DLEB 4LY7A 4Q8EA 2HHQA 4M3WA 3OYHA 1S9FA 1UWBB 3LP0A 4GW6A 1WAFA 2ATQA 3HVRA 4ELUA 4O4GA 1N4LA 1XC9A 4ECXA 4RUCA 2W9BB 3CDEA 3AVCA 3PX4A 5KG7A 3PR4A 1LW2A 3OHBA 1VRUA 3GYNA 4Y2AA 2FVCA 1S0NA 4RW7B 3CJ4A 3MEDB 4CF0A 4C8KA 1BL3A 4O0JA 4OJRA 5J2NA 3QLHA 2FJWA 3EZUA 2RDJA 3QEPA 4IRCA 3CQ8A 3KD1E 3DRPA 3K59A 1CSJA 4CGJA 3L2RA 1IKYB 1B9DA 3OYAA 4CJQA 3KLGB 1RTIB 1F21A 4BE0A 4CGIA 4KHWA 2HAIA 2D5RA 3OL7A 3KK3A 5KRSA 2EX3A 1NHVA 3QETA 3OVNA 1JLGA 3TAPA 4NCAA 4RNHA 2XGPA 1TK5A 1C1BB 1RBSA 4HKQA 1WSHA 5KFOA 1RT6A 2E4LA 1HNVA 4LH5A 1Q9XA 4RNNA 1NKEA 3MEEA 3QNOA 1LWCA 2FVQA 2AGPA 3QIOA 4TQRA 2JC0A 2FLPA 1XR7A 1BCMA 4Q5VA 4MK7A 4B8CA 3I8DA 4B9LA 1RDAA 4IG3A 3RTVA 4QAGA 4CJ4A 1EP4A 1EX4A 4OLAA 1RYRA 2GBZA 3VN5A 4M3UA 4GVMA 2XGQA 4CF8A 2YNFA 1O1WA 4MK9A 4J9SA 3IS9A 3IAYA 4KRFA 1JX4A 1HQUA 4DSLA 2ASLA 1ZTTA 4DU1A 2IGIA 2B4JA 3TARA 5HLFA 4UQGA 1IKWA 5KFWA 2HWIA 3NAHA 2D0AA 1XWLA 3P5JA 5HROB 1LW0A 1L3TA 3EYZA 1A5WA 4B08A 4CGDA 2W8KA 4KTWA 3MFHA 5KTQA 2AGQA 3SUNA 3OYEA 1TQLA 2GC8A 5KFGA 1BISA 4AHRA 2QKKA 5I3UB 4DWIA 1BQMA 3RB3A 3P1GA 1XR6A 4YR3A 4B3OB 5F8LA 1LWFB 4DQQA 4MKAA 1QE1A 4IR9A 1YTUA 4C8NA 3LAMA 3NF9A 2W9AA 1SH3A 5EU7A 3MR3A 1S49A 4ZHRA 3KK2A 4E7HA 1RCHA 2ALZA 3DRRB 4CJVA 3OL9A 4EYIB 3LP0B 3H5YA 3NMAA 3BDPA 2Z1JA 2UUTA 3V1OA 3AO3A 4WE1A 2IJNA 2D41A 1RA6A 4XO0A 2OPRA 4NYFA 2DPIA 2KW4A 2BE2A 3MXIA 4WFZA 1LW2B 1VRUB 2E9RX 4IOBA 5L1IA 4EO8A 3G86A 3QLHB 1WSJA 4CK3A 3LDSA 2AJQA 1SUQA 5KFQA 1T94A 3KLEB 4DTRA 1D9DA 3QERA 1X9WA 1ZBLA 4ZVFA 3DRPB 3MR5A 3KLIA 3T5JA 5KFDA 3ALYA 2XCAA 4CIEA 3ZT3A 2FVSA 3IN5A 1BGXT 2G8UA 1SL2A 3TAEA 4NLPA 3KJVA 3ZSWA 3ZSYA 4HCCA 4PUOA 1C6VA 3THVA 4Y3CA 1I39A 3KK3B 2OPPB 5KFAA 1RA7A 2Y1JA 3V6JA 4DSKA 1GX5A 4FZXC 1JLGB 3PW7A 4ED6A 4ZTFA 2IJFA 4NLDA 1A5VA 4W5TA 3NKYA 4RNFA 1RT6B 4FJLA 4FK4A 4O3RA 4ECYA 1HNVB 2DTUA 4AHUA 2I5JA 5CYMA 2G8IA 4O3PA 3MEEB 4IDKA 4MKBA 4J9PA 4I9LA 5JS2A 1LWCB 3E51A 3C95A 1Q8IA 2HVHA 2BRLA 2KTQA 1JLCA 5JXSA 3NGZA 1WSIA 4KHYA 3KMSA 1BI4B 5KFEA 3QEVA 4BDPA 3WNGA 4IG3B 3G10A 3S3OA 3OYCA 5KFBA 2Z1HA 1Z26A 1EP4B 4IQXA 2WRMA 2D7SA 3G6YA 4BDYA 2YNFB 4GMJB 3AVLA 4CJPA 5KT6A 3IS9B 3E01A 4O44A 3GV5B 1A5XA 3H5UA 4CJRA 5HBMA 4LSLB 2YNIB 3K5OA 1IKWB 3NH1A 4FLXA 4J9KA 4ECSA 2W7OA 1S9GA 3ZSRA 4RNMA 1U4BA 1LW0B 4CJLA 1N6QA 4FVMA 3ZSXA 1T05A 1NHUA 4HUEA 4B9TA 3KK1A 4WZMA 5E41A 3D28A 1T03A 2IAJA 1RT3A 3VQBA 1S97A 4DSJA 1BQMB 3ZT1A 2KZZA 3JYTA 4ECZA 4OVLA 3RRGA 4I7FA 1YT3A 2HHVA 3L2QA 3Q8PB 2RKIA 4JUZA 1WSEA 1QE1B 1S1WA 1W9HA 4BWJA 4JRPA 3V81A 3GIMA 4IG0A 4ZHRB 4CK1A 4CHZA 2YKNB 3KK2B 4CECA 1HMVB 1GOAA 4CFAA 1NOYA 3ZT4A 4YNQA 1VSEA 4LQ9A 3RMBA 4E3SA 2OPRB 2IMWP 4E7KA 5DMRA 2BE2B 1ZBHA 3BSOA 5J2MA 5KFFA 2R2SA 2ZKUA 5F8JA 3RMCA 1XHXA 2FBVA 1SUQB 3TANA 5KG6A 3PW0A 3GIIA 4EBCA 2OZMA 4ZVHA 1U04A 2R7YA 2XY7A 2RN2A 3KLIB 1TL3B 5J1EA 4PWDA 3H40A 3LWLA 3PZPA 4Z4HA 1RT2A 4RZRA 1VSFA 1ZBUA 3NAIA 4PUOB 4U6PA 4RW4A 4XPEA 5HRPA 3K58A 2DFHA 3VQCA 5KFRA 1UOCA 4YP3A 4EZ6A 1T8EA 2F8TA 2JEJA 3ZT2A 2OPSA 4CF9A 5CYQA 4FK2A 3KHLA 4YR0A 1C0TA 4KHRA 3CJ2A 4TYAA 2D0CA 3NE6A 3I5CA 3BQ1A 3KHRA 1WNSA 3H5SA 4Z4IA 3AVAA 3SQ0A 1JL1A 2I5JB 2ZD1A 5CYMB 3V6HA 2FVPA 2JC1A 4DTMA 3OJSA 2VG6A 2HNYA 4IDKB 3CG7A 4CEQA 1QAJA 4FJJA 3HJFA 4ED7A 4FW1A 4EO6A 4OKKA 1JLCB 4E7IA 5KG1A 3GIJA 1Z25A 3VQ4A 3C6TB 4WXOA 3LP1A 2OH2A 4F3OA 4NLYA 3VA3A 3V9WA 2YHAA 1QS4A 3AVBA 1SH0A 4CHOA 3DMJA 5KG3A 3OS1A 5F8GA 2GIQA 2P1JA 3BQ2A 4DL4A 2R8KA 4W5QA 3E01B 4O44B 1BQNA 1HPZA 4ECWA 1TAUA 5FROA 4KO0A 4ELTA 1Y97A 1TP7A 3BGRB 1QUVA 1ITGA 3NF6A 3B6PA 2HNZA 1N6QB 4M3RA 1T05B 2BR0A 1QSSA 4RW8A 3MXMA 3KK1B 4KI6A 4M45A 4DQRA 1T03B 4ZVEA 1KLMA 2IAJB 2HVIA 2FJXA 4NLQA 2ETJA 3TAFA 3FDSA 4E0DA 4FLZA 1GOBA 1SL0A 3JYTB 5L1LA 4I7FB 2VG5B 2RKIB 4W5OA 1TKZB 3HPOA 4ED2A 4K50A 5L9XA 1S1WB 3CM5A 3V81B 1WSGA 4XIUA 1EKEA 2X74A 3NGYA 3M8RA 4IG0B 4JV0A 2FBTA 1NK7A 5C25A 3RRHA 4DTUA 4F4YA 4KSEB 1L3SA 1YVFA 4R5PA 3T5KA 2EHGA 5SZTA 4J2DA 4E89A 4DFJA 3QIPA 4AH9A 2FLNA 4NLVA 3WNFA 3AO1A 4FS2A 4Y34A 1N5YB 4CGGA 4IR1A 1NK8A 1JLAA 3OJUA 3AVNA 3I0RA 3V6KA 3PV8A 4ED3A 4ZVGA 3CO9A 3SV4A 1NK9A 4J2EA 3F73A 2VA2A 4FM2A 4O55A 2HHXA 3M8PA 1OS5A 3U3GA 4CEOA 2V4QA 3VQEA 3MEGA 4E1NA 1KVAA 3AVGA 1VRTB 4NZ0A 1RAJA 3EPGA 1X1PA 2HW3A 4WZQA 3DLKA 4FBUA 4KHSA 3L2UA 3D0PA 4HTUA 5SWMA 3H5XA 4K4XA 3Q8QB 4PWDB 1XI1A 3L2VA 1RT2B 3IGVA 4C8LA 4W5NA 5F9LA 2UVRA 1JLBA 3SFUA 4RW4B 1S0MA 1SV5A 1ZTWA 4Y1CA 1RT5A 3OLBA 1X9SA 1RT7B 5KFVA 3V4IA 1I6JA 1VSLA 4I2PA 2IC3A 2OPQB 2OPSB 5CYQB 1RDDA 3MECA 2J6TA 1KFDA 1ZBFA 5DLFA 5K14A 1SH2A 2C28A 2C22A 3OYFA 1I3AA 4J2AA 1X9MA 3SJJA 1NK5A 3PO4A 3DRSB 2OA8A 4NLUA 2ASJA 3K2PA 4B9VA 2OZSA 4FJGA 5L1KA 5KFPA 3T5HA 5D3GA 1S1XB 3KKSA 4CJWA 4CIGA 3LZJA 1DTQA 4Q0BA 4ID1A 2IBKA 3DMJB 3EPIA 1J54A 3T19A 1T3NA 3S3MA 3VQQA 3NBPA 2AX1A 3BQ0A 3OYMA 4DL2A 4M95A 2Z1IA 1BQNB 3BSNA 2XHBA 1HPZB 5HP1B 3CWJA 4IKAA 4KO0B 1RTJB 4WXWA 2ASDA 1S10A 3L8BA 1TKDA 3PW4A 2GV9A 2I1RA 1C0UA 2HNZB 3CJ3A 1K6YA 4K4VA 2YNGA 2B5JA 2YHBA 4LD0A 4RW8B 1D1UA 4DL5A 2E9ZA 3IG1A 5DG7A 3RB0A 1RDCA 1KLMB 1TKXA 2W42A 4HHTA 3AA5X 3N6NA 2RF2B 3M9OB 4NYNA 1CXUA 4TQSA 3AO2A 4CEZA 3AA2A 4OPKA 4Z0UA 4ICLA 3A2FA 2X78A 3SV3A 4H8KA 3LPTA 3LAKA 5C25B 1QTMA 4I9QA 3OL8A 1LWEA 5C24A 2IM3A 4DTPA 3CFPA 4R5PB 3QO9A 2D0BA 3QIPB 3GILA 4K8ZA 2IM0A 3BJYA 1ASVA 1RDBA 4CJ5A 1JLAB 4O4GB 2E6LA 4OGEA 1GOCA 4DTSA 3Q8RB 3SI8A 3I0RB 4TYBA 2BDPA 4KFBA 4CFBA 1EXQA 1DTTA 2R8JA 4DLGA 4DQSA 3FQLA 3M8PB 4GC7A 5KFLA 3RB4A 4G1QA 4CEDA 4H4OA 3EY1A 4DLEA 4MQ3A 1KVBA 3S9HA 4IKFA 4URSA 1SL1A 4OKJA 4JS5A 4RW9A 3DLGA 4DFPA 3DLKB 5J2NB 4BWMA 4FLUA 3OYDA 4CGHA 2KQ2A 4FM0A 5KRTA 5CZ2A 2C2EA 3MTKA 4HVJA 3ZT0A 3HVWA 3AVHA 3SPYA 4KAIA 1VSMA 4DF4A 1RT4A 2XWYA 4QOZB 2HB5A 3CYMA 1JLBB 2VWKA 5F8MA 2HMIA 1SV5B 1RDRA 1RT5B 3ZSQA 3KLVA 1ZETA 4CFCA 3V4IB 3V1RA 2IC3B 1W0HA
chains in the Genus database with same CATH superfamily
2GIRA 4DV6F 3GCWP 3IMXA 3I4PA 4RU2A 3MECB 1KCFA 1OH8A 1MMDA 4YDUC 4JV2A 4O3SA 1N36F 2JEGA 5KFZA 5K14B 2KFNA 5T14A 1IBLK 3NP5A 3O3LA 4QIVA 2ZOMA 1HR0F 2Q79A 3CE8A 4HL9A 4DPUA 3NMRA 4KHPF 4BE1A 4YR2A 2HURA 3QBWA 4JK7A 3SQ1A 3CPEA 2FGCA 2MKCA 3CNQP 3H3NO 2DNRA 4BC9A 4OPHA 1DTQB 5D78A 4Q0BB 2P8IA 2ZM6K 1TVRA 1X31C 3DYAA 4YMEA 1F1BB 4EFAC 4KGXB 2DGUA 2OAUA 2Q3PA 4C11B 3PW5A 3CDUA 5FIIA 2IBOA 1Z2LA 1FJGJ 3AVMA 5FPDA 2WONA 4KKOA 3K57A 1NK6A 2EEYA 5FDLA 1RWKB 3BKFA 4IJAA 1Y7PA 4GV3A 2QI2A 2IDEA 1MA9B 4R8UA 2CVIA 4EEYA 5IXUA 2BQ3A 1U48A 3O4QA 3VQPA 3QQCD 4UOCA 4NCBA 2YJEA 4C7QA 3I9V9 4CJFA 3MF5A 2FC8A 1K8AO 4W4MA 3DXMB 3NGIA 1TUGB 3VQTA 4OI3A 3MAQA 2A18A 4FJ7A 3Q23A 1LOTB 3I33A 1TYQB 1MROA 3MK6A 2LXUA 3MM6A 4WYLA 5EY4A 2EC0A 5E5NA 4C0HA 5E84A 4YQWA 2RRNA 1N32J 3H2LA 3A8IA 2QXFA 3HHDA 4QWBA 5C24B 4CERA 1U6ZA 4IFVA 4PG8A 4AFFA 2E1MC 1DEJA 4FWPA 1XNRF 3BN7A 4ZCLA 1O51A 4OYXA 2N3LA 3DN9A 2XI3A 3MMBA 4DG1A 2LCWA 3PYEA 2VB6A 3HSJA 1YRUA 1YRTA 4QPTA 1NH8A 4DSIA 3HRGA 1C4AA 2BV3A 1RGIA 1FRKA 3OV7A 2ZGYA 4H4OB 1XK8A 4JAXA 4CLWA 3PO5A 4Q43A 1HKAA 4X62F 2W9CA 4ANEA 3GV8B 4FKXA 4TNOA 4JD2A 1PYSB 3OS0A 1BDGA 4CM2A 1N48A 2E5IA 2Q97A 1RT4B 2G4BA 2XEXA 3VQ6A 3D1OA 1KD1O 3ET6A 3MWPA 3FCHA 4L74A 3ZO7A 3KJVB 1IBMJ 1P1LA 4AM7A 3BR8A 5K8PA 1RB0A 3A5OC 1FXXA 2LU2A 1JCFA 3HP6A 3Q2TC 1IR1A 3TAMA 4H0YB 2GQCA 4FJNA 3WXIA 4DV4K 3R9PA 4OL8A 3R6MA 3FEXB 4LSNB 2FSNA 4BRPA 1JKHB 1FK9A 3UPFA 1TTHB 3DJCA 4KHUA 3H3OB 3H2VE 4LF9F 3NNCA 4CDIA 1J2VA 1GXUA 2VPYB 3AB4B 1PBAA 2CNLB 1VSHA 1VOMA 2IY5B 3QGHA 1WOSA 1ILYA 1XBWA 4ZP8A 3H4BA 3QZ8A 3IDHA 1J5OB 4GVLA 4U7UK 4CJ7A 5A76A 3SYZA 3N79A 5ETKA 1FJCA 3AXMA 1W25A 1U2VA 4TXSA 3KG0A 1HNWF 4B3MJ 2KXHA 3M4XA 2PBDA 2DD8S 1S7IA 3S1TA 3SQ2A 1NNDA 1CC7A 3A5MC 4AHVA 4NLTA 5AZIB 3ITHB 4C8MA 1B70B 4LF4J 2EG2A 4RBTA 4B3RK 3ZSVA 4BROA 1KAYA 2BW2A 1RTHB 5J2PB 3NVKA 1RWVB 2VWBA 7FDRA 4FZYA 1RKIA 2QXLA 1IBLJ 3R1HA 2VBZA 4WK1A 2P9NB 1C0MA 3LDNA 3PX6A 1D4XA 2CJ9A 4ZPCA 2LMIA 1S72N 1XHZA 2WOMA 1KEKA 3QNNA 2FLLA 3PIOL 1UA0A 3OYJA 4RWTA 3BR9A 5AJ3J 3W8PA 2ZM6J 3KJQB 2DEJA 3M9NB 2C3YA 1S72S 3ULEA 3BGLA 3QYYA 5T41A 4FJHA 4QW9A 5DK5A 1R7IA 1LEOA 5C7PA 4K2JA 1LXJA 4FYXB 4NI2A 3R5BA 3HP9A 4OHYA 3DHWC 1I3OB 3N6LA 3WXJA 2F40A 3N6MA 5KFYA 2PYLA 2ZF5O 2WHOA 4AHSA 1UVNA 2CPIA 5J1EB 4KB0A 4FLWA 3AV9A 4YOTA 1OVQA 1MSWD 2IPOB 4KPYA 4H5RA 2G13A 4UY85 3LF0A 2V9WA 4QWDA 1EKRA 3GV7B 3ZC4A 3KKFA 3QT7A 2NLXA 2PEHA 1S4EA 2H4YB 3LGHA 1QVGM 5KFKA 1C0TB 1CJUB 1CJKA 3OHRA 1UA1A 1PSDA 3IP0A 1GX6A 3J81O 2NSBA 3D3BJ 2DNKA 3MPVA 3M8QA 2DGQA 1MN7A 5C42A 3TZXA 2OPPA 4CLPA 3A8KA 4X64K 4OX9K 4PKDB 1S6PA 3ZSZA 3PKYA 3W62A 2MLZA 3DI6B 1WC4A 1WI6A 1HYSA 2C2DA 3LPUA 3KNAA 1FKPA 1KAZA 1V3RA 2VONA 3QGGA 2ZJQQ 4ECTA 2HBRB 4YOWA 4OGCA 2EFVA 2VG7B 2O3DA 3M2RB 4PHTX 5A6WA 4AQYK 3BUZB 2NPFA 1I51B 3NH2A 2BQUA 1AFJA 1EZZB 4LRAA 5AQWA 3DXBA 3L7OA 1TMJA 3LDQA 1TR0A 3JSMB 4YUDA 5EUHA 5FLXY 2ACMA 3G25A 3DOKA 2KHCA 3KFWX 3TEGA 4B8AB 1ICEB 1QVGR 4AYBD 5RUBA 1GLAG 4CHQA 4DV3F 4Y28C 2MQPA 4F2SA 4OLBA 4JI5K 2DY4A 4WWSA 1RWWB 3ZZRA 1NK4A 2P5OA 2B8QA 3TUJC 4YOEA 1NGBA 5CCMA 1E4GT 5AQIA 4EWTA 1BWFO 5LL6Z 5KFXA 1F9EB 2QN6B 3Q89A 2V6AA 2GEMA 3QEIA 2YKNA 1NZAA 1HHQA 1HMVA 1CJVA 4AILC 4QYRA 3U9DA 2FZCB 4DR4F 2PA3A 3H90A 3BF3A 2MHNA 4Z4EA 1QTNB 2KXNB 2YPYA 1T7PA 2B56A 3SLCA 3FSIA 4DCHA 2BW7A 1SJRA 3TUIC 3POTB 5AZJB 1WAJA 5CD4A 1OIAA 3RAXA 1TV6A 3PIPL 2HF3A 4IFYB 2PO4A 4ANCA 2BANA 4BCAA 2HSTA 3IRXA 4FJ8A 3BGFA 4ILGB 4P74A 1S1TA 2NXEA 2XZTB 1XNRK 2ZH4A 1UZDA 3BV8A 1HARA 1C1CB 4QOTA 2M5YA 1YAGA 2GUIA 3GYGA 4PXCA 4RJVA 5F0XA 4GO7X 4P9SA 4PQUB 3RBZA 2Z1GA 3DLBA 1HQEB 2QM1A 3IA0A 1YTYA 3HOTA 3OVAA 4IOCL 4L8RB 4OYIA 4QPXA 4JLHA 1T9WA 3KUGA 2VD3A 3CB4A 3K7RA 4YHHF 1FEEA 3MN7A 3FE1A 4CF1A 4X62K 5AQHA 3I6PA 3MM8B 1BD6A 1JLEB 3TR8A 4PL7A 3I87A 4NYOA 1U6BA 2V0NA 2UVWA 4Q8FA 2JFKA 2C2RA 4FYDA 1H72C 1RHKB 1PC4A 2R2UA 2LSNA 3KLHA 1HLWA 1TUUA 2CJAA 1HUXA 1D9AA 2CQ3A 2XWXA 5IOLA 2QO3A 4RG8A 2H3GX 1N33F 1H1VA 2BXJA 3CFRA 1KLNA 5J2QB 3EZOA 3HVAA 3NF8A 4MKVA 2AGOA 2A10A 3JS9A 2Q6CA 1NRKA 4OJ3A 4N8NA 2F65A 5KQDA 2UZAA 1KVKA 4JV1A 4LF9K 3GB0A 2QRRA 1NAQA 3NOGA 4YB5A 2NLWA 1BUXA 4C8ZA 3ATUA 1QVFM 5MLCV 3PJXA 1MU2B 4I2QA 4CJ3A 3BGRA 4KC5A 4OPJA 2B4PA 3OHAA 2R2RA 3W64A 1RJJA 4HYKA 6AT1B 4E1MA 5CCLA 3CCVS 4CBXA 2PZSA 3OTOJ 4JV5F 4JI6K 4X64J 4OX9J 4XPCA 1S1UA 4DFKA 3RGIA 2HIQA 2CRLA 1DARA 3NGDA 1VSKA 4NEYA 1VBXA 1YVUA 2B6AA 1G2EA 5CY4A 4L6V3 1NOZA 5LL6d 5IM0B 2CVEA 2M70A 1HNXF 4DV7K 3V4MA 4G1QB 5IV3A 3F9MA 4TVAB 4AQYJ 3MUMP 2G8HA 3TPQA 4DV6J 1XR5A 1Z4UA 2AT1B 1RT1B 5DDPC 1IKVB 1X4FA 2JEFA 1SQFA 4CZLA 4IUFA 4K8XA 1GMWA 3OL6A 2IOCA 2FDNA 1P90A 1HR0J 5BREA 2A42A 1VRTA 3OYNA 4X4QA 4Q44A 1T11A 3M3ZA 1YJVA 4DL6A 3KHYA 3RAQA 1ITPA 1PYTA 2K3KA 3A1YG 1SXLA 1FHTA 3AO5A 4FLYA 1NGDA 1J5EK 2UUWA 1LV5A 1TL1B 1YITN 1YXQA 1VQ7N 4H4KC 1YSJA 1KQKA 3MMVA 3QSYB 3NCRA 3I96A 4AHCA 5C2FA 3KLGA 3E8OA 4A61A 4FF2A 2UXCF 2XB2D 1SIZA 4ED8A 3B4DA 4E7JA 3TI0A 3UN2A 1KS2A 1YITS 1RTDB 4FLVA 4CEFA 1YRXA 4QWCA 2BH1A 4FW2A 1RU1A 2LQ8A 3GQCA 2MKIA 1JLQB 4DX5A 2MQMA 4IH7A 3JTPA 1B3TA 2MQ8A 2AEJA 2KT3A 4OLPA 4A8WA 3BZKA 2W2MP 1EWQA 3OT9A 2ATLA 3E1YA 5KGXA 4GC6A 2Z0GA 2Z58B 1FTCA 4CJSA 5KFUA 3BP8A 1S1XA 3QGIA 1IG8A 1PJ5A 1YJ9S 4CZFA 1J53A 3WC0A 4OHVA 3GZ7A 4B02A 4HVZA 3VMFB 3EGNA 1N34K 4K4YA 4FVUA 3OTCA 3K89A 5FRMA 1FX4A 1DQ9A 1XNRJ 1UVKA 3KWGA 1NCLA 3J81j 4O3NA 4NLBA 3MMAB 5F0UA 2ILZA 4OZ3A 2XG8A 3CJAA 5CR4A 1RTJA 1WLJA 2IMOA 2D0OA 5HQLA 2PA8D 1M5PC 3D2EA 2DT9A 1NGHA 4IBNA 1HA1A 3PW2A 4GV6A 2YNHB 2VGNA 2X7IA 2RF2A 3PRDA 2ZJPQ 5JVHQ 4X62J 2I9SA 1GLCG 5KFSA 2NSCA 1WC1A 4C3MA 4Z4CA 1Y10A 1V4TA 3GFZA 4ES2A 1CPZA 1LWFA 2COLA 3J7ZT 4F3QA 4TKTA 4LBHA 1OVYA 1NGAA 2QW9A 1NSAA 3MEKA 3UN5A 2J6UA 2BRKA 4Q8EA 2HHQA 1QZ6A 4HI1A 3OYHA 4DR1F 3B82A 1UWBB 3DAWA 4X84A 4GW6A 2P9SB 2ATQA 4OZ1A 3N5BA 1Q5YA 3KDOA 4ELUA 4HTIA 1N4LA 5HVFA 3NEKA 5KOWA 4DHYA 3JTOA 1U02A 4ECXA 1PILA 2NUHA 3W9IA 1X4DA 4ZLLA 1WBDA 3SCJE 1NGGA 3G6EN 3PX4A 2O01C 5KG7A 3CULA 3OHBA 1VRUA 3W7BA 1ZA1B 4OZ5A 1S0NA 2CIMA 4LF9J 4CF0A 4C8KA 1CQNA 3G6ES 2H5IB 5GAHU 4IRCA 1E6VB 1WEXA 1R89A 3R2DJ 4J37A 3AAQA 4PPZA 4CGJA 3L2RA 1IKYB 2JNJA 1B9DA 3MUVP 3A3PB 2W6KA 4BE0A 1LOUA 2HAIA 3W9HA 4ZVRB 3VEYA 3LM2A 3OL7A 2H5JB 3KK3A 4DHVA 1UVIA 2IRYA 1U0HB 1OJ4A 1NHVA 2OMOA 5BJRA 4DR4K 4NO7A 1ZZFA 4OHZA 3CGIA 4RNHA 1P8ZA 4LFAK 1VBZA 1F9HA 1C1BB 1RBSA 1TFWA 4HKQA 1VMBA 1WSHA 5KFOA 1FXDA 4BRAA 4DV7J 1ATNA 4OYBA 4ZJOA 1FTRA 4DN0A 2MQQA 3BZCA 2VJUA 1BCMA 3EKSA 2RAQA 5EXWA 1KWMA 4USHA 2EI5A 5D4NA 4B8CA 1RDAA 4JI2K 3VZHA 3RTVA 4CJ4A 1X4EA 1Y4ZB 2GBZA 2L9WA 3RW7A 4GVMA 2DK2A 4J9SA 3M05A 1PJ6A 4FSVA 3CC4N 2EFGA 4DSLA 3BO3A 4X4OA 1HX1A 4UQGA 3BBBA 3N9UC 1KBRA 5HROB 3CC4S 1L3TA 3FNNA 1W7WA 4CGDA 1HBUA 2W8KA 1Q95G 3SUNA 3PRBA 3HI0A 1X5TA 1C4CA 2CQIA 2EKNA 1TQLA 4MLHA 2GC8A 1VCTA 3B8HA 4AHRA 3VV2B 1U1PA 5I3UB 3NCPA 5SUHA 3RB3A 4PXBA 3SQGA 1H2VZ 3HD1A 5F8LA 3EVOA 3W2WB 2F9JA 2YHYA 1YTUA 3S7RA 3D0GE 4M63A 3LAMA 3NF9A 4FWNA 3ONQA 2APOA 3DRRB 4QU6A 5M2UA 2JZ5A 2Z1JA 1SQKA 1I94F 1F5CA 3V1OA 2O66A 3AO3A 2HIYA 2ZJRQ 4JYAK 1N34J 3PHTA 4NYFA 3MHYA 1MMNA 4CLLA 4WFBL 4IOAQ 1BG3A 2E9RX 4O23A 4FWSA 2WZ1A 4A2BA 5L1IA 4EO8A 5DS7A 3G86A 1APSA 5A8KB 4JV5K 1NB2A 3LDSA 1BE4A 3KLEB 1D9DA 4HR2A 1X9WA 4ZVFA 3DXKB 3MR5A 1RHQB 3T5JA 4ERDA 3M2UA 4ZOSA 3ALYA 4BG8A 3ZT3A 1TL7B 2P9UA 1AB8A 2Z2LA 3ENVA 1X60A 3S8SA 3ZSYA 4PUOA 4CI6A 4DBQA 4DV0F 4CO1A 2E5JA 4CZKA 4XEIA 2L41A 1GX5A 2XSFA 2B4VA 1WHWA 4ZTFA 2IJFA 1B4SA 4K42A 4FXVA 1Q7LB 2ZDPA 1R8CA 1MWZA 4CT9A 4ECYA 1HNVB 3O1WA 4AHUA 2I5JA 3CCWA 3CMES 5TKYA 3MEEB 4J9PA 2NRTA 4CO2A 3Q7CA 5LJ5Y 4I64A 3AARA 2N7YA 4BC2A 1JLCA 1CULB 3P8BB 1BI4B 4WCEQ 2FHKA 2ZBCA 2HS4A 1EKSA 2Z1HA 4IQXA 3MPDA 3M1VA 4I56A 2AW0A 2UXCK 2W2PP 1JNRB 4CRJA 2G9OA 3L9ZA 3I56S 1QQOA 1A5XA 2OMLA 3NH1A 4JKGB 3VGVA 3ZSRA 1U4BA 1LW0B 2ZUGA 5IFMA 4JB8B 1T05A 1IJEB 4HUEA 4B9TA 1Q8KA 1H2UX 3MCMA 1FWLA 4DR4J 4ILMA 2FQQB 1RT3A 3X1LB 4DSJA 2GMHA 4LFAJ 4LR8A 2KZZA 3JYTA 4OVLA 1YT3A 3EDRB 3CJKA 3ZETB 2J0SD 1W9HA 4JRPA 3CCLN 3M8WA 4IG0A 4ZHRB 4CO5A 4CK1A 4P10A 3ZXWA 2KLAA 3GP9A 1HNZF 4WTYA 1RQ0A 4QQBA 4KGVB 1VSEA 3D68A 1BMQB 1UEVA 1NMNA 4JI2J 1RLCL 4E3SA 2B9WA 2M8HA 3SDEA 2E8AA 4L3KA 2OKQA 2DH8A 2W2QP 3ZTOA 1SKUB 2ZKUA 3QT6A 3IMQJ 1XHXA 2FBVA 1HKCA 3TANA 5A0YB 5KG6A 1G99A 1YDLA 3PW0A 5B09A 4FPIA 5AQXA 1K9MO 2M2BA 1RWNB 2ZH2A 2ZHOA 4EK2A 2RHKA 1XNQF 3CC2N 4PWDA 4ED5A 3LWLA 4F36A 5DM7Q 1VSFA 1ZBUA 3TUZC 3GWCA 2CQ1A 4XPEA 2GZOA 3CC2S 7AT1B 2KB2A 4PCQA 5E0OA 2F8TA 4X4PA 2V4JB 4CF9A 5GAHP 2MKJA 2OLWA 2YTCA 4KHRA 3MM5A 5LMUF 2M52A 3NE6A 3NLCA 3I5CA 1FXLA 1J6ZA 3WQUA 4ZCIA 5CYMB 3V6HA 1GMVA 3FZMA 4B1VA 3L6QA 4ZJLA 4MDBA 2X51A 3CG7A 5F1XA 3O80A 2ZJQL 2BX6A 1S76D 4J9UE 1QAJA 4FJJA 4E7IA 5T7LB 5KG1A 4LF1A 3GR1A 3QB0A 1VQKS 2M7SA 4F3OA 2EWSA 1CS4B 2AEFA 3Q24A 3WC2A 1P27B 3QT8A 5KG3A 3BM7A 5F8GA 1JJHA 2ZHBA 4JV5J 2R8KA 1N8RO 4ISGA 4W5QA 2QYGA 3O2IA 3E01B 5A6PA 1YI2S 2CZ4A 3MOZA 5FROA 3GMGA 3OXGA 2DIUA 4ELTA 5A2QY 2DITA 3NF6A 1XEZA 3G8TA 1N6QB 2GO9A 1M1HA 1HNXJ 3CCRN 3CCMS 1FD8A 2YH1A 4KI6A 4ID8A 3WX8A 1OWXA 1ROFA 2FY8A 2HVIA 2FJXA 4FNIA 4NLQA 2VASA 3DOMB 4B9QA 3GR0A 4I7FB 3FR0A 4FYWB 3CPWM 4JI4K 1P6TA 2HPUA 3CEDA 1KOHA 5LOQA 4HI2A 4WP8A 2F1FA 1ZM3A 5C25A 4I6YA 5IS2A 4KSEB 2CNNB 5SZTA 3U27A 2MLXA 4DFJA 4OYOA 3CCJN 4NLVA 3WNFA 3QMQA 2FUG9 1VR6A 3IWLA 1U1KA 4Y34A 1N5YB 2LEAA 3HOSA 1JLAA 2WB1D 3OTEA 3V6KA 2VDHA 2QA2A 1GLEG 1F0XA 3NY0A 3T1YK 5ETTA 4O55A 1IUJA 3M8PA 2UXCJ 1OS5A 3UVJB 3VQEA 2XS5A 1KVAA 3CJSA 2IDLA 2HW3A 3ZZUA 1PJ7A 1HBMA 2DO0A 4BR4A 3D0PA 3KWIA 1UPMB 2QT7A 5KOXA 1XI1A 2R9LA 3EN9A 1U8WA 2OI2A 2VQFF 4DV2K 4RW4B 1RSCA 2E2PA 4Y1CA 1RT5A 1SC6A 2CJBA 2FJDB 1RK8A 4I2PA 3T1HF 5HVHA 3H8YA 1H2TZ 3CPWR 2P9KB 2LDYA 4OI2A 5AE2A 3MECA 2J6TA 2QL5B 2HQFA 1OH5A 5DLFA 3TZZA 4KH0B 5K14A 4GO5X 3G82B 2C22A 3CCUS 2A3JA 1I3AA 4DR7K 3M32B 3SJHA 3MCNA 3DRSB 3PO4A 4NLUA 1BY9A 1FEHA 2EWHA 3T5HA 4I6AA 4CJWA 4DOZA 1RGVA 3VCDA 4EUVA 1DTQA 4Q0BA 1VQ4N 1NB7A 4J7CA 2QMXA 4A8MP 2ALYB 3FGUA 3EPIA 1DURA 2NZ4A 1IQTA 3T19A 4JI3F 2R7WA 4BR5A 4C11A 2NRVA 3OYMA 2Z1IA 3BEGB 1RBLA 2QZ8A 1H38A 1PKUA 1ZAVA 5HP1B 2YWGA 2ASDA 3MM7B 3PW4A 2GV9A 2AP1A 4M5GA 1YG0A 1K6YA 2VFSA 2J0QD 4LD0A 4QIEA 3RB0A 5B7WA 1JJ2M 1NPKA 4NYNA 2L08A 4OJGA 3AO2A 4ICLA 1EQMA 3SV3A 4Z7YA 5IQ6A 4JKBA 3TJ9A 1WDTA 2BKNA 4BS2A 5C24A 1QM9A 2H48B 4DUYF 2D0BA 3UNGC 4K8ZA 3KG1A 4O4GB 4QBUA 1GOCA 1XTZA 3Q8RB 3KNGA 3I0RB 4TYBA 2BDPA 4OQJA 3ADAC 2WSFC 2GWKA 2XNRA 5KFLA 4CEDA 4H4OA 1EAYC 4DLEA 1KVBA 3S9HA 3BPDA 3AQOA 1NJIT 3QBCA 3GPAA 5AQVA 3DKDA 1BOTO 4RW9A 5J2NB 4BWMA 1U1NA 3OYDA 4CGHA 2KQ2A 5KRTA 2F8MA 5CZ2A 2Y8WA 4M7YA 4KGMA 5B0EA 3HZ6A 4YDUA 3J80O 4HVJA 3AVHA 4KPCA 4KAIA 1RT4A 3O9UA 5GMEA 2VKZG 1X7VA 2MY8A 4E98A 2VWKA 4BR9A 2OHDA 1S57A 1JJ2R 5A8WB 5BR8F 1ZETA 4U67L 4CFCA 4JI4J 3ENAA 3VQDA 4BG9A 1X3MA 3WT0A 4LSNA 1WN7A 2MKSA 4DMNA 2UP1A 3BREA 3EXYA 4IH6A 3NGKA 1JKHA 1KHVA 1YZ6A 2I7NA 2OGUA 3HHKA 2RVJA 1VQNN 1DQ8A 1KVCA 1AFIA 3OBWA 2J7KA 1Q8LA 4LIRA 4USJC 3AJ1A 5BRDA 5BYQA 3JXOA 4P73A 3CJCA 3CT9A 3TO8A 3LANA 3RMAA 3R2CJ 1B9FA 5D0HA 3T1YJ 4DS4A 1XNQK 1J5OA 1TL4A 2VUGA 4O0IA 5AQKA 3ATVA 2LP4A 2WK4A 4KREA 3FZBA 4KR0B 4QWEA 1NZ8A 3ZX2A 4ETXA 3D0IE 3PVXA 5HLFB 3HYFA 4O5BA 4PXEA 3W0LA 2BJ9A 1FRXA 5KFIA 1YHQS 1NSPA 2YNGB 4FJIA 1QUPA 5AZIA 3ITHA 2F8HA 2R8HA 5B8HA 2DO4A 1KP6A 1RWOB 4EHTA 3EXCX 3OSNA 1JXEA 1Z2ZA 3FMBA 5LMNF 1DGKN 1RTHA 5JVHL 5J2PA 4FM1A 4PY5A 1I94J 4ZJQA 1T9TA 1RAIB 3K17A 1QSYA 3TTDA 2P9NA 1LWEB 5AE3A 3UDLA 4X4UA 3VGLA 1Q16B 4IYQA 3TWZA 3QO9B 4KAZA 1U49A 2AYEA 2HWHA 2GFFA 3VF2A 1UP1A 3TX0A 4PYDA 4WE1B 4CESA 4CJKA 5U47A 2CJYB 3GJQB 5KG0A 4X4TA 2KXFA 4BRHA 5HMXA 3D2FA 4BVPA 4LT6A 1HBNB 2DTJA 3PCOB 5HMZA 3EVWA 4I6MB 1KVIA 3LGMA 4RCHA 1U1QA 3W8GA 4P71A 3UD5A 2QK9A 1FFGB 4DS5A 4UT4A 3AGKA 2CAJA 2DXFA 1OY9A 4FZVA 4FCYA 3V9UA 3LPYA 2NRXA 4ZLPA 4QW8A 5B08A 2HMIB 5AE1A 3ZEUB 4KH6A 4FLTA 1ASUA 1VQSA 4OJ1A 4N76A 4ZLJA 4P2MA 3MCOA 3O3FA 1WF1A 2NREA 1RBTA 5C10A 4DSEA 1CJUA 5I3QA 3HKWA 3G4SN 3LP2B 1NGCA 4QWAA 1KKHA 2HNDB 3MWBA 3CDWA 3CJ1A 4BRCA 3EKUA 4EBEA 4FPAA 3VQ5A 4ER8A 5L9NA 2RHQB 3PYDA 1N5TA 1B0PA 1M5SA 3L4BC 3ZLJA 4KHNA 3DI6A 1FVSA 1DLOB 3K9JA 3Q2SC 2GX9A 2IVFB 4IQMA 2LEBA 1EJ7L 1NLKL 3L7PA 4LF5F 2VQFK 3SUQA 2R7XA 1BLUA 2IVMA 2VG7A 3QFHA 3M2RA 3V9SA 4NLXA 1L3KA 2F9DA 4ED4A 4PQAA 4AD6A 1NKBA 1HNIB 3KOAA 5HBMB 5JLFA 3T1HK 5CE3A 4DU4A 3OFGA 4M5JA 2X6SA 4ECRA 4FBTA 4OX6A 1S9GB 2ASMA 5I9EB 2XO6A 4CZHA 4DR6F 3CCEN 3V1QA 2GVDB 3FFIB 5LXRA 3SUOA 3JSMA 3AOCA 1KQFB 3FBEA 4RWWA 1HNZJ 3U8XA 2JOQA 4A8XA 4HUFA 4B1YB 4F02A 1HBOB 4F4KA 2Y1LB 4WFAL 4ECUA 2LU1A 1XERA 4OZ0A 2HZVA 3CD6S 2V7ZA 2P9PB 3C6AA 3BN4A 4CLKA 3UI3A 4URQU 3R97A 5AQNA 3BSAA 1RWPB 4A2AA 3WUHA 5CZ1A 4JI3K 5BPMA 2IRXA 3B6OA 3DXSX 1S5JA 2JSXA 3RBEA 1XNQJ 3KMQA 1OPIA 4CHNA 2AP6A 5DO2A 4K5RA 1GAOA 1L5UA 2CGJA 4IOAL 3NL0A 3VENA 2N3OA 1WEZA 2AIRB 5E3CA 1FDBA 1T95A 1N5QA 3NF7A 3FMWA 1OO0B 1X4AA 3KJNB 3I5AA 3ISNC 1SB6A 3POTA 3R5CA 5AZJA 1D5AA 3WEEB 4IFYA 2GUPA 1S99A 1HI1A 4MYTA 3UDEA 3EZ5A 2V9KA 2MXYA 1Q5VA 3RB6A 4CD1A 2F3JA 4CHYA 4LF6F 4C9DA 3CM6A 2FXUA 3E9PA 2G8FA 4TY8B 2DHXA 3HVTB 3CD7A 1C1CA 4YFUA 3DM2B 1OKJA 1HWLA 3H42A 4C8OA 5AFUH 4BDZA 4PQUA 4B3SK 4C98A 4WFNQ 3B54A 4LR9A 4TLRA 4F67A 1HQEA 1W2BM 3L3UA 4EP5A 4Y2KA 4X65K 4XH4A 4FJXA 1HQ2A 3CIPA 2HNYB 4EU0A 4F0HA 4H5NA 3AA3A 4FJ5A 4UOHA 3FQKA 1VGYA 1JLEA 5HRRA 3HSGA 4KH1B 5EWGA 1U2CA 3RUBL 4EYHB 3JQKA 4WCEL 4K4TA 2IM1A 4CH0S 1S22A 1YTAA 1UAXA 4DPTA 3F2KA 4H0XB 4MAKA 5ETPA 5LT5A 2Q43A 3IBWA 3ENBA 1U47A 3CJ7A 2BEFA 3BKUA 1F9FA 4OZJA 3N0VA 2PD1A 3O9TA 1VQ6N 4OIXA 5J2QA 2JFDA 5JICA 3R7NB 4R25A 2QWOA 4WIIA 2J8AA 1H74A 4QCLA 2MZJA 3TVYA 3A5LC 2K8GA 4BGAA 1R0AB 4FJMA 1MU2A 3I5BA 2RRBA 2UXBF 2HHHF 1KHWA 2HQGA 4FXWA 3PEHA 3QBXA 3SPZA 4FF4A 4N8OA 3QRPA 3R6GB 4AT1B 4DB3A 3PY8A 4BE2A 4Y2CA 3GJSB 2WVEA 1YJTA 2R4FA 2EC2A 2A2DA 2UUAF 2RE2A 2HHUA 5LSRA 2OUGA 1JCGA 3SUPA 3WNEA 2YHXA 4Q45A 5TKWA 2MYFA 4KE5A 5DLGA 1A7GE 4NXNK 5IM0A 4KBIA 3L2WA 3SK3A 2VQFJ 2UV8G 2GVZB 1M0SA 1CLQA 3PIOQ 3MEGB 1FD2A 4FWLA 3T1HJ 1WTFA 3H59A 3D45A 3OS2A 3DWLA 1RT1A 3HBTA 1IKVA 2ZITA 1HW8A 2OANA 2CQBA 2ZZNA 1LAVA 3ETOA 2J9CA 2F4VK 4LQ3A 1FKOB 3HSTB 2ROPA 1FWPA 1NH7A 3O08A 2QKBA 4CJTA 4USIA 4F2RA 3CXCM 2D3ZA 1PG5B 4BHQA 4DF8A 2R7SA 1YJNN 2R7TA 4DFMA 3MPYA 3IC1A 3VQSA 4I67A 1F5BA 1QZ5A 1KDNA 4J9NA 4CZCA 2JWLA 2M0GB 2UU9K 2DFEA 3GJTB 4ES1A 4JI3J 3P39A 4KHQA 2ZWHA 4M5IA 3AJDA 2FJVA 1RUSA 3HXMA 1NMDA 3AVJA 3KLFB 2JLEA 3Q86A 2HHTA 5FRNA 1JLQA 4F3TA 2C2KB 4PA1A 1VC0A 3BBFA 2Y1IA 2YI1A 4Y1DA 3K0JA 3GG1A 1EB0A 5K8OA 3R5JB 2O4GA 4G1IA 3W3SA 3FGVA 1IG9A 3HX9A 4GVBB 2YBVA 3T6BA 1WTBA 2GIFA 1S0OA 4TY9A 1NU4A 5JLHA 4FNHA 1X9JA 4CYUB 3ISND 3DGPA 3F9KA 1TGOA 2I7PA 2LFVA 2HGMA 2C3UA 2E9TA 2QV6A 1KSPA 1C0UB 2B0GA 5HMWA 2V68A 3HSZA 3CXCR 3MMAA 4IWVA 3QZ7A 1VQLN 1WKKA 5D0EA 3MCSA 4B3SJ 2ZVIA 4BRQA 4X65J 3P96A 1VQLS 2IA0A 4FWQA 1WC5A 2HQDA 3DHXA 2K1RB 3J7ZO 4L76A 4B3MF 3OFFA 4KGKA 4NX9A 2VG5A 3FZ2A 2DHAA 3GJRB 3DLRA 3P45B 3TEHB 4ISEA 1WF2A 3G96A 4JHDB 2QA4N 1TK8A 3O1LA 2VA3A 4U7CA 4DR6K 1PYOB 3ULDA 2HBZB 1UWBA 2KH9A 3LDPA 5HATA 3VF0B 5HRNA 2P9SA 2W01A 4EHUA 1NDCA 4URGA 3GFYA 1IBLF 2OFHX 3CC7N 1SI9A 4H4KA 4NASA 5LSOA 1IH7A 2KI2A 4QYZK 1A6LA 4OYAA 4MDAA 3SSSA 1L3VA 1JL2A 2MJUA 1MW7A 3FRZA 1G15A 2C1EB 2E6MA 4RW6B 2ZM6F 3PIPQ 1W2IA 1GK8A 3PLAA 4MFBB 2HYIB 5BR9A 3ZNUA 2PSZA 1IKYA 1IM4A 3P5TL 4CF2A 1GFWB 4IRKA 1U45A 2WBMA 3FKBA 4DTNA 3SFGA 1NG9A 5KT2A 1U0HA 3FZKA 2M3DA 4YY3K 4ZIVA 1XMOF 3UDVA 4ELVA 1UTAA 3TABA 5F8IA 3T5LA 3MXJA 1ZAWA 5BPLA 1C1BA 4H5WA 2RUSA 2QL7B 2HHWA 4LF2A 4IOCQ 3JB9k 2NXNA 2DISA 4RU9A 1HWIA 4RBVA 4P2SA 4AF1A 2QSWA 2PN6A 5IWAK 4AM6A 2F5GA 4ES3A 4MH8A 2AQ4A 5LMNJ 4A46A 5L46A 4R8UB 5I42B 3AOBA 3DCAA 1VK0A 2XYHB 5DDOC 2JLGA 2XS7A 3QEXA 1VQPN 4ZPBA 2JGUA 4RUAA 4U9RA 1YBTA 2MMYA 5KFCA 2DNGA 4DPWA 4I68A 1VJWA 4CO4A 5M1NA 2QLFB 4J90A 2ITMA 3L95X 1RHRB 1VIXA 4IO9Q 3I0SB 5HROA 1E6YB 4NYPA 4N5SA 4C8YA 2F8EX 3SSQA 3VQ8A 1KFSA 2JX2A 2YWFA 4BREA 1TUVA 1URNA 4J2BA 4IFVB 4J9RA 5I3UA 1EETB 1X3NA 3A12A 3D6TB 5KFJA 1WOPA 2MKYA 3PFOA 1Q4RA 2NZTA 1WC6A 4H54A 4K2XA 2VWJA 2DXDA 2PIIA 2AYGA 3W2WA 4USTA 5CA5A 2UUBK 2HBYB 2KFZA 2E88A 4FK0A 4N7TA 3QFPA 4XTTA 3DLEB 4LY7A 2C3PA 2ZOGA 4M3WA 2Z30B 4DV4F 2P9CA 3H46O 3ZZPA 2J0WA 4C23A 1R0BG 1WKLA 1QAYA 4Q2MA 2E1CA 1TUWA 1XC9A 3A0IX 2JRSA 2D9PA 4RUCA 3MUTP 2QLXA 3CDEA 2XYGB 3T41A 1OH6A 3TZWA 4Y2AA 2FVCA 2HK3A 4A8FA 4RW7B 3CJ4A 3R5GA 4ZA1A 2LYVA 2BZ2A 4OJRA 2FJWA 2W4CA 5A8KA 2DGXA 1I1GA 3DXKA 3TR5A 2VF3A 1UEUA 2KN4A 4LF7F 3B6BA 4CBWA 2W4DA 1TL7A 2DGTA 3OYAA 4LFBK 4U7UD 4JI7F 4CNYA 3ULHA 1RAHB 3OVNA 1AW0A 4DMZA 4PABA 5AT1B 2XGPA 1PAEX 4IEEA 2XULA 5E26A 3PG9A 5BRFA 1MWQA 3HHLC 2NQPA 1HNVA 4DR6J 4LH5A 4B3RF 1K44A 3VEOA 1JK9B 3MEEA 1YZ7A 4RR5A 2GAHC 2AGPA 2OJ3A 2JC0A 2FLPA 1RXOB 1XR7A 5AQJA 5M1FA 1CULA 4B9LA 4QAGA 2HZAA 4QYZJ 3GLJA 4OLAA 5FPEA 1Q53A 2XGQA 1IJJA 1YBUA 4MK9A 5GIPA 3CCSN 3D6RA 2ZH5A 1VDHA 2ZVSA 1DQAA 1HQUA 2ASLA 5ETMA 4DU1A 2IGIA 2HFUA 4JKGA 2D74B 3DRYA 4NA3A 1JQGA 1HHSA 1LW0A 1QDUB 3EYZA 2AA4A 4B08A 5KTQA 4KTWA 3CJ9A 5BRHA 3OYEA 4YY3J 5HMYA 3IUCA 2E5HA 4FO0A 2QKKA 7FD1A 4DWIA 3UO0A 1XR6A 1Q79A 4B3OB 3ZETA 3PACA 2NUUG 2AF6A 5HL7Q 5G0RA 2W9AA 5EU7A 3MR3A 4ZHRA 3OTBA 2KU7A 2FJAB 1GXTA 4M5DB 1RCHA 4Z37A 2CQDA 3OL9A 3HMJG 3LP0B 3BDPA 2DGSA 1YF5L 5HN0A 2IJNA 2D41A 2GJ2A 2W41A 2KW4A 4WFZA 4NA1A 4MO5A 1FDNA 3EEQA 4OX9F 2D1KA 3UD4P 2VCPA 2DBBA 2XMAA 4BRIA 3QLHB 4CK3A 4JI0K 2AJQA 5A0YA 5KFQA 4K0KK 2QEXS 4FOIA 3D54A 1BU6O 5D4LA 3DNCA 4C0BA 1LNQA 1ATSA 4G9ZA 2FVSA 3HHLB 4W90B 2G8UA 4NLPA 3ZSWA 4HCCA 3R8EA 2HFVA 5HVGA 3Q22A 4Y3CA 3KJFB 2MGZB 3IRWP 2QLBB 1NEEA 4BC4A 1BA0A 5FLXU 2LKZA 2OPPB 5KFAA 5BPNA 2V4JA 2UUBJ 4FPRA 4ED6A 2CPEA 4NLDA 4P2XA 4RNFA 1RT6B 2DRBA 4LFCK 4FK4A 8AT1B 2P9GA 5CYMA 4N77A 3GFHA 3I31A 3DLLL 4I9LA 5M2PA 5JS2A 3AY0A 1LWCB 4JI8K 1Q8IA 1URRA 2KVQE 3R8YA 5JXSA 2KTQA 1WSIA 5T7LA 1UFWA 3DFEA 3IBCB 4JI5F 2UXBJ 5KFEA 2HHHJ 3LTOA 1CS4A 3G10A 3S3OA 3CDAA 1EQYA 5KFBA 1Z26A 2ZKTA 4Y6IA 4WF9L 3AVLA 2UUAJ 5KT6A 4GVEA 5CABA 3E01A 3GV5B 2E1ZA 1FNOA 2OTJS 4CJRA 3C2PA 2BE9B 2XQCA 1XMOK 5H9FK 4FLXA 4QR0A 5GAEU 4J9KA 2W7OA 4LFBJ 2MTLA 4RNMA 4L75A 2V50A 1N6QA 2DHHA 4FVMA 1H73A 1S6UA 3RVCA 3U4LA 5E41A 3DU6A 3D28A 2B4UA 2FY1A 1FO1A 3DOMA 1BQMB 1O6XA 3RRGA 4I7FA 4F4AA 2HHVA 2IRUA 5K8MA 2WVFA 1WSEA 1M5OC 1QE1B 4BWJA 4DCOB 2PAVA 3QRRA 3GIMA 4LMZA 3HHLD 3ELHA 2J76E 2YKNB 4S0MA 5F2RA 4CM0A 1HMVB 4JKFA 1CJVB 4P7TA 1RAGB 1GOAA 2CQGA 3ZT4A 3T9ZA 4YNQA 4LQ9A 5F0WA 3VTIA 2E1AA 3SBMA 1RCXB 4E7KA 4RLEA 2V67A 2BE2B 4DR3K 3HI9A 3BSOA 3SCLE 4UOGA 5J2MA 3UVJA 3F5TA 3W3DA 3VEWA 3OR1B 1SUQB 2L3MA 2RJZA 3M7VA 4DUTA 3EL2A 5JVGL 2KL8A 4WFBQ 3H40A 4OZ2A 2O8CB 4Z4HA 4M8LA 4K8RA 1UJ4A 1Q18A 4WFNL 3NAIA 1EO1A 4RW4A 3EGVA 5HRPA 2DPNA 1FE4A 3DU5A 3D3CJ 3AD9C 3KYLA 2E7WA 1PBUA 3W66A 1UOCA 1K8KB 5AQFA 2JEJA 3ZT2A 2VC1A 2P9KA 4FK2A 2OELA 2FHJD 4TYAA 1VQOS 2D0CA 4WQ5A 5DJBA 3SBGA 3KHRA 2GMJA 2CQ0A 2Z4PA 3FRYA 2ZD1A 3G82A 1DT9A 2JC1A 3GE1A 4DTMA 2VG6A 2XNQA 4CEQA 4HWIA 5LY3A 5DZ7A 4ED7A 4YB6A 4OKKA 1P8GA 4L73A 1XMBA 2LQ9A 1Z25A 2CNOB 4E1JA 3RRKA 2X1GA 1R6VA 3LP1A 2OH2A 4GKJK 4X66K 2PMWA 4LF7K 4JI6F 4X4SA 3EGWB 2GIQA 3CO0P 1VQMS 3CJTA 3PYFA 1HW9A 3N4PA 4JI7K 4K0KJ 2QFIA 2YKQA 2DNYA 4O44B 1WD6A 2ZBIA 4LRFA 3O9SA 4WP9A 4B17A 1U0SA 2RNEA 1TAUA 3ID8A 2ACYA 3MM7A 4DV7F 3O9RA 3BGRB 3M30B 2X3GA 1ITGA 3AT1B 2P9EA 4HLBA 5D0GA 3TA0A 3PDNA 2BJ7A 4K43A 1Q82T 1T03B 1IM6A 2BJ3A 3Q8UA 1FKAF 2DHGA 2BM1A 3TA2A 3FLCO 3H2UB 3CD0A 2O8FB 4LFCJ 2ERRA 3O1BA 4K50A 3L7UA 1S1WB 3A8JA 3V81B 3HD2A 4R0JA 4OLOA 2X74A 4JV0A 2FBTA 4ATNA 3WQTA 4F4YA 2BABA 4E89A 4CZGA 4LBPA 4H0OA 2FLNA 1J5EF 4DZ6A 4P72A 6FD1A 1OY6A 3FEYB 4EFHA 1LK5A 3U1NA 3OJUA 3AVNA 3I0RA 3PV8A 4LVOP 2HHPA 4ED3A 3CJ8A 4ZVGA 1NJIO 4OV1A 5M1PA 1M1KT 1NK9A 3N5FA 3BY5A 2NR0A 3U3GA 4CEOA 3WHIA 3KXDA 4LBIA 1VRTB 1RAJA 2YXLA 3EPGA 4A4JA 3QFUA 4WZQA 4WP3A 4FBUA 4KHSA 1XMOJ 5H9FJ 2GO8A 4LIWA 1IVZA 1RAEB 1RT2B 3TU5A 4W5NA 5F9LA 1N52B 3SSRA 3AQPA 3SFUA 5IT9Y 2V51B 1ZTWA 5A8WA 3OVBA 3AOAA 5KFVA 3K0SA 2UV8A 2JDJA 1RZMA 2OPSB 5CYQB 1N34F 4DV1K 1KFDA 4DCPB 2WVBA 2DNLA 4C6AA 1NU0A 3G8SA 2I2YA 1ZBSA 3DGVA 5AQQA 1XUPO 5KPRA 1UWAA 4PR6A 2ASJA 3K2PA 3FFKB 2V7YA 1CJTA 4UTGA 1S1XB 2KJVA 2WBNA 3M2VB 4DR3J 3LZJA 3J7YI 4C1NI 2CQ2A 1Y5LB 2IBKA 2BJEA 3EVMA 3VQQA 4DL2A 4M95A 1RKJA 1CLFA 4KH4A 1BQNB 3BSNA 1WI8A 2XHBA 2VPXB 3KVGA 3CWJA 2V2KA 4KO0B 1RTJB 1NGFA 4WXWA 1S10A 2I1RA 3CJ3A 1UETA 4I0WA 2YNGA 3MMCA 2H54B 1D1UA 2YKAA 2AJ0A 4ZDNA 1RDCA 1KLMB 2W42A 2RF2B 4DV4J 3M9OB 2YX1A 1CXUA 2G2OA 2RH3A 4CEZA 4U7BA 2XMMA 3JXUA 5GAEP 3JSBA 4UZCA 3LAKA 2IVPA 1ZBTA 4CP5A 2GS8A 2EBEA 2CPHA 2VFRA 1QTMA 4I9QA 3OL8A 1LWEA 3MTJA 1Z1ZA 4AXJA 4R5PB 4D3GA 3F56A 3EE3A 2FF6A 1R6YA 3QO9A 3QIPB 3TJAA 3GILA 2F7VA 1HL6A 4U96A 4J9VA 4X66J 4OGEA 2FIUA 1F60B 2U2FA 4LF7J 4KH5A 3ENOA 3WBZA 4CFBA 3NGSA 2VC0A 4MJKA 3CCQS 2FYXA 4M63C 4JI7J 4GC7A 3EY1A 2XMVA 4BRFA 1HBNA 3ENHA 4I6MA 3RG6A 4URSA 3JAMY 4OKJA 4LFAF 1LK7A 2V34A 2E2NA 5DM6L 2B51A 3MTKA 4B1ZA 2O8DA 3ZTRA 4DF4A 1X4GA 2DGVA 5HAOA 2J7UA 2C3MA 3CYMA 4B3RJ 1JLBB 3N4QA 3MZIA 2HMIA 2QL9B 1RDRA 3ZEUA 1VBYA 1YIJS 1NUEA 2MDAA 3V4IB 3V1RA 3PX0A 2AZ3A 2CWXA 4JI2F 5C2GA 1RHMB 3K5LA 2EK6A 1ZC6A 3LP2A 2HNDA 3EUNA 2XS2A 4HT7A 2ZEJA 4CHPA 4TSXA 3ILLA 4HEA9 1SJ3P 4LRBA 3G2XA 2D0PA 4BVOA 1NHKL 4DQ8A 3CFOA 2AJ1A 3P31A 2A0FB 3SQ4A 5D3GB 3BEXA 4ZCMA 2G2YA 1NM2A 3B8AX 4CVNE 1DLOA 1O13A 3AO4A 5JS1A 3KKRA 1VQ8S 1Q0NA 4ECQA 2KYXA 3NGTA 4BLGA 2ITGA 1XMQK 5F9NA 4ZMMA 5LJVA 2Q31A 1ESVA 1QQNA 1JLFA 1SAZA 4B9MA 4CEEA 4A8YA 1AROP 1HNIA 4A8QA 3OUYB 4CEAA 4UY8T 4ZPAA 3C8YA 1HYVA 4IO9L 2WB4A 2WCXA 5B0FA 3FFIA 2DCLA 3GL1A 3PJWA 5JUMA 4OI6A 3LW5C 3T1AA 1TKXB 1Y3JA 1TU0B 1KOOA 2XC9A 2MJNA 4O3OA 4JYAF 4DV1J 4F26A 1D8YA 5HOOA 3CCVN 4DV5K 1W7AA 4W5RA 3DOLA 4LSZB 4DTOA 5EHHA 4CFDA 3SQGB 1CC8A 5DDQC 4NXMK 2DVIA 2FLOA 3MDFA 8ATCB 2CJQA 4M41A 2R7RA 2CH6A 1YJWN 2RDDA 2H5EA 2ZHAA 3HFVA 2GAGC 1MNEA 4K5SA 5K20B 3VR1A 3G6XA 4NRTA 3IM9A 2CPJA 1MMLA 4KB7A 3UIQA 5EDWA 1EIYB 4DZDA 4LREA 1K0TA 1NBWA 1YJWS 5HI7A 2XZDB 4CJUA 3NFAA 4XDDA 2P6SA 5F8HA 1DTTB 1C1AA 1P1TA 3P3DA 4ED0A 1VSIA 2G0IA 2H51B 5ETLA 2ZBRA 5K5MA 5BN9A 1GLJO 2WUSA 4EP4A 2HHSA 4KHMA 3DLHA 2MQLA 1TMMA 4MTPA 5ETSA 2AD9A 3WEEA 3A3OB 2P51A 2BKPA 3ICLA 3GSIA 4N56A 4W98A 2FC0A 4PYAA 3G6VA 5THWA 4O8KA 2FHOB 1KRPA 4F04B 1RHJB 3CIZA 3D7SB 4TY8A 1NPRA 3HVTA 4TU9A 2KKZA 3WIVA 1GT8A 3DM2A 4JI5J 5LM7E 5D8HB 3D66A 2HLUA 4DQIA 1UCNA 1ZAXA 2EK1A 3TVZA 4U67Q 2ZH6A 4KGZB 1NSKL 2D1CA 1SBRA 1QQCA 1S12A 5B0AA 3NH0A 4DR5K 2JVOA 3QINA 3TSUA 2NXCA 1BIZA 3NS7B 1NKCA 1WOQA 3M6UA 4NA2A 3VEZA 3ENQA 1K1SA 2BQRA 1HD0A 3KUEA 4A8SA 4Z4FA 4BRNA 1YJ9N 5L1JA 2QMUB 3C6UB 3WZ0A 1IN0A 1RTZA 2GNKA 4RNOA 3OR2A 5FLXO 2AJ2A 3BSCA 2JWKA 3UR3C 1N88A 1UPPA 3Q8SB 3SNNA 4NYZA 4OJHA 5F8NA 4HACB 1U24A 3K2YA 2ZZMA 3L09A 2F8SA 1QHAA 3NVMA 4E8UA 3BH6B 4FP9A 1ZBIA 3V2UC 4ZK7M 2MSSA 1RT3B 5L8RC 2JVRA 2OSRA 1R0AA 4WFXA 5AXLA 2YKMB 2DY9A 1N56A 4DEZA 3CJKB 5M1KA 3UKUB 2HBMA 3SQOP 5HL7L 1YUWA 3W9JA 2BGGA 3VPZA 4NPOA 2LQBA 4H4MB 4WU2A 1H3DA 3H08A 4BRLA 4E7LA 3MCAB 2J9EA 3J80U 1KVJA 3JAMO 3LUYA 3OYIA 3CMAS 5KGWA 5AR0A 4F7VA 3VA0A 4O4RA 5IC4B 1E4FT 1XC3A 3CF5L 1XMQJ 4UZBA 2J4RA 1F5AA 3US5A 1K1QA 1QSLA 2GVZA 2AYMA 2CJXB 1FRIA 3O4NA 2A5XA 4ZPDA 1U2FA 5CYJA 4NLGA 4XDCA 4J9MA 3D1HA 3NNAA 3DRXA 4KTQA 2E1RA 3AVFA 1FJGK 2O8BA 4USWA 3AA4A 1RI7A 3THTA 2RS2A 1TK0A 1UEKA 5E3QA 1AUDA 1HJRA 1SS6A 3K8VA 3LALA 3EWGA 2V4RA 1FKOA 4LH4A 1RFQA 3GG4A 4K4ZA 2H9ZA 2O8EB 1SKWA 1X5OA 1UJ6A 3LGNA 4NXMJ 2VQEK 2GHWA 2RHSB 1Q78A 2O1PA 1B0TA 5CHCB 1F3VA 1MDUB 1HKGA 3A13A 4OV6A 5A2QU 4JI6J 2RPIA 2RU9A 3C3LA 2ZE2B 1GLBG 3PEJA 3THWB 4JS4A 2IDOA 2E7VA 3FSYA 4CZJA 4C0OC 3ZZOA 4CQ1A 4BC3A 5E7OB 2XLIA 1RBUA 3C14B 5EGYA 1R3NA 2UUCF 3KLFA 1S9EB 1YGYA 3CETA 4YOXA 2CADA 3MM9A 4OI4A 1RAOA 3T6JA 5ETVA 2XCPA 3EJMA 2DNQA 5DQGA 2FBYA 2V94A 1NXIA 4CBUA 2IIRA 4GVBA 1U1MA 2XY5A 1R0CB 1Y5NB 4NCGB 2ZNYA 4JI4F 1B92A 4UF4A 3LWMA 1S79A 4HDGA 4FWRA 2YKPA 3UB5A 5GADI 1U1RA 3C66A 5CZXA 2OEJA 5KFTA 4CE9A 1S0VA 2NPIA 2XI2A 2IM2A 3KZBA 3T3FA 1VQ9S 1A0OB 1X8DA 3VAHA 2F7TA 1NJZA 4KV8B 3HO1A 1UW4A 1HI8A 1J5EJ 4LSLA 2YNIA 3P6YC 1LXNA 4L3NA 5CHIA 2HBLA 1RBVA 2I0XA 3T1YF 2RMLA 5KFNA 2GWJA 2CUYA 3RR8A 3Q8VA 5H1SQ 3O8MA 4ID5B 3HPHA 2O67A 3WX4A 4CIOA 2AU0A 4WFAQ 4DPOA 1EWRA 1REVB 2OYQA 5DGBA 2NCKL 2E5LF 2ROGA 2MQOA 3VEXA 2HGLA 1IJFB 4KRWA 3HULA 4DV2F 3UQSA 1S6OA 5DGAA 3AY9A 2YV0X 1ACMB 2B43A 3IR6B 1OYDA 2VOOA 2BUNA 4WQ4A 4JK8A 2PYJA 1RNHA 4PKIA 2HK2A 3C46A 1LAWA 2CPYA 2G1DA 2IYGA 2Q1NA 3OYBA 4QJVA 1WSFA 2DPJA 4DR7F 3BZQA 2CYYA 3VERA 3VVUA 3RSEB 2HG4A 4ZVQB 3D6HB 1DAXA 3KHGA 4ZKAA 2E44A 4RW6A 5MAOA 4I2PB 4I69A 2G8VA 1TL3A 3C16B 1RYSA 2VPWB 3VAJA 4MFBA 2FHMA 4NLSA 3RU0A 2OFGX 2MZRA 4Y65A 2PMZD 3IM8A 2MB0B 2JHEA 1H0HB 4EZ9A 3O8WA 3V9XA 1QAIA 1WF0A 3HM8A 2V8GA 4H0PA 3CMEN 3W60A 1RWUA 2HBJA 4JP8A 3NAEA 5HQMA 3J81Y 2QA1A 5GAEI 2IJRA 3RBXA 1YVNA 1IKXB 2DJWA 2IVOA 5KAKA 3VQ7A 5AJ3K 4KIAA 3FSXA 4DTXA 3DDKA 2ABYA 2HOEA 2AJFE 3TP2A 2VFUA 2OIHA 1VYAA 3PR5B 2O4IA 3RR7A 2RB7A 3D6MB 1JXLA 4MIBA 4CLYA 2F9TA 3C6TA 2A1SA 3I56N 5I42A 4FJKA 2R7OA 4M94A 1L3UA 2KM8C 2AMCB 2DR5A 3ZZZA 2G0CA 3IXQA 4CK2A 2Q0UA 3Q83A 1Y00A 1IBKK 2IS3A 3BB5A 1H98A 2I8EA 2XMTA 3OQ2A 2CGKA 2FBXA 4NWBA 2VQEJ 2QTDA 1J9AA 1JIHA 4DR2F 1UMJA 4M3YA 2YJFA 3VAKA 4ICLB 4LVNP 2ZC4A 3I0SA 4Z4GA 4FPBA 3SCKE 1E6YA 2QE5A 2C2ZB 3KD5E 3JSYA 2R7UA 3C0BA 2RQKA 1T9XA 2Z56B 4DL3A 3TSQA 1IQZA 3HT3A 3M6VA 1EETA 2CQCA 2AX0A 1UVJA 4EIAA 5IZHA 1KC8T 1TKZA 2GV1A 2KDOA 2A2CA 1CZBA 1K73T 4M5KA 2PI4A 3DLEA 3HTVA 2HVZA 3CSKA 4M1KA 1CZAN 3NMUA 5I3PA 3U1LA 3U02A 3SZ2A 2VBYA 1DHMA 2C42A 1NGIA 4RW9B 1H7WA 4PG7A 2PT0A 2M88A 2JH3A 2LDIA 4HH0A 4FXDA 1DY3A 2XY6A 3U7JA 1DBDA 4E2FB 3NGRA 2CG8A 1FNXH 3TX8A 1HLUA 2FVRA 2ZH8A 1S6QB 3CHWA 4ETZA 2QTWA 2QWRA 4RW7A 4PKHA 2KHOA 3QATA 2D3UA 2MKHA 4OYMA 1WELA 3R7SB 1JXVA 3S41A 4QZVB 3AA9A 3IO1A 3IR7B 4ZVUB 3V6DB 2N7CA 3V9ZA 2MZQA 2HFZA 4F4WA 3GTYX 3EM1A 1RT7A 2DFFA 3VEVA 3ZCMA 4TLQA 2OPQA 3M8SA 4CCHA 4J5OA 4BQZA 2KM8B 2A6AA 2KJWA 3KIOA 5DG8A 3CQYA 1VQKN 1VSJA 5FPNA 3GBTA 2LLZA 2XSJB 4M42A 2DNPA 3OVSA 4B9NA 1X0PA 4JYAJ 3AVKA 1FVQA 2J9DA 4LF8F 1XJWB 2V2VA 1OPZA 3Q0AA 1S1VB 2KO1A 3U6FA 1VRQC 1YI2N 2CDQA 2NRRA 3QFWA 1TKTB 4R79A 2C2MB 4DQPA 4KI4A 4J8FA 1VQ5N 2F63A 2YPZA 1S48A 1WG1A 2ZDOA 1CXQA 3NNHA 4K59A 4I6WA 4KY3A 4Y0FA 3CCMN 2YQ0A 4TN2A 2W8LA 4PG6A 2A3ZA 3HM9A 2UUCK 1REGX 1VQ5S 1HI0P 5DQHA 1OQ6A 4OKEA 1RISA 4IH5A 1MG7A 3CD5A 4P75A 3QJLA 2HZCA 2QSFA 2KG0A 3K5PA 4Y2MA 2B7BB 2WC9A 4X2BA 2H4WB 3QRQA 3I8BA 3HLUA 4B3OA 1OQ3A 2GX8A 4FZZA 3QESA 5ETNA 3TAGA 4ILJA 3M6XA 3ZTSA 4H0TB 3VQ9A 3D2FB 2M9KA 1RU2A 3BF1A 4M5DA 5E3RA 3VESA 3LP0A 2VOPA 3W5XA 1WAFA 2C2OB 1BHNA 1J27A 2FGOA 2ZBQA 2K7KA 2W9BB 5AQTA 3AVCA 3PR4A 3R7BB 1IBKJ 2CGLA 3GYNA 3FZHA 3BGOP 3MEDB 2IFXA 1BL3A 4O0JA 1V5VA 4PWUA 3QLHA 1GTEA 3EZUA 2RDJA 2G1HA 3CQ8A 1NDPA 4ZPWR 2WFBA 5F3TA 2E5LK 1KR4A 2QIFA 3NCQA 1BO5O 1CSJA 1N54B 3HHLA 4CJQA 1RTIB 2CNKB 3RJMB 4C3KA 3LL3A 2PC6A 4YDDB 3C15B 2D5RA 3L0QA 2MKKA 2MGZA 2A40A 3HJVA 2EX3A 3D4JA 1V3ZA 3IR5B 3OTOK 3CCUN 3QETA 1SC3B 3TAPA 3NS6A 4XH5A 3UFCX 1OH7A 4QIFA 2FTRA 1RT6A 1U2RA 2EVZA 2E4LA 2A1BA 4PPDA 1Q9XA 1S77D 3G8QA 1JNZB 2X3DA 1NKEA 2V5HG 3H1VX 3F0NA 1LWCA 2FVQA 4TQRA 4PAAA 1O5JA 5ADXA 1IR0A 3CDBA 3THXB 4QS7A 2DHSA 2KHDA 5GMKa 4MK7A 3I8DA 4DV6K 2UXDF 2CZVC 4JNEA 4IZ9A 1EX4A 1N36K 3O5BA 2VODA 2QX0A 4IOXA 4CF8A 1O1WA 2SXLA 1RWXB 5IV4A 3IAYA 1HR0K 4KRFA 5AQUA 2Y0BB 1ZTTA 1LQ9A 4KHPK 2B4JA 3TARA 1UVMA 2FHJA 3WXLA 3NAHA 1XWLA 2J5AA 1FW6A 1U6FA 4ILHA 1RDUA 2AGQA 1GMUA 1GQEA 4AL7A 3FBCA 3DXMA 2KRBA 1BISA 1TYQA 3GU0A 1MN9A 4PXDA