3KJVA

Hiv-1 reverse transcriptase in complex with dna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
556
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
total genus 128
structure length 549
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kjvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kjvA05
3ZSZA 3DLHA 3OYHA 3V4IB 3AVNA 1B9DA 1REVB 1ASUA 4I2PB 1D5AA 2W8LA 3AVFA 1T94A 3TARA 1ZBLA 2FVSA 3OJUA 1YTUA 4ECSA 2FVRA 3PX4A 1S1UA 2ATQA 4RU9A 2I5JA 4AHSA 4UQGA 3NDKA 4CIEA 2RF2B 3CDUA 3TWHA 1FKOB 3QGHA 1KVCA 2XY7A 2X74A 3OYNA 1C1CA 3IS9B 4EZ9A 4QOZB 1D8YA 4CHNA 3EZ5A 1TV6B 5KFMA 3TAMA 1RTDA 3U3GA 2OPPB 5F8JA 3QEXA 4KHRA 3VQ9A 3MF5A 4OKJA 2NUBA 3V9XA 2B5JA 4ZVEA 4YMEA 2ASDA 4RW4A 3EYZA 3SI8A 4C8OA 3C6TA 1JKHB 2HWHA 2AU0A 2VG7B 5CYQA 3H4BA 3TAPA 1TV6A 3THVA 1TL1A 1HYSA 1TK5A 1BL3A 1HNVA 3OL9A 3PY8A 3SQ4A 2B5JB 1XR5A 4E1MA 2RDJA 1MU2A 1Z25A 5L1IA 3DRSB 3SZ2A 5HBMA 3H08A 2E9ZA 3IGVA 2I5JB 4CJPA 1ZBFA 5DLGA 1UA1A 4ECQA 1G15A 4DMNA 3DLGA 2XCAA 3LDSA 1YTAA 4DTMA 4I7FA 3PO5A 4DU3A 1C2PA 3NGIA 4Z4CA 3QNOA 3M8PB 4KV8B 3ZSYA 3I5AA 1T03B 3DYAA 3QESA 4AILC 1IKYB 5J2QB 4WXOA 2DFFA 4YR0A 1CXQA 1QQCA 4CEZA 3VQ8A 3OYDA 4IOBA 1JL1A 3LP0A 3RB0A 4NLWA 2YNFA 2BRKA 4C8KA 3KK1A 1KLMA 3MECB 2KW4A 3NGDA 4L8RB 4FM1A 1TVRA 4MK7A 2R8GA 2FLNA 4LSLB 4K4XA 3AVMA 1YT3A 3V6DB 2VWKA 4DG1A 4ECTA 4DTUA 4C8LA 3L2UA 1S4FA 5FDLA 1REVA 2HNYA 3MR5A 1HPZA 2E9TA 1JLCB 5JXSA 4YFUA 4RW9B 2W42A 1CZBA 4KREA 3LZJA 5J2MB 4TY8B 3PW7A 1TP7A 3HVRA 3GIJA 4M3RA 3GIKA 3CDEA 1QAIA 4M41A 4E7KA 2W9BA 4IRCA 1S6PB 2B43A 3HVTA 4KHMA 1TKDA 1K6YA 3KHRA 2YKMA 3Q8PB 4QCLA 4OKEA 3V6DA 2GC8A 3HVWA 3I5BA 1RT7A 3OS1A 2QKKA 4FM0A 2D7SA 3V1RA 3FSIA 4ELVA 2FVQA 2JGUA 3L2QA 3IS9A 3P1GA 4EO6A 4KHWA 1T03A 3FQLA 3KJVB 4ED6A 3G10A 3KKSA 4JUZA 1S48A 4DTRA 2E9RX 4NZ0A 1TAUA 4CJKA 2X78A 3L8BA 4CF8A 2YNHB 4FBUA 3SYZA 3C6TB 5KT5A 3V6KA 3M8SA 3CG7A 3T5JA 4O0JA 2C22A 5DK5A 4PY5A 4IH7A 2W9CB 5K14B 3AVKA 5KT4A 4LH5A 4FLXA 4B08A 3O3HA 1RDRA 4O3PA 4CK3A 4AHVA 2RPIA 4F8RA 2BDPA 2OYQA 1GOAA 3AO1A 1ZBIA 3M8QB 1ZETA 2OPQB 3DRPB 3V9ZA 3RBDA 1JLBA 2EX3A 4MKBA 3RB4A 4KTQA 1HNVB 1SL1A 2HNZA 4ZPAA 3LP0B 3NMAA 1IH7A 4WZMA 4ELUA 3SUNA 1RNHA 2FBVA 4E7HA 4Y3CA 3TAQA 5D3GA 3ALYA 3RRHA 4F50A 5KFTA 4DL6A 4JRQA 3SUOA 3O3FA 4FCYA 1A5XA 2WB4A 4Y1DA 4W5NA 1ASVA 2PY5A 2XHBA 3I0SB 3C6UA 3M8RA 3GV8B 2KQ2A 4ZPBA 3H5YA 1QUVA 4ED7A 4RNMA 3PO4A 5I42A 4BWJA 5KFWA 3OSNA 4E19A 3CFPA 1HRHA 5KG3A 3KLGB 2IDOA 4ZHRB 1X9WA 3KHGA 2J6SA 3OYFA 1YVFA 4YNQA 4KBIA 1Q9XA 4ECVA 1N56A 4MFBA 5HROB 2KZMA 3OLAA 4CHOA 4BACA 3RRGA 4CEFA 1C0TA 3KD5E 3OL7A 2BANA 4OLBA 3IG1B 4B8AB 4DU1A 4CJFA 1WLJA 5DLFA 3I0RB 1GX6A 4EP4A 4ED1A 1SL2A 3FRZA 4EZ6A 2JC0A 4CJ3A 3KLVA 4BDYA 2IC3B 3CIZA 3QEPA 2QXFA 3CJ2A 4EBDA 5KFSA 1WN7A 3AA3A 3V6HA 3QGGA 2HNDB 3KK2B 5EDWA 1D9FA 4FJHA 4Q45A 3AVLA 2OPQA 5K14A 1RBTA 5KG4A 4O4RA 4FZYA 4B9MA 1KRPA 3DRRB 4RW6B 5KT7A 1DTTB 1RT1B 2RF2A 5HLFB 1LWFB 1SL0A 3QNNA 3PW0A 3SQ1A 4CJUA 5FDLB 3O3GA 5KT6A 3IRXB 4RW8B 5CYMB 3CM5A 1ITGA 3H59A 2R2UA 3RMBA 4KB0A 4W5QA 4K4ZA 3ZSVA 1X9SA 4KB1A 4DFKA 4GMJB 4O3RA 4GW6A 4DF4A 3OYIA 4NYNA 3NCIA 1RAJA 4DL7A 1NK0A 2FC0A 3HP9A 2W7OA 4DSFA 3V6JA 5DGAA 3DMJB 1RT1A 4R0EA 4GVMA 4DWIA 2W8KA 1DLOA 4NLQA 1TL3A 5L1JA 4ED3A 4LY7A 4Z0UA 3H40A 4DTNA 4N56A 3HL8A 2IAJA 4PQUB 1YVUA 3U3YA 1T05B 2VA2A 3MXIA 1RCHA 5I3UA 3G6VA 3QEWA 5JUMA 4CJ4A 3TQ1A 2WOMB 5C24B 3SUQA 2YKMB 3CJ4A 3ITHB 3S3NA 3FFIB 2HNZB 4CCHA 5KFFA 3I8DA 1KTQA 4FLWA 3OSPA 4F4KA 2KZZA 2GIQA 2P5GA 2OH2A 2R2SA 2YKNB 4CK1A 4NRUA 1WSGA 1S1UB 2A1SA 4RUAA 1SV5B 3KLFB 1VSKA 3T1AA 3CM6A 3ZT4A 4RNHA 1JLCA 3PW4A 1C0MA 4WE1A 1NJYA 2KTQA 1R0AA 3C6UB 3FQKA 2VG6A 4TN2A 3OHAA 3DI6B 1LV5A 3KD1E 3UIQA 4Q43A 1B9FA 4J9LA 1BI4A 4ZVFA 1A5VA 3T5KA 2Z1GA 4QWCA 3QIPB 1KVBA 2FVPA 4FM2A 1BIUA 3KK2A 3UR0A 2Z1JA 1DTQA 2E4LA 1UWBA 4IFVA 4CFBA 2B6AB 4QW9A 1JLQB 3OS0A 3M8PA 3M9MB 3DRSA 4DTXA 2WK4A 4OGEA 3MFHA 1LWCA 3G86A 4CEEA 5KG6A 3KOAA 4DTJA 4HCCA 4RW6A 4BWMA 1RTJB 4CEAA 3VQ5A 1BQNB 5KFOA 3OS2A 1NJWA 3L3VA 1HARA 1LAVA 1S1TB 1NKEA 4JLHA 4I2QA 3T5LA 3NGZA 4NCAA 4YR2A 1L3VA 4NLSA 1QTMA 5KT2A 1J53A 5KG5A 4F2SA 3CYMA 4IFVB 1D0EA 4WZQA 4K8XA 1MU2B 3AVHA 4J9RA 3K5OA 4CF2A 1HNIB 3NFAA 2GV9A 2YNIA 3HPHA 3ISNC 1KSPA 4Z4IA 1JIHA 1CSJA 2XRIA 2VG5A 3LALA 5KG0A 2ZKUA 3QO9B 4N76A 3E01B 1S9EB 3MEDB 2PYLA 1S9FA 4PUOA 1LW2B 4N5SA 4EBCA 1RYRA 2YNIB 4ZP8A 1N6QA 3EPIA 4DQQA 3P5JA 3HKWA 5L1KA 4J9OA 4ECZA 5SWMA 4G1QB 3AV9A 2HHTA 1XWLA 1C0UB 4FJGA 4NCGA 4FS1A 5I42B 1J9AA 4H54A 3F73A 2XO7A 3GQCA 4J9NA 1RYSA 5KFKA 4ZP9A 4EBEA 2FJXA 3BR9A 3KHLA 3HPGA 4DLGA 3BSNA 4O0IA 2G8FA 4DL4A 1GOCA 3NAHA 4KV8A 4HHTA 3SFGA 2YKNA 2G8UA 4FJMA 2ITGA 4K4YA 1DTTA 4IG3B 1NK8A 4Y2CA 2IC3A 4NLYA 1QAJA 4URSA 1T8EA 5KI6A 4NLOA 1U45A 3ITHA 4R8UB 2ZD1B 2BE2A 1D9DA 2W9BB 4ZMMA 1HYZA 2YNGB 4DTPA 1WAFA 4F4ZA 3ULDA 1X9MA 1JLBB 5DG8A 5DQIA 4CEOA 2FVCA 1JLFB 2ILZA 1N5YB 4NYFA 4AHUA 3NH2A 4CGIA 3LWMA 4E3SA 3VQQA 3QIOA 3M9NB 1FKOA 4DSIA 2IOCA 4PA1A 2G8KA 4KKOA 2F96A 2HW3A 2ZQBA 2HB5A 2W9AA 4JS4A 4J9QA 2HVIA 5KTQA 3BQ0A 3KLIB 5J1EA 3C95A 3PJXA 1C1BA 2P51A 2R7YA 3V1QA 4ECWA 2OZSA 2BANB 4WYWA 4F2RA 4KAIA 4NLTA 3QZ8A 2IJNA 2AJQA 3LANA 2DPJA 3BDPA 4DSLA 1BQNA 3KLHA 5KG1A 1C1BB 5F9LA 2RKIA 3MEDA 1A5WA 4M3ZA 4LH4A 4ED2A 2C28A 4FJ8A 5J2PA 1HQEA 3DOKA 2WOMA 1EP4B 2X6SA 2WONA 4ZHRA 2DPIA 3K5NA 1CZ9A 3DLKA 4NYZA 1S1XA 1VSMA 1RTJA 1ASWA 4CEDA 1TKTA 4KB7A 2GIRA 1LW0B 3TAFA 4Q0BA 4K4WA 3DLKB 4F4YA 4FJLA 3H4DA 3P83D 3VQPA 5KRSA 3IRXA 4LSNA 4DU4A 1TGOA 4B3OA 3SPYA 1R0AB 1TK0A 5CY4A 2OA8A 3NH1A 3D45A 2QE5A 2IM1A 3RAXA 2IS3A 3Q8QB 2I1RA 3TVKA 5DQHA 4AH9A 4CHPA 4F3OA 5KFVA 4O3OA 2HVHA 3LPTA 4EYIB 3MFIA 1UWBB 4URGA 1JLEB 4RNNA 4K4TA 3NE6A 1IKVA 2R2TA 5KFNA 3PUFA 4E0DA 3RMAA 1TKTB 2FJVA 1NJXA 2DFHA 2IA6A 4FJ9A 4M45A 4CGFA 4O3QA 3WNFA 4Z4GA 3GILA 2CJQA 3HPOA 4FLUA 4CFAA 4LSNB 3V9UA 3OLBA 5KFCA 4HUFA 2JEGA 1VSDA 3OYLA 1HYSB 1Z26A 2HMIA 3T19A 5KFEA 1KFDA 1NKCA 2R8IA 4CJLA 1BGXT 3D28A 4OLAA 5HP1B 3H5SA 1IM4A 4DFMA 2D0BA 4QAGA 1RBUA 2YV0X 4DSKA 3F9KA 5F8HA 3ZSXA 3HJFA 3DLRA 4EO8A 1Q9YA 4GC7A 3KLFA 4FVMA 3UDLA 1IO2A 3DOKB 4B9SA 4BDZA 4KFBB 3U6FA 3PX0A 3OYJA 5DQGA 3ZT1A 1ZYQA 3O4QA 3OL8A 3OHBA 2BQUA 2BE2B 4ELTA 1VRTB 3NH0A 3BQ1A 1KCFA 1Z4UA 4B9LA 2VWJA 4B9TA 3LP2A 5C42B 1XR6A 3ICLA 4DSJA 2IM3A 1TK8A 4DQPA 3SI6A 4I2PA 4CHQA 1UAXA 4M3XA 1X1PA 5EUHA 2AGQA 1C1AA 2F8SA 4CE9A 2ATLA 4Q8EA 2FLPA 3TABA 3QEVA 4KI6A 3BGRB 3HHKA 1JX4A 4CHZA 1XC9A 4MH8A 3HK2A 4K4VA 4FYDA 4IR9A 4BE1A 4FW1A 1CLQA 3V9WA 5J2NB 1S97A 1RTIA 4NRTA 4KHQA 1DTQB 3QETA 3BGRA 4IR1A 3L2WA 4IG3A 4CJEA 5C42A 3AO5A 4RG8A 3BJYA 4HCBA 4NCGB 4HYKA 3ZCMA 3OYKA 3SJJA 1JXLA 4E7IA 4IDKB 3AVGA 4ECUA 4TYBA 3HSTB 2QK9A 1FKPB 4IBNA 5EWGA 5KGXA 4JV2A 1Y97A 4R5PA 3IAYA 3L2RA 4KI4A 3AO4A 4QWDA 1S10A 4MKAA 4M95A 4M3TA 2DY4A 4J2EA 2WHOA 3DM2A 3LWLA 3EPGA 4H4MB 1S1WB 4ICLA 3G6XA 4DEZA 3BSAA 5EU7A 5KFZA 3PV8A 4F4WA 3PW5A 3MR6A 1ZBHA 1SH2A 2ZD1A 3G6YA 1U09A 2D3ZA 1WAJA 4B8CA 3MR2A 1RTHB 2VG7A 5CYQB 2D0AA 4CFCA 3LP1A 3VN5A 3VQBA 4CJQA 1JL2A 1VSIA 5F9NA 1RT5B 4NLXA 1SUQB 1VRUB 4U6PA 3KMQA 3HVTB 3D5MA 3WNEA 4KFBA 1NK7A 1BQMA 2UVRA 4I2QB 1KHVA 2V4QA 1LWCB 4H4MA 2ETJA 1U49A 3VQSA 2HHWA 1CXUA 3M8QA 4CIGA 2UUWA 5F8NA 3BREA 3VQEA 5J2QA 3LP3A 4FS2A 4DL5A 4DS5A 1QE1A 1S1VA 2ZE2B 4QWEA 3I0SA 1K1QA 2AQ4A 1NHVA 4IDKA 3DOLA 3K58A 2HAIA 3SV3A 1XR7A 3ASMA 3ZSQA 4YP3A 3VQAA 5KFYA 1RBRA 1JLFA 1KFSA 1FK9B 1LW0A 4FXDA 2VG6B 4ECYA 1HNIA 4OKKA 5HBMB 1DLOB 3OJSA 4KO0B 1BISA 1TAQA 2G8IA 1IKYA 4LD0A 1HQUB 4O4GA 3DLEA 3KLEB 3CQ8A 3SNNA 4KPYA 2V9WA 2YNGA 3V81A 1S6QB 5C5JA 2XCPA 1KLMB 3KKRA 3I5CA 1QE1B 3KLHB 4B9VA 1S1WA 4ICLB 4NLDA 4J9PA 4OPKA 2O5DA 1RDDA 4RNOA 4CK2A 4DF8A 2FLLA 4RNFA 3UPFA 3QZ7A 2BGGA 1WSHA 4QPXA 4URQU 4HUGA 3KLIA 5J1EB 3ZSWA 3NF8A 5DMRA 2ILYA 3ZSRA 4J9MA 1S0OA 3KNAA 2W9CA 3AA5X 5CZ2A 3NBPB 3CJ3A 4KKOB 3H2LA 2B6AA 4WXWA 3GIMA 3OVNA 4TQSA 1VRUA 4M94A 1N6QB 4FJNA 1RTDB 3TANA 1S9GA 2D5RA 2HHXA 4KHYA 4JV1A 3CVKA 2Y1IA 4WFXA 3NHGA 4FLVA 1TL1B 1XI1A 3DOLB 4DQRA 1EX4A 4FK2A 5T14A 4AHRA 3BSCA 3K57A 1IG9A 3KK3A 4LQ9A 3NF7A 4CIFA 1SUQA 1S49A 2WRMA 5HRRA 2IBKA 3QO9A 3DRRA 4J2AA 5FRNA 2ASLA 3M9OB 4Z4HA 1RA7A 4M3UA 4IH6A 2YHBA 5KFUA 2RDIA 4JV0A 4WE1B 5L9XA 3AVBA 4HUEA 1JLGA 4DTSA 1MMLA 1BCOA 4MK8A 3MEGA 4I7FB 1S6PA 3V1OA 5T7BA 3V81B 3RMDA 4WFYA 3MEEB 5KFBA 1NKBA 2HHVA 4QWAA 4EP5A 3IG1A 3TAGA 4DLEA 1WNEA 2ASJA 1BCMA 4J9KA 2YNFB 1HMVA 3QLHA 3L2VA 1WSIA 3WNHA 3B6OA 3OYCA 4FJKA 2FJWA 2BQRA 2B4JA 4DS4A 4DG1B 1TKZA 4O3SA 1HPZB 3PR4A 4ZVHA 1SKWA 1RT4A 3JSMB 1FK9A 5DG9A 1UA0A 4Z4EA 3MR3A 4DQSA 5JS1A 1RTIB 1BIZA 2WCXA 4F4XA 4CFDA 1TKZB 4PWDB 4NLVA 1ZBUA 5KG2A 3OYBA 1RBVA 3Q8SB 3KHHA 2HMIB 2G8WA 3AA2A 2OPPA 2Q3SA 4CGDA 2R8KA 3KMSA 5KFRA 4CF9A 3MAQA 1QHTA 2IJFA 4TSXA 4DSEA 3H98A 1QSLA 2A1RA 4CF0A 1HQEB 3AO3A 1NOZA 4N47A 3HM9A 3N6LA 3GV5B 2IGIA 4Y34A 3AA4A 4KHNA 2R8JA 3EY1A 4IG0A 1IKWA 1EXQA 4XPEA 1XHZA 3LP1B 2OZMA 5KGWA 1RT6B 3S9HA 4BDPA 4OL8A 1NNDA 4KAZA 4O4GB 3VQ6A 1ZTTA 1LWFA 3LAMA 3RAQA 5CZ1A 2HHUA 2JEIA 4YR3A 4G1QA 2OPSB 3MEEA 3WNGA 3K59A 3MXJA 1C6VA 1VSEA 2Z1HA 4R8UA 4Z4FA 4TXSA 4J2DA 2GBZA 1S0MA 1U47A 4DQIA 3LPUA 3HYFA 3RTVA 3E51A 1N48A 1RTHA 3ISND 3KK1B 2V0NA 4Y2AA 4U7CA 2HHQA 5HROA 4LSLA 4IQXA 1SKSA 2F8EX 3OY9A 4IG0B 3CO9A 3DMJA 2C2RA 3QLHB 4CJRA 2R8HA 1WSFA 3CWJA 3C94A 4E7LA 4WYLA 4JRPA 1S9GB 2XGPA 4ZP6A 2E6LA 3VQ7A 2O4IA 3VQDA 2UUTA 2X6NA 3BSOA 5C25A 3SPZA 3AO2A 2XI2A 3NAIA 3QGIA 2YHAA 2UVVA 2WONB 1NHUA 3CDWA 2JLEA 1EP4A 3AVJA 3LZIA 4KO0A 5KFXA 1D1UA 4IKFA 2J6UA 4CJSA 3QERA 4FJJA 4B9NA 1S9EA 2LSNA 2PZSA 1T7PA 4CJTA 5KRTA 3TAMB 5KT3A 2KFNA 4CECA 3A2FA 1TVRB 2D0CA 1EETB 5E41A 4MIBA 2BQ3A 4G3IA 4CHYA 3LP2B 5KFDA 4CGGA 4CERA 1SH0A 5F8GA 3NKYA 5HRSA 1NK9A 4FLTA 3TR8A 4B9UA 2XGQA 1T3NA 3DM2B 5DG7A 4DL3A 1VSFA 1JLQA 2HHSA 1TKXA 3RMCA 4RZRA 3DLGB 3KIOA 4O3NA 1NJZA 1Q8IA 2DFEA 3OYMA 2IMWP 4CJ5A 3PHEA 1LWEB 5C24A 4RUCA 5L1LA 1EETA 4O44A 3QYYA 5KFAA 4Q44A 4J2BA 5KFQA 3BQ2A 4K4SA 3GYNA 1J5OA 5FROA 2E6MA 4I9LA 2FBTA 1W0HA 1BQMB 1RT2B 1L3TA 3EZUA 4ZVGA 4FJ5A 2QKBA 2XY6A 1N5YA 4DL2A 4KE5A 4YQWA 4BE2A 2VA3A 2VG5B 3KTQA 4E1NA 4CGJA 1JLEA 4M3WA 1C1CB 1IKXA 5HLFA 4R5PB 5KFIA 4JS5A 4ZPCA 1JLAA 4ID5A 1L3SA 1XHXA 1QSYA 2AGPA 3O4NA 3SQ2A 4FZZA 3RB3A 2JC1A 1HYVA 4KRFA 4C8MA 2AX0A 2JEJA 3K5MA 3HP6A 1RDCA 1S1TA 4QW8A 5EWFA 2AWZA 1JXEA 5J2PB 3HT3A 2BRLA 4ZPDA 3G0ZA 2IM0A 4MK9A 2XC9A 4FJXA 4E7JA 1I39A 3AVCA 4W5OA 4OGCA 2G8VA 3KLEA 3B6PA 3E01A 4IH5A 4EYHB 3NL0A 3PX6A 4H8KA 4DFJA 4TY9A 1KVAA 3RBEA 3TAEA 3VQCA 3VQ4A 1NK6A 3KJVA 4FZXC 3JYTB 1LW2A 4BE0A 2D41A 1RBSA 4OJRA 2DTUA 4NLPA 3I0RA 1JXBA 2AX1A 1L5UA 1L3UA 2P1JA 2O4GA 1WSEA 2XI3A 1S1VB 2ZE2A 3QINA 3V4IA 3NAEA 3Q8RB 4O44B 2V4RA 4FLYA 2EHGA 5HRPA 3CFRA 3D0PA 3S3MA 1TKXB 1FKPA 4O5BA 1JLGB 1RT3B 3K2PA 4IRDA 2OPRA 1NOYA 4KHUA 1IKVB 1JLAB 4K50A 3RR7A 4PUOB 4XIUA 5I3UB 1RT7B 4F3TA 3MTKA 4C8NA 3H5XA 3OYAA 4EEYA 4TLRA 4OVLA 4MQ3A 3IN5A 4K8ZA 4ED8A 1QSSA 3LAKA 3JYTA 3NF9A 2P5OA 3ZSOA 4RW7B 4GC6A 4Q0BB 3QEIA 1J5OB 1RDBA 2HNDA 4XPCA 4AHCA 4ZTJA 5SZTA 1NK4A 1SV5A 5JS2A 3T5HA 3SV4A 1I6JA 1BHLA 5KFLA 5D3GB 4ZP7A 4H4OA 2UVWA 1SH3A 1RA6A 3SFUA 4I9QA 1K1SA 1GOBA 1RT3A 4NCBA 4ECRA 5DGBA 1S1XB 4IRKA 2RN2A 2D3UA 3ZT0A 4X2BA 1C0UA 1TQLA 3DYAB 1T05A 1O1WA 4IFYA 2IAJB 4PQUA 1VRTA 1RILA 4AHTA 3PJWA 2EC0A 2XWYA 3CJ0A 3PR5B 1OS5A 1RT2A 3FFIA 2HWIA 3PZPA 1GX5A 3VA3A 4KTWA 2ALZA 4IFYB 3CJ5A 4NLUA 3NGYA 3CFOA 1RDAA 2PYJA 1F21A 1UOCA 3GV7B 2JEFA 3L3UA 3HXMA 5KFGA 3OYEA 1U04A 3H5UA 4RW9A 1I3AA 4KSEB 4CGHA 4TYAA 2FBXA 3AVAA 2OPSA 2QV6A 2HNYB 2KFZA 3AVIA 4MIAA 3SUPA 4CF1A 3RWUA 1HQUA 1QS4A 1KLNA 3N6MA 3MECA 3HVAA 2FBYA 3UQSA 4HVJA 4ECXA 4RW4B 2GUIA 4OPJA 3FDSA 4KHSA 4FBTA 3QIPA 1VSHA 3PW2A 2XY5A 1HMVB 4O55A 4CJVA 2BR0A 4E89A 3OL6A 4Q5VA 3V9SA 4HKQA 5KG7A 1VSLA 1VK0A 3DLBA 4W5RA 5HRNA 4CEBA 2AGOA 1B92A 1C0TB 1KHWA 1W9HA 3KK3B 5KFPA 1S0NA 1ZTWA 1RT6A 4CESA 2RKIB 5KFJA 1S5JA 2G8HA 2XY8A 4CEQA 5CYMA 1BI4B 1S6QA 4B3OB 2CKWA 4ZTFA 1N4LA 3VA0A 3S3OA 4QWBA 4J9SA 3KLGA 4XO0A 2YNHA 1J54A 5HP1A 4KTZA 4FK0A 1VSJA 4N41A 5KFHA 5C25B 4Q8FA 2Z1IA 3N6NA 3RR8A 1RT5A 3ZT3A 3HO1A 4NLRA 2IM2A 4PWDA 4IKAA 4Y1CA 3ZT2A 1NK5A 3SCXA 2W7PA 2R2RA 4FLZA 5FRMA 4MFBB 3PVXA 1U4BA 4ID5B 3QIDA 4M3YA 3MEGB 4LQ3A 4RW7A 1SKRA 3OYGA 2F8TA 4FW2A 2Y1JA 1FXXA 1WNSA 4TQRA 1U48A 2C2EA 4FJIA 1JKHA 2UVUA 1WSJA 1IKWB 4FJ7A 4ID1A 3TI0A 3K5LA 3T3FA 4H4OB 2C2DA 3RB6A 3IGNA 4HTUA 4W5TA 5J2MA 4TY8A 4M42A 4FK4A 4NLGA 1IKXB 1RT4B 3JSMA 3DDKA 5F8LA 5EWEA 1LWEA 4K4UA 4CJWA 5F8IA 3DRPA 3DLEB 3GIIA 1W25A 5F8MA 3MXMA 2OPRB 5J2NA 2WTFA 4DTOA 4ED0A 3DI6A 1EKEA 3NF6A 1TL3B 3NBPA 1HJRA 1LAWA 4WFZA 4DFPA 2J6TA 3SQ0A 4RW8A
chains in the Genus database with same CATH superfamily
2QEXN 1PIEA 1URNA 3OYHA 1F5CA 3V4IB 3AVNA 3PG9A 4JHDA 3VERA 1ASUA 1UPMB 4I2PB 2NNWA 2VOPA 3TARA 1ZBLA 3S7RA 3G96A 3A4TA 3OJUA 3MMVA 1YTUA 1S1UA 1W2IA 3IA0A 3FEYB 2MZJA 1FTCA 1FKOB 2L08A 2XY7A 2RS8A 2XMAA 1HI1A 2EKNA 4QOZB 1UVMA 1FTRA 1RLDA 5F8JA 4TU7A 1NXIA 4LFAK 1REGX 3VQ9A 3MF5A 1M5VC 2WUSA 3V9XA 2B5JA 5SUHA 4YMEA 4EFHA 5D0GA 2J9CA 3I33A 3THVA 4U7UK 1HIYA 1JJ2R 1TK5A 1BL3A 2GAHC 3OL9A 5C15A 3SQ4A 4F67A 1XR5A 3AHPA 2RDJA 4UUWA 5HBMA 3H08A 2E9ZA 1S7IA 3HI9A 5DLGA 4ECQA 1G15A 1YTAA 2CPIA 2ZZTA 3SSQA 5AQGA 4DU3A 4Z4CA 3QNOA 4KV8B 3M30A 1U1LA 5KAKA 3DYAA 4AILC 3CW2C 3OTOF 3VQ8A 4RWXA 4DV5K 5B0EA 2NCKL 2YNFA 2A1BA 5D8HB 4ZVTB 1KLMA 2CJYB 3MECB 2KW4A 3NGDA 3R3TA 1TVRA 1HHTP 1X4DA 3W2WB 4K4XA 2YKAA 4ECTA 4H5WA 2HF3A 3EZOA 2HNYA 2V2QA 2AYEA 3U4LA 3MR5A 2V9KA 2MEWA 2E9TA 2LU1A 3A3OB 4RW9B 3BEGB 1CZBA 5F0XA 3DLJA 3PW7A 1TP7A 2D69A 3HVRA 2AEJA 4M3RA 3GIKA 1QAIA 3JTNA 4CTAA 2J0XA 2DR9A 5GADI 1IM6A 4GNIA 1B7FA 2HHHK 3HVTA 3UCGA 1ICEB 4OKEA 3V6DA 2GC8A 3I5BA 2CQ3A 2KFYA 4PL8A 2QKKA 1U0HA 4V19S 1WG1A 4FM0A 2VIHA 3FSIA 2ADCA 4RJVA 2FVQA 2KXFA 3KJNB 4DV1F 3DLLL 4FVUA 1GLDG 2ROGA 4I6YA 1T9TA 2B0GA 4WTYA 1LXJA 4F26A 2KG1A 1WB9A 2KT5A 3EKUA 4PG5A 3KJVB 2KDOA 2KL8A 3ENOA 3KKSA 4LF5F 4N8NA 4DTRA 3DXMB 3CXCR 4ZVSB 4ALZA 2OAUA 4NXNK 2KHDA 4JI8J 4QYRA 4KH1B 1RWMB 1UVKA 3CD5A 2YNHB 4FBUA 1GH8A 3SYZA 3ZX0A 3V6KA 2V68A 2ZH9A 3CD6N 4DUYJ 4WIQA 5ETPA 2C22A 1RAEB 5DK5A 5K14B 2Z2YB 1IR0A 5EX5A 4B08A 5AQVA 2RPIA 4JI6F 3U1NA 4F8RA 2BDPA 2F7TA 4JI8F 2PI5A 2Q6BA 2GZOA 2OPQB 3LPEA 3DRPB 2YTCA 2HYIB 2MQOA 2ZFHA 2QFIA 4DR5K 1HNVB 1SL1A 3JQMA 1RBAA 3LM9A 1VQNN 3M2RA 3M5RA 3NMAA 1IH7A 4WYBA 3CJSA 1RNHA 4TNOA 4E7HA 2BKNA 1MWYA 2V94A 4ILGB 3RRHA 2GVZB 5T41A 5KFTA 2CQ2A 2P9NA 2H65B 3O3FA 4BR9A 2R7OA 2FJAB 2WB4A 1S77D 2OGUA 1ASVA 3I0SB 3C6UA 1UFKA 3TUZC 3H5YA 2P9IB 5I42A 3MM7A 2F4FA 3Q7BA 3ETMA 1U2FA 3THTA 3OSNA 3TA1A 3KLGB 2MGZA 3KHGA 1R8HA 4OZ0A 1LFPA 2NQPA 3M8ZA 4X4OA 3RG6A 1CJVB 2KZMA 4MYTA 3OLAA 4CHOA 4BACA 4CEFA 2RD5C 1NLKL 4DX6A 2BANA 2OKQA 1X4EA 1WLJA 5D0HA 5DLFA 3I0RB 3CJ9A 1GTHA 4LF4F 3NRBA 3FRZA 4JI3F 3MHYA 4Y65A 2ZITA 4OX9J 2QW9A 2HZCA 5KFSA 3AA3A 2A42A 3QGGA 2HNDB 4JKCA 3KK2B 1VQ9S 3JTPA 1HNXJ 4OJ1A 2OPQA 4O4RA 2MYFA 4B9MA 3DRRB 1SJ4P 3O5BA 2O8DA 1RT1B 1YBAA 2RF2A 3KXDA 5A6WA 1HPMA 1VQNS 4JKBA 2DNPA 2WVCA 3EICA 4NI2B 1ATRA 1YLXA 4CJUA 5HOOA 3O3GA 4HHJA 1VQMS 5KT6A 2YWWA 5CYMB 1SQGA 3CSKA 4OMFG 5E3AA 3CCES 2R2UA 2MSTA 4W5QA 1WF2A 5JICA 2XMUA 4CZMA 3DC2A 4DFKA 4PG6A 4DF4A 2PI4A 1APSA 4GW6A 2FHOB 5AQNA 1HUXA 2FC0A 4OI2A 1H73A 2NLWA 4Q2LA 3V6JA 1Z1ZA 2J9EA 4NXMK 3RZAA 1YRTA 3Q23A 1CQNA 2NYHA 2XNRA 4N56A 3FGUA 4PQUB 3CCJN 1BXNA 3DHWC 3U3YA 1SJRA 1GMVA 2Z56B 1RCHA 5JUMA 2GELA 3B6BA 4CJ4A 5C24B 2GCFA 3G87A 2YKMB 1OYDA 5KFFA 3C6AA 3I8DA 1KTQA 4FLWA 3OSPA 1NCLA 3OTDA 2P5GA 1MN7A 5AQKA 2R2SA 2E1RA 5GAGP 4ZJLA 4CK1A 2A1SA 1HI0P 3KLFB 2ERRA 4LFAF 4RNHA 5IT0A 1JLCA 2J0QD 3C6UB 3DCAA 1LV5A 3HHNB 1BI4A 2PMHA 1A5VA 1YGYA 2V7YA 2HBQB 3T5KA 3WX8A 2WB1D 4X65K 3QIPB 1SJ3P 3UR0A 1M5HA 2ZH2A 3T7ZA 1NM2A 3H20A 2B6AB 5LMUK 4FF4A 1HBMB 4OGEA 3OFFA 2R7UA 4CEEA 3KOAA 3R5DA 4DTJA 4HCCA 4AFFA 1EB0A 2RH3A 3P8BB 1V3RA 5KFOA 1RWPB 1N34K 3OS2A 1NJWA 4FPRA 4OJ3A 4HH1A 1S1TB 3L7PA 1NKEA 3T1HJ 2ASPA 3BZKA 4JLHA 1FX4A 1NDLA 2CPFA 3SAGA 4CQ1A 2QSFA 3N5FA 4NLSA 4WKYA 3WXJA 3PFEA 5KG5A 4RTFD 2A2DA 2NRVA 1P90A 1MU2B 2M8DB 2DISA 1YJRA 1U2VB 5M1FA 3K5OA 2YXLA 4FF1A 2GQQA 2LEAA 3SDEB 1UVLA 2NRWA 2ZKUA 4N76A 3MEDB 3H0PA 4N5SA 4OX6A 1RYRA 2YNIB 2C2NA 1FD2A 3HKWA 5L1KA 4J9OA 1CBKA 4TU9A 1NZAA 2HHTA 1XWLA 5BREA 1C0UB 4I6WA 3F73A 4H5TA 4GKKF 3H8YA 2LQ5A 3BN7A 4ZP9A 2Y3YA 4YHHK 2FJXA 3DOMA 4DLGA 5GAEI 3HPGA 4KHPJ 4ZLJA 2G8FA 4X62K 2Q43A 4UY85 2HGLA 4JKGB 1GOCA 2GV1A 4HLBA 2ZBQA 3NCRA 2BUNA 1J6ZA 2QL5B 4DUYF 4AUKA 1D4XA 1X4AA 4IG3B 3AJDA 2IC3A 5D4PA 4R8UB 3M6VA 1UJ5A 1KS2A 1UEVA 1RU2A 4B3SK 3SQOP 4DTPA 3ZFVA 3IMXA 1WAFA 1C0GA 1JLBB 4NB4A 2HQDA 4B3RF 3K2YA 1N5YB 3LWMA 4E3SA 2X1BA 1K73T 1FKOA 3PJ9A 4OYZA 2IOCA 3RSEA 1QM9A 3NMUA 2QO3A 2F96A 4JKGA 2ZGZA 4J9QA 4OI0A 5KTQA 3O44A 5FIIA 2B4OA 1E6YB 3C95A 3PJXA 3L95X 2J0SD 1NNEA 3ONQA 2GX9A 4BC5A 2OZSA 4FNHA 3THPA 2HFVA 3CMQA 3G71S 1KVIA 2AJQA 5HQMA 3LANA 3EUNA 4DSLA 2FC8A 5G0RB 5KG1A 1C1BB 2O67A 1HKCA 2RKIA 3MEDA 2A6AA 1NMEB 3QSYB 3JS6A 1M5OC 4FJ8A 4C3MA 2W4PA 1HQEA 2N7YA 4P2XA 3AOAA 2CQ1A 1EP4B 2CIMA 2DPIA 1QVFR 2KRBA 4I6MA 3DLKA 2P9GA 4NYZA 1UTAA 3IBFB 2IVNA 1YBUA 3UNGC 2ACMA 5K9FA 4AQYK 4BR7A 4KB7A 3MMCA 1RAAB 1WTBA 5FPMA 3BBBA 2DPNA 3KWIA 5KRSA 2P9SB 2VOOA 1Q1KA 3SPYA 1R0AB 2COLA 2OA8A 3T1HF 2HVDA 4C11B 1PJ6A 2A2CA 4FKYA 1N33K 2VDIA 2IM1A 2QLXA 1UVNA 2I1RA 1Z6RA 4F3OA 4CZEA 5KFVA 2HVHA 2M2BA 1NGBA 4PAAA 2B51A 1O6XA 4URGA 1OH5A 2L48A 1IKVA 2NSBA 3PUFA 2NRHA 2JFDA 3O5TB 4DL0C 1SJFA 4E0DA 3CJBA 3RMAA 2FJVA 3MMBA 4JI3K 3CCSS 4ATNA 2IA6A 4DR6F 4CGFA 1R27B 2LXUA 1S3XA 3WNFA 4Z4GA 2CA9A 2HRYA 2CJQA 3HPOA 1NGAA 1I5OB 2H3EB 1Z26A 4WFNL 2JWKA 2Q0UA 3LM2A 1C4CA 2C2MB 4CJLA 1BGXT 4DSKA 3MCMA 1VQ8S 3NP5A 3HJFA 3DLRA 2GW8A 4YB1P 4QIGA 4EO8A 4CZKA 4OZLA 1FFWB 3UDLA 1IO2A 4B9SA 3U6FA 2V34A 2CNNB 5HANA 3GCWP 2NSCA 2W7AA 4LC9B 5FPNA 3LA0A 3VCDA 1OY6A 4B9LA 4B9TA 2VWJA 1IBLF 2BE9B 4UF4A 4XEIA 3SI6A 4CYUA 4CHQA 3ULEA 2B9EA 2HK3A 2HBMA 1VC0A 1K47A 4A8FA 4M3XA 2NXEA 1N0UA 4A47A 4G9ZA 4MTPA 5M2UA 4WCEL 2DGSA 1XNQK 3TABA 2EKYA 3MOZA 2CZ9A 4ZPVR 3NS5A 1BWVA 1FRKA 3O9TA 1H1VA 3P31A 3L6QA 1CULA 4BE1A 1F3FA 3QBWA 4KHQA 3QETA 2NPFA 3V4MA 3BGRA 4HT7A 4RG8A 1V3ZA 2BOAA 4JI8K 2VC0A 1T11A 2HSTA 3GE9A 3SJJA 3J80U 4R79A 3D1HA 4TYBA 1Z2ZA 4XK8C 1JCFA 3HFKA 3ENAA 3N9UC 3DKDA 1WWHA 4LBIA 5GIPA 2WHOA 2WFBA 3G4SN 4KPCA 4DEZA 1HI8A 3BSAA 5KFZA 4JI5F 5D4NA 3MCAB 1Q5VA 3GYGA 1U1OA 5FD1A 1SH2A 1U09A 1Q78A 2PEHA 2D3ZA 1AZSB 1JWWA 3HHDA 4B8CA 2DHSA 3D6FB 4Y2IA 3FBCA 2VG7A 1SI9A 2D0AA 3KDOA 3LP1A 3VQBA 3CMES 4J91A 1RT5B 2YQ1A 4NYPA 1SUQB 4JV5F 4M5LA 4QIFA 4I67A 4U6PA 4EHTA 2AZ1A 3WNEA 4DR2F 4DR3J 1NK7A 1W7WA 1BQMA 5BR8K 1FVQA 3I82A 1KHVA 2QEXS 3MM9B 1R3NA 4H0VB 2QM1A 5E3PA 4JI7J 4LRBA 2QG9B 4CIGA 2DNQA 3UW1A 3BREA 1RAOA 2FDNA 4FS2A 1NEEA 1Y10A 3BBFA 2K06A 3I31A 3I0SA 1K1QA 3ILLA 5G4DA 2DIVA 2P8IA 2HQFA 5ETOA 4YP3A 2DGOA 1NBEB 1KFSA 1HNXK 2VG6B 3P49B 1PKUA 3CCEN 3KG0A 2DGXA 2G1HA 1NU0A 2ZJPQ 4ZLNA 1QZ6A 3GLJA 2C1EB 4P52A 3OR2A 1WEXA 4A8QA 3CQ8A 1S6QB 5F3TA 2MQPA 2XCPA 3EVWA 1ZM9A 1QE1B 1GLBG 3KLHB 1BC6A 1T44A 4MLHA 4J9PA 2O5DA 1F2HA 1RDDA 1RBOB 3VAGA 2QLJB 2BGGA 1YITN 1WUUA 1X5SA 1XIQA 5DMRA 3ZSRA 4J9MA 3CC7S 3P6YC 4LFCJ 3IAS9 5ETVA 3NBPB 3CJ3A 4OZ1A 2IIHA 2R7RA 4U9RA 3J8AA 4WXWA 1NDKA 4TQSA 1VRUA 1YX2A 2CNLB 1RTDB 1S9GA 2D5RA 4JV1A 3CVKA 2Y1IA 1ROFA 4WFXA 3D2EB 4FLVA 1TL1B 1XI1A 4OYBA 4FK2A 2HKEA 3K57A 1IG9A 1SUQA 3DRRA 1M1HA 2OO4A 3AD9C 4J2AA 4Z4HA 5ETMA 1KD1O 2YHBA 1A7GE 2BM0A 5KPTA 4WE1B 4NYOA 3WBZA 3W3DA 1JLGA 2Q2RA 2M88A 1FJCA 1MMLA 3AB4B 5LT5A 3RMDA 4OHZA 2ZZNA 1XTZA 4DBQA 4EP5A 4MKVA 1RKIA 3N4WA 1BCMA 1TUWA 4J9KA 1UCNA 4DV2K 5DZ6A 3G71N 3QLHA 3JQJA 3B6OA 4BRIA 3OYCA 4FJKA 4DS4A 4QR1A 4ES1A 3R7NB 1NU4A 4PXDA 2A6OA 2CQ0A 1VMBA 2EVZA 1SKWA 2HMPA 2O8BA 1UA0A 3DNCA 1RTIB 1BIZA 3R5AA 1TKZB 4NLVA 4PWWA 3M8WA 2P9PA 3IC1A 3FZBA 3FJ2A 3OYBA 1RBVA 3Q8SB 2KRRA 3KHHA 3FUYA 4I64A 2Q3SA 3AODA 3CDAA 3L09A 6FDRA 4F0HA 3BH7B 3H98A 1Y5NB 2A1RA 5E2QA 4WIIA 3AA4A 2VBWA 2RQKA 1YJVA 3CCLN 2OZMA 2YHWA 4LBPA 4O4GB 2L41A 4ZVQB 2AF6A 1LWFA 2CPHA 1TTHB 3NVKA 2JEIA 4YR3A 2V69A 3K59A 1NPKA 4TXSA 5F3ZA 2R4FA 4M63A 1Q16B 4J2DA 3UD3P 3CCZA 2XULA 1RTHA 5B0AA 2XM3A 4RR5A 4U7CA 4PKHA 3D66A 4USWA 5HROA 1HNZJ 2V63A 2GX8A 2Y8WA 1M5PC 3CO9A 3QLHB 4CJRA 1S5ZA 4X4UA 1G2EA 1WACA 4RU2A 3CWJA 4CZLA 4E7LA 4WYLA 2KH9A 4A59A 4ZP6A 3MD3A 4JBCA 4LF8K 2L9NA 3PFOA 2UUTA 5C25A 2XI2A 4JI4K 4ZJOA 2WONB 3L9ZA 4FWPA 3BPDA 3AVJA 4NWBA 1D1UA 1T02A 4U8VA 3R9LA 4KJIA 3R27A 2PZSA 8ATCB 1YJ9N 2ZH1A 2KFNA 4WQ5A 4DR6J 4DV3F 1TVRB 1ZS6A 2YKOA 3WXKA 5A8WB 4H5RA 4CGGA 2ZH6A 3J7YI 3CPWR 1T9XA 3AY0A 2VFTA 2B7BB 3NKYA 1NK9A 2QIFA 2YWFA 3JSBA 4DUZF 4B9UA 3BGFA 2UU9F 3POTA 4RBVA 3BM7A 5K8MA 5DG7A 2Q97A 2CAJA 2BJ1A 1JLQA 4DR5J 1FESA 4EUVA 3W3SA 3FVYA 3HCXA 2IMWP 4CJ5A 3DRXA 1LWEB 3PHEA 3RGIA 5C24A 4CO2A 4RUCA 5L1LA 5CHCB 2GS8A 1W26A 1NDCA 4A2AA 1O8BA 2QWQA 4BRHA 3Q8VA 4K4SA 2W4CA 1J5OA 4JD2B 2HBRB 1BQMB 3VGMA 2QKBA 4M5KA 3GP9A 4DL2A 4YQWA 2ZM6F 3JB9k 2GWJA 5B0GA 4CM0A 4OZ5A 3PIPQ 3AGRA 1C1CB 4JS5A 3VR1A 1NUEA 3W60A 4JEPA 1CJUA 1QSYA 2AGPA 3SQ2A 4IUFA 2WVBA 3ZXWA 1FE0A 2KXNB 1WHXA 3HP6A 3HT0A 1VQ8N 4NL5A 3MM5B 2ZF5O 4TKTA 3G0ZA 2YWEA 4E7JA 1RAIB 4WWSA 3IWNC 3VZHA 3E01A 1YF5L 4IH5A 4EYHB 4M5GA 1U1KA 2W40A 4DFJA 1JNRB 1FF2A 4CT9A 2WW4A 5AE2A 1NK6A 1LXNA 3FGVA 3ETOA 2D41A 1SC3B 2OD6A 1HNWJ 1E3MA 3SAHA 2WBMA 3I0RA 4P2SA 4G1PA 3UFCX 1DQ9A 1CC7A 2O4GA 1IWAA 2I0XA 4C97A 4FO0A 2LDIA 2QN6B 2MQMA 3D7SB 3HHLA 3QINA 3C19A 1M1GA 4ETZA 4UOHA 3P5BP 2Y0SD 3CFRA 3MK6A 2RDDA 1TUGB 1M5KC 1OY8A 3K2PA 3JXUA 3KWMA 1NOYA 5L39A 1L3KA 4KHUA 1NMNA 4K50A 4BG8A 5I3UB 5HL7L 4C8NA 3OYAA 5AQSA 3IN5A 4K8ZA 4LF4J 4ED8A 1QSSA 4U7BA 2XZWA 3NF9A 5B8HA 1HKGA 2VQEK 3D3CJ 4W92B 1J5OB 3PYEA 2ZWPA 3AH6A 2UUCK 4PABA 5SZTA 2VKRA 4QS7A 4L74A 1J27A 1I6JA 1HBMA 5E33A 1VK3A 1KXPA 1Y3JA 2HWTA 2CQ4A 2RU9A 2R7QA 2UXDJ 5JVGL 4ECRA 2JLFA 5HVFA 4X2BA 3DYAB 1T05A 1RDWX 2YQ3A 1Y9OA 4OX9F 3CJ0A 5HJYA 2YPZA 2RB7A 3BEXA 2KU7A 4OX8A 3FFIA 1GX5A 2ZBCA 4KTWA 2XLJA 1WG5A 4IFYB 4IOCQ 3CC2S 4NI2A 2E1ZA 1RDAA 1F21A 3HXMA 5ETRA 2JEFA 4BRPA 1U04A 2CXEA 1IXKA 4RW9A 3PM9A 2FD2A 1I3AA 4HH0A 2DTJA 1YWXA 2IMOA 2DH9A 3AVAA 2QV6A 2HNYB 2KFZA 4KY3A 2FHKA 2XYHB 3VAKA 5AQLA 3E2EA 4LIRA 3W5ZA 2J8AA 1XNRF 1KLNA 4BROA 3MECA 2FBYA 3UQSA 4ECXA 4RW4B 4PXEA 2GUIA 5BPNA 3FDSA 3C14A 3VAIA 4WF9Q 5EGYA 4A8MP 3QIPA 2XG8A 1VSHA 2XY5A 2ITMA 1HMVB 2VFRA 3GDQA 2ZBRA 3OL6A 3D0HE 4HKQA 4ZPTR 1KWMA 1VSLA 3BKTA 3DLBA 4KHPK 4CEBA 2AGOA 1KN6A 5THWA 2WSFC 3KK3B 3K89A 4OYOA 5AXNA 5H9EK 2RKIB 5KFJA 3PKMA 4MMOA 2XY8A 2C2KB 5JVGQ 3S3OA 1R8AA 4B17A 3OW2R 3WEEB 1T3OA 1WOOA 2YNHA 4A62A 2BV3A 1J54A 4KTZA 1VSJA 1MW7A 4DUTA 5LL6Z 4Q8FA 5IV3A 1YJUA 1PBAA 4OHWA 3HO1A 4NLRA 2XNQA 3ZT2A 2PEBA 2HFOA 3G6EN 3O6QA 4OZJA 4DV6F 2R2RA 1U8SA 5HL7Q 3LO3A 1FRXA 4M3YA 2VHGA 3ZZUA 5B0DA 3CCUS 4FW2A 2DB1A 2Y1JA 3CETA 1SBRA 2ZC3A 3O80A 2V7ZA 1WNSA 4N7TA 1FDDA 1UWAA 4CP5A 1U48A 1ZBTA 1HD1A 4JP8A 4U95A 3K5LA 2GGPB 3T3FA 4N77A 2I38A 3ZETA 2IVMA 3M1FA 4DN9A 2XZDB 4GKJJ 4LF6J 3AXMA 2FZCB 2ZUGA 2PGCA 4PYAA 5J2MA 2V8GA 1VK8A 4CJWA 4C0OC 3DDKA 5F8IA 3DLEB 2M5YA 4RKUC 2OPRB 3CO0P 4X65J 1KQSM 2WTFA 2FB0A 2JHEA 3DI6A 3JAMY 3NBPA 2W25A 4DFPA 4RW8A 3ZSZA 2LDYA 1R6VA 5ELZA 1R6YA 1D5AA 2IRYA 4B1XB 2W8LA 3AT1B 1T94A 2CJBA 4B3SJ 2XMWA 2E7VA 1DAXA 3UD4P 4IXCA 3FZ2A 4U67Q 3PX4A 1WOQA 1RGVA 1FFGB 2ATQA 2OHDA 1Q82T 5DDRC 2O8CB 4YY3K 4WK3A 4OHVA 4JAXA 2RF2B 5KQ8A 3CDUA 3IWLA 4GKJF 4LR7A 3CUNA 3IS9B 4EZ9A 1D8YA 3JAMU 1EWQA 5KFMA 1RTDA 3U3GA 5H9FJ 3QEXA 1T9VA 4KHRA 2NUBA 2CQIA 2M7SA 3TTCA 1UW4A 2AU0A 5CYQA 3H4BA 3ID8A 2GQCA 2ZM6K 4NA2A 3W65A 3BGLA 3Q22A 4USJC 5AQOA 3PY8A 1IR1A 1B3TA 4QYZJ 2B5JB 4E1MA 1Z25A 2P9LB 5C12A 3HKZD 2POKA 1FDNA 3B8HA 1ZBFA 1JK9B 1UA1A 1FXLA 4YOTA 3DLGA 2G2ZA 5DDOC 1NGJA 4I7FA 1N52B 2DKOB 4K5SA 2KKHA 3NGIA 3Q2SC 2ZBIA 2E1YA 3ZZPA 3I5AA 1H98A 1T03B 3MD1A 3QESA 3T9NA 4YR0A 3GG1A 1WC0A 4G6VB 5G0RA 1YIJS 4BREA 3FZLA 4NLWA 2BRKA 3KK1A 2V4JA 4L8RB 4FM1A 1HLUA 4MK7A 4LSLB 3H2VE 3V6DB 4BHQA 4B1ZA 4DG1A 2M0GB 5FDLA 4EGLA 3Q24A 5KPZA 4OJHA 1R8CA 5IV4A 1HPZA 1U7LA 1JLCB 4YFUA 5MLCV 3QDKA 2O01C 4KREA 5J2MB 3MMAB 4LFCK 2GFFA 2E44A 5EY4A 2RUGA 3AOBA 4E7KA 4OI6A 2DNLA 5AXKA 4IRCA 1F2GA 3HD2A 1YHQN 5IQQA 1KQSR 1V5IB 1GT8A 2YKQA 1K6YA 4LF8J 1H7XA 2UUBJ 2YKMA 1NG9A 3HVWA 1RT7A 3EN9A 2QTWA 5BXIA 1UEUA 3CPEA 4BC7A 3QICA 4ZCLA 2PFDA 3MCNA 3SCLE 4P74A 5J1NA 3W9HA 1N32K 3FQLA 2DNGA 1QZ5A 4OI4A 4JUZA 3VF6A 1S0VA 2PD1A 1Y64A 1TAUA 1OSDA 2Y8YA 4CJKA 4LF7K 4N8OA 4CF8A 3AD8C 1SC4B 4AM7A 5KT5A 2LQBA 4DV0F 3VEVA 4O0JA 2FHJA 2QTDA 5IOLA 4IQMA 2W9CB 3AVKA 1UMJA 5KT4A 2FXUA 4FLXA 3MPWA 1RDRA 4O3PA 1FWKA 2P9CA 3QWPA 1TL7A 3R3LA 5CR4A 1K73O 2OYQA 4C48A 1GOAA 3AO1A 5D78A 2KVQE 5I3QA 2EX3A 3RB4A 3FZHA 4JI2K 1WKJA 2F4VK 4DB3A 2HNZA 3SBTA 4ZPAA 2CG8A 3LP0B 3EJMA 3BF1A 3D0IE 2IA0A 2D9PA 1DRZA 4EIAA 3GYXB 3TAQA 3DFEA 2RIJA 2F9DA 3ZTQA 3D2FA 3M6UA 5ADXA 4DL6A 2UUAJ 2D3O1 4ES3A 3KNGA 2RRAA 3QGPA 1FJEB 4GV9A 4W5NA 4JKAA 3SLCA 4PWUA 2CG4A 2HF4A 3GV8B 2DO0A 2HGNA 3PO4A 2MXYA 4BWJA 3UD5A 3BH6B 3CFPA 1HRHA 5KG3A 2IDOA 2C3PA 1ZBSA 2HQGA 1Q9XA 4ECVA 4CW7B 2O8FB 3LDPA 3SXLA 1N56A 4MFBA 1DARA 4NASA 3N28A 5GMKa 3WEEA 4R0JA 3KD5E 3OL7A 2F5GA 3IG1B 4BRMA 1TU0B 1WTFA 2J9DE 1SL2A 1S79A 2BJEA 3ZYYX 4EZ6A 4HWIA 1DJ0A 2JC0A 1Z2LA 4RWTA 2JVOA 2NRZA 3CIZA 2MKSA 1FA0A 2QXFA 4JD2A 4CO4A 3ZX2A 4I6AA 1Q86T 5EDWA 2AZ3A 1D9FA 4FJHA 3D6TB 1DBDA 5C2DA 2XMMA 3P45B 5KG4A 3H7HB 1PGZA 1U26A 2FPHX 1JNZB 1DTTB 3QSIA 3HSCA 5HLFB 2H5EA 3UN3A 3QNNA 3PW0A 3MM8A 3I4HX 2VJUA 4H0TB 4RW8B 1WSRA 1FO1A 4KB0A 2BJ3A 3D67A 3FLCO 3I55S 4UTGA 3FKBA 4ILJA 4KB1A 4GMJB 5AT1B 3OYIA 1JJCB 3DGPA 3NCIA 2YJEA 1OSCA 3VEXA 1X8DA 1O13A 2W7OA 3QMQA 4XH4A 5CH7B 3DMJB 1H2UX 4ITSA 1RT1A 2LFVA 3J80O 4DWIA 2W8KA 5CHIA 3CPWM 3G2XA 5L1JA 2ADBA 1E4GT 4LY7A 3H40A 1RK8A 2MHEA 1HR0F 2LKZA 1UFWA 1T05B 1CS4B 3KKFA 1RBLA 2YX7A 3G6VA 2BYCA 2C42A 3R8EA 2RU3A 3S3NA 2O8CA 3IBCB 5LMNF 1XEZA 2HNZB 4CCHA 2CNOB 3TA0A 9ATCB 2OSQA 2MZQA 2YKNB 4NRUA 1Q7YT 2UXCJ 1OVYA 4K41A 4X66F 1FEHA 3CNQP 1GLEG 3ZT4A 1U1MA 3HTVA 2N82B 1QY7A 2M9KA 1T95A 2XWXA 1NJYA 2KTQA 1R0AA 5M1KA 3O9RA 3FQKA 2VG6A 2J7WA 4ZDNA 3DI6B 1WC3A 3HF5A 3WC2A 3CCRN 2IDEA 2BBEA 1KVBA 2FVPA 3EKSA 2Z1JA 1DTQA 1GLLO 3ZEUB 2CADA 3THXB 1RLCL 1D3WA 1KDNA 4QW9A 4JK8A 2E2QA 1H2VZ 5IT4A 3M8PA 4DTXA 2OD4A 2P9LA 2XLKA 2GO8A 1LWCA 1DKGD 1NM1A 3QT5A 4BWMA 1WD6A 1RTJB 4Z37A 4DR1F 3LDLA 3ZZ0A 1BQNB 3LOUA 1U0SA 3L3VA 3MURP 1ZPWX 2E2NA 1UVJA 2CQPA 3FK4A 4YR2A 4DV2F 4YB6A 3TZZA 3U02A 3SDEA 4F2SA 2J5AA 1D0EA 4K8XA 3EO3A 3THXA 3HX9A 3AVHA 3AFGA 4YUDA 2YNIA 4ER8A 1X5TA 3HPHA 1VJQA 4V19X 2NUHA 3LALA 2ASOA 1BE4A 5L38A 3QO9B 2DR5A 2CRLA 2BABA 2PYLA 3A3NB 2LU2A 4PUOA 1LW2B 4EBCA 4DQQA 1N36F 4FYVB 3P5JA 5J1PA 3AA8A 1H0HB 2JFKA 2FF6A 5SWMA 1IBMF 4DV5F 3R5JB 3VESA 4FJGA 3TOQA 5L46A 4F02A 4BRDA 4J9UE 2AJFE 3SCKE 1RYSA 4GVEA 3VF2A 4FWKA 3BR9A 2NYIA 2YWHA 2OI2A 2MKIA 2MPUA 3DGVA 5CYJA 1FDBA 4KV8A 3S41A 3A12A 1FX2A 4PG4A 2YKNA 4EWTA 4I0WA 1F9HA 3PNIA 4FJMA 2GHVC 2ITGA 2E1AA 2F7VA 4Y2CA 1DZ5A 4URSA 1RQ0A 5KI6A 2BE2A 2JX2A 2W9BB 2EG1A 2I2YA 3O2IA 4CTAB 3ADAC 3F41A 1DURA 1X9MA 4DR4K 5DQIA 3SK3A 1X3MA 2DITA 3UN5A 3CCMS 1YK9A 3A8IA 4AHUA 3NH2A 1T3VA 3QIOA 2G8KA 1K44A 4IYQA 2W9AA 4NE9C 4F9OA 1RWKB 5ITHA 3KLIB 2R7YA 3SSRA 3I9ZA 4WYWA 2OMOA 3D6RA 4DI6A 4F2RA 4KAIA 1YZ7A 3QZ8A 2E5LJ 2DY1A 3AOCA 2B9WA 3KLHA 4DPTA 2FJBB 3OVAA 4IO8A 3JTOA 1BQXA 2C28A 5J2PA 4CZGA 5HMYA 1HD0A 1EQMA 3CCMN 4BCAA 2WONA 4ETXA 2VFSA 3W63A 2GWKA 2XO6A 1X31C 1VSMA 3R6GB 1RTJA 1TKTA 2V8DA 4QS8A 2GIRA 1EHWA 1LNQA 2K3KA 4NXNJ 3P83D 4LSNA 3TJAA 4DV0J 2DHXA 1FRIA 2O8FA 2AP6A 2HK2A 4DUZK 3D45A 3EDQB 3PCOB 4QIVA 3RAXA 2IS3A 3K0SA 3OA9A 1VBKA 2VJVA 3LPTA 4EYIB 4Q2MA 3BPSP 4RNNA 3GR0A 2DR6A 2PN6A 3VGKA 1TKTB 3CC7N 1NJXA 1EWRA 1KAYA 3OBIA 1KP6A 3NY0A 1H38A 4FJ9A 3QT6A 3VEYA 4M45A 3UE5A 1HNZF 4FLUA 4CFAA 4M63C 4LSNB 1HYSB 4YDUA 2VPWB 2HMIA 3C66A 3SQGA 2XMVA 2E29A 1NKCA 2P9KA 2LXFA 5HP1B 3H5SA 4DV7J 4DFMA 2Q36A 1RBUA 5TKWA 3TR5A 4JK9A 5F8HA 2CVEA 5IWAK 1VI7A 3G8SA 4B1YB 3OBWA 4GC7A 4QQBA 1YXQA 4FVMA 4BDZA 4K42A 5E26A 3PX0A 3VZIA 4ILRA 3OYJA 1OIAA 3UWTA 3ZT1A 1Z05A 2VYPA 3O1WA 1Y5IB 3OHRA 3GU0A 2QWPA 3W7BA 3R1XA 4I68A 4EK2A 2HZVA 2BQUA 3FSYA 4JOUA 1KCFA 4JYAJ 3SBGA 4UY8T 1KBRA 3CCQN 2FY1A 3ICLA 4DSJA 1ZAVA 1FWPA 2ALYB 4F3QA 3C0BA 4DN0A 3HOSA 3U1MA 2HBLA 3TUJC 2AGQA 1V9OA 1C1AA 2F8SA 3UKRB 2ATLA 5AR0A 2MZRA 4LVOP 2CDQA 4C9DA 5KOXA 4ENOA 3BGRB 4KH0B 4CHZA 4MH8A 4GMKA 1UJ4A 1UAWA 4FW1A 4IO9Q 1NJIT 3CCRS 3OR1A 1BY9A 4WK1A 3L2WA 4OIXA 4LR8A 4ISFA 4HYKA 4X66K 3C65A 1JXLA 4E7IA 3J80Y 4IDKB 5EXWA 4GV6A 1FNOA 4JI2F 2WW8A 2P9PB 3AO4A 1S10A 3VV2B 4M3TA 4J2EA 2BM1A 3DM2A 1M1KO 4USUA 3EPGA 5F0UA 3PKYA 2DNHA 5AE1A 3VGLA 1VLOA 3DXSX 5EU7A 1FJGF 2GGPA 3BYPA 3PW5A 3MR6A 3THYA 1ZBHA 2V5HG 2ZH8A 3EXCX 4LIWA 1RTHB 4WFBQ 4CH7A 2IIRA 4CFCA 4JI2J 1TMMA 3VN5A 4CJQA 3UN2A 2RQMA 1KQFB 2OJ3A 4DR4J 3KMQA 3HVTB 3D5MA 4LF6K 3HFZB 4KFBA 4LF7J 5JMNA 4FWMA 1N33J 2UVRA 3NOCA 1WC6A 2OANA 1LWCB 4H4MA 3M2VA 1U49A 2HHWA 3MPYA 2CPJA 3P4UB 2KO1A 2UUWA 3W8GA 3PSFA 1FEEA 2V4JB 5J2QA 3VQEA 3M7VA 2Q1NA 4P10A 1LKZA 2AQ4A 3DOLA 3K58A 3SV3A 2NRXA 2D3OR 3HZ6A 2JWNA 1IV0A 4B3TJ 1RBRA 1DT9A 2WSCC 2AEFA 1AXQA 4FXDA 3OTCA 1N36K 1HJOA 4OKKA 1HW8A 3LPYA 4K0KJ 5K5MA 1EAYC 1DLOB 2VCPA 4I69A 2HBJA 5GMEA 1J2VA 2Z58B 1HQUB 3EGNA 3KLEB 1N88A 3K8VA 3TWZA 3SNNA 2VF3A 4Z7CA 3V81A 5LJVA 2J8SA 1VHIA 2HIQA 2W2MP 4YOEA 3I5CA 3NGTA 3SCJE 1M0SA 2ZWHA 4GVBA 1S1WA 4DCHA 2Y9HA 2ZWOA 3L7UA 4CK2A 4RX6A 3IO1A 3OD2A 1VQKS 2BH1A 3CC4N 3EE8A 1WSHA 4QPXA 1T6DA 3CE8A 1NGGA 5J1EB 5GAGI 3POTB 2W24A 2AT1B 3F0NA 5RUBA 2YKPA 2B6AA 5A8WA 2B7CB 1T9YA 2MJUA 4K5RA 5GVQA 3HBTA 2Z30B 3V5RA 4K59A 5M1OA 4DR4F 3IMQJ 1UZHA 2KYZA 3HM8A 4KC5A 3DOLB 4DQRA 3C16B 1EX4A 2DH7A 3KJQB 3KK3A 3NF7A 2FSKA 1S49A 5FRNA 5LMNK 3T9ZA 4H5NA 3VENA 4L6V3 4M3UA 3VAMA 2HAFA 2B9XA 3PRBA 5L9XA 3NCQA 2QC3A 4UZBA 4B3RJ 3AVBA 4HUEA 1WC1A 4LJMA 2JSXA 2QT7A 4M5JA 4A5AA 3TQEA 1GXTA 1T9UA 3VTIA 2G0IA 3V81B 1RWNB 5M1PA 5KFBA 5EX3A 3TAGA 4DLEA 3AAQA 1HNWF 2EFVA 4YY3J 2YNFB 1HMVA 3L2VA 4B3RK 2E5HA 3GWCA 3VQTA 3CIPA 2XHCA 3HHLC 3TEGA 1TKZA 3IRWP 1UL3A 3PR4A 1S76D 1SB6A 2RHQB 1ZZNA 4ZVHA 3PYDA 2W01A 1FK9A 3ILIA 1HR0J 4DQSA 3QAEA 3MI7X 1UEKA 3RAMA 4F4XA 2OFHX 4HTJA 3MWTA 1EQ0A 1ZBUA 4CT8A 2R7VA 2G8WA 5LY3A 4KRWA 3AA2A 1WEZA 4CGDA 1YRUA 1VBZA 1PC4A 2OEKA 5KFRA 2DIUA 5B0CA 3LDOA 4M8LA 4B1WB 4CF9A 1TUUA 4TSXA 4DSEA 4N47A 4LF9K 3N6LA 2ZDOA 2IGIA 3EY1A 3ZZZA 4IG0A 3PEJA 4C3KA 5HI7A 3LP1B 1RT6B 1VQOS 2DVIA 4OZ2A 3CMEN 1NNDA 3JS9A 2DNKA 4PEOA 4KH4A 4H0PA 2O1PA 1ZTTA 3VETA 2EG2A 2W6LA 3RAQA 4UOFA 5CZ1A 1A0OB 4LRAA 3MEEA 3WNGA 1C6VA 1VSEA 2Z1HA 3H1VX 4M7XA 2DNZA 3O8WA 2UUCJ 1S0MA 2DNMA 1MSWD 2DGTA 1Q95G 4BQLA 1N48A 3ISND 2Z8QA 4LT6A 2EFOA 2V0NA 5FLXU 2HHQA 2XYGB 4LSLA 2UUBF 2F8EX 3AJ1A 4IG0B 3KJFB 3PHTA 3VVTA 5M1NA 2K3IA 3VAFA 4C1NI 1VDHA 4EU0A 1S9GB 4B3MJ 4CLWA 3UCUP 4DCPB 3BSOA 2ZHBA 1WDDA 2N4DA 3HHLB 1BHNA 3D1QA 2BW2A 2UVVA 2VBXA 3LZIA 5B08A 5KFXA 3VALA 3MAHA 4CJSA 3J81O 3QERA 4FJJA 3EE3A 1T7PA 1C4AA 2VBYA 4M7YA 5KT3A 4A5BA 3HD1A 4LSZB 2EFNA 4A57A 4JN4A 4L3KA 4MIBA 4G3IA 1IBLK 3F44A 5KFDA 4BRQA 1SH0A 3NNAA 1NB7A 5HRSA 3Q2TC 3TR8A 5E84A 3CT9A 2XGQA 3ATUA 1T3NA 4FYWB 3DM2B 2H48B 1SIZA 2ZZMA 3MDQA 3WZ0A 4UOCA 4ZK7M 3R2DJ 1T9WA 4RZRA 3MXHP 2OCEA 4JI6J 2M3DA 4O3NA 2DFEA 1QDUB 1P9YA 2L3MA 2N4CA 4O44A 3FSXA 1VQ5S 3E66A 5AE3A 5KFAA 2C3MA 3Q89A 2MKJA 3BQ2A 1W0HA 3CD6S 3EZUA 4ZVGA 2XY6A 2E2PA 3AXKA 3MX2A 1XNQJ 2CFXA 3LH2S 1ITPA 3M32B 5HJXA 1JLEA 4Z7YA 4G1IA 3M4XA 3ET6A 3SIPB 2IYGA 3TRGA 5KFIA 1JLAA 1BWEA 1X4HA 1XHXA 2AJ4A 4XDCA 4JI5K 4E2FB 5CCMA 4X65F 1HYVA 4C8MA 3CCUN 1OPIA 2JEJA 4MAKA 1HX1A 4OX7A 1S1TA 1FW6A 5IZHA 1RTZA 1A9NB 2I8EA 3KHYA 4BC3A 1VFJA 1JMTA 4J7CA 2PBDA 4GY2B 1WBDA 1NLVA 2Q31A 2WAQD 2IM0A 2XC9A 4B3MF 3TTDA 4FJXA 4UUXA 4OGCA 2BTFA 1BG3A 3B6PA 3SAFA 3QT7A 3NL0A 5HVGA 1F5AA 4H8KA 3W2WA 1E6VB 4TY9A 3MPVA 3H90A 1KVKA 2HIYA 1KVAA 3CCLS 5FPEA 3Q8YA 2ABYA 3KJVA 4WQ4A 2Q0RA 4BE0A 5T7LA 4NA3A 2QLFB 4NLPA 1AW0A 1L5UA 1L3UA 1QQMA 1WSEA 2LA6A 2XI3A 1Y0HA 3NAEA 1VQ5N 4FLYA 2EHGA 5HRPA 3LUYA 4OHXA 4WFAQ 3S3MA 1HNXF 2Z57B 2CQCA 2ZJRQ 1RT3B 5DM7L 2OPRA 5DDQC 1IKVB 3IR5B 3X3UA 4HI2A 4PUOB 4XIUA 5C2CA 1FRJA 5ETSA 4F3TA 4ZCMA 3MTKA 4C6AA 1Q86O 2KVIA 3TJ9A 4TLRA 4ZJQA 4BRKA 2DRDA 3TSUA 4MO4A 1K0TA 1RSCA 3MM6A 3JYTA 1HWUA 3ZSOA 4RW7B 3RJMB 2QWRA 1LK7A 4C8YA 3KWGA 2VFVA 2HNDA 1VRQC 4XPCA 4ZTJA 1NK4A 4DQ8A 2NZTA 3T5HA 3SV4A 4UOGA 4B3TF 1BHLA 3EM1A 5D3GB 3CMAN 1RA6A 1IQTA 4FL9A 4I9QA 3IR7B 3CQYA 1RT3A 4NCBA 1BOTO 4IRKA 2NUUG 2D3UA 1FHTA 3ZT0A 5E7OB 4DR7K 2OIHA 1Q53A 4AHTA 1G3OA 1VQ6N 5LSRA 1OS5A 1S12A 2HWIA 5AQYA 3TZYA 3CJ5A 3NGYA 1WHYA 2KG0A 2PYJA 1UOCA 1Q81O 1AYEA 3GV7B 3L3UA 2E2OA 3GFHA 3ISZA 3GONA 4MDAA 1TELA 4KSEB 2AA4A 2HHHF 1HBOB 4TYAA 1HR0K 3A0IX 3HMJG 4QIWD 2QMWA 1UJ6A 3R9PA 1XMQK 2H3GX 1RCXB 3R5CA 3MM6B 2E8AA 3SUPA 4HI1A 4CF1A 3RWUA 3N6MA 2W2QP 3IUCA 2PFUA 4JB8B 3IR6B 2EEYA 1S57A 3K9KA 2QZ8A 4O55A 3TTFA 2BR0A 4E89A 1KNZA 1EO1A 4FKXA 4RUBA 3V9SA 1CJVA 5KG7A 4IZ9A 5HQLA 1C0TB 1G7CB 2VGNA 3R7BB 4OI1A 3MX5A 3E8OA 3FFKB 1BI4B 1S6QA 4ZTFA 2D0PA 1KOOA 3MM7B 3VA0A 2HRTA 3ID6A 3ZTRA 1X4BA 5B7WA 2V52B 4XO0A 2BJ9A 4CO0A 5IC6B 2B3TB 2EPIA 4A8SA 4N41A 1R31A 2UXBJ 1I94K 2W1BA 4FWSA 3LTOA 2V50A 2IRXA 2YX4A 5LSOA 3HHEA 2CGLA 2RHKA 4Y2KA 2EI5A 2LVWA 4JNEA 2IM2A 7FDRA 1F9FA 4Y1CA 2CQBA 3GB0A 4DR5F 1R8PA 2DR7A 2FZGB 2DEJA 2W7PA 1VQYA 8RUCA 4DU8A 1WI8A 3PVXA 1U4BA 4U7UD 4ID5B 3D7EO 3US5A 4RW7A 5E3RA 1YKWA 4X4SA 3ZX3A 4S0MA 4BVPA 2LEBA 4FJIA 4Y28C 3U9ZA 4AQYF 2UVUA 1AUSL 1LQ9A 3O1BA 4LRDA 1PYTA 2C2DA 4X84A 4Q7AA 1X5OA 4W5TA 2VB6A 2VQFK 3T69A 1K9MT 4BRAA 1IKXB 5EWEA 4K4UA 3BUZB 1RFQA 3PEHA 3CD7A 3GIIA 3MXMA 3J7AN 3RVCA 4ED0A 1X4FA 2FJDB 3LDQA 2YHXA 4GKKJ 3BDEA 3TJ8A 1U1PA 3OXGA 1B9DA 1REVB 2OTLN 1Y00A 3U8XA 1OJ4A 3AVFA 5BN9A 1RAFB 1DY3A 2M70A 3O8MA 2YI1A 4ECSA 2FVRA 3VF0B 1RXOB 4F0KA 4WFNQ 4RU9A 3GIRA 2I5JA 1F0XA 1HHQA 2ZNYA 5IT9U 4USMA 2UXCK 4UQGA 4CIEA 1N5QA 3AA9A 1I94J 2UXBK 1CJKA 3G8QA 1U25A 3TAMA 5C7PA 2OPPB 3I8BA 2E1CA 4OKJA 1AT1B 4LUBA 4ZVEA 4C8OA 4RW4A 5D77A 2ASDA 3C6TA 1VBYA 2K1RA 3TAPA 3WIUA 1TV6A 3E9PA 1TL1A 3C15B 1IJJA 2P9KB 2ZH7A 1WELA 1HNVA 3TSQA 2UU9K 4L73A 1MU2A 3RW7A 5H9FK 1FI4A 2J76E 3IGVA 3TZXA 2I5JB 4CJPA 5H1SV 3CC2N 3VEZA 3LDSA 5AJ3F 4FPIA 4LF9F 1DEJA 1C2PA 4FF2A 2CVIA 3MM9A 4A4JA 3H3NO 4WP8A 1IKYB 5J2QB 3AQOA 4USTA 4WXOA 4AE5A 1CXQA 1QQCA 3OYDA 1JL1A 5U47A 3NCPA 3RB0A 5CD4H 4ILLA 1TFWA 4C8KA 4MIWA 3TVYA 1MROB 3QAUA 2APOA 2R8GA 3AVMA 1YT3A 2VWKA 2PC6A 3M32A 3L2UA 4PPZA 1TFYA 1REVA 2VH7A 1LFWA 1V3SA 4IEEA 2XTJP 3C6HA 4WFBL 4TY8B 3GIJA 1U02A 3TW0A 2C2OB 3CDEA 5K8NA 4UZCA 5BPLA 1UVIA 1QVGR 1S6PB 3C15A 3OBYA 5AQWA 4KHMA 2NXNA 3D2EA 3KHRA 3Q86A 4WU2A 3Q8PB 4QCLA 3KUGA 5AQPA 1P27B 2E5JA 1RKJA 3VGSA 5M2RA 1NJIO 2D7SA 2D4WA 2BW7A 4ELVA 2MTLA 1G99A 3L2QA 3GJRB 2XS5A 3P1GA 2F3JA 2O8DB 3CCSN 1B0VA 4O0NA 3WT0A 1VBXA 5D4LA 2QI2A 3A5LC 3G10A 3H25A 3FE1A 2J7UA 1NH7A 4OYWA 3P5TL 2E9RX 3P39A 4UT4A 3TP2A 4B3TK 2F9TA 3L8BA 2F1FA 4BLGA 5AFUA 3C6TB 4JI0K 1WORA 4QPTA 3M8SA 4CYUB 5AXLA 4B1UB 1ZA2B 1KR4A 3F2KA 3H1QA 2AHOB 1EJ7L 2QX0A 4U67L 4LH5A 1X7VA 4A48A 3UVJB 4IO9L 4KYZA 1BLUA 3R1HA 4DMZA 4DR3K 2U1AA 5D0RA 1ZBIA 4YDUC 3M8QB 1VHXA 3TZWA 4CJ7A 2E5LK 4E8UA 3BYRA 3RBDA 1JLBA 4BS2A 2KN4A 5AZJB 4MKBA 1CLFA 4KTQA 1ESVA 3HI0A 3J7YU 1D09B 2CH6A 2AJ1A 3BGUA 1G4CA 5GAGU 1BWFO 3MPDA 5FPDA 3SUNA 1KOHA 4A61A 1P8GA 4Y3CA 3CQXA 3WQUA 3ALYA 4F50A 2PA3A 4JRQA 2RILA 1ILYA 4PG8A 3D3BJ 4FCYA 2EK6A 1QTNB 1A5XA 3W64A 4Y1DA 3R6MA 2PY5A 3D0GE 4DV2J 1QUVA 4ED7A 2MY8A 1WKLA 4DV4K 5KFWA 2E66A 4NEZA 5JJBA 2G0CA 4ED5A 4E19A 1RWOB 3ATVA 4CD3A 4NLCA 1K9MO 3SMZA 5BYSA 1CZAN 1H6KX 4YNQA 4KBIA 3EZWA 4C11A 3ENVA 2WC9A 2MB0B 2M8HA 3U1LA 5HROB 2VPYB 2Q3PA 2W2PP 3RRGA 2NPIA 1C0TA 4OLBA 4B8AB 4CJFA 3BZCA 1GX6A 3MMCB 3FEZA 1MWKA 4CJ3A 2DXFA 4BDYA 1CC8A 3W2VB 1ACMB 4QJVA 2QWMA 1DHMA 1WN7A 3E1YA 5A8KA 1YIJN 2FHMA 4Q45A 3CXCM 2H5JB 5K14A 1YJNN 3N4QA 4FZYA 5KT7A 3QJLA 1DQ8A 1UKUA 3M8YA 2EK1A 5A76A 2MKHA 3SQ1A 5FDLB 3CM5A 3MAAB 3H59A 2DY9A 3MUMP 4ZN1A 2DCLA 4PQAA 3ENHA 3RMBA 2UV8A 2HRUA 3S8SA 2IYIA 2YJFA 3ZSVA 4BGBA 3VF4A 5A6PA 2OTLS 1NK0A 1H3DA 2VQFF 3HP9A 4DSFA 1QVFM 2P9IA 2HS3A 1CJTB 2IDLA 4XTTA 3PDNA 4DZ6A 1RADB 2QA2A 2QMXA 4OLOA 3B4MA 4NLQA 4CLFA 4ED3A 3OTOK 5I4MA 4ILMA 3ZZTA 4DTNA 1HBOA 2O8BB 3CEDA 3UNYA 1JJ2M 2VA2A 3BKUA 2QL9B 3QEWA 3W2VA 2ACYA 3WQTA 2WOMB 4LF2A 1OMSA 3W62A 2KT2A 3V2UC 3A5OC 2W2NP 4F4KA 3ZC4A 2GIQA 1NSAA 4P73A 4HDGA 5FJ4A 1WSGA 1S1UB 2AYMA 4RUAA 1SV5B 3CM6A 2GHWA 3RU0A 2A18A 4ISEA 2F8HA 1DGKN 1C0MA 3E9LA 3W0LA 1X4CA 3DAWA 3OHAA 3KD1E 3UIQA 4Q43A 1TUYA 3SQGB 4IOCL 1VQPS 2JNJA 2CDRB 3T6JA 2Z1GA 4QWCA 4FM2A 1BIUA 3KK2A 4DV1K 2E4LA 1QAYA 1X60A 4FWNA 1UWBA 1EIYB 3OPKA 3OTBA 4CFBA 3TX8A 3MGJA 1LOUA 1SQKA 4Z2XA 3OS0A 2ZUAA 3M9MB 2WK4A 1YUWA 3MFHA 3KUEA 5JMVA 1URRA 5KG6A 2I7PA 2JOQA 2P9EA 1U1NA 1MA9B 4CEAA 3VQ5A 2EBEA 1HARA 1GEHA 3D1OA 4OV1A 4I2QA 5HMWA 3T5LA 1L3VA 4A46A 1QTMA 5AXMA 1J53A 1RAGB 1YJWS 3G82B 4IFVB 1PYSB 4WZQA 2CQGA 3DJCA 1DFDA 4P2MA 3SCIE 5IWAJ 3BKFA 4J9RA 4CF2A 2JRSA 2GV9A 2HFZA 3PACA 1PBUA 4J9VA 1KSPA 1JIHA 5IFMA 2Z0GA 1I94F 2VG5A 3NG8A 3TU5A 3JAMO 1O0PA 3E01B 1S9EB 2HEKA 1WUAA 2HHPA 4ZP8A 4USKA 3VWSA 1M5SA 4JI1K 3CCQS 5HATA 4OYIA 3AV9A 3HSZA 4JKEA 4O23A 1LCUA 1FJGJ 4NCGA 4DV1J 2GO9A 4FS1A 1Y7PA 1J9AA 2XO7A 3T6BA 3GQCA 4J9NA 4JYAK 4MKYA 5CA5A 1VQPN 3BSNA 2QWOA 3QWUA 1PJ5A 1H72C 4JK7A 4HHTA 3SFGA 1LOTB 3A8YA 3MN7A 5AZIB 1VS3A 2RS2A 4K4YA 1DTTA 1NK8A 1AFIA 4JV5K 2B9YA 1QAJA 1T8EA 4NLOA 2ZD1B 4PL7A 2DRBA 2AJ2A 3QMLA 4ZMMA 3CJKA 2QWLA 4LF1A 5BR9A 4F4ZA 3ULDA 5LXYA 2HBYB 4L76A 4CEOA 1AROP 2FVCA 4P7VA 1JLFB 2ILZA 4X62J 5BRDA 4I6MB 4CGIA 5BRHA 1XNRJ 4PA1A 3J81j 4KKOA 3PIPL 3HOTA 2HW3A 5LM7E 2HB5A 2AMCB 3IDHA 2JWLA 3BQ0A 4A2BA 1TR0A 1RABB 3V1QA 4ZLPA 5ADXH 4YB5A 2CH5A 3GR1A 2KHCA 3PIOL 1WOPA 2FGCA 4NLTA 2IJNA 4KIAA 1RP5A 4KQZA 2DPJA 5HMXA 3CCWA 3HSDA 5F9LA 4AF1A 1YDLA 3MMJA 4QYZK 1A5WA 4M3ZA 4LH4A 3MCSA 1N36J 7FD1A 2X6SA 4BR4A 5IT9Y 3K5NA 1K8KB 3KVGA 1FNXH 4JKHA 3CCVN 5KPRA 4CEDA 1LW0B 2UUAK 2HZAA 4Q0BA 2UXDF 4F4YA 4FJLA 2XSFA 2KB2A 1FXRA 3IRXA 1N5SA 1MMNA 5E3QA 1TGOA 4B3OA 1TK0A 3THYB 4BR0A 2BA9A 2EBGA 2A6MA 1VC6A 2V67A 4HTLA 5BR8J 4PZVA 4NXMJ 2P9UA 2Z2ZA 2QSWA 1GAOA 4DPXA 3Q8QB 3NWGA 3TVKA 1NGIA 5DQHA 2MGZB 3F56A 3MFIA 1NGFA 2GNKA 5FLXO 4FDFA 4X64K 5KFNA 2EW9A 3E9OA 3J7YP 1VJWA 3EGVA 1MWMA 1XNRK 2FF3B 2P5VA 1V4SA 5DDPC 3TYTA 1RZMA 2M4MA 3V9UA 2ATCB 3OLBA 2MZSA 5KFCA 2EFQA 1VSDA 4DX8H 3TUPA 2GA7A 2Z2MA 5KFEA 1U6ZA 1KFDA 1KC8T 1EQYA 3D28A 2D0BA 4QAGA 2YV0X 1BUPA 3PSIA 2WSEC 5L8RC 2GMHA 1XMBA 1XUPO 3OW2M 4FXVA 1Q9YA 3T41A 5AQIA 3AARA 4IWVA 2NXCA 1IG8A 3M6WA 4DV5J 4O5FA 2MZ1A 2BACA 1ZYQA 4WKRA 3GOIA 3CGIA 2BE2B 5LMUF 4ELTA 1VRTB 3NH0A 3C46A 1ATSA 4HHHA 3RYLA 3LP2A 5C42B 4BRCA 4J90A 3NNCA 4H4KA 4DQPA 3I56S 3BV8A 2Q66A 5B0BA 1UAXA 4GVLA 1E4FT 3KG4A 2LEPA 5EUHA 2JLGA 2HBKA 4DV6K 4CE9A 2P6TA 4Q8EA 1HBNB 2XEXA 2KM8B 1PAUB 2Y1RI 2V2ZA 3QEVA 1RWWB 4NO7A 1X0PA 3HHKA 2FQQB 1M1KT 1JX4A 1XC9A 4FYDA 4QZVB 4IR9A 4BRFA 1W2BR 3PTWA 2FLOA 1CLQA 3V9WA 5J2NB 4NRTA 5JLHA 4WPAA 1YJ9S 1SKUB 4ANDA 3QRPA 5C42A 3BJYA 4DR3F 4HCBA 4IDHA 4DR2J 3ZCMA 4DDFA 3AVGA 2JZ5A 4ECUA 2QK9A 5A8RB 3R2CJ 2KYXA 1WC5A 1FKPB 1S4EA 4KT0C 5EWGA 5KGXA 3DN9A 2FC9A 3CJ1A 1Y97A 3IAYA 3L2RA 4KI4A 3HJVA 4QWDA 4LRCA 2G4BA 4MKAA 1T0TV 4M95A 2VONA 3IAM9 4CH1A 3LWLA 1QHAA 4H4MB 1F9EB 1VIOA 4ICLA 3M2VB 3G6XA 3FBBA 4CLPA 2VC1A 1WG4A 4J8FA 3PV8A 1FJ7A 2AIRB 1IBMJ 4X62F 3G6YA 4A8KA 2HHHJ 1NGDA 3JQKA 4ZA1A 3MR2A 1NBWA 1IVZA 5CYQB 4C8ZA 5KOWA 1XQIA 2O3DA 2XYPB 5AZJA 1R7IA 5F9NA 1RCOB 3DU6A 4GKJK 2XB2D 1VRUB 3D9BA 5AQJA 2MJNA 1VQLS 3RRKA 4JI4F 2IHR1 4FVCA 4O8KA 4I2QB 2R7WA 3NS7B 1EX8A 1N5VA 4E98A 2ETJA 4XDDA 1BO5O 1KQGB 3L7OA 2N3LA 2BJ7A 3GJSB 3J7ZT 2G2OA 3UB5A 5F8NA 3ILJA 4FXWA 3LP3A 2OEMA 1S1VA 2ZE2B 4QWEA 3PRVA 1NHVA 2U2FA 2YBVA 2CQDA 2HAIA 5F41A 4EAHD 1XR7A 2A40A 3ASMA 1RUSA 3ZSQA 3JXOA 5KFYA 2ZH5A 2IVPA 1WSVA 4X4VA 2VKZG 3NGKA 5HBMB 4C98A 4DJBA 1XMQF 1FDAA 3OJSA 1BISA 1KD1T 4DV6J 2G8IA 1IKYA 4LD0A 2NR0A 4O4GA 3DLEA 1PCAA 4I56A 4KPYA 2DGUA 3MMAA 2V9WA 1FERA 4LRFA 3K7RA 5C5JA 3DGPB 2DNOA 5IC4B 1KLMB 4LF5K 1IUJA 3DXKA 4B9VA 4ICLB 2QA4S 1X9JA 4RNOA 1CPZA 3EGWB 3CJAA 4DF8A 1CEZA 4YN3B 1YTYA 1FT8A 4IFEA 4RNFA 3HFVA 3JSYA 4LREA 4PKDB 3WX4A