3KJVA

Hiv-1 reverse transcriptase in complex with dna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
556
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 128
structure length 549
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kjvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kjvA05
4CE9A 3G86A 1B9DA 4TY9A 3IN5A 1RAJA 2PZSA 1GOCA 4LQ9A 4RNMA 4ZVHA 5F8MA 3HT3A 5EDWA 2BQUA 3KJVB 4K4TA 4KTQA 3KLFA 4CJ4A 5I3UB 5F8HA 4FK2A 4I7FA 1RT6A 4RUAA 4GVMA 3H08A 4HTUA 2IMWP 2EHGA 2G8HA 2ATLA 1S4FA 1TP7A 3CDUA 3AO1A 3SQ1A 2OPQB 4OKJA 1VSEA 3L2QA 4YP3A 3MTKA 1TQLA 4XPCA 4WZMA 1TK5A 5J2PB 3UPFA 5KG4A 5KFBA 3TAMB 3M9OB 4KAIA 4CEQA 4CJVA 4FK4A 1TAUA 4C8OA 1FK9A 2OPSB 2C22A 4FXDA 2VA3A 1SL2A 2F8SA 3S3OA 3DOKB 3IG1A 4FJ5A 1WSEA 4Z4EA 4KV8A 4IFYA 4NYNA 2ZD1B 2HW3A 1REVA 3G6YA 4F4WA 3G6XA 4CF9A 3PV8A 4CEFA 5KFHA 2F96A 2B6AB 4IRDA 1NNDA 1CXQA 4ZPAA 3H40A 3ZCMA 3K5LA 4G3IA 4FJ8A 1NHVA 2AU0A 5DGAA 1R0AB 4ED2A 1LWFB 4O0JA 1NK7A 1YTAA 3QNNA 3LAMA 4DF8A 4DQRA 4WFXA 1YVFA 1U04A 4DFKA 4FJMA 4MIBA 2O4GA 3DI6A 5KFZA 1HQEB 4NLXA 1LWCB 3OYMA 1RTHA 4J9PA 3RR8A 4DL3A 4F50A 4KRFA 1RT1B 4F4ZA 2HHQA 1HNVB 3H4DA 4M3XA 1TKZA 1RA7A 2E4LA 2YV0X 3NBPB 4YNQA 1EP4B 4G1QA 3QEWA 3BR9A 4FLUA 3KD5E 3CVKA 1DTQA 1KLMB 3KD1E 3DLEB 2W7OA 4ECWA 3OYLA 3H5SA 1J5OA 4EZ6A 4RW4B 1JKHA 1SH2A 4Z4HA 4ELVA 3HVTA 3G6VA 1UAXA 4Z4IA 3OYCA 3NGDA 3IRXB 1UWBA 4F3OA 2IJFA 4O55A 3CQ8A 1YTUA 2WOMA 1QS4A 4HVJA 5C5JA 3L8BA 2V4RA 4JV2A 5KFGA 4ICLB 2GIQA 4KE5A 3NF9A 3P83D 5DG9A 3PW2A 1KLNA 2IOCA 4Q8FA 2WONB 3HPGA 1CZBA 3KHRA 5JS2A 4F3TA 5D3GA 3HKWA 1BI4B 1KVAA 4MFBA 3JYTA 1TK0A 2HHUA 4O44B 3KLGB 1DLOB 4B3OA 2GC8A 2W9CB 2ZE2B 4PQUB 1RYSA 4DSKA 1N5YA 1JLQA 1QAJA 3LWLA 4KHSA 1N6QA 1JLFA 4PWDA 3LP1A 4BE2A 4O5BA 1RT3A 2BRLA 3M8PB 1RBUA 1KTQA 5KFIA 3K2PA 2J6SA 3PJWA 4KB1A 1FKPA 1WN7A 1RTIB 5KGXA 3KHGA 2X74A 4ECTA 1ASUA 5J2MB 1C0TB 4TY8B 1ZBIA 1X9SA 4Q5VA 2OPRB 4J9RA 3VQCA 2FJXA 1T03A 4KI6A 3AV9A 1S49A 2YKNB 4B9NA 2FVQA 5KT3A 2JEGA 2XCPA 5KG7A 4H4MA 4ECYA 2YHBA 3NH0A 3DRRA 4QW8A 4RNNA 2VG5B 1JLCB 2DPJA 4BE0A 1U47A 3IAYA 2JEJA 4RW8B 1VSHA 4JLHA 5I42B 4B9UA 5L1IA 4Q0BA 2IC3A 2IDOA 3VQ4A 1X1PA 3NF7A 3AA5X 1KRPA 3H5UA 4NLTA 2GIRA 4FK0A 4IQXA 4M3ZA 2FJWA 1RT4B 1TVRA 3U3YA 4ZPDA 2Q3SA 5HROB 3OS2A 2AX1A 4HUGA 4KKOA 3DLRA 3AVKA 2P51A 4CJWA 2QKKA 5DG8A 2WHOA 2PY5A 1BQNA 4FJLA 4C8NA 4AH9A 4U6PA 1JLAA 4KHYA 1SH0A 4Y2CA 4F4XA 5HRRA 3M8QB 3AVGA 1WAFA 1NK5A 1S0MA 4FLVA 1S6QA 3LP3A 3AVNA 2DFEA 2YNIA 4RZRA 4J9MA 1JIHA 3VA0A 3QESA 1IKVA 4I2PB 2G8FA 5F8IA 1QHTA 4ID5A 2WCXA 2A1RA 3JSMA 1EX4A 1TL3B 1C0MA 3QINA 2CKWA 4IG0B 4O3OA 5CYQB 1G15A 4DS4A 4O0IA 4DLGA 3NAHA 3CDWA 3TAPA 2IM1A 1ZBFA 2IAJB 3FQKA 3LZJA 4M3UA 4DG1B 1VRTB 2XY8A 1DTTA 4YR3A 3CJ4A 2AWZA 2VG6B 2FBTA 3QLHA 3DM2A 5DGBA 5KFXA 2JC1A 4W5NA 4HYKA 3QIDA 3OSNA 2BANA 3MF5A 3RWUA 2JEFA 1JL2A 4KO0B 4B08A 4CJSA 4EEYA 5F8JA 2D0AA 3ZSQA 4K8ZA 4C8LA 5KFRA 4FBUA 3OYHA 3MEGA 3BQ1A 4DSEA 4FLWA 1C6VA 2W42A 3I5CA 4OLBA 3SQ0A 3SQ2A 2JLEA 5HP1A 5JUMA 4OPJA 5KG5A 1TV6A 1RT6B 4ECQA 2R8JA 1L5UA 1CZ9A 4H8KA 4EO8A 4KTWA 4RW9B 3QNOA 4CEEA 2YNHA 4CJFA 4CFCA 2BE2A 4F2RA 2HNDB 1BGXT 3TWHA 5T7BA 4M3WA 1LW0B 4KHMA 3RB0A 1KVBA 3H5XA 1S9FA 3NFAA 1WSIA 2Y1JA 4NLGA 2BR0A 3GIJA 3IG1B 3PY8A 3TR8A 5CZ1A 4KV8B 4GC6A 2C2EA 2JEIA 1REVB 3HVRA 2W8LA 3N6LA 4Y1DA 3WNGA 3LAKA 4E0DA 4FZYA 4FBTA 4NLPA 4FJNA 3OLAA 4XO0A 2XO7A 3CJ0A 3DYAA 1LAWA 2I1RA 1WAJA 3UDLA 5CZ2A 3MR3A 1L3UA 5KFPA 4KSEB 3TVKA 2W7PA 1U09A 1NKBA 4E7HA 1JLBA 4YMEA 2J6TA 3QEXA 4NCAA 3RBDA 3DI6B 1JLEA 3QERA 4LD0A 1RTHB 1JL1A 4DWIA 1HYVA 2B43A 3CWJA 2HVIA 3C6TB 3OYNA 1OS5A 5C24B 3MR6A 4BACA 3PJXA 5DLGA 2X6NA 1IKYB 1SKSA 3K58A 5KFKA 3GQCA 3D45A 3AVHA 1TL1A 1A5XA 2ATQA 4G1QB 1S1WA 4O3NA 4JS4A 1DTQB 4E3SA 4CESA 1J9AA 3V4IB 4CHPA 4NLYA 4WXWA 4EZ9A 3K5MA 1J5OB 1JKHB 1W9HA 3VQPA 3HVTB 1UWBB 4FLZA 3OL6A 4ZP8A 3VQAA 2WOMB 4N5SA 3C94A 4LSNA 3U6FA 3T5HA 4FLYA 4QPXA 1JXBA 3V1OA 2DFHA 2HNZA 4DU3A 3AO4A 3PW4A 1WSGA 2YNGA 4IH5A 5HBMA 2C2RA 3VQSA 1BIZA 3KLEB 2CJQA 2R2UA 3DRSA 4EP5A 4EBEA 5D3GB 3QIPA 3SPZA 4TYBA 4LH5A 4MFBB 3JYTB 1C1BA 4DL5A 4RUCA 4RW6A 5SWMA 1HMVB 5DQGA 1RTJA 1SUQA 1N5YB 1U48A 1JLQB 4N76A 1F21A 1WNEA 4I9LA 4W5OA 1N6QB 1JLFB 3LP1B 3OL9A 4B9TA 3HL8A 1JLGB 4F8RA 4RNOA 4YFUA 3RB3A 4DQPA 2P5OA 2XHBA 5K14A 2LSNA 3RB6A 3Q8QB 2BQ3A 4IR1A 4TQSA 2GBZA 3V81A 3NAEA 1FKPB 3RTVA 3SUPA 4UQGA 1J54A 3PUFA 4Z4GA 4CJEA 3DMJA 4KFBA 1D0EA 2HHWA 1JXEA 1RT5A 3A2FA 1C2PA 1K1SA 3VQ7A 4O3RA 4HHTA 4DTNA 4OGCA 4ZHRB 1N4LA 1UA0A 4MK8A 2XY7A 1T03B 3PZPA 3NF8A 4CF8A 2W8KA 5KFFA 4IKAA 4M95A 3M8SA 3LANA 2D0BA 3DOLA 3HVWA 3DRRB 3KLHA 3HSTB 4FJ9A 3CG7A 4M41A 3RAQA 5J1EB 1NHUA 4ZTFA 4FM0A 2XCAA 3PX4A 1S1VA 3AA4A 3WNFA 3I8DA 4FJGA 2IS3A 3ZSRA 2VA2A 1D1UA 3AO5A 1TKXB 3FRZA 4CF1A 2HHSA 1NKCA 3I0SA 4DTOA 3CO9A 2IC3B 4ELTA 3QEVA 3QYYA 3OSPA 4CJTA 4YR2A 5L1JA 3RRHA 5DK5A 4C8KA 2HNYB 1TVRB 3D28A 4YR0A 4DSLA 3KNAA 2HAIA 4TXSA 4QWDA 4I2QA 1Q9XA 4NYZA 4MIAA 4B9LA 2NUBA 1HYZA 3LALA 4KKOB 2VWKA 4GW6A 4Z0UA 2IM2A 4MKBA 4DL7A 3MAQA 1S6PB 3V6DA 4QWCA 2QKBA 5HLFA 2XY6A 5KFAA 4MK7A 2D3UA 3ZSOA 2KZZA 2PYJA 4DFPA 2Z1JA 5DLFA 4IG3B 2YNIB 2IM0A 1QSSA 2ASLA 4PUOB 3NH1A 1QTMA 1T05A 2OA8A 2HHXA 2XGPA 3OVNA 5L9XA 1IKVB 3VQEA 3FSIA 4NZ0A 1QUVA 4ID5B 4KHWA 1HPZA 1RBVA 3M9MB 4J9LA 4M94A 3KLIB 1VK0A 3B6PA 5J2QA 3MECA 2RN2A 3AVCA 1A5VA 3FFIA 3DRPA 1NK8A 4EP4A 2WTFA 4J9QA 3EZUA 3SFGA 2HVHA 2XC9A 1S48A 3H4BA 4WZQA 5JXSA 4E1MA 3DLBA 3O3GA 1QE1B 4CEDA 4E7LA 4URGA 3SV4A 3HK2A 3AA3A 1Z26A 4BDYA 1KVCA 5C42A 1ZBUA 3QLHB 3DM2B 3QZ8A 3ZSXA 4NCBA 3L3UA 2Z1IA 1NK6A 5KFNA 1GX5A 4NLQA 4CGJA 4IOBA 1GOBA 1S97A 3LP0A 4H4OA 4MQ3A 3CJ3A 2AJQA 1K6YA 3ZT4A 3RMAA 1L3VA 4WFYA 1I3AA 3MFHA 2A1SA 1RBRA 3NCIA 3BSAA 1CSJA 4JS5A 5HP1B 1LAVA 5KTQA 3ZSWA 1WSHA 4Y2AA 3L2WA 4N41A 4CGGA 3CM6A 3NL0A 3F9KA 2YNHB 3DLKB 4NLWA 3KLVA 3GIKA 3NAIA 4DL6A 1SH3A 4K50A 3OYKA 2AGOA 1XR7A 5KFLA 4QWBA 1YT3A 3HP9A 2F8EX 1SV5A 3NGYA 1Z25A 3ALYA 4CJLA 1LW2B 2C2DA 3BSCA 4ZP7A 4HCBA 3VN5A 3MEDA 3ZT1A 2D5RA 3SI6A 1HNIA 4O3QA 2UVWA 4IFVA 3MXIA 1RT7A 1NOYA 1NJYA 2I5JA 1QQCA 3AVBA 4QCLA 2R8HA 1W0HA 3DDKA 4URSA 3LZIA 1TKTA 2AGQA 4K4VA 1NJWA 4ZPBA 4CHZA 1JLBB 4WE1A 2XWYA 5EWGA 4EBCA 3TARA 1JLEB 1D9FA 5JS1A 3O3FA 2IGIA 2RPIA 1C1CA 2HWHA 2OPQA 4AHRA 3V9XA 3GV8B 2DFFA 4MK9A 5KT7A 2D7SA 4OKEA 3TAMA 3RAXA 3K5OA 4B8CA 1IKXA 1ITGA 4MKAA 4ZVFA 1TL1B 3EPIA 2YNFA 4EYIB 1S1WB 3PW7A 5HRNA 3K59A 4AILC 4GC7A 3Q8SB 4TYAA 2E9ZA 5J2NA 4DTRA 3GV7B 3V6HA 4OVLA 2KQ2A 2KZMA 1Y97A 4DL4A 4ZP9A 4M3YA 3T5KA 4AHVA 4Q44A 4JRPA 2JGUA 1QAIA 4CGIA 4LQ3A 2OPPA 4URQU 3OJUA 3AVJA 2V0NA 3SJJA 5HBMB 3OS1A 3NGZA 1BCMA 3I0RA 2KTQA 4J2AA 4K8XA 1LWCA 3ISND 1L3SA 3PO5A 3DRSB 1XC9A 3VQ5A 3KOAA 3IS9A 3QIPB 5C25A 2YHAA 1C1BB 4NRTA 2G8WA 4YQWA 2OYQA 4RW6B 5E41A 3OS0A 4CFBA 3WNHA 1ZBLA 1RTJB 2C28A 3GIIA 5KT5A 1NK4A 4J2BA 1IH7A 1B9FA 3D0PA 4ZMMA 1FKOA 1RYRA 4HCCA 2B4JA 3DLEA 3BSNA 4ZVEA 4FS1A 4Y1CA 2FC0A 3HPOA 5K14B 1LV5A 2UVRA 1RNHA 4NCGA 2ASDA 1S0OA 2W9AA 4NLOA 4M42A 1X9WA 1K1QA 4NLSA 1BCOA 1A5WA 4TQRA 2AGPA 2O5DA 3L2VA 4ECVA 1EETA 4K4WA 3OHBA 4LSLA 3KLFB 3KMQA 4CK2A 3OYJA 3EYZA 4CEOA 1LWEA 4I7FB 3IGNA 1BI4A 4DTMA 1TKDA 2D3ZA 3KLGA 1DLOA 3DOLB 3K57A 5CYMA 4R5PA 3KLHB 3KK3A 4PQUA 1Q9YA 4N56A 3AO3A 5KRSA 1D8YA 5F9NA 1S1VB 4E7KA 1N56A 1Q8IA 3M8RA 2AQ4A 3TAQA 1TK8A 5KFUA 1FK9B 1UOCA 3BQ2A 4KHRA 3K5NA 3QO9A 4H54A 3RBEA 4DMNA 3QEIA 3NKYA 5KFDA 4Z4FA 1GOAA 4IFYB 3GILA 5KFWA 3G10A 2R8IA 3AVLA 2HWIA 3H2LA 5EUHA 3UQSA 1HQUA 4BE1A 3S3MA 5KFTA 5KG2A 3RMDA 4DU1A 5HRPA 4ED6A 4E19A 5KG0A 1TGOA 4KB0A 1C0UA 3V6DB 2GV9A 2BDPA 1L3TA 2UUTA 4FJIA 1NJXA 4CCHA 4FW2A 3BJYA 3F73A 1TAQA 3EZ5A 1RTDA 3I5BA 3SUOA 4R0EA 2RF2A 3KKSA 1RBSA 4CGFA 4B9SA 2VG5A 1S10A 1T05B 4EBDA 3U3GA 4QWEA 4ZP6A 1WSJA 3RMCA 4X2BA 1TKZB 1HPZB 3SNNA 2F8TA 2XRIA 4M45A 5T14A 4HUFA 4CJQA 5J2QB 4XPEA 4MH8A 4EO6A 4E7IA 1D9DA 1RT4A 2GUIA 1XR5A 4IRCA 1IKWA 3T5LA 1WSFA 2FVSA 2R7YA 2E9RX 2KFZA 5FROA 2R2SA 5DQHA 4Z4CA 2G8UA 3SV3A 3HJFA 5C42B 3S3NA 4RW7A 3SFUA 3HYFA 3EY1A 4K4XA 4HUEA 3EPGA 1BIUA 3OYAA 4CEAA 4RU9A 1ZYQA 2IM3A 2FBYA 3LP0B 3N6MA 1JXLA 4KI4A 1HYSA 1ZETA 1I39A 3UIQA 4H4OB 3ITHA 3OJSA 3O4QA 1T8EA 2B5JA 4FS2A 3ZSYA 3KK2A 4B3OB 3ICLA 1XHZA 3MFIA 3LPTA 1KFSA 4FYDA 2E9TA 2W9BA 4PWDB 3T19A 5KFCA 1RT3B 4CIGA 3LWMA 4IG0A 1W25A 3NHGA 5L1LA 2FBXA 1RT2A 4ED0A 4OLAA 3HHKA 3AVMA 4ED3A 3TABA 2WK4A 4O3PA 4I9QA 2DPIA 4DL2A 3OY9A 1B92A 4DG1A 2HHVA 3NMAA 1SV5B 4R8UA 1ZTTA 4CJ5A 1S1TA 4CIEA 2VG6A 5KFMA 2V9WA 1KHWA 3AVAA 2XI3A 2X6SA 4N47A 3MEDB 3V9UA 3N6NA 3O3HA 4ZVGA 1HNIB 5KFJA 1XR6A 4FVMA 2I5JB 3MEEA 4DTUA 2XY5A 2IBKA 4DTXA 4H4MB 1NK0A 5F8LA 1ASWA 3ZT0A 4CJPA 3VQDA 2FLLA 1TKTB 1VSKA 4DSIA 4NRUA 2ASJA 1MU2A 1KSPA 3C6UA 4OPKA 4GMJB 4CK1A 4RW9A 4WE1B 1ASVA 3RR7A 5FRMA 4NYFA 4Q0BB 4FJHA 1C1CB 1VRUA 4DSFA 2HNDA 3THVA 1U4BA 4IDKA 3ZSVA 2RDIA 4BDPA 3V1RA 1WLJA 1KHVA 3Q8PB 1QSLA 4ECXA 2KW4A 4F4KA 1LW0A 3BGRA 3KK1A 1IKXB 3QGIA 1CXUA 1BQMA 4ED8A 4EYHB 4K4ZA 1BQNB 2YNFB 1JLAB 2WRMA 2ZQBA 3AO2A 5J2NB 3OYIA 1SL0A 5DQIA 2HMIA 2RKIA 4NLRA 1S6QB 1JX4A 1S1UA 2RDJA 1T3NA 1S9EA 1IG9A 5KG1A 5F8NA 3VQ6A 4L8RB 5FDLA 2JC0A 3RB4A 2BRKA 1HRHA 2OPPB 1RA6A 3L2RA 3JSMB 3BSOA 2OH2A 3UR0A 3KKRA 1S9GA 3DLGA 3TANA 3VQ8A 3I5AA 3I0RB 3P1GA 3VQ9A 1EXQA 4NLDA 1S1XA 3VA3A 3IS9B 4O4GA 3T3FA 5C25B 4CERA 3C6TA 2QXFA 3SUNA 4J9NA 1XI1A 5C24A 4K4YA 4J9OA 4LH4A 4DQIA 4CK3A 4BWMA 1IKYA 4B9MA 4FJJA 4M3TA 4CJUA 1NK9A 2D0CA 3Q8RB 1FKOB 4J2EA 1DTTB 3L3VA 4CHNA 3KHLA 3V9WA 4W5QA 3V4IA 4FZXC 3T5JA 3PVXA 4FJKA 3QGGA 4LY7A 2BANB 4U7CA 3OYEA 2J6UA 4NCGB 1O1WA 3HO1A 4KHNA 5KFSA 4Y3CA 1IM4A 4RNFA 4E1NA 4DTJA 3SI8A 3PR5B 4AHTA 4ED1A 2R2TA 2AX0A 3T1AA 3MEGB 3MXMA 3OYGA 3BREA 1EETB 4DFJA 4LSLB 3BDPA 3O4NA 3SQ4A 2BQRA 5EU7A 1TV6B 4AHSA 3HVAA 5KFVA 4DTPA 4CFDA 1LWEB 2HB5A 3C95A 3KLEA 3QZ7A 4W5TA 4RNHA 3PR4A 4ECRA 3LP2A 2P1JA 5KG6A 3CM5A 1XHXA 1HMVA 5CYMB 4R5PB 3KK3B 1IO2A 2BE2B 3CDEA 4CJKA 4DQQA 3LPUA 3H59A 2FVCA 1RDDA 1MMLA 3FDSA 1JLGA 2EX3A 2YKMA 2VG7A 4AHUA 4ID1A 4K4UA 3E01A 3ZT2A 3QO9B 3MR5A 4F4YA 1KFDA 1N48A 3HP6A 1WNSA 1NJZA 4CEBA 2DTUA 4KAZA 1HQUB 3V9SA 1EKEA 3OHAA 4XIUA 5KG3A 1VSIA 3NDKA 4QW9A 1C0UB 3OL7A 3SPYA 1ZBHA 3KJVA 3DYAB 4ZHRA 5I3UA 1X9MA 4FJ7A 2UVUA 1VSFA 3VQQA 3QETA 4FM2A 3TQ1A 4JV1A 1RTDB 4WXOA 5KRTA 1C1AA 5KT6A 4J2DA 1NKEA 2RF2B 2EC0A 5KI6A 4TLRA 5J1EA 2HHTA 2O4IA 5KFQA 4QWAA 5J2PA 2Z1GA 5EWEA 1U45A 4ZTJA 2IA6A 1BHLA 1TKXA 1S5JA 2OPSA 3TAGA 3RRGA 4CJ3A 3H5YA 4FM1A 3DOKA 5EWFA 4TN2A 2ETJA 4CFAA 2ZD1A 5KFYA 1S0NA 2HNYA 3NGIA 1Z4UA 1IKWB 5DG7A 4W5RA 2BGGA 2B6AA 4OJRA 2D41A 3ISNC 1RDBA 4PY5A 3QIOA 2QE5A 2FBVA 1NOZA 3CYMA 1S6PA 4DS5A 4J9KA 1BISA 1R0AA 3LDSA 1LWFA 4LSNB 3S9HA 4RW7B 2ITGA 1T94A 2HNZB 4BWJA 4ZPCA 2ILYA 2YNGB 4DEZA 3VQBA 2R8GA 3WNEA 1HQEA 4IG3A 5KFEA 3IGVA 1HYSB 4PUOA 2QK9A 3ITHB 2B5JB 2V4QA 3TAEA 3KMSA 3KK2B 1RT1A 4AHCA 3KTQA 1HNVA 4JUZA 2ALZA 4QAGA 1SUQB 3KHHA 2W9BB 4ECZA 3PW5A 3NBPA 3KLIA 2WB4A 1EP4A 2P5GA 1KLMA 1RT2B 5KT4A 4CGDA 4ED7A 4K4SA 4PA1A 2PYLA 3OYFA 4WYLA 4KBIA 4RW4A 3E51A 3V81B 2X78A 4B9VA 4DQSA 4IBNA 5F9LA 4DFMA 3IRXA 4R8UB 1QE1A 1S1TB 3B6OA 4ECUA 4FZZA 3DMJB 4KFBB 3OLBA 4CHOA 1RT5B 4ICLA 3QEPA 1RCHA 1VSJA 4E89A 1SKWA 2DY4A 4Q43A 1KCFA 4O3SA 2WONA 4JRQA 1CLQA 1VSMA 1HARA 3MEEB 4RG8A 3D5MA 1GX6A 3GIMA 4O44A 3ZT3A 1VSDA 2W9CA 2ZE2A 5FRNA 1RDCA 2R2RA 4ELUA 4DTSA 4ECSA 1MU2B 1RILA 3FQLA 1J53A 1HJRA 4CF2A 3C6UB 3PW0A 4FW1A 3M8PA 4Q8EA 3L2UA 3NE6A 3DLKA 2QV6A 3I0SB 1U49A 1VSLA 1RDAA 4KTZA 3V6KA 1VRUB 2ZKUA 1RTIA 4IDKB 4CJRA 4I2QB 1LW2A 4OGEA 3BGRB 3KK1B 5J2MA 5F8GA 4NLVA 2KFNA 1C0TA 3PX0A 4TY8A 3SYZA 1BQMB 5KGWA 5KT2A 2FVPA 4KPYA 2OPRA 3PHEA 5HLFB 2XGQA 4CGHA 4OL8A 2FLPA 3AVIA 5HRSA 2YKNA 2HMIB 2RKIB 4DU4A 1BL3A 3AA2A 3V1QA 4WFZA 3HXMA 3ASMA 4C8MA 2FVRA 1S1UB 1JLCA 1T7PA 4CEZA 4IRKA 3KIOA 4CF0A 1S9EB 4F2SA 5FDLB 3CFPA 4CECA 4RW8A 1D5AA 1ZTWA 2E6MA 5I42A 1S9GB 3DLGB 1SL1A 1S1XB 3G0ZA 4QOZB 3OYBA 4NLUA 4O4GB 2Z1HA 3MECB 5DMRA 3HM9A 1FXXA 3SCXA 3PO4A 2OZSA 4DSJA 3FFIB 3DRPB 3RMBA 5HROA 2VWJA 3SZ2A 3H98A 3V6JA 4TSXA 4DLEA 4IKFA 4B8AB 4WYWA 3CFRA 4DF4A 1RDRA 4IR9A 2UUWA 3AVFA 2FJVA 3OL8A 4BDZA 3HPHA 3OYDA 4KREA 1I6JA 2G8KA 3M8QA 1UA1A 4FCYA 5CY4A 3V9ZA 4IH7A 4CHYA 4FLTA 1QSYA 2ILZA 3M9NB 5L1KA 4KHQA 3GYNA 2R8KA 4I2PA 3ULDA 4KHUA 2G8IA 3CJ5A 2E6LA 1TL3A 5SZTA 3BQ0A 4O4RA 4HKQA 2Y1IA 3TI0A 3ZSZA 4IH6A 3PX6A 2IJNA 4Q45A 3CFOA 4OKKA 5CYQA 3LP2B 3P5JA 3QGHA 3NF6A 4CIFA 4Y34A 2IAJA 3TAFA 3GV5B 2XI2A 3SUQA 3CIZA 1VRTA 3MXJA 2FLNA 2G8VA 3DLHA 1SKRA 2OZMA 1YVUA 4FJXA 2YKMB 3MR2A 4CHQA 2VG7B 5KFOA 1XWLA 3E01B 4M3RA 4E7JA 2UVVA 4FLXA 4KO0A 3NH2A 4JV0A 1RBTA 4J9SA 4KB7A 3CJ2A 4IFVB 1RT7B
chains in the Genus database with same CATH superfamily
1B9DA 2YBVA 4TY9A 3NMUA 2BJDA 1OPIA 5BR8K 4LQ9A 4JI7J 2E1RA 3ATVA 5F8MA 3BZKA 1A6LA 2XSFA 3MCOA 1YJUA 4CH0S 4KTQA 2YJFA 5I3UB 5MLCQ 4I7FA 4MKYA 2DGTA 2G8HA 4JI8J 1FNOA 1MWMA 4OZLA 4OKJA 2KVQE 3A3OB 3GU0A 4NPOA 1EQ0A 3FE1A 2JZ5A 4C4WA 3QGPA 3UPFA 3PEHA 2IVOA 3TAMB 4FP9A 3N4PA 3FGUA 3BBCA 1TAUA 2DPNA 4DUTA 1W2BM 4LFAJ 2B56A 2HFUA 4USVA 2GO9A 4FXDA 2VHGA 2CXEA 4FWMA 1RP5A 3Q2TC 4IFYA 3DJCA 2HW3A 1REVA 1NG9A 3K5PA 4JB8B 4IEEA 3MDQA 2DHHA 1IVZA 4IRDA 4E98A 2HRTA 3VEOA 4QR1A 4BRGA 4ZPAA 2I7NA 4DX7A 4LF8F 1K8AO 1R0AB 3AOBA 4FXWA 3VAHA 1LWFB 4FXVA 1HNXK 2ZZTA 2E2QA 1YF5L 4WFXA 1YVFA 5DDOC 4DFKA 3CF5Q 4LFCK 2HOEA 4MIBA 1EKRA 1SC4B 1HQEB 2JWLA 4NLXA 3BKFA 1RTHA 3RR8A 4F50A 2CQPA 1RT1B 4F4ZA 3CF5L 4OZ3A 1GEHA 3BUZB 4M3XA 4B3MJ 1HUXA 2O8DB 1FRIA 2W4PA 2KT5A 5B7WA 1WEZA 2OKQA 3BR9A 4FLUA 3KD5E 1RBOB 2BXJA 3MCSA 1KLMB 4A47A 3DLEB 2W7OA 3BN7A 2NRHA 1J5OA 5DDQC 3ADAC 4ELVA 4Z4IA 3IRXB 1HPMA 4O55A 3HSCA 1JJ4A 4IJAA 1Q8BA 3L8BA 2XS7A 3MWBA 2CH5A 5GINA 3B8HA 3W2VA 3P83D 1OH7A 3G4SS 5DG9A 4BRIA 2WONB 2J9DA 3HPGA 3HFZB 5D3GA 3HKWA 1KVAA 2DRBA 4OPHA 2ZE2B 1MMNA 2KXFA 1U0HB 1N5YA 2N4DA 1JLQA 2QLWA 1PCAA 1HWUA 4PWDA 3LP1A 4BE2A 2F9JA 1VIOA 2W1BA 4JI4J 2YCHA 1RBUA 2A5XA 2JLFA 4UY8T 4GVBA 3CCZA 4B3RJ 2OFHX 2F65A 3K2PA 2J6SA 1HNZK 1WC6A 2QYCA 2X1GA 1ASUA 1SIZA 5LJWA 4ENOA 1FJGJ 4J37A 2OPRB 3JSRA 4CBUA 1BU6O 4YN3B 3PACA 5AQZA 1OH8A 1S49A 3I6PA 2VPWB 2XCPA 3BYRA 4QZVB 4DHYA 4F0MA 1AB8A 1Q53A 4QW8A 4RNNA 1JLCB 2DH9A 1WUAA 1TYQB 4UF4A 1WC5A 3OFGA 2LDIA 2QMWA 1GLLO 1NMDA 3O1WA 5I42B 4G1PA 4ZKAA 2IC3A 3NNHA 4NLTA 4WQ5A 2GIRA 1R59O 2FJWA 4KGVB 1RT4B 1TVRA 2P9PB 4BRKA 2VC0A 5GAHI 1URRA 2E2NA 4HUGA 4KKOA 2IDEA 2GMHA 4JKCA 1CS4A 2UUCK 2WFBA 2J8AA 4AH9A 2HZVA 1W2IA 4Y2CA 4P71A 2NRXA 3LM9A 1RKIA 4F4XA 4B3TJ 5GAHU 1NK5A 1S6QA 4YY3J 2DFEA 3R6MA 2Q31A 4KHPF 3CCRN 2HBMA 1VBKA 3TJ8A 1Q8LA 1VQ8S 3NOGA 1FESA 5HJYA 1N32F 1C0MA 3CE8A 4IG0B 5IC4B 1IBCB 3EE8A 2ZJRQ 2IM1A 3K7RA 4M3UA 1RWKB 3N5BA 4DR6F 3CJ4A 1VQPN 4MJKA 3POTB 3IXQA 3CTRA 4JI3F 4N7TA 3RBXA 2P9NB 4GV3A 2ZM6J 1KC8T 2KYZA 3OSNA 3LH2S 1JL2A 3MN6A 4J90A 4B08A 2BKNA 5IT9Y 2RQKA 2JWKA 1S3XA 3S7RA 3B8AX 3BQ1A 2CIMA 2W42A 1IBKJ 3MX5A 3CXCR 3M5RA 2JLEA 4RCHA 1UPPA 3M4XA 5AQOA 1X3NA 5JJBA 2H4WB 2YNHA 4CJFA 1T9WA 1UFWA 4CFCA 2DGUA 3BH7B 1EARA 2E5IA 3D66A 4XDCA 1T02A 3QRQA 2HNDB 2GS8A 1MROA 3JB9k 3TWHA 1PSDA 2D0PA 2B9EA 4H0TB 4M3WA 1Y00A 3AARA 1OVQA 3SJHA 3NFAA 3DU6A 1H98A 2DR8A 2EBEA 3AD9C 2HG4A 4USWA 3TR8A 3X1LB 3R1XA 1IUJA 2HQFA 1REVB 3IMXA 3VVUA 3AXMA 3LAKA 4E0DA 4NLPA 2GQ2A 4FJNA 1LWXA 3CEDA 1N5QA 3OLAA 3CJ0A 2JLGA 1LAWA 1GLAG 5I3QA 1H74A 4V19J 5KFPA 2Q1LA 2WVFA 2UV8A 2W7PA 2A2DA 2O1PA 1U09A 3DNCA 4E7HA 2OI2A 4JKHA 4BR2A 3QEXA 3RBDA 1JLEA 1CJKA 3WXIA 1RKJA 1RTHB 4DWIA 2DR9A 1QZ5A 2B43A 2HVIA 3V4MA 4FWPA 3C6TB 1ZZFA 4BC9A 3MR6A 1FNMA 4KH1B 5DLGA 2X6NA 3PIOL 3TWZA 4PHTX 1P9QC 2QWNA 3AVHA 4JS4A 4E3SA 5IOLA 2D4WA 2P8IA 4X64K 4WXWA 3K2YA 1J5OB 4JI6J 3QRRA 1W9HA 3VQPA 4U7UD 3CC4N 1NGAA 3CD0A 3U6FA 3H1VX 4FLYA 4QPXA 3W2VB 3OBIA 3EE9A 2P9CA 1IJJA 2J4RA 4CD1A 2DTJA 4EP5A 5D3GB 2XM3A 1Y9OA 4DL5A 2JWNA 3D54A 3I31A 2ROGA 5THWA 5ADZA 1FVQA 1ZZNA 1J5EF 5BR8J 5DQGA 1RTJA 4JHDB 1N5YB 1JLQB 1AZSA 3PIPL 4EGLA 5IWAJ 3WQUA 3US5A 3LP1B 3O2IA 1JLGB 2B7CB 1HKCA 1RDWX 4A59A 4DV3K 4HACA 1Q86T 2J0QD 2DEJA 4TQSA 1HWLA 2GBZA 4CNYA 2QWLA 4UQGA 1J54A 4Y2KA 4DR3F 2R3VA 4QU7A 1X0FA 1ACMB 2APOA 2HHWA 2J76E 1RT5A 4QIFA 1K1SA 5EOYA 4OGCA 1UFLA 2YXLA 1HHQA 1RLCL 4DUZJ 1UJ6A 3M8SA 3CCSS 2D0BA 5EXWA 1RWXB 3P6YC 4FJ9A 4M41A 3DXKA 2BKPA 1RBAA 4WU3A 2W6KA 1U6FA 2M88A 4X62K 1IXKA 3NCRA 1HNXJ 2DNKA 3VTIA 2IS3A 3QT5A 1D1UA 3AO5A 3QAUA 2BE9B 1TKXB 4WBFA 4LFCJ 4N8NA 4DTOA 3CO9A 2IC3B 3QEVA 3QYYA 4XAKA 1P8GA 5L1JA 1OY6A 1TL7B 1ZAWA 2DNGA 1TVRB 4YR0A 2HAIA 4JKDA 4MIAA 1ELOA 4KKOB 5B0AA 4DCHA 1K8AT 1HWJA 1CS4B 4GW6A 2AW0A 2QKBA 3R5JB 3BN4A 1M5PC 2CPZA 4FPBA 1FFWB 3P96A 3ZSOA 1VJWA 3MOZA 2CGJA 5DM6L 4DFPA 1H2TZ 1U2FA 3WXLA 2VFSA 3QFWA 1UL3A 3GWCA 1T05A 2OA8A 1HA1A 2HHXA 1EAYC 2HVEA 2XMMA 3ENBA 2CPEA 1YK9A 2VPXB 4M94A 4ZOSA 2DRDA 2CQHA 3HI0A 3J80Y 5F0WA 2HFOA 2KH9A 1QZ6A 3AA8A 4ATNA 2B8PA 4H5TA 2LXUA 2I38A 2WBRA 1GXTA 2XC9A 3M32A 3H4BA 3M2VA 4MT1A 1FXRA 4WJBA 3HHDA 5KPRA 4L76A 4CEDA 4OX6A 4URGA 5BRDA 2PC6A 1Z26A 4CO0A 4UOHA 3QZ8A 3L3UA 4ZIVA 1NK6A 2YKAA 3ZLJA 1VHXA 1X4EA 4P73A 3LP0A 1R6VA 2A3ZA 1HNZJ 1JXVA 3CJ3A 3NGTA 4OX7A 1K6YA 4WQ5C 3RMAA 4WFYA 3SAGA 4FF1A 2EK1A 3NCIA 3A5OC 4CTAA 2E8AA 2FTRA 4NXNK 4ILMA 2NPFA 1WSHA 3IWLA 2YNHB 3ENHA 4FF4A 3UB5A 2QA4G 3GIKA 1ITPA 4DL6A 1HLWA 1ZXOA 2AGOA 1PO6A 4QWBA 2PI5A 4JI2F 1MROB 1K73O 1F60B 3RRKA 3VEVA 4A2BA 4LUBA 2G1DA 2UU9F 3CCMS 5BYQA 2C2DA 1FFGB 3BSCA 3AFGA 3NGRA 2OEMA 1XQSC 3SI6A 3WIVA 3K17A 4V1Ak 1FRXA 2DYAA 4RX6A 2DVIA 2L9WA 4X65J 3OTBA 2R8HA 2MTLA 2Q6BA 3D0IE 3BGFA 3QFPA 1P1LA 1UEVA 1PC4A 4FYWB 2HEKA 4WWSA 4B9QA 1WC3A 2CWKA 3O6QA 4DV0J 2QWPA 5FLXO 2J0XA 2MQ8A 4FYYB 3TARA 5LMUJ 3MD3A 1JLEB 1IJEB 2WBMA 1BA1A 5CD4H 3PYDA 2HWHA 4IOCQ 3W0LA 4MAKA 1IBLK 5KT7A 4L75A 3D9BA 3KKFA 4P7VA 1V3SA 2EBGA 2N3OA 2W2QP 3M1FA 3SMZA 1IKXA 2E5LK 1YRXA 1ITGA 4BRCA 5AJ3K 4YHHF 3FRYA 3K59A 4XH5A 2MLZA 4AILC 3Q8SB 3V6HA 1T0TV 2JJ4D 2CAJA 2KZMA 1GAOA 3MXHP 2ZOMA 4AHVA 1U26A 5CABA 3CPWR 1Q95G 2QL9B 4LF2A 4LQ3A 1U6BA 4LF4F 4USMA 2OPPA 2D69A 2V0NA 3SJJA 1IM6A 2F4VF 1BCMA 3CMQA 2KTQA 3HHEA 2J5AA 3VQ5A 2H5EA 4LT6A 2G8WA 5E41A 4NWBA 3OS0A 3VTHA 3WBZA 3WNHA 1RTJB 5IT0A 1IH7A 2KHCA 2CPIA 4OI6A 1RYRA 4HCCA 4TLQA 4EIAA 4HT5A 3RG6A 2B4JA 4WCEL 3C15B 4OV6A 2A6OA 4M7YA 1WUUA 4Y1CA 4HACB 1RWNB 5LOQA 4W92B 1HQ2A 2PSZA 1M1GA 2UVRA 2XMVA 2KG1A 1RNHA 3EL2A 4NLOA 3EZOA 2CQDA 4M42A 2ZJQL 2MQPA 4WP9A 1DRZA 2DGXA 4ECVA 1EETA 3OHBA 1X4CA 2K3IA 4DR2J 1VQOS 1VGYA 4CEOA 1QVGM 4LRBA 2V69A 3VF4A 1TKDA 4LFBF 2WSEC 2MHNA 2V4JA 5LJVA 2LXIA 4N56A 3FZLA 4K5RA 3DXKB 1OYEA 3GCWP 1QVFM 1HIYA 3WC0A 3HOSA 3CERA 1FK9B 3BQ2A 1AFIA 4BC2A 3GJTB 3W1YC 3QEIA 5AFUA 1UCNA 2X3DA 4ZLJA 4Z4FA 3MM9A 2AZ1A 3G10A 1FA0A 3H2LA 5EUHA 3RMDA 1GLCG 2VL1A 3JS9A 5FD1A 1BC6A 1C0UA 3HZEA 2YX6A 2GV9A 1L3TA 2UUTA 4WK3A 2V68A 4FJIA 2NLWA 4NXMJ 2ZGYA 3THPA 1PAUB 1RTDA 1RAIB 5C10A 2V52B 4UUWA 2RF2A 1RBSA 3FBEA 4CGFA 2XMWA 4DPTA 1T05B 4RLEA 1WTFA 3U3GA 4QWEA 2PFUA 4J91A 3RMCA 2MLXA 2NZ4A 4PABA 1QQNA 1TKZB 2CJ9A 1RK8A 4I6AA 3U02A 2DXEA 4M45A 5GADP 4DCJB 3CGIA 2M3DA 5KAKA 1KQSR 1FT8A 5H9EK 4MH8A 4DCOB 1H1VA 3SCJE 4K43A 3T6JA 4OZ2A 1R8PA 2FJDB 3T5LA 1WSFA 3M32B 3GJQB 2KFZA 2EFPA 2R2SA 3SV3A 4ZPWR 3H45C 4I69A 3JAMO 2DCLA 3EPGA 1ZYQA 4DV4F 3LP0B 5ETRA 1IR2A 1HYSA 1ZETA 3ITHA 2XLJA 2BOAA 3HSZA 3KK2A 5AE2A 4B3OB 3G8SA 4ZN3A 1Z05A 3EVOA 1FTCA 3MFIA 1KFSA 2E9TA 2W9BA 1BWVA 3J7Z5 1FDNA 2XBPA 4K0KK 3N5FA 1KR4A 3T9ZA 4O3PA 1BLUA 3KG1A 2BJ9A 1B92A 4DG1A 2W01A 2MKKA 5JVHQ 1ZTTA 4LBPA 1S1TA 5K8NA 4X62J 4CIEA 3QSIA 2V9WA 3CC2N 3QPIA 2KM8B 3J81j 5FPEA 3PKYA 1JMTA 4KC5A 1NJIO 2XI3A 4KHPK 1Q8KA 1JCGA 5JVHL 5CHCB 3O3HA 3E9LA 2VQFJ 4DV7F 3UCUP 1Q5YA 1SC1B 2XY5A 2BKOA 4PG8A 2NZTA 4H4MB 3GE1A 4CLYA 4CZLA 2QC3A 4U96A 3EGVA 4DR4F 4NRUA 2WVCA 1KSPA 4OPKA 4L6V3 4CK1A 1U1LA 3RR7A 3EDRB 3TPQA 3TX8A 4Q0BB 4FJHA 1OY8A 4YOEA 4JI3K 2FZCB 4DSFA 1U4BA 4IDKA 3ZSVA 3KUGA 3EMTA 3VHQA 2XLIA 3V1RA 4ECXA 2C42A 3KK1A 4HEA9 1IKXB 3QGIA 4ILRA 1U2VB 3GG4A 4BC5A 1U02A 2MKCA 2QLFB 4EYHB 2QEXN 4BVOA 4RWTA 4UZBA 4DJBA 3AO2A 2DNYA 2DT9A 1ZPVA 4LMZA 3DLLQ 4L3KA 2IY5B 3DXMA 3LTOA 3M6XA 4X4NA 1IG9A 5CH7B 4JI0F 5FDLA 4FWLA 1HRHA 2OPPB 4BREA 1VMBA 2OH2A 3BSOA 2PEHA 1ZH5A 2Z30B 2EWSA 3DLGA 3VQ8A 2VBXA 2KM8C 3P1GA 2EI5A 1S22A 2HZCA 3T3FA 4CERA 1R89A 2QXFA 3JSBA 4CLPA 4J9OA 1RABB 4ZJLA 4BWMA 3CMES 2GWJA 4CJUA 2D0CA 1IN0A 2WVDA 1DTTB 4CBWA 4OIXA 3PSIA 2QI2A 3AB2B 1FVSA 3OHRA 1I1GA 1BXNA 2N4CA 4FJKA 4U7CA 3H0PA 1YJNS 1FRMA 5DRKA 4E1NA 4DTJA 3PR5B 2WBNA 3T1AA 2D0OA 4R79A 5KQ8A 2I0XA 3IAS9 1EETB 4JK8A 1RGVA 1UVMA 2NNWA 1MNEA 3U1NA 2BQRA 1TV6B 3J80U 2VU5A 2BM0A 3PR4A 2G2YA 2P1JA 4M1KA 4B3SJ 3I56N 2LU2A 1G3OA 2V4JB 3ZZZA 1SKUB 1IO2A 5GMEA 5DZ7A 3CDEA 4E2FB 2DD8S 2XYGB 4CDIA 1Y3JA 3GIRA 1ILYA 4LBIA 1FFSB 1XJWB 3M30A 2GQCA 1SAZA 5A2QO 2MXYA 2DGWA 3CDBA 2YQ0A 2E5GA 2EFQA 4PG4A 1J6ZA 2OSRA 4DU7A 3MPVA 1H2UX 4WU2A 4F4YA 1VQLS 1WNSA 1DGKN 2BJ3A 4FZVA 4PXCA 2DTUA 4LC9B 2R42A 2HFSA 2N3LA 2VIHA 3V9SA 3OHAA 1C0UB 3OL7A 4H5VA 3SPYA 2RB7A 2VFUA 3DYAB 3BF3A 1ULRA 1NSAA 2EFGA 4PG5A 2UVUA 1VSFA 2DNHA 3QETA 3TQ1A 2XZDB 1RSCA 4M63A 2ADBA 1RTDB 4WXOA 1C1AA 5KT6A 2HMPA 4J2DA 1NKEA 2RF2B 5IT4A 2CNNB 2EC0A 3OFHA 4TKTA 2O4IA 4QWAA 5J2PA 5EWEA 1U45A 2IA6A 1WC1A 4CI0B 3ZZ0A 2DXDA 2H9ZA 2AD9A 1S5JA 2B8QA 3G6ES 3RRGA 4CJ3A 2RQ4A 2BMBA 4TN2A 2ETJA 4PPDA 1MN9A 5KFYA 5HVFA 3U7JA 5KOWA 3NGIA 2V63A 5DG7A 4OJRA 1RDBA 3QIOA 3PCOB 1NOZA 2PBDA 2Y1LB 4LJMA 1AUDA 4FF2A 1HKGA 4P9SA 4CJ7A 4TU9A 2HIYA 3G82B 3L95X 2HNZB 3NLCA 4ZVRB 4LF8J 4BWJA 4ZPCA 2YNGB 3DFEA 2ZHAA 1NCLA 3IM8A 3WNEA 1MN7A 4IG3A 4H03B 1HYSB 3ITHB 1Q79A 3L3CA 4WYBA 3R1HA 3TAEA 3KK2B 4AHCA 2RQMA 4JUZA 3H2UB 1VQMN 1PBUA 4PPZA 4F26A 3HSGA 2W9BB 4LF9K 3PW5A 3NBPA 3KLIA 2WB4A 2CQ0A 2V8HA 2P5GA 3F9MA 5KT4A 4CGDA 4ED7A 5AQUA 1EB0A 3OYFA 5RUBA 4DZ6A 1FJ7A 3MN7A 2VC1A 3C19A 4B9VA 3FEZA 2F9WA 5F9LA 2HGLA 4DFMA 3VEZA 2VPZB 4IUFA 2X1AA 1S1TB 3B6OA 4ECUA 3CCES 4KFBB 3M1VA 3THWA 3OR2A 4P52A 3Q7BA 4DU8A 3AY0A 1SKWA 3RAMA 3W63A 1KCFA 3TZYA 4QIVA 2E88A 4XEIA 5M1QA 1WDDA 2AA4A 3E1YA 1VSMA 4RG8A 3NGUA 1GX6A 3GIMA 3B6BA 5AR0A 1Q18A 1MLAA 1MW7A 2W9CA 3TA2A 2I7PA 2R7TA 3M8YA 4ECSA 1RILA 2ZH2A 1HJRA 3KNGA 4CF2A 1HBMA 2A41A 3IKMA 2BACA 1NEEA 4CM0A 5DM7L 1U49A 2G13A 4KTZA 3K0SA 1S79A 1RTIA 2XS2A 4IDKB 4QYZK 4QIGA 2W7AA 3G87A 4MMOA 5D0EA 2P9GA 5E26A 4OGEA 3KK1B 1F9HA 2VQEK 4RWWA 2ZWHA 5LMNK 2HS4A 2E5HA 5KT2A 5HLFB 2W4CA 4CGHA 3JTOA 1VBYA 3AVIA 1NAQA 4DXLA 4GMKA 4Y0FA 2AJ2A 4DU4A 3AA2A 1N52B 5CZVA 1VQ4S 2B9YA 3HXMA 1N33K 2FVRA 1T7PA 4LR7A 2VB6A 3WT0A 2BJEA 4F2SA 5FDLB 5ETPA 2GQQA 3ZX3A 4RW8A 1ZTWA 1U24A 4JI2K 3DLGB 2Z57B 3ETMA 2DCUB 1SL1A 3G0ZA 3OYBA 1UJ5A 3EJMA 3I8BA 3MECB 3T1YK 1RHMB 1FXXA 2OZSA 4DSJA 3M6UA 3K9JA 1WG1A 4OYMA 3FC9A 2HQCA 4LIWA 4IKFA 3EE3A 1ZC6A 4IR9A 3NEKA 3AVFA 4JKGA 1O51A 3UE5A 3M8QA 2Q1NA 2HVZA 1VC6A 3KDOA 3ZZUA 2NPIA 3M9NB 3UD4P 2RSQA 4OV1A 5KQDA 4DDFA 1XC3A 3CJ5A 4X66F 4KHPJ 2L48A 2V34A 3WQTA 4HKQA 1XNQF 2Y1IA 1I94F 3ZSZA 2IJNA 2JNJA 4OKKA 1N32J 3SK3A 4DKWA 1RWUA 2KLAA 2DGVA 1SC6A 1NH7A 5A8WB 2EWHA 2IAJA 3GV5B 2XI2A 2F5GA 2LA6A 4NOHA 2GVZA 4A8QA 1JJ2R 4YOUA 3H42A 3M30B 1SJ4P 1SKRA 1YVUA 2YH0A 3MR2A 4CHQA 1XWLA 1Q78A 3VR1A 1EIYB 2VDHA 2XMTA 1YTYA 2KFYA 4JI3J 4JV0A 3NH2A 3CJ2A 4IFVB 2AYBA 5MLCV 4CE9A 3IN5A 1RAJA 4O8KA 2FUG9 4AM6A 4OHVA 3HT3A 5DDRC 4JD2A 3AH6A 4K4TA 3FFKB 3AODA 1OSCA 3HDSA 5F8HA 1VI7A 4FK2A 1RT6A 2OELA 1UZDA 1U8WA 1V5IB 4RUAA 5GIOA 3H08A 1WF0A 4K2JA 2YVSA 2ATLA 3AO1A 1TL5A 2ACMA 2XZTB 1NLVA 4CT9A 1VQKS 1CVJA 1VSEA 1VC0A 1Y5NB 2QO3A 1WSVA 3N0VA 4WZMA 1TK5A 5J2PB 5GADI 5KFBA 4C0BA 2ZH3A 1A0OB 1SBRA 2FGCA 4CEQA 4CJVA 1N54B 4DPXA 5EGYA 4ALZA 3NWGA 3MM6B 2MY7A 2HHHK 3D1QA 1SL2A 3IG1A 4FJ5A 2IRUA 4NYNA 4PKGA 4J7CA 2BEFA 4KT0C 4CF9A 5IFMA 2RRNA 1NNDA 5GADU 5ELZA 3K5LA 1RAAB 3ZCMA 1Z6RA 2M2BA 1NHVA 3ET6A 4FF3A 3JSYA 4LFBK 4O0JA 2QA2A 2Z4PA 1F5CA 1JNRB 2ZJPL 1HR0K 1YTAA 1NO8A 4AQYK 3FBCA 3JXOA 4IEIA 5HK4A 4DL3A 3PTWA 3GDQA 4CLSA 3IMQJ 4KRFA 2HHQA 3QMLA 1EWQA 2BE7D 1GT8A 5M2RA 3RSEA 1RGIA 3E9OA 4KY3A 4V19S 4M5DA 2E4LA 3NBPB 2FJAB 2AV5A 4G1QA 1B0VA 1DTQA 1TELA 2A18A 5BXIA 2V2QA 2ASOA 2EXUA 3I9ZA 4ECWA 2WTUA 3FK4A 4M63C 3G6VA 3OYCA 3NGDA 2IJFA 1YKWA 1YZ7A 1HW9A 1QS4A 5C5JA 4JV2A 1FJEB 4KQZA 2J9CA 3THWB 3OR2B 4KE5A 3NF9A 2FIUA 5EX0A 3W60A 4KH4A 2OIHA 3R9LA 1KLNA 3FBFA 2M9KA 3ZNJ1 4DR5F 2BW7A 3KLGB 1DLOB 2GC8A 2W9CB 1DZ5A 1LQ9A 4IOXA 4PQUB 1RYSA 3G71N 3LWLA 2EVZA 2J7WA 1GLJO 5E3RA 1N6QA 3W3DA 1J5EJ 1WF1A 2BRLA 3RGIA 3ONQA 2BABA 4ZITA 3CC7S 2V94A 4JBCA 5KFIA 2ADCA 3PJWA 1ZBTA 4QR2A 1WN7A 2QTDA 1RTIB 1RZMA 2HS0A 4U67Q 3KHGA 3KVGA 4ECTA 3NS5A 2HFZA 2F7VA 1ZBIA 4DR3J 2L08A 4U67L 1WSRA 2FJXA 3CD5A 2R7SA 3QT6A 4K2XA 4F02A 1KDNA 2FVQA 2JEGA 4X4PA 3IM9A 1N34F 3DRRA 4C23A 2VG5B 2ITMA 1M5SA 3UKRA 4ZLNA 3IR7B 3C7NA 1U47A 1B64A 2JEJA 3ZTPA 2LU1A 4RW8B 2PA8D 4X4OA 1OSDA 2UYTA 4B9UA 3N4WA 2UZAA 2UP1A 1KXPA 3VQ4A 3NF7A 3AA5X 1U2CA 3AQPA 3OA9A 1UEKA 2FHOB 3MMBA 4U95A 3VVTA 3AVKA 2P51A 2V5HG 5D0GA 1NDLA 4JOUA 2IA0A 4C8NA 1LOTB 4U6PA 5E2QA 3NGKA 2GX8A 4JKGB 3VPZA 2ZC4A 3A12A 4DR4K 3M8QB 3AVGA 1WAFA 4PQAA 4KGXB 3AVNA 4WFNL 2FJEB 4I6MA 5IQ6A 4J9MA 3VA0A 1UWAA 2Z2MA 2G8FA 2DGSA 2VYPA 2DB1A 3RUBL 4FOEA 2A1RA 2DR7A 3JSMA 1VCTA 1EX4A 3AB4B 1H6KX 2OJ3A 3QINA 3EX7B 2WC9A 2OP5A 3L9ZA 1NRKA 1I51B 1G15A 1OQ6A 1FRLA 2IHR1 4DLGA 3CDWA 1ZBFA 3IC1A 3P4IA 2IAJB 1F3FA 2PE8A 3FQKA 3HSJA 3LZJA 2B7BB 3DAWA 1YJWS 2RS8A 2HRYA 3FMBA 4GV9A 3FZ2A 3AXKA 3ZZYA 3BBBA 2JOQA 4EHTA 3CMAS 2JC1A 2J0SD 4W5NA 3QBCA 3QIDA 5C0YA 1WI8A 1U1MA 3S6EA 1Q7YT 4CJSA 5AQXA 2H5IB 4QYZJ 3WIUA 4K8ZA 3HRGA 5KFRA 1NNEA 5E3CA 4JNEA 1BWEA 2NXJA 4WKRA 4OJGA 1HL6A 1XMOK 4ZVUB 2VQEJ 3HD2A 3P31A 5JUMA 2HFVA 3D2FA 1RT6B 4A8YA 2HHPA 4H8KA 4EO8A 4CEEA 2NYHA 1OVYA 1VQNN 2ZVIA 5A2QU 1XN9A 1SJRA 2M0GB 1HNXF 3OFEA 2C2KB 4F2RA 4K7QA 3T6BA 3OW2R 1VJQA 2KJVA 4IFEA 3SDEA 4DL0C 2WSCC 4KHMA 1VBXA 1KVBA 3H5XA 2XO6A 2Y1JA 4I67A 1WSIA 4JI2J 4NLGA 3TJAA 3WX4A 2UU9J 3IG1B 3PY8A 1PC5A 5CZ1A 3OBWA 2C2EA 1R6YA 4JI1F 3OR1A 4YOWA 1M90T 2UXDK 1YBUA 4WFAL 4FZYA 2RS2A 2G0IA 5L8RC 3ET6B 2XO7A 1UAWA 3UDLA 5CZ2A 3NGSA 3VGLA 1VS3A 2I9SA 2NLXA 1NKBA 5AQIA 3L7UA 3TOQA 3NNCA 1JLBA 4YMEA 4G6VB 4FPAA 2EKYA 2WVEA 4LD0A 1JL1A 1HYVA 3CJSA 4WTYA 5ETMA 3R97A 3A8EA 3QATA 1PGZA 4NEZA 4PWWA 2QJ3A 4AL6A 5C24B 3PJXA 1IKYB 1SKSA 3K58A 5KFKA 2CPHA 4M5DB 1TL1A 2ROEA 4G1QB 3CQXA 3VEXA 2GGPA 1DTQB 1TTHB 3BPDA 3V4IB 1TMJA 5AXKA 6FDRA 4NLYA 4EZ9A 4WP3A 4YHHJ 2C2NA 2GAHC 3R7NB 3GTYX 4OHYA 2DIVA 3JTPA 2W2OP 3OXFA 3OD2A 5B8HA 1HBNA 3C65A 1M5VC 2ZH1A 4FLZA 4RR5A 4N5SA 3C94A 3T5HA 2AYGA 1NGEA 1JXBA 6AT1B 4JV5K 5HBMA 3HCXA 4FN5A 3ZETA 1RWMB 4LF4J 3KLEB 2CJQA 3DRSA 1GXUA 2QA4S 1C1BA 1DKGD 2F4VJ 4RUCA 2E1ZA 5TKYA 5SWMA 3TSUA 1HMVB 1U48A 1WNEA 2B3TB 4W5OA 1N6QB 4N77A 4F8RA 2Q79A 3VERA 2P9IA 2P5OA 2XHBA 5HVHA 1CZAN 1GLEG 1TL4A 2BQ3A 3V81A 1MWQA 3RTVA 3G4SN 4LF6K 3HMJG 2Q97A 3DCAA 2XZWA 3NG8A 4Z4GA 5AQNA 1Y0HA 2HBKA 3DMJA 1EQMA 2K3KA 1D0EA 3O1BA 2CVEA 1JXEA 3K8VA 4HHTA 4DV5K 3WX8A 3A8JA 1HWIA 1N4LA 1LNQA 2W8KA 5ETQA 4KH5A 4IKAA 2E7WA 2UUCF 3SMPA 1XMQK 3LANA 5D4OA 3SCLE 5M1KA 3DOLA 3BF1A 3DRRB 3EVWA 3KLHA 2YQ3A 3HHLD 3UKRB 5J1EB 2EFOA 1NHUA 4ZTFA 4K41A 3C7NB 1MWKA 4LFBJ 2DNNA 3PX4A 1S1VA 4OZJA 4FJGA 3ZSRA 2VA2A 2IJRA 3FRZA 4CF1A 2ZUAA 1MG7A 1RAHB 3QICA 4HH0A 2I2YA 1AROP 2LMIA 4BR7A 4C8KA 2HNYB 4DSLA 4NI2A 4JN4A 1TUGB 4QWDA 2G4BA 4NYZA 1HWKA 4B9LA 1FDBA 2VWKA 4Z0UA 1S6PB 3IA0A 1VHFA 3KWGA 4DR7K 1BMQB 4MK7A 3MAHA 1BUPA 2Z1JA 3CULA 1D9AA 2IM0A 1QSSA 2ASLA 4PUOB 4I6MB 3NH1A 3MCNA 1ZA2B 2ZHBA 2DITA 5A8KA 3OVNA 4UZCA 4W98A 4NZ0A 1QUVA 1HPZA 3M9MB 3OVAA 3AJDA 2HVDA 1J27A 2A3JA 4IXCA 3B6PA 5E5NA 3A1YG 5GMKa 3EKUA 3M2UB 4OYXA 5IS2A 3QBXA 3GOIA 3AVCA 1A5VA 3QBWA 3FFIA 4C98A 1BY9A 5H9FJ 4EP4A 2QLJB 1U1NA 5B0BA 2GW8A 3EZUA 1TFYA 4E1MA 1QE1B 3TA0A 3SV4A 4OJ1A 1KVCA 1ZBUA 2DH7A 4NCBA 2EK6A 1GTEA 3D0GE 3PYEA 1N0VC 2V8VA 5KFNA 3RVCA 1N8RO 1CC7A 3H6EA 1GOBA 1S97A 2MY8A 4ZCIA 4DR1K 3L4BC 2AJQA 3ZT4A 4DV4J 3D3CJ 1RU2A 3B82A 3VAIA 3MCAB 4QS7A 4BRMA 2UXCF 3VOVA 4UY85 3M3ZA 4R0JA 3D2FB 2G0JA 4A5AA 1O0PA 4Y2AA 2UXBF 4N41A 3W2WA 3CM6A 3DLKB 2IVFB 3DKDA 2R7VA 2MDAA 4GKJF 4A62A 4DCPB 2FZGB 4K50A 1YT3A 2VDIA 2KXHA 3B4MA 4FWRA 3NGYA 4CJLA 3D6FB 4PG6A 4ZPVR 5FPNA 3D1HA 1FNXH 4HCBA 4ZCMA 2CA9A 2BW2A 1WB9A 1K9MO 4UY8O 5LSOA 3UFCX 3BBFA 1HNIA 5GMDA 4KGZB 4X66K 1NOYA 2I5JA 2ZF5O 4OLPA 2W6LA 2XTJP 4IDHA 2MQMA 3DDKA 3SBGA 3J7YP 5A0YA 4DV7J 4URSA 4X64F 3UR3C 1T9UA 3WXKA 4IOAQ 3R8YA 4F25A 3LPYA 4X4RA 1RUSA 1JLBB 4DR4J 1QJHA 1VIXA 1D9FA 4IOAL 4HR2A 1C1CA 4AHRA 2FJBB 3V9XA 3AD7C 3W5YA 4MK9A 2UV8G 1NLKL 2D7SA 3F5TA 3TAMA 1B99A 3RAXA 3K5OA 4P72A 3LDLA 1UVKA 1TL1B 2LVWA 4EYIB 5HRNA 3PW7A 4GC7A 4A8XA 5J2NA 3PRVA 4DTRA 2ZKTA 1H3DA 4J5OA 3M05A 1Y97A 4EI2A 4RU2A 5IXUA 2RQCA 3E66A 3R7SB 1HBNB 4DV3F 2BA9A 1FERA 5HO4A 2E44A 3UD3P 4CGIA 1Q5VA 2UUAK 4O23A 1GLBG 2KHDA 1PYOB 3OJUA 4A61A 3FSXA 4M8LA 2RAQA 5HBMB 3OS1A 3O80A 1QTNB 4JI0J 4ID8A 3PO5A 3TQEA 3DRSB 4B1XB 1C1BB 3G8QA 3H3OB 3AAPA 4CFBA 2C28A 2O8DA 1VQ9S 2IYGA 3D0PA 4ZMMA 1FKOA 3QSYB 1UW9A 3ZNUA 2GVDA 2P9IB 2KN4A 2Y0BB 3DLEA 1P1TA 2FC0A 1LV5A 2ASDA 2W9AA 2XMUA 1K1QA 1WOSA 1BCOA 3ZX2A 1A5WA 4YB7A 3R5CA 3VAGA 4M5LA 2PFFB 3EICA 2Y8WA 4LSLA 3KLFB 3KMQA 3VAMA 1NB7A 2YPYA 3DN9A 3NNAA 2NR0A 1NGIA 2QXLA 2OCEA 1KQFB 2D3ZA 3DOLB 3K57A 3N79A 3KLHB 4CO2A 1Q9YA 3AO3A 1S1VB 1BA0A 1N56A 1S76D 3TAQA 2W2PP 1VYAA 4FDFA 2VJVA 2EG2A 3CPWM 1FEEA 4KHRA 1G2EA 3QO9A 4DMNA 4EUVA 2Z56B 3P39A 3GILA 2RD5C 2R8IA 3UQSA 3M6GA 2HBZB 3DOMA 1HQUA 2FF6A 1L3KA 3S3MA 4DU1A 2W2MP 4A8FA 4EFHA 3CCSN 5HRPA 5KG0A 1TGOA 2NRZA 4JYAK 1F6TA 2BDPA 5F0XA 4U9RA 4DPOA 4QYRA 1A7GE 4CCHA 1NHKL 3BJYA 1E6VA 2RHQB 1TAQA 3A8IA 2XYHB 3I5BA 3SUOA 1R0BG 3KKSA 2P5VA 1S10A 1FRJA 2M5YA 5A8KB 3QRPA 2CFXA 4EWTA 4DPUA 3QNWB 2FDNA 1HPZB 2F8TA 1XTZA 2QWQA 3IUCA 1KEKA 4LSZB 1R8AA 3R2CJ 1S12A 4CJQA 4XPEA 1J2VA 3GG0A 5HOOA 1RT4A 4HTLA 2GUIA 1XR5A 1CJTB 4IRCA 1IKWA 5EX5A 4NXNF 3NS6A 3I55S 3UDEA 1E4FT 2R7YA 2E9RX 5FROA 4AXJA 4Z4CA 1N34K 5BN8A 3TW0A 4HUEA 3TEGA 1BIUA 3JQKA 3OYAA 2YKOA 1NSQA 3N6MA 4I6WA 1JXLA 2E29A 3UIQA 4A2AA 4DV6K 1T8EA 3EN9A 2LQ9A 3LPTA 5AQQA 4DV1K 4FYDA 2K2PA 3O6WA 1RU1A 4MDAA 1Y11A 3V2UC 1RT3B 4LRDA 4CIGA 1FD8A 4IG0A 1T3OA 3IWNC 1HX1A 1RT2A 3W2WB 4OLAA 3TABA 1U1QA 3KFWX 4ZLLA 3S41A 2KU7A 4DL2A 5M1NA 4PXDA 4R8UA 3HT0A 2ZBPA 4M5JA 4H0PA 4BG8A 5AXNA 1LFPA 4XH1A 3H7HB 3W7BA 4ZA1A 1KTVA 1IBLF 3AVAA 4OHZA 2AIRB 3BEGB 2DGOA 4C3MA 3D1OA 1HNIB 1SS6A 5KFJA 2E5LF 3CETA 1RXOB 2I5JB 3IO1A 3MEEA 5AJ3F 4JKEA 1KQSM 3KUEA 2IBKA 2X1BA 2XSJB 2KO1A 4RBTA 5F8LA 3ZT0A 5A0YB 2RU9A 3MM7A 2FLLA 1TU0B 2M4MA 4U8VA 2N7CA 4YDXA 1D8ZA 4WFBL 3CCMN 1NPPA 4DB3A 3G8TA 1ASVA 2AEJA 5FRMA 1H7XA 3PG9A 2J9DE 4NYFA 1BE4A 1VQ7S 1LXJA 1HD0A 1C1CB 3U8XA 2HNDA 4RL1A 1ICEB 2WB1D 1QSLA 3CI5A 4F4KA 3BGRA 2LLZA 3CT9A 1BQMA 1EZZB 1RB0A 2I6WA 4MO4A 4K4ZA 1BQNB 3MZIA 1JLAB 1IQTA 2ZQBA 4QS8A 5J2NB 3UNYA 2RKIA 4NLRA 1CBKA 1HI0P 5H1SQ 3VQ6A 2JC0A 2BRKA 1RA6A 2QYGA 2C2ZB 3KKRA 2V8DA 1S9GA 2W4DA 3TANA 3P45B 4NLDA 2BJ1A 3KHYA 2NRVA 4O4GA 1FI4A 3C6TA 2NREA 3SUNA 5CCMA 1GXLA 3GB0A 3AGRA 4FJJA 4JI1K 4UOGA 3KK7A 3DRXA 1XERA 3Q23A 1FKOB 3EGWB 4UW2A 4J2EA 2HZAA 2GVDB 5DETA 5B0FA 5T41A 1RI7A 3TZZA 4W5QA 4FZXC 1NMEB 3FZBA 3PVXA 1N8RT 3QGGA 3NCQA 1RWVB 2BANB 1RJJA 3VF6A 2YX7A 3OYEA 3FCHA 5AQKA 4RNFA 4F36A 3OTOK 2R2TA 2AX0A 3MEGB 3OYGA 3BREA 3WXMB 1SQFA 4M5MA 4DFJA 4LSLB 2P2CB 2QLBB 5KPZA 3O4NA 3SQ4A 5EU7A 4A8SA 1SQKA 2AJ4A 3FZFA 4AHSA 5BN9A 3R6GB 3K9KA 4W5TA 4RNHA 4X66J 3LP2A 2CQGA 2J7UA 1F1BB 5T7LA 1XNQJ 4D3HA 1JK9B 1I94J 1XHXA 1QUPA 2BE2B 1TMMA 4JHDA 3EVMA 2D3O1 3SBMA 3C16A 4OX8A 4RUBA 4CP5A 1OIAA 1B0TA 1JLGA 3FDSA 3C3LA 1K9MT 2VG7A 3SAFA 1X4GA 2HQ3A 2RDDA 4NX9A 3ZT2A 4PZVA 3QO9B 4GKKK 3DGPB 3MR5A 2AJ0A 3KG0A 2KB2A 3DOMB 1HQUB 2P6SA 1UVNA 1EKEA 5IT9O 3MI7X 5GAEP 4F0HA 5FPDA 4RBUA 4C7QA 2YWWA 1X9MA 5HANA 5M2PA 1E6VB 2G1HA 5B0DA 1WELA 2QWRA 4JI5F 5KRTA 3F2KA 1TUYA 3R2DJ 1P90A 2KYXA 3PM9A 3NOCA 5KI6A 4TLRA 2C1EB 3BEXA 3R3LA 5AQMA 3HJVA 2NSBA 4Y2IA 3TJ9A 4ZTJA 1LXNA 1TKXA 2P6TA 3E2EA 1X31C 2B4UA 2QN6B 3DOKA 2EG1A 1TL7A 1MSWD 4ILJA 4CFAA 2ZD1A 3IDHA 4BLGA 3W8GA 1IKWB 4W5RA 2BGGA 3PJ9A 3ISNC 5K5MA 4K0KF 5JMVA 4MLEA 3CYMA 3PFEA 2CYYA 4DS5A 4J9KA 2HGNA 3EUNA 4LSNB 4HI1A 2W2NP 5HQMA 1F9EB 3MOJB 3ULHA 4Y65A 2ILYA 3W5XA 3FR0A 3QWUA 3IGVA 1VQ5S 5CA5A 1X5SA 2QK9A 1YJTA 3GR1A 1YJVA 1AYEA 1NWKA 3KDNA 3GPAA 1HNVA 2YHWA 1O13A 1SUQB 5AZIA 3OBYA 3T1HK 1B7YB 1M5HA 1S7HA 2OGUA 5AFUH 1RT2B 2CJYB 3I56S 2PYLA 4WYLA 1OKJA 3LDPA 1NBEB 2OTJS 4RW4A 3E51A 2X78A 4DQSA 4IBNA 3SQGA 2ZDOA 4X4QA 2JRSA 4R8UB 2VD3A 1NDCA 3BKUA 5ETOA 3BV8A 4CZIA 3P8BB 1GLDG 3VEYA 3GL1A 1KKHA 3MPDA 4ICLA 3QEPA 4E89A 1NGBA 1NZ8A 3O4WA 4KPCA 3BZCA 4A46A 3O5BA 4OX9F 5E33A 3J7YI 1HARA 1Q82O 1QAYA 3MEEB 3D5MA 1IG8A 3ZC4A 2DR6A 4O44A 1OH6A 3ZT3A 1VSDA 5JICA 1Y64A 3MPUB 5E0OA 1V3RA 3MM7B 2CG8A 2BJ7A 5D78A 4ELUA 2LA4A 4DR5J 4DTSA 3FQLA 1Q16B 1T9YA 5A76A 1XMBA 4Q8EA 4IO8A 2QV6A 3I0SB 5CQGA 4XTTA 3D7SB 1RDAA 2FHJA 3ULEA 4C1NK 2K1RA 1HNWF 3U9ZA 4I2QB 3BGRB 4C1NI 2U1AA 4H0OA 1BQMB 3KJFB 2VZ9A 1S77D 3VGVA 3PHEA 4BR5A 3A13A 2XGQA 5HN0A 4OL8A 3MAAB 2UXCK 5HRSA 2YKNA 4MIWA 2RKIB 1BL3A 4WFZA 4OFZA 2M7SA 4DUYF 3ASMA 1X0PA 2UXBK 1QQMA 2K8GA 3AA9A 4NE9C 1N34J 4M7XA 1SQGA 4GKJK 1QQOA 3KWIA 1S9GB 2ROPA 1BUXA 1F5BA 4QOZB 3PIOQ 2ZH5A 2MMYA 3IWXA 1GNKA 2P9UA 4O4GB 1O5JA 2Z1HA 4B1VA 5B0GA 1E6YA 4AL5A 2UUBF 4BRHA 3HM9A 1KOHA 2DNZA 3DRPB 5MAOA 2GJ2A 5HROA 4FPRA 1IBMK 3H98A 3V6JA 1F2GA 8RUCA 2F3JA 2HYIB 4TSXA 3ZO7A 2PO4A 1PYSB 4DF4A 3GONA 2UUWA 3EWGA 2CJKA 1D4XA 1XK8A 1UVJA 4F7VA 3OYDA 4KREA 1I6JA 2VF3A 5LSRA 4FCYA 2RUSA 3K8WA 4CZEA 4FLTA 1T11A 2ILZA 3EEQA 3HD1A 4I2PA 1YI2S 4KHUA 3T41A 2G8IA 4ZPTR 4A4JA 2E6LA 5SZTA 3R1LA 3BQ0A 2YHYA 4O4RA 3TI0A 2XHWA 3SSRA 3UD5A 4PL7A 1HFEL 3PX6A 3PIPQ 3CFOA 3GBTA 5CYQA 3LP2B 4X4TA 4RKUC 2Q43A 5T7LB 5K8MA 4NA2A 2Q36A 3JTNA 3J80O 3C16B 3CIZA 1G1XA 2U2FA 1X60A 2G8VA 2FLNA 4USKA 1TUVA 3C15A 5E3PA 4H5WA 2VG7B 4M3RA 2CJAA 3KJNB 1OYDA 3O9RA 4E7JA 2CQ3A 3GJSB 4FLXA 2DHGA 4OYOA 3Q24A 2JDJA 1RT7B 3G86A 4MYTA 3PXGa 4ZIWA 1ZBSA 2PZSA 1YGYA 1UPMB 1VFJA 4PYDA 3OTCA 4ZVPB 1NGGA 3IBWA 5CYJA 5ETVA 5BYRA 1T6CA 3AGKA 2KG0A 4GVMA 4HTUA 2EHGA 2RIJA 2IPOB 3CDUA 1FF2A 3SQ1A 4QQBA 2OPQB 2GEMA 1VQLN 3TRGA 1RADB 4FPIA 5KG4A 2CG4A 3M9OB 4KAIA 3NY0A 3BKTA 4FK4A 4C8OA 1FK9A 3GZ7A 4JI7K 4M5GA 2JH3A 4RTFD 2QFJA 4FKYA 2VA3A 3DOKB 4Z4EA 4K42A 4KV8A 2QWOA 3BDEA 2ZD1B 5JVGQ 3FEYB 4ED5A 3G6YA 4F4WA 3LDQA 3G6XA 2CPFA 4LF9F 3AAQA 4H5RA 2AJFE 2GELA 4CEFA 4JI8K 1EHWA 1CXQA 3J7AP 4WF9L 3H40A 3Q0AA 3D6RA 4JI1J 4G3IA 4FJ8A 5JVGL 3UCGA 5DM6Q 2RU3A 2AU0A 1T6DA 4CLKA 3QNNA 4IO9L 2ERRA 3LAMA 4DQRA 1RAOA 1JJ2M 3DI6A 3G6EN 2H4YB 4BCAA 1LWCB 3OYMA 3P5TL 4J9VA 1YDLA 3I96A 2WZ1A 1WBDA 1HNVB 3H4DA 1TKZA 5AZIB 2IVMA 5GAHP 1YJ9S 2RVJA 2YV0X 4YNQA 3QEWA 3S01A 3BYPA 2YQ1A 8AT1B 5C2CA 3KD1E 3VV2B 3ID6A 1YIJN 2Z58B 3SCKE 3OYLA 2E5JA 2KDOA 4TNOA 1XNRF 4RW4B 1JKHA 3I87A 4BGAA 3HVTA 3SQGB 1UAXA 1UWBA 3QMQA 3IRWP 4F3OA 4BR9A 1R0CB 3ILOA 4X4SA 3BM7A 5G0RB 2GHWA 5KFGA 4B3MK 1BWFO 4ICLB 2GIQA 2GMJA 3HKZD 1C0FA 4BC3A 3MR7A 2IOCA 3UDCA 1SJ3P 2VQEF 3U1LA 5JS2A 5LMNF 4F3TA 1BI4B 1TK0A 2HHUA 4O44B 1JB0C 4B3OA 2I8EA 2ASYA 4DSKA 1RHKB 4LRFA 1QAJA 3CD6N 1NDPA 1JLFA 1SPBP 1KD1O 3GMGA 3CCJS 3QQCD 3CCEN 1N33F 3N28A 3OTEA 1VHIA 3AT1B 3VGUA 4HVZA 1MWYA 4OPAA 4KB1A 1WG5A 3CIMA 3ULEB 2FY8A 4FNHA 2K1RB 3SAHA 1KONA 5KGXA 3ENWA 4FYXB 4RWXA 2ZH7A 4AUKA 1U6ZA 9ATCB 4YUDA 4A48A 3T1YF 1X9SA 2YWGA 4ED4A 3VQCA 1T03A 3FCVA 4JI4K 3AV9A 2YKNB 2MYFA 4IZ9A 4B3RK 4H4MA 1S6UA 2N7YA 2PN6A 3MPWA 4ECYA 2YHBA 3HSDA 2A6AA 2UUCJ 4HHHA 3IAYA 1R43A 4K59A 2MKYA 4ER8A 5HMZA 1AW0A 1C4CA 5D8HB 4JLHA 1FJGK 2K7JA 4Q0BA 2IDOA 3GCXP 3NMRA 1X1PA 2P9UB 1NU0A 1WJ9A 1YLXA 4CZHA 2VONA 1E6YB 1YSJA 4ZLPA 2G2OA 1Q7LB 3U3YA 1VK8A 5E84A 5HROB 3OS2A 1S59A 2DO0A 2AX1A 3DLRA 1U2VA 2ZBCA 4CJWA 4FKXA 1VQ4N 1R27B 2QKKA 2PY5A 3U9DA 3T1HJ 2QIFA 4FJLA 1KP6A 1I3OB 1DQAA 3X3UA 3D6MB 4ANEA 4Z2XA 2Q6CA 2FD2A 4R25A 1K44A 5HRRA 2MZJA 2YJEA 1S0MA 1HHSA 2YNIA 1YHQN 4OYAA 4I2PB 1KQGB 4GNIA 4CYUA 3DU5A 2CUYA 4LVOP 2CKWA 2HQGA 3W9JA 4O3OA 2CQIA 1XIQA 2LKZA 3BGOP 5CYQB 3OFFA 3NAHA 3M2RA 1LEOA 4WCEQ 2O8EA 2FHJD 1NDKA 2ZEJA 1G7CB 2XY8A 1DTTA 2F1FA 4YR3A 5CZXA 3CO0P 2AWZA 2VG6B 3GFYA 2FBTA 5DGBA 3QLHA 5KFXA 3WZ0A 2ZJQQ 4O0NA 5E3AA 4DZDA 4GO7X 3SCIE 4CZMA 2CNKB 3OQ2A 1UTAA 3MF5A 3RWUA 1U2RA 3N9UC 2JEFA 1Q82T 4EEYA 2D0AA 4NYPA 4M5NA 2EKNA 4LR8A 5GAEI 2KRBA 2HHHF 3OYHA 4FLWA 3I5CA 3SQ2A 2NCKL 4MLHA 3CCLS 5HP1A 2FF3B 4OPJA 1TUUA 1TV6A 1RISA 2ZWPA 4ECQA 4HT7A 2IRYA 4KTWA 2UXCJ 4NA1A 4RW9B 1YRTA 1RHJB 3GR0A 1FKAF 2MZSA 2ZM6K 1PKUA 5GAEU 1Q81T 2E1MC 3ENAA 1RCOB 4CLZA 1HR0F 2QA1A 3OUYB 4AQYF 2UXBJ 1RLDA 2L3MA 1IR0A 3MMCA 2R4FA 4GKJJ 5ETTA 4A8MP 5C2GA 3MM5A 1LW0B 5HAOA 2FSNA 4F0KA 1IBKK 5AQTA 1S9FA 2ZOGA 3K0JA 3CCUS 2NXUA 2DIUA 3A5LC 2BR0A 2NZCA 5IT9U 1PJ6A 4KV8B 4GC6A 1CEZA 1P9YA 3FJ2A 3N6LA 2W8LA 4H5NA 1WORA 5HMXA 4I56A 4XO0A 2IMOA 1VQKN 2LQ5A 3I4PA 3DYAA 1VAZA 3L6QA 3MR3A 1L3UA 4X64J 3N01A 4CIOA 2J6TA 3DI6B 4S0MA 2OTLN 2WUSA 5FIIA 5AQLA 2MZRA 3S8SA 1OS5A 4BHQA 2M8DB 4PYAA 2DGQA 1M0SA 2IVPA 2MPUA 4QR0A 3GQCA 3D45A 1A5XA 2ATQA 1S1WA 4B1UB 3ZTRA 4BR4A 4XH4A 1WACA 3K5MA 1S72S 1JKHB 1LK7A 3HVTB 3HX9A 1UWBB 3MHYA 4ZP8A 4X4VA 4JI5K 2ZFHA 2G0CA 3OW2M 3V1OA 2DFHA 3G82A 2HNZA 4DV3J 1QDUB 3AO4A 4KGKA 2YNGA 3MD1A 4IH5A 2C2RA 4I64A 4CZFA 2CRLA 3VQSA 2QL5B 4EMDA 2CZ9A 2R2UA 4DN9A 3VAKA 4EBEA 3QIPA 3SPZA 4TYBA 1OMSA 4BRDA 2MKSA 4HTJA 3RU0A 4JI6K 2GUPA 3TZXA 2MEWA 2HIQA 2YWFA 4LRAA 1JLFB 3QT7A 2O8CA 5LXRA 2GA7A 4LBHA 3MCPA 1Y7PA 4DQPA 3W3SA 4QU6A 3RB6A 3Q8QB 2VH7A 1O6XA 1AT1B 1P6TA 2XS5A 2Y8YA 1R3NA 5D0HA 1IJFB 1HHTP 4P2MA 3AOAA 3HZGA 3TYTA 4ZK7M 4OLOA 4KFBA 1KVKA 4OZNA 3PLAA 1RCXB 4C48A 2GIFA 2ZUGA 5IWAK 4ZHRB 1WI6A 1T03B 3PZPA 3NF8A 5KFFA 1FD2A 2EW9A 2DEIA 4JEPA 4O5FA 4CRJA 5M1PA 5LY3A 3CC7N 3LOUA 1H7WA 2CH6A 2Q66A 3CQYA 4FM0A 2MZTA 3BS9A 3AA4A 3WNFA 4B17A 2X1FA 5LJ5Y 3J7A1 2FC8A 5M1FA 1QY7A 2MQQA 4NLCA 3KG4A 4HWIA 4CJTA 5DK5A 3OXGA 2D3OR 3D28A 3KNAA 4PCQA 5LM7E 4DUZK 3C8YA 1X4FA 1Q9XA 4OYWA 2E2PA 2PT0A 2RMLA 1BDGA 2NUBA 2JVRA 2KVIA 2GZOA 3P3DA 1KNZA 4OX9K 4LRCA 1FWKA 3MAQA 4DL7A 3PDNA 1NPKA 5HLFA 5KFAA 2YH1A 4DX5A 2PYJA 4CZGA 2DH8A 5IV3A 2SXLA 5DLFA 5C12A 2YNIB 4AE5A 2XGPA 2AYEA 2XYPB 5L9XA 5CHIA 5EX3A 3VQEA 2LQBA 3FSIA 3GYXB 5F2RA 4KHWA 4CYUB 2A2CA 1HNWK 2LP4A 2AHOB 1N88A 1VK0A 1XMOF 1WHXA 5J2QA 4YDUA 3MECA 3NWRA 2RN2A 4KR0B 2XG8A 3CCQS 3M2RB 2R9LA 2O8EB 4MTPA 1ATNA 3LF0A 2BTFA 3H25A 1S48A 5JXSA 3FBBA 4E7LA 2KKHA 4NXNJ 3HK2A 4BDYA 1FRKA 5C42A 3TTCA 3QLHB 1W97L 4DUYK 2CPXA 3PRDA 3U27A 2QFIA 2CPDA 4CGJA 3OVBA 2Q2RA 3CPEA 1H72C 4MQ3A 1L3VA 1VQ6S 2FLOA 4P7TA 4L74A 2MSTA 3MFHA 2A1SA 3BSAA 4F67A 1RWOB 1CSJA 2UUBK 4CM2A 5HP1B 3SLCA 1KD1T 1YJWN 2A1BA 1IR1A 3TZWA 3TA1A 5KTQA 2UXDF 1X7VA 3ZSWA 2IVYA 1V3ZA 3L2WA 2Z2YB 3KZBA 4CGGA 3F9KA 4FWQA 4NLWA 3CMAN 2PA3A 3W5ZA 1RWPB 4OI1A 3KLVA 1N5SA 5A8WA 3NAIA 5JLFA 5KFLA 5I3PA 3HP9A 3MMCB 4CO1A 1Z25A 3ALYA 3VAFA 3MM5B 2BYCA 1LW2B 5IZHA 4ZP7A 1RWWB 2PGCA 2HK3A 4EU0A 3MEDA 5AQRA 2D5RA 3TUIC 9RUBA 1NGFA 4O3QA 2ASPA 1IBLJ 1BO5O 3MXIA 4IFVA 1NJYA 3M7VA 2W41A 3AVBA 4CZJA 3D68A 1W0HA 2IYIA 2QL7B 2E5LJ 5E7OB 1JCFA 2DKOB 5AJ3J 1TKTA 3FSYA 1RAGB 2VPYB 3EXCX 1YBTA 2MGZA 2ASMA 3J7AN 3HULA 2MLYA 3ZX0A 1AA1B 2V8PA 4CHZA 4EBCA 5EWGA 1KOOA 4Z7CA 1YZ6A 1SQEA 3R9PA 2D74B 5JS1A 2ZNZA 2KT3A 2RPIA 5KOXA 3R5DA 3L4QA 3FMWA 1AFJA 2DFFA 4JV5F 1S7IA 1UETA 4X65K 4OKEA 4AFFA 1WC4A 5C7PA 4B8CA 1S57A 3MM6A 4ZVFA 4GY2B 2IIHA 4CLUA 2P9KB 3EPIA 2YNFA 2C3OA 1S1WB 1U1KA 4I1TA 2QGFB 4TYAA 2YWHA 3TR5A 1X4BA 4DV0K 2HLTA 3UN2A 3GV7B 3CJBA 1K0TA 2VFVA 3HI9A 4OVLA 3W9IA 5U47A 2K06A 3R7BB 5LMUK 1P8ZA 2KQ2A 3A0IX 2CPJA 4DL4A 2J8SA 3ILIA 1R8CA 4Q44A 4JRPA 2JGUA 1QAIA 2D9PA 2ZOFA 2YWKA 4CI6A 2DISA 3VGSA 4LF6F 1MA9B 2CNLB 3TVZA 3QAEA 3NGZA 3I0RA 1YITS 4J2AA 3TUZC 4DMZA 1E3MA 3QIPB 4YORA 5F1XA 4NO7A 5C25A 2DO4A 4NRTA 4DV5F 4YQWA 2OYQA 1SVDA 1F3VA 1IWAA 3GIIA 5KT5A 1U1RA 1NK4A 4J2BA 1K8KA 1XMQF 4ZVQB 1FWLA 2O8CB 2ZJRL 2OEJA 4DV2K 4Y6IA 3BSNA 3QB0A 2PD1A 3THXA 1B7FA 2F40A 3EDQB 2G2ZA 4NCGA 2QA4N 3OTDA 3UW1A 2DHXA 3VGKA 1WKLA 2LFVA 1DHMA 3PFOA 3LGMA 1YWXA 1FX4A 4ZVTB 3EYZA 2HQIA 1LWEA 4I7FB 3VZHA 1Q7YO 1BG3A 4JKFA 2NRRA 3B78A 4FWOA 4DTMA 3KLGA 1DLOA 4DR7F 5CYMA 4PQUA 3KK3A 1PAEX 2FYXA 5KRSA 1ROFA 5DM7Q 1D8YA 3R5AA 1XNRK 3M8RA 1C0GA 3EKSA 5KFUA 1UOCA 5B0CA 3K5NA 4H54A 4DR2K