3KJVA

Hiv-1 reverse transcriptase in complex with dna
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
556
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing the molecular interactions of a nucleotide analog, GS-9148, with HIV-1 reverse transcriptase-DNA complex.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase p66 subunit
total genus 128
structure length 549
sequence length 556
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3kjvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3kjvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3kjvA05
1T94A 4O3QA 1TQLA 3MXIA 4OVLA 1S6QB 1D0EA 3MXJA 4CIFA 4CGGA 4MH8A 4K8XA 1O1WA 2OZMA 4RW8B 2HNYA 4FJKA 1RDRA 5KG0A 5DGAA 3NE6A 4FBTA 3ZSQA 2O4IA 4FJ8A 3TAQA 1D9FA 4CHOA 3I0SB 3NH2A 1BISA 4NCAA 3TI0A 3FFIB 3OYMA 4CJLA 4G1QA 5DQGA 3SFUA 3QIPA 4KO0B 2X74A 3UDLA 4QAGA 3PW7A 1REVA 2WONA 1JLQA 1W25A 3L2RA 4YQWA 4KFBA 4CIGA 1XHXA 4O0JA 5D3GB 4CJ4A 3OYNA 1C2PA 4ELTA 1WNEA 4DF8A 4F50A 4CJQA 3P5JA 3SQ1A 3GILA 4TQRA 1RTDB 1EX4A 1T7PA 1TL3A 4CHPA 2FVCA 4KAZA 4IRCA 3B6PA 4TY8A 2BE2A 3K59A 2OPRA 2W9BA 4R8UA 4CF9A 4CK3A 4RW7A 2GC8A 1B9FA 4DQSA 4MKAA 4DG1A 2Z1GA 3L2WA 4ED3A 4DSIA 3MFIA 2PZSA 3V6DB 4B9TA 1L5UA 4F4KA 5FDLA 1CZ9A 1VSIA 2ITGA 3CDWA 4IFVB 1I3AA 1SH2A 1JL1A 3K58A 2FLPA 2IS3A 3LP3A 3KOAA 4O4GA 3NF9A 5L1JA 5KRTA 4DLGA 1C0TB 4J2EA 5KGWA 4M94A 4DU3A 4YNQA 3SV4A 1NJXA 3KLFA 3QEWA 5FROA 3SUNA 2VWJA 1N4LA 2FVSA 1D9DA 4CFCA 1JXEA 1S10A 1NJZA 4G1QB 3VQ9A 1RTDA 4OKKA 1S1UB 2PYLA 5KI6A 1TAUA 2ZE2B 2RF2A 4Z4GA 4Q45A 4N5SA 1L3VA 4B9VA 4FJMA 5F8NA 4CJUA 3TQ1A 3VA0A 1EETB 5KFJA 3QYYA 3DRRB 1GOBA 2IGIA 2YNHB 3O3GA 4FJHA 1SH3A 4NRTA 3TWHA 1RT7B 3BQ0A 4FZZA 3ZCMA 5KFVA 1JLCA 1UWBA 4EP4A 4GC6A 5HBMA 3JSMA 1U45A 4BACA 1QAJA 1NK8A 2I1RA 4M3YA 2HNDA 2D3ZA 5HROB 3T5HA 3L3UA 3RBEA 3IS9A 2C2EA 4NYNA 1RBVA 2QV6A 1L3UA 4PWDA 1G15A 1RA7A 1WSEA 3OL8A 1L3TA 2X78A 5KG4A 5I42B 2OPSA 4CF8A 3HXMA 5CYQA 1HYZA 1HRHA 4J9RA 3VQ5A 4HUFA 4E7HA 2AX0A 3PR5B 2ILYA 4DS4A 3QINA 1TL1A 5K14A 1HPZB 1Z26A 1S1UA 1A5XA 4TYBA 4B9NA 3V9WA 4GC7A 4CEAA 1JLBB 1IKWA 3KLGB 1X9WA 4ZPAA 1IM4A 1TP7A 2OPQA 2X6NA 3V6HA 1RT3B 5C42A 4ZPDA 4WFYA 3OLAA 4EZ6A 4CK2A 3MTKA 2X6SA 3ZT4A 4CJFA 5HBMB 1LV5A 3BSAA 2WTFA 1EETA 1I6JA 4CJPA 4IDKB 1N6QA 1LWFB 3BDPA 2YKNB 4EYHB 3ZSOA 4Q43A 1WNSA 3Q8PB 3H2LA 1NHUA 1JX4A 3IG1A 1SKSA 3T3FA 1C1BB 3HPGA 2WK4A 2QXFA 3KKSA 1N5YA 5KFQA 4ZVEA 5J2MA 3HVTB 3KLHB 3IS9B 4B3OA 1ZBIA 4WZQA 4FLUA 1BQMA 4PUOB 1QQCA 4E19A 3OYDA 2XWYA 4FLYA 4EO8A 4B9LA 4ZHRB 4ECSA 4NLWA 1IKWB 1W0HA 5I42A 1UOCA 2W42A 4DL2A 3C6TB 3OYKA 4CESA 5EWEA 5J2NB 3H4DA 4FLWA 3G6YA 4Z4EA 4DFJA 5KFFA 5C25B 3KK3A 4AHTA 3N6LA 4DTSA 3ICLA 1S0NA 4NLRA 1HQEA 3ISND 2DPIA 2UUWA 2WOMB 1X1PA 2IM0A 3EZ5A 3LAKA 5D3GA 5DLGA 1CLQA 4LSLB 4CF0A 4KAIA 2GIRA 4YR0A 3HM9A 4KTQA 5KFRA 3CG7A 1KSPA 4EP5A 4ECTA 5F9LA 1S0OA 3IG1B 3OYIA 1HYSB 4FBUA 1C0UB 1S9EB 3QNNA 3RRGA 4DSLA 3FSIA 1QSSA 4QWEA 1YT3A 3PW0A 1BI4B 4M3WA 4U6PA 2D3UA 1BCMA 3OL9A 5KFWA 3CM6A 1J5OB 4CFDA 3D0PA 3RRHA 4CHYA 2XHBA 4LH5A 5FRMA 1J53A 1BCOA 3QLHA 3U3GA 3LALA 4FLXA 1RYRA 3MFHA 3K2PA 4ZP9A 5KFTA 2ZD1A 5KG2A 4JLHA 1RA6A 3AVJA 1HJRA 1S1XA 3QO9A 4EEYA 4CK1A 3OJUA 4DTJA 3M8QA 4FJGA 1F21A 4DL7A 3HPHA 3MECB 2JC1A 4DTRA 2HAIA 3PO4A 2FLLA 2O4GA 3GIMA 3GIJA 3C95A 2XRIA 4MFBB 4Z4HA 3FDSA 3QGGA 2ZE2A 2E9TA 4KHSA 2B43A 5SZTA 1NK7A 1C1CB 2D41A 4Y2CA 2YNIA 1U09A 3KMSA 2XY6A 1DTQA 3M8PB 1KCFA 2IAJA 1JXBA 2ATLA 1RYSA 4H4OA 4J9NA 2P51A 4RNNA 3PZPA 4ZMMA 1NK4A 4QWDA 1RT7A 2Q3SA 1LWCB 3LZIA 2EHGA 4E1MA 1KTQA 3BREA 3JYTA 4FLZA 1UWBB 1TVRB 2R8KA 5DG9A 4F3OA 3TAEA 1RAJA 4TN2A 1Y97A 3ZSYA 2HNDB 4WFZA 4B9UA 4WXWA 4HHTA 2P1JA 1QAIA 3MR3A 3THVA 2HMIA 5EWGA 1RT5A 5KFUA 1VSFA 3M9MB 3D5MA 4EBEA 2HNYB 3QEIA 2V4RA 2R8GA 1K1SA 4QWCA 3KHRA 1CZBA 5KT7A 3AVMA 3SUQA 3DRSA 2IC3A 4IRKA 1T3NA 4YR3A 3DLEB 3NDKA 3OYJA 4KV8B 5KTQA 4ED8A 3LP2B 1S4FA 3MF5A 4DWIA 3P1GA 3SUOA 5J2QA 3DMJB 4E7KA 1RDDA 4CJSA 3GYNA 3OYCA 4ZTJA 2FBTA 4RW4A 3M8PA 3KJVB 2GIQA 3NMAA 2G8KA 1ZYQA 4KHRA 4OKJA 5KFNA 4OPJA 4DTUA 1ZTTA 3M9OB 3S3MA 4TY8B 2E6LA 4OGEA 3VQQA 4CEFA 3HHKA 3I5BA 4KRFA 3Q8SB 1N6QB 2IA6A 1HMVA 4I7FA 5T14A 3NHGA 5DK5A 4WZMA 1QUVA 3DI6A 2BANB 1WAJA 3DRSB 4N56A 3H59A 3EY1A 2PY5A 3QIOA 1S5JA 2BQ3A 3DLEA 4FJ5A 4FLVA 1ZBHA 4TYAA 4MIAA 2XY5A 3KLHA 4EBDA 4GMJB 3IGNA 3Q8QB 4C8LA 4HUGA 2VG6A 2W8KA 3L3VA 2AU0A 4O55A 2W9CB 2AGPA 3LWLA 4LH4A 1YTUA 1A5WA 3AO3A 3AVKA 5J2NA 2B6AB 2FVRA 2HWIA 5KGXA 3TAMA 3VA3A 4GVMA 3DM2A 4ECWA 4FJNA 4CGFA 4WE1B 2RDIA 3I8DA 4NCGB 1HQEB 4ECRA 4RW6A 4FZYA 3HYFA 3MR5A 2Z1HA 2ASJA 1J54A 4NLTA 3RWUA 1KLMB 4BWMA 2YNHA 4Z0UA 5KG5A 3IGVA 5HRRA 3MEGB 4IRDA 3ZSWA 3B6OA 3L2VA 3TR8A 5CYMA 1JLGA 4C8KA 3H4BA 2ZKUA 1T03A 1HMVB 4I7FB 4TY9A 1BGXT 2VWKA 4CF1A 4R5PB 2F96A 3KHHA 3I0SA 4TQSA 1JLAB 4KB1A 3LDSA 3RMDA 4J9SA 2JEIA 1RT4B 2UVRA 4Q8FA 1VSMA 3EPIA 3MXMA 2AGOA 3L2UA 2VA2A 1LW2B 4RUAA 1TKZA 3PX4A 2FVQA 4K4XA 1S1VA 1W9HA 4IH6A 3G10A 5DQHA 5EU7A 3RMCA 3SNNA 1ZTWA 4IQXA 1VRTB 4IOBA 4LQ9A 1UAXA 1HARA 3CQ8A 5HLFA 2V9WA 1SL0A 4KHMA 3RMBA 1ITGA 1VSDA 3HK2A 2HNZA 4F2SA 4I2PA 4KHYA 1R0AB 2YV0X 1TGOA 3UIQA 3AO5A 4DQIA 4J9OA 1IKVA 1QE1B 4ID5A 4WE1A 4F4YA 4DQPA 5HRSA 4I2QA 1SUQA 4FJ7A 4CIEA 3T5KA 1U4BA 4FM0A 4B9SA 5KG3A 3O3HA 4O44B 1NK9A 3I0RB 3V4IB 3IN5A 2IMWP 3JYTB 3H5UA 3ALYA 4CEEA 1QS4A 1MU2B 3KLIA 2QKBA 4DTXA 3VQCA 1IH7A 1A5VA 1JL2A 4DL4A 1S97A 4CE9A 3C6UB 3AV9A 4XPEA 4MKBA 1TKXA 4HUEA 4X2BA 3DRPA 2WRMA 4FM2A 3HP6A 4CEBA 3OS1A 1ASVA 2E6MA 3PV8A 1CXUA 4R5PA 4F4WA 3PW2A 3C6TA 2CJQA 4K8ZA 4M3RA 1GX6A 3KTQA 1C1AA 3F9KA 4E1NA 2EX3A 1S6PA 3LP2A 4KTZA 3T5LA 3MEEB 3ULDA 4KFBB 1TKZB 5J2QB 4FCYA 3HVWA 3OS0A 3Q8RB 4I2QB 3HP9A 3UR0A 3AVHA 1HYVA 4YR2A 4CGHA 4ZVHA 2HHSA 1VRTA 5KG1A 4HVJA 1NK0A 2AJQA 4RW4B 3H5YA 3BQ2A 3OY9A 3KJVA 3O3FA 5HLFB 4YMEA 3HSTB 2IJFA 1DTTB 1VSHA 3WNGA 3T5JA 1XHZA 4B9MA 2D5RA 4DLEA 4O4RA 3CM5A 5KFDA 4O44A 4WYWA 4ZTFA 1HYSA 4H4MA 3KLIB 4CJ3A 1TK5A 2HHXA 4QW9A 1BIZA 3K5OA 1WSJA 1S6QA 3LZJA 2I5JB 4IKFA 3QERA 2B4JA 3UPFA 1VSJA 2OZSA 1RT2A 4DQQA 4NLYA 2IJNA 4QWAA 3KD5E 3MEDB 2XCAA 2VG5A 5FRNA 1NNDA 4RNMA 2ZD1B 4XO0A 3DOLA 1S1XB 1C0TA 3OL7A 2DTUA 3UQSA 1BL3A 3KLFB 1TKXB 3E01A 3GV8B 3VQ6A 1CSJA 4RW9B 3EYZA 3IAYA 5DG7A 1REVB 2WONB 1JIHA 1JLBA 3NAIA 2J6TA 3T1AA 4WYLA 4Z4FA 2W9CA 1SKRA 3DOKA 4J2BA 4IG3A 3KK2B 1S6PB 1DLOA 2J6UA 2YNGB 3S3NA 3DM2B 3GIKA 4E3SA 4NLQA 4KHWA 4K4ZA 1C1CA 1HQUB 1L3SA 4NCGA 3S3OA 3OHAA 3ZT3A 4R8UB 3TVKA 2IAJB 3OYFA 1S49A 3SPYA 3K5LA 4CGJA 4NLUA 3ITHA 1GOCA 1S48A 1QTMA 1KHVA 1FKOB 3DLBA 1KLNA 5CYMB 4EO6A 3CJ5A 4IKAA 3NGDA 3HVTA 4RW8A 2FJWA 2A1SA 3NF6A 4PWDB 1WAFA 3DLKA 4QW8A 3RMAA 1VSLA 3RTVA 1NKBA 4N76A 3BGRA 5KG7A 4IFYA 3DLRA 3WNEA 2PYJA 1IKXA 3I5AA 2Y1IA 4OL8A 3OYHA 4CCHA 3TABA 4N41A 4FK0A 2HB5A 2VG5B 3HKWA 1LW0B 4FJIA 4ED7A 2RDJA 2OPPA 1IKYA 2IOCA 3QGIA 4F2RA 1BQNA 3HVAA 1UA1A 4J2DA 5KFHA 4E7JA 3NH0A 4URQU 1N56A 4DFPA 4KI6A 3OVNA 1S1VB 3RB3A 5C5JA 2EC0A 2KFNA 3PVXA 3T19A 2OPQB 1HNIA 2HHUA 2RPIA 4KTWA 1Z4UA 4CECA 4B8CA 4MK9A 4DSFA 3VQEA 4ZPCA 4DSKA 3H40A 4LSNB 4CGDA 1WLJA 4FJXA 3M9NB 4ECZA 1TK8A 5HRNA 4ED1A 4F3TA 3V9XA 1ZBFA 5JS2A 1LWFA 2FBXA 1EKEA 1LAWA 3WNHA 2G8UA 1D5AA 5KFAA 5F8MA 4JV1A 3PW5A 1FKPB 3AVNA 5HRPA 4JUZA 4KKOB 2DFHA 3NGIA 2P5OA 5J1EA 1XR5A 4NLOA 2XO7A 4F4XA 4CERA 4WFXA 2IM2A 5JXSA 4ED0A 4IR9A 1WSHA 5KFKA 1TL1B 5K14B 3V9ZA 2RN2A 4M3ZA 2C2DA 4K4TA 2IM1A 2F8SA 3QIPB 3OS2A 2R2UA 1IKXB 1JLQB 3GQCA 3OLBA 2W8LA 3MECA 2YHBA 4MQ3A 2R8IA 5E41A 3MAQA 2KTQA 4CF2A 4CEQA 5HP1A 5T7BA 3OSNA 2YNIB 2DFEA 4Y34A 4EBCA 3AVLA 3NH1A 5DGBA 1KRPA 4EZ9A 2HHTA 4FK2A 4OJRA 4UQGA 2UVVA 4OPKA 2YKNA 3V1QA 3QETA 3BSOA 3SCXA 4RUCA 4Z4CA 4CHZA 4Z4IA 3V6DA 2QKKA 1WSFA 1XC9A 4CJ5A 3LAMA 4URSA 1RT1B 1N5YB 4K50A 2W7OA 2I5JA 3CJ3A 2HWHA 2HMIB 3QIDA 4Y1CA 2W9AA 4ZHRA 1RT2B 3ZT2A 4R0EA 4ICLB 4H8KA 1Q9XA 1HNVA 1HPZA 2G8HA 1J9AA 3AA4A 3VQDA 3DYAB 1QHTA 1VSKA 4KO0A 3LANA 1X9SA 1S1WA 2XC9A 2BQRA 2WCXA 4IR1A 3M8QB 3HVRA 4IH7A 3NAEA 4CFBA 4ID1A 3E01B 4KB7A 4RW9A 4Y1DA 3OYGA 5L1KA 2E4LA 3QNOA 3CWJA 3CDUA 4MFBA 2Z1IA 2G8VA 4FJJA 4ELUA 5F8IA 1RT3A 4W5QA 2WB4A 2BE2B 4KI4A 3PW4A 3M8RA 4C8OA 1U04A 2W9BB 3LP0A 3FQLA 4RW7B 4BDPA 4NLSA 1C0UA 1S9EA 2D0BA 1GOAA 3JSMB 5EUHA 1RT1A 1WSIA 2OYQA 1UA0A 2W7PA 3CFRA 4JV2A 4DU1A 2E9RX 4K4VA 3OSPA 1SH0A 4ZVFA 1RILA 1S1TA 1Q9YA 5F9NA 4ICLA 3RAQA 1TKDA 4ED2A 4ZP8A 4B3OB 4PUOA 3NL0A 3ZSZA 2FBVA 4XPCA 1JKHA 4O3NA 4QWBA 2A1RA 4M3TA 3QO9B 4KHNA 3H08A 5CY4A 4BE2A 2GUIA 4IFYB 4KB0A 4FJLA 4KBIA 2IC3B 4DSEA 3BJYA 4PA1A 3KLGA 1RTHA 2YNFB 4KV8A 1HNVB 2DFFA 3RB6A 3OL6A 4OKEA 1IKYB 4DTOA 1KVCA 4RNOA 3CYMA 1S1WB 2ATQA 4DMNA 2GV9A 5KFEA 4M42A 4CEZA 2DPJA 4ECXA 1NHVA 5C24A 4QPXA 5F8HA 2OPRB 4RW6B 3PX0A 2XI3A 3CFPA 5EDWA 4JRQA 4IDKA 3H5XA 3QZ7A 1I39A 1S9GA 4BE0A 1C0MA 3ZSVA 4O3PA 3SPZA 2XGQA 3VQPA 1C6VA 1BI4A 4ZVGA 4GW6A 1C1BA 3HL8A 5KFSA 3SQ2A 4BDZA 4ECVA 5J2MB 3TARA 5J2PB 1J5OA 2C28A 2XY8A 1BQMB 4FLTA 3DI6B 3PY8A 2Y1JA 4CJEA 1XR6A 4MIBA 2BDPA 3SFGA 3AVCA 1D8YA 2RKIA 3H98A 1RTHB 2YNFA 4HKQA 4EYIB 4K4WA 4KSEB 3KHLA 1RBUA 5KFOA 1K1QA 3MR6A 3CJ4A 4FW2A 4CJVA 2KQ2A 3LPTA 3NFAA 4FK4A 3PJXA 4CFAA 4CJKA 2D7SA 4DFKA 2C2RA 3VQ7A 4KHUA 4NLXA 3AO2A 4M3UA 5KT6A 4RU9A 4HYKA 2B6AA 3LPUA 1XWLA 2XGPA 3N6NA 3AVAA 2HW3A 3SQ4A 3TAMB 4CHQA 4NLVA 4CEDA 4DTMA 3SV3A 3DDKA 4E89A 1R0AA 4M45A 1RDBA 4HCBA 2HVIA 1JXLA 4NYFA 5C24B 3PJWA 3QEXA 1KFSA 2BGGA 3DLGB 1RTIA 3K57A 3AVFA 3CDEA 2LSNA 4DSJA 3PR4A 2G8IA 2YKMA 4DF4A 3KD1E 2ZQBA 3V9UA 1LAVA 3QLHB 4W5TA 5KT3A 4IBNA 4ECYA 5EWFA 5CYQB 3V6KA 4O3RA 4Q8EA 1T03B 1T05B 1B92A 3TAFA 1SV5B 1YVFA 5KT5A 3OYBA 2KZZA 4AHUA 3DRPB 5CZ1A 1GX5A 3KLEA 5KFIA 5I3UB 2JC0A 5L9XA 2BQUA 4F8RA 3ZSXA 4Y2AA 2D0AA 4NYZA 1OS5A 3DMJA 2G8WA 3MEEA 4KREA 2WOMA 3ASMA 3SZ2A 1TK0A 4DL6A 4M41A 4AH9A 4LSLA 2V0NA 3TANA 1Z25A 2HNZB 1B9DA 5SWMA 1X9MA 1XI1A 1RTIB 4BDYA 2IM3A 1RTJB 5JUMA 4JS4A 1DTTA 4K4YA 3N6MA 4HCCA 3D28A 3ZT1A 4DEZA 3V81A 2B5JB 3CJ0A 3V1RA 3BR9A 2R2RA 3IRXA 2KZMA 2CKWA 2GBZA 4E7LA 2FLNA 3PHEA 1SV5A 3TAPA 3I0RA 3V4IA 3GIIA 2UVWA 1LWEB 3KK1A 1RT5B 4B08A 3CO9A 2BANA 1NKCA 3L2QA 2V4QA 1IG9A 3VN5A 1NKEA 1QSYA 1JLEB 3MEDA 4J2AA 4DQRA 5KFGA 5DQIA 4ECUA 1K6YA 1JKHB 2R8HA 4ELVA 4Q0BA 3O4QA 5DLFA 5KFPA 2NUBA 3VQSA 5C25A 3KK3B 4RZRA 2R8JA 4AHRA 2JLEA 4Q5VA 3PO5A 3QZ8A 1TV6A 3QEVA 2O5DA 3LP1B 1Q8IA 2JEGA 3NKYA 1NJYA 1VK0A 3CFOA 3M8SA 2WHOA 3MR2A 4F4ZA 4DL5A 3ZSRA 3V81B 1DLOB 2P5GA 4TLRA 2OH2A 3AVBA 1N48A 1RNHA 4DU4A 1ASWA 2AWZA 2YHAA 3G6XA 4KE5A 3NAHA 4DG1B 4CJTA 5KFCA 4O3OA 4KPYA 3V1OA 1WN7A 4HTUA 1LWEA 2C22A 3U3YA 4I9LA 1TVRA 1ASUA 1RCHA 1KHWA 4OLAA 5KT2A 4NZ0A 5L1IA 4OLBA 5F8JA 2UUTA 1SKWA 1JLEA 1RDAA 2FJVA 2R2SA 1NOYA 4NCBA 1D1UA 4WXOA 3EPGA 5J2PA 4K4SA 2XCPA 3D45A 4AHCA 3DLHA 2VA3A 3BGRB 1JLAA 2J6SA 3SUPA 1ZETA 3C94A 2RKIB 4J9PA 3AVGA 3DOLB 4FVMA 1KVAA 1RT6A 3AVIA 4DTPA 2KFZA 4FJ9A 2XY7A 2RF2B 4M3XA 1S0MA 2D0CA 3KKRA 4OGCA 3KIOA 3OYLA 3DOKB 2VG7B 3DRRA 3LP1A 3AA2A 2IBKA 2BR0A 4QCLA 4MK7A 1CXQA 4LD0A 3OYEA 1DTQB 1VRUB 3KNAA 3PX6A 1T8EA 3E51A 1U48A 4H4OB 4E0DA 1KFDA 2BRKA 3KHGA 1SUQB 3RAXA 1FK9A 1TKTB 2R7YA 3K5NA 5HROA 4DL3A 3BSNA 2FVPA 4J9LA 3OYAA 4NLDA 4E7IA 5CZ2A 3ITHB 4TSXA 1BIUA 3A2FA 3NBPA 2HHWA 2OPSB 3WNFA 3HT3A 3FRZA 1FKOA 5KFZA 5DG8A 4RNHA 3RBDA 1U49A 3V9SA 1ZBLA 3DLKB 5KFYA 1RT6B 4YFUA 3C6UA 5KRSA 1RT4A 2F8EX 4NLGA 3SI8A 2ALZA 4ZP6A 1VSEA 3QESA 4O3SA 4CEOA 4B8AB 4J9KA 3KLEB 3U6FA 1NK6A 5I3UA 2ETJA 2E9ZA 1VRUA 1TL3B 3CIZA 3EZUA 5C42B 4AHSA 4AHVA 3FQKA 4J9MA 4FYDA 4M95A 3OJSA 3LWMA 4O5BA 4I2PB 2KW4A 1FXXA 4ZP7A 4DFMA 3KLVA 2JEJA 4FS2A 4L8RB 3SJJA 4QOZB 2HHVA 3ISNC 2AQ4A 2F8TA 2FC0A 3AA5X 3HPOA 4J9QA 1RBRA 4FM1A 2G8FA 2IDOA 3NBPB 3I5CA 4H54A 4AILC 3BQ1A 4ECQA 3NF7A 2B5JA 3SI6A 1FK9B 1TKTA 1KVBA 4I9QA 1U47A 4C8MA 5KFMA 4IFVA 3IRXB 2BRLA 1NK5A 2ASLA 3HJFA 4LQ3A 5KFLA 1JLFA 3O4NA 1FKPA 4O4GB 2AX1A 4URGA 3HO1A 3CJ2A 3G6VA 1BHLA 4CJRA 3KK1B 4W5RA 2QE5A 5J1EB 3BSCA 1S9FA 4U7CA 4IH5A 1RDCA 2R2TA 1LW0A 2JEFA 2FJXA 1ZBUA 2OPPB 1LW2A 4G3IA 1YVUA 4Q0BB 4O0IA 1EP4B 3G86A 4FS1A 4W5OA 2Z1JA 1RBTA 1TV6B 4DTNA 4Y3CA 3PUFA 3H5SA 4RNFA 1XR7A 3K5MA 4IG3B 4KHQA 3KK2A 2XI2A 4N47A 5KFXA 1RBSA 4IG0A 4RG8A 2HHQA 3ZT0A 1KLMA 1JLCB 5DMRA 2DY4A 4CJWA 4LSNA 4ED6A 1HQUA 2OA8A 3MEGA 2QK9A 4CHNA 3P83D 3OHBA 3VQ8A 5F8LA 4W5NA 5KT4A 3NGYA 1IO2A 4Q44A 4TXSA 3DLGA 3KMQA 1JLGB 4NLPA 3RB0A 4JS5A 3L8BA 3QGHA 4FZXC 4BWJA 1MU2A 3SQ0A 3VQAA 2YKMB 4PQUA 4KKOA 4ZPBA 4JV0A 4NRUA 2FBYA 3NF8A 1S1TB 4BE1A 1YTAA 1QSLA 3RR8A 1NJWA 3G0ZA 1SL2A 5L1LA 1T05A 4MK8A 1JLFB 3AO1A 3NCIA 3QEPA 3NGZA 4JRPA 2VG6B 1EP4A 2UVUA 5F8GA 3SYZA 1EXQA 3TAGA 2JGUA 3S9HA 1TAQA 4FW1A 3DYAA 4XIUA 3F73A 3GV7B 1WSGA 3FFIA 4LY7A 1BQNB 4CGIA 3GV5B 2ASDA 4IG0B 3AA3A 1SL1A 5KG6A 3VQBA 4K4UA 2AGQA 2ILZA 2HVHA 2YNGA 1HNIB 4YP3A 5HP1B 2VG7A 4ID5B 1QE1A 1IKVB 3RR7A 5JS1A 3CVKA 4PY5A 1MMLA 4FXDA 1RTJA 4C8NA 3LP0B 1LWCA 5KFBA 1NOZA 3VQ4A 3V6JA 5FDLB 4H4MB 3RB4A 1S9GB 3AO4A 4PQUB 4DS5A
chains in the Genus database with same CATH superfamily
1AFJA 4O3QA 1TQLA 2H5JB 3HHDA 3MXJA 4X65F 2F3JA 4FZVA 4ED5A 4MH8A 1RDUA 2YX1A 3O9TA 3U4LA 3S7RA 4OYIA 4FJKA 2BOAA 2JSXA 1TUUA 1RBOB 1VQNS 2AZ3A 2O4IA 2E2QA 4CHOA 2P2CB 3TI0A 3FFIB 2ZH3A 2O8CA 4G1QA 1Y3JA 3ENAA 2CPEA 4KO0B 4PG4A 2K8GA 1JLQA 4PKIA 4FWNA 1W25A 5SUHA 1T9VA 3TJAA 3CCES 2B4PA 4CJ4A 5AZJA 3OYNA 1ILYA 2VFUA 4X62F 1TL7B 1FDBA 3BF1A 1O5JA 4N8OA 3GILA 1RTDB 3ENOA 1TL3A 4JI4J 5CH7B 3PIPQ 3CSKA 3HD2A 2BE2A 1RFQA 4HDHA 4K25A 1TMJA 4WFNQ 4CK3A 3W65A 1M5KC 4MKAA 1PKUA 5HQLA 4CZIA 2PMZD 1U2VA 2Z1GA 2RIJA 3N01A 4FOEA 1Y00A 3RBZA 1RTZA 5E0OA 4B9TA 5E3RA 3OXFA 2IIHA 3HFKA 3BZKA 3BUZB 5L8RC 2A0FB 1VSIA 1KVIA 3R6MA 3UCGA 1SQEA 1SH2A 3DDNA 2E7WA 3HTVA 3ZNUA 2IS3A 3AARA 5KRTA 1C0TB 4J2EA 4ZOSA 5FD1A 1NJXA 1WOOA 3KUGA 3KZBA 2B4UA 3QDKA 2L9NA 4QZVB 1N4LA 4CFCA 2L41A 1Q4RA 1NJZA 4OZLA 3M6UA 3VQ9A 3GIRA 4H5TA 5KI6A 2RF2A 2NZCA 2CPFA 3W9JA 5F8NA 2MQOA 5DM6L 2HRUA 3CIMA 1YAGA 3DRRB 2FZCB 2GELA 2KLAA 1FEEA 3O3GA 3TWHA 2IDLA 2GVDB 3MZIA 5KFVA 3VTIA 4EP4A 3DFEA 4Q2LA 1N0VC 5HBMA 4OIXA 2AYMA 4Z94A 1HR0J 1WORA 4M3YA 4NLBA 2HNDA 2JL9A 3L95X 5HMZA 1NBEB 2DNZA 1NU0A 2HGLA 2C2EA 2Z2LA 4NYNA 1RBVA 2F7VA 3CJSA 1VQON 1BD6A 1G15A 1WSEA 2GHPA 5KG4A 4CF8A 2ASOA 1SS6A 4AQYK 3C0BA 4E7HA 4WFBQ 2MDAA 4MJKA 2CGJA 3MCAB 3PR5B 4M5GA 1WEZA 1Z26A 3NXZA 2QMWA 4B9NA 1M1KO 4RPFA 4CEAA 1FWPA 2HHHF 3BGUA 4CYUB 2A3ZA 2OPQA 3PJ9A 4YHHF 4K7QA 1RT3B 3E2EA 4EZ6A 4HR2A 2X6SA 4PKDB 2CDQA 3ADAC 1X5PA 3FCHA 4USHA 2W24A 3B8AX 3CCLN 1NDCA 1R8BA 2AJ0A 4EYHB 4FDFA 1YJWS 1VBZA 3H2LA 1UWAA 1JX4A 3K0SA 2O8BB 3ILJA 4I6YA 2R4FA 1JMTA 3HHNB 3VGTA 1I94J 1N5YA 5KFQA 1RHKB 4FVCA 2MYFA 2E66A 1BQMA 2EBEA 1QQCA 4E19A 1OPZA 3D1OA 3HI0A 4LR7A 4EO8A 2K7KA 3A5MC 1MA9B 1Y5NB 5I42A 4DXLA 3MAAA 4DL2A 4CZCA 3C6TB 3M1VA 3BGOP 3RGIA 4FLWA 2Q66A 4Z4EA 1CPZA 4RWXA 3ICLA 4H5NA 1RCXB 2HQDA 3P5TL 1XMQK 4NLRA 4NEYA 2UUWA 3JTNA 3EZ5A 1AA1B 3LAKA 2FHJA 3WC2A 3CJ9A 3HM9A 3NOGA 1XJWB 3R5AA 5KPTA 5HANA 3MOJB 1HYSB 1XIQA 1C0UB 1S9EB 2ABYA 3D0IE 2C2NA 3HULA 3RRGA 4DSLA 4LFBF 1I51B 3EN9A 4JV5K 4B9QA 1RACB 2F65A 4LIWA 1BCMA 4NL5A 3CM6A 5GIPA 3RRHA 5D78A 1BCOA 4FLXA 2H65B 1RYRA 3W63A 4X4VA 4K59A 1PYTA 4ZP9A 3C7NA 3FCWA 2ZH5A 4OI2A 4DTJA 3B82A 2CPZA 3EGWB 5IT0A 2E1YA 2G1DA 4NA2A 1NXIA 1U8SA 4M5MA 4DL7A 3MECB 1VQ4S 4JD2A 2CZ9A 2O4GA 2BE7D 4MFBB 1AZSA 1HBMA 4Z4HA 3FDSA 3QGGA 4ZCIA 4WQ4C 2HQIA 5M1KA 3M8YA 1RLCL 2KHCA 1O6XA 3A8IA 2IAJA 4E8UA 3TUZC 3H3NO 2P51A 4QWDA 3HZ6A 4W4MA 1RUSA 1LWCB 3P96A 3BREA 3JYTA 1ZBSA 4FLZA 3T6JA 1TVRB 2HBYB 3CCSN 4C48A 4K5SA 4Y00A 3TAEA 1U26A 4WFZA 4B9UA 4BC9A 3MR3A 2HMIA 5EWGA 5GAHP 1UEUA 1VSFA 4EBEA 4LIRA 1F2GA 3EEQA 3QPIA 3HZGA 2GHWA 3MUTP 2GX9A 3SUQA 4JI6F 2B7BB 3UVJA 1RSCA 5KPZA 2IC3A 4IRKA 4PWWA 1VISA 4DWIA 2DNKA 4QS7A 3CDBA 3P1GA 5FLXO 5J2QA 2HBRB 4F04B 3OYCA 4OLPA 2FBTA 1RAGB 2OTJN 3JSRA 2VBXA 2C3UA 5KFNA 4OPJA 1IBLK 3GOIA 4DTUA 2V63A 4OYZA 5KQ8A 1VDHA 3M9OB 2C1EB 4OI6A 4P10A 3HHKA 3I5BA 2GFFA 6FDRA 5E3CA 1N6QB 1V5IB 1U6FA 4M7YA 3NHGA 3P4UB 2DVIA 1DQ8A 1G6BA 5DK5A 1QUVA 3DI6A 1KONA 3GE9A 4N56A 2ROPA 5MAOA 4WTYA 1R8HA 4CNZA 3J7ZO 1S5JA 7AT1B 4JI6K 3DLEA 4NXMK 3FLCO 2DBBA 1RI7A 4DUYJ 3KLHA 1BC6A 3IGNA 2L3MA 3AXKA 3IMQJ 4I1TA 2O8DB 2F5GA 3WZ0A 2C2KB 2VZ9A 4Q2MA 1NSKL 2N3LA 3O1LA 1YBAA 3AO3A 4ZVSB 3O6WA 3GYGA 3FC9A 5CHCB 2FVRA 4A59A 5KGXA 1UCNA 4CLWA 4GVMA 3W2VB 1BLUA 4PG5A 2IVNA 3BS9A 1HQEB 4FZYA 4RW6A 1BA1A 3VAIA 4DR2K 3VAFA 3MR5A 3PSFA 1J54A 1WSVA 1Q86T 2XMKA 5KG5A 4K2XA 3V2UC 1TUYA 5JLFA 1NPKA 1VQ9S 3ZSWA 2CPHA 2FJAB 1WHWA 3A4TA 5CYMA 4ANDA 1ZAVA 3O5BA 1JLGA 3TR5A 3AD8C 4M5NA 2QSWA 1IXKA 2FZKB 3KJNB 3VAJA 1PC5A 4IUFA 5DDRC 1BGXT 2VWKA 2OELA 1Q81T 3RMDA 4DV4J 2FSNA 1QAXA 4AT1B 1VSMA 1P27B 2HZVA 3M6VA 3L2UA 2VA2A 1TKZA 3F5TA 3NNAA 1NHKL 3G10A 4B3MJ 4LFCK 4IQXA 4A5BA 3VOVA 1SL0A 3L7PA 1NGBA 5B0EA 4F2SA 3PKMA 4I2PA 1KOHA 1VQ6N 1ATSA 2YV0X 2UXDK 3D6TB 4DR3K 4BS2A 1L3KA 4FWRA 4PYAA 1IKVA 4ID5A 2FJEB 5E26A 4F4YA 4DQPA 4KGZB 4MKYA 5HRSA 4I2QA 3AJ1A 3JSBA 3TSUA 4FJ7A 4JI8J 4CIEA 3T5KA 3MUVP 1HQ2A 1EQ0A 3O3HA 3PYDA 2EFVA 4O44B 3I0RB 4A61A 1S7HA 1MU2B 4AD6A 3E9OA 2GO8A 3E9LA 1GQEA 1A5VA 3MMVA 5DM7Q 1S97A 1CG2A 3UB5A 1K0TA 3AV9A 1U1OA 3QSYB 4XPEA 1M0SA 4X2BA 4YOTA 4QPTA 1JCEA 3PV8A 2HGNA 1FWLA 3MAAB 3SAGA 2KYZA 4F4WA 2QA2A 2CJQA 1NDLA 4K8ZA 1GX6A 2DYAA 3VAKA 3KTQA 1X4EA 4Y0FA 4J91A 2B8QA 2MKIA 3MEEB 3ULDA 2GJFA 3T9NA 3HVWA 4DR3F 2NRZA 3HP9A 1FXRA 1VRTA 4CZLA 5AQJA 3KJVA 4U7UK 3O3FA 5HLFB 2VJVA 2H3EB 3HSTB 4USVA 2J0XA 4C0HA 4O23A 4B9MA 1I3OB 1XNQF 2D5RA 5KFDA 5AFUH 3EGNA 3ILIA 3DDIA 3CD7A 1HYSA 1IBKF 1UP1A 4GV3A 1U1NA 3KLIB 1ZPWX 1R0BG 3MD1A 2BACA 2LXFA 3LZJA 1CJKA 5F3TA 3P6YC 2I5JB 4IKFA 4I68A 4UTGA 1KD1O 2HAFA 2B4JA 3HOTA 1RT2A 2BVZA 3KD5E 2Q1LA 4YS2A 2QMXA 4RNMA 3EDRB 2XSFA 2G0CA 3HSCA 2EG2A 1HD1A 2LU1A 1VFJA 3ZX3A 1BL3A 1HNWF 5DG7A 1JIHA 2F7TA 1VGYA 2VONA 4WYLA 2W9CA 1SKRA 1FRJA 1BUXA 4IG3A 2BUNA 2U2FA 5H9FJ 4GKKF 2D4WA 1M1KT 1O0PA 5AFUA 4DR7J 1Q7LB 1DLOA 2YNGB 4V19S 3GIKA 2MKHA 3GWCA 4KHWA 4K4ZA 4NCGA 2QZ8A 3A8JA 4R8UB 3TEGA 3TVKA 5E3PA 4EMDA 3J81O 2J0QD 3QFWA 3SPYA 3K5LA 1S5ZA 1GOCA 1S48A 3EDQB 1QTMA 1ZH5A 3NGDA 4RW8A 4RUBA 3NF6A 4PWDB 1WAFA 3DLKA 3WQTA 3RTVA 1UFKA 1OH7A 2F9TA 4WCEL 2PYJA 4CCHA 1FTCA 3OYHA 3TABA 2NCKL 2DITA 4DR6K 4ED7A 1T9YA 2GQ2A 2VGNA 3NMUA 3C14A 1PJ7A 2VC1A 2ATCB 3TW0A 3BZQA 2BW2A 1DT9A 1S1VB 2YX4A 5C5JA 3LGMA 2KFNA 2B3TB 2HHUA 1LK7A 4KTWA 1Z4UA 4CECA 4DSFA 2YWHA 4LSNB 2NRRA 4FJXA 2F4VF 1YJ9S 1V6HA 4ECZA 3G96A 2EFPA 1TK8A 1WF0A 2HQFA 2J8AA 2A41A 4CLFA 1B3TA 5DZ7A 3UKRA 2HURA 2KO1A 2DNRA 3SK3A 1E3MA 2C3OA 5LL6Z 1ESVA 1FKPB 2DXFA 1HW8A 4JUZA 3NGIA 3WBZA 2HSTA 3KWMA 3DLJA 4CERA 2MY7A 5JXSA 2GAGC 4ED0A 2RDDA 4DR6F 1TL1B 4LR8A 3V9ZA 2F8SA 3QIPB 1WD6A 3OS2A 1NGCA 2R2UA 4DR5K 3AA9A 2R9LA 1VIOA 3GQCA 3PIPL 3KG1A 4MQ3A 2V68A 3Q24A 5E41A 4YOVA 1KQSM 4KGMA 2KTQA 3A0IX 3VEYA 4ZJLA 3CCUS 2BV3A 4U7BA 5T7BA 3OSNA 2MKCA 2DFEA 3E9PA 4PXDA 1DZ5A 3UKRB 3ZETA 1KRPA 3NH1A 5DGBA 3FBFA 2MHNA 5DM6Q 4X62J 1OSCA 4OPKA 3V1QA 3QNWB 4M63C 3NGSA 4OI0A 4CHZA 2P9PA 1YRUA 3BGLA 4I4BA 3QT5A 3MGJA 5GAGI 1R3NA 4E1JA 3LDPA 2GV1A 5B0BA 1OQ6A 3CJ3A 2HWHA 3O6QA 4ZHRA 2VPWB 3TUPA 1XMOJ 2YWKA 4R0EA 1QLNA 2VYPA 4ICLB 3N0VA 1Q9XA 1J9AA 3AA4A 3VTHA 2EG1A 1VSKA 2MHEA 5D4OA 1X9SA 3M8QB 2MKKA 4WFBL 3NAEA 4CFBA 1H3DA 2GIFA 5AQSA 1URRA 4Y1DA 1K73O 3CC2S 1EQMA 4PKGA 2HFZA 3NLCA 4ZVQB 2Z1IA 4FJJA 2YX6A 4W5QA 2CGKA 2WB4A 3Q8VA 1TYQB 2BE2B 4KI4A 1OY6A 1Q79A 2FSJA 1U7LA 1FDDA 2W9BB 3FQLA 4BDPA 2P9PB 1S57A 3MMCA 1HBUB 3IFEA 3DOMA 3TEHB 1GOAA 3JSMB 1N0UA 1WSIA 1CULA 2YJFA 5M1NA 1UA0A 4HI1A 3CFRA 4JI7F 2HLTA 2E9RX 1Q95G 1RILA 1XQIA 1Q9YA 4ICLA 4JV5J 2HFSA 1SJRA 4PUOA 1XC3A 3NL0A 3GR0A 1ACMB 2DD8S 4J5OA 2WSFC 3F41A 1Y64A 4KHNA 4A47A 4JI7J 5CY4A 2O8DA 2HVEA 3GJSB 4NYOA 2OD6A 5GAHU 1Q8LA 4DB3A 2VF3A 1HNVB 4TU7A 1EAYC 1WG4A 3NMRA 3RB6A 3L0QA 1WG1A 1XMQJ 1YHQS 3BBBA 1IKYB 3TZWA 1KVCA 1S0VA 4OKEA 4FNIA 4H0YB 2IY5B 2GV9A 1BQXA 4M1KA 3D4JA 2N4DA 3PXGa 3MMCB 2CG8A 2HSEB 1HWJA 3PX0A 1RWXB 2HK2A 4X4SA 1KAYA 4IDKA 4CO4A 1I39A 2WVFA 1C0MA 4O3PA 1K8KA 3HT0A 3T69A 1BI4A 4ZVGA 1GLLO 1C1BA 3T1YF 1SVDA 1C0GA 1CLFA 3O9SA 4BDZA 3LGHA 4ECVA 3M05A 3THWB 1B0VA 2F4FA 5B0CA 1NGJA 4JI2K 5L38A 3VGLA 1MWMA 4OJGA 4BVOA 3PY8A 3MTJA 1XR6A 4OYAA 3SFGA 3AVCA 2MKYA 4BG8A 4HKQA 3OR1A 4EYIB 1G4CA 4KSEB 3KHLA 1RBUA 4ETZA 4DR1J 1S99A 2IRUA 2PC6A 2IVOA 2ZH8A 1B7YB 1NM2A 3PJXA 4BRCA 4CJKA 1MNEA 4USKA 2JFDA 4M5DA 4NLXA 1FJ7A 5KT6A 2B6AA 3TSQA 3TAMB 4BC2A 1DEJA 4NLVA 1DGKN 3IR6B 4CEDA 2A6OA 4LF7K 4XH5A 3CE8A 3CNQP 3CCRN 3DDKA 4E89A 5B09A 3NGTA 1NSAA 1GMVA 2VBZA 5AQVA 3E66A 3J7YU 1KFSA 1N33F 3DLGB 3CMEN 1HNWK 2YKMA 1SZ2A 3QMLA 1VQ6S 5AQFA 1QVGR 4QIVA 3QLHB 1UJ4A 1VQ8N 3V6KA 2M88A 4O3RA 5KT5A 3PFOA 5K8PA 1K8AO 4AHUA 3P49B 4C8ZA 3UD5A 2ERRA 2XHWA 1EQYA 1J5EK 1DQ9A 2K3KA 4JKEA 1CJVB 1E4FT 2G2ZA 2FJBB 5KFIA 1V9OA 3P31A 4CT9A 5ETPA 1SQFA 4LFBJ 2IVMA 1FI4A 4Y2AA 4I6MB 3D3CJ 3D0HE 2P9LB 3N79A 3R5CA 4AE5A 3SZ2A 1Q82O 4M41A 4LSLA 4KT0C 2V0NA 3E8OA 3I9V9 4P74A 3GE1A 4CZGA 2GVDA 1HKCA 3M32B 5F3ZA 1RTJB 1YSJA 3U02A 3FGUA 4K4YA 4HCCA 4WP8A 4DEZA 2ZDOA 2ZZNA 2RRBA 3BR9A 4PXCA 4Y28C 2CKWA 1WC6A 3JS9A 4LF5K 3MOZA 1YJRA 5GMKa 4A8OA 3DHXA 1CJKB 4RL1A 3KK1A 4B08A 4C11B 1NKCA 1EKRA 2V4QA 2KXFA 1Q7YT 3UW1A 4MAKA 5A8KA 3VEWA 4JOUA 4J2AA 3TJ9A 1WHVA 1K6YA 1JKHB 1X4CA 4LR9A 5T7LB 4ILMA 3SLCA 1TU0B 2NUBA 2R7UA 2A3JA 2JLEA 3KG4A 2BJ8A 4QS8A 1Q8IA 3LP1B 5DDOC 4UY8T 1KQSR 1MN7A 3NKYA 1NJYA 2DXEA 3W61A 3DJCA 5K8MA 3A1YG 1I1GA 4HT5A 4BRPA 2VB6A 3N4QA 3MN6A 4DR4K 3CF5L 1XMOF 2OH2A 3G6XA 2F8HA 4DG1B 5KFCA 3CJ8A 4H5RA 3PYGA 3R5BA 1WN7A 3C6AA 1G2EA 1EIYB 1B70B 1AB8A 3KG0A 4HTUA 2XS7A 3Q7BA 3U3YA 1ASUA 4BRDA 2UUTA 2RHQB 1XTZA 4GNIA 2FJVA 4BHQA 1NM1A 2UU9K 1NOYA 1D1UA 4LRFA 5L46A 5J2PA 4K4SA 4LC9B 2XCPA 2XSJA 2FD2A 5LMNK 2XS2A 3D45A 3CB4A 4XK8C 3DLHA 4AHCA 3TZYA 2VA3A 1AXQA 2BXJA 4J7CA 3SUPA 1WEXA 3EE8A 3DOLB 4FVMA 1RT6A 4G9ZA 4B1ZA 4C4WA 4DTPA 1R8AA 4FJ9A 5EGYA 1S0MA 1EWRA 1AZSB 2X1FA 1GTEA 3E1YA 3KKRA 2LQ5A 1ZXOA 2HBZB 2VG7B 3QAEA 3AA2A 2IBKA 2BR0A 4NX9A 4AQYF 4B3TJ 1N8RT 4Y2KA 4X4RA 3KNAA 1BXNA 3AOAA 4LJMA 1T8EA 3E51A 4H4OB 3FBEA 4KJIA 4E0DA 1NEEA 1SUQB 3GYXB 1TKTB 2XHCA 4OHVA 3K5NA 4IWVA 1HFEL 4FF3A 5HROA 3BSNA 2VPZB 1IJEB 2FVPA 4K0KF 4KRWA 3EJMA 4YDUA 3W64A 3CULA 4P73A 3O9RA 5CZ2A 5BPNA 1DRZA 4YHHK 2HHWA 4YEAA 2A10A 1WI8A 2V9KA 4UOCA 4ES1A 4JI3J 3GFYA 2CVEA 1RT6B 4CZKA 4DX7A 2H1YA 3HHLD 4DUTA 5IC4B 3AHPA 4NLGA 4FWSA 2KM8C 3SI8A 3FBCA 3I33A 1ZM3A 3FCVA 4ZP6A 1JNRB 3QESA 4GO7X 3KFWX 4X66F 4NA1A 5F0WA 1NO8A 4B8AB 1LCUA 4J9KA 3U6FA 5I3UA 2QWLA 2E9ZA 3BYRA 1VRUA 4GVBA 5CD4H 3EZUA 4JI7K 2E2NA 5C42B 2P9UA 4AHSA 1CJTB 1GLEG 4J9MA 4FYDA 4M95A 3LWMA 4O5BA 5LSRA 2KW4A 3ULEB 4X65K 2HBQB 2JEJA 2PI4A 3CERA 2JVOA 4QOZB 3BEGB 3TWZA 3F0NA 1GLJO 2DGTA 4CD1A 2V2KA 4DHYA 2G8FA 2I6WA 3D2EB 3BQ1A 2XB2D 5IQ6A 4ERDA 4B3TF 1FK9B 4OYPA 2V5HG 2KU7A 3IRXB 2EK1A 2MJNA 4OO1J 4RLEA 2PA8D 4JKBA 1HR0K 2FB0A 3CJ7A 3DCAA 3CCJN 3QWUA 1JLFA 4O4GB 5A8WA 1FRKA 4NOHA 3G6VA 1BHLA 1F2HA 1S9FA 1UEVA 4ZK7M 3ZO7A 1XUPO 4Z37A 1RDCA 2R2TA 2YKAA 3ET6B 4CM2A 3H7HB 2OPPB 2NPIA 4G3IA 4Q0BB 2FDNA 5D0EA 3G86A 3GTYX 2Y8YA 4RNFA 1XR7A 2XI2A 1YRXA 4CH1A 4N47A 2NZTA 4RG8A 1MMNA 1VAZA 3EWGA 1RZMA 2OA8A 1BWFO 2QK9A 4CHNA 2FGOA 1K73T 1F5AA 2IHR1 2HBJA 2RNEA 1YJVA 4CWBA 4KC5A 3NGYA 4TXSA 3KMQA 1JLGB 4A62A 1WOQA 3L8BA 2MSTA 3QGHA 3ZZUA 1X4DA 4FZXC 1MU2A 3MN5A 3SQ0A 3U1NA 3AB2B 4ZPBA 4JV0A 1VQ5S 2DHGA 1SL2A 1UZHA 2RD5C 4X64J 1TZ0A 5C2CA 2CWKA 8RUCA 2XLKA 3FKBA 3DYAA 2XNQA 4BR2A 4WBFA 3B8HA 3BO4A 2Q6BA 3GV5B 3W2VA 3D1HA 1T6CA 2QRRA 3VQBA 3ZYYX 2CQ3A 4ES2A 4U96A 2AGQA 2V8HA 2ZH2A 5HP1B 4ID5B 1IKVB 3RR7A 3K8WA 1GT8A 3ZZTA 1VQ5N 3CCEN 3WUHA 1TL5A 5JS1A 3OTDA 4L72B 1LEOA 3LP0B 5FDLB 2XMJA 1N36F 3THXA 2DO4A 3MXIA 3OR2A 1D0EA 3J7Z5 2VIHA 3W9HA 2HHHK 4K8XA 5E5NA 2OEKA 4B02A 5DGAA 1P1LA 4F4AA 2W2QP 4FJ8A 2ZUAA 1BISA 4XEIA 4NCAA 4DPTA 5AJ3F 2QWQA 3ZFVA 1R0CB 1N32J 3UWTA 1HKBA 4I6WA 1IR0A 2X7IA 3QT7A 4B3MF 1I94F 2GTDA 3M2VA 2Q79A 2YWEA 1C2PA 1V3SA 3RYLA 1WNEA 4ELTA 3T6BA 4F50A 3OBWA 4TQRA 1T7PA 1EX4A 2WBMA 3JQKA 2FVCA 4CM0A 2D74B 2KHOA 4NO7A 4P2FA 2OPRA 1PBUA 3THXB 1KQGB 1OYDA 4R8UA 3ENVA 4KHPF 4FWPA 3ID8A 4WK1A 1GLAG 4DG1A 4CDIA 2X1AA 4ED3A 3MFIA 3V6DB 3EVMA 4F4KA 5DRKA 4ILRA 1Y3KA 2IYIA 1FCAA 1HNZK 3CDWA 4IFVB 4F0KA 4RKUC 2WVDA 3PEJA 3O1WA 2V69A 1IBLJ 2FLPA 4CZFA 4JI0J 3OFGA 1XMQF 4BCAA 3W1YC 3BH6B 3KWIA 2QYGA 4RCHA 5AE3A 3SV4A 4YNQA 3KLFA 3SUNA 2GW8A 3IA0A 4B3MK 4IXCA 1RCOB 1JB0C 5IT9U 3HHEA 1D9DA 4U67L 2KL8A 2P6SA 3PG9A 3GB0A 1RTDA 1N52B 2HBMA 1TAUA 4Z4GA 4JV5F 4LFBK 3MPWA 4N5SA 1L3VA 2MQLA 5GVQA 4B9VA 1ITPA 2VQFJ 2F9WA 1XN9A 4CZJA 2O8EB 4WU3A 5IFMA 4YB5A 3AH6A 3S8SA 2YWGA 2G0IA 2XLJA 2VOOA 1U2VB 5LMNJ 3N4WA 3ZCMA 1JLCA 5BRHA 3R1XA 2I1RA 4V19J 1FJGK 2D3ZA 3T5HA 3L3UA 2DRDA 3RBEA 3IS9A 4DCOB 4CO0A 1W2BR 1RA7A 3OL8A 1Q8BA 4X4OA 5CYQA 3SQGA 1HRHA 5C2GA 2AX0A 2ILYA 4DS4A 1TL1A 3VGKA 1HPZB 5B0GA 2VC0A 1H6KX 4OZNA 3JS6A 4KBOA 1HKAA 1JLBB 1IKWA 1X9WA 2CZ4A 1HI8A 5HN0A 2HHPA 1T02A 2KJWA 4CBXA 4CK2A 3ZT4A 2AT1B 5DZ6A 5HBMB 3UD4P 3ULEA 3O80A 2A6MA 3IAS9 1LV5A 2DR8A 4H0TB 3BSAA 5ETNA 4B1XB 3NWGA 1LWFB 3EE9A 2BMBA 1UVKA 3ZSOA 1WNSA 3PYEA 1NHUA 4JI8K 1S72S 3IG1A 4KR0B 3BO3A 1SKSA 3D2EA 3T3FA 3L4QA 1FVQA 4XH1A 2WK4A 2QXFA 7FD1A 2E1MC 3WQPA 3VAGA 3PIOL 5J2MA 3HVTB 2E5HA 2DXDA 2Z2ZA 2P9KA 3L09A 4B3OA 1ZBIA 3OYDA 2XWYA 3R7BB 3CEDA 1KR4A 4ZHRB 4CTAB 3U8XA 3C65A 5CA5A 1W0HA 1UOCA 2W42A 1BHNA 5GAGU 5A6WA 1CVJA 5EWEA 2VPXB 3H4DA 3DXMA 3A8YA 2DCUB 2BZ2A 3P3DA 3KK3A 3KUHA 3PTWA 3N6LA 3VGMA 4DTSA 1S0NA 1ATNA 3ISND 2DPIA 3LF0A 5D15A 4FYVB 2V8VA 5DLGA 2V2VA 1QAYA 1ZM2A 1VQ4N 4LF5F 4OX9K 2I9SA 4KTQA 2J8SA 2VUGA 1S59A 4JNEA 1SPBP 4I69A 5F9LA 3IG1B 2YHXA 1Z2LA 3QNNA 4NXMF 3HD1A 1WKKA 2QWPA 3CIPA 1W7WA 1YT3A 2ZWPA 4M3WA 2D3UA 4DI6A 4FPRA 5KFWA 1MSWD 4LH5A 5FRMA 2KT3A 5HI7A 3N9UC 5HQMA 3MFHA 3K2PA 2BOPA 2ZD1A 5KG2A 3THTA 3AVJA 4LBPA 3QO9A 3BF4A 1FJGF 4EEYA 3NGKA 3OJUA 4PABA 3M8QA 4FJGA 3PCOB 3GG4A 1KTVA 4DPWA 4DTRA 2GQQA 5FPMA 2HAIA 1WC3A 5IT9Y 4B17A 3M5RA 1V4TA 1IWGA 4DV2K 4DBQA 2AA4A 2ZE2A 3NS6A 5SZTA 4PG6A 1NK7A 1C1CB 1VMBA 2D41A 2DHAA 3NGRA 3KMSA 4G65A 3C15B 2ZC3A 1JXBA 4JKDA 2RQMA 1NK4A 4ZMMA 2ZZTA 1RT7A 1Q53A 2ZOMA 4E1MA 4FXWA 1UWBB 4DV7K 5AQXA 5LMNF 4PQAA 1ATRA 3CMES 1RAJA 3FEXB 1BG3A 2VCPA 2VFTA 4HHTA 4ZJQA 2RE1A 4GKKJ 5KFUA 4BVPA 1N54B 2RU3A 2HLUA 3QEIA 1K1SA 2IMOA 3KHRA 5KT7A 1K0VA 3AVMA 3MM5A 4JI8F 4ZCLA 4OX6A 1T3NA 3NDKA 1VBXA 2G0JA 2V4JA 5KTQA 1R59O 3CC4N 1NPPA 4WIQA 5HSPA 2GEMA 3Q0AA 3SUOA 5BRFA 1NMEB 4E7KA 1H73A 4CJSA 3MPUB 2CQ4A 1PBAA 2RS2A 1M90T 4OKJA 2RVJA 4BRAA 2V8PA 4CO3A 3TZXA 3ZX0A 3CD6S 2H51B 3A5LC 2QYCA 3QJLA 1X3NA 4HWIA 2KH9A 4GVEA 1NLKL 2IDEA 5JJBA 3ZX2A 3BM7A 5T14A 4M5IA 2BW7A 1QTNB 4WZMA 2FF6A 3WXJA 2O8BA 2BANB 1WAJA 3EY1A 3QIOA 4LF6J 4FJ5A 2XYPB 4QYZK 3ZXWA 5B8HA 4MIAA 3TYTA 2XY5A 1SJ3P 4DR4J 3DXSX 1KEKA 3QAUA 4WQ4A 2W8KA 2NXJA 4ZN1A 4P2XA 4GRSA 2AF6A 4FNHA 4LH4A 1YTUA 3AVKA 5J2NA 4P72A 2XNRA 3VA3A 3M1FA 5LJVA 4FJNA 3I8DA 1LOUA 2AEMA 3JSYA 4BRKA 4JI5J 5E2QA 2Z1HA 2ASJA 2QLWA 1KLMB 4BWMA 5AQQA 1RKJA 4OX8A 4CD3A 3IGVA 5HRRA 8ATCB 3FNNA 3B6OA 3L2VA 3TR8A 3EZOA 1GXUA 3UE5A 1IBMF 2GMLA 1IV0A 4C8KA 3H4BA 3GR1A 4BRHA 2AD9A 1HMVB 4I7FB 3IR5B 3MM7B 1JCGA 3A3PB 2MZTA 3M8WA 3A5OC 3G8SA 3CCRS 2W2MP 2F96A 2B56A 3I0SA 1JLAB 3BP8A 1RT4B 1NJIT 4CZEA 5M2PA 3QWPA 5TKWA 3ETOA 1LW2B 4CLSA 1NMDA 4C9DA 4LRBA 4ISGA 1W9HA 4WQ5C 2ZNZA 4IH6A 5A8RB 5DQHA 4OZ3A 3OBIA 1YTYA 4LQ9A 1UAXA 1IWAA 5A6PA 3CPWR 2V9WA 4KHMA 2R7QA 1VSDA 1WELA 1E6YA 3P39A 2NZ4A 3PDNA 4MTPA 2GQCA 3L7UA 2XMAA 4DQIA 1SC4B 2CQIA 5KQDA 2HBLA 3K5PA 3EX7B 1R27B 3WXIA 1NAQA 3EGVA 3AAQA 3BBCA 5IXUA 3V4IB 3IN5A 4B1WB 2AJ2A 2IMWP 3JYTB 2R7WA 1FJCA 3ALYA 1QS4A 4CEEA 1Y10A 1FKAF 1T0TV 2GWKA 2CZVC 5BYSA 3S1TA 3C6UB 1O13A 4MKBA 4HUEA 2LVWA 3DRPA 1A6LA 4FM2A 2CJXB 1HWIA 1CXUA 2YVSA 2YTCA 4R5PA 4MDAA 5EN1A 3PW2A 3C6TA 1MWQA 2D0OA 3DLLL 4M3RA 3O44A 1FRXA 3F9KA 3JXOA 4E1NA 2EX3A 1S6PA 1E6YB 3T5LA 1PAUB 4FCYA 3SBTA 4ZLLA 4I2QB 3R5DA 2HHSA 4CGHA 1FESA 4YR2A 2O8EA 4HVJA 4RW4B 1QY7A 3H5YA 1U6ZA 3BQ2A 3EVWA 3BO2A 2DB1A 3CCMS 1KVKA 4DV1F 4JI3F 1BA0A 3CM5A 4O44A 4K8RA 2UYTA 2CQHA 2UUCK 5BR8J 4IO8A 3WIVA 3Q89A 1TK5A 2HHXA 4QR1A 4QW9A 1YRTA 3K5OA 2CQ0A 1S6QA 4KPCA 1KN6A 3ENBA 4JI0F 4PL8A 4F3QA 5HAOA 4G1IA 3UPFA 2OFGX 2IJNA 4XDCA 2VG5A 2EKYA 5FRNA 3EKUA 3C7NB 2QFJA 4BC4A 1P6TA 3OL7A 2ZITA 2M9KA 1TKXB 3HZEA 2VFRA 1YITS 3LM9A 3IAYA 1QQMA 3HHLB 2WONB 1JLBA 1FEHA 1HWLA 3T1AA 1S4EA 5E33A 2J6TA 2NUUG 2ZOGA 2OMOA 4KIAA 4J2BA 4KHPK 3KK2B 1HNXK 3CJQA 3K89A 4UUWA 3S3NA 3DM2B 4E3SA 1HNZJ 2A40A 1HQUB 1OVQA 4BLGA 1L3SA 3S3OA 3OHAA 2NRXA 3FEZA 2IAJB 2F63A 1S7IA 1HW9A 1IUJA 1RWWB 1RU1A 2NLWA 2RHSB 3UN3A 1OIAA 2ASYA 3BKTA 5IOLA 1KHVA 3DLBA 5CYMB 4EO6A 3H3OB 5M1PA 2IYGA 1NGGA 3HVTA 3FJ2A 3S6EA 1IBMJ 3RMAA 5MLCV 1VSLA 1GH8A 3HLUA 4OZ2A 4M5HA 2ZWHA 5EX0A 4N41A 4A8SA 2CNLB 3HKWA 3MM5B 4FJIA 2KVQE 5AQLA 1LNQA 2RDJA 2OPPA 2IOCA 4LF1A 4QJVA 1UA1A 2QFIA 4J2DA 5KFHA 1NDPA 4NYPA 1SJ4P 1VQYA 3OVNA 1U1LA 2YH0A 4KH1B 4YDXA 5AQWA 5D77A 4JKGA 1HNIA 2RPIA 4ZLNA 3WT0A 3T1HJ 4MK9A 4B8CA 2GGPB 4IEEA 4DSKA 2RU9A 1BOTO 1RISA 4DV3K 1MWKA 3IC1A 1RAHB 5HRNA 4ED1A 1DJ0A 4F3TA 3V9XA 1FRHA 2QJ3A 3VR1A 1M5VC 1U0HB 3DRXA 3WNHA 2G8UA 1IBKJ 5BN8A 2MQQA 2QEXN 2LCWA 3I9ZA 5KFAA 4JV1A 3PW5A 2AMCB 4KKOB 2DFHA 2RSQA 3LGNA 1TFWA 5J1EA 4NLOA 1ZM9A 2YWFA 2UXCF 4IR9A 4DR3J 4UOGA 4P75A 2C2DA 3M30B 4K4TA 1U1QA 4LFAK 5IWAJ 1VQKS 2O1PA 1IKXB 4N7TA 1U24A 1IQTA 1TTHB 2W8LA 4CLUA 2W7AA 2KI2A 2YKPA 2CQBA 3ATUA 3Q22A 2QL9B 4LVOP 1OSDA 1KC8T 3F2KA 1S3XA 5HP1A 2RS8A 2MQPA 5AQMA 2JLFA 2YNIB 2HRTA 2ZHBA 4EBCA 1I5OB 5GADU 4UZBA 1WUAA 2ZFHA 4USTA 1WG5A 2YKNA 3SCXA 4GKKK 1TMMA 1FNOA 2QLBB 3MM6A 4Z4IA 4F02A 1XC9A 1FVSA 4CJ5A 3VGSA 3CCQS 4YB6A 5A0YA 4WP3A 2I7PA 4ANEA 2AEJA 3QIDA 2ROEA 4Y1CA 3L6QA 4EI2A 5ETMA 3UE2A 4DR2F 3BY5A 1FFWB 3RZAA 1HNVA 1DAXA 1U1RA 4QYRA 1VQOS 4KO0A 1KAXA 2E88A 2UV8A 3KNGA 1SC6A 3HHLC 4IH7A 2WAQD 5ETTA 3CD0A 2C2OB 3OYGA 1R8PA 5A8RA 2E4LA 3QNOA 3CWJA 2PFFB 3CDUA 2G8VA 1BU6O 5LMUJ 1RT3A 1RQ0A 2KDOA 1C4AA 2CQDA 2IJRA 3LP0A 4U8YA 2WB1D 4NZ6A 1T95A 2W4CA 2MMYA 4KGVB 2D0BA 3I32A 3OXGA 3KJFB 2B7CB 3SBMA 2CQPA 1TUGB 2NUHA 3UDCA 4JV2A 2C42A 4ZVFA 2DGUA 2RRNA 4PYDA 5F9NA 4X65J 2KHDA 2DTJA 4CJ7A 3EKSA 2Y1RI 3RJMB 4XPCA 1XNRK 2XULA 2A1RA 2Z2MA 2O8CB 4RBTA 1N34F 3H08A 4BQLA 4ZPWR 1OO0B 3CQXA 4DR7K 2HKEA 2GUIA 4IFYB 4FJLA 2KN4A 4KBIA 5AJ3J 2K1RB 3BJYA 1CBKA 2DNGA 1RTHA 2YNFB 2M8HA 3UFCX 2DFFA 4ZCKA 1X4AA 2OO4A 3G9CA 1CEZA 3OL6A 2VH7A 4BC3A 2BABA 2W4DA 1S1WB 2ATQA 2Q31A 3CMAN 2DPJA 4ILGB 1YUWA 2BUPA 4FPBA 4WFAL 3AD9C 1UMJA 1PO6A 2OPRB 4ZVTB 3VF6A 1X31C 4OZ5A 2XI3A 1EKSA 2UXCJ 5FPDA 1NSPA 1WHXA 5HVGA 1IR2A 2BKNA 3LOUA 4M5JA 4YOWA 1FTRA 1B0TA 3R9PA 4H0OA 1VK8A 3HL8A 2HFOA 5KFSA 3SQ2A 3QRQA 3JAMU 4BR7A 3TARA 5DETA 1J5OA 1S72N 2MLZA 3HRGA 2RUGA 2A2DA 1BQMB 4FLTA 1VIXA 3VCDA 4KH4A 4CJEA 2VQEF 1G99A 4MIBA 3AGKA 2Q1NA 1R31A 2E5GA 2OP5A 2RKIA 3AODA 1BWVA 1X9JA 3NOCA 1HIYA 3L4BC 4CJVA 3G6ES 3LPTA 4J37A 3D9BA 4DU8A 5K8NA 4CFAA 4PRFA 3NP5A 4I56A 2B0GA 2D7SA 4JHDB 2C2RA 1PC4A 2ZBIA 4OPAA 5ETVA 1FERA 2HW3A 4CHQA 1UFWA 4JKFA 1RHJB 1AFIA 1P8ZA 2QX0A 3JAMO 2UU9J 5HMWA 4M45A 1UJ5A 4HCBA 3D1QA 5C24B 2QI2A 3OFHA 2H5EA 2DR9A 3QEXA 3MN9A 1ZA1B 2BGGA 1H7WA 3TO8A 3CDEA 2LSNA 3G6EN 4NE9C 4FVUA 2JFKA 2ZQBA 2J7WA 2VFVA 1Y5IB 1GK8A 4A8XA 1RAAB 2HK3A 3NGUA 4QR0A 2ZZMA 3QGPA 1Y0HA 1T03B 1UW9A 3TAFA 1M5SA 4NMLA 2CQ2A 3MWPA 2P9SA 5AQNA 5LMUK 1WTFA 3DRPB 3HFZB 5CZ1A 1NB7A 1NGHA 3DXKA 1YITN 2RQ4A 3KLEA 4JK7A 4Y2IA 4DCJB 3OTOK 3A3OB 2D69A 3O3LA 4RUHA 2GNKA 2D0AA 4NYZA 1OS5A 1VQ7N 4DR1K 3D6MB 4LF7F 1SC1B 2G8WA 1WJ9A 3UN5A 2VPYB 5A2QU 2MQ8A 3SMZA 3EE3A 5FJ4A 1RGIA 2ZGYA 5D6GA 2AJ4A 3VZHA 4ZLPA 1Z25A 2HNZB 1YBUA 3H2VE 4RBVA 2E5JA 2ZVSA 1IBMK 4JS4A 4FWQA 3C6HA 3CJKA 4E98A 1VQMS 3J7YI 3N6MA 1U1KA 3D28A 1NGEA 4F26A 2FSKA 5IT4A 1KXPA 2R2RA 2PMHA 2C2ZB 4MLEA 4JP8A 3QMQA 3M2RB 4Z7YA 4FL9A 3PHEA 1NRKA 4YOYA 3OVSA 3VGUA 4DV7J 3GIIA 1X7VA 4IYQA 4EIAA 2CPIA 1LWEB 2LEAA 4B3RJ 2QWNA 3ETMA 1QSYA 4ENOA 2CH6A 4RTFD 1JLEB 3KDOA 3GCXP 1VJWA 5KFGA 4ZVUB 2A6AA 1YZ6A 4FSVA 3O4QA 2OUGA 5KFPA 4AHRA 3KK3B 3OA9A 2FIUA 1TV6A 2O5DA 1GLBG 5IWAK 3R5JB 5D0GA 4O8KA 1RHRB 1MG7A 5J1PA 2WHOA 1NB2A 3MR2A 2NRTA 1EJ7L 4TLRA 1RNHA 4DU4A 2YHAA 2P6TA 2FF3B 2BJDA 2RHKA 4QR2A 2W6KA 2NRHA 5GAEI 1U1MA 1LWEA 1TVRA 1KHWA 2QMUB 4OLAA 4YOUA 5KT2A 5L1IA 4V19X 5A8KB 3VF4A 4XTTA 1SKWA 2OTLS 4FN5A 2W4PA 4FKYA 5IM0A 2R2SA 4WXOA 3EPGA 4LF7J 1YVNA 4DKWA 2VWBA 1FHTA 1U2RA 3CD5A 3DGVA 3HSGA 3P5BP 1N36J 2NXUA 3R2CJ 4BC5A 4K43A 5AQGA 1ULRA 4RX6A 3AVGA 3F9MA 2VL1A 2YXLA 5EXWA 4FYWB 3DHWC 3MPYA 3NWRA 1N5VA 2XMTA 1U2FA 3QRPA 2R3VA 4OGCA 3MAHA 2P9IA 3O2IA 3KIOA 3GFXA 3DOKB 4QBUA 2DR6A 4M5DB 4DV6J 3R8YA 1CXQA 4F67A 4LD0A 3QBXA 3BDEA 1U48A 4JI2J 4JI0K 3KHGA 2O67A 2AYBA 1IG8A 3GJTB 4DL3A 3R7SB 2PEHA 1KS2A 4CRJA 4J9LA 4A8QA 3OYAA 3FR0A 2COLA 2ZWOA 4NLDA 5F0UA 4E7IA 1XNQJ 4BRGA 3LO3A 4DCPB 1CZAN 5HK4A 2OPSB 5RUBA 3HT3A 3H25A 4B3SK 3FRZA 1FKOA 2DNNA 4RNHA 4TU9A 3RBDA 3QRRA 2XQCA 1ZBLA 2YHWA 1IVZA 3G82A 5TKYA 5KRSA 5BR9A 3IBCB 3POTB 4A8YA 3AJ2A 1VSEA 1U6BA 2RQKA 4PG8A 1WKLA 4LT6A 1MWYA 2W6LA 3TA2A 1TL3B 3CIZA 5ITHA 3AD7C 3ILLA 5C12A 4JEPA 1CC8A 4DV4K 4I2PB 3MX2A 1FXXA 3CHWA 2WW8A 1JJHA 5HATA 1ZM4A 4CH0S 4DFMA 1H2UX 4FS2A 3SJJA 4BR5A 4AQYJ 2HHVA 3ISNC 3AA5X 3TP2A 3HPOA 1LOTB 4J9QA 1RBRA 4GKJF 5CQGA 2OD4A 4LRAA 4JYAJ 3OPKA 4H54A 3NF7A 2J0WA 2EFGA 1KVBA 3RU0A 3U7JA 4C8MA 2CPDA 2BRLA 1F5BA 3J80U 4DV3J 1N88A 3K9KA 2D3O1 2AX1A 4JYAK 3HO1A 2WUSA 2R42A 4W5RA 2QE5A 4CLZA 1RXOB 3QB0A 3LDNA 1VQ8S 3JTPA 3RBXA 1M5OC 1FFSB 3OR1B 2MQNA 1LW0A 2N3OA 5CAAA 3CF5Q 3TSPA 4A8WA 3BPDA 2JEFA 2FJXA 1ZBUA 3GMGA 5ETQA 4I64A 5ETOA 4O0IA 1QHAA 2PSZA 1RBTA 2FLOA 4Y3CA 2OFHX 4JHDA 2GCFA 3K5MA 1VC0A 4TKTA 1UVNA 3W66A 3WXKA 1RBSA 3BN4A 4IG0A 2HHQA 1KLMA 4LF9K 3MM8B 1FXDA 4ED6A 2UP1A 2CWXA 2QW9A 3OHBA 4PHTX 3VQ8A 1LXJA 4K5RA 4Q44A 3DLGA 3PLAA 3ELHA 1TFYA 1QVGM 3D3BJ 1J27A 4UT4A 4CBWA 2VBWA 2YKMB 1J2VA 2DY1A 4C0OC 1S1TB 4BE1A 5AXKA 3C66A 1IQZA 5EX5A 3AT1B 2D1KA 4HT7A 3NCIA 4S0MA 1UL3A 4CLLA 1WC5A 2XSJB 2CNNB 1Q16B 3NGZA 1U2CA 1RAOA 2UVUA 4EHTA 1HBNB 1EXQA 3TAGA 2J0SD 1TAQA 1RWOB 3MHYA 4LFCJ 3G71S 1RDWX 4LY7A 1BQNB 2ZM6J 4CGIA 2R7OA 4WQ5A 1VQPN 4IG0B 2KRRA 2R7SA 2DK2A 2A5XA 3JTOA 3AFGA 3MM8A 3TA0A 2Z56B 2DCLA 1BWEA 3DU6A 2ILZA 3W5XA 2YNGA 2QSFA 2P9NA 4YP3A 1VBYA 3W5YA 1FT8A 1YG0A 5JVHQ 1KC8O 2P9GA 2UXBJ 3PHTA 1RTJA 4C8NA 1NOZA 3CCLS 2DNOA 3EXCX 1TL4A 2UUAJ 4DS5A 1T94A 4OVLA 3OTOF 3S41A 1S6QB 5E3QA 4CIFA 3IM9A 1WC4A 2MY8A 4RW8B 4W92B 2HNYA 2PMWA 3NE6A 3ZSQA 3D0GE 3TAQA 4FOIA 3I0SB 3NH2A 2E1AA 1RWUA 1HPMA 2E20A 2F8MA 4JI1J 4CJLA 5DQGA 3P45B 3EXYA 4N8NA 4EU0A 2J4RA 2X74A 1NH8A 4DJBA 4QAGA 4F25A 2WONA 1Y4ZB 4YQWA 4CH7A 2AZ1A 2PT0A 4ZITA 4O0JA 5D3GB 1K47A 2VV5A 3R1HA 3U9DA 4CZMA 3CJCA 1QDUB 4DF8A 2NLXA 2QL7B 4CJQA 2Z4PA 3SQ1A 3HM8A 2O66A 4C1NK 3CPEA 4KAZA 1F6TA 4IRCA 3CPWM 1LWXA 3K59A 5U47A 2OCEA 4R0JA 4RW7A 2GC8A 4DQSA 2HVDA 3I56N 3ZNJ1 5C7PA 2G4BA 1VYAA 3L2WA 3JQMA 3NS7B 4HACA 1HHSA 5AXMA 1L5UA 2OTLN 1CZ9A 5GAEP 9ATCB 3SQGB 1YK9A 2ITGA 1I3AA 1JL1A 4OHWA 3K58A 3LP3A 3KOAA 5BREA 6AT1B 5L1JA 2UUBK 2B8PA 4DLGA 2A42A 5AXLA 5KGWA 4DU3A 3ENWA 2QLFB 2VWJA 2JWNA 4ILHA 3KUEA 4CLPA 3AOBA 2FVSA 2HFVA 4ISFA 1S10A 4G1QB 3IBFB 3M4XA 4USJC 2PYLA 2ITMA 4Q45A 2I38A 3D7SB 2OIHA 3OXLA 3PACA 5AQIA 3TQ1A 3VA0A 5KFJA 2E8AA 3QYYA 3VEVA 1Y5LB 2E2PA 1ZAXA 1T6DA 4XDDA 3BQ0A 3CGIA 4FZZA 4GC6A 2KM8B 3JSMA 1U45A 1QAJA 4X4QA 1T44A 5HROB 2O8FB 2P9KB 1SIZA 2UUAK 1F60B 2QV6A 1UZDA 1L3UA 4PWDA 2X78A 3WEEB 5I42B 2HMPA 5ETLA 1X8DA 4J9RA 2XM3A 4HUFA 3X3UA 1VLYA 3TVYA 3QINA 3CC2N 1A5XA 2LP4A 4ZPVR 2O3DA 4TYBA 4GC7A 5L9NA 3POTA 5F1XA 5JVHL 3KLGB 2ZM6K 4L3KA 4ZIVA 2OMLA 1IM4A 1TP7A 1VCTA 2ZF5O 1HBOB 4EHUA 1H7XA 2KKHA 5AT1B 1WDTA 3R9LA 3V6HA 3A8KA 1Z2ZA 5C42A 4AL7A 4WFYA 2MSSA 4RWTA 1T3VA 3OLAA 2PI5A 2E5LK 4WK3A 3MI7X 3MTKA 4CJFA 4LF6K 2FTRA 1OKJA 1X3MA 1IJFB 4L74A 2E7VA 2WTFA 1EETA 1I6JA 4CJPA 4IDKB 1N6QA 4WFAQ 5IC6B 3ZC4A 2YKNB 2ZHAA 4Q43A 1U1PA 3Q8PB 3MM6B 2NRVA 3HCXA 1Q86O 3FSYA 5CHIA 3WEEA 2CPXA 2E7XA 3HPGA 1MWZA 3L3CA 3KKSA 4WYBA 1NGDA 2VBYA 3I87A 2RRAA 3KLHB 4FLUA 2CPJA 4M63A 4CNYA 5ETKA 2VQFF 3ZZOA 4B9LA 4ECSA 4NLWA 4U95A 1N33J 1IKWB 3CMQA 5AQRA 1WHYA 4LMZA 5HJYA 4HL9A 2Z57B 2G2OA 4IDHA 1OQ3A 3CXCR 1KD1T 4DFJA 5KFFA 3TJ8A 5C25B 2QT7A 1HQEA 2IM0A 3M2VB 3C19A 4QIWD 1CLQA 4CO1A 4KAIA 4OQJA 4YR0A 5KFRA 2C3PA 4ECTA 1FD8A 3M6XA 4PPZA 1S0OA 4A8KA 3IXQA 3OYIA 4FBUA 2YKOA 4OI4A 5THWA 1QSSA 4A8MP 2XMVA 4X66J 2LECA 4ZJOA 3CD6N 4CFDA 1M90O 1J53A 3QLHA 3LALA 4JI5K 4KY3A 3LUYA 5KFTA 4GKJJ 1RA6A 2CPYA 1HJRA 1S1XA 2OHDA 1KP6A 4DU7A 3VMFB 5B0FA 3PIOQ 1F21A 2V7ZA 2JC1A 2BA9A 3M1VB 4FWKA 3J81U 1KQFB 2FLLA 4TLQA 3I82A 3C95A 2XRIA 3VZIA 2R7VA 4KH0B 3MMBB 1SBRA 2VDHA 4Y2CA 2YNIA 1U09A 4A4JA 5LJ5Y 2XY6A 1VQSA 1DTQA 3M8PB 3IBWA 4OYXA 3VF2A 3DOMB 4LREA 2ATLA 1RYSA 2A18A 4J9NA 4RWWA 3LZIA 2EHGA 1KTQA 4OJ1A 1R6VA 2R8KA 4F36A 4YORA 5DG9A 2HGMA 4KYZA 2IVPA 1Y97A 3ZSYA 2HNDB 1VQPS 4WXWA 2P1JA 1ZBTA 3THVA 4X4UA 1RT5A 4JI4F 1LK5A 4OX9J 1K44A 3MK6A 3I8BA 2V4RA 3UD3P 2ZBCA 4IOAQ 4QWCA 3GBTA 1CZBA 3MCPA 3UO0A 4YR3A 4K0KJ 3ENHA 3OYJA 3UKUB 3LP2B 3WXLA 5GINA 4Y2MA 3P8BB 3H42A 4IEIA 3DMJB 2ZBRA 3OTOJ 1RDDA 4ANCA 2LQ9A 3GYNA 4ZTJA 2AEFA 4F0MA 2P9LA 3M8PA 3CW2C 4OYMA 3VAMA 4YUDA 2Q97A 3QATA 3OUYB 5I9EB 2E6LA 1UVIA 1RAFB 2DH8A 4IOXA 4LF8K 4CEFA 2XMMA 3FVYA 4KRFA 2ZUGA 3Q8SB 3US5A 5HO4A 2IA6A 1WKJA 2KYXA 4C7QA 1WI6A 2PY5A 4MLHA 3H59A 2IFXA 2CJKA 2BQ3A 4G6VB 5BXIA 4FLVA 2X1GA 4TYAA 2CJ9A 4EBDA 3J80Y 2XTJP 2V51B 1WUUA 3GU0A 4UZCA 2L48A 4C8LA 4ES3A 3HDSA 3L3VA 4OJ3A 3WX4A 4USMA 1MLAA 1A5WA 4ETXA 3O9UA 3W7BA 4B1YB 2B6AB 4IO1A 5HL7L 3V4MA 2HVZA 3OUYA 3R1LA 2HPUA 2HWIA 3TAMA 1N8RO 1VC6A 2B9YA 2BE9B 3D6HB 2LQJA 2OLWA 2GO9A 4J9UE 3CJKB 5LL6d 5GADP 4Z0UA 4KH5A 2X3GA 3MEGB 2I2YA 1N5TA 4IJAA 4Y0WA 2M52A 1QM9A 4LRDA 1GLFO 2QA1A 4GV6A 4F3MA 1W2BM 2Y0SD 1HD0A 2ZKUA 1M5HA 2ZJRL 2KFYA 1T03A 4TY9A 3CCMN 2VQEJ 3GZ7A 5FIIA 1M1HA 4CF1A 1U25A 2W40A 3KHHA 5BR8F 2HIYA 5KAKA 3W8PA 4Q8FA 2CQGA 3TZZA 3MXMA 4TU8A 2AGOA 2PFDA 4P2SA 4ZIWA 3PX4A 3L4IA 1RBAA 1S1VA 1FXLA 2NSCA 3A8EA 1G1XA 3SNNA 1ZTWA 1VRTB 4ILLA 3CQ8A 3WXMB 4DDFA 5HLFA 4JD2B 1SJ1A 3LA0A 2XS5A 3RMBA 1VHFA 5C0YA 1DFDA 2HNZA 1HBMB 4KHYA 1R0AB 2LA6A 1TGOA 5EHHA 3UIQA 1URNA 1HA1A 3AO5A 4J9OA 1QE1B 4WE1A 2MTLA 3PYFA 3VESA 3S01A 2H5IB 2XO6A 2CG4A 3R7NB 1S6UA 1U4BA 1XNQK 4L3QA 4FM0A 4B9SA 5KG3A 5AE2A 1NK9A 1IBKK 4MDBA 1IBLF 3TTCA 1QJHA 1J6ZA 3R6GB 2V52B 2QKBA 4DTXA 2NQPA 1NH7A 1JL2A 3MCMA 3J7AN 1VQ7S 2ZH4A 4ZVPB 4LF6F 4RJVA 2WRMA 3HP6A 3T1HK 1DBDA 3OS1A 1ASVA 2ZDPA 2HIQA 5JVGQ 3NEKA 2E2OA 2QWMA 2WBNA 4C6AA 8AT1B 1S6OA 2DR5A 2U1AA 3EM1A 1C1AA 1N32K 3DAWA 3TTDA 4BROA 4KFBB 1TKZB 2ZH7A 5J2QB 2GZOA 5AZJB 5D0HA 3UR0A 1HYVA 4ZVHA 3FZLA 1NK0A 1N36K 4KQZA 3FFKB 3CCVN 3OY9A 2EFQA 2RUSA 4KGKA 2IJFA 1DTTB 3WHIA 3WNGA 2DNPA 3T5JA 4DLEA 3CDAA 3W3SA 1ZZNA 5D4PA 3EICA 2V8DA 2CYYA 3M7VA 3DXBA 4H4MA 1ELOA 1W2IA 4CJ3A 1NWKA 5JMVA 4JB8B 3ENQA 4WCEQ 1SJFA 3C46A 1BIZA 1WSJA 3ZTRA 1VQNN 2Y8WA 3TX0A 5DDPC 1MW7A 2OZSA 3SAFA 4DQQA 3R3TA 4NLYA 4QWAA 4IOCQ 1GMWA 5AQYA 2YX7A 4WKYA 1UVLA 2KJVA 2ZD1B 4AM6A 4XO0A 1NGFA 3DOLA 1VOMA 2DTUA 3UQSA 4AXIA 3Q2TC 4JK9A 2ZVIA 3E01A 1RE1B 3VQ6A 1CSJA 4RW9B 4OI3A 3PEHA 1REVB 4ED4A 3MR7A 3NAIA 6FD1A 3R3LA 4Z4FA 1T9UA 3W2WA 2CA9A 4UQTA 4L76A 2J6UA 2YHYA 4JI3K 4NLQA 1C1CA 3A3NB 4B3RK 3TX8A 5C10A 2ADBA 1P90A 4MYTA 3BKFA 4HI2A 1EO1A 4OZ0A 1HKGA 3OYFA 2AKWB 4DV4F 3CCQN 4DV1J 1WB9A 2GS8A 2CQ1A 4YDUC 2DGSA 2UUBF 2OEJA 1FKOB 3ISZA 2FUG9 1KLNA 4QIEA 3IR7B 3KDNA 4UOFA 2W2NP 3CJ5A 2FJWA 3B4MA 4QW8A 1YX2A 5LY3A 1FF2A 2ALYB 4YOXA 1NKBA 4N76A 5KG7A 3DLRA 3I5AA 4OL8A 2V50A 4J9VA 4FK0A 1KQKA 1LW0B 3GG1A 2DH7A 3C16B 3IMXA 3QGIA 4QS9A 4CLTA 2V4JB 2PD1A 4BRQA 4E7JA 4BR0A 4DV7F 3NH0A 2BJ1A 1N56A 2NYIA 4DFPA 4YOEA 1YIJN 4LBIA 4Q7AA 2EC0A 3T19A 3QBWA 2OPQB 5H1SQ 5LJ3Y 1NBWA 3P4IA 1REGX 2ACYA 1B0PA 3VQEA 1CJUA 3QFHA 4ZPCA 4CGDA 1WLJA 3M9NB 3SCJE 3HKZD 2DRBA 3IFRA 2QGFB 3WDOA 4ER8A 5JS2A 3BZCA 2V7YA 1EKEA 1LAWA 4C2MA 5A0YB 2EPIA 3GSDA 1D5AA 5JVGL 5F8MA 3AVNA 5HRPA 1JQGA 3DLLQ 5LJWA 2P5OA 3R97A 3VF0B 1XR5A 1KWMA 1YDLA 2UUCF 4F4XA 5FPEA 3MCOA 4WFXA 1YI2S 2IM2A 4CZHA 3GP9A 3OQ2A 2ZM6F 3MURP 4ZVOB 5KFKA 5K14B 1Y11A 4A48A 4NASA 2RN2A 4M3ZA 3GDQA 5AQZA 4PL7A 2IM1A 2Z30B 3DKDA 5JMNA 1JLQB 1FRLA 2E5LF 3OLBA 4ITSA 5DO2A 2M2BA 2YHBA 4M8LA 2R8IA 3FUYA 1S79A 3MAQA 4AM7A 3OVBA 4LF2A 1WEYA 3N4PA 2O01C 1SXLA 3ILOA 4CF2A 4JKAA 4MMOA 1X0FA 3AJDA 2FQQB 4UOHA 4B3SJ 1YQHA 2ZNYA 2WFBA 4Y34A 3AVLA 2HHTA 2CDRB 5IV3A 4UQGA 1WOPA 2YPYA 2UVVA 1WACA 3QETA 3BSOA 4Z4CA 4MT1A 3V6DA 4LF4F 2LQBA 2EWSA