2QKBA

Human rnase h catalytic domain mutant d210n in complex with 20-mer rna/dna hybrid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*GP*AP*GP*UP*GP*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*
publication title Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna/rna
total genus 45
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2qkbA00
1SV5A 4O4GA 1X9MA 3P1GA 3NGIA 1JL1A 1BCMA 2P51A 3ZT3A 2G8FA 4M3RA 1HNIA 3ZCMA 3H08A 4PY5A 3OYBA 5C24A 4M45A 3V1OA 3EYZA 2E6LA 4KB0A 5T7BA 4UQGA 2ZD1A 4KTWA 4DTNA 3KK1A 1NKBA 1Z26A 4CF1A 3S3OA 3AA3A 1SKSA 4KTZA 3SPYA 3KKSA 2BE2A 3QINA 3SV4A 1KLNA 3KLGA 3LZJA 1S9EA 4DTSA 3TWHA 4DSJA 1A5XA 1CZBA 3AO2A 2G8HA 1JLCA 1REVA 3NDKA 3ZT4A 2QKBA 4C8NA 1NJWA 2RN2A 3VQ5A 4IKFA 4CECA 4DSFA 4AHSA 3SUOA 4DSIA 3ALYA 3ZSYA 4CGGA 5I3UA 3NH1A 1RDDA 4H4OA 4CFDA 1D5AA 1YVUA 3DRPA 4DTOA 1RTDA 4FJGA 4ID5A 3WNFA 3NAEA 1HNVA 4MFBA 3NE6A 2PYLA 4CJLA 4E0DA 5KTQA 3VQAA 3KIOA 1LWEA 1NKCA 4OLAA 2KTQA 4FW2A 2KFZA 3KTQA 2HB5A 4NYNA 4DFPA 1Z25A 2X78A 4CGHA 1RDBA 3M8QA 3HSTB 2ATQA 3KLFA 3LWLA 4LSNA 3MEGA 3EZ5A 3NF7A 1ZYQA 3OS1A 3ZSXA 4KHNA 3M8RA 1J9AA 2D0AA 3AVNA 1A5VA 1C0MA 1EETA 3TAGA 5HROA 1UOCA 4BDPA 2QK9A 4ELVA 2DTUA 4F8RA 4IFYA 3MAQA 3RRHA 3QNNA 1CLQA 3RWUA 3JYTA 2WONA 1NK8A 3O4QA 4PQUA 1B92A 4M42A 2HHUA 4FLZA 3QESA 2RKIA 1KTQA 5J2MA 3NF9A 3SUNA 2PY5A 3V6DA 4CHPA 1ZBHA 3K5MA 4J2EA 5D3GA 3V1QA 1RDCA 1VSIA 4B9NA 3ZSQA 4KHUA 1MU2A 4E7LA 1Q8IA 3L2QA 4J2BA 4EP4A 5J1EA 4FJ8A 2G8IA 3KK2A 3VQDA 1BI4B 1IKXA 2Y1JA 4TSXA 1QE1A 1UAXA 4QAGA 1SKWA 3LWMA 1QSSA 2JLEA 1VSMA 3VQBA 4DG1A 3F9KA 1HJRA 3K57A 3IG1A 3IRXA 5CYQA 1KVAA 3DRSA 3D0PA 1D9FA 3HXMA 4KB1A 3CFPA 1BGXT 1JLAA 1X9WA 4JS5A 4I2QA 5KRTA 2FBYA 1BIUA 3DLBA 2B5JA 4JLHA 5KGWA 4CJWA 4CIGA 3G10A 1T05A 2HMIA 4DSLA 3PO4A 3NBPA 4KREA 1EKEA 4Q5VA 3C6UA 1G15A 4F2SA 3CQ8A 3VQQA 3V1RA 2OA8A 3HP6A 2R7YA 4HVJA 4O0JA 3VQ7A 4FYDA 3LPTA 3DRRA 3AO1A 4E19A 2I5JA 1VRUA 1S6PA 4DQSA 1NK5A 1ZBIA 2DFEA 2HHQA 3OYIA 1NK7A 4Z4EA 1IO2A 2IAJA 3SNNA 2IS3A 2X74A 3ISNC 2YNHA 4CJSA 4O5BA 4HUFA 3QERA 3AA4A 4K8ZA 1RT7A 4W5NA 4OKKA 4CHNA 1RDAA 3QEIA 2D5RA 3E01A 3SUQA 1LW2A 3VQ6A 4GW6A 4BWJA 4IG3A 3KK3A 3V4IA 4OKJA 4CJUA 3B6PA 1WAJA 1S1XA 1YTAA 5HLFA 1QSYA 5CZ1A 1VSHA 3ZT0A 3OYCA 3KLHA 1LV5A 4DTXA 3HPHA 1SKRA 1TV6A 3DLHA 3HO1A 1Q9YA 1ZBLA 4CEZA 3OYMA 2E6MA 4LH4A 2EHGA 3AVAA 3TANA 3O3HA 4DLEA 3V9UA 1VSKA 1IKWA 1U4BA 4Q0BA 3TAPA 3KLEA 4M3TA 1TAQA 3V81A 4FXDA 2ETJA 3SQ4A 1TK5A 2JGUA 4HUGA 1DTTA 3AVFA 4CEOA 4CJ3A 4JS4A 4I7FA 3SUPA 1KSPA 1CXQA 1JXBA 2DFFA 2BANA 3NF8A 3TAQA 3DMJA 1WSGA 4O44A 1VSDA 4W5RA 3RR8A 1ZBUA 4DTPA 2X6SA 1FXXA 2HHSA 3QNOA 1RTHA 5SZTA 2GUIA 1FKPA 2HNZA 3TARA 3VQCA 4N5SA 4DSEA 1XHXA 3AVCA 4RW8A 1NJYA 3IAYA 1RBVA 1WN7A 3AV9A 4B9SA 3F73A 4B9MA 4FK0A 3HM9A 3QLHA 4AILC 3MXJA 3OVNA 1TKXA 2GV9A 4IDKA 4AHVA 1TKDA 2DY4A 4N41A 3TAFA 1IG9A 2D0CA 3NCIA 4DF8A 1CXUA 2YHAA 2YNIA 3OYEA 4HHTA 4CEAA 3LAKA 4DU1A 1I39A 4F4KA 4FJIA 3HL8A 1GOAA 3A2FA 4OLBA 4C8OA 3NFAA 4CE9A 4KHYA 5KI6A 1SL0A 4EZ9A 1TL1A 4Z4FA 4KRFA 1JLFA 4Y1CA 4AHCA 4M41A 4W5OA 2Z1HA 4G1QA 4GMJB 3LANA 1C6VA 1B9DA 1Q9XA 2PZSA 3OYNA 5FRNA 3CG7A 3VQPA 1N6QA 4DFMA 4OPJA 1HQUA 1S1VA 4CGJA 2P5GA 3HK2A 4CFBA 3SV3A 1XI1A 1W9HA 4LH5A 3DLGA 3OS2A 2HHTA 2OYQA 4W5QA 4CHQA 4I9LA 3AVGA 4IG0A 1HQEA 1NOZA 2P1JA 4Z0UA 4KO0A 3ZT1A 4JRQA 2KZMA 3DLEA 2XHBA 1K6YA 3V9ZA 2BDPA 4OVLA 1XWLA 4CIEA 2GBZA 1KVBA 3DM2A 4Z4CA 4OGCA 2W42A 3QEWA 4CEDA 4H4MA 5HRRA 4PWDA 1RT1A 3ITHA 1BL3A 3DOLA 4CF2A 3LZIA 4AHRA 1KLMA 4E7HA 3AVHA 3S9HA 4K8XA 4FK2A 2HW3A 3VQ4A 4CK3A 1NJXA 5HRPA 1KFDA 4DS5A 3QIOA 4H8KA 1WSEA 4M3ZA 3O4NA 1BISA 3O3GA 4F3OA 1VK0A 4FLXA 3ZSWA 4CFCA 4KPYA 1UA1A 4FJJA 1A5WA 1N5YA 5CYMA 3BDPA 5J2PA 1WAFA 2G8UA 5DMRA 3P5JA 1X9SA 3K59A 3PUFA 1QS4A 3M8SA 4FLUA 3U3YA 3S3MA 1JKHA 1TVRA 3RRGA 1RT4A 3ASMA 4E1NA 2ITGA 4CEEA 4B9UA 4MQ3A 4FZYA 3HT3A 4B9TA 1C1BA 4C8MA 3OYJA 1YTUA 4CCHA 1S1WA 2VG6A 3WNEA 5HP1A 3SPZA 3AVJA 5K14A 2FBXA 3ZSRA 1IKYA 2Z1IA 5CZ2A 3WNHA 4QOZB 4N56A 4NYFA 3OYDA 3O3FA 3MEDA 3SYZA 3CM6A 3NF6A 3AA2A 4DQQA 4KI6A 4BE1A 2YNFA 4CJEA 4DTMA 4CGDA 4ZHRA 4I2PA 3DOKA 3ZT2A 2QXFA 4CJQA 1TKZA 4C8LA 3NGZA 1HRHA 3MEEA 4CJKA 3SJJA 4FJMA 1JLEA 4PA1A 4ELTA 2HHXA 2OPQA 1S1UA 1BQMA 1JXEA 4FCYA 1XHZA 3L2WA 2VWJA 1T03A 3LPUA 1RBUA 1EX4A 3LP1A 1BCOA 4OPKA 4E7KA 4KTQA 3OJSA 2WOMA 1RTJA 4FW1A 4EZ6A 3G0ZA 4NCAA 4CF0A 4CERA 4FLTA 3KD1E 1EP4A 3QIPA 2OZMA 4NCGA 2YV0X 2OPRA 5C25A 1C0UA 4CHYA 3TAEA 4E3SA 1L3VA 1VSLA 4I9QA 1T8EA 3FFIA 4DQPA 2O4IA 3HVRA 4R5PA 4CGIA 1JL2A 3VN5A 4LD0A 4CFAA 4CEFA 3ULDA 3MXMA 4W5TA 4AH9A 3K5LA 4CEQA 1QTMA 4CJ4A 1KRPA 2B6AA 1ZBFA 1LAWA 2G8KA 3I8DA 1T7PA 2PYJA 4PUOA 1QHTA 2ZE2A 3VQ9A 2XY5A 1UA0A 1VSFA 4DQRA 2IDOA 3QEPA 4FM0A 1SL1A 4BE0A 4FLWA 2QKKA 2RPIA 4B8AB 1UWBA 2HNYA 1WNSA 1QQCA 1W0HA 4FJHA 3C94A 3L2UA 2IOCA 3QEXA 1C0TA 4Z4GA 1NKEA 2VG7A 1BIZA 3LDSA 2KQ2A 1D8YA 4B9LA 3L3VA 1O1WA 1RT2A 1S5JA 3OJUA 1L3UA 2X6NA 3KJVA 3SQ2A 1U45A 1J54A 1KCFA 3SQ1A 1ASWA 4RW6A 2O4GA 1RNHA 3MXIA 4ID1A 3RMDA 1HMVA 1GOBA 2B4JA 1TK0A 3OYHA 2EX3A 3KKRA 2OPSA 1LWCA 1ITGA 2HNDA 2HHWA 2YHBA 3HPOA 1NJZA 4BE2A 3SZ2A 1SL2A 4GVMA 3M8PA 4FJ5A 3HJFA 1C1AA 5KGXA 3OY9A 2YKNA 3T1AA 4DU4A 1LW0A 3VA3A 2XY7A 2LSNA 2P5OA 1TL3A 1RTIA 3VA0A 1B9FA 1RILA 4DQIA 3TAMA 2Y1IA 5FROA 3LAMA 1QSLA 2Q3SA 1NK0A 4KHQA 2HVIA 1WSHA 4Z4HA 4FLYA 3V9XA 4E7JA 3K5OA 2Z1GA 1S9GA 3C95A 3P83D 4E89A 2DFHA 2XO7A 4FLVA 2FBTA 1L5UA 1ASUA 4HCCA 1WSJA 1BI4A 3PX4A 3K2PA 3AVIA 4FM1A 1DTQA 5HRNA 4CHOA 3TABA 4B9VA 4M3YA 1LWFA 3PX6A 2AJQA 5JS1A 3UIQA 4F2RA 3SQ0A 2A1SA 4BDZA 4DMNA 4M3XA 4CJVA 4DTUA 1ASVA 3DI6A 1LAVA 3MECA 4KI4A 3K5NA 1GOCA 2YKMA 4FJLA 3AVLA 3LALA 3BGRA 4FJXA 5FRMA 2G8VA 4DU3A 2VWKA 4HTUA 3OYKA 3CFOA 3OYFA 4DF4A 4AHTA 3AVMA 1FKOA 1Y97A 3LP0A 5I42A 1WSIA 1U49A 4Y1DA 3OYAA 2IC3A 4DLGA 3QEVA 3U6FA 1IKVA 1NK9A 4FZXC 2IGIA 3DLKA 2XY6A 3T3FA 3CM5A 3TR8A 4CJRA 3OYGA 1TKTA 1JLGA 4HUEA 2OPPA 4BACA 3RTVA 4FJ7A 3C6TA 4M3UA 1TK8A 1WLJA 4F3TA 4KHWA 2BGGA 4OGEA 4CF9A 5C42A 1SUQA 1JLQA 5FDLA 4RW7A 4CJFA 4KAZA 3JSMA 2A1RA 4N76A 3RMAA 4RW9A 1L3TA 4WE1A 1X1PA 4B08A 1HPZA 2ZQBA 3DLRA 4KHSA 3I0SA 1U48A 1HYVA 2VG5A 3AO4A 3NGYA 4JRPA 4O0IA 5JS2A 3NHGA 4DTRA 1NOYA 3AO5A 4CEBA 4XIUA 2KFNA 4LY7A 3D45A 5J2QA 4KFBA 4E1MA 4FJ9A 3AO3A 4O55A 5DK5A 2XRIA 3NH0A 3SI6A 3PO5A 4B8CA 1WSFA 2KW4A 4CESA 3KLIA 1XC9A 3KD5E 1RBTA 4AHUA 4CK1A 1F21A 4FM2A 1D9DA 4CK2A 3L8BA 3L2RA 4FJNA 3HP9A 1L3SA 1NK4A 3PY8A 1DLOA 3AVKA 5HBMA 1RBRA 1RBSA 5HRSA 1HYSA 3AVBA 1YT3A 4DWIA 1TAUA 4Z4IA 1S6QA 3CYMA 1KFSA 1CZ9A 2F8SA 4CHZA 3V9SA 4J2DA 3ZSZA 1I3AA 4CJTA 5EU7A 3OS0A 1U04A 1JLBA 1FK9A 3TI0A 3I0RA 3HVTA 4LSLA 3QETA 2F8TA 1S1TA 4C8KA 3QO9A 3K58A 4DFJA 3VQEA 4CJ5A 3VQ8A 4L8RB 3ZSOA 4FZZA 4IFVA 4DS4A 2OZSA 4ZTFA 4KKOA 3U3GA 3OYLA 4ELUA 5KRSA 3L2VA 1RT5A 2YNGA 4EP5A 4YNQA 3S3NA 3SCXA 3LP2A 4N47A 2D0BA 4YFUA 3RMCA 1EXQA 4IBNA 4HCBA 2KZZA 1VSEA 4DSKA 2RF2A 3WNGA 1J53A 3EY1A 2FBVA 3CFRA 4CGFA 4OKEA 4DTJA 2Z1JA 4FVMA 4ICLA 1RT3A 4KV8A 1TGOA 2HHVA 1C1CA 2E4LA 4RW4A 1RT6A 3RR7A 3B6OA 5SWMA 2HVHA 3T19A 3IS9A 3PV8A 3RMBA 4J2AA 1BQNA 4BDYA 5CY4A 3HPGA 2G8WA 2XY8A 1U47A 2FC0A 4FJKA 1VRTA 4FK4A 3ZSVA 4M3WA 2NUBA 4DFKA 3PX0A 3L3UA 1KVCA 4CF8A 4CIFA 3NH2A 3DYAA 1HYZA 4RG8A 4B3OA 4CJPA 3LP3A 1J5OA 4ZTJA 3HYFA 5E41A 3V9WA 1R0AA 4QCLA 4E7IA 2F96A 4NCBA 1IH7A 3THVA 4BWMA 1VSJA 3AA5X 4OJRA 1RCHA 1NK6A 5J2NA 1BHLA
chains in the Genus database with same CATH superfamily
1X9MA 5GAGP 2AP1A 2Q36A 4B1YB 1BDGA 2D0OA 3CJ7A 1JL1A 2P51A 1HR0K 2G8FA 3J7YP 4M3RA 3ZCMA 3RVCA 2E6LA 3AGKA 4DTNA 4H5NA 1NKBA 3H1QA 3AA3A 3CJ9A 4YOUA 4KTZA 4DV3K 3KKSA 3CXCM 3G6EN 4IEIA 3HI0A 1A5XA 1YITN 1JLCA 1REVA 3ZT4A 3L0QA 4IWVA 4CZHA 5KQ8A 4KH6A 5IWAK 3SUOA 3FR0A 4CGGA 4WQ5A 5I3UA 4H4OA 4DTOA 1YXQA 1YVUA 1RTDA 4FJGA 1DEJA 4ID5A 4MFBA 3KIOA 1LWEA 3DAWA 4FW2A 4FL9A 2QWLA 4H0TB 4A2BA 3HSTB 2ATQA 4LSNA 4C23A 3ID6A 5M1FA 1IV0A 2HOEA 4JI5K 4BVPA 5BRHA 4ELVA 2P9IB 3C6AA 4BROA 3QNNA 2WONA 4PQUA 4M42A 3QESA 1TUUA 1KTQA 4CD1A 5J2MA 3MCPA 4X65K 4MDAA 4A57A 3E9LA 4E7LA 4J2BA 1NGBA 4EP4A 3CCMN 4PKIA 1BI4B 5AJ3K 1NGIA 2HBKA 2JLEA 2E8AA 3F9KA 3Q7BA 3K57A 1TYQB 3P39A 1NJIO 5CYQA 4J8FA 4LF4K 1VHXA 1ESVA 3AAPA 3G10A 4MDBA 3PSIA 3PO4A 2NRRA 1G15A 4F2SA 3VQQA 3V1RA 3HP6A 4HVJA 4O0JA 3VQ7A 3DRRA 2I5JA 1VRUA 4DQSA 1KAYA 1NK5A 4KH5A 3H46O 5AQLA 4CJSA 4GV6A 4K8ZA 1QQNA 1TUYA 4W5NA 1XNQK 3CCVN 4DV6K 3VMFB 3SUQA 1LW2A 3U4LA 3KK3A 3CJCA 3O6WA 4GKKK 1QSYA 4BRKA 2IVPA 3UE5A 3HPHA 3WQUA 3HO1A 1ZBLA 4CEZA 4LH4A 3VGLA 4Q0BA 3TAPA 2WBNA 4M3TA 2ETJA 1TK5A 4A5BA 4HUGA 3L6QA 1K8KA 1N33K 1CXQA 5BPMA 4C1NI 1WSGA 4O44A 5AQOA 1KQSM 1HX1A 3VETA 1ZBUA 5SZTA 2QA4N 3VQCA 4N5SA 2ZJPL 3D7EO 4B9MA 5AZIB 2GV9A 2F7TA 3ENOA 4AHVA 3NCIA 4DF8A 1CXUA 1MWKA 4HHTA 1S72N 1I39A 5M1PA 5LMNK 4F9OA 4EZ9A 3LDPA 4GMJB 3FLCO 1C6VA 1N8RO 2PZSA 3OYNA 5FRNA 3VQPA 1S1VA 3M3ZA 3WT0A 2UUCK 1XI1A 3OS2A 1V4SA 3ENBA 4W5QA 4CHQA 4NB4A 2O8DB 4JRQA 1RGIA 3DLEA 2XHBA 2BDPA 4YOTA 4OVLA 4CIEA 4BRCA 2W42A 3F5TA 4OGCA 5HRRA 5FPEA 1RT1A 3DOLA 5LJWA 4E7HA 2HW3A 4FK2A 3CD6N 1NJXA 2WUSA 4K41A 3VENA 3O4NA 1BISA 4F3OA 4FLXA 4DR5K 2UUBK 2P9LB 4QS9A 1A5WA 1N5YA 5CYMA 4YDUA 5M1OA 3K59A 2HF3A 1TVRA 3S3MA 2ITGA 3UKRA 3SAGA 2D1KA 3HT3A 3MK6A 5AQRA 4C8MA 4OX9K 4JHDB 3WNEA 4E1JA 3AARA 4QOZB 4N56A 4JK7A 3OYDA 3O3FA 2A40A 2VQFK 4BE1A 4CJEA 3DXMB 2ITMA 4I2PA 2ZWHA 4CJQA 3FZHA 3CPWM 3MEEA 4FJMA 3SJJA 3VEZA 3W3DA 4ELTA 2OPQA 1VQ4N 3LM2A 4FCYA 1XHZA 4OPKA 4FW1A 4EZ6A 4CF0A 4PKGA 1YHQN 3KD1E 1EP4A 2BH1A 1VSLA 4K42A 4DQPA 1SAZA 3QBXA 2QWPA 2WC9A 5GINA 4CFAA 1EO1A 4DUZK 1S3XA 3K5LA 1LAWA 5JVHL 1XMQK 1VSFA 4DQRA 3MCAB 3IMXA 4A5AA 1IG8A 1K8AO 1UWBA 1U6ZA 1N36K 3L2UA 2VG7A 1E4GT 4B9LA 3HOSA 1BO5O 1RT2A 4DHYA 3KJVA 2P9UB 3SQ2A 1J54A 2O4GA 4LC9B 4ID1A 3C0BA 1TK0A 2NRHA 1DT9A 3KKRA 1KD1O 2HNDA 2HHWA 3L4QA 2YHBA 3TSPA 4BE2A 4FJ5A 3HJFA 1VQ5N 3OY9A 2P9IA 1BWFO 1NMDA 3QDKA 5EXWA 3VA0A 3P4IA 4DQIA 2HBLA 5BN9A 2Q3SA 4FLYA 4E7JA 2E1ZA 4E89A 3C95A 1VQ6N 2FBTA 1L5UA 2O8FB 1BI4A 3AVIA 4BC2A 3AY9A 4CHOA 4B9VA 4KHPK 3UIQA 4YOYA 4BDZA 1TYQA 4B3MK 3SAFA 4DTUA 3E9OA 3MECA 4KI4A 2YKMA 3LL3A 3BGRA 4NLBA 2G8VA 1O13A 4DKWA 4HTUA 4XH5A 3OYKA 4C1NK 3AVMA 4CD3A 1WSIA 3CERA 5BRFA 2CGLA 3OYAA 2W6LA 3U6FA 3DLKA 3Q7CA 4CBUA 5MLCQ 1TK8A 3EEQA 4OGEA 2A41A 1X3MA 3RMAA 4RW9A 4WE1A 3DLRA 1U48A 2VG5A 3NGYA 4DTRA 3NHGA 3IUCA 4LY7A 4DQ8A 4FJ9A 3AO3A 3ZYYX 2XRIA 4H5TA 3HM8A 3NH0A 3SI6A 3PO5A 4CESA 3KD5E 4AHUA 2ZM6K 1D9DA 5LY3A 3T1YK 1RBSA 5HRSA 1YT3A 4BR0A 3R8EA 1U2VB 4CHZA 5B8HA 3V9SA 3CCRN 1U04A 3I0RA 4C8KA 4QS7A 2VGMA 3BZCA 3VQEA 1NGJA 3VQ8A 1ATSA 4X64K 4DS4A 2HHHK 2FF6A 4ELUA 3GDQA 1HNZK 3L2VA 2YNGA 3VEVA 3RMCA 5BPLA 5AZIA 1J53A 2E88A 1OVQA 3SJHA 4CGFA 4DTJA 4KV8A 4IJNA 1C1CA 3CHWA 3H45C 4BGAA 1RT6A 4H5WA 4NO7A 3T1HK 3T19A 3HPGA 4FJKA 4FK4A 4M3WA 2Q0RA 4LF5K 1ILYA 4A59A 4WQ5C 5E41A 3V9WA 3THVA 2GWKA 4BGBA 1RCHA 1NK6A 5J2NA 2O8DA 1WBBA 1YVNA 4JKGB 1BCMA 3VEXA 1HNIA 2CGKA 4M45A 3EYZA 5T7BA 1QZ6A 1SKSA 3SPYA 3QINA 1OVYA 1FJGK 3KLGA 4DTSA 3TWHA 2FF3B 1YJWN 4JKCA 2P9LA 2QKBA 4WFBL 1KAZA 3CJAA 3NMUA 1ATRA 3VQ5A 2QW9A 3THXB 4A2AA 3ZSYA 2V52B 3E1YA 3NH1A 4CFDA 3DRPA 3WNFA 2PYLA 1OH6A 5KTQA 1BG3A 3VQAA 1NKCA 4BC4A 4B1XB 4JHDA 1XNRK 3ATVA 2X78A 4CGHA 4PL8A 3I33A 3MEGA 3EZ5A 1IBKK 3NF7A 3OS1A 2VQEK 3M8RA 1J9AA 2D0AA 1A5VA 3DXMA 4K25A 4B1UB 3RWUA 4B1VA 2RKIA 1LCUA 3SUNA 2PY5A 3V6DA 4CHPA 1W7AA 1ZBHA 1RDCA 4B9NA 3MWPA 4FJ8A 5FPMA 3KK2A 2ZGZA 4AM6A 3O9TA 1SKWA 3LWMA 5AQZA 3ULEB 3O9SA 1VSMA 4EAHD 1GLDG 1HJRA 3VESA 5BPNA 1KVAA 4JEPA 1D9FA 5AFUA 3HXMA 1BGXT 2E2PA 1E3MA 2UXBK 4JS5A 4DR7K 5KRTA 2FBYA 1BIUA 3DLBA 5KGWA 4JLHA 4CJWA 4CIGA 2HMIA 4G9ZA 5AQGA 1EKEA 3C6UA 3CQ8A 1T44A 2OA8A 3EKUA 4M7XA 2Q97A 2OCEA 3A8YA 4RTFD 2R7YA 5A2QO 4FYDA 5E26A 3LPTA 3AO1A 1S6PA 5CE3A 2HHQA 2E2OA 1YAGA 2P9UA 2P9KB 4Z4EA 2IS3A 2X74A 1D4XA 4GNIA 5ADXA 3G71N 4HUFA 3ID8A 2PFUA 3EO3A 2UU9K 3QEIA 5C10A 2D5RA 4HWIA 4GW6A 4BWJA 4IG3A 3V4IA 4CJUA 3B6PA 4WCEL 1WAJA 4BR9A 5F2RA 5CZ1A 1LV5A 4RCHA 3KLHA 1SKRA 3D2FB 3QBWA 1Q9YA 2WFBA 3EKSA 4JI8K 1VSKA 4WFAL 4JI7K 4HTLA 3V81A 3CMAN 5M1KA 3GOIA 2O8FA 3ZETB 3AVFA 3SUPA 1KSPA 2P9PB 3DLLL 3DMJA 4W5RA 2GX9A 4XH4A 4A61A 1WUAA 1RTHA 4JKHA 2I7PA 3DXKB 1ZBSA 1QQOA 2Q0UA 1V4TA 4RW8A 3F9MA 1K9MO 2NRXA 3WEEB 3AV9A 3HM9A 4AILC 3ZX2A 4IDKA 5AQQA 1S22A 3I8BA 4N41A 1IG9A 1ZXOA 4JK9A 1GLAG 4NXMK 3LAKA 1NNEA 1C0FA 3HL8A 3A2FA 4C8OA 3NFAA 5KI6A 1SL0A 4Z4FA 3VPZA 3MN6A 2E1YA 4M41A 3ZX0A 4YDUC 1VQNN 3KVGA 3SK3A 3TSUA 1B9DA 5TKWA 3CG7A 1NGAA 1N6QA 4DFMA 3HK2A 4CFBA 2HHTA 3DLGA 3EZWA 3AVGA 4Z0UA 2J4RA 2KZMA 1K6YA 2GBZA 3O9RA 3U9DA 2Q31A 3FFKB 1U2VA 4AHRA 3AVHA 1BUPA 3VQ4A 5HRPA 4DS5A 1YJNN 1HKGA 3UB5A 3J81O 1VK0A 2FXUA 3ZSWA 4CFCA 5LJVA 4KPYA 3GL1A 1UA1A 1M1KO 4FJJA 1WAFA 2G8UA 3FZKA 3M8SA 3U9ZA 3RRGA 3ASMA 3CF5L 3K9JA 4MQ3A 2Q1NA 2I7NA 3OYJA 4CCHA 5AQMA 3SPZA 4GVEA 3ZSRA 4DR4K 1IKYA 5CZ2A 3O80A 4NYFA 2GUPA 3NF6A 3THWB 1OKJA 4ZHRA 3DOKA 3H6EA 3NVMA 3ZT2A 3VGMA 4YORA 3MN5A 3NGZA 1HRHA 4K0KK 2HHXA 1S1UA 3L2WA 2VWJA 1T03A 3WUHA 1RBUA 1EX4A 3JXUA 4KTQA 5GADP 3OJSA 3G0ZA 4CERA 4JAXA 3QIPA 2OZMA 4NCGA 4ISFA 5C25A 2OPRA 3N4PA 1C0UA 4JKGA 3J8AA 3JS6A 4JKFA 3TAEA 1J5EK 4I9QA 1W97L 5C0YA 2O4IA 1MDUB 1JL2A 3VEOA 3VN5A 3ULDA 1N32K 3MXMA 4W5TA 4CEQA 1KRPA 4CJ4A 2B6AA 3E66A 1ZBFA 1T7PA 3H1VX 5AQNA 2XY5A 1UA0A 2IDOA 4FM0A 2YHYA 2O8CB 4JV5K 3GBTA 3THXA 1WNSA 1QQCA 1W0HA 4FPBA 3LDSA 1D8YA 3L3VA 1S5JA 1BA0A 3SQ1A 4OO1J 4YHHK 5AQKA 3O1BA 2EX3A 1LWCA 1YF5L 1NJZA 3FGUA 3C7NB 2YKNA 4DU4A 1LW0A 2OANA 1EQYA 3VA3A 2LSNA 3IKMA 2XY7A 2YHWA 3P38A 4DR2K 4KHQA 2HVIA 3WXKA 4Z4HA 5F0XA 4IDHA 2Z1GA 1S9GA 4FVUA 2XO7A 1ASUA 5AQTA 3CMEN 4FM1A 3H3NO 1DTQA 5HRNA 4H0XB 4M3YA 3ULEA 4MO5A 4EHUA 3SQ0A 2A1SA 4F2RA 4CJVA 4CZKA 1LAVA 1SZ2A 4FJLA 2NLXA 4FJXA 4EFHA 1QVFM 1X3NA 5M1QA 2VWKA 3SAHA 3OYFA 3LP0A 4JI2K 3S41A 1U49A 4Y1DA 4DV5K 5EOYA 4I6MB 3CM5A 3TR8A 3OYGA 1JLGA 2OPPA 3KK7A 1HKCA 5C42A 2P9KA 5FDLA 4CJFA 4N76A 1X1PA 1VQ7N 1HNXK 5JS2A 1NOYA 3AO5A 4CEBA 1RDWX 5I9EB 1NGHA 3D45A 4KFBA 3I56N 3MDQA 4X66K 1WSFA 4IKFA 3LDLA 4CK2A 4FJNA 5AQUA 1L3SA 1DLOA 3D2FA 1RBRA 3AVBA 4BR5A 3CC4N 1Q81O 2F8SA 3SLCA 3WQTA 4YOWA 1VQPN 1SS6A 3ZSZA 3ZETA 1JLBA 2GWJA 4LSLA 2P9PA 4MLEA 3K58A 4U7BA 5CR4A 1DKGD 4CJ5A 4IFVA 2OZSA 3DXKA 1HNWK 4KKOA 3U3GA 4YNQA 3S3NA 4LFBK 3LP2A 4N47A 5BREA 4YFUA 1EXQA 3WEEA 3BF3A 4HCBA 5FPDA 2Z1JA 2NRZA 4FWQA 3G25A 3T69A 3OHRA 5SWMA 5BR9A 3R3LA 4JI1K 5CY4A 1GLJO 1YJ9N 2G8WA 1U47A 2FC0A 3L3UA 2ZGYA 4CF8A 4DV4K 3DYAA 1HYZA 4B3OA 1J5OA 3KHYA 1R0AA 2ASOA 3EE8A 3O08A 2F9TA 4CZFA 2UYTA 3R1XA 3VF2A 3P1GA 5AZJB 3NGIA 4UY8O 3ZT3A 2NRWA 4Z94A 3OYBA 4JD2B 3CCLN 3SBGA 3V1OA 2A42A 4UQGA 2ZD1A 4KTWA 3KK1A 4BR4A 5GIPA 1Z26A 4CF1A 5JLFA 4M7YA 4Y0WA 1JJ2M 1CZBA 3AO2A 2G8HA 1VQMN 3TU5A 2P9SB 3NDKA 2E20A 4C8NA 1NJWA 2RN2A 4FWLA 3QB0A 3G4SN 1P8ZA 2CH5A 3BUZB 4CECA 4DSIA 5LMUK 3OBYA 1RDDA 3EL2A 1NG9A 4CJLA 4E0DA 5AQYA 4FWNA 3O8MA 2HB5A 4CW7B 1HJOA 3KLFA 3LWLA 3ZSXA 4KHNA 3P31A 4IFEA 3TAGA 3THWA 1EETA 5HROA 3ZX3A 4BC3A 1UOCA 2DTUA 4F8RA 4IFYA 1CLQA 3JYTA 3ENHA 2O8BB 1NK8A 4DCHA 3OA9A 1B92A 1NGEA 2KHOA 4FLZA 4B1ZA 5C2FA 3K5MA 5D3GA 4KHUA 1MU2A 4K43A 2IIRA 2G8IA 1IKXA 4TSXA 1QE1A 4FO0A 4QAGA 1QSSA 3F2KA 3VQBA 3IG1A 3IRXA 3D0PA 4KB1A 2YI1A 5FLXO 3CFPA 1JLAA 3K9KA 1DGKN 3CC2N 1HUXA 2QI2A 1VQKN 4I2QA 2UXCK 2B5JA 1T05A 5BN8A 4KREA 3OW2M 4DSLA 2O8CA 4Q5VA 1BOTO 1T3VA 1HPMA 4E19A 1NM1A 3CPEA 3FZLA 3OYIA 2QM1A 4ZTFA 1EWQA 2V7ZA 3AA4A 1E4FT 1RT7A 4BQLA 1Q18A 4DV7K 5ADXH 2A5XA 4CHNA 1RDAA 2BUPA 3E01A 5TKYA 4BRLA 4OKJA 4FPAA 1S1XA 1BA1A 1YTAA 5HLFA 4DTXA 5AQPA 3DLHA 3UKUB 1JCEA 2E6MA 2EHGA 3AVAA 3O3HA 4DLEA 1NGDA 3V9UA 2PAVA 1Y64A 4JKEA 3T7ZA 2OTJN 1TAQA 4BG9A 1DTTA 4CJ3A 3TSQA 3TTFA 3BP8A 4BRQA 1VSDA 5AQXA 3RR8A 4DTPA 2HHSA 1FKPA 3TARA 2VYPA 4LF8K 1XHXA 3AVCA 1NJYA 1WN7A 3HOTA 4LFAK 4FK0A 3QLHA 1TKDA 3OVNA 3OTOK 1TKXA 2DY4A 3TAFA 2YNIA 4CEAA 3D6RA 1Z6RA 4I6MA 1GOAA 4OLBA 3BY5A 2UUAK 2ZJQL 4KHYA 2IVOA 4KRFA 3I55N 4Y1CA 3M5RA 2Z1HA 3MX2A 3LANA 5AQIA 4OPJA 1HQUA 2P9NB 1W9HA 4LH5A 2E2QA 2OYQA 1GLCG 4I9LA 2RHKA 4BRMA 1HQEA 1NOZA 2P1JA 5AQSA 1IBMK 4FWPA 4IOCL 2KLAA 1KVBA 3DM2A 4BQZA 5GAEP 4H4MA 4PWDA 3LZIA 3S9HA 2BTFA 3QIOA 4M3ZA 4O8KA 3CC7N 3A5LC 4BRHA 5LL6Z 3BDPA 5J2PA 4CZMA 5DMRA 3PUFA 3U3YA 1RT4A 4E1NA 2FSKA 4FZYA 1W2BM 5KQDA 1YTUA 4OPHA 3WXIA 2VG6A 3AVJA 2YJFA 3WNHA 3SYZA 3CM6A 3AA2A 3BEXA 4DQQA 4KI6A 2YNFA 4JI3K 2QXFA 1TKZA 4CJKA 1JXEA 3LP1A 1BCOA 1RTJA 4DR3K 4NCAA 2AA4A 5H1SQ 4FLTA 3PSFA 2YV0X 5AZJA 1I94K 4E3SA 4CJ7A 1VQLN 4CGIA 2ZJRL 4LD0A 4JD2A 5FPNA 3DJCA 4AH9A 5F1XA 3UKRB 1QTMA 3I8DA 2PYJA 2F4VK 1QHTA 1RFQA 2ZE2A 3VQ9A 3QEPA 2P9SA 5GIOA 4BE0A 2QKKA 4GKJK 2RPIA 4B8AB 2HNYA 4FJHA 1C0TA 1Q86O 4Z4GA 1BIZA 4CZIA 2KQ2A 2HMPA 3OJUA 1L3UA 4FWRA 4BRPA 2X6NA 1KCFA 3MXIA 3RMDA 2OPSA 1ITGA 3SZ2A 3DWLA 1SL2A 3M8PA 4DR6K 1FW6A 1C1AA 1XUPO 2P5OA 3ATUA 1RTIA 2O8BA 2W6KA 2QWOA 1RILA 3TAMA 2GEMA 3FE1A 1QSLA 3OBWA 1WSHA 3V9XA 2CGJA 3K5OA 2DFHA 4YOXA 2FSNA 2QWRA 4WYBA 3O4WA 2AJQA 3PX6A 5JS1A 2O8EB 4FWSA 3M6GA 1ASVA 1OH5A 3NVKA 3DI6A 2ZF5O 4IO9L 1GOCA 2GELA 3LALA 3C65A 3FZFA 3CCUN 3CFOA 4DF4A 3VERA 1WBDA 1FKOA 1Y97A 5I42A 2IC3A 4DLGA 4WQ4A 3QEVA 1NK9A 4FZXC 5GAHP 2IGIA 2QWMA 4R79A 4BRAA 3T3FA 3RTVA 4H5RA 1TKTA 2RE2A 4FJ7A 3LDOA 1WLJA 2BGGA 4CF9A 3IDHA 1SUQA 1JLQA 1H1VA 4DB3A 4KAZA 2A1RA 3SMSA 2YCHA 3LDQA 2V7YA 4YY3K 3HTVA 4JRPA 3MN9A 4O0IA 2KFNA 3VTHA 5DK5A 4U67L 4B8CA 1XC9A 1QVGM 1F21A 3L8BA 4CZGA 3HP9A 4LF9K 3AVKA 5HBMA 1HYSA 1R59O 1YUWA 1S6QA 3UKUA 1KFSA 2QTDA 1CZ9A 2NRTA 1Q7YO 1NLVA 4J2DA 5HOOA 3L4IA 3LDNA 1NBWA 1FK9A 3TI0A 4IO8A 2F8TA 3ZEUB 4BR7A 5KPTA 3QO9A 1C0GA 4CI6A 4BRNA 4DFJA 3O9UA 3QFPA 5AQJA 4L8RB 4FZZA 4ISEA 3OYLA 3D2EB 4AQYK 1RT5A 3SCXA 1J6ZA 2KZZA 2RF2A 3WNGA 2YX6A 2FBVA 3EY1A 4OKEA 2VWBA 4FVMA 2HHVA 4DV1K 3AGRA 4RW4A 3SMPA 1Z05A 3RR7A 2HVHA 3RMBA 3TPQA 3ZLJA 4BDYA 4J2AA 4L3QA 1VRTA 3ZSVA 4GV9A 3AAQA 2A6AA 3NH2A 4CIFA 4RG8A 4FWKA 4CJPA 4H0OA 3LP3A 4ZTJA 4FSVA 2ASMA 2P9NA 1N34K 2F96A 4NCBA 1IH7A 3VF6A 2Q2RA 4JYAK 1NGGA 4OJRA 4BRGA 2ASPA 4B9QA 4CF2A 4OLAA 1SV5A 4O4GA 2DPNA 1NGCA 4RWTA 4PY5A 3H08A 2YHXA 1GLFO 5C24A 1MA9B 3THYB 2FSJA 4JK8A 4ISGA 3S3OA 2QXLA 2VGNA 2BE2A 3SV4A 4FOIA 1KLNA 3LZJA 1S9EA 4DSJA 5KPRA 3RSEB 3VTIA 4H0YB 4DSFA 2VCPA 4AHSA 3ALYA 2WTUA 1D5AA 3MN7A 3MMVA 3NAEA 1HNVA 3NE6A 3CQYA 3WXLA 2KTQA 1BU6O 4FWMA 2UXDK 2KFZA 3KTQA 4NYNA 4DFPA 4WF9L 1EWRA 1T6CA 1Z25A 1RDBA 3M8QA 5EX5A 3QICA 1ZYQA 1CZAN 3AVNA 1C0MA 5EVZA 4BY9C 4A62A 5JMVA 4BDPA 2YJEA 3MAQA 3RRHA 4YOVA 3O4QA 2HHUA 5C2DA 4B3RK 3NF9A 4J2EA 3V1QA 3GG4A 1VSIA 3ZSQA 1NGFA 1Q8IA 3L2QA 5J1EA 3VQDA 2Y1JA 1UAXA 4BVOA 3SBTA 3VGKA 4CBXA 3PLAA 1WB9A 4DG1A 4DV2K 4MO4A 3DRSA 3EE9A 3VOVA 3J7ZO 1X9WA 3A5NC 4H0VB 4BRFA 4GV3A 3NBPA 3N4QA 3FZMA 3CQXA 2JWLA 4O5FA 1VQON 1QQMA 1ZBIA 1YIJN 2DFEA 4ILJA 4XH1A 4JN4A 4NLCA 4PL7A 1NK7A 1IO2A 2IAJA 3SNNA 3ISNC 2YNHA 4O5BA 3QERA 5AQVA 1KAXA 2HBMA 4OKKA 4LF7K 4DUYK 2W40A 3VQ6A 1Q82O 4IOXA 3CI5A 3CJ1A 3OYCA 1VSHA 3ZT0A 3EN9A 1TV6A 3OYMA 1GLBG 3QMLA 3TANA 3R6MA 4MLHA 1IKWA 5JLHA 1U4BA 3KLEA 1K73O 4FXDA 3CCSN 3SQ4A 2JGUA 4CEOA 4JS4A 4I7FA 1JXBA 2DFFA 4BG8A 1ZC6A 2BANA 2GTDA 3NF8A 2CH6A 2F9WA 3CIPA 3O9QA 3TAQA 2O8EA 4X62K 2V51B 2X6SA 3VF4A 1FXXA 3QNOA 2GUIA 3J80O 2HNZA 5DM7L 3VEYA 4DSEA 3BZKA 3IAYA 1RBVA 4B9SA 3F73A 3MXJA 2PBDA 4EHTA 2D0CA 2YHAA 3OYEA 4DU1A 4F4KA 1IBLK 4CE9A 1TL1A 1JLFA 4AHCA 4W5OA 4G1QA 3WXJA 5CHIA 1Q9XA 4KH4A 2P5GA 4DR1K 4CGJA 3GE1A 3SV3A 3A5OC 4IG0A 1OH8A 4KO0A 3ZT1A 4H5VA 5M1NA 4FWOA 3V9ZA 1XWLA 4Z4CA 3QEWA 4CEDA 5EY4A 3ITHA 1BL3A 5HL7L 1KLMA 3VEWA 5JICA 3BF1A 3QFUA 4K8XA 4CK3A 1KFDA 5AQWA 4H8KA 1WSEA 3O3GA 3ZEUA 1YI2N 3B8AX 1KC8O 2EWSA 2QEXN 4OPAA 3P5JA 1X9SA 1QS4A 1QZ5A 4FLUA 3A5MC 1JKHA 3D2EA 2HF4A 4CEEA 4B9UA 1QHAA 2D0PA 1OH7A 3CETA 3HZ6A 1NMNA 4JKBA 4B9TA 1C1BA 5AFUH 1S1WA 5HP1A 4CZLA 5K14A 5C12A 2FBXA 3KWGA 1VAZA 2Z1IA 5C15A 3MEDA 4CZEA 4DTMA 1NU0A 4CGDA 4JNEA 3O5BA 4C8LA 4IJAA 3PIPL 3M1FA 1JLEA 4V19S 4PA1A 3WXMB 1BQMA 3LPUA 4E7KA 4FOEA 2QWNA 2WOMA 3KWIA 4DV0K 4CHYA 4CVNE 3MX5A 1L3VA 3C7NA 1T8EA 3FFIA 3HVRA 4R5PA 4ILHA 4CEFA 3THYA 2JWKA 1T6DA 4GY2B 2G8KA 4PUOA 4WFNL 3K0SA 4IZ9A 3O1WA 5BRDA 1SL1A 1KXPA 4NXNK 3RSEA 4B3TK 4FLWA 1MWMA 1HLUA 1M90O 1GLLO 3C94A 4BREA 2W41A 2IOCA 3QEXA 3J7AP 1NKEA 4JKAA 1O1WA 4BRIA 1U45A 1ASWA 3CJBA 5E84A 4RW6A 1RNHA 1HMVA 1GOBA 2B4JA 1JCGA 2D4WA 2H3GX 3OYHA 1SQKA 3HPOA 5BR8K 4GVMA 5DM6L 5KGXA 3T1AA 3HBTA 3LM9A 1TL3A 3IFRA 1P90A 1B9FA 4WQ4C 5AQHA 4B1WB 3CCJN 2Y1IA 2QWQA 5FROA 3LAMA 1NK0A 3R9PA 4EIAA 2NZTA 1LOTB 4FLVA 4IEEA 3P83D 4B3SK 4IOAL 4HCCA 4JI0K 1WSJA 3PX4A 3H3OB 3K2PA 1K8KB 3TABA 1LWFA 3HRGA 4M3XA 4DMNA 1XQSC 3PIOL 1HKBA 5IT9O 3CCQN 3K5NA 3AVLA 1NWKA 5FRMA 1XC3A 1XMOK 4DU3A 4H0PA 4AHTA 5KPZA 1IKVA 2NRVA 4JKDA 4JI6K 4BC5A 4BRDA 2XY6A 2QK9A 4CJRA 2HBJA 4HUEA 4BACA 3C6TA 4M3UA 4F3TA 5ELZA 4KHWA 2A3ZA 4CZJA 4RW7A 3JSMA 2E2NA 1L3TA 4B08A 3A0IX 1HPZA 2ZQBA 2OTLN 4KHSA 3I0SA 1X9JA 1HYVA 1ATNA 1GLEG 3AO4A 2E5LK 4KB0A 3JAMO 4XIUA 4ILGB 4AM7A 3TTDA 5J2QA 4E1MA 2FLOA 4O55A 5AR0A 3TTCA 3C6HA 2KW4A 4BR2A 3KLIA 4FJIA 1RBTA 4CK1A 4FM2A 3KZBA 1WOQA 3L2RA 1NK4A 3PY8A 2IVNA 1TAUA 4DWIA 3W0LA 4AF1A 4Z4IA 3CYMA 4PKHA 4LF6K 1I3AA 4CJTA 5EU7A 3OS0A 4IXCA 3HVTA 4M63C 3QETA 1S1TA 3E9PA 2HSTA 3ZSOA 1VQ8N 3HSCA 5JVGL 4KBOA 5KRSA 4H03B 3U8XA 4EP5A 2D0BA 4IBNA 1VSEA 4DSKA 4JI4K 1JCFA 3CFRA 4PHTX 4XEIA 4ICLA 1RT3A 1TGOA 2E4LA 3B6OA 3IS9A 3PV8A 1BQNA 4O8UA 2XY8A 4CBWA 2NUBA 4DFKA 3PX0A 4LFCK 1KVCA 3CCEN 1IJJA 1RDUA 3HYFA 3MWTA 4QCLA 1G99A 4E7IA 4QS8A 2KKZA 2NNWA 4BWMA 1VSJA 3AA5X 5AQFA 1VQ9N 1BHLA
chains in the Genus database with same CATH topology
1SV5A 4O4GA 1X9MA 3P1GA 3NGIA 1JL1A 1BCMA 2P51A 3ZT3A 2G8FA 4M3RA 1HNIA 3ZCMA 3H08A 4PY5A 3OYBA 5C24A 4M45A 3V1OA 3EYZA 2E6LA 4KB0A 5T7BA 4UQGA 2ZD1A 4KTWA 4DTNA 3KK1A 1NKBA 1Z26A 4CF1A 3S3OA 3AA3A 1SKSA 4KTZA 3SPYA 3KKSA 2BE2A 3QINA 3SV4A 1KLNA 3KLGA 3LZJA 1S9EA 4DTSA 3TWHA 4DSJA 1A5XA 1CZBA 3AO2A 2G8HA 1JLCA 1REVA 3NDKA 3ZT4A 2QKBA 4C8NA 1NJWA 2RN2A 3VQ5A 4IKFA 4CECA 4DSFA 4AHSA 3SUOA 4DSIA 3ALYA 3ZSYA 4CGGA 5I3UA 3NH1A 1RDDA 4H4OA 4CFDA 1D5AA 1YVUA 3DRPA 4DTOA 1RTDA 4FJGA 4ID5A 3WNFA 3NAEA 1HNVA 4MFBA 3NE6A 2PYLA 4CJLA 4E0DA 5KTQA 3VQAA 3KIOA 1LWEA 1NKCA 4OLAA 2KTQA 4FW2A 2KFZA 3KTQA 2HB5A 4NYNA 4DFPA 1Z25A 2X78A 4CGHA 1RDBA 3M8QA 3HSTB 2ATQA 3KLFA 3LWLA 4LSNA 3MEGA 3EZ5A 3NF7A 1ZYQA 3OS1A 3ZSXA 4KHNA 3M8RA 1J9AA 2D0AA 3AVNA 1A5VA 1C0MA 1EETA 3TAGA 5HROA 1UOCA 4BDPA 2QK9A 4ELVA 2DTUA 4F8RA 4IFYA 3MAQA 3RRHA 3QNNA 1CLQA 3RWUA 3JYTA 2WONA 1NK8A 3O4QA 4PQUA 1B92A 4M42A 2HHUA 4FLZA 3QESA 2RKIA 1KTQA 5J2MA 3NF9A 3SUNA 2PY5A 3V6DA 4CHPA 1ZBHA 3K5MA 4J2EA 5D3GA 3V1QA 1RDCA 1VSIA 4B9NA 3ZSQA 4KHUA 1MU2A 4E7LA 1Q8IA 3L2QA 4J2BA 4EP4A 5J1EA 4FJ8A 2G8IA 3KK2A 3VQDA 1BI4B 1IKXA 2Y1JA 4TSXA 1QE1A 1UAXA 4QAGA 1SKWA 3LWMA 1QSSA 2JLEA 1VSMA 3VQBA 4DG1A 3F9KA 1HJRA 3K57A 3IG1A 3IRXA 5CYQA 1KVAA 3DRSA 3D0PA 1D9FA 3HXMA 4KB1A 3CFPA 1BGXT 1JLAA 1X9WA 4JS5A 4I2QA 5KRTA 2FBYA 1BIUA 3DLBA 2B5JA 4JLHA 5KGWA 4CJWA 4CIGA 3G10A 1T05A 2HMIA 4DSLA 3PO4A 3NBPA 4KREA 1EKEA 4Q5VA 3C6UA 1G15A 4F2SA 3CQ8A 3VQQA 3V1RA 2OA8A 3HP6A 2R7YA 4HVJA 4O0JA 3VQ7A 4FYDA 3LPTA 3DRRA 3AO1A 4E19A 2I5JA 1VRUA 1S6PA 4DQSA 1NK5A 1ZBIA 2DFEA 2HHQA 3OYIA 1NK7A 4Z4EA 1IO2A 2IAJA 3SNNA 2IS3A 2X74A 3ISNC 2YNHA 4CJSA 4O5BA 4HUFA 3QERA 3AA4A 4K8ZA 1RT7A 4W5NA 4OKKA 4CHNA 1RDAA 3QEIA 2D5RA 3E01A 3SUQA 1LW2A 3VQ6A 4GW6A 4BWJA 4IG3A 3KK3A 3V4IA 4OKJA 4CJUA 3B6PA 1WAJA 1S1XA 1YTAA 5HLFA 1QSYA 5CZ1A 1VSHA 3ZT0A 3OYCA 3KLHA 1LV5A 4DTXA 3HPHA 1SKRA 1TV6A 3DLHA 3HO1A 1Q9YA 1ZBLA 4CEZA 3OYMA 2E6MA 4LH4A 2EHGA 3AVAA 3TANA 3O3HA 4DLEA 3V9UA 1VSKA 1IKWA 1U4BA 4Q0BA 3TAPA 3KLEA 4M3TA 1TAQA 3V81A 4FXDA 2ETJA 3SQ4A 1TK5A 2JGUA 4HUGA 1DTTA 3AVFA 4CEOA 4CJ3A 4JS4A 4I7FA 3SUPA 1KSPA 1CXQA 1JXBA 2DFFA 2BANA 3NF8A 3TAQA 3DMJA 1WSGA 4O44A 1VSDA 4W5RA 3RR8A 1ZBUA 4DTPA 2X6SA 1FXXA 2HHSA 3QNOA 1RTHA 5SZTA 2GUIA 1FKPA 2HNZA 3TARA 3VQCA 4N5SA 4DSEA 1XHXA 3AVCA 4RW8A 1NJYA 3IAYA 1RBVA 1WN7A 3AV9A 4B9SA 3F73A 4B9MA 4FK0A 3HM9A 3QLHA 4AILC 3MXJA 3OVNA 1TKXA 2GV9A 4IDKA 4AHVA 1TKDA 2DY4A 4N41A 3TAFA 1IG9A 2D0CA 3NCIA 4DF8A 1CXUA 2YHAA 2YNIA 3OYEA 4HHTA 4CEAA 3LAKA 4DU1A 1I39A 4F4KA 4FJIA 3HL8A 1GOAA 3A2FA 4OLBA 4C8OA 3NFAA 4CE9A 4KHYA 5KI6A 1SL0A 4EZ9A 1TL1A 4Z4FA 4KRFA 1JLFA 4Y1CA 4AHCA 4M41A 4W5OA 2Z1HA 4G1QA 4GMJB 3LANA 1C6VA 1B9DA 1Q9XA 2PZSA 3OYNA 5FRNA 3CG7A 3VQPA 1N6QA 4DFMA 4OPJA 1HQUA 1S1VA 4CGJA 2P5GA 3HK2A 4CFBA 3SV3A 1XI1A 1W9HA 4LH5A 3DLGA 3OS2A 2HHTA 2OYQA 4W5QA 4CHQA 4I9LA 3AVGA 4IG0A 1HQEA 1NOZA 2P1JA 4Z0UA 4KO0A 3ZT1A 4JRQA 2KZMA 3DLEA 2XHBA 1K6YA 3V9ZA 2BDPA 4OVLA 1XWLA 4CIEA 2GBZA 1KVBA 3DM2A 4Z4CA 4OGCA 2W42A 3QEWA 4CEDA 4H4MA 5HRRA 4PWDA 1RT1A 3ITHA 1BL3A 3DOLA 4CF2A 3LZIA 4AHRA 1KLMA 4E7HA 3AVHA 3S9HA 4K8XA 4FK2A 2HW3A 3VQ4A 4CK3A 1NJXA 5HRPA 1KFDA 4DS5A 3QIOA 4H8KA 1WSEA 4M3ZA 3O4NA 1BISA 3O3GA 4F3OA 1VK0A 4FLXA 3ZSWA 4CFCA 4KPYA 1UA1A 4FJJA 1A5WA 1N5YA 5CYMA 3BDPA 5J2PA 1WAFA 2G8UA 5DMRA 3P5JA 1X9SA 3K59A 3PUFA 1QS4A 3M8SA 4FLUA 3U3YA 3S3MA 1JKHA 1TVRA 3RRGA 1RT4A 3ASMA 4E1NA 2ITGA 4CEEA 4B9UA 4MQ3A 4FZYA 3HT3A 4B9TA 1C1BA 4C8MA 3OYJA 1YTUA 4CCHA 1S1WA 2VG6A 3WNEA 5HP1A 3SPZA 3AVJA 5K14A 2FBXA 3ZSRA 1IKYA 2Z1IA 5CZ2A 3WNHA 4QOZB 4N56A 4NYFA 3OYDA 3O3FA 3MEDA 3SYZA 3CM6A 3NF6A 3AA2A 4DQQA 4KI6A 4BE1A 2YNFA 4CJEA 4DTMA 4CGDA 4ZHRA 4I2PA 3DOKA 3ZT2A 2QXFA 4CJQA 1TKZA 4C8LA 3NGZA 1HRHA 3MEEA 4CJKA 3SJJA 4FJMA 1JLEA 4PA1A 4ELTA 2HHXA 2OPQA 1S1UA 1BQMA 1JXEA 4FCYA 1XHZA 3L2WA 2VWJA 1T03A 3LPUA 1RBUA 1EX4A 3LP1A 1BCOA 4OPKA 4E7KA 4KTQA 3OJSA 2WOMA 1RTJA 4FW1A 4EZ6A 3G0ZA 4NCAA 4CF0A 4CERA 4FLTA 3KD1E 1EP4A 3QIPA 2OZMA 4NCGA 2YV0X 2OPRA 5C25A 1C0UA 4CHYA 3TAEA 4E3SA 1L3VA 1VSLA 4I9QA 1T8EA 3FFIA 4DQPA 2O4IA 3HVRA 4R5PA 4CGIA 1JL2A 3VN5A 4LD0A 4CFAA 4CEFA 3ULDA 3MXMA 4W5TA 4AH9A 3K5LA 4CEQA 1QTMA 4CJ4A 1KRPA 2B6AA 1ZBFA 1LAWA 2G8KA 3I8DA 1T7PA 2PYJA 4PUOA 1QHTA 2ZE2A 3VQ9A 2XY5A 1UA0A 1VSFA 4DQRA 2IDOA 3QEPA 4FM0A 1SL1A 4BE0A 4FLWA 2QKKA 2RPIA 4B8AB 1UWBA 2HNYA 1WNSA 1QQCA 1W0HA 4FJHA 3C94A 3L2UA 2IOCA 3QEXA 1C0TA 4Z4GA 1NKEA 2VG7A 1BIZA 3LDSA 2KQ2A 1D8YA 4B9LA 3L3VA 1O1WA 1RT2A 1S5JA 3OJUA 1L3UA 2X6NA 3KJVA 3SQ2A 1U45A 1J54A 1KCFA 3SQ1A 1ASWA 4RW6A 2O4GA 1RNHA 3MXIA 4ID1A 3RMDA 1HMVA 1GOBA 2B4JA 1TK0A 3OYHA 2EX3A 3KKRA 2OPSA 1LWCA 1ITGA 2HNDA 2HHWA 2YHBA 3HPOA 1NJZA 4BE2A 3SZ2A 1SL2A 4GVMA 3M8PA 4FJ5A 3HJFA 1C1AA 5KGXA 3OY9A 2YKNA 3T1AA 4DU4A 1LW0A 3VA3A 2XY7A 2LSNA 2P5OA 1TL3A 1RTIA 3VA0A 1B9FA 1RILA 4DQIA 3TAMA 2Y1IA 5FROA 3LAMA 1QSLA 2Q3SA 1NK0A 4KHQA 2HVIA 1WSHA 4Z4HA 4FLYA 3V9XA 4E7JA 3K5OA 2Z1GA 1S9GA 3C95A 3P83D 4E89A 2DFHA 2XO7A 4FLVA 2FBTA 1L5UA 1ASUA 4HCCA 1WSJA 1BI4A 3PX4A 3K2PA 3AVIA 4FM1A 1DTQA 5HRNA 4CHOA 3TABA 4B9VA 4M3YA 1LWFA 3PX6A 2AJQA 5JS1A 3UIQA 4F2RA 3SQ0A 2A1SA 4BDZA 4DMNA 4M3XA 4CJVA 4DTUA 1ASVA 3DI6A 1LAVA 3MECA 4KI4A 3K5NA 1GOCA 2YKMA 4FJLA 3AVLA 3LALA 3BGRA 4FJXA 5FRMA 2G8VA 4DU3A 2VWKA 4HTUA 3OYKA 3CFOA 3OYFA 4DF4A 4AHTA 3AVMA 1FKOA 1Y97A 3LP0A 5I42A 1WSIA 1U49A 4Y1DA 3OYAA 2IC3A 4DLGA 3QEVA 3U6FA 1IKVA 1NK9A 4FZXC 2IGIA 3DLKA 2XY6A 3T3FA 3CM5A 3TR8A 4CJRA 3OYGA 1TKTA 1JLGA 4HUEA 2OPPA 4BACA 3RTVA 4FJ7A 3C6TA 4M3UA 1TK8A 1WLJA 4F3TA 4KHWA 2BGGA 4OGEA 4CF9A 5C42A 1SUQA 1JLQA 5FDLA 4RW7A 4CJFA 4KAZA 3JSMA 2A1RA 4N76A 3RMAA 4RW9A 1L3TA 4WE1A 1X1PA 4B08A 1HPZA 2ZQBA 3DLRA 4KHSA 3I0SA 1U48A 1HYVA 2VG5A 3AO4A 3NGYA 4JRPA 4O0IA 5JS2A 3NHGA 4DTRA 1NOYA 3AO5A 4CEBA 4XIUA 2KFNA 4LY7A 3D45A 5J2QA 4KFBA 4E1MA 4FJ9A 3AO3A 4O55A 5DK5A 2XRIA 3NH0A 3SI6A 3PO5A 4B8CA 1WSFA 2KW4A 4CESA 3KLIA 1XC9A 3KD5E 1RBTA 4AHUA 4CK1A 1F21A 4FM2A 1D9DA 4CK2A 3L8BA 3L2RA 4FJNA 3HP9A 1L3SA 1NK4A 3PY8A 1DLOA 3AVKA 5HBMA 1RBRA 1RBSA 5HRSA 1HYSA 3AVBA 1YT3A 4DWIA 1TAUA 4Z4IA 1S6QA 3CYMA 1KFSA 1CZ9A 2F8SA 4CHZA 3V9SA 4J2DA 3ZSZA 1I3AA 4CJTA 5EU7A 3OS0A 1U04A 1JLBA 1FK9A 3TI0A 3I0RA 3HVTA 4LSLA 3QETA 2F8TA 1S1TA 4C8KA 3QO9A 3K58A 4DFJA 3VQEA 4CJ5A 3VQ8A 4L8RB 3ZSOA 4FZZA 4IFVA 4DS4A 2OZSA 4ZTFA 4KKOA 3U3GA 3OYLA 4ELUA 5KRSA 3L2VA 1RT5A 2YNGA 4EP5A 4YNQA 3S3NA 3SCXA 3LP2A 4N47A 2D0BA 4YFUA 3RMCA 1EXQA 4IBNA 4HCBA 2KZZA 1VSEA 4DSKA 2RF2A 3WNGA 1J53A 3EY1A 2FBVA 3CFRA 4CGFA 4OKEA 4DTJA 2Z1JA 4FVMA 4ICLA 1RT3A 4KV8A 1TGOA 2HHVA 1C1CA 2E4LA 4RW4A 1RT6A 3RR7A 3B6OA 5SWMA 2HVHA 3T19A 3IS9A 3PV8A 3RMBA 4J2AA 1BQNA 4BDYA 5CY4A 3HPGA 2G8WA 2XY8A 1U47A 2FC0A 4FJKA 1VRTA 4FK4A 3ZSVA 4M3WA 2NUBA 4DFKA 3PX0A 3L3UA 1KVCA 4CF8A 4CIFA 3NH2A 3DYAA 1HYZA 4RG8A 4B3OA 4CJPA 3LP3A 1J5OA 4ZTJA 3HYFA 5E41A 3V9WA 1R0AA 4QCLA 4E7IA 2F96A 4NCBA 1IH7A 3THVA 4BWMA 1VSJA 3AA5X 4OJRA 1RCHA 1NK6A 5J2NA 1BHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV5 A;  4O4G A;  1X9M A;  3P1G A;  3NGI A;  1JL1 A;  1BCM A;  2P51 A;  3ZT3 A;  2G8F A;  4M3R A;  1HNI A;  3ZCM A;  3H08 A;  4PY5 A;  3OYB A;  5C24 A;  4M45 A;  3V1O A;  3EYZ A;  2E6L A;  4KB0 A;  5T7B A;  4UQG A;  2ZD1 A;  4KTW A;  4DTN A;  3KK1 A;  1NKB A;  1Z26 A;  4CF1 A;  3S3O A;  3AA3 A;  1SKS A;  4KTZ A;  3SPY A;  3KKS A;  2BE2 A;  3QIN A;  3SV4 A;  1KLN A;  3KLG A;  3LZJ A;  1S9E A;  4DTS A;  3TWH A;  4DSJ A;  1A5X A;  1CZB A;  3AO2 A;  2G8H A;  1JLC A;  1REV A;  3NDK A;  3ZT4 A;  2QKB A;  4C8N A;  1NJW A;  2RN2 A;  3VQ5 A;  4IKF A;  4CEC A;  4DSF A;  4AHS A;  3SUO A;  4DSI A;  3ALY A;  3ZSY A;  4CGG A;  5I3U A;  3NH1 A;  1RDD A;  4H4O A;  4CFD A;  1D5A A;  1YVU A;  3DRP A;  4DTO A;  1RTD A;  4FJG A;  4ID5 A;  3WNF A;  3NAE A;  1HNV A;  4MFB A;  3NE6 A;  2PYL A;  4CJL A;  4E0D A;  5KTQ A;  3VQA A;  3KIO A;  1LWE A;  1NKC A;  4OLA A;  2KTQ A;  4FW2 A;  2KFZ A;  3KTQ A;  2HB5 A;  4NYN A;  4DFP A;  1Z25 A;  2X78 A;  4CGH A;  1RDB A;  3M8Q A;  3HST B;  2ATQ A;  3KLF A;  3LWL A;  4LSN A;  3MEG A;  3EZ5 A;  3NF7 A;  1ZYQ A;  3OS1 A;  3ZSX A;  4KHN A;  3M8R A;  1J9A A;  2D0A A;  3AVN A;  1A5V A;  1C0M A;  1EET A;  3TAG A;  5HRO A;  1UOC A;  4BDP A;  2QK9 A;  4ELV A;  2DTU A;  4F8R A;  4IFY A;  3MAQ A;  3RRH A;  3QNN A;  1CLQ A;  3RWU A;  3JYT A;  2WON A;  1NK8 A;  3O4Q A;  4PQU A;  1B92 A;  4M42 A;  2HHU A;  4FLZ A;  3QES A;  2RKI A;  1KTQ A;  5J2M A;  3NF9 A;  3SUN A;  2PY5 A;  3V6D A;  4CHP A;  1ZBH A;  3K5M A;  4J2E A;  5D3G A;  3V1Q A;  1RDC A;  1VSI A;  4B9N A;  3ZSQ A;  4KHU A;  1MU2 A;  4E7L A;  1Q8I A;  3L2Q A;  4J2B A;  4EP4 A;  5J1E A;  4FJ8 A;  2G8I A;  3KK2 A;  3VQD A;  1BI4 B;  1IKX A;  2Y1J A;  4TSX A;  1QE1 A;  1UAX A;  4QAG A;  1SKW A;  3LWM A;  1QSS A;  2JLE A;  1VSM A;  3VQB A;  4DG1 A;  3F9K A;  1HJR A;  3K57 A;  3IG1 A;  3IRX A;  5CYQ A;  1KVA A;  3DRS A;  3D0P A;  1D9F A;  3HXM A;  4KB1 A;  3CFP A;  1BGX T;  1JLA A;  1X9W A;  4JS5 A;  4I2Q A;  5KRT A;  2FBY A;  1BIU A;  3DLB A;  2B5J A;  4JLH A;  5KGW A;  4CJW A;  4CIG A;  3G10 A;  1T05 A;  2HMI A;  4DSL A;  3PO4 A;  3NBP A;  4KRE A;  1EKE A;  4Q5V A;  3C6U A;  1G15 A;  4F2S A;  3CQ8 A;  3VQQ A;  3V1R A;  2OA8 A;  3HP6 A;  2R7Y A;  4HVJ A;  4O0J A;  3VQ7 A;  4FYD A;  3LPT A;  3DRR A;  3AO1 A;  4E19 A;  2I5J A;  1VRU A;  1S6P A;  4DQS A;  1NK5 A;  1ZBI A;  2DFE A;  2HHQ A;  3OYI A;  1NK7 A;  4Z4E A;  1IO2 A;  2IAJ A;  3SNN A;  2IS3 A;  2X74 A;  3ISN C;  2YNH A;  4CJS A;  4O5B A;  4HUF A;  3QER A;  3AA4 A;  4K8Z A;  1RT7 A;  4W5N A;  4OKK A;  4CHN A;  1RDA A;  3QEI A;  2D5R A;  3E01 A;  3SUQ A;  1LW2 A;  3VQ6 A;  4GW6 A;  4BWJ A;  4IG3 A;  3KK3 A;  3V4I A;  4OKJ A;  4CJU A;  3B6P A;  1WAJ A;  1S1X A;  1YTA A;  5HLF A;  1QSY A;  5CZ1 A;  1VSH A;  3ZT0 A;  3OYC A;  3KLH A;  1LV5 A;  4DTX A;  3HPH A;  1SKR A;  1TV6 A;  3DLH A;  3HO1 A;  1Q9Y A;  1ZBL A;  4CEZ A;  3OYM A;  2E6M A;  4LH4 A;  2EHG A;  3AVA A;  3TAN A;  3O3H A;  4DLE A;  3V9U A;  1VSK A;  1IKW A;  1U4B A;  4Q0B A;  3TAP A;  3KLE A;  4M3T A;  1TAQ A;  3V81 A;  4FXD A;  2ETJ A;  3SQ4 A;  1TK5 A;  2JGU A;  4HUG A;  1DTT A;  3AVF A;  4CEO A;  4CJ3 A;  4JS4 A;  4I7F A;  3SUP A;  1KSP A;  1CXQ A;  1JXB A;  2DFF A;  2BAN A;  3NF8 A;  3TAQ A;  3DMJ A;  1WSG A;  4O44 A;  1VSD A;  4W5R A;  3RR8 A;  1ZBU A;  4DTP A;  2X6S A;  1FXX A;  2HHS A;  3QNO A;  1RTH A;  5SZT A;  2GUI A;  1FKP A;  2HNZ A;  3TAR A;  3VQC A;  4N5S A;  4DSE A;  1XHX A;  3AVC A;  4RW8 A;  1NJY A;  3IAY A;  1RBV A;  1WN7 A;  3AV9 A;  4B9S A;  3F73 A;  4B9M A;  4FK0 A;  3HM9 A;  3QLH A;  4AIL C;  3MXJ A;  3OVN A;  1TKX A;  2GV9 A;  4IDK A;  4AHV A;  1TKD A;  2DY4 A;  4N41 A;  3TAF A;  1IG9 A;  2D0C A;  3NCI A;  4DF8 A;  1CXU A;  2YHA A;  2YNI A;  3OYE A;  4HHT A;  4CEA A;  3LAK A;  4DU1 A;  1I39 A;  4F4K A;  4FJI A;  3HL8 A;  1GOA A;  3A2F A;  4OLB A;  4C8O A;  3NFA A;  4CE9 A;  4KHY A;  5KI6 A;  1SL0 A;  4EZ9 A;  1TL1 A;  4Z4F A;  4KRF A;  1JLF A;  4Y1C A;  4AHC A;  4M41 A;  4W5O A;  2Z1H A;  4G1Q A;  4GMJ B;  3LAN A;  1C6V A;  1B9D A;  1Q9X A;  2PZS A;  3OYN A;  5FRN A;  3CG7 A;  3VQP A;  1N6Q A;  4DFM A;  4OPJ A;  1HQU A;  1S1V A;  4CGJ A;  2P5G A;  3HK2 A;  4CFB A;  3SV3 A;  1XI1 A;  1W9H A;  4LH5 A;  3DLG A;  3OS2 A;  2HHT A;  2OYQ A;  4W5Q A;  4CHQ A;  4I9L A;  3AVG A;  4IG0 A;  1HQE A;  1NOZ A;  2P1J A;  4Z0U A;  4KO0 A;  3ZT1 A;  4JRQ A;  2KZM A;  3DLE A;  2XHB A;  1K6Y A;  3V9Z A;  2BDP A;  4OVL A;  1XWL A;  4CIE A;  2GBZ A;  1KVB A;  3DM2 A;  4Z4C A;  4OGC A;  2W42 A;  3QEW A;  4CED A;  4H4M A;  5HRR A;  4PWD A;  1RT1 A;  3ITH A;  1BL3 A;  3DOL A;  4CF2 A;  3LZI A;  4AHR A;  1KLM A;  4E7H A;  3AVH A;  3S9H A;  4K8X A;  4FK2 A;  2HW3 A;  3VQ4 A;  4CK3 A;  1NJX A;  5HRP A;  1KFD A;  4DS5 A;  3QIO A;  4H8K A;  1WSE A;  4M3Z A;  3O4N A;  1BIS A;  3O3G A;  4F3O A;  1VK0 A;  4FLX A;  3ZSW A;  4CFC A;  4KPY A;  1UA1 A;  4FJJ A;  1A5W A;  1N5Y A;  5CYM A;  3BDP A;  5J2P A;  1WAF A;  2G8U A;  5DMR A;  3P5J A;  1X9S A;  3K59 A;  3PUF A;  1QS4 A;  3M8S A;  4FLU A;  3U3Y A;  3S3M A;  1JKH A;  1TVR A;  3RRG A;  1RT4 A;  3ASM A;  4E1N A;  2ITG A;  4CEE A;  4B9U A;  4MQ3 A;  4FZY A;  3HT3 A;  4B9T A;  1C1B A;  4C8M A;  3OYJ A;  1YTU A;  4CCH A;  1S1W A;  2VG6 A;  3WNE A;  5HP1 A;  3SPZ A;  3AVJ A;  5K14 A;  2FBX A;  3ZSR A;  1IKY A;  2Z1I A;  5CZ2 A;  3WNH A;  4QOZ B;  4N56 A;  4NYF A;  3OYD A;  3O3F A;  3MED A;  3SYZ A;  3CM6 A;  3NF6 A;  3AA2 A;  4DQQ A;  4KI6 A;  4BE1 A;  2YNF A;  4CJE A;  4DTM A;  4CGD A;  4ZHR A;  4I2P A;  3DOK A;  3ZT2 A;  2QXF A;  4CJQ A;  1TKZ A;  4C8L A;  3NGZ A;  1HRH A;  3MEE A;  4CJK A;  3SJJ A;  4FJM A;  1JLE A;  4PA1 A;  4ELT A;  2HHX A;  2OPQ A;  1S1U A;  1BQM A;  1JXE A;  4FCY A;  1XHZ A;  3L2W A;  2VWJ A;  1T03 A;  3LPU A;  1RBU A;  1EX4 A;  3LP1 A;  1BCO A;  4OPK A;  4E7K A;  4KTQ A;  3OJS A;  2WOM A;  1RTJ A;  4FW1 A;  4EZ6 A;  3G0Z A;  4NCA A;  4CF0 A;  4CER A;  4FLT A;  3KD1 E;  1EP4 A;  3QIP A;  2OZM A;  4NCG A;  2YV0 X;  2OPR A;  5C25 A;  1C0U A;  4CHY A;  3TAE A;  4E3S A;  1L3V A;  1VSL A;  4I9Q A;  1T8E A;  3FFI A;  4DQP A;  2O4I A;  3HVR A;  4R5P A;  4CGI A;  1JL2 A;  3VN5 A;  4LD0 A;  4CFA A;  4CEF A;  3ULD A;  3MXM A;  4W5T A;  4AH9 A;  3K5L A;  4CEQ A;  1QTM A;  4CJ4 A;  1KRP A;  2B6A A;  1ZBF A;  1LAW A;  2G8K A;  3I8D A;  1T7P A;  2PYJ A;  4PUO A;  1QHT A;  2ZE2 A;  3VQ9 A;  2XY5 A;  1UA0 A;  1VSF A;  4DQR A;  2IDO A;  3QEP A;  4FM0 A;  1SL1 A;  4BE0 A;  4FLW A;  2QKK A;  2RPI A;  4B8A B;  1UWB A;  2HNY A;  1WNS A;  1QQC A;  1W0H A;  4FJH A;  3C94 A;  3L2U A;  2IOC A;  3QEX A;  1C0T A;  4Z4G A;  1NKE A;  2VG7 A;  1BIZ A;  3LDS A;  2KQ2 A;  1D8Y A;  4B9L A;  3L3V A;  1O1W A;  1RT2 A;  1S5J A;  3OJU A;  1L3U A;  2X6N A;  3KJV A;  3SQ2 A;  1U45 A;  1J54 A;  1KCF A;  3SQ1 A;  1ASW A;  4RW6 A;  2O4G A;  1RNH A;  3MXI A;  4ID1 A;  3RMD A;  1HMV A;  1GOB A;  2B4J A;  1TK0 A;  3OYH A;  2EX3 A;  3KKR A;  2OPS A;  1LWC A;  1ITG A;  2HND A;  2HHW A;  2YHB A;  3HPO A;  1NJZ A;  4BE2 A;  3SZ2 A;  1SL2 A;  4GVM A;  3M8P A;  4FJ5 A;  3HJF A;  1C1A A;  5KGX A;  3OY9 A;  2YKN A;  3T1A A;  4DU4 A;  1LW0 A;  3VA3 A;  2XY7 A;  2LSN A;  2P5O A;  1TL3 A;  1RTI A;  3VA0 A;  1B9F A;  1RIL A;  4DQI A;  3TAM A;  2Y1I A;  5FRO A;  3LAM A;  1QSL A;  2Q3S A;  1NK0 A;  4KHQ A;  2HVI A;  1WSH A;  4Z4H A;  4FLY A;  3V9X A;  4E7J A;  3K5O A;  2Z1G A;  1S9G A;  3C95 A;  3P83 D;  4E89 A;  2DFH A;  2XO7 A;  4FLV A;  2FBT A;  1L5U A;  1ASU A;  4HCC A;  1WSJ A;  1BI4 A;  3PX4 A;  3K2P A;  3AVI A;  4FM1 A;  1DTQ A;  5HRN A;  4CHO A;  3TAB A;  4B9V A;  4M3Y A;  1LWF A;  3PX6 A;  2AJQ A;  5JS1 A;  3UIQ A;  4F2R A;  3SQ0 A;  2A1S A;  4BDZ A;  4DMN A;  4M3X A;  4CJV A;  4DTU A;  1ASV A;  3DI6 A;  1LAV A;  3MEC A;  4KI4 A;  3K5N A;  1GOC A;  2YKM A;  4FJL A;  3AVL A;  3LAL A;  3BGR A;  4FJX A;  5FRM A;  2G8V A;  4DU3 A;  2VWK A;  4HTU A;  3OYK A;  3CFO A;  3OYF A;  4DF4 A;  4AHT A;  3AVM A;  1FKO A;  1Y97 A;  3LP0 A;  5I42 A;  1WSI A;  1U49 A;  4Y1D A;  3OYA A;  2IC3 A;  4DLG A;  3QEV A;  3U6F A;  1IKV A;  1NK9 A;  4FZX C;  2IGI A;  3DLK A;  2XY6 A;  3T3F A;  3CM5 A;  3TR8 A;  4CJR A;  3OYG A;  1TKT A;  1JLG A;  4HUE A;  2OPP A;  4BAC A;  3RTV A;  4FJ7 A;  3C6T A;  4M3U A;  1TK8 A;  1WLJ A;  4F3T A;  4KHW A;  2BGG A;  4OGE A;  4CF9 A;  5C42 A;  1SUQ A;  1JLQ A;  5FDL A;  4RW7 A;  4CJF A;  4KAZ A;  3JSM A;  2A1R A;  4N76 A;  3RMA A;  4RW9 A;  1L3T A;  4WE1 A;  1X1P A;  4B08 A;  1HPZ A;  2ZQB A;  3DLR A;  4KHS A;  3I0S A;  1U48 A;  1HYV A;  2VG5 A;  3AO4 A;  3NGY A;  4JRP A;  4O0I A;  5JS2 A;  3NHG A;  4DTR A;  1NOY A;  3AO5 A;  4CEB A;  4XIU A;  2KFN A;  4LY7 A;  3D45 A;  5J2Q A;  4KFB A;  4E1M A;  4FJ9 A;  3AO3 A;  4O55 A;  5DK5 A;  2XRI A;  3NH0 A;  3SI6 A;  3PO5 A;  4B8C A;  1WSF A;  2KW4 A;  4CES A;  3KLI A;  1XC9 A;  3KD5 E;  1RBT A;  4AHU A;  4CK1 A;  1F21 A;  4FM2 A;  1D9D A;  4CK2 A;  3L8B A;  3L2R A;  4FJN A;  3HP9 A;  1L3S A;  1NK4 A;  3PY8 A;  1DLO A;  3AVK A;  5HBM A;  1RBR A;  1RBS A;  5HRS A;  1HYS A;  3AVB A;  1YT3 A;  4DWI A;  1TAU A;  4Z4I A;  1S6Q A;  3CYM A;  1KFS A;  1CZ9 A;  2F8S A;  4CHZ A;  3V9S A;  4J2D A;  3ZSZ A;  1I3A A;  4CJT A;  5EU7 A;  3OS0 A;  1U04 A;  1JLB A;  1FK9 A;  3TI0 A;  3I0R A;  3HVT A;  4LSL A;  3QET A;  2F8T A;  1S1T A;  4C8K A;  3QO9 A;  3K58 A;  4DFJ A;  3VQE A;  4CJ5 A;  3VQ8 A;  4L8R B;  3ZSO A;  4FZZ A;  4IFV A;  4DS4 A;  2OZS A;  4ZTF A;  4KKO A;  3U3G A;  3OYL A;  4ELU A;  5KRS A;  3L2V A;  1RT5 A;  2YNG A;  4EP5 A;  4YNQ A;  3S3N A;  3SCX A;  3LP2 A;  4N47 A;  2D0B A;  4YFU A;  3RMC A;  1EXQ A;  4IBN A;  4HCB A;  2KZZ A;  1VSE A;  4DSK A;  2RF2 A;  3WNG A;  1J53 A;  3EY1 A;  2FBV A;  3CFR A;  4CGF A;  4OKE A;  4DTJ A;  2Z1J A;  4FVM A;  4ICL A;  1RT3 A;  4KV8 A;  1TGO A;  2HHV A;  1C1C A;  2E4L A;  4RW4 A;  1RT6 A;  3RR7 A;  3B6O A;  5SWM A;  2HVH A;  3T19 A;  3IS9 A;  3PV8 A;  3RMB A;  4J2A A;  1BQN A;  4BDY A;  5CY4 A;  3HPG A;  2G8W A;  2XY8 A;  1U47 A;  2FC0 A;  4FJK A;  1VRT A;  4FK4 A;  3ZSV A;  4M3W A;  2NUB A;  4DFK A;  3PX0 A;  3L3U A;  1KVC A;  4CF8 A;  4CIF A;  3NH2 A;  3DYA A;  1HYZ A;  4RG8 A;  4B3O A;  4CJP A;  3LP3 A;  1J5O A;  4ZTJ A;  3HYF A;  5E41 A;  3V9W A;  1R0A A;  4QCL A;  4E7I A;  2F96 A;  4NCB A;  1IH7 A;  3THV A;  4BWM A;  1VSJ A;  3AA5 X;  4OJR A;  1RCH A;  1NK6 A;  5J2N A;  1BHL A; 
#chains in the Genus database with same CATH topology
 1X9M A;  5GAG P;  2AP1 A;  2Q36 A;  4B1Y B;  1BDG A;  2D0O A;  3CJ7 A;  1JL1 A;  2P51 A;  1HR0 K;  2G8F A;  3J7Y P;  4M3R A;  3ZCM A;  3RVC A;  2E6L A;  3AGK A;  4DTN A;  4H5N A;  1NKB A;  3H1Q A;  3AA3 A;  3CJ9 A;  4YOU A;  4KTZ A;  4DV3 K;  3KKS A;  3CXC M;  3G6E N;  4IEI A;  3HI0 A;  1A5X A;  1YIT N;  1JLC A;  1REV A;  3ZT4 A;  3L0Q A;  4IWV A;  4CZH A;  5KQ8 A;  4KH6 A;  5IWA K;  3SUO A;  3FR0 A;  4CGG A;  4WQ5 A;  5I3U A;  4H4O A;  4DTO A;  1YXQ A;  1YVU A;  1RTD A;  4FJG A;  1DEJ A;  4ID5 A;  4MFB A;  3KIO A;  1LWE A;  3DAW A;  4FW2 A;  4FL9 A;  2QWL A;  4H0T B;  4A2B A;  3HST B;  2ATQ A;  4LSN A;  4C23 A;  3ID6 A;  5M1F A;  1IV0 A;  2HOE A;  4JI5 K;  4BVP A;  5BRH A;  4ELV A;  2P9I B;  3C6A A;  4BRO A;  3QNN A;  2WON A;  4PQU A;  4M42 A;  3QES A;  1TUU A;  1KTQ A;  4CD1 A;  5J2M A;  3MCP A;  4X65 K;  4MDA A;  4A57 A;  3E9L A;  4E7L A;  4J2B A;  1NGB A;  4EP4 A;  3CCM N;  4PKI A;  1BI4 B;  5AJ3 K;  1NGI A;  2HBK A;  2JLE A;  2E8A A;  3F9K A;  3Q7B A;  3K57 A;  1TYQ B;  3P39 A;  1NJI O;  5CYQ A;  4J8F A;  4LF4 K;  1VHX A;  1ESV A;  3AAP A;  3G10 A;  4MDB A;  3PSI A;  3PO4 A;  2NRR A;  1G15 A;  4F2S A;  3VQQ A;  3V1R A;  3HP6 A;  4HVJ A;  4O0J A;  3VQ7 A;  3DRR A;  2I5J A;  1VRU A;  4DQS A;  1KAY A;  1NK5 A;  4KH5 A;  3H46 O;  5AQL A;  4CJS A;  4GV6 A;  4K8Z A;  1QQN A;  1TUY A;  4W5N A;  1XNQ K;  3CCV N;  4DV6 K;  3VMF B;  3SUQ A;  1LW2 A;  3U4L A;  3KK3 A;  3CJC A;  3O6W A;  4GKK K;  1QSY A;  4BRK A;  2IVP A;  3UE5 A;  3HPH A;  3WQU A;  3HO1 A;  1ZBL A;  4CEZ A;  4LH4 A;  3VGL A;  4Q0B A;  3TAP A;  2WBN A;  4M3T A;  2ETJ A;  1TK5 A;  4A5B A;  4HUG A;  3L6Q A;  1K8K A;  1N33 K;  1CXQ A;  5BPM A;  4C1N I;  1WSG A;  4O44 A;  5AQO A;  1KQS M;  1HX1 A;  3VET A;  1ZBU A;  5SZT A;  2QA4 N;  3VQC A;  4N5S A;  2ZJP L;  3D7E O;  4B9M A;  5AZI B;  2GV9 A;  2F7T A;  3ENO A;  4AHV A;  3NCI A;  4DF8 A;  1CXU A;  1MWK A;  4HHT A;  1S72 N;  1I39 A;  5M1P A;  5LMN K;  4F9O A;  4EZ9 A;  3LDP A;  4GMJ B;  3FLC O;  1C6V A;  1N8R O;  2PZS A;  3OYN A;  5FRN A;  3VQP A;  1S1V A;  3M3Z A;  3WT0 A;  2UUC K;  1XI1 A;  3OS2 A;  1V4S A;  3ENB A;  4W5Q A;  4CHQ A;  4NB4 A;  2O8D B;  4JRQ A;  1RGI A;  3DLE A;  2XHB A;  2BDP A;  4YOT A;  4OVL A;  4CIE A;  4BRC A;  2W42 A;  3F5T A;  4OGC A;  5HRR A;  5FPE A;  1RT1 A;  3DOL A;  5LJW A;  4E7H A;  2HW3 A;  4FK2 A;  3CD6 N;  1NJX A;  2WUS A;  4K41 A;  3VEN A;  3O4N A;  1BIS A;  4F3O A;  4FLX A;  4DR5 K;  2UUB K;  2P9L B;  4QS9 A;  1A5W A;  1N5Y A;  5CYM A;  4YDU A;  5M1O A;  3K59 A;  2HF3 A;  1TVR A;  3S3M A;  2ITG A;  3UKR A;  3SAG A;  2D1K A;  3HT3 A;  3MK6 A;  5AQR A;  4C8M A;  4OX9 K;  4JHD B;  3WNE A;  4E1J A;  3AAR A;  4QOZ B;  4N56 A;  4JK7 A;  3OYD A;  3O3F A;  2A40 A;  2VQF K;  4BE1 A;  4CJE A;  3DXM B;  2ITM A;  4I2P A;  2ZWH A;  4CJQ A;  3FZH A;  3CPW M;  3MEE A;  4FJM A;  3SJJ A;  3VEZ A;  3W3D A;  4ELT A;  2OPQ A;  1VQ4 N;  3LM2 A;  4FCY A;  1XHZ A;  4OPK A;  4FW1 A;  4EZ6 A;  4CF0 A;  4PKG A;  1YHQ N;  3KD1 E;  1EP4 A;  2BH1 A;  1VSL A;  4K42 A;  4DQP A;  1SAZ A;  3QBX A;  2QWP A;  2WC9 A;  5GIN A;  4CFA A;  1EO1 A;  4DUZ K;  1S3X A;  3K5L A;  1LAW A;  5JVH L;  1XMQ K;  1VSF A;  4DQR A;  3MCA B;  3IMX A;  4A5A A;  1IG8 A;  1K8A O;  1UWB A;  1U6Z A;  1N36 K;  3L2U A;  2VG7 A;  1E4G T;  4B9L A;  3HOS A;  1BO5 O;  1RT2 A;  4DHY A;  3KJV A;  2P9U B;  3SQ2 A;  1J54 A;  2O4G A;  4LC9 B;  4ID1 A;  3C0B A;  1TK0 A;  2NRH A;  1DT9 A;  3KKR A;  1KD1 O;  2HND A;  2HHW A;  3L4Q A;  2YHB A;  3TSP A;  4BE2 A;  4FJ5 A;  3HJF A;  1VQ5 N;  3OY9 A;  2P9I A;  1BWF O;  1NMD A;  3QDK A;  5EXW A;  3VA0 A;  3P4I A;  4DQI A;  2HBL A;  5BN9 A;  2Q3S A;  4FLY A;  4E7J A;  2E1Z A;  4E89 A;  3C95 A;  1VQ6 N;  2FBT A;  1L5U A;  2O8F B;  1BI4 A;  3AVI A;  4BC2 A;  3AY9 A;  4CHO A;  4B9V A;  4KHP K;  3UIQ A;  4YOY A;  4BDZ A;  1TYQ A;  4B3M K;  3SAF A;  4DTU A;  3E9O A;  3MEC A;  4KI4 A;  2YKM A;  3LL3 A;  3BGR A;  4NLB A;  2G8V A;  1O13 A;  4DKW A;  4HTU A;  4XH5 A;  3OYK A;  4C1N K;  3AVM A;  4CD3 A;  1WSI A;  3CER A;  5BRF A;  2CGL A;  3OYA A;  2W6L A;  3U6F A;  3DLK A;  3Q7C A;  4CBU A;  5MLC Q;  1TK8 A;  3EEQ A;  4OGE A;  2A41 A;  1X3M A;  3RMA A;  4RW9 A;  4WE1 A;  3DLR A;  1U48 A;  2VG5 A;  3NGY A;  4DTR A;  3NHG A;  3IUC A;  4LY7 A;  4DQ8 A;  4FJ9 A;  3AO3 A;  3ZYY X;  2XRI A;  4H5T A;  3HM8 A;  3NH0 A;  3SI6 A;  3PO5 A;  4CES A;  3KD5 E;  4AHU A;  2ZM6 K;  1D9D A;  5LY3 A;  3T1Y K;  1RBS A;  5HRS A;  1YT3 A;  4BR0 A;  3R8E A;  1U2V B;  4CHZ A;  5B8H A;  3V9S A;  3CCR N;  1U04 A;  3I0R A;  4C8K A;  4QS7 A;  2VGM A;  3BZC A;  3VQE A;  1NGJ A;  3VQ8 A;  1ATS A;  4X64 K;  4DS4 A;  2HHH K;  2FF6 A;  4ELU A;  3GDQ A;  1HNZ K;  3L2V A;  2YNG A;  3VEV A;  3RMC A;  5BPL A;  5AZI A;  1J53 A;  2E88 A;  1OVQ A;  3SJH A;  4CGF A;  4DTJ A;  4KV8 A;  4IJN A;  1C1C A;  3CHW A;  3H45 C;  4BGA A;  1RT6 A;  4H5W A;  4NO7 A;  3T1H K;  3T19 A;  3HPG A;  4FJK A;  4FK4 A;  4M3W A;  2Q0R A;  4LF5 K;  1ILY A;  4A59 A;  4WQ5 C;  5E41 A;  3V9W A;  3THV A;  2GWK A;  4BGB A;  1RCH A;  1NK6 A;  5J2N A;  2O8D A;  1WBB A;  1YVN A;  4JKG B;  1BCM A;  3VEX A;  1HNI A;  2CGK A;  4M45 A;  3EYZ A;  5T7B A;  1QZ6 A;  1SKS A;  3SPY A;  3QIN A;  1OVY A;  1FJG K;  3KLG A;  4DTS A;  3TWH A;  2FF3 B;  1YJW N;  4JKC A;  2P9L A;  2QKB A;  4WFB L;  1KAZ A;  3CJA A;  3NMU A;  1ATR A;  3VQ5 A;  2QW9 A;  3THX B;  4A2A A;  3ZSY A;  2V52 B;  3E1Y A;  3NH1 A;  4CFD A;  3DRP A;  3WNF A;  2PYL A;  1OH6 A;  5KTQ A;  1BG3 A;  3VQA A;  1NKC A;  4BC4 A;  4B1X B;  4JHD A;  1XNR K;  3ATV A;  2X78 A;  4CGH A;  4PL8 A;  3I33 A;  3MEG A;  3EZ5 A;  1IBK K;  3NF7 A;  3OS1 A;  2VQE K;  3M8R A;  1J9A A;  2D0A A;  1A5V A;  3DXM A;  4K25 A;  4B1U B;  3RWU A;  4B1V A;  2RKI A;  1LCU A;  3SUN A;  2PY5 A;  3V6D A;  4CHP A;  1W7A A;  1ZBH A;  1RDC A;  4B9N A;  3MWP A;  4FJ8 A;  5FPM A;  3KK2 A;  2ZGZ A;  4AM6 A;  3O9T A;  1SKW A;  3LWM A;  5AQZ A;  3ULE B;  3O9S A;  1VSM A;  4EAH D;  1GLD G;  1HJR A;  3VES A;  5BPN A;  1KVA A;  4JEP A;  1D9F A;  5AFU A;  3HXM A;  1BGX T;  2E2P A;  1E3M A;  2UXB K;  4JS5 A;  4DR7 K;  5KRT A;  2FBY A;  1BIU A;  3DLB A;  5KGW A;  4JLH A;  4CJW A;  4CIG A;  2HMI A;  4G9Z A;  5AQG A;  1EKE A;  3C6U A;  3CQ8 A;  1T44 A;  2OA8 A;  3EKU A;  4M7X A;  2Q97 A;  2OCE A;  3A8Y A;  4RTF D;  2R7Y A;  5A2Q O;  4FYD A;  5E26 A;  3LPT A;  3AO1 A;  1S6P A;  5CE3 A;  2HHQ A;  2E2O A;  1YAG A;  2P9U A;  2P9K B;  4Z4E A;  2IS3 A;  2X74 A;  1D4X A;  4GNI A;  5ADX A;  3G71 N;  4HUF A;  3ID8 A;  2PFU A;  3EO3 A;  2UU9 K;  3QEI A;  5C10 A;  2D5R A;  4HWI A;  4GW6 A;  4BWJ A;  4IG3 A;  3V4I A;  4CJU A;  3B6P A;  4WCE L;  1WAJ A;  4BR9 A;  5F2R A;  5CZ1 A;  1LV5 A;  4RCH A;  3KLH A;  1SKR A;  3D2F B;  3QBW A;  1Q9Y A;  2WFB A;  3EKS A;  4JI8 K;  1VSK A;  4WFA L;  4JI7 K;  4HTL A;  3V81 A;  3CMA N;  5M1K A;  3GOI A;  2O8F A;  3ZET B;  3AVF A;  3SUP A;  1KSP A;  2P9P B;  3DLL L;  3DMJ A;  4W5R A;  2GX9 A;  4XH4 A;  4A61 A;  1WUA A;  1RTH A;  4JKH A;  2I7P A;  3DXK B;  1ZBS A;  1QQO A;  2Q0U A;  1V4T A;  4RW8 A;  3F9M A;  1K9M O;  2NRX A;  3WEE B;  3AV9 A;  3HM9 A;  4AIL C;  3ZX2 A;  4IDK A;  5AQQ A;  1S22 A;  3I8B A;  4N41 A;  1IG9 A;  1ZXO A;  4JK9 A;  1GLA G;  4NXM K;  3LAK A;  1NNE A;  1C0F A;  3HL8 A;  3A2F A;  4C8O A;  3NFA A;  5KI6 A;  1SL0 A;  4Z4F A;  3VPZ A;  3MN6 A;  2E1Y A;  4M41 A;  3ZX0 A;  4YDU C;  1VQN N;  3KVG A;  3SK3 A;  3TSU A;  1B9D A;  5TKW A;  3CG7 A;  1NGA A;  1N6Q A;  4DFM A;  3HK2 A;  4CFB A;  2HHT A;  3DLG A;  3EZW A;  3AVG A;  4Z0U A;  2J4R A;  2KZM A;  1K6Y A;  2GBZ A;  3O9R A;  3U9D A;  2Q31 A;  3FFK B;  1U2V A;  4AHR A;  3AVH A;  1BUP A;  3VQ4 A;  5HRP A;  4DS5 A;  1YJN N;  1HKG A;  3UB5 A;  3J81 O;  1VK0 A;  2FXU A;  3ZSW A;  4CFC A;  5LJV A;  4KPY A;  3GL1 A;  1UA1 A;  1M1K O;  4FJJ A;  1WAF A;  2G8U A;  3FZK A;  3M8S A;  3U9Z A;  3RRG A;  3ASM A;  3CF5 L;  3K9J A;  4MQ3 A;  2Q1N A;  2I7N A;  3OYJ A;  4CCH A;  5AQM A;  3SPZ A;  4GVE A;  3ZSR A;  4DR4 K;  1IKY A;  5CZ2 A;  3O80 A;  4NYF A;  2GUP A;  3NF6 A;  3THW B;  1OKJ A;  4ZHR A;  3DOK A;  3H6E A;  3NVM A;  3ZT2 A;  3VGM A;  4YOR A;  3MN5 A;  3NGZ A;  1HRH A;  4K0K K;  2HHX A;  1S1U A;  3L2W A;  2VWJ A;  1T03 A;  3WUH A;  1RBU A;  1EX4 A;  3JXU A;  4KTQ A;  5GAD P;  3OJS A;  3G0Z A;  4CER A;  4JAX A;  3QIP A;  2OZM A;  4NCG A;  4ISF A;  5C25 A;  2OPR A;  3N4P A;  1C0U A;  4JKG A;  3J8A A;  3JS6 A;  4JKF A;  3TAE A;  1J5E K;  4I9Q A;  1W97 L;  5C0Y A;  2O4I A;  1MDU B;  1JL2 A;  3VEO A;  3VN5 A;  3ULD A;  1N32 K;  3MXM A;  4W5T A;  4CEQ A;  1KRP A;  4CJ4 A;  2B6A A;  3E66 A;  1ZBF A;  1T7P A;  3H1V X;  5AQN A;  2XY5 A;  1UA0 A;  2IDO A;  4FM0 A;  2YHY A;  2O8C B;  4JV5 K;  3GBT A;  3THX A;  1WNS A;  1QQC A;  1W0H A;  4FPB A;  3LDS A;  1D8Y A;  3L3V A;  1S5J A;  1BA0 A;  3SQ1 A;  4OO1 J;  4YHH K;  5AQK A;  3O1B A;  2EX3 A;  1LWC A;  1YF5 L;  1NJZ A;  3FGU A;  3C7N B;  2YKN A;  4DU4 A;  1LW0 A;  2OAN A;  1EQY A;  3VA3 A;  2LSN A;  3IKM A;  2XY7 A;  2YHW A;  3P38 A;  4DR2 K;  4KHQ A;  2HVI A;  3WXK A;  4Z4H A;  5F0X A;  4IDH A;  2Z1G A;  1S9G A;  4FVU A;  2XO7 A;  1ASU A;  5AQT A;  3CME N;  4FM1 A;  3H3N O;  1DTQ A;  5HRN A;  4H0X B;  4M3Y A;  3ULE A;  4MO5 A;  4EHU A;  3SQ0 A;  2A1S A;  4F2R A;  4CJV A;  4CZK A;  1LAV A;  1SZ2 A;  4FJL A;  2NLX A;  4FJX A;  4EFH A;  1QVF M;  1X3N A;  5M1Q A;  2VWK A;  3SAH A;  3OYF A;  3LP0 A;  4JI2 K;  3S41 A;  1U49 A;  4Y1D A;  4DV5 K;  5EOY A;  4I6M B;  3CM5 A;  3TR8 A;  3OYG A;  1JLG A;  2OPP A;  3KK7 A;  1HKC A;  5C42 A;  2P9K A;  5FDL A;  4CJF A;  4N76 A;  1X1P A;  1VQ7 N;  1HNX K;  5JS2 A;  1NOY A;  3AO5 A;  4CEB A;  1RDW X;  5I9E B;  1NGH A;  3D45 A;  4KFB A;  3I56 N;  3MDQ A;  4X66 K;  1WSF A;  4IKF A;  3LDL A;  4CK2 A;  4FJN A;  5AQU A;  1L3S A;  1DLO A;  3D2F A;  1RBR A;  3AVB A;  4BR5 A;  3CC4 N;  1Q81 O;  2F8S A;  3SLC A;  3WQT A;  4YOW A;  1VQP N;  1SS6 A;  3ZSZ A;  3ZET A;  1JLB A;  2GWJ A;  4LSL A;  2P9P A;  4MLE A;  3K58 A;  4U7B A;  5CR4 A;  1DKG D;  4CJ5 A;  4IFV A;  2OZS A;  3DXK A;  1HNW K;  4KKO A;  3U3G A;  4YNQ A;  3S3N A;  4LFB K;  3LP2 A;  4N47 A;  5BRE A;  4YFU A;  1EXQ A;  3WEE A;  3BF3 A;  4HCB A;  5FPD A;  2Z1J A;  2NRZ A;  4FWQ A;  3G25 A;  3T69 A;  3OHR A;  5SWM A;  5BR9 A;  3R3L A;  4JI1 K;  5CY4 A;  1GLJ O;  1YJ9 N;  2G8W A;  1U47 A;  2FC0 A;  3L3U A;  2ZGY A;  4CF8 A;  4DV4 K;  3DYA A;  1HYZ A;  4B3O A;  1J5O A;  3KHY A;  1R0A A;  2ASO A;  3EE8 A;  3O08 A;  2F9T A;  4CZF A;  2UYT A;  3R1X A;  3VF2 A;  3P1G A;  5AZJ B;  3NGI A;  4UY8 O;  3ZT3 A;  2NRW A;  4Z94 A;  3OYB A;  4JD2 B;  3CCL N;  3SBG A;  3V1O A;  2A42 A;  4UQG A;  2ZD1 A;  4KTW A;  3KK1 A;  4BR4 A;  5GIP A;  1Z26 A;  4CF1 A;  5JLF A;  4M7Y A;  4Y0W A;  1JJ2 M;  1CZB A;  3AO2 A;  2G8H A;  1VQM N;  3TU5 A;  2P9S B;  3NDK A;  2E20 A;  4C8N A;  1NJW A;  2RN2 A;  4FWL A;  3QB0 A;  3G4S N;  1P8Z A;  2CH5 A;  3BUZ B;  4CEC A;  4DSI A;  5LMU K;  3OBY A;  1RDD A;  3EL2 A;  1NG9 A;  4CJL A;  4E0D A;  5AQY A;  4FWN A;  3O8M A;  2HB5 A;  4CW7 B;  1HJO A;  3KLF A;  3LWL A;  3ZSX A;  4KHN A;  3P31 A;  4IFE A;  3TAG A;  3THW A;  1EET A;  5HRO A;  3ZX3 A;  4BC3 A;  1UOC A;  2DTU A;  4F8R A;  4IFY A;  1CLQ A;  3JYT A;  3ENH A;  2O8B B;  1NK8 A;  4DCH A;  3OA9 A;  1B92 A;  1NGE A;  2KHO A;  4FLZ A;  4B1Z A;  5C2F A;  3K5M A;  5D3G A;  4KHU A;  1MU2 A;  4K43 A;  2IIR A;  2G8I A;  1IKX A;  4TSX A;  1QE1 A;  4FO0 A;  4QAG A;  1QSS A;  3F2K A;  3VQB A;  3IG1 A;  3IRX A;  3D0P A;  4KB1 A;  2YI1 A;  5FLX O;  3CFP A;  1JLA A;  3K9K A;  1DGK N;  3CC2 N;  1HUX A;  2QI2 A;  1VQK N;  4I2Q A;  2UXC K;  2B5J A;  1T05 A;  5BN8 A;  4KRE A;  3OW2 M;  4DSL A;  2O8C A;  4Q5V A;  1BOT O;  1T3V A;  1HPM A;  4E19 A;  1NM1 A;  3CPE A;  3FZL A;  3OYI A;  2QM1 A;  4ZTF A;  1EWQ A;  2V7Z A;  3AA4 A;  1E4F T;  1RT7 A;  4BQL A;  1Q18 A;  4DV7 K;  5ADX H;  2A5X A;  4CHN A;  1RDA A;  2BUP A;  3E01 A;  5TKY A;  4BRL A;  4OKJ A;  4FPA A;  1S1X A;  1BA1 A;  1YTA A;  5HLF A;  4DTX A;  5AQP A;  3DLH A;  3UKU B;  1JCE A;  2E6M A;  2EHG A;  3AVA A;  3O3H A;  4DLE A;  1NGD A;  3V9U A;  2PAV A;  1Y64 A;  4JKE A;  3T7Z A;  2OTJ N;  1TAQ A;  4BG9 A;  1DTT A;  4CJ3 A;  3TSQ A;  3TTF A;  3BP8 A;  4BRQ A;  1VSD A;  5AQX A;  3RR8 A;  4DTP A;  2HHS A;  1FKP A;  3TAR A;  2VYP A;  4LF8 K;  1XHX A;  3AVC A;  1NJY A;  1WN7 A;  3HOT A;  4LFA K;  4FK0 A;  3QLH A;  1TKD A;  3OVN A;  3OTO K;  1TKX A;  2DY4 A;  3TAF A;  2YNI A;  4CEA A;  3D6R A;  1Z6R A;  4I6M A;  1GOA A;  4OLB A;  3BY5 A;  2UUA K;  2ZJQ L;  4KHY A;  2IVO A;  4KRF A;  3I55 N;  4Y1C A;  3M5R A;  2Z1H A;  3MX2 A;  3LAN A;  5AQI A;  4OPJ A;  1HQU A;  2P9N B;  1W9H A;  4LH5 A;  2E2Q A;  2OYQ A;  1GLC G;  4I9L A;  2RHK A;  4BRM A;  1HQE A;  1NOZ A;  2P1J A;  5AQS A;  1IBM K;  4FWP A;  4IOC L;  2KLA A;  1KVB A;  3DM2 A;  4BQZ A;  5GAE P;  4H4M A;  4PWD A;  3LZI A;  3S9H A;  2BTF A;  3QIO A;  4M3Z A;  4O8K A;  3CC7 N;  3A5L C;  4BRH A;  5LL6 Z;  3BDP A;  5J2P A;  4CZM A;  5DMR A;  3PUF A;  3U3Y A;  1RT4 A;  4E1N A;  2FSK A;  4FZY A;  1W2B M;  5KQD A;  1YTU A;  4OPH A;  3WXI A;  2VG6 A;  3AVJ A;  2YJF A;  3WNH A;  3SYZ A;  3CM6 A;  3AA2 A;  3BEX A;  4DQQ A;  4KI6 A;  2YNF A;  4JI3 K;  2QXF A;  1TKZ A;  4CJK A;  1JXE A;  3LP1 A;  1BCO A;  1RTJ A;  4DR3 K;  4NCA A;  2AA4 A;  5H1S Q;  4FLT A;  3PSF A;  2YV0 X;  5AZJ A;  1I94 K;  4E3S A;  4CJ7 A;  1VQL N;  4CGI A;  2ZJR L;  4LD0 A;  4JD2 A;  5FPN A;  3DJC A;  4AH9 A;  5F1X A;  3UKR B;  1QTM A;  3I8D A;  2PYJ A;  2F4V K;  1QHT A;  1RFQ A;  2ZE2 A;  3VQ9 A;  3QEP A;  2P9S A;  5GIO A;  4BE0 A;  2QKK A;  4GKJ K;  2RPI A;  4B8A B;  2HNY A;  4FJH A;  1C0T A;  1Q86 O;  4Z4G A;  1BIZ A;  4CZI A;  2KQ2 A;  2HMP A;  3OJU A;  1L3U A;  4FWR A;  4BRP A;  2X6N A;  1KCF A;  3MXI A;  3RMD A;  2OPS A;  1ITG A;  3SZ2 A;  3DWL A;  1SL2 A;  3M8P A;  4DR6 K;  1FW6 A;  1C1A A;  1XUP O;  2P5O A;  3ATU A;  1RTI A;  2O8B A;  2W6K A;  2QWO A;  1RIL A;  3TAM A;  2GEM A;  3FE1 A;  1QSL A;  3OBW A;  1WSH A;  3V9X A;  2CGJ A;  3K5O A;  2DFH A;  4YOX A;  2FSN A;  2QWR A;  4WYB A;  3O4W A;  2AJQ A;  3PX6 A;  5JS1 A;  2O8E B;  4FWS A;  3M6G A;  1ASV A;  1OH5 A;  3NVK A;  3DI6 A;  2ZF5 O;  4IO9 L;  1GOC A;  2GEL A;  3LAL A;  3C65 A;  3FZF A;  3CCU N;  3CFO A;  4DF4 A;  3VER A;  1WBD A;  1FKO A;  1Y97 A;  5I42 A;  2IC3 A;  4DLG A;  4WQ4 A;  3QEV A;  1NK9 A;  4FZX C;  5GAH P;  2IGI A;  2QWM A;  4R79 A;  4BRA A;  3T3F A;  3RTV A;  4H5R A;  1TKT A;  2RE2 A;  4FJ7 A;  3LDO A;  1WLJ A;  2BGG A;  4CF9 A;  3IDH A;  1SUQ A;  1JLQ A;  1H1V A;  4DB3 A;  4KAZ A;  2A1R A;  3SMS A;  2YCH A;  3LDQ A;  2V7Y A;  4YY3 K;  3HTV A;  4JRP A;  3MN9 A;  4O0I A;  2KFN A;  3VTH A;  5DK5 A;  4U67 L;  4B8C A;  1XC9 A;  1QVG M;  1F21 A;  3L8B A;  4CZG A;  3HP9 A;  4LF9 K;  3AVK A;  5HBM A;  1HYS A;  1R59 O;  1YUW A;  1S6Q A;  3UKU A;  1KFS A;  2QTD A;  1CZ9 A;  2NRT A;  1Q7Y O;  1NLV A;  4J2D A;  5HOO A;  3L4I A;  3LDN A;  1NBW A;  1FK9 A;  3TI0 A;  4IO8 A;  2F8T A;  3ZEU B;  4BR7 A;  5KPT A;  3QO9 A;  1C0G A;  4CI6 A;  4BRN A;  4DFJ A;  3O9U A;  3QFP A;  5AQJ A;  4L8R B;  4FZZ A;  4ISE A;  3OYL A;  3D2E B;  4AQY K;  1RT5 A;  3SCX A;  1J6Z A;  2KZZ A;  2RF2 A;  3WNG A;  2YX6 A;  2FBV A;  3EY1 A;  4OKE A;  2VWB A;  4FVM A;  2HHV A;  4DV1 K;  3AGR A;  4RW4 A;  3SMP A;  1Z05 A;  3RR7 A;  2HVH A;  3RMB A;  3TPQ A;  3ZLJ A;  4BDY A;  4J2A A;  4L3Q A;  1VRT A;  3ZSV A;  4GV9 A;  3AAQ A;  2A6A A;  3NH2 A;  4CIF A;  4RG8 A;  4FWK A;  4CJP A;  4H0O A;  3LP3 A;  4ZTJ A;  4FSV A;  2ASM A;  2P9N A;  1N34 K;  2F96 A;  4NCB A;  1IH7 A;  3VF6 A;  2Q2R A;  4JYA K;  1NGG A;  4OJR A;  4BRG A;  2ASP A;  4B9Q A;  4CF2 A;  4OLA A;  1SV5 A;  4O4G A;  2DPN A;  1NGC A;  4RWT A;  4PY5 A;  3H08 A;  2YHX A;  1GLF O;  5C24 A;  1MA9 B;  3THY B;  2FSJ A;  4JK8 A;  4ISG A;  3S3O A;  2QXL A;  2VGN A;  2BE2 A;  3SV4 A;  4FOI A;  1KLN A;  3LZJ A;  1S9E A;  4DSJ A;  5KPR A;  3RSE B;  3VTI A;  4H0Y B;  4DSF A;  2VCP A;  4AHS A;  3ALY A;  2WTU A;  1D5A A;  3MN7 A;  3MMV A;  3NAE A;  1HNV A;  3NE6 A;  3CQY A;  3WXL A;  2KTQ A;  1BU6 O;  4FWM A;  2UXD K;  2KFZ A;  3KTQ A;  4NYN A;  4DFP A;  4WF9 L;  1EWR A;  1T6C A;  1Z25 A;  1RDB A;  3M8Q A;  5EX5 A;  3QIC A;  1ZYQ A;  1CZA N;  3AVN A;  1C0M A;  5EVZ A;  4BY9 C;  4A62 A;  5JMV A;  4BDP A;  2YJE A;  3MAQ A;  3RRH A;  4YOV A;  3O4Q A;  2HHU A;  5C2D A;  4B3R K;  3NF9 A;  4J2E A;  3V1Q A;  3GG4 A;  1VSI A;  3ZSQ A;  1NGF A;  1Q8I A;  3L2Q A;  5J1E A;  3VQD A;  2Y1J A;  1UAX A;  4BVO A;  3SBT A;  3VGK A;  4CBX A;  3PLA A;  1WB9 A;  4DG1 A;  4DV2 K;  4MO4 A;  3DRS A;  3EE9 A;  3VOV A;  3J7Z O;  1X9W A;  3A5N C;  4H0V B;  4BRF A;  4GV3 A;  3NBP A;  3N4Q A;  3FZM A;  3CQX A;  2JWL A;  4O5F A;  1VQO N;  1QQM A;  1ZBI A;  1YIJ N;  2DFE A;  4ILJ A;  4XH1 A;  4JN4 A;  4NLC A;  4PL7 A;  1NK7 A;  1IO2 A;  2IAJ A;  3SNN A;  3ISN C;  2YNH A;  4O5B A;  3QER A;  5AQV A;  1KAX A;  2HBM A;  4OKK A;  4LF7 K;  4DUY K;  2W40 A;  3VQ6 A;  1Q82 O;  4IOX A;  3CI5 A;  3CJ1 A;  3OYC A;  1VSH A;  3ZT0 A;  3EN9 A;  1TV6 A;  3OYM A;  1GLB G;  3QML A;  3TAN A;  3R6M A;  4MLH A;  1IKW A;  5JLH A;  1U4B A;  3KLE A;  1K73 O;  4FXD A;  3CCS N;  3SQ4 A;  2JGU A;  4CEO A;  4JS4 A;  4I7F A;  1JXB A;  2DFF A;  4BG8 A;  1ZC6 A;  2BAN A;  2GTD A;  3NF8 A;  2CH6 A;  2F9W A;  3CIP A;  3O9Q A;  3TAQ A;  2O8E A;  4X62 K;  2V51 B;  2X6S A;  3VF4 A;  1FXX A;  3QNO A;  2GUI A;  3J80 O;  2HNZ A;  5DM7 L;  3VEY A;  4DSE A;  3BZK A;  3IAY A;  1RBV A;  4B9S A;  3F73 A;  3MXJ A;  2PBD A;  4EHT A;  2D0C A;  2YHA A;  3OYE A;  4DU1 A;  4F4K A;  1IBL K;  4CE9 A;  1TL1 A;  1JLF A;  4AHC A;  4W5O A;  4G1Q A;  3WXJ A;  5CHI A;  1Q9X A;  4KH4 A;  2P5G A;  4DR1 K;  4CGJ A;  3GE1 A;  3SV3 A;  3A5O C;  4IG0 A;  1OH8 A;  4KO0 A;  3ZT1 A;  4H5V A;  5M1N A;  4FWO A;  3V9Z A;  1XWL A;  4Z4C A;  3QEW A;  4CED A;  5EY4 A;  3ITH A;  1BL3 A;  5HL7 L;  1KLM A;  3VEW A;  5JIC A;  3BF1 A;  3QFU A;  4K8X A;  4CK3 A;  1KFD A;  5AQW A;  4H8K A;  1WSE A;  3O3G A;  3ZEU A;  1YI2 N;  3B8A X;  1KC8 O;  2EWS A;  2QEX N;  4OPA A;  3P5J A;  1X9S A;  1QS4 A;  1QZ5 A;  4FLU A;  3A5M C;  1JKH A;  3D2E A;  2HF4 A;  4CEE A;  4B9U A;  1QHA A;  2D0P A;  1OH7 A;  3CET A;  3HZ6 A;  1NMN A;  4JKB A;  4B9T A;  1C1B A;  5AFU H;  1S1W A;  5HP1 A;  4CZL A;  5K14 A;  5C12 A;  2FBX A;  3KWG A;  1VAZ A;  2Z1I A;  5C15 A;  3MED A;  4CZE A;  4DTM A;  1NU0 A;  4CGD A;  4JNE A;  3O5B A;  4C8L A;  4IJA A;  3PIP L;  3M1F A;  1JLE A;  4V19 S;  4PA1 A;  3WXM B;  1BQM A;  3LPU A;  4E7K A;  4FOE A;  2QWN A;  2WOM A;  3KWI A;  4DV0 K;  4CHY A;  4CVN E;  3MX5 A;  1L3V A;  3C7N A;  1T8E A;  3FFI A;  3HVR A;  4R5P A;  4ILH A;  4CEF A;  3THY A;  2JWK A;  1T6D A;  4GY2 B;  2G8K A;  4PUO A;  4WFN L;  3K0S A;  4IZ9 A;  3O1W A;  5BRD A;  1SL1 A;  1KXP A;  4NXN K;  3RSE A;  4B3T K;  4FLW A;  1MWM A;  1HLU A;  1M90 O;  1GLL O;  3C94 A;  4BRE A;  2W41 A;  2IOC A;  3QEX A;  3J7A P;  1NKE A;  4JKA A;  1O1W A;  4BRI A;  1U45 A;  1ASW A;  3CJB A;  5E84 A;  4RW6 A;  1RNH A;  1HMV A;  1GOB A;  2B4J A;  1JCG A;  2D4W A;  2H3G X;  3OYH A;  1SQK A;  3HPO A;  5BR8 K;  4GVM A;  5DM6 L;  5KGX A;  3T1A A;  3HBT A;  3LM9 A;  1TL3 A;  3IFR A;  1P90 A;  1B9F A;  4WQ4 C;  5AQH A;  4B1W B;  3CCJ N;  2Y1I A;  2QWQ A;  5FRO A;  3LAM A;  1NK0 A;  3R9P A;  4EIA A;  2NZT A;  1LOT B;  4FLV A;  4IEE A;  3P83 D;  4B3S K;  4IOA L;  4HCC A;  4JI0 K;  1WSJ A;  3PX4 A;  3H3O B;  3K2P A;  1K8K B;  3TAB A;  1LWF A;  3HRG A;  4M3X A;  4DMN A;  1XQS C;  3PIO L;  1HKB A;  5IT9 O;  3CCQ N;  3K5N A;  3AVL A;  1NWK A;  5FRM A;  1XC3 A;  1XMO K;  4DU3 A;  4H0P A;  4AHT A;  5KPZ A;  1IKV A;  2NRV A;  4JKD A;  4JI6 K;  4BC5 A;  4BRD A;  2XY6 A;  2QK9 A;  4CJR A;  2HBJ A;  4HUE A;  4BAC A;  3C6T A;  4M3U A;  4F3T A;  5ELZ A;  4KHW A;  2A3Z A;  4CZJ A;  4RW7 A;  3JSM A;  2E2N A;  1L3T A;  4B08 A;  3A0I X;  1HPZ A;  2ZQB A;  2OTL N;  4KHS A;  3I0S A;  1X9J A;  1HYV A;  1ATN A;  1GLE G;  3AO4 A;  2E5L K;  4KB0 A;  3JAM O;  4XIU A;  4ILG B;  4AM7 A;  3TTD A;  5J2Q A;  4E1M A;  2FLO A;  4O55 A;  5AR0 A;  3TTC A;  3C6H A;  2KW4 A;  4BR2 A;  3KLI A;  4FJI A;  1RBT A;  4CK1 A;  4FM2 A;  3KZB A;  1WOQ A;  3L2R A;  1NK4 A;  3PY8 A;  2IVN A;  1TAU A;  4DWI A;  3W0L A;  4AF1 A;  4Z4I A;  3CYM A;  4PKH A;  4LF6 K;  1I3A A;  4CJT A;  5EU7 A;  3OS0 A;  4IXC A;  3HVT A;  4M63 C;  3QET A;  1S1T A;  3E9P A;  2HST A;  3ZSO A;  1VQ8 N;  3HSC A;  5JVG L;  4KBO A;  5KRS A;  4H03 B;  3U8X A;  4EP5 A;  2D0B A;  4IBN A;  1VSE A;  4DSK A;  4JI4 K;  1JCF A;  3CFR A;  4PHT X;  4XEI A;  4ICL A;  1RT3 A;  1TGO A;  2E4L A;  3B6O A;  3IS9 A;  3PV8 A;  1BQN A;  4O8U A;  2XY8 A;  4CBW A;  2NUB A;  4DFK A;  3PX0 A;  4LFC K;  1KVC A;  3CCE N;  1IJJ A;  1RDU A;  3HYF A;  3MWT A;  4QCL A;  1G99 A;  4E7I A;  4QS8 A;  2KKZ A;  2NNW A;  4BWM A;  1VSJ A;  3AA5 X;  5AQF A;  1VQ9 N;  1BHL A; 
#chains in the Genus database with same CATH homology
 1SV5 A;  4O4G A;  1X9M A;  3P1G A;  3NGI A;  1JL1 A;  1BCM A;  2P51 A;  3ZT3 A;  2G8F A;  4M3R A;  1HNI A;  3ZCM A;  3H08 A;  4PY5 A;  3OYB A;  5C24 A;  4M45 A;  3V1O A;  3EYZ A;  2E6L A;  4KB0 A;  5T7B A;  4UQG A;  2ZD1 A;  4KTW A;  4DTN A;  3KK1 A;  1NKB A;  1Z26 A;  4CF1 A;  3S3O A;  3AA3 A;  1SKS A;  4KTZ A;  3SPY A;  3KKS A;  2BE2 A;  3QIN A;  3SV4 A;  1KLN A;  3KLG A;  3LZJ A;  1S9E A;  4DTS A;  3TWH A;  4DSJ A;  1A5X A;  1CZB A;  3AO2 A;  2G8H A;  1JLC A;  1REV A;  3NDK A;  3ZT4 A;  2QKB A;  4C8N A;  1NJW A;  2RN2 A;  3VQ5 A;  4IKF A;  4CEC A;  4DSF A;  4AHS A;  3SUO A;  4DSI A;  3ALY A;  3ZSY A;  4CGG A;  5I3U A;  3NH1 A;  1RDD A;  4H4O A;  4CFD A;  1D5A A;  1YVU A;  3DRP A;  4DTO A;  1RTD A;  4FJG A;  4ID5 A;  3WNF A;  3NAE A;  1HNV A;  4MFB A;  3NE6 A;  2PYL A;  4CJL A;  4E0D A;  5KTQ A;  3VQA A;  3KIO A;  1LWE A;  1NKC A;  4OLA A;  2KTQ A;  4FW2 A;  2KFZ A;  3KTQ A;  2HB5 A;  4NYN A;  4DFP A;  1Z25 A;  2X78 A;  4CGH A;  1RDB A;  3M8Q A;  3HST B;  2ATQ A;  3KLF A;  3LWL A;  4LSN A;  3MEG A;  3EZ5 A;  3NF7 A;  1ZYQ A;  3OS1 A;  3ZSX A;  4KHN A;  3M8R A;  1J9A A;  2D0A A;  3AVN A;  1A5V A;  1C0M A;  1EET A;  3TAG A;  5HRO A;  1UOC A;  4BDP A;  2QK9 A;  4ELV A;  2DTU A;  4F8R A;  4IFY A;  3MAQ A;  3RRH A;  3QNN A;  1CLQ A;  3RWU A;  3JYT A;  2WON A;  1NK8 A;  3O4Q A;  4PQU A;  1B92 A;  4M42 A;  2HHU A;  4FLZ A;  3QES A;  2RKI A;  1KTQ A;  5J2M A;  3NF9 A;  3SUN A;  2PY5 A;  3V6D A;  4CHP A;  1ZBH A;  3K5M A;  4J2E A;  5D3G A;  3V1Q A;  1RDC A;  1VSI A;  4B9N A;  3ZSQ A;  4KHU A;  1MU2 A;  4E7L A;  1Q8I A;  3L2Q A;  4J2B A;  4EP4 A;  5J1E A;  4FJ8 A;  2G8I A;  3KK2 A;  3VQD A;  1BI4 B;  1IKX A;  2Y1J A;  4TSX A;  1QE1 A;  1UAX A;  4QAG A;  1SKW A;  3LWM A;  1QSS A;  2JLE A;  1VSM A;  3VQB A;  4DG1 A;  3F9K A;  1HJR A;  3K57 A;  3IG1 A;  3IRX A;  5CYQ A;  1KVA A;  3DRS A;  3D0P A;  1D9F A;  3HXM A;  4KB1 A;  3CFP A;  1BGX T;  1JLA A;  1X9W A;  4JS5 A;  4I2Q A;  5KRT A;  2FBY A;  1BIU A;  3DLB A;  2B5J A;  4JLH A;  5KGW A;  4CJW A;  4CIG A;  3G10 A;  1T05 A;  2HMI A;  4DSL A;  3PO4 A;  3NBP A;  4KRE A;  1EKE A;  4Q5V A;  3C6U A;  1G15 A;  4F2S A;  3CQ8 A;  3VQQ A;  3V1R A;  2OA8 A;  3HP6 A;  2R7Y A;  4HVJ A;  4O0J A;  3VQ7 A;  4FYD A;  3LPT A;  3DRR A;  3AO1 A;  4E19 A;  2I5J A;  1VRU A;  1S6P A;  4DQS A;  1NK5 A;  1ZBI A;  2DFE A;  2HHQ A;  3OYI A;  1NK7 A;  4Z4E A;  1IO2 A;  2IAJ A;  3SNN A;  2IS3 A;  2X74 A;  3ISN C;  2YNH A;  4CJS A;  4O5B A;  4HUF A;  3QER A;  3AA4 A;  4K8Z A;  1RT7 A;  4W5N A;  4OKK A;  4CHN A;  1RDA A;  3QEI A;  2D5R A;  3E01 A;  3SUQ A;  1LW2 A;  3VQ6 A;  4GW6 A;  4BWJ A;  4IG3 A;  3KK3 A;  3V4I A;  4OKJ A;  4CJU A;  3B6P A;  1WAJ A;  1S1X A;  1YTA A;  5HLF A;  1QSY A;  5CZ1 A;  1VSH A;  3ZT0 A;  3OYC A;  3KLH A;  1LV5 A;  4DTX A;  3HPH A;  1SKR A;  1TV6 A;  3DLH A;  3HO1 A;  1Q9Y A;  1ZBL A;  4CEZ A;  3OYM A;  2E6M A;  4LH4 A;  2EHG A;  3AVA A;  3TAN A;  3O3H A;  4DLE A;  3V9U A;  1VSK A;  1IKW A;  1U4B A;  4Q0B A;  3TAP A;  3KLE A;  4M3T A;  1TAQ A;  3V81 A;  4FXD A;  2ETJ A;  3SQ4 A;  1TK5 A;  2JGU A;  4HUG A;  1DTT A;  3AVF A;  4CEO A;  4CJ3 A;  4JS4 A;  4I7F A;  3SUP A;  1KSP A;  1CXQ A;  1JXB A;  2DFF A;  2BAN A;  3NF8 A;  3TAQ A;  3DMJ A;  1WSG A;  4O44 A;  1VSD A;  4W5R A;  3RR8 A;  1ZBU A;  4DTP A;  2X6S A;  1FXX A;  2HHS A;  3QNO A;  1RTH A;  5SZT A;  2GUI A;  1FKP A;  2HNZ A;  3TAR A;  3VQC A;  4N5S A;  4DSE A;  1XHX A;  3AVC A;  4RW8 A;  1NJY A;  3IAY A;  1RBV A;  1WN7 A;  3AV9 A;  4B9S A;  3F73 A;  4B9M A;  4FK0 A;  3HM9 A;  3QLH A;  4AIL C;  3MXJ A;  3OVN A;  1TKX A;  2GV9 A;  4IDK A;  4AHV A;  1TKD A;  2DY4 A;  4N41 A;  3TAF A;  1IG9 A;  2D0C A;  3NCI A;  4DF8 A;  1CXU A;  2YHA A;  2YNI A;  3OYE A;  4HHT A;  4CEA A;  3LAK A;  4DU1 A;  1I39 A;  4F4K A;  4FJI A;  3HL8 A;  1GOA A;  3A2F A;  4OLB A;  4C8O A;  3NFA A;  4CE9 A;  4KHY A;  5KI6 A;  1SL0 A;  4EZ9 A;  1TL1 A;  4Z4F A;  4KRF A;  1JLF A;  4Y1C A;  4AHC A;  4M41 A;  4W5O A;  2Z1H A;  4G1Q A;  4GMJ B;  3LAN A;  1C6V A;  1B9D A;  1Q9X A;  2PZS A;  3OYN A;  5FRN A;  3CG7 A;  3VQP A;  1N6Q A;  4DFM A;  4OPJ A;  1HQU A;  1S1V A;  4CGJ A;  2P5G A;  3HK2 A;  4CFB A;  3SV3 A;  1XI1 A;  1W9H A;  4LH5 A;  3DLG A;  3OS2 A;  2HHT A;  2OYQ A;  4W5Q A;  4CHQ A;  4I9L A;  3AVG A;  4IG0 A;  1HQE A;  1NOZ A;  2P1J A;  4Z0U A;  4KO0 A;  3ZT1 A;  4JRQ A;  2KZM A;  3DLE A;  2XHB A;  1K6Y A;  3V9Z A;  2BDP A;  4OVL A;  1XWL A;  4CIE A;  2GBZ A;  1KVB A;  3DM2 A;  4Z4C A;  4OGC A;  2W42 A;  3QEW A;  4CED A;  4H4M A;  5HRR A;  4PWD A;  1RT1 A;  3ITH A;  1BL3 A;  3DOL A;  4CF2 A;  3LZI A;  4AHR A;  1KLM A;  4E7H A;  3AVH A;  3S9H A;  4K8X A;  4FK2 A;  2HW3 A;  3VQ4 A;  4CK3 A;  1NJX A;  5HRP A;  1KFD A;  4DS5 A;  3QIO A;  4H8K A;  1WSE A;  4M3Z A;  3O4N A;  1BIS A;  3O3G A;  4F3O A;  1VK0 A;  4FLX A;  3ZSW A;  4CFC A;  4KPY A;  1UA1 A;  4FJJ A;  1A5W A;  1N5Y A;  5CYM A;  3BDP A;  5J2P A;  1WAF A;  2G8U A;  5DMR A;  3P5J A;  1X9S A;  3K59 A;  3PUF A;  1QS4 A;  3M8S A;  4FLU A;  3U3Y A;  3S3M A;  1JKH A;  1TVR A;  3RRG A;  1RT4 A;  3ASM A;  4E1N A;  2ITG A;  4CEE A;  4B9U A;  4MQ3 A;  4FZY A;  3HT3 A;  4B9T A;  1C1B A;  4C8M A;  3OYJ A;  1YTU A;  4CCH A;  1S1W A;  2VG6 A;  3WNE A;  5HP1 A;  3SPZ A;  3AVJ A;  5K14 A;  2FBX A;  3ZSR A;  1IKY A;  2Z1I A;  5CZ2 A;  3WNH A;  4QOZ B;  4N56 A;  4NYF A;  3OYD A;  3O3F A;  3MED A;  3SYZ A;  3CM6 A;  3NF6 A;  3AA2 A;  4DQQ A;  4KI6 A;  4BE1 A;  2YNF A;  4CJE A;  4DTM A;  4CGD A;  4ZHR A;  4I2P A;  3DOK A;  3ZT2 A;  2QXF A;  4CJQ A;  1TKZ A;  4C8L A;  3NGZ A;  1HRH A;  3MEE A;  4CJK A;  3SJJ A;  4FJM A;  1JLE A;  4PA1 A;  4ELT A;  2HHX A;  2OPQ A;  1S1U A;  1BQM A;  1JXE A;  4FCY A;  1XHZ A;  3L2W A;  2VWJ A;  1T03 A;  3LPU A;  1RBU A;  1EX4 A;  3LP1 A;  1BCO A;  4OPK A;  4E7K A;  4KTQ A;  3OJS A;  2WOM A;  1RTJ A;  4FW1 A;  4EZ6 A;  3G0Z A;  4NCA A;  4CF0 A;  4CER A;  4FLT A;  3KD1 E;  1EP4 A;  3QIP A;  2OZM A;  4NCG A;  2YV0 X;  2OPR A;  5C25 A;  1C0U A;  4CHY A;  3TAE A;  4E3S A;  1L3V A;  1VSL A;  4I9Q A;  1T8E A;  3FFI A;  4DQP A;  2O4I A;  3HVR A;  4R5P A;  4CGI A;  1JL2 A;  3VN5 A;  4LD0 A;  4CFA A;  4CEF A;  3ULD A;  3MXM A;  4W5T A;  4AH9 A;  3K5L A;  4CEQ A;  1QTM A;  4CJ4 A;  1KRP A;  2B6A A;  1ZBF A;  1LAW A;  2G8K A;  3I8D A;  1T7P A;  2PYJ A;  4PUO A;  1QHT A;  2ZE2 A;  3VQ9 A;  2XY5 A;  1UA0 A;  1VSF A;  4DQR A;  2IDO A;  3QEP A;  4FM0 A;  1SL1 A;  4BE0 A;  4FLW A;  2QKK A;  2RPI A;  4B8A B;  1UWB A;  2HNY A;  1WNS A;  1QQC A;  1W0H A;  4FJH A;  3C94 A;  3L2U A;  2IOC A;  3QEX A;  1C0T A;  4Z4G A;  1NKE A;  2VG7 A;  1BIZ A;  3LDS A;  2KQ2 A;  1D8Y A;  4B9L A;  3L3V A;  1O1W A;  1RT2 A;  1S5J A;  3OJU A;  1L3U A;  2X6N A;  3KJV A;  3SQ2 A;  1U45 A;  1J54 A;  1KCF A;  3SQ1 A;  1ASW A;  4RW6 A;  2O4G A;  1RNH A;  3MXI A;  4ID1 A;  3RMD A;  1HMV A;  1GOB A;  2B4J A;  1TK0 A;  3OYH A;  2EX3 A;  3KKR A;  2OPS A;  1LWC A;  1ITG A;  2HND A;  2HHW A;  2YHB A;  3HPO A;  1NJZ A;  4BE2 A;  3SZ2 A;  1SL2 A;  4GVM A;  3M8P A;  4FJ5 A;  3HJF A;  1C1A A;  5KGX A;  3OY9 A;  2YKN A;  3T1A A;  4DU4 A;  1LW0 A;  3VA3 A;  2XY7 A;  2LSN A;  2P5O A;  1TL3 A;  1RTI A;  3VA0 A;  1B9F A;  1RIL A;  4DQI A;  3TAM A;  2Y1I A;  5FRO A;  3LAM A;  1QSL A;  2Q3S A;  1NK0 A;  4KHQ A;  2HVI A;  1WSH A;  4Z4H A;  4FLY A;  3V9X A;  4E7J A;  3K5O A;  2Z1G A;  1S9G A;  3C95 A;  3P83 D;  4E89 A;  2DFH A;  2XO7 A;  4FLV A;  2FBT A;  1L5U A;  1ASU A;  4HCC A;  1WSJ A;  1BI4 A;  3PX4 A;  3K2P A;  3AVI A;  4FM1 A;  1DTQ A;  5HRN A;  4CHO A;  3TAB A;  4B9V A;  4M3Y A;  1LWF A;  3PX6 A;  2AJQ A;  5JS1 A;  3UIQ A;  4F2R A;  3SQ0 A;  2A1S A;  4BDZ A;  4DMN A;  4M3X A;  4CJV A;  4DTU A;  1ASV A;  3DI6 A;  1LAV A;  3MEC A;  4KI4 A;  3K5N A;  1GOC A;  2YKM A;  4FJL A;  3AVL A;  3LAL A;  3BGR A;  4FJX A;  5FRM A;  2G8V A;  4DU3 A;  2VWK A;  4HTU A;  3OYK A;  3CFO A;  3OYF A;  4DF4 A;  4AHT A;  3AVM A;  1FKO A;  1Y97 A;  3LP0 A;  5I42 A;  1WSI A;  1U49 A;  4Y1D A;  3OYA A;  2IC3 A;  4DLG A;  3QEV A;  3U6F A;  1IKV A;  1NK9 A;  4FZX C;  2IGI A;  3DLK A;  2XY6 A;  3T3F A;  3CM5 A;  3TR8 A;  4CJR A;  3OYG A;  1TKT A;  1JLG A;  4HUE A;  2OPP A;  4BAC A;  3RTV A;  4FJ7 A;  3C6T A;  4M3U A;  1TK8 A;  1WLJ A;  4F3T A;  4KHW A;  2BGG A;  4OGE A;  4CF9 A;  5C42 A;  1SUQ A;  1JLQ A;  5FDL A;  4RW7 A;  4CJF A;  4KAZ A;  3JSM A;  2A1R A;  4N76 A;  3RMA A;  4RW9 A;  1L3T A;  4WE1 A;  1X1P A;  4B08 A;  1HPZ A;  2ZQB A;  3DLR A;  4KHS A;  3I0S A;  1U48 A;  1HYV A;  2VG5 A;  3AO4 A;  3NGY A;  4JRP A;  4O0I A;  5JS2 A;  3NHG A;  4DTR A;  1NOY A;  3AO5 A;  4CEB A;  4XIU A;  2KFN A;  4LY7 A;  3D45 A;  5J2Q A;  4KFB A;  4E1M A;  4FJ9 A;  3AO3 A;  4O55 A;  5DK5 A;  2XRI A;  3NH0 A;  3SI6 A;  3PO5 A;  4B8C A;  1WSF A;  2KW4 A;  4CES A;  3KLI A;  1XC9 A;  3KD5 E;  1RBT A;  4AHU A;  4CK1 A;  1F21 A;  4FM2 A;  1D9D A;  4CK2 A;  3L8B A;  3L2R A;  4FJN A;  3HP9 A;  1L3S A;  1NK4 A;  3PY8 A;  1DLO A;  3AVK A;  5HBM A;  1RBR A;  1RBS A;  5HRS A;  1HYS A;  3AVB A;  1YT3 A;  4DWI A;  1TAU A;  4Z4I A;  1S6Q A;  3CYM A;  1KFS A;  1CZ9 A;  2F8S A;  4CHZ A;  3V9S A;  4J2D A;  3ZSZ A;  1I3A A;  4CJT A;  5EU7 A;  3OS0 A;  1U04 A;  1JLB A;  1FK9 A;  3TI0 A;  3I0R A;  3HVT A;  4LSL A;  3QET A;  2F8T A;  1S1T A;  4C8K A;  3QO9 A;  3K58 A;  4DFJ A;  3VQE A;  4CJ5 A;  3VQ8 A;  4L8R B;  3ZSO A;  4FZZ A;  4IFV A;  4DS4 A;  2OZS A;  4ZTF A;  4KKO A;  3U3G A;  3OYL A;  4ELU A;  5KRS A;  3L2V A;  1RT5 A;  2YNG A;  4EP5 A;  4YNQ A;  3S3N A;  3SCX A;  3LP2 A;  4N47 A;  2D0B A;  4YFU A;  3RMC A;  1EXQ A;  4IBN A;  4HCB A;  2KZZ A;  1VSE A;  4DSK A;  2RF2 A;  3WNG A;  1J53 A;  3EY1 A;  2FBV A;  3CFR A;  4CGF A;  4OKE A;  4DTJ A;  2Z1J A;  4FVM A;  4ICL A;  1RT3 A;  4KV8 A;  1TGO A;  2HHV A;  1C1C A;  2E4L A;  4RW4 A;  1RT6 A;  3RR7 A;  3B6O A;  5SWM A;  2HVH A;  3T19 A;  3IS9 A;  3PV8 A;  3RMB A;  4J2A A;  1BQN A;  4BDY A;  5CY4 A;  3HPG A;  2G8W A;  2XY8 A;  1U47 A;  2FC0 A;  4FJK A;  1VRT A;  4FK4 A;  3ZSV A;  4M3W A;  2NUB A;  4DFK A;  3PX0 A;  3L3U A;  1KVC A;  4CF8 A;  4CIF A;  3NH2 A;  3DYA A;  1HYZ A;  4RG8 A;  4B3O A;  4CJP A;  3LP3 A;  1J5O A;  4ZTJ A;  3HYF A;  5E41 A;  3V9W A;  1R0A A;  4QCL A;  4E7I A;  2F96 A;  4NCB A;  1IH7 A;  3THV A;  4BWM A;  1VSJ A;  3AA5 X;  4OJR A;  1RCH A;  1NK6 A;  5J2N A;  1BHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...