2QKBA

Human rnase h catalytic domain mutant d210n in complex with 20-mer rna/dna hybrid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*GP*AP*GP*UP*GP*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*
publication title Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna/rna
total genus 45
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2qkbA00
4M3RA 4CJLA 1RT6A 5E41A 4FLWA 4Z4FA 4J2AA 4CJFA 3LP3A 4DTMA 4CEDA 1D9DA 1KVAA 3QEVA 1TAQA 3ALYA 3HSTB 2XY6A 2XY5A 2EHGA 4DSKA 1SUQA 4KPYA 1R0AA 4I9QA 3HYFA 1RBRA 1TK5A 2G8VA 2AJQA 3AO2A 3AV9A 5JS1A 4CJPA 1D5AA 3DRRA 2GV9A 3NE6A 3NBPA 3HM9A 3ZSZA 4KHNA 1FKPA 3QEPA 3AVHA 2LSNA 3VQ8A 4FM0A 1Q9YA 4CFAA 4Z4EA 2Z1JA 2WOMA 2HHVA 2YHAA 1RDBA 4I9LA 3HPGA 4BDYA 3QO9A 4FZXC 1KFSA 3HP9A 5CZ2A 3L2VA 1N5YA 3L2QA 1A5VA 3RR7A 2D0CA 1Z25A 5KGXA 3U3YA 3AO5A 4NCAA 1Z26A 3V9WA 4ICLA 1S1WA 2QK9A 2X6NA 1WNSA 3OS2A 1XWLA 1HQEA 3AO4A 3SV3A 1NJYA 2HHTA 1B9DA 1EX4A 1K6YA 3G0ZA 2YNHA 3SUQA 4B9LA 1BQMA 1SL1A 1JLCA 1QSLA 3HO1A 3KLIA 4CIEA 3KTQA 3FFIA 5EU7A 4JS5A 1QSSA 3TAPA 4E1NA 4DWIA 3K58A 1JLGA 2DFEA 3TARA 2E6MA 1REVA 1ZBLA 4Y1CA 2HMIA 1EETA 4I2QA 1IKVA 3UIQA 2HHQA 2FBYA 1VSMA 3S9HA 4CEAA 4CEBA 1SL0A 3ASMA 1CXQA 5FRMA 1HNVA 1L3VA 2HNDA 4CJUA 2X6SA 3K59A 2DTUA 2YHBA 4N5SA 3PX4A 2FBVA 3LALA 3OS1A 4JRPA 4JS4A 4DFJA 3OYLA 3LAMA 3AA4A 1BI4B 1TVRA 2YV0X 3B6PA 3L2WA 1T7PA 1S1XA 2RKIA 2Y1IA 4EZ9A 4W5TA 4CJ3A 1VSJA 5CY4A 4GMJB 1LAVA 3OYGA 2G8FA 2ITGA 3M8SA 4CGIA 4RW8A 4H8KA 3V9UA 4H4MA 4ELVA 4YFUA 2W42A 3DI6A 3SI6A 4Q5VA 1RBSA 5FRNA 4Z4GA 4HTUA 1VSDA 4OPJA 1S6QA 1S1TA 4PUOA 5D3GA 1LWFA 1W0HA 3P5JA 4Z4IA 2F8TA 3L3UA 4ZHRA 1WN7A 1D8YA 1S5JA 3TWHA 4FLXA 1WAFA 4J2BA 4B9MA 4DF4A 4FM2A 1ZYQA 4WE1A 4QCLA 3DOLA 3VQCA 1RTJA 3WNGA 4KHWA 4AHVA 2ATQA 3OYEA 4M45A 4BDZA 4E7JA 1RILA 2ETJA 4HUGA 3K5OA 1UA1A 1NKCA 3IG1A 3TR8A 3S3OA 1QHTA 2HHWA 1LAWA 5I42A 3PY8A 2HW3A 1C0MA 1HJRA 4OVLA 3OYCA 3M8RA 3D0PA 5HRPA 3OJSA 4NYNA 3SUNA 5HROA 1RDCA 3V9ZA 4DQPA 4RW9A 3EY1A 1JXBA 3PUFA 4O44A 2FC0A 2Y1JA 3PX0A 4CGHA 3TANA 1U48A 2P5GA 1HYVA 4FXDA 4IKFA 3K5NA 4FW2A 3P1GA 3ZCMA 3TAQA 4DSIA 3AVLA 3U6FA 1QE1A 1UWBA 4B8AB 4W5QA 4OGEA 2YNIA 5CZ1A 1MU2A 2QXFA 1XC9A 2VG7A 2OZSA 1SL2A 4EZ6A 2HHXA 5SZTA 1BISA 1TKZA 1QTMA 3PO4A 1L5UA 4BDPA 3E01A 3HPOA 1U49A 4F8RA 2RPIA 3ZSWA 1TGOA 3WNFA 4CESA 2XY7A 1KFDA 2KFZA 3RRHA 3CFPA 4JRQA 3QIOA 4E19A 4CIGA 4BE1A 1NKBA 1IG9A 1JLQA 3O3HA 4M3TA 2JGUA 3SQ4A 1A5WA 4R5PA 5DK5A 4K8XA 1BIUA 2GBZA 3IRXA 5FROA 4B08A 5J2QA 4FK4A 3O4NA 4DF8A 4OLAA 1IKWA 4CGGA 4HHTA 3HP6A 2G8HA 4FLTA 3TAEA 3I0SA 2PYLA 4F2SA 4FK2A 1C1CA 3QEWA 4DQSA 5HBMA 3DLKA 1TKTA 3AVIA 4KFBA 5DMRA 1RT2A 1I3AA 1TV6A 1VSHA 3TI0A 4FJHA 4KHSA 4QOZB 3ZT3A 1YTAA 3MXJA 4AILC 4FJ7A 4M3XA 1RTDA 4CJVA 3CM5A 4M3WA 1LWEA 3LWMA 3HL8A 3HT3A 1XHZA 1FXXA 2Z1IA 4CERA 4B9NA 1ASWA 3OJUA 1NJXA 1NK6A 1WSIA 3AVMA 4E7IA 2G8WA 3NF9A 3A2FA 4OLBA 2HHSA 3NGIA 3NFAA 4FCYA 2HNYA 3I8DA 1JL2A 5HRRA 1NK0A 1JXEA 1B9FA 4W5RA 3PX6A 3JYTA 4KB0A 2B4JA 2X78A 1FK9A 1VRUA 1HYSA 4GW6A 3WNEA 4CJ4A 1NK8A 1VSEA 3SUOA 3O3GA 4KHYA 1BHLA 4KHQA 2OPRA 1VSIA 3K2PA 4CK1A 4PQUA 2WONA 3VQ4A 1S1VA 3ISNC 1EKEA 1DTQA 3NH0A 3OYKA 1WAJA 1O1WA 2KZZA 1EXQA 4CF0A 1B92A 3O3FA 3SQ2A 4DSLA 3RMAA 1X9SA 3HXMA 4CJEA 2E4LA 3DLGA 4B9TA 4B9VA 1RBTA 5FDLA 5HP1A 4AHCA 3SJJA 3HJFA 3VN5A 1HMVA 4DFPA 3SQ0A 2VG6A 4Y1DA 5KI6A 2BE2A 2Z1GA 3G10A 5I3UA 4CEQA 1NOYA 1L3SA 3TAGA 2F8SA 2QKBA 1KVCA 3KLFA 3NF7A 3KK3A 3T19A 2E6LA 2OZMA 1VK0A 4EP4A 4OGCA 3MEEA 4FJJA 3HPHA 4BE0A 2OA8A 4FJKA 1UOCA 3KKSA 1RT4A 4CK3A 4PY5A 3NAEA 4DSFA 5J2MA 2D0AA 2RF2A 3SUPA 4CEZA 3NF8A 4AHRA 5T7BA 4DSJA 3SZ2A 3OYJA 4F4KA 4FJ8A 2O4GA 1KSPA 3L2UA 3DYAA 3CFRA 3KK1A 2QKKA 1WSJA 5CYMA 5K14A 2G8UA 3LWLA 3NCIA 3KK2A 4C8NA 1JLFA 3SCXA 3NDKA 4GVMA 3DLEA 4AHUA 4MQ3A 5J2NA 4DS5A 1KLNA 1KTQA 3LZIA 2XY8A 4TSXA 4E7KA 3S3MA 2A1RA 1T8EA 4OPKA 4CIFA 2P51A 3ZSYA 4W5OA 2RN2A 1JLAA 2B6AA 1TKXA 3ZSXA 4Z0UA 1J54A 3KD5E 1NJZA 3NH1A 4LH4A 1RDDA 2NUBA 5J2PA 3IS9A 4G1QA 3DRPA 1CLQA 4DLGA 1TL1A 5HRNA 4DTJA 2IS3A 3F73A 2R7YA 4B8CA 2HVIA 4F2RA 2KFNA 4M3ZA 3LZJA 4FYDA 1X9MA 3NF6A 3I0RA 1ASUA 3LP1A 2KW4A 4LY7A 2IDOA 4CF9A 1RCHA 3C6UA 4NYFA 4ELTA 3V1OA 3VQQA 1RT5A 5CYQA 3S3NA 4J2EA 3DRSA 1YT3A 4KAZA 3QEIA 2G8IA 4FM1A 4C8OA 2IC3A 3KJVA 3EYZA 3SNNA 4L8RB 4CJTA 3LPUA 3LANA 3HVTA 1WLJA 4LD0A 3KLGA 1GOAA 2IAJA 4CF1A 4CJSA 4DTSA 3OYBA 1XI1A 4PA1A 4RW7A 2PYJA 1JL1A 1JKHA 4CFBA 1T03A 3RRGA 3V4IA 3ITHA 1SKSA 1RT1A 2XHBA 4FLZA 3QERA 3DLBA 1DTTA 3OY9A 1HRHA 1IKXA 1C6VA 1U04A 1C1BA 3V9XA 4FVMA 4B9SA 3KD1E 3DLRA 1ITGA 3QIPA 4QAGA 4DQRA 3V81A 1U45A 3DMJA 2PZSA 1RBVA 4LSNA 4BWMA 3K5MA 4KI6A 4CEEA 3TAFA 4DS4A 4ZTFA 4DTUA 4AHSA 1C0UA 1FKOA 1RNHA 2BANA 3VQEA 2IOCA 3T1AA 2X74A 1QSYA 1RTIA 1WSHA 3PO5A 3AVKA 3SYZA 3BGRA 3BDPA 3EZ5A 4CGFA 3OYNA 3CQ8A 5KRTA 1JLBA 3CM6A 3KIOA 1VSFA 3LP0A 3HVRA 4IBNA 4CEFA 3M8QA 2O4IA 1L3TA 4FZYA 2IGIA 1UAXA 4DG1A 1J53A 1LW0A 3MECA 4CHYA 1VRTA 3MEDA 1Q9XA 4FZZA 4DFMA 3OYHA 1NK5A 3U3GA 2BGGA 1RTHA 3KKRA 4FJNA 2ZE2A 4MFBA 2KTQA 1S9GA 2GUIA 4NCBA 3QEXA 4IDKA 4CHNA 2A1SA 4ID5A 4KB1A 1LW2A 1QQCA 1BIZA 4BACA 1NKEA 5J1EA 1S9EA 2DFFA 1WSGA 3AO1A 4E0DA 2Z1HA 1TAUA 1VSKA 4UQGA 1KRPA 4M3UA 1EP4A 4FLUA 2BDPA 2D5RA 1BGXT 1KVBA 3ULDA 4E3SA 4FJ5A 4PWDA 4E1MA 1RDAA 3K5LA 4KI4A 4O0JA 1CXUA 5KGWA 1RBUA 3MAQA 4DFKA 1SKRA 4B9UA 3HK2A 3VQ9A 4KREA 4FJ9A 1NJWA 1HNIA 4KKOA 1BL3A 4CHPA 4M42A 1ZBUA 4E7HA 3RTVA 3PV8A 3OVNA 4Q0BA 2OYQA 2FBXA 1QS4A 3ZT2A 4H4OA 2F96A 2YNFA 1SKWA 3IAYA 4N41A 4M41A 3AVNA 4DQQA 4DU4A 3SPZA 2OPPA 3KLEA 3OYAA 3AO3A 4OKJA 1TK8A 3VQ7A 1GOCA 4OJRA 3ZT0A 3OYDA 3QNOA 4YNQA 4CJKA 3AA2A 3QETA 4DTRA 4ELUA 1VSLA 2XRIA 3RMDA 4W5NA 1X1PA 4HCBA 1IO2A 1HQUA 5C24A 3ZSOA 4HUFA 1NK9A 5KRSA 3C6TA 4FW1A 2VWKA 4O4GA 3RMBA 3QNNA 1TKDA 4CECA 4AHTA 4KRFA 1F21A 3AVFA 5SWMA 3ZT1A 3VA0A 1TK0A 2I5JA 3P83D 2VWJA 3QESA 5C25A 3CG7A 2FBTA 4ID1A 1BI4A 4RW4A 4CGJA 4DMNA 1ZBHA 1YVUA 4RW6A 4CFCA 1D9FA 3NH2A 2HB5A 2ZQBA 3CFOA 1J9AA 3VQAA 4CJQA 4FJGA 3DOKA 4E89A 4F3TA 1W9HA 4CJRA 3VQPA 2D0BA 1ASVA 4O55A 4K8ZA 3TABA 2HHUA 1C1AA 1ZBFA 1IH7A 1WSFA 4DTOA 4DU1A 4AH9A 1BQNA 5HRSA 3THVA 3MXIA 4KTQA 1C0TA 1S1UA 1LV5A 2HVHA 3AVGA 3M8PA 4ZTJA 4KV8A 1CZBA 3LAKA 4RG8A 4O0IA 3VQ6A 3ZSRA 1Q8IA 1U4BA 4IG3A 4OKEA 2XO7A 2DFHA 1N6QA 3V6DA 4N76A 4Z4HA 3K57A 3MEGA 3V1QA 3SPYA 1BCMA 2G8KA 1HYZA 4IFVA 4NCGA 4DU3A 3AA5X 1NK7A 4KO0A 1T05A 2KZMA 2YNGA 3NGZA 3OYMA 3RWUA 4J2DA 1Y97A 4CE9A 4BE2A 4N47A 5C42A 3VQ5A 1ZBIA 3AVCA 4KTWA 1BCOA 2EX3A 3L3VA 5KTQA 4OKKA 4CHZA 3WNHA 2OPQA 4N56A 4CF2A 4CJWA 4CEOA 2VG5A 1RT7A 1SV5A 3O4QA 1JLEA 1LWCA 2B5JA 3DM2A 4IFYA 4LSLA 4O5BA 4CK2A 4CFDA 4FK0A 3CYMA 3H08A 1KLMA 4LH5A 3ZSVA 1A5XA 2Q3SA 3LDSA 3OS0A 1UA0A 1NK4A 1YTUA 3T3FA 4CCHA 1L3UA 1KCFA 1NOZA 4CHOA 2YKNA 4FJMA 3VA3A 3V1RA 2PY5A 4FJXA 1J5OA 3VQDA 1I39A 4DSEA 3AVAA 3C95A 2P5OA 4FLYA 4I2PA 3F9KA 1U47A 3LPTA 4JLHA 4Z4CA 4C8KA 3L8BA 4DTXA 1CZ9A 4CJ5A 4E7LA 3RR8A 4B3OA 1DLOA 1IKYA 4M3YA 1G15A 3AVJA 4HVJA 3AA3A 1RT3A 1HPZA 4HUEA 4I7FA 3NHGA 4CF8A 4BWJA 4CHQA 3ZSQA 4FJIA 4DTNA 2DY4A 4DTPA 3DLHA 3NGYA 2P1JA 5HLFA 3OYFA 3TAMA 3QLHA 3KLHA 4F3OA 4C8MA 4KHUA 2KQ2A 3SQ1A 3AVBA 4DLEA 2OPSA 3QINA 1WSEA 4FJLA 3B6OA 2ZD1A 2JLEA 3SV4A 1S6PA 3V9SA 3RMCA 4DQIA 3JSMA 3L2RA 1GOBA 1TL3A 1XHXA 3VQBA 2HNZA 4XIUA 3MXMA 1X9WA 3LP2A 4IG0A 4CGDA 4HCCA 4C8LA 3C94A 3D45A 4KTZA 3OYIA 5JS2A 2YKMA 4EP5A 3ZT4A 4FLVA
chains in the Genus database with same CATH superfamily
4M3RA 3UKRA 3P4IA 4CJLA 5E41A 4CEDA 3CD6N 1KVAA 1TAQA 1SUQA 3DXKA 1QQNA 2AJQA 1YF5L 4BRNA 3FZHA 5JS1A 4K0KK 3NE6A 3HM9A 1IBKK 3WUHA 3AVHA 4K42A 3U4LA 3UKRB 1Q9YA 3HRGA 4NLBA 5M1PA 2WOMA 2HHVA 3SAHA 3ENHA 3QO9A 3MX2A 2PBDA 3DXKB 2KHOA 4MO4A 1KAYA 2P9KA 3U3YA 2IVPA 4A61A 1S1WA 2X6NA 2O8EA 1WNSA 3OS2A 1WBDA 1XWLA 4PHTX 2I7PA 3C65A 4LFBK 4B1YB 2ZJQL 3SUQA 1JLCA 3HO1A 3CJBA 4CIEA 3KTQA 1OKJA 2P9KB 4YOTA 4DWIA 1J6ZA 2NLXA 4WCEL 4BGBA 4CI6A 1GLFO 1EETA 2O8EB 3CCRN 3O8MA 3UIQA 4GV9A 2ZWHA 3QFUA 1VSMA 3S9HA 4CEBA 3CIPA 2HNDA 2X6SA 3K59A 3OS1A 3OYLA 5E84A 2ZF5O 4CJ3A 3O4WA 2Q36A 4FWKA 4X64K 3PSIA 2QA4N 4ELVA 1RBSA 5FRNA 5LJVA 3P38A 1XNQK 2E20A 3KZBA 1K9MO 1RTJA 3OYEA 4E7JA 4IO9L 2HHWA 2HW3A 1C0MA 2AA4A 3O9UA 4YOUA 4KH6A 1RDCA 3V9ZA 2Q31A 1JXBA 4YOXA 4CGHA 1VQPN 2WUSA 2VQFK 3O80A 2YHWA 3P1GA 2E2QA 4OGEA 1MU2A 2QXFA 3ZX2A 3P39A 1QTMA 2HBLA 4BDPA 5GIOA 1HPMA 3VPZA 1U49A 2RPIA 2XY7A 4IOXA 3JAMO 5KQ8A 4CZMA 1JLQA 1E4GT 5I9EB 4R5PA 5FPEA 4K8XA 1BIUA 2GBZA 3O5BA 3G6EN 4FK4A 4OLAA 1IKWA 4HHTA 4DV0K 3I0SA 3IDHA 5CE3A 4JI3K 4FK2A 1C1CA 4DQSA 3O1WA 3GOIA 1VSHA 4FJHA 4BR2A 3MXJA 2A42A 3CCVN 4GV3A 4IXCA 2Z1IA 2YCHA 1NK6A 5AQVA 5IT9O 1HNZK 1OVYA 5B8HA 4JK8A 5M1OA 3JYTA 2B4JA 1RFQA 1YIJN 1NGIA 4CJ4A 4CZIA 4RCHA 1VSIA 4DUYK 3ISNC 2A6AA 2WFBA 1Y64A 5AQGA 3FLCO 3VF4A 3THXA 4DSLA 1NGHA 4JKGA 3VOVA 4CJEA 3HXMA 3CI5A 5FDLA 4AHCA 2HHHK 4DFPA 5AQMA 4Y1DA 5KI6A 2F8SA 1MWMA 3O9RA 4WYBA 3KK3A 1C0FA 5JLHA 4OGCA 3MEEA 3THXB 3HPHA 4JKDA 3NAEA 3SUPA 3JS6A 3SMPA 4OPHA 4X65K 3L2UA 2Q0UA 3VENA 3KK2A 4JI1K 2FF3B 3O08A 1KLNA 4MQ3A 4DS5A 5C2DA 1KTQA 2RHKA 4Z94A 2GWKA 1OH8A 4CIFA 2BTFA 3ZSYA 4W5OA 3AARA 2UYTA 1QQOA 3ENBA 1RDDA 2NUBA 2ITMA 1ZBSA 4DLGA 2IS3A 1TUYA 5BRDA 3LZJA 4FYDA 3NF6A 3I0RA 4X66K 3EN9A 1RCHA 2VGNA 4CJ7A 4XH4A 4DR1K 3BP8A 3VQQA 1W97L 2G8IA 3QEIA 1HKGA 2IC3A 4JEPA 3BEXA 3UB5A 1WLJA 5KPZA 4XEIA 3OYBA 3SK3A 4BR5A 4CFBA 3EZWA 3DLBA 4H0TB 3OY9A 4WQ5A 4B9SA 1C1BA 3DLRA 2PZSA 4BWMA 4KI6A 4ZTFA 4B3MK 4AHSA 1C0UA 1RNHA 3CJ1A 3VQEA 4H5VA 3GL1A 1WSHA 3EZ5A 3K0SA 3J8AA 2E1ZA 2IGIA 4H5RA 4CHYA 1J53A 1LW0A 3MEDA 4MLEA 4MLHA 1NK5A 3U3GA 2BGGA 3E66A 4JV5K 4MFBA 2FXUA 3C6HA 4FWLA 2E88A 1Q81O 5JVGL 2KTQA 2GUIA 3BF1A 4IDKA 4CHNA 2A1SA 4KB1A 1LW2A 3E9PA 1QQCA 1BIZA 4BACA 2QI2A 3AO1A 4UQGA 4M3UA 1BGXT 1KVBA 3IKMA 4E3SA 4FJ5A 4X62K 4A2BA 4DFKA 1RBUA 4FJ9A 4KKOA 1BL3A 4CHPA 3PV8A 5BPLA 1QVFM 4Q0BA 4H4OA 2F96A 3A5MC 4M41A 3SPZA 2OPPA 4JKAA 5AJ3K 3CMEN 4OKJA 5AQUA 4GVEA 3QNOA 4IDHA 3AA2A 4DTRA 4DV4K 2XRIA 1HQUA 3ZSOA 1NK9A 3H46O 3C6TA 1TKDA 4DR6K 5SWMA 3VA0A 5C25A 2FBTA 1R59O 1ZBHA 1S22A 4CFCA 2HB5A 3EEQA 2V51B 1Z05A 4LC9B 3DOKA 4F3TA 4MDAA 1W9HA 3VEYA 4O55A 1J5EK 3EKUA 3AAPA 3THVA 4KTQA 3MK6A 1U6ZA 3ZSRA 1Q8IA 4IG3A 4OKEA 3A5NC 4H0XB 4CZFA 3V6DA 3V1QA 4DU3A 4JYAK 1NK7A 2NRRA 1YI2N 5C0YA 4N47A 3AVCA 4KTWA 5EXWA 4OKKA 3ATVA 4H5TA 2OPQA 4N56A 1SV5A 3O4QA 4IFYA 4FWQA 3LDSA 3OS0A 2CH6A 2QTDA 1KCFA 4CHOA 4DB3A 1Z6RA 1NJIO 2O8BA 2PY5A 3QMLA 5IWAK 1I39A 2QW9A 4OX9K 1U47A 4CZEA 4FWNA 3OHRA 4BC2A 5JMVA 4JD2B 3L8BA 4DTXA 4JAXA 1DLOA 1IKYA 3DXMA 1HPZA 4H5NA 4CHQA 2O8BB 4NXNK 5EY4A 4JI6K 5HLFA 4BRAA 3TAMA 3QLHA 5MLCQ 4C8MA 3TPQA 1NGEA 2ZD1A 4BG9A 4DQIA 3JSMA 4XIUA 3VQBA 3M6GA 3DXMB 4AQYK 4C8LA 3E9OA 1VQKN 4A2AA 3OYIA 2YKMA 3N4PA 3A5LC 3I8BA 4FLWA 4J2AA 4A5AA 2NRZA 4DTMA 1XMQK 3LM2A 3ALYA 3H1VX 2NZTA 4LFAK 1R0AA 1XC3A 1RBRA 2G8VA 2O8FA 3AO2A 3BZKA 4M7YA 4CJPA 4BRQA 3NBPA 4DQ8A 4KBOA 3HM8A 5AZIA 4IJNA 2YHAA 1NMDA 4B1WB 4F9OA 3HPGA 1KFSA 4QS9A 3L2VA 2O8FB 3RR7A 1A5VA 2UXDK 4YY3K 4NCAA 3V9WA 4ICLA 3F2KA 4OPAA 5AZIB 3CJ9A 1T44A 3J7YP 3UKUB 2HHTA 1EX4A 1K6YA 4MO5A 4CZLA 2YNHA 3VEOA 2YI1A 1SL1A 1VQMN 3G71N 1Q18A 4E1NA 2E6MA 4Y1CA 4AF1A 3G4SN 3R3LA 4N5SA 2FBVA 3AAQA 4CD3A 3HOTA 4JS4A 2GX9A 3LAMA 3AA4A 3B6PA 1S1XA 2Y1IA 3O9SA 3VF2A 1VSJA 2P9IB 2WBNA 4GMJB 5CY4A 4RW8A 4H8KA 3V9UA 4YFUA 3DI6A 4NO7A 4PUOA 1S1TA 4JK9A 1LWFA 1W0HA 5D3GA 3KWIA 4DHYA 1D8YA 1WAFA 2Q2RA 2GELA 1ZYQA 3VQCA 3C0BA 1EO1A 3VTIA 5ELZA 3T1YK 4V19S 1RILA 2YHXA 4HUGA 1UA1A 3IG1A 4PL7A 1LAWA 5I42A 2P9PA 3OYCA 1HJRA 2GTDA 4OVLA 3M8RA 3D0PA 1HUXA 3CC4N 3SUNA 5HROA 2AP1A 4DQPA 3D6RA 3EY1A 3PUFA 2FC0A 3PX0A 4FPAA 4JHDA 1QZ5A 1NWKA 4BRFA 1VQNN 3K5NA 1KC8O 3QB0A 3F5TA 1X9JA 3U6FA 4WFBL 4LF6K 4QS7A 1UWBA 4B8AB 4BRMA 5CZ1A 4W5QA 5JVHL 1XC9A 4B3RK 2O8CA 4JKEA 2P9PB 1BISA 1TKZA 3E01A 4C23A 3HPOA 4F8RA 3ZSWA 2DPNA 1YJ9N 3SAFA 2HF4A 4PKIA 4DR2K 4JI2K 3CCSN 3GDQA 5DK5A 2O8CB 5FROA 4B08A 5J2QA 3O4NA 4DF8A 4CGGA 1GLCG 2G8HA 4FLTA 1Q7YO 4JKBA 2PYLA 3DLKA 1TKTA 3AVIA 1KQSM 4KHSA 1I3AA 1TV6A 3TI0A 3ZT3A 2A3ZA 3LWMA 4CERA 4B9NA 3OJUA 1NJXA 1RGIA 1WSIA 4E7IA 2G8WA 3FR0A 3A2FA 2UU9K 4OLBA 5EOYA 2HHSA 3NFAA 2HNYA 4IOCL 1NK0A 4KB0A 2HBKA 2X78A 1HYSA 3NMUA 5AQPA 1NK8A 1VSEA 3SUOA 2P9NA 1SS6A 1BHLA 5AR0A 1YITN 1WAJA 3CCLN 2KZZA 3ZETA 4EFHA 4CF0A 1B92A 4LF4K 3U8XA 5AQTA 3RMAA 3R9PA 2NRWA 2BUPA 1X9SA 2E4LA 4B9TA 2D0PA 5HP1A 5LY3A 2P9NB 3CJ7A 3K9KA 3SJJA 1HMVA 2VG6A 3TTCA 2BE2A 2Z1GA 3G10A 1C0GA 4CEQA 3ZYYX 3LL3A 1KVCA 3ZETB 3MN6A 2GEMA 2F4VK 2OZMA 1T6CA 4WFNL 4IEIA 4FJKA 5H1SQ 3KKSA 1RT4A 4DSFA 4DV6K 2J4RA 4PKGA 3NF8A 4AHRA 5T7BA 4DSJA 4F4KA 3OYJA 3LDNA 3AGRA 3FZLA 2O4GA 3DYAA 3CFRA 3GE1A 5CYMA 5AFUH 3LWLA 2VGMA 1JLFA 3SCXA 3LZIA 4TSXA 3GG4A 2A1RA 3H3NO 4I6MA 1T8EA 1JLAA 2B6AA 4BRLA 1GLLO 1JCEA 3NH1A 5J2PA 3DRPA 2ASOA 1TL1A 5HRNA 4DTJA 2A41A 5LMUK 2KFNA 3CJCA 4M3ZA 2Q1NA 5CHIA 1ASUA 2A5XA 1SAZA 4A62A 3V1OA 5CYQA 4ISEA 1YT3A 4KAZA 3SMSA 4L8RB 3CCQN 3HVTA 4KH4A 3QICA 4CJSA 4GNIA 4O8UA 4CF1A 4HTLA 1XI1A 5F1XA 4RW7A 1K73O 4JI5K 1T03A 1JKHA 2QWQA 3CERA 3RRGA 1IBLK 4DCHA 3QERA 4FLZA 4FWMA 1DTTA 3OA9A 4DR3K 1HRHA 4EHTA 2IVOA 1IKXA 3VESA 4QAGA 1U45A 1BU6O 4JNEA 1RBVA 4CEEA 3TAFA 4DTUA 5AQYA 2BANA 2IOCA 5AFUA 1QSYA 3G25A 1IJJA 1S72N 5FLXO 1JLBA 3KIOA 4CEFA 2O4IA 1O13A 5M1QA 4FWPA 1L3TA 3EL2A 4DG1A 4HWIA 3KKRA 4BRPA 4CW7B 3TTDA 2ASPA 1NKEA 1ATNA 1WSGA 4PKHA 4E0DA 1TAUA 1EP4A 2D5RA 3BY5A 1GLBG 2E5LK 4PWDA 2CH5A 4E1MA 4B1VA 3K5LA 5KGWA 3MAQA 3HK2A 1NJWA 1HNIA 2KKZA 3VEVA 1ZBUA 4E7HA 3AGKA 4QS8A 4B1XB 3CC2N 2FBXA 1SQKA 5GAHP 3ZT2A 2YNFA 3AVNA 3ZEUA 4JKHA 3CQYA 2HF3A 4O5FA 3FZKA 1GOCA 3OYDA 3TSQA 4YNQA 4IZ9A 5AQHA 3RMDA 3HOSA 4W5NA 4ISFA 4HCBA 4JI0K 4IOAL 5C24A 3MN5A 4FW1A 4O4GA 2ASMA 4AHTA 4JKGB 4KRFA 3ZT1A 1TK0A 3ZEUB 2I5JA 2VWJA 3CG7A 4ID1A 3WEEA 1BI4A 4RW4A 4CGJA 1YAGA 1YVUA 4H0PA 3B8AX 4RW6A 1XQSC 4BRGA 3H3OB 3NH2A 4CJQA 2D4WA 4E89A 3OBYA 3TABA 2HHUA 3LDOA 1NGFA 1BQNA 4CBUA 3MXIA 1C0TA 3N4QA 3WEEB 3THWA 3LAKA 3VQ6A 1U4BA 2BH1A 4ISGA 1HNXK 3BF3A 3SPYA 2G8KA 4IFVA 3BZCA 3CC7N 3FE1A 5AQNA 2KZMA 3RWUA 1Y97A 4BE2A 5C42A 1BCOA 1EWRA 3L3VA 4CHZA 3WNHA 4O8KA 3RTVA 3PLAA 3R1XA 3DM2A 1LWCA 3EE9A 2Q3SA 3WXKA 4FJMA 4FJXA 1J5OA 2P9SA 2W6KA 4FLYA 1G99A 4WQ4C 4I2PA 1ESVA 2PFUA 3LPTA 1T3VA 4Z4CA 4C8KA 3J7AP 3RR8A 3M5RA 4JN4A 1T6DA 2JWLA 3Q7BA 1RT3A 3NHGA 4FJIA 4DTNA 3DLHA 2P9SB 3NGYA 1QHAA 2KQ2A 3AVBA 4DLEA 2OPSA 3B6OA 2JLEA 3L2RA 1XHXA 1TL3A 5AZJA 4IG0A 4HCCA 2E2PA 3Q7CA 4YHHK 4E1JA 4NB4A 4KTZA 2JGUA 3ZT4A 1RT6A 1NBWA 3QEVA 2XY6A 5AZJB 4I9QA 3HYFA 1TK5A 3CCJN 2QWOA 1D5AA 3DRRA 2GV9A 3WQTA 5M1NA 4DV1K 1FKPA 1FJGK 4FM0A 3QDKA 4DV3K 1YXQA 4GY2B 4FZXC 2HBJA 3HP9A 5CZ2A 2E1YA 1M90O 1JCFA 1Z25A 3LDPA 5AQZA 3S41A 5KGXA 1Z26A 3D2FA 4BRKA 1HQEA 3AO4A 3SV3A 1B9DA 1H1VA 1K8AO 3T1HK 3G0ZA 3OBWA 1JJ2M 3PSFA 1QSLA 3KLIA 1U2VA 1DKGD 3C6AA 5EU7A 5TKWA 4JS5A 3TAPA 2YJEA 1JLGA 2DFEA 4FWOA 1GLAG 3MWPA 1ZBLA 2HMIA 1IKVA 3D2FB 3D7EO 2HSTA 1IBMK 4CEAA 1ATSA 1L3VA 2DTUA 4CJUA 2YHBA 1U2VB 1K8KA 4JRPA 4DFJA 2HBMA 2YV0X 1TVRA 1T7PA 3L4QA 4WF9L 5JLFA 1VQ8N 2CGKA 3UE5A 5LMNK 4H4MA 3CPEA 4A5BA 3SI6A 4Q5VA 1VSDA 4WFAL 1S6QA 1K8KB 4Z4IA 4ZHRA 4AM6A 1YHQN 4J2BA 4WE1A 4QCLA 4KHWA 4AHVA 2ATQA 5E26A 4M45A 4BDZA 2O8DA 3IUCA 2V52B 3K5OA 1NKCA 5AQSA 4IEEA 1QHTA 3PY8A 4NYNA 1NGBA 2NRVA 4FOIA 4RW9A 4O44A 4ILHA 3TANA 3WXJA 1HYVA 4BR9A 4IKFA 4FXDA 3ZX3A 4FW2A 3F9MA 3RVCA 3ZCMA 1GLJO 3AVLA 1QE1A 2YNIA 4EZ6A 2HHXA 2VG7A 3SJHA 5SZTA 1EWQA 2V7ZA 4CBXA 1TGOA 4FL9A 3RRHA 1NGCA 5BRFA 4LF8K 3E9LA 1HKBA 4BC5A 1NKBA 4EIAA 3O3HA 3SQ4A 3P31A 3ID8A 3TTFA 1YUWA 3GBTA 1HR0K 4F2SA 4JKFA 4KFBA 2ZJRL 4CZKA 3EE8A 1RTDA 4CJVA 1LWEA 3HBTA 3HL8A 4CD1A 3HT3A 1XHZA 4H0VB 1ASWA 1SZ2A 3AVMA 3IFRA 4GKKK 1NMNA 3I8DA 2OANA 5HRRA 1JXEA 4W5RA 3SBGA 1FK9A 1VRUA 4GW6A 5KPRA 3WNEA 3O3GA 1N36K 2WONA 3VQ4A 1S1VA 1EKEA 3NH0A 3OYKA 1MWKA 1O1WA 4M63C 4IFEA 1KXPA 3DLGA 4B9VA 1RBTA 3VN5A 4L3QA 1KAZA 1FW6A 5I3UA 1NOYA 1L3SA 2QKBA 5FPNA 3NF7A 1VK0A 3ULEA 4FJJA 3SLCA 2OA8A 3DJCA 1N32K 4PY5A 1RDWX 4B3SK 3QBXA 1ATRA 3LDLA 4FJ8A 1KSPA 4JKCA 3KK1A 1WSJA 3U9ZA 5K14A 3NCIA 4B1UB 2FF6A 4C8NA 3ULEB 4GVMA 3DLEA 4BR0A 2XY8A 3VF6A 3S3MA 2W41A 4Y0WA 3HI0A 3CCMN 2RN2A 1J54A 3FFKB 3VETA 1TYQA 1P8ZA 3C7NA 1P90A 3MN7A 3R6MA 1NJZA 4LH4A 3IS9A 3I33A 5HOOA 4FVUA 1CLQA 2R7YA 2HVIA 4F2RA 3MX5A 4BRHA 1E4FT 4JI7K 1VQON 3KK7A 1MA9B 4LY7A 2IDOA 4M7XA 3VGLA 3IMXA 4ELTA 5AQXA 3CPWM 4J2EA 4CVNE 3DRSA 4FM1A 3KJVA 3EYZA 3SNNA 1GOAA 1ZXOA 2FSJA 2IAJA 2VCPA 4C1NI 1GLEG 5GIPA 2PYJA 4EHUA 1JL1A 4MDBA 4NXMK 4JHDB 3WXLA 3V4IA 1SKSA 1RT1A 2XHBA 1C6VA 3CMAN 4FVMA 1ITGA 3V81A 4DQRA 3DMJA 1Q82O 4A57A 1VHXA 1FKOA 4JK7A 3T1AA 1V4SA 1RTIA 3PO5A 3SYZA 3BGRA 3BDPA 4H03B 4CGFA 1YJNN 3CM6A 3FGUA 4IBNA 2FSKA 3M8QA 4BR4A 3MMVA 4ILJA 1UAXA 3TSPA 3MECA 4EAHD 4DFMA 3QFPA 1NGAA 2GWJA 4IJAA 1W2BM 5J1EA 1S9EA 2DFFA 1VSKA 1BDGA 2BDPA 1DT9A 3O1BA 3ULDA 1RDAA 4KI4A 4O0JA 1SKRA 1VQ5N 4KREA 4DV5K 3I56N 1WUAA 4M42A 4FO0A 4K43A 2OYQA 1QS4A 3L6QA 4N41A 3IAYA 1BG3A 4DQQA 4DU4A 3KLEA 3OYAA 3AO3A 3A8YA 3CF5L 1TK8A 2FSNA 3CQXA 3QETA 4FOEA 1X1PA 1IO2A 4FPBA 4HUFA 4BRDA 5AQRA 5DM7L 4CECA 4G9ZA 1F21A 1BUPA 3AVFA 3ENOA 3P83D 5JICA 5C15A 3A0IX 5BN9A 3DLLL 1Q86O 1D9FA 3QBWA 2ZQBA 3CFOA 1J9AA 4YDUA 5EVZA 4FJGA 1M1KO 4YOYA 4CJRA 3VEXA 3VQPA 2D0BA 4K8ZA 3CCEN 1ZBFA 1WSFA 4DTOA 1GLDG 4DU1A 5HRSA 1BO5O 1S1UA 2HVHA 4KV8A 1CZBA 4RG8A 4O0IA 5GAEP 4WQ5C 5HL7L 4AM7A 3AY9A 2XO7A 2QEXN 4N76A 3W0LA 3K57A 3SBTA 2RE2A 1HYZA 4NCGA 4KO0A 2EWSA 2YNGA 2UUAK 3VQ5A 1ZBIA 4I6MB 2EX3A 5AQLA 2ZM6K 4CF2A 4CJWA 4DS4A 3ZT0A 1DEJA 1JLEA 2B5JA 1VQ4N 4A59A 2Q97A 1CZAN 3CYMA 3H08A 4JI8K 1LOTB 3FZFA 4LF7K 3MCPA 2YKNA 5GINA 3V1RA 3VQDA 4DSEA 2UXBK 2QWPA 1S3XA 3ATUA 3F9KA 2I7NA 2QWMA 4UY8O 3CCUN 5AQQA 5AQJA 1CZ9A 4CJ5A 5BPNA 4E7LA 4B3OA 1HNWK 1YVNA 3MN9A 4I7FA 4CF8A 4BWJA 3ZSQA 4DTPA 2F9WA 2P1JA 3KLHA 4F3OA 4KHUA 3VTHA 3J81O 3QINA 4FJLA 1JCGA 3V9SA 3MXMA 1GOBA 2HNZA 1X9WA 3KHYA 4CGDA 3C94A 3D45A 5JS2A 4EP5A 4FLVA 2QWLA 4YOVA 4Z4FA 4CJFA 3LP3A 1D9DA 1BA1A 3HSTB 3O6WA 2XY5A 2EHGA 3VERA 4DSKA 4KPYA 3AV9A 4OO1J 2V7YA 5BREA 4B3TK 3I55N 3ZSZA 5C12A 3DAWA 1OH7A 4KHNA 3QEPA 2LSNA 3VQ8A 4CFAA 4Z4EA 2Z1JA 3J80O 2HOEA 1RDBA 4I9LA 4BDYA 1N34K 3NVKA 3WT0A 3ZLJA 5BRHA 1X3MA 5DM6L 1N5YA 3L2QA 2D0CA 3AO5A 2ZJPL 2Q0RA 2ZGYA 1QQMA 1NGGA 1NJYA 3MDQA 4BY9C 3O9QA 4RTFD 4R79A 4B9LA 1BQMA 2IVNA 2NRTA 2QXLA 3FFIA 2E2NA 1QSSA 4KH5A 2FLOA 3K58A 2NRXA 3TARA 3LM9A 1REVA 4XH5A 1NNEA 4I2QA 2HHQA 2FBYA 1SL0A 5FRMA 2OCEA 3ASMA 1CXQA 1HNVA 3PX4A 2F9TA 4U7BA 3LALA 1BI4B 4EZ9A 2HMPA 3L2WA 3M3ZA 3WXMB 2RKIA 4W5TA 1LAVA 3OYGA 2D1KA 2G8FA 5BN8A 2ITGA 3M8SA 4CGIA 3NVMA 4H0OA 2W42A 4Z4GA 4HTUA 4OPJA 2CGJA 3KWGA 3P5JA 3PIOL 2F8TA 3L3UA 3SAGA 1WN7A 1S5JA 3TWHA 4FLXA 3THWB 4B9MA 4DF4A 4FM2A 3DOLA 3WNGA 3D2EA 2ETJA 3TR8A 3S3OA 1BOTO 1DGKN 2OTJN 1VQLN 1HKCA 5HRPA 4BQZA 3OJSA 4GKJK 4DR5K 2Y1JA 1U48A 2P5GA 1E3MA 3FZMA 1VQ7N 3D2EB 3TAQA 1OVQA 4DSIA 4BG8A 3RSEA 2OZSA 2QWNA 3LDQA 1SL2A 2W6LA 3PO4A 1L5UA 4ILGB 3E1YA 3TU5A 3WNFA 4CESA 1KFDA 2KFZA 1W7AA 4CZJA 4JRQA 1WBBA 3QIOA 5EX5A 4E19A 4CIGA 3VEWA 4BE1A 3H1QA 1IG9A 3HZ6A 4M3TA 1QVGM 2YJFA 4FSVA 5CR4A 1A5WA 2JWKA 3MWTA 3RSEB 5AQKA 3IRXA 3VGKA 3HP6A 3TAEA 1X3NA 5FPDA 5BPMA 3QEWA 1YJWN 3K9JA 1OH5A 5HBMA 2QM1A 5DMRA 1RT2A 4QOZB 1VQ9N 1EQYA 1YTAA 4AILC 4FJ7A 4M3XA 1IV0A 3CM5A 4M3WA 3L0QA 1FXXA 5FPMA 5LL6Z 4JI4K 3NF9A 5AQIA 2UUBK 3NGIA 4FCYA 1MDUB 1JL2A 1B9FA 3PX6A 2E2OA 2VWBA 4LF5K 3T69A 3TSUA 4KHYA 4KHQA 2OPRA 4CK1A 3K2PA 4PQUA 1XUPO 1DTQA 1EXQA 4BC4A 3O3FA 3SQ2A 4DR4K 4BROA 5A2QO 3HJFA 3SQ0A 1NU0A 2F7TA 3TAGA 3A5OC 3KLFA 3T19A 5KQDA 5GADP 2E6LA 4EP4A 2NRHA 2A40A 4BE0A 1UOCA 4CK3A 4DV7K 2OTLN 5TKYA 5J2MA 2D0AA 2RF2A 2YHYA 4LF9K 4CEZA 3KVGA 3SZ2A 2QKKA 4BC3A 2KLAA 2G8UA 2PAVA 3NDKA 4DR7K 3MCAB 4AHUA 5J2NA 2UXCK 4E7KA 4H0YB 4OPKA 2VQEK 2P51A 1LCUA 1BWFO 1TKXA 4FWRA 4K41A 4Z0UA 3ZSXA 3KD5E 4KHPK 4G1QA 4BRIA 3F73A 3BUZB 3EKSA 4B8CA 5C10A 3EO3A 1VAZA 1X9MA 5LJWA 3LP1A 4IO8A 2KW4A 4CF9A 3C6UA 4NYFA 4FWSA 4YORA 4RWTA 4BVOA 1RT5A 2O8DB 3S3NA 4C8OA 3CXCM 4JD2A 4CJTA 1HX1A 3LPUA 3LANA 4LD0A 4IWVA 3KLGA 1BA0A 2WTUA 4DTSA 3M1FA 4PA1A 3ITHA 3O9TA 1U04A 3V9XA 3KD1E 1NGJA 3QIPA 4PL8A 2QK9A 4LSNA 3K5MA 3JXUA 4NLCA 1NM1A 2X74A 3AVKA 1VQ6N 3CQ8A 3OYNA 5KRTA 1VSFA 2D0OA 3LP0A 3U9DA 3HVRA 4BRCA 4BR7A 4FZYA 1Q9XA 4FZZA 1VRTA 3T7ZA 3OYHA 4LFCK 3DWLA 1RTHA 1WOQA 4FJNA 2ZE2A 3CETA 4GV6A 1S9GA 4NCBA 3QEXA 4K25A 4WQ4A 4DKWA 4ID5A 2Z1HA 5AQWA 4XH1A 1KRPA 4FLUA 1OH6A 3CHWA 5C2FA 4DV2K 1HJOA 1CXUA 4B9UA 4U67L 3H45C 3VQ9A 4DUZK 4YDUC 3UKUA 3OVNA 5KPTA 1XNRK 1ZC6A 3WQUA 1NGDA 5F0XA 1SKWA 1V4TA 5AQFA 3VQ7A 4OJRA 4CJKA 4ELUA 4BGAA 1VSLA 5M1KA 3PIPL 3HSCA 5KRSA 1D4XA 2VWKA 3RMBA 3QNNA 2IIRA 3W3DA 2WC9A 5BR9A 1QZ6A 3QESA 1IG8A 4DMNA 4B9QA 2P9IA 5F2RA 3VQAA 5ADXH 2QWRA 3J7ZO 5AQOA 4CZGA 1ASVA 1I94K 1C1AA 1IH7A 4B1ZA 4AH9A 1NLVA 1LV5A 3AVGA 3M8PA 4ZTJA 1N33K 3OTOK 3ZX0A 3R8EA 2P9LA 3VMFB 2DFHA 1N6QA 4Z4HA 4BQLA 3MEGA 3L4IA 4CBWA 1BCMA 3AA5X 4BVPA 3VGMA 1ILYA 1KD1O 4H5WA 3NGZA 3OYMA 4J2DA 4CE9A 1N8RO 1RDUA 3THYA 1TUUA 5KTQA 2W40A 3OW2M 1HLUA 1TYQB 2ZGZA 3C7NB 4CEOA 1RT7A 4O5BA 4LSLA 2VG5A 4CK2A 3CFPA 2P9LB 4FK0A 4CFDA 1XMOK 4LH5A 1KLMA 3ZSVA 1A5XA 1YTUA 1UA0A 1NK4A 3T3FA 4CCHA 1L3UA 1NOZA 3WXIA 3VA3A 2VYPA 3AVAA 3C95A 3H6EA 2P5OA 4J8FA 3THYB 5GAGP 3VEZA 4JLHA 4BREA 4CZHA 1KAXA 2P9UA 4M3YA 2GUPA 1G15A 3AVJA 4HVJA 3AA3A 4HUEA 2DY4A 1WB9A 5ADXA 3CJAA 4YOWA 5M1FA 2NNWA 3OYFA 2H3GX 2CGLA 4C1NK 5BR8K 3SQ1A 1WSEA 2YX6A 3SV4A 1S6PA 3RMCA 2E8AA 2P9UB 3LP2A 3HTVA 2UUCK 3ID6A 1T05A 1NG9A
chains in the Genus database with same CATH topology
4M3RA 4CJLA 1RT6A 5E41A 4FLWA 4Z4FA 4J2AA 4CJFA 3LP3A 4DTMA 4CEDA 1D9DA 1KVAA 3QEVA 1TAQA 3ALYA 3HSTB 2XY6A 2XY5A 2EHGA 4DSKA 1SUQA 4KPYA 1R0AA 4I9QA 3HYFA 1RBRA 1TK5A 2G8VA 2AJQA 3AO2A 3AV9A 5JS1A 4CJPA 1D5AA 3DRRA 2GV9A 3NE6A 3NBPA 3HM9A 3ZSZA 4KHNA 1FKPA 3QEPA 3AVHA 2LSNA 3VQ8A 4FM0A 1Q9YA 4CFAA 4Z4EA 2Z1JA 2WOMA 2HHVA 2YHAA 1RDBA 4I9LA 3HPGA 4BDYA 3QO9A 4FZXC 1KFSA 3HP9A 5CZ2A 3L2VA 1N5YA 3L2QA 1A5VA 3RR7A 2D0CA 1Z25A 5KGXA 3U3YA 3AO5A 4NCAA 1Z26A 3V9WA 4ICLA 1S1WA 2QK9A 2X6NA 1WNSA 3OS2A 1XWLA 1HQEA 3AO4A 3SV3A 1NJYA 2HHTA 1B9DA 1EX4A 1K6YA 3G0ZA 2YNHA 3SUQA 4B9LA 1BQMA 1SL1A 1JLCA 1QSLA 3HO1A 3KLIA 4CIEA 3KTQA 3FFIA 5EU7A 4JS5A 1QSSA 3TAPA 4E1NA 4DWIA 3K58A 1JLGA 2DFEA 3TARA 2E6MA 1REVA 1ZBLA 4Y1CA 2HMIA 1EETA 4I2QA 1IKVA 3UIQA 2HHQA 2FBYA 1VSMA 3S9HA 4CEAA 4CEBA 1SL0A 3ASMA 1CXQA 5FRMA 1HNVA 1L3VA 2HNDA 4CJUA 2X6SA 3K59A 2DTUA 2YHBA 4N5SA 3PX4A 2FBVA 3LALA 3OS1A 4JRPA 4JS4A 4DFJA 3OYLA 3LAMA 3AA4A 1BI4B 1TVRA 2YV0X 3B6PA 3L2WA 1T7PA 1S1XA 2RKIA 2Y1IA 4EZ9A 4W5TA 4CJ3A 1VSJA 5CY4A 4GMJB 1LAVA 3OYGA 2G8FA 2ITGA 3M8SA 4CGIA 4RW8A 4H8KA 3V9UA 4H4MA 4ELVA 4YFUA 2W42A 3DI6A 3SI6A 4Q5VA 1RBSA 5FRNA 4Z4GA 4HTUA 1VSDA 4OPJA 1S6QA 1S1TA 4PUOA 5D3GA 1LWFA 1W0HA 3P5JA 4Z4IA 2F8TA 3L3UA 4ZHRA 1WN7A 1D8YA 1S5JA 3TWHA 4FLXA 1WAFA 4J2BA 4B9MA 4DF4A 4FM2A 1ZYQA 4WE1A 4QCLA 3DOLA 3VQCA 1RTJA 3WNGA 4KHWA 4AHVA 2ATQA 3OYEA 4M45A 4BDZA 4E7JA 1RILA 2ETJA 4HUGA 3K5OA 1UA1A 1NKCA 3IG1A 3TR8A 3S3OA 1QHTA 2HHWA 1LAWA 5I42A 3PY8A 2HW3A 1C0MA 1HJRA 4OVLA 3OYCA 3M8RA 3D0PA 5HRPA 3OJSA 4NYNA 3SUNA 5HROA 1RDCA 3V9ZA 4DQPA 4RW9A 3EY1A 1JXBA 3PUFA 4O44A 2FC0A 2Y1JA 3PX0A 4CGHA 3TANA 1U48A 2P5GA 1HYVA 4FXDA 4IKFA 3K5NA 4FW2A 3P1GA 3ZCMA 3TAQA 4DSIA 3AVLA 3U6FA 1QE1A 1UWBA 4B8AB 4W5QA 4OGEA 2YNIA 5CZ1A 1MU2A 2QXFA 1XC9A 2VG7A 2OZSA 1SL2A 4EZ6A 2HHXA 5SZTA 1BISA 1TKZA 1QTMA 3PO4A 1L5UA 4BDPA 3E01A 3HPOA 1U49A 4F8RA 2RPIA 3ZSWA 1TGOA 3WNFA 4CESA 2XY7A 1KFDA 2KFZA 3RRHA 3CFPA 4JRQA 3QIOA 4E19A 4CIGA 4BE1A 1NKBA 1IG9A 1JLQA 3O3HA 4M3TA 2JGUA 3SQ4A 1A5WA 4R5PA 5DK5A 4K8XA 1BIUA 2GBZA 3IRXA 5FROA 4B08A 5J2QA 4FK4A 3O4NA 4DF8A 4OLAA 1IKWA 4CGGA 4HHTA 3HP6A 2G8HA 4FLTA 3TAEA 3I0SA 2PYLA 4F2SA 4FK2A 1C1CA 3QEWA 4DQSA 5HBMA 3DLKA 1TKTA 3AVIA 4KFBA 5DMRA 1RT2A 1I3AA 1TV6A 1VSHA 3TI0A 4FJHA 4KHSA 4QOZB 3ZT3A 1YTAA 3MXJA 4AILC 4FJ7A 4M3XA 1RTDA 4CJVA 3CM5A 4M3WA 1LWEA 3LWMA 3HL8A 3HT3A 1XHZA 1FXXA 2Z1IA 4CERA 4B9NA 1ASWA 3OJUA 1NJXA 1NK6A 1WSIA 3AVMA 4E7IA 2G8WA 3NF9A 3A2FA 4OLBA 2HHSA 3NGIA 3NFAA 4FCYA 2HNYA 3I8DA 1JL2A 5HRRA 1NK0A 1JXEA 1B9FA 4W5RA 3PX6A 3JYTA 4KB0A 2B4JA 2X78A 1FK9A 1VRUA 1HYSA 4GW6A 3WNEA 4CJ4A 1NK8A 1VSEA 3SUOA 3O3GA 4KHYA 1BHLA 4KHQA 2OPRA 1VSIA 3K2PA 4CK1A 4PQUA 2WONA 3VQ4A 1S1VA 3ISNC 1EKEA 1DTQA 3NH0A 3OYKA 1WAJA 1O1WA 2KZZA 1EXQA 4CF0A 1B92A 3O3FA 3SQ2A 4DSLA 3RMAA 1X9SA 3HXMA 4CJEA 2E4LA 3DLGA 4B9TA 4B9VA 1RBTA 5FDLA 5HP1A 4AHCA 3SJJA 3HJFA 3VN5A 1HMVA 4DFPA 3SQ0A 2VG6A 4Y1DA 5KI6A 2BE2A 2Z1GA 3G10A 5I3UA 4CEQA 1NOYA 1L3SA 3TAGA 2F8SA 2QKBA 1KVCA 3KLFA 3NF7A 3KK3A 3T19A 2E6LA 2OZMA 1VK0A 4EP4A 4OGCA 3MEEA 4FJJA 3HPHA 4BE0A 2OA8A 4FJKA 1UOCA 3KKSA 1RT4A 4CK3A 4PY5A 3NAEA 4DSFA 5J2MA 2D0AA 2RF2A 3SUPA 4CEZA 3NF8A 4AHRA 5T7BA 4DSJA 3SZ2A 3OYJA 4F4KA 4FJ8A 2O4GA 1KSPA 3L2UA 3DYAA 3CFRA 3KK1A 2QKKA 1WSJA 5CYMA 5K14A 2G8UA 3LWLA 3NCIA 3KK2A 4C8NA 1JLFA 3SCXA 3NDKA 4GVMA 3DLEA 4AHUA 4MQ3A 5J2NA 4DS5A 1KLNA 1KTQA 3LZIA 2XY8A 4TSXA 4E7KA 3S3MA 2A1RA 1T8EA 4OPKA 4CIFA 2P51A 3ZSYA 4W5OA 2RN2A 1JLAA 2B6AA 1TKXA 3ZSXA 4Z0UA 1J54A 3KD5E 1NJZA 3NH1A 4LH4A 1RDDA 2NUBA 5J2PA 3IS9A 4G1QA 3DRPA 1CLQA 4DLGA 1TL1A 5HRNA 4DTJA 2IS3A 3F73A 2R7YA 4B8CA 2HVIA 4F2RA 2KFNA 4M3ZA 3LZJA 4FYDA 1X9MA 3NF6A 3I0RA 1ASUA 3LP1A 2KW4A 4LY7A 2IDOA 4CF9A 1RCHA 3C6UA 4NYFA 4ELTA 3V1OA 3VQQA 1RT5A 5CYQA 3S3NA 4J2EA 3DRSA 1YT3A 4KAZA 3QEIA 2G8IA 4FM1A 4C8OA 2IC3A 3KJVA 3EYZA 3SNNA 4L8RB 4CJTA 3LPUA 3LANA 3HVTA 1WLJA 4LD0A 3KLGA 1GOAA 2IAJA 4CF1A 4CJSA 4DTSA 3OYBA 1XI1A 4PA1A 4RW7A 2PYJA 1JL1A 1JKHA 4CFBA 1T03A 3RRGA 3V4IA 3ITHA 1SKSA 1RT1A 2XHBA 4FLZA 3QERA 3DLBA 1DTTA 3OY9A 1HRHA 1IKXA 1C6VA 1U04A 1C1BA 3V9XA 4FVMA 4B9SA 3KD1E 3DLRA 1ITGA 3QIPA 4QAGA 4DQRA 3V81A 1U45A 3DMJA 2PZSA 1RBVA 4LSNA 4BWMA 3K5MA 4KI6A 4CEEA 3TAFA 4DS4A 4ZTFA 4DTUA 4AHSA 1C0UA 1FKOA 1RNHA 2BANA 3VQEA 2IOCA 3T1AA 2X74A 1QSYA 1RTIA 1WSHA 3PO5A 3AVKA 3SYZA 3BGRA 3BDPA 3EZ5A 4CGFA 3OYNA 3CQ8A 5KRTA 1JLBA 3CM6A 3KIOA 1VSFA 3LP0A 3HVRA 4IBNA 4CEFA 3M8QA 2O4IA 1L3TA 4FZYA 2IGIA 1UAXA 4DG1A 1J53A 1LW0A 3MECA 4CHYA 1VRTA 3MEDA 1Q9XA 4FZZA 4DFMA 3OYHA 1NK5A 3U3GA 2BGGA 1RTHA 3KKRA 4FJNA 2ZE2A 4MFBA 2KTQA 1S9GA 2GUIA 4NCBA 3QEXA 4IDKA 4CHNA 2A1SA 4ID5A 4KB1A 1LW2A 1QQCA 1BIZA 4BACA 1NKEA 5J1EA 1S9EA 2DFFA 1WSGA 3AO1A 4E0DA 2Z1HA 1TAUA 1VSKA 4UQGA 1KRPA 4M3UA 1EP4A 4FLUA 2BDPA 2D5RA 1BGXT 1KVBA 3ULDA 4E3SA 4FJ5A 4PWDA 4E1MA 1RDAA 3K5LA 4KI4A 4O0JA 1CXUA 5KGWA 1RBUA 3MAQA 4DFKA 1SKRA 4B9UA 3HK2A 3VQ9A 4KREA 4FJ9A 1NJWA 1HNIA 4KKOA 1BL3A 4CHPA 4M42A 1ZBUA 4E7HA 3RTVA 3PV8A 3OVNA 4Q0BA 2OYQA 2FBXA 1QS4A 3ZT2A 4H4OA 2F96A 2YNFA 1SKWA 3IAYA 4N41A 4M41A 3AVNA 4DQQA 4DU4A 3SPZA 2OPPA 3KLEA 3OYAA 3AO3A 4OKJA 1TK8A 3VQ7A 1GOCA 4OJRA 3ZT0A 3OYDA 3QNOA 4YNQA 4CJKA 3AA2A 3QETA 4DTRA 4ELUA 1VSLA 2XRIA 3RMDA 4W5NA 1X1PA 4HCBA 1IO2A 1HQUA 5C24A 3ZSOA 4HUFA 1NK9A 5KRSA 3C6TA 4FW1A 2VWKA 4O4GA 3RMBA 3QNNA 1TKDA 4CECA 4AHTA 4KRFA 1F21A 3AVFA 5SWMA 3ZT1A 3VA0A 1TK0A 2I5JA 3P83D 2VWJA 3QESA 5C25A 3CG7A 2FBTA 4ID1A 1BI4A 4RW4A 4CGJA 4DMNA 1ZBHA 1YVUA 4RW6A 4CFCA 1D9FA 3NH2A 2HB5A 2ZQBA 3CFOA 1J9AA 3VQAA 4CJQA 4FJGA 3DOKA 4E89A 4F3TA 1W9HA 4CJRA 3VQPA 2D0BA 1ASVA 4O55A 4K8ZA 3TABA 2HHUA 1C1AA 1ZBFA 1IH7A 1WSFA 4DTOA 4DU1A 4AH9A 1BQNA 5HRSA 3THVA 3MXIA 4KTQA 1C0TA 1S1UA 1LV5A 2HVHA 3AVGA 3M8PA 4ZTJA 4KV8A 1CZBA 3LAKA 4RG8A 4O0IA 3VQ6A 3ZSRA 1Q8IA 1U4BA 4IG3A 4OKEA 2XO7A 2DFHA 1N6QA 3V6DA 4N76A 4Z4HA 3K57A 3MEGA 3V1QA 3SPYA 1BCMA 2G8KA 1HYZA 4IFVA 4NCGA 4DU3A 3AA5X 1NK7A 4KO0A 1T05A 2KZMA 2YNGA 3NGZA 3OYMA 3RWUA 4J2DA 1Y97A 4CE9A 4BE2A 4N47A 5C42A 3VQ5A 1ZBIA 3AVCA 4KTWA 1BCOA 2EX3A 3L3VA 5KTQA 4OKKA 4CHZA 3WNHA 2OPQA 4N56A 4CF2A 4CJWA 4CEOA 2VG5A 1RT7A 1SV5A 3O4QA 1JLEA 1LWCA 2B5JA 3DM2A 4IFYA 4LSLA 4O5BA 4CK2A 4CFDA 4FK0A 3CYMA 3H08A 1KLMA 4LH5A 3ZSVA 1A5XA 2Q3SA 3LDSA 3OS0A 1UA0A 1NK4A 1YTUA 3T3FA 4CCHA 1L3UA 1KCFA 1NOZA 4CHOA 2YKNA 4FJMA 3VA3A 3V1RA 2PY5A 4FJXA 1J5OA 3VQDA 1I39A 4DSEA 3AVAA 3C95A 2P5OA 4FLYA 4I2PA 3F9KA 1U47A 3LPTA 4JLHA 4Z4CA 4C8KA 3L8BA 4DTXA 1CZ9A 4CJ5A 4E7LA 3RR8A 4B3OA 1DLOA 1IKYA 4M3YA 1G15A 3AVJA 4HVJA 3AA3A 1RT3A 1HPZA 4HUEA 4I7FA 3NHGA 4CF8A 4BWJA 4CHQA 3ZSQA 4FJIA 4DTNA 2DY4A 4DTPA 3DLHA 3NGYA 2P1JA 5HLFA 3OYFA 3TAMA 3QLHA 3KLHA 4F3OA 4C8MA 4KHUA 2KQ2A 3SQ1A 3AVBA 4DLEA 2OPSA 3QINA 1WSEA 4FJLA 3B6OA 2ZD1A 2JLEA 3SV4A 1S6PA 3V9SA 3RMCA 4DQIA 3JSMA 3L2RA 1GOBA 1TL3A 1XHXA 3VQBA 2HNZA 4XIUA 3MXMA 1X9WA 3LP2A 4IG0A 4CGDA 4HCCA 4C8LA 3C94A 3D45A 4KTZA 3OYIA 5JS2A 2YKMA 4EP5A 3ZT4A 4FLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3R A;  4CJL A;  1RT6 A;  5E41 A;  4FLW A;  4Z4F A;  4J2A A;  4CJF A;  3LP3 A;  4DTM A;  4CED A;  1D9D A;  1KVA A;  3QEV A;  1TAQ A;  3ALY A;  3HST B;  2XY6 A;  2XY5 A;  2EHG A;  4DSK A;  1SUQ A;  4KPY A;  1R0A A;  4I9Q A;  3HYF A;  1RBR A;  1TK5 A;  2G8V A;  2AJQ A;  3AO2 A;  3AV9 A;  5JS1 A;  4CJP A;  1D5A A;  3DRR A;  2GV9 A;  3NE6 A;  3NBP A;  3HM9 A;  3ZSZ A;  4KHN A;  1FKP A;  3QEP A;  3AVH A;  2LSN A;  3VQ8 A;  4FM0 A;  1Q9Y A;  4CFA A;  4Z4E A;  2Z1J A;  2WOM A;  2HHV A;  2YHA A;  1RDB A;  4I9L A;  3HPG A;  4BDY A;  3QO9 A;  4FZX C;  1KFS A;  3HP9 A;  5CZ2 A;  3L2V A;  1N5Y A;  3L2Q A;  1A5V A;  3RR7 A;  2D0C A;  1Z25 A;  5KGX A;  3U3Y A;  3AO5 A;  4NCA A;  1Z26 A;  3V9W A;  4ICL A;  1S1W A;  2QK9 A;  2X6N A;  1WNS A;  3OS2 A;  1XWL A;  1HQE A;  3AO4 A;  3SV3 A;  1NJY A;  2HHT A;  1B9D A;  1EX4 A;  1K6Y A;  3G0Z A;  2YNH A;  3SUQ A;  4B9L A;  1BQM A;  1SL1 A;  1JLC A;  1QSL A;  3HO1 A;  3KLI A;  4CIE A;  3KTQ A;  3FFI A;  5EU7 A;  4JS5 A;  1QSS A;  3TAP A;  4E1N A;  4DWI A;  3K58 A;  1JLG A;  2DFE A;  3TAR A;  2E6M A;  1REV A;  1ZBL A;  4Y1C A;  2HMI A;  1EET A;  4I2Q A;  1IKV A;  3UIQ A;  2HHQ A;  2FBY A;  1VSM A;  3S9H A;  4CEA A;  4CEB A;  1SL0 A;  3ASM A;  1CXQ A;  5FRM A;  1HNV A;  1L3V A;  2HND A;  4CJU A;  2X6S A;  3K59 A;  2DTU A;  2YHB A;  4N5S A;  3PX4 A;  2FBV A;  3LAL A;  3OS1 A;  4JRP A;  4JS4 A;  4DFJ A;  3OYL A;  3LAM A;  3AA4 A;  1BI4 B;  1TVR A;  2YV0 X;  3B6P A;  3L2W A;  1T7P A;  1S1X A;  2RKI A;  2Y1I A;  4EZ9 A;  4W5T A;  4CJ3 A;  1VSJ A;  5CY4 A;  4GMJ B;  1LAV A;  3OYG A;  2G8F A;  2ITG A;  3M8S A;  4CGI A;  4RW8 A;  4H8K A;  3V9U A;  4H4M A;  4ELV A;  4YFU A;  2W42 A;  3DI6 A;  3SI6 A;  4Q5V A;  1RBS A;  5FRN A;  4Z4G A;  4HTU A;  1VSD A;  4OPJ A;  1S6Q A;  1S1T A;  4PUO A;  5D3G A;  1LWF A;  1W0H A;  3P5J A;  4Z4I A;  2F8T A;  3L3U A;  4ZHR A;  1WN7 A;  1D8Y A;  1S5J A;  3TWH A;  4FLX A;  1WAF A;  4J2B A;  4B9M A;  4DF4 A;  4FM2 A;  1ZYQ A;  4WE1 A;  4QCL A;  3DOL A;  3VQC A;  1RTJ A;  3WNG A;  4KHW A;  4AHV A;  2ATQ A;  3OYE A;  4M45 A;  4BDZ A;  4E7J A;  1RIL A;  2ETJ A;  4HUG A;  3K5O A;  1UA1 A;  1NKC A;  3IG1 A;  3TR8 A;  3S3O A;  1QHT A;  2HHW A;  1LAW A;  5I42 A;  3PY8 A;  2HW3 A;  1C0M A;  1HJR A;  4OVL A;  3OYC A;  3M8R A;  3D0P A;  5HRP A;  3OJS A;  4NYN A;  3SUN A;  5HRO A;  1RDC A;  3V9Z A;  4DQP A;  4RW9 A;  3EY1 A;  1JXB A;  3PUF A;  4O44 A;  2FC0 A;  2Y1J A;  3PX0 A;  4CGH A;  3TAN A;  1U48 A;  2P5G A;  1HYV A;  4FXD A;  4IKF A;  3K5N A;  4FW2 A;  3P1G A;  3ZCM A;  3TAQ A;  4DSI A;  3AVL A;  3U6F A;  1QE1 A;  1UWB A;  4B8A B;  4W5Q A;  4OGE A;  2YNI A;  5CZ1 A;  1MU2 A;  2QXF A;  1XC9 A;  2VG7 A;  2OZS A;  1SL2 A;  4EZ6 A;  2HHX A;  5SZT A;  1BIS A;  1TKZ A;  1QTM A;  3PO4 A;  1L5U A;  4BDP A;  3E01 A;  3HPO A;  1U49 A;  4F8R A;  2RPI A;  3ZSW A;  1TGO A;  3WNF A;  4CES A;  2XY7 A;  1KFD A;  2KFZ A;  3RRH A;  3CFP A;  4JRQ A;  3QIO A;  4E19 A;  4CIG A;  4BE1 A;  1NKB A;  1IG9 A;  1JLQ A;  3O3H A;  4M3T A;  2JGU A;  3SQ4 A;  1A5W A;  4R5P A;  5DK5 A;  4K8X A;  1BIU A;  2GBZ A;  3IRX A;  5FRO A;  4B08 A;  5J2Q A;  4FK4 A;  3O4N A;  4DF8 A;  4OLA A;  1IKW A;  4CGG A;  4HHT A;  3HP6 A;  2G8H A;  4FLT A;  3TAE A;  3I0S A;  2PYL A;  4F2S A;  4FK2 A;  1C1C A;  3QEW A;  4DQS A;  5HBM A;  3DLK A;  1TKT A;  3AVI A;  4KFB A;  5DMR A;  1RT2 A;  1I3A A;  1TV6 A;  1VSH A;  3TI0 A;  4FJH A;  4KHS A;  4QOZ B;  3ZT3 A;  1YTA A;  3MXJ A;  4AIL C;  4FJ7 A;  4M3X A;  1RTD A;  4CJV A;  3CM5 A;  4M3W A;  1LWE A;  3LWM A;  3HL8 A;  3HT3 A;  1XHZ A;  1FXX A;  2Z1I A;  4CER A;  4B9N A;  1ASW A;  3OJU A;  1NJX A;  1NK6 A;  1WSI A;  3AVM A;  4E7I A;  2G8W A;  3NF9 A;  3A2F A;  4OLB A;  2HHS A;  3NGI A;  3NFA A;  4FCY A;  2HNY A;  3I8D A;  1JL2 A;  5HRR A;  1NK0 A;  1JXE A;  1B9F A;  4W5R A;  3PX6 A;  3JYT A;  4KB0 A;  2B4J A;  2X78 A;  1FK9 A;  1VRU A;  1HYS A;  4GW6 A;  3WNE A;  4CJ4 A;  1NK8 A;  1VSE A;  3SUO A;  3O3G A;  4KHY A;  1BHL A;  4KHQ A;  2OPR A;  1VSI A;  3K2P A;  4CK1 A;  4PQU A;  2WON A;  3VQ4 A;  1S1V A;  3ISN C;  1EKE A;  1DTQ A;  3NH0 A;  3OYK A;  1WAJ A;  1O1W A;  2KZZ A;  1EXQ A;  4CF0 A;  1B92 A;  3O3F A;  3SQ2 A;  4DSL A;  3RMA A;  1X9S A;  3HXM A;  4CJE A;  2E4L A;  3DLG A;  4B9T A;  4B9V A;  1RBT A;  5FDL A;  5HP1 A;  4AHC A;  3SJJ A;  3HJF A;  3VN5 A;  1HMV A;  4DFP A;  3SQ0 A;  2VG6 A;  4Y1D A;  5KI6 A;  2BE2 A;  2Z1G A;  3G10 A;  5I3U A;  4CEQ A;  1NOY A;  1L3S A;  3TAG A;  2F8S A;  2QKB A;  1KVC A;  3KLF A;  3NF7 A;  3KK3 A;  3T19 A;  2E6L A;  2OZM A;  1VK0 A;  4EP4 A;  4OGC A;  3MEE A;  4FJJ A;  3HPH A;  4BE0 A;  2OA8 A;  4FJK A;  1UOC A;  3KKS A;  1RT4 A;  4CK3 A;  4PY5 A;  3NAE A;  4DSF A;  5J2M A;  2D0A A;  2RF2 A;  3SUP A;  4CEZ A;  3NF8 A;  4AHR A;  5T7B A;  4DSJ A;  3SZ2 A;  3OYJ A;  4F4K A;  4FJ8 A;  2O4G A;  1KSP A;  3L2U A;  3DYA A;  3CFR A;  3KK1 A;  2QKK A;  1WSJ A;  5CYM A;  5K14 A;  2G8U A;  3LWL A;  3NCI A;  3KK2 A;  4C8N A;  1JLF A;  3SCX A;  3NDK A;  4GVM A;  3DLE A;  4AHU A;  4MQ3 A;  5J2N A;  4DS5 A;  1KLN A;  1KTQ A;  3LZI A;  2XY8 A;  4TSX A;  4E7K A;  3S3M A;  2A1R A;  1T8E A;  4OPK A;  4CIF A;  2P51 A;  3ZSY A;  4W5O A;  2RN2 A;  1JLA A;  2B6A A;  1TKX A;  3ZSX A;  4Z0U A;  1J54 A;  3KD5 E;  1NJZ A;  3NH1 A;  4LH4 A;  1RDD A;  2NUB A;  5J2P A;  3IS9 A;  4G1Q A;  3DRP A;  1CLQ A;  4DLG A;  1TL1 A;  5HRN A;  4DTJ A;  2IS3 A;  3F73 A;  2R7Y A;  4B8C A;  2HVI A;  4F2R A;  2KFN A;  4M3Z A;  3LZJ A;  4FYD A;  1X9M A;  3NF6 A;  3I0R A;  1ASU A;  3LP1 A;  2KW4 A;  4LY7 A;  2IDO A;  4CF9 A;  1RCH A;  3C6U A;  4NYF A;  4ELT A;  3V1O A;  3VQQ A;  1RT5 A;  5CYQ A;  3S3N A;  4J2E A;  3DRS A;  1YT3 A;  4KAZ A;  3QEI A;  2G8I A;  4FM1 A;  4C8O A;  2IC3 A;  3KJV A;  3EYZ A;  3SNN A;  4L8R B;  4CJT A;  3LPU A;  3LAN A;  3HVT A;  1WLJ A;  4LD0 A;  3KLG A;  1GOA A;  2IAJ A;  4CF1 A;  4CJS A;  4DTS A;  3OYB A;  1XI1 A;  4PA1 A;  4RW7 A;  2PYJ A;  1JL1 A;  1JKH A;  4CFB A;  1T03 A;  3RRG A;  3V4I A;  3ITH A;  1SKS A;  1RT1 A;  2XHB A;  4FLZ A;  3QER A;  3DLB A;  1DTT A;  3OY9 A;  1HRH A;  1IKX A;  1C6V A;  1U04 A;  1C1B A;  3V9X A;  4FVM A;  4B9S A;  3KD1 E;  3DLR A;  1ITG A;  3QIP A;  4QAG A;  4DQR A;  3V81 A;  1U45 A;  3DMJ A;  2PZS A;  1RBV A;  4LSN A;  4BWM A;  3K5M A;  4KI6 A;  4CEE A;  3TAF A;  4DS4 A;  4ZTF A;  4DTU A;  4AHS A;  1C0U A;  1FKO A;  1RNH A;  2BAN A;  3VQE A;  2IOC A;  3T1A A;  2X74 A;  1QSY A;  1RTI A;  1WSH A;  3PO5 A;  3AVK A;  3SYZ A;  3BGR A;  3BDP A;  3EZ5 A;  4CGF A;  3OYN A;  3CQ8 A;  5KRT A;  1JLB A;  3CM6 A;  3KIO A;  1VSF A;  3LP0 A;  3HVR A;  4IBN A;  4CEF A;  3M8Q A;  2O4I A;  1L3T A;  4FZY A;  2IGI A;  1UAX A;  4DG1 A;  1J53 A;  1LW0 A;  3MEC A;  4CHY A;  1VRT A;  3MED A;  1Q9X A;  4FZZ A;  4DFM A;  3OYH A;  1NK5 A;  3U3G A;  2BGG A;  1RTH A;  3KKR A;  4FJN A;  2ZE2 A;  4MFB A;  2KTQ A;  1S9G A;  2GUI A;  4NCB A;  3QEX A;  4IDK A;  4CHN A;  2A1S A;  4ID5 A;  4KB1 A;  1LW2 A;  1QQC A;  1BIZ A;  4BAC A;  1NKE A;  5J1E A;  1S9E A;  2DFF A;  1WSG A;  3AO1 A;  4E0D A;  2Z1H A;  1TAU A;  1VSK A;  4UQG A;  1KRP A;  4M3U A;  1EP4 A;  4FLU A;  2BDP A;  2D5R A;  1BGX T;  1KVB A;  3ULD A;  4E3S A;  4FJ5 A;  4PWD A;  4E1M A;  1RDA A;  3K5L A;  4KI4 A;  4O0J A;  1CXU A;  5KGW A;  1RBU A;  3MAQ A;  4DFK A;  1SKR A;  4B9U A;  3HK2 A;  3VQ9 A;  4KRE A;  4FJ9 A;  1NJW A;  1HNI A;  4KKO A;  1BL3 A;  4CHP A;  4M42 A;  1ZBU A;  4E7H A;  3RTV A;  3PV8 A;  3OVN A;  4Q0B A;  2OYQ A;  2FBX A;  1QS4 A;  3ZT2 A;  4H4O A;  2F96 A;  2YNF A;  1SKW A;  3IAY A;  4N41 A;  4M41 A;  3AVN A;  4DQQ A;  4DU4 A;  3SPZ A;  2OPP A;  3KLE A;  3OYA A;  3AO3 A;  4OKJ A;  1TK8 A;  3VQ7 A;  1GOC A;  4OJR A;  3ZT0 A;  3OYD A;  3QNO A;  4YNQ A;  4CJK A;  3AA2 A;  3QET A;  4DTR A;  4ELU A;  1VSL A;  2XRI A;  3RMD A;  4W5N A;  1X1P A;  4HCB A;  1IO2 A;  1HQU A;  5C24 A;  3ZSO A;  4HUF A;  1NK9 A;  5KRS A;  3C6T A;  4FW1 A;  2VWK A;  4O4G A;  3RMB A;  3QNN A;  1TKD A;  4CEC A;  4AHT A;  4KRF A;  1F21 A;  3AVF A;  5SWM A;  3ZT1 A;  3VA0 A;  1TK0 A;  2I5J A;  3P83 D;  2VWJ A;  3QES A;  5C25 A;  3CG7 A;  2FBT A;  4ID1 A;  1BI4 A;  4RW4 A;  4CGJ A;  4DMN A;  1ZBH A;  1YVU A;  4RW6 A;  4CFC A;  1D9F A;  3NH2 A;  2HB5 A;  2ZQB A;  3CFO A;  1J9A A;  3VQA A;  4CJQ A;  4FJG A;  3DOK A;  4E89 A;  4F3T A;  1W9H A;  4CJR A;  3VQP A;  2D0B A;  1ASV A;  4O55 A;  4K8Z A;  3TAB A;  2HHU A;  1C1A A;  1ZBF A;  1IH7 A;  1WSF A;  4DTO A;  4DU1 A;  4AH9 A;  1BQN A;  5HRS A;  3THV A;  3MXI A;  4KTQ A;  1C0T A;  1S1U A;  1LV5 A;  2HVH A;  3AVG A;  3M8P A;  4ZTJ A;  4KV8 A;  1CZB A;  3LAK A;  4RG8 A;  4O0I A;  3VQ6 A;  3ZSR A;  1Q8I A;  1U4B A;  4IG3 A;  4OKE A;  2XO7 A;  2DFH A;  1N6Q A;  3V6D A;  4N76 A;  4Z4H A;  3K57 A;  3MEG A;  3V1Q A;  3SPY A;  1BCM A;  2G8K A;  1HYZ A;  4IFV A;  4NCG A;  4DU3 A;  3AA5 X;  1NK7 A;  4KO0 A;  1T05 A;  2KZM A;  2YNG A;  3NGZ A;  3OYM A;  3RWU A;  4J2D A;  1Y97 A;  4CE9 A;  4BE2 A;  4N47 A;  5C42 A;  3VQ5 A;  1ZBI A;  3AVC A;  4KTW A;  1BCO A;  2EX3 A;  3L3V A;  5KTQ A;  4OKK A;  4CHZ A;  3WNH A;  2OPQ A;  4N56 A;  4CF2 A;  4CJW A;  4CEO A;  2VG5 A;  1RT7 A;  1SV5 A;  3O4Q A;  1JLE A;  1LWC A;  2B5J A;  3DM2 A;  4IFY A;  4LSL A;  4O5B A;  4CK2 A;  4CFD A;  4FK0 A;  3CYM A;  3H08 A;  1KLM A;  4LH5 A;  3ZSV A;  1A5X A;  2Q3S A;  3LDS A;  3OS0 A;  1UA0 A;  1NK4 A;  1YTU A;  3T3F A;  4CCH A;  1L3U A;  1KCF A;  1NOZ A;  4CHO A;  2YKN A;  4FJM A;  3VA3 A;  3V1R A;  2PY5 A;  4FJX A;  1J5O A;  3VQD A;  1I39 A;  4DSE A;  3AVA A;  3C95 A;  2P5O A;  4FLY A;  4I2P A;  3F9K A;  1U47 A;  3LPT A;  4JLH A;  4Z4C A;  4C8K A;  3L8B A;  4DTX A;  1CZ9 A;  4CJ5 A;  4E7L A;  3RR8 A;  4B3O A;  1DLO A;  1IKY A;  4M3Y A;  1G15 A;  3AVJ A;  4HVJ A;  3AA3 A;  1RT3 A;  1HPZ A;  4HUE A;  4I7F A;  3NHG A;  4CF8 A;  4BWJ A;  4CHQ A;  3ZSQ A;  4FJI A;  4DTN A;  2DY4 A;  4DTP A;  3DLH A;  3NGY A;  2P1J A;  5HLF A;  3OYF A;  3TAM A;  3QLH A;  3KLH A;  4F3O A;  4C8M A;  4KHU A;  2KQ2 A;  3SQ1 A;  3AVB A;  4DLE A;  2OPS A;  3QIN A;  1WSE A;  4FJL A;  3B6O A;  2ZD1 A;  2JLE A;  3SV4 A;  1S6P A;  3V9S A;  3RMC A;  4DQI A;  3JSM A;  3L2R A;  1GOB A;  1TL3 A;  1XHX A;  3VQB A;  2HNZ A;  4XIU A;  3MXM A;  1X9W A;  3LP2 A;  4IG0 A;  4CGD A;  4HCC A;  4C8L A;  3C94 A;  3D45 A;  4KTZ A;  3OYI A;  5JS2 A;  2YKM A;  4EP5 A;  3ZT4 A;  4FLV A; 
#chains in the Genus database with same CATH topology
 4M3R A;  3UKR A;  3P4I A;  4CJL A;  5E41 A;  4CED A;  3CD6 N;  1KVA A;  1TAQ A;  1SUQ A;  3DXK A;  1QQN A;  2AJQ A;  1YF5 L;  4BRN A;  3FZH A;  5JS1 A;  4K0K K;  3NE6 A;  3HM9 A;  1IBK K;  3WUH A;  3AVH A;  4K42 A;  3U4L A;  3UKR B;  1Q9Y A;  3HRG A;  4NLB A;  5M1P A;  2WOM A;  2HHV A;  3SAH A;  3ENH A;  3QO9 A;  3MX2 A;  2PBD A;  3DXK B;  2KHO A;  4MO4 A;  1KAY A;  2P9K A;  3U3Y A;  2IVP A;  4A61 A;  1S1W A;  2X6N A;  2O8E A;  1WNS A;  3OS2 A;  1WBD A;  1XWL A;  4PHT X;  2I7P A;  3C65 A;  4LFB K;  4B1Y B;  2ZJQ L;  3SUQ A;  1JLC A;  3HO1 A;  3CJB A;  4CIE A;  3KTQ A;  1OKJ A;  2P9K B;  4YOT A;  4DWI A;  1J6Z A;  2NLX A;  4WCE L;  4BGB A;  4CI6 A;  1GLF O;  1EET A;  2O8E B;  3CCR N;  3O8M A;  3UIQ A;  4GV9 A;  2ZWH A;  3QFU A;  1VSM A;  3S9H A;  4CEB A;  3CIP A;  2HND A;  2X6S A;  3K59 A;  3OS1 A;  3OYL A;  5E84 A;  2ZF5 O;  4CJ3 A;  3O4W A;  2Q36 A;  4FWK A;  4X64 K;  3PSI A;  2QA4 N;  4ELV A;  1RBS A;  5FRN A;  5LJV A;  3P38 A;  1XNQ K;  2E20 A;  3KZB A;  1K9M O;  1RTJ A;  3OYE A;  4E7J A;  4IO9 L;  2HHW A;  2HW3 A;  1C0M A;  2AA4 A;  3O9U A;  4YOU A;  4KH6 A;  1RDC A;  3V9Z A;  2Q31 A;  1JXB A;  4YOX A;  4CGH A;  1VQP N;  2WUS A;  2VQF K;  3O80 A;  2YHW A;  3P1G A;  2E2Q A;  4OGE A;  1MU2 A;  2QXF A;  3ZX2 A;  3P39 A;  1QTM A;  2HBL A;  4BDP A;  5GIO A;  1HPM A;  3VPZ A;  1U49 A;  2RPI A;  2XY7 A;  4IOX A;  3JAM O;  5KQ8 A;  4CZM A;  1JLQ A;  1E4G T;  5I9E B;  4R5P A;  5FPE A;  4K8X A;  1BIU A;  2GBZ A;  3O5B A;  3G6E N;  4FK4 A;  4OLA A;  1IKW A;  4HHT A;  4DV0 K;  3I0S A;  3IDH A;  5CE3 A;  4JI3 K;  4FK2 A;  1C1C A;  4DQS A;  3O1W A;  3GOI A;  1VSH A;  4FJH A;  4BR2 A;  3MXJ A;  2A42 A;  3CCV N;  4GV3 A;  4IXC A;  2Z1I A;  2YCH A;  1NK6 A;  5AQV A;  5IT9 O;  1HNZ K;  1OVY A;  5B8H A;  4JK8 A;  5M1O A;  3JYT A;  2B4J A;  1RFQ A;  1YIJ N;  1NGI A;  4CJ4 A;  4CZI A;  4RCH A;  1VSI A;  4DUY K;  3ISN C;  2A6A A;  2WFB A;  1Y64 A;  5AQG A;  3FLC O;  3VF4 A;  3THX A;  4DSL A;  1NGH A;  4JKG A;  3VOV A;  4CJE A;  3HXM A;  3CI5 A;  5FDL A;  4AHC A;  2HHH K;  4DFP A;  5AQM A;  4Y1D A;  5KI6 A;  2F8S A;  1MWM A;  3O9R A;  4WYB A;  3KK3 A;  1C0F A;  5JLH A;  4OGC A;  3MEE A;  3THX B;  3HPH A;  4JKD A;  3NAE A;  3SUP A;  3JS6 A;  3SMP A;  4OPH A;  4X65 K;  3L2U A;  2Q0U A;  3VEN A;  3KK2 A;  4JI1 K;  2FF3 B;  3O08 A;  1KLN A;  4MQ3 A;  4DS5 A;  5C2D A;  1KTQ A;  2RHK A;  4Z94 A;  2GWK A;  1OH8 A;  4CIF A;  2BTF A;  3ZSY A;  4W5O A;  3AAR A;  2UYT A;  1QQO A;  3ENB A;  1RDD A;  2NUB A;  2ITM A;  1ZBS A;  4DLG A;  2IS3 A;  1TUY A;  5BRD A;  3LZJ A;  4FYD A;  3NF6 A;  3I0R A;  4X66 K;  3EN9 A;  1RCH A;  2VGN A;  4CJ7 A;  4XH4 A;  4DR1 K;  3BP8 A;  3VQQ A;  1W97 L;  2G8I A;  3QEI A;  1HKG A;  2IC3 A;  4JEP A;  3BEX A;  3UB5 A;  1WLJ A;  5KPZ A;  4XEI A;  3OYB A;  3SK3 A;  4BR5 A;  4CFB A;  3EZW A;  3DLB A;  4H0T B;  3OY9 A;  4WQ5 A;  4B9S A;  1C1B A;  3DLR A;  2PZS A;  4BWM A;  4KI6 A;  4ZTF A;  4B3M K;  4AHS A;  1C0U A;  1RNH A;  3CJ1 A;  3VQE A;  4H5V A;  3GL1 A;  1WSH A;  3EZ5 A;  3K0S A;  3J8A A;  2E1Z A;  2IGI A;  4H5R A;  4CHY A;  1J53 A;  1LW0 A;  3MED A;  4MLE A;  4MLH A;  1NK5 A;  3U3G A;  2BGG A;  3E66 A;  4JV5 K;  4MFB A;  2FXU A;  3C6H A;  4FWL A;  2E88 A;  1Q81 O;  5JVG L;  2KTQ A;  2GUI A;  3BF1 A;  4IDK A;  4CHN A;  2A1S A;  4KB1 A;  1LW2 A;  3E9P A;  1QQC A;  1BIZ A;  4BAC A;  2QI2 A;  3AO1 A;  4UQG A;  4M3U A;  1BGX T;  1KVB A;  3IKM A;  4E3S A;  4FJ5 A;  4X62 K;  4A2B A;  4DFK A;  1RBU A;  4FJ9 A;  4KKO A;  1BL3 A;  4CHP A;  3PV8 A;  5BPL A;  1QVF M;  4Q0B A;  4H4O A;  2F96 A;  3A5M C;  4M41 A;  3SPZ A;  2OPP A;  4JKA A;  5AJ3 K;  3CME N;  4OKJ A;  5AQU A;  4GVE A;  3QNO A;  4IDH A;  3AA2 A;  4DTR A;  4DV4 K;  2XRI A;  1HQU A;  3ZSO A;  1NK9 A;  3H46 O;  3C6T A;  1TKD A;  4DR6 K;  5SWM A;  3VA0 A;  5C25 A;  2FBT A;  1R59 O;  1ZBH A;  1S22 A;  4CFC A;  2HB5 A;  3EEQ A;  2V51 B;  1Z05 A;  4LC9 B;  3DOK A;  4F3T A;  4MDA A;  1W9H A;  3VEY A;  4O55 A;  1J5E K;  3EKU A;  3AAP A;  3THV A;  4KTQ A;  3MK6 A;  1U6Z A;  3ZSR A;  1Q8I A;  4IG3 A;  4OKE A;  3A5N C;  4H0X B;  4CZF A;  3V6D A;  3V1Q A;  4DU3 A;  4JYA K;  1NK7 A;  2NRR A;  1YI2 N;  5C0Y A;  4N47 A;  3AVC A;  4KTW A;  5EXW A;  4OKK A;  3ATV A;  4H5T A;  2OPQ A;  4N56 A;  1SV5 A;  3O4Q A;  4IFY A;  4FWQ A;  3LDS A;  3OS0 A;  2CH6 A;  2QTD A;  1KCF A;  4CHO A;  4DB3 A;  1Z6R A;  1NJI O;  2O8B A;  2PY5 A;  3QML A;  5IWA K;  1I39 A;  2QW9 A;  4OX9 K;  1U47 A;  4CZE A;  4FWN A;  3OHR A;  4BC2 A;  5JMV A;  4JD2 B;  3L8B A;  4DTX A;  4JAX A;  1DLO A;  1IKY A;  3DXM A;  1HPZ A;  4H5N A;  4CHQ A;  2O8B B;  4NXN K;  5EY4 A;  4JI6 K;  5HLF A;  4BRA A;  3TAM A;  3QLH A;  5MLC Q;  4C8M A;  3TPQ A;  1NGE A;  2ZD1 A;  4BG9 A;  4DQI A;  3JSM A;  4XIU A;  3VQB A;  3M6G A;  3DXM B;  4AQY K;  4C8L A;  3E9O A;  1VQK N;  4A2A A;  3OYI A;  2YKM A;  3N4P A;  3A5L C;  3I8B A;  4FLW A;  4J2A A;  4A5A A;  2NRZ A;  4DTM A;  1XMQ K;  3LM2 A;  3ALY A;  3H1V X;  2NZT A;  4LFA K;  1R0A A;  1XC3 A;  1RBR A;  2G8V A;  2O8F A;  3AO2 A;  3BZK A;  4M7Y A;  4CJP A;  4BRQ A;  3NBP A;  4DQ8 A;  4KBO A;  3HM8 A;  5AZI A;  4IJN A;  2YHA A;  1NMD A;  4B1W B;  4F9O A;  3HPG A;  1KFS A;  4QS9 A;  3L2V A;  2O8F B;  3RR7 A;  1A5V A;  2UXD K;  4YY3 K;  4NCA A;  3V9W A;  4ICL A;  3F2K A;  4OPA A;  5AZI B;  3CJ9 A;  1T44 A;  3J7Y P;  3UKU B;  2HHT A;  1EX4 A;  1K6Y A;  4MO5 A;  4CZL A;  2YNH A;  3VEO A;  2YI1 A;  1SL1 A;  1VQM N;  3G71 N;  1Q18 A;  4E1N A;  2E6M A;  4Y1C A;  4AF1 A;  3G4S N;  3R3L A;  4N5S A;  2FBV A;  3AAQ A;  4CD3 A;  3HOT A;  4JS4 A;  2GX9 A;  3LAM A;  3AA4 A;  3B6P A;  1S1X A;  2Y1I A;  3O9S A;  3VF2 A;  1VSJ A;  2P9I B;  2WBN A;  4GMJ B;  5CY4 A;  4RW8 A;  4H8K A;  3V9U A;  4YFU A;  3DI6 A;  4NO7 A;  4PUO A;  1S1T A;  4JK9 A;  1LWF A;  1W0H A;  5D3G A;  3KWI A;  4DHY A;  1D8Y A;  1WAF A;  2Q2R A;  2GEL A;  1ZYQ A;  3VQC A;  3C0B A;  1EO1 A;  3VTI A;  5ELZ A;  3T1Y K;  4V19 S;  1RIL A;  2YHX A;  4HUG A;  1UA1 A;  3IG1 A;  4PL7 A;  1LAW A;  5I42 A;  2P9P A;  3OYC A;  1HJR A;  2GTD A;  4OVL A;  3M8R A;  3D0P A;  1HUX A;  3CC4 N;  3SUN A;  5HRO A;  2AP1 A;  4DQP A;  3D6R A;  3EY1 A;  3PUF A;  2FC0 A;  3PX0 A;  4FPA A;  4JHD A;  1QZ5 A;  1NWK A;  4BRF A;  1VQN N;  3K5N A;  1KC8 O;  3QB0 A;  3F5T A;  1X9J A;  3U6F A;  4WFB L;  4LF6 K;  4QS7 A;  1UWB A;  4B8A B;  4BRM A;  5CZ1 A;  4W5Q A;  5JVH L;  1XC9 A;  4B3R K;  2O8C A;  4JKE A;  2P9P B;  1BIS A;  1TKZ A;  3E01 A;  4C23 A;  3HPO A;  4F8R A;  3ZSW A;  2DPN A;  1YJ9 N;  3SAF A;  2HF4 A;  4PKI A;  4DR2 K;  4JI2 K;  3CCS N;  3GDQ A;  5DK5 A;  2O8C B;  5FRO A;  4B08 A;  5J2Q A;  3O4N A;  4DF8 A;  4CGG A;  1GLC G;  2G8H A;  4FLT A;  1Q7Y O;  4JKB A;  2PYL A;  3DLK A;  1TKT A;  3AVI A;  1KQS M;  4KHS A;  1I3A A;  1TV6 A;  3TI0 A;  3ZT3 A;  2A3Z A;  3LWM A;  4CER A;  4B9N A;  3OJU A;  1NJX A;  1RGI A;  1WSI A;  4E7I A;  2G8W A;  3FR0 A;  3A2F A;  2UU9 K;  4OLB A;  5EOY A;  2HHS A;  3NFA A;  2HNY A;  4IOC L;  1NK0 A;  4KB0 A;  2HBK A;  2X78 A;  1HYS A;  3NMU A;  5AQP A;  1NK8 A;  1VSE A;  3SUO A;  2P9N A;  1SS6 A;  1BHL A;  5AR0 A;  1YIT N;  1WAJ A;  3CCL N;  2KZZ A;  3ZET A;  4EFH A;  4CF0 A;  1B92 A;  4LF4 K;  3U8X A;  5AQT A;  3RMA A;  3R9P A;  2NRW A;  2BUP A;  1X9S A;  2E4L A;  4B9T A;  2D0P A;  5HP1 A;  5LY3 A;  2P9N B;  3CJ7 A;  3K9K A;  3SJJ A;  1HMV A;  2VG6 A;  3TTC A;  2BE2 A;  2Z1G A;  3G10 A;  1C0G A;  4CEQ A;  3ZYY X;  3LL3 A;  1KVC A;  3ZET B;  3MN6 A;  2GEM A;  2F4V K;  2OZM A;  1T6C A;  4WFN L;  4IEI A;  4FJK A;  5H1S Q;  3KKS A;  1RT4 A;  4DSF A;  4DV6 K;  2J4R A;  4PKG A;  3NF8 A;  4AHR A;  5T7B A;  4DSJ A;  4F4K A;  3OYJ A;  3LDN A;  3AGR A;  3FZL A;  2O4G A;  3DYA A;  3CFR A;  3GE1 A;  5CYM A;  5AFU H;  3LWL A;  2VGM A;  1JLF A;  3SCX A;  3LZI A;  4TSX A;  3GG4 A;  2A1R A;  3H3N O;  4I6M A;  1T8E A;  1JLA A;  2B6A A;  4BRL A;  1GLL O;  1JCE A;  3NH1 A;  5J2P A;  3DRP A;  2ASO A;  1TL1 A;  5HRN A;  4DTJ A;  2A41 A;  5LMU K;  2KFN A;  3CJC A;  4M3Z A;  2Q1N A;  5CHI A;  1ASU A;  2A5X A;  1SAZ A;  4A62 A;  3V1O A;  5CYQ A;  4ISE A;  1YT3 A;  4KAZ A;  3SMS A;  4L8R B;  3CCQ N;  3HVT A;  4KH4 A;  3QIC A;  4CJS A;  4GNI A;  4O8U A;  4CF1 A;  4HTL A;  1XI1 A;  5F1X A;  4RW7 A;  1K73 O;  4JI5 K;  1T03 A;  1JKH A;  2QWQ A;  3CER A;  3RRG A;  1IBL K;  4DCH A;  3QER A;  4FLZ A;  4FWM A;  1DTT A;  3OA9 A;  4DR3 K;  1HRH A;  4EHT A;  2IVO A;  1IKX A;  3VES A;  4QAG A;  1U45 A;  1BU6 O;  4JNE A;  1RBV A;  4CEE A;  3TAF A;  4DTU A;  5AQY A;  2BAN A;  2IOC A;  5AFU A;  1QSY A;  3G25 A;  1IJJ A;  1S72 N;  5FLX O;  1JLB A;  3KIO A;  4CEF A;  2O4I A;  1O13 A;  5M1Q A;  4FWP A;  1L3T A;  3EL2 A;  4DG1 A;  4HWI A;  3KKR A;  4BRP A;  4CW7 B;  3TTD A;  2ASP A;  1NKE A;  1ATN A;  1WSG A;  4PKH A;  4E0D A;  1TAU A;  1EP4 A;  2D5R A;  3BY5 A;  1GLB G;  2E5L K;  4PWD A;  2CH5 A;  4E1M A;  4B1V A;  3K5L A;  5KGW A;  3MAQ A;  3HK2 A;  1NJW A;  1HNI A;  2KKZ A;  3VEV A;  1ZBU A;  4E7H A;  3AGK A;  4QS8 A;  4B1X B;  3CC2 N;  2FBX A;  1SQK A;  5GAH P;  3ZT2 A;  2YNF A;  3AVN A;  3ZEU A;  4JKH A;  3CQY A;  2HF3 A;  4O5F A;  3FZK A;  1GOC A;  3OYD A;  3TSQ A;  4YNQ A;  4IZ9 A;  5AQH A;  3RMD A;  3HOS A;  4W5N A;  4ISF A;  4HCB A;  4JI0 K;  4IOA L;  5C24 A;  3MN5 A;  4FW1 A;  4O4G A;  2ASM A;  4AHT A;  4JKG B;  4KRF A;  3ZT1 A;  1TK0 A;  3ZEU B;  2I5J A;  2VWJ A;  3CG7 A;  4ID1 A;  3WEE A;  1BI4 A;  4RW4 A;  4CGJ A;  1YAG A;  1YVU A;  4H0P A;  3B8A X;  4RW6 A;  1XQS C;  4BRG A;  3H3O B;  3NH2 A;  4CJQ A;  2D4W A;  4E89 A;  3OBY A;  3TAB A;  2HHU A;  3LDO A;  1NGF A;  1BQN A;  4CBU A;  3MXI A;  1C0T A;  3N4Q A;  3WEE B;  3THW A;  3LAK A;  3VQ6 A;  1U4B A;  2BH1 A;  4ISG A;  1HNX K;  3BF3 A;  3SPY A;  2G8K A;  4IFV A;  3BZC A;  3CC7 N;  3FE1 A;  5AQN A;  2KZM A;  3RWU A;  1Y97 A;  4BE2 A;  5C42 A;  1BCO A;  1EWR A;  3L3V A;  4CHZ A;  3WNH A;  4O8K A;  3RTV A;  3PLA A;  3R1X A;  3DM2 A;  1LWC A;  3EE9 A;  2Q3S A;  3WXK A;  4FJM A;  4FJX A;  1J5O A;  2P9S A;  2W6K A;  4FLY A;  1G99 A;  4WQ4 C;  4I2P A;  1ESV A;  2PFU A;  3LPT A;  1T3V A;  4Z4C A;  4C8K A;  3J7A P;  3RR8 A;  3M5R A;  4JN4 A;  1T6D A;  2JWL A;  3Q7B A;  1RT3 A;  3NHG A;  4FJI A;  4DTN A;  3DLH A;  2P9S B;  3NGY A;  1QHA A;  2KQ2 A;  3AVB A;  4DLE A;  2OPS A;  3B6O A;  2JLE A;  3L2R A;  1XHX A;  1TL3 A;  5AZJ A;  4IG0 A;  4HCC A;  2E2P A;  3Q7C A;  4YHH K;  4E1J A;  4NB4 A;  4KTZ A;  2JGU A;  3ZT4 A;  1RT6 A;  1NBW A;  3QEV A;  2XY6 A;  5AZJ B;  4I9Q A;  3HYF A;  1TK5 A;  3CCJ N;  2QWO A;  1D5A A;  3DRR A;  2GV9 A;  3WQT A;  5M1N A;  4DV1 K;  1FKP A;  1FJG K;  4FM0 A;  3QDK A;  4DV3 K;  1YXQ A;  4GY2 B;  4FZX C;  2HBJ A;  3HP9 A;  5CZ2 A;  2E1Y A;  1M90 O;  1JCF A;  1Z25 A;  3LDP A;  5AQZ A;  3S41 A;  5KGX A;  1Z26 A;  3D2F A;  4BRK A;  1HQE A;  3AO4 A;  3SV3 A;  1B9D A;  1H1V A;  1K8A O;  3T1H K;  3G0Z A;  3OBW A;  1JJ2 M;  3PSF A;  1QSL A;  3KLI A;  1U2V A;  1DKG D;  3C6A A;  5EU7 A;  5TKW A;  4JS5 A;  3TAP A;  2YJE A;  1JLG A;  2DFE A;  4FWO A;  1GLA G;  3MWP A;  1ZBL A;  2HMI A;  1IKV A;  3D2F B;  3D7E O;  2HST A;  1IBM K;  4CEA A;  1ATS A;  1L3V A;  2DTU A;  4CJU A;  2YHB A;  1U2V B;  1K8K A;  4JRP A;  4DFJ A;  2HBM A;  2YV0 X;  1TVR A;  1T7P A;  3L4Q A;  4WF9 L;  5JLF A;  1VQ8 N;  2CGK A;  3UE5 A;  5LMN K;  4H4M A;  3CPE A;  4A5B A;  3SI6 A;  4Q5V A;  1VSD A;  4WFA L;  1S6Q A;  1K8K B;  4Z4I A;  4ZHR A;  4AM6 A;  1YHQ N;  4J2B A;  4WE1 A;  4QCL A;  4KHW A;  4AHV A;  2ATQ A;  5E26 A;  4M45 A;  4BDZ A;  2O8D A;  3IUC A;  2V52 B;  3K5O A;  1NKC A;  5AQS A;  4IEE A;  1QHT A;  3PY8 A;  4NYN A;  1NGB A;  2NRV A;  4FOI A;  4RW9 A;  4O44 A;  4ILH A;  3TAN A;  3WXJ A;  1HYV A;  4BR9 A;  4IKF A;  4FXD A;  3ZX3 A;  4FW2 A;  3F9M A;  3RVC A;  3ZCM A;  1GLJ O;  3AVL A;  1QE1 A;  2YNI A;  4EZ6 A;  2HHX A;  2VG7 A;  3SJH A;  5SZT A;  1EWQ A;  2V7Z A;  4CBX A;  1TGO A;  4FL9 A;  3RRH A;  1NGC A;  5BRF A;  4LF8 K;  3E9L A;  1HKB A;  4BC5 A;  1NKB A;  4EIA A;  3O3H A;  3SQ4 A;  3P31 A;  3ID8 A;  3TTF A;  1YUW A;  3GBT A;  1HR0 K;  4F2S A;  4JKF A;  4KFB A;  2ZJR L;  4CZK A;  3EE8 A;  1RTD A;  4CJV A;  1LWE A;  3HBT A;  3HL8 A;  4CD1 A;  3HT3 A;  1XHZ A;  4H0V B;  1ASW A;  1SZ2 A;  3AVM A;  3IFR A;  4GKK K;  1NMN A;  3I8D A;  2OAN A;  5HRR A;  1JXE A;  4W5R A;  3SBG A;  1FK9 A;  1VRU A;  4GW6 A;  5KPR A;  3WNE A;  3O3G A;  1N36 K;  2WON A;  3VQ4 A;  1S1V A;  1EKE A;  3NH0 A;  3OYK A;  1MWK A;  1O1W A;  4M63 C;  4IFE A;  1KXP A;  3DLG A;  4B9V A;  1RBT A;  3VN5 A;  4L3Q A;  1KAZ A;  1FW6 A;  5I3U A;  1NOY A;  1L3S A;  2QKB A;  5FPN A;  3NF7 A;  1VK0 A;  3ULE A;  4FJJ A;  3SLC A;  2OA8 A;  3DJC A;  1N32 K;  4PY5 A;  1RDW X;  4B3S K;  3QBX A;  1ATR A;  3LDL A;  4FJ8 A;  1KSP A;  4JKC A;  3KK1 A;  1WSJ A;  3U9Z A;  5K14 A;  3NCI A;  4B1U B;  2FF6 A;  4C8N A;  3ULE B;  4GVM A;  3DLE A;  4BR0 A;  2XY8 A;  3VF6 A;  3S3M A;  2W41 A;  4Y0W A;  3HI0 A;  3CCM N;  2RN2 A;  1J54 A;  3FFK B;  3VET A;  1TYQ A;  1P8Z A;  3C7N A;  1P90 A;  3MN7 A;  3R6M A;  1NJZ A;  4LH4 A;  3IS9 A;  3I33 A;  5HOO A;  4FVU A;  1CLQ A;  2R7Y A;  2HVI A;  4F2R A;  3MX5 A;  4BRH A;  1E4F T;  4JI7 K;  1VQO N;  3KK7 A;  1MA9 B;  4LY7 A;  2IDO A;  4M7X A;  3VGL A;  3IMX A;  4ELT A;  5AQX A;  3CPW M;  4J2E A;  4CVN E;  3DRS A;  4FM1 A;  3KJV A;  3EYZ A;  3SNN A;  1GOA A;  1ZXO A;  2FSJ A;  2IAJ A;  2VCP A;  4C1N I;  1GLE G;  5GIP A;  2PYJ A;  4EHU A;  1JL1 A;  4MDB A;  4NXM K;  4JHD B;  3WXL A;  3V4I A;  1SKS A;  1RT1 A;  2XHB A;  1C6V A;  3CMA N;  4FVM A;  1ITG A;  3V81 A;  4DQR A;  3DMJ A;  1Q82 O;  4A57 A;  1VHX A;  1FKO A;  4JK7 A;  3T1A A;  1V4S A;  1RTI A;  3PO5 A;  3SYZ A;  3BGR A;  3BDP A;  4H03 B;  4CGF A;  1YJN N;  3CM6 A;  3FGU A;  4IBN A;  2FSK A;  3M8Q A;  4BR4 A;  3MMV A;  4ILJ A;  1UAX A;  3TSP A;  3MEC A;  4EAH D;  4DFM A;  3QFP A;  1NGA A;  2GWJ A;  4IJA A;  1W2B M;  5J1E A;  1S9E A;  2DFF A;  1VSK A;  1BDG A;  2BDP A;  1DT9 A;  3O1B A;  3ULD A;  1RDA A;  4KI4 A;  4O0J A;  1SKR A;  1VQ5 N;  4KRE A;  4DV5 K;  3I56 N;  1WUA A;  4M42 A;  4FO0 A;  4K43 A;  2OYQ A;  1QS4 A;  3L6Q A;  4N41 A;  3IAY A;  1BG3 A;  4DQQ A;  4DU4 A;  3KLE A;  3OYA A;  3AO3 A;  3A8Y A;  3CF5 L;  1TK8 A;  2FSN A;  3CQX A;  3QET A;  4FOE A;  1X1P A;  1IO2 A;  4FPB A;  4HUF A;  4BRD A;  5AQR A;  5DM7 L;  4CEC A;  4G9Z A;  1F21 A;  1BUP A;  3AVF A;  3ENO A;  3P83 D;  5JIC A;  5C15 A;  3A0I X;  5BN9 A;  3DLL L;  1Q86 O;  1D9F A;  3QBW A;  2ZQB A;  3CFO A;  1J9A A;  4YDU A;  5EVZ A;  4FJG A;  1M1K O;  4YOY A;  4CJR A;  3VEX A;  3VQP A;  2D0B A;  4K8Z A;  3CCE N;  1ZBF A;  1WSF A;  4DTO A;  1GLD G;  4DU1 A;  5HRS A;  1BO5 O;  1S1U A;  2HVH A;  4KV8 A;  1CZB A;  4RG8 A;  4O0I A;  5GAE P;  4WQ5 C;  5HL7 L;  4AM7 A;  3AY9 A;  2XO7 A;  2QEX N;  4N76 A;  3W0L A;  3K57 A;  3SBT A;  2RE2 A;  1HYZ A;  4NCG A;  4KO0 A;  2EWS A;  2YNG A;  2UUA K;  3VQ5 A;  1ZBI A;  4I6M B;  2EX3 A;  5AQL A;  2ZM6 K;  4CF2 A;  4CJW A;  4DS4 A;  3ZT0 A;  1DEJ A;  1JLE A;  2B5J A;  1VQ4 N;  4A59 A;  2Q97 A;  1CZA N;  3CYM A;  3H08 A;  4JI8 K;  1LOT B;  3FZF A;  4LF7 K;  3MCP A;  2YKN A;  5GIN A;  3V1R A;  3VQD A;  4DSE A;  2UXB K;  2QWP A;  1S3X A;  3ATU A;  3F9K A;  2I7N A;  2QWM A;  4UY8 O;  3CCU N;  5AQQ A;  5AQJ A;  1CZ9 A;  4CJ5 A;  5BPN A;  4E7L A;  4B3O A;  1HNW K;  1YVN A;  3MN9 A;  4I7F A;  4CF8 A;  4BWJ A;  3ZSQ A;  4DTP A;  2F9W A;  2P1J A;  3KLH A;  4F3O A;  4KHU A;  3VTH A;  3J81 O;  3QIN A;  4FJL A;  1JCG A;  3V9S A;  3MXM A;  1GOB A;  2HNZ A;  1X9W A;  3KHY A;  4CGD A;  3C94 A;  3D45 A;  5JS2 A;  4EP5 A;  4FLV A;  2QWL A;  4YOV A;  4Z4F A;  4CJF A;  3LP3 A;  1D9D A;  1BA1 A;  3HST B;  3O6W A;  2XY5 A;  2EHG A;  3VER A;  4DSK A;  4KPY A;  3AV9 A;  4OO1 J;  2V7Y A;  5BRE A;  4B3T K;  3I55 N;  3ZSZ A;  5C12 A;  3DAW A;  1OH7 A;  4KHN A;  3QEP A;  2LSN A;  3VQ8 A;  4CFA A;  4Z4E A;  2Z1J A;  3J80 O;  2HOE A;  1RDB A;  4I9L A;  4BDY A;  1N34 K;  3NVK A;  3WT0 A;  3ZLJ A;  5BRH A;  1X3M A;  5DM6 L;  1N5Y A;  3L2Q A;  2D0C A;  3AO5 A;  2ZJP L;  2Q0R A;  2ZGY A;  1QQM A;  1NGG A;  1NJY A;  3MDQ A;  4BY9 C;  3O9Q A;  4RTF D;  4R79 A;  4B9L A;  1BQM A;  2IVN A;  2NRT A;  2QXL A;  3FFI A;  2E2N A;  1QSS A;  4KH5 A;  2FLO A;  3K58 A;  2NRX A;  3TAR A;  3LM9 A;  1REV A;  4XH5 A;  1NNE A;  4I2Q A;  2HHQ A;  2FBY A;  1SL0 A;  5FRM A;  2OCE A;  3ASM A;  1CXQ A;  1HNV A;  3PX4 A;  2F9T A;  4U7B A;  3LAL A;  1BI4 B;  4EZ9 A;  2HMP A;  3L2W A;  3M3Z A;  3WXM B;  2RKI A;  4W5T A;  1LAV A;  3OYG A;  2D1K A;  2G8F A;  5BN8 A;  2ITG A;  3M8S A;  4CGI A;  3NVM A;  4H0O A;  2W42 A;  4Z4G A;  4HTU A;  4OPJ A;  2CGJ A;  3KWG A;  3P5J A;  3PIO L;  2F8T A;  3L3U A;  3SAG A;  1WN7 A;  1S5J A;  3TWH A;  4FLX A;  3THW B;  4B9M A;  4DF4 A;  4FM2 A;  3DOL A;  3WNG A;  3D2E A;  2ETJ A;  3TR8 A;  3S3O A;  1BOT O;  1DGK N;  2OTJ N;  1VQL N;  1HKC A;  5HRP A;  4BQZ A;  3OJS A;  4GKJ K;  4DR5 K;  2Y1J A;  1U48 A;  2P5G A;  1E3M A;  3FZM A;  1VQ7 N;  3D2E B;  3TAQ A;  1OVQ A;  4DSI A;  4BG8 A;  3RSE A;  2OZS A;  2QWN A;  3LDQ A;  1SL2 A;  2W6L A;  3PO4 A;  1L5U A;  4ILG B;  3E1Y A;  3TU5 A;  3WNF A;  4CES A;  1KFD A;  2KFZ A;  1W7A A;  4CZJ A;  4JRQ A;  1WBB A;  3QIO A;  5EX5 A;  4E19 A;  4CIG A;  3VEW A;  4BE1 A;  3H1Q A;  1IG9 A;  3HZ6 A;  4M3T A;  1QVG M;  2YJF A;  4FSV A;  5CR4 A;  1A5W A;  2JWK A;  3MWT A;  3RSE B;  5AQK A;  3IRX A;  3VGK A;  3HP6 A;  3TAE A;  1X3N A;  5FPD A;  5BPM A;  3QEW A;  1YJW N;  3K9J A;  1OH5 A;  5HBM A;  2QM1 A;  5DMR A;  1RT2 A;  4QOZ B;  1VQ9 N;  1EQY A;  1YTA A;  4AIL C;  4FJ7 A;  4M3X A;  1IV0 A;  3CM5 A;  4M3W A;  3L0Q A;  1FXX A;  5FPM A;  5LL6 Z;  4JI4 K;  3NF9 A;  5AQI A;  2UUB K;  3NGI A;  4FCY A;  1MDU B;  1JL2 A;  1B9F A;  3PX6 A;  2E2O A;  2VWB A;  4LF5 K;  3T69 A;  3TSU A;  4KHY A;  4KHQ A;  2OPR A;  4CK1 A;  3K2P A;  4PQU A;  1XUP O;  1DTQ A;  1EXQ A;  4BC4 A;  3O3F A;  3SQ2 A;  4DR4 K;  4BRO A;  5A2Q O;  3HJF A;  3SQ0 A;  1NU0 A;  2F7T A;  3TAG A;  3A5O C;  3KLF A;  3T19 A;  5KQD A;  5GAD P;  2E6L A;  4EP4 A;  2NRH A;  2A40 A;  4BE0 A;  1UOC A;  4CK3 A;  4DV7 K;  2OTL N;  5TKY A;  5J2M A;  2D0A A;  2RF2 A;  2YHY A;  4LF9 K;  4CEZ A;  3KVG A;  3SZ2 A;  2QKK A;  4BC3 A;  2KLA A;  2G8U A;  2PAV A;  3NDK A;  4DR7 K;  3MCA B;  4AHU A;  5J2N A;  2UXC K;  4E7K A;  4H0Y B;  4OPK A;  2VQE K;  2P51 A;  1LCU A;  1BWF O;  1TKX A;  4FWR A;  4K41 A;  4Z0U A;  3ZSX A;  3KD5 E;  4KHP K;  4G1Q A;  4BRI A;  3F73 A;  3BUZ B;  3EKS A;  4B8C A;  5C10 A;  3EO3 A;  1VAZ A;  1X9M A;  5LJW A;  3LP1 A;  4IO8 A;  2KW4 A;  4CF9 A;  3C6U A;  4NYF A;  4FWS A;  4YOR A;  4RWT A;  4BVO A;  1RT5 A;  2O8D B;  3S3N A;  4C8O A;  3CXC M;  4JD2 A;  4CJT A;  1HX1 A;  3LPU A;  3LAN A;  4LD0 A;  4IWV A;  3KLG A;  1BA0 A;  2WTU A;  4DTS A;  3M1F A;  4PA1 A;  3ITH A;  3O9T A;  1U04 A;  3V9X A;  3KD1 E;  1NGJ A;  3QIP A;  4PL8 A;  2QK9 A;  4LSN A;  3K5M A;  3JXU A;  4NLC A;  1NM1 A;  2X74 A;  3AVK A;  1VQ6 N;  3CQ8 A;  3OYN A;  5KRT A;  1VSF A;  2D0O A;  3LP0 A;  3U9D A;  3HVR A;  4BRC A;  4BR7 A;  4FZY A;  1Q9X A;  4FZZ A;  1VRT A;  3T7Z A;  3OYH A;  4LFC K;  3DWL A;  1RTH A;  1WOQ A;  4FJN A;  2ZE2 A;  3CET A;  4GV6 A;  1S9G A;  4NCB A;  3QEX A;  4K25 A;  4WQ4 A;  4DKW A;  4ID5 A;  2Z1H A;  5AQW A;  4XH1 A;  1KRP A;  4FLU A;  1OH6 A;  3CHW A;  5C2F A;  4DV2 K;  1HJO A;  1CXU A;  4B9U A;  4U67 L;  3H45 C;  3VQ9 A;  4DUZ K;  4YDU C;  3UKU A;  3OVN A;  5KPT A;  1XNR K;  1ZC6 A;  3WQU A;  1NGD A;  5F0X A;  1SKW A;  1V4T A;  5AQF A;  3VQ7 A;  4OJR A;  4CJK A;  4ELU A;  4BGA A;  1VSL A;  5M1K A;  3PIP L;  3HSC A;  5KRS A;  1D4X A;  2VWK A;  3RMB A;  3QNN A;  2IIR A;  3W3D A;  2WC9 A;  5BR9 A;  1QZ6 A;  3QES A;  1IG8 A;  4DMN A;  4B9Q A;  2P9I A;  5F2R A;  3VQA A;  5ADX H;  2QWR A;  3J7Z O;  5AQO A;  4CZG A;  1ASV A;  1I94 K;  1C1A A;  1IH7 A;  4B1Z A;  4AH9 A;  1NLV A;  1LV5 A;  3AVG A;  3M8P A;  4ZTJ A;  1N33 K;  3OTO K;  3ZX0 A;  3R8E A;  2P9L A;  3VMF B;  2DFH A;  1N6Q A;  4Z4H A;  4BQL A;  3MEG A;  3L4I A;  4CBW A;  1BCM A;  3AA5 X;  4BVP A;  3VGM A;  1ILY A;  1KD1 O;  4H5W A;  3NGZ A;  3OYM A;  4J2D A;  4CE9 A;  1N8R O;  1RDU A;  3THY A;  1TUU A;  5KTQ A;  2W40 A;  3OW2 M;  1HLU A;  1TYQ B;  2ZGZ A;  3C7N B;  4CEO A;  1RT7 A;  4O5B A;  4LSL A;  2VG5 A;  4CK2 A;  3CFP A;  2P9L B;  4FK0 A;  4CFD A;  1XMO K;  4LH5 A;  1KLM A;  3ZSV A;  1A5X A;  1YTU A;  1UA0 A;  1NK4 A;  3T3F A;  4CCH A;  1L3U A;  1NOZ A;  3WXI A;  3VA3 A;  2VYP A;  3AVA A;  3C95 A;  3H6E A;  2P5O A;  4J8F A;  3THY B;  5GAG P;  3VEZ A;  4JLH A;  4BRE A;  4CZH A;  1KAX A;  2P9U A;  4M3Y A;  2GUP A;  1G15 A;  3AVJ A;  4HVJ A;  3AA3 A;  4HUE A;  2DY4 A;  1WB9 A;  5ADX A;  3CJA A;  4YOW A;  5M1F A;  2NNW A;  3OYF A;  2H3G X;  2CGL A;  4C1N K;  5BR8 K;  3SQ1 A;  1WSE A;  2YX6 A;  3SV4 A;  1S6P A;  3RMC A;  2E8A A;  2P9U B;  3LP2 A;  3HTV A;  2UUC K;  3ID6 A;  1T05 A;  1NG9 A; 
#chains in the Genus database with same CATH homology
 4M3R A;  4CJL A;  1RT6 A;  5E41 A;  4FLW A;  4Z4F A;  4J2A A;  4CJF A;  3LP3 A;  4DTM A;  4CED A;  1D9D A;  1KVA A;  3QEV A;  1TAQ A;  3ALY A;  3HST B;  2XY6 A;  2XY5 A;  2EHG A;  4DSK A;  1SUQ A;  4KPY A;  1R0A A;  4I9Q A;  3HYF A;  1RBR A;  1TK5 A;  2G8V A;  2AJQ A;  3AO2 A;  3AV9 A;  5JS1 A;  4CJP A;  1D5A A;  3DRR A;  2GV9 A;  3NE6 A;  3NBP A;  3HM9 A;  3ZSZ A;  4KHN A;  1FKP A;  3QEP A;  3AVH A;  2LSN A;  3VQ8 A;  4FM0 A;  1Q9Y A;  4CFA A;  4Z4E A;  2Z1J A;  2WOM A;  2HHV A;  2YHA A;  1RDB A;  4I9L A;  3HPG A;  4BDY A;  3QO9 A;  4FZX C;  1KFS A;  3HP9 A;  5CZ2 A;  3L2V A;  1N5Y A;  3L2Q A;  1A5V A;  3RR7 A;  2D0C A;  1Z25 A;  5KGX A;  3U3Y A;  3AO5 A;  4NCA A;  1Z26 A;  3V9W A;  4ICL A;  1S1W A;  2QK9 A;  2X6N A;  1WNS A;  3OS2 A;  1XWL A;  1HQE A;  3AO4 A;  3SV3 A;  1NJY A;  2HHT A;  1B9D A;  1EX4 A;  1K6Y A;  3G0Z A;  2YNH A;  3SUQ A;  4B9L A;  1BQM A;  1SL1 A;  1JLC A;  1QSL A;  3HO1 A;  3KLI A;  4CIE A;  3KTQ A;  3FFI A;  5EU7 A;  4JS5 A;  1QSS A;  3TAP A;  4E1N A;  4DWI A;  3K58 A;  1JLG A;  2DFE A;  3TAR A;  2E6M A;  1REV A;  1ZBL A;  4Y1C A;  2HMI A;  1EET A;  4I2Q A;  1IKV A;  3UIQ A;  2HHQ A;  2FBY A;  1VSM A;  3S9H A;  4CEA A;  4CEB A;  1SL0 A;  3ASM A;  1CXQ A;  5FRM A;  1HNV A;  1L3V A;  2HND A;  4CJU A;  2X6S A;  3K59 A;  2DTU A;  2YHB A;  4N5S A;  3PX4 A;  2FBV A;  3LAL A;  3OS1 A;  4JRP A;  4JS4 A;  4DFJ A;  3OYL A;  3LAM A;  3AA4 A;  1BI4 B;  1TVR A;  2YV0 X;  3B6P A;  3L2W A;  1T7P A;  1S1X A;  2RKI A;  2Y1I A;  4EZ9 A;  4W5T A;  4CJ3 A;  1VSJ A;  5CY4 A;  4GMJ B;  1LAV A;  3OYG A;  2G8F A;  2ITG A;  3M8S A;  4CGI A;  4RW8 A;  4H8K A;  3V9U A;  4H4M A;  4ELV A;  4YFU A;  2W42 A;  3DI6 A;  3SI6 A;  4Q5V A;  1RBS A;  5FRN A;  4Z4G A;  4HTU A;  1VSD A;  4OPJ A;  1S6Q A;  1S1T A;  4PUO A;  5D3G A;  1LWF A;  1W0H A;  3P5J A;  4Z4I A;  2F8T A;  3L3U A;  4ZHR A;  1WN7 A;  1D8Y A;  1S5J A;  3TWH A;  4FLX A;  1WAF A;  4J2B A;  4B9M A;  4DF4 A;  4FM2 A;  1ZYQ A;  4WE1 A;  4QCL A;  3DOL A;  3VQC A;  1RTJ A;  3WNG A;  4KHW A;  4AHV A;  2ATQ A;  3OYE A;  4M45 A;  4BDZ A;  4E7J A;  1RIL A;  2ETJ A;  4HUG A;  3K5O A;  1UA1 A;  1NKC A;  3IG1 A;  3TR8 A;  3S3O A;  1QHT A;  2HHW A;  1LAW A;  5I42 A;  3PY8 A;  2HW3 A;  1C0M A;  1HJR A;  4OVL A;  3OYC A;  3M8R A;  3D0P A;  5HRP A;  3OJS A;  4NYN A;  3SUN A;  5HRO A;  1RDC A;  3V9Z A;  4DQP A;  4RW9 A;  3EY1 A;  1JXB A;  3PUF A;  4O44 A;  2FC0 A;  2Y1J A;  3PX0 A;  4CGH A;  3TAN A;  1U48 A;  2P5G A;  1HYV A;  4FXD A;  4IKF A;  3K5N A;  4FW2 A;  3P1G A;  3ZCM A;  3TAQ A;  4DSI A;  3AVL A;  3U6F A;  1QE1 A;  1UWB A;  4B8A B;  4W5Q A;  4OGE A;  2YNI A;  5CZ1 A;  1MU2 A;  2QXF A;  1XC9 A;  2VG7 A;  2OZS A;  1SL2 A;  4EZ6 A;  2HHX A;  5SZT A;  1BIS A;  1TKZ A;  1QTM A;  3PO4 A;  1L5U A;  4BDP A;  3E01 A;  3HPO A;  1U49 A;  4F8R A;  2RPI A;  3ZSW A;  1TGO A;  3WNF A;  4CES A;  2XY7 A;  1KFD A;  2KFZ A;  3RRH A;  3CFP A;  4JRQ A;  3QIO A;  4E19 A;  4CIG A;  4BE1 A;  1NKB A;  1IG9 A;  1JLQ A;  3O3H A;  4M3T A;  2JGU A;  3SQ4 A;  1A5W A;  4R5P A;  5DK5 A;  4K8X A;  1BIU A;  2GBZ A;  3IRX A;  5FRO A;  4B08 A;  5J2Q A;  4FK4 A;  3O4N A;  4DF8 A;  4OLA A;  1IKW A;  4CGG A;  4HHT A;  3HP6 A;  2G8H A;  4FLT A;  3TAE A;  3I0S A;  2PYL A;  4F2S A;  4FK2 A;  1C1C A;  3QEW A;  4DQS A;  5HBM A;  3DLK A;  1TKT A;  3AVI A;  4KFB A;  5DMR A;  1RT2 A;  1I3A A;  1TV6 A;  1VSH A;  3TI0 A;  4FJH A;  4KHS A;  4QOZ B;  3ZT3 A;  1YTA A;  3MXJ A;  4AIL C;  4FJ7 A;  4M3X A;  1RTD A;  4CJV A;  3CM5 A;  4M3W A;  1LWE A;  3LWM A;  3HL8 A;  3HT3 A;  1XHZ A;  1FXX A;  2Z1I A;  4CER A;  4B9N A;  1ASW A;  3OJU A;  1NJX A;  1NK6 A;  1WSI A;  3AVM A;  4E7I A;  2G8W A;  3NF9 A;  3A2F A;  4OLB A;  2HHS A;  3NGI A;  3NFA A;  4FCY A;  2HNY A;  3I8D A;  1JL2 A;  5HRR A;  1NK0 A;  1JXE A;  1B9F A;  4W5R A;  3PX6 A;  3JYT A;  4KB0 A;  2B4J A;  2X78 A;  1FK9 A;  1VRU A;  1HYS A;  4GW6 A;  3WNE A;  4CJ4 A;  1NK8 A;  1VSE A;  3SUO A;  3O3G A;  4KHY A;  1BHL A;  4KHQ A;  2OPR A;  1VSI A;  3K2P A;  4CK1 A;  4PQU A;  2WON A;  3VQ4 A;  1S1V A;  3ISN C;  1EKE A;  1DTQ A;  3NH0 A;  3OYK A;  1WAJ A;  1O1W A;  2KZZ A;  1EXQ A;  4CF0 A;  1B92 A;  3O3F A;  3SQ2 A;  4DSL A;  3RMA A;  1X9S A;  3HXM A;  4CJE A;  2E4L A;  3DLG A;  4B9T A;  4B9V A;  1RBT A;  5FDL A;  5HP1 A;  4AHC A;  3SJJ A;  3HJF A;  3VN5 A;  1HMV A;  4DFP A;  3SQ0 A;  2VG6 A;  4Y1D A;  5KI6 A;  2BE2 A;  2Z1G A;  3G10 A;  5I3U A;  4CEQ A;  1NOY A;  1L3S A;  3TAG A;  2F8S A;  2QKB A;  1KVC A;  3KLF A;  3NF7 A;  3KK3 A;  3T19 A;  2E6L A;  2OZM A;  1VK0 A;  4EP4 A;  4OGC A;  3MEE A;  4FJJ A;  3HPH A;  4BE0 A;  2OA8 A;  4FJK A;  1UOC A;  3KKS A;  1RT4 A;  4CK3 A;  4PY5 A;  3NAE A;  4DSF A;  5J2M A;  2D0A A;  2RF2 A;  3SUP A;  4CEZ A;  3NF8 A;  4AHR A;  5T7B A;  4DSJ A;  3SZ2 A;  3OYJ A;  4F4K A;  4FJ8 A;  2O4G A;  1KSP A;  3L2U A;  3DYA A;  3CFR A;  3KK1 A;  2QKK A;  1WSJ A;  5CYM A;  5K14 A;  2G8U A;  3LWL A;  3NCI A;  3KK2 A;  4C8N A;  1JLF A;  3SCX A;  3NDK A;  4GVM A;  3DLE A;  4AHU A;  4MQ3 A;  5J2N A;  4DS5 A;  1KLN A;  1KTQ A;  3LZI A;  2XY8 A;  4TSX A;  4E7K A;  3S3M A;  2A1R A;  1T8E A;  4OPK A;  4CIF A;  2P51 A;  3ZSY A;  4W5O A;  2RN2 A;  1JLA A;  2B6A A;  1TKX A;  3ZSX A;  4Z0U A;  1J54 A;  3KD5 E;  1NJZ A;  3NH1 A;  4LH4 A;  1RDD A;  2NUB A;  5J2P A;  3IS9 A;  4G1Q A;  3DRP A;  1CLQ A;  4DLG A;  1TL1 A;  5HRN A;  4DTJ A;  2IS3 A;  3F73 A;  2R7Y A;  4B8C A;  2HVI A;  4F2R A;  2KFN A;  4M3Z A;  3LZJ A;  4FYD A;  1X9M A;  3NF6 A;  3I0R A;  1ASU A;  3LP1 A;  2KW4 A;  4LY7 A;  2IDO A;  4CF9 A;  1RCH A;  3C6U A;  4NYF A;  4ELT A;  3V1O A;  3VQQ A;  1RT5 A;  5CYQ A;  3S3N A;  4J2E A;  3DRS A;  1YT3 A;  4KAZ A;  3QEI A;  2G8I A;  4FM1 A;  4C8O A;  2IC3 A;  3KJV A;  3EYZ A;  3SNN A;  4L8R B;  4CJT A;  3LPU A;  3LAN A;  3HVT A;  1WLJ A;  4LD0 A;  3KLG A;  1GOA A;  2IAJ A;  4CF1 A;  4CJS A;  4DTS A;  3OYB A;  1XI1 A;  4PA1 A;  4RW7 A;  2PYJ A;  1JL1 A;  1JKH A;  4CFB A;  1T03 A;  3RRG A;  3V4I A;  3ITH A;  1SKS A;  1RT1 A;  2XHB A;  4FLZ A;  3QER A;  3DLB A;  1DTT A;  3OY9 A;  1HRH A;  1IKX A;  1C6V A;  1U04 A;  1C1B A;  3V9X A;  4FVM A;  4B9S A;  3KD1 E;  3DLR A;  1ITG A;  3QIP A;  4QAG A;  4DQR A;  3V81 A;  1U45 A;  3DMJ A;  2PZS A;  1RBV A;  4LSN A;  4BWM A;  3K5M A;  4KI6 A;  4CEE A;  3TAF A;  4DS4 A;  4ZTF A;  4DTU A;  4AHS A;  1C0U A;  1FKO A;  1RNH A;  2BAN A;  3VQE A;  2IOC A;  3T1A A;  2X74 A;  1QSY A;  1RTI A;  1WSH A;  3PO5 A;  3AVK A;  3SYZ A;  3BGR A;  3BDP A;  3EZ5 A;  4CGF A;  3OYN A;  3CQ8 A;  5KRT A;  1JLB A;  3CM6 A;  3KIO A;  1VSF A;  3LP0 A;  3HVR A;  4IBN A;  4CEF A;  3M8Q A;  2O4I A;  1L3T A;  4FZY A;  2IGI A;  1UAX A;  4DG1 A;  1J53 A;  1LW0 A;  3MEC A;  4CHY A;  1VRT A;  3MED A;  1Q9X A;  4FZZ A;  4DFM A;  3OYH A;  1NK5 A;  3U3G A;  2BGG A;  1RTH A;  3KKR A;  4FJN A;  2ZE2 A;  4MFB A;  2KTQ A;  1S9G A;  2GUI A;  4NCB A;  3QEX A;  4IDK A;  4CHN A;  2A1S A;  4ID5 A;  4KB1 A;  1LW2 A;  1QQC A;  1BIZ A;  4BAC A;  1NKE A;  5J1E A;  1S9E A;  2DFF A;  1WSG A;  3AO1 A;  4E0D A;  2Z1H A;  1TAU A;  1VSK A;  4UQG A;  1KRP A;  4M3U A;  1EP4 A;  4FLU A;  2BDP A;  2D5R A;  1BGX T;  1KVB A;  3ULD A;  4E3S A;  4FJ5 A;  4PWD A;  4E1M A;  1RDA A;  3K5L A;  4KI4 A;  4O0J A;  1CXU A;  5KGW A;  1RBU A;  3MAQ A;  4DFK A;  1SKR A;  4B9U A;  3HK2 A;  3VQ9 A;  4KRE A;  4FJ9 A;  1NJW A;  1HNI A;  4KKO A;  1BL3 A;  4CHP A;  4M42 A;  1ZBU A;  4E7H A;  3RTV A;  3PV8 A;  3OVN A;  4Q0B A;  2OYQ A;  2FBX A;  1QS4 A;  3ZT2 A;  4H4O A;  2F96 A;  2YNF A;  1SKW A;  3IAY A;  4N41 A;  4M41 A;  3AVN A;  4DQQ A;  4DU4 A;  3SPZ A;  2OPP A;  3KLE A;  3OYA A;  3AO3 A;  4OKJ A;  1TK8 A;  3VQ7 A;  1GOC A;  4OJR A;  3ZT0 A;  3OYD A;  3QNO A;  4YNQ A;  4CJK A;  3AA2 A;  3QET A;  4DTR A;  4ELU A;  1VSL A;  2XRI A;  3RMD A;  4W5N A;  1X1P A;  4HCB A;  1IO2 A;  1HQU A;  5C24 A;  3ZSO A;  4HUF A;  1NK9 A;  5KRS A;  3C6T A;  4FW1 A;  2VWK A;  4O4G A;  3RMB A;  3QNN A;  1TKD A;  4CEC A;  4AHT A;  4KRF A;  1F21 A;  3AVF A;  5SWM A;  3ZT1 A;  3VA0 A;  1TK0 A;  2I5J A;  3P83 D;  2VWJ A;  3QES A;  5C25 A;  3CG7 A;  2FBT A;  4ID1 A;  1BI4 A;  4RW4 A;  4CGJ A;  4DMN A;  1ZBH A;  1YVU A;  4RW6 A;  4CFC A;  1D9F A;  3NH2 A;  2HB5 A;  2ZQB A;  3CFO A;  1J9A A;  3VQA A;  4CJQ A;  4FJG A;  3DOK A;  4E89 A;  4F3T A;  1W9H A;  4CJR A;  3VQP A;  2D0B A;  1ASV A;  4O55 A;  4K8Z A;  3TAB A;  2HHU A;  1C1A A;  1ZBF A;  1IH7 A;  1WSF A;  4DTO A;  4DU1 A;  4AH9 A;  1BQN A;  5HRS A;  3THV A;  3MXI A;  4KTQ A;  1C0T A;  1S1U A;  1LV5 A;  2HVH A;  3AVG A;  3M8P A;  4ZTJ A;  4KV8 A;  1CZB A;  3LAK A;  4RG8 A;  4O0I A;  3VQ6 A;  3ZSR A;  1Q8I A;  1U4B A;  4IG3 A;  4OKE A;  2XO7 A;  2DFH A;  1N6Q A;  3V6D A;  4N76 A;  4Z4H A;  3K57 A;  3MEG A;  3V1Q A;  3SPY A;  1BCM A;  2G8K A;  1HYZ A;  4IFV A;  4NCG A;  4DU3 A;  3AA5 X;  1NK7 A;  4KO0 A;  1T05 A;  2KZM A;  2YNG A;  3NGZ A;  3OYM A;  3RWU A;  4J2D A;  1Y97 A;  4CE9 A;  4BE2 A;  4N47 A;  5C42 A;  3VQ5 A;  1ZBI A;  3AVC A;  4KTW A;  1BCO A;  2EX3 A;  3L3V A;  5KTQ A;  4OKK A;  4CHZ A;  3WNH A;  2OPQ A;  4N56 A;  4CF2 A;  4CJW A;  4CEO A;  2VG5 A;  1RT7 A;  1SV5 A;  3O4Q A;  1JLE A;  1LWC A;  2B5J A;  3DM2 A;  4IFY A;  4LSL A;  4O5B A;  4CK2 A;  4CFD A;  4FK0 A;  3CYM A;  3H08 A;  1KLM A;  4LH5 A;  3ZSV A;  1A5X A;  2Q3S A;  3LDS A;  3OS0 A;  1UA0 A;  1NK4 A;  1YTU A;  3T3F A;  4CCH A;  1L3U A;  1KCF A;  1NOZ A;  4CHO A;  2YKN A;  4FJM A;  3VA3 A;  3V1R A;  2PY5 A;  4FJX A;  1J5O A;  3VQD A;  1I39 A;  4DSE A;  3AVA A;  3C95 A;  2P5O A;  4FLY A;  4I2P A;  3F9K A;  1U47 A;  3LPT A;  4JLH A;  4Z4C A;  4C8K A;  3L8B A;  4DTX A;  1CZ9 A;  4CJ5 A;  4E7L A;  3RR8 A;  4B3O A;  1DLO A;  1IKY A;  4M3Y A;  1G15 A;  3AVJ A;  4HVJ A;  3AA3 A;  1RT3 A;  1HPZ A;  4HUE A;  4I7F A;  3NHG A;  4CF8 A;  4BWJ A;  4CHQ A;  3ZSQ A;  4FJI A;  4DTN A;  2DY4 A;  4DTP A;  3DLH A;  3NGY A;  2P1J A;  5HLF A;  3OYF A;  3TAM A;  3QLH A;  3KLH A;  4F3O A;  4C8M A;  4KHU A;  2KQ2 A;  3SQ1 A;  3AVB A;  4DLE A;  2OPS A;  3QIN A;  1WSE A;  4FJL A;  3B6O A;  2ZD1 A;  2JLE A;  3SV4 A;  1S6P A;  3V9S A;  3RMC A;  4DQI A;  3JSM A;  3L2R A;  1GOB A;  1TL3 A;  1XHX A;  3VQB A;  2HNZ A;  4XIU A;  3MXM A;  1X9W A;  3LP2 A;  4IG0 A;  4CGD A;  4HCC A;  4C8L A;  3C94 A;  3D45 A;  4KTZ A;  3OYI A;  5JS2 A;  2YKM A;  4EP5 A;  3ZT4 A;  4FLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...