2QKBA

Human rnase h catalytic domain mutant d210n in complex with 20-mer rna/dna hybrid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna/rna
molecule keywords 5'-R(*GP*GP*AP*GP*UP*GP*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*
publication title Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2qkbA00
1VRTA 4M3WA 3VQ9A 1N5YA 5HP1A 4BE0A 3CM5A 1HMVA 1KTQA 1T8EA 4LY7A 1ASUA 2Y1JA 2IDOA 3QETA 2ZD1A 2YHBA 4DTXA 2WOMA 5DMRA 4AHSA 4CEAA 3KK3A 1CZ9A 3K2PA 2ITGA 1S5JA 1NK6A 1Q9YA 1YTAA 4HVJA 3CFPA 3VQ8A 1RTDA 1GOAA 2X78A 4B9NA 5KGWA 5HRNA 3CM6A 4I7FA 3ULDA 1A5XA 1ZYQA 2OZMA 1JL2A 3C6TA 3I0SA 4AH9A 3D0PA 4CEOA 4CK3A 3VN5A 4JRQA 3MEEA 1NOYA 3AO4A 1Q9XA 2XRIA 1X9SA 4CJPA 4C8KA 2VWJA 4B9LA 3MAQA 1J54A 1Z26A 3K58A 1D9FA 2KQ2A 1TGOA 4HUEA 3LP3A 1JLQA 2RF2A 2X6NA 4CGGA 2HHXA 1BCOA 4OGCA 5HLFA 4RW4A 1KLNA 1KRPA 1FKPA 1IKWA 4FJNA 1B92A 2LSNA 2A1SA 3QO9A 2HMIA 2DTUA 3HT3A 4AHTA 5KTQA 2B5JA 2ATQA 2DFFA 4BDYA 4O55A 4DU1A 1EX4A 3V1QA 3S9HA 1LW2A 4IKFA 3LPTA 1C0MA 1KCFA 1RT2A 2GBZA 2HNYA 3C6UA 1SL1A 3AO3A 1VSMA 3AA3A 4FLXA 4DFKA 4K8XA 3KLGA 2HHWA 3ZT2A 1HYVA 3AVFA 5J2QA 3SUNA 4N47A 3AVLA 3AVAA 3NE6A 1RT7A 1D9DA 4FM0A 4DQRA 1U45A 5KI6A 4OKEA 3MEGA 3H08A 2BE2A 4E7JA 3OYAA 4F3OA 1W9HA 5HBMA 4CFDA 3PO5A 4B9TA 2YNGA 4Q5VA 1S1UA 3CYMA 3TR8A 3AVIA 1RT3A 3TAGA 1WSIA 3B6PA 1SL2A 4CF0A 4FK4A 1BIZA 3HK2A 1VSHA 1JKHA 1Y97A 2IS3A 3RTVA 5CYQA 4CESA 3DYAA 3KK2A 4CJUA 2B6AA 4DTRA 4CJFA 3VQBA 3ZT4A 4BACA 3SV3A 3LAMA 1QSSA 1IKXA 4O0JA 5JS2A 3RR8A 3KKRA 1ITGA 1VSFA 3KKSA 4CJWA 3PV8A 4CJLA 4FJ5A 1SL0A 4FW2A 4ICLA 4QOZB 1TL1A 1WN7A 3OYKA 1X1PA 5CY4A 1RBTA 4DSKA 1TAUA 1UWBA 4G1QA 2KZMA 4J2AA 5KRSA 2F8SA 1RT1A 4HUFA 3L2WA 1U49A 4JS4A 5FRNA 1XWLA 2NUBA 1T03A 4WE1A 3OYNA 4FCYA 3SI6A 3DLBA 3THVA 1DLOA 3KLIA 2G8IA 4BDPA 3OYBA 3LP1A 2KTQA 3OYIA 1IO2A 3M8QA 1UOCA 3HXMA 3NCIA 2BDPA 1B9DA 2G8HA 2G8WA 3KD5E 4ELUA 2E6LA 4W5NA 4DTUA 3L2VA 1LV5A 2FBXA 3ZSOA 3WNHA 4NCBA 4LSNA 1T05A 2HVIA 1LAWA 2XO7A 1NKEA 4Y1CA 4FLVA 3MECA 3TAEA 2GV9A 4CHZA 1CXUA 3HPOA 3OYEA 3VQ6A 1RBRA 2HB5A 4CEDA 2P5GA 1KLMA 4C8LA 1TKXA 1JXBA 3G0ZA 3TAPA 3QINA 3AVJA 4NYFA 3V9UA 1LWCA 3QIPA 2X6SA 1C1AA 4C8NA 3U3YA 3CQ8A 4I2QA 3NHGA 1RT6A 3AVNA 4KHQA 1QSYA 3DM2A 4KO0A 2KFZA 2EHGA 1DTTA 5J2NA 3KLFA 1JL1A 4YNQA 1I39A 4KTWA 3AVGA 3ZT3A 3AVKA 4CGDA 4CJ5A 4FW1A 3VQ5A 3O3GA 4DF8A 4CJTA 1A5VA 3RMCA 1NK7A 2PY5A 2PYJA 1RCHA 3L2RA 4Z4GA 3LALA 1NKBA 3S3NA 4DQQA 4EZ9A 3C94A 2YNHA 3LZIA 4ID1A 2VWKA 4E19A 5C25A 3EYZA 4E1MA 3SCXA 1ZBIA 1NK4A 2EX3A 1HQEA 4F3TA 1BI4B 4KFBA 2QXFA 5I3UA 4TSXA 4F8RA 3HJFA 3DMJA 1C6VA 1TAQA 2XY8A 3CG7A 3QEIA 4CCHA 3P5JA 3ZSVA 4AHRA 1XHZA 4B9UA 1RBUA 4FJIA 2YNIA 4FLTA 2OPPA 4CIGA 2P1JA 2JLEA 1BHLA 5K14A 4GW6A 1IG9A 3PX6A 1HNVA 3QERA 4DSJA 2DY4A 4M3XA 1WSJA 1GOCA 4OKKA 3UIQA 3V4IA 1WLJA 2Y1IA 1RTIA 4JS5A 2G8UA 4FM2A 1VSLA 4KI6A 3VQCA 4NCGA 5J2PA 3OYCA 1WSHA 4DTSA 4KHUA 4Z0UA 1GOBA 1FKOA 1JXEA 2PZSA 1RDAA 3I8DA 1BQMA 1HPZA 2RKIA 1NJYA 4O44A 4B9MA 1RT4A 5SWMA 4EZ6A 2F96A 1X9MA 3AO1A 3S3MA 3K57A 4M3UA 1O1WA 2HHTA 4OKJA 3AA2A 3VA0A 5FRMA 3VQEA 3OYHA 4DSFA 3V81A 4RW8A 2FBVA 3ASMA 3OYGA 3SQ1A 3IAYA 4AHUA 5D3GA 1TKDA 4DQSA 4CJ4A 3K59A 2GUIA 3BGRA 5HRPA 3V6DA 3OYJA 1SKWA 3K5MA 3ZSXA 4CGJA 2ETJA 3NF7A 1L5UA 3VA3A 2FBYA 4DU4A 3ZT1A 4PQUA 1RDBA 3NF6A 1HYSA 1D5AA 1SKSA 1L3SA 1WAJA 1IKYA 3AVCA 3DRSA 4W5QA 3NGIA 1HYZA 4C8MA 4BE1A 4FVMA 4DTOA 3OS0A 4FLZA 1ASWA 3VQQA 3SQ2A 3M8RA 1U47A 4NCAA 4Z4CA 1DTQA 2Q3SA 3CFOA 4CJ3A 3TABA 4C8OA 5HROA 5EU7A 4DS5A 3HSTB 4DFMA 4O5BA 4I9QA 4CF8A 3HO1A 3ITHA 1NK9A 4FLYA 3NH1A 4CGHA 4AHCA 1NK0A 4W5RA 4OPKA 1L3UA 1K6YA 3LZJA 4HCCA 3RR7A 4ID5A 1TV6A 3QIOA 1SV5A 4B8CA 4CECA 1C0TA 2FBTA 2QKBA 1RDDA 2HHSA 4LH5A 2HHVA 5SZTA 1KVBA 2AJQA 1EXQA 3RMBA 4B3OA 4CGIA 5DK5A 3HM9A 1XI1A 3KK1A 3V9ZA 4FK2A 3HVRA 1C1BA 3M8PA 4FJMA 3IS9A 1EKEA 3O4QA 3LAKA 3TAQA 2BANA 4O4GA 3DOLA 3IRXA 3ZSZA 4BE2A 4KRFA 1VSKA 4RW9A 4E7LA 1HNIA 4IG3A 4ZTFA 2A1RA 3DI6A 4JLHA 1QHTA 2ZE2A 1S6PA 3F9KA 4CIFA 4DF4A 3ZSYA 4CHQA 2P5OA 2RN2A 4QAGA 2WONA 2BGGA 2Z1HA 2O4GA 3DLRA 3MXIA 4CJEA 2KFNA 3QEPA 3SYZA 3OVNA 3O4NA 2VG7A 1JLBA 3I0RA 4M3TA 3DLEA 2QK9A 4PWDA 1RTJA 1BISA 3DLHA 3TAFA 5KGXA 3LANA 2IC3A 1VK0A 5E41A 4DTPA 1RTHA 4RG8A 3AO5A 1YTUA 4FLWA 2P51A 3K5NA 4DQPA 4KTQA 2IOCA 2XY5A 3MXMA 4H8KA 4FZXC 4CERA 3AO2A 3HVTA 4EP4A 4CHYA 1KSPA 4F2SA 4L8RB 1A5WA 4FLUA 4E7KA 4OVLA 3TWHA 3TARA 3MXJA 3QESA 1TK0A 5HRRA 4Z4FA 4KPYA 4KV8A 3VQ4A 3DLGA 4F2RA 3NFAA 1L3VA 2D0BA 3KLEA 3T3FA 3KD1E 1IKVA 3NF8A 2VG6A 5KRTA 4KREA 4PA1A 3TI0A 4CIEA 4N41A 4IFYA 4KTZA 3TANA 3NAEA 4IDKA 4DQIA 1VRUA 5J1EA 1J53A 4KAZA 3JSMA 4M3YA 4FJKA 3AVBA 4GMJB 1S6QA 1RNHA 3V1OA 3PY8A 3NH0A 3QEWA 3V1RA 4FJJA 3AVHA 4B9VA 3U6FA 1JLAA 3AA4A 1KFSA 4CEEA 1VSIA 4DLEA 1B9FA 4CJKA 3SPZA 1QE1A 3WNFA 1X9WA 1BQNA 1JLEA 3HPHA 4CF1A 3V9SA 4HHTA 1LWFA 5CYMA 3HYFA 4ZTJA 3O3HA 1Q8IA 1MU2A 3AV9A 4DFPA 4R5PA 4YFUA 5I42A 1QTMA 1VSEA 3PUFA 2FC0A 3WNEA 4J2DA 5T7BA 2E4LA 4CJVA 4PUOA 4OLAA 4IFVA 4DMNA 1YVUA 3OY9A 3NGYA 4DS4A 4W5OA 4KI4A 1D8YA 3RMAA 4OJRA 4DG1A 3ZCMA 1ZBFA 4AILC 4CJQA 2HNZA 3SUOA 3VQ7A 2OA8A 1BI4A 5C42A 1JLFA 2QKKA 1RBSA 1S1VA 4GVMA 2B4JA 4M45A 4CGFA 3KLHA 3MEDA 4LH4A 3KJVA 2D5RA 2HW3A 3OYDA 2ZQBA 1UA0A 3VQAA 3ZSRA 1R0AA 4DSIA 2IGIA 4K8ZA 1TKZA 4LD0A 1U04A 1VSJA 3ZSWA 2OPRA 3V9XA 1CLQA 3NF9A 3QLHA 1LW0A 3QNOA 4B8AB 3G10A 3LPUA 1XHXA 4FJLA 3LWMA 1BL3A 4CK2A 1S9GA 4ELVA 3VQPA 3OYLA 2HVHA 2KZZA 3O3FA 1UAXA 4CEBA 4KHWA 4M41A 4M3RA 3L2QA 1NOZA 1ASVA 5FROA 1UA1A 3FFIA 1T7PA 1REVA 2OZSA 1EP4A 2HHQA 1F21A 4Z4IA 5CZ2A 3RMDA 1ZBUA 1JLGA 3KTQA 1C0UA 3IG1A 3AA5X 4RW7A 1RILA 1W0HA 1VSDA 2OYQA 4KHYA 5CZ1A 4OLBA 1NJZA 3HPGA 2W42A 3SJJA 1SUQA 3LDSA 4EP5A 3QEVA 3S3OA 2JGUA 3V9WA 1NJWA 4B08A 4E3SA 3NGZA 3EY1A 4HCBA 4E89A 4CJRA 4B9SA 5C24A 3LWLA 2G8VA 2Z1GA 3LP0A 4DU3A 4CHPA 1KVCA 3AVMA 4FJ8A 3DRRA 2YNFA 1TKTA 5FDLA 2IAJA 3ISNC 4KKOA 1RT5A 3ALYA 4E7IA 1G15A 3SNNA 2XY7A 2YKNA 1XC9A 1SKRA 3HL8A 2D0AA 3BDPA 1ZBLA 3WNGA 2E6MA 1J5OA 4F4KA 2OPSA 4Z4HA 1WSEA 1TL3A 3SUQA 4E0DA 3OS2A 1C1CA 1RDCA 3SQ4A 2Z1JA 4CHNA 4E7HA 3HP6A 1NK5A 4CFBA 4KHNA 2D0CA 4IBNA 1L3TA 4M3ZA 4DTMA 1BIUA 1JLCA 4N76A 4IG0A 1YT3A 4I9LA 1U48A 2DFEA 2OPQA 3L8BA 5JS1A 3DLKA 3QEXA 3A2FA 4NYNA 3VQDA 1NKCA 4MFBA 1U4BA 2G8KA 4FJHA 4CEZA 2I5JA 4N56A 1WSFA 2R7YA 3OJSA 3RRGA 1LAVA 2HHUA 3SUPA 3DOKA 1BGXT 3D45A 4MQ3A 4HUGA 3RRHA 3RWUA 1S1TA 4BWMA 4UQGA 4ZHRA 4J2BA 1RBVA 1HRHA 1S9EA 1BCMA 2PYLA 3NDKA 3OS1A 3F73A 3PO4A 3P83D 1QQCA 4H4MA 3QNNA 3SPYA 2Z1IA 1FXXA 3M8SA 1EETA 4FZZA 4FJ9A 4DFJA 2YHAA 1IH7A 2X74A 4KB1A 4FZYA 4BWJA 1NJXA 2YKMA 1HJRA 4CF9A 2VG5A 3P1GA 1WNSA 3DRPA 3PX4A 4I2PA 1LWEA 4LSLA 4DLGA 4W5TA 4CJSA 3SQ0A 1NK8A 3CFRA 2RPIA 3HP9A 3ZT0A 3L3VA 4FJ7A 4OGEA 1QS4A 3NBPA 1CZBA 1WAFA 4DTNA 3SZ2A 3NH2A 4XIUA 4FK0A 4Y1DA 4KB0A 2G8FA 1TVRA 1TK5A 3L2UA 5HRSA 2HNDA 4FYDA 4CEQA 2F8TA 1ZBHA 4BDZA 3K5LA 1N6QA 3L3UA 4AHVA 4N5SA 1CXQA 3OJUA 4DSLA 4FJGA 4J2EA 1KVAA 4FXDA 1KFDA 4E1NA 3ZSQA 2DFHA 4KHSA 4CHOA 4CEFA 4CE9A 4OPJA 3C95A 3T1AA 3E01A 3OYMA 4O0IA 4FM1A 4DTJA 1I3AA 4H4OA 1FK9A 4QCLA 3SV4A 1WSGA 1S1WA 4CFAA 4CK1A 3T19A 3OYFA 4PY5A 4ELTA 1TK8A 4FJXA 4Z4EA 3U3GA 3EZ5A 3JYTA 2KW4A 1HQUA 2O4IA 1Z25A 2XY6A 2YV0X 3K5OA 3B6OA 5J2MA 4CF2A 4DSEA 2XHBA 3PX0A 4HTUA 1QSLA 4DWIA 4RW6A 3KIOA 3TAMA 4Q0BA 4M42A 3LP2A 4CFCA 1J9AA 4JRPA 1S1XA
chains in the Genus database with same CATH superfamily
1D4XA 2VCPA 5HP1A 4BE0A 5EXWA 3JAMO 1KTQA 2ASMA 3FZHA 4LY7A 2Y1JA 4JEPA 1XNRK 3BUZB 3EN9A 5DMRA 1MDUB 4AHSA 3KK3A 1FW6A 3MK6A 4DR6K 4HVJA 4B9NA 2H3GX 3MMVA 3A8YA 4I7FA 3ULDA 1ZYQA 4IO8A 3VEXA 4CEOA 4CK3A 1NOYA 1Q9XA 4B9LA 3MAQA 1J54A 3GDQA 3I56N 4HUEA 1JLQA 4CGGA 2HHXA 1BCOA 4EHTA 4OGCA 5HLFA 1FKPA 1IKWA 4XEIA 3HT3A 2P9PB 5KTQA 3DXMA 1EX4A 2ZJPL 4IKFA 4JI3K 2WBNA 4K8XA 2HHWA 1HYVA 3AVFA 4MO5A 3AVLA 2E2PA 5AQUA 3OA9A 2F9WA 3MEGA 1N33K 2BE2A 5A2QO 4E7JA 4F3OA 3O9TA 2E88A 2QWQA 5I9EB 3TR8A 3CYMA 3O1BA 3NMUA 2BH1A 4QS9A 3EL2A 1BIZA 4YOVA 5CYQA 4CESA 3KK2A 2B6AA 1YHQN 4JKGB 3VQBA 2FSKA 5H1SQ 5LY3A 1NMDA 2D4WA 4O0JA 5JS2A 3RR8A 1ITGA 3VMFB 4R79A 1SL0A 2OANA 4C1NK 5F0XA 5ADXH 3CD6N 4K41A 1WN7A 1RBTA 1TAUA 4LF7K 4U67L 5KRSA 5BN9A 2V7YA 3UE5A 3C0BA 1N8RO 4JS4A 2NUBA 1K8KA 1DEJA 5C15A 4YDUA 3Q7CA 4FCYA 3SI6A 2O8CB 1DLOA 2UXDK 2KTQA 2NRZA 5AQOA 3H3OB 5JLFA 3M8QA 1UOCA 4WFNL 3HXMA 3NCIA 3CC4N 3KD5E 4ELUA 4DTUA 3L2VA 3CJ9A 3ZSOA 1Q82O 4FLVA 3MECA 3CJAA 2GV9A 4CHZA 3HPOA 2E1YA 1S72N 3VOVA 1TKXA 3VEVA 1I94K 5BPMA 3QINA 4DHYA 4CZIA 3NHGA 5AZIA 1RT6A 3AVNA 5ADXA 5J2NA 3D2EB 1K8AO 1JL1A 1I39A 4KTWA 3AVGA 3ZT3A 4FW1A 3VQ5A 4CJTA 2PY5A 3LALA 2O8EB 4Y0WA 4EZ9A 5AQFA 1BA1A 2GWKA 2VWKA 5C25A 3EYZA 4E1MA 4F3TA 4KFBA 4TSXA 4F8RA 3HJFA 3DMJA 4B3SK 2XY8A 4IEIA 4YOUA 5AQLA 4CCHA 4FLTA 2P1JA 5K14A 3PX6A 3QERA 4M3XA 4OKKA 3BF3A 3D2FB 3OW2M 4E1JA 4BQLA 4KHUA 4KI6A 3VQCA 1WSHA 3EEQA 3WXJA 4Z0UA 1FKOA 3AY9A 2RKIA 2NNWA 2E2NA 1RT4A 3WXKA 5SWMA 4OPHA 2F96A 3A0IX 4JN4A 2UXBK 4DSFA 4H0PA 2F7TA 4RW8A 2FBVA 3OYGA 3THYA 4CJ4A 3V6DA 3ZETB 3OYJA 3ZSXA 3NF7A 4KH4A 3NF6A 3DLLL 3DRSA 4W5QA 1HYZA 4HTLA 3ZYYX 4FVMA 1NWKA 2Q2RA 1ASWA 4FWOA 1U47A 3GE1A 4Z4CA 1DTQA 2ZGZA 3ATUA 2Q3SA 3TABA 4NCAA 4DR3K 4CF8A 3ITHA 1NK9A 4CVNE 4FLYA 4JI8K 4ISFA 1NK0A 2YI1A 1K6YA 3LDPA 1U6ZA 2QKBA 4CJ7A 4LH5A 4B3OA 1XI1A 5AQQA 1C1BA 4FJMA 3O4QA 3LAKA 1VQ9N 3TAQA 4O4GA 4KH6A 3IRXA 3G6EN 4GV3A 4E7LA 4QS8A 2A1RA 1XC3A 2UUCK 1WBDA 3U8XA 3CCSN 2WONA 3MXIA 4CJEA 3SYZA 2VG7A 1BA0A 5AQPA 3CCJN 2QWLA 2ZF5O 3TAFA 1V4TA 4JV5K 2IC3A 4DTPA 1Q18A 2P51A 2IOCA 2XY5A 3HTVA 4H8KA 4FZXC 4L8RB 5M1FA 4B1WB 1A5WA 2O8DB 4OVLA 5BREA 3TARA 3VGLA 1W97L 1L3VA 2D0BA 3KLEA 2HMPA 4J8FA 4KREA 3PLAA 3HI0A 3UKUB 2E2OA 2DPNA 4KAZA 4GMJB 1RNHA 4BR0A 4M7YA 3V1RA 3QEWA 3U6FA 3AA4A 1KFSA 4CJKA 3SPZA 4CF1A 3HPHA 4OX9K 4HHTA 3F9MA 4IFEA 5C12A 4X62K 4FWMA 1MU2A 4R5PA 3KZBA 3CJ7A 1VSEA 3WNEA 4J2DA 4B1VA 4IXCA 4PUOA 5F2RA 3OY9A 1QHAA 1D8YA 2GWJA 4OJRA 1BI4A 5I42A 4M45A 3J8AA 2HW3A 3A5MC 3ZSRA 4DSIA 5JMVA 2ZWHA 3NVMA 2IGIA 4XH4A 1U04A 1KAXA 3QLHA 2WUSA 1HPMA 2FF3B 3OYLA 2Q0UA 2NRRA 4KHWA 1YJNN 2V52B 3H3NO 3FFIA 3VESA 2P9PA 3P4IA 1T7PA 3EKUA 3ZEUB 4Z4IA 5CZ2A 1ZBUA 3PSFA 3H1QA 4RW7A 3AA5X 1RILA 5CZ1A 3VEWA 2O8FB 5GAGP 1KXPA 3VF6A 3V9WA 3EY1A 3ZX2A 4CJRA 2G8VA 1GLAG 1QVFM 2HHHK 4CHPA 3DRRA 1TKTA 4MLHA 1M1KO 3H45C 2ZGYA 3LM9A 1HUXA 3SNNA 1VQ6N 1SKRA 2D0AA 3BDPA 3WNGA 2NLXA 2E6MA 4F4KA 2P9LB 3OS2A 3ENBA 1C1CA 1ILYA 5LMUK 4JNEA 4JKGA 4E7HA 2HSTA 2D0CA 1L3TA 5DM7L 5AQJA 4WFAL 5C0YA 3E9OA 3P39A 3MCPA 4BRFA 1E3MA 2G8KA 4CEZA 2I5JA 1C0GA 1EQYA 1WSFA 2W6LA 2R7YA 1QVGM 4JI6K 3SUPA 5EVZA 4MQ3A 5C10A 4UQGA 1R59O 5FPMA 3OS1A 1IBLK 3F73A 3PO4A 1QQCA 1GLLO 3BZCA 4C1NI 1EETA 3PSIA 2O8CA 3QICA 1IH7A 5BRHA 4KB1A 4OO1J 4FZYA 2BUPA 3LL3A 4CBUA 4CF9A 1GLJO 1LWEA 3KVGA 3LDQA 1CZBA 3SZ2A 3ULEB 3NH2A 4XIUA 4K25A 5GADP 1TK5A 5HRSA 2F8TA 1ZBHA 4J2EA 3WEEB 4FJGA 1KVAA 4E1NA 4KHSA 4CHOA 3AAQA 1FK9A 4CK1A 4PY5A 3T19A 4CZFA 3D2EA 3DAWA 1TK8A 4FJXA 4Z4EA 3U3GA 3TSUA 2O4IA 2YV0X 2XHBA 2OTLN 3G4SN 2P9IB 1QSLA 4DWIA 4RW6A 4Q0BA 1HJOA 1SL2A 4JRPA 2O8EA 1N5YA 4B3MK 1T8EA 4CZGA 1ASUA 2IDOA 4WFBL 2YHBA 4DTXA 2WOMA 4CEAA 3K2PA 2ITGA 1S5JA 1YTAA 3CFPA 1RDUA 3G25A 5BN8A 1A5XA 1NU0A 4AH9A 3AO4A 2XRIA 4C8KA 3D2FA 2KQ2A 5KPRA 4EHUA 4FJNA 1B92A 3QO9A 3QBWA 4BDYA 2ATQA 1KCFA 2GBZA 4FLXA 2UU9K 3KLGA 3FZFA 5J2QA 4N47A 3C6HA 3AVAA 3NE6A 1RT7A 4FM0A 4DQRA 4U7BA 3ZETA 4OKEA 3PO5A 1IJJA 4BRPA 1S1UA 3CQXA 5AQNA 3TAGA 1RT3A 1IBKK 4H03B 2V51B 1Y97A 1JKHA 5AQKA 2AA4A 2YHXA 3SV3A 3LAMA 3KKSA 4CJWA 3ATVA 4CJLA 4FW2A 4BR5A 4QOZB 2YCHA 4NB4A 2ZM6K 5CY4A 4DSKA 2KZMA 3FFKB 3DWLA 2F8SA 3E9LA 4ILHA 1RT1A 4HUFA 3HOTA 4DR2K 5FRNA 3O08A 1T03A 3OYNA 2NRTA 3KLIA 3OYBA 4B3RK 1E4GT 3OYIA 4LFAK 1VAZA 2HF4A 2E6LA 5AQHA 1LV5A 3OHRA 5AQVA 3WNHA 4NCBA 2HVIA 4Y1CA 4FSVA 2NRHA 3TAEA 3K0SA 1CXUA 2QM1A 4CEDA 2P5GA 1KLMA 5DM6L 1JXBA 4AF1A 2O8DA 4NYFA 4H5WA 4BROA 1HKGA 4FVUA 1QSYA 3DM2A 2EHGA 4PHTX 1XUPO 3UKUA 4DUYK 3AVKA 3OBWA 5LJVA 4DF8A 1NBWA 3WQUA 1NK7A 4BVPA 3S3NA 3C94A 2YNHA 3LZIA 4ID1A 3QB0A 1NM1A 1BI4B 5I3UA 2QWOA 3CG7A 5FPNA 3P5JA 2OPPA 4CIGA 2Q97A 3E1YA 1HNVA 2FSNA 5LJWA 3KK7A 1WSJA 2Y1IA 4NO7A 1RTIA 1ATRA 2G8UA 1VSLA 1NMNA 4NCGA 1YJ9N 4DTSA 3O1WA 3TU5A 2IVOA 1KQSM 1RDAA 1BQMA 1HPZA 4JI4K 4JD2B 1NJYA 4EFHA 2QWNA 5BPNA 3I55N 4BG9A 1O1WA 2J4RA 2HHTA 4OKJA 1NGIA 3V81A 3IAYA 3ZEUA 3SQ1A 3IDHA 2P9SA 3K59A 3K5MA 5AFUH 1L5UA 2O8FA 3L0QA 2FBYA 4DU4A 3ZT1A 2OCEA 2VGNA 1SKSA 1L3SA 2P9KB 3O9RA 3AVCA 4PKGA 3KHYA 4BE1A 4C8MA 4BRIA 2YHYA 4IWVA 4DTOA 3VQQA 3SQ2A 1NGJA 3M8RA 1DKGD 4CJ3A 4BRQA 5EU7A 2IVPA 4DFMA 2P9LA 3HO1A 3T1HK 3NH1A 1H1VA 2RHKA 4CGHA 2PAVA 1ZBSA 4CI6A 3R3LA 1BUPA 4HCCA 3LZJA 3RR7A 1XNQK 1TV6A 1C0TA 1WOQA 1RDDA 3D6RA 4IOXA 5SZTA 1EXQA 3MX2A 3RMBA 4H0TB 4CGIA 5KQDA 3VGMA 3M8PA 3IS9A 1EKEA 5AQRA 4BE2A 4FWSA 3DI6A 3R6MA 1QHTA 2ZE2A 3F9KA 4CIFA 2Z1HA 4H0XB 2KFNA 3QEPA 4DCHA 5AFUA 3OVNA 4BC2A 2QK9A 4PWDA 5AQSA 2FLOA 5KGXA 3J81O 3CERA 1RTHA 4FLWA 1WB9A 4DQPA 4KTQA 3CPWM 5BR9A 2V7ZA 4KHPK 2D0PA 5E26A 3AO2A 3HVTA 4F2SA 5AZJB 3ULEA 4DB3A 4Z4FA 5HRRA 3VQ4A 1OH8A 4F2RA 1YAGA 4IOAL 1OH7A 4PA1A 1V4SA 3WEEA 3TI0A 4CIEA 4JYAK 4KTZA 3TANA 4IDKA 1VRUA 5J1EA 4M3YA 3LM2A 3AVBA 1S6QA 3PY8A 5FLXO 4B9VA 1JLAA 4DLEA 3Q7BA 1LWFA 3HYFA 3CCUN 2A41A 1Q8IA 2P9IA 5M1KA 2NZTA 2Q1NA 2OTJN 2FC0A 4HWIA 3MWPA 2JWKA 3NGYA 4W5OA 4KI4A 3ZCMA 1ZBFA 4XH5A 4CJQA 4PL7A 2OA8A 4JKDA 5C42A 1JLFA 4NLBA 4CW7B 1RBSA 4CGFA 3KJVA 3MN6A 3VQAA 3J80O 1OKJA 4DV3K 1IBMK 4K8ZA 5AQWA 1VSJA 3CJ1A 3ZSWA 4FWPA 2OPRA 1LOTB 2CGJA 3NF9A 1ESVA 1LW0A 3LPUA 1XHXA 1TUUA 3LWMA 3VQPA 4I6MB 2HBKA 3VF2A 1BOTO 4WYBA 2KZZA 4X64K 3L4IA 4M41A 4B3TK 3L2QA 1ASVA 4BR2A 2OZSA 1EP4A 4MDAA 3VF4A 3KWGA 3KTQA 3P31A 3O5BA 4OLBA 4YOTA 4H0VB 2W42A 3SJJA 3S3OA 3LDSA 4EP5A 1NJWA 1JCGA 4E89A 5C24A 2Z1GA 3LP0A 4DU3A 3AVMA 3VTHA 2IAJA 2QEXN 3CQYA 4E7IA 3ALYA 5AJ3K 3M3ZA 1HR0K 1ZBLA 5JVGL 4G9ZA 3SUQA 4BREA 4IZ9A 4BRGA 1NJIO 4CHNA 1N36K 4JI1K 4IBNA 1CZAN 1BIUA 1JLCA 4GNIA 4N76A 4IG0A 1IG8A 4I9LA 1U48A 2RE2A 2OPQA 3L8BA 4NYNA 3VQDA 4MFBA 1U4BA 5BPLA 5M1OA 1LAVA 1NGAA 4HUGA 3AGKA 3RRHA 3VERA 2A40A 4J2BA 1S9EA 1BCMA 2NRWA 3NDKA 4DQ8A 1X9JA 4CZHA 3P83D 3SPYA 3QNNA 5KQ8A 4DFJA 4CD3A 3U4LA 1EO1A 2A5XA 2YKMA 1HJRA 2VG5A 1VHXA 3P1GA 3HOSA 1S3XA 3PX4A 4LF6K 3MWTA 4LSLA 4DLGA 1QQOA 3SQ0A 3WXMB 3R8EA 3L3VA 3LDLA 4BR9A 4WF9L 4DR5K 4DTNA 1N32K 2G8FA 4A61A 4CEQA 4FXDA 4DSLA 3OJUA 1VQNN 3ID8A 4BRAA 1QQMA 3UKRA 4CEFA 4CZLA 4BG8A 3SV4A 1WSGA 1S1WA 3LDOA 4ELTA 1Z25A 3SK3A 2XY6A 3B6OA 4DSEA 4FWQA 1M90O 3LP2A 1ATSA 1VRTA 3OBYA 2A3ZA 3CM5A 1HMVA 2O8BB 4JK8A 3EE8A 4FWKA 2ZD1A 4K43A 2QW9A 1CZ9A 1GLCG 1NK6A 3VQ8A 1RTDA 1GOAA 2X78A 5KGWA 5HRNA 3WXIA 1JL2A 4ILJA 3I0SA 2ZJQL 5AQIA 3VPZA 3BF1A 3THXB 1VQ5N 4JRQA 1ATNA 1X9SA 2VWJA 4LC9B 4C23A 4MDBA 2E8AA 1Z26A 2RF2A 2YJFA 1KRPA 2P9UB 2QA4N 4JD2A 2P9SB 2HMIA 2LSNA 2A1SA 3ENHA 4AHTA 2DFFA 4DU1A 1W7AA 1VQ7N 1Z05A 3V1QA 3S9HA 1LW2A 2D0OA 1C0MA 2HNYA 1KAYA 2F4VK 1MWKA 3C6UA 4MLEA 4JKAA 4JI7K 1VSMA 1HNWK 3ZT2A 3SUNA 1D9DA 3BEXA 4BVOA 1U45A 4JI0K 4M7XA 3MN7A 5C2DA 3OYAA 1G99A 1W9HA 3HRGA 3VETA 4B9TA 2P9KA 2PFUA 1DT9A 2YNGA 4EIAA 3AVIA 2GEMA 3HK2A 1VSHA 3RTVA 2IS3A 2E2QA 3DYAA 4CJUA 4DTRA 4DV6K 1IKXA 2FF6A 3KKRA 1VSFA 4FJ5A 3WUHA 2UUBK 3JS6A 4A2BA 3OYKA 1X1PA 1UWBA 1U49A 4PKHA 5AQYA 2Q36A 1XWLA 4WE1A 3DLBA 2P9NB 1X3MA 3M6GA 3THVA 2G8IA 2WC9A 4BDPA 4LFBK 2BDPA 3W3DA 1B9DA 1NGGA 3CXCM 4W5NA 2WTUA 3THWB 2GELA 4LSNA 1T05A 1LAWA 3OYEA 2YX6A 2HB5A 1X3NA 5AZJA 1LWCA 3QIPA 4C8NA 3U3YA 3VEYA 3AAPA 4KHQA 4KO0A 4RWTA 2KFZA 1DTTA 1P90A 3T1YK 4YNQA 1NGDA 3T69A 4JI5K 5AQXA 3O9QA 4CGDA 3O8MA 1A5VA 3VGKA 4YHHK 1RCHA 4Z4GA 3MX5A 4H5TA 1NKBA 4E19A 3SCXA 1WBBA 1ZBIA 2WFBA 2EX3A 3C6AA 4CZJA 3I8BA 4A57A 3ZX0A 2W40A 1TAQA 4A2AA 3BP8A 2QXLA 3FLCO 1XHZA 1OH6A 4B9UA 2YNIA 4IOCL 2VQEK 2JLEA 1BHLA 4GW6A 3TTCA 4DSJA 1YIJN 3UIQA 3PIOL 4JS5A 3K9JA 1HNXK 3EZWA 2GUPA 2PZSA 1GOBA 3I8DA 2CH6A 1RGIA 4B9MA 4O44A 1Q81O 4A62A 4EZ6A 1SAZA 3QFPA 4I6MA 3D7EO 3K57A 1YXQA 2E20A 4B1UB 3DXKB 3AA2A 3IUCA 3MCAB 3VA0A 5AQZA 3VQEA 3OYHA 5FRMA 4RCHA 3ASMA 4AHUA 5D3GA 1TKDA 5IT9O 1MWMA 4DQSA 3OTOK 1NG9A 5HRPA 3BGRA 1SKWA 4CGJA 4EAHD 2ETJA 4CZMA 1D5AA 4LFCK 5C2FA 1IKYA 3NGIA 2QWMA 4KBOA 3OS0A 4FLZA 4X65K 1U2VB 1K73O 2A6AA 3CFOA 5MLCQ 2HBJA 4JHDA 4MO4A 4O5BA 3C7NA 3IKMA 1L3UA 1QZ5A 4OPKA 4ID5A 1FJGK 1SV5A 3KWIA 3QMLA 2FBTA 1VQON 4H0OA 2HHSA 2AJQA 2CH5A 3RSEB 1BU6O 4NLCA 3HM9A 4FK2A 3KK1A 3V9ZA 3R9PA 2BANA 3ZSZA 1VSKA 4RW9A 4IG3A 1LCUA 4JLHA 1S6PA 4DV2K 2RN2A 2BGGA 5HOOA 3DLRA 2BTFA 2FSJA 3O4NA 4GKKK 1JLBA 3CCQN 3J7AP 3LANA 1K9MO 1ZXOA 3RVCA 1VK0A 4BR4A 4ISEA 4DV0K 4B9QA 4DKWA 1JCEA 3MXMA 1TYQA 3UB5A 3H1VX 3UKRB 4EP4A 4GV9A 1JCFA 1BDGA 4FLUA 3DJCA 3TWHA 2HF3A 4AQYK 1TK0A 1GLDG 3T3FA 3KD1E 1IKVA 3NF8A 3SJHA 4N41A 2KHOA 4IFYA 2ASPA 4DQIA 3F2KA 1J53A 3JSMA 4FJKA 5LL6Z 3V1OA 3ENOA 4CEEA 1VSIA 2VGMA 3CC7N 1B9FA 1QE1A 3WNFA 1XMOK 1BQNA 1JLEA 1GLEG 1Y64A 2QWPA 5CYMA 4Z94A 3O3HA 3AV9A 4DFPA 4YFUA 1WUAA 4WQ5C 3CJBA 3PUFA 4LF4K 4BGAA 5T7BA 2E4LA 4OLAA 4FL9A 2O8BA 4DS4A 1XMQK 4DV5K 3QFUA 4DG1A 3P38A 3VEZA 4AILC 3MN5A 4JI2K 2QKKA 1S1VA 2B4JA 1QQNA 3KLHA 1NNEA 4LH4A 4O8KA 1N34K 3WXLA 5FPDA 4B1XB 5GIOA 1R0AA 5BR8K 4IO9L 1EWRA 1TKZA 4LD0A 3THXA 3L6QA 1S22A 3U9DA 3VEOA 5KPZA 3V9XA 2E5LK 1CLQA 1BL3A 2I7NA 1S9GA 2E1ZA 2HVHA 3O3FA 4CEBA 4DR7K 1YI2N 5FROA 1UA1A 2P9UA 2Q0RA 5GIPA 3C65A 3GG4A 2HHQA 4JKBA 3RMDA 1JLGA 4OPAA 1C0UA 1VSDA 2OYQA 3HPGA 2A42A 2JGUA 4E3SA 3GBTA 3NGZA 4B9SA 3GL1A 4BGBA 1KVCA 3CI5A 5FDLA 1TUYA 3ISNC 4KKOA 1XC9A 3HZ6A 1OH5A 1J5OA 4IEEA 4Z4HA 1WSEA 1TL3A 4E0DA 3HM8A 4UY8O 3FZMA 3HP6A 1NK5A 4M3ZA 3TPQA 3TSQA 4DTMA 3T7ZA 1NGBA 5JS1A 2HBMA 3DLKA 3QEXA 3GOIA 1YJWN 4N56A 3OJSA 2HHUA 3RWUA 1NGHA 4DR4K 2W41A 4WCEL 1RBVA 2PYLA 3U9ZA 2CGLA 1NGFA 2PBDA 4H4MA 2Z1IA 5CE3A 5HL7L 3M8SA 2P9NA 2GX9A 4FWLA 3N4QA 2QTDA 4BWJA 5EY4A 1WNSA 3DRPA 3M1FA 4I2PA 3CHWA 4FPBA 4CJSA 4W5TA 1NK8A 2RPIA 3HP9A 3ZT0A 3THWA 4FJ7A 3MN9A 1QS4A 1WAFA 4QS7A 4YOYA 3PIPL 4KB0A 1TVRA 4GY2B 5CHIA 4AHVA 4NXNK 3E66A 1MA9B 4K0KK 2DFHA 4CE9A 4OPJA 4DV1K 3T1AA 3E01A 4YOWA 4O0IA 4FM1A 1I3AA 4H4OA 1EWQA 2IVNA 3I33A 1YVNA 4H5VA 5JVHL 5ELZA 1HQUA 5J2MA 1T6DA 2HOEA 3TSPA 3CJCA 4M42A 4IJNA 1J9AA 3JXUA 4CFCA 3A5LC 1S1XA 3L4QA 2NRXA 5E41A 4M3WA 3VQ9A 1HNZK 3HSCA 3QETA 4O5FA 4FPAA 4H0YB 3CF5L 1Q9YA 3EO3A 1GLFO 3CM6A 3ZLJA 1YUWA 2OZMA 1OVYA 1T44A 4BC5A 3C6TA 3D0PA 3VN5A 3SAGA 3MEEA 3SLCA 4CJPA 5B8HA 3K58A 1D9FA 1TGOA 4FWNA 3LP3A 2X6NA 1KLNA 4RW4A 2YHWA 2DTUA 5TKYA 2B5JA 4O55A 2NRVA 3QBXA 3LPTA 1RT2A 4WQ5A 1NLVA 3DXKA 5IWAK 3CETA 3AO3A 1SL1A 3AA3A 4DFKA 2F9TA 4O8UA 4GV6A 5KI6A 1E4FT 5EOYA 3H08A 5HBMA 4CFDA 4JHDB 3VTIA 3CPEA 5EX5A 4ILGB 4Q5VA 2EWSA 3C7NB 1KAZA 1WSIA 3B6PA 4CF0A 4FK4A 4IDHA 1U2VA 1VQKN 4CJFA 5JLHA 1T3VA 3ZT4A 4BACA 1QSSA 3FE1A 4BRKA 4NXMK 1P8ZA 5M1QA 3PV8A 3CC2N 4ICLA 1TL1A 4G1QA 3RSEA 1W2BM 4J2AA 4LF9K 3FR0A 4JKEA 5JICA 3O4WA 1XQSC 3L2WA 3ZX3A 3WQTA 5BRFA 4BY9C 3LP1A 1IO2A 2IIRA 1SS6A 4JKCA 1Q7YO 1TYQB 2UUAK 2G8HA 2G8WA 1BWFO 5GAEP 1VQLN 2FBXA 2XO7A 1NKEA 3AGRA 3M5RA 3SMSA 1RBRA 3VQ6A 4V19S 4C8LA 2ITMA 3G0ZA 3TAPA 3AVJA 3V9UA 2X6SA 1C1AA 3CQ8A 3BY5A 4I2QA 4BRLA 3CIPA 2D1KA 3KLFA 2VQFK 4CJ5A 3O3GA 2QI2A 3RMCA 2PYJA 3L2RA 4JKHA 4DQQA 4GVEA 4BRMA 3CCRN 5GAHP 4YY3K 3J7YP 4BRDA 1NK4A 1HQEA 4YOXA 2QXFA 3FZKA 2HBLA 4YORA 1C6VA 4AM6A 3CCMN 3QEIA 3ZSVA 4AHRA 4BRNA 1RBUA 4FJIA 4WQ4C 1IG9A 5TKWA 2DY4A 1Z6RA 1GOCA 2UXCK 4CZKA 3V4IA 1WLJA 1VQMN 3O6WA 4FM2A 1DGKN 2VYPA 5J2PA 3OYCA 1JXEA 1QZ6A 4PKIA 1NGCA 4PL8A 3CCVN 3DXMB 1HKCA 1X9MA 3AO1A 3S3MA 4M3UA 4H5NA 1GLBG 3H6EA 3SBTA 3EE9A 5E84A 5FPEA 4A5BA 2ASOA 2GUIA 4GKJK 3A5NC 4PQUA 3VA3A 1RDBA 1HYSA 4RTFD 1WAJA 5KPTA 4FO0A 3CCLN 4BQZA 4DUZK 3J7ZO 3B8AX 4C8OA 5HROA 4DS5A 3HSTB 5LMNK 4I9QA 4ISGA 3IMXA 4AHCA 4W5RA 4B1ZA 3QIOA 4F9OA 4B8CA 4CECA 2Q31A 3CCEN 2HHVA 1KVBA 5DK5A 3HVRA 1BO5O 4XH1A 5M1PA 1NGEA 4BRCA 2YJEA 3DOLA 1K8KB 4M63C 4KRFA 1HNIA 3ID6A 4ZTFA 1HKBA 4JK7A 4DF4A 4L3QA 3ZSYA 4CHQA 2P5OA 4QAGA 3O9SA 2KLAA 2O4GA 3MDQA 5CR4A 3I0RA 4M3TA 3DLEA 1RTJA 4JK9A 1BISA 1BG3A 3TTFA 4CZEA 3DLHA 4RG8A 3SAFA 3AO5A 4LF5K 1YTUA 3K5NA 1YITN 3TTDA 4CD1A 4CERA 4CHYA 1KSPA 4E7KA 3QDKA 3MXJA 1SZ2A 3QESA 4KPYA 4KV8A 3DLGA 5AQTA 3NFAA 3N4PA 5AZIB 5KRTA 2VG6A 2CGKA 3WT0A 3E9PA 3NAEA 4A59A 3G71N 4DV7K 4JAXA 4X66K 4FJJA 2QWRA 3NH0A 2AP1A 3AVHA 1OVQA 4K42A 1X9WA 3H46O 3V9SA 3LDNA 4BC4A 4ZTJA 1HX1A 3IFRA 4FOIA 1QTMA 2VWBA 4CJVA 3EKSA 4IFVA 1YVUA 4DMNA 1C0FA 3RMAA 1JJ2M 2HNZA 3SUOA 3VQ7A 4AM7A 2KKZA 4GVMA 1VQ4N 1KD1O 3MEDA 2D5RA 2FXUA 4JKFA 3OYDA 2ZQBA 2UYTA 1RFQA 3BZKA 1UA0A 2JWLA 1YF5L 3QNOA 4B8AB 3G10A 4FJLA 4CK2A 4ELVA 4LF8K 1UAXA 4FWRA 4BR7A 4M3RA 5GINA 1NOZA 5F1XA 1REVA 1F21A 2ZJRL 3THYB 1KC8O 3HBTA 3IG1A 5AQMA 1W0HA 4KHYA 1NJZA 4FOEA 1SUQA 3QEVA 3SAHA 4B08A 4YDUC 4HCBA 4KH5A 3LWLA 3K9KA 3AARA 3SBGA 3O9UA 4FJ8A 4WQ4A 2YNFA 4BRHA 5AQGA 1RT5A 1T6CA 1G15A 2XY7A 2YKNA 3HL8A 1HLUA 2W6KA 5M1NA 4CBXA 2OPSA 1RDCA 3SQ4A 2Z1JA 3FZLA 3SMPA 4CFBA 4KHNA 1YT3A 2DFEA 3A2FA 1NKCA 4FJHA 4DV4K 3RRGA 1Q86O 3W0LA 1RDWX 2GTDA 3DOKA 1BGXT 3D45A 1S1TA 4BWMA 4ZHRA 1HRHA 1IV0A 3VENA 4DR1K 1FXXA 1VQPN 1J5EK 3A5OC 5AR0A 3FGUA 4FJ9A 4FZZA 2YHAA 2X74A 3R1XA 1NJXA 1O13A 3F5TA 3CFRA 1J6ZA 2I7PA 4OGEA 3NBPA 3S41A 3CMAN 4FK0A 1ZC6A 4Y1DA 4B1YB 3L2UA 2HNDA 4FYDA 4BDZA 3K5LA 1N6QA 3L3UA 4N5SA 4IJAA 1CXQA 5BRDA 1KFDA 3ZSQA 1VQ8N 3CMEN 3C95A 3OYMA 4DTJA 4QCLA 4CFAA 3OYFA 4H5RA 3JYTA 3EZ5A 2KW4A 3K5OA 4BC3A 4CF2A 4A5AA 3O80A 3PX0A 4HTUA 3TAMA 3KIOA 3NVKA 1SQKA 4CBWA
chains in the Genus database with same CATH topology
1VRTA 4M3WA 3VQ9A 1N5YA 5HP1A 4BE0A 3CM5A 1HMVA 1KTQA 1T8EA 4LY7A 1ASUA 2Y1JA 2IDOA 3QETA 2ZD1A 2YHBA 4DTXA 2WOMA 5DMRA 4AHSA 4CEAA 3KK3A 1CZ9A 3K2PA 2ITGA 1S5JA 1NK6A 1Q9YA 1YTAA 4HVJA 3CFPA 3VQ8A 1RTDA 1GOAA 2X78A 4B9NA 5KGWA 5HRNA 3CM6A 4I7FA 3ULDA 1A5XA 1ZYQA 2OZMA 1JL2A 3C6TA 3I0SA 4AH9A 3D0PA 4CEOA 4CK3A 3VN5A 4JRQA 3MEEA 1NOYA 3AO4A 1Q9XA 2XRIA 1X9SA 4CJPA 4C8KA 2VWJA 4B9LA 3MAQA 1J54A 1Z26A 3K58A 1D9FA 2KQ2A 1TGOA 4HUEA 3LP3A 1JLQA 2RF2A 2X6NA 4CGGA 2HHXA 1BCOA 4OGCA 5HLFA 4RW4A 1KLNA 1KRPA 1FKPA 1IKWA 4FJNA 1B92A 2LSNA 2A1SA 3QO9A 2HMIA 2DTUA 3HT3A 4AHTA 5KTQA 2B5JA 2ATQA 2DFFA 4BDYA 4O55A 4DU1A 1EX4A 3V1QA 3S9HA 1LW2A 4IKFA 3LPTA 1C0MA 1KCFA 1RT2A 2GBZA 2HNYA 3C6UA 1SL1A 3AO3A 1VSMA 3AA3A 4FLXA 4DFKA 4K8XA 3KLGA 2HHWA 3ZT2A 1HYVA 3AVFA 5J2QA 3SUNA 4N47A 3AVLA 3AVAA 3NE6A 1RT7A 1D9DA 4FM0A 4DQRA 1U45A 5KI6A 4OKEA 3MEGA 3H08A 2BE2A 4E7JA 3OYAA 4F3OA 1W9HA 5HBMA 4CFDA 3PO5A 4B9TA 2YNGA 4Q5VA 1S1UA 3CYMA 3TR8A 3AVIA 1RT3A 3TAGA 1WSIA 3B6PA 1SL2A 4CF0A 4FK4A 1BIZA 3HK2A 1VSHA 1JKHA 1Y97A 2IS3A 3RTVA 5CYQA 4CESA 3DYAA 3KK2A 4CJUA 2B6AA 4DTRA 4CJFA 3VQBA 3ZT4A 4BACA 3SV3A 3LAMA 1QSSA 1IKXA 4O0JA 5JS2A 3RR8A 3KKRA 1ITGA 1VSFA 3KKSA 4CJWA 3PV8A 4CJLA 4FJ5A 1SL0A 4FW2A 4ICLA 4QOZB 1TL1A 1WN7A 3OYKA 1X1PA 5CY4A 1RBTA 4DSKA 1TAUA 1UWBA 4G1QA 2KZMA 4J2AA 5KRSA 2F8SA 1RT1A 4HUFA 3L2WA 1U49A 4JS4A 5FRNA 1XWLA 2NUBA 1T03A 4WE1A 3OYNA 4FCYA 3SI6A 3DLBA 3THVA 1DLOA 3KLIA 2G8IA 4BDPA 3OYBA 3LP1A 2KTQA 3OYIA 1IO2A 3M8QA 1UOCA 3HXMA 3NCIA 2BDPA 1B9DA 2G8HA 2G8WA 3KD5E 4ELUA 2E6LA 4W5NA 4DTUA 3L2VA 1LV5A 2FBXA 3ZSOA 3WNHA 4NCBA 4LSNA 1T05A 2HVIA 1LAWA 2XO7A 1NKEA 4Y1CA 4FLVA 3MECA 3TAEA 2GV9A 4CHZA 1CXUA 3HPOA 3OYEA 3VQ6A 1RBRA 2HB5A 4CEDA 2P5GA 1KLMA 4C8LA 1TKXA 1JXBA 3G0ZA 3TAPA 3QINA 3AVJA 4NYFA 3V9UA 1LWCA 3QIPA 2X6SA 1C1AA 4C8NA 3U3YA 3CQ8A 4I2QA 3NHGA 1RT6A 3AVNA 4KHQA 1QSYA 3DM2A 4KO0A 2KFZA 2EHGA 1DTTA 5J2NA 3KLFA 1JL1A 4YNQA 1I39A 4KTWA 3AVGA 3ZT3A 3AVKA 4CGDA 4CJ5A 4FW1A 3VQ5A 3O3GA 4DF8A 4CJTA 1A5VA 3RMCA 1NK7A 2PY5A 2PYJA 1RCHA 3L2RA 4Z4GA 3LALA 1NKBA 3S3NA 4DQQA 4EZ9A 3C94A 2YNHA 3LZIA 4ID1A 2VWKA 4E19A 5C25A 3EYZA 4E1MA 3SCXA 1ZBIA 1NK4A 2EX3A 1HQEA 4F3TA 1BI4B 4KFBA 2QXFA 5I3UA 4TSXA 4F8RA 3HJFA 3DMJA 1C6VA 1TAQA 2XY8A 3CG7A 3QEIA 4CCHA 3P5JA 3ZSVA 4AHRA 1XHZA 4B9UA 1RBUA 4FJIA 2YNIA 4FLTA 2OPPA 4CIGA 2P1JA 2JLEA 1BHLA 5K14A 4GW6A 1IG9A 3PX6A 1HNVA 3QERA 4DSJA 2DY4A 4M3XA 1WSJA 1GOCA 4OKKA 3UIQA 3V4IA 1WLJA 2Y1IA 1RTIA 4JS5A 2G8UA 4FM2A 1VSLA 4KI6A 3VQCA 4NCGA 5J2PA 3OYCA 1WSHA 4DTSA 4KHUA 4Z0UA 1GOBA 1FKOA 1JXEA 2PZSA 1RDAA 3I8DA 1BQMA 1HPZA 2RKIA 1NJYA 4O44A 4B9MA 1RT4A 5SWMA 4EZ6A 2F96A 1X9MA 3AO1A 3S3MA 3K57A 4M3UA 1O1WA 2HHTA 4OKJA 3AA2A 3VA0A 5FRMA 3VQEA 3OYHA 4DSFA 3V81A 4RW8A 2FBVA 3ASMA 3OYGA 3SQ1A 3IAYA 4AHUA 5D3GA 1TKDA 4DQSA 4CJ4A 3K59A 2GUIA 3BGRA 5HRPA 3V6DA 3OYJA 1SKWA 3K5MA 3ZSXA 4CGJA 2ETJA 3NF7A 1L5UA 3VA3A 2FBYA 4DU4A 3ZT1A 4PQUA 1RDBA 3NF6A 1HYSA 1D5AA 1SKSA 1L3SA 1WAJA 1IKYA 3AVCA 3DRSA 4W5QA 3NGIA 1HYZA 4C8MA 4BE1A 4FVMA 4DTOA 3OS0A 4FLZA 1ASWA 3VQQA 3SQ2A 3M8RA 1U47A 4NCAA 4Z4CA 1DTQA 2Q3SA 3CFOA 4CJ3A 3TABA 4C8OA 5HROA 5EU7A 4DS5A 3HSTB 4DFMA 4O5BA 4I9QA 4CF8A 3HO1A 3ITHA 1NK9A 4FLYA 3NH1A 4CGHA 4AHCA 1NK0A 4W5RA 4OPKA 1L3UA 1K6YA 3LZJA 4HCCA 3RR7A 4ID5A 1TV6A 3QIOA 1SV5A 4B8CA 4CECA 1C0TA 2FBTA 2QKBA 1RDDA 2HHSA 4LH5A 2HHVA 5SZTA 1KVBA 2AJQA 1EXQA 3RMBA 4B3OA 4CGIA 5DK5A 3HM9A 1XI1A 3KK1A 3V9ZA 4FK2A 3HVRA 1C1BA 3M8PA 4FJMA 3IS9A 1EKEA 3O4QA 3LAKA 3TAQA 2BANA 4O4GA 3DOLA 3IRXA 3ZSZA 4BE2A 4KRFA 1VSKA 4RW9A 4E7LA 1HNIA 4IG3A 4ZTFA 2A1RA 3DI6A 4JLHA 1QHTA 2ZE2A 1S6PA 3F9KA 4CIFA 4DF4A 3ZSYA 4CHQA 2P5OA 2RN2A 4QAGA 2WONA 2BGGA 2Z1HA 2O4GA 3DLRA 3MXIA 4CJEA 2KFNA 3QEPA 3SYZA 3OVNA 3O4NA 2VG7A 1JLBA 3I0RA 4M3TA 3DLEA 2QK9A 4PWDA 1RTJA 1BISA 3DLHA 3TAFA 5KGXA 3LANA 2IC3A 1VK0A 5E41A 4DTPA 1RTHA 4RG8A 3AO5A 1YTUA 4FLWA 2P51A 3K5NA 4DQPA 4KTQA 2IOCA 2XY5A 3MXMA 4H8KA 4FZXC 4CERA 3AO2A 3HVTA 4EP4A 4CHYA 1KSPA 4F2SA 4L8RB 1A5WA 4FLUA 4E7KA 4OVLA 3TWHA 3TARA 3MXJA 3QESA 1TK0A 5HRRA 4Z4FA 4KPYA 4KV8A 3VQ4A 3DLGA 4F2RA 3NFAA 1L3VA 2D0BA 3KLEA 3T3FA 3KD1E 1IKVA 3NF8A 2VG6A 5KRTA 4KREA 4PA1A 3TI0A 4CIEA 4N41A 4IFYA 4KTZA 3TANA 3NAEA 4IDKA 4DQIA 1VRUA 5J1EA 1J53A 4KAZA 3JSMA 4M3YA 4FJKA 3AVBA 4GMJB 1S6QA 1RNHA 3V1OA 3PY8A 3NH0A 3QEWA 3V1RA 4FJJA 3AVHA 4B9VA 3U6FA 1JLAA 3AA4A 1KFSA 4CEEA 1VSIA 4DLEA 1B9FA 4CJKA 3SPZA 1QE1A 3WNFA 1X9WA 1BQNA 1JLEA 3HPHA 4CF1A 3V9SA 4HHTA 1LWFA 5CYMA 3HYFA 4ZTJA 3O3HA 1Q8IA 1MU2A 3AV9A 4DFPA 4R5PA 4YFUA 5I42A 1QTMA 1VSEA 3PUFA 2FC0A 3WNEA 4J2DA 5T7BA 2E4LA 4CJVA 4PUOA 4OLAA 4IFVA 4DMNA 1YVUA 3OY9A 3NGYA 4DS4A 4W5OA 4KI4A 1D8YA 3RMAA 4OJRA 4DG1A 3ZCMA 1ZBFA 4AILC 4CJQA 2HNZA 3SUOA 3VQ7A 2OA8A 1BI4A 5C42A 1JLFA 2QKKA 1RBSA 1S1VA 4GVMA 2B4JA 4M45A 4CGFA 3KLHA 3MEDA 4LH4A 3KJVA 2D5RA 2HW3A 3OYDA 2ZQBA 1UA0A 3VQAA 3ZSRA 1R0AA 4DSIA 2IGIA 4K8ZA 1TKZA 4LD0A 1U04A 1VSJA 3ZSWA 2OPRA 3V9XA 1CLQA 3NF9A 3QLHA 1LW0A 3QNOA 4B8AB 3G10A 3LPUA 1XHXA 4FJLA 3LWMA 1BL3A 4CK2A 1S9GA 4ELVA 3VQPA 3OYLA 2HVHA 2KZZA 3O3FA 1UAXA 4CEBA 4KHWA 4M41A 4M3RA 3L2QA 1NOZA 1ASVA 5FROA 1UA1A 3FFIA 1T7PA 1REVA 2OZSA 1EP4A 2HHQA 1F21A 4Z4IA 5CZ2A 3RMDA 1ZBUA 1JLGA 3KTQA 1C0UA 3IG1A 3AA5X 4RW7A 1RILA 1W0HA 1VSDA 2OYQA 4KHYA 5CZ1A 4OLBA 1NJZA 3HPGA 2W42A 3SJJA 1SUQA 3LDSA 4EP5A 3QEVA 3S3OA 2JGUA 3V9WA 1NJWA 4B08A 4E3SA 3NGZA 3EY1A 4HCBA 4E89A 4CJRA 4B9SA 5C24A 3LWLA 2G8VA 2Z1GA 3LP0A 4DU3A 4CHPA 1KVCA 3AVMA 4FJ8A 3DRRA 2YNFA 1TKTA 5FDLA 2IAJA 3ISNC 4KKOA 1RT5A 3ALYA 4E7IA 1G15A 3SNNA 2XY7A 2YKNA 1XC9A 1SKRA 3HL8A 2D0AA 3BDPA 1ZBLA 3WNGA 2E6MA 1J5OA 4F4KA 2OPSA 4Z4HA 1WSEA 1TL3A 3SUQA 4E0DA 3OS2A 1C1CA 1RDCA 3SQ4A 2Z1JA 4CHNA 4E7HA 3HP6A 1NK5A 4CFBA 4KHNA 2D0CA 4IBNA 1L3TA 4M3ZA 4DTMA 1BIUA 1JLCA 4N76A 4IG0A 1YT3A 4I9LA 1U48A 2DFEA 2OPQA 3L8BA 5JS1A 3DLKA 3QEXA 3A2FA 4NYNA 3VQDA 1NKCA 4MFBA 1U4BA 2G8KA 4FJHA 4CEZA 2I5JA 4N56A 1WSFA 2R7YA 3OJSA 3RRGA 1LAVA 2HHUA 3SUPA 3DOKA 1BGXT 3D45A 4MQ3A 4HUGA 3RRHA 3RWUA 1S1TA 4BWMA 4UQGA 4ZHRA 4J2BA 1RBVA 1HRHA 1S9EA 1BCMA 2PYLA 3NDKA 3OS1A 3F73A 3PO4A 3P83D 1QQCA 4H4MA 3QNNA 3SPYA 2Z1IA 1FXXA 3M8SA 1EETA 4FZZA 4FJ9A 4DFJA 2YHAA 1IH7A 2X74A 4KB1A 4FZYA 4BWJA 1NJXA 2YKMA 1HJRA 4CF9A 2VG5A 3P1GA 1WNSA 3DRPA 3PX4A 4I2PA 1LWEA 4LSLA 4DLGA 4W5TA 4CJSA 3SQ0A 1NK8A 3CFRA 2RPIA 3HP9A 3ZT0A 3L3VA 4FJ7A 4OGEA 1QS4A 3NBPA 1CZBA 1WAFA 4DTNA 3SZ2A 3NH2A 4XIUA 4FK0A 4Y1DA 4KB0A 2G8FA 1TVRA 1TK5A 3L2UA 5HRSA 2HNDA 4FYDA 4CEQA 2F8TA 1ZBHA 4BDZA 3K5LA 1N6QA 3L3UA 4AHVA 4N5SA 1CXQA 3OJUA 4DSLA 4FJGA 4J2EA 1KVAA 4FXDA 1KFDA 4E1NA 3ZSQA 2DFHA 4KHSA 4CHOA 4CEFA 4CE9A 4OPJA 3C95A 3T1AA 3E01A 3OYMA 4O0IA 4FM1A 4DTJA 1I3AA 4H4OA 1FK9A 4QCLA 3SV4A 1WSGA 1S1WA 4CFAA 4CK1A 3T19A 3OYFA 4PY5A 4ELTA 1TK8A 4FJXA 4Z4EA 3U3GA 3EZ5A 3JYTA 2KW4A 1HQUA 2O4IA 1Z25A 2XY6A 2YV0X 3K5OA 3B6OA 5J2MA 4CF2A 4DSEA 2XHBA 3PX0A 4HTUA 1QSLA 4DWIA 4RW6A 3KIOA 3TAMA 4Q0BA 4M42A 3LP2A 4CFCA 1J9AA 4JRPA 1S1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRT A;  4M3W A;  3VQ9 A;  1N5Y A;  5HP1 A;  4BE0 A;  3CM5 A;  1HMV A;  1KTQ A;  1T8E A;  4LY7 A;  1ASU A;  2Y1J A;  2IDO A;  3QET A;  2ZD1 A;  2YHB A;  4DTX A;  2WOM A;  5DMR A;  4AHS A;  4CEA A;  3KK3 A;  1CZ9 A;  3K2P A;  2ITG A;  1S5J A;  1NK6 A;  1Q9Y A;  1YTA A;  4HVJ A;  3CFP A;  3VQ8 A;  1RTD A;  1GOA A;  2X78 A;  4B9N A;  5KGW A;  5HRN A;  3CM6 A;  4I7F A;  3ULD A;  1A5X A;  1ZYQ A;  2OZM A;  1JL2 A;  3C6T A;  3I0S A;  4AH9 A;  3D0P A;  4CEO A;  4CK3 A;  3VN5 A;  4JRQ A;  3MEE A;  1NOY A;  3AO4 A;  1Q9X A;  2XRI A;  1X9S A;  4CJP A;  4C8K A;  2VWJ A;  4B9L A;  3MAQ A;  1J54 A;  1Z26 A;  3K58 A;  1D9F A;  2KQ2 A;  1TGO A;  4HUE A;  3LP3 A;  1JLQ A;  2RF2 A;  2X6N A;  4CGG A;  2HHX A;  1BCO A;  4OGC A;  5HLF A;  4RW4 A;  1KLN A;  1KRP A;  1FKP A;  1IKW A;  4FJN A;  1B92 A;  2LSN A;  2A1S A;  3QO9 A;  2HMI A;  2DTU A;  3HT3 A;  4AHT A;  5KTQ A;  2B5J A;  2ATQ A;  2DFF A;  4BDY A;  4O55 A;  4DU1 A;  1EX4 A;  3V1Q A;  3S9H A;  1LW2 A;  4IKF A;  3LPT A;  1C0M A;  1KCF A;  1RT2 A;  2GBZ A;  2HNY A;  3C6U A;  1SL1 A;  3AO3 A;  1VSM A;  3AA3 A;  4FLX A;  4DFK A;  4K8X A;  3KLG A;  2HHW A;  3ZT2 A;  1HYV A;  3AVF A;  5J2Q A;  3SUN A;  4N47 A;  3AVL A;  3AVA A;  3NE6 A;  1RT7 A;  1D9D A;  4FM0 A;  4DQR A;  1U45 A;  5KI6 A;  4OKE A;  3MEG A;  3H08 A;  2BE2 A;  4E7J A;  3OYA A;  4F3O A;  1W9H A;  5HBM A;  4CFD A;  3PO5 A;  4B9T A;  2YNG A;  4Q5V A;  1S1U A;  3CYM A;  3TR8 A;  3AVI A;  1RT3 A;  3TAG A;  1WSI A;  3B6P A;  1SL2 A;  4CF0 A;  4FK4 A;  1BIZ A;  3HK2 A;  1VSH A;  1JKH A;  1Y97 A;  2IS3 A;  3RTV A;  5CYQ A;  4CES A;  3DYA A;  3KK2 A;  4CJU A;  2B6A A;  4DTR A;  4CJF A;  3VQB A;  3ZT4 A;  4BAC A;  3SV3 A;  3LAM A;  1QSS A;  1IKX A;  4O0J A;  5JS2 A;  3RR8 A;  3KKR A;  1ITG A;  1VSF A;  3KKS A;  4CJW A;  3PV8 A;  4CJL A;  4FJ5 A;  1SL0 A;  4FW2 A;  4ICL A;  4QOZ B;  1TL1 A;  1WN7 A;  3OYK A;  1X1P A;  5CY4 A;  1RBT A;  4DSK A;  1TAU A;  1UWB A;  4G1Q A;  2KZM A;  4J2A A;  5KRS A;  2F8S A;  1RT1 A;  4HUF A;  3L2W A;  1U49 A;  4JS4 A;  5FRN A;  1XWL A;  2NUB A;  1T03 A;  4WE1 A;  3OYN A;  4FCY A;  3SI6 A;  3DLB A;  3THV A;  1DLO A;  3KLI A;  2G8I A;  4BDP A;  3OYB A;  3LP1 A;  2KTQ A;  3OYI A;  1IO2 A;  3M8Q A;  1UOC A;  3HXM A;  3NCI A;  2BDP A;  1B9D A;  2G8H A;  2G8W A;  3KD5 E;  4ELU A;  2E6L A;  4W5N A;  4DTU A;  3L2V A;  1LV5 A;  2FBX A;  3ZSO A;  3WNH A;  4NCB A;  4LSN A;  1T05 A;  2HVI A;  1LAW A;  2XO7 A;  1NKE A;  4Y1C A;  4FLV A;  3MEC A;  3TAE A;  2GV9 A;  4CHZ A;  1CXU A;  3HPO A;  3OYE A;  3VQ6 A;  1RBR A;  2HB5 A;  4CED A;  2P5G A;  1KLM A;  4C8L A;  1TKX A;  1JXB A;  3G0Z A;  3TAP A;  3QIN A;  3AVJ A;  4NYF A;  3V9U A;  1LWC A;  3QIP A;  2X6S A;  1C1A A;  4C8N A;  3U3Y A;  3CQ8 A;  4I2Q A;  3NHG A;  1RT6 A;  3AVN A;  4KHQ A;  1QSY A;  3DM2 A;  4KO0 A;  2KFZ A;  2EHG A;  1DTT A;  5J2N A;  3KLF A;  1JL1 A;  4YNQ A;  1I39 A;  4KTW A;  3AVG A;  3ZT3 A;  3AVK A;  4CGD A;  4CJ5 A;  4FW1 A;  3VQ5 A;  3O3G A;  4DF8 A;  4CJT A;  1A5V A;  3RMC A;  1NK7 A;  2PY5 A;  2PYJ A;  1RCH A;  3L2R A;  4Z4G A;  3LAL A;  1NKB A;  3S3N A;  4DQQ A;  4EZ9 A;  3C94 A;  2YNH A;  3LZI A;  4ID1 A;  2VWK A;  4E19 A;  5C25 A;  3EYZ A;  4E1M A;  3SCX A;  1ZBI A;  1NK4 A;  2EX3 A;  1HQE A;  4F3T A;  1BI4 B;  4KFB A;  2QXF A;  5I3U A;  4TSX A;  4F8R A;  3HJF A;  3DMJ A;  1C6V A;  1TAQ A;  2XY8 A;  3CG7 A;  3QEI A;  4CCH A;  3P5J A;  3ZSV A;  4AHR A;  1XHZ A;  4B9U A;  1RBU A;  4FJI A;  2YNI A;  4FLT A;  2OPP A;  4CIG A;  2P1J A;  2JLE A;  1BHL A;  5K14 A;  4GW6 A;  1IG9 A;  3PX6 A;  1HNV A;  3QER A;  4DSJ A;  2DY4 A;  4M3X A;  1WSJ A;  1GOC A;  4OKK A;  3UIQ A;  3V4I A;  1WLJ A;  2Y1I A;  1RTI A;  4JS5 A;  2G8U A;  4FM2 A;  1VSL A;  4KI6 A;  3VQC A;  4NCG A;  5J2P A;  3OYC A;  1WSH A;  4DTS A;  4KHU A;  4Z0U A;  1GOB A;  1FKO A;  1JXE A;  2PZS A;  1RDA A;  3I8D A;  1BQM A;  1HPZ A;  2RKI A;  1NJY A;  4O44 A;  4B9M A;  1RT4 A;  5SWM A;  4EZ6 A;  2F96 A;  1X9M A;  3AO1 A;  3S3M A;  3K57 A;  4M3U A;  1O1W A;  2HHT A;  4OKJ A;  3AA2 A;  3VA0 A;  5FRM A;  3VQE A;  3OYH A;  4DSF A;  3V81 A;  4RW8 A;  2FBV A;  3ASM A;  3OYG A;  3SQ1 A;  3IAY A;  4AHU A;  5D3G A;  1TKD A;  4DQS A;  4CJ4 A;  3K59 A;  2GUI A;  3BGR A;  5HRP A;  3V6D A;  3OYJ A;  1SKW A;  3K5M A;  3ZSX A;  4CGJ A;  2ETJ A;  3NF7 A;  1L5U A;  3VA3 A;  2FBY A;  4DU4 A;  3ZT1 A;  4PQU A;  1RDB A;  3NF6 A;  1HYS A;  1D5A A;  1SKS A;  1L3S A;  1WAJ A;  1IKY A;  3AVC A;  3DRS A;  4W5Q A;  3NGI A;  1HYZ A;  4C8M A;  4BE1 A;  4FVM A;  4DTO A;  3OS0 A;  4FLZ A;  1ASW A;  3VQQ A;  3SQ2 A;  3M8R A;  1U47 A;  4NCA A;  4Z4C A;  1DTQ A;  2Q3S A;  3CFO A;  4CJ3 A;  3TAB A;  4C8O A;  5HRO A;  5EU7 A;  4DS5 A;  3HST B;  4DFM A;  4O5B A;  4I9Q A;  4CF8 A;  3HO1 A;  3ITH A;  1NK9 A;  4FLY A;  3NH1 A;  4CGH A;  4AHC A;  1NK0 A;  4W5R A;  4OPK A;  1L3U A;  1K6Y A;  3LZJ A;  4HCC A;  3RR7 A;  4ID5 A;  1TV6 A;  3QIO A;  1SV5 A;  4B8C A;  4CEC A;  1C0T A;  2FBT A;  2QKB A;  1RDD A;  2HHS A;  4LH5 A;  2HHV A;  5SZT A;  1KVB A;  2AJQ A;  1EXQ A;  3RMB A;  4B3O A;  4CGI A;  5DK5 A;  3HM9 A;  1XI1 A;  3KK1 A;  3V9Z A;  4FK2 A;  3HVR A;  1C1B A;  3M8P A;  4FJM A;  3IS9 A;  1EKE A;  3O4Q A;  3LAK A;  3TAQ A;  2BAN A;  4O4G A;  3DOL A;  3IRX A;  3ZSZ A;  4BE2 A;  4KRF A;  1VSK A;  4RW9 A;  4E7L A;  1HNI A;  4IG3 A;  4ZTF A;  2A1R A;  3DI6 A;  4JLH A;  1QHT A;  2ZE2 A;  1S6P A;  3F9K A;  4CIF A;  4DF4 A;  3ZSY A;  4CHQ A;  2P5O A;  2RN2 A;  4QAG A;  2WON A;  2BGG A;  2Z1H A;  2O4G A;  3DLR A;  3MXI A;  4CJE A;  2KFN A;  3QEP A;  3SYZ A;  3OVN A;  3O4N A;  2VG7 A;  1JLB A;  3I0R A;  4M3T A;  3DLE A;  2QK9 A;  4PWD A;  1RTJ A;  1BIS A;  3DLH A;  3TAF A;  5KGX A;  3LAN A;  2IC3 A;  1VK0 A;  5E41 A;  4DTP A;  1RTH A;  4RG8 A;  3AO5 A;  1YTU A;  4FLW A;  2P51 A;  3K5N A;  4DQP A;  4KTQ A;  2IOC A;  2XY5 A;  3MXM A;  4H8K A;  4FZX C;  4CER A;  3AO2 A;  3HVT A;  4EP4 A;  4CHY A;  1KSP A;  4F2S A;  4L8R B;  1A5W A;  4FLU A;  4E7K A;  4OVL A;  3TWH A;  3TAR A;  3MXJ A;  3QES A;  1TK0 A;  5HRR A;  4Z4F A;  4KPY A;  4KV8 A;  3VQ4 A;  3DLG A;  4F2R A;  3NFA A;  1L3V A;  2D0B A;  3KLE A;  3T3F A;  3KD1 E;  1IKV A;  3NF8 A;  2VG6 A;  5KRT A;  4KRE A;  4PA1 A;  3TI0 A;  4CIE A;  4N41 A;  4IFY A;  4KTZ A;  3TAN A;  3NAE A;  4IDK A;  4DQI A;  1VRU A;  5J1E A;  1J53 A;  4KAZ A;  3JSM A;  4M3Y A;  4FJK A;  3AVB A;  4GMJ B;  1S6Q A;  1RNH A;  3V1O A;  3PY8 A;  3NH0 A;  3QEW A;  3V1R A;  4FJJ A;  3AVH A;  4B9V A;  3U6F A;  1JLA A;  3AA4 A;  1KFS A;  4CEE A;  1VSI A;  4DLE A;  1B9F A;  4CJK A;  3SPZ A;  1QE1 A;  3WNF A;  1X9W A;  1BQN A;  1JLE A;  3HPH A;  4CF1 A;  3V9S A;  4HHT A;  1LWF A;  5CYM A;  3HYF A;  4ZTJ A;  3O3H A;  1Q8I A;  1MU2 A;  3AV9 A;  4DFP A;  4R5P A;  4YFU A;  5I42 A;  1QTM A;  1VSE A;  3PUF A;  2FC0 A;  3WNE A;  4J2D A;  5T7B A;  2E4L A;  4CJV A;  4PUO A;  4OLA A;  4IFV A;  4DMN A;  1YVU A;  3OY9 A;  3NGY A;  4DS4 A;  4W5O A;  4KI4 A;  1D8Y A;  3RMA A;  4OJR A;  4DG1 A;  3ZCM A;  1ZBF A;  4AIL C;  4CJQ A;  2HNZ A;  3SUO A;  3VQ7 A;  2OA8 A;  1BI4 A;  5C42 A;  1JLF A;  2QKK A;  1RBS A;  1S1V A;  4GVM A;  2B4J A;  4M45 A;  4CGF A;  3KLH A;  3MED A;  4LH4 A;  3KJV A;  2D5R A;  2HW3 A;  3OYD A;  2ZQB A;  1UA0 A;  3VQA A;  3ZSR A;  1R0A A;  4DSI A;  2IGI A;  4K8Z A;  1TKZ A;  4LD0 A;  1U04 A;  1VSJ A;  3ZSW A;  2OPR A;  3V9X A;  1CLQ A;  3NF9 A;  3QLH A;  1LW0 A;  3QNO A;  4B8A B;  3G10 A;  3LPU A;  1XHX A;  4FJL A;  3LWM A;  1BL3 A;  4CK2 A;  1S9G A;  4ELV A;  3VQP A;  3OYL A;  2HVH A;  2KZZ A;  3O3F A;  1UAX A;  4CEB A;  4KHW A;  4M41 A;  4M3R A;  3L2Q A;  1NOZ A;  1ASV A;  5FRO A;  1UA1 A;  3FFI A;  1T7P A;  1REV A;  2OZS A;  1EP4 A;  2HHQ A;  1F21 A;  4Z4I A;  5CZ2 A;  3RMD A;  1ZBU A;  1JLG A;  3KTQ A;  1C0U A;  3IG1 A;  3AA5 X;  4RW7 A;  1RIL A;  1W0H A;  1VSD A;  2OYQ A;  4KHY A;  5CZ1 A;  4OLB A;  1NJZ A;  3HPG A;  2W42 A;  3SJJ A;  1SUQ A;  3LDS A;  4EP5 A;  3QEV A;  3S3O A;  2JGU A;  3V9W A;  1NJW A;  4B08 A;  4E3S A;  3NGZ A;  3EY1 A;  4HCB A;  4E89 A;  4CJR A;  4B9S A;  5C24 A;  3LWL A;  2G8V A;  2Z1G A;  3LP0 A;  4DU3 A;  4CHP A;  1KVC A;  3AVM A;  4FJ8 A;  3DRR A;  2YNF A;  1TKT A;  5FDL A;  2IAJ A;  3ISN C;  4KKO A;  1RT5 A;  3ALY A;  4E7I A;  1G15 A;  3SNN A;  2XY7 A;  2YKN A;  1XC9 A;  1SKR A;  3HL8 A;  2D0A A;  3BDP A;  1ZBL A;  3WNG A;  2E6M A;  1J5O A;  4F4K A;  2OPS A;  4Z4H A;  1WSE A;  1TL3 A;  3SUQ A;  4E0D A;  3OS2 A;  1C1C A;  1RDC A;  3SQ4 A;  2Z1J A;  4CHN A;  4E7H A;  3HP6 A;  1NK5 A;  4CFB A;  4KHN A;  2D0C A;  4IBN A;  1L3T A;  4M3Z A;  4DTM A;  1BIU A;  1JLC A;  4N76 A;  4IG0 A;  1YT3 A;  4I9L A;  1U48 A;  2DFE A;  2OPQ A;  3L8B A;  5JS1 A;  3DLK A;  3QEX A;  3A2F A;  4NYN A;  3VQD A;  1NKC A;  4MFB A;  1U4B A;  2G8K A;  4FJH A;  4CEZ A;  2I5J A;  4N56 A;  1WSF A;  2R7Y A;  3OJS A;  3RRG A;  1LAV A;  2HHU A;  3SUP A;  3DOK A;  1BGX T;  3D45 A;  4MQ3 A;  4HUG A;  3RRH A;  3RWU A;  1S1T A;  4BWM A;  4UQG A;  4ZHR A;  4J2B A;  1RBV A;  1HRH A;  1S9E A;  1BCM A;  2PYL A;  3NDK A;  3OS1 A;  3F73 A;  3PO4 A;  3P83 D;  1QQC A;  4H4M A;  3QNN A;  3SPY A;  2Z1I A;  1FXX A;  3M8S A;  1EET A;  4FZZ A;  4FJ9 A;  4DFJ A;  2YHA A;  1IH7 A;  2X74 A;  4KB1 A;  4FZY A;  4BWJ A;  1NJX A;  2YKM A;  1HJR A;  4CF9 A;  2VG5 A;  3P1G A;  1WNS A;  3DRP A;  3PX4 A;  4I2P A;  1LWE A;  4LSL A;  4DLG A;  4W5T A;  4CJS A;  3SQ0 A;  1NK8 A;  3CFR A;  2RPI A;  3HP9 A;  3ZT0 A;  3L3V A;  4FJ7 A;  4OGE A;  1QS4 A;  3NBP A;  1CZB A;  1WAF A;  4DTN A;  3SZ2 A;  3NH2 A;  4XIU A;  4FK0 A;  4Y1D A;  4KB0 A;  2G8F A;  1TVR A;  1TK5 A;  3L2U A;  5HRS A;  2HND A;  4FYD A;  4CEQ A;  2F8T A;  1ZBH A;  4BDZ A;  3K5L A;  1N6Q A;  3L3U A;  4AHV A;  4N5S A;  1CXQ A;  3OJU A;  4DSL A;  4FJG A;  4J2E A;  1KVA A;  4FXD A;  1KFD A;  4E1N A;  3ZSQ A;  2DFH A;  4KHS A;  4CHO A;  4CEF A;  4CE9 A;  4OPJ A;  3C95 A;  3T1A A;  3E01 A;  3OYM A;  4O0I A;  4FM1 A;  4DTJ A;  1I3A A;  4H4O A;  1FK9 A;  4QCL A;  3SV4 A;  1WSG A;  1S1W A;  4CFA A;  4CK1 A;  3T19 A;  3OYF A;  4PY5 A;  4ELT A;  1TK8 A;  4FJX A;  4Z4E A;  3U3G A;  3EZ5 A;  3JYT A;  2KW4 A;  1HQU A;  2O4I A;  1Z25 A;  2XY6 A;  2YV0 X;  3K5O A;  3B6O A;  5J2M A;  4CF2 A;  4DSE A;  2XHB A;  3PX0 A;  4HTU A;  1QSL A;  4DWI A;  4RW6 A;  3KIO A;  3TAM A;  4Q0B A;  4M42 A;  3LP2 A;  4CFC A;  1J9A A;  4JRP A;  1S1X A; 
#chains in the Genus database with same CATH topology
 1D4X A;  2VCP A;  5HP1 A;  4BE0 A;  5EXW A;  3JAM O;  1KTQ A;  2ASM A;  3FZH A;  4LY7 A;  2Y1J A;  4JEP A;  1XNR K;  3BUZ B;  3EN9 A;  5DMR A;  1MDU B;  4AHS A;  3KK3 A;  1FW6 A;  3MK6 A;  4DR6 K;  4HVJ A;  4B9N A;  2H3G X;  3MMV A;  3A8Y A;  4I7F A;  3ULD A;  1ZYQ A;  4IO8 A;  3VEX A;  4CEO A;  4CK3 A;  1NOY A;  1Q9X A;  4B9L A;  3MAQ A;  1J54 A;  3GDQ A;  3I56 N;  4HUE A;  1JLQ A;  4CGG A;  2HHX A;  1BCO A;  4EHT A;  4OGC A;  5HLF A;  1FKP A;  1IKW A;  4XEI A;  3HT3 A;  2P9P B;  5KTQ A;  3DXM A;  1EX4 A;  2ZJP L;  4IKF A;  4JI3 K;  2WBN A;  4K8X A;  2HHW A;  1HYV A;  3AVF A;  4MO5 A;  3AVL A;  2E2P A;  5AQU A;  3OA9 A;  2F9W A;  3MEG A;  1N33 K;  2BE2 A;  5A2Q O;  4E7J A;  4F3O A;  3O9T A;  2E88 A;  2QWQ A;  5I9E B;  3TR8 A;  3CYM A;  3O1B A;  3NMU A;  2BH1 A;  4QS9 A;  3EL2 A;  1BIZ A;  4YOV A;  5CYQ A;  4CES A;  3KK2 A;  2B6A A;  1YHQ N;  4JKG B;  3VQB A;  2FSK A;  5H1S Q;  5LY3 A;  1NMD A;  2D4W A;  4O0J A;  5JS2 A;  3RR8 A;  1ITG A;  3VMF B;  4R79 A;  1SL0 A;  2OAN A;  4C1N K;  5F0X A;  5ADX H;  3CD6 N;  4K41 A;  1WN7 A;  1RBT A;  1TAU A;  4LF7 K;  4U67 L;  5KRS A;  5BN9 A;  2V7Y A;  3UE5 A;  3C0B A;  1N8R O;  4JS4 A;  2NUB A;  1K8K A;  1DEJ A;  5C15 A;  4YDU A;  3Q7C A;  4FCY A;  3SI6 A;  2O8C B;  1DLO A;  2UXD K;  2KTQ A;  2NRZ A;  5AQO A;  3H3O B;  5JLF A;  3M8Q A;  1UOC A;  4WFN L;  3HXM A;  3NCI A;  3CC4 N;  3KD5 E;  4ELU A;  4DTU A;  3L2V A;  3CJ9 A;  3ZSO A;  1Q82 O;  4FLV A;  3MEC A;  3CJA A;  2GV9 A;  4CHZ A;  3HPO A;  2E1Y A;  1S72 N;  3VOV A;  1TKX A;  3VEV A;  1I94 K;  5BPM A;  3QIN A;  4DHY A;  4CZI A;  3NHG A;  5AZI A;  1RT6 A;  3AVN A;  5ADX A;  5J2N A;  3D2E B;  1K8A O;  1JL1 A;  1I39 A;  4KTW A;  3AVG A;  3ZT3 A;  4FW1 A;  3VQ5 A;  4CJT A;  2PY5 A;  3LAL A;  2O8E B;  4Y0W A;  4EZ9 A;  5AQF A;  1BA1 A;  2GWK A;  2VWK A;  5C25 A;  3EYZ A;  4E1M A;  4F3T A;  4KFB A;  4TSX A;  4F8R A;  3HJF A;  3DMJ A;  4B3S K;  2XY8 A;  4IEI A;  4YOU A;  5AQL A;  4CCH A;  4FLT A;  2P1J A;  5K14 A;  3PX6 A;  3QER A;  4M3X A;  4OKK A;  3BF3 A;  3D2F B;  3OW2 M;  4E1J A;  4BQL A;  4KHU A;  4KI6 A;  3VQC A;  1WSH A;  3EEQ A;  3WXJ A;  4Z0U A;  1FKO A;  3AY9 A;  2RKI A;  2NNW A;  2E2N A;  1RT4 A;  3WXK A;  5SWM A;  4OPH A;  2F96 A;  3A0I X;  4JN4 A;  2UXB K;  4DSF A;  4H0P A;  2F7T A;  4RW8 A;  2FBV A;  3OYG A;  3THY A;  4CJ4 A;  3V6D A;  3ZET B;  3OYJ A;  3ZSX A;  3NF7 A;  4KH4 A;  3NF6 A;  3DLL L;  3DRS A;  4W5Q A;  1HYZ A;  4HTL A;  3ZYY X;  4FVM A;  1NWK A;  2Q2R A;  1ASW A;  4FWO A;  1U47 A;  3GE1 A;  4Z4C A;  1DTQ A;  2ZGZ A;  3ATU A;  2Q3S A;  3TAB A;  4NCA A;  4DR3 K;  4CF8 A;  3ITH A;  1NK9 A;  4CVN E;  4FLY A;  4JI8 K;  4ISF A;  1NK0 A;  2YI1 A;  1K6Y A;  3LDP A;  1U6Z A;  2QKB A;  4CJ7 A;  4LH5 A;  4B3O A;  1XI1 A;  5AQQ A;  1C1B A;  4FJM A;  3O4Q A;  3LAK A;  1VQ9 N;  3TAQ A;  4O4G A;  4KH6 A;  3IRX A;  3G6E N;  4GV3 A;  4E7L A;  4QS8 A;  2A1R A;  1XC3 A;  2UUC K;  1WBD A;  3U8X A;  3CCS N;  2WON A;  3MXI A;  4CJE A;  3SYZ A;  2VG7 A;  1BA0 A;  5AQP A;  3CCJ N;  2QWL A;  2ZF5 O;  3TAF A;  1V4T A;  4JV5 K;  2IC3 A;  4DTP A;  1Q18 A;  2P51 A;  2IOC A;  2XY5 A;  3HTV A;  4H8K A;  4FZX C;  4L8R B;  5M1F A;  4B1W B;  1A5W A;  2O8D B;  4OVL A;  5BRE A;  3TAR A;  3VGL A;  1W97 L;  1L3V A;  2D0B A;  3KLE A;  2HMP A;  4J8F A;  4KRE A;  3PLA A;  3HI0 A;  3UKU B;  2E2O A;  2DPN A;  4KAZ A;  4GMJ B;  1RNH A;  4BR0 A;  4M7Y A;  3V1R A;  3QEW A;  3U6F A;  3AA4 A;  1KFS A;  4CJK A;  3SPZ A;  4CF1 A;  3HPH A;  4OX9 K;  4HHT A;  3F9M A;  4IFE A;  5C12 A;  4X62 K;  4FWM A;  1MU2 A;  4R5P A;  3KZB A;  3CJ7 A;  1VSE A;  3WNE A;  4J2D A;  4B1V A;  4IXC A;  4PUO A;  5F2R A;  3OY9 A;  1QHA A;  1D8Y A;  2GWJ A;  4OJR A;  1BI4 A;  5I42 A;  4M45 A;  3J8A A;  2HW3 A;  3A5M C;  3ZSR A;  4DSI A;  5JMV A;  2ZWH A;  3NVM A;  2IGI A;  4XH4 A;  1U04 A;  1KAX A;  3QLH A;  2WUS A;  1HPM A;  2FF3 B;  3OYL A;  2Q0U A;  2NRR A;  4KHW A;  1YJN N;  2V52 B;  3H3N O;  3FFI A;  3VES A;  2P9P A;  3P4I A;  1T7P A;  3EKU A;  3ZEU B;  4Z4I A;  5CZ2 A;  1ZBU A;  3PSF A;  3H1Q A;  4RW7 A;  3AA5 X;  1RIL A;  5CZ1 A;  3VEW A;  2O8F B;  5GAG P;  1KXP A;  3VF6 A;  3V9W A;  3EY1 A;  3ZX2 A;  4CJR A;  2G8V A;  1GLA G;  1QVF M;  2HHH K;  4CHP A;  3DRR A;  1TKT A;  4MLH A;  1M1K O;  3H45 C;  2ZGY A;  3LM9 A;  1HUX A;  3SNN A;  1VQ6 N;  1SKR A;  2D0A A;  3BDP A;  3WNG A;  2NLX A;  2E6M A;  4F4K A;  2P9L B;  3OS2 A;  3ENB A;  1C1C A;  1ILY A;  5LMU K;  4JNE A;  4JKG A;  4E7H A;  2HST A;  2D0C A;  1L3T A;  5DM7 L;  5AQJ A;  4WFA L;  5C0Y A;  3E9O A;  3P39 A;  3MCP A;  4BRF A;  1E3M A;  2G8K A;  4CEZ A;  2I5J A;  1C0G A;  1EQY A;  1WSF A;  2W6L A;  2R7Y A;  1QVG M;  4JI6 K;  3SUP A;  5EVZ A;  4MQ3 A;  5C10 A;  4UQG A;  1R59 O;  5FPM A;  3OS1 A;  1IBL K;  3F73 A;  3PO4 A;  1QQC A;  1GLL O;  3BZC A;  4C1N I;  1EET A;  3PSI A;  2O8C A;  3QIC A;  1IH7 A;  5BRH A;  4KB1 A;  4OO1 J;  4FZY A;  2BUP A;  3LL3 A;  4CBU A;  4CF9 A;  1GLJ O;  1LWE A;  3KVG A;  3LDQ A;  1CZB A;  3SZ2 A;  3ULE B;  3NH2 A;  4XIU A;  4K25 A;  5GAD P;  1TK5 A;  5HRS A;  2F8T A;  1ZBH A;  4J2E A;  3WEE B;  4FJG A;  1KVA A;  4E1N A;  4KHS A;  4CHO A;  3AAQ A;  1FK9 A;  4CK1 A;  4PY5 A;  3T19 A;  4CZF A;  3D2E A;  3DAW A;  1TK8 A;  4FJX A;  4Z4E A;  3U3G A;  3TSU A;  2O4I A;  2YV0 X;  2XHB A;  2OTL N;  3G4S N;  2P9I B;  1QSL A;  4DWI A;  4RW6 A;  4Q0B A;  1HJO A;  1SL2 A;  4JRP A;  2O8E A;  1N5Y A;  4B3M K;  1T8E A;  4CZG A;  1ASU A;  2IDO A;  4WFB L;  2YHB A;  4DTX A;  2WOM A;  4CEA A;  3K2P A;  2ITG A;  1S5J A;  1YTA A;  3CFP A;  1RDU A;  3G25 A;  5BN8 A;  1A5X A;  1NU0 A;  4AH9 A;  3AO4 A;  2XRI A;  4C8K A;  3D2F A;  2KQ2 A;  5KPR A;  4EHU A;  4FJN A;  1B92 A;  3QO9 A;  3QBW A;  4BDY A;  2ATQ A;  1KCF A;  2GBZ A;  4FLX A;  2UU9 K;  3KLG A;  3FZF A;  5J2Q A;  4N47 A;  3C6H A;  3AVA A;  3NE6 A;  1RT7 A;  4FM0 A;  4DQR A;  4U7B A;  3ZET A;  4OKE A;  3PO5 A;  1IJJ A;  4BRP A;  1S1U A;  3CQX A;  5AQN A;  3TAG A;  1RT3 A;  1IBK K;  4H03 B;  2V51 B;  1Y97 A;  1JKH A;  5AQK A;  2AA4 A;  2YHX A;  3SV3 A;  3LAM A;  3KKS A;  4CJW A;  3ATV A;  4CJL A;  4FW2 A;  4BR5 A;  4QOZ B;  2YCH A;  4NB4 A;  2ZM6 K;  5CY4 A;  4DSK A;  2KZM A;  3FFK B;  3DWL A;  2F8S A;  3E9L A;  4ILH A;  1RT1 A;  4HUF A;  3HOT A;  4DR2 K;  5FRN A;  3O08 A;  1T03 A;  3OYN A;  2NRT A;  3KLI A;  3OYB A;  4B3R K;  1E4G T;  3OYI A;  4LFA K;  1VAZ A;  2HF4 A;  2E6L A;  5AQH A;  1LV5 A;  3OHR A;  5AQV A;  3WNH A;  4NCB A;  2HVI A;  4Y1C A;  4FSV A;  2NRH A;  3TAE A;  3K0S A;  1CXU A;  2QM1 A;  4CED A;  2P5G A;  1KLM A;  5DM6 L;  1JXB A;  4AF1 A;  2O8D A;  4NYF A;  4H5W A;  4BRO A;  1HKG A;  4FVU A;  1QSY A;  3DM2 A;  2EHG A;  4PHT X;  1XUP O;  3UKU A;  4DUY K;  3AVK A;  3OBW A;  5LJV A;  4DF8 A;  1NBW A;  3WQU A;  1NK7 A;  4BVP A;  3S3N A;  3C94 A;  2YNH A;  3LZI A;  4ID1 A;  3QB0 A;  1NM1 A;  1BI4 B;  5I3U A;  2QWO A;  3CG7 A;  5FPN A;  3P5J A;  2OPP A;  4CIG A;  2Q97 A;  3E1Y A;  1HNV A;  2FSN A;  5LJW A;  3KK7 A;  1WSJ A;  2Y1I A;  4NO7 A;  1RTI A;  1ATR A;  2G8U A;  1VSL A;  1NMN A;  4NCG A;  1YJ9 N;  4DTS A;  3O1W A;  3TU5 A;  2IVO A;  1KQS M;  1RDA A;  1BQM A;  1HPZ A;  4JI4 K;  4JD2 B;  1NJY A;  4EFH A;  2QWN A;  5BPN A;  3I55 N;  4BG9 A;  1O1W A;  2J4R A;  2HHT A;  4OKJ A;  1NGI A;  3V81 A;  3IAY A;  3ZEU A;  3SQ1 A;  3IDH A;  2P9S A;  3K59 A;  3K5M A;  5AFU H;  1L5U A;  2O8F A;  3L0Q A;  2FBY A;  4DU4 A;  3ZT1 A;  2OCE A;  2VGN A;  1SKS A;  1L3S A;  2P9K B;  3O9R A;  3AVC A;  4PKG A;  3KHY A;  4BE1 A;  4C8M A;  4BRI A;  2YHY A;  4IWV A;  4DTO A;  3VQQ A;  3SQ2 A;  1NGJ A;  3M8R A;  1DKG D;  4CJ3 A;  4BRQ A;  5EU7 A;  2IVP A;  4DFM A;  2P9L A;  3HO1 A;  3T1H K;  3NH1 A;  1H1V A;  2RHK A;  4CGH A;  2PAV A;  1ZBS A;  4CI6 A;  3R3L A;  1BUP A;  4HCC A;  3LZJ A;  3RR7 A;  1XNQ K;  1TV6 A;  1C0T A;  1WOQ A;  1RDD A;  3D6R A;  4IOX A;  5SZT A;  1EXQ A;  3MX2 A;  3RMB A;  4H0T B;  4CGI A;  5KQD A;  3VGM A;  3M8P A;  3IS9 A;  1EKE A;  5AQR A;  4BE2 A;  4FWS A;  3DI6 A;  3R6M A;  1QHT A;  2ZE2 A;  3F9K A;  4CIF A;  2Z1H A;  4H0X B;  2KFN A;  3QEP A;  4DCH A;  5AFU A;  3OVN A;  4BC2 A;  2QK9 A;  4PWD A;  5AQS A;  2FLO A;  5KGX A;  3J81 O;  3CER A;  1RTH A;  4FLW A;  1WB9 A;  4DQP A;  4KTQ A;  3CPW M;  5BR9 A;  2V7Z A;  4KHP K;  2D0P A;  5E26 A;  3AO2 A;  3HVT A;  4F2S A;  5AZJ B;  3ULE A;  4DB3 A;  4Z4F A;  5HRR A;  3VQ4 A;  1OH8 A;  4F2R A;  1YAG A;  4IOA L;  1OH7 A;  4PA1 A;  1V4S A;  3WEE A;  3TI0 A;  4CIE A;  4JYA K;  4KTZ A;  3TAN A;  4IDK A;  1VRU A;  5J1E A;  4M3Y A;  3LM2 A;  3AVB A;  1S6Q A;  3PY8 A;  5FLX O;  4B9V A;  1JLA A;  4DLE A;  3Q7B A;  1LWF A;  3HYF A;  3CCU N;  2A41 A;  1Q8I A;  2P9I A;  5M1K A;  2NZT A;  2Q1N A;  2OTJ N;  2FC0 A;  4HWI A;  3MWP A;  2JWK A;  3NGY A;  4W5O A;  4KI4 A;  3ZCM A;  1ZBF A;  4XH5 A;  4CJQ A;  4PL7 A;  2OA8 A;  4JKD A;  5C42 A;  1JLF A;  4NLB A;  4CW7 B;  1RBS A;  4CGF A;  3KJV A;  3MN6 A;  3VQA A;  3J80 O;  1OKJ A;  4DV3 K;  1IBM K;  4K8Z A;  5AQW A;  1VSJ A;  3CJ1 A;  3ZSW A;  4FWP A;  2OPR A;  1LOT B;  2CGJ A;  3NF9 A;  1ESV A;  1LW0 A;  3LPU A;  1XHX A;  1TUU A;  3LWM A;  3VQP A;  4I6M B;  2HBK A;  3VF2 A;  1BOT O;  4WYB A;  2KZZ A;  4X64 K;  3L4I A;  4M41 A;  4B3T K;  3L2Q A;  1ASV A;  4BR2 A;  2OZS A;  1EP4 A;  4MDA A;  3VF4 A;  3KWG A;  3KTQ A;  3P31 A;  3O5B A;  4OLB A;  4YOT A;  4H0V B;  2W42 A;  3SJJ A;  3S3O A;  3LDS A;  4EP5 A;  1NJW A;  1JCG A;  4E89 A;  5C24 A;  2Z1G A;  3LP0 A;  4DU3 A;  3AVM A;  3VTH A;  2IAJ A;  2QEX N;  3CQY A;  4E7I A;  3ALY A;  5AJ3 K;  3M3Z A;  1HR0 K;  1ZBL A;  5JVG L;  4G9Z A;  3SUQ A;  4BRE A;  4IZ9 A;  4BRG A;  1NJI O;  4CHN A;  1N36 K;  4JI1 K;  4IBN A;  1CZA N;  1BIU A;  1JLC A;  4GNI A;  4N76 A;  4IG0 A;  1IG8 A;  4I9L A;  1U48 A;  2RE2 A;  2OPQ A;  3L8B A;  4NYN A;  3VQD A;  4MFB A;  1U4B A;  5BPL A;  5M1O A;  1LAV A;  1NGA A;  4HUG A;  3AGK A;  3RRH A;  3VER A;  2A40 A;  4J2B A;  1S9E A;  1BCM A;  2NRW A;  3NDK A;  4DQ8 A;  1X9J A;  4CZH A;  3P83 D;  3SPY A;  3QNN A;  5KQ8 A;  4DFJ A;  4CD3 A;  3U4L A;  1EO1 A;  2A5X A;  2YKM A;  1HJR A;  2VG5 A;  1VHX A;  3P1G A;  3HOS A;  1S3X A;  3PX4 A;  4LF6 K;  3MWT A;  4LSL A;  4DLG A;  1QQO A;  3SQ0 A;  3WXM B;  3R8E A;  3L3V A;  3LDL A;  4BR9 A;  4WF9 L;  4DR5 K;  4DTN A;  1N32 K;  2G8F A;  4A61 A;  4CEQ A;  4FXD A;  4DSL A;  3OJU A;  1VQN N;  3ID8 A;  4BRA A;  1QQM A;  3UKR A;  4CEF A;  4CZL A;  4BG8 A;  3SV4 A;  1WSG A;  1S1W A;  3LDO A;  4ELT A;  1Z25 A;  3SK3 A;  2XY6 A;  3B6O A;  4DSE A;  4FWQ A;  1M90 O;  3LP2 A;  1ATS A;  1VRT A;  3OBY A;  2A3Z A;  3CM5 A;  1HMV A;  2O8B B;  4JK8 A;  3EE8 A;  4FWK A;  2ZD1 A;  4K43 A;  2QW9 A;  1CZ9 A;  1GLC G;  1NK6 A;  3VQ8 A;  1RTD A;  1GOA A;  2X78 A;  5KGW A;  5HRN A;  3WXI A;  1JL2 A;  4ILJ A;  3I0S A;  2ZJQ L;  5AQI A;  3VPZ A;  3BF1 A;  3THX B;  1VQ5 N;  4JRQ A;  1ATN A;  1X9S A;  2VWJ A;  4LC9 B;  4C23 A;  4MDB A;  2E8A A;  1Z26 A;  2RF2 A;  2YJF A;  1KRP A;  2P9U B;  2QA4 N;  4JD2 A;  2P9S B;  2HMI A;  2LSN A;  2A1S A;  3ENH A;  4AHT A;  2DFF A;  4DU1 A;  1W7A A;  1VQ7 N;  1Z05 A;  3V1Q A;  3S9H A;  1LW2 A;  2D0O A;  1C0M A;  2HNY A;  1KAY A;  2F4V K;  1MWK A;  3C6U A;  4MLE A;  4JKA A;  4JI7 K;  1VSM A;  1HNW K;  3ZT2 A;  3SUN A;  1D9D A;  3BEX A;  4BVO A;  1U45 A;  4JI0 K;  4M7X A;  3MN7 A;  5C2D A;  3OYA A;  1G99 A;  1W9H A;  3HRG A;  3VET A;  4B9T A;  2P9K A;  2PFU A;  1DT9 A;  2YNG A;  4EIA A;  3AVI A;  2GEM A;  3HK2 A;  1VSH A;  3RTV A;  2IS3 A;  2E2Q A;  3DYA A;  4CJU A;  4DTR A;  4DV6 K;  1IKX A;  2FF6 A;  3KKR A;  1VSF A;  4FJ5 A;  3WUH A;  2UUB K;  3JS6 A;  4A2B A;  3OYK A;  1X1P A;  1UWB A;  1U49 A;  4PKH A;  5AQY A;  2Q36 A;  1XWL A;  4WE1 A;  3DLB A;  2P9N B;  1X3M A;  3M6G A;  3THV A;  2G8I A;  2WC9 A;  4BDP A;  4LFB K;  2BDP A;  3W3D A;  1B9D A;  1NGG A;  3CXC M;  4W5N A;  2WTU A;  3THW B;  2GEL A;  4LSN A;  1T05 A;  1LAW A;  3OYE A;  2YX6 A;  2HB5 A;  1X3N A;  5AZJ A;  1LWC A;  3QIP A;  4C8N A;  3U3Y A;  3VEY A;  3AAP A;  4KHQ A;  4KO0 A;  4RWT A;  2KFZ A;  1DTT A;  1P90 A;  3T1Y K;  4YNQ A;  1NGD A;  3T69 A;  4JI5 K;  5AQX A;  3O9Q A;  4CGD A;  3O8M A;  1A5V A;  3VGK A;  4YHH K;  1RCH A;  4Z4G A;  3MX5 A;  4H5T A;  1NKB A;  4E19 A;  3SCX A;  1WBB A;  1ZBI A;  2WFB A;  2EX3 A;  3C6A A;  4CZJ A;  3I8B A;  4A57 A;  3ZX0 A;  2W40 A;  1TAQ A;  4A2A A;  3BP8 A;  2QXL A;  3FLC O;  1XHZ A;  1OH6 A;  4B9U A;  2YNI A;  4IOC L;  2VQE K;  2JLE A;  1BHL A;  4GW6 A;  3TTC A;  4DSJ A;  1YIJ N;  3UIQ A;  3PIO L;  4JS5 A;  3K9J A;  1HNX K;  3EZW A;  2GUP A;  2PZS A;  1GOB A;  3I8D A;  2CH6 A;  1RGI A;  4B9M A;  4O44 A;  1Q81 O;  4A62 A;  4EZ6 A;  1SAZ A;  3QFP A;  4I6M A;  3D7E O;  3K57 A;  1YXQ A;  2E20 A;  4B1U B;  3DXK B;  3AA2 A;  3IUC A;  3MCA B;  3VA0 A;  5AQZ A;  3VQE A;  3OYH A;  5FRM A;  4RCH A;  3ASM A;  4AHU A;  5D3G A;  1TKD A;  5IT9 O;  1MWM A;  4DQS A;  3OTO K;  1NG9 A;  5HRP A;  3BGR A;  1SKW A;  4CGJ A;  4EAH D;  2ETJ A;  4CZM A;  1D5A A;  4LFC K;  5C2F A;  1IKY A;  3NGI A;  2QWM A;  4KBO A;  3OS0 A;  4FLZ A;  4X65 K;  1U2V B;  1K73 O;  2A6A A;  3CFO A;  5MLC Q;  2HBJ A;  4JHD A;  4MO4 A;  4O5B A;  3C7N A;  3IKM A;  1L3U A;  1QZ5 A;  4OPK A;  4ID5 A;  1FJG K;  1SV5 A;  3KWI A;  3QML A;  2FBT A;  1VQO N;  4H0O A;  2HHS A;  2AJQ A;  2CH5 A;  3RSE B;  1BU6 O;  4NLC A;  3HM9 A;  4FK2 A;  3KK1 A;  3V9Z A;  3R9P A;  2BAN A;  3ZSZ A;  1VSK A;  4RW9 A;  4IG3 A;  1LCU A;  4JLH A;  1S6P A;  4DV2 K;  2RN2 A;  2BGG A;  5HOO A;  3DLR A;  2BTF A;  2FSJ A;  3O4N A;  4GKK K;  1JLB A;  3CCQ N;  3J7A P;  3LAN A;  1K9M O;  1ZXO A;  3RVC A;  1VK0 A;  4BR4 A;  4ISE A;  4DV0 K;  4B9Q A;  4DKW A;  1JCE A;  3MXM A;  1TYQ A;  3UB5 A;  3H1V X;  3UKR B;  4EP4 A;  4GV9 A;  1JCF A;  1BDG A;  4FLU A;  3DJC A;  3TWH A;  2HF3 A;  4AQY K;  1TK0 A;  1GLD G;  3T3F A;  3KD1 E;  1IKV A;  3NF8 A;  3SJH A;  4N41 A;  2KHO A;  4IFY A;  2ASP A;  4DQI A;  3F2K A;  1J53 A;  3JSM A;  4FJK A;  5LL6 Z;  3V1O A;  3ENO A;  4CEE A;  1VSI A;  2VGM A;  3CC7 N;  1B9F A;  1QE1 A;  3WNF A;  1XMO K;  1BQN A;  1JLE A;  1GLE G;  1Y64 A;  2QWP A;  5CYM A;  4Z94 A;  3O3H A;  3AV9 A;  4DFP A;  4YFU A;  1WUA A;  4WQ5 C;  3CJB A;  3PUF A;  4LF4 K;  4BGA A;  5T7B A;  2E4L A;  4OLA A;  4FL9 A;  2O8B A;  4DS4 A;  1XMQ K;  4DV5 K;  3QFU A;  4DG1 A;  3P38 A;  3VEZ A;  4AIL C;  3MN5 A;  4JI2 K;  2QKK A;  1S1V A;  2B4J A;  1QQN A;  3KLH A;  1NNE A;  4LH4 A;  4O8K A;  1N34 K;  3WXL A;  5FPD A;  4B1X B;  5GIO A;  1R0A A;  5BR8 K;  4IO9 L;  1EWR A;  1TKZ A;  4LD0 A;  3THX A;  3L6Q A;  1S22 A;  3U9D A;  3VEO A;  5KPZ A;  3V9X A;  2E5L K;  1CLQ A;  1BL3 A;  2I7N A;  1S9G A;  2E1Z A;  2HVH A;  3O3F A;  4CEB A;  4DR7 K;  1YI2 N;  5FRO A;  1UA1 A;  2P9U A;  2Q0R A;  5GIP A;  3C65 A;  3GG4 A;  2HHQ A;  4JKB A;  3RMD A;  1JLG A;  4OPA A;  1C0U A;  1VSD A;  2OYQ A;  3HPG A;  2A42 A;  2JGU A;  4E3S A;  3GBT A;  3NGZ A;  4B9S A;  3GL1 A;  4BGB A;  1KVC A;  3CI5 A;  5FDL A;  1TUY A;  3ISN C;  4KKO A;  1XC9 A;  3HZ6 A;  1OH5 A;  1J5O A;  4IEE A;  4Z4H A;  1WSE A;  1TL3 A;  4E0D A;  3HM8 A;  4UY8 O;  3FZM A;  3HP6 A;  1NK5 A;  4M3Z A;  3TPQ A;  3TSQ A;  4DTM A;  3T7Z A;  1NGB A;  5JS1 A;  2HBM A;  3DLK A;  3QEX A;  3GOI A;  1YJW N;  4N56 A;  3OJS A;  2HHU A;  3RWU A;  1NGH A;  4DR4 K;  2W41 A;  4WCE L;  1RBV A;  2PYL A;  3U9Z A;  2CGL A;  1NGF A;  2PBD A;  4H4M A;  2Z1I A;  5CE3 A;  5HL7 L;  3M8S A;  2P9N A;  2GX9 A;  4FWL A;  3N4Q A;  2QTD A;  4BWJ A;  5EY4 A;  1WNS A;  3DRP A;  3M1F A;  4I2P A;  3CHW A;  4FPB A;  4CJS A;  4W5T A;  1NK8 A;  2RPI A;  3HP9 A;  3ZT0 A;  3THW A;  4FJ7 A;  3MN9 A;  1QS4 A;  1WAF A;  4QS7 A;  4YOY A;  3PIP L;  4KB0 A;  1TVR A;  4GY2 B;  5CHI A;  4AHV A;  4NXN K;  3E66 A;  1MA9 B;  4K0K K;  2DFH A;  4CE9 A;  4OPJ A;  4DV1 K;  3T1A A;  3E01 A;  4YOW A;  4O0I A;  4FM1 A;  1I3A A;  4H4O A;  1EWQ A;  2IVN A;  3I33 A;  1YVN A;  4H5V A;  5JVH L;  5ELZ A;  1HQU A;  5J2M A;  1T6D A;  2HOE A;  3TSP A;  3CJC A;  4M42 A;  4IJN A;  1J9A A;  3JXU A;  4CFC A;  3A5L C;  1S1X A;  3L4Q A;  2NRX A;  5E41 A;  4M3W A;  3VQ9 A;  1HNZ K;  3HSC A;  3QET A;  4O5F A;  4FPA A;  4H0Y B;  3CF5 L;  1Q9Y A;  3EO3 A;  1GLF O;  3CM6 A;  3ZLJ A;  1YUW A;  2OZM A;  1OVY A;  1T44 A;  4BC5 A;  3C6T A;  3D0P A;  3VN5 A;  3SAG A;  3MEE A;  3SLC A;  4CJP A;  5B8H A;  3K58 A;  1D9F A;  1TGO A;  4FWN A;  3LP3 A;  2X6N A;  1KLN A;  4RW4 A;  2YHW A;  2DTU A;  5TKY A;  2B5J A;  4O55 A;  2NRV A;  3QBX A;  3LPT A;  1RT2 A;  4WQ5 A;  1NLV A;  3DXK A;  5IWA K;  3CET A;  3AO3 A;  1SL1 A;  3AA3 A;  4DFK A;  2F9T A;  4O8U A;  4GV6 A;  5KI6 A;  1E4F T;  5EOY A;  3H08 A;  5HBM A;  4CFD A;  4JHD B;  3VTI A;  3CPE A;  5EX5 A;  4ILG B;  4Q5V A;  2EWS A;  3C7N B;  1KAZ A;  1WSI A;  3B6P A;  4CF0 A;  4FK4 A;  4IDH A;  1U2V A;  1VQK N;  4CJF A;  5JLH A;  1T3V A;  3ZT4 A;  4BAC A;  1QSS A;  3FE1 A;  4BRK A;  4NXM K;  1P8Z A;  5M1Q A;  3PV8 A;  3CC2 N;  4ICL A;  1TL1 A;  4G1Q A;  3RSE A;  1W2B M;  4J2A A;  4LF9 K;  3FR0 A;  4JKE A;  5JIC A;  3O4W A;  1XQS C;  3L2W A;  3ZX3 A;  3WQT A;  5BRF A;  4BY9 C;  3LP1 A;  1IO2 A;  2IIR A;  1SS6 A;  4JKC A;  1Q7Y O;  1TYQ B;  2UUA K;  2G8H A;  2G8W A;  1BWF O;  5GAE P;  1VQL N;  2FBX A;  2XO7 A;  1NKE A;  3AGR A;  3M5R A;  3SMS A;  1RBR A;  3VQ6 A;  4V19 S;  4C8L A;  2ITM A;  3G0Z A;  3TAP A;  3AVJ A;  3V9U A;  2X6S A;  1C1A A;  3CQ8 A;  3BY5 A;  4I2Q A;  4BRL A;  3CIP A;  2D1K A;  3KLF A;  2VQF K;  4CJ5 A;  3O3G A;  2QI2 A;  3RMC A;  2PYJ A;  3L2R A;  4JKH A;  4DQQ A;  4GVE A;  4BRM A;  3CCR N;  5GAH P;  4YY3 K;  3J7Y P;  4BRD A;  1NK4 A;  1HQE A;  4YOX A;  2QXF A;  3FZK A;  2HBL A;  4YOR A;  1C6V A;  4AM6 A;  3CCM N;  3QEI A;  3ZSV A;  4AHR A;  4BRN A;  1RBU A;  4FJI A;  4WQ4 C;  1IG9 A;  5TKW A;  2DY4 A;  1Z6R A;  1GOC A;  2UXC K;  4CZK A;  3V4I A;  1WLJ A;  1VQM N;  3O6W A;  4FM2 A;  1DGK N;  2VYP A;  5J2P A;  3OYC A;  1JXE A;  1QZ6 A;  4PKI A;  1NGC A;  4PL8 A;  3CCV N;  3DXM B;  1HKC A;  1X9M A;  3AO1 A;  3S3M A;  4M3U A;  4H5N A;  1GLB G;  3H6E A;  3SBT A;  3EE9 A;  5E84 A;  5FPE A;  4A5B A;  2ASO A;  2GUI A;  4GKJ K;  3A5N C;  4PQU A;  3VA3 A;  1RDB A;  1HYS A;  4RTF D;  1WAJ A;  5KPT A;  4FO0 A;  3CCL N;  4BQZ A;  4DUZ K;  3J7Z O;  3B8A X;  4C8O A;  5HRO A;  4DS5 A;  3HST B;  5LMN K;  4I9Q A;  4ISG A;  3IMX A;  4AHC A;  4W5R A;  4B1Z A;  3QIO A;  4F9O A;  4B8C A;  4CEC A;  2Q31 A;  3CCE N;  2HHV A;  1KVB A;  5DK5 A;  3HVR A;  1BO5 O;  4XH1 A;  5M1P A;  1NGE A;  4BRC A;  2YJE A;  3DOL A;  1K8K B;  4M63 C;  4KRF A;  1HNI A;  3ID6 A;  4ZTF A;  1HKB A;  4JK7 A;  4DF4 A;  4L3Q A;  3ZSY A;  4CHQ A;  2P5O A;  4QAG A;  3O9S A;  2KLA A;  2O4G A;  3MDQ A;  5CR4 A;  3I0R A;  4M3T A;  3DLE A;  1RTJ A;  4JK9 A;  1BIS A;  1BG3 A;  3TTF A;  4CZE A;  3DLH A;  4RG8 A;  3SAF A;  3AO5 A;  4LF5 K;  1YTU A;  3K5N A;  1YIT N;  3TTD A;  4CD1 A;  4CER A;  4CHY A;  1KSP A;  4E7K A;  3QDK A;  3MXJ A;  1SZ2 A;  3QES A;  4KPY A;  4KV8 A;  3DLG A;  5AQT A;  3NFA A;  3N4P A;  5AZI B;  5KRT A;  2VG6 A;  2CGK A;  3WT0 A;  3E9P A;  3NAE A;  4A59 A;  3G71 N;  4DV7 K;  4JAX A;  4X66 K;  4FJJ A;  2QWR A;  3NH0 A;  2AP1 A;  3AVH A;  1OVQ A;  4K42 A;  1X9W A;  3H46 O;  3V9S A;  3LDN A;  4BC4 A;  4ZTJ A;  1HX1 A;  3IFR A;  4FOI A;  1QTM A;  2VWB A;  4CJV A;  3EKS A;  4IFV A;  1YVU A;  4DMN A;  1C0F A;  3RMA A;  1JJ2 M;  2HNZ A;  3SUO A;  3VQ7 A;  4AM7 A;  2KKZ A;  4GVM A;  1VQ4 N;  1KD1 O;  3MED A;  2D5R A;  2FXU A;  4JKF A;  3OYD A;  2ZQB A;  2UYT A;  1RFQ A;  3BZK A;  1UA0 A;  2JWL A;  1YF5 L;  3QNO A;  4B8A B;  3G10 A;  4FJL A;  4CK2 A;  4ELV A;  4LF8 K;  1UAX A;  4FWR A;  4BR7 A;  4M3R A;  5GIN A;  1NOZ A;  5F1X A;  1REV A;  1F21 A;  2ZJR L;  3THY B;  1KC8 O;  3HBT A;  3IG1 A;  5AQM A;  1W0H A;  4KHY A;  1NJZ A;  4FOE A;  1SUQ A;  3QEV A;  3SAH A;  4B08 A;  4YDU C;  4HCB A;  4KH5 A;  3LWL A;  3K9K A;  3AAR A;  3SBG A;  3O9U A;  4FJ8 A;  4WQ4 A;  2YNF A;  4BRH A;  5AQG A;  1RT5 A;  1T6C A;  1G15 A;  2XY7 A;  2YKN A;  3HL8 A;  1HLU A;  2W6K A;  5M1N A;  4CBX A;  2OPS A;  1RDC A;  3SQ4 A;  2Z1J A;  3FZL A;  3SMP A;  4CFB A;  4KHN A;  1YT3 A;  2DFE A;  3A2F A;  1NKC A;  4FJH A;  4DV4 K;  3RRG A;  1Q86 O;  3W0L A;  1RDW X;  2GTD A;  3DOK A;  1BGX T;  3D45 A;  1S1T A;  4BWM A;  4ZHR A;  1HRH A;  1IV0 A;  3VEN A;  4DR1 K;  1FXX A;  1VQP N;  1J5E K;  3A5O C;  5AR0 A;  3FGU A;  4FJ9 A;  4FZZ A;  2YHA A;  2X74 A;  3R1X A;  1NJX A;  1O13 A;  3F5T A;  3CFR A;  1J6Z A;  2I7P A;  4OGE A;  3NBP A;  3S41 A;  3CMA N;  4FK0 A;  1ZC6 A;  4Y1D A;  4B1Y B;  3L2U A;  2HND A;  4FYD A;  4BDZ A;  3K5L A;  1N6Q A;  3L3U A;  4N5S A;  4IJA A;  1CXQ A;  5BRD A;  1KFD A;  3ZSQ A;  1VQ8 N;  3CME N;  3C95 A;  3OYM A;  4DTJ A;  4QCL A;  4CFA A;  3OYF A;  4H5R A;  3JYT A;  3EZ5 A;  2KW4 A;  3K5O A;  4BC3 A;  4CF2 A;  4A5A A;  3O80 A;  3PX0 A;  4HTU A;  3TAM A;  3KIO A;  3NVK A;  1SQK A;  4CBW A; 
#chains in the Genus database with same CATH homology
 1VRT A;  4M3W A;  3VQ9 A;  1N5Y A;  5HP1 A;  4BE0 A;  3CM5 A;  1HMV A;  1KTQ A;  1T8E A;  4LY7 A;  1ASU A;  2Y1J A;  2IDO A;  3QET A;  2ZD1 A;  2YHB A;  4DTX A;  2WOM A;  5DMR A;  4AHS A;  4CEA A;  3KK3 A;  1CZ9 A;  3K2P A;  2ITG A;  1S5J A;  1NK6 A;  1Q9Y A;  1YTA A;  4HVJ A;  3CFP A;  3VQ8 A;  1RTD A;  1GOA A;  2X78 A;  4B9N A;  5KGW A;  5HRN A;  3CM6 A;  4I7F A;  3ULD A;  1A5X A;  1ZYQ A;  2OZM A;  1JL2 A;  3C6T A;  3I0S A;  4AH9 A;  3D0P A;  4CEO A;  4CK3 A;  3VN5 A;  4JRQ A;  3MEE A;  1NOY A;  3AO4 A;  1Q9X A;  2XRI A;  1X9S A;  4CJP A;  4C8K A;  2VWJ A;  4B9L A;  3MAQ A;  1J54 A;  1Z26 A;  3K58 A;  1D9F A;  2KQ2 A;  1TGO A;  4HUE A;  3LP3 A;  1JLQ A;  2RF2 A;  2X6N A;  4CGG A;  2HHX A;  1BCO A;  4OGC A;  5HLF A;  4RW4 A;  1KLN A;  1KRP A;  1FKP A;  1IKW A;  4FJN A;  1B92 A;  2LSN A;  2A1S A;  3QO9 A;  2HMI A;  2DTU A;  3HT3 A;  4AHT A;  5KTQ A;  2B5J A;  2ATQ A;  2DFF A;  4BDY A;  4O55 A;  4DU1 A;  1EX4 A;  3V1Q A;  3S9H A;  1LW2 A;  4IKF A;  3LPT A;  1C0M A;  1KCF A;  1RT2 A;  2GBZ A;  2HNY A;  3C6U A;  1SL1 A;  3AO3 A;  1VSM A;  3AA3 A;  4FLX A;  4DFK A;  4K8X A;  3KLG A;  2HHW A;  3ZT2 A;  1HYV A;  3AVF A;  5J2Q A;  3SUN A;  4N47 A;  3AVL A;  3AVA A;  3NE6 A;  1RT7 A;  1D9D A;  4FM0 A;  4DQR A;  1U45 A;  5KI6 A;  4OKE A;  3MEG A;  3H08 A;  2BE2 A;  4E7J A;  3OYA A;  4F3O A;  1W9H A;  5HBM A;  4CFD A;  3PO5 A;  4B9T A;  2YNG A;  4Q5V A;  1S1U A;  3CYM A;  3TR8 A;  3AVI A;  1RT3 A;  3TAG A;  1WSI A;  3B6P A;  1SL2 A;  4CF0 A;  4FK4 A;  1BIZ A;  3HK2 A;  1VSH A;  1JKH A;  1Y97 A;  2IS3 A;  3RTV A;  5CYQ A;  4CES A;  3DYA A;  3KK2 A;  4CJU A;  2B6A A;  4DTR A;  4CJF A;  3VQB A;  3ZT4 A;  4BAC A;  3SV3 A;  3LAM A;  1QSS A;  1IKX A;  4O0J A;  5JS2 A;  3RR8 A;  3KKR A;  1ITG A;  1VSF A;  3KKS A;  4CJW A;  3PV8 A;  4CJL A;  4FJ5 A;  1SL0 A;  4FW2 A;  4ICL A;  4QOZ B;  1TL1 A;  1WN7 A;  3OYK A;  1X1P A;  5CY4 A;  1RBT A;  4DSK A;  1TAU A;  1UWB A;  4G1Q A;  2KZM A;  4J2A A;  5KRS A;  2F8S A;  1RT1 A;  4HUF A;  3L2W A;  1U49 A;  4JS4 A;  5FRN A;  1XWL A;  2NUB A;  1T03 A;  4WE1 A;  3OYN A;  4FCY A;  3SI6 A;  3DLB A;  3THV A;  1DLO A;  3KLI A;  2G8I A;  4BDP A;  3OYB A;  3LP1 A;  2KTQ A;  3OYI A;  1IO2 A;  3M8Q A;  1UOC A;  3HXM A;  3NCI A;  2BDP A;  1B9D A;  2G8H A;  2G8W A;  3KD5 E;  4ELU A;  2E6L A;  4W5N A;  4DTU A;  3L2V A;  1LV5 A;  2FBX A;  3ZSO A;  3WNH A;  4NCB A;  4LSN A;  1T05 A;  2HVI A;  1LAW A;  2XO7 A;  1NKE A;  4Y1C A;  4FLV A;  3MEC A;  3TAE A;  2GV9 A;  4CHZ A;  1CXU A;  3HPO A;  3OYE A;  3VQ6 A;  1RBR A;  2HB5 A;  4CED A;  2P5G A;  1KLM A;  4C8L A;  1TKX A;  1JXB A;  3G0Z A;  3TAP A;  3QIN A;  3AVJ A;  4NYF A;  3V9U A;  1LWC A;  3QIP A;  2X6S A;  1C1A A;  4C8N A;  3U3Y A;  3CQ8 A;  4I2Q A;  3NHG A;  1RT6 A;  3AVN A;  4KHQ A;  1QSY A;  3DM2 A;  4KO0 A;  2KFZ A;  2EHG A;  1DTT A;  5J2N A;  3KLF A;  1JL1 A;  4YNQ A;  1I39 A;  4KTW A;  3AVG A;  3ZT3 A;  3AVK A;  4CGD A;  4CJ5 A;  4FW1 A;  3VQ5 A;  3O3G A;  4DF8 A;  4CJT A;  1A5V A;  3RMC A;  1NK7 A;  2PY5 A;  2PYJ A;  1RCH A;  3L2R A;  4Z4G A;  3LAL A;  1NKB A;  3S3N A;  4DQQ A;  4EZ9 A;  3C94 A;  2YNH A;  3LZI A;  4ID1 A;  2VWK A;  4E19 A;  5C25 A;  3EYZ A;  4E1M A;  3SCX A;  1ZBI A;  1NK4 A;  2EX3 A;  1HQE A;  4F3T A;  1BI4 B;  4KFB A;  2QXF A;  5I3U A;  4TSX A;  4F8R A;  3HJF A;  3DMJ A;  1C6V A;  1TAQ A;  2XY8 A;  3CG7 A;  3QEI A;  4CCH A;  3P5J A;  3ZSV A;  4AHR A;  1XHZ A;  4B9U A;  1RBU A;  4FJI A;  2YNI A;  4FLT A;  2OPP A;  4CIG A;  2P1J A;  2JLE A;  1BHL A;  5K14 A;  4GW6 A;  1IG9 A;  3PX6 A;  1HNV A;  3QER A;  4DSJ A;  2DY4 A;  4M3X A;  1WSJ A;  1GOC A;  4OKK A;  3UIQ A;  3V4I A;  1WLJ A;  2Y1I A;  1RTI A;  4JS5 A;  2G8U A;  4FM2 A;  1VSL A;  4KI6 A;  3VQC A;  4NCG A;  5J2P A;  3OYC A;  1WSH A;  4DTS A;  4KHU A;  4Z0U A;  1GOB A;  1FKO A;  1JXE A;  2PZS A;  1RDA A;  3I8D A;  1BQM A;  1HPZ A;  2RKI A;  1NJY A;  4O44 A;  4B9M A;  1RT4 A;  5SWM A;  4EZ6 A;  2F96 A;  1X9M A;  3AO1 A;  3S3M A;  3K57 A;  4M3U A;  1O1W A;  2HHT A;  4OKJ A;  3AA2 A;  3VA0 A;  5FRM A;  3VQE A;  3OYH A;  4DSF A;  3V81 A;  4RW8 A;  2FBV A;  3ASM A;  3OYG A;  3SQ1 A;  3IAY A;  4AHU A;  5D3G A;  1TKD A;  4DQS A;  4CJ4 A;  3K59 A;  2GUI A;  3BGR A;  5HRP A;  3V6D A;  3OYJ A;  1SKW A;  3K5M A;  3ZSX A;  4CGJ A;  2ETJ A;  3NF7 A;  1L5U A;  3VA3 A;  2FBY A;  4DU4 A;  3ZT1 A;  4PQU A;  1RDB A;  3NF6 A;  1HYS A;  1D5A A;  1SKS A;  1L3S A;  1WAJ A;  1IKY A;  3AVC A;  3DRS A;  4W5Q A;  3NGI A;  1HYZ A;  4C8M A;  4BE1 A;  4FVM A;  4DTO A;  3OS0 A;  4FLZ A;  1ASW A;  3VQQ A;  3SQ2 A;  3M8R A;  1U47 A;  4NCA A;  4Z4C A;  1DTQ A;  2Q3S A;  3CFO A;  4CJ3 A;  3TAB A;  4C8O A;  5HRO A;  5EU7 A;  4DS5 A;  3HST B;  4DFM A;  4O5B A;  4I9Q A;  4CF8 A;  3HO1 A;  3ITH A;  1NK9 A;  4FLY A;  3NH1 A;  4CGH A;  4AHC A;  1NK0 A;  4W5R A;  4OPK A;  1L3U A;  1K6Y A;  3LZJ A;  4HCC A;  3RR7 A;  4ID5 A;  1TV6 A;  3QIO A;  1SV5 A;  4B8C A;  4CEC A;  1C0T A;  2FBT A;  2QKB A;  1RDD A;  2HHS A;  4LH5 A;  2HHV A;  5SZT A;  1KVB A;  2AJQ A;  1EXQ A;  3RMB A;  4B3O A;  4CGI A;  5DK5 A;  3HM9 A;  1XI1 A;  3KK1 A;  3V9Z A;  4FK2 A;  3HVR A;  1C1B A;  3M8P A;  4FJM A;  3IS9 A;  1EKE A;  3O4Q A;  3LAK A;  3TAQ A;  2BAN A;  4O4G A;  3DOL A;  3IRX A;  3ZSZ A;  4BE2 A;  4KRF A;  1VSK A;  4RW9 A;  4E7L A;  1HNI A;  4IG3 A;  4ZTF A;  2A1R A;  3DI6 A;  4JLH A;  1QHT A;  2ZE2 A;  1S6P A;  3F9K A;  4CIF A;  4DF4 A;  3ZSY A;  4CHQ A;  2P5O A;  2RN2 A;  4QAG A;  2WON A;  2BGG A;  2Z1H A;  2O4G A;  3DLR A;  3MXI A;  4CJE A;  2KFN A;  3QEP A;  3SYZ A;  3OVN A;  3O4N A;  2VG7 A;  1JLB A;  3I0R A;  4M3T A;  3DLE A;  2QK9 A;  4PWD A;  1RTJ A;  1BIS A;  3DLH A;  3TAF A;  5KGX A;  3LAN A;  2IC3 A;  1VK0 A;  5E41 A;  4DTP A;  1RTH A;  4RG8 A;  3AO5 A;  1YTU A;  4FLW A;  2P51 A;  3K5N A;  4DQP A;  4KTQ A;  2IOC A;  2XY5 A;  3MXM A;  4H8K A;  4FZX C;  4CER A;  3AO2 A;  3HVT A;  4EP4 A;  4CHY A;  1KSP A;  4F2S A;  4L8R B;  1A5W A;  4FLU A;  4E7K A;  4OVL A;  3TWH A;  3TAR A;  3MXJ A;  3QES A;  1TK0 A;  5HRR A;  4Z4F A;  4KPY A;  4KV8 A;  3VQ4 A;  3DLG A;  4F2R A;  3NFA A;  1L3V A;  2D0B A;  3KLE A;  3T3F A;  3KD1 E;  1IKV A;  3NF8 A;  2VG6 A;  5KRT A;  4KRE A;  4PA1 A;  3TI0 A;  4CIE A;  4N41 A;  4IFY A;  4KTZ A;  3TAN A;  3NAE A;  4IDK A;  4DQI A;  1VRU A;  5J1E A;  1J53 A;  4KAZ A;  3JSM A;  4M3Y A;  4FJK A;  3AVB A;  4GMJ B;  1S6Q A;  1RNH A;  3V1O A;  3PY8 A;  3NH0 A;  3QEW A;  3V1R A;  4FJJ A;  3AVH A;  4B9V A;  3U6F A;  1JLA A;  3AA4 A;  1KFS A;  4CEE A;  1VSI A;  4DLE A;  1B9F A;  4CJK A;  3SPZ A;  1QE1 A;  3WNF A;  1X9W A;  1BQN A;  1JLE A;  3HPH A;  4CF1 A;  3V9S A;  4HHT A;  1LWF A;  5CYM A;  3HYF A;  4ZTJ A;  3O3H A;  1Q8I A;  1MU2 A;  3AV9 A;  4DFP A;  4R5P A;  4YFU A;  5I42 A;  1QTM A;  1VSE A;  3PUF A;  2FC0 A;  3WNE A;  4J2D A;  5T7B A;  2E4L A;  4CJV A;  4PUO A;  4OLA A;  4IFV A;  4DMN A;  1YVU A;  3OY9 A;  3NGY A;  4DS4 A;  4W5O A;  4KI4 A;  1D8Y A;  3RMA A;  4OJR A;  4DG1 A;  3ZCM A;  1ZBF A;  4AIL C;  4CJQ A;  2HNZ A;  3SUO A;  3VQ7 A;  2OA8 A;  1BI4 A;  5C42 A;  1JLF A;  2QKK A;  1RBS A;  1S1V A;  4GVM A;  2B4J A;  4M45 A;  4CGF A;  3KLH A;  3MED A;  4LH4 A;  3KJV A;  2D5R A;  2HW3 A;  3OYD A;  2ZQB A;  1UA0 A;  3VQA A;  3ZSR A;  1R0A A;  4DSI A;  2IGI A;  4K8Z A;  1TKZ A;  4LD0 A;  1U04 A;  1VSJ A;  3ZSW A;  2OPR A;  3V9X A;  1CLQ A;  3NF9 A;  3QLH A;  1LW0 A;  3QNO A;  4B8A B;  3G10 A;  3LPU A;  1XHX A;  4FJL A;  3LWM A;  1BL3 A;  4CK2 A;  1S9G A;  4ELV A;  3VQP A;  3OYL A;  2HVH A;  2KZZ A;  3O3F A;  1UAX A;  4CEB A;  4KHW A;  4M41 A;  4M3R A;  3L2Q A;  1NOZ A;  1ASV A;  5FRO A;  1UA1 A;  3FFI A;  1T7P A;  1REV A;  2OZS A;  1EP4 A;  2HHQ A;  1F21 A;  4Z4I A;  5CZ2 A;  3RMD A;  1ZBU A;  1JLG A;  3KTQ A;  1C0U A;  3IG1 A;  3AA5 X;  4RW7 A;  1RIL A;  1W0H A;  1VSD A;  2OYQ A;  4KHY A;  5CZ1 A;  4OLB A;  1NJZ A;  3HPG A;  2W42 A;  3SJJ A;  1SUQ A;  3LDS A;  4EP5 A;  3QEV A;  3S3O A;  2JGU A;  3V9W A;  1NJW A;  4B08 A;  4E3S A;  3NGZ A;  3EY1 A;  4HCB A;  4E89 A;  4CJR A;  4B9S A;  5C24 A;  3LWL A;  2G8V A;  2Z1G A;  3LP0 A;  4DU3 A;  4CHP A;  1KVC A;  3AVM A;  4FJ8 A;  3DRR A;  2YNF A;  1TKT A;  5FDL A;  2IAJ A;  3ISN C;  4KKO A;  1RT5 A;  3ALY A;  4E7I A;  1G15 A;  3SNN A;  2XY7 A;  2YKN A;  1XC9 A;  1SKR A;  3HL8 A;  2D0A A;  3BDP A;  1ZBL A;  3WNG A;  2E6M A;  1J5O A;  4F4K A;  2OPS A;  4Z4H A;  1WSE A;  1TL3 A;  3SUQ A;  4E0D A;  3OS2 A;  1C1C A;  1RDC A;  3SQ4 A;  2Z1J A;  4CHN A;  4E7H A;  3HP6 A;  1NK5 A;  4CFB A;  4KHN A;  2D0C A;  4IBN A;  1L3T A;  4M3Z A;  4DTM A;  1BIU A;  1JLC A;  4N76 A;  4IG0 A;  1YT3 A;  4I9L A;  1U48 A;  2DFE A;  2OPQ A;  3L8B A;  5JS1 A;  3DLK A;  3QEX A;  3A2F A;  4NYN A;  3VQD A;  1NKC A;  4MFB A;  1U4B A;  2G8K A;  4FJH A;  4CEZ A;  2I5J A;  4N56 A;  1WSF A;  2R7Y A;  3OJS A;  3RRG A;  1LAV A;  2HHU A;  3SUP A;  3DOK A;  1BGX T;  3D45 A;  4MQ3 A;  4HUG A;  3RRH A;  3RWU A;  1S1T A;  4BWM A;  4UQG A;  4ZHR A;  4J2B A;  1RBV A;  1HRH A;  1S9E A;  1BCM A;  2PYL A;  3NDK A;  3OS1 A;  3F73 A;  3PO4 A;  3P83 D;  1QQC A;  4H4M A;  3QNN A;  3SPY A;  2Z1I A;  1FXX A;  3M8S A;  1EET A;  4FZZ A;  4FJ9 A;  4DFJ A;  2YHA A;  1IH7 A;  2X74 A;  4KB1 A;  4FZY A;  4BWJ A;  1NJX A;  2YKM A;  1HJR A;  4CF9 A;  2VG5 A;  3P1G A;  1WNS A;  3DRP A;  3PX4 A;  4I2P A;  1LWE A;  4LSL A;  4DLG A;  4W5T A;  4CJS A;  3SQ0 A;  1NK8 A;  3CFR A;  2RPI A;  3HP9 A;  3ZT0 A;  3L3V A;  4FJ7 A;  4OGE A;  1QS4 A;  3NBP A;  1CZB A;  1WAF A;  4DTN A;  3SZ2 A;  3NH2 A;  4XIU A;  4FK0 A;  4Y1D A;  4KB0 A;  2G8F A;  1TVR A;  1TK5 A;  3L2U A;  5HRS A;  2HND A;  4FYD A;  4CEQ A;  2F8T A;  1ZBH A;  4BDZ A;  3K5L A;  1N6Q A;  3L3U A;  4AHV A;  4N5S A;  1CXQ A;  3OJU A;  4DSL A;  4FJG A;  4J2E A;  1KVA A;  4FXD A;  1KFD A;  4E1N A;  3ZSQ A;  2DFH A;  4KHS A;  4CHO A;  4CEF A;  4CE9 A;  4OPJ A;  3C95 A;  3T1A A;  3E01 A;  3OYM A;  4O0I A;  4FM1 A;  4DTJ A;  1I3A A;  4H4O A;  1FK9 A;  4QCL A;  3SV4 A;  1WSG A;  1S1W A;  4CFA A;  4CK1 A;  3T19 A;  3OYF A;  4PY5 A;  4ELT A;  1TK8 A;  4FJX A;  4Z4E A;  3U3G A;  3EZ5 A;  3JYT A;  2KW4 A;  1HQU A;  2O4I A;  1Z25 A;  2XY6 A;  2YV0 X;  3K5O A;  3B6O A;  5J2M A;  4CF2 A;  4DSE A;  2XHB A;  3PX0 A;  4HTU A;  1QSL A;  4DWI A;  4RW6 A;  3KIO A;  3TAM A;  4Q0B A;  4M42 A;  3LP2 A;  4CFC A;  1J9A A;  4JRP A;  1S1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...