2QKBA

Human rnase h catalytic domain mutant d210n in complex with 20-mer rna/dna hybrid
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
GSHMGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna/rna
molecule keywords 5'-R(*GP*GP*AP*GP*UP*GP*CP*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*
total genus 45
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2qkbA00
3OVNA 5KGXA 4QOZB 4KPYA 2G8HA 2OPRA 2P51A 2P1JA 2RF2A 3V81A 4R5PA 1L3SA 3FFIA 3K57A 1S6QA 1D5AA 2PYLA 1BL3A 1S1WA 1N5YA 3TARA 2FBTA 2F8SA 1NK8A 3K5MA 4E1NA 4CJSA 1YT3A 2XO7A 5DMRA 3LPTA 3C94A 5HRPA 4E7LA 3ZSQA 4CJVA 1WSFA 1SKSA 3LAKA 5HBMA 1EETA 4FLYA 1WN7A 4CEBA 4FLUA 4OKEA 3KK2A 4Z4EA 4DSIA 4CHNA 2Z1HA 3NF7A 4FW2A 3F9KA 4OLAA 2W42A 3LP0A 4B8AB 4DG1A 1TL3A 3RR7A 3NAEA 4RG8A 4DTXA 3OYGA 1T8EA 4MFBA 4KREA 4ELTA 3OYHA 1TKXA 4F8RA 4E7KA 1GOBA 4BDYA 3V9UA 1UA0A 4DTJA 1A5XA 4OPKA 3QEXA 4FXDA 5I3UA 3DLGA 4IBNA 1HYSA 3HPHA 4C8MA 2HVHA 3SPZA 4N41A 4CJUA 3AA2A 3HVRA 4BE0A 1HQEA 1A5VA 3HP9A 1NK7A 1HNVA 2OYQA 1VSHA 4C8LA 2VWKA 5DK5A 2G8FA 4NCGA 3NGIA 4DQQA 3DOKA 1LW2A 4PY5A 4KB1A 1BQNA 4KHYA 1TAUA 1RBRA 1WLJA 1BISA 4LD0A 1S9GA 1RNHA 1RBUA 1VSKA 3E01A 2OZMA 3V6DA 4DQSA 3M8RA 3DLKA 1NK5A 4M3WA 4QAGA 2HHUA 1LAVA 4Q5VA 4Q0BA 1JLCA 1X1PA 4FZZA 3OYAA 4KAZA 3MEDA 3KLGA 3HM9A 1U47A 3OJUA 2IC3A 3MAQA 4DSLA 4N76A 4KB0A 1UOCA 5HRSA 1F21A 5CZ1A 3O3HA 3SPYA 4B9NA 1HMVA 2D0CA 1L3TA 4CK2A 4BE2A 3PUFA 4H4MA 4DFMA 4IDKA 3NGZA 3VQPA 3ZSVA 2DFHA 5FRMA 3CM6A 3PX0A 4B08A 3OYCA 2F8TA 1GOAA 3ZT2A 3SUQA 4DQIA 3DYAA 4RW6A 4DTMA 4E7IA 4PWDA 2PZSA 3P5JA 4GMJB 1DTQA 4KHSA 1IKXA 2D5RA 2OZSA 4E7JA 3KLHA 4CECA 2HHVA 1RT7A 3AVGA 1JLAA 4B8CA 4FJMA 3NE6A 4IFYA 4CEEA 2BE2A 1EXQA 3KIOA 1KVAA 4RW4A 4CFCA 1WNSA 1RTJA 5J2NA 3TAGA 4W5NA 3SJJA 3KK3A 3S3MA 4K8ZA 2QXFA 4FCYA 1NKBA 3NF8A 4Y1DA 3OYLA 4G1QA 3AVMA 3OYBA 1RBVA 2BANA 1EX4A 5CYMA 5KRTA 4FJLA 4JRPA 2YHAA 3ITHA 3M8QA 3LPUA 3LWLA 4DU1A 1TKTA 3NGYA 5E41A 1QSLA 1VSLA 3VQQA 1RDDA 4OVLA 3WNEA 1C0TA 3ZT4A 4L8RB 4FJJA 4ICLA 4FJNA 4Z4IA 4EZ6A 2XY7A 4DU3A 3LDSA 2HNYA 4FLXA 4DFJA 1S9EA 5HROA 3MEGA 3WNFA 4IFVA 4BE1A 3C6TA 4M3RA 4AH9A 3K59A 2HHQA 4OGCA 1B92A 5C42A 3VQ8A 4FJKA 3SUPA 3NBPA 3LANA 3HPOA 2IAJA 3CM5A 3VQ9A 3ZSZA 5KGWA 4J2BA 3OYMA 3V9ZA 4I9QA 2DY4A 4JLHA 3NH2A 2E6MA 3TAFA 2DFFA 3WNGA 1BQMA 3JSMA 3RMCA 1BIZA 4KV8A 4CJRA 5SZTA 3BDPA 3PO4A 3PY8A 4FJ8A 1Z26A 1KSPA 4CJ4A 2GBZA 3SQ2A 4CF0A 4HUFA 1RTHA 3T1AA 1S6PA 4CEOA 1Y97A 4AHRA 4CIGA 4CK3A 4DFPA 3AO5A 2I5JA 3SCXA 4QCLA 2VG6A 4KKOA 5FRNA 1RDCA 4W5QA 1B9DA 1S5JA 4M3UA 1ZBHA 1Z25A 3V1QA 1S1TA 3K5LA 2ETJA 1ASUA 3DRPA 1WAFA 3V9WA 2QKKA 4CGDA 4HVJA 1RT1A 3G10A 3ASMA 4J2DA 4N5SA 3AVAA 4FYDA 4CJEA 4YFUA 1HNIA 2OPPA 3AV9A 3WNHA 4CGJA 3EY1A 4AHCA 4DQPA 4O5BA 1QSSA 4PA1A 1J9AA 1HJRA 2HNDA 2RPIA 4HCBA 3HP6A 1LWCA 2QK9A 3QEIA 2HMIA 4Z4CA 4I9LA 1VSMA 3V9XA 2OPSA 3IG1A 1DLOA 3S3OA 3P83D 4FJXA 1Q9XA 4FK2A 3RWUA 3QEWA 3AVNA 3QIPA 2R7YA 1UA1A 1RT6A 2X6SA 1J53A 3M8PA 3O4QA 3D45A 4FJGA 1TKZA 1NJZA 1TKDA 2LSNA 1S1VA 3KK1A 3A2FA 2EX3A 1NKCA 3ZSWA 4F3TA 1S1UA 3V4IA 2X74A 5KRSA 5J2PA 1R0AA 1ZBFA 3HK2A 2D0BA 3DLBA 3VQ4A 1I39A 4FJ5A 2YNGA 3CFRA 1J54A 3RMAA 3AO4A 4JS4A 1NK9A 1L3UA 1J5OA 3SZ2A 3DLEA 3QESA 1XI1A 3SNNA 3G0ZA 3QIOA 2KZZA 5HP1A 3KLIA 1IH7A 2D0AA 3DOLA 4CERA 4CIFA 3EZ5A 3DLHA 4ID5A 3QNNA 4I2PA 4KFBA 3QETA 4B9SA 1QHTA 2JGUA 3NF6A 4OKKA 2WONA 1GOCA 3RRGA 4FLZA 4B9MA 3QLHA 3VN5A 1X9WA 3OYNA 5KTQA 1IO2A 3EYZA 3HL8A 3HT3A 1U48A 1BHLA 1XHZA 3OY9A 3MXJA 4BDZA 4HHTA 3OYJA 4ZTFA 1QE1A 4CHQA 1BCOA 1IKVA 1ZBUA 1VSJA 4KHQA 3RTVA 3ISNC 1VRTA 4DS5A 4FLTA 3PO5A 2E4LA 2Z1IA 4DS4A 2WOMA 3LP2A 4O4GA 4DSKA 1VRUA 2YHBA 3ZCMA 3L2QA 3F73A 3ZSOA 5FROA 4HTUA 4CGHA 4CGGA 4FLVA 2BDPA 3B6PA 4KTQA 3VQ7A 4CEFA 4N56A 3I0SA 2HHWA 5SWMA 1JXEA 4OLBA 1HYZA 4LSNA 1TK5A 3AVJA 5D3GA 1NOYA 4F2SA 2G8WA 1JL1A 3HYFA 4CHZA 1VSDA 3RMBA 1XWLA 4CJTA 2YNFA 1RT2A 3K58A 4FZYA 1TGOA 3P1GA 5HLFA 1T03A 4J2AA 4BACA 3HJFA 2YNIA 3KD1E 1WAJA 1I3AA 1KTQA 3K2PA 2KQ2A 4CFDA 4CJPA 4KRFA 3OYEA 3QEPA 2A1SA 3DRRA 3O3FA 5CY4A 4CF9A 1CXUA 3NHGA 3BGRA 4IKFA 4DWIA 1RT5A 5EU7A 3KTQA 3U6FA 1EP4A 4DQRA 4CEAA 4DSJA 3SV3A 1QQCA 3OYDA 4KO0A 4CIEA 4CGIA 4CJ3A 3AA5X 1XHXA 1REVA 3LALA 1NKEA 4CF2A 3IAYA 1C6VA 2G8KA 2VG5A 1K6YA 3LP3A 4MQ3A 2HB5A 2Q3SA 3HSTB 1RBSA 4OKJA 3ZT3A 4W5OA 1N6QA 4Z4GA 1UWBA 4B9UA 2YNHA 4M42A 2KFNA 1TK8A 1WSEA 3ULDA 1FKPA 4O0JA 4M3TA 1EKEA 4AHTA 3L2VA 2VG7A 3DLRA 1IKYA 1ZBLA 4ZHRA 3LZIA 3RR8A 3OS0A 2B5JA 4E0DA 3OYFA 1IG9A 1CXQA 1C0UA 3JYTA 2YKMA 3PX4A 2G8UA 4B9TA 4FJ7A 4KI6A 4YNQA 2DTUA 2YKNA 3U3YA 1ITGA 3VQ6A 4NYNA 1QTMA 3ZSRA 2NUBA 4CJWA 4I7FA 2X6NA 3K5NA 4DMNA 3ZSYA 3AVKA 3I0RA 3NFAA 4AHUA 3AVIA 2KTQA 3C6UA 4EP5A 4CGFA 3LP1A 1JLBA 4CK1A 3AVFA 3NH0A 2FBVA 2O4IA 1RTDA 4KHNA 1C0MA 1WSJA 2ZQBA 4DU4A 1U49A 5HRRA 4AHSA 1WSGA 3VQAA 3VA0A 2B6AA 4IG3A 1CLQA 5CZ2A 2IS3A 3AVCA 3KJVA 1X9MA 3MXIA 2HHTA 4CEDA 4H4OA 3NH1A 1C1CA 1RCHA 4I2QA 1XC9A 4DTNA 1BI4A 2KFZA 2B4JA 1A5WA 3I8DA 3AA3A 4ZTJA 3ZT0A 4J2EA 1IKWA 1YVUA 4HUGA 2DFEA 5KI6A 3CYMA 3AO3A 3SYZA 1LW0A 3TANA 3RMDA 4F4KA 3TABA 4NCAA 3KKRA 1VSIA 3CG7A 3DI6A 4GVMA 3LWMA 4Y1CA 2Y1IA 4Z4FA 3QO9A 4M41A 4CESA 3KKSA 1NK6A 2PYJA 3TI0A 3SQ1A 1RDAA 2F96A 1DTTA 4BWMA 4FM2A 3RRHA 4AILC 4RW7A 4DFKA 4W5RA 3AO1A 4RW9A 1NJYA 2KW4A 4FJHA 5J1EA 5I42A 5J2QA 1UAXA 4TSXA 4FK4A 1LAWA 3DRSA 3SV4A 2XY8A 4LY7A 1U4BA 4C8KA 4F2RA 3B6OA 3VQBA 1LWEA 4GW6A 1KVBA 3OYKA 3M8SA 1FKOA 3ZT1A 2KZMA 1RDBA 4B9VA 3D0PA 4FW1A 4LH5A 4DTRA 3OS2A 3C95A 3PX6A 4M45A 1NK4A 4AHVA 3DMJA 4Z0UA 1KVCA 3NF9A 4FZXC 1KLMA 4CJQA 1TL1A 1JLEA 4EP4A 1YTAA 2Z1JA 3U3GA 3CFPA 3SUOA 1SL0A 1RT3A 1S1XA 1TAQA 2HW3A 3L2UA 1HQUA 2HHXA 1HRHA 3VQ5A 2Y1JA 1BIUA 4KHWA 2XY5A 3HXMA 4CEQA 4LH4A 4CE9A 1B9FA 3VQCA 3TAEA 1ASWA 4OGEA 1JL2A 1HPZA 4CJ5A 1MU2A 3ALYA 3OJSA 1QS4A 2JLEA 1G15A 4RW8A 2E6LA 4WE1A 2OA8A 4Z4HA 1JLFA 3L8BA 1SL2A 3VQEA 4HCCA 1T7PA 3NDKA 1JLGA 4E89A 3KD5E 1SKWA 1RBTA 3AVBA 3S3NA 3SQ0A 3NCIA 4FVMA 3TAQA 5J2MA 4FM1A 4E7HA 4M3XA 4M3YA 4H8KA 2QKBA 2GV9A 4KTZA 1RTIA 3KLEA 1O1WA 1RT4A 1NJWA 2EHGA 3V9SA 4FJ9A 3V1RA 3HVTA 4HUEA 3L2WA 1KRPA 3AO2A 4CJKA 3AVLA 1LV5A 1LWFA 4K8XA 1ASVA 2X78A 1FK9A 1WSHA 2OPQA 4B9LA 1HYVA 2AJQA 4CFBA 1JKHA 5C25A 3TAPA 3SUNA 2IDOA 1L3VA 1VSEA 1QSYA 2A1RA 4B3OA 1NK0A 1ZBIA 2HVIA 4CJLA 2P5OA 4LSLA 4C8OA 5JS2A 2Z1GA 4E3SA 4ELVA 2RN2A 4O55A 2XHBA 3LZJA 2P5GA 3VA3A 3UIQA 1SL1A 4NCBA 4O44A 4DLEA 1SKRA 2PY5A 1D8YA 4CHYA 4UQGA 5CYQA 1Q9YA 3L2RA 3OS1A 3SI6A 3SQ4A 1BI4B 1X9SA 4CHOA 4E1MA 4EZ9A 1C1BA 4C8NA 1NJXA 2YV0X 2ATQA 3AA4A 4O0IA 3HPGA 2BGGA 4CF8A 2RKIA 1TVRA 4BDPA 1Q8IA 5FDLA 2IGIA 2FBXA 4FLWA 1L5UA 3IRXA 3DM2A 4CHPA 3S9HA 4NYFA 4DTUA 3AVHA 3TAMA 2G8IA 4CF1A 4N47A 3CFOA 3V1OA 3K5OA 4JRQA 3H08A 3O4NA 4ID1A 2HHSA 4OJRA 1CZBA 2O4GA 3QINA 3ZSXA 1ZYQA 4BWJA 1CZ9A 1KLNA 5K14A 4CCHA 4FK0A 4JS5A 3QERA 1SUQA 2FBYA 2IOCA 3VQDA 3L3VA 2GUIA 1T05A 5JS1A 1WSIA 3IS9A 1VSFA 3L3UA 4PUOA 4E19A 3TWHA 1YTUA 3KLFA 1RILA 3O3GA 1KFDA 1VK0A 4DSFA 4DTSA 5C24A 1BCMA 3T19A 4DF8A 3LAMA 3THVA 4KI4A 1NOZA 2FC0A 4IG0A 4OPJA 3MECA 4M3ZA 4DLGA 1KCFA 4CJFA 4FJIA 2XY6A 1W9HA 4KHUA 4ELUA 1C1AA 2G8VA 1SV5A 3CQ8A 2ZE2A 3QEVA 1JXBA 5HRNA 4DTPA 2ZD1A 1JLQA 3HO1A 3TR8A 2XRIA 3OYIA 3QNOA 2ITGA 1D9FA 4DTOA 4DF4A 3PV8A 4CEZA 1BGXT 1FXXA 1U45A 1TV6A 4XIUA 3T3FA 3MXMA 4W5TA 4KTWA 5T7BA 3MEEA 2VWJA 1KFSA 4CFAA 4F3OA 2HNZA 4PQUA 1TK0A 1W0HA 1U04A 1D9DA 4FM0A 4DSEA
chains in the Genus database with same CATH superfamily
4WFNL 4KPYA 2G8HA 2P9LB 3FZFA 3V81A 5B8HA 1D5AA 2PYLA 1BL3A 1E4FT 4BC4A 3F5TA 3K0SA 2KLAA 3BF1A 1Q82O 3ZSQA 4CJVA 4FLUA 5AQOA 3O80A 1KAYA 4FW2A 3L4QA 4B8AB 1NNEA 4IZ9A 3NAEA 4DTXA 2FF6A 3VEZA 3WXMB 3ZYYX 1T6DA 3OYHA 1TKXA 4ISGA 4F8RA 3A8YA 5GINA 1A5XA 5GAGP 4DTJA 4OPKA 2QWQA 3QEXA 5I3UA 2YHWA 4IBNA 4CZKA 3SPZA 3J7ZO 3HVRA 5AZJB 3NGIA 4C1NI 4CBXA 3PSFA 2E1YA 4PY5A 3R8EA 1BQNA 4KHYA 4WF9L 1RBRA 4LFCK 1WLJA 1NMDA 3V6DA 2HHUA 4BROA 4Q0BA 3J8AA 1X1PA 3KZBA 3OYAA 1N34K 4JI4K 2DPNA 2D0PA 3OJUA 4DSLA 3QBXA 2JWKA 3J80O 2A6AA 4JKFA 4B1VA 5CZ1A 4B9NA 2D0CA 4BE2A 4FWRA 4IDKA 3OYCA 1GOAA 1TYQA 3ZT2A 4RW6A 5AQVA 3WEEB 5FPDA 2F7TA 2HHVA 3AVGA 4FJMA 2HHHK 3D2FA 1EXQA 5J2NA 1RTJA 1QVGM 4JI8K 3S3MA 1CZAN 1KXPA 4RWTA 4G1QA 4FJLA 5KRTA 2ASOA 2YHAA 3ITHA 3LPUA 3LWLA 4DU1A 1DKGD 5FLXO 4OVLA 4FJNA 4JI2K 2XY7A 4DU3A 2HNYA 4FLXA 2ZJQL 5HROA 3MEGA 3WNFA 1BA0A 5CR4A 4M3RA 3TSPA 4AH9A 3K59A 1GLJO 1HLUA 3VGLA 3VQ8A 3NBPA 3OTOK 5EVZA 2QM1A 3OYMA 4I9QA 2DY4A 3NH2A 5JLHA 3VOVA 3A5NC 4CJRA 1X3MA 2ZJPL 3BDPA 1DGKN 1Z26A 4CJ4A 4FOIA 3THXA 3T1AA 1Y97A 4CK3A 1W7AA 1EO1A 2VG6A 4KKOA 1S5JA 1Z25A 3LDOA 5GIPA 2ETJA 3QBWA 3ASMA 3VMFB 4AQYK 5HOOA 4N5SA 5C0YA 5CHIA 1BG3A 4YFUA 3AV9A 4O5BA 4PA1A 4JKGB 2HNDA 2QK9A 3KWIA 3HP6A 4DR6K 2AP1A 2Q0RA 2HMIA 4Y0WA 3VEOA 3IG1A 4FWKA 4GV3A 4FK2A 1VQ4N 3AVNA 1NU0A 1MWKA 1RDUA 1J53A 1SS6A 3CCUN 1NGFA 1NJZA 2LSNA 4DR4K 4NLBA 3V4IA 2X74A 5KRSA 1ZBFA 1ZXOA 1C0FA 3DLBA 3VQ4A 3S41A 3CFRA 3RMAA 1SZ2A 2NRRA 2HBJA 3SZ2A 3DLEA 1XI1A 4AM6A 2J4RA 3DOLA 4CERA 1ZC6A 1QHTA 4OKKA 2WONA 1GOCA 1KC8O 4FLZA 2YJFA 5C15A 1X9WA 4BR4A 1QQNA 4FPBA 5ADXA 3CERA 4ZTFA 3AAQA 1VSJA 2QW9A 3BEXA 2WOMA 5AQKA 1VRUA 2YHBA 1X9JA 4CEFA 3QICA 3MCPA 4H0OA 4DV5K 1NOYA 4V19S 4PHTX 3TTFA 4XH1A 1JL1A 1GLEG 1VSDA 3RMBA 2YNFA 5HLFA 2P9KB 4BACA 2YNIA 1NG9A 1I3AA 5AFUA 1KTQA 2KQ2A 4FSVA 3OYEA 2VQFK 3QEPA 4IKFA 3FZMA 4DV1K 5EU7A 3K9JA 3T1HK 1QQCA 4KO0A 4CIEA 2W6KA 1XHXA 1REVA 1NKEA 3ENHA 4MQ3A 5AQZA 2Q3SA 1N6QA 4Z94A 4W5OA 5JLFA 4Z4GA 3WEEA 3OBWA 1N8RO 2KFNA 3HOSA 3ULDA 4M3TA 4AHTA 1IKYA 1YF5L 3LZIA 4BC5A 3E9OA 2B5JA 4E0DA 1IG9A 3PX4A 5C2DA 3U3YA 3VQ6A 4B1UB 5MLCQ 3ZSRA 1HKGA 2NUBA 4I7FA 4DMNA 3AVKA 5IT9O 3SAGA 3BUZB 4BRAA 3CXCM 1IV0A 1EQYA 1U6ZA 4ISFA 4KHNA 1C0MA 2ZQBA 1U49A 3RVCA 1GLBG 3VQAA 4IG3A 2CGLA 5CZ2A 3UKRA 1X9MA 1IBLK 2V52B 4FPAA 4I2QA 4WQ4C 3CMEN 1A5WA 3I8DA 4ZTJA 2GUPA 1IKWA 1YVUA 2DFEA 3CYMA 3W3DA 4CZFA 4H03B 3RMDA 3CG7A 3CJCA 2A40A 4M41A 3SQ1A 4AILC 1WBBA 3AO1A 4M7YA 5J2QA 5I42A 4DHYA 4TSXA 4F2RA 4C8KA 3B6OA 2Q0UA 3OYKA 3M8SA 3AGRA 1RDBA 4B9VA 4FW1A 3O1BA 1NK4A 4I6MA 4AHVA 3DMJA 3ZX2A 1KVCA 3CPEA 1KLMA 3RSEB 3SUOA 1YTAA 4FWMA 3U3GA 3CFPA 1RT3A 1TAQA 2HW3A 3BP8A 2HHXA 1HRHA 2Y1JA 1M1KO 4CEQA 4LH4A 4CE9A 3VQCA 1HPZA 4CJ5A 2WFBA 2JLEA 1G15A 4WE1A 1K8AO 3EO3A 1JLFA 3FZLA 1YI2N 3S3NA 1YXQA 3TAQA 4FM1A 4E7HA 4M3XA 5AQUA 4BRHA 1RTIA 1NGJA 4M63C 1WB9A 1NJWA 4KH5A 2EHGA 3V9SA 3DJCA 3V1RA 4HUEA 1E3MA 3AVLA 1LV5A 4IXCA 2X78A 3P38A 3WXJA 3SUNA 1QSYA 1VSEA 1JCGA 3IDHA 2D0OA 1NK0A 4C8OA 4DB3A 1HNZK 4CZLA 5AQFA 5AQXA 2YX6A 4NCBA 1WUAA 1KD1O 3RSEA 1NGEA 4CHYA 5DM7L 3U9ZA 2E8AA 4CHOA 4MO5A 3AA4A 2ZF5O 3ENBA 3O08A 4BDPA 5AQSA 3TSUA 2IGIA 3N4PA 3IRXA 4CHPA 4NYFA 4XEIA 4DTUA 3AVHA 4PL7A 5AQMA 4CF1A 2V51B 5AZJA 4DUYK 4MLHA 4BVOA 1CZBA 2O4GA 3LDPA 1GLLO 1CZ9A 3JAMO 4CCHA 3IFRA 3QERA 3VQDA 1JCEA 2P9IB 5JS1A 3IS9A 4H0VB 4CVNE 1OH5A 3KLFA 3ZEUB 1KFDA 1HNWK 4DTSA 4JN4A 3TU5A 4KI4A 3QMLA 4IG0A 4DLGA 5AJ3K 2XY6A 4ELUA 1Q7YO 3CQ8A 3WT0A 3HO1A 4X65K 3TR8A 3QNOA 3WXKA 5C2FA 4FVUA 4CEZA 1BGXT 4B9SA 2A42A 4W5TA 1KFSA 4PQUA 4F3OA 4NB4A 1U04A 4BQZA 4JI1K 3SAFA 3WQUA 2OPRA 2P51A 2P1JA 2RF2A 1OH6A 4R5PA 3FFIA 3ATVA 1S6QA 3AGKA 3D7EO 1RGIA 4GKKK 3K5MA 4E1NA 5DMRA 3C94A 2IVPA 5HRPA 2E88A 3VESA 5AQGA 5HBMA 1EETA 4WFAL 4FLYA 4OKEA 4Z4EA 5F2RA 4CHNA 3F9KA 3JS6A 4DG1A 1TL3A 4BRNA 3FZKA 4RG8A 4ISEA 3MX2A 1T8EA 4MFBA 2O8CB 3VENA 4ELTA 2UUAK 1UA0A 4BDYA 3V9UA 1HPMA 3DLGA 3HPHA 4C8MA 2HVHA 4N41A 3AA2A 3HP9A 1NK7A 3J7YP 2OYQA 4C8LA 5DK5A 3C6HA 4DQQA 4KB1A 4LFAK 1BISA 4LD0A 1RNHA 3E01A 4DQSA 4M3WA 1LAVA 4Q5VA 3THWA 3CJ1A 4KAZA 5LY3A 5KQDA 3KLGA 2UUCK 4A59A 3IUCA 3CJBA 4C23A 1LOTB 2IC3A 1F21A 3O3HA 4CK2A 3VQPA 2E20A 3ZSVA 5E84A 4K42A 3G71N 4BC2A 4DTMA 3GE1A 1V4TA 4O8KA 4KHSA 2P9PA 5AZIB 5M1OA 1W2BM 3DWLA 3KLHA 4JNEA 3EKUA 1YUWA 2V7YA 4CEEA 5I9EB 1VQ5N 4JKEA 3KIOA 1KVAA 3CHWA 4RW4A 3WXIA 3TAGA 1P8ZA 3KK3A 4FCYA 3NF8A 1S3XA 4Y1DA 3AVMA 5CYMA 2AA4A 1TKTA 1N33K 1RDDA 4DUZK 3WNEA 1C0TA 2W41A 4EZ6A 3M5RA 4DFJA 1S9EA 4IFVA 5BRDA 1OVYA 4KBOA 5C42A 4BGAA 3SUPA 3LANA 3VQ9A 3ZSZA 5KGWA 4YOXA 4J2BA 3QB0A 3V9ZA 4JLHA 5EX5A 2E6MA 2D4WA 2DFFA 2P9PB 4KV8A 3L4IA 3PY8A 4FJ8A 3E9LA 2JWLA 1E4GT 4HUFA 2ITMA 3VGKA 4BGBA 1RDCA 3ATUA 4JEPA 4W5QA 1S1TA 3C7NA 4OPHA 3V9WA 2GELA 4CGDA 1RT1A 4J2DA 3O1WA 1VQNN 3BZCA 4CI6A 1HNIA 5BRFA 3QDKA 3AARA 4H5WA 2ZJRL 1QSSA 1HJRA 4B1ZA 2RPIA 3UKRB 3MN9A 3CF5L 2HBMA 4I9LA 3J7AP 3V9XA 2OPSA 3SLCA 4DR1K 1DLOA 4FJXA 3P83D 1GLCG 1UA1A 1RT6A 3O4QA 4WQ4A 3KK1A 2EX3A 3T7ZA 3CCQN 3HK2A 4JKBA 1J54A 2UXBK 1T3VA 1NK9A 1L3UA 5AFUH 3QIOA 1IH7A 3EZ5A 3ULEB 4IOCL 1N36K 3VN5A 3W0LA 4GY2B 1IO2A 3OY9A 3MXJA 3CIPA 1QE1A 1ZBUA 1IKVA 1BDGA 3CCLN 5FPMA 4DS4A 3J81O 3LP2A 1MDUB 3ZCMA 1X3NA 3L2QA 1MWMA 4HTUA 5FROA 2A41A 2NRTA 4CGHA 2BDPA 4FLVA 4KTQA 3VQ7A 4N56A 1JXEA 3CQYA 1HYZA 1TK5A 4BQLA 1JJ2M 1IG8A 5M1FA 3TPQA 3HYFA 4QS8A 2QTDA 4C1NK 2HF3A 3K58A 1RT2A 1FW6A 4DR2K 1K73O 3P1GA 1T03A 1WAJA 2P9KA 3VTIA 3FFKB 2QWNA 3WXLA 1NGGA 3BGRA 3KTQA 1EP4A 3CCJN 4DSJA 3O4WA 2UU9K 4CGIA 2IVNA 3IAYA 4FOEA 2G8KA 2VG5A 3LP3A 2HB5A 3P39A 4FL9A 1UWBA 4M42A 5AZIA 3U9DA 3E1YA 1TK8A 1GLDG 2V7ZA 2VG7A 3DLRA 1U2VB 3RR8A 3R9PA 1CXQA 2WBNA 3K9KA 2YKMA 4B9TA 1GLAG 4FJ7A 4GV6A 2DTUA 2WUSA 4JK8A 1ITGA 1IBMK 1KQSM 1YVNA 3LM9A 1BA1A 4CJWA 1VQ9N 3R3LA 1SQKA 4AHUA 3AVIA 2KTQA 3CC2N 4IFEA 3LP1A 1ATNA 1RTDA 4YDUC 2FF3B 2BTFA 4DU4A 4AHSA 3D6RA 1QZ5A 3VA0A 2IS3A 2ASMA 3AVCA 3KJVA 5AQIA 4YOYA 3G6EN 3NH1A 1C1CA 1RCHA 4DTNA 2B4JA 4BRMA 3ID8A 1G99A 3CQXA 4BRKA 4J2EA 5KI6A 1LW0A 4H0PA 4MLEA 4F4KA 3TABA 1VQLN 2Y1IA 4GVMA 4Y1CA 4Z4FA 1O13A 3QO9A 4CESA 3KKSA 4H5NA 2PYJA 2HBKA 1RDAA 2F96A 4BWMA 4DFKA 4RW9A 3ENOA 4BR7A 4FJHA 2VCPA 1UAXA 3H3NO 4LF4K 1LAWA 4RCHA 3SV4A 4LY7A 2UXDK 1HNXK 3OS2A 3PX6A 4M45A 4Z0UA 4OX9K 2O8EB 5GIOA 1TL1A 4B1YB 4CZJA 4M7XA 1HQUA 4BY9C 3HXMA 3CETA 1MU2A 3OJSA 3LWMA 4GKJK 4QCLA 4JK9A 2E6LA 1SL2A 4BRPA 3NVMA 5JVGL 3KD5E 4DR3K 1RBTA 3SQ0A 5KPTA 1S22A 3DAWA 4M3YA 4H8KA 2F4VK 4KTZA 3KLEA 2A3ZA 4FJ9A 3L2WA 2FLOA 4CJKA 4K8XA 1K9MO 1HYVA 2AJQA 1JKHA 3TAPA 1I94K 4B3OA 5JS2A 2Z1GA 4ELVA 2XHBA 3LZJA 3MK6A 2IIRA 1VQ8N 5M1PA 1SKRA 2PY5A 5BPMA 1VAZA 4UQGA 3AAPA 4QS7A 5CYQA 5BRHA 3OS1A 3SI6A 3MX5A 1X9SA 4C8NA 5AR0A 1NWKA 4L3QA 4PKIA 4B3TK 2QWMA 2FBXA 4FLWA 3FE1A 3DM2A 2QI2A 3CI5A 5F1XA 1XNQK 3TAMA 2G8IA 3V1OA 3FR0A 4JRQA 3FZHA 3H08A 2HHSA 4OJRA 3QINA 3ZSXA 1ZYQA 4BWJA 2P9LA 1KLNA 3THYA 4FK0A 2W40A 3M3ZA 2Q1NA 2IOCA 3L3VA 3CCRN 1QZ6A 2ZGYA 4DV4K 1VSFA 4JKCA 3TWHA 1YTUA 1HKBA 1RILA 3OA9A 4DSFA 5C10A 2YJEA 4KHPK 3THVA 2FC0A 1DEJA 4OPJA 4CJFA 3CCSN 3MWTA 2ZE2A 3QEVA 1JXBA 5HRNA 1JLQA 2CH6A 4B1XB 2XRIA 4DTOA 1U45A 1FXXA 2CGJA 1TV6A 2HSTA 2NLXA 4XIUA 4K41A 5T7BA 3MEEA 4HWIA 2VWJA 1P90A 1K8KA 2HNZA 4K0KK 4LF8K 2W6LA 1KAXA 4DSEA 3OVNA 5KGXA 3MN5A 4NO7A 4JI5K 4BR9A 3K57A 3C6AA 5DM6L 1S1WA 2FBTA 3OBYA 2QWOA 1Y64A 2F8SA 1NK8A 1YT3A 1HJOA 2XO7A 4YOWA 4G9ZA 1SKSA 1WN7A 3KK2A 2Z1HA 4A61A 4OLAA 3LP0A 1VQMN 2VQEK 2O8DA 3VERA 2HOEA 2IVOA 3OYGA 4KREA 1EWRA 1D4XA 1GOBA 1RDWX 4CZEA 2O8CA 4LF9K 4FXDA 2GWJA 1HYSA 4ILHA 4CJUA 2HF4A 3IMXA 4BE0A 3VEWA 1A5VA 1S72N 1VSHA 2VWKA 2G8FA 1QHAA 4NCGA 3DOKA 1LW2A 3Q7CA 1TAUA 2F8TA 5LMNK 2YCHA 1NK5A 3DLKA 1ATRA 3CJ9A 3ZETA 3C65A 2GX9A 5AQNA 1NLVA 3I8BA 3KK7A 3ZEUA 3FGUA 3TTCA 5KPRA 1OKJA 4N76A 5GAEP 4KB0A 1UOCA 5BR9A 1HMVA 1L3TA 3PUFA 4H4MA 4BRIA 4DFMA 2DFHA 3CM6A 2YI1A 3SUQA 2A5XA 4GV9A 2QA4N 4E7IA 4PWDA 2ZGZA 4JKAA 1DTQA 1HUXA 3TTDA 2OZSA 1JLAA 4B8CA 3NE6A 2FSNA 3VEYA 2BE2A 5AQPA 1WNSA 5AQHA 2VGNA 1NKBA 3OYLA 1RBVA 4JRPA 3M8QA 4F9OA 1XUPO 3A5MC 1QSLA 1VSLA 1HR0K 4BRDA 4FWSA 1XMQK 4L8RB 4ICLA 4DR5K 3E9PA 3LDSA 3O9UA 5LJWA 2O8BA 4H0YB 3SK3A 4BE1A 4DCHA 4BRLA 1B92A 4JKGA 5JVHL 3LDNA 5AQYA 3CM5A 5AQTA 2VGMA 5BPLA 3P31A 1BWFO 3RMCA 3PO4A 5SZTA 1Z6RA 2F9WA 1VQON 4ILJA 1YJWN 1S6PA 4AHRA 2E5LK 4DFPA 3AO5A 2I5JA 5M1QA 3WQTA 3SAHA 1ZBHA 2QWPA 3K5LA 5TKYA 1WAFA 4IEEA 4WQ5A 4FYDA 4YOVA 2OPPA 1J9AA 4H5RA 4BC3A 1LWCA 3QEIA 2ZWHA 1VSMA 5LJVA 1T6CA 3VETA 3S3OA 1JCFA 4NLCA 2R7YA 3GG4A 3ID6A 2X6SA 3M8PA 4FJGA 4IDHA 3THXB 1TKDA 1S1VA 4A5AA 1XMOK 3A2FA 3ZSWA 1TUUA 4PKGA 1R0AA 5J2PA 3NVKA 2D0BA 1I39A 4FJ5A 2YNGA 5LMUK 3QESA 4A2AA 3SNNA 2P9SB 2KZZA 1BOTO 4B3RK 3KLIA 2D0AA 4CIFA 3DLHA 3QNNA 4I2PA 3NF6A 4B9MA 3CJAA 5KTQA 1U48A 4BDZA 5AQLA 3OYJA 4HHTA 4CHQA 1BCOA 4KHQA 3PO5A 4O4GA 3F73A 3KWGA 4CZMA 3B6PA 4BREA 5SWMA 4OLBA 4LSNA 3AVJA 4F2SA 3MN6A 2G8WA 4J8FA 3G4SN 1XWLA 4FZYA 3L0QA 5C12A 2QWLA 4O5FA 1YAGA 4IO9L 3HJFA 3KD1E 3M1FA 1VQ6N 3K2PA 5BREA 4CJPA 1IJJA 1OH7A 1NGBA 2CGKA 5CY4A 1CXUA 3NHGA 1OVQA 4YOTA 3EN9A 3VF2A 4CEAA 1VQPN 3SV3A 3OYDA 1Z05A 1K8KB 1WBDA 4CF2A 4YY3K 2ZM6K 4DR7K 1K6YA 2GEMA 3HSTB 1RBSA 4OKJA 4YORA 4BG8A 4WYBA 4A57A 4DKWA 1EKEA 2E2PA 4ZHRA 2FSKA 4WCEL 3OYFA 4FWQA 3JYTA 3QFPA 2VWBA 2X6NA 3E66A 5BN8A 2NRWA 3I0RA 3NFAA 4K43A 3C6UA 4EP5A 4CGFA 2NZTA 1JLBA 3H1QA 2UUBK 4CK1A 4IOXA 1WSJA 1WSGA 2B6AA 3B8AX 3MXIA 2HHTA 4X66K 4H4OA 1XC9A 3R1XA 3AA3A 3ZT0A 3CMAN 3SYZA 3AO3A 1TYQB 3KKRA 3DI6A 1Q86O 3HTVA 1NGHA 2QWRA 5CE3A 5EXWA 4FM2A 4RW7A 4W5RA 4FK4A 3DRSA 2NRHA 3VQBA 1YJ9N 5E26A 1LWEA 1KVBA 4LH5A 2O8EA 5ADXH 4MDAA 5M1NA 4FZXC 4CJQA 4EP4A 2G8UA 1SL0A 4BR5A 3VEVA 3VQ5A 4XH5A 4OGEA 1D9FA 3ALYA 3L8BA 4HCCA 5H1SQ 3KVGA 1T7PA 1JLGA 4E89A 1SKWA 3D2EA 3NCIA 4FVMA 4E1JA 5J2MA 4CBUA 2QKBA 3DXKB 1O1WA 2ASPA 3NMUA 3AO2A 4RTFD 1ASVA 3C7NB 1FK9A 2OPQA 4B9LA 4CFBA 1L3VA 5C25A 2IDOA 1ZBIA 4CJLA 1TUYA 3HOTA 5KQ8A 2P5GA 3UIQA 2P9IA 1SL1A 4H5TA 4O44A 4FWNA 4EIAA 3TSQA 1HKCA 3ULEA 2NRVA 3L2RA 2O8DB 3SQ4A 1BI4B 1NJXA 2YV0X 3HSCA 4O0IA 3HPGA 1HX1A 4CF8A 1NJIO 2RKIA 5FDLA 3F2KA 2E2QA 4JHDA 3VF6A 3S9HA 1V4SA 4FWLA 1NBWA 5KPZA 2KKZA 4N47A 5EY4A 1XC3A 3SBGA 2NRXA 1NGIA 2PBDA 3O4NA 3PLAA 1YITN 4CZHA 1SUQA 3QFUA 1T05A 3L3UA 4PUOA 4E19A 1VK0A 3CD6N 5C24A 1QVFM 3Q7BA 3T19A 4DF8A 3LAMA 1NOZA 2RE2A 5BPNA 3U8XA 4BG9A 1KCFA 4KHUA 4AF1A 3UKUA 3H46O 1ZBSA 4DTPA 2ZD1A 4JHDB 3KHYA 3MXMA 3T3FA 4CFAA 1R59O 1W0HA 3WUHA 1D9DA 3GDQA 3CC4N 4QOZB 3O9TA 2OTLN 3I56N 1L3SA 4U7BA 1H1VA 1YJNN 1N5YA 3TARA 3DLLL 1U2VA 4CJSA 4B9QA 4LC9B 3LPTA 3HZ6A 4E7LA 1WSFA 3SMPA 3LAKA 3C0BA 4CEBA 4DSIA 3NF7A 4KH4A 2W42A 4CZIA 3ZLJA 2E1ZA 4IEIA 3RR7A 2YHYA 3SJHA 4R79A 4K25A 4E7KA 4PL8A 5EOYA 5AQWA 1QQMA 3AY9A 4JI7K 3EL2A 1HQEA 1HNVA 1N32K 4BVPA 4JI6K 1W97L 3DXMB 3M6GA 1S9GA 2OZMA 1RBUA 1VSKA 4H0TB 1QQOA 3M8RA 4QAGA 2RHKA 3FLCO 1JLCA 4GVEA 2P9SA 4CJ7A 4FZZA 4FWOA 3MEDA 2P9UB 3HM9A 1U47A 3MAQA 5AQJA 2BH1A 5ELZA 5HRSA 3SPYA 2GTDA 1M90O 4JI0K 3L6QA 5FPNA 4UY8O 4B3SK 3A5LC 3NGZA 4CW7B 2UXCK 3PX0A 3BY5A 3H3OB 4HTLA 4NXMK 4B08A 4DQIA 3DYAA 2Q2RA 3HRGA 2PZSA 1MA9B 3P5JA 4GMJB 1IKXA 2D5RA 2BUPA 4E7JA 3DXMA 5BN9A 4CECA 1RT7A 4NXNK 3HM8A 4IFYA 3EE9A 4DV7K 4CFCA 4JAXA 4W5NA 3SJJA 4K8ZA 3THYB 2QXFA 1RFQA 3UE5A 1C0GA 3OYBA 2BANA 3T69A 1EX4A 4FO0A 3NGYA 2FXUA 3I33A 5E41A 3VQQA 4I6MB 3ZT4A 4FJJA 1T44A 4Z4IA 4DV2K 4MDBA 4DV6K 3U4LA 3LDLA 3C6TA 4EFHA 2HHQA 4OGCA 4FJKA 4H5VA 3HPOA 2IAJA 4IJNA 3ZX0A 4DV3K 4B1WB 3TAFA 3VEXA 3WNGA 1BQMA 2Q97A 3JSMA 1BIZA 4JKDA 3F9MA 2OANA 4YHHK 1KSPA 5IWAK 1VHXA 2GBZA 3SQ2A 4CF0A 1RTHA 4CEOA 4CIGA 5A2QO 4DV0K 4O8UA 3SCXA 5FRNA 1B9DA 4M3UA 4JYAK 4A2BA 1ATSA 3V1QA 1ASUA 3DRPA 2QKKA 4HVJA 3G10A 2QXLA 3O6WA 2OTJN 1NMNA 3AVAA 4CJEA 3UB5A 3WNHA 4CGJA 3EY1A 4AHCA 4DQPA 4HCBA 2F9TA 4AM7A 4Z4CA 3H45C 4BR0A 1YHQN 3PIPL 3H6EA 1Q9XA 3D2EB 2WTUA 3RWUA 3QEWA 3QIPA 3LL3A 4BRCA 3D45A 1TKZA 1SAZA 2KHOA 4A62A 1NKCA 4F3TA 1S1UA 2HBLA 4KH6A 4FWPA 4JK7A 3AO4A 4JS4A 4XH4A 1J5OA 3G0ZA 3ZETB 5HP1A 4ID5A 4KFBA 3QETA 1YIJN 2JGUA 4OPAA 3RRGA 3QLHA 3OYNA 3GL1A 3EYZA 3HL8A 3HT3A 1BHLA 3CPWM 5LL6Z 1XHZA 2E2NA 1NGAA 4X62K 3RTVA 3ISNC 4EHTA 1VRTA 3ZX3A 4DS5A 4FLTA 2E4LA 3CC7N 5AQQA 2HMPA 2Z1IA 4DSKA 3ZSOA 1ESVA 4CGGA 4CZGA 3I0SA 2HHWA 3GOIA 1VQKN 3VTHA 5D3GA 3HI0A 3EZWA 4LF6K 4CHZA 3EE8A 1J6ZA 4CJTA 1Q81O 1TGOA 5GADP 1BO5O 4YDUA 4J2AA 2PFUA 5AQRA 4YOUA 4CFDA 4KRFA 1NGDA 1Q18A 2A1SA 3DRRA 3O3FA 3BF3A 4CF9A 4DWIA 1RT5A 4BRFA 1BUPA 3U6FA 4DQRA 4BRQA 2P9NA 3GBTA 4CJ3A 3AA5X 3LALA 1C6VA 2O8FA 1XQSC 2D1KA 4LF5K 3ZT3A 4B9UA 2YNHA 4OO1J 4JV5K 2YHXA 4ILGB 1WSEA 1FKPA 4O0JA 3VPZA 3L2VA 3DXKA 3P4IA 2NNWA 3A0IX 1ZBLA 3LM2A 2E2OA 2EWSA 3OS0A 1C0UA 1DT9A 5BR8K 4KI6A 4YNQA 2YKNA 3D2FB 1LCUA 4NYNA 4EHUA 3O5BA 1QTMA 3K5NA 2Q36A 3ZSYA 5GAHP 4IOAL 5FPEA 3AVFA 3NH0A 2FBVA 2O4IA 4CBWA 3PSIA 5HRRA 4LFBK 1CLQA 3O9RA 3IKMA 3N4QA 2QEXN 4PKHA 3BZKA 4CEDA 2KFZA 2P9NB 2Q31A 1BI4A 4QS9A 2O8BB 4HUGA 3TANA 3MMVA 4NCAA 1VSIA 3CJ7A 2I7PA 2CH5A 3LDQA 1NK6A 4X64K 3TI0A 4JKHA 1DTTA 3RRHA 3SBTA 3THWB 2KW4A 1NJYA 5J1EA 4CD3A 5M1KA 1IBKK 4WQ5C 2P9UA 2XY8A 1U4BA 3MN7A 4GW6A 2GWKA 1FKOA 3ZT1A 2KZMA 3EKSA 3D0PA 4DTRA 1WOQA 3C95A 4DQ8A 3CCEN 3NF9A 3H1VX 2UYTA 2NRZA 1OH8A 4MO4A 1JLEA 2Z1JA 3OW2M 3OHRA 1S1XA 3G25A 3CCVN 3L2UA 3PIOL 1BIUA 4KHWA 2XY5A 2I7NA 4GNIA 1B9FA 3TAEA 1ASWA 1JL2A 4WFBL 1QS4A 4RW8A 2OA8A 4Z4HA 3VQEA 3NDKA 3CCMN 3AVBA 3T1YK 2GV9A 1RT4A 3HVTA 1KRPA 1EWQA 2H3GX 1LWFA 3HBTA 3MDQA 5TKWA 1WSHA 4IO8A 4A5BA 1GLFO 2A1RA 2HVIA 3O9SA 2P5OA 4LSLA 4E3SA 2RN2A 4O55A 3VA3A 1NM1A 4DLEA 3VF4A 1D8YA 4IWVA 2FSJA 1Q9YA 3A5OC 3SMSA 4E1MA 4EZ9A 1C1BA 2ATQA 4JD2A 3MWPA 2BGGA 1TVRA 2WC9A 4BR2A 4LF7K 1Q8IA 1L5UA 4CD1A 5F0XA 5HL7L 1KAZA 3CFOA 3K5OA 1BU6O 2OCEA 4ID1A 4U67L 3I55N 1J5EK 3R6MA 5K14A 4B3MK 1XNRK 2PAVA 4JS5A 4H0XB 1VQ7N 2FBYA 4EAHD 4IJAA 4BRGA 2GUIA 1WSIA 3MCAB 3O3GA 3O8MA 5JMVA 5JICA 1BCMA 3UKUB 3MECA 4M3ZA 4FJIA 1NGCA 4JD2B 1W9HA 3EEQA 1C1AA 2G8VA 1SV5A 3VGMA 3OYIA 2VYPA 1ILYA 2ITGA 2O8FB 4DF4A 3PV8A 5FRMA 1FJGK 4KTWA 3JXUA 3O9QA 1TK0A 4JI3K 4FM0A
chains in the Genus database with same CATH topology
3OVNA 5KGXA 4QOZB 4KPYA 2G8HA 2OPRA 2P51A 2P1JA 2RF2A 3V81A 4R5PA 1L3SA 3FFIA 3K57A 1S6QA 1D5AA 2PYLA 1BL3A 1S1WA 1N5YA 3TARA 2FBTA 2F8SA 1NK8A 3K5MA 4E1NA 4CJSA 1YT3A 2XO7A 5DMRA 3LPTA 3C94A 5HRPA 4E7LA 3ZSQA 4CJVA 1WSFA 1SKSA 3LAKA 5HBMA 1EETA 4FLYA 1WN7A 4CEBA 4FLUA 4OKEA 3KK2A 4Z4EA 4DSIA 4CHNA 2Z1HA 3NF7A 4FW2A 3F9KA 4OLAA 2W42A 3LP0A 4B8AB 4DG1A 1TL3A 3RR7A 3NAEA 4RG8A 4DTXA 3OYGA 1T8EA 4MFBA 4KREA 4ELTA 3OYHA 1TKXA 4F8RA 4E7KA 1GOBA 4BDYA 3V9UA 1UA0A 4DTJA 1A5XA 4OPKA 3QEXA 4FXDA 5I3UA 3DLGA 4IBNA 1HYSA 3HPHA 4C8MA 2HVHA 3SPZA 4N41A 4CJUA 3AA2A 3HVRA 4BE0A 1HQEA 1A5VA 3HP9A 1NK7A 1HNVA 2OYQA 1VSHA 4C8LA 2VWKA 5DK5A 2G8FA 4NCGA 3NGIA 4DQQA 3DOKA 1LW2A 4PY5A 4KB1A 1BQNA 4KHYA 1TAUA 1RBRA 1WLJA 1BISA 4LD0A 1S9GA 1RNHA 1RBUA 1VSKA 3E01A 2OZMA 3V6DA 4DQSA 3M8RA 3DLKA 1NK5A 4M3WA 4QAGA 2HHUA 1LAVA 4Q5VA 4Q0BA 1JLCA 1X1PA 4FZZA 3OYAA 4KAZA 3MEDA 3KLGA 3HM9A 1U47A 3OJUA 2IC3A 3MAQA 4DSLA 4N76A 4KB0A 1UOCA 5HRSA 1F21A 5CZ1A 3O3HA 3SPYA 4B9NA 1HMVA 2D0CA 1L3TA 4CK2A 4BE2A 3PUFA 4H4MA 4DFMA 4IDKA 3NGZA 3VQPA 3ZSVA 2DFHA 5FRMA 3CM6A 3PX0A 4B08A 3OYCA 2F8TA 1GOAA 3ZT2A 3SUQA 4DQIA 3DYAA 4RW6A 4DTMA 4E7IA 4PWDA 2PZSA 3P5JA 4GMJB 1DTQA 4KHSA 1IKXA 2D5RA 2OZSA 4E7JA 3KLHA 4CECA 2HHVA 1RT7A 3AVGA 1JLAA 4B8CA 4FJMA 3NE6A 4IFYA 4CEEA 2BE2A 1EXQA 3KIOA 1KVAA 4RW4A 4CFCA 1WNSA 1RTJA 5J2NA 3TAGA 4W5NA 3SJJA 3KK3A 3S3MA 4K8ZA 2QXFA 4FCYA 1NKBA 3NF8A 4Y1DA 3OYLA 4G1QA 3AVMA 3OYBA 1RBVA 2BANA 1EX4A 5CYMA 5KRTA 4FJLA 4JRPA 2YHAA 3ITHA 3M8QA 3LPUA 3LWLA 4DU1A 1TKTA 3NGYA 5E41A 1QSLA 1VSLA 3VQQA 1RDDA 4OVLA 3WNEA 1C0TA 3ZT4A 4L8RB 4FJJA 4ICLA 4FJNA 4Z4IA 4EZ6A 2XY7A 4DU3A 3LDSA 2HNYA 4FLXA 4DFJA 1S9EA 5HROA 3MEGA 3WNFA 4IFVA 4BE1A 3C6TA 4M3RA 4AH9A 3K59A 2HHQA 4OGCA 1B92A 5C42A 3VQ8A 4FJKA 3SUPA 3NBPA 3LANA 3HPOA 2IAJA 3CM5A 3VQ9A 3ZSZA 5KGWA 4J2BA 3OYMA 3V9ZA 4I9QA 2DY4A 4JLHA 3NH2A 2E6MA 3TAFA 2DFFA 3WNGA 1BQMA 3JSMA 3RMCA 1BIZA 4KV8A 4CJRA 5SZTA 3BDPA 3PO4A 3PY8A 4FJ8A 1Z26A 1KSPA 4CJ4A 2GBZA 3SQ2A 4CF0A 4HUFA 1RTHA 3T1AA 1S6PA 4CEOA 1Y97A 4AHRA 4CIGA 4CK3A 4DFPA 3AO5A 2I5JA 3SCXA 4QCLA 2VG6A 4KKOA 5FRNA 1RDCA 4W5QA 1B9DA 1S5JA 4M3UA 1ZBHA 1Z25A 3V1QA 1S1TA 3K5LA 2ETJA 1ASUA 3DRPA 1WAFA 3V9WA 2QKKA 4CGDA 4HVJA 1RT1A 3G10A 3ASMA 4J2DA 4N5SA 3AVAA 4FYDA 4CJEA 4YFUA 1HNIA 2OPPA 3AV9A 3WNHA 4CGJA 3EY1A 4AHCA 4DQPA 4O5BA 1QSSA 4PA1A 1J9AA 1HJRA 2HNDA 2RPIA 4HCBA 3HP6A 1LWCA 2QK9A 3QEIA 2HMIA 4Z4CA 4I9LA 1VSMA 3V9XA 2OPSA 3IG1A 1DLOA 3S3OA 3P83D 4FJXA 1Q9XA 4FK2A 3RWUA 3QEWA 3AVNA 3QIPA 2R7YA 1UA1A 1RT6A 2X6SA 1J53A 3M8PA 3O4QA 3D45A 4FJGA 1TKZA 1NJZA 1TKDA 2LSNA 1S1VA 3KK1A 3A2FA 2EX3A 1NKCA 3ZSWA 4F3TA 1S1UA 3V4IA 2X74A 5KRSA 5J2PA 1R0AA 1ZBFA 3HK2A 2D0BA 3DLBA 3VQ4A 1I39A 4FJ5A 2YNGA 3CFRA 1J54A 3RMAA 3AO4A 4JS4A 1NK9A 1L3UA 1J5OA 3SZ2A 3DLEA 3QESA 1XI1A 3SNNA 3G0ZA 3QIOA 2KZZA 5HP1A 3KLIA 1IH7A 2D0AA 3DOLA 4CERA 4CIFA 3EZ5A 3DLHA 4ID5A 3QNNA 4I2PA 4KFBA 3QETA 4B9SA 1QHTA 2JGUA 3NF6A 4OKKA 2WONA 1GOCA 3RRGA 4FLZA 4B9MA 3QLHA 3VN5A 1X9WA 3OYNA 5KTQA 1IO2A 3EYZA 3HL8A 3HT3A 1U48A 1BHLA 1XHZA 3OY9A 3MXJA 4BDZA 4HHTA 3OYJA 4ZTFA 1QE1A 4CHQA 1BCOA 1IKVA 1ZBUA 1VSJA 4KHQA 3RTVA 3ISNC 1VRTA 4DS5A 4FLTA 3PO5A 2E4LA 2Z1IA 4DS4A 2WOMA 3LP2A 4O4GA 4DSKA 1VRUA 2YHBA 3ZCMA 3L2QA 3F73A 3ZSOA 5FROA 4HTUA 4CGHA 4CGGA 4FLVA 2BDPA 3B6PA 4KTQA 3VQ7A 4CEFA 4N56A 3I0SA 2HHWA 5SWMA 1JXEA 4OLBA 1HYZA 4LSNA 1TK5A 3AVJA 5D3GA 1NOYA 4F2SA 2G8WA 1JL1A 3HYFA 4CHZA 1VSDA 3RMBA 1XWLA 4CJTA 2YNFA 1RT2A 3K58A 4FZYA 1TGOA 3P1GA 5HLFA 1T03A 4J2AA 4BACA 3HJFA 2YNIA 3KD1E 1WAJA 1I3AA 1KTQA 3K2PA 2KQ2A 4CFDA 4CJPA 4KRFA 3OYEA 3QEPA 2A1SA 3DRRA 3O3FA 5CY4A 4CF9A 1CXUA 3NHGA 3BGRA 4IKFA 4DWIA 1RT5A 5EU7A 3KTQA 3U6FA 1EP4A 4DQRA 4CEAA 4DSJA 3SV3A 1QQCA 3OYDA 4KO0A 4CIEA 4CGIA 4CJ3A 3AA5X 1XHXA 1REVA 3LALA 1NKEA 4CF2A 3IAYA 1C6VA 2G8KA 2VG5A 1K6YA 3LP3A 4MQ3A 2HB5A 2Q3SA 3HSTB 1RBSA 4OKJA 3ZT3A 4W5OA 1N6QA 4Z4GA 1UWBA 4B9UA 2YNHA 4M42A 2KFNA 1TK8A 1WSEA 3ULDA 1FKPA 4O0JA 4M3TA 1EKEA 4AHTA 3L2VA 2VG7A 3DLRA 1IKYA 1ZBLA 4ZHRA 3LZIA 3RR8A 3OS0A 2B5JA 4E0DA 3OYFA 1IG9A 1CXQA 1C0UA 3JYTA 2YKMA 3PX4A 2G8UA 4B9TA 4FJ7A 4KI6A 4YNQA 2DTUA 2YKNA 3U3YA 1ITGA 3VQ6A 4NYNA 1QTMA 3ZSRA 2NUBA 4CJWA 4I7FA 2X6NA 3K5NA 4DMNA 3ZSYA 3AVKA 3I0RA 3NFAA 4AHUA 3AVIA 2KTQA 3C6UA 4EP5A 4CGFA 3LP1A 1JLBA 4CK1A 3AVFA 3NH0A 2FBVA 2O4IA 1RTDA 4KHNA 1C0MA 1WSJA 2ZQBA 4DU4A 1U49A 5HRRA 4AHSA 1WSGA 3VQAA 3VA0A 2B6AA 4IG3A 1CLQA 5CZ2A 2IS3A 3AVCA 3KJVA 1X9MA 3MXIA 2HHTA 4CEDA 4H4OA 3NH1A 1C1CA 1RCHA 4I2QA 1XC9A 4DTNA 1BI4A 2KFZA 2B4JA 1A5WA 3I8DA 3AA3A 4ZTJA 3ZT0A 4J2EA 1IKWA 1YVUA 4HUGA 2DFEA 5KI6A 3CYMA 3AO3A 3SYZA 1LW0A 3TANA 3RMDA 4F4KA 3TABA 4NCAA 3KKRA 1VSIA 3CG7A 3DI6A 4GVMA 3LWMA 4Y1CA 2Y1IA 4Z4FA 3QO9A 4M41A 4CESA 3KKSA 1NK6A 2PYJA 3TI0A 3SQ1A 1RDAA 2F96A 1DTTA 4BWMA 4FM2A 3RRHA 4AILC 4RW7A 4DFKA 4W5RA 3AO1A 4RW9A 1NJYA 2KW4A 4FJHA 5J1EA 5I42A 5J2QA 1UAXA 4TSXA 4FK4A 1LAWA 3DRSA 3SV4A 2XY8A 4LY7A 1U4BA 4C8KA 4F2RA 3B6OA 3VQBA 1LWEA 4GW6A 1KVBA 3OYKA 3M8SA 1FKOA 3ZT1A 2KZMA 1RDBA 4B9VA 3D0PA 4FW1A 4LH5A 4DTRA 3OS2A 3C95A 3PX6A 4M45A 1NK4A 4AHVA 3DMJA 4Z0UA 1KVCA 3NF9A 4FZXC 1KLMA 4CJQA 1TL1A 1JLEA 4EP4A 1YTAA 2Z1JA 3U3GA 3CFPA 3SUOA 1SL0A 1RT3A 1S1XA 1TAQA 2HW3A 3L2UA 1HQUA 2HHXA 1HRHA 3VQ5A 2Y1JA 1BIUA 4KHWA 2XY5A 3HXMA 4CEQA 4LH4A 4CE9A 1B9FA 3VQCA 3TAEA 1ASWA 4OGEA 1JL2A 1HPZA 4CJ5A 1MU2A 3ALYA 3OJSA 1QS4A 2JLEA 1G15A 4RW8A 2E6LA 4WE1A 2OA8A 4Z4HA 1JLFA 3L8BA 1SL2A 3VQEA 4HCCA 1T7PA 3NDKA 1JLGA 4E89A 3KD5E 1SKWA 1RBTA 3AVBA 3S3NA 3SQ0A 3NCIA 4FVMA 3TAQA 5J2MA 4FM1A 4E7HA 4M3XA 4M3YA 4H8KA 2QKBA 2GV9A 4KTZA 1RTIA 3KLEA 1O1WA 1RT4A 1NJWA 2EHGA 3V9SA 4FJ9A 3V1RA 3HVTA 4HUEA 3L2WA 1KRPA 3AO2A 4CJKA 3AVLA 1LV5A 1LWFA 4K8XA 1ASVA 2X78A 1FK9A 1WSHA 2OPQA 4B9LA 1HYVA 2AJQA 4CFBA 1JKHA 5C25A 3TAPA 3SUNA 2IDOA 1L3VA 1VSEA 1QSYA 2A1RA 4B3OA 1NK0A 1ZBIA 2HVIA 4CJLA 2P5OA 4LSLA 4C8OA 5JS2A 2Z1GA 4E3SA 4ELVA 2RN2A 4O55A 2XHBA 3LZJA 2P5GA 3VA3A 3UIQA 1SL1A 4NCBA 4O44A 4DLEA 1SKRA 2PY5A 1D8YA 4CHYA 4UQGA 5CYQA 1Q9YA 3L2RA 3OS1A 3SI6A 3SQ4A 1BI4B 1X9SA 4CHOA 4E1MA 4EZ9A 1C1BA 4C8NA 1NJXA 2YV0X 2ATQA 3AA4A 4O0IA 3HPGA 2BGGA 4CF8A 2RKIA 1TVRA 4BDPA 1Q8IA 5FDLA 2IGIA 2FBXA 4FLWA 1L5UA 3IRXA 3DM2A 4CHPA 3S9HA 4NYFA 4DTUA 3AVHA 3TAMA 2G8IA 4CF1A 4N47A 3CFOA 3V1OA 3K5OA 4JRQA 3H08A 3O4NA 4ID1A 2HHSA 4OJRA 1CZBA 2O4GA 3QINA 3ZSXA 1ZYQA 4BWJA 1CZ9A 1KLNA 5K14A 4CCHA 4FK0A 4JS5A 3QERA 1SUQA 2FBYA 2IOCA 3VQDA 3L3VA 2GUIA 1T05A 5JS1A 1WSIA 3IS9A 1VSFA 3L3UA 4PUOA 4E19A 3TWHA 1YTUA 3KLFA 1RILA 3O3GA 1KFDA 1VK0A 4DSFA 4DTSA 5C24A 1BCMA 3T19A 4DF8A 3LAMA 3THVA 4KI4A 1NOZA 2FC0A 4IG0A 4OPJA 3MECA 4M3ZA 4DLGA 1KCFA 4CJFA 4FJIA 2XY6A 1W9HA 4KHUA 4ELUA 1C1AA 2G8VA 1SV5A 3CQ8A 2ZE2A 3QEVA 1JXBA 5HRNA 4DTPA 2ZD1A 1JLQA 3HO1A 3TR8A 2XRIA 3OYIA 3QNOA 2ITGA 1D9FA 4DTOA 4DF4A 3PV8A 4CEZA 1BGXT 1FXXA 1U45A 1TV6A 4XIUA 3T3FA 3MXMA 4W5TA 4KTWA 5T7BA 3MEEA 2VWJA 1KFSA 4CFAA 4F3OA 2HNZA 4PQUA 1TK0A 1W0HA 1U04A 1D9DA 4FM0A 4DSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVN A;  5KGX A;  4QOZ B;  4KPY A;  2G8H A;  2OPR A;  2P51 A;  2P1J A;  2RF2 A;  3V81 A;  4R5P A;  1L3S A;  3FFI A;  3K57 A;  1S6Q A;  1D5A A;  2PYL A;  1BL3 A;  1S1W A;  1N5Y A;  3TAR A;  2FBT A;  2F8S A;  1NK8 A;  3K5M A;  4E1N A;  4CJS A;  1YT3 A;  2XO7 A;  5DMR A;  3LPT A;  3C94 A;  5HRP A;  4E7L A;  3ZSQ A;  4CJV A;  1WSF A;  1SKS A;  3LAK A;  5HBM A;  1EET A;  4FLY A;  1WN7 A;  4CEB A;  4FLU A;  4OKE A;  3KK2 A;  4Z4E A;  4DSI A;  4CHN A;  2Z1H A;  3NF7 A;  4FW2 A;  3F9K A;  4OLA A;  2W42 A;  3LP0 A;  4B8A B;  4DG1 A;  1TL3 A;  3RR7 A;  3NAE A;  4RG8 A;  4DTX A;  3OYG A;  1T8E A;  4MFB A;  4KRE A;  4ELT A;  3OYH A;  1TKX A;  4F8R A;  4E7K A;  1GOB A;  4BDY A;  3V9U A;  1UA0 A;  4DTJ A;  1A5X A;  4OPK A;  3QEX A;  4FXD A;  5I3U A;  3DLG A;  4IBN A;  1HYS A;  3HPH A;  4C8M A;  2HVH A;  3SPZ A;  4N41 A;  4CJU A;  3AA2 A;  3HVR A;  4BE0 A;  1HQE A;  1A5V A;  3HP9 A;  1NK7 A;  1HNV A;  2OYQ A;  1VSH A;  4C8L A;  2VWK A;  5DK5 A;  2G8F A;  4NCG A;  3NGI A;  4DQQ A;  3DOK A;  1LW2 A;  4PY5 A;  4KB1 A;  1BQN A;  4KHY A;  1TAU A;  1RBR A;  1WLJ A;  1BIS A;  4LD0 A;  1S9G A;  1RNH A;  1RBU A;  1VSK A;  3E01 A;  2OZM A;  3V6D A;  4DQS A;  3M8R A;  3DLK A;  1NK5 A;  4M3W A;  4QAG A;  2HHU A;  1LAV A;  4Q5V A;  4Q0B A;  1JLC A;  1X1P A;  4FZZ A;  3OYA A;  4KAZ A;  3MED A;  3KLG A;  3HM9 A;  1U47 A;  3OJU A;  2IC3 A;  3MAQ A;  4DSL A;  4N76 A;  4KB0 A;  1UOC A;  5HRS A;  1F21 A;  5CZ1 A;  3O3H A;  3SPY A;  4B9N A;  1HMV A;  2D0C A;  1L3T A;  4CK2 A;  4BE2 A;  3PUF A;  4H4M A;  4DFM A;  4IDK A;  3NGZ A;  3VQP A;  3ZSV A;  2DFH A;  5FRM A;  3CM6 A;  3PX0 A;  4B08 A;  3OYC A;  2F8T A;  1GOA A;  3ZT2 A;  3SUQ A;  4DQI A;  3DYA A;  4RW6 A;  4DTM A;  4E7I A;  4PWD A;  2PZS A;  3P5J A;  4GMJ B;  1DTQ A;  4KHS A;  1IKX A;  2D5R A;  2OZS A;  4E7J A;  3KLH A;  4CEC A;  2HHV A;  1RT7 A;  3AVG A;  1JLA A;  4B8C A;  4FJM A;  3NE6 A;  4IFY A;  4CEE A;  2BE2 A;  1EXQ A;  3KIO A;  1KVA A;  4RW4 A;  4CFC A;  1WNS A;  1RTJ A;  5J2N A;  3TAG A;  4W5N A;  3SJJ A;  3KK3 A;  3S3M A;  4K8Z A;  2QXF A;  4FCY A;  1NKB A;  3NF8 A;  4Y1D A;  3OYL A;  4G1Q A;  3AVM A;  3OYB A;  1RBV A;  2BAN A;  1EX4 A;  5CYM A;  5KRT A;  4FJL A;  4JRP A;  2YHA A;  3ITH A;  3M8Q A;  3LPU A;  3LWL A;  4DU1 A;  1TKT A;  3NGY A;  5E41 A;  1QSL A;  1VSL A;  3VQQ A;  1RDD A;  4OVL A;  3WNE A;  1C0T A;  3ZT4 A;  4L8R B;  4FJJ A;  4ICL A;  4FJN A;  4Z4I A;  4EZ6 A;  2XY7 A;  4DU3 A;  3LDS A;  2HNY A;  4FLX A;  4DFJ A;  1S9E A;  5HRO A;  3MEG A;  3WNF A;  4IFV A;  4BE1 A;  3C6T A;  4M3R A;  4AH9 A;  3K59 A;  2HHQ A;  4OGC A;  1B92 A;  5C42 A;  3VQ8 A;  4FJK A;  3SUP A;  3NBP A;  3LAN A;  3HPO A;  2IAJ A;  3CM5 A;  3VQ9 A;  3ZSZ A;  5KGW A;  4J2B A;  3OYM A;  3V9Z A;  4I9Q A;  2DY4 A;  4JLH A;  3NH2 A;  2E6M A;  3TAF A;  2DFF A;  3WNG A;  1BQM A;  3JSM A;  3RMC A;  1BIZ A;  4KV8 A;  4CJR A;  5SZT A;  3BDP A;  3PO4 A;  3PY8 A;  4FJ8 A;  1Z26 A;  1KSP A;  4CJ4 A;  2GBZ A;  3SQ2 A;  4CF0 A;  4HUF A;  1RTH A;  3T1A A;  1S6P A;  4CEO A;  1Y97 A;  4AHR A;  4CIG A;  4CK3 A;  4DFP A;  3AO5 A;  2I5J A;  3SCX A;  4QCL A;  2VG6 A;  4KKO A;  5FRN A;  1RDC A;  4W5Q A;  1B9D A;  1S5J A;  4M3U A;  1ZBH A;  1Z25 A;  3V1Q A;  1S1T A;  3K5L A;  2ETJ A;  1ASU A;  3DRP A;  1WAF A;  3V9W A;  2QKK A;  4CGD A;  4HVJ A;  1RT1 A;  3G10 A;  3ASM A;  4J2D A;  4N5S A;  3AVA A;  4FYD A;  4CJE A;  4YFU A;  1HNI A;  2OPP A;  3AV9 A;  3WNH A;  4CGJ A;  3EY1 A;  4AHC A;  4DQP A;  4O5B A;  1QSS A;  4PA1 A;  1J9A A;  1HJR A;  2HND A;  2RPI A;  4HCB A;  3HP6 A;  1LWC A;  2QK9 A;  3QEI A;  2HMI A;  4Z4C A;  4I9L A;  1VSM A;  3V9X A;  2OPS A;  3IG1 A;  1DLO A;  3S3O A;  3P83 D;  4FJX A;  1Q9X A;  4FK2 A;  3RWU A;  3QEW A;  3AVN A;  3QIP A;  2R7Y A;  1UA1 A;  1RT6 A;  2X6S A;  1J53 A;  3M8P A;  3O4Q A;  3D45 A;  4FJG A;  1TKZ A;  1NJZ A;  1TKD A;  2LSN A;  1S1V A;  3KK1 A;  3A2F A;  2EX3 A;  1NKC A;  3ZSW A;  4F3T A;  1S1U A;  3V4I A;  2X74 A;  5KRS A;  5J2P A;  1R0A A;  1ZBF A;  3HK2 A;  2D0B A;  3DLB A;  3VQ4 A;  1I39 A;  4FJ5 A;  2YNG A;  3CFR A;  1J54 A;  3RMA A;  3AO4 A;  4JS4 A;  1NK9 A;  1L3U A;  1J5O A;  3SZ2 A;  3DLE A;  3QES A;  1XI1 A;  3SNN A;  3G0Z A;  3QIO A;  2KZZ A;  5HP1 A;  3KLI A;  1IH7 A;  2D0A A;  3DOL A;  4CER A;  4CIF A;  3EZ5 A;  3DLH A;  4ID5 A;  3QNN A;  4I2P A;  4KFB A;  3QET A;  4B9S A;  1QHT A;  2JGU A;  3NF6 A;  4OKK A;  2WON A;  1GOC A;  3RRG A;  4FLZ A;  4B9M A;  3QLH A;  3VN5 A;  1X9W A;  3OYN A;  5KTQ A;  1IO2 A;  3EYZ A;  3HL8 A;  3HT3 A;  1U48 A;  1BHL A;  1XHZ A;  3OY9 A;  3MXJ A;  4BDZ A;  4HHT A;  3OYJ A;  4ZTF A;  1QE1 A;  4CHQ A;  1BCO A;  1IKV A;  1ZBU A;  1VSJ A;  4KHQ A;  3RTV A;  3ISN C;  1VRT A;  4DS5 A;  4FLT A;  3PO5 A;  2E4L A;  2Z1I A;  4DS4 A;  2WOM A;  3LP2 A;  4O4G A;  4DSK A;  1VRU A;  2YHB A;  3ZCM A;  3L2Q A;  3F73 A;  3ZSO A;  5FRO A;  4HTU A;  4CGH A;  4CGG A;  4FLV A;  2BDP A;  3B6P A;  4KTQ A;  3VQ7 A;  4CEF A;  4N56 A;  3I0S A;  2HHW A;  5SWM A;  1JXE A;  4OLB A;  1HYZ A;  4LSN A;  1TK5 A;  3AVJ A;  5D3G A;  1NOY A;  4F2S A;  2G8W A;  1JL1 A;  3HYF A;  4CHZ A;  1VSD A;  3RMB A;  1XWL A;  4CJT A;  2YNF A;  1RT2 A;  3K58 A;  4FZY A;  1TGO A;  3P1G A;  5HLF A;  1T03 A;  4J2A A;  4BAC A;  3HJF A;  2YNI A;  3KD1 E;  1WAJ A;  1I3A A;  1KTQ A;  3K2P A;  2KQ2 A;  4CFD A;  4CJP A;  4KRF A;  3OYE A;  3QEP A;  2A1S A;  3DRR A;  3O3F A;  5CY4 A;  4CF9 A;  1CXU A;  3NHG A;  3BGR A;  4IKF A;  4DWI A;  1RT5 A;  5EU7 A;  3KTQ A;  3U6F A;  1EP4 A;  4DQR A;  4CEA A;  4DSJ A;  3SV3 A;  1QQC A;  3OYD A;  4KO0 A;  4CIE A;  4CGI A;  4CJ3 A;  3AA5 X;  1XHX A;  1REV A;  3LAL A;  1NKE A;  4CF2 A;  3IAY A;  1C6V A;  2G8K A;  2VG5 A;  1K6Y A;  3LP3 A;  4MQ3 A;  2HB5 A;  2Q3S A;  3HST B;  1RBS A;  4OKJ A;  3ZT3 A;  4W5O A;  1N6Q A;  4Z4G A;  1UWB A;  4B9U A;  2YNH A;  4M42 A;  2KFN A;  1TK8 A;  1WSE A;  3ULD A;  1FKP A;  4O0J A;  4M3T A;  1EKE A;  4AHT A;  3L2V A;  2VG7 A;  3DLR A;  1IKY A;  1ZBL A;  4ZHR A;  3LZI A;  3RR8 A;  3OS0 A;  2B5J A;  4E0D A;  3OYF A;  1IG9 A;  1CXQ A;  1C0U A;  3JYT A;  2YKM A;  3PX4 A;  2G8U A;  4B9T A;  4FJ7 A;  4KI6 A;  4YNQ A;  2DTU A;  2YKN A;  3U3Y A;  1ITG A;  3VQ6 A;  4NYN A;  1QTM A;  3ZSR A;  2NUB A;  4CJW A;  4I7F A;  2X6N A;  3K5N A;  4DMN A;  3ZSY A;  3AVK A;  3I0R A;  3NFA A;  4AHU A;  3AVI A;  2KTQ A;  3C6U A;  4EP5 A;  4CGF A;  3LP1 A;  1JLB A;  4CK1 A;  3AVF A;  3NH0 A;  2FBV A;  2O4I A;  1RTD A;  4KHN A;  1C0M A;  1WSJ A;  2ZQB A;  4DU4 A;  1U49 A;  5HRR A;  4AHS A;  1WSG A;  3VQA A;  3VA0 A;  2B6A A;  4IG3 A;  1CLQ A;  5CZ2 A;  2IS3 A;  3AVC A;  3KJV A;  1X9M A;  3MXI A;  2HHT A;  4CED A;  4H4O A;  3NH1 A;  1C1C A;  1RCH A;  4I2Q A;  1XC9 A;  4DTN A;  1BI4 A;  2KFZ A;  2B4J A;  1A5W A;  3I8D A;  3AA3 A;  4ZTJ A;  3ZT0 A;  4J2E A;  1IKW A;  1YVU A;  4HUG A;  2DFE A;  5KI6 A;  3CYM A;  3AO3 A;  3SYZ A;  1LW0 A;  3TAN A;  3RMD A;  4F4K A;  3TAB A;  4NCA A;  3KKR A;  1VSI A;  3CG7 A;  3DI6 A;  4GVM A;  3LWM A;  4Y1C A;  2Y1I A;  4Z4F A;  3QO9 A;  4M41 A;  4CES A;  3KKS A;  1NK6 A;  2PYJ A;  3TI0 A;  3SQ1 A;  1RDA A;  2F96 A;  1DTT A;  4BWM A;  4FM2 A;  3RRH A;  4AIL C;  4RW7 A;  4DFK A;  4W5R A;  3AO1 A;  4RW9 A;  1NJY A;  2KW4 A;  4FJH A;  5J1E A;  5I42 A;  5J2Q A;  1UAX A;  4TSX A;  4FK4 A;  1LAW A;  3DRS A;  3SV4 A;  2XY8 A;  4LY7 A;  1U4B A;  4C8K A;  4F2R A;  3B6O A;  3VQB A;  1LWE A;  4GW6 A;  1KVB A;  3OYK A;  3M8S A;  1FKO A;  3ZT1 A;  2KZM A;  1RDB A;  4B9V A;  3D0P A;  4FW1 A;  4LH5 A;  4DTR A;  3OS2 A;  3C95 A;  3PX6 A;  4M45 A;  1NK4 A;  4AHV A;  3DMJ A;  4Z0U A;  1KVC A;  3NF9 A;  4FZX C;  1KLM A;  4CJQ A;  1TL1 A;  1JLE A;  4EP4 A;  1YTA A;  2Z1J A;  3U3G A;  3CFP A;  3SUO A;  1SL0 A;  1RT3 A;  1S1X A;  1TAQ A;  2HW3 A;  3L2U A;  1HQU A;  2HHX A;  1HRH A;  3VQ5 A;  2Y1J A;  1BIU A;  4KHW A;  2XY5 A;  3HXM A;  4CEQ A;  4LH4 A;  4CE9 A;  1B9F A;  3VQC A;  3TAE A;  1ASW A;  4OGE A;  1JL2 A;  1HPZ A;  4CJ5 A;  1MU2 A;  3ALY A;  3OJS A;  1QS4 A;  2JLE A;  1G15 A;  4RW8 A;  2E6L A;  4WE1 A;  2OA8 A;  4Z4H A;  1JLF A;  3L8B A;  1SL2 A;  3VQE A;  4HCC A;  1T7P A;  3NDK A;  1JLG A;  4E89 A;  3KD5 E;  1SKW A;  1RBT A;  3AVB A;  3S3N A;  3SQ0 A;  3NCI A;  4FVM A;  3TAQ A;  5J2M A;  4FM1 A;  4E7H A;  4M3X A;  4M3Y A;  4H8K A;  2QKB A;  2GV9 A;  4KTZ A;  1RTI A;  3KLE A;  1O1W A;  1RT4 A;  1NJW A;  2EHG A;  3V9S A;  4FJ9 A;  3V1R A;  3HVT A;  4HUE A;  3L2W A;  1KRP A;  3AO2 A;  4CJK A;  3AVL A;  1LV5 A;  1LWF A;  4K8X A;  1ASV A;  2X78 A;  1FK9 A;  1WSH A;  2OPQ A;  4B9L A;  1HYV A;  2AJQ A;  4CFB A;  1JKH A;  5C25 A;  3TAP A;  3SUN A;  2IDO A;  1L3V A;  1VSE A;  1QSY A;  2A1R A;  4B3O A;  1NK0 A;  1ZBI A;  2HVI A;  4CJL A;  2P5O A;  4LSL A;  4C8O A;  5JS2 A;  2Z1G A;  4E3S A;  4ELV A;  2RN2 A;  4O55 A;  2XHB A;  3LZJ A;  2P5G A;  3VA3 A;  3UIQ A;  1SL1 A;  4NCB A;  4O44 A;  4DLE A;  1SKR A;  2PY5 A;  1D8Y A;  4CHY A;  4UQG A;  5CYQ A;  1Q9Y A;  3L2R A;  3OS1 A;  3SI6 A;  3SQ4 A;  1BI4 B;  1X9S A;  4CHO A;  4E1M A;  4EZ9 A;  1C1B A;  4C8N A;  1NJX A;  2YV0 X;  2ATQ A;  3AA4 A;  4O0I A;  3HPG A;  2BGG A;  4CF8 A;  2RKI A;  1TVR A;  4BDP A;  1Q8I A;  5FDL A;  2IGI A;  2FBX A;  4FLW A;  1L5U A;  3IRX A;  3DM2 A;  4CHP A;  3S9H A;  4NYF A;  4DTU A;  3AVH A;  3TAM A;  2G8I A;  4CF1 A;  4N47 A;  3CFO A;  3V1O A;  3K5O A;  4JRQ A;  3H08 A;  3O4N A;  4ID1 A;  2HHS A;  4OJR A;  1CZB A;  2O4G A;  3QIN A;  3ZSX A;  1ZYQ A;  4BWJ A;  1CZ9 A;  1KLN A;  5K14 A;  4CCH A;  4FK0 A;  4JS5 A;  3QER A;  1SUQ A;  2FBY A;  2IOC A;  3VQD A;  3L3V A;  2GUI A;  1T05 A;  5JS1 A;  1WSI A;  3IS9 A;  1VSF A;  3L3U A;  4PUO A;  4E19 A;  3TWH A;  1YTU A;  3KLF A;  1RIL A;  3O3G A;  1KFD A;  1VK0 A;  4DSF A;  4DTS A;  5C24 A;  1BCM A;  3T19 A;  4DF8 A;  3LAM A;  3THV A;  4KI4 A;  1NOZ A;  2FC0 A;  4IG0 A;  4OPJ A;  3MEC A;  4M3Z A;  4DLG A;  1KCF A;  4CJF A;  4FJI A;  2XY6 A;  1W9H A;  4KHU A;  4ELU A;  1C1A A;  2G8V A;  1SV5 A;  3CQ8 A;  2ZE2 A;  3QEV A;  1JXB A;  5HRN A;  4DTP A;  2ZD1 A;  1JLQ A;  3HO1 A;  3TR8 A;  2XRI A;  3OYI A;  3QNO A;  2ITG A;  1D9F A;  4DTO A;  4DF4 A;  3PV8 A;  4CEZ A;  1BGX T;  1FXX A;  1U45 A;  1TV6 A;  4XIU A;  3T3F A;  3MXM A;  4W5T A;  4KTW A;  5T7B A;  3MEE A;  2VWJ A;  1KFS A;  4CFA A;  4F3O A;  2HNZ A;  4PQU A;  1TK0 A;  1W0H A;  1U04 A;  1D9D A;  4FM0 A;  4DSE A; 
#chains in the Genus database with same CATH topology
 4WFN L;  4KPY A;  2G8H A;  2P9L B;  3FZF A;  3V81 A;  5B8H A;  1D5A A;  2PYL A;  1BL3 A;  1E4F T;  4BC4 A;  3F5T A;  3K0S A;  2KLA A;  3BF1 A;  1Q82 O;  3ZSQ A;  4CJV A;  4FLU A;  5AQO A;  3O80 A;  1KAY A;  4FW2 A;  3L4Q A;  4B8A B;  1NNE A;  4IZ9 A;  3NAE A;  4DTX A;  2FF6 A;  3VEZ A;  3WXM B;  3ZYY X;  1T6D A;  3OYH A;  1TKX A;  4ISG A;  4F8R A;  3A8Y A;  5GIN A;  1A5X A;  5GAG P;  4DTJ A;  4OPK A;  2QWQ A;  3QEX A;  5I3U A;  2YHW A;  4IBN A;  4CZK A;  3SPZ A;  3J7Z O;  3HVR A;  5AZJ B;  3NGI A;  4C1N I;  4CBX A;  3PSF A;  2E1Y A;  4PY5 A;  3R8E A;  1BQN A;  4KHY A;  4WF9 L;  1RBR A;  4LFC K;  1WLJ A;  1NMD A;  3V6D A;  2HHU A;  4BRO A;  4Q0B A;  3J8A A;  1X1P A;  3KZB A;  3OYA A;  1N34 K;  4JI4 K;  2DPN A;  2D0P A;  3OJU A;  4DSL A;  3QBX A;  2JWK A;  3J80 O;  2A6A A;  4JKF A;  4B1V A;  5CZ1 A;  4B9N A;  2D0C A;  4BE2 A;  4FWR A;  4IDK A;  3OYC A;  1GOA A;  1TYQ A;  3ZT2 A;  4RW6 A;  5AQV A;  3WEE B;  5FPD A;  2F7T A;  2HHV A;  3AVG A;  4FJM A;  2HHH K;  3D2F A;  1EXQ A;  5J2N A;  1RTJ A;  1QVG M;  4JI8 K;  3S3M A;  1CZA N;  1KXP A;  4RWT A;  4G1Q A;  4FJL A;  5KRT A;  2ASO A;  2YHA A;  3ITH A;  3LPU A;  3LWL A;  4DU1 A;  1DKG D;  5FLX O;  4OVL A;  4FJN A;  4JI2 K;  2XY7 A;  4DU3 A;  2HNY A;  4FLX A;  2ZJQ L;  5HRO A;  3MEG A;  3WNF A;  1BA0 A;  5CR4 A;  4M3R A;  3TSP A;  4AH9 A;  3K59 A;  1GLJ O;  1HLU A;  3VGL A;  3VQ8 A;  3NBP A;  3OTO K;  5EVZ A;  2QM1 A;  3OYM A;  4I9Q A;  2DY4 A;  3NH2 A;  5JLH A;  3VOV A;  3A5N C;  4CJR A;  1X3M A;  2ZJP L;  3BDP A;  1DGK N;  1Z26 A;  4CJ4 A;  4FOI A;  3THX A;  3T1A A;  1Y97 A;  4CK3 A;  1W7A A;  1EO1 A;  2VG6 A;  4KKO A;  1S5J A;  1Z25 A;  3LDO A;  5GIP A;  2ETJ A;  3QBW A;  3ASM A;  3VMF B;  4AQY K;  5HOO A;  4N5S A;  5C0Y A;  5CHI A;  1BG3 A;  4YFU A;  3AV9 A;  4O5B A;  4PA1 A;  4JKG B;  2HND A;  2QK9 A;  3KWI A;  3HP6 A;  4DR6 K;  2AP1 A;  2Q0R A;  2HMI A;  4Y0W A;  3VEO A;  3IG1 A;  4FWK A;  4GV3 A;  4FK2 A;  1VQ4 N;  3AVN A;  1NU0 A;  1MWK A;  1RDU A;  1J53 A;  1SS6 A;  3CCU N;  1NGF A;  1NJZ A;  2LSN A;  4DR4 K;  4NLB A;  3V4I A;  2X74 A;  5KRS A;  1ZBF A;  1ZXO A;  1C0F A;  3DLB A;  3VQ4 A;  3S41 A;  3CFR A;  3RMA A;  1SZ2 A;  2NRR A;  2HBJ A;  3SZ2 A;  3DLE A;  1XI1 A;  4AM6 A;  2J4R A;  3DOL A;  4CER A;  1ZC6 A;  1QHT A;  4OKK A;  2WON A;  1GOC A;  1KC8 O;  4FLZ A;  2YJF A;  5C15 A;  1X9W A;  4BR4 A;  1QQN A;  4FPB A;  5ADX A;  3CER A;  4ZTF A;  3AAQ A;  1VSJ A;  2QW9 A;  3BEX A;  2WOM A;  5AQK A;  1VRU A;  2YHB A;  1X9J A;  4CEF A;  3QIC A;  3MCP A;  4H0O A;  4DV5 K;  1NOY A;  4V19 S;  4PHT X;  3TTF A;  4XH1 A;  1JL1 A;  1GLE G;  1VSD A;  3RMB A;  2YNF A;  5HLF A;  2P9K B;  4BAC A;  2YNI A;  1NG9 A;  1I3A A;  5AFU A;  1KTQ A;  2KQ2 A;  4FSV A;  3OYE A;  2VQF K;  3QEP A;  4IKF A;  3FZM A;  4DV1 K;  5EU7 A;  3K9J A;  3T1H K;  1QQC A;  4KO0 A;  4CIE A;  2W6K A;  1XHX A;  1REV A;  1NKE A;  3ENH A;  4MQ3 A;  5AQZ A;  2Q3S A;  1N6Q A;  4Z94 A;  4W5O A;  5JLF A;  4Z4G A;  3WEE A;  3OBW A;  1N8R O;  2KFN A;  3HOS A;  3ULD A;  4M3T A;  4AHT A;  1IKY A;  1YF5 L;  3LZI A;  4BC5 A;  3E9O A;  2B5J A;  4E0D A;  1IG9 A;  3PX4 A;  5C2D A;  3U3Y A;  3VQ6 A;  4B1U B;  5MLC Q;  3ZSR A;  1HKG A;  2NUB A;  4I7F A;  4DMN A;  3AVK A;  5IT9 O;  3SAG A;  3BUZ B;  4BRA A;  3CXC M;  1IV0 A;  1EQY A;  1U6Z A;  4ISF A;  4KHN A;  1C0M A;  2ZQB A;  1U49 A;  3RVC A;  1GLB G;  3VQA A;  4IG3 A;  2CGL A;  5CZ2 A;  3UKR A;  1X9M A;  1IBL K;  2V52 B;  4FPA A;  4I2Q A;  4WQ4 C;  3CME N;  1A5W A;  3I8D A;  4ZTJ A;  2GUP A;  1IKW A;  1YVU A;  2DFE A;  3CYM A;  3W3D A;  4CZF A;  4H03 B;  3RMD A;  3CG7 A;  3CJC A;  2A40 A;  4M41 A;  3SQ1 A;  4AIL C;  1WBB A;  3AO1 A;  4M7Y A;  5J2Q A;  5I42 A;  4DHY A;  4TSX A;  4F2R A;  4C8K A;  3B6O A;  2Q0U A;  3OYK A;  3M8S A;  3AGR A;  1RDB A;  4B9V A;  4FW1 A;  3O1B A;  1NK4 A;  4I6M A;  4AHV A;  3DMJ A;  3ZX2 A;  1KVC A;  3CPE A;  1KLM A;  3RSE B;  3SUO A;  1YTA A;  4FWM A;  3U3G A;  3CFP A;  1RT3 A;  1TAQ A;  2HW3 A;  3BP8 A;  2HHX A;  1HRH A;  2Y1J A;  1M1K O;  4CEQ A;  4LH4 A;  4CE9 A;  3VQC A;  1HPZ A;  4CJ5 A;  2WFB A;  2JLE A;  1G15 A;  4WE1 A;  1K8A O;  3EO3 A;  1JLF A;  3FZL A;  1YI2 N;  3S3N A;  1YXQ A;  3TAQ A;  4FM1 A;  4E7H A;  4M3X A;  5AQU A;  4BRH A;  1RTI A;  1NGJ A;  4M63 C;  1WB9 A;  1NJW A;  4KH5 A;  2EHG A;  3V9S A;  3DJC A;  3V1R A;  4HUE A;  1E3M A;  3AVL A;  1LV5 A;  4IXC A;  2X78 A;  3P38 A;  3WXJ A;  3SUN A;  1QSY A;  1VSE A;  1JCG A;  3IDH A;  2D0O A;  1NK0 A;  4C8O A;  4DB3 A;  1HNZ K;  4CZL A;  5AQF A;  5AQX A;  2YX6 A;  4NCB A;  1WUA A;  1KD1 O;  3RSE A;  1NGE A;  4CHY A;  5DM7 L;  3U9Z A;  2E8A A;  4CHO A;  4MO5 A;  3AA4 A;  2ZF5 O;  3ENB A;  3O08 A;  4BDP A;  5AQS A;  3TSU A;  2IGI A;  3N4P A;  3IRX A;  4CHP A;  4NYF A;  4XEI A;  4DTU A;  3AVH A;  4PL7 A;  5AQM A;  4CF1 A;  2V51 B;  5AZJ A;  4DUY K;  4MLH A;  4BVO A;  1CZB A;  2O4G A;  3LDP A;  1GLL O;  1CZ9 A;  3JAM O;  4CCH A;  3IFR A;  3QER A;  3VQD A;  1JCE A;  2P9I B;  5JS1 A;  3IS9 A;  4H0V B;  4CVN E;  1OH5 A;  3KLF A;  3ZEU B;  1KFD A;  1HNW K;  4DTS A;  4JN4 A;  3TU5 A;  4KI4 A;  3QML A;  4IG0 A;  4DLG A;  5AJ3 K;  2XY6 A;  4ELU A;  1Q7Y O;  3CQ8 A;  3WT0 A;  3HO1 A;  4X65 K;  3TR8 A;  3QNO A;  3WXK A;  5C2F A;  4FVU A;  4CEZ A;  1BGX T;  4B9S A;  2A42 A;  4W5T A;  1KFS A;  4PQU A;  4F3O A;  4NB4 A;  1U04 A;  4BQZ A;  4JI1 K;  3SAF A;  3WQU A;  2OPR A;  2P51 A;  2P1J A;  2RF2 A;  1OH6 A;  4R5P A;  3FFI A;  3ATV A;  1S6Q A;  3AGK A;  3D7E O;  1RGI A;  4GKK K;  3K5M A;  4E1N A;  5DMR A;  3C94 A;  2IVP A;  5HRP A;  2E88 A;  3VES A;  5AQG A;  5HBM A;  1EET A;  4WFA L;  4FLY A;  4OKE A;  4Z4E A;  5F2R A;  4CHN A;  3F9K A;  3JS6 A;  4DG1 A;  1TL3 A;  4BRN A;  3FZK A;  4RG8 A;  4ISE A;  3MX2 A;  1T8E A;  4MFB A;  2O8C B;  3VEN A;  4ELT A;  2UUA K;  1UA0 A;  4BDY A;  3V9U A;  1HPM A;  3DLG A;  3HPH A;  4C8M A;  2HVH A;  4N41 A;  3AA2 A;  3HP9 A;  1NK7 A;  3J7Y P;  2OYQ A;  4C8L A;  5DK5 A;  3C6H A;  4DQQ A;  4KB1 A;  4LFA K;  1BIS A;  4LD0 A;  1RNH A;  3E01 A;  4DQS A;  4M3W A;  1LAV A;  4Q5V A;  3THW A;  3CJ1 A;  4KAZ A;  5LY3 A;  5KQD A;  3KLG A;  2UUC K;  4A59 A;  3IUC A;  3CJB A;  4C23 A;  1LOT B;  2IC3 A;  1F21 A;  3O3H A;  4CK2 A;  3VQP A;  2E20 A;  3ZSV A;  5E84 A;  4K42 A;  3G71 N;  4BC2 A;  4DTM A;  3GE1 A;  1V4T A;  4O8K A;  4KHS A;  2P9P A;  5AZI B;  5M1O A;  1W2B M;  3DWL A;  3KLH A;  4JNE A;  3EKU A;  1YUW A;  2V7Y A;  4CEE A;  5I9E B;  1VQ5 N;  4JKE A;  3KIO A;  1KVA A;  3CHW A;  4RW4 A;  3WXI A;  3TAG A;  1P8Z A;  3KK3 A;  4FCY A;  3NF8 A;  1S3X A;  4Y1D A;  3AVM A;  5CYM A;  2AA4 A;  1TKT A;  1N33 K;  1RDD A;  4DUZ K;  3WNE A;  1C0T A;  2W41 A;  4EZ6 A;  3M5R A;  4DFJ A;  1S9E A;  4IFV A;  5BRD A;  1OVY A;  4KBO A;  5C42 A;  4BGA A;  3SUP A;  3LAN A;  3VQ9 A;  3ZSZ A;  5KGW A;  4YOX A;  4J2B A;  3QB0 A;  3V9Z A;  4JLH A;  5EX5 A;  2E6M A;  2D4W A;  2DFF A;  2P9P B;  4KV8 A;  3L4I A;  3PY8 A;  4FJ8 A;  3E9L A;  2JWL A;  1E4G T;  4HUF A;  2ITM A;  3VGK A;  4BGB A;  1RDC A;  3ATU A;  4JEP A;  4W5Q A;  1S1T A;  3C7N A;  4OPH A;  3V9W A;  2GEL A;  4CGD A;  1RT1 A;  4J2D A;  3O1W A;  1VQN N;  3BZC A;  4CI6 A;  1HNI A;  5BRF A;  3QDK A;  3AAR A;  4H5W A;  2ZJR L;  1QSS A;  1HJR A;  4B1Z A;  2RPI A;  3UKR B;  3MN9 A;  3CF5 L;  2HBM A;  4I9L A;  3J7A P;  3V9X A;  2OPS A;  3SLC A;  4DR1 K;  1DLO A;  4FJX A;  3P83 D;  1GLC G;  1UA1 A;  1RT6 A;  3O4Q A;  4WQ4 A;  3KK1 A;  2EX3 A;  3T7Z A;  3CCQ N;  3HK2 A;  4JKB A;  1J54 A;  2UXB K;  1T3V A;  1NK9 A;  1L3U A;  5AFU H;  3QIO A;  1IH7 A;  3EZ5 A;  3ULE B;  4IOC L;  1N36 K;  3VN5 A;  3W0L A;  4GY2 B;  1IO2 A;  3OY9 A;  3MXJ A;  3CIP A;  1QE1 A;  1ZBU A;  1IKV A;  1BDG A;  3CCL N;  5FPM A;  4DS4 A;  3J81 O;  3LP2 A;  1MDU B;  3ZCM A;  1X3N A;  3L2Q A;  1MWM A;  4HTU A;  5FRO A;  2A41 A;  2NRT A;  4CGH A;  2BDP A;  4FLV A;  4KTQ A;  3VQ7 A;  4N56 A;  1JXE A;  3CQY A;  1HYZ A;  1TK5 A;  4BQL A;  1JJ2 M;  1IG8 A;  5M1F A;  3TPQ A;  3HYF A;  4QS8 A;  2QTD A;  4C1N K;  2HF3 A;  3K58 A;  1RT2 A;  1FW6 A;  4DR2 K;  1K73 O;  3P1G A;  1T03 A;  1WAJ A;  2P9K A;  3VTI A;  3FFK B;  2QWN A;  3WXL A;  1NGG A;  3BGR A;  3KTQ A;  1EP4 A;  3CCJ N;  4DSJ A;  3O4W A;  2UU9 K;  4CGI A;  2IVN A;  3IAY A;  4FOE A;  2G8K A;  2VG5 A;  3LP3 A;  2HB5 A;  3P39 A;  4FL9 A;  1UWB A;  4M42 A;  5AZI A;  3U9D A;  3E1Y A;  1TK8 A;  1GLD G;  2V7Z A;  2VG7 A;  3DLR A;  1U2V B;  3RR8 A;  3R9P A;  1CXQ A;  2WBN A;  3K9K A;  2YKM A;  4B9T A;  1GLA G;  4FJ7 A;  4GV6 A;  2DTU A;  2WUS A;  4JK8 A;  1ITG A;  1IBM K;  1KQS M;  1YVN A;  3LM9 A;  1BA1 A;  4CJW A;  1VQ9 N;  3R3L A;  1SQK A;  4AHU A;  3AVI A;  2KTQ A;  3CC2 N;  4IFE A;  3LP1 A;  1ATN A;  1RTD A;  4YDU C;  2FF3 B;  2BTF A;  4DU4 A;  4AHS A;  3D6R A;  1QZ5 A;  3VA0 A;  2IS3 A;  2ASM A;  3AVC A;  3KJV A;  5AQI A;  4YOY A;  3G6E N;  3NH1 A;  1C1C A;  1RCH A;  4DTN A;  2B4J A;  4BRM A;  3ID8 A;  1G99 A;  3CQX A;  4BRK A;  4J2E A;  5KI6 A;  1LW0 A;  4H0P A;  4MLE A;  4F4K A;  3TAB A;  1VQL N;  2Y1I A;  4GVM A;  4Y1C A;  4Z4F A;  1O13 A;  3QO9 A;  4CES A;  3KKS A;  4H5N A;  2PYJ A;  2HBK A;  1RDA A;  2F96 A;  4BWM A;  4DFK A;  4RW9 A;  3ENO A;  4BR7 A;  4FJH A;  2VCP A;  1UAX A;  3H3N O;  4LF4 K;  1LAW A;  4RCH A;  3SV4 A;  4LY7 A;  2UXD K;  1HNX K;  3OS2 A;  3PX6 A;  4M45 A;  4Z0U A;  4OX9 K;  2O8E B;  5GIO A;  1TL1 A;  4B1Y B;  4CZJ A;  4M7X A;  1HQU A;  4BY9 C;  3HXM A;  3CET A;  1MU2 A;  3OJS A;  3LWM A;  4GKJ K;  4QCL A;  4JK9 A;  2E6L A;  1SL2 A;  4BRP A;  3NVM A;  5JVG L;  3KD5 E;  4DR3 K;  1RBT A;  3SQ0 A;  5KPT A;  1S22 A;  3DAW A;  4M3Y A;  4H8K A;  2F4V K;  4KTZ A;  3KLE A;  2A3Z A;  4FJ9 A;  3L2W A;  2FLO A;  4CJK A;  4K8X A;  1K9M O;  1HYV A;  2AJQ A;  1JKH A;  3TAP A;  1I94 K;  4B3O A;  5JS2 A;  2Z1G A;  4ELV A;  2XHB A;  3LZJ A;  3MK6 A;  2IIR A;  1VQ8 N;  5M1P A;  1SKR A;  2PY5 A;  5BPM A;  1VAZ A;  4UQG A;  3AAP A;  4QS7 A;  5CYQ A;  5BRH A;  3OS1 A;  3SI6 A;  3MX5 A;  1X9S A;  4C8N A;  5AR0 A;  1NWK A;  4L3Q A;  4PKI A;  4B3T K;  2QWM A;  2FBX A;  4FLW A;  3FE1 A;  3DM2 A;  2QI2 A;  3CI5 A;  5F1X A;  1XNQ K;  3TAM A;  2G8I A;  3V1O A;  3FR0 A;  4JRQ A;  3FZH A;  3H08 A;  2HHS A;  4OJR A;  3QIN A;  3ZSX A;  1ZYQ A;  4BWJ A;  2P9L A;  1KLN A;  3THY A;  4FK0 A;  2W40 A;  3M3Z A;  2Q1N A;  2IOC A;  3L3V A;  3CCR N;  1QZ6 A;  2ZGY A;  4DV4 K;  1VSF A;  4JKC A;  3TWH A;  1YTU A;  1HKB A;  1RIL A;  3OA9 A;  4DSF A;  5C10 A;  2YJE A;  4KHP K;  3THV A;  2FC0 A;  1DEJ A;  4OPJ A;  4CJF A;  3CCS N;  3MWT A;  2ZE2 A;  3QEV A;  1JXB A;  5HRN A;  1JLQ A;  2CH6 A;  4B1X B;  2XRI A;  4DTO A;  1U45 A;  1FXX A;  2CGJ A;  1TV6 A;  2HST A;  2NLX A;  4XIU A;  4K41 A;  5T7B A;  3MEE A;  4HWI A;  2VWJ A;  1P90 A;  1K8K A;  2HNZ A;  4K0K K;  4LF8 K;  2W6L A;  1KAX A;  4DSE A;  3OVN A;  5KGX A;  3MN5 A;  4NO7 A;  4JI5 K;  4BR9 A;  3K57 A;  3C6A A;  5DM6 L;  1S1W A;  2FBT A;  3OBY A;  2QWO A;  1Y64 A;  2F8S A;  1NK8 A;  1YT3 A;  1HJO A;  2XO7 A;  4YOW A;  4G9Z A;  1SKS A;  1WN7 A;  3KK2 A;  2Z1H A;  4A61 A;  4OLA A;  3LP0 A;  1VQM N;  2VQE K;  2O8D A;  3VER A;  2HOE A;  2IVO A;  3OYG A;  4KRE A;  1EWR A;  1D4X A;  1GOB A;  1RDW X;  4CZE A;  2O8C A;  4LF9 K;  4FXD A;  2GWJ A;  1HYS A;  4ILH A;  4CJU A;  2HF4 A;  3IMX A;  4BE0 A;  3VEW A;  1A5V A;  1S72 N;  1VSH A;  2VWK A;  2G8F A;  1QHA A;  4NCG A;  3DOK A;  1LW2 A;  3Q7C A;  1TAU A;  2F8T A;  5LMN K;  2YCH A;  1NK5 A;  3DLK A;  1ATR A;  3CJ9 A;  3ZET A;  3C65 A;  2GX9 A;  5AQN A;  1NLV A;  3I8B A;  3KK7 A;  3ZEU A;  3FGU A;  3TTC A;  5KPR A;  1OKJ A;  4N76 A;  5GAE P;  4KB0 A;  1UOC A;  5BR9 A;  1HMV A;  1L3T A;  3PUF A;  4H4M A;  4BRI A;  4DFM A;  2DFH A;  3CM6 A;  2YI1 A;  3SUQ A;  2A5X A;  4GV9 A;  2QA4 N;  4E7I A;  4PWD A;  2ZGZ A;  4JKA A;  1DTQ A;  1HUX A;  3TTD A;  2OZS A;  1JLA A;  4B8C A;  3NE6 A;  2FSN A;  3VEY A;  2BE2 A;  5AQP A;  1WNS A;  5AQH A;  2VGN A;  1NKB A;  3OYL A;  1RBV A;  4JRP A;  3M8Q A;  4F9O A;  1XUP O;  3A5M C;  1QSL A;  1VSL A;  1HR0 K;  4BRD A;  4FWS A;  1XMQ K;  4L8R B;  4ICL A;  4DR5 K;  3E9P A;  3LDS A;  3O9U A;  5LJW A;  2O8B A;  4H0Y B;  3SK3 A;  4BE1 A;  4DCH A;  4BRL A;  1B92 A;  4JKG A;  5JVH L;  3LDN A;  5AQY A;  3CM5 A;  5AQT A;  2VGM A;  5BPL A;  3P31 A;  1BWF O;  3RMC A;  3PO4 A;  5SZT A;  1Z6R A;  2F9W A;  1VQO N;  4ILJ A;  1YJW N;  1S6P A;  4AHR A;  2E5L K;  4DFP A;  3AO5 A;  2I5J A;  5M1Q A;  3WQT A;  3SAH A;  1ZBH A;  2QWP A;  3K5L A;  5TKY A;  1WAF A;  4IEE A;  4WQ5 A;  4FYD A;  4YOV A;  2OPP A;  1J9A A;  4H5R A;  4BC3 A;  1LWC A;  3QEI A;  2ZWH A;  1VSM A;  5LJV A;  1T6C A;  3VET A;  3S3O A;  1JCF A;  4NLC A;  2R7Y A;  3GG4 A;  3ID6 A;  2X6S A;  3M8P A;  4FJG A;  4IDH A;  3THX B;  1TKD A;  1S1V A;  4A5A A;  1XMO K;  3A2F A;  3ZSW A;  1TUU A;  4PKG A;  1R0A A;  5J2P A;  3NVK A;  2D0B A;  1I39 A;  4FJ5 A;  2YNG A;  5LMU K;  3QES A;  4A2A A;  3SNN A;  2P9S B;  2KZZ A;  1BOT O;  4B3R K;  3KLI A;  2D0A A;  4CIF A;  3DLH A;  3QNN A;  4I2P A;  3NF6 A;  4B9M A;  3CJA A;  5KTQ A;  1U48 A;  4BDZ A;  5AQL A;  3OYJ A;  4HHT A;  4CHQ A;  1BCO A;  4KHQ A;  3PO5 A;  4O4G A;  3F73 A;  3KWG A;  4CZM A;  3B6P A;  4BRE A;  5SWM A;  4OLB A;  4LSN A;  3AVJ A;  4F2S A;  3MN6 A;  2G8W A;  4J8F A;  3G4S N;  1XWL A;  4FZY A;  3L0Q A;  5C12 A;  2QWL A;  4O5F A;  1YAG A;  4IO9 L;  3HJF A;  3KD1 E;  3M1F A;  1VQ6 N;  3K2P A;  5BRE A;  4CJP A;  1IJJ A;  1OH7 A;  1NGB A;  2CGK A;  5CY4 A;  1CXU A;  3NHG A;  1OVQ A;  4YOT A;  3EN9 A;  3VF2 A;  4CEA A;  1VQP N;  3SV3 A;  3OYD A;  1Z05 A;  1K8K B;  1WBD A;  4CF2 A;  4YY3 K;  2ZM6 K;  4DR7 K;  1K6Y A;  2GEM A;  3HST B;  1RBS A;  4OKJ A;  4YOR A;  4BG8 A;  4WYB A;  4A57 A;  4DKW A;  1EKE A;  2E2P A;  4ZHR A;  2FSK A;  4WCE L;  3OYF A;  4FWQ A;  3JYT A;  3QFP A;  2VWB A;  2X6N A;  3E66 A;  5BN8 A;  2NRW A;  3I0R A;  3NFA A;  4K43 A;  3C6U A;  4EP5 A;  4CGF A;  2NZT A;  1JLB A;  3H1Q A;  2UUB K;  4CK1 A;  4IOX A;  1WSJ A;  1WSG A;  2B6A A;  3B8A X;  3MXI A;  2HHT A;  4X66 K;  4H4O A;  1XC9 A;  3R1X A;  3AA3 A;  3ZT0 A;  3CMA N;  3SYZ A;  3AO3 A;  1TYQ B;  3KKR A;  3DI6 A;  1Q86 O;  3HTV A;  1NGH A;  2QWR A;  5CE3 A;  5EXW A;  4FM2 A;  4RW7 A;  4W5R A;  4FK4 A;  3DRS A;  2NRH A;  3VQB A;  1YJ9 N;  5E26 A;  1LWE A;  1KVB A;  4LH5 A;  2O8E A;  5ADX H;  4MDA A;  5M1N A;  4FZX C;  4CJQ A;  4EP4 A;  2G8U A;  1SL0 A;  4BR5 A;  3VEV A;  3VQ5 A;  4XH5 A;  4OGE A;  1D9F A;  3ALY A;  3L8B A;  4HCC A;  5H1S Q;  3KVG A;  1T7P A;  1JLG A;  4E89 A;  1SKW A;  3D2E A;  3NCI A;  4FVM A;  4E1J A;  5J2M A;  4CBU A;  2QKB A;  3DXK B;  1O1W A;  2ASP A;  3NMU A;  3AO2 A;  4RTF D;  1ASV A;  3C7N B;  1FK9 A;  2OPQ A;  4B9L A;  4CFB A;  1L3V A;  5C25 A;  2IDO A;  1ZBI A;  4CJL A;  1TUY A;  3HOT A;  5KQ8 A;  2P5G A;  3UIQ A;  2P9I A;  1SL1 A;  4H5T A;  4O44 A;  4FWN A;  4EIA A;  3TSQ A;  1HKC A;  3ULE A;  2NRV A;  3L2R A;  2O8D B;  3SQ4 A;  1BI4 B;  1NJX A;  2YV0 X;  3HSC A;  4O0I A;  3HPG A;  1HX1 A;  4CF8 A;  1NJI O;  2RKI A;  5FDL A;  3F2K A;  2E2Q A;  4JHD A;  3VF6 A;  3S9H A;  1V4S A;  4FWL A;  1NBW A;  5KPZ A;  2KKZ A;  4N47 A;  5EY4 A;  1XC3 A;  3SBG A;  2NRX A;  1NGI A;  2PBD A;  3O4N A;  3PLA A;  1YIT N;  4CZH A;  1SUQ A;  3QFU A;  1T05 A;  3L3U A;  4PUO A;  4E19 A;  1VK0 A;  3CD6 N;  5C24 A;  1QVF M;  3Q7B A;  3T19 A;  4DF8 A;  3LAM A;  1NOZ A;  2RE2 A;  5BPN A;  3U8X A;  4BG9 A;  1KCF A;  4KHU A;  4AF1 A;  3UKU A;  3H46 O;  1ZBS A;  4DTP A;  2ZD1 A;  4JHD B;  3KHY A;  3MXM A;  3T3F A;  4CFA A;  1R59 O;  1W0H A;  3WUH A;  1D9D A;  3GDQ A;  3CC4 N;  4QOZ B;  3O9T A;  2OTL N;  3I56 N;  1L3S A;  4U7B A;  1H1V A;  1YJN N;  1N5Y A;  3TAR A;  3DLL L;  1U2V A;  4CJS A;  4B9Q A;  4LC9 B;  3LPT A;  3HZ6 A;  4E7L A;  1WSF A;  3SMP A;  3LAK A;  3C0B A;  4CEB A;  4DSI A;  3NF7 A;  4KH4 A;  2W42 A;  4CZI A;  3ZLJ A;  2E1Z A;  4IEI A;  3RR7 A;  2YHY A;  3SJH A;  4R79 A;  4K25 A;  4E7K A;  4PL8 A;  5EOY A;  5AQW A;  1QQM A;  3AY9 A;  4JI7 K;  3EL2 A;  1HQE A;  1HNV A;  1N32 K;  4BVP A;  4JI6 K;  1W97 L;  3DXM B;  3M6G A;  1S9G A;  2OZM A;  1RBU A;  1VSK A;  4H0T B;  1QQO A;  3M8R A;  4QAG A;  2RHK A;  3FLC O;  1JLC A;  4GVE A;  2P9S A;  4CJ7 A;  4FZZ A;  4FWO A;  3MED A;  2P9U B;  3HM9 A;  1U47 A;  3MAQ A;  5AQJ A;  2BH1 A;  5ELZ A;  5HRS A;  3SPY A;  2GTD A;  1M90 O;  4JI0 K;  3L6Q A;  5FPN A;  4UY8 O;  4B3S K;  3A5L C;  3NGZ A;  4CW7 B;  2UXC K;  3PX0 A;  3BY5 A;  3H3O B;  4HTL A;  4NXM K;  4B08 A;  4DQI A;  3DYA A;  2Q2R A;  3HRG A;  2PZS A;  1MA9 B;  3P5J A;  4GMJ B;  1IKX A;  2D5R A;  2BUP A;  4E7J A;  3DXM A;  5BN9 A;  4CEC A;  1RT7 A;  4NXN K;  3HM8 A;  4IFY A;  3EE9 A;  4DV7 K;  4CFC A;  4JAX A;  4W5N A;  3SJJ A;  4K8Z A;  3THY B;  2QXF A;  1RFQ A;  3UE5 A;  1C0G A;  3OYB A;  2BAN A;  3T69 A;  1EX4 A;  4FO0 A;  3NGY A;  2FXU A;  3I33 A;  5E41 A;  3VQQ A;  4I6M B;  3ZT4 A;  4FJJ A;  1T44 A;  4Z4I A;  4DV2 K;  4MDB A;  4DV6 K;  3U4L A;  3LDL A;  3C6T A;  4EFH A;  2HHQ A;  4OGC A;  4FJK A;  4H5V A;  3HPO A;  2IAJ A;  4IJN A;  3ZX0 A;  4DV3 K;  4B1W B;  3TAF A;  3VEX A;  3WNG A;  1BQM A;  2Q97 A;  3JSM A;  1BIZ A;  4JKD A;  3F9M A;  2OAN A;  4YHH K;  1KSP A;  5IWA K;  1VHX A;  2GBZ A;  3SQ2 A;  4CF0 A;  1RTH A;  4CEO A;  4CIG A;  5A2Q O;  4DV0 K;  4O8U A;  3SCX A;  5FRN A;  1B9D A;  4M3U A;  4JYA K;  4A2B A;  1ATS A;  3V1Q A;  1ASU A;  3DRP A;  2QKK A;  4HVJ A;  3G10 A;  2QXL A;  3O6W A;  2OTJ N;  1NMN A;  3AVA A;  4CJE A;  3UB5 A;  3WNH A;  4CGJ A;  3EY1 A;  4AHC A;  4DQP A;  4HCB A;  2F9T A;  4AM7 A;  4Z4C A;  3H45 C;  4BR0 A;  1YHQ N;  3PIP L;  3H6E A;  1Q9X A;  3D2E B;  2WTU A;  3RWU A;  3QEW A;  3QIP A;  3LL3 A;  4BRC A;  3D45 A;  1TKZ A;  1SAZ A;  2KHO A;  4A62 A;  1NKC A;  4F3T A;  1S1U A;  2HBL A;  4KH6 A;  4FWP A;  4JK7 A;  3AO4 A;  4JS4 A;  4XH4 A;  1J5O A;  3G0Z A;  3ZET B;  5HP1 A;  4ID5 A;  4KFB A;  3QET A;  1YIJ N;  2JGU A;  4OPA A;  3RRG A;  3QLH A;  3OYN A;  3GL1 A;  3EYZ A;  3HL8 A;  3HT3 A;  1BHL A;  3CPW M;  5LL6 Z;  1XHZ A;  2E2N A;  1NGA A;  4X62 K;  3RTV A;  3ISN C;  4EHT A;  1VRT A;  3ZX3 A;  4DS5 A;  4FLT A;  2E4L A;  3CC7 N;  5AQQ A;  2HMP A;  2Z1I A;  4DSK A;  3ZSO A;  1ESV A;  4CGG A;  4CZG A;  3I0S A;  2HHW A;  3GOI A;  1VQK N;  3VTH A;  5D3G A;  3HI0 A;  3EZW A;  4LF6 K;  4CHZ A;  3EE8 A;  1J6Z A;  4CJT A;  1Q81 O;  1TGO A;  5GAD P;  1BO5 O;  4YDU A;  4J2A A;  2PFU A;  5AQR A;  4YOU A;  4CFD A;  4KRF A;  1NGD A;  1Q18 A;  2A1S A;  3DRR A;  3O3F A;  3BF3 A;  4CF9 A;  4DWI A;  1RT5 A;  4BRF A;  1BUP A;  3U6F A;  4DQR A;  4BRQ A;  2P9N A;  3GBT A;  4CJ3 A;  3AA5 X;  3LAL A;  1C6V A;  2O8F A;  1XQS C;  2D1K A;  4LF5 K;  3ZT3 A;  4B9U A;  2YNH A;  4OO1 J;  4JV5 K;  2YHX A;  4ILG B;  1WSE A;  1FKP A;  4O0J A;  3VPZ A;  3L2V A;  3DXK A;  3P4I A;  2NNW A;  3A0I X;  1ZBL A;  3LM2 A;  2E2O A;  2EWS A;  3OS0 A;  1C0U A;  1DT9 A;  5BR8 K;  4KI6 A;  4YNQ A;  2YKN A;  3D2F B;  1LCU A;  4NYN A;  4EHU A;  3O5B A;  1QTM A;  3K5N A;  2Q36 A;  3ZSY A;  5GAH P;  4IOA L;  5FPE A;  3AVF A;  3NH0 A;  2FBV A;  2O4I A;  4CBW A;  3PSI A;  5HRR A;  4LFB K;  1CLQ A;  3O9R A;  3IKM A;  3N4Q A;  2QEX N;  4PKH A;  3BZK A;  4CED A;  2KFZ A;  2P9N B;  2Q31 A;  1BI4 A;  4QS9 A;  2O8B B;  4HUG A;  3TAN A;  3MMV A;  4NCA A;  1VSI A;  3CJ7 A;  2I7P A;  2CH5 A;  3LDQ A;  1NK6 A;  4X64 K;  3TI0 A;  4JKH A;  1DTT A;  3RRH A;  3SBT A;  3THW B;  2KW4 A;  1NJY A;  5J1E A;  4CD3 A;  5M1K A;  1IBK K;  4WQ5 C;  2P9U A;  2XY8 A;  1U4B A;  3MN7 A;  4GW6 A;  2GWK A;  1FKO A;  3ZT1 A;  2KZM A;  3EKS A;  3D0P A;  4DTR A;  1WOQ A;  3C95 A;  4DQ8 A;  3CCE N;  3NF9 A;  3H1V X;  2UYT A;  2NRZ A;  1OH8 A;  4MO4 A;  1JLE A;  2Z1J A;  3OW2 M;  3OHR A;  1S1X A;  3G25 A;  3CCV N;  3L2U A;  3PIO L;  1BIU A;  4KHW A;  2XY5 A;  2I7N A;  4GNI A;  1B9F A;  3TAE A;  1ASW A;  1JL2 A;  4WFB L;  1QS4 A;  4RW8 A;  2OA8 A;  4Z4H A;  3VQE A;  3NDK A;  3CCM N;  3AVB A;  3T1Y K;  2GV9 A;  1RT4 A;  3HVT A;  1KRP A;  1EWQ A;  2H3G X;  1LWF A;  3HBT A;  3MDQ A;  5TKW A;  1WSH A;  4IO8 A;  4A5B A;  1GLF O;  2A1R A;  2HVI A;  3O9S A;  2P5O A;  4LSL A;  4E3S A;  2RN2 A;  4O55 A;  3VA3 A;  1NM1 A;  4DLE A;  3VF4 A;  1D8Y A;  4IWV A;  2FSJ A;  1Q9Y A;  3A5O C;  3SMS A;  4E1M A;  4EZ9 A;  1C1B A;  2ATQ A;  4JD2 A;  3MWP A;  2BGG A;  1TVR A;  2WC9 A;  4BR2 A;  4LF7 K;  1Q8I A;  1L5U A;  4CD1 A;  5F0X A;  5HL7 L;  1KAZ A;  3CFO A;  3K5O A;  1BU6 O;  2OCE A;  4ID1 A;  4U67 L;  3I55 N;  1J5E K;  3R6M A;  5K14 A;  4B3M K;  1XNR K;  2PAV A;  4JS5 A;  4H0X B;  1VQ7 N;  2FBY A;  4EAH D;  4IJA A;  4BRG A;  2GUI A;  1WSI A;  3MCA B;  3O3G A;  3O8M A;  5JMV A;  5JIC A;  1BCM A;  3UKU B;  3MEC A;  4M3Z A;  4FJI A;  1NGC A;  4JD2 B;  1W9H A;  3EEQ A;  1C1A A;  2G8V A;  1SV5 A;  3VGM A;  3OYI A;  2VYP A;  1ILY A;  2ITG A;  2O8F B;  4DF4 A;  3PV8 A;  5FRM A;  1FJG K;  4KTW A;  3JXU A;  3O9Q A;  1TK0 A;  4JI3 K;  4FM0 A; 
#chains in the Genus database with same CATH homology
 3OVN A;  5KGX A;  4QOZ B;  4KPY A;  2G8H A;  2OPR A;  2P51 A;  2P1J A;  2RF2 A;  3V81 A;  4R5P A;  1L3S A;  3FFI A;  3K57 A;  1S6Q A;  1D5A A;  2PYL A;  1BL3 A;  1S1W A;  1N5Y A;  3TAR A;  2FBT A;  2F8S A;  1NK8 A;  3K5M A;  4E1N A;  4CJS A;  1YT3 A;  2XO7 A;  5DMR A;  3LPT A;  3C94 A;  5HRP A;  4E7L A;  3ZSQ A;  4CJV A;  1WSF A;  1SKS A;  3LAK A;  5HBM A;  1EET A;  4FLY A;  1WN7 A;  4CEB A;  4FLU A;  4OKE A;  3KK2 A;  4Z4E A;  4DSI A;  4CHN A;  2Z1H A;  3NF7 A;  4FW2 A;  3F9K A;  4OLA A;  2W42 A;  3LP0 A;  4B8A B;  4DG1 A;  1TL3 A;  3RR7 A;  3NAE A;  4RG8 A;  4DTX A;  3OYG A;  1T8E A;  4MFB A;  4KRE A;  4ELT A;  3OYH A;  1TKX A;  4F8R A;  4E7K A;  1GOB A;  4BDY A;  3V9U A;  1UA0 A;  4DTJ A;  1A5X A;  4OPK A;  3QEX A;  4FXD A;  5I3U A;  3DLG A;  4IBN A;  1HYS A;  3HPH A;  4C8M A;  2HVH A;  3SPZ A;  4N41 A;  4CJU A;  3AA2 A;  3HVR A;  4BE0 A;  1HQE A;  1A5V A;  3HP9 A;  1NK7 A;  1HNV A;  2OYQ A;  1VSH A;  4C8L A;  2VWK A;  5DK5 A;  2G8F A;  4NCG A;  3NGI A;  4DQQ A;  3DOK A;  1LW2 A;  4PY5 A;  4KB1 A;  1BQN A;  4KHY A;  1TAU A;  1RBR A;  1WLJ A;  1BIS A;  4LD0 A;  1S9G A;  1RNH A;  1RBU A;  1VSK A;  3E01 A;  2OZM A;  3V6D A;  4DQS A;  3M8R A;  3DLK A;  1NK5 A;  4M3W A;  4QAG A;  2HHU A;  1LAV A;  4Q5V A;  4Q0B A;  1JLC A;  1X1P A;  4FZZ A;  3OYA A;  4KAZ A;  3MED A;  3KLG A;  3HM9 A;  1U47 A;  3OJU A;  2IC3 A;  3MAQ A;  4DSL A;  4N76 A;  4KB0 A;  1UOC A;  5HRS A;  1F21 A;  5CZ1 A;  3O3H A;  3SPY A;  4B9N A;  1HMV A;  2D0C A;  1L3T A;  4CK2 A;  4BE2 A;  3PUF A;  4H4M A;  4DFM A;  4IDK A;  3NGZ A;  3VQP A;  3ZSV A;  2DFH A;  5FRM A;  3CM6 A;  3PX0 A;  4B08 A;  3OYC A;  2F8T A;  1GOA A;  3ZT2 A;  3SUQ A;  4DQI A;  3DYA A;  4RW6 A;  4DTM A;  4E7I A;  4PWD A;  2PZS A;  3P5J A;  4GMJ B;  1DTQ A;  4KHS A;  1IKX A;  2D5R A;  2OZS A;  4E7J A;  3KLH A;  4CEC A;  2HHV A;  1RT7 A;  3AVG A;  1JLA A;  4B8C A;  4FJM A;  3NE6 A;  4IFY A;  4CEE A;  2BE2 A;  1EXQ A;  3KIO A;  1KVA A;  4RW4 A;  4CFC A;  1WNS A;  1RTJ A;  5J2N A;  3TAG A;  4W5N A;  3SJJ A;  3KK3 A;  3S3M A;  4K8Z A;  2QXF A;  4FCY A;  1NKB A;  3NF8 A;  4Y1D A;  3OYL A;  4G1Q A;  3AVM A;  3OYB A;  1RBV A;  2BAN A;  1EX4 A;  5CYM A;  5KRT A;  4FJL A;  4JRP A;  2YHA A;  3ITH A;  3M8Q A;  3LPU A;  3LWL A;  4DU1 A;  1TKT A;  3NGY A;  5E41 A;  1QSL A;  1VSL A;  3VQQ A;  1RDD A;  4OVL A;  3WNE A;  1C0T A;  3ZT4 A;  4L8R B;  4FJJ A;  4ICL A;  4FJN A;  4Z4I A;  4EZ6 A;  2XY7 A;  4DU3 A;  3LDS A;  2HNY A;  4FLX A;  4DFJ A;  1S9E A;  5HRO A;  3MEG A;  3WNF A;  4IFV A;  4BE1 A;  3C6T A;  4M3R A;  4AH9 A;  3K59 A;  2HHQ A;  4OGC A;  1B92 A;  5C42 A;  3VQ8 A;  4FJK A;  3SUP A;  3NBP A;  3LAN A;  3HPO A;  2IAJ A;  3CM5 A;  3VQ9 A;  3ZSZ A;  5KGW A;  4J2B A;  3OYM A;  3V9Z A;  4I9Q A;  2DY4 A;  4JLH A;  3NH2 A;  2E6M A;  3TAF A;  2DFF A;  3WNG A;  1BQM A;  3JSM A;  3RMC A;  1BIZ A;  4KV8 A;  4CJR A;  5SZT A;  3BDP A;  3PO4 A;  3PY8 A;  4FJ8 A;  1Z26 A;  1KSP A;  4CJ4 A;  2GBZ A;  3SQ2 A;  4CF0 A;  4HUF A;  1RTH A;  3T1A A;  1S6P A;  4CEO A;  1Y97 A;  4AHR A;  4CIG A;  4CK3 A;  4DFP A;  3AO5 A;  2I5J A;  3SCX A;  4QCL A;  2VG6 A;  4KKO A;  5FRN A;  1RDC A;  4W5Q A;  1B9D A;  1S5J A;  4M3U A;  1ZBH A;  1Z25 A;  3V1Q A;  1S1T A;  3K5L A;  2ETJ A;  1ASU A;  3DRP A;  1WAF A;  3V9W A;  2QKK A;  4CGD A;  4HVJ A;  1RT1 A;  3G10 A;  3ASM A;  4J2D A;  4N5S A;  3AVA A;  4FYD A;  4CJE A;  4YFU A;  1HNI A;  2OPP A;  3AV9 A;  3WNH A;  4CGJ A;  3EY1 A;  4AHC A;  4DQP A;  4O5B A;  1QSS A;  4PA1 A;  1J9A A;  1HJR A;  2HND A;  2RPI A;  4HCB A;  3HP6 A;  1LWC A;  2QK9 A;  3QEI A;  2HMI A;  4Z4C A;  4I9L A;  1VSM A;  3V9X A;  2OPS A;  3IG1 A;  1DLO A;  3S3O A;  3P83 D;  4FJX A;  1Q9X A;  4FK2 A;  3RWU A;  3QEW A;  3AVN A;  3QIP A;  2R7Y A;  1UA1 A;  1RT6 A;  2X6S A;  1J53 A;  3M8P A;  3O4Q A;  3D45 A;  4FJG A;  1TKZ A;  1NJZ A;  1TKD A;  2LSN A;  1S1V A;  3KK1 A;  3A2F A;  2EX3 A;  1NKC A;  3ZSW A;  4F3T A;  1S1U A;  3V4I A;  2X74 A;  5KRS A;  5J2P A;  1R0A A;  1ZBF A;  3HK2 A;  2D0B A;  3DLB A;  3VQ4 A;  1I39 A;  4FJ5 A;  2YNG A;  3CFR A;  1J54 A;  3RMA A;  3AO4 A;  4JS4 A;  1NK9 A;  1L3U A;  1J5O A;  3SZ2 A;  3DLE A;  3QES A;  1XI1 A;  3SNN A;  3G0Z A;  3QIO A;  2KZZ A;  5HP1 A;  3KLI A;  1IH7 A;  2D0A A;  3DOL A;  4CER A;  4CIF A;  3EZ5 A;  3DLH A;  4ID5 A;  3QNN A;  4I2P A;  4KFB A;  3QET A;  4B9S A;  1QHT A;  2JGU A;  3NF6 A;  4OKK A;  2WON A;  1GOC A;  3RRG A;  4FLZ A;  4B9M A;  3QLH A;  3VN5 A;  1X9W A;  3OYN A;  5KTQ A;  1IO2 A;  3EYZ A;  3HL8 A;  3HT3 A;  1U48 A;  1BHL A;  1XHZ A;  3OY9 A;  3MXJ A;  4BDZ A;  4HHT A;  3OYJ A;  4ZTF A;  1QE1 A;  4CHQ A;  1BCO A;  1IKV A;  1ZBU A;  1VSJ A;  4KHQ A;  3RTV A;  3ISN C;  1VRT A;  4DS5 A;  4FLT A;  3PO5 A;  2E4L A;  2Z1I A;  4DS4 A;  2WOM A;  3LP2 A;  4O4G A;  4DSK A;  1VRU A;  2YHB A;  3ZCM A;  3L2Q A;  3F73 A;  3ZSO A;  5FRO A;  4HTU A;  4CGH A;  4CGG A;  4FLV A;  2BDP A;  3B6P A;  4KTQ A;  3VQ7 A;  4CEF A;  4N56 A;  3I0S A;  2HHW A;  5SWM A;  1JXE A;  4OLB A;  1HYZ A;  4LSN A;  1TK5 A;  3AVJ A;  5D3G A;  1NOY A;  4F2S A;  2G8W A;  1JL1 A;  3HYF A;  4CHZ A;  1VSD A;  3RMB A;  1XWL A;  4CJT A;  2YNF A;  1RT2 A;  3K58 A;  4FZY A;  1TGO A;  3P1G A;  5HLF A;  1T03 A;  4J2A A;  4BAC A;  3HJF A;  2YNI A;  3KD1 E;  1WAJ A;  1I3A A;  1KTQ A;  3K2P A;  2KQ2 A;  4CFD A;  4CJP A;  4KRF A;  3OYE A;  3QEP A;  2A1S A;  3DRR A;  3O3F A;  5CY4 A;  4CF9 A;  1CXU A;  3NHG A;  3BGR A;  4IKF A;  4DWI A;  1RT5 A;  5EU7 A;  3KTQ A;  3U6F A;  1EP4 A;  4DQR A;  4CEA A;  4DSJ A;  3SV3 A;  1QQC A;  3OYD A;  4KO0 A;  4CIE A;  4CGI A;  4CJ3 A;  3AA5 X;  1XHX A;  1REV A;  3LAL A;  1NKE A;  4CF2 A;  3IAY A;  1C6V A;  2G8K A;  2VG5 A;  1K6Y A;  3LP3 A;  4MQ3 A;  2HB5 A;  2Q3S A;  3HST B;  1RBS A;  4OKJ A;  3ZT3 A;  4W5O A;  1N6Q A;  4Z4G A;  1UWB A;  4B9U A;  2YNH A;  4M42 A;  2KFN A;  1TK8 A;  1WSE A;  3ULD A;  1FKP A;  4O0J A;  4M3T A;  1EKE A;  4AHT A;  3L2V A;  2VG7 A;  3DLR A;  1IKY A;  1ZBL A;  4ZHR A;  3LZI A;  3RR8 A;  3OS0 A;  2B5J A;  4E0D A;  3OYF A;  1IG9 A;  1CXQ A;  1C0U A;  3JYT A;  2YKM A;  3PX4 A;  2G8U A;  4B9T A;  4FJ7 A;  4KI6 A;  4YNQ A;  2DTU A;  2YKN A;  3U3Y A;  1ITG A;  3VQ6 A;  4NYN A;  1QTM A;  3ZSR A;  2NUB A;  4CJW A;  4I7F A;  2X6N A;  3K5N A;  4DMN A;  3ZSY A;  3AVK A;  3I0R A;  3NFA A;  4AHU A;  3AVI A;  2KTQ A;  3C6U A;  4EP5 A;  4CGF A;  3LP1 A;  1JLB A;  4CK1 A;  3AVF A;  3NH0 A;  2FBV A;  2O4I A;  1RTD A;  4KHN A;  1C0M A;  1WSJ A;  2ZQB A;  4DU4 A;  1U49 A;  5HRR A;  4AHS A;  1WSG A;  3VQA A;  3VA0 A;  2B6A A;  4IG3 A;  1CLQ A;  5CZ2 A;  2IS3 A;  3AVC A;  3KJV A;  1X9M A;  3MXI A;  2HHT A;  4CED A;  4H4O A;  3NH1 A;  1C1C A;  1RCH A;  4I2Q A;  1XC9 A;  4DTN A;  1BI4 A;  2KFZ A;  2B4J A;  1A5W A;  3I8D A;  3AA3 A;  4ZTJ A;  3ZT0 A;  4J2E A;  1IKW A;  1YVU A;  4HUG A;  2DFE A;  5KI6 A;  3CYM A;  3AO3 A;  3SYZ A;  1LW0 A;  3TAN A;  3RMD A;  4F4K A;  3TAB A;  4NCA A;  3KKR A;  1VSI A;  3CG7 A;  3DI6 A;  4GVM A;  3LWM A;  4Y1C A;  2Y1I A;  4Z4F A;  3QO9 A;  4M41 A;  4CES A;  3KKS A;  1NK6 A;  2PYJ A;  3TI0 A;  3SQ1 A;  1RDA A;  2F96 A;  1DTT A;  4BWM A;  4FM2 A;  3RRH A;  4AIL C;  4RW7 A;  4DFK A;  4W5R A;  3AO1 A;  4RW9 A;  1NJY A;  2KW4 A;  4FJH A;  5J1E A;  5I42 A;  5J2Q A;  1UAX A;  4TSX A;  4FK4 A;  1LAW A;  3DRS A;  3SV4 A;  2XY8 A;  4LY7 A;  1U4B A;  4C8K A;  4F2R A;  3B6O A;  3VQB A;  1LWE A;  4GW6 A;  1KVB A;  3OYK A;  3M8S A;  1FKO A;  3ZT1 A;  2KZM A;  1RDB A;  4B9V A;  3D0P A;  4FW1 A;  4LH5 A;  4DTR A;  3OS2 A;  3C95 A;  3PX6 A;  4M45 A;  1NK4 A;  4AHV A;  3DMJ A;  4Z0U A;  1KVC A;  3NF9 A;  4FZX C;  1KLM A;  4CJQ A;  1TL1 A;  1JLE A;  4EP4 A;  1YTA A;  2Z1J A;  3U3G A;  3CFP A;  3SUO A;  1SL0 A;  1RT3 A;  1S1X A;  1TAQ A;  2HW3 A;  3L2U A;  1HQU A;  2HHX A;  1HRH A;  3VQ5 A;  2Y1J A;  1BIU A;  4KHW A;  2XY5 A;  3HXM A;  4CEQ A;  4LH4 A;  4CE9 A;  1B9F A;  3VQC A;  3TAE A;  1ASW A;  4OGE A;  1JL2 A;  1HPZ A;  4CJ5 A;  1MU2 A;  3ALY A;  3OJS A;  1QS4 A;  2JLE A;  1G15 A;  4RW8 A;  2E6L A;  4WE1 A;  2OA8 A;  4Z4H A;  1JLF A;  3L8B A;  1SL2 A;  3VQE A;  4HCC A;  1T7P A;  3NDK A;  1JLG A;  4E89 A;  3KD5 E;  1SKW A;  1RBT A;  3AVB A;  3S3N A;  3SQ0 A;  3NCI A;  4FVM A;  3TAQ A;  5J2M A;  4FM1 A;  4E7H A;  4M3X A;  4M3Y A;  4H8K A;  2QKB A;  2GV9 A;  4KTZ A;  1RTI A;  3KLE A;  1O1W A;  1RT4 A;  1NJW A;  2EHG A;  3V9S A;  4FJ9 A;  3V1R A;  3HVT A;  4HUE A;  3L2W A;  1KRP A;  3AO2 A;  4CJK A;  3AVL A;  1LV5 A;  1LWF A;  4K8X A;  1ASV A;  2X78 A;  1FK9 A;  1WSH A;  2OPQ A;  4B9L A;  1HYV A;  2AJQ A;  4CFB A;  1JKH A;  5C25 A;  3TAP A;  3SUN A;  2IDO A;  1L3V A;  1VSE A;  1QSY A;  2A1R A;  4B3O A;  1NK0 A;  1ZBI A;  2HVI A;  4CJL A;  2P5O A;  4LSL A;  4C8O A;  5JS2 A;  2Z1G A;  4E3S A;  4ELV A;  2RN2 A;  4O55 A;  2XHB A;  3LZJ A;  2P5G A;  3VA3 A;  3UIQ A;  1SL1 A;  4NCB A;  4O44 A;  4DLE A;  1SKR A;  2PY5 A;  1D8Y A;  4CHY A;  4UQG A;  5CYQ A;  1Q9Y A;  3L2R A;  3OS1 A;  3SI6 A;  3SQ4 A;  1BI4 B;  1X9S A;  4CHO A;  4E1M A;  4EZ9 A;  1C1B A;  4C8N A;  1NJX A;  2YV0 X;  2ATQ A;  3AA4 A;  4O0I A;  3HPG A;  2BGG A;  4CF8 A;  2RKI A;  1TVR A;  4BDP A;  1Q8I A;  5FDL A;  2IGI A;  2FBX A;  4FLW A;  1L5U A;  3IRX A;  3DM2 A;  4CHP A;  3S9H A;  4NYF A;  4DTU A;  3AVH A;  3TAM A;  2G8I A;  4CF1 A;  4N47 A;  3CFO A;  3V1O A;  3K5O A;  4JRQ A;  3H08 A;  3O4N A;  4ID1 A;  2HHS A;  4OJR A;  1CZB A;  2O4G A;  3QIN A;  3ZSX A;  1ZYQ A;  4BWJ A;  1CZ9 A;  1KLN A;  5K14 A;  4CCH A;  4FK0 A;  4JS5 A;  3QER A;  1SUQ A;  2FBY A;  2IOC A;  3VQD A;  3L3V A;  2GUI A;  1T05 A;  5JS1 A;  1WSI A;  3IS9 A;  1VSF A;  3L3U A;  4PUO A;  4E19 A;  3TWH A;  1YTU A;  3KLF A;  1RIL A;  3O3G A;  1KFD A;  1VK0 A;  4DSF A;  4DTS A;  5C24 A;  1BCM A;  3T19 A;  4DF8 A;  3LAM A;  3THV A;  4KI4 A;  1NOZ A;  2FC0 A;  4IG0 A;  4OPJ A;  3MEC A;  4M3Z A;  4DLG A;  1KCF A;  4CJF A;  4FJI A;  2XY6 A;  1W9H A;  4KHU A;  4ELU A;  1C1A A;  2G8V A;  1SV5 A;  3CQ8 A;  2ZE2 A;  3QEV A;  1JXB A;  5HRN A;  4DTP A;  2ZD1 A;  1JLQ A;  3HO1 A;  3TR8 A;  2XRI A;  3OYI A;  3QNO A;  2ITG A;  1D9F A;  4DTO A;  4DF4 A;  3PV8 A;  4CEZ A;  1BGX T;  1FXX A;  1U45 A;  1TV6 A;  4XIU A;  3T3F A;  3MXM A;  4W5T A;  4KTW A;  5T7B A;  3MEE A;  2VWJ A;  1KFS A;  4CFA A;  4F3O A;  2HNZ A;  4PQU A;  1TK0 A;  1W0H A;  1U04 A;  1D9D A;  4FM0 A;  4DSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...