4CJWA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjwA00
4M45A 3JSMA 1B92A 4ID5A 1NJYA 4KRFA 1IKYA 1A5VA 4W5RA 3SUPA 1TK5A 1UA0A 3VQPA 1WSEA 3VQDA 3HSTB 1BI4A 4KHSA 3AVIA 1LAVA 4JRQA 1RT4A 4O55A 3LWLA 2KW4A 3DLEA 4CF8A 3RTVA 1KTQA 3VA3A 4NCGA 4KHUA 4FJKA 4CFDA 4DU4A 4C8LA 4Z4GA 2VWJA 3LP3A 2B5JA 1NK5A 1WLJA 3KKRA 1LV5A 1LAWA 1L3UA 3SNNA 1NKEA 3SPZA 4BE2A 3SYZA 2D0BA 4NYNA 5J2PA 3TAMA 2HNZA 4Z4HA 1SKSA 4EZ9A 3B6PA 2X6NA 3AVCA 1TVRA 1VK0A 4PA1A 2D5RA 1S1TA 1WSIA 4W5OA 3RMBA 4FJGA 4CECA 4CF2A 4QOZB 2Y1IA 3V4IA 3TAGA 4HCCA 4J2DA 2ZD1A 3MEDA 4DQQA 4Q0BA 3SUQA 1XI1A 4CJPA 3ZT4A 1JLFA 4F4KA 4B9TA 2P1JA 3QESA 3TAEA 2G8UA 4CEFA 2PY5A 3DI6A 3QEPA 3AVHA 1BGXT 3LP0A 3QETA 3S3OA 4B9VA 4PY5A 3S3NA 5JS2A 1JLQA 3V1QA 1HPZA 1VSEA 3VN5A 3WNFA 3SV4A 1RTIA 3KLGA 4DQIA 4M3WA 1WSHA 5T7BA 3C95A 3OYFA 4DTPA 3KK1A 1VSHA 1RDCA 2P5OA 4G1QA 4O4GA 3OYEA 2OYQA 4FK4A 4BE0A 2WOMA 4FJHA 2IAJA 4MFBA 1U47A 4DTNA 4FW2A 1Q9YA 4DSKA 5E41A 4M3TA 2HHVA 4M3YA 1JLGA 1LWCA 5J1EA 3L8BA 2BDPA 4ELVA 3K59A 3EYZA 4E7LA 2IOCA 4E7JA 3SQ0A 4CHQA 4DTOA 4C8NA 3QIOA 3LZIA 2OPPA 3SI6A 3PX4A 4KB0A 4F3OA 4M3UA 4OKJA 3O3FA 1A5XA 4OVLA 4IG0A 4DG1A 4E7IA 3SUNA 3BGRA 4I9LA 1SL2A 1GOBA 4JLHA 1DLOA 4B9MA 3QINA 4CJ5A 1QHTA 4CJQA 1RT2A 3HVTA 4CEBA 3TABA 3RMAA 3DLKA 1RBRA 4FJ8A 4CJUA 3V9XA 4DU1A 2X74A 3CFRA 1CZBA 4DF8A 3HL8A 4K8XA 1QSYA 1X1PA 3CM6A 1TKZA 1XC9A 3LP1A 2XHBA 4CFCA 3T3FA 4H8KA 4OPJA 4B9LA 4BDYA 4AILC 3VQBA 2YNGA 2OPQA 3QEWA 1JXBA 3K57A 4JS5A 5J2MA 2OA8A 1LW2A 3AO5A 2IGIA 1S9EA 4KV8A 4LSLA 5C25A 4LH5A 4OPKA 3V6DA 1J9AA 3AA3A 3VQEA 3OYBA 1Q9XA 3ZCMA 4KTZA 4BDPA 4FYDA 4HUEA 3ALYA 3WNGA 1ZBHA 2GBZA 3HK2A 1RDAA 4Y1CA 5CYQA 3ZSQA 3K58A 3VQ6A 2BE2A 4PUOA 3AA2A 3TI0A 1FK9A 3C6UA 4CIGA 4J2EA 2G8VA 3NGYA 1WNSA 3OY9A 3DRRA 3ULDA 1CLQA 1TKXA 4CEOA 5KGXA 4FM2A 5DMRA 1ZBUA 2JLEA 1FXXA 4WE1A 4CJKA 1NJZA 2IDOA 1J53A 2NUBA 1JLCA 2DFEA 4E7KA 4DTUA 3D45A 3LAMA 3P5JA 4B9SA 4GMJB 3HPOA 5C42A 3M8SA 1T05A 4OLBA 4DU3A 1QSSA 2HVIA 1GOCA 3L2UA 1MU2A 4E7HA 2F96A 2HW3A 3K5OA 4F2RA 1TK8A 2HNYA 3OYGA 2HHSA 4O0JA 4K8ZA 1TKTA 4DFKA 2XY5A 5K14A 3DOKA 4DTMA 1KFSA 4FW1A 1TAUA 2PYJA 3H08A 3P1GA 4B9NA 1HMVA 3ZT0A 1XHZA 2QKBA 5HBMA 4CEAA 3QNOA 4IKFA 3VQCA 3OYIA 3KD5E 3AVJA 1ZBIA 4KREA 1BIUA 3MXJA 3V9WA 4KFBA 3ZSVA 3OJUA 2AJQA 1HQUA 1SL0A 3AO3A 4CJTA 1IH7A 4BWMA 2OPSA 1L5UA 3PY8A 4Z4IA 4BACA 3TWHA 4CGDA 3KTQA 3PO4A 4KO0A 1D5AA 5FDLA 3OYDA 2O4IA 4EZ6A 1U4BA 2IS3A 1KVCA 5DK5A 2VWKA 3HPHA 4OKEA 5HRPA 4CJVA 3OYKA 1NJWA 2YHBA 4Q5VA 3PV8A 4FM1A 2LSNA 3TAPA 3V1OA 3T1AA 2G8FA 2HNDA 1X9WA 3LDSA 1IKVA 1LWEA 3KIOA 3OVNA 1VSJA 2YHAA 1JLEA 3AA4A 4HUGA 4O44A 3RRHA 3QERA 4IBNA 2F8SA 3ITHA 1A5WA 1W0HA 5KGWA 2KQ2A 3DLGA 3LANA 1NK6A 4DSLA 4NYFA 1TGOA 2FBVA 1KCFA 2EHGA 5HROA 2KFZA 1WAJA 3AVLA 3OS2A 1N5YA 3M8RA 4PQUA 3F9KA 3L3UA 2XY6A 1VSLA 1RT6A 1U04A 3SUOA 1SKWA 3HPGA 3HT3A 5FROA 4KHYA 2HHUA 1BISA 1VRUA 4KHQA 5I42A 1ZYQA 1NK8A 2HHQA 3ZT1A 3ZSXA 4O0IA 3G0ZA 1DTQA 4E3SA 4NCAA 1S6QA 2FBXA 4CGJA 4KPYA 3I8DA 3V9SA 4MQ3A 1T03A 4W5QA 4E1NA 1IO2A 4KHNA 3MXIA 2YKNA 1IG9A 1BQNA 4DSJA 4ZTFA 2DFHA 3M8PA 4XIUA 3CQ8A 3K5MA 1SL1A 4HHTA 2D0AA 4RW6A 1BI4B 3VQAA 3V9UA 2G8KA 4DWIA 3HJFA 3AVFA 3QLHA 4F2SA 2RF2A 4ZHRA 1JXEA 4N56A 4DQSA 1VRTA 3AVNA 1Y97A 4CHNA 1Z26A 4OGEA 3HVRA 3O4NA 1RTDA 3NE6A 1D9FA 1ZBLA 2ZQBA 1S6PA 1C6VA 3ISNC 3L2VA 3SV3A 1NKCA 1L3SA 4I2QA 2O4GA 1HNVA 4HTUA 4LY7A 2D0CA 4AHRA 3C94A 4CJEA 3LPTA 4B08A 4Y1DA 4OJRA 1HRHA 4FLVA 1KVBA 4FZZA 4AHCA 5HP1A 4FJLA 1WN7A 3O3GA 4FJIA 4AH9A 4KTWA 1LWFA 2Z1HA 2OZMA 1BHLA 1L3VA 4N41A 3QEIA 3G10A 5SZTA 4FJ7A 2RKIA 2YNFA 2I5JA 3CG7A 3TANA 5C24A 3RR7A 2YKMA 1B9DA 2YNHA 3AO2A 3OYLA 4CESA 1X9SA 4ELTA 1VSMA 5SWMA 1JKHA 4CE9A 5EU7A 5KRTA 2G8WA 3IAYA 3ZT3A 4RW8A 1I3AA 4FLXA 1N6QA 2PYLA 4YFUA 4FLZA 4ELUA 4OLAA 3UIQA 1C1BA 3K5LA 2DY4A 1RDBA 4UQGA 1D8YA 3CM5A 2EX3A 2P51A 4GVMA 4FVMA 4DFPA 3KD1E 3SQ1A 4FJNA 2YV0X 4FZYA 4C8MA 4JS4A 4CGIA 4DSIA 1C0MA 3OYHA 1EKEA 2E4LA 4CJFA 4IFYA 1EP4A 4E89A 3NGIA 4FM0A 3B6OA 3SJJA 1R0AA 4KB1A 3CYMA 3P83D 5FRNA 4FK2A 1UA1A 3MEGA 3OS1A 1EETA 3EY1A 3PUFA 1BIZA 4FLWA 3SZ2A 3SQ4A 1KLNA 1ASWA 4E1MA 4LH4A 4TSXA 3KLFA 1RDDA 3ZSZA 1NK9A 1XWLA 2DFFA 3AVGA 3MAQA 1BL3A 2HVHA 4PWDA 1HYVA 3L2WA 4LSNA 3AVMA 1JLAA 3IG1A 3ZSOA 4N5SA 3K2PA 4FCYA 2FBTA 4BDZA 3M8QA 4FJJA 1HQEA 1RTHA 2ATQA 4CJSA 4DLGA 4DFJA 4ZTJA 3RR8A 4C8OA 4FK0A 4KI4A 4CEZA 3KLEA 1ASVA 1RNHA 4CGGA 1RILA 2JGUA 3L3VA 4DTJA 5HLFA 4C8KA 2P5GA 4W5NA 1B9FA 3I0RA 4CK1A 5HRRA 4DTSA 1REVA 2ZE2A 4B9UA 3DYAA 2E6MA 4ICLA 3DM2A 1VSKA 2BANA 3L2RA 1RT5A 1F21A 4CF0A 4LD0A 3AA5X 2A1RA 4DSFA 3DLBA 4RG8A 4CK3A 4M3RA 4DFMA 4IFVA 4I2PA 4CGHA 3VQ4A 4QAGA 3NF9A 1HYSA 2E6LA 2B4JA 3VQ5A 1LW0A 1C0UA 5FRMA 3DLRA 4B3OA 2YNIA 4IG3A 4QCLA 1C0TA 1QTMA 4W5TA 1QS4A 2XO7A 4CHYA 2FC0A 5HRSA 3HP6A 2F8TA 1NJXA 1EXQA 4R5PA 4H4MA 4Z4FA 1ASUA 3IRXA 2B6AA 4EP4A 4CJRA 3NDKA 2QK9A 5JS1A 2Z1IA 4CIEA 1EX4A 3KLHA 1RBVA 1NKBA 4DQPA 1VSDA 3ZSYA 3AVBA 4CFBA 1TK0A 3TAQA 1YVUA 2Z1JA 4FZXC 2GUIA 3PX6A 1KSPA 4J2AA 4HVJA 2KZZA 3U6FA 4E0DA 1TKDA 1G15A 3SCXA 3MXMA 3NH1A 3OYNA 3HM9A 3S3MA 5KTQA 3NH2A 1SV5A 3QEXA 4I7FA 3K5NA 3KK3A 1U45A 3L2QA 3DLHA 4F3TA 3U3YA 4N47A 1YT3A 3VQ8A 2OZSA 3MECA 3KKSA 5KI6A 4CERA 1S1VA 1K6YA 3VA0A 1C1CA 4DTRA 1ITGA 3WNHA 3O4QA 1T8EA 1RT3A 3KLIA 3IS9A 3OYAA 1TL1A 3CFPA 3PX0A 1FKPA 1QSLA 1T7PA 3ZSRA 1IKWA 1TL3A 2HB5A 4FLTA 3NBPA 5J2QA 2XY7A 1NK7A 3CFOA 4ID1A 4Z4CA 4JRPA 3V1RA 4CEDA 4CF9A 3O3HA 1U49A 4CEEA 3SPYA 3OYJA 1CXUA 1JL1A 3HP9A 1W9HA 2A1SA 3ZSWA 3QO9A 4CIFA 4DLEA 3VQ7A 3AV9A 3WNEA 4DS4A 3OS0A 3OYMA 4DS5A 1CXQA 1S9GA 1KVAA 3LALA 4HCBA 4H4OA 1SUQA 4OKKA 2ITGA 2X78A 2WONA 4M3XA 1KLMA 2OPRA 3NHGA 1WSGA 4BWJA 4BE1A 4RW9A 3HXMA 4IDKA 4Z0UA 1SKRA 3RRGA 3LPUA 3F73A 5I3UA 2R7YA 4Z4EA 1D9DA 4CCHA 1S1UA 1CZ9A 1RBUA 5J2NA 1YTUA 3KK2A 1NK0A 2IC3A 1UWBA 3NF7A 4AHVA 3LWMA 2G8HA 4NCBA 1BCMA 3AO1A 4KAZA 1HNIA 1J54A 4FJMA 1RCHA 2QKKA 1ZBFA 3D0PA 3TR8A 3MEEA 3TARA 2RPIA 3NH0A 3QIPA 1S1WA 1FKOA 3LP2A 4FJ5A 4J2BA 3HYFA 2XRIA 4FLUA 3HO1A 3EZ5A 4RW7A 4CGFA 3PO5A 1JLBA 4B8CA 4OGCA 3LZJA 3AVAA 5CY4A 1RT1A 1VSIA 2VG7A 4B8AB 4DF4A 1GOAA 4CEQA 1J5OA 3VQ9A 1WSFA 3ASMA 3VQQA 1YTAA 2VG6A 4KI6A 4L8RB 1WAFA 3E01A 2X6SA 4GW6A 2KFNA 3SQ2A 3NFAA 1RBTA 2Q3SA 4CHPA 2RN2A 2KZMA 2XY8A 5KRSA 3AO4A 4N76A 3QNNA 4CHZA 3DOLA 1RBSA 1UAXA 1Z25A 5D3GA 2QXFA 1BCOA 4AHUA 4CFAA 3NF8A 1U48A 4HUFA 2HHTA 4FLYA 1VSFA 3DMJA 3T19A 2W42A 4M3ZA 3NCIA 2PZSA 1QQCA 1L3TA 3KJVA 4M42A 4FJXA 2VG5A 1XHXA 2Z1GA 4I9QA 4CF1A 2Y1JA 5CZ1A 4DQRA 1QE1A 4CJ3A 5CZ2A 4CK2A 1HJRA 3AVKA 4DTXA 1TV6A 4FXDA 2DTUA 1S1XA 4O5BA 4M41A 1NOYA 3A2FA 4YNQA 1JL2A 1O1WA 3OYCA 1IKXA 3OJSA 4F8RA 2BGGA 2HHXA 2FBYA 1TAQA 3V9ZA 3V81A 3C6TA 3RMDA 3ZT2A 3FFIA 2HMIA 4AHSA 3RWUA 2HHWA 2ETJA 4CHOA 4E19A 3BDPA 4CJ4A 5HRNA 4FJ9A 3JYTA 4KKOA 1DTTA 1Q8IA 4DSEA 5CYMA 1KFDA 3NGZA 4CJWA 3RMCA 3TAFA 1KRPA 4KHWA 2G8IA 1BQMA 1RT7A 4CJLA 3LAKA 4DMNA 3DRPA 3NAEA 4KTQA 4AHTA 3S9HA 2GV9A 4RW4A 4EP5A 3THVA 1X9MA 3I0SA 1I39A 1NK4A 1RTJA 2KTQA 1WSJA 1NOZA 1S5JA 1C1AA 1HYZA 3U3GA 3QEVA 3DRSA 3NF6A 1UOCA
chains in the Genus database with same CATH superfamily
1B92A 3MX2A 1TK5A 3K9JA 4CBXA 3O80A 1WSEA 3MN9A 3VQDA 3QB0A 1E4GT 1VQON 1BI4A 3AVIA 4JRQA 4O55A 3DLEA 4DCHA 4DUZK 2HBMA 3P31A 3WXJA 2O8CB 3LP3A 4BR5A 3P4IA 2B5JA 2P9UA 1NGAA 4FPBA 3SNNA 1ZBSA 1NKEA 4BE2A 1S22A 4JKCA 2HNZA 4Z4HA 1SKSA 4EZ9A 2X6NA 1TVRA 4PA1A 3LL3A 5AQYA 2D5RA 1WB9A 2OTJN 3ATVA 3TAGA 4H0VB 4DQQA 3QMLA 3KWGA 3BEXA 5GAHP 1JLFA 4F4KA 4B9TA 3NVKA 2P1JA 3MCPA 3R3LA 2PY5A 1TUYA 3DI6A 3LP0A 3S3OA 4B9VA 1JLQA 4B3RK 1RTIA 3KLGA 4DQIA 2HSTA 5T7BA 4IJNA 3KK1A 4K25A 4FK4A 4FJHA 2FSNA 3PIPL 4FW2A 4DTNA 4M3TA 4M3YA 3MCAB 3H45C 3PSFA 1E4FT 3CQYA 4IOCL 3THXA 1GLFO 3SI6A 1A5XA 4OVLA 2NRHA 4IG0A 4BVPA 3SUNA 3BGRA 3IUCA 4I9LA 3G4SN 1GOBA 4K43A 4CJQA 3TABA 5AQHA 2JWLA 3LDPA 4CJUA 3V9XA 2X74A 3DXKA 2H3GX 1TKZA 3LP1A 4H8KA 4OPJA 2NNWA 3KHYA 4B9LA 4NB4A 2YNGA 1JXBA 3K57A 4B3SK 4MLHA 3QFUA 3V6DA 4LH5A 3VQEA 3OYBA 4BDPA 3ALYA 1VQ4N 3J81O 1HKCA 2UXBK 3OBWA 5BRFA 4PUOA 1XNQK 5AQFA 4BRGA 2UU9K 5M1PA 5DMRA 2IDOA 2VGNA 1HUXA 4AQYK 4GNIA 1JLCA 3D6RA 3D45A 4LF6K 3LAMA 4B9SA 4GMJB 3M8SA 4OLBA 3L0QA 4DU3A 4Y0WA 1MU2A 2F96A 3DXKB 1C0GA 5ELZA 4B9NA 5HBMA 4CEAA 4IKFA 1NWKA 4CI6A 3OYIA 3KD5E 4KREA 1BIUA 3CHWA 3KVGA 5BR9A 4KFBA 1HQUA 4CVNE 4BWMA 4Z4IA 3TWHA 3KTQA 3H3OB 3OYDA 5GIOA 1N34K 5HRPA 1SS6A 1MWKA 3TAPA 3T1AA 3SJHA 4IOAL 5C10A 1JCFA 3EKUA 1LWEA 5H1SQ 1VSJA 5TKYA 3PIOL 4IBNA 4YOWA 3ITHA 1W0HA 2QXLA 2QA4N 2V7ZA 1W7AA 2FBVA 4A59A 3O9TA 1WAJA 1LCUA 2XY6A 3ULEA 4YOUA 1RT6A 1SKWA 3HPGA 1IG8A 3HT3A 1BISA 1YAGA 3ZYYX 1NK8A 3IMXA 3ZSXA 3C6HA 1J6ZA 4AM7A 1IO2A 4E1NA 1HKBA 3MXIA 2YKNA 4DSJA 1BQNA 3GDQA 4JK9A 3K5MA 4HHTA 2Q97A 5AQMA 3VQAA 4X64K 4DWIA 3AVFA 3QLHA 2OANA 4WFBL 4YOXA 1IV0A 2EWSA 4CHNA 1RTDA 2I7NA 1D9FA 3JXUA 4FWPA 2O4GA 1QQMA 4NLBA 4HTUA 4AHRA 3KK7A 5AQWA 1ATSA 3FLCO 1WN7A 3O3GA 4FJIA 2P9PA 3ULEB 3O1WA 4NLCA 4N41A 1BHLA 4JI6K 3G10A 2RKIA 2I5JA 4KHPK 4ISFA 3NMUA 3JAMO 4EHUA 1X9SA 4A62A 1OH6A 4FLXA 3ENHA 4OLAA 4EIAA 2P51A 4GVMA 4DFPA 5DM6L 4IFYA 3B6OA 3P83D 5E84A 1EETA 2E2PA 3A8YA 3CCSN 1BL3A 2HVHA 1GLBG 3VF4A 3AVMA 4Z94A 4FCYA 2UUCK 1XUPO 2P9PB 1HQEA 1HJOA 4FK0A 2JGUA 3E1YA 2P5GA 4IEEA 5HRRA 1NGBA 5AR0A 4O5FA 3VTHA 3NVMA 1VSKA 3CCLN 3J7AP 3H1QA 4H5RA 4XH1A 4M3RA 4DFMA 4IFVA 4I2PA 3LDNA 3UKUB 3F2KA 2B4JA 3VQ5A 1RDUA 5FRMA 3OBYA 4PHTX 1QS4A 4CHYA 1U2VA 4BY9C 2F8TA 3O9UA 4H4MA 1ASUA 2B6AA 5JS1A 4B3TK 4DQPA 2QWLA 4CFBA 1TK0A 3WXIA 2Z1JA 3CCMN 4JI8K 2IVPA 4I7FA 4F3TA 3L2QA 3DLHA 3U3YA 3VQ8A 2OZSA 3LM2A 1S1VA 4X62K 3QBXA 3IS9A 2FF6A 1FKPA 1QSLA 1MA9B 1IKWA 1TL3A 2QTDA 2HHHK 4Z4CA 5MLCQ 1XMOK 4BRKA 1CXUA 1JL1A 2BUPA 2A1SA 3ZSWA 4DS4A 3N4QA 3OYMA 4DS5A 5FPMA 1SUQA 4OKKA 2OPRA 5BPLA 3IKMA 4BE1A 4CZMA 3AY9A 3RRGA 4FWLA 2A41A 3H1VX 4LF9K 4Z4EA 1YF5L 1CZ9A 5J2NA 3THWB 2O8BB 5BPMA 2IC3A 2G8HA 5FPEA 4B1YB 4FJMA 2V51B 4JKFA 2QKKA 3D0PA 4IWVA 4CD1A 2YHYA 5AQNA 1S1WA 3LP2A 4FJ5A 2XRIA 3K0SA 5AQTA 3PO5A 2A40A 3LZJA 4B8AB 3VGKA 3A5LC 2BTFA 4BC5A 3C6AA 3ZLJA 3FZKA 4DV0K 4A5AA 1SZ2A 3CCEN 4BC3A 2XY8A 4N76A 3O9SA 4CHZA 1VQPN 4AHUA 2KKZA 1U48A 2NRTA 3VOVA 3DMJA 1G99A 3T19A 3L4IA 3DAWA 1QQCA 3E9LA 4M42A 4KBOA 2VG5A 1XHXA 4DQRA 1WBDA 1QE1A 2Q0UA 4DTXA 4JKGB 4FXDA 1S1XA 3CERA 2ZGYA 4YNQA 3OJSA 4KH5A 5KQDA 4JKAA 3UE5A 2HHXA 1DGKN 2HMIA 4AHSA 4NXNK 2ETJA 3BDPA 3JYTA 4H0YB 4DSEA 3NGZA 3QFPA 3RMCA 1HR0K 4BRQA 4CJLA 4DMNA 3CC2N 4QS7A 4JI5K 1N36K 4JK7A 4DV2K 1X9MA 5A2QO 2Q31A 4DV3K 2YI1A 1NK4A 4LF8K 2YJFA 1NOZA 2A42A 3KZBA 3U3GA 5F0XA 4DLEA 4M45A 3JSMA 3UKRA 1NJYA 3ZEUA 3HSTB 4CZKA 4KHSA 4M63C 1LAVA 5AZIA 3LWLA 1KTQA 3MN5A 3O5BA 4NCGA 1QHAA 5AQUA 3T1YK 1NGFA 4GV6A 2D0BA 3TAMA 1NGJA 4FJGA 1KC8O 2Y1IA 4J2DA 4Q0BA 3SUQA 4OX9K 3ZT4A 2YHXA 3QESA 4WQ5C 4JKDA 1HPZA 1JJ2M 1VSEA 3VN5A 3SV4A 5KPRA 3O9RA 3SMSA 2VQEK 3QBWA 1RDCA 4O4GA 3MDQA 3ZEUB 2IAJA 5KPZA 3FZFA 1U47A 1Q9YA 5E41A 4FWQA 2HHVA 5J1EA 3L8BA 2BDPA 2UUBK 2IOCA 4E7JA 3SQ0A 4CHQA 3LZIA 4M3UA 3PX4A 2F9TA 3FR0A 4MO4A 4F3OA 4KB0A 4JK8A 1BO5O 4HTLA 3J80O 5M1QA 2P9KA 4JI3K 1HNWK 3PSIA 4CZIA 3QINA 1QHTA 3RSEA 4CEBA 3RMAA 4JI7K 3HRGA 1RBRA 4X66K 3CJBA 4AILC 3TSPA 3C7NA 4FVUA 3QEWA 4JS5A 3UIQA 4KV8A 2IGIA 5C25A 4H03B 1Q9XA 4KTZA 3WNGA 3CJAA 1ZBHA 5CYQA 3K58A 5BRHA 3ZSQA 3P39A 1S72N 2UXCK 2BE2A 3R1XA 3TI0A 1FK9A 4BRFA 4J2EA 4B1VA 2P9LA 2IVNA 3NGYA 1WNSA 3I55N 3DRRA 1SAZA 3FFKB 2P9IA 3GBTA 3HBTA 1FXXA 4CJKA 4H0PA 2NUBA 3HOTA 3D2EA 3MMVA 5GIPA 2P9KB 2FSKA 2ITMA 5EVZA 1T05A 1Q86O 2HVIA 4JHDA 3WXLA 2NRVA 1OH5A 2HW3A 3K5OA 5EXWA 4F2RA 3K9KA 2HHSA 3SLCA 4DFKA 1KFSA 5K14A 2CGKA 3FZHA 3H08A 4BREA 2QKBA 5AQRA 1KXPA 1ZBIA 4ILGB 3MXJA 3OJUA 1XQSC 2CH6A 3AO3A 3ID6A 1IH7A 4CJTA 2Q0RA 5C12A 4CGDA 3WUHA 3PO4A 2UYTA 4KO0A 3MWPA 5FDLA 4U67L 3T7ZA 1U4BA 2IS3A 1KVCA 1YHQN 4CJVA 3OYKA 2YHBA 3PV8A 2P9IB 4FM1A 4LFAK 3Q7BA 1X9WA 1IKVA 4K0KK 2Q1NA 1JLEA 1QVFM 4O44A 3RRHA 2F8SA 5KGWA 4DSLA 3DLGA 4F9OA 4NYFA 4B3MK 2EHGA 4DV1K 5GAGP 1IJJA 5IWAK 4CJ7A 1U04A 3SUOA 5FROA 4KHYA 2HBJA 1VRUA 5I42A 2HHQA 3ZT1A 4L3QA 4O0IA 4E3SA 1S6QA 4KPYA 2IVOA 4MQ3A 1T03A 4A57A 4KHNA 2HOEA 4GV3A 4RWTA 3WEEA 3OW2M 4PKGA 4ZTFA 2DFHA 4XIUA 2WBNA 5AQZA 1WUAA 1KAXA 1BI4B 3V9UA 2G8KA 4CZGA 4DV6K 2RF2A 4ZHRA 3AVNA 1Q7YO 1X3NA 3O4NA 3HVRA 1DKGD 2ZQBA 1NKCA 2P9UB 4I2QA 2NLXA 1FJGK 4LY7A 4YDUC 4FLVA 1HRHA 2QWNA 4IOXA 2A3ZA 5BR8K 4BC2A 5SZTA 3I56N 4FJ7A 2YNFA 3RVCA 3BUZB 3CG7A 3TU5A 5C24A 1O13A 4IO9L 4ELTA 3W0LA 3ZX0A 5SWMA 4MO5A 3WEEB 5KRTA 2G8WA 3CCUN 3ZT3A 4BQZA 5M1KA 4FLZA 2CH5A 4MDAA 3K5LA 4BR4A 2EX3A 4FVMA 4FJNA 2HMPA 2E4LA 3THXB 3SJJA 2E2OA 5LJWA 4KB1A 5FRNA 3O6WA 5GAEP 3EY1A 3BF3A 1BIZA 3PUFA 2D0OA 3SZ2A 1BU6O 1ASWA 1BA1A 4TSXA 4E1MA 1NK9A 3ZSZA 1T6DA 3VENA 3MAQA 4WQ5A 1HYVA 3L2WA 4N5SA 2QW9A 2FBTA 4BDZA 4FJJA 4DFJA 1RTHA 4DLGA 4ZTJA 4C8OA 4KI4A 4CEZA 4DTJA 2V52B 3L3VA 5HOOA 2NRRA 1B9FA 1GLEG 3R6MA 1REVA 2JWKA 1SQKA 2E6MA 3TSUA 2FLOA 3H3NO 4YOTA 3F9MA 3UB5A 3DLBA 3O08A 4RG8A 3L6QA 1LOTB 2E5LK 5F2RA 2O8DA 5E26A 2NZTA 2E6LA 5BN9A 1C0UA 4B3OA 4IG3A 1YVNA 4BQLA 3VMFB 4WFAL 4AF1A 4H5NA 5LY3A 1EXQA 2QK9A 4CJRA 2Z1IA 1RBVA 1GLLO 3SBTA 1KAZA 3HM8A 3VEVA 3PX6A 2KZZA 2ASMA 3NH1A 3S3MA 4BR0A 1BDGA 3QEXA 4LFBK 5BPNA 1T6CA 1T3VA 3BZKA 4A5BA 2QI2A 3VA0A 1C1CA 2VQFK 1RT3A 1TL1A 5BN8A 3ZSRA 5J2QA 3V1RA 3R8EA 4CF9A 3O3HA 2YJEA 1NBWA 1W9HA 3RMBA 2O8FA 1N33K 1CXQA 3H46O 3LALA 4HCBA 5AQIA 4H4OA 2WONA 1KLMA 1IBMK 1WSGA 5LMNK 1N32K 4IDKA 3MWTA 1D9DA 1S1UA 1RBUA 5JVHL 3KK2A 1NK0A 3NF7A 2D0PA 3DXMA 4GKJK 4MDBA 4JAXA 5M1NA 1ZBFA 2GX9A 2VYPA 1EWQA 1QZ6A 4FLUA 4V19S 3HO1A 1JLBA 3MX5A 4DF4A 2VG7A 4CEQA 3VQ9A 3THYA 1YTAA 2VG6A 3E01A 3SQ2A 3NFAA 3CC4N 4CHPA 2F4VK 2RN2A 4B1XB 2KZMA 5BRDA 5KRSA 5LJVA 2O8FB 1RBSA 1UAXA 1Z25A 2QXFA 4O8KA 2HHTA 1VSFA 2W42A 3CJ7A 5ADXA 3NCIA 4X65K 4FJXA 3ZX2A 4I9QA 1TYQA 5CZ2A 2I7PA 1HJRA 1XC3A 3AVKA 1TV6A 2DTUA 3FE1A 4O5BA 3AAQA 1NOYA 4OPAA 3A2FA 1BUPA 4FL9A 4BRIA 2FBYA 3C6TA 3RMDA 3ZT2A 1KD1O 1VQKN 2HHWA 1S3XA 1P8ZA 4BG8A 4E19A 4CJ4A 4FJ9A 5CYMA 1KFDA 1VQMN 3OTOK 2HF4A 4K42A 3THYB 5FPNA 3DRPA 4KTQA 4AHTA 3S9HA 4QS8A 5HL7L 3THVA 4YDUA 1C0FA 1WSJA 1YIJN 3L4QA 3QEVA 2WFBA 4M3XA 1BG3A 5KPTA 1UOCA 4KRFA 1HKGA 4YOVA 2WUSA 4GVEA 3G25A 3M6GA 1TYQB 4CF8A 3CJCA 4BR9A 2ZJQL 4DU4A 4C8LA 4FWNA 5AZJA 1NK5A 1V4TA 1ESVA 1LAWA 3E9OA 4CZJA 1L3UA 3SPZA 4JI2K 3B6PA 4W5OA 2O8EA 4QOZB 3V4IA 1IBKK 3MK6A 4BRPA 1XI1A 2E20A 3N4PA 4JKHA 3TAEA 4PY5A 3AVHA 4DR4K 5TKWA 3S3NA 1U2VB 3WNFA 5AQJA 5AQOA 5CE3A 1WSHA 3LM9A 3OYFA 4DTPA 3WT0A 3LDOA 3I8BA 4G1QA 4DSKA 1IBLK 2AA4A 3SK3A 1JLGA 1LWCA 3CI5A 3K59A 4C23A 3EYZA 4ISGA 4E7LA 4C8NA 3QIOA 3LDQA 4E7IA 3VPZA 4JLHA 1DLOA 5JLHA 4WFNL 1RT2A 3HVTA 3VGMA 4FJ8A 3FZLA 5EX5A 5GADP 4DU1A 3CFRA 4DF8A 4K8XA 4E1JA 4CFCA 2O8EB 3VESA 3CXCM 4EFHA 4CZEA 2OPQA 4CBUA 1LW2A 1S9EA 4LSLA 1HNXK 3ZCMA 3AGKA 4HUEA 1RDAA 4Y1CA 3C0BA 4KH4A 4IXCA 3OY9A 3E66A 1CLQA 1TKXA 4FM2A 1M1KO 4FPAA 3EE9A 4H5VA 4M7XA 2JLEA 4WE1A 2GUPA 4M7YA 4KH6A 4LFCK 3PLAA 1R59O 4DTUA 2DFEA 3HPOA 5C42A 1QSSA 1GOCA 1TK8A 2ZM6K 2HNYA 2NRWA 4O0JA 4K8ZA 1TKTA 2XY5A 4DTMA 1FW6A 2PYJA 3P1GA 1HMVA 3ZT0A 2YX6A 2QM1A 4LF4K 1Y64A 4JYAK 2VWBA 1NG9A 1Q18A 1SL0A 3HSCA 1YJWN 1L5UA 5I9EB 1K8KA 3CCQN 1D5AA 1NGGA 1GLDG 4EZ6A 2ASPA 3CQXA 3U9DA 2VWKA 3HPHA 2Q2RA 4OKEA 1NJWA 2E1ZA 4JI4K 3V1OA 3O1BA 2G8FA 3U9ZA 1M90O 2RE2A 3LDSA 3J7YP 3OVNA 1NGHA 1VAZA 4HUGA 3QERA 3TSQA 1A5WA 3LANA 1NK6A 1KCFA 5HROA 2KFZA 3AVLA 4H5TA 3M8RA 3F9KA 3O4WA 1W2BM 4KHQA 2Q36A 1DTQA 4NCAA 1MWMA 2FBXA 4CGJA 3SAHA 3MN7A 1P90A 4DKWA 3EE8A 2PFUA 3UKRB 1VHXA 1CZAN 3M8PA 1K8KB 5AQKA 3VGLA 4B1ZA 1SL1A 4RW6A 3MN6A 3VERA 5AZIB 4WCEL 1JXEA 1VRTA 1YJNN 2ZJRL 4OGEA 2DPNA 1ZBLA 4FWSA 1C6VA 3ISNC 1L3SA 4JI0K 1VQ8N 4JNEA 3EZWA 4JN4A 5JMVA 1HNVA 3BY5A 4CJEA 3P38A 4B08A 4OJRA 1BOTO 4FZZA 4AHCA 2PBDA 4FJLA 4KTWA 1LWFA 2Z1HA 1NM1A 3ZX3A 4FOIA 3CF5L 3OA9A 3EO3A 3IDHA 1HPMA 2ZGZA 3RR7A 2CGJA 5AQVA 4BVOA 2YNHA 4MLEA 1X9JA 1JKHA 1NGEA 1TUUA 4CE9A 3T1HK 1I94K 4GKKK 1QQOA 4YFUA 1VQ7N 5AFUH 1C1BA 2OCEA 2DY4A 1D8YA 2A6AA 4C8MA 4DV5K 4BRHA 4CGIA 3WXMB 1EKEA 4CJFA 1EP4A 3NGIA 4DV7K 1N8RO 3VETA 3MEGA 3OS1A 1XMQK 4FOEA 3RSEB 2DFFA 4PWDA 4LSNA 3ZSOA 4H0XB 2PAVA 4B9QA 4BRAA 4H5WA 3M8QA 4CJSA 3C7NB 3KLEA 3O8MA 1ASVA 1RNHA 4CGGA 4BRLA 3I0RA 2ZWHA 3SMPA 4CK1A 3CMAN 4DTSA 3VF6A 2YHWA 2ZE2A 3DYAA 1EO1A 4ICLA 1OH8A 1VQ5N 5LMUK 4LD0A 4CK3A 4ILJA 2P9LB 4CGHA 3VQ4A 4DR6K 4QAGA 3NF9A 1HYSA 1LW0A 2GELA 2YNIA 4QCLA 2J4RA 4XEIA 4W5TA 4FWKA 2FC0A 3D2EB 4FWRA 5HRSA 1NGDA 1NJXA 4BGBA 2E2NA 4Z4FA 5AQXA 4JHDB 3TTFA 1NGIA 1NKBA 3KLHA 3ZSYA 3GL1A 1YVUA 3E9PA 3TPQA 1BA0A 5C0YA 1YITN 4FZXC 2GUIA 4DUYK 4J2AA 1JCGA 4YORA 3U6FA 1G15A 3MXMA 3HM9A 1NU0A 3NH2A 1SV5A 3K5NA 4DHYA 4N47A 1YT3A 3EN9A 3MECA 4AM6A 1K6YA 4DTRA 1T8EA 4OO1J 3KLIA 3DWLA 3OYAA 3IAYA 4FLTA 4KHUA 4JRPA 4CEDA 4LF5K 4JEPA 4CEEA 3SPYA 4BC4A 3HP9A 4FO0A 3SBGA 4CIFA 5GINA 3VQ7A 3OS0A 3FGUA 1NLVA 1KVAA 3AARA 3JS6A 3NHGA 4BWJA 4RW9A 1SKRA 1K8AO 1YTUA 3T69A 4DR5K 1UWBA 3LWMA 4JI1K 3EEQA 1BCMA 3AO1A 4KAZA 3SAFA 1HNIA 4BRDA 1J54A 1RCHA 4RCHA 3M1FA 3CPWM 3NH0A 3R9PA 1FKOA 4J2BA 3HYFA 3CJ1A 3EZ5A 4RW7A 4CD3A 4B8CA 5HLFA 3AVAA 1RT1A 1VSIA 1GOAA 1J5OA 4K41A 3ASMA 3VQQA 1VQNN 4L8RB 5EY4A 1WAFA 2X6SA 1YXQA 2KFNA 5AJ3K 4B1WB 4CW7B 3QDKA 3WQTA 4IEIA 3QNNA 5D3GA 4YY3K 4LC9B 1BCOA 4CFAA 5IT9O 4M3ZA 1RFQA 5FLXO 1L3TA 2PZSA 4EAHD 1BWFO 3KJVA 2Z1GA 4CF1A 1ZC6A 4NO7A 3HTVA 3OHRA 4M41A 3CIPA 3CPEA 2AP1A 3OYCA 1IKXA 4WQ4C 3V81A 3SAGA 1JCEA 3B8AX 5HRNA 2F7TA 4KKOA 2CGLA 5JLFA 1DEJA 3WQUA 2G8IA 1BQMA 1H1VA 3LAKA 3NAEA 4IJAA 2GV9A 4RW4A 4EP5A 1I39A 3A5MC 1RTJA 2KTQA 1C1AA 1HYZA 3DRSA 3NF6A 3VF2A 5FPDA 2P9SA 4DV4K 4ID5A 1IKYA 1A5VA 4W5RA 3SUPA 3O9QA 1UA0A 3VQPA 2OTLN 1RT4A 3W3DA 1HNZK 2KW4A 3RTVA 3VA3A 3U4LA 4FJKA 4CFDA 4Z4GA 2VWJA 4DR2K 4EHTA 4RTFD 1WLJA 3KKRA 1YJ9N 1LV5A 2ZF5O 3VEOA 3SYZA 1GLAG 4JD2A 4ISEA 1D4XA 4NYNA 5J2PA 3AVCA 1VK0A 3VEYA 1S1TA 1WSIA 3HZ6A 4GY2B 4CECA 4CF2A 4HCCA 2ZD1A 4JKBA 3MEDA 2O8DB 4CJPA 1T44A 4IFEA 4UY8O 1KAYA 4QS9A 2G8UA 4CEFA 3QEPA 1BGXT 3QETA 5JS2A 3V1QA 2P9SB 4M3WA 2GWJA 2WC9A 3C95A 2RHKA 1VSHA 2QWQA 2P5OA 3OYEA 2OYQA 4BE0A 2WOMA 4MFBA 4ELVA 2E1YA 1ILYA 4DTOA 1YUWA 2OPPA 1DT9A 4OKJA 3O3FA 4DG1A 3BP8A 4YHHK 2QWMA 1SL2A 3H6EA 4B9MA 4A2AA 4CJ5A 5DM7L 4JD2B 3DLKA 1CZBA 3GG4A 3HL8A 3J7ZO 1QSYA 1X1PA 3CM6A 1XC9A 2XHBA 3T3FA 5B8HA 2QEXN 4BDYA 3G6EN 3VQBA 4LF7K 3CCVN 5J2MA 2OA8A 2A5XA 4CZFA 3AO5A 4OPKA 4BG9A 4FWMA 1GLJO 1J9AA 3AA3A 5C2DA 1VQ6N 4FYDA 3HK2A 2GBZA 1K73O 1RGIA 4DR3K 1ATNA 3VQ6A 4IO8A 1X3MA 3AA2A 3C6UA 4O8UA 5EOYA 4CIGA 4DQ8A 5AQLA 2G8VA 1ZXOA 2UUAK 3UKUA 3ULDA 4CEOA 5KGXA 1ZBUA 3DXMB 1NJZA 4NXMK 1J53A 4E7KA 3P5JA 4G9ZA 4PL8A 3L2UA 4E7HA 3EL2A 3OYGA 3DOKA 1TAUA 4FW1A 5CHIA 3CETA 1XHZA 3QNOA 4H0TB 3VQCA 1WOQA 3AVJA 3IFRA 4WF9L 1Z6RA 1QQNA 3V9WA 3ZSVA 1K9MO 2KLAA 2AJQA 2OPSA 2UXDK 2YCHA 3PY8A 4BACA 2GEMA 2P9NA 2O4IA 4GV9A 2QWPA 3ZETA 4A61A 3D7EO 5DK5A 3U8XA 4Q5VA 2LSNA 1Z05A 1NGCA 2HNDA 3KIOA 2D1KA 2YHAA 3AA4A 1NMDA 3BZCA 2KQ2A 1TGOA 4BR2A 4BGAA 3OS2A 1N5YA 4PQUA 3L3UA 1VSLA 4ILHA 3THWA 2HHUA 2O8BA 1ZYQA 3DJCA 3CD6N 1OH7A 3G0ZA 5JVGL 4A2BA 3M5RA 3I8DA 3V9SA 4W5QA 4DR7K 1MDUB 3TTCA 1IG9A 3AGRA 3CQ8A 5C15A 4U7BA 2D0AA 4C1NI 4WQ4A 2P9NB 4BRMA 3HJFA 3EKSA 3ZETB 4F2SA 2NRZA 4N56A 4DQSA 2FF3B 4YOYA 1Y97A 1Z26A 1J5EK 5ADXH 1EQYA 1HX1A 3A5OC 3NE6A 5M1OA 5AZJB 1S6PA 3L2VA 3SV3A 4XH4A 2D0CA 3C94A 3LPTA 2QWRA 4Y1DA 1NNEA 1KVBA 5HP1A 4AH9A 1OVYA 3HI0A 1HLUA 2OZMA 3AAPA 1L3VA 4JKGA 3QEIA 2GWKA 5BREA 2GTDA 4J8FA 3TANA 3G71N 2D4WA 4WYBA 2YKMA 1B9DA 3AO2A 3OYLA 3KWIA 4CESA 1VSMA 5EU7A 4FSVA 4RW8A 1I3AA 1N6QA 4FWOA 2PYLA 4ELUA 2WTUA 3A0IX 1RDBA 4R79A 4UQGA 3CM5A 1Q81O 3HOSA 3TTDA 3KD1E 3CMEN 3SQ1A 3CC7N 2YV0X 4FZYA 4JS4A 4DSIA 1C0MA 3OYHA 4E89A 4FM0A 5AQGA 2HF3A 1R0AA 1OVQA 3CYMA 4FK2A 1V4SA 1UA1A 4FLWA 3SQ4A 3M3ZA 1KLNA 3KLFA 4LH4A 1RDDA 1XWLA 4OPHA 3AVGA 3Q7CA 1VQLN 2IIRA 1JLAA 3ID8A 3IG1A 3K2PA 1QZ5A 3CCJN 1NMNA 3WXKA 2ATQA 3VEXA 3RR8A 4CZLA 4JV5K 1RILA 2FSJA 4C8KA 4W5NA 2W41A 3FZMA 2ASOA 2E8AA 3I33A 5AQQA 4B9UA 3DM2A 2BANA 3L2RA 1RT5A 1F21A 4CF0A 3AA5X 2A1RA 2W6LA 4DSFA 3J8AA 4H0OA 2V7YA 3CJ9A 1Q82O 3CCRN 3C65A 5LL6Z 3LDLA 3DLRA 5AFUA 2E2QA 2VCPA 1C0TA 5AQSA 1QTMA 2XO7A 4BR7A 2E88A 2FXUA 3HP6A 4PKHA 3VTIA 4R5PA 1E3MA 2F9WA 1KQSM 3IRXA 4EP4A 3NDKA 1OKJA 3VEZA 4CIEA 1EX4A 1VSDA 3AVBA 3BF1A 3TAQA 1KSPA 4HVJA 4E0DA 1TKDA 3SCXA 3OYNA 1U6ZA 5KTQA 3KK3A 1U45A 4C1NK 3KKSA 5KI6A 4CERA 4JKEA 1ITGA 4XH5A 3S41A 3O4QA 3WNHA 5JICA 1GLCG 2VGMA 3CFPA 2BH1A 3PX0A 5C2FA 1T7PA 1NK7A 2HB5A 2XY7A 3NBPA 3CFOA 4ID1A 2KHOA 1U49A 2NRXA 3OYJA 2W6KA 3QO9A 3WNEA 3AV9A 4DR1K 4PKIA 1S9GA 4I6MA 3ENOA 2ITGA 2X78A 1NJIO 3HXMA 4Z0UA 3LPUA 3ATUA 3F73A 5I3UA 2R7YA 4CCHA 4AHVA 1W97L 4NCBA 1QVGM 4BRNA 4CZHA 5M1FA 3TR8A 3MEEA 3TARA 2RPIA 4BROA 3QIPA 4IDHA 4CGFA 3ENBA 4OGCA 5CY4A 3D2FA 3A5NC 3VEWA 1WSFA 4KI6A 4BRCA 4PL7A 4GW6A 1RBTA 2Q3SA 5CR4A 5KQ8A 3AO4A 3DOLA 3NF8A 4I6MB 4CBWA 4HUFA 1RDWX 4FLYA 1ATRA 3F5TA 3GOIA 2Y1JA 5CZ1A 3DLLL 4CJ3A 4HWIA 4CK2A 4DB3A 5F1XA 2QWOA 2HBKA 1XNRK 2O8CA 2HBLA 1JL2A 1O1WA 2BGGA 4F8RA 3GE1A 1TAQA 3V9ZA 3RWUA 3FFIA 1YI2N 2ZJPL 4CHOA 4IZ9A 1WBBA 1DTTA 1Q8IA 1VQ9N 4CJWA 3D2FB 1EWRA 4B1UB 3TAFA 1KRPA 4KHWA 1RT7A 3QICA 2W40A 3I0SA 5AQPA 1S5JA
chains in the Genus database with same CATH topology
4M45A 3JSMA 1B92A 4ID5A 1NJYA 4KRFA 1IKYA 1A5VA 4W5RA 3SUPA 1TK5A 1UA0A 3VQPA 1WSEA 3VQDA 3HSTB 1BI4A 4KHSA 3AVIA 1LAVA 4JRQA 1RT4A 4O55A 3LWLA 2KW4A 3DLEA 4CF8A 3RTVA 1KTQA 3VA3A 4NCGA 4KHUA 4FJKA 4CFDA 4DU4A 4C8LA 4Z4GA 2VWJA 3LP3A 2B5JA 1NK5A 1WLJA 3KKRA 1LV5A 1LAWA 1L3UA 3SNNA 1NKEA 3SPZA 4BE2A 3SYZA 2D0BA 4NYNA 5J2PA 3TAMA 2HNZA 4Z4HA 1SKSA 4EZ9A 3B6PA 2X6NA 3AVCA 1TVRA 1VK0A 4PA1A 2D5RA 1S1TA 1WSIA 4W5OA 3RMBA 4FJGA 4CECA 4CF2A 4QOZB 2Y1IA 3V4IA 3TAGA 4HCCA 4J2DA 2ZD1A 3MEDA 4DQQA 4Q0BA 3SUQA 1XI1A 4CJPA 3ZT4A 1JLFA 4F4KA 4B9TA 2P1JA 3QESA 3TAEA 2G8UA 4CEFA 2PY5A 3DI6A 3QEPA 3AVHA 1BGXT 3LP0A 3QETA 3S3OA 4B9VA 4PY5A 3S3NA 5JS2A 1JLQA 3V1QA 1HPZA 1VSEA 3VN5A 3WNFA 3SV4A 1RTIA 3KLGA 4DQIA 4M3WA 1WSHA 5T7BA 3C95A 3OYFA 4DTPA 3KK1A 1VSHA 1RDCA 2P5OA 4G1QA 4O4GA 3OYEA 2OYQA 4FK4A 4BE0A 2WOMA 4FJHA 2IAJA 4MFBA 1U47A 4DTNA 4FW2A 1Q9YA 4DSKA 5E41A 4M3TA 2HHVA 4M3YA 1JLGA 1LWCA 5J1EA 3L8BA 2BDPA 4ELVA 3K59A 3EYZA 4E7LA 2IOCA 4E7JA 3SQ0A 4CHQA 4DTOA 4C8NA 3QIOA 3LZIA 2OPPA 3SI6A 3PX4A 4KB0A 4F3OA 4M3UA 4OKJA 3O3FA 1A5XA 4OVLA 4IG0A 4DG1A 4E7IA 3SUNA 3BGRA 4I9LA 1SL2A 1GOBA 4JLHA 1DLOA 4B9MA 3QINA 4CJ5A 1QHTA 4CJQA 1RT2A 3HVTA 4CEBA 3TABA 3RMAA 3DLKA 1RBRA 4FJ8A 4CJUA 3V9XA 4DU1A 2X74A 3CFRA 1CZBA 4DF8A 3HL8A 4K8XA 1QSYA 1X1PA 3CM6A 1TKZA 1XC9A 3LP1A 2XHBA 4CFCA 3T3FA 4H8KA 4OPJA 4B9LA 4BDYA 4AILC 3VQBA 2YNGA 2OPQA 3QEWA 1JXBA 3K57A 4JS5A 5J2MA 2OA8A 1LW2A 3AO5A 2IGIA 1S9EA 4KV8A 4LSLA 5C25A 4LH5A 4OPKA 3V6DA 1J9AA 3AA3A 3VQEA 3OYBA 1Q9XA 3ZCMA 4KTZA 4BDPA 4FYDA 4HUEA 3ALYA 3WNGA 1ZBHA 2GBZA 3HK2A 1RDAA 4Y1CA 5CYQA 3ZSQA 3K58A 3VQ6A 2BE2A 4PUOA 3AA2A 3TI0A 1FK9A 3C6UA 4CIGA 4J2EA 2G8VA 3NGYA 1WNSA 3OY9A 3DRRA 3ULDA 1CLQA 1TKXA 4CEOA 5KGXA 4FM2A 5DMRA 1ZBUA 2JLEA 1FXXA 4WE1A 4CJKA 1NJZA 2IDOA 1J53A 2NUBA 1JLCA 2DFEA 4E7KA 4DTUA 3D45A 3LAMA 3P5JA 4B9SA 4GMJB 3HPOA 5C42A 3M8SA 1T05A 4OLBA 4DU3A 1QSSA 2HVIA 1GOCA 3L2UA 1MU2A 4E7HA 2F96A 2HW3A 3K5OA 4F2RA 1TK8A 2HNYA 3OYGA 2HHSA 4O0JA 4K8ZA 1TKTA 4DFKA 2XY5A 5K14A 3DOKA 4DTMA 1KFSA 4FW1A 1TAUA 2PYJA 3H08A 3P1GA 4B9NA 1HMVA 3ZT0A 1XHZA 2QKBA 5HBMA 4CEAA 3QNOA 4IKFA 3VQCA 3OYIA 3KD5E 3AVJA 1ZBIA 4KREA 1BIUA 3MXJA 3V9WA 4KFBA 3ZSVA 3OJUA 2AJQA 1HQUA 1SL0A 3AO3A 4CJTA 1IH7A 4BWMA 2OPSA 1L5UA 3PY8A 4Z4IA 4BACA 3TWHA 4CGDA 3KTQA 3PO4A 4KO0A 1D5AA 5FDLA 3OYDA 2O4IA 4EZ6A 1U4BA 2IS3A 1KVCA 5DK5A 2VWKA 3HPHA 4OKEA 5HRPA 4CJVA 3OYKA 1NJWA 2YHBA 4Q5VA 3PV8A 4FM1A 2LSNA 3TAPA 3V1OA 3T1AA 2G8FA 2HNDA 1X9WA 3LDSA 1IKVA 1LWEA 3KIOA 3OVNA 1VSJA 2YHAA 1JLEA 3AA4A 4HUGA 4O44A 3RRHA 3QERA 4IBNA 2F8SA 3ITHA 1A5WA 1W0HA 5KGWA 2KQ2A 3DLGA 3LANA 1NK6A 4DSLA 4NYFA 1TGOA 2FBVA 1KCFA 2EHGA 5HROA 2KFZA 1WAJA 3AVLA 3OS2A 1N5YA 3M8RA 4PQUA 3F9KA 3L3UA 2XY6A 1VSLA 1RT6A 1U04A 3SUOA 1SKWA 3HPGA 3HT3A 5FROA 4KHYA 2HHUA 1BISA 1VRUA 4KHQA 5I42A 1ZYQA 1NK8A 2HHQA 3ZT1A 3ZSXA 4O0IA 3G0ZA 1DTQA 4E3SA 4NCAA 1S6QA 2FBXA 4CGJA 4KPYA 3I8DA 3V9SA 4MQ3A 1T03A 4W5QA 4E1NA 1IO2A 4KHNA 3MXIA 2YKNA 1IG9A 1BQNA 4DSJA 4ZTFA 2DFHA 3M8PA 4XIUA 3CQ8A 3K5MA 1SL1A 4HHTA 2D0AA 4RW6A 1BI4B 3VQAA 3V9UA 2G8KA 4DWIA 3HJFA 3AVFA 3QLHA 4F2SA 2RF2A 4ZHRA 1JXEA 4N56A 4DQSA 1VRTA 3AVNA 1Y97A 4CHNA 1Z26A 4OGEA 3HVRA 3O4NA 1RTDA 3NE6A 1D9FA 1ZBLA 2ZQBA 1S6PA 1C6VA 3ISNC 3L2VA 3SV3A 1NKCA 1L3SA 4I2QA 2O4GA 1HNVA 4HTUA 4LY7A 2D0CA 4AHRA 3C94A 4CJEA 3LPTA 4B08A 4Y1DA 4OJRA 1HRHA 4FLVA 1KVBA 4FZZA 4AHCA 5HP1A 4FJLA 1WN7A 3O3GA 4FJIA 4AH9A 4KTWA 1LWFA 2Z1HA 2OZMA 1BHLA 1L3VA 4N41A 3QEIA 3G10A 5SZTA 4FJ7A 2RKIA 2YNFA 2I5JA 3CG7A 3TANA 5C24A 3RR7A 2YKMA 1B9DA 2YNHA 3AO2A 3OYLA 4CESA 1X9SA 4ELTA 1VSMA 5SWMA 1JKHA 4CE9A 5EU7A 5KRTA 2G8WA 3IAYA 3ZT3A 4RW8A 1I3AA 4FLXA 1N6QA 2PYLA 4YFUA 4FLZA 4ELUA 4OLAA 3UIQA 1C1BA 3K5LA 2DY4A 1RDBA 4UQGA 1D8YA 3CM5A 2EX3A 2P51A 4GVMA 4FVMA 4DFPA 3KD1E 3SQ1A 4FJNA 2YV0X 4FZYA 4C8MA 4JS4A 4CGIA 4DSIA 1C0MA 3OYHA 1EKEA 2E4LA 4CJFA 4IFYA 1EP4A 4E89A 3NGIA 4FM0A 3B6OA 3SJJA 1R0AA 4KB1A 3CYMA 3P83D 5FRNA 4FK2A 1UA1A 3MEGA 3OS1A 1EETA 3EY1A 3PUFA 1BIZA 4FLWA 3SZ2A 3SQ4A 1KLNA 1ASWA 4E1MA 4LH4A 4TSXA 3KLFA 1RDDA 3ZSZA 1NK9A 1XWLA 2DFFA 3AVGA 3MAQA 1BL3A 2HVHA 4PWDA 1HYVA 3L2WA 4LSNA 3AVMA 1JLAA 3IG1A 3ZSOA 4N5SA 3K2PA 4FCYA 2FBTA 4BDZA 3M8QA 4FJJA 1HQEA 1RTHA 2ATQA 4CJSA 4DLGA 4DFJA 4ZTJA 3RR8A 4C8OA 4FK0A 4KI4A 4CEZA 3KLEA 1ASVA 1RNHA 4CGGA 1RILA 2JGUA 3L3VA 4DTJA 5HLFA 4C8KA 2P5GA 4W5NA 1B9FA 3I0RA 4CK1A 5HRRA 4DTSA 1REVA 2ZE2A 4B9UA 3DYAA 2E6MA 4ICLA 3DM2A 1VSKA 2BANA 3L2RA 1RT5A 1F21A 4CF0A 4LD0A 3AA5X 2A1RA 4DSFA 3DLBA 4RG8A 4CK3A 4M3RA 4DFMA 4IFVA 4I2PA 4CGHA 3VQ4A 4QAGA 3NF9A 1HYSA 2E6LA 2B4JA 3VQ5A 1LW0A 1C0UA 5FRMA 3DLRA 4B3OA 2YNIA 4IG3A 4QCLA 1C0TA 1QTMA 4W5TA 1QS4A 2XO7A 4CHYA 2FC0A 5HRSA 3HP6A 2F8TA 1NJXA 1EXQA 4R5PA 4H4MA 4Z4FA 1ASUA 3IRXA 2B6AA 4EP4A 4CJRA 3NDKA 2QK9A 5JS1A 2Z1IA 4CIEA 1EX4A 3KLHA 1RBVA 1NKBA 4DQPA 1VSDA 3ZSYA 3AVBA 4CFBA 1TK0A 3TAQA 1YVUA 2Z1JA 4FZXC 2GUIA 3PX6A 1KSPA 4J2AA 4HVJA 2KZZA 3U6FA 4E0DA 1TKDA 1G15A 3SCXA 3MXMA 3NH1A 3OYNA 3HM9A 3S3MA 5KTQA 3NH2A 1SV5A 3QEXA 4I7FA 3K5NA 3KK3A 1U45A 3L2QA 3DLHA 4F3TA 3U3YA 4N47A 1YT3A 3VQ8A 2OZSA 3MECA 3KKSA 5KI6A 4CERA 1S1VA 1K6YA 3VA0A 1C1CA 4DTRA 1ITGA 3WNHA 3O4QA 1T8EA 1RT3A 3KLIA 3IS9A 3OYAA 1TL1A 3CFPA 3PX0A 1FKPA 1QSLA 1T7PA 3ZSRA 1IKWA 1TL3A 2HB5A 4FLTA 3NBPA 5J2QA 2XY7A 1NK7A 3CFOA 4ID1A 4Z4CA 4JRPA 3V1RA 4CEDA 4CF9A 3O3HA 1U49A 4CEEA 3SPYA 3OYJA 1CXUA 1JL1A 3HP9A 1W9HA 2A1SA 3ZSWA 3QO9A 4CIFA 4DLEA 3VQ7A 3AV9A 3WNEA 4DS4A 3OS0A 3OYMA 4DS5A 1CXQA 1S9GA 1KVAA 3LALA 4HCBA 4H4OA 1SUQA 4OKKA 2ITGA 2X78A 2WONA 4M3XA 1KLMA 2OPRA 3NHGA 1WSGA 4BWJA 4BE1A 4RW9A 3HXMA 4IDKA 4Z0UA 1SKRA 3RRGA 3LPUA 3F73A 5I3UA 2R7YA 4Z4EA 1D9DA 4CCHA 1S1UA 1CZ9A 1RBUA 5J2NA 1YTUA 3KK2A 1NK0A 2IC3A 1UWBA 3NF7A 4AHVA 3LWMA 2G8HA 4NCBA 1BCMA 3AO1A 4KAZA 1HNIA 1J54A 4FJMA 1RCHA 2QKKA 1ZBFA 3D0PA 3TR8A 3MEEA 3TARA 2RPIA 3NH0A 3QIPA 1S1WA 1FKOA 3LP2A 4FJ5A 4J2BA 3HYFA 2XRIA 4FLUA 3HO1A 3EZ5A 4RW7A 4CGFA 3PO5A 1JLBA 4B8CA 4OGCA 3LZJA 3AVAA 5CY4A 1RT1A 1VSIA 2VG7A 4B8AB 4DF4A 1GOAA 4CEQA 1J5OA 3VQ9A 1WSFA 3ASMA 3VQQA 1YTAA 2VG6A 4KI6A 4L8RB 1WAFA 3E01A 2X6SA 4GW6A 2KFNA 3SQ2A 3NFAA 1RBTA 2Q3SA 4CHPA 2RN2A 2KZMA 2XY8A 5KRSA 3AO4A 4N76A 3QNNA 4CHZA 3DOLA 1RBSA 1UAXA 1Z25A 5D3GA 2QXFA 1BCOA 4AHUA 4CFAA 3NF8A 1U48A 4HUFA 2HHTA 4FLYA 1VSFA 3DMJA 3T19A 2W42A 4M3ZA 3NCIA 2PZSA 1QQCA 1L3TA 3KJVA 4M42A 4FJXA 2VG5A 1XHXA 2Z1GA 4I9QA 4CF1A 2Y1JA 5CZ1A 4DQRA 1QE1A 4CJ3A 5CZ2A 4CK2A 1HJRA 3AVKA 4DTXA 1TV6A 4FXDA 2DTUA 1S1XA 4O5BA 4M41A 1NOYA 3A2FA 4YNQA 1JL2A 1O1WA 3OYCA 1IKXA 3OJSA 4F8RA 2BGGA 2HHXA 2FBYA 1TAQA 3V9ZA 3V81A 3C6TA 3RMDA 3ZT2A 3FFIA 2HMIA 4AHSA 3RWUA 2HHWA 2ETJA 4CHOA 4E19A 3BDPA 4CJ4A 5HRNA 4FJ9A 3JYTA 4KKOA 1DTTA 1Q8IA 4DSEA 5CYMA 1KFDA 3NGZA 4CJWA 3RMCA 3TAFA 1KRPA 4KHWA 2G8IA 1BQMA 1RT7A 4CJLA 3LAKA 4DMNA 3DRPA 3NAEA 4KTQA 4AHTA 3S9HA 2GV9A 4RW4A 4EP5A 3THVA 1X9MA 3I0SA 1I39A 1NK4A 1RTJA 2KTQA 1WSJA 1NOZA 1S5JA 1C1AA 1HYZA 3U3GA 3QEVA 3DRSA 3NF6A 1UOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M45 A;  3JSM A;  1B92 A;  4ID5 A;  1NJY A;  4KRF A;  1IKY A;  1A5V A;  4W5R A;  3SUP A;  1TK5 A;  1UA0 A;  3VQP A;  1WSE A;  3VQD A;  3HST B;  1BI4 A;  4KHS A;  3AVI A;  1LAV A;  4JRQ A;  1RT4 A;  4O55 A;  3LWL A;  2KW4 A;  3DLE A;  4CF8 A;  3RTV A;  1KTQ A;  3VA3 A;  4NCG A;  4KHU A;  4FJK A;  4CFD A;  4DU4 A;  4C8L A;  4Z4G A;  2VWJ A;  3LP3 A;  2B5J A;  1NK5 A;  1WLJ A;  3KKR A;  1LV5 A;  1LAW A;  1L3U A;  3SNN A;  1NKE A;  3SPZ A;  4BE2 A;  3SYZ A;  2D0B A;  4NYN A;  5J2P A;  3TAM A;  2HNZ A;  4Z4H A;  1SKS A;  4EZ9 A;  3B6P A;  2X6N A;  3AVC A;  1TVR A;  1VK0 A;  4PA1 A;  2D5R A;  1S1T A;  1WSI A;  4W5O A;  3RMB A;  4FJG A;  4CEC A;  4CF2 A;  4QOZ B;  2Y1I A;  3V4I A;  3TAG A;  4HCC A;  4J2D A;  2ZD1 A;  3MED A;  4DQQ A;  4Q0B A;  3SUQ A;  1XI1 A;  4CJP A;  3ZT4 A;  1JLF A;  4F4K A;  4B9T A;  2P1J A;  3QES A;  3TAE A;  2G8U A;  4CEF A;  2PY5 A;  3DI6 A;  3QEP A;  3AVH A;  1BGX T;  3LP0 A;  3QET A;  3S3O A;  4B9V A;  4PY5 A;  3S3N A;  5JS2 A;  1JLQ A;  3V1Q A;  1HPZ A;  1VSE A;  3VN5 A;  3WNF A;  3SV4 A;  1RTI A;  3KLG A;  4DQI A;  4M3W A;  1WSH A;  5T7B A;  3C95 A;  3OYF A;  4DTP A;  3KK1 A;  1VSH A;  1RDC A;  2P5O A;  4G1Q A;  4O4G A;  3OYE A;  2OYQ A;  4FK4 A;  4BE0 A;  2WOM A;  4FJH A;  2IAJ A;  4MFB A;  1U47 A;  4DTN A;  4FW2 A;  1Q9Y A;  4DSK A;  5E41 A;  4M3T A;  2HHV A;  4M3Y A;  1JLG A;  1LWC A;  5J1E A;  3L8B A;  2BDP A;  4ELV A;  3K59 A;  3EYZ A;  4E7L A;  2IOC A;  4E7J A;  3SQ0 A;  4CHQ A;  4DTO A;  4C8N A;  3QIO A;  3LZI A;  2OPP A;  3SI6 A;  3PX4 A;  4KB0 A;  4F3O A;  4M3U A;  4OKJ A;  3O3F A;  1A5X A;  4OVL A;  4IG0 A;  4DG1 A;  4E7I A;  3SUN A;  3BGR A;  4I9L A;  1SL2 A;  1GOB A;  4JLH A;  1DLO A;  4B9M A;  3QIN A;  4CJ5 A;  1QHT A;  4CJQ A;  1RT2 A;  3HVT A;  4CEB A;  3TAB A;  3RMA A;  3DLK A;  1RBR A;  4FJ8 A;  4CJU A;  3V9X A;  4DU1 A;  2X74 A;  3CFR A;  1CZB A;  4DF8 A;  3HL8 A;  4K8X A;  1QSY A;  1X1P A;  3CM6 A;  1TKZ A;  1XC9 A;  3LP1 A;  2XHB A;  4CFC A;  3T3F A;  4H8K A;  4OPJ A;  4B9L A;  4BDY A;  4AIL C;  3VQB A;  2YNG A;  2OPQ A;  3QEW A;  1JXB A;  3K57 A;  4JS5 A;  5J2M A;  2OA8 A;  1LW2 A;  3AO5 A;  2IGI A;  1S9E A;  4KV8 A;  4LSL A;  5C25 A;  4LH5 A;  4OPK A;  3V6D A;  1J9A A;  3AA3 A;  3VQE A;  3OYB A;  1Q9X A;  3ZCM A;  4KTZ A;  4BDP A;  4FYD A;  4HUE A;  3ALY A;  3WNG A;  1ZBH A;  2GBZ A;  3HK2 A;  1RDA A;  4Y1C A;  5CYQ A;  3ZSQ A;  3K58 A;  3VQ6 A;  2BE2 A;  4PUO A;  3AA2 A;  3TI0 A;  1FK9 A;  3C6U A;  4CIG A;  4J2E A;  2G8V A;  3NGY A;  1WNS A;  3OY9 A;  3DRR A;  3ULD A;  1CLQ A;  1TKX A;  4CEO A;  5KGX A;  4FM2 A;  5DMR A;  1ZBU A;  2JLE A;  1FXX A;  4WE1 A;  4CJK A;  1NJZ A;  2IDO A;  1J53 A;  2NUB A;  1JLC A;  2DFE A;  4E7K A;  4DTU A;  3D45 A;  3LAM A;  3P5J A;  4B9S A;  4GMJ B;  3HPO A;  5C42 A;  3M8S A;  1T05 A;  4OLB A;  4DU3 A;  1QSS A;  2HVI A;  1GOC A;  3L2U A;  1MU2 A;  4E7H A;  2F96 A;  2HW3 A;  3K5O A;  4F2R A;  1TK8 A;  2HNY A;  3OYG A;  2HHS A;  4O0J A;  4K8Z A;  1TKT A;  4DFK A;  2XY5 A;  5K14 A;  3DOK A;  4DTM A;  1KFS A;  4FW1 A;  1TAU A;  2PYJ A;  3H08 A;  3P1G A;  4B9N A;  1HMV A;  3ZT0 A;  1XHZ A;  2QKB A;  5HBM A;  4CEA A;  3QNO A;  4IKF A;  3VQC A;  3OYI A;  3KD5 E;  3AVJ A;  1ZBI A;  4KRE A;  1BIU A;  3MXJ A;  3V9W A;  4KFB A;  3ZSV A;  3OJU A;  2AJQ A;  1HQU A;  1SL0 A;  3AO3 A;  4CJT A;  1IH7 A;  4BWM A;  2OPS A;  1L5U A;  3PY8 A;  4Z4I A;  4BAC A;  3TWH A;  4CGD A;  3KTQ A;  3PO4 A;  4KO0 A;  1D5A A;  5FDL A;  3OYD A;  2O4I A;  4EZ6 A;  1U4B A;  2IS3 A;  1KVC A;  5DK5 A;  2VWK A;  3HPH A;  4OKE A;  5HRP A;  4CJV A;  3OYK A;  1NJW A;  2YHB A;  4Q5V A;  3PV8 A;  4FM1 A;  2LSN A;  3TAP A;  3V1O A;  3T1A A;  2G8F A;  2HND A;  1X9W A;  3LDS A;  1IKV A;  1LWE A;  3KIO A;  3OVN A;  1VSJ A;  2YHA A;  1JLE A;  3AA4 A;  4HUG A;  4O44 A;  3RRH A;  3QER A;  4IBN A;  2F8S A;  3ITH A;  1A5W A;  1W0H A;  5KGW A;  2KQ2 A;  3DLG A;  3LAN A;  1NK6 A;  4DSL A;  4NYF A;  1TGO A;  2FBV A;  1KCF A;  2EHG A;  5HRO A;  2KFZ A;  1WAJ A;  3AVL A;  3OS2 A;  1N5Y A;  3M8R A;  4PQU A;  3F9K A;  3L3U A;  2XY6 A;  1VSL A;  1RT6 A;  1U04 A;  3SUO A;  1SKW A;  3HPG A;  3HT3 A;  5FRO A;  4KHY A;  2HHU A;  1BIS A;  1VRU A;  4KHQ A;  5I42 A;  1ZYQ A;  1NK8 A;  2HHQ A;  3ZT1 A;  3ZSX A;  4O0I A;  3G0Z A;  1DTQ A;  4E3S A;  4NCA A;  1S6Q A;  2FBX A;  4CGJ A;  4KPY A;  3I8D A;  3V9S A;  4MQ3 A;  1T03 A;  4W5Q A;  4E1N A;  1IO2 A;  4KHN A;  3MXI A;  2YKN A;  1IG9 A;  1BQN A;  4DSJ A;  4ZTF A;  2DFH A;  3M8P A;  4XIU A;  3CQ8 A;  3K5M A;  1SL1 A;  4HHT A;  2D0A A;  4RW6 A;  1BI4 B;  3VQA A;  3V9U A;  2G8K A;  4DWI A;  3HJF A;  3AVF A;  3QLH A;  4F2S A;  2RF2 A;  4ZHR A;  1JXE A;  4N56 A;  4DQS A;  1VRT A;  3AVN A;  1Y97 A;  4CHN A;  1Z26 A;  4OGE A;  3HVR A;  3O4N A;  1RTD A;  3NE6 A;  1D9F A;  1ZBL A;  2ZQB A;  1S6P A;  1C6V A;  3ISN C;  3L2V A;  3SV3 A;  1NKC A;  1L3S A;  4I2Q A;  2O4G A;  1HNV A;  4HTU A;  4LY7 A;  2D0C A;  4AHR A;  3C94 A;  4CJE A;  3LPT A;  4B08 A;  4Y1D A;  4OJR A;  1HRH A;  4FLV A;  1KVB A;  4FZZ A;  4AHC A;  5HP1 A;  4FJL A;  1WN7 A;  3O3G A;  4FJI A;  4AH9 A;  4KTW A;  1LWF A;  2Z1H A;  2OZM A;  1BHL A;  1L3V A;  4N41 A;  3QEI A;  3G10 A;  5SZT A;  4FJ7 A;  2RKI A;  2YNF A;  2I5J A;  3CG7 A;  3TAN A;  5C24 A;  3RR7 A;  2YKM A;  1B9D A;  2YNH A;  3AO2 A;  3OYL A;  4CES A;  1X9S A;  4ELT A;  1VSM A;  5SWM A;  1JKH A;  4CE9 A;  5EU7 A;  5KRT A;  2G8W A;  3IAY A;  3ZT3 A;  4RW8 A;  1I3A A;  4FLX A;  1N6Q A;  2PYL A;  4YFU A;  4FLZ A;  4ELU A;  4OLA A;  3UIQ A;  1C1B A;  3K5L A;  2DY4 A;  1RDB A;  4UQG A;  1D8Y A;  3CM5 A;  2EX3 A;  2P51 A;  4GVM A;  4FVM A;  4DFP A;  3KD1 E;  3SQ1 A;  4FJN A;  2YV0 X;  4FZY A;  4C8M A;  4JS4 A;  4CGI A;  4DSI A;  1C0M A;  3OYH A;  1EKE A;  2E4L A;  4CJF A;  4IFY A;  1EP4 A;  4E89 A;  3NGI A;  4FM0 A;  3B6O A;  3SJJ A;  1R0A A;  4KB1 A;  3CYM A;  3P83 D;  5FRN A;  4FK2 A;  1UA1 A;  3MEG A;  3OS1 A;  1EET A;  3EY1 A;  3PUF A;  1BIZ A;  4FLW A;  3SZ2 A;  3SQ4 A;  1KLN A;  1ASW A;  4E1M A;  4LH4 A;  4TSX A;  3KLF A;  1RDD A;  3ZSZ A;  1NK9 A;  1XWL A;  2DFF A;  3AVG A;  3MAQ A;  1BL3 A;  2HVH A;  4PWD A;  1HYV A;  3L2W A;  4LSN A;  3AVM A;  1JLA A;  3IG1 A;  3ZSO A;  4N5S A;  3K2P A;  4FCY A;  2FBT A;  4BDZ A;  3M8Q A;  4FJJ A;  1HQE A;  1RTH A;  2ATQ A;  4CJS A;  4DLG A;  4DFJ A;  4ZTJ A;  3RR8 A;  4C8O A;  4FK0 A;  4KI4 A;  4CEZ A;  3KLE A;  1ASV A;  1RNH A;  4CGG A;  1RIL A;  2JGU A;  3L3V A;  4DTJ A;  5HLF A;  4C8K A;  2P5G A;  4W5N A;  1B9F A;  3I0R A;  4CK1 A;  5HRR A;  4DTS A;  1REV A;  2ZE2 A;  4B9U A;  3DYA A;  2E6M A;  4ICL A;  3DM2 A;  1VSK A;  2BAN A;  3L2R A;  1RT5 A;  1F21 A;  4CF0 A;  4LD0 A;  3AA5 X;  2A1R A;  4DSF A;  3DLB A;  4RG8 A;  4CK3 A;  4M3R A;  4DFM A;  4IFV A;  4I2P A;  4CGH A;  3VQ4 A;  4QAG A;  3NF9 A;  1HYS A;  2E6L A;  2B4J A;  3VQ5 A;  1LW0 A;  1C0U A;  5FRM A;  3DLR A;  4B3O A;  2YNI A;  4IG3 A;  4QCL A;  1C0T A;  1QTM A;  4W5T A;  1QS4 A;  2XO7 A;  4CHY A;  2FC0 A;  5HRS A;  3HP6 A;  2F8T A;  1NJX A;  1EXQ A;  4R5P A;  4H4M A;  4Z4F A;  1ASU A;  3IRX A;  2B6A A;  4EP4 A;  4CJR A;  3NDK A;  2QK9 A;  5JS1 A;  2Z1I A;  4CIE A;  1EX4 A;  3KLH A;  1RBV A;  1NKB A;  4DQP A;  1VSD A;  3ZSY A;  3AVB A;  4CFB A;  1TK0 A;  3TAQ A;  1YVU A;  2Z1J A;  4FZX C;  2GUI A;  3PX6 A;  1KSP A;  4J2A A;  4HVJ A;  2KZZ A;  3U6F A;  4E0D A;  1TKD A;  1G15 A;  3SCX A;  3MXM A;  3NH1 A;  3OYN A;  3HM9 A;  3S3M A;  5KTQ A;  3NH2 A;  1SV5 A;  3QEX A;  4I7F A;  3K5N A;  3KK3 A;  1U45 A;  3L2Q A;  3DLH A;  4F3T A;  3U3Y A;  4N47 A;  1YT3 A;  3VQ8 A;  2OZS A;  3MEC A;  3KKS A;  5KI6 A;  4CER A;  1S1V A;  1K6Y A;  3VA0 A;  1C1C A;  4DTR A;  1ITG A;  3WNH A;  3O4Q A;  1T8E A;  1RT3 A;  3KLI A;  3IS9 A;  3OYA A;  1TL1 A;  3CFP A;  3PX0 A;  1FKP A;  1QSL A;  1T7P A;  3ZSR A;  1IKW A;  1TL3 A;  2HB5 A;  4FLT A;  3NBP A;  5J2Q A;  2XY7 A;  1NK7 A;  3CFO A;  4ID1 A;  4Z4C A;  4JRP A;  3V1R A;  4CED A;  4CF9 A;  3O3H A;  1U49 A;  4CEE A;  3SPY A;  3OYJ A;  1CXU A;  1JL1 A;  3HP9 A;  1W9H A;  2A1S A;  3ZSW A;  3QO9 A;  4CIF A;  4DLE A;  3VQ7 A;  3AV9 A;  3WNE A;  4DS4 A;  3OS0 A;  3OYM A;  4DS5 A;  1CXQ A;  1S9G A;  1KVA A;  3LAL A;  4HCB A;  4H4O A;  1SUQ A;  4OKK A;  2ITG A;  2X78 A;  2WON A;  4M3X A;  1KLM A;  2OPR A;  3NHG A;  1WSG A;  4BWJ A;  4BE1 A;  4RW9 A;  3HXM A;  4IDK A;  4Z0U A;  1SKR A;  3RRG A;  3LPU A;  3F73 A;  5I3U A;  2R7Y A;  4Z4E A;  1D9D A;  4CCH A;  1S1U A;  1CZ9 A;  1RBU A;  5J2N A;  1YTU A;  3KK2 A;  1NK0 A;  2IC3 A;  1UWB A;  3NF7 A;  4AHV A;  3LWM A;  2G8H A;  4NCB A;  1BCM A;  3AO1 A;  4KAZ A;  1HNI A;  1J54 A;  4FJM A;  1RCH A;  2QKK A;  1ZBF A;  3D0P A;  3TR8 A;  3MEE A;  3TAR A;  2RPI A;  3NH0 A;  3QIP A;  1S1W A;  1FKO A;  3LP2 A;  4FJ5 A;  4J2B A;  3HYF A;  2XRI A;  4FLU A;  3HO1 A;  3EZ5 A;  4RW7 A;  4CGF A;  3PO5 A;  1JLB A;  4B8C A;  4OGC A;  3LZJ A;  3AVA A;  5CY4 A;  1RT1 A;  1VSI A;  2VG7 A;  4B8A B;  4DF4 A;  1GOA A;  4CEQ A;  1J5O A;  3VQ9 A;  1WSF A;  3ASM A;  3VQQ A;  1YTA A;  2VG6 A;  4KI6 A;  4L8R B;  1WAF A;  3E01 A;  2X6S A;  4GW6 A;  2KFN A;  3SQ2 A;  3NFA A;  1RBT A;  2Q3S A;  4CHP A;  2RN2 A;  2KZM A;  2XY8 A;  5KRS A;  3AO4 A;  4N76 A;  3QNN A;  4CHZ A;  3DOL A;  1RBS A;  1UAX A;  1Z25 A;  5D3G A;  2QXF A;  1BCO A;  4AHU A;  4CFA A;  3NF8 A;  1U48 A;  4HUF A;  2HHT A;  4FLY A;  1VSF A;  3DMJ A;  3T19 A;  2W42 A;  4M3Z A;  3NCI A;  2PZS A;  1QQC A;  1L3T A;  3KJV A;  4M42 A;  4FJX A;  2VG5 A;  1XHX A;  2Z1G A;  4I9Q A;  4CF1 A;  2Y1J A;  5CZ1 A;  4DQR A;  1QE1 A;  4CJ3 A;  5CZ2 A;  4CK2 A;  1HJR A;  3AVK A;  4DTX A;  1TV6 A;  4FXD A;  2DTU A;  1S1X A;  4O5B A;  4M41 A;  1NOY A;  3A2F A;  4YNQ A;  1JL2 A;  1O1W A;  3OYC A;  1IKX A;  3OJS A;  4F8R A;  2BGG A;  2HHX A;  2FBY A;  1TAQ A;  3V9Z A;  3V81 A;  3C6T A;  3RMD A;  3ZT2 A;  3FFI A;  2HMI A;  4AHS A;  3RWU A;  2HHW A;  2ETJ A;  4CHO A;  4E19 A;  3BDP A;  4CJ4 A;  5HRN A;  4FJ9 A;  3JYT A;  4KKO A;  1DTT A;  1Q8I A;  4DSE A;  5CYM A;  1KFD A;  3NGZ A;  4CJW A;  3RMC A;  3TAF A;  1KRP A;  4KHW A;  2G8I A;  1BQM A;  1RT7 A;  4CJL A;  3LAK A;  4DMN A;  3DRP A;  3NAE A;  4KTQ A;  4AHT A;  3S9H A;  2GV9 A;  4RW4 A;  4EP5 A;  3THV A;  1X9M A;  3I0S A;  1I39 A;  1NK4 A;  1RTJ A;  2KTQ A;  1WSJ A;  1NOZ A;  1S5J A;  1C1A A;  1HYZ A;  3U3G A;  3QEV A;  3DRS A;  3NF6 A;  1UOC A; 
#chains in the Genus database with same CATH topology
 1B92 A;  3MX2 A;  1TK5 A;  3K9J A;  4CBX A;  3O80 A;  1WSE A;  3MN9 A;  3VQD A;  3QB0 A;  1E4G T;  1VQO N;  1BI4 A;  3AVI A;  4JRQ A;  4O55 A;  3DLE A;  4DCH A;  4DUZ K;  2HBM A;  3P31 A;  3WXJ A;  2O8C B;  3LP3 A;  4BR5 A;  3P4I A;  2B5J A;  2P9U A;  1NGA A;  4FPB A;  3SNN A;  1ZBS A;  1NKE A;  4BE2 A;  1S22 A;  4JKC A;  2HNZ A;  4Z4H A;  1SKS A;  4EZ9 A;  2X6N A;  1TVR A;  4PA1 A;  3LL3 A;  5AQY A;  2D5R A;  1WB9 A;  2OTJ N;  3ATV A;  3TAG A;  4H0V B;  4DQQ A;  3QML A;  3KWG A;  3BEX A;  5GAH P;  1JLF A;  4F4K A;  4B9T A;  3NVK A;  2P1J A;  3MCP A;  3R3L A;  2PY5 A;  1TUY A;  3DI6 A;  3LP0 A;  3S3O A;  4B9V A;  1JLQ A;  4B3R K;  1RTI A;  3KLG A;  4DQI A;  2HST A;  5T7B A;  4IJN A;  3KK1 A;  4K25 A;  4FK4 A;  4FJH A;  2FSN A;  3PIP L;  4FW2 A;  4DTN A;  4M3T A;  4M3Y A;  3MCA B;  3H45 C;  3PSF A;  1E4F T;  3CQY A;  4IOC L;  3THX A;  1GLF O;  3SI6 A;  1A5X A;  4OVL A;  2NRH A;  4IG0 A;  4BVP A;  3SUN A;  3BGR A;  3IUC A;  4I9L A;  3G4S N;  1GOB A;  4K43 A;  4CJQ A;  3TAB A;  5AQH A;  2JWL A;  3LDP A;  4CJU A;  3V9X A;  2X74 A;  3DXK A;  2H3G X;  1TKZ A;  3LP1 A;  4H8K A;  4OPJ A;  2NNW A;  3KHY A;  4B9L A;  4NB4 A;  2YNG A;  1JXB A;  3K57 A;  4B3S K;  4MLH A;  3QFU A;  3V6D A;  4LH5 A;  3VQE A;  3OYB A;  4BDP A;  3ALY A;  1VQ4 N;  3J81 O;  1HKC A;  2UXB K;  3OBW A;  5BRF A;  4PUO A;  1XNQ K;  5AQF A;  4BRG A;  2UU9 K;  5M1P A;  5DMR A;  2IDO A;  2VGN A;  1HUX A;  4AQY K;  4GNI A;  1JLC A;  3D6R A;  3D45 A;  4LF6 K;  3LAM A;  4B9S A;  4GMJ B;  3M8S A;  4OLB A;  3L0Q A;  4DU3 A;  4Y0W A;  1MU2 A;  2F96 A;  3DXK B;  1C0G A;  5ELZ A;  4B9N A;  5HBM A;  4CEA A;  4IKF A;  1NWK A;  4CI6 A;  3OYI A;  3KD5 E;  4KRE A;  1BIU A;  3CHW A;  3KVG A;  5BR9 A;  4KFB A;  1HQU A;  4CVN E;  4BWM A;  4Z4I A;  3TWH A;  3KTQ A;  3H3O B;  3OYD A;  5GIO A;  1N34 K;  5HRP A;  1SS6 A;  1MWK A;  3TAP A;  3T1A A;  3SJH A;  4IOA L;  5C10 A;  1JCF A;  3EKU A;  1LWE A;  5H1S Q;  1VSJ A;  5TKY A;  3PIO L;  4IBN A;  4YOW A;  3ITH A;  1W0H A;  2QXL A;  2QA4 N;  2V7Z A;  1W7A A;  2FBV A;  4A59 A;  3O9T A;  1WAJ A;  1LCU A;  2XY6 A;  3ULE A;  4YOU A;  1RT6 A;  1SKW A;  3HPG A;  1IG8 A;  3HT3 A;  1BIS A;  1YAG A;  3ZYY X;  1NK8 A;  3IMX A;  3ZSX A;  3C6H A;  1J6Z A;  4AM7 A;  1IO2 A;  4E1N A;  1HKB A;  3MXI A;  2YKN A;  4DSJ A;  1BQN A;  3GDQ A;  4JK9 A;  3K5M A;  4HHT A;  2Q97 A;  5AQM A;  3VQA A;  4X64 K;  4DWI A;  3AVF A;  3QLH A;  2OAN A;  4WFB L;  4YOX A;  1IV0 A;  2EWS A;  4CHN A;  1RTD A;  2I7N A;  1D9F A;  3JXU A;  4FWP A;  2O4G A;  1QQM A;  4NLB A;  4HTU A;  4AHR A;  3KK7 A;  5AQW A;  1ATS A;  3FLC O;  1WN7 A;  3O3G A;  4FJI A;  2P9P A;  3ULE B;  3O1W A;  4NLC A;  4N41 A;  1BHL A;  4JI6 K;  3G10 A;  2RKI A;  2I5J A;  4KHP K;  4ISF A;  3NMU A;  3JAM O;  4EHU A;  1X9S A;  4A62 A;  1OH6 A;  4FLX A;  3ENH A;  4OLA A;  4EIA A;  2P51 A;  4GVM A;  4DFP A;  5DM6 L;  4IFY A;  3B6O A;  3P83 D;  5E84 A;  1EET A;  2E2P A;  3A8Y A;  3CCS N;  1BL3 A;  2HVH A;  1GLB G;  3VF4 A;  3AVM A;  4Z94 A;  4FCY A;  2UUC K;  1XUP O;  2P9P B;  1HQE A;  1HJO A;  4FK0 A;  2JGU A;  3E1Y A;  2P5G A;  4IEE A;  5HRR A;  1NGB A;  5AR0 A;  4O5F A;  3VTH A;  3NVM A;  1VSK A;  3CCL N;  3J7A P;  3H1Q A;  4H5R A;  4XH1 A;  4M3R A;  4DFM A;  4IFV A;  4I2P A;  3LDN A;  3UKU B;  3F2K A;  2B4J A;  3VQ5 A;  1RDU A;  5FRM A;  3OBY A;  4PHT X;  1QS4 A;  4CHY A;  1U2V A;  4BY9 C;  2F8T A;  3O9U A;  4H4M A;  1ASU A;  2B6A A;  5JS1 A;  4B3T K;  4DQP A;  2QWL A;  4CFB A;  1TK0 A;  3WXI A;  2Z1J A;  3CCM N;  4JI8 K;  2IVP A;  4I7F A;  4F3T A;  3L2Q A;  3DLH A;  3U3Y A;  3VQ8 A;  2OZS A;  3LM2 A;  1S1V A;  4X62 K;  3QBX A;  3IS9 A;  2FF6 A;  1FKP A;  1QSL A;  1MA9 B;  1IKW A;  1TL3 A;  2QTD A;  2HHH K;  4Z4C A;  5MLC Q;  1XMO K;  4BRK A;  1CXU A;  1JL1 A;  2BUP A;  2A1S A;  3ZSW A;  4DS4 A;  3N4Q A;  3OYM A;  4DS5 A;  5FPM A;  1SUQ A;  4OKK A;  2OPR A;  5BPL A;  3IKM A;  4BE1 A;  4CZM A;  3AY9 A;  3RRG A;  4FWL A;  2A41 A;  3H1V X;  4LF9 K;  4Z4E A;  1YF5 L;  1CZ9 A;  5J2N A;  3THW B;  2O8B B;  5BPM A;  2IC3 A;  2G8H A;  5FPE A;  4B1Y B;  4FJM A;  2V51 B;  4JKF A;  2QKK A;  3D0P A;  4IWV A;  4CD1 A;  2YHY A;  5AQN A;  1S1W A;  3LP2 A;  4FJ5 A;  2XRI A;  3K0S A;  5AQT A;  3PO5 A;  2A40 A;  3LZJ A;  4B8A B;  3VGK A;  3A5L C;  2BTF A;  4BC5 A;  3C6A A;  3ZLJ A;  3FZK A;  4DV0 K;  4A5A A;  1SZ2 A;  3CCE N;  4BC3 A;  2XY8 A;  4N76 A;  3O9S A;  4CHZ A;  1VQP N;  4AHU A;  2KKZ A;  1U48 A;  2NRT A;  3VOV A;  3DMJ A;  1G99 A;  3T19 A;  3L4I A;  3DAW A;  1QQC A;  3E9L A;  4M42 A;  4KBO A;  2VG5 A;  1XHX A;  4DQR A;  1WBD A;  1QE1 A;  2Q0U A;  4DTX A;  4JKG B;  4FXD A;  1S1X A;  3CER A;  2ZGY A;  4YNQ A;  3OJS A;  4KH5 A;  5KQD A;  4JKA A;  3UE5 A;  2HHX A;  1DGK N;  2HMI A;  4AHS A;  4NXN K;  2ETJ A;  3BDP A;  3JYT A;  4H0Y B;  4DSE A;  3NGZ A;  3QFP A;  3RMC A;  1HR0 K;  4BRQ A;  4CJL A;  4DMN A;  3CC2 N;  4QS7 A;  4JI5 K;  1N36 K;  4JK7 A;  4DV2 K;  1X9M A;  5A2Q O;  2Q31 A;  4DV3 K;  2YI1 A;  1NK4 A;  4LF8 K;  2YJF A;  1NOZ A;  2A42 A;  3KZB A;  3U3G A;  5F0X A;  4DLE A;  4M45 A;  3JSM A;  3UKR A;  1NJY A;  3ZEU A;  3HST B;  4CZK A;  4KHS A;  4M63 C;  1LAV A;  5AZI A;  3LWL A;  1KTQ A;  3MN5 A;  3O5B A;  4NCG A;  1QHA A;  5AQU A;  3T1Y K;  1NGF A;  4GV6 A;  2D0B A;  3TAM A;  1NGJ A;  4FJG A;  1KC8 O;  2Y1I A;  4J2D A;  4Q0B A;  3SUQ A;  4OX9 K;  3ZT4 A;  2YHX A;  3QES A;  4WQ5 C;  4JKD A;  1HPZ A;  1JJ2 M;  1VSE A;  3VN5 A;  3SV4 A;  5KPR A;  3O9R A;  3SMS A;  2VQE K;  3QBW A;  1RDC A;  4O4G A;  3MDQ A;  3ZEU B;  2IAJ A;  5KPZ A;  3FZF A;  1U47 A;  1Q9Y A;  5E41 A;  4FWQ A;  2HHV A;  5J1E A;  3L8B A;  2BDP A;  2UUB K;  2IOC A;  4E7J A;  3SQ0 A;  4CHQ A;  3LZI A;  4M3U A;  3PX4 A;  2F9T A;  3FR0 A;  4MO4 A;  4F3O A;  4KB0 A;  4JK8 A;  1BO5 O;  4HTL A;  3J80 O;  5M1Q A;  2P9K A;  4JI3 K;  1HNW K;  3PSI A;  4CZI A;  3QIN A;  1QHT A;  3RSE A;  4CEB A;  3RMA A;  4JI7 K;  3HRG A;  1RBR A;  4X66 K;  3CJB A;  4AIL C;  3TSP A;  3C7N A;  4FVU A;  3QEW A;  4JS5 A;  3UIQ A;  4KV8 A;  2IGI A;  5C25 A;  4H03 B;  1Q9X A;  4KTZ A;  3WNG A;  3CJA A;  1ZBH A;  5CYQ A;  3K58 A;  5BRH A;  3ZSQ A;  3P39 A;  1S72 N;  2UXC K;  2BE2 A;  3R1X A;  3TI0 A;  1FK9 A;  4BRF A;  4J2E A;  4B1V A;  2P9L A;  2IVN A;  3NGY A;  1WNS A;  3I55 N;  3DRR A;  1SAZ A;  3FFK B;  2P9I A;  3GBT A;  3HBT A;  1FXX A;  4CJK A;  4H0P A;  2NUB A;  3HOT A;  3D2E A;  3MMV A;  5GIP A;  2P9K B;  2FSK A;  2ITM A;  5EVZ A;  1T05 A;  1Q86 O;  2HVI A;  4JHD A;  3WXL A;  2NRV A;  1OH5 A;  2HW3 A;  3K5O A;  5EXW A;  4F2R A;  3K9K A;  2HHS A;  3SLC A;  4DFK A;  1KFS A;  5K14 A;  2CGK A;  3FZH A;  3H08 A;  4BRE A;  2QKB A;  5AQR A;  1KXP A;  1ZBI A;  4ILG B;  3MXJ A;  3OJU A;  1XQS C;  2CH6 A;  3AO3 A;  3ID6 A;  1IH7 A;  4CJT A;  2Q0R A;  5C12 A;  4CGD A;  3WUH A;  3PO4 A;  2UYT A;  4KO0 A;  3MWP A;  5FDL A;  4U67 L;  3T7Z A;  1U4B A;  2IS3 A;  1KVC A;  1YHQ N;  4CJV A;  3OYK A;  2YHB A;  3PV8 A;  2P9I B;  4FM1 A;  4LFA K;  3Q7B A;  1X9W A;  1IKV A;  4K0K K;  2Q1N A;  1JLE A;  1QVF M;  4O44 A;  3RRH A;  2F8S A;  5KGW A;  4DSL A;  3DLG A;  4F9O A;  4NYF A;  4B3M K;  2EHG A;  4DV1 K;  5GAG P;  1IJJ A;  5IWA K;  4CJ7 A;  1U04 A;  3SUO A;  5FRO A;  4KHY A;  2HBJ A;  1VRU A;  5I42 A;  2HHQ A;  3ZT1 A;  4L3Q A;  4O0I A;  4E3S A;  1S6Q A;  4KPY A;  2IVO A;  4MQ3 A;  1T03 A;  4A57 A;  4KHN A;  2HOE A;  4GV3 A;  4RWT A;  3WEE A;  3OW2 M;  4PKG A;  4ZTF A;  2DFH A;  4XIU A;  2WBN A;  5AQZ A;  1WUA A;  1KAX A;  1BI4 B;  3V9U A;  2G8K A;  4CZG A;  4DV6 K;  2RF2 A;  4ZHR A;  3AVN A;  1Q7Y O;  1X3N A;  3O4N A;  3HVR A;  1DKG D;  2ZQB A;  1NKC A;  2P9U B;  4I2Q A;  2NLX A;  1FJG K;  4LY7 A;  4YDU C;  4FLV A;  1HRH A;  2QWN A;  4IOX A;  2A3Z A;  5BR8 K;  4BC2 A;  5SZT A;  3I56 N;  4FJ7 A;  2YNF A;  3RVC A;  3BUZ B;  3CG7 A;  3TU5 A;  5C24 A;  1O13 A;  4IO9 L;  4ELT A;  3W0L A;  3ZX0 A;  5SWM A;  4MO5 A;  3WEE B;  5KRT A;  2G8W A;  3CCU N;  3ZT3 A;  4BQZ A;  5M1K A;  4FLZ A;  2CH5 A;  4MDA A;  3K5L A;  4BR4 A;  2EX3 A;  4FVM A;  4FJN A;  2HMP A;  2E4L A;  3THX B;  3SJJ A;  2E2O A;  5LJW A;  4KB1 A;  5FRN A;  3O6W A;  5GAE P;  3EY1 A;  3BF3 A;  1BIZ A;  3PUF A;  2D0O A;  3SZ2 A;  1BU6 O;  1ASW A;  1BA1 A;  4TSX A;  4E1M A;  1NK9 A;  3ZSZ A;  1T6D A;  3VEN A;  3MAQ A;  4WQ5 A;  1HYV A;  3L2W A;  4N5S A;  2QW9 A;  2FBT A;  4BDZ A;  4FJJ A;  4DFJ A;  1RTH A;  4DLG A;  4ZTJ A;  4C8O A;  4KI4 A;  4CEZ A;  4DTJ A;  2V52 B;  3L3V A;  5HOO A;  2NRR A;  1B9F A;  1GLE G;  3R6M A;  1REV A;  2JWK A;  1SQK A;  2E6M A;  3TSU A;  2FLO A;  3H3N O;  4YOT A;  3F9M A;  3UB5 A;  3DLB A;  3O08 A;  4RG8 A;  3L6Q A;  1LOT B;  2E5L K;  5F2R A;  2O8D A;  5E26 A;  2NZT A;  2E6L A;  5BN9 A;  1C0U A;  4B3O A;  4IG3 A;  1YVN A;  4BQL A;  3VMF B;  4WFA L;  4AF1 A;  4H5N A;  5LY3 A;  1EXQ A;  2QK9 A;  4CJR A;  2Z1I A;  1RBV A;  1GLL O;  3SBT A;  1KAZ A;  3HM8 A;  3VEV A;  3PX6 A;  2KZZ A;  2ASM A;  3NH1 A;  3S3M A;  4BR0 A;  1BDG A;  3QEX A;  4LFB K;  5BPN A;  1T6C A;  1T3V A;  3BZK A;  4A5B A;  2QI2 A;  3VA0 A;  1C1C A;  2VQF K;  1RT3 A;  1TL1 A;  5BN8 A;  3ZSR A;  5J2Q A;  3V1R A;  3R8E A;  4CF9 A;  3O3H A;  2YJE A;  1NBW A;  1W9H A;  3RMB A;  2O8F A;  1N33 K;  1CXQ A;  3H46 O;  3LAL A;  4HCB A;  5AQI A;  4H4O A;  2WON A;  1KLM A;  1IBM K;  1WSG A;  5LMN K;  1N32 K;  4IDK A;  3MWT A;  1D9D A;  1S1U A;  1RBU A;  5JVH L;  3KK2 A;  1NK0 A;  3NF7 A;  2D0P A;  3DXM A;  4GKJ K;  4MDB A;  4JAX A;  5M1N A;  1ZBF A;  2GX9 A;  2VYP A;  1EWQ A;  1QZ6 A;  4FLU A;  4V19 S;  3HO1 A;  1JLB A;  3MX5 A;  4DF4 A;  2VG7 A;  4CEQ A;  3VQ9 A;  3THY A;  1YTA A;  2VG6 A;  3E01 A;  3SQ2 A;  3NFA A;  3CC4 N;  4CHP A;  2F4V K;  2RN2 A;  4B1X B;  2KZM A;  5BRD A;  5KRS A;  5LJV A;  2O8F B;  1RBS A;  1UAX A;  1Z25 A;  2QXF A;  4O8K A;  2HHT A;  1VSF A;  2W42 A;  3CJ7 A;  5ADX A;  3NCI A;  4X65 K;  4FJX A;  3ZX2 A;  4I9Q A;  1TYQ A;  5CZ2 A;  2I7P A;  1HJR A;  1XC3 A;  3AVK A;  1TV6 A;  2DTU A;  3FE1 A;  4O5B A;  3AAQ A;  1NOY A;  4OPA A;  3A2F A;  1BUP A;  4FL9 A;  4BRI A;  2FBY A;  3C6T A;  3RMD A;  3ZT2 A;  1KD1 O;  1VQK N;  2HHW A;  1S3X A;  1P8Z A;  4BG8 A;  4E19 A;  4CJ4 A;  4FJ9 A;  5CYM A;  1KFD A;  1VQM N;  3OTO K;  2HF4 A;  4K42 A;  3THY B;  5FPN A;  3DRP A;  4KTQ A;  4AHT A;  3S9H A;  4QS8 A;  5HL7 L;  3THV A;  4YDU A;  1C0F A;  1WSJ A;  1YIJ N;  3L4Q A;  3QEV A;  2WFB A;  4M3X A;  1BG3 A;  5KPT A;  1UOC A;  4KRF A;  1HKG A;  4YOV A;  2WUS A;  4GVE A;  3G25 A;  3M6G A;  1TYQ B;  4CF8 A;  3CJC A;  4BR9 A;  2ZJQ L;  4DU4 A;  4C8L A;  4FWN A;  5AZJ A;  1NK5 A;  1V4T A;  1ESV A;  1LAW A;  3E9O A;  4CZJ A;  1L3U A;  3SPZ A;  4JI2 K;  3B6P A;  4W5O A;  2O8E A;  4QOZ B;  3V4I A;  1IBK K;  3MK6 A;  4BRP A;  1XI1 A;  2E20 A;  3N4P A;  4JKH A;  3TAE A;  4PY5 A;  3AVH A;  4DR4 K;  5TKW A;  3S3N A;  1U2V B;  3WNF A;  5AQJ A;  5AQO A;  5CE3 A;  1WSH A;  3LM9 A;  3OYF A;  4DTP A;  3WT0 A;  3LDO A;  3I8B A;  4G1Q A;  4DSK A;  1IBL K;  2AA4 A;  3SK3 A;  1JLG A;  1LWC A;  3CI5 A;  3K59 A;  4C23 A;  3EYZ A;  4ISG A;  4E7L A;  4C8N A;  3QIO A;  3LDQ A;  4E7I A;  3VPZ A;  4JLH A;  1DLO A;  5JLH A;  4WFN L;  1RT2 A;  3HVT A;  3VGM A;  4FJ8 A;  3FZL A;  5EX5 A;  5GAD P;  4DU1 A;  3CFR A;  4DF8 A;  4K8X A;  4E1J A;  4CFC A;  2O8E B;  3VES A;  3CXC M;  4EFH A;  4CZE A;  2OPQ A;  4CBU A;  1LW2 A;  1S9E A;  4LSL A;  1HNX K;  3ZCM A;  3AGK A;  4HUE A;  1RDA A;  4Y1C A;  3C0B A;  4KH4 A;  4IXC A;  3OY9 A;  3E66 A;  1CLQ A;  1TKX A;  4FM2 A;  1M1K O;  4FPA A;  3EE9 A;  4H5V A;  4M7X A;  2JLE A;  4WE1 A;  2GUP A;  4M7Y A;  4KH6 A;  4LFC K;  3PLA A;  1R59 O;  4DTU A;  2DFE A;  3HPO A;  5C42 A;  1QSS A;  1GOC A;  1TK8 A;  2ZM6 K;  2HNY A;  2NRW A;  4O0J A;  4K8Z A;  1TKT A;  2XY5 A;  4DTM A;  1FW6 A;  2PYJ A;  3P1G A;  1HMV A;  3ZT0 A;  2YX6 A;  2QM1 A;  4LF4 K;  1Y64 A;  4JYA K;  2VWB A;  1NG9 A;  1Q18 A;  1SL0 A;  3HSC A;  1YJW N;  1L5U A;  5I9E B;  1K8K A;  3CCQ N;  1D5A A;  1NGG A;  1GLD G;  4EZ6 A;  2ASP A;  3CQX A;  3U9D A;  2VWK A;  3HPH A;  2Q2R A;  4OKE A;  1NJW A;  2E1Z A;  4JI4 K;  3V1O A;  3O1B A;  2G8F A;  3U9Z A;  1M90 O;  2RE2 A;  3LDS A;  3J7Y P;  3OVN A;  1NGH A;  1VAZ A;  4HUG A;  3QER A;  3TSQ A;  1A5W A;  3LAN A;  1NK6 A;  1KCF A;  5HRO A;  2KFZ A;  3AVL A;  4H5T A;  3M8R A;  3F9K A;  3O4W A;  1W2B M;  4KHQ A;  2Q36 A;  1DTQ A;  4NCA A;  1MWM A;  2FBX A;  4CGJ A;  3SAH A;  3MN7 A;  1P90 A;  4DKW A;  3EE8 A;  2PFU A;  3UKR B;  1VHX A;  1CZA N;  3M8P A;  1K8K B;  5AQK A;  3VGL A;  4B1Z A;  1SL1 A;  4RW6 A;  3MN6 A;  3VER A;  5AZI B;  4WCE L;  1JXE A;  1VRT A;  1YJN N;  2ZJR L;  4OGE A;  2DPN A;  1ZBL A;  4FWS A;  1C6V A;  3ISN C;  1L3S A;  4JI0 K;  1VQ8 N;  4JNE A;  3EZW A;  4JN4 A;  5JMV A;  1HNV A;  3BY5 A;  4CJE A;  3P38 A;  4B08 A;  4OJR A;  1BOT O;  4FZZ A;  4AHC A;  2PBD A;  4FJL A;  4KTW A;  1LWF A;  2Z1H A;  1NM1 A;  3ZX3 A;  4FOI A;  3CF5 L;  3OA9 A;  3EO3 A;  3IDH A;  1HPM A;  2ZGZ A;  3RR7 A;  2CGJ A;  5AQV A;  4BVO A;  2YNH A;  4MLE A;  1X9J A;  1JKH A;  1NGE A;  1TUU A;  4CE9 A;  3T1H K;  1I94 K;  4GKK K;  1QQO A;  4YFU A;  1VQ7 N;  5AFU H;  1C1B A;  2OCE A;  2DY4 A;  1D8Y A;  2A6A A;  4C8M A;  4DV5 K;  4BRH A;  4CGI A;  3WXM B;  1EKE A;  4CJF A;  1EP4 A;  3NGI A;  4DV7 K;  1N8R O;  3VET A;  3MEG A;  3OS1 A;  1XMQ K;  4FOE A;  3RSE B;  2DFF A;  4PWD A;  4LSN A;  3ZSO A;  4H0X B;  2PAV A;  4B9Q A;  4BRA A;  4H5W A;  3M8Q A;  4CJS A;  3C7N B;  3KLE A;  3O8M A;  1ASV A;  1RNH A;  4CGG A;  4BRL A;  3I0R A;  2ZWH A;  3SMP A;  4CK1 A;  3CMA N;  4DTS A;  3VF6 A;  2YHW A;  2ZE2 A;  3DYA A;  1EO1 A;  4ICL A;  1OH8 A;  1VQ5 N;  5LMU K;  4LD0 A;  4CK3 A;  4ILJ A;  2P9L B;  4CGH A;  3VQ4 A;  4DR6 K;  4QAG A;  3NF9 A;  1HYS A;  1LW0 A;  2GEL A;  2YNI A;  4QCL A;  2J4R A;  4XEI A;  4W5T A;  4FWK A;  2FC0 A;  3D2E B;  4FWR A;  5HRS A;  1NGD A;  1NJX A;  4BGB A;  2E2N A;  4Z4F A;  5AQX A;  4JHD B;  3TTF A;  1NGI A;  1NKB A;  3KLH A;  3ZSY A;  3GL1 A;  1YVU A;  3E9P A;  3TPQ A;  1BA0 A;  5C0Y A;  1YIT N;  4FZX C;  2GUI A;  4DUY K;  4J2A A;  1JCG A;  4YOR A;  3U6F A;  1G15 A;  3MXM A;  3HM9 A;  1NU0 A;  3NH2 A;  1SV5 A;  3K5N A;  4DHY A;  4N47 A;  1YT3 A;  3EN9 A;  3MEC A;  4AM6 A;  1K6Y A;  4DTR A;  1T8E A;  4OO1 J;  3KLI A;  3DWL A;  3OYA A;  3IAY A;  4FLT A;  4KHU A;  4JRP A;  4CED A;  4LF5 K;  4JEP A;  4CEE A;  3SPY A;  4BC4 A;  3HP9 A;  4FO0 A;  3SBG A;  4CIF A;  5GIN A;  3VQ7 A;  3OS0 A;  3FGU A;  1NLV A;  1KVA A;  3AAR A;  3JS6 A;  3NHG A;  4BWJ A;  4RW9 A;  1SKR A;  1K8A O;  1YTU A;  3T69 A;  4DR5 K;  1UWB A;  3LWM A;  4JI1 K;  3EEQ A;  1BCM A;  3AO1 A;  4KAZ A;  3SAF A;  1HNI A;  4BRD A;  1J54 A;  1RCH A;  4RCH A;  3M1F A;  3CPW M;  3NH0 A;  3R9P A;  1FKO A;  4J2B A;  3HYF A;  3CJ1 A;  3EZ5 A;  4RW7 A;  4CD3 A;  4B8C A;  5HLF A;  3AVA A;  1RT1 A;  1VSI A;  1GOA A;  1J5O A;  4K41 A;  3ASM A;  3VQQ A;  1VQN N;  4L8R B;  5EY4 A;  1WAF A;  2X6S A;  1YXQ A;  2KFN A;  5AJ3 K;  4B1W B;  4CW7 B;  3QDK A;  3WQT A;  4IEI A;  3QNN A;  5D3G A;  4YY3 K;  4LC9 B;  1BCO A;  4CFA A;  5IT9 O;  4M3Z A;  1RFQ A;  5FLX O;  1L3T A;  2PZS A;  4EAH D;  1BWF O;  3KJV A;  2Z1G A;  4CF1 A;  1ZC6 A;  4NO7 A;  3HTV A;  3OHR A;  4M41 A;  3CIP A;  3CPE A;  2AP1 A;  3OYC A;  1IKX A;  4WQ4 C;  3V81 A;  3SAG A;  1JCE A;  3B8A X;  5HRN A;  2F7T A;  4KKO A;  2CGL A;  5JLF A;  1DEJ A;  3WQU A;  2G8I A;  1BQM A;  1H1V A;  3LAK A;  3NAE A;  4IJA A;  2GV9 A;  4RW4 A;  4EP5 A;  1I39 A;  3A5M C;  1RTJ A;  2KTQ A;  1C1A A;  1HYZ A;  3DRS A;  3NF6 A;  3VF2 A;  5FPD A;  2P9S A;  4DV4 K;  4ID5 A;  1IKY A;  1A5V A;  4W5R A;  3SUP A;  3O9Q A;  1UA0 A;  3VQP A;  2OTL N;  1RT4 A;  3W3D A;  1HNZ K;  2KW4 A;  3RTV A;  3VA3 A;  3U4L A;  4FJK A;  4CFD A;  4Z4G A;  2VWJ A;  4DR2 K;  4EHT A;  4RTF D;  1WLJ A;  3KKR A;  1YJ9 N;  1LV5 A;  2ZF5 O;  3VEO A;  3SYZ A;  1GLA G;  4JD2 A;  4ISE A;  1D4X A;  4NYN A;  5J2P A;  3AVC A;  1VK0 A;  3VEY A;  1S1T A;  1WSI A;  3HZ6 A;  4GY2 B;  4CEC A;  4CF2 A;  4HCC A;  2ZD1 A;  4JKB A;  3MED A;  2O8D B;  4CJP A;  1T44 A;  4IFE A;  4UY8 O;  1KAY A;  4QS9 A;  2G8U A;  4CEF A;  3QEP A;  1BGX T;  3QET A;  5JS2 A;  3V1Q A;  2P9S B;  4M3W A;  2GWJ A;  2WC9 A;  3C95 A;  2RHK A;  1VSH A;  2QWQ A;  2P5O A;  3OYE A;  2OYQ A;  4BE0 A;  2WOM A;  4MFB A;  4ELV A;  2E1Y A;  1ILY A;  4DTO A;  1YUW A;  2OPP A;  1DT9 A;  4OKJ A;  3O3F A;  4DG1 A;  3BP8 A;  4YHH K;  2QWM A;  1SL2 A;  3H6E A;  4B9M A;  4A2A A;  4CJ5 A;  5DM7 L;  4JD2 B;  3DLK A;  1CZB A;  3GG4 A;  3HL8 A;  3J7Z O;  1QSY A;  1X1P A;  3CM6 A;  1XC9 A;  2XHB A;  3T3F A;  5B8H A;  2QEX N;  4BDY A;  3G6E N;  3VQB A;  4LF7 K;  3CCV N;  5J2M A;  2OA8 A;  2A5X A;  4CZF A;  3AO5 A;  4OPK A;  4BG9 A;  4FWM A;  1GLJ O;  1J9A A;  3AA3 A;  5C2D A;  1VQ6 N;  4FYD A;  3HK2 A;  2GBZ A;  1K73 O;  1RGI A;  4DR3 K;  1ATN A;  3VQ6 A;  4IO8 A;  1X3M A;  3AA2 A;  3C6U A;  4O8U A;  5EOY A;  4CIG A;  4DQ8 A;  5AQL A;  2G8V A;  1ZXO A;  2UUA K;  3UKU A;  3ULD A;  4CEO A;  5KGX A;  1ZBU A;  3DXM B;  1NJZ A;  4NXM K;  1J53 A;  4E7K A;  3P5J A;  4G9Z A;  4PL8 A;  3L2U A;  4E7H A;  3EL2 A;  3OYG A;  3DOK A;  1TAU A;  4FW1 A;  5CHI A;  3CET A;  1XHZ A;  3QNO A;  4H0T B;  3VQC A;  1WOQ A;  3AVJ A;  3IFR A;  4WF9 L;  1Z6R A;  1QQN A;  3V9W A;  3ZSV A;  1K9M O;  2KLA A;  2AJQ A;  2OPS A;  2UXD K;  2YCH A;  3PY8 A;  4BAC A;  2GEM A;  2P9N A;  2O4I A;  4GV9 A;  2QWP A;  3ZET A;  4A61 A;  3D7E O;  5DK5 A;  3U8X A;  4Q5V A;  2LSN A;  1Z05 A;  1NGC A;  2HND A;  3KIO A;  2D1K A;  2YHA A;  3AA4 A;  1NMD A;  3BZC A;  2KQ2 A;  1TGO A;  4BR2 A;  4BGA A;  3OS2 A;  1N5Y A;  4PQU A;  3L3U A;  1VSL A;  4ILH A;  3THW A;  2HHU A;  2O8B A;  1ZYQ A;  3DJC A;  3CD6 N;  1OH7 A;  3G0Z A;  5JVG L;  4A2B A;  3M5R A;  3I8D A;  3V9S A;  4W5Q A;  4DR7 K;  1MDU B;  3TTC A;  1IG9 A;  3AGR A;  3CQ8 A;  5C15 A;  4U7B A;  2D0A A;  4C1N I;  4WQ4 A;  2P9N B;  4BRM A;  3HJF A;  3EKS A;  3ZET B;  4F2S A;  2NRZ A;  4N56 A;  4DQS A;  2FF3 B;  4YOY A;  1Y97 A;  1Z26 A;  1J5E K;  5ADX H;  1EQY A;  1HX1 A;  3A5O C;  3NE6 A;  5M1O A;  5AZJ B;  1S6P A;  3L2V A;  3SV3 A;  4XH4 A;  2D0C A;  3C94 A;  3LPT A;  2QWR A;  4Y1D A;  1NNE A;  1KVB A;  5HP1 A;  4AH9 A;  1OVY A;  3HI0 A;  1HLU A;  2OZM A;  3AAP A;  1L3V A;  4JKG A;  3QEI A;  2GWK A;  5BRE A;  2GTD A;  4J8F A;  3TAN A;  3G71 N;  2D4W A;  4WYB A;  2YKM A;  1B9D A;  3AO2 A;  3OYL A;  3KWI A;  4CES A;  1VSM A;  5EU7 A;  4FSV A;  4RW8 A;  1I3A A;  1N6Q A;  4FWO A;  2PYL A;  4ELU A;  2WTU A;  3A0I X;  1RDB A;  4R79 A;  4UQG A;  3CM5 A;  1Q81 O;  3HOS A;  3TTD A;  3KD1 E;  3CME N;  3SQ1 A;  3CC7 N;  2YV0 X;  4FZY A;  4JS4 A;  4DSI A;  1C0M A;  3OYH A;  4E89 A;  4FM0 A;  5AQG A;  2HF3 A;  1R0A A;  1OVQ A;  3CYM A;  4FK2 A;  1V4S A;  1UA1 A;  4FLW A;  3SQ4 A;  3M3Z A;  1KLN A;  3KLF A;  4LH4 A;  1RDD A;  1XWL A;  4OPH A;  3AVG A;  3Q7C A;  1VQL N;  2IIR A;  1JLA A;  3ID8 A;  3IG1 A;  3K2P A;  1QZ5 A;  3CCJ N;  1NMN A;  3WXK A;  2ATQ A;  3VEX A;  3RR8 A;  4CZL A;  4JV5 K;  1RIL A;  2FSJ A;  4C8K A;  4W5N A;  2W41 A;  3FZM A;  2ASO A;  2E8A A;  3I33 A;  5AQQ A;  4B9U A;  3DM2 A;  2BAN A;  3L2R A;  1RT5 A;  1F21 A;  4CF0 A;  3AA5 X;  2A1R A;  2W6L A;  4DSF A;  3J8A A;  4H0O A;  2V7Y A;  3CJ9 A;  1Q82 O;  3CCR N;  3C65 A;  5LL6 Z;  3LDL A;  3DLR A;  5AFU A;  2E2Q A;  2VCP A;  1C0T A;  5AQS A;  1QTM A;  2XO7 A;  4BR7 A;  2E88 A;  2FXU A;  3HP6 A;  4PKH A;  3VTI A;  4R5P A;  1E3M A;  2F9W A;  1KQS M;  3IRX A;  4EP4 A;  3NDK A;  1OKJ A;  3VEZ A;  4CIE A;  1EX4 A;  1VSD A;  3AVB A;  3BF1 A;  3TAQ A;  1KSP A;  4HVJ A;  4E0D A;  1TKD A;  3SCX A;  3OYN A;  1U6Z A;  5KTQ A;  3KK3 A;  1U45 A;  4C1N K;  3KKS A;  5KI6 A;  4CER A;  4JKE A;  1ITG A;  4XH5 A;  3S41 A;  3O4Q A;  3WNH A;  5JIC A;  1GLC G;  2VGM A;  3CFP A;  2BH1 A;  3PX0 A;  5C2F A;  1T7P A;  1NK7 A;  2HB5 A;  2XY7 A;  3NBP A;  3CFO A;  4ID1 A;  2KHO A;  1U49 A;  2NRX A;  3OYJ A;  2W6K A;  3QO9 A;  3WNE A;  3AV9 A;  4DR1 K;  4PKI A;  1S9G A;  4I6M A;  3ENO A;  2ITG A;  2X78 A;  1NJI O;  3HXM A;  4Z0U A;  3LPU A;  3ATU A;  3F73 A;  5I3U A;  2R7Y A;  4CCH A;  4AHV A;  1W97 L;  4NCB A;  1QVG M;  4BRN A;  4CZH A;  5M1F A;  3TR8 A;  3MEE A;  3TAR A;  2RPI A;  4BRO A;  3QIP A;  4IDH A;  4CGF A;  3ENB A;  4OGC A;  5CY4 A;  3D2F A;  3A5N C;  3VEW A;  1WSF A;  4KI6 A;  4BRC A;  4PL7 A;  4GW6 A;  1RBT A;  2Q3S A;  5CR4 A;  5KQ8 A;  3AO4 A;  3DOL A;  3NF8 A;  4I6M B;  4CBW A;  4HUF A;  1RDW X;  4FLY A;  1ATR A;  3F5T A;  3GOI A;  2Y1J A;  5CZ1 A;  3DLL L;  4CJ3 A;  4HWI A;  4CK2 A;  4DB3 A;  5F1X A;  2QWO A;  2HBK A;  1XNR K;  2O8C A;  2HBL A;  1JL2 A;  1O1W A;  2BGG A;  4F8R A;  3GE1 A;  1TAQ A;  3V9Z A;  3RWU A;  3FFI A;  1YI2 N;  2ZJP L;  4CHO A;  4IZ9 A;  1WBB A;  1DTT A;  1Q8I A;  1VQ9 N;  4CJW A;  3D2F B;  1EWR A;  4B1U B;  3TAF A;  1KRP A;  4KHW A;  1RT7 A;  3QIC A;  2W40 A;  3I0S A;  5AQP A;  1S5J A; 
#chains in the Genus database with same CATH homology
 4M45 A;  3JSM A;  1B92 A;  4ID5 A;  1NJY A;  4KRF A;  1IKY A;  1A5V A;  4W5R A;  3SUP A;  1TK5 A;  1UA0 A;  3VQP A;  1WSE A;  3VQD A;  3HST B;  1BI4 A;  4KHS A;  3AVI A;  1LAV A;  4JRQ A;  1RT4 A;  4O55 A;  3LWL A;  2KW4 A;  3DLE A;  4CF8 A;  3RTV A;  1KTQ A;  3VA3 A;  4NCG A;  4KHU A;  4FJK A;  4CFD A;  4DU4 A;  4C8L A;  4Z4G A;  2VWJ A;  3LP3 A;  2B5J A;  1NK5 A;  1WLJ A;  3KKR A;  1LV5 A;  1LAW A;  1L3U A;  3SNN A;  1NKE A;  3SPZ A;  4BE2 A;  3SYZ A;  2D0B A;  4NYN A;  5J2P A;  3TAM A;  2HNZ A;  4Z4H A;  1SKS A;  4EZ9 A;  3B6P A;  2X6N A;  3AVC A;  1TVR A;  1VK0 A;  4PA1 A;  2D5R A;  1S1T A;  1WSI A;  4W5O A;  3RMB A;  4FJG A;  4CEC A;  4CF2 A;  4QOZ B;  2Y1I A;  3V4I A;  3TAG A;  4HCC A;  4J2D A;  2ZD1 A;  3MED A;  4DQQ A;  4Q0B A;  3SUQ A;  1XI1 A;  4CJP A;  3ZT4 A;  1JLF A;  4F4K A;  4B9T A;  2P1J A;  3QES A;  3TAE A;  2G8U A;  4CEF A;  2PY5 A;  3DI6 A;  3QEP A;  3AVH A;  1BGX T;  3LP0 A;  3QET A;  3S3O A;  4B9V A;  4PY5 A;  3S3N A;  5JS2 A;  1JLQ A;  3V1Q A;  1HPZ A;  1VSE A;  3VN5 A;  3WNF A;  3SV4 A;  1RTI A;  3KLG A;  4DQI A;  4M3W A;  1WSH A;  5T7B A;  3C95 A;  3OYF A;  4DTP A;  3KK1 A;  1VSH A;  1RDC A;  2P5O A;  4G1Q A;  4O4G A;  3OYE A;  2OYQ A;  4FK4 A;  4BE0 A;  2WOM A;  4FJH A;  2IAJ A;  4MFB A;  1U47 A;  4DTN A;  4FW2 A;  1Q9Y A;  4DSK A;  5E41 A;  4M3T A;  2HHV A;  4M3Y A;  1JLG A;  1LWC A;  5J1E A;  3L8B A;  2BDP A;  4ELV A;  3K59 A;  3EYZ A;  4E7L A;  2IOC A;  4E7J A;  3SQ0 A;  4CHQ A;  4DTO A;  4C8N A;  3QIO A;  3LZI A;  2OPP A;  3SI6 A;  3PX4 A;  4KB0 A;  4F3O A;  4M3U A;  4OKJ A;  3O3F A;  1A5X A;  4OVL A;  4IG0 A;  4DG1 A;  4E7I A;  3SUN A;  3BGR A;  4I9L A;  1SL2 A;  1GOB A;  4JLH A;  1DLO A;  4B9M A;  3QIN A;  4CJ5 A;  1QHT A;  4CJQ A;  1RT2 A;  3HVT A;  4CEB A;  3TAB A;  3RMA A;  3DLK A;  1RBR A;  4FJ8 A;  4CJU A;  3V9X A;  4DU1 A;  2X74 A;  3CFR A;  1CZB A;  4DF8 A;  3HL8 A;  4K8X A;  1QSY A;  1X1P A;  3CM6 A;  1TKZ A;  1XC9 A;  3LP1 A;  2XHB A;  4CFC A;  3T3F A;  4H8K A;  4OPJ A;  4B9L A;  4BDY A;  4AIL C;  3VQB A;  2YNG A;  2OPQ A;  3QEW A;  1JXB A;  3K57 A;  4JS5 A;  5J2M A;  2OA8 A;  1LW2 A;  3AO5 A;  2IGI A;  1S9E A;  4KV8 A;  4LSL A;  5C25 A;  4LH5 A;  4OPK A;  3V6D A;  1J9A A;  3AA3 A;  3VQE A;  3OYB A;  1Q9X A;  3ZCM A;  4KTZ A;  4BDP A;  4FYD A;  4HUE A;  3ALY A;  3WNG A;  1ZBH A;  2GBZ A;  3HK2 A;  1RDA A;  4Y1C A;  5CYQ A;  3ZSQ A;  3K58 A;  3VQ6 A;  2BE2 A;  4PUO A;  3AA2 A;  3TI0 A;  1FK9 A;  3C6U A;  4CIG A;  4J2E A;  2G8V A;  3NGY A;  1WNS A;  3OY9 A;  3DRR A;  3ULD A;  1CLQ A;  1TKX A;  4CEO A;  5KGX A;  4FM2 A;  5DMR A;  1ZBU A;  2JLE A;  1FXX A;  4WE1 A;  4CJK A;  1NJZ A;  2IDO A;  1J53 A;  2NUB A;  1JLC A;  2DFE A;  4E7K A;  4DTU A;  3D45 A;  3LAM A;  3P5J A;  4B9S A;  4GMJ B;  3HPO A;  5C42 A;  3M8S A;  1T05 A;  4OLB A;  4DU3 A;  1QSS A;  2HVI A;  1GOC A;  3L2U A;  1MU2 A;  4E7H A;  2F96 A;  2HW3 A;  3K5O A;  4F2R A;  1TK8 A;  2HNY A;  3OYG A;  2HHS A;  4O0J A;  4K8Z A;  1TKT A;  4DFK A;  2XY5 A;  5K14 A;  3DOK A;  4DTM A;  1KFS A;  4FW1 A;  1TAU A;  2PYJ A;  3H08 A;  3P1G A;  4B9N A;  1HMV A;  3ZT0 A;  1XHZ A;  2QKB A;  5HBM A;  4CEA A;  3QNO A;  4IKF A;  3VQC A;  3OYI A;  3KD5 E;  3AVJ A;  1ZBI A;  4KRE A;  1BIU A;  3MXJ A;  3V9W A;  4KFB A;  3ZSV A;  3OJU A;  2AJQ A;  1HQU A;  1SL0 A;  3AO3 A;  4CJT A;  1IH7 A;  4BWM A;  2OPS A;  1L5U A;  3PY8 A;  4Z4I A;  4BAC A;  3TWH A;  4CGD A;  3KTQ A;  3PO4 A;  4KO0 A;  1D5A A;  5FDL A;  3OYD A;  2O4I A;  4EZ6 A;  1U4B A;  2IS3 A;  1KVC A;  5DK5 A;  2VWK A;  3HPH A;  4OKE A;  5HRP A;  4CJV A;  3OYK A;  1NJW A;  2YHB A;  4Q5V A;  3PV8 A;  4FM1 A;  2LSN A;  3TAP A;  3V1O A;  3T1A A;  2G8F A;  2HND A;  1X9W A;  3LDS A;  1IKV A;  1LWE A;  3KIO A;  3OVN A;  1VSJ A;  2YHA A;  1JLE A;  3AA4 A;  4HUG A;  4O44 A;  3RRH A;  3QER A;  4IBN A;  2F8S A;  3ITH A;  1A5W A;  1W0H A;  5KGW A;  2KQ2 A;  3DLG A;  3LAN A;  1NK6 A;  4DSL A;  4NYF A;  1TGO A;  2FBV A;  1KCF A;  2EHG A;  5HRO A;  2KFZ A;  1WAJ A;  3AVL A;  3OS2 A;  1N5Y A;  3M8R A;  4PQU A;  3F9K A;  3L3U A;  2XY6 A;  1VSL A;  1RT6 A;  1U04 A;  3SUO A;  1SKW A;  3HPG A;  3HT3 A;  5FRO A;  4KHY A;  2HHU A;  1BIS A;  1VRU A;  4KHQ A;  5I42 A;  1ZYQ A;  1NK8 A;  2HHQ A;  3ZT1 A;  3ZSX A;  4O0I A;  3G0Z A;  1DTQ A;  4E3S A;  4NCA A;  1S6Q A;  2FBX A;  4CGJ A;  4KPY A;  3I8D A;  3V9S A;  4MQ3 A;  1T03 A;  4W5Q A;  4E1N A;  1IO2 A;  4KHN A;  3MXI A;  2YKN A;  1IG9 A;  1BQN A;  4DSJ A;  4ZTF A;  2DFH A;  3M8P A;  4XIU A;  3CQ8 A;  3K5M A;  1SL1 A;  4HHT A;  2D0A A;  4RW6 A;  1BI4 B;  3VQA A;  3V9U A;  2G8K A;  4DWI A;  3HJF A;  3AVF A;  3QLH A;  4F2S A;  2RF2 A;  4ZHR A;  1JXE A;  4N56 A;  4DQS A;  1VRT A;  3AVN A;  1Y97 A;  4CHN A;  1Z26 A;  4OGE A;  3HVR A;  3O4N A;  1RTD A;  3NE6 A;  1D9F A;  1ZBL A;  2ZQB A;  1S6P A;  1C6V A;  3ISN C;  3L2V A;  3SV3 A;  1NKC A;  1L3S A;  4I2Q A;  2O4G A;  1HNV A;  4HTU A;  4LY7 A;  2D0C A;  4AHR A;  3C94 A;  4CJE A;  3LPT A;  4B08 A;  4Y1D A;  4OJR A;  1HRH A;  4FLV A;  1KVB A;  4FZZ A;  4AHC A;  5HP1 A;  4FJL A;  1WN7 A;  3O3G A;  4FJI A;  4AH9 A;  4KTW A;  1LWF A;  2Z1H A;  2OZM A;  1BHL A;  1L3V A;  4N41 A;  3QEI A;  3G10 A;  5SZT A;  4FJ7 A;  2RKI A;  2YNF A;  2I5J A;  3CG7 A;  3TAN A;  5C24 A;  3RR7 A;  2YKM A;  1B9D A;  2YNH A;  3AO2 A;  3OYL A;  4CES A;  1X9S A;  4ELT A;  1VSM A;  5SWM A;  1JKH A;  4CE9 A;  5EU7 A;  5KRT A;  2G8W A;  3IAY A;  3ZT3 A;  4RW8 A;  1I3A A;  4FLX A;  1N6Q A;  2PYL A;  4YFU A;  4FLZ A;  4ELU A;  4OLA A;  3UIQ A;  1C1B A;  3K5L A;  2DY4 A;  1RDB A;  4UQG A;  1D8Y A;  3CM5 A;  2EX3 A;  2P51 A;  4GVM A;  4FVM A;  4DFP A;  3KD1 E;  3SQ1 A;  4FJN A;  2YV0 X;  4FZY A;  4C8M A;  4JS4 A;  4CGI A;  4DSI A;  1C0M A;  3OYH A;  1EKE A;  2E4L A;  4CJF A;  4IFY A;  1EP4 A;  4E89 A;  3NGI A;  4FM0 A;  3B6O A;  3SJJ A;  1R0A A;  4KB1 A;  3CYM A;  3P83 D;  5FRN A;  4FK2 A;  1UA1 A;  3MEG A;  3OS1 A;  1EET A;  3EY1 A;  3PUF A;  1BIZ A;  4FLW A;  3SZ2 A;  3SQ4 A;  1KLN A;  1ASW A;  4E1M A;  4LH4 A;  4TSX A;  3KLF A;  1RDD A;  3ZSZ A;  1NK9 A;  1XWL A;  2DFF A;  3AVG A;  3MAQ A;  1BL3 A;  2HVH A;  4PWD A;  1HYV A;  3L2W A;  4LSN A;  3AVM A;  1JLA A;  3IG1 A;  3ZSO A;  4N5S A;  3K2P A;  4FCY A;  2FBT A;  4BDZ A;  3M8Q A;  4FJJ A;  1HQE A;  1RTH A;  2ATQ A;  4CJS A;  4DLG A;  4DFJ A;  4ZTJ A;  3RR8 A;  4C8O A;  4FK0 A;  4KI4 A;  4CEZ A;  3KLE A;  1ASV A;  1RNH A;  4CGG A;  1RIL A;  2JGU A;  3L3V A;  4DTJ A;  5HLF A;  4C8K A;  2P5G A;  4W5N A;  1B9F A;  3I0R A;  4CK1 A;  5HRR A;  4DTS A;  1REV A;  2ZE2 A;  4B9U A;  3DYA A;  2E6M A;  4ICL A;  3DM2 A;  1VSK A;  2BAN A;  3L2R A;  1RT5 A;  1F21 A;  4CF0 A;  4LD0 A;  3AA5 X;  2A1R A;  4DSF A;  3DLB A;  4RG8 A;  4CK3 A;  4M3R A;  4DFM A;  4IFV A;  4I2P A;  4CGH A;  3VQ4 A;  4QAG A;  3NF9 A;  1HYS A;  2E6L A;  2B4J A;  3VQ5 A;  1LW0 A;  1C0U A;  5FRM A;  3DLR A;  4B3O A;  2YNI A;  4IG3 A;  4QCL A;  1C0T A;  1QTM A;  4W5T A;  1QS4 A;  2XO7 A;  4CHY A;  2FC0 A;  5HRS A;  3HP6 A;  2F8T A;  1NJX A;  1EXQ A;  4R5P A;  4H4M A;  4Z4F A;  1ASU A;  3IRX A;  2B6A A;  4EP4 A;  4CJR A;  3NDK A;  2QK9 A;  5JS1 A;  2Z1I A;  4CIE A;  1EX4 A;  3KLH A;  1RBV A;  1NKB A;  4DQP A;  1VSD A;  3ZSY A;  3AVB A;  4CFB A;  1TK0 A;  3TAQ A;  1YVU A;  2Z1J A;  4FZX C;  2GUI A;  3PX6 A;  1KSP A;  4J2A A;  4HVJ A;  2KZZ A;  3U6F A;  4E0D A;  1TKD A;  1G15 A;  3SCX A;  3MXM A;  3NH1 A;  3OYN A;  3HM9 A;  3S3M A;  5KTQ A;  3NH2 A;  1SV5 A;  3QEX A;  4I7F A;  3K5N A;  3KK3 A;  1U45 A;  3L2Q A;  3DLH A;  4F3T A;  3U3Y A;  4N47 A;  1YT3 A;  3VQ8 A;  2OZS A;  3MEC A;  3KKS A;  5KI6 A;  4CER A;  1S1V A;  1K6Y A;  3VA0 A;  1C1C A;  4DTR A;  1ITG A;  3WNH A;  3O4Q A;  1T8E A;  1RT3 A;  3KLI A;  3IS9 A;  3OYA A;  1TL1 A;  3CFP A;  3PX0 A;  1FKP A;  1QSL A;  1T7P A;  3ZSR A;  1IKW A;  1TL3 A;  2HB5 A;  4FLT A;  3NBP A;  5J2Q A;  2XY7 A;  1NK7 A;  3CFO A;  4ID1 A;  4Z4C A;  4JRP A;  3V1R A;  4CED A;  4CF9 A;  3O3H A;  1U49 A;  4CEE A;  3SPY A;  3OYJ A;  1CXU A;  1JL1 A;  3HP9 A;  1W9H A;  2A1S A;  3ZSW A;  3QO9 A;  4CIF A;  4DLE A;  3VQ7 A;  3AV9 A;  3WNE A;  4DS4 A;  3OS0 A;  3OYM A;  4DS5 A;  1CXQ A;  1S9G A;  1KVA A;  3LAL A;  4HCB A;  4H4O A;  1SUQ A;  4OKK A;  2ITG A;  2X78 A;  2WON A;  4M3X A;  1KLM A;  2OPR A;  3NHG A;  1WSG A;  4BWJ A;  4BE1 A;  4RW9 A;  3HXM A;  4IDK A;  4Z0U A;  1SKR A;  3RRG A;  3LPU A;  3F73 A;  5I3U A;  2R7Y A;  4Z4E A;  1D9D A;  4CCH A;  1S1U A;  1CZ9 A;  1RBU A;  5J2N A;  1YTU A;  3KK2 A;  1NK0 A;  2IC3 A;  1UWB A;  3NF7 A;  4AHV A;  3LWM A;  2G8H A;  4NCB A;  1BCM A;  3AO1 A;  4KAZ A;  1HNI A;  1J54 A;  4FJM A;  1RCH A;  2QKK A;  1ZBF A;  3D0P A;  3TR8 A;  3MEE A;  3TAR A;  2RPI A;  3NH0 A;  3QIP A;  1S1W A;  1FKO A;  3LP2 A;  4FJ5 A;  4J2B A;  3HYF A;  2XRI A;  4FLU A;  3HO1 A;  3EZ5 A;  4RW7 A;  4CGF A;  3PO5 A;  1JLB A;  4B8C A;  4OGC A;  3LZJ A;  3AVA A;  5CY4 A;  1RT1 A;  1VSI A;  2VG7 A;  4B8A B;  4DF4 A;  1GOA A;  4CEQ A;  1J5O A;  3VQ9 A;  1WSF A;  3ASM A;  3VQQ A;  1YTA A;  2VG6 A;  4KI6 A;  4L8R B;  1WAF A;  3E01 A;  2X6S A;  4GW6 A;  2KFN A;  3SQ2 A;  3NFA A;  1RBT A;  2Q3S A;  4CHP A;  2RN2 A;  2KZM A;  2XY8 A;  5KRS A;  3AO4 A;  4N76 A;  3QNN A;  4CHZ A;  3DOL A;  1RBS A;  1UAX A;  1Z25 A;  5D3G A;  2QXF A;  1BCO A;  4AHU A;  4CFA A;  3NF8 A;  1U48 A;  4HUF A;  2HHT A;  4FLY A;  1VSF A;  3DMJ A;  3T19 A;  2W42 A;  4M3Z A;  3NCI A;  2PZS A;  1QQC A;  1L3T A;  3KJV A;  4M42 A;  4FJX A;  2VG5 A;  1XHX A;  2Z1G A;  4I9Q A;  4CF1 A;  2Y1J A;  5CZ1 A;  4DQR A;  1QE1 A;  4CJ3 A;  5CZ2 A;  4CK2 A;  1HJR A;  3AVK A;  4DTX A;  1TV6 A;  4FXD A;  2DTU A;  1S1X A;  4O5B A;  4M41 A;  1NOY A;  3A2F A;  4YNQ A;  1JL2 A;  1O1W A;  3OYC A;  1IKX A;  3OJS A;  4F8R A;  2BGG A;  2HHX A;  2FBY A;  1TAQ A;  3V9Z A;  3V81 A;  3C6T A;  3RMD A;  3ZT2 A;  3FFI A;  2HMI A;  4AHS A;  3RWU A;  2HHW A;  2ETJ A;  4CHO A;  4E19 A;  3BDP A;  4CJ4 A;  5HRN A;  4FJ9 A;  3JYT A;  4KKO A;  1DTT A;  1Q8I A;  4DSE A;  5CYM A;  1KFD A;  3NGZ A;  4CJW A;  3RMC A;  3TAF A;  1KRP A;  4KHW A;  2G8I A;  1BQM A;  1RT7 A;  4CJL A;  3LAK A;  4DMN A;  3DRP A;  3NAE A;  4KTQ A;  4AHT A;  3S9H A;  2GV9 A;  4RW4 A;  4EP5 A;  3THV A;  1X9M A;  3I0S A;  1I39 A;  1NK4 A;  1RTJ A;  2KTQ A;  1WSJ A;  1NOZ A;  1S5J A;  1C1A A;  1HYZ A;  3U3G A;  3QEV A;  3DRS A;  3NF6 A;  1UOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...