4CJWA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjwA00
4C8OA 3CG7A 1WN7A 1TVRA 3LP1A 1ZBHA 1S5JA 3C6TA 1NJWA 1BCOA 5CY4A 3NCIA 4DQSA 5HROA 3VA3A 3SPZA 1LV5A 4DSKA 3VQ7A 4BE1A 3VQAA 4M3ZA 4FZYA 1HNVA 4DFMA 2JGUA 3VQEA 4F2SA 1U47A 2Z1IA 3CM6A 5KGXA 1U48A 4FLVA 4CEEA 4FJ9A 4CGIA 4PQUA 4K8XA 3OYNA 1YTUA 3ULDA 3DMJA 3NBPA 3TR8A 1LW0A 4CF8A 3RRGA 3DLRA 1FKPA 3C94A 3WNFA 3KLGA 3VQCA 3DRPA 4DTXA 1JLBA 1ASWA 4B9SA 4CJPA 1VK0A 4XIUA 3NGIA 4KB1A 4E0DA 2X74A 4KTWA 1HYVA 3AVAA 3MAQA 2HMIA 5KRTA 4H4MA 5JS1A 3AVNA 1RNHA 1F21A 5C24A 1C1BA 1IKWA 2IC3A 4DTPA 3BGRA 4IFVA 1VRTA 5FROA 3AVGA 3AVMA 4KFBA 1QHTA 2XY7A 2Z1GA 1BI4B 1KFSA 4I2QA 4PWDA 3OVNA 4ELTA 3SUPA 3VQ9A 4CHYA 3F9KA 4O44A 3KJVA 1RBUA 3DRRA 1IKYA 4C8NA 2KW4A 4E1MA 3DLGA 3RR7A 4EP4A 4KHSA 2HHVA 1R0AA 4DWIA 3VQPA 2HHWA 3NH0A 3CQ8A 4CF9A 3G0ZA 1VRUA 3U3GA 4CIGA 4DU3A 2YNFA 1RTIA 3ZSQA 4Z4CA 3ZT0A 4AHVA 5HRPA 1C0UA 1JLFA 4OJRA 4QOZB 3HXMA 3VQ5A 1SL0A 1L5UA 4KTZA 1NOYA 4FLXA 3ZSZA 2A1RA 4IBNA 2E4LA 2RN2A 2G8KA 4M3WA 4Z4FA 3ZSVA 5HP1A 1TGOA 5I3UA 2YNIA 3HM9A 1JLCA 3O3FA 4PUOA 4ZHRA 1W9HA 2FBVA 3B6OA 3K2PA 1BI4A 3AVHA 3HP6A 1S6QA 4KPYA 3V1RA 3HJFA 3TAFA 1TK5A 1VSHA 2ZD1A 3U6FA 4L8RB 1BGXT 3NH2A 3VN5A 3P83D 3HPGA 3U3YA 3ZSXA 4CIEA 4CEBA 1S6PA 4O55A 3KLIA 3RR8A 4C8KA 3NF8A 4OGCA 3QIPA 4Q5VA 3V9UA 1S1XA 3VQ6A 1LWEA 1RDDA 3ZT4A 4EP5A 3V1OA 2DFEA 3VQDA 4CEDA 3EY1A 4BE0A 1S9GA 2IOCA 3O3GA 3K57A 4CJTA 3OS0A 2YKMA 1U49A 1WLJA 4CJEA 1L3VA 4CECA 3QETA 3SJJA 1WSJA 3NFAA 4CGJA 3K58A 2BANA 2B5JA 3TARA 2HNDA 1U4BA 5J1EA 3DI6A 4B9VA 2G8WA 2OPRA 3I0SA 4CF0A 4E89A 4W5OA 4FK4A 2KZZA 3DLEA 3D0PA 4OKEA 2YHAA 4RG8A 5J2PA 2FC0A 2GV9A 3LALA 4FW1A 3LWLA 2WOMA 1FKOA 1ASUA 4LH5A 1IH7A 4B9UA 2VG6A 4KHNA 1HPZA 4DQPA 1CZBA 4OKJA 4FJKA 1JXEA 4DSLA 1RT7A 1NJXA 3AVLA 1IO2A 4CFBA 3QEWA 4Q0BA 1ITGA 3HPHA 1HRHA 4ID1A 1HYSA 2AJQA 2D5RA 3AO2A 3OYMA 3AVKA 2X78A 5T7BA 2OPPA 1BISA 1T03A 4CHZA 5CYMA 1JXBA 4CEFA 4HUGA 1NK4A 4FYDA 3QEXA 1RTHA 4FVMA 2FBYA 4O0IA 3QEIA 3AA2A 3OYLA 5J2MA 1TKTA 1WSIA 4DSFA 2VG7A 3I8DA 4G1QA 1KRPA 1HQEA 3ZSWA 4BDPA 1KVBA 3DYAA 3T19A 5CZ1A 4FJNA 2KTQA 2OA8A 2QXFA 3RRHA 3KD5E 4YFUA 3LANA 2O4GA 4E3SA 2BE2A 4RW6A 4KHUA 2YV0X 3L2UA 4OGEA 3OYFA 4JRPA 1S1WA 5SZTA 3NHGA 4BDYA 4NCAA 1LWFA 4BE2A 2HHUA 3OYJA 4FLZA 4KRFA 3ZT1A 1VSMA 1U04A 4CJWA 2HHTA 4AHRA 2KQ2A 3IAYA 3V1QA 3LP0A 1EX4A 1RTJA 1UWBA 3DLBA 4KO0A 4RW8A 4H4OA 1X9SA 3F73A 4DU4A 4NCBA 2IDOA 3OY9A 1YVUA 1RBSA 3QINA 4LY7A 1BIUA 3QNNA 4FJIA 4CEAA 2EHGA 4I2PA 2OPSA 2LSNA 1I3AA 1RDCA 3NE6A 1D8YA 4KB0A 4J2AA 4E7IA 4KHWA 1BCMA 4B8AB 1MU2A 3KKRA 4IFYA 4IG3A 5CZ2A 3OYIA 3NH1A 3VA0A 4B9LA 4DSIA 4DQIA 1DTTA 5FRMA 4FLUA 5I42A 3MECA 3SUOA 1RT2A 4W5NA 1JLGA 2OYQA 3AO5A 4CHOA 5JS2A 4I9QA 4OLBA 1Q9YA 2KFNA 3HYFA 1G15A 4DFJA 2HHXA 4F4KA 3TAQA 1KFDA 3WNGA 2FBXA 3K5LA 4N41A 1HJRA 2W42A 4FJ8A 1GOCA 4DLEA 2G8FA 2ZE2A 2QKBA 3CFPA 2G8VA 3KLHA 2R7YA 1EXQA 4DMNA 4FCYA 4O0JA 3V9ZA 3TANA 4CJUA 3MXIA 5DK5A 3SUQA 1RBTA 4CEOA 1B9DA 3MEGA 4W5TA 4HTUA 1TKZA 4B3OA 2YNGA 2P5OA 4ELUA 3LPUA 2P5GA 1Q9XA 4MFBA 4WE1A 1L3TA 1QSLA 2VG5A 1KLMA 4DU1A 1RT6A 3LZIA 4NYFA 3OJUA 4E7HA 1N6QA 1C0MA 3KK2A 2HVIA 4DTRA 3NF9A 2HB5A 3MXJA 2PYLA 3V4IA 3VQ4A 3LZJA 1C0TA 3ITHA 4ELVA 2ITGA 3VQQA 2E6MA 2YNHA 3SYZA 1A5WA 1T8EA 4CESA 4CCHA 3V81A 1I39A 1TL1A 1LAVA 1XWLA 3M8SA 1NKCA 4OPKA 1RT1A 4B9NA 1TAQA 4CF1A 3I0RA 1IKVA 3A2FA 3TAGA 3L2RA 3HL8A 4CERA 4CFAA 3OYCA 3L2VA 1JLQA 4FM0A 1EP4A 1QS4A 2D0BA 4IDKA 4QCLA 2B6AA 2PZSA 3DOKA 1HQUA 4FZZA 3SQ4A 4M41A 1TK8A 4DTJA 3QERA 3SQ0A 4LD0A 4PY5A 3RMAA 4FW2A 3O4NA 4LSLA 2Z1HA 2KFZA 1S1UA 4Y1CA 3VQBA 4KI4A 3C6UA 3ZSOA 1RT5A 2D0AA 1D5AA 3AVJA 3IG1A 4LH4A 1NK6A 4FK0A 2XO7A 3L3VA 2OZMA 1REVA 1HMVA 4DFPA 4CHNA 2XRIA 4M3XA 1JL1A 2XY6A 1S9EA 4ID5A 5SWMA 4DF8A 3QLHA 3ZSRA 1RCHA 5FDLA 3JYTA 1CZ9A 1TL3A 3SV3A 3S3MA 1LW2A 2G8HA 2BGGA 3DLKA 4BWMA 4N76A 1ZBUA 1RT4A 2HNZA 4OPJA 4CJRA 4J2EA 1Y97A 3ZCMA 4KKOA 4FJLA 3CFRA 4HVJA 5KTQA 1TAUA 1C6VA 2G8IA 3ALYA 2F8TA 1BQNA 1NK9A 4N56A 5D3GA 3M8QA 3ZT2A 1Z26A 3O3HA 1XC9A 2JLEA 2DFFA 2PY5A 3TABA 3S9HA 4DTUA 1LAWA 4EZ9A 1KSPA 2ATQA 4GW6A 3OS2A 1RDBA 4W5RA 4DTMA 4CGGA 3AO1A 2Z1JA 4JS5A 3ZSYA 1TKDA 4CGFA 4DLGA 5DMRA 4FLTA 3S3NA 4FM2A 1NK8A 3SQ2A 2OZSA 1KVAA 1WAJA 1S1VA 1UOCA 3TI0A 3HK2A 1JLEA 3H08A 4AHCA 4M3UA 2BDPA 2OPQA 1BL3A 3AO4A 1BQMA 4O4GA 1C1AA 1WSFA 1UAXA 2XY5A 2FBTA 4RW7A 4HUFA 1SUQA 1IKXA 4PA1A 4B9MA 5HRSA 3THVA 2ZQBA 1IG9A 4Y1DA 1YT3A 1VSEA 1ZYQA 1VSFA 4CIFA 3LAKA 3SPYA 3KK3A 3DM2A 2F96A 3D45A 4E7KA 4FJHA 4CHQA 3AA4A 4CEZA 2XHBA 3TAMA 1Z25A 3PX4A 5KI6A 4B9TA 4CJ3A 3SUNA 3QO9A 2ETJA 5C42A 4FJMA 1VSDA 1A5VA 3RTVA 3PO4A 2YKNA 4JRQA 5HBMA 4K8ZA 4CK2A 2Y1JA 1WNSA 3KIOA 5J2NA 4I7FA 4DTNA 1NKEA 3LDSA 3KTQA 1RT3A 4ZTJA 4Z4IA 4DQQA 3OYEA 4Z0UA 4DFKA 3OYAA 1XHZA 4F2RA 1RBRA 3RWUA 1QQCA 3TAPA 4AHSA 4DSJA 4HCCA 4M3YA 1LWCA 4LSNA 4BWJA 1QTMA 4W5QA 3KKSA 2RKIA 4E7LA 4H8KA 1EETA 4DG1A 1L3UA 1NK5A 2HHSA 3SZ2A 3E01A 2GUIA 4CHPA 3KLFA 4M42A 3QIOA 1O1WA 4M3RA 4TSXA 3OYKA 1D9DA 4M3TA 4HHTA 1QSYA 4Z4GA 4UQGA 1X1PA 2DFHA 2GBZA 4GVMA 4FLWA 3QNOA 2P51A 3O4QA 1BIZA 1TK0A 2IAJA 3K5OA 4JS4A 4N47A 4CJLA 3SI6A 3ZT3A 1UA0A 2G8UA 4CJSA 3AO3A 2HNYA 3AVFA 3OYBA 3S3OA 3T3FA 3BDPA 3NDKA 3SV4A 1QSSA 5E41A 3K5MA 1SL1A 4FK2A 1NJYA 1NK7A 1X9WA 2O4IA 1B92A 1XHXA 2NUBA 3L8BA 4NCGA 3PY8A 1YTAA 2PYJA 4CK3A 4NYNA 3TAEA 3HVTA 3HT3A 4FJJA 3ISNC 4CE9A 1NK0A 4IG0A 3LP2A 4QAGA 5EU7A 4OLAA 1A5XA 3HO1A 3KLEA 3EZ5A 4KTQA 3P5JA 1SKSA 2HHQA 2X6SA 5K14A 1VSIA 4HUEA 4DS4A 1U45A 3LAMA 4RW9A 1VSLA 4YNQA 3QEPA 1S1TA 1J54A 1D9FA 3EYZA 4CFCA 4J2BA 1DTQA 1DLOA 1JKHA 3K59A 1EKEA 1VSJA 2DTUA 1C1CA 1GOAA 4DTSA 1RTDA 4KAZA 1FK9A 4OKKA 5J2QA 4EZ6A 5C25A 1L3SA 1RBVA 1K6YA 5CYQA 1RDAA 3P1GA 3NGZA 4KHYA 1QE1A 3KK1A 3ASMA 3B6PA 4E7JA 3TWHA 3WNHA 1JL2A 3K5NA 3G10A 3IRXA 4AH9A 2D0CA 4I9LA 4RW4A 4CEQA 2RF2A 3L3UA 3C95A 4CK1A 4DSEA 1J53A 1SKWA 4J2DA 2XY8A 3MEDA 2I5JA 1VSKA 3RMBA 4CJ4A 4DS5A 5HRRA 3NAEA 1W0HA 2KZMA 3PO5A 1HYZA 2IS3A 1TKXA 4CJFA 1ASVA 1KCFA 3SCXA 1KLNA 2Q3SA 1T05A 1CLQA 4F8RA 1BHLA 2VWJA 5FRNA 3L2QA 4FZXC 4BACA 1WSEA 3SNNA 1FXXA 3LP3A 3OS1A 3L2WA 2HW3A 3OYGA 1SV5A 2P1JA 3HSTB 3OYHA 3PX6A 4E1NA 1ZBLA 1UA1A 4FJGA 3FFIA 4C8MA 3M8RA 4F3TA 1SL2A 4B08A 3HVRA 1WSGA 4O5BA 4HCBA 3QEVA 3DLHA 3VQ8A 3CM5A 4CGDA 1GOBA 3V9WA 4DQRA 3V6DA 3DRSA 4FXDA 2QKKA 2E6LA 2X6NA 4CJVA 4CJKA 4FJXA 4M45A 1CXUA 1WAFA 4OVLA 1ZBFA 4ZTFA 3NGYA 5KRSA 3AVCA 3NF6A 4AHTA 3T1AA 2WONA 1N5YA 3UIQA 1KTQA 1RILA 1SKRA 4KI6A 3DOLA 1NOZA 3LPTA 4JLHA 3OJSA 2A1SA 2HVHA 1T7PA 2F8SA 3RMCA 5KGWA 4MQ3A 4CJ5A 4C8LA 4DF4A 4CF2A 1Q8IA 4FM1A 4F3OA 3M8PA 1TV6A 3MEEA 5HLFA 3NF7A 3MXMA 1J9AA 3JSMA 4KV8A 3PV8A 4N5SA 3AV9A 2YHBA 2IGIA 3V9XA 3AVIA 4GMJB 4KHQA 3QESA 1X9MA 4FJ7A 3PX0A 1XI1A 3PUFA 1WSHA 3IS9A 3AVBA 3HP9A 4BDZA 2Y1IA 4AILC 2RPIA 5HRNA 1J5OA 4KREA 4Z4HA 4DTOA 1NJZA 3AA5X 3V9SA 4CFDA 1NKBA 4FJ5A 4ICLA 4IKFA 1HNIA 4B8CA 3CFOA 4R5PA 4Z4EA 3AA3A 4AHUA 4E19A 3WNEA 3SQ1A 1KVCA 3LWMA 1JLAA 2VWKA 2QK9A 4FLYA 2B4JA 3OYDA 4CGHA 2EX3A 4CJQA 3CYMA 1ZBIA 2DY4A 3HPOA 3RMDA 3KD1E 1B9FA 1CXQA
chains in the Genus database with same CATH superfamily
1WN7A 1TVRA 1N34K 3VA3A 3SPZA 1LV5A 5I9EB 3VQ7A 3CMAN 4M3ZA 1HNVA 4DFMA 4EFHA 4FPAA 1U47A 1U48A 5BPLA 2HMPA 3ZLJA 3DMJA 3CCJN 1LW0A 3CHWA 3WNFA 1Z6RA 4DTXA 2ZJRL 3CCSN 3EKUA 4B9SA 1HNWK 1VK0A 3QDKA 5LJVA 4XIUA 3NGIA 2X74A 3AVAA 3MAQA 2HMIA 1GLCG 4A57A 4WCEL 2ZJQL 5JS1A 3HI0A 4HTLA 1N36K 2Z1GA 1X9JA 3VQ9A 3F9KA 3SMSA 4C8NA 3DLGA 4IFEA 3K9JA 2HHWA 4CF9A 3CXCM 1VRUA 3U3GA 4DU3A 3UKRB 1BG3A 2V51B 4E1JA 1JLFA 1SL0A 4FLXA 3T7ZA 2E4LA 2G8KA 2VQEK 4DUYK 3FFKB 2IIRA 4KH4A 4JK8A 3T1HK 3O3FA 4B3TK 2V7ZA 4ZHRA 5AQTA 4DV0K 3I8BA 3K2PA 1BI4A 2HBMA 3F5TA 4IJAA 2V52B 4CEBA 4AM7A 2FF6A 3NF8A 3QIPA 4Q5VA 3MX5A 3RSEA 1EQYA 4NLCA 5M1NA 4CECA 3U9DA 1U4BA 3DI6A 2OPRA 3I0SA 4CF0A 4FK4A 4CD3A 4JEPA 5EVZA 2KZZA 1SAZA 5AQPA 3GDQA 4B9UA 4LH5A 1FKOA 2VG6A 4GY2B 4NO7A 1HPZA 5LJWA 4DR1K 4OKJA 1OH8A 3ULEA 4BRIA 2AJQA 3AO2A 4JKFA 3LDLA 1T03A 4CHZA 5CYMA 1NK4A 3QEXA 3OHRA 4OPHA 4RCHA 3BZCA 3AA2A 3HM8A 2VG7A 1HQEA 4FOIA 3ZSWA 4BDPA 5AQFA 1ILYA 5GAEP 4M7YA 1SQKA 5AQWA 3OYFA 4RWTA 3NHGA 4BE2A 2P9PA 1BA0A 3CCUN 1RTJA 1UWBA 4KO0A 3F73A 1YUWA 4FWLA 4NCBA 1RBSA 3QINA 4LY7A 4YOTA 4CEAA 4IJNA 4I2PA 4KB0A 4J8FA 3OYIA 5CZ2A 2P9LB 3VA0A 4DQIA 3DLLL 4BQZA 3R8EA 4W5NA 4CI6A 1JLGA 5ELZA 5B8HA 3DXKB 3HYFA 3ZEUA 4DFJA 3WNGA 1HJRA 4B1XB 2W42A 4MLEA 5M1QA 4BRFA 2G8VA 4OPAA 4JI6K 4CJUA 3MXIA 2YHXA 4H5WA 4GKKK 4FWNA 4B3OA 2KHOA 2P5OA 3ZX0A 3LPUA 1Q9XA 1QSLA 1C0MA 3KK2A 1NGGA 2P9KB 3QB0A 4K41A 3LZJA 3J80O 4CVNE 4YORA 4K42A 1T8EA 5EX5A 1JCFA 3ID6A 1TL1A 4BG8A 4B9NA 1IKVA 2QWRA 3HL8A 3R3LA 3BY5A 3DXMA 3OYCA 4FM0A 2D0BA 4IDKA 4QCLA 3DOKA 4FZZA 2JWKA 4M41A 1TK8A 4DTJA 4PY5A 3O4NA 4Y1CA 4KI4A 4CBXA 3HSCA 3C6UA 2HSTA 1D5AA 4IXCA 4LH4A 4FWMA 2CH5A 5F1XA 4CW7B 4BQLA 3JXUA 1S9EA 3LDQA 5CR4A 4DF8A 3SV3A 3S3MA 2G8HA 3DLKA 2WC9A 3FE1A 1Y97A 3ZCMA 1HPMA 3CFRA 4HVJA 1TAUA 2RHKA 3VGMA 4C1NI 2G8IA 4B3SK 1BQNA 3O3HA 1Z26A 2P9NB 2DFFA 2E1ZA 5AQLA 1LAWA 1KSPA 2ATQA 4I6MB 3OS2A 1BOTO 4DTMA 4IEIA 3AARA 4JS5A 4FLTA 3CETA 4ISFA 3SQ2A 1WAJA 1S1VA 3KK7A 3H08A 3Q7CA 4JK7A 4JHDA 3ZYYX 5DM7L 4RW7A 4XEIA 1IKXA 1U6ZA 4X64K 1IG9A 2ZQBA 1ZYQA 2O8CA 3SPYA 3KK3A 3DM2A 5AQGA 4E7KA 3UE5A 5F2RA 5C42A 1A5VA 3RTVA 2YKNA 1IBKK 1QQOA 4YOYA 4DR5K 4Z4IA 1XHZA 3OYEA 4WF9L 4HCCA 3A5OC 1LWCA 2Q1NA 4UY8O 3SMPA 3A8YA 4A62A 2VCPA 4CHPA 3MMVA 1WBDA 2E5LK 3MCPA 4M3RA 4BRDA 3CJBA 4HHTA 5LY3A 2GBZA 4GVMA 2P51A 4JAXA 1BIZA 1FJGK 1TK0A 4JS4A 4N47A 4MO4A 1UA0A 3AO3A 3BDPA 2O4IA 4BC3A 2O8EB 1KC8O 1B92A 2PYJA 2Q0UA 3TAEA 4O8KA 1NK0A 5EU7A 4JV5K 1A5XA 2X6SA 4ILGB 1VSIA 4HUEA 4DS4A 2NNWA 3LAMA 1U45A 1NGCA 1VSLA 3M1FA 1S1TA 1Y64A 1D9FA 1DTQA 3FR0A 1WOQA 3VEYA 2A40A 3UKUA 3SLCA 1FK9A 5LL6Z 5BRDA 4EZ6A 5C25A 3B8AX 1C0FA 2E20A 3P31A 3NGZA 4E7JA 4C8OA 3BEXA 1JL2A 1Q18A 3IRXA 2D0CA 1SKWA 4RW4A 5BPMA 3L3UA 1VQKN 4CJ4A 2VQFK 1MWKA 3R9PA 3PO5A 2IS3A 1TKXA 4CJFA 4Y0WA 1KLNA 5FRNA 4FZXC 3OS1A 3OYGA 2ASMA 2P1JA 3O9QA 1UA1A 5AZJB 4FJGA 3M8RA 1DKGD 3ENBA 3CMEN 4HCBA 4O5BA 3C7NA 3BF3A 3CD6N 1GOBA 3ID8A 3H1QA 4JN4A 4YDUC 2X6NA 4OVLA 2FSKA 3ZX2A 3NGYA 5KRSA 3CPEA 3NF6A 3MN9A 4AHTA 4Z94A 5BPNA 3T1AA 2WONA 4M7XA 1KTQA 3THXB 3RMCA 4BGBA 1Q8IA 3MEEA 5HLFA 4JI5K 2YHBA 2IGIA 3THWA 3PX0A 1QVFM 3CC2N 3M3ZA 4LC9B 3AVBA 1GLDG 4Z4HA 4DTOA 3V9SA 1EWRA 3CF5L 1NKBA 1HNIA 3CPWM 5GAGP 4AHUA 4A61A 4E19A 5IWAK 2QK9A 4CGHA 1NJIO 2DY4A 1T44A 3RMDA 4M63C 3LDPA 1VQON 1J5EK 2O8FA 1S5JA 1NJWA 5CY4A 3W3DA 4BE1A 1MA9B 3TTFA 4F2SA 3SJHA 3MN5A 5EOYA 4CEEA 4CGIA 2E2NA 3OYNA 2O8BB 3NBPA 4CF8A 4FWOA 1K8KA 1V4SA 3EE8A 4BY9C 4KB1A 4E0DA 4KTWA 1HYVA 3F9MA 1VHXA 1RNHA 1C1BA 1NMNA 3BGRA 5FROA 1VRTA 1FW6A 4B1YB 4KFBA 1KFSA 4PWDA 1NGJA 1ZBSA 2P9IB 3A5MC 3H1VX 5JICA 3IUCA 1R0AA 3VF6A 4DHYA 3NH0A 3CQ8A 3G0ZA 1RTIA 5AR0A 4Z4CA 4H0VB 4AHVA 4LF6K 3VQ5A 4BRPA 1L5UA 3RVCA 4IBNA 3ZSVA 1HKBA 3O4WA 1JLCA 1MWMA 3B6OA 3AVHA 1S6QA 2NRHA 3TAFA 3EL2A 3BP8A 1TK5A 2ZD1A 3ZX3A 4L8RB 1LCUA 3NH2A 3VN5A 5AQVA 3U3YA 3RR8A 4OGCA 1S1XA 4BE0A 1RDDA 3VMFB 4DU4A 1S9GA 2ZJPL 1LOTB 3OS0A 1U49A 1WLJA 4CJEA 3K58A 3TARA 2HNDA 5J1EA 4B9VA 5EY4A 3EN9A 1QZ5A 3DLEA 1YI2N 4OKEA 4X62K 2YHAA 2GEMA 4FW1A 3LWLA 1ASUA 4DSLA 1NJXA 4JI2K 2A3ZA 1IO2A 3WUHA 1YF5L 3QEWA 4Q0BA 3HPHA 2O8DB 2D5RA 3J7YP 3OYMA 2X78A 1BISA 4FYDA 4FWRA 2FBYA 1JJ2M 4B3RK 3MX2A 4BR9A 4O0IA 3QEIA 5J2MA 1NU0A 1Q86O 1TKTA 3GL1A 5HOOA 4LFCK 4DSFA 2F7TA 3SBTA 5CZ1A 5GIOA 2QXFA 3RRHA 2P9SB 2QA4N 2BE2A 4RW6A 4KHUA 2YV0X 3L2UA 2RE2A 3A0IX 1U04A 5C10A 3TSQA 3LP0A 3WEEB 4BRLA 2IDOA 2PFUA 3OY9A 1OH6A 4MO5A 1BO5O 4BR2A 2OPSA 3D2FA 1RDCA 4KHWA 2YX6A 3MDQA 3QBXA 3SK3A 4WFBL 4DSIA 4QS9A 5FRMA 4FLUA 3LDOA 3SAGA 3D7EO 2OYQA 3AO5A 4CHOA 1CZAN 3LM2A 2E2QA 4F4KA 3TAQA 2FBXA 2QWNA 1GOCA 1HKGA 3CFPA 4FCYA 3V9ZA 3PLAA 5AQSA 3MEGA 3NVMA 4W5TA 1ATRA 2NRZA 2P5GA 3WXKA 4MFBA 2EWSA 4WE1A 3EEQA 1RT6A 3LZIA 3KWGA 3OJUA 4E7HA 1Z05A 1N6QA 3NF9A 4GNIA 3VQ4A 1C0TA 1OH5A 3Q7BA 1QVGM 1HJOA 1XWLA 1NKCA 5AZIA 3AAQA 1KXPA 4JKAA 4CFAA 1JLQA 1EP4A 2B6AA 1HQUA 3W0LA 3QERA 3SQ0A 3O8MA 4JD2A 2Z1HA 2KFZA 3CJAA 3M5RA 3ATVA 1NK6A 5AQIA 3L3VA 2OZMA 4B1WB 4M3XA 2FF3B 2F4VK 5SWMA 5M1PA 1RT4A 2HNZA 4JKHA 4OPJA 4CJRA 5LMUK 2QWLA 3PSFA 4KKOA 3T1YK 4OO1J 1JCGA 1ATNA 3I55N 3ALYA 3O6WA 5F0XA 1NK9A 5KQDA 2QTDA 2F9WA 4JKBA 4A5BA 2Q2RA 4BREA 3S9HA 3N4QA 4EZ9A 1RDBA 3O9UA 4YDUA 1QZ6A 1R59O 4A5AA 3AO1A 3TU5A 2A42A 1TKDA 4DLGA 5DMRA 1GLLO 1Q81O 4QS8A 4O5FA 3TI0A 4EAHD 5H1SQ 1JLEA 4YOUA 4JI7K 4M3UA 1K9MO 1BL3A 1BQMA 3IFRA 4HUFA 1SUQA 4PA1A 4Y1DA 1VSEA 4H5RA 3FZHA 4FJHA 4WQ5C 3AA4A 3VERA 4BC2A 1Z25A 4B9TA 3SUNA 4BRCA 2Q97A 3ENHA 5KPTA 4WFAL 2YHWA 4K8ZA 1E3MA 1VQLN 4I7FA 4DTNA 3WQTA 1RT3A 4Z0UA 3RWUA 3CQXA 3VEOA 2UUBK 3TAPA 4AHSA 3DAWA 3C0BA 4BWJA 4LSNA 4W5QA 4IOXA 4DG1A 3CCEN 3E01A 2GUIA 3P39A 1QSYA 4UQGA 1X1PA 2DFHA 4FLWA 3O4QA 3F2KA 1S22A 3K5OA 5AQYA 3SI6A 3K9KA 4IO9L 4CJSA 4JK9A 2YJEA 3NDKA 3SV4A 5E41A 1NK7A 1XHXA 2NUBA 5GINA 1YTAA 2ZGZA 4BR0A 3QBWA 3HT3A 4CE9A 1KAYA 4X65K 1N32K 3WT0A 2QXLA 4ILJA 4CFCA 3WXJA 1JKHA 2W6LA 2ITMA 2DTUA 1C1CA 4DTSA 3RSEB 4OKKA 1RBVA 5CYQA 1IBLK 1T6DA 5C12A 3ASMA 3B6PA 5BR9A 2I7PA 3I8DA 3BZKA 1ATSA 4AH9A 2E2PA 2RF2A 3C95A 4J2DA 3MEDA 3RMBA 3THYA 5HRRA 2DPNA 1HYZA 1KCFA 3OBWA 2Q3SA 3E9PA 3D6RA 4B1UB 3L2QA 4PL7A 5BN9A 1BUPA 5AQHA 4JKGB 3HSTB 3ULEB 2P9UB 4PKIA 4E1NA 4DR4K 1EO1A 4C8MA 4F3TA 3O9SA 4B08A 3HVRA 1WSGA 4PKGA 3DLHA 4K25A 4DQRA 4FXDA 4PKHA 2A5XA 5BRHA 4A2BA 1YJNN 3NMUA 4YY3K 1ZBFA 4ZTFA 1TYQA 3UIQA 4WQ4A 4KI6A 4CBWA 4JLHA 2A6AA 2HVHA 2F8SA 4MQ3A 5AQQA 3MCAB 4FM1A 3MXMA 3C6AA 4MDAA 3AVIA 3PIPL 1X9MA 1NGBA 3HP9A 1ZC6A 2RPIA 1NGFA 4H0XB 5JVGL 2QEXN 4BG9A 3CFOA 4YHHK 3L4QA 3GOIA 4R5PA 3VTHA 3AA3A 1NM1A 1VQ4N 3THXA 1KVCA 3IMXA 5KQ8A 3FZMA 3ZEUB 2KKZA 3LP1A 1ZBHA 4B1ZA 4DSKA 3VQAA 4DCHA 2JGUA 3JAMO 5KGXA 4FLVA 4FJ9A 4K8XA 2JWLA 3ULDA 3DLRA 3QFUA 1FKPA 3CCMN 3U4LA 3VQCA 1ASWA 1XQSC 4H0TB 4JI4K 4CJ7A 2NRVA 2OCEA 5C24A 2NRTA 4EHTA 1IKWA 2IC3A 4BRMA 4IFVA 1ESVA 3AVMA 1QHTA 2XY7A 4I2QA 4XH1A 3E1YA 2PBDA 2CGLA 3SUPA 3O1WA 4O44A 3KJVA 1RBUA 3DRRA 1IKYA 4B1VA 3CJ1A 2YJFA 3EZWA 4EP4A 5FPMA 3RR7A 1TUUA 3N4PA 3CCLN 4CIGA 4AQYK 2VWBA 3ZT0A 3HXMA 4DV5K 4KTZA 1X3MA 3VF4A 2A1RA 3TTDA 4Z4FA 3ZETB 5HP1A 4IWVA 5I3UA 1YAGA 4FL9A 1K8AO 1BU6O 5BN8A 1WBBA 1W9HA 3TSPA 4KPYA 3V1RA 3AGKA 2P9IA 4IEEA 3HPGA 4C8KA 5FLXO 3V9UA 1NK8A 1LWEA 3ZT4A 3VQDA 4CEDA 5GADP 2IOCA 3O3GA 3K57A 3FZFA 4CJTA 4EIAA 1YITN 3QETA 3MK6A 2BANA 3U9ZA 4BROA 1K73O 4E89A 2HHHK 4DR3K 4BC4A 2HF3A 3D0PA 2VGMA 5J2PA 2GV9A 3L6QA 4FO0A 4KHNA 4DQPA 2I7NA 4FJKA 1JXEA 3FZKA 1RDUA 4JHDB 3AVLA 3H45C 4CFBA 1ITGA 5GIPA 4ID1A 1HYSA 2O8CB 4YOVA 3AVKA 3G71N 5T7BA 2OPPA 3EO3A 1JXBA 2QM1A 4CEFA 1RTHA 3VEXA 2OANA 3OYLA 5EXWA 2OTJN 3KHYA 4K0KK 4G1QA 2NLXA 1KVBA 3T19A 5JMVA 2YHYA 4LF5K 1U2VB 4YFUA 3LANA 2O4GA 2AP1A 1NGEA 2UYTA 4OGEA 5SZTA 2HHUA 1XC3A 4NCAA 1LWFA 4KRFA 5AQZA 1VSMA 3ZT1A 4LF9K 2HHTA 4AHRA 2KQ2A 2AA4A 3IAYA 2O8DA 3V1QA 3DLBA 4RW8A 4H4OA 1X9SA 3FZLA 1YVUA 4A2AA 2NRWA 4DV4K 1VQMN 3QNNA 2ZWHA 3IDHA 2LSNA 4DV2K 1DEJA 1I3AA 1D8YA 4J2AA 1BCMA 3C65A 4DR6K 4IG3A 3SAHA 4B9LA 1DTTA 3CC7N 2Q31A 3MECA 5I42A 3H46O 2P9SA 2KFNA 4IZ9A 3TTCA 3OA9A 4N41A 4FJ8A 4C1NK 4NXMK 2ZE2A 4KREA 4V19S 2R7YA 3D2EB 4BRAA 3WEEA 3SBGA 5JLHA 4HTUA 1TKZA 2UU9K 2ASPA 2YNGA 3C6HA 5AQRA 1KQSM 2YCHA 1KLMA 4DU1A 3DJCA 1YXQA 4LFAK 2HVIA 2HB5A 1O13A 3MXJA 2PYLA 3VOVA 4GV6A 3ITHA 3VQQA 2YNHA 2HBJA 3SYZA 1A5WA 3VEZA 4CESA 4CCHA 5M1FA 1I39A 3M8SA 1TAQA 3J7ZO 3I33A 2W41A 3A2FA 4CERA 1C0GA 3C7NB 3L2VA 2QWOA 1QS4A 1VQ5N 3O9RA 3SQ4A 3S41A 4LD0A 3QMLA 3RMAA 3UKRA 4FWSA 4NLBA 2E1YA 2IVNA 4FW2A 3VQBA 3AGRA 3IG1A 4FK0A 2XO7A 1REVA 1HMVA 3ATUA 4CHNA 2XRIA 2GELA 3ZSRA 1IV0A 5FDLA 1CZ9A 3G4SN 1TL3A 1LW2A 2BGGA 5AQXA 4BWMA 4LF8K 5CE3A 4N76A 2QWPA 3A5NC 1C6VA 2F8TA 2Q36A 1GLFO 5D3GA 3CJCA 3M8QA 3ZT2A 1XC9A 5JLFA 4JKDA 1X3NA 2Z1JA 4CZKA 3ZSYA 4ISEA 3CCQN 3KVGA 2QW9A 4FWKA 2OZSA 2O8FB 1KVAA 1UOCA 3SAFA 2OPQA 1QQMA 3OW2M 3WXIA 2QI2A 3NVKA 1WSFA 3LM9A 2FBTA 3HBTA 5HRSA 1YT3A 1VSFA 4CIFA 1OVQA 2F96A 1K8KB 4A59A 4CEZA 2XHBA 3P4IA 3TAMA 2HHQA 5KI6A 4GKJK 3QO9A 2ETJA 2GTDA 1VSDA 4GVEA 4BRHA 4CK2A 4KBOA 2Y1JA 1WNSA 3H3OB 3LDSA 5C2DA 4DQQA 3OYAA 2W6KA 1HNZK 1QQCA 3VEVA 4M3YA 4E7LA 1L3UA 1EETA 2QWQA 1NK5A 5BRFA 2HHSA 4M42A 3OYKA 1IBMK 4TSXA 1D9DA 1VQ9N 3QNOA 1DT9A 2IAJA 2Q0RA 4CJLA 1W7AA 3ZT3A 2G8UA 2HNYA 3AVFA 3S3OA 3T3FA 1QSSA 1NGAA 3L8BA 3PY8A 1KAZA 2NRRA 1QQNA 2P9LA 3H6EA 4NYNA 4CK3A 3HVTA 3ISNC 1P90A 4IG0A 3LP2A 4QAGA 3HO1A 3KLEA 4KTQA 1SKSA 3DXKA 5K14A 3QEPA 1J54A 4J2BA 1DLOA 4B3MK 3EKSA 1GOAA 2NRXA 1RTDA 4KAZA 3BUZB 4FSVA 5J2QA 4DV3K 1L3SA 2KLAA 4HWIA 1NGDA 4LF4K 2WTUA 2D1KA 3WNHA 3K5NA 2D0PA 3G10A 2H3GX 4GV9A 4I9LA 3U8XA 1J53A 5ADXA 2P9KA 2XY8A 2I5JA 4DS5A 1W0HA 1ASVA 1CLQA 1BHLA 4EHUA 2VWJA 3WXLA 1WSEA 3L2WA 1ZBLA 3FFIA 3E9OA 2HBKA 3QEVA 4B9QA 3CM5A 3V9WA 3DRSA 2E6LA 4U67L 4CJKA 4M45A 1CXUA 2BTFA 3MWTA 1N5YA 1SKRA 2E88A 1NOZA 2A1SA 3CQYA 1T7PA 5KGWA 4CJ5A 2UXBK 4CF2A 4F3OA 3M8PA 1BDGA 4NB4A 3PV8A 4JKGA 4KV8A 2P9UA 3QESA 1GLAG 4FJ7A 1V4TA 3LDNA 1XI1A 2PAVA 3LL3A 2VGNA 4BDZA 2ZF5O 5BREA 1BA1A 5HRNA 1J5OA 1NJZA 4CFDA 2P9NA 3D2FB 2W40A 4FJ5A 4IKFA 4B8CA 1S72N 3CJ9A 2CGKA 3CERA 4I6MA 3WNEA 3OTOK 2VWKA 3WQUA 4JYAK 3CYMA 1ZBIA 2UXCK 1D4XA 3HPOA 3KD1E 1B9FA 4GW6A 1CXQA 3K0SA 3CG7A 3C6TA 1BCOA 3NCIA 4DQSA 5HROA 4DB3A 2QWMA 1YJWN 4FZYA 3GG4A 3VQEA 1G99A 3R1XA 2Z1IA 3CM6A 4PQUA 4QS7A 5AQUA 5AQMA 1YTUA 3TR8A 3RRGA 3O1BA 1SZ2A 2D4WA 3C94A 3KLGA 3DRPA 2UUAK 3VENA 1JLBA 3I56N 4CJPA 2UUCK 3CJ7A 5KRTA 4H4MA 3CCRN 3AVNA 4JI8K 1YVNA 1F21A 5FPEA 4IOCL 5AFUA 4DTPA 5HL7L 5AZIB 1HNXK 3AVGA 1BI4B 1XMOK 1NGIA 3OVNA 4ELTA 4CHYA 3H3NO 4E1MA 2KW4A 3O9TA 1VQNN 2HHVA 3HOSA 4KH6A 4BRQA 3VQPA 4DWIA 1T6CA 2YNFA 3ZSQA 4JD2B 4C23A 4IOAL 3VEWA 5HRPA 1C0UA 4OJRA 2WUSA 4QOZB 4X66K 1NOYA 4BRKA 3ZSZA 3FGUA 1VQ6N 2RN2A 4M3WA 4DV6K 4CZHA 2O8EA 1TGOA 2YNIA 3HM9A 4PUOA 3ENOA 1ZXOA 2FBVA 4H0OA 3HP6A 2WFBA 3HJFA 1HLUA 1VSHA 1NNEA 3U6FA 1BGXT 4XH5A 3P83D 4WFNL 4KHSA 3ZSXA 4CIEA 1S6PA 4O55A 3KLIA 2ZM6K 2BH1A 3VQ6A 4EP5A 2G8FA 3V1OA 2DFEA 3EY1A 4CD1A 1L3VA 2YKMA 4CZGA 4G9ZA 3SJJA 1WSJA 3NFAA 4CGJA 2B5JA 2G8WA 3ZETA 1S3XA 4W5OA 3WXMB 5M1KA 4RG8A 2FC0A 3LALA 1VQ8N 2WOMA 1IH7A 1NWKA 1EWQA 4FWQA 1CZBA 4OX9K 2FLOA 2CGJA 4H0YB 1RT7A 4IDHA 3VGKA 1Q7YO 5AZJA 2P9PB 3IKMA 5C0YA 4LF7K 1HRHA 4KHPK 4FOEA 4CZJA 4HUGA 5M1OA 3MN7A 4CZIA 3VETA 4FVMA 4WYBA 4F9OA 1WSIA 1N8RO 1KRPA 3DYAA 1HUXA 4BVOA 4CBUA 2FXUA 4FJNA 5C2FA 2KTQA 2OA8A 3KD5E 4L3QA 4YOWA 4E3SA 3FLCO 4JRPA 1S1WA 1WB9A 4BDYA 5DM6L 3OYJA 4FLZA 4CJWA 4JKEA 3L0QA 4FWPA 1EX4A 3MWPA 4LFBK 4DKWA 1BIUA 1OVYA 4FJIA 2EHGA 1NGHA 3GE1A 3TSUA 1HR0K 4GV3A 3NE6A 4JNEA 1Q82O 1MDUB 4E7IA 4B8AB 1MU2A 3KKRA 4IFYA 3NH1A 1I94K 1RDWX 3PIOL 1OKJA 3SUOA 1RGIA 1U2VA 1RT2A 3VF2A 4OLBA 5JS2A 4I9QA 1Q9YA 1G15A 1VAZA 1E4FT 2HHXA 1KFDA 3K5LA 5CHIA 5AQNA 4DLEA 2QKBA 3O80A 3KLHA 3TANA 1EXQA 4DMNA 4O0JA 3DXMB 1XNRK 5GAHP 5DK5A 3SUQA 1RBTA 4CEOA 1M90O 1B9DA 4R79A 4ELUA 2A41A 4XH4A 1L3TA 2VG5A 1KD1O 2O8BA 4NYFA 2IVOA 4DTRA 5AJ3K 4BVPA 3V4IA 3THYB 3UB5A 4ELVA 2ITGA 1YIJN 2E6MA 4JKCA 2HBLA 3DWLA 2GWJA 3V81A 2V7YA 1LAVA 4OPKA 1RT1A 4CF1A 3I0RA 4DQ8A 5JVHL 3TAGA 1T3VA 3L2RA 4BR7A 5KPZA 5ADXH 3D2EA 1E4GT 2E8AA 3CIPA 3VESA 4O8UA 3CI5A 5FPDA 2PZSA 3AAPA 1RFQA 2GX9A 4H03B 4PL8A 4LSLA 4NXNK 1S1UA 4CZLA 1TYQB 3ZSOA 1RT5A 2D0AA 3AVJA 4H5VA 1YHQN 4DFPA 4U7BA 1OH7A 3CC4N 1JL1A 3VTIA 2XY6A 4ID5A 3T69A 1YJ9N 3QLHA 1RCHA 3JYTA 3CCVN 5BR8K 1SS6A 2F9TA 1ZBUA 4J2EA 4FJLA 5KTQA 1XUPO 2BUPA 3M6GA 4N56A 5TKWA 2JLEA 2PY5A 3TABA 4DTUA 2ASOA 4W5RA 4CGGA 3BF1A 1QHAA 4CGFA 1IJJA 5LMNK 4FM2A 4BR5A 3G6EN 1J6ZA 3HK2A 1W97L 1NLVA 3HTVA 4AHCA 2BDPA 2D0OA 3AO4A 4DV1K 5C15A 4O4GA 1XMQK 1C1AA 1UAXA 3E9LA 2XY5A 3JS6A 4B9MA 3THVA 1M1KO 3LAKA 2FSJA 5E26A 5FPNA 3D45A 4CHQA 3KZBA 4CZMA 1P8ZA 3PX4A 4DV7K 4FJMA 4CJ3A 3J81O 3PO4A 4FPBA 4JRQA 1BWFO 5HBMA 4PHTX 1NBWA 1GLEG 4WQ5A 3KIOA 5J2NA 1NKEA 3KTQA 4ZTJA 4DFKA 3O5BA 4F2RA 1RBRA 4DSJA 4BC5A 1QTMA 3KKSA 2RKIA 4H8KA 3SZ2A 1HX1A 3KLFA 1N33K 3QIOA 1O1WA 4M3TA 5IT9O 4KH5A 4Z4GA 3UKUB 4BR4A 1WUAA 5AFUH 1NG9A 1KAXA 3TPQA 3EE9A 4MLHA 4JI1K 3AY9A 3GBTA 3OYBA 2HOEA 4FK2A 3K5MA 1SL1A 3PSIA 1NJYA 1X9WA 3OBYA 3R6MA 4NCGA 3MN6A 4FJJA 2HF4A 3HZ6A 4ISGA 4JI3K 4OLAA 3EZ5A 1VQ7N 4IO8A 3P5JA 2CH6A 4RW9A 4YNQA 3EYZA 2NZTA 4AF1A 3K59A 1EKEA 1VSJA 4H5NA 1GLJO 4YOXA 1K6YA 3VPZA 1RDAA 2WBNA 4DR2K 3QICA 3P1GA 4KHYA 1QE1A 3KK1A 1VQPN 3J7AP 3TWHA 1H1VA 2J4RA 4CK1A 3S3NA 4CEQA 1HKCA 4DSEA 1W2BM 1VSKA 3NAEA 4FVUA 2KZMA 2IVPA 1GLBG 3A5LC 3SCXA 4DUZK 1T05A 4F8RA 3KWIA 4BACA 3SNNA 4MDBA 1FXXA 3LP3A 5MLCQ 2HW3A 1SV5A 3OYHA 3PX6A 3THWB 3G25A 1NMDA 4AM6A 1SL2A 5AQOA 1IG8A 3VQ8A 4CGDA 3V6DA 2VYPA 3E66A 2GWKA 3HRGA 2QKKA 3O08A 4WQ4C 4CJVA 2OTLN 2E2OA 4CZEA 4FJXA 1WAFA 2YI1A 3AVCA 2FSNA 3L4IA 2ZGYA 1RILA 3QFPA 4BRGA 3DOLA 3LPTA 5AQKA 3OJSA 3VGLA 4RTFD 3P38A 4CZFA 4C8LA 4DF4A 4H5TA 3HOTA 1TV6A 3NF7A 1J9AA 3JSMA 5E84A 4N5SA 3AV9A 4BRNA 5A2QO 3J8AA 3V9XA 4GMJB 4KHQA 4ILHA 3PUFA 4DR7K 1WSHA 1TUYA 3IS9A 2Y1IA 4AILC 3AA5X 4ICLA 4H0PA 5AQJA 4JI0K 4Z4EA 1DGKN 5KPRA 2GUPA 1JCEA 3SQ1A 3LWMA 1JLAA 1XNQK 4FLYA 2B4JA 4BGAA 3OYDA 4K43A 2EX3A 4CJQA 2UXDK 5TKYA
chains in the Genus database with same CATH topology
4C8OA 3CG7A 1WN7A 1TVRA 3LP1A 1ZBHA 1S5JA 3C6TA 1NJWA 1BCOA 5CY4A 3NCIA 4DQSA 5HROA 3VA3A 3SPZA 1LV5A 4DSKA 3VQ7A 4BE1A 3VQAA 4M3ZA 4FZYA 1HNVA 4DFMA 2JGUA 3VQEA 4F2SA 1U47A 2Z1IA 3CM6A 5KGXA 1U48A 4FLVA 4CEEA 4FJ9A 4CGIA 4PQUA 4K8XA 3OYNA 1YTUA 3ULDA 3DMJA 3NBPA 3TR8A 1LW0A 4CF8A 3RRGA 3DLRA 1FKPA 3C94A 3WNFA 3KLGA 3VQCA 3DRPA 4DTXA 1JLBA 1ASWA 4B9SA 4CJPA 1VK0A 4XIUA 3NGIA 4KB1A 4E0DA 2X74A 4KTWA 1HYVA 3AVAA 3MAQA 2HMIA 5KRTA 4H4MA 5JS1A 3AVNA 1RNHA 1F21A 5C24A 1C1BA 1IKWA 2IC3A 4DTPA 3BGRA 4IFVA 1VRTA 5FROA 3AVGA 3AVMA 4KFBA 1QHTA 2XY7A 2Z1GA 1BI4B 1KFSA 4I2QA 4PWDA 3OVNA 4ELTA 3SUPA 3VQ9A 4CHYA 3F9KA 4O44A 3KJVA 1RBUA 3DRRA 1IKYA 4C8NA 2KW4A 4E1MA 3DLGA 3RR7A 4EP4A 4KHSA 2HHVA 1R0AA 4DWIA 3VQPA 2HHWA 3NH0A 3CQ8A 4CF9A 3G0ZA 1VRUA 3U3GA 4CIGA 4DU3A 2YNFA 1RTIA 3ZSQA 4Z4CA 3ZT0A 4AHVA 5HRPA 1C0UA 1JLFA 4OJRA 4QOZB 3HXMA 3VQ5A 1SL0A 1L5UA 4KTZA 1NOYA 4FLXA 3ZSZA 2A1RA 4IBNA 2E4LA 2RN2A 2G8KA 4M3WA 4Z4FA 3ZSVA 5HP1A 1TGOA 5I3UA 2YNIA 3HM9A 1JLCA 3O3FA 4PUOA 4ZHRA 1W9HA 2FBVA 3B6OA 3K2PA 1BI4A 3AVHA 3HP6A 1S6QA 4KPYA 3V1RA 3HJFA 3TAFA 1TK5A 1VSHA 2ZD1A 3U6FA 4L8RB 1BGXT 3NH2A 3VN5A 3P83D 3HPGA 3U3YA 3ZSXA 4CIEA 4CEBA 1S6PA 4O55A 3KLIA 3RR8A 4C8KA 3NF8A 4OGCA 3QIPA 4Q5VA 3V9UA 1S1XA 3VQ6A 1LWEA 1RDDA 3ZT4A 4EP5A 3V1OA 2DFEA 3VQDA 4CEDA 3EY1A 4BE0A 1S9GA 2IOCA 3O3GA 3K57A 4CJTA 3OS0A 2YKMA 1U49A 1WLJA 4CJEA 1L3VA 4CECA 3QETA 3SJJA 1WSJA 3NFAA 4CGJA 3K58A 2BANA 2B5JA 3TARA 2HNDA 1U4BA 5J1EA 3DI6A 4B9VA 2G8WA 2OPRA 3I0SA 4CF0A 4E89A 4W5OA 4FK4A 2KZZA 3DLEA 3D0PA 4OKEA 2YHAA 4RG8A 5J2PA 2FC0A 2GV9A 3LALA 4FW1A 3LWLA 2WOMA 1FKOA 1ASUA 4LH5A 1IH7A 4B9UA 2VG6A 4KHNA 1HPZA 4DQPA 1CZBA 4OKJA 4FJKA 1JXEA 4DSLA 1RT7A 1NJXA 3AVLA 1IO2A 4CFBA 3QEWA 4Q0BA 1ITGA 3HPHA 1HRHA 4ID1A 1HYSA 2AJQA 2D5RA 3AO2A 3OYMA 3AVKA 2X78A 5T7BA 2OPPA 1BISA 1T03A 4CHZA 5CYMA 1JXBA 4CEFA 4HUGA 1NK4A 4FYDA 3QEXA 1RTHA 4FVMA 2FBYA 4O0IA 3QEIA 3AA2A 3OYLA 5J2MA 1TKTA 1WSIA 4DSFA 2VG7A 3I8DA 4G1QA 1KRPA 1HQEA 3ZSWA 4BDPA 1KVBA 3DYAA 3T19A 5CZ1A 4FJNA 2KTQA 2OA8A 2QXFA 3RRHA 3KD5E 4YFUA 3LANA 2O4GA 4E3SA 2BE2A 4RW6A 4KHUA 2YV0X 3L2UA 4OGEA 3OYFA 4JRPA 1S1WA 5SZTA 3NHGA 4BDYA 4NCAA 1LWFA 4BE2A 2HHUA 3OYJA 4FLZA 4KRFA 3ZT1A 1VSMA 1U04A 4CJWA 2HHTA 4AHRA 2KQ2A 3IAYA 3V1QA 3LP0A 1EX4A 1RTJA 1UWBA 3DLBA 4KO0A 4RW8A 4H4OA 1X9SA 3F73A 4DU4A 4NCBA 2IDOA 3OY9A 1YVUA 1RBSA 3QINA 4LY7A 1BIUA 3QNNA 4FJIA 4CEAA 2EHGA 4I2PA 2OPSA 2LSNA 1I3AA 1RDCA 3NE6A 1D8YA 4KB0A 4J2AA 4E7IA 4KHWA 1BCMA 4B8AB 1MU2A 3KKRA 4IFYA 4IG3A 5CZ2A 3OYIA 3NH1A 3VA0A 4B9LA 4DSIA 4DQIA 1DTTA 5FRMA 4FLUA 5I42A 3MECA 3SUOA 1RT2A 4W5NA 1JLGA 2OYQA 3AO5A 4CHOA 5JS2A 4I9QA 4OLBA 1Q9YA 2KFNA 3HYFA 1G15A 4DFJA 2HHXA 4F4KA 3TAQA 1KFDA 3WNGA 2FBXA 3K5LA 4N41A 1HJRA 2W42A 4FJ8A 1GOCA 4DLEA 2G8FA 2ZE2A 2QKBA 3CFPA 2G8VA 3KLHA 2R7YA 1EXQA 4DMNA 4FCYA 4O0JA 3V9ZA 3TANA 4CJUA 3MXIA 5DK5A 3SUQA 1RBTA 4CEOA 1B9DA 3MEGA 4W5TA 4HTUA 1TKZA 4B3OA 2YNGA 2P5OA 4ELUA 3LPUA 2P5GA 1Q9XA 4MFBA 4WE1A 1L3TA 1QSLA 2VG5A 1KLMA 4DU1A 1RT6A 3LZIA 4NYFA 3OJUA 4E7HA 1N6QA 1C0MA 3KK2A 2HVIA 4DTRA 3NF9A 2HB5A 3MXJA 2PYLA 3V4IA 3VQ4A 3LZJA 1C0TA 3ITHA 4ELVA 2ITGA 3VQQA 2E6MA 2YNHA 3SYZA 1A5WA 1T8EA 4CESA 4CCHA 3V81A 1I39A 1TL1A 1LAVA 1XWLA 3M8SA 1NKCA 4OPKA 1RT1A 4B9NA 1TAQA 4CF1A 3I0RA 1IKVA 3A2FA 3TAGA 3L2RA 3HL8A 4CERA 4CFAA 3OYCA 3L2VA 1JLQA 4FM0A 1EP4A 1QS4A 2D0BA 4IDKA 4QCLA 2B6AA 2PZSA 3DOKA 1HQUA 4FZZA 3SQ4A 4M41A 1TK8A 4DTJA 3QERA 3SQ0A 4LD0A 4PY5A 3RMAA 4FW2A 3O4NA 4LSLA 2Z1HA 2KFZA 1S1UA 4Y1CA 3VQBA 4KI4A 3C6UA 3ZSOA 1RT5A 2D0AA 1D5AA 3AVJA 3IG1A 4LH4A 1NK6A 4FK0A 2XO7A 3L3VA 2OZMA 1REVA 1HMVA 4DFPA 4CHNA 2XRIA 4M3XA 1JL1A 2XY6A 1S9EA 4ID5A 5SWMA 4DF8A 3QLHA 3ZSRA 1RCHA 5FDLA 3JYTA 1CZ9A 1TL3A 3SV3A 3S3MA 1LW2A 2G8HA 2BGGA 3DLKA 4BWMA 4N76A 1ZBUA 1RT4A 2HNZA 4OPJA 4CJRA 4J2EA 1Y97A 3ZCMA 4KKOA 4FJLA 3CFRA 4HVJA 5KTQA 1TAUA 1C6VA 2G8IA 3ALYA 2F8TA 1BQNA 1NK9A 4N56A 5D3GA 3M8QA 3ZT2A 1Z26A 3O3HA 1XC9A 2JLEA 2DFFA 2PY5A 3TABA 3S9HA 4DTUA 1LAWA 4EZ9A 1KSPA 2ATQA 4GW6A 3OS2A 1RDBA 4W5RA 4DTMA 4CGGA 3AO1A 2Z1JA 4JS5A 3ZSYA 1TKDA 4CGFA 4DLGA 5DMRA 4FLTA 3S3NA 4FM2A 1NK8A 3SQ2A 2OZSA 1KVAA 1WAJA 1S1VA 1UOCA 3TI0A 3HK2A 1JLEA 3H08A 4AHCA 4M3UA 2BDPA 2OPQA 1BL3A 3AO4A 1BQMA 4O4GA 1C1AA 1WSFA 1UAXA 2XY5A 2FBTA 4RW7A 4HUFA 1SUQA 1IKXA 4PA1A 4B9MA 5HRSA 3THVA 2ZQBA 1IG9A 4Y1DA 1YT3A 1VSEA 1ZYQA 1VSFA 4CIFA 3LAKA 3SPYA 3KK3A 3DM2A 2F96A 3D45A 4E7KA 4FJHA 4CHQA 3AA4A 4CEZA 2XHBA 3TAMA 1Z25A 3PX4A 5KI6A 4B9TA 4CJ3A 3SUNA 3QO9A 2ETJA 5C42A 4FJMA 1VSDA 1A5VA 3RTVA 3PO4A 2YKNA 4JRQA 5HBMA 4K8ZA 4CK2A 2Y1JA 1WNSA 3KIOA 5J2NA 4I7FA 4DTNA 1NKEA 3LDSA 3KTQA 1RT3A 4ZTJA 4Z4IA 4DQQA 3OYEA 4Z0UA 4DFKA 3OYAA 1XHZA 4F2RA 1RBRA 3RWUA 1QQCA 3TAPA 4AHSA 4DSJA 4HCCA 4M3YA 1LWCA 4LSNA 4BWJA 1QTMA 4W5QA 3KKSA 2RKIA 4E7LA 4H8KA 1EETA 4DG1A 1L3UA 1NK5A 2HHSA 3SZ2A 3E01A 2GUIA 4CHPA 3KLFA 4M42A 3QIOA 1O1WA 4M3RA 4TSXA 3OYKA 1D9DA 4M3TA 4HHTA 1QSYA 4Z4GA 4UQGA 1X1PA 2DFHA 2GBZA 4GVMA 4FLWA 3QNOA 2P51A 3O4QA 1BIZA 1TK0A 2IAJA 3K5OA 4JS4A 4N47A 4CJLA 3SI6A 3ZT3A 1UA0A 2G8UA 4CJSA 3AO3A 2HNYA 3AVFA 3OYBA 3S3OA 3T3FA 3BDPA 3NDKA 3SV4A 1QSSA 5E41A 3K5MA 1SL1A 4FK2A 1NJYA 1NK7A 1X9WA 2O4IA 1B92A 1XHXA 2NUBA 3L8BA 4NCGA 3PY8A 1YTAA 2PYJA 4CK3A 4NYNA 3TAEA 3HVTA 3HT3A 4FJJA 3ISNC 4CE9A 1NK0A 4IG0A 3LP2A 4QAGA 5EU7A 4OLAA 1A5XA 3HO1A 3KLEA 3EZ5A 4KTQA 3P5JA 1SKSA 2HHQA 2X6SA 5K14A 1VSIA 4HUEA 4DS4A 1U45A 3LAMA 4RW9A 1VSLA 4YNQA 3QEPA 1S1TA 1J54A 1D9FA 3EYZA 4CFCA 4J2BA 1DTQA 1DLOA 1JKHA 3K59A 1EKEA 1VSJA 2DTUA 1C1CA 1GOAA 4DTSA 1RTDA 4KAZA 1FK9A 4OKKA 5J2QA 4EZ6A 5C25A 1L3SA 1RBVA 1K6YA 5CYQA 1RDAA 3P1GA 3NGZA 4KHYA 1QE1A 3KK1A 3ASMA 3B6PA 4E7JA 3TWHA 3WNHA 1JL2A 3K5NA 3G10A 3IRXA 4AH9A 2D0CA 4I9LA 4RW4A 4CEQA 2RF2A 3L3UA 3C95A 4CK1A 4DSEA 1J53A 1SKWA 4J2DA 2XY8A 3MEDA 2I5JA 1VSKA 3RMBA 4CJ4A 4DS5A 5HRRA 3NAEA 1W0HA 2KZMA 3PO5A 1HYZA 2IS3A 1TKXA 4CJFA 1ASVA 1KCFA 3SCXA 1KLNA 2Q3SA 1T05A 1CLQA 4F8RA 1BHLA 2VWJA 5FRNA 3L2QA 4FZXC 4BACA 1WSEA 3SNNA 1FXXA 3LP3A 3OS1A 3L2WA 2HW3A 3OYGA 1SV5A 2P1JA 3HSTB 3OYHA 3PX6A 4E1NA 1ZBLA 1UA1A 4FJGA 3FFIA 4C8MA 3M8RA 4F3TA 1SL2A 4B08A 3HVRA 1WSGA 4O5BA 4HCBA 3QEVA 3DLHA 3VQ8A 3CM5A 4CGDA 1GOBA 3V9WA 4DQRA 3V6DA 3DRSA 4FXDA 2QKKA 2E6LA 2X6NA 4CJVA 4CJKA 4FJXA 4M45A 1CXUA 1WAFA 4OVLA 1ZBFA 4ZTFA 3NGYA 5KRSA 3AVCA 3NF6A 4AHTA 3T1AA 2WONA 1N5YA 3UIQA 1KTQA 1RILA 1SKRA 4KI6A 3DOLA 1NOZA 3LPTA 4JLHA 3OJSA 2A1SA 2HVHA 1T7PA 2F8SA 3RMCA 5KGWA 4MQ3A 4CJ5A 4C8LA 4DF4A 4CF2A 1Q8IA 4FM1A 4F3OA 3M8PA 1TV6A 3MEEA 5HLFA 3NF7A 3MXMA 1J9AA 3JSMA 4KV8A 3PV8A 4N5SA 3AV9A 2YHBA 2IGIA 3V9XA 3AVIA 4GMJB 4KHQA 3QESA 1X9MA 4FJ7A 3PX0A 1XI1A 3PUFA 1WSHA 3IS9A 3AVBA 3HP9A 4BDZA 2Y1IA 4AILC 2RPIA 5HRNA 1J5OA 4KREA 4Z4HA 4DTOA 1NJZA 3AA5X 3V9SA 4CFDA 1NKBA 4FJ5A 4ICLA 4IKFA 1HNIA 4B8CA 3CFOA 4R5PA 4Z4EA 3AA3A 4AHUA 4E19A 3WNEA 3SQ1A 1KVCA 3LWMA 1JLAA 2VWKA 2QK9A 4FLYA 2B4JA 3OYDA 4CGHA 2EX3A 4CJQA 3CYMA 1ZBIA 2DY4A 3HPOA 3RMDA 3KD1E 1B9FA 1CXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8O A;  3CG7 A;  1WN7 A;  1TVR A;  3LP1 A;  1ZBH A;  1S5J A;  3C6T A;  1NJW A;  1BCO A;  5CY4 A;  3NCI A;  4DQS A;  5HRO A;  3VA3 A;  3SPZ A;  1LV5 A;  4DSK A;  3VQ7 A;  4BE1 A;  3VQA A;  4M3Z A;  4FZY A;  1HNV A;  4DFM A;  2JGU A;  3VQE A;  4F2S A;  1U47 A;  2Z1I A;  3CM6 A;  5KGX A;  1U48 A;  4FLV A;  4CEE A;  4FJ9 A;  4CGI A;  4PQU A;  4K8X A;  3OYN A;  1YTU A;  3ULD A;  3DMJ A;  3NBP A;  3TR8 A;  1LW0 A;  4CF8 A;  3RRG A;  3DLR A;  1FKP A;  3C94 A;  3WNF A;  3KLG A;  3VQC A;  3DRP A;  4DTX A;  1JLB A;  1ASW A;  4B9S A;  4CJP A;  1VK0 A;  4XIU A;  3NGI A;  4KB1 A;  4E0D A;  2X74 A;  4KTW A;  1HYV A;  3AVA A;  3MAQ A;  2HMI A;  5KRT A;  4H4M A;  5JS1 A;  3AVN A;  1RNH A;  1F21 A;  5C24 A;  1C1B A;  1IKW A;  2IC3 A;  4DTP A;  3BGR A;  4IFV A;  1VRT A;  5FRO A;  3AVG A;  3AVM A;  4KFB A;  1QHT A;  2XY7 A;  2Z1G A;  1BI4 B;  1KFS A;  4I2Q A;  4PWD A;  3OVN A;  4ELT A;  3SUP A;  3VQ9 A;  4CHY A;  3F9K A;  4O44 A;  3KJV A;  1RBU A;  3DRR A;  1IKY A;  4C8N A;  2KW4 A;  4E1M A;  3DLG A;  3RR7 A;  4EP4 A;  4KHS A;  2HHV A;  1R0A A;  4DWI A;  3VQP A;  2HHW A;  3NH0 A;  3CQ8 A;  4CF9 A;  3G0Z A;  1VRU A;  3U3G A;  4CIG A;  4DU3 A;  2YNF A;  1RTI A;  3ZSQ A;  4Z4C A;  3ZT0 A;  4AHV A;  5HRP A;  1C0U A;  1JLF A;  4OJR A;  4QOZ B;  3HXM A;  3VQ5 A;  1SL0 A;  1L5U A;  4KTZ A;  1NOY A;  4FLX A;  3ZSZ A;  2A1R A;  4IBN A;  2E4L A;  2RN2 A;  2G8K A;  4M3W A;  4Z4F A;  3ZSV A;  5HP1 A;  1TGO A;  5I3U A;  2YNI A;  3HM9 A;  1JLC A;  3O3F A;  4PUO A;  4ZHR A;  1W9H A;  2FBV A;  3B6O A;  3K2P A;  1BI4 A;  3AVH A;  3HP6 A;  1S6Q A;  4KPY A;  3V1R A;  3HJF A;  3TAF A;  1TK5 A;  1VSH A;  2ZD1 A;  3U6F A;  4L8R B;  1BGX T;  3NH2 A;  3VN5 A;  3P83 D;  3HPG A;  3U3Y A;  3ZSX A;  4CIE A;  4CEB A;  1S6P A;  4O55 A;  3KLI A;  3RR8 A;  4C8K A;  3NF8 A;  4OGC A;  3QIP A;  4Q5V A;  3V9U A;  1S1X A;  3VQ6 A;  1LWE A;  1RDD A;  3ZT4 A;  4EP5 A;  3V1O A;  2DFE A;  3VQD A;  4CED A;  3EY1 A;  4BE0 A;  1S9G A;  2IOC A;  3O3G A;  3K57 A;  4CJT A;  3OS0 A;  2YKM A;  1U49 A;  1WLJ A;  4CJE A;  1L3V A;  4CEC A;  3QET A;  3SJJ A;  1WSJ A;  3NFA A;  4CGJ A;  3K58 A;  2BAN A;  2B5J A;  3TAR A;  2HND A;  1U4B A;  5J1E A;  3DI6 A;  4B9V A;  2G8W A;  2OPR A;  3I0S A;  4CF0 A;  4E89 A;  4W5O A;  4FK4 A;  2KZZ A;  3DLE A;  3D0P A;  4OKE A;  2YHA A;  4RG8 A;  5J2P A;  2FC0 A;  2GV9 A;  3LAL A;  4FW1 A;  3LWL A;  2WOM A;  1FKO A;  1ASU A;  4LH5 A;  1IH7 A;  4B9U A;  2VG6 A;  4KHN A;  1HPZ A;  4DQP A;  1CZB A;  4OKJ A;  4FJK A;  1JXE A;  4DSL A;  1RT7 A;  1NJX A;  3AVL A;  1IO2 A;  4CFB A;  3QEW A;  4Q0B A;  1ITG A;  3HPH A;  1HRH A;  4ID1 A;  1HYS A;  2AJQ A;  2D5R A;  3AO2 A;  3OYM A;  3AVK A;  2X78 A;  5T7B A;  2OPP A;  1BIS A;  1T03 A;  4CHZ A;  5CYM A;  1JXB A;  4CEF A;  4HUG A;  1NK4 A;  4FYD A;  3QEX A;  1RTH A;  4FVM A;  2FBY A;  4O0I A;  3QEI A;  3AA2 A;  3OYL A;  5J2M A;  1TKT A;  1WSI A;  4DSF A;  2VG7 A;  3I8D A;  4G1Q A;  1KRP A;  1HQE A;  3ZSW A;  4BDP A;  1KVB A;  3DYA A;  3T19 A;  5CZ1 A;  4FJN A;  2KTQ A;  2OA8 A;  2QXF A;  3RRH A;  3KD5 E;  4YFU A;  3LAN A;  2O4G A;  4E3S A;  2BE2 A;  4RW6 A;  4KHU A;  2YV0 X;  3L2U A;  4OGE A;  3OYF A;  4JRP A;  1S1W A;  5SZT A;  3NHG A;  4BDY A;  4NCA A;  1LWF A;  4BE2 A;  2HHU A;  3OYJ A;  4FLZ A;  4KRF A;  3ZT1 A;  1VSM A;  1U04 A;  4CJW A;  2HHT A;  4AHR A;  2KQ2 A;  3IAY A;  3V1Q A;  3LP0 A;  1EX4 A;  1RTJ A;  1UWB A;  3DLB A;  4KO0 A;  4RW8 A;  4H4O A;  1X9S A;  3F73 A;  4DU4 A;  4NCB A;  2IDO A;  3OY9 A;  1YVU A;  1RBS A;  3QIN A;  4LY7 A;  1BIU A;  3QNN A;  4FJI A;  4CEA A;  2EHG A;  4I2P A;  2OPS A;  2LSN A;  1I3A A;  1RDC A;  3NE6 A;  1D8Y A;  4KB0 A;  4J2A A;  4E7I A;  4KHW A;  1BCM A;  4B8A B;  1MU2 A;  3KKR A;  4IFY A;  4IG3 A;  5CZ2 A;  3OYI A;  3NH1 A;  3VA0 A;  4B9L A;  4DSI A;  4DQI A;  1DTT A;  5FRM A;  4FLU A;  5I42 A;  3MEC A;  3SUO A;  1RT2 A;  4W5N A;  1JLG A;  2OYQ A;  3AO5 A;  4CHO A;  5JS2 A;  4I9Q A;  4OLB A;  1Q9Y A;  2KFN A;  3HYF A;  1G15 A;  4DFJ A;  2HHX A;  4F4K A;  3TAQ A;  1KFD A;  3WNG A;  2FBX A;  3K5L A;  4N41 A;  1HJR A;  2W42 A;  4FJ8 A;  1GOC A;  4DLE A;  2G8F A;  2ZE2 A;  2QKB A;  3CFP A;  2G8V A;  3KLH A;  2R7Y A;  1EXQ A;  4DMN A;  4FCY A;  4O0J A;  3V9Z A;  3TAN A;  4CJU A;  3MXI A;  5DK5 A;  3SUQ A;  1RBT A;  4CEO A;  1B9D A;  3MEG A;  4W5T A;  4HTU A;  1TKZ A;  4B3O A;  2YNG A;  2P5O A;  4ELU A;  3LPU A;  2P5G A;  1Q9X A;  4MFB A;  4WE1 A;  1L3T A;  1QSL A;  2VG5 A;  1KLM A;  4DU1 A;  1RT6 A;  3LZI A;  4NYF A;  3OJU A;  4E7H A;  1N6Q A;  1C0M A;  3KK2 A;  2HVI A;  4DTR A;  3NF9 A;  2HB5 A;  3MXJ A;  2PYL A;  3V4I A;  3VQ4 A;  3LZJ A;  1C0T A;  3ITH A;  4ELV A;  2ITG A;  3VQQ A;  2E6M A;  2YNH A;  3SYZ A;  1A5W A;  1T8E A;  4CES A;  4CCH A;  3V81 A;  1I39 A;  1TL1 A;  1LAV A;  1XWL A;  3M8S A;  1NKC A;  4OPK A;  1RT1 A;  4B9N A;  1TAQ A;  4CF1 A;  3I0R A;  1IKV A;  3A2F A;  3TAG A;  3L2R A;  3HL8 A;  4CER A;  4CFA A;  3OYC A;  3L2V A;  1JLQ A;  4FM0 A;  1EP4 A;  1QS4 A;  2D0B A;  4IDK A;  4QCL A;  2B6A A;  2PZS A;  3DOK A;  1HQU A;  4FZZ A;  3SQ4 A;  4M41 A;  1TK8 A;  4DTJ A;  3QER A;  3SQ0 A;  4LD0 A;  4PY5 A;  3RMA A;  4FW2 A;  3O4N A;  4LSL A;  2Z1H A;  2KFZ A;  1S1U A;  4Y1C A;  3VQB A;  4KI4 A;  3C6U A;  3ZSO A;  1RT5 A;  2D0A A;  1D5A A;  3AVJ A;  3IG1 A;  4LH4 A;  1NK6 A;  4FK0 A;  2XO7 A;  3L3V A;  2OZM A;  1REV A;  1HMV A;  4DFP A;  4CHN A;  2XRI A;  4M3X A;  1JL1 A;  2XY6 A;  1S9E A;  4ID5 A;  5SWM A;  4DF8 A;  3QLH A;  3ZSR A;  1RCH A;  5FDL A;  3JYT A;  1CZ9 A;  1TL3 A;  3SV3 A;  3S3M A;  1LW2 A;  2G8H A;  2BGG A;  3DLK A;  4BWM A;  4N76 A;  1ZBU A;  1RT4 A;  2HNZ A;  4OPJ A;  4CJR A;  4J2E A;  1Y97 A;  3ZCM A;  4KKO A;  4FJL A;  3CFR A;  4HVJ A;  5KTQ A;  1TAU A;  1C6V A;  2G8I A;  3ALY A;  2F8T A;  1BQN A;  1NK9 A;  4N56 A;  5D3G A;  3M8Q A;  3ZT2 A;  1Z26 A;  3O3H A;  1XC9 A;  2JLE A;  2DFF A;  2PY5 A;  3TAB A;  3S9H A;  4DTU A;  1LAW A;  4EZ9 A;  1KSP A;  2ATQ A;  4GW6 A;  3OS2 A;  1RDB A;  4W5R A;  4DTM A;  4CGG A;  3AO1 A;  2Z1J A;  4JS5 A;  3ZSY A;  1TKD A;  4CGF A;  4DLG A;  5DMR A;  4FLT A;  3S3N A;  4FM2 A;  1NK8 A;  3SQ2 A;  2OZS A;  1KVA A;  1WAJ A;  1S1V A;  1UOC A;  3TI0 A;  3HK2 A;  1JLE A;  3H08 A;  4AHC A;  4M3U A;  2BDP A;  2OPQ A;  1BL3 A;  3AO4 A;  1BQM A;  4O4G A;  1C1A A;  1WSF A;  1UAX A;  2XY5 A;  2FBT A;  4RW7 A;  4HUF A;  1SUQ A;  1IKX A;  4PA1 A;  4B9M A;  5HRS A;  3THV A;  2ZQB A;  1IG9 A;  4Y1D A;  1YT3 A;  1VSE A;  1ZYQ A;  1VSF A;  4CIF A;  3LAK A;  3SPY A;  3KK3 A;  3DM2 A;  2F96 A;  3D45 A;  4E7K A;  4FJH A;  4CHQ A;  3AA4 A;  4CEZ A;  2XHB A;  3TAM A;  1Z25 A;  3PX4 A;  5KI6 A;  4B9T A;  4CJ3 A;  3SUN A;  3QO9 A;  2ETJ A;  5C42 A;  4FJM A;  1VSD A;  1A5V A;  3RTV A;  3PO4 A;  2YKN A;  4JRQ A;  5HBM A;  4K8Z A;  4CK2 A;  2Y1J A;  1WNS A;  3KIO A;  5J2N A;  4I7F A;  4DTN A;  1NKE A;  3LDS A;  3KTQ A;  1RT3 A;  4ZTJ A;  4Z4I A;  4DQQ A;  3OYE A;  4Z0U A;  4DFK A;  3OYA A;  1XHZ A;  4F2R A;  1RBR A;  3RWU A;  1QQC A;  3TAP A;  4AHS A;  4DSJ A;  4HCC A;  4M3Y A;  1LWC A;  4LSN A;  4BWJ A;  1QTM A;  4W5Q A;  3KKS A;  2RKI A;  4E7L A;  4H8K A;  1EET A;  4DG1 A;  1L3U A;  1NK5 A;  2HHS A;  3SZ2 A;  3E01 A;  2GUI A;  4CHP A;  3KLF A;  4M42 A;  3QIO A;  1O1W A;  4M3R A;  4TSX A;  3OYK A;  1D9D A;  4M3T A;  4HHT A;  1QSY A;  4Z4G A;  4UQG A;  1X1P A;  2DFH A;  2GBZ A;  4GVM A;  4FLW A;  3QNO A;  2P51 A;  3O4Q A;  1BIZ A;  1TK0 A;  2IAJ A;  3K5O A;  4JS4 A;  4N47 A;  4CJL A;  3SI6 A;  3ZT3 A;  1UA0 A;  2G8U A;  4CJS A;  3AO3 A;  2HNY A;  3AVF A;  3OYB A;  3S3O A;  3T3F A;  3BDP A;  3NDK A;  3SV4 A;  1QSS A;  5E41 A;  3K5M A;  1SL1 A;  4FK2 A;  1NJY A;  1NK7 A;  1X9W A;  2O4I A;  1B92 A;  1XHX A;  2NUB A;  3L8B A;  4NCG A;  3PY8 A;  1YTA A;  2PYJ A;  4CK3 A;  4NYN A;  3TAE A;  3HVT A;  3HT3 A;  4FJJ A;  3ISN C;  4CE9 A;  1NK0 A;  4IG0 A;  3LP2 A;  4QAG A;  5EU7 A;  4OLA A;  1A5X A;  3HO1 A;  3KLE A;  3EZ5 A;  4KTQ A;  3P5J A;  1SKS A;  2HHQ A;  2X6S A;  5K14 A;  1VSI A;  4HUE A;  4DS4 A;  1U45 A;  3LAM A;  4RW9 A;  1VSL A;  4YNQ A;  3QEP A;  1S1T A;  1J54 A;  1D9F A;  3EYZ A;  4CFC A;  4J2B A;  1DTQ A;  1DLO A;  1JKH A;  3K59 A;  1EKE A;  1VSJ A;  2DTU A;  1C1C A;  1GOA A;  4DTS A;  1RTD A;  4KAZ A;  1FK9 A;  4OKK A;  5J2Q A;  4EZ6 A;  5C25 A;  1L3S A;  1RBV A;  1K6Y A;  5CYQ A;  1RDA A;  3P1G A;  3NGZ A;  4KHY A;  1QE1 A;  3KK1 A;  3ASM A;  3B6P A;  4E7J A;  3TWH A;  3WNH A;  1JL2 A;  3K5N A;  3G10 A;  3IRX A;  4AH9 A;  2D0C A;  4I9L A;  4RW4 A;  4CEQ A;  2RF2 A;  3L3U A;  3C95 A;  4CK1 A;  4DSE A;  1J53 A;  1SKW A;  4J2D A;  2XY8 A;  3MED A;  2I5J A;  1VSK A;  3RMB A;  4CJ4 A;  4DS5 A;  5HRR A;  3NAE A;  1W0H A;  2KZM A;  3PO5 A;  1HYZ A;  2IS3 A;  1TKX A;  4CJF A;  1ASV A;  1KCF A;  3SCX A;  1KLN A;  2Q3S A;  1T05 A;  1CLQ A;  4F8R A;  1BHL A;  2VWJ A;  5FRN A;  3L2Q A;  4FZX C;  4BAC A;  1WSE A;  3SNN A;  1FXX A;  3LP3 A;  3OS1 A;  3L2W A;  2HW3 A;  3OYG A;  1SV5 A;  2P1J A;  3HST B;  3OYH A;  3PX6 A;  4E1N A;  1ZBL A;  1UA1 A;  4FJG A;  3FFI A;  4C8M A;  3M8R A;  4F3T A;  1SL2 A;  4B08 A;  3HVR A;  1WSG A;  4O5B A;  4HCB A;  3QEV A;  3DLH A;  3VQ8 A;  3CM5 A;  4CGD A;  1GOB A;  3V9W A;  4DQR A;  3V6D A;  3DRS A;  4FXD A;  2QKK A;  2E6L A;  2X6N A;  4CJV A;  4CJK A;  4FJX A;  4M45 A;  1CXU A;  1WAF A;  4OVL A;  1ZBF A;  4ZTF A;  3NGY A;  5KRS A;  3AVC A;  3NF6 A;  4AHT A;  3T1A A;  2WON A;  1N5Y A;  3UIQ A;  1KTQ A;  1RIL A;  1SKR A;  4KI6 A;  3DOL A;  1NOZ A;  3LPT A;  4JLH A;  3OJS A;  2A1S A;  2HVH A;  1T7P A;  2F8S A;  3RMC A;  5KGW A;  4MQ3 A;  4CJ5 A;  4C8L A;  4DF4 A;  4CF2 A;  1Q8I A;  4FM1 A;  4F3O A;  3M8P A;  1TV6 A;  3MEE A;  5HLF A;  3NF7 A;  3MXM A;  1J9A A;  3JSM A;  4KV8 A;  3PV8 A;  4N5S A;  3AV9 A;  2YHB A;  2IGI A;  3V9X A;  3AVI A;  4GMJ B;  4KHQ A;  3QES A;  1X9M A;  4FJ7 A;  3PX0 A;  1XI1 A;  3PUF A;  1WSH A;  3IS9 A;  3AVB A;  3HP9 A;  4BDZ A;  2Y1I A;  4AIL C;  2RPI A;  5HRN A;  1J5O A;  4KRE A;  4Z4H A;  4DTO A;  1NJZ A;  3AA5 X;  3V9S A;  4CFD A;  1NKB A;  4FJ5 A;  4ICL A;  4IKF A;  1HNI A;  4B8C A;  3CFO A;  4R5P A;  4Z4E A;  3AA3 A;  4AHU A;  4E19 A;  3WNE A;  3SQ1 A;  1KVC A;  3LWM A;  1JLA A;  2VWK A;  2QK9 A;  4FLY A;  2B4J A;  3OYD A;  4CGH A;  2EX3 A;  4CJQ A;  3CYM A;  1ZBI A;  2DY4 A;  3HPO A;  3RMD A;  3KD1 E;  1B9F A;  1CXQ A; 
#chains in the Genus database with same CATH topology
 1WN7 A;  1TVR A;  1N34 K;  3VA3 A;  3SPZ A;  1LV5 A;  5I9E B;  3VQ7 A;  3CMA N;  4M3Z A;  1HNV A;  4DFM A;  4EFH A;  4FPA A;  1U47 A;  1U48 A;  5BPL A;  2HMP A;  3ZLJ A;  3DMJ A;  3CCJ N;  1LW0 A;  3CHW A;  3WNF A;  1Z6R A;  4DTX A;  2ZJR L;  3CCS N;  3EKU A;  4B9S A;  1HNW K;  1VK0 A;  3QDK A;  5LJV A;  4XIU A;  3NGI A;  2X74 A;  3AVA A;  3MAQ A;  2HMI A;  1GLC G;  4A57 A;  4WCE L;  2ZJQ L;  5JS1 A;  3HI0 A;  4HTL A;  1N36 K;  2Z1G A;  1X9J A;  3VQ9 A;  3F9K A;  3SMS A;  4C8N A;  3DLG A;  4IFE A;  3K9J A;  2HHW A;  4CF9 A;  3CXC M;  1VRU A;  3U3G A;  4DU3 A;  3UKR B;  1BG3 A;  2V51 B;  4E1J A;  1JLF A;  1SL0 A;  4FLX A;  3T7Z A;  2E4L A;  2G8K A;  2VQE K;  4DUY K;  3FFK B;  2IIR A;  4KH4 A;  4JK8 A;  3T1H K;  3O3F A;  4B3T K;  2V7Z A;  4ZHR A;  5AQT A;  4DV0 K;  3I8B A;  3K2P A;  1BI4 A;  2HBM A;  3F5T A;  4IJA A;  2V52 B;  4CEB A;  4AM7 A;  2FF6 A;  3NF8 A;  3QIP A;  4Q5V A;  3MX5 A;  3RSE A;  1EQY A;  4NLC A;  5M1N A;  4CEC A;  3U9D A;  1U4B A;  3DI6 A;  2OPR A;  3I0S A;  4CF0 A;  4FK4 A;  4CD3 A;  4JEP A;  5EVZ A;  2KZZ A;  1SAZ A;  5AQP A;  3GDQ A;  4B9U A;  4LH5 A;  1FKO A;  2VG6 A;  4GY2 B;  4NO7 A;  1HPZ A;  5LJW A;  4DR1 K;  4OKJ A;  1OH8 A;  3ULE A;  4BRI A;  2AJQ A;  3AO2 A;  4JKF A;  3LDL A;  1T03 A;  4CHZ A;  5CYM A;  1NK4 A;  3QEX A;  3OHR A;  4OPH A;  4RCH A;  3BZC A;  3AA2 A;  3HM8 A;  2VG7 A;  1HQE A;  4FOI A;  3ZSW A;  4BDP A;  5AQF A;  1ILY A;  5GAE P;  4M7Y A;  1SQK A;  5AQW A;  3OYF A;  4RWT A;  3NHG A;  4BE2 A;  2P9P A;  1BA0 A;  3CCU N;  1RTJ A;  1UWB A;  4KO0 A;  3F73 A;  1YUW A;  4FWL A;  4NCB A;  1RBS A;  3QIN A;  4LY7 A;  4YOT A;  4CEA A;  4IJN A;  4I2P A;  4KB0 A;  4J8F A;  3OYI A;  5CZ2 A;  2P9L B;  3VA0 A;  4DQI A;  3DLL L;  4BQZ A;  3R8E A;  4W5N A;  4CI6 A;  1JLG A;  5ELZ A;  5B8H A;  3DXK B;  3HYF A;  3ZEU A;  4DFJ A;  3WNG A;  1HJR A;  4B1X B;  2W42 A;  4MLE A;  5M1Q A;  4BRF A;  2G8V A;  4OPA A;  4JI6 K;  4CJU A;  3MXI A;  2YHX A;  4H5W A;  4GKK K;  4FWN A;  4B3O A;  2KHO A;  2P5O A;  3ZX0 A;  3LPU A;  1Q9X A;  1QSL A;  1C0M A;  3KK2 A;  1NGG A;  2P9K B;  3QB0 A;  4K41 A;  3LZJ A;  3J80 O;  4CVN E;  4YOR A;  4K42 A;  1T8E A;  5EX5 A;  1JCF A;  3ID6 A;  1TL1 A;  4BG8 A;  4B9N A;  1IKV A;  2QWR A;  3HL8 A;  3R3L A;  3BY5 A;  3DXM A;  3OYC A;  4FM0 A;  2D0B A;  4IDK A;  4QCL A;  3DOK A;  4FZZ A;  2JWK A;  4M41 A;  1TK8 A;  4DTJ A;  4PY5 A;  3O4N A;  4Y1C A;  4KI4 A;  4CBX A;  3HSC A;  3C6U A;  2HST A;  1D5A A;  4IXC A;  4LH4 A;  4FWM A;  2CH5 A;  5F1X A;  4CW7 B;  4BQL A;  3JXU A;  1S9E A;  3LDQ A;  5CR4 A;  4DF8 A;  3SV3 A;  3S3M A;  2G8H A;  3DLK A;  2WC9 A;  3FE1 A;  1Y97 A;  3ZCM A;  1HPM A;  3CFR A;  4HVJ A;  1TAU A;  2RHK A;  3VGM A;  4C1N I;  2G8I A;  4B3S K;  1BQN A;  3O3H A;  1Z26 A;  2P9N B;  2DFF A;  2E1Z A;  5AQL A;  1LAW A;  1KSP A;  2ATQ A;  4I6M B;  3OS2 A;  1BOT O;  4DTM A;  4IEI A;  3AAR A;  4JS5 A;  4FLT A;  3CET A;  4ISF A;  3SQ2 A;  1WAJ A;  1S1V A;  3KK7 A;  3H08 A;  3Q7C A;  4JK7 A;  4JHD A;  3ZYY X;  5DM7 L;  4RW7 A;  4XEI A;  1IKX A;  1U6Z A;  4X64 K;  1IG9 A;  2ZQB A;  1ZYQ A;  2O8C A;  3SPY A;  3KK3 A;  3DM2 A;  5AQG A;  4E7K A;  3UE5 A;  5F2R A;  5C42 A;  1A5V A;  3RTV A;  2YKN A;  1IBK K;  1QQO A;  4YOY A;  4DR5 K;  4Z4I A;  1XHZ A;  3OYE A;  4WF9 L;  4HCC A;  3A5O C;  1LWC A;  2Q1N A;  4UY8 O;  3SMP A;  3A8Y A;  4A62 A;  2VCP A;  4CHP A;  3MMV A;  1WBD A;  2E5L K;  3MCP A;  4M3R A;  4BRD A;  3CJB A;  4HHT A;  5LY3 A;  2GBZ A;  4GVM A;  2P51 A;  4JAX A;  1BIZ A;  1FJG K;  1TK0 A;  4JS4 A;  4N47 A;  4MO4 A;  1UA0 A;  3AO3 A;  3BDP A;  2O4I A;  4BC3 A;  2O8E B;  1KC8 O;  1B92 A;  2PYJ A;  2Q0U A;  3TAE A;  4O8K A;  1NK0 A;  5EU7 A;  4JV5 K;  1A5X A;  2X6S A;  4ILG B;  1VSI A;  4HUE A;  4DS4 A;  2NNW A;  3LAM A;  1U45 A;  1NGC A;  1VSL A;  3M1F A;  1S1T A;  1Y64 A;  1D9F A;  1DTQ A;  3FR0 A;  1WOQ A;  3VEY A;  2A40 A;  3UKU A;  3SLC A;  1FK9 A;  5LL6 Z;  5BRD A;  4EZ6 A;  5C25 A;  3B8A X;  1C0F A;  2E20 A;  3P31 A;  3NGZ A;  4E7J A;  4C8O A;  3BEX A;  1JL2 A;  1Q18 A;  3IRX A;  2D0C A;  1SKW A;  4RW4 A;  5BPM A;  3L3U A;  1VQK N;  4CJ4 A;  2VQF K;  1MWK A;  3R9P A;  3PO5 A;  2IS3 A;  1TKX A;  4CJF A;  4Y0W A;  1KLN A;  5FRN A;  4FZX C;  3OS1 A;  3OYG A;  2ASM A;  2P1J A;  3O9Q A;  1UA1 A;  5AZJ B;  4FJG A;  3M8R A;  1DKG D;  3ENB A;  3CME N;  4HCB A;  4O5B A;  3C7N A;  3BF3 A;  3CD6 N;  1GOB A;  3ID8 A;  3H1Q A;  4JN4 A;  4YDU C;  2X6N A;  4OVL A;  2FSK A;  3ZX2 A;  3NGY A;  5KRS A;  3CPE A;  3NF6 A;  3MN9 A;  4AHT A;  4Z94 A;  5BPN A;  3T1A A;  2WON A;  4M7X A;  1KTQ A;  3THX B;  3RMC A;  4BGB A;  1Q8I A;  3MEE A;  5HLF A;  4JI5 K;  2YHB A;  2IGI A;  3THW A;  3PX0 A;  1QVF M;  3CC2 N;  3M3Z A;  4LC9 B;  3AVB A;  1GLD G;  4Z4H A;  4DTO A;  3V9S A;  1EWR A;  3CF5 L;  1NKB A;  1HNI A;  3CPW M;  5GAG P;  4AHU A;  4A61 A;  4E19 A;  5IWA K;  2QK9 A;  4CGH A;  1NJI O;  2DY4 A;  1T44 A;  3RMD A;  4M63 C;  3LDP A;  1VQO N;  1J5E K;  2O8F A;  1S5J A;  1NJW A;  5CY4 A;  3W3D A;  4BE1 A;  1MA9 B;  3TTF A;  4F2S A;  3SJH A;  3MN5 A;  5EOY A;  4CEE A;  4CGI A;  2E2N A;  3OYN A;  2O8B B;  3NBP A;  4CF8 A;  4FWO A;  1K8K A;  1V4S A;  3EE8 A;  4BY9 C;  4KB1 A;  4E0D A;  4KTW A;  1HYV A;  3F9M A;  1VHX A;  1RNH A;  1C1B A;  1NMN A;  3BGR A;  5FRO A;  1VRT A;  1FW6 A;  4B1Y B;  4KFB A;  1KFS A;  4PWD A;  1NGJ A;  1ZBS A;  2P9I B;  3A5M C;  3H1V X;  5JIC A;  3IUC A;  1R0A A;  3VF6 A;  4DHY A;  3NH0 A;  3CQ8 A;  3G0Z A;  1RTI A;  5AR0 A;  4Z4C A;  4H0V B;  4AHV A;  4LF6 K;  3VQ5 A;  4BRP A;  1L5U A;  3RVC A;  4IBN A;  3ZSV A;  1HKB A;  3O4W A;  1JLC A;  1MWM A;  3B6O A;  3AVH A;  1S6Q A;  2NRH A;  3TAF A;  3EL2 A;  3BP8 A;  1TK5 A;  2ZD1 A;  3ZX3 A;  4L8R B;  1LCU A;  3NH2 A;  3VN5 A;  5AQV A;  3U3Y A;  3RR8 A;  4OGC A;  1S1X A;  4BE0 A;  1RDD A;  3VMF B;  4DU4 A;  1S9G A;  2ZJP L;  1LOT B;  3OS0 A;  1U49 A;  1WLJ A;  4CJE A;  3K58 A;  3TAR A;  2HND A;  5J1E A;  4B9V A;  5EY4 A;  3EN9 A;  1QZ5 A;  3DLE A;  1YI2 N;  4OKE A;  4X62 K;  2YHA A;  2GEM A;  4FW1 A;  3LWL A;  1ASU A;  4DSL A;  1NJX A;  4JI2 K;  2A3Z A;  1IO2 A;  3WUH A;  1YF5 L;  3QEW A;  4Q0B A;  3HPH A;  2O8D B;  2D5R A;  3J7Y P;  3OYM A;  2X78 A;  1BIS A;  4FYD A;  4FWR A;  2FBY A;  1JJ2 M;  4B3R K;  3MX2 A;  4BR9 A;  4O0I A;  3QEI A;  5J2M A;  1NU0 A;  1Q86 O;  1TKT A;  3GL1 A;  5HOO A;  4LFC K;  4DSF A;  2F7T A;  3SBT A;  5CZ1 A;  5GIO A;  2QXF A;  3RRH A;  2P9S B;  2QA4 N;  2BE2 A;  4RW6 A;  4KHU A;  2YV0 X;  3L2U A;  2RE2 A;  3A0I X;  1U04 A;  5C10 A;  3TSQ A;  3LP0 A;  3WEE B;  4BRL A;  2IDO A;  2PFU A;  3OY9 A;  1OH6 A;  4MO5 A;  1BO5 O;  4BR2 A;  2OPS A;  3D2F A;  1RDC A;  4KHW A;  2YX6 A;  3MDQ A;  3QBX A;  3SK3 A;  4WFB L;  4DSI A;  4QS9 A;  5FRM A;  4FLU A;  3LDO A;  3SAG A;  3D7E O;  2OYQ A;  3AO5 A;  4CHO A;  1CZA N;  3LM2 A;  2E2Q A;  4F4K A;  3TAQ A;  2FBX A;  2QWN A;  1GOC A;  1HKG A;  3CFP A;  4FCY A;  3V9Z A;  3PLA A;  5AQS A;  3MEG A;  3NVM A;  4W5T A;  1ATR A;  2NRZ A;  2P5G A;  3WXK A;  4MFB A;  2EWS A;  4WE1 A;  3EEQ A;  1RT6 A;  3LZI A;  3KWG A;  3OJU A;  4E7H A;  1Z05 A;  1N6Q A;  3NF9 A;  4GNI A;  3VQ4 A;  1C0T A;  1OH5 A;  3Q7B A;  1QVG M;  1HJO A;  1XWL A;  1NKC A;  5AZI A;  3AAQ A;  1KXP A;  4JKA A;  4CFA A;  1JLQ A;  1EP4 A;  2B6A A;  1HQU A;  3W0L A;  3QER A;  3SQ0 A;  3O8M A;  4JD2 A;  2Z1H A;  2KFZ A;  3CJA A;  3M5R A;  3ATV A;  1NK6 A;  5AQI A;  3L3V A;  2OZM A;  4B1W B;  4M3X A;  2FF3 B;  2F4V K;  5SWM A;  5M1P A;  1RT4 A;  2HNZ A;  4JKH A;  4OPJ A;  4CJR A;  5LMU K;  2QWL A;  3PSF A;  4KKO A;  3T1Y K;  4OO1 J;  1JCG A;  1ATN A;  3I55 N;  3ALY A;  3O6W A;  5F0X A;  1NK9 A;  5KQD A;  2QTD A;  2F9W A;  4JKB A;  4A5B A;  2Q2R A;  4BRE A;  3S9H A;  3N4Q A;  4EZ9 A;  1RDB A;  3O9U A;  4YDU A;  1QZ6 A;  1R59 O;  4A5A A;  3AO1 A;  3TU5 A;  2A42 A;  1TKD A;  4DLG A;  5DMR A;  1GLL O;  1Q81 O;  4QS8 A;  4O5F A;  3TI0 A;  4EAH D;  5H1S Q;  1JLE A;  4YOU A;  4JI7 K;  4M3U A;  1K9M O;  1BL3 A;  1BQM A;  3IFR A;  4HUF A;  1SUQ A;  4PA1 A;  4Y1D A;  1VSE A;  4H5R A;  3FZH A;  4FJH A;  4WQ5 C;  3AA4 A;  3VER A;  4BC2 A;  1Z25 A;  4B9T A;  3SUN A;  4BRC A;  2Q97 A;  3ENH A;  5KPT A;  4WFA L;  2YHW A;  4K8Z A;  1E3M A;  1VQL N;  4I7F A;  4DTN A;  3WQT A;  1RT3 A;  4Z0U A;  3RWU A;  3CQX A;  3VEO A;  2UUB K;  3TAP A;  4AHS A;  3DAW A;  3C0B A;  4BWJ A;  4LSN A;  4W5Q A;  4IOX A;  4DG1 A;  3CCE N;  3E01 A;  2GUI A;  3P39 A;  1QSY A;  4UQG A;  1X1P A;  2DFH A;  4FLW A;  3O4Q A;  3F2K A;  1S22 A;  3K5O A;  5AQY A;  3SI6 A;  3K9K A;  4IO9 L;  4CJS A;  4JK9 A;  2YJE A;  3NDK A;  3SV4 A;  5E41 A;  1NK7 A;  1XHX A;  2NUB A;  5GIN A;  1YTA A;  2ZGZ A;  4BR0 A;  3QBW A;  3HT3 A;  4CE9 A;  1KAY A;  4X65 K;  1N32 K;  3WT0 A;  2QXL A;  4ILJ A;  4CFC A;  3WXJ A;  1JKH A;  2W6L A;  2ITM A;  2DTU A;  1C1C A;  4DTS A;  3RSE B;  4OKK A;  1RBV A;  5CYQ A;  1IBL K;  1T6D A;  5C12 A;  3ASM A;  3B6P A;  5BR9 A;  2I7P A;  3I8D A;  3BZK A;  1ATS A;  4AH9 A;  2E2P A;  2RF2 A;  3C95 A;  4J2D A;  3MED A;  3RMB A;  3THY A;  5HRR A;  2DPN A;  1HYZ A;  1KCF A;  3OBW A;  2Q3S A;  3E9P A;  3D6R A;  4B1U B;  3L2Q A;  4PL7 A;  5BN9 A;  1BUP A;  5AQH A;  4JKG B;  3HST B;  3ULE B;  2P9U B;  4PKI A;  4E1N A;  4DR4 K;  1EO1 A;  4C8M A;  4F3T A;  3O9S A;  4B08 A;  3HVR A;  1WSG A;  4PKG A;  3DLH A;  4K25 A;  4DQR A;  4FXD A;  4PKH A;  2A5X A;  5BRH A;  4A2B A;  1YJN N;  3NMU A;  4YY3 K;  1ZBF A;  4ZTF A;  1TYQ A;  3UIQ A;  4WQ4 A;  4KI6 A;  4CBW A;  4JLH A;  2A6A A;  2HVH A;  2F8S A;  4MQ3 A;  5AQQ A;  3MCA B;  4FM1 A;  3MXM A;  3C6A A;  4MDA A;  3AVI A;  3PIP L;  1X9M A;  1NGB A;  3HP9 A;  1ZC6 A;  2RPI A;  1NGF A;  4H0X B;  5JVG L;  2QEX N;  4BG9 A;  3CFO A;  4YHH K;  3L4Q A;  3GOI A;  4R5P A;  3VTH A;  3AA3 A;  1NM1 A;  1VQ4 N;  3THX A;  1KVC A;  3IMX A;  5KQ8 A;  3FZM A;  3ZEU B;  2KKZ A;  3LP1 A;  1ZBH A;  4B1Z A;  4DSK A;  3VQA A;  4DCH A;  2JGU A;  3JAM O;  5KGX A;  4FLV A;  4FJ9 A;  4K8X A;  2JWL A;  3ULD A;  3DLR A;  3QFU A;  1FKP A;  3CCM N;  3U4L A;  3VQC A;  1ASW A;  1XQS C;  4H0T B;  4JI4 K;  4CJ7 A;  2NRV A;  2OCE A;  5C24 A;  2NRT A;  4EHT A;  1IKW A;  2IC3 A;  4BRM A;  4IFV A;  1ESV A;  3AVM A;  1QHT A;  2XY7 A;  4I2Q A;  4XH1 A;  3E1Y A;  2PBD A;  2CGL A;  3SUP A;  3O1W A;  4O44 A;  3KJV A;  1RBU A;  3DRR A;  1IKY A;  4B1V A;  3CJ1 A;  2YJF A;  3EZW A;  4EP4 A;  5FPM A;  3RR7 A;  1TUU A;  3N4P A;  3CCL N;  4CIG A;  4AQY K;  2VWB A;  3ZT0 A;  3HXM A;  4DV5 K;  4KTZ A;  1X3M A;  3VF4 A;  2A1R A;  3TTD A;  4Z4F A;  3ZET B;  5HP1 A;  4IWV A;  5I3U A;  1YAG A;  4FL9 A;  1K8A O;  1BU6 O;  5BN8 A;  1WBB A;  1W9H A;  3TSP A;  4KPY A;  3V1R A;  3AGK A;  2P9I A;  4IEE A;  3HPG A;  4C8K A;  5FLX O;  3V9U A;  1NK8 A;  1LWE A;  3ZT4 A;  3VQD A;  4CED A;  5GAD P;  2IOC A;  3O3G A;  3K57 A;  3FZF A;  4CJT A;  4EIA A;  1YIT N;  3QET A;  3MK6 A;  2BAN A;  3U9Z A;  4BRO A;  1K73 O;  4E89 A;  2HHH K;  4DR3 K;  4BC4 A;  2HF3 A;  3D0P A;  2VGM A;  5J2P A;  2GV9 A;  3L6Q A;  4FO0 A;  4KHN A;  4DQP A;  2I7N A;  4FJK A;  1JXE A;  3FZK A;  1RDU A;  4JHD B;  3AVL A;  3H45 C;  4CFB A;  1ITG A;  5GIP A;  4ID1 A;  1HYS A;  2O8C B;  4YOV A;  3AVK A;  3G71 N;  5T7B A;  2OPP A;  3EO3 A;  1JXB A;  2QM1 A;  4CEF A;  1RTH A;  3VEX A;  2OAN A;  3OYL A;  5EXW A;  2OTJ N;  3KHY A;  4K0K K;  4G1Q A;  2NLX A;  1KVB A;  3T19 A;  5JMV A;  2YHY A;  4LF5 K;  1U2V B;  4YFU A;  3LAN A;  2O4G A;  2AP1 A;  1NGE A;  2UYT A;  4OGE A;  5SZT A;  2HHU A;  1XC3 A;  4NCA A;  1LWF A;  4KRF A;  5AQZ A;  1VSM A;  3ZT1 A;  4LF9 K;  2HHT A;  4AHR A;  2KQ2 A;  2AA4 A;  3IAY A;  2O8D A;  3V1Q A;  3DLB A;  4RW8 A;  4H4O A;  1X9S A;  3FZL A;  1YVU A;  4A2A A;  2NRW A;  4DV4 K;  1VQM N;  3QNN A;  2ZWH A;  3IDH A;  2LSN A;  4DV2 K;  1DEJ A;  1I3A A;  1D8Y A;  4J2A A;  1BCM A;  3C65 A;  4DR6 K;  4IG3 A;  3SAH A;  4B9L A;  1DTT A;  3CC7 N;  2Q31 A;  3MEC A;  5I42 A;  3H46 O;  2P9S A;  2KFN A;  4IZ9 A;  3TTC A;  3OA9 A;  4N41 A;  4FJ8 A;  4C1N K;  4NXM K;  2ZE2 A;  4KRE A;  4V19 S;  2R7Y A;  3D2E B;  4BRA A;  3WEE A;  3SBG A;  5JLH A;  4HTU A;  1TKZ A;  2UU9 K;  2ASP A;  2YNG A;  3C6H A;  5AQR A;  1KQS M;  2YCH A;  1KLM A;  4DU1 A;  3DJC A;  1YXQ A;  4LFA K;  2HVI A;  2HB5 A;  1O13 A;  3MXJ A;  2PYL A;  3VOV A;  4GV6 A;  3ITH A;  3VQQ A;  2YNH A;  2HBJ A;  3SYZ A;  1A5W A;  3VEZ A;  4CES A;  4CCH A;  5M1F A;  1I39 A;  3M8S A;  1TAQ A;  3J7Z O;  3I33 A;  2W41 A;  3A2F A;  4CER A;  1C0G A;  3C7N B;  3L2V A;  2QWO A;  1QS4 A;  1VQ5 N;  3O9R A;  3SQ4 A;  3S41 A;  4LD0 A;  3QML A;  3RMA A;  3UKR A;  4FWS A;  4NLB A;  2E1Y A;  2IVN A;  4FW2 A;  3VQB A;  3AGR A;  3IG1 A;  4FK0 A;  2XO7 A;  1REV A;  1HMV A;  3ATU A;  4CHN A;  2XRI A;  2GEL A;  3ZSR A;  1IV0 A;  5FDL A;  1CZ9 A;  3G4S N;  1TL3 A;  1LW2 A;  2BGG A;  5AQX A;  4BWM A;  4LF8 K;  5CE3 A;  4N76 A;  2QWP A;  3A5N C;  1C6V A;  2F8T A;  2Q36 A;  1GLF O;  5D3G A;  3CJC A;  3M8Q A;  3ZT2 A;  1XC9 A;  5JLF A;  4JKD A;  1X3N A;  2Z1J A;  4CZK A;  3ZSY A;  4ISE A;  3CCQ N;  3KVG A;  2QW9 A;  4FWK A;  2OZS A;  2O8F B;  1KVA A;  1UOC A;  3SAF A;  2OPQ A;  1QQM A;  3OW2 M;  3WXI A;  2QI2 A;  3NVK A;  1WSF A;  3LM9 A;  2FBT A;  3HBT A;  5HRS A;  1YT3 A;  1VSF A;  4CIF A;  1OVQ A;  2F96 A;  1K8K B;  4A59 A;  4CEZ A;  2XHB A;  3P4I A;  3TAM A;  2HHQ A;  5KI6 A;  4GKJ K;  3QO9 A;  2ETJ A;  2GTD A;  1VSD A;  4GVE A;  4BRH A;  4CK2 A;  4KBO A;  2Y1J A;  1WNS A;  3H3O B;  3LDS A;  5C2D A;  4DQQ A;  3OYA A;  2W6K A;  1HNZ K;  1QQC A;  3VEV A;  4M3Y A;  4E7L A;  1L3U A;  1EET A;  2QWQ A;  1NK5 A;  5BRF A;  2HHS A;  4M42 A;  3OYK A;  1IBM K;  4TSX A;  1D9D A;  1VQ9 N;  3QNO A;  1DT9 A;  2IAJ A;  2Q0R A;  4CJL A;  1W7A A;  3ZT3 A;  2G8U A;  2HNY A;  3AVF A;  3S3O A;  3T3F A;  1QSS A;  1NGA A;  3L8B A;  3PY8 A;  1KAZ A;  2NRR A;  1QQN A;  2P9L A;  3H6E A;  4NYN A;  4CK3 A;  3HVT A;  3ISN C;  1P90 A;  4IG0 A;  3LP2 A;  4QAG A;  3HO1 A;  3KLE A;  4KTQ A;  1SKS A;  3DXK A;  5K14 A;  3QEP A;  1J54 A;  4J2B A;  1DLO A;  4B3M K;  3EKS A;  1GOA A;  2NRX A;  1RTD A;  4KAZ A;  3BUZ B;  4FSV A;  5J2Q A;  4DV3 K;  1L3S A;  2KLA A;  4HWI A;  1NGD A;  4LF4 K;  2WTU A;  2D1K A;  3WNH A;  3K5N A;  2D0P A;  3G10 A;  2H3G X;  4GV9 A;  4I9L A;  3U8X A;  1J53 A;  5ADX A;  2P9K A;  2XY8 A;  2I5J A;  4DS5 A;  1W0H A;  1ASV A;  1CLQ A;  1BHL A;  4EHU A;  2VWJ A;  3WXL A;  1WSE A;  3L2W A;  1ZBL A;  3FFI A;  3E9O A;  2HBK A;  3QEV A;  4B9Q A;  3CM5 A;  3V9W A;  3DRS A;  2E6L A;  4U67 L;  4CJK A;  4M45 A;  1CXU A;  2BTF A;  3MWT A;  1N5Y A;  1SKR A;  2E88 A;  1NOZ A;  2A1S A;  3CQY A;  1T7P A;  5KGW A;  4CJ5 A;  2UXB K;  4CF2 A;  4F3O A;  3M8P A;  1BDG A;  4NB4 A;  3PV8 A;  4JKG A;  4KV8 A;  2P9U A;  3QES A;  1GLA G;  4FJ7 A;  1V4T A;  3LDN A;  1XI1 A;  2PAV A;  3LL3 A;  2VGN A;  4BDZ A;  2ZF5 O;  5BRE A;  1BA1 A;  5HRN A;  1J5O A;  1NJZ A;  4CFD A;  2P9N A;  3D2F B;  2W40 A;  4FJ5 A;  4IKF A;  4B8C A;  1S72 N;  3CJ9 A;  2CGK A;  3CER A;  4I6M A;  3WNE A;  3OTO K;  2VWK A;  3WQU A;  4JYA K;  3CYM A;  1ZBI A;  2UXC K;  1D4X A;  3HPO A;  3KD1 E;  1B9F A;  4GW6 A;  1CXQ A;  3K0S A;  3CG7 A;  3C6T A;  1BCO A;  3NCI A;  4DQS A;  5HRO A;  4DB3 A;  2QWM A;  1YJW N;  4FZY A;  3GG4 A;  3VQE A;  1G99 A;  3R1X A;  2Z1I A;  3CM6 A;  4PQU A;  4QS7 A;  5AQU A;  5AQM A;  1YTU A;  3TR8 A;  3RRG A;  3O1B A;  1SZ2 A;  2D4W A;  3C94 A;  3KLG A;  3DRP A;  2UUA K;  3VEN A;  1JLB A;  3I56 N;  4CJP A;  2UUC K;  3CJ7 A;  5KRT A;  4H4M A;  3CCR N;  3AVN A;  4JI8 K;  1YVN A;  1F21 A;  5FPE A;  4IOC L;  5AFU A;  4DTP A;  5HL7 L;  5AZI B;  1HNX K;  3AVG A;  1BI4 B;  1XMO K;  1NGI A;  3OVN A;  4ELT A;  4CHY A;  3H3N O;  4E1M A;  2KW4 A;  3O9T A;  1VQN N;  2HHV A;  3HOS A;  4KH6 A;  4BRQ A;  3VQP A;  4DWI A;  1T6C A;  2YNF A;  3ZSQ A;  4JD2 B;  4C23 A;  4IOA L;  3VEW A;  5HRP A;  1C0U A;  4OJR A;  2WUS A;  4QOZ B;  4X66 K;  1NOY A;  4BRK A;  3ZSZ A;  3FGU A;  1VQ6 N;  2RN2 A;  4M3W A;  4DV6 K;  4CZH A;  2O8E A;  1TGO A;  2YNI A;  3HM9 A;  4PUO A;  3ENO A;  1ZXO A;  2FBV A;  4H0O A;  3HP6 A;  2WFB A;  3HJF A;  1HLU A;  1VSH A;  1NNE A;  3U6F A;  1BGX T;  4XH5 A;  3P83 D;  4WFN L;  4KHS A;  3ZSX A;  4CIE A;  1S6P A;  4O55 A;  3KLI A;  2ZM6 K;  2BH1 A;  3VQ6 A;  4EP5 A;  2G8F A;  3V1O A;  2DFE A;  3EY1 A;  4CD1 A;  1L3V A;  2YKM A;  4CZG A;  4G9Z A;  3SJJ A;  1WSJ A;  3NFA A;  4CGJ A;  2B5J A;  2G8W A;  3ZET A;  1S3X A;  4W5O A;  3WXM B;  5M1K A;  4RG8 A;  2FC0 A;  3LAL A;  1VQ8 N;  2WOM A;  1IH7 A;  1NWK A;  1EWQ A;  4FWQ A;  1CZB A;  4OX9 K;  2FLO A;  2CGJ A;  4H0Y B;  1RT7 A;  4IDH A;  3VGK A;  1Q7Y O;  5AZJ A;  2P9P B;  3IKM A;  5C0Y A;  4LF7 K;  1HRH A;  4KHP K;  4FOE A;  4CZJ A;  4HUG A;  5M1O A;  3MN7 A;  4CZI A;  3VET A;  4FVM A;  4WYB A;  4F9O A;  1WSI A;  1N8R O;  1KRP A;  3DYA A;  1HUX A;  4BVO A;  4CBU A;  2FXU A;  4FJN A;  5C2F A;  2KTQ A;  2OA8 A;  3KD5 E;  4L3Q A;  4YOW A;  4E3S A;  3FLC O;  4JRP A;  1S1W A;  1WB9 A;  4BDY A;  5DM6 L;  3OYJ A;  4FLZ A;  4CJW A;  4JKE A;  3L0Q A;  4FWP A;  1EX4 A;  3MWP A;  4LFB K;  4DKW A;  1BIU A;  1OVY A;  4FJI A;  2EHG A;  1NGH A;  3GE1 A;  3TSU A;  1HR0 K;  4GV3 A;  3NE6 A;  4JNE A;  1Q82 O;  1MDU B;  4E7I A;  4B8A B;  1MU2 A;  3KKR A;  4IFY A;  3NH1 A;  1I94 K;  1RDW X;  3PIO L;  1OKJ A;  3SUO A;  1RGI A;  1U2V A;  1RT2 A;  3VF2 A;  4OLB A;  5JS2 A;  4I9Q A;  1Q9Y A;  1G15 A;  1VAZ A;  1E4F T;  2HHX A;  1KFD A;  3K5L A;  5CHI A;  5AQN A;  4DLE A;  2QKB A;  3O80 A;  3KLH A;  3TAN A;  1EXQ A;  4DMN A;  4O0J A;  3DXM B;  1XNR K;  5GAH P;  5DK5 A;  3SUQ A;  1RBT A;  4CEO A;  1M90 O;  1B9D A;  4R79 A;  4ELU A;  2A41 A;  4XH4 A;  1L3T A;  2VG5 A;  1KD1 O;  2O8B A;  4NYF A;  2IVO A;  4DTR A;  5AJ3 K;  4BVP A;  3V4I A;  3THY B;  3UB5 A;  4ELV A;  2ITG A;  1YIJ N;  2E6M A;  4JKC A;  2HBL A;  3DWL A;  2GWJ A;  3V81 A;  2V7Y A;  1LAV A;  4OPK A;  1RT1 A;  4CF1 A;  3I0R A;  4DQ8 A;  5JVH L;  3TAG A;  1T3V A;  3L2R A;  4BR7 A;  5KPZ A;  5ADX H;  3D2E A;  1E4G T;  2E8A A;  3CIP A;  3VES A;  4O8U A;  3CI5 A;  5FPD A;  2PZS A;  3AAP A;  1RFQ A;  2GX9 A;  4H03 B;  4PL8 A;  4LSL A;  4NXN K;  1S1U A;  4CZL A;  1TYQ B;  3ZSO A;  1RT5 A;  2D0A A;  3AVJ A;  4H5V A;  1YHQ N;  4DFP A;  4U7B A;  1OH7 A;  3CC4 N;  1JL1 A;  3VTI A;  2XY6 A;  4ID5 A;  3T69 A;  1YJ9 N;  3QLH A;  1RCH A;  3JYT A;  3CCV N;  5BR8 K;  1SS6 A;  2F9T A;  1ZBU A;  4J2E A;  4FJL A;  5KTQ A;  1XUP O;  2BUP A;  3M6G A;  4N56 A;  5TKW A;  2JLE A;  2PY5 A;  3TAB A;  4DTU A;  2ASO A;  4W5R A;  4CGG A;  3BF1 A;  1QHA A;  4CGF A;  1IJJ A;  5LMN K;  4FM2 A;  4BR5 A;  3G6E N;  1J6Z A;  3HK2 A;  1W97 L;  1NLV A;  3HTV A;  4AHC A;  2BDP A;  2D0O A;  3AO4 A;  4DV1 K;  5C15 A;  4O4G A;  1XMQ K;  1C1A A;  1UAX A;  3E9L A;  2XY5 A;  3JS6 A;  4B9M A;  3THV A;  1M1K O;  3LAK A;  2FSJ A;  5E26 A;  5FPN A;  3D45 A;  4CHQ A;  3KZB A;  4CZM A;  1P8Z A;  3PX4 A;  4DV7 K;  4FJM A;  4CJ3 A;  3J81 O;  3PO4 A;  4FPB A;  4JRQ A;  1BWF O;  5HBM A;  4PHT X;  1NBW A;  1GLE G;  4WQ5 A;  3KIO A;  5J2N A;  1NKE A;  3KTQ A;  4ZTJ A;  4DFK A;  3O5B A;  4F2R A;  1RBR A;  4DSJ A;  4BC5 A;  1QTM A;  3KKS A;  2RKI A;  4H8K A;  3SZ2 A;  1HX1 A;  3KLF A;  1N33 K;  3QIO A;  1O1W A;  4M3T A;  5IT9 O;  4KH5 A;  4Z4G A;  3UKU B;  4BR4 A;  1WUA A;  5AFU H;  1NG9 A;  1KAX A;  3TPQ A;  3EE9 A;  4MLH A;  4JI1 K;  3AY9 A;  3GBT A;  3OYB A;  2HOE A;  4FK2 A;  3K5M A;  1SL1 A;  3PSI A;  1NJY A;  1X9W A;  3OBY A;  3R6M A;  4NCG A;  3MN6 A;  4FJJ A;  2HF4 A;  3HZ6 A;  4ISG A;  4JI3 K;  4OLA A;  3EZ5 A;  1VQ7 N;  4IO8 A;  3P5J A;  2CH6 A;  4RW9 A;  4YNQ A;  3EYZ A;  2NZT A;  4AF1 A;  3K59 A;  1EKE A;  1VSJ A;  4H5N A;  1GLJ O;  4YOX A;  1K6Y A;  3VPZ A;  1RDA A;  2WBN A;  4DR2 K;  3QIC A;  3P1G A;  4KHY A;  1QE1 A;  3KK1 A;  1VQP N;  3J7A P;  3TWH A;  1H1V A;  2J4R A;  4CK1 A;  3S3N A;  4CEQ A;  1HKC A;  4DSE A;  1W2B M;  1VSK A;  3NAE A;  4FVU A;  2KZM A;  2IVP A;  1GLB G;  3A5L C;  3SCX A;  4DUZ K;  1T05 A;  4F8R A;  3KWI A;  4BAC A;  3SNN A;  4MDB A;  1FXX A;  3LP3 A;  5MLC Q;  2HW3 A;  1SV5 A;  3OYH A;  3PX6 A;  3THW B;  3G25 A;  1NMD A;  4AM6 A;  1SL2 A;  5AQO A;  1IG8 A;  3VQ8 A;  4CGD A;  3V6D A;  2VYP A;  3E66 A;  2GWK A;  3HRG A;  2QKK A;  3O08 A;  4WQ4 C;  4CJV A;  2OTL N;  2E2O A;  4CZE A;  4FJX A;  1WAF A;  2YI1 A;  3AVC A;  2FSN A;  3L4I A;  2ZGY A;  1RIL A;  3QFP A;  4BRG A;  3DOL A;  3LPT A;  5AQK A;  3OJS A;  3VGL A;  4RTF D;  3P38 A;  4CZF A;  4C8L A;  4DF4 A;  4H5T A;  3HOT A;  1TV6 A;  3NF7 A;  1J9A A;  3JSM A;  5E84 A;  4N5S A;  3AV9 A;  4BRN A;  5A2Q O;  3J8A A;  3V9X A;  4GMJ B;  4KHQ A;  4ILH A;  3PUF A;  4DR7 K;  1WSH A;  1TUY A;  3IS9 A;  2Y1I A;  4AIL C;  3AA5 X;  4ICL A;  4H0P A;  5AQJ A;  4JI0 K;  4Z4E A;  1DGK N;  5KPR A;  2GUP A;  1JCE A;  3SQ1 A;  3LWM A;  1JLA A;  1XNQ K;  4FLY A;  2B4J A;  4BGA A;  3OYD A;  4K43 A;  2EX3 A;  4CJQ A;  2UXD K;  5TKY A; 
#chains in the Genus database with same CATH homology
 4C8O A;  3CG7 A;  1WN7 A;  1TVR A;  3LP1 A;  1ZBH A;  1S5J A;  3C6T A;  1NJW A;  1BCO A;  5CY4 A;  3NCI A;  4DQS A;  5HRO A;  3VA3 A;  3SPZ A;  1LV5 A;  4DSK A;  3VQ7 A;  4BE1 A;  3VQA A;  4M3Z A;  4FZY A;  1HNV A;  4DFM A;  2JGU A;  3VQE A;  4F2S A;  1U47 A;  2Z1I A;  3CM6 A;  5KGX A;  1U48 A;  4FLV A;  4CEE A;  4FJ9 A;  4CGI A;  4PQU A;  4K8X A;  3OYN A;  1YTU A;  3ULD A;  3DMJ A;  3NBP A;  3TR8 A;  1LW0 A;  4CF8 A;  3RRG A;  3DLR A;  1FKP A;  3C94 A;  3WNF A;  3KLG A;  3VQC A;  3DRP A;  4DTX A;  1JLB A;  1ASW A;  4B9S A;  4CJP A;  1VK0 A;  4XIU A;  3NGI A;  4KB1 A;  4E0D A;  2X74 A;  4KTW A;  1HYV A;  3AVA A;  3MAQ A;  2HMI A;  5KRT A;  4H4M A;  5JS1 A;  3AVN A;  1RNH A;  1F21 A;  5C24 A;  1C1B A;  1IKW A;  2IC3 A;  4DTP A;  3BGR A;  4IFV A;  1VRT A;  5FRO A;  3AVG A;  3AVM A;  4KFB A;  1QHT A;  2XY7 A;  2Z1G A;  1BI4 B;  1KFS A;  4I2Q A;  4PWD A;  3OVN A;  4ELT A;  3SUP A;  3VQ9 A;  4CHY A;  3F9K A;  4O44 A;  3KJV A;  1RBU A;  3DRR A;  1IKY A;  4C8N A;  2KW4 A;  4E1M A;  3DLG A;  3RR7 A;  4EP4 A;  4KHS A;  2HHV A;  1R0A A;  4DWI A;  3VQP A;  2HHW A;  3NH0 A;  3CQ8 A;  4CF9 A;  3G0Z A;  1VRU A;  3U3G A;  4CIG A;  4DU3 A;  2YNF A;  1RTI A;  3ZSQ A;  4Z4C A;  3ZT0 A;  4AHV A;  5HRP A;  1C0U A;  1JLF A;  4OJR A;  4QOZ B;  3HXM A;  3VQ5 A;  1SL0 A;  1L5U A;  4KTZ A;  1NOY A;  4FLX A;  3ZSZ A;  2A1R A;  4IBN A;  2E4L A;  2RN2 A;  2G8K A;  4M3W A;  4Z4F A;  3ZSV A;  5HP1 A;  1TGO A;  5I3U A;  2YNI A;  3HM9 A;  1JLC A;  3O3F A;  4PUO A;  4ZHR A;  1W9H A;  2FBV A;  3B6O A;  3K2P A;  1BI4 A;  3AVH A;  3HP6 A;  1S6Q A;  4KPY A;  3V1R A;  3HJF A;  3TAF A;  1TK5 A;  1VSH A;  2ZD1 A;  3U6F A;  4L8R B;  1BGX T;  3NH2 A;  3VN5 A;  3P83 D;  3HPG A;  3U3Y A;  3ZSX A;  4CIE A;  4CEB A;  1S6P A;  4O55 A;  3KLI A;  3RR8 A;  4C8K A;  3NF8 A;  4OGC A;  3QIP A;  4Q5V A;  3V9U A;  1S1X A;  3VQ6 A;  1LWE A;  1RDD A;  3ZT4 A;  4EP5 A;  3V1O A;  2DFE A;  3VQD A;  4CED A;  3EY1 A;  4BE0 A;  1S9G A;  2IOC A;  3O3G A;  3K57 A;  4CJT A;  3OS0 A;  2YKM A;  1U49 A;  1WLJ A;  4CJE A;  1L3V A;  4CEC A;  3QET A;  3SJJ A;  1WSJ A;  3NFA A;  4CGJ A;  3K58 A;  2BAN A;  2B5J A;  3TAR A;  2HND A;  1U4B A;  5J1E A;  3DI6 A;  4B9V A;  2G8W A;  2OPR A;  3I0S A;  4CF0 A;  4E89 A;  4W5O A;  4FK4 A;  2KZZ A;  3DLE A;  3D0P A;  4OKE A;  2YHA A;  4RG8 A;  5J2P A;  2FC0 A;  2GV9 A;  3LAL A;  4FW1 A;  3LWL A;  2WOM A;  1FKO A;  1ASU A;  4LH5 A;  1IH7 A;  4B9U A;  2VG6 A;  4KHN A;  1HPZ A;  4DQP A;  1CZB A;  4OKJ A;  4FJK A;  1JXE A;  4DSL A;  1RT7 A;  1NJX A;  3AVL A;  1IO2 A;  4CFB A;  3QEW A;  4Q0B A;  1ITG A;  3HPH A;  1HRH A;  4ID1 A;  1HYS A;  2AJQ A;  2D5R A;  3AO2 A;  3OYM A;  3AVK A;  2X78 A;  5T7B A;  2OPP A;  1BIS A;  1T03 A;  4CHZ A;  5CYM A;  1JXB A;  4CEF A;  4HUG A;  1NK4 A;  4FYD A;  3QEX A;  1RTH A;  4FVM A;  2FBY A;  4O0I A;  3QEI A;  3AA2 A;  3OYL A;  5J2M A;  1TKT A;  1WSI A;  4DSF A;  2VG7 A;  3I8D A;  4G1Q A;  1KRP A;  1HQE A;  3ZSW A;  4BDP A;  1KVB A;  3DYA A;  3T19 A;  5CZ1 A;  4FJN A;  2KTQ A;  2OA8 A;  2QXF A;  3RRH A;  3KD5 E;  4YFU A;  3LAN A;  2O4G A;  4E3S A;  2BE2 A;  4RW6 A;  4KHU A;  2YV0 X;  3L2U A;  4OGE A;  3OYF A;  4JRP A;  1S1W A;  5SZT A;  3NHG A;  4BDY A;  4NCA A;  1LWF A;  4BE2 A;  2HHU A;  3OYJ A;  4FLZ A;  4KRF A;  3ZT1 A;  1VSM A;  1U04 A;  4CJW A;  2HHT A;  4AHR A;  2KQ2 A;  3IAY A;  3V1Q A;  3LP0 A;  1EX4 A;  1RTJ A;  1UWB A;  3DLB A;  4KO0 A;  4RW8 A;  4H4O A;  1X9S A;  3F73 A;  4DU4 A;  4NCB A;  2IDO A;  3OY9 A;  1YVU A;  1RBS A;  3QIN A;  4LY7 A;  1BIU A;  3QNN A;  4FJI A;  4CEA A;  2EHG A;  4I2P A;  2OPS A;  2LSN A;  1I3A A;  1RDC A;  3NE6 A;  1D8Y A;  4KB0 A;  4J2A A;  4E7I A;  4KHW A;  1BCM A;  4B8A B;  1MU2 A;  3KKR A;  4IFY A;  4IG3 A;  5CZ2 A;  3OYI A;  3NH1 A;  3VA0 A;  4B9L A;  4DSI A;  4DQI A;  1DTT A;  5FRM A;  4FLU A;  5I42 A;  3MEC A;  3SUO A;  1RT2 A;  4W5N A;  1JLG A;  2OYQ A;  3AO5 A;  4CHO A;  5JS2 A;  4I9Q A;  4OLB A;  1Q9Y A;  2KFN A;  3HYF A;  1G15 A;  4DFJ A;  2HHX A;  4F4K A;  3TAQ A;  1KFD A;  3WNG A;  2FBX A;  3K5L A;  4N41 A;  1HJR A;  2W42 A;  4FJ8 A;  1GOC A;  4DLE A;  2G8F A;  2ZE2 A;  2QKB A;  3CFP A;  2G8V A;  3KLH A;  2R7Y A;  1EXQ A;  4DMN A;  4FCY A;  4O0J A;  3V9Z A;  3TAN A;  4CJU A;  3MXI A;  5DK5 A;  3SUQ A;  1RBT A;  4CEO A;  1B9D A;  3MEG A;  4W5T A;  4HTU A;  1TKZ A;  4B3O A;  2YNG A;  2P5O A;  4ELU A;  3LPU A;  2P5G A;  1Q9X A;  4MFB A;  4WE1 A;  1L3T A;  1QSL A;  2VG5 A;  1KLM A;  4DU1 A;  1RT6 A;  3LZI A;  4NYF A;  3OJU A;  4E7H A;  1N6Q A;  1C0M A;  3KK2 A;  2HVI A;  4DTR A;  3NF9 A;  2HB5 A;  3MXJ A;  2PYL A;  3V4I A;  3VQ4 A;  3LZJ A;  1C0T A;  3ITH A;  4ELV A;  2ITG A;  3VQQ A;  2E6M A;  2YNH A;  3SYZ A;  1A5W A;  1T8E A;  4CES A;  4CCH A;  3V81 A;  1I39 A;  1TL1 A;  1LAV A;  1XWL A;  3M8S A;  1NKC A;  4OPK A;  1RT1 A;  4B9N A;  1TAQ A;  4CF1 A;  3I0R A;  1IKV A;  3A2F A;  3TAG A;  3L2R A;  3HL8 A;  4CER A;  4CFA A;  3OYC A;  3L2V A;  1JLQ A;  4FM0 A;  1EP4 A;  1QS4 A;  2D0B A;  4IDK A;  4QCL A;  2B6A A;  2PZS A;  3DOK A;  1HQU A;  4FZZ A;  3SQ4 A;  4M41 A;  1TK8 A;  4DTJ A;  3QER A;  3SQ0 A;  4LD0 A;  4PY5 A;  3RMA A;  4FW2 A;  3O4N A;  4LSL A;  2Z1H A;  2KFZ A;  1S1U A;  4Y1C A;  3VQB A;  4KI4 A;  3C6U A;  3ZSO A;  1RT5 A;  2D0A A;  1D5A A;  3AVJ A;  3IG1 A;  4LH4 A;  1NK6 A;  4FK0 A;  2XO7 A;  3L3V A;  2OZM A;  1REV A;  1HMV A;  4DFP A;  4CHN A;  2XRI A;  4M3X A;  1JL1 A;  2XY6 A;  1S9E A;  4ID5 A;  5SWM A;  4DF8 A;  3QLH A;  3ZSR A;  1RCH A;  5FDL A;  3JYT A;  1CZ9 A;  1TL3 A;  3SV3 A;  3S3M A;  1LW2 A;  2G8H A;  2BGG A;  3DLK A;  4BWM A;  4N76 A;  1ZBU A;  1RT4 A;  2HNZ A;  4OPJ A;  4CJR A;  4J2E A;  1Y97 A;  3ZCM A;  4KKO A;  4FJL A;  3CFR A;  4HVJ A;  5KTQ A;  1TAU A;  1C6V A;  2G8I A;  3ALY A;  2F8T A;  1BQN A;  1NK9 A;  4N56 A;  5D3G A;  3M8Q A;  3ZT2 A;  1Z26 A;  3O3H A;  1XC9 A;  2JLE A;  2DFF A;  2PY5 A;  3TAB A;  3S9H A;  4DTU A;  1LAW A;  4EZ9 A;  1KSP A;  2ATQ A;  4GW6 A;  3OS2 A;  1RDB A;  4W5R A;  4DTM A;  4CGG A;  3AO1 A;  2Z1J A;  4JS5 A;  3ZSY A;  1TKD A;  4CGF A;  4DLG A;  5DMR A;  4FLT A;  3S3N A;  4FM2 A;  1NK8 A;  3SQ2 A;  2OZS A;  1KVA A;  1WAJ A;  1S1V A;  1UOC A;  3TI0 A;  3HK2 A;  1JLE A;  3H08 A;  4AHC A;  4M3U A;  2BDP A;  2OPQ A;  1BL3 A;  3AO4 A;  1BQM A;  4O4G A;  1C1A A;  1WSF A;  1UAX A;  2XY5 A;  2FBT A;  4RW7 A;  4HUF A;  1SUQ A;  1IKX A;  4PA1 A;  4B9M A;  5HRS A;  3THV A;  2ZQB A;  1IG9 A;  4Y1D A;  1YT3 A;  1VSE A;  1ZYQ A;  1VSF A;  4CIF A;  3LAK A;  3SPY A;  3KK3 A;  3DM2 A;  2F96 A;  3D45 A;  4E7K A;  4FJH A;  4CHQ A;  3AA4 A;  4CEZ A;  2XHB A;  3TAM A;  1Z25 A;  3PX4 A;  5KI6 A;  4B9T A;  4CJ3 A;  3SUN A;  3QO9 A;  2ETJ A;  5C42 A;  4FJM A;  1VSD A;  1A5V A;  3RTV A;  3PO4 A;  2YKN A;  4JRQ A;  5HBM A;  4K8Z A;  4CK2 A;  2Y1J A;  1WNS A;  3KIO A;  5J2N A;  4I7F A;  4DTN A;  1NKE A;  3LDS A;  3KTQ A;  1RT3 A;  4ZTJ A;  4Z4I A;  4DQQ A;  3OYE A;  4Z0U A;  4DFK A;  3OYA A;  1XHZ A;  4F2R A;  1RBR A;  3RWU A;  1QQC A;  3TAP A;  4AHS A;  4DSJ A;  4HCC A;  4M3Y A;  1LWC A;  4LSN A;  4BWJ A;  1QTM A;  4W5Q A;  3KKS A;  2RKI A;  4E7L A;  4H8K A;  1EET A;  4DG1 A;  1L3U A;  1NK5 A;  2HHS A;  3SZ2 A;  3E01 A;  2GUI A;  4CHP A;  3KLF A;  4M42 A;  3QIO A;  1O1W A;  4M3R A;  4TSX A;  3OYK A;  1D9D A;  4M3T A;  4HHT A;  1QSY A;  4Z4G A;  4UQG A;  1X1P A;  2DFH A;  2GBZ A;  4GVM A;  4FLW A;  3QNO A;  2P51 A;  3O4Q A;  1BIZ A;  1TK0 A;  2IAJ A;  3K5O A;  4JS4 A;  4N47 A;  4CJL A;  3SI6 A;  3ZT3 A;  1UA0 A;  2G8U A;  4CJS A;  3AO3 A;  2HNY A;  3AVF A;  3OYB A;  3S3O A;  3T3F A;  3BDP A;  3NDK A;  3SV4 A;  1QSS A;  5E41 A;  3K5M A;  1SL1 A;  4FK2 A;  1NJY A;  1NK7 A;  1X9W A;  2O4I A;  1B92 A;  1XHX A;  2NUB A;  3L8B A;  4NCG A;  3PY8 A;  1YTA A;  2PYJ A;  4CK3 A;  4NYN A;  3TAE A;  3HVT A;  3HT3 A;  4FJJ A;  3ISN C;  4CE9 A;  1NK0 A;  4IG0 A;  3LP2 A;  4QAG A;  5EU7 A;  4OLA A;  1A5X A;  3HO1 A;  3KLE A;  3EZ5 A;  4KTQ A;  3P5J A;  1SKS A;  2HHQ A;  2X6S A;  5K14 A;  1VSI A;  4HUE A;  4DS4 A;  1U45 A;  3LAM A;  4RW9 A;  1VSL A;  4YNQ A;  3QEP A;  1S1T A;  1J54 A;  1D9F A;  3EYZ A;  4CFC A;  4J2B A;  1DTQ A;  1DLO A;  1JKH A;  3K59 A;  1EKE A;  1VSJ A;  2DTU A;  1C1C A;  1GOA A;  4DTS A;  1RTD A;  4KAZ A;  1FK9 A;  4OKK A;  5J2Q A;  4EZ6 A;  5C25 A;  1L3S A;  1RBV A;  1K6Y A;  5CYQ A;  1RDA A;  3P1G A;  3NGZ A;  4KHY A;  1QE1 A;  3KK1 A;  3ASM A;  3B6P A;  4E7J A;  3TWH A;  3WNH A;  1JL2 A;  3K5N A;  3G10 A;  3IRX A;  4AH9 A;  2D0C A;  4I9L A;  4RW4 A;  4CEQ A;  2RF2 A;  3L3U A;  3C95 A;  4CK1 A;  4DSE A;  1J53 A;  1SKW A;  4J2D A;  2XY8 A;  3MED A;  2I5J A;  1VSK A;  3RMB A;  4CJ4 A;  4DS5 A;  5HRR A;  3NAE A;  1W0H A;  2KZM A;  3PO5 A;  1HYZ A;  2IS3 A;  1TKX A;  4CJF A;  1ASV A;  1KCF A;  3SCX A;  1KLN A;  2Q3S A;  1T05 A;  1CLQ A;  4F8R A;  1BHL A;  2VWJ A;  5FRN A;  3L2Q A;  4FZX C;  4BAC A;  1WSE A;  3SNN A;  1FXX A;  3LP3 A;  3OS1 A;  3L2W A;  2HW3 A;  3OYG A;  1SV5 A;  2P1J A;  3HST B;  3OYH A;  3PX6 A;  4E1N A;  1ZBL A;  1UA1 A;  4FJG A;  3FFI A;  4C8M A;  3M8R A;  4F3T A;  1SL2 A;  4B08 A;  3HVR A;  1WSG A;  4O5B A;  4HCB A;  3QEV A;  3DLH A;  3VQ8 A;  3CM5 A;  4CGD A;  1GOB A;  3V9W A;  4DQR A;  3V6D A;  3DRS A;  4FXD A;  2QKK A;  2E6L A;  2X6N A;  4CJV A;  4CJK A;  4FJX A;  4M45 A;  1CXU A;  1WAF A;  4OVL A;  1ZBF A;  4ZTF A;  3NGY A;  5KRS A;  3AVC A;  3NF6 A;  4AHT A;  3T1A A;  2WON A;  1N5Y A;  3UIQ A;  1KTQ A;  1RIL A;  1SKR A;  4KI6 A;  3DOL A;  1NOZ A;  3LPT A;  4JLH A;  3OJS A;  2A1S A;  2HVH A;  1T7P A;  2F8S A;  3RMC A;  5KGW A;  4MQ3 A;  4CJ5 A;  4C8L A;  4DF4 A;  4CF2 A;  1Q8I A;  4FM1 A;  4F3O A;  3M8P A;  1TV6 A;  3MEE A;  5HLF A;  3NF7 A;  3MXM A;  1J9A A;  3JSM A;  4KV8 A;  3PV8 A;  4N5S A;  3AV9 A;  2YHB A;  2IGI A;  3V9X A;  3AVI A;  4GMJ B;  4KHQ A;  3QES A;  1X9M A;  4FJ7 A;  3PX0 A;  1XI1 A;  3PUF A;  1WSH A;  3IS9 A;  3AVB A;  3HP9 A;  4BDZ A;  2Y1I A;  4AIL C;  2RPI A;  5HRN A;  1J5O A;  4KRE A;  4Z4H A;  4DTO A;  1NJZ A;  3AA5 X;  3V9S A;  4CFD A;  1NKB A;  4FJ5 A;  4ICL A;  4IKF A;  1HNI A;  4B8C A;  3CFO A;  4R5P A;  4Z4E A;  3AA3 A;  4AHU A;  4E19 A;  3WNE A;  3SQ1 A;  1KVC A;  3LWM A;  1JLA A;  2VWK A;  2QK9 A;  4FLY A;  2B4J A;  3OYD A;  4CGH A;  2EX3 A;  4CJQ A;  3CYM A;  1ZBI A;  2DY4 A;  3HPO A;  3RMD A;  3KD1 E;  1B9F A;  1CXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...