4CJWA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjwA00
1IO2A 1Q8IA 1FK9A 4CJQA 1KVAA 3DLBA 4DTNA 2XY6A 4CK3A 4FM1A 5C25A 1JXBA 1XC9A 4FLWA 1C0UA 3VA3A 1TKDA 4J2BA 1EP4A 2B6AA 2RN2A 3NH2A 4N56A 3VQCA 3CFRA 2X6NA 3SV4A 3ISNC 2W42A 1S5JA 3H08A 4GW6A 3S3MA 4YFUA 4KHNA 2NUBA 5J2NA 4CGIA 4HUEA 3ULDA 3P83D 3E01A 2XRIA 4CEBA 4G1QA 4IG0A 1LV5A 4Z4FA 2Z1GA 5DMRA 3DYAA 3MEGA 3RR8A 1Z25A 2HMIA 3QEXA 2OZSA 4KV8A 3IS9A 1LWCA 2OPPA 4DWIA 3AVBA 3OYGA 4DTXA 2PYLA 3ZCMA 4M41A 1NJYA 5J2PA 1EX4A 4C8KA 4EZ6A 2X78A 4KHUA 3OYHA 3S3OA 4KAZA 2BANA 4DFMA 3QEIA 4ID5A 5I42A 4CGDA 5FRNA 1EETA 3HL8A 1REVA 3MEDA 3OJSA 4B9NA 3VQ6A 2B4JA 3L2QA 1BISA 3C95A 2A1RA 1HJRA 4DS5A 2WONA 2XO7A 3HP6A 3SUQA 4TSXA 4HTUA 3IRXA 1FKOA 1Z26A 4B9SA 3RMBA 2EHGA 3HPGA 5KRTA 1N6QA 2HB5A 1J5OA 1CLQA 2YKMA 4CJ5A 1ZBHA 3O4NA 3V4IA 4OLBA 4DSIA 3AA5X 1ZBFA 4WE1A 3TR8A 4DMNA 3QIOA 3OYJA 1SV5A 2JGUA 3RR7A 2KZZA 2BGGA 1RT4A 4CHPA 4O0JA 3AO4A 4CEFA 1HRHA 4FZXC 3M8PA 3LP1A 1YVUA 1S9EA 4CEEA 3LAMA 1FXXA 2X74A 3THVA 3K59A 1RILA 3OYMA 4HHTA 1RBSA 2VG6A 2HVHA 2YV0X 4CGJA 4DSKA 4RW6A 1RNHA 5DK5A 1GOAA 2DFFA 4J2EA 3KLGA 4BE1A 3ZSWA 3OYCA 1W9HA 1JLBA 2E4LA 3ZSZA 4DTUA 1NJWA 1TGOA 4N76A 1LWEA 1ZBIA 3DLEA 2KW4A 3QLHA 4EP4A 3MAQA 4GVMA 3V9SA 1I3AA 5HBMA 3NHGA 3AVKA 3LZIA 3OYDA 1QHTA 4KHYA 1NJZA 1W0HA 1QTMA 3AA2A 3DI6A 3OYFA 3M8QA 3TAQA 4BACA 4E0DA 3CYMA 3ZSQA 4CIGA 5HRNA 3TAPA 1HPZA 1S1TA 1WSEA 4NYFA 4ZTFA 4FVMA 1VSKA 1A5WA 3MXMA 4CJSA 3JSMA 3AVHA 4E7JA 2G8HA 1LAVA 2HHXA 1VSDA 1SKRA 2PYJA 4F2SA 4FJXA 3DOLA 1EKEA 4LSNA 4CJLA 4E19A 4OPKA 3UIQA 4QAGA 4FJ9A 3AO3A 4KB1A 1LW0A 4FLXA 3LPTA 4CJWA 3ZSXA 4E1MA 1RTIA 1U04A 4DSEA 3KLFA 3AA3A 3AVJA 2PY5A 3T3FA 4CCHA 4M42A 2D0CA 1WSGA 5HLFA 1XWLA 2IGIA 1U48A 1X1PA 4CF9A 5I3UA 4DS4A 1C1AA 3HVRA 1RT7A 5CY4A 3QNOA 1NK4A 4N41A 1CXQA 4CJ3A 3SI6A 4DLGA 3WNHA 3VQPA 1NOZA 2O4IA 3KTQA 4C8LA 4NCGA 2HHSA 2HHUA 1SL2A 3C6TA 2VG7A 4IG3A 2GV9A 4UQGA 4OKKA 4DLEA 3V9XA 1JLQA 5KGWA 1U45A 2G8IA 3OYAA 4DF4A 1WLJA 4C8MA 4RW8A 3OJUA 1I39A 4FYDA 1HYVA 5CYQA 3RMCA 3FFIA 4LY7A 4BWJA 4DTOA 1B92A 4M3YA 2E6MA 4CFBA 3SV3A 1U49A 3QERA 1SL0A 4CE9A 1JLGA 2XY7A 3ITHA 1LAWA 1NJXA 1ZBLA 2Y1IA 1A5VA 2VWJA 3ZSOA 2Y1JA 1NK8A 3K5LA 3U6FA 3QO9A 1TK8A 1S9GA 1TAQA 4DQPA 2XHBA 4Z0UA 1KFSA 4CEAA 3AO2A 1JLFA 1WN7A 3VQ4A 3KK3A 4FLTA 3L8BA 2HHWA 1F21A 3LAKA 4M3UA 3O3HA 3SYZA 1IKYA 4FW1A 3HO1A 4CF1A 4C8OA 5KI6A 3M8RA 1D9FA 4Y1CA 4Y1DA 2QK9A 4ELTA 2YNFA 4PUOA 4J2DA 3VA0A 3PV8A 3SJJA 4F3TA 4CFDA 3NE6A 3NAEA 1C0TA 1VK0A 1WAFA 2DFHA 4CJEA 3PO4A 4F4KA 3K5OA 3BDPA 1RT3A 3WNEA 3KK2A 4W5TA 3V9WA 3L3VA 2OA8A 3QESA 4Z4IA 4OPJA 1BQMA 3IG1A 4DQSA 4CIFA 4Z4EA 4H4MA 1WSFA 5K14A 2RF2A 2XY8A 3LPUA 4KREA 2ITGA 2G8VA 4M3XA 1QQCA 2AJQA 3K5NA 3TAEA 3K57A 5SWMA 3LWMA 5J1EA 1RTJA 4I7FA 1NK0A 4Z4HA 4B08A 1J9AA 3EYZA 3TAFA 2XY5A 4Z4GA 1VSLA 4I9LA 3OY9A 1UA0A 4EZ9A 4OJRA 1NOYA 3CQ8A 4JRQA 5FDLA 4FJ5A 4E1NA 4DTSA 2FBYA 1TL3A 2BE2A 3OYKA 4I9QA 4FM2A 4OKEA 4W5RA 4AHVA 1UA1A 3K2PA 3NBPA 2IDOA 2HHQA 3OVNA 4H4OA 4FJMA 3AVMA 3BGRA 4CHQA 4BDZA 1ZYQA 1N5YA 1QSSA 4FJLA 1KCFA 2OZMA 4RG8A 2IOCA 2JLEA 1MU2A 3HP9A 2F8SA 5EU7A 4CJPA 2HVIA 1K6YA 3T19A 1RTHA 3SQ1A 4ELVA 1RBVA 3AA4A 1QSYA 4N47A 3LP3A 3KJVA 4IDKA 1S1VA 3G0ZA 4CF0A 1RT6A 3TABA 4FXDA 4RW9A 3NF6A 4ICLA 3PY8A 3VQEA 3CFPA 1UOCA 4LH5A 4EP5A 4CEQA 4ZHRA 3HM9A 1NK5A 4DSJA 3SUOA 4FJ8A 1VSJA 3L2RA 3LZJA 2ZE2A 1TK5A 4OLAA 5JS1A 1VRTA 1SUQA 4CJFA 1BIZA 4CERA 3SUPA 1Y97A 3L3UA 3EZ5A 1DTQA 3ZSYA 4M3WA 1T7PA 4IFVA 3T1AA 2G8KA 4E7LA 1RT2A 3DRSA 3VQDA 4AHUA 1UAXA 1JXEA 3K5MA 3SNNA 4O55A 4Q5VA 3O3FA 1BQNA 1KTQA 1VSFA 1BIUA 2HNZA 4CIEA 3DLHA 4B9UA 2GBZA 1S6QA 3LALA 3NCIA 4GMJB 4FLYA 2Z1IA 4B9MA 3O3GA 4KFBA 1S6PA 3RWUA 1L3UA 1IG9A 4M3ZA 3LP2A 4MFBA 2EX3A 2VG5A 4FLZA 2G8WA 4E7IA 4CF2A 4NYNA 3CFOA 4O44A 4DFKA 2KFZA 3CG7A 3KIOA 1HQUA 4BWMA 4AHRA 3TAGA 3SPYA 1DLOA 4CJVA 4FJJA 3AVAA 4Z4CA 4M3RA 3I8DA 3OS1A 1VSHA 4HUFA 1B9FA 3O4QA 4KTWA 3TWHA 3PX0A 1XI1A 4B9LA 4QCLA 3MECA 1JLAA 2WOMA 2IAJA 2R7YA 4DF8A 4DTMA 4DFJA 1D5AA 1HNVA 1UWBA 1QS4A 1XHXA 4PA1A 3AV9A 1BGXT 1RBRA 1T05A 4PQUA 4Q0BA 3VQ7A 4CEDA 3P1GA 3KD5E 3CM6A 3AVCA 3NGYA 3DOKA 3V1OA 1WNSA 5T7BA 1BI4B 1LW2A 3S3NA 3ZSRA 2P5GA 3TARA 4FK2A 4CJKA 3I0SA 2F96A 3KKRA 3HJFA 5HRRA 1Q9XA 2OPQA 3WNGA 3RTVA 4KI4A 1VSEA 5HRPA 2KTQA 3PUFA 3SUNA 4O5BA 4FJKA 3HVTA 3SQ0A 1TV6A 4FJIA 4QOZB 3DLRA 3I0RA 3OS0A 1KLNA 2IS3A 4YNQA 2G8UA 2HW3A 3VQ8A 1ASVA 2LSNA 1HYSA 1KFDA 1IKVA 4OGCA 4CGFA 1TAUA 4RW4A 3V81A 4AILC 3ZSVA 3AVGA 3L2WA 4CK2A 3D0PA 4KTQA 1BCMA 5E41A 4H8KA 2HHTA 2P5OA 2YKNA 3PO5A 3B6OA 3DMJA 1RTDA 4DTPA 1GOBA 1JKHA 1D8YA 4AH9A 1RT5A 1Q9YA 3HT3A 4LSLA 3KLIA 5JS2A 4ZTJA 2F8TA 1U47A 1CXUA 3NF8A 4DU4A 4KTZA 4CF8A 1RCHA 1RDBA 4HUGA 1S1WA 3SPZA 4FJ7A 4FZYA 1L5UA 4KHWA 5KRSA 1L3VA 1S1UA 2YNHA 4AHCA 4B9TA 3NF9A 1IKXA 2D0BA 5KTQA 4JS4A 1ASUA 1IH7A 4B8AB 4CEOA 3RMDA 3C94A 3NGZA 3HK2A 4PWDA 3OYIA 2D0AA 2I5JA 3VN5A 1RDCA 3S9HA 1KVBA 4C8NA 4KHQA 1ITGA 4E7KA 3RMAA 3SZ2A 1VSIA 4HCCA 2Z1HA 2KQ2A 2QKBA 5SZTA 1HYZA 4ELUA 1LWFA 4O0IA 3EY1A 4BDPA 3OS2A 2YHBA 3NGIA 1JLCA 1ASWA 4I2QA 1GOCA 3QEVA 3B6PA 2ETJA 4IBNA 2Q3SA 2DY4A 2P1JA 2DFEA 3P5JA 4KI6A 1JL2A 3DLKA 4M3TA 2Z1JA 3D45A 1WSIA 1G15A 3VQBA 3U3YA 3PX4A 2KZMA 1R0AA 2HHVA 1WAJA 3ZT1A 2QKKA 3QETA 5CYMA 1C1CA 3QINA 3QNNA 2HNYA 3IAYA 3JYTA 2PZSA 4CJ4A 1X9SA 4B3OA 3A2FA 3KLEA 4W5NA 1YT3A 4IKFA 3ASMA 3K58A 5J2MA 4DQRA 4BDYA 1NK7A 4E89A 2FBTA 4CHYA 2GUIA 5FROA 1NK9A 3NH0A 4FJGA 4PY5A 3MXJA 1JLEA 4FLUA 3HPHA 4FJHA 4J2AA 4JLHA 1TKTA 4CK1A 4R5PA 2X6SA 2YNIA 4AHTA 4FM0A 3PX6A 3TAMA 5HROA 1SKWA 4L8RB 3HXMA 1EXQA 3ALYA 3LP0A 5C42A 3ZT4A 2ATQA 4DSFA 3G10A 1SKSA 4BE2A 4B9VA 1X9MA 1DTTA 1KSPA 1RDDA 1ZBUA 3QEWA 1NK6A 4F8RA 2DTUA 2A1SA 3OYBA 1TKXA 4FLVA 2O4GA 2E6LA 5CZ1A 3C6UA 2KFNA 4OKJA 1X9WA 2ZD1A 3V9ZA 4XIUA 3QEPA 5HP1A 5HRSA 4CJRA 3L2VA 4DFPA 2P51A 4DTRA 5FRMA 1KRPA 4F3OA 1WSHA 1A5XA 3ZT0A 4CJTA 4ID1A 3MXIA 2G8FA 3KK1A 1O1WA 3DM2A 3HSTB 1CZBA 1IKWA 3LANA 3NFAA 3LWLA 4DU1A 4CHZA 3SQ4A 1SL1A 2OPSA 4OGEA 3HYFA 4F2RA 4FW2A 3SQ2A 1L3SA 3AVLA 3MEEA 1C6VA 4JS5A 2RKIA 1HQEA 3NF7A 2QXFA 4W5QA 2FBVA 1L3TA 1YTAA 3VQ9A 4DSLA 4KRFA 4DTJA 3AVFA 1TVRA 1QSLA 4CGGA 3OYNA 4KHSA 4KB0A 3U3GA 1J53A 1KLMA 2ZQBA 2D5RA 4K8XA 4O4GA 1VRUA 2FC0A 1HMVA 4DG1A 4HVJA 1T8EA 1B9DA 1QE1A 4LD0A 1WSJA 1RBTA 4CECA 1TL1A 1NKEA 2IC3A 1BL3A 4KO0A 3NDKA 1NKCA 3LDSA 4E3SA 4FK4A 1TK0A 1J54A 4CFAA 1BCOA 4RW7A 3L2UA 3OYEA 3KKSA 2OYQA 3DRPA 1C0MA 1YTUA 1D9DA 5J2QA 4DQQA 2HNDA 1BI4A 4KPYA 4W5OA 3VQ5A 3QIPA 3ZT3A 3V6DA 1NKBA 4KKOA 4OVLA 5KGXA 1U4BA 4K8ZA 1HNIA 3DLGA 3AO5A 4CHOA 3HPOA 4BE0A 3SCXA 4JRPA 2OPRA 3KD1E 3ZT2A 3KLHA 1KVCA 3F73A 4N5SA 5D3GA 3AO1A 3VQQA 4CHNA 1T03A 1S1XA 1RDAA 1XHZA 2VWKA 3V1RA 2RPIA 1JL1A 4IFYA 4NCAA 3VQAA 3TANA 1TKZA 4NCBA 5CZ2A 2B5JA 4B8CA 4CESA 4E7HA 1C1BA 1RT1A 4FK0A 4FJNA 3CM5A 5C24A 4FZZA 3TI0A 4CJUA 4DQIA 1CZ9A 4AHSA 3AVIA 3RRHA 2BDPA 3V9UA 3NH1A 3AVNA 4CGHA 3DRRA 4MQ3A 4CEZA 4I2PA 3V1QA 1RBUA 4CFCA 3F9KA 3OYLA 4M45A 4HCBA 1VSMA 3WNFA 1FKPA 4FCYA 2YHAA 4LH4A 1BHLA 2YNGA 3RRGA 2FBXA 3M8SA 4DU3A
chains in the Genus database with same CATH superfamily
1KVAA 3GDQA 4FM1A 5C25A 3DXMA 2HMPA 1EP4A 5AQYA 3NH2A 4N56A 4BR9A 2ASMA 3S3MA 2NUBA 3ULDA 4KH4A 2XRIA 3EZWA 4WFAL 4LF9K 1LV5A 4CBUA 3RR8A 4HTLA 4KV8A 1LWCA 2OPPA 3AVBA 3U9ZA 4M41A 5BRHA 4KAZA 5FRNA 3G25A 4CGDA 3L2QA 2A1RA 4DS5A 1KXPA 4KH6A 4TSXA 3IRXA 1Z26A 3IKMA 1WB9A 3EKSA 2YKMA 3TSPA 4BRGA 2A41A 1N36K 2JGUA 2O8DA 2GWJA 2BGGA 4O0JA 4CEFA 1HRHA 3M8PA 3CETA 2IVPA 1BOTO 1Q18A 4DV7K 3OYMA 2HVHA 2HBJA 2YV0X 4RW6A 4BVPA 2E2PA 5AZJB 2HSTA 3OYCA 4IDHA 1GLFO 3ZSZA 5AJ3K 4N76A 3MCAB 4C1NI 4EP4A 2IVNA 4JK7A 3NHGA 3VETA 3OYDA 4KHYA 5LJVA 1VQ9N 5FLXO 3J7YP 4BACA 3CCMN 3ZSQA 3TAPA 1S1TA 4FVMA 5FPNA 2UXDK 1A5WA 3MXMA 3JSMA 3MWTA 4E7JA 2HHXA 1YXQA 4YOTA 4OPKA 3UIQA 3RSEB 1GLLO 4CJWA 3ZSXA 4X62K 3UE5A 3AVJA 4CJ7A 2D0CA 1WSGA 2IGIA 1J6ZA 2P9PB 4CF9A 1C1AA 3HVRA 3QNOA 4CJ3A 3WQUA 4DHYA 2PFUA 3EE9A 3WNHA 3VQPA 1NGFA 5HOOA 3SBTA 3KTQA 4DV6K 2HHSA 3VEYA 3MN6A 3ZEUA 2VWBA 4OKKA 1JLQA 1QQOA 5CE3A 4LFAK 5KGWA 5EX5A 2CGLA 4C8MA 4U67L 4LY7A 5AQLA 3SV3A 3QERA 2HOEA 3MWPA 5TKWA 3MX2A 4ILGB 1Z6RA 2XY7A 3SAHA 3CCSN 2Y1IA 3ZSOA 1WOQA 3QO9A 1TAQA 3HRGA 1YVNA 3L4QA 5DM7L 2XHBA 4Z0UA 2W6KA 3C6HA 1WN7A 1EWQA 3O3HA 1IKYA 4M63C 4ELTA 2YNFA 3NE6A 4ILJA 1VK0A 1WAFA 3A5NC 3PO4A 3K5OA 3BDPA 3WNEA 3KK2A 3V9WA 1HJOA 3IG1A 4H4MA 5C12A 5K14A 4FSVA 4YDUA 2ITGA 3B8AX 2G8VA 5M1FA 2AJQA 3K5NA 3T69A 3K57A 5SWMA 3LWMA 5J1EA 4B08A 3OA9A 1J9AA 4I9LA 3OY9A 4OJRA 1DGKN 3CQ8A 4KBOA 4JRQA 5FDLA 4JI4K 4FJ5A 4E1NA 3FZLA 4IO8A 4DTSA 1TL3A 3OYKA 4I9QA 4FM2A 4W5RA 3O6WA 3M3ZA 3NBPA 2QEXN 1S72N 5AQPA 3SAFA 4ISFA 4CHQA 4BDZA 1ZYQA 4DV0K 3LL3A 2HBMA 1EQYA 2Q2RA 2F8SA 3E66A 3O1WA 2E2NA 4H0OA 1QSYA 1IJJA 4N47A 3UKRB 4CF0A 1RT6A 4ICLA 2QXLA 1UOCA 3AAQA 4LH5A 4FPBA 4DSJA 1VSJA 3L2RA 4Y0WA 3QFPA 4BQLA 3L3UA 4YOUA 3ZSYA 2O8EB 1VQ7N 3K9KA 2G8KA 1RT2A 3DRSA 1X9WA 2P9NA 1UAXA 2Q31A 3FZHA 1SKRA 1BQNA 3LALA 4GNIA 3P4IA 2QI2A 3D6RA 3RWUA 1L3UA 1ATNA 3CMAN 2G8WA 4E7IA 4CF2A 2E1YA 4MDAA 3CFOA 2KFZA 3CG7A 4BWMA 3TAGA 3SPYA 1O13A 4DV3K 4FJJA 4KTWA 4OO1J 3D7EO 1JLAA 2WOMA 2IAJA 3O9UA 4Q0BA 3AV9A 4FOIA 1T05A 3LDPA 3NGYA 3VENA 2P5GA 4FK2A 3HJFA 3KKRA 3CHWA 1Q9XA 3O4WA 1VSEA 4H5TA 2H3GX 3PUFA 3HVTA 3R9PA 2VYPA 5AR0A 1TAUA 4RW4A 3V81A 1FW6A 3D0PA 3CCEN 2O8FA 2UUBK 3PO5A 4GV9A 3HBTA 1HKGA 4LF7K 3KHYA 4DKWA 1U47A 4KTZA 4CF8A 3J81O 4MO4A 2UXBK 2YNHA 3NF9A 3ULEA 4X66K 1TUYA 3AY9A 3C94A 4PWDA 3S9HA 3CERA 4C8NA 2Z1HA 2QKBA 1NGIA 5C2DA 1LWFA 5BRFA 4O0IA 3EY1A 4LF8K 4B3SK 2W41A 5JLFA 3TTDA 2NRHA 1ESVA 3P38A 3M1FA 2DY4A 3J80O 4CD1A 4M3TA 3JXUA 3D45A 4BRAA 2KZMA 2QKKA 5CYMA 1NGHA 4YOYA 5LMNK 3EN9A 3QNNA 5AQVA 1X9SA 3A2FA 2ZJPL 4W5NA 5GIOA 3ASMA 1NK7A 1IBLK 2FBTA 2GUIA 3C65A 1GLDG 4BG8A 2YNIA 3CJCA 4FM0A 1SKWA 1OH7A 1QQNA 2A40A 5C42A 3ZT4A 2ATQA 4BRDA 3G10A 1SKSA 3VGMA 1DTTA 4JHDB 4KH5A 4B1VA 2A1SA 1NMNA 2P9UB 1SQKA 3FLCO 1RGIA 2E6LA 5CZ1A 4OKJA 2ZD1A 5HP1A 3W0LA 4CJRA 5HRSA 5LL6Z 3L2VA 4DTRA 3ENBA 4F3OA 1HKCA 4CZLA 3VTIA 2HW3A 3NFAA 3CCVN 3HYFA 5AQFA 3UKUA 3JAMO 3SQ2A 1YTAA 3VQ9A 1QZ5A 2IIRA 1TVRA 1QSLA 4CI6A 3U3GA 4V19S 5KPTA 1K8AO 2NRTA 2ZQBA 3G71N 3VGKA 1VRUA 4GV3A 5AQUA 3ENHA 1T8EA 4LD0A 1NKEA 2GELA 5CR4A 3NDKA 1ZBIA 4E3SA 1Z05A 1TK0A 1J54A 2FSNA 1WBDA 4K25A 3DRPA 4K43A 3TSUA 3CPWM 4IJNA 3GBTA 4R79A 3VQ5A 3ZT3A 4W5OA 1NGCA 1U4BA 2W6LA 3QMLA 4CHOA 3WT0A 3KLHA 4N5SA 5D3GA 1RDAA 2P9IA 2VWKA 3CCRN 3V1RA 4DV4K 4CZFA 4NCAA 3TANA 3D2EB 1W97L 1BUPA 2NRXA 4CZEA 1C1BA 1RT1A 4FK0A 5C24A 3CF5L 4YORA 4CJUA 4JI1K 4F9OA 2F9WA 3DRRA 4I2PA 3V1QA 1RBUA 4HCBA 3TU5A 2YHAA 4LH4A 1MWMA 2YNGA 2FBXA 2P9SA 1IO2A 4XH5A 2GWKA 1FK9A 2OTLN 5AQHA 4CK3A 4BC5A 4FLWA 3VA3A 1TKDA 1XC3A 4J2BA 2B6AA 2RN2A 4JKGB 3VQCA 1KC8O 4KHNA 4YFUA 3THYA 1E3MA 4HUEA 3E01A 4BR4A 4IG0A 5DMRA 3DYAA 3MEGA 3QEXA 2QWQA 5AQJA 4FL9A 3IS9A 3D2FB 4DWIA 4DTXA 4EZ6A 4MDBA 1EX4A 2X78A 4KHUA 3GOIA 1BG3A 3QEIA 5I42A 2YCHA 1EETA 1REVA 1TYQA 1VQON 3OJSA 4B9NA 4E1JA 2B4JA 3C95A 1ZC6A 4BRIA 2WONA 3ID8A 3LDNA 4B9SA 2EHGA 1N6QA 1BA0A 3HM8A 2YJEA 3O4NA 4OLBA 3AA5X 3TR8A 4EFHA 3QIOA 1SV5A 1YJWN 1QVFM 3H45C 2UXCK 4CEEA 1S9EA 3K59A 3QFUA 1RILA 4HHTA 3IUCA 2CH6A 4NLCA 5DK5A 5ADXA 1GOAA 3O8MA 4J2EA 3QBXA 3KLGA 4BE1A 4BR0A 2FSJA 1W9HA 1JLBA 2E4LA 1NJWA 2CH5A 1TGOA 3MDQA 1LWEA 4JKBA 3V9SA 2KW4A 4GVMA 5BN8A 4JI3K 1GLAG 5HBMA 3H3NO 1W0HA 1QTMA 3WXMB 4BRNA 4BRMA 3CYMA 1WSEA 1VSKA 4AM7A 4BC4A 3J7AP 1VSDA 1X3NA 3VEVA 4CJLA 4FJ9A 1LW0A 3MN9A 3THXB 4DSEA 3RSEA 5M1KA 3T3FA 4CCHA 5A2QO 1NGEA 4C1NK 4N41A 5CY4A 3H6EA 3BF3A 4DLGA 1OKJA 2P9PA 1S22A 1KAYA 4BG9A 4C8LA 4NCGA 2HHUA 1SL2A 3C6TA 3DAWA 2VG7A 3A0IX 4IG3A 3OTOK 2NRVA 4UQGA 3VOVA 2E2OA 2G8IA 1WLJA 1I39A 4WF9L 1HYVA 1B92A 3I33A 3SMPA 1U49A 3E9OA 1M1KO 1JLGA 1LAWA 3MX5A 4PKIA 2V7ZA 1NK8A 3K5LA 3CCQN 3U6FA 4YOXA 2O8CB 1S9GA 4DQPA 4JI5K 2WC9A 1JLFA 3VQ4A 4FLTA 3AAPA 4BR2A 5BN9A 3L8BA 1WBBA 1HNXK 3HO1A 4C8OA 5KI6A 3VF4A 4Y1DA 4I6MB 1XMOK 3AGRA 4J2DA 3PV8A 3SJJA 4BVOA 4CJEA 5BPLA 4F4KA 3CC2N 1VAZA 1VQ5N 3L3VA 3O5BA 4FWLA 4CIFA 3RVCA 3W3DA 1WSFA 4Z4EA 2XY8A 4BREA 3EO3A 4O8UA 4B1ZA 3TAEA 4CVNE 3SMSA 2XY5A 4EZ9A 1UA0A 1NOYA 3VTHA 5IWAK 4OKEA 4AHVA 4GY2B 2ZGZA 5GIPA 4H4OA 3AVMA 3BGRA 4FJLA 1J5EK 4RG8A 3VESA 2Q1NA 4H0VB 2HVIA 3T19A 1X9JA 5JMVA 2ZWHA 4ELVA 1RBVA 4IDKA 4DQ8A 3BZCA 4IZ9A 2JWLA 3NF6A 3PY8A 4FOEA 3CC4N 3VQEA 4EP5A 1YHQN 2QWMA 3UKRA 4FJ8A 4JKEA 4OLAA 5JS1A 1SUQA 1T44A 3EZ5A 3KVGA 5AQQA 2ASPA 4M3WA 1T7PA 3SLCA 1J5OA 3K5MA 2O8EA 4O55A 4B9UA 1KTQA 2HNZA 3MMVA 4JD2A 2GBZA 3NCIA 4GMJB 4DR7K 1D4XA 3FGUA 3O3GA 4DR1K 4KFBA 1IG9A 1G99A 1XUPO 2HBLA 5BPNA 4AHRA 3KWIA 2WTUA 1BU6O 1VQMN 2O8BB 4RTFD 1VSHA 1VQLN 1B9FA 3MECA 3U9DA 4DF8A 4DTMA 2UUCK 1YAGA 1D5AA 4DFJA 4PQUA 1RBRA 4CEDA 2YJFA 3P1GA 3CM6A 3AVCA 4NXNK 1WNSA 3TARA 3CI5A 1XMQK 1EO1A 3VEZA 5HRRA 3RTVA 3WNGA 3KK7A 4K41A 5I9EB 4KI4A 5M1OA 1X3MA 3C7NB 1YJ9N 3SUNA 1T6CA 4O5BA 3BUZB 3OS0A 2IS3A 2G8UA 2E8AA 5GAHP 1IKVA 4CGFA 3U8XA 3THWA 5AQTA 3L2WA 5E41A 4H8KA 3MN7A 4AF1A 3OBWA 4B1UB 3VMFB 2P9LA 2QWOA 1RTDA 4DTPA 5AZIB 4FWKA 1RT5A 1Q9YA 3HT3A 3KLIA 5JS2A 4ZTJA 2QWNA 2F8TA 3SPZA 4FJ7A 1RCHA 4HUGA 1GLBG 5GAEP 4CZIA 1E4GT 1IBMK 4L3QA 1IKXA 3TTFA 3RMDA 1ASUA 1IH7A 3O80A 4CEOA 3DXMB 3HK2A 4IWVA 3FZKA 2I5JA 1KVBA 4KHQA 4E7KA 2CGKA 4BDPA 1FJGK 4K42A 2CGJA 4B3TK 5GINA 1JLCA 4BROA 3GL1A 4I2QA 3QEVA 2Q3SA 2P1JA 3FZMA 1HUXA 2A5XA 3DLKA 2Z1JA 2A6AA 1WSIA 1N32K 1G15A 3U3YA 1R0AA 1WAJA 4MLHA 5M1QA 3JYTA 2HHHK 3ZX2A 1W7AA 5J2MA 4DQRA 2A42A 3SK3A 3ZETA 3CIPA 3NH0A 4FJGA 4PY5A 4X65K 1JLEA 3A5OC 3HPHA 4BGAA 4CK1A 4BR5A 4R5PA 4KRFA 5HROA 3TAMA 2O8DB 1EXQA 4DSFA 4UY8O 4CBWA 1V4TA 2NLXA 2W40A 1RDDA 4JI2K 1P90A 3AARA 4FLVA 3TPQA 4JHDA 3M5RA 1Q7YO 2P51A 3LDOA 4IOXA 3TTCA 2D4WA 1Y64A 5AFUH 5FPMA 3KK1A 5F1XA 1O1WA 3DM2A 2G8FA 1CZBA 3LANA 4DU1A 3BF1A 2OPSA 2P9KA 4OGEA 5IT9O 3BY5A 3MK6A 3AVLA 2RKIA 1HQEA 2OANA 2QWRA 4IOAL 5FPDA 1L3TA 1C0FA 1U6ZA 5AQKA 4KHSA 2I7NA 4KB0A 1WUAA 1KLMA 2D5RA 1B9DA 1QE1A 4CECA 1BL3A 2WBNA 3EE8A 2ASOA 4FK4A 1BCOA 3KKSA 1SZ2A 2ZF5O 1D9DA 1BI4A 3FZFA 1MA9B 4KKOA 1NBWA 4K8ZA 4WFNL 3DLGA 2KHOA 4BC3A 1N8RO 3ZEUB 4CHNA 1T03A 4NLBA 2RPIA 1VQNN 4IJAA 4NCBA 3VQAA 1TKZA 4CBXA 3CM5A 1JCEA 1HX1A 4ISGA 2VQEK 3AVIA 3D2EA 3V9UA 3AVNA 1DKGD 3L4IA 4CEZA 3J7ZO 4FO0A 2F9TA 3CJ9A 2A3ZA 3RRGA 1FKPA 2DPNA 1NGDA 1K9MO 3M8SA 4FWMA 1Q8IA 5M1PA 2EWSA 1S3XA 3DLBA 5AQRA 2XY6A 4H5NA 4GKJK 1XC9A 4EAHD 2V7YA 4DR4K 3CFRA 2W42A 3H08A 4GW6A 5J2NA 3P31A 4PHTX 3NVMA 4CEBA 4G1QA 4Z4FA 5F2RA 1KAZA 1Z25A 1GLJO 4CZMA 3VF6A 2OZSA 1NLVA 4JYAK 3ZCMA 4C8KA 2VCPA 3F9MA 3D2FA 3HL8A 5AQMA 1SAZA 3VQ6A 1BISA 2QW9A 5FPEA 2XO7A 3HP6A 3SUQA 3H46O 1FKOA 3RMBA 3HPGA 1CLQA 1OVYA 1ZBHA 5E26A 5BR8K 3UB5A 3PSFA 1ZBFA 4DMNA 1I94K 3OYJA 3RR7A 4LFBK 4WYBA 2KZZA 1RT4A 4CD3A 4BRHA 4FZXC 1P8ZA 1YVUA 3THVA 2X74A 3S41A 3WEEA 4CGJA 2DFFA 4JEPA 1TUUA 4BR7A 2ZJRL 4GVEA 3CXCM 4Z94A 4LC9B 2IVOA 3QLHA 1IG8A 1QHTA 1NJZA 3AA2A 2ZGYA 4RCHA 4A5BA 4E0DA 1NU0A 4ZTFA 1HPZA 1M90O 3CCLN 1KAXA 2Q0RA 3AVHA 3G4SN 4F2SA 3LDQA 3O9RA 3I56N 5AQOA 3AO3A 1JCGA 4E1MA 3E9LA 5LY3A 1U04A 1V4SA 3KLFA 4M42A 1U48A 4C23A 1RT7A 3SI6A 1JJ2M 2O4IA 2GV9A 4DLEA 3OYAA 4RW8A 5CYQA 3FFIA 4BWJA 4DTOA 3Q7CA 4H0PA 3CJ1A 2E6MA 4M3YA 3LDLA 3LM9A 3CQXA 2O8FB 3CJ7A 3DLLL 4IO9L 3MN5A 3WQTA 1JCFA 2E5LK 5E84A 4GV6A 3KK3A 2O8CA 4QS9A 2HHWA 1F21A 4WCEL 3LAKA 4M3UA 3SYZA 3M8RA 1D9FA 2D0PA 2F7TA 4BRCA 3VA0A 3WXLA 4F3TA 1VHXA 2DFHA 4Z4IA 3QESA 1BQMA 3O1BA 2RF2A 3LPUA 3I8BA 1QQCA 2FXUA 4H5WA 1RTJA 2D0OA 3TSQA 1NK0A 4Z4HA 3TAFA 4Z4GA 5DM6L 2BE2A 2WFBA 3DWLA 1UA1A 3K2PA 2IDOA 3T1HK 2YI1A 4FJMA 1QSSA 1KCFA 2YHYA 5C2FA 2IOCA 2JLEA 1MU2A 3HP9A 2QM1A 1HLUA 2NZTA 1RTHA 3CCUN 3AA4A 4YOWA 1W2BM 3LP3A 3KJVA 4DR3K 1S1VA 3G0ZA 4H0YB 5AQZA 1VQ4N 1YITN 4RW9A 3CFPA 1NK5A 5AZJA 4CEQA 4GKKK 3SUOA 4IXCA 2VGNA 1VRTA 3A5LC 4CJFA 1BIZA 4CERA 1HPMA 5JVGL 4WQ4C 4IFVA 1LOTB 3T1AA 3ZLJA 4EHTA 3SNNA 4AHUA 4Q5VA 5GAGP 5LMUK 3DLHA 1VSFA 1BIUA 4CIEA 1YJNN 1S6QA 3UKUB 4FLYA 2Z1IA 2GEMA 1S6PA 4O5FA 4M3ZA 2EX3A 3E1YA 4IFEA 4DFKA 3KIOA 1HQUA 1OVQA 3SJHA 2OCEA 4JN4A 3AVAA 4M3RA 3I8DA 4DV2K 3PX0A 3TWHA 4QCLA 3WUHA 5BRDA 2R7YA 1U2VB 2FF3B 1MWKA 4PL8A 1XHXA 3KD5E 1HR0K 1BGXT 3VQ7A 3V1OA 3DOKA 3ZSRA 4CJKA 3I0SA 2F96A 3HOTA 4JKFA 1KQSM 3PIOL 4FWSA 3T1YK 2KTQA 3R3LA 3PSIA 2HBKA 4U7BA 4QOZB 3DLRA 2YHWA 1KLNA 3C7NA 4YNQA 3VQ8A 2P9IB 1KFDA 2AA4A 4CZKA 3R1XA 1OH6A 3VEXA 4AILC 4CK2A 1BCMA 2HHTA 4JI7K 3FFKB 4A2AA 3DMJA 3O08A 1JKHA 1D8YA 4JV5K 4LSLA 1CXUA 3NF8A 4DU4A 5AZIA 1Q82O 3VGLA 2P9SB 4KHWA 1L5UA 2AP1A 4OPHA 1L3VA 4AHCA 3AGKA 5LJWA 2D0BA 5KTQA 4B8AB 4XH1A 3NGZA 3VN5A 1RDCA 1ITGA 3RMAA 3SZ2A 4HCCA 2KLAA 3H3OB 2KQ2A 3THYB 3OW2M 4ELUA 3L6QA 2PAVA 4IBNA 2ETJA 5KQ8A 2DFEA 3P5JA 4KI6A 1JL2A 3VF2A 4PL7A 2HF4A 3VQBA 3PX4A 2HHVA 3ZT1A 4WQ5C 1TYQB 3QINA 2HNYA 5BPMA 2PZSA 4CJ4A 4B3OA 3Q7BA 3KLEA 4B3RK 4BY9C 4FWOA 4H5RA 5FROA 1T3VA 2FSKA 1QHAA 4B1XB 1TKTA 3PX6A 3LM2A 4L8RB 3ALYA 3LP0A 3I55N 2BUPA 2V52B 3GE1A 3F2KA 4B9VA 4H0XB 1X9MA 1KSPA 1ZBUA 3QEWA 4F8RA 2DTUA 3OYBA 1GLCG 2O4GA 3C6UA 4EHUA 4JKDA 3V9ZA 2UU9K 3O9TA 1VQKN 1NJIO 3DXKB 4B1YB 1A5XA 3L0QA 3ZT0A 1H1VA 4ID1A 3HSTB 1IKWA 2E20A 3SQ4A 3A8YA 4BRKA 4FW2A 4JNEA 4B9QA 4MLEA 1C6VA 4FWQA 4JS5A 5BR9A 2QXFA 5EOYA 1N33K 2RE2A 1K8KB 3T7ZA 1J53A 5BREA 3CD6N 1HMVA 3SBGA 2IC3A 1DT9A 1NKCA 1YF5L 3F5TA 2OYQA 1NM1A 3OYEA 4DR6K 1YTUA 4LF5K 4DQQA 2HNDA 5EY4A 2QWLA 2YX6A 3V6DA 1XQSC 5KGXA 4BE0A 3P39A 5AQXA 3SCXA 1OH5A 2OPRA 3ZT2A 3F73A 3AO1A 4FWNA 4JKAA 1JL1A 4IFYA 4LF6K 4IEEA 2B5JA 4E7HA 5TKYA 4DQIA 1BO5O 2BDPA 1HNZK 3VPZA 4MQ3A 4QS8A 2Q36A 4CFCA 3F9KA 4FCYA 1NGGA 1BHLA 4A2BA 5AQGA 4JI8K 4CJQA 4DTNA 3CJAA 1JXBA 3CQYA 1C0UA 3E9PA 5C15A 1ILYA 2X6NA 3SV4A 3ISNC 4XEIA 1S5JA 3DJCA 4CGIA 3P83D 4OX9K 3ZX3A 1GLEG 2Z1GA 2HMIA 1VQ8N 4WQ4A 4PKGA 3MCPA 3OYGA 2PYLA 1NJYA 5J2PA 4G9ZA 3N4PA 3OYHA 3S3OA 2BANA 4DFMA 4ID5A 4ILHA 3MEDA 1XNQK 4A59A 1HJRA 5JICA 4HTUA 5KRTA 2HB5A 4CJ5A 3ZYYX 3V4IA 3PIPL 4DSIA 4WE1A 3QDKA 3G6EN 2UUAK 4CHPA 3AO4A 3LP1A 5JVHL 3LAMA 1FXXA 1RBSA 2VG6A 4WFBL 2NNWA 2P9UA 3ATUA 3CC7N 4DSKA 4HWIA 1RNHA 2FLOA 3ZSWA 4DTUA 3VEWA 1C0GA 3DLEA 3MAQA 1I3AA 1NGBA 3LZIA 3AVKA 3IDHA 3J8AA 3CMEN 3DI6A 3OYFA 3M8QA 3TAQA 4M7YA 4CIGA 4JD2B 5HRNA 4NYFA 2NRWA 2NRRA 4DV1K 4CJSA 2G8HA 4DR5K 1LAVA 2PYJA 4FJXA 3DOLA 4NB4A 1EKEA 4LSNA 4E19A 1QVGM 4QAGA 4KB1A 4FLXA 5AQNA 3LPTA 4PKHA 1RTIA 2VGMA 5EVZA 3AA3A 2PY5A 5GADP 5AFUA 5HLFA 1XNRK 1XWLA 1X1PA 1NWKA 3H1QA 1N34K 1RDUA 5I3UA 4DS4A 1NK4A 1CXQA 2OTJN 5HL7L 3EL2A 3WXKA 4NXMK 1NOZA 2E1ZA 3OBYA 3V9XA 4H0TB 4JKHA 5AQWA 1U45A 2I7PA 4DF4A 3OJUA 4FYDA 2ZJQL 1NNEA 3RMCA 1HKBA 4DUZK 4CFBA 2UYTA 1RDWX 4X64K 1SL0A 3THWB 4WQ5A 4CE9A 2E2QA 3ITHA 3KWGA 2GUPA 4M7XA 4CZGA 1ZBLA 1NJXA 1A5VA 2VWJA 2Y1JA 2P9LB 4AM6A 1TK8A 3PLAA 5JLHA 1ZXOA 3M6GA 4KHPK 1KFSA 4CEAA 3AO2A 3GG4A 1BWFO 5CHIA 3BEXA 3QBWA 4NO7A 4FW1A 4CF1A 4Y1CA 2QK9A 4PUOA 4JKGA 4A61A 4CFDA 3NAEA 1C0TA 4JAXA 1CZAN 1IBKK 1RT3A 4JKCA 2OA8A 4W5TA 3ID6A 4OPJA 4DQSA 3HSCA 4KREA 4BQZA 4M3XA 1IV0A 3R6MA 4RWTA 4I7FA 2J4RA 3EYZA 1VSLA 1QZ6A 2FF6A 2FBYA 5F0XA 3BZKA 4H5VA 5H1SQ 2HHQA 3OVNA 4DB3A 1N5YA 1T6DA 2OZMA 5AQSA 3ZETB 5EU7A 4CJPA 2F4VK 1K6YA 2D1KA 3IMXA 3SQ1A 1MDUB 1QQMA 2E88A 3TABA 4FXDA 1R59O 3O9SA 4ZHRA 3HM9A 3JS6A 3N4QA 3H1VX 3SAGA 1RFQA 3LZJA 2ZE2A 1TK5A 3IFRA 3CPEA 3SUPA 4CZHA 1Y97A 4OPAA 2P9NB 1DTQA 2GX9A 4FWRA 4H03B 3ATVA 3HI0A 4E7LA 3VQDA 2HF3A 4BGBA 1JXEA 3O3FA 4J8FA 4FPAA 2P9KB 4LFCK 3VERA 4B9MA 4FWPA 1EWRA 3FR0A 3LP2A 4MFBA 1YI2N 2VG5A 5MLCQ 2VQFK 4FLZA 4NYNA 3EKUA 4O44A 4EIAA 3THXA 1DLOA 1LCUA 4CJVA 2QTDA 4Z4CA 1OH8A 3OS1A 1XI1A 4HUFA 3O4QA 4B9LA 4JK9A 4A5AA 1HNVA 1UWBA 1QS4A 4PA1A 2WUSA 1U2VA 3CJBA 1E4FT 1VQ6N 2V51B 5T7BA 3S3NA 1BI4B 1LW2A 2OPQA 4A57A 5B8HA 5HRPA 4LF4K 4FJKA 3SQ0A 1TV6A 4FJIA 1SS6A 3I0RA 3KZBA 1ASVA 2LSNA 1HYSA 5KPRA 3EEQA 4OGCA 1YUWA 3VEOA 3ZSVA 2RHKA 3AVGA 4KTQA 2NRZA 2P5OA 2YKNA 3ZX0A 4DV5K 2QA4N 1KD1O 3B6OA 4B3MK 1GOBA 4BRLA 4AH9A 4BRQA 4JK8A 3ULEB 1RDBA 3BP8A 1S1WA 4FZYA 5KRSA 1S1UA 4B9TA 4I6MA 4IEIA 4JS4A 3OYIA 2D0AA 1VQPN 1VSIA 1BA1A 1ZBSA 5SZTA 1HYZA 4JI6K 3OS2A 2YHBA 3NGIA 1ASWA 1GOCA 3B6PA 3QB0A 5AQIA 3WXJA 3C0BA 2ZM6K 4AQYK 5KQDA 5KPZA 1HNWK 3QETA 1C1CA 5ADXH 3K9JA 3IAYA 4O8KA 1YT3A 4IKFA 3K58A 5C0YA 3OHRA 4BDYA 4DR2K 4E89A 4CHYA 1DEJA 3HOSA 2KKZA 1NK9A 3MXJA 2BTFA 4FLUA 4FJHA 4XH4A 4JLHA 4J2AA 2X6SA 4AHTA 5M1NA 3C6AA 3HXMA 4BE2A 1NMDA 4DCHA 1ATRA 1NK6A 1TKXA 3WEEB 4CZJA 2KFNA 1Q81O 3HTVA 3QEPA 3HZ6A 4A62A 4XIUA 3CCJN 1K73O 4DFPA 5FRMA 1KRPA 4YDUC 1WSHA 2PBDA 4CJTA 4CW7B 3MXIA 2JWKA 1BDGA 3LWLA 1SL1A 5ELZA 3DXKA 3R8EA 4CHZA 4F2RA 2BH1A 1L3SA 3MEEA 3NF7A 2Q0UA 4W5QA 2FBVA 1NG9A 4DSLA 2Q97A 4DTJA 3AVFA 4YHHK 4JI0K 4CGGA 3OYNA 4IOCL 4FVUA 4K8XA 4O4GA 2FC0A 4HVJA 4DG1A 1WSJA 1RBTA 1K8KA 1TL1A 4YY3K 2O8BA 5EXWA 4KO0A 3LDSA 4CFAA 3L2UA 4RW7A 4BRFA 3WXIA 1C0MA 3U4LA 3ENOA 4BC2A 5J2QA 4KPYA 3QIPA 1NKBA 4OVLA 3QICA 1HNIA 2QWPA 3AO5A 3HPOA 4JRPA 2GTDA 3KD1E 1KVCA 3NMUA 1NGJA 3VQQA 3A5MC 1YIJN 1S1XA 3NVKA 1XHZA 4K0KK 4ISEA 4DUYK 3FE1A 5CZ2A 4CESA 4B8CA 1NGAA 4BRPA 1Q86O 4FJNA 4FZZA 3TI0A 1CZ9A 4AHSA 3RRHA 4YOVA 4QS7A 1ATSA 3NH1A 4CGHA 5C10A 3OYLA 2ITMA 4M45A 1VSMA 3WNFA 3K0SA 3O9QA 2YHXA 4B1WB 4MO5A 4DU3A
chains in the Genus database with same CATH topology
1IO2A 1Q8IA 1FK9A 4CJQA 1KVAA 3DLBA 4DTNA 2XY6A 4CK3A 4FM1A 5C25A 1JXBA 1XC9A 4FLWA 1C0UA 3VA3A 1TKDA 4J2BA 1EP4A 2B6AA 2RN2A 3NH2A 4N56A 3VQCA 3CFRA 2X6NA 3SV4A 3ISNC 2W42A 1S5JA 3H08A 4GW6A 3S3MA 4YFUA 4KHNA 2NUBA 5J2NA 4CGIA 4HUEA 3ULDA 3P83D 3E01A 2XRIA 4CEBA 4G1QA 4IG0A 1LV5A 4Z4FA 2Z1GA 5DMRA 3DYAA 3MEGA 3RR8A 1Z25A 2HMIA 3QEXA 2OZSA 4KV8A 3IS9A 1LWCA 2OPPA 4DWIA 3AVBA 3OYGA 4DTXA 2PYLA 3ZCMA 4M41A 1NJYA 5J2PA 1EX4A 4C8KA 4EZ6A 2X78A 4KHUA 3OYHA 3S3OA 4KAZA 2BANA 4DFMA 3QEIA 4ID5A 5I42A 4CGDA 5FRNA 1EETA 3HL8A 1REVA 3MEDA 3OJSA 4B9NA 3VQ6A 2B4JA 3L2QA 1BISA 3C95A 2A1RA 1HJRA 4DS5A 2WONA 2XO7A 3HP6A 3SUQA 4TSXA 4HTUA 3IRXA 1FKOA 1Z26A 4B9SA 3RMBA 2EHGA 3HPGA 5KRTA 1N6QA 2HB5A 1J5OA 1CLQA 2YKMA 4CJ5A 1ZBHA 3O4NA 3V4IA 4OLBA 4DSIA 3AA5X 1ZBFA 4WE1A 3TR8A 4DMNA 3QIOA 3OYJA 1SV5A 2JGUA 3RR7A 2KZZA 2BGGA 1RT4A 4CHPA 4O0JA 3AO4A 4CEFA 1HRHA 4FZXC 3M8PA 3LP1A 1YVUA 1S9EA 4CEEA 3LAMA 1FXXA 2X74A 3THVA 3K59A 1RILA 3OYMA 4HHTA 1RBSA 2VG6A 2HVHA 2YV0X 4CGJA 4DSKA 4RW6A 1RNHA 5DK5A 1GOAA 2DFFA 4J2EA 3KLGA 4BE1A 3ZSWA 3OYCA 1W9HA 1JLBA 2E4LA 3ZSZA 4DTUA 1NJWA 1TGOA 4N76A 1LWEA 1ZBIA 3DLEA 2KW4A 3QLHA 4EP4A 3MAQA 4GVMA 3V9SA 1I3AA 5HBMA 3NHGA 3AVKA 3LZIA 3OYDA 1QHTA 4KHYA 1NJZA 1W0HA 1QTMA 3AA2A 3DI6A 3OYFA 3M8QA 3TAQA 4BACA 4E0DA 3CYMA 3ZSQA 4CIGA 5HRNA 3TAPA 1HPZA 1S1TA 1WSEA 4NYFA 4ZTFA 4FVMA 1VSKA 1A5WA 3MXMA 4CJSA 3JSMA 3AVHA 4E7JA 2G8HA 1LAVA 2HHXA 1VSDA 1SKRA 2PYJA 4F2SA 4FJXA 3DOLA 1EKEA 4LSNA 4CJLA 4E19A 4OPKA 3UIQA 4QAGA 4FJ9A 3AO3A 4KB1A 1LW0A 4FLXA 3LPTA 4CJWA 3ZSXA 4E1MA 1RTIA 1U04A 4DSEA 3KLFA 3AA3A 3AVJA 2PY5A 3T3FA 4CCHA 4M42A 2D0CA 1WSGA 5HLFA 1XWLA 2IGIA 1U48A 1X1PA 4CF9A 5I3UA 4DS4A 1C1AA 3HVRA 1RT7A 5CY4A 3QNOA 1NK4A 4N41A 1CXQA 4CJ3A 3SI6A 4DLGA 3WNHA 3VQPA 1NOZA 2O4IA 3KTQA 4C8LA 4NCGA 2HHSA 2HHUA 1SL2A 3C6TA 2VG7A 4IG3A 2GV9A 4UQGA 4OKKA 4DLEA 3V9XA 1JLQA 5KGWA 1U45A 2G8IA 3OYAA 4DF4A 1WLJA 4C8MA 4RW8A 3OJUA 1I39A 4FYDA 1HYVA 5CYQA 3RMCA 3FFIA 4LY7A 4BWJA 4DTOA 1B92A 4M3YA 2E6MA 4CFBA 3SV3A 1U49A 3QERA 1SL0A 4CE9A 1JLGA 2XY7A 3ITHA 1LAWA 1NJXA 1ZBLA 2Y1IA 1A5VA 2VWJA 3ZSOA 2Y1JA 1NK8A 3K5LA 3U6FA 3QO9A 1TK8A 1S9GA 1TAQA 4DQPA 2XHBA 4Z0UA 1KFSA 4CEAA 3AO2A 1JLFA 1WN7A 3VQ4A 3KK3A 4FLTA 3L8BA 2HHWA 1F21A 3LAKA 4M3UA 3O3HA 3SYZA 1IKYA 4FW1A 3HO1A 4CF1A 4C8OA 5KI6A 3M8RA 1D9FA 4Y1CA 4Y1DA 2QK9A 4ELTA 2YNFA 4PUOA 4J2DA 3VA0A 3PV8A 3SJJA 4F3TA 4CFDA 3NE6A 3NAEA 1C0TA 1VK0A 1WAFA 2DFHA 4CJEA 3PO4A 4F4KA 3K5OA 3BDPA 1RT3A 3WNEA 3KK2A 4W5TA 3V9WA 3L3VA 2OA8A 3QESA 4Z4IA 4OPJA 1BQMA 3IG1A 4DQSA 4CIFA 4Z4EA 4H4MA 1WSFA 5K14A 2RF2A 2XY8A 3LPUA 4KREA 2ITGA 2G8VA 4M3XA 1QQCA 2AJQA 3K5NA 3TAEA 3K57A 5SWMA 3LWMA 5J1EA 1RTJA 4I7FA 1NK0A 4Z4HA 4B08A 1J9AA 3EYZA 3TAFA 2XY5A 4Z4GA 1VSLA 4I9LA 3OY9A 1UA0A 4EZ9A 4OJRA 1NOYA 3CQ8A 4JRQA 5FDLA 4FJ5A 4E1NA 4DTSA 2FBYA 1TL3A 2BE2A 3OYKA 4I9QA 4FM2A 4OKEA 4W5RA 4AHVA 1UA1A 3K2PA 3NBPA 2IDOA 2HHQA 3OVNA 4H4OA 4FJMA 3AVMA 3BGRA 4CHQA 4BDZA 1ZYQA 1N5YA 1QSSA 4FJLA 1KCFA 2OZMA 4RG8A 2IOCA 2JLEA 1MU2A 3HP9A 2F8SA 5EU7A 4CJPA 2HVIA 1K6YA 3T19A 1RTHA 3SQ1A 4ELVA 1RBVA 3AA4A 1QSYA 4N47A 3LP3A 3KJVA 4IDKA 1S1VA 3G0ZA 4CF0A 1RT6A 3TABA 4FXDA 4RW9A 3NF6A 4ICLA 3PY8A 3VQEA 3CFPA 1UOCA 4LH5A 4EP5A 4CEQA 4ZHRA 3HM9A 1NK5A 4DSJA 3SUOA 4FJ8A 1VSJA 3L2RA 3LZJA 2ZE2A 1TK5A 4OLAA 5JS1A 1VRTA 1SUQA 4CJFA 1BIZA 4CERA 3SUPA 1Y97A 3L3UA 3EZ5A 1DTQA 3ZSYA 4M3WA 1T7PA 4IFVA 3T1AA 2G8KA 4E7LA 1RT2A 3DRSA 3VQDA 4AHUA 1UAXA 1JXEA 3K5MA 3SNNA 4O55A 4Q5VA 3O3FA 1BQNA 1KTQA 1VSFA 1BIUA 2HNZA 4CIEA 3DLHA 4B9UA 2GBZA 1S6QA 3LALA 3NCIA 4GMJB 4FLYA 2Z1IA 4B9MA 3O3GA 4KFBA 1S6PA 3RWUA 1L3UA 1IG9A 4M3ZA 3LP2A 4MFBA 2EX3A 2VG5A 4FLZA 2G8WA 4E7IA 4CF2A 4NYNA 3CFOA 4O44A 4DFKA 2KFZA 3CG7A 3KIOA 1HQUA 4BWMA 4AHRA 3TAGA 3SPYA 1DLOA 4CJVA 4FJJA 3AVAA 4Z4CA 4M3RA 3I8DA 3OS1A 1VSHA 4HUFA 1B9FA 3O4QA 4KTWA 3TWHA 3PX0A 1XI1A 4B9LA 4QCLA 3MECA 1JLAA 2WOMA 2IAJA 2R7YA 4DF8A 4DTMA 4DFJA 1D5AA 1HNVA 1UWBA 1QS4A 1XHXA 4PA1A 3AV9A 1BGXT 1RBRA 1T05A 4PQUA 4Q0BA 3VQ7A 4CEDA 3P1GA 3KD5E 3CM6A 3AVCA 3NGYA 3DOKA 3V1OA 1WNSA 5T7BA 1BI4B 1LW2A 3S3NA 3ZSRA 2P5GA 3TARA 4FK2A 4CJKA 3I0SA 2F96A 3KKRA 3HJFA 5HRRA 1Q9XA 2OPQA 3WNGA 3RTVA 4KI4A 1VSEA 5HRPA 2KTQA 3PUFA 3SUNA 4O5BA 4FJKA 3HVTA 3SQ0A 1TV6A 4FJIA 4QOZB 3DLRA 3I0RA 3OS0A 1KLNA 2IS3A 4YNQA 2G8UA 2HW3A 3VQ8A 1ASVA 2LSNA 1HYSA 1KFDA 1IKVA 4OGCA 4CGFA 1TAUA 4RW4A 3V81A 4AILC 3ZSVA 3AVGA 3L2WA 4CK2A 3D0PA 4KTQA 1BCMA 5E41A 4H8KA 2HHTA 2P5OA 2YKNA 3PO5A 3B6OA 3DMJA 1RTDA 4DTPA 1GOBA 1JKHA 1D8YA 4AH9A 1RT5A 1Q9YA 3HT3A 4LSLA 3KLIA 5JS2A 4ZTJA 2F8TA 1U47A 1CXUA 3NF8A 4DU4A 4KTZA 4CF8A 1RCHA 1RDBA 4HUGA 1S1WA 3SPZA 4FJ7A 4FZYA 1L5UA 4KHWA 5KRSA 1L3VA 1S1UA 2YNHA 4AHCA 4B9TA 3NF9A 1IKXA 2D0BA 5KTQA 4JS4A 1ASUA 1IH7A 4B8AB 4CEOA 3RMDA 3C94A 3NGZA 3HK2A 4PWDA 3OYIA 2D0AA 2I5JA 3VN5A 1RDCA 3S9HA 1KVBA 4C8NA 4KHQA 1ITGA 4E7KA 3RMAA 3SZ2A 1VSIA 4HCCA 2Z1HA 2KQ2A 2QKBA 5SZTA 1HYZA 4ELUA 1LWFA 4O0IA 3EY1A 4BDPA 3OS2A 2YHBA 3NGIA 1JLCA 1ASWA 4I2QA 1GOCA 3QEVA 3B6PA 2ETJA 4IBNA 2Q3SA 2DY4A 2P1JA 2DFEA 3P5JA 4KI6A 1JL2A 3DLKA 4M3TA 2Z1JA 3D45A 1WSIA 1G15A 3VQBA 3U3YA 3PX4A 2KZMA 1R0AA 2HHVA 1WAJA 3ZT1A 2QKKA 3QETA 5CYMA 1C1CA 3QINA 3QNNA 2HNYA 3IAYA 3JYTA 2PZSA 4CJ4A 1X9SA 4B3OA 3A2FA 3KLEA 4W5NA 1YT3A 4IKFA 3ASMA 3K58A 5J2MA 4DQRA 4BDYA 1NK7A 4E89A 2FBTA 4CHYA 2GUIA 5FROA 1NK9A 3NH0A 4FJGA 4PY5A 3MXJA 1JLEA 4FLUA 3HPHA 4FJHA 4J2AA 4JLHA 1TKTA 4CK1A 4R5PA 2X6SA 2YNIA 4AHTA 4FM0A 3PX6A 3TAMA 5HROA 1SKWA 4L8RB 3HXMA 1EXQA 3ALYA 3LP0A 5C42A 3ZT4A 2ATQA 4DSFA 3G10A 1SKSA 4BE2A 4B9VA 1X9MA 1DTTA 1KSPA 1RDDA 1ZBUA 3QEWA 1NK6A 4F8RA 2DTUA 2A1SA 3OYBA 1TKXA 4FLVA 2O4GA 2E6LA 5CZ1A 3C6UA 2KFNA 4OKJA 1X9WA 2ZD1A 3V9ZA 4XIUA 3QEPA 5HP1A 5HRSA 4CJRA 3L2VA 4DFPA 2P51A 4DTRA 5FRMA 1KRPA 4F3OA 1WSHA 1A5XA 3ZT0A 4CJTA 4ID1A 3MXIA 2G8FA 3KK1A 1O1WA 3DM2A 3HSTB 1CZBA 1IKWA 3LANA 3NFAA 3LWLA 4DU1A 4CHZA 3SQ4A 1SL1A 2OPSA 4OGEA 3HYFA 4F2RA 4FW2A 3SQ2A 1L3SA 3AVLA 3MEEA 1C6VA 4JS5A 2RKIA 1HQEA 3NF7A 2QXFA 4W5QA 2FBVA 1L3TA 1YTAA 3VQ9A 4DSLA 4KRFA 4DTJA 3AVFA 1TVRA 1QSLA 4CGGA 3OYNA 4KHSA 4KB0A 3U3GA 1J53A 1KLMA 2ZQBA 2D5RA 4K8XA 4O4GA 1VRUA 2FC0A 1HMVA 4DG1A 4HVJA 1T8EA 1B9DA 1QE1A 4LD0A 1WSJA 1RBTA 4CECA 1TL1A 1NKEA 2IC3A 1BL3A 4KO0A 3NDKA 1NKCA 3LDSA 4E3SA 4FK4A 1TK0A 1J54A 4CFAA 1BCOA 4RW7A 3L2UA 3OYEA 3KKSA 2OYQA 3DRPA 1C0MA 1YTUA 1D9DA 5J2QA 4DQQA 2HNDA 1BI4A 4KPYA 4W5OA 3VQ5A 3QIPA 3ZT3A 3V6DA 1NKBA 4KKOA 4OVLA 5KGXA 1U4BA 4K8ZA 1HNIA 3DLGA 3AO5A 4CHOA 3HPOA 4BE0A 3SCXA 4JRPA 2OPRA 3KD1E 3ZT2A 3KLHA 1KVCA 3F73A 4N5SA 5D3GA 3AO1A 3VQQA 4CHNA 1T03A 1S1XA 1RDAA 1XHZA 2VWKA 3V1RA 2RPIA 1JL1A 4IFYA 4NCAA 3VQAA 3TANA 1TKZA 4NCBA 5CZ2A 2B5JA 4B8CA 4CESA 4E7HA 1C1BA 1RT1A 4FK0A 4FJNA 3CM5A 5C24A 4FZZA 3TI0A 4CJUA 4DQIA 1CZ9A 4AHSA 3AVIA 3RRHA 2BDPA 3V9UA 3NH1A 3AVNA 4CGHA 3DRRA 4MQ3A 4CEZA 4I2PA 3V1QA 1RBUA 4CFCA 3F9KA 3OYLA 4M45A 4HCBA 1VSMA 3WNFA 1FKPA 4FCYA 2YHAA 4LH4A 1BHLA 2YNGA 3RRGA 2FBXA 3M8SA 4DU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO2 A;  1Q8I A;  1FK9 A;  4CJQ A;  1KVA A;  3DLB A;  4DTN A;  2XY6 A;  4CK3 A;  4FM1 A;  5C25 A;  1JXB A;  1XC9 A;  4FLW A;  1C0U A;  3VA3 A;  1TKD A;  4J2B A;  1EP4 A;  2B6A A;  2RN2 A;  3NH2 A;  4N56 A;  3VQC A;  3CFR A;  2X6N A;  3SV4 A;  3ISN C;  2W42 A;  1S5J A;  3H08 A;  4GW6 A;  3S3M A;  4YFU A;  4KHN A;  2NUB A;  5J2N A;  4CGI A;  4HUE A;  3ULD A;  3P83 D;  3E01 A;  2XRI A;  4CEB A;  4G1Q A;  4IG0 A;  1LV5 A;  4Z4F A;  2Z1G A;  5DMR A;  3DYA A;  3MEG A;  3RR8 A;  1Z25 A;  2HMI A;  3QEX A;  2OZS A;  4KV8 A;  3IS9 A;  1LWC A;  2OPP A;  4DWI A;  3AVB A;  3OYG A;  4DTX A;  2PYL A;  3ZCM A;  4M41 A;  1NJY A;  5J2P A;  1EX4 A;  4C8K A;  4EZ6 A;  2X78 A;  4KHU A;  3OYH A;  3S3O A;  4KAZ A;  2BAN A;  4DFM A;  3QEI A;  4ID5 A;  5I42 A;  4CGD A;  5FRN A;  1EET A;  3HL8 A;  1REV A;  3MED A;  3OJS A;  4B9N A;  3VQ6 A;  2B4J A;  3L2Q A;  1BIS A;  3C95 A;  2A1R A;  1HJR A;  4DS5 A;  2WON A;  2XO7 A;  3HP6 A;  3SUQ A;  4TSX A;  4HTU A;  3IRX A;  1FKO A;  1Z26 A;  4B9S A;  3RMB A;  2EHG A;  3HPG A;  5KRT A;  1N6Q A;  2HB5 A;  1J5O A;  1CLQ A;  2YKM A;  4CJ5 A;  1ZBH A;  3O4N A;  3V4I A;  4OLB A;  4DSI A;  3AA5 X;  1ZBF A;  4WE1 A;  3TR8 A;  4DMN A;  3QIO A;  3OYJ A;  1SV5 A;  2JGU A;  3RR7 A;  2KZZ A;  2BGG A;  1RT4 A;  4CHP A;  4O0J A;  3AO4 A;  4CEF A;  1HRH A;  4FZX C;  3M8P A;  3LP1 A;  1YVU A;  1S9E A;  4CEE A;  3LAM A;  1FXX A;  2X74 A;  3THV A;  3K59 A;  1RIL A;  3OYM A;  4HHT A;  1RBS A;  2VG6 A;  2HVH A;  2YV0 X;  4CGJ A;  4DSK A;  4RW6 A;  1RNH A;  5DK5 A;  1GOA A;  2DFF A;  4J2E A;  3KLG A;  4BE1 A;  3ZSW A;  3OYC A;  1W9H A;  1JLB A;  2E4L A;  3ZSZ A;  4DTU A;  1NJW A;  1TGO A;  4N76 A;  1LWE A;  1ZBI A;  3DLE A;  2KW4 A;  3QLH A;  4EP4 A;  3MAQ A;  4GVM A;  3V9S A;  1I3A A;  5HBM A;  3NHG A;  3AVK A;  3LZI A;  3OYD A;  1QHT A;  4KHY A;  1NJZ A;  1W0H A;  1QTM A;  3AA2 A;  3DI6 A;  3OYF A;  3M8Q A;  3TAQ A;  4BAC A;  4E0D A;  3CYM A;  3ZSQ A;  4CIG A;  5HRN A;  3TAP A;  1HPZ A;  1S1T A;  1WSE A;  4NYF A;  4ZTF A;  4FVM A;  1VSK A;  1A5W A;  3MXM A;  4CJS A;  3JSM A;  3AVH A;  4E7J A;  2G8H A;  1LAV A;  2HHX A;  1VSD A;  1SKR A;  2PYJ A;  4F2S A;  4FJX A;  3DOL A;  1EKE A;  4LSN A;  4CJL A;  4E19 A;  4OPK A;  3UIQ A;  4QAG A;  4FJ9 A;  3AO3 A;  4KB1 A;  1LW0 A;  4FLX A;  3LPT A;  4CJW A;  3ZSX A;  4E1M A;  1RTI A;  1U04 A;  4DSE A;  3KLF A;  3AA3 A;  3AVJ A;  2PY5 A;  3T3F A;  4CCH A;  4M42 A;  2D0C A;  1WSG A;  5HLF A;  1XWL A;  2IGI A;  1U48 A;  1X1P A;  4CF9 A;  5I3U A;  4DS4 A;  1C1A A;  3HVR A;  1RT7 A;  5CY4 A;  3QNO A;  1NK4 A;  4N41 A;  1CXQ A;  4CJ3 A;  3SI6 A;  4DLG A;  3WNH A;  3VQP A;  1NOZ A;  2O4I A;  3KTQ A;  4C8L A;  4NCG A;  2HHS A;  2HHU A;  1SL2 A;  3C6T A;  2VG7 A;  4IG3 A;  2GV9 A;  4UQG A;  4OKK A;  4DLE A;  3V9X A;  1JLQ A;  5KGW A;  1U45 A;  2G8I A;  3OYA A;  4DF4 A;  1WLJ A;  4C8M A;  4RW8 A;  3OJU A;  1I39 A;  4FYD A;  1HYV A;  5CYQ A;  3RMC A;  3FFI A;  4LY7 A;  4BWJ A;  4DTO A;  1B92 A;  4M3Y A;  2E6M A;  4CFB A;  3SV3 A;  1U49 A;  3QER A;  1SL0 A;  4CE9 A;  1JLG A;  2XY7 A;  3ITH A;  1LAW A;  1NJX A;  1ZBL A;  2Y1I A;  1A5V A;  2VWJ A;  3ZSO A;  2Y1J A;  1NK8 A;  3K5L A;  3U6F A;  3QO9 A;  1TK8 A;  1S9G A;  1TAQ A;  4DQP A;  2XHB A;  4Z0U A;  1KFS A;  4CEA A;  3AO2 A;  1JLF A;  1WN7 A;  3VQ4 A;  3KK3 A;  4FLT A;  3L8B A;  2HHW A;  1F21 A;  3LAK A;  4M3U A;  3O3H A;  3SYZ A;  1IKY A;  4FW1 A;  3HO1 A;  4CF1 A;  4C8O A;  5KI6 A;  3M8R A;  1D9F A;  4Y1C A;  4Y1D A;  2QK9 A;  4ELT A;  2YNF A;  4PUO A;  4J2D A;  3VA0 A;  3PV8 A;  3SJJ A;  4F3T A;  4CFD A;  3NE6 A;  3NAE A;  1C0T A;  1VK0 A;  1WAF A;  2DFH A;  4CJE A;  3PO4 A;  4F4K A;  3K5O A;  3BDP A;  1RT3 A;  3WNE A;  3KK2 A;  4W5T A;  3V9W A;  3L3V A;  2OA8 A;  3QES A;  4Z4I A;  4OPJ A;  1BQM A;  3IG1 A;  4DQS A;  4CIF A;  4Z4E A;  4H4M A;  1WSF A;  5K14 A;  2RF2 A;  2XY8 A;  3LPU A;  4KRE A;  2ITG A;  2G8V A;  4M3X A;  1QQC A;  2AJQ A;  3K5N A;  3TAE A;  3K57 A;  5SWM A;  3LWM A;  5J1E A;  1RTJ A;  4I7F A;  1NK0 A;  4Z4H A;  4B08 A;  1J9A A;  3EYZ A;  3TAF A;  2XY5 A;  4Z4G A;  1VSL A;  4I9L A;  3OY9 A;  1UA0 A;  4EZ9 A;  4OJR A;  1NOY A;  3CQ8 A;  4JRQ A;  5FDL A;  4FJ5 A;  4E1N A;  4DTS A;  2FBY A;  1TL3 A;  2BE2 A;  3OYK A;  4I9Q A;  4FM2 A;  4OKE A;  4W5R A;  4AHV A;  1UA1 A;  3K2P A;  3NBP A;  2IDO A;  2HHQ A;  3OVN A;  4H4O A;  4FJM A;  3AVM A;  3BGR A;  4CHQ A;  4BDZ A;  1ZYQ A;  1N5Y A;  1QSS A;  4FJL A;  1KCF A;  2OZM A;  4RG8 A;  2IOC A;  2JLE A;  1MU2 A;  3HP9 A;  2F8S A;  5EU7 A;  4CJP A;  2HVI A;  1K6Y A;  3T19 A;  1RTH A;  3SQ1 A;  4ELV A;  1RBV A;  3AA4 A;  1QSY A;  4N47 A;  3LP3 A;  3KJV A;  4IDK A;  1S1V A;  3G0Z A;  4CF0 A;  1RT6 A;  3TAB A;  4FXD A;  4RW9 A;  3NF6 A;  4ICL A;  3PY8 A;  3VQE A;  3CFP A;  1UOC A;  4LH5 A;  4EP5 A;  4CEQ A;  4ZHR A;  3HM9 A;  1NK5 A;  4DSJ A;  3SUO A;  4FJ8 A;  1VSJ A;  3L2R A;  3LZJ A;  2ZE2 A;  1TK5 A;  4OLA A;  5JS1 A;  1VRT A;  1SUQ A;  4CJF A;  1BIZ A;  4CER A;  3SUP A;  1Y97 A;  3L3U A;  3EZ5 A;  1DTQ A;  3ZSY A;  4M3W A;  1T7P A;  4IFV A;  3T1A A;  2G8K A;  4E7L A;  1RT2 A;  3DRS A;  3VQD A;  4AHU A;  1UAX A;  1JXE A;  3K5M A;  3SNN A;  4O55 A;  4Q5V A;  3O3F A;  1BQN A;  1KTQ A;  1VSF A;  1BIU A;  2HNZ A;  4CIE A;  3DLH A;  4B9U A;  2GBZ A;  1S6Q A;  3LAL A;  3NCI A;  4GMJ B;  4FLY A;  2Z1I A;  4B9M A;  3O3G A;  4KFB A;  1S6P A;  3RWU A;  1L3U A;  1IG9 A;  4M3Z A;  3LP2 A;  4MFB A;  2EX3 A;  2VG5 A;  4FLZ A;  2G8W A;  4E7I A;  4CF2 A;  4NYN A;  3CFO A;  4O44 A;  4DFK A;  2KFZ A;  3CG7 A;  3KIO A;  1HQU A;  4BWM A;  4AHR A;  3TAG A;  3SPY A;  1DLO A;  4CJV A;  4FJJ A;  3AVA A;  4Z4C A;  4M3R A;  3I8D A;  3OS1 A;  1VSH A;  4HUF A;  1B9F A;  3O4Q A;  4KTW A;  3TWH A;  3PX0 A;  1XI1 A;  4B9L A;  4QCL A;  3MEC A;  1JLA A;  2WOM A;  2IAJ A;  2R7Y A;  4DF8 A;  4DTM A;  4DFJ A;  1D5A A;  1HNV A;  1UWB A;  1QS4 A;  1XHX A;  4PA1 A;  3AV9 A;  1BGX T;  1RBR A;  1T05 A;  4PQU A;  4Q0B A;  3VQ7 A;  4CED A;  3P1G A;  3KD5 E;  3CM6 A;  3AVC A;  3NGY A;  3DOK A;  3V1O A;  1WNS A;  5T7B A;  1BI4 B;  1LW2 A;  3S3N A;  3ZSR A;  2P5G A;  3TAR A;  4FK2 A;  4CJK A;  3I0S A;  2F96 A;  3KKR A;  3HJF A;  5HRR A;  1Q9X A;  2OPQ A;  3WNG A;  3RTV A;  4KI4 A;  1VSE A;  5HRP A;  2KTQ A;  3PUF A;  3SUN A;  4O5B A;  4FJK A;  3HVT A;  3SQ0 A;  1TV6 A;  4FJI A;  4QOZ B;  3DLR A;  3I0R A;  3OS0 A;  1KLN A;  2IS3 A;  4YNQ A;  2G8U A;  2HW3 A;  3VQ8 A;  1ASV A;  2LSN A;  1HYS A;  1KFD A;  1IKV A;  4OGC A;  4CGF A;  1TAU A;  4RW4 A;  3V81 A;  4AIL C;  3ZSV A;  3AVG A;  3L2W A;  4CK2 A;  3D0P A;  4KTQ A;  1BCM A;  5E41 A;  4H8K A;  2HHT A;  2P5O A;  2YKN A;  3PO5 A;  3B6O A;  3DMJ A;  1RTD A;  4DTP A;  1GOB A;  1JKH A;  1D8Y A;  4AH9 A;  1RT5 A;  1Q9Y A;  3HT3 A;  4LSL A;  3KLI A;  5JS2 A;  4ZTJ A;  2F8T A;  1U47 A;  1CXU A;  3NF8 A;  4DU4 A;  4KTZ A;  4CF8 A;  1RCH A;  1RDB A;  4HUG A;  1S1W A;  3SPZ A;  4FJ7 A;  4FZY A;  1L5U A;  4KHW A;  5KRS A;  1L3V A;  1S1U A;  2YNH A;  4AHC A;  4B9T A;  3NF9 A;  1IKX A;  2D0B A;  5KTQ A;  4JS4 A;  1ASU A;  1IH7 A;  4B8A B;  4CEO A;  3RMD A;  3C94 A;  3NGZ A;  3HK2 A;  4PWD A;  3OYI A;  2D0A A;  2I5J A;  3VN5 A;  1RDC A;  3S9H A;  1KVB A;  4C8N A;  4KHQ A;  1ITG A;  4E7K A;  3RMA A;  3SZ2 A;  1VSI A;  4HCC A;  2Z1H A;  2KQ2 A;  2QKB A;  5SZT A;  1HYZ A;  4ELU A;  1LWF A;  4O0I A;  3EY1 A;  4BDP A;  3OS2 A;  2YHB A;  3NGI A;  1JLC A;  1ASW A;  4I2Q A;  1GOC A;  3QEV A;  3B6P A;  2ETJ A;  4IBN A;  2Q3S A;  2DY4 A;  2P1J A;  2DFE A;  3P5J A;  4KI6 A;  1JL2 A;  3DLK A;  4M3T A;  2Z1J A;  3D45 A;  1WSI A;  1G15 A;  3VQB A;  3U3Y A;  3PX4 A;  2KZM A;  1R0A A;  2HHV A;  1WAJ A;  3ZT1 A;  2QKK A;  3QET A;  5CYM A;  1C1C A;  3QIN A;  3QNN A;  2HNY A;  3IAY A;  3JYT A;  2PZS A;  4CJ4 A;  1X9S A;  4B3O A;  3A2F A;  3KLE A;  4W5N A;  1YT3 A;  4IKF A;  3ASM A;  3K58 A;  5J2M A;  4DQR A;  4BDY A;  1NK7 A;  4E89 A;  2FBT A;  4CHY A;  2GUI A;  5FRO A;  1NK9 A;  3NH0 A;  4FJG A;  4PY5 A;  3MXJ A;  1JLE A;  4FLU A;  3HPH A;  4FJH A;  4J2A A;  4JLH A;  1TKT A;  4CK1 A;  4R5P A;  2X6S A;  2YNI A;  4AHT A;  4FM0 A;  3PX6 A;  3TAM A;  5HRO A;  1SKW A;  4L8R B;  3HXM A;  1EXQ A;  3ALY A;  3LP0 A;  5C42 A;  3ZT4 A;  2ATQ A;  4DSF A;  3G10 A;  1SKS A;  4BE2 A;  4B9V A;  1X9M A;  1DTT A;  1KSP A;  1RDD A;  1ZBU A;  3QEW A;  1NK6 A;  4F8R A;  2DTU A;  2A1S A;  3OYB A;  1TKX A;  4FLV A;  2O4G A;  2E6L A;  5CZ1 A;  3C6U A;  2KFN A;  4OKJ A;  1X9W A;  2ZD1 A;  3V9Z A;  4XIU A;  3QEP A;  5HP1 A;  5HRS A;  4CJR A;  3L2V A;  4DFP A;  2P51 A;  4DTR A;  5FRM A;  1KRP A;  4F3O A;  1WSH A;  1A5X A;  3ZT0 A;  4CJT A;  4ID1 A;  3MXI A;  2G8F A;  3KK1 A;  1O1W A;  3DM2 A;  3HST B;  1CZB A;  1IKW A;  3LAN A;  3NFA A;  3LWL A;  4DU1 A;  4CHZ A;  3SQ4 A;  1SL1 A;  2OPS A;  4OGE A;  3HYF A;  4F2R A;  4FW2 A;  3SQ2 A;  1L3S A;  3AVL A;  3MEE A;  1C6V A;  4JS5 A;  2RKI A;  1HQE A;  3NF7 A;  2QXF A;  4W5Q A;  2FBV A;  1L3T A;  1YTA A;  3VQ9 A;  4DSL A;  4KRF A;  4DTJ A;  3AVF A;  1TVR A;  1QSL A;  4CGG A;  3OYN A;  4KHS A;  4KB0 A;  3U3G A;  1J53 A;  1KLM A;  2ZQB A;  2D5R A;  4K8X A;  4O4G A;  1VRU A;  2FC0 A;  1HMV A;  4DG1 A;  4HVJ A;  1T8E A;  1B9D A;  1QE1 A;  4LD0 A;  1WSJ A;  1RBT A;  4CEC A;  1TL1 A;  1NKE A;  2IC3 A;  1BL3 A;  4KO0 A;  3NDK A;  1NKC A;  3LDS A;  4E3S A;  4FK4 A;  1TK0 A;  1J54 A;  4CFA A;  1BCO A;  4RW7 A;  3L2U A;  3OYE A;  3KKS A;  2OYQ A;  3DRP A;  1C0M A;  1YTU A;  1D9D A;  5J2Q A;  4DQQ A;  2HND A;  1BI4 A;  4KPY A;  4W5O A;  3VQ5 A;  3QIP A;  3ZT3 A;  3V6D A;  1NKB A;  4KKO A;  4OVL A;  5KGX A;  1U4B A;  4K8Z A;  1HNI A;  3DLG A;  3AO5 A;  4CHO A;  3HPO A;  4BE0 A;  3SCX A;  4JRP A;  2OPR A;  3KD1 E;  3ZT2 A;  3KLH A;  1KVC A;  3F73 A;  4N5S A;  5D3G A;  3AO1 A;  3VQQ A;  4CHN A;  1T03 A;  1S1X A;  1RDA A;  1XHZ A;  2VWK A;  3V1R A;  2RPI A;  1JL1 A;  4IFY A;  4NCA A;  3VQA A;  3TAN A;  1TKZ A;  4NCB A;  5CZ2 A;  2B5J A;  4B8C A;  4CES A;  4E7H A;  1C1B A;  1RT1 A;  4FK0 A;  4FJN A;  3CM5 A;  5C24 A;  4FZZ A;  3TI0 A;  4CJU A;  4DQI A;  1CZ9 A;  4AHS A;  3AVI A;  3RRH A;  2BDP A;  3V9U A;  3NH1 A;  3AVN A;  4CGH A;  3DRR A;  4MQ3 A;  4CEZ A;  4I2P A;  3V1Q A;  1RBU A;  4CFC A;  3F9K A;  3OYL A;  4M45 A;  4HCB A;  1VSM A;  3WNF A;  1FKP A;  4FCY A;  2YHA A;  4LH4 A;  1BHL A;  2YNG A;  3RRG A;  2FBX A;  3M8S A;  4DU3 A; 
#chains in the Genus database with same CATH topology
 1KVA A;  3GDQ A;  4FM1 A;  5C25 A;  3DXM A;  2HMP A;  1EP4 A;  5AQY A;  3NH2 A;  4N56 A;  4BR9 A;  2ASM A;  3S3M A;  2NUB A;  3ULD A;  4KH4 A;  2XRI A;  3EZW A;  4WFA L;  4LF9 K;  1LV5 A;  4CBU A;  3RR8 A;  4HTL A;  4KV8 A;  1LWC A;  2OPP A;  3AVB A;  3U9Z A;  4M41 A;  5BRH A;  4KAZ A;  5FRN A;  3G25 A;  4CGD A;  3L2Q A;  2A1R A;  4DS5 A;  1KXP A;  4KH6 A;  4TSX A;  3IRX A;  1Z26 A;  3IKM A;  1WB9 A;  3EKS A;  2YKM A;  3TSP A;  4BRG A;  2A41 A;  1N36 K;  2JGU A;  2O8D A;  2GWJ A;  2BGG A;  4O0J A;  4CEF A;  1HRH A;  3M8P A;  3CET A;  2IVP A;  1BOT O;  1Q18 A;  4DV7 K;  3OYM A;  2HVH A;  2HBJ A;  2YV0 X;  4RW6 A;  4BVP A;  2E2P A;  5AZJ B;  2HST A;  3OYC A;  4IDH A;  1GLF O;  3ZSZ A;  5AJ3 K;  4N76 A;  3MCA B;  4C1N I;  4EP4 A;  2IVN A;  4JK7 A;  3NHG A;  3VET A;  3OYD A;  4KHY A;  5LJV A;  1VQ9 N;  5FLX O;  3J7Y P;  4BAC A;  3CCM N;  3ZSQ A;  3TAP A;  1S1T A;  4FVM A;  5FPN A;  2UXD K;  1A5W A;  3MXM A;  3JSM A;  3MWT A;  4E7J A;  2HHX A;  1YXQ A;  4YOT A;  4OPK A;  3UIQ A;  3RSE B;  1GLL O;  4CJW A;  3ZSX A;  4X62 K;  3UE5 A;  3AVJ A;  4CJ7 A;  2D0C A;  1WSG A;  2IGI A;  1J6Z A;  2P9P B;  4CF9 A;  1C1A A;  3HVR A;  3QNO A;  4CJ3 A;  3WQU A;  4DHY A;  2PFU A;  3EE9 A;  3WNH A;  3VQP A;  1NGF A;  5HOO A;  3SBT A;  3KTQ A;  4DV6 K;  2HHS A;  3VEY A;  3MN6 A;  3ZEU A;  2VWB A;  4OKK A;  1JLQ A;  1QQO A;  5CE3 A;  4LFA K;  5KGW A;  5EX5 A;  2CGL A;  4C8M A;  4U67 L;  4LY7 A;  5AQL A;  3SV3 A;  3QER A;  2HOE A;  3MWP A;  5TKW A;  3MX2 A;  4ILG B;  1Z6R A;  2XY7 A;  3SAH A;  3CCS N;  2Y1I A;  3ZSO A;  1WOQ A;  3QO9 A;  1TAQ A;  3HRG A;  1YVN A;  3L4Q A;  5DM7 L;  2XHB A;  4Z0U A;  2W6K A;  3C6H A;  1WN7 A;  1EWQ A;  3O3H A;  1IKY A;  4M63 C;  4ELT A;  2YNF A;  3NE6 A;  4ILJ A;  1VK0 A;  1WAF A;  3A5N C;  3PO4 A;  3K5O A;  3BDP A;  3WNE A;  3KK2 A;  3V9W A;  1HJO A;  3IG1 A;  4H4M A;  5C12 A;  5K14 A;  4FSV A;  4YDU A;  2ITG A;  3B8A X;  2G8V A;  5M1F A;  2AJQ A;  3K5N A;  3T69 A;  3K57 A;  5SWM A;  3LWM A;  5J1E A;  4B08 A;  3OA9 A;  1J9A A;  4I9L A;  3OY9 A;  4OJR A;  1DGK N;  3CQ8 A;  4KBO A;  4JRQ A;  5FDL A;  4JI4 K;  4FJ5 A;  4E1N A;  3FZL A;  4IO8 A;  4DTS A;  1TL3 A;  3OYK A;  4I9Q A;  4FM2 A;  4W5R A;  3O6W A;  3M3Z A;  3NBP A;  2QEX N;  1S72 N;  5AQP A;  3SAF A;  4ISF A;  4CHQ A;  4BDZ A;  1ZYQ A;  4DV0 K;  3LL3 A;  2HBM A;  1EQY A;  2Q2R A;  2F8S A;  3E66 A;  3O1W A;  2E2N A;  4H0O A;  1QSY A;  1IJJ A;  4N47 A;  3UKR B;  4CF0 A;  1RT6 A;  4ICL A;  2QXL A;  1UOC A;  3AAQ A;  4LH5 A;  4FPB A;  4DSJ A;  1VSJ A;  3L2R A;  4Y0W A;  3QFP A;  4BQL A;  3L3U A;  4YOU A;  3ZSY A;  2O8E B;  1VQ7 N;  3K9K A;  2G8K A;  1RT2 A;  3DRS A;  1X9W A;  2P9N A;  1UAX A;  2Q31 A;  3FZH A;  1SKR A;  1BQN A;  3LAL A;  4GNI A;  3P4I A;  2QI2 A;  3D6R A;  3RWU A;  1L3U A;  1ATN A;  3CMA N;  2G8W A;  4E7I A;  4CF2 A;  2E1Y A;  4MDA A;  3CFO A;  2KFZ A;  3CG7 A;  4BWM A;  3TAG A;  3SPY A;  1O13 A;  4DV3 K;  4FJJ A;  4KTW A;  4OO1 J;  3D7E O;  1JLA A;  2WOM A;  2IAJ A;  3O9U A;  4Q0B A;  3AV9 A;  4FOI A;  1T05 A;  3LDP A;  3NGY A;  3VEN A;  2P5G A;  4FK2 A;  3HJF A;  3KKR A;  3CHW A;  1Q9X A;  3O4W A;  1VSE A;  4H5T A;  2H3G X;  3PUF A;  3HVT A;  3R9P A;  2VYP A;  5AR0 A;  1TAU A;  4RW4 A;  3V81 A;  1FW6 A;  3D0P A;  3CCE N;  2O8F A;  2UUB K;  3PO5 A;  4GV9 A;  3HBT A;  1HKG A;  4LF7 K;  3KHY A;  4DKW A;  1U47 A;  4KTZ A;  4CF8 A;  3J81 O;  4MO4 A;  2UXB K;  2YNH A;  3NF9 A;  3ULE A;  4X66 K;  1TUY A;  3AY9 A;  3C94 A;  4PWD A;  3S9H A;  3CER A;  4C8N A;  2Z1H A;  2QKB A;  1NGI A;  5C2D A;  1LWF A;  5BRF A;  4O0I A;  3EY1 A;  4LF8 K;  4B3S K;  2W41 A;  5JLF A;  3TTD A;  2NRH A;  1ESV A;  3P38 A;  3M1F A;  2DY4 A;  3J80 O;  4CD1 A;  4M3T A;  3JXU A;  3D45 A;  4BRA A;  2KZM A;  2QKK A;  5CYM A;  1NGH A;  4YOY A;  5LMN K;  3EN9 A;  3QNN A;  5AQV A;  1X9S A;  3A2F A;  2ZJP L;  4W5N A;  5GIO A;  3ASM A;  1NK7 A;  1IBL K;  2FBT A;  2GUI A;  3C65 A;  1GLD G;  4BG8 A;  2YNI A;  3CJC A;  4FM0 A;  1SKW A;  1OH7 A;  1QQN A;  2A40 A;  5C42 A;  3ZT4 A;  2ATQ A;  4BRD A;  3G10 A;  1SKS A;  3VGM A;  1DTT A;  4JHD B;  4KH5 A;  4B1V A;  2A1S A;  1NMN A;  2P9U B;  1SQK A;  3FLC O;  1RGI A;  2E6L A;  5CZ1 A;  4OKJ A;  2ZD1 A;  5HP1 A;  3W0L A;  4CJR A;  5HRS A;  5LL6 Z;  3L2V A;  4DTR A;  3ENB A;  4F3O A;  1HKC A;  4CZL A;  3VTI A;  2HW3 A;  3NFA A;  3CCV N;  3HYF A;  5AQF A;  3UKU A;  3JAM O;  3SQ2 A;  1YTA A;  3VQ9 A;  1QZ5 A;  2IIR A;  1TVR A;  1QSL A;  4CI6 A;  3U3G A;  4V19 S;  5KPT A;  1K8A O;  2NRT A;  2ZQB A;  3G71 N;  3VGK A;  1VRU A;  4GV3 A;  5AQU A;  3ENH A;  1T8E A;  4LD0 A;  1NKE A;  2GEL A;  5CR4 A;  3NDK A;  1ZBI A;  4E3S A;  1Z05 A;  1TK0 A;  1J54 A;  2FSN A;  1WBD A;  4K25 A;  3DRP A;  4K43 A;  3TSU A;  3CPW M;  4IJN A;  3GBT A;  4R79 A;  3VQ5 A;  3ZT3 A;  4W5O A;  1NGC A;  1U4B A;  2W6L A;  3QML A;  4CHO A;  3WT0 A;  3KLH A;  4N5S A;  5D3G A;  1RDA A;  2P9I A;  2VWK A;  3CCR N;  3V1R A;  4DV4 K;  4CZF A;  4NCA A;  3TAN A;  3D2E B;  1W97 L;  1BUP A;  2NRX A;  4CZE A;  1C1B A;  1RT1 A;  4FK0 A;  5C24 A;  3CF5 L;  4YOR A;  4CJU A;  4JI1 K;  4F9O A;  2F9W A;  3DRR A;  4I2P A;  3V1Q A;  1RBU A;  4HCB A;  3TU5 A;  2YHA A;  4LH4 A;  1MWM A;  2YNG A;  2FBX A;  2P9S A;  1IO2 A;  4XH5 A;  2GWK A;  1FK9 A;  2OTL N;  5AQH A;  4CK3 A;  4BC5 A;  4FLW A;  3VA3 A;  1TKD A;  1XC3 A;  4J2B A;  2B6A A;  2RN2 A;  4JKG B;  3VQC A;  1KC8 O;  4KHN A;  4YFU A;  3THY A;  1E3M A;  4HUE A;  3E01 A;  4BR4 A;  4IG0 A;  5DMR A;  3DYA A;  3MEG A;  3QEX A;  2QWQ A;  5AQJ A;  4FL9 A;  3IS9 A;  3D2F B;  4DWI A;  4DTX A;  4EZ6 A;  4MDB A;  1EX4 A;  2X78 A;  4KHU A;  3GOI A;  1BG3 A;  3QEI A;  5I42 A;  2YCH A;  1EET A;  1REV A;  1TYQ A;  1VQO N;  3OJS A;  4B9N A;  4E1J A;  2B4J A;  3C95 A;  1ZC6 A;  4BRI A;  2WON A;  3ID8 A;  3LDN A;  4B9S A;  2EHG A;  1N6Q A;  1BA0 A;  3HM8 A;  2YJE A;  3O4N A;  4OLB A;  3AA5 X;  3TR8 A;  4EFH A;  3QIO A;  1SV5 A;  1YJW N;  1QVF M;  3H45 C;  2UXC K;  4CEE A;  1S9E A;  3K59 A;  3QFU A;  1RIL A;  4HHT A;  3IUC A;  2CH6 A;  4NLC A;  5DK5 A;  5ADX A;  1GOA A;  3O8M A;  4J2E A;  3QBX A;  3KLG A;  4BE1 A;  4BR0 A;  2FSJ A;  1W9H A;  1JLB A;  2E4L A;  1NJW A;  2CH5 A;  1TGO A;  3MDQ A;  1LWE A;  4JKB A;  3V9S A;  2KW4 A;  4GVM A;  5BN8 A;  4JI3 K;  1GLA G;  5HBM A;  3H3N O;  1W0H A;  1QTM A;  3WXM B;  4BRN A;  4BRM A;  3CYM A;  1WSE A;  1VSK A;  4AM7 A;  4BC4 A;  3J7A P;  1VSD A;  1X3N A;  3VEV A;  4CJL A;  4FJ9 A;  1LW0 A;  3MN9 A;  3THX B;  4DSE A;  3RSE A;  5M1K A;  3T3F A;  4CCH A;  5A2Q O;  1NGE A;  4C1N K;  4N41 A;  5CY4 A;  3H6E A;  3BF3 A;  4DLG A;  1OKJ A;  2P9P A;  1S22 A;  1KAY A;  4BG9 A;  4C8L A;  4NCG A;  2HHU A;  1SL2 A;  3C6T A;  3DAW A;  2VG7 A;  3A0I X;  4IG3 A;  3OTO K;  2NRV A;  4UQG A;  3VOV A;  2E2O A;  2G8I A;  1WLJ A;  1I39 A;  4WF9 L;  1HYV A;  1B92 A;  3I33 A;  3SMP A;  1U49 A;  3E9O A;  1M1K O;  1JLG A;  1LAW A;  3MX5 A;  4PKI A;  2V7Z A;  1NK8 A;  3K5L A;  3CCQ N;  3U6F A;  4YOX A;  2O8C B;  1S9G A;  4DQP A;  4JI5 K;  2WC9 A;  1JLF A;  3VQ4 A;  4FLT A;  3AAP A;  4BR2 A;  5BN9 A;  3L8B A;  1WBB A;  1HNX K;  3HO1 A;  4C8O A;  5KI6 A;  3VF4 A;  4Y1D A;  4I6M B;  1XMO K;  3AGR A;  4J2D A;  3PV8 A;  3SJJ A;  4BVO A;  4CJE A;  5BPL A;  4F4K A;  3CC2 N;  1VAZ A;  1VQ5 N;  3L3V A;  3O5B A;  4FWL A;  4CIF A;  3RVC A;  3W3D A;  1WSF A;  4Z4E A;  2XY8 A;  4BRE A;  3EO3 A;  4O8U A;  4B1Z A;  3TAE A;  4CVN E;  3SMS A;  2XY5 A;  4EZ9 A;  1UA0 A;  1NOY A;  3VTH A;  5IWA K;  4OKE A;  4AHV A;  4GY2 B;  2ZGZ A;  5GIP A;  4H4O A;  3AVM A;  3BGR A;  4FJL A;  1J5E K;  4RG8 A;  3VES A;  2Q1N A;  4H0V B;  2HVI A;  3T19 A;  1X9J A;  5JMV A;  2ZWH A;  4ELV A;  1RBV A;  4IDK A;  4DQ8 A;  3BZC A;  4IZ9 A;  2JWL A;  3NF6 A;  3PY8 A;  4FOE A;  3CC4 N;  3VQE A;  4EP5 A;  1YHQ N;  2QWM A;  3UKR A;  4FJ8 A;  4JKE A;  4OLA A;  5JS1 A;  1SUQ A;  1T44 A;  3EZ5 A;  3KVG A;  5AQQ A;  2ASP A;  4M3W A;  1T7P A;  3SLC A;  1J5O A;  3K5M A;  2O8E A;  4O55 A;  4B9U A;  1KTQ A;  2HNZ A;  3MMV A;  4JD2 A;  2GBZ A;  3NCI A;  4GMJ B;  4DR7 K;  1D4X A;  3FGU A;  3O3G A;  4DR1 K;  4KFB A;  1IG9 A;  1G99 A;  1XUP O;  2HBL A;  5BPN A;  4AHR A;  3KWI A;  2WTU A;  1BU6 O;  1VQM N;  2O8B B;  4RTF D;  1VSH A;  1VQL N;  1B9F A;  3MEC A;  3U9D A;  4DF8 A;  4DTM A;  2UUC K;  1YAG A;  1D5A A;  4DFJ A;  4PQU A;  1RBR A;  4CED A;  2YJF A;  3P1G A;  3CM6 A;  3AVC A;  4NXN K;  1WNS A;  3TAR A;  3CI5 A;  1XMQ K;  1EO1 A;  3VEZ A;  5HRR A;  3RTV A;  3WNG A;  3KK7 A;  4K41 A;  5I9E B;  4KI4 A;  5M1O A;  1X3M A;  3C7N B;  1YJ9 N;  3SUN A;  1T6C A;  4O5B A;  3BUZ B;  3OS0 A;  2IS3 A;  2G8U A;  2E8A A;  5GAH P;  1IKV A;  4CGF A;  3U8X A;  3THW A;  5AQT A;  3L2W A;  5E41 A;  4H8K A;  3MN7 A;  4AF1 A;  3OBW A;  4B1U B;  3VMF B;  2P9L A;  2QWO A;  1RTD A;  4DTP A;  5AZI B;  4FWK A;  1RT5 A;  1Q9Y A;  3HT3 A;  3KLI A;  5JS2 A;  4ZTJ A;  2QWN A;  2F8T A;  3SPZ A;  4FJ7 A;  1RCH A;  4HUG A;  1GLB G;  5GAE P;  4CZI A;  1E4G T;  1IBM K;  4L3Q A;  1IKX A;  3TTF A;  3RMD A;  1ASU A;  1IH7 A;  3O80 A;  4CEO A;  3DXM B;  3HK2 A;  4IWV A;  3FZK A;  2I5J A;  1KVB A;  4KHQ A;  4E7K A;  2CGK A;  4BDP A;  1FJG K;  4K42 A;  2CGJ A;  4B3T K;  5GIN A;  1JLC A;  4BRO A;  3GL1 A;  4I2Q A;  3QEV A;  2Q3S A;  2P1J A;  3FZM A;  1HUX A;  2A5X A;  3DLK A;  2Z1J A;  2A6A A;  1WSI A;  1N32 K;  1G15 A;  3U3Y A;  1R0A A;  1WAJ A;  4MLH A;  5M1Q A;  3JYT A;  2HHH K;  3ZX2 A;  1W7A A;  5J2M A;  4DQR A;  2A42 A;  3SK3 A;  3ZET A;  3CIP A;  3NH0 A;  4FJG A;  4PY5 A;  4X65 K;  1JLE A;  3A5O C;  3HPH A;  4BGA A;  4CK1 A;  4BR5 A;  4R5P A;  4KRF A;  5HRO A;  3TAM A;  2O8D B;  1EXQ A;  4DSF A;  4UY8 O;  4CBW A;  1V4T A;  2NLX A;  2W40 A;  1RDD A;  4JI2 K;  1P90 A;  3AAR A;  4FLV A;  3TPQ A;  4JHD A;  3M5R A;  1Q7Y O;  2P51 A;  3LDO A;  4IOX A;  3TTC A;  2D4W A;  1Y64 A;  5AFU H;  5FPM A;  3KK1 A;  5F1X A;  1O1W A;  3DM2 A;  2G8F A;  1CZB A;  3LAN A;  4DU1 A;  3BF1 A;  2OPS A;  2P9K A;  4OGE A;  5IT9 O;  3BY5 A;  3MK6 A;  3AVL A;  2RKI A;  1HQE A;  2OAN A;  2QWR A;  4IOA L;  5FPD A;  1L3T A;  1C0F A;  1U6Z A;  5AQK A;  4KHS A;  2I7N A;  4KB0 A;  1WUA A;  1KLM A;  2D5R A;  1B9D A;  1QE1 A;  4CEC A;  1BL3 A;  2WBN A;  3EE8 A;  2ASO A;  4FK4 A;  1BCO A;  3KKS A;  1SZ2 A;  2ZF5 O;  1D9D A;  1BI4 A;  3FZF A;  1MA9 B;  4KKO A;  1NBW A;  4K8Z A;  4WFN L;  3DLG A;  2KHO A;  4BC3 A;  1N8R O;  3ZEU B;  4CHN A;  1T03 A;  4NLB A;  2RPI A;  1VQN N;  4IJA A;  4NCB A;  3VQA A;  1TKZ A;  4CBX A;  3CM5 A;  1JCE A;  1HX1 A;  4ISG A;  2VQE K;  3AVI A;  3D2E A;  3V9U A;  3AVN A;  1DKG D;  3L4I A;  4CEZ A;  3J7Z O;  4FO0 A;  2F9T A;  3CJ9 A;  2A3Z A;  3RRG A;  1FKP A;  2DPN A;  1NGD A;  1K9M O;  3M8S A;  4FWM A;  1Q8I A;  5M1P A;  2EWS A;  1S3X A;  3DLB A;  5AQR A;  2XY6 A;  4H5N A;  4GKJ K;  1XC9 A;  4EAH D;  2V7Y A;  4DR4 K;  3CFR A;  2W42 A;  3H08 A;  4GW6 A;  5J2N A;  3P31 A;  4PHT X;  3NVM A;  4CEB A;  4G1Q A;  4Z4F A;  5F2R A;  1KAZ A;  1Z25 A;  1GLJ O;  4CZM A;  3VF6 A;  2OZS A;  1NLV A;  4JYA K;  3ZCM A;  4C8K A;  2VCP A;  3F9M A;  3D2F A;  3HL8 A;  5AQM A;  1SAZ A;  3VQ6 A;  1BIS A;  2QW9 A;  5FPE A;  2XO7 A;  3HP6 A;  3SUQ A;  3H46 O;  1FKO A;  3RMB A;  3HPG A;  1CLQ A;  1OVY A;  1ZBH A;  5E26 A;  5BR8 K;  3UB5 A;  3PSF A;  1ZBF A;  4DMN A;  1I94 K;  3OYJ A;  3RR7 A;  4LFB K;  4WYB A;  2KZZ A;  1RT4 A;  4CD3 A;  4BRH A;  4FZX C;  1P8Z A;  1YVU A;  3THV A;  2X74 A;  3S41 A;  3WEE A;  4CGJ A;  2DFF A;  4JEP A;  1TUU A;  4BR7 A;  2ZJR L;  4GVE A;  3CXC M;  4Z94 A;  4LC9 B;  2IVO A;  3QLH A;  1IG8 A;  1QHT A;  1NJZ A;  3AA2 A;  2ZGY A;  4RCH A;  4A5B A;  4E0D A;  1NU0 A;  4ZTF A;  1HPZ A;  1M90 O;  3CCL N;  1KAX A;  2Q0R A;  3AVH A;  3G4S N;  4F2S A;  3LDQ A;  3O9R A;  3I56 N;  5AQO A;  3AO3 A;  1JCG A;  4E1M A;  3E9L A;  5LY3 A;  1U04 A;  1V4S A;  3KLF A;  4M42 A;  1U48 A;  4C23 A;  1RT7 A;  3SI6 A;  1JJ2 M;  2O4I A;  2GV9 A;  4DLE A;  3OYA A;  4RW8 A;  5CYQ A;  3FFI A;  4BWJ A;  4DTO A;  3Q7C A;  4H0P A;  3CJ1 A;  2E6M A;  4M3Y A;  3LDL A;  3LM9 A;  3CQX A;  2O8F B;  3CJ7 A;  3DLL L;  4IO9 L;  3MN5 A;  3WQT A;  1JCF A;  2E5L K;  5E84 A;  4GV6 A;  3KK3 A;  2O8C A;  4QS9 A;  2HHW A;  1F21 A;  4WCE L;  3LAK A;  4M3U A;  3SYZ A;  3M8R A;  1D9F A;  2D0P A;  2F7T A;  4BRC A;  3VA0 A;  3WXL A;  4F3T A;  1VHX A;  2DFH A;  4Z4I A;  3QES A;  1BQM A;  3O1B A;  2RF2 A;  3LPU A;  3I8B A;  1QQC A;  2FXU A;  4H5W A;  1RTJ A;  2D0O A;  3TSQ A;  1NK0 A;  4Z4H A;  3TAF A;  4Z4G A;  5DM6 L;  2BE2 A;  2WFB A;  3DWL A;  1UA1 A;  3K2P A;  2IDO A;  3T1H K;  2YI1 A;  4FJM A;  1QSS A;  1KCF A;  2YHY A;  5C2F A;  2IOC A;  2JLE A;  1MU2 A;  3HP9 A;  2QM1 A;  1HLU A;  2NZT A;  1RTH A;  3CCU N;  3AA4 A;  4YOW A;  1W2B M;  3LP3 A;  3KJV A;  4DR3 K;  1S1V A;  3G0Z A;  4H0Y B;  5AQZ A;  1VQ4 N;  1YIT N;  4RW9 A;  3CFP A;  1NK5 A;  5AZJ A;  4CEQ A;  4GKK K;  3SUO A;  4IXC A;  2VGN A;  1VRT A;  3A5L C;  4CJF A;  1BIZ A;  4CER A;  1HPM A;  5JVG L;  4WQ4 C;  4IFV A;  1LOT B;  3T1A A;  3ZLJ A;  4EHT A;  3SNN A;  4AHU A;  4Q5V A;  5GAG P;  5LMU K;  3DLH A;  1VSF A;  1BIU A;  4CIE A;  1YJN N;  1S6Q A;  3UKU B;  4FLY A;  2Z1I A;  2GEM A;  1S6P A;  4O5F A;  4M3Z A;  2EX3 A;  3E1Y A;  4IFE A;  4DFK A;  3KIO A;  1HQU A;  1OVQ A;  3SJH A;  2OCE A;  4JN4 A;  3AVA A;  4M3R A;  3I8D A;  4DV2 K;  3PX0 A;  3TWH A;  4QCL A;  3WUH A;  5BRD A;  2R7Y A;  1U2V B;  2FF3 B;  1MWK A;  4PL8 A;  1XHX A;  3KD5 E;  1HR0 K;  1BGX T;  3VQ7 A;  3V1O A;  3DOK A;  3ZSR A;  4CJK A;  3I0S A;  2F96 A;  3HOT A;  4JKF A;  1KQS M;  3PIO L;  4FWS A;  3T1Y K;  2KTQ A;  3R3L A;  3PSI A;  2HBK A;  4U7B A;  4QOZ B;  3DLR A;  2YHW A;  1KLN A;  3C7N A;  4YNQ A;  3VQ8 A;  2P9I B;  1KFD A;  2AA4 A;  4CZK A;  3R1X A;  1OH6 A;  3VEX A;  4AIL C;  4CK2 A;  1BCM A;  2HHT A;  4JI7 K;  3FFK B;  4A2A A;  3DMJ A;  3O08 A;  1JKH A;  1D8Y A;  4JV5 K;  4LSL A;  1CXU A;  3NF8 A;  4DU4 A;  5AZI A;  1Q82 O;  3VGL A;  2P9S B;  4KHW A;  1L5U A;  2AP1 A;  4OPH A;  1L3V A;  4AHC A;  3AGK A;  5LJW A;  2D0B A;  5KTQ A;  4B8A B;  4XH1 A;  3NGZ A;  3VN5 A;  1RDC A;  1ITG A;  3RMA A;  3SZ2 A;  4HCC A;  2KLA A;  3H3O B;  2KQ2 A;  3THY B;  3OW2 M;  4ELU A;  3L6Q A;  2PAV A;  4IBN A;  2ETJ A;  5KQ8 A;  2DFE A;  3P5J A;  4KI6 A;  1JL2 A;  3VF2 A;  4PL7 A;  2HF4 A;  3VQB A;  3PX4 A;  2HHV A;  3ZT1 A;  4WQ5 C;  1TYQ B;  3QIN A;  2HNY A;  5BPM A;  2PZS A;  4CJ4 A;  4B3O A;  3Q7B A;  3KLE A;  4B3R K;  4BY9 C;  4FWO A;  4H5R A;  5FRO A;  1T3V A;  2FSK A;  1QHA A;  4B1X B;  1TKT A;  3PX6 A;  3LM2 A;  4L8R B;  3ALY A;  3LP0 A;  3I55 N;  2BUP A;  2V52 B;  3GE1 A;  3F2K A;  4B9V A;  4H0X B;  1X9M A;  1KSP A;  1ZBU A;  3QEW A;  4F8R A;  2DTU A;  3OYB A;  1GLC G;  2O4G A;  3C6U A;  4EHU A;  4JKD A;  3V9Z A;  2UU9 K;  3O9T A;  1VQK N;  1NJI O;  3DXK B;  4B1Y B;  1A5X A;  3L0Q A;  3ZT0 A;  1H1V A;  4ID1 A;  3HST B;  1IKW A;  2E20 A;  3SQ4 A;  3A8Y A;  4BRK A;  4FW2 A;  4JNE A;  4B9Q A;  4MLE A;  1C6V A;  4FWQ A;  4JS5 A;  5BR9 A;  2QXF A;  5EOY A;  1N33 K;  2RE2 A;  1K8K B;  3T7Z A;  1J53 A;  5BRE A;  3CD6 N;  1HMV A;  3SBG A;  2IC3 A;  1DT9 A;  1NKC A;  1YF5 L;  3F5T A;  2OYQ A;  1NM1 A;  3OYE A;  4DR6 K;  1YTU A;  4LF5 K;  4DQQ A;  2HND A;  5EY4 A;  2QWL A;  2YX6 A;  3V6D A;  1XQS C;  5KGX A;  4BE0 A;  3P39 A;  5AQX A;  3SCX A;  1OH5 A;  2OPR A;  3ZT2 A;  3F73 A;  3AO1 A;  4FWN A;  4JKA A;  1JL1 A;  4IFY A;  4LF6 K;  4IEE A;  2B5J A;  4E7H A;  5TKY A;  4DQI A;  1BO5 O;  2BDP A;  1HNZ K;  3VPZ A;  4MQ3 A;  4QS8 A;  2Q36 A;  4CFC A;  3F9K A;  4FCY A;  1NGG A;  1BHL A;  4A2B A;  5AQG A;  4JI8 K;  4CJQ A;  4DTN A;  3CJA A;  1JXB A;  3CQY A;  1C0U A;  3E9P A;  5C15 A;  1ILY A;  2X6N A;  3SV4 A;  3ISN C;  4XEI A;  1S5J A;  3DJC A;  4CGI A;  3P83 D;  4OX9 K;  3ZX3 A;  1GLE G;  2Z1G A;  2HMI A;  1VQ8 N;  4WQ4 A;  4PKG A;  3MCP A;  3OYG A;  2PYL A;  1NJY A;  5J2P A;  4G9Z A;  3N4P A;  3OYH A;  3S3O A;  2BAN A;  4DFM A;  4ID5 A;  4ILH A;  3MED A;  1XNQ K;  4A59 A;  1HJR A;  5JIC A;  4HTU A;  5KRT A;  2HB5 A;  4CJ5 A;  3ZYY X;  3V4I A;  3PIP L;  4DSI A;  4WE1 A;  3QDK A;  3G6E N;  2UUA K;  4CHP A;  3AO4 A;  3LP1 A;  5JVH L;  3LAM A;  1FXX A;  1RBS A;  2VG6 A;  4WFB L;  2NNW A;  2P9U A;  3ATU A;  3CC7 N;  4DSK A;  4HWI A;  1RNH A;  2FLO A;  3ZSW A;  4DTU A;  3VEW A;  1C0G A;  3DLE A;  3MAQ A;  1I3A A;  1NGB A;  3LZI A;  3AVK A;  3IDH A;  3J8A A;  3CME N;  3DI6 A;  3OYF A;  3M8Q A;  3TAQ A;  4M7Y A;  4CIG A;  4JD2 B;  5HRN A;  4NYF A;  2NRW A;  2NRR A;  4DV1 K;  4CJS A;  2G8H A;  4DR5 K;  1LAV A;  2PYJ A;  4FJX A;  3DOL A;  4NB4 A;  1EKE A;  4LSN A;  4E19 A;  1QVG M;  4QAG A;  4KB1 A;  4FLX A;  5AQN A;  3LPT A;  4PKH A;  1RTI A;  2VGM A;  5EVZ A;  3AA3 A;  2PY5 A;  5GAD P;  5AFU A;  5HLF A;  1XNR K;  1XWL A;  1X1P A;  1NWK A;  3H1Q A;  1N34 K;  1RDU A;  5I3U A;  4DS4 A;  1NK4 A;  1CXQ A;  2OTJ N;  5HL7 L;  3EL2 A;  3WXK A;  4NXM K;  1NOZ A;  2E1Z A;  3OBY A;  3V9X A;  4H0T B;  4JKH A;  5AQW A;  1U45 A;  2I7P A;  4DF4 A;  3OJU A;  4FYD A;  2ZJQ L;  1NNE A;  3RMC A;  1HKB A;  4DUZ K;  4CFB A;  2UYT A;  1RDW X;  4X64 K;  1SL0 A;  3THW B;  4WQ5 A;  4CE9 A;  2E2Q A;  3ITH A;  3KWG A;  2GUP A;  4M7X A;  4CZG A;  1ZBL A;  1NJX A;  1A5V A;  2VWJ A;  2Y1J A;  2P9L B;  4AM6 A;  1TK8 A;  3PLA A;  5JLH A;  1ZXO A;  3M6G A;  4KHP K;  1KFS A;  4CEA A;  3AO2 A;  3GG4 A;  1BWF O;  5CHI A;  3BEX A;  3QBW A;  4NO7 A;  4FW1 A;  4CF1 A;  4Y1C A;  2QK9 A;  4PUO A;  4JKG A;  4A61 A;  4CFD A;  3NAE A;  1C0T A;  4JAX A;  1CZA N;  1IBK K;  1RT3 A;  4JKC A;  2OA8 A;  4W5T A;  3ID6 A;  4OPJ A;  4DQS A;  3HSC A;  4KRE A;  4BQZ A;  4M3X A;  1IV0 A;  3R6M A;  4RWT A;  4I7F A;  2J4R A;  3EYZ A;  1VSL A;  1QZ6 A;  2FF6 A;  2FBY A;  5F0X A;  3BZK A;  4H5V A;  5H1S Q;  2HHQ A;  3OVN A;  4DB3 A;  1N5Y A;  1T6D A;  2OZM A;  5AQS A;  3ZET B;  5EU7 A;  4CJP A;  2F4V K;  1K6Y A;  2D1K A;  3IMX A;  3SQ1 A;  1MDU B;  1QQM A;  2E88 A;  3TAB A;  4FXD A;  1R59 O;  3O9S A;  4ZHR A;  3HM9 A;  3JS6 A;  3N4Q A;  3H1V X;  3SAG A;  1RFQ A;  3LZJ A;  2ZE2 A;  1TK5 A;  3IFR A;  3CPE A;  3SUP A;  4CZH A;  1Y97 A;  4OPA A;  2P9N B;  1DTQ A;  2GX9 A;  4FWR A;  4H03 B;  3ATV A;  3HI0 A;  4E7L A;  3VQD A;  2HF3 A;  4BGB A;  1JXE A;  3O3F A;  4J8F A;  4FPA A;  2P9K B;  4LFC K;  3VER A;  4B9M A;  4FWP A;  1EWR A;  3FR0 A;  3LP2 A;  4MFB A;  1YI2 N;  2VG5 A;  5MLC Q;  2VQF K;  4FLZ A;  4NYN A;  3EKU A;  4O44 A;  4EIA A;  3THX A;  1DLO A;  1LCU A;  4CJV A;  2QTD A;  4Z4C A;  1OH8 A;  3OS1 A;  1XI1 A;  4HUF A;  3O4Q A;  4B9L A;  4JK9 A;  4A5A A;  1HNV A;  1UWB A;  1QS4 A;  4PA1 A;  2WUS A;  1U2V A;  3CJB A;  1E4F T;  1VQ6 N;  2V51 B;  5T7B A;  3S3N A;  1BI4 B;  1LW2 A;  2OPQ A;  4A57 A;  5B8H A;  5HRP A;  4LF4 K;  4FJK A;  3SQ0 A;  1TV6 A;  4FJI A;  1SS6 A;  3I0R A;  3KZB A;  1ASV A;  2LSN A;  1HYS A;  5KPR A;  3EEQ A;  4OGC A;  1YUW A;  3VEO A;  3ZSV A;  2RHK A;  3AVG A;  4KTQ A;  2NRZ A;  2P5O A;  2YKN A;  3ZX0 A;  4DV5 K;  2QA4 N;  1KD1 O;  3B6O A;  4B3M K;  1GOB A;  4BRL A;  4AH9 A;  4BRQ A;  4JK8 A;  3ULE B;  1RDB A;  3BP8 A;  1S1W A;  4FZY A;  5KRS A;  1S1U A;  4B9T A;  4I6M A;  4IEI A;  4JS4 A;  3OYI A;  2D0A A;  1VQP N;  1VSI A;  1BA1 A;  1ZBS A;  5SZT A;  1HYZ A;  4JI6 K;  3OS2 A;  2YHB A;  3NGI A;  1ASW A;  1GOC A;  3B6P A;  3QB0 A;  5AQI A;  3WXJ A;  3C0B A;  2ZM6 K;  4AQY K;  5KQD A;  5KPZ A;  1HNW K;  3QET A;  1C1C A;  5ADX H;  3K9J A;  3IAY A;  4O8K A;  1YT3 A;  4IKF A;  3K58 A;  5C0Y A;  3OHR A;  4BDY A;  4DR2 K;  4E89 A;  4CHY A;  1DEJ A;  3HOS A;  2KKZ A;  1NK9 A;  3MXJ A;  2BTF A;  4FLU A;  4FJH A;  4XH4 A;  4JLH A;  4J2A A;  2X6S A;  4AHT A;  5M1N A;  3C6A A;  3HXM A;  4BE2 A;  1NMD A;  4DCH A;  1ATR A;  1NK6 A;  1TKX A;  3WEE B;  4CZJ A;  2KFN A;  1Q81 O;  3HTV A;  3QEP A;  3HZ6 A;  4A62 A;  4XIU A;  3CCJ N;  1K73 O;  4DFP A;  5FRM A;  1KRP A;  4YDU C;  1WSH A;  2PBD A;  4CJT A;  4CW7 B;  3MXI A;  2JWK A;  1BDG A;  3LWL A;  1SL1 A;  5ELZ A;  3DXK A;  3R8E A;  4CHZ A;  4F2R A;  2BH1 A;  1L3S A;  3MEE A;  3NF7 A;  2Q0U A;  4W5Q A;  2FBV A;  1NG9 A;  4DSL A;  2Q97 A;  4DTJ A;  3AVF A;  4YHH K;  4JI0 K;  4CGG A;  3OYN A;  4IOC L;  4FVU A;  4K8X A;  4O4G A;  2FC0 A;  4HVJ A;  4DG1 A;  1WSJ A;  1RBT A;  1K8K A;  1TL1 A;  4YY3 K;  2O8B A;  5EXW A;  4KO0 A;  3LDS A;  4CFA A;  3L2U A;  4RW7 A;  4BRF A;  3WXI A;  1C0M A;  3U4L A;  3ENO A;  4BC2 A;  5J2Q A;  4KPY A;  3QIP A;  1NKB A;  4OVL A;  3QIC A;  1HNI A;  2QWP A;  3AO5 A;  3HPO A;  4JRP A;  2GTD A;  3KD1 E;  1KVC A;  3NMU A;  1NGJ A;  3VQQ A;  3A5M C;  1YIJ N;  1S1X A;  3NVK A;  1XHZ A;  4K0K K;  4ISE A;  4DUY K;  3FE1 A;  5CZ2 A;  4CES A;  4B8C A;  1NGA A;  4BRP A;  1Q86 O;  4FJN A;  4FZZ A;  3TI0 A;  1CZ9 A;  4AHS A;  3RRH A;  4YOV A;  4QS7 A;  1ATS A;  3NH1 A;  4CGH A;  5C10 A;  3OYL A;  2ITM A;  4M45 A;  1VSM A;  3WNF A;  3K0S A;  3O9Q A;  2YHX A;  4B1W B;  4MO5 A;  4DU3 A; 
#chains in the Genus database with same CATH homology
 1IO2 A;  1Q8I A;  1FK9 A;  4CJQ A;  1KVA A;  3DLB A;  4DTN A;  2XY6 A;  4CK3 A;  4FM1 A;  5C25 A;  1JXB A;  1XC9 A;  4FLW A;  1C0U A;  3VA3 A;  1TKD A;  4J2B A;  1EP4 A;  2B6A A;  2RN2 A;  3NH2 A;  4N56 A;  3VQC A;  3CFR A;  2X6N A;  3SV4 A;  3ISN C;  2W42 A;  1S5J A;  3H08 A;  4GW6 A;  3S3M A;  4YFU A;  4KHN A;  2NUB A;  5J2N A;  4CGI A;  4HUE A;  3ULD A;  3P83 D;  3E01 A;  2XRI A;  4CEB A;  4G1Q A;  4IG0 A;  1LV5 A;  4Z4F A;  2Z1G A;  5DMR A;  3DYA A;  3MEG A;  3RR8 A;  1Z25 A;  2HMI A;  3QEX A;  2OZS A;  4KV8 A;  3IS9 A;  1LWC A;  2OPP A;  4DWI A;  3AVB A;  3OYG A;  4DTX A;  2PYL A;  3ZCM A;  4M41 A;  1NJY A;  5J2P A;  1EX4 A;  4C8K A;  4EZ6 A;  2X78 A;  4KHU A;  3OYH A;  3S3O A;  4KAZ A;  2BAN A;  4DFM A;  3QEI A;  4ID5 A;  5I42 A;  4CGD A;  5FRN A;  1EET A;  3HL8 A;  1REV A;  3MED A;  3OJS A;  4B9N A;  3VQ6 A;  2B4J A;  3L2Q A;  1BIS A;  3C95 A;  2A1R A;  1HJR A;  4DS5 A;  2WON A;  2XO7 A;  3HP6 A;  3SUQ A;  4TSX A;  4HTU A;  3IRX A;  1FKO A;  1Z26 A;  4B9S A;  3RMB A;  2EHG A;  3HPG A;  5KRT A;  1N6Q A;  2HB5 A;  1J5O A;  1CLQ A;  2YKM A;  4CJ5 A;  1ZBH A;  3O4N A;  3V4I A;  4OLB A;  4DSI A;  3AA5 X;  1ZBF A;  4WE1 A;  3TR8 A;  4DMN A;  3QIO A;  3OYJ A;  1SV5 A;  2JGU A;  3RR7 A;  2KZZ A;  2BGG A;  1RT4 A;  4CHP A;  4O0J A;  3AO4 A;  4CEF A;  1HRH A;  4FZX C;  3M8P A;  3LP1 A;  1YVU A;  1S9E A;  4CEE A;  3LAM A;  1FXX A;  2X74 A;  3THV A;  3K59 A;  1RIL A;  3OYM A;  4HHT A;  1RBS A;  2VG6 A;  2HVH A;  2YV0 X;  4CGJ A;  4DSK A;  4RW6 A;  1RNH A;  5DK5 A;  1GOA A;  2DFF A;  4J2E A;  3KLG A;  4BE1 A;  3ZSW A;  3OYC A;  1W9H A;  1JLB A;  2E4L A;  3ZSZ A;  4DTU A;  1NJW A;  1TGO A;  4N76 A;  1LWE A;  1ZBI A;  3DLE A;  2KW4 A;  3QLH A;  4EP4 A;  3MAQ A;  4GVM A;  3V9S A;  1I3A A;  5HBM A;  3NHG A;  3AVK A;  3LZI A;  3OYD A;  1QHT A;  4KHY A;  1NJZ A;  1W0H A;  1QTM A;  3AA2 A;  3DI6 A;  3OYF A;  3M8Q A;  3TAQ A;  4BAC A;  4E0D A;  3CYM A;  3ZSQ A;  4CIG A;  5HRN A;  3TAP A;  1HPZ A;  1S1T A;  1WSE A;  4NYF A;  4ZTF A;  4FVM A;  1VSK A;  1A5W A;  3MXM A;  4CJS A;  3JSM A;  3AVH A;  4E7J A;  2G8H A;  1LAV A;  2HHX A;  1VSD A;  1SKR A;  2PYJ A;  4F2S A;  4FJX A;  3DOL A;  1EKE A;  4LSN A;  4CJL A;  4E19 A;  4OPK A;  3UIQ A;  4QAG A;  4FJ9 A;  3AO3 A;  4KB1 A;  1LW0 A;  4FLX A;  3LPT A;  4CJW A;  3ZSX A;  4E1M A;  1RTI A;  1U04 A;  4DSE A;  3KLF A;  3AA3 A;  3AVJ A;  2PY5 A;  3T3F A;  4CCH A;  4M42 A;  2D0C A;  1WSG A;  5HLF A;  1XWL A;  2IGI A;  1U48 A;  1X1P A;  4CF9 A;  5I3U A;  4DS4 A;  1C1A A;  3HVR A;  1RT7 A;  5CY4 A;  3QNO A;  1NK4 A;  4N41 A;  1CXQ A;  4CJ3 A;  3SI6 A;  4DLG A;  3WNH A;  3VQP A;  1NOZ A;  2O4I A;  3KTQ A;  4C8L A;  4NCG A;  2HHS A;  2HHU A;  1SL2 A;  3C6T A;  2VG7 A;  4IG3 A;  2GV9 A;  4UQG A;  4OKK A;  4DLE A;  3V9X A;  1JLQ A;  5KGW A;  1U45 A;  2G8I A;  3OYA A;  4DF4 A;  1WLJ A;  4C8M A;  4RW8 A;  3OJU A;  1I39 A;  4FYD A;  1HYV A;  5CYQ A;  3RMC A;  3FFI A;  4LY7 A;  4BWJ A;  4DTO A;  1B92 A;  4M3Y A;  2E6M A;  4CFB A;  3SV3 A;  1U49 A;  3QER A;  1SL0 A;  4CE9 A;  1JLG A;  2XY7 A;  3ITH A;  1LAW A;  1NJX A;  1ZBL A;  2Y1I A;  1A5V A;  2VWJ A;  3ZSO A;  2Y1J A;  1NK8 A;  3K5L A;  3U6F A;  3QO9 A;  1TK8 A;  1S9G A;  1TAQ A;  4DQP A;  2XHB A;  4Z0U A;  1KFS A;  4CEA A;  3AO2 A;  1JLF A;  1WN7 A;  3VQ4 A;  3KK3 A;  4FLT A;  3L8B A;  2HHW A;  1F21 A;  3LAK A;  4M3U A;  3O3H A;  3SYZ A;  1IKY A;  4FW1 A;  3HO1 A;  4CF1 A;  4C8O A;  5KI6 A;  3M8R A;  1D9F A;  4Y1C A;  4Y1D A;  2QK9 A;  4ELT A;  2YNF A;  4PUO A;  4J2D A;  3VA0 A;  3PV8 A;  3SJJ A;  4F3T A;  4CFD A;  3NE6 A;  3NAE A;  1C0T A;  1VK0 A;  1WAF A;  2DFH A;  4CJE A;  3PO4 A;  4F4K A;  3K5O A;  3BDP A;  1RT3 A;  3WNE A;  3KK2 A;  4W5T A;  3V9W A;  3L3V A;  2OA8 A;  3QES A;  4Z4I A;  4OPJ A;  1BQM A;  3IG1 A;  4DQS A;  4CIF A;  4Z4E A;  4H4M A;  1WSF A;  5K14 A;  2RF2 A;  2XY8 A;  3LPU A;  4KRE A;  2ITG A;  2G8V A;  4M3X A;  1QQC A;  2AJQ A;  3K5N A;  3TAE A;  3K57 A;  5SWM A;  3LWM A;  5J1E A;  1RTJ A;  4I7F A;  1NK0 A;  4Z4H A;  4B08 A;  1J9A A;  3EYZ A;  3TAF A;  2XY5 A;  4Z4G A;  1VSL A;  4I9L A;  3OY9 A;  1UA0 A;  4EZ9 A;  4OJR A;  1NOY A;  3CQ8 A;  4JRQ A;  5FDL A;  4FJ5 A;  4E1N A;  4DTS A;  2FBY A;  1TL3 A;  2BE2 A;  3OYK A;  4I9Q A;  4FM2 A;  4OKE A;  4W5R A;  4AHV A;  1UA1 A;  3K2P A;  3NBP A;  2IDO A;  2HHQ A;  3OVN A;  4H4O A;  4FJM A;  3AVM A;  3BGR A;  4CHQ A;  4BDZ A;  1ZYQ A;  1N5Y A;  1QSS A;  4FJL A;  1KCF A;  2OZM A;  4RG8 A;  2IOC A;  2JLE A;  1MU2 A;  3HP9 A;  2F8S A;  5EU7 A;  4CJP A;  2HVI A;  1K6Y A;  3T19 A;  1RTH A;  3SQ1 A;  4ELV A;  1RBV A;  3AA4 A;  1QSY A;  4N47 A;  3LP3 A;  3KJV A;  4IDK A;  1S1V A;  3G0Z A;  4CF0 A;  1RT6 A;  3TAB A;  4FXD A;  4RW9 A;  3NF6 A;  4ICL A;  3PY8 A;  3VQE A;  3CFP A;  1UOC A;  4LH5 A;  4EP5 A;  4CEQ A;  4ZHR A;  3HM9 A;  1NK5 A;  4DSJ A;  3SUO A;  4FJ8 A;  1VSJ A;  3L2R A;  3LZJ A;  2ZE2 A;  1TK5 A;  4OLA A;  5JS1 A;  1VRT A;  1SUQ A;  4CJF A;  1BIZ A;  4CER A;  3SUP A;  1Y97 A;  3L3U A;  3EZ5 A;  1DTQ A;  3ZSY A;  4M3W A;  1T7P A;  4IFV A;  3T1A A;  2G8K A;  4E7L A;  1RT2 A;  3DRS A;  3VQD A;  4AHU A;  1UAX A;  1JXE A;  3K5M A;  3SNN A;  4O55 A;  4Q5V A;  3O3F A;  1BQN A;  1KTQ A;  1VSF A;  1BIU A;  2HNZ A;  4CIE A;  3DLH A;  4B9U A;  2GBZ A;  1S6Q A;  3LAL A;  3NCI A;  4GMJ B;  4FLY A;  2Z1I A;  4B9M A;  3O3G A;  4KFB A;  1S6P A;  3RWU A;  1L3U A;  1IG9 A;  4M3Z A;  3LP2 A;  4MFB A;  2EX3 A;  2VG5 A;  4FLZ A;  2G8W A;  4E7I A;  4CF2 A;  4NYN A;  3CFO A;  4O44 A;  4DFK A;  2KFZ A;  3CG7 A;  3KIO A;  1HQU A;  4BWM A;  4AHR A;  3TAG A;  3SPY A;  1DLO A;  4CJV A;  4FJJ A;  3AVA A;  4Z4C A;  4M3R A;  3I8D A;  3OS1 A;  1VSH A;  4HUF A;  1B9F A;  3O4Q A;  4KTW A;  3TWH A;  3PX0 A;  1XI1 A;  4B9L A;  4QCL A;  3MEC A;  1JLA A;  2WOM A;  2IAJ A;  2R7Y A;  4DF8 A;  4DTM A;  4DFJ A;  1D5A A;  1HNV A;  1UWB A;  1QS4 A;  1XHX A;  4PA1 A;  3AV9 A;  1BGX T;  1RBR A;  1T05 A;  4PQU A;  4Q0B A;  3VQ7 A;  4CED A;  3P1G A;  3KD5 E;  3CM6 A;  3AVC A;  3NGY A;  3DOK A;  3V1O A;  1WNS A;  5T7B A;  1BI4 B;  1LW2 A;  3S3N A;  3ZSR A;  2P5G A;  3TAR A;  4FK2 A;  4CJK A;  3I0S A;  2F96 A;  3KKR A;  3HJF A;  5HRR A;  1Q9X A;  2OPQ A;  3WNG A;  3RTV A;  4KI4 A;  1VSE A;  5HRP A;  2KTQ A;  3PUF A;  3SUN A;  4O5B A;  4FJK A;  3HVT A;  3SQ0 A;  1TV6 A;  4FJI A;  4QOZ B;  3DLR A;  3I0R A;  3OS0 A;  1KLN A;  2IS3 A;  4YNQ A;  2G8U A;  2HW3 A;  3VQ8 A;  1ASV A;  2LSN A;  1HYS A;  1KFD A;  1IKV A;  4OGC A;  4CGF A;  1TAU A;  4RW4 A;  3V81 A;  4AIL C;  3ZSV A;  3AVG A;  3L2W A;  4CK2 A;  3D0P A;  4KTQ A;  1BCM A;  5E41 A;  4H8K A;  2HHT A;  2P5O A;  2YKN A;  3PO5 A;  3B6O A;  3DMJ A;  1RTD A;  4DTP A;  1GOB A;  1JKH A;  1D8Y A;  4AH9 A;  1RT5 A;  1Q9Y A;  3HT3 A;  4LSL A;  3KLI A;  5JS2 A;  4ZTJ A;  2F8T A;  1U47 A;  1CXU A;  3NF8 A;  4DU4 A;  4KTZ A;  4CF8 A;  1RCH A;  1RDB A;  4HUG A;  1S1W A;  3SPZ A;  4FJ7 A;  4FZY A;  1L5U A;  4KHW A;  5KRS A;  1L3V A;  1S1U A;  2YNH A;  4AHC A;  4B9T A;  3NF9 A;  1IKX A;  2D0B A;  5KTQ A;  4JS4 A;  1ASU A;  1IH7 A;  4B8A B;  4CEO A;  3RMD A;  3C94 A;  3NGZ A;  3HK2 A;  4PWD A;  3OYI A;  2D0A A;  2I5J A;  3VN5 A;  1RDC A;  3S9H A;  1KVB A;  4C8N A;  4KHQ A;  1ITG A;  4E7K A;  3RMA A;  3SZ2 A;  1VSI A;  4HCC A;  2Z1H A;  2KQ2 A;  2QKB A;  5SZT A;  1HYZ A;  4ELU A;  1LWF A;  4O0I A;  3EY1 A;  4BDP A;  3OS2 A;  2YHB A;  3NGI A;  1JLC A;  1ASW A;  4I2Q A;  1GOC A;  3QEV A;  3B6P A;  2ETJ A;  4IBN A;  2Q3S A;  2DY4 A;  2P1J A;  2DFE A;  3P5J A;  4KI6 A;  1JL2 A;  3DLK A;  4M3T A;  2Z1J A;  3D45 A;  1WSI A;  1G15 A;  3VQB A;  3U3Y A;  3PX4 A;  2KZM A;  1R0A A;  2HHV A;  1WAJ A;  3ZT1 A;  2QKK A;  3QET A;  5CYM A;  1C1C A;  3QIN A;  3QNN A;  2HNY A;  3IAY A;  3JYT A;  2PZS A;  4CJ4 A;  1X9S A;  4B3O A;  3A2F A;  3KLE A;  4W5N A;  1YT3 A;  4IKF A;  3ASM A;  3K58 A;  5J2M A;  4DQR A;  4BDY A;  1NK7 A;  4E89 A;  2FBT A;  4CHY A;  2GUI A;  5FRO A;  1NK9 A;  3NH0 A;  4FJG A;  4PY5 A;  3MXJ A;  1JLE A;  4FLU A;  3HPH A;  4FJH A;  4J2A A;  4JLH A;  1TKT A;  4CK1 A;  4R5P A;  2X6S A;  2YNI A;  4AHT A;  4FM0 A;  3PX6 A;  3TAM A;  5HRO A;  1SKW A;  4L8R B;  3HXM A;  1EXQ A;  3ALY A;  3LP0 A;  5C42 A;  3ZT4 A;  2ATQ A;  4DSF A;  3G10 A;  1SKS A;  4BE2 A;  4B9V A;  1X9M A;  1DTT A;  1KSP A;  1RDD A;  1ZBU A;  3QEW A;  1NK6 A;  4F8R A;  2DTU A;  2A1S A;  3OYB A;  1TKX A;  4FLV A;  2O4G A;  2E6L A;  5CZ1 A;  3C6U A;  2KFN A;  4OKJ A;  1X9W A;  2ZD1 A;  3V9Z A;  4XIU A;  3QEP A;  5HP1 A;  5HRS A;  4CJR A;  3L2V A;  4DFP A;  2P51 A;  4DTR A;  5FRM A;  1KRP A;  4F3O A;  1WSH A;  1A5X A;  3ZT0 A;  4CJT A;  4ID1 A;  3MXI A;  2G8F A;  3KK1 A;  1O1W A;  3DM2 A;  3HST B;  1CZB A;  1IKW A;  3LAN A;  3NFA A;  3LWL A;  4DU1 A;  4CHZ A;  3SQ4 A;  1SL1 A;  2OPS A;  4OGE A;  3HYF A;  4F2R A;  4FW2 A;  3SQ2 A;  1L3S A;  3AVL A;  3MEE A;  1C6V A;  4JS5 A;  2RKI A;  1HQE A;  3NF7 A;  2QXF A;  4W5Q A;  2FBV A;  1L3T A;  1YTA A;  3VQ9 A;  4DSL A;  4KRF A;  4DTJ A;  3AVF A;  1TVR A;  1QSL A;  4CGG A;  3OYN A;  4KHS A;  4KB0 A;  3U3G A;  1J53 A;  1KLM A;  2ZQB A;  2D5R A;  4K8X A;  4O4G A;  1VRU A;  2FC0 A;  1HMV A;  4DG1 A;  4HVJ A;  1T8E A;  1B9D A;  1QE1 A;  4LD0 A;  1WSJ A;  1RBT A;  4CEC A;  1TL1 A;  1NKE A;  2IC3 A;  1BL3 A;  4KO0 A;  3NDK A;  1NKC A;  3LDS A;  4E3S A;  4FK4 A;  1TK0 A;  1J54 A;  4CFA A;  1BCO A;  4RW7 A;  3L2U A;  3OYE A;  3KKS A;  2OYQ A;  3DRP A;  1C0M A;  1YTU A;  1D9D A;  5J2Q A;  4DQQ A;  2HND A;  1BI4 A;  4KPY A;  4W5O A;  3VQ5 A;  3QIP A;  3ZT3 A;  3V6D A;  1NKB A;  4KKO A;  4OVL A;  5KGX A;  1U4B A;  4K8Z A;  1HNI A;  3DLG A;  3AO5 A;  4CHO A;  3HPO A;  4BE0 A;  3SCX A;  4JRP A;  2OPR A;  3KD1 E;  3ZT2 A;  3KLH A;  1KVC A;  3F73 A;  4N5S A;  5D3G A;  3AO1 A;  3VQQ A;  4CHN A;  1T03 A;  1S1X A;  1RDA A;  1XHZ A;  2VWK A;  3V1R A;  2RPI A;  1JL1 A;  4IFY A;  4NCA A;  3VQA A;  3TAN A;  1TKZ A;  4NCB A;  5CZ2 A;  2B5J A;  4B8C A;  4CES A;  4E7H A;  1C1B A;  1RT1 A;  4FK0 A;  4FJN A;  3CM5 A;  5C24 A;  4FZZ A;  3TI0 A;  4CJU A;  4DQI A;  1CZ9 A;  4AHS A;  3AVI A;  3RRH A;  2BDP A;  3V9U A;  3NH1 A;  3AVN A;  4CGH A;  3DRR A;  4MQ3 A;  4CEZ A;  4I2P A;  3V1Q A;  1RBU A;  4CFC A;  3F9K A;  3OYL A;  4M45 A;  4HCB A;  1VSM A;  3WNF A;  1FKP A;  4FCY A;  2YHA A;  4LH4 A;  1BHL A;  2YNG A;  3RRG A;  2FBX A;  3M8S A;  4DU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...