4CJWA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cjwA00
1WSJA 2XHBA 1SKRA 2BANA 4LY7A 4DSLA 3AVGA 4E0DA 4MFBA 1JLBA 4CGGA 3SNNA 1T03A 1WLJA 1XWLA 4DFKA 4E1MA 4N56A 1L3TA 3E01A 2E6MA 4FZZA 4DU3A 3AA2A 2RKIA 3S3MA 4KREA 4OKKA 5KRSA 3AVAA 4FCYA 4FJHA 4CJTA 4HUGA 4HCCA 3LPUA 1WAJA 3VQBA 4QOZB 2P51A 1VRUA 5C25A 1UOCA 1CLQA 3RMCA 3MAQA 4CF0A 1EP4A 4KFBA 3G0ZA 1WSHA 4EP5A 2F8TA 1WSEA 4KTZA 1C0MA 3ZT0A 4KTWA 1Q9XA 4J2AA 2HB5A 3TAEA 1RDDA 2XY8A 2EX3A 3U3GA 3FFIA 3SV4A 1KVAA 4E7KA 1IO2A 4CGIA 5CYMA 4B9TA 1ZBHA 1HYSA 3OYIA 4IFYA 5I42A 3M8QA 1KVBA 4N47A 1RDAA 5HRSA 3TWHA 4CJPA 1B92A 3QEVA 1BCMA 3KK2A 3ZSXA 4FJ8A 4BDYA 4DQRA 1D8YA 4K8XA 4IG3A 4CIGA 1FKPA 3HVRA 1VSMA 3CYMA 4DQSA 3QEWA 4FK2A 4Z4FA 3AA3A 1BQMA 1WAFA 3OYAA 3KLEA 2G8FA 1CZBA 1GOBA 1LWEA 2FBYA 3ZSQA 3DI6A 4B8CA 3O3GA 3OYBA 4PQUA 4CJKA 5I3UA 4FLYA 4CJ3A 3ZSRA 1QSYA 3DLKA 2YNGA 4CHPA 4LSNA 2Z1IA 4EZ6A 1RTDA 3TI0A 4NCBA 2G8HA 3DLHA 2HHWA 4FLTA 2A1RA 2OA8A 3AVBA 1A5VA 4YFUA 3OYLA 3VN5A 3NCIA 4DQQA 2Y1IA 1NJXA 4AH9A 2X74A 3VQ4A 4JS4A 1KTQA 4DS4A 3L2VA 3U3YA 2G8UA 3V1OA 1CXUA 4DTRA 4H4MA 1FXXA 5KRTA 3I8DA 1JLCA 2D0AA 4H8KA 4HVJA 4E3SA 4KI4A 1C6VA 1HRHA 2G8VA 1ZBUA 1RDBA 4NCGA 1SUQA 2XRIA 2Y1JA 4DFMA 5SZTA 3QEXA 1A5WA 3WNEA 3LALA 4C8MA 3QEPA 2WONA 1N6QA 3OYEA 3OYJA 3AO5A 3NGZA 3OS1A 1LAVA 1RNHA 2FC0A 3PO5A 1NJZA 4O5BA 1SL0A 4KHQA 3LZIA 4E19A 4W5QA 2Z1JA 3PY8A 3KJVA 1EXQA 4O4GA 1ASWA 3TABA 2EHGA 5FRNA 1UWBA 4OPJA 3SI6A 2FBVA 4DF4A 3VQ9A 4ELUA 1NK8A 3HP9A 1TKXA 1W0HA 4AILC 4JLHA 4CHNA 4GMJB 3OVNA 4BE0A 2ZD1A 2YV0X 1J9AA 1WSFA 3HP6A 4CJLA 3O4QA 1QTMA 1JKHA 1YTAA 1KLMA 4RG8A 1J54A 2DFEA 4OGEA 2ATQA 3KLIA 3HJFA 2Z1HA 4DS5A 4NCAA 1TK5A 4FXDA 3NF7A 3LPTA 3CG7A 2F8SA 3M8PA 1Z26A 3IRXA 3NE6A 2G8IA 1ZBFA 1UA1A 1KVCA 3K5OA 1L5UA 3SJJA 4PUOA 4KRFA 1RT4A 1QSLA 3EZ5A 1L3SA 3NFAA 4PWDA 3ZSYA 2DY4A 4ID1A 4W5OA 1JLEA 3AVIA 5T7BA 1VSKA 4CJ5A 1JXBA 4N76A 1BL3A 1REVA 1RTHA 1KSPA 3DLBA 2HW3A 4CHQA 3QIPA 3VQ7A 1HJRA 2W42A 1VRTA 2HNZA 3AVNA 3AV9A 3HVTA 4M41A 3PV8A 4RW4A 3KLHA 3UIQA 4BDPA 1NKBA 3DRRA 2RPIA 3L3VA 4OVLA 1RDCA 4CFCA 4CIEA 3CFRA 3V9ZA 1RILA 3JYTA 1WNSA 5J2PA 4FJ5A 2IC3A 1JL2A 4DTXA 1SL2A 1YVUA 1NOZA 3K2PA 4FLXA 3PO4A 2XO7A 3CQ8A 2BGGA 1TGOA 2DTUA 5FRMA 4OLAA 4DSIA 1J53A 3NAEA 2XY7A 1D9DA 3ZT1A 3DYAA 3HPOA 3TAPA 4AHTA 3ALYA 4O55A 1S6PA 1O1WA 3I0SA 4CJVA 3NHGA 4DU4A 4DTSA 3RTVA 4DTJA 1WSIA 3WNHA 1NJWA 3V1RA 4F2RA 2D0BA 3WNFA 3V81A 3BGRA 4YNQA 4BWMA 1T7PA 1SKSA 4CCHA 1JLAA 4E1NA 2P1JA 1D5AA 3ZT2A 4LH4A 1L3UA 3VQCA 4DFPA 1X9SA 2KZZA 5E41A 3L2UA 4ZHRA 1TAUA 4CK1A 4J2BA 3SUOA 4FJKA 1QQCA 3TAQA 1S1TA 3V9WA 4E7JA 1IKWA 1GOAA 4KV8A 1Z25A 4G1QA 2KW4A 5HRRA 4FM1A 4OLBA 4B08A 4KB0A 4RW6A 3RR7A 3NH0A 3SQ0A 4ID5A 4CHOA 4LD0A 3SPZA 2YKMA 3AO1A 3ZCMA 4CEFA 3PUFA 3I0RA 2QK9A 1TV6A 3MEGA 1SL1A 2X6NA 4CF2A 3P1GA 3ZSWA 2OZMA 2HNYA 3DLRA 4M3UA 3ITHA 1I3AA 4Y1CA 3LDSA 3TAGA 4FK4A 4IG0A 4N5SA 5KTQA 3PX0A 3ZSVA 4IKFA 4FLWA 2B4JA 2IS3A 4FM0A 1NK7A 3AVCA 2HHTA 4Z4IA 3ZSOA 5J2NA 1A5XA 2VG6A 3SZ2A 3S9HA 4KHWA 3AO4A 1ITGA 2XY5A 3TANA 2HHQA 4RW9A 2HHXA 2OZSA 3HPHA 3MECA 3AO2A 4MQ3A 2VG5A 3A2FA 2P5GA 4C8LA 2R7YA 2HVIA 4CEBA 3PX6A 1ZBIA 3QINA 5KGXA 4EP4A 4CEOA 4I7FA 3NBPA 1ZYQA 4LH5A 1S9EA 3OYFA 3MEEA 1RBSA 1DTQA 3T3FA 2ZQBA 3U6FA 2BE2A 3IG1A 3HYFA 1EX4A 4AHSA 3V9UA 1NOYA 1R0AA 3D45A 2B6AA 2YNIA 3KK3A 3HT3A 4M3TA 3LANA 4F4KA 1NK9A 3D0PA 1ZBLA 3AA5X 1KFSA 4F2SA 4GVMA 1XHZA 3OJUA 2IGIA 1LWFA 2OPPA 4CF8A 4DTPA 3SQ2A 1BQNA 4EZ9A 4BE1A 2PZSA 1BHLA 1KFDA 3QEIA 4CGFA 1ASVA 1NK0A 3S3OA 3KK1A 1I39A 1U04A 2PYLA 3L3UA 1U4BA 2IAJA 3OYCA 1QSSA 4CJSA 4FJIA 1NKCA 2YHAA 4DSFA 1DTTA 3DRPA 3QNNA 2DFHA 5JS2A 4W5NA 2E4LA 2A1SA 3C94A 5CY4A 4FLVA 4C8NA 4CFBA 1JLQA 4ZTJA 4CERA 4CF9A 1CXQA 4WE1A 4CIFA 1X9WA 1HYZA 4Z4CA 3L2RA 3SUPA 1EKEA 4I9LA 3KLFA 3SYZA 2O4IA 4CHZA 3WNGA 3VA3A 3AVJA 3M8SA 4W5TA 4BE2A 4CJEA 1RCHA 1BCOA 3NGIA 2XY6A 4KI6A 4KB1A 4HUFA 4CGHA 2WOMA 1EETA 1B9FA 1Q8IA 4KKOA 4Y1DA 2VWJA 4Q0BA 2JLEA 3QETA 4OKEA 1BIUA 3DLEA 3QLHA 4F3OA 4KHUA 1G15A 2DFFA 3DRSA 3KIOA 1NK5A 4FJGA 3K58A 3M8RA 1QHTA 5CYQA 1S1XA 5C24A 2I5JA 4M3XA 2B5JA 4FJNA 1QS4A 3LAKA 2NUBA 4FLUA 3LAMA 1T05A 4DTUA 1RTJA 3DMJA 3K5MA 3F9KA 1IKXA 5SWMA 1J5OA 3OYDA 4H4OA 4E89A 3AVFA 1T8EA 1HQUA 3L8BA 1X9MA 3RMBA 1VSDA 1JLFA 2GUIA 4M3WA 4FK0A 5HBMA 3KLGA 3NF9A 4W5RA 1XC9A 4CFDA 2IDOA 2G8KA 3OS0A 2P5OA 4CE9A 4O0IA 4CJUA 1HMVA 1YTUA 4M42A 3RMAA 3QESA 3L2WA 4K8ZA 4DLGA 4FM2A 2D5RA 2LSNA 4FW2A 4NYNA 3K5NA 5J2MA 5HROA 2QKKA 1WSGA 3NH1A 2QXFA 4L8RB 4DU1A 3V6DA 5J2QA 3OYGA 4Z4GA 1TKZA 3LP0A 1KLNA 4QAGA 4AHCA 1BISA 4CJQA 3MXIA 3TR8A 4RW8A 4FJMA 3ZSZA 3VQDA 1BIZA 1LWCA 1YT3A 4DF8A 1N5YA 4CFAA 3T1AA 3OYHA 3EYZA 4JRPA 3OYKA 4DLEA 1C0TA 3LWMA 3AA4A 3HK2A 4CGDA 1IKVA 4CJWA 4XIUA 5C42A 4Q5VA 2VWKA 2ZE2A 1RT5A 5HRNA 4E7IA 3EY1A 1BGXT 4B9MA 3RR8A 2FBXA 5FROA 1S1UA 4B9SA 3VQ5A 3HM9A 4Z0UA 5KI6A 4B9LA 1SV5A 5K14A 3AVLA 1TK0A 1C1BA 3O4NA 4OJRA 3VQ6A 3QNOA 1HYVA 5CZ1A 3CFOA 4KHSA 3LWLA 2BDPA 1RBTA 2ETJA 2D0CA 1FKOA 3BDPA 4QCLA 4CHYA 2KTQA 1VK0A 2OYQA 3SPYA 4CK3A 3RMDA 4CECA 5HP1A 1QE1A 3V4IA 3SQ1A 1UAXA 3SV3A 3LP2A 1S9GA 4DFJA 2HVHA 1MU2A 2RF2A 4FZYA 1HPZA 4DWIA 3ASMA 3KKRA 5FDLA 4DTMA 1TL3A 4N41A 2RN2A 4PA1A 4AHUA 4I9QA 1RT7A 4Z4HA 4FZXC 4OPKA 2GBZA 3HPGA 4M3ZA 1VSHA 1TKDA 4FYDA 1C1AA 3QO9A 1IG9A 3O3HA 1VSEA 3NF8A 4O0JA 1UA0A 4FJ7A 1JLGA 4FW1A 5DK5A 4CEQA 1TAQA 3B6OA 1IH7A 4M3YA 5KGWA 2IOCA 4HUEA 5HRPA 4FJXA 2Z1GA 3HO1A 2OPQA 4B3OA 3SUNA 1NK4A 4KHYA 4JRQA 4AHVA 1WN7A 4ELTA 3OS2A 3KKSA 3ZT3A 1LV5A 2PY5A 2GV9A 4DTNA 1RT1A 1NKEA 4OGCA 1IKYA 5DMRA 4B8AB 4CEDA 1DLOA 3V9XA 3T19A 1LAWA 4HTUA 2OPSA 1NK6A 2X6SA 4Z4EA 1Y97A 3K57A 3HL8A 3MXMA 2YNFA 5J1EA 2YNHA 4FVMA 4FJJA 4KHNA 3LP3A 2YHBA 2HNDA 4CJRA 4DSEA 4DSJA 1VSLA 3QIOA 3VQAA 5EU7A 3V9SA 3S3NA 1C0UA 1RT2A 3AVHA 1S1WA 4I2PA 4CEZA 3TARA 4O44A 1XHXA 2PYJA 3ISNC 4AHRA 4CJ4A 2X78A 3L2QA 3V1QA 3H08A 4DG1A 1FK9A 4B9VA 4IBNA 1TK8A 4ZTFA 1SKWA 1L3VA 3MEDA 4DMNA 3K59A 3NH2A 2OPRA 1S6QA 3C6TA 1HNIA 1S1VA 3IS9A 1S5JA 3OYNA 4JS5A 1W9HA 4E7HA 3CM5A 3C6UA 3RRHA 2FBTA 3NDKA 3DLGA 3LZJA 4FLZA 4ICLA 4CEAA 1LW2A 2HHVA 1D9FA 3CFPA 1C1CA 1RBUA 4M3RA 3DM2A 3K5LA 1BI4A 3VQQA 3VA0A 1VSIA 4BDZA 3C95A 1K6YA 1JL1A 3AO3A 1RBRA 1Q9YA 4OKJA 3AVKA 2E6LA 1JXEA 1U45A 1LW0A 2VG7A 4FJ9A 3TAFA 4KPYA 1TL1A 3HXMA 1U48A 3OYMA 3VQEA 4CJFA 4F3TA 2KFZA 4CGJA 2HHUA 4B9UA 4HCBA 4R5PA 3VQPA 1KCFA 1CZ9A 3P5JA 2Q3SA 3OJSA 3B6PA 3JSMA 3PX4A 4B9NA 2ITGA 4DQIA 4PY5A 4UQGA 4M45A 1F21A 4BACA 1RBVA 3TAMA 5CZ2A 1HNVA 3O3FA 4F8RA 3CM6A 4KO0A 3ZT4A 4CK2A 1XI1A 4C8OA 5JS1A 2G8WA 3F73A 1TVRA 1BI4B 4LSLA 1VSFA 4RW7A 2HMIA 3ULDA 3HSTB 4CEEA 3SUQA 4HHTA 2YKNA 3SQ4A 2QKBA 5D3GA 1RT3A 4GW6A 3RRGA 1U47A 3OY9A 3NGYA 4ELVA 3KD1E 3NF6A 2KZMA 4IFVA 5HLFA 4CF1A 3IAYA 3MXJA 4J2DA 3THVA 1NJYA 1X1PA 2AJQA 1B9DA 4J2EA 1RTIA 1U49A 2KQ2A 3P83D 2JGUA 2KFNA 4C8KA 2HHSA 3DOKA 4CESA 3VQ8A 3KD5E 3DOLA 2F96A 3LP1A 1VSJA 1KRPA 4BWJA 3SCXA 4DQPA 4DSKA 2O4GA 4TSXA 1GOCA 3AVMA 1TKTA 3RWUA 1ASUA 4NYFA 3QERA 4IDKA 3G10A 4DTOA 3KTQA 4KAZA 4I2QA 4KTQA 1RT6A 4FJLA 1HQEA 4E7LA
chains in the Genus database with same CATH superfamily
1GLFO 3AVGA 4E0DA 1JLBA 1OH8A 1L3TA 3CQXA 4X66K 4DU3A 3S3MA 4FJHA 4FCYA 3QICA 3RMCA 4CF0A 1WSEA 3TAEA 3FFIA 4YDUC 5CYMA 1OH5A 3OYIA 1NGFA 4B1ZA 1NBWA 1VQKN 4CJPA 1B92A 4X65K 4AM6A 5DM6L 3KK2A 3WQUA 1D8YA 1TUUA 4IG3A 4DQSA 1TYQA 4BQLA 4FWQA 2NRXA 4HTLA 2VGMA 3E1YA 5M1QA 4CJ3A 3ZSRA 1QSYA 1H1VA 4G9ZA 3VEVA 4EZ6A 4NCBA 4LSNA 1RTDA 1KAZA 4CZKA 2G8HA 4BC5A 2A1RA 2OA8A 3OYLA 5IT9O 3VN5A 1TUYA 5AQMA 3T69A 3ZX0A 3U3YA 3EN9A 4XEIA 1CXUA 1T6CA 2I7NA 5KRTA 4H8KA 1C6VA 4M63C 1HRHA 3E9OA 4M7YA 2Y1JA 1A5WA 3MN7A 3LALA 1P90A 1N6QA 1EWQA 1RNHA 4J8FA 1NJZA 1QHAA 3FGUA 3U4LA 5AQOA 3C65A 2Z1JA 2JWLA 2W40A 1ASWA 1N34K 2EHGA 2QW9A 4WFNL 1Z6RA 5FRNA 3VQ9A 3HP9A 3CCQN 4BRDA 1EQYA 3HOSA 1YIJN 3HP6A 3O4QA 5AFUA 1ATSA 1QTMA 2IVOA 2WFBA 5AQIA 4OGEA 2ATQA 3KLIA 2Z1HA 4B1VA 1Q82O 3CJCA 3LPTA 3CG7A 3IRXA 2G8IA 1IBLK 1L3SA 4PWDA 4H03B 3THYB 5T7BA 4QS9A 3VQ7A 1HJRA 1VRTA 3HVTA 3PV8A 4H5VA 5GIOA 3L3VA 4CFCA 3JYTA 1WNSA 2P9PB 3CJ9A 4RTFD 4FJ5A 3O5BA 4YOWA 3D2FB 4B3RK 2O8EB 3MN6A 4FLXA 3PO4A 3CQ8A 2DTUA 5ELZA 2XY7A 1D9DA 3HPOA 3NHGA 1O1WA 1W7AA 3CC7N 5AQHA 4JKFA 4IZ9A 4DTSA 3RTVA 3WNHA 4JKHA 4BWMA 1SKSA 4CBXA 4CCHA 3ZT2A 3CJBA 3MWPA 4JKCA 1X9SA 5E41A 4YDUA 4CK1A 3SUOA 4FJKA 2P9PA 4A2BA 3TAQA 2YI1A 1MWKA 4IFEA 4E7JA 1Z25A 2H3GX 1YHQN 3FZHA 5JVHL 3SPZA 3IFRA 3PUFA 3I0RA 4CBUA 2X6NA 4BRCA 2HNYA 3DLRA 4M3UA 3VF4A 4BR2A 4N5SA 2ZJPL 5KTQA 3PX0A 4IKFA 1VQ4N 3AVCA 3ZSOA 5AZJA 3UKUB 2VG6A 4WF9L 3AO4A 1ITGA 3ATUA 4CZHA 2QEXN 2PFUA 2HHQA 3HPHA 3AO2A 4MQ3A 3H3OB 5HL7L 2QA4N 3QINA 5KGXA 4EP4A 2Q31A 4CEOA 1LCUA 1ZYQA 1S9EA 2ZQBA 3V9UA 2E2NA 1NWKA 1QQOA 1GLLO 4FWKA 3LANA 2E20A 4FOEA 3D0PA 1ZBLA 2GWKA 1ATRA 1KFSA 5AZJB 4GVMA 1XHZA 4BR0A 2PZSA 1BHLA 5GADP 3QEIA 4ISGA 2O8BB 1VQMN 3KK1A 2IAJA 3OYCA 3THWA 1QSSA 2YHAA 3UE5A 5FPDA 1YJNN 1RDUA 4A5AA 1HX1A 5JS2A 4W5NA 2E4LA 1NGGA 1CXQA 4C23A 1X9WA 1VQLN 5AQSA 1K8AO 4Z4CA 1EKEA 4I9LA 4CHZA 1R59O 3AVJA 5BPLA 4EHTA 3VETA 1BCOA 2NRRA 4KI6A 4HUFA 4CGHA 4BGBA 2WOMA 2A41A 4A2AA 3CCEN 4OKEA 3QLHA 3J7ZO 4DCHA 4JAXA 3BP8A 4FJGA 1XMOK 5CYQA 2B5JA 5E26A 3LAKA 4FLUA 2E8AA 1T05A 4GV9A 1IKXA 3MN5A 4E89A 3E66A 1YI2N 4MLEA 3L8BA 2GUIA 3UB5A 3OS0A 2P5OA 1XNRK 1HMVA 2RHKA 3SMPA 4FM2A 5M1NA 1WSGA 2E2OA 3LP0A 2GELA 3DWLA 4CJQA 4RW8A 4KH6A 1NGAA 1BIZA 3EL2A 3EYZA 3SAGA 3RSEA 4YOVA 3LWMA 3MWTA 3WXKA 5C42A 3KHYA 5C15A 3EY1A 1QVFM 1S1UA 4CW7B 3VQ5A 3HM9A 3CERA 5KI6A 1SV5A 1OVQA 4EHUA 3PLAA 4H5RA 1HYVA 3T1HK 2ETJA 2D0CA 4LF8K 4CHYA 3BZKA 1NGBA 2OYQA 4CECA 1QE1A 2W41A 2A42A 4FWPA 2HVHA 3LM9A 1MU2A 2Q0UA 4FZYA 1HPZA 3WQTA 3KKRA 4DTMA 4N41A 5AQQA 3IDHA 2GBZA 1Q86O 1VSHA 2QTDA 4PKIA 4FYDA 4NLCA 3QO9A 1C0GA 1YJWN 1VSEA 4O0JA 1JLGA 5DK5A 4CEQA 1TAQA 5KGWA 4HUEA 5M1FA 1JCEA 3SUNA 3DXKA 1S72N 4AHVA 3ZYYX 4ELTA 3KKSA 3A5MC 2GV9A 4YHHK 4DTNA 4L3QA 4CEDA 1YVNA 3V9XA 3T19A 1LAWA 3GOIA 5ADXA 1NK6A 3MXMA 3CJAA 2YNFA 5J1EA 2FSKA 2NRHA 2YHBA 2HNDA 4JK8A 4CJRA 3PSIA 4H5WA 1S1WA 3F9MA 4DV7K 3ISNC 3L2QA 4C1NK 3H08A 1IJJA 3BEXA 1XMQK 3K59A 3OA9A 1S6QA 3C6TA 1TKDA 1S1VA 4E7HA 3OYNA 1W9HA 3VEYA 3C6UA 4H0XB 3DLGA 2P9UB 1LW2A 3M6GA 4FWLA 2HHVA 2YJFA 4M3RA 3DM2A 1BI4A 3VQQA 3VA0A 2P9KB 4BDZA 4BY9C 2YJEA 1K6YA 1JL1A 3AO3A 3ZLJA 4OKJA 3PIOL 3AVKA 5AQZA 1LW0A 4K42A 3TAFA 3HXMA 3VTIA 3OYMA 3VQEA 5AQGA 4B9UA 4HCBA 5BR8K 3VQPA 1KCFA 3P5JA 2Q3SA 4B9NA 2ITGA 4DQIA 1F21A 4BACA 5KQDA 1HNVA 1NGHA 1TVRA 1BI4B 4LSLA 3WEEA 4RW7A 3SUQA 1Q81O 4ELVA 3N4PA 2KZMA 2VWBA 4IOXA 5HLFA 3IAYA 1X1PA 1RTIA 2KQ2A 3P83D 2JGUA 4C8KA 3DOKA 4BROA 1IBMK 4LF4K 4KHPK 2OANA 1O13A 4CZJA 4NYFA 3QERA 2O8FB 4DTOA 3HTVA 4DUYK 3D2EB 3OBYA 2BANA 1GLBG 4MFBA 4CGGA 3SNNA 1WLJA 1XWLA 4E1MA 4MO4A 2QWPA 3CCSN 4YORA 4FZZA 3NMUA 4OKKA 5ADXH 3AVAA 3CPEA 4CJTA 3LPUA 1WAJA 2P51A 3MK6A 5C25A 2HOEA 4U67L 3A5NC 4JKDA 4ISFA 4CZMA 1EP4A 3G0ZA 1WSHA 4J2AA 2HB5A 2XY8A 4CGIA 2IIRA 5HRSA 2QXLA 4DQRA 3SLCA 4K8XA 2A3ZA 3CYMA 2NRTA 1BQMA 4IO8A 4JKAA 3DLLL 2G8FA 2P9NA 4CJKA 4FLYA 4GV3A 3DLKA 2YNGA 2Z1IA 4QS8A 3TI0A 3DLHA 2EWSA 3LDLA 1A5VA 4IOAL 4HWIA 1NJXA 3VQ4A 3Q7BA 3L2VA 4K41A 3V1OA 4FWRA 2P9SA 4H4MA 1QZ6A 3O9RA 1BOTO 1RDBA 4NCGA 2ITMA 1SUQA 2XRIA 3QEXA 4GVEA 4B1WB 3OS1A 3DXMA 4O8KA 4O5BA 4KHQA 4O4GA 4PHTX 3TABA 4CBWA 2A40A 3SI6A 4BRNA 4DF4A 2P9LB 5C12A 4H5TA 4JD2A 3OVNA 4BE0A 2IVPA 2YV0X 1BU6O 1J9AA 2ZD1A 4YOXA 5HOOA 1KLMA 5LMUK 2NRVA 4RG8A 5AQYA 1J54A 2QM1A 3QFPA 3NF7A 1U6ZA 2OCEA 4JEPA 3M8PA 3NE6A 1ZBFA 3VMFB 4K43A 5M1PA 3VGKA 3NFAA 3ZSYA 2DY4A 3R6MA 4ID1A 1IG8A 2ASMA 1BL3A 2HW3A 4CHQA 1ESVA 3AV9A 1DEJA 4CI6A 4RW4A 4IJAA 5LJWA 3HM8A 3UIQA 3DRRA 2WC9A 2HBLA 2RPIA 3P4IA 4OVLA 1OH6A 4Z94A 1JL2A 1YVUA 2BGGA 4FO0A 3W3DA 2NRWA 5FRMA 3O1WA 3ALYA 3I0SA 1NJWA 4BQZA 5BPNA 3BGRA 4YNQA 1JLAA 2P1JA 1D5AA 4A57A 2QWOA 2KZZA 1CZAN 4J2BA 1QQCA 3P39A 4NXMK 1SQKA 1HUXA 3V9WA 1IKWA 3FR0A 2ZJRL 4CVNE 2KW4A 3VERA 4OLBA 4RW6A 3NH0A 4B1UB 3AO1A 3ZCMA 4CEFA 2BTFA 4V19S 4JNEA 4CZEA 1TV6A 3CCRN 1NJIO 4Y1CA 3ZSVA 3SAFA 2B4JA 4FM0A 4Z4IA 3S9HA 4FPAA 4KHWA 3CMAN 3GE1A 3R1XA 4RW9A 3A0IX 1Y64A 3MECA 2VG5A 2R7YA 3WT0A 2PAVA 4CEBA 1MA9B 4I7FA 1RBSA 3T3FA 1ZBSA 3J7YP 5IWAK 3ZEUA 2BE2A 4QS7A 4B3SK 3DAWA 4AHSA 2KHOA 1X3MA 2YCHA 5C2FA 4B3TK 3ULEA 4BRQA 3J81O 4DTPA 2OPPA 4CF8A 1E4FT 3SQ2A 3IKMA 5M1KA 5CHIA 3TSQA 4BR5A 4DV3K 1I39A 1U04A 1HKBA 2JWKA 4DV2K 4BR4A 1U4BA 3VEWA 4CJSA 1NKCA 3ATVA 2HSTA 2A1SA 1M1KO 4C8NA 2UXCK 4CFBA 1JLQA 4ZTJA 4CERA 4CF9A 4CIFA 4LFAK 3KLFA 2O4IA 3L6QA 3P31A 3WUHA 3M8SA 1K73O 4BE2A 3H3NO 3Q7CA 1RCHA 2ZGZA 3NGIA 4EIAA 1EETA 1VQ8N 3EZWA 4KHUA 1NK5A 2J4RA 2P9SB 1QHTA 4JI3K 4FJNA 3F2KA 3D7EO 2NUBA 1BUPA 1XNQK 3WXIA 1HQUA 2QWNA 4M3WA 3NF9A 2RE2A 1BG3A 4CE9A 3D2FA 1YTUA 4M42A 3RMAA 3M1FA 3QESA 3L2WA 5HROA 2D5RA 4NYNA 4DU1A 3RSEB 3OYGA 1TKZA 4GKJK 4NO7A 3WXLA 1BISA 3CC4N 3T1AA 3HK2A 1IKVA 4K0KK 1OVYA 4Q5VA 3IMXA 1RT5A 1VQON 4E7IA 1BGXT 4WCEL 4BR7A 3RR8A 4Z0UA 1KQSM 5K14A 1YITN 1TK0A 4KH4A 3QNOA 3CF5L 3CFOA 4KHSA 1RBTA 3BDPA 3SPYA 4R79A 5AZIB 4BRIA 4CK3A 4LF7K 5HP1A 5AQNA 5GAHP 1S9GA 4YOTA 5EX5A 3B8AX 3FZLA 2RF2A 2UUCK 3ASMA 3IUCA 1P8ZA 4PA1A 4EAHD 3C0BA 4O8UA 2ZM6K 4I9QA 3HPGA 3LDNA 4M3ZA 1HJOA 2W6LA 1ILYA 3NF8A 4YOYA 3B6OA 1IH7A 2IOCA 2OPQA 1XC3A 5FLXO 4JRQA 1KXPA 1RT1A 1NKEA 5DMRA 4B8AB 1NGJA 2OPSA 2F9TA 2P9KA 1VQPN 4JKGA 4WQ4C 3K57A 3HL8A 3JAMO 4FJJA 4KHNA 1MWMA 3VQAA 5EU7A 4AF1A 1JCGA 1RT2A 3D6RA 2E88A 4BREA 4DR4K 1XHXA 5AQJA 4CJ4A 3MEDA 3NH2A 4DV1K 2OPRA 5DM7L 1HNIA 1S5JA 3CM5A 2FBTA 4JKGB 4DR2K 2CGLA 1D9FA 3EKUA 1S22A 1C1CA 1YAGA 3K5LA 3C95A 4PKGA 3J7AP 1QZ5A 2ASOA 2E6LA 4FJ9A 5GAEP 4KPYA 3AGRA 2AA4A 4WFBL 2A6AA 4CGJA 4IO9L 1HLUA 3JSMA 3H1QA 1FW6A 1S3XA 3TAMA 3O3FA 4C8OA 5JS1A 2G8WA 3F73A 1VSFA 3L0QA 4CEEA 1N33K 2QKBA 2KLAA 1RT3A 3CCUN 3RRGA 4B1XB 2P9IA 3THXB 4IFVA 5EVZA 4CF1A 3MXJA 1DT9A 5JLFA 4AQYK 3THVA 4GV6A 1U49A 5JLHA 2KFNA 4CESA 4BRGA 3DOLA 1VSJA 4BWJA 3SCXA 4DQPA 2O4GA 3RWUA 3AVMA 5AQVA 1ASUA 2UXDK 1K9MO 4A61A 2YHXA 1HQEA 3O8MA 1SKRA 4LY7A 4DSLA 5JICA 3AGKA 3SK3A 4DFKA 1KAXA 4I6MB 3AA2A 4JKEA 3CD6N 5KRSA 4HUGA 3C7NA 5CR4A 3VQBA 4QOZB 1VRUA 3FLCO 1UOCA 1CLQA 1XUPO 3MAQA 4KFBA 2F8TA 3ZT0A 1WB9A 1Q9XA 5F0XA 2D1KA 3U3GA 3SV4A 4E7KA 1IO2A 1ZBHA 2QWRA 1HYSA 4H0TB 3SAHA 4OO1J 3TWHA 3QEVA 2W6KA 3ZSXA 4FJ8A 3CXCM 4BDYA 1FKPA 1ZC6A 1VSMA 3HVRA 3AA3A 1WAFA 1GOBA 3ZSQA 4WFAL 3QDKA 3O3GA 3OYBA 4FL9A 1IBKK 4CHPA 4CJ7A 3MCPA 3TSUA 2UU9K 3O9QA 2HHWA 3EE9A 1KC8O 3AVBA 4DQQA 4CD3A 4DHYA 2Y1IA 2X74A 4JS4A 4DS4A 2G8UA 4JI7K 1HKGA 3CPWM 1U2VB 4DTRA 1FXXA 1JLCA 2D0AA 4XH1A 4KI4A 2ZJQL 4FWNA 2G8VA 3O9TA 2V7YA 4DFMA 5SZTA 4E1JA 3QEPA 4C8MA 2WONA 3OYEA 3AO5A 3LM2A 3PO5A 3VEXA 3LZIA 2AP1A 4E19A 1LOTB 3PY8A 4NB4A 3THYA 2UUBK 3K9KA 5GINA 4OPJA 3VOVA 4ELUA 1NK8A 4AILC 1W0HA 2UYTA 4CHNA 3CJ7A 3HZ6A 4JKBA 4MDAA 1JKHA 1YTAA 2DFEA 3HJFA 1WBBA 4NCAA 1DGKN 1NU0A 2F8SA 1Z26A 1KVCA 4KRFA 2VGNA 4DUZK 1N36K 4B9QA 1QSLA 3EZ5A 5TKWA 1JLEA 3AVIA 1VSKA 1JXBA 1REVA 1RTHA 4BC4A 3FZKA 2O8DB 3AVNA 2HNZA 3G71N 4M41A 5JMVA 3G6EN 4BDPA 1NKBA 4CIEA 3CFRA 3V9ZA 3H1VX 4DTXA 1VQ5N 1SL2A 4A5BA 4WQ5A 3K2PA 3CCVN 1TGOA 4OLAA 4DSIA 1J53A 3NAEA 2HHHK 3CCJN 3DYAA 4AHTA 4B1YB 4O55A 4CJVA 4BR9A 4IOCL 3V1RA 3AAQA 2A5XA 3WNFA 3ZX2A 3I55N 2O8DA 4E1NA 2ZWHA 2QWQA 3O1BA 4LH4A 4B3MK 3VQCA 2BH1A 3L2UA 4ZHRA 2Q36A 4JI0K 4BRMA 1WUAA 1S1TA 1YJ9N 5I9EB 1GOAA 2V52B 4KV8A 1NLVA 4JI2K 2E2PA 5HRRA 3NVKA 3O4WA 4B08A 5KPZA 3RR7A 5KQ8A 1YF5L 2QK9A 1V4TA 3MEGA 1SL1A 3ITHA 2P9IB 3THXA 3A8YA 2HHTA 3E9PA 3G4SN 2XY5A 3TANA 2HHXA 2V51B 2OZSA 3GG4A 2P9NB 4A62A 2CGKA 3A2FA 4C8LA 3DJCA 3PX6A 1ZBIA 5GIPA 3ZETA 3NBPA 3H46O 3QBXA 4LH5A 3OYFA 1DTQA 3U6FA 3IG1A 4JHDA 3HYFA 4I6MA 1BA1A 3D45A 5CE3A 2B6AA 2YNIA 3KK3A 3QMLA 4M3TA 2HBMA 2ZGYA 4F2SA 5LMNK 3LDQA 1HNZK 3OJUA 1LWFA 4EZ9A 1HNWK 4BE1A 4CGFA 1ASVA 3S3OA 1VQNN 3L3UA 2CH6A 4C1NI 2OTJN 4CZLA 5E84A 3WEEB 3MX2A 1HYZA 3L2RA 3SYZA 3RVCA 4CD1A 4MO5A 3WNGA 3VA3A 2IVNA 2FLOA 4CJEA 2FSJA 2XY6A 3H45C 4KB1A 4KBOA 4Y1DA 1Q8IA 4KKOA 1VQ6N 2JLEA 1BIUA 3OHRA 3DLEA 5C0YA 1BA0A 1G15A 3F5TA 3KIOA 3VESA 1NG9A 5EY4A 3M8RA 4M3XA 2VCPA 3LAMA 1RTJA 3F9KA 5SWMA 4JI5K 1J5OA 5KPRA 3WXMB 4BRAA 1RFQA 1X9MA 3RMBA 1JLFA 3T1YK 2HMPA 3NVMA 4FWMA 3KLGA 5AQFA 4W5RA 2IDOA 2G8KA 3ENHA 4O0IA 3R8EA 4IJNA 4DLGA 5J2MA 1VAZA 2LSNA 4U7BA 4KH5A 4UY8O 3FZFA 3V6DA 5J2QA 4BC3A 4Z4GA 4JI4K 4QAGA 4AHCA 4IWVA 1NGEA 3HRGA 1EO1A 2DPNA 3ZSZA 3GDQA 3VQDA 3JS6A 1LWCA 1N5YA 4DF8A 4CFAA 3OYHA 1C0TA 4CGDA 4CJWA 4FWOA 1X9JA 4WYBA 3J80O 5LJVA 4B9MA 2FBXA 5FROA 4B9SA 2P9UA 1C1BA 3O4NA 3BZCA 1BO5O 1J6ZA 3LWLA 3AARA 2BDPA 2D0PA 2KTQA 1VK0A 3OW2M 3SQ1A 1UAXA 2QI2A 3EKSA 3LP2A 4H0YB 4H0OA 2P9LA 3TTFA 5FDLA 4OPAA 2D4WA 4BRHA 4Z4HA 4FZXC 4OPKA 5FPNA 2GEMA 3O3HA 1UA0A 4PL7A 5AJ3K 1RDWX 3DXMB 5HRPA 2Z1GA 3HO1A 2O8CA 4DR1K 3CETA 4B3OA 5GAGP 3ZT3A 2E1YA 4OGCA 1IKYA 3MX5A 4HTUA 1QVGM 2X6SA 4Z4EA 1Y97A 3W0LA 3T7ZA 1HR0K 1SZ2A 2YNHA 3M5RA 4FVMA 4DSJA 3QIOA 1YUWA 3V9SA 4LC9B 3S3NA 3AVHA 3TARA 1GLEG 2QWLA 4O44A 5F1XA 2PYJA 4GNIA 2X78A 3MCAB 3V1QA 1FK9A 4IBNA 5KPTA 1TK8A 1GLAG 4ZTFA 1N32K 3MN9A 4DMNA 4JS5A 3IS9A 5H1SQ 4JN4A 2NRZA 3RRHA 3NDKA 3LZJA 3H6EA 4ICLA 4DV0K 4FLZA 3CFPA 4JK9A 1VSIA 2VQFK 5EXWA 5AQWA 3UKUA 1T6DA 3HOTA 1U45A 3UKRA 3PIPL 3I56N 3K9JA 1U48A 2O8BA 4F3TA 2KFZA 2HHUA 4R5PA 3ID6A 2YHYA 3A5OC 3O6WA 1NGCA 1HNXK 4UQGA 1RBVA 3KWIA 4KO0A 1XI1A 4YY3K 4CZGA 3C6HA 5MLCQ 4EFHA 2HMIA 3ULDA 3HSTB 4HHTA 2YKNA 3KWGA 5D3GA 4GW6A 2VYPA 3CC2N 3NGYA 3NF6A 2AJQA 1NJYA 4OX9K 3CIPA 4BRPA 3KD5E 2F96A 2E2QA 1GOCA 1TKTA 3CJ1A 4IDKA 3EO3A 3G10A 3KTQA 4KAZA 3U9DA 4E7LA 1WSJA 2XHBA 4DR3K 4GKKK 3TSPA 1T03A 1I94K 4N56A 3E01A 2E6MA 4JK7A 4KREA 1NMDA 2RKIA 2D0OA 4FOIA 4BG8A 2GUPA 4HCCA 3ULEB 4BG9A 3SBTA 3O80A 4RWTA 5AQLA 4EP5A 4KTZA 1C0MA 4KTWA 1RDDA 2EX3A 1TYQB 1KVAA 4B9TA 4IFYA 5I42A 3M8QA 1KVBA 4N47A 1RDAA 5AQPA 5BRDA 1BCMA 3SBGA 3ZX3A 4CIGA 5C2DA 3S41A 4PKHA 4Z4FA 3QEWA 4FK2A 1VQ9N 5BN9A 3OYAA 3KLEA 1CZBA 1LWEA 2FBYA 3L4IA 3DI6A 3VF6A 4B8CA 4PQUA 5I3UA 5AQKA 2YX6A 2FSNA 4FLTA 5BPMA 4YFUA 3NCIA 1GLDG 1NGDA 3BF1A 3J8AA 4AH9A 1KTQA 4JHDB 3I8DA 4X62K 5LY3A 4HVJA 4E3SA 4LF9K 4M7XA 4ILGB 1ZBUA 5BRFA 4H0PA 3L4QA 2WBNA 3U8XA 3WNEA 3CCMN 4FPBA 3OYJA 3QB0A 3NGZA 1LAVA 2FC0A 3R9PA 1SL0A 4BVPA 1BWFO 1SAZA 4W5QA 3VTHA 3KJVA 2FF6A 1EXQA 3N4QA 1UWBA 1M90O 2CH5A 2FBVA 5BRHA 2O8CB 1TKXA 4JLHA 4GMJB 3FFKB 2O8EA 1WSFA 3MDQA 3C6AA 4CJLA 2OTLN 3LL3A 1QQMA 3I8BA 1NMNA 4ILJA 1YXQA 4FXDA 4DS5A 1VQ7N 4XH5A 1TK5A 1GLJO 1J5EK 4O5FA 1UA1A 3K5OA 1L5UA 3SJJA 4PUOA 1RT4A 5BN8A 1C0FA 4W5OA 3A5LC 4CJ5A 3LDOA 4N76A 1BDGA 5AQXA 1KSPA 3DLBA 4BRLA 3QIPA 2W42A 5AZIA 3KLHA 4CZIA 2V7ZA 3M3ZA 4DR7K 1RDCA 2NLXA 1RILA 5J2PA 2IC3A 2HBKA 1NOZA 5FPEA 3O9SA 2XO7A 2FF3B 3MMVA 4NLBA 4JYAK 4AM7A 3ZT1A 3TAPA 1S6PA 4DU4A 3JXUA 3VGLA 2ASPA 4DTJA 1WSIA 4F2RA 2D0BA 3V81A 1T7PA 5AQTA 4H5NA 1W2BM 1L3UA 4WQ5C 1GLCG 4DFPA 1TAUA 5A2QO 3WXJA 4JI1K 4DV5K 2NZTA 1K8KB 2Q97A 4JI6K 3GL1A 4G1QA 4BC2A 4FM1A 3VEOA 4CZFA 5BR9A 4KB0A 4DR6K 3SQ0A 1OKJA 4ID5A 4LD0A 4CHOA 2YKMA 4DV6K 3KK7A 3ZEUB 2OZMA 4CF2A 3P1GA 3ZSWA 1D4XA 1I3AA 3LDSA 3TAGA 4FK4A 4IG0A 4FLWA 2IS3A 1NK7A 4IXCA 1E4GT 5J2NA 1A5XA 3CI5A 3SZ2A 3HBTA 1FJGK 5AFUH 4OPHA 2KKZA 2P5GA 2HVIA 2UUAK 4FSVA 1HPMA 1WOQA 1NM1A 3ENBA 3MEEA 5AQUA 3PSFA 3QFUA 4X64K 1EX4A 1NOYA 1R0AA 4MLHA 3HT3A 4F4KA 1NK9A 3KVGA 3AA5X 2O8FA 3D2EA 3HSCA 3THWB 2IGIA 1BQNA 3SJHA 1KFDA 1NK0A 4Y0WA 2BUPA 2PYLA 4IEEA 3R3LA 1G99A 4FJIA 2ZF5O 4DSFA 1WBDA 1DTTA 3DRPA 3QNNA 2DFHA 2QWMA 3TPQA 3C94A 5CY4A 4FLVA 5AR0A 4LFCK 4WE1A 3VF2A 4JI8K 3SUPA 2HF3A 1SS6A 4W5TA 4DB3A 2VWJA 4Q0BA 1B9FA 1W97L 1MDUB 3QETA 3O08A 4F3OA 2DFFA 3DRSA 3K58A 1S1XA 5C24A 2I5JA 3I33A 2E5LK 2F7TA 1QS4A 2HF4A 4YOUA 3FZMA 4DTUA 3DMJA 3K5MA 3BY5A 4BVOA 3BF3A 3OYDA 4H4OA 5FPMA 3EE8A 4DKWA 3AVFA 1T8EA 1VSDA 4FWSA 4FK0A 1XQSC 5HBMA 1XC9A 1IV0A 4CFDA 4DR5K 2Q0RA 3C7NB 1E3MA 5EOYA 4CJUA 3O9UA 1Q7YO 3E9LA 2Q2RA 3TTDA 4K8ZA 4FW2A 3K0SA 3LDPA 3K5NA 2QKKA 4L8RB 1T44A 4IEIA 3NH1A 2QXFA 5TKYA 3ENOA 1KLNA 2I7PA 2NNWA 4MDBA 3OTOK 4JD2B 3MXIA 3TR8A 4A59A 4FJMA 5JVGL 1YT3A 4H0VB 1X3NA 4JRPA 3OYKA 4DLEA 3AA4A 2F9WA 2WUSA 3AY9A 4XIUA 2VWKA 2ZE2A 3ID8A 4BRFA 5HRNA 4LFBK 4B9LA 1ATNA 3AVLA 1KAYA 1T3VA 2F4VK 4OJRA 3VQ6A 1VHXA 5CZ1A 4QCLA 1FKOA 3VEZA 3RMDA 4NXNK 3V4IA 1V4SA 4F9OA 3SV3A 4DFJA 2GWJA 1U2VA 4K25A 1ZXOA 2GX9A 3P38A 2GTDA 4DQ8A 4DWIA 2PBDA 2FXUA 4LF6K 1TL3A 2RN2A 5AQRA 4AHUA 1RT7A 4DV4K 3G25A 3CQYA 2HBJA 1OH7A 1QQNA 1C1AA 3FE1A 1IG9A 3DXKB 1JJ2M 3BUZB 4FJ7A 3CMEN 4FW1A 1KD1O 4M3YA 4PL8A 4FJXA 1NK4A 4KHYA 1K8KA 4GY2B 1WN7A 3OS2A 1LV5A 2PY5A 5BREA 3CCLN 3TTCA 1DLOA 3OBWA 5LL6Z 2E1ZA 3LP3A 3VENA 4DSEA 1VSLA 3VPZA 1C0UA 4CEZA 4I2PA 4AHRA 4ISEA 4DG1A 4BRKA 1N8RO 4B9VA 2UXBK 1SKWA 1L3VA 1RGIA 4WQ4A 4ILHA 1JCFA 4LF5K 4BGAA 2WTUA 4CEAA 3SMSA 1RBUA 3KZBA 3TU5A 3QBWA 1RBRA 4RCHA 1Q9YA 1JXEA 5B8HA 5M1OA 4FVUA 3EEQA 2VG7A 3VGMA 1NNEA 5F2RA 1TL1A 4CJFA 1EWRA 1CZ9A 5C10A 3PX4A 3OJSA 3B6PA 1NGIA 3UKRB 4PY5A 4M45A 3HI0A 3CHWA 5CZ2A 2YHWA 4F8RA 3CM6A 3ZT4A 4CK2A 2Q1NA 2CGJA 1Z05A 4JV5K 3SQ4A 3GBTA 4IDHA 1Q18A 3U9ZA 1U47A 3OY9A 3KD1E 3ZETB 2VQEK 4J2DA 1B9DA 4J2EA 3AAPA 1DKGD 2HHSA 3VQ8A 3LP1A 1KRPA 1HKCA 4XH4A 4DSKA 4TSXA 4I2QA 4KTQA 1RT6A 4FJLA
chains in the Genus database with same CATH topology
1WSJA 2XHBA 1SKRA 2BANA 4LY7A 4DSLA 3AVGA 4E0DA 4MFBA 1JLBA 4CGGA 3SNNA 1T03A 1WLJA 1XWLA 4DFKA 4E1MA 4N56A 1L3TA 3E01A 2E6MA 4FZZA 4DU3A 3AA2A 2RKIA 3S3MA 4KREA 4OKKA 5KRSA 3AVAA 4FCYA 4FJHA 4CJTA 4HUGA 4HCCA 3LPUA 1WAJA 3VQBA 4QOZB 2P51A 1VRUA 5C25A 1UOCA 1CLQA 3RMCA 3MAQA 4CF0A 1EP4A 4KFBA 3G0ZA 1WSHA 4EP5A 2F8TA 1WSEA 4KTZA 1C0MA 3ZT0A 4KTWA 1Q9XA 4J2AA 2HB5A 3TAEA 1RDDA 2XY8A 2EX3A 3U3GA 3FFIA 3SV4A 1KVAA 4E7KA 1IO2A 4CGIA 5CYMA 4B9TA 1ZBHA 1HYSA 3OYIA 4IFYA 5I42A 3M8QA 1KVBA 4N47A 1RDAA 5HRSA 3TWHA 4CJPA 1B92A 3QEVA 1BCMA 3KK2A 3ZSXA 4FJ8A 4BDYA 4DQRA 1D8YA 4K8XA 4IG3A 4CIGA 1FKPA 3HVRA 1VSMA 3CYMA 4DQSA 3QEWA 4FK2A 4Z4FA 3AA3A 1BQMA 1WAFA 3OYAA 3KLEA 2G8FA 1CZBA 1GOBA 1LWEA 2FBYA 3ZSQA 3DI6A 4B8CA 3O3GA 3OYBA 4PQUA 4CJKA 5I3UA 4FLYA 4CJ3A 3ZSRA 1QSYA 3DLKA 2YNGA 4CHPA 4LSNA 2Z1IA 4EZ6A 1RTDA 3TI0A 4NCBA 2G8HA 3DLHA 2HHWA 4FLTA 2A1RA 2OA8A 3AVBA 1A5VA 4YFUA 3OYLA 3VN5A 3NCIA 4DQQA 2Y1IA 1NJXA 4AH9A 2X74A 3VQ4A 4JS4A 1KTQA 4DS4A 3L2VA 3U3YA 2G8UA 3V1OA 1CXUA 4DTRA 4H4MA 1FXXA 5KRTA 3I8DA 1JLCA 2D0AA 4H8KA 4HVJA 4E3SA 4KI4A 1C6VA 1HRHA 2G8VA 1ZBUA 1RDBA 4NCGA 1SUQA 2XRIA 2Y1JA 4DFMA 5SZTA 3QEXA 1A5WA 3WNEA 3LALA 4C8MA 3QEPA 2WONA 1N6QA 3OYEA 3OYJA 3AO5A 3NGZA 3OS1A 1LAVA 1RNHA 2FC0A 3PO5A 1NJZA 4O5BA 1SL0A 4KHQA 3LZIA 4E19A 4W5QA 2Z1JA 3PY8A 3KJVA 1EXQA 4O4GA 1ASWA 3TABA 2EHGA 5FRNA 1UWBA 4OPJA 3SI6A 2FBVA 4DF4A 3VQ9A 4ELUA 1NK8A 3HP9A 1TKXA 1W0HA 4AILC 4JLHA 4CHNA 4GMJB 3OVNA 4BE0A 2ZD1A 2YV0X 1J9AA 1WSFA 3HP6A 4CJLA 3O4QA 1QTMA 1JKHA 1YTAA 1KLMA 4RG8A 1J54A 2DFEA 4OGEA 2ATQA 3KLIA 3HJFA 2Z1HA 4DS5A 4NCAA 1TK5A 4FXDA 3NF7A 3LPTA 3CG7A 2F8SA 3M8PA 1Z26A 3IRXA 3NE6A 2G8IA 1ZBFA 1UA1A 1KVCA 3K5OA 1L5UA 3SJJA 4PUOA 4KRFA 1RT4A 1QSLA 3EZ5A 1L3SA 3NFAA 4PWDA 3ZSYA 2DY4A 4ID1A 4W5OA 1JLEA 3AVIA 5T7BA 1VSKA 4CJ5A 1JXBA 4N76A 1BL3A 1REVA 1RTHA 1KSPA 3DLBA 2HW3A 4CHQA 3QIPA 3VQ7A 1HJRA 2W42A 1VRTA 2HNZA 3AVNA 3AV9A 3HVTA 4M41A 3PV8A 4RW4A 3KLHA 3UIQA 4BDPA 1NKBA 3DRRA 2RPIA 3L3VA 4OVLA 1RDCA 4CFCA 4CIEA 3CFRA 3V9ZA 1RILA 3JYTA 1WNSA 5J2PA 4FJ5A 2IC3A 1JL2A 4DTXA 1SL2A 1YVUA 1NOZA 3K2PA 4FLXA 3PO4A 2XO7A 3CQ8A 2BGGA 1TGOA 2DTUA 5FRMA 4OLAA 4DSIA 1J53A 3NAEA 2XY7A 1D9DA 3ZT1A 3DYAA 3HPOA 3TAPA 4AHTA 3ALYA 4O55A 1S6PA 1O1WA 3I0SA 4CJVA 3NHGA 4DU4A 4DTSA 3RTVA 4DTJA 1WSIA 3WNHA 1NJWA 3V1RA 4F2RA 2D0BA 3WNFA 3V81A 3BGRA 4YNQA 4BWMA 1T7PA 1SKSA 4CCHA 1JLAA 4E1NA 2P1JA 1D5AA 3ZT2A 4LH4A 1L3UA 3VQCA 4DFPA 1X9SA 2KZZA 5E41A 3L2UA 4ZHRA 1TAUA 4CK1A 4J2BA 3SUOA 4FJKA 1QQCA 3TAQA 1S1TA 3V9WA 4E7JA 1IKWA 1GOAA 4KV8A 1Z25A 4G1QA 2KW4A 5HRRA 4FM1A 4OLBA 4B08A 4KB0A 4RW6A 3RR7A 3NH0A 3SQ0A 4ID5A 4CHOA 4LD0A 3SPZA 2YKMA 3AO1A 3ZCMA 4CEFA 3PUFA 3I0RA 2QK9A 1TV6A 3MEGA 1SL1A 2X6NA 4CF2A 3P1GA 3ZSWA 2OZMA 2HNYA 3DLRA 4M3UA 3ITHA 1I3AA 4Y1CA 3LDSA 3TAGA 4FK4A 4IG0A 4N5SA 5KTQA 3PX0A 3ZSVA 4IKFA 4FLWA 2B4JA 2IS3A 4FM0A 1NK7A 3AVCA 2HHTA 4Z4IA 3ZSOA 5J2NA 1A5XA 2VG6A 3SZ2A 3S9HA 4KHWA 3AO4A 1ITGA 2XY5A 3TANA 2HHQA 4RW9A 2HHXA 2OZSA 3HPHA 3MECA 3AO2A 4MQ3A 2VG5A 3A2FA 2P5GA 4C8LA 2R7YA 2HVIA 4CEBA 3PX6A 1ZBIA 3QINA 5KGXA 4EP4A 4CEOA 4I7FA 3NBPA 1ZYQA 4LH5A 1S9EA 3OYFA 3MEEA 1RBSA 1DTQA 3T3FA 2ZQBA 3U6FA 2BE2A 3IG1A 3HYFA 1EX4A 4AHSA 3V9UA 1NOYA 1R0AA 3D45A 2B6AA 2YNIA 3KK3A 3HT3A 4M3TA 3LANA 4F4KA 1NK9A 3D0PA 1ZBLA 3AA5X 1KFSA 4F2SA 4GVMA 1XHZA 3OJUA 2IGIA 1LWFA 2OPPA 4CF8A 4DTPA 3SQ2A 1BQNA 4EZ9A 4BE1A 2PZSA 1BHLA 1KFDA 3QEIA 4CGFA 1ASVA 1NK0A 3S3OA 3KK1A 1I39A 1U04A 2PYLA 3L3UA 1U4BA 2IAJA 3OYCA 1QSSA 4CJSA 4FJIA 1NKCA 2YHAA 4DSFA 1DTTA 3DRPA 3QNNA 2DFHA 5JS2A 4W5NA 2E4LA 2A1SA 3C94A 5CY4A 4FLVA 4C8NA 4CFBA 1JLQA 4ZTJA 4CERA 4CF9A 1CXQA 4WE1A 4CIFA 1X9WA 1HYZA 4Z4CA 3L2RA 3SUPA 1EKEA 4I9LA 3KLFA 3SYZA 2O4IA 4CHZA 3WNGA 3VA3A 3AVJA 3M8SA 4W5TA 4BE2A 4CJEA 1RCHA 1BCOA 3NGIA 2XY6A 4KI6A 4KB1A 4HUFA 4CGHA 2WOMA 1EETA 1B9FA 1Q8IA 4KKOA 4Y1DA 2VWJA 4Q0BA 2JLEA 3QETA 4OKEA 1BIUA 3DLEA 3QLHA 4F3OA 4KHUA 1G15A 2DFFA 3DRSA 3KIOA 1NK5A 4FJGA 3K58A 3M8RA 1QHTA 5CYQA 1S1XA 5C24A 2I5JA 4M3XA 2B5JA 4FJNA 1QS4A 3LAKA 2NUBA 4FLUA 3LAMA 1T05A 4DTUA 1RTJA 3DMJA 3K5MA 3F9KA 1IKXA 5SWMA 1J5OA 3OYDA 4H4OA 4E89A 3AVFA 1T8EA 1HQUA 3L8BA 1X9MA 3RMBA 1VSDA 1JLFA 2GUIA 4M3WA 4FK0A 5HBMA 3KLGA 3NF9A 4W5RA 1XC9A 4CFDA 2IDOA 2G8KA 3OS0A 2P5OA 4CE9A 4O0IA 4CJUA 1HMVA 1YTUA 4M42A 3RMAA 3QESA 3L2WA 4K8ZA 4DLGA 4FM2A 2D5RA 2LSNA 4FW2A 4NYNA 3K5NA 5J2MA 5HROA 2QKKA 1WSGA 3NH1A 2QXFA 4L8RB 4DU1A 3V6DA 5J2QA 3OYGA 4Z4GA 1TKZA 3LP0A 1KLNA 4QAGA 4AHCA 1BISA 4CJQA 3MXIA 3TR8A 4RW8A 4FJMA 3ZSZA 3VQDA 1BIZA 1LWCA 1YT3A 4DF8A 1N5YA 4CFAA 3T1AA 3OYHA 3EYZA 4JRPA 3OYKA 4DLEA 1C0TA 3LWMA 3AA4A 3HK2A 4CGDA 1IKVA 4CJWA 4XIUA 5C42A 4Q5VA 2VWKA 2ZE2A 1RT5A 5HRNA 4E7IA 3EY1A 1BGXT 4B9MA 3RR8A 2FBXA 5FROA 1S1UA 4B9SA 3VQ5A 3HM9A 4Z0UA 5KI6A 4B9LA 1SV5A 5K14A 3AVLA 1TK0A 1C1BA 3O4NA 4OJRA 3VQ6A 3QNOA 1HYVA 5CZ1A 3CFOA 4KHSA 3LWLA 2BDPA 1RBTA 2ETJA 2D0CA 1FKOA 3BDPA 4QCLA 4CHYA 2KTQA 1VK0A 2OYQA 3SPYA 4CK3A 3RMDA 4CECA 5HP1A 1QE1A 3V4IA 3SQ1A 1UAXA 3SV3A 3LP2A 1S9GA 4DFJA 2HVHA 1MU2A 2RF2A 4FZYA 1HPZA 4DWIA 3ASMA 3KKRA 5FDLA 4DTMA 1TL3A 4N41A 2RN2A 4PA1A 4AHUA 4I9QA 1RT7A 4Z4HA 4FZXC 4OPKA 2GBZA 3HPGA 4M3ZA 1VSHA 1TKDA 4FYDA 1C1AA 3QO9A 1IG9A 3O3HA 1VSEA 3NF8A 4O0JA 1UA0A 4FJ7A 1JLGA 4FW1A 5DK5A 4CEQA 1TAQA 3B6OA 1IH7A 4M3YA 5KGWA 2IOCA 4HUEA 5HRPA 4FJXA 2Z1GA 3HO1A 2OPQA 4B3OA 3SUNA 1NK4A 4KHYA 4JRQA 4AHVA 1WN7A 4ELTA 3OS2A 3KKSA 3ZT3A 1LV5A 2PY5A 2GV9A 4DTNA 1RT1A 1NKEA 4OGCA 1IKYA 5DMRA 4B8AB 4CEDA 1DLOA 3V9XA 3T19A 1LAWA 4HTUA 2OPSA 1NK6A 2X6SA 4Z4EA 1Y97A 3K57A 3HL8A 3MXMA 2YNFA 5J1EA 2YNHA 4FVMA 4FJJA 4KHNA 3LP3A 2YHBA 2HNDA 4CJRA 4DSEA 4DSJA 1VSLA 3QIOA 3VQAA 5EU7A 3V9SA 3S3NA 1C0UA 1RT2A 3AVHA 1S1WA 4I2PA 4CEZA 3TARA 4O44A 1XHXA 2PYJA 3ISNC 4AHRA 4CJ4A 2X78A 3L2QA 3V1QA 3H08A 4DG1A 1FK9A 4B9VA 4IBNA 1TK8A 4ZTFA 1SKWA 1L3VA 3MEDA 4DMNA 3K59A 3NH2A 2OPRA 1S6QA 3C6TA 1HNIA 1S1VA 3IS9A 1S5JA 3OYNA 4JS5A 1W9HA 4E7HA 3CM5A 3C6UA 3RRHA 2FBTA 3NDKA 3DLGA 3LZJA 4FLZA 4ICLA 4CEAA 1LW2A 2HHVA 1D9FA 3CFPA 1C1CA 1RBUA 4M3RA 3DM2A 3K5LA 1BI4A 3VQQA 3VA0A 1VSIA 4BDZA 3C95A 1K6YA 1JL1A 3AO3A 1RBRA 1Q9YA 4OKJA 3AVKA 2E6LA 1JXEA 1U45A 1LW0A 2VG7A 4FJ9A 3TAFA 4KPYA 1TL1A 3HXMA 1U48A 3OYMA 3VQEA 4CJFA 4F3TA 2KFZA 4CGJA 2HHUA 4B9UA 4HCBA 4R5PA 3VQPA 1KCFA 1CZ9A 3P5JA 2Q3SA 3OJSA 3B6PA 3JSMA 3PX4A 4B9NA 2ITGA 4DQIA 4PY5A 4UQGA 4M45A 1F21A 4BACA 1RBVA 3TAMA 5CZ2A 1HNVA 3O3FA 4F8RA 3CM6A 4KO0A 3ZT4A 4CK2A 1XI1A 4C8OA 5JS1A 2G8WA 3F73A 1TVRA 1BI4B 4LSLA 1VSFA 4RW7A 2HMIA 3ULDA 3HSTB 4CEEA 3SUQA 4HHTA 2YKNA 3SQ4A 2QKBA 5D3GA 1RT3A 4GW6A 3RRGA 1U47A 3OY9A 3NGYA 4ELVA 3KD1E 3NF6A 2KZMA 4IFVA 5HLFA 4CF1A 3IAYA 3MXJA 4J2DA 3THVA 1NJYA 1X1PA 2AJQA 1B9DA 4J2EA 1RTIA 1U49A 2KQ2A 3P83D 2JGUA 2KFNA 4C8KA 2HHSA 3DOKA 4CESA 3VQ8A 3KD5E 3DOLA 2F96A 3LP1A 1VSJA 1KRPA 4BWJA 3SCXA 4DQPA 4DSKA 2O4GA 4TSXA 1GOCA 3AVMA 1TKTA 3RWUA 1ASUA 4NYFA 3QERA 4IDKA 3G10A 4DTOA 3KTQA 4KAZA 4I2QA 4KTQA 1RT6A 4FJLA 1HQEA 4E7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSJ A;  2XHB A;  1SKR A;  2BAN A;  4LY7 A;  4DSL A;  3AVG A;  4E0D A;  4MFB A;  1JLB A;  4CGG A;  3SNN A;  1T03 A;  1WLJ A;  1XWL A;  4DFK A;  4E1M A;  4N56 A;  1L3T A;  3E01 A;  2E6M A;  4FZZ A;  4DU3 A;  3AA2 A;  2RKI A;  3S3M A;  4KRE A;  4OKK A;  5KRS A;  3AVA A;  4FCY A;  4FJH A;  4CJT A;  4HUG A;  4HCC A;  3LPU A;  1WAJ A;  3VQB A;  4QOZ B;  2P51 A;  1VRU A;  5C25 A;  1UOC A;  1CLQ A;  3RMC A;  3MAQ A;  4CF0 A;  1EP4 A;  4KFB A;  3G0Z A;  1WSH A;  4EP5 A;  2F8T A;  1WSE A;  4KTZ A;  1C0M A;  3ZT0 A;  4KTW A;  1Q9X A;  4J2A A;  2HB5 A;  3TAE A;  1RDD A;  2XY8 A;  2EX3 A;  3U3G A;  3FFI A;  3SV4 A;  1KVA A;  4E7K A;  1IO2 A;  4CGI A;  5CYM A;  4B9T A;  1ZBH A;  1HYS A;  3OYI A;  4IFY A;  5I42 A;  3M8Q A;  1KVB A;  4N47 A;  1RDA A;  5HRS A;  3TWH A;  4CJP A;  1B92 A;  3QEV A;  1BCM A;  3KK2 A;  3ZSX A;  4FJ8 A;  4BDY A;  4DQR A;  1D8Y A;  4K8X A;  4IG3 A;  4CIG A;  1FKP A;  3HVR A;  1VSM A;  3CYM A;  4DQS A;  3QEW A;  4FK2 A;  4Z4F A;  3AA3 A;  1BQM A;  1WAF A;  3OYA A;  3KLE A;  2G8F A;  1CZB A;  1GOB A;  1LWE A;  2FBY A;  3ZSQ A;  3DI6 A;  4B8C A;  3O3G A;  3OYB A;  4PQU A;  4CJK A;  5I3U A;  4FLY A;  4CJ3 A;  3ZSR A;  1QSY A;  3DLK A;  2YNG A;  4CHP A;  4LSN A;  2Z1I A;  4EZ6 A;  1RTD A;  3TI0 A;  4NCB A;  2G8H A;  3DLH A;  2HHW A;  4FLT A;  2A1R A;  2OA8 A;  3AVB A;  1A5V A;  4YFU A;  3OYL A;  3VN5 A;  3NCI A;  4DQQ A;  2Y1I A;  1NJX A;  4AH9 A;  2X74 A;  3VQ4 A;  4JS4 A;  1KTQ A;  4DS4 A;  3L2V A;  3U3Y A;  2G8U A;  3V1O A;  1CXU A;  4DTR A;  4H4M A;  1FXX A;  5KRT A;  3I8D A;  1JLC A;  2D0A A;  4H8K A;  4HVJ A;  4E3S A;  4KI4 A;  1C6V A;  1HRH A;  2G8V A;  1ZBU A;  1RDB A;  4NCG A;  1SUQ A;  2XRI A;  2Y1J A;  4DFM A;  5SZT A;  3QEX A;  1A5W A;  3WNE A;  3LAL A;  4C8M A;  3QEP A;  2WON A;  1N6Q A;  3OYE A;  3OYJ A;  3AO5 A;  3NGZ A;  3OS1 A;  1LAV A;  1RNH A;  2FC0 A;  3PO5 A;  1NJZ A;  4O5B A;  1SL0 A;  4KHQ A;  3LZI A;  4E19 A;  4W5Q A;  2Z1J A;  3PY8 A;  3KJV A;  1EXQ A;  4O4G A;  1ASW A;  3TAB A;  2EHG A;  5FRN A;  1UWB A;  4OPJ A;  3SI6 A;  2FBV A;  4DF4 A;  3VQ9 A;  4ELU A;  1NK8 A;  3HP9 A;  1TKX A;  1W0H A;  4AIL C;  4JLH A;  4CHN A;  4GMJ B;  3OVN A;  4BE0 A;  2ZD1 A;  2YV0 X;  1J9A A;  1WSF A;  3HP6 A;  4CJL A;  3O4Q A;  1QTM A;  1JKH A;  1YTA A;  1KLM A;  4RG8 A;  1J54 A;  2DFE A;  4OGE A;  2ATQ A;  3KLI A;  3HJF A;  2Z1H A;  4DS5 A;  4NCA A;  1TK5 A;  4FXD A;  3NF7 A;  3LPT A;  3CG7 A;  2F8S A;  3M8P A;  1Z26 A;  3IRX A;  3NE6 A;  2G8I A;  1ZBF A;  1UA1 A;  1KVC A;  3K5O A;  1L5U A;  3SJJ A;  4PUO A;  4KRF A;  1RT4 A;  1QSL A;  3EZ5 A;  1L3S A;  3NFA A;  4PWD A;  3ZSY A;  2DY4 A;  4ID1 A;  4W5O A;  1JLE A;  3AVI A;  5T7B A;  1VSK A;  4CJ5 A;  1JXB A;  4N76 A;  1BL3 A;  1REV A;  1RTH A;  1KSP A;  3DLB A;  2HW3 A;  4CHQ A;  3QIP A;  3VQ7 A;  1HJR A;  2W42 A;  1VRT A;  2HNZ A;  3AVN A;  3AV9 A;  3HVT A;  4M41 A;  3PV8 A;  4RW4 A;  3KLH A;  3UIQ A;  4BDP A;  1NKB A;  3DRR A;  2RPI A;  3L3V A;  4OVL A;  1RDC A;  4CFC A;  4CIE A;  3CFR A;  3V9Z A;  1RIL A;  3JYT A;  1WNS A;  5J2P A;  4FJ5 A;  2IC3 A;  1JL2 A;  4DTX A;  1SL2 A;  1YVU A;  1NOZ A;  3K2P A;  4FLX A;  3PO4 A;  2XO7 A;  3CQ8 A;  2BGG A;  1TGO A;  2DTU A;  5FRM A;  4OLA A;  4DSI A;  1J53 A;  3NAE A;  2XY7 A;  1D9D A;  3ZT1 A;  3DYA A;  3HPO A;  3TAP A;  4AHT A;  3ALY A;  4O55 A;  1S6P A;  1O1W A;  3I0S A;  4CJV A;  3NHG A;  4DU4 A;  4DTS A;  3RTV A;  4DTJ A;  1WSI A;  3WNH A;  1NJW A;  3V1R A;  4F2R A;  2D0B A;  3WNF A;  3V81 A;  3BGR A;  4YNQ A;  4BWM A;  1T7P A;  1SKS A;  4CCH A;  1JLA A;  4E1N A;  2P1J A;  1D5A A;  3ZT2 A;  4LH4 A;  1L3U A;  3VQC A;  4DFP A;  1X9S A;  2KZZ A;  5E41 A;  3L2U A;  4ZHR A;  1TAU A;  4CK1 A;  4J2B A;  3SUO A;  4FJK A;  1QQC A;  3TAQ A;  1S1T A;  3V9W A;  4E7J A;  1IKW A;  1GOA A;  4KV8 A;  1Z25 A;  4G1Q A;  2KW4 A;  5HRR A;  4FM1 A;  4OLB A;  4B08 A;  4KB0 A;  4RW6 A;  3RR7 A;  3NH0 A;  3SQ0 A;  4ID5 A;  4CHO A;  4LD0 A;  3SPZ A;  2YKM A;  3AO1 A;  3ZCM A;  4CEF A;  3PUF A;  3I0R A;  2QK9 A;  1TV6 A;  3MEG A;  1SL1 A;  2X6N A;  4CF2 A;  3P1G A;  3ZSW A;  2OZM A;  2HNY A;  3DLR A;  4M3U A;  3ITH A;  1I3A A;  4Y1C A;  3LDS A;  3TAG A;  4FK4 A;  4IG0 A;  4N5S A;  5KTQ A;  3PX0 A;  3ZSV A;  4IKF A;  4FLW A;  2B4J A;  2IS3 A;  4FM0 A;  1NK7 A;  3AVC A;  2HHT A;  4Z4I A;  3ZSO A;  5J2N A;  1A5X A;  2VG6 A;  3SZ2 A;  3S9H A;  4KHW A;  3AO4 A;  1ITG A;  2XY5 A;  3TAN A;  2HHQ A;  4RW9 A;  2HHX A;  2OZS A;  3HPH A;  3MEC A;  3AO2 A;  4MQ3 A;  2VG5 A;  3A2F A;  2P5G A;  4C8L A;  2R7Y A;  2HVI A;  4CEB A;  3PX6 A;  1ZBI A;  3QIN A;  5KGX A;  4EP4 A;  4CEO A;  4I7F A;  3NBP A;  1ZYQ A;  4LH5 A;  1S9E A;  3OYF A;  3MEE A;  1RBS A;  1DTQ A;  3T3F A;  2ZQB A;  3U6F A;  2BE2 A;  3IG1 A;  3HYF A;  1EX4 A;  4AHS A;  3V9U A;  1NOY A;  1R0A A;  3D45 A;  2B6A A;  2YNI A;  3KK3 A;  3HT3 A;  4M3T A;  3LAN A;  4F4K A;  1NK9 A;  3D0P A;  1ZBL A;  3AA5 X;  1KFS A;  4F2S A;  4GVM A;  1XHZ A;  3OJU A;  2IGI A;  1LWF A;  2OPP A;  4CF8 A;  4DTP A;  3SQ2 A;  1BQN A;  4EZ9 A;  4BE1 A;  2PZS A;  1BHL A;  1KFD A;  3QEI A;  4CGF A;  1ASV A;  1NK0 A;  3S3O A;  3KK1 A;  1I39 A;  1U04 A;  2PYL A;  3L3U A;  1U4B A;  2IAJ A;  3OYC A;  1QSS A;  4CJS A;  4FJI A;  1NKC A;  2YHA A;  4DSF A;  1DTT A;  3DRP A;  3QNN A;  2DFH A;  5JS2 A;  4W5N A;  2E4L A;  2A1S A;  3C94 A;  5CY4 A;  4FLV A;  4C8N A;  4CFB A;  1JLQ A;  4ZTJ A;  4CER A;  4CF9 A;  1CXQ A;  4WE1 A;  4CIF A;  1X9W A;  1HYZ A;  4Z4C A;  3L2R A;  3SUP A;  1EKE A;  4I9L A;  3KLF A;  3SYZ A;  2O4I A;  4CHZ A;  3WNG A;  3VA3 A;  3AVJ A;  3M8S A;  4W5T A;  4BE2 A;  4CJE A;  1RCH A;  1BCO A;  3NGI A;  2XY6 A;  4KI6 A;  4KB1 A;  4HUF A;  4CGH A;  2WOM A;  1EET A;  1B9F A;  1Q8I A;  4KKO A;  4Y1D A;  2VWJ A;  4Q0B A;  2JLE A;  3QET A;  4OKE A;  1BIU A;  3DLE A;  3QLH A;  4F3O A;  4KHU A;  1G15 A;  2DFF A;  3DRS A;  3KIO A;  1NK5 A;  4FJG A;  3K58 A;  3M8R A;  1QHT A;  5CYQ A;  1S1X A;  5C24 A;  2I5J A;  4M3X A;  2B5J A;  4FJN A;  1QS4 A;  3LAK A;  2NUB A;  4FLU A;  3LAM A;  1T05 A;  4DTU A;  1RTJ A;  3DMJ A;  3K5M A;  3F9K A;  1IKX A;  5SWM A;  1J5O A;  3OYD A;  4H4O A;  4E89 A;  3AVF A;  1T8E A;  1HQU A;  3L8B A;  1X9M A;  3RMB A;  1VSD A;  1JLF A;  2GUI A;  4M3W A;  4FK0 A;  5HBM A;  3KLG A;  3NF9 A;  4W5R A;  1XC9 A;  4CFD A;  2IDO A;  2G8K A;  3OS0 A;  2P5O A;  4CE9 A;  4O0I A;  4CJU A;  1HMV A;  1YTU A;  4M42 A;  3RMA A;  3QES A;  3L2W A;  4K8Z A;  4DLG A;  4FM2 A;  2D5R A;  2LSN A;  4FW2 A;  4NYN A;  3K5N A;  5J2M A;  5HRO A;  2QKK A;  1WSG A;  3NH1 A;  2QXF A;  4L8R B;  4DU1 A;  3V6D A;  5J2Q A;  3OYG A;  4Z4G A;  1TKZ A;  3LP0 A;  1KLN A;  4QAG A;  4AHC A;  1BIS A;  4CJQ A;  3MXI A;  3TR8 A;  4RW8 A;  4FJM A;  3ZSZ A;  3VQD A;  1BIZ A;  1LWC A;  1YT3 A;  4DF8 A;  1N5Y A;  4CFA A;  3T1A A;  3OYH A;  3EYZ A;  4JRP A;  3OYK A;  4DLE A;  1C0T A;  3LWM A;  3AA4 A;  3HK2 A;  4CGD A;  1IKV A;  4CJW A;  4XIU A;  5C42 A;  4Q5V A;  2VWK A;  2ZE2 A;  1RT5 A;  5HRN A;  4E7I A;  3EY1 A;  1BGX T;  4B9M A;  3RR8 A;  2FBX A;  5FRO A;  1S1U A;  4B9S A;  3VQ5 A;  3HM9 A;  4Z0U A;  5KI6 A;  4B9L A;  1SV5 A;  5K14 A;  3AVL A;  1TK0 A;  1C1B A;  3O4N A;  4OJR A;  3VQ6 A;  3QNO A;  1HYV A;  5CZ1 A;  3CFO A;  4KHS A;  3LWL A;  2BDP A;  1RBT A;  2ETJ A;  2D0C A;  1FKO A;  3BDP A;  4QCL A;  4CHY A;  2KTQ A;  1VK0 A;  2OYQ A;  3SPY A;  4CK3 A;  3RMD A;  4CEC A;  5HP1 A;  1QE1 A;  3V4I A;  3SQ1 A;  1UAX A;  3SV3 A;  3LP2 A;  1S9G A;  4DFJ A;  2HVH A;  1MU2 A;  2RF2 A;  4FZY A;  1HPZ A;  4DWI A;  3ASM A;  3KKR A;  5FDL A;  4DTM A;  1TL3 A;  4N41 A;  2RN2 A;  4PA1 A;  4AHU A;  4I9Q A;  1RT7 A;  4Z4H A;  4FZX C;  4OPK A;  2GBZ A;  3HPG A;  4M3Z A;  1VSH A;  1TKD A;  4FYD A;  1C1A A;  3QO9 A;  1IG9 A;  3O3H A;  1VSE A;  3NF8 A;  4O0J A;  1UA0 A;  4FJ7 A;  1JLG A;  4FW1 A;  5DK5 A;  4CEQ A;  1TAQ A;  3B6O A;  1IH7 A;  4M3Y A;  5KGW A;  2IOC A;  4HUE A;  5HRP A;  4FJX A;  2Z1G A;  3HO1 A;  2OPQ A;  4B3O A;  3SUN A;  1NK4 A;  4KHY A;  4JRQ A;  4AHV A;  1WN7 A;  4ELT A;  3OS2 A;  3KKS A;  3ZT3 A;  1LV5 A;  2PY5 A;  2GV9 A;  4DTN A;  1RT1 A;  1NKE A;  4OGC A;  1IKY A;  5DMR A;  4B8A B;  4CED A;  1DLO A;  3V9X A;  3T19 A;  1LAW A;  4HTU A;  2OPS A;  1NK6 A;  2X6S A;  4Z4E A;  1Y97 A;  3K57 A;  3HL8 A;  3MXM A;  2YNF A;  5J1E A;  2YNH A;  4FVM A;  4FJJ A;  4KHN A;  3LP3 A;  2YHB A;  2HND A;  4CJR A;  4DSE A;  4DSJ A;  1VSL A;  3QIO A;  3VQA A;  5EU7 A;  3V9S A;  3S3N A;  1C0U A;  1RT2 A;  3AVH A;  1S1W A;  4I2P A;  4CEZ A;  3TAR A;  4O44 A;  1XHX A;  2PYJ A;  3ISN C;  4AHR A;  4CJ4 A;  2X78 A;  3L2Q A;  3V1Q A;  3H08 A;  4DG1 A;  1FK9 A;  4B9V A;  4IBN A;  1TK8 A;  4ZTF A;  1SKW A;  1L3V A;  3MED A;  4DMN A;  3K59 A;  3NH2 A;  2OPR A;  1S6Q A;  3C6T A;  1HNI A;  1S1V A;  3IS9 A;  1S5J A;  3OYN A;  4JS5 A;  1W9H A;  4E7H A;  3CM5 A;  3C6U A;  3RRH A;  2FBT A;  3NDK A;  3DLG A;  3LZJ A;  4FLZ A;  4ICL A;  4CEA A;  1LW2 A;  2HHV A;  1D9F A;  3CFP A;  1C1C A;  1RBU A;  4M3R A;  3DM2 A;  3K5L A;  1BI4 A;  3VQQ A;  3VA0 A;  1VSI A;  4BDZ A;  3C95 A;  1K6Y A;  1JL1 A;  3AO3 A;  1RBR A;  1Q9Y A;  4OKJ A;  3AVK A;  2E6L A;  1JXE A;  1U45 A;  1LW0 A;  2VG7 A;  4FJ9 A;  3TAF A;  4KPY A;  1TL1 A;  3HXM A;  1U48 A;  3OYM A;  3VQE A;  4CJF A;  4F3T A;  2KFZ A;  4CGJ A;  2HHU A;  4B9U A;  4HCB A;  4R5P A;  3VQP A;  1KCF A;  1CZ9 A;  3P5J A;  2Q3S A;  3OJS A;  3B6P A;  3JSM A;  3PX4 A;  4B9N A;  2ITG A;  4DQI A;  4PY5 A;  4UQG A;  4M45 A;  1F21 A;  4BAC A;  1RBV A;  3TAM A;  5CZ2 A;  1HNV A;  3O3F A;  4F8R A;  3CM6 A;  4KO0 A;  3ZT4 A;  4CK2 A;  1XI1 A;  4C8O A;  5JS1 A;  2G8W A;  3F73 A;  1TVR A;  1BI4 B;  4LSL A;  1VSF A;  4RW7 A;  2HMI A;  3ULD A;  3HST B;  4CEE A;  3SUQ A;  4HHT A;  2YKN A;  3SQ4 A;  2QKB A;  5D3G A;  1RT3 A;  4GW6 A;  3RRG A;  1U47 A;  3OY9 A;  3NGY A;  4ELV A;  3KD1 E;  3NF6 A;  2KZM A;  4IFV A;  5HLF A;  4CF1 A;  3IAY A;  3MXJ A;  4J2D A;  3THV A;  1NJY A;  1X1P A;  2AJQ A;  1B9D A;  4J2E A;  1RTI A;  1U49 A;  2KQ2 A;  3P83 D;  2JGU A;  2KFN A;  4C8K A;  2HHS A;  3DOK A;  4CES A;  3VQ8 A;  3KD5 E;  3DOL A;  2F96 A;  3LP1 A;  1VSJ A;  1KRP A;  4BWJ A;  3SCX A;  4DQP A;  4DSK A;  2O4G A;  4TSX A;  1GOC A;  3AVM A;  1TKT A;  3RWU A;  1ASU A;  4NYF A;  3QER A;  4IDK A;  3G10 A;  4DTO A;  3KTQ A;  4KAZ A;  4I2Q A;  4KTQ A;  1RT6 A;  4FJL A;  1HQE A;  4E7L A; 
#chains in the Genus database with same CATH topology
 1GLF O;  3AVG A;  4E0D A;  1JLB A;  1OH8 A;  1L3T A;  3CQX A;  4X66 K;  4DU3 A;  3S3M A;  4FJH A;  4FCY A;  3QIC A;  3RMC A;  4CF0 A;  1WSE A;  3TAE A;  3FFI A;  4YDU C;  5CYM A;  1OH5 A;  3OYI A;  1NGF A;  4B1Z A;  1NBW A;  1VQK N;  4CJP A;  1B92 A;  4X65 K;  4AM6 A;  5DM6 L;  3KK2 A;  3WQU A;  1D8Y A;  1TUU A;  4IG3 A;  4DQS A;  1TYQ A;  4BQL A;  4FWQ A;  2NRX A;  4HTL A;  2VGM A;  3E1Y A;  5M1Q A;  4CJ3 A;  3ZSR A;  1QSY A;  1H1V A;  4G9Z A;  3VEV A;  4EZ6 A;  4NCB A;  4LSN A;  1RTD A;  1KAZ A;  4CZK A;  2G8H A;  4BC5 A;  2A1R A;  2OA8 A;  3OYL A;  5IT9 O;  3VN5 A;  1TUY A;  5AQM A;  3T69 A;  3ZX0 A;  3U3Y A;  3EN9 A;  4XEI A;  1CXU A;  1T6C A;  2I7N A;  5KRT A;  4H8K A;  1C6V A;  4M63 C;  1HRH A;  3E9O A;  4M7Y A;  2Y1J A;  1A5W A;  3MN7 A;  3LAL A;  1P90 A;  1N6Q A;  1EWQ A;  1RNH A;  4J8F A;  1NJZ A;  1QHA A;  3FGU A;  3U4L A;  5AQO A;  3C65 A;  2Z1J A;  2JWL A;  2W40 A;  1ASW A;  1N34 K;  2EHG A;  2QW9 A;  4WFN L;  1Z6R A;  5FRN A;  3VQ9 A;  3HP9 A;  3CCQ N;  4BRD A;  1EQY A;  3HOS A;  1YIJ N;  3HP6 A;  3O4Q A;  5AFU A;  1ATS A;  1QTM A;  2IVO A;  2WFB A;  5AQI A;  4OGE A;  2ATQ A;  3KLI A;  2Z1H A;  4B1V A;  1Q82 O;  3CJC A;  3LPT A;  3CG7 A;  3IRX A;  2G8I A;  1IBL K;  1L3S A;  4PWD A;  4H03 B;  3THY B;  5T7B A;  4QS9 A;  3VQ7 A;  1HJR A;  1VRT A;  3HVT A;  3PV8 A;  4H5V A;  5GIO A;  3L3V A;  4CFC A;  3JYT A;  1WNS A;  2P9P B;  3CJ9 A;  4RTF D;  4FJ5 A;  3O5B A;  4YOW A;  3D2F B;  4B3R K;  2O8E B;  3MN6 A;  4FLX A;  3PO4 A;  3CQ8 A;  2DTU A;  5ELZ A;  2XY7 A;  1D9D A;  3HPO A;  3NHG A;  1O1W A;  1W7A A;  3CC7 N;  5AQH A;  4JKF A;  4IZ9 A;  4DTS A;  3RTV A;  3WNH A;  4JKH A;  4BWM A;  1SKS A;  4CBX A;  4CCH A;  3ZT2 A;  3CJB A;  3MWP A;  4JKC A;  1X9S A;  5E41 A;  4YDU A;  4CK1 A;  3SUO A;  4FJK A;  2P9P A;  4A2B A;  3TAQ A;  2YI1 A;  1MWK A;  4IFE A;  4E7J A;  1Z25 A;  2H3G X;  1YHQ N;  3FZH A;  5JVH L;  3SPZ A;  3IFR A;  3PUF A;  3I0R A;  4CBU A;  2X6N A;  4BRC A;  2HNY A;  3DLR A;  4M3U A;  3VF4 A;  4BR2 A;  4N5S A;  2ZJP L;  5KTQ A;  3PX0 A;  4IKF A;  1VQ4 N;  3AVC A;  3ZSO A;  5AZJ A;  3UKU B;  2VG6 A;  4WF9 L;  3AO4 A;  1ITG A;  3ATU A;  4CZH A;  2QEX N;  2PFU A;  2HHQ A;  3HPH A;  3AO2 A;  4MQ3 A;  3H3O B;  5HL7 L;  2QA4 N;  3QIN A;  5KGX A;  4EP4 A;  2Q31 A;  4CEO A;  1LCU A;  1ZYQ A;  1S9E A;  2ZQB A;  3V9U A;  2E2N A;  1NWK A;  1QQO A;  1GLL O;  4FWK A;  3LAN A;  2E20 A;  4FOE A;  3D0P A;  1ZBL A;  2GWK A;  1ATR A;  1KFS A;  5AZJ B;  4GVM A;  1XHZ A;  4BR0 A;  2PZS A;  1BHL A;  5GAD P;  3QEI A;  4ISG A;  2O8B B;  1VQM N;  3KK1 A;  2IAJ A;  3OYC A;  3THW A;  1QSS A;  2YHA A;  3UE5 A;  5FPD A;  1YJN N;  1RDU A;  4A5A A;  1HX1 A;  5JS2 A;  4W5N A;  2E4L A;  1NGG A;  1CXQ A;  4C23 A;  1X9W A;  1VQL N;  5AQS A;  1K8A O;  4Z4C A;  1EKE A;  4I9L A;  4CHZ A;  1R59 O;  3AVJ A;  5BPL A;  4EHT A;  3VET A;  1BCO A;  2NRR A;  4KI6 A;  4HUF A;  4CGH A;  4BGB A;  2WOM A;  2A41 A;  4A2A A;  3CCE N;  4OKE A;  3QLH A;  3J7Z O;  4DCH A;  4JAX A;  3BP8 A;  4FJG A;  1XMO K;  5CYQ A;  2B5J A;  5E26 A;  3LAK A;  4FLU A;  2E8A A;  1T05 A;  4GV9 A;  1IKX A;  3MN5 A;  4E89 A;  3E66 A;  1YI2 N;  4MLE A;  3L8B A;  2GUI A;  3UB5 A;  3OS0 A;  2P5O A;  1XNR K;  1HMV A;  2RHK A;  3SMP A;  4FM2 A;  5M1N A;  1WSG A;  2E2O A;  3LP0 A;  2GEL A;  3DWL A;  4CJQ A;  4RW8 A;  4KH6 A;  1NGA A;  1BIZ A;  3EL2 A;  3EYZ A;  3SAG A;  3RSE A;  4YOV A;  3LWM A;  3MWT A;  3WXK A;  5C42 A;  3KHY A;  5C15 A;  3EY1 A;  1QVF M;  1S1U A;  4CW7 B;  3VQ5 A;  3HM9 A;  3CER A;  5KI6 A;  1SV5 A;  1OVQ A;  4EHU A;  3PLA A;  4H5R A;  1HYV A;  3T1H K;  2ETJ A;  2D0C A;  4LF8 K;  4CHY A;  3BZK A;  1NGB A;  2OYQ A;  4CEC A;  1QE1 A;  2W41 A;  2A42 A;  4FWP A;  2HVH A;  3LM9 A;  1MU2 A;  2Q0U A;  4FZY A;  1HPZ A;  3WQT A;  3KKR A;  4DTM A;  4N41 A;  5AQQ A;  3IDH A;  2GBZ A;  1Q86 O;  1VSH A;  2QTD A;  4PKI A;  4FYD A;  4NLC A;  3QO9 A;  1C0G A;  1YJW N;  1VSE A;  4O0J A;  1JLG A;  5DK5 A;  4CEQ A;  1TAQ A;  5KGW A;  4HUE A;  5M1F A;  1JCE A;  3SUN A;  3DXK A;  1S72 N;  4AHV A;  3ZYY X;  4ELT A;  3KKS A;  3A5M C;  2GV9 A;  4YHH K;  4DTN A;  4L3Q A;  4CED A;  1YVN A;  3V9X A;  3T19 A;  1LAW A;  3GOI A;  5ADX A;  1NK6 A;  3MXM A;  3CJA A;  2YNF A;  5J1E A;  2FSK A;  2NRH A;  2YHB A;  2HND A;  4JK8 A;  4CJR A;  3PSI A;  4H5W A;  1S1W A;  3F9M A;  4DV7 K;  3ISN C;  3L2Q A;  4C1N K;  3H08 A;  1IJJ A;  3BEX A;  1XMQ K;  3K59 A;  3OA9 A;  1S6Q A;  3C6T A;  1TKD A;  1S1V A;  4E7H A;  3OYN A;  1W9H A;  3VEY A;  3C6U A;  4H0X B;  3DLG A;  2P9U B;  1LW2 A;  3M6G A;  4FWL A;  2HHV A;  2YJF A;  4M3R A;  3DM2 A;  1BI4 A;  3VQQ A;  3VA0 A;  2P9K B;  4BDZ A;  4BY9 C;  2YJE A;  1K6Y A;  1JL1 A;  3AO3 A;  3ZLJ A;  4OKJ A;  3PIO L;  3AVK A;  5AQZ A;  1LW0 A;  4K42 A;  3TAF A;  3HXM A;  3VTI A;  3OYM A;  3VQE A;  5AQG A;  4B9U A;  4HCB A;  5BR8 K;  3VQP A;  1KCF A;  3P5J A;  2Q3S A;  4B9N A;  2ITG A;  4DQI A;  1F21 A;  4BAC A;  5KQD A;  1HNV A;  1NGH A;  1TVR A;  1BI4 B;  4LSL A;  3WEE A;  4RW7 A;  3SUQ A;  1Q81 O;  4ELV A;  3N4P A;  2KZM A;  2VWB A;  4IOX A;  5HLF A;  3IAY A;  1X1P A;  1RTI A;  2KQ2 A;  3P83 D;  2JGU A;  4C8K A;  3DOK A;  4BRO A;  1IBM K;  4LF4 K;  4KHP K;  2OAN A;  1O13 A;  4CZJ A;  4NYF A;  3QER A;  2O8F B;  4DTO A;  3HTV A;  4DUY K;  3D2E B;  3OBY A;  2BAN A;  1GLB G;  4MFB A;  4CGG A;  3SNN A;  1WLJ A;  1XWL A;  4E1M A;  4MO4 A;  2QWP A;  3CCS N;  4YOR A;  4FZZ A;  3NMU A;  4OKK A;  5ADX H;  3AVA A;  3CPE A;  4CJT A;  3LPU A;  1WAJ A;  2P51 A;  3MK6 A;  5C25 A;  2HOE A;  4U67 L;  3A5N C;  4JKD A;  4ISF A;  4CZM A;  1EP4 A;  3G0Z A;  1WSH A;  4J2A A;  2HB5 A;  2XY8 A;  4CGI A;  2IIR A;  5HRS A;  2QXL A;  4DQR A;  3SLC A;  4K8X A;  2A3Z A;  3CYM A;  2NRT A;  1BQM A;  4IO8 A;  4JKA A;  3DLL L;  2G8F A;  2P9N A;  4CJK A;  4FLY A;  4GV3 A;  3DLK A;  2YNG A;  2Z1I A;  4QS8 A;  3TI0 A;  3DLH A;  2EWS A;  3LDL A;  1A5V A;  4IOA L;  4HWI A;  1NJX A;  3VQ4 A;  3Q7B A;  3L2V A;  4K41 A;  3V1O A;  4FWR A;  2P9S A;  4H4M A;  1QZ6 A;  3O9R A;  1BOT O;  1RDB A;  4NCG A;  2ITM A;  1SUQ A;  2XRI A;  3QEX A;  4GVE A;  4B1W B;  3OS1 A;  3DXM A;  4O8K A;  4O5B A;  4KHQ A;  4O4G A;  4PHT X;  3TAB A;  4CBW A;  2A40 A;  3SI6 A;  4BRN A;  4DF4 A;  2P9L B;  5C12 A;  4H5T A;  4JD2 A;  3OVN A;  4BE0 A;  2IVP A;  2YV0 X;  1BU6 O;  1J9A A;  2ZD1 A;  4YOX A;  5HOO A;  1KLM A;  5LMU K;  2NRV A;  4RG8 A;  5AQY A;  1J54 A;  2QM1 A;  3QFP A;  3NF7 A;  1U6Z A;  2OCE A;  4JEP A;  3M8P A;  3NE6 A;  1ZBF A;  3VMF B;  4K43 A;  5M1P A;  3VGK A;  3NFA A;  3ZSY A;  2DY4 A;  3R6M A;  4ID1 A;  1IG8 A;  2ASM A;  1BL3 A;  2HW3 A;  4CHQ A;  1ESV A;  3AV9 A;  1DEJ A;  4CI6 A;  4RW4 A;  4IJA A;  5LJW A;  3HM8 A;  3UIQ A;  3DRR A;  2WC9 A;  2HBL A;  2RPI A;  3P4I A;  4OVL A;  1OH6 A;  4Z94 A;  1JL2 A;  1YVU A;  2BGG A;  4FO0 A;  3W3D A;  2NRW A;  5FRM A;  3O1W A;  3ALY A;  3I0S A;  1NJW A;  4BQZ A;  5BPN A;  3BGR A;  4YNQ A;  1JLA A;  2P1J A;  1D5A A;  4A57 A;  2QWO A;  2KZZ A;  1CZA N;  4J2B A;  1QQC A;  3P39 A;  4NXM K;  1SQK A;  1HUX A;  3V9W A;  1IKW A;  3FR0 A;  2ZJR L;  4CVN E;  2KW4 A;  3VER A;  4OLB A;  4RW6 A;  3NH0 A;  4B1U B;  3AO1 A;  3ZCM A;  4CEF A;  2BTF A;  4V19 S;  4JNE A;  4CZE A;  1TV6 A;  3CCR N;  1NJI O;  4Y1C A;  3ZSV A;  3SAF A;  2B4J A;  4FM0 A;  4Z4I A;  3S9H A;  4FPA A;  4KHW A;  3CMA N;  3GE1 A;  3R1X A;  4RW9 A;  3A0I X;  1Y64 A;  3MEC A;  2VG5 A;  2R7Y A;  3WT0 A;  2PAV A;  4CEB A;  1MA9 B;  4I7F A;  1RBS A;  3T3F A;  1ZBS A;  3J7Y P;  5IWA K;  3ZEU A;  2BE2 A;  4QS7 A;  4B3S K;  3DAW A;  4AHS A;  2KHO A;  1X3M A;  2YCH A;  5C2F A;  4B3T K;  3ULE A;  4BRQ A;  3J81 O;  4DTP A;  2OPP A;  4CF8 A;  1E4F T;  3SQ2 A;  3IKM A;  5M1K A;  5CHI A;  3TSQ A;  4BR5 A;  4DV3 K;  1I39 A;  1U04 A;  1HKB A;  2JWK A;  4DV2 K;  4BR4 A;  1U4B A;  3VEW A;  4CJS A;  1NKC A;  3ATV A;  2HST A;  2A1S A;  1M1K O;  4C8N A;  2UXC K;  4CFB A;  1JLQ A;  4ZTJ A;  4CER A;  4CF9 A;  4CIF A;  4LFA K;  3KLF A;  2O4I A;  3L6Q A;  3P31 A;  3WUH A;  3M8S A;  1K73 O;  4BE2 A;  3H3N O;  3Q7C A;  1RCH A;  2ZGZ A;  3NGI A;  4EIA A;  1EET A;  1VQ8 N;  3EZW A;  4KHU A;  1NK5 A;  2J4R A;  2P9S B;  1QHT A;  4JI3 K;  4FJN A;  3F2K A;  3D7E O;  2NUB A;  1BUP A;  1XNQ K;  3WXI A;  1HQU A;  2QWN A;  4M3W A;  3NF9 A;  2RE2 A;  1BG3 A;  4CE9 A;  3D2F A;  1YTU A;  4M42 A;  3RMA A;  3M1F A;  3QES A;  3L2W A;  5HRO A;  2D5R A;  4NYN A;  4DU1 A;  3RSE B;  3OYG A;  1TKZ A;  4GKJ K;  4NO7 A;  3WXL A;  1BIS A;  3CC4 N;  3T1A A;  3HK2 A;  1IKV A;  4K0K K;  1OVY A;  4Q5V A;  3IMX A;  1RT5 A;  1VQO N;  4E7I A;  1BGX T;  4WCE L;  4BR7 A;  3RR8 A;  4Z0U A;  1KQS M;  5K14 A;  1YIT N;  1TK0 A;  4KH4 A;  3QNO A;  3CF5 L;  3CFO A;  4KHS A;  1RBT A;  3BDP A;  3SPY A;  4R79 A;  5AZI B;  4BRI A;  4CK3 A;  4LF7 K;  5HP1 A;  5AQN A;  5GAH P;  1S9G A;  4YOT A;  5EX5 A;  3B8A X;  3FZL A;  2RF2 A;  2UUC K;  3ASM A;  3IUC A;  1P8Z A;  4PA1 A;  4EAH D;  3C0B A;  4O8U A;  2ZM6 K;  4I9Q A;  3HPG A;  3LDN A;  4M3Z A;  1HJO A;  2W6L A;  1ILY A;  3NF8 A;  4YOY A;  3B6O A;  1IH7 A;  2IOC A;  2OPQ A;  1XC3 A;  5FLX O;  4JRQ A;  1KXP A;  1RT1 A;  1NKE A;  5DMR A;  4B8A B;  1NGJ A;  2OPS A;  2F9T A;  2P9K A;  1VQP N;  4JKG A;  4WQ4 C;  3K57 A;  3HL8 A;  3JAM O;  4FJJ A;  4KHN A;  1MWM A;  3VQA A;  5EU7 A;  4AF1 A;  1JCG A;  1RT2 A;  3D6R A;  2E88 A;  4BRE A;  4DR4 K;  1XHX A;  5AQJ A;  4CJ4 A;  3MED A;  3NH2 A;  4DV1 K;  2OPR A;  5DM7 L;  1HNI A;  1S5J A;  3CM5 A;  2FBT A;  4JKG B;  4DR2 K;  2CGL A;  1D9F A;  3EKU A;  1S22 A;  1C1C A;  1YAG A;  3K5L A;  3C95 A;  4PKG A;  3J7A P;  1QZ5 A;  2ASO A;  2E6L A;  4FJ9 A;  5GAE P;  4KPY A;  3AGR A;  2AA4 A;  4WFB L;  2A6A A;  4CGJ A;  4IO9 L;  1HLU A;  3JSM A;  3H1Q A;  1FW6 A;  1S3X A;  3TAM A;  3O3F A;  4C8O A;  5JS1 A;  2G8W A;  3F73 A;  1VSF A;  3L0Q A;  4CEE A;  1N33 K;  2QKB A;  2KLA A;  1RT3 A;  3CCU N;  3RRG A;  4B1X B;  2P9I A;  3THX B;  4IFV A;  5EVZ A;  4CF1 A;  3MXJ A;  1DT9 A;  5JLF A;  4AQY K;  3THV A;  4GV6 A;  1U49 A;  5JLH A;  2KFN A;  4CES A;  4BRG A;  3DOL A;  1VSJ A;  4BWJ A;  3SCX A;  4DQP A;  2O4G A;  3RWU A;  3AVM A;  5AQV A;  1ASU A;  2UXD K;  1K9M O;  4A61 A;  2YHX A;  1HQE A;  3O8M A;  1SKR A;  4LY7 A;  4DSL A;  5JIC A;  3AGK A;  3SK3 A;  4DFK A;  1KAX A;  4I6M B;  3AA2 A;  4JKE A;  3CD6 N;  5KRS A;  4HUG A;  3C7N A;  5CR4 A;  3VQB A;  4QOZ B;  1VRU A;  3FLC O;  1UOC A;  1CLQ A;  1XUP O;  3MAQ A;  4KFB A;  2F8T A;  3ZT0 A;  1WB9 A;  1Q9X A;  5F0X A;  2D1K A;  3U3G A;  3SV4 A;  4E7K A;  1IO2 A;  1ZBH A;  2QWR A;  1HYS A;  4H0T B;  3SAH A;  4OO1 J;  3TWH A;  3QEV A;  2W6K A;  3ZSX A;  4FJ8 A;  3CXC M;  4BDY A;  1FKP A;  1ZC6 A;  1VSM A;  3HVR A;  3AA3 A;  1WAF A;  1GOB A;  3ZSQ A;  4WFA L;  3QDK A;  3O3G A;  3OYB A;  4FL9 A;  1IBK K;  4CHP A;  4CJ7 A;  3MCP A;  3TSU A;  2UU9 K;  3O9Q A;  2HHW A;  3EE9 A;  1KC8 O;  3AVB A;  4DQQ A;  4CD3 A;  4DHY A;  2Y1I A;  2X74 A;  4JS4 A;  4DS4 A;  2G8U A;  4JI7 K;  1HKG A;  3CPW M;  1U2V B;  4DTR A;  1FXX A;  1JLC A;  2D0A A;  4XH1 A;  4KI4 A;  2ZJQ L;  4FWN A;  2G8V A;  3O9T A;  2V7Y A;  4DFM A;  5SZT A;  4E1J A;  3QEP A;  4C8M A;  2WON A;  3OYE A;  3AO5 A;  3LM2 A;  3PO5 A;  3VEX A;  3LZI A;  2AP1 A;  4E19 A;  1LOT B;  3PY8 A;  4NB4 A;  3THY A;  2UUB K;  3K9K A;  5GIN A;  4OPJ A;  3VOV A;  4ELU A;  1NK8 A;  4AIL C;  1W0H A;  2UYT A;  4CHN A;  3CJ7 A;  3HZ6 A;  4JKB A;  4MDA A;  1JKH A;  1YTA A;  2DFE A;  3HJF A;  1WBB A;  4NCA A;  1DGK N;  1NU0 A;  2F8S A;  1Z26 A;  1KVC A;  4KRF A;  2VGN A;  4DUZ K;  1N36 K;  4B9Q A;  1QSL A;  3EZ5 A;  5TKW A;  1JLE A;  3AVI A;  1VSK A;  1JXB A;  1REV A;  1RTH A;  4BC4 A;  3FZK A;  2O8D B;  3AVN A;  2HNZ A;  3G71 N;  4M41 A;  5JMV A;  3G6E N;  4BDP A;  1NKB A;  4CIE A;  3CFR A;  3V9Z A;  3H1V X;  4DTX A;  1VQ5 N;  1SL2 A;  4A5B A;  4WQ5 A;  3K2P A;  3CCV N;  1TGO A;  4OLA A;  4DSI A;  1J53 A;  3NAE A;  2HHH K;  3CCJ N;  3DYA A;  4AHT A;  4B1Y B;  4O55 A;  4CJV A;  4BR9 A;  4IOC L;  3V1R A;  3AAQ A;  2A5X A;  3WNF A;  3ZX2 A;  3I55 N;  2O8D A;  4E1N A;  2ZWH A;  2QWQ A;  3O1B A;  4LH4 A;  4B3M K;  3VQC A;  2BH1 A;  3L2U A;  4ZHR A;  2Q36 A;  4JI0 K;  4BRM A;  1WUA A;  1S1T A;  1YJ9 N;  5I9E B;  1GOA A;  2V52 B;  4KV8 A;  1NLV A;  4JI2 K;  2E2P A;  5HRR A;  3NVK A;  3O4W A;  4B08 A;  5KPZ A;  3RR7 A;  5KQ8 A;  1YF5 L;  2QK9 A;  1V4T A;  3MEG A;  1SL1 A;  3ITH A;  2P9I B;  3THX A;  3A8Y A;  2HHT A;  3E9P A;  3G4S N;  2XY5 A;  3TAN A;  2HHX A;  2V51 B;  2OZS A;  3GG4 A;  2P9N B;  4A62 A;  2CGK A;  3A2F A;  4C8L A;  3DJC A;  3PX6 A;  1ZBI A;  5GIP A;  3ZET A;  3NBP A;  3H46 O;  3QBX A;  4LH5 A;  3OYF A;  1DTQ A;  3U6F A;  3IG1 A;  4JHD A;  3HYF A;  4I6M A;  1BA1 A;  3D45 A;  5CE3 A;  2B6A A;  2YNI A;  3KK3 A;  3QML A;  4M3T A;  2HBM A;  2ZGY A;  4F2S A;  5LMN K;  3LDQ A;  1HNZ K;  3OJU A;  1LWF A;  4EZ9 A;  1HNW K;  4BE1 A;  4CGF A;  1ASV A;  3S3O A;  1VQN N;  3L3U A;  2CH6 A;  4C1N I;  2OTJ N;  4CZL A;  5E84 A;  3WEE B;  3MX2 A;  1HYZ A;  3L2R A;  3SYZ A;  3RVC A;  4CD1 A;  4MO5 A;  3WNG A;  3VA3 A;  2IVN A;  2FLO A;  4CJE A;  2FSJ A;  2XY6 A;  3H45 C;  4KB1 A;  4KBO A;  4Y1D A;  1Q8I A;  4KKO A;  1VQ6 N;  2JLE A;  1BIU A;  3OHR A;  3DLE A;  5C0Y A;  1BA0 A;  1G15 A;  3F5T A;  3KIO A;  3VES A;  1NG9 A;  5EY4 A;  3M8R A;  4M3X A;  2VCP A;  3LAM A;  1RTJ A;  3F9K A;  5SWM A;  4JI5 K;  1J5O A;  5KPR A;  3WXM B;  4BRA A;  1RFQ A;  1X9M A;  3RMB A;  1JLF A;  3T1Y K;  2HMP A;  3NVM A;  4FWM A;  3KLG A;  5AQF A;  4W5R A;  2IDO A;  2G8K A;  3ENH A;  4O0I A;  3R8E A;  4IJN A;  4DLG A;  5J2M A;  1VAZ A;  2LSN A;  4U7B A;  4KH5 A;  4UY8 O;  3FZF A;  3V6D A;  5J2Q A;  4BC3 A;  4Z4G A;  4JI4 K;  4QAG A;  4AHC A;  4IWV A;  1NGE A;  3HRG A;  1EO1 A;  2DPN A;  3ZSZ A;  3GDQ A;  3VQD A;  3JS6 A;  1LWC A;  1N5Y A;  4DF8 A;  4CFA A;  3OYH A;  1C0T A;  4CGD A;  4CJW A;  4FWO A;  1X9J A;  4WYB A;  3J80 O;  5LJV A;  4B9M A;  2FBX A;  5FRO A;  4B9S A;  2P9U A;  1C1B A;  3O4N A;  3BZC A;  1BO5 O;  1J6Z A;  3LWL A;  3AAR A;  2BDP A;  2D0P A;  2KTQ A;  1VK0 A;  3OW2 M;  3SQ1 A;  1UAX A;  2QI2 A;  3EKS A;  3LP2 A;  4H0Y B;  4H0O A;  2P9L A;  3TTF A;  5FDL A;  4OPA A;  2D4W A;  4BRH A;  4Z4H A;  4FZX C;  4OPK A;  5FPN A;  2GEM A;  3O3H A;  1UA0 A;  4PL7 A;  5AJ3 K;  1RDW X;  3DXM B;  5HRP A;  2Z1G A;  3HO1 A;  2O8C A;  4DR1 K;  3CET A;  4B3O A;  5GAG P;  3ZT3 A;  2E1Y A;  4OGC A;  1IKY A;  3MX5 A;  4HTU A;  1QVG M;  2X6S A;  4Z4E A;  1Y97 A;  3W0L A;  3T7Z A;  1HR0 K;  1SZ2 A;  2YNH A;  3M5R A;  4FVM A;  4DSJ A;  3QIO A;  1YUW A;  3V9S A;  4LC9 B;  3S3N A;  3AVH A;  3TAR A;  1GLE G;  2QWL A;  4O44 A;  5F1X A;  2PYJ A;  4GNI A;  2X78 A;  3MCA B;  3V1Q A;  1FK9 A;  4IBN A;  5KPT A;  1TK8 A;  1GLA G;  4ZTF A;  1N32 K;  3MN9 A;  4DMN A;  4JS5 A;  3IS9 A;  5H1S Q;  4JN4 A;  2NRZ A;  3RRH A;  3NDK A;  3LZJ A;  3H6E A;  4ICL A;  4DV0 K;  4FLZ A;  3CFP A;  4JK9 A;  1VSI A;  2VQF K;  5EXW A;  5AQW A;  3UKU A;  1T6D A;  3HOT A;  1U45 A;  3UKR A;  3PIP L;  3I56 N;  3K9J A;  1U48 A;  2O8B A;  4F3T A;  2KFZ A;  2HHU A;  4R5P A;  3ID6 A;  2YHY A;  3A5O C;  3O6W A;  1NGC A;  1HNX K;  4UQG A;  1RBV A;  3KWI A;  4KO0 A;  1XI1 A;  4YY3 K;  4CZG A;  3C6H A;  5MLC Q;  4EFH A;  2HMI A;  3ULD A;  3HST B;  4HHT A;  2YKN A;  3KWG A;  5D3G A;  4GW6 A;  2VYP A;  3CC2 N;  3NGY A;  3NF6 A;  2AJQ A;  1NJY A;  4OX9 K;  3CIP A;  4BRP A;  3KD5 E;  2F96 A;  2E2Q A;  1GOC A;  1TKT A;  3CJ1 A;  4IDK A;  3EO3 A;  3G10 A;  3KTQ A;  4KAZ A;  3U9D A;  4E7L A;  1WSJ A;  2XHB A;  4DR3 K;  4GKK K;  3TSP A;  1T03 A;  1I94 K;  4N56 A;  3E01 A;  2E6M A;  4JK7 A;  4KRE A;  1NMD A;  2RKI A;  2D0O A;  4FOI A;  4BG8 A;  2GUP A;  4HCC A;  3ULE B;  4BG9 A;  3SBT A;  3O80 A;  4RWT A;  5AQL A;  4EP5 A;  4KTZ A;  1C0M A;  4KTW A;  1RDD A;  2EX3 A;  1TYQ B;  1KVA A;  4B9T A;  4IFY A;  5I42 A;  3M8Q A;  1KVB A;  4N47 A;  1RDA A;  5AQP A;  5BRD A;  1BCM A;  3SBG A;  3ZX3 A;  4CIG A;  5C2D A;  3S41 A;  4PKH A;  4Z4F A;  3QEW A;  4FK2 A;  1VQ9 N;  5BN9 A;  3OYA A;  3KLE A;  1CZB A;  1LWE A;  2FBY A;  3L4I A;  3DI6 A;  3VF6 A;  4B8C A;  4PQU A;  5I3U A;  5AQK A;  2YX6 A;  2FSN A;  4FLT A;  5BPM A;  4YFU A;  3NCI A;  1GLD G;  1NGD A;  3BF1 A;  3J8A A;  4AH9 A;  1KTQ A;  4JHD B;  3I8D A;  4X62 K;  5LY3 A;  4HVJ A;  4E3S A;  4LF9 K;  4M7X A;  4ILG B;  1ZBU A;  5BRF A;  4H0P A;  3L4Q A;  2WBN A;  3U8X A;  3WNE A;  3CCM N;  4FPB A;  3OYJ A;  3QB0 A;  3NGZ A;  1LAV A;  2FC0 A;  3R9P A;  1SL0 A;  4BVP A;  1BWF O;  1SAZ A;  4W5Q A;  3VTH A;  3KJV A;  2FF6 A;  1EXQ A;  3N4Q A;  1UWB A;  1M90 O;  2CH5 A;  2FBV A;  5BRH A;  2O8C B;  1TKX A;  4JLH A;  4GMJ B;  3FFK B;  2O8E A;  1WSF A;  3MDQ A;  3C6A A;  4CJL A;  2OTL N;  3LL3 A;  1QQM A;  3I8B A;  1NMN A;  4ILJ A;  1YXQ A;  4FXD A;  4DS5 A;  1VQ7 N;  4XH5 A;  1TK5 A;  1GLJ O;  1J5E K;  4O5F A;  1UA1 A;  3K5O A;  1L5U A;  3SJJ A;  4PUO A;  1RT4 A;  5BN8 A;  1C0F A;  4W5O A;  3A5L C;  4CJ5 A;  3LDO A;  4N76 A;  1BDG A;  5AQX A;  1KSP A;  3DLB A;  4BRL A;  3QIP A;  2W42 A;  5AZI A;  3KLH A;  4CZI A;  2V7Z A;  3M3Z A;  4DR7 K;  1RDC A;  2NLX A;  1RIL A;  5J2P A;  2IC3 A;  2HBK A;  1NOZ A;  5FPE A;  3O9S A;  2XO7 A;  2FF3 B;  3MMV A;  4NLB A;  4JYA K;  4AM7 A;  3ZT1 A;  3TAP A;  1S6P A;  4DU4 A;  3JXU A;  3VGL A;  2ASP A;  4DTJ A;  1WSI A;  4F2R A;  2D0B A;  3V81 A;  1T7P A;  5AQT A;  4H5N A;  1W2B M;  1L3U A;  4WQ5 C;  1GLC G;  4DFP A;  1TAU A;  5A2Q O;  3WXJ A;  4JI1 K;  4DV5 K;  2NZT A;  1K8K B;  2Q97 A;  4JI6 K;  3GL1 A;  4G1Q A;  4BC2 A;  4FM1 A;  3VEO A;  4CZF A;  5BR9 A;  4KB0 A;  4DR6 K;  3SQ0 A;  1OKJ A;  4ID5 A;  4LD0 A;  4CHO A;  2YKM A;  4DV6 K;  3KK7 A;  3ZEU B;  2OZM A;  4CF2 A;  3P1G A;  3ZSW A;  1D4X A;  1I3A A;  3LDS A;  3TAG A;  4FK4 A;  4IG0 A;  4FLW A;  2IS3 A;  1NK7 A;  4IXC A;  1E4G T;  5J2N A;  1A5X A;  3CI5 A;  3SZ2 A;  3HBT A;  1FJG K;  5AFU H;  4OPH A;  2KKZ A;  2P5G A;  2HVI A;  2UUA K;  4FSV A;  1HPM A;  1WOQ A;  1NM1 A;  3ENB A;  3MEE A;  5AQU A;  3PSF A;  3QFU A;  4X64 K;  1EX4 A;  1NOY A;  1R0A A;  4MLH A;  3HT3 A;  4F4K A;  1NK9 A;  3KVG A;  3AA5 X;  2O8F A;  3D2E A;  3HSC A;  3THW B;  2IGI A;  1BQN A;  3SJH A;  1KFD A;  1NK0 A;  4Y0W A;  2BUP A;  2PYL A;  4IEE A;  3R3L A;  1G99 A;  4FJI A;  2ZF5 O;  4DSF A;  1WBD A;  1DTT A;  3DRP A;  3QNN A;  2DFH A;  2QWM A;  3TPQ A;  3C94 A;  5CY4 A;  4FLV A;  5AR0 A;  4LFC K;  4WE1 A;  3VF2 A;  4JI8 K;  3SUP A;  2HF3 A;  1SS6 A;  4W5T A;  4DB3 A;  2VWJ A;  4Q0B A;  1B9F A;  1W97 L;  1MDU B;  3QET A;  3O08 A;  4F3O A;  2DFF A;  3DRS A;  3K58 A;  1S1X A;  5C24 A;  2I5J A;  3I33 A;  2E5L K;  2F7T A;  1QS4 A;  2HF4 A;  4YOU A;  3FZM A;  4DTU A;  3DMJ A;  3K5M A;  3BY5 A;  4BVO A;  3BF3 A;  3OYD A;  4H4O A;  5FPM A;  3EE8 A;  4DKW A;  3AVF A;  1T8E A;  1VSD A;  4FWS A;  4FK0 A;  1XQS C;  5HBM A;  1XC9 A;  1IV0 A;  4CFD A;  4DR5 K;  2Q0R A;  3C7N B;  1E3M A;  5EOY A;  4CJU A;  3O9U A;  1Q7Y O;  3E9L A;  2Q2R A;  3TTD A;  4K8Z A;  4FW2 A;  3K0S A;  3LDP A;  3K5N A;  2QKK A;  4L8R B;  1T44 A;  4IEI A;  3NH1 A;  2QXF A;  5TKY A;  3ENO A;  1KLN A;  2I7P A;  2NNW A;  4MDB A;  3OTO K;  4JD2 B;  3MXI A;  3TR8 A;  4A59 A;  4FJM A;  5JVG L;  1YT3 A;  4H0V B;  1X3N A;  4JRP A;  3OYK A;  4DLE A;  3AA4 A;  2F9W A;  2WUS A;  3AY9 A;  4XIU A;  2VWK A;  2ZE2 A;  3ID8 A;  4BRF A;  5HRN A;  4LFB K;  4B9L A;  1ATN A;  3AVL A;  1KAY A;  1T3V A;  2F4V K;  4OJR A;  3VQ6 A;  1VHX A;  5CZ1 A;  4QCL A;  1FKO A;  3VEZ A;  3RMD A;  4NXN K;  3V4I A;  1V4S A;  4F9O A;  3SV3 A;  4DFJ A;  2GWJ A;  1U2V A;  4K25 A;  1ZXO A;  2GX9 A;  3P38 A;  2GTD A;  4DQ8 A;  4DWI A;  2PBD A;  2FXU A;  4LF6 K;  1TL3 A;  2RN2 A;  5AQR A;  4AHU A;  1RT7 A;  4DV4 K;  3G25 A;  3CQY A;  2HBJ A;  1OH7 A;  1QQN A;  1C1A A;  3FE1 A;  1IG9 A;  3DXK B;  1JJ2 M;  3BUZ B;  4FJ7 A;  3CME N;  4FW1 A;  1KD1 O;  4M3Y A;  4PL8 A;  4FJX A;  1NK4 A;  4KHY A;  1K8K A;  4GY2 B;  1WN7 A;  3OS2 A;  1LV5 A;  2PY5 A;  5BRE A;  3CCL N;  3TTC A;  1DLO A;  3OBW A;  5LL6 Z;  2E1Z A;  3LP3 A;  3VEN A;  4DSE A;  1VSL A;  3VPZ A;  1C0U A;  4CEZ A;  4I2P A;  4AHR A;  4ISE A;  4DG1 A;  4BRK A;  1N8R O;  4B9V A;  2UXB K;  1SKW A;  1L3V A;  1RGI A;  4WQ4 A;  4ILH A;  1JCF A;  4LF5 K;  4BGA A;  2WTU A;  4CEA A;  3SMS A;  1RBU A;  3KZB A;  3TU5 A;  3QBW A;  1RBR A;  4RCH A;  1Q9Y A;  1JXE A;  5B8H A;  5M1O A;  4FVU A;  3EEQ A;  2VG7 A;  3VGM A;  1NNE A;  5F2R A;  1TL1 A;  4CJF A;  1EWR A;  1CZ9 A;  5C10 A;  3PX4 A;  3OJS A;  3B6P A;  1NGI A;  3UKR B;  4PY5 A;  4M45 A;  3HI0 A;  3CHW A;  5CZ2 A;  2YHW A;  4F8R A;  3CM6 A;  3ZT4 A;  4CK2 A;  2Q1N A;  2CGJ A;  1Z05 A;  4JV5 K;  3SQ4 A;  3GBT A;  4IDH A;  1Q18 A;  3U9Z A;  1U47 A;  3OY9 A;  3KD1 E;  3ZET B;  2VQE K;  4J2D A;  1B9D A;  4J2E A;  3AAP A;  1DKG D;  2HHS A;  3VQ8 A;  3LP1 A;  1KRP A;  1HKC A;  4XH4 A;  4DSK A;  4TSX A;  4I2Q A;  4KTQ A;  1RT6 A;  4FJL A; 
#chains in the Genus database with same CATH homology
 1WSJ A;  2XHB A;  1SKR A;  2BAN A;  4LY7 A;  4DSL A;  3AVG A;  4E0D A;  4MFB A;  1JLB A;  4CGG A;  3SNN A;  1T03 A;  1WLJ A;  1XWL A;  4DFK A;  4E1M A;  4N56 A;  1L3T A;  3E01 A;  2E6M A;  4FZZ A;  4DU3 A;  3AA2 A;  2RKI A;  3S3M A;  4KRE A;  4OKK A;  5KRS A;  3AVA A;  4FCY A;  4FJH A;  4CJT A;  4HUG A;  4HCC A;  3LPU A;  1WAJ A;  3VQB A;  4QOZ B;  2P51 A;  1VRU A;  5C25 A;  1UOC A;  1CLQ A;  3RMC A;  3MAQ A;  4CF0 A;  1EP4 A;  4KFB A;  3G0Z A;  1WSH A;  4EP5 A;  2F8T A;  1WSE A;  4KTZ A;  1C0M A;  3ZT0 A;  4KTW A;  1Q9X A;  4J2A A;  2HB5 A;  3TAE A;  1RDD A;  2XY8 A;  2EX3 A;  3U3G A;  3FFI A;  3SV4 A;  1KVA A;  4E7K A;  1IO2 A;  4CGI A;  5CYM A;  4B9T A;  1ZBH A;  1HYS A;  3OYI A;  4IFY A;  5I42 A;  3M8Q A;  1KVB A;  4N47 A;  1RDA A;  5HRS A;  3TWH A;  4CJP A;  1B92 A;  3QEV A;  1BCM A;  3KK2 A;  3ZSX A;  4FJ8 A;  4BDY A;  4DQR A;  1D8Y A;  4K8X A;  4IG3 A;  4CIG A;  1FKP A;  3HVR A;  1VSM A;  3CYM A;  4DQS A;  3QEW A;  4FK2 A;  4Z4F A;  3AA3 A;  1BQM A;  1WAF A;  3OYA A;  3KLE A;  2G8F A;  1CZB A;  1GOB A;  1LWE A;  2FBY A;  3ZSQ A;  3DI6 A;  4B8C A;  3O3G A;  3OYB A;  4PQU A;  4CJK A;  5I3U A;  4FLY A;  4CJ3 A;  3ZSR A;  1QSY A;  3DLK A;  2YNG A;  4CHP A;  4LSN A;  2Z1I A;  4EZ6 A;  1RTD A;  3TI0 A;  4NCB A;  2G8H A;  3DLH A;  2HHW A;  4FLT A;  2A1R A;  2OA8 A;  3AVB A;  1A5V A;  4YFU A;  3OYL A;  3VN5 A;  3NCI A;  4DQQ A;  2Y1I A;  1NJX A;  4AH9 A;  2X74 A;  3VQ4 A;  4JS4 A;  1KTQ A;  4DS4 A;  3L2V A;  3U3Y A;  2G8U A;  3V1O A;  1CXU A;  4DTR A;  4H4M A;  1FXX A;  5KRT A;  3I8D A;  1JLC A;  2D0A A;  4H8K A;  4HVJ A;  4E3S A;  4KI4 A;  1C6V A;  1HRH A;  2G8V A;  1ZBU A;  1RDB A;  4NCG A;  1SUQ A;  2XRI A;  2Y1J A;  4DFM A;  5SZT A;  3QEX A;  1A5W A;  3WNE A;  3LAL A;  4C8M A;  3QEP A;  2WON A;  1N6Q A;  3OYE A;  3OYJ A;  3AO5 A;  3NGZ A;  3OS1 A;  1LAV A;  1RNH A;  2FC0 A;  3PO5 A;  1NJZ A;  4O5B A;  1SL0 A;  4KHQ A;  3LZI A;  4E19 A;  4W5Q A;  2Z1J A;  3PY8 A;  3KJV A;  1EXQ A;  4O4G A;  1ASW A;  3TAB A;  2EHG A;  5FRN A;  1UWB A;  4OPJ A;  3SI6 A;  2FBV A;  4DF4 A;  3VQ9 A;  4ELU A;  1NK8 A;  3HP9 A;  1TKX A;  1W0H A;  4AIL C;  4JLH A;  4CHN A;  4GMJ B;  3OVN A;  4BE0 A;  2ZD1 A;  2YV0 X;  1J9A A;  1WSF A;  3HP6 A;  4CJL A;  3O4Q A;  1QTM A;  1JKH A;  1YTA A;  1KLM A;  4RG8 A;  1J54 A;  2DFE A;  4OGE A;  2ATQ A;  3KLI A;  3HJF A;  2Z1H A;  4DS5 A;  4NCA A;  1TK5 A;  4FXD A;  3NF7 A;  3LPT A;  3CG7 A;  2F8S A;  3M8P A;  1Z26 A;  3IRX A;  3NE6 A;  2G8I A;  1ZBF A;  1UA1 A;  1KVC A;  3K5O A;  1L5U A;  3SJJ A;  4PUO A;  4KRF A;  1RT4 A;  1QSL A;  3EZ5 A;  1L3S A;  3NFA A;  4PWD A;  3ZSY A;  2DY4 A;  4ID1 A;  4W5O A;  1JLE A;  3AVI A;  5T7B A;  1VSK A;  4CJ5 A;  1JXB A;  4N76 A;  1BL3 A;  1REV A;  1RTH A;  1KSP A;  3DLB A;  2HW3 A;  4CHQ A;  3QIP A;  3VQ7 A;  1HJR A;  2W42 A;  1VRT A;  2HNZ A;  3AVN A;  3AV9 A;  3HVT A;  4M41 A;  3PV8 A;  4RW4 A;  3KLH A;  3UIQ A;  4BDP A;  1NKB A;  3DRR A;  2RPI A;  3L3V A;  4OVL A;  1RDC A;  4CFC A;  4CIE A;  3CFR A;  3V9Z A;  1RIL A;  3JYT A;  1WNS A;  5J2P A;  4FJ5 A;  2IC3 A;  1JL2 A;  4DTX A;  1SL2 A;  1YVU A;  1NOZ A;  3K2P A;  4FLX A;  3PO4 A;  2XO7 A;  3CQ8 A;  2BGG A;  1TGO A;  2DTU A;  5FRM A;  4OLA A;  4DSI A;  1J53 A;  3NAE A;  2XY7 A;  1D9D A;  3ZT1 A;  3DYA A;  3HPO A;  3TAP A;  4AHT A;  3ALY A;  4O55 A;  1S6P A;  1O1W A;  3I0S A;  4CJV A;  3NHG A;  4DU4 A;  4DTS A;  3RTV A;  4DTJ A;  1WSI A;  3WNH A;  1NJW A;  3V1R A;  4F2R A;  2D0B A;  3WNF A;  3V81 A;  3BGR A;  4YNQ A;  4BWM A;  1T7P A;  1SKS A;  4CCH A;  1JLA A;  4E1N A;  2P1J A;  1D5A A;  3ZT2 A;  4LH4 A;  1L3U A;  3VQC A;  4DFP A;  1X9S A;  2KZZ A;  5E41 A;  3L2U A;  4ZHR A;  1TAU A;  4CK1 A;  4J2B A;  3SUO A;  4FJK A;  1QQC A;  3TAQ A;  1S1T A;  3V9W A;  4E7J A;  1IKW A;  1GOA A;  4KV8 A;  1Z25 A;  4G1Q A;  2KW4 A;  5HRR A;  4FM1 A;  4OLB A;  4B08 A;  4KB0 A;  4RW6 A;  3RR7 A;  3NH0 A;  3SQ0 A;  4ID5 A;  4CHO A;  4LD0 A;  3SPZ A;  2YKM A;  3AO1 A;  3ZCM A;  4CEF A;  3PUF A;  3I0R A;  2QK9 A;  1TV6 A;  3MEG A;  1SL1 A;  2X6N A;  4CF2 A;  3P1G A;  3ZSW A;  2OZM A;  2HNY A;  3DLR A;  4M3U A;  3ITH A;  1I3A A;  4Y1C A;  3LDS A;  3TAG A;  4FK4 A;  4IG0 A;  4N5S A;  5KTQ A;  3PX0 A;  3ZSV A;  4IKF A;  4FLW A;  2B4J A;  2IS3 A;  4FM0 A;  1NK7 A;  3AVC A;  2HHT A;  4Z4I A;  3ZSO A;  5J2N A;  1A5X A;  2VG6 A;  3SZ2 A;  3S9H A;  4KHW A;  3AO4 A;  1ITG A;  2XY5 A;  3TAN A;  2HHQ A;  4RW9 A;  2HHX A;  2OZS A;  3HPH A;  3MEC A;  3AO2 A;  4MQ3 A;  2VG5 A;  3A2F A;  2P5G A;  4C8L A;  2R7Y A;  2HVI A;  4CEB A;  3PX6 A;  1ZBI A;  3QIN A;  5KGX A;  4EP4 A;  4CEO A;  4I7F A;  3NBP A;  1ZYQ A;  4LH5 A;  1S9E A;  3OYF A;  3MEE A;  1RBS A;  1DTQ A;  3T3F A;  2ZQB A;  3U6F A;  2BE2 A;  3IG1 A;  3HYF A;  1EX4 A;  4AHS A;  3V9U A;  1NOY A;  1R0A A;  3D45 A;  2B6A A;  2YNI A;  3KK3 A;  3HT3 A;  4M3T A;  3LAN A;  4F4K A;  1NK9 A;  3D0P A;  1ZBL A;  3AA5 X;  1KFS A;  4F2S A;  4GVM A;  1XHZ A;  3OJU A;  2IGI A;  1LWF A;  2OPP A;  4CF8 A;  4DTP A;  3SQ2 A;  1BQN A;  4EZ9 A;  4BE1 A;  2PZS A;  1BHL A;  1KFD A;  3QEI A;  4CGF A;  1ASV A;  1NK0 A;  3S3O A;  3KK1 A;  1I39 A;  1U04 A;  2PYL A;  3L3U A;  1U4B A;  2IAJ A;  3OYC A;  1QSS A;  4CJS A;  4FJI A;  1NKC A;  2YHA A;  4DSF A;  1DTT A;  3DRP A;  3QNN A;  2DFH A;  5JS2 A;  4W5N A;  2E4L A;  2A1S A;  3C94 A;  5CY4 A;  4FLV A;  4C8N A;  4CFB A;  1JLQ A;  4ZTJ A;  4CER A;  4CF9 A;  1CXQ A;  4WE1 A;  4CIF A;  1X9W A;  1HYZ A;  4Z4C A;  3L2R A;  3SUP A;  1EKE A;  4I9L A;  3KLF A;  3SYZ A;  2O4I A;  4CHZ A;  3WNG A;  3VA3 A;  3AVJ A;  3M8S A;  4W5T A;  4BE2 A;  4CJE A;  1RCH A;  1BCO A;  3NGI A;  2XY6 A;  4KI6 A;  4KB1 A;  4HUF A;  4CGH A;  2WOM A;  1EET A;  1B9F A;  1Q8I A;  4KKO A;  4Y1D A;  2VWJ A;  4Q0B A;  2JLE A;  3QET A;  4OKE A;  1BIU A;  3DLE A;  3QLH A;  4F3O A;  4KHU A;  1G15 A;  2DFF A;  3DRS A;  3KIO A;  1NK5 A;  4FJG A;  3K58 A;  3M8R A;  1QHT A;  5CYQ A;  1S1X A;  5C24 A;  2I5J A;  4M3X A;  2B5J A;  4FJN A;  1QS4 A;  3LAK A;  2NUB A;  4FLU A;  3LAM A;  1T05 A;  4DTU A;  1RTJ A;  3DMJ A;  3K5M A;  3F9K A;  1IKX A;  5SWM A;  1J5O A;  3OYD A;  4H4O A;  4E89 A;  3AVF A;  1T8E A;  1HQU A;  3L8B A;  1X9M A;  3RMB A;  1VSD A;  1JLF A;  2GUI A;  4M3W A;  4FK0 A;  5HBM A;  3KLG A;  3NF9 A;  4W5R A;  1XC9 A;  4CFD A;  2IDO A;  2G8K A;  3OS0 A;  2P5O A;  4CE9 A;  4O0I A;  4CJU A;  1HMV A;  1YTU A;  4M42 A;  3RMA A;  3QES A;  3L2W A;  4K8Z A;  4DLG A;  4FM2 A;  2D5R A;  2LSN A;  4FW2 A;  4NYN A;  3K5N A;  5J2M A;  5HRO A;  2QKK A;  1WSG A;  3NH1 A;  2QXF A;  4L8R B;  4DU1 A;  3V6D A;  5J2Q A;  3OYG A;  4Z4G A;  1TKZ A;  3LP0 A;  1KLN A;  4QAG A;  4AHC A;  1BIS A;  4CJQ A;  3MXI A;  3TR8 A;  4RW8 A;  4FJM A;  3ZSZ A;  3VQD A;  1BIZ A;  1LWC A;  1YT3 A;  4DF8 A;  1N5Y A;  4CFA A;  3T1A A;  3OYH A;  3EYZ A;  4JRP A;  3OYK A;  4DLE A;  1C0T A;  3LWM A;  3AA4 A;  3HK2 A;  4CGD A;  1IKV A;  4CJW A;  4XIU A;  5C42 A;  4Q5V A;  2VWK A;  2ZE2 A;  1RT5 A;  5HRN A;  4E7I A;  3EY1 A;  1BGX T;  4B9M A;  3RR8 A;  2FBX A;  5FRO A;  1S1U A;  4B9S A;  3VQ5 A;  3HM9 A;  4Z0U A;  5KI6 A;  4B9L A;  1SV5 A;  5K14 A;  3AVL A;  1TK0 A;  1C1B A;  3O4N A;  4OJR A;  3VQ6 A;  3QNO A;  1HYV A;  5CZ1 A;  3CFO A;  4KHS A;  3LWL A;  2BDP A;  1RBT A;  2ETJ A;  2D0C A;  1FKO A;  3BDP A;  4QCL A;  4CHY A;  2KTQ A;  1VK0 A;  2OYQ A;  3SPY A;  4CK3 A;  3RMD A;  4CEC A;  5HP1 A;  1QE1 A;  3V4I A;  3SQ1 A;  1UAX A;  3SV3 A;  3LP2 A;  1S9G A;  4DFJ A;  2HVH A;  1MU2 A;  2RF2 A;  4FZY A;  1HPZ A;  4DWI A;  3ASM A;  3KKR A;  5FDL A;  4DTM A;  1TL3 A;  4N41 A;  2RN2 A;  4PA1 A;  4AHU A;  4I9Q A;  1RT7 A;  4Z4H A;  4FZX C;  4OPK A;  2GBZ A;  3HPG A;  4M3Z A;  1VSH A;  1TKD A;  4FYD A;  1C1A A;  3QO9 A;  1IG9 A;  3O3H A;  1VSE A;  3NF8 A;  4O0J A;  1UA0 A;  4FJ7 A;  1JLG A;  4FW1 A;  5DK5 A;  4CEQ A;  1TAQ A;  3B6O A;  1IH7 A;  4M3Y A;  5KGW A;  2IOC A;  4HUE A;  5HRP A;  4FJX A;  2Z1G A;  3HO1 A;  2OPQ A;  4B3O A;  3SUN A;  1NK4 A;  4KHY A;  4JRQ A;  4AHV A;  1WN7 A;  4ELT A;  3OS2 A;  3KKS A;  3ZT3 A;  1LV5 A;  2PY5 A;  2GV9 A;  4DTN A;  1RT1 A;  1NKE A;  4OGC A;  1IKY A;  5DMR A;  4B8A B;  4CED A;  1DLO A;  3V9X A;  3T19 A;  1LAW A;  4HTU A;  2OPS A;  1NK6 A;  2X6S A;  4Z4E A;  1Y97 A;  3K57 A;  3HL8 A;  3MXM A;  2YNF A;  5J1E A;  2YNH A;  4FVM A;  4FJJ A;  4KHN A;  3LP3 A;  2YHB A;  2HND A;  4CJR A;  4DSE A;  4DSJ A;  1VSL A;  3QIO A;  3VQA A;  5EU7 A;  3V9S A;  3S3N A;  1C0U A;  1RT2 A;  3AVH A;  1S1W A;  4I2P A;  4CEZ A;  3TAR A;  4O44 A;  1XHX A;  2PYJ A;  3ISN C;  4AHR A;  4CJ4 A;  2X78 A;  3L2Q A;  3V1Q A;  3H08 A;  4DG1 A;  1FK9 A;  4B9V A;  4IBN A;  1TK8 A;  4ZTF A;  1SKW A;  1L3V A;  3MED A;  4DMN A;  3K59 A;  3NH2 A;  2OPR A;  1S6Q A;  3C6T A;  1HNI A;  1S1V A;  3IS9 A;  1S5J A;  3OYN A;  4JS5 A;  1W9H A;  4E7H A;  3CM5 A;  3C6U A;  3RRH A;  2FBT A;  3NDK A;  3DLG A;  3LZJ A;  4FLZ A;  4ICL A;  4CEA A;  1LW2 A;  2HHV A;  1D9F A;  3CFP A;  1C1C A;  1RBU A;  4M3R A;  3DM2 A;  3K5L A;  1BI4 A;  3VQQ A;  3VA0 A;  1VSI A;  4BDZ A;  3C95 A;  1K6Y A;  1JL1 A;  3AO3 A;  1RBR A;  1Q9Y A;  4OKJ A;  3AVK A;  2E6L A;  1JXE A;  1U45 A;  1LW0 A;  2VG7 A;  4FJ9 A;  3TAF A;  4KPY A;  1TL1 A;  3HXM A;  1U48 A;  3OYM A;  3VQE A;  4CJF A;  4F3T A;  2KFZ A;  4CGJ A;  2HHU A;  4B9U A;  4HCB A;  4R5P A;  3VQP A;  1KCF A;  1CZ9 A;  3P5J A;  2Q3S A;  3OJS A;  3B6P A;  3JSM A;  3PX4 A;  4B9N A;  2ITG A;  4DQI A;  4PY5 A;  4UQG A;  4M45 A;  1F21 A;  4BAC A;  1RBV A;  3TAM A;  5CZ2 A;  1HNV A;  3O3F A;  4F8R A;  3CM6 A;  4KO0 A;  3ZT4 A;  4CK2 A;  1XI1 A;  4C8O A;  5JS1 A;  2G8W A;  3F73 A;  1TVR A;  1BI4 B;  4LSL A;  1VSF A;  4RW7 A;  2HMI A;  3ULD A;  3HST B;  4CEE A;  3SUQ A;  4HHT A;  2YKN A;  3SQ4 A;  2QKB A;  5D3G A;  1RT3 A;  4GW6 A;  3RRG A;  1U47 A;  3OY9 A;  3NGY A;  4ELV A;  3KD1 E;  3NF6 A;  2KZM A;  4IFV A;  5HLF A;  4CF1 A;  3IAY A;  3MXJ A;  4J2D A;  3THV A;  1NJY A;  1X1P A;  2AJQ A;  1B9D A;  4J2E A;  1RTI A;  1U49 A;  2KQ2 A;  3P83 D;  2JGU A;  2KFN A;  4C8K A;  2HHS A;  3DOK A;  4CES A;  3VQ8 A;  3KD5 E;  3DOL A;  2F96 A;  3LP1 A;  1VSJ A;  1KRP A;  4BWJ A;  3SCX A;  4DQP A;  4DSK A;  2O4G A;  4TSX A;  1GOC A;  3AVM A;  1TKT A;  3RWU A;  1ASU A;  4NYF A;  3QER A;  4IDK A;  3G10 A;  4DTO A;  3KTQ A;  4KAZ A;  4I2Q A;  4KTQ A;  1RT6 A;  4FJL A;  1HQE A;  4E7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...