3BEXA

Type iii pantothenate kinase from thermotoga maritima complexed with pantothenate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 77
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bexA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bexA02
2IVOA 5AQUA 1YUWA 3F9MA 4PKGA 3JXUA 4H03B 1NGEA 5LJWA 3KVGA 2A41A 4B1YB 4CD3A 3H3OB 3MDQA 2DPNA 3D2FA 3DXKA 2P9UA 2ASPA 4BQLA 5BN8A 1BA0A 1HKCA 3MCPA 3WXIA 3MN5A 1NMDA 3CJAA 4CZEA 4BRHA 1TYQB 4ISFA 4WYBA 3BF3A 5AZJB 4DB3A 3VEXA 3FZFA 4PL7A 3CIPA 4FOEA 3SK3A 3IMXA 3SMPA 5EY4A 5EVZA 5AZIB 4RTFD 1LOTB 1G99A 2ZWHA 3UB5A 3ZETA 1DKGD 3ZX2A 3FZKA 2NZTA 1GLFO 4HTLA 3BUZB 2V7ZA 4H0TB 2V7YA 2P9IA 1NGIA 3HI0A 2P9PA 3CJCA 3FZLA 4HWIA 3H46O 3I33A 3M3ZA 3RSEB 5AQKA 1NGBA 4XH1A 2D0PA 3QB0A 1BOTO 1J6ZA 2D1KA 1BU6O 4B1UB 3HSCA 3SLCA 4BR9A 3MMVA 4H0VB 3LDQA 4YDUA 4B1XB 3O5BA 4XH5A 4WQ5A 1NBWA 4CZLA 3L0QA 5AQXA 2P9KA 3DAWA 3A5NC 3U9ZA 1IG8A 3C7NA 3O8MA 4B1VA 1KAZA 2D4WA 2W41A 3AY9A 1T44A 5E84A 4BGBA 4LC9B 1NGAA 2KHOA 3UKUA 4I6MB 2YJEA 3A5OC 2D0OA 3L6QA 4ISGA 4CZJA 4AM6A 5BPMA 4GY2B 4BRIA 2V52B 3ULEB 2A6AA 3CHWA 3QBXA 2A5XA 3WEEB 2Q1NA 2YI1A 4BRDA 1R59O 4O8KA 4A2AA 2CH6A 4CZFA 4WQ4C 5AQSA 4BVPA 1OKJA 3SJHA 3MN7A 1GLLO 2P9LA 4EAHD 3LDOA 5EOYA 2IVNA 4BRKA 4PKIA 3FZMA 2Q0UA 4RCHA 4BG8A 4IWVA 3WXLA 1LCUA 5I9EB 1Y64A 1IJJA 4C23A 3ZEUB 3VEWA 3P4IA 1Z05A 3LDLA 4JNEA 1NGGA 5FPMA 1HKBA 3D2EA 2VWBA 4JHDA 3GL1A 1ATNA 1RGIA 1S3XA 4RWTA 3VGMA 3B8AX 2E1YA 3OHRA 1WUAA 1RFQA 1QHAA 4JD2B 5E26A 1QZ6A 5AQLA 4EHTA 4A61A 2QWNA 2FLOA 4BR5A 1U2VB 2YJFA 3MN9A 1SZ2A 3O1WA 2FSJA 5ADXA 1U6ZA 4K25A 5BRDA 4FWKA 3UE5A 2YHXA 3VEOA 2FSKA 2VYPA 2GUPA 2OANA 4PL8A 5B8HA 5JLHA 5KPZA 1GLJO 4BQZA 3KZBA 4EHUA 3LM9A 1P8ZA 5BN9A 3DJCA 2QWOA 3HBTA 5EXWA 5BPLA 1CZAN 2IVPA 3ENOA 1TYQA 4CJ7A 3A5LC 4EFHA 5BPNA 4NO7A 4MO4A 3VEVA 5KPTA 2YHYA 4BR0A 1T6CA 3CJ9A 3SMSA 2CH5A 4ISEA 3AARA 2QWPA 4FWOA 1XUPO 4M7XA 1SAZA 3VETA 2CGKA 5AZIA 3D2FB 4CZGA 5KPRA 5AQNA 5AQMA 1NGHA 3CI5A 4DQ8A 3G25A 4Z94A 3CJ7A 2NRHA 4FO0A 4BRGA 4DHYA 5AQGA 4CZHA 1WOQA 3BEXA 4BRLA 3KHYA 2P9SB 5BRFA 3HZ6A 2ZGZA 2ZF5O 2QWQA 2HF3A 4MO5A 5AQYA 3W3DA 2PAVA 1ZBSA 3BF1A 3O4WA 1BWFO 5BREA 3ATVA 3AAPA 3LM2A 5TKYA 3GDQA 1E4GT 1BA1A 4B9QA 3FE1A 3ZETB 4J8FA 3VERA 1ATRA 1GLAG 3CJBA 1QQNA 4H0YB 1HKGA 5KQ8A 1HPMA 2IIRA 4JAXA 4BRQA 2P9NB 4CI6A 2E2OA 3WUHA 4H5TA 1MA9B 4K42A 3H45C 1YAGA 4H5WA 1JCFA 2E88A 3VOVA 2CGJA 3R6MA 3GG4A 3A5MC 3WT0A 4I6MA 2ASOA 3WQTA 3H1QA 3CQYA 3EZWA 3O80A 4QS9A 5AR0A 4BRPA 3ULEA 2BTFA 2I7PA 3H6EA 1HLUA 1GLDG 1X3MA 2Q2RA 3WEEA 3EKUA 1H1VA 2F9TA 1X3NA 3BP8A 2ITMA 4BR2A 4BVOA 4H5VA 2EWSA 3VGKA 4BROA 3UKRA 4A62A 1TUUA 3CETA 1T6DA 1GLBG 4AM7A 5JICA 3QDKA 4DCHA 1BDGA 5AQOA 5ADXH 1NM1A 4M7YA 3JS6A 2I7NA 4FPBA 5KQDA 4FWRA 4BREA 2E20A 3VF6A 3H3NO 4Y0WA 4BRMA 1NGJA 2Q0RA 3S41A 3W0LA 3DXMB 4YDUC 3U8XA 4PKHA 4WQ5C 3EL2A 4M63C 3C0BA 1XC3A 2QM1A 4FPAA 4JD2A 3AAQA 3HTVA 3QMLA 1ESVA 2BUPA 5AQRA 3O6WA 5AFUA 1K8KB 2HF4A 3L4IA 3QFPA 4GNIA 1U2VA 3O1BA 4FWLA 2PBDA 5LY3A 2VCPA 3VESA 1MDUB 2Q36A 3EN9A 3I8BA 4CZIA 3A8YA 5AQZA 1HX1A 2FSNA 1QZ5A 4BC3A 1RDWX 4NB4A 2GEMA 3TU5A 3ATUA 4H0PA 4K41A 5AQHA 2WUSA 3QICA 4IXCA 2QWMA 2ZGYA 2QW9A 5F1XA 4BC2A 4FSVA 4F9OA 5AZJA 4B1WB 1Q18A 4CBUA 1MWMA 2HOEA 4MLEA 3R8EA 5CE3A 5AQQA 2FXUA 5ELZA 4BRAA 1ATSA 2FF3B 3J8AA 4H5RA 1HJOA 2GELA 1C0GA 3IUCA 3VGLA 2W40A 5F0XA 3H1VX 5AQJA 3DXKB 3GBTA 2P9UB 2ASMA 4FWPA 3FZHA 2H3GX 3EO3A 4B1ZA 1ZXOA 4JN4A 4KBOA 5LJVA 4BC4A 1NWKA 3WXJA 3ID8A 2P9SA 3VENA 1DGKN 3TPQA 3GOIA 1NGDA 3O08A 4FWQA 2E2QA 3RSEA 4XEIA 2E1ZA 2YHWA 3DWLA 1XQSC 2J4RA 5AQIA 4BRNA 4BRCA 2GTDA 1BG3A 3M6GA 4FWSA 3VEYA 3WQUA 4L3QA 4WQ4A 4IZ9A 4QS8A 3R9PA 1NGCA 2P9NA 3CJ1A 1HUXA 2A3ZA 2P9IB 1QQMA 3QFUA 1D4XA 2P9PB 1GLCG 3ENHA 3QBWA 5FPEA 2Q31A 1QQOA 3LDPA 3IDHA 1GLEG 3VF4A 2GWJA 2AA4A 1ZC6A 3LL3A 4CBWA 1Z6RA 3FGUA 2E2NA 1S22A 4XH4A 4CZKA 2AP1A 2FF6A 3VEZA 4BG9A 3LDNA 2V51B 4QS7A 3VPZA 2HMPA 3ZX3A 2P9KB 1TUYA 3C7NB 1NGFA 4BRFA 2QWRA 5AFUH 2F9WA 4CBXA 2A42A 1JCGA 2GWKA 4BR7A 2A40A 3FLCO 3MN6A 5BRHA 1KAYA 1KAXA 3D7EO 5JLFA 5EX5A 3UKUB 3WXKA 1MWKA 4IO8A 5FPNA 3EKSA 5JMVA 1E4FT 1EQYA 2Q97A 5AQVA 3ZEUA 1BO5O 4H0XB 2QXLA 4IJNA 4CZMA 3CQXA 3DXMA 4BC5A 4K43A 3UKRB 5FPDA 3MK6A 2P9LB 2E8AA 5BR9A 4H5NA 3M1FA 4BGAA 2E2PA 1JCEA 5AQPA 3GE1A 1BUPA 1KXPA 4IJAA 1K8KA 4A2BA 5AQWA 1SQKA 4H0OA 3A0IX 3IFRA 3U9DA 3CERA 5F2RA 5AQFA 3D2EB 3FFKB 4JHDB 4MLHA 4FWNA 3FR0A 4FOIA 1C0FA 1YXQA 3VF2A 2QWLA 1X9JA 2CGLA 4O5FA 3U4LA 3ZX0A 1DEJA 3HM8A 1V4SA 1V4TA 4FL9A 1YVNA 2NLXA 4EIAA 2UYTA 5AQTA 4BR4A 4FWMA 1NLVA 4E1JA 2YCHA 4CD1A
chains in the Genus database with same CATH superfamily
4PWDA 2A41A 5DM7L 3C6TA 4IFEA 3MDQA 2DPNA 1RCHA 3JAMO 4KHSA 3VQ6A 1BA0A 5BN8A 3DLLL 4F2SA 1HKCA 3V9UA 1NMDA 3ZSWA 1UA1A 4BRHA 4DB3A 4WF9L 2JLEA 4CGJA 2HNZA 3CIPA 4CGGA 3CCQN 3CCLN 1XNQK 3K9JA 2NRRA 3P1GA 5EY4A 1RDBA 4FM1A 4DQSA 2HBLA 3AVNA 1ASUA 1DKGD 3B6PA 3FZKA 2NZTA 4DSEA 2OYQA 2EHGA 4JI0K 4H0TB 3NVMA 3WNEA 1BIZA 1NGIA 3CJCA 2O4GA 5A2QO 1XHZA 3CC2N 4OLBA 4DFPA 1JLEA 4DSFA 1Q81O 3SQ0A 3RSEB 1U45A 1QS4A 4XH1A 1FKPA 3NF7A 3KKSA 1BU6O 5BR8K 3SLCA 3MMVA 1N8RO 3OJSA 4ZHRA 4N47A 4WQ5A 4N5SA 4CZLA 2P9KA 3DAWA 3A5NC 4IFVA 4B1VA 5KGXA 3NVKA 2WBNA 4FVMA 4LC9B 4NCGA 3VQCA 2KHOA 1S1UA 2ETJA 3UKUA 4I6MB 2YJEA 2G8KA 3L6QA 4ISGA 4CZJA 1QTMA 3K9KA 5BPMA 4GV6A 4KTZA 1K8AO 3QBXA 4LH4A 2YI1A 3IG1A 1JLFA 4O8KA 4FM2A 2VG6A 1R0AA 2YKNA 2X6SA 3QO9A 4C1NI 1W9HA 4CGHA 1OKJA 2P9LA 5EOYA 3JYTA 1NK6A 3EZ5A 4XIUA 4RCHA 2YNIA 4IWVA 5I9EB 4GV3A 4BWJA 4CGIA 1KSPA 4FJJA 1IJJA 3SAFA 1ZBHA 4B9LA 4DU1A 2FBVA 4K0KK 5FPMA 2VWBA 4DFKA 2VWKA 1NKBA 3B8AX 1Q86O 1NJZA 1QHAA 3BZKA 3DYAA 4B3MK 1JLAA 3S3NA 2QWNA 2FLOA 2YJFA 2DTUA 3OYEA 3TTDA 1B9DA 3O1WA 1Z26A 4W5TA 3V9ZA 2VYPA 2E6LA 3QEPA 3I8DA 1NOYA 1VSFA 3KZBA 4EHUA 2PYLA 2QWOA 3Q7CA 5EXWA 4KO0A 4DV7K 5BPNA 4KB0A 3PY8A 3A5LC 1EETA 2HHXA 2YHYA 3SMSA 2OTLN 3NF9A 2QWPA 4E1NA 3O9QA 4M7XA 3VETA 3KK7A 2O8EB 5KPRA 1L3UA 5AQNA 4DFMA 2NRWA 4DQ8A 4Z94A 1N34K 3V1QA 4DHYA 4FO0A 4BRGA 1WBBA 4CZHA 4BRLA 1TK0A 3G10A 4E3SA 2QWQA 4DFJA 2HF3A 3W3DA 3I56N 3LAMA 5GIPA 1Q9XA 3KLFA 3PLAA 1KC8O 1B9FA 1CXQA 5HROA 3ZETB 1CXUA 2XY8A 1IKXA 1F21A 3JSMA 4CEQA 1QQNA 3E9LA 2KKZA 4BRQA 4CI6A 2E2OA 2G8FA 4KHWA 1HNIA 4KV8A 4RW6A 2HBMA 4CFBA 3GG4A 3WT0A 2RE2A 1HNZK 4DWIA 1T8EA 3EZWA 5AR0A 1XWLA 2RPIA 3SAGA 1HLUA 3WEEA 1H1VA 2HW3A 3T1HK 2HHUA 4KHNA 4BR2A 5JS1A 4BVOA 3NFAA 3V4IA 1XMOK 4DQPA 4B3TK 1NG9A 1A5XA 3G71N 3CETA 4E7JA 4FW2A 1GLBG 2O8BB 4DCHA 1BDGA 1Q82O 1LWFA 2BH1A 4CF0A 5HRNA 4IG0A 3QERA 1NM1A 4KHYA 3VQDA 4KH5A 3NAEA 2ZM6K 2I7NA 3NH1A 4FWRA 1KFDA 2E20A 3RRHA 4DQIA 2BDPA 4JI7K 1FJGK 1I3AA 1Q9YA 1XC3A 2QM1A 4FPAA 3SUOA 4JD2A 3CFOA 3AAQA 2BUPA 2YHBA 3O6WA 1YITN 1ZYQA 4CEDA 4FJ7A 3QFPA 1U2VA 2G8IA 1QSSA 4E0DA 3DLEA 1E3MA 2O8DB 1HYVA 2Q36A 5TKWA 4BDYA 3EN9A 4FYDA 3A8YA 4CJTA 1HX1A 4CFDA 2XY6A 1EXQA 3PIPL 2GEMA 3AA5X 2Y1JA 2X74A 4H0PA 3LZIA 3THYA 2QWMA 4CE9A 3OYLA 3ALYA 3CMAN 2QW9A 5F1XA 1JXBA 1MWMA 3R8EA 2FXUA 3QINA 4JI4K 1ATSA 4DTPA 2GELA 3VQ9A 4CK3A 3PO5A 4ELTA 1K6YA 3NGYA 2W40A 4GV9A 4DTOA 3H1VX 5AQJA 1REVA 4B3RK 3TAGA 2ASMA 3HSTB 3FZHA 4B1ZA 4F4KA 1ZXOA 1KQSM 1C0MA 1NGDA 3O08A 4BDZA 3EE9A 3RSEA 4AHCA 2E1ZA 3DWLA 2OPRA 4B9MA 1XQSC 4JS5A 4FWSA 3VEYA 4L3QA 5C42A 4FJGA 3RR8A 4QOZB 1RT4A 4ZTFA 3MXMA 2P9NA 3VQ7A 3RMDA 4CK1A 3WNHA 4AQYK 1D4XA 4N56A 1GLCG 1SKWA 1QQOA 3LDPA 1X9SA 3IDHA 1NK9A 4CERA 4JKAA 4IKFA 1WBDA 4XH4A 4CZKA 2AP1A 1Y97A 4HTUA 3VPZA 4QS7A 4L8RB 2PZSA 2O8FA 4N41A 3D6RA 3ZT0A 2P9KB 1NK0A 3AA4A 4DV1K 2YX6A 1NGFA 3CFRA 2KFNA 1SL0A 3HK2A 3FLCO 1VSIA 1UWBA 1VAZA 4DTJA 3UKUB 4RW8A 1SL1A 3NBPA 1RBVA 1VSJA 1EQYA 1VHXA 1YT3A 4C8KA 4H0XB 3T1YK 3EY1A 2QXLA 1M90O 3S3OA 1KTQA 3BGRA 4DUZK 1KLMA 3UKRB 4O44A 3MK6A 2P9LB 3L2WA 2E2PA 1JCEA 4PA1A 5AQPA 1NK5A 5KTQA 4A2BA 1SQKA 1O13A 3A0IX 4CF8A 1IH7A 4DG1A 2NRTA 3CERA 3KK3A 5AQFA 4CEBA 5M1PA 3ZSOA 4MLHA 4U67L 1U04A 1C0FA 3E9PA 3KLGA 1RDUA 1X9JA 4O5FA 3ZX0A 3HM8A 1V4SA 5KRTA 3SUNA 4JI1K 3V81A 1L5UA 5AQTA 1GOAA 4Y1CA 1NLVA 4AILC 4E1JA 1VSEA 2YCHA 2IVOA 4CFAA 3F9MA 5JVHL 1VQNN 4H03B 3O3HA 3L2VA 4B1YB 3DXKA 2P9UA 2W42A 2ASPA 3CPWM 3CCSN 3OBWA 3HM9A 1NJXA 3A2FA 4DR5K 4J2AA 4CZEA 3MX2A 4ISFA 5AZJB 3BF3A 2DFFA 2O4IA 2KZMA 1NU0A 1JXEA 2QKBA 1ZBLA 1WSIA 2KQ2A 3FFIA 4RTFD 3TTFA 1LOTB 4HVJA 4Z4CA 2ZWHA 2KZZA 3OTOK 3UB5A 4DR1K 3ZETA 4CJ4A 3CC4N 1OH8A 1GLFO 2XHBA 4FW1A 3DLRA 4CJWA 4JS4A 2V7YA 4DR3K 4H4MA 3FZLA 4HWIA 3L3VA 4MQ3A 2EX3A 1NGBA 2B4JA 3M8QA 1LAWA 3C95A 3SJJA 1J6ZA 3ITHA 2NNWA 1YF5L 3HSCA 1RBUA 3M8RA 5CZ1A 3T19A 4BE0A 3SQ2A 4FLVA 4CHYA 1NBWA 2VQEK 3PV8A 4MDBA 1IG8A 3O8MA 2HHQA 1U4BA 3LAKA 1TAUA 3NF8A 3AY9A 4A57A 3ZT4A 1FK9A 4FJNA 4FJXA 4JLHA 4DV2K 1BCMA 4H8KA 1WB9A 4AM6A 3TAQA 1X9WA 4W5QA 5I3UA 4K8XA 2A5XA 2YNFA 2Q1NA 3WEEB 4Z4FA 4FLXA 4CJPA 4I7FA 4A2AA 1IKWA 3HO1A 1RTHA 4ICLA 4CZFA 4WQ4C 5AQSA 3AO5A 3SJHA 2HHWA 3V9SA 4CJ3A 3KIOA 3PUFA 4CIEA 3FZMA 4I9QA 3WXLA 3VQBA 2JWKA 1Y64A 1X9MA 3LZJA 2VG7A 4C8OA 1JL2A 3ZEUB 2NRVA 3PX6A 4JNEA 1NGGA 4IFYA 4JHDA 4Z0UA 3P5JA 4G1QA 1S3XA 4RWTA 3P39A 1BHLA 4B08A 1WAJA 3OHRA 1B92A 1RFQA 4CJVA 3NH0A 4JD2B 4BACA 2WFBA 5E26A 4EHTA 2VGMA 3THWA 4G9ZA 1L3VA 2D5RA 1U2VB 3MN9A 3WNFA 2FSJA 1U6ZA 4K25A 3UE5A 4JKGB 2HVHA 5GIOA 1RBSA 5JLHA 3DLBA 5KPZA 1GLJO 1ZBFA 2F96A 3O9RA 3LM9A 4DTSA 4KHUA 3HBTA 3THYB 4W5NA 4WE1A 2IVPA 3NH2A 1TYQA 4DS5A 4MO4A 4M3YA 5KPTA 3M5RA 4BR0A 3CJ9A 4KTWA 3HYFA 4QCLA 5CR4A 3AARA 3VQQA 1XUPO 1SV5A 4AHVA 2CGKA 5AZIA 1D5AA 3D2FB 3L4QA 4CGFA 4FLYA 5AQMA 3CI5A 2NRHA 5AQGA 3O3FA 3KHYA 4DSJA 3QEXA 3HPOA 4O5BA 2F4VK 5C24A 5AQYA 3O4WA 4ID5A 4CEFA 4FVUA 2P51A 2UXDK 4IDKA 3LM2A 2G8VA 4OJRA 3FE1A 4J8FA 2HNYA 3VERA 2F8TA 4WFNL 5JVGL 1HPMA 2P9NB 3VA0A 2RKIA 3TI0A 1D8YA 1JJ2M 4NCBA 4DF8A 4HCCA 1MA9B 1VQ7N 3ZSXA 4CEOA 2E88A 1FXXA 1NJIO 2P1JA 1KLNA 2CGJA 3N4PA 1VQ5N 4M3TA 2ASOA 2XO7A 2E5LK 3O80A 3PSIA 3OA9A 2HMIA 5AJ3K 3CPEA 3ULEA 1RDCA 3DOLA 3EKUA 1NMNA 2O8FB 4E89A 3T3FA 2F9TA 2WC9A 3DLHA 1RT6A 1X3NA 3HT3A 4H4OA 4JKEA 3CM6A 3UKRA 3TAPA 5EU7A 3NDKA 1VQ4N 1A5VA 5C12A 2YKMA 3AVIA 4CJKA 3LWLA 5AQOA 3D0PA 5ADXH 3SBTA 1QHTA 3JS6A 3MEGA 4FPBA 1D9FA 3MECA 1FW6A 3I55N 4B9UA 4CHZA 3E1YA 4ELUA 1NGJA 2BE2A 3PIOL 5C0YA 3S41A 3W0LA 2RF2A 1BQNA 4PKHA 4GVEA 5SWMA 4R5PA 3EL2A 4IOXA 3IAYA 2LSNA 2QI2A 5AQRA 3QMLA 1NOZA 5AFUA 1S1XA 1RDAA 1RNHA 3O1BA 4M3ZA 2PBDA 1HR0K 1BGXT 4YOUA 1S1VA 4YOYA 1MDUB 4FJ5A 3AVHA 3TSUA 3K5MA 1YIJN 4BC3A 1EWQA 1RDWX 3DRRA 2PYJA 4FCYA 3TU5A 3M8SA 3ATUA 1XHXA 4GKKK 3OVNA 3SNNA 4Q0BA 4K41A 5AQHA 2WUSA 3QICA 2HHTA 1RTJA 3H08A 2ZGYA 1VK0A 3AVJA 2ZJQL 4FSVA 2WTUA 1ZBUA 4B1WB 5AZJA 3KTQA 4CF9A 2HOEA 4JEPA 4BRAA 3TR8A 2FF3B 3ZLJA 1TV6A 1T03A 4C8MA 1RT7A 5C2DA 4C8NA 2OPQA 3C6UA 4F2RA 5F0XA 4OPKA 3DXKB 3GBTA 3DLGA 4KAZA 2FBYA 2P9UB 4V19S 3ZSYA 4BC4A 1NWKA 3T7ZA 1KVBA 3VENA 1DGKN 3TPQA 2UXCK 5C15A 2GV9A 3P31A 4AH9A 3VQ8A 1QSLA 4FJHA 2J4RA 2ZD1A 3DRPA 2GTDA 5HOOA 5GAGP 3WQUA 1YTUA 2UUBK 4HHTA 4JK7A 4WQ4A 4QS8A 2UUCK 3O4QA 4LSLA 4X64K 4OKKA 1J54A 5HP1A 2GUIA 1S9EA 4BY9C 2ZJPL 1GLEG 3VF4A 1HNXK 2GWJA 3LDSA 1Z6RA 3FGUA 2FF6A 1DT9A 3LDNA 5M1OA 2V51B 3O9SA 1FKOA 1YHQN 2OPPA 3AVAA 2PY5A 1DTQA 1L3SA 2ITGA 1WSJA 1JCGA 2A42A 4CBXA 2A40A 4OPHA 1N33K 1KAYA 1KAXA 1RTIA 5EX5A 4NYFA 4CW7B 4IO8A 2B5JA 4FK4A 3QIPA 4CHNA 1E4FT 3ZEUA 4JKDA 3UIQA 2OA8A 3KK2A 1GOBA 1X1PA 3K5OA 4BC5A 1KFSA 3AV9A 3CFPA 4DR6K 4LH5A 4H5NA 4ILHA 2G8UA 2DY4A 3RMCA 3GE1A 1W0HA 4DU4A 5LMNK 4AHUA 5FRNA 4DQRA 3LP2A 3CCEN 3DRSA 3HP9A 3IFRA 4CVNE 4F3TA 1TGOA 3LPUA 5T7BA 1WSHA 2OCEA 4JKGA 4FLUA 3D45A 4JHDB 1LWEA 4R79A 3QEVA 3OYMA 4O0IA 5M1QA 3SZ2A 3BZCA 3FR0A 4FOIA 1TKDA 3VF2A 4IG3A 2CGLA 4OKEA 1SS6A 3THWB 4DTUA 3VQEA 5H1SQ 4BR4A 4FWMA 5M1KA 2Z1JA 5AQUA 1KRPA 2VQFK 3MWPA 3JXUA 4KREA 5LJWA 1NGEA 4PHTX 3KVGA 2QA4N 3H3OB 4JKFA 3D2FA 4BWMA 1XNRK 2FC0A 1OH7A 2GX9A 1TKTA 3CJAA 1TYQB 4WYBA 3VEXA 4PL7A 2A1SA 3C6HA 4FOEA 1VQKN 3HOTA 1TAQA 3IMXA 1Q7YO 5C10A 3SMPA 3O9UA 4FZYA 5EVZA 5AZIB 2ATQA 1YI2N 3J7YP 4CCHA 1YJWN 1IKVA 3U3GA 1S72N 1RTDA 2YNGA 2DFHA 1WN7A 3BUZB 2V7ZA 4CJQA 4CGDA 4KTQA 2P9IA 3KK1A 3RMAA 1N5YA 1TL1A 2UU9K 3KLEA 3MEDA 3I33A 4JKCA 4X62K 1XC9A 1IBMK 5AQKA 1TVRA 3K59A 4AHTA 5LMUK 3OYJA 4LF4K 4FJMA 4BR9A 4H0VB 3LDQA 4AHRA 3O5BA 5CHIA 4M3XA 4FM0A 3LANA 2XRIA 4XH5A 1SKRA 5J2NA 3SPYA 1VQMN 3L0QA 5AQXA 1SUQA 3S3MA 4B8CA 4CEZA 4ILGB 5E84A 1NGAA 3U3YA 4KH6A 4BRIA 3ULEB 2A6AA 3CHWA 3O9TA 3J7AP 3N4QA 4BRDA 1R59O 4KRFA 2DFEA 4OLAA 3AVFA 3OYNA 3MN7A 1GLLO 3MEEA 1C1AA 5J2PA 4PKIA 2B6AA 4JKHA 2KFZA 4LSNA 4RW7A 1LCUA 3DI6A 5MLCQ 4KFBA 1KCFA 4CJRA 3VEWA 3P4IA 3SCXA 1UA0A 1T05A 3EE8A 3D2EA 1ATNA 3MXJA 1RGIA 4FJLA 2KLAA 2E1YA 1WUAA 3SPZA 3L2QA 2HHVA 1JKHA 5IWAK 1QZ6A 5AQLA 4KHPK 5J2MA 3AGRA 3L3UA 4KI4A 4BR5A 4UY8O 4Z4IA 1JLGA 1SZ2A 3OYDA 1NKCA 3TSQA 4FWKA 4YORA 2FSKA 2OANA 3S9HA 4OGCA 4IOAL 3NE6A 5HLFA 3DJCA 1NK7A 3MWTA 4J2DA 4CJFA 4IBNA 3QIOA 3ENOA 4EFHA 3EYZA 3TABA 4NO7A 3DLKA 2IGIA 3BY5A 2CH5A 4DSKA 4A59A 3RWUA 1SAZA 4FZZA 3I0RA 1VSHA 3P83D 4J2EA 2OPSA 3TWHA 2RN2A 3CYMA 3HL8A 3V1RA 3AVCA 1CZ9A 5BRFA 3HZ6A 3PX4A 1NK8A 1WSEA 1ZBSA 2WONA 5CY4A 3PO4A 3AAPA 3VMFB 1DLOA 1S1WA 4FK2A 1IO2A 2P5OA 1BA1A 4B9QA 4J2BA 1ATRA 1WLJA 1GLAG 3CJBA 1BI4B 3MXIA 1WNSA 2VG5A 1HKGA 4H0YB 5HRRA 3AVKA 4CEEA 5KQ8A 3AA3A 4JAXA 3WNGA 5FRMA 4IEEA 3WUHA 3F73A 3SQ4A 2O8CB 4K42A 1NNEA 3H45C 1YAGA 2X6NA 4H5WA 4OPJA 1JCFA 3VOVA 3U6FA 4W5OA 3A5MC 1QVGM 3G6EN 1T3VA 4EP5A 3VA3A 3H1QA 4QS9A 4BDPA 1HYSA 2QK9A 1YJ9N 1X3MA 4CJEA 3CG7A 1NKEA 1QQCA 2KTQA 3RTVA 3BP8A 3CQ8A 4I9LA 2ITMA 4H5VA 5CYMA 2EWSA 3ISNC 4CIFA 4DR4K 4OVLA 2JGUA 4BROA 1IBKK 1TUUA 1VRUA 1T6DA 3AA2A 4EP4A 5JICA 4KPYA 3NGZA 1U48A 4RW4A 4M7YA 3IS9A 5CZ2A 5E41A 1VQ6N 4LFCK 5KQDA 1K9MO 1TKZA 1IG9A 3MX5A 1HMVA 1C0TA 1VSLA 2Q0RA 4Y0WA 3AVGA 4YDUC 3U8XA 2Q3SA 1DTTA 4DR7K 2NRXA 4JRQA 4TSXA 4OO1J 3C0BA 3Q7BA 3SBGA 2XY5A 4PQUA 4JI2K 1VRTA 2HHSA 3K57A 3SUQA 5HRSA 4HCBA 2HF4A 3AVBA 4GNIA 3WXMB 3RR7A 4FWLA 5LY3A 1RBTA 4KB1A 1N32K 4HUGA 1HYZA 1XI1A 3VESA 3HPHA 4B9SA 1U49A 1RILA 4F8RA 4CZIA 5C2FA 3ULDA 1VSDA 5AQZA 2A1RA 2FSNA 3ZCMA 1SL2A 4NB4A 1XMQK 4N76A 4DV0K 1WSGA 1A5WA 3SV3A 1VQON 4OGEA 4IXCA 3KWIA 1IV0A 2HBKA 3TAMA 2NRZA 4BC2A 3G4SN 3QNNA 4CBUA 4MLEA 5CE3A 1T7PA 5AQQA 1HNVA 4LY7A 4AHSA 4H5RA 3CCMN 3IUCA 4NLCA 3VGLA 4BE2A 4BE1A 2H3GX 5LJVA 1RT3A 3ID8A 2P9SA 4RG8A 3GOIA 4FWQA 1BCOA 1QVFM 1JLBA 3HJFA 4XEIA 3NCIA 1LV5A 4JI5K 3M8PA 1BG3A 1HQUA 2YV0X 5GINA 3SUPA 4NCAA 3QEIA 3VTIA 3AVMA 4O4GA 3R9PA 1NGCA 2AJQA 5FLXO 1HUXA 2A3ZA 2P9IB 4JK8A 5KGWA 1C1CA 1J5OA 1JLQA 3ENHA 3QBWA 1LAVA 5FPEA 2AA4A 1J53A 4CBWA 3OS2A 1O1WA 3HP6A 1M1KO 4W5RA 3QNOA 3VEZA 1HQEA 1QE1A 2HMPA 3ZX3A 5HRPA 3PSFA 1TUYA 1YVUA 2FBTA 4BRFA 2F9WA 2GWKA 1NJWA 5M1NA 4DV6K 5BRHA 1P90A 1EO1A 3D7EO 1OH6A 3L2UA 3WXKA 1MWKA 4M42A 1BIUA 4O0JA 4DQQA 5FPNA 4YHHK 4ID1A 1S6QA 3BDPA 4B9NA 3SAHA 3OYCA 4YY3K 4B3OA 1BO5O 4NXNK 4ELVA 3O3GA 2FBXA 5SZTA 4DV5K 1TK5A 1C1BA 4IJNA 2GBZA 4CZMA 3CQXA 2HB5A 1CZBA 3DXMA 5FPDA 3OJUA 2E8AA 4O55A 2QEXN 4BGAA 4YOWA 4NYNA 4CIGA 4KI6A 3SYZA 1BUPA 4B9TA 5CYQA 1KXPA 4IJAA 1K8KA 3LPTA 5AQWA 4IDHA 1EP4A 5C25A 1HRHA 4JYAK 1J5EK 1QSYA 4FJIA 3EEQA 3OBYA 5F2RA 1NK4A 1GOCA 3D2EB 3FFKB 1I39A 4CFCA 3VQ4A 5GAEP 4Z4EA 1BISA 3PX0A 4LF6K 3HVRA 3C65A 2E6MA 2IS3A 5KRSA 1YXQA 3U4LA 3V1OA 4CHOA 4X65K 1W97L 3CC7N 4FL9A 3C6AA 4YNQA 1YVNA 2NLXA 4EIAA 4Y1DA 4KHQA 3E9OA 2UYTA 2Z1GA 4E7HA 4FJ9A 4CD1A 1YUWA 3DOKA 3L8BA 1MU2A 4PKGA 3DM2A 3C94A 1BQMA 5D3GA 3RMBA 3ID6A 2HBJA 4CD3A 4DTRA 4DV4K 1ITGA 4BQLA 3OS1A 3OYAA 3E01A 3MCPA 1WSFA 3WXIA 3MN5A 3VQAA 1HNWK 3FZFA 3R1XA 3ZT2A 3SK3A 4DU3A 1VQLN 4DR2K 4C8LA 3OYIA 1G99A 2UXBK 4LD0A 3ZX2A 5DK5A 5GAHP 1BI4A 4HTLA 3QESA 3VQPA 3CM5A 1C0UA 2F8SA 2OZSA 4RW9A 3J7ZO 3HI0A 2P9PA 5JS2A 3TTCA 2BGGA 2O8CA 3OYGA 3H46O 1OVYA 4WCEL 3M3ZA 3SQ1A 5K14A 1JL1A 2D0PA 3QB0A 1BOTO 2D1KA 4B1UB 1LW0A 1KVCA 4YDUA 4B1XB 1EWRA 4MFBA 3TAEA 4M3RA 4C1NK 1KVAA 3U9ZA 3C7NA 4AF1A 1RBRA 1KAZA 2HVIA 2D4WA 2W41A 1TK8A 4WFAL 4ZTJA 2D0CA 1T44A 4BGBA 4DS4A 2P5GA 3A5OC 4LF8K 2D0OA 1D9DA 4YOTA 4GY2B 2V52B 3OYFA 4FK0A 4E19A 4IEIA 2CH6A 4CF2A 1YJNN 3THXA 4M41A 4BVPA 1RT2A 2ZJRL 3ENBA 4EAHD 3LDOA 2IVNA 4JI8K 4BRKA 2Q0UA 1U47A 4BG8A 4UQGA 2E4LA 4B8AB 2W6KA 1W7AA 4C23A 3NHGA 4FLWA 4B3SK 4KKOA 1Z05A 1N6QA 3AGKA 3LDLA 4X66K 4GKJK 2HHHK 1HKBA 1IBLK 1BL3A 3GL1A 2IOCA 4U7BA 3VGMA 3SV4A 5J1EA 4FLTA 5FDLA 2D0BA 1NJYA 4A61A 2ZQBA 1LW2A 3K5LA 4Z4GA 1S5JA 3ZSZA 5ADXA 5BRDA 3F5TA 2IAJA 2YHXA 4O8UA 1HPZA 3VEOA 1RT1A 4PL8A 2GUPA 5B8HA 3IRXA 1RDDA 4BQZA 3G0ZA 4OKJA 4JRPA 1P8ZA 5BN9A 4DTXA 2VWJA 3VQ5A 3K0SA 4LF7K 5BPLA 1YTAA 5KI6A 1CZAN 5M1FA 4CJ7A 4DTNA 1EKEA 4FJKA 3VEVA 4CESA 1T6CA 3ZSVA 3CF5L 4ISEA 2QTDA 2QXFA 3CCRN 4FWOA 1KD1O 3K58A 3O4NA 4EZ9A 1L3TA 4CZGA 2OZMA 3NGIA 1NGHA 1UAXA 4PY5A 3AVLA 3G25A 3P38A 3CJ7A 4I2PA 1S1TA 1WOQA 3BEXA 3VTHA 4NLBA 3CXCM 2P9SB 4JI6K 2ZGZA 2ZF5O 4MO5A 2R7YA 2PAVA 3OYHA 3BF1A 1BWFO 5BREA 3ATVA 4F3OA 3T69A 1OH5A 5TKYA 3KD5E 3GDQA 3KD1E 1E4GT 2UUAK 4A5BA 3V9WA 2YHAA 5LL6Z 4DMNA 2W6LA 2IIRA 3E66A 2JWLA 1TL3A 3RRGA 4GVMA 4LFAK 4H5TA 5GADP 3KWGA 3T1AA 4WFBL 2HSTA 2IC3A 1ZBIA 4HUFA 4CJLA 1C6VA 3R6MA 3MAQA 4I6MA 2XY7A 3WQTA 3CQYA 3AO4A 4BRPA 3J80O 4OX9K 2BTFA 2I7PA 3H6EA 4Q5VA 3V9XA 1GLDG 2Q2RA 3I0SA 3RVCA 5DM6L 1ASWA 2ZE2A 3CCUN 4CHPA 4FJ8A 5J2QA 3F2KA 1EX4A 4DLEA 3VGKA 4HUEA 4DLGA 4A62A 4CK2A 1K73O 4AM7A 3QDKA 1VQ9N 1SKSA 2F7TA 3KKRA 3HVTA 2Z1IA 4M3WA 4BREA 2HNDA 3OYKA 2OTJN 3HPGA 3VF6A 3THVA 3H3NO 4BRMA 2PFUA 3DXMB 4QAGA 3CCVN 4WQ5C 1LWCA 2RHKA 4M63C 3ASMA 1OVQA 3HTVA 1ESVA 1TKXA 1K8KB 1G15A 3QEWA 3L4IA 4CJUA 2G8WA 2VCPA 3QLHA 3L2RA 4FZXC 3LALA 3I8BA 4NXMK 1Q8IA 4DKWA 1QZ5A 3ZT3A 1Z25A 4YOVA 4ILJA 1VSMA 3CD6N 4IOCL 4E1MA 4YOXA 1VSKA 3ZYYX 4JKBA 4F9OA 3K5NA 1Q18A 4GW6A 1HJRA 3OS0A 5ELZA 3J8AA 1HJOA 1UOCA 1C0GA 3NF6A 3AO2A 2KW4A 3B6OA 2O8EA 4DUYK 4GMJB 1ILYA 3TANA 4FWPA 2X78A 3EO3A 3NMUA 4JN4A 1S6PA 4KBOA 2VGNA 1I94K 2NUBA 3KLHA 3WXJA 3KLIA 4IO9L 3VN5A 2QKKA 3K2PA 1ASVA 5DMRA 1S9GA 3HXMA 4M45A 2E2QA 2YHWA 5AQIA 4BRNA 4BRCA 3M6GA 1CLQA 3LWMA 4IZ9A 3OY9A 1W2BM 4EZ6A 3KJVA 5HBMA 3CJ1A 4DSIA 2BANA 3SI6A 1QQMA 3QFUA 1JLCA 2P9PB 3QETA 4LF5K 2Q31A 4JI3K 3TARA 1ZC6A 3LL3A 5IT9O 1IKYA 2Z1HA 3HRGA 2G8HA 4M3UA 2E2NA 4K8ZA 1S22A 4BG9A 2WOMA 5I42A 3OW2M 4OPAA 4DTMA 3ZT1A 4FXDA 3HOSA 4DF4A 3C7NB 3ZSQA 4CEAA 3CCJN 4E7LA 4YFUA 2QWRA 5AFUH 4DSLA 3AO3A 4BR7A 5HL7L 2O8BA 3MN6A 4LF9K 4LFBK 4MDAA 5JLFA 4I2QA 4FLZA 3ZSRA 4E7IA 3OYBA 4CHQA 3EKSA 1WAFA 5JMVA 4CECA 2Q97A 5AQVA 1J9AA 4CF1A 3AO1A 3IKMA 1VQ8N 3THXB 2D0AA 2YNHA 4K43A 3CMEN 4JV5K 3MCAB 2Y1IA 5BR9A 3M1FA 2IDOA 1RT5A 4B9VA 3V6DA 1VQPN 2I5JA 3J81O 3LP1A 4JK9A 4H0OA 3F9KA 2O8DA 3U9DA 4Z4HA 3R3LA 3TAFA 4E7KA 4FWNA 4PUOA 4DV3K 3LP0A 5FROA 4A5AA 3TSPA 2QWLA 4KH4A 4CJ5A 1DEJA 1V4TA 4CJSA 3LP3A 1N36K 3DMJA
chains in the Genus database with same CATH topology
2IVOA 5AQUA 1YUWA 3F9MA 4PKGA 5JVHL 3MWPA 3JXUA 1VQNN 4H03B 1NGEA 4PHTX 3KVGA 2A41A 3ID6A 5LJWA 2QA4N 2HBJA 5DM7L 4IFEA 4B1YB 4CD3A 3H3OB 4JKFA 3MDQA 2DPNA 3D2FA 3DXKA 2P9UA 3CPWM 2ASPA 4BQLA 5BN8A 1BA0A 3CCSN 3DLLL 3OBWA 2GX9A 1HKCA 3MCPA 3WXIA 3MN5A 1NMDA 3CJAA 4CZEA 3MX2A 4BRHA 1TYQB 4ISFA 4WYBA 3BF3A 5AZJB 4DB3A 4WF9L 3VEXA 3FZFA 4PL7A 3C6HA 3CIPA 3R1XA 3CCQN 4FOEA 3SK3A 1VQKN 3HOTA 1VQLN 3CCLN 3IMXA 3K9JA 5C10A 2NRRA 1Q7YO 3SMPA 5EY4A 3O9UA 2HBLA 5EVZA 5AZIB 4RTFD 3TTFA 1YI2N 1LOTB 1G99A 2ZWHA 3UB5A 3ZETA 1DKGD 3ZX2A 3FZKA 2NZTA 3CC4N 1YJWN 5GAHP 1GLFO 1S72N 4HTLA 3BUZB 2V7ZA 4H0TB 2V7YA 3NVMA 2P9IA 1NGIA 3J7ZO 3HI0A 2P9PA 3TTCA 3CJCA 3FZLA 4HWIA 3CC2N 3H46O 1OVYA 3I33A 4WCEL 1Q81O 4JKCA 3M3ZA 3RSEB 5AQKA 1NGBA 4XH1A 2D0PA 3QB0A 1BOTO 1J6ZA 2D1KA 1BU6O 2NNWA 4B1UB 1YF5L 3HSCA 3SLCA 4BR9A 3MMVA 4H0VB 3LDQA 4YDUA 4B1XB 3O5BA 5CHIA 1N8RO 4XH5A 4WQ5A 1NBWA 4CZLA 1VQMN 3L0QA 5AQXA 2P9KA 4MDBA 3DAWA 4C1NK 3A5NC 3U9ZA 1IG8A 3C7NA 3O8MA 4AF1A 4B1VA 1KAZA 3NVKA 2D4WA 2W41A 4WFAL 3AY9A 2WBNA 1T44A 4ILGB 5E84A 4LC9B 1NGAA 4A57A 4BGBA 2KHOA 3UKUA 4I6MB 2YJEA 3A5OC 2D0OA 3L6QA 4ISGA 4CZJA 4AM6A 3K9KA 4KH6A 4GY2B 4YOTA 5BPMA 4GV6A 4BRIA 2V52B 3ULEB 1K8AO 2A6AA 3CHWA 3O9TA 3QBXA 3N4QA 2A5XA 3WEEB 2Q1NA 2YI1A 4BRDA 1R59O 4O8KA 4A2AA 4IEIA 2CH6A 1YJNN 4C1NI 4CZFA 4WQ4C 5AQSA 4BVPA 1OKJA 2ZJRL 3SJHA 3MN7A 3ENBA 1GLLO 2P9LA 4EAHD 3LDOA 5EOYA 2IVNA 4BRKA 4PKIA 3FZMA 2Q0UA 4RCHA 4BG8A 4JKHA 4IWVA 3WXLA 1LCUA 5I9EB 4GV3A 2JWKA 1Y64A 5MLCQ 1IJJA 3SAFA 4C23A 3ZEUB 3VEWA 3P4IA 1Z05A 2NRVA 3AGKA 3LDLA 4JNEA 1NGGA 3EE8A 5FPMA 1HKBA 3D2EA 2VWBA 4JHDA 3GL1A 1ATNA 4U7BA 1RGIA 1S3XA 4RWTA 2KLAA 3P39A 3VGMA 3B8AX 2E1YA 3OHRA 1WUAA 1Q86O 1RFQA 1QHAA 4JD2B 2WFBA 1QZ6A 5E26A 2VGMA 5AQLA 4A61A 4EHTA 4G9ZA 2QWNA 3AGRA 2FLOA 4BR5A 1U2VB 2YJFA 3MN9A 4UY8O 1SZ2A 3TTDA 3O1WA 2FSJA 5ADXA 3TSQA 1U6ZA 4K25A 5BRDA 4FWKA 3F5TA 4YORA 3UE5A 4JKGB 4O8UA 2YHXA 5GIOA 3VEOA 2FSKA 2VYPA 2GUPA 2OANA 4PL8A 5B8HA 5JLHA 5KPZA 1GLJO 4BQZA 3KZBA 4EHUA 4IOAL 3O9RA 3LM9A 1P8ZA 5BN9A 3DJCA 2QWOA 3HBTA 3Q7CA 3MWTA 5EXWA 5BPLA 1CZAN 2IVPA 3ENOA 1TYQA 4CJ7A 3A5LC 4EFHA 5BPNA 4NO7A 4MO4A 5M1FA 3VEVA 3M5RA 5KPTA 2YHYA 4BR0A 1T6CA 3CJ9A 3SMSA 3CF5L 2OTLN 2CH5A 5CR4A 4ISEA 3AARA 2QTDA 2QWPA 4A59A 3CCRN 4FWOA 1XUPO 3O9QA 4M7XA 1SAZA 3VETA 1KD1O 2CGKA 5AZIA 3KK7A 3D2FB 4CZGA 3L4QA 5KPRA 5AQNA 5AQMA 1NGHA 3CI5A 2NRWA 3G25A 3P38A 4DQ8A 4Z94A 3CJ7A 2NRHA 4FO0A 4BRGA 4DHYA 5AQGA 4CZHA 1WOQA 3BEXA 4BRLA 3VTHA 4NLBA 3KHYA 3CXCM 2P9SB 5BRFA 3HZ6A 2ZGZA 2ZF5O 2QWQA 2HF3A 4MO5A 5AQYA 3W3DA 2PAVA 1ZBSA 3BF1A 3O4WA 5GIPA 1BWFO 3I56N 5BREA 3ATVA 4FVUA 3AAPA 3VMFB 3T69A 3PLAA 3LM2A 5TKYA 1KC8O 3GDQA 1E4GT 1BA1A 4B9QA 3FE1A 3ZETB 4J8FA 3VERA 4A5BA 1ATRA 1GLAG 3CJBA 4WFNL 5JVGL 1QQNA 3E9LA 4H0YB 1HKGA 2KKZA 5KQ8A 1HPMA 2IIRA 4JAXA 4BRQA 2P9NB 3E66A 2JWLA 4CI6A 2E2OA 4IEEA 1JJ2M 3WUHA 4H5TA 5GADP 1MA9B 3KWGA 1VQ7N 4K42A 3H45C 4WFBL 1YAGA 4H5WA 1JCFA 2E88A 2HSTA 2HBMA 1NJIO 3VOVA 2CGJA 3N4PA 3R6MA 1VQ5N 3GG4A 3A5MC 3WT0A 2RE2A 4I6MA 3G6EN 1T3VA 2ASOA 1QVGM 3WQTA 3H1QA 3CQYA 3EZWA 3O80A 4QS9A 5AR0A 4BRPA 3OA9A 3SAGA 3CPEA 1YJ9N 3ULEA 2BTFA 2I7PA 3H6EA 1HLUA 1GLDG 1X3MA 2Q2RA 3WEEA 3EKUA 1H1VA 3RVCA 5DM6L 3CCUN 2F9TA 2WC9A 3F2KA 1X3NA 3BP8A 2ITMA 4BR2A 4BVOA 4H5VA 2EWSA 4JKEA 3VGKA 4BROA 3UKRA 4A62A 1TUUA 3CETA 1T6DA 3G71N 1GLBG 1K73O 1VQ4N 4AM7A 5JICA 3QDKA 4DCHA 5C12A 1VQ9N 1BDGA 1Q82O 2BH1A 5AQOA 2ZJQL 5ADXH 1NM1A 2F7TA 3SBTA 4M7YA 4KH5A 3JS6A 1VQ6N 2I7NA 4FPBA 5KQDA 4FWRA 4BREA 3I55N 2OTJN 1K9MO 2E20A 3VF6A 3E1YA 3H3NO 3MX5A 4Y0WA 4BRMA 1NGJA 2Q0RA 3PIOL 2PFUA 5C0YA 3S41A 3W0LA 3DXMB 4YDUC 3U8XA 4PKHA 2NRXA 4GVEA 3CCVN 4WQ5C 3EL2A 4IOXA 2RHKA 4M63C 4OO1J 3C0BA 3Q7BA 3SBGA 1XC3A 2QM1A 4FPAA 2QI2A 4JD2A 3AAQA 3HTVA 3QMLA 1ESVA 2BUPA 5AQRA 3O6WA 1YITN 5AFUA 1K8KB 2HF4A 3L4IA 3QFPA 4GNIA 1U2VA 3WXMB 3O1BA 4FWLA 2PBDA 5LY3A 4YOUA 2VCPA 3VESA 4YOYA 1MDUB 2Q36A 5TKWA 3EN9A 3I8BA 4CZIA 5C2FA 3A8YA 5AQZA 4DKWA 1HX1A 2FSNA 1QZ5A 3TSUA 1YIJN 4BC3A 3PIPL 1RDWX 4YOVA 4NB4A 4ILJA 2GEMA 3TU5A 3ATUA 3CD6N 4IOCL 1VQON 4H0PA 4K41A 5AQHA 2WUSA 3QICA 4IXCA 2QWMA 3CMAN 3KWIA 4YOXA 3ZYYX 2HBKA 2ZGYA 2NRZA 2QW9A 5F1XA 4JKBA 4FSVA 4BC2A 4F9OA 5AZJA 4B1WB 3G4SN 1Q18A 4CBUA 1MWMA 2HOEA 4JEPA 4MLEA 3R8EA 5CE3A 5AQQA 2FXUA 5ELZA 4BRAA 1ATSA 2FF3B 3J8AA 4H5RA 1HJOA 2GELA 1C0GA 3CCMN 3IUCA 4NLCA 3VGLA 2W40A 5C2DA 4GV9A 1ILYA 5F0XA 3H1VX 5AQJA 3DXKB 3GBTA 2P9UB 2ASMA 4FWPA 3FZHA 2H3GX 3EO3A 4B1ZA 3NMUA 1ZXOA 4JN4A 4KBOA 5LJVA 2VGNA 1KQSM 4BC4A 1NWKA 3T7ZA 3WXJA 3ID8A 2P9SA 3VENA 1DGKN 3TPQA 3GOIA 5C15A 4IO9L 1NGDA 3O08A 3P31A 4FWQA 3EE9A 1QVFM 2E2QA 3RSEA 4XEIA 2E1ZA 2YHWA 3DWLA 1XQSC 2J4RA 5AQIA 4BRNA 4BRCA 2GTDA 1BG3A 3M6GA 4FWSA 5GAGP 3VEYA 3WQUA 5GINA 5HOOA 3VTIA 4L3QA 4JK7A 4WQ4A 1W2BM 4IZ9A 4QS8A 3R9PA 1NGCA 2P9NA 3CJ1A 1HUXA 2A3ZA 2P9IB 4JK8A 1QQMA 3QFUA 1D4XA 2P9PB 1GLCG 3ENHA 3QBWA 5FPEA 4BY9C 2Q31A 1QQOA 3LDPA 2ZJPL 3IDHA 1GLEG 3VF4A 2GWJA 2AA4A 1ZC6A 3LL3A 4CBWA 1Z6RA 3HRGA 4JKAA 1M1KO 3FGUA 2E2NA 1S22A 4XH4A 4CZKA 2AP1A 2FF6A 3VEZA 4BG9A 1DT9A 3LDNA 5M1OA 2V51B 3O9SA 4QS7A 3VPZA 3OW2M 4OPAA 2HMPA 1YHQN 3HOSA 3D6RA 3ZX3A 2P9KB 1TUYA 3C7NB 2YX6A 1NGFA 3CCJN 4BRFA 2QWRA 5AFUH 2F9WA 4CBXA 2A42A 1JCGA 2GWKA 4BR7A 5HL7L 2A40A 3FLCO 4OPHA 3MN6A 5M1NA 5BRHA 1P90A 1EO1A 1KAYA 1KAXA 1VAZA 3D7EO 4MDAA 5JLFA 5EX5A 3UKUB 3WXKA 1MWKA 4IO8A 5FPNA 3EKSA 5JMVA 1E4FT 1EQYA 2Q97A 5AQVA 3SAHA 3ZEUA 4JKDA 1BO5O 3IKMA 4H0XB 1VQ8N 1M90O 2QXLA 4IJNA 4CZMA 3CQXA 3DXMA 4BC5A 4K43A 3UKRB 5FPDA 3MK6A 2P9LB 2E8AA 3CMEN 3MCAB 5BR9A 4H5NA 3M1FA 4ILHA 4BGAA 2E2PA 1JCEA 4YOWA 5AQPA 2QEXN 3GE1A 1BUPA 1KXPA 4IJAA 1K8KA 1VQPN 4A2BA 5AQWA 1SQKA 4IDHA 4JK9A 3CCEN 4H0OA 1O13A 3A0IX 3IFRA 3U9DA 2NRTA 3CERA 3OBYA 3R3LA 5F2RA 5AQFA 4JKGA 5M1PA 3D2EB 3FFKB 4JHDB 4MLHA 4R79A 4FWNA 5GAEP 5M1QA 3C65A 4U67L 3FR0A 4FOIA 1C0FA 1YXQA 3VF2A 3E9PA 4A5AA 1RDUA 3TSPA 2QWLA 1X9JA 2CGLA 4KH4A 4O5FA 3U4LA 3ZX0A 1DEJA 3CC7N 1W97L 1V4SA 3HM8A 1V4TA 1SS6A 3C6AA 4FL9A 1YVNA 2NLXA 4EIAA 3E9OA 2UYTA 5H1SQ 5AQTA 4BR4A 4FWMA 5M1KA 1NLVA 4E1JA 2YCHA 4CD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IVO A;  5AQU A;  1YUW A;  3F9M A;  4PKG A;  3JXU A;  4H03 B;  1NGE A;  5LJW A;  3KVG A;  2A41 A;  4B1Y B;  4CD3 A;  3H3O B;  3MDQ A;  2DPN A;  3D2F A;  3DXK A;  2P9U A;  2ASP A;  4BQL A;  5BN8 A;  1BA0 A;  1HKC A;  3MCP A;  3WXI A;  3MN5 A;  1NMD A;  3CJA A;  4CZE A;  4BRH A;  1TYQ B;  4ISF A;  4WYB A;  3BF3 A;  5AZJ B;  4DB3 A;  3VEX A;  3FZF A;  4PL7 A;  3CIP A;  4FOE A;  3SK3 A;  3IMX A;  3SMP A;  5EY4 A;  5EVZ A;  5AZI B;  4RTF D;  1LOT B;  1G99 A;  2ZWH A;  3UB5 A;  3ZET A;  1DKG D;  3ZX2 A;  3FZK A;  2NZT A;  1GLF O;  4HTL A;  3BUZ B;  2V7Z A;  4H0T B;  2V7Y A;  2P9I A;  1NGI A;  3HI0 A;  2P9P A;  3CJC A;  3FZL A;  4HWI A;  3H46 O;  3I33 A;  3M3Z A;  3RSE B;  5AQK A;  1NGB A;  4XH1 A;  2D0P A;  3QB0 A;  1BOT O;  1J6Z A;  2D1K A;  1BU6 O;  4B1U B;  3HSC A;  3SLC A;  4BR9 A;  3MMV A;  4H0V B;  3LDQ A;  4YDU A;  4B1X B;  3O5B A;  4XH5 A;  4WQ5 A;  1NBW A;  4CZL A;  3L0Q A;  5AQX A;  2P9K A;  3DAW A;  3A5N C;  3U9Z A;  1IG8 A;  3C7N A;  3O8M A;  4B1V A;  1KAZ A;  2D4W A;  2W41 A;  3AY9 A;  1T44 A;  5E84 A;  4BGB A;  4LC9 B;  1NGA A;  2KHO A;  3UKU A;  4I6M B;  2YJE A;  3A5O C;  2D0O A;  3L6Q A;  4ISG A;  4CZJ A;  4AM6 A;  5BPM A;  4GY2 B;  4BRI A;  2V52 B;  3ULE B;  2A6A A;  3CHW A;  3QBX A;  2A5X A;  3WEE B;  2Q1N A;  2YI1 A;  4BRD A;  1R59 O;  4O8K A;  4A2A A;  2CH6 A;  4CZF A;  4WQ4 C;  5AQS A;  4BVP A;  1OKJ A;  3SJH A;  3MN7 A;  1GLL O;  2P9L A;  4EAH D;  3LDO A;  5EOY A;  2IVN A;  4BRK A;  4PKI A;  3FZM A;  2Q0U A;  4RCH A;  4BG8 A;  4IWV A;  3WXL A;  1LCU A;  5I9E B;  1Y64 A;  1IJJ A;  4C23 A;  3ZEU B;  3VEW A;  3P4I A;  1Z05 A;  3LDL A;  4JNE A;  1NGG A;  5FPM A;  1HKB A;  3D2E A;  2VWB A;  4JHD A;  3GL1 A;  1ATN A;  1RGI A;  1S3X A;  4RWT A;  3VGM A;  3B8A X;  2E1Y A;  3OHR A;  1WUA A;  1RFQ A;  1QHA A;  4JD2 B;  5E26 A;  1QZ6 A;  5AQL A;  4EHT A;  4A61 A;  2QWN A;  2FLO A;  4BR5 A;  1U2V B;  2YJF A;  3MN9 A;  1SZ2 A;  3O1W A;  2FSJ A;  5ADX A;  1U6Z A;  4K25 A;  5BRD A;  4FWK A;  3UE5 A;  2YHX A;  3VEO A;  2FSK A;  2VYP A;  2GUP A;  2OAN A;  4PL8 A;  5B8H A;  5JLH A;  5KPZ A;  1GLJ O;  4BQZ A;  3KZB A;  4EHU A;  3LM9 A;  1P8Z A;  5BN9 A;  3DJC A;  2QWO A;  3HBT A;  5EXW A;  5BPL A;  1CZA N;  2IVP A;  3ENO A;  1TYQ A;  4CJ7 A;  3A5L C;  4EFH A;  5BPN A;  4NO7 A;  4MO4 A;  3VEV A;  5KPT A;  2YHY A;  4BR0 A;  1T6C A;  3CJ9 A;  3SMS A;  2CH5 A;  4ISE A;  3AAR A;  2QWP A;  4FWO A;  1XUP O;  4M7X A;  1SAZ A;  3VET A;  2CGK A;  5AZI A;  3D2F B;  4CZG A;  5KPR A;  5AQN A;  5AQM A;  1NGH A;  3CI5 A;  4DQ8 A;  3G25 A;  4Z94 A;  3CJ7 A;  2NRH A;  4FO0 A;  4BRG A;  4DHY A;  5AQG A;  4CZH A;  1WOQ A;  3BEX A;  4BRL A;  3KHY A;  2P9S B;  5BRF A;  3HZ6 A;  2ZGZ A;  2ZF5 O;  2QWQ A;  2HF3 A;  4MO5 A;  5AQY A;  3W3D A;  2PAV A;  1ZBS A;  3BF1 A;  3O4W A;  1BWF O;  5BRE A;  3ATV A;  3AAP A;  3LM2 A;  5TKY A;  3GDQ A;  1E4G T;  1BA1 A;  4B9Q A;  3FE1 A;  3ZET B;  4J8F A;  3VER A;  1ATR A;  1GLA G;  3CJB A;  1QQN A;  4H0Y B;  1HKG A;  5KQ8 A;  1HPM A;  2IIR A;  4JAX A;  4BRQ A;  2P9N B;  4CI6 A;  2E2O A;  3WUH A;  4H5T A;  1MA9 B;  4K42 A;  3H45 C;  1YAG A;  4H5W A;  1JCF A;  2E88 A;  3VOV A;  2CGJ A;  3R6M A;  3GG4 A;  3A5M C;  3WT0 A;  4I6M A;  2ASO A;  3WQT A;  3H1Q A;  3CQY A;  3EZW A;  3O80 A;  4QS9 A;  5AR0 A;  4BRP A;  3ULE A;  2BTF A;  2I7P A;  3H6E A;  1HLU A;  1GLD G;  1X3M A;  2Q2R A;  3WEE A;  3EKU A;  1H1V A;  2F9T A;  1X3N A;  3BP8 A;  2ITM A;  4BR2 A;  4BVO A;  4H5V A;  2EWS A;  3VGK A;  4BRO A;  3UKR A;  4A62 A;  1TUU A;  3CET A;  1T6D A;  1GLB G;  4AM7 A;  5JIC A;  3QDK A;  4DCH A;  1BDG A;  5AQO A;  5ADX H;  1NM1 A;  4M7Y A;  3JS6 A;  2I7N A;  4FPB A;  5KQD A;  4FWR A;  4BRE A;  2E20 A;  3VF6 A;  3H3N O;  4Y0W A;  4BRM A;  1NGJ A;  2Q0R A;  3S41 A;  3W0L A;  3DXM B;  4YDU C;  3U8X A;  4PKH A;  4WQ5 C;  3EL2 A;  4M63 C;  3C0B A;  1XC3 A;  2QM1 A;  4FPA A;  4JD2 A;  3AAQ A;  3HTV A;  3QML A;  1ESV A;  2BUP A;  5AQR A;  3O6W A;  5AFU A;  1K8K B;  2HF4 A;  3L4I A;  3QFP A;  4GNI A;  1U2V A;  3O1B A;  4FWL A;  2PBD A;  5LY3 A;  2VCP A;  3VES A;  1MDU B;  2Q36 A;  3EN9 A;  3I8B A;  4CZI A;  3A8Y A;  5AQZ A;  1HX1 A;  2FSN A;  1QZ5 A;  4BC3 A;  1RDW X;  4NB4 A;  2GEM A;  3TU5 A;  3ATU A;  4H0P A;  4K41 A;  5AQH A;  2WUS A;  3QIC A;  4IXC A;  2QWM A;  2ZGY A;  2QW9 A;  5F1X A;  4BC2 A;  4FSV A;  4F9O A;  5AZJ A;  4B1W B;  1Q18 A;  4CBU A;  1MWM A;  2HOE A;  4MLE A;  3R8E A;  5CE3 A;  5AQQ A;  2FXU A;  5ELZ A;  4BRA A;  1ATS A;  2FF3 B;  3J8A A;  4H5R A;  1HJO A;  2GEL A;  1C0G A;  3IUC A;  3VGL A;  2W40 A;  5F0X A;  3H1V X;  5AQJ A;  3DXK B;  3GBT A;  2P9U B;  2ASM A;  4FWP A;  3FZH A;  2H3G X;  3EO3 A;  4B1Z A;  1ZXO A;  4JN4 A;  4KBO A;  5LJV A;  4BC4 A;  1NWK A;  3WXJ A;  3ID8 A;  2P9S A;  3VEN A;  1DGK N;  3TPQ A;  3GOI A;  1NGD A;  3O08 A;  4FWQ A;  2E2Q A;  3RSE A;  4XEI A;  2E1Z A;  2YHW A;  3DWL A;  1XQS C;  2J4R A;  5AQI A;  4BRN A;  4BRC A;  2GTD A;  1BG3 A;  3M6G A;  4FWS A;  3VEY A;  3WQU A;  4L3Q A;  4WQ4 A;  4IZ9 A;  4QS8 A;  3R9P A;  1NGC A;  2P9N A;  3CJ1 A;  1HUX A;  2A3Z A;  2P9I B;  1QQM A;  3QFU A;  1D4X A;  2P9P B;  1GLC G;  3ENH A;  3QBW A;  5FPE A;  2Q31 A;  1QQO A;  3LDP A;  3IDH A;  1GLE G;  3VF4 A;  2GWJ A;  2AA4 A;  1ZC6 A;  3LL3 A;  4CBW A;  1Z6R A;  3FGU A;  2E2N A;  1S22 A;  4XH4 A;  4CZK A;  2AP1 A;  2FF6 A;  3VEZ A;  4BG9 A;  3LDN A;  2V51 B;  4QS7 A;  3VPZ A;  2HMP A;  3ZX3 A;  2P9K B;  1TUY A;  3C7N B;  1NGF A;  4BRF A;  2QWR A;  5AFU H;  2F9W A;  4CBX A;  2A42 A;  1JCG A;  2GWK A;  4BR7 A;  2A40 A;  3FLC O;  3MN6 A;  5BRH A;  1KAY A;  1KAX A;  3D7E O;  5JLF A;  5EX5 A;  3UKU B;  3WXK A;  1MWK A;  4IO8 A;  5FPN A;  3EKS A;  5JMV A;  1E4F T;  1EQY A;  2Q97 A;  5AQV A;  3ZEU A;  1BO5 O;  4H0X B;  2QXL A;  4IJN A;  4CZM A;  3CQX A;  3DXM A;  4BC5 A;  4K43 A;  3UKR B;  5FPD A;  3MK6 A;  2P9L B;  2E8A A;  5BR9 A;  4H5N A;  3M1F A;  4BGA A;  2E2P A;  1JCE A;  5AQP A;  3GE1 A;  1BUP A;  1KXP A;  4IJA A;  1K8K A;  4A2B A;  5AQW A;  1SQK A;  4H0O A;  3A0I X;  3IFR A;  3U9D A;  3CER A;  5F2R A;  5AQF A;  3D2E B;  3FFK B;  4JHD B;  4MLH A;  4FWN A;  3FR0 A;  4FOI A;  1C0F A;  1YXQ A;  3VF2 A;  2QWL A;  1X9J A;  2CGL A;  4O5F A;  3U4L A;  3ZX0 A;  1DEJ A;  3HM8 A;  1V4S A;  1V4T A;  4FL9 A;  1YVN A;  2NLX A;  4EIA A;  2UYT A;  5AQT A;  4BR4 A;  4FWM A;  1NLV A;  4E1J A;  2YCH A;  4CD1 A; 
#chains in the Genus database with same CATH topology
 4PWD A;  2A41 A;  5DM7 L;  3C6T A;  4IFE A;  3MDQ A;  2DPN A;  1RCH A;  3JAM O;  4KHS A;  3VQ6 A;  1BA0 A;  5BN8 A;  3DLL L;  4F2S A;  1HKC A;  3V9U A;  1NMD A;  3ZSW A;  1UA1 A;  4BRH A;  4DB3 A;  4WF9 L;  2JLE A;  4CGJ A;  2HNZ A;  3CIP A;  4CGG A;  3CCQ N;  3CCL N;  1XNQ K;  3K9J A;  2NRR A;  3P1G A;  5EY4 A;  1RDB A;  4FM1 A;  4DQS A;  2HBL A;  3AVN A;  1ASU A;  1DKG D;  3B6P A;  3FZK A;  2NZT A;  4DSE A;  2OYQ A;  2EHG A;  4JI0 K;  4H0T B;  3NVM A;  3WNE A;  1BIZ A;  1NGI A;  3CJC A;  2O4G A;  5A2Q O;  1XHZ A;  3CC2 N;  4OLB A;  4DFP A;  1JLE A;  4DSF A;  1Q81 O;  3SQ0 A;  3RSE B;  1U45 A;  1QS4 A;  4XH1 A;  1FKP A;  3NF7 A;  3KKS A;  1BU6 O;  5BR8 K;  3SLC A;  3MMV A;  1N8R O;  3OJS A;  4ZHR A;  4N47 A;  4WQ5 A;  4N5S A;  4CZL A;  2P9K A;  3DAW A;  3A5N C;  4IFV A;  4B1V A;  5KGX A;  3NVK A;  2WBN A;  4FVM A;  4LC9 B;  4NCG A;  3VQC A;  2KHO A;  1S1U A;  2ETJ A;  3UKU A;  4I6M B;  2YJE A;  2G8K A;  3L6Q A;  4ISG A;  4CZJ A;  1QTM A;  3K9K A;  5BPM A;  4GV6 A;  4KTZ A;  1K8A O;  3QBX A;  4LH4 A;  2YI1 A;  3IG1 A;  1JLF A;  4O8K A;  4FM2 A;  2VG6 A;  1R0A A;  2YKN A;  2X6S A;  3QO9 A;  4C1N I;  1W9H A;  4CGH A;  1OKJ A;  2P9L A;  5EOY A;  3JYT A;  1NK6 A;  3EZ5 A;  4XIU A;  4RCH A;  2YNI A;  4IWV A;  5I9E B;  4GV3 A;  4BWJ A;  4CGI A;  1KSP A;  4FJJ A;  1IJJ A;  3SAF A;  1ZBH A;  4B9L A;  4DU1 A;  2FBV A;  4K0K K;  5FPM A;  2VWB A;  4DFK A;  2VWK A;  1NKB A;  3B8A X;  1Q86 O;  1NJZ A;  1QHA A;  3BZK A;  3DYA A;  4B3M K;  1JLA A;  3S3N A;  2QWN A;  2FLO A;  2YJF A;  2DTU A;  3OYE A;  3TTD A;  1B9D A;  3O1W A;  1Z26 A;  4W5T A;  3V9Z A;  2VYP A;  2E6L A;  3QEP A;  3I8D A;  1NOY A;  1VSF A;  3KZB A;  4EHU A;  2PYL A;  2QWO A;  3Q7C A;  5EXW A;  4KO0 A;  4DV7 K;  5BPN A;  4KB0 A;  3PY8 A;  3A5L C;  1EET A;  2HHX A;  2YHY A;  3SMS A;  2OTL N;  3NF9 A;  2QWP A;  4E1N A;  3O9Q A;  4M7X A;  3VET A;  3KK7 A;  2O8E B;  5KPR A;  1L3U A;  5AQN A;  4DFM A;  2NRW A;  4DQ8 A;  4Z94 A;  1N34 K;  3V1Q A;  4DHY A;  4FO0 A;  4BRG A;  1WBB A;  4CZH A;  4BRL A;  1TK0 A;  3G10 A;  4E3S A;  2QWQ A;  4DFJ A;  2HF3 A;  3W3D A;  3I56 N;  3LAM A;  5GIP A;  1Q9X A;  3KLF A;  3PLA A;  1KC8 O;  1B9F A;  1CXQ A;  5HRO A;  3ZET B;  1CXU A;  2XY8 A;  1IKX A;  1F21 A;  3JSM A;  4CEQ A;  1QQN A;  3E9L A;  2KKZ A;  4BRQ A;  4CI6 A;  2E2O A;  2G8F A;  4KHW A;  1HNI A;  4KV8 A;  4RW6 A;  2HBM A;  4CFB A;  3GG4 A;  3WT0 A;  2RE2 A;  1HNZ K;  4DWI A;  1T8E A;  3EZW A;  5AR0 A;  1XWL A;  2RPI A;  3SAG A;  1HLU A;  3WEE A;  1H1V A;  2HW3 A;  3T1H K;  2HHU A;  4KHN A;  4BR2 A;  5JS1 A;  4BVO A;  3NFA A;  3V4I A;  1XMO K;  4DQP A;  4B3T K;  1NG9 A;  1A5X A;  3G71 N;  3CET A;  4E7J A;  4FW2 A;  1GLB G;  2O8B B;  4DCH A;  1BDG A;  1Q82 O;  1LWF A;  2BH1 A;  4CF0 A;  5HRN A;  4IG0 A;  3QER A;  1NM1 A;  4KHY A;  3VQD A;  4KH5 A;  3NAE A;  2ZM6 K;  2I7N A;  3NH1 A;  4FWR A;  1KFD A;  2E20 A;  3RRH A;  4DQI A;  2BDP A;  4JI7 K;  1FJG K;  1I3A A;  1Q9Y A;  1XC3 A;  2QM1 A;  4FPA A;  3SUO A;  4JD2 A;  3CFO A;  3AAQ A;  2BUP A;  2YHB A;  3O6W A;  1YIT N;  1ZYQ A;  4CED A;  4FJ7 A;  3QFP A;  1U2V A;  2G8I A;  1QSS A;  4E0D A;  3DLE A;  1E3M A;  2O8D B;  1HYV A;  2Q36 A;  5TKW A;  4BDY A;  3EN9 A;  4FYD A;  3A8Y A;  4CJT A;  1HX1 A;  4CFD A;  2XY6 A;  1EXQ A;  3PIP L;  2GEM A;  3AA5 X;  2Y1J A;  2X74 A;  4H0P A;  3LZI A;  3THY A;  2QWM A;  4CE9 A;  3OYL A;  3ALY A;  3CMA N;  2QW9 A;  5F1X A;  1JXB A;  1MWM A;  3R8E A;  2FXU A;  3QIN A;  4JI4 K;  1ATS A;  4DTP A;  2GEL A;  3VQ9 A;  4CK3 A;  3PO5 A;  4ELT A;  1K6Y A;  3NGY A;  2W40 A;  4GV9 A;  4DTO A;  3H1V X;  5AQJ A;  1REV A;  4B3R K;  3TAG A;  2ASM A;  3HST B;  3FZH A;  4B1Z A;  4F4K A;  1ZXO A;  1KQS M;  1C0M A;  1NGD A;  3O08 A;  4BDZ A;  3EE9 A;  3RSE A;  4AHC A;  2E1Z A;  3DWL A;  2OPR A;  4B9M A;  1XQS C;  4JS5 A;  4FWS A;  3VEY A;  4L3Q A;  5C42 A;  4FJG A;  3RR8 A;  4QOZ B;  1RT4 A;  4ZTF A;  3MXM A;  2P9N A;  3VQ7 A;  3RMD A;  4CK1 A;  3WNH A;  4AQY K;  1D4X A;  4N56 A;  1GLC G;  1SKW A;  1QQO A;  3LDP A;  1X9S A;  3IDH A;  1NK9 A;  4CER A;  4JKA A;  4IKF A;  1WBD A;  4XH4 A;  4CZK A;  2AP1 A;  1Y97 A;  4HTU A;  3VPZ A;  4QS7 A;  4L8R B;  2PZS A;  2O8F A;  4N41 A;  3D6R A;  3ZT0 A;  2P9K B;  1NK0 A;  3AA4 A;  4DV1 K;  2YX6 A;  1NGF A;  3CFR A;  2KFN A;  1SL0 A;  3HK2 A;  3FLC O;  1VSI A;  1UWB A;  1VAZ A;  4DTJ A;  3UKU B;  4RW8 A;  1SL1 A;  3NBP A;  1RBV A;  1VSJ A;  1EQY A;  1VHX A;  1YT3 A;  4C8K A;  4H0X B;  3T1Y K;  3EY1 A;  2QXL A;  1M90 O;  3S3O A;  1KTQ A;  3BGR A;  4DUZ K;  1KLM A;  3UKR B;  4O44 A;  3MK6 A;  2P9L B;  3L2W A;  2E2P A;  1JCE A;  4PA1 A;  5AQP A;  1NK5 A;  5KTQ A;  4A2B A;  1SQK A;  1O13 A;  3A0I X;  4CF8 A;  1IH7 A;  4DG1 A;  2NRT A;  3CER A;  3KK3 A;  5AQF A;  4CEB A;  5M1P A;  3ZSO A;  4MLH A;  4U67 L;  1U04 A;  1C0F A;  3E9P A;  3KLG A;  1RDU A;  1X9J A;  4O5F A;  3ZX0 A;  3HM8 A;  1V4S A;  5KRT A;  3SUN A;  4JI1 K;  3V81 A;  1L5U A;  5AQT A;  1GOA A;  4Y1C A;  1NLV A;  4AIL C;  4E1J A;  1VSE A;  2YCH A;  2IVO A;  4CFA A;  3F9M A;  5JVH L;  1VQN N;  4H03 B;  3O3H A;  3L2V A;  4B1Y B;  3DXK A;  2P9U A;  2W42 A;  2ASP A;  3CPW M;  3CCS N;  3OBW A;  3HM9 A;  1NJX A;  3A2F A;  4DR5 K;  4J2A A;  4CZE A;  3MX2 A;  4ISF A;  5AZJ B;  3BF3 A;  2DFF A;  2O4I A;  2KZM A;  1NU0 A;  1JXE A;  2QKB A;  1ZBL A;  1WSI A;  2KQ2 A;  3FFI A;  4RTF D;  3TTF A;  1LOT B;  4HVJ A;  4Z4C A;  2ZWH A;  2KZZ A;  3OTO K;  3UB5 A;  4DR1 K;  3ZET A;  4CJ4 A;  3CC4 N;  1OH8 A;  1GLF O;  2XHB A;  4FW1 A;  3DLR A;  4CJW A;  4JS4 A;  2V7Y A;  4DR3 K;  4H4M A;  3FZL A;  4HWI A;  3L3V A;  4MQ3 A;  2EX3 A;  1NGB A;  2B4J A;  3M8Q A;  1LAW A;  3C95 A;  3SJJ A;  1J6Z A;  3ITH A;  2NNW A;  1YF5 L;  3HSC A;  1RBU A;  3M8R A;  5CZ1 A;  3T19 A;  4BE0 A;  3SQ2 A;  4FLV A;  4CHY A;  1NBW A;  2VQE K;  3PV8 A;  4MDB A;  1IG8 A;  3O8M A;  2HHQ A;  1U4B A;  3LAK A;  1TAU A;  3NF8 A;  3AY9 A;  4A57 A;  3ZT4 A;  1FK9 A;  4FJN A;  4FJX A;  4JLH A;  4DV2 K;  1BCM A;  4H8K A;  1WB9 A;  4AM6 A;  3TAQ A;  1X9W A;  4W5Q A;  5I3U A;  4K8X A;  2A5X A;  2YNF A;  2Q1N A;  3WEE B;  4Z4F A;  4FLX A;  4CJP A;  4I7F A;  4A2A A;  1IKW A;  3HO1 A;  1RTH A;  4ICL A;  4CZF A;  4WQ4 C;  5AQS A;  3AO5 A;  3SJH A;  2HHW A;  3V9S A;  4CJ3 A;  3KIO A;  3PUF A;  4CIE A;  3FZM A;  4I9Q A;  3WXL A;  3VQB A;  2JWK A;  1Y64 A;  1X9M A;  3LZJ A;  2VG7 A;  4C8O A;  1JL2 A;  3ZEU B;  2NRV A;  3PX6 A;  4JNE A;  1NGG A;  4IFY A;  4JHD A;  4Z0U A;  3P5J A;  4G1Q A;  1S3X A;  4RWT A;  3P39 A;  1BHL A;  4B08 A;  1WAJ A;  3OHR A;  1B92 A;  1RFQ A;  4CJV A;  3NH0 A;  4JD2 B;  4BAC A;  2WFB A;  5E26 A;  4EHT A;  2VGM A;  3THW A;  4G9Z A;  1L3V A;  2D5R A;  1U2V B;  3MN9 A;  3WNF A;  2FSJ A;  1U6Z A;  4K25 A;  3UE5 A;  4JKG B;  2HVH A;  5GIO A;  1RBS A;  5JLH A;  3DLB A;  5KPZ A;  1GLJ O;  1ZBF A;  2F96 A;  3O9R A;  3LM9 A;  4DTS A;  4KHU A;  3HBT A;  3THY B;  4W5N A;  4WE1 A;  2IVP A;  3NH2 A;  1TYQ A;  4DS5 A;  4MO4 A;  4M3Y A;  5KPT A;  3M5R A;  4BR0 A;  3CJ9 A;  4KTW A;  3HYF A;  4QCL A;  5CR4 A;  3AAR A;  3VQQ A;  1XUP O;  1SV5 A;  4AHV A;  2CGK A;  5AZI A;  1D5A A;  3D2F B;  3L4Q A;  4CGF A;  4FLY A;  5AQM A;  3CI5 A;  2NRH A;  5AQG A;  3O3F A;  3KHY A;  4DSJ A;  3QEX A;  3HPO A;  4O5B A;  2F4V K;  5C24 A;  5AQY A;  3O4W A;  4ID5 A;  4CEF A;  4FVU A;  2P51 A;  2UXD K;  4IDK A;  3LM2 A;  2G8V A;  4OJR A;  3FE1 A;  4J8F A;  2HNY A;  3VER A;  2F8T A;  4WFN L;  5JVG L;  1HPM A;  2P9N B;  3VA0 A;  2RKI A;  3TI0 A;  1D8Y A;  1JJ2 M;  4NCB A;  4DF8 A;  4HCC A;  1MA9 B;  1VQ7 N;  3ZSX A;  4CEO A;  2E88 A;  1FXX A;  1NJI O;  2P1J A;  1KLN A;  2CGJ A;  3N4P A;  1VQ5 N;  4M3T A;  2ASO A;  2XO7 A;  2E5L K;  3O80 A;  3PSI A;  3OA9 A;  2HMI A;  5AJ3 K;  3CPE A;  3ULE A;  1RDC A;  3DOL A;  3EKU A;  1NMN A;  2O8F B;  4E89 A;  3T3F A;  2F9T A;  2WC9 A;  3DLH A;  1RT6 A;  1X3N A;  3HT3 A;  4H4O A;  4JKE A;  3CM6 A;  3UKR A;  3TAP A;  5EU7 A;  3NDK A;  1VQ4 N;  1A5V A;  5C12 A;  2YKM A;  3AVI A;  4CJK A;  3LWL A;  5AQO A;  3D0P A;  5ADX H;  3SBT A;  1QHT A;  3JS6 A;  3MEG A;  4FPB A;  1D9F A;  3MEC A;  1FW6 A;  3I55 N;  4B9U A;  4CHZ A;  3E1Y A;  4ELU A;  1NGJ A;  2BE2 A;  3PIO L;  5C0Y A;  3S41 A;  3W0L A;  2RF2 A;  1BQN A;  4PKH A;  4GVE A;  5SWM A;  4R5P A;  3EL2 A;  4IOX A;  3IAY A;  2LSN A;  2QI2 A;  5AQR A;  3QML A;  1NOZ A;  5AFU A;  1S1X A;  1RDA A;  1RNH A;  3O1B A;  4M3Z A;  2PBD A;  1HR0 K;  1BGX T;  4YOU A;  1S1V A;  4YOY A;  1MDU B;  4FJ5 A;  3AVH A;  3TSU A;  3K5M A;  1YIJ N;  4BC3 A;  1EWQ A;  1RDW X;  3DRR A;  2PYJ A;  4FCY A;  3TU5 A;  3M8S A;  3ATU A;  1XHX A;  4GKK K;  3OVN A;  3SNN A;  4Q0B A;  4K41 A;  5AQH A;  2WUS A;  3QIC A;  2HHT A;  1RTJ A;  3H08 A;  2ZGY A;  1VK0 A;  3AVJ A;  2ZJQ L;  4FSV A;  2WTU A;  1ZBU A;  4B1W B;  5AZJ A;  3KTQ A;  4CF9 A;  2HOE A;  4JEP A;  4BRA A;  3TR8 A;  2FF3 B;  3ZLJ A;  1TV6 A;  1T03 A;  4C8M A;  1RT7 A;  5C2D A;  4C8N A;  2OPQ A;  3C6U A;  4F2R A;  5F0X A;  4OPK A;  3DXK B;  3GBT A;  3DLG A;  4KAZ A;  2FBY A;  2P9U B;  4V19 S;  3ZSY A;  4BC4 A;  1NWK A;  3T7Z A;  1KVB A;  3VEN A;  1DGK N;  3TPQ A;  2UXC K;  5C15 A;  2GV9 A;  3P31 A;  4AH9 A;  3VQ8 A;  1QSL A;  4FJH A;  2J4R A;  2ZD1 A;  3DRP A;  2GTD A;  5HOO A;  5GAG P;  3WQU A;  1YTU A;  2UUB K;  4HHT A;  4JK7 A;  4WQ4 A;  4QS8 A;  2UUC K;  3O4Q A;  4LSL A;  4X64 K;  4OKK A;  1J54 A;  5HP1 A;  2GUI A;  1S9E A;  4BY9 C;  2ZJP L;  1GLE G;  3VF4 A;  1HNX K;  2GWJ A;  3LDS A;  1Z6R A;  3FGU A;  2FF6 A;  1DT9 A;  3LDN A;  5M1O A;  2V51 B;  3O9S A;  1FKO A;  1YHQ N;  2OPP A;  3AVA A;  2PY5 A;  1DTQ A;  1L3S A;  2ITG A;  1WSJ A;  1JCG A;  2A42 A;  4CBX A;  2A40 A;  4OPH A;  1N33 K;  1KAY A;  1KAX A;  1RTI A;  5EX5 A;  4NYF A;  4CW7 B;  4IO8 A;  2B5J A;  4FK4 A;  3QIP A;  4CHN A;  1E4F T;  3ZEU A;  4JKD A;  3UIQ A;  2OA8 A;  3KK2 A;  1GOB A;  1X1P A;  3K5O A;  4BC5 A;  1KFS A;  3AV9 A;  3CFP A;  4DR6 K;  4LH5 A;  4H5N A;  4ILH A;  2G8U A;  2DY4 A;  3RMC A;  3GE1 A;  1W0H A;  4DU4 A;  5LMN K;  4AHU A;  5FRN A;  4DQR A;  3LP2 A;  3CCE N;  3DRS A;  3HP9 A;  3IFR A;  4CVN E;  4F3T A;  1TGO A;  3LPU A;  5T7B A;  1WSH A;  2OCE A;  4JKG A;  4FLU A;  3D45 A;  4JHD B;  1LWE A;  4R79 A;  3QEV A;  3OYM A;  4O0I A;  5M1Q A;  3SZ2 A;  3BZC A;  3FR0 A;  4FOI A;  1TKD A;  3VF2 A;  4IG3 A;  2CGL A;  4OKE A;  1SS6 A;  3THW B;  4DTU A;  3VQE A;  5H1S Q;  4BR4 A;  4FWM A;  5M1K A;  2Z1J A;  5AQU A;  1KRP A;  2VQF K;  3MWP A;  3JXU A;  4KRE A;  5LJW A;  1NGE A;  4PHT X;  3KVG A;  2QA4 N;  3H3O B;  4JKF A;  3D2F A;  4BWM A;  1XNR K;  2FC0 A;  1OH7 A;  2GX9 A;  1TKT A;  3CJA A;  1TYQ B;  4WYB A;  3VEX A;  4PL7 A;  2A1S A;  3C6H A;  4FOE A;  1VQK N;  3HOT A;  1TAQ A;  3IMX A;  1Q7Y O;  5C10 A;  3SMP A;  3O9U A;  4FZY A;  5EVZ A;  5AZI B;  2ATQ A;  1YI2 N;  3J7Y P;  4CCH A;  1YJW N;  1IKV A;  3U3G A;  1S72 N;  1RTD A;  2YNG A;  2DFH A;  1WN7 A;  3BUZ B;  2V7Z A;  4CJQ A;  4CGD A;  4KTQ A;  2P9I A;  3KK1 A;  3RMA A;  1N5Y A;  1TL1 A;  2UU9 K;  3KLE A;  3MED A;  3I33 A;  4JKC A;  4X62 K;  1XC9 A;  1IBM K;  5AQK A;  1TVR A;  3K59 A;  4AHT A;  5LMU K;  3OYJ A;  4LF4 K;  4FJM A;  4BR9 A;  4H0V B;  3LDQ A;  4AHR A;  3O5B A;  5CHI A;  4M3X A;  4FM0 A;  3LAN A;  2XRI A;  4XH5 A;  1SKR A;  5J2N A;  3SPY A;  1VQM N;  3L0Q A;  5AQX A;  1SUQ A;  3S3M A;  4B8C A;  4CEZ A;  4ILG B;  5E84 A;  1NGA A;  3U3Y A;  4KH6 A;  4BRI A;  3ULE B;  2A6A A;  3CHW A;  3O9T A;  3J7A P;  3N4Q A;  4BRD A;  1R59 O;  4KRF A;  2DFE A;  4OLA A;  3AVF A;  3OYN A;  3MN7 A;  1GLL O;  3MEE A;  1C1A A;  5J2P A;  4PKI A;  2B6A A;  4JKH A;  2KFZ A;  4LSN A;  4RW7 A;  1LCU A;  3DI6 A;  5MLC Q;  4KFB A;  1KCF A;  4CJR A;  3VEW A;  3P4I A;  3SCX A;  1UA0 A;  1T05 A;  3EE8 A;  3D2E A;  1ATN A;  3MXJ A;  1RGI A;  4FJL A;  2KLA A;  2E1Y A;  1WUA A;  3SPZ A;  3L2Q A;  2HHV A;  1JKH A;  5IWA K;  1QZ6 A;  5AQL A;  4KHP K;  5J2M A;  3AGR A;  3L3U A;  4KI4 A;  4BR5 A;  4UY8 O;  4Z4I A;  1JLG A;  1SZ2 A;  3OYD A;  1NKC A;  3TSQ A;  4FWK A;  4YOR A;  2FSK A;  2OAN A;  3S9H A;  4OGC A;  4IOA L;  3NE6 A;  5HLF A;  3DJC A;  1NK7 A;  3MWT A;  4J2D A;  4CJF A;  4IBN A;  3QIO A;  3ENO A;  4EFH A;  3EYZ A;  3TAB A;  4NO7 A;  3DLK A;  2IGI A;  3BY5 A;  2CH5 A;  4DSK A;  4A59 A;  3RWU A;  1SAZ A;  4FZZ A;  3I0R A;  1VSH A;  3P83 D;  4J2E A;  2OPS A;  3TWH A;  2RN2 A;  3CYM A;  3HL8 A;  3V1R A;  3AVC A;  1CZ9 A;  5BRF A;  3HZ6 A;  3PX4 A;  1NK8 A;  1WSE A;  1ZBS A;  2WON A;  5CY4 A;  3PO4 A;  3AAP A;  3VMF B;  1DLO A;  1S1W A;  4FK2 A;  1IO2 A;  2P5O A;  1BA1 A;  4B9Q A;  4J2B A;  1ATR A;  1WLJ A;  1GLA G;  3CJB A;  1BI4 B;  3MXI A;  1WNS A;  2VG5 A;  1HKG A;  4H0Y B;  5HRR A;  3AVK A;  4CEE A;  5KQ8 A;  3AA3 A;  4JAX A;  3WNG A;  5FRM A;  4IEE A;  3WUH A;  3F73 A;  3SQ4 A;  2O8C B;  4K42 A;  1NNE A;  3H45 C;  1YAG A;  2X6N A;  4H5W A;  4OPJ A;  1JCF A;  3VOV A;  3U6F A;  4W5O A;  3A5M C;  1QVG M;  3G6E N;  1T3V A;  4EP5 A;  3VA3 A;  3H1Q A;  4QS9 A;  4BDP A;  1HYS A;  2QK9 A;  1YJ9 N;  1X3M A;  4CJE A;  3CG7 A;  1NKE A;  1QQC A;  2KTQ A;  3RTV A;  3BP8 A;  3CQ8 A;  4I9L A;  2ITM A;  4H5V A;  5CYM A;  2EWS A;  3ISN C;  4CIF A;  4DR4 K;  4OVL A;  2JGU A;  4BRO A;  1IBK K;  1TUU A;  1VRU A;  1T6D A;  3AA2 A;  4EP4 A;  5JIC A;  4KPY A;  3NGZ A;  1U48 A;  4RW4 A;  4M7Y A;  3IS9 A;  5CZ2 A;  5E41 A;  1VQ6 N;  4LFC K;  5KQD A;  1K9M O;  1TKZ A;  1IG9 A;  3MX5 A;  1HMV A;  1C0T A;  1VSL A;  2Q0R A;  4Y0W A;  3AVG A;  4YDU C;  3U8X A;  2Q3S A;  1DTT A;  4DR7 K;  2NRX A;  4JRQ A;  4TSX A;  4OO1 J;  3C0B A;  3Q7B A;  3SBG A;  2XY5 A;  4PQU A;  4JI2 K;  1VRT A;  2HHS A;  3K57 A;  3SUQ A;  5HRS A;  4HCB A;  2HF4 A;  3AVB A;  4GNI A;  3WXM B;  3RR7 A;  4FWL A;  5LY3 A;  1RBT A;  4KB1 A;  1N32 K;  4HUG A;  1HYZ A;  1XI1 A;  3VES A;  3HPH A;  4B9S A;  1U49 A;  1RIL A;  4F8R A;  4CZI A;  5C2F A;  3ULD A;  1VSD A;  5AQZ A;  2A1R A;  2FSN A;  3ZCM A;  1SL2 A;  4NB4 A;  1XMQ K;  4N76 A;  4DV0 K;  1WSG A;  1A5W A;  3SV3 A;  1VQO N;  4OGE A;  4IXC A;  3KWI A;  1IV0 A;  2HBK A;  3TAM A;  2NRZ A;  4BC2 A;  3G4S N;  3QNN A;  4CBU A;  4MLE A;  5CE3 A;  1T7P A;  5AQQ A;  1HNV A;  4LY7 A;  4AHS A;  4H5R A;  3CCM N;  3IUC A;  4NLC A;  3VGL A;  4BE2 A;  4BE1 A;  2H3G X;  5LJV A;  1RT3 A;  3ID8 A;  2P9S A;  4RG8 A;  3GOI A;  4FWQ A;  1BCO A;  1QVF M;  1JLB A;  3HJF A;  4XEI A;  3NCI A;  1LV5 A;  4JI5 K;  3M8P A;  1BG3 A;  1HQU A;  2YV0 X;  5GIN A;  3SUP A;  4NCA A;  3QEI A;  3VTI A;  3AVM A;  4O4G A;  3R9P A;  1NGC A;  2AJQ A;  5FLX O;  1HUX A;  2A3Z A;  2P9I B;  4JK8 A;  5KGW A;  1C1C A;  1J5O A;  1JLQ A;  3ENH A;  3QBW A;  1LAV A;  5FPE A;  2AA4 A;  1J53 A;  4CBW A;  3OS2 A;  1O1W A;  3HP6 A;  1M1K O;  4W5R A;  3QNO A;  3VEZ A;  1HQE A;  1QE1 A;  2HMP A;  3ZX3 A;  5HRP A;  3PSF A;  1TUY A;  1YVU A;  2FBT A;  4BRF A;  2F9W A;  2GWK A;  1NJW A;  5M1N A;  4DV6 K;  5BRH A;  1P90 A;  1EO1 A;  3D7E O;  1OH6 A;  3L2U A;  3WXK A;  1MWK A;  4M42 A;  1BIU A;  4O0J A;  4DQQ A;  5FPN A;  4YHH K;  4ID1 A;  1S6Q A;  3BDP A;  4B9N A;  3SAH A;  3OYC A;  4YY3 K;  4B3O A;  1BO5 O;  4NXN K;  4ELV A;  3O3G A;  2FBX A;  5SZT A;  4DV5 K;  1TK5 A;  1C1B A;  4IJN A;  2GBZ A;  4CZM A;  3CQX A;  2HB5 A;  1CZB A;  3DXM A;  5FPD A;  3OJU A;  2E8A A;  4O55 A;  2QEX N;  4BGA A;  4YOW A;  4NYN A;  4CIG A;  4KI6 A;  3SYZ A;  1BUP A;  4B9T A;  5CYQ A;  1KXP A;  4IJA A;  1K8K A;  3LPT A;  5AQW A;  4IDH A;  1EP4 A;  5C25 A;  1HRH A;  4JYA K;  1J5E K;  1QSY A;  4FJI A;  3EEQ A;  3OBY A;  5F2R A;  1NK4 A;  1GOC A;  3D2E B;  3FFK B;  1I39 A;  4CFC A;  3VQ4 A;  5GAE P;  4Z4E A;  1BIS A;  3PX0 A;  4LF6 K;  3HVR A;  3C65 A;  2E6M A;  2IS3 A;  5KRS A;  1YXQ A;  3U4L A;  3V1O A;  4CHO A;  4X65 K;  1W97 L;  3CC7 N;  4FL9 A;  3C6A A;  4YNQ A;  1YVN A;  2NLX A;  4EIA A;  4Y1D A;  4KHQ A;  3E9O A;  2UYT A;  2Z1G A;  4E7H A;  4FJ9 A;  4CD1 A;  1YUW A;  3DOK A;  3L8B A;  1MU2 A;  4PKG A;  3DM2 A;  3C94 A;  1BQM A;  5D3G A;  3RMB A;  3ID6 A;  2HBJ A;  4CD3 A;  4DTR A;  4DV4 K;  1ITG A;  4BQL A;  3OS1 A;  3OYA A;  3E01 A;  3MCP A;  1WSF A;  3WXI A;  3MN5 A;  3VQA A;  1HNW K;  3FZF A;  3R1X A;  3ZT2 A;  3SK3 A;  4DU3 A;  1VQL N;  4DR2 K;  4C8L A;  3OYI A;  1G99 A;  2UXB K;  4LD0 A;  3ZX2 A;  5DK5 A;  5GAH P;  1BI4 A;  4HTL A;  3QES A;  3VQP A;  3CM5 A;  1C0U A;  2F8S A;  2OZS A;  4RW9 A;  3J7Z O;  3HI0 A;  2P9P A;  5JS2 A;  3TTC A;  2BGG A;  2O8C A;  3OYG A;  3H46 O;  1OVY A;  4WCE L;  3M3Z A;  3SQ1 A;  5K14 A;  1JL1 A;  2D0P A;  3QB0 A;  1BOT O;  2D1K A;  4B1U B;  1LW0 A;  1KVC A;  4YDU A;  4B1X B;  1EWR A;  4MFB A;  3TAE A;  4M3R A;  4C1N K;  1KVA A;  3U9Z A;  3C7N A;  4AF1 A;  1RBR A;  1KAZ A;  2HVI A;  2D4W A;  2W41 A;  1TK8 A;  4WFA L;  4ZTJ A;  2D0C A;  1T44 A;  4BGB A;  4DS4 A;  2P5G A;  3A5O C;  4LF8 K;  2D0O A;  1D9D A;  4YOT A;  4GY2 B;  2V52 B;  3OYF A;  4FK0 A;  4E19 A;  4IEI A;  2CH6 A;  4CF2 A;  1YJN N;  3THX A;  4M41 A;  4BVP A;  1RT2 A;  2ZJR L;  3ENB A;  4EAH D;  3LDO A;  2IVN A;  4JI8 K;  4BRK A;  2Q0U A;  1U47 A;  4BG8 A;  4UQG A;  2E4L A;  4B8A B;  2W6K A;  1W7A A;  4C23 A;  3NHG A;  4FLW A;  4B3S K;  4KKO A;  1Z05 A;  1N6Q A;  3AGK A;  3LDL A;  4X66 K;  4GKJ K;  2HHH K;  1HKB A;  1IBL K;  1BL3 A;  3GL1 A;  2IOC A;  4U7B A;  3VGM A;  3SV4 A;  5J1E A;  4FLT A;  5FDL A;  2D0B A;  1NJY A;  4A61 A;  2ZQB A;  1LW2 A;  3K5L A;  4Z4G A;  1S5J A;  3ZSZ A;  5ADX A;  5BRD A;  3F5T A;  2IAJ A;  2YHX A;  4O8U A;  1HPZ A;  3VEO A;  1RT1 A;  4PL8 A;  2GUP A;  5B8H A;  3IRX A;  1RDD A;  4BQZ A;  3G0Z A;  4OKJ A;  4JRP A;  1P8Z A;  5BN9 A;  4DTX A;  2VWJ A;  3VQ5 A;  3K0S A;  4LF7 K;  5BPL A;  1YTA A;  5KI6 A;  1CZA N;  5M1F A;  4CJ7 A;  4DTN A;  1EKE A;  4FJK A;  3VEV A;  4CES A;  1T6C A;  3ZSV A;  3CF5 L;  4ISE A;  2QTD A;  2QXF A;  3CCR N;  4FWO A;  1KD1 O;  3K58 A;  3O4N A;  4EZ9 A;  1L3T A;  4CZG A;  2OZM A;  3NGI A;  1NGH A;  1UAX A;  4PY5 A;  3AVL A;  3G25 A;  3P38 A;  3CJ7 A;  4I2P A;  1S1T A;  1WOQ A;  3BEX A;  3VTH A;  4NLB A;  3CXC M;  2P9S B;  4JI6 K;  2ZGZ A;  2ZF5 O;  4MO5 A;  2R7Y A;  2PAV A;  3OYH A;  3BF1 A;  1BWF O;  5BRE A;  3ATV A;  4F3O A;  3T69 A;  1OH5 A;  5TKY A;  3KD5 E;  3GDQ A;  3KD1 E;  1E4G T;  2UUA K;  4A5B A;  3V9W A;  2YHA A;  5LL6 Z;  4DMN A;  2W6L A;  2IIR A;  3E66 A;  2JWL A;  1TL3 A;  3RRG A;  4GVM A;  4LFA K;  4H5T A;  5GAD P;  3KWG A;  3T1A A;  4WFB L;  2HST A;  2IC3 A;  1ZBI A;  4HUF A;  4CJL A;  1C6V A;  3R6M A;  3MAQ A;  4I6M A;  2XY7 A;  3WQT A;  3CQY A;  3AO4 A;  4BRP A;  3J80 O;  4OX9 K;  2BTF A;  2I7P A;  3H6E A;  4Q5V A;  3V9X A;  1GLD G;  2Q2R A;  3I0S A;  3RVC A;  5DM6 L;  1ASW A;  2ZE2 A;  3CCU N;  4CHP A;  4FJ8 A;  5J2Q A;  3F2K A;  1EX4 A;  4DLE A;  3VGK A;  4HUE A;  4DLG A;  4A62 A;  4CK2 A;  1K73 O;  4AM7 A;  3QDK A;  1VQ9 N;  1SKS A;  2F7T A;  3KKR A;  3HVT A;  2Z1I A;  4M3W A;  4BRE A;  2HND A;  3OYK A;  2OTJ N;  3HPG A;  3VF6 A;  3THV A;  3H3N O;  4BRM A;  2PFU A;  3DXM B;  4QAG A;  3CCV N;  4WQ5 C;  1LWC A;  2RHK A;  4M63 C;  3ASM A;  1OVQ A;  3HTV A;  1ESV A;  1TKX A;  1K8K B;  1G15 A;  3QEW A;  3L4I A;  4CJU A;  2G8W A;  2VCP A;  3QLH A;  3L2R A;  4FZX C;  3LAL A;  3I8B A;  4NXM K;  1Q8I A;  4DKW A;  1QZ5 A;  3ZT3 A;  1Z25 A;  4YOV A;  4ILJ A;  1VSM A;  3CD6 N;  4IOC L;  4E1M A;  4YOX A;  1VSK A;  3ZYY X;  4JKB A;  4F9O A;  3K5N A;  1Q18 A;  4GW6 A;  1HJR A;  3OS0 A;  5ELZ A;  3J8A A;  1HJO A;  1UOC A;  1C0G A;  3NF6 A;  3AO2 A;  2KW4 A;  3B6O A;  2O8E A;  4DUY K;  4GMJ B;  1ILY A;  3TAN A;  4FWP A;  2X78 A;  3EO3 A;  3NMU A;  4JN4 A;  1S6P A;  4KBO A;  2VGN A;  1I94 K;  2NUB A;  3KLH A;  3WXJ A;  3KLI A;  4IO9 L;  3VN5 A;  2QKK A;  3K2P A;  1ASV A;  5DMR A;  1S9G A;  3HXM A;  4M45 A;  2E2Q A;  2YHW A;  5AQI A;  4BRN A;  4BRC A;  3M6G A;  1CLQ A;  3LWM A;  4IZ9 A;  3OY9 A;  1W2B M;  4EZ6 A;  3KJV A;  5HBM A;  3CJ1 A;  4DSI A;  2BAN A;  3SI6 A;  1QQM A;  3QFU A;  1JLC A;  2P9P B;  3QET A;  4LF5 K;  2Q31 A;  4JI3 K;  3TAR A;  1ZC6 A;  3LL3 A;  5IT9 O;  1IKY A;  2Z1H A;  3HRG A;  2G8H A;  4M3U A;  2E2N A;  4K8Z A;  1S22 A;  4BG9 A;  2WOM A;  5I42 A;  3OW2 M;  4OPA A;  4DTM A;  3ZT1 A;  4FXD A;  3HOS A;  4DF4 A;  3C7N B;  3ZSQ A;  4CEA A;  3CCJ N;  4E7L A;  4YFU A;  2QWR A;  5AFU H;  4DSL A;  3AO3 A;  4BR7 A;  5HL7 L;  2O8B A;  3MN6 A;  4LF9 K;  4LFB K;  4MDA A;  5JLF A;  4I2Q A;  4FLZ A;  3ZSR A;  4E7I A;  3OYB A;  4CHQ A;  3EKS A;  1WAF A;  5JMV A;  4CEC A;  2Q97 A;  5AQV A;  1J9A A;  4CF1 A;  3AO1 A;  3IKM A;  1VQ8 N;  3THX B;  2D0A A;  2YNH A;  4K43 A;  3CME N;  4JV5 K;  3MCA B;  2Y1I A;  5BR9 A;  3M1F A;  2IDO A;  1RT5 A;  4B9V A;  3V6D A;  1VQP N;  2I5J A;  3J81 O;  3LP1 A;  4JK9 A;  4H0O A;  3F9K A;  2O8D A;  3U9D A;  4Z4H A;  3R3L A;  3TAF A;  4E7K A;  4FWN A;  4PUO A;  4DV3 K;  3LP0 A;  5FRO A;  4A5A A;  3TSP A;  2QWL A;  4KH4 A;  4CJ5 A;  1DEJ A;  1V4T A;  4CJS A;  3LP3 A;  1N36 K;  3DMJ A; 
#chains in the Genus database with same CATH homology
 2IVO A;  5AQU A;  1YUW A;  3F9M A;  4PKG A;  5JVH L;  3MWP A;  3JXU A;  1VQN N;  4H03 B;  1NGE A;  4PHT X;  3KVG A;  2A41 A;  3ID6 A;  5LJW A;  2QA4 N;  2HBJ A;  5DM7 L;  4IFE A;  4B1Y B;  4CD3 A;  3H3O B;  4JKF A;  3MDQ A;  2DPN A;  3D2F A;  3DXK A;  2P9U A;  3CPW M;  2ASP A;  4BQL A;  5BN8 A;  1BA0 A;  3CCS N;  3DLL L;  3OBW A;  2GX9 A;  1HKC A;  3MCP A;  3WXI A;  3MN5 A;  1NMD A;  3CJA A;  4CZE A;  3MX2 A;  4BRH A;  1TYQ B;  4ISF A;  4WYB A;  3BF3 A;  5AZJ B;  4DB3 A;  4WF9 L;  3VEX A;  3FZF A;  4PL7 A;  3C6H A;  3CIP A;  3R1X A;  3CCQ N;  4FOE A;  3SK3 A;  1VQK N;  3HOT A;  1VQL N;  3CCL N;  3IMX A;  3K9J A;  5C10 A;  2NRR A;  1Q7Y O;  3SMP A;  5EY4 A;  3O9U A;  2HBL A;  5EVZ A;  5AZI B;  4RTF D;  3TTF A;  1YI2 N;  1LOT B;  1G99 A;  2ZWH A;  3UB5 A;  3ZET A;  1DKG D;  3ZX2 A;  3FZK A;  2NZT A;  3CC4 N;  1YJW N;  5GAH P;  1GLF O;  1S72 N;  4HTL A;  3BUZ B;  2V7Z A;  4H0T B;  2V7Y A;  3NVM A;  2P9I A;  1NGI A;  3J7Z O;  3HI0 A;  2P9P A;  3TTC A;  3CJC A;  3FZL A;  4HWI A;  3CC2 N;  3H46 O;  1OVY A;  3I33 A;  4WCE L;  1Q81 O;  4JKC A;  3M3Z A;  3RSE B;  5AQK A;  1NGB A;  4XH1 A;  2D0P A;  3QB0 A;  1BOT O;  1J6Z A;  2D1K A;  1BU6 O;  2NNW A;  4B1U B;  1YF5 L;  3HSC A;  3SLC A;  4BR9 A;  3MMV A;  4H0V B;  3LDQ A;  4YDU A;  4B1X B;  3O5B A;  5CHI A;  1N8R O;  4XH5 A;  4WQ5 A;  1NBW A;  4CZL A;  1VQM N;  3L0Q A;  5AQX A;  2P9K A;  4MDB A;  3DAW A;  4C1N K;  3A5N C;  3U9Z A;  1IG8 A;  3C7N A;  3O8M A;  4AF1 A;  4B1V A;  1KAZ A;  3NVK A;  2D4W A;  2W41 A;  4WFA L;  3AY9 A;  2WBN A;  1T44 A;  4ILG B;  5E84 A;  4LC9 B;  1NGA A;  4A57 A;  4BGB A;  2KHO A;  3UKU A;  4I6M B;  2YJE A;  3A5O C;  2D0O A;  3L6Q A;  4ISG A;  4CZJ A;  4AM6 A;  3K9K A;  4KH6 A;  4GY2 B;  4YOT A;  5BPM A;  4GV6 A;  4BRI A;  2V52 B;  3ULE B;  1K8A O;  2A6A A;  3CHW A;  3O9T A;  3QBX A;  3N4Q A;  2A5X A;  3WEE B;  2Q1N A;  2YI1 A;  4BRD A;  1R59 O;  4O8K A;  4A2A A;  4IEI A;  2CH6 A;  1YJN N;  4C1N I;  4CZF A;  4WQ4 C;  5AQS A;  4BVP A;  1OKJ A;  2ZJR L;  3SJH A;  3MN7 A;  3ENB A;  1GLL O;  2P9L A;  4EAH D;  3LDO A;  5EOY A;  2IVN A;  4BRK A;  4PKI A;  3FZM A;  2Q0U A;  4RCH A;  4BG8 A;  4JKH A;  4IWV A;  3WXL A;  1LCU A;  5I9E B;  4GV3 A;  2JWK A;  1Y64 A;  5MLC Q;  1IJJ A;  3SAF A;  4C23 A;  3ZEU B;  3VEW A;  3P4I A;  1Z05 A;  2NRV A;  3AGK A;  3LDL A;  4JNE A;  1NGG A;  3EE8 A;  5FPM A;  1HKB A;  3D2E A;  2VWB A;  4JHD A;  3GL1 A;  1ATN A;  4U7B A;  1RGI A;  1S3X A;  4RWT A;  2KLA A;  3P39 A;  3VGM A;  3B8A X;  2E1Y A;  3OHR A;  1WUA A;  1Q86 O;  1RFQ A;  1QHA A;  4JD2 B;  2WFB A;  1QZ6 A;  5E26 A;  2VGM A;  5AQL A;  4A61 A;  4EHT A;  4G9Z A;  2QWN A;  3AGR A;  2FLO A;  4BR5 A;  1U2V B;  2YJF A;  3MN9 A;  4UY8 O;  1SZ2 A;  3TTD A;  3O1W A;  2FSJ A;  5ADX A;  3TSQ A;  1U6Z A;  4K25 A;  5BRD A;  4FWK A;  3F5T A;  4YOR A;  3UE5 A;  4JKG B;  4O8U A;  2YHX A;  5GIO A;  3VEO A;  2FSK A;  2VYP A;  2GUP A;  2OAN A;  4PL8 A;  5B8H A;  5JLH A;  5KPZ A;  1GLJ O;  4BQZ A;  3KZB A;  4EHU A;  4IOA L;  3O9R A;  3LM9 A;  1P8Z A;  5BN9 A;  3DJC A;  2QWO A;  3HBT A;  3Q7C A;  3MWT A;  5EXW A;  5BPL A;  1CZA N;  2IVP A;  3ENO A;  1TYQ A;  4CJ7 A;  3A5L C;  4EFH A;  5BPN A;  4NO7 A;  4MO4 A;  5M1F A;  3VEV A;  3M5R A;  5KPT A;  2YHY A;  4BR0 A;  1T6C A;  3CJ9 A;  3SMS A;  3CF5 L;  2OTL N;  2CH5 A;  5CR4 A;  4ISE A;  3AAR A;  2QTD A;  2QWP A;  4A59 A;  3CCR N;  4FWO A;  1XUP O;  3O9Q A;  4M7X A;  1SAZ A;  3VET A;  1KD1 O;  2CGK A;  5AZI A;  3KK7 A;  3D2F B;  4CZG A;  3L4Q A;  5KPR A;  5AQN A;  5AQM A;  1NGH A;  3CI5 A;  2NRW A;  3G25 A;  3P38 A;  4DQ8 A;  4Z94 A;  3CJ7 A;  2NRH A;  4FO0 A;  4BRG A;  4DHY A;  5AQG A;  4CZH A;  1WOQ A;  3BEX A;  4BRL A;  3VTH A;  4NLB A;  3KHY A;  3CXC M;  2P9S B;  5BRF A;  3HZ6 A;  2ZGZ A;  2ZF5 O;  2QWQ A;  2HF3 A;  4MO5 A;  5AQY A;  3W3D A;  2PAV A;  1ZBS A;  3BF1 A;  3O4W A;  5GIP A;  1BWF O;  3I56 N;  5BRE A;  3ATV A;  4FVU A;  3AAP A;  3VMF B;  3T69 A;  3PLA A;  3LM2 A;  5TKY A;  1KC8 O;  3GDQ A;  1E4G T;  1BA1 A;  4B9Q A;  3FE1 A;  3ZET B;  4J8F A;  3VER A;  4A5B A;  1ATR A;  1GLA G;  3CJB A;  4WFN L;  5JVG L;  1QQN A;  3E9L A;  4H0Y B;  1HKG A;  2KKZ A;  5KQ8 A;  1HPM A;  2IIR A;  4JAX A;  4BRQ A;  2P9N B;  3E66 A;  2JWL A;  4CI6 A;  2E2O A;  4IEE A;  1JJ2 M;  3WUH A;  4H5T A;  5GAD P;  1MA9 B;  3KWG A;  1VQ7 N;  4K42 A;  3H45 C;  4WFB L;  1YAG A;  4H5W A;  1JCF A;  2E88 A;  2HST A;  2HBM A;  1NJI O;  3VOV A;  2CGJ A;  3N4P A;  3R6M A;  1VQ5 N;  3GG4 A;  3A5M C;  3WT0 A;  2RE2 A;  4I6M A;  3G6E N;  1T3V A;  2ASO A;  1QVG M;  3WQT A;  3H1Q A;  3CQY A;  3EZW A;  3O80 A;  4QS9 A;  5AR0 A;  4BRP A;  3OA9 A;  3SAG A;  3CPE A;  1YJ9 N;  3ULE A;  2BTF A;  2I7P A;  3H6E A;  1HLU A;  1GLD G;  1X3M A;  2Q2R A;  3WEE A;  3EKU A;  1H1V A;  3RVC A;  5DM6 L;  3CCU N;  2F9T A;  2WC9 A;  3F2K A;  1X3N A;  3BP8 A;  2ITM A;  4BR2 A;  4BVO A;  4H5V A;  2EWS A;  4JKE A;  3VGK A;  4BRO A;  3UKR A;  4A62 A;  1TUU A;  3CET A;  1T6D A;  3G71 N;  1GLB G;  1K73 O;  1VQ4 N;  4AM7 A;  5JIC A;  3QDK A;  4DCH A;  5C12 A;  1VQ9 N;  1BDG A;  1Q82 O;  2BH1 A;  5AQO A;  2ZJQ L;  5ADX H;  1NM1 A;  2F7T A;  3SBT A;  4M7Y A;  4KH5 A;  3JS6 A;  1VQ6 N;  2I7N A;  4FPB A;  5KQD A;  4FWR A;  4BRE A;  3I55 N;  2OTJ N;  1K9M O;  2E20 A;  3VF6 A;  3E1Y A;  3H3N O;  3MX5 A;  4Y0W A;  4BRM A;  1NGJ A;  2Q0R A;  3PIO L;  2PFU A;  5C0Y A;  3S41 A;  3W0L A;  3DXM B;  4YDU C;  3U8X A;  4PKH A;  2NRX A;  4GVE A;  3CCV N;  4WQ5 C;  3EL2 A;  4IOX A;  2RHK A;  4M63 C;  4OO1 J;  3C0B A;  3Q7B A;  3SBG A;  1XC3 A;  2QM1 A;  4FPA A;  2QI2 A;  4JD2 A;  3AAQ A;  3HTV A;  3QML A;  1ESV A;  2BUP A;  5AQR A;  3O6W A;  1YIT N;  5AFU A;  1K8K B;  2HF4 A;  3L4I A;  3QFP A;  4GNI A;  1U2V A;  3WXM B;  3O1B A;  4FWL A;  2PBD A;  5LY3 A;  4YOU A;  2VCP A;  3VES A;  4YOY A;  1MDU B;  2Q36 A;  5TKW A;  3EN9 A;  3I8B A;  4CZI A;  5C2F A;  3A8Y A;  5AQZ A;  4DKW A;  1HX1 A;  2FSN A;  1QZ5 A;  3TSU A;  1YIJ N;  4BC3 A;  3PIP L;  1RDW X;  4YOV A;  4NB4 A;  4ILJ A;  2GEM A;  3TU5 A;  3ATU A;  3CD6 N;  4IOC L;  1VQO N;  4H0P A;  4K41 A;  5AQH A;  2WUS A;  3QIC A;  4IXC A;  2QWM A;  3CMA N;  3KWI A;  4YOX A;  3ZYY X;  2HBK A;  2ZGY A;  2NRZ A;  2QW9 A;  5F1X A;  4JKB A;  4FSV A;  4BC2 A;  4F9O A;  5AZJ A;  4B1W B;  3G4S N;  1Q18 A;  4CBU A;  1MWM A;  2HOE A;  4JEP A;  4MLE A;  3R8E A;  5CE3 A;  5AQQ A;  2FXU A;  5ELZ A;  4BRA A;  1ATS A;  2FF3 B;  3J8A A;  4H5R A;  1HJO A;  2GEL A;  1C0G A;  3CCM N;  3IUC A;  4NLC A;  3VGL A;  2W40 A;  5C2D A;  4GV9 A;  1ILY A;  5F0X A;  3H1V X;  5AQJ A;  3DXK B;  3GBT A;  2P9U B;  2ASM A;  4FWP A;  3FZH A;  2H3G X;  3EO3 A;  4B1Z A;  3NMU A;  1ZXO A;  4JN4 A;  4KBO A;  5LJV A;  2VGN A;  1KQS M;  4BC4 A;  1NWK A;  3T7Z A;  3WXJ A;  3ID8 A;  2P9S A;  3VEN A;  1DGK N;  3TPQ A;  3GOI A;  5C15 A;  4IO9 L;  1NGD A;  3O08 A;  3P31 A;  4FWQ A;  3EE9 A;  1QVF M;  2E2Q A;  3RSE A;  4XEI A;  2E1Z A;  2YHW A;  3DWL A;  1XQS C;  2J4R A;  5AQI A;  4BRN A;  4BRC A;  2GTD A;  1BG3 A;  3M6G A;  4FWS A;  5GAG P;  3VEY A;  3WQU A;  5GIN A;  5HOO A;  3VTI A;  4L3Q A;  4JK7 A;  4WQ4 A;  1W2B M;  4IZ9 A;  4QS8 A;  3R9P A;  1NGC A;  2P9N A;  3CJ1 A;  1HUX A;  2A3Z A;  2P9I B;  4JK8 A;  1QQM A;  3QFU A;  1D4X A;  2P9P B;  1GLC G;  3ENH A;  3QBW A;  5FPE A;  4BY9 C;  2Q31 A;  1QQO A;  3LDP A;  2ZJP L;  3IDH A;  1GLE G;  3VF4 A;  2GWJ A;  2AA4 A;  1ZC6 A;  3LL3 A;  4CBW A;  1Z6R A;  3HRG A;  4JKA A;  1M1K O;  3FGU A;  2E2N A;  1S22 A;  4XH4 A;  4CZK A;  2AP1 A;  2FF6 A;  3VEZ A;  4BG9 A;  1DT9 A;  3LDN A;  5M1O A;  2V51 B;  3O9S A;  4QS7 A;  3VPZ A;  3OW2 M;  4OPA A;  2HMP A;  1YHQ N;  3HOS A;  3D6R A;  3ZX3 A;  2P9K B;  1TUY A;  3C7N B;  2YX6 A;  1NGF A;  3CCJ N;  4BRF A;  2QWR A;  5AFU H;  2F9W A;  4CBX A;  2A42 A;  1JCG A;  2GWK A;  4BR7 A;  5HL7 L;  2A40 A;  3FLC O;  4OPH A;  3MN6 A;  5M1N A;  5BRH A;  1P90 A;  1EO1 A;  1KAY A;  1KAX A;  1VAZ A;  3D7E O;  4MDA A;  5JLF A;  5EX5 A;  3UKU B;  3WXK A;  1MWK A;  4IO8 A;  5FPN A;  3EKS A;  5JMV A;  1E4F T;  1EQY A;  2Q97 A;  5AQV A;  3SAH A;  3ZEU A;  4JKD A;  1BO5 O;  3IKM A;  4H0X B;  1VQ8 N;  1M90 O;  2QXL A;  4IJN A;  4CZM A;  3CQX A;  3DXM A;  4BC5 A;  4K43 A;  3UKR B;  5FPD A;  3MK6 A;  2P9L B;  2E8A A;  3CME N;  3MCA B;  5BR9 A;  4H5N A;  3M1F A;  4ILH A;  4BGA A;  2E2P A;  1JCE A;  4YOW A;  5AQP A;  2QEX N;  3GE1 A;  1BUP A;  1KXP A;  4IJA A;  1K8K A;  1VQP N;  4A2B A;  5AQW A;  1SQK A;  4IDH A;  4JK9 A;  3CCE N;  4H0O A;  1O13 A;  3A0I X;  3IFR A;  3U9D A;  2NRT A;  3CER A;  3OBY A;  3R3L A;  5F2R A;  5AQF A;  4JKG A;  5M1P A;  3D2E B;  3FFK B;  4JHD B;  4MLH A;  4R79 A;  4FWN A;  5GAE P;  5M1Q A;  3C65 A;  4U67 L;  3FR0 A;  4FOI A;  1C0F A;  1YXQ A;  3VF2 A;  3E9P A;  4A5A A;  1RDU A;  3TSP A;  2QWL A;  1X9J A;  2CGL A;  4KH4 A;  4O5F A;  3U4L A;  3ZX0 A;  1DEJ A;  3CC7 N;  1W97 L;  1V4S A;  3HM8 A;  1V4T A;  1SS6 A;  3C6A A;  4FL9 A;  1YVN A;  2NLX A;  4EIA A;  3E9O A;  2UYT A;  5H1S Q;  5AQT A;  4BR4 A;  4FWM A;  5M1K A;  1NLV A;  4E1J A;  2YCH A;  4CD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...