3BEXA

Type iii pantothenate kinase from thermotoga maritima complexed with pantothenate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
248
structure length
248
Chain Sequence
b'MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 77
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bexA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bexA02
2A3ZA 2IIRA 1QQNA 3VGKA 1E4FT 1NGEA 2FLOA 2HF3A 2GUPA 2ZGZA 5AZIA 3BUZB 2E2NA 2Q0UA 4AM6A 4BRDA 3DAWA 2HOEA 3O4WA 5JLHA 4A61A 4BRPA 2A41A 2VYPA 3IFRA 3H3NO 1ATRA 3A5OC 4MLHA 2BUPA 1Q18A 3A5NC 5AQXA 4FPAA 1HKCA 3GL1A 4I6MA 5AQIA 5EVZA 2FF3B 3WXLA 1YXQA 5ELZA 3AAPA 3AY9A 3MK6A 1KAXA 2QW9A 2GTDA 3VEVA 5AQGA 1BG3A 1JCFA 2GWKA 3H6EA 4IZ9A 3CIPA 3LDQA 4A2BA 3UKRA 3O5BA 1JCEA 4FO0A 1S3XA 3U4LA 3MDQA 4DQ8A 3MMVA 2P9PA 1QZ6A 2WUSA 3EL2A 3O1BA 2P9LB 2Q2RA 4FPBA 2FSKA 4FOIA 4XEIA 4Y0WA 3A5LC 1GLFO 4BRIA 1T44A 1U6ZA 1NWKA 4JHDB 2A40A 3R8EA 1ZC6A 2E88A 3C7NB 1R59O 2A6AA 4CBUA 2P9NB 5FPDA 3CJ7A 3M3ZA 1BDGA 1GLAG 1U2VA 3CJ9A 1YUWA 2F9TA 3GOIA 1J6ZA 4H03B 4MO4A 4GY2B 3ZX0A 2YJFA 1XC3A 3VOVA 1X3NA 4FWSA 2ASMA 3FZHA 3L4IA 1BOTO 3CJCA 5AQLA 3IDHA 5FPEA 1QQOA 1HPMA 3D7EO 3WEEA 2J4RA 5EOYA 2EWSA 3FZMA 1GLBG 1SQKA 1EQYA 4BRHA 1TUYA 5BREA 1P8ZA 2P9UA 1HX1A 4K43A 3MN9A 4BRQA 1NGDA 4O8KA 3CERA 2V7YA 1QHAA 3QB0A 4BR2A 1GLJO 3L0QA 2HF4A 3UE5A 2PBDA 3QICA 3U8XA 3D2FB 3CI5A 4XH4A 4YDUC 5AQYA 3SLCA 4BC5A 5EXWA 4H5TA 4M7YA 3QMLA 2CH5A 4BR4A 5AQNA 4E1JA 5AQUA 2E1YA 3H1QA 3TU5A 5LJWA 2QWQA 3JXUA 3VESA 4PKIA 3BP8A 4DCHA 2D0OA 3QDKA 3M1FA 1V4SA 2GELA 4NB4A 3WUHA 3KVGA 1NGBA 1SZ2A 3JS6A 2CGKA 2E8AA 4CZJA 5CE3A 4H5RA 5AQRA 1GLDG 2Q97A 5AQHA 4BVOA 4EHTA 5AQKA 1CZAN 1ATSA 2ZWHA 4JD2A 4FWRA 3WXJA 4BROA 3WT0A 1HKBA 3LDPA 2W41A 2QWLA 3VETA 3VEZA 1NLVA 3ZX3A 3ZEUB 4Z94A 3DWLA 5LJVA 4XH5A 4CZIA 3GDQA 3UKUA 5E84A 3KHYA 4BR5A 4BREA 3G25A 2H3GX 4BGBA 2D0PA 2QWRA 3I8BA 4M63C 3DXKA 1LOTB 5AZJB 2P9IA 4C23A 5AQPA 3D2EB 4WYBA 2ZGYA 4CZHA 2W40A 4F9OA 5AQSA 1HKGA 4ISFA 5AFUA 3GBTA 4FWQA 4JNEA 3DXMA 3A5MC 1NBWA 3HTVA 5AZIB 3DJCA 4CZEA 1QZ5A 4DHYA 3SJHA 3FZKA 2ITMA 3VF6A 1WOQA 4HTLA 2YI1A 2FSJA 2QXLA 2AP1A 3A8YA 1T6DA 3ZETA 1TYQB 3H3OB 1HJOA 2NLXA 3FLCO 1XQSC 4H0PA 4HWIA 4YDUA 3VENA 4I6MB 5I9EB 4BRAA 4BR7A 4L3QA 1XUPO 3RSEB 4B1WB 4IJAA 1H1VA 1V4TA 2QWNA 3MN5A 1MDUB 5BPMA 1NGCA 2OANA 3GE1A 3LM9A 3UKRB 3QBWA 4BR0A 3VEWA 2NZTA 3FZFA 2ASOA 2QWOA 3VGLA 3W3DA 3CJ1A 4CJ7A 2P9PB 5TKYA 2Q31A 2D1KA 3QFPA 1GLCG 1SAZA 5F2RA 3ULEA 2CGLA 5BN8A 1E4GT 2P9KA 5BRHA 5AQMA 2P9SA 1LCUA 4B1XB 2YJEA 4K41A 3LDOA 2UYTA 2HMPA 4RTFD 3ENOA 2IVPA 3EKUA 2I7NA 2D4WA 4H5VA 3CHWA 1U2VB 2NRHA 2IVNA 3ATVA 4FSVA 1MWKA 2QWMA 3EKSA 4KBOA 3FGUA 2KHOA 4BRGA 2YHXA 4BRCA 1K8KB 4B9QA 2A5XA 5KPRA 2FXUA 4BC3A 4NO7A 3HI0A 3I33A 5BRFA 3WEEB 4IO8A 4CZLA 5EX5A 2VCPA 4BR9A 3VF4A 4K25A 1YAGA 3VERA 3ZX2A 4EAHD 1OKJA 2QM1A 1JCGA 4IWVA 4CD3A 3EZWA 2P9UB 3IUCA 4K42A 3FE1A 5ADXH 5AQZA 4MO5A 3CJBA 3HBTA 4MLEA 4FOEA 1WUAA 1BU6O 3VF2A 1T6CA 3O6WA 5JMVA 3VPZA 5ADXA 5AQVA 1MWMA 1GLEG 1BA0A 3CJAA 4BC2A 5AQWA 4PL7A 3L6QA 1NGGA 1NMDA 3WQUA 3ID8A 1NGJA 3CQYA 3ZEUA 4BG9A 1NGFA 5KPTA 2YHYA 1HUXA 2FSNA 3C0BA 5B8HA 4FWMA 2V7ZA 1IJJA 3WXKA 3ATUA 3O8MA 2QWPA 5BR9A 5KPZA 3BF1A 3IMXA 2ASPA 1RDWX 4H0VB 5AZJA 5AFUH 4JD2B 1HLUA 1NGIA 3OHRA 3AARA 3HM8A 3WXIA 3SMPA 3AAQA 3FFKB 5AQFA 4IJNA 4BG8A 4PKGA 4DB3A 5FPNA 3UKUB 3VEYA 4CBXA 2E2OA 1X3MA 4CI6A 1BA1A 3A0IX 5E26A 3LM2A 1GLLO 1KAZA 4BRMA 1NGAA 2V51B 2Q0RA 4RCHA 1RGIA 4BVPA 1C0FA 3DXKB 4FWPA 3TPQA 4A2AA 2P9IB 1KXPA 2FF6A 1BO5O 1TYQA 3U9ZA 1MA9B 1G99A 2ZF5O 2P9LA 5BN9A 1Z05A 3EO3A 4QS7A 4WQ5A 3RSEA 1TUUA 3LDNA 3DXMB 5FPMA 2YHWA 3U9DA 4JHDA 5F0XA 4BC4A 4CZGA 2Q1NA 2CGJA 4EHUA 3H45C 3C7NA 4CZFA 4WQ4C 2P9NA 1S22A 2AA4A 1ZBSA 3HZ6A 1D4XA 1NGHA 3LL3A 1QQMA 3SK3A 3ZETB 4GNIA 3QFUA 2E2PA 3CETA 1YVNA 3J8AA 3R9PA 1KAYA 3HSCA 5BRDA 4H5WA 3VGMA 4ISGA 4QS9A 2F9WA 3F9MA 2E20A 4FWOA 1DEJA 5BPLA 5KQDA 4ISEA 3BEXA 2YCHA 1ESVA 3P4IA 2I7PA 4B1VA 2A42A 5BPNA 4BQZA 5JLFA 3B8AX 5JICA 5LY3A 3H46O 4H0YB 4PL8A 1K8KA 3M6GA 2V52B 3ULEB 1ZXOA 1Z6RA 1BWFO 4H5NA 5AQJA 2P9KB 5EY4A 4BRNA 2E1ZA 4J8FA 2PAVA 1NM1A 3D2FA 2P9SB 2GWJA 4WQ5C 3UB5A 5AR0A 4LC9B 3S41A 2Q36A 4CZMA 4AM7A 3QBXA 1IG8A 3MN6A 3CQXA 3FZLA 4XH1A 1C0GA 1BUPA 2DPNA 3W0LA 1DGKN 1RFQA 3H1VX 4FWNA 3VEOA 3WQTA 3GG4A 4CD1A 3MN7A 4IXCA 4BGAA 3O08A 4H0TB 1DKGD 4BRFA 4B1YB 2IVOA 4QS8A 2CH6A 4B1ZA 5AQTA 1Y64A 4JAXA 4CZKA 4M7XA 4FWLA 3KZBA 4BRLA 4A62A 4WQ4A 4H0XB 4B1UB 1X9JA 3BF3A 5KQ8A 4O5FA 5AQOA 4EFHA 4H0OA 3VEXA 3SMSA 5F1XA 3EN9A 2E2QA 4FWKA 4EIAA 2BTFA 4PKHA 3FR0A 4FL9A 3D2EA 3O80A 5AQQA 4RWTA 4CBWA 3R6MA 2GEMA 3LDLA 3MCPA 2VWBA 4JN4A 4BRKA 1ATNA 3O1WA 4BQLA 3ENHA
chains in the Genus database with same CATH superfamily
3DRPA 4B9UA 1QQNA 3V1RA 2GUPA 5AZIA 1C0UA 4DSEA 3DLHA 3AVIA 4FW2A 4CJFA 3NH0A 3O4WA 3CXCM 2A41A 3SPZA 4C8MA 4RW4A 2RE2A 3CD6N 1VRUA 2QEXN 5AQXA 1HYZA 2HNYA 5ELZA 1TK8A 4JI7K 3SUPA 3AVJA 4YHHK 5FROA 3ZSQA 2ZM6K 3PO4A 4KHUA 3P83D 3CIPA 3KD1E 3O5BA 4B9SA 1S3XA 4DTMA 3MDQA 4O0IA 1JLQA 2WUSA 3L2RA 1OH6A 2FSKA 4DFMA 4E7HA 1RCHA 1KTQA 4LF8K 1VSIA 1U6ZA 4DFKA 3DLKA 3SBTA 2A40A 5AJ3K 1VQ5N 1ZC6A 1LAVA 2E88A 3C7NB 2A6AA 2Z1JA 4FLWA 2P51A 1U2VA 2RF2A 4KTWA 1RBUA 1YUWA 3QO9A 3ZX0A 4H03B 2HBMA 2ZJQL 1IG9A 1YVUA 1UAXA 4O5BA 5SWMA 4FWSA 3L4IA 3IDHA 4GW6A 1S9GA 1QVFM 3LAKA 4CF9A 1VQ8N 4QOZB 1TVRA 3H08A 4M3ZA 4B8CA 3HP6A 5BREA 2P9UA 4CESA 1HX1A 1LW2A 1NKCA 2V7YA 2O8BB 1YITN 1YF5L 4H8KA 5AQYA 4AHSA 1U45A 2HSTA 3QMLA 3SYZA 4E1JA 3U6FA 3VQQA 1S72N 3H1QA 5LJWA 2EX3A 1J54A 1KCFA 2D0OA 2QI2A 3R3LA 1V4SA 1Q7YO 3LPUA 1OH5A 1SZ2A 3O9UA 3E9PA 4CZJA 4EHTA 3MXJA 1CZAN 4IEEA 2ZWHA 5J2MA 1HKBA 4CF8A 1GOCA 3E01A 4DV1K 3VA3A 4KHNA 1WBDA 2UU9K 5E84A 2H3GX 4DSFA 3THYA 2KKZA 2D0PA 4E19A 4CJTA 2NRWA 1LWEA 4W5TA 1UWBA 1HJRA 3PIOL 4CZHA 3NE6A 2VQEK 3KK7A 4IOCL 4F9OA 5AQSA 3THVA 3GBTA 2QXFA 3N4PA 3HTVA 4BDYA 4CZEA 1QZ5A 2XO7A 1Z26A 1WOQA 4HTLA 2QXLA 2AP1A 5T7BA 3NGYA 1SV5A 3H3OB 4H0PA 2IGIA 4YY3K 2QKBA 4DTXA 3NBPA 4M3WA 4DR7K 1H1VA 1V4TA 1O1WA 5DK5A 3QNOA 4FJHA 2ITGA 4FLXA 2OANA 3UKRB 4DSIA 4CEOA 1R0AA 4FZYA 1RTDA 3W3DA 4CJ7A 5TKYA 3NF8A 2XRIA 4OKJA 5M1NA 2D1KA 5F2RA 3C95A 5BN8A 1J5EK 4DV3K 3K0SA 4CK3A 5AQMA 3SAFA 4ELTA 1BL3A 2P9SA 4B1XB 3G6EN 4KAZA 3HM9A 4I7FA 3DM2A 4K41A 3J80O 4KREA 5CZ1A 4B9LA 3ENOA 2IVPA 4DF4A 2I7NA 2D4WA 3DMJA 1XI1A 1XHXA 3CHWA 3CCJN 3HVRA 2QWMA 3EKSA 4KBOA 2KHOA 4BRGA 4BRCA 2G8FA 1XHZA 2XHBA 3QESA 4NO7A 4CJPA 4KO0A 3SV3A 5HOOA 1JXBA 5BRFA 3K58A 1EETA 4IO8A 5FDLA 4CZLA 5EX5A 1HNWK 2VCPA 2W6KA 4DU4A 3P31A 2QM1A 4IWVA 2VGNA 3V9SA 4K42A 1A5VA 4KB1A 3CJBA 2ZJRL 1T6CA 3O6WA 4DTUA 4Z4GA 1BISA 2OPSA 4IDKA 4NCBA 4DQSA 3EE8A 4QAGA 5AQWA 3L6QA 1NGGA 5C0YA 4JKAA 4DUZK 4CJLA 2YHYA 4JYAK 3C0BA 3MX2A 2UUCK 3C6TA 2WOMA 3WXKA 3O8MA 1TKXA 3MCAB 1RDWX 1NJZA 1TGOA 5AFUH 4JD2B 4CE9A 3HPOA 3PY8A 4IKFA 1D5AA 1L5UA 3AAQA 3FFKB 4DSLA 4BG8A 3LDSA 1N32K 4AF1A 4DB3A 4KH4A 3UKUB 3VEYA 2EHGA 4DR5K 3K9JA 3NGZA 3LM2A 1GLLO 1KAZA 3ZSVA 4FLUA 4RCHA 1U4BA 1TKDA 1HYSA 3DXKB 4CJQA 3VTHA 5GAEP 3SQ4A 2FF6A 3RVCA 4HCBA 4B08A 3KLHA 2WTUA 3EO3A 4QS7A 4GV9A 3V4IA 2OZSA 1A5XA 1TUUA 3AVLA 3LDNA 5FPMA 3OYCA 3TAGA 4JHDA 2FBTA 3L2WA 1SL2A 4Z0UA 3P1GA 4CZFA 1S22A 4JI6K 3RMDA 1NGHA 4DSJA 1QQMA 3Q7BA 3SK3A 5JVHL 4F2RA 3CYMA 4JRPA 3ZSZA 2E2PA 3CETA 2KZMA 3VGMA 3MXIA 2O8FB 4ISGA 1KVAA 2B6AA 2BE2A 4CFDA 2BDPA 1NMNA 2VG7A 3ZSXA 5BPLA 5KQDA 1ESVA 3SNNA 5M1PA 4FJJA 5LY3A 3H46O 1ZBHA 5M1FA 3DRSA 3M6GA 3TI0A 2D0BA 3ZT0A 5SZTA 1T8EA 4ICLA 4IG0A 4OPHA 3O3FA 4BRNA 2E1ZA 4J8FA 4X66K 5HBMA 1CXUA 1XMOK 4KH5A 4NCAA 4CJWA 3KLGA 4FK0A 4N76A 2OTJN 3PO5A 5KGWA 3TARA 4AM7A 4ILJA 1JL2A 1IG8A 1M1KO 4ILGB 1FKPA 3L8BA 1BUPA 2DPNA 1RFQA 2OA8A 3K2PA 4FWNA 3LWMA 3WQTA 1BHLA 4BGAA 3SAHA 3D0PA 4H0TB 2G8KA 3T1YK 4B1YB 1JJ2M 1T7PA 2CH6A 3TR8A 4B1ZA 3P38A 3OYDA 4KFBA 3AVMA 1UOCA 3HPGA 1I94K 4FWLA 4JKGB 4B3MK 3M8SA 2YKNA 1HR0K 4WQ4A 3DLEA 1U04A 4B1UB 4CVNE 1X9JA 4FLTA 4H4MA 2UUBK 3DYAA 4EFHA 1EP4A 4H0OA 3IS9A 2O8DA 3J7AP 2BTFA 4PKHA 2F4VK 4KHWA 1QSYA 1S9EA 4RWTA 2D0AA 4CBWA 3LDLA 3I56N 2VWBA 3LALA 4JN4A 1ATNA 5JVGL 2Z1GA 4JS5A 3QIOA 3O9QA 2FLOA 3NCIA 1D9FA 2JGUA 4OGCA 1KC8O 2HMIA 3BUZB 4HUEA 2Q0UA 3IG1A 2O4IA 1VSKA 4RW6A 4U67L 4KHPK 4MDBA 4IBNA 3H3NO 5DMRA 4CJ3A 3WXLA 1HKCA 4GVMA 5AQIA 2KFNA 2FF3B 3WXMB 3MECA 3NF6A 1HQEA 1S1WA 3AAPA 3VQ9A 3QINA 3D45A 5AQGA 4BY9C 3SQ2A 2GWKA 3H6EA 4IZ9A 4DTPA 1JCEA 3G71N 2RKIA 2P9PA 1QZ6A 3KLEA 5DM7L 3O1BA 2P9LB 4FPBA 4CEAA 3T69A 4YFUA 4FOIA 4XEIA 3KWIA 1FK9A 3WNHA 1T44A 1HNXK 1WSHA 5HRNA 2IC3A 1L3UA 1R59O 4B3TK 4FJLA 3SBGA 4CBUA 2BGGA 3OS2A 4KV8A 5GIPA 1BDGA 1GLAG 3RTVA 3CJ9A 3SUQA 1BI4A 3GOIA 4J2BA 1A5WA 2YJFA 3OYKA 2YNHA 2ASMA 3KWGA 3CJCA 5AQLA 1NOYA 4PWDA 2O8CA 1IKYA 1QQOA 5CZ2A 3VQ4A 3WEEA 1KFDA 3OYFA 3V9UA 4A59A 3HOTA 2EWSA 3T1HK 1S1TA 4Y1DA 1TUYA 1ZBIA 2HHUA 1KVBA 5CY4A 4JI5K 4CGDA 4BRQA 3CERA 4A5AA 2ZD1A 3LZIA 3L3VA 1IBLK 3CI5A 3D2FB 4C8NA 4O4GA 1JL1A 2NRZA 2HHTA 4KTQA 3K57A 2P5GA 4BDZA 4DWIA 4FLYA 3HP9A 4HHTA 1N8RO 3NMUA 2GUIA 3QDKA 3U3GA 1VQ6N 4LFAK 3TTDA 1YJNN 1NKEA 2HNZA 4X62K 1HNVA 4FJGA 2CGKA 3ZT2A 2DFEA 2JWLA 3WNGA 2Y1IA 4H5RA 1BQMA 4JI2K 4BVOA 3ZT4A 3OYNA 3JYTA 2VWJA 1ATSA 4CJVA 3WXJA 3VEZA 3ZX3A 3ZEUB 4XH5A 3O9RA 3S3MA 3HL8A 4BREA 1ASVA 3G25A 4YOYA 4GVEA 4BGBA 2QWRA 1SS6A 5AZJB 5CHIA 2B4JA 2P9IA 1U49A 1RTIA 4CJ4A 3AA4A 1QVGM 1VQON 4YNQA 1HKGA 5AFUA 1I3AA 4FWQA 1NK9A 4M3UA 4JNEA 3A5MC 1TKTA 4K8XA 5AZIB 4NXMK 1YTUA 2HHSA 2FC0A 3VF6A 1C1CA 4H4OA 1CZBA 2YI1A 2FSJA 4OPJA 3ZETA 1TYQB 1HJOA 4FVMA 4DMNA 5C10A 3VENA 1XC9A 4LFCK 3EY1A 2HHVA 4ZTFA 4LSLA 5LMUK 1VSFA 1XUPO 4IFVA 4IJAA 3MN5A 5BPMA 1NGCA 1N33K 3OYEA 3LAMA 3GE1A 3QBWA 3VN5A 1VQ7N 4MDAA 3VGLA 2ASOA 2QWOA 5GAGP 3CJ1A 1DTQA 4Z4EA 3MEGA 1W2BM 1GLCG 4AH9A 2CGLA 1LWCA 2P9KA 3J7ZO 4F2SA 1RDDA 3M5RA 4CERA 4WFAL 3AA3A 4DR4K 3M8PA 4ZHRA 1KRPA 4FLZA 3CCQN 4RTFD 3NAEA 4JV5K 1U2VB 2NRHA 1RBRA 3OS0A 4FSVA 4CHNA 3FGUA 4B9QA 2O8BA 2A5XA 4DR2K 4DR6K 5JS2A 2UXDK 3PV8A 3CCLN 3M8QA 4KTZA 4E0DA 1RBTA 1RT1A 4BR9A 4K25A 3ZX2A 1LV5A 4QCLA 4EAHD 4CHOA 1JCGA 4B8AB 3HPHA 2NUBA 2VQFK 5GADP 4CD3A 2P9UB 1JLBA 2QTDA 1HYVA 4CEZA 1WNSA 1WN7A 3VQEA 5ADXH 5AQZA 4MO5A 3HBTA 4FOEA 1WUAA 4JKCA 1Q9YA 4BE1A 1VK0A 3VPZA 1X9MA 4O44A 5K14A 3QEIA 3DLBA 4F8RA 3AGRA 4J2AA 4PL7A 3THWB 3WQUA 2O4GA 1KFSA 3KKSA 3VQDA 3DLGA 1HUXA 2FSNA 5B8HA 2R7YA 3J7YP 4FWMA 4CFBA 4DU1A 1YTAA 1TK0A 5M1KA 4JK8A 5KPZA 1IBMK 2VG6A 3BF1A 3IMXA 4TSXA 3KTQA 3OYAA 3AVHA 4E7JA 1ASUA 1U48A 4CJUA 1LW0A 1NGIA 3VQPA 3HM8A 4IDHA 1RTHA 3WXIA 5I42A 4IJNA 2F7TA 3PX4A 5FPNA 2FBYA 4CBXA 4BE2A 1X3MA 2RN2A 4CIGA 1D8YA 3SJJA 4OPAA 3SZ2A 5E26A 3THYB 3ID6A 3LPTA 4M42A 3CG7A 5CR4A 1RGIA 3HXMA 4KHQA 4FWPA 4A2AA 3OYMA 3ZSYA 2NRVA 3S9HA 1UA1A 1G99A 2OTLN 1Z05A 1N5YA 1JLGA 2DY4A 2JLEA 3ZSOA 3U9DA 4FM2A 4LF7K 5M1QA 5IWAK 4WQ4C 2P9NA 3PIPL 3HZ6A 3RR8A 4GNIA 3KJVA 3V1OA 4I9QA 4FXDA 1WAJA 3KLFA 1QQCA 3CQ8A 4U7BA 4H5WA 5JS1A 3HRGA 2PZSA 2F9WA 4FJ7A 1UA0A 4FWOA 3OA9A 2YCHA 3K5NA 5C2DA 4FZZA 3I0SA 1ZBLA 4CHPA 5BPNA 3TAQA 3B8AX 1Q82O 4PUOA 1BQNA 4H0YB 3T1AA 3OYBA 4C1NK 1XMQK 4CJRA 3C65A 4H5NA 1BWFO 3F2KA 5EY4A 1TL3A 5CYMA 4F3TA 2DTUA 3G4SN 1REVA 1NM1A 1C6VA 2P9SB 1QE1A 4WQ5C 3UB5A 5HLFA 4JKBA 2KLAA 1B92A 3C6UA 2ZQBA 4LF5K 5J1EA 3MWTA 4FJMA 3KK1A 4B9VA 3MN7A 2HB5A 4IXCA 1WLJA 3O08A 1NK4A 4DFJA 4FM1A 4WFNL 1U47A 2YNFA 1C0MA 3HVTA 4NYFA 4JAXA 4LD0A 4M7XA 3CM5A 2B5JA 3CPEA 2KFZA 1VSEA 3KZBA 4IFEA 4A62A 3QIPA 3L4QA 4CGGA 3LP2A 4H0XB 1N6QA 3BF3A 4AQYK 2NRXA 5AQOA 3ASMA 3I8DA 3OYLA 3VEXA 3KLIA 1T05A 3O4NA 1VSJA 3TSQA 3L2VA 2I5JA 4FL9A 3D2EA 3O80A 1VSMA 4I2QA 2GEMA 3T19A 4YOTA 2Z1IA 3O1WA 3ENHA 1QSLA 2A3ZA 2G8UA 3VGKA 1E4FT 3CFRA 2HF3A 1SKSA 2X74A 4LF9K 4AM6A 4X64K 2HOEA 3BY5A 3V9WA 5JLHA 4BRPA 1N34K 3ULDA 2VYPA 2NRTA 3IFRA 1IO2A 1ATRA 4E3SA 5C12A 3A5OC 4DS5A 1Q18A 3A5NC 4KB0A 5C25A 4FPAA 3GL1A 4I6MA 3WNEA 4BWJA 4M3TA 3MK6A 1KAXA 2PYLA 2QW9A 2GTDA 3F9KA 3P39A 3VEVA 3KK3A 1BG3A 1B9FA 4ID1A 2ZE2A 3SPYA 4CGFA 4A2BA 3AVFA 1ZYQA 3CCEN 1VSLA 3OVNA 2UUAK 2VG5A 3EL2A 1P90A 2Q2RA 1RNHA 4KHSA 1VSHA 4Y0WA 3A5LC 4BRIA 3DOLA 1NWKA 4JHDB 3R8EA 3TAFA 3LANA 5FPDA 3M3ZA 1RT5A 5M1OA 1QTMA 4WFBL 1XNQK 2F9TA 4MO4A 4GY2B 3B6PA 4OX9K 1XC3A 3VOVA 3S3OA 4CCHA 1S1UA 1X3NA 3OYJA 3FZHA 3RWUA 2E5LK 3CPWM 5J2PA 1HPMA 1JLCA 1WSIA 4CJEA 1ZBUA 2J4RA 3Q7CA 5EOYA 3O4QA 1GLBG 4HUGA 2O8EA 2XY6A 1P8ZA 1RT3A 3IRXA 4B9MA 4F3OA 4K43A 3MN9A 4C8KA 1NGDA 1RDCA 1QHAA 3QB0A 3PLAA 4BR2A 2D5RA 3THXA 3I55N 3UE5A 3V9ZA 3QICA 3U8XA 2GX9A 3PSIA 3T3FA 2HBKA 1QHTA 1IKXA 5EXWA 4H5TA 5GAHP 4FJ9A 3G10A 2CH5A 3SV4A 4BR4A 5AQNA 1NNEA 1EWRA 4CJKA 3AA2A 5AQUA 4B3RK 1RT4A 3AVCA 2QWQA 4PKIA 4DCHA 4AHUA 1HNZK 4F4KA 2YV0X 1BIUA 2GELA 4NB4A 1OH8A 3WUHA 1NGBA 3JS6A 1S1VA 2ATQA 2E8AA 4C1NI 3PX0A 5CE3A 3HK2A 4DQRA 4BE0A 4IFYA 5HRPA 4FWRA 2QWLA 3TABA 5HP1A 4DLEA 4DQQA 5LJVA 4HUFA 3KHYA 1OH7A 2XY7A 3OJUA 2O8DB 2OCEA 3E9LA 4KRFA 3I8BA 1C0TA 1CXQA 3E1YA 1LOTB 3CM6A 4WE1A 4C23A 3WNFA 3KKRA 3R1XA 5AQPA 1ILYA 2ZGYA 4N56A 3LZJA 3J81O 1JLEA 2W40A 3VQBA 4W5NA 2HVIA 3DXMA 1NBWA 3NHGA 3DJCA 4DHYA 3SJHA 3FZKA 2ITMA 1XWLA 4KPYA 1HQUA 2QK9A 3L2QA 1D9DA 4DV0K 4C8OA 3KIOA 4RG8A 1T6DA 2NLXA 3FLCO 4YDUA 4HWIA 5I9EB 5KGXA 1FXXA 3LP0A 1K6YA 4L3QA 3RSEB 3HOSA 4PHTX 1MDUB 5LL6Z 3LWLA 4AHVA 4X65K 1IBKK 3LM9A 3NGIA 4DTNA 4BR0A 3QERA 2A1RA 3VQ5A 1TKZA 3VEWA 2NZTA 3FZFA 4CEDA 3HT3A 2P9PB 1JLAA 4FW1A 1NK7A 1GOAA 3ZT1A 2E4LA 4JKEA 3QFPA 2NRRA 4V19S 3ULEA 1X9WA 4UY8O 2YNIA 1J9AA 2PY5A 3PUFA 3SUOA 2NNWA 4UQGA 1KLMA 4CECA 4M45A 1OVYA 3QEVA 1L3VA 1K9MO 4XIUA 4DV7K 2YJEA 1SL0A 3LDOA 3O3GA 2KQ2A 4YOVA 2UYTA 1NKBA 4H5VA 3AVNA 1HNIA 1HMVA 3I0RA 1W7AA 2VWKA 5BR8K 3ATVA 2XY5A 1BI4B 2YHXA 1KD1O 3OS1A 3NF9A 1K8KB 4E1MA 4DV4K 2G8HA 4KI4A 1BGXT 5KPRA 1TAUA 2FXUA 4BC3A 3HI0A 3HO1A 4KHYA 3I33A 3ZSRA 3WEEB 1GOBA 4DTJA 3OYHA 4YOWA 4CGHA 4FM0A 4LF4K 5FRMA 4AHRA 3VERA 2F8SA 2X78A 4AHTA 5TKWA 1NG9A 4LH5A 3IUCA 3FE1A 3CCMN 3TANA 3ZCMA 1LWFA 4CJ5A 4MLEA 4GMJB 3DRRA 1BU6O 3OYIA 4B9NA 3QEPA 1IH7A 5JMVA 5AQVA 3CCUN 1BA0A 1NJXA 3AO3A 4BC2A 1EO1A 1NMDA 3ISNC 4BG9A 3ZEUA 1Q81O 2OPQA 3E66A 3G0ZA 5KPTA 4LFBK 4E89A 3N4QA 4FK4A 3PX6A 4KKOA 4L8RB 3MAQA 1NK6A 1JLFA 1TV6A 3NF7A 4E7KA 3ATUA 1C1BA 5BR9A 4DR1K 2ASPA 4CF1A 5AZJA 2Y1JA 1HLUA 3OHRA 3SMPA 1Q86O 4JRQA 2E2OA 4BDPA 4LF6K 3OY9A 3VQCA 4RW9A 4E1NA 1TAQA 1FW6A 2G8WA 4DLGA 4DUYK 3MX5A 2Q0RA 4PQUA 5GINA 3EE9A 4BVPA 2P9IB 2DFFA 2X6NA 1K73O 3U9ZA 1TYQA 1S6PA 1RTJA 3IAYA 4DS4A 2IS3A 4W5RA 2OYQA 3UIQA 2YHWA 4DV5K 4BC4A 2Q1NA 2CGJA 4EHUA 3RRHA 3P5JA 4O8UA 3ZT3A 1LAWA 3C7NA 4FZXC 1NJWA 4Q0BA 2AA4A 3RRGA 1ZBSA 2RHKA 4WCEL 1SL1A 4CK2A 1D4XA 3K5MA 4GKJK 3LL3A 1QS4A 3ZETB 4Q5VA 1WAFA 2YHAA 1Q9XA 4LH4A 4K8ZA 1EXQA 3EZ5A 1YVNA 3AVGA 1KAYA 3HSCA 1JKHA 3FFIA 4I9LA 5C42A 4CEQA 3VQ6A 3SCXA 2E20A 4ISEA 2ZJPL 4AHCA 5KTQA 3C6AA 4IO9L 4GV3A 4BQZA 5JLFA 5J2QA 4NXNK 5JICA 4G9ZA 1VAZA 3CCVN 4LSNA 5AQJA 2P9KB 1J5OA 1W97L 3AO5A 2PAVA 4FCYA 1X1PA 1TK5A 2GWJA 4OKKA 3LP3A 5AR0A 4LC9B 3OTOK 3S41A 2Q36A 5HROA 1W0HA 3SAGA 4CZMA 1WB9A 4DSKA 3MN6A 1RDAA 3FZLA 5KRSA 1C0GA 3OJSA 3SUNA 2UXCK 3ZLJA 3TAPA 1DGKN 3VEOA 4DFPA 4CD1A 4O0JA 2A1SA 3L3UA 4Z4IA 1IKVA 5EU7A 4ELVA 4G1QA 1DKGD 3QNNA 2IVOA 4QS8A 3DLLL 4JEPA 3THWA 4CIEA 1Y64A 1NK5A 1VQLN 1KSPA 1FJGK 4CZKA 4DTOA 1J53A 3CCRN 4Z4FA 1O13A 2KW4A 2HHWA 1TL1A 5FRNA 4O5FA 2BANA 4K0KK 2HBLA 3SMSA 5F1XA 1VQPN 1W9HA 4EIAA 2IAJA 3FR0A 3QEWA 5AQQA 1QSSA 4DF8A 3MCPA 3TAEA 2IIRA 3V6DA 3CMEN 1NGEA 2ZGZA 1IKWA 2E2NA 1HPZA 4BRDA 3DAWA 4OLBA 2PYJA 4A61A 1JXEA 4MQ3A 5CYQA 1T3VA 3CF5L 2HHHK 4MLHA 2BUPA 5EVZA 4CF2A 1YXQA 5KI6A 1ASWA 3AY9A 1YI2N 3CCSN 4YORA 3TSUA 1JCFA 3LDQA 3UKRA 1X9SA 4FO0A 3U4LA 1RDUA 3CC7N 4OVLA 4DQ8A 3MMVA 1KLNA 3CMAN 4BWMA 1SKRA 1VQNN 1WSJA 1GLFO 5J2NA 1YIJN 3U3YA 4M41A 4OJRA 1EKEA 1KVCA 2P9NB 3CJ7A 3S3NA 1DLOA 4ZTJA 1J6ZA 4JKHA 3V1QA 1BCMA 5E41A 4EZ6A 3EYZA 3RMCA 1BOTO 1NJYA 2HBJA 5FPEA 1VQ4N 3D7EO 4DV6K 4FJNA 2P1JA 5A2QO 3IKMA 1RT2A 1S5JA 4DR3K 4FJ5A 2Z1HA 1RILA 1DT9A 1S1XA 3FZMA 4B9TA 1OVQA 1SQKA 1EQYA 4BRHA 4FYDA 4C8LA 4WF9L 4CK1A 5DM6L 5HRSA 1B9DA 3A2FA 3AO2A 4O8KA 1GLJO 4N47A 3L0QA 2HF4A 2PBDA 3AV9A 4GV6A 4YDUC 4XH4A 3SLCA 4BC5A 1NK0A 4M7YA 3VQAA 3VTIA 4LY7A 3HJFA 4RW8A 2E1YA 3JAMO 3TU5A 3L2UA 2W6LA 3JXUA 3VESA 3BP8A 3JSMA 4CJSA 4JK7A 3M1FA 4NLCA 3KVGA 3BZKA 2WBNA 4CFCA 2KZZA 2RPIA 2D0CA 3SQ0A 2OPPA 4JI3K 5AQRA 1GLDG 2Q97A 3BDPA 5AQHA 4Z4HA 5AQKA 4OLAA 2E6LA 4JD2A 4BROA 3WT0A 4FVUA 2JWKA 2OZMA 3LDPA 2W41A 4KH6A 3VETA 2HW3A 1EWQA 1C1AA 1NLVA 2DFHA 3O9SA 4JKDA 4Z94A 4CHQA 1NU0A 2QKKA 1CLQA 3DWLA 1G15A 4CZIA 3GDQA 3UKUA 4JI8K 4BR5A 1E3MA 4NYNA 4IG3A 4CEFA 4M63C 1SKWA 4OO1J 3DXKA 3AVKA 2VGMA 3HYFA 3D2EB 4WYBA 3NFAA 4IOXA 3VQ7A 4B3OA 4ISFA 4I2PA 4O55A 2WONA 1RDBA 1HRHA 3ALYA 2G8IA 3DLRA 2FBVA 1SUQA 2F8TA 3A8YA 4CHYA 3T7ZA 4OPKA 4M3YA 3K5OA 3NH2A 3K59A 1XQSC 4I6MB 4BRAA 4BR7A 3O9TA 1L3TA 3AO1A 4YOUA 3AO4A 4NCGA 4B1WB 4RW7A 2O8FA 1VQKN 2QWNA 4Z4CA 3M8RA 4PA1A 3NVMA 4J2EA 3DI6A 4FJXA 3KD5E 3QEXA 3AVAA 2OPRA 1K8AO 2Q31A 4W5OA 1SAZA 3RMBA 1BIZA 2WFBA 1E4GT 5BRHA 5KRTA 4JI0K 4DQIA 1YHQN 1LCUA 2WC9A 4IEIA 4BACA 4M3RA 1IV0A 2HMPA 2AJQA 4R5PA 3EKUA 2IVNA 1WSGA 3QETA 1MWKA 4ID5A 3NDKA 2ETJA 1Q8IA 3TTCA 4YOXA 2HHQA 4W5QA 2P5OA 4JKFA 4A57A 1KQSM 3RMAA 4OGEA 4J2DA 1VHXA 4DQPA 3VF4A 1YAGA 3TAMA 1OKJA 2O8EB 1RBSA 3EZWA 3AA5X 4JKGA 4ILHA 4HCCA 3F73A 3THXB 3VF2A 2X6SA 5ADXA 4FJ8A 4PY5A 1DTTA 4N41A 1CZ9A 1MWMA 1GLEG 2XY8A 4FJKA 1VQMN 5LMNK 3CJAA 1NJIO 3ID8A 1NGJA 3DOKA 4R79A 3CQYA 1NGFA 4JI4K 2BH1A 1ZBFA 4OKEA 2V7ZA 1IJJA 4AILC 2QWPA 1VRTA 5IT9O 4E7LA 2W42A 4FJIA 4DTSA 1F21A 1VQ9N 4H0VB 3CC4N 2E6MA 1T03A 3NVKA 5C2FA 2YKMA 3AARA 3C6HA 4NLBA 3MWPA 5AQFA 4DKWA 3RR7A 4PKGA 3ZSWA 1N36K 1EX4A 3ZYYX 2KTQA 5GIOA 4CI6A 1BA1A 3A0IX 4MFBA 1ITGA 3ITHA 4BRMA 1NGAA 2V51B 1WSEA 4JLHA 4IOAL 1C0FA 3TPQA 2YHBA 4Y1CA 3TTFA 1RBVA 4DTRA 1KXPA 4JK9A 5HRRA 1BO5O 5C15A 1MA9B 1XNRK 2ZF5O 2P9LA 5BN9A 5FLXO 4WQ5A 5I3UA 3RSEA 4HVJA 4EZ9A 3DXMB 5F0XA 4CZGA 1FKOA 1NK8A 4DV2K 3H45C 3CFPA 3MEEA 1S6QA 4JI1K 1Z25A 5C24A 4N5SA 5H1SQ 3V81A 2FBXA 2G8VA 3CFOA 3QFUA 2IDOA 1Y97A 2YX6A 3J8AA 3R9PA 5BRDA 4CGIA 1YJWN 4DG1A 4QS9A 4FK2A 2HNDA 4ELUA 3F9MA 1DEJA 3BEXA 3P4IA 3LP1A 3O3HA 1L3SA 2I7PA 1M90O 4CIFA 4B1VA 2A42A 3PSFA 3AVBA 3MEDA 4PL8A 4EP5A 1K8KA 2V52B 4FLVA 3ULEB 2GBZA 3OW2M 3OBWA 1ZXOA 2YNGA 1Z6RA 2Q3SA 3E9OA 3AGKA 2LSNA 4EP4A 3MXMA 3V9XA 3QLHA 4CF0A 3K5LA 3TWHA 2O8CB 3D6RA 3D2FA 1RT7A 3VA0A 4CW7B 4JS4A 2PFUA 4GKKK 1NOZA 3VMFB 2UXBK 1RT6A 2F96A 1YT3A 5MLCQ 3SQ1A 3ENBA 3QBXA 3CQXA 3SI6A 4XH1A 5D3GA 3VQ8A 2HVHA 4E7IA 3W0LA 2QA4N 3H1VX 3NH1A 3OBYA 3GG4A 3K9KA 4BRFA 4B3SK 5AQTA 1WBBA 3OYGA 3KK2A 3C94A 3B6OA 4BRLA 3EEQA 1BCOA 2HHXA 2IOCA 1WSFA 5KQ8A 1YJ9N 4A5BA 4DU3A 3EN9A 2GV9A 5HL7L 2E2QA 4KI6A 3HSTB 1VSDA 4FWKA 4CEBA 4CFAA 4CGJA 4CHZA 4M3XA 1MU2A 3BZCA 4CEEA 3TSPA 3R6MA 3BGRA 1I39A 3F5TA 4HTUA 4BRKA 3CC2N 4BQLA
chains in the Genus database with same CATH topology
2A3ZA 2IIRA 3CMEN 1QQNA 3VGKA 3O9QA 1E4FT 1NGEA 2FLOA 2HF3A 2GUPA 2ZGZA 5AZIA 3BUZB 1KC8O 2E2NA 2Q0UA 4AM6A 4BRDA 3DAWA 2HOEA 4U67L 3O4WA 3CXCM 5JLHA 4MDBA 4A61A 4BRPA 2A41A 2VYPA 1T3VA 2NRTA 2RE2A 3H3NO 3IFRA 1ATRA 3CD6N 3CF5L 5C12A 3A5OC 2QEXN 4MLHA 2BUPA 1Q18A 3A5NC 5AQXA 4FPAA 1HKCA 3GL1A 4I6MA 5AQIA 5EVZA 2FF3B 3WXMB 3WXLA 1YXQA 5ELZA 3AAPA 3AY9A 3MK6A 1KAXA 1YI2N 2QW9A 2GTDA 3P39A 3VEVA 4YORA 3CCSN 5AQGA 1BG3A 3TSUA 4BY9C 1JCFA 2GWKA 3H6EA 4IZ9A 3CIPA 3LDQA 4A2BA 3UKRA 3O5BA 1JCEA 4FO0A 1S3XA 3U4LA 1RDUA 3CCEN 3CC7N 3MDQA 3G71N 4DQ8A 3MMVA 2P9PA 1QZ6A 3CMAN 2WUSA 3EL2A 1P90A 5DM7L 3O1BA 2P9LB 2Q2RA 4FPBA 2FSKA 3T69A 4FOIA 4XEIA 4Y0WA 3KWIA 1VQNN 3A5LC 1GLFO 4BRIA 1T44A 1U6ZA 1YIJN 1NWKA 4JHDB 3SBTA 2A40A 1VQ5N 3R8EA 1ZC6A 2E88A 3C7NB 1R59O 2A6AA 3SBGA 4CBUA 2P9NB 5FPDA 3CJ7A 3M3ZA 5M1OA 5GIPA 1BDGA 1GLAG 1U2VA 3CJ9A 1YUWA 4WFBL 2F9TA 3GOIA 1J6ZA 2HBMA 4H03B 4GY2B 4JKHA 4MO4A 3ZX0A 2ZJQL 2YJFA 1XC3A 3VOVA 1X3NA 4FWSA 2ASMA 3CCVN 3FZHA 3KWGA 1BOTO 3CJCA 3L4IA 5AQLA 2HBJA 3IDHA 5FPEA 3CPWM 1VQ4N 1QQOA 1HPMA 3D7EO 1QVFM 3WEEA 3IKMA 1VQ8N 4A59A 2J4RA 3Q7CA 5EOYA 2EWSA 3HOTA 1DT9A 3FZMA 1GLBG 1SQKA 1EQYA 4BRHA 1TUYA 5BREA 4WF9L 5DM6L 1P8ZA 2P9UA 1HX1A 4K43A 3MN9A 4BRQA 1NGDA 4O8KA 3CERA 2V7YA 1QHAA 3QB0A 4A5AA 3PLAA 4BR2A 1GLJO 1YITN 1YF5L 3L0QA 2HF4A 3UE5A 2PBDA 3QICA 3I55N 4GV6A 3U8XA 3CI5A 2GX9A 3D2FB 4XH4A 4YDUC 5AQYA 3SLCA 2HBKA 2NRZA 4BC5A 2HSTA 5EXWA 4H5TA 4M7YA 5GAHP 3QMLA 3VTIA 2CH5A 4BR4A 5AQNA 4E1JA 5AQUA 2E1YA 1S72N 3H1QA 3TU5A 5LJWA 2QWQA 3JXUA 3VESA 4PKIA 3BP8A 4DCHA 2D0OA 2QI2A 3QDKA 1N8RO 1VQ6N 3NMUA 3R3LA 4JK7A 3M1FA 1V4SA 1Q7YO 3TTDA 4NLCA 1YJNN 2GELA 4NB4A 3WUHA 3KVGA 1NGBA 2WBNA 1SZ2A 3JS6A 3O9UA 2CGKA 2E8AA 2JWLA 4C1NI 3E9PA 4CZJA 5CE3A 4H5RA 5AQRA 1GLDG 2Q97A 5AQHA 4BVOA 4EHTA 5AQKA 1CZAN 4IOAL 4IEEA 1ATSA 2ZWHA 4JD2A 4FWRA 3WXJA 4BROA 3WT0A 4FVUA 2JWKA 1HKBA 3LDPA 2W41A 2QWLA 4KH6A 3VETA 3VEZA 3O9SA 1NLVA 4JKDA 3ZEUB 3ZX3A 4Z94A 3DWLA 5LJVA 4XH5A 4CZIA 3O9RA 3GDQA 3UKUA 5E84A 3KHYA 4BR5A 4BREA 3G25A 4YOYA 2H3GX 4GVEA 2KKZA 4BGBA 3E9LA 2D0PA 2QWRA 3I8BA 1SS6A 4M63C 2NRWA 4OO1J 3DXKA 3E1YA 1LOTB 5AZJB 2VGMA 5CHIA 2P9IA 4C23A 3R1XA 5AQPA 3D2EB 4WYBA 1ILYA 3PIOL 2ZGYA 4CZHA 1QVGM 1VQON 4IOXA 2W40A 3KK7A 4IOCL 4F9OA 5AQSA 1HKGA 4ISFA 5AFUA 3GBTA 4FWQA 4JNEA 3DXMA 3N4PA 3A5MC 1NBWA 3HTVA 5AZIB 3DJCA 4CZEA 1QZ5A 4DHYA 3SJHA 3FZKA 2ITMA 3VF6A 1WOQA 4HTLA 2YI1A 2FSJA 2QXLA 2AP1A 3A8YA 3T7ZA 1T6DA 3ZETA 1TYQB 3H3OB 1HJOA 2NLXA 3FLCO 1XQSC 4H0PA 4HWIA 4YDUA 3VENA 4I6MB 5C10A 4BRAA 4BR7A 5I9EB 4L3QA 3O9TA 1XUPO 4YOUA 3RSEB 4B1WB 4IJAA 1VQKN 3HOSA 1H1VA 1V4TA 2QWNA 3MN5A 4PHTX 1MDUB 5BPMA 1NGCA 3NVMA 2OANA 3GE1A 3LM9A 3UKRB 3QBWA 4BR0A 1VQ7N 4MDAA 3VEWA 2NZTA 3FZFA 2ASOA 2QWOA 3VGLA 3W3DA 5GAGP 3CJ1A 4CJ7A 2P9PB 5TKYA 1K8AO 2Q31A 5M1NA 4JKEA 2D1KA 3QFPA 1GLCG 2NRRA 1SAZA 5F2RA 3ULEA 1W2BM 4UY8O 2CGLA 5BN8A 2WFBA 1E4GT 2P9KA 5BRHA 3J7ZO 3M5RA 4WFAL 5AQMA 2NNWA 3SAFA 2P9SA 1YHQN 1LCUA 2WC9A 1OVYA 4IEIA 4B1XB 3G6EN 1K9MO 2YJEA 4K41A 3CCQN 3LDOA 4YOVA 2UYTA 2HMPA 4RTFD 3ENOA 2IVPA 3EKUA 2I7NA 2D4WA 4H5VA 3CHWA 3CCJN 1U2VB 2NRHA 2IVNA 3ATVA 4FSVA 1MWKA 2QWMA 3EKSA 4KBOA 3FGUA 2KHOA 4BRGA 2YHXA 4BRCA 1KD1O 3TTCA 1K8KB 4YOXA 4B9QA 2A5XA 5KPRA 4JKFA 2FXUA 4A57A 4NO7A 3HI0A 4BC3A 1KQSM 3CCLN 5HOOA 3I33A 5BRFA 3WEEB 4IO8A 4CZLA 5EX5A 4YOWA 2VCPA 4BR9A 3VF4A 4K25A 1YAGA 3VERA 3ZX2A 4EAHD 1OKJA 3P31A 2QM1A 1JCGA 5TKWA 5GADP 4IWVA 4CD3A 3EZWA 2P9UB 2VGNA 2QTDA 3IUCA 4K42A 3FE1A 4JKGA 3CCMN 4ILHA 5ADXH 5AQZA 4MO5A 3CJBA 3HBTA 4MLEA 4FOEA 1WUAA 4JKCA 2ZJRL 1BU6O 3VF2A 1T6CA 3O6WA 5JMVA 3VPZA 5ADXA 5AQVA 1MWMA 3CCUN 1GLEG 3AGRA 3EE8A 1BA0A 1VQMN 3CJAA 4BC2A 5AQWA 4PL7A 3L6QA 1NGGA 1EO1A 1NMDA 1NJIO 3WQUA 3ID8A 1NGJA 4R79A 3CQYA 3ZEUA 4BG9A 1Q81O 5C0YA 4JKAA 3E66A 1NGFA 5KPTA 3N4QA 2YHYA 1HUXA 2FSNA 3C0BA 3MX2A 5B8HA 2BH1A 4FWMA 2V7ZA 1IJJA 3WXKA 5M1KA 4JK8A 3ATUA 3O8MA 2QWPA 5BR9A 5KPZA 3BF1A 3IMXA 3MCAB 1VQ9N 2ASPA 1RDWX 4H0VB 5AZJA 3CC4N 3NVKA 5AFUH 4JD2B 5C2FA 1HLUA 1NGIA 3OHRA 3AARA 3C6HA 4NLBA 3HM8A 3MWPA 4IDHA 3SMPA 3WXIA 3AAQA 3FFKB 5AQFA 4DKWA 4IJNA 4BG8A 4PKGA 4AF1A 2F7TA 3ZYYX 4DB3A 4KH4A 1Q86O 5FPNA 3UKUB 3VEYA 4CBXA 2E2OA 1X3MA 5GIOA 3K9JA 4CI6A 1BA1A 3A0IX 4OPAA 5E26A 3LM2A 1GLLO 3ID6A 1KAZA 3MX5A 4BRMA 1NGAA 2V51B 2Q0RA 4RCHA 5CR4A 1RGIA 5GINA 3EE9A 4BVPA 1C0FA 3DXKB 4FWPA 3TPQA 3TTFA 3VTHA 4A2AA 5GAEP 2P9IB 1KXPA 2FF6A 2NRVA 4JK9A 1K73O 1BO5O 1TYQA 3RVCA 1MA9B 1G99A 3U9ZA 5C15A 2ZF5O 2P9LA 5BN9A 2OTLN 1Z05A 3EO3A 4QS7A 4GV9A 4WQ5A 3RSEA 1TUUA 3LDNA 3DXMB 5FPMA 2YHWA 3U9DA 4JHDA 5F0XA 4BC4A 5M1QA 4CZGA 2Q1NA 2CGJA 4EHUA 3H45C 4O8UA 3C7NA 4CZFA 4WQ4C 2P9NA 1S22A 2AA4A 1ZBSA 2RHKA 4WCEL 3PIPL 3HZ6A 1D4XA 1NGHA 3LL3A 5H1SQ 1QQMA 3Q7BA 3SK3A 4GNIA 3ZETB 5JVHL 3QFUA 2YX6A 2E2PA 3CETA 1YVNA 3J8AA 3R9PA 1KAYA 3HSCA 4U7BA 5BRDA 4H5WA 3VGMA 3HRGA 4ISGA 1YJWN 4QS9A 2F9WA 3F9MA 2E20A 4FWOA 1DEJA 3OA9A 5BPLA 4ISEA 3BEXA 5KQDA 2YCHA 2ZJPL 3C6AA 5C2DA 1ESVA 3P4IA 4IO9L 2I7PA 5M1PA 1M90O 4GV3A 4B1VA 2A42A 5BPNA 4BQZA 5JLFA 3B8AX 1Q82O 5JICA 5LY3A 4G9ZA 3H46O 4H0YB 1VAZA 4PL8A 5M1FA 4C1NK 1K8KA 3M6GA 2V52B 3C65A 3ULEB 3OW2M 1ZXOA 3OBWA 1Z6RA 1BWFO 4H5NA 3F2KA 3E9OA 3AGKA 2P9KB 5AQJA 5EY4A 4OPHA 1W97L 4BRNA 2E1ZA 4J8FA 3G4SN 2PAVA 1NM1A 3D6RA 3D2FA 2P9SB 2GWJA 4KH5A 4WQ5C 3UB5A 2PFUA 5AR0A 4LC9B 4JKBA 3S41A 3VMFB 2OTJN 2Q36A 2KLAA 3SAGA 4CZMA 5MLCQ 4AM7A 3ENBA 4ILJA 3QBXA 1IG8A 1M1KO 3MN6A 4ILGB 3CQXA 3FZLA 4XH1A 3MWTA 1C0GA 1BUPA 2DPNA 3W0LA 1DGKN 1RFQA 2QA4N 3H1VX 4FWNA 3OBYA 3VEOA 3WQTA 3GG4A 4CD1A 3MN7A 4IXCA 4BGAA 3O08A 3SAHA 3K9KA 4H0TB 4WFNL 1DKGD 4BRFA 4B1YB 2IVOA 4QS8A 1JJ2M 2CH6A 3DLLL 4JEPA 4B1ZA 5AQTA 1Y64A 3P38A 1VQLN 4JAXA 4CZKA 4M7XA 3CPEA 3CCRN 1O13A 4FWLA 3KZBA 4JKGB 4IFEA 4BRLA 4A62A 4WQ4A 3L4QA 4H0XB 4B1UB 1X9JA 3BF3A 5KQ8A 4O5FA 2NRXA 1YJ9N 5AQOA 4EFHA 4H0OA 3VEXA 4A5BA 2HBLA 3SMSA 5F1XA 3TSQA 3EN9A 1VQPN 5HL7L 2E2QA 4FWKA 4EIAA 2BTFA 4PKHA 3FR0A 4FL9A 3D2EA 3O80A 5AQQA 4RWTA 4CBWA 3R6MA 3TSPA 2GEMA 3LDLA 3MCPA 3I56N 2VWBA 3F5TA 4JN4A 4BRKA 1ATNA 4YOTA 3O1WA 3CC2N 5JVGL 4BQLA 3ENHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A3Z A;  2IIR A;  1QQN A;  3VGK A;  1E4F T;  1NGE A;  2FLO A;  2HF3 A;  2GUP A;  2ZGZ A;  5AZI A;  3BUZ B;  2E2N A;  2Q0U A;  4AM6 A;  4BRD A;  3DAW A;  2HOE A;  3O4W A;  5JLH A;  4A61 A;  4BRP A;  2A41 A;  2VYP A;  3IFR A;  3H3N O;  1ATR A;  3A5O C;  4MLH A;  2BUP A;  1Q18 A;  3A5N C;  5AQX A;  4FPA A;  1HKC A;  3GL1 A;  4I6M A;  5AQI A;  5EVZ A;  2FF3 B;  3WXL A;  1YXQ A;  5ELZ A;  3AAP A;  3AY9 A;  3MK6 A;  1KAX A;  2QW9 A;  2GTD A;  3VEV A;  5AQG A;  1BG3 A;  1JCF A;  2GWK A;  3H6E A;  4IZ9 A;  3CIP A;  3LDQ A;  4A2B A;  3UKR A;  3O5B A;  1JCE A;  4FO0 A;  1S3X A;  3U4L A;  3MDQ A;  4DQ8 A;  3MMV A;  2P9P A;  1QZ6 A;  2WUS A;  3EL2 A;  3O1B A;  2P9L B;  2Q2R A;  4FPB A;  2FSK A;  4FOI A;  4XEI A;  4Y0W A;  3A5L C;  1GLF O;  4BRI A;  1T44 A;  1U6Z A;  1NWK A;  4JHD B;  2A40 A;  3R8E A;  1ZC6 A;  2E88 A;  3C7N B;  1R59 O;  2A6A A;  4CBU A;  2P9N B;  5FPD A;  3CJ7 A;  3M3Z A;  1BDG A;  1GLA G;  1U2V A;  3CJ9 A;  1YUW A;  2F9T A;  3GOI A;  1J6Z A;  4H03 B;  4MO4 A;  4GY2 B;  3ZX0 A;  2YJF A;  1XC3 A;  3VOV A;  1X3N A;  4FWS A;  2ASM A;  3FZH A;  3L4I A;  1BOT O;  3CJC A;  5AQL A;  3IDH A;  5FPE A;  1QQO A;  1HPM A;  3D7E O;  3WEE A;  2J4R A;  5EOY A;  2EWS A;  3FZM A;  1GLB G;  1SQK A;  1EQY A;  4BRH A;  1TUY A;  5BRE A;  1P8Z A;  2P9U A;  1HX1 A;  4K43 A;  3MN9 A;  4BRQ A;  1NGD A;  4O8K A;  3CER A;  2V7Y A;  1QHA A;  3QB0 A;  4BR2 A;  1GLJ O;  3L0Q A;  2HF4 A;  3UE5 A;  2PBD A;  3QIC A;  3U8X A;  3D2F B;  3CI5 A;  4XH4 A;  4YDU C;  5AQY A;  3SLC A;  4BC5 A;  5EXW A;  4H5T A;  4M7Y A;  3QML A;  2CH5 A;  4BR4 A;  5AQN A;  4E1J A;  5AQU A;  2E1Y A;  3H1Q A;  3TU5 A;  5LJW A;  2QWQ A;  3JXU A;  3VES A;  4PKI A;  3BP8 A;  4DCH A;  2D0O A;  3QDK A;  3M1F A;  1V4S A;  2GEL A;  4NB4 A;  3WUH A;  3KVG A;  1NGB A;  1SZ2 A;  3JS6 A;  2CGK A;  2E8A A;  4CZJ A;  5CE3 A;  4H5R A;  5AQR A;  1GLD G;  2Q97 A;  5AQH A;  4BVO A;  4EHT A;  5AQK A;  1CZA N;  1ATS A;  2ZWH A;  4JD2 A;  4FWR A;  3WXJ A;  4BRO A;  3WT0 A;  1HKB A;  3LDP A;  2W41 A;  2QWL A;  3VET A;  3VEZ A;  1NLV A;  3ZX3 A;  3ZEU B;  4Z94 A;  3DWL A;  5LJV A;  4XH5 A;  4CZI A;  3GDQ A;  3UKU A;  5E84 A;  3KHY A;  4BR5 A;  4BRE A;  3G25 A;  2H3G X;  4BGB A;  2D0P A;  2QWR A;  3I8B A;  4M63 C;  3DXK A;  1LOT B;  5AZJ B;  2P9I A;  4C23 A;  5AQP A;  3D2E B;  4WYB A;  2ZGY A;  4CZH A;  2W40 A;  4F9O A;  5AQS A;  1HKG A;  4ISF A;  5AFU A;  3GBT A;  4FWQ A;  4JNE A;  3DXM A;  3A5M C;  1NBW A;  3HTV A;  5AZI B;  3DJC A;  4CZE A;  1QZ5 A;  4DHY A;  3SJH A;  3FZK A;  2ITM A;  3VF6 A;  1WOQ A;  4HTL A;  2YI1 A;  2FSJ A;  2QXL A;  2AP1 A;  3A8Y A;  1T6D A;  3ZET A;  1TYQ B;  3H3O B;  1HJO A;  2NLX A;  3FLC O;  1XQS C;  4H0P A;  4HWI A;  4YDU A;  3VEN A;  4I6M B;  5I9E B;  4BRA A;  4BR7 A;  4L3Q A;  1XUP O;  3RSE B;  4B1W B;  4IJA A;  1H1V A;  1V4T A;  2QWN A;  3MN5 A;  1MDU B;  5BPM A;  1NGC A;  2OAN A;  3GE1 A;  3LM9 A;  3UKR B;  3QBW A;  4BR0 A;  3VEW A;  2NZT A;  3FZF A;  2ASO A;  2QWO A;  3VGL A;  3W3D A;  3CJ1 A;  4CJ7 A;  2P9P B;  5TKY A;  2Q31 A;  2D1K A;  3QFP A;  1GLC G;  1SAZ A;  5F2R A;  3ULE A;  2CGL A;  5BN8 A;  1E4G T;  2P9K A;  5BRH A;  5AQM A;  2P9S A;  1LCU A;  4B1X B;  2YJE A;  4K41 A;  3LDO A;  2UYT A;  2HMP A;  4RTF D;  3ENO A;  2IVP A;  3EKU A;  2I7N A;  2D4W A;  4H5V A;  3CHW A;  1U2V B;  2NRH A;  2IVN A;  3ATV A;  4FSV A;  1MWK A;  2QWM A;  3EKS A;  4KBO A;  3FGU A;  2KHO A;  4BRG A;  2YHX A;  4BRC A;  1K8K B;  4B9Q A;  2A5X A;  5KPR A;  2FXU A;  4BC3 A;  4NO7 A;  3HI0 A;  3I33 A;  5BRF A;  3WEE B;  4IO8 A;  4CZL A;  5EX5 A;  2VCP A;  4BR9 A;  3VF4 A;  4K25 A;  1YAG A;  3VER A;  3ZX2 A;  4EAH D;  1OKJ A;  2QM1 A;  1JCG A;  4IWV A;  4CD3 A;  3EZW A;  2P9U B;  3IUC A;  4K42 A;  3FE1 A;  5ADX H;  5AQZ A;  4MO5 A;  3CJB A;  3HBT A;  4MLE A;  4FOE A;  1WUA A;  1BU6 O;  3VF2 A;  1T6C A;  3O6W A;  5JMV A;  3VPZ A;  5ADX A;  5AQV A;  1MWM A;  1GLE G;  1BA0 A;  3CJA A;  4BC2 A;  5AQW A;  4PL7 A;  3L6Q A;  1NGG A;  1NMD A;  3WQU A;  3ID8 A;  1NGJ A;  3CQY A;  3ZEU A;  4BG9 A;  1NGF A;  5KPT A;  2YHY A;  1HUX A;  2FSN A;  3C0B A;  5B8H A;  4FWM A;  2V7Z A;  1IJJ A;  3WXK A;  3ATU A;  3O8M A;  2QWP A;  5BR9 A;  5KPZ A;  3BF1 A;  3IMX A;  2ASP A;  1RDW X;  4H0V B;  5AZJ A;  5AFU H;  4JD2 B;  1HLU A;  1NGI A;  3OHR A;  3AAR A;  3HM8 A;  3WXI A;  3SMP A;  3AAQ A;  3FFK B;  5AQF A;  4IJN A;  4BG8 A;  4PKG A;  4DB3 A;  5FPN A;  3UKU B;  3VEY A;  4CBX A;  2E2O A;  1X3M A;  4CI6 A;  1BA1 A;  3A0I X;  5E26 A;  3LM2 A;  1GLL O;  1KAZ A;  4BRM A;  1NGA A;  2V51 B;  2Q0R A;  4RCH A;  1RGI A;  4BVP A;  1C0F A;  3DXK B;  4FWP A;  3TPQ A;  4A2A A;  2P9I B;  1KXP A;  2FF6 A;  1BO5 O;  1TYQ A;  3U9Z A;  1MA9 B;  1G99 A;  2ZF5 O;  2P9L A;  5BN9 A;  1Z05 A;  3EO3 A;  4QS7 A;  4WQ5 A;  3RSE A;  1TUU A;  3LDN A;  3DXM B;  5FPM A;  2YHW A;  3U9D A;  4JHD A;  5F0X A;  4BC4 A;  4CZG A;  2Q1N A;  2CGJ A;  4EHU A;  3H45 C;  3C7N A;  4CZF A;  4WQ4 C;  2P9N A;  1S22 A;  2AA4 A;  1ZBS A;  3HZ6 A;  1D4X A;  1NGH A;  3LL3 A;  1QQM A;  3SK3 A;  3ZET B;  4GNI A;  3QFU A;  2E2P A;  3CET A;  1YVN A;  3J8A A;  3R9P A;  1KAY A;  3HSC A;  5BRD A;  4H5W A;  3VGM A;  4ISG A;  4QS9 A;  2F9W A;  3F9M A;  2E20 A;  4FWO A;  1DEJ A;  5BPL A;  5KQD A;  4ISE A;  3BEX A;  2YCH A;  1ESV A;  3P4I A;  2I7P A;  4B1V A;  2A42 A;  5BPN A;  4BQZ A;  5JLF A;  3B8A X;  5JIC A;  5LY3 A;  3H46 O;  4H0Y B;  4PL8 A;  1K8K A;  3M6G A;  2V52 B;  3ULE B;  1ZXO A;  1Z6R A;  1BWF O;  4H5N A;  5AQJ A;  2P9K B;  5EY4 A;  4BRN A;  2E1Z A;  4J8F A;  2PAV A;  1NM1 A;  3D2F A;  2P9S B;  2GWJ A;  4WQ5 C;  3UB5 A;  5AR0 A;  4LC9 B;  3S41 A;  2Q36 A;  4CZM A;  4AM7 A;  3QBX A;  1IG8 A;  3MN6 A;  3CQX A;  3FZL A;  4XH1 A;  1C0G A;  1BUP A;  2DPN A;  3W0L A;  1DGK N;  1RFQ A;  3H1V X;  4FWN A;  3VEO A;  3WQT A;  3GG4 A;  4CD1 A;  3MN7 A;  4IXC A;  4BGA A;  3O08 A;  4H0T B;  1DKG D;  4BRF A;  4B1Y B;  2IVO A;  4QS8 A;  2CH6 A;  4B1Z A;  5AQT A;  1Y64 A;  4JAX A;  4CZK A;  4M7X A;  4FWL A;  3KZB A;  4BRL A;  4A62 A;  4WQ4 A;  4H0X B;  4B1U B;  1X9J A;  3BF3 A;  5KQ8 A;  4O5F A;  5AQO A;  4EFH A;  4H0O A;  3VEX A;  3SMS A;  5F1X A;  3EN9 A;  2E2Q A;  4FWK A;  4EIA A;  2BTF A;  4PKH A;  3FR0 A;  4FL9 A;  3D2E A;  3O80 A;  5AQQ A;  4RWT A;  4CBW A;  3R6M A;  2GEM A;  3LDL A;  3MCP A;  2VWB A;  4JN4 A;  4BRK A;  1ATN A;  3O1W A;  4BQL A;  3ENH A; 
#chains in the Genus database with same CATH topology
 3DRP A;  4B9U A;  1QQN A;  3V1R A;  2GUP A;  5AZI A;  1C0U A;  4DSE A;  3DLH A;  3AVI A;  4FW2 A;  4CJF A;  3NH0 A;  3O4W A;  3CXC M;  2A41 A;  3SPZ A;  4C8M A;  4RW4 A;  2RE2 A;  3CD6 N;  1VRU A;  2QEX N;  5AQX A;  1HYZ A;  2HNY A;  5ELZ A;  1TK8 A;  4JI7 K;  3SUP A;  3AVJ A;  4YHH K;  5FRO A;  3ZSQ A;  2ZM6 K;  3PO4 A;  4KHU A;  3P83 D;  3CIP A;  3KD1 E;  3O5B A;  4B9S A;  1S3X A;  4DTM A;  3MDQ A;  4O0I A;  1JLQ A;  2WUS A;  3L2R A;  1OH6 A;  2FSK A;  4DFM A;  4E7H A;  1RCH A;  1KTQ A;  4LF8 K;  1VSI A;  1U6Z A;  4DFK A;  3DLK A;  3SBT A;  2A40 A;  5AJ3 K;  1VQ5 N;  1ZC6 A;  1LAV A;  2E88 A;  3C7N B;  2A6A A;  2Z1J A;  4FLW A;  2P51 A;  1U2V A;  2RF2 A;  4KTW A;  1RBU A;  1YUW A;  3QO9 A;  3ZX0 A;  4H03 B;  2HBM A;  2ZJQ L;  1IG9 A;  1YVU A;  1UAX A;  4O5B A;  5SWM A;  4FWS A;  3L4I A;  3IDH A;  4GW6 A;  1S9G A;  1QVF M;  3LAK A;  4CF9 A;  1VQ8 N;  4QOZ B;  1TVR A;  3H08 A;  4M3Z A;  4B8C A;  3HP6 A;  5BRE A;  2P9U A;  4CES A;  1HX1 A;  1LW2 A;  1NKC A;  2V7Y A;  2O8B B;  1YIT N;  1YF5 L;  4H8K A;  5AQY A;  4AHS A;  1U45 A;  2HST A;  3QML A;  3SYZ A;  4E1J A;  3U6F A;  3VQQ A;  1S72 N;  3H1Q A;  5LJW A;  2EX3 A;  1J54 A;  1KCF A;  2D0O A;  2QI2 A;  3R3L A;  1V4S A;  1Q7Y O;  3LPU A;  1OH5 A;  1SZ2 A;  3O9U A;  3E9P A;  4CZJ A;  4EHT A;  3MXJ A;  1CZA N;  4IEE A;  2ZWH A;  5J2M A;  1HKB A;  4CF8 A;  1GOC A;  3E01 A;  4DV1 K;  3VA3 A;  4KHN A;  1WBD A;  2UU9 K;  5E84 A;  2H3G X;  4DSF A;  3THY A;  2KKZ A;  2D0P A;  4E19 A;  4CJT A;  2NRW A;  1LWE A;  4W5T A;  1UWB A;  1HJR A;  3PIO L;  4CZH A;  3NE6 A;  2VQE K;  3KK7 A;  4IOC L;  4F9O A;  5AQS A;  3THV A;  3GBT A;  2QXF A;  3N4P A;  3HTV A;  4BDY A;  4CZE A;  1QZ5 A;  2XO7 A;  1Z26 A;  1WOQ A;  4HTL A;  2QXL A;  2AP1 A;  5T7B A;  3NGY A;  1SV5 A;  3H3O B;  4H0P A;  2IGI A;  4YY3 K;  2QKB A;  4DTX A;  3NBP A;  4M3W A;  4DR7 K;  1H1V A;  1V4T A;  1O1W A;  5DK5 A;  3QNO A;  4FJH A;  2ITG A;  4FLX A;  2OAN A;  3UKR B;  4DSI A;  4CEO A;  1R0A A;  4FZY A;  1RTD A;  3W3D A;  4CJ7 A;  5TKY A;  3NF8 A;  2XRI A;  4OKJ A;  5M1N A;  2D1K A;  5F2R A;  3C95 A;  5BN8 A;  1J5E K;  4DV3 K;  3K0S A;  4CK3 A;  5AQM A;  3SAF A;  4ELT A;  1BL3 A;  2P9S A;  4B1X B;  3G6E N;  4KAZ A;  3HM9 A;  4I7F A;  3DM2 A;  4K41 A;  3J80 O;  4KRE A;  5CZ1 A;  4B9L A;  3ENO A;  2IVP A;  4DF4 A;  2I7N A;  2D4W A;  3DMJ A;  1XI1 A;  1XHX A;  3CHW A;  3CCJ N;  3HVR A;  2QWM A;  3EKS A;  4KBO A;  2KHO A;  4BRG A;  4BRC A;  2G8F A;  1XHZ A;  2XHB A;  3QES A;  4NO7 A;  4CJP A;  4KO0 A;  3SV3 A;  5HOO A;  1JXB A;  5BRF A;  3K58 A;  1EET A;  4IO8 A;  5FDL A;  4CZL A;  5EX5 A;  1HNW K;  2VCP A;  2W6K A;  4DU4 A;  3P31 A;  2QM1 A;  4IWV A;  2VGN A;  3V9S A;  4K42 A;  1A5V A;  4KB1 A;  3CJB A;  2ZJR L;  1T6C A;  3O6W A;  4DTU A;  4Z4G A;  1BIS A;  2OPS A;  4IDK A;  4NCB A;  4DQS A;  3EE8 A;  4QAG A;  5AQW A;  3L6Q A;  1NGG A;  5C0Y A;  4JKA A;  4DUZ K;  4CJL A;  2YHY A;  4JYA K;  3C0B A;  3MX2 A;  2UUC K;  3C6T A;  2WOM A;  3WXK A;  3O8M A;  1TKX A;  3MCA B;  1RDW X;  1NJZ A;  1TGO A;  5AFU H;  4JD2 B;  4CE9 A;  3HPO A;  3PY8 A;  4IKF A;  1D5A A;  1L5U A;  3AAQ A;  3FFK B;  4DSL A;  4BG8 A;  3LDS A;  1N32 K;  4AF1 A;  4DB3 A;  4KH4 A;  3UKU B;  3VEY A;  2EHG A;  4DR5 K;  3K9J A;  3NGZ A;  3LM2 A;  1GLL O;  1KAZ A;  3ZSV A;  4FLU A;  4RCH A;  1U4B A;  1TKD A;  1HYS A;  3DXK B;  4CJQ A;  3VTH A;  5GAE P;  3SQ4 A;  2FF6 A;  3RVC A;  4HCB A;  4B08 A;  3KLH A;  2WTU A;  3EO3 A;  4QS7 A;  4GV9 A;  3V4I A;  2OZS A;  1A5X A;  1TUU A;  3AVL A;  3LDN A;  5FPM A;  3OYC A;  3TAG A;  4JHD A;  2FBT A;  3L2W A;  1SL2 A;  4Z0U A;  3P1G A;  4CZF A;  1S22 A;  4JI6 K;  3RMD A;  1NGH A;  4DSJ A;  1QQM A;  3Q7B A;  3SK3 A;  5JVH L;  4F2R A;  3CYM A;  4JRP A;  3ZSZ A;  2E2P A;  3CET A;  2KZM A;  3VGM A;  3MXI A;  2O8F B;  4ISG A;  1KVA A;  2B6A A;  2BE2 A;  4CFD A;  2BDP A;  1NMN A;  2VG7 A;  3ZSX A;  5BPL A;  5KQD A;  1ESV A;  3SNN A;  5M1P A;  4FJJ A;  5LY3 A;  3H46 O;  1ZBH A;  5M1F A;  3DRS A;  3M6G A;  3TI0 A;  2D0B A;  3ZT0 A;  5SZT A;  1T8E A;  4ICL A;  4IG0 A;  4OPH A;  3O3F A;  4BRN A;  2E1Z A;  4J8F A;  4X66 K;  5HBM A;  1CXU A;  1XMO K;  4KH5 A;  4NCA A;  4CJW A;  3KLG A;  4FK0 A;  4N76 A;  2OTJ N;  3PO5 A;  5KGW A;  3TAR A;  4AM7 A;  4ILJ A;  1JL2 A;  1IG8 A;  1M1K O;  4ILG B;  1FKP A;  3L8B A;  1BUP A;  2DPN A;  1RFQ A;  2OA8 A;  3K2P A;  4FWN A;  3LWM A;  3WQT A;  1BHL A;  4BGA A;  3SAH A;  3D0P A;  4H0T B;  2G8K A;  3T1Y K;  4B1Y B;  1JJ2 M;  1T7P A;  2CH6 A;  3TR8 A;  4B1Z A;  3P38 A;  3OYD A;  4KFB A;  3AVM A;  1UOC A;  3HPG A;  1I94 K;  4FWL A;  4JKG B;  4B3M K;  3M8S A;  2YKN A;  1HR0 K;  4WQ4 A;  3DLE A;  1U04 A;  4B1U B;  4CVN E;  1X9J A;  4FLT A;  4H4M A;  2UUB K;  3DYA A;  4EFH A;  1EP4 A;  4H0O A;  3IS9 A;  2O8D A;  3J7A P;  2BTF A;  4PKH A;  2F4V K;  4KHW A;  1QSY A;  1S9E A;  4RWT A;  2D0A A;  4CBW A;  3LDL A;  3I56 N;  2VWB A;  3LAL A;  4JN4 A;  1ATN A;  5JVG L;  2Z1G A;  4JS5 A;  3QIO A;  3O9Q A;  2FLO A;  3NCI A;  1D9F A;  2JGU A;  4OGC A;  1KC8 O;  2HMI A;  3BUZ B;  4HUE A;  2Q0U A;  3IG1 A;  2O4I A;  1VSK A;  4RW6 A;  4U67 L;  4KHP K;  4MDB A;  4IBN A;  3H3N O;  5DMR A;  4CJ3 A;  3WXL A;  1HKC A;  4GVM A;  5AQI A;  2KFN A;  2FF3 B;  3WXM B;  3MEC A;  3NF6 A;  1HQE A;  1S1W A;  3AAP A;  3VQ9 A;  3QIN A;  3D45 A;  5AQG A;  4BY9 C;  3SQ2 A;  2GWK A;  3H6E A;  4IZ9 A;  4DTP A;  1JCE A;  3G71 N;  2RKI A;  2P9P A;  1QZ6 A;  3KLE A;  5DM7 L;  3O1B A;  2P9L B;  4FPB A;  4CEA A;  3T69 A;  4YFU A;  4FOI A;  4XEI A;  3KWI A;  1FK9 A;  3WNH A;  1T44 A;  1HNX K;  1WSH A;  5HRN A;  2IC3 A;  1L3U A;  1R59 O;  4B3T K;  4FJL A;  3SBG A;  4CBU A;  2BGG A;  3OS2 A;  4KV8 A;  5GIP A;  1BDG A;  1GLA G;  3RTV A;  3CJ9 A;  3SUQ A;  1BI4 A;  3GOI A;  4J2B A;  1A5W A;  2YJF A;  3OYK A;  2YNH A;  2ASM A;  3KWG A;  3CJC A;  5AQL A;  1NOY A;  4PWD A;  2O8C A;  1IKY A;  1QQO A;  5CZ2 A;  3VQ4 A;  3WEE A;  1KFD A;  3OYF A;  3V9U A;  4A59 A;  3HOT A;  2EWS A;  3T1H K;  1S1T A;  4Y1D A;  1TUY A;  1ZBI A;  2HHU A;  1KVB A;  5CY4 A;  4JI5 K;  4CGD A;  4BRQ A;  3CER A;  4A5A A;  2ZD1 A;  3LZI A;  3L3V A;  1IBL K;  3CI5 A;  3D2F B;  4C8N A;  4O4G A;  1JL1 A;  2NRZ A;  2HHT A;  4KTQ A;  3K57 A;  2P5G A;  4BDZ A;  4DWI A;  4FLY A;  3HP9 A;  4HHT A;  1N8R O;  3NMU A;  2GUI A;  3QDK A;  3U3G A;  1VQ6 N;  4LFA K;  3TTD A;  1YJN N;  1NKE A;  2HNZ A;  4X62 K;  1HNV A;  4FJG A;  2CGK A;  3ZT2 A;  2DFE A;  2JWL A;  3WNG A;  2Y1I A;  4H5R A;  1BQM A;  4JI2 K;  4BVO A;  3ZT4 A;  3OYN A;  3JYT A;  2VWJ A;  1ATS A;  4CJV A;  3WXJ A;  3VEZ A;  3ZX3 A;  3ZEU B;  4XH5 A;  3O9R A;  3S3M A;  3HL8 A;  4BRE A;  1ASV A;  3G25 A;  4YOY A;  4GVE A;  4BGB A;  2QWR A;  1SS6 A;  5AZJ B;  5CHI A;  2B4J A;  2P9I A;  1U49 A;  1RTI A;  4CJ4 A;  3AA4 A;  1QVG M;  1VQO N;  4YNQ A;  1HKG A;  5AFU A;  1I3A A;  4FWQ A;  1NK9 A;  4M3U A;  4JNE A;  3A5M C;  1TKT A;  4K8X A;  5AZI B;  4NXM K;  1YTU A;  2HHS A;  2FC0 A;  3VF6 A;  1C1C A;  4H4O A;  1CZB A;  2YI1 A;  2FSJ A;  4OPJ A;  3ZET A;  1TYQ B;  1HJO A;  4FVM A;  4DMN A;  5C10 A;  3VEN A;  1XC9 A;  4LFC K;  3EY1 A;  2HHV A;  4ZTF A;  4LSL A;  5LMU K;  1VSF A;  1XUP O;  4IFV A;  4IJA A;  3MN5 A;  5BPM A;  1NGC A;  1N33 K;  3OYE A;  3LAM A;  3GE1 A;  3QBW A;  3VN5 A;  1VQ7 N;  4MDA A;  3VGL A;  2ASO A;  2QWO A;  5GAG P;  3CJ1 A;  1DTQ A;  4Z4E A;  3MEG A;  1W2B M;  1GLC G;  4AH9 A;  2CGL A;  1LWC A;  2P9K A;  3J7Z O;  4F2S A;  1RDD A;  3M5R A;  4CER A;  4WFA L;  3AA3 A;  4DR4 K;  3M8P A;  4ZHR A;  1KRP A;  4FLZ A;  3CCQ N;  4RTF D;  3NAE A;  4JV5 K;  1U2V B;  2NRH A;  1RBR A;  3OS0 A;  4FSV A;  4CHN A;  3FGU A;  4B9Q A;  2O8B A;  2A5X A;  4DR2 K;  4DR6 K;  5JS2 A;  2UXD K;  3PV8 A;  3CCL N;  3M8Q A;  4KTZ A;  4E0D A;  1RBT A;  1RT1 A;  4BR9 A;  4K25 A;  3ZX2 A;  1LV5 A;  4QCL A;  4EAH D;  4CHO A;  1JCG A;  4B8A B;  3HPH A;  2NUB A;  2VQF K;  5GAD P;  4CD3 A;  2P9U B;  1JLB A;  2QTD A;  1HYV A;  4CEZ A;  1WNS A;  1WN7 A;  3VQE A;  5ADX H;  5AQZ A;  4MO5 A;  3HBT A;  4FOE A;  1WUA A;  4JKC A;  1Q9Y A;  4BE1 A;  1VK0 A;  3VPZ A;  1X9M A;  4O44 A;  5K14 A;  3QEI A;  3DLB A;  4F8R A;  3AGR A;  4J2A A;  4PL7 A;  3THW B;  3WQU A;  2O4G A;  1KFS A;  3KKS A;  3VQD A;  3DLG A;  1HUX A;  2FSN A;  5B8H A;  2R7Y A;  3J7Y P;  4FWM A;  4CFB A;  4DU1 A;  1YTA A;  1TK0 A;  5M1K A;  4JK8 A;  5KPZ A;  1IBM K;  2VG6 A;  3BF1 A;  3IMX A;  4TSX A;  3KTQ A;  3OYA A;  3AVH A;  4E7J A;  1ASU A;  1U48 A;  4CJU A;  1LW0 A;  1NGI A;  3VQP A;  3HM8 A;  4IDH A;  1RTH A;  3WXI A;  5I42 A;  4IJN A;  2F7T A;  3PX4 A;  5FPN A;  2FBY A;  4CBX A;  4BE2 A;  1X3M A;  2RN2 A;  4CIG A;  1D8Y A;  3SJJ A;  4OPA A;  3SZ2 A;  5E26 A;  3THY B;  3ID6 A;  3LPT A;  4M42 A;  3CG7 A;  5CR4 A;  1RGI A;  3HXM A;  4KHQ A;  4FWP A;  4A2A A;  3OYM A;  3ZSY A;  2NRV A;  3S9H A;  1UA1 A;  1G99 A;  2OTL N;  1Z05 A;  1N5Y A;  1JLG A;  2DY4 A;  2JLE A;  3ZSO A;  3U9D A;  4FM2 A;  4LF7 K;  5M1Q A;  5IWA K;  4WQ4 C;  2P9N A;  3PIP L;  3HZ6 A;  3RR8 A;  4GNI A;  3KJV A;  3V1O A;  4I9Q A;  4FXD A;  1WAJ A;  3KLF A;  1QQC A;  3CQ8 A;  4U7B A;  4H5W A;  5JS1 A;  3HRG A;  2PZS A;  2F9W A;  4FJ7 A;  1UA0 A;  4FWO A;  3OA9 A;  2YCH A;  3K5N A;  5C2D A;  4FZZ A;  3I0S A;  1ZBL A;  4CHP A;  5BPN A;  3TAQ A;  3B8A X;  1Q82 O;  4PUO A;  1BQN A;  4H0Y B;  3T1A A;  3OYB A;  4C1N K;  1XMQ K;  4CJR A;  3C65 A;  4H5N A;  1BWF O;  3F2K A;  5EY4 A;  1TL3 A;  5CYM A;  4F3T A;  2DTU A;  3G4S N;  1REV A;  1NM1 A;  1C6V A;  2P9S B;  1QE1 A;  4WQ5 C;  3UB5 A;  5HLF A;  4JKB A;  2KLA A;  1B92 A;  3C6U A;  2ZQB A;  4LF5 K;  5J1E A;  3MWT A;  4FJM A;  3KK1 A;  4B9V A;  3MN7 A;  2HB5 A;  4IXC A;  1WLJ A;  3O08 A;  1NK4 A;  4DFJ A;  4FM1 A;  4WFN L;  1U47 A;  2YNF A;  1C0M A;  3HVT A;  4NYF A;  4JAX A;  4LD0 A;  4M7X A;  3CM5 A;  2B5J A;  3CPE A;  2KFZ A;  1VSE A;  3KZB A;  4IFE A;  4A62 A;  3QIP A;  3L4Q A;  4CGG A;  3LP2 A;  4H0X B;  1N6Q A;  3BF3 A;  4AQY K;  2NRX A;  5AQO A;  3ASM A;  3I8D A;  3OYL A;  3VEX A;  3KLI A;  1T05 A;  3O4N A;  1VSJ A;  3TSQ A;  3L2V A;  2I5J A;  4FL9 A;  3D2E A;  3O80 A;  1VSM A;  4I2Q A;  2GEM A;  3T19 A;  4YOT A;  2Z1I A;  3O1W A;  3ENH A;  1QSL A;  2A3Z A;  2G8U A;  3VGK A;  1E4F T;  3CFR A;  2HF3 A;  1SKS A;  2X74 A;  4LF9 K;  4AM6 A;  4X64 K;  2HOE A;  3BY5 A;  3V9W A;  5JLH A;  4BRP A;  1N34 K;  3ULD A;  2VYP A;  2NRT A;  3IFR A;  1IO2 A;  1ATR A;  4E3S A;  5C12 A;  3A5O C;  4DS5 A;  1Q18 A;  3A5N C;  4KB0 A;  5C25 A;  4FPA A;  3GL1 A;  4I6M A;  3WNE A;  4BWJ A;  4M3T A;  3MK6 A;  1KAX A;  2PYL A;  2QW9 A;  2GTD A;  3F9K A;  3P39 A;  3VEV A;  3KK3 A;  1BG3 A;  1B9F A;  4ID1 A;  2ZE2 A;  3SPY A;  4CGF A;  4A2B A;  3AVF A;  1ZYQ A;  3CCE N;  1VSL A;  3OVN A;  2UUA K;  2VG5 A;  3EL2 A;  1P90 A;  2Q2R A;  1RNH A;  4KHS A;  1VSH A;  4Y0W A;  3A5L C;  4BRI A;  3DOL A;  1NWK A;  4JHD B;  3R8E A;  3TAF A;  3LAN A;  5FPD A;  3M3Z A;  1RT5 A;  5M1O A;  1QTM A;  4WFB L;  1XNQ K;  2F9T A;  4MO4 A;  4GY2 B;  3B6P A;  4OX9 K;  1XC3 A;  3VOV A;  3S3O A;  4CCH A;  1S1U A;  1X3N A;  3OYJ A;  3FZH A;  3RWU A;  2E5L K;  3CPW M;  5J2P A;  1HPM A;  1JLC A;  1WSI A;  4CJE A;  1ZBU A;  2J4R A;  3Q7C A;  5EOY A;  3O4Q A;  1GLB G;  4HUG A;  2O8E A;  2XY6 A;  1P8Z A;  1RT3 A;  3IRX A;  4B9M A;  4F3O A;  4K43 A;  3MN9 A;  4C8K A;  1NGD A;  1RDC A;  1QHA A;  3QB0 A;  3PLA A;  4BR2 A;  2D5R A;  3THX A;  3I55 N;  3UE5 A;  3V9Z A;  3QIC A;  3U8X A;  2GX9 A;  3PSI A;  3T3F A;  2HBK A;  1QHT A;  1IKX A;  5EXW A;  4H5T A;  5GAH P;  4FJ9 A;  3G10 A;  2CH5 A;  3SV4 A;  4BR4 A;  5AQN A;  1NNE A;  1EWR A;  4CJK A;  3AA2 A;  5AQU A;  4B3R K;  1RT4 A;  3AVC A;  2QWQ A;  4PKI A;  4DCH A;  4AHU A;  1HNZ K;  4F4K A;  2YV0 X;  1BIU A;  2GEL A;  4NB4 A;  1OH8 A;  3WUH A;  1NGB A;  3JS6 A;  1S1V A;  2ATQ A;  2E8A A;  4C1N I;  3PX0 A;  5CE3 A;  3HK2 A;  4DQR A;  4BE0 A;  4IFY A;  5HRP A;  4FWR A;  2QWL A;  3TAB A;  5HP1 A;  4DLE A;  4DQQ A;  5LJV A;  4HUF A;  3KHY A;  1OH7 A;  2XY7 A;  3OJU A;  2O8D B;  2OCE A;  3E9L A;  4KRF A;  3I8B A;  1C0T A;  1CXQ A;  3E1Y A;  1LOT B;  3CM6 A;  4WE1 A;  4C23 A;  3WNF A;  3KKR A;  3R1X A;  5AQP A;  1ILY A;  2ZGY A;  4N56 A;  3LZJ A;  3J81 O;  1JLE A;  2W40 A;  3VQB A;  4W5N A;  2HVI A;  3DXM A;  1NBW A;  3NHG A;  3DJC A;  4DHY A;  3SJH A;  3FZK A;  2ITM A;  1XWL A;  4KPY A;  1HQU A;  2QK9 A;  3L2Q A;  1D9D A;  4DV0 K;  4C8O A;  3KIO A;  4RG8 A;  1T6D A;  2NLX A;  3FLC O;  4YDU A;  4HWI A;  5I9E B;  5KGX A;  1FXX A;  3LP0 A;  1K6Y A;  4L3Q A;  3RSE B;  3HOS A;  4PHT X;  1MDU B;  5LL6 Z;  3LWL A;  4AHV A;  4X65 K;  1IBK K;  3LM9 A;  3NGI A;  4DTN A;  4BR0 A;  3QER A;  2A1R A;  3VQ5 A;  1TKZ A;  3VEW A;  2NZT A;  3FZF A;  4CED A;  3HT3 A;  2P9P B;  1JLA A;  4FW1 A;  1NK7 A;  1GOA A;  3ZT1 A;  2E4L A;  4JKE A;  3QFP A;  2NRR A;  4V19 S;  3ULE A;  1X9W A;  4UY8 O;  2YNI A;  1J9A A;  2PY5 A;  3PUF A;  3SUO A;  2NNW A;  4UQG A;  1KLM A;  4CEC A;  4M45 A;  1OVY A;  3QEV A;  1L3V A;  1K9M O;  4XIU A;  4DV7 K;  2YJE A;  1SL0 A;  3LDO A;  3O3G A;  2KQ2 A;  4YOV A;  2UYT A;  1NKB A;  4H5V A;  3AVN A;  1HNI A;  1HMV A;  3I0R A;  1W7A A;  2VWK A;  5BR8 K;  3ATV A;  2XY5 A;  1BI4 B;  2YHX A;  1KD1 O;  3OS1 A;  3NF9 A;  1K8K B;  4E1M A;  4DV4 K;  2G8H A;  4KI4 A;  1BGX T;  5KPR A;  1TAU A;  2FXU A;  4BC3 A;  3HI0 A;  3HO1 A;  4KHY A;  3I33 A;  3ZSR A;  3WEE B;  1GOB A;  4DTJ A;  3OYH A;  4YOW A;  4CGH A;  4FM0 A;  4LF4 K;  5FRM A;  4AHR A;  3VER A;  2F8S A;  2X78 A;  4AHT A;  5TKW A;  1NG9 A;  4LH5 A;  3IUC A;  3FE1 A;  3CCM N;  3TAN A;  3ZCM A;  1LWF A;  4CJ5 A;  4MLE A;  4GMJ B;  3DRR A;  1BU6 O;  3OYI A;  4B9N A;  3QEP A;  1IH7 A;  5JMV A;  5AQV A;  3CCU N;  1BA0 A;  1NJX A;  3AO3 A;  4BC2 A;  1EO1 A;  1NMD A;  3ISN C;  4BG9 A;  3ZEU A;  1Q81 O;  2OPQ A;  3E66 A;  3G0Z A;  5KPT A;  4LFB K;  4E89 A;  3N4Q A;  4FK4 A;  3PX6 A;  4KKO A;  4L8R B;  3MAQ A;  1NK6 A;  1JLF A;  1TV6 A;  3NF7 A;  4E7K A;  3ATU A;  1C1B A;  5BR9 A;  4DR1 K;  2ASP A;  4CF1 A;  5AZJ A;  2Y1J A;  1HLU A;  3OHR A;  3SMP A;  1Q86 O;  4JRQ A;  2E2O A;  4BDP A;  4LF6 K;  3OY9 A;  3VQC A;  4RW9 A;  4E1N A;  1TAQ A;  1FW6 A;  2G8W A;  4DLG A;  4DUY K;  3MX5 A;  2Q0R A;  4PQU A;  5GIN A;  3EE9 A;  4BVP A;  2P9I B;  2DFF A;  2X6N A;  1K73 O;  3U9Z A;  1TYQ A;  1S6P A;  1RTJ A;  3IAY A;  4DS4 A;  2IS3 A;  4W5R A;  2OYQ A;  3UIQ A;  2YHW A;  4DV5 K;  4BC4 A;  2Q1N A;  2CGJ A;  4EHU A;  3RRH A;  3P5J A;  4O8U A;  3ZT3 A;  1LAW A;  3C7N A;  4FZX C;  1NJW A;  4Q0B A;  2AA4 A;  3RRG A;  1ZBS A;  2RHK A;  4WCE L;  1SL1 A;  4CK2 A;  1D4X A;  3K5M A;  4GKJ K;  3LL3 A;  1QS4 A;  3ZET B;  4Q5V A;  1WAF A;  2YHA A;  1Q9X A;  4LH4 A;  4K8Z A;  1EXQ A;  3EZ5 A;  1YVN A;  3AVG A;  1KAY A;  3HSC A;  1JKH A;  3FFI A;  4I9L A;  5C42 A;  4CEQ A;  3VQ6 A;  3SCX A;  2E20 A;  4ISE A;  2ZJP L;  4AHC A;  5KTQ A;  3C6A A;  4IO9 L;  4GV3 A;  4BQZ A;  5JLF A;  5J2Q A;  4NXN K;  5JIC A;  4G9Z A;  1VAZ A;  3CCV N;  4LSN A;  5AQJ A;  2P9K B;  1J5O A;  1W97 L;  3AO5 A;  2PAV A;  4FCY A;  1X1P A;  1TK5 A;  2GWJ A;  4OKK A;  3LP3 A;  5AR0 A;  4LC9 B;  3OTO K;  3S41 A;  2Q36 A;  5HRO A;  1W0H A;  3SAG A;  4CZM A;  1WB9 A;  4DSK A;  3MN6 A;  1RDA A;  3FZL A;  5KRS A;  1C0G A;  3OJS A;  3SUN A;  2UXC K;  3ZLJ A;  3TAP A;  1DGK N;  3VEO A;  4DFP A;  4CD1 A;  4O0J A;  2A1S A;  3L3U A;  4Z4I A;  1IKV A;  5EU7 A;  4ELV A;  4G1Q A;  1DKG D;  3QNN A;  2IVO A;  4QS8 A;  3DLL L;  4JEP A;  3THW A;  4CIE A;  1Y64 A;  1NK5 A;  1VQL N;  1KSP A;  1FJG K;  4CZK A;  4DTO A;  1J53 A;  3CCR N;  4Z4F A;  1O13 A;  2KW4 A;  2HHW A;  1TL1 A;  5FRN A;  4O5F A;  2BAN A;  4K0K K;  2HBL A;  3SMS A;  5F1X A;  1VQP N;  1W9H A;  4EIA A;  2IAJ A;  3FR0 A;  3QEW A;  5AQQ A;  1QSS A;  4DF8 A;  3MCP A;  3TAE A;  2IIR A;  3V6D A;  3CME N;  1NGE A;  2ZGZ A;  1IKW A;  2E2N A;  1HPZ A;  4BRD A;  3DAW A;  4OLB A;  2PYJ A;  4A61 A;  1JXE A;  4MQ3 A;  5CYQ A;  1T3V A;  3CF5 L;  2HHH K;  4MLH A;  2BUP A;  5EVZ A;  4CF2 A;  1YXQ A;  5KI6 A;  1ASW A;  3AY9 A;  1YI2 N;  3CCS N;  4YOR A;  3TSU A;  1JCF A;  3LDQ A;  3UKR A;  1X9S A;  4FO0 A;  3U4L A;  1RDU A;  3CC7 N;  4OVL A;  4DQ8 A;  3MMV A;  1KLN A;  3CMA N;  4BWM A;  1SKR A;  1VQN N;  1WSJ A;  1GLF O;  5J2N A;  1YIJ N;  3U3Y A;  4M41 A;  4OJR A;  1EKE A;  1KVC A;  2P9N B;  3CJ7 A;  3S3N A;  1DLO A;  4ZTJ A;  1J6Z A;  4JKH A;  3V1Q A;  1BCM A;  5E41 A;  4EZ6 A;  3EYZ A;  3RMC A;  1BOT O;  1NJY A;  2HBJ A;  5FPE A;  1VQ4 N;  3D7E O;  4DV6 K;  4FJN A;  2P1J A;  5A2Q O;  3IKM A;  1RT2 A;  1S5J A;  4DR3 K;  4FJ5 A;  2Z1H A;  1RIL A;  1DT9 A;  1S1X A;  3FZM A;  4B9T A;  1OVQ A;  1SQK A;  1EQY A;  4BRH A;  4FYD A;  4C8L A;  4WF9 L;  4CK1 A;  5DM6 L;  5HRS A;  1B9D A;  3A2F A;  3AO2 A;  4O8K A;  1GLJ O;  4N47 A;  3L0Q A;  2HF4 A;  2PBD A;  3AV9 A;  4GV6 A;  4YDU C;  4XH4 A;  3SLC A;  4BC5 A;  1NK0 A;  4M7Y A;  3VQA A;  3VTI A;  4LY7 A;  3HJF A;  4RW8 A;  2E1Y A;  3JAM O;  3TU5 A;  3L2U A;  2W6L A;  3JXU A;  3VES A;  3BP8 A;  3JSM A;  4CJS A;  4JK7 A;  3M1F A;  4NLC A;  3KVG A;  3BZK A;  2WBN A;  4CFC A;  2KZZ A;  2RPI A;  2D0C A;  3SQ0 A;  2OPP A;  4JI3 K;  5AQR A;  1GLD G;  2Q97 A;  3BDP A;  5AQH A;  4Z4H A;  5AQK A;  4OLA A;  2E6L A;  4JD2 A;  4BRO A;  3WT0 A;  4FVU A;  2JWK A;  2OZM A;  3LDP A;  2W41 A;  4KH6 A;  3VET A;  2HW3 A;  1EWQ A;  1C1A A;  1NLV A;  2DFH A;  3O9S A;  4JKD A;  4Z94 A;  4CHQ A;  1NU0 A;  2QKK A;  1CLQ A;  3DWL A;  1G15 A;  4CZI A;  3GDQ A;  3UKU A;  4JI8 K;  4BR5 A;  1E3M A;  4NYN A;  4IG3 A;  4CEF A;  4M63 C;  1SKW A;  4OO1 J;  3DXK A;  3AVK A;  2VGM A;  3HYF A;  3D2E B;  4WYB A;  3NFA A;  4IOX A;  3VQ7 A;  4B3O A;  4ISF A;  4I2P A;  4O55 A;  2WON A;  1RDB A;  1HRH A;  3ALY A;  2G8I A;  3DLR A;  2FBV A;  1SUQ A;  2F8T A;  3A8Y A;  4CHY A;  3T7Z A;  4OPK A;  4M3Y A;  3K5O A;  3NH2 A;  3K59 A;  1XQS C;  4I6M B;  4BRA A;  4BR7 A;  3O9T A;  1L3T A;  3AO1 A;  4YOU A;  3AO4 A;  4NCG A;  4B1W B;  4RW7 A;  2O8F A;  1VQK N;  2QWN A;  4Z4C A;  3M8R A;  4PA1 A;  3NVM A;  4J2E A;  3DI6 A;  4FJX A;  3KD5 E;  3QEX A;  3AVA A;  2OPR A;  1K8A O;  2Q31 A;  4W5O A;  1SAZ A;  3RMB A;  1BIZ A;  2WFB A;  1E4G T;  5BRH A;  5KRT A;  4JI0 K;  4DQI A;  1YHQ N;  1LCU A;  2WC9 A;  4IEI A;  4BAC A;  4M3R A;  1IV0 A;  2HMP A;  2AJQ A;  4R5P A;  3EKU A;  2IVN A;  1WSG A;  3QET A;  1MWK A;  4ID5 A;  3NDK A;  2ETJ A;  1Q8I A;  3TTC A;  4YOX A;  2HHQ A;  4W5Q A;  2P5O A;  4JKF A;  4A57 A;  1KQS M;  3RMA A;  4OGE A;  4J2D A;  1VHX A;  4DQP A;  3VF4 A;  1YAG A;  3TAM A;  1OKJ A;  2O8E B;  1RBS A;  3EZW A;  3AA5 X;  4JKG A;  4ILH A;  4HCC A;  3F73 A;  3THX B;  3VF2 A;  2X6S A;  5ADX A;  4FJ8 A;  4PY5 A;  1DTT A;  4N41 A;  1CZ9 A;  1MWM A;  1GLE G;  2XY8 A;  4FJK A;  1VQM N;  5LMN K;  3CJA A;  1NJI O;  3ID8 A;  1NGJ A;  3DOK A;  4R79 A;  3CQY A;  1NGF A;  4JI4 K;  2BH1 A;  1ZBF A;  4OKE A;  2V7Z A;  1IJJ A;  4AIL C;  2QWP A;  1VRT A;  5IT9 O;  4E7L A;  2W42 A;  4FJI A;  4DTS A;  1F21 A;  1VQ9 N;  4H0V B;  3CC4 N;  2E6M A;  1T03 A;  3NVK A;  5C2F A;  2YKM A;  3AAR A;  3C6H A;  4NLB A;  3MWP A;  5AQF A;  4DKW A;  3RR7 A;  4PKG A;  3ZSW A;  1N36 K;  1EX4 A;  3ZYY X;  2KTQ A;  5GIO A;  4CI6 A;  1BA1 A;  3A0I X;  4MFB A;  1ITG A;  3ITH A;  4BRM A;  1NGA A;  2V51 B;  1WSE A;  4JLH A;  4IOA L;  1C0F A;  3TPQ A;  2YHB A;  4Y1C A;  3TTF A;  1RBV A;  4DTR A;  1KXP A;  4JK9 A;  5HRR A;  1BO5 O;  5C15 A;  1MA9 B;  1XNR K;  2ZF5 O;  2P9L A;  5BN9 A;  5FLX O;  4WQ5 A;  5I3U A;  3RSE A;  4HVJ A;  4EZ9 A;  3DXM B;  5F0X A;  4CZG A;  1FKO A;  1NK8 A;  4DV2 K;  3H45 C;  3CFP A;  3MEE A;  1S6Q A;  4JI1 K;  1Z25 A;  5C24 A;  4N5S A;  5H1S Q;  3V81 A;  2FBX A;  2G8V A;  3CFO A;  3QFU A;  2IDO A;  1Y97 A;  2YX6 A;  3J8A A;  3R9P A;  5BRD A;  4CGI A;  1YJW N;  4DG1 A;  4QS9 A;  4FK2 A;  2HND A;  4ELU A;  3F9M A;  1DEJ A;  3BEX A;  3P4I A;  3LP1 A;  3O3H A;  1L3S A;  2I7P A;  1M90 O;  4CIF A;  4B1V A;  2A42 A;  3PSF A;  3AVB A;  3MED A;  4PL8 A;  4EP5 A;  1K8K A;  2V52 B;  4FLV A;  3ULE B;  2GBZ A;  3OW2 M;  3OBW A;  1ZXO A;  2YNG A;  1Z6R A;  2Q3S A;  3E9O A;  3AGK A;  2LSN A;  4EP4 A;  3MXM A;  3V9X A;  3QLH A;  4CF0 A;  3K5L A;  3TWH A;  2O8C B;  3D6R A;  3D2F A;  1RT7 A;  3VA0 A;  4CW7 B;  4JS4 A;  2PFU A;  4GKK K;  1NOZ A;  3VMF B;  2UXB K;  1RT6 A;  2F96 A;  1YT3 A;  5MLC Q;  3SQ1 A;  3ENB A;  3QBX A;  3CQX A;  3SI6 A;  4XH1 A;  5D3G A;  3VQ8 A;  2HVH A;  4E7I A;  3W0L A;  2QA4 N;  3H1V X;  3NH1 A;  3OBY A;  3GG4 A;  3K9K A;  4BRF A;  4B3S K;  5AQT A;  1WBB A;  3OYG A;  3KK2 A;  3C94 A;  3B6O A;  4BRL A;  3EEQ A;  1BCO A;  2HHX A;  2IOC A;  1WSF A;  5KQ8 A;  1YJ9 N;  4A5B A;  4DU3 A;  3EN9 A;  2GV9 A;  5HL7 L;  2E2Q A;  4KI6 A;  3HST B;  1VSD A;  4FWK A;  4CEB A;  4CFA A;  4CGJ A;  4CHZ A;  4M3X A;  1MU2 A;  3BZC A;  4CEE A;  3TSP A;  3R6M A;  3BGR A;  1I39 A;  3F5T A;  4HTU A;  4BRK A;  3CC2 N;  4BQL A; 
#chains in the Genus database with same CATH homology
 2A3Z A;  2IIR A;  3CME N;  1QQN A;  3VGK A;  3O9Q A;  1E4F T;  1NGE A;  2FLO A;  2HF3 A;  2GUP A;  2ZGZ A;  5AZI A;  3BUZ B;  1KC8 O;  2E2N A;  2Q0U A;  4AM6 A;  4BRD A;  3DAW A;  2HOE A;  4U67 L;  3O4W A;  3CXC M;  5JLH A;  4MDB A;  4A61 A;  4BRP A;  2A41 A;  2VYP A;  1T3V A;  2NRT A;  2RE2 A;  3H3N O;  3IFR A;  1ATR A;  3CD6 N;  3CF5 L;  5C12 A;  3A5O C;  2QEX N;  4MLH A;  2BUP A;  1Q18 A;  3A5N C;  5AQX A;  4FPA A;  1HKC A;  3GL1 A;  4I6M A;  5AQI A;  5EVZ A;  2FF3 B;  3WXM B;  3WXL A;  1YXQ A;  5ELZ A;  3AAP A;  3AY9 A;  3MK6 A;  1KAX A;  1YI2 N;  2QW9 A;  2GTD A;  3P39 A;  3VEV A;  4YOR A;  3CCS N;  5AQG A;  1BG3 A;  3TSU A;  4BY9 C;  1JCF A;  2GWK A;  3H6E A;  4IZ9 A;  3CIP A;  3LDQ A;  4A2B A;  3UKR A;  3O5B A;  1JCE A;  4FO0 A;  1S3X A;  3U4L A;  1RDU A;  3CCE N;  3CC7 N;  3MDQ A;  3G71 N;  4DQ8 A;  3MMV A;  2P9P A;  1QZ6 A;  3CMA N;  2WUS A;  3EL2 A;  1P90 A;  5DM7 L;  3O1B A;  2P9L B;  2Q2R A;  4FPB A;  2FSK A;  3T69 A;  4FOI A;  4XEI A;  4Y0W A;  3KWI A;  1VQN N;  3A5L C;  1GLF O;  4BRI A;  1T44 A;  1U6Z A;  1YIJ N;  1NWK A;  4JHD B;  3SBT A;  2A40 A;  1VQ5 N;  3R8E A;  1ZC6 A;  2E88 A;  3C7N B;  1R59 O;  2A6A A;  3SBG A;  4CBU A;  2P9N B;  5FPD A;  3CJ7 A;  3M3Z A;  5M1O A;  5GIP A;  1BDG A;  1GLA G;  1U2V A;  3CJ9 A;  1YUW A;  4WFB L;  2F9T A;  3GOI A;  1J6Z A;  2HBM A;  4H03 B;  4GY2 B;  4JKH A;  4MO4 A;  3ZX0 A;  2ZJQ L;  2YJF A;  1XC3 A;  3VOV A;  1X3N A;  4FWS A;  2ASM A;  3CCV N;  3FZH A;  3KWG A;  1BOT O;  3CJC A;  3L4I A;  5AQL A;  2HBJ A;  3IDH A;  5FPE A;  3CPW M;  1VQ4 N;  1QQO A;  1HPM A;  3D7E O;  1QVF M;  3WEE A;  3IKM A;  1VQ8 N;  4A59 A;  2J4R A;  3Q7C A;  5EOY A;  2EWS A;  3HOT A;  1DT9 A;  3FZM A;  1GLB G;  1SQK A;  1EQY A;  4BRH A;  1TUY A;  5BRE A;  4WF9 L;  5DM6 L;  1P8Z A;  2P9U A;  1HX1 A;  4K43 A;  3MN9 A;  4BRQ A;  1NGD A;  4O8K A;  3CER A;  2V7Y A;  1QHA A;  3QB0 A;  4A5A A;  3PLA A;  4BR2 A;  1GLJ O;  1YIT N;  1YF5 L;  3L0Q A;  2HF4 A;  3UE5 A;  2PBD A;  3QIC A;  3I55 N;  4GV6 A;  3U8X A;  3CI5 A;  2GX9 A;  3D2F B;  4XH4 A;  4YDU C;  5AQY A;  3SLC A;  2HBK A;  2NRZ A;  4BC5 A;  2HST A;  5EXW A;  4H5T A;  4M7Y A;  5GAH P;  3QML A;  3VTI A;  2CH5 A;  4BR4 A;  5AQN A;  4E1J A;  5AQU A;  2E1Y A;  1S72 N;  3H1Q A;  3TU5 A;  5LJW A;  2QWQ A;  3JXU A;  3VES A;  4PKI A;  3BP8 A;  4DCH A;  2D0O A;  2QI2 A;  3QDK A;  1N8R O;  1VQ6 N;  3NMU A;  3R3L A;  4JK7 A;  3M1F A;  1V4S A;  1Q7Y O;  3TTD A;  4NLC A;  1YJN N;  2GEL A;  4NB4 A;  3WUH A;  3KVG A;  1NGB A;  2WBN A;  1SZ2 A;  3JS6 A;  3O9U A;  2CGK A;  2E8A A;  2JWL A;  4C1N I;  3E9P A;  4CZJ A;  5CE3 A;  4H5R A;  5AQR A;  1GLD G;  2Q97 A;  5AQH A;  4BVO A;  4EHT A;  5AQK A;  1CZA N;  4IOA L;  4IEE A;  1ATS A;  2ZWH A;  4JD2 A;  4FWR A;  3WXJ A;  4BRO A;  3WT0 A;  4FVU A;  2JWK A;  1HKB A;  3LDP A;  2W41 A;  2QWL A;  4KH6 A;  3VET A;  3VEZ A;  3O9S A;  1NLV A;  4JKD A;  3ZEU B;  3ZX3 A;  4Z94 A;  3DWL A;  5LJV A;  4XH5 A;  4CZI A;  3O9R A;  3GDQ A;  3UKU A;  5E84 A;  3KHY A;  4BR5 A;  4BRE A;  3G25 A;  4YOY A;  2H3G X;  4GVE A;  2KKZ A;  4BGB A;  3E9L A;  2D0P A;  2QWR A;  3I8B A;  1SS6 A;  4M63 C;  2NRW A;  4OO1 J;  3DXK A;  3E1Y A;  1LOT B;  5AZJ B;  2VGM A;  5CHI A;  2P9I A;  4C23 A;  3R1X A;  5AQP A;  3D2E B;  4WYB A;  1ILY A;  3PIO L;  2ZGY A;  4CZH A;  1QVG M;  1VQO N;  4IOX A;  2W40 A;  3KK7 A;  4IOC L;  4F9O A;  5AQS A;  1HKG A;  4ISF A;  5AFU A;  3GBT A;  4FWQ A;  4JNE A;  3DXM A;  3N4P A;  3A5M C;  1NBW A;  3HTV A;  5AZI B;  3DJC A;  4CZE A;  1QZ5 A;  4DHY A;  3SJH A;  3FZK A;  2ITM A;  3VF6 A;  1WOQ A;  4HTL A;  2YI1 A;  2FSJ A;  2QXL A;  2AP1 A;  3A8Y A;  3T7Z A;  1T6D A;  3ZET A;  1TYQ B;  3H3O B;  1HJO A;  2NLX A;  3FLC O;  1XQS C;  4H0P A;  4HWI A;  4YDU A;  3VEN A;  4I6M B;  5C10 A;  4BRA A;  4BR7 A;  5I9E B;  4L3Q A;  3O9T A;  1XUP O;  4YOU A;  3RSE B;  4B1W B;  4IJA A;  1VQK N;  3HOS A;  1H1V A;  1V4T A;  2QWN A;  3MN5 A;  4PHT X;  1MDU B;  5BPM A;  1NGC A;  3NVM A;  2OAN A;  3GE1 A;  3LM9 A;  3UKR B;  3QBW A;  4BR0 A;  1VQ7 N;  4MDA A;  3VEW A;  2NZT A;  3FZF A;  2ASO A;  2QWO A;  3VGL A;  3W3D A;  5GAG P;  3CJ1 A;  4CJ7 A;  2P9P B;  5TKY A;  1K8A O;  2Q31 A;  5M1N A;  4JKE A;  2D1K A;  3QFP A;  1GLC G;  2NRR A;  1SAZ A;  5F2R A;  3ULE A;  1W2B M;  4UY8 O;  2CGL A;  5BN8 A;  2WFB A;  1E4G T;  2P9K A;  5BRH A;  3J7Z O;  3M5R A;  4WFA L;  5AQM A;  2NNW A;  3SAF A;  2P9S A;  1YHQ N;  1LCU A;  2WC9 A;  1OVY A;  4IEI A;  4B1X B;  3G6E N;  1K9M O;  2YJE A;  4K41 A;  3CCQ N;  3LDO A;  4YOV A;  2UYT A;  2HMP A;  4RTF D;  3ENO A;  2IVP A;  3EKU A;  2I7N A;  2D4W A;  4H5V A;  3CHW A;  3CCJ N;  1U2V B;  2NRH A;  2IVN A;  3ATV A;  4FSV A;  1MWK A;  2QWM A;  3EKS A;  4KBO A;  3FGU A;  2KHO A;  4BRG A;  2YHX A;  4BRC A;  1KD1 O;  3TTC A;  1K8K B;  4YOX A;  4B9Q A;  2A5X A;  5KPR A;  4JKF A;  2FXU A;  4A57 A;  4NO7 A;  3HI0 A;  4BC3 A;  1KQS M;  3CCL N;  5HOO A;  3I33 A;  5BRF A;  3WEE B;  4IO8 A;  4CZL A;  5EX5 A;  4YOW A;  2VCP A;  4BR9 A;  3VF4 A;  4K25 A;  1YAG A;  3VER A;  3ZX2 A;  4EAH D;  1OKJ A;  3P31 A;  2QM1 A;  1JCG A;  5TKW A;  5GAD P;  4IWV A;  4CD3 A;  3EZW A;  2P9U B;  2VGN A;  2QTD A;  3IUC A;  4K42 A;  3FE1 A;  4JKG A;  3CCM N;  4ILH A;  5ADX H;  5AQZ A;  4MO5 A;  3CJB A;  3HBT A;  4MLE A;  4FOE A;  1WUA A;  4JKC A;  2ZJR L;  1BU6 O;  3VF2 A;  1T6C A;  3O6W A;  5JMV A;  3VPZ A;  5ADX A;  5AQV A;  1MWM A;  3CCU N;  1GLE G;  3AGR A;  3EE8 A;  1BA0 A;  1VQM N;  3CJA A;  4BC2 A;  5AQW A;  4PL7 A;  3L6Q A;  1NGG A;  1EO1 A;  1NMD A;  1NJI O;  3WQU A;  3ID8 A;  1NGJ A;  4R79 A;  3CQY A;  3ZEU A;  4BG9 A;  1Q81 O;  5C0Y A;  4JKA A;  3E66 A;  1NGF A;  5KPT A;  3N4Q A;  2YHY A;  1HUX A;  2FSN A;  3C0B A;  3MX2 A;  5B8H A;  2BH1 A;  4FWM A;  2V7Z A;  1IJJ A;  3WXK A;  5M1K A;  4JK8 A;  3ATU A;  3O8M A;  2QWP A;  5BR9 A;  5KPZ A;  3BF1 A;  3IMX A;  3MCA B;  1VQ9 N;  2ASP A;  1RDW X;  4H0V B;  5AZJ A;  3CC4 N;  3NVK A;  5AFU H;  4JD2 B;  5C2F A;  1HLU A;  1NGI A;  3OHR A;  3AAR A;  3C6H A;  4NLB A;  3HM8 A;  3MWP A;  4IDH A;  3SMP A;  3WXI A;  3AAQ A;  3FFK B;  5AQF A;  4DKW A;  4IJN A;  4BG8 A;  4PKG A;  4AF1 A;  2F7T A;  3ZYY X;  4DB3 A;  4KH4 A;  1Q86 O;  5FPN A;  3UKU B;  3VEY A;  4CBX A;  2E2O A;  1X3M A;  5GIO A;  3K9J A;  4CI6 A;  1BA1 A;  3A0I X;  4OPA A;  5E26 A;  3LM2 A;  1GLL O;  3ID6 A;  1KAZ A;  3MX5 A;  4BRM A;  1NGA A;  2V51 B;  2Q0R A;  4RCH A;  5CR4 A;  1RGI A;  5GIN A;  3EE9 A;  4BVP A;  1C0F A;  3DXK B;  4FWP A;  3TPQ A;  3TTF A;  3VTH A;  4A2A A;  5GAE P;  2P9I B;  1KXP A;  2FF6 A;  2NRV A;  4JK9 A;  1K73 O;  1BO5 O;  1TYQ A;  3RVC A;  1MA9 B;  1G99 A;  3U9Z A;  5C15 A;  2ZF5 O;  2P9L A;  5BN9 A;  2OTL N;  1Z05 A;  3EO3 A;  4QS7 A;  4GV9 A;  4WQ5 A;  3RSE A;  1TUU A;  3LDN A;  3DXM B;  5FPM A;  2YHW A;  3U9D A;  4JHD A;  5F0X A;  4BC4 A;  5M1Q A;  4CZG A;  2Q1N A;  2CGJ A;  4EHU A;  3H45 C;  4O8U A;  3C7N A;  4CZF A;  4WQ4 C;  2P9N A;  1S22 A;  2AA4 A;  1ZBS A;  2RHK A;  4WCE L;  3PIP L;  3HZ6 A;  1D4X A;  1NGH A;  3LL3 A;  5H1S Q;  1QQM A;  3Q7B A;  3SK3 A;  4GNI A;  3ZET B;  5JVH L;  3QFU A;  2YX6 A;  2E2P A;  3CET A;  1YVN A;  3J8A A;  3R9P A;  1KAY A;  3HSC A;  4U7B A;  5BRD A;  4H5W A;  3VGM A;  3HRG A;  4ISG A;  1YJW N;  4QS9 A;  2F9W A;  3F9M A;  2E20 A;  4FWO A;  1DEJ A;  3OA9 A;  5BPL A;  4ISE A;  3BEX A;  5KQD A;  2YCH A;  2ZJP L;  3C6A A;  5C2D A;  1ESV A;  3P4I A;  4IO9 L;  2I7P A;  5M1P A;  1M90 O;  4GV3 A;  4B1V A;  2A42 A;  5BPN A;  4BQZ A;  5JLF A;  3B8A X;  1Q82 O;  5JIC A;  5LY3 A;  4G9Z A;  3H46 O;  4H0Y B;  1VAZ A;  4PL8 A;  5M1F A;  4C1N K;  1K8K A;  3M6G A;  2V52 B;  3C65 A;  3ULE B;  3OW2 M;  1ZXO A;  3OBW A;  1Z6R A;  1BWF O;  4H5N A;  3F2K A;  3E9O A;  3AGK A;  2P9K B;  5AQJ A;  5EY4 A;  4OPH A;  1W97 L;  4BRN A;  2E1Z A;  4J8F A;  3G4S N;  2PAV A;  1NM1 A;  3D6R A;  3D2F A;  2P9S B;  2GWJ A;  4KH5 A;  4WQ5 C;  3UB5 A;  2PFU A;  5AR0 A;  4LC9 B;  4JKB A;  3S41 A;  3VMF B;  2OTJ N;  2Q36 A;  2KLA A;  3SAG A;  4CZM A;  5MLC Q;  4AM7 A;  3ENB A;  4ILJ A;  3QBX A;  1IG8 A;  1M1K O;  3MN6 A;  4ILG B;  3CQX A;  3FZL A;  4XH1 A;  3MWT A;  1C0G A;  1BUP A;  2DPN A;  3W0L A;  1DGK N;  1RFQ A;  2QA4 N;  3H1V X;  4FWN A;  3OBY A;  3VEO A;  3WQT A;  3GG4 A;  4CD1 A;  3MN7 A;  4IXC A;  4BGA A;  3O08 A;  3SAH A;  3K9K A;  4H0T B;  4WFN L;  1DKG D;  4BRF A;  4B1Y B;  2IVO A;  4QS8 A;  1JJ2 M;  2CH6 A;  3DLL L;  4JEP A;  4B1Z A;  5AQT A;  1Y64 A;  3P38 A;  1VQL N;  4JAX A;  4CZK A;  4M7X A;  3CPE A;  3CCR N;  1O13 A;  4FWL A;  3KZB A;  4JKG B;  4IFE A;  4BRL A;  4A62 A;  4WQ4 A;  3L4Q A;  4H0X B;  4B1U B;  1X9J A;  3BF3 A;  5KQ8 A;  4O5F A;  2NRX A;  1YJ9 N;  5AQO A;  4EFH A;  4H0O A;  3VEX A;  4A5B A;  2HBL A;  3SMS A;  5F1X A;  3TSQ A;  3EN9 A;  1VQP N;  5HL7 L;  2E2Q A;  4FWK A;  4EIA A;  2BTF A;  4PKH A;  3FR0 A;  4FL9 A;  3D2E A;  3O80 A;  5AQQ A;  4RWT A;  4CBW A;  3R6M A;  3TSP A;  2GEM A;  3LDL A;  3MCP A;  3I56 N;  2VWB A;  3F5T A;  4JN4 A;  4BRK A;  1ATN A;  4YOT A;  3O1W A;  3CC2 N;  5JVG L;  4BQL A;  3ENH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...