3BEXA

Type iii pantothenate kinase from thermotoga maritima complexed with pantothenate
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
248
structure length
248
Chain Sequence
MDPMYLLVDVGNTHSVFSITEDGKTFRRWRLSTGVFQTEDELFSHLHPLLGDAMREIKGIGVASVVPTQNTVIERFSQKYFHISPIWVKAKNGCVKWNVKNPSEVGADRVANVVAFVKEYGKNGIIIDMGTATTVDLVVNGSYEGGAILPGFFMMVHSLFRGTAKLPLVEVKPADFVVGKDTEENIRLGVVNGSVYALEGIIGRIKEVYGDLPVVLTGGQSKIVKDMIKHEIFDEDLTIKGVYHFCFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type III pantothenate kinase
publication title Structural basis for substrate binding and the catalytic mechanism of type III pantothenate kinase.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 77
structure length 248
sequence length 248
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03309 Pan_kinase Type III pantothenate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bexA01
3.30.420.490 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bexA02
1QZ5A 3KHYA 4BR5A 3ENOA 3J8AA 3ZETA 3HZ6A 2GWJA 5LJWA 3G25A 4PKGA 1ESVA 2HMPA 4BRNA 5AQRA 5E84A 4E1JA 2CGLA 3HM8A 4JD2A 4BRFA 4MLHA 4DHYA 4K25A 1QHAA 2I7PA 2P9IB 2YHXA 3AAQA 4BRGA 2IIRA 4QS9A 4BRPA 3MK6A 3M1FA 3QMLA 4FPAA 4BREA 3BEXA 4FWKA 4BG8A 5JICA 1XUPO 2I7NA 2P9PB 4XH5A 3IDHA 1EQYA 1GLBG 3C0BA 4H03B 1QQNA 4WQ5A 5AFUH 5AR0A 5ADXH 3UB5A 4FWRA 4QS7A 4BRHA 2A6AA 3U9DA 4O5FA 3HI0A 3DAWA 4I6MA 2E1ZA 2E2NA 3LDQA 3DXKA 3ULEA 2Q0RA 1RFQA 2KHOA 1ATRA 3GG4A 3SMSA 3EKUA 1C0FA 1SZ2A 2Q2RA 5TKYA 1XQSC 2UYTA 3DXMA 3BP8A 1BWFO 3F9MA 2ZF5O 1NMDA 2V7YA 2VCPA 5AZJA 3VPZA 2P9NA 3EL2A 1DKGD 1NGFA 3HBTA 4H0VB 4O8KA 3CJBA 4EHUA 2ASOA 4FWLA 1HJOA 3EO3A 4BR7A 4B1YB 2ASPA 2V51B 2D1KA 2PBDA 3M3ZA 4IJAA 4JD2B 4CZIA 1NGIA 3FR0A 1OKJA 3O08A 3SJHA 5AQYA 1ATSA 3FGUA 3ZX3A 4Z94A 3ATUA 3VF4A 1NBWA 3JS6A 2AA4A 1S3XA 5BPNA 5F0XA 2E20A 4FL9A 1HUXA 3DWLA 1ZXOA 2YJFA 2FSJA 3IMXA 2GWKA 3MN6A 4B1ZA 3LDOA 3AAPA 4B1WB 4PL7A 3MMVA 1NGEA 2QWRA 4MLEA 4PKHA 5EX5A 3ZEUA 5AQFA 3JXUA 3MCPA 1RGIA 4NB4A 3HTVA 4FOEA 3U9ZA 4JN4A 1KAXA 3FFKB 3VENA 2Q0UA 5FPNA 2IVNA 3VEOA 3WQUA 5I9EB 3UE5A 1YUWA 1RDWX 3DXKB 3ULEB 1D4XA 2HF4A 1T44A 5FPDA 2W41A 1BA0A 4CZEA 5CE3A 5EY4A 2PAVA 3CETA 1X3MA 3B8AX 5AQNA 4GY2B 4L3QA 2FF6A 1DEJA 1QQMA 1TUYA 3W0LA 2P9NB 2P9SA 4J8FA 4CZLA 5BREA 4A2AA 2IVOA 2ZGZA 3M6GA 5AQLA 4IXCA 1NWKA 5AQMA 2A3ZA 2CH6A 5ADXA 3FZHA 3LDNA 2GELA 3OHRA 2FSNA 4YDUC 1YAGA 5F2RA 4XEIA 3MN9A 5E26A 1BO5O 4B1VA 1JCFA 2E88A 3H1VX 2QWNA 5AQZA 3ZX2A 3CJCA 5AQUA 5FPMA 3QFUA 1MDUB 3ATVA 3BF1A 1MWKA 3UKRB 4ISGA 3CIPA 1WOQA 1GLAG 3VOVA 1XC3A 4FWQA 1ZC6A 5BRFA 4WYBA 5LJVA 3A5OC 3ZEUB 1G99A 3CJ7A 2OANA 2FSKA 5BN9A 4PL8A 3DJCA 3D7EO 4XH4A 3S41A 3CHWA 2NZTA 3O80A 1H1VA 4BGBA 5AQQA 4MO5A 4BRAA 5BPMA 4ISEA 4ISFA 2QM1A 3KVGA 4H0PA 1Z6RA 1GLLO 3I8BA 2YHWA 5JLHA 3MN7A 4IJNA 1HKCA 5AQGA 2H3GX 4A61A 1WUAA 2P9SB 3UKUB 2AP1A 1X9JA 3O1BA 1MWMA 1J6ZA 2HOEA 3CQXA 3WXJA 1ZBSA 2GEMA 3MN5A 4JNEA 3FZFA 4A2BA 4H5NA 3GBTA 2QXLA 1HPMA 5LY3A 2P9KA 1R59O 1C0GA 3LM2A 3D2FA 3WUHA 4CBXA 4H5WA 1NLVA 4BR0A 3LL3A 1HKBA 3HSCA 4PKIA 1GLFO 4HWIA 1S22A 3H1QA 5AQWA 4BG9A 2QWQA 2FLOA 4NO7A 1SQKA 4BR2A 4CZGA 1GLJO 1HX1A 4H0OA 1KAZA 4BRIA 3H6EA 4K43A 5AZIB 3UKRA 4FO0A 3ZX0A 3WXKA 2ITMA 3A5MC 1GLEG 2F9TA 2Q97A 3VETA 1ATNA 1U6ZA 4BQLA 1U2VB 4BVOA 2YCHA 4FPBA 4IZ9A 4FWPA 2Q31A 4WQ4C 4FSVA 1BU6O 5AQIA 1V4SA 4CZJA 3FE1A 1E4FT 5AQPA 3H45C 1KAYA 2DPNA 1CZAN 4BRQA 3A5NC 2QWOA 5JLFA 2E1YA 4YDUA 1JCGA 1YVNA 3LDPA 4DQ8A 5AQOA 2GTDA 1NGHA 1TYQA 4IO8A 3C7NA 5BN8A 4H5TA 4B9QA 1TUUA 3R9PA 3O6WA 2P9KB 3H46O 3LM9A 3D2EA 3UKUA 4FWOA 4JHDA 3D2FB 3VESA 3KZBA 3FLCO 3VGMA 3A5LC 4KBOA 4BQZA 5EOYA 5AFUA 2A40A 2QW9A 3CJAA 3U4LA 1Q18A 3RSEA 1K8KB 2W40A 4BGAA 3QICA 4DCHA 2ASMA 2F9WA 2E2QA 4CBUA 4MO4A 1LCUA 5AQSA 2A42A 2D0PA 5KQDA 2FF3B 2J4RA 4H5RA 3I33A 1GLCG 5BRDA 4H5VA 4DB3A 4XH1A 3VEZA 3QB0A 3U8XA 2E8AA 5AZIA 2GUPA 4B1UB 4EHTA 4QS8A 1TYQB 3C7NB 1U2VA 3SLCA 4BC4A 3VF2A 3FZLA 3GL1A 5KQ8A 3LDLA 3VEXA 4BRCA 3D2EB 4GNIA 2FXUA 3MDQA 3WQTA 4C23A 4JHDB 4BRKA 1BDGA 2WUSA 1BG3A 3EN9A 1NGCA 4BVPA 4CZMA 2QWPA 3BUZB 1BOTO 2NRHA 3AARA 4H0TB 4BR4A 4FWSA 4H0XB 3QBXA 2QWLA 2D0OA 1QZ6A 3RSEB 3VF6A 5EXWA 2EWSA 2CGJA 4RWTA 1BA1A 1T6DA 3GOIA 4RCHA 2BTFA 5AQKA 2NLXA 1JCEA 4CZHA 1QQOA 1MA9B 3A0IX 2Q1NA 2CH5A 4K41A 3CJ1A 3H3OB 5KPRA 3W3DA 4WQ4A 3ENHA 4HTLA 3IUCA 2E2PA 1V4TA 3R8EA 4CI6A 4B1XB 3VEYA 2ZGYA 4BC3A 1YXQA 3R6MA 4FWMA 1DGKN 1K8KA 1NGJA 1P8ZA 3BF3A 3WEEA 5F1XA 2P9UA 2YI1A 5EVZA 4RTFD 1HLUA 5AQVA 5JMVA 1E4GT 3L4IA 4FOIA 3O1WA 3ZETB 4WQ5C 2HF3A 3A8YA 3VEWA 2YHYA 4A62A 2P9LA 3QDKA 1IG8A 5AQXA 4CJ7A 3L0QA 2BUPA 1Z05A 3FZKA 3P4IA 4EAHD 4BC2A 4CZFA 4CD3A 3CJ9A 4BR9A 1KXPA 3CQYA 4AM6A 4H0YB 5BPLA 1NGDA 3WT0A 3ID8A 5BR9A 3EKSA 2V52B 4M7XA 4Y0WA 3SMPA 1T6CA 5KPZA 1X3NA 5AQTA 3VGLA 3VGKA 3TU5A 3IFRA 5FPEA 1NGBA 3WXIA 2VYPA 4JAXA 3VEVA 4M63C 4CZKA 4IWVA 4F9OA 3O5BA 4AM7A 2IVPA 5ELZA 2P9IA 5AQHA 3CERA 4BC5A 2QWMA 2ZWHA 4K42A 3TPQA 3VERA 4I6MB 1NM1A 2YJEA 3GDQA 2A41A 4BRLA 4LC9B 1HKGA 3CI5A 2Q36A 3WXLA 2P9PA 3FZMA 1LOTB 2D4WA 3L6QA 4BRMA 2E2OA 3DXMB 3WEEB 5KPTA 2CGKA 3QFPA 1BUPA 2P9UB 5AZJB 1NGAA 3QBWA 5AQJA 1NGGA 3GE1A 3O8MA 4CD1A 2V7ZA 1SAZA 4EIAA 2P9LB 2A5XA 3AY9A 4BRDA 4EFHA 3SK3A 3EZWA 1GLDG 3H3NO 4CBWA 1IJJA 2VWBA 4M7YA 4BROA 5BRHA 5B8HA 3O4WA 4FWNA 1Y64A
chains in the Genus database with same CATH superfamily
2B5JA 3ENOA 3ZETA 4FM1A 3HZ6A 3THWA 1L3VA 1ESVA 4NYFA 4BRNA 5AQRA 2WTUA 4FVUA 3ZSWA 3HM8A 4DG1A 4BRFA 4MLHA 4FLYA 3CMAN 4QCLA 2P9IB 3AVIA 1T03A 4QS9A 3K58A 1X9SA 4FLZA 2YNHA 4DSJA 3QMLA 4FM2A 4FWKA 2WC9A 3WNEA 3S3MA 1K8AO 4XH5A 4DLGA 4DTPA 3CC4N 4OGEA 4IKFA 4DMNA 3HVRA 4RW4A 3G4SN 3UB5A 3RMAA 1JL1A 4FZYA 1XNRK 1NK6A 3E01A 3VQAA 3HO1A 1HYSA 1NK0A 2Q0RA 3CFPA 2ZJQL 3GG4A 3N4QA 4FW2A 4KPYA 2UYTA 4DTXA 2E4LA 1BWFO 2DFFA 1A5VA 3RR8A 4FJ9A 2HBMA 1NGFA 3ISNC 4I2PA 4YOTA 3TAMA 4FWLA 3EO3A 4BR7A 4DR4K 2O8EB 1ASVA 4Q0BA 4CHZA 4KTQA 4JK9A 4JD2B 4CZIA 1NGIA 4CJKA 4E0DA 5C2DA 5M1FA 3ATUA 3OYLA 2PYJA 1C1BA 1WSEA 1RBSA 4DTSA 2YJFA 1J53A 3CCRN 2GWKA 3MN6A 3M8QA 3AO5A 3LDOA 5M1OA 1JJ2M 4B1WB 4DSEA 1NGEA 1XNQK 5AQFA 2Q3SA 1RGIA 4NB4A 1NK4A 2E6MA 3VENA 5KI6A 1QSLA 3CCJN 3VEOA 3UE5A 1EX4A 1XWLA 3ULEB 2HF4A 5FPDA 2W41A 1BA0A 4DSFA 3L3VA 1L3UA 5J2MA 1X3MA 3NGIA 5TKWA 3F5TA 4GY2B 4L3QA 1DEJA 2P9SA 4JKBA 2ZJRL 4B9VA 4CGHA 2ZGZA 3JYTA 2F96A 4HCCA 4KRFA 5ADXA 4HVJA 3ZT4A 4RW9A 3NDKA 1X9WA 5E26A 1BO5O 4B1VA 1JCFA 2G8HA 3J7YP 3VQ6A 3UKRB 3K57A 4W5OA 1NJZA 3VOVA 1GLAG 1CZBA 1XC3A 3Q7BA 4QOZB 4FWQA 1ZC6A 4LF5K 3LAMA 1IKVA 1C6VA 3VQBA 4FLVA 2FSKA 4AHCA 3CFRA 3OJSA 3DJCA 4FK0A 4FJ5A 4XH4A 4OKKA 1H1VA 3ZT2A 4MO5A 4JYAK 1K6YA 1NK7A 1M1KO 4AHRA 1REVA 1GLLO 3C6UA 2HHWA 3J80O 4A61A 4X62K 3UKUB 5LMNK 3TTCA 3OY9A 1Q7YO 1VQLN 3JAMO 3AVAA 1ZBSA 3CCQN 3QERA 2GEMA 3PX4A 1RT4A 4JNEA 2BE2A 3T1AA 2NRZA 4DV3K 4MFBA 4A2BA 3K9KA 3NE6A 3F2KA 1R59O 3AVGA 3M5RA 4CJLA 1NLVA 4DKWA 4IOAL 4PKIA 5LL6Z 3ALYA 4CEZA 3VQ7A 2VG5A 3P5JA 4CGIA 1SQKA 3RWUA 3DRSA 1VSHA 4OPHA 3DI6A 1GLJO 1S6PA 1HX1A 4R79A 1Q81O 1WAFA 3H6EA 5AZIB 5CYMA 3ZX0A 3WXKA 1UOCA 3A5MC 3ITHA 4ID1A 3CYMA 4CJ3A 3HK2A 4M41A 4IZ9A 4FWPA 1VSFA 5HRSA 4FYDA 4K0KK 3NF8A 2VWJA 3EE9A 1E4FT 4B8CA 3DLLL 4DSIA 2DPNA 2HHQA 3TSPA 3NVMA 4KTZA 1JCGA 1LWEA 5AQOA 1I3AA 3CF5L 1UA1A 4CJWA 3TANA 1TYQA 4B3TK 3HOSA 3C7NA 4JK7A 4E3SA 2KFNA 2WBNA 4B9QA 1TUUA 3R9PA 4C1NK 1L3SA 4IOCL 4CVNE 2O8BB 3LM9A 4B3SK 3D2EA 1FW6A 3IG1A 3FLCO 5HRPA 3VGMA 3A5LC 4JI3K 4BQZA 1DTQA 1NJYA 1QS4A 4KHQA 3U4LA 1C0MA 4DU4A 3M8RA 2W40A 4KH6A 1OH5A 4GKJK 1VSDA 3CCEN 4BGAA 3QICA 4DCHA 2XHBA 4JKHA 3T69A 1OVQA 3TTFA 2E2QA 5CR4A 4MO4A 5AQSA 1N32K 4JEPA 5J2QA 4FK2A 1YIJN 1W9HA 2RPIA 3NAEA 4YNQA 4JK8A 1FK9A 4JKGB 4QAGA 3LP0A 2WOMA 4XH1A 3VEZA 2OA8A 2O8FA 3QNNA 5J1EA 2KLAA 3OBYA 3MXJA 4J2BA 4JKCA 5FLXO 3VMFB 1WBBA 1U2VA 4DR5K 3MXIA 4CW7B 1HYZA 3SAGA 3OS0A 4O5BA 4JI7K 3MDQA 3TAQA 4NCAA 2W42A 1B9DA 1NGCA 3V1QA 4CZMA 2QWPA 3SJJA 1HNIA 3MCAB 3BUZB 3TAGA 3PV8A 4KHNA 4H0TB 4B9LA 1VQKN 4H0XB 3THYA 3T3FA 1QZ6A 3OS1A 4FCYA 1HMVA 3AVHA 2EWSA 3KD5E 4LF6K 4CEBA 3HVTA 2BTFA 3PSFA 3MEEA 5HP1A 4E1MA 3CQ8A 4CFBA 4CIEA 4N56A 3PX6A 3OYNA 3RMDA 3CJ1A 1OH8A 2PY5A 3W3DA 4WQ4A 3IUCA 3R8EA 3VQQA 3VEYA 3QLHA 4C8OA 4FWMA 4XIUA 3WEEA 1NGJA 3EYZA 2FBVA 2P9UA 5EVZA 4R5PA 4CFDA 4CJ5A 4PWDA 1L5UA 4FLWA 3MEDA 1HLUA 1VSMA 3ZSYA 5JMVA 3VQCA 4WQ5C 1HJRA 2HF3A 4GVEA 1RT1A 2P9LA 1BL3A 2BUPA 3FZKA 3V9WA 3RR7A 4BC2A 3QO9A 2AJQA 4CZFA 4CJEA 4CD3A 4Z0UA 4BR9A 1KXPA 3DLHA 1WSGA 1D9FA 3F73A 4AM6A 4E19A 4H4OA 2ZD1A 4H0YB 4CCHA 1NGDA 3ID8A 1ZBIA 2KQ2A 1Z26A 4M7XA 3SMPA 1T6CA 2OPSA 5KPZA 5AQTA 1X1PA 1ASUA 5CYQA 1NGBA 3HM9A 5HROA 1N8RO 4CJTA 4LF7K 2P9IA 4JS4A 3CERA 1RDCA 2QWMA 1S1WA 4X66K 5C10A 5FDLA 3VERA 4Z4HA 2GBZA 2YJEA 3GDQA 2A41A 2VGNA 3AVLA 3WXLA 2D4WA 4KHUA 3M8SA 1N33K 5KPTA 3TABA 1BUPA 3VTHA 1NGAA 1OVYA 3QBWA 2V7ZA 3ZSVA 3CMEN 3MX2A 5HOOA 4BRDA 4EFHA 3SK3A 3EZWA 4CJRA 4M7YA 2GX9A 3NGYA 1IKXA 3AO2A 4BROA 3KLGA 3OYMA 4YORA 4C8KA 1Y64A 1C1AA 2HMIA 4DV2K 2QKBA 2G8UA 1QZ5A 4BR5A 3J8AA 1D8YA 2BANA 3ZSRA 2GWJA 5LJWA 2O8EA 2ZJPL 4FVMA 4E1JA 2XY5A 1TAUA 4JD2A 4E7LA 4K25A 3AAQA 2IIRA 3MK6A 4FW1A 4DUZK 1NNEA 3BEXA 5JICA 4E7IA 1XMOK 4X64K 2I7NA 3AV9A 4ELTA 1ZBHA 3NH0A 4U67L 1EQYA 3E9OA 3C0BA 4YOUA 4B9SA 1QQNA 1S1UA 3I8DA 1IBKK 4QS7A 4BRHA 4EZ6A 3U9DA 3DAWA 1NK9A 4I6MA 3EE8A 2E1ZA 3ULEA 1RFQA 1VSKA 3VA0A 1ATRA 3SMSA 3EKUA 1SZ2A 3WNFA 5TKYA 3VQEA 3BP8A 5JS1A 5AZJA 1S1TA 1Z25A 3VPZA 2QKKA 3EL2A 3DLEA 5C24A 4AILC 4EHUA 4N76A 2WFBA 4DTMA 3P38A 3K9JA 1EWQA 4B1YB 1TL1A 2UU9K 1VK0A 4DQSA 5D3GA 2PBDA 3LPUA 4CJVA 5AQYA 1HRHA 2Z1HA 3R1XA 3ZX3A 1LW0A 4Z94A 5KTQA 1S3XA 5DMRA 4AHSA 1XHZA 3J7AP 4Y1CA 1HUXA 1VQ7N 1GOCA 2IS3A 4B1ZA 4LF8K 2P51A 3AAPA 1IBMK 3MMVA 3O4QA 2FBXA 2QWRA 1BQMA 5EX5A 2Z1IA 3HTVA 1KCFA 3U9ZA 3KLFA 4OLAA 4RW6A 1RBRA 4JN4A 1KAXA 3FFKB 1NJXA 1IKWA 5FPNA 4Z4EA 3WQUA 1YUWA 4M3TA 2DY4A 2O8CA 4TSXA 1T44A 1YVUA 5CE3A 3G10A 1VSEA 1HNZK 3KLHA 1VSJA 2PAVA 3MXMA 1U4BA 3B8AX 1LWCA 1QQMA 2FF6A 1TUYA 2UUBK 4MDAA 3SV3A 3VA3A 2JLEA 4DTJA 1NMNA 4CEFA 1UA0A 4NLBA 4IXCA 3AO4A 4YDUC 2FSNA 1LAVA 3MN9A 3G71N 2E88A 3OJUA 1S1XA 2VQEK 4EZ9A 5FPMA 3RMBA 3S3NA 1MDUB 3ATVA 3BF1A 4ISGA 3CIPA 4FLUA 1WOQA 2O8DB 2ZE2A 2F7TA 4JI8K 4GV6A 1YI2N 4WF9L 4WYBA 4J2EA 5LJVA 3A5OC 3OS2A 2ZQBA 3LALA 2HW3A 4NYNA 3HYFA 3D7EO 3K59A 3JSMA 4CEDA 3O80A 4BGBA 5AQQA 4BRAA 5BPMA 4ISEA 3S3OA 2QM1A 3HRGA 1GOAA 3L2UA 4H0PA 3PIPL 3KK1A 1J5EK 5JLHA 4JKDA 3MN7A 1ILYA 3DRPA 1EWRA 1YJNN 1IV0A 1WUAA 5FRMA 1Q9YA 5JS2A 2AP1A 3O1BA 1MWMA 3CQXA 2HHTA 5H1SQ 3WNGA 1N34K 3CCSN 1N6QA 1XC9A 2OPQA 4CEEA 4BDYA 1JLBA 1NU0A 4YOVA 4H5NA 3OW2M 3GBTA 1WNSA 3K0SA 2XRIA 4M3ZA 3S9HA 2O8BA 1WAJA 4AF1A 1HYVA 1RDDA 1C0GA 3LM2A 1N36K 3WUHA 4CBXA 4H5WA 2YHAA 5GAEP 3LL3A 4KHSA 3HSCA 4DTOA 4H4MA 5C15A 5AQWA 1TV6A 2ZM6K 1A5WA 3THXA 4CZGA 2WONA 5M1KA 1RBUA 1S1VA 1KAZA 4K43A 3DLGA 3O9RA 2ITMA 2QTDA 1KVCA 4DF8A 3IKMA 5CZ1A 3EZ5A 4BVOA 2YCHA 4FPBA 4FLTA 3SPYA 1BU6O 3L2RA 1V4SA 1YF5L 3H45C 3CCLN 1L3TA 4ZHRA 1RTDA 1RT2A 2QWOA 1BI4B 2E1YA 1YVNA 1CXQA 2OPPA 2GTDA 4H8KA 4E7HA 3ULDA 4CE9A 3RRHA 3TAPA 3AVFA 4IO8A 4DV0K 4H5TA 4J2DA 3O9QA 4FJHA 4AHVA 1RT6A 2P9KB 3J81O 4O44A 1W2BM 4V19S 5JVHL 4O0IA 3SZ2A 3VESA 3KZBA 4KBOA 4CEAA 2ETJA 5EOYA 5AFUA 4F2RA 3HOTA 4IOXA 3O3HA 2A40A 2QW9A 1NKBA 3NF6A 3E9LA 4DV6K 3NH2A 1KD1O 1HR0K 3OYHA 3C6TA 2ASMA 2F9WA 4CJ4A 3SNNA 3SV4A 3P83D 4FJKA 1C0UA 2D0PA 2YX6A 2I5JA 2OTJN 3DLBA 5IT9O 1GLCG 5BRDA 4PY5A 1S72N 4NXMK 3AVJA 4JV5K 3SUQA 3U8XA 1F21A 1HNWK 4EHTA 3MWPA 4LD0A 3KJVA 5JVGL 1TKZA 5K14A 4DLEA 4M3YA 4CIFA 2XY7A 3ZT0A 1A5XA 3VF2A 4FJLA 3VQ4A 2OTLN 4DR2K 3RVCA 5KQ8A 3UIQA 3ASMA 1UAXA 3LDLA 4GNIA 4PHTX 3Q7CA 1TGOA 4JHDB 1TVRA 5GAHP 4NXNK 2HHSA 1BDGA 4LF9K 2Z1GA 4CJPA 4GVMA 3EN9A 4BVPA 1U47A 4BE0A 4M45A 1C1CA 3AA4A 3AARA 3V1RA 1W0HA 1RTIA 2QWLA 4AHTA 4G1QA 4RWTA 1BA1A 4RCHA 5AQKA 3NF7A 1J5OA 3MAQA 1QQOA 3A0IX 2Q1NA 2CH5A 5HLFA 3HPGA 5KPRA 3K2PA 3ZSOA 4ILHA 2P1JA 3ID6A 1BIZA 4FJIA 4U7BA 1M90O 3I0SA 3CM6A 4CK1A 2KFZA 2ZGYA 1YXQA 4DWIA 3QIPA 3CCMN 1NK5A 1NKCA 1K8KA 3BF3A 4GMJB 2YI1A 3P31A 1RNHA 4KHWA 5AQVA 3LAKA 3ZETB 1WSHA 4GKKK 3A8YA 4NLCA 2YHYA 1T3VA 3THWB 3KWIA 1IG8A 3L3UA 4M3XA 4DTRA 3L0QA 3CCVN 2ATQA 4EAHD 1Z05A 3WXMB 4CF8A 3H08A 3TR8A 2OYQA 5BPLA 4K8XA 2Y1IA 3LZIA 4Y0WA 4UY8O 1RDUA 3VGLA 3E1YA 2KZMA 3WXIA 4JAXA 4C8NA 3VEVA 1SL2A 4NCGA 3SUNA 1K9MO 4F9OA 3O5BA 5HRRA 5C42A 5I3UA 4BC5A 2X78A 4CF1A 5KRTA 3TPQA 3I56N 2FBYA 3J7ZO 3V4IA 4KI6A 4DTUA 2HBJA 3SI6A 3FZMA 1LOTB 3L6QA 1BIUA 4BRMA 3SAFA 2E2OA 4CHOA 5GAGP 2CGKA 3K5LA 1SKWA 4KH4A 1BHLA 4CFAA 3NGZA 2W6LA 4W5NA 1EXQA 4OX9K 4EIAA 1I94K 2A5XA 2IGIA 5CY4A 1KRPA 3PLAA 3DYAA 4YOWA 1Y97A 4IDKA 3VQ5A 4OLBA 2O4IA 1SKRA 4AH9A 4DQRA 4DFMA 1NOZA 3TAFA 2HNYA 2OPRA 2HHVA 1RBVA 3G25A 4PKGA 5E84A 3KD1E 2P5OA 2CGLA 4KV8A 4W5TA 1QHAA 3LWMA 4BRGA 3CG7A 4BRPA 4W5QA 2OZSA 4OO1J 4JI5K 3M1FA 1RT5A 3L2WA 4BREA 5M1NA 4Z4IA 4F2SA 4M42A 5C0YA 2F8TA 1CXUA 3IRXA 3SQ1A 3IDHA 3F9KA 3TSUA 2E5LK 4DFPA 4WQ5A 2BDPA 5AFUH 5ADXH 2A6AA 3O9SA 3HI0A 2E2NA 3LDQA 2KHOA 3OYKA 4KREA 3VN5A 1XMQK 4FLXA 2DFHA 3DXMA 4LY7A 3BDPA 2ZF5O 1NMDA 2X74A 4Z4CA 3HBTA 4O8KA 1U04A 3CJBA 3K5MA 1HJOA 2D5RA 2UUAK 2V51B 1OH7A 4IJAA 5MLCQ 1OKJA 3O08A 3FGUA 2PFUA 5KGWA 3VF4A 1NBWA 1T8EA 2B6AA 3TI0A 2AA4A 4WCEL 4DSLA 4N47A 2VGMA 4FL9A 1KSPA 1S6QA 3A2FA 4OPAA 4KB0A 3NVKA 4KB1A 3O3GA 2YNGA 1QE1A 3IMXA 2O4GA 2G8IA 4PL7A 1I39A 2OCEA 3KLIA 2R7YA 3JXUA 3MCPA 3P39A 4IEEA 2G8VA 2IVNA 2GV9A 4DU3A 1RDWX 4YHHK 3B6PA 3DXKB 1D4XA 4FM0A 3U6FA 4DSKA 1SV5A 4CJUA 5DM7L 4LSLA 3KLEA 2DTUA 5AQNA 5CHIA 1KVAA 3LDSA 2P9NB 4F3TA 3PO4A 4A2AA 2IVOA 5BR8K 4X65K 3SQ0A 4FJNA 1U48A 3G6EN 4IFEA 5AQMA 3NH1A 3FZHA 2GELA 2XY8A 5F2RA 3OHRA 1NJIO 4XEIA 2YKMA 1SUQA 3C94A 2NRVA 3H1VX 2QWNA 5AQZA 3ZX2A 3KK2A 3CJCA 5AQUA 4IO9L 1VQNN 3O3FA 4WFNL 1WSIA 1N5YA 3SYZA 4JLHA 3AVMA 4E1NA 3ZEUB 1BGXT 4KHPK 1DLOA 1G99A 3CJ7A 1VQ9N 2OANA 4HUGA 3CFOA 3IAYA 1TK0A 4PL8A 2NNWA 3S41A 3CHWA 2NZTA 3DLKA 4ISFA 1ASWA 3KVGA 3PY8A 2DFEA 1BQNA 3MX5A 2YHWA 4IBNA 5AQGA 2H3GX 1VQMN 3ZSZA 4DS5A 1EP4A 3D0PA 3WXJA 3CD6N 3N4PA 3V9SA 3QEVA 1R0AA 4MDBA 3T1HK 3KKSA 2PZSA 4DU1A 2P9KA 3QNOA 4DV1K 4B3RK 3OYJA 1FXXA 1RBTA 1T05A 3HXMA 3V81A 3QEXA 3MEGA 2VWKA 4CGDA 4HWIA 3H1QA 4BG9A 1KTQA 4C8MA 1VHXA 4N5SA 1O13A 4BR2A 3O9UA 2IAJA 1EKEA 2KW4A 3BZCA 3PO5A 1VQ5N 1WSFA 2O8FB 2UUCK 4BRIA 3UKRA 1IBLK 4FO0A 4ID5A 1GLEG 2F9TA 2Q97A 1VRTA 4Z4FA 1U2VB 3U3YA 3LZJA 2Q31A 4FSVA 3K5NA 3C65A 5AQIA 5AQPA 5DK5A 5A2QO 4JKEA 5GADP 4Q5VA 1RDAA 5FROA 3PSIA 5KGXA 4YDUA 3TWHA 3KKRA 4ILJA 3NMUA 4DUYK 2W6KA 3VQDA 3O6WA 1RTHA 3H46O 3ZSQA 5M1QA 1NKEA 3UKUA 2EX3A 4JRPA 4FWOA 3HL8A 4JHDA 3D2FB 4KHYA 5SWMA 1LWFA 3DM2A 4C1NI 4CECA 1JLAA 2HNDA 5I42A 3NHGA 1Q18A 4B08A 4BE2A 4O0JA 1QSSA 3PIOL 1LAWA 3R3LA 1BCMA 4Y1DA 1KQSM 3L2VA 4DR1K 4DR3K 3SUPA 1IO2A 3I55N 4LH5A 1TAQA 2FF3B 4FJ7A 4H5RA 2YV0X 3QIOA 4H5VA 2KTQA 3QB0A 4OPJA 1DT9A 3V6DA 5AZIA 2GUPA 4HTUA 3QINA 2IOCA 3SLCA 4F3OA 4BC4A 4B9TA 5M1PA 1WLJA 3GL1A 3VEXA 4DQQA 4O4GA 4M3RA 2F8SA 4LFAK 2GUIA 4UQGA 1JKHA 4J2AA 4BACA 1LW2A 4KI4A 3LP3A 2RN2A 3SBTA 3P1GA 3K5OA 1BOTO 4E7JA 2G8FA 3SUOA 3QBXA 3RSEB 4ELUA 5EXWA 3QEWA 3GOIA 3OYAA 1HNXK 3U3GA 4EP4A 2Y1JA 1MA9B 3QETA 3DOLA 4JI1K 4MQ3A 1S5JA 3LANA 1ITGA 3ENHA 4HTLA 3FFIA 1V4TA 4CI6A 3SQ4A 4B1XB 5IWAK 4IFVA 4RG8A 4DV5K 3R6MA 2D0BA 4B3OA 5F1XA 1K73O 4RTFD 3VQ8A 5AJ3K 3L4IA 4OGCA 4ICLA 4CHPA 5J2NA 3E9PA 3QEIA 2E6LA 4JS5A 1VQ6N 3NFAA 3QDKA 5AQXA 4CJ7A 3TAEA 3RTVA 2QEXN 4BDZA 4FXDA 4JKGA 3C6AA 4I9QA 3QEPA 3ZYYX 3OYEA 2NRTA 3EY1A 3NCIA 4IG3A 4Z4GA 1WB9A 1KVBA 4ZTFA 3RMCA 1KLNA 5BR9A 1TK5A 4O55A 3IS9A 4DV4K 2HNZA 3TU5A 3VQ9A 2UXBK 1RDBA 3MWTA 4FJJA 4AM7A 3V9ZA 5AQHA 1RILA 1KC8O 2YNIA 4I6MB 1NM1A 1YJWN 3CI5A 2Q36A 4CF9A 5C12A 4WFBL 2NRWA 3QFPA 1TKTA 5AZJB 1NGGA 1S9GA 3O8MA 5SZTA 1ZYQA 4DQPA 4KTWA 1C0TA 2NRXA 1D9DA 3OTOK 4HUFA 1YTAA 1YJ9N 1S9EA 2D0AA 2IC3A 4OPKA 1IJJA 2VWBA 2A1SA 3BGRA 4YOYA 4WFAL 3M8PA 4JRQA 4G9ZA 1TKXA 4HUEA 3KHYA 1SKSA 2FBTA 3ZT1A 1QTMA 4O8UA 3HSTB 4CHNA 2HMPA 2QI2A 1YHQN 2G8WA 3WNHA 1QSYA 4DTNA 4BWMA 4DHYA 2I7PA 2YHXA 1P90A 2BH1A 4N41A 4NCBA 4FPAA 1U45A 4JI6K 1YTUA 2O8CB 3D45A 4PA1A 1XUPO 4BG8A 5KRSA 2P9PB 4IG0A 4OKJA 4L8RB 2HHHK 1GLBG 2X6NA 4H03B 4I9LA 5AR0A 4FWRA 1ZBUA 2HBLA 4CJQA 3SPZA 4DQIA 4O5FA 1ZBLA 4FJ8A 4CGGA 3DXKA 4RW7A 5C25A 1IKYA 3ZCMA 1C0FA 2Q2RA 3LP2A 4KO0A 1XQSC 4LH4A 3AVNA 3F9MA 2V7YA 2VCPA 4JKAA 2P9NA 1DKGD 4LFCK 4H0VB 2ASOA 4FZXC 1Q8IA 3PUFA 3KK7A 1WSJA 2ASPA 4FJXA 1HQEA 1HPZA 2D1KA 1T7PA 3M3ZA 1NJWA 2HVIA 4DFKA 3FR0A 1VRUA 3SJHA 1ATSA 1UWBA 3JS6A 2D0CA 3QESA 5BPNA 5F0XA 1W7AA 2F4VK 4CESA 2E20A 2QA4N 3DWLA 1ZXOA 3AA5X 2HHUA 1RT7A 5T7BA 2FSJA 3V1OA 4YOXA 3OYGA 4PQUA 4C8LA 4MLEA 4PKHA 3ZEUA 5GIPA 3KIOA 1VQPN 3E66A 4FOEA 4IEIA 4IDHA 2HVHA 2Q0UA 3T1YK 5I9EB 2BGGA 4KH5A 3CXCM 4CZEA 1YT3A 2EHGA 4ILGB 5EY4A 1VAZA 1WBDA 3CETA 1VQON 3ZLJA 3BZKA 3W0LA 4W5RA 5J2PA 4J8FA 4CZLA 5BREA 3M6GA 2UXDK 5AQLA 1NWKA 4F4KA 2A3ZA 2CH6A 4JI2K 3LDNA 4GW6A 3DLRA 1YAGA 2KKZA 3PX0A 1Q82O 3ENBA 3THXB 3QFUA 1JLCA 1HNVA 1MWKA 5C2FA 1U49A 5HRNA 5BRFA 3TARA 3AO3A 3V9UA 3VQPA 3HT3A 3DMJA 5DM6L 5BN9A 2RKIA 1FKPA 4KFBA 4A59A 2UXCK 3AVCA 2HB5A 1QVFM 1VQ8N 1JLGA 1Z6RA 4M3UA 3I8BA 2YKNA 3D6RA 3AA2A 4IJNA 1HKCA 1VQ4N 4CEOA 4DF4A 5CZ2A 5E41A 4CK2A 3G0ZA 4FJGA 3SCXA 2P9SB 1X9JA 1QQCA 1J6ZA 3AGKA 2HOEA 4CJSA 3MN5A 1SL1A 4AQYK 3FZFA 3KK3A 2A1RA 4AHUA 1B9FA 1HQUA 2QXLA 1HPMA 5LY3A 3KWGA 3D2FA 3B6OA 4BR0A 4GV9A 1HKBA 4CGJA 1KFSA 5GINA 3CPWM 1GLFO 3OVNA 1S22A 2QWQA 3L2QA 4A57A 2FLOA 4NO7A 3O9TA 4WE1A 1XI1A 2KZZA 3OYFA 1KLMA 3CM5A 4H0OA 3CC2N 1JLFA 2XY6A 2OZMA 1D5AA 2O8DA 3SQ2A 1VSIA 3VETA 1ATNA 1U6ZA 4BQLA 2PYLA 3NF9A 4GV3A 4WQ4C 1NOYA 4EP5A 4CZJA 3FE1A 1J9AA 3OA9A 1ZBFA 3RRGA 1TL3A 1KAYA 2Z1JA 3SAHA 1CZAN 4BRQA 4B9UA 3A5NC 5JLFA 3KTQA 4DFJA 5EU7A 3LDPA 1CZ9A 4DQ8A 4CHQA 3LWLA 4B3MK 3LPTA 4RW8A 4DR7K 1NGHA 2JWLA 1KFDA 2YNFA 5BN8A 2HHXA 1JL2A 5LMUK 4A5AA 1JLQA 3DRRA 2RHKA 3HPHA 3T19A 4I7FA 1QVGM 4FJMA 4BDPA 1FKOA 4LSNA 2HSTA 3CJAA 3RSEA 3OYBA 3VTIA 1NG9A 4E89A 4FZZA 1K8KB 3AGRA 4KKOA 1RT3A 1O1WA 1Q9XA 4DV7K 4B9MA 5FRNA 3CC7N 4CBUA 1LCUA 3T7ZA 4F8RA 2A42A 3MECA 4DR6K 5KQDA 4BWJA 5HBMA 2J4RA 2IDOA 4E7KA 2NUBA 3I33A 4BY9C 4DB3A 1YITN 4CIGA 3HPOA 4ZTJA 2B4JA 3C6HA 2E8AA 4B1UB 2VQFK 4K8ZA 2YHBA 1B92A 1G15A 4QS8A 4OKEA 1X9MA 1EETA 1TYQB 2P5GA 4JKFA 3OYIA 3C7NB 3AO1A 3FZLA 1J54A 4HHTA 4CERA 4CFCA 1GOBA 4BRCA 3D2EB 3TTDA 3AVBA 2FXUA 3WQTA 2LSNA 4C23A 1JLEA 4BRKA 3HP6A 4IFYA 2FC0A 2WUSA 1BI4A 1BG3A 4CGFA 4KAZA 1RTJA 3C95A 1VSLA 3ZSXA 2QXFA 2NRHA 4BR4A 1XHXA 2JWKA 4FWSA 1IH7A 1SL0A 1QHTA 1SS6A 3CPEA 2D0OA 5HL7L 3VF6A 3NBPA 2CGJA 4BE1A 3HP9A 1T6DA 2NLXA 1JCEA 4CF0A 4CZHA 1TKDA 4K41A 3L4QA 3H3OB 4LF4K 2E2PA 1TK8A 4BC3A 1BCOA 1DGKN 1P8ZA 3OYCA 1BISA 3LP1A 2NRRA 4I2QA 4LFBK 1JXEA 2VG6A 1E4GT 3ZT3A 4FOIA 3O1WA 2ITGA 4CEQA 3TSQA 3VEWA 4A62A 3AA3A 2RE2A 4PUOA 4DS4A 4JI4K 3P4IA 4A5BA 3OYDA 2JGUA 3CJ9A 4CF2A 4M3WA 3CQYA 4ELVA 4CK3A 3WT0A 3EKSA 3SBGA 4HCBA 2V52B 3V9XA 3THYB 4FK4A 1X3NA 3VGKA 3OBWA 3IFRA 5FPEA 2XO7A 3THVA 1WN7A 2VYPA 1W97L 4M63C 4CZKA 4IWVA 1LV5A 4B8AB 2IVPA 1MU2A 5ELZA 4JI0K 2ZWHA 4K42A 2G8KA 2QK9A 1E3MA 1IG9A 4OJRA 1RCHA 1JXBA 4BRLA 4LC9B 1HKGA 4B9NA 3HJFA 2P9PA 1CLQA 3DXMB 3WEEB 2X6SA 2RF2A 3BY5A 2P9UB 4CHYA 3CCUN 4CD1A 5AQJA 3GE1A 3L8BA 3I0RA 3O4NA 1SAZA 1Q86O 1OH6A 2HBKA 2P9LB 3AY9A 1EO1A 4CJFA 4YY3K 4CBWA 3H3NO 1GLDG 5GIOA 3AVKA 1DTTA 3DOKA 1NK8A 1FJGK 3EEQA 5BRHA 4OVLA 4YFUA 5B8HA 3O4WA 2VG7A 4FWNA
chains in the Genus database with same CATH topology
1QZ5A 3KHYA 4BR5A 3ENOA 3J8AA 3ZETA 3HZ6A 2GWJA 5LJWA 3G25A 4PKGA 4O8UA 1ESVA 2ZJPL 2HMPA 4BRNA 5AQRA 5E84A 2QI2A 1YHQN 4FVUA 4E1JA 2CGLA 3HM8A 4JD2A 4BRFA 4MLHA 4DHYA 4K25A 1QHAA 2I7PA 3CMAN 2P9IB 2YHXA 3AAQA 4BRGA 1P90A 2BH1A 2IIRA 4QS9A 4BRPA 3MK6A 4OO1J 3M1FA 3QMLA 4FPAA 4BREA 5M1NA 3BEXA 4FWKA 4BG8A 5JICA 1XUPO 5C0YA 2I7NA 2WC9A 2P9PB 1K8AO 4XH5A 3IDHA 4U67L 1EQYA 3E9OA 1GLBG 3TSUA 3CC4N 3C0BA 4H03B 4YOUA 1QQNA 4WQ5A 5AFUH 5AR0A 5ADXH 3G4SN 3UB5A 4FWRA 4QS7A 4BRHA 2A6AA 3U9DA 2HBLA 3O9SA 4O5FA 3HI0A 3DAWA 4I6MA 3EE8A 2E1ZA 2E2NA 3LDQA 3DXKA 3ULEA 2Q0RA 1RFQA 2KHOA 2ZJQL 1ATRA 3GG4A 3SMSA 3EKUA 1C0FA 1SZ2A 3N4QA 2Q2RA 5TKYA 1XQSC 2UYTA 3DXMA 3BP8A 1BWFO 3F9MA 2ZF5O 1NMDA 2V7YA 2VCPA 5AZJA 4JKAA 3VPZA 2P9NA 3EL2A 2HBMA 1DKGD 1NGFA 3HBTA 4H0VB 4O8KA 4YOTA 3CJBA 4EHUA 2ASOA 4FWLA 2WFBA 1HJOA 3EO3A 4BR7A 3KK7A 3P38A 3K9JA 4B1YB 2ASPA 2V51B 2D1KA 2PBDA 3M3ZA 4IJAA 4JK9A 4JD2B 4CZIA 1NGIA 5MLCQ 3FR0A 1OKJA 3O08A 3SJHA 5AQYA 1ATSA 3FGUA 3R1XA 2PFUA 3ATUA 3VF4A 1NBWA 3ZX3A 4Z94A 5C2DA 5M1FA 3JS6A 2AA4A 1S3XA 4WCEL 5BPNA 5F0XA 2E20A 3DLLL 2VGMA 4FL9A 2QA4N 1HUXA 3DWLA 4OPAA 1VQ7N 3NVKA 1ZXOA 2YJFA 3CCRN 2FSJA 3IMXA 2GWKA 3MN6A 4B1ZA 3LDOA 4YOXA 5M1OA 3AAPA 1JJ2M 4B1WB 4PL7A 3MMVA 1NGEA 2QWRA 4MLEA 4PKHA 5EX5A 3ZEUA 5AQFA 3JXUA 3MCPA 5GIPA 1VQPN 1RGIA 4NB4A 3E66A 3HTVA 4FOEA 3P39A 3U9ZA 4IEIA 4IEEA 4IDHA 4JN4A 1KAXA 3FFKB 3VENA 2Q0UA 5FPNA 2IVNA 3CCJN 3VEOA 3WQUA 5I9EB 3UE5A 1YUWA 1RDWX 4KH5A 3CXCM 3DXKB 3ULEB 1D4XA 2HF4A 1T44A 5FPDA 2W41A 1BA0A 4CZEA 5CE3A 4ILGB 5EY4A 2PAVA 1VAZA 5DM7L 3CETA 1X3MA 1VQON 3B8AX 5TKWA 3F5TA 5AQNA 5CHIA 4GY2B 4L3QA 2FF6A 1DEJA 1QQMA 1TUYA 3W0LA 2P9NB 2P9SA 4JKBA 4J8FA 4CZLA 5BREA 2ZJRL 4MDAA 4A2AA 2IVOA 2ZGZA 3M6GA 4NLBA 5AQLA 4IXCA 1NWKA 3G6EN 4IFEA 2A3ZA 5AQMA 2CH6A 5ADXA 3FZHA 3LDNA 2GELA 3OHRA 2FSNA 4YDUC 1YAGA 5F2RA 1NJIO 4XEIA 3MN9A 5E26A 1BO5O 4B1VA 3G71N 1JCFA 2E88A 2KKZA 2NRVA 3H1VX 2QWNA 5AQZA 3ZX2A 3CJCA 3ENBA 5AQUA 1Q82O 5FPMA 4IO9L 1VQNN 4WFNL 3QFUA 1MDUB 3ATVA 3BF1A 1MWKA 3UKRB 4ISGA 3CIPA 1WOQA 1GLAG 3VOVA 2F7TA 5C2FA 1XC3A 3Q7BA 4FWQA 1ZC6A 5BRFA 4GV6A 1YI2N 4WF9L 4WYBA 5LJVA 3A5OC 3ZEUB 1G99A 3CJ7A 1VQ9N 2OANA 5DM6L 2FSKA 5BN9A 4PL8A 2NNWA 3DJCA 3D7EO 4XH4A 3S41A 3CHWA 4A59A 2NZTA 3O80A 1H1VA 4BGBA 5AQQA 1QVFM 4MO5A 4BRAA 5BPMA 4ISEA 4ISFA 2QM1A 1M1KO 1VQ8N 3HRGA 3KVGA 4H0PA 3PIPL 1Z6RA 3MX5A 1GLLO 3I8BA 2YHWA 3D6RA 5JLHA 4JKDA 3MN7A 4IJNA 1HKCA 1VQ4N 1ILYA 5AQGA 2H3GX 1YJNN 1VQMN 4A61A 1WUAA 2P9SB 3UKUB 2AP1A 1X9JA 3O1BA 3TTCA 1MWMA 1J6ZA 3AGKA 2HOEA 3CQXA 1Q7YO 1VQLN 3WXJA 3CD6N 5H1SQ 3N4PA 1ZBSA 3CCQN 3CCSN 2GEMA 4MDBA 3MN5A 4JNEA 3FZFA 2NRZA 4A2BA 4YOVA 4H5NA 3OW2M 3GBTA 3K9KA 2QXLA 1HPMA 5LY3A 2P9KA 4AF1A 3F2KA 1R59O 3KWGA 1C0GA 3LM2A 3M5RA 3D2FA 3WUHA 4CBXA 4H5WA 1NLVA 4BR0A 3LL3A 1HKBA 4DKWA 3HSCA 5GAEP 4GV9A 4IOAL 5GINA 3CPWM 4PKIA 5C15A 1GLFO 4HWIA 1S22A 3H1QA 5AQWA 4BG9A 2QWQA 4A57A 2FLOA 4NO7A 1SQKA 1O13A 3O9TA 4BR2A 3O9UA 4OPHA 4CZGA 1GLJO 5M1KA 1HX1A 1VQ5N 4R79A 1Q81O 4H0OA 1KAZA 4BRIA 3H6EA 4K43A 3O9RA 5AZIB 4FO0A 3UKRA 3ZX0A 3WXKA 2ITMA 3CC2N 2QTDA 3A5MC 1GLEG 2F9TA 2Q97A 3VETA 3IKMA 1ATNA 1U6ZA 4BQLA 1U2VB 4BVOA 2YCHA 4GV3A 4FPBA 4IZ9A 4FWPA 2Q31A 4WQ4C 4FSVA 1BU6O 3C65A 3EE9A 5AQIA 1V4SA 1YF5L 3FE1A 1E4FT 3OA9A 5AQPA 3H45C 4CZJA 1KAYA 3SAHA 2DPNA 1CZAN 4JKEA 4BRQA 3TSPA 5GADP 3CCLN 3A5NC 3NVMA 2QWOA 5JLFA 2E1YA 4YDUA 1JCGA 1YVNA 3LDPA 4DQ8A 5AQOA 3CF5L 4ILJA 3NMUA 2GTDA 1NGHA 1TYQA 2JWLA 3HOSA 4IO8A 3C7NA 4JK7A 5BN8A 4H5TA 2WBNA 3O9QA 4B9QA 1TUUA 3R9PA 4C1NK 4IOCL 3O6WA 2P9KB 3H46O 3LM9A 3D2EA 5M1QA 4A5AA 3UKUA 4FWOA 1W2BM 5JVHL 4JHDA 3D2FB 3VESA 3KZBA 3FLCO 2RHKA 1QVGM 3VGMA 3A5LC 4KBOA 4BQZA 4C1NI 5EOYA 5AFUA 3HOTA 4IOXA 2A40A 2QW9A 2HSTA 3CJAA 3U4LA 1Q18A 3RSEA 3VTIA 3E9LA 1K8KB 1KD1O 3AGRA 2W40A 4KH6A 3PIOL 3CCEN 4BGAA 3QICA 3R3LA 4DCHA 1KQSM 3CC7N 2ASMA 2F9WA 4JKHA 3T69A 3TTFA 2E2QA 5CR4A 4CBUA 4MO4A 1LCUA 5AQSA 4JEPA 3T7ZA 2A42A 2D0PA 2YX6A 3I55N 1YIJN 2OTJN 5KQDA 2FF3B 2J4RA 4H5RA 4JK8A 4JKGB 3I33A 1GLCG 5BRDA 4H5VA 4BY9C 4DB3A 1S72N 1YITN 4XH1A 3VEZA 3QB0A 3U8XA 1DT9A 3C6HA 2E8AA 5AZIA 2GUPA 2KLAA 4B1UB 3OBYA 4EHTA 3MWPA 4QS8A 5JVGL 1TYQB 4JKFA 4JKCA 3C7NB 3VMFB 1U2VA 3SLCA 4BC4A 3VF2A 3FZLA 2OTLN 5M1PA 3RVCA 3GL1A 5KQ8A 3LDLA 3VEXA 4BRCA 3D2EB 4GNIA 3TTDA 3SAGA 4PHTX 2FXUA 3MDQA 3Q7CA 3WQTA 4C23A 4JHDB 4BRKA 5GAHP 1BDGA 2WUSA 1BG3A 3EN9A 1NGCA 4BVPA 4CZMA 2QWPA 3SBTA 3MCAB 3BUZB 1BOTO 2NRHA 3AARA 2JWKA 4H0TB 4BR4A 4FWSA 4H0XB 1VQKN 1SS6A 3CPEA 3QBXA 2QWLA 2D0OA 1QZ6A 3RSEB 5HL7L 3VF6A 5EXWA 2EWSA 2CGJA 4RWTA 1BA1A 1T6DA 3GOIA 4RCHA 2BTFA 5AQKA 2NLXA 1JCEA 4CZHA 1QQOA 1MA9B 3A0IX 2Q1NA 2CH5A 4K41A 3L4QA 3CJ1A 3H3OB 5KPRA 3W3DA 4WQ4A 4ILHA 3ENHA 3ID6A 3IUCA 2E2PA 4HTLA 1V4TA 3R8EA 4CI6A 4B1XB 4U7BA 1M90O 3VEYA 2ZGYA 4BC3A 1YXQA 3R6MA 4FWMA 3CCMN 1DGKN 1K8KA 1NGJA 1P8ZA 3BF3A 3WEEA 5F1XA 2P9UA 2YI1A 5EVZA 2NRRA 4RTFD 1K73O 3P31A 1HLUA 5AQVA 5JMVA 1E4GT 3L4IA 4FOIA 3O1WA 3ZETB 4WQ5C 3TSQA 2HF3A 3A8YA 3E9PA 4GVEA 4NLCA 2YHYA 1T3VA 2P9LA 3VEWA 4A62A 1VQ6N 3KWIA 1IG8A 3QDKA 2RE2A 5AQXA 4CJ7A 2QEXN 3L0QA 3CCVN 4JKGA 3C6AA 2BUPA 1Z05A 3FZKA 3P4IA 3WXMB 4EAHD 4A5BA 4BC2A 3ZYYX 4CZFA 2NRTA 4CD3A 3CJ9A 4BR9A 1KXPA 3CQYA 4AM6A 4H0YB 5BPLA 1NGDA 3WT0A 3ID8A 5BR9A 3EKSA 3SBGA 2V52B 4M7XA 4Y0WA 3SMPA 1T6CA 5KPZA 4UY8O 1RDUA 1X3NA 3E1YA 3OBWA 5AQTA 3VGLA 3TU5A 3IFRA 3VGKA 5FPEA 1N8RO 1NGBA 3WXIA 2VYPA 4JAXA 3VEVA 1W97L 4M63C 4CZKA 1K9MO 3MWTA 4IWVA 4F9OA 3O5BA 4AM7A 2IVPA 5ELZA 2P9IA 5AQHA 3CERA 4BC5A 2QWMA 1KC8O 2ZWHA 4K42A 3TPQA 3I56N 5C10A 3VERA 4I6MB 1NM1A 3J7ZO 2YJEA 3GDQA 2A41A 2HBJA 4LC9B 1HKGA 3CI5A 2Q36A 2VGNA 4BRLA 1YJWN 3WXLA 2P9PA 3FZMA 5C12A 1LOTB 2D4WA 3L6QA 4WFBL 3SAFA 4BRMA 2E2OA 3DXMB 3WEEB 2NRWA 5GAGP 5KPTA 2CGKA 3QFPA 1BUPA 2P9UB 3CCUN 5AZJB 3VTHA 1NGAA 1OVYA 3QBWA 1NGGA 3GE1A 3O8MA 5AQJA 4KH4A 4CD1A 2V7ZA 3CMEN 3MX2A 1SAZA 1Q86O 4EIAA 2NRXA 2HBKA 2P9LB 2A5XA 5HOOA 3AY9A 1EO1A 4BRDA 1YJ9N 4EFHA 3PLAA 3SK3A 3EZWA 1GLDG 3H3NO 4CBWA 5GIOA 4YOWA 1IJJA 2VWBA 2GX9A 4M7YA 4BROA 5BRHA 4YOYA 4WFAL 4YORA 5B8HA 3O4WA 4G9ZA 4FWNA 1Y64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ5 A;  3KHY A;  4BR5 A;  3ENO A;  3J8A A;  3ZET A;  3HZ6 A;  2GWJ A;  5LJW A;  3G25 A;  4PKG A;  1ESV A;  2HMP A;  4BRN A;  5AQR A;  5E84 A;  4E1J A;  2CGL A;  3HM8 A;  4JD2 A;  4BRF A;  4MLH A;  4DHY A;  4K25 A;  1QHA A;  2I7P A;  2P9I B;  2YHX A;  3AAQ A;  4BRG A;  2IIR A;  4QS9 A;  4BRP A;  3MK6 A;  3M1F A;  3QML A;  4FPA A;  4BRE A;  3BEX A;  4FWK A;  4BG8 A;  5JIC A;  1XUP O;  2I7N A;  2P9P B;  4XH5 A;  3IDH A;  1EQY A;  1GLB G;  3C0B A;  4H03 B;  1QQN A;  4WQ5 A;  5AFU H;  5AR0 A;  5ADX H;  3UB5 A;  4FWR A;  4QS7 A;  4BRH A;  2A6A A;  3U9D A;  4O5F A;  3HI0 A;  3DAW A;  4I6M A;  2E1Z A;  2E2N A;  3LDQ A;  3DXK A;  3ULE A;  2Q0R A;  1RFQ A;  2KHO A;  1ATR A;  3GG4 A;  3SMS A;  3EKU A;  1C0F A;  1SZ2 A;  2Q2R A;  5TKY A;  1XQS C;  2UYT A;  3DXM A;  3BP8 A;  1BWF O;  3F9M A;  2ZF5 O;  1NMD A;  2V7Y A;  2VCP A;  5AZJ A;  3VPZ A;  2P9N A;  3EL2 A;  1DKG D;  1NGF A;  3HBT A;  4H0V B;  4O8K A;  3CJB A;  4EHU A;  2ASO A;  4FWL A;  1HJO A;  3EO3 A;  4BR7 A;  4B1Y B;  2ASP A;  2V51 B;  2D1K A;  2PBD A;  3M3Z A;  4IJA A;  4JD2 B;  4CZI A;  1NGI A;  3FR0 A;  1OKJ A;  3O08 A;  3SJH A;  5AQY A;  1ATS A;  3FGU A;  3ZX3 A;  4Z94 A;  3ATU A;  3VF4 A;  1NBW A;  3JS6 A;  2AA4 A;  1S3X A;  5BPN A;  5F0X A;  2E20 A;  4FL9 A;  1HUX A;  3DWL A;  1ZXO A;  2YJF A;  2FSJ A;  3IMX A;  2GWK A;  3MN6 A;  4B1Z A;  3LDO A;  3AAP A;  4B1W B;  4PL7 A;  3MMV A;  1NGE A;  2QWR A;  4MLE A;  4PKH A;  5EX5 A;  3ZEU A;  5AQF A;  3JXU A;  3MCP A;  1RGI A;  4NB4 A;  3HTV A;  4FOE A;  3U9Z A;  4JN4 A;  1KAX A;  3FFK B;  3VEN A;  2Q0U A;  5FPN A;  2IVN A;  3VEO A;  3WQU A;  5I9E B;  3UE5 A;  1YUW A;  1RDW X;  3DXK B;  3ULE B;  1D4X A;  2HF4 A;  1T44 A;  5FPD A;  2W41 A;  1BA0 A;  4CZE A;  5CE3 A;  5EY4 A;  2PAV A;  3CET A;  1X3M A;  3B8A X;  5AQN A;  4GY2 B;  4L3Q A;  2FF6 A;  1DEJ A;  1QQM A;  1TUY A;  3W0L A;  2P9N B;  2P9S A;  4J8F A;  4CZL A;  5BRE A;  4A2A A;  2IVO A;  2ZGZ A;  3M6G A;  5AQL A;  4IXC A;  1NWK A;  5AQM A;  2A3Z A;  2CH6 A;  5ADX A;  3FZH A;  3LDN A;  2GEL A;  3OHR A;  2FSN A;  4YDU C;  1YAG A;  5F2R A;  4XEI A;  3MN9 A;  5E26 A;  1BO5 O;  4B1V A;  1JCF A;  2E88 A;  3H1V X;  2QWN A;  5AQZ A;  3ZX2 A;  3CJC A;  5AQU A;  5FPM A;  3QFU A;  1MDU B;  3ATV A;  3BF1 A;  1MWK A;  3UKR B;  4ISG A;  3CIP A;  1WOQ A;  1GLA G;  3VOV A;  1XC3 A;  4FWQ A;  1ZC6 A;  5BRF A;  4WYB A;  5LJV A;  3A5O C;  3ZEU B;  1G99 A;  3CJ7 A;  2OAN A;  2FSK A;  5BN9 A;  4PL8 A;  3DJC A;  3D7E O;  4XH4 A;  3S41 A;  3CHW A;  2NZT A;  3O80 A;  1H1V A;  4BGB A;  5AQQ A;  4MO5 A;  4BRA A;  5BPM A;  4ISE A;  4ISF A;  2QM1 A;  3KVG A;  4H0P A;  1Z6R A;  1GLL O;  3I8B A;  2YHW A;  5JLH A;  3MN7 A;  4IJN A;  1HKC A;  5AQG A;  2H3G X;  4A61 A;  1WUA A;  2P9S B;  3UKU B;  2AP1 A;  1X9J A;  3O1B A;  1MWM A;  1J6Z A;  2HOE A;  3CQX A;  3WXJ A;  1ZBS A;  2GEM A;  3MN5 A;  4JNE A;  3FZF A;  4A2B A;  4H5N A;  3GBT A;  2QXL A;  1HPM A;  5LY3 A;  2P9K A;  1R59 O;  1C0G A;  3LM2 A;  3D2F A;  3WUH A;  4CBX A;  4H5W A;  1NLV A;  4BR0 A;  3LL3 A;  1HKB A;  3HSC A;  4PKI A;  1GLF O;  4HWI A;  1S22 A;  3H1Q A;  5AQW A;  4BG9 A;  2QWQ A;  2FLO A;  4NO7 A;  1SQK A;  4BR2 A;  4CZG A;  1GLJ O;  1HX1 A;  4H0O A;  1KAZ A;  4BRI A;  3H6E A;  4K43 A;  5AZI B;  3UKR A;  4FO0 A;  3ZX0 A;  3WXK A;  2ITM A;  3A5M C;  1GLE G;  2F9T A;  2Q97 A;  3VET A;  1ATN A;  1U6Z A;  4BQL A;  1U2V B;  4BVO A;  2YCH A;  4FPB A;  4IZ9 A;  4FWP A;  2Q31 A;  4WQ4 C;  4FSV A;  1BU6 O;  5AQI A;  1V4S A;  4CZJ A;  3FE1 A;  1E4F T;  5AQP A;  3H45 C;  1KAY A;  2DPN A;  1CZA N;  4BRQ A;  3A5N C;  2QWO A;  5JLF A;  2E1Y A;  4YDU A;  1JCG A;  1YVN A;  3LDP A;  4DQ8 A;  5AQO A;  2GTD A;  1NGH A;  1TYQ A;  4IO8 A;  3C7N A;  5BN8 A;  4H5T A;  4B9Q A;  1TUU A;  3R9P A;  3O6W A;  2P9K B;  3H46 O;  3LM9 A;  3D2E A;  3UKU A;  4FWO A;  4JHD A;  3D2F B;  3VES A;  3KZB A;  3FLC O;  3VGM A;  3A5L C;  4KBO A;  4BQZ A;  5EOY A;  5AFU A;  2A40 A;  2QW9 A;  3CJA A;  3U4L A;  1Q18 A;  3RSE A;  1K8K B;  2W40 A;  4BGA A;  3QIC A;  4DCH A;  2ASM A;  2F9W A;  2E2Q A;  4CBU A;  4MO4 A;  1LCU A;  5AQS A;  2A42 A;  2D0P A;  5KQD A;  2FF3 B;  2J4R A;  4H5R A;  3I33 A;  1GLC G;  5BRD A;  4H5V A;  4DB3 A;  4XH1 A;  3VEZ A;  3QB0 A;  3U8X A;  2E8A A;  5AZI A;  2GUP A;  4B1U B;  4EHT A;  4QS8 A;  1TYQ B;  3C7N B;  1U2V A;  3SLC A;  4BC4 A;  3VF2 A;  3FZL A;  3GL1 A;  5KQ8 A;  3LDL A;  3VEX A;  4BRC A;  3D2E B;  4GNI A;  2FXU A;  3MDQ A;  3WQT A;  4C23 A;  4JHD B;  4BRK A;  1BDG A;  2WUS A;  1BG3 A;  3EN9 A;  1NGC A;  4BVP A;  4CZM A;  2QWP A;  3BUZ B;  1BOT O;  2NRH A;  3AAR A;  4H0T B;  4BR4 A;  4FWS A;  4H0X B;  3QBX A;  2QWL A;  2D0O A;  1QZ6 A;  3RSE B;  3VF6 A;  5EXW A;  2EWS A;  2CGJ A;  4RWT A;  1BA1 A;  1T6D A;  3GOI A;  4RCH A;  2BTF A;  5AQK A;  2NLX A;  1JCE A;  4CZH A;  1QQO A;  1MA9 B;  3A0I X;  2Q1N A;  2CH5 A;  4K41 A;  3CJ1 A;  3H3O B;  5KPR A;  3W3D A;  4WQ4 A;  3ENH A;  4HTL A;  3IUC A;  2E2P A;  1V4T A;  3R8E A;  4CI6 A;  4B1X B;  3VEY A;  2ZGY A;  4BC3 A;  1YXQ A;  3R6M A;  4FWM A;  1DGK N;  1K8K A;  1NGJ A;  1P8Z A;  3BF3 A;  3WEE A;  5F1X A;  2P9U A;  2YI1 A;  5EVZ A;  4RTF D;  1HLU A;  5AQV A;  5JMV A;  1E4G T;  3L4I A;  4FOI A;  3O1W A;  3ZET B;  4WQ5 C;  2HF3 A;  3A8Y A;  3VEW A;  2YHY A;  4A62 A;  2P9L A;  3QDK A;  1IG8 A;  5AQX A;  4CJ7 A;  3L0Q A;  2BUP A;  1Z05 A;  3FZK A;  3P4I A;  4EAH D;  4BC2 A;  4CZF A;  4CD3 A;  3CJ9 A;  4BR9 A;  1KXP A;  3CQY A;  4AM6 A;  4H0Y B;  5BPL A;  1NGD A;  3WT0 A;  3ID8 A;  5BR9 A;  3EKS A;  2V52 B;  4M7X A;  4Y0W A;  3SMP A;  1T6C A;  5KPZ A;  1X3N A;  5AQT A;  3VGL A;  3VGK A;  3TU5 A;  3IFR A;  5FPE A;  1NGB A;  3WXI A;  2VYP A;  4JAX A;  3VEV A;  4M63 C;  4CZK A;  4IWV A;  4F9O A;  3O5B A;  4AM7 A;  2IVP A;  5ELZ A;  2P9I A;  5AQH A;  3CER A;  4BC5 A;  2QWM A;  2ZWH A;  4K42 A;  3TPQ A;  3VER A;  4I6M B;  1NM1 A;  2YJE A;  3GDQ A;  2A41 A;  4BRL A;  4LC9 B;  1HKG A;  3CI5 A;  2Q36 A;  3WXL A;  2P9P A;  3FZM A;  1LOT B;  2D4W A;  3L6Q A;  4BRM A;  2E2O A;  3DXM B;  3WEE B;  5KPT A;  2CGK A;  3QFP A;  1BUP A;  2P9U B;  5AZJ B;  1NGA A;  3QBW A;  5AQJ A;  1NGG A;  3GE1 A;  3O8M A;  4CD1 A;  2V7Z A;  1SAZ A;  4EIA A;  2P9L B;  2A5X A;  3AY9 A;  4BRD A;  4EFH A;  3SK3 A;  3EZW A;  1GLD G;  3H3N O;  4CBW A;  1IJJ A;  2VWB A;  4M7Y A;  4BRO A;  5BRH A;  5B8H A;  3O4W A;  4FWN A;  1Y64 A; 
#chains in the Genus database with same CATH topology
 2B5J A;  3ENO A;  3ZET A;  4FM1 A;  3HZ6 A;  3THW A;  1L3V A;  1ESV A;  4NYF A;  4BRN A;  5AQR A;  2WTU A;  4FVU A;  3ZSW A;  3HM8 A;  4DG1 A;  4BRF A;  4MLH A;  4FLY A;  3CMA N;  4QCL A;  2P9I B;  3AVI A;  1T03 A;  4QS9 A;  3K58 A;  1X9S A;  4FLZ A;  2YNH A;  4DSJ A;  3QML A;  4FM2 A;  4FWK A;  2WC9 A;  3WNE A;  3S3M A;  1K8A O;  4XH5 A;  4DLG A;  4DTP A;  3CC4 N;  4OGE A;  4IKF A;  4DMN A;  3HVR A;  4RW4 A;  3G4S N;  3UB5 A;  3RMA A;  1JL1 A;  4FZY A;  1XNR K;  1NK6 A;  3E01 A;  3VQA A;  3HO1 A;  1HYS A;  1NK0 A;  2Q0R A;  3CFP A;  2ZJQ L;  3GG4 A;  3N4Q A;  4FW2 A;  4KPY A;  2UYT A;  4DTX A;  2E4L A;  1BWF O;  2DFF A;  1A5V A;  3RR8 A;  4FJ9 A;  2HBM A;  1NGF A;  3ISN C;  4I2P A;  4YOT A;  3TAM A;  4FWL A;  3EO3 A;  4BR7 A;  4DR4 K;  2O8E B;  1ASV A;  4Q0B A;  4CHZ A;  4KTQ A;  4JK9 A;  4JD2 B;  4CZI A;  1NGI A;  4CJK A;  4E0D A;  5C2D A;  5M1F A;  3ATU A;  3OYL A;  2PYJ A;  1C1B A;  1WSE A;  1RBS A;  4DTS A;  2YJF A;  1J53 A;  3CCR N;  2GWK A;  3MN6 A;  3M8Q A;  3AO5 A;  3LDO A;  5M1O A;  1JJ2 M;  4B1W B;  4DSE A;  1NGE A;  1XNQ K;  5AQF A;  2Q3S A;  1RGI A;  4NB4 A;  1NK4 A;  2E6M A;  3VEN A;  5KI6 A;  1QSL A;  3CCJ N;  3VEO A;  3UE5 A;  1EX4 A;  1XWL A;  3ULE B;  2HF4 A;  5FPD A;  2W41 A;  1BA0 A;  4DSF A;  3L3V A;  1L3U A;  5J2M A;  1X3M A;  3NGI A;  5TKW A;  3F5T A;  4GY2 B;  4L3Q A;  1DEJ A;  2P9S A;  4JKB A;  2ZJR L;  4B9V A;  4CGH A;  2ZGZ A;  3JYT A;  2F96 A;  4HCC A;  4KRF A;  5ADX A;  4HVJ A;  3ZT4 A;  4RW9 A;  3NDK A;  1X9W A;  5E26 A;  1BO5 O;  4B1V A;  1JCF A;  2G8H A;  3J7Y P;  3VQ6 A;  3UKR B;  3K57 A;  4W5O A;  1NJZ A;  3VOV A;  1GLA G;  1CZB A;  1XC3 A;  3Q7B A;  4QOZ B;  4FWQ A;  1ZC6 A;  4LF5 K;  3LAM A;  1IKV A;  1C6V A;  3VQB A;  4FLV A;  2FSK A;  4AHC A;  3CFR A;  3OJS A;  3DJC A;  4FK0 A;  4FJ5 A;  4XH4 A;  4OKK A;  1H1V A;  3ZT2 A;  4MO5 A;  4JYA K;  1K6Y A;  1NK7 A;  1M1K O;  4AHR A;  1REV A;  1GLL O;  3C6U A;  2HHW A;  3J80 O;  4A61 A;  4X62 K;  3UKU B;  5LMN K;  3TTC A;  3OY9 A;  1Q7Y O;  1VQL N;  3JAM O;  3AVA A;  1ZBS A;  3CCQ N;  3QER A;  2GEM A;  3PX4 A;  1RT4 A;  4JNE A;  2BE2 A;  3T1A A;  2NRZ A;  4DV3 K;  4MFB A;  4A2B A;  3K9K A;  3NE6 A;  3F2K A;  1R59 O;  3AVG A;  3M5R A;  4CJL A;  1NLV A;  4DKW A;  4IOA L;  4PKI A;  5LL6 Z;  3ALY A;  4CEZ A;  3VQ7 A;  2VG5 A;  3P5J A;  4CGI A;  1SQK A;  3RWU A;  3DRS A;  1VSH A;  4OPH A;  3DI6 A;  1GLJ O;  1S6P A;  1HX1 A;  4R79 A;  1Q81 O;  1WAF A;  3H6E A;  5AZI B;  5CYM A;  3ZX0 A;  3WXK A;  1UOC A;  3A5M C;  3ITH A;  4ID1 A;  3CYM A;  4CJ3 A;  3HK2 A;  4M41 A;  4IZ9 A;  4FWP A;  1VSF A;  5HRS A;  4FYD A;  4K0K K;  3NF8 A;  2VWJ A;  3EE9 A;  1E4F T;  4B8C A;  3DLL L;  4DSI A;  2DPN A;  2HHQ A;  3TSP A;  3NVM A;  4KTZ A;  1JCG A;  1LWE A;  5AQO A;  1I3A A;  3CF5 L;  1UA1 A;  4CJW A;  3TAN A;  1TYQ A;  4B3T K;  3HOS A;  3C7N A;  4JK7 A;  4E3S A;  2KFN A;  2WBN A;  4B9Q A;  1TUU A;  3R9P A;  4C1N K;  1L3S A;  4IOC L;  4CVN E;  2O8B B;  3LM9 A;  4B3S K;  3D2E A;  1FW6 A;  3IG1 A;  3FLC O;  5HRP A;  3VGM A;  3A5L C;  4JI3 K;  4BQZ A;  1DTQ A;  1NJY A;  1QS4 A;  4KHQ A;  3U4L A;  1C0M A;  4DU4 A;  3M8R A;  2W40 A;  4KH6 A;  1OH5 A;  4GKJ K;  1VSD A;  3CCE N;  4BGA A;  3QIC A;  4DCH A;  2XHB A;  4JKH A;  3T69 A;  1OVQ A;  3TTF A;  2E2Q A;  5CR4 A;  4MO4 A;  5AQS A;  1N32 K;  4JEP A;  5J2Q A;  4FK2 A;  1YIJ N;  1W9H A;  2RPI A;  3NAE A;  4YNQ A;  4JK8 A;  1FK9 A;  4JKG B;  4QAG A;  3LP0 A;  2WOM A;  4XH1 A;  3VEZ A;  2OA8 A;  2O8F A;  3QNN A;  5J1E A;  2KLA A;  3OBY A;  3MXJ A;  4J2B A;  4JKC A;  5FLX O;  3VMF B;  1WBB A;  1U2V A;  4DR5 K;  3MXI A;  4CW7 B;  1HYZ A;  3SAG A;  3OS0 A;  4O5B A;  4JI7 K;  3MDQ A;  3TAQ A;  4NCA A;  2W42 A;  1B9D A;  1NGC A;  3V1Q A;  4CZM A;  2QWP A;  3SJJ A;  1HNI A;  3MCA B;  3BUZ B;  3TAG A;  3PV8 A;  4KHN A;  4H0T B;  4B9L A;  1VQK N;  4H0X B;  3THY A;  3T3F A;  1QZ6 A;  3OS1 A;  4FCY A;  1HMV A;  3AVH A;  2EWS A;  3KD5 E;  4LF6 K;  4CEB A;  3HVT A;  2BTF A;  3PSF A;  3MEE A;  5HP1 A;  4E1M A;  3CQ8 A;  4CFB A;  4CIE A;  4N56 A;  3PX6 A;  3OYN A;  3RMD A;  3CJ1 A;  1OH8 A;  2PY5 A;  3W3D A;  4WQ4 A;  3IUC A;  3R8E A;  3VQQ A;  3VEY A;  3QLH A;  4C8O A;  4FWM A;  4XIU A;  3WEE A;  1NGJ A;  3EYZ A;  2FBV A;  2P9U A;  5EVZ A;  4R5P A;  4CFD A;  4CJ5 A;  4PWD A;  1L5U A;  4FLW A;  3MED A;  1HLU A;  1VSM A;  3ZSY A;  5JMV A;  3VQC A;  4WQ5 C;  1HJR A;  2HF3 A;  4GVE A;  1RT1 A;  2P9L A;  1BL3 A;  2BUP A;  3FZK A;  3V9W A;  3RR7 A;  4BC2 A;  3QO9 A;  2AJQ A;  4CZF A;  4CJE A;  4CD3 A;  4Z0U A;  4BR9 A;  1KXP A;  3DLH A;  1WSG A;  1D9F A;  3F73 A;  4AM6 A;  4E19 A;  4H4O A;  2ZD1 A;  4H0Y B;  4CCH A;  1NGD A;  3ID8 A;  1ZBI A;  2KQ2 A;  1Z26 A;  4M7X A;  3SMP A;  1T6C A;  2OPS A;  5KPZ A;  5AQT A;  1X1P A;  1ASU A;  5CYQ A;  1NGB A;  3HM9 A;  5HRO A;  1N8R O;  4CJT A;  4LF7 K;  2P9I A;  4JS4 A;  3CER A;  1RDC A;  2QWM A;  1S1W A;  4X66 K;  5C10 A;  5FDL A;  3VER A;  4Z4H A;  2GBZ A;  2YJE A;  3GDQ A;  2A41 A;  2VGN A;  3AVL A;  3WXL A;  2D4W A;  4KHU A;  3M8S A;  1N33 K;  5KPT A;  3TAB A;  1BUP A;  3VTH A;  1NGA A;  1OVY A;  3QBW A;  2V7Z A;  3ZSV A;  3CME N;  3MX2 A;  5HOO A;  4BRD A;  4EFH A;  3SK3 A;  3EZW A;  4CJR A;  4M7Y A;  2GX9 A;  3NGY A;  1IKX A;  3AO2 A;  4BRO A;  3KLG A;  3OYM A;  4YOR A;  4C8K A;  1Y64 A;  1C1A A;  2HMI A;  4DV2 K;  2QKB A;  2G8U A;  1QZ5 A;  4BR5 A;  3J8A A;  1D8Y A;  2BAN A;  3ZSR A;  2GWJ A;  5LJW A;  2O8E A;  2ZJP L;  4FVM A;  4E1J A;  2XY5 A;  1TAU A;  4JD2 A;  4E7L A;  4K25 A;  3AAQ A;  2IIR A;  3MK6 A;  4FW1 A;  4DUZ K;  1NNE A;  3BEX A;  5JIC A;  4E7I A;  1XMO K;  4X64 K;  2I7N A;  3AV9 A;  4ELT A;  1ZBH A;  3NH0 A;  4U67 L;  1EQY A;  3E9O A;  3C0B A;  4YOU A;  4B9S A;  1QQN A;  1S1U A;  3I8D A;  1IBK K;  4QS7 A;  4BRH A;  4EZ6 A;  3U9D A;  3DAW A;  1NK9 A;  4I6M A;  3EE8 A;  2E1Z A;  3ULE A;  1RFQ A;  1VSK A;  3VA0 A;  1ATR A;  3SMS A;  3EKU A;  1SZ2 A;  3WNF A;  5TKY A;  3VQE A;  3BP8 A;  5JS1 A;  5AZJ A;  1S1T A;  1Z25 A;  3VPZ A;  2QKK A;  3EL2 A;  3DLE A;  5C24 A;  4AIL C;  4EHU A;  4N76 A;  2WFB A;  4DTM A;  3P38 A;  3K9J A;  1EWQ A;  4B1Y B;  1TL1 A;  2UU9 K;  1VK0 A;  4DQS A;  5D3G A;  2PBD A;  3LPU A;  4CJV A;  5AQY A;  1HRH A;  2Z1H A;  3R1X A;  3ZX3 A;  1LW0 A;  4Z94 A;  5KTQ A;  1S3X A;  5DMR A;  4AHS A;  1XHZ A;  3J7A P;  4Y1C A;  1HUX A;  1VQ7 N;  1GOC A;  2IS3 A;  4B1Z A;  4LF8 K;  2P51 A;  3AAP A;  1IBM K;  3MMV A;  3O4Q A;  2FBX A;  2QWR A;  1BQM A;  5EX5 A;  2Z1I A;  3HTV A;  1KCF A;  3U9Z A;  3KLF A;  4OLA A;  4RW6 A;  1RBR A;  4JN4 A;  1KAX A;  3FFK B;  1NJX A;  1IKW A;  5FPN A;  4Z4E A;  3WQU A;  1YUW A;  4M3T A;  2DY4 A;  2O8C A;  4TSX A;  1T44 A;  1YVU A;  5CE3 A;  3G10 A;  1VSE A;  1HNZ K;  3KLH A;  1VSJ A;  2PAV A;  3MXM A;  1U4B A;  3B8A X;  1LWC A;  1QQM A;  2FF6 A;  1TUY A;  2UUB K;  4MDA A;  3SV3 A;  3VA3 A;  2JLE A;  4DTJ A;  1NMN A;  4CEF A;  1UA0 A;  4NLB A;  4IXC A;  3AO4 A;  4YDU C;  2FSN A;  1LAV A;  3MN9 A;  3G71 N;  2E88 A;  3OJU A;  1S1X A;  2VQE K;  4EZ9 A;  5FPM A;  3RMB A;  3S3N A;  1MDU B;  3ATV A;  3BF1 A;  4ISG A;  3CIP A;  4FLU A;  1WOQ A;  2O8D B;  2ZE2 A;  2F7T A;  4JI8 K;  4GV6 A;  1YI2 N;  4WF9 L;  4WYB A;  4J2E A;  5LJV A;  3A5O C;  3OS2 A;  2ZQB A;  3LAL A;  2HW3 A;  4NYN A;  3HYF A;  3D7E O;  3K59 A;  3JSM A;  4CED A;  3O80 A;  4BGB A;  5AQQ A;  4BRA A;  5BPM A;  4ISE A;  3S3O A;  2QM1 A;  3HRG A;  1GOA A;  3L2U A;  4H0P A;  3PIP L;  3KK1 A;  1J5E K;  5JLH A;  4JKD A;  3MN7 A;  1ILY A;  3DRP A;  1EWR A;  1YJN N;  1IV0 A;  1WUA A;  5FRM A;  1Q9Y A;  5JS2 A;  2AP1 A;  3O1B A;  1MWM A;  3CQX A;  2HHT A;  5H1S Q;  3WNG A;  1N34 K;  3CCS N;  1N6Q A;  1XC9 A;  2OPQ A;  4CEE A;  4BDY A;  1JLB A;  1NU0 A;  4YOV A;  4H5N A;  3OW2 M;  3GBT A;  1WNS A;  3K0S A;  2XRI A;  4M3Z A;  3S9H A;  2O8B A;  1WAJ A;  4AF1 A;  1HYV A;  1RDD A;  1C0G A;  3LM2 A;  1N36 K;  3WUH A;  4CBX A;  4H5W A;  2YHA A;  5GAE P;  3LL3 A;  4KHS A;  3HSC A;  4DTO A;  4H4M A;  5C15 A;  5AQW A;  1TV6 A;  2ZM6 K;  1A5W A;  3THX A;  4CZG A;  2WON A;  5M1K A;  1RBU A;  1S1V A;  1KAZ A;  4K43 A;  3DLG A;  3O9R A;  2ITM A;  2QTD A;  1KVC A;  4DF8 A;  3IKM A;  5CZ1 A;  3EZ5 A;  4BVO A;  2YCH A;  4FPB A;  4FLT A;  3SPY A;  1BU6 O;  3L2R A;  1V4S A;  1YF5 L;  3H45 C;  3CCL N;  1L3T A;  4ZHR A;  1RTD A;  1RT2 A;  2QWO A;  1BI4 B;  2E1Y A;  1YVN A;  1CXQ A;  2OPP A;  2GTD A;  4H8K A;  4E7H A;  3ULD A;  4CE9 A;  3RRH A;  3TAP A;  3AVF A;  4IO8 A;  4DV0 K;  4H5T A;  4J2D A;  3O9Q A;  4FJH A;  4AHV A;  1RT6 A;  2P9K B;  3J81 O;  4O44 A;  1W2B M;  4V19 S;  5JVH L;  4O0I A;  3SZ2 A;  3VES A;  3KZB A;  4KBO A;  4CEA A;  2ETJ A;  5EOY A;  5AFU A;  4F2R A;  3HOT A;  4IOX A;  3O3H A;  2A40 A;  2QW9 A;  1NKB A;  3NF6 A;  3E9L A;  4DV6 K;  3NH2 A;  1KD1 O;  1HR0 K;  3OYH A;  3C6T A;  2ASM A;  2F9W A;  4CJ4 A;  3SNN A;  3SV4 A;  3P83 D;  4FJK A;  1C0U A;  2D0P A;  2YX6 A;  2I5J A;  2OTJ N;  3DLB A;  5IT9 O;  1GLC G;  5BRD A;  4PY5 A;  1S72 N;  4NXM K;  3AVJ A;  4JV5 K;  3SUQ A;  3U8X A;  1F21 A;  1HNW K;  4EHT A;  3MWP A;  4LD0 A;  3KJV A;  5JVG L;  1TKZ A;  5K14 A;  4DLE A;  4M3Y A;  4CIF A;  2XY7 A;  3ZT0 A;  1A5X A;  3VF2 A;  4FJL A;  3VQ4 A;  2OTL N;  4DR2 K;  3RVC A;  5KQ8 A;  3UIQ A;  3ASM A;  1UAX A;  3LDL A;  4GNI A;  4PHT X;  3Q7C A;  1TGO A;  4JHD B;  1TVR A;  5GAH P;  4NXN K;  2HHS A;  1BDG A;  4LF9 K;  2Z1G A;  4CJP A;  4GVM A;  3EN9 A;  4BVP A;  1U47 A;  4BE0 A;  4M45 A;  1C1C A;  3AA4 A;  3AAR A;  3V1R A;  1W0H A;  1RTI A;  2QWL A;  4AHT A;  4G1Q A;  4RWT A;  1BA1 A;  4RCH A;  5AQK A;  3NF7 A;  1J5O A;  3MAQ A;  1QQO A;  3A0I X;  2Q1N A;  2CH5 A;  5HLF A;  3HPG A;  5KPR A;  3K2P A;  3ZSO A;  4ILH A;  2P1J A;  3ID6 A;  1BIZ A;  4FJI A;  4U7B A;  1M90 O;  3I0S A;  3CM6 A;  4CK1 A;  2KFZ A;  2ZGY A;  1YXQ A;  4DWI A;  3QIP A;  3CCM N;  1NK5 A;  1NKC A;  1K8K A;  3BF3 A;  4GMJ B;  2YI1 A;  3P31 A;  1RNH A;  4KHW A;  5AQV A;  3LAK A;  3ZET B;  1WSH A;  4GKK K;  3A8Y A;  4NLC A;  2YHY A;  1T3V A;  3THW B;  3KWI A;  1IG8 A;  3L3U A;  4M3X A;  4DTR A;  3L0Q A;  3CCV N;  2ATQ A;  4EAH D;  1Z05 A;  3WXM B;  4CF8 A;  3H08 A;  3TR8 A;  2OYQ A;  5BPL A;  4K8X A;  2Y1I A;  3LZI A;  4Y0W A;  4UY8 O;  1RDU A;  3VGL A;  3E1Y A;  2KZM A;  3WXI A;  4JAX A;  4C8N A;  3VEV A;  1SL2 A;  4NCG A;  3SUN A;  1K9M O;  4F9O A;  3O5B A;  5HRR A;  5C42 A;  5I3U A;  4BC5 A;  2X78 A;  4CF1 A;  5KRT A;  3TPQ A;  3I56 N;  2FBY A;  3J7Z O;  3V4I A;  4KI6 A;  4DTU A;  2HBJ A;  3SI6 A;  3FZM A;  1LOT B;  3L6Q A;  1BIU A;  4BRM A;  3SAF A;  2E2O A;  4CHO A;  5GAG P;  2CGK A;  3K5L A;  1SKW A;  4KH4 A;  1BHL A;  4CFA A;  3NGZ A;  2W6L A;  4W5N A;  1EXQ A;  4OX9 K;  4EIA A;  1I94 K;  2A5X A;  2IGI A;  5CY4 A;  1KRP A;  3PLA A;  3DYA A;  4YOW A;  1Y97 A;  4IDK A;  3VQ5 A;  4OLB A;  2O4I A;  1SKR A;  4AH9 A;  4DQR A;  4DFM A;  1NOZ A;  3TAF A;  2HNY A;  2OPR A;  2HHV A;  1RBV A;  3G25 A;  4PKG A;  5E84 A;  3KD1 E;  2P5O A;  2CGL A;  4KV8 A;  4W5T A;  1QHA A;  3LWM A;  4BRG A;  3CG7 A;  4BRP A;  4W5Q A;  2OZS A;  4OO1 J;  4JI5 K;  3M1F A;  1RT5 A;  3L2W A;  4BRE A;  5M1N A;  4Z4I A;  4F2S A;  4M42 A;  5C0Y A;  2F8T A;  1CXU A;  3IRX A;  3SQ1 A;  3IDH A;  3F9K A;  3TSU A;  2E5L K;  4DFP A;  4WQ5 A;  2BDP A;  5AFU H;  5ADX H;  2A6A A;  3O9S A;  3HI0 A;  2E2N A;  3LDQ A;  2KHO A;  3OYK A;  4KRE A;  3VN5 A;  1XMQ K;  4FLX A;  2DFH A;  3DXM A;  4LY7 A;  3BDP A;  2ZF5 O;  1NMD A;  2X74 A;  4Z4C A;  3HBT A;  4O8K A;  1U04 A;  3CJB A;  3K5M A;  1HJO A;  2D5R A;  2UUA K;  2V51 B;  1OH7 A;  4IJA A;  5MLC Q;  1OKJ A;  3O08 A;  3FGU A;  2PFU A;  5KGW A;  3VF4 A;  1NBW A;  1T8E A;  2B6A A;  3TI0 A;  2AA4 A;  4WCE L;  4DSL A;  4N47 A;  2VGM A;  4FL9 A;  1KSP A;  1S6Q A;  3A2F A;  4OPA A;  4KB0 A;  3NVK A;  4KB1 A;  3O3G A;  2YNG A;  1QE1 A;  3IMX A;  2O4G A;  2G8I A;  4PL7 A;  1I39 A;  2OCE A;  3KLI A;  2R7Y A;  3JXU A;  3MCP A;  3P39 A;  4IEE A;  2G8V A;  2IVN A;  2GV9 A;  4DU3 A;  1RDW X;  4YHH K;  3B6P A;  3DXK B;  1D4X A;  4FM0 A;  3U6F A;  4DSK A;  1SV5 A;  4CJU A;  5DM7 L;  4LSL A;  3KLE A;  2DTU A;  5AQN A;  5CHI A;  1KVA A;  3LDS A;  2P9N B;  4F3T A;  3PO4 A;  4A2A A;  2IVO A;  5BR8 K;  4X65 K;  3SQ0 A;  4FJN A;  1U48 A;  3G6E N;  4IFE A;  5AQM A;  3NH1 A;  3FZH A;  2GEL A;  2XY8 A;  5F2R A;  3OHR A;  1NJI O;  4XEI A;  2YKM A;  1SUQ A;  3C94 A;  2NRV A;  3H1V X;  2QWN A;  5AQZ A;  3ZX2 A;  3KK2 A;  3CJC A;  5AQU A;  4IO9 L;  1VQN N;  3O3F A;  4WFN L;  1WSI A;  1N5Y A;  3SYZ A;  4JLH A;  3AVM A;  4E1N A;  3ZEU B;  1BGX T;  4KHP K;  1DLO A;  1G99 A;  3CJ7 A;  1VQ9 N;  2OAN A;  4HUG A;  3CFO A;  3IAY A;  1TK0 A;  4PL8 A;  2NNW A;  3S41 A;  3CHW A;  2NZT A;  3DLK A;  4ISF A;  1ASW A;  3KVG A;  3PY8 A;  2DFE A;  1BQN A;  3MX5 A;  2YHW A;  4IBN A;  5AQG A;  2H3G X;  1VQM N;  3ZSZ A;  4DS5 A;  1EP4 A;  3D0P A;  3WXJ A;  3CD6 N;  3N4P A;  3V9S A;  3QEV A;  1R0A A;  4MDB A;  3T1H K;  3KKS A;  2PZS A;  4DU1 A;  2P9K A;  3QNO A;  4DV1 K;  4B3R K;  3OYJ A;  1FXX A;  1RBT A;  1T05 A;  3HXM A;  3V81 A;  3QEX A;  3MEG A;  2VWK A;  4CGD A;  4HWI A;  3H1Q A;  4BG9 A;  1KTQ A;  4C8M A;  1VHX A;  4N5S A;  1O13 A;  4BR2 A;  3O9U A;  2IAJ A;  1EKE A;  2KW4 A;  3BZC A;  3PO5 A;  1VQ5 N;  1WSF A;  2O8F B;  2UUC K;  4BRI A;  3UKR A;  1IBL K;  4FO0 A;  4ID5 A;  1GLE G;  2F9T A;  2Q97 A;  1VRT A;  4Z4F A;  1U2V B;  3U3Y A;  3LZJ A;  2Q31 A;  4FSV A;  3K5N A;  3C65 A;  5AQI A;  5AQP A;  5DK5 A;  5A2Q O;  4JKE A;  5GAD P;  4Q5V A;  1RDA A;  5FRO A;  3PSI A;  5KGX A;  4YDU A;  3TWH A;  3KKR A;  4ILJ A;  3NMU A;  4DUY K;  2W6K A;  3VQD A;  3O6W A;  1RTH A;  3H46 O;  3ZSQ A;  5M1Q A;  1NKE A;  3UKU A;  2EX3 A;  4JRP A;  4FWO A;  3HL8 A;  4JHD A;  3D2F B;  4KHY A;  5SWM A;  1LWF A;  3DM2 A;  4C1N I;  4CEC A;  1JLA A;  2HND A;  5I42 A;  3NHG A;  1Q18 A;  4B08 A;  4BE2 A;  4O0J A;  1QSS A;  3PIO L;  1LAW A;  3R3L A;  1BCM A;  4Y1D A;  1KQS M;  3L2V A;  4DR1 K;  4DR3 K;  3SUP A;  1IO2 A;  3I55 N;  4LH5 A;  1TAQ A;  2FF3 B;  4FJ7 A;  4H5R A;  2YV0 X;  3QIO A;  4H5V A;  2KTQ A;  3QB0 A;  4OPJ A;  1DT9 A;  3V6D A;  5AZI A;  2GUP A;  4HTU A;  3QIN A;  2IOC A;  3SLC A;  4F3O A;  4BC4 A;  4B9T A;  5M1P A;  1WLJ A;  3GL1 A;  3VEX A;  4DQQ A;  4O4G A;  4M3R A;  2F8S A;  4LFA K;  2GUI A;  4UQG A;  1JKH A;  4J2A A;  4BAC A;  1LW2 A;  4KI4 A;  3LP3 A;  2RN2 A;  3SBT A;  3P1G A;  3K5O A;  1BOT O;  4E7J A;  2G8F A;  3SUO A;  3QBX A;  3RSE B;  4ELU A;  5EXW A;  3QEW A;  3GOI A;  3OYA A;  1HNX K;  3U3G A;  4EP4 A;  2Y1J A;  1MA9 B;  3QET A;  3DOL A;  4JI1 K;  4MQ3 A;  1S5J A;  3LAN A;  1ITG A;  3ENH A;  4HTL A;  3FFI A;  1V4T A;  4CI6 A;  3SQ4 A;  4B1X B;  5IWA K;  4IFV A;  4RG8 A;  4DV5 K;  3R6M A;  2D0B A;  4B3O A;  5F1X A;  1K73 O;  4RTF D;  3VQ8 A;  5AJ3 K;  3L4I A;  4OGC A;  4ICL A;  4CHP A;  5J2N A;  3E9P A;  3QEI A;  2E6L A;  4JS5 A;  1VQ6 N;  3NFA A;  3QDK A;  5AQX A;  4CJ7 A;  3TAE A;  3RTV A;  2QEX N;  4BDZ A;  4FXD A;  4JKG A;  3C6A A;  4I9Q A;  3QEP A;  3ZYY X;  3OYE A;  2NRT A;  3EY1 A;  3NCI A;  4IG3 A;  4Z4G A;  1WB9 A;  1KVB A;  4ZTF A;  3RMC A;  1KLN A;  5BR9 A;  1TK5 A;  4O55 A;  3IS9 A;  4DV4 K;  2HNZ A;  3TU5 A;  3VQ9 A;  2UXB K;  1RDB A;  3MWT A;  4FJJ A;  4AM7 A;  3V9Z A;  5AQH A;  1RIL A;  1KC8 O;  2YNI A;  4I6M B;  1NM1 A;  1YJW N;  3CI5 A;  2Q36 A;  4CF9 A;  5C12 A;  4WFB L;  2NRW A;  3QFP A;  1TKT A;  5AZJ B;  1NGG A;  1S9G A;  3O8M A;  5SZT A;  1ZYQ A;  4DQP A;  4KTW A;  1C0T A;  2NRX A;  1D9D A;  3OTO K;  4HUF A;  1YTA A;  1YJ9 N;  1S9E A;  2D0A A;  2IC3 A;  4OPK A;  1IJJ A;  2VWB A;  2A1S A;  3BGR A;  4YOY A;  4WFA L;  3M8P A;  4JRQ A;  4G9Z A;  1TKX A;  4HUE A;  3KHY A;  1SKS A;  2FBT A;  3ZT1 A;  1QTM A;  4O8U A;  3HST B;  4CHN A;  2HMP A;  2QI2 A;  1YHQ N;  2G8W A;  3WNH A;  1QSY A;  4DTN A;  4BWM A;  4DHY A;  2I7P A;  2YHX A;  1P90 A;  2BH1 A;  4N41 A;  4NCB A;  4FPA A;  1U45 A;  4JI6 K;  1YTU A;  2O8C B;  3D45 A;  4PA1 A;  1XUP O;  4BG8 A;  5KRS A;  2P9P B;  4IG0 A;  4OKJ A;  4L8R B;  2HHH K;  1GLB G;  2X6N A;  4H03 B;  4I9L A;  5AR0 A;  4FWR A;  1ZBU A;  2HBL A;  4CJQ A;  3SPZ A;  4DQI A;  4O5F A;  1ZBL A;  4FJ8 A;  4CGG A;  3DXK A;  4RW7 A;  5C25 A;  1IKY A;  3ZCM A;  1C0F A;  2Q2R A;  3LP2 A;  4KO0 A;  1XQS C;  4LH4 A;  3AVN A;  3F9M A;  2V7Y A;  2VCP A;  4JKA A;  2P9N A;  1DKG D;  4LFC K;  4H0V B;  2ASO A;  4FZX C;  1Q8I A;  3PUF A;  3KK7 A;  1WSJ A;  2ASP A;  4FJX A;  1HQE A;  1HPZ A;  2D1K A;  1T7P A;  3M3Z A;  1NJW A;  2HVI A;  4DFK A;  3FR0 A;  1VRU A;  3SJH A;  1ATS A;  1UWB A;  3JS6 A;  2D0C A;  3QES A;  5BPN A;  5F0X A;  1W7A A;  2F4V K;  4CES A;  2E20 A;  2QA4 N;  3DWL A;  1ZXO A;  3AA5 X;  2HHU A;  1RT7 A;  5T7B A;  2FSJ A;  3V1O A;  4YOX A;  3OYG A;  4PQU A;  4C8L A;  4MLE A;  4PKH A;  3ZEU A;  5GIP A;  3KIO A;  1VQP N;  3E66 A;  4FOE A;  4IEI A;  4IDH A;  2HVH A;  2Q0U A;  3T1Y K;  5I9E B;  2BGG A;  4KH5 A;  3CXC M;  4CZE A;  1YT3 A;  2EHG A;  4ILG B;  5EY4 A;  1VAZ A;  1WBD A;  3CET A;  1VQO N;  3ZLJ A;  3BZK A;  3W0L A;  4W5R A;  5J2P A;  4J8F A;  4CZL A;  5BRE A;  3M6G A;  2UXD K;  5AQL A;  1NWK A;  4F4K A;  2A3Z A;  2CH6 A;  4JI2 K;  3LDN A;  4GW6 A;  3DLR A;  1YAG A;  2KKZ A;  3PX0 A;  1Q82 O;  3ENB A;  3THX B;  3QFU A;  1JLC A;  1HNV A;  1MWK A;  5C2F A;  1U49 A;  5HRN A;  5BRF A;  3TAR A;  3AO3 A;  3V9U A;  3VQP A;  3HT3 A;  3DMJ A;  5DM6 L;  5BN9 A;  2RKI A;  1FKP A;  4KFB A;  4A59 A;  2UXC K;  3AVC A;  2HB5 A;  1QVF M;  1VQ8 N;  1JLG A;  1Z6R A;  4M3U A;  3I8B A;  2YKN A;  3D6R A;  3AA2 A;  4IJN A;  1HKC A;  1VQ4 N;  4CEO A;  4DF4 A;  5CZ2 A;  5E41 A;  4CK2 A;  3G0Z A;  4FJG A;  3SCX A;  2P9S B;  1X9J A;  1QQC A;  1J6Z A;  3AGK A;  2HOE A;  4CJS A;  3MN5 A;  1SL1 A;  4AQY K;  3FZF A;  3KK3 A;  2A1R A;  4AHU A;  1B9F A;  1HQU A;  2QXL A;  1HPM A;  5LY3 A;  3KWG A;  3D2F A;  3B6O A;  4BR0 A;  4GV9 A;  1HKB A;  4CGJ A;  1KFS A;  5GIN A;  3CPW M;  1GLF O;  3OVN A;  1S22 A;  2QWQ A;  3L2Q A;  4A57 A;  2FLO A;  4NO7 A;  3O9T A;  4WE1 A;  1XI1 A;  2KZZ A;  3OYF A;  1KLM A;  3CM5 A;  4H0O A;  3CC2 N;  1JLF A;  2XY6 A;  2OZM A;  1D5A A;  2O8D A;  3SQ2 A;  1VSI A;  3VET A;  1ATN A;  1U6Z A;  4BQL A;  2PYL A;  3NF9 A;  4GV3 A;  4WQ4 C;  1NOY A;  4EP5 A;  4CZJ A;  3FE1 A;  1J9A A;  3OA9 A;  1ZBF A;  3RRG A;  1TL3 A;  1KAY A;  2Z1J A;  3SAH A;  1CZA N;  4BRQ A;  4B9U A;  3A5N C;  5JLF A;  3KTQ A;  4DFJ A;  5EU7 A;  3LDP A;  1CZ9 A;  4DQ8 A;  4CHQ A;  3LWL A;  4B3M K;  3LPT A;  4RW8 A;  4DR7 K;  1NGH A;  2JWL A;  1KFD A;  2YNF A;  5BN8 A;  2HHX A;  1JL2 A;  5LMU K;  4A5A A;  1JLQ A;  3DRR A;  2RHK A;  3HPH A;  3T19 A;  4I7F A;  1QVG M;  4FJM A;  4BDP A;  1FKO A;  4LSN A;  2HST A;  3CJA A;  3RSE A;  3OYB A;  3VTI A;  1NG9 A;  4E89 A;  4FZZ A;  1K8K B;  3AGR A;  4KKO A;  1RT3 A;  1O1W A;  1Q9X A;  4DV7 K;  4B9M A;  5FRN A;  3CC7 N;  4CBU A;  1LCU A;  3T7Z A;  4F8R A;  2A42 A;  3MEC A;  4DR6 K;  5KQD A;  4BWJ A;  5HBM A;  2J4R A;  2IDO A;  4E7K A;  2NUB A;  3I33 A;  4BY9 C;  4DB3 A;  1YIT N;  4CIG A;  3HPO A;  4ZTJ A;  2B4J A;  3C6H A;  2E8A A;  4B1U B;  2VQF K;  4K8Z A;  2YHB A;  1B92 A;  1G15 A;  4QS8 A;  4OKE A;  1X9M A;  1EET A;  1TYQ B;  2P5G A;  4JKF A;  3OYI A;  3C7N B;  3AO1 A;  3FZL A;  1J54 A;  4HHT A;  4CER A;  4CFC A;  1GOB A;  4BRC A;  3D2E B;  3TTD A;  3AVB A;  2FXU A;  3WQT A;  2LSN A;  4C23 A;  1JLE A;  4BRK A;  3HP6 A;  4IFY A;  2FC0 A;  2WUS A;  1BI4 A;  1BG3 A;  4CGF A;  4KAZ A;  1RTJ A;  3C95 A;  1VSL A;  3ZSX A;  2QXF A;  2NRH A;  4BR4 A;  1XHX A;  2JWK A;  4FWS A;  1IH7 A;  1SL0 A;  1QHT A;  1SS6 A;  3CPE A;  2D0O A;  5HL7 L;  3VF6 A;  3NBP A;  2CGJ A;  4BE1 A;  3HP9 A;  1T6D A;  2NLX A;  1JCE A;  4CF0 A;  4CZH A;  1TKD A;  4K41 A;  3L4Q A;  3H3O B;  4LF4 K;  2E2P A;  1TK8 A;  4BC3 A;  1BCO A;  1DGK N;  1P8Z A;  3OYC A;  1BIS A;  3LP1 A;  2NRR A;  4I2Q A;  4LFB K;  1JXE A;  2VG6 A;  1E4G T;  3ZT3 A;  4FOI A;  3O1W A;  2ITG A;  4CEQ A;  3TSQ A;  3VEW A;  4A62 A;  3AA3 A;  2RE2 A;  4PUO A;  4DS4 A;  4JI4 K;  3P4I A;  4A5B A;  3OYD A;  2JGU A;  3CJ9 A;  4CF2 A;  4M3W A;  3CQY A;  4ELV A;  4CK3 A;  3WT0 A;  3EKS A;  3SBG A;  4HCB A;  2V52 B;  3V9X A;  3THY B;  4FK4 A;  1X3N A;  3VGK A;  3OBW A;  3IFR A;  5FPE A;  2XO7 A;  3THV A;  1WN7 A;  2VYP A;  1W97 L;  4M63 C;  4CZK A;  4IWV A;  1LV5 A;  4B8A B;  2IVP A;  1MU2 A;  5ELZ A;  4JI0 K;  2ZWH A;  4K42 A;  2G8K A;  2QK9 A;  1E3M A;  1IG9 A;  4OJR A;  1RCH A;  1JXB A;  4BRL A;  4LC9 B;  1HKG A;  4B9N A;  3HJF A;  2P9P A;  1CLQ A;  3DXM B;  3WEE B;  2X6S A;  2RF2 A;  3BY5 A;  2P9U B;  4CHY A;  3CCU N;  4CD1 A;  5AQJ A;  3GE1 A;  3L8B A;  3I0R A;  3O4N A;  1SAZ A;  1Q86 O;  1OH6 A;  2HBK A;  2P9L B;  3AY9 A;  1EO1 A;  4CJF A;  4YY3 K;  4CBW A;  3H3N O;  1GLD G;  5GIO A;  3AVK A;  1DTT A;  3DOK A;  1NK8 A;  1FJG K;  3EEQ A;  5BRH A;  4OVL A;  4YFU A;  5B8H A;  3O4W A;  2VG7 A;  4FWN A; 
#chains in the Genus database with same CATH homology
 1QZ5 A;  3KHY A;  4BR5 A;  3ENO A;  3J8A A;  3ZET A;  3HZ6 A;  2GWJ A;  5LJW A;  3G25 A;  4PKG A;  4O8U A;  1ESV A;  2ZJP L;  2HMP A;  4BRN A;  5AQR A;  5E84 A;  2QI2 A;  1YHQ N;  4FVU A;  4E1J A;  2CGL A;  3HM8 A;  4JD2 A;  4BRF A;  4MLH A;  4DHY A;  4K25 A;  1QHA A;  2I7P A;  3CMA N;  2P9I B;  2YHX A;  3AAQ A;  4BRG A;  1P90 A;  2BH1 A;  2IIR A;  4QS9 A;  4BRP A;  3MK6 A;  4OO1 J;  3M1F A;  3QML A;  4FPA A;  4BRE A;  5M1N A;  3BEX A;  4FWK A;  4BG8 A;  5JIC A;  1XUP O;  5C0Y A;  2I7N A;  2WC9 A;  2P9P B;  1K8A O;  4XH5 A;  3IDH A;  4U67 L;  1EQY A;  3E9O A;  1GLB G;  3TSU A;  3CC4 N;  3C0B A;  4H03 B;  4YOU A;  1QQN A;  4WQ5 A;  5AFU H;  5AR0 A;  5ADX H;  3G4S N;  3UB5 A;  4FWR A;  4QS7 A;  4BRH A;  2A6A A;  3U9D A;  2HBL A;  3O9S A;  4O5F A;  3HI0 A;  3DAW A;  4I6M A;  3EE8 A;  2E1Z A;  2E2N A;  3LDQ A;  3DXK A;  3ULE A;  2Q0R A;  1RFQ A;  2KHO A;  2ZJQ L;  1ATR A;  3GG4 A;  3SMS A;  3EKU A;  1C0F A;  1SZ2 A;  3N4Q A;  2Q2R A;  5TKY A;  1XQS C;  2UYT A;  3DXM A;  3BP8 A;  1BWF O;  3F9M A;  2ZF5 O;  1NMD A;  2V7Y A;  2VCP A;  5AZJ A;  4JKA A;  3VPZ A;  2P9N A;  3EL2 A;  2HBM A;  1DKG D;  1NGF A;  3HBT A;  4H0V B;  4O8K A;  4YOT A;  3CJB A;  4EHU A;  2ASO A;  4FWL A;  2WFB A;  1HJO A;  3EO3 A;  4BR7 A;  3KK7 A;  3P38 A;  3K9J A;  4B1Y B;  2ASP A;  2V51 B;  2D1K A;  2PBD A;  3M3Z A;  4IJA A;  4JK9 A;  4JD2 B;  4CZI A;  1NGI A;  5MLC Q;  3FR0 A;  1OKJ A;  3O08 A;  3SJH A;  5AQY A;  1ATS A;  3FGU A;  3R1X A;  2PFU A;  3ATU A;  3VF4 A;  1NBW A;  3ZX3 A;  4Z94 A;  5C2D A;  5M1F A;  3JS6 A;  2AA4 A;  1S3X A;  4WCE L;  5BPN A;  5F0X A;  2E20 A;  3DLL L;  2VGM A;  4FL9 A;  2QA4 N;  1HUX A;  3DWL A;  4OPA A;  1VQ7 N;  3NVK A;  1ZXO A;  2YJF A;  3CCR N;  2FSJ A;  3IMX A;  2GWK A;  3MN6 A;  4B1Z A;  3LDO A;  4YOX A;  5M1O A;  3AAP A;  1JJ2 M;  4B1W B;  4PL7 A;  3MMV A;  1NGE A;  2QWR A;  4MLE A;  4PKH A;  5EX5 A;  3ZEU A;  5AQF A;  3JXU A;  3MCP A;  5GIP A;  1VQP N;  1RGI A;  4NB4 A;  3E66 A;  3HTV A;  4FOE A;  3P39 A;  3U9Z A;  4IEI A;  4IEE A;  4IDH A;  4JN4 A;  1KAX A;  3FFK B;  3VEN A;  2Q0U A;  5FPN A;  2IVN A;  3CCJ N;  3VEO A;  3WQU A;  5I9E B;  3UE5 A;  1YUW A;  1RDW X;  4KH5 A;  3CXC M;  3DXK B;  3ULE B;  1D4X A;  2HF4 A;  1T44 A;  5FPD A;  2W41 A;  1BA0 A;  4CZE A;  5CE3 A;  4ILG B;  5EY4 A;  2PAV A;  1VAZ A;  5DM7 L;  3CET A;  1X3M A;  1VQO N;  3B8A X;  5TKW A;  3F5T A;  5AQN A;  5CHI A;  4GY2 B;  4L3Q A;  2FF6 A;  1DEJ A;  1QQM A;  1TUY A;  3W0L A;  2P9N B;  2P9S A;  4JKB A;  4J8F A;  4CZL A;  5BRE A;  2ZJR L;  4MDA A;  4A2A A;  2IVO A;  2ZGZ A;  3M6G A;  4NLB A;  5AQL A;  4IXC A;  1NWK A;  3G6E N;  4IFE A;  2A3Z A;  5AQM A;  2CH6 A;  5ADX A;  3FZH A;  3LDN A;  2GEL A;  3OHR A;  2FSN A;  4YDU C;  1YAG A;  5F2R A;  1NJI O;  4XEI A;  3MN9 A;  5E26 A;  1BO5 O;  4B1V A;  3G71 N;  1JCF A;  2E88 A;  2KKZ A;  2NRV A;  3H1V X;  2QWN A;  5AQZ A;  3ZX2 A;  3CJC A;  3ENB A;  5AQU A;  1Q82 O;  5FPM A;  4IO9 L;  1VQN N;  4WFN L;  3QFU A;  1MDU B;  3ATV A;  3BF1 A;  1MWK A;  3UKR B;  4ISG A;  3CIP A;  1WOQ A;  1GLA G;  3VOV A;  2F7T A;  5C2F A;  1XC3 A;  3Q7B A;  4FWQ A;  1ZC6 A;  5BRF A;  4GV6 A;  1YI2 N;  4WF9 L;  4WYB A;  5LJV A;  3A5O C;  3ZEU B;  1G99 A;  3CJ7 A;  1VQ9 N;  2OAN A;  5DM6 L;  2FSK A;  5BN9 A;  4PL8 A;  2NNW A;  3DJC A;  3D7E O;  4XH4 A;  3S41 A;  3CHW A;  4A59 A;  2NZT A;  3O80 A;  1H1V A;  4BGB A;  5AQQ A;  1QVF M;  4MO5 A;  4BRA A;  5BPM A;  4ISE A;  4ISF A;  2QM1 A;  1M1K O;  1VQ8 N;  3HRG A;  3KVG A;  4H0P A;  3PIP L;  1Z6R A;  3MX5 A;  1GLL O;  3I8B A;  2YHW A;  3D6R A;  5JLH A;  4JKD A;  3MN7 A;  4IJN A;  1HKC A;  1VQ4 N;  1ILY A;  5AQG A;  2H3G X;  1YJN N;  1VQM N;  4A61 A;  1WUA A;  2P9S B;  3UKU B;  2AP1 A;  1X9J A;  3O1B A;  3TTC A;  1MWM A;  1J6Z A;  3AGK A;  2HOE A;  3CQX A;  1Q7Y O;  1VQL N;  3WXJ A;  3CD6 N;  5H1S Q;  3N4P A;  1ZBS A;  3CCQ N;  3CCS N;  2GEM A;  4MDB A;  3MN5 A;  4JNE A;  3FZF A;  2NRZ A;  4A2B A;  4YOV A;  4H5N A;  3OW2 M;  3GBT A;  3K9K A;  2QXL A;  1HPM A;  5LY3 A;  2P9K A;  4AF1 A;  3F2K A;  1R59 O;  3KWG A;  1C0G A;  3LM2 A;  3M5R A;  3D2F A;  3WUH A;  4CBX A;  4H5W A;  1NLV A;  4BR0 A;  3LL3 A;  1HKB A;  4DKW A;  3HSC A;  5GAE P;  4GV9 A;  4IOA L;  5GIN A;  3CPW M;  4PKI A;  5C15 A;  1GLF O;  4HWI A;  1S22 A;  3H1Q A;  5AQW A;  4BG9 A;  2QWQ A;  4A57 A;  2FLO A;  4NO7 A;  1SQK A;  1O13 A;  3O9T A;  4BR2 A;  3O9U A;  4OPH A;  4CZG A;  1GLJ O;  5M1K A;  1HX1 A;  1VQ5 N;  4R79 A;  1Q81 O;  4H0O A;  1KAZ A;  4BRI A;  3H6E A;  4K43 A;  3O9R A;  5AZI B;  4FO0 A;  3UKR A;  3ZX0 A;  3WXK A;  2ITM A;  3CC2 N;  2QTD A;  3A5M C;  1GLE G;  2F9T A;  2Q97 A;  3VET A;  3IKM A;  1ATN A;  1U6Z A;  4BQL A;  1U2V B;  4BVO A;  2YCH A;  4GV3 A;  4FPB A;  4IZ9 A;  4FWP A;  2Q31 A;  4WQ4 C;  4FSV A;  1BU6 O;  3C65 A;  3EE9 A;  5AQI A;  1V4S A;  1YF5 L;  3FE1 A;  1E4F T;  3OA9 A;  5AQP A;  3H45 C;  4CZJ A;  1KAY A;  3SAH A;  2DPN A;  1CZA N;  4JKE A;  4BRQ A;  3TSP A;  5GAD P;  3CCL N;  3A5N C;  3NVM A;  2QWO A;  5JLF A;  2E1Y A;  4YDU A;  1JCG A;  1YVN A;  3LDP A;  4DQ8 A;  5AQO A;  3CF5 L;  4ILJ A;  3NMU A;  2GTD A;  1NGH A;  1TYQ A;  2JWL A;  3HOS A;  4IO8 A;  3C7N A;  4JK7 A;  5BN8 A;  4H5T A;  2WBN A;  3O9Q A;  4B9Q A;  1TUU A;  3R9P A;  4C1N K;  4IOC L;  3O6W A;  2P9K B;  3H46 O;  3LM9 A;  3D2E A;  5M1Q A;  4A5A A;  3UKU A;  4FWO A;  1W2B M;  5JVH L;  4JHD A;  3D2F B;  3VES A;  3KZB A;  3FLC O;  2RHK A;  1QVG M;  3VGM A;  3A5L C;  4KBO A;  4BQZ A;  4C1N I;  5EOY A;  5AFU A;  3HOT A;  4IOX A;  2A40 A;  2QW9 A;  2HST A;  3CJA A;  3U4L A;  1Q18 A;  3RSE A;  3VTI A;  3E9L A;  1K8K B;  1KD1 O;  3AGR A;  2W40 A;  4KH6 A;  3PIO L;  3CCE N;  4BGA A;  3QIC A;  3R3L A;  4DCH A;  1KQS M;  3CC7 N;  2ASM A;  2F9W A;  4JKH A;  3T69 A;  3TTF A;  2E2Q A;  5CR4 A;  4CBU A;  4MO4 A;  1LCU A;  5AQS A;  4JEP A;  3T7Z A;  2A42 A;  2D0P A;  2YX6 A;  3I55 N;  1YIJ N;  2OTJ N;  5KQD A;  2FF3 B;  2J4R A;  4H5R A;  4JK8 A;  4JKG B;  3I33 A;  1GLC G;  5BRD A;  4H5V A;  4BY9 C;  4DB3 A;  1S72 N;  1YIT N;  4XH1 A;  3VEZ A;  3QB0 A;  3U8X A;  1DT9 A;  3C6H A;  2E8A A;  5AZI A;  2GUP A;  2KLA A;  4B1U B;  3OBY A;  4EHT A;  3MWP A;  4QS8 A;  5JVG L;  1TYQ B;  4JKF A;  4JKC A;  3C7N B;  3VMF B;  1U2V A;  3SLC A;  4BC4 A;  3VF2 A;  3FZL A;  2OTL N;  5M1P A;  3RVC A;  3GL1 A;  5KQ8 A;  3LDL A;  3VEX A;  4BRC A;  3D2E B;  4GNI A;  3TTD A;  3SAG A;  4PHT X;  2FXU A;  3MDQ A;  3Q7C A;  3WQT A;  4C23 A;  4JHD B;  4BRK A;  5GAH P;  1BDG A;  2WUS A;  1BG3 A;  3EN9 A;  1NGC A;  4BVP A;  4CZM A;  2QWP A;  3SBT A;  3MCA B;  3BUZ B;  1BOT O;  2NRH A;  3AAR A;  2JWK A;  4H0T B;  4BR4 A;  4FWS A;  4H0X B;  1VQK N;  1SS6 A;  3CPE A;  3QBX A;  2QWL A;  2D0O A;  1QZ6 A;  3RSE B;  5HL7 L;  3VF6 A;  5EXW A;  2EWS A;  2CGJ A;  4RWT A;  1BA1 A;  1T6D A;  3GOI A;  4RCH A;  2BTF A;  5AQK A;  2NLX A;  1JCE A;  4CZH A;  1QQO A;  1MA9 B;  3A0I X;  2Q1N A;  2CH5 A;  4K41 A;  3L4Q A;  3CJ1 A;  3H3O B;  5KPR A;  3W3D A;  4WQ4 A;  4ILH A;  3ENH A;  3ID6 A;  3IUC A;  2E2P A;  4HTL A;  1V4T A;  3R8E A;  4CI6 A;  4B1X B;  4U7B A;  1M90 O;  3VEY A;  2ZGY A;  4BC3 A;  1YXQ A;  3R6M A;  4FWM A;  3CCM N;  1DGK N;  1K8K A;  1NGJ A;  1P8Z A;  3BF3 A;  3WEE A;  5F1X A;  2P9U A;  2YI1 A;  5EVZ A;  2NRR A;  4RTF D;  1K73 O;  3P31 A;  1HLU A;  5AQV A;  5JMV A;  1E4G T;  3L4I A;  4FOI A;  3O1W A;  3ZET B;  4WQ5 C;  3TSQ A;  2HF3 A;  3A8Y A;  3E9P A;  4GVE A;  4NLC A;  2YHY A;  1T3V A;  2P9L A;  3VEW A;  4A62 A;  1VQ6 N;  3KWI A;  1IG8 A;  3QDK A;  2RE2 A;  5AQX A;  4CJ7 A;  2QEX N;  3L0Q A;  3CCV N;  4JKG A;  3C6A A;  2BUP A;  1Z05 A;  3FZK A;  3P4I A;  3WXM B;  4EAH D;  4A5B A;  4BC2 A;  3ZYY X;  4CZF A;  2NRT A;  4CD3 A;  3CJ9 A;  4BR9 A;  1KXP A;  3CQY A;  4AM6 A;  4H0Y B;  5BPL A;  1NGD A;  3WT0 A;  3ID8 A;  5BR9 A;  3EKS A;  3SBG A;  2V52 B;  4M7X A;  4Y0W A;  3SMP A;  1T6C A;  5KPZ A;  4UY8 O;  1RDU A;  1X3N A;  3E1Y A;  3OBW A;  5AQT A;  3VGL A;  3TU5 A;  3IFR A;  3VGK A;  5FPE A;  1N8R O;  1NGB A;  3WXI A;  2VYP A;  4JAX A;  3VEV A;  1W97 L;  4M63 C;  4CZK A;  1K9M O;  3MWT A;  4IWV A;  4F9O A;  3O5B A;  4AM7 A;  2IVP A;  5ELZ A;  2P9I A;  5AQH A;  3CER A;  4BC5 A;  2QWM A;  1KC8 O;  2ZWH A;  4K42 A;  3TPQ A;  3I56 N;  5C10 A;  3VER A;  4I6M B;  1NM1 A;  3J7Z O;  2YJE A;  3GDQ A;  2A41 A;  2HBJ A;  4LC9 B;  1HKG A;  3CI5 A;  2Q36 A;  2VGN A;  4BRL A;  1YJW N;  3WXL A;  2P9P A;  3FZM A;  5C12 A;  1LOT B;  2D4W A;  3L6Q A;  4WFB L;  3SAF A;  4BRM A;  2E2O A;  3DXM B;  3WEE B;  2NRW A;  5GAG P;  5KPT A;  2CGK A;  3QFP A;  1BUP A;  2P9U B;  3CCU N;  5AZJ B;  3VTH A;  1NGA A;  1OVY A;  3QBW A;  1NGG A;  3GE1 A;  3O8M A;  5AQJ A;  4KH4 A;  4CD1 A;  2V7Z A;  3CME N;  3MX2 A;  1SAZ A;  1Q86 O;  4EIA A;  2NRX A;  2HBK A;  2P9L B;  2A5X A;  5HOO A;  3AY9 A;  1EO1 A;  4BRD A;  1YJ9 N;  4EFH A;  3PLA A;  3SK3 A;  3EZW A;  1GLD G;  3H3N O;  4CBW A;  5GIO A;  4YOW A;  1IJJ A;  2VWB A;  2GX9 A;  4M7Y A;  4BRO A;  5BRH A;  4YOY A;  4WFA L;  4YOR A;  5B8H A;  3O4W A;  4G9Z A;  4FWN A;  1Y64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...