1LAVA

Stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYLRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE H
publication title Stabilization of Escherichia coli ribonuclease HI by cavity-filling mutations within a hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
total genus 52
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lavA00
3IAYA 4IG0A 4Q5VA 3V6DA 4CHYA 3OYCA 3OYHA 3ITHA 4Z4EA 4KV8A 4FLWA 4DTJA 4KPYA 1QSLA 5FRNA 3VQ7A 1TKTA 4OKEA 3ZSOA 4C8OA 1Q9YA 4FK4A 1YTUA 1BIUA 2HNDA 4DMNA 4IDKA 1C1BA 4DF4A 3AVMA 3KK2A 4DF8A 4N41A 1JLFA 1LWFA 1QQCA 2D0CA 3V1OA 1QTMA 2QK9A 2IAJA 3V9XA 3OYMA 1YTAA 3CG7A 1Q8IA 3LP3A 3T19A 1KVBA 1KVAA 3O3GA 3OYEA 2PYJA 2RN2A 4CJRA 4FLTA 2YKMA 4W5TA 3WNGA 4DSKA 4GVMA 1D5AA 3LALA 3DI6A 3OVNA 1RCHA 5E41A 1LWEA 2I5JA 3K5OA 4KHWA 2XY5A 1BIZA 1EXQA 2VWKA 3OS1A 5SWMA 3K5LA 4PWDA 3NGIA 4FZZA 4W5RA 1XC9A 3MXMA 3G0ZA 4E1NA 4M3XA 1S1XA 3KK1A 1UWBA 1GOCA 2X6SA 3HP9A 4O5BA 5HRRA 4CJWA 3KTQA 1ZBHA 3I8DA 3HP6A 3F73A 4B9SA 1X9MA 1RDAA 3MXJA 4FVMA 2HW3A 1RTIA 1ZBLA 4ELVA 3S3MA 2X74A 4DTXA 3AVAA 1UA1A 1N6QA 5KGXA 3JSMA 2FBTA 4ZTFA 4KRFA 3A2FA 1JLBA 1S1VA 3P83D 4DTSA 4CHNA 1LV5A 4F3OA 1VRUA 4OPJA 4CEFA 3DOLA 4CCHA 4O44A 4CJLA 3AVHA 2QXFA 2OYQA 1VSJA 3AA3A 1RDBA 3CFOA 4ID5A 3VQBA 3NE6A 1O1WA 1SV5A 4RW9A 3WNFA 3HPOA 2ZD1A 3CFPA 3V9WA 4B9NA 3HXMA 5J2MA 4FM2A 1ZBFA 3V1RA 4FJLA 4B9VA 4NYNA 4FLYA 3EZ5A 3PV8A 3HYFA 4UQGA 3KLFA 3QNNA 4LH4A 1CZBA 4CJUA 4E7IA 2O4IA 5DK5A 3MAQA 4DFMA 3AO2A 4C8MA 3RMAA 3AVJA 1TKXA 4I2PA 1JXEA 3AO4A 3OS2A 4FK2A 4Z4IA 1EETA 5K14A 2BGGA 4DFPA 1RBTA 1VSEA 4CIFA 1BQNA 4IFYA 3V9SA 4KHQA 5J2PA 2P1JA 2IOCA 3AA2A 1EKEA 2GV9A 4F2RA 3VQAA 2D5RA 3SPYA 1W9HA 3TWHA 3U6FA 2OA8A 3MEDA 1IO2A 4DTMA 4B9LA 2OZMA 2F8SA 1JLGA 1HPZA 3DYAA 2BANA 2A1RA 5KI6A 2FBVA 3KD1E 2VWJA 4DS4A 2ETJA 3KLIA 5SZTA 3HO1A 1T03A 1HMVA 1L3SA 3OJSA 3LZIA 1JLAA 4LSNA 1TGOA 1A5VA 2HVIA 3SQ1A 2HHTA 4AHUA 1RT1A 3HVRA 4E7LA 3NHGA 3ALYA 4B08A 3M8SA 3ULDA 1R0AA 1WSGA 2LSNA 3LP2A 1X9SA 2HHSA 1RT6A 2YNGA 5FRMA 2ATQA 1BQMA 5CYMA 3VA3A 4Z4FA 4CFBA 5KRTA 3QEXA 3S3OA 4KB1A 1LAVA 3SNNA 2JGUA 4Z4HA 2HHQA 2IGIA 2KZZA 1RNHA 2EX3A 3D45A 3C95A 2YNHA 3P1GA 4CJFA 1SL2A 3RWUA 1T7PA 4GMJB 4CJSA 3NDKA 4EP5A 4CK3A 3L2RA 4BWMA 4RW6A 4CK2A 2RPIA 3PX4A 4HHTA 1FKOA 1WSEA 1VK0A 4PA1A 3ZSWA 4CERA 4FLVA 3V81A 4CF8A 3SPZA 4CIGA 1B9FA 1KCFA 2F8TA 1XHZA 3VQEA 3NH0A 1QE1A 3G10A 3ZCMA 4OLBA 1ASWA 1ZBIA 4PY5A 1IKYA 2HHWA 3OY9A 1IKWA 1WAJA 3VQDA 4W5QA 4HUEA 2VG7A 4ZTJA 4F8RA 1TKDA 2B6AA 1CXUA 3QIOA 2RF2A 3AO1A 3QESA 1U47A 1JXBA 4BDPA 3AA4A 3TAPA 4FK0A 1TV6A 4DFJA 2BDPA 4KTQA 3KKSA 1RT2A 4DFKA 1RTDA 1ASVA 1RT3A 1HYSA 1L3UA 4KAZA 4F3TA 1B92A 3LP0A 3NH1A 1U49A 3RR8A 2WONA 4H8KA 4CE9A 1NK5A 2Q3SA 3C6UA 4FCYA 1TK5A 4OVLA 1ZYQA 4FJ8A 3PO4A 3DLHA 3IG1A 3VQ8A 3RMDA 3VQPA 3LAKA 1WSIA 5C24A 1JL2A 3U3YA 3I0SA 3OYIA 4RW4A 4LD0A 4BDYA 1D8YA 4BE2A 4CHZA 3MECA 1QSYA 4IG3A 4FZYA 1S6QA 4DTRA 3KLHA 1RILA 3M8QA 4AILC 4RG8A 4FW2A 4CGFA 4CF1A 2Y1IA 1C6VA 1WN7A 1YVUA 1C0UA 3OYDA 3K5MA 4QAGA 4CJVA 1B9DA 3TR8A 3PX0A 3NF7A 4I2QA 4CJTA 3C94A 1VSMA 3TAGA 3AVLA 2DFFA 2FBYA 3LWMA 3LPUA 3HJFA 4CJPA 4Z4GA 4CFDA 1NK0A 1SKSA 1RT4A 1TKZA 1JLEA 4KB0A 4DSLA 1BL3A 1Z26A 3EYZA 2PZSA 5EU7A 1GOAA 3ZSYA 3DRSA 3MXIA 1U4BA 4M3RA 3F9KA 4FLUA 4CJ4A 4BWJA 2PYLA 4FJNA 4Z4CA 3FFIA 1DTTA 3SV4A 4IKFA 3MEEA 2Z1HA 4CGIA 3ZT1A 3S3NA 1S1WA 4MQ3A 4M45A 2BE2A 3L8BA 5HRNA 2XY7A 3DLRA 4CEAA 1S1TA 3LPTA 2P51A 2AJQA 3B6OA 1RBRA 4KHNA 4CIEA 4MFBA 1XWLA 4JS4A 1FKPA 4KFBA 3SV3A 4L8RB 2DFEA 1S1UA 3JYTA 4NCBA 3VQ6A 2HNYA 3AVNA 4O55A 3EY1A 4BE0A 1KSPA 4J2EA 4O0JA 1RDCA 4HCBA 1T8EA 2DTUA 2B4JA 3KJVA 4CJKA 4W5OA 1SUQA 1NJXA 2HNZA 2EHGA 1KFSA 4CGJA 1D9DA 1TAQA 4FLZA 3BGRA 5J2QA 4M3TA 1RTJA 4CFCA 4QOZB 2HHVA 4N56A 3OYNA 4ELUA 3SUNA 1IKVA 5KRSA 4OGEA 3V9ZA 4CFAA 1CLQA 4B3OA 4Y1CA 4CF9A 3TAQA 1QSSA 5CY4A 4DSIA 4H4MA 4E7HA 4N76A 4DQSA 1U48A 5FDLA 3PX6A 1BISA 4KHUA 4I9LA 4E19A 2QKKA 3TAMA 5J1EA 1WLJA 1BHLA 1LW0A 3QNOA 1FXXA 2G8UA 4E3SA 4CHQA 4CK1A 5HP1A 4YNQA 5HLFA 3TAEA 4CJ3A 4FZXC 3V4IA 1NJYA 1RBUA 4CJ5A 3LZJA 4JS5A 4FJMA 4RW8A 1HYVA 3P5JA 5FROA 4DQPA 2GUIA 3L2WA 4CJEA 3U3GA 3TANA 4IBNA 3VQCA 4K8ZA 1DTQA 4ELTA 2YNFA 1WSJA 4HUFA 1C1AA 2E6MA 3RMCA 1NK9A 1L5UA 3NH2A 5T7BA 3K5NA 4FJIA 1W0HA 2OPSA 3CM6A 2KTQA 1WNSA 3SUOA 4DSEA 3E01A 2OPRA 4KHSA 2FC0A 3SQ4A 2P5GA 4Z0UA 3T3FA 1VSKA 1J53A 4YFUA 1VSFA 3DRRA 1LAWA 3SQ0A 3HVTA 5C25A 1S9EA 4OKJA 2E4LA 4DTOA 4DTNA 4CGGA 3ZSQA 4B9MA 3QLHA 3ZSVA 4AHSA 4HVJA 3RR7A 3OYBA 1EP4A 1A5XA 4CEEA 1TK0A 3TABA 1CXQA 3LANA 3O3HA 3QERA 1Q9XA 2HHUA 2HB5A 5HRPA 1BGXT 1HNVA 4J2AA 3KLGA 4DQIA 4FYDA 4QCLA 1L3VA 4CECA 4AHCA 4KTWA 2HMIA 3KK3A 4CEOA 4BACA 4EZ6A 1TL3A 4CEQA 4FJJA 2YHAA 3QINA 4J2DA 4OGCA 4Y1DA 3LWLA 1S9GA 2B5JA 1WSHA 3KIOA 3CFRA 1K6YA 3VQ5A 4KO0A 3LDSA 2IS3A 1UA0A 4M42A 3ZT2A 1XI1A 1TL1A 4DLEA 1IKXA 1U04A 4DTPA 4B9TA 3L2UA 1KRPA 3O4QA 1HQEA 4B8AB 3CM5A 3NGZA 1L3TA 4EZ9A 3IS9A 3CQ8A 3L3VA 1TVRA 2XY8A 1T05A 1VSLA 3NF9A 4M41A 4BDZA 3SQ2A 4HTUA 1IG9A 1NOZA 1MU2A 3HPHA 3M8RA 3LAMA 3DM2A 3HPGA 3QO9A 4N47A 1I3AA 4DU1A 3AVCA 4E7JA 3DLEA 1TAUA 1Y97A 3QEVA 1SL0A 4FJ7A 3DRPA 1SL1A 1RT5A 2Z1JA 3T1AA 1GOBA 2OPPA 4FLXA 3RMBA 1KVCA 2JLEA 4ID1A 2ZQBA 4FJHA 1C1CA 2G8HA 4E7KA 1SKWA 4E1MA 2XRIA 3C6TA 4FXDA 3VN5A 1BI4A 1VRTA 3THVA 1NJZA 1YT3A 3O4NA 3ZSZA 3DLKA 4C8NA 4XIUA 4CEDA 4FM0A 4FJGA 4OLAA 5KTQA 5I42A 3B6PA 3ZSXA 3SUPA 1F21A 2ZE2A 4DWIA 4LSLA 1JLQA 3SYZA 4FJXA 2YV0X 3AA5X 2FBXA 2KQ2A 2QKBA 3QEWA 3OYFA 3K2PA 3HK2A 5CYQA 1J54A 1QS4A 1XHXA 1C0TA 1HNIA 4R5PA 3WNEA 3DLGA 4DQQA 2IC3A 3S9HA 4HCCA 4Q0BA 1TK8A 4C8LA 1A5WA 2DFHA 1RBSA 3VA0A 4DS5A 5D3GA 3SUQA 1QHTA 4HUGA 1Z25A 5CZ2A 4DQRA 1REVA 1BI4B 2XHBA 3ZT0A 5HROA 1NKEA 1SKRA 4K8XA 4M3ZA 3DMJA 2G8KA 4NYFA 3SI6A 1IH7A 3IRXA 4M3UA 1X9WA 1HYZA 4B8CA 4G1QA 2KFNA 3NBPA 5KGWA 3RRHA 3NAEA 5C42A 4N5SA 3SJJA 4JLHA 2G8IA 3SCXA 4W5NA 3TI0A 2YNIA 1J9AA 2E6LA 5J2NA 2XY6A 4CHOA 1NK4A 1HQUA 4FJKA 4CHPA 2VG6A 3PUFA 1UAXA 1LW2A 3MEGA 3ZT4A 4JRPA 1RDDA 4DSFA 1KLNA 3LP1A 3ZT3A 4NCAA 4M3WA 2KZMA 1FK9A 4AH9A 2XO7A 3L2QA 4I9QA 2KFZA 4OJRA 3QEIA 3ZSRA 3K59A 3AVBA 5HBMA 1HRHA 1JLCA 3OYKA 4FM1A 4I7FA 4ICLA 4M3YA 2X6NA 4WE1A 1VSDA 3DLBA 2KW4A 4FW1A 3OYLA 4O4GA 4CEZA 2OZSA 4F4KA 3KKRA 3AV9A 1WAFA 4KKOA 4AHVA 3D0PA 4PUOA 4KREA 3HM9A 3TARA 2HHXA 3NFAA 4ZHRA 2Y1JA 4O0IA 4TSXA 4OKKA 3CYMA 4KI6A 2GBZA 2R7YA 2DY4A 3DOKA 4C8KA 1NK7A 1VSIA 1HJRA 2P5OA 1BCOA 3QIPA 2YKNA 3BDPA 1UOCA 3ASMA 4RW7A 4DU4A 3QEPA 2Z1GA 4F2SA 1KLMA 3OYAA 3K58A 2YHBA 2IDOA 5CZ1A 3HL8A 3OYGA 5HRSA 4AHTA 3M8PA 3QETA 1NKBA 2G8VA 3TAFA 1X1PA 4CGDA 3NCIA 1JL1A 1G15A 1LWCA 1S5JA 1VSHA 3NF6A 4DU3A 4KI4A 3AVKA 2HVHA 3VQ4A 1D9FA 1EX4A 4H4OA 3RRGA 5I3UA 1RT7A 1NK6A 3UIQA 1RTHA 2G8WA 1BCMA 1NK8A 2WOMA 4E89A 3PO5A 1DLOA 4E0DA 3AO3A 4DTUA 2PY5A 1J5OA 3L3UA 1CZ9A 4CESA 1JKHA 3AO5A 3V1QA 3AVGA 2F96A 2RKIA 1S6PA 3KLEA 4CJQA 1ITGA 3AVIA 4PQUA 1RBVA 2ITGA 3ISNC 4GW6A 3NGYA 4EP4A 3H08A 4CF2A 3L2VA 3I0RA 2G8FA 4KHYA 3KD5E 4AHRA 4OPKA 4LH5A 4CF0A 1ASUA 5JS2A 3V9UA 1KFDA 4J2BA 2W42A 4CGHA 3AVFA 3OJUA 3VQ9A 3K57A 2VG5A 3RTVA 2NUBA 4B9UA 5JS1A 4JRQA 1N5YA 1I39A 3NF8A 2D0BA 4NCGA 2O4GA 3WNHA 5DMRA 4CEBA 3HT3A 4IFVA 4BE1A 3SZ2A 4FJ5A 1U45A 4FJ9A 3PY8A 1NOYA 2Z1IA 4LY7A 1KTQA 2OPQA 4DG1A 2X78A 3O3FA 1NJWA 1NKCA 1C0MA 1WSFA 4KTZA 4DLGA 1ZBUA 2D0AA 3HSTB 3VQQA 4DSJA 3OS0A 2A1SA 3OYJA
chains in the Genus database with same CATH superfamily
4H0PA 3D2EB 4F9OA 5JMVA 5FRNA 3AARA 4C8OA 1YITN 3AY9A 4FK4A 1NG9A 4JI5K 1BIUA 3LDQA 1QQCA 4MDBA 3V1OA 2IAJA 3V9XA 3A0IX 3PIOL 3OYEA 2QWOA 4DSKA 1GLAG 2Q0UA 1D5AA 3OVNA 4KHWA 2D1KA 1BIZA 2FSJA 2QWPA 1XC9A 3G0ZA 3MX5A 3KK1A 2X6SA 2P9SB 4JEPA 4L3QA 3I8DA 3HP6A 3F73A 4CD3A 4B9SA 3DXMA 3MXJA 2HW3A 3VTHA 5M1OA 4DTXA 1UA1A 1N6QA 5KGXA 3JSMA 1TUYA 1JLBA 3P83D 4F3OA 4CHNA 3DOLA 2IVNA 2OYQA 3VQBA 1O1WA 1SV5A 4MO4A 4BR5A 3HPOA 2P9UA 4FJLA 4DR6K 4NO7A 3WXJA 3ENOA 1QVGM 1E4FT 2NRTA 4K41A 3AVJA 5FPNA 4I2PA 1DKGD 3E9PA 4Z4IA 4DFPA 1BQNA 4IFYA 2IOCA 1EKEA 3ZX2A 3TWHA 3U6FA 4R79A 4BRPA 1P8ZA 2OZMA 1JLGA 3DYAA 4KH6A 2BANA 5KI6A 3WUHA 4QS9A 4CZEA 4JI2K 3UKRA 2ETJA 3HO1A 3R8EA 1JLAA 3O08A 4LSNA 1TGOA 1A5VA 3J7ZO 3SQ1A 1RT1A 3NHGA 3ULDA 2CGLA 5GADP 2V7ZA 1EO1A 1WSGA 2YHXA 2IVPA 3VTIA 3VENA 2VWBA 3VA3A 3MCPA 5FLXO 3SNNA 2JGUA 4Z4HA 5AQVA 3O9SA 1RDUA 1RNHA 2EX3A 3P1GA 1MA9B 3FZLA 4GMJB 3L2RA 1HJOA 4FWKA 2HBLA 4CK2A 2RPIA 4HHTA 1WSEA 4X66K 1B9FA 1U2VB 2KFNA 3NH0A 1QE1A 1OVQA 1ASWA 4PY5A 3VQDA 4F8RA 3CCJN 4ZTJA 4PL7A 1CXUA 4FK0A 3AA4A 4DV0K 1HNWK 4KTQA 1RT2A 5AQRA 1B92A 5AZIA 4H5NA 2E5LK 4H8KA 4CE9A 1NK5A 5BPNA 2Q3SA 1ZBSA 4IWVA 4FCYA 4OVLA 1TYQB 3PO4A 4CBXA 3VQ8A 1NGGA 3OYIA 3T1YK 3MECA 4FZYA 3DLLL 3NVKA 4GV3A 1J6ZA 3SAHA 3TSQA 4CF1A 4GV6A 1YVUA 1ATRA 5GIPA 2QWRA 4JKCA 4BC4A 2DFFA 3CMEN 3LWMA 4DUZK 2D0OA 2Q36A 4KB0A 3MXIA 4FPBA 4EFHA 1HX1A 4M7XA 4CJ4A 4BWJA 2PYLA 4FJNA 4Z4CA 1DTTA 3SV4A 4ILHA 3NVMA 5KPZA 1DT9A 4YOWA 4H5TA 1VQ7N 3VF6A 3BP8A 3HRGA 1S1UA 3JYTA 3EY1A 3OW2M 4DKWA 1KSPA 1GLBG 4J2EA 2VGMA 4M63C 2NRXA 3KJVA 4CJKA 1NGJA 3CPWM 1D9DA 4M3TA 1RTJA 1DGKN 3O5BA 3H3NO 5KRSA 1MDUB 5GAGP 5AQOA 1QSSA 1N33K 4DSIA 5KQ8A 4E7HA 4DQSA 4G9ZA 1MWMA 4I9LA 2NRZA 1BHLA 4CK1A 5HP1A 4YNQA 4CJ3A 1W7AA 2WBNA 4RW8A 1GLEG 3P5JA 5M1NA 4JI4K 1KAYA 4IBNA 4BRAA 4ELTA 2YNFA 3SMPA 3RMCA 1NK9A 2Q0RA 2ZM6K 3GOIA 3L0QA 2VQFK 4FJIA 2E1ZA 1NBWA 4A5AA 3E01A 2OPRA 3CHWA 4FWLA 5JICA 4EHUA 2P5GA 5C2DA 5ADXA 3DRRA 4RWTA 1LAWA 2O8EA 2E4LA 4DTOA 3ZSVA 4JAXA 3RR7A 3ZEUB 2P9IA 4CEEA 1CXQA 3QERA 1Q9XA 3CCMN 4QCLA 4YORA 4A5BA 4FJJA 3VEOA 2YHAA 4OGCA 1S9GA 1X3MA 3WQTA 3O4QA 1VQLN 3NGZA 3WXLA 3IS9A 5AQLA 3VESA 4HTUA 1IG9A 3E1YA 3HPHA 1X9JA 1VQ4N 3QO9A 4IO9L 4E7JA 4DV6K 1TAUA 1Y97A 1SL1A 4DV7K 2Z1JA 3T1AA 1SKWA 1XUPO 2O8FB 3SBGA 3O9RA 1SZ2A 3EL2A 2FXUA 4KRFA 1NGBA 1VRTA 5I42A 3SUPA 1TUUA 5LJVA 2FBXA 3QEWA 3HK2A 5AQQA 1HNIA 2E1YA 3S9HA 4HCCA 3CCQN 4YDUA 3B8AX 4BG8A 1A5WA 4ISGA 1RBSA 3IDHA 4BRDA 3VA0A 3TTCA 3SUQA 4K8XA 1BI4B 3ZT0A 4M3ZA 4DB3A 4E1JA 4M3UA 3RVCA 1HYZA 3BF1A 4G1QA 4GKKK 3CQXA 3NBPA 4UY8O 3NAEA 4WQ5A 4W5NA 1BO5O 4CHOA 3MEGA 4DR5K 1N34K 1FK9A 4AH9A 1G99A 1ESVA 3CXCM 4OJRA 2PAVA 4Y0WA 1HRHA 1VSDA 2RE2A 4FW1A 2OZSA 3KKRA 3AV9A 3D0PA 3L4QA 1N8RO 2P9LA 1WOQA 4O0IA 4JI8K 4OKKA 1BCOA 2YJEA 1S3XA 3IUCA 3ASMA 4RW7A 4I6MA 1OKJA 3QEPA 3TSPA 1KLMA 2E20A 3OYAA 3HZ6A 2IDOA 2YHBA 3CPEA 1WB9A 5HOOA 4PHTX 2QWMA 3NCIA 1JL1A 1LWCA 4GKJK 5KPRA 1D9FA 1EX4A 1NK6A 3UIQA 2G8WA 1BCMA 4B3RK 1VAZA 1DLOA 3CJ9A 3AO3A 1IV0A 2HSTA 4CESA 4YDUC 3KLEA 1D4XA 4PQUA 3R1XA 2ITGA 4CF2A 3H08A 1I94K 3I0RA 1WUAA 3D2EA 3MMVA 4OPKA 3PLAA 2HMPA 1ASUA 3V9UA 3QFUA 4J2BA 4B9UA 3WXIA 2D4WA 3VQ9A 3RTVA 3NF8A 5AQXA 5AQUA 3T69A 3BF3A 1QHAA 4CEBA 3HT3A 4ISEA 4XH4A 3H46O 3SAGA 4BRCA 5AJ3K 3CJBA 1NKCA 4DLGA 1Q7YO 4E3SA 5AQYA 3U8XA 4JKFA 4Q5VA 1NMDA 4Z4EA 2NRHA 1QSLA 1BDGA 5GINA 1TKTA 4OKEA 3C7NB 4CZMA 4FWRA 4JD2B 3AVMA 5BRFA 3KK2A 4DF4A 4N41A 1JLFA 2D0CA 3OYMA 3HOTA 5E26A 4GVMA 3LALA 1RCHA 5E41A 3S41A 1OVYA 1EXQA 3AAQA 1J5EK 3K5LA 3AGRA 5CHIA 4FZZA 4W5RA 1XMOK 3MXMA 3A5MC 4E1NA 4EAHD 3U9DA 1S1XA 1UWBA 3E9OA 4ILJA 2GWKA 3MK6A 1ZBLA 3S3MA 2X74A 3AVAA 2ZJPL 3LL3A 4FWMA 1S1VA 3WXMB 2HF4A 3EZWA 4OPJA 4CEFA 4CCHA 3F5TA 3AVHA 2E8AA 4ILGB 3CFOA 5AQSA 4RW9A 1NM1A 4A62A 5LY3A 5J2MA 4FM2A 2ASPA 3V1RA 1WBDA 3HYFA 4E7IA 2O4IA 5DK5A 3MAQA 4DFMA 3AO2A 3CERA 4C8MA 4BR9A 3RMAA 3PIPL 4FK2A 3AO4A 1NGCA 3DXKB 4DV1K 5J2PA 4F2RA 4CZLA 3SPYA 1YJWN 1VQKN 2Q1NA 2QWQA 1NGFA 4DTMA 4B9LA 1W97L 2EWSA 4XEIA 2F8SA 4U67L 2UXBK 2FBVA 3R6MA 3TSUA 4DR2K 2VWJA 1DEJA 1HMVA 3EKSA 3GBTA 4BRNA 4U7BA 3LZIA 1LOTB 2HVIA 2HHTA 4AHUA 2FSNA 1VQ5N 3VGKA 2QEXN 1JCEA 1T6CA 1RT6A 5CYMA 3UB5A 4Z4FA 3SK3A 4IOCL 5CE3A 2KZZA 2IGIA 4I6MB 4X62K 3ULEB 1E4GT 1T7PA 3NDKA 5BPMA 3D6RA 4BWMA 1RDWX 2YCHA 1VK0A 4PA1A 4CF8A 4OPAA 3VF2A 1U6ZA 1TYQA 4CIGA 2F8TA 1XHZA 3VQEA 3G10A 3ZCMA 1IKYA 3OY9A 1IKWA 1WAJA 4JKGB 4W5QA 2VG7A 4K42A 3QIOA 3QESA 3TAPA 1TV6A 3JXUA 1OH7A 4DFKA 1RT3A 3VEYA 3K0SA 1L3UA 1XMQK 3NH1A 3RR8A 4DR1K 3VETA 3OBWA 3WQUA 5AFUH 1BG3A 4AQYK 1WSIA 5C24A 3U3YA 1NGDA 1FJGK 1QSYA 3C6AA 4IG3A 4DTRA 3GE1A 1ZC6A 1K8AO 4BVOA 4WFBL 4FW2A 1C6VA 2UXDK 3OYDA 1Z6RA 4QAGA 4CJVA 3TR8A 4I2QA 3TAGA 2AP1A 2FBYA 4YOTA 2UUAK 3G25A 1T3VA 1KAXA 4Z4GA 4CFDA 3PSFA 4PKHA 1SKSA 4BVPA 1JLEA 4DSLA 5EU7A 2E2PA 3ZSYA 1YIJN 3F9KA 1C0GA 3FFIA 4AM7A 4CZJA 3S3NA 2BE2A 2XY7A 3O9TA 2A5XA 4NLCA 4KHNA 3M3ZA 1XWLA 3QICA 1FKPA 4KFBA 4L8RB 2DFEA 4BE0A 2HNYA 4O55A 3EE8A 4HCBA 5BN9A 4XH1A 4IEIA 3D7EO 4GY2B 3H1QA 1SUQA 2HBJA 3DWLA 4CGJA 4FLZA 3BGRA 1V4TA 5J2QA 2UXCK 5FPMA 4A2BA 2GWJA 5C15A 3P39A 4ELUA 4JKEA 1IKVA 3H45C 4H5VA 2NRRA 4JK9A 3WXKA 4CFAA 3V9ZA 2F4VK 4Y1CA 3TAQA 1C0FA 4IJNA 1Q82O 2CH6A 4H4MA 4N76A 5FDLA 3PX6A 1BISA 4KHUA 4E19A 3TAMA 2H3GX 4BRIA 3JAMO 2Q97A 4H5RA 1FXXA 3BZCA 2G8UA 3VEVA 3MWPA 5HLFA 3TAEA 4FZXC 4JS5A 4PL8A 4H0VB 5FROA 4LFAK 4BR4A 2GUIA 3VOVA 3TANA 3ZEUA 4K8ZA 1XNQK 4HUFA 1C1AA 2E6MA 1VQ9N 1BU6O 2Q31A 3MCAB 2ZWHA 3O1BA 2FF3B 1WNSA 2ZGYA 3SQ4A 1VSKA 1ATNA 4YFUA 1VSFA 3SQ0A 3HVTA 1S9EA 2IVOA 4OKJA 4B9MA 4DTNA 3ZSQA 1BOTO 2PFUA 3QLHA 4FWQA 4AHSA 4JN4A 4FWNA 3OYBA 1EP4A 1A5XA 1TK0A 3GL1A 3M1FA 1JCFA 3LANA 5HRPA 3W0LA 4EIAA 4J2AA 2GELA 3GDQA 4FO0A 1KQSM 3ID6A 1VQMN 4CEOA 4EZ6A 1TL3A 3CFRA 1WSHA 2ASOA 3KIOA 1K6YA 2ZF5O 3LDSA 2IS3A 1XI1A 1IKXA 4B9TA 1KRPA 4DQ8A 1L3TA 2O8FA 1NU0A 3KWIA 4M41A 3SQ2A 3KHYA 1NOZA 1YF5L 3M8RA 3LAMA 2UU9K 4LF6K 5TKYA 4N47A 2YX6A 1I3AA 3M6GA 2A42A 3DLEA 4LF9K 2A3ZA 4FJ7A 4PKGA 4FLXA 1GOBA 2OPPA 1Q18A 4ID1A 2W41A 2ZQBA 3MN5A 1C1CA 4E7KA 4FXDA 1BI4A 1KAZA 4OLAA 4XIUA 5KTQA 1N36K 3ZSXA 2ZE2A 3SYZA 4OO1J 4JI0K 2KQ2A 5EX5A 4CVNE 3KWGA 3K2PA 1OH5A 1XHXA 1C0TA 3DLGA 3E9LA 4Q0BA 2A41A 3CC4N 5D3GA 1QHTA 4HUGA 3R9PA 1SKRA 3JS6A 3SI6A 3IRXA 3QMLA 2QTDA 1YAGA 2P9KB 4MO5A 2E2OA 3C6HA 3RRHA 3SJJA 3BEXA 3TI0A 2YNIA 1J9AA 4H0YB 3SBTA 4FJKA 2VYPA 4FWSA 4CHPA 2VG6A 3PUFA 3T1HK 1UAXA 4JRPA 1RDDA 2XO7A 3L2QA 3SMSA 2HF3A 3OYKA 1JLCA 2X6NA 2KW4A 4O4GA 4CEZA 4O5FA 1HLUA 4DUYK 4F4KA 1WAFA 4IOXA 4J8FA 4ZHRA 2Y1JA 5JVGL 3VEWA 5LJWA 1NNEA 3CD6N 2YKNA 1UOCA 3ZX3A 3K58A 5HRSA 3QETA 1KD1O 1Q86O 1G15A 4O8KA 1NGEA 4HWIA 4KI4A 2HVHA 3VQ4A 3MDQA 3RRGA 5EY4A 4B1XB 4X64K 1NK8A 3PO5A 3QFPA 1GLFO 4BY9C 3L3UA 4BRFA 5BN8A 1HPMA 5AQGA 4IOAL 1S6PA 4DCHA 4BR7A 3ISNC 4GW6A 3NGYA 5B8HA 1K73O 3KD5E 3O4WA 2QA4N 4CZGA 2OTLN 5C2FA 1HKBA 2VG5A 5JS1A 3C7NA 1N5YA 4YOVA 4NCGA 4JD2A 2CH5A 1U45A 4B3MK 4FJ9A 4FOEA 2UUBK 1N32K 1KTQA 3O3FA 1NJWA 1C0MA 1WSFA 1ZBUA 2D0AA 3KVGA 3OYJA 1NGIA 3IAYA 2ITMA 3LDLA 4IG0A 4B3SK 3OYCA 3OYHA 3ITHA 1VQ6N 5EOYA 4FLWA 3UKUB 2YHYA 4KPYA 1SQKA 3ZSOA 1Q9YA 3ZETB 1YTUA 1T44A 4DMNA 3L6QA 4IDKA 3HOSA 4DF8A 1LWFA 1QTMA 3MN6A 2W6LA 1YTAA 3CG7A 5M1KA 1KVBA 1KVAA 3F2KA 4FLTA 2YKMA 4W5TA 3WNGA 2UUCK 4B9QA 1H1VA 3CCEN 2I5JA 3K5OA 4JI6K 3I55N 4BR0A 3NGIA 3U4LA 4M7YA 1GOCA 3HP9A 3DAWA 4CJWA 5HRRA 5C10A 1X9MA 1RDAA 4FVMA 4IEEA 4ELVA 4C1NK 1HR0K 3CC7N 3A2FA 2FF6A 5GAHP 3VEZA 1VRUA 3DXKA 3A5NC 4CJLA 3IFRA 1VSJA 4ID5A 3C0BA 4B9NA 3V9WA 3BZKA 3HXMA 1IBKK 4A59A 4DV2K 4FLYA 3EZ5A 4UQGA 1RFQA 3KLFA 3QNNA 4LH4A 4CJUA 3EO3A 1JXEA 4H5WA 5K14A 1RBTA 3V9SA 5BPLA 3VQAA 2D5RA 4WFAL 2O8BB 2OA8A 3MEDA 3WEEB 4FOIA 1IO2A 1HPZA 2WTUA 4C1NI 3KD1E 2NZTA 4DS4A 4BC3A 1T6DA 4C23A 5SZTA 3ULEA 3OJSA 2OANA 4H03B 3HVRA 5DM7L 2WUSA 3ALYA 5BREA 1YI2N 4JI7K 1R0AA 1YUWA 3AGKA 2LSNA 3LP2A 1X9SA 5MLCQ 3H3OB 2ATQA 1ZXOA 4JKGA 1NJIO 4KB1A 3S3OA 2Q2RA 4JKBA 4LF5K 3D45A 3C95A 2YNHA 5M1QA 5GAEP 3ZX0A 4RW6A 3PX4A 1FKOA 4CERA 4B1VA 3V81A 4KHPK 5CR4A 2D0PA 3D2FB 3THWB 4OLBA 4YOXA 2HHWA 2QI2A 4DV4K 5LL6Z 4HUEA 1YHQN 3THYB 2RF2A 1U47A 4BDPA 1JXBA 4BRGA 2BDPA 3FE1A 1ASVA 3LM9A 1HYSA 4F3TA 1GLLO 4A61A 2WONA 3C6UA 4KBOA 4AF1A 3TTDA 3M5RA 3DLHA 4DR7K 3RMDA 3VQPA 4OPHA 3LAKA 4YOYA 4JI1K 2DPNA 3I0SA 2QM1A 4RW4A 4LD0A 3VERA 4BDYA 4CHZA 3AAPA 1HNXK 1S6QA 3KLHA 1RILA 4B1UB 4AILC 4RG8A 2Y1IA 1C0UA 4ISFA 1B9DA 3LDNA 4CJTA 1YJNN 3C94A 1VSMA 3HTVA 4K0KK 1JJ2M 4OX9K 3HJFA 4BQZA 1S22A 3EN9A 1NGAA 1Z26A 3EYZA 2PZSA 1GOAA 3EE9A 4M3RA 1X3NA 5AQFA 2HOEA 1QZ6A 1S1WA 2F9WA 4MQ3A 4M45A 3DLRA 1S1TA 3LPTA 2P51A 2AJQA 4MLEA 4JS4A 3G6EN 3VQ6A 3AVNA 5FPDA 2IIRA 4B1WB 1RDCA 2GUPA 3RSEA 2DTUA 2B4JA 1EQYA 4BGAA 1KFSA 1TAQA 3P31A 4CFCA 3FR0A 3FZMA 4LC9B 4QOZB 2HHVA 1SAZA 3J8AA 4N56A 3MN9A 3SUNA 3BUZB 4OGEA 3N4QA 1CLQA 3A5LC 1KXPA 3VPZA 5CY4A 1S72N 2YHWA 4B3TK 1GLCG 1LW0A 3QNOA 5AZJB 4GNIA 3LZJA 1HYVA 2VCPA 3MWTA 4CJEA 3U3GA 4JKDA 5C0YA 1L5UA 1LCUA 5T7BA 2OPSA 2GX9A 3CM6A 3THXA 3O9UA 4KHSA 4KH4A 2FC0A 3TPQA 4Z0UA 3FZKA 1J53A 5M1PA 1NWKA 4HVJA 4X65K 1K9MO 2ASMA 3N4PA 2JWLA 3O3HA 1HNVA 1OH8A 3OBYA 5LMUK 3HBTA 2ZJRL 2UYTA 4KTWA 2HMIA 4BACA 4CEQA 3O8MA 3LWLA 5EXWA 2B5JA 4K43A 4B1ZA 4M42A 3VQ5A 5ADXH 4FWPA 4LFBK 1TL1A 3FGUA 4PKIA 3L2UA 1HQEA 2RHKA 5BRHA 4EZ9A 4LF4K 3CQ8A 3L3VA 1VSLA 4BDZA 4AM6A 1MU2A 3DM2A 2O8DB 3AVCA 2YJFA 1M90O 4YY3K 1K8KB 3OA9A 3QEVA 3WT0A 3KZBA 2HHHK 2JLEA 4FJHA 4BRMA 4CZIA 3L4IA 3P38A 4E1MA 3CCSN 3EKUA 3C6TA 3THVA 4DQPA 1NJZA 1YT3A 3ZSZA 2KHOA 4CEDA 4FM0A 3ENBA 3B6PA 2P9KA 4DWIA 2V7YA 4FJXA 2YV0X 3HM8A 2QKBA 3O6WA 4IDHA 4NCBA 4R5PA 2J4RA 3WNEA 4DQQA 4LF8K 4C8LA 1QQMA 4DQRA 4NXNK 3Q7CA 3DMJA 2G8KA 4JK8A 4CZKA 4JLHA 3SCXA 4WYBA 2E6LA 5J2NA 5KQDA 3ZT4A 3J7YP 4NCAA 3LP1A 3ZT3A 1XQSC 4M3WA 4RTFD 3RSEB 4I9QA 4NLBA 4I7FA 4ICLA 4QS8A 3DLBA 1VQPN 4AHVA 4XH5A 4JHDB 4IJAA 1IJJA 4KI6A 2GBZA 2R7YA 2DY4A 4BC2A 3DOKA 4C8KA 2A6AA 1NK7A 5AQJA 5C12A 3BDPA 3PSIA 2BUPA 4DU4A 2QWLA 4H0XB 4BG9A 5F0XA 2Z1GA 4F2SA 1CZAN 3TTFA 1KC8O 4FWOA 3O9QA 3QBXA 5CZ1A 3HL8A 4RCHA 3TU5A 4AHTA 4CW7B 1NKBA 4CGDA 5AQKA 5I3UA 1RT7A 4FPAA 4E89A 4JV5K 2P9PA 2KKZA 2PY5A 1CZ9A 2GEMA 3THXB 1JKHA 2RKIA 1QZ5A 2VQEK 3AVIA 4EP4A 3A8YA 2G8FA 4AHRA 4LH5A 4WQ4A 5JS2A 3UKUA 2KLAA 4CI6A 2W42A 4CGHA 3OJUA 3K57A 5AQTA 3ZETA 5BR8K 4H0TB 2O4GA 4FJ5A 4K25A 1MWKA 4BE1A 3PY8A 2F9TA 4DG1A 1VQNN 2YI1A 1VQON 3HSTB 5F2RA 4DSJA 3OS0A 2O8CB 3V6DA 4CHYA 2QXLA 4KV8A 3ENHA 4DTJA 3VQ7A 2HNDA 3FLCO 1C1BA 3CI5A 3H6EA 4WFNL 2QK9A 3T19A 1IG8A 1Q8IA 3LP3A 3U9ZA 3CCUN 4A57A 3O3GA 2PYJA 2RN2A 4CJRA 2P9NB 2NLXA 1XC3A 3DI6A 2BTFA 1LWEA 1QQNA 3F9MA 3I8BA 2XY5A 2VWKA 3J81O 5SWMA 3OS1A 4PWDA 2E2QA 4M3XA 5DM6L 4O5BA 1ZBHA 3KTQA 3LDOA 5A2QO 1RTIA 4ZTFA 2FBTA 4DTSA 1LV5A 3G4SN 1XNRK 4JKHA 4O44A 2QXFA 3AA3A 1RDBA 4FVUA 4JK7A 2O8BA 3NE6A 3WEEA 3WNFA 3CFPA 2ZD1A 1ZBFA 4B9VA 4NYNA 4BRLA 5I9EB 3PV8A 2WC9A 3DXMB 1CZBA 2F7TA 2OCEA 4WQ4C 1EWRA 2NRWA 1GLDG 1TKXA 2HBMA 3Q7BA 3OS2A 3QBWA 1EETA 2BGGA 1VSEA 4CIFA 4KHQA 2P1JA 2CGKA 3AA2A 1YJ9N 2GV9A 4BREA 1W9HA 3CC2N 3CJCA 2P9UB 2A1RA 1ATSA 3CJ1A 1Q81O 2FLOA 4JKAA 3KLIA 4BROA 5M1FA 4NB4A 3I33A 1L3SA 3DJCA 4A2AA 1GLJO 1ILYA 1SS6A 4BQLA 4E7LA 4B08A 3M8SA 2QWNA 4CJ7A 3D2FA 3THWA 3OTOK 3MX2A 1RGIA 2HHSA 5AQWA 2YNGA 5FRMA 1BQMA 4CFBA 5AQZA 5KRTA 3QEXA 4CD1A 1LAVA 3THYA 2HHQA 4FSVA 3UKRB 1O13A 2BH1A 4CJFA 1SL2A 3RWUA 4CJSA 4EP5A 4CK3A 2CGJA 5AFUA 3CCVN 3ZSWA 4FLVA 2JWKA 3SPZA 3R3LA 4DR3K 1KCFA 5GIOA 1ZBIA 1TKDA 2B6AA 3CJAA 3AO1A 2P9PB 3SJHA 4DFJA 3KKSA 1FW6A 1RTDA 4CBUA 1HKGA 3LP0A 1U49A 1TK5A 1W2BM 4QS7A 1ZYQA 4FJ8A 3G71N 3IG1A 4GVEA 1JL2A 1D8YA 4BE2A 4JI3K 4JNEA 3M8QA 4CGFA 3O1WA 1WN7A 5AZIB 4B1YB 3K5MA 5F1XA 5IT9O 3CETA 3A5OC 3PX0A 3NF7A 3FZHA 3T7ZA 4BR2A 1OH6A 3AVLA 1NLVA 3LPUA 4CJPA 1NK0A 4KH5A 1RT4A 1TKZA 1BL3A 3DRSA 1U4BA 3KK7A 4YHHK 4FLUA 3VMFB 4IZ9A 3K9KA 4IKFA 3MEEA 2Z1HA 3LDPA 3ZT1A 4CGIA 3J80O 4GV9A 3FFKB 3L8BA 5HRNA 4CEAA 3B6OA 3ATUA 1RBRA 4CIEA 4MFBA 3SV3A 4O0JA 2AA4A 2PBDA 3E66A 4BRHA 3QDKA 3QB0A 1T8EA 4W5OA 4HTLA 1NGHA 1NJXA 2HNZA 2EHGA 5AQMA 2HBKA 3SLCA 3I56N 5H1SQ 4H0OA 5AZJA 5JLFA 3OYNA 4BGBA 3ID8A 4WF9L 1IBMK 4B3OA 4CF9A 2ZGZA 1U48A 2QKKA 1HKCA 5J1EA 4Z94A 3W3DA 1WLJA 4CHQA 2VGNA 3FZFA 3V4IA 1NJYA 1RBUA 4CJ5A 4FJMA 3LM2A 3SAFA 3CCRN 1WBBA 3L2WA 3CQYA 3C65A 3VQCA 1DTQA 1WSJA 3NH2A 3K5NA 1W0HA 2KTQA 4EHTA 2GTDA 3ZYYX 3SUOA 4DSEA 5AQIA 4DV3K 4JYAK 1BA1A 3T3FA 4YOUA 1BUPA 2NRVA 3BY5A 5C25A 4KAZA 4MLHA 4CGGA 3VGLA 5AQNA 2QW9A 5AQPA 1IBLK 3O80A 1BWFO 3TABA 3CCLN 2HHUA 2HB5A 1BGXT 4IO8A 3KLGA 4O8UA 4DQIA 4FYDA 1L3VA 3HI0A 4AHCA 4CECA 3KK3A 2O8DA 4J2DA 3QINA 4Y1DA 1K8KA 4KO0A 1UA0A 4DR4K 2O8EB 2WFBA 3IKMA 3ZT2A 4DLEA 1U04A 4DTPA 4CZHA 1HNZK 4B8AB 2P9IB 3CM5A 5AR0A 1TVRA 2XY8A 1T05A 4WQ5C 3NF9A 1BA0A 2E88A 5JVHL 4CBWA 3HPGA 4DU1A 1SL0A 2NNWA 3DRPA 1RT5A 3RMBA 1KVCA 2G8HA 1VQ8N 5KPTA 2XRIA 2FSKA 1JCGA 1QQOA 1Z05A 3VN5A 2P9SA 1T03A 3O4NA 4FJGA 3DLKA 4C8NA 3ATVA 1F21A 4FL9A 4LSLA 1JLQA 3AA5X 4BRKA 3OYFA 5CYQA 1J54A 1QS4A 4IFEA 2IC3A 1TK8A 5ELZA 2W40A 3UE5A 2DFHA 4DS5A 1Z25A 5CZ2A 5HROA 1REVA 2XHBA 1NKEA 2V52B 4NYFA 1IH7A 2W6KA 1X9WA 4B8CA 5E84A 3J7AP 5BR9A 4LFCK 5KGWA 3GG4A 5C42A 4N5SA 4IXCA 2G8IA 1EWQA 2XY6A 1NK4A 1HQUA 4JHDA 3VGMA 1LW2A 1QVFM 4WCEL 4DSFA 1KLNA 2KZMA 4BC5A 1V4SA 5FPEA 3OHRA 3ZLJA 2KFZA 4MDAA 3QEIA 2OTJN 1VHXA 3ZSRA 3K59A 3AVBA 5HBMA 4FM1A 4M3YA 4WE1A 1NMNA 3OYLA 2I7PA 4KKOA 1E3MA 4PUOA 4KREA 3HM9A 3TARA 3H1VX 2HHXA 3NFAA 4TSXA 3CYMA 1P90A 3CF5L 1VSIA 1HJRA 4DHYA 3QIPA 3CJ7A 3IMXA 2P5OA 3CIPA 3OYGA 4CZFA 3M8PA 2G8VA 3TAFA 2V51B 5LMNK 1X1PA 2A40A 2P9LB 1S5JA 1YVNA 1U2VA 1VSHA 3NF6A 5IWAK 4DU3A 3AVKA 1R59O 4LF7K 4H4OA 3NMUA 1RTHA 2I7NA 1HUXA 2WOMA 1M1KO 4E0DA 4DTUA 1J5OA 1YXQA 3AO5A 3V1QA 3AVGA 2F96A 5EVZA 2ZJQL 4CJQA 1ITGA 3MN7A 4NXMK 1RBVA 3CMAN 3L2VA 3EEQA 4KHYA 5BRDA 2O8CA 2E2NA 3HSCA 4CF0A 3K9JA 3VEXA 1KFDA 3AVFA 2NUBA 4JRQA 1I39A 5AQHA 2D0BA 4V19S 3WNHA 5DMRA 3SZ2A 4IFVA 5TKWA 3VF4A 1NOYA 2Z1IA 3P4IA 1Y64A 4LY7A 5JLHA 2OPQA 2X78A 4KTZA 2P9NA 3VQQA 5HL7L 4DV5K 2A1SA 4BRQA
chains in the Genus database with same CATH topology
3IAYA 4IG0A 4Q5VA 3V6DA 4CHYA 3OYCA 3OYHA 3ITHA 4Z4EA 4KV8A 4FLWA 4DTJA 4KPYA 1QSLA 5FRNA 3VQ7A 1TKTA 4OKEA 3ZSOA 4C8OA 1Q9YA 4FK4A 1YTUA 1BIUA 2HNDA 4DMNA 4IDKA 1C1BA 4DF4A 3AVMA 3KK2A 4DF8A 4N41A 1JLFA 1LWFA 1QQCA 2D0CA 3V1OA 1QTMA 2QK9A 2IAJA 3V9XA 3OYMA 1YTAA 3CG7A 1Q8IA 3LP3A 3T19A 1KVBA 1KVAA 3O3GA 3OYEA 2PYJA 2RN2A 4CJRA 4FLTA 2YKMA 4W5TA 3WNGA 4DSKA 4GVMA 1D5AA 3LALA 3DI6A 3OVNA 1RCHA 5E41A 1LWEA 2I5JA 3K5OA 4KHWA 2XY5A 1BIZA 1EXQA 2VWKA 3OS1A 5SWMA 3K5LA 4PWDA 3NGIA 4FZZA 4W5RA 1XC9A 3MXMA 3G0ZA 4E1NA 4M3XA 1S1XA 3KK1A 1UWBA 1GOCA 2X6SA 3HP9A 4O5BA 5HRRA 4CJWA 3KTQA 1ZBHA 3I8DA 3HP6A 3F73A 4B9SA 1X9MA 1RDAA 3MXJA 4FVMA 2HW3A 1RTIA 1ZBLA 4ELVA 3S3MA 2X74A 4DTXA 3AVAA 1UA1A 1N6QA 5KGXA 3JSMA 2FBTA 4ZTFA 4KRFA 3A2FA 1JLBA 1S1VA 3P83D 4DTSA 4CHNA 1LV5A 4F3OA 1VRUA 4OPJA 4CEFA 3DOLA 4CCHA 4O44A 4CJLA 3AVHA 2QXFA 2OYQA 1VSJA 3AA3A 1RDBA 3CFOA 4ID5A 3VQBA 3NE6A 1O1WA 1SV5A 4RW9A 3WNFA 3HPOA 2ZD1A 3CFPA 3V9WA 4B9NA 3HXMA 5J2MA 4FM2A 1ZBFA 3V1RA 4FJLA 4B9VA 4NYNA 4FLYA 3EZ5A 3PV8A 3HYFA 4UQGA 3KLFA 3QNNA 4LH4A 1CZBA 4CJUA 4E7IA 2O4IA 5DK5A 3MAQA 4DFMA 3AO2A 4C8MA 3RMAA 3AVJA 1TKXA 4I2PA 1JXEA 3AO4A 3OS2A 4FK2A 4Z4IA 1EETA 5K14A 2BGGA 4DFPA 1RBTA 1VSEA 4CIFA 1BQNA 4IFYA 3V9SA 4KHQA 5J2PA 2P1JA 2IOCA 3AA2A 1EKEA 2GV9A 4F2RA 3VQAA 2D5RA 3SPYA 1W9HA 3TWHA 3U6FA 2OA8A 3MEDA 1IO2A 4DTMA 4B9LA 2OZMA 2F8SA 1JLGA 1HPZA 3DYAA 2BANA 2A1RA 5KI6A 2FBVA 3KD1E 2VWJA 4DS4A 2ETJA 3KLIA 5SZTA 3HO1A 1T03A 1HMVA 1L3SA 3OJSA 3LZIA 1JLAA 4LSNA 1TGOA 1A5VA 2HVIA 3SQ1A 2HHTA 4AHUA 1RT1A 3HVRA 4E7LA 3NHGA 3ALYA 4B08A 3M8SA 3ULDA 1R0AA 1WSGA 2LSNA 3LP2A 1X9SA 2HHSA 1RT6A 2YNGA 5FRMA 2ATQA 1BQMA 5CYMA 3VA3A 4Z4FA 4CFBA 5KRTA 3QEXA 3S3OA 4KB1A 1LAVA 3SNNA 2JGUA 4Z4HA 2HHQA 2IGIA 2KZZA 1RNHA 2EX3A 3D45A 3C95A 2YNHA 3P1GA 4CJFA 1SL2A 3RWUA 1T7PA 4GMJB 4CJSA 3NDKA 4EP5A 4CK3A 3L2RA 4BWMA 4RW6A 4CK2A 2RPIA 3PX4A 4HHTA 1FKOA 1WSEA 1VK0A 4PA1A 3ZSWA 4CERA 4FLVA 3V81A 4CF8A 3SPZA 4CIGA 1B9FA 1KCFA 2F8TA 1XHZA 3VQEA 3NH0A 1QE1A 3G10A 3ZCMA 4OLBA 1ASWA 1ZBIA 4PY5A 1IKYA 2HHWA 3OY9A 1IKWA 1WAJA 3VQDA 4W5QA 4HUEA 2VG7A 4ZTJA 4F8RA 1TKDA 2B6AA 1CXUA 3QIOA 2RF2A 3AO1A 3QESA 1U47A 1JXBA 4BDPA 3AA4A 3TAPA 4FK0A 1TV6A 4DFJA 2BDPA 4KTQA 3KKSA 1RT2A 4DFKA 1RTDA 1ASVA 1RT3A 1HYSA 1L3UA 4KAZA 4F3TA 1B92A 3LP0A 3NH1A 1U49A 3RR8A 2WONA 4H8KA 4CE9A 1NK5A 2Q3SA 3C6UA 4FCYA 1TK5A 4OVLA 1ZYQA 4FJ8A 3PO4A 3DLHA 3IG1A 3VQ8A 3RMDA 3VQPA 3LAKA 1WSIA 5C24A 1JL2A 3U3YA 3I0SA 3OYIA 4RW4A 4LD0A 4BDYA 1D8YA 4BE2A 4CHZA 3MECA 1QSYA 4IG3A 4FZYA 1S6QA 4DTRA 3KLHA 1RILA 3M8QA 4AILC 4RG8A 4FW2A 4CGFA 4CF1A 2Y1IA 1C6VA 1WN7A 1YVUA 1C0UA 3OYDA 3K5MA 4QAGA 4CJVA 1B9DA 3TR8A 3PX0A 3NF7A 4I2QA 4CJTA 3C94A 1VSMA 3TAGA 3AVLA 2DFFA 2FBYA 3LWMA 3LPUA 3HJFA 4CJPA 4Z4GA 4CFDA 1NK0A 1SKSA 1RT4A 1TKZA 1JLEA 4KB0A 4DSLA 1BL3A 1Z26A 3EYZA 2PZSA 5EU7A 1GOAA 3ZSYA 3DRSA 3MXIA 1U4BA 4M3RA 3F9KA 4FLUA 4CJ4A 4BWJA 2PYLA 4FJNA 4Z4CA 3FFIA 1DTTA 3SV4A 4IKFA 3MEEA 2Z1HA 4CGIA 3ZT1A 3S3NA 1S1WA 4MQ3A 4M45A 2BE2A 3L8BA 5HRNA 2XY7A 3DLRA 4CEAA 1S1TA 3LPTA 2P51A 2AJQA 3B6OA 1RBRA 4KHNA 4CIEA 4MFBA 1XWLA 4JS4A 1FKPA 4KFBA 3SV3A 4L8RB 2DFEA 1S1UA 3JYTA 4NCBA 3VQ6A 2HNYA 3AVNA 4O55A 3EY1A 4BE0A 1KSPA 4J2EA 4O0JA 1RDCA 4HCBA 1T8EA 2DTUA 2B4JA 3KJVA 4CJKA 4W5OA 1SUQA 1NJXA 2HNZA 2EHGA 1KFSA 4CGJA 1D9DA 1TAQA 4FLZA 3BGRA 5J2QA 4M3TA 1RTJA 4CFCA 4QOZB 2HHVA 4N56A 3OYNA 4ELUA 3SUNA 1IKVA 5KRSA 4OGEA 3V9ZA 4CFAA 1CLQA 4B3OA 4Y1CA 4CF9A 3TAQA 1QSSA 5CY4A 4DSIA 4H4MA 4E7HA 4N76A 4DQSA 1U48A 5FDLA 3PX6A 1BISA 4KHUA 4I9LA 4E19A 2QKKA 3TAMA 5J1EA 1WLJA 1BHLA 1LW0A 3QNOA 1FXXA 2G8UA 4E3SA 4CHQA 4CK1A 5HP1A 4YNQA 5HLFA 3TAEA 4CJ3A 4FZXC 3V4IA 1NJYA 1RBUA 4CJ5A 3LZJA 4JS5A 4FJMA 4RW8A 1HYVA 3P5JA 5FROA 4DQPA 2GUIA 3L2WA 4CJEA 3U3GA 3TANA 4IBNA 3VQCA 4K8ZA 1DTQA 4ELTA 2YNFA 1WSJA 4HUFA 1C1AA 2E6MA 3RMCA 1NK9A 1L5UA 3NH2A 5T7BA 3K5NA 4FJIA 1W0HA 2OPSA 3CM6A 2KTQA 1WNSA 3SUOA 4DSEA 3E01A 2OPRA 4KHSA 2FC0A 3SQ4A 2P5GA 4Z0UA 3T3FA 1VSKA 1J53A 4YFUA 1VSFA 3DRRA 1LAWA 3SQ0A 3HVTA 5C25A 1S9EA 4OKJA 2E4LA 4DTOA 4DTNA 4CGGA 3ZSQA 4B9MA 3QLHA 3ZSVA 4AHSA 4HVJA 3RR7A 3OYBA 1EP4A 1A5XA 4CEEA 1TK0A 3TABA 1CXQA 3LANA 3O3HA 3QERA 1Q9XA 2HHUA 2HB5A 5HRPA 1BGXT 1HNVA 4J2AA 3KLGA 4DQIA 4FYDA 4QCLA 1L3VA 4CECA 4AHCA 4KTWA 2HMIA 3KK3A 4CEOA 4BACA 4EZ6A 1TL3A 4CEQA 4FJJA 2YHAA 3QINA 4J2DA 4OGCA 4Y1DA 3LWLA 1S9GA 2B5JA 1WSHA 3KIOA 3CFRA 1K6YA 3VQ5A 4KO0A 3LDSA 2IS3A 1UA0A 4M42A 3ZT2A 1XI1A 1TL1A 4DLEA 1IKXA 1U04A 4DTPA 4B9TA 3L2UA 1KRPA 3O4QA 1HQEA 4B8AB 3CM5A 3NGZA 1L3TA 4EZ9A 3IS9A 3CQ8A 3L3VA 1TVRA 2XY8A 1T05A 1VSLA 3NF9A 4M41A 4BDZA 3SQ2A 4HTUA 1IG9A 1NOZA 1MU2A 3HPHA 3M8RA 3LAMA 3DM2A 3HPGA 3QO9A 4N47A 1I3AA 4DU1A 3AVCA 4E7JA 3DLEA 1TAUA 1Y97A 3QEVA 1SL0A 4FJ7A 3DRPA 1SL1A 1RT5A 2Z1JA 3T1AA 1GOBA 2OPPA 4FLXA 3RMBA 1KVCA 2JLEA 4ID1A 2ZQBA 4FJHA 1C1CA 2G8HA 4E7KA 1SKWA 4E1MA 2XRIA 3C6TA 4FXDA 3VN5A 1BI4A 1VRTA 3THVA 1NJZA 1YT3A 3O4NA 3ZSZA 3DLKA 4C8NA 4XIUA 4CEDA 4FM0A 4FJGA 4OLAA 5KTQA 5I42A 3B6PA 3ZSXA 3SUPA 1F21A 2ZE2A 4DWIA 4LSLA 1JLQA 3SYZA 4FJXA 2YV0X 3AA5X 2FBXA 2KQ2A 2QKBA 3QEWA 3OYFA 3K2PA 3HK2A 5CYQA 1J54A 1QS4A 1XHXA 1C0TA 1HNIA 4R5PA 3WNEA 3DLGA 4DQQA 2IC3A 3S9HA 4HCCA 4Q0BA 1TK8A 4C8LA 1A5WA 2DFHA 1RBSA 3VA0A 4DS5A 5D3GA 3SUQA 1QHTA 4HUGA 1Z25A 5CZ2A 4DQRA 1REVA 1BI4B 2XHBA 3ZT0A 5HROA 1NKEA 1SKRA 4K8XA 4M3ZA 3DMJA 2G8KA 4NYFA 3SI6A 1IH7A 3IRXA 4M3UA 1X9WA 1HYZA 4B8CA 4G1QA 2KFNA 3NBPA 5KGWA 3RRHA 3NAEA 5C42A 4N5SA 3SJJA 4JLHA 2G8IA 3SCXA 4W5NA 3TI0A 2YNIA 1J9AA 2E6LA 5J2NA 2XY6A 4CHOA 1NK4A 1HQUA 4FJKA 4CHPA 2VG6A 3PUFA 1UAXA 1LW2A 3MEGA 3ZT4A 4JRPA 1RDDA 4DSFA 1KLNA 3LP1A 3ZT3A 4NCAA 4M3WA 2KZMA 1FK9A 4AH9A 2XO7A 3L2QA 4I9QA 2KFZA 4OJRA 3QEIA 3ZSRA 3K59A 3AVBA 5HBMA 1HRHA 1JLCA 3OYKA 4FM1A 4I7FA 4ICLA 4M3YA 2X6NA 4WE1A 1VSDA 3DLBA 2KW4A 4FW1A 3OYLA 4O4GA 4CEZA 2OZSA 4F4KA 3KKRA 3AV9A 1WAFA 4KKOA 4AHVA 3D0PA 4PUOA 4KREA 3HM9A 3TARA 2HHXA 3NFAA 4ZHRA 2Y1JA 4O0IA 4TSXA 4OKKA 3CYMA 4KI6A 2GBZA 2R7YA 2DY4A 3DOKA 4C8KA 1NK7A 1VSIA 1HJRA 2P5OA 1BCOA 3QIPA 2YKNA 3BDPA 1UOCA 3ASMA 4RW7A 4DU4A 3QEPA 2Z1GA 4F2SA 1KLMA 3OYAA 3K58A 2YHBA 2IDOA 5CZ1A 3HL8A 3OYGA 5HRSA 4AHTA 3M8PA 3QETA 1NKBA 2G8VA 3TAFA 1X1PA 4CGDA 3NCIA 1JL1A 1G15A 1LWCA 1S5JA 1VSHA 3NF6A 4DU3A 4KI4A 3AVKA 2HVHA 3VQ4A 1D9FA 1EX4A 4H4OA 3RRGA 5I3UA 1RT7A 1NK6A 3UIQA 1RTHA 2G8WA 1BCMA 1NK8A 2WOMA 4E89A 3PO5A 1DLOA 4E0DA 3AO3A 4DTUA 2PY5A 1J5OA 3L3UA 1CZ9A 4CESA 1JKHA 3AO5A 3V1QA 3AVGA 2F96A 2RKIA 1S6PA 3KLEA 4CJQA 1ITGA 3AVIA 4PQUA 1RBVA 2ITGA 3ISNC 4GW6A 3NGYA 4EP4A 3H08A 4CF2A 3L2VA 3I0RA 2G8FA 4KHYA 3KD5E 4AHRA 4OPKA 4LH5A 4CF0A 1ASUA 5JS2A 3V9UA 1KFDA 4J2BA 2W42A 4CGHA 3AVFA 3OJUA 3VQ9A 3K57A 2VG5A 3RTVA 2NUBA 4B9UA 5JS1A 4JRQA 1N5YA 1I39A 3NF8A 2D0BA 4NCGA 2O4GA 3WNHA 5DMRA 4CEBA 3HT3A 4IFVA 4BE1A 3SZ2A 4FJ5A 1U45A 4FJ9A 3PY8A 1NOYA 2Z1IA 4LY7A 1KTQA 2OPQA 4DG1A 2X78A 3O3FA 1NJWA 1NKCA 1C0MA 1WSFA 4KTZA 4DLGA 1ZBUA 2D0AA 3HSTB 3VQQA 4DSJA 3OS0A 2A1SA 3OYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IAY A;  4IG0 A;  4Q5V A;  3V6D A;  4CHY A;  3OYC A;  3OYH A;  3ITH A;  4Z4E A;  4KV8 A;  4FLW A;  4DTJ A;  4KPY A;  1QSL A;  5FRN A;  3VQ7 A;  1TKT A;  4OKE A;  3ZSO A;  4C8O A;  1Q9Y A;  4FK4 A;  1YTU A;  1BIU A;  2HND A;  4DMN A;  4IDK A;  1C1B A;  4DF4 A;  3AVM A;  3KK2 A;  4DF8 A;  4N41 A;  1JLF A;  1LWF A;  1QQC A;  2D0C A;  3V1O A;  1QTM A;  2QK9 A;  2IAJ A;  3V9X A;  3OYM A;  1YTA A;  3CG7 A;  1Q8I A;  3LP3 A;  3T19 A;  1KVB A;  1KVA A;  3O3G A;  3OYE A;  2PYJ A;  2RN2 A;  4CJR A;  4FLT A;  2YKM A;  4W5T A;  3WNG A;  4DSK A;  4GVM A;  1D5A A;  3LAL A;  3DI6 A;  3OVN A;  1RCH A;  5E41 A;  1LWE A;  2I5J A;  3K5O A;  4KHW A;  2XY5 A;  1BIZ A;  1EXQ A;  2VWK A;  3OS1 A;  5SWM A;  3K5L A;  4PWD A;  3NGI A;  4FZZ A;  4W5R A;  1XC9 A;  3MXM A;  3G0Z A;  4E1N A;  4M3X A;  1S1X A;  3KK1 A;  1UWB A;  1GOC A;  2X6S A;  3HP9 A;  4O5B A;  5HRR A;  4CJW A;  3KTQ A;  1ZBH A;  3I8D A;  3HP6 A;  3F73 A;  4B9S A;  1X9M A;  1RDA A;  3MXJ A;  4FVM A;  2HW3 A;  1RTI A;  1ZBL A;  4ELV A;  3S3M A;  2X74 A;  4DTX A;  3AVA A;  1UA1 A;  1N6Q A;  5KGX A;  3JSM A;  2FBT A;  4ZTF A;  4KRF A;  3A2F A;  1JLB A;  1S1V A;  3P83 D;  4DTS A;  4CHN A;  1LV5 A;  4F3O A;  1VRU A;  4OPJ A;  4CEF A;  3DOL A;  4CCH A;  4O44 A;  4CJL A;  3AVH A;  2QXF A;  2OYQ A;  1VSJ A;  3AA3 A;  1RDB A;  3CFO A;  4ID5 A;  3VQB A;  3NE6 A;  1O1W A;  1SV5 A;  4RW9 A;  3WNF A;  3HPO A;  2ZD1 A;  3CFP A;  3V9W A;  4B9N A;  3HXM A;  5J2M A;  4FM2 A;  1ZBF A;  3V1R A;  4FJL A;  4B9V A;  4NYN A;  4FLY A;  3EZ5 A;  3PV8 A;  3HYF A;  4UQG A;  3KLF A;  3QNN A;  4LH4 A;  1CZB A;  4CJU A;  4E7I A;  2O4I A;  5DK5 A;  3MAQ A;  4DFM A;  3AO2 A;  4C8M A;  3RMA A;  3AVJ A;  1TKX A;  4I2P A;  1JXE A;  3AO4 A;  3OS2 A;  4FK2 A;  4Z4I A;  1EET A;  5K14 A;  2BGG A;  4DFP A;  1RBT A;  1VSE A;  4CIF A;  1BQN A;  4IFY A;  3V9S A;  4KHQ A;  5J2P A;  2P1J A;  2IOC A;  3AA2 A;  1EKE A;  2GV9 A;  4F2R A;  3VQA A;  2D5R A;  3SPY A;  1W9H A;  3TWH A;  3U6F A;  2OA8 A;  3MED A;  1IO2 A;  4DTM A;  4B9L A;  2OZM A;  2F8S A;  1JLG A;  1HPZ A;  3DYA A;  2BAN A;  2A1R A;  5KI6 A;  2FBV A;  3KD1 E;  2VWJ A;  4DS4 A;  2ETJ A;  3KLI A;  5SZT A;  3HO1 A;  1T03 A;  1HMV A;  1L3S A;  3OJS A;  3LZI A;  1JLA A;  4LSN A;  1TGO A;  1A5V A;  2HVI A;  3SQ1 A;  2HHT A;  4AHU A;  1RT1 A;  3HVR A;  4E7L A;  3NHG A;  3ALY A;  4B08 A;  3M8S A;  3ULD A;  1R0A A;  1WSG A;  2LSN A;  3LP2 A;  1X9S A;  2HHS A;  1RT6 A;  2YNG A;  5FRM A;  2ATQ A;  1BQM A;  5CYM A;  3VA3 A;  4Z4F A;  4CFB A;  5KRT A;  3QEX A;  3S3O A;  4KB1 A;  1LAV A;  3SNN A;  2JGU A;  4Z4H A;  2HHQ A;  2IGI A;  2KZZ A;  1RNH A;  2EX3 A;  3D45 A;  3C95 A;  2YNH A;  3P1G A;  4CJF A;  1SL2 A;  3RWU A;  1T7P A;  4GMJ B;  4CJS A;  3NDK A;  4EP5 A;  4CK3 A;  3L2R A;  4BWM A;  4RW6 A;  4CK2 A;  2RPI A;  3PX4 A;  4HHT A;  1FKO A;  1WSE A;  1VK0 A;  4PA1 A;  3ZSW A;  4CER A;  4FLV A;  3V81 A;  4CF8 A;  3SPZ A;  4CIG A;  1B9F A;  1KCF A;  2F8T A;  1XHZ A;  3VQE A;  3NH0 A;  1QE1 A;  3G10 A;  3ZCM A;  4OLB A;  1ASW A;  1ZBI A;  4PY5 A;  1IKY A;  2HHW A;  3OY9 A;  1IKW A;  1WAJ A;  3VQD A;  4W5Q A;  4HUE A;  2VG7 A;  4ZTJ A;  4F8R A;  1TKD A;  2B6A A;  1CXU A;  3QIO A;  2RF2 A;  3AO1 A;  3QES A;  1U47 A;  1JXB A;  4BDP A;  3AA4 A;  3TAP A;  4FK0 A;  1TV6 A;  4DFJ A;  2BDP A;  4KTQ A;  3KKS A;  1RT2 A;  4DFK A;  1RTD A;  1ASV A;  1RT3 A;  1HYS A;  1L3U A;  4KAZ A;  4F3T A;  1B92 A;  3LP0 A;  3NH1 A;  1U49 A;  3RR8 A;  2WON A;  4H8K A;  4CE9 A;  1NK5 A;  2Q3S A;  3C6U A;  4FCY A;  1TK5 A;  4OVL A;  1ZYQ A;  4FJ8 A;  3PO4 A;  3DLH A;  3IG1 A;  3VQ8 A;  3RMD A;  3VQP A;  3LAK A;  1WSI A;  5C24 A;  1JL2 A;  3U3Y A;  3I0S A;  3OYI A;  4RW4 A;  4LD0 A;  4BDY A;  1D8Y A;  4BE2 A;  4CHZ A;  3MEC A;  1QSY A;  4IG3 A;  4FZY A;  1S6Q A;  4DTR A;  3KLH A;  1RIL A;  3M8Q A;  4AIL C;  4RG8 A;  4FW2 A;  4CGF A;  4CF1 A;  2Y1I A;  1C6V A;  1WN7 A;  1YVU A;  1C0U A;  3OYD A;  3K5M A;  4QAG A;  4CJV A;  1B9D A;  3TR8 A;  3PX0 A;  3NF7 A;  4I2Q A;  4CJT A;  3C94 A;  1VSM A;  3TAG A;  3AVL A;  2DFF A;  2FBY A;  3LWM A;  3LPU A;  3HJF A;  4CJP A;  4Z4G A;  4CFD A;  1NK0 A;  1SKS A;  1RT4 A;  1TKZ A;  1JLE A;  4KB0 A;  4DSL A;  1BL3 A;  1Z26 A;  3EYZ A;  2PZS A;  5EU7 A;  1GOA A;  3ZSY A;  3DRS A;  3MXI A;  1U4B A;  4M3R A;  3F9K A;  4FLU A;  4CJ4 A;  4BWJ A;  2PYL A;  4FJN A;  4Z4C A;  3FFI A;  1DTT A;  3SV4 A;  4IKF A;  3MEE A;  2Z1H A;  4CGI A;  3ZT1 A;  3S3N A;  1S1W A;  4MQ3 A;  4M45 A;  2BE2 A;  3L8B A;  5HRN A;  2XY7 A;  3DLR A;  4CEA A;  1S1T A;  3LPT A;  2P51 A;  2AJQ A;  3B6O A;  1RBR A;  4KHN A;  4CIE A;  4MFB A;  1XWL A;  4JS4 A;  1FKP A;  4KFB A;  3SV3 A;  4L8R B;  2DFE A;  1S1U A;  3JYT A;  4NCB A;  3VQ6 A;  2HNY A;  3AVN A;  4O55 A;  3EY1 A;  4BE0 A;  1KSP A;  4J2E A;  4O0J A;  1RDC A;  4HCB A;  1T8E A;  2DTU A;  2B4J A;  3KJV A;  4CJK A;  4W5O A;  1SUQ A;  1NJX A;  2HNZ A;  2EHG A;  1KFS A;  4CGJ A;  1D9D A;  1TAQ A;  4FLZ A;  3BGR A;  5J2Q A;  4M3T A;  1RTJ A;  4CFC A;  4QOZ B;  2HHV A;  4N56 A;  3OYN A;  4ELU A;  3SUN A;  1IKV A;  5KRS A;  4OGE A;  3V9Z A;  4CFA A;  1CLQ A;  4B3O A;  4Y1C A;  4CF9 A;  3TAQ A;  1QSS A;  5CY4 A;  4DSI A;  4H4M A;  4E7H A;  4N76 A;  4DQS A;  1U48 A;  5FDL A;  3PX6 A;  1BIS A;  4KHU A;  4I9L A;  4E19 A;  2QKK A;  3TAM A;  5J1E A;  1WLJ A;  1BHL A;  1LW0 A;  3QNO A;  1FXX A;  2G8U A;  4E3S A;  4CHQ A;  4CK1 A;  5HP1 A;  4YNQ A;  5HLF A;  3TAE A;  4CJ3 A;  4FZX C;  3V4I A;  1NJY A;  1RBU A;  4CJ5 A;  3LZJ A;  4JS5 A;  4FJM A;  4RW8 A;  1HYV A;  3P5J A;  5FRO A;  4DQP A;  2GUI A;  3L2W A;  4CJE A;  3U3G A;  3TAN A;  4IBN A;  3VQC A;  4K8Z A;  1DTQ A;  4ELT A;  2YNF A;  1WSJ A;  4HUF A;  1C1A A;  2E6M A;  3RMC A;  1NK9 A;  1L5U A;  3NH2 A;  5T7B A;  3K5N A;  4FJI A;  1W0H A;  2OPS A;  3CM6 A;  2KTQ A;  1WNS A;  3SUO A;  4DSE A;  3E01 A;  2OPR A;  4KHS A;  2FC0 A;  3SQ4 A;  2P5G A;  4Z0U A;  3T3F A;  1VSK A;  1J53 A;  4YFU A;  1VSF A;  3DRR A;  1LAW A;  3SQ0 A;  3HVT A;  5C25 A;  1S9E A;  4OKJ A;  2E4L A;  4DTO A;  4DTN A;  4CGG A;  3ZSQ A;  4B9M A;  3QLH A;  3ZSV A;  4AHS A;  4HVJ A;  3RR7 A;  3OYB A;  1EP4 A;  1A5X A;  4CEE A;  1TK0 A;  3TAB A;  1CXQ A;  3LAN A;  3O3H A;  3QER A;  1Q9X A;  2HHU A;  2HB5 A;  5HRP A;  1BGX T;  1HNV A;  4J2A A;  3KLG A;  4DQI A;  4FYD A;  4QCL A;  1L3V A;  4CEC A;  4AHC A;  4KTW A;  2HMI A;  3KK3 A;  4CEO A;  4BAC A;  4EZ6 A;  1TL3 A;  4CEQ A;  4FJJ A;  2YHA A;  3QIN A;  4J2D A;  4OGC A;  4Y1D A;  3LWL A;  1S9G A;  2B5J A;  1WSH A;  3KIO A;  3CFR A;  1K6Y A;  3VQ5 A;  4KO0 A;  3LDS A;  2IS3 A;  1UA0 A;  4M42 A;  3ZT2 A;  1XI1 A;  1TL1 A;  4DLE A;  1IKX A;  1U04 A;  4DTP A;  4B9T A;  3L2U A;  1KRP A;  3O4Q A;  1HQE A;  4B8A B;  3CM5 A;  3NGZ A;  1L3T A;  4EZ9 A;  3IS9 A;  3CQ8 A;  3L3V A;  1TVR A;  2XY8 A;  1T05 A;  1VSL A;  3NF9 A;  4M41 A;  4BDZ A;  3SQ2 A;  4HTU A;  1IG9 A;  1NOZ A;  1MU2 A;  3HPH A;  3M8R A;  3LAM A;  3DM2 A;  3HPG A;  3QO9 A;  4N47 A;  1I3A A;  4DU1 A;  3AVC A;  4E7J A;  3DLE A;  1TAU A;  1Y97 A;  3QEV A;  1SL0 A;  4FJ7 A;  3DRP A;  1SL1 A;  1RT5 A;  2Z1J A;  3T1A A;  1GOB A;  2OPP A;  4FLX A;  3RMB A;  1KVC A;  2JLE A;  4ID1 A;  2ZQB A;  4FJH A;  1C1C A;  2G8H A;  4E7K A;  1SKW A;  4E1M A;  2XRI A;  3C6T A;  4FXD A;  3VN5 A;  1BI4 A;  1VRT A;  3THV A;  1NJZ A;  1YT3 A;  3O4N A;  3ZSZ A;  3DLK A;  4C8N A;  4XIU A;  4CED A;  4FM0 A;  4FJG A;  4OLA A;  5KTQ A;  5I42 A;  3B6P A;  3ZSX A;  3SUP A;  1F21 A;  2ZE2 A;  4DWI A;  4LSL A;  1JLQ A;  3SYZ A;  4FJX A;  2YV0 X;  3AA5 X;  2FBX A;  2KQ2 A;  2QKB A;  3QEW A;  3OYF A;  3K2P A;  3HK2 A;  5CYQ A;  1J54 A;  1QS4 A;  1XHX A;  1C0T A;  1HNI A;  4R5P A;  3WNE A;  3DLG A;  4DQQ A;  2IC3 A;  3S9H A;  4HCC A;  4Q0B A;  1TK8 A;  4C8L A;  1A5W A;  2DFH A;  1RBS A;  3VA0 A;  4DS5 A;  5D3G A;  3SUQ A;  1QHT A;  4HUG A;  1Z25 A;  5CZ2 A;  4DQR A;  1REV A;  1BI4 B;  2XHB A;  3ZT0 A;  5HRO A;  1NKE A;  1SKR A;  4K8X A;  4M3Z A;  3DMJ A;  2G8K A;  4NYF A;  3SI6 A;  1IH7 A;  3IRX A;  4M3U A;  1X9W A;  1HYZ A;  4B8C A;  4G1Q A;  2KFN A;  3NBP A;  5KGW A;  3RRH A;  3NAE A;  5C42 A;  4N5S A;  3SJJ A;  4JLH A;  2G8I A;  3SCX A;  4W5N A;  3TI0 A;  2YNI A;  1J9A A;  2E6L A;  5J2N A;  2XY6 A;  4CHO A;  1NK4 A;  1HQU A;  4FJK A;  4CHP A;  2VG6 A;  3PUF A;  1UAX A;  1LW2 A;  3MEG A;  3ZT4 A;  4JRP A;  1RDD A;  4DSF A;  1KLN A;  3LP1 A;  3ZT3 A;  4NCA A;  4M3W A;  2KZM A;  1FK9 A;  4AH9 A;  2XO7 A;  3L2Q A;  4I9Q A;  2KFZ A;  4OJR A;  3QEI A;  3ZSR A;  3K59 A;  3AVB A;  5HBM A;  1HRH A;  1JLC A;  3OYK A;  4FM1 A;  4I7F A;  4ICL A;  4M3Y A;  2X6N A;  4WE1 A;  1VSD A;  3DLB A;  2KW4 A;  4FW1 A;  3OYL A;  4O4G A;  4CEZ A;  2OZS A;  4F4K A;  3KKR A;  3AV9 A;  1WAF A;  4KKO A;  4AHV A;  3D0P A;  4PUO A;  4KRE A;  3HM9 A;  3TAR A;  2HHX A;  3NFA A;  4ZHR A;  2Y1J A;  4O0I A;  4TSX A;  4OKK A;  3CYM A;  4KI6 A;  2GBZ A;  2R7Y A;  2DY4 A;  3DOK A;  4C8K A;  1NK7 A;  1VSI A;  1HJR A;  2P5O A;  1BCO A;  3QIP A;  2YKN A;  3BDP A;  1UOC A;  3ASM A;  4RW7 A;  4DU4 A;  3QEP A;  2Z1G A;  4F2S A;  1KLM A;  3OYA A;  3K58 A;  2YHB A;  2IDO A;  5CZ1 A;  3HL8 A;  3OYG A;  5HRS A;  4AHT A;  3M8P A;  3QET A;  1NKB A;  2G8V A;  3TAF A;  1X1P A;  4CGD A;  3NCI A;  1JL1 A;  1G15 A;  1LWC A;  1S5J A;  1VSH A;  3NF6 A;  4DU3 A;  4KI4 A;  3AVK A;  2HVH A;  3VQ4 A;  1D9F A;  1EX4 A;  4H4O A;  3RRG A;  5I3U A;  1RT7 A;  1NK6 A;  3UIQ A;  1RTH A;  2G8W A;  1BCM A;  1NK8 A;  2WOM A;  4E89 A;  3PO5 A;  1DLO A;  4E0D A;  3AO3 A;  4DTU A;  2PY5 A;  1J5O A;  3L3U A;  1CZ9 A;  4CES A;  1JKH A;  3AO5 A;  3V1Q A;  3AVG A;  2F96 A;  2RKI A;  1S6P A;  3KLE A;  4CJQ A;  1ITG A;  3AVI A;  4PQU A;  1RBV A;  2ITG A;  3ISN C;  4GW6 A;  3NGY A;  4EP4 A;  3H08 A;  4CF2 A;  3L2V A;  3I0R A;  2G8F A;  4KHY A;  3KD5 E;  4AHR A;  4OPK A;  4LH5 A;  4CF0 A;  1ASU A;  5JS2 A;  3V9U A;  1KFD A;  4J2B A;  2W42 A;  4CGH A;  3AVF A;  3OJU A;  3VQ9 A;  3K57 A;  2VG5 A;  3RTV A;  2NUB A;  4B9U A;  5JS1 A;  4JRQ A;  1N5Y A;  1I39 A;  3NF8 A;  2D0B A;  4NCG A;  2O4G A;  3WNH A;  5DMR A;  4CEB A;  3HT3 A;  4IFV A;  4BE1 A;  3SZ2 A;  4FJ5 A;  1U45 A;  4FJ9 A;  3PY8 A;  1NOY A;  2Z1I A;  4LY7 A;  1KTQ A;  2OPQ A;  4DG1 A;  2X78 A;  3O3F A;  1NJW A;  1NKC A;  1C0M A;  1WSF A;  4KTZ A;  4DLG A;  1ZBU A;  2D0A A;  3HST B;  3VQQ A;  4DSJ A;  3OS0 A;  2A1S A;  3OYJ A; 
#chains in the Genus database with same CATH topology
 4H0P A;  3D2E B;  4F9O A;  5JMV A;  5FRN A;  3AAR A;  4C8O A;  1YIT N;  3AY9 A;  4FK4 A;  1NG9 A;  4JI5 K;  1BIU A;  3LDQ A;  1QQC A;  4MDB A;  3V1O A;  2IAJ A;  3V9X A;  3A0I X;  3PIO L;  3OYE A;  2QWO A;  4DSK A;  1GLA G;  2Q0U A;  1D5A A;  3OVN A;  4KHW A;  2D1K A;  1BIZ A;  2FSJ A;  2QWP A;  1XC9 A;  3G0Z A;  3MX5 A;  3KK1 A;  2X6S A;  2P9S B;  4JEP A;  4L3Q A;  3I8D A;  3HP6 A;  3F73 A;  4CD3 A;  4B9S A;  3DXM A;  3MXJ A;  2HW3 A;  3VTH A;  5M1O A;  4DTX A;  1UA1 A;  1N6Q A;  5KGX A;  3JSM A;  1TUY A;  1JLB A;  3P83 D;  4F3O A;  4CHN A;  3DOL A;  2IVN A;  2OYQ A;  3VQB A;  1O1W A;  1SV5 A;  4MO4 A;  4BR5 A;  3HPO A;  2P9U A;  4FJL A;  4DR6 K;  4NO7 A;  3WXJ A;  3ENO A;  1QVG M;  1E4F T;  2NRT A;  4K41 A;  3AVJ A;  5FPN A;  4I2P A;  1DKG D;  3E9P A;  4Z4I A;  4DFP A;  1BQN A;  4IFY A;  2IOC A;  1EKE A;  3ZX2 A;  3TWH A;  3U6F A;  4R79 A;  4BRP A;  1P8Z A;  2OZM A;  1JLG A;  3DYA A;  4KH6 A;  2BAN A;  5KI6 A;  3WUH A;  4QS9 A;  4CZE A;  4JI2 K;  3UKR A;  2ETJ A;  3HO1 A;  3R8E A;  1JLA A;  3O08 A;  4LSN A;  1TGO A;  1A5V A;  3J7Z O;  3SQ1 A;  1RT1 A;  3NHG A;  3ULD A;  2CGL A;  5GAD P;  2V7Z A;  1EO1 A;  1WSG A;  2YHX A;  2IVP A;  3VTI A;  3VEN A;  2VWB A;  3VA3 A;  3MCP A;  5FLX O;  3SNN A;  2JGU A;  4Z4H A;  5AQV A;  3O9S A;  1RDU A;  1RNH A;  2EX3 A;  3P1G A;  1MA9 B;  3FZL A;  4GMJ B;  3L2R A;  1HJO A;  4FWK A;  2HBL A;  4CK2 A;  2RPI A;  4HHT A;  1WSE A;  4X66 K;  1B9F A;  1U2V B;  2KFN A;  3NH0 A;  1QE1 A;  1OVQ A;  1ASW A;  4PY5 A;  3VQD A;  4F8R A;  3CCJ N;  4ZTJ A;  4PL7 A;  1CXU A;  4FK0 A;  3AA4 A;  4DV0 K;  1HNW K;  4KTQ A;  1RT2 A;  5AQR A;  1B92 A;  5AZI A;  4H5N A;  2E5L K;  4H8K A;  4CE9 A;  1NK5 A;  5BPN A;  2Q3S A;  1ZBS A;  4IWV A;  4FCY A;  4OVL A;  1TYQ B;  3PO4 A;  4CBX A;  3VQ8 A;  1NGG A;  3OYI A;  3T1Y K;  3MEC A;  4FZY A;  3DLL L;  3NVK A;  4GV3 A;  1J6Z A;  3SAH A;  3TSQ A;  4CF1 A;  4GV6 A;  1YVU A;  1ATR A;  5GIP A;  2QWR A;  4JKC A;  4BC4 A;  2DFF A;  3CME N;  3LWM A;  4DUZ K;  2D0O A;  2Q36 A;  4KB0 A;  3MXI A;  4FPB A;  4EFH A;  1HX1 A;  4M7X A;  4CJ4 A;  4BWJ A;  2PYL A;  4FJN A;  4Z4C A;  1DTT A;  3SV4 A;  4ILH A;  3NVM A;  5KPZ A;  1DT9 A;  4YOW A;  4H5T A;  1VQ7 N;  3VF6 A;  3BP8 A;  3HRG A;  1S1U A;  3JYT A;  3EY1 A;  3OW2 M;  4DKW A;  1KSP A;  1GLB G;  4J2E A;  2VGM A;  4M63 C;  2NRX A;  3KJV A;  4CJK A;  1NGJ A;  3CPW M;  1D9D A;  4M3T A;  1RTJ A;  1DGK N;  3O5B A;  3H3N O;  5KRS A;  1MDU B;  5GAG P;  5AQO A;  1QSS A;  1N33 K;  4DSI A;  5KQ8 A;  4E7H A;  4DQS A;  4G9Z A;  1MWM A;  4I9L A;  2NRZ A;  1BHL A;  4CK1 A;  5HP1 A;  4YNQ A;  4CJ3 A;  1W7A A;  2WBN A;  4RW8 A;  1GLE G;  3P5J A;  5M1N A;  4JI4 K;  1KAY A;  4IBN A;  4BRA A;  4ELT A;  2YNF A;  3SMP A;  3RMC A;  1NK9 A;  2Q0R A;  2ZM6 K;  3GOI A;  3L0Q A;  2VQF K;  4FJI A;  2E1Z A;  1NBW A;  4A5A A;  3E01 A;  2OPR A;  3CHW A;  4FWL A;  5JIC A;  4EHU A;  2P5G A;  5C2D A;  5ADX A;  3DRR A;  4RWT A;  1LAW A;  2O8E A;  2E4L A;  4DTO A;  3ZSV A;  4JAX A;  3RR7 A;  3ZEU B;  2P9I A;  4CEE A;  1CXQ A;  3QER A;  1Q9X A;  3CCM N;  4QCL A;  4YOR A;  4A5B A;  4FJJ A;  3VEO A;  2YHA A;  4OGC A;  1S9G A;  1X3M A;  3WQT A;  3O4Q A;  1VQL N;  3NGZ A;  3WXL A;  3IS9 A;  5AQL A;  3VES A;  4HTU A;  1IG9 A;  3E1Y A;  3HPH A;  1X9J A;  1VQ4 N;  3QO9 A;  4IO9 L;  4E7J A;  4DV6 K;  1TAU A;  1Y97 A;  1SL1 A;  4DV7 K;  2Z1J A;  3T1A A;  1SKW A;  1XUP O;  2O8F B;  3SBG A;  3O9R A;  1SZ2 A;  3EL2 A;  2FXU A;  4KRF A;  1NGB A;  1VRT A;  5I42 A;  3SUP A;  1TUU A;  5LJV A;  2FBX A;  3QEW A;  3HK2 A;  5AQQ A;  1HNI A;  2E1Y A;  3S9H A;  4HCC A;  3CCQ N;  4YDU A;  3B8A X;  4BG8 A;  1A5W A;  4ISG A;  1RBS A;  3IDH A;  4BRD A;  3VA0 A;  3TTC A;  3SUQ A;  4K8X A;  1BI4 B;  3ZT0 A;  4M3Z A;  4DB3 A;  4E1J A;  4M3U A;  3RVC A;  1HYZ A;  3BF1 A;  4G1Q A;  4GKK K;  3CQX A;  3NBP A;  4UY8 O;  3NAE A;  4WQ5 A;  4W5N A;  1BO5 O;  4CHO A;  3MEG A;  4DR5 K;  1N34 K;  1FK9 A;  4AH9 A;  1G99 A;  1ESV A;  3CXC M;  4OJR A;  2PAV A;  4Y0W A;  1HRH A;  1VSD A;  2RE2 A;  4FW1 A;  2OZS A;  3KKR A;  3AV9 A;  3D0P A;  3L4Q A;  1N8R O;  2P9L A;  1WOQ A;  4O0I A;  4JI8 K;  4OKK A;  1BCO A;  2YJE A;  1S3X A;  3IUC A;  3ASM A;  4RW7 A;  4I6M A;  1OKJ A;  3QEP A;  3TSP A;  1KLM A;  2E20 A;  3OYA A;  3HZ6 A;  2IDO A;  2YHB A;  3CPE A;  1WB9 A;  5HOO A;  4PHT X;  2QWM A;  3NCI A;  1JL1 A;  1LWC A;  4GKJ K;  5KPR A;  1D9F A;  1EX4 A;  1NK6 A;  3UIQ A;  2G8W A;  1BCM A;  4B3R K;  1VAZ A;  1DLO A;  3CJ9 A;  3AO3 A;  1IV0 A;  2HST A;  4CES A;  4YDU C;  3KLE A;  1D4X A;  4PQU A;  3R1X A;  2ITG A;  4CF2 A;  3H08 A;  1I94 K;  3I0R A;  1WUA A;  3D2E A;  3MMV A;  4OPK A;  3PLA A;  2HMP A;  1ASU A;  3V9U A;  3QFU A;  4J2B A;  4B9U A;  3WXI A;  2D4W A;  3VQ9 A;  3RTV A;  3NF8 A;  5AQX A;  5AQU A;  3T69 A;  3BF3 A;  1QHA A;  4CEB A;  3HT3 A;  4ISE A;  4XH4 A;  3H46 O;  3SAG A;  4BRC A;  5AJ3 K;  3CJB A;  1NKC A;  4DLG A;  1Q7Y O;  4E3S A;  5AQY A;  3U8X A;  4JKF A;  4Q5V A;  1NMD A;  4Z4E A;  2NRH A;  1QSL A;  1BDG A;  5GIN A;  1TKT A;  4OKE A;  3C7N B;  4CZM A;  4FWR A;  4JD2 B;  3AVM A;  5BRF A;  3KK2 A;  4DF4 A;  4N41 A;  1JLF A;  2D0C A;  3OYM A;  3HOT A;  5E26 A;  4GVM A;  3LAL A;  1RCH A;  5E41 A;  3S41 A;  1OVY A;  1EXQ A;  3AAQ A;  1J5E K;  3K5L A;  3AGR A;  5CHI A;  4FZZ A;  4W5R A;  1XMO K;  3MXM A;  3A5M C;  4E1N A;  4EAH D;  3U9D A;  1S1X A;  1UWB A;  3E9O A;  4ILJ A;  2GWK A;  3MK6 A;  1ZBL A;  3S3M A;  2X74 A;  3AVA A;  2ZJP L;  3LL3 A;  4FWM A;  1S1V A;  3WXM B;  2HF4 A;  3EZW A;  4OPJ A;  4CEF A;  4CCH A;  3F5T A;  3AVH A;  2E8A A;  4ILG B;  3CFO A;  5AQS A;  4RW9 A;  1NM1 A;  4A62 A;  5LY3 A;  5J2M A;  4FM2 A;  2ASP A;  3V1R A;  1WBD A;  3HYF A;  4E7I A;  2O4I A;  5DK5 A;  3MAQ A;  4DFM A;  3AO2 A;  3CER A;  4C8M A;  4BR9 A;  3RMA A;  3PIP L;  4FK2 A;  3AO4 A;  1NGC A;  3DXK B;  4DV1 K;  5J2P A;  4F2R A;  4CZL A;  3SPY A;  1YJW N;  1VQK N;  2Q1N A;  2QWQ A;  1NGF A;  4DTM A;  4B9L A;  1W97 L;  2EWS A;  4XEI A;  2F8S A;  4U67 L;  2UXB K;  2FBV A;  3R6M A;  3TSU A;  4DR2 K;  2VWJ A;  1DEJ A;  1HMV A;  3EKS A;  3GBT A;  4BRN A;  4U7B A;  3LZI A;  1LOT B;  2HVI A;  2HHT A;  4AHU A;  2FSN A;  1VQ5 N;  3VGK A;  2QEX N;  1JCE A;  1T6C A;  1RT6 A;  5CYM A;  3UB5 A;  4Z4F A;  3SK3 A;  4IOC L;  5CE3 A;  2KZZ A;  2IGI A;  4I6M B;  4X62 K;  3ULE B;  1E4G T;  1T7P A;  3NDK A;  5BPM A;  3D6R A;  4BWM A;  1RDW X;  2YCH A;  1VK0 A;  4PA1 A;  4CF8 A;  4OPA A;  3VF2 A;  1U6Z A;  1TYQ A;  4CIG A;  2F8T A;  1XHZ A;  3VQE A;  3G10 A;  3ZCM A;  1IKY A;  3OY9 A;  1IKW A;  1WAJ A;  4JKG B;  4W5Q A;  2VG7 A;  4K42 A;  3QIO A;  3QES A;  3TAP A;  1TV6 A;  3JXU A;  1OH7 A;  4DFK A;  1RT3 A;  3VEY A;  3K0S A;  1L3U A;  1XMQ K;  3NH1 A;  3RR8 A;  4DR1 K;  3VET A;  3OBW A;  3WQU A;  5AFU H;  1BG3 A;  4AQY K;  1WSI A;  5C24 A;  3U3Y A;  1NGD A;  1FJG K;  1QSY A;  3C6A A;  4IG3 A;  4DTR A;  3GE1 A;  1ZC6 A;  1K8A O;  4BVO A;  4WFB L;  4FW2 A;  1C6V A;  2UXD K;  3OYD A;  1Z6R A;  4QAG A;  4CJV A;  3TR8 A;  4I2Q A;  3TAG A;  2AP1 A;  2FBY A;  4YOT A;  2UUA K;  3G25 A;  1T3V A;  1KAX A;  4Z4G A;  4CFD A;  3PSF A;  4PKH A;  1SKS A;  4BVP A;  1JLE A;  4DSL A;  5EU7 A;  2E2P A;  3ZSY A;  1YIJ N;  3F9K A;  1C0G A;  3FFI A;  4AM7 A;  4CZJ A;  3S3N A;  2BE2 A;  2XY7 A;  3O9T A;  2A5X A;  4NLC A;  4KHN A;  3M3Z A;  1XWL A;  3QIC A;  1FKP A;  4KFB A;  4L8R B;  2DFE A;  4BE0 A;  2HNY A;  4O55 A;  3EE8 A;  4HCB A;  5BN9 A;  4XH1 A;  4IEI A;  3D7E O;  4GY2 B;  3H1Q A;  1SUQ A;  2HBJ A;  3DWL A;  4CGJ A;  4FLZ A;  3BGR A;  1V4T A;  5J2Q A;  2UXC K;  5FPM A;  4A2B A;  2GWJ A;  5C15 A;  3P39 A;  4ELU A;  4JKE A;  1IKV A;  3H45 C;  4H5V A;  2NRR A;  4JK9 A;  3WXK A;  4CFA A;  3V9Z A;  2F4V K;  4Y1C A;  3TAQ A;  1C0F A;  4IJN A;  1Q82 O;  2CH6 A;  4H4M A;  4N76 A;  5FDL A;  3PX6 A;  1BIS A;  4KHU A;  4E19 A;  3TAM A;  2H3G X;  4BRI A;  3JAM O;  2Q97 A;  4H5R A;  1FXX A;  3BZC A;  2G8U A;  3VEV A;  3MWP A;  5HLF A;  3TAE A;  4FZX C;  4JS5 A;  4PL8 A;  4H0V B;  5FRO A;  4LFA K;  4BR4 A;  2GUI A;  3VOV A;  3TAN A;  3ZEU A;  4K8Z A;  1XNQ K;  4HUF A;  1C1A A;  2E6M A;  1VQ9 N;  1BU6 O;  2Q31 A;  3MCA B;  2ZWH A;  3O1B A;  2FF3 B;  1WNS A;  2ZGY A;  3SQ4 A;  1VSK A;  1ATN A;  4YFU A;  1VSF A;  3SQ0 A;  3HVT A;  1S9E A;  2IVO A;  4OKJ A;  4B9M A;  4DTN A;  3ZSQ A;  1BOT O;  2PFU A;  3QLH A;  4FWQ A;  4AHS A;  4JN4 A;  4FWN A;  3OYB A;  1EP4 A;  1A5X A;  1TK0 A;  3GL1 A;  3M1F A;  1JCF A;  3LAN A;  5HRP A;  3W0L A;  4EIA A;  4J2A A;  2GEL A;  3GDQ A;  4FO0 A;  1KQS M;  3ID6 A;  1VQM N;  4CEO A;  4EZ6 A;  1TL3 A;  3CFR A;  1WSH A;  2ASO A;  3KIO A;  1K6Y A;  2ZF5 O;  3LDS A;  2IS3 A;  1XI1 A;  1IKX A;  4B9T A;  1KRP A;  4DQ8 A;  1L3T A;  2O8F A;  1NU0 A;  3KWI A;  4M41 A;  3SQ2 A;  3KHY A;  1NOZ A;  1YF5 L;  3M8R A;  3LAM A;  2UU9 K;  4LF6 K;  5TKY A;  4N47 A;  2YX6 A;  1I3A A;  3M6G A;  2A42 A;  3DLE A;  4LF9 K;  2A3Z A;  4FJ7 A;  4PKG A;  4FLX A;  1GOB A;  2OPP A;  1Q18 A;  4ID1 A;  2W41 A;  2ZQB A;  3MN5 A;  1C1C A;  4E7K A;  4FXD A;  1BI4 A;  1KAZ A;  4OLA A;  4XIU A;  5KTQ A;  1N36 K;  3ZSX A;  2ZE2 A;  3SYZ A;  4OO1 J;  4JI0 K;  2KQ2 A;  5EX5 A;  4CVN E;  3KWG A;  3K2P A;  1OH5 A;  1XHX A;  1C0T A;  3DLG A;  3E9L A;  4Q0B A;  2A41 A;  3CC4 N;  5D3G A;  1QHT A;  4HUG A;  3R9P A;  1SKR A;  3JS6 A;  3SI6 A;  3IRX A;  3QML A;  2QTD A;  1YAG A;  2P9K B;  4MO5 A;  2E2O A;  3C6H A;  3RRH A;  3SJJ A;  3BEX A;  3TI0 A;  2YNI A;  1J9A A;  4H0Y B;  3SBT A;  4FJK A;  2VYP A;  4FWS A;  4CHP A;  2VG6 A;  3PUF A;  3T1H K;  1UAX A;  4JRP A;  1RDD A;  2XO7 A;  3L2Q A;  3SMS A;  2HF3 A;  3OYK A;  1JLC A;  2X6N A;  2KW4 A;  4O4G A;  4CEZ A;  4O5F A;  1HLU A;  4DUY K;  4F4K A;  1WAF A;  4IOX A;  4J8F A;  4ZHR A;  2Y1J A;  5JVG L;  3VEW A;  5LJW A;  1NNE A;  3CD6 N;  2YKN A;  1UOC A;  3ZX3 A;  3K58 A;  5HRS A;  3QET A;  1KD1 O;  1Q86 O;  1G15 A;  4O8K A;  1NGE A;  4HWI A;  4KI4 A;  2HVH A;  3VQ4 A;  3MDQ A;  3RRG A;  5EY4 A;  4B1X B;  4X64 K;  1NK8 A;  3PO5 A;  3QFP A;  1GLF O;  4BY9 C;  3L3U A;  4BRF A;  5BN8 A;  1HPM A;  5AQG A;  4IOA L;  1S6P A;  4DCH A;  4BR7 A;  3ISN C;  4GW6 A;  3NGY A;  5B8H A;  1K73 O;  3KD5 E;  3O4W A;  2QA4 N;  4CZG A;  2OTL N;  5C2F A;  1HKB A;  2VG5 A;  5JS1 A;  3C7N A;  1N5Y A;  4YOV A;  4NCG A;  4JD2 A;  2CH5 A;  1U45 A;  4B3M K;  4FJ9 A;  4FOE A;  2UUB K;  1N32 K;  1KTQ A;  3O3F A;  1NJW A;  1C0M A;  1WSF A;  1ZBU A;  2D0A A;  3KVG A;  3OYJ A;  1NGI A;  3IAY A;  2ITM A;  3LDL A;  4IG0 A;  4B3S K;  3OYC A;  3OYH A;  3ITH A;  1VQ6 N;  5EOY A;  4FLW A;  3UKU B;  2YHY A;  4KPY A;  1SQK A;  3ZSO A;  1Q9Y A;  3ZET B;  1YTU A;  1T44 A;  4DMN A;  3L6Q A;  4IDK A;  3HOS A;  4DF8 A;  1LWF A;  1QTM A;  3MN6 A;  2W6L A;  1YTA A;  3CG7 A;  5M1K A;  1KVB A;  1KVA A;  3F2K A;  4FLT A;  2YKM A;  4W5T A;  3WNG A;  2UUC K;  4B9Q A;  1H1V A;  3CCE N;  2I5J A;  3K5O A;  4JI6 K;  3I55 N;  4BR0 A;  3NGI A;  3U4L A;  4M7Y A;  1GOC A;  3HP9 A;  3DAW A;  4CJW A;  5HRR A;  5C10 A;  1X9M A;  1RDA A;  4FVM A;  4IEE A;  4ELV A;  4C1N K;  1HR0 K;  3CC7 N;  3A2F A;  2FF6 A;  5GAH P;  3VEZ A;  1VRU A;  3DXK A;  3A5N C;  4CJL A;  3IFR A;  1VSJ A;  4ID5 A;  3C0B A;  4B9N A;  3V9W A;  3BZK A;  3HXM A;  1IBK K;  4A59 A;  4DV2 K;  4FLY A;  3EZ5 A;  4UQG A;  1RFQ A;  3KLF A;  3QNN A;  4LH4 A;  4CJU A;  3EO3 A;  1JXE A;  4H5W A;  5K14 A;  1RBT A;  3V9S A;  5BPL A;  3VQA A;  2D5R A;  4WFA L;  2O8B B;  2OA8 A;  3MED A;  3WEE B;  4FOI A;  1IO2 A;  1HPZ A;  2WTU A;  4C1N I;  3KD1 E;  2NZT A;  4DS4 A;  4BC3 A;  1T6D A;  4C23 A;  5SZT A;  3ULE A;  3OJS A;  2OAN A;  4H03 B;  3HVR A;  5DM7 L;  2WUS A;  3ALY A;  5BRE A;  1YI2 N;  4JI7 K;  1R0A A;  1YUW A;  3AGK A;  2LSN A;  3LP2 A;  1X9S A;  5MLC Q;  3H3O B;  2ATQ A;  1ZXO A;  4JKG A;  1NJI O;  4KB1 A;  3S3O A;  2Q2R A;  4JKB A;  4LF5 K;  3D45 A;  3C95 A;  2YNH A;  5M1Q A;  5GAE P;  3ZX0 A;  4RW6 A;  3PX4 A;  1FKO A;  4CER A;  4B1V A;  3V81 A;  4KHP K;  5CR4 A;  2D0P A;  3D2F B;  3THW B;  4OLB A;  4YOX A;  2HHW A;  2QI2 A;  4DV4 K;  5LL6 Z;  4HUE A;  1YHQ N;  3THY B;  2RF2 A;  1U47 A;  4BDP A;  1JXB A;  4BRG A;  2BDP A;  3FE1 A;  1ASV A;  3LM9 A;  1HYS A;  4F3T A;  1GLL O;  4A61 A;  2WON A;  3C6U A;  4KBO A;  4AF1 A;  3TTD A;  3M5R A;  3DLH A;  4DR7 K;  3RMD A;  3VQP A;  4OPH A;  3LAK A;  4YOY A;  4JI1 K;  2DPN A;  3I0S A;  2QM1 A;  4RW4 A;  4LD0 A;  3VER A;  4BDY A;  4CHZ A;  3AAP A;  1HNX K;  1S6Q A;  3KLH A;  1RIL A;  4B1U B;  4AIL C;  4RG8 A;  2Y1I A;  1C0U A;  4ISF A;  1B9D A;  3LDN A;  4CJT A;  1YJN N;  3C94 A;  1VSM A;  3HTV A;  4K0K K;  1JJ2 M;  4OX9 K;  3HJF A;  4BQZ A;  1S22 A;  3EN9 A;  1NGA A;  1Z26 A;  3EYZ A;  2PZS A;  1GOA A;  3EE9 A;  4M3R A;  1X3N A;  5AQF A;  2HOE A;  1QZ6 A;  1S1W A;  2F9W A;  4MQ3 A;  4M45 A;  3DLR A;  1S1T A;  3LPT A;  2P51 A;  2AJQ A;  4MLE A;  4JS4 A;  3G6E N;  3VQ6 A;  3AVN A;  5FPD A;  2IIR A;  4B1W B;  1RDC A;  2GUP A;  3RSE A;  2DTU A;  2B4J A;  1EQY A;  4BGA A;  1KFS A;  1TAQ A;  3P31 A;  4CFC A;  3FR0 A;  3FZM A;  4LC9 B;  4QOZ B;  2HHV A;  1SAZ A;  3J8A A;  4N56 A;  3MN9 A;  3SUN A;  3BUZ B;  4OGE A;  3N4Q A;  1CLQ A;  3A5L C;  1KXP A;  3VPZ A;  5CY4 A;  1S72 N;  2YHW A;  4B3T K;  1GLC G;  1LW0 A;  3QNO A;  5AZJ B;  4GNI A;  3LZJ A;  1HYV A;  2VCP A;  3MWT A;  4CJE A;  3U3G A;  4JKD A;  5C0Y A;  1L5U A;  1LCU A;  5T7B A;  2OPS A;  2GX9 A;  3CM6 A;  3THX A;  3O9U A;  4KHS A;  4KH4 A;  2FC0 A;  3TPQ A;  4Z0U A;  3FZK A;  1J53 A;  5M1P A;  1NWK A;  4HVJ A;  4X65 K;  1K9M O;  2ASM A;  3N4P A;  2JWL A;  3O3H A;  1HNV A;  1OH8 A;  3OBY A;  5LMU K;  3HBT A;  2ZJR L;  2UYT A;  4KTW A;  2HMI A;  4BAC A;  4CEQ A;  3O8M A;  3LWL A;  5EXW A;  2B5J A;  4K43 A;  4B1Z A;  4M42 A;  3VQ5 A;  5ADX H;  4FWP A;  4LFB K;  1TL1 A;  3FGU A;  4PKI A;  3L2U A;  1HQE A;  2RHK A;  5BRH A;  4EZ9 A;  4LF4 K;  3CQ8 A;  3L3V A;  1VSL A;  4BDZ A;  4AM6 A;  1MU2 A;  3DM2 A;  2O8D B;  3AVC A;  2YJF A;  1M90 O;  4YY3 K;  1K8K B;  3OA9 A;  3QEV A;  3WT0 A;  3KZB A;  2HHH K;  2JLE A;  4FJH A;  4BRM A;  4CZI A;  3L4I A;  3P38 A;  4E1M A;  3CCS N;  3EKU A;  3C6T A;  3THV A;  4DQP A;  1NJZ A;  1YT3 A;  3ZSZ A;  2KHO A;  4CED A;  4FM0 A;  3ENB A;  3B6P A;  2P9K A;  4DWI A;  2V7Y A;  4FJX A;  2YV0 X;  3HM8 A;  2QKB A;  3O6W A;  4IDH A;  4NCB A;  4R5P A;  2J4R A;  3WNE A;  4DQQ A;  4LF8 K;  4C8L A;  1QQM A;  4DQR A;  4NXN K;  3Q7C A;  3DMJ A;  2G8K A;  4JK8 A;  4CZK A;  4JLH A;  3SCX A;  4WYB A;  2E6L A;  5J2N A;  5KQD A;  3ZT4 A;  3J7Y P;  4NCA A;  3LP1 A;  3ZT3 A;  1XQS C;  4M3W A;  4RTF D;  3RSE B;  4I9Q A;  4NLB A;  4I7F A;  4ICL A;  4QS8 A;  3DLB A;  1VQP N;  4AHV A;  4XH5 A;  4JHD B;  4IJA A;  1IJJ A;  4KI6 A;  2GBZ A;  2R7Y A;  2DY4 A;  4BC2 A;  3DOK A;  4C8K A;  2A6A A;  1NK7 A;  5AQJ A;  5C12 A;  3BDP A;  3PSI A;  2BUP A;  4DU4 A;  2QWL A;  4H0X B;  4BG9 A;  5F0X A;  2Z1G A;  4F2S A;  1CZA N;  3TTF A;  1KC8 O;  4FWO A;  3O9Q A;  3QBX A;  5CZ1 A;  3HL8 A;  4RCH A;  3TU5 A;  4AHT A;  4CW7 B;  1NKB A;  4CGD A;  5AQK A;  5I3U A;  1RT7 A;  4FPA A;  4E89 A;  4JV5 K;  2P9P A;  2KKZ A;  2PY5 A;  1CZ9 A;  2GEM A;  3THX B;  1JKH A;  2RKI A;  1QZ5 A;  2VQE K;  3AVI A;  4EP4 A;  3A8Y A;  2G8F A;  4AHR A;  4LH5 A;  4WQ4 A;  5JS2 A;  3UKU A;  2KLA A;  4CI6 A;  2W42 A;  4CGH A;  3OJU A;  3K57 A;  5AQT A;  3ZET A;  5BR8 K;  4H0T B;  2O4G A;  4FJ5 A;  4K25 A;  1MWK A;  4BE1 A;  3PY8 A;  2F9T A;  4DG1 A;  1VQN N;  2YI1 A;  1VQO N;  3HST B;  5F2R A;  4DSJ A;  3OS0 A;  2O8C B;  3V6D A;  4CHY A;  2QXL A;  4KV8 A;  3ENH A;  4DTJ A;  3VQ7 A;  2HND A;  3FLC O;  1C1B A;  3CI5 A;  3H6E A;  4WFN L;  2QK9 A;  3T19 A;  1IG8 A;  1Q8I A;  3LP3 A;  3U9Z A;  3CCU N;  4A57 A;  3O3G A;  2PYJ A;  2RN2 A;  4CJR A;  2P9N B;  2NLX A;  1XC3 A;  3DI6 A;  2BTF A;  1LWE A;  1QQN A;  3F9M A;  3I8B A;  2XY5 A;  2VWK A;  3J81 O;  5SWM A;  3OS1 A;  4PWD A;  2E2Q A;  4M3X A;  5DM6 L;  4O5B A;  1ZBH A;  3KTQ A;  3LDO A;  5A2Q O;  1RTI A;  4ZTF A;  2FBT A;  4DTS A;  1LV5 A;  3G4S N;  1XNR K;  4JKH A;  4O44 A;  2QXF A;  3AA3 A;  1RDB A;  4FVU A;  4JK7 A;  2O8B A;  3NE6 A;  3WEE A;  3WNF A;  3CFP A;  2ZD1 A;  1ZBF A;  4B9V A;  4NYN A;  4BRL A;  5I9E B;  3PV8 A;  2WC9 A;  3DXM B;  1CZB A;  2F7T A;  2OCE A;  4WQ4 C;  1EWR A;  2NRW A;  1GLD G;  1TKX A;  2HBM A;  3Q7B A;  3OS2 A;  3QBW A;  1EET A;  2BGG A;  1VSE A;  4CIF A;  4KHQ A;  2P1J A;  2CGK A;  3AA2 A;  1YJ9 N;  2GV9 A;  4BRE A;  1W9H A;  3CC2 N;  3CJC A;  2P9U B;  2A1R A;  1ATS A;  3CJ1 A;  1Q81 O;  2FLO A;  4JKA A;  3KLI A;  4BRO A;  5M1F A;  4NB4 A;  3I33 A;  1L3S A;  3DJC A;  4A2A A;  1GLJ O;  1ILY A;  1SS6 A;  4BQL A;  4E7L A;  4B08 A;  3M8S A;  2QWN A;  4CJ7 A;  3D2F A;  3THW A;  3OTO K;  3MX2 A;  1RGI A;  2HHS A;  5AQW A;  2YNG A;  5FRM A;  1BQM A;  4CFB A;  5AQZ A;  5KRT A;  3QEX A;  4CD1 A;  1LAV A;  3THY A;  2HHQ A;  4FSV A;  3UKR B;  1O13 A;  2BH1 A;  4CJF A;  1SL2 A;  3RWU A;  4CJS A;  4EP5 A;  4CK3 A;  2CGJ A;  5AFU A;  3CCV N;  3ZSW A;  4FLV A;  2JWK A;  3SPZ A;  3R3L A;  4DR3 K;  1KCF A;  5GIO A;  1ZBI A;  1TKD A;  2B6A A;  3CJA A;  3AO1 A;  2P9P B;  3SJH A;  4DFJ A;  3KKS A;  1FW6 A;  1RTD A;  4CBU A;  1HKG A;  3LP0 A;  1U49 A;  1TK5 A;  1W2B M;  4QS7 A;  1ZYQ A;  4FJ8 A;  3G71 N;  3IG1 A;  4GVE A;  1JL2 A;  1D8Y A;  4BE2 A;  4JI3 K;  4JNE A;  3M8Q A;  4CGF A;  3O1W A;  1WN7 A;  5AZI B;  4B1Y B;  3K5M A;  5F1X A;  5IT9 O;  3CET A;  3A5O C;  3PX0 A;  3NF7 A;  3FZH A;  3T7Z A;  4BR2 A;  1OH6 A;  3AVL A;  1NLV A;  3LPU A;  4CJP A;  1NK0 A;  4KH5 A;  1RT4 A;  1TKZ A;  1BL3 A;  3DRS A;  1U4B A;  3KK7 A;  4YHH K;  4FLU A;  3VMF B;  4IZ9 A;  3K9K A;  4IKF A;  3MEE A;  2Z1H A;  3LDP A;  3ZT1 A;  4CGI A;  3J80 O;  4GV9 A;  3FFK B;  3L8B A;  5HRN A;  4CEA A;  3B6O A;  3ATU A;  1RBR A;  4CIE A;  4MFB A;  3SV3 A;  4O0J A;  2AA4 A;  2PBD A;  3E66 A;  4BRH A;  3QDK A;  3QB0 A;  1T8E A;  4W5O A;  4HTL A;  1NGH A;  1NJX A;  2HNZ A;  2EHG A;  5AQM A;  2HBK A;  3SLC A;  3I56 N;  5H1S Q;  4H0O A;  5AZJ A;  5JLF A;  3OYN A;  4BGB A;  3ID8 A;  4WF9 L;  1IBM K;  4B3O A;  4CF9 A;  2ZGZ A;  1U48 A;  2QKK A;  1HKC A;  5J1E A;  4Z94 A;  3W3D A;  1WLJ A;  4CHQ A;  2VGN A;  3FZF A;  3V4I A;  1NJY A;  1RBU A;  4CJ5 A;  4FJM A;  3LM2 A;  3SAF A;  3CCR N;  1WBB A;  3L2W A;  3CQY A;  3C65 A;  3VQC A;  1DTQ A;  1WSJ A;  3NH2 A;  3K5N A;  1W0H A;  2KTQ A;  4EHT A;  2GTD A;  3ZYY X;  3SUO A;  4DSE A;  5AQI A;  4DV3 K;  4JYA K;  1BA1 A;  3T3F A;  4YOU A;  1BUP A;  2NRV A;  3BY5 A;  5C25 A;  4KAZ A;  4MLH A;  4CGG A;  3VGL A;  5AQN A;  2QW9 A;  5AQP A;  1IBL K;  3O80 A;  1BWF O;  3TAB A;  3CCL N;  2HHU A;  2HB5 A;  1BGX T;  4IO8 A;  3KLG A;  4O8U A;  4DQI A;  4FYD A;  1L3V A;  3HI0 A;  4AHC A;  4CEC A;  3KK3 A;  2O8D A;  4J2D A;  3QIN A;  4Y1D A;  1K8K A;  4KO0 A;  1UA0 A;  4DR4 K;  2O8E B;  2WFB A;  3IKM A;  3ZT2 A;  4DLE A;  1U04 A;  4DTP A;  4CZH A;  1HNZ K;  4B8A B;  2P9I B;  3CM5 A;  5AR0 A;  1TVR A;  2XY8 A;  1T05 A;  4WQ5 C;  3NF9 A;  1BA0 A;  2E88 A;  5JVH L;  4CBW A;  3HPG A;  4DU1 A;  1SL0 A;  2NNW A;  3DRP A;  1RT5 A;  3RMB A;  1KVC A;  2G8H A;  1VQ8 N;  5KPT A;  2XRI A;  2FSK A;  1JCG A;  1QQO A;  1Z05 A;  3VN5 A;  2P9S A;  1T03 A;  3O4N A;  4FJG A;  3DLK A;  4C8N A;  3ATV A;  1F21 A;  4FL9 A;  4LSL A;  1JLQ A;  3AA5 X;  4BRK A;  3OYF A;  5CYQ A;  1J54 A;  1QS4 A;  4IFE A;  2IC3 A;  1TK8 A;  5ELZ A;  2W40 A;  3UE5 A;  2DFH A;  4DS5 A;  1Z25 A;  5CZ2 A;  5HRO A;  1REV A;  2XHB A;  1NKE A;  2V52 B;  4NYF A;  1IH7 A;  2W6K A;  1X9W A;  4B8C A;  5E84 A;  3J7A P;  5BR9 A;  4LFC K;  5KGW A;  3GG4 A;  5C42 A;  4N5S A;  4IXC A;  2G8I A;  1EWQ A;  2XY6 A;  1NK4 A;  1HQU A;  4JHD A;  3VGM A;  1LW2 A;  1QVF M;  4WCE L;  4DSF A;  1KLN A;  2KZM A;  4BC5 A;  1V4S A;  5FPE A;  3OHR A;  3ZLJ A;  2KFZ A;  4MDA A;  3QEI A;  2OTJ N;  1VHX A;  3ZSR A;  3K59 A;  3AVB A;  5HBM A;  4FM1 A;  4M3Y A;  4WE1 A;  1NMN A;  3OYL A;  2I7P A;  4KKO A;  1E3M A;  4PUO A;  4KRE A;  3HM9 A;  3TAR A;  3H1V X;  2HHX A;  3NFA A;  4TSX A;  3CYM A;  1P90 A;  3CF5 L;  1VSI A;  1HJR A;  4DHY A;  3QIP A;  3CJ7 A;  3IMX A;  2P5O A;  3CIP A;  3OYG A;  4CZF A;  3M8P A;  2G8V A;  3TAF A;  2V51 B;  5LMN K;  1X1P A;  2A40 A;  2P9L B;  1S5J A;  1YVN A;  1U2V A;  1VSH A;  3NF6 A;  5IWA K;  4DU3 A;  3AVK A;  1R59 O;  4LF7 K;  4H4O A;  3NMU A;  1RTH A;  2I7N A;  1HUX A;  2WOM A;  1M1K O;  4E0D A;  4DTU A;  1J5O A;  1YXQ A;  3AO5 A;  3V1Q A;  3AVG A;  2F96 A;  5EVZ A;  2ZJQ L;  4CJQ A;  1ITG A;  3MN7 A;  4NXM K;  1RBV A;  3CMA N;  3L2V A;  3EEQ A;  4KHY A;  5BRD A;  2O8C A;  2E2N A;  3HSC A;  4CF0 A;  3K9J A;  3VEX A;  1KFD A;  3AVF A;  2NUB A;  4JRQ A;  1I39 A;  5AQH A;  2D0B A;  4V19 S;  3WNH A;  5DMR A;  3SZ2 A;  4IFV A;  5TKW A;  3VF4 A;  1NOY A;  2Z1I A;  3P4I A;  1Y64 A;  4LY7 A;  5JLH A;  2OPQ A;  2X78 A;  4KTZ A;  2P9N A;  3VQQ A;  5HL7 L;  4DV5 K;  2A1S A;  4BRQ A; 
#chains in the Genus database with same CATH homology
 3IAY A;  4IG0 A;  4Q5V A;  3V6D A;  4CHY A;  3OYC A;  3OYH A;  3ITH A;  4Z4E A;  4KV8 A;  4FLW A;  4DTJ A;  4KPY A;  1QSL A;  5FRN A;  3VQ7 A;  1TKT A;  4OKE A;  3ZSO A;  4C8O A;  1Q9Y A;  4FK4 A;  1YTU A;  1BIU A;  2HND A;  4DMN A;  4IDK A;  1C1B A;  4DF4 A;  3AVM A;  3KK2 A;  4DF8 A;  4N41 A;  1JLF A;  1LWF A;  1QQC A;  2D0C A;  3V1O A;  1QTM A;  2QK9 A;  2IAJ A;  3V9X A;  3OYM A;  1YTA A;  3CG7 A;  1Q8I A;  3LP3 A;  3T19 A;  1KVB A;  1KVA A;  3O3G A;  3OYE A;  2PYJ A;  2RN2 A;  4CJR A;  4FLT A;  2YKM A;  4W5T A;  3WNG A;  4DSK A;  4GVM A;  1D5A A;  3LAL A;  3DI6 A;  3OVN A;  1RCH A;  5E41 A;  1LWE A;  2I5J A;  3K5O A;  4KHW A;  2XY5 A;  1BIZ A;  1EXQ A;  2VWK A;  3OS1 A;  5SWM A;  3K5L A;  4PWD A;  3NGI A;  4FZZ A;  4W5R A;  1XC9 A;  3MXM A;  3G0Z A;  4E1N A;  4M3X A;  1S1X A;  3KK1 A;  1UWB A;  1GOC A;  2X6S A;  3HP9 A;  4O5B A;  5HRR A;  4CJW A;  3KTQ A;  1ZBH A;  3I8D A;  3HP6 A;  3F73 A;  4B9S A;  1X9M A;  1RDA A;  3MXJ A;  4FVM A;  2HW3 A;  1RTI A;  1ZBL A;  4ELV A;  3S3M A;  2X74 A;  4DTX A;  3AVA A;  1UA1 A;  1N6Q A;  5KGX A;  3JSM A;  2FBT A;  4ZTF A;  4KRF A;  3A2F A;  1JLB A;  1S1V A;  3P83 D;  4DTS A;  4CHN A;  1LV5 A;  4F3O A;  1VRU A;  4OPJ A;  4CEF A;  3DOL A;  4CCH A;  4O44 A;  4CJL A;  3AVH A;  2QXF A;  2OYQ A;  1VSJ A;  3AA3 A;  1RDB A;  3CFO A;  4ID5 A;  3VQB A;  3NE6 A;  1O1W A;  1SV5 A;  4RW9 A;  3WNF A;  3HPO A;  2ZD1 A;  3CFP A;  3V9W A;  4B9N A;  3HXM A;  5J2M A;  4FM2 A;  1ZBF A;  3V1R A;  4FJL A;  4B9V A;  4NYN A;  4FLY A;  3EZ5 A;  3PV8 A;  3HYF A;  4UQG A;  3KLF A;  3QNN A;  4LH4 A;  1CZB A;  4CJU A;  4E7I A;  2O4I A;  5DK5 A;  3MAQ A;  4DFM A;  3AO2 A;  4C8M A;  3RMA A;  3AVJ A;  1TKX A;  4I2P A;  1JXE A;  3AO4 A;  3OS2 A;  4FK2 A;  4Z4I A;  1EET A;  5K14 A;  2BGG A;  4DFP A;  1RBT A;  1VSE A;  4CIF A;  1BQN A;  4IFY A;  3V9S A;  4KHQ A;  5J2P A;  2P1J A;  2IOC A;  3AA2 A;  1EKE A;  2GV9 A;  4F2R A;  3VQA A;  2D5R A;  3SPY A;  1W9H A;  3TWH A;  3U6F A;  2OA8 A;  3MED A;  1IO2 A;  4DTM A;  4B9L A;  2OZM A;  2F8S A;  1JLG A;  1HPZ A;  3DYA A;  2BAN A;  2A1R A;  5KI6 A;  2FBV A;  3KD1 E;  2VWJ A;  4DS4 A;  2ETJ A;  3KLI A;  5SZT A;  3HO1 A;  1T03 A;  1HMV A;  1L3S A;  3OJS A;  3LZI A;  1JLA A;  4LSN A;  1TGO A;  1A5V A;  2HVI A;  3SQ1 A;  2HHT A;  4AHU A;  1RT1 A;  3HVR A;  4E7L A;  3NHG A;  3ALY A;  4B08 A;  3M8S A;  3ULD A;  1R0A A;  1WSG A;  2LSN A;  3LP2 A;  1X9S A;  2HHS A;  1RT6 A;  2YNG A;  5FRM A;  2ATQ A;  1BQM A;  5CYM A;  3VA3 A;  4Z4F A;  4CFB A;  5KRT A;  3QEX A;  3S3O A;  4KB1 A;  1LAV A;  3SNN A;  2JGU A;  4Z4H A;  2HHQ A;  2IGI A;  2KZZ A;  1RNH A;  2EX3 A;  3D45 A;  3C95 A;  2YNH A;  3P1G A;  4CJF A;  1SL2 A;  3RWU A;  1T7P A;  4GMJ B;  4CJS A;  3NDK A;  4EP5 A;  4CK3 A;  3L2R A;  4BWM A;  4RW6 A;  4CK2 A;  2RPI A;  3PX4 A;  4HHT A;  1FKO A;  1WSE A;  1VK0 A;  4PA1 A;  3ZSW A;  4CER A;  4FLV A;  3V81 A;  4CF8 A;  3SPZ A;  4CIG A;  1B9F A;  1KCF A;  2F8T A;  1XHZ A;  3VQE A;  3NH0 A;  1QE1 A;  3G10 A;  3ZCM A;  4OLB A;  1ASW A;  1ZBI A;  4PY5 A;  1IKY A;  2HHW A;  3OY9 A;  1IKW A;  1WAJ A;  3VQD A;  4W5Q A;  4HUE A;  2VG7 A;  4ZTJ A;  4F8R A;  1TKD A;  2B6A A;  1CXU A;  3QIO A;  2RF2 A;  3AO1 A;  3QES A;  1U47 A;  1JXB A;  4BDP A;  3AA4 A;  3TAP A;  4FK0 A;  1TV6 A;  4DFJ A;  2BDP A;  4KTQ A;  3KKS A;  1RT2 A;  4DFK A;  1RTD A;  1ASV A;  1RT3 A;  1HYS A;  1L3U A;  4KAZ A;  4F3T A;  1B92 A;  3LP0 A;  3NH1 A;  1U49 A;  3RR8 A;  2WON A;  4H8K A;  4CE9 A;  1NK5 A;  2Q3S A;  3C6U A;  4FCY A;  1TK5 A;  4OVL A;  1ZYQ A;  4FJ8 A;  3PO4 A;  3DLH A;  3IG1 A;  3VQ8 A;  3RMD A;  3VQP A;  3LAK A;  1WSI A;  5C24 A;  1JL2 A;  3U3Y A;  3I0S A;  3OYI A;  4RW4 A;  4LD0 A;  4BDY A;  1D8Y A;  4BE2 A;  4CHZ A;  3MEC A;  1QSY A;  4IG3 A;  4FZY A;  1S6Q A;  4DTR A;  3KLH A;  1RIL A;  3M8Q A;  4AIL C;  4RG8 A;  4FW2 A;  4CGF A;  4CF1 A;  2Y1I A;  1C6V A;  1WN7 A;  1YVU A;  1C0U A;  3OYD A;  3K5M A;  4QAG A;  4CJV A;  1B9D A;  3TR8 A;  3PX0 A;  3NF7 A;  4I2Q A;  4CJT A;  3C94 A;  1VSM A;  3TAG A;  3AVL A;  2DFF A;  2FBY A;  3LWM A;  3LPU A;  3HJF A;  4CJP A;  4Z4G A;  4CFD A;  1NK0 A;  1SKS A;  1RT4 A;  1TKZ A;  1JLE A;  4KB0 A;  4DSL A;  1BL3 A;  1Z26 A;  3EYZ A;  2PZS A;  5EU7 A;  1GOA A;  3ZSY A;  3DRS A;  3MXI A;  1U4B A;  4M3R A;  3F9K A;  4FLU A;  4CJ4 A;  4BWJ A;  2PYL A;  4FJN A;  4Z4C A;  3FFI A;  1DTT A;  3SV4 A;  4IKF A;  3MEE A;  2Z1H A;  4CGI A;  3ZT1 A;  3S3N A;  1S1W A;  4MQ3 A;  4M45 A;  2BE2 A;  3L8B A;  5HRN A;  2XY7 A;  3DLR A;  4CEA A;  1S1T A;  3LPT A;  2P51 A;  2AJQ A;  3B6O A;  1RBR A;  4KHN A;  4CIE A;  4MFB A;  1XWL A;  4JS4 A;  1FKP A;  4KFB A;  3SV3 A;  4L8R B;  2DFE A;  1S1U A;  3JYT A;  4NCB A;  3VQ6 A;  2HNY A;  3AVN A;  4O55 A;  3EY1 A;  4BE0 A;  1KSP A;  4J2E A;  4O0J A;  1RDC A;  4HCB A;  1T8E A;  2DTU A;  2B4J A;  3KJV A;  4CJK A;  4W5O A;  1SUQ A;  1NJX A;  2HNZ A;  2EHG A;  1KFS A;  4CGJ A;  1D9D A;  1TAQ A;  4FLZ A;  3BGR A;  5J2Q A;  4M3T A;  1RTJ A;  4CFC A;  4QOZ B;  2HHV A;  4N56 A;  3OYN A;  4ELU A;  3SUN A;  1IKV A;  5KRS A;  4OGE A;  3V9Z A;  4CFA A;  1CLQ A;  4B3O A;  4Y1C A;  4CF9 A;  3TAQ A;  1QSS A;  5CY4 A;  4DSI A;  4H4M A;  4E7H A;  4N76 A;  4DQS A;  1U48 A;  5FDL A;  3PX6 A;  1BIS A;  4KHU A;  4I9L A;  4E19 A;  2QKK A;  3TAM A;  5J1E A;  1WLJ A;  1BHL A;  1LW0 A;  3QNO A;  1FXX A;  2G8U A;  4E3S A;  4CHQ A;  4CK1 A;  5HP1 A;  4YNQ A;  5HLF A;  3TAE A;  4CJ3 A;  4FZX C;  3V4I A;  1NJY A;  1RBU A;  4CJ5 A;  3LZJ A;  4JS5 A;  4FJM A;  4RW8 A;  1HYV A;  3P5J A;  5FRO A;  4DQP A;  2GUI A;  3L2W A;  4CJE A;  3U3G A;  3TAN A;  4IBN A;  3VQC A;  4K8Z A;  1DTQ A;  4ELT A;  2YNF A;  1WSJ A;  4HUF A;  1C1A A;  2E6M A;  3RMC A;  1NK9 A;  1L5U A;  3NH2 A;  5T7B A;  3K5N A;  4FJI A;  1W0H A;  2OPS A;  3CM6 A;  2KTQ A;  1WNS A;  3SUO A;  4DSE A;  3E01 A;  2OPR A;  4KHS A;  2FC0 A;  3SQ4 A;  2P5G A;  4Z0U A;  3T3F A;  1VSK A;  1J53 A;  4YFU A;  1VSF A;  3DRR A;  1LAW A;  3SQ0 A;  3HVT A;  5C25 A;  1S9E A;  4OKJ A;  2E4L A;  4DTO A;  4DTN A;  4CGG A;  3ZSQ A;  4B9M A;  3QLH A;  3ZSV A;  4AHS A;  4HVJ A;  3RR7 A;  3OYB A;  1EP4 A;  1A5X A;  4CEE A;  1TK0 A;  3TAB A;  1CXQ A;  3LAN A;  3O3H A;  3QER A;  1Q9X A;  2HHU A;  2HB5 A;  5HRP A;  1BGX T;  1HNV A;  4J2A A;  3KLG A;  4DQI A;  4FYD A;  4QCL A;  1L3V A;  4CEC A;  4AHC A;  4KTW A;  2HMI A;  3KK3 A;  4CEO A;  4BAC A;  4EZ6 A;  1TL3 A;  4CEQ A;  4FJJ A;  2YHA A;  3QIN A;  4J2D A;  4OGC A;  4Y1D A;  3LWL A;  1S9G A;  2B5J A;  1WSH A;  3KIO A;  3CFR A;  1K6Y A;  3VQ5 A;  4KO0 A;  3LDS A;  2IS3 A;  1UA0 A;  4M42 A;  3ZT2 A;  1XI1 A;  1TL1 A;  4DLE A;  1IKX A;  1U04 A;  4DTP A;  4B9T A;  3L2U A;  1KRP A;  3O4Q A;  1HQE A;  4B8A B;  3CM5 A;  3NGZ A;  1L3T A;  4EZ9 A;  3IS9 A;  3CQ8 A;  3L3V A;  1TVR A;  2XY8 A;  1T05 A;  1VSL A;  3NF9 A;  4M41 A;  4BDZ A;  3SQ2 A;  4HTU A;  1IG9 A;  1NOZ A;  1MU2 A;  3HPH A;  3M8R A;  3LAM A;  3DM2 A;  3HPG A;  3QO9 A;  4N47 A;  1I3A A;  4DU1 A;  3AVC A;  4E7J A;  3DLE A;  1TAU A;  1Y97 A;  3QEV A;  1SL0 A;  4FJ7 A;  3DRP A;  1SL1 A;  1RT5 A;  2Z1J A;  3T1A A;  1GOB A;  2OPP A;  4FLX A;  3RMB A;  1KVC A;  2JLE A;  4ID1 A;  2ZQB A;  4FJH A;  1C1C A;  2G8H A;  4E7K A;  1SKW A;  4E1M A;  2XRI A;  3C6T A;  4FXD A;  3VN5 A;  1BI4 A;  1VRT A;  3THV A;  1NJZ A;  1YT3 A;  3O4N A;  3ZSZ A;  3DLK A;  4C8N A;  4XIU A;  4CED A;  4FM0 A;  4FJG A;  4OLA A;  5KTQ A;  5I42 A;  3B6P A;  3ZSX A;  3SUP A;  1F21 A;  2ZE2 A;  4DWI A;  4LSL A;  1JLQ A;  3SYZ A;  4FJX A;  2YV0 X;  3AA5 X;  2FBX A;  2KQ2 A;  2QKB A;  3QEW A;  3OYF A;  3K2P A;  3HK2 A;  5CYQ A;  1J54 A;  1QS4 A;  1XHX A;  1C0T A;  1HNI A;  4R5P A;  3WNE A;  3DLG A;  4DQQ A;  2IC3 A;  3S9H A;  4HCC A;  4Q0B A;  1TK8 A;  4C8L A;  1A5W A;  2DFH A;  1RBS A;  3VA0 A;  4DS5 A;  5D3G A;  3SUQ A;  1QHT A;  4HUG A;  1Z25 A;  5CZ2 A;  4DQR A;  1REV A;  1BI4 B;  2XHB A;  3ZT0 A;  5HRO A;  1NKE A;  1SKR A;  4K8X A;  4M3Z A;  3DMJ A;  2G8K A;  4NYF A;  3SI6 A;  1IH7 A;  3IRX A;  4M3U A;  1X9W A;  1HYZ A;  4B8C A;  4G1Q A;  2KFN A;  3NBP A;  5KGW A;  3RRH A;  3NAE A;  5C42 A;  4N5S A;  3SJJ A;  4JLH A;  2G8I A;  3SCX A;  4W5N A;  3TI0 A;  2YNI A;  1J9A A;  2E6L A;  5J2N A;  2XY6 A;  4CHO A;  1NK4 A;  1HQU A;  4FJK A;  4CHP A;  2VG6 A;  3PUF A;  1UAX A;  1LW2 A;  3MEG A;  3ZT4 A;  4JRP A;  1RDD A;  4DSF A;  1KLN A;  3LP1 A;  3ZT3 A;  4NCA A;  4M3W A;  2KZM A;  1FK9 A;  4AH9 A;  2XO7 A;  3L2Q A;  4I9Q A;  2KFZ A;  4OJR A;  3QEI A;  3ZSR A;  3K59 A;  3AVB A;  5HBM A;  1HRH A;  1JLC A;  3OYK A;  4FM1 A;  4I7F A;  4ICL A;  4M3Y A;  2X6N A;  4WE1 A;  1VSD A;  3DLB A;  2KW4 A;  4FW1 A;  3OYL A;  4O4G A;  4CEZ A;  2OZS A;  4F4K A;  3KKR A;  3AV9 A;  1WAF A;  4KKO A;  4AHV A;  3D0P A;  4PUO A;  4KRE A;  3HM9 A;  3TAR A;  2HHX A;  3NFA A;  4ZHR A;  2Y1J A;  4O0I A;  4TSX A;  4OKK A;  3CYM A;  4KI6 A;  2GBZ A;  2R7Y A;  2DY4 A;  3DOK A;  4C8K A;  1NK7 A;  1VSI A;  1HJR A;  2P5O A;  1BCO A;  3QIP A;  2YKN A;  3BDP A;  1UOC A;  3ASM A;  4RW7 A;  4DU4 A;  3QEP A;  2Z1G A;  4F2S A;  1KLM A;  3OYA A;  3K58 A;  2YHB A;  2IDO A;  5CZ1 A;  3HL8 A;  3OYG A;  5HRS A;  4AHT A;  3M8P A;  3QET A;  1NKB A;  2G8V A;  3TAF A;  1X1P A;  4CGD A;  3NCI A;  1JL1 A;  1G15 A;  1LWC A;  1S5J A;  1VSH A;  3NF6 A;  4DU3 A;  4KI4 A;  3AVK A;  2HVH A;  3VQ4 A;  1D9F A;  1EX4 A;  4H4O A;  3RRG A;  5I3U A;  1RT7 A;  1NK6 A;  3UIQ A;  1RTH A;  2G8W A;  1BCM A;  1NK8 A;  2WOM A;  4E89 A;  3PO5 A;  1DLO A;  4E0D A;  3AO3 A;  4DTU A;  2PY5 A;  1J5O A;  3L3U A;  1CZ9 A;  4CES A;  1JKH A;  3AO5 A;  3V1Q A;  3AVG A;  2F96 A;  2RKI A;  1S6P A;  3KLE A;  4CJQ A;  1ITG A;  3AVI A;  4PQU A;  1RBV A;  2ITG A;  3ISN C;  4GW6 A;  3NGY A;  4EP4 A;  3H08 A;  4CF2 A;  3L2V A;  3I0R A;  2G8F A;  4KHY A;  3KD5 E;  4AHR A;  4OPK A;  4LH5 A;  4CF0 A;  1ASU A;  5JS2 A;  3V9U A;  1KFD A;  4J2B A;  2W42 A;  4CGH A;  3AVF A;  3OJU A;  3VQ9 A;  3K57 A;  2VG5 A;  3RTV A;  2NUB A;  4B9U A;  5JS1 A;  4JRQ A;  1N5Y A;  1I39 A;  3NF8 A;  2D0B A;  4NCG A;  2O4G A;  3WNH A;  5DMR A;  4CEB A;  3HT3 A;  4IFV A;  4BE1 A;  3SZ2 A;  4FJ5 A;  1U45 A;  4FJ9 A;  3PY8 A;  1NOY A;  2Z1I A;  4LY7 A;  1KTQ A;  2OPQ A;  4DG1 A;  2X78 A;  3O3F A;  1NJW A;  1NKC A;  1C0M A;  1WSF A;  4KTZ A;  4DLG A;  1ZBU A;  2D0A A;  3HST B;  3VQQ A;  4DSJ A;  3OS0 A;  2A1S A;  3OYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...