1LAVA

Stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYLRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization of Escherichia coli ribonuclease HI by cavity-filling mutations within a hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords RIBONUCLEASE H
total genus 52
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lavA00
4HUFA 4KI4A 4FK0A 3HPOA 2HHTA 4O55A 1BGXT 1FKOA 4FLZA 1XI1A 4NYFA 3LPUA 1X1PA 1L3UA 4ZTJA 3HPGA 3KLEA 3SQ4A 3QINA 2E4LA 4F4KA 4FK4A 4DSKA 4J2EA 3KLHA 3OYKA 1S6PA 4FZZA 4CJ4A 2Z1GA 3V1OA 5T7BA 1NK4A 3PO5A 4C8KA 1RT4A 3F9KA 2O4IA 2E6MA 1IKVA 4DTMA 3QNNA 2BE2A 4TSXA 1NK5A 3AO5A 5CY4A 4OLBA 2KTQA 4KPYA 4CF2A 3QERA 3ZSWA 3LP2A 3WNHA 1TVRA 4EZ9A 4FLVA 1WSFA 4M42A 4GVMA 1ZBFA 2VG6A 2ZD1A 4CEBA 2JLEA 3AO2A 1C0MA 3OS1A 3OYEA 4CFBA 3KD5E 4M41A 4B3OA 1RT1A 2B4JA 1T03A 4FJ9A 4O5BA 1KFSA 3V4IA 4HCBA 4ZHRA 1L3SA 4M3ZA 4M3WA 5E41A 1EKEA 1KCFA 3FFIA 4KTZA 1DLOA 2D0BA 2ETJA 3M8QA 4MQ3A 4FVMA 3VQ7A 3O3FA 3MEGA 1RDCA 3MECA 1KSPA 4I2PA 1VRTA 1LAWA 1UAXA 1WAJA 2OPSA 4EP5A 4KI6A 4O0JA 1RT5A 3ZSQA 3OYIA 1D9FA 1NOZA 4FJLA 2IAJA 3LWMA 4CHYA 1JXEA 1IKXA 1RDDA 3OYCA 4AHVA 4PWDA 2GUIA 4B9MA 1RILA 1S9GA 4DTOA 4FM2A 3KK1A 4NCBA 4DFMA 4M3YA 2HNZA 3RR8A 3UIQA 1RT2A 3M8SA 4B8CA 2YHBA 2G8VA 2G8UA 2O4GA 4CJFA 1LAVA 2XY6A 3SQ2A 3NFAA 2G8KA 4OLAA 3E01A 1BIUA 4RG8A 4OJRA 1REVA 1XHZA 3DRRA 3VA0A 1Z25A 3OYFA 3HPHA 4CGDA 3SV4A 3HSTB 3VQEA 3QNOA 3WNGA 1N6QA 2PY5A 3KKRA 5D3GA 4FXDA 4F3TA 4PUOA 3SUQA 3NF6A 4DMNA 3O4QA 5HROA 5CYQA 1BQNA 1RT6A 3AV9A 1WSEA 3ALYA 4CGHA 3F73A 1BIZA 4KKOA 3QLHA 3CQ8A 2P5OA 5DMRA 3QEVA 3SUNA 3AO4A 4KREA 5HRSA 3AVNA 1ZBUA 4NCAA 1IO2A 4K8ZA 3OYDA 4IKFA 1HYSA 4AILC 3L2QA 3VA3A 3U3GA 3NH1A 4KHUA 4DLEA 4DTJA 1EX4A 4JLHA 3V9SA 1LV5A 3I8DA 1B9DA 1XHXA 1WN7A 3PX6A 1CZBA 2OYQA 1U48A 3HK2A 4FJ5A 1A5WA 5HLFA 5K14A 1ZBIA 1Z26A 1BL3A 1RCHA 2KQ2A 3L8BA 3NBPA 1NK6A 4RW8A 3ASMA 2YNFA 4YFUA 1NJWA 2FC0A 2XO7A 1RBTA 5HP1A 3OYBA 3RRGA 3WNEA 3TARA 1K6YA 3ZT4A 4BE1A 1KVAA 4GMJB 3ZT1A 4DSJA 3OVNA 4CJQA 4OKKA 4FLTA 2X78A 4DS4A 2PYLA 3BGRA 3G10A 4CHZA 4W5TA 4E3SA 4FJ7A 3LWLA 3VQ6A 1JL2A 3NF9A 3QIOA 1S1WA 4CF1A 3OYLA 2XY8A 4FZXC 1VRUA 2KFNA 1DTQA 4LSLA 1LWCA 1HYVA 3OJSA 3RMAA 3V81A 4C8OA 1VSEA 1YTUA 3DLRA 3OYAA 1WSHA 3SZ2A 1HMVA 4DQQA 4AHSA 3NAEA 4CK3A 4PA1A 3NCIA 2KZMA 5HRRA 3EZ5A 1HNVA 3TI0A 4F2SA 1C1CA 3P1GA 1HQEA 1NK0A 2HB5A 4FJNA 3HJFA 3MEEA 4Z0UA 4W5NA 2E6LA 4FJJA 2YNIA 1HNIA 4K8XA 4CFAA 3O3GA 4FLUA 3DM2A 1KVBA 1YTAA 4WE1A 4DQPA 1J9AA 3LP3A 4QCLA 3CM5A 2Z1IA 4CJTA 3LAMA 1ZYQA 4RW9A 1VSDA 1QHTA 3ZSXA 4W5QA 3L3VA 3LAKA 3MXMA 2HNYA 4OVLA 1KRPA 4LSNA 4DF8A 1RBVA 1GOBA 3RMDA 4CJSA 3ZT3A 4IG3A 4J2DA 1W9HA 4CEAA 4EZ6A 4DFJA 1J54A 1G15A 3VQBA 3DMJA 4AH9A 4JS5A 3AA4A 1L3VA 4OGCA 4EP4A 4IDKA 4B9SA 3KIOA 3L3UA 4KTWA 3DLBA 4JS4A 1SV5A 3QO9A 2A1RA 2HHUA 3SPZA 5JS2A 1I39A 2WONA 3LANA 4LH4A 4CJ3A 4FK2A 2AJQA 5HRNA 2D5RA 2RF2A 1RBSA 3NHGA 4BDPA 2RN2A 5KGWA 3C6UA 3OYMA 4DG1A 4B9UA 2RKIA 1FK9A 4OPJA 1QQCA 3K5LA 1WNSA 3I0RA 1TK8A 3DOKA 1ZBLA 4J2AA 4KAZA 3CYMA 4DU1A 3KD1E 1IH7A 1LWEA 1W0HA 4CJ5A 4CJWA 3TAFA 3TAEA 1JXBA 4W5OA 4ZTFA 3ZSOA 1TAQA 4BWJA 3SQ0A 4B9NA 4FJGA 2D0AA 3AVMA 3AA5X 4OKEA 4DU3A 1BHLA 4XIUA 4CHPA 4DFKA 1BQMA 3ZCMA 3A2FA 4DQRA 4DF4A 1S5JA 4AHCA 1S6QA 2YHAA 3G0ZA 3HP6A 2HHSA 3AVKA 4CK1A 4GW6A 4O4GA 2I5JA 5FRNA 3LZJA 3OJUA 5C25A 4FLYA 1EXQA 1QS4A 1NK7A 5CZ1A 2HHXA 3JSMA 4OGEA 2GBZA 3P83D 1KTQA 4CFDA 1S1VA 3P5JA 1ASWA 2HHWA 1WLJA 4CF9A 4DU4A 1UOCA 4IG0A 1ASUA 3DI6A 4CJKA 3TAMA 4QAGA 2ITGA 1T05A 1S9EA 1NKCA 3VQDA 4CGJA 4CHQA 4CIFA 5KRSA 3VQQA 2IS3A 1LWFA 4CJEA 3ITHA 4CJUA 3DLGA 1N5YA 4DS5A 1D9DA 3PO4A 4ELTA 4FZYA 4ICLA 5C42A 2WOMA 3KTQA 3S9HA 2GV9A 4J2BA 1HJRA 4DTNA 2BDPA 2QK9A 4I9QA 4FYDA 4CGFA 5KTQA 1NKBA 3D45A 2XRIA 3C94A 4Q5VA 1VSJA 3L2VA 4Z4IA 1QE1A 2G8WA 1F21A 1C0UA 1C0TA 1GOAA 3C6TA 4DSFA 4CIEA 4M3XA 1IG9A 4FLXA 3LZIA 4M3TA 1NK8A 4RW4A 1Q9YA 1TAUA 3AVHA 4KHYA 4CHNA 3K5OA 2PZSA 1QSLA 4C8MA 3HXMA 1TK5A 3V9XA 5J2PA 4AHUA 3NGYA 2QKBA 4CEEA 4F2RA 2OZMA 5FROA 1RT7A 4CEOA 4CEQA 2FBTA 5FDLA 4UQGA 3CFRA 3NGZA 3TAPA 2P51A 4OKJA 3PX4A 2D0CA 3AA3A 2Y1JA 4HUEA 4N76A 2B6AA 5KGXA 4HVJA 3NGIA 1NJXA 3C95A 1SKSA 2OZSA 4DTRA 3LP1A 5J2QA 1T8EA 2KFZA 2DFHA 2HMIA 1B9FA 2KZZA 3ZT2A 3K2PA 3AVLA 5FRMA 4DSEA 4B9LA 4M3RA 4DWIA 3MXIA 4IFYA 4B9TA 4HCCA 3K5NA 2F8SA 2OPRA 1NJYA 1QTMA 3NDKA 1YVUA 3HO1A 1KVCA 2HHVA 1RNHA 4LY7A 1LW2A 1RTIA 1Q9XA 4F8RA 3OYHA 3OY9A 4JRPA 2Z1HA 3DLEA 3T3FA 3VQPA 4CEDA 3I0SA 1KLMA 1TKZA 3M8RA 1O1WA 3JYTA 1NKEA 4HHTA 1R0AA 1JLFA 3V1QA 4ID1A 3AVGA 4B9VA 3U6FA 1SKRA 3LALA 3RWUA 2Y1IA 3OYNA 1U45A 3TABA 4Z4FA 1VSIA 1D5AA 2VG7A 1JL1A 3ZT0A 1CXUA 1NJZA 5J2MA 4KTQA 1IKYA 3DOLA 1TGOA 1U04A 2LSNA 3CFOA 5DK5A 3KJVA 4LH5A 3PV8A 3S3NA 3SQ1A 1RBRA 4E7LA 1C6VA 3K5MA 5KI6A 5I3UA 1Y97A 2BANA 1HPZA 3K58A 5KRTA 4N5SA 4HTUA 2XY7A 2YNHA 4CJVA 1SL1A 4N41A 3PY8A 4CIGA 1KFDA 4Y1DA 2Q3SA 2VWJA 4FM0A 1IKWA 3VQ9A 2HW3A 4FJIA 4CECA 5SZTA 3QEXA 4FM1A 3QEWA 1EP4A 3HT3A 3SJJA 4BE0A 4I2QA 3OS0A 3V9ZA 2IOCA 4BWMA 1U49A 2ZE2A 3L2UA 3NE6A 2JGUA 1EETA 4PY5A 3VQ5A 2DFFA 1C1AA 3RTVA 4FJXA 3V1RA 3QESA 1J5OA 4CGGA 2P1JA 2X6NA 3DLHA 2P5GA 2HVIA 5CZ2A 5HBMA 4LD0A 1SL2A 3S3MA 3AO3A 3IG1A 2IGIA 2BGGA 4YNQA 1MU2A 3S3OA 4NYNA 3M8PA 3NH2A 4FW1A 4DTXA 1Q8IA 4KO0A 1C1BA 1VSFA 3EY1A 3RMCA 1XC9A 1U47A 4KHNA 3KKSA 1FXXA 1HRHA 4H4MA 2RPIA 1JLAA 2FBXA 1ASVA 3VQ8A 1SUQA 4MFBA 2IC3A 4OPKA 4DTSA 1L3TA 4FJKA 1A5VA 2VWKA 2X74A 4H8KA 4G1QA 3NF7A 3T19A 4R5PA 3KK3A 2FBYA 2ATQA 1WSGA 4RW7A 4E89A 3TAQA 1JKHA 2DY4A 4I7FA 4IFVA 2HNDA 3AVCA 1VSMA 3WNFA 5I42A 1WAFA 2ZQBA 3KLFA 3V6DA 3ZSZA 2VG5A 2R7YA 1SL0A 4DLGA 3O4NA 1TL1A 5SWMA 4DQSA 4E0DA 4NCGA 1S1XA 4FJ8A 2W42A 3B6PA 1X9WA 1B92A 3RRHA 4RW6A 3AO1A 1X9MA 1JLEA 4Q0BA 4KFBA 1TV6A 4O0IA 3BDPA 1BCMA 4Y1CA 3CFPA 3ZSYA 3THVA 2OPQA 3LPTA 1BCOA 3L2WA 1WSIA 4FLWA 3SI6A 4CF0A 1TK0A 1RTHA 1TKTA 4AHRA 2YNGA 3EYZA 1CXQA 4B8AB 5J2NA 3QEIA 5JS1A 4FCYA 3V9UA 2FBVA 1QSSA 2G8IA 1A5XA 3SUPA 4E7KA 3SNNA 4L8RB 1RT3A 4Z4EA 4KRFA 5EU7A 4PQUA 3ULDA 1CZ9A 3B6OA 3KLGA 1HQUA 1RBUA 3AVBA 3HL8A 1J53A 1VSLA 4CESA 4CJLA 3SCXA 3NF8A 1UA1A 3IRXA 4KHQA 2X6SA 4KHSA 3DLKA 2DTUA 1ZBHA 2KW4A 4CEZA 1TL3A 3OS2A 3QEPA 1T7PA 3MXJA 3VQCA 4ELVA 3V9WA 3ZSRA 1RDBA 3CM6A 4CJPA 5C24A 4CFCA 1JLCA 4W5RA 4DSIA 3VN5A 3AVFA 3TANA 3QIPA 3SPYA 1JLBA 3OYJA 3SYZA 1TKXA 4Z4CA 4E7JA 1BISA 4QOZB 1I3AA 2OPPA 4BACA 4ID5A 3VQ4A 4E19A 4N56A 1YT3A 4AHTA 4BE2A 2OA8A 4KHWA 1DTTA 2IDOA 1RDAA 1RTDA 4CE9A 3IS9A 4KB1A 3O3HA 3HM9A 3LDSA 3SV3A 2F8TA 3AVAA 4CHOA 2EX3A 2YKNA 3HVTA 3K59A 2HVHA 4Z4GA 1QSYA 4KV8A 2G8FA 5CYMA 3TAGA 1BI4B 2EHGA 4C8NA 4DSLA 3PX0A 3KK2A 3AVJA 1L5UA 3DYAA 1S1TA 3RR7A 4ELUA 3DRPA 4CK2A 1KLNA 1CLQA 3HVRA 3HP9A 4IBNA 2XHBA 1UWBA 4M45A 1D8YA 1VSHA 3KLIA 2QKKA 4C8LA 4FJMA 3MAQA 1S1UA 1BI4A 1LW0A 4CGIA 3MEDA 4JRQA 2NUBA 4BDYA 1TKDA 4CCHA 3PUFA 3CG7A 4B08A 3T1AA 4CJRA 3AA2A 3TWHA 1VK0A 2DFEA 1UA0A 4O44A 1NOYA 1RTJA 2A1SA 4E1MA 4H4OA 4DFPA 2PYJA 5HRPA 4FJHA 4N47A 3D0PA 3NH0A 1X9SA 3IAYA 4F3OA 3OYGA 1NK9A 4M3UA 3DRSA 3U3YA 1U4BA 4Z4HA 2YV0X 3K57A 1FKPA 2QXFA 1XWLA 3QETA 1VSKA 1WSJA 3H08A 4CEFA 2G8HA 4I9LA 4DTUA 3L2RA 2HHQA 3HYFA 1HYZA 1JLQA 4CF8A 2YKMA 3SUOA 4E7HA 4BDZA 1ITGA 4FW2A 4KB0A 4CERA 3LP0A 1JLGA 3RMBA 3VQAA 3ZSVA 2F96A 4E1NA 2XY5A 3ISNC 1SKWA 2B5JA 4E7IA 5J1EA 3AVIA 4DTPA 4HUGA 1GOCA 3TR8A 2Z1JA 4DQIA
chains in the Genus database with same CATH superfamily
4HUFA 2P9NB 1QQMA 3THYB 3THWB 3P31A 1X1PA 4BVOA 4BRAA 1TYQB 4DSKA 2HBJA 1S6PA 3L4IA 3E66A 3V1OA 1JCEA 3F9KA 5JVHL 2BE2A 2HOEA 4TSXA 3AO5A 5CY4A 4DV0K 4OLBA 3O8MA 4KPYA 4CF2A 3LP2A 1BU6O 3VTHA 1SZ2A 4EZ9A 4FLVA 4GKJK 3ENOA 2VG6A 2JLEA 5HL7L 4CFBA 4M41A 2B4JA 1T03A 4LFCK 2P9UA 3PSIA 4M3WA 1DLOA 2D0BA 3M8QA 4FVMA 1K9MO 3MECA 1KSPA 4QS7A 2VGNA 4CZFA 1VQKN 4X66K 3AAPA 1NOZA 4FJLA 3OYCA 1YVNA 3GOIA 1RILA 3CCLN 4FM2A 3KK1A 2VGMA 4DFMA 4B8CA 3VEVA 2G8UA 2O4GA 4FO0A 4A5AA 3GBTA 3CETA 4WQ4A 1V4TA 3KHYA 3VA0A 1Z25A 5KPTA 3HSTB 3QNOA 1N6QA 3EN9A 3KK7A 5DM6L 5CYQA 3QLHA 5FPEA 5EVZA 3SUNA 3N4QA 5M1KA 3FZMA 4IKFA 2P9SA 4DV2K 4AILC 3NH1A 4BQZA 3NMUA 2YHWA 3M5RA 4KHPK 4DV7K 1LV5A 3PX6A 3H1QA 5HLFA 4CZHA 3L8BA 4EFHA 4RW8A 3E1YA 4FWSA 4LF6K 3RRGA 5LMNK 3ZT4A 1KVAA 4MLEA 4CJQA 5C2FA 3CF5L 3VERA 1O13A 5BRHA 3J7AP 1JL2A 4FZXC 4B3RK 3OYLA 1QVGM 3K0SA 1DTQA 1VAZA 3BF1A 3SZ2A 1RDWX 2RE2A 1MWKA 4DQQA 4AHSA 3EZWA 1SS6A 1VQ4N 4ILJA 1MWMA 4OX9K 1LOTB 2HB5A 2VQFK 5EY4A 1VQON 4YOTA 4Z0UA 2D0PA 3CCSN 3DM2A 3THWA 4DQPA 2UU9K 3A5MC 1VSDA 1KRPA 3L3VA 3LAKA 4JN4A 2HNYA 1RBVA 3WEEB 3ZT3A 4J2DA 3VQBA 2O8EA 3DMJA 5AQWA 3I55N 3AA4A 4B9SA 4OGCA 1JCFA 4EP4A 4AM7A 3KIOA 3BF3A 5AFUA 1W97L 5JS2A 4CJ3A 4MDAA 2P9IA 4BDPA 2RN2A 2VYPA 4DG1A 1FK9A 4DV5K 3K5LA 1WNSA 4BRDA 4KAZA 1IH7A 1HKCA 1QHAA 2P9PB 4BRIA 3JXUA 4JKDA 4B9NA 4FJGA 2D0AA 3AVMA 4DU3A 4OKEA 1BHLA 4M63C 3ZCMA 3BUZB 1S6QA 2HHSA 3AVKA 5FRNA 1ATRA 3A0IX 5CZ1A 2HHXA 4OGEA 1KTQA 4CFDA 4NLCA 4B1YB 2O8CB 1HPMA 4BC2A 2HHWA 1WLJA 1Z6RA 1ASUA 3QBWA 2HBLA 3LDOA 1S9EA 1NKCA 5C12A 1LWFA 3MMVA 3ITHA 4CJEA 3DLGA 4CJUA 1N5YA 4YOUA 2GV9A 4PL7A 2BDPA 3TTCA 3F5TA 4I9QA 4CGFA 5KTQA 3C94A 4Z4IA 1VSJA 3IDHA 1F21A 1C0TA 2Q31A 3C6TA 3AARA 4JKCA 3CI5A 3U9DA 4DSFA 3LZIA 5KPRA 2WUSA 4CHNA 1ZBSA 3M6GA 5AQXA 1WOQA 4F2RA 4UQGA 3O9RA 1HKBA 1FW6A 1GLBG 4HUEA 4CBUA 1NGGA 3KWIA 2B6AA 4B1WB 4BREA 3U9ZA 5LY3A 5E84A 1T8EA 2DFHA 2ZGZA 2HMIA 3ZT2A 4OO1J 4B9LA 4DWIA 4IFYA 5EX5A 3L6QA 3ZX0A 4H0XB 1YVUA 4LY7A 1RTIA 3OY9A 3MK6A 2NRVA 4JI4K 3M8RA 3DXMB 1VQ8N 3TSUA 2FLOA 3P38A 1NKEA 3V1QA 3AVGA 3RWUA 3OYNA 3LM2A 1D5AA 3VPZA 1JL1A 1K8AO 3O6WA 1X9JA 3KJVA 2JWKA 4LH5A 3VEOA 1C6VA 2A41A 3K5MA 1NG9A 2ZF5O 2BANA 1IV0A 4YOYA 2YNHA 1SL1A 2NZTA 5BREA 4FM0A 1NMDA 2P9IB 4FJIA 3QEXA 3I8BA 4FM1A 3CIPA 3MDQA 3SJJA 3V9ZA 3VF2A 2IOCA 4KH6A 2JGUA 1I94K 5FPDA 2P5GA 3DLHA 3F2KA 5HBMA 3NVMA 3CCQN 3S3OA 4NYNA 3NH2A 4FW1A 4FWKA 1C1BA 2HF4A 3EY1A 1U47A 4DTSA 1SUQA 2IC3A 1L3TA 3RMAA 3T19A 4Z94A 4R5PA 2FBYA 1WSGA 4IFVA 1QQOA 1WAFA 3DXKA 2NRRA 3KLFA 3ZSZA 2VG5A 1SL0A 4O8UA 4DLGA 3O4NA 3A5NC 5SWMA 4DQSA 3J7YP 5AJ3K 3JAMO 1M90O 1XQSC 1X9MA 4JHDA 4BC5A 1TV6A 4O0IA 4Y1CA 2A3ZA 3FR0A 2FF6A 3SI6A 2YNGA 5JS1A 1NGHA 4PKHA 2FSKA 3HM8A 3SNNA 4L8RB 2QM1A 4PQUA 2HSTA 4EAHD 3SK3A 1SAZA 3TPQA 3ID6A 1UA1A 4CJLA 2FSNA 3CD6N 2UUBK 1RGIA 4KHSA 3DLKA 4CEZA 4AQYK 3PSFA 3QEPA 1T7PA 3MXJA 3ZSRA 3HBTA 3CM6A 2ZGYA 2NRWA 4W5RA 3QIPA 3SYZA 4HWIA 4E7JA 5C0YA 2OPPA 3VQ4A 3J80O 1DTTA 1HJOA 4F9OA 3CC4N 1RTDA 4GV9A 3ULEA 2VQEK 2YKNA 3FGUA 2HVHA 2G8FA 5LJVA 5LMUK 2W6KA 3AVJA 3E9LA 3DYAA 3RR7A 2QWOA 3I33A 1CLQA 4IBNA 4FJMA 2NNWA 4CZLA 3MAQA 5AQQA 4JRQA 4E0DA 2NUBA 5LL6Z 4OPHA 4B08A 2EWSA 3AA2A 1VK0A 2DFEA 1VQPN 2A1SA 3O9QA 2AA4A 1VQLN 4FJHA 4N47A 4ISFA 2W6LA 5JMVA 4M3UA 3U3YA 2YV0X 4K0KK 2QXFA 5AZIB 2HHQA 3L2RA 1W2BM 1IBKK 2YKMA 4GNIA 3SUOA 4E7HA 4JKAA 4KB0A 1JJ2M 3ISNC 5J1EA 1ZC6A 5GAGP 4DTPA 4IEIA 4GV3A 4JKBA 4BC4A 2Z1JA 1BOTO 2F4VK 4KI4A 4A62A 3CJBA 4JKGA 3LPUA 3MWPA 4FK4A 4DQ8A 3QINA 4F4KA 3EO3A 5F2RA 4J2EA 3KLHA 3OYKA 2O4IA 2QW9A 2E6MA 4JHDB 3QERA 3ZSWA 2KKZA 3ZX2A 4GVMA 2OTJN 5IT9O 3OYEA 4B3OA 4H0YB 4O5BA 1KCFA 1SQKA 3VQ7A 1NNEA 1RDCA 1LAWA 1UAXA 4KI6A 4O0JA 3ZSQA 3LWMA 4CHYA 1JXEA 4IO9L 1YJ9N 1GLAG 4PWDA 5GADP 2YJEA 1S9GA 1WUAA 2P9KA 3UIQA 1RT2A 3EEQA 3LDNA 2VWBA 5M1PA 1T44A 1WBBA 1LAVA 2XY6A 2G8KA 2F9TA 3DRRA 5FPNA 4CGDA 3VQEA 4BRQA 2PY5A 4H5RA 4FXDA 4F3TA 4JEPA 4C23A 2NRZA 3NF6A 5BPLA 1WSEA 1S72N 1BIZA 3CQ8A 5DMRA 4DHYA 4WQ4C 5BN9A 5HRSA 3AVNA 1ZBUA 4EHUA 4FOEA 4NCAA 1G99A 3OBYA 1HYSA 3L2QA 1C0GA 4DLEA 1EX4A 2E20A 3I8DA 1B9DA 2OYQA 1U48A 2IIRA 5K14A 1ZBIA 2F7TA 3ASMA 3O1WA 4YFUA 2XO7A 3TARA 1KAXA 2OTLN 3OVNA 4FLTA 1NGFA 3G10A 4CHZA 2V7YA 4FJ7A 3R6MA 3VQ6A 4YOXA 1VRUA 3GG4A 3V81A 1VSEA 3DLRA 2YX6A 2O8CA 3NAEA 4PA1A 2KZMA 3EZ5A 1HNVA 3TI0A 3P1GA 3ZLJA 3UKRB 3HJFA 2IVOA 3MEEA 4YDUC 5BR8K 1HX1A 3O3GA 1J9AA 3CQYA 4Y0WA 4IFEA 2Z1IA 1YF5L 1ZYQA 4RW9A 1QHTA 3H46O 3MXMA 4OVLA 4DF8A 1ZXOA 3KZBA 4DFJA 4EZ6A 1J54A 3N4PA 3HRGA 4X64K 3P4IA 3DLBA 1SV5A 3CPEA 2A1RA 3SPZA 3LANA 4LH4A 4JK8A 2RF2A 1RBSA 4H5TA 3TU5A 3C6UA 1ESVA 4BGBA 3DOKA 1ZBLA 3CYMA 4DU1A 4CJWA 1HR0K 3B8AX 1OKJA 3R3LA 2V51B 4H0TB 3ID8A 4CHPA 5BR9A 3D2FB 3G0ZA 3OTOK 1NGEA 2YJFA 3OJUA 5C25A 1EXQA 5M1NA 3BP8A 1BA1A 3JSMA 2HMPA 3FE1A 3P5JA 1ASWA 1TUYA 2A40A 2UXDK 4M7XA 2P9PA 1EWQA 2ITGA 3H6EA 2YHYA 1FJGK 5KRSA 1IBMK 3VQQA 4FZYA 2NRTA 4ICLA 3KTQA 1X3MA 2QK9A 2O8FA 1BO5O 2XRIA 4YOVA 1QE1A 4BROA 1BDGA 3EKUA 2QWRA 4JI2K 2O8EB 3IMXA 3MN5A 4M3TA 3MN9A 4RW4A 1Q9YA 3K5OA 1QSLA 3VEYA 1EWRA 3HXMA 1TK5A 4CEEA 1NWKA 2FBTA 3NGZA 3TAPA 3PX4A 4N76A 2E2OA 3WXIA 4FWNA 2D0OA 2OZSA 4DTRA 3LDPA 3CJAA 4JD2A 1N8RO 4JNEA 4QS9A 3K2PA 3AVLA 5KQ8A 3SMSA 4WF9L 3K5NA 2OPRA 1NJYA 2UUCK 2PBDA 1QTMA 1KVCA 5AQZA 4BRPA 4F8RA 1Q9XA 3OYHA 4JRPA 2ZJQL 4A57A 1XUPO 1LCUA 4CEDA 3VQPA 1TKZA 2D4WA 3DAWA 3CCEN 5AQUA 3DXMA 2Q0UA 2JWLA 3JYTA 4HHTA 2GWKA 3C7NA 2GUPA 3U6FA 1SKRA 2GWJA 2Y1IA 2QWLA 1U45A 3D7EO 4KTQA 1CXUA 5J2MA 1IKYA 1D9DA 5DK5A 1U04A 3PV8A 3ENBA 4BR5A 4CZEA 3MX5A 5KI6A 1Y97A 1KAZA 4BRLA 2E2NA 4N5SA 4DR1K 1N34K 4N41A 4K42A 4PL8A 3CMEN 1IKWA 4JI3K 1GLEG 3HT3A 4FSVA 3O9SA 3TTDA 3OW2M 1U49A 3NE6A 4FJXA 1C1AA 1NBWA 2OCEA 3V1RA 2O8DA 2HVIA 2X6NA 4JKGB 4LD0A 3S3MA 4BQLA 2BGGA 2IGIA 4DTXA 1Q8IA 2QTDA 3RMCA 2D1KA 3BZCA 1HRHA 1ASVA 4MFBA 4FJKA 1A5VA 3NF7A 3AGKA 4E89A 2DY4A 4BRGA 3AVCA 4JI6K 1VSMA 4ILGB 5I42A 2ZQBA 3LDLA 3OA9A 2YI1A 1TL1A 3ULEB 3K9JA 3VESA 2W42A 2Q2RA 3RRHA 3RSEA 4H0VB 4JI1K 5AQJA 5M1QA 1OH8A 1BCMA 3CFPA 2OPQA 5JLFA 4WFAL 1RTHA 3CMAN 1CXQA 4B8AB 3QEIA 3V9UA 1QSSA 1A5XA 3SUPA 4Z4EA 1TYQA 2J4RA 3ULDA 4IO8A 4NB4A 2CH6A 2E8AA 3KLGA 1HQUA 3SCXA 4CESA 3VGLA 3NF8A 5I9EB 3CJ9A 1MDUB 1NGIA 4O8KA 4DR3K 3EE9A 3VQCA 1RDBA 3O4WA 1JLCA 3SBTA 1EO1A 4DR2K 1JLBA 1KC8O 4AM6A 1TKXA 4QOZB 1I3AA 4XH5A 2OA8A 2CGJA 4ID5A 4N56A 1YT3A 4KHWA 3ATUA 2IDOA 4JKFA 2P9LB 2CGLA 4KB1A 3HM9A 2F8TA 3LM9A 4CHOA 4GV6A 2EX3A 1NM1A 2CH5A 3SAHA 2PAVA 4Z4GA 2QEXN 1QSYA 3BZKA 4OPAA 3OBWA 5CYMA 4DSLA 3VGKA 4ELUA 1KLNA 5MLCQ 3HP9A 1TKDA 4CGIA 1LW0A 3PUFA 5CHIA 1NOYA 4C1NK 5ELZA 3IKMA 2PYJA 2WBNA 4EIAA 2HBKA 2H3GX 4X62K 4UY8O 1VQMN 3QETA 1WSJA 4CEFA 4I9LA 4YDUA 1JLQA 3P39A 3CXCM 1M1KO 3HSCA 3QICA 4FW2A 3WXJA 4CERA 3LP0A 1JLGA 4LC9B 3RMBA 1Q81O 4E1NA 4FWPA 2B5JA 3W3DA 1GOCA 3TR8A 2E88A 3HPOA 4JK7A 2HHTA 3I56N 4FLZA 1XI1A 1S22A 1L3UA 1VQNN 3KLEA 3SQ4A 1E4FT 3H3NO 3QFUA 5JVGL 1NK4A 3PO5A 4C8KA 1HNZK 1IKVA 3QNNA 4KH5A 4ISEA 2ZM6K 5BPNA 4L3QA 1ZBFA 1NGAA 2ZD1A 4CEBA 3AO2A 1C0MA 4FJ9A 3EL2A 1KFSA 4HCBA 4ZHRA 4DR5K 5E41A 1EKEA 4M7YA 2ETJA 3MEGA 2OPSA 1RT5A 1GLCG 3OYIA 3TSPA 1D9FA 4G9ZA 1IKXA 4DV6K 5AQRA 4AHVA 3G4SN 2BUPA 4NCBA 2HNZA 1R59O 2G8VA 4BRMA 3SQ2A 4OLAA 4CBWA 4JD2B 1BIUA 3E01A 1T6DA 4OJRA 4RG8A 3VETA 3GE1A 5F1XA 4A59A 1XHZA 3HPHA 2UUAK 5JICA 3SUQA 1CZAN 1NGBA 3ALYA 3AV9A 3CCUN 1QZ6A 4KKOA 4LF4K 5JLHA 5ADXH 1ILYA 3AO4A 3W0LA 1IO2A 4K8ZA 3WT0A 1WBDA 3VA3A 3U3GA 4KHUA 4DTJA 1YJWN 3V9SA 2E5LK 1XHXA 5FPMA 3G25A 2RHKA 3HK2A 4FJ5A 4B3MK 4YY3K 3L4QA 1Z26A 1BL3A 1RCHA 2KQ2A 3UKRA 3NBPA 2YNFA 3FZKA 4BG9A 5HP1A 5M1FA 3WNEA 2V52B 4BE1A 4GMJB 1YAGA 3ZT1A 3AAQA 4OKKA 2X78A 2PYLA 4QS8A 3CC7N 4CF1A 4H5NA 2ZJRL 3OJSA 3OYAA 3WQUA 4CK3A 5HRRA 4JI0K 4F2SA 1HQEA 1NK0A 3QBXA 4FVUA 4CW7B 4BRFA 3O1BA 4FJNA 3TSQA 2E6LA 4FJJA 1HNIA 4K8XA 4FLUA 4WE1A 3LP3A 3CM5A 1BG3A 3R1XA 3LAMA 4IEEA 4W5QA 3ZSXA 4I6MB 3KD5E 1T6CA 4LSNA 1IBLK 1GOBA 3RMDA 4CJSA 1W9HA 4CEAA 1G15A 2OANA 4AH9A 4CI6A 4IDKA 3L3UA 4KTWA 3O80A 4JS4A 2HHUA 4BRKA 5AZIA 3KWGA 5HRNA 4CZMA 3OYMA 2RKIA 3T1YK 5AQHA 4OPJA 5AFUH 1QQCA 1TK8A 2I7NA 3U4LA 4IJNA 4CJ5A 1W0HA 1LWEA 2Q0RA 2HBMA 4BGAA 4LF5K 2P9KB 3TAEA 1JXBA 4W5OA 3ZSOA 1TAQA 4BWJA 3SQ0A 3C6AA 4CZKA 3ZETB 4IOAL 3FFKB 5TKWA 4DFKA 4DF4A 4DQRA 1K8KA 5AQMA 4AHCA 2YHAA 3GL1A 4GW6A 3CQXA 4FLYA 3T69A 2GBZA 2NRHA 4CF9A 4DR7K 4DU4A 3A8YA 4IG0A 3CERA 4CJKA 4NO7A 4K41A 3VQDA 4CHQA 3PO4A 4DS5A 4ELTA 4U7BA 2WOMA 3S9HA 4J2BA 1H1VA 3MCAB 4FYDA 1NKBA 3D45A 4IOXA 5KPZA 3L2VA 3VF6A 4PHTX 5AQNA 4C1NI 4CIEA 4FLXA 2O8BA 1NK8A 1TAUA 1KQSM 3AVHA 4KHYA 4NXMK 2PZSA 4AHUA 4O5FA 4LF9K 2OZMA 4CEQA 3CFRA 3MN6A 3VGMA 4IJAA 1Z05A 4MDBA 4OKJA 3AA3A 4WFNL 3SMPA 1NJXA 3NGIA 3C95A 5AQTA 1SKSA 5J2QA 3H45C 5HOOA 3SAFA 2PFUA 1B9FA 2KZZA 5FRMA 4DSEA 4M3RA 3MXIA 4B9TA 4HCCA 2F8SA 5AQYA 2VCPA 4DCHA 3NDKA 3HO1A 4YHHK 2HHVA 3SAGA 4KBOA 2W40A 1HLUA 3EKSA 5IWAK 1YJNN 4EHTA 3MCPA 1P90A 3D2EA 1OVYA 3K9KA 2HHHK 1U6ZA 2QA4N 2V7ZA 4MO5A 1JLFA 2IVNA 3VOVA 1Q86O 3TABA 1VSIA 1NJZA 2FF3B 1ATNA 3O9TA 1HNWK 5BRFA 3S3NA 3SQ1A 5I3UA 4ILHA 1YIJN 3K58A 5KRTA 5AQSA 2Q3SA 2HW3A 1GLDG 5GIPA 3HTVA 2ASPA 3HOSA 4BE0A 3VENA 4BRNA 1JCGA 2ZE2A 3M3ZA 4PY5A 3VQ5A 2DFFA 3RTVA 1DT9A 4ISGA 5GINA 1Q82O 1TUUA 3QDKA 1VQ7N 4CGGA 3CJ1A 2P1JA 5CZ2A 3IFRA 1U2VB 3IG1A 1MU2A 3ENHA 2WTUA 3M8PA 5AQIA 3PLAA 3C7NB 4DUZK 4KO0A 2O8BB 2RPIA 3VQ8A 1OH6A 3FLCO 2VWKA 3KK3A 4G1QA 3G6EN 4H5VA 2ATQA 3SBGA 4RW7A 1JKHA 4I7FA 3WNFA 4FOIA 3V6DA 3J7ZO 4IXCA 4CD1A 4NCGA 3RSEB 1S1XA 3FZHA 3AO1A 1JLEA 3BDPA 5AQGA 3THVA 3ZSYA 3LPTA 1BCOA 4CF0A 1HKGA 5E26A 1TK0A 4J8FA 4BR2A 1VQ6N 3VMFB 4FCYA 4U67L 4IZ9A 5AQOA 4BR4A 3D2FA 3B6OA 3AVBA 3HL8A 4Z4FA 1RDUA 1T3VA 1KAYA 2DTUA 5ADXA 2KW4A 3QMLA 1TL3A 3ZEUA 2P9SB 5C2DA 3OS2A 4H03B 3T1HK 2O8DB 3OHRA 5C24A 3C6HA 4CFCA 1J5EK 5A2QO 4DSIA 3CCVN 3VN5A 3LDQA 3TANA 1XMQK 1S3XA 3SPYA 3OYJA 4Z4CA 1BISA 1DGKN 4BACA 5AQKA 5M1OA 1RDAA 2KLAA 3LDSA 3CC2N 3AVAA 3HVTA 4JI8K 4JKEA 2QWQA 1BI4B 4JV5K 3PX0A 1L5UA 4JK9A 3D6RA 3L0QA 4CZGA 4M45A 1D8YA 1VSHA 3KLIA 3GDQA 4H5WA 4BDYA 1S1UA 3H3OB 3MEDA 3ZETA 3CG7A 5FLXO 2IVPA 4WFBL 5AQFA 1UA0A 3J81O 1RTJA 5AZJB 4E1MA 2P9UB 2A5XA 4H4OA 2GEMA 4DFPA 2BH1A 4CD3A 2P9LA 3NH0A 3IAYA 4F3OA 3UKUB 1NK9A 3DRSA 4JYAK 1U4BA 3K57A 1FKPA 4BY9C 1QVFM 3H08A 2G8HA 1VHXA 1HYZA 2Q36A 4CF8A 2BTFA 1IJJA 1ITGA 4PKIA 1IG8A 1QQNA 1RFQA 3VQAA 3ZSVA 1SKWA 3AVIA 4HUGA 4DQIA 4FK0A 4DV3K 1U2VA 4O55A 1BGXT 1FKOA 3THYA 4NYFA 4GVEA 4RWTA 4ZTJA 2P9NA 3HPGA 5AQPA 4BVPA 2E4LA 4B9QA 3THXB 4FZZA 4CJ4A 2Z1GA 5T7BA 1RT4A 4DTMA 4FPAA 3VEZA 1YI2N 1NK5A 2KTQA 4WQ5C 3WNHA 1TVRA 4XH4A 4FWQA 1WSFA 4M42A 2KHOA 1XC3A 1C0FA 2E1ZA 3OS1A 2QI2A 1RT1A 4LF8K 5AZJA 3V4IA 4BR7A 5GIOA 1L3SA 4M3ZA 4MLHA 4BR0A 1NGCA 3ZX3A 3FFIA 4KTZA 4MQ3A 3O3FA 3MX2A 3EE8A 4I2PA 1VRTA 4KH4A 3VEXA 1WAJA 4EP5A 1QZ5A 5TKYA 2IAJA 3JS6A 2QWMA 1RDDA 4A61A 2GUIA 4B9MA 2ZJPL 4DTOA 3UE5A 1YUWA 4M3YA 3RR8A 3M8SA 4NLBA 1DEJA 2YHBA 4BR9A 4CJFA 3NFAA 4RCHA 3QB0A 4WCEL 1REVA 3OYFA 3A5LC 3SV4A 3WXKA 5D3GA 3WNGA 3KKRA 4PUOA 3KVGA 4DMNA 3O4QA 5HROA 1BQNA 1RT6A 1N33K 3THXA 4CGHA 4IDHA 3F73A 2P5OA 3QEVA 5BPMA 4KREA 1XNRK 1KD1O 3IUCA 3E9PA 3OYDA 4JLHA 3O08A 1WN7A 1CZBA 1A5WA 3D2EB 1NK6A 4K25A 1NJWA 2FC0A 1RBTA 3OYBA 1K6YA 2O8FB 5EXWA 3DJCA 4E1JA 4DSJA 3FZLA 4DS4A 2GELA 3BGRA 4W5TA 4E3SA 3LWLA 3CCMN 3NF9A 3QIOA 1S1WA 2KFNA 2XY8A 4PKGA 4LSLA 1LWCA 2A6AA 1HYVA 3WQTA 4C8OA 1YTUA 1WSHA 4IWVA 1HMVA 3BEXA 3DXKB 3SLCA 2I7PA 3NCIA 1BA0A 1C1CA 3HOTA 4W5NA 2YNIA 4CFAA 4I6MA 1KVBA 1YTAA 4QCLA 1NMNA 4CJTA 2QWPA 2ZWHA 4JI7K 4IG3A 5C15A 1V4SA 5AR0A 1YXQA 4DB3A 4JS5A 1L3VA 4DV4K 3AGRA 5EOYA 3QO9A 3LL3A 4FK2A 1I39A 2WONA 2AJQA 4V19S 2D5RA 3NHGA 4A2BA 5KGWA 4B9UA 3BY5A 1NGJA 3I0RA 2FXUA 4J2AA 3KD1E 3TAFA 3WEEA 1GLJO 3ATVA 4FWOA 5F0XA 4ZTFA 3G71N 2UXCK 4FPBA 2NLXA 1HNXK 3AA5X 4B1XB 4XIUA 1WB9A 2DPNA 1E3MA 1BQMA 3A2FA 1S5JA 3HP6A 4CK1A 4O4GA 2I5JA 3LZJA 4B1VA 1QS4A 4AF1A 1NK7A 3P83D 4FL9A 1S1VA 5AQVA 5LJWA 1NLVA 1N36K 1UOCA 2ITMA 3DI6A 1T05A 3TAMA 4QAGA 3PIOL 4CGJA 4CIFA 3CJ7A 4CVNE 1XNQK 2IS3A 5C42A 3WUHA 5KQDA 4B3TK 2WC9A 1HJRA 4DTNA 2WFBA 3AY9A 1BUPA 1GLFO 4Q5VA 2G8WA 4BRHA 1C0UA 1OH7A 1GOAA 4M3XA 1IG9A 3WXMB 4C8MA 3CCJN 3CCRN 3V9XA 5J2PA 3NGYA 2QKBA 5FROA 1RT7A 4CEOA 3CPWM 5FDLA 4CZIA 1OVQA 3TTFA 2P51A 2D0CA 2Y1JA 3R9PA 3O9UA 5CR4A 1HUXA 5KGXA 3A5OC 4HVJA 3VEWA 2HF3A 1NJIO 1MA9B 3DWLA 3LP1A 2ASMA 2KFZA 1OH5A 3PIPL 4H0OA 3VF4A 3UKUA 1J6ZA 4K43A 5BN8A 4YORA 2QWNA 4DR4K 3E9OA 5BRDA 5B8HA 3O5BA 1RNHA 1LW2A 1P8ZA 2Z1HA 3DLEA 3T3FA 3I0SA 1KLMA 1O1WA 1YHQN 1R0AA 1DKGD 3T7ZA 4ID1A 4B9VA 3LALA 2E1YA 2AP1A 2VG7A 3ZT0A 1EQYA 3DOLA 1TGOA 2LSNA 5GAHP 3CFOA 2A42A 1RBRA 4E7LA 2ASOA 1HPZA 4HTUA 2XY7A 1Q18A 4CJVA 3PY8A 4CIGA 1KFDA 4Y1DA 1N32K 2CGKA 2VWJA 2UYTA 3VQ9A 4DKWA 4CECA 5SZTA 3QEWA 1EP4A 4I2QA 3OS0A 5AQLA 4BWMA 3L2UA 4DV1K 4A2AA 1EETA 3MN7A 3QESA 1J5OA 2GX9A 2W41A 1W7AA 1SL2A 3AO3A 4CJ7A 4YNQA 1VQ5N 1E4GT 4WQ5A 1VSFA 1XC9A 1Y64A 4KHNA 2Q97A 3KKSA 1FXXA 3HZ6A 4H4MA 1JLAA 2FBXA 4OPKA 4GKKK 3H1VX 2X74A 4H8KA 1K8KB 3CJCA 4LF7K 4FWLA 4LFBK 3TAQA 2YHXA 2HNDA 4JAXA 3UB5A 2R7YA 3WXLA 4A5BA 5CE3A 4JI5K 5H1SQ 4FJ8A 3B6PA 1X9WA 1B92A 4RW6A 5DM7L 4Q0BA 1BWFO 1K73O 4KFBA 4GY2B 4YOWA 3DLLL 4FLWA 3L2WA 1WSIA 1VQ9N 3SJHA 1TKTA 3VTIA 4AHRA 3EYZA 5J2NA 4FWMA 4RTFD 2FBVA 2G8IA 4LFAK 4E7KA 1RT3A 4X65K 4KRFA 5EU7A 4NXNK 3MWTA 3Q7BA 1CZ9A 1NU0A 1RBUA 1J53A 1VSLA 4KHQA 3C65A 3IRXA 4WYBA 2X6SA 3ZEUB 1ZBHA 2NRXA 4IOCL 1NGDA 1ATSA 3S41A 4CZJA 2E2PA 2QXLA 4B1UB 3HI0A 4XEIA 4ELVA 1X3NA 3V9WA 4DUYK 4CJPA 3AVFA 4BE2A 4E19A 2GTDA 5GAEP 4AHTA 4B1ZA 5C10A 4BRCA 4R79A 4CE9A 3IS9A 3O3HA 3SV3A 2FSJA 1XMOK 3NVKA 3K59A 4KV8A 1Q7YO 4B3SK 3TAGA 2EHGA 4C8NA 3Q7CA 3KK2A 4JKHA 1S1TA 3DRPA 4CK2A 2F9WA 3R8EA 3HVRA 2QKKA 1GLLO 1UWBA 2XHBA 4C8LA 2E2QA 1BI4A 4CCHA 3M1FA 3ZYYX 3FZFA 3T1AA 4CJRA 3TWHA 4O44A 2UXBK 3C0BA 3F9MA 5HRPA 3QFPA 2Q1NA 3CHWA 4MO4A 3D0PA 4BG8A 1X9SA 1D4XA 3OYGA 4CBXA 4Z4HA 1XWLA 1VSKA 4BC3A 4HTLA 4DTUA 3HYFA 4DR6K 4BDZA 3U8XA 4H0PA 2XY5A 1KXPA 2F96A 2YCHA 4FWRA 4E7IA 1YITN 3RVCA 4XH1A 3J8AA
chains in the Genus database with same CATH topology
4HUFA 4KI4A 4FK0A 3HPOA 2HHTA 4O55A 1BGXT 1FKOA 4FLZA 1XI1A 4NYFA 3LPUA 1X1PA 1L3UA 4ZTJA 3HPGA 3KLEA 3SQ4A 3QINA 2E4LA 4F4KA 4FK4A 4DSKA 4J2EA 3KLHA 3OYKA 1S6PA 4FZZA 4CJ4A 2Z1GA 3V1OA 5T7BA 1NK4A 3PO5A 4C8KA 1RT4A 3F9KA 2O4IA 2E6MA 1IKVA 4DTMA 3QNNA 2BE2A 4TSXA 1NK5A 3AO5A 5CY4A 4OLBA 2KTQA 4KPYA 4CF2A 3QERA 3ZSWA 3LP2A 3WNHA 1TVRA 4EZ9A 4FLVA 1WSFA 4M42A 4GVMA 1ZBFA 2VG6A 2ZD1A 4CEBA 2JLEA 3AO2A 1C0MA 3OS1A 3OYEA 4CFBA 3KD5E 4M41A 4B3OA 1RT1A 2B4JA 1T03A 4FJ9A 4O5BA 1KFSA 3V4IA 4HCBA 4ZHRA 1L3SA 4M3ZA 4M3WA 5E41A 1EKEA 1KCFA 3FFIA 4KTZA 1DLOA 2D0BA 2ETJA 3M8QA 4MQ3A 4FVMA 3VQ7A 3O3FA 3MEGA 1RDCA 3MECA 1KSPA 4I2PA 1VRTA 1LAWA 1UAXA 1WAJA 2OPSA 4EP5A 4KI6A 4O0JA 1RT5A 3ZSQA 3OYIA 1D9FA 1NOZA 4FJLA 2IAJA 3LWMA 4CHYA 1JXEA 1IKXA 1RDDA 3OYCA 4AHVA 4PWDA 2GUIA 4B9MA 1RILA 1S9GA 4DTOA 4FM2A 3KK1A 4NCBA 4DFMA 4M3YA 2HNZA 3RR8A 3UIQA 1RT2A 3M8SA 4B8CA 2YHBA 2G8VA 2G8UA 2O4GA 4CJFA 1LAVA 2XY6A 3SQ2A 3NFAA 2G8KA 4OLAA 3E01A 1BIUA 4RG8A 4OJRA 1REVA 1XHZA 3DRRA 3VA0A 1Z25A 3OYFA 3HPHA 4CGDA 3SV4A 3HSTB 3VQEA 3QNOA 3WNGA 1N6QA 2PY5A 3KKRA 5D3GA 4FXDA 4F3TA 4PUOA 3SUQA 3NF6A 4DMNA 3O4QA 5HROA 5CYQA 1BQNA 1RT6A 3AV9A 1WSEA 3ALYA 4CGHA 3F73A 1BIZA 4KKOA 3QLHA 3CQ8A 2P5OA 5DMRA 3QEVA 3SUNA 3AO4A 4KREA 5HRSA 3AVNA 1ZBUA 4NCAA 1IO2A 4K8ZA 3OYDA 4IKFA 1HYSA 4AILC 3L2QA 3VA3A 3U3GA 3NH1A 4KHUA 4DLEA 4DTJA 1EX4A 4JLHA 3V9SA 1LV5A 3I8DA 1B9DA 1XHXA 1WN7A 3PX6A 1CZBA 2OYQA 1U48A 3HK2A 4FJ5A 1A5WA 5HLFA 5K14A 1ZBIA 1Z26A 1BL3A 1RCHA 2KQ2A 3L8BA 3NBPA 1NK6A 4RW8A 3ASMA 2YNFA 4YFUA 1NJWA 2FC0A 2XO7A 1RBTA 5HP1A 3OYBA 3RRGA 3WNEA 3TARA 1K6YA 3ZT4A 4BE1A 1KVAA 4GMJB 3ZT1A 4DSJA 3OVNA 4CJQA 4OKKA 4FLTA 2X78A 4DS4A 2PYLA 3BGRA 3G10A 4CHZA 4W5TA 4E3SA 4FJ7A 3LWLA 3VQ6A 1JL2A 3NF9A 3QIOA 1S1WA 4CF1A 3OYLA 2XY8A 4FZXC 1VRUA 2KFNA 1DTQA 4LSLA 1LWCA 1HYVA 3OJSA 3RMAA 3V81A 4C8OA 1VSEA 1YTUA 3DLRA 3OYAA 1WSHA 3SZ2A 1HMVA 4DQQA 4AHSA 3NAEA 4CK3A 4PA1A 3NCIA 2KZMA 5HRRA 3EZ5A 1HNVA 3TI0A 4F2SA 1C1CA 3P1GA 1HQEA 1NK0A 2HB5A 4FJNA 3HJFA 3MEEA 4Z0UA 4W5NA 2E6LA 4FJJA 2YNIA 1HNIA 4K8XA 4CFAA 3O3GA 4FLUA 3DM2A 1KVBA 1YTAA 4WE1A 4DQPA 1J9AA 3LP3A 4QCLA 3CM5A 2Z1IA 4CJTA 3LAMA 1ZYQA 4RW9A 1VSDA 1QHTA 3ZSXA 4W5QA 3L3VA 3LAKA 3MXMA 2HNYA 4OVLA 1KRPA 4LSNA 4DF8A 1RBVA 1GOBA 3RMDA 4CJSA 3ZT3A 4IG3A 4J2DA 1W9HA 4CEAA 4EZ6A 4DFJA 1J54A 1G15A 3VQBA 3DMJA 4AH9A 4JS5A 3AA4A 1L3VA 4OGCA 4EP4A 4IDKA 4B9SA 3KIOA 3L3UA 4KTWA 3DLBA 4JS4A 1SV5A 3QO9A 2A1RA 2HHUA 3SPZA 5JS2A 1I39A 2WONA 3LANA 4LH4A 4CJ3A 4FK2A 2AJQA 5HRNA 2D5RA 2RF2A 1RBSA 3NHGA 4BDPA 2RN2A 5KGWA 3C6UA 3OYMA 4DG1A 4B9UA 2RKIA 1FK9A 4OPJA 1QQCA 3K5LA 1WNSA 3I0RA 1TK8A 3DOKA 1ZBLA 4J2AA 4KAZA 3CYMA 4DU1A 3KD1E 1IH7A 1LWEA 1W0HA 4CJ5A 4CJWA 3TAFA 3TAEA 1JXBA 4W5OA 4ZTFA 3ZSOA 1TAQA 4BWJA 3SQ0A 4B9NA 4FJGA 2D0AA 3AVMA 3AA5X 4OKEA 4DU3A 1BHLA 4XIUA 4CHPA 4DFKA 1BQMA 3ZCMA 3A2FA 4DQRA 4DF4A 1S5JA 4AHCA 1S6QA 2YHAA 3G0ZA 3HP6A 2HHSA 3AVKA 4CK1A 4GW6A 4O4GA 2I5JA 5FRNA 3LZJA 3OJUA 5C25A 4FLYA 1EXQA 1QS4A 1NK7A 5CZ1A 2HHXA 3JSMA 4OGEA 2GBZA 3P83D 1KTQA 4CFDA 1S1VA 3P5JA 1ASWA 2HHWA 1WLJA 4CF9A 4DU4A 1UOCA 4IG0A 1ASUA 3DI6A 4CJKA 3TAMA 4QAGA 2ITGA 1T05A 1S9EA 1NKCA 3VQDA 4CGJA 4CHQA 4CIFA 5KRSA 3VQQA 2IS3A 1LWFA 4CJEA 3ITHA 4CJUA 3DLGA 1N5YA 4DS5A 1D9DA 3PO4A 4ELTA 4FZYA 4ICLA 5C42A 2WOMA 3KTQA 3S9HA 2GV9A 4J2BA 1HJRA 4DTNA 2BDPA 2QK9A 4I9QA 4FYDA 4CGFA 5KTQA 1NKBA 3D45A 2XRIA 3C94A 4Q5VA 1VSJA 3L2VA 4Z4IA 1QE1A 2G8WA 1F21A 1C0UA 1C0TA 1GOAA 3C6TA 4DSFA 4CIEA 4M3XA 1IG9A 4FLXA 3LZIA 4M3TA 1NK8A 4RW4A 1Q9YA 1TAUA 3AVHA 4KHYA 4CHNA 3K5OA 2PZSA 1QSLA 4C8MA 3HXMA 1TK5A 3V9XA 5J2PA 4AHUA 3NGYA 2QKBA 4CEEA 4F2RA 2OZMA 5FROA 1RT7A 4CEOA 4CEQA 2FBTA 5FDLA 4UQGA 3CFRA 3NGZA 3TAPA 2P51A 4OKJA 3PX4A 2D0CA 3AA3A 2Y1JA 4HUEA 4N76A 2B6AA 5KGXA 4HVJA 3NGIA 1NJXA 3C95A 1SKSA 2OZSA 4DTRA 3LP1A 5J2QA 1T8EA 2KFZA 2DFHA 2HMIA 1B9FA 2KZZA 3ZT2A 3K2PA 3AVLA 5FRMA 4DSEA 4B9LA 4M3RA 4DWIA 3MXIA 4IFYA 4B9TA 4HCCA 3K5NA 2F8SA 2OPRA 1NJYA 1QTMA 3NDKA 1YVUA 3HO1A 1KVCA 2HHVA 1RNHA 4LY7A 1LW2A 1RTIA 1Q9XA 4F8RA 3OYHA 3OY9A 4JRPA 2Z1HA 3DLEA 3T3FA 3VQPA 4CEDA 3I0SA 1KLMA 1TKZA 3M8RA 1O1WA 3JYTA 1NKEA 4HHTA 1R0AA 1JLFA 3V1QA 4ID1A 3AVGA 4B9VA 3U6FA 1SKRA 3LALA 3RWUA 2Y1IA 3OYNA 1U45A 3TABA 4Z4FA 1VSIA 1D5AA 2VG7A 1JL1A 3ZT0A 1CXUA 1NJZA 5J2MA 4KTQA 1IKYA 3DOLA 1TGOA 1U04A 2LSNA 3CFOA 5DK5A 3KJVA 4LH5A 3PV8A 3S3NA 3SQ1A 1RBRA 4E7LA 1C6VA 3K5MA 5KI6A 5I3UA 1Y97A 2BANA 1HPZA 3K58A 5KRTA 4N5SA 4HTUA 2XY7A 2YNHA 4CJVA 1SL1A 4N41A 3PY8A 4CIGA 1KFDA 4Y1DA 2Q3SA 2VWJA 4FM0A 1IKWA 3VQ9A 2HW3A 4FJIA 4CECA 5SZTA 3QEXA 4FM1A 3QEWA 1EP4A 3HT3A 3SJJA 4BE0A 4I2QA 3OS0A 3V9ZA 2IOCA 4BWMA 1U49A 2ZE2A 3L2UA 3NE6A 2JGUA 1EETA 4PY5A 3VQ5A 2DFFA 1C1AA 3RTVA 4FJXA 3V1RA 3QESA 1J5OA 4CGGA 2P1JA 2X6NA 3DLHA 2P5GA 2HVIA 5CZ2A 5HBMA 4LD0A 1SL2A 3S3MA 3AO3A 3IG1A 2IGIA 2BGGA 4YNQA 1MU2A 3S3OA 4NYNA 3M8PA 3NH2A 4FW1A 4DTXA 1Q8IA 4KO0A 1C1BA 1VSFA 3EY1A 3RMCA 1XC9A 1U47A 4KHNA 3KKSA 1FXXA 1HRHA 4H4MA 2RPIA 1JLAA 2FBXA 1ASVA 3VQ8A 1SUQA 4MFBA 2IC3A 4OPKA 4DTSA 1L3TA 4FJKA 1A5VA 2VWKA 2X74A 4H8KA 4G1QA 3NF7A 3T19A 4R5PA 3KK3A 2FBYA 2ATQA 1WSGA 4RW7A 4E89A 3TAQA 1JKHA 2DY4A 4I7FA 4IFVA 2HNDA 3AVCA 1VSMA 3WNFA 5I42A 1WAFA 2ZQBA 3KLFA 3V6DA 3ZSZA 2VG5A 2R7YA 1SL0A 4DLGA 3O4NA 1TL1A 5SWMA 4DQSA 4E0DA 4NCGA 1S1XA 4FJ8A 2W42A 3B6PA 1X9WA 1B92A 3RRHA 4RW6A 3AO1A 1X9MA 1JLEA 4Q0BA 4KFBA 1TV6A 4O0IA 3BDPA 1BCMA 4Y1CA 3CFPA 3ZSYA 3THVA 2OPQA 3LPTA 1BCOA 3L2WA 1WSIA 4FLWA 3SI6A 4CF0A 1TK0A 1RTHA 1TKTA 4AHRA 2YNGA 3EYZA 1CXQA 4B8AB 5J2NA 3QEIA 5JS1A 4FCYA 3V9UA 2FBVA 1QSSA 2G8IA 1A5XA 3SUPA 4E7KA 3SNNA 4L8RB 1RT3A 4Z4EA 4KRFA 5EU7A 4PQUA 3ULDA 1CZ9A 3B6OA 3KLGA 1HQUA 1RBUA 3AVBA 3HL8A 1J53A 1VSLA 4CESA 4CJLA 3SCXA 3NF8A 1UA1A 3IRXA 4KHQA 2X6SA 4KHSA 3DLKA 2DTUA 1ZBHA 2KW4A 4CEZA 1TL3A 3OS2A 3QEPA 1T7PA 3MXJA 3VQCA 4ELVA 3V9WA 3ZSRA 1RDBA 3CM6A 4CJPA 5C24A 4CFCA 1JLCA 4W5RA 4DSIA 3VN5A 3AVFA 3TANA 3QIPA 3SPYA 1JLBA 3OYJA 3SYZA 1TKXA 4Z4CA 4E7JA 1BISA 4QOZB 1I3AA 2OPPA 4BACA 4ID5A 3VQ4A 4E19A 4N56A 1YT3A 4AHTA 4BE2A 2OA8A 4KHWA 1DTTA 2IDOA 1RDAA 1RTDA 4CE9A 3IS9A 4KB1A 3O3HA 3HM9A 3LDSA 3SV3A 2F8TA 3AVAA 4CHOA 2EX3A 2YKNA 3HVTA 3K59A 2HVHA 4Z4GA 1QSYA 4KV8A 2G8FA 5CYMA 3TAGA 1BI4B 2EHGA 4C8NA 4DSLA 3PX0A 3KK2A 3AVJA 1L5UA 3DYAA 1S1TA 3RR7A 4ELUA 3DRPA 4CK2A 1KLNA 1CLQA 3HVRA 3HP9A 4IBNA 2XHBA 1UWBA 4M45A 1D8YA 1VSHA 3KLIA 2QKKA 4C8LA 4FJMA 3MAQA 1S1UA 1BI4A 1LW0A 4CGIA 3MEDA 4JRQA 2NUBA 4BDYA 1TKDA 4CCHA 3PUFA 3CG7A 4B08A 3T1AA 4CJRA 3AA2A 3TWHA 1VK0A 2DFEA 1UA0A 4O44A 1NOYA 1RTJA 2A1SA 4E1MA 4H4OA 4DFPA 2PYJA 5HRPA 4FJHA 4N47A 3D0PA 3NH0A 1X9SA 3IAYA 4F3OA 3OYGA 1NK9A 4M3UA 3DRSA 3U3YA 1U4BA 4Z4HA 2YV0X 3K57A 1FKPA 2QXFA 1XWLA 3QETA 1VSKA 1WSJA 3H08A 4CEFA 2G8HA 4I9LA 4DTUA 3L2RA 2HHQA 3HYFA 1HYZA 1JLQA 4CF8A 2YKMA 3SUOA 4E7HA 4BDZA 1ITGA 4FW2A 4KB0A 4CERA 3LP0A 1JLGA 3RMBA 3VQAA 3ZSVA 2F96A 4E1NA 2XY5A 3ISNC 1SKWA 2B5JA 4E7IA 5J1EA 3AVIA 4DTPA 4HUGA 1GOCA 3TR8A 2Z1JA 4DQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HUF A;  4KI4 A;  4FK0 A;  3HPO A;  2HHT A;  4O55 A;  1BGX T;  1FKO A;  4FLZ A;  1XI1 A;  4NYF A;  3LPU A;  1X1P A;  1L3U A;  4ZTJ A;  3HPG A;  3KLE A;  3SQ4 A;  3QIN A;  2E4L A;  4F4K A;  4FK4 A;  4DSK A;  4J2E A;  3KLH A;  3OYK A;  1S6P A;  4FZZ A;  4CJ4 A;  2Z1G A;  3V1O A;  5T7B A;  1NK4 A;  3PO5 A;  4C8K A;  1RT4 A;  3F9K A;  2O4I A;  2E6M A;  1IKV A;  4DTM A;  3QNN A;  2BE2 A;  4TSX A;  1NK5 A;  3AO5 A;  5CY4 A;  4OLB A;  2KTQ A;  4KPY A;  4CF2 A;  3QER A;  3ZSW A;  3LP2 A;  3WNH A;  1TVR A;  4EZ9 A;  4FLV A;  1WSF A;  4M42 A;  4GVM A;  1ZBF A;  2VG6 A;  2ZD1 A;  4CEB A;  2JLE A;  3AO2 A;  1C0M A;  3OS1 A;  3OYE A;  4CFB A;  3KD5 E;  4M41 A;  4B3O A;  1RT1 A;  2B4J A;  1T03 A;  4FJ9 A;  4O5B A;  1KFS A;  3V4I A;  4HCB A;  4ZHR A;  1L3S A;  4M3Z A;  4M3W A;  5E41 A;  1EKE A;  1KCF A;  3FFI A;  4KTZ A;  1DLO A;  2D0B A;  2ETJ A;  3M8Q A;  4MQ3 A;  4FVM A;  3VQ7 A;  3O3F A;  3MEG A;  1RDC A;  3MEC A;  1KSP A;  4I2P A;  1VRT A;  1LAW A;  1UAX A;  1WAJ A;  2OPS A;  4EP5 A;  4KI6 A;  4O0J A;  1RT5 A;  3ZSQ A;  3OYI A;  1D9F A;  1NOZ A;  4FJL A;  2IAJ A;  3LWM A;  4CHY A;  1JXE A;  1IKX A;  1RDD A;  3OYC A;  4AHV A;  4PWD A;  2GUI A;  4B9M A;  1RIL A;  1S9G A;  4DTO A;  4FM2 A;  3KK1 A;  4NCB A;  4DFM A;  4M3Y A;  2HNZ A;  3RR8 A;  3UIQ A;  1RT2 A;  3M8S A;  4B8C A;  2YHB A;  2G8V A;  2G8U A;  2O4G A;  4CJF A;  1LAV A;  2XY6 A;  3SQ2 A;  3NFA A;  2G8K A;  4OLA A;  3E01 A;  1BIU A;  4RG8 A;  4OJR A;  1REV A;  1XHZ A;  3DRR A;  3VA0 A;  1Z25 A;  3OYF A;  3HPH A;  4CGD A;  3SV4 A;  3HST B;  3VQE A;  3QNO A;  3WNG A;  1N6Q A;  2PY5 A;  3KKR A;  5D3G A;  4FXD A;  4F3T A;  4PUO A;  3SUQ A;  3NF6 A;  4DMN A;  3O4Q A;  5HRO A;  5CYQ A;  1BQN A;  1RT6 A;  3AV9 A;  1WSE A;  3ALY A;  4CGH A;  3F73 A;  1BIZ A;  4KKO A;  3QLH A;  3CQ8 A;  2P5O A;  5DMR A;  3QEV A;  3SUN A;  3AO4 A;  4KRE A;  5HRS A;  3AVN A;  1ZBU A;  4NCA A;  1IO2 A;  4K8Z A;  3OYD A;  4IKF A;  1HYS A;  4AIL C;  3L2Q A;  3VA3 A;  3U3G A;  3NH1 A;  4KHU A;  4DLE A;  4DTJ A;  1EX4 A;  4JLH A;  3V9S A;  1LV5 A;  3I8D A;  1B9D A;  1XHX A;  1WN7 A;  3PX6 A;  1CZB A;  2OYQ A;  1U48 A;  3HK2 A;  4FJ5 A;  1A5W A;  5HLF A;  5K14 A;  1ZBI A;  1Z26 A;  1BL3 A;  1RCH A;  2KQ2 A;  3L8B A;  3NBP A;  1NK6 A;  4RW8 A;  3ASM A;  2YNF A;  4YFU A;  1NJW A;  2FC0 A;  2XO7 A;  1RBT A;  5HP1 A;  3OYB A;  3RRG A;  3WNE A;  3TAR A;  1K6Y A;  3ZT4 A;  4BE1 A;  1KVA A;  4GMJ B;  3ZT1 A;  4DSJ A;  3OVN A;  4CJQ A;  4OKK A;  4FLT A;  2X78 A;  4DS4 A;  2PYL A;  3BGR A;  3G10 A;  4CHZ A;  4W5T A;  4E3S A;  4FJ7 A;  3LWL A;  3VQ6 A;  1JL2 A;  3NF9 A;  3QIO A;  1S1W A;  4CF1 A;  3OYL A;  2XY8 A;  4FZX C;  1VRU A;  2KFN A;  1DTQ A;  4LSL A;  1LWC A;  1HYV A;  3OJS A;  3RMA A;  3V81 A;  4C8O A;  1VSE A;  1YTU A;  3DLR A;  3OYA A;  1WSH A;  3SZ2 A;  1HMV A;  4DQQ A;  4AHS A;  3NAE A;  4CK3 A;  4PA1 A;  3NCI A;  2KZM A;  5HRR A;  3EZ5 A;  1HNV A;  3TI0 A;  4F2S A;  1C1C A;  3P1G A;  1HQE A;  1NK0 A;  2HB5 A;  4FJN A;  3HJF A;  3MEE A;  4Z0U A;  4W5N A;  2E6L A;  4FJJ A;  2YNI A;  1HNI A;  4K8X A;  4CFA A;  3O3G A;  4FLU A;  3DM2 A;  1KVB A;  1YTA A;  4WE1 A;  4DQP A;  1J9A A;  3LP3 A;  4QCL A;  3CM5 A;  2Z1I A;  4CJT A;  3LAM A;  1ZYQ A;  4RW9 A;  1VSD A;  1QHT A;  3ZSX A;  4W5Q A;  3L3V A;  3LAK A;  3MXM A;  2HNY A;  4OVL A;  1KRP A;  4LSN A;  4DF8 A;  1RBV A;  1GOB A;  3RMD A;  4CJS A;  3ZT3 A;  4IG3 A;  4J2D A;  1W9H A;  4CEA A;  4EZ6 A;  4DFJ A;  1J54 A;  1G15 A;  3VQB A;  3DMJ A;  4AH9 A;  4JS5 A;  3AA4 A;  1L3V A;  4OGC A;  4EP4 A;  4IDK A;  4B9S A;  3KIO A;  3L3U A;  4KTW A;  3DLB A;  4JS4 A;  1SV5 A;  3QO9 A;  2A1R A;  2HHU A;  3SPZ A;  5JS2 A;  1I39 A;  2WON A;  3LAN A;  4LH4 A;  4CJ3 A;  4FK2 A;  2AJQ A;  5HRN A;  2D5R A;  2RF2 A;  1RBS A;  3NHG A;  4BDP A;  2RN2 A;  5KGW A;  3C6U A;  3OYM A;  4DG1 A;  4B9U A;  2RKI A;  1FK9 A;  4OPJ A;  1QQC A;  3K5L A;  1WNS A;  3I0R A;  1TK8 A;  3DOK A;  1ZBL A;  4J2A A;  4KAZ A;  3CYM A;  4DU1 A;  3KD1 E;  1IH7 A;  1LWE A;  1W0H A;  4CJ5 A;  4CJW A;  3TAF A;  3TAE A;  1JXB A;  4W5O A;  4ZTF A;  3ZSO A;  1TAQ A;  4BWJ A;  3SQ0 A;  4B9N A;  4FJG A;  2D0A A;  3AVM A;  3AA5 X;  4OKE A;  4DU3 A;  1BHL A;  4XIU A;  4CHP A;  4DFK A;  1BQM A;  3ZCM A;  3A2F A;  4DQR A;  4DF4 A;  1S5J A;  4AHC A;  1S6Q A;  2YHA A;  3G0Z A;  3HP6 A;  2HHS A;  3AVK A;  4CK1 A;  4GW6 A;  4O4G A;  2I5J A;  5FRN A;  3LZJ A;  3OJU A;  5C25 A;  4FLY A;  1EXQ A;  1QS4 A;  1NK7 A;  5CZ1 A;  2HHX A;  3JSM A;  4OGE A;  2GBZ A;  3P83 D;  1KTQ A;  4CFD A;  1S1V A;  3P5J A;  1ASW A;  2HHW A;  1WLJ A;  4CF9 A;  4DU4 A;  1UOC A;  4IG0 A;  1ASU A;  3DI6 A;  4CJK A;  3TAM A;  4QAG A;  2ITG A;  1T05 A;  1S9E A;  1NKC A;  3VQD A;  4CGJ A;  4CHQ A;  4CIF A;  5KRS A;  3VQQ A;  2IS3 A;  1LWF A;  4CJE A;  3ITH A;  4CJU A;  3DLG A;  1N5Y A;  4DS5 A;  1D9D A;  3PO4 A;  4ELT A;  4FZY A;  4ICL A;  5C42 A;  2WOM A;  3KTQ A;  3S9H A;  2GV9 A;  4J2B A;  1HJR A;  4DTN A;  2BDP A;  2QK9 A;  4I9Q A;  4FYD A;  4CGF A;  5KTQ A;  1NKB A;  3D45 A;  2XRI A;  3C94 A;  4Q5V A;  1VSJ A;  3L2V A;  4Z4I A;  1QE1 A;  2G8W A;  1F21 A;  1C0U A;  1C0T A;  1GOA A;  3C6T A;  4DSF A;  4CIE A;  4M3X A;  1IG9 A;  4FLX A;  3LZI A;  4M3T A;  1NK8 A;  4RW4 A;  1Q9Y A;  1TAU A;  3AVH A;  4KHY A;  4CHN A;  3K5O A;  2PZS A;  1QSL A;  4C8M A;  3HXM A;  1TK5 A;  3V9X A;  5J2P A;  4AHU A;  3NGY A;  2QKB A;  4CEE A;  4F2R A;  2OZM A;  5FRO A;  1RT7 A;  4CEO A;  4CEQ A;  2FBT A;  5FDL A;  4UQG A;  3CFR A;  3NGZ A;  3TAP A;  2P51 A;  4OKJ A;  3PX4 A;  2D0C A;  3AA3 A;  2Y1J A;  4HUE A;  4N76 A;  2B6A A;  5KGX A;  4HVJ A;  3NGI A;  1NJX A;  3C95 A;  1SKS A;  2OZS A;  4DTR A;  3LP1 A;  5J2Q A;  1T8E A;  2KFZ A;  2DFH A;  2HMI A;  1B9F A;  2KZZ A;  3ZT2 A;  3K2P A;  3AVL A;  5FRM A;  4DSE A;  4B9L A;  4M3R A;  4DWI A;  3MXI A;  4IFY A;  4B9T A;  4HCC A;  3K5N A;  2F8S A;  2OPR A;  1NJY A;  1QTM A;  3NDK A;  1YVU A;  3HO1 A;  1KVC A;  2HHV A;  1RNH A;  4LY7 A;  1LW2 A;  1RTI A;  1Q9X A;  4F8R A;  3OYH A;  3OY9 A;  4JRP A;  2Z1H A;  3DLE A;  3T3F A;  3VQP A;  4CED A;  3I0S A;  1KLM A;  1TKZ A;  3M8R A;  1O1W A;  3JYT A;  1NKE A;  4HHT A;  1R0A A;  1JLF A;  3V1Q A;  4ID1 A;  3AVG A;  4B9V A;  3U6F A;  1SKR A;  3LAL A;  3RWU A;  2Y1I A;  3OYN A;  1U45 A;  3TAB A;  4Z4F A;  1VSI A;  1D5A A;  2VG7 A;  1JL1 A;  3ZT0 A;  1CXU A;  1NJZ A;  5J2M A;  4KTQ A;  1IKY A;  3DOL A;  1TGO A;  1U04 A;  2LSN A;  3CFO A;  5DK5 A;  3KJV A;  4LH5 A;  3PV8 A;  3S3N A;  3SQ1 A;  1RBR A;  4E7L A;  1C6V A;  3K5M A;  5KI6 A;  5I3U A;  1Y97 A;  2BAN A;  1HPZ A;  3K58 A;  5KRT A;  4N5S A;  4HTU A;  2XY7 A;  2YNH A;  4CJV A;  1SL1 A;  4N41 A;  3PY8 A;  4CIG A;  1KFD A;  4Y1D A;  2Q3S A;  2VWJ A;  4FM0 A;  1IKW A;  3VQ9 A;  2HW3 A;  4FJI A;  4CEC A;  5SZT A;  3QEX A;  4FM1 A;  3QEW A;  1EP4 A;  3HT3 A;  3SJJ A;  4BE0 A;  4I2Q A;  3OS0 A;  3V9Z A;  2IOC A;  4BWM A;  1U49 A;  2ZE2 A;  3L2U A;  3NE6 A;  2JGU A;  1EET A;  4PY5 A;  3VQ5 A;  2DFF A;  1C1A A;  3RTV A;  4FJX A;  3V1R A;  3QES A;  1J5O A;  4CGG A;  2P1J A;  2X6N A;  3DLH A;  2P5G A;  2HVI A;  5CZ2 A;  5HBM A;  4LD0 A;  1SL2 A;  3S3M A;  3AO3 A;  3IG1 A;  2IGI A;  2BGG A;  4YNQ A;  1MU2 A;  3S3O A;  4NYN A;  3M8P A;  3NH2 A;  4FW1 A;  4DTX A;  1Q8I A;  4KO0 A;  1C1B A;  1VSF A;  3EY1 A;  3RMC A;  1XC9 A;  1U47 A;  4KHN A;  3KKS A;  1FXX A;  1HRH A;  4H4M A;  2RPI A;  1JLA A;  2FBX A;  1ASV A;  3VQ8 A;  1SUQ A;  4MFB A;  2IC3 A;  4OPK A;  4DTS A;  1L3T A;  4FJK A;  1A5V A;  2VWK A;  2X74 A;  4H8K A;  4G1Q A;  3NF7 A;  3T19 A;  4R5P A;  3KK3 A;  2FBY A;  2ATQ A;  1WSG A;  4RW7 A;  4E89 A;  3TAQ A;  1JKH A;  2DY4 A;  4I7F A;  4IFV A;  2HND A;  3AVC A;  1VSM A;  3WNF A;  5I42 A;  1WAF A;  2ZQB A;  3KLF A;  3V6D A;  3ZSZ A;  2VG5 A;  2R7Y A;  1SL0 A;  4DLG A;  3O4N A;  1TL1 A;  5SWM A;  4DQS A;  4E0D A;  4NCG A;  1S1X A;  4FJ8 A;  2W42 A;  3B6P A;  1X9W A;  1B92 A;  3RRH A;  4RW6 A;  3AO1 A;  1X9M A;  1JLE A;  4Q0B A;  4KFB A;  1TV6 A;  4O0I A;  3BDP A;  1BCM A;  4Y1C A;  3CFP A;  3ZSY A;  3THV A;  2OPQ A;  3LPT A;  1BCO A;  3L2W A;  1WSI A;  4FLW A;  3SI6 A;  4CF0 A;  1TK0 A;  1RTH A;  1TKT A;  4AHR A;  2YNG A;  3EYZ A;  1CXQ A;  4B8A B;  5J2N A;  3QEI A;  5JS1 A;  4FCY A;  3V9U A;  2FBV A;  1QSS A;  2G8I A;  1A5X A;  3SUP A;  4E7K A;  3SNN A;  4L8R B;  1RT3 A;  4Z4E A;  4KRF A;  5EU7 A;  4PQU A;  3ULD A;  1CZ9 A;  3B6O A;  3KLG A;  1HQU A;  1RBU A;  3AVB A;  3HL8 A;  1J53 A;  1VSL A;  4CES A;  4CJL A;  3SCX A;  3NF8 A;  1UA1 A;  3IRX A;  4KHQ A;  2X6S A;  4KHS A;  3DLK A;  2DTU A;  1ZBH A;  2KW4 A;  4CEZ A;  1TL3 A;  3OS2 A;  3QEP A;  1T7P A;  3MXJ A;  3VQC A;  4ELV A;  3V9W A;  3ZSR A;  1RDB A;  3CM6 A;  4CJP A;  5C24 A;  4CFC A;  1JLC A;  4W5R A;  4DSI A;  3VN5 A;  3AVF A;  3TAN A;  3QIP A;  3SPY A;  1JLB A;  3OYJ A;  3SYZ A;  1TKX A;  4Z4C A;  4E7J A;  1BIS A;  4QOZ B;  1I3A A;  2OPP A;  4BAC A;  4ID5 A;  3VQ4 A;  4E19 A;  4N56 A;  1YT3 A;  4AHT A;  4BE2 A;  2OA8 A;  4KHW A;  1DTT A;  2IDO A;  1RDA A;  1RTD A;  4CE9 A;  3IS9 A;  4KB1 A;  3O3H A;  3HM9 A;  3LDS A;  3SV3 A;  2F8T A;  3AVA A;  4CHO A;  2EX3 A;  2YKN A;  3HVT A;  3K59 A;  2HVH A;  4Z4G A;  1QSY A;  4KV8 A;  2G8F A;  5CYM A;  3TAG A;  1BI4 B;  2EHG A;  4C8N A;  4DSL A;  3PX0 A;  3KK2 A;  3AVJ A;  1L5U A;  3DYA A;  1S1T A;  3RR7 A;  4ELU A;  3DRP A;  4CK2 A;  1KLN A;  1CLQ A;  3HVR A;  3HP9 A;  4IBN A;  2XHB A;  1UWB A;  4M45 A;  1D8Y A;  1VSH A;  3KLI A;  2QKK A;  4C8L A;  4FJM A;  3MAQ A;  1S1U A;  1BI4 A;  1LW0 A;  4CGI A;  3MED A;  4JRQ A;  2NUB A;  4BDY A;  1TKD A;  4CCH A;  3PUF A;  3CG7 A;  4B08 A;  3T1A A;  4CJR A;  3AA2 A;  3TWH A;  1VK0 A;  2DFE A;  1UA0 A;  4O44 A;  1NOY A;  1RTJ A;  2A1S A;  4E1M A;  4H4O A;  4DFP A;  2PYJ A;  5HRP A;  4FJH A;  4N47 A;  3D0P A;  3NH0 A;  1X9S A;  3IAY A;  4F3O A;  3OYG A;  1NK9 A;  4M3U A;  3DRS A;  3U3Y A;  1U4B A;  4Z4H A;  2YV0 X;  3K57 A;  1FKP A;  2QXF A;  1XWL A;  3QET A;  1VSK A;  1WSJ A;  3H08 A;  4CEF A;  2G8H A;  4I9L A;  4DTU A;  3L2R A;  2HHQ A;  3HYF A;  1HYZ A;  1JLQ A;  4CF8 A;  2YKM A;  3SUO A;  4E7H A;  4BDZ A;  1ITG A;  4FW2 A;  4KB0 A;  4CER A;  3LP0 A;  1JLG A;  3RMB A;  3VQA A;  3ZSV A;  2F96 A;  4E1N A;  2XY5 A;  3ISN C;  1SKW A;  2B5J A;  4E7I A;  5J1E A;  3AVI A;  4DTP A;  4HUG A;  1GOC A;  3TR8 A;  2Z1J A;  4DQI A; 
#chains in the Genus database with same CATH topology
 4HUF A;  2P9N B;  1QQM A;  3THY B;  3THW B;  3P31 A;  1X1P A;  4BVO A;  4BRA A;  1TYQ B;  4DSK A;  2HBJ A;  1S6P A;  3L4I A;  3E66 A;  3V1O A;  1JCE A;  3F9K A;  5JVH L;  2BE2 A;  2HOE A;  4TSX A;  3AO5 A;  5CY4 A;  4DV0 K;  4OLB A;  3O8M A;  4KPY A;  4CF2 A;  3LP2 A;  1BU6 O;  3VTH A;  1SZ2 A;  4EZ9 A;  4FLV A;  4GKJ K;  3ENO A;  2VG6 A;  2JLE A;  5HL7 L;  4CFB A;  4M41 A;  2B4J A;  1T03 A;  4LFC K;  2P9U A;  3PSI A;  4M3W A;  1DLO A;  2D0B A;  3M8Q A;  4FVM A;  1K9M O;  3MEC A;  1KSP A;  4QS7 A;  2VGN A;  4CZF A;  1VQK N;  4X66 K;  3AAP A;  1NOZ A;  4FJL A;  3OYC A;  1YVN A;  3GOI A;  1RIL A;  3CCL N;  4FM2 A;  3KK1 A;  2VGM A;  4DFM A;  4B8C A;  3VEV A;  2G8U A;  2O4G A;  4FO0 A;  4A5A A;  3GBT A;  3CET A;  4WQ4 A;  1V4T A;  3KHY A;  3VA0 A;  1Z25 A;  5KPT A;  3HST B;  3QNO A;  1N6Q A;  3EN9 A;  3KK7 A;  5DM6 L;  5CYQ A;  3QLH A;  5FPE A;  5EVZ A;  3SUN A;  3N4Q A;  5M1K A;  3FZM A;  4IKF A;  2P9S A;  4DV2 K;  4AIL C;  3NH1 A;  4BQZ A;  3NMU A;  2YHW A;  3M5R A;  4KHP K;  4DV7 K;  1LV5 A;  3PX6 A;  3H1Q A;  5HLF A;  4CZH A;  3L8B A;  4EFH A;  4RW8 A;  3E1Y A;  4FWS A;  4LF6 K;  3RRG A;  5LMN K;  3ZT4 A;  1KVA A;  4MLE A;  4CJQ A;  5C2F A;  3CF5 L;  3VER A;  1O13 A;  5BRH A;  3J7A P;  1JL2 A;  4FZX C;  4B3R K;  3OYL A;  1QVG M;  3K0S A;  1DTQ A;  1VAZ A;  3BF1 A;  3SZ2 A;  1RDW X;  2RE2 A;  1MWK A;  4DQQ A;  4AHS A;  3EZW A;  1SS6 A;  1VQ4 N;  4ILJ A;  1MWM A;  4OX9 K;  1LOT B;  2HB5 A;  2VQF K;  5EY4 A;  1VQO N;  4YOT A;  4Z0U A;  2D0P A;  3CCS N;  3DM2 A;  3THW A;  4DQP A;  2UU9 K;  3A5M C;  1VSD A;  1KRP A;  3L3V A;  3LAK A;  4JN4 A;  2HNY A;  1RBV A;  3WEE B;  3ZT3 A;  4J2D A;  3VQB A;  2O8E A;  3DMJ A;  5AQW A;  3I55 N;  3AA4 A;  4B9S A;  4OGC A;  1JCF A;  4EP4 A;  4AM7 A;  3KIO A;  3BF3 A;  5AFU A;  1W97 L;  5JS2 A;  4CJ3 A;  4MDA A;  2P9I A;  4BDP A;  2RN2 A;  2VYP A;  4DG1 A;  1FK9 A;  4DV5 K;  3K5L A;  1WNS A;  4BRD A;  4KAZ A;  1IH7 A;  1HKC A;  1QHA A;  2P9P B;  4BRI A;  3JXU A;  4JKD A;  4B9N A;  4FJG A;  2D0A A;  3AVM A;  4DU3 A;  4OKE A;  1BHL A;  4M63 C;  3ZCM A;  3BUZ B;  1S6Q A;  2HHS A;  3AVK A;  5FRN A;  1ATR A;  3A0I X;  5CZ1 A;  2HHX A;  4OGE A;  1KTQ A;  4CFD A;  4NLC A;  4B1Y B;  2O8C B;  1HPM A;  4BC2 A;  2HHW A;  1WLJ A;  1Z6R A;  1ASU A;  3QBW A;  2HBL A;  3LDO A;  1S9E A;  1NKC A;  5C12 A;  1LWF A;  3MMV A;  3ITH A;  4CJE A;  3DLG A;  4CJU A;  1N5Y A;  4YOU A;  2GV9 A;  4PL7 A;  2BDP A;  3TTC A;  3F5T A;  4I9Q A;  4CGF A;  5KTQ A;  3C94 A;  4Z4I A;  1VSJ A;  3IDH A;  1F21 A;  1C0T A;  2Q31 A;  3C6T A;  3AAR A;  4JKC A;  3CI5 A;  3U9D A;  4DSF A;  3LZI A;  5KPR A;  2WUS A;  4CHN A;  1ZBS A;  3M6G A;  5AQX A;  1WOQ A;  4F2R A;  4UQG A;  3O9R A;  1HKB A;  1FW6 A;  1GLB G;  4HUE A;  4CBU A;  1NGG A;  3KWI A;  2B6A A;  4B1W B;  4BRE A;  3U9Z A;  5LY3 A;  5E84 A;  1T8E A;  2DFH A;  2ZGZ A;  2HMI A;  3ZT2 A;  4OO1 J;  4B9L A;  4DWI A;  4IFY A;  5EX5 A;  3L6Q A;  3ZX0 A;  4H0X B;  1YVU A;  4LY7 A;  1RTI A;  3OY9 A;  3MK6 A;  2NRV A;  4JI4 K;  3M8R A;  3DXM B;  1VQ8 N;  3TSU A;  2FLO A;  3P38 A;  1NKE A;  3V1Q A;  3AVG A;  3RWU A;  3OYN A;  3LM2 A;  1D5A A;  3VPZ A;  1JL1 A;  1K8A O;  3O6W A;  1X9J A;  3KJV A;  2JWK A;  4LH5 A;  3VEO A;  1C6V A;  2A41 A;  3K5M A;  1NG9 A;  2ZF5 O;  2BAN A;  1IV0 A;  4YOY A;  2YNH A;  1SL1 A;  2NZT A;  5BRE A;  4FM0 A;  1NMD A;  2P9I B;  4FJI A;  3QEX A;  3I8B A;  4FM1 A;  3CIP A;  3MDQ A;  3SJJ A;  3V9Z A;  3VF2 A;  2IOC A;  4KH6 A;  2JGU A;  1I94 K;  5FPD A;  2P5G A;  3DLH A;  3F2K A;  5HBM A;  3NVM A;  3CCQ N;  3S3O A;  4NYN A;  3NH2 A;  4FW1 A;  4FWK A;  1C1B A;  2HF4 A;  3EY1 A;  1U47 A;  4DTS A;  1SUQ A;  2IC3 A;  1L3T A;  3RMA A;  3T19 A;  4Z94 A;  4R5P A;  2FBY A;  1WSG A;  4IFV A;  1QQO A;  1WAF A;  3DXK A;  2NRR A;  3KLF A;  3ZSZ A;  2VG5 A;  1SL0 A;  4O8U A;  4DLG A;  3O4N A;  3A5N C;  5SWM A;  4DQS A;  3J7Y P;  5AJ3 K;  3JAM O;  1M90 O;  1XQS C;  1X9M A;  4JHD A;  4BC5 A;  1TV6 A;  4O0I A;  4Y1C A;  2A3Z A;  3FR0 A;  2FF6 A;  3SI6 A;  2YNG A;  5JS1 A;  1NGH A;  4PKH A;  2FSK A;  3HM8 A;  3SNN A;  4L8R B;  2QM1 A;  4PQU A;  2HST A;  4EAH D;  3SK3 A;  1SAZ A;  3TPQ A;  3ID6 A;  1UA1 A;  4CJL A;  2FSN A;  3CD6 N;  2UUB K;  1RGI A;  4KHS A;  3DLK A;  4CEZ A;  4AQY K;  3PSF A;  3QEP A;  1T7P A;  3MXJ A;  3ZSR A;  3HBT A;  3CM6 A;  2ZGY A;  2NRW A;  4W5R A;  3QIP A;  3SYZ A;  4HWI A;  4E7J A;  5C0Y A;  2OPP A;  3VQ4 A;  3J80 O;  1DTT A;  1HJO A;  4F9O A;  3CC4 N;  1RTD A;  4GV9 A;  3ULE A;  2VQE K;  2YKN A;  3FGU A;  2HVH A;  2G8F A;  5LJV A;  5LMU K;  2W6K A;  3AVJ A;  3E9L A;  3DYA A;  3RR7 A;  2QWO A;  3I33 A;  1CLQ A;  4IBN A;  4FJM A;  2NNW A;  4CZL A;  3MAQ A;  5AQQ A;  4JRQ A;  4E0D A;  2NUB A;  5LL6 Z;  4OPH A;  4B08 A;  2EWS A;  3AA2 A;  1VK0 A;  2DFE A;  1VQP N;  2A1S A;  3O9Q A;  2AA4 A;  1VQL N;  4FJH A;  4N47 A;  4ISF A;  2W6L A;  5JMV A;  4M3U A;  3U3Y A;  2YV0 X;  4K0K K;  2QXF A;  5AZI B;  2HHQ A;  3L2R A;  1W2B M;  1IBK K;  2YKM A;  4GNI A;  3SUO A;  4E7H A;  4JKA A;  4KB0 A;  1JJ2 M;  3ISN C;  5J1E A;  1ZC6 A;  5GAG P;  4DTP A;  4IEI A;  4GV3 A;  4JKB A;  4BC4 A;  2Z1J A;  1BOT O;  2F4V K;  4KI4 A;  4A62 A;  3CJB A;  4JKG A;  3LPU A;  3MWP A;  4FK4 A;  4DQ8 A;  3QIN A;  4F4K A;  3EO3 A;  5F2R A;  4J2E A;  3KLH A;  3OYK A;  2O4I A;  2QW9 A;  2E6M A;  4JHD B;  3QER A;  3ZSW A;  2KKZ A;  3ZX2 A;  4GVM A;  2OTJ N;  5IT9 O;  3OYE A;  4B3O A;  4H0Y B;  4O5B A;  1KCF A;  1SQK A;  3VQ7 A;  1NNE A;  1RDC A;  1LAW A;  1UAX A;  4KI6 A;  4O0J A;  3ZSQ A;  3LWM A;  4CHY A;  1JXE A;  4IO9 L;  1YJ9 N;  1GLA G;  4PWD A;  5GAD P;  2YJE A;  1S9G A;  1WUA A;  2P9K A;  3UIQ A;  1RT2 A;  3EEQ A;  3LDN A;  2VWB A;  5M1P A;  1T44 A;  1WBB A;  1LAV A;  2XY6 A;  2G8K A;  2F9T A;  3DRR A;  5FPN A;  4CGD A;  3VQE A;  4BRQ A;  2PY5 A;  4H5R A;  4FXD A;  4F3T A;  4JEP A;  4C23 A;  2NRZ A;  3NF6 A;  5BPL A;  1WSE A;  1S72 N;  1BIZ A;  3CQ8 A;  5DMR A;  4DHY A;  4WQ4 C;  5BN9 A;  5HRS A;  3AVN A;  1ZBU A;  4EHU A;  4FOE A;  4NCA A;  1G99 A;  3OBY A;  1HYS A;  3L2Q A;  1C0G A;  4DLE A;  1EX4 A;  2E20 A;  3I8D A;  1B9D A;  2OYQ A;  1U48 A;  2IIR A;  5K14 A;  1ZBI A;  2F7T A;  3ASM A;  3O1W A;  4YFU A;  2XO7 A;  3TAR A;  1KAX A;  2OTL N;  3OVN A;  4FLT A;  1NGF A;  3G10 A;  4CHZ A;  2V7Y A;  4FJ7 A;  3R6M A;  3VQ6 A;  4YOX A;  1VRU A;  3GG4 A;  3V81 A;  1VSE A;  3DLR A;  2YX6 A;  2O8C A;  3NAE A;  4PA1 A;  2KZM A;  3EZ5 A;  1HNV A;  3TI0 A;  3P1G A;  3ZLJ A;  3UKR B;  3HJF A;  2IVO A;  3MEE A;  4YDU C;  5BR8 K;  1HX1 A;  3O3G A;  1J9A A;  3CQY A;  4Y0W A;  4IFE A;  2Z1I A;  1YF5 L;  1ZYQ A;  4RW9 A;  1QHT A;  3H46 O;  3MXM A;  4OVL A;  4DF8 A;  1ZXO A;  3KZB A;  4DFJ A;  4EZ6 A;  1J54 A;  3N4P A;  3HRG A;  4X64 K;  3P4I A;  3DLB A;  1SV5 A;  3CPE A;  2A1R A;  3SPZ A;  3LAN A;  4LH4 A;  4JK8 A;  2RF2 A;  1RBS A;  4H5T A;  3TU5 A;  3C6U A;  1ESV A;  4BGB A;  3DOK A;  1ZBL A;  3CYM A;  4DU1 A;  4CJW A;  1HR0 K;  3B8A X;  1OKJ A;  3R3L A;  2V51 B;  4H0T B;  3ID8 A;  4CHP A;  5BR9 A;  3D2F B;  3G0Z A;  3OTO K;  1NGE A;  2YJF A;  3OJU A;  5C25 A;  1EXQ A;  5M1N A;  3BP8 A;  1BA1 A;  3JSM A;  2HMP A;  3FE1 A;  3P5J A;  1ASW A;  1TUY A;  2A40 A;  2UXD K;  4M7X A;  2P9P A;  1EWQ A;  2ITG A;  3H6E A;  2YHY A;  1FJG K;  5KRS A;  1IBM K;  3VQQ A;  4FZY A;  2NRT A;  4ICL A;  3KTQ A;  1X3M A;  2QK9 A;  2O8F A;  1BO5 O;  2XRI A;  4YOV A;  1QE1 A;  4BRO A;  1BDG A;  3EKU A;  2QWR A;  4JI2 K;  2O8E B;  3IMX A;  3MN5 A;  4M3T A;  3MN9 A;  4RW4 A;  1Q9Y A;  3K5O A;  1QSL A;  3VEY A;  1EWR A;  3HXM A;  1TK5 A;  4CEE A;  1NWK A;  2FBT A;  3NGZ A;  3TAP A;  3PX4 A;  4N76 A;  2E2O A;  3WXI A;  4FWN A;  2D0O A;  2OZS A;  4DTR A;  3LDP A;  3CJA A;  4JD2 A;  1N8R O;  4JNE A;  4QS9 A;  3K2P A;  3AVL A;  5KQ8 A;  3SMS A;  4WF9 L;  3K5N A;  2OPR A;  1NJY A;  2UUC K;  2PBD A;  1QTM A;  1KVC A;  5AQZ A;  4BRP A;  4F8R A;  1Q9X A;  3OYH A;  4JRP A;  2ZJQ L;  4A57 A;  1XUP O;  1LCU A;  4CED A;  3VQP A;  1TKZ A;  2D4W A;  3DAW A;  3CCE N;  5AQU A;  3DXM A;  2Q0U A;  2JWL A;  3JYT A;  4HHT A;  2GWK A;  3C7N A;  2GUP A;  3U6F A;  1SKR A;  2GWJ A;  2Y1I A;  2QWL A;  1U45 A;  3D7E O;  4KTQ A;  1CXU A;  5J2M A;  1IKY A;  1D9D A;  5DK5 A;  1U04 A;  3PV8 A;  3ENB A;  4BR5 A;  4CZE A;  3MX5 A;  5KI6 A;  1Y97 A;  1KAZ A;  4BRL A;  2E2N A;  4N5S A;  4DR1 K;  1N34 K;  4N41 A;  4K42 A;  4PL8 A;  3CME N;  1IKW A;  4JI3 K;  1GLE G;  3HT3 A;  4FSV A;  3O9S A;  3TTD A;  3OW2 M;  1U49 A;  3NE6 A;  4FJX A;  1C1A A;  1NBW A;  2OCE A;  3V1R A;  2O8D A;  2HVI A;  2X6N A;  4JKG B;  4LD0 A;  3S3M A;  4BQL A;  2BGG A;  2IGI A;  4DTX A;  1Q8I A;  2QTD A;  3RMC A;  2D1K A;  3BZC A;  1HRH A;  1ASV A;  4MFB A;  4FJK A;  1A5V A;  3NF7 A;  3AGK A;  4E89 A;  2DY4 A;  4BRG A;  3AVC A;  4JI6 K;  1VSM A;  4ILG B;  5I42 A;  2ZQB A;  3LDL A;  3OA9 A;  2YI1 A;  1TL1 A;  3ULE B;  3K9J A;  3VES A;  2W42 A;  2Q2R A;  3RRH A;  3RSE A;  4H0V B;  4JI1 K;  5AQJ A;  5M1Q A;  1OH8 A;  1BCM A;  3CFP A;  2OPQ A;  5JLF A;  4WFA L;  1RTH A;  3CMA N;  1CXQ A;  4B8A B;  3QEI A;  3V9U A;  1QSS A;  1A5X A;  3SUP A;  4Z4E A;  1TYQ A;  2J4R A;  3ULD A;  4IO8 A;  4NB4 A;  2CH6 A;  2E8A A;  3KLG A;  1HQU A;  3SCX A;  4CES A;  3VGL A;  3NF8 A;  5I9E B;  3CJ9 A;  1MDU B;  1NGI A;  4O8K A;  4DR3 K;  3EE9 A;  3VQC A;  1RDB A;  3O4W A;  1JLC A;  3SBT A;  1EO1 A;  4DR2 K;  1JLB A;  1KC8 O;  4AM6 A;  1TKX A;  4QOZ B;  1I3A A;  4XH5 A;  2OA8 A;  2CGJ A;  4ID5 A;  4N56 A;  1YT3 A;  4KHW A;  3ATU A;  2IDO A;  4JKF A;  2P9L B;  2CGL A;  4KB1 A;  3HM9 A;  2F8T A;  3LM9 A;  4CHO A;  4GV6 A;  2EX3 A;  1NM1 A;  2CH5 A;  3SAH A;  2PAV A;  4Z4G A;  2QEX N;  1QSY A;  3BZK A;  4OPA A;  3OBW A;  5CYM A;  4DSL A;  3VGK A;  4ELU A;  1KLN A;  5MLC Q;  3HP9 A;  1TKD A;  4CGI A;  1LW0 A;  3PUF A;  5CHI A;  1NOY A;  4C1N K;  5ELZ A;  3IKM A;  2PYJ A;  2WBN A;  4EIA A;  2HBK A;  2H3G X;  4X62 K;  4UY8 O;  1VQM N;  3QET A;  1WSJ A;  4CEF A;  4I9L A;  4YDU A;  1JLQ A;  3P39 A;  3CXC M;  1M1K O;  3HSC A;  3QIC A;  4FW2 A;  3WXJ A;  4CER A;  3LP0 A;  1JLG A;  4LC9 B;  3RMB A;  1Q81 O;  4E1N A;  4FWP A;  2B5J A;  3W3D A;  1GOC A;  3TR8 A;  2E88 A;  3HPO A;  4JK7 A;  2HHT A;  3I56 N;  4FLZ A;  1XI1 A;  1S22 A;  1L3U A;  1VQN N;  3KLE A;  3SQ4 A;  1E4F T;  3H3N O;  3QFU A;  5JVG L;  1NK4 A;  3PO5 A;  4C8K A;  1HNZ K;  1IKV A;  3QNN A;  4KH5 A;  4ISE A;  2ZM6 K;  5BPN A;  4L3Q A;  1ZBF A;  1NGA A;  2ZD1 A;  4CEB A;  3AO2 A;  1C0M A;  4FJ9 A;  3EL2 A;  1KFS A;  4HCB A;  4ZHR A;  4DR5 K;  5E41 A;  1EKE A;  4M7Y A;  2ETJ A;  3MEG A;  2OPS A;  1RT5 A;  1GLC G;  3OYI A;  3TSP A;  1D9F A;  4G9Z A;  1IKX A;  4DV6 K;  5AQR A;  4AHV A;  3G4S N;  2BUP A;  4NCB A;  2HNZ A;  1R59 O;  2G8V A;  4BRM A;  3SQ2 A;  4OLA A;  4CBW A;  4JD2 B;  1BIU A;  3E01 A;  1T6D A;  4OJR A;  4RG8 A;  3VET A;  3GE1 A;  5F1X A;  4A59 A;  1XHZ A;  3HPH A;  2UUA K;  5JIC A;  3SUQ A;  1CZA N;  1NGB A;  3ALY A;  3AV9 A;  3CCU N;  1QZ6 A;  4KKO A;  4LF4 K;  5JLH A;  5ADX H;  1ILY A;  3AO4 A;  3W0L A;  1IO2 A;  4K8Z A;  3WT0 A;  1WBD A;  3VA3 A;  3U3G A;  4KHU A;  4DTJ A;  1YJW N;  3V9S A;  2E5L K;  1XHX A;  5FPM A;  3G25 A;  2RHK A;  3HK2 A;  4FJ5 A;  4B3M K;  4YY3 K;  3L4Q A;  1Z26 A;  1BL3 A;  1RCH A;  2KQ2 A;  3UKR A;  3NBP A;  2YNF A;  3FZK A;  4BG9 A;  5HP1 A;  5M1F A;  3WNE A;  2V52 B;  4BE1 A;  4GMJ B;  1YAG A;  3ZT1 A;  3AAQ A;  4OKK A;  2X78 A;  2PYL A;  4QS8 A;  3CC7 N;  4CF1 A;  4H5N A;  2ZJR L;  3OJS A;  3OYA A;  3WQU A;  4CK3 A;  5HRR A;  4JI0 K;  4F2S A;  1HQE A;  1NK0 A;  3QBX A;  4FVU A;  4CW7 B;  4BRF A;  3O1B A;  4FJN A;  3TSQ A;  2E6L A;  4FJJ A;  1HNI A;  4K8X A;  4FLU A;  4WE1 A;  3LP3 A;  3CM5 A;  1BG3 A;  3R1X A;  3LAM A;  4IEE A;  4W5Q A;  3ZSX A;  4I6M B;  3KD5 E;  1T6C A;  4LSN A;  1IBL K;  1GOB A;  3RMD A;  4CJS A;  1W9H A;  4CEA A;  1G15 A;  2OAN A;  4AH9 A;  4CI6 A;  4IDK A;  3L3U A;  4KTW A;  3O80 A;  4JS4 A;  2HHU A;  4BRK A;  5AZI A;  3KWG A;  5HRN A;  4CZM A;  3OYM A;  2RKI A;  3T1Y K;  5AQH A;  4OPJ A;  5AFU H;  1QQC A;  1TK8 A;  2I7N A;  3U4L A;  4IJN A;  4CJ5 A;  1W0H A;  1LWE A;  2Q0R A;  2HBM A;  4BGA A;  4LF5 K;  2P9K B;  3TAE A;  1JXB A;  4W5O A;  3ZSO A;  1TAQ A;  4BWJ A;  3SQ0 A;  3C6A A;  4CZK A;  3ZET B;  4IOA L;  3FFK B;  5TKW A;  4DFK A;  4DF4 A;  4DQR A;  1K8K A;  5AQM A;  4AHC A;  2YHA A;  3GL1 A;  4GW6 A;  3CQX A;  4FLY A;  3T69 A;  2GBZ A;  2NRH A;  4CF9 A;  4DR7 K;  4DU4 A;  3A8Y A;  4IG0 A;  3CER A;  4CJK A;  4NO7 A;  4K41 A;  3VQD A;  4CHQ A;  3PO4 A;  4DS5 A;  4ELT A;  4U7B A;  2WOM A;  3S9H A;  4J2B A;  1H1V A;  3MCA B;  4FYD A;  1NKB A;  3D45 A;  4IOX A;  5KPZ A;  3L2V A;  3VF6 A;  4PHT X;  5AQN A;  4C1N I;  4CIE A;  4FLX A;  2O8B A;  1NK8 A;  1TAU A;  1KQS M;  3AVH A;  4KHY A;  4NXM K;  2PZS A;  4AHU A;  4O5F A;  4LF9 K;  2OZM A;  4CEQ A;  3CFR A;  3MN6 A;  3VGM A;  4IJA A;  1Z05 A;  4MDB A;  4OKJ A;  3AA3 A;  4WFN L;  3SMP A;  1NJX A;  3NGI A;  3C95 A;  5AQT A;  1SKS A;  5J2Q A;  3H45 C;  5HOO A;  3SAF A;  2PFU A;  1B9F A;  2KZZ A;  5FRM A;  4DSE A;  4M3R A;  3MXI A;  4B9T A;  4HCC A;  2F8S A;  5AQY A;  2VCP A;  4DCH A;  3NDK A;  3HO1 A;  4YHH K;  2HHV A;  3SAG A;  4KBO A;  2W40 A;  1HLU A;  3EKS A;  5IWA K;  1YJN N;  4EHT A;  3MCP A;  1P90 A;  3D2E A;  1OVY A;  3K9K A;  2HHH K;  1U6Z A;  2QA4 N;  2V7Z A;  4MO5 A;  1JLF A;  2IVN A;  3VOV A;  1Q86 O;  3TAB A;  1VSI A;  1NJZ A;  2FF3 B;  1ATN A;  3O9T A;  1HNW K;  5BRF A;  3S3N A;  3SQ1 A;  5I3U A;  4ILH A;  1YIJ N;  3K58 A;  5KRT A;  5AQS A;  2Q3S A;  2HW3 A;  1GLD G;  5GIP A;  3HTV A;  2ASP A;  3HOS A;  4BE0 A;  3VEN A;  4BRN A;  1JCG A;  2ZE2 A;  3M3Z A;  4PY5 A;  3VQ5 A;  2DFF A;  3RTV A;  1DT9 A;  4ISG A;  5GIN A;  1Q82 O;  1TUU A;  3QDK A;  1VQ7 N;  4CGG A;  3CJ1 A;  2P1J A;  5CZ2 A;  3IFR A;  1U2V B;  3IG1 A;  1MU2 A;  3ENH A;  2WTU A;  3M8P A;  5AQI A;  3PLA A;  3C7N B;  4DUZ K;  4KO0 A;  2O8B B;  2RPI A;  3VQ8 A;  1OH6 A;  3FLC O;  2VWK A;  3KK3 A;  4G1Q A;  3G6E N;  4H5V A;  2ATQ A;  3SBG A;  4RW7 A;  1JKH A;  4I7F A;  3WNF A;  4FOI A;  3V6D A;  3J7Z O;  4IXC A;  4CD1 A;  4NCG A;  3RSE B;  1S1X A;  3FZH A;  3AO1 A;  1JLE A;  3BDP A;  5AQG A;  3THV A;  3ZSY A;  3LPT A;  1BCO A;  4CF0 A;  1HKG A;  5E26 A;  1TK0 A;  4J8F A;  4BR2 A;  1VQ6 N;  3VMF B;  4FCY A;  4U67 L;  4IZ9 A;  5AQO A;  4BR4 A;  3D2F A;  3B6O A;  3AVB A;  3HL8 A;  4Z4F A;  1RDU A;  1T3V A;  1KAY A;  2DTU A;  5ADX A;  2KW4 A;  3QML A;  1TL3 A;  3ZEU A;  2P9S B;  5C2D A;  3OS2 A;  4H03 B;  3T1H K;  2O8D B;  3OHR A;  5C24 A;  3C6H A;  4CFC A;  1J5E K;  5A2Q O;  4DSI A;  3CCV N;  3VN5 A;  3LDQ A;  3TAN A;  1XMQ K;  1S3X A;  3SPY A;  3OYJ A;  4Z4C A;  1BIS A;  1DGK N;  4BAC A;  5AQK A;  5M1O A;  1RDA A;  2KLA A;  3LDS A;  3CC2 N;  3AVA A;  3HVT A;  4JI8 K;  4JKE A;  2QWQ A;  1BI4 B;  4JV5 K;  3PX0 A;  1L5U A;  4JK9 A;  3D6R A;  3L0Q A;  4CZG A;  4M45 A;  1D8Y A;  1VSH A;  3KLI A;  3GDQ A;  4H5W A;  4BDY A;  1S1U A;  3H3O B;  3MED A;  3ZET A;  3CG7 A;  5FLX O;  2IVP A;  4WFB L;  5AQF A;  1UA0 A;  3J81 O;  1RTJ A;  5AZJ B;  4E1M A;  2P9U B;  2A5X A;  4H4O A;  2GEM A;  4DFP A;  2BH1 A;  4CD3 A;  2P9L A;  3NH0 A;  3IAY A;  4F3O A;  3UKU B;  1NK9 A;  3DRS A;  4JYA K;  1U4B A;  3K57 A;  1FKP A;  4BY9 C;  1QVF M;  3H08 A;  2G8H A;  1VHX A;  1HYZ A;  2Q36 A;  4CF8 A;  2BTF A;  1IJJ A;  1ITG A;  4PKI A;  1IG8 A;  1QQN A;  1RFQ A;  3VQA A;  3ZSV A;  1SKW A;  3AVI A;  4HUG A;  4DQI A;  4FK0 A;  4DV3 K;  1U2V A;  4O55 A;  1BGX T;  1FKO A;  3THY A;  4NYF A;  4GVE A;  4RWT A;  4ZTJ A;  2P9N A;  3HPG A;  5AQP A;  4BVP A;  2E4L A;  4B9Q A;  3THX B;  4FZZ A;  4CJ4 A;  2Z1G A;  5T7B A;  1RT4 A;  4DTM A;  4FPA A;  3VEZ A;  1YI2 N;  1NK5 A;  2KTQ A;  4WQ5 C;  3WNH A;  1TVR A;  4XH4 A;  4FWQ A;  1WSF A;  4M42 A;  2KHO A;  1XC3 A;  1C0F A;  2E1Z A;  3OS1 A;  2QI2 A;  1RT1 A;  4LF8 K;  5AZJ A;  3V4I A;  4BR7 A;  5GIO A;  1L3S A;  4M3Z A;  4MLH A;  4BR0 A;  1NGC A;  3ZX3 A;  3FFI A;  4KTZ A;  4MQ3 A;  3O3F A;  3MX2 A;  3EE8 A;  4I2P A;  1VRT A;  4KH4 A;  3VEX A;  1WAJ A;  4EP5 A;  1QZ5 A;  5TKY A;  2IAJ A;  3JS6 A;  2QWM A;  1RDD A;  4A61 A;  2GUI A;  4B9M A;  2ZJP L;  4DTO A;  3UE5 A;  1YUW A;  4M3Y A;  3RR8 A;  3M8S A;  4NLB A;  1DEJ A;  2YHB A;  4BR9 A;  4CJF A;  3NFA A;  4RCH A;  3QB0 A;  4WCE L;  1REV A;  3OYF A;  3A5L C;  3SV4 A;  3WXK A;  5D3G A;  3WNG A;  3KKR A;  4PUO A;  3KVG A;  4DMN A;  3O4Q A;  5HRO A;  1BQN A;  1RT6 A;  1N33 K;  3THX A;  4CGH A;  4IDH A;  3F73 A;  2P5O A;  3QEV A;  5BPM A;  4KRE A;  1XNR K;  1KD1 O;  3IUC A;  3E9P A;  3OYD A;  4JLH A;  3O08 A;  1WN7 A;  1CZB A;  1A5W A;  3D2E B;  1NK6 A;  4K25 A;  1NJW A;  2FC0 A;  1RBT A;  3OYB A;  1K6Y A;  2O8F B;  5EXW A;  3DJC A;  4E1J A;  4DSJ A;  3FZL A;  4DS4 A;  2GEL A;  3BGR A;  4W5T A;  4E3S A;  3LWL A;  3CCM N;  3NF9 A;  3QIO A;  1S1W A;  2KFN A;  2XY8 A;  4PKG A;  4LSL A;  1LWC A;  2A6A A;  1HYV A;  3WQT A;  4C8O A;  1YTU A;  1WSH A;  4IWV A;  1HMV A;  3BEX A;  3DXK B;  3SLC A;  2I7P A;  3NCI A;  1BA0 A;  1C1C A;  3HOT A;  4W5N A;  2YNI A;  4CFA A;  4I6M A;  1KVB A;  1YTA A;  4QCL A;  1NMN A;  4CJT A;  2QWP A;  2ZWH A;  4JI7 K;  4IG3 A;  5C15 A;  1V4S A;  5AR0 A;  1YXQ A;  4DB3 A;  4JS5 A;  1L3V A;  4DV4 K;  3AGR A;  5EOY A;  3QO9 A;  3LL3 A;  4FK2 A;  1I39 A;  2WON A;  2AJQ A;  4V19 S;  2D5R A;  3NHG A;  4A2B A;  5KGW A;  4B9U A;  3BY5 A;  1NGJ A;  3I0R A;  2FXU A;  4J2A A;  3KD1 E;  3TAF A;  3WEE A;  1GLJ O;  3ATV A;  4FWO A;  5F0X A;  4ZTF A;  3G71 N;  2UXC K;  4FPB A;  2NLX A;  1HNX K;  3AA5 X;  4B1X B;  4XIU A;  1WB9 A;  2DPN A;  1E3M A;  1BQM A;  3A2F A;  1S5J A;  3HP6 A;  4CK1 A;  4O4G A;  2I5J A;  3LZJ A;  4B1V A;  1QS4 A;  4AF1 A;  1NK7 A;  3P83 D;  4FL9 A;  1S1V A;  5AQV A;  5LJW A;  1NLV A;  1N36 K;  1UOC A;  2ITM A;  3DI6 A;  1T05 A;  3TAM A;  4QAG A;  3PIO L;  4CGJ A;  4CIF A;  3CJ7 A;  4CVN E;  1XNQ K;  2IS3 A;  5C42 A;  3WUH A;  5KQD A;  4B3T K;  2WC9 A;  1HJR A;  4DTN A;  2WFB A;  3AY9 A;  1BUP A;  1GLF O;  4Q5V A;  2G8W A;  4BRH A;  1C0U A;  1OH7 A;  1GOA A;  4M3X A;  1IG9 A;  3WXM B;  4C8M A;  3CCJ N;  3CCR N;  3V9X A;  5J2P A;  3NGY A;  2QKB A;  5FRO A;  1RT7 A;  4CEO A;  3CPW M;  5FDL A;  4CZI A;  1OVQ A;  3TTF A;  2P51 A;  2D0C A;  2Y1J A;  3R9P A;  3O9U A;  5CR4 A;  1HUX A;  5KGX A;  3A5O C;  4HVJ A;  3VEW A;  2HF3 A;  1NJI O;  1MA9 B;  3DWL A;  3LP1 A;  2ASM A;  2KFZ A;  1OH5 A;  3PIP L;  4H0O A;  3VF4 A;  3UKU A;  1J6Z A;  4K43 A;  5BN8 A;  4YOR A;  2QWN A;  4DR4 K;  3E9O A;  5BRD A;  5B8H A;  3O5B A;  1RNH A;  1LW2 A;  1P8Z A;  2Z1H A;  3DLE A;  3T3F A;  3I0S A;  1KLM A;  1O1W A;  1YHQ N;  1R0A A;  1DKG D;  3T7Z A;  4ID1 A;  4B9V A;  3LAL A;  2E1Y A;  2AP1 A;  2VG7 A;  3ZT0 A;  1EQY A;  3DOL A;  1TGO A;  2LSN A;  5GAH P;  3CFO A;  2A42 A;  1RBR A;  4E7L A;  2ASO A;  1HPZ A;  4HTU A;  2XY7 A;  1Q18 A;  4CJV A;  3PY8 A;  4CIG A;  1KFD A;  4Y1D A;  1N32 K;  2CGK A;  2VWJ A;  2UYT A;  3VQ9 A;  4DKW A;  4CEC A;  5SZT A;  3QEW A;  1EP4 A;  4I2Q A;  3OS0 A;  5AQL A;  4BWM A;  3L2U A;  4DV1 K;  4A2A A;  1EET A;  3MN7 A;  3QES A;  1J5O A;  2GX9 A;  2W41 A;  1W7A A;  1SL2 A;  3AO3 A;  4CJ7 A;  4YNQ A;  1VQ5 N;  1E4G T;  4WQ5 A;  1VSF A;  1XC9 A;  1Y64 A;  4KHN A;  2Q97 A;  3KKS A;  1FXX A;  3HZ6 A;  4H4M A;  1JLA A;  2FBX A;  4OPK A;  4GKK K;  3H1V X;  2X74 A;  4H8K A;  1K8K B;  3CJC A;  4LF7 K;  4FWL A;  4LFB K;  3TAQ A;  2YHX A;  2HND A;  4JAX A;  3UB5 A;  2R7Y A;  3WXL A;  4A5B A;  5CE3 A;  4JI5 K;  5H1S Q;  4FJ8 A;  3B6P A;  1X9W A;  1B92 A;  4RW6 A;  5DM7 L;  4Q0B A;  1BWF O;  1K73 O;  4KFB A;  4GY2 B;  4YOW A;  3DLL L;  4FLW A;  3L2W A;  1WSI A;  1VQ9 N;  3SJH A;  1TKT A;  3VTI A;  4AHR A;  3EYZ A;  5J2N A;  4FWM A;  4RTF D;  2FBV A;  2G8I A;  4LFA K;  4E7K A;  1RT3 A;  4X65 K;  4KRF A;  5EU7 A;  4NXN K;  3MWT A;  3Q7B A;  1CZ9 A;  1NU0 A;  1RBU A;  1J53 A;  1VSL A;  4KHQ A;  3C65 A;  3IRX A;  4WYB A;  2X6S A;  3ZEU B;  1ZBH A;  2NRX A;  4IOC L;  1NGD A;  1ATS A;  3S41 A;  4CZJ A;  2E2P A;  2QXL A;  4B1U B;  3HI0 A;  4XEI A;  4ELV A;  1X3N A;  3V9W A;  4DUY K;  4CJP A;  3AVF A;  4BE2 A;  4E19 A;  2GTD A;  5GAE P;  4AHT A;  4B1Z A;  5C10 A;  4BRC A;  4R79 A;  4CE9 A;  3IS9 A;  3O3H A;  3SV3 A;  2FSJ A;  1XMO K;  3NVK A;  3K59 A;  4KV8 A;  1Q7Y O;  4B3S K;  3TAG A;  2EHG A;  4C8N A;  3Q7C A;  3KK2 A;  4JKH A;  1S1T A;  3DRP A;  4CK2 A;  2F9W A;  3R8E A;  3HVR A;  2QKK A;  1GLL O;  1UWB A;  2XHB A;  4C8L A;  2E2Q A;  1BI4 A;  4CCH A;  3M1F A;  3ZYY X;  3FZF A;  3T1A A;  4CJR A;  3TWH A;  4O44 A;  2UXB K;  3C0B A;  3F9M A;  5HRP A;  3QFP A;  2Q1N A;  3CHW A;  4MO4 A;  3D0P A;  4BG8 A;  1X9S A;  1D4X A;  3OYG A;  4CBX A;  4Z4H A;  1XWL A;  1VSK A;  4BC3 A;  4HTL A;  4DTU A;  3HYF A;  4DR6 K;  4BDZ A;  3U8X A;  4H0P A;  2XY5 A;  1KXP A;  2F96 A;  2YCH A;  4FWR A;  4E7I A;  1YIT N;  3RVC A;  4XH1 A;  3J8A A; 
#chains in the Genus database with same CATH homology
 4HUF A;  4KI4 A;  4FK0 A;  3HPO A;  2HHT A;  4O55 A;  1BGX T;  1FKO A;  4FLZ A;  1XI1 A;  4NYF A;  3LPU A;  1X1P A;  1L3U A;  4ZTJ A;  3HPG A;  3KLE A;  3SQ4 A;  3QIN A;  2E4L A;  4F4K A;  4FK4 A;  4DSK A;  4J2E A;  3KLH A;  3OYK A;  1S6P A;  4FZZ A;  4CJ4 A;  2Z1G A;  3V1O A;  5T7B A;  1NK4 A;  3PO5 A;  4C8K A;  1RT4 A;  3F9K A;  2O4I A;  2E6M A;  1IKV A;  4DTM A;  3QNN A;  2BE2 A;  4TSX A;  1NK5 A;  3AO5 A;  5CY4 A;  4OLB A;  2KTQ A;  4KPY A;  4CF2 A;  3QER A;  3ZSW A;  3LP2 A;  3WNH A;  1TVR A;  4EZ9 A;  4FLV A;  1WSF A;  4M42 A;  4GVM A;  1ZBF A;  2VG6 A;  2ZD1 A;  4CEB A;  2JLE A;  3AO2 A;  1C0M A;  3OS1 A;  3OYE A;  4CFB A;  3KD5 E;  4M41 A;  4B3O A;  1RT1 A;  2B4J A;  1T03 A;  4FJ9 A;  4O5B A;  1KFS A;  3V4I A;  4HCB A;  4ZHR A;  1L3S A;  4M3Z A;  4M3W A;  5E41 A;  1EKE A;  1KCF A;  3FFI A;  4KTZ A;  1DLO A;  2D0B A;  2ETJ A;  3M8Q A;  4MQ3 A;  4FVM A;  3VQ7 A;  3O3F A;  3MEG A;  1RDC A;  3MEC A;  1KSP A;  4I2P A;  1VRT A;  1LAW A;  1UAX A;  1WAJ A;  2OPS A;  4EP5 A;  4KI6 A;  4O0J A;  1RT5 A;  3ZSQ A;  3OYI A;  1D9F A;  1NOZ A;  4FJL A;  2IAJ A;  3LWM A;  4CHY A;  1JXE A;  1IKX A;  1RDD A;  3OYC A;  4AHV A;  4PWD A;  2GUI A;  4B9M A;  1RIL A;  1S9G A;  4DTO A;  4FM2 A;  3KK1 A;  4NCB A;  4DFM A;  4M3Y A;  2HNZ A;  3RR8 A;  3UIQ A;  1RT2 A;  3M8S A;  4B8C A;  2YHB A;  2G8V A;  2G8U A;  2O4G A;  4CJF A;  1LAV A;  2XY6 A;  3SQ2 A;  3NFA A;  2G8K A;  4OLA A;  3E01 A;  1BIU A;  4RG8 A;  4OJR A;  1REV A;  1XHZ A;  3DRR A;  3VA0 A;  1Z25 A;  3OYF A;  3HPH A;  4CGD A;  3SV4 A;  3HST B;  3VQE A;  3QNO A;  3WNG A;  1N6Q A;  2PY5 A;  3KKR A;  5D3G A;  4FXD A;  4F3T A;  4PUO A;  3SUQ A;  3NF6 A;  4DMN A;  3O4Q A;  5HRO A;  5CYQ A;  1BQN A;  1RT6 A;  3AV9 A;  1WSE A;  3ALY A;  4CGH A;  3F73 A;  1BIZ A;  4KKO A;  3QLH A;  3CQ8 A;  2P5O A;  5DMR A;  3QEV A;  3SUN A;  3AO4 A;  4KRE A;  5HRS A;  3AVN A;  1ZBU A;  4NCA A;  1IO2 A;  4K8Z A;  3OYD A;  4IKF A;  1HYS A;  4AIL C;  3L2Q A;  3VA3 A;  3U3G A;  3NH1 A;  4KHU A;  4DLE A;  4DTJ A;  1EX4 A;  4JLH A;  3V9S A;  1LV5 A;  3I8D A;  1B9D A;  1XHX A;  1WN7 A;  3PX6 A;  1CZB A;  2OYQ A;  1U48 A;  3HK2 A;  4FJ5 A;  1A5W A;  5HLF A;  5K14 A;  1ZBI A;  1Z26 A;  1BL3 A;  1RCH A;  2KQ2 A;  3L8B A;  3NBP A;  1NK6 A;  4RW8 A;  3ASM A;  2YNF A;  4YFU A;  1NJW A;  2FC0 A;  2XO7 A;  1RBT A;  5HP1 A;  3OYB A;  3RRG A;  3WNE A;  3TAR A;  1K6Y A;  3ZT4 A;  4BE1 A;  1KVA A;  4GMJ B;  3ZT1 A;  4DSJ A;  3OVN A;  4CJQ A;  4OKK A;  4FLT A;  2X78 A;  4DS4 A;  2PYL A;  3BGR A;  3G10 A;  4CHZ A;  4W5T A;  4E3S A;  4FJ7 A;  3LWL A;  3VQ6 A;  1JL2 A;  3NF9 A;  3QIO A;  1S1W A;  4CF1 A;  3OYL A;  2XY8 A;  4FZX C;  1VRU A;  2KFN A;  1DTQ A;  4LSL A;  1LWC A;  1HYV A;  3OJS A;  3RMA A;  3V81 A;  4C8O A;  1VSE A;  1YTU A;  3DLR A;  3OYA A;  1WSH A;  3SZ2 A;  1HMV A;  4DQQ A;  4AHS A;  3NAE A;  4CK3 A;  4PA1 A;  3NCI A;  2KZM A;  5HRR A;  3EZ5 A;  1HNV A;  3TI0 A;  4F2S A;  1C1C A;  3P1G A;  1HQE A;  1NK0 A;  2HB5 A;  4FJN A;  3HJF A;  3MEE A;  4Z0U A;  4W5N A;  2E6L A;  4FJJ A;  2YNI A;  1HNI A;  4K8X A;  4CFA A;  3O3G A;  4FLU A;  3DM2 A;  1KVB A;  1YTA A;  4WE1 A;  4DQP A;  1J9A A;  3LP3 A;  4QCL A;  3CM5 A;  2Z1I A;  4CJT A;  3LAM A;  1ZYQ A;  4RW9 A;  1VSD A;  1QHT A;  3ZSX A;  4W5Q A;  3L3V A;  3LAK A;  3MXM A;  2HNY A;  4OVL A;  1KRP A;  4LSN A;  4DF8 A;  1RBV A;  1GOB A;  3RMD A;  4CJS A;  3ZT3 A;  4IG3 A;  4J2D A;  1W9H A;  4CEA A;  4EZ6 A;  4DFJ A;  1J54 A;  1G15 A;  3VQB A;  3DMJ A;  4AH9 A;  4JS5 A;  3AA4 A;  1L3V A;  4OGC A;  4EP4 A;  4IDK A;  4B9S A;  3KIO A;  3L3U A;  4KTW A;  3DLB A;  4JS4 A;  1SV5 A;  3QO9 A;  2A1R A;  2HHU A;  3SPZ A;  5JS2 A;  1I39 A;  2WON A;  3LAN A;  4LH4 A;  4CJ3 A;  4FK2 A;  2AJQ A;  5HRN A;  2D5R A;  2RF2 A;  1RBS A;  3NHG A;  4BDP A;  2RN2 A;  5KGW A;  3C6U A;  3OYM A;  4DG1 A;  4B9U A;  2RKI A;  1FK9 A;  4OPJ A;  1QQC A;  3K5L A;  1WNS A;  3I0R A;  1TK8 A;  3DOK A;  1ZBL A;  4J2A A;  4KAZ A;  3CYM A;  4DU1 A;  3KD1 E;  1IH7 A;  1LWE A;  1W0H A;  4CJ5 A;  4CJW A;  3TAF A;  3TAE A;  1JXB A;  4W5O A;  4ZTF A;  3ZSO A;  1TAQ A;  4BWJ A;  3SQ0 A;  4B9N A;  4FJG A;  2D0A A;  3AVM A;  3AA5 X;  4OKE A;  4DU3 A;  1BHL A;  4XIU A;  4CHP A;  4DFK A;  1BQM A;  3ZCM A;  3A2F A;  4DQR A;  4DF4 A;  1S5J A;  4AHC A;  1S6Q A;  2YHA A;  3G0Z A;  3HP6 A;  2HHS A;  3AVK A;  4CK1 A;  4GW6 A;  4O4G A;  2I5J A;  5FRN A;  3LZJ A;  3OJU A;  5C25 A;  4FLY A;  1EXQ A;  1QS4 A;  1NK7 A;  5CZ1 A;  2HHX A;  3JSM A;  4OGE A;  2GBZ A;  3P83 D;  1KTQ A;  4CFD A;  1S1V A;  3P5J A;  1ASW A;  2HHW A;  1WLJ A;  4CF9 A;  4DU4 A;  1UOC A;  4IG0 A;  1ASU A;  3DI6 A;  4CJK A;  3TAM A;  4QAG A;  2ITG A;  1T05 A;  1S9E A;  1NKC A;  3VQD A;  4CGJ A;  4CHQ A;  4CIF A;  5KRS A;  3VQQ A;  2IS3 A;  1LWF A;  4CJE A;  3ITH A;  4CJU A;  3DLG A;  1N5Y A;  4DS5 A;  1D9D A;  3PO4 A;  4ELT A;  4FZY A;  4ICL A;  5C42 A;  2WOM A;  3KTQ A;  3S9H A;  2GV9 A;  4J2B A;  1HJR A;  4DTN A;  2BDP A;  2QK9 A;  4I9Q A;  4FYD A;  4CGF A;  5KTQ A;  1NKB A;  3D45 A;  2XRI A;  3C94 A;  4Q5V A;  1VSJ A;  3L2V A;  4Z4I A;  1QE1 A;  2G8W A;  1F21 A;  1C0U A;  1C0T A;  1GOA A;  3C6T A;  4DSF A;  4CIE A;  4M3X A;  1IG9 A;  4FLX A;  3LZI A;  4M3T A;  1NK8 A;  4RW4 A;  1Q9Y A;  1TAU A;  3AVH A;  4KHY A;  4CHN A;  3K5O A;  2PZS A;  1QSL A;  4C8M A;  3HXM A;  1TK5 A;  3V9X A;  5J2P A;  4AHU A;  3NGY A;  2QKB A;  4CEE A;  4F2R A;  2OZM A;  5FRO A;  1RT7 A;  4CEO A;  4CEQ A;  2FBT A;  5FDL A;  4UQG A;  3CFR A;  3NGZ A;  3TAP A;  2P51 A;  4OKJ A;  3PX4 A;  2D0C A;  3AA3 A;  2Y1J A;  4HUE A;  4N76 A;  2B6A A;  5KGX A;  4HVJ A;  3NGI A;  1NJX A;  3C95 A;  1SKS A;  2OZS A;  4DTR A;  3LP1 A;  5J2Q A;  1T8E A;  2KFZ A;  2DFH A;  2HMI A;  1B9F A;  2KZZ A;  3ZT2 A;  3K2P A;  3AVL A;  5FRM A;  4DSE A;  4B9L A;  4M3R A;  4DWI A;  3MXI A;  4IFY A;  4B9T A;  4HCC A;  3K5N A;  2F8S A;  2OPR A;  1NJY A;  1QTM A;  3NDK A;  1YVU A;  3HO1 A;  1KVC A;  2HHV A;  1RNH A;  4LY7 A;  1LW2 A;  1RTI A;  1Q9X A;  4F8R A;  3OYH A;  3OY9 A;  4JRP A;  2Z1H A;  3DLE A;  3T3F A;  3VQP A;  4CED A;  3I0S A;  1KLM A;  1TKZ A;  3M8R A;  1O1W A;  3JYT A;  1NKE A;  4HHT A;  1R0A A;  1JLF A;  3V1Q A;  4ID1 A;  3AVG A;  4B9V A;  3U6F A;  1SKR A;  3LAL A;  3RWU A;  2Y1I A;  3OYN A;  1U45 A;  3TAB A;  4Z4F A;  1VSI A;  1D5A A;  2VG7 A;  1JL1 A;  3ZT0 A;  1CXU A;  1NJZ A;  5J2M A;  4KTQ A;  1IKY A;  3DOL A;  1TGO A;  1U04 A;  2LSN A;  3CFO A;  5DK5 A;  3KJV A;  4LH5 A;  3PV8 A;  3S3N A;  3SQ1 A;  1RBR A;  4E7L A;  1C6V A;  3K5M A;  5KI6 A;  5I3U A;  1Y97 A;  2BAN A;  1HPZ A;  3K58 A;  5KRT A;  4N5S A;  4HTU A;  2XY7 A;  2YNH A;  4CJV A;  1SL1 A;  4N41 A;  3PY8 A;  4CIG A;  1KFD A;  4Y1D A;  2Q3S A;  2VWJ A;  4FM0 A;  1IKW A;  3VQ9 A;  2HW3 A;  4FJI A;  4CEC A;  5SZT A;  3QEX A;  4FM1 A;  3QEW A;  1EP4 A;  3HT3 A;  3SJJ A;  4BE0 A;  4I2Q A;  3OS0 A;  3V9Z A;  2IOC A;  4BWM A;  1U49 A;  2ZE2 A;  3L2U A;  3NE6 A;  2JGU A;  1EET A;  4PY5 A;  3VQ5 A;  2DFF A;  1C1A A;  3RTV A;  4FJX A;  3V1R A;  3QES A;  1J5O A;  4CGG A;  2P1J A;  2X6N A;  3DLH A;  2P5G A;  2HVI A;  5CZ2 A;  5HBM A;  4LD0 A;  1SL2 A;  3S3M A;  3AO3 A;  3IG1 A;  2IGI A;  2BGG A;  4YNQ A;  1MU2 A;  3S3O A;  4NYN A;  3M8P A;  3NH2 A;  4FW1 A;  4DTX A;  1Q8I A;  4KO0 A;  1C1B A;  1VSF A;  3EY1 A;  3RMC A;  1XC9 A;  1U47 A;  4KHN A;  3KKS A;  1FXX A;  1HRH A;  4H4M A;  2RPI A;  1JLA A;  2FBX A;  1ASV A;  3VQ8 A;  1SUQ A;  4MFB A;  2IC3 A;  4OPK A;  4DTS A;  1L3T A;  4FJK A;  1A5V A;  2VWK A;  2X74 A;  4H8K A;  4G1Q A;  3NF7 A;  3T19 A;  4R5P A;  3KK3 A;  2FBY A;  2ATQ A;  1WSG A;  4RW7 A;  4E89 A;  3TAQ A;  1JKH A;  2DY4 A;  4I7F A;  4IFV A;  2HND A;  3AVC A;  1VSM A;  3WNF A;  5I42 A;  1WAF A;  2ZQB A;  3KLF A;  3V6D A;  3ZSZ A;  2VG5 A;  2R7Y A;  1SL0 A;  4DLG A;  3O4N A;  1TL1 A;  5SWM A;  4DQS A;  4E0D A;  4NCG A;  1S1X A;  4FJ8 A;  2W42 A;  3B6P A;  1X9W A;  1B92 A;  3RRH A;  4RW6 A;  3AO1 A;  1X9M A;  1JLE A;  4Q0B A;  4KFB A;  1TV6 A;  4O0I A;  3BDP A;  1BCM A;  4Y1C A;  3CFP A;  3ZSY A;  3THV A;  2OPQ A;  3LPT A;  1BCO A;  3L2W A;  1WSI A;  4FLW A;  3SI6 A;  4CF0 A;  1TK0 A;  1RTH A;  1TKT A;  4AHR A;  2YNG A;  3EYZ A;  1CXQ A;  4B8A B;  5J2N A;  3QEI A;  5JS1 A;  4FCY A;  3V9U A;  2FBV A;  1QSS A;  2G8I A;  1A5X A;  3SUP A;  4E7K A;  3SNN A;  4L8R B;  1RT3 A;  4Z4E A;  4KRF A;  5EU7 A;  4PQU A;  3ULD A;  1CZ9 A;  3B6O A;  3KLG A;  1HQU A;  1RBU A;  3AVB A;  3HL8 A;  1J53 A;  1VSL A;  4CES A;  4CJL A;  3SCX A;  3NF8 A;  1UA1 A;  3IRX A;  4KHQ A;  2X6S A;  4KHS A;  3DLK A;  2DTU A;  1ZBH A;  2KW4 A;  4CEZ A;  1TL3 A;  3OS2 A;  3QEP A;  1T7P A;  3MXJ A;  3VQC A;  4ELV A;  3V9W A;  3ZSR A;  1RDB A;  3CM6 A;  4CJP A;  5C24 A;  4CFC A;  1JLC A;  4W5R A;  4DSI A;  3VN5 A;  3AVF A;  3TAN A;  3QIP A;  3SPY A;  1JLB A;  3OYJ A;  3SYZ A;  1TKX A;  4Z4C A;  4E7J A;  1BIS A;  4QOZ B;  1I3A A;  2OPP A;  4BAC A;  4ID5 A;  3VQ4 A;  4E19 A;  4N56 A;  1YT3 A;  4AHT A;  4BE2 A;  2OA8 A;  4KHW A;  1DTT A;  2IDO A;  1RDA A;  1RTD A;  4CE9 A;  3IS9 A;  4KB1 A;  3O3H A;  3HM9 A;  3LDS A;  3SV3 A;  2F8T A;  3AVA A;  4CHO A;  2EX3 A;  2YKN A;  3HVT A;  3K59 A;  2HVH A;  4Z4G A;  1QSY A;  4KV8 A;  2G8F A;  5CYM A;  3TAG A;  1BI4 B;  2EHG A;  4C8N A;  4DSL A;  3PX0 A;  3KK2 A;  3AVJ A;  1L5U A;  3DYA A;  1S1T A;  3RR7 A;  4ELU A;  3DRP A;  4CK2 A;  1KLN A;  1CLQ A;  3HVR A;  3HP9 A;  4IBN A;  2XHB A;  1UWB A;  4M45 A;  1D8Y A;  1VSH A;  3KLI A;  2QKK A;  4C8L A;  4FJM A;  3MAQ A;  1S1U A;  1BI4 A;  1LW0 A;  4CGI A;  3MED A;  4JRQ A;  2NUB A;  4BDY A;  1TKD A;  4CCH A;  3PUF A;  3CG7 A;  4B08 A;  3T1A A;  4CJR A;  3AA2 A;  3TWH A;  1VK0 A;  2DFE A;  1UA0 A;  4O44 A;  1NOY A;  1RTJ A;  2A1S A;  4E1M A;  4H4O A;  4DFP A;  2PYJ A;  5HRP A;  4FJH A;  4N47 A;  3D0P A;  3NH0 A;  1X9S A;  3IAY A;  4F3O A;  3OYG A;  1NK9 A;  4M3U A;  3DRS A;  3U3Y A;  1U4B A;  4Z4H A;  2YV0 X;  3K57 A;  1FKP A;  2QXF A;  1XWL A;  3QET A;  1VSK A;  1WSJ A;  3H08 A;  4CEF A;  2G8H A;  4I9L A;  4DTU A;  3L2R A;  2HHQ A;  3HYF A;  1HYZ A;  1JLQ A;  4CF8 A;  2YKM A;  3SUO A;  4E7H A;  4BDZ A;  1ITG A;  4FW2 A;  4KB0 A;  4CER A;  3LP0 A;  1JLG A;  3RMB A;  3VQA A;  3ZSV A;  2F96 A;  4E1N A;  2XY5 A;  3ISN C;  1SKW A;  2B5J A;  4E7I A;  5J1E A;  3AVI A;  4DTP A;  4HUG A;  1GOC A;  3TR8 A;  2Z1J A;  4DQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...