1LAVA

Stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYLRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Stabilization of Escherichia coli ribonuclease HI by cavity-filling mutations within a hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 52
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lavA00
3KD5E 2Z1HA 3P83D 1SKRA 4AH9A 3MEGA 1WN7A 2FBVA 1FXXA 4FLVA 2XY8A 4FJGA 3VQCA 4RW6A 3ZSYA 3RRGA 4KHUA 2Z1IA 3QEWA 3VN5A 3AVKA 2Q3SA 2A1SA 4CERA 2KW4A 1DLOA 4E1MA 4DQSA 1D9DA 4KKOA 1IKYA 4H8KA 3P1GA 4R5PA 4OPJA 4DF8A 1BQNA 1F21A 3AVHA 3QLHA 3VA3A 1CXQA 1VSEA 3V81A 2PY5A 3IG1A 3T3FA 3BGRA 3NAEA 3SNNA 1U47A 5FRMA 5HROA 2HNZA 1QE1A 1WSFA 3CFOA 5KTQA 1ZBHA 3ZSOA 2P5GA 1U04A 1W9HA 3S3MA 3CFPA 3SPYA 3HJFA 1RT5A 3QEIA 4KV8A 3MXJA 4NCGA 4Z4CA 1BI4A 1NKEA 4KTQA 1VK0A 3SCXA 1JLFA 4OPKA 1L3VA 1KVAA 1ITGA 2YV0X 3V9SA 3QETA 4FK2A 4KHSA 4FJHA 4AHTA 1KSPA 1QS4A 1J53A 3LZIA 3AVIA 4FJ5A 4FCYA 4GVMA 1A5WA 1WSHA 4YNQA 1KFSA 1RTIA 3OYKA 5I42A 1NJXA 1R0AA 1BI4B 1ASWA 1RTHA 1XWLA 3O3HA 4TSXA 1JXEA 4O0JA 4BWJA 1UA1A 2OPRA 3V9XA 3MXIA 1S1VA 3NE6A 2NUBA 4CJ4A 1RT1A 3ZSWA 4CE9A 4DLEA 3SI6A 3HP9A 4DQIA 1RDDA 1XHXA 5K14A 3NH2A 3H08A 1IKWA 5J2QA 1NK5A 4O5BA 1T05A 2PYJA 3SPZA 1N5YA 1DTTA 2GUIA 4FLXA 1G15A 3TAEA 5CZ1A 3SUQA 4ELUA 3I8DA 3RR7A 1TKDA 3HO1A 4PWDA 4HUEA 4CGDA 1TAQA 3V4IA 4NCAA 1XC9A 4CEEA 4B9SA 4CJRA 2XY7A 4BDZA 3AVJA 3MECA 1LWCA 3DLBA 3V1OA 2EHGA 2F8SA 4FJIA 2X78A 1SL1A 5CYQA 3I0RA 3S9HA 4FJJA 1U49A 4KHYA 5FRNA 1U4BA 4O0IA 1C6VA 1UAXA 4CIFA 3OYFA 3M8QA 3C94A 3VA0A 4C8MA 3QERA 2XY6A 1TL3A 2GV9A 1A5VA 1VSKA 3OYNA 1IG9A 1CZBA 1KTQA 1LW2A 1VSJA 3CG7A 1K6YA 4GMJB 4CHOA 2IC3A 4B8CA 3ASMA 1RDBA 1LW0A 1S6QA 3M8PA 4C8KA 3ALYA 1HQEA 2VWKA 4Y1DA 5HBMA 4CCHA 1YTUA 4I2PA 4M42A 3OYMA 2HHSA 4NCBA 2ETJA 4CFAA 1RBTA 2HVHA 1BQMA 3ZCMA 4BE1A 2P1JA 2R7YA 4DTNA 1YVUA 3QESA 2VG7A 2LSNA 3VQQA 3JYTA 3L2WA 4Z4FA 4LY7A 4CK1A 1QSYA 4FYDA 1Z25A 2GBZA 3AVBA 4J2DA 4DTMA 4LH5A 3CM6A 4O4GA 3KD1E 4IDKA 1VSIA 4WE1A 3MXMA 4CJVA 5JS1A 3AV9A 2P5OA 3K5NA 1TK5A 3PV8A 3K59A 4W5NA 3NDKA 1NOZA 2ZD1A 2KFNA 1JLGA 1RTDA 1WSEA 1VSDA 4KO0A 1HYZA 4MQ3A 3SV3A 1HYVA 4ZHRA 4I2QA 3K5MA 3V9WA 4H4MA 4DG1A 2G8UA 3C6UA 4BDPA 3CM5A 4DQQA 5E41A 3HP6A 4M3YA 3SQ1A 4K8XA 3HK2A 2D0BA 1EKEA 1UA0A 1FKOA 3FFIA 1TV6A 3D45A 3LDSA 1IKXA 4OLBA 1HPZA 2B4JA 4FM2A 5KRTA 4DSIA 1WAJA 4RW7A 5C42A 4M3UA 2VG5A 2XY5A 1W0HA 2YKMA 2G8HA 1SKSA 3QEXA 2X6NA 4KI6A 1RNHA 4CGJA 4Z4EA 4FXDA 1IKVA 4KTZA 3L2QA 2RPIA 4RW4A 1TK0A 3DOLA 4CJ5A 1NK9A 4DTUA 2FBYA 3ZSXA 4ZTFA 3KJVA 1WNSA 2HNYA 3QNNA 4XIUA 1X9WA 4E7JA 1L3UA 4Q5VA 3NCIA 1GOBA 1EETA 1J54A 3NGYA 3SZ2A 3NGZA 2D0AA 4DU4A 1X9SA 4CJ3A 3PX0A 1L5UA 1LAVA 3SUPA 3VQ4A 3SUNA 1KLMA 4EZ6A 4CJWA 1UOCA 1BIZA 1Z26A 1S1WA 5CYMA 3PO4A 1KVCA 4QOZB 4FJXA 4OKJA 3THVA 4FJNA 2IDOA 4E7LA 1GOAA 3NH1A 3KLIA 1TKZA 3L2VA 2KZZA 2RF2A 5EU7A 3NFAA 3D0PA 4CFCA 3SQ2A 1KRPA 3CQ8A 3AO4A 3AVNA 1X9MA 5KGWA 4E7IA 3QIOA 4B8AB 1NOYA 4BWMA 3TI0A 1RDAA 1RT4A 1X1PA 3DI6A 4B9MA 2VG6A 4Q0BA 4CJFA 3L2RA 3TAGA 4QAGA 3HYFA 3G10A 4O55A 4KI4A 3V6DA 3LALA 3OYDA 1VSLA 4Z4GA 1C0TA 3CFRA 4N47A 4LD0A 1EXQA 1UWBA 2HNDA 2P51A 3WNEA 4GW6A 4DFKA 1ZBUA 3B6OA 3UIQA 4CEFA 5HRPA 5KRSA 3L8BA 1ZBIA 3DRPA 1D5AA 4DTXA 2G8WA 1I3AA 3OYEA 2YHBA 5CY4A 3K2PA 4F4KA 1SL2A 1T7PA 3KLHA 3DYAA 3TARA 5I3UA 3QEVA 3RR8A 4N41A 4B9UA 4KB0A 3MEEA 1TL1A 4PY5A 3KLFA 1RDCA 1JL2A 2HW3A 3OJUA 3LP2A 4M41A 2D0CA 1BCMA 2Z1JA 4C8NA 1RBVA 4EP4A 3OJSA 5J2PA 1JLCA 1HMVA 3DLGA 4FJMA 1NJWA 2RN2A 3L3UA 1MU2A 1NK6A 4OKKA 4BE2A 3SUOA 2YNGA 1B9DA 1HJRA 4MFBA 3VQ8A 3OYIA 1YTAA 1C1CA 1KVBA 4PUOA 3AVGA 4FLZA 3V9UA 1DTQA 4JRQA 4F2SA 1TKTA 2JGUA 1S6PA 1BIUA 3O4NA 4DMNA 4HUGA 4DWIA 3OYBA 3OYJA 4FZYA 1QQCA 5DK5A 4CEAA 3RMBA 4OLAA 2BDPA 2VWJA 4DSJA 4FLUA 3DLRA 4CF9A 3QEPA 1JLAA 1RT2A 1NK0A 3OS1A 3ZSZA 3HM9A 1RT6A 3MAQA 5HLFA 4F3OA 3SJJA 2PYLA 2I5JA 4E1NA 4PA1A 3BDPA 4AILC 4DSLA 2IOCA 1VSMA 2HHVA 1BL3A 2F96A 1S1UA 3K57A 2BGGA 4H4OA 4Z4HA 4FZZA 3O3GA 1ASVA 2DFHA 3HT3A 2KTQA 1S9EA 5FROA 3TR8A 3IAYA 1L3TA 2OA8A 2XO7A 4IG3A 3C6TA 3PY8A 4FJ9A 2JLEA 3AVLA 3IRXA 4OGEA 1ZBLA 1C0UA 4FLWA 1Q8IA 5SWMA 1Y97A 2B5JA 3M8RA 5HP1A 3AO1A 3QINA 1LWFA 2PZSA 3LP1A 2ZQBA 1TKXA 4M3WA 4FVMA 4FJKA 4DS5A 3TANA 4IG0A 1VSHA 4K8ZA 2F8TA 2HHXA 1A5XA 3AO5A 1RILA 5T7BA 4BE0A 1RBSA 3ZSVA 4CJTA 4DTPA 4FLYA 4DSFA 4N56A 1D9FA 2QXFA 2D5RA 3OYAA 4G1QA 4B08A 4RW8A 4CF8A 2ATQA 3VQ5A 3QIPA 4FW1A 1L3SA 1T03A 3ZT4A 5CZ2A 2KFZA 3LAMA 2YNFA 3VQ9A 3E01A 5C25A 5JS2A 1NK4A 4DQPA 1JXBA 1NKBA 4FJ7A 3AVCA 3VQAA 5HRSA 3KK1A 4HUFA 4E19A 4DS4A 1YT3A 3DRSA 4AHCA 1ZYQA 4B9VA 1J9AA 1C1BA 3A2FA 4CGFA 4JLHA 3TAFA 3NGIA 3DLEA 3PX4A 4HHTA 2A1RA 3EY1A 2HHQA 5HRNA 3KLGA 4DU1A 3G0ZA 3QO9A 1Q9YA 4CEDA 1HRHA 2DFEA 4KRFA 4CJKA 2Y1JA 3JSMA 3LAKA 1CZ9A 4CESA 4ZTJA 2Z1GA 4UQGA 2KZMA 1CLQA 3MEDA 4CIEA 2HHTA 1JLEA 3AVAA 4KREA 2E6MA 4CEBA 4CGHA 4FM1A 2E4LA 4C8OA 3QNOA 3PX6A 3L2UA 4B9NA 4N76A 2OPPA 4CEOA 1TK8A 4CHPA 3K58A 1XHZA 2G8VA 4KHWA 4CJSA 3L3VA 3LPUA 5C24A 1IO2A 2QKKA 4AHSA 4CF0A 3K5OA 1RBRA 5DMRA 2FC0A 4RW9A 5HRRA 3SQ4A 1FK9A 2HB5A 1JKHA 5D3GA 3EYZA 4LH4A 4HCCA 4FJLA 3TAQA 1EX4A 4NYNA 1SV5A 2XHBA 2IAJA 3TAPA 4BACA 1HQUA 3LZJA 3V1QA 3HVRA 4KTWA 4OGCA 1NJZA 4CJUA 4IKFA 3RWUA 4FW2A 1U48A 4CFDA 3LANA 4DFMA 1NK7A 4CHZA 3PUFA 3ZT2A 1BGXT 1WSJA 2IGIA 1S9GA 3VQPA 4DF4A 4ELVA 3RMAA 2G8FA 4L8RB 4AHRA 3EZ5A 4HTUA 4KFBA 3NHGA 4PQUA 2DY4A 2O4GA 3KK3A 4J2BA 1LWEA 3DLHA 2G8IA 3DOKA 4I9LA 4DTSA 5J1EA 4CHNA 4DQRA 4E3SA 4RG8A 4N5SA 3RRHA 2OYQA 4J2EA 3KTQA 1EP4A 4W5RA 4F2RA 4ID5A 1T8EA 3PO5A 3KIOA 2IS3A 3NF7A 1QSLA 1ASUA 4LSNA 4E0DA 2AJQA 1TAUA 1CXUA 1HNIA 3VQEA 4BDYA 1WSGA 3VQBA 3B6PA 1WSIA 2BANA 3V9ZA 4OKEA 3KKSA 3LP3A 4NYFA 3WNGA 2XRIA 4AHVA 4DSKA 4CJLA 4W5TA 2HHWA 1O1WA 3AO3A 3ZT1A 3ZT0A 2HHUA 5KI6A 2OPSA 4E89A 2W42A 2QK9A 3WNHA 3DRRA 1KCFA 2O4IA 4OJRA 1BCOA 3LWLA 2DFFA 3NF8A 1U45A 3OY9A 1B92A 1Q9XA 2BE2A 1KFDA 3AA2A 4HVJA 3F9KA 3OYHA 4M3RA 4CHQA 5J2MA 2B6AA 4CJQA 4YFUA 3LWMA 2YNIA 4KAZA 3ZSQA 1RCHA 3KKRA 1VSFA 1VRTA 1RTJA 3HPOA 3SV4A 4DU3A 2EX3A 4IBNA 1S5JA 4Y1CA 4Z0UA 1BHLA 1RT3A 3VQDA 4E7HA 2HMIA 4HCBA 1KLNA 4J2AA 1FKPA 1S1TA 3F73A 3HL8A 3HVTA 4W5QA 3CYMA 4FZXC 5KGXA 3ITHA 3OS2A 1LV5A 1IH7A 2KQ2A 4DTJA 3U6FA 3AVFA 3T1AA 4CIGA 1QHTA 3OS0A 4EZ9A 3P5JA 3VQ7A 3U3YA 2X6SA 5FDLA 3NF9A 4CFBA 3IS9A 4M3XA 3K5LA 3RMCA 1REVA 4CGGA 2WOMA 1C0MA 4KB1A 4CK3A 1WLJA 4JS5A 1QSSA 4DFJA 4CEZA 2FBTA 4B3OA 3AA3A 4CF1A 3HXMA 4JS4A 3V1RA 1SKWA 1QTMA 4CGIA 3ULDA 4B9TA 2RKIA 4LSLA 2QKBA 1GOCA 2OPQA 5J2NA 4KHQA 3HPGA 3TAMA 1RT7A 3OYGA 2G8KA 4FM0A 4Z4IA 4FLTA 4CK2A 4QCLA 4CEQA 4F3TA 2YHAA 3T19A 4O44A 1I39A 3AA5X 3DLKA 3LPTA 4IFVA 4M45A 4CF2A 3DM2A 1C1AA 5SZTA 3O4QA 3RTVA 4DFPA 4I7FA 1XI1A 4I9QA 3DMJA 3ZSRA 3VQ6A 2ITGA 3S3OA 1HYSA 2OZSA 3RMDA 3ZT3A 2YKNA 3KLEA 1JLBA 2OZMA 2FBXA 4B9LA 1BISA 3OYLA 3OVNA 4M3ZA 1S1XA 3M8SA 4JRPA 4ICLA 4C8LA 1VRUA 2X74A 4DTRA 1J5OA 4AHUA 3TABA 4KPYA 4DLGA 1RBUA 3I0SA 3OYCA 2DTUA 2HVIA 1HNVA 4OVLA 4CJPA 1LAWA 3C95A 1NJYA 4IFYA 1SUQA 1B9FA 3ISNC 1JLQA 2ZE2A 1NKCA 4EP5A 3KK2A 4F8RA 3TWHA 3AVMA 4CJEA 3O3FA 4FJ8A 1D8YA 1TVRA 3AA4A 1WAFA 3SQ0A 2WONA 4FK4A 4M3TA 4E7KA 3WNFA 3HSTB 3HPHA 4ID1A 4FK0A 3LP0A 4CECA 2Y1IA 4ELTA 4CHYA 4DSEA 1NK8A 1TGOA 1SL0A 4KHNA 3AO2A 4W5OA 3U3GA 3NH0A 4DTOA 2YNHA 3NF6A 3NBPA 2E6LA 1JL1A 3S3NA 1ZBFA 1N6QA 3SYZA
chains in the Genus database with same CATH superfamily
4BVOA 4DUYK 3MEGA 2QWMA 2XY8A 1S22A 3TSPA 4KHUA 4IXCA 4CERA 4U7BA 5C15A 5LJVA 3B8AX 1QZ6A 1D9DA 3D2FB 4PL7A 4DF8A 1BQNA 3QLHA 3C6HA 3JXUA 3T3FA 3BGRA 3SNNA 1U47A 4ILGB 4YOYA 1QE1A 3CFOA 1Q7YO 5KTQA 3S3MA 3HJFA 3QEIA 4KV8A 3MXJA 4Z4CA 5BRFA 5C12A 1BI4A 3SCXA 2HBLA 4JK7A 1ITGA 3C0BA 4FK2A 4FJHA 3AVIA 2VQEK 3GG4A 3CCMN 3T1HK 4BR9A 1NGBA 1R0AA 1XWLA 2FF6A 1TYQA 4TSXA 4BWJA 1UA1A 3O5BA 3O9UA 3MXIA 4JHDB 2VGNA 4CJ4A 1RT1A 3ZSWA 5M1KA 1S72N 4DQIA 5AQGA 1NK5A 2PYJA 1MWKA 3O9QA 3RR7A 1P8ZA 4PWDA 4JEPA 1TAQA 4IEIA 4GVEA 3AVJA 4F9OA 3MECA 2Q97A 3MN5A 2EHGA 4FJIA 2X78A 3WEEA 3GDQA 4KHYA 1U49A 3THWA 3OYFA 3C94A 3QERA 5AZJB 2XY6A 1TL3A 1NLVA 3R1XA 1T3VA 1CZBA 1KTQA 4BC4A 4CHOA 4GMJB 1M1KO 2IC3A 2F4VK 5AJ3K 2H3GX 3TTCA 3ALYA 5HBMA 4I2PA 4CZLA 3OYMA 1RBTA 3O9SA 3BEXA 1OH8A 2HVHA 3O1WA 2R7YA 3QESA 3D2EB 3LL3A 4FYDA 1Z25A 2GBZA 4LH5A 4O4GA 4GV6A 4JN4A 3SLCA 1JCGA 1NOZA 2ZD1A 3CF5L 3RSEA 1RTDA 1HYZA 3VEXA 3AGKA 3UE5A 3K5MA 4QS9A 4BDPA 3CM5A 4DQQA 3HK2A 3P39A 1UA0A 1FKOA 3FGUA 1KD1O 1NJIO 1RGIA 4DSIA 2EWSA 2VG5A 1W0HA 2G8HA 1HX1A 4EAHD 1IKVA 3FZMA 3L2QA 1TK0A 3WUHA 4FWNA 4XH4A 4FWOA 2YJEA 5AQSA 2PBDA 4DV0K 1SAZA 1X9WA 4E7JA 4Q5VA 3ZEUB 3SZ2A 4OX9K 3KWIA 3MN9A 4DU4A 2P9IB 1YHQN 3PX0A 3EE9A 1OKJA 3VQ4A 3SUNA 4EZ6A 1X3NA 2E1YA 4H5TA 4CJWA 4YOUA 1Z26A 3EO3A 1KVCA 1RDWX 4QOZB 4BRAA 1GOAA 3NH1A 1TKZA 5AQQA 3L0QA 4CFCA 3SQ2A 3WXMB 4BC2A 5FPDA 3ENHA 1X9MA 4IEEA 4X66K 5GADP 3ZETB 1X1PA 4Q0BA 3WXLA 4O55A 3V6DA 4Z4GA 1EXQA 1N36K 1IV0A 4PHTX 3SBTA 3B6OA 5HRPA 4BRGA 4DTXA 4JI0K 1MDUB 3KLHA 3DYAA 1QQNA 3CQXA 2BTFA 2NZTA 3MEEA 1JL2A 3D7EO 4M41A 4FWQA 1TYQB 1IJJA 4EP4A 1RBVA 2I7NA 3DLGA 4OKKA 4MFBA 3CCLN 1C1CA 2HF3A 4PUOA 3C7NB 4DMNA 4HUGA 4DWIA 3OYBA 4FZYA 3H46O 5BRHA 3RMBA 2VWJA 3CHWA 3Q7CA 2OANA 3DLRA 4FLUA 3GE1A 1E3MA 3CMAN 2IOCA 2F9WA 1ASVA 3DJCA 2DFHA 3IAYA 2HBJA 4YORA 3PY8A 2ZGYA 2JLEA 2YCHA 4BGAA 1U2VB 3ID8A 2P9NB 2O8FB 3O1BA 4OGEA 1Q8IA 5A2QO 3J8AA 3LP1A 3THYA 4M3WA 4H0YB 1NGHA 4IG0A 3N4PA 1D4XA 3I33A 3AO5A 2JWLA 4CJTA 3ZSVA 4DTPA 4FLYA 2VCPA 1RFQA 5EVZA 4G1QA 2YJFA 4DCHA 4B08A 4CF8A 2ATQA 3VQ5A 1T03A 2YNFA 3VEVA 5C25A 3CC7N 4FJ7A 3KK1A 4DS4A 2VQFK 2P9SB 1M90O 4KHPK 3VETA 3G6EN 3CPEA 3DLEA 3PX4A 4HHTA 3KLGA 3G0ZA 4BRNA 3CPWM 2Y1JA 3EZWA 4UQGA 4CIEA 4JD2B 4CGHA 2E4LA 4A2BA 3QNOA 3L4QA 5BPLA 1TK8A 3K58A 4EHUA 1K73O 4CJSA 5IT9O 3WXJA 4I6MA 1RBRA 5HRRA 2FC0A 3BUZB 3EYZA 3ZX2A 1SV5A 2E1ZA 4BACA 3LZJA 4B3MK 1NJZA 4OGCA 4CJUA 4KH4A 4DR4K 4ISEA 2GUPA 3PUFA 1BGXT 4DF4A 1NGDA 4MDAA 3EZ5A 4HTUA 4KFBA 3NHGA 4PQUA 2O4GA 3KK3A 1LWEA 3DLHA 4LFCK 4DQRA 4N5SA 3PO5A 1KXPA 1QSLA 4B1WB 1TAUA 2AJQA 1HNIA 3VTIA 3J7AP 5HL7L 3V9ZA 4A5AA 2XRIA 4JKGA 3FE1A 4AHVA 2HHWA 2YHWA 3AO3A 3ZT0A 3WNHA 2A5XA 2O4IA 4BC5A 3CJ7A 3MWPA 5ELZA 1U45A 1B92A 4BRDA 3S41A 3CJCA 4HVJA 4M3RA 4CHQA 4YFUA 3LWMA 2UUBK 1VRTA 3PSFA 2EX3A 4E7HA 1BHLA 4B9QA 5AR0A 3F73A 4CZJA 1MWMA 4W5QA 2CGKA 3Q7BA 2KQ2A 5ADXA 4NXNK 5LMUK 3VQ7A 3U3YA 2WUSA 2X6SA 4CFBA 4DKWA 5BR8K 3RMCA 1REVA 4FO0A 3NVMA 1C0MA 1VQ5N 4KB1A 3SK3A 2VYPA 4CEZA 4B3OA 2AA4A 3AA3A 4CF1A 5F0XA 4LSLA 1HNXK 3CCJN 4QS7A 5KPRA 1YIJN 5C0YA 3UB5A 4F3TA 2YHAA 4J8FA 4O44A 4WQ4C 4OO1J 4M45A 5SZTA 3ATUA 3O4QA 2QWOA 5EOYA 3DMJA 2GWJA 5AQWA 2BH1A 3FZFA 3S3OA 3LDQA 4M7YA 3VMFB 1VQ7N 4LF4K 4M3ZA 4ICLA 4KPYA 4JNEA 1OH7A 4AHUA 1J5OA 4FSVA 2UUCK 5KPTA 4JKAA 5GAGP 4K42A 4LFAK 2WBNA 4JYAK 4RCHA 2PAVA 1C0FA 3KK2A 2HSTA 3O3FA 4FJ8A 4X65K 1TVRA 3AA4A 4AF1A 1SZ2A 3HPHA 4BRMA 4BQZA 3NH0A 1XMQK 2YNHA 3D2FA 2W40A 4X64K 1JL1A 2W42A 1N6QA 3SYZA 3KD5E 4AH9A 1YF5L 1BA1A 1FXXA 3VTHA 4FJGA 3QBWA 2Z1IA 2Q3SA 4FWLA 1DLOA 4KKOA 4R5PA 1HNWK 2RHKA 1F21A 3AVHA 4CZGA 4B1YB 4CZKA 4EIAA 4BR4A 5HROA 1WSFA 4A57A 3ZSOA 1U04A 1W9HA 3CFPA 3SPYA 1RT5A 4NCGA 3PSIA 2P9UB 5M1PA 1KQSM 2YV0X 2W6LA 3V9SA 2QW9A 3BF1A 1DKGD 4JHDA 5GAHP 1J53A 4FJ5A 4FCYA 3BF3A 1T6DA 5I42A 4C23A 1IBMK 1JXEA 2OPRA 4HTLA 2NUBA 1OH6A 3PIOL 3HP9A 1T05A 3NH2A 3H08A 4FLXA 2GUIA 1G15A 4ELUA 5HOOA 4JI4K 1XC9A 1EWQA 2XY7A 4BDZA 1NGCA 5AZJA 1P90A 2W41A 5AFUA 1LWCA 3QDKA 5LMNK 5EXWA 3S9HA 4FJJA 5FRNA 3I55N 4O0IA 4YHHK 5AQRA 3L6QA 3NVKA 4DV2K 2FSNA 2GV9A 1K6YA 3ASMA 3D2EA 1T6CA 3MWTA 4BR5A 4C8KA 1HQEA 2VWKA 3TU5A 1YTUA 2Q0RA 1Q86O 2IVPA 2HHSA 4CFAA 3O8MA 5CE3A 5MLCQ 3VENA 2VG7A 2LSNA 4Z4FA 4CK1A 2Q0UA 1N34K 4OPAA 4IDKA 3AV9A 4AQYK 2E8AA 2O8DB 4MLEA 4B1ZA 3K59A 1VSDA 4I2QA 2KFNA 4H4MA 5AQVA 5E41A 4K8XA 2QM1A 3VPZA 1TV6A 1HKCA 3LDSA 1YI2N 3F2KA 3MCPA 3TTDA 2B4JA 5B8HA 1WAJA 4RW7A 5C42A 2E88A 4GKKK 5CR4A 3ZEUA 3FZLA 4CGJA 4Z4EA 2P9IA 4RW4A 4JAXA 3LDOA 1GLDG 3DOLA 4BR0A 2VWBA 4CJ5A 5JMVA 4DV3K 3ZSXA 4JI5K 4GNIA 4FOIA 5FLXO 2HHHK 1L3UA 1GOBA 1EETA 1X9SA 3FFKB 5AQYA 4B3RK 1NGFA 2RE2A 2ZWHA 3ZETA 5CYMA 3WQUA 3ENOA 4FJXA 4OKJA 3KLIA 3DAWA 4MO5A 3AVNA 5KGWA 5AZIB 3QIOA 3KZBA 3HZ6A 5AQKA 4B8AB 3TI0A 1NOYA 2VG6A 1YAGA 3HYFA 3G10A 4KI4A 1EQYA 3CFRA 4N47A 2HNDA 2P51A 1VQNN 4DFKA 5KRSA 3L8BA 1LCUA 2P9LB 2G8WA 1I3AA 3OYEA 5F1XA 3K2PA 2ZGZA 4B1UB 3TARA 5I3UA 3QEVA 3KLFA 1NM1A 3C7NA 3CERA 3CJ9A 2D0CA 2Z1JA 4JKEA 4HWIA 1JLCA 3UKUB 4CI6A 2RN2A 4LC9B 1N8RO 4BE2A 3OYIA 4MDBA 1YTAA 4FLZA 3E1YA 4JRQA 1BWFO 1TKTA 1S6PA 1KC8O 4M7XA 1BIUA 3OYJA 4CEAA 4DSJA 4CF9A 3M3ZA 1JLAA 2FSKA 1NGJA 4DHYA 3SJJA 1U2VA 4E1NA 2P9NA 2PYLA 2HHVA 2O8FA 1ATNA 3J7ZO 2UXBK 3HT3A 2KTQA 1S9EA 5FROA 3HTVA 3DXKA 2XO7A 4BRPA 4FJ9A 3AVLA 3IRXA 3WT0A 4FLWA 4K43A 2PZSA 2IVOA 4DS5A 4JKFA 3SAGA 4BE0A 1RBSA 4N56A 1D9FA 2QXFA 4DR2K 3VEOA 3H3NO 1QHAA 2P9SA 1NWKA 2E2OA 3EKSA 1L3SA 4FW1A 3A0IX 2KFZA 3QFUA 3LAMA 5DM7L 1NK4A 4DQPA 4H5NA 3VQAA 3HRGA 2QTDA 1YT3A 3U9ZA 4AHCA 1J9AA 3A2FA 1VQ9N 2NLXA 4JD2A 2QEXN 3HOTA 1JCFA 3JAMO 2D4WA 2HHQA 3EY1A 2CGLA 2A6AA 1Q9YA 4CEDA 5TKYA 4KRFA 1OH5A 3LAKA 1CZ9A 1VQLN 2ZF5O 1HUXA 1CLQA 5AQIA 1JLEA 1NG9A 4BG9A 4FM1A 3PX6A 3U9DA 3L2UA 5AQHA 4CHPA 2G8VA 3CCVN 3L3VA 3VF2A 4CJ7A 5DMRA 3SQ4A 2ZJQL 4LH4A 4ILJA 4HCCA 3TAQA 1Y64A 2IAJA 4BROA 3V1QA 4QS8A 4IKFA 3RWUA 3VERA 4CHZA 4B3SK 3RMAA 4L8RB 2DY4A 4FPBA 3ZLJA 1E4FT 5LJWA 4BRLA 4DTSA 5J1EA 4W5RA 3BY5A 1J6ZA 1ASUA 1OVYA 3VQEA 4JK9A 1WSGA 5FPMA 1WSIA 3QFPA 3WNGA 5GIPA 3ZT1A 2HHUA 3A5OC 4E89A 1KCFA 3SMSA 4OJRA 2E2QA 2DFFA 4LF5K 4CD1A 5C2FA 2BE2A 3F9KA 3OYHA 1W2BM 2V7ZA 1FJGK 3KKRA 1VSFA 2DPNA 1RTJA 3HPOA 3P4IA 3EL2A 4DU3A 3A8YA 2A42A 4Y1CA 1RT3A 3FR0A 3VQDA 4HCBA 2CGJA 1KLNA 4LFBK 1NGGA 1U6ZA 2QXLA 3HVTA 3TPQA 2UYTA 4C1NK 5I9EB 1IH7A 3OS2A 1LV5A 1V4TA 3DXMB 4YOTA 1QHTA 5GAEP 1OVQA 3R6MA 3N4QA 4JK8A 2P9KB 4BQLA 3OA9A 3VGMA 4YOWA 2YHYA 3IS9A 1QVFM 3K5LA 4O5FA 1NGIA 4GKJK 1YITN 4CK3A 1WLJA 4DFJA 3DXKB 5AQPA 3HXMA 4BR7A 1SKWA 2QI2A 4CGIA 4BRIA 2OPQA 5J2NA 3GL1A 3CMEN 3ZYYX 4KHQA 1RT7A 2G8KA 4Z4IA 4GY2B 4CK2A 3ZX0A 4EHTA 4CF2A 4I9QA 1C1AA 3RTVA 3ZSRA 3CCEN 2ITGA 3M1FA 1HYSA 3ZT3A 2O8CB 2OZMA 2FBXA 1S1XA 3MK6A 1RBUA 3QICA 2DTUA 3CJ1A 2HVIA 4OVLA 1LAWA 1NJYA 4WFBL 1Q82O 3ISNC 1JLQA 1QQOA 3WXKA 1BDGA 3VGKA 1T44A 2KHOA 1WAFA 2NRWA 4M3TA 3PIPL 3WNFA 4FK0A 2Q1NA 4CECA 2Y1IA 4ELTA 3VEWA 4FWSA 4DSEA 4C1NI 1NK8A 1ESVA 3AO2A 1HKGA 1XC3A 4DTOA 3NBPA 5M1QA 2E6LA 1DGKN 4NLBA 4L3QA 2FBVA 2E20A 4ISFA 2GEMA 2QWLA 3VQCA 4RW6A 3ZSYA 4DV4K 3QEWA 3AVKA 3CQYA 4B1VA 3CXCM 1IKYA 2ZJPL 3P1GA 5GINA 5JVGL 5ADXH 2P9PB 3VA3A 2P9UA 1CXQA 1VSEA 3V81A 2PY5A 3NAEA 3T7ZA 1VQMN 4A61A 2P5GA 4GV9A 4FL9A 4BC3A 1N33K 1KAZA 1K8AO 4OPKA 1KVAA 3QETA 1DEJA 4AHTA 1BUPA 4GVMA 1A5WA 1Z6RA 2NRVA 4XH1A 4YNQA 4DV5K 1KFSA 3OYKA 2ASOA 4PKIA 1RTHA 1ASWA 3AAQA 4H0VB 3V9XA 1K9MO 3O6WA 2ASMA 4Y0WA 4CE9A 4DLEA 3J81O 1RDDA 1XHXA 4G9ZA 4O5BA 3SPZA 1N5YA 1DTTA 5CZ1A 1NMNA 3SUQA 3I8DA 4H0TB 4IOAL 3V4IA 3OHRA 4DV7K 4CEEA 4B9SA 3BP8A 4FWRA 3AGRA 3DLBA 3V1OA 5IWAK 3I0RA 3ZX3A 1U4BA 1UAXA 1BA0A 3M8QA 3VA0A 3NMUA 4C8MA 3OYNA 1IG9A 3CG7A 3MX2A 4B8CA 1RDBA 1E4GT 2A40A 3GBTA 3M8PA 4Y1DA 3DWLA 4CBXA 4NB4A 4M42A 4NCBA 4MLHA 1BQMA 3ZCMA 2O8DA 4JV5K 1YVUA 3VQQA 2GELA 4LF9K 4JKDA 4DTMA 3KD1E 3CM6A 5TKWA 1VSIA 1HNZK 2WTUA 4CJVA 5JS1A 1TK5A 1O13A 3U4LA 1G99A 3NDKA 1JLGA 1WSEA 4KO0A 3V9WA 4M3YA 4DG1A 4WFNL 2G8UA 3UKRB 3LDNA 3HP6A 4DR1K 1WUAA 2D0BA 3KK7A 3K0SA 4CBUA 2KLAA 1I94K 4YDUA 4OLBA 1HPZA 3MCAB 4M3UA 2YKMA 4FXDA 4CZHA 3QEXA 4KTZA 5JLHA 2NRXA 3LDLA 1NK9A 4AM7A 1GLFO 2CH5A 4V19S 5BN9A 4ZTFA 2VGMA 3KJVA 3O80A 2J4RA 2HNYA 4JKBA 3QNNA 4XIUA 2KKZA 3NGYA 1J54A 3NGZA 2D0AA 2OCEA 4XEIA 1L5UA 1LAVA 5AZIA 3SUPA 5AFUH 5AQNA 1KLMA 1UOCA 1VQPN 4CZFA 1S1WA 3PO4A 1WB9A 1GLCG 3THVA 2D0OA 4FJNA 4PL8A 4B1XB 3L2VA 5EU7A 1WOQA 2F7TA 2ASPA 4K0KK 3SAHA 3P38A 4CW7B 1RT4A 2P9LA 3W0LA 3DI6A 4PKHA 4FWPA 1VAZA 3LALA 3OYDA 1VSLA 1C0TA 4LD0A 3A5MC 4BGBA 1XQSC 4B3TK 1NU0A 3UKUA 1D5AA 5BPMA 2YHBA 3RR8A 4N41A 2HBMA 1TL1A 2HW3A 3OJUA 1IG8A 3LP2A 1K8KB 4C8NA 1X3MA 1BCMA 3KWGA 4DR6K 5JVHL 1GLLO 3VQ8A 5GIOA 1HJRA 3AVGA 3V9UA 4F2SA 3PLAA 5JLFA 2BDPA 3QEPA 2D1KA 4K25A 4RTFD 3OS1A 1RT6A 3ULEB 3MAQA 1NK0A 3BDPA 4PA1A 3E9LA 1VSMA 1BL3A 2CH6A 2NRZA 1BU6O 1S1UA 2BGGA 4H4OA 4FZZA 3O3GA 1NGEA 3OTOK 3TR8A 3TSUA 2UXCK 1L3TA 3BZCA 4BG8A 3THXB 2D0PA 3C6TA 4O8UA 4CVNE 3EEQA 5KQDA 1C0UA 1GLBG 1Y97A 5HP1A 3AO1A 3QINA 1LWFA 1VQON 2ZQBA 4FVMA 4FJKA 3TANA 3MN7A 4K8ZA 1RILA 4WQ5A 5T7BA 3VF4A 3VESA 3AARA 4X62K 3HSCA 4LF8K 3D6RA 2O8BB 2FF3B 3J7YP 3ZT4A 5M1NA 1H1VA 5JS2A 3CCUN 5HRSA 3SJHA 4E19A 2V52B 4FPAA 4CGFA 4JLHA 3TAFA 3NGIA 5AQZA 3IMXA 2A1RA 3EN9A 4CD3A 3QO9A 1YJ9N 1HRHA 4CJKA 3JSMA 4BRCA 4ZTJA 4H03B 2Z1GA 2KZMA 4A59A 4CEBA 4YY3K 3CCQN 5AQTA 4B9NA 2OPPA 1XHZA 4KHWA 5EX5A 5C24A 1IO2A 2QKKA 4FOEA 4AHSA 4CF0A 3H45C 3CCSN 3IDHA 3IKMA 1EX4A 2HMPA 2XHBA 3HM8A 3CC2N 3HVRA 4KTWA 1U48A 5E26A 1XNRK 3LANA 3VEYA 3ZT2A 2IGIA 3LM9A 4AHRA 4BVPA 4J2BA 2UXDK 4KH5A 2G8IA 3DOKA 4I9LA 4NLCA 4CHNA 5M1FA 4E3SA 1GLEG 3KTQA 1EP4A 4ID5A 1T8EA 1WBDA 3NF7A 4IDHA 4E0DA 1ATSA 2GTDA 4FWMA 5C2DA 4BDYA 1YJNN 3B6PA 2BANA 2WC9A 4WF9L 3KKSA 3LP3A 3EKUA 4NYFA 4JI3K 4CJLA 4W5TA 5KI6A 2OPSA 3ENBA 1NMDA 3DRRA 3LWLA 3L4IA 3OY9A 5FPEA 2E2PA 1Q9XA 2Q36A 1KFDA 3AA2A 3MMVA 2FLOA 3DXMA 2B6AA 3H1VX 4CJQA 2YNIA 5BPNA 3ZSQA 1RCHA 2W6KA 2P9KA 2ZM6K 1EWRA 4J2AA 4DR5K 1FKPA 1S1TA 3HL8A 3CYMA 2A41A 4DTJA 2NRRA 1XMOK 3AVFA 3T1AA 3OS0A 3P5JA 4R79A 2O8EB 3R9PA 2V51B 4M3XA 3H3OB 4MO4A 1EO1A 4CGGA 1QSSA 4JS5A 1ZXOA 4JS4A 2QKBA 3LDPA 3OYGA 3HI0A 4FVUA 4QCLA 3R8EA 2O8CA 4U67L 4CEQA 3T19A 1I39A 3AA5X 3DLKA 4IFVA 4DV6K 4I7FA 2OZSA 3RMDA 2YKNA 3KLEA 1JLBA 2ZJRL 5AQUA 1HLUA 4IFEA 4JRPA 1VRUA 5BRDA 4DTRA 1FW6A 2A3ZA 3TABA 4GV3A 3I0SA 2PFUA 1HNVA 3C95A 1B9FA 4JKHA 3H6EA 4NO7A 1NKCA 4F8RA 3AVMA 4CJEA 3O08A 3CCRN 2WONA 4FK4A 3W3DA 3HSTB 2HF4A 4ID1A 1Z05A 3LP0A 4IO8A 1TGOA 1SL0A 4KHNA 2IVNA 1HKBA 3NF6A 3I56N 3S3NA 2Z1HA 2P9PA 3P83D 3A5LC 1SKRA 3G4SN 1BO5O 1WN7A 5AQXA 4FLVA 1R59O 3RRGA 3CD6N 3VN5A 1KAYA 2A1SA 2KW4A 4DQSA 4E1MA 4H5RA 5JICA 3M6GA 4Z94A 4H8KA 4OPJA 2NRHA 1J5EK 3IG1A 3QB0A 3A5NC 5FRMA 2HNZA 1ZBHA 4BRQA 3OBWA 1NKEA 4KTQA 1VK0A 1JLFA 1L3VA 3JS6A 4A5BA 1ZC6A 1KSPA 1QS4A 3LZIA 4EFHA 3SAFA 4DR7K 3ATVA 1WSHA 1RTIA 3QBXA 1NJXA 1BI4B 1TUYA 5AQJA 3O3HA 4O0JA 2E5LK 4IJNA 4AM6A 1S1VA 3P31A 3NE6A 1DT9A 3KVGA 3SI6A 5F2RA 5K14A 5J2QA 1IKWA 3AAPA 3EE8A 5KPZA 3TAEA 1TKDA 3HO1A 4IZ9A 4HUEA 4CGDA 4NCAA 4WYBA 4CJRA 3VGLA 2F8SA 1YVNA 4CBWA 5CYQA 1SL1A 3O9TA 1C6VA 4CIFA 3OBYA 3H1QA 3CIPA 1XUPO 4DR3K 1A5VA 1VSKA 3CI5A 3VEZA 1LW2A 1VSJA 3WEEB 3MX5A 3THWB 1LW0A 1S6QA 4CCHA 3TTFA 3BZKA 2ETJA 3E9OA 1X9JA 4BE1A 4BY9C 2P1JA 3O9RA 4DTNA 3FLCO 3JYTA 3L2WA 4LY7A 2GWKA 1N32K 1QSYA 4J2DA 3AVBA 3UKRA 4WE1A 3MXMA 2YX6A 2P5OA 2WFBA 1LOTB 4H5VA 2FSJA 3K5NA 3MDQA 1NNEA 3PV8A 4W5NA 3VOVA 4MQ3A 3SV3A 1HYVA 4ZHRA 4FZXC 4WFAL 4KHSA 3C6UA 3GOIA 3SQ1A 3FZHA 1EKEA 3FFIA 5M1OA 3D45A 3C6AA 1IKXA 4IOCL 3RSEB 4FM2A 5KRTA 2XY5A 1SKSA 2X6NA 4KI6A 1RNHA 2V7YA 2RPIA 4DTUA 2FBYA 3AY9A 4LF6K 1WNSA 3NCIA 2JWKA 1KAXA 4CJ3A 4JI1K 2Q31A 1WBBA 5C10A 1BIZA 5EY4A 3I8BA 3U8XA 4IWVA 2IDOA 4E7LA 2KZZA 5BREA 2RF2A 3NFAA 3D0PA 1KRPA 4KBOA 3CQ8A 3AO4A 4E7IA 1VHXA 4CZEA 4BWMA 1RDAA 1Q18A 4CZMA 1VQKN 2YI1A 4B9MA 4CJFA 3L2RA 3TAGA 4QAGA 4ISGA 3CETA 2UUAK 1UWBA 3WNEA 4GW6A 4IO9L 1K8KA 1ZBUA 3UIQA 4CEFA 2E2NA 1XNQK 2IIRA 3T1YK 1ZBIA 3DRPA 2I7PA 3J80O 4F4KA 4DUZK 5CY4A 1SL2A 1T7PA 2HOEA 4B9UA 4KB0A 4PY5A 1GLJO 1RDCA 1QVGM 3O4WA 5J2PA 3OJSA 1HMVA 4FJMA 1NJWA 3L3UA 1NK6A 1MU2A 4NXMK 1S3XA 3SUOA 2YNGA 1B9DA 3ULEA 1KVBA 1YXQA 1DTQA 1RDUA 3C65A 2JGUA 3O4NA 1IBLK 1QQCA 5DK5A 4OLAA 4WCEL 4CZIA 4JI2K 1HR0K 4JI7K 1RT2A 3THXA 3HM9A 3ZSZA 2NNWA 5HLFA 4F3OA 5H1SQ 2I5JA 4DSLA 4AILC 4K41A 2F96A 3K57A 4Z4HA 4YDUC 2OA8A 4IG3A 2AP1A 1ZBLA 1ZBSA 4KH6A 4BREA 2B5JA 5SWMA 3M8RA 1GLAG 4DB3A 1TKXA 2O8BA 1VSHA 4IJAA 2F8TA 2HHXA 1A5XA 3ID6A 1Q81O 4DSFA 4JKCA 2D5RA 3OYAA 4OPHA 3RVCA 3T69A 3THYB 4RW8A 3QIPA 3IUCA 2QWNA 5CZ2A 5FPNA 4UY8O 3VQ9A 3E01A 1JXBA 2QWPA 1NKBA 3AVCA 4HUFA 3DRSA 4B9VA 1C1BA 4BRKA 1JCEA 4JI8K 5HRNA 4DU1A 3K9JA 1NBWA 2QWRA 2DFEA 3WQTA 1SS6A 2F9TA 4CESA 2NRTA 3MEDA 4M63C 2HHTA 3AVAA 4KREA 2E6MA 4A62A 2BUPA 4C8OA 3OW2M 2QA4N 4N76A 4YOVA 4CEOA 2QWQA 3LPUA 4PKGA 1ILYA 3K5OA 1YUWA 4RW9A 4WQ4A 5AQLA 1FK9A 2HB5A 1V4SA 1JKHA 3E66A 5D3GA 2ITMA 4H0XB 1JJ2M 4FJLA 4NYNA 3TAPA 1HQUA 3SBGA 3HBTA 4IOXA 4I6MB 4FW2A 4JI6K 4CFDA 4DFMA 1NK7A 3DLLL 4ELVA 1WSJA 3VQPA 1S9GA 2G8FA 3G25A 1C0GA 1HPMA 3IFRA 4BRFA 4YOXA 2OYQA 3RRHA 4RG8A 4J2EA 4F2RA 4E1JA 2FXUA 3KIOA 2IS3A 2YHXA 4LSNA 3F9MA 1CXUA 4BRHA 3VQBA 4OKEA 5KQ8A 4BR2A 4DSKA 1O1WA 5AQMA 2QK9A 1VQ8N 4XH5A 4DQ8A 1BCOA 4WQ5C 1IBKK 3F5TA 3NF8A 5E84A 1W7AA 4H0PA 1HJOA 4JKGB 3G71N 2GX9A 3TSQA 5J2MA 4KAZA 3KHYA 3SV4A 2O8EA 2HMIA 4IBNA 1S5JA 4Z0UA 5AQFA 5KGXA 3ITHA 3U6FA 4CIGA 4EZ9A 4ILHA 5FDLA 1ATRA 3NF9A 3HOSA 5AQOA 3CJBA 3R3LA 3MN6A 1QQMA 2WOMA 5CHIA 1NGAA 2FBTA 3SMPA 1MA9B 3V1RA 1QTMA 4B9TA 3ULDA 2RKIA 2OTLN 4H5WA 1GOCA 3CC4N 3HPGA 5LY3A 3TAMA 4FM0A 4FLTA 3E9PA 3FZKA 3LM2A 2OTJN 2HBKA 3QMLA 1ZYQA 3LPTA 3DM2A 1XI1A 4DFPA 3VQ6A 1TUUA 1CZAN 4B9LA 1BISA 3OYLA 1SQKA 3OVNA 4DV1K 4H0OA 3M8SA 4C8LA 2X74A 5BN8A 4DLGA 1VQ4N 3M5RA 5DM6L 3OYCA 4CJPA 4LF7K 2UU9K 4IFYA 1SUQA 2ZE2A 3K9KA 4EP5A 3CJAA 3TWHA 1D8YA 4O8KA 3SQ0A 1VQ6N 4A2AA 4E7KA 4RWTA 4CHYA 2Q2RA 5LL6Z 1BG3A 1W97L 1BOTO 1YJWN 1QZ5A 3U3GA 5BR9A 3WXIA 3VF6A 4W5OA 4FWKA 1ZBFA
chains in the Genus database with same CATH topology
3KD5E 2Z1HA 3P83D 1SKRA 4AH9A 3MEGA 1WN7A 2FBVA 1FXXA 4FLVA 2XY8A 4FJGA 3VQCA 4RW6A 3ZSYA 3RRGA 4KHUA 2Z1IA 3QEWA 3VN5A 3AVKA 2Q3SA 2A1SA 4CERA 2KW4A 1DLOA 4E1MA 4DQSA 1D9DA 4KKOA 1IKYA 4H8KA 3P1GA 4R5PA 4OPJA 4DF8A 1BQNA 1F21A 3AVHA 3QLHA 3VA3A 1CXQA 1VSEA 3V81A 2PY5A 3IG1A 3T3FA 3BGRA 3NAEA 3SNNA 1U47A 5FRMA 5HROA 2HNZA 1QE1A 1WSFA 3CFOA 5KTQA 1ZBHA 3ZSOA 2P5GA 1U04A 1W9HA 3S3MA 3CFPA 3SPYA 3HJFA 1RT5A 3QEIA 4KV8A 3MXJA 4NCGA 4Z4CA 1BI4A 1NKEA 4KTQA 1VK0A 3SCXA 1JLFA 4OPKA 1L3VA 1KVAA 1ITGA 2YV0X 3V9SA 3QETA 4FK2A 4KHSA 4FJHA 4AHTA 1KSPA 1QS4A 1J53A 3LZIA 3AVIA 4FJ5A 4FCYA 4GVMA 1A5WA 1WSHA 4YNQA 1KFSA 1RTIA 3OYKA 5I42A 1NJXA 1R0AA 1BI4B 1ASWA 1RTHA 1XWLA 3O3HA 4TSXA 1JXEA 4O0JA 4BWJA 1UA1A 2OPRA 3V9XA 3MXIA 1S1VA 3NE6A 2NUBA 4CJ4A 1RT1A 3ZSWA 4CE9A 4DLEA 3SI6A 3HP9A 4DQIA 1RDDA 1XHXA 5K14A 3NH2A 3H08A 1IKWA 5J2QA 1NK5A 4O5BA 1T05A 2PYJA 3SPZA 1N5YA 1DTTA 2GUIA 4FLXA 1G15A 3TAEA 5CZ1A 3SUQA 4ELUA 3I8DA 3RR7A 1TKDA 3HO1A 4PWDA 4HUEA 4CGDA 1TAQA 3V4IA 4NCAA 1XC9A 4CEEA 4B9SA 4CJRA 2XY7A 4BDZA 3AVJA 3MECA 1LWCA 3DLBA 3V1OA 2EHGA 2F8SA 4FJIA 2X78A 1SL1A 5CYQA 3I0RA 3S9HA 4FJJA 1U49A 4KHYA 5FRNA 1U4BA 4O0IA 1C6VA 1UAXA 4CIFA 3OYFA 3M8QA 3C94A 3VA0A 4C8MA 3QERA 2XY6A 1TL3A 2GV9A 1A5VA 1VSKA 3OYNA 1IG9A 1CZBA 1KTQA 1LW2A 1VSJA 3CG7A 1K6YA 4GMJB 4CHOA 2IC3A 4B8CA 3ASMA 1RDBA 1LW0A 1S6QA 3M8PA 4C8KA 3ALYA 1HQEA 2VWKA 4Y1DA 5HBMA 4CCHA 1YTUA 4I2PA 4M42A 3OYMA 2HHSA 4NCBA 2ETJA 4CFAA 1RBTA 2HVHA 1BQMA 3ZCMA 4BE1A 2P1JA 2R7YA 4DTNA 1YVUA 3QESA 2VG7A 2LSNA 3VQQA 3JYTA 3L2WA 4Z4FA 4LY7A 4CK1A 1QSYA 4FYDA 1Z25A 2GBZA 3AVBA 4J2DA 4DTMA 4LH5A 3CM6A 4O4GA 3KD1E 4IDKA 1VSIA 4WE1A 3MXMA 4CJVA 5JS1A 3AV9A 2P5OA 3K5NA 1TK5A 3PV8A 3K59A 4W5NA 3NDKA 1NOZA 2ZD1A 2KFNA 1JLGA 1RTDA 1WSEA 1VSDA 4KO0A 1HYZA 4MQ3A 3SV3A 1HYVA 4ZHRA 4I2QA 3K5MA 3V9WA 4H4MA 4DG1A 2G8UA 3C6UA 4BDPA 3CM5A 4DQQA 5E41A 3HP6A 4M3YA 3SQ1A 4K8XA 3HK2A 2D0BA 1EKEA 1UA0A 1FKOA 3FFIA 1TV6A 3D45A 3LDSA 1IKXA 4OLBA 1HPZA 2B4JA 4FM2A 5KRTA 4DSIA 1WAJA 4RW7A 5C42A 4M3UA 2VG5A 2XY5A 1W0HA 2YKMA 2G8HA 1SKSA 3QEXA 2X6NA 4KI6A 1RNHA 4CGJA 4Z4EA 4FXDA 1IKVA 4KTZA 3L2QA 2RPIA 4RW4A 1TK0A 3DOLA 4CJ5A 1NK9A 4DTUA 2FBYA 3ZSXA 4ZTFA 3KJVA 1WNSA 2HNYA 3QNNA 4XIUA 1X9WA 4E7JA 1L3UA 4Q5VA 3NCIA 1GOBA 1EETA 1J54A 3NGYA 3SZ2A 3NGZA 2D0AA 4DU4A 1X9SA 4CJ3A 3PX0A 1L5UA 1LAVA 3SUPA 3VQ4A 3SUNA 1KLMA 4EZ6A 4CJWA 1UOCA 1BIZA 1Z26A 1S1WA 5CYMA 3PO4A 1KVCA 4QOZB 4FJXA 4OKJA 3THVA 4FJNA 2IDOA 4E7LA 1GOAA 3NH1A 3KLIA 1TKZA 3L2VA 2KZZA 2RF2A 5EU7A 3NFAA 3D0PA 4CFCA 3SQ2A 1KRPA 3CQ8A 3AO4A 3AVNA 1X9MA 5KGWA 4E7IA 3QIOA 4B8AB 1NOYA 4BWMA 3TI0A 1RDAA 1RT4A 1X1PA 3DI6A 4B9MA 2VG6A 4Q0BA 4CJFA 3L2RA 3TAGA 4QAGA 3HYFA 3G10A 4O55A 4KI4A 3V6DA 3LALA 3OYDA 1VSLA 4Z4GA 1C0TA 3CFRA 4N47A 4LD0A 1EXQA 1UWBA 2HNDA 2P51A 3WNEA 4GW6A 4DFKA 1ZBUA 3B6OA 3UIQA 4CEFA 5HRPA 5KRSA 3L8BA 1ZBIA 3DRPA 1D5AA 4DTXA 2G8WA 1I3AA 3OYEA 2YHBA 5CY4A 3K2PA 4F4KA 1SL2A 1T7PA 3KLHA 3DYAA 3TARA 5I3UA 3QEVA 3RR8A 4N41A 4B9UA 4KB0A 3MEEA 1TL1A 4PY5A 3KLFA 1RDCA 1JL2A 2HW3A 3OJUA 3LP2A 4M41A 2D0CA 1BCMA 2Z1JA 4C8NA 1RBVA 4EP4A 3OJSA 5J2PA 1JLCA 1HMVA 3DLGA 4FJMA 1NJWA 2RN2A 3L3UA 1MU2A 1NK6A 4OKKA 4BE2A 3SUOA 2YNGA 1B9DA 1HJRA 4MFBA 3VQ8A 3OYIA 1YTAA 1C1CA 1KVBA 4PUOA 3AVGA 4FLZA 3V9UA 1DTQA 4JRQA 4F2SA 1TKTA 2JGUA 1S6PA 1BIUA 3O4NA 4DMNA 4HUGA 4DWIA 3OYBA 3OYJA 4FZYA 1QQCA 5DK5A 4CEAA 3RMBA 4OLAA 2BDPA 2VWJA 4DSJA 4FLUA 3DLRA 4CF9A 3QEPA 1JLAA 1RT2A 1NK0A 3OS1A 3ZSZA 3HM9A 1RT6A 3MAQA 5HLFA 4F3OA 3SJJA 2PYLA 2I5JA 4E1NA 4PA1A 3BDPA 4AILC 4DSLA 2IOCA 1VSMA 2HHVA 1BL3A 2F96A 1S1UA 3K57A 2BGGA 4H4OA 4Z4HA 4FZZA 3O3GA 1ASVA 2DFHA 3HT3A 2KTQA 1S9EA 5FROA 3TR8A 3IAYA 1L3TA 2OA8A 2XO7A 4IG3A 3C6TA 3PY8A 4FJ9A 2JLEA 3AVLA 3IRXA 4OGEA 1ZBLA 1C0UA 4FLWA 1Q8IA 5SWMA 1Y97A 2B5JA 3M8RA 5HP1A 3AO1A 3QINA 1LWFA 2PZSA 3LP1A 2ZQBA 1TKXA 4M3WA 4FVMA 4FJKA 4DS5A 3TANA 4IG0A 1VSHA 4K8ZA 2F8TA 2HHXA 1A5XA 3AO5A 1RILA 5T7BA 4BE0A 1RBSA 3ZSVA 4CJTA 4DTPA 4FLYA 4DSFA 4N56A 1D9FA 2QXFA 2D5RA 3OYAA 4G1QA 4B08A 4RW8A 4CF8A 2ATQA 3VQ5A 3QIPA 4FW1A 1L3SA 1T03A 3ZT4A 5CZ2A 2KFZA 3LAMA 2YNFA 3VQ9A 3E01A 5C25A 5JS2A 1NK4A 4DQPA 1JXBA 1NKBA 4FJ7A 3AVCA 3VQAA 5HRSA 3KK1A 4HUFA 4E19A 4DS4A 1YT3A 3DRSA 4AHCA 1ZYQA 4B9VA 1J9AA 1C1BA 3A2FA 4CGFA 4JLHA 3TAFA 3NGIA 3DLEA 3PX4A 4HHTA 2A1RA 3EY1A 2HHQA 5HRNA 3KLGA 4DU1A 3G0ZA 3QO9A 1Q9YA 4CEDA 1HRHA 2DFEA 4KRFA 4CJKA 2Y1JA 3JSMA 3LAKA 1CZ9A 4CESA 4ZTJA 2Z1GA 4UQGA 2KZMA 1CLQA 3MEDA 4CIEA 2HHTA 1JLEA 3AVAA 4KREA 2E6MA 4CEBA 4CGHA 4FM1A 2E4LA 4C8OA 3QNOA 3PX6A 3L2UA 4B9NA 4N76A 2OPPA 4CEOA 1TK8A 4CHPA 3K58A 1XHZA 2G8VA 4KHWA 4CJSA 3L3VA 3LPUA 5C24A 1IO2A 2QKKA 4AHSA 4CF0A 3K5OA 1RBRA 5DMRA 2FC0A 4RW9A 5HRRA 3SQ4A 1FK9A 2HB5A 1JKHA 5D3GA 3EYZA 4LH4A 4HCCA 4FJLA 3TAQA 1EX4A 4NYNA 1SV5A 2XHBA 2IAJA 3TAPA 4BACA 1HQUA 3LZJA 3V1QA 3HVRA 4KTWA 4OGCA 1NJZA 4CJUA 4IKFA 3RWUA 4FW2A 1U48A 4CFDA 3LANA 4DFMA 1NK7A 4CHZA 3PUFA 3ZT2A 1BGXT 1WSJA 2IGIA 1S9GA 3VQPA 4DF4A 4ELVA 3RMAA 2G8FA 4L8RB 4AHRA 3EZ5A 4HTUA 4KFBA 3NHGA 4PQUA 2DY4A 2O4GA 3KK3A 4J2BA 1LWEA 3DLHA 2G8IA 3DOKA 4I9LA 4DTSA 5J1EA 4CHNA 4DQRA 4E3SA 4RG8A 4N5SA 3RRHA 2OYQA 4J2EA 3KTQA 1EP4A 4W5RA 4F2RA 4ID5A 1T8EA 3PO5A 3KIOA 2IS3A 3NF7A 1QSLA 1ASUA 4LSNA 4E0DA 2AJQA 1TAUA 1CXUA 1HNIA 3VQEA 4BDYA 1WSGA 3VQBA 3B6PA 1WSIA 2BANA 3V9ZA 4OKEA 3KKSA 3LP3A 4NYFA 3WNGA 2XRIA 4AHVA 4DSKA 4CJLA 4W5TA 2HHWA 1O1WA 3AO3A 3ZT1A 3ZT0A 2HHUA 5KI6A 2OPSA 4E89A 2W42A 2QK9A 3WNHA 3DRRA 1KCFA 2O4IA 4OJRA 1BCOA 3LWLA 2DFFA 3NF8A 1U45A 3OY9A 1B92A 1Q9XA 2BE2A 1KFDA 3AA2A 4HVJA 3F9KA 3OYHA 4M3RA 4CHQA 5J2MA 2B6AA 4CJQA 4YFUA 3LWMA 2YNIA 4KAZA 3ZSQA 1RCHA 3KKRA 1VSFA 1VRTA 1RTJA 3HPOA 3SV4A 4DU3A 2EX3A 4IBNA 1S5JA 4Y1CA 4Z0UA 1BHLA 1RT3A 3VQDA 4E7HA 2HMIA 4HCBA 1KLNA 4J2AA 1FKPA 1S1TA 3F73A 3HL8A 3HVTA 4W5QA 3CYMA 4FZXC 5KGXA 3ITHA 3OS2A 1LV5A 1IH7A 2KQ2A 4DTJA 3U6FA 3AVFA 3T1AA 4CIGA 1QHTA 3OS0A 4EZ9A 3P5JA 3VQ7A 3U3YA 2X6SA 5FDLA 3NF9A 4CFBA 3IS9A 4M3XA 3K5LA 3RMCA 1REVA 4CGGA 2WOMA 1C0MA 4KB1A 4CK3A 1WLJA 4JS5A 1QSSA 4DFJA 4CEZA 2FBTA 4B3OA 3AA3A 4CF1A 3HXMA 4JS4A 3V1RA 1SKWA 1QTMA 4CGIA 3ULDA 4B9TA 2RKIA 4LSLA 2QKBA 1GOCA 2OPQA 5J2NA 4KHQA 3HPGA 3TAMA 1RT7A 3OYGA 2G8KA 4FM0A 4Z4IA 4FLTA 4CK2A 4QCLA 4CEQA 4F3TA 2YHAA 3T19A 4O44A 1I39A 3AA5X 3DLKA 3LPTA 4IFVA 4M45A 4CF2A 3DM2A 1C1AA 5SZTA 3O4QA 3RTVA 4DFPA 4I7FA 1XI1A 4I9QA 3DMJA 3ZSRA 3VQ6A 2ITGA 3S3OA 1HYSA 2OZSA 3RMDA 3ZT3A 2YKNA 3KLEA 1JLBA 2OZMA 2FBXA 4B9LA 1BISA 3OYLA 3OVNA 4M3ZA 1S1XA 3M8SA 4JRPA 4ICLA 4C8LA 1VRUA 2X74A 4DTRA 1J5OA 4AHUA 3TABA 4KPYA 4DLGA 1RBUA 3I0SA 3OYCA 2DTUA 2HVIA 1HNVA 4OVLA 4CJPA 1LAWA 3C95A 1NJYA 4IFYA 1SUQA 1B9FA 3ISNC 1JLQA 2ZE2A 1NKCA 4EP5A 3KK2A 4F8RA 3TWHA 3AVMA 4CJEA 3O3FA 4FJ8A 1D8YA 1TVRA 3AA4A 1WAFA 3SQ0A 2WONA 4FK4A 4M3TA 4E7KA 3WNFA 3HSTB 3HPHA 4ID1A 4FK0A 3LP0A 4CECA 2Y1IA 4ELTA 4CHYA 4DSEA 1NK8A 1TGOA 1SL0A 4KHNA 3AO2A 4W5OA 3U3GA 3NH0A 4DTOA 2YNHA 3NF6A 3NBPA 2E6LA 1JL1A 3S3NA 1ZBFA 1N6QA 3SYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KD5 E;  2Z1H A;  3P83 D;  1SKR A;  4AH9 A;  3MEG A;  1WN7 A;  2FBV A;  1FXX A;  4FLV A;  2XY8 A;  4FJG A;  3VQC A;  4RW6 A;  3ZSY A;  3RRG A;  4KHU A;  2Z1I A;  3QEW A;  3VN5 A;  3AVK A;  2Q3S A;  2A1S A;  4CER A;  2KW4 A;  1DLO A;  4E1M A;  4DQS A;  1D9D A;  4KKO A;  1IKY A;  4H8K A;  3P1G A;  4R5P A;  4OPJ A;  4DF8 A;  1BQN A;  1F21 A;  3AVH A;  3QLH A;  3VA3 A;  1CXQ A;  1VSE A;  3V81 A;  2PY5 A;  3IG1 A;  3T3F A;  3BGR A;  3NAE A;  3SNN A;  1U47 A;  5FRM A;  5HRO A;  2HNZ A;  1QE1 A;  1WSF A;  3CFO A;  5KTQ A;  1ZBH A;  3ZSO A;  2P5G A;  1U04 A;  1W9H A;  3S3M A;  3CFP A;  3SPY A;  3HJF A;  1RT5 A;  3QEI A;  4KV8 A;  3MXJ A;  4NCG A;  4Z4C A;  1BI4 A;  1NKE A;  4KTQ A;  1VK0 A;  3SCX A;  1JLF A;  4OPK A;  1L3V A;  1KVA A;  1ITG A;  2YV0 X;  3V9S A;  3QET A;  4FK2 A;  4KHS A;  4FJH A;  4AHT A;  1KSP A;  1QS4 A;  1J53 A;  3LZI A;  3AVI A;  4FJ5 A;  4FCY A;  4GVM A;  1A5W A;  1WSH A;  4YNQ A;  1KFS A;  1RTI A;  3OYK A;  5I42 A;  1NJX A;  1R0A A;  1BI4 B;  1ASW A;  1RTH A;  1XWL A;  3O3H A;  4TSX A;  1JXE A;  4O0J A;  4BWJ A;  1UA1 A;  2OPR A;  3V9X A;  3MXI A;  1S1V A;  3NE6 A;  2NUB A;  4CJ4 A;  1RT1 A;  3ZSW A;  4CE9 A;  4DLE A;  3SI6 A;  3HP9 A;  4DQI A;  1RDD A;  1XHX A;  5K14 A;  3NH2 A;  3H08 A;  1IKW A;  5J2Q A;  1NK5 A;  4O5B A;  1T05 A;  2PYJ A;  3SPZ A;  1N5Y A;  1DTT A;  2GUI A;  4FLX A;  1G15 A;  3TAE A;  5CZ1 A;  3SUQ A;  4ELU A;  3I8D A;  3RR7 A;  1TKD A;  3HO1 A;  4PWD A;  4HUE A;  4CGD A;  1TAQ A;  3V4I A;  4NCA A;  1XC9 A;  4CEE A;  4B9S A;  4CJR A;  2XY7 A;  4BDZ A;  3AVJ A;  3MEC A;  1LWC A;  3DLB A;  3V1O A;  2EHG A;  2F8S A;  4FJI A;  2X78 A;  1SL1 A;  5CYQ A;  3I0R A;  3S9H A;  4FJJ A;  1U49 A;  4KHY A;  5FRN A;  1U4B A;  4O0I A;  1C6V A;  1UAX A;  4CIF A;  3OYF A;  3M8Q A;  3C94 A;  3VA0 A;  4C8M A;  3QER A;  2XY6 A;  1TL3 A;  2GV9 A;  1A5V A;  1VSK A;  3OYN A;  1IG9 A;  1CZB A;  1KTQ A;  1LW2 A;  1VSJ A;  3CG7 A;  1K6Y A;  4GMJ B;  4CHO A;  2IC3 A;  4B8C A;  3ASM A;  1RDB A;  1LW0 A;  1S6Q A;  3M8P A;  4C8K A;  3ALY A;  1HQE A;  2VWK A;  4Y1D A;  5HBM A;  4CCH A;  1YTU A;  4I2P A;  4M42 A;  3OYM A;  2HHS A;  4NCB A;  2ETJ A;  4CFA A;  1RBT A;  2HVH A;  1BQM A;  3ZCM A;  4BE1 A;  2P1J A;  2R7Y A;  4DTN A;  1YVU A;  3QES A;  2VG7 A;  2LSN A;  3VQQ A;  3JYT A;  3L2W A;  4Z4F A;  4LY7 A;  4CK1 A;  1QSY A;  4FYD A;  1Z25 A;  2GBZ A;  3AVB A;  4J2D A;  4DTM A;  4LH5 A;  3CM6 A;  4O4G A;  3KD1 E;  4IDK A;  1VSI A;  4WE1 A;  3MXM A;  4CJV A;  5JS1 A;  3AV9 A;  2P5O A;  3K5N A;  1TK5 A;  3PV8 A;  3K59 A;  4W5N A;  3NDK A;  1NOZ A;  2ZD1 A;  2KFN A;  1JLG A;  1RTD A;  1WSE A;  1VSD A;  4KO0 A;  1HYZ A;  4MQ3 A;  3SV3 A;  1HYV A;  4ZHR A;  4I2Q A;  3K5M A;  3V9W A;  4H4M A;  4DG1 A;  2G8U A;  3C6U A;  4BDP A;  3CM5 A;  4DQQ A;  5E41 A;  3HP6 A;  4M3Y A;  3SQ1 A;  4K8X A;  3HK2 A;  2D0B A;  1EKE A;  1UA0 A;  1FKO A;  3FFI A;  1TV6 A;  3D45 A;  3LDS A;  1IKX A;  4OLB A;  1HPZ A;  2B4J A;  4FM2 A;  5KRT A;  4DSI A;  1WAJ A;  4RW7 A;  5C42 A;  4M3U A;  2VG5 A;  2XY5 A;  1W0H A;  2YKM A;  2G8H A;  1SKS A;  3QEX A;  2X6N A;  4KI6 A;  1RNH A;  4CGJ A;  4Z4E A;  4FXD A;  1IKV A;  4KTZ A;  3L2Q A;  2RPI A;  4RW4 A;  1TK0 A;  3DOL A;  4CJ5 A;  1NK9 A;  4DTU A;  2FBY A;  3ZSX A;  4ZTF A;  3KJV A;  1WNS A;  2HNY A;  3QNN A;  4XIU A;  1X9W A;  4E7J A;  1L3U A;  4Q5V A;  3NCI A;  1GOB A;  1EET A;  1J54 A;  3NGY A;  3SZ2 A;  3NGZ A;  2D0A A;  4DU4 A;  1X9S A;  4CJ3 A;  3PX0 A;  1L5U A;  1LAV A;  3SUP A;  3VQ4 A;  3SUN A;  1KLM A;  4EZ6 A;  4CJW A;  1UOC A;  1BIZ A;  1Z26 A;  1S1W A;  5CYM A;  3PO4 A;  1KVC A;  4QOZ B;  4FJX A;  4OKJ A;  3THV A;  4FJN A;  2IDO A;  4E7L A;  1GOA A;  3NH1 A;  3KLI A;  1TKZ A;  3L2V A;  2KZZ A;  2RF2 A;  5EU7 A;  3NFA A;  3D0P A;  4CFC A;  3SQ2 A;  1KRP A;  3CQ8 A;  3AO4 A;  3AVN A;  1X9M A;  5KGW A;  4E7I A;  3QIO A;  4B8A B;  1NOY A;  4BWM A;  3TI0 A;  1RDA A;  1RT4 A;  1X1P A;  3DI6 A;  4B9M A;  2VG6 A;  4Q0B A;  4CJF A;  3L2R A;  3TAG A;  4QAG A;  3HYF A;  3G10 A;  4O55 A;  4KI4 A;  3V6D A;  3LAL A;  3OYD A;  1VSL A;  4Z4G A;  1C0T A;  3CFR A;  4N47 A;  4LD0 A;  1EXQ A;  1UWB A;  2HND A;  2P51 A;  3WNE A;  4GW6 A;  4DFK A;  1ZBU A;  3B6O A;  3UIQ A;  4CEF A;  5HRP A;  5KRS A;  3L8B A;  1ZBI A;  3DRP A;  1D5A A;  4DTX A;  2G8W A;  1I3A A;  3OYE A;  2YHB A;  5CY4 A;  3K2P A;  4F4K A;  1SL2 A;  1T7P A;  3KLH A;  3DYA A;  3TAR A;  5I3U A;  3QEV A;  3RR8 A;  4N41 A;  4B9U A;  4KB0 A;  3MEE A;  1TL1 A;  4PY5 A;  3KLF A;  1RDC A;  1JL2 A;  2HW3 A;  3OJU A;  3LP2 A;  4M41 A;  2D0C A;  1BCM A;  2Z1J A;  4C8N A;  1RBV A;  4EP4 A;  3OJS A;  5J2P A;  1JLC A;  1HMV A;  3DLG A;  4FJM A;  1NJW A;  2RN2 A;  3L3U A;  1MU2 A;  1NK6 A;  4OKK A;  4BE2 A;  3SUO A;  2YNG A;  1B9D A;  1HJR A;  4MFB A;  3VQ8 A;  3OYI A;  1YTA A;  1C1C A;  1KVB A;  4PUO A;  3AVG A;  4FLZ A;  3V9U A;  1DTQ A;  4JRQ A;  4F2S A;  1TKT A;  2JGU A;  1S6P A;  1BIU A;  3O4N A;  4DMN A;  4HUG A;  4DWI A;  3OYB A;  3OYJ A;  4FZY A;  1QQC A;  5DK5 A;  4CEA A;  3RMB A;  4OLA A;  2BDP A;  2VWJ A;  4DSJ A;  4FLU A;  3DLR A;  4CF9 A;  3QEP A;  1JLA A;  1RT2 A;  1NK0 A;  3OS1 A;  3ZSZ A;  3HM9 A;  1RT6 A;  3MAQ A;  5HLF A;  4F3O A;  3SJJ A;  2PYL A;  2I5J A;  4E1N A;  4PA1 A;  3BDP A;  4AIL C;  4DSL A;  2IOC A;  1VSM A;  2HHV A;  1BL3 A;  2F96 A;  1S1U A;  3K57 A;  2BGG A;  4H4O A;  4Z4H A;  4FZZ A;  3O3G A;  1ASV A;  2DFH A;  3HT3 A;  2KTQ A;  1S9E A;  5FRO A;  3TR8 A;  3IAY A;  1L3T A;  2OA8 A;  2XO7 A;  4IG3 A;  3C6T A;  3PY8 A;  4FJ9 A;  2JLE A;  3AVL A;  3IRX A;  4OGE A;  1ZBL A;  1C0U A;  4FLW A;  1Q8I A;  5SWM A;  1Y97 A;  2B5J A;  3M8R A;  5HP1 A;  3AO1 A;  3QIN A;  1LWF A;  2PZS A;  3LP1 A;  2ZQB A;  1TKX A;  4M3W A;  4FVM A;  4FJK A;  4DS5 A;  3TAN A;  4IG0 A;  1VSH A;  4K8Z A;  2F8T A;  2HHX A;  1A5X A;  3AO5 A;  1RIL A;  5T7B A;  4BE0 A;  1RBS A;  3ZSV A;  4CJT A;  4DTP A;  4FLY A;  4DSF A;  4N56 A;  1D9F A;  2QXF A;  2D5R A;  3OYA A;  4G1Q A;  4B08 A;  4RW8 A;  4CF8 A;  2ATQ A;  3VQ5 A;  3QIP A;  4FW1 A;  1L3S A;  1T03 A;  3ZT4 A;  5CZ2 A;  2KFZ A;  3LAM A;  2YNF A;  3VQ9 A;  3E01 A;  5C25 A;  5JS2 A;  1NK4 A;  4DQP A;  1JXB A;  1NKB A;  4FJ7 A;  3AVC A;  3VQA A;  5HRS A;  3KK1 A;  4HUF A;  4E19 A;  4DS4 A;  1YT3 A;  3DRS A;  4AHC A;  1ZYQ A;  4B9V A;  1J9A A;  1C1B A;  3A2F A;  4CGF A;  4JLH A;  3TAF A;  3NGI A;  3DLE A;  3PX4 A;  4HHT A;  2A1R A;  3EY1 A;  2HHQ A;  5HRN A;  3KLG A;  4DU1 A;  3G0Z A;  3QO9 A;  1Q9Y A;  4CED A;  1HRH A;  2DFE A;  4KRF A;  4CJK A;  2Y1J A;  3JSM A;  3LAK A;  1CZ9 A;  4CES A;  4ZTJ A;  2Z1G A;  4UQG A;  2KZM A;  1CLQ A;  3MED A;  4CIE A;  2HHT A;  1JLE A;  3AVA A;  4KRE A;  2E6M A;  4CEB A;  4CGH A;  4FM1 A;  2E4L A;  4C8O A;  3QNO A;  3PX6 A;  3L2U A;  4B9N A;  4N76 A;  2OPP A;  4CEO A;  1TK8 A;  4CHP A;  3K58 A;  1XHZ A;  2G8V A;  4KHW A;  4CJS A;  3L3V A;  3LPU A;  5C24 A;  1IO2 A;  2QKK A;  4AHS A;  4CF0 A;  3K5O A;  1RBR A;  5DMR A;  2FC0 A;  4RW9 A;  5HRR A;  3SQ4 A;  1FK9 A;  2HB5 A;  1JKH A;  5D3G A;  3EYZ A;  4LH4 A;  4HCC A;  4FJL A;  3TAQ A;  1EX4 A;  4NYN A;  1SV5 A;  2XHB A;  2IAJ A;  3TAP A;  4BAC A;  1HQU A;  3LZJ A;  3V1Q A;  3HVR A;  4KTW A;  4OGC A;  1NJZ A;  4CJU A;  4IKF A;  3RWU A;  4FW2 A;  1U48 A;  4CFD A;  3LAN A;  4DFM A;  1NK7 A;  4CHZ A;  3PUF A;  3ZT2 A;  1BGX T;  1WSJ A;  2IGI A;  1S9G A;  3VQP A;  4DF4 A;  4ELV A;  3RMA A;  2G8F A;  4L8R B;  4AHR A;  3EZ5 A;  4HTU A;  4KFB A;  3NHG A;  4PQU A;  2DY4 A;  2O4G A;  3KK3 A;  4J2B A;  1LWE A;  3DLH A;  2G8I A;  3DOK A;  4I9L A;  4DTS A;  5J1E A;  4CHN A;  4DQR A;  4E3S A;  4RG8 A;  4N5S A;  3RRH A;  2OYQ A;  4J2E A;  3KTQ A;  1EP4 A;  4W5R A;  4F2R A;  4ID5 A;  1T8E A;  3PO5 A;  3KIO A;  2IS3 A;  3NF7 A;  1QSL A;  1ASU A;  4LSN A;  4E0D A;  2AJQ A;  1TAU A;  1CXU A;  1HNI A;  3VQE A;  4BDY A;  1WSG A;  3VQB A;  3B6P A;  1WSI A;  2BAN A;  3V9Z A;  4OKE A;  3KKS A;  3LP3 A;  4NYF A;  3WNG A;  2XRI A;  4AHV A;  4DSK A;  4CJL A;  4W5T A;  2HHW A;  1O1W A;  3AO3 A;  3ZT1 A;  3ZT0 A;  2HHU A;  5KI6 A;  2OPS A;  4E89 A;  2W42 A;  2QK9 A;  3WNH A;  3DRR A;  1KCF A;  2O4I A;  4OJR A;  1BCO A;  3LWL A;  2DFF A;  3NF8 A;  1U45 A;  3OY9 A;  1B92 A;  1Q9X A;  2BE2 A;  1KFD A;  3AA2 A;  4HVJ A;  3F9K A;  3OYH A;  4M3R A;  4CHQ A;  5J2M A;  2B6A A;  4CJQ A;  4YFU A;  3LWM A;  2YNI A;  4KAZ A;  3ZSQ A;  1RCH A;  3KKR A;  1VSF A;  1VRT A;  1RTJ A;  3HPO A;  3SV4 A;  4DU3 A;  2EX3 A;  4IBN A;  1S5J A;  4Y1C A;  4Z0U A;  1BHL A;  1RT3 A;  3VQD A;  4E7H A;  2HMI A;  4HCB A;  1KLN A;  4J2A A;  1FKP A;  1S1T A;  3F73 A;  3HL8 A;  3HVT A;  4W5Q A;  3CYM A;  4FZX C;  5KGX A;  3ITH A;  3OS2 A;  1LV5 A;  1IH7 A;  2KQ2 A;  4DTJ A;  3U6F A;  3AVF A;  3T1A A;  4CIG A;  1QHT A;  3OS0 A;  4EZ9 A;  3P5J A;  3VQ7 A;  3U3Y A;  2X6S A;  5FDL A;  3NF9 A;  4CFB A;  3IS9 A;  4M3X A;  3K5L A;  3RMC A;  1REV A;  4CGG A;  2WOM A;  1C0M A;  4KB1 A;  4CK3 A;  1WLJ A;  4JS5 A;  1QSS A;  4DFJ A;  4CEZ A;  2FBT A;  4B3O A;  3AA3 A;  4CF1 A;  3HXM A;  4JS4 A;  3V1R A;  1SKW A;  1QTM A;  4CGI A;  3ULD A;  4B9T A;  2RKI A;  4LSL A;  2QKB A;  1GOC A;  2OPQ A;  5J2N A;  4KHQ A;  3HPG A;  3TAM A;  1RT7 A;  3OYG A;  2G8K A;  4FM0 A;  4Z4I A;  4FLT A;  4CK2 A;  4QCL A;  4CEQ A;  4F3T A;  2YHA A;  3T19 A;  4O44 A;  1I39 A;  3AA5 X;  3DLK A;  3LPT A;  4IFV A;  4M45 A;  4CF2 A;  3DM2 A;  1C1A A;  5SZT A;  3O4Q A;  3RTV A;  4DFP A;  4I7F A;  1XI1 A;  4I9Q A;  3DMJ A;  3ZSR A;  3VQ6 A;  2ITG A;  3S3O A;  1HYS A;  2OZS A;  3RMD A;  3ZT3 A;  2YKN A;  3KLE A;  1JLB A;  2OZM A;  2FBX A;  4B9L A;  1BIS A;  3OYL A;  3OVN A;  4M3Z A;  1S1X A;  3M8S A;  4JRP A;  4ICL A;  4C8L A;  1VRU A;  2X74 A;  4DTR A;  1J5O A;  4AHU A;  3TAB A;  4KPY A;  4DLG A;  1RBU A;  3I0S A;  3OYC A;  2DTU A;  2HVI A;  1HNV A;  4OVL A;  4CJP A;  1LAW A;  3C95 A;  1NJY A;  4IFY A;  1SUQ A;  1B9F A;  3ISN C;  1JLQ A;  2ZE2 A;  1NKC A;  4EP5 A;  3KK2 A;  4F8R A;  3TWH A;  3AVM A;  4CJE A;  3O3F A;  4FJ8 A;  1D8Y A;  1TVR A;  3AA4 A;  1WAF A;  3SQ0 A;  2WON A;  4FK4 A;  4M3T A;  4E7K A;  3WNF A;  3HST B;  3HPH A;  4ID1 A;  4FK0 A;  3LP0 A;  4CEC A;  2Y1I A;  4ELT A;  4CHY A;  4DSE A;  1NK8 A;  1TGO A;  1SL0 A;  4KHN A;  3AO2 A;  4W5O A;  3U3G A;  3NH0 A;  4DTO A;  2YNH A;  3NF6 A;  3NBP A;  2E6L A;  1JL1 A;  3S3N A;  1ZBF A;  1N6Q A;  3SYZ A; 
#chains in the Genus database with same CATH topology
 4BVO A;  4DUY K;  3MEG A;  2QWM A;  2XY8 A;  1S22 A;  3TSP A;  4KHU A;  4IXC A;  4CER A;  4U7B A;  5C15 A;  5LJV A;  3B8A X;  1QZ6 A;  1D9D A;  3D2F B;  4PL7 A;  4DF8 A;  1BQN A;  3QLH A;  3C6H A;  3JXU A;  3T3F A;  3BGR A;  3SNN A;  1U47 A;  4ILG B;  4YOY A;  1QE1 A;  3CFO A;  1Q7Y O;  5KTQ A;  3S3M A;  3HJF A;  3QEI A;  4KV8 A;  3MXJ A;  4Z4C A;  5BRF A;  5C12 A;  1BI4 A;  3SCX A;  2HBL A;  4JK7 A;  1ITG A;  3C0B A;  4FK2 A;  4FJH A;  3AVI A;  2VQE K;  3GG4 A;  3CCM N;  3T1H K;  4BR9 A;  1NGB A;  1R0A A;  1XWL A;  2FF6 A;  1TYQ A;  4TSX A;  4BWJ A;  1UA1 A;  3O5B A;  3O9U A;  3MXI A;  4JHD B;  2VGN A;  4CJ4 A;  1RT1 A;  3ZSW A;  5M1K A;  1S72 N;  4DQI A;  5AQG A;  1NK5 A;  2PYJ A;  1MWK A;  3O9Q A;  3RR7 A;  1P8Z A;  4PWD A;  4JEP A;  1TAQ A;  4IEI A;  4GVE A;  3AVJ A;  4F9O A;  3MEC A;  2Q97 A;  3MN5 A;  2EHG A;  4FJI A;  2X78 A;  3WEE A;  3GDQ A;  4KHY A;  1U49 A;  3THW A;  3OYF A;  3C94 A;  3QER A;  5AZJ B;  2XY6 A;  1TL3 A;  1NLV A;  3R1X A;  1T3V A;  1CZB A;  1KTQ A;  4BC4 A;  4CHO A;  4GMJ B;  1M1K O;  2IC3 A;  2F4V K;  5AJ3 K;  2H3G X;  3TTC A;  3ALY A;  5HBM A;  4I2P A;  4CZL A;  3OYM A;  1RBT A;  3O9S A;  3BEX A;  1OH8 A;  2HVH A;  3O1W A;  2R7Y A;  3QES A;  3D2E B;  3LL3 A;  4FYD A;  1Z25 A;  2GBZ A;  4LH5 A;  4O4G A;  4GV6 A;  4JN4 A;  3SLC A;  1JCG A;  1NOZ A;  2ZD1 A;  3CF5 L;  3RSE A;  1RTD A;  1HYZ A;  3VEX A;  3AGK A;  3UE5 A;  3K5M A;  4QS9 A;  4BDP A;  3CM5 A;  4DQQ A;  3HK2 A;  3P39 A;  1UA0 A;  1FKO A;  3FGU A;  1KD1 O;  1NJI O;  1RGI A;  4DSI A;  2EWS A;  2VG5 A;  1W0H A;  2G8H A;  1HX1 A;  4EAH D;  1IKV A;  3FZM A;  3L2Q A;  1TK0 A;  3WUH A;  4FWN A;  4XH4 A;  4FWO A;  2YJE A;  5AQS A;  2PBD A;  4DV0 K;  1SAZ A;  1X9W A;  4E7J A;  4Q5V A;  3ZEU B;  3SZ2 A;  4OX9 K;  3KWI A;  3MN9 A;  4DU4 A;  2P9I B;  1YHQ N;  3PX0 A;  3EE9 A;  1OKJ A;  3VQ4 A;  3SUN A;  4EZ6 A;  1X3N A;  2E1Y A;  4H5T A;  4CJW A;  4YOU A;  1Z26 A;  3EO3 A;  1KVC A;  1RDW X;  4QOZ B;  4BRA A;  1GOA A;  3NH1 A;  1TKZ A;  5AQQ A;  3L0Q A;  4CFC A;  3SQ2 A;  3WXM B;  4BC2 A;  5FPD A;  3ENH A;  1X9M A;  4IEE A;  4X66 K;  5GAD P;  3ZET B;  1X1P A;  4Q0B A;  3WXL A;  4O55 A;  3V6D A;  4Z4G A;  1EXQ A;  1N36 K;  1IV0 A;  4PHT X;  3SBT A;  3B6O A;  5HRP A;  4BRG A;  4DTX A;  4JI0 K;  1MDU B;  3KLH A;  3DYA A;  1QQN A;  3CQX A;  2BTF A;  2NZT A;  3MEE A;  1JL2 A;  3D7E O;  4M41 A;  4FWQ A;  1TYQ B;  1IJJ A;  4EP4 A;  1RBV A;  2I7N A;  3DLG A;  4OKK A;  4MFB A;  3CCL N;  1C1C A;  2HF3 A;  4PUO A;  3C7N B;  4DMN A;  4HUG A;  4DWI A;  3OYB A;  4FZY A;  3H46 O;  5BRH A;  3RMB A;  2VWJ A;  3CHW A;  3Q7C A;  2OAN A;  3DLR A;  4FLU A;  3GE1 A;  1E3M A;  3CMA N;  2IOC A;  2F9W A;  1ASV A;  3DJC A;  2DFH A;  3IAY A;  2HBJ A;  4YOR A;  3PY8 A;  2ZGY A;  2JLE A;  2YCH A;  4BGA A;  1U2V B;  3ID8 A;  2P9N B;  2O8F B;  3O1B A;  4OGE A;  1Q8I A;  5A2Q O;  3J8A A;  3LP1 A;  3THY A;  4M3W A;  4H0Y B;  1NGH A;  4IG0 A;  3N4P A;  1D4X A;  3I33 A;  3AO5 A;  2JWL A;  4CJT A;  3ZSV A;  4DTP A;  4FLY A;  2VCP A;  1RFQ A;  5EVZ A;  4G1Q A;  2YJF A;  4DCH A;  4B08 A;  4CF8 A;  2ATQ A;  3VQ5 A;  1T03 A;  2YNF A;  3VEV A;  5C25 A;  3CC7 N;  4FJ7 A;  3KK1 A;  4DS4 A;  2VQF K;  2P9S B;  1M90 O;  4KHP K;  3VET A;  3G6E N;  3CPE A;  3DLE A;  3PX4 A;  4HHT A;  3KLG A;  3G0Z A;  4BRN A;  3CPW M;  2Y1J A;  3EZW A;  4UQG A;  4CIE A;  4JD2 B;  4CGH A;  2E4L A;  4A2B A;  3QNO A;  3L4Q A;  5BPL A;  1TK8 A;  3K58 A;  4EHU A;  1K73 O;  4CJS A;  5IT9 O;  3WXJ A;  4I6M A;  1RBR A;  5HRR A;  2FC0 A;  3BUZ B;  3EYZ A;  3ZX2 A;  1SV5 A;  2E1Z A;  4BAC A;  3LZJ A;  4B3M K;  1NJZ A;  4OGC A;  4CJU A;  4KH4 A;  4DR4 K;  4ISE A;  2GUP A;  3PUF A;  1BGX T;  4DF4 A;  1NGD A;  4MDA A;  3EZ5 A;  4HTU A;  4KFB A;  3NHG A;  4PQU A;  2O4G A;  3KK3 A;  1LWE A;  3DLH A;  4LFC K;  4DQR A;  4N5S A;  3PO5 A;  1KXP A;  1QSL A;  4B1W B;  1TAU A;  2AJQ A;  1HNI A;  3VTI A;  3J7A P;  5HL7 L;  3V9Z A;  4A5A A;  2XRI A;  4JKG A;  3FE1 A;  4AHV A;  2HHW A;  2YHW A;  3AO3 A;  3ZT0 A;  3WNH A;  2A5X A;  2O4I A;  4BC5 A;  3CJ7 A;  3MWP A;  5ELZ A;  1U45 A;  1B92 A;  4BRD A;  3S41 A;  3CJC A;  4HVJ A;  4M3R A;  4CHQ A;  4YFU A;  3LWM A;  2UUB K;  1VRT A;  3PSF A;  2EX3 A;  4E7H A;  1BHL A;  4B9Q A;  5AR0 A;  3F73 A;  4CZJ A;  1MWM A;  4W5Q A;  2CGK A;  3Q7B A;  2KQ2 A;  5ADX A;  4NXN K;  5LMU K;  3VQ7 A;  3U3Y A;  2WUS A;  2X6S A;  4CFB A;  4DKW A;  5BR8 K;  3RMC A;  1REV A;  4FO0 A;  3NVM A;  1C0M A;  1VQ5 N;  4KB1 A;  3SK3 A;  2VYP A;  4CEZ A;  4B3O A;  2AA4 A;  3AA3 A;  4CF1 A;  5F0X A;  4LSL A;  1HNX K;  3CCJ N;  4QS7 A;  5KPR A;  1YIJ N;  5C0Y A;  3UB5 A;  4F3T A;  2YHA A;  4J8F A;  4O44 A;  4WQ4 C;  4OO1 J;  4M45 A;  5SZT A;  3ATU A;  3O4Q A;  2QWO A;  5EOY A;  3DMJ A;  2GWJ A;  5AQW A;  2BH1 A;  3FZF A;  3S3O A;  3LDQ A;  4M7Y A;  3VMF B;  1VQ7 N;  4LF4 K;  4M3Z A;  4ICL A;  4KPY A;  4JNE A;  1OH7 A;  4AHU A;  1J5O A;  4FSV A;  2UUC K;  5KPT A;  4JKA A;  5GAG P;  4K42 A;  4LFA K;  2WBN A;  4JYA K;  4RCH A;  2PAV A;  1C0F A;  3KK2 A;  2HST A;  3O3F A;  4FJ8 A;  4X65 K;  1TVR A;  3AA4 A;  4AF1 A;  1SZ2 A;  3HPH A;  4BRM A;  4BQZ A;  3NH0 A;  1XMQ K;  2YNH A;  3D2F A;  2W40 A;  4X64 K;  1JL1 A;  2W42 A;  1N6Q A;  3SYZ A;  3KD5 E;  4AH9 A;  1YF5 L;  1BA1 A;  1FXX A;  3VTH A;  4FJG A;  3QBW A;  2Z1I A;  2Q3S A;  4FWL A;  1DLO A;  4KKO A;  4R5P A;  1HNW K;  2RHK A;  1F21 A;  3AVH A;  4CZG A;  4B1Y B;  4CZK A;  4EIA A;  4BR4 A;  5HRO A;  1WSF A;  4A57 A;  3ZSO A;  1U04 A;  1W9H A;  3CFP A;  3SPY A;  1RT5 A;  4NCG A;  3PSI A;  2P9U B;  5M1P A;  1KQS M;  2YV0 X;  2W6L A;  3V9S A;  2QW9 A;  3BF1 A;  1DKG D;  4JHD A;  5GAH P;  1J53 A;  4FJ5 A;  4FCY A;  3BF3 A;  1T6D A;  5I42 A;  4C23 A;  1IBM K;  1JXE A;  2OPR A;  4HTL A;  2NUB A;  1OH6 A;  3PIO L;  3HP9 A;  1T05 A;  3NH2 A;  3H08 A;  4FLX A;  2GUI A;  1G15 A;  4ELU A;  5HOO A;  4JI4 K;  1XC9 A;  1EWQ A;  2XY7 A;  4BDZ A;  1NGC A;  5AZJ A;  1P90 A;  2W41 A;  5AFU A;  1LWC A;  3QDK A;  5LMN K;  5EXW A;  3S9H A;  4FJJ A;  5FRN A;  3I55 N;  4O0I A;  4YHH K;  5AQR A;  3L6Q A;  3NVK A;  4DV2 K;  2FSN A;  2GV9 A;  1K6Y A;  3ASM A;  3D2E A;  1T6C A;  3MWT A;  4BR5 A;  4C8K A;  1HQE A;  2VWK A;  3TU5 A;  1YTU A;  2Q0R A;  1Q86 O;  2IVP A;  2HHS A;  4CFA A;  3O8M A;  5CE3 A;  5MLC Q;  3VEN A;  2VG7 A;  2LSN A;  4Z4F A;  4CK1 A;  2Q0U A;  1N34 K;  4OPA A;  4IDK A;  3AV9 A;  4AQY K;  2E8A A;  2O8D B;  4MLE A;  4B1Z A;  3K59 A;  1VSD A;  4I2Q A;  2KFN A;  4H4M A;  5AQV A;  5E41 A;  4K8X A;  2QM1 A;  3VPZ A;  1TV6 A;  1HKC A;  3LDS A;  1YI2 N;  3F2K A;  3MCP A;  3TTD A;  2B4J A;  5B8H A;  1WAJ A;  4RW7 A;  5C42 A;  2E88 A;  4GKK K;  5CR4 A;  3ZEU A;  3FZL A;  4CGJ A;  4Z4E A;  2P9I A;  4RW4 A;  4JAX A;  3LDO A;  1GLD G;  3DOL A;  4BR0 A;  2VWB A;  4CJ5 A;  5JMV A;  4DV3 K;  3ZSX A;  4JI5 K;  4GNI A;  4FOI A;  5FLX O;  2HHH K;  1L3U A;  1GOB A;  1EET A;  1X9S A;  3FFK B;  5AQY A;  4B3R K;  1NGF A;  2RE2 A;  2ZWH A;  3ZET A;  5CYM A;  3WQU A;  3ENO A;  4FJX A;  4OKJ A;  3KLI A;  3DAW A;  4MO5 A;  3AVN A;  5KGW A;  5AZI B;  3QIO A;  3KZB A;  3HZ6 A;  5AQK A;  4B8A B;  3TI0 A;  1NOY A;  2VG6 A;  1YAG A;  3HYF A;  3G10 A;  4KI4 A;  1EQY A;  3CFR A;  4N47 A;  2HND A;  2P51 A;  1VQN N;  4DFK A;  5KRS A;  3L8B A;  1LCU A;  2P9L B;  2G8W A;  1I3A A;  3OYE A;  5F1X A;  3K2P A;  2ZGZ A;  4B1U B;  3TAR A;  5I3U A;  3QEV A;  3KLF A;  1NM1 A;  3C7N A;  3CER A;  3CJ9 A;  2D0C A;  2Z1J A;  4JKE A;  4HWI A;  1JLC A;  3UKU B;  4CI6 A;  2RN2 A;  4LC9 B;  1N8R O;  4BE2 A;  3OYI A;  4MDB A;  1YTA A;  4FLZ A;  3E1Y A;  4JRQ A;  1BWF O;  1TKT A;  1S6P A;  1KC8 O;  4M7X A;  1BIU A;  3OYJ A;  4CEA A;  4DSJ A;  4CF9 A;  3M3Z A;  1JLA A;  2FSK A;  1NGJ A;  4DHY A;  3SJJ A;  1U2V A;  4E1N A;  2P9N A;  2PYL A;  2HHV A;  2O8F A;  1ATN A;  3J7Z O;  2UXB K;  3HT3 A;  2KTQ A;  1S9E A;  5FRO A;  3HTV A;  3DXK A;  2XO7 A;  4BRP A;  4FJ9 A;  3AVL A;  3IRX A;  3WT0 A;  4FLW A;  4K43 A;  2PZS A;  2IVO A;  4DS5 A;  4JKF A;  3SAG A;  4BE0 A;  1RBS A;  4N56 A;  1D9F A;  2QXF A;  4DR2 K;  3VEO A;  3H3N O;  1QHA A;  2P9S A;  1NWK A;  2E2O A;  3EKS A;  1L3S A;  4FW1 A;  3A0I X;  2KFZ A;  3QFU A;  3LAM A;  5DM7 L;  1NK4 A;  4DQP A;  4H5N A;  3VQA A;  3HRG A;  2QTD A;  1YT3 A;  3U9Z A;  4AHC A;  1J9A A;  3A2F A;  1VQ9 N;  2NLX A;  4JD2 A;  2QEX N;  3HOT A;  1JCF A;  3JAM O;  2D4W A;  2HHQ A;  3EY1 A;  2CGL A;  2A6A A;  1Q9Y A;  4CED A;  5TKY A;  4KRF A;  1OH5 A;  3LAK A;  1CZ9 A;  1VQL N;  2ZF5 O;  1HUX A;  1CLQ A;  5AQI A;  1JLE A;  1NG9 A;  4BG9 A;  4FM1 A;  3PX6 A;  3U9D A;  3L2U A;  5AQH A;  4CHP A;  2G8V A;  3CCV N;  3L3V A;  3VF2 A;  4CJ7 A;  5DMR A;  3SQ4 A;  2ZJQ L;  4LH4 A;  4ILJ A;  4HCC A;  3TAQ A;  1Y64 A;  2IAJ A;  4BRO A;  3V1Q A;  4QS8 A;  4IKF A;  3RWU A;  3VER A;  4CHZ A;  4B3S K;  3RMA A;  4L8R B;  2DY4 A;  4FPB A;  3ZLJ A;  1E4F T;  5LJW A;  4BRL A;  4DTS A;  5J1E A;  4W5R A;  3BY5 A;  1J6Z A;  1ASU A;  1OVY A;  3VQE A;  4JK9 A;  1WSG A;  5FPM A;  1WSI A;  3QFP A;  3WNG A;  5GIP A;  3ZT1 A;  2HHU A;  3A5O C;  4E89 A;  1KCF A;  3SMS A;  4OJR A;  2E2Q A;  2DFF A;  4LF5 K;  4CD1 A;  5C2F A;  2BE2 A;  3F9K A;  3OYH A;  1W2B M;  2V7Z A;  1FJG K;  3KKR A;  1VSF A;  2DPN A;  1RTJ A;  3HPO A;  3P4I A;  3EL2 A;  4DU3 A;  3A8Y A;  2A42 A;  4Y1C A;  1RT3 A;  3FR0 A;  3VQD A;  4HCB A;  2CGJ A;  1KLN A;  4LFB K;  1NGG A;  1U6Z A;  2QXL A;  3HVT A;  3TPQ A;  2UYT A;  4C1N K;  5I9E B;  1IH7 A;  3OS2 A;  1LV5 A;  1V4T A;  3DXM B;  4YOT A;  1QHT A;  5GAE P;  1OVQ A;  3R6M A;  3N4Q A;  4JK8 A;  2P9K B;  4BQL A;  3OA9 A;  3VGM A;  4YOW A;  2YHY A;  3IS9 A;  1QVF M;  3K5L A;  4O5F A;  1NGI A;  4GKJ K;  1YIT N;  4CK3 A;  1WLJ A;  4DFJ A;  3DXK B;  5AQP A;  3HXM A;  4BR7 A;  1SKW A;  2QI2 A;  4CGI A;  4BRI A;  2OPQ A;  5J2N A;  3GL1 A;  3CME N;  3ZYY X;  4KHQ A;  1RT7 A;  2G8K A;  4Z4I A;  4GY2 B;  4CK2 A;  3ZX0 A;  4EHT A;  4CF2 A;  4I9Q A;  1C1A A;  3RTV A;  3ZSR A;  3CCE N;  2ITG A;  3M1F A;  1HYS A;  3ZT3 A;  2O8C B;  2OZM A;  2FBX A;  1S1X A;  3MK6 A;  1RBU A;  3QIC A;  2DTU A;  3CJ1 A;  2HVI A;  4OVL A;  1LAW A;  1NJY A;  4WFB L;  1Q82 O;  3ISN C;  1JLQ A;  1QQO A;  3WXK A;  1BDG A;  3VGK A;  1T44 A;  2KHO A;  1WAF A;  2NRW A;  4M3T A;  3PIP L;  3WNF A;  4FK0 A;  2Q1N A;  4CEC A;  2Y1I A;  4ELT A;  3VEW A;  4FWS A;  4DSE A;  4C1N I;  1NK8 A;  1ESV A;  3AO2 A;  1HKG A;  1XC3 A;  4DTO A;  3NBP A;  5M1Q A;  2E6L A;  1DGK N;  4NLB A;  4L3Q A;  2FBV A;  2E20 A;  4ISF A;  2GEM A;  2QWL A;  3VQC A;  4RW6 A;  3ZSY A;  4DV4 K;  3QEW A;  3AVK A;  3CQY A;  4B1V A;  3CXC M;  1IKY A;  2ZJP L;  3P1G A;  5GIN A;  5JVG L;  5ADX H;  2P9P B;  3VA3 A;  2P9U A;  1CXQ A;  1VSE A;  3V81 A;  2PY5 A;  3NAE A;  3T7Z A;  1VQM N;  4A61 A;  2P5G A;  4GV9 A;  4FL9 A;  4BC3 A;  1N33 K;  1KAZ A;  1K8A O;  4OPK A;  1KVA A;  3QET A;  1DEJ A;  4AHT A;  1BUP A;  4GVM A;  1A5W A;  1Z6R A;  2NRV A;  4XH1 A;  4YNQ A;  4DV5 K;  1KFS A;  3OYK A;  2ASO A;  4PKI A;  1RTH A;  1ASW A;  3AAQ A;  4H0V B;  3V9X A;  1K9M O;  3O6W A;  2ASM A;  4Y0W A;  4CE9 A;  4DLE A;  3J81 O;  1RDD A;  1XHX A;  4G9Z A;  4O5B A;  3SPZ A;  1N5Y A;  1DTT A;  5CZ1 A;  1NMN A;  3SUQ A;  3I8D A;  4H0T B;  4IOA L;  3V4I A;  3OHR A;  4DV7 K;  4CEE A;  4B9S A;  3BP8 A;  4FWR A;  3AGR A;  3DLB A;  3V1O A;  5IWA K;  3I0R A;  3ZX3 A;  1U4B A;  1UAX A;  1BA0 A;  3M8Q A;  3VA0 A;  3NMU A;  4C8M A;  3OYN A;  1IG9 A;  3CG7 A;  3MX2 A;  4B8C A;  1RDB A;  1E4G T;  2A40 A;  3GBT A;  3M8P A;  4Y1D A;  3DWL A;  4CBX A;  4NB4 A;  4M42 A;  4NCB A;  4MLH A;  1BQM A;  3ZCM A;  2O8D A;  4JV5 K;  1YVU A;  3VQQ A;  2GEL A;  4LF9 K;  4JKD A;  4DTM A;  3KD1 E;  3CM6 A;  5TKW A;  1VSI A;  1HNZ K;  2WTU A;  4CJV A;  5JS1 A;  1TK5 A;  1O13 A;  3U4L A;  1G99 A;  3NDK A;  1JLG A;  1WSE A;  4KO0 A;  3V9W A;  4M3Y A;  4DG1 A;  4WFN L;  2G8U A;  3UKR B;  3LDN A;  3HP6 A;  4DR1 K;  1WUA A;  2D0B A;  3KK7 A;  3K0S A;  4CBU A;  2KLA A;  1I94 K;  4YDU A;  4OLB A;  1HPZ A;  3MCA B;  4M3U A;  2YKM A;  4FXD A;  4CZH A;  3QEX A;  4KTZ A;  5JLH A;  2NRX A;  3LDL A;  1NK9 A;  4AM7 A;  1GLF O;  2CH5 A;  4V19 S;  5BN9 A;  4ZTF A;  2VGM A;  3KJV A;  3O80 A;  2J4R A;  2HNY A;  4JKB A;  3QNN A;  4XIU A;  2KKZ A;  3NGY A;  1J54 A;  3NGZ A;  2D0A A;  2OCE A;  4XEI A;  1L5U A;  1LAV A;  5AZI A;  3SUP A;  5AFU H;  5AQN A;  1KLM A;  1UOC A;  1VQP N;  4CZF A;  1S1W A;  3PO4 A;  1WB9 A;  1GLC G;  3THV A;  2D0O A;  4FJN A;  4PL8 A;  4B1X B;  3L2V A;  5EU7 A;  1WOQ A;  2F7T A;  2ASP A;  4K0K K;  3SAH A;  3P38 A;  4CW7 B;  1RT4 A;  2P9L A;  3W0L A;  3DI6 A;  4PKH A;  4FWP A;  1VAZ A;  3LAL A;  3OYD A;  1VSL A;  1C0T A;  4LD0 A;  3A5M C;  4BGB A;  1XQS C;  4B3T K;  1NU0 A;  3UKU A;  1D5A A;  5BPM A;  2YHB A;  3RR8 A;  4N41 A;  2HBM A;  1TL1 A;  2HW3 A;  3OJU A;  1IG8 A;  3LP2 A;  1K8K B;  4C8N A;  1X3M A;  1BCM A;  3KWG A;  4DR6 K;  5JVH L;  1GLL O;  3VQ8 A;  5GIO A;  1HJR A;  3AVG A;  3V9U A;  4F2S A;  3PLA A;  5JLF A;  2BDP A;  3QEP A;  2D1K A;  4K25 A;  4RTF D;  3OS1 A;  1RT6 A;  3ULE B;  3MAQ A;  1NK0 A;  3BDP A;  4PA1 A;  3E9L A;  1VSM A;  1BL3 A;  2CH6 A;  2NRZ A;  1BU6 O;  1S1U A;  2BGG A;  4H4O A;  4FZZ A;  3O3G A;  1NGE A;  3OTO K;  3TR8 A;  3TSU A;  2UXC K;  1L3T A;  3BZC A;  4BG8 A;  3THX B;  2D0P A;  3C6T A;  4O8U A;  4CVN E;  3EEQ A;  5KQD A;  1C0U A;  1GLB G;  1Y97 A;  5HP1 A;  3AO1 A;  3QIN A;  1LWF A;  1VQO N;  2ZQB A;  4FVM A;  4FJK A;  3TAN A;  3MN7 A;  4K8Z A;  1RIL A;  4WQ5 A;  5T7B A;  3VF4 A;  3VES A;  3AAR A;  4X62 K;  3HSC A;  4LF8 K;  3D6R A;  2O8B B;  2FF3 B;  3J7Y P;  3ZT4 A;  5M1N A;  1H1V A;  5JS2 A;  3CCU N;  5HRS A;  3SJH A;  4E19 A;  2V52 B;  4FPA A;  4CGF A;  4JLH A;  3TAF A;  3NGI A;  5AQZ A;  3IMX A;  2A1R A;  3EN9 A;  4CD3 A;  3QO9 A;  1YJ9 N;  1HRH A;  4CJK A;  3JSM A;  4BRC A;  4ZTJ A;  4H03 B;  2Z1G A;  2KZM A;  4A59 A;  4CEB A;  4YY3 K;  3CCQ N;  5AQT A;  4B9N A;  2OPP A;  1XHZ A;  4KHW A;  5EX5 A;  5C24 A;  1IO2 A;  2QKK A;  4FOE A;  4AHS A;  4CF0 A;  3H45 C;  3CCS N;  3IDH A;  3IKM A;  1EX4 A;  2HMP A;  2XHB A;  3HM8 A;  3CC2 N;  3HVR A;  4KTW A;  1U48 A;  5E26 A;  1XNR K;  3LAN A;  3VEY A;  3ZT2 A;  2IGI A;  3LM9 A;  4AHR A;  4BVP A;  4J2B A;  2UXD K;  4KH5 A;  2G8I A;  3DOK A;  4I9L A;  4NLC A;  4CHN A;  5M1F A;  4E3S A;  1GLE G;  3KTQ A;  1EP4 A;  4ID5 A;  1T8E A;  1WBD A;  3NF7 A;  4IDH A;  4E0D A;  1ATS A;  2GTD A;  4FWM A;  5C2D A;  4BDY A;  1YJN N;  3B6P A;  2BAN A;  2WC9 A;  4WF9 L;  3KKS A;  3LP3 A;  3EKU A;  4NYF A;  4JI3 K;  4CJL A;  4W5T A;  5KI6 A;  2OPS A;  3ENB A;  1NMD A;  3DRR A;  3LWL A;  3L4I A;  3OY9 A;  5FPE A;  2E2P A;  1Q9X A;  2Q36 A;  1KFD A;  3AA2 A;  3MMV A;  2FLO A;  3DXM A;  2B6A A;  3H1V X;  4CJQ A;  2YNI A;  5BPN A;  3ZSQ A;  1RCH A;  2W6K A;  2P9K A;  2ZM6 K;  1EWR A;  4J2A A;  4DR5 K;  1FKP A;  1S1T A;  3HL8 A;  3CYM A;  2A41 A;  4DTJ A;  2NRR A;  1XMO K;  3AVF A;  3T1A A;  3OS0 A;  3P5J A;  4R79 A;  2O8E B;  3R9P A;  2V51 B;  4M3X A;  3H3O B;  4MO4 A;  1EO1 A;  4CGG A;  1QSS A;  4JS5 A;  1ZXO A;  4JS4 A;  2QKB A;  3LDP A;  3OYG A;  3HI0 A;  4FVU A;  4QCL A;  3R8E A;  2O8C A;  4U67 L;  4CEQ A;  3T19 A;  1I39 A;  3AA5 X;  3DLK A;  4IFV A;  4DV6 K;  4I7F A;  2OZS A;  3RMD A;  2YKN A;  3KLE A;  1JLB A;  2ZJR L;  5AQU A;  1HLU A;  4IFE A;  4JRP A;  1VRU A;  5BRD A;  4DTR A;  1FW6 A;  2A3Z A;  3TAB A;  4GV3 A;  3I0S A;  2PFU A;  1HNV A;  3C95 A;  1B9F A;  4JKH A;  3H6E A;  4NO7 A;  1NKC A;  4F8R A;  3AVM A;  4CJE A;  3O08 A;  3CCR N;  2WON A;  4FK4 A;  3W3D A;  3HST B;  2HF4 A;  4ID1 A;  1Z05 A;  3LP0 A;  4IO8 A;  1TGO A;  1SL0 A;  4KHN A;  2IVN A;  1HKB A;  3NF6 A;  3I56 N;  3S3N A;  2Z1H A;  2P9P A;  3P83 D;  3A5L C;  1SKR A;  3G4S N;  1BO5 O;  1WN7 A;  5AQX A;  4FLV A;  1R59 O;  3RRG A;  3CD6 N;  3VN5 A;  1KAY A;  2A1S A;  2KW4 A;  4DQS A;  4E1M A;  4H5R A;  5JIC A;  3M6G A;  4Z94 A;  4H8K A;  4OPJ A;  2NRH A;  1J5E K;  3IG1 A;  3QB0 A;  3A5N C;  5FRM A;  2HNZ A;  1ZBH A;  4BRQ A;  3OBW A;  1NKE A;  4KTQ A;  1VK0 A;  1JLF A;  1L3V A;  3JS6 A;  4A5B A;  1ZC6 A;  1KSP A;  1QS4 A;  3LZI A;  4EFH A;  3SAF A;  4DR7 K;  3ATV A;  1WSH A;  1RTI A;  3QBX A;  1NJX A;  1BI4 B;  1TUY A;  5AQJ A;  3O3H A;  4O0J A;  2E5L K;  4IJN A;  4AM6 A;  1S1V A;  3P31 A;  3NE6 A;  1DT9 A;  3KVG A;  3SI6 A;  5F2R A;  5K14 A;  5J2Q A;  1IKW A;  3AAP A;  3EE8 A;  5KPZ A;  3TAE A;  1TKD A;  3HO1 A;  4IZ9 A;  4HUE A;  4CGD A;  4NCA A;  4WYB A;  4CJR A;  3VGL A;  2F8S A;  1YVN A;  4CBW A;  5CYQ A;  1SL1 A;  3O9T A;  1C6V A;  4CIF A;  3OBY A;  3H1Q A;  3CIP A;  1XUP O;  4DR3 K;  1A5V A;  1VSK A;  3CI5 A;  3VEZ A;  1LW2 A;  1VSJ A;  3WEE B;  3MX5 A;  3THW B;  1LW0 A;  1S6Q A;  4CCH A;  3TTF A;  3BZK A;  2ETJ A;  3E9O A;  1X9J A;  4BE1 A;  4BY9 C;  2P1J A;  3O9R A;  4DTN A;  3FLC O;  3JYT A;  3L2W A;  4LY7 A;  2GWK A;  1N32 K;  1QSY A;  4J2D A;  3AVB A;  3UKR A;  4WE1 A;  3MXM A;  2YX6 A;  2P5O A;  2WFB A;  1LOT B;  4H5V A;  2FSJ A;  3K5N A;  3MDQ A;  1NNE A;  3PV8 A;  4W5N A;  3VOV A;  4MQ3 A;  3SV3 A;  1HYV A;  4ZHR A;  4FZX C;  4WFA L;  4KHS A;  3C6U A;  3GOI A;  3SQ1 A;  3FZH A;  1EKE A;  3FFI A;  5M1O A;  3D45 A;  3C6A A;  1IKX A;  4IOC L;  3RSE B;  4FM2 A;  5KRT A;  2XY5 A;  1SKS A;  2X6N A;  4KI6 A;  1RNH A;  2V7Y A;  2RPI A;  4DTU A;  2FBY A;  3AY9 A;  4LF6 K;  1WNS A;  3NCI A;  2JWK A;  1KAX A;  4CJ3 A;  4JI1 K;  2Q31 A;  1WBB A;  5C10 A;  1BIZ A;  5EY4 A;  3I8B A;  3U8X A;  4IWV A;  2IDO A;  4E7L A;  2KZZ A;  5BRE A;  2RF2 A;  3NFA A;  3D0P A;  1KRP A;  4KBO A;  3CQ8 A;  3AO4 A;  4E7I A;  1VHX A;  4CZE A;  4BWM A;  1RDA A;  1Q18 A;  4CZM A;  1VQK N;  2YI1 A;  4B9M A;  4CJF A;  3L2R A;  3TAG A;  4QAG A;  4ISG A;  3CET A;  2UUA K;  1UWB A;  3WNE A;  4GW6 A;  4IO9 L;  1K8K A;  1ZBU A;  3UIQ A;  4CEF A;  2E2N A;  1XNQ K;  2IIR A;  3T1Y K;  1ZBI A;  3DRP A;  2I7P A;  3J80 O;  4F4K A;  4DUZ K;  5CY4 A;  1SL2 A;  1T7P A;  2HOE A;  4B9U A;  4KB0 A;  4PY5 A;  1GLJ O;  1RDC A;  1QVG M;  3O4W A;  5J2P A;  3OJS A;  1HMV A;  4FJM A;  1NJW A;  3L3U A;  1NK6 A;  1MU2 A;  4NXM K;  1S3X A;  3SUO A;  2YNG A;  1B9D A;  3ULE A;  1KVB A;  1YXQ A;  1DTQ A;  1RDU A;  3C65 A;  2JGU A;  3O4N A;  1IBL K;  1QQC A;  5DK5 A;  4OLA A;  4WCE L;  4CZI A;  4JI2 K;  1HR0 K;  4JI7 K;  1RT2 A;  3THX A;  3HM9 A;  3ZSZ A;  2NNW A;  5HLF A;  4F3O A;  5H1S Q;  2I5J A;  4DSL A;  4AIL C;  4K41 A;  2F96 A;  3K57 A;  4Z4H A;  4YDU C;  2OA8 A;  4IG3 A;  2AP1 A;  1ZBL A;  1ZBS A;  4KH6 A;  4BRE A;  2B5J A;  5SWM A;  3M8R A;  1GLA G;  4DB3 A;  1TKX A;  2O8B A;  1VSH A;  4IJA A;  2F8T A;  2HHX A;  1A5X A;  3ID6 A;  1Q81 O;  4DSF A;  4JKC A;  2D5R A;  3OYA A;  4OPH A;  3RVC A;  3T69 A;  3THY B;  4RW8 A;  3QIP A;  3IUC A;  2QWN A;  5CZ2 A;  5FPN A;  4UY8 O;  3VQ9 A;  3E01 A;  1JXB A;  2QWP A;  1NKB A;  3AVC A;  4HUF A;  3DRS A;  4B9V A;  1C1B A;  4BRK A;  1JCE A;  4JI8 K;  5HRN A;  4DU1 A;  3K9J A;  1NBW A;  2QWR A;  2DFE A;  3WQT A;  1SS6 A;  2F9T A;  4CES A;  2NRT A;  3MED A;  4M63 C;  2HHT A;  3AVA A;  4KRE A;  2E6M A;  4A62 A;  2BUP A;  4C8O A;  3OW2 M;  2QA4 N;  4N76 A;  4YOV A;  4CEO A;  2QWQ A;  3LPU A;  4PKG A;  1ILY A;  3K5O A;  1YUW A;  4RW9 A;  4WQ4 A;  5AQL A;  1FK9 A;  2HB5 A;  1V4S A;  1JKH A;  3E66 A;  5D3G A;  2ITM A;  4H0X B;  1JJ2 M;  4FJL A;  4NYN A;  3TAP A;  1HQU A;  3SBG A;  3HBT A;  4IOX A;  4I6M B;  4FW2 A;  4JI6 K;  4CFD A;  4DFM A;  1NK7 A;  3DLL L;  4ELV A;  1WSJ A;  3VQP A;  1S9G A;  2G8F A;  3G25 A;  1C0G A;  1HPM A;  3IFR A;  4BRF A;  4YOX A;  2OYQ A;  3RRH A;  4RG8 A;  4J2E A;  4F2R A;  4E1J A;  2FXU A;  3KIO A;  2IS3 A;  2YHX A;  4LSN A;  3F9M A;  1CXU A;  4BRH A;  3VQB A;  4OKE A;  5KQ8 A;  4BR2 A;  4DSK A;  1O1W A;  5AQM A;  2QK9 A;  1VQ8 N;  4XH5 A;  4DQ8 A;  1BCO A;  4WQ5 C;  1IBK K;  3F5T A;  3NF8 A;  5E84 A;  1W7A A;  4H0P A;  1HJO A;  4JKG B;  3G71 N;  2GX9 A;  3TSQ A;  5J2M A;  4KAZ A;  3KHY A;  3SV4 A;  2O8E A;  2HMI A;  4IBN A;  1S5J A;  4Z0U A;  5AQF A;  5KGX A;  3ITH A;  3U6F A;  4CIG A;  4EZ9 A;  4ILH A;  5FDL A;  1ATR A;  3NF9 A;  3HOS A;  5AQO A;  3CJB A;  3R3L A;  3MN6 A;  1QQM A;  2WOM A;  5CHI A;  1NGA A;  2FBT A;  3SMP A;  1MA9 B;  3V1R A;  1QTM A;  4B9T A;  3ULD A;  2RKI A;  2OTL N;  4H5W A;  1GOC A;  3CC4 N;  3HPG A;  5LY3 A;  3TAM A;  4FM0 A;  4FLT A;  3E9P A;  3FZK A;  3LM2 A;  2OTJ N;  2HBK A;  3QML A;  1ZYQ A;  3LPT A;  3DM2 A;  1XI1 A;  4DFP A;  3VQ6 A;  1TUU A;  1CZA N;  4B9L A;  1BIS A;  3OYL A;  1SQK A;  3OVN A;  4DV1 K;  4H0O A;  3M8S A;  4C8L A;  2X74 A;  5BN8 A;  4DLG A;  1VQ4 N;  3M5R A;  5DM6 L;  3OYC A;  4CJP A;  4LF7 K;  2UU9 K;  4IFY A;  1SUQ A;  2ZE2 A;  3K9K A;  4EP5 A;  3CJA A;  3TWH A;  1D8Y A;  4O8K A;  3SQ0 A;  1VQ6 N;  4A2A A;  4E7K A;  4RWT A;  4CHY A;  2Q2R A;  5LL6 Z;  1BG3 A;  1W97 L;  1BOT O;  1YJW N;  1QZ5 A;  3U3G A;  5BR9 A;  3WXI A;  3VF6 A;  4W5O A;  4FWK A;  1ZBF A; 
#chains in the Genus database with same CATH homology
 3KD5 E;  2Z1H A;  3P83 D;  1SKR A;  4AH9 A;  3MEG A;  1WN7 A;  2FBV A;  1FXX A;  4FLV A;  2XY8 A;  4FJG A;  3VQC A;  4RW6 A;  3ZSY A;  3RRG A;  4KHU A;  2Z1I A;  3QEW A;  3VN5 A;  3AVK A;  2Q3S A;  2A1S A;  4CER A;  2KW4 A;  1DLO A;  4E1M A;  4DQS A;  1D9D A;  4KKO A;  1IKY A;  4H8K A;  3P1G A;  4R5P A;  4OPJ A;  4DF8 A;  1BQN A;  1F21 A;  3AVH A;  3QLH A;  3VA3 A;  1CXQ A;  1VSE A;  3V81 A;  2PY5 A;  3IG1 A;  3T3F A;  3BGR A;  3NAE A;  3SNN A;  1U47 A;  5FRM A;  5HRO A;  2HNZ A;  1QE1 A;  1WSF A;  3CFO A;  5KTQ A;  1ZBH A;  3ZSO A;  2P5G A;  1U04 A;  1W9H A;  3S3M A;  3CFP A;  3SPY A;  3HJF A;  1RT5 A;  3QEI A;  4KV8 A;  3MXJ A;  4NCG A;  4Z4C A;  1BI4 A;  1NKE A;  4KTQ A;  1VK0 A;  3SCX A;  1JLF A;  4OPK A;  1L3V A;  1KVA A;  1ITG A;  2YV0 X;  3V9S A;  3QET A;  4FK2 A;  4KHS A;  4FJH A;  4AHT A;  1KSP A;  1QS4 A;  1J53 A;  3LZI A;  3AVI A;  4FJ5 A;  4FCY A;  4GVM A;  1A5W A;  1WSH A;  4YNQ A;  1KFS A;  1RTI A;  3OYK A;  5I42 A;  1NJX A;  1R0A A;  1BI4 B;  1ASW A;  1RTH A;  1XWL A;  3O3H A;  4TSX A;  1JXE A;  4O0J A;  4BWJ A;  1UA1 A;  2OPR A;  3V9X A;  3MXI A;  1S1V A;  3NE6 A;  2NUB A;  4CJ4 A;  1RT1 A;  3ZSW A;  4CE9 A;  4DLE A;  3SI6 A;  3HP9 A;  4DQI A;  1RDD A;  1XHX A;  5K14 A;  3NH2 A;  3H08 A;  1IKW A;  5J2Q A;  1NK5 A;  4O5B A;  1T05 A;  2PYJ A;  3SPZ A;  1N5Y A;  1DTT A;  2GUI A;  4FLX A;  1G15 A;  3TAE A;  5CZ1 A;  3SUQ A;  4ELU A;  3I8D A;  3RR7 A;  1TKD A;  3HO1 A;  4PWD A;  4HUE A;  4CGD A;  1TAQ A;  3V4I A;  4NCA A;  1XC9 A;  4CEE A;  4B9S A;  4CJR A;  2XY7 A;  4BDZ A;  3AVJ A;  3MEC A;  1LWC A;  3DLB A;  3V1O A;  2EHG A;  2F8S A;  4FJI A;  2X78 A;  1SL1 A;  5CYQ A;  3I0R A;  3S9H A;  4FJJ A;  1U49 A;  4KHY A;  5FRN A;  1U4B A;  4O0I A;  1C6V A;  1UAX A;  4CIF A;  3OYF A;  3M8Q A;  3C94 A;  3VA0 A;  4C8M A;  3QER A;  2XY6 A;  1TL3 A;  2GV9 A;  1A5V A;  1VSK A;  3OYN A;  1IG9 A;  1CZB A;  1KTQ A;  1LW2 A;  1VSJ A;  3CG7 A;  1K6Y A;  4GMJ B;  4CHO A;  2IC3 A;  4B8C A;  3ASM A;  1RDB A;  1LW0 A;  1S6Q A;  3M8P A;  4C8K A;  3ALY A;  1HQE A;  2VWK A;  4Y1D A;  5HBM A;  4CCH A;  1YTU A;  4I2P A;  4M42 A;  3OYM A;  2HHS A;  4NCB A;  2ETJ A;  4CFA A;  1RBT A;  2HVH A;  1BQM A;  3ZCM A;  4BE1 A;  2P1J A;  2R7Y A;  4DTN A;  1YVU A;  3QES A;  2VG7 A;  2LSN A;  3VQQ A;  3JYT A;  3L2W A;  4Z4F A;  4LY7 A;  4CK1 A;  1QSY A;  4FYD A;  1Z25 A;  2GBZ A;  3AVB A;  4J2D A;  4DTM A;  4LH5 A;  3CM6 A;  4O4G A;  3KD1 E;  4IDK A;  1VSI A;  4WE1 A;  3MXM A;  4CJV A;  5JS1 A;  3AV9 A;  2P5O A;  3K5N A;  1TK5 A;  3PV8 A;  3K59 A;  4W5N A;  3NDK A;  1NOZ A;  2ZD1 A;  2KFN A;  1JLG A;  1RTD A;  1WSE A;  1VSD A;  4KO0 A;  1HYZ A;  4MQ3 A;  3SV3 A;  1HYV A;  4ZHR A;  4I2Q A;  3K5M A;  3V9W A;  4H4M A;  4DG1 A;  2G8U A;  3C6U A;  4BDP A;  3CM5 A;  4DQQ A;  5E41 A;  3HP6 A;  4M3Y A;  3SQ1 A;  4K8X A;  3HK2 A;  2D0B A;  1EKE A;  1UA0 A;  1FKO A;  3FFI A;  1TV6 A;  3D45 A;  3LDS A;  1IKX A;  4OLB A;  1HPZ A;  2B4J A;  4FM2 A;  5KRT A;  4DSI A;  1WAJ A;  4RW7 A;  5C42 A;  4M3U A;  2VG5 A;  2XY5 A;  1W0H A;  2YKM A;  2G8H A;  1SKS A;  3QEX A;  2X6N A;  4KI6 A;  1RNH A;  4CGJ A;  4Z4E A;  4FXD A;  1IKV A;  4KTZ A;  3L2Q A;  2RPI A;  4RW4 A;  1TK0 A;  3DOL A;  4CJ5 A;  1NK9 A;  4DTU A;  2FBY A;  3ZSX A;  4ZTF A;  3KJV A;  1WNS A;  2HNY A;  3QNN A;  4XIU A;  1X9W A;  4E7J A;  1L3U A;  4Q5V A;  3NCI A;  1GOB A;  1EET A;  1J54 A;  3NGY A;  3SZ2 A;  3NGZ A;  2D0A A;  4DU4 A;  1X9S A;  4CJ3 A;  3PX0 A;  1L5U A;  1LAV A;  3SUP A;  3VQ4 A;  3SUN A;  1KLM A;  4EZ6 A;  4CJW A;  1UOC A;  1BIZ A;  1Z26 A;  1S1W A;  5CYM A;  3PO4 A;  1KVC A;  4QOZ B;  4FJX A;  4OKJ A;  3THV A;  4FJN A;  2IDO A;  4E7L A;  1GOA A;  3NH1 A;  3KLI A;  1TKZ A;  3L2V A;  2KZZ A;  2RF2 A;  5EU7 A;  3NFA A;  3D0P A;  4CFC A;  3SQ2 A;  1KRP A;  3CQ8 A;  3AO4 A;  3AVN A;  1X9M A;  5KGW A;  4E7I A;  3QIO A;  4B8A B;  1NOY A;  4BWM A;  3TI0 A;  1RDA A;  1RT4 A;  1X1P A;  3DI6 A;  4B9M A;  2VG6 A;  4Q0B A;  4CJF A;  3L2R A;  3TAG A;  4QAG A;  3HYF A;  3G10 A;  4O55 A;  4KI4 A;  3V6D A;  3LAL A;  3OYD A;  1VSL A;  4Z4G A;  1C0T A;  3CFR A;  4N47 A;  4LD0 A;  1EXQ A;  1UWB A;  2HND A;  2P51 A;  3WNE A;  4GW6 A;  4DFK A;  1ZBU A;  3B6O A;  3UIQ A;  4CEF A;  5HRP A;  5KRS A;  3L8B A;  1ZBI A;  3DRP A;  1D5A A;  4DTX A;  2G8W A;  1I3A A;  3OYE A;  2YHB A;  5CY4 A;  3K2P A;  4F4K A;  1SL2 A;  1T7P A;  3KLH A;  3DYA A;  3TAR A;  5I3U A;  3QEV A;  3RR8 A;  4N41 A;  4B9U A;  4KB0 A;  3MEE A;  1TL1 A;  4PY5 A;  3KLF A;  1RDC A;  1JL2 A;  2HW3 A;  3OJU A;  3LP2 A;  4M41 A;  2D0C A;  1BCM A;  2Z1J A;  4C8N A;  1RBV A;  4EP4 A;  3OJS A;  5J2P A;  1JLC A;  1HMV A;  3DLG A;  4FJM A;  1NJW A;  2RN2 A;  3L3U A;  1MU2 A;  1NK6 A;  4OKK A;  4BE2 A;  3SUO A;  2YNG A;  1B9D A;  1HJR A;  4MFB A;  3VQ8 A;  3OYI A;  1YTA A;  1C1C A;  1KVB A;  4PUO A;  3AVG A;  4FLZ A;  3V9U A;  1DTQ A;  4JRQ A;  4F2S A;  1TKT A;  2JGU A;  1S6P A;  1BIU A;  3O4N A;  4DMN A;  4HUG A;  4DWI A;  3OYB A;  3OYJ A;  4FZY A;  1QQC A;  5DK5 A;  4CEA A;  3RMB A;  4OLA A;  2BDP A;  2VWJ A;  4DSJ A;  4FLU A;  3DLR A;  4CF9 A;  3QEP A;  1JLA A;  1RT2 A;  1NK0 A;  3OS1 A;  3ZSZ A;  3HM9 A;  1RT6 A;  3MAQ A;  5HLF A;  4F3O A;  3SJJ A;  2PYL A;  2I5J A;  4E1N A;  4PA1 A;  3BDP A;  4AIL C;  4DSL A;  2IOC A;  1VSM A;  2HHV A;  1BL3 A;  2F96 A;  1S1U A;  3K57 A;  2BGG A;  4H4O A;  4Z4H A;  4FZZ A;  3O3G A;  1ASV A;  2DFH A;  3HT3 A;  2KTQ A;  1S9E A;  5FRO A;  3TR8 A;  3IAY A;  1L3T A;  2OA8 A;  2XO7 A;  4IG3 A;  3C6T A;  3PY8 A;  4FJ9 A;  2JLE A;  3AVL A;  3IRX A;  4OGE A;  1ZBL A;  1C0U A;  4FLW A;  1Q8I A;  5SWM A;  1Y97 A;  2B5J A;  3M8R A;  5HP1 A;  3AO1 A;  3QIN A;  1LWF A;  2PZS A;  3LP1 A;  2ZQB A;  1TKX A;  4M3W A;  4FVM A;  4FJK A;  4DS5 A;  3TAN A;  4IG0 A;  1VSH A;  4K8Z A;  2F8T A;  2HHX A;  1A5X A;  3AO5 A;  1RIL A;  5T7B A;  4BE0 A;  1RBS A;  3ZSV A;  4CJT A;  4DTP A;  4FLY A;  4DSF A;  4N56 A;  1D9F A;  2QXF A;  2D5R A;  3OYA A;  4G1Q A;  4B08 A;  4RW8 A;  4CF8 A;  2ATQ A;  3VQ5 A;  3QIP A;  4FW1 A;  1L3S A;  1T03 A;  3ZT4 A;  5CZ2 A;  2KFZ A;  3LAM A;  2YNF A;  3VQ9 A;  3E01 A;  5C25 A;  5JS2 A;  1NK4 A;  4DQP A;  1JXB A;  1NKB A;  4FJ7 A;  3AVC A;  3VQA A;  5HRS A;  3KK1 A;  4HUF A;  4E19 A;  4DS4 A;  1YT3 A;  3DRS A;  4AHC A;  1ZYQ A;  4B9V A;  1J9A A;  1C1B A;  3A2F A;  4CGF A;  4JLH A;  3TAF A;  3NGI A;  3DLE A;  3PX4 A;  4HHT A;  2A1R A;  3EY1 A;  2HHQ A;  5HRN A;  3KLG A;  4DU1 A;  3G0Z A;  3QO9 A;  1Q9Y A;  4CED A;  1HRH A;  2DFE A;  4KRF A;  4CJK A;  2Y1J A;  3JSM A;  3LAK A;  1CZ9 A;  4CES A;  4ZTJ A;  2Z1G A;  4UQG A;  2KZM A;  1CLQ A;  3MED A;  4CIE A;  2HHT A;  1JLE A;  3AVA A;  4KRE A;  2E6M A;  4CEB A;  4CGH A;  4FM1 A;  2E4L A;  4C8O A;  3QNO A;  3PX6 A;  3L2U A;  4B9N A;  4N76 A;  2OPP A;  4CEO A;  1TK8 A;  4CHP A;  3K58 A;  1XHZ A;  2G8V A;  4KHW A;  4CJS A;  3L3V A;  3LPU A;  5C24 A;  1IO2 A;  2QKK A;  4AHS A;  4CF0 A;  3K5O A;  1RBR A;  5DMR A;  2FC0 A;  4RW9 A;  5HRR A;  3SQ4 A;  1FK9 A;  2HB5 A;  1JKH A;  5D3G A;  3EYZ A;  4LH4 A;  4HCC A;  4FJL A;  3TAQ A;  1EX4 A;  4NYN A;  1SV5 A;  2XHB A;  2IAJ A;  3TAP A;  4BAC A;  1HQU A;  3LZJ A;  3V1Q A;  3HVR A;  4KTW A;  4OGC A;  1NJZ A;  4CJU A;  4IKF A;  3RWU A;  4FW2 A;  1U48 A;  4CFD A;  3LAN A;  4DFM A;  1NK7 A;  4CHZ A;  3PUF A;  3ZT2 A;  1BGX T;  1WSJ A;  2IGI A;  1S9G A;  3VQP A;  4DF4 A;  4ELV A;  3RMA A;  2G8F A;  4L8R B;  4AHR A;  3EZ5 A;  4HTU A;  4KFB A;  3NHG A;  4PQU A;  2DY4 A;  2O4G A;  3KK3 A;  4J2B A;  1LWE A;  3DLH A;  2G8I A;  3DOK A;  4I9L A;  4DTS A;  5J1E A;  4CHN A;  4DQR A;  4E3S A;  4RG8 A;  4N5S A;  3RRH A;  2OYQ A;  4J2E A;  3KTQ A;  1EP4 A;  4W5R A;  4F2R A;  4ID5 A;  1T8E A;  3PO5 A;  3KIO A;  2IS3 A;  3NF7 A;  1QSL A;  1ASU A;  4LSN A;  4E0D A;  2AJQ A;  1TAU A;  1CXU A;  1HNI A;  3VQE A;  4BDY A;  1WSG A;  3VQB A;  3B6P A;  1WSI A;  2BAN A;  3V9Z A;  4OKE A;  3KKS A;  3LP3 A;  4NYF A;  3WNG A;  2XRI A;  4AHV A;  4DSK A;  4CJL A;  4W5T A;  2HHW A;  1O1W A;  3AO3 A;  3ZT1 A;  3ZT0 A;  2HHU A;  5KI6 A;  2OPS A;  4E89 A;  2W42 A;  2QK9 A;  3WNH A;  3DRR A;  1KCF A;  2O4I A;  4OJR A;  1BCO A;  3LWL A;  2DFF A;  3NF8 A;  1U45 A;  3OY9 A;  1B92 A;  1Q9X A;  2BE2 A;  1KFD A;  3AA2 A;  4HVJ A;  3F9K A;  3OYH A;  4M3R A;  4CHQ A;  5J2M A;  2B6A A;  4CJQ A;  4YFU A;  3LWM A;  2YNI A;  4KAZ A;  3ZSQ A;  1RCH A;  3KKR A;  1VSF A;  1VRT A;  1RTJ A;  3HPO A;  3SV4 A;  4DU3 A;  2EX3 A;  4IBN A;  1S5J A;  4Y1C A;  4Z0U A;  1BHL A;  1RT3 A;  3VQD A;  4E7H A;  2HMI A;  4HCB A;  1KLN A;  4J2A A;  1FKP A;  1S1T A;  3F73 A;  3HL8 A;  3HVT A;  4W5Q A;  3CYM A;  4FZX C;  5KGX A;  3ITH A;  3OS2 A;  1LV5 A;  1IH7 A;  2KQ2 A;  4DTJ A;  3U6F A;  3AVF A;  3T1A A;  4CIG A;  1QHT A;  3OS0 A;  4EZ9 A;  3P5J A;  3VQ7 A;  3U3Y A;  2X6S A;  5FDL A;  3NF9 A;  4CFB A;  3IS9 A;  4M3X A;  3K5L A;  3RMC A;  1REV A;  4CGG A;  2WOM A;  1C0M A;  4KB1 A;  4CK3 A;  1WLJ A;  4JS5 A;  1QSS A;  4DFJ A;  4CEZ A;  2FBT A;  4B3O A;  3AA3 A;  4CF1 A;  3HXM A;  4JS4 A;  3V1R A;  1SKW A;  1QTM A;  4CGI A;  3ULD A;  4B9T A;  2RKI A;  4LSL A;  2QKB A;  1GOC A;  2OPQ A;  5J2N A;  4KHQ A;  3HPG A;  3TAM A;  1RT7 A;  3OYG A;  2G8K A;  4FM0 A;  4Z4I A;  4FLT A;  4CK2 A;  4QCL A;  4CEQ A;  4F3T A;  2YHA A;  3T19 A;  4O44 A;  1I39 A;  3AA5 X;  3DLK A;  3LPT A;  4IFV A;  4M45 A;  4CF2 A;  3DM2 A;  1C1A A;  5SZT A;  3O4Q A;  3RTV A;  4DFP A;  4I7F A;  1XI1 A;  4I9Q A;  3DMJ A;  3ZSR A;  3VQ6 A;  2ITG A;  3S3O A;  1HYS A;  2OZS A;  3RMD A;  3ZT3 A;  2YKN A;  3KLE A;  1JLB A;  2OZM A;  2FBX A;  4B9L A;  1BIS A;  3OYL A;  3OVN A;  4M3Z A;  1S1X A;  3M8S A;  4JRP A;  4ICL A;  4C8L A;  1VRU A;  2X74 A;  4DTR A;  1J5O A;  4AHU A;  3TAB A;  4KPY A;  4DLG A;  1RBU A;  3I0S A;  3OYC A;  2DTU A;  2HVI A;  1HNV A;  4OVL A;  4CJP A;  1LAW A;  3C95 A;  1NJY A;  4IFY A;  1SUQ A;  1B9F A;  3ISN C;  1JLQ A;  2ZE2 A;  1NKC A;  4EP5 A;  3KK2 A;  4F8R A;  3TWH A;  3AVM A;  4CJE A;  3O3F A;  4FJ8 A;  1D8Y A;  1TVR A;  3AA4 A;  1WAF A;  3SQ0 A;  2WON A;  4FK4 A;  4M3T A;  4E7K A;  3WNF A;  3HST B;  3HPH A;  4ID1 A;  4FK0 A;  3LP0 A;  4CEC A;  2Y1I A;  4ELT A;  4CHY A;  4DSE A;  1NK8 A;  1TGO A;  1SL0 A;  4KHN A;  3AO2 A;  4W5O A;  3U3G A;  3NH0 A;  4DTO A;  2YNH A;  3NF6 A;  3NBP A;  2E6L A;  1JL1 A;  3S3N A;  1ZBF A;  1N6Q A;  3SYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...