1LAVA

Stabilization of escherichia coli ribonuclease hi by cavity-filling mutations within a hydrophobic core
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
155
structure length
155
Chain Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHCEVILSTDSQYLRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERCDELARAAAMNPTLEDTGYQVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE H
publication title Stabilization of Escherichia coli ribonuclease HI by cavity-filling mutations within a hydrophobic core.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 52
structure length 155
sequence length 155
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 1993-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lavA00
4CHQA 3SYZA 1S1TA 3V9SA 4RG8A 5HRSA 4B3OA 1SV5A 3AO1A 4CHNA 4CFDA 2PYJA 4FJMA 5D3GA 1DLOA 5J2QA 4BDPA 1KFSA 4DU1A 3M8PA 4BACA 4FJ7A 1NOYA 4FZZA 2HNYA 3OYEA 4O5BA 4KI4A 3QIPA 4CEZA 1KFDA 2BE2A 2G8KA 1LWCA 3NF6A 1WSIA 3I0SA 1IG9A 1C1CA 1HMVA 3K59A 2YKMA 2VG6A 1TAUA 4Z4GA 4J2BA 4OKJA 3DYAA 3L2QA 4EP4A 3CG7A 4KHWA 2KTQA 1A5WA 1LW2A 1WLJA 1ZBIA 4E19A 3OYJA 3CM5A 3C6TA 4F3TA 4CESA 3V9WA 1HRHA 4CHYA 3ZSRA 4CJKA 4NCGA 2A1SA 1O1WA 4J2EA 5HRNA 3NE6A 1IH7A 3KLHA 4B9SA 4Y1DA 1TKTA 1VSHA 4E7JA 4CHOA 2YNGA 4DFJA 2A1RA 2HNZA 1QSLA 2GUIA 4KHNA 1RT1A 4E7IA 5KRTA 5JS2A 4FM1A 3HP9A 1EETA 2E6LA 1RTIA 3KD1E 1MU2A 1W9HA 3ISNC 1RILA 3DM2A 4UQGA 4BE0A 4JS4A 3AVHA 4Z4CA 2Y1JA 1VSDA 3MEGA 2G8FA 3TARA 4AHUA 3B6PA 3IAYA 1B9DA 1LWFA 4CF8A 3M8SA 4DG1A 4O0JA 1EX4A 3SPYA 3NGYA 4FW1A 1N6QA 1RTJA 4CJRA 4DSKA 3RMBA 2P5GA 4FLXA 2P1JA 1XHZA 5E41A 1RDDA 1I39A 3AO5A 4O0IA 1QS4A 4FJ8A 4I7FA 2X74A 4B9MA 3K57A 3K2PA 2ZQBA 1KTQA 3P5JA 3QEIA 1C6VA 4KTWA 4FK2A 3NF9A 3OYAA 1WAJA 1TL1A 4CJWA 3K58A 3HP6A 1L3VA 3AA3A 3RR8A 4M3YA 2HHTA 1IKYA 4KO0A 4KV8A 4CK1A 4AHTA 3OJUA 1ZBHA 4HCBA 4HUGA 4CJ4A 4DTRA 3LPUA 2IC3A 3CM6A 3OS1A 4Z4EA 2HHQA 3DMJA 3VQPA 4CJ5A 4W5TA 3OYLA 2PYLA 5KTQA 4LD0A 3MECA 4DQQA 1RBRA 4ZHRA 3AVMA 1WSGA 4HCCA 4FJIA 3CYMA 1NKEA 2KZMA 2G8IA 1K6YA 4LY7A 4DTOA 3RMAA 1TKZA 3AVJA 3RTVA 1CZBA 3SQ1A 2OYQA 3AO3A 4ID1A 4N47A 1J5OA 4ELTA 2DFFA 4FLZA 1RTDA 3NF7A 3LZIA 4I9QA 4CJPA 4AH9A 2E6MA 3SNNA 1UA1A 3AVCA 1TVRA 3LPTA 4FW2A 1IKVA 2IDOA 3ASMA 3V1QA 1ITGA 3QEVA 1SKRA 3LALA 3L3VA 1EXQA 4IKFA 3V1RA 1WNSA 1S1WA 4QAGA 3K5OA 2DTUA 1L3SA 3OYGA 4CGHA 4KHUA 4I2QA 4CK3A 3U3GA 4NYNA 3LWLA 4DQSA 2YHAA 5CY4A 5C25A 3PX6A 3ZT0A 4DLEA 1RT7A 5C24A 3OYHA 1UA0A 3EY1A 4KHSA 2QKBA 3DLKA 1HYZA 4CGJA 5HRPA 1SKWA 2OPSA 4OVLA 4DWIA 4CCHA 4EZ9A 3L8BA 3HPOA 4KB0A 3HPGA 4B9VA 4CJEA 3SCXA 1NKCA 4DFMA 2W42A 4KREA 3QNNA 2GBZA 3AVNA 4FZYA 1J54A 1S9EA 4E0DA 4ELVA 3HO1A 3OYMA 1D9FA 1VRUA 4XIUA 1RCHA 4C8LA 3PV8A 4FLYA 3NAEA 3DOKA 3EZ5A 4CERA 3ZCMA 3SUOA 1J53A 4CFBA 3G10A 1C0UA 4AHRA 4YFUA 4AHSA 2XY6A 3RMCA 3KK3A 1FKPA 2KFZA 4F4KA 3T1AA 3LP0A 3KK1A 1C1AA 3MAQA 3RR7A 1ASUA 3VQ6A 3VQBA 4KFBA 3AVLA 3BGRA 3I0RA 2HB5A 2ZD1A 4Z0UA 3IG1A 3AVFA 3UIQA 3LP3A 4W5NA 4CEQA 1C0MA 2D5RA 1X9WA 1CZ9A 4DF4A 1NK8A 3CQ8A 1RBUA 4M3WA 1VSKA 4CJLA 3SJJA 3QLHA 4HHTA 4EZ6A 3QIOA 3WNEA 4JS5A 4DFKA 2OPRA 4DTMA 4IBNA 4KRFA 4FK4A 1NKBA 4M3TA 2JLEA 4M42A 3U6FA 2DY4A 1JLQA 3MEDA 3AVKA 1HYSA 4FJGA 2QK9A 2OZMA 3LP1A 1BI4A 3HVTA 1ASWA 4FJHA 4FJNA 4LH4A 1JXEA 1JLGA 4JRPA 2P51A 3DLGA 1XC9A 2G8UA 3EYZA 4C8KA 3KKSA 4M3XA 5I42A 1B9FA 1QHTA 3VQ8A 4DS4A 4M3ZA 3QO9A 2O4IA 3AV9A 3OYFA 3RMDA 5HRRA 1RBSA 4FJJA 1EKEA 3LAKA 5CYQA 4DFPA 3F73A 4IDKA 5J1EA 1S1UA 3PX4A 4DMNA 3DLRA 3KKRA 1N5YA 1WSFA 2ITGA 2F8TA 1L5UA 1HPZA 4CK2A 1RTHA 3MXMA 2OZSA 4B9LA 4Q0BA 1VSIA 2IS3A 4OKKA 3G0ZA 2IGIA 5FDLA 4KTQA 4JLHA 3PUFA 2WONA 5HBMA 3OYIA 1NK9A 2FBVA 4E7LA 2OA8A 4NCBA 2IAJA 1BGXT 1JLCA 3OYKA 4DTJA 3THVA 3K5LA 3OY9A 1JL1A 4DSLA 1BIUA 3MEEA 3ZT4A 3VQDA 2G8VA 1D9DA 1RT5A 3VQ9A 1RDAA 1SKSA 3V4IA 3SUPA 4ELUA 2KW4A 3AO2A 4F8RA 3KLEA 3TAFA 3SUQA 1RT3A 4LSNA 1QE1A 4E7KA 4CJSA 4FYDA 2B6AA 4CF9A 4DTUA 2Y1IA 3VN5A 3TWHA 3QESA 3V9UA 3HPHA 1LAWA 3E01A 3TANA 3OYNA 4BWMA 5FRMA 3ZT2A 3JYTA 4QCLA 2ATQA 5SWMA 1VRTA 3SQ2A 3ZSXA 1HNIA 4CF1A 1ZBLA 1NK7A 4J2AA 4CEDA 1FXXA 3WNFA 3A2FA 3SV3A 4CJFA 3TAQA 4KAZA 4DQRA 3ZSQA 1QTMA 5HP1A 4Y1CA 1SL0A 4DSEA 4QOZB 2HVHA 2QXFA 3IS9A 4DU4A 4ZTFA 3NHGA 5KGXA 2XY8A 3H08A 3U3YA 4YNQA 3DLBA 5J2MA 4DSIA 1LWEA 3NF8A 4RW4A 3TAMA 4N56A 3RRHA 3PO5A 2BGGA 3NCIA 2F8SA 3KLGA 2X78A 2HVIA 3AA5X 1UOCA 2BDPA 1B92A 3AVIA 4FLTA 2Q3SA 1BISA 2Z1JA 3ZSOA 1XI1A 4DSJA 4H8KA 3TABA 1TK8A 1JLFA 2F96A 2YNFA 3V6DA 1KCFA 4CFCA 1NJXA 3QNOA 4KB1A 3KK2A 4PWDA 4OGEA 1RT6A 4M3UA 3OS2A 1RBTA 3OYDA 4E1NA 3TI0A 4DTNA 1ASVA 1JL2A 1HQEA 2FBYA 3S3MA 1U45A 3CFRA 3DOLA 1U47A 2QKKA 1JLBA 1YTAA 4O4GA 2YHBA 1ZYQA 3VQ7A 2ZE2A 4E1MA 3LZJA 3VA0A 3VQAA 1D5AA 2VWKA 2WOMA 3O4NA 5KRSA 4RW9A 4DTXA 3VA3A 2OPPA 2BANA 1TAQA 3LANA 4RW8A 2R7YA 3PX0A 4N41A 2HHWA 3LAMA 2DFEA 3HM9A 2YNHA 4W5RA 3WNHA 4MFBA 4DU3A 4FM2A 4ZTJA 1ZBFA 1T03A 3NH0A 5CYMA 2DFHA 1R0AA 3TR8A 3AA4A 1WN7A 1TL3A 4ICLA 1VSJA 1LW0A 2RPIA 3T19A 5FRNA 2RKIA 3SUNA 4M3RA 4W5QA 3HXMA 4DS5A 1HJRA 1UAXA 3ZT1A 4CGGA 4OPJA 3KLFA 5I3UA 1Q9YA 1RDBA 3F9KA 1RT4A 3M8RA 1NOZA 4KI6A 4KHQA 1HNVA 4Z4IA 2I5JA 4B9TA 4IFYA 3HJFA 2XY7A 3TAPA 1BIZA 1RBVA 4FM0A 4E3SA 3BDPA 1KVBA 4I9LA 3HK2A 3ZT3A 4W5OA 4L8RB 1F21A 4RW6A 2Z1GA 3NGZA 4CJVA 1QSSA 4CJUA 1QQCA 3DLHA 1S6PA 3VQ5A 3I8DA 4CE9A 5T7BA 1Q8IA 2XHBA 4B8CA 4DQPA 4DQIA 5C42A 1NK0A 4IG0A 3VQEA 2Z1HA 4E89A 3KLIA 2HHXA 3S3NA 1NJWA 2YKNA 3RRGA 4CECA 1LV5A 1UWBA 3HYFA 1WSJA 1WSEA 3LP2A 1YVUA 1HQUA 3HSTB 4CJQA 1Y97A 4N76A 4BE1A 3CFOA 1RT2A 4CIFA 1GOBA 1L3TA 4NCAA 2HHVA 1BQMA 4ID5A 1J9AA 5J2NA 3V81A 3L2RA 4FJXA 2VG5A 2HW3A 2XRIA 4FVMA 3D45A 3SZ2A 3RWUA 4OPKA 3SPZA 1NJYA 4DTPA 2D0AA 4F2SA 1NK4A 1S1VA 3P83D 1X9SA 1D8YA 2RN2A 4TSXA 3OYBA 1S9GA 1A5XA 3ZSVA 3SV4A 2EX3A 3FFIA 1TK5A 4OKEA 1KVCA 5HROA 3NH2A 3C6UA 4BE2A 4FJ5A 1I3AA 4GW6A 1T7PA 4GMJB 2HMIA 3NDKA 1TKDA 1IKXA 4K8XA 4Z4FA 1FK9A 4O44A 1REVA 3QETA 4CEAA 2P5OA 3ZSWA 1JKHA 4AHVA 3OYCA 4DF8A 4WE1A 4OJRA 4H4OA 3L2UA 3QEWA 1T8EA 4CGIA 3T3FA 1GOCA 4M45A 4CEFA 5EU7A 1KLNA 4B8AB 1IKWA 2JGUA 1TV6A 3P1GA 1L3UA 1LAVA 4F3OA 2G8HA 4KHYA 2FC0A 3LDSA 2EHGA 3HT3A 2HHUA 5HLFA 2O4GA 1U48A 1CXUA 4BDYA 5K14A 1BL3A 1BQNA 4R5PA 2VWJA 3CFPA 4F2RA 5JS1A 1CXQA 1U49A 2AJQA 1EP4A 3KIOA 4Z4HA 1S1XA 4CIEA 4C8MA 3TAGA 1Z26A 5SZTA 1FKOA 3O3HA 4FLWA 1SL2A 3QINA 2YNIA 3O3FA 1BCMA 1KLMA 4BWJA 4PUOA 2G8WA 1XHXA 1W0HA 3DRRA 4CEEA 4CF0A 4CEOA 4EP5A 4LH5A 5J2PA 4OLBA 4FCYA 4OGCA 3LWMA 3C94A 2X6NA 3O4QA 2D0BA 1C1BA 4B9UA 1U4BA 3SQ4A 2NUBA 1T05A 3AA2A 4KTZA 2OPQA 1WAFA 1SUQA 2VG7A 4FZXC 3B6OA 4N5SA 4H4MA 3TAEA 4G1QA 1BHLA 3AO4A 3WNGA 4B08A 5CZ2A 3NGIA 4KPYA 1C0TA 1RDCA 4MQ3A 4KKOA 1S6QA 3VQCA 1IO2A 2KQ2A 4M41A 2XY5A 3KJVA 4CJTA 4FK0A 4OLAA 3L2VA 1WSHA 2ETJA 3DRPA 2IOCA 4IFVA 4HUEA 1KVAA 4AILC 2D0CA 3MXIA 3SQ0A 2RF2A 3DLEA 3AVAA 4I2PA 4IG3A 1X9MA 3PY8A 4CGFA 1U04A 2KZZA 4DSFA 1TK0A 1DTTA 3VQ4A 5DMRA 3K5MA 4E7HA 5FROA 4CFAA 1NJZA 4Q5VA 1S5JA 1BI4B 3AVBA 3DRSA 2HHSA 2GV9A 3ZSZA 4NYFA 3D0PA 3C95A 4PA1A 1SL1A 3QEPA 4AHCA 1XWLA 2FBXA 4RW7A 1DTQA 4FLVA 5KI6A 4CIGA 4FJ9A 1ZBUA 3PO4A 4FJLA 1VK0A 1VSFA 3ALYA 3M8QA 1NK5A 3ZSYA 3ULDA 3DI6A 4CHPA 2KFNA 3QEXA 3HVRA 5CZ1A 3IRXA 3OJSA 3L2WA 1BCOA 1Q9XA 3L3UA 3NFAA 3NH1A 3V9ZA 3MXJA 4CHZA 2Z1IA 4C8NA 4DTSA 5KGWA 3AVGA 1A5VA 3SI6A 1CLQA 3HL8A 2B5JA 3O3GA 1G15A 1JLEA 2E4LA 4FLUA 3NBPA 4JRQA 2PY5A 4PY5A 5DK5A 4CJ3A 3OS0A 3S9HA 1RNHA 4DLGA 1VSEA 2B4JA 3OVNA 3VQQA 1JLAA 4HUFA 1QSYA 4HVJA 1KRPA 3KTQA 4PQUA 2PZSA 2LSNA 3V1OA 1TGOA 2HNDA 1NK6A 1JXBA 1HYVA 1TKXA 4CGDA 4CF2A 3QERA 1GOAA 4B9NA 4FXDA 3V9XA 3JSMA 4GVMA 1VSLA 2YV0X 1YTUA 4K8ZA 2XO7A 3KD5E 3ITHA 3S3OA 1YT3A 2FBTA 4LSLA 4C8OA 4FJKA 4CEBA 1Z25A 4O55A 4HTUA 1X1PA 1VSMA 1KSPA 2X6SA 4J2DA 4BDZA 3K5NA
chains in the Genus database with same CATH superfamily
4CHQA 1S1TA 4RG8A 4B3OA 4CZHA 5D3GA 5AQFA 1DLOA 4BDPA 1KFSA 4DU1A 3M8PA 1Q81O 4BACA 4IZ9A 1QVFM 4JI2K 1LCUA 3OYEA 2G8KA 3NF6A 1HMVA 1XUPO 1W97L 1FJGK 2E20A 1BA1A 1ZBIA 3OYJA 5KPTA 3CM5A 1ZC6A 2YHWA 3K0SA 3ZSRA 3FLCO 1U2VA 4CJKA 2A1SA 1IH7A 2YNGA 4I6MA 2HNZA 2VCPA 5M1KA 1QSLA 4KHNA 1RT1A 4JI6K 4E7IA 2P9PA 2OTLN 3KD1E 1MU2A 1Q86O 1N8RO 4JK8A 3TARA 2O8DB 3IAYA 1B9DA 1LWFA 1WBBA 3M8SA 3SPYA 4H0YB 1RTJA 4WFBL 4DSKA 4PL7A 2HMPA 2FF6A 1RDDA 1QS4A 1IBLK 4B9MA 2HBLA 3K2PA 1KTQA 3P5JA 3MK6A 3K9JA 4FWPA 3OYAA 2ZM6K 3K58A 1L3VA 3WQUA 1IKYA 1NWKA 4NLBA 4JKAA 1R59O 4CJ4A 1XNQK 3CM6A 3VQPA 2P9IA 3SMSA 3OYLA 1OH8A 4LD0A 1RBRA 3KVGA 3AVMA 1K8AO 4HCCA 3CYMA 3HZ6A 2DPNA 2KZMA 4DTOA 4JI7K 3RTVA 2OYQA 2YCHA 4IJAA 5AQRA 5DM7L 3NF7A 2HBMA 3ZETA 2E6MA 2UXDK 3LALA 3L3VA 5AQMA 5BREA 2VQEK 3DLLL 4CK3A 5AZJA 2YJFA 4BREA 4H0VB 5JLHA 2NRZA 2QKBA 1HYZA 5HRPA 3B8AX 4YDUA 4JKGB 5LL6Z 4H0OA 4CJEA 3SCXA 3CQYA 2W42A 4C1NK 3QNNA 3I56N 1NNEA 2UXBK 1J54A 4MO5A 4ELVA 3HO1A 1VRUA 4C8LA 2UXCK 2OTJN 3EZ5A 4B9VA 3SUOA 3RMCA 4AHSA 3KK3A 2D1KA 3CMEN 4M7XA 1ASUA 1VHXA 4HTLA 3E66A 3VQ6A 4LC9B 2HB5A 3IG1A 5BPLA 3UIQA 1HNXK 4CEQA 1CZ9A 1NK8A 1N32K 5FPDA 1VSKA 4M3WA 3SJJA 3WNEA 2P9UA 4JS5A 4DFKA 1CZAN 4IBNA 2Q97A 4M3TA 4M42A 2DY4A 2O8FA 1JLQA 2OZMA 3HVTA 1YHQN 4LH4A 4JRPA 1JLGA 1XC9A 4BG9A 3KKSA 5I42A 1B9FA 2HBJA 3SLCA 4DS4A 3QO9A 2P9NA 1RGIA 3OYFA 4GV9A 3LAKA 3F73A 4IDKA 3CHWA 1WSFA 3THWB 4JI5K 4JAXA 3Q7BA 1SQKA 4CK2A 2A3ZA 3WXIA 3KWGA 3VF4A 4B9LA 2D4WA 2W6LA 1HLUA 3ZYYX 2WONA 3S41A 4FWMA 5EVZA 3O4WA 2EWSA 3SBGA 3AARA 4DTJA 1BGXT 1JLCA 5GIOA 3THVA 3OY9A 1T6DA 1JL1A 4DSLA 3ZT4A 2NRRA 1D9DA 3J80O 1RT5A 3VQ9A 4BRCA 3LDNA 4ELUA 3SUQA 1NGEA 1QE1A 4CJSA 3E9PA 2Y1IA 3JS6A 5M1NA 3QESA 3ENOA 3ZT2A 2E1ZA 3R9PA 4Z94A 4KAZA 4DQRA 3THYA 5LMUK 3ZLJA 1SL0A 5AQQA 2ZJQL 3IS9A 3OTOK 2WTUA 4DV2K 4N56A 3RRHA 4CVNE 4QS9A 2X78A 4AF1A 3LDOA 4FLTA 2FSJA 3TABA 1JLFA 3V6DA 3KK2A 3UKRA 3VF2A 1RBTA 4E1NA 4DTNA 1HQEA 5AQLA 2FBYA 3S3MA 1U45A 3DOLA 4DUZK 1JLBA 4H5TA 2YHBA 3F2KA 2ZE2A 4RW9A 3VA3A 2BANA 4AQYK 4N41A 3LAMA 3BEXA 4MFBA 5BR8K 1T03A 4ZTJA 2GX9A 3GG4A 2DFHA 4YOWA 3TR8A 1TL3A 4I6MB 1VSJA 1HKBA 1VQ4N 3T19A 5FRNA 5ELZA 4M3RA 2P9PB 3TPQA 1HJRA 1UAXA 4H5NA 1Q9YA 4KI6A 3F9KA 1NOZA 2QI2A 4KHQA 3CC4N 4BR2A 1BIZA 3UKUA 3W3DA 3TAPA 1SS6A 3AAQA 3BDPA 4RW6A 4MLEA 3NGZA 4WQ5A 4O5FA 4CJUA 3DLHA 1S6PA 3L0QA 2VGNA 1Q8IA 3LDQA 3J7YP 5C42A 3IFRA 3KLIA 3CCEN 3PSFA 3O1BA 4CECA 3HYFA 2OCEA 3LP2A 4LFBK 1HQUA 3AY9A 4CJQA 3CFOA 4CIFA 2P9IB 4JI0K 4NCAA 3L2RA 2VG5A 2GTDA 4RCHA 3R3LA 3D2EB 1NJYA 1NK4A 1D8YA 2BUPA 2RN2A 4BRIA 1Z6RA 2D0OA 3ZETB 1TK5A 3AGKA 3D6RA 1VQPN 3WQTA 3QETA 2QEXN 3C65A 3ZSWA 2GELA 5AQGA 3OYCA 5C2DA 1T8EA 4OJRA 3QEWA 3T3FA 5AZJB 2V52B 4CEFA 1KLNA 2QWOA 1LAVA 2EHGA 5JS1A 1BQNA 4F2RA 4CIEA 4C8MA 1FKOA 1X3MA 1SL2A 3O3FA 4PUOA 1TUUA 4CEOA 5J2PA 4OLBA 4FCYA 3C94A 2X6NA 4WCEL 4B9UA 3SQ4A 1T05A 5KPZA 3AA2A 1WAFA 1SUQA 2CH5A 2NRXA 1RDWX 5BN8A 5AQVA 5BRDA 3TAEA 3AO4A 5CZ2A 1P8ZA 4DCHA 4MQ3A 1S6QA 4BQLA 4M41A 4CW7B 3SK3A 4YOUA 4CJTA 2D0PA 1WSHA 2P9UB 3SQ0A 4NB4A 3AVAA 3O9UA 2KZZA 4DSFA 1NJZA 1RDUA 4CFAA 2E88A 1S5JA 1BDGA 3AVBA 3L4IA 3DRSA 2GV9A 3D0PA 2CGKA 3C95A 4PA1A 4AHCA 2FBXA 1S3XA 3Q7CA 1YJNN 4FJ9A 1ZBUA 3ALYA 3M8QA 3ID8A 1NK5A 3U8XA 3ZSYA 3ULDA 2KFNA 3MCPA 3HVRA 5CZ1A 3UE5A 3A5LC 3L3UA 3NFAA 3NH1A 3MXJA 5CHIA 3AVGA 3O9SA 3HL8A 5F2RA 2QWMA 4FLUA 3HM8A 3DJCA 4JRQA 2PY5A 4BC5A 3OS0A 3S9HA 5BN9A 1QSYA 4PQUA 4BGAA 2PZSA 1NGJA 3QERA 4LF5K 1GOAA 3RVCA 1VSLA 2YV0X 4K8ZA 3KD5E 4J8FA 3CCMN 1WBDA 5BRFA 2FBTA 4LSLA 4C8OA 1Z25A 4O55A 3A0IX 4CZFA 4BRQA 4YOTA 3C7NA 4BR0A 3SBTA 3CCJN 3AO1A 4CHNA 4CFDA 2PYJA 5AJ3K 5J2QA 5FPNA 1NU0A 3O9QA 1NOYA 4KI4A 4O5BA 1KFDA 1LWCA 1J5EK 1WSIA 5GIPA 1IG9A 3TSPA 2KHOA 1HUXA 1TAUA 4OKJA 1KXPA 4KHWA 3CG7A 3HOTA 3HSCA 1A5WA 1LW2A 2P9LB 2KLAA 4CESA 3V9WA 1IBKK 5DM6L 1VQ5N 1YI2N 2E5LK 5M1OA 4JN4A 3KLHA 3UKRB 4CHOA 2WC9A 1YUWA 5KRTA 3CF5L 1EETA 2E6LA 3DM2A 4UQGA 5BPMA 3AVHA 2Y1JA 1VQNN 1YF5L 3MEGA 3DWLA 4AHUA 4BC4A 5AQYA 4DG1A 4FW1A 4CJRA 4G9ZA 4OPAA 3SAHA 3O9TA 1I39A 3AO5A 4O0IA 3U9DA 1YJWN 3L4QA 3QEIA 4KTWA 3CXCM 1WAJA 4KV8A 4CK1A 1ZBHA 3TU5A 4HCBA 2A40A 4JKDA 4HUGA 4JI8K 2IC3A 2BTFA 3BP8A 3DMJA 4CJ5A 3UKUB 1C0GA 3MECA 4UY8O 1WSGA 4MLHA 3MN9A 4BR9A 2G8IA 3VF6A 4ELTA 3AO3A 1GLFO 4FLZA 1QZ5A 4I9QA 3J7ZO 4AH9A 3THXA 3AVCA 4FW2A 3SJHA 4JEPA 1OVYA 1TUYA 1SKRA 3T1HK 1WNSA 1HJOA 1Y64A 4DR7K 2DTUA 4ILHA 1L3SA 4CGHA 4I2QA 4NYNA 4K42A 2Q2RA 5CE3A 4LF4K 4B1WB 4DLEA 4YDUC 1RT7A 3EY1A 4KHSA 4YOVA 4LF6K 1NMDA 3VERA 3LL3A 4OVLA 4DWIA 4EZ9A 3L8BA 3HPOA 1WB9A 3BZKA 4BRPA 2HHHK 2O8EA 4KREA 3E9LA 3AVNA 3ENBA 1NGBA 1S9EA 4YOXA 3OYMA 4KH4A 2QA4N 1QHAA 4X66K 3M6GA 1W2BM 3PV8A 4PHTX 3NAEA 2XY6A 3G10A 1C0UA 1IG8A 2KFZA 4BRMA 4F4KA 4XH4A 3CETA 4M63C 1C1AA 4BRLA 3FGUA 4CD3A 2GUPA 1NM1A 1OH5A 3I0RA 4W5NA 2IVOA 5JLFA 1N33K 3QLHA 5AQPA 3QIOA 4A5AA 3DXKA 4KRFA 2JLEA 3KK7A 3SMPA 3LP1A 3CJ1A 3QFPA 2QTDA 2E2OA 4C8KA 3EYZA 5AQNA 4M3ZA 5FLXO 4IOCL 1EWRA 5HRRA 4FJJA 3CJBA 4WQ4A 4JKBA 1XMQK 3KKRA 2WFBA 3OHRA 1K9MO 1QQOA 1GLEG 4Q0BA 5FPMA 2IS3A 2IGIA 2CGJA 5HBMA 4B1UB 1NK9A 4ILGB 5C2FA 2FBVA 1VQMN 4E7LA 3HK2A 2J4RA 5IWAK 4WF9L 2F9WA 3VEWA 2ZJRL 3MEEA 3VQDA 2I7PA 2A5XA 1SKSA 3V4IA 3AO2A 2HBKA 3TAFA 4E7KA 4FYDA 2B6AA 4JKCA 5EX5A 1BG3A 3V9UA 3HPHA 5AQXA 1GLBG 3OYNA 4BWMA 5FRMA 3PLAA 4AM7A 3MX2A 2QXLA 1NK7A 1HNIA 4JYAK 4CEDA 3WNFA 3G6EN 3C6AA 3MN7A 4B3TK 3D2EA 5GAGP 3KWIA 1GLLO 4WFNL 5AZIA 2V51B 3EKUA 5KQ8A 3NHGA 5KGXA 4IJNA 3DLBA 4DSIA 4KHYA 2HHTA 3NF8A 3TAMA 3PO5A 4IO9L 3C7NB 2F8SA 4B3RK 4X65K 3NVKA 4CZLA 3AA5X 2PFUA 2H3GX 2BDPA 1HX1A 2Q36A 3EKSA 1XNRK 2Q3SA 2Z1JA 2YHXA 5AQJA 4H8KA 2F96A 4OGEA 3FZHA 2QKKA 2QWLA 2YI1A 1U47A 1YTAA 1K73O 3SAFA 1ZYQA 3WUHA 3VQ7A 1XQSC 3VQAA 3CIPA 3ID6A 1EO1A 2W41A 4IO8A 5LY3A 2YNHA 4BR5A 4DR1K 4DU3A 4FM2A 1BO5O 3MN5A 3NH0A 5C12A 1SAZA 3QB0A 4FL9A 5B8HA 1Q7YO 3MMVA 2RKIA 3SUNA 3MWPA 3VEYA 4OPJA 3M8RA 3VEVA 3HJFA 4B9TA 4WQ5C 1RFQA 3H3OB 4L8RB 4BR7A 2Z1GA 5HOOA 4IWVA 4JK9A 3VQ5A 3I8DA 4CE9A 2HHXA 4XH5A 1NJWA 2A6AA 4QS7A 1QVGM 3NMUA 1UWBA 1WSJA 4FVUA 2KKZA 1HPMA 3O80A 2HHVA 3CJCA 1J9AA 4BGBA 5J2NA 4JK7A 2XRIA 2E8AA 3RWUA 3TTCA 3SZ2A 4F2SA 1S1VA 2F9TA 3FFIA 3THXB 2HSTA 3C6UA 3NH2A 4BE2A 4FJ5A 1I3AA 1TKDA 1IKXA 4Z4FA 1X3NA 4O44A 4Y0WA 4CEAA 4GKJK 4A62A 4DF8A 2E2PA 3VTHA 3L2UA 4CGIA 4GY2B 5LJWA 4M45A 2NRVA 4BVPA 3P1GA 1L3UA 3HT3A 4NXNK 4IDHA 4B1YB 1CXUA 1GLCG 5K14A 1BL3A 1U49A 2AJQA 1EP4A 2O8EB 5SZTA 3O3HA 1VAZA 3BZCA 3DRRA 4EP5A 4LH5A 4OGCA 4DR2K 3O4QA 1C1BA 2QWRA 2P9LA 1NG9A 2VGMA 1BHLA 4B08A 1RDCA 4KKOA 1VQKN 1IO2A 4OLAA 3KJVA 3DRPA 4IFVA 2IOCA 1NGAA 4HUEA 4AILC 3DXKB 2D0CA 1NGIA 1X9MA 4CGFA 4EIAA 5FROA 1SL1A 3GOIA 4FLVA 5KI6A 3VGMA 3WXLA 4FJLA 1VK0A 3R8EA 2IVPA 1JJ2M 3QEXA 3IRXA 3OJSA 3L2WA 3G71N 4MDBA 3V9ZA 2Z1IA 4C8NA 4DTSA 3O3GA 2B5JA 1G15A 4A57A 5AQHA 1C0FA 2E4LA 3NBPA 4PY5A 2JWKA 2V7ZA 3EZWA 3OVNA 3V1OA 4U67L 1TGOA 2HNDA 3T69A 1NK6A 4CF2A 3J81O 4CJ7A 4X64K 4GKKK 3ITHA 3WXMB 3S3OA 2O8CB 4CEBA 3VGKA 1VSMA 4J2DA 4BDZA 3K5NA 5EOYA 1YAGA 5HRSA 3CPWM 1NLVA 5A2QO 5GAEP 4PKGA 4FZZA 2HNYA 4IFEA 3PIOL 5AQZA 5M1FA 3L6QA 5BPNA 1C1CA 3K59A 2VG6A 5AZIB 4Z4GA 4EP4A 3BY5A 1WLJA 2NRWA 4WYBA 5E26A 4ISGA 3C6TA 4F3TA 1HRHA 4CHYA 4IEIA 4NCGA 1O1WA 5HRNA 2GWJA 4XH1A 4B9SA 4WFAL 4E7JA 3CCRN 1N34K 2JWLA 1G99A 2GUIA 4FM1A 2NZTA 4EAHD 1W9HA 1RILA 4KBOA 4JS4A 3O9RA 4Z4CA 3P39A 4B3SK 1VSDA 2A42A 2G8FA 3WT0A 3B6PA 3CERA 4CF8A 4O0JA 1EX4A 3NGYA 2F4VK 1BU6O 4YHHK 3IMXA 3RMBA 3CC7N 3ULEB 2P5GA 2P1JA 1NGCA 5E41A 4I7FA 2FF3B 2X74A 3CJ9A 4B9QA 1FW6A 4JKHA 2CGLA 4BRNA 1C6VA 4CJWA 1TL1A 3HP6A 3F5TA 1D4XA 4FWRA 4AHTA 1JCEA 3HTVA 4DV0K 4DTRA 4Z4EA 4HWIA 1H1VA 1JCFA 4DQQA 1TYQA 5LMNK 4ZHRA 1K6YA 3SQ1A 3QICA 3RMAA 1OH7A 2FXUA 4ID1A 1P90A 4N47A 1J5OA 2DFFA 1RTDA 1KC8O 3SNNA 4GNIA 4ISEA 4DQ8A 4BQZA 3ASMA 1ATNA 1O13A 4K41A 4CZJA 3V1RA 1S1WA 3KZBA 2YJEA 2AP1A 3I8BA 4DQSA 1GLAG 2YHAA 5CY4A 4DUYK 3AAPA 3PX6A 3OYHA 1UA0A 4OO1J 3EE9A 3DLKA 3IUCA 1NGHA 1SKWA 1EWQA 2OPSA 3NVMA 4EHUA 1NKCA 4DFMA 2GBZA 2FSNA 1D9FA 4LF7K 4C1NI 4FLYA 3FR0A 1J53A 4YFUA 1FKPA 5H1SQ 3LP0A 3KK1A 2O8BB 3ATUA 3MAQA 3AVLA 3BGRA 2ZD1A 1X9WA 4JHDA 3CQ8A 1RBUA 2ITMA 2UYTA 4JD2A 4DTMA 2W6KA 1BUPA 3U6FA 3ENHA 5HL7L 4LFAK 4PKIA 5MLCQ 4FJGA 2QK9A 4FOEA 1BI4A 1ASWA 1SZ2A 1Z05A 1X9JA 2P51A 3DLGA 4WQ4C 3DAWA 2O4IA 5I9EB 3AV9A 1RBSA 1EKEA 3QBWA 2OANA 5CYQA 4CZMA 1MWMA 5J1EA 1S1UA 3CJ7A 4DMNA 5AQIA 3WEEA 2ASMA 2F8TA 1WOQA 1L5UA 1S72N 3MXMA 3VEXA 1ILYA 1DEJA 4OKKA 3G0ZA 5FDLA 4BR4A 4KTQA 3OYIA 1JCGA 1QZ6A 2BH1A 2OA8A 4NCBA 3K5LA 2NNWA 3ZX2A 4BRKA 1RDAA 4CI6A 3ZX0A 1RT3A 4DTUA 4CF9A 2NLXA 3TANA 2UU9K 3U9ZA 4CF1A 4J2AA 1WUAA 5F1XA 3A2FA 3SV3A 1EQYA 4FWOA 2GEMA 5HP1A 4Y1CA 1K8KA 3VEZA 3LDPA 4DSEA 2QXFA 4BRDA 2Q1NA 4DU4A 4ZTFA 3QBXA 3KHYA 3U3YA 4YNQA 5J2MA 4RW4A 5FPEA 1B92A 3AVIA 4IOXA 1XI1A 1TK8A 2YNFA 1KCFA 2ASPA 1NJXA 3FZMA 4NO7A 1RT6A 4M3UA 3OS2A 3R1XA 3TI0A 1NGDA 1XC3A 3CMAN 4O4GA 4E1MA 2VWBA 3D2FB 3IKMA 3LZJA 3M1FA 5M1QA 3RSEA 4BRFA 3O4NA 3W0LA 4DV7K 5KRSA 2UUAK 1GLDG 4DTXA 3LANA 1TAQA 3PX0A 4RW8A 3HM9A 3WNHA 4KH5A 5AQTA 3EEQA 3AA4A 3A5OC 3BF3A 1YITN 1LW0A 2RPIA 3MWTA 1KQSM 4LF9K 3VTIA 3HXMA 4DS5A 5JMVA 4E1JA 3TTFA 3KLFA 1RT4A 1HNVA 5AR0A 4Z4IA 4IFYA 1NJIO 4E3SA 4FM0A 4H0TB 3VENA 3TSUA 4X62K 3ZT3A 4W5OA 1F21A 3M3ZA 1QSSA 1QQCA 2XHBA 4DQIA 2HF4A 3GE1A 4IG0A 3VQEA 2Z1HA 3EL2A 2YKNA 2ZGYA 1V4TA 1LV5A 1YVUA 4N76A 4A2BA 4BVOA 1RT2A 1TYQB 1BQMA 3O1WA 4ID5A 5C0YA 2HW3A 3JXUA 4O8KA 4OPKA 3CCUN 5C15A 4C23A 1X9SA 3CC2N 4TSXA 1A5XA 3ZSVA 3SV4A 2EX3A 5HROA 3O6WA 4GW6A 4GMJB 1VQ9N 4K8XA 1MA9B 3R6MA 3H6EA 1NBWA 3I55N 2O8CA 1GOCA 3H46O 4B8AB 1TV6A 4K43A 4BC2A 2HHUA 1E4GT 2G8HA 2FC0A 3E1YA 2UUBK 5AQWA 3CFPA 4FWLA 3KIOA 1Z26A 2ZJPL 3QINA 1BCMA 4KHPK 2ASOA 2G8WA 1XHXA 5EXWA 2UUCK 4LF8K 4FWSA 3O8MA 2D0BA 1IBMK 2NUBA 4CBXA 4KTZA 2OPQA 4FZXC 3A8YA 4N5SA 4H4MA 4G1QA 3F9MA 3WNGA 4FPBA 3NGIA 3CI5A 4JHDB 1C0TA 2F7TA 3VQCA 2KQ2A 2XY5A 2ZGZA 3L2VA 2ETJA 4R79A 3MXIA 4JD2B 3CCVN 2RF2A 3DLEA 4I2PA 2RHKA 4NXMK 1TK0A 4QS8A 3K5MA 4E7HA 3EN9A 1BI4B 4DV6K 4H0XB 3QEPA 4CZIA 1XWLA 4RW7A 4BRAA 1DTQA 1GLJO 3OW2M 1NMNA 3O5BA 1U6ZA 1VSFA 3ULEA 3DI6A 4CHPA 3LM9A 1Q9XA 1BCOA 3VPZA 3WEEB 3MN6A 4CHZA 3SI6A 1ATRA 5KGWA 5JVGL 3E9OA 1MWKA 3HI0A 1RNHA 4DLGA 4HUFA 1OKJA 3M5RA 4YY3K 2LSNA 1HYVA 1TKXA 2NRTA 1KAYA 1KAXA 4GVMA 1HR0K 2XO7A 4FWQA 1YT3A 3H3NO 4BRGA 3UB5A 4HTUA 1X1PA 2X6SA 5IT9O 1IV0A 4CD1A 3SYZA 3V9SA 1SV5A 4BRHA 4FJMA 4BY9C 2QWNA 1DT9A 4FJ7A 3EO3A 3N4PA 3QIPA 4CEZA 3CCQN 2BE2A 4CZGA 5ADXA 3I0SA 1K8KB 2YKMA 3MCAB 4J2BA 3DYAA 3L2QA 2KTQA 1QQMA 5CR4A 3N4QA 4E19A 3JAMO 3GBTA 3CCSN 3J8AA 4CBWA 4DV5K 4ISFA 4LFCK 3PSIA 2P9SA 4H03B 4J2EA 3NE6A 4Y1DA 1TKTA 1VSHA 4AM6A 5AFUA 4DFJA 2A1RA 3HOSA 2PAVA 3T7ZA 5JS2A 3HP9A 1RTIA 4GVEA 2O8BA 3ISNC 3RSEB 2Q31A 4BE0A 1VQLN 1I94K 4JKFA 5AQSA 1N6QA 3O08A 5AQOA 3OBWA 4FLXA 3A5NC 5TKWA 1XHZA 4FJ8A 4H0PA 3K57A 4FSVA 2RE2A 2ZQBA 1HNWK 4FK2A 3NF9A 1NGGA 4M3YA 3RR8A 3AA3A 4KO0A 3OJUA 3BUZB 4U7BA 4H5WA 4PL8A 3LPUA 3OS1A 2HHQA 1YJ9N 4W5TA 2V7YA 1Q18A 2PYLA 5KTQA 4FWNA 3LDLA 3DXMB 4FJIA 1NKEA 3J7AP 4LY7A 3CPEA 1TKZA 3AVJA 1CZBA 2E2QA 1ATSA 3LZIA 3G4SN 2IIRA 4B1XB 4CJPA 1UA1A 1TVRA 3LPTA 4OPHA 1IKVA 3OA9A 2IDOA 3V1QA 1ITGA 3QEVA 2IVNA 1EXQA 4IKFA 3CQXA 4QAGA 3K5OA 5AQKA 1NGFA 4BC3A 3OYGA 4KHUA 3U3GA 3LWLA 4BG8A 3GL1A 5C25A 3ZT0A 2P9KA 5C24A 4CGJA 5JVHL 1M1KO 4CCHA 4KB0A 3HPGA 4A2AA 3ZEUA 2E1YA 3K9KA 4FZYA 1U2VB 4E0DA 2QWQA 4H5VA 5LJVA 4XIUA 1RCHA 3MX5A 1N36K 3LM2A 3DOKA 4CERA 2ZWHA 3ZCMA 4DV4K 4CFBA 4AHRA 2YX6A 1LOTB 3T1AA 3IDHA 2CH6A 3C0BA 4JI1K 3FZLA 5AQUA 3U4LA 3RR7A 3VQBA 4KFBA 1ZXOA 4YOYA 4Z0UA 3AVFA 1YVNA 3LP3A 4CZKA 1C0MA 2D5RA 4DF4A 3VMFB 4CJLA 4HHTA 4EZ6A 2OPRA 3P31A 4FK4A 5BRHA 1NKBA 3MEDA 4KH6A 3AVKA 4A5BA 1HYSA 3D2FA 3SAGA 2VYPA 4FJHA 4FJNA 1JXEA 2G8UA 4M3XA 1QHTA 2E2NA 4K25A 3VQ8A 5TKYA 3RMDA 4XEIA 4ILJA 4DFPA 1T6CA 3PX4A 1N5YA 2QM1A 3DLRA 5C10A 2ITGA 4RWTA 1YIJN 1HPZA 1RTHA 4MO4A 2OZSA 4V19S 3H45C 5GINA 1ZBSA 1VSIA 4JLHA 3PUFA 3OBYA 5M1PA 3HBTA 3FFKB 1E4FT 1XMOK 2IAJA 3OYKA 2GWKA 4GV3A 1BIUA 2G8VA 4F8RA 3SUPA 2KW4A 3KLEA 3BF1A 4LSNA 4FWKA 3VN5A 3TWHA 3ATVA 3I33A 1LAWA 3E01A 3JYTA 4QCLA 1YXQA 2ATQA 5SWMA 1VRTA 3SQ2A 3ZSXA 1ZBLA 4RTFD 1FXXA 3FZFA 4B1ZA 3TAQA 4CJFA 3ZSQA 1QTMA 4JKEA 4B1VA 4QOZB 2HVHA 1VQ8N 3GDQA 3FE1A 2XY8A 3H08A 3AGRA 1LWEA 5KQDA 2BGGA 5E84A 4IXCA 1HKCA 2YHYA 3VETA 3NCIA 3MDQA 3KLGA 2HVIA 1UOCA 4BROA 3ZX3A 1VQ7N 3ZSOA 1BISA 4DSJA 2Q0RA 1VQ6N 1KAZA 4PWDA 4CFCA 3QNOA 4KB1A 1BWFO 3OYDA 1IJJA 4F9OA 1ASVA 1JL2A 3CFRA 2O8FB 4EFHA 3VA0A 1D5AA 3D7EO 2VWKA 2WOMA 1S22A 3QMLA 2O8DA 2OPPA 2HHWA 2R7YA 2DFEA 4W5RA 2P9NB 5KPRA 2HOEA 1ZBFA 2P9SB 5CYMA 1R0AA 3QDKA 4PKHA 3C6HA 4DB3A 1WN7A 1T3VA 4DR4K 4ICLA 4L3QA 4H5RA 4W5QA 4NLCA 3ZT1A 4CGGA 5I3UA 1RDBA 5ADXH 2I5JA 2XY7A 1RBVA 2QW9A 1KVBA 4I9LA 4CJVA 2PBDA 3H1VX 5T7BA 2WBNA 3P4IA 4B8CA 4DQPA 1NK0A 4E89A 3TSQA 3S3NA 3RRGA 3WXKA 1WSEA 5AFUH 4A59A 3HSTB 5JICA 5GAHP 1Y97A 5GADP 4BE1A 4JNEA 1GOBA 1L3TA 1Q82O 1OH6A 1KD1O 3CD6N 3T1YK 3V81A 4FJXA 4K0KK 3THYB 4JI4K 4FVMA 2FLOA 3D45A 3SPZA 4IEEA 4DTPA 2D0AA 1DGKN 3P83D 3FZKA 3OYBA 1S9GA 3VEOA 4JKGA 2I7NA 4OKEA 1KVCA 1T7PA 4YORA 2HMIA 3NDKA 1ESVA 4FOIA 1FK9A 1REVA 3WXJA 5F0XA 2P5OA 1JKHA 5EY4A 4AHVA 2HF3A 4WE1A 4H4OA 5EU7A 1W7AA 1IKWA 2JGUA 2P9KB 1HNZK 1QQNA 4F3OA 4DV3K 3LDSA 5HLFA 2O4GA 1U48A 4BDYA 2Q0UA 4R5PA 2VWJA 1CXQA 3P38A 3VOVA 4Z4HA 4DHYA 1S1XA 3G25A 3TAGA 3ZEUB 4FLWA 2YNIA 4DV1K 4BWJA 1KLMA 2WUSA 1W0HA 4CEEA 4CF0A 3CCLN 3LWMA 4FO0A 4A61A 4O8UA 1U4BA 3PIPL 4DR5K 2VG7A 4M7YA 3B6OA 4KPYA 1J6ZA 1M90O 4CBUA 4FK0A 1HKGA 1VQON 4JV5K 1BOTO 3THWA 1KVAA 3H1QA 4DR6K 4IG3A 4JI3K 2W40A 3VESA 3PY8A 1U04A 1DTTA 3VQ4A 5DMRA 4CZEA 2QWPA 4Q5VA 1E3MA 4DR3K 3TTDA 2HHSA 3A5MC 3ZSZA 4NYFA 4IOAL 4EHTA 3EE8A 4CIGA 1V4SA 3PO4A 5BR9A 4MDAA 3HRGA 4DKWA 2AA4A 2A41A 1OVQA 1T44A 4FPAA 2ZF5O 1CLQA 1A5VA 4B3MK 4OX9K 1JLEA 3QFUA 3CJAA 4GV6A 2VQFK 5DK5A 4CJ3A 1VSEA 2B4JA 1BA0A 1DKGD 1JLAA 3VQQA 1KRPA 4HVJA 3KTQA 1JXBA 4FXDA 4CGDA 4B9NA 3V9XA 3JSMA 3DXMA 1YTUA 2NRHA 4FJKA 2FSKA 3VGLA 1MDUB 1KSPA
chains in the Genus database with same CATH topology
4CHQA 3SYZA 1S1TA 3V9SA 4RG8A 5HRSA 4B3OA 1SV5A 3AO1A 4CHNA 4CFDA 2PYJA 4FJMA 5D3GA 1DLOA 5J2QA 4BDPA 1KFSA 4DU1A 3M8PA 4BACA 4FJ7A 1NOYA 4FZZA 2HNYA 3OYEA 4O5BA 4KI4A 3QIPA 4CEZA 1KFDA 2BE2A 2G8KA 1LWCA 3NF6A 1WSIA 3I0SA 1IG9A 1C1CA 1HMVA 3K59A 2YKMA 2VG6A 1TAUA 4Z4GA 4J2BA 4OKJA 3DYAA 3L2QA 4EP4A 3CG7A 4KHWA 2KTQA 1A5WA 1LW2A 1WLJA 1ZBIA 4E19A 3OYJA 3CM5A 3C6TA 4F3TA 4CESA 3V9WA 1HRHA 4CHYA 3ZSRA 4CJKA 4NCGA 2A1SA 1O1WA 4J2EA 5HRNA 3NE6A 1IH7A 3KLHA 4B9SA 4Y1DA 1TKTA 1VSHA 4E7JA 4CHOA 2YNGA 4DFJA 2A1RA 2HNZA 1QSLA 2GUIA 4KHNA 1RT1A 4E7IA 5KRTA 5JS2A 4FM1A 3HP9A 1EETA 2E6LA 1RTIA 3KD1E 1MU2A 1W9HA 3ISNC 1RILA 3DM2A 4UQGA 4BE0A 4JS4A 3AVHA 4Z4CA 2Y1JA 1VSDA 3MEGA 2G8FA 3TARA 4AHUA 3B6PA 3IAYA 1B9DA 1LWFA 4CF8A 3M8SA 4DG1A 4O0JA 1EX4A 3SPYA 3NGYA 4FW1A 1N6QA 1RTJA 4CJRA 4DSKA 3RMBA 2P5GA 4FLXA 2P1JA 1XHZA 5E41A 1RDDA 1I39A 3AO5A 4O0IA 1QS4A 4FJ8A 4I7FA 2X74A 4B9MA 3K57A 3K2PA 2ZQBA 1KTQA 3P5JA 3QEIA 1C6VA 4KTWA 4FK2A 3NF9A 3OYAA 1WAJA 1TL1A 4CJWA 3K58A 3HP6A 1L3VA 3AA3A 3RR8A 4M3YA 2HHTA 1IKYA 4KO0A 4KV8A 4CK1A 4AHTA 3OJUA 1ZBHA 4HCBA 4HUGA 4CJ4A 4DTRA 3LPUA 2IC3A 3CM6A 3OS1A 4Z4EA 2HHQA 3DMJA 3VQPA 4CJ5A 4W5TA 3OYLA 2PYLA 5KTQA 4LD0A 3MECA 4DQQA 1RBRA 4ZHRA 3AVMA 1WSGA 4HCCA 4FJIA 3CYMA 1NKEA 2KZMA 2G8IA 1K6YA 4LY7A 4DTOA 3RMAA 1TKZA 3AVJA 3RTVA 1CZBA 3SQ1A 2OYQA 3AO3A 4ID1A 4N47A 1J5OA 4ELTA 2DFFA 4FLZA 1RTDA 3NF7A 3LZIA 4I9QA 4CJPA 4AH9A 2E6MA 3SNNA 1UA1A 3AVCA 1TVRA 3LPTA 4FW2A 1IKVA 2IDOA 3ASMA 3V1QA 1ITGA 3QEVA 1SKRA 3LALA 3L3VA 1EXQA 4IKFA 3V1RA 1WNSA 1S1WA 4QAGA 3K5OA 2DTUA 1L3SA 3OYGA 4CGHA 4KHUA 4I2QA 4CK3A 3U3GA 4NYNA 3LWLA 4DQSA 2YHAA 5CY4A 5C25A 3PX6A 3ZT0A 4DLEA 1RT7A 5C24A 3OYHA 1UA0A 3EY1A 4KHSA 2QKBA 3DLKA 1HYZA 4CGJA 5HRPA 1SKWA 2OPSA 4OVLA 4DWIA 4CCHA 4EZ9A 3L8BA 3HPOA 4KB0A 3HPGA 4B9VA 4CJEA 3SCXA 1NKCA 4DFMA 2W42A 4KREA 3QNNA 2GBZA 3AVNA 4FZYA 1J54A 1S9EA 4E0DA 4ELVA 3HO1A 3OYMA 1D9FA 1VRUA 4XIUA 1RCHA 4C8LA 3PV8A 4FLYA 3NAEA 3DOKA 3EZ5A 4CERA 3ZCMA 3SUOA 1J53A 4CFBA 3G10A 1C0UA 4AHRA 4YFUA 4AHSA 2XY6A 3RMCA 3KK3A 1FKPA 2KFZA 4F4KA 3T1AA 3LP0A 3KK1A 1C1AA 3MAQA 3RR7A 1ASUA 3VQ6A 3VQBA 4KFBA 3AVLA 3BGRA 3I0RA 2HB5A 2ZD1A 4Z0UA 3IG1A 3AVFA 3UIQA 3LP3A 4W5NA 4CEQA 1C0MA 2D5RA 1X9WA 1CZ9A 4DF4A 1NK8A 3CQ8A 1RBUA 4M3WA 1VSKA 4CJLA 3SJJA 3QLHA 4HHTA 4EZ6A 3QIOA 3WNEA 4JS5A 4DFKA 2OPRA 4DTMA 4IBNA 4KRFA 4FK4A 1NKBA 4M3TA 2JLEA 4M42A 3U6FA 2DY4A 1JLQA 3MEDA 3AVKA 1HYSA 4FJGA 2QK9A 2OZMA 3LP1A 1BI4A 3HVTA 1ASWA 4FJHA 4FJNA 4LH4A 1JXEA 1JLGA 4JRPA 2P51A 3DLGA 1XC9A 2G8UA 3EYZA 4C8KA 3KKSA 4M3XA 5I42A 1B9FA 1QHTA 3VQ8A 4DS4A 4M3ZA 3QO9A 2O4IA 3AV9A 3OYFA 3RMDA 5HRRA 1RBSA 4FJJA 1EKEA 3LAKA 5CYQA 4DFPA 3F73A 4IDKA 5J1EA 1S1UA 3PX4A 4DMNA 3DLRA 3KKRA 1N5YA 1WSFA 2ITGA 2F8TA 1L5UA 1HPZA 4CK2A 1RTHA 3MXMA 2OZSA 4B9LA 4Q0BA 1VSIA 2IS3A 4OKKA 3G0ZA 2IGIA 5FDLA 4KTQA 4JLHA 3PUFA 2WONA 5HBMA 3OYIA 1NK9A 2FBVA 4E7LA 2OA8A 4NCBA 2IAJA 1BGXT 1JLCA 3OYKA 4DTJA 3THVA 3K5LA 3OY9A 1JL1A 4DSLA 1BIUA 3MEEA 3ZT4A 3VQDA 2G8VA 1D9DA 1RT5A 3VQ9A 1RDAA 1SKSA 3V4IA 3SUPA 4ELUA 2KW4A 3AO2A 4F8RA 3KLEA 3TAFA 3SUQA 1RT3A 4LSNA 1QE1A 4E7KA 4CJSA 4FYDA 2B6AA 4CF9A 4DTUA 2Y1IA 3VN5A 3TWHA 3QESA 3V9UA 3HPHA 1LAWA 3E01A 3TANA 3OYNA 4BWMA 5FRMA 3ZT2A 3JYTA 4QCLA 2ATQA 5SWMA 1VRTA 3SQ2A 3ZSXA 1HNIA 4CF1A 1ZBLA 1NK7A 4J2AA 4CEDA 1FXXA 3WNFA 3A2FA 3SV3A 4CJFA 3TAQA 4KAZA 4DQRA 3ZSQA 1QTMA 5HP1A 4Y1CA 1SL0A 4DSEA 4QOZB 2HVHA 2QXFA 3IS9A 4DU4A 4ZTFA 3NHGA 5KGXA 2XY8A 3H08A 3U3YA 4YNQA 3DLBA 5J2MA 4DSIA 1LWEA 3NF8A 4RW4A 3TAMA 4N56A 3RRHA 3PO5A 2BGGA 3NCIA 2F8SA 3KLGA 2X78A 2HVIA 3AA5X 1UOCA 2BDPA 1B92A 3AVIA 4FLTA 2Q3SA 1BISA 2Z1JA 3ZSOA 1XI1A 4DSJA 4H8KA 3TABA 1TK8A 1JLFA 2F96A 2YNFA 3V6DA 1KCFA 4CFCA 1NJXA 3QNOA 4KB1A 3KK2A 4PWDA 4OGEA 1RT6A 4M3UA 3OS2A 1RBTA 3OYDA 4E1NA 3TI0A 4DTNA 1ASVA 1JL2A 1HQEA 2FBYA 3S3MA 1U45A 3CFRA 3DOLA 1U47A 2QKKA 1JLBA 1YTAA 4O4GA 2YHBA 1ZYQA 3VQ7A 2ZE2A 4E1MA 3LZJA 3VA0A 3VQAA 1D5AA 2VWKA 2WOMA 3O4NA 5KRSA 4RW9A 4DTXA 3VA3A 2OPPA 2BANA 1TAQA 3LANA 4RW8A 2R7YA 3PX0A 4N41A 2HHWA 3LAMA 2DFEA 3HM9A 2YNHA 4W5RA 3WNHA 4MFBA 4DU3A 4FM2A 4ZTJA 1ZBFA 1T03A 3NH0A 5CYMA 2DFHA 1R0AA 3TR8A 3AA4A 1WN7A 1TL3A 4ICLA 1VSJA 1LW0A 2RPIA 3T19A 5FRNA 2RKIA 3SUNA 4M3RA 4W5QA 3HXMA 4DS5A 1HJRA 1UAXA 3ZT1A 4CGGA 4OPJA 3KLFA 5I3UA 1Q9YA 1RDBA 3F9KA 1RT4A 3M8RA 1NOZA 4KI6A 4KHQA 1HNVA 4Z4IA 2I5JA 4B9TA 4IFYA 3HJFA 2XY7A 3TAPA 1BIZA 1RBVA 4FM0A 4E3SA 3BDPA 1KVBA 4I9LA 3HK2A 3ZT3A 4W5OA 4L8RB 1F21A 4RW6A 2Z1GA 3NGZA 4CJVA 1QSSA 4CJUA 1QQCA 3DLHA 1S6PA 3VQ5A 3I8DA 4CE9A 5T7BA 1Q8IA 2XHBA 4B8CA 4DQPA 4DQIA 5C42A 1NK0A 4IG0A 3VQEA 2Z1HA 4E89A 3KLIA 2HHXA 3S3NA 1NJWA 2YKNA 3RRGA 4CECA 1LV5A 1UWBA 3HYFA 1WSJA 1WSEA 3LP2A 1YVUA 1HQUA 3HSTB 4CJQA 1Y97A 4N76A 4BE1A 3CFOA 1RT2A 4CIFA 1GOBA 1L3TA 4NCAA 2HHVA 1BQMA 4ID5A 1J9AA 5J2NA 3V81A 3L2RA 4FJXA 2VG5A 2HW3A 2XRIA 4FVMA 3D45A 3SZ2A 3RWUA 4OPKA 3SPZA 1NJYA 4DTPA 2D0AA 4F2SA 1NK4A 1S1VA 3P83D 1X9SA 1D8YA 2RN2A 4TSXA 3OYBA 1S9GA 1A5XA 3ZSVA 3SV4A 2EX3A 3FFIA 1TK5A 4OKEA 1KVCA 5HROA 3NH2A 3C6UA 4BE2A 4FJ5A 1I3AA 4GW6A 1T7PA 4GMJB 2HMIA 3NDKA 1TKDA 1IKXA 4K8XA 4Z4FA 1FK9A 4O44A 1REVA 3QETA 4CEAA 2P5OA 3ZSWA 1JKHA 4AHVA 3OYCA 4DF8A 4WE1A 4OJRA 4H4OA 3L2UA 3QEWA 1T8EA 4CGIA 3T3FA 1GOCA 4M45A 4CEFA 5EU7A 1KLNA 4B8AB 1IKWA 2JGUA 1TV6A 3P1GA 1L3UA 1LAVA 4F3OA 2G8HA 4KHYA 2FC0A 3LDSA 2EHGA 3HT3A 2HHUA 5HLFA 2O4GA 1U48A 1CXUA 4BDYA 5K14A 1BL3A 1BQNA 4R5PA 2VWJA 3CFPA 4F2RA 5JS1A 1CXQA 1U49A 2AJQA 1EP4A 3KIOA 4Z4HA 1S1XA 4CIEA 4C8MA 3TAGA 1Z26A 5SZTA 1FKOA 3O3HA 4FLWA 1SL2A 3QINA 2YNIA 3O3FA 1BCMA 1KLMA 4BWJA 4PUOA 2G8WA 1XHXA 1W0HA 3DRRA 4CEEA 4CF0A 4CEOA 4EP5A 4LH5A 5J2PA 4OLBA 4FCYA 4OGCA 3LWMA 3C94A 2X6NA 3O4QA 2D0BA 1C1BA 4B9UA 1U4BA 3SQ4A 2NUBA 1T05A 3AA2A 4KTZA 2OPQA 1WAFA 1SUQA 2VG7A 4FZXC 3B6OA 4N5SA 4H4MA 3TAEA 4G1QA 1BHLA 3AO4A 3WNGA 4B08A 5CZ2A 3NGIA 4KPYA 1C0TA 1RDCA 4MQ3A 4KKOA 1S6QA 3VQCA 1IO2A 2KQ2A 4M41A 2XY5A 3KJVA 4CJTA 4FK0A 4OLAA 3L2VA 1WSHA 2ETJA 3DRPA 2IOCA 4IFVA 4HUEA 1KVAA 4AILC 2D0CA 3MXIA 3SQ0A 2RF2A 3DLEA 3AVAA 4I2PA 4IG3A 1X9MA 3PY8A 4CGFA 1U04A 2KZZA 4DSFA 1TK0A 1DTTA 3VQ4A 5DMRA 3K5MA 4E7HA 5FROA 4CFAA 1NJZA 4Q5VA 1S5JA 1BI4B 3AVBA 3DRSA 2HHSA 2GV9A 3ZSZA 4NYFA 3D0PA 3C95A 4PA1A 1SL1A 3QEPA 4AHCA 1XWLA 2FBXA 4RW7A 1DTQA 4FLVA 5KI6A 4CIGA 4FJ9A 1ZBUA 3PO4A 4FJLA 1VK0A 1VSFA 3ALYA 3M8QA 1NK5A 3ZSYA 3ULDA 3DI6A 4CHPA 2KFNA 3QEXA 3HVRA 5CZ1A 3IRXA 3OJSA 3L2WA 1BCOA 1Q9XA 3L3UA 3NFAA 3NH1A 3V9ZA 3MXJA 4CHZA 2Z1IA 4C8NA 4DTSA 5KGWA 3AVGA 1A5VA 3SI6A 1CLQA 3HL8A 2B5JA 3O3GA 1G15A 1JLEA 2E4LA 4FLUA 3NBPA 4JRQA 2PY5A 4PY5A 5DK5A 4CJ3A 3OS0A 3S9HA 1RNHA 4DLGA 1VSEA 2B4JA 3OVNA 3VQQA 1JLAA 4HUFA 1QSYA 4HVJA 1KRPA 3KTQA 4PQUA 2PZSA 2LSNA 3V1OA 1TGOA 2HNDA 1NK6A 1JXBA 1HYVA 1TKXA 4CGDA 4CF2A 3QERA 1GOAA 4B9NA 4FXDA 3V9XA 3JSMA 4GVMA 1VSLA 2YV0X 1YTUA 4K8ZA 2XO7A 3KD5E 3ITHA 3S3OA 1YT3A 2FBTA 4LSLA 4C8OA 4FJKA 4CEBA 1Z25A 4O55A 4HTUA 1X1PA 1VSMA 1KSPA 2X6SA 4J2DA 4BDZA 3K5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHQ A;  3SYZ A;  1S1T A;  3V9S A;  4RG8 A;  5HRS A;  4B3O A;  1SV5 A;  3AO1 A;  4CHN A;  4CFD A;  2PYJ A;  4FJM A;  5D3G A;  1DLO A;  5J2Q A;  4BDP A;  1KFS A;  4DU1 A;  3M8P A;  4BAC A;  4FJ7 A;  1NOY A;  4FZZ A;  2HNY A;  3OYE A;  4O5B A;  4KI4 A;  3QIP A;  4CEZ A;  1KFD A;  2BE2 A;  2G8K A;  1LWC A;  3NF6 A;  1WSI A;  3I0S A;  1IG9 A;  1C1C A;  1HMV A;  3K59 A;  2YKM A;  2VG6 A;  1TAU A;  4Z4G A;  4J2B A;  4OKJ A;  3DYA A;  3L2Q A;  4EP4 A;  3CG7 A;  4KHW A;  2KTQ A;  1A5W A;  1LW2 A;  1WLJ A;  1ZBI A;  4E19 A;  3OYJ A;  3CM5 A;  3C6T A;  4F3T A;  4CES A;  3V9W A;  1HRH A;  4CHY A;  3ZSR A;  4CJK A;  4NCG A;  2A1S A;  1O1W A;  4J2E A;  5HRN A;  3NE6 A;  1IH7 A;  3KLH A;  4B9S A;  4Y1D A;  1TKT A;  1VSH A;  4E7J A;  4CHO A;  2YNG A;  4DFJ A;  2A1R A;  2HNZ A;  1QSL A;  2GUI A;  4KHN A;  1RT1 A;  4E7I A;  5KRT A;  5JS2 A;  4FM1 A;  3HP9 A;  1EET A;  2E6L A;  1RTI A;  3KD1 E;  1MU2 A;  1W9H A;  3ISN C;  1RIL A;  3DM2 A;  4UQG A;  4BE0 A;  4JS4 A;  3AVH A;  4Z4C A;  2Y1J A;  1VSD A;  3MEG A;  2G8F A;  3TAR A;  4AHU A;  3B6P A;  3IAY A;  1B9D A;  1LWF A;  4CF8 A;  3M8S A;  4DG1 A;  4O0J A;  1EX4 A;  3SPY A;  3NGY A;  4FW1 A;  1N6Q A;  1RTJ A;  4CJR A;  4DSK A;  3RMB A;  2P5G A;  4FLX A;  2P1J A;  1XHZ A;  5E41 A;  1RDD A;  1I39 A;  3AO5 A;  4O0I A;  1QS4 A;  4FJ8 A;  4I7F A;  2X74 A;  4B9M A;  3K57 A;  3K2P A;  2ZQB A;  1KTQ A;  3P5J A;  3QEI A;  1C6V A;  4KTW A;  4FK2 A;  3NF9 A;  3OYA A;  1WAJ A;  1TL1 A;  4CJW A;  3K58 A;  3HP6 A;  1L3V A;  3AA3 A;  3RR8 A;  4M3Y A;  2HHT A;  1IKY A;  4KO0 A;  4KV8 A;  4CK1 A;  4AHT A;  3OJU A;  1ZBH A;  4HCB A;  4HUG A;  4CJ4 A;  4DTR A;  3LPU A;  2IC3 A;  3CM6 A;  3OS1 A;  4Z4E A;  2HHQ A;  3DMJ A;  3VQP A;  4CJ5 A;  4W5T A;  3OYL A;  2PYL A;  5KTQ A;  4LD0 A;  3MEC A;  4DQQ A;  1RBR A;  4ZHR A;  3AVM A;  1WSG A;  4HCC A;  4FJI A;  3CYM A;  1NKE A;  2KZM A;  2G8I A;  1K6Y A;  4LY7 A;  4DTO A;  3RMA A;  1TKZ A;  3AVJ A;  3RTV A;  1CZB A;  3SQ1 A;  2OYQ A;  3AO3 A;  4ID1 A;  4N47 A;  1J5O A;  4ELT A;  2DFF A;  4FLZ A;  1RTD A;  3NF7 A;  3LZI A;  4I9Q A;  4CJP A;  4AH9 A;  2E6M A;  3SNN A;  1UA1 A;  3AVC A;  1TVR A;  3LPT A;  4FW2 A;  1IKV A;  2IDO A;  3ASM A;  3V1Q A;  1ITG A;  3QEV A;  1SKR A;  3LAL A;  3L3V A;  1EXQ A;  4IKF A;  3V1R A;  1WNS A;  1S1W A;  4QAG A;  3K5O A;  2DTU A;  1L3S A;  3OYG A;  4CGH A;  4KHU A;  4I2Q A;  4CK3 A;  3U3G A;  4NYN A;  3LWL A;  4DQS A;  2YHA A;  5CY4 A;  5C25 A;  3PX6 A;  3ZT0 A;  4DLE A;  1RT7 A;  5C24 A;  3OYH A;  1UA0 A;  3EY1 A;  4KHS A;  2QKB A;  3DLK A;  1HYZ A;  4CGJ A;  5HRP A;  1SKW A;  2OPS A;  4OVL A;  4DWI A;  4CCH A;  4EZ9 A;  3L8B A;  3HPO A;  4KB0 A;  3HPG A;  4B9V A;  4CJE A;  3SCX A;  1NKC A;  4DFM A;  2W42 A;  4KRE A;  3QNN A;  2GBZ A;  3AVN A;  4FZY A;  1J54 A;  1S9E A;  4E0D A;  4ELV A;  3HO1 A;  3OYM A;  1D9F A;  1VRU A;  4XIU A;  1RCH A;  4C8L A;  3PV8 A;  4FLY A;  3NAE A;  3DOK A;  3EZ5 A;  4CER A;  3ZCM A;  3SUO A;  1J53 A;  4CFB A;  3G10 A;  1C0U A;  4AHR A;  4YFU A;  4AHS A;  2XY6 A;  3RMC A;  3KK3 A;  1FKP A;  2KFZ A;  4F4K A;  3T1A A;  3LP0 A;  3KK1 A;  1C1A A;  3MAQ A;  3RR7 A;  1ASU A;  3VQ6 A;  3VQB A;  4KFB A;  3AVL A;  3BGR A;  3I0R A;  2HB5 A;  2ZD1 A;  4Z0U A;  3IG1 A;  3AVF A;  3UIQ A;  3LP3 A;  4W5N A;  4CEQ A;  1C0M A;  2D5R A;  1X9W A;  1CZ9 A;  4DF4 A;  1NK8 A;  3CQ8 A;  1RBU A;  4M3W A;  1VSK A;  4CJL A;  3SJJ A;  3QLH A;  4HHT A;  4EZ6 A;  3QIO A;  3WNE A;  4JS5 A;  4DFK A;  2OPR A;  4DTM A;  4IBN A;  4KRF A;  4FK4 A;  1NKB A;  4M3T A;  2JLE A;  4M42 A;  3U6F A;  2DY4 A;  1JLQ A;  3MED A;  3AVK A;  1HYS A;  4FJG A;  2QK9 A;  2OZM A;  3LP1 A;  1BI4 A;  3HVT A;  1ASW A;  4FJH A;  4FJN A;  4LH4 A;  1JXE A;  1JLG A;  4JRP A;  2P51 A;  3DLG A;  1XC9 A;  2G8U A;  3EYZ A;  4C8K A;  3KKS A;  4M3X A;  5I42 A;  1B9F A;  1QHT A;  3VQ8 A;  4DS4 A;  4M3Z A;  3QO9 A;  2O4I A;  3AV9 A;  3OYF A;  3RMD A;  5HRR A;  1RBS A;  4FJJ A;  1EKE A;  3LAK A;  5CYQ A;  4DFP A;  3F73 A;  4IDK A;  5J1E A;  1S1U A;  3PX4 A;  4DMN A;  3DLR A;  3KKR A;  1N5Y A;  1WSF A;  2ITG A;  2F8T A;  1L5U A;  1HPZ A;  4CK2 A;  1RTH A;  3MXM A;  2OZS A;  4B9L A;  4Q0B A;  1VSI A;  2IS3 A;  4OKK A;  3G0Z A;  2IGI A;  5FDL A;  4KTQ A;  4JLH A;  3PUF A;  2WON A;  5HBM A;  3OYI A;  1NK9 A;  2FBV A;  4E7L A;  2OA8 A;  4NCB A;  2IAJ A;  1BGX T;  1JLC A;  3OYK A;  4DTJ A;  3THV A;  3K5L A;  3OY9 A;  1JL1 A;  4DSL A;  1BIU A;  3MEE A;  3ZT4 A;  3VQD A;  2G8V A;  1D9D A;  1RT5 A;  3VQ9 A;  1RDA A;  1SKS A;  3V4I A;  3SUP A;  4ELU A;  2KW4 A;  3AO2 A;  4F8R A;  3KLE A;  3TAF A;  3SUQ A;  1RT3 A;  4LSN A;  1QE1 A;  4E7K A;  4CJS A;  4FYD A;  2B6A A;  4CF9 A;  4DTU A;  2Y1I A;  3VN5 A;  3TWH A;  3QES A;  3V9U A;  3HPH A;  1LAW A;  3E01 A;  3TAN A;  3OYN A;  4BWM A;  5FRM A;  3ZT2 A;  3JYT A;  4QCL A;  2ATQ A;  5SWM A;  1VRT A;  3SQ2 A;  3ZSX A;  1HNI A;  4CF1 A;  1ZBL A;  1NK7 A;  4J2A A;  4CED A;  1FXX A;  3WNF A;  3A2F A;  3SV3 A;  4CJF A;  3TAQ A;  4KAZ A;  4DQR A;  3ZSQ A;  1QTM A;  5HP1 A;  4Y1C A;  1SL0 A;  4DSE A;  4QOZ B;  2HVH A;  2QXF A;  3IS9 A;  4DU4 A;  4ZTF A;  3NHG A;  5KGX A;  2XY8 A;  3H08 A;  3U3Y A;  4YNQ A;  3DLB A;  5J2M A;  4DSI A;  1LWE A;  3NF8 A;  4RW4 A;  3TAM A;  4N56 A;  3RRH A;  3PO5 A;  2BGG A;  3NCI A;  2F8S A;  3KLG A;  2X78 A;  2HVI A;  3AA5 X;  1UOC A;  2BDP A;  1B92 A;  3AVI A;  4FLT A;  2Q3S A;  1BIS A;  2Z1J A;  3ZSO A;  1XI1 A;  4DSJ A;  4H8K A;  3TAB A;  1TK8 A;  1JLF A;  2F96 A;  2YNF A;  3V6D A;  1KCF A;  4CFC A;  1NJX A;  3QNO A;  4KB1 A;  3KK2 A;  4PWD A;  4OGE A;  1RT6 A;  4M3U A;  3OS2 A;  1RBT A;  3OYD A;  4E1N A;  3TI0 A;  4DTN A;  1ASV A;  1JL2 A;  1HQE A;  2FBY A;  3S3M A;  1U45 A;  3CFR A;  3DOL A;  1U47 A;  2QKK A;  1JLB A;  1YTA A;  4O4G A;  2YHB A;  1ZYQ A;  3VQ7 A;  2ZE2 A;  4E1M A;  3LZJ A;  3VA0 A;  3VQA A;  1D5A A;  2VWK A;  2WOM A;  3O4N A;  5KRS A;  4RW9 A;  4DTX A;  3VA3 A;  2OPP A;  2BAN A;  1TAQ A;  3LAN A;  4RW8 A;  2R7Y A;  3PX0 A;  4N41 A;  2HHW A;  3LAM A;  2DFE A;  3HM9 A;  2YNH A;  4W5R A;  3WNH A;  4MFB A;  4DU3 A;  4FM2 A;  4ZTJ A;  1ZBF A;  1T03 A;  3NH0 A;  5CYM A;  2DFH A;  1R0A A;  3TR8 A;  3AA4 A;  1WN7 A;  1TL3 A;  4ICL A;  1VSJ A;  1LW0 A;  2RPI A;  3T19 A;  5FRN A;  2RKI A;  3SUN A;  4M3R A;  4W5Q A;  3HXM A;  4DS5 A;  1HJR A;  1UAX A;  3ZT1 A;  4CGG A;  4OPJ A;  3KLF A;  5I3U A;  1Q9Y A;  1RDB A;  3F9K A;  1RT4 A;  3M8R A;  1NOZ A;  4KI6 A;  4KHQ A;  1HNV A;  4Z4I A;  2I5J A;  4B9T A;  4IFY A;  3HJF A;  2XY7 A;  3TAP A;  1BIZ A;  1RBV A;  4FM0 A;  4E3S A;  3BDP A;  1KVB A;  4I9L A;  3HK2 A;  3ZT3 A;  4W5O A;  4L8R B;  1F21 A;  4RW6 A;  2Z1G A;  3NGZ A;  4CJV A;  1QSS A;  4CJU A;  1QQC A;  3DLH A;  1S6P A;  3VQ5 A;  3I8D A;  4CE9 A;  5T7B A;  1Q8I A;  2XHB A;  4B8C A;  4DQP A;  4DQI A;  5C42 A;  1NK0 A;  4IG0 A;  3VQE A;  2Z1H A;  4E89 A;  3KLI A;  2HHX A;  3S3N A;  1NJW A;  2YKN A;  3RRG A;  4CEC A;  1LV5 A;  1UWB A;  3HYF A;  1WSJ A;  1WSE A;  3LP2 A;  1YVU A;  1HQU A;  3HST B;  4CJQ A;  1Y97 A;  4N76 A;  4BE1 A;  3CFO A;  1RT2 A;  4CIF A;  1GOB A;  1L3T A;  4NCA A;  2HHV A;  1BQM A;  4ID5 A;  1J9A A;  5J2N A;  3V81 A;  3L2R A;  4FJX A;  2VG5 A;  2HW3 A;  2XRI A;  4FVM A;  3D45 A;  3SZ2 A;  3RWU A;  4OPK A;  3SPZ A;  1NJY A;  4DTP A;  2D0A A;  4F2S A;  1NK4 A;  1S1V A;  3P83 D;  1X9S A;  1D8Y A;  2RN2 A;  4TSX A;  3OYB A;  1S9G A;  1A5X A;  3ZSV A;  3SV4 A;  2EX3 A;  3FFI A;  1TK5 A;  4OKE A;  1KVC A;  5HRO A;  3NH2 A;  3C6U A;  4BE2 A;  4FJ5 A;  1I3A A;  4GW6 A;  1T7P A;  4GMJ B;  2HMI A;  3NDK A;  1TKD A;  1IKX A;  4K8X A;  4Z4F A;  1FK9 A;  4O44 A;  1REV A;  3QET A;  4CEA A;  2P5O A;  3ZSW A;  1JKH A;  4AHV A;  3OYC A;  4DF8 A;  4WE1 A;  4OJR A;  4H4O A;  3L2U A;  3QEW A;  1T8E A;  4CGI A;  3T3F A;  1GOC A;  4M45 A;  4CEF A;  5EU7 A;  1KLN A;  4B8A B;  1IKW A;  2JGU A;  1TV6 A;  3P1G A;  1L3U A;  1LAV A;  4F3O A;  2G8H A;  4KHY A;  2FC0 A;  3LDS A;  2EHG A;  3HT3 A;  2HHU A;  5HLF A;  2O4G A;  1U48 A;  1CXU A;  4BDY A;  5K14 A;  1BL3 A;  1BQN A;  4R5P A;  2VWJ A;  3CFP A;  4F2R A;  5JS1 A;  1CXQ A;  1U49 A;  2AJQ A;  1EP4 A;  3KIO A;  4Z4H A;  1S1X A;  4CIE A;  4C8M A;  3TAG A;  1Z26 A;  5SZT A;  1FKO A;  3O3H A;  4FLW A;  1SL2 A;  3QIN A;  2YNI A;  3O3F A;  1BCM A;  1KLM A;  4BWJ A;  4PUO A;  2G8W A;  1XHX A;  1W0H A;  3DRR A;  4CEE A;  4CF0 A;  4CEO A;  4EP5 A;  4LH5 A;  5J2P A;  4OLB A;  4FCY A;  4OGC A;  3LWM A;  3C94 A;  2X6N A;  3O4Q A;  2D0B A;  1C1B A;  4B9U A;  1U4B A;  3SQ4 A;  2NUB A;  1T05 A;  3AA2 A;  4KTZ A;  2OPQ A;  1WAF A;  1SUQ A;  2VG7 A;  4FZX C;  3B6O A;  4N5S A;  4H4M A;  3TAE A;  4G1Q A;  1BHL A;  3AO4 A;  3WNG A;  4B08 A;  5CZ2 A;  3NGI A;  4KPY A;  1C0T A;  1RDC A;  4MQ3 A;  4KKO A;  1S6Q A;  3VQC A;  1IO2 A;  2KQ2 A;  4M41 A;  2XY5 A;  3KJV A;  4CJT A;  4FK0 A;  4OLA A;  3L2V A;  1WSH A;  2ETJ A;  3DRP A;  2IOC A;  4IFV A;  4HUE A;  1KVA A;  4AIL C;  2D0C A;  3MXI A;  3SQ0 A;  2RF2 A;  3DLE A;  3AVA A;  4I2P A;  4IG3 A;  1X9M A;  3PY8 A;  4CGF A;  1U04 A;  2KZZ A;  4DSF A;  1TK0 A;  1DTT A;  3VQ4 A;  5DMR A;  3K5M A;  4E7H A;  5FRO A;  4CFA A;  1NJZ A;  4Q5V A;  1S5J A;  1BI4 B;  3AVB A;  3DRS A;  2HHS A;  2GV9 A;  3ZSZ A;  4NYF A;  3D0P A;  3C95 A;  4PA1 A;  1SL1 A;  3QEP A;  4AHC A;  1XWL A;  2FBX A;  4RW7 A;  1DTQ A;  4FLV A;  5KI6 A;  4CIG A;  4FJ9 A;  1ZBU A;  3PO4 A;  4FJL A;  1VK0 A;  1VSF A;  3ALY A;  3M8Q A;  1NK5 A;  3ZSY A;  3ULD A;  3DI6 A;  4CHP A;  2KFN A;  3QEX A;  3HVR A;  5CZ1 A;  3IRX A;  3OJS A;  3L2W A;  1BCO A;  1Q9X A;  3L3U A;  3NFA A;  3NH1 A;  3V9Z A;  3MXJ A;  4CHZ A;  2Z1I A;  4C8N A;  4DTS A;  5KGW A;  3AVG A;  1A5V A;  3SI6 A;  1CLQ A;  3HL8 A;  2B5J A;  3O3G A;  1G15 A;  1JLE A;  2E4L A;  4FLU A;  3NBP A;  4JRQ A;  2PY5 A;  4PY5 A;  5DK5 A;  4CJ3 A;  3OS0 A;  3S9H A;  1RNH A;  4DLG A;  1VSE A;  2B4J A;  3OVN A;  3VQQ A;  1JLA A;  4HUF A;  1QSY A;  4HVJ A;  1KRP A;  3KTQ A;  4PQU A;  2PZS A;  2LSN A;  3V1O A;  1TGO A;  2HND A;  1NK6 A;  1JXB A;  1HYV A;  1TKX A;  4CGD A;  4CF2 A;  3QER A;  1GOA A;  4B9N A;  4FXD A;  3V9X A;  3JSM A;  4GVM A;  1VSL A;  2YV0 X;  1YTU A;  4K8Z A;  2XO7 A;  3KD5 E;  3ITH A;  3S3O A;  1YT3 A;  2FBT A;  4LSL A;  4C8O A;  4FJK A;  4CEB A;  1Z25 A;  4O55 A;  4HTU A;  1X1P A;  1VSM A;  1KSP A;  2X6S A;  4J2D A;  4BDZ A;  3K5N A; 
#chains in the Genus database with same CATH topology
 4CHQ A;  1S1T A;  4RG8 A;  4B3O A;  4CZH A;  5D3G A;  5AQF A;  1DLO A;  4BDP A;  1KFS A;  4DU1 A;  3M8P A;  1Q81 O;  4BAC A;  4IZ9 A;  1QVF M;  4JI2 K;  1LCU A;  3OYE A;  2G8K A;  3NF6 A;  1HMV A;  1XUP O;  1W97 L;  1FJG K;  2E20 A;  1BA1 A;  1ZBI A;  3OYJ A;  5KPT A;  3CM5 A;  1ZC6 A;  2YHW A;  3K0S A;  3ZSR A;  3FLC O;  1U2V A;  4CJK A;  2A1S A;  1IH7 A;  2YNG A;  4I6M A;  2HNZ A;  2VCP A;  5M1K A;  1QSL A;  4KHN A;  1RT1 A;  4JI6 K;  4E7I A;  2P9P A;  2OTL N;  3KD1 E;  1MU2 A;  1Q86 O;  1N8R O;  4JK8 A;  3TAR A;  2O8D B;  3IAY A;  1B9D A;  1LWF A;  1WBB A;  3M8S A;  3SPY A;  4H0Y B;  1RTJ A;  4WFB L;  4DSK A;  4PL7 A;  2HMP A;  2FF6 A;  1RDD A;  1QS4 A;  1IBL K;  4B9M A;  2HBL A;  3K2P A;  1KTQ A;  3P5J A;  3MK6 A;  3K9J A;  4FWP A;  3OYA A;  2ZM6 K;  3K58 A;  1L3V A;  3WQU A;  1IKY A;  1NWK A;  4NLB A;  4JKA A;  1R59 O;  4CJ4 A;  1XNQ K;  3CM6 A;  3VQP A;  2P9I A;  3SMS A;  3OYL A;  1OH8 A;  4LD0 A;  1RBR A;  3KVG A;  3AVM A;  1K8A O;  4HCC A;  3CYM A;  3HZ6 A;  2DPN A;  2KZM A;  4DTO A;  4JI7 K;  3RTV A;  2OYQ A;  2YCH A;  4IJA A;  5AQR A;  5DM7 L;  3NF7 A;  2HBM A;  3ZET A;  2E6M A;  2UXD K;  3LAL A;  3L3V A;  5AQM A;  5BRE A;  2VQE K;  3DLL L;  4CK3 A;  5AZJ A;  2YJF A;  4BRE A;  4H0V B;  5JLH A;  2NRZ A;  2QKB A;  1HYZ A;  5HRP A;  3B8A X;  4YDU A;  4JKG B;  5LL6 Z;  4H0O A;  4CJE A;  3SCX A;  3CQY A;  2W42 A;  4C1N K;  3QNN A;  3I56 N;  1NNE A;  2UXB K;  1J54 A;  4MO5 A;  4ELV A;  3HO1 A;  1VRU A;  4C8L A;  2UXC K;  2OTJ N;  3EZ5 A;  4B9V A;  3SUO A;  3RMC A;  4AHS A;  3KK3 A;  2D1K A;  3CME N;  4M7X A;  1ASU A;  1VHX A;  4HTL A;  3E66 A;  3VQ6 A;  4LC9 B;  2HB5 A;  3IG1 A;  5BPL A;  3UIQ A;  1HNX K;  4CEQ A;  1CZ9 A;  1NK8 A;  1N32 K;  5FPD A;  1VSK A;  4M3W A;  3SJJ A;  3WNE A;  2P9U A;  4JS5 A;  4DFK A;  1CZA N;  4IBN A;  2Q97 A;  4M3T A;  4M42 A;  2DY4 A;  2O8F A;  1JLQ A;  2OZM A;  3HVT A;  1YHQ N;  4LH4 A;  4JRP A;  1JLG A;  1XC9 A;  4BG9 A;  3KKS A;  5I42 A;  1B9F A;  2HBJ A;  3SLC A;  4DS4 A;  3QO9 A;  2P9N A;  1RGI A;  3OYF A;  4GV9 A;  3LAK A;  3F73 A;  4IDK A;  3CHW A;  1WSF A;  3THW B;  4JI5 K;  4JAX A;  3Q7B A;  1SQK A;  4CK2 A;  2A3Z A;  3WXI A;  3KWG A;  3VF4 A;  4B9L A;  2D4W A;  2W6L A;  1HLU A;  3ZYY X;  2WON A;  3S41 A;  4FWM A;  5EVZ A;  3O4W A;  2EWS A;  3SBG A;  3AAR A;  4DTJ A;  1BGX T;  1JLC A;  5GIO A;  3THV A;  3OY9 A;  1T6D A;  1JL1 A;  4DSL A;  3ZT4 A;  2NRR A;  1D9D A;  3J80 O;  1RT5 A;  3VQ9 A;  4BRC A;  3LDN A;  4ELU A;  3SUQ A;  1NGE A;  1QE1 A;  4CJS A;  3E9P A;  2Y1I A;  3JS6 A;  5M1N A;  3QES A;  3ENO A;  3ZT2 A;  2E1Z A;  3R9P A;  4Z94 A;  4KAZ A;  4DQR A;  3THY A;  5LMU K;  3ZLJ A;  1SL0 A;  5AQQ A;  2ZJQ L;  3IS9 A;  3OTO K;  2WTU A;  4DV2 K;  4N56 A;  3RRH A;  4CVN E;  4QS9 A;  2X78 A;  4AF1 A;  3LDO A;  4FLT A;  2FSJ A;  3TAB A;  1JLF A;  3V6D A;  3KK2 A;  3UKR A;  3VF2 A;  1RBT A;  4E1N A;  4DTN A;  1HQE A;  5AQL A;  2FBY A;  3S3M A;  1U45 A;  3DOL A;  4DUZ K;  1JLB A;  4H5T A;  2YHB A;  3F2K A;  2ZE2 A;  4RW9 A;  3VA3 A;  2BAN A;  4AQY K;  4N41 A;  3LAM A;  3BEX A;  4MFB A;  5BR8 K;  1T03 A;  4ZTJ A;  2GX9 A;  3GG4 A;  2DFH A;  4YOW A;  3TR8 A;  1TL3 A;  4I6M B;  1VSJ A;  1HKB A;  1VQ4 N;  3T19 A;  5FRN A;  5ELZ A;  4M3R A;  2P9P B;  3TPQ A;  1HJR A;  1UAX A;  4H5N A;  1Q9Y A;  4KI6 A;  3F9K A;  1NOZ A;  2QI2 A;  4KHQ A;  3CC4 N;  4BR2 A;  1BIZ A;  3UKU A;  3W3D A;  3TAP A;  1SS6 A;  3AAQ A;  3BDP A;  4RW6 A;  4MLE A;  3NGZ A;  4WQ5 A;  4O5F A;  4CJU A;  3DLH A;  1S6P A;  3L0Q A;  2VGN A;  1Q8I A;  3LDQ A;  3J7Y P;  5C42 A;  3IFR A;  3KLI A;  3CCE N;  3PSF A;  3O1B A;  4CEC A;  3HYF A;  2OCE A;  3LP2 A;  4LFB K;  1HQU A;  3AY9 A;  4CJQ A;  3CFO A;  4CIF A;  2P9I B;  4JI0 K;  4NCA A;  3L2R A;  2VG5 A;  2GTD A;  4RCH A;  3R3L A;  3D2E B;  1NJY A;  1NK4 A;  1D8Y A;  2BUP A;  2RN2 A;  4BRI A;  1Z6R A;  2D0O A;  3ZET B;  1TK5 A;  3AGK A;  3D6R A;  1VQP N;  3WQT A;  3QET A;  2QEX N;  3C65 A;  3ZSW A;  2GEL A;  5AQG A;  3OYC A;  5C2D A;  1T8E A;  4OJR A;  3QEW A;  3T3F A;  5AZJ B;  2V52 B;  4CEF A;  1KLN A;  2QWO A;  1LAV A;  2EHG A;  5JS1 A;  1BQN A;  4F2R A;  4CIE A;  4C8M A;  1FKO A;  1X3M A;  1SL2 A;  3O3F A;  4PUO A;  1TUU A;  4CEO A;  5J2P A;  4OLB A;  4FCY A;  3C94 A;  2X6N A;  4WCE L;  4B9U A;  3SQ4 A;  1T05 A;  5KPZ A;  3AA2 A;  1WAF A;  1SUQ A;  2CH5 A;  2NRX A;  1RDW X;  5BN8 A;  5AQV A;  5BRD A;  3TAE A;  3AO4 A;  5CZ2 A;  1P8Z A;  4DCH A;  4MQ3 A;  1S6Q A;  4BQL A;  4M41 A;  4CW7 B;  3SK3 A;  4YOU A;  4CJT A;  2D0P A;  1WSH A;  2P9U B;  3SQ0 A;  4NB4 A;  3AVA A;  3O9U A;  2KZZ A;  4DSF A;  1NJZ A;  1RDU A;  4CFA A;  2E88 A;  1S5J A;  1BDG A;  3AVB A;  3L4I A;  3DRS A;  2GV9 A;  3D0P A;  2CGK A;  3C95 A;  4PA1 A;  4AHC A;  2FBX A;  1S3X A;  3Q7C A;  1YJN N;  4FJ9 A;  1ZBU A;  3ALY A;  3M8Q A;  3ID8 A;  1NK5 A;  3U8X A;  3ZSY A;  3ULD A;  2KFN A;  3MCP A;  3HVR A;  5CZ1 A;  3UE5 A;  3A5L C;  3L3U A;  3NFA A;  3NH1 A;  3MXJ A;  5CHI A;  3AVG A;  3O9S A;  3HL8 A;  5F2R A;  2QWM A;  4FLU A;  3HM8 A;  3DJC A;  4JRQ A;  2PY5 A;  4BC5 A;  3OS0 A;  3S9H A;  5BN9 A;  1QSY A;  4PQU A;  4BGA A;  2PZS A;  1NGJ A;  3QER A;  4LF5 K;  1GOA A;  3RVC A;  1VSL A;  2YV0 X;  4K8Z A;  3KD5 E;  4J8F A;  3CCM N;  1WBD A;  5BRF A;  2FBT A;  4LSL A;  4C8O A;  1Z25 A;  4O55 A;  3A0I X;  4CZF A;  4BRQ A;  4YOT A;  3C7N A;  4BR0 A;  3SBT A;  3CCJ N;  3AO1 A;  4CHN A;  4CFD A;  2PYJ A;  5AJ3 K;  5J2Q A;  5FPN A;  1NU0 A;  3O9Q A;  1NOY A;  4KI4 A;  4O5B A;  1KFD A;  1LWC A;  1J5E K;  1WSI A;  5GIP A;  1IG9 A;  3TSP A;  2KHO A;  1HUX A;  1TAU A;  4OKJ A;  1KXP A;  4KHW A;  3CG7 A;  3HOT A;  3HSC A;  1A5W A;  1LW2 A;  2P9L B;  2KLA A;  4CES A;  3V9W A;  1IBK K;  5DM6 L;  1VQ5 N;  1YI2 N;  2E5L K;  5M1O A;  4JN4 A;  3KLH A;  3UKR B;  4CHO A;  2WC9 A;  1YUW A;  5KRT A;  3CF5 L;  1EET A;  2E6L A;  3DM2 A;  4UQG A;  5BPM A;  3AVH A;  2Y1J A;  1VQN N;  1YF5 L;  3MEG A;  3DWL A;  4AHU A;  4BC4 A;  5AQY A;  4DG1 A;  4FW1 A;  4CJR A;  4G9Z A;  4OPA A;  3SAH A;  3O9T A;  1I39 A;  3AO5 A;  4O0I A;  3U9D A;  1YJW N;  3L4Q A;  3QEI A;  4KTW A;  3CXC M;  1WAJ A;  4KV8 A;  4CK1 A;  1ZBH A;  3TU5 A;  4HCB A;  2A40 A;  4JKD A;  4HUG A;  4JI8 K;  2IC3 A;  2BTF A;  3BP8 A;  3DMJ A;  4CJ5 A;  3UKU B;  1C0G A;  3MEC A;  4UY8 O;  1WSG A;  4MLH A;  3MN9 A;  4BR9 A;  2G8I A;  3VF6 A;  4ELT A;  3AO3 A;  1GLF O;  4FLZ A;  1QZ5 A;  4I9Q A;  3J7Z O;  4AH9 A;  3THX A;  3AVC A;  4FW2 A;  3SJH A;  4JEP A;  1OVY A;  1TUY A;  1SKR A;  3T1H K;  1WNS A;  1HJO A;  1Y64 A;  4DR7 K;  2DTU A;  4ILH A;  1L3S A;  4CGH A;  4I2Q A;  4NYN A;  4K42 A;  2Q2R A;  5CE3 A;  4LF4 K;  4B1W B;  4DLE A;  4YDU C;  1RT7 A;  3EY1 A;  4KHS A;  4YOV A;  4LF6 K;  1NMD A;  3VER A;  3LL3 A;  4OVL A;  4DWI A;  4EZ9 A;  3L8B A;  3HPO A;  1WB9 A;  3BZK A;  4BRP A;  2HHH K;  2O8E A;  4KRE A;  3E9L A;  3AVN A;  3ENB A;  1NGB A;  1S9E A;  4YOX A;  3OYM A;  4KH4 A;  2QA4 N;  1QHA A;  4X66 K;  3M6G A;  1W2B M;  3PV8 A;  4PHT X;  3NAE A;  2XY6 A;  3G10 A;  1C0U A;  1IG8 A;  2KFZ A;  4BRM A;  4F4K A;  4XH4 A;  3CET A;  4M63 C;  1C1A A;  4BRL A;  3FGU A;  4CD3 A;  2GUP A;  1NM1 A;  1OH5 A;  3I0R A;  4W5N A;  2IVO A;  5JLF A;  1N33 K;  3QLH A;  5AQP A;  3QIO A;  4A5A A;  3DXK A;  4KRF A;  2JLE A;  3KK7 A;  3SMP A;  3LP1 A;  3CJ1 A;  3QFP A;  2QTD A;  2E2O A;  4C8K A;  3EYZ A;  5AQN A;  4M3Z A;  5FLX O;  4IOC L;  1EWR A;  5HRR A;  4FJJ A;  3CJB A;  4WQ4 A;  4JKB A;  1XMQ K;  3KKR A;  2WFB A;  3OHR A;  1K9M O;  1QQO A;  1GLE G;  4Q0B A;  5FPM A;  2IS3 A;  2IGI A;  2CGJ A;  5HBM A;  4B1U B;  1NK9 A;  4ILG B;  5C2F A;  2FBV A;  1VQM N;  4E7L A;  3HK2 A;  2J4R A;  5IWA K;  4WF9 L;  2F9W A;  3VEW A;  2ZJR L;  3MEE A;  3VQD A;  2I7P A;  2A5X A;  1SKS A;  3V4I A;  3AO2 A;  2HBK A;  3TAF A;  4E7K A;  4FYD A;  2B6A A;  4JKC A;  5EX5 A;  1BG3 A;  3V9U A;  3HPH A;  5AQX A;  1GLB G;  3OYN A;  4BWM A;  5FRM A;  3PLA A;  4AM7 A;  3MX2 A;  2QXL A;  1NK7 A;  1HNI A;  4JYA K;  4CED A;  3WNF A;  3G6E N;  3C6A A;  3MN7 A;  4B3T K;  3D2E A;  5GAG P;  3KWI A;  1GLL O;  4WFN L;  5AZI A;  2V51 B;  3EKU A;  5KQ8 A;  3NHG A;  5KGX A;  4IJN A;  3DLB A;  4DSI A;  4KHY A;  2HHT A;  3NF8 A;  3TAM A;  3PO5 A;  4IO9 L;  3C7N B;  2F8S A;  4B3R K;  4X65 K;  3NVK A;  4CZL A;  3AA5 X;  2PFU A;  2H3G X;  2BDP A;  1HX1 A;  2Q36 A;  3EKS A;  1XNR K;  2Q3S A;  2Z1J A;  2YHX A;  5AQJ A;  4H8K A;  2F96 A;  4OGE A;  3FZH A;  2QKK A;  2QWL A;  2YI1 A;  1U47 A;  1YTA A;  1K73 O;  3SAF A;  1ZYQ A;  3WUH A;  3VQ7 A;  1XQS C;  3VQA A;  3CIP A;  3ID6 A;  1EO1 A;  2W41 A;  4IO8 A;  5LY3 A;  2YNH A;  4BR5 A;  4DR1 K;  4DU3 A;  4FM2 A;  1BO5 O;  3MN5 A;  3NH0 A;  5C12 A;  1SAZ A;  3QB0 A;  4FL9 A;  5B8H A;  1Q7Y O;  3MMV A;  2RKI A;  3SUN A;  3MWP A;  3VEY A;  4OPJ A;  3M8R A;  3VEV A;  3HJF A;  4B9T A;  4WQ5 C;  1RFQ A;  3H3O B;  4L8R B;  4BR7 A;  2Z1G A;  5HOO A;  4IWV A;  4JK9 A;  3VQ5 A;  3I8D A;  4CE9 A;  2HHX A;  4XH5 A;  1NJW A;  2A6A A;  4QS7 A;  1QVG M;  3NMU A;  1UWB A;  1WSJ A;  4FVU A;  2KKZ A;  1HPM A;  3O80 A;  2HHV A;  3CJC A;  1J9A A;  4BGB A;  5J2N A;  4JK7 A;  2XRI A;  2E8A A;  3RWU A;  3TTC A;  3SZ2 A;  4F2S A;  1S1V A;  2F9T A;  3FFI A;  3THX B;  2HST A;  3C6U A;  3NH2 A;  4BE2 A;  4FJ5 A;  1I3A A;  1TKD A;  1IKX A;  4Z4F A;  1X3N A;  4O44 A;  4Y0W A;  4CEA A;  4GKJ K;  4A62 A;  4DF8 A;  2E2P A;  3VTH A;  3L2U A;  4CGI A;  4GY2 B;  5LJW A;  4M45 A;  2NRV A;  4BVP A;  3P1G A;  1L3U A;  3HT3 A;  4NXN K;  4IDH A;  4B1Y B;  1CXU A;  1GLC G;  5K14 A;  1BL3 A;  1U49 A;  2AJQ A;  1EP4 A;  2O8E B;  5SZT A;  3O3H A;  1VAZ A;  3BZC A;  3DRR A;  4EP5 A;  4LH5 A;  4OGC A;  4DR2 K;  3O4Q A;  1C1B A;  2QWR A;  2P9L A;  1NG9 A;  2VGM A;  1BHL A;  4B08 A;  1RDC A;  4KKO A;  1VQK N;  1IO2 A;  4OLA A;  3KJV A;  3DRP A;  4IFV A;  2IOC A;  1NGA A;  4HUE A;  4AIL C;  3DXK B;  2D0C A;  1NGI A;  1X9M A;  4CGF A;  4EIA A;  5FRO A;  1SL1 A;  3GOI A;  4FLV A;  5KI6 A;  3VGM A;  3WXL A;  4FJL A;  1VK0 A;  3R8E A;  2IVP A;  1JJ2 M;  3QEX A;  3IRX A;  3OJS A;  3L2W A;  3G71 N;  4MDB A;  3V9Z A;  2Z1I A;  4C8N A;  4DTS A;  3O3G A;  2B5J A;  1G15 A;  4A57 A;  5AQH A;  1C0F A;  2E4L A;  3NBP A;  4PY5 A;  2JWK A;  2V7Z A;  3EZW A;  3OVN A;  3V1O A;  4U67 L;  1TGO A;  2HND A;  3T69 A;  1NK6 A;  4CF2 A;  3J81 O;  4CJ7 A;  4X64 K;  4GKK K;  3ITH A;  3WXM B;  3S3O A;  2O8C B;  4CEB A;  3VGK A;  1VSM A;  4J2D A;  4BDZ A;  3K5N A;  5EOY A;  1YAG A;  5HRS A;  3CPW M;  1NLV A;  5A2Q O;  5GAE P;  4PKG A;  4FZZ A;  2HNY A;  4IFE A;  3PIO L;  5AQZ A;  5M1F A;  3L6Q A;  5BPN A;  1C1C A;  3K59 A;  2VG6 A;  5AZI B;  4Z4G A;  4EP4 A;  3BY5 A;  1WLJ A;  2NRW A;  4WYB A;  5E26 A;  4ISG A;  3C6T A;  4F3T A;  1HRH A;  4CHY A;  4IEI A;  4NCG A;  1O1W A;  5HRN A;  2GWJ A;  4XH1 A;  4B9S A;  4WFA L;  4E7J A;  3CCR N;  1N34 K;  2JWL A;  1G99 A;  2GUI A;  4FM1 A;  2NZT A;  4EAH D;  1W9H A;  1RIL A;  4KBO A;  4JS4 A;  3O9R A;  4Z4C A;  3P39 A;  4B3S K;  1VSD A;  2A42 A;  2G8F A;  3WT0 A;  3B6P A;  3CER A;  4CF8 A;  4O0J A;  1EX4 A;  3NGY A;  2F4V K;  1BU6 O;  4YHH K;  3IMX A;  3RMB A;  3CC7 N;  3ULE B;  2P5G A;  2P1J A;  1NGC A;  5E41 A;  4I7F A;  2FF3 B;  2X74 A;  3CJ9 A;  4B9Q A;  1FW6 A;  4JKH A;  2CGL A;  4BRN A;  1C6V A;  4CJW A;  1TL1 A;  3HP6 A;  3F5T A;  1D4X A;  4FWR A;  4AHT A;  1JCE A;  3HTV A;  4DV0 K;  4DTR A;  4Z4E A;  4HWI A;  1H1V A;  1JCF A;  4DQQ A;  1TYQ A;  5LMN K;  4ZHR A;  1K6Y A;  3SQ1 A;  3QIC A;  3RMA A;  1OH7 A;  2FXU A;  4ID1 A;  1P90 A;  4N47 A;  1J5O A;  2DFF A;  1RTD A;  1KC8 O;  3SNN A;  4GNI A;  4ISE A;  4DQ8 A;  4BQZ A;  3ASM A;  1ATN A;  1O13 A;  4K41 A;  4CZJ A;  3V1R A;  1S1W A;  3KZB A;  2YJE A;  2AP1 A;  3I8B A;  4DQS A;  1GLA G;  2YHA A;  5CY4 A;  4DUY K;  3AAP A;  3PX6 A;  3OYH A;  1UA0 A;  4OO1 J;  3EE9 A;  3DLK A;  3IUC A;  1NGH A;  1SKW A;  1EWQ A;  2OPS A;  3NVM A;  4EHU A;  1NKC A;  4DFM A;  2GBZ A;  2FSN A;  1D9F A;  4LF7 K;  4C1N I;  4FLY A;  3FR0 A;  1J53 A;  4YFU A;  1FKP A;  5H1S Q;  3LP0 A;  3KK1 A;  2O8B B;  3ATU A;  3MAQ A;  3AVL A;  3BGR A;  2ZD1 A;  1X9W A;  4JHD A;  3CQ8 A;  1RBU A;  2ITM A;  2UYT A;  4JD2 A;  4DTM A;  2W6K A;  1BUP A;  3U6F A;  3ENH A;  5HL7 L;  4LFA K;  4PKI A;  5MLC Q;  4FJG A;  2QK9 A;  4FOE A;  1BI4 A;  1ASW A;  1SZ2 A;  1Z05 A;  1X9J A;  2P51 A;  3DLG A;  4WQ4 C;  3DAW A;  2O4I A;  5I9E B;  3AV9 A;  1RBS A;  1EKE A;  3QBW A;  2OAN A;  5CYQ A;  4CZM A;  1MWM A;  5J1E A;  1S1U A;  3CJ7 A;  4DMN A;  5AQI A;  3WEE A;  2ASM A;  2F8T A;  1WOQ A;  1L5U A;  1S72 N;  3MXM A;  3VEX A;  1ILY A;  1DEJ A;  4OKK A;  3G0Z A;  5FDL A;  4BR4 A;  4KTQ A;  3OYI A;  1JCG A;  1QZ6 A;  2BH1 A;  2OA8 A;  4NCB A;  3K5L A;  2NNW A;  3ZX2 A;  4BRK A;  1RDA A;  4CI6 A;  3ZX0 A;  1RT3 A;  4DTU A;  4CF9 A;  2NLX A;  3TAN A;  2UU9 K;  3U9Z A;  4CF1 A;  4J2A A;  1WUA A;  5F1X A;  3A2F A;  3SV3 A;  1EQY A;  4FWO A;  2GEM A;  5HP1 A;  4Y1C A;  1K8K A;  3VEZ A;  3LDP A;  4DSE A;  2QXF A;  4BRD A;  2Q1N A;  4DU4 A;  4ZTF A;  3QBX A;  3KHY A;  3U3Y A;  4YNQ A;  5J2M A;  4RW4 A;  5FPE A;  1B92 A;  3AVI A;  4IOX A;  1XI1 A;  1TK8 A;  2YNF A;  1KCF A;  2ASP A;  1NJX A;  3FZM A;  4NO7 A;  1RT6 A;  4M3U A;  3OS2 A;  3R1X A;  3TI0 A;  1NGD A;  1XC3 A;  3CMA N;  4O4G A;  4E1M A;  2VWB A;  3D2F B;  3IKM A;  3LZJ A;  3M1F A;  5M1Q A;  3RSE A;  4BRF A;  3O4N A;  3W0L A;  4DV7 K;  5KRS A;  2UUA K;  1GLD G;  4DTX A;  3LAN A;  1TAQ A;  3PX0 A;  4RW8 A;  3HM9 A;  3WNH A;  4KH5 A;  5AQT A;  3EEQ A;  3AA4 A;  3A5O C;  3BF3 A;  1YIT N;  1LW0 A;  2RPI A;  3MWT A;  1KQS M;  4LF9 K;  3VTI A;  3HXM A;  4DS5 A;  5JMV A;  4E1J A;  3TTF A;  3KLF A;  1RT4 A;  1HNV A;  5AR0 A;  4Z4I A;  4IFY A;  1NJI O;  4E3S A;  4FM0 A;  4H0T B;  3VEN A;  3TSU A;  4X62 K;  3ZT3 A;  4W5O A;  1F21 A;  3M3Z A;  1QSS A;  1QQC A;  2XHB A;  4DQI A;  2HF4 A;  3GE1 A;  4IG0 A;  3VQE A;  2Z1H A;  3EL2 A;  2YKN A;  2ZGY A;  1V4T A;  1LV5 A;  1YVU A;  4N76 A;  4A2B A;  4BVO A;  1RT2 A;  1TYQ B;  1BQM A;  3O1W A;  4ID5 A;  5C0Y A;  2HW3 A;  3JXU A;  4O8K A;  4OPK A;  3CCU N;  5C15 A;  4C23 A;  1X9S A;  3CC2 N;  4TSX A;  1A5X A;  3ZSV A;  3SV4 A;  2EX3 A;  5HRO A;  3O6W A;  4GW6 A;  4GMJ B;  1VQ9 N;  4K8X A;  1MA9 B;  3R6M A;  3H6E A;  1NBW A;  3I55 N;  2O8C A;  1GOC A;  3H46 O;  4B8A B;  1TV6 A;  4K43 A;  4BC2 A;  2HHU A;  1E4G T;  2G8H A;  2FC0 A;  3E1Y A;  2UUB K;  5AQW A;  3CFP A;  4FWL A;  3KIO A;  1Z26 A;  2ZJP L;  3QIN A;  1BCM A;  4KHP K;  2ASO A;  2G8W A;  1XHX A;  5EXW A;  2UUC K;  4LF8 K;  4FWS A;  3O8M A;  2D0B A;  1IBM K;  2NUB A;  4CBX A;  4KTZ A;  2OPQ A;  4FZX C;  3A8Y A;  4N5S A;  4H4M A;  4G1Q A;  3F9M A;  3WNG A;  4FPB A;  3NGI A;  3CI5 A;  4JHD B;  1C0T A;  2F7T A;  3VQC A;  2KQ2 A;  2XY5 A;  2ZGZ A;  3L2V A;  2ETJ A;  4R79 A;  3MXI A;  4JD2 B;  3CCV N;  2RF2 A;  3DLE A;  4I2P A;  2RHK A;  4NXM K;  1TK0 A;  4QS8 A;  3K5M A;  4E7H A;  3EN9 A;  1BI4 B;  4DV6 K;  4H0X B;  3QEP A;  4CZI A;  1XWL A;  4RW7 A;  4BRA A;  1DTQ A;  1GLJ O;  3OW2 M;  1NMN A;  3O5B A;  1U6Z A;  1VSF A;  3ULE A;  3DI6 A;  4CHP A;  3LM9 A;  1Q9X A;  1BCO A;  3VPZ A;  3WEE B;  3MN6 A;  4CHZ A;  3SI6 A;  1ATR A;  5KGW A;  5JVG L;  3E9O A;  1MWK A;  3HI0 A;  1RNH A;  4DLG A;  4HUF A;  1OKJ A;  3M5R A;  4YY3 K;  2LSN A;  1HYV A;  1TKX A;  2NRT A;  1KAY A;  1KAX A;  4GVM A;  1HR0 K;  2XO7 A;  4FWQ A;  1YT3 A;  3H3N O;  4BRG A;  3UB5 A;  4HTU A;  1X1P A;  2X6S A;  5IT9 O;  1IV0 A;  4CD1 A;  3SYZ A;  3V9S A;  1SV5 A;  4BRH A;  4FJM A;  4BY9 C;  2QWN A;  1DT9 A;  4FJ7 A;  3EO3 A;  3N4P A;  3QIP A;  4CEZ A;  3CCQ N;  2BE2 A;  4CZG A;  5ADX A;  3I0S A;  1K8K B;  2YKM A;  3MCA B;  4J2B A;  3DYA A;  3L2Q A;  2KTQ A;  1QQM A;  5CR4 A;  3N4Q A;  4E19 A;  3JAM O;  3GBT A;  3CCS N;  3J8A A;  4CBW A;  4DV5 K;  4ISF A;  4LFC K;  3PSI A;  2P9S A;  4H03 B;  4J2E A;  3NE6 A;  4Y1D A;  1TKT A;  1VSH A;  4AM6 A;  5AFU A;  4DFJ A;  2A1R A;  3HOS A;  2PAV A;  3T7Z A;  5JS2 A;  3HP9 A;  1RTI A;  4GVE A;  2O8B A;  3ISN C;  3RSE B;  2Q31 A;  4BE0 A;  1VQL N;  1I94 K;  4JKF A;  5AQS A;  1N6Q A;  3O08 A;  5AQO A;  3OBW A;  4FLX A;  3A5N C;  5TKW A;  1XHZ A;  4FJ8 A;  4H0P A;  3K57 A;  4FSV A;  2RE2 A;  2ZQB A;  1HNW K;  4FK2 A;  3NF9 A;  1NGG A;  4M3Y A;  3RR8 A;  3AA3 A;  4KO0 A;  3OJU A;  3BUZ B;  4U7B A;  4H5W A;  4PL8 A;  3LPU A;  3OS1 A;  2HHQ A;  1YJ9 N;  4W5T A;  2V7Y A;  1Q18 A;  2PYL A;  5KTQ A;  4FWN A;  3LDL A;  3DXM B;  4FJI A;  1NKE A;  3J7A P;  4LY7 A;  3CPE A;  1TKZ A;  3AVJ A;  1CZB A;  2E2Q A;  1ATS A;  3LZI A;  3G4S N;  2IIR A;  4B1X B;  4CJP A;  1UA1 A;  1TVR A;  3LPT A;  4OPH A;  1IKV A;  3OA9 A;  2IDO A;  3V1Q A;  1ITG A;  3QEV A;  2IVN A;  1EXQ A;  4IKF A;  3CQX A;  4QAG A;  3K5O A;  5AQK A;  1NGF A;  4BC3 A;  3OYG A;  4KHU A;  3U3G A;  3LWL A;  4BG8 A;  3GL1 A;  5C25 A;  3ZT0 A;  2P9K A;  5C24 A;  4CGJ A;  5JVH L;  1M1K O;  4CCH A;  4KB0 A;  3HPG A;  4A2A A;  3ZEU A;  2E1Y A;  3K9K A;  4FZY A;  1U2V B;  4E0D A;  2QWQ A;  4H5V A;  5LJV A;  4XIU A;  1RCH A;  3MX5 A;  1N36 K;  3LM2 A;  3DOK A;  4CER A;  2ZWH A;  3ZCM A;  4DV4 K;  4CFB A;  4AHR A;  2YX6 A;  1LOT B;  3T1A A;  3IDH A;  2CH6 A;  3C0B A;  4JI1 K;  3FZL A;  5AQU A;  3U4L A;  3RR7 A;  3VQB A;  4KFB A;  1ZXO A;  4YOY A;  4Z0U A;  3AVF A;  1YVN A;  3LP3 A;  4CZK A;  1C0M A;  2D5R A;  4DF4 A;  3VMF B;  4CJL A;  4HHT A;  4EZ6 A;  2OPR A;  3P31 A;  4FK4 A;  5BRH A;  1NKB A;  3MED A;  4KH6 A;  3AVK A;  4A5B A;  1HYS A;  3D2F A;  3SAG A;  2VYP A;  4FJH A;  4FJN A;  1JXE A;  2G8U A;  4M3X A;  1QHT A;  2E2N A;  4K25 A;  3VQ8 A;  5TKY A;  3RMD A;  4XEI A;  4ILJ A;  4DFP A;  1T6C A;  3PX4 A;  1N5Y A;  2QM1 A;  3DLR A;  5C10 A;  2ITG A;  4RWT A;  1YIJ N;  1HPZ A;  1RTH A;  4MO4 A;  2OZS A;  4V19 S;  3H45 C;  5GIN A;  1ZBS A;  1VSI A;  4JLH A;  3PUF A;  3OBY A;  5M1P A;  3HBT A;  3FFK B;  1E4F T;  1XMO K;  2IAJ A;  3OYK A;  2GWK A;  4GV3 A;  1BIU A;  2G8V A;  4F8R A;  3SUP A;  2KW4 A;  3KLE A;  3BF1 A;  4LSN A;  4FWK A;  3VN5 A;  3TWH A;  3ATV A;  3I33 A;  1LAW A;  3E01 A;  3JYT A;  4QCL A;  1YXQ A;  2ATQ A;  5SWM A;  1VRT A;  3SQ2 A;  3ZSX A;  1ZBL A;  4RTF D;  1FXX A;  3FZF A;  4B1Z A;  3TAQ A;  4CJF A;  3ZSQ A;  1QTM A;  4JKE A;  4B1V A;  4QOZ B;  2HVH A;  1VQ8 N;  3GDQ A;  3FE1 A;  2XY8 A;  3H08 A;  3AGR A;  1LWE A;  5KQD A;  2BGG A;  5E84 A;  4IXC A;  1HKC A;  2YHY A;  3VET A;  3NCI A;  3MDQ A;  3KLG A;  2HVI A;  1UOC A;  4BRO A;  3ZX3 A;  1VQ7 N;  3ZSO A;  1BIS A;  4DSJ A;  2Q0R A;  1VQ6 N;  1KAZ A;  4PWD A;  4CFC A;  3QNO A;  4KB1 A;  1BWF O;  3OYD A;  1IJJ A;  4F9O A;  1ASV A;  1JL2 A;  3CFR A;  2O8F B;  4EFH A;  3VA0 A;  1D5A A;  3D7E O;  2VWK A;  2WOM A;  1S22 A;  3QML A;  2O8D A;  2OPP A;  2HHW A;  2R7Y A;  2DFE A;  4W5R A;  2P9N B;  5KPR A;  2HOE A;  1ZBF A;  2P9S B;  5CYM A;  1R0A A;  3QDK A;  4PKH A;  3C6H A;  4DB3 A;  1WN7 A;  1T3V A;  4DR4 K;  4ICL A;  4L3Q A;  4H5R A;  4W5Q A;  4NLC A;  3ZT1 A;  4CGG A;  5I3U A;  1RDB A;  5ADX H;  2I5J A;  2XY7 A;  1RBV A;  2QW9 A;  1KVB A;  4I9L A;  4CJV A;  2PBD A;  3H1V X;  5T7B A;  2WBN A;  3P4I A;  4B8C A;  4DQP A;  1NK0 A;  4E89 A;  3TSQ A;  3S3N A;  3RRG A;  3WXK A;  1WSE A;  5AFU H;  4A59 A;  3HST B;  5JIC A;  5GAH P;  1Y97 A;  5GAD P;  4BE1 A;  4JNE A;  1GOB A;  1L3T A;  1Q82 O;  1OH6 A;  1KD1 O;  3CD6 N;  3T1Y K;  3V81 A;  4FJX A;  4K0K K;  3THY B;  4JI4 K;  4FVM A;  2FLO A;  3D45 A;  3SPZ A;  4IEE A;  4DTP A;  2D0A A;  1DGK N;  3P83 D;  3FZK A;  3OYB A;  1S9G A;  3VEO A;  4JKG A;  2I7N A;  4OKE A;  1KVC A;  1T7P A;  4YOR A;  2HMI A;  3NDK A;  1ESV A;  4FOI A;  1FK9 A;  1REV A;  3WXJ A;  5F0X A;  2P5O A;  1JKH A;  5EY4 A;  4AHV A;  2HF3 A;  4WE1 A;  4H4O A;  5EU7 A;  1W7A A;  1IKW A;  2JGU A;  2P9K B;  1HNZ K;  1QQN A;  4F3O A;  4DV3 K;  3LDS A;  5HLF A;  2O4G A;  1U48 A;  4BDY A;  2Q0U A;  4R5P A;  2VWJ A;  1CXQ A;  3P38 A;  3VOV A;  4Z4H A;  4DHY A;  1S1X A;  3G25 A;  3TAG A;  3ZEU B;  4FLW A;  2YNI A;  4DV1 K;  4BWJ A;  1KLM A;  2WUS A;  1W0H A;  4CEE A;  4CF0 A;  3CCL N;  3LWM A;  4FO0 A;  4A61 A;  4O8U A;  1U4B A;  3PIP L;  4DR5 K;  2VG7 A;  4M7Y A;  3B6O A;  4KPY A;  1J6Z A;  1M90 O;  4CBU A;  4FK0 A;  1HKG A;  1VQO N;  4JV5 K;  1BOT O;  3THW A;  1KVA A;  3H1Q A;  4DR6 K;  4IG3 A;  4JI3 K;  2W40 A;  3VES A;  3PY8 A;  1U04 A;  1DTT A;  3VQ4 A;  5DMR A;  4CZE A;  2QWP A;  4Q5V A;  1E3M A;  4DR3 K;  3TTD A;  2HHS A;  3A5M C;  3ZSZ A;  4NYF A;  4IOA L;  4EHT A;  3EE8 A;  4CIG A;  1V4S A;  3PO4 A;  5BR9 A;  4MDA A;  3HRG A;  4DKW A;  2AA4 A;  2A41 A;  1OVQ A;  1T44 A;  4FPA A;  2ZF5 O;  1CLQ A;  1A5V A;  4B3M K;  4OX9 K;  1JLE A;  3QFU A;  3CJA A;  4GV6 A;  2VQF K;  5DK5 A;  4CJ3 A;  1VSE A;  2B4J A;  1BA0 A;  1DKG D;  1JLA A;  3VQQ A;  1KRP A;  4HVJ A;  3KTQ A;  1JXB A;  4FXD A;  4CGD A;  4B9N A;  3V9X A;  3JSM A;  3DXM A;  1YTU A;  2NRH A;  4FJK A;  2FSK A;  3VGL A;  1MDU B;  1KSP A; 
#chains in the Genus database with same CATH homology
 4CHQ A;  3SYZ A;  1S1T A;  3V9S A;  4RG8 A;  5HRS A;  4B3O A;  1SV5 A;  3AO1 A;  4CHN A;  4CFD A;  2PYJ A;  4FJM A;  5D3G A;  1DLO A;  5J2Q A;  4BDP A;  1KFS A;  4DU1 A;  3M8P A;  4BAC A;  4FJ7 A;  1NOY A;  4FZZ A;  2HNY A;  3OYE A;  4O5B A;  4KI4 A;  3QIP A;  4CEZ A;  1KFD A;  2BE2 A;  2G8K A;  1LWC A;  3NF6 A;  1WSI A;  3I0S A;  1IG9 A;  1C1C A;  1HMV A;  3K59 A;  2YKM A;  2VG6 A;  1TAU A;  4Z4G A;  4J2B A;  4OKJ A;  3DYA A;  3L2Q A;  4EP4 A;  3CG7 A;  4KHW A;  2KTQ A;  1A5W A;  1LW2 A;  1WLJ A;  1ZBI A;  4E19 A;  3OYJ A;  3CM5 A;  3C6T A;  4F3T A;  4CES A;  3V9W A;  1HRH A;  4CHY A;  3ZSR A;  4CJK A;  4NCG A;  2A1S A;  1O1W A;  4J2E A;  5HRN A;  3NE6 A;  1IH7 A;  3KLH A;  4B9S A;  4Y1D A;  1TKT A;  1VSH A;  4E7J A;  4CHO A;  2YNG A;  4DFJ A;  2A1R A;  2HNZ A;  1QSL A;  2GUI A;  4KHN A;  1RT1 A;  4E7I A;  5KRT A;  5JS2 A;  4FM1 A;  3HP9 A;  1EET A;  2E6L A;  1RTI A;  3KD1 E;  1MU2 A;  1W9H A;  3ISN C;  1RIL A;  3DM2 A;  4UQG A;  4BE0 A;  4JS4 A;  3AVH A;  4Z4C A;  2Y1J A;  1VSD A;  3MEG A;  2G8F A;  3TAR A;  4AHU A;  3B6P A;  3IAY A;  1B9D A;  1LWF A;  4CF8 A;  3M8S A;  4DG1 A;  4O0J A;  1EX4 A;  3SPY A;  3NGY A;  4FW1 A;  1N6Q A;  1RTJ A;  4CJR A;  4DSK A;  3RMB A;  2P5G A;  4FLX A;  2P1J A;  1XHZ A;  5E41 A;  1RDD A;  1I39 A;  3AO5 A;  4O0I A;  1QS4 A;  4FJ8 A;  4I7F A;  2X74 A;  4B9M A;  3K57 A;  3K2P A;  2ZQB A;  1KTQ A;  3P5J A;  3QEI A;  1C6V A;  4KTW A;  4FK2 A;  3NF9 A;  3OYA A;  1WAJ A;  1TL1 A;  4CJW A;  3K58 A;  3HP6 A;  1L3V A;  3AA3 A;  3RR8 A;  4M3Y A;  2HHT A;  1IKY A;  4KO0 A;  4KV8 A;  4CK1 A;  4AHT A;  3OJU A;  1ZBH A;  4HCB A;  4HUG A;  4CJ4 A;  4DTR A;  3LPU A;  2IC3 A;  3CM6 A;  3OS1 A;  4Z4E A;  2HHQ A;  3DMJ A;  3VQP A;  4CJ5 A;  4W5T A;  3OYL A;  2PYL A;  5KTQ A;  4LD0 A;  3MEC A;  4DQQ A;  1RBR A;  4ZHR A;  3AVM A;  1WSG A;  4HCC A;  4FJI A;  3CYM A;  1NKE A;  2KZM A;  2G8I A;  1K6Y A;  4LY7 A;  4DTO A;  3RMA A;  1TKZ A;  3AVJ A;  3RTV A;  1CZB A;  3SQ1 A;  2OYQ A;  3AO3 A;  4ID1 A;  4N47 A;  1J5O A;  4ELT A;  2DFF A;  4FLZ A;  1RTD A;  3NF7 A;  3LZI A;  4I9Q A;  4CJP A;  4AH9 A;  2E6M A;  3SNN A;  1UA1 A;  3AVC A;  1TVR A;  3LPT A;  4FW2 A;  1IKV A;  2IDO A;  3ASM A;  3V1Q A;  1ITG A;  3QEV A;  1SKR A;  3LAL A;  3L3V A;  1EXQ A;  4IKF A;  3V1R A;  1WNS A;  1S1W A;  4QAG A;  3K5O A;  2DTU A;  1L3S A;  3OYG A;  4CGH A;  4KHU A;  4I2Q A;  4CK3 A;  3U3G A;  4NYN A;  3LWL A;  4DQS A;  2YHA A;  5CY4 A;  5C25 A;  3PX6 A;  3ZT0 A;  4DLE A;  1RT7 A;  5C24 A;  3OYH A;  1UA0 A;  3EY1 A;  4KHS A;  2QKB A;  3DLK A;  1HYZ A;  4CGJ A;  5HRP A;  1SKW A;  2OPS A;  4OVL A;  4DWI A;  4CCH A;  4EZ9 A;  3L8B A;  3HPO A;  4KB0 A;  3HPG A;  4B9V A;  4CJE A;  3SCX A;  1NKC A;  4DFM A;  2W42 A;  4KRE A;  3QNN A;  2GBZ A;  3AVN A;  4FZY A;  1J54 A;  1S9E A;  4E0D A;  4ELV A;  3HO1 A;  3OYM A;  1D9F A;  1VRU A;  4XIU A;  1RCH A;  4C8L A;  3PV8 A;  4FLY A;  3NAE A;  3DOK A;  3EZ5 A;  4CER A;  3ZCM A;  3SUO A;  1J53 A;  4CFB A;  3G10 A;  1C0U A;  4AHR A;  4YFU A;  4AHS A;  2XY6 A;  3RMC A;  3KK3 A;  1FKP A;  2KFZ A;  4F4K A;  3T1A A;  3LP0 A;  3KK1 A;  1C1A A;  3MAQ A;  3RR7 A;  1ASU A;  3VQ6 A;  3VQB A;  4KFB A;  3AVL A;  3BGR A;  3I0R A;  2HB5 A;  2ZD1 A;  4Z0U A;  3IG1 A;  3AVF A;  3UIQ A;  3LP3 A;  4W5N A;  4CEQ A;  1C0M A;  2D5R A;  1X9W A;  1CZ9 A;  4DF4 A;  1NK8 A;  3CQ8 A;  1RBU A;  4M3W A;  1VSK A;  4CJL A;  3SJJ A;  3QLH A;  4HHT A;  4EZ6 A;  3QIO A;  3WNE A;  4JS5 A;  4DFK A;  2OPR A;  4DTM A;  4IBN A;  4KRF A;  4FK4 A;  1NKB A;  4M3T A;  2JLE A;  4M42 A;  3U6F A;  2DY4 A;  1JLQ A;  3MED A;  3AVK A;  1HYS A;  4FJG A;  2QK9 A;  2OZM A;  3LP1 A;  1BI4 A;  3HVT A;  1ASW A;  4FJH A;  4FJN A;  4LH4 A;  1JXE A;  1JLG A;  4JRP A;  2P51 A;  3DLG A;  1XC9 A;  2G8U A;  3EYZ A;  4C8K A;  3KKS A;  4M3X A;  5I42 A;  1B9F A;  1QHT A;  3VQ8 A;  4DS4 A;  4M3Z A;  3QO9 A;  2O4I A;  3AV9 A;  3OYF A;  3RMD A;  5HRR A;  1RBS A;  4FJJ A;  1EKE A;  3LAK A;  5CYQ A;  4DFP A;  3F73 A;  4IDK A;  5J1E A;  1S1U A;  3PX4 A;  4DMN A;  3DLR A;  3KKR A;  1N5Y A;  1WSF A;  2ITG A;  2F8T A;  1L5U A;  1HPZ A;  4CK2 A;  1RTH A;  3MXM A;  2OZS A;  4B9L A;  4Q0B A;  1VSI A;  2IS3 A;  4OKK A;  3G0Z A;  2IGI A;  5FDL A;  4KTQ A;  4JLH A;  3PUF A;  2WON A;  5HBM A;  3OYI A;  1NK9 A;  2FBV A;  4E7L A;  2OA8 A;  4NCB A;  2IAJ A;  1BGX T;  1JLC A;  3OYK A;  4DTJ A;  3THV A;  3K5L A;  3OY9 A;  1JL1 A;  4DSL A;  1BIU A;  3MEE A;  3ZT4 A;  3VQD A;  2G8V A;  1D9D A;  1RT5 A;  3VQ9 A;  1RDA A;  1SKS A;  3V4I A;  3SUP A;  4ELU A;  2KW4 A;  3AO2 A;  4F8R A;  3KLE A;  3TAF A;  3SUQ A;  1RT3 A;  4LSN A;  1QE1 A;  4E7K A;  4CJS A;  4FYD A;  2B6A A;  4CF9 A;  4DTU A;  2Y1I A;  3VN5 A;  3TWH A;  3QES A;  3V9U A;  3HPH A;  1LAW A;  3E01 A;  3TAN A;  3OYN A;  4BWM A;  5FRM A;  3ZT2 A;  3JYT A;  4QCL A;  2ATQ A;  5SWM A;  1VRT A;  3SQ2 A;  3ZSX A;  1HNI A;  4CF1 A;  1ZBL A;  1NK7 A;  4J2A A;  4CED A;  1FXX A;  3WNF A;  3A2F A;  3SV3 A;  4CJF A;  3TAQ A;  4KAZ A;  4DQR A;  3ZSQ A;  1QTM A;  5HP1 A;  4Y1C A;  1SL0 A;  4DSE A;  4QOZ B;  2HVH A;  2QXF A;  3IS9 A;  4DU4 A;  4ZTF A;  3NHG A;  5KGX A;  2XY8 A;  3H08 A;  3U3Y A;  4YNQ A;  3DLB A;  5J2M A;  4DSI A;  1LWE A;  3NF8 A;  4RW4 A;  3TAM A;  4N56 A;  3RRH A;  3PO5 A;  2BGG A;  3NCI A;  2F8S A;  3KLG A;  2X78 A;  2HVI A;  3AA5 X;  1UOC A;  2BDP A;  1B92 A;  3AVI A;  4FLT A;  2Q3S A;  1BIS A;  2Z1J A;  3ZSO A;  1XI1 A;  4DSJ A;  4H8K A;  3TAB A;  1TK8 A;  1JLF A;  2F96 A;  2YNF A;  3V6D A;  1KCF A;  4CFC A;  1NJX A;  3QNO A;  4KB1 A;  3KK2 A;  4PWD A;  4OGE A;  1RT6 A;  4M3U A;  3OS2 A;  1RBT A;  3OYD A;  4E1N A;  3TI0 A;  4DTN A;  1ASV A;  1JL2 A;  1HQE A;  2FBY A;  3S3M A;  1U45 A;  3CFR A;  3DOL A;  1U47 A;  2QKK A;  1JLB A;  1YTA A;  4O4G A;  2YHB A;  1ZYQ A;  3VQ7 A;  2ZE2 A;  4E1M A;  3LZJ A;  3VA0 A;  3VQA A;  1D5A A;  2VWK A;  2WOM A;  3O4N A;  5KRS A;  4RW9 A;  4DTX A;  3VA3 A;  2OPP A;  2BAN A;  1TAQ A;  3LAN A;  4RW8 A;  2R7Y A;  3PX0 A;  4N41 A;  2HHW A;  3LAM A;  2DFE A;  3HM9 A;  2YNH A;  4W5R A;  3WNH A;  4MFB A;  4DU3 A;  4FM2 A;  4ZTJ A;  1ZBF A;  1T03 A;  3NH0 A;  5CYM A;  2DFH A;  1R0A A;  3TR8 A;  3AA4 A;  1WN7 A;  1TL3 A;  4ICL A;  1VSJ A;  1LW0 A;  2RPI A;  3T19 A;  5FRN A;  2RKI A;  3SUN A;  4M3R A;  4W5Q A;  3HXM A;  4DS5 A;  1HJR A;  1UAX A;  3ZT1 A;  4CGG A;  4OPJ A;  3KLF A;  5I3U A;  1Q9Y A;  1RDB A;  3F9K A;  1RT4 A;  3M8R A;  1NOZ A;  4KI6 A;  4KHQ A;  1HNV A;  4Z4I A;  2I5J A;  4B9T A;  4IFY A;  3HJF A;  2XY7 A;  3TAP A;  1BIZ A;  1RBV A;  4FM0 A;  4E3S A;  3BDP A;  1KVB A;  4I9L A;  3HK2 A;  3ZT3 A;  4W5O A;  4L8R B;  1F21 A;  4RW6 A;  2Z1G A;  3NGZ A;  4CJV A;  1QSS A;  4CJU A;  1QQC A;  3DLH A;  1S6P A;  3VQ5 A;  3I8D A;  4CE9 A;  5T7B A;  1Q8I A;  2XHB A;  4B8C A;  4DQP A;  4DQI A;  5C42 A;  1NK0 A;  4IG0 A;  3VQE A;  2Z1H A;  4E89 A;  3KLI A;  2HHX A;  3S3N A;  1NJW A;  2YKN A;  3RRG A;  4CEC A;  1LV5 A;  1UWB A;  3HYF A;  1WSJ A;  1WSE A;  3LP2 A;  1YVU A;  1HQU A;  3HST B;  4CJQ A;  1Y97 A;  4N76 A;  4BE1 A;  3CFO A;  1RT2 A;  4CIF A;  1GOB A;  1L3T A;  4NCA A;  2HHV A;  1BQM A;  4ID5 A;  1J9A A;  5J2N A;  3V81 A;  3L2R A;  4FJX A;  2VG5 A;  2HW3 A;  2XRI A;  4FVM A;  3D45 A;  3SZ2 A;  3RWU A;  4OPK A;  3SPZ A;  1NJY A;  4DTP A;  2D0A A;  4F2S A;  1NK4 A;  1S1V A;  3P83 D;  1X9S A;  1D8Y A;  2RN2 A;  4TSX A;  3OYB A;  1S9G A;  1A5X A;  3ZSV A;  3SV4 A;  2EX3 A;  3FFI A;  1TK5 A;  4OKE A;  1KVC A;  5HRO A;  3NH2 A;  3C6U A;  4BE2 A;  4FJ5 A;  1I3A A;  4GW6 A;  1T7P A;  4GMJ B;  2HMI A;  3NDK A;  1TKD A;  1IKX A;  4K8X A;  4Z4F A;  1FK9 A;  4O44 A;  1REV A;  3QET A;  4CEA A;  2P5O A;  3ZSW A;  1JKH A;  4AHV A;  3OYC A;  4DF8 A;  4WE1 A;  4OJR A;  4H4O A;  3L2U A;  3QEW A;  1T8E A;  4CGI A;  3T3F A;  1GOC A;  4M45 A;  4CEF A;  5EU7 A;  1KLN A;  4B8A B;  1IKW A;  2JGU A;  1TV6 A;  3P1G A;  1L3U A;  1LAV A;  4F3O A;  2G8H A;  4KHY A;  2FC0 A;  3LDS A;  2EHG A;  3HT3 A;  2HHU A;  5HLF A;  2O4G A;  1U48 A;  1CXU A;  4BDY A;  5K14 A;  1BL3 A;  1BQN A;  4R5P A;  2VWJ A;  3CFP A;  4F2R A;  5JS1 A;  1CXQ A;  1U49 A;  2AJQ A;  1EP4 A;  3KIO A;  4Z4H A;  1S1X A;  4CIE A;  4C8M A;  3TAG A;  1Z26 A;  5SZT A;  1FKO A;  3O3H A;  4FLW A;  1SL2 A;  3QIN A;  2YNI A;  3O3F A;  1BCM A;  1KLM A;  4BWJ A;  4PUO A;  2G8W A;  1XHX A;  1W0H A;  3DRR A;  4CEE A;  4CF0 A;  4CEO A;  4EP5 A;  4LH5 A;  5J2P A;  4OLB A;  4FCY A;  4OGC A;  3LWM A;  3C94 A;  2X6N A;  3O4Q A;  2D0B A;  1C1B A;  4B9U A;  1U4B A;  3SQ4 A;  2NUB A;  1T05 A;  3AA2 A;  4KTZ A;  2OPQ A;  1WAF A;  1SUQ A;  2VG7 A;  4FZX C;  3B6O A;  4N5S A;  4H4M A;  3TAE A;  4G1Q A;  1BHL A;  3AO4 A;  3WNG A;  4B08 A;  5CZ2 A;  3NGI A;  4KPY A;  1C0T A;  1RDC A;  4MQ3 A;  4KKO A;  1S6Q A;  3VQC A;  1IO2 A;  2KQ2 A;  4M41 A;  2XY5 A;  3KJV A;  4CJT A;  4FK0 A;  4OLA A;  3L2V A;  1WSH A;  2ETJ A;  3DRP A;  2IOC A;  4IFV A;  4HUE A;  1KVA A;  4AIL C;  2D0C A;  3MXI A;  3SQ0 A;  2RF2 A;  3DLE A;  3AVA A;  4I2P A;  4IG3 A;  1X9M A;  3PY8 A;  4CGF A;  1U04 A;  2KZZ A;  4DSF A;  1TK0 A;  1DTT A;  3VQ4 A;  5DMR A;  3K5M A;  4E7H A;  5FRO A;  4CFA A;  1NJZ A;  4Q5V A;  1S5J A;  1BI4 B;  3AVB A;  3DRS A;  2HHS A;  2GV9 A;  3ZSZ A;  4NYF A;  3D0P A;  3C95 A;  4PA1 A;  1SL1 A;  3QEP A;  4AHC A;  1XWL A;  2FBX A;  4RW7 A;  1DTQ A;  4FLV A;  5KI6 A;  4CIG A;  4FJ9 A;  1ZBU A;  3PO4 A;  4FJL A;  1VK0 A;  1VSF A;  3ALY A;  3M8Q A;  1NK5 A;  3ZSY A;  3ULD A;  3DI6 A;  4CHP A;  2KFN A;  3QEX A;  3HVR A;  5CZ1 A;  3IRX A;  3OJS A;  3L2W A;  1BCO A;  1Q9X A;  3L3U A;  3NFA A;  3NH1 A;  3V9Z A;  3MXJ A;  4CHZ A;  2Z1I A;  4C8N A;  4DTS A;  5KGW A;  3AVG A;  1A5V A;  3SI6 A;  1CLQ A;  3HL8 A;  2B5J A;  3O3G A;  1G15 A;  1JLE A;  2E4L A;  4FLU A;  3NBP A;  4JRQ A;  2PY5 A;  4PY5 A;  5DK5 A;  4CJ3 A;  3OS0 A;  3S9H A;  1RNH A;  4DLG A;  1VSE A;  2B4J A;  3OVN A;  3VQQ A;  1JLA A;  4HUF A;  1QSY A;  4HVJ A;  1KRP A;  3KTQ A;  4PQU A;  2PZS A;  2LSN A;  3V1O A;  1TGO A;  2HND A;  1NK6 A;  1JXB A;  1HYV A;  1TKX A;  4CGD A;  4CF2 A;  3QER A;  1GOA A;  4B9N A;  4FXD A;  3V9X A;  3JSM A;  4GVM A;  1VSL A;  2YV0 X;  1YTU A;  4K8Z A;  2XO7 A;  3KD5 E;  3ITH A;  3S3O A;  1YT3 A;  2FBT A;  4LSL A;  4C8O A;  4FJK A;  4CEB A;  1Z25 A;  4O55 A;  4HTU A;  1X1P A;  1VSM A;  1KSP A;  2X6S A;  4J2D A;  4BDZ A;  3K5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...