1BL3A

Catalytic domain of hiv-1 integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 47
structure length 142
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bl3A00
3MEGA 3K5OA 2QXFA 1J54A 4CK3A 4CECA 1D8YA 2RF2A 4QCLA 2QKBA 4F3TA 2Q3SA 3D0PA 3OYEA 4DF4A 1QSYA 4JRPA 1VSIA 3SV3A 4B9TA 3I0RA 4ID5A 1D9FA 1BGXT 2OPQA 4E1MA 2A1SA 3CFRA 1RT1A 1C1CA 1BIUA 1S9GA 1DTQA 1WSHA 3NDKA 1NJXA 2X74A 2Z1HA 1EKEA 1QS4A 3B6PA 1ASUA 4MFBA 4CJTA 3TAMA 3TAEA 2HNYA 4YFUA 1HPZA 5C25A 5KGXA 4KI4A 3AVMA 3AA2A 3DOLA 5CY4A 4W5NA 3K5MA 3DMJA 2YNFA 5HRPA 3QIPA 1VRUA 4CEBA 4BACA 4KTQA 4CK1A 4I7FA 3K5NA 3BDPA 4M3ZA 4ELVA 4M45A 4IG0A 1TGOA 2G8HA 4IFYA 3VQCA 1L3TA 3AVBA 1REVA 4H8KA 4E7KA 3SPZA 3LP2A 1RILA 3ZCMA 2GUIA 3SYZA 1X9SA 1Q9XA 4DQQA 2HW3A 1YVUA 3CM6A 4O0IA 3V1QA 2G8KA 3MAQA 3VQAA 4WE1A 3HXMA 4DTRA 3KTQA 2IC3A 2ITGA 4RW4A 1HJRA 1BCMA 1LV5A 4CHZA 4DSKA 3ZT4A 1NKBA 3NF6A 2GBZA 1N5YA 4KRFA 3RTVA 4KI6A 1WNSA 4LY7A 3FFIA 4DU4A 2IS3A 3DLEA 3AVKA 1A5XA 3K57A 3LZJA 1JL1A 3TANA 3L2VA 3OYCA 2G8VA 1RT7A 1RTIA 3TR8A 4OPKA 4LSNA 3OYBA 1DLOA 4M41A 3HSTB 3O3FA 3TWHA 1L3SA 4N47A 4GVMA 5FROA 4DLEA 4NCGA 4CJPA 4DQSA 3QLHA 4DQIA 4KB1A 4FXDA 2KFZA 1JXEA 5K14A 3S9HA 2YNGA 3KLHA 2YNIA 3HK2A 4CEFA 4KO0A 3QNOA 1HYZA 3K5LA 3V9ZA 3QETA 1SKSA 4FYDA 2DFHA 2RPIA 2XRIA 3LWMA 2X6SA 3ZT0A 1L3UA 1FKPA 3NH1A 4DS4A 4FJ8A 5HRRA 4JRQA 5HBMA 1KFDA 4DQPA 2FBVA 1TVRA 4E7LA 3RWUA 1K6YA 1NK0A 1RTHA 3VQBA 3PX0A 4PUOA 1KCFA 3NF8A 5FRNA 3HJFA 3LAKA 3KJVA 1UOCA 3MXJA 4FW2A 4M3UA 3AVCA 3AO3A 1SUQA 1S1VA 4CCHA 1BIZA 4BE0A 3QIOA 1VSKA 3VA0A 3SQ0A 1WSIA 4FJGA 3S3NA 1C0TA 3V9SA 1QTMA 3SPYA 5J2QA 1U45A 4N76A 4FK2A 1ASVA 1F21A 4DTMA 2LSNA 3SUOA 3QEXA 4HTUA 3H08A 3V81A 4EP5A 4IFVA 1RBVA 3DLHA 3K2PA 1S1UA 4FW1A 1VSEA 4DSFA 2RKIA 2E6MA 4L8RB 2KZZA 4E7JA 3RMAA 4C8LA 3OY9A 3DI6A 1TV6A 1HNVA 1B92A 2JGUA 3IS9A 4J2EA 3SQ4A 3HM9A 3C95A 3UIQA 1NOYA 4N5SA 3V4IA 4CJ3A 2QK9A 4O0JA 4CK2A 3ZT3A 5HRSA 1A5WA 1JL2A 3AA4A 4B9LA 3EZ5A 4CHYA 3QNNA 4M3XA 1WSFA 3AVHA 2HVHA 3SUNA 4GMJB 1Z25A 3ZSXA 3TABA 1LWFA 4IKFA 3V1OA 1UAXA 4C8NA 3KK1A 3PO5A 1IKWA 4DFPA 1VSJA 3AO4A 4FVMA 1RDAA 1GOAA 5DK5A 4CEOA 5SZTA 1NK8A 3HVTA 3WNEA 4W5RA 4JS5A 4DTUA 3DLKA 4O55A 4OPJA 1A5VA 3RMDA 2HHWA 3RR7A 1S5JA 4AHVA 5SWMA 3HVRA 3AO2A 5DMRA 4HUGA 3V6DA 1VRTA 4HVJA 4FK0A 1KSPA 3L2UA 1YTUA 2OPSA 4PY5A 1S1WA 3NFAA 3SUPA 2F8TA 3PUFA 4QAGA 2BANA 4CEEA 4ZTFA 4CHNA 3M8SA 1VK0A 2IGIA 1NK7A 3L8BA 4C8KA 1XI1A 4KTWA 1VSFA 1S6QA 3WNHA 3RR8A 4W5TA 3OS2A 4FLZA 1SKRA 1UA1A 3QEVA 4F3OA 4CJLA 4DTSA 3CG7A 3HPOA 4CJFA 4ZHRA 4Z0UA 1GOCA 2DFEA 3G0ZA 3LALA 4G1QA 3OYFA 1FK9A 1RBTA 4KHWA 1QSLA 3O4NA 4FLXA 4CHPA 4XIUA 3NGYA 1FKOA 2YNHA 3I8DA 3NF7A 4DQRA 4FK4A 4IDKA 3KLEA 3C6UA 5CYMA 4TSXA 1CXQA 3WNGA 1XHXA 2KZMA 3DLGA 3MEDA 1CLQA 2FBTA 4CJUA 3ZSOA 1L5UA 1KVAA 1RDBA 3NF9A 3AVFA 4N56A 2GV9A 1T7PA 4Y1CA 4PQUA 4CJWA 3TI0A 1TK5A 2KW4A 3AO1A 3M8PA 3IAYA 3L3VA 4M3TA 1SL2A 1BISA 1Z26A 4CHOA 4IG3A 1JLGA 2HNZA 3LAMA 4DTJA 1NJWA 1NK6A 1EP4A 4BWMA 4FZXC 4CEAA 3OYDA 4ELUA 1U04A 4BDYA 4Z4IA 2EX3A 2BGGA 3OYLA 3VQQA 1TKZA 1ZYQA 1C0UA 3L2QA 2VWKA 1R0AA 3LWLA 4FJ5A 3KLIA 1TAQA 3HP9A 4FJLA 2B4JA 1I39A 2IOCA 2P1JA 3O4QA 2D0BA 2Y1JA 2DTUA 4DLGA 5I3UA 2HHVA 4Q0BA 3U6FA 4CE9A 4CFCA 4OLBA 4CIGA 1HNIA 1I3AA 4EZ9A 5JS1A 1IKXA 4HUEA 5HRNA 2IAJA 4NCAA 2NUBA 1N6QA 3OYKA 3MXMA 2G8WA 4RW8A 2VWJA 4B8CA 3PX4A 4NYNA 3DLBA 3IRXA 4AHTA 3LPTA 1U48A 4CEQA 3LZIA 2P5GA 3KD1E 4OVLA 4BWJA 3VQDA 4AILC 4DTOA 4CERA 3JYTA 1JLBA 3QINA 4DSLA 1LWCA 1KLNA 1ZBFA 4FJJA 2YV0X 4CJQA 3NGZA 1SV5A 3NH2A 1SKWA 4Z4FA 4FJKA 4CGJA 1S1TA 2Z1JA 3KLGA 1G15A 1UWBA 4FZYA 4FJNA 1TL3A 3DLRA 2D0CA 3P5JA 1LAVA 2KQ2A 3AVIA 3CFOA 4CFBA 3K58A 1JKHA 4OGEA 4PWDA 4LH4A 2FBYA 1JLCA 2XY6A 1HYSA 3T19A 5HP1A 4E0DA 4AHCA 5KRTA 2OZSA 1YT3A 1Y97A 4AHUA 1FXXA 1C6VA 4LSLA 1EETA 4ICLA 1GOBA 3DM2A 2B5JA 3RRGA 3RMBA 2OPPA 3OYMA 4DTNA 4JS4A 2ETJA 1XHZA 1J5OA 2A1RA 4AHSA 2HHSA 2XHBA 4FJ7A 2B6AA 4IBNA 4E7HA 3NH0A 1NKEA 1NJZA 2BE2A 1WAFA 1RT3A 1MU2A 3AVAA 4EP4A 4KHNA 2DY4A 3QESA 4J2BA 2O4GA 2YKNA 2PZSA 3BGRA 3OVNA 4Z4CA 4FLWA 3ZSYA 3S3MA 3ZSZA 5KI6A 4CFDA 4KPYA 3VQ7A 3THVA 4O44A 4B9SA 4OKJA 3TAGA 1ZBIA 1U4BA 3TAFA 1NKCA 3OYHA 1IO2A 4KFBA 4PA1A 4GW6A 1WSJA 4EZ6A 2O4IA 1EXQA 1W0HA 3AVGA 1X9MA 3SQ1A 2XY7A 3D45A 1LW2A 1Q8IA 3U3GA 4J2AA 1CZBA 3ALYA 3AVLA 3ZT1A 3LANA 2F96A 4FJIA 4HCCA 4FJMA 4FJ9A 1RNHA 3HYFA 3ZSQA 4CJEA 4O5BA 4DG1A 1B9DA 1RTDA 1J9AA 4NCBA 4RW6A 4CF0A 1BQMA 2G8FA 1TKDA 4KHSA 1O1WA 3SJJA 1IKYA 1RT5A 1HMVA 5CZ2A 1QQCA 1Q9YA 1L3VA 4CESA 1T05A 1VSDA 2KFNA 3NAEA 4CJ5A 1CZ9A 3OS1A 3KKRA 2XY5A 1LW0A 1VSLA 5E41A 3NE6A 4K8XA 4CEZA 3LDSA 1KLMA 1KFSA 3O3HA 5D3GA 3V9UA 4F8RA 5J1EA 1IH7A 4DU3A 1TKTA 3AA5X 1XWLA 3HPGA 4H4OA 4RG8A 1TKXA 5JS2A 4B8AB 3JSMA 3F73A 3PV8A 4B08A 2ZD1A 4CF8A 1RCHA 2X6NA 5J2PA 1UA0A 3WNFA 4B9MA 2DFFA 5HLFA 4M42A 1LWEA 4CF2A 2YHAA 1RBUA 3SZ2A 1KTQA 5C24A 3ZSVA 1TK8A 2HMIA 4ELTA 4CGHA 4DWIA 1J53A 4KTZA 3DRSA 3A2FA 3MECA 4Z4EA 3NHGA 4HUFA 2OA8A 4DF8A 5HROA 2I5JA 3CYMA 3M8RA 4DFMA 4FJXA 1VSMA 4Z4HA 1T03A 1W9HA 4OKEA 1JLFA 3OYNA 1D5AA 2VG5A 4CGGA 2F8SA 1ITGA 1RDDA 4KAZA 1JLEA 1U49A 4KHQA 3VQPA 1BI4B 1SL1A 4B3OA 1QE1A 1U47A 4Q5VA 4M3WA 5KRSA 4KB0A 1C0MA 1VSHA 4AH9A 3SV4A 3DOKA 3LP3A 4ID1A 4CGDA 1RT2A 3QEIA 4B9VA 3L3UA 5J2NA 2QKKA 4I9QA 3HO1A 2Z1GA 1X9WA 4FM2A 2WONA 3P1GA 3VQ4A 3ZT2A 4KV8A 2E4LA 4I2PA 3DYAA 4W5OA 3EYZA 3TAPA 3CM5A 4F2RA 1HQUA 1YTAA 4DFJA 2PYJA 4FM1A 2XY8A 4CFAA 3VQ8A 3QEPA 2HVIA 1C1BA 2VG7A 4O4GA 1RT6A 1S6PA 4JLHA 4RW7A 4BE2A 2OYQA 2ATQA 1QHTA 4CF1A 3VN5A 3K59A 1NK5A 2P51A 5C42A 4J2DA 1BI4A 1RBSA 3PY8A 3SCXA 3VQEA 1WAJA 3SI6A 4BDPA 3EY1A 1HYVA 1EX4A 4DS5A 4F2SA 2OZMA 3ISNC 5EU7A 2R7YA 1WLJA 3VQ5A 3HPHA 3ZSRA 4CGIA 3LPUA 1BCOA 2KTQA 1XC9A 1KVCA 1JLQA 2FC0A 2BDPA 4OJRA 3OJSA 3B6OA 1ZBUA 3V1RA 5T7BA 5CZ1A 4FZZA 2HHQA 2ZQBA 2X78A 4AHRA 5FDLA 3HT3A 4Z4GA 1RT4A 4K8ZA 3AO5A 3RRHA 2WOMA 2AJQA 4FCYA 4CF9A 3ZSWA 1RBRA 4E1NA 4CHQA 3E01A 1JLAA 5KGWA 3KKSA 4FLUA 4FLVA 4B9UA 5KTQA 4RW9A 4DMNA 4DSEA 4UQGA 1NJYA 4KHYA 2W42A 4BDZA 1DTTA 4CJKA 1TL1A 4N41A 1C1AA 5J2MA 2PYLA 3VA3A 3QERA 2P5OA 4FLYA 3CFPA 3F9KA 1B9FA 4DTXA 3TARA 2YKMA 4DTPA 3ITHA 3C94A 2EHGA 3OYJA 1ZBHA 3QO9A 3LP1A 3QEWA 4R5PA 1SL0A 3KK2A 3SQ2A 4F4KA 1NK4A 2YHBA 2G8UA 4E19A 2Z1IA 4E7IA 4E3SA 4MQ3A 4LD0A 4E89A 4W5QA 2D0AA 3U3YA 3ASMA 3S3OA 1LAWA 4KREA 3OJUA 2D5RA 1ASWA 1QSSA 1BL3A 3PO4A 3AA3A 3AV9A 1WN7A 3KLFA 4FM0A 3V9WA 3SNNA 4OLAA 4ZTJA 3OS0A 3HP6A 4HCBA 2Y1IA 4FLTA 1IKVA 1HQEA 3O3GA 2HNDA 4CJVA 2IDOA 3KK3A 3VQ9A 3RMCA 3AVJA 1WSEA 4QOZB 2HHTA 4DFKA 4CIEA 1BHLA 4C8MA 4DSIA 1RDCA 3NBPA 1JXBA 5I42A 1BQNA 3IG1A 4CIFA 2PY5A 4C8OA 4HHTA 1T8EA 4DSJA 4YNQA 3V9XA 2VG6A 3ULDA 4CJRA 2HHUA 1CXUA 1NK9A 4CEDA 1KRPA 3OYAA 1RTJA 2JLEA 1S9EA 2HB5A 4OGCA 3L2RA 2OPRA 3NGIA 3I0SA 4NYFA 3OYIA 4OKKA 4DU1A 3HL8A 3PX6A 2FBXA 4B9NA 5CYQA 3L2WA 4FJHA 1ZBLA 3VQ6A 3SUQA 1X1PA 3LP0A 4BE1A 3CQ8A 3T3FA 3TAQA 4CJSA 3DRRA 1KVBA 3P83D 4KKOA 4CGFA 2XO7A 3KD5E 4KHUA 1TK0A 2ZE2A 4Y1DA 3NCIA 1HRHA 4I9LA 3MEEA 1S1XA 2HHXA 4M3YA 3M8QA 3C6TA 3G10A 4I2QA 4M3RA 3MXIA 1IG9A 2G8IA 1TAUA 2E6LA 3OYGA 4H4MA 1WSGA 4CJ4A 3KIOA 3T1AA 3DRPA 1NOZA 1D9DA 5FRMA 2RN2A 3AVNA 4LH5A
chains in the Genus database with same CATH superfamily
3MEGA 3K5OA 4ISEA 4JI6K 2ZM6K 2FXUA 2QWNA 4L3QA 1QSYA 4IWVA 4JRPA 3SV3A 1BGXT 1HKBA 2OPQA 4WFBL 1DTQA 2X74A 2KKZA 3HTVA 1ASUA 2HNYA 1V4TA 3DXMB 2FLOA 3ENOA 3DXKA 1VQ7N 4CEBA 2Q0UA 3K5NA 5AQYA 3VGMA 2W41A 4IFYA 1VHXA 3CC7N 3MDQA 4E7KA 3ZCMA 1XUPO 1QQOA 4MDBA 1C0GA 4IEEA 4M7XA 1Q9XA 4AQYK 1VQ8N 2ZJRL 1S22A 1YVUA 3CM6A 4O0IA 4YOTA 3V1QA 4WQ5C 3DXMA 3WQUA 1LV5A 4CHZA 2YHXA 1K8KB 1N5YA 4DV0K 4LY7A 1GLLO 3DLEA 3H3NO 1JL1A 3L2VA 3J80O 3H6EA 5BR8K 1RTIA 5AQRA 3GL1A 1U6ZA 1IBKK 1NMDA 1YF5L 3QMLA 4GVMA 4NCGA 4DLEA 2CGLA 1JXEA 5K14A 3I33A 2YNGA 3JAMO 3KLHA 2YNIA 3HK2A 4CEFA 4KO0A 1K8KA 3K5LA 4FYDA 1SAZA 2RPIA 2X6SA 3ZT0A 1L3UA 1FKPA 3KK7A 2E2QA 5HBMA 5DM6L 4BQZA 4E7LA 1NK0A 1RTHA 3F9MA 1KCFA 3KJVA 1UOCA 3AVCA 1ILYA 1YAGA 1BIZA 2HSTA 3QIOA 1WSIA 1W97L 1ESVA 1U45A 4DTMA 3UKUB 4DR5K 3QEXA 3V81A 1BO5O 4JK9A 4X65K 4E7JA 1Q81O 3IS9A 4IOAL 4N5SA 2PFUA 4CJ3A 2QK9A 4O0JA 4HTLA 3F5TA 5HRSA 4RWTA 1JL2A 4M3XA 3EZ5A 4CHYA 1WSFA 1GLBG 2HVHA 1NGFA 3ZX0A 1Z25A 3UKUA 5EXWA 1UAXA 3GDQA 3KK1A 4DV2K 2A5XA 2VQFK 2NNWA 3DLKA 1A5VA 4BREA 2E2OA 2ZJPL 1S5JA 5SWMA 3HVRA 5DMRA 4JI5K 1KSPA 1YTUA 3A5NC 4CZGA 1XMOK 3SUPA 2F8TA 4QAGA 3CCJN 4CHNA 3L8BA 1S6QA 3OS2A 4I6MB 3ZEUB 2HBJA 4YDUC 4DTSA 3CG7A 4JN4A 3J7ZO 4Z0UA 2DFEA 3G0ZA 4H0YB 3OYFA 1QQMA 4CVNE 3O4NA 3NGYA 4DQRA 4FK4A 3NF7A 4UY8O 4CD3A 3C6UA 4TSXA 3ATUA 3AVFA 3ZYYX 1T7PA 3CCLN 4I6MA 1TK5A 3ZEUA 3IAYA 3L3VA 1Z26A 4CHOA 4JI0K 4BG9A 4DR4K 1W2BM 2BGGA 3L0QA 1OVQA 3OYLA 1ZYQA 2NRTA 1EO1A 3KLIA 4BG8A 1HLUA 4FJLA 2B4JA 3O4QA 2D0BA 3CXCM 5BPNA 4PL8A 4Q0BA 1HNIA 5JS1A 3WEEB 3WQTA 3E1YA 2UUCK 2VWJA 4B8CA 1X3MA 4NYNA 4GVEA 3LPTA 1U48A 3T7ZA 3CCVN 4AILC 2IVOA 3W0LA 4EFHA 3JYTA 4Z4FA 3NH2A 3CJCA 4FJKA 1BDGA 4U7BA 3KLGA 4DUYK 4DQ8A 1UWBA 3C65A 3DLRA 3K9JA 1LAVA 3CFOA 3WEEA 2HMPA 4JD2B 1HPMA 1C6VA 4B1ZA 2UU9K 2V7ZA 2B5JA 3WXJA 1QHAA 1J5OA 1I94K 2HHSA 4AHSA 2XHBA 2B6AA 2E1ZA 3U9DA 3EZWA 2JWLA 2PZSA 2CGJA 5KQ8A 4FLWA 4CFDA 4JD2A 1IV0A 4FWNA 1ZBIA 1U4BA 3TAFA 3KHYA 4GW6A 3C6HA 4GNIA 1JJ2M 4EZ6A 1W0HA 3CHWA 2WTUA 1Q8IA 4J2AA 3ALYA 2F96A 2VWBA 4HCCA 4FJ9A 2IVNA 2IVPA 4DG1A 1B9DA 4CZLA 1RTDA 3HOTA 4RW6A 4KHSA 1O1WA 2JWKA 1T05A 3NAEA 1BOTO 1CZ9A 4O8UA 4CJ5A 3OS1A 1GLJO 5IWAK 5E41A 3NE6A 1NBWA 1EWRA 2NZTA 1KLMA 4WF9L 5ADXA 1GLFO 5DM7L 5J1EA 4KHQA 3F73A 5JS2A 3JSMA 3L4QA 5BR9A 3K9KA 5M1QA 4BR4A 4CF8A 5J2PA 2DFFA 4BRNA 2YHAA 1RBUA 3T69A 3ZSVA 1TK8A 4WFAL 2YI1A 4GY2B 3MECA 4Z4EA 3C6AA 5EVZA 3ATVA 2I5JA 4DFMA 4Z4HA 1JLFA 3CJ1A 3O8MA 4BC2A 3H1QA 1JLEA 1QE1A 4ILJA 4NXNK 1C0MA 4BROA 3QEIA 4BC3A 5J2NA 3H45C 3EKUA 1X9WA 4FM2A 4PKIA 3ZT2A 4I2PA 4F2RA 4MLEA 5AQKA 4A57A 4CFAA 5AQTA 2NLXA 1RT6A 1S6PA 3J81O 1HYVA 2OZMA 5EU7A 4CGIA 4JKEA 1BCOA 2KTQA 1NJIO 1KVCA 2FC0A 4JKCA 2BDPA 1K9MO 2HHQA 1NGAA 1VAZA 2X78A 3LDOA 4A2AA 3HT3A 1O13A 3VF4A 4CF9A 3E01A 1JLAA 5KGWA 4B9UA 4UQGA 4DCHA 5AFUA 2W42A 1DTTA 4CJKA 1TL1A 4LF9K 1C1AA 4LF4K 3KVGA 3MX5A 3DAWA 3TSUA 3EL2A 2EHGA 2QTDA 4JI4K 4F4KA 3FE1A 3CPEA 1ZC6A 2G8UA 4E19A 1T6DA 4OX9K 4H0TB 4J8FA 4FM0A 3OS0A 1CZAN 3O3GA 1WB9A 4DSIA 3NBPA 3CJ9A 4KBOA 4CIFA 2A41A 4HHTA 1T8EA 3PSIA 1XMQK 4CI6A 5BREA 4PKHA 4CEDA 3OYAA 1RTJA 2NRRA 3I0SA 5JLFA 3PX6A 2FBXA 5CYQA 1H1VA 3LDPA 3SUQA 4NXMK 4JKFA 1X1PA 4FWMA 3TAQA 3DRRA 1TK0A 3NCIA 3TSPA 4I2QA 1IG9A 2G8IA 1HNXK 1TAUA 3OYGA 4H4MA 4CJ4A 4X66K 3DRPA 3H3OB 2ZGZA 2E5LK 3WXKA 1N34K 1JCGA 2FF3B 1D8YA 2QKBA 3M3ZA 4IJNA 4B1UB 1WOQA 4F3TA 2Q3SA 4BRLA 3D0PA 4DF4A 4B9TA 1D9FA 1JCEA 4E1MA 5JLHA 2A1SA 1C1CA 4IDHA 3QFUA 4BVOA 1WSHA 3NDKA 1NJXA 4LFBK 4IXCA 2Z1HA 1EKEA 3B6PA 4MFBA 3S41A 4KI6A 2A40A 1MWKA 3AVMA 5CY4A 4W5NA 2YNFA 3QIPA 4BACA 4CK1A 1YJ9N 1D4XA 4ELVA 2KHOA 2G8HA 1L3TA 3AVBA 3LP2A 1RILA 2GUIA 4XH4A 4H0OA 4DQQA 3DLLL 2HW3A 3MAQA 5JVHL 3KZBA 3KTQA 2IC3A 3FGUA 4RW4A 1BCMA 4QS7A 1IG8A 2GBZA 3J8AA 4EIAA 1WNSA 3FFIA 4DU4A 4K41A 2OTJN 1N33K 3LZJA 1N8RO 3AAPA 1EWQA 4H0PA 1RT7A 5M1KA 3TR8A 5BRDA 4LSNA 1VQNN 2QWMA 4DQIA 4KB1A 3QLHA 2ITMA 2WFBA 3S9HA 3SMPA 2CH6A 3QNOA 1WUAA 3BUZB 4CZKA 3V9ZA 4BRPA 4JYAK 2XRIA 3LWMA 5AQFA 4DS4A 1TVRA 3CJAA 3PX0A 3Q7BA 2HHHK 5FRNA 3HJFA 4MO5A 2HBMA 2V51B 3AO3A 4JNEA 1QTMA 5J2QA 4AM7A 3B8AX 2E2PA 5HOOA 1RBVA 3DLHA 1OVYA 3I55N 3QICA 1S1UA 1VSEA 4IEIA 2RKIA 4L8RB 2QWRA 3RMAA 3ENHA 1KAXA 4C8LA 1TV6A 1VQ6N 4H5WA 3SQ4A 3VGLA 3PSFA 3V4IA 3ZT3A 3IKMA 3QNNA 3AVHA 2QWQA 4C8NA 4DR1K 5ELZA 4A62A 4DFPA 1VSJA 4JI2K 4FVMA 1RDAA 5DK5A 5SZTA 4H5VA 4W5RA 4DTUA 4OPJA 3RR7A 4K43A 1DKGD 4FK0A 4PY5A 2P9KB 3FFKB 1IJJA 5CHIA 1NNEA 4KTWA 3WNHA 4W5TA 2A3ZA 3P4IA 1UA1A 3T1HK 3D2EB 2QWLA 3HPOA 3TTFA 4B3MK 1GOCA 3RSEB 3LALA 4G1QA 1FK9A 4IDKA 3N4PA 1N36K 2P9KA 3MEDA 1CLQA 4CJUA 3ZSOA 2FSKA 3CC4N 1KVAA 1ZXOA 4BRMA 4BRHA 4N56A 4PQUA 5FPEA 4Y1CA 2E88A 3TI0A 2KW4A 1QVGM 3M8PA 5AQNA 2YHYA 1JLGA 3LAMA 3O08A 4IG3A 1EP4A 4B1WB 4ELUA 1BA1A 4FWKA 1U04A 4Z4IA 5AQIA 2NRVA 3RSEA 1IBMK 2D1KA 1E4FT 1TKZA 1R0AA 1TAQA 3HP9A 2IOCA 3NMUA 1X3NA 2DTUA 2Y1JA 4DLGA 1GLAG 4CIGA 3EEQA 4HUEA 2HBKA 4NCAA 2NUBA 4KH5A 3VGKA 3OYKA 3MXMA 1MDUB 4X64K 4CEQA 5GAHP 4DTOA 3QINA 3BP8A 2VQEK 5EOYA 1ZBFA 1NU0A 2Q31A 5AQZA 2YV0X 4CJQA 3NGZA 1SV5A 1S1TA 4DR2K 5BRFA 3CC2N 4OGEA 4PWDA 4LH4A 1DT9A 5HP1A 3QDKA 4FWSA 3CJBA 2OZSA 1FXXA 4WQ4A 3DM2A 2OTLN 4LFAK 3OYMA 4DTNA 3ZLJA 1HKCA 2UXCK 5CR4A 5M1NA 1GLDG 4E7HA 2BE2A 2UXBK 3QESA 2YKNA 3BGRA 4Z4CA 3ZSZA 5AQMA 3VQ7A 4B9SA 3TAGA 4OPAA 1ATNA 1OH7A 4KFBA 4U67L 3MX2A 1QZ6A 1RDWX 2O4IA 3TU5A 3KWIA 4K25A 3O6WA 3VMFB 3D45A 1VQLN 1LW2A 3QFPA 1CZBA 3ZT1A 3FLCO 4O5FA 1OH5A 4YORA 1J9AA 3IUCA 4BGBA 2GTDA 1TKDA 2G8FA 3SJJA 5LJVA 2FF6A 5CZ2A 1L3VA 3ZETB 3VEOA 3BZCA 1TUYA 4JV5K 4BR7A 4E1JA 5AR0A 3V9UA 1HR0K 1Q18A 4F8RA 1XWLA 4RG8A 5KPTA 1TKXA 5H1SQ 4B9MA 5HLFA 1EQYA 4LFCK 2E1YA 3SZ2A 2AP1A 3VESA 3NHGA 4HUFA 4LF8K 5HROA 2FSNA 3ZETA 4FJXA 4NLBA 1D5AA 1RDDA 5LMNK 1U49A 1BI4B 4B3OA 3LDLA 4Q5VA 4KB0A 3E9LA 1VSHA 4CGDA 4B9VA 4A5AA 4CZHA 1P90A 2Z1GA 5C15A 3MWPA 4OO1J 4V19S 3TTCA 1HQUA 3VF6A 2PYJA 4YY3K 4YOYA 4J2EA 1NK5A 3VN5A 2P51A 2NRXA 5BPMA 4J2DA 1BI4A 1RBSA 3WXLA 4DS5A 3NVKA 3M1FA 1WLJA 2F9TA 3O1WA 2I7PA 3B6OA 4H5NA 4MDAA 5CZ1A 1J6ZA 3HZ6A 4AHRA 4Z4GA 1RT4A 4BRAA 3AO5A 2AJQA 4CHQA 4FLVA 5LJWA 4IFEA 2AA4A 4KHYA 1NJYA 2HBLA 3H46O 3QERA 1Q86O 4JHDB 2YKMA 3ITHA 3LM9A 4Z94A 1ZBHA 3O4WA 4R5PA 1SL0A 3L4IA 3KK2A 3SQ2A 4CZJA 2YX6A 1LOTB 4E7IA 4E3SA 4LD0A 4BVPA 3ASMA 4CZMA 1BL3A 4B3RK 2Q1NA 4LF6K 4OLAA 4BY9C 4ZTJA 3CCQN 4FLTA 1IKVA 4JHDA 4CJVA 2IDOA 3VQ9A 1WSEA 4DFKA 4CIEA 1BHLA 2VGNA 1GLEG 2UUAK 1BQNA 2E8AA 3V9XA 2HHUA 1CXUA 5M1OA 4PHTX 1NK9A 2JLEA 4OGCA 2Q2RA 4KH6A 1R59O 3OYIA 4OKKA 4DU1A 3HL8A 4WCEL 4AM6A 3L2WA 3NVMA 1ZBLA 3LDQA 4DV4K 4CJSA 1KVBA 2XO7A 2ZE2A 3CJ7A 4I9LA 3MEEA 2HHXA 5JMVA 4BGAA 4M3RA 1S72N 1WSGA 3KIOA 1NOZA 1D9DA 5FRMA 4O55A 3AVNA 4FWRA 4CK3A 2QI2A 3VTIA 3K0SA 4ID5A 5F2RA 1S9GA 5GINA 4CJTA 4KI4A 4YFUA 1HPZA 5C25A 3WT0A 4FSVA 3O9TA 1VRUA 3JS6A 3BDPA 1RGIA 4M45A 4IG0A 3UE5A 1NM1A 3O9QA 3VQCA 4C1NK 4ISFA 1REVA 1RDUA 2GWJA 4JKGB 3SYZA 1VQ5N 3CCUN 1X9SA 1E4GT 4NB4A 3SBTA 5C2DA 1MA9B 2G8KA 3VQAA 4WE1A 1OH6A 4BRCA 4FOIA 1HJRA 4XEIA 5LL6Z 3RTVA 4IO8A 4DR3K 5E84A 1Q82O 3OBYA 2IS3A 4BC4A 1YI2N 4JKGA 3ID6A 4OPKA 5AZIB 4M41A 3HSTB 3O3FA 3TWHA 1L3SA 1G99A 2KFZA 4CJPA 4DQSA 4FXDA 5GIOA 4F9OA 4H03B 3UB5A 1HYZA 4K42A 1SKSA 2DFHA 1XNRK 2YCHA 3NH1A 4FJ8A 1KFDA 2NRWA 2FBVA 3RWUA 1K6YA 3VQBA 2O8DB 3LAKA 5AZIA 3A8YA 3MXJA 3MWTA 3CIPA 4H0XB 4M3UA 5C12A 4BE0A 1VSKA 3D2FB 3VA0A 1K8AO 3CQXA 4QS8A 5AQQA 3V9SA 1F21A 1NMNA 3SUOA 2W6LA 4LF7K 3H08A 3THXB 4IFVA 2YJEA 4X62K 3E9PA 2E6MA 3O9UA 2KZZA 4H5RA 5JVGL 1BA0A 3DI6A 1NGEA 1B92A 2O8DA 2GEMA 5AQVA 3C95A 4ISGA 3UIQA 2CH5A 3UKRB 4CK2A 1A5WA 3D2FA 3Q7CA 3OW2M 4DUZK 3SUNA 5KPZA 3ZSXA 2O8EB 3TABA 4FVUA 4BRGA 1Q7YO 4IKFA 3V1OA 1IKWA 4LF5K 3AO4A 3CD6N 3THXA 5TKYA 1GOAA 4CEOA 1NK8A 3WNEA 4JS5A 4AHVA 3AO2A 4HVJA 3L2UA 2OPSA 2ZF5O 3PUFA 2IGIA 3UKRA 2D0PA 2E20A 1XI1A 3RR8A 3VF2A 4FLZA 2O8EA 3QEVA 4CJFA 4ZHRA 1RBTA 5JICA 3G71N 1VQ9N 1QSLA 3DJCA 4KHWA 4CHPA 4XIUA 3J7AP 2YNHA 3KLEA 2I7NA 2P9NB 4DB3A 3WXIA 3WNGA 1KAYA 3VEYA 1XHXA 1Z6RA 3DLGA 1L5UA 1RDBA 3NF9A 2D0OA 2GV9A 2D4WA 3SAFA 5C0YA 1NJWA 2HNZA 3HRGA 1NK6A 4CEAA 4PKGA 2EX3A 3L6QA 3VQQA 2ZJQL 3L2QA 5A2QO 3CCMN 5AQHA 1HX1A 2P1JA 4JK7A 1KC8O 2P9NA 1YHQN 4OLBA 4CE9A 3OHRA 2IIRA 5GIPA 1I3AA 4EZ9A 3W3DA 4ILHA 5HRNA 3HI0A 1N6QA 4HWIA 2WC9A 2G8WA 4KHPK 3GG4A 3IRXA 3P38A 4AHTA 4B9QA 2P5GA 2BUPA 3KD1E 4OVLA 4BWJA 4CZIA 3VQDA 4XH1A 4CERA 2UXDK 4DSLA 1LWCA 3HOSA 1KLNA 3MMVA 2VGMA 4FJJA 1T3VA 4A59A 4CGJA 2Z1JA 1G15A 4JI1K 1TL3A 1TYQB 2D0CA 3P5JA 3AVIA 4CFBA 5AQPA 2UYTA 4JEPA 2FBYA 1JLCA 1OKJA 2XY6A 1HYSA 3G25A 4AHCA 1Y97A 4AHUA 4LSLA 1EETA 2VYPA 3AY9A 5BN9A 2OPPA 1P8ZA 5ADXH 3EKSA 3SJHA 4JS4A 4B3TK 2ETJA 3THWB 2A1RA 1VQON 2OCEA 3C0BA 2O4GA 1TYQA 3OVNA 3S3MA 4WQ4C 4KPYA 4YHHK 1HUXA 2QWOA 2QXLA 4YOUA 5F1XA 1X9MA 3AVGA 3BEXA 3THWA 3SQ1A 5FPDA 2RHKA 3U3GA 4BQLA 3LANA 3MK6A 4FJIA 1RNHA 3HYFA 3ZSQA 4CJEA 4O5BA 4NCBA 1KAZA 2VCPA 4CF0A 1BQMA 5FLXO 1HMVA 2YHWA 1QQCA 3O9RA 1K73O 2KFNA 2GX9A 2H3GX 1VSLA 3LDSA 5D3GA 4MLHA 2A6AA 2ASMA 1U2VB 1IH7A 1TKTA 2QW9A 3AA5X 3HPGA 4H4OA 3ENBA 4B8AB 3PV8A 4JKDA 2X6NA 1UA0A 2ZGYA 3WNFA 2BH1A 4FL9A 4DHYA 5AQUA 3D6RA 4CF2A 2PAVA 2HMIA 4ELTA 4DR6K 4CGHA 4DWIA 1J53A 2J4RA 4CW7B 2Q36A 2V52B 2HOEA 4JKHA 2OA8A 5AJ3K 2P9IB 4AF1A 4DF8A 1KXPA 3M8RA 1VSMA 1T03A 3C7NB 3OYNA 2VG5A 1E3MA 1ITGA 5AFUH 4BR0A 4KAZA 3VQPA 1X9JA 1SL1A 1U2VA 4M3WA 4M7YA 3CF5L 3D2EA 4AH9A 1YJNN 3DOKA 4C23A 3L3UA 2QKKA 3P1GA 3VQ4A 3BZKA 4FOEA 1NG9A 1YTAA 2P9IA 4DFJA 2XY8A 3QEPA 2HVIA 1MWMA 1RFQA 1C1BA 3I56N 3C7NA 4JLHA 2BTFA 4K0KK 2ATQA 1QHTA 3O5BA 4CF1A 3K59A 4NLCA 4BR2A 5C42A 3OTOK 4YOVA 3SCXA 3VQEA 1HJOA 3I8BA 4LC9B 3EY1A 1EX4A 4BDPA 3ISNC 2R7YA 2YJFA 3HPHA 3CCSN 1XC9A 5B8HA 3BY5A 3OJSA 4DKWA 1ZBUA 2P9PB 1HNWK 3LDNA 4KH4A 5FDLA 3U4LA 1Y64A 3ZX2A 3R8EA 5C2FA 4FCYA 4E1NA 3R1XA 4FLUA 5KTQA 4RW9A 1W7AA 2PYLA 3VA3A 4FLYA 3CFPA 3F9KA 3TARA 5LY3A 3C94A 4GV6A 2P9PA 3QO9A 2Q97A 3QEWA 4C1NI 3R9PA 3MN9A 1NGJA 2YHBA 1WBDA 5FPMA 4IJAA 2Z1IA 4MQ3A 4W5QA 2D0AA 1XNQK 1TUUA 3S3OA 1LAWA 4KREA 3OJUA 1SZ2A 2D5RA 1QZ5A 2HF4A 3PO4A 3AGKA 3AA3A 3KLFA 1WN7A 2O8FB 3CMAN 2F9WA 2HF3A 3HP6A 2Y1IA 4DV3K 1HQEA 2HNDA 3KK3A 4H0VB 3AVJA 3O80A 4QOZB 2HHTA 4C8MA 1JXBA 5I42A 3IG1A 3FZHA 2PY5A 4YNQA 1BG3A 2VG6A 2Q0RA 4IZ9A 4CJRA 3ULDA 5LMUK 4A61A 1S9EA 3NGIA 2V7YA 1XQSC 5AQLA 2O8FA 4JI3K 5AQXA 4FJHA 3VPZA 2NRZA 3LP0A 4BE1A 4GKKK 4WFNL 5F0XA 3T3FA 4KKOA 4CGFA 4Y1DA 1S1XA 3QBXA 4M3YA 3M8QA 3C6TA 3GOIA 3T1AA 1NGHA 4DV1K 2RN2A 3SMSA 2EWSA 2QXFA 3FR0A 1J54A 1NGIA 4CECA 4JK8A 2RF2A 1YXQA 4QS9A 4QCLA 3OYEA 1VSIA 4FWPA 3I0RA 5KQDA 4CZEA 3CFRA 1RT1A 3VEXA 1BIUA 2P9UB 1QS4A 3TAEA 3TAMA 5BPLA 3CCEN 5KGXA 3ZX3A 3DOLA 3AA2A 4WQ5A 3K5MA 3DMJA 3AARA 5HRPA 1NGBA 4KTQA 4G9ZA 3FZKA 4I7FA 3ULEB 4EHTA 4M3ZA 1NGCA 2NRHA 4B1XB 4EHUA 1TGOA 2QEXN 3PLAA 4H8KA 3SPZA 3FZLA 1HKGA 3N4QA 5TKWA 4H5TA 2P9UA 3HXMA 4DTRA 4Y0WA 2ITGA 4YOWA 3ZT4A 1NKBA 5M1FA 5HL7L 3NF6A 4DSKA 4KRFA 4CJ7A 3EN9A 5AQOA 5KPRA 4GV9A 3ULEA 1WBBA 4CBWA 2ASPA 4DV6K 3AVKA 1A5XA 3K57A 2G8VA 3P31A 1ATSA 5FPNA 3OYCA 3TANA 4BC5A 3OYBA 1DLOA 3VETA 3MN6A 1FW6A 5FROA 4N47A 1DGKN 5EY4A 3A5LC 4RTFD 3QETA 3OA9A 4CBXA 4JI8K 5AQWA 1LCUA 5HRRA 4JRQA 4DQPA 3SBGA 4PUOA 1YJWN 3NF8A 1DEJA 1VQMN 4FW2A 1T44A 5E26A 4GKJK 3FZMA 1SUQA 1S1VA 4CCHA 2ASOA 4YOXA 3SQ0A 4OPHA 1OH8A 1BWFO 1SS6A 3S3NA 1C0TA 4FJGA 5BN8A 3SPYA 4FK2A 4N76A 3MN5A 1ASVA 4WYBA 2LSNA 3CMEN 4O8KA 1BU6O 4HTUA 4EP5A 3K2PA 1N32K 4FW1A 4DSFA 1QQNA 2F4VK 1NLVA 3M5RA 3OY9A 2JGUA 1HNVA 3CCRN 1YVNA 4BR9A 3HM9A 2QA4N 1NOYA 4B9LA 3AA4A 3IDHA 1QVFM 1GLCG 4RCHA 4GMJB 4IO9L 3F2KA 3WUHA 4B3SK 1LWFA 3PO5A 4YDUA 3HVTA 2HHWA 3RMDA 4HUGA 3V6DA 1VRTA 1S1WA 3NFAA 3M6GA 2BANA 4CEEA 4ZTFA 1NK7A 3M8SA 1VK0A 4C8KA 1VSFA 3MCPA 3O9SA 2P9SB 2GWKA 1SKRA 5AQSA 4F3OA 4CJLA 4CZFA 1VQ4N 1S3XA 1J5EK 4FLXA 3TTDA 3I8DA 1FKOA 3R3LA 3AAQA 5CYMA 1CXQA 2KZMA 1HNZK 2FBTA 1JCFA 4JKBA 5GAGP 3VEZA 3FZFA 4CJWA 3AO1A 4A5BA 4M3TA 2P9SA 1SL2A 1BISA 4DTJA 4FZXC 4BWMA 3OYDA 4BDYA 3MN7A 4JKAA 1C0UA 2O8CB 2VWKA 3LWLA 4FJ5A 1I39A 4FWLA 5I3UA 2HHVA 3U6FA 4CFCA 1XC3A 1IKXA 3EE8A 4DV7K 3A5MC 2IAJA 1YIJN 2KLAA 4RW8A 3CERA 3SK3A 3PX4A 3EO3A 2WUSA 2FSJA 4EAHD 3DLBA 3SLCA 1V4SA 3LZIA 4B1VA 3IFRA 2O8CA 3DWLA 1JLBA 3RVCA 3HM8A 4CD1A 2P9LB 1SKWA 4FWOA 1M1KO 3CQYA 4FJNA 4FZYA 2KQ2A 4BRDA 3K58A 1JKHA 3CI5A 3T19A 1YUWA 4E0DA 5KRTA 1YT3A 3BF1A 4JI7K 4ICLA 1GOBA 3RRGA 3RMBA 5GADP 4NO7A 1XHZA 1NGGA 2P9LA 4FJ7A 3LM2A 4IBNA 3NH0A 4FPAA 1NJZA 1NKEA 1WAFA 3CPWM 1RT3A 1MU2A 3AVAA 4EP4A 4KHNA 1FJGK 3GE1A 2DY4A 4J2BA 3E66A 5EX5A 3ZSYA 3GBTA 5KI6A 3KWGA 2GELA 4O44A 3VERA 3THVA 4OKJA 1IBLK 4M63C 1NKCA 3OYHA 1IO2A 4PA1A 3IMXA 1WSJA 4DV5K 1EXQA 2F7TA 2XY7A 3VTHA 3U9ZA 5I9EB 1M90O 3AVLA 4FJMA 4BRFA 2RE2A 3QBWA 3OBWA 3U8XA 2OANA 1IKYA 1RT5A 1Q9YA 3P39A 4CESA 3VEWA 1VSDA 3G6EN 2XY5A 3KKRA 1LW0A 4IOCL 2CGKA 4K8XA 4CEZA 3MCAB 1KFSA 3O3HA 3VENA 4DU3A 3J7YP 4B08A 2ZD1A 1RCHA 1SQKA 4M42A 1ATRA 1LWEA 4ILGB 1KTQA 5C24A 4XH5A 1KQSM 4KTZA 3DRSA 3A2FA 4IOXA 3PIOL 3CYMA 1W9HA 4OKEA 1NGDA 5AQGA 4CGGA 2F8SA 5AZJB 3THYB 1U47A 5GAEP 5KRSA 2QM1A 4FWQA 3O1BA 3SV4A 3LP3A 4ID1A 1RT2A 3BF3A 4I9QA 3JXUA 3HO1A 3T1YK 2WONA 1BUPA 3ID8A 2E4LA 4KV8A 3DYAA 4B1YB 4W5OA 3EYZA 3TAPA 3CM5A 1ZBSA 2PBDA 4FM1A 3VQ8A 3TSQA 4BE2A 4O4GA 2VG7A 3CETA 3WXMB 4RW7A 2OYQA 1C0FA 3SAGA 5IT9O 1VQPN 5AZJA 2DPNA 3THYA 3SAHA 3PY8A 1WAJA 4R79A 3SI6A 5AQJA 4F2SA 4BRKA 3VQ5A 3ZSRA 3LPUA 1JLQA 4OJRA 5T7BA 3V1RA 3AGRA 4FZZA 2ZQBA 2W6KA 4CBUA 4K8ZA 3RRHA 2WOMA 4GV3A 3EE9A 4BRQA 3ZSWA 1RBRA 2A42A 3KKSA 4DMNA 4DSEA 4BDZA 4DR7K 4N41A 3R6MA 5M1PA 3QB0A 2E2NA 5J2MA 2P5OA 4DTXA 1B9FA 4FPBA 5C10A 4MO4A 5BRHA 4DTPA 3OYJA 5MLCQ 3E9OA 3LP1A 4JAXA 1NK4A 3A0IX 2QWPA 3VOVA 4E89A 3U3YA 4A2BA 3PIPL 1YITN 1ASWA 1QSSA 3SNNA 3AV9A 3V9WA 3HBTA 2ZWHA 4HCBA 3D7EO 3VEVA 3RMCA 1Z05A 1NWKA 1RDCA 2WBNA 4BR5A 4PL7A 1KD1O 4C8OA 4DSJA 1T6CA 3A5OC 1KRPA 2O8BB 3G4SN 2HB5A 3L2RA 2OPRA 4NYFA 4B9NA 4BRIA 2W40A 3HSCA 3VQ6A 2GUPA 3CQ8A 4FO0A 5CE3A 3P83D 4KHUA 3LL3A 3KD5E 1HRHA 2UUBK 3G10A 3MXIA 3H1VX 2E6LA 3DXKB 2O8BA 3TPQA 1VQKN 4LH5A
chains in the Genus database with same CATH topology
3MEGA 3K5OA 2QXFA 1J54A 4CK3A 4CECA 1D8YA 2RF2A 4QCLA 2QKBA 4F3TA 2Q3SA 3D0PA 3OYEA 4DF4A 1QSYA 4JRPA 1VSIA 3SV3A 4B9TA 3I0RA 4ID5A 1D9FA 1BGXT 2OPQA 4E1MA 2A1SA 3CFRA 1RT1A 1C1CA 1BIUA 1S9GA 1DTQA 1WSHA 3NDKA 1NJXA 2X74A 2Z1HA 1EKEA 1QS4A 3B6PA 1ASUA 4MFBA 4CJTA 3TAMA 3TAEA 2HNYA 4YFUA 1HPZA 5C25A 5KGXA 4KI4A 3AVMA 3AA2A 3DOLA 5CY4A 4W5NA 3K5MA 3DMJA 2YNFA 5HRPA 3QIPA 1VRUA 4CEBA 4BACA 4KTQA 4CK1A 4I7FA 3K5NA 3BDPA 4M3ZA 4ELVA 4M45A 4IG0A 1TGOA 2G8HA 4IFYA 3VQCA 1L3TA 3AVBA 1REVA 4H8KA 4E7KA 3SPZA 3LP2A 1RILA 3ZCMA 2GUIA 3SYZA 1X9SA 1Q9XA 4DQQA 2HW3A 1YVUA 3CM6A 4O0IA 3V1QA 2G8KA 3MAQA 3VQAA 4WE1A 3HXMA 4DTRA 3KTQA 2IC3A 2ITGA 4RW4A 1HJRA 1BCMA 1LV5A 4CHZA 4DSKA 3ZT4A 1NKBA 3NF6A 2GBZA 1N5YA 4KRFA 3RTVA 4KI6A 1WNSA 4LY7A 3FFIA 4DU4A 2IS3A 3DLEA 3AVKA 1A5XA 3K57A 3LZJA 1JL1A 3TANA 3L2VA 3OYCA 2G8VA 1RT7A 1RTIA 3TR8A 4OPKA 4LSNA 3OYBA 1DLOA 4M41A 3HSTB 3O3FA 3TWHA 1L3SA 4N47A 4GVMA 5FROA 4DLEA 4NCGA 4CJPA 4DQSA 3QLHA 4DQIA 4KB1A 4FXDA 2KFZA 1JXEA 5K14A 3S9HA 2YNGA 3KLHA 2YNIA 3HK2A 4CEFA 4KO0A 3QNOA 1HYZA 3K5LA 3V9ZA 3QETA 1SKSA 4FYDA 2DFHA 2RPIA 2XRIA 3LWMA 2X6SA 3ZT0A 1L3UA 1FKPA 3NH1A 4DS4A 4FJ8A 5HRRA 4JRQA 5HBMA 1KFDA 4DQPA 2FBVA 1TVRA 4E7LA 3RWUA 1K6YA 1NK0A 1RTHA 3VQBA 3PX0A 4PUOA 1KCFA 3NF8A 5FRNA 3HJFA 3LAKA 3KJVA 1UOCA 3MXJA 4FW2A 4M3UA 3AVCA 3AO3A 1SUQA 1S1VA 4CCHA 1BIZA 4BE0A 3QIOA 1VSKA 3VA0A 3SQ0A 1WSIA 4FJGA 3S3NA 1C0TA 3V9SA 1QTMA 3SPYA 5J2QA 1U45A 4N76A 4FK2A 1ASVA 1F21A 4DTMA 2LSNA 3SUOA 3QEXA 4HTUA 3H08A 3V81A 4EP5A 4IFVA 1RBVA 3DLHA 3K2PA 1S1UA 4FW1A 1VSEA 4DSFA 2RKIA 2E6MA 4L8RB 2KZZA 4E7JA 3RMAA 4C8LA 3OY9A 3DI6A 1TV6A 1HNVA 1B92A 2JGUA 3IS9A 4J2EA 3SQ4A 3HM9A 3C95A 3UIQA 1NOYA 4N5SA 3V4IA 4CJ3A 2QK9A 4O0JA 4CK2A 3ZT3A 5HRSA 1A5WA 1JL2A 3AA4A 4B9LA 3EZ5A 4CHYA 3QNNA 4M3XA 1WSFA 3AVHA 2HVHA 3SUNA 4GMJB 1Z25A 3ZSXA 3TABA 1LWFA 4IKFA 3V1OA 1UAXA 4C8NA 3KK1A 3PO5A 1IKWA 4DFPA 1VSJA 3AO4A 4FVMA 1RDAA 1GOAA 5DK5A 4CEOA 5SZTA 1NK8A 3HVTA 3WNEA 4W5RA 4JS5A 4DTUA 3DLKA 4O55A 4OPJA 1A5VA 3RMDA 2HHWA 3RR7A 1S5JA 4AHVA 5SWMA 3HVRA 3AO2A 5DMRA 4HUGA 3V6DA 1VRTA 4HVJA 4FK0A 1KSPA 3L2UA 1YTUA 2OPSA 4PY5A 1S1WA 3NFAA 3SUPA 2F8TA 3PUFA 4QAGA 2BANA 4CEEA 4ZTFA 4CHNA 3M8SA 1VK0A 2IGIA 1NK7A 3L8BA 4C8KA 1XI1A 4KTWA 1VSFA 1S6QA 3WNHA 3RR8A 4W5TA 3OS2A 4FLZA 1SKRA 1UA1A 3QEVA 4F3OA 4CJLA 4DTSA 3CG7A 3HPOA 4CJFA 4ZHRA 4Z0UA 1GOCA 2DFEA 3G0ZA 3LALA 4G1QA 3OYFA 1FK9A 1RBTA 4KHWA 1QSLA 3O4NA 4FLXA 4CHPA 4XIUA 3NGYA 1FKOA 2YNHA 3I8DA 3NF7A 4DQRA 4FK4A 4IDKA 3KLEA 3C6UA 5CYMA 4TSXA 1CXQA 3WNGA 1XHXA 2KZMA 3DLGA 3MEDA 1CLQA 2FBTA 4CJUA 3ZSOA 1L5UA 1KVAA 1RDBA 3NF9A 3AVFA 4N56A 2GV9A 1T7PA 4Y1CA 4PQUA 4CJWA 3TI0A 1TK5A 2KW4A 3AO1A 3M8PA 3IAYA 3L3VA 4M3TA 1SL2A 1BISA 1Z26A 4CHOA 4IG3A 1JLGA 2HNZA 3LAMA 4DTJA 1NJWA 1NK6A 1EP4A 4BWMA 4FZXC 4CEAA 3OYDA 4ELUA 1U04A 4BDYA 4Z4IA 2EX3A 2BGGA 3OYLA 3VQQA 1TKZA 1ZYQA 1C0UA 3L2QA 2VWKA 1R0AA 3LWLA 4FJ5A 3KLIA 1TAQA 3HP9A 4FJLA 2B4JA 1I39A 2IOCA 2P1JA 3O4QA 2D0BA 2Y1JA 2DTUA 4DLGA 5I3UA 2HHVA 4Q0BA 3U6FA 4CE9A 4CFCA 4OLBA 4CIGA 1HNIA 1I3AA 4EZ9A 5JS1A 1IKXA 4HUEA 5HRNA 2IAJA 4NCAA 2NUBA 1N6QA 3OYKA 3MXMA 2G8WA 4RW8A 2VWJA 4B8CA 3PX4A 4NYNA 3DLBA 3IRXA 4AHTA 3LPTA 1U48A 4CEQA 3LZIA 2P5GA 3KD1E 4OVLA 4BWJA 3VQDA 4AILC 4DTOA 4CERA 3JYTA 1JLBA 3QINA 4DSLA 1LWCA 1KLNA 1ZBFA 4FJJA 2YV0X 4CJQA 3NGZA 1SV5A 3NH2A 1SKWA 4Z4FA 4FJKA 4CGJA 1S1TA 2Z1JA 3KLGA 1G15A 1UWBA 4FZYA 4FJNA 1TL3A 3DLRA 2D0CA 3P5JA 1LAVA 2KQ2A 3AVIA 3CFOA 4CFBA 3K58A 1JKHA 4OGEA 4PWDA 4LH4A 2FBYA 1JLCA 2XY6A 1HYSA 3T19A 5HP1A 4E0DA 4AHCA 5KRTA 2OZSA 1YT3A 1Y97A 4AHUA 1FXXA 1C6VA 4LSLA 1EETA 4ICLA 1GOBA 3DM2A 2B5JA 3RRGA 3RMBA 2OPPA 3OYMA 4DTNA 4JS4A 2ETJA 1XHZA 1J5OA 2A1RA 4AHSA 2HHSA 2XHBA 4FJ7A 2B6AA 4IBNA 4E7HA 3NH0A 1NKEA 1NJZA 2BE2A 1WAFA 1RT3A 1MU2A 3AVAA 4EP4A 4KHNA 2DY4A 3QESA 4J2BA 2O4GA 2YKNA 2PZSA 3BGRA 3OVNA 4Z4CA 4FLWA 3ZSYA 3S3MA 3ZSZA 5KI6A 4CFDA 4KPYA 3VQ7A 3THVA 4O44A 4B9SA 4OKJA 3TAGA 1ZBIA 1U4BA 3TAFA 1NKCA 3OYHA 1IO2A 4KFBA 4PA1A 4GW6A 1WSJA 4EZ6A 2O4IA 1EXQA 1W0HA 3AVGA 1X9MA 3SQ1A 2XY7A 3D45A 1LW2A 1Q8IA 3U3GA 4J2AA 1CZBA 3ALYA 3AVLA 3ZT1A 3LANA 2F96A 4FJIA 4HCCA 4FJMA 4FJ9A 1RNHA 3HYFA 3ZSQA 4CJEA 4O5BA 4DG1A 1B9DA 1RTDA 1J9AA 4NCBA 4RW6A 4CF0A 1BQMA 2G8FA 1TKDA 4KHSA 1O1WA 3SJJA 1IKYA 1RT5A 1HMVA 5CZ2A 1QQCA 1Q9YA 1L3VA 4CESA 1T05A 1VSDA 2KFNA 3NAEA 4CJ5A 1CZ9A 3OS1A 3KKRA 2XY5A 1LW0A 1VSLA 5E41A 3NE6A 4K8XA 4CEZA 3LDSA 1KLMA 1KFSA 3O3HA 5D3GA 3V9UA 4F8RA 5J1EA 1IH7A 4DU3A 1TKTA 3AA5X 1XWLA 3HPGA 4H4OA 4RG8A 1TKXA 5JS2A 4B8AB 3JSMA 3F73A 3PV8A 4B08A 2ZD1A 4CF8A 1RCHA 2X6NA 5J2PA 1UA0A 3WNFA 4B9MA 2DFFA 5HLFA 4M42A 1LWEA 4CF2A 2YHAA 1RBUA 3SZ2A 1KTQA 5C24A 3ZSVA 1TK8A 2HMIA 4ELTA 4CGHA 4DWIA 1J53A 4KTZA 3DRSA 3A2FA 3MECA 4Z4EA 3NHGA 4HUFA 2OA8A 4DF8A 5HROA 2I5JA 3CYMA 3M8RA 4DFMA 4FJXA 1VSMA 4Z4HA 1T03A 1W9HA 4OKEA 1JLFA 3OYNA 1D5AA 2VG5A 4CGGA 2F8SA 1ITGA 1RDDA 4KAZA 1JLEA 1U49A 4KHQA 3VQPA 1BI4B 1SL1A 4B3OA 1QE1A 1U47A 4Q5VA 4M3WA 5KRSA 4KB0A 1C0MA 1VSHA 4AH9A 3SV4A 3DOKA 3LP3A 4ID1A 4CGDA 1RT2A 3QEIA 4B9VA 3L3UA 5J2NA 2QKKA 4I9QA 3HO1A 2Z1GA 1X9WA 4FM2A 2WONA 3P1GA 3VQ4A 3ZT2A 4KV8A 2E4LA 4I2PA 3DYAA 4W5OA 3EYZA 3TAPA 3CM5A 4F2RA 1HQUA 1YTAA 4DFJA 2PYJA 4FM1A 2XY8A 4CFAA 3VQ8A 3QEPA 2HVIA 1C1BA 2VG7A 4O4GA 1RT6A 1S6PA 4JLHA 4RW7A 4BE2A 2OYQA 2ATQA 1QHTA 4CF1A 3VN5A 3K59A 1NK5A 2P51A 5C42A 4J2DA 1BI4A 1RBSA 3PY8A 3SCXA 3VQEA 1WAJA 3SI6A 4BDPA 3EY1A 1HYVA 1EX4A 4DS5A 4F2SA 2OZMA 3ISNC 5EU7A 2R7YA 1WLJA 3VQ5A 3HPHA 3ZSRA 4CGIA 3LPUA 1BCOA 2KTQA 1XC9A 1KVCA 1JLQA 2FC0A 2BDPA 4OJRA 3OJSA 3B6OA 1ZBUA 3V1RA 5T7BA 5CZ1A 4FZZA 2HHQA 2ZQBA 2X78A 4AHRA 5FDLA 3HT3A 4Z4GA 1RT4A 4K8ZA 3AO5A 3RRHA 2WOMA 2AJQA 4FCYA 4CF9A 3ZSWA 1RBRA 4E1NA 4CHQA 3E01A 1JLAA 5KGWA 3KKSA 4FLUA 4FLVA 4B9UA 5KTQA 4RW9A 4DMNA 4DSEA 4UQGA 1NJYA 4KHYA 2W42A 4BDZA 1DTTA 4CJKA 1TL1A 4N41A 1C1AA 5J2MA 2PYLA 3VA3A 3QERA 2P5OA 4FLYA 3CFPA 3F9KA 1B9FA 4DTXA 3TARA 2YKMA 4DTPA 3ITHA 3C94A 2EHGA 3OYJA 1ZBHA 3QO9A 3LP1A 3QEWA 4R5PA 1SL0A 3KK2A 3SQ2A 4F4KA 1NK4A 2YHBA 2G8UA 4E19A 2Z1IA 4E7IA 4E3SA 4MQ3A 4LD0A 4E89A 4W5QA 2D0AA 3U3YA 3ASMA 3S3OA 1LAWA 4KREA 3OJUA 2D5RA 1ASWA 1QSSA 1BL3A 3PO4A 3AA3A 3AV9A 1WN7A 3KLFA 4FM0A 3V9WA 3SNNA 4OLAA 4ZTJA 3OS0A 3HP6A 4HCBA 2Y1IA 4FLTA 1IKVA 1HQEA 3O3GA 2HNDA 4CJVA 2IDOA 3KK3A 3VQ9A 3RMCA 3AVJA 1WSEA 4QOZB 2HHTA 4DFKA 4CIEA 1BHLA 4C8MA 4DSIA 1RDCA 3NBPA 1JXBA 5I42A 1BQNA 3IG1A 4CIFA 2PY5A 4C8OA 4HHTA 1T8EA 4DSJA 4YNQA 3V9XA 2VG6A 3ULDA 4CJRA 2HHUA 1CXUA 1NK9A 4CEDA 1KRPA 3OYAA 1RTJA 2JLEA 1S9EA 2HB5A 4OGCA 3L2RA 2OPRA 3NGIA 3I0SA 4NYFA 3OYIA 4OKKA 4DU1A 3HL8A 3PX6A 2FBXA 4B9NA 5CYQA 3L2WA 4FJHA 1ZBLA 3VQ6A 3SUQA 1X1PA 3LP0A 4BE1A 3CQ8A 3T3FA 3TAQA 4CJSA 3DRRA 1KVBA 3P83D 4KKOA 4CGFA 2XO7A 3KD5E 4KHUA 1TK0A 2ZE2A 4Y1DA 3NCIA 1HRHA 4I9LA 3MEEA 1S1XA 2HHXA 4M3YA 3M8QA 3C6TA 3G10A 4I2QA 4M3RA 3MXIA 1IG9A 2G8IA 1TAUA 2E6LA 3OYGA 4H4MA 1WSGA 4CJ4A 3KIOA 3T1AA 3DRPA 1NOZA 1D9DA 5FRMA 2RN2A 3AVNA 4LH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MEG A;  3K5O A;  2QXF A;  1J54 A;  4CK3 A;  4CEC A;  1D8Y A;  2RF2 A;  4QCL A;  2QKB A;  4F3T A;  2Q3S A;  3D0P A;  3OYE A;  4DF4 A;  1QSY A;  4JRP A;  1VSI A;  3SV3 A;  4B9T A;  3I0R A;  4ID5 A;  1D9F A;  1BGX T;  2OPQ A;  4E1M A;  2A1S A;  3CFR A;  1RT1 A;  1C1C A;  1BIU A;  1S9G A;  1DTQ A;  1WSH A;  3NDK A;  1NJX A;  2X74 A;  2Z1H A;  1EKE A;  1QS4 A;  3B6P A;  1ASU A;  4MFB A;  4CJT A;  3TAM A;  3TAE A;  2HNY A;  4YFU A;  1HPZ A;  5C25 A;  5KGX A;  4KI4 A;  3AVM A;  3AA2 A;  3DOL A;  5CY4 A;  4W5N A;  3K5M A;  3DMJ A;  2YNF A;  5HRP A;  3QIP A;  1VRU A;  4CEB A;  4BAC A;  4KTQ A;  4CK1 A;  4I7F A;  3K5N A;  3BDP A;  4M3Z A;  4ELV A;  4M45 A;  4IG0 A;  1TGO A;  2G8H A;  4IFY A;  3VQC A;  1L3T A;  3AVB A;  1REV A;  4H8K A;  4E7K A;  3SPZ A;  3LP2 A;  1RIL A;  3ZCM A;  2GUI A;  3SYZ A;  1X9S A;  1Q9X A;  4DQQ A;  2HW3 A;  1YVU A;  3CM6 A;  4O0I A;  3V1Q A;  2G8K A;  3MAQ A;  3VQA A;  4WE1 A;  3HXM A;  4DTR A;  3KTQ A;  2IC3 A;  2ITG A;  4RW4 A;  1HJR A;  1BCM A;  1LV5 A;  4CHZ A;  4DSK A;  3ZT4 A;  1NKB A;  3NF6 A;  2GBZ A;  1N5Y A;  4KRF A;  3RTV A;  4KI6 A;  1WNS A;  4LY7 A;  3FFI A;  4DU4 A;  2IS3 A;  3DLE A;  3AVK A;  1A5X A;  3K57 A;  3LZJ A;  1JL1 A;  3TAN A;  3L2V A;  3OYC A;  2G8V A;  1RT7 A;  1RTI A;  3TR8 A;  4OPK A;  4LSN A;  3OYB A;  1DLO A;  4M41 A;  3HST B;  3O3F A;  3TWH A;  1L3S A;  4N47 A;  4GVM A;  5FRO A;  4DLE A;  4NCG A;  4CJP A;  4DQS A;  3QLH A;  4DQI A;  4KB1 A;  4FXD A;  2KFZ A;  1JXE A;  5K14 A;  3S9H A;  2YNG A;  3KLH A;  2YNI A;  3HK2 A;  4CEF A;  4KO0 A;  3QNO A;  1HYZ A;  3K5L A;  3V9Z A;  3QET A;  1SKS A;  4FYD A;  2DFH A;  2RPI A;  2XRI A;  3LWM A;  2X6S A;  3ZT0 A;  1L3U A;  1FKP A;  3NH1 A;  4DS4 A;  4FJ8 A;  5HRR A;  4JRQ A;  5HBM A;  1KFD A;  4DQP A;  2FBV A;  1TVR A;  4E7L A;  3RWU A;  1K6Y A;  1NK0 A;  1RTH A;  3VQB A;  3PX0 A;  4PUO A;  1KCF A;  3NF8 A;  5FRN A;  3HJF A;  3LAK A;  3KJV A;  1UOC A;  3MXJ A;  4FW2 A;  4M3U A;  3AVC A;  3AO3 A;  1SUQ A;  1S1V A;  4CCH A;  1BIZ A;  4BE0 A;  3QIO A;  1VSK A;  3VA0 A;  3SQ0 A;  1WSI A;  4FJG A;  3S3N A;  1C0T A;  3V9S A;  1QTM A;  3SPY A;  5J2Q A;  1U45 A;  4N76 A;  4FK2 A;  1ASV A;  1F21 A;  4DTM A;  2LSN A;  3SUO A;  3QEX A;  4HTU A;  3H08 A;  3V81 A;  4EP5 A;  4IFV A;  1RBV A;  3DLH A;  3K2P A;  1S1U A;  4FW1 A;  1VSE A;  4DSF A;  2RKI A;  2E6M A;  4L8R B;  2KZZ A;  4E7J A;  3RMA A;  4C8L A;  3OY9 A;  3DI6 A;  1TV6 A;  1HNV A;  1B92 A;  2JGU A;  3IS9 A;  4J2E A;  3SQ4 A;  3HM9 A;  3C95 A;  3UIQ A;  1NOY A;  4N5S A;  3V4I A;  4CJ3 A;  2QK9 A;  4O0J A;  4CK2 A;  3ZT3 A;  5HRS A;  1A5W A;  1JL2 A;  3AA4 A;  4B9L A;  3EZ5 A;  4CHY A;  3QNN A;  4M3X A;  1WSF A;  3AVH A;  2HVH A;  3SUN A;  4GMJ B;  1Z25 A;  3ZSX A;  3TAB A;  1LWF A;  4IKF A;  3V1O A;  1UAX A;  4C8N A;  3KK1 A;  3PO5 A;  1IKW A;  4DFP A;  1VSJ A;  3AO4 A;  4FVM A;  1RDA A;  1GOA A;  5DK5 A;  4CEO A;  5SZT A;  1NK8 A;  3HVT A;  3WNE A;  4W5R A;  4JS5 A;  4DTU A;  3DLK A;  4O55 A;  4OPJ A;  1A5V A;  3RMD A;  2HHW A;  3RR7 A;  1S5J A;  4AHV A;  5SWM A;  3HVR A;  3AO2 A;  5DMR A;  4HUG A;  3V6D A;  1VRT A;  4HVJ A;  4FK0 A;  1KSP A;  3L2U A;  1YTU A;  2OPS A;  4PY5 A;  1S1W A;  3NFA A;  3SUP A;  2F8T A;  3PUF A;  4QAG A;  2BAN A;  4CEE A;  4ZTF A;  4CHN A;  3M8S A;  1VK0 A;  2IGI A;  1NK7 A;  3L8B A;  4C8K A;  1XI1 A;  4KTW A;  1VSF A;  1S6Q A;  3WNH A;  3RR8 A;  4W5T A;  3OS2 A;  4FLZ A;  1SKR A;  1UA1 A;  3QEV A;  4F3O A;  4CJL A;  4DTS A;  3CG7 A;  3HPO A;  4CJF A;  4ZHR A;  4Z0U A;  1GOC A;  2DFE A;  3G0Z A;  3LAL A;  4G1Q A;  3OYF A;  1FK9 A;  1RBT A;  4KHW A;  1QSL A;  3O4N A;  4FLX A;  4CHP A;  4XIU A;  3NGY A;  1FKO A;  2YNH A;  3I8D A;  3NF7 A;  4DQR A;  4FK4 A;  4IDK A;  3KLE A;  3C6U A;  5CYM A;  4TSX A;  1CXQ A;  3WNG A;  1XHX A;  2KZM A;  3DLG A;  3MED A;  1CLQ A;  2FBT A;  4CJU A;  3ZSO A;  1L5U A;  1KVA A;  1RDB A;  3NF9 A;  3AVF A;  4N56 A;  2GV9 A;  1T7P A;  4Y1C A;  4PQU A;  4CJW A;  3TI0 A;  1TK5 A;  2KW4 A;  3AO1 A;  3M8P A;  3IAY A;  3L3V A;  4M3T A;  1SL2 A;  1BIS A;  1Z26 A;  4CHO A;  4IG3 A;  1JLG A;  2HNZ A;  3LAM A;  4DTJ A;  1NJW A;  1NK6 A;  1EP4 A;  4BWM A;  4FZX C;  4CEA A;  3OYD A;  4ELU A;  1U04 A;  4BDY A;  4Z4I A;  2EX3 A;  2BGG A;  3OYL A;  3VQQ A;  1TKZ A;  1ZYQ A;  1C0U A;  3L2Q A;  2VWK A;  1R0A A;  3LWL A;  4FJ5 A;  3KLI A;  1TAQ A;  3HP9 A;  4FJL A;  2B4J A;  1I39 A;  2IOC A;  2P1J A;  3O4Q A;  2D0B A;  2Y1J A;  2DTU A;  4DLG A;  5I3U A;  2HHV A;  4Q0B A;  3U6F A;  4CE9 A;  4CFC A;  4OLB A;  4CIG A;  1HNI A;  1I3A A;  4EZ9 A;  5JS1 A;  1IKX A;  4HUE A;  5HRN A;  2IAJ A;  4NCA A;  2NUB A;  1N6Q A;  3OYK A;  3MXM A;  2G8W A;  4RW8 A;  2VWJ A;  4B8C A;  3PX4 A;  4NYN A;  3DLB A;  3IRX A;  4AHT A;  3LPT A;  1U48 A;  4CEQ A;  3LZI A;  2P5G A;  3KD1 E;  4OVL A;  4BWJ A;  3VQD A;  4AIL C;  4DTO A;  4CER A;  3JYT A;  1JLB A;  3QIN A;  4DSL A;  1LWC A;  1KLN A;  1ZBF A;  4FJJ A;  2YV0 X;  4CJQ A;  3NGZ A;  1SV5 A;  3NH2 A;  1SKW A;  4Z4F A;  4FJK A;  4CGJ A;  1S1T A;  2Z1J A;  3KLG A;  1G15 A;  1UWB A;  4FZY A;  4FJN A;  1TL3 A;  3DLR A;  2D0C A;  3P5J A;  1LAV A;  2KQ2 A;  3AVI A;  3CFO A;  4CFB A;  3K58 A;  1JKH A;  4OGE A;  4PWD A;  4LH4 A;  2FBY A;  1JLC A;  2XY6 A;  1HYS A;  3T19 A;  5HP1 A;  4E0D A;  4AHC A;  5KRT A;  2OZS A;  1YT3 A;  1Y97 A;  4AHU A;  1FXX A;  1C6V A;  4LSL A;  1EET A;  4ICL A;  1GOB A;  3DM2 A;  2B5J A;  3RRG A;  3RMB A;  2OPP A;  3OYM A;  4DTN A;  4JS4 A;  2ETJ A;  1XHZ A;  1J5O A;  2A1R A;  4AHS A;  2HHS A;  2XHB A;  4FJ7 A;  2B6A A;  4IBN A;  4E7H A;  3NH0 A;  1NKE A;  1NJZ A;  2BE2 A;  1WAF A;  1RT3 A;  1MU2 A;  3AVA A;  4EP4 A;  4KHN A;  2DY4 A;  3QES A;  4J2B A;  2O4G A;  2YKN A;  2PZS A;  3BGR A;  3OVN A;  4Z4C A;  4FLW A;  3ZSY A;  3S3M A;  3ZSZ A;  5KI6 A;  4CFD A;  4KPY A;  3VQ7 A;  3THV A;  4O44 A;  4B9S A;  4OKJ A;  3TAG A;  1ZBI A;  1U4B A;  3TAF A;  1NKC A;  3OYH A;  1IO2 A;  4KFB A;  4PA1 A;  4GW6 A;  1WSJ A;  4EZ6 A;  2O4I A;  1EXQ A;  1W0H A;  3AVG A;  1X9M A;  3SQ1 A;  2XY7 A;  3D45 A;  1LW2 A;  1Q8I A;  3U3G A;  4J2A A;  1CZB A;  3ALY A;  3AVL A;  3ZT1 A;  3LAN A;  2F96 A;  4FJI A;  4HCC A;  4FJM A;  4FJ9 A;  1RNH A;  3HYF A;  3ZSQ A;  4CJE A;  4O5B A;  4DG1 A;  1B9D A;  1RTD A;  1J9A A;  4NCB A;  4RW6 A;  4CF0 A;  1BQM A;  2G8F A;  1TKD A;  4KHS A;  1O1W A;  3SJJ A;  1IKY A;  1RT5 A;  1HMV A;  5CZ2 A;  1QQC A;  1Q9Y A;  1L3V A;  4CES A;  1T05 A;  1VSD A;  2KFN A;  3NAE A;  4CJ5 A;  1CZ9 A;  3OS1 A;  3KKR A;  2XY5 A;  1LW0 A;  1VSL A;  5E41 A;  3NE6 A;  4K8X A;  4CEZ A;  3LDS A;  1KLM A;  1KFS A;  3O3H A;  5D3G A;  3V9U A;  4F8R A;  5J1E A;  1IH7 A;  4DU3 A;  1TKT A;  3AA5 X;  1XWL A;  3HPG A;  4H4O A;  4RG8 A;  1TKX A;  5JS2 A;  4B8A B;  3JSM A;  3F73 A;  3PV8 A;  4B08 A;  2ZD1 A;  4CF8 A;  1RCH A;  2X6N A;  5J2P A;  1UA0 A;  3WNF A;  4B9M A;  2DFF A;  5HLF A;  4M42 A;  1LWE A;  4CF2 A;  2YHA A;  1RBU A;  3SZ2 A;  1KTQ A;  5C24 A;  3ZSV A;  1TK8 A;  2HMI A;  4ELT A;  4CGH A;  4DWI A;  1J53 A;  4KTZ A;  3DRS A;  3A2F A;  3MEC A;  4Z4E A;  3NHG A;  4HUF A;  2OA8 A;  4DF8 A;  5HRO A;  2I5J A;  3CYM A;  3M8R A;  4DFM A;  4FJX A;  1VSM A;  4Z4H A;  1T03 A;  1W9H A;  4OKE A;  1JLF A;  3OYN A;  1D5A A;  2VG5 A;  4CGG A;  2F8S A;  1ITG A;  1RDD A;  4KAZ A;  1JLE A;  1U49 A;  4KHQ A;  3VQP A;  1BI4 B;  1SL1 A;  4B3O A;  1QE1 A;  1U47 A;  4Q5V A;  4M3W A;  5KRS A;  4KB0 A;  1C0M A;  1VSH A;  4AH9 A;  3SV4 A;  3DOK A;  3LP3 A;  4ID1 A;  4CGD A;  1RT2 A;  3QEI A;  4B9V A;  3L3U A;  5J2N A;  2QKK A;  4I9Q A;  3HO1 A;  2Z1G A;  1X9W A;  4FM2 A;  2WON A;  3P1G A;  3VQ4 A;  3ZT2 A;  4KV8 A;  2E4L A;  4I2P A;  3DYA A;  4W5O A;  3EYZ A;  3TAP A;  3CM5 A;  4F2R A;  1HQU A;  1YTA A;  4DFJ A;  2PYJ A;  4FM1 A;  2XY8 A;  4CFA A;  3VQ8 A;  3QEP A;  2HVI A;  1C1B A;  2VG7 A;  4O4G A;  1RT6 A;  1S6P A;  4JLH A;  4RW7 A;  4BE2 A;  2OYQ A;  2ATQ A;  1QHT A;  4CF1 A;  3VN5 A;  3K59 A;  1NK5 A;  2P51 A;  5C42 A;  4J2D A;  1BI4 A;  1RBS A;  3PY8 A;  3SCX A;  3VQE A;  1WAJ A;  3SI6 A;  4BDP A;  3EY1 A;  1HYV A;  1EX4 A;  4DS5 A;  4F2S A;  2OZM A;  3ISN C;  5EU7 A;  2R7Y A;  1WLJ A;  3VQ5 A;  3HPH A;  3ZSR A;  4CGI A;  3LPU A;  1BCO A;  2KTQ A;  1XC9 A;  1KVC A;  1JLQ A;  2FC0 A;  2BDP A;  4OJR A;  3OJS A;  3B6O A;  1ZBU A;  3V1R A;  5T7B A;  5CZ1 A;  4FZZ A;  2HHQ A;  2ZQB A;  2X78 A;  4AHR A;  5FDL A;  3HT3 A;  4Z4G A;  1RT4 A;  4K8Z A;  3AO5 A;  3RRH A;  2WOM A;  2AJQ A;  4FCY A;  4CF9 A;  3ZSW A;  1RBR A;  4E1N A;  4CHQ A;  3E01 A;  1JLA A;  5KGW A;  3KKS A;  4FLU A;  4FLV A;  4B9U A;  5KTQ A;  4RW9 A;  4DMN A;  4DSE A;  4UQG A;  1NJY A;  4KHY A;  2W42 A;  4BDZ A;  1DTT A;  4CJK A;  1TL1 A;  4N41 A;  1C1A A;  5J2M A;  2PYL A;  3VA3 A;  3QER A;  2P5O A;  4FLY A;  3CFP A;  3F9K A;  1B9F A;  4DTX A;  3TAR A;  2YKM A;  4DTP A;  3ITH A;  3C94 A;  2EHG A;  3OYJ A;  1ZBH A;  3QO9 A;  3LP1 A;  3QEW A;  4R5P A;  1SL0 A;  3KK2 A;  3SQ2 A;  4F4K A;  1NK4 A;  2YHB A;  2G8U A;  4E19 A;  2Z1I A;  4E7I A;  4E3S A;  4MQ3 A;  4LD0 A;  4E89 A;  4W5Q A;  2D0A A;  3U3Y A;  3ASM A;  3S3O A;  1LAW A;  4KRE A;  3OJU A;  2D5R A;  1ASW A;  1QSS A;  1BL3 A;  3PO4 A;  3AA3 A;  3AV9 A;  1WN7 A;  3KLF A;  4FM0 A;  3V9W A;  3SNN A;  4OLA A;  4ZTJ A;  3OS0 A;  3HP6 A;  4HCB A;  2Y1I A;  4FLT A;  1IKV A;  1HQE A;  3O3G A;  2HND A;  4CJV A;  2IDO A;  3KK3 A;  3VQ9 A;  3RMC A;  3AVJ A;  1WSE A;  4QOZ B;  2HHT A;  4DFK A;  4CIE A;  1BHL A;  4C8M A;  4DSI A;  1RDC A;  3NBP A;  1JXB A;  5I42 A;  1BQN A;  3IG1 A;  4CIF A;  2PY5 A;  4C8O A;  4HHT A;  1T8E A;  4DSJ A;  4YNQ A;  3V9X A;  2VG6 A;  3ULD A;  4CJR A;  2HHU A;  1CXU A;  1NK9 A;  4CED A;  1KRP A;  3OYA A;  1RTJ A;  2JLE A;  1S9E A;  2HB5 A;  4OGC A;  3L2R A;  2OPR A;  3NGI A;  3I0S A;  4NYF A;  3OYI A;  4OKK A;  4DU1 A;  3HL8 A;  3PX6 A;  2FBX A;  4B9N A;  5CYQ A;  3L2W A;  4FJH A;  1ZBL A;  3VQ6 A;  3SUQ A;  1X1P A;  3LP0 A;  4BE1 A;  3CQ8 A;  3T3F A;  3TAQ A;  4CJS A;  3DRR A;  1KVB A;  3P83 D;  4KKO A;  4CGF A;  2XO7 A;  3KD5 E;  4KHU A;  1TK0 A;  2ZE2 A;  4Y1D A;  3NCI A;  1HRH A;  4I9L A;  3MEE A;  1S1X A;  2HHX A;  4M3Y A;  3M8Q A;  3C6T A;  3G10 A;  4I2Q A;  4M3R A;  3MXI A;  1IG9 A;  2G8I A;  1TAU A;  2E6L A;  3OYG A;  4H4M A;  1WSG A;  4CJ4 A;  3KIO A;  3T1A A;  3DRP A;  1NOZ A;  1D9D A;  5FRM A;  2RN2 A;  3AVN A;  4LH5 A; 
#chains in the Genus database with same CATH topology
 3MEG A;  3K5O A;  4ISE A;  4JI6 K;  2ZM6 K;  2FXU A;  2QWN A;  4L3Q A;  1QSY A;  4IWV A;  4JRP A;  3SV3 A;  1BGX T;  1HKB A;  2OPQ A;  4WFB L;  1DTQ A;  2X74 A;  2KKZ A;  3HTV A;  1ASU A;  2HNY A;  1V4T A;  3DXM B;  2FLO A;  3ENO A;  3DXK A;  1VQ7 N;  4CEB A;  2Q0U A;  3K5N A;  5AQY A;  3VGM A;  2W41 A;  4IFY A;  1VHX A;  3CC7 N;  3MDQ A;  4E7K A;  3ZCM A;  1XUP O;  1QQO A;  4MDB A;  1C0G A;  4IEE A;  4M7X A;  1Q9X A;  4AQY K;  1VQ8 N;  2ZJR L;  1S22 A;  1YVU A;  3CM6 A;  4O0I A;  4YOT A;  3V1Q A;  4WQ5 C;  3DXM A;  3WQU A;  1LV5 A;  4CHZ A;  2YHX A;  1K8K B;  1N5Y A;  4DV0 K;  4LY7 A;  1GLL O;  3DLE A;  3H3N O;  1JL1 A;  3L2V A;  3J80 O;  3H6E A;  5BR8 K;  1RTI A;  5AQR A;  3GL1 A;  1U6Z A;  1IBK K;  1NMD A;  1YF5 L;  3QML A;  4GVM A;  4NCG A;  4DLE A;  2CGL A;  1JXE A;  5K14 A;  3I33 A;  2YNG A;  3JAM O;  3KLH A;  2YNI A;  3HK2 A;  4CEF A;  4KO0 A;  1K8K A;  3K5L A;  4FYD A;  1SAZ A;  2RPI A;  2X6S A;  3ZT0 A;  1L3U A;  1FKP A;  3KK7 A;  2E2Q A;  5HBM A;  5DM6 L;  4BQZ A;  4E7L A;  1NK0 A;  1RTH A;  3F9M A;  1KCF A;  3KJV A;  1UOC A;  3AVC A;  1ILY A;  1YAG A;  1BIZ A;  2HST A;  3QIO A;  1WSI A;  1W97 L;  1ESV A;  1U45 A;  4DTM A;  3UKU B;  4DR5 K;  3QEX A;  3V81 A;  1BO5 O;  4JK9 A;  4X65 K;  4E7J A;  1Q81 O;  3IS9 A;  4IOA L;  4N5S A;  2PFU A;  4CJ3 A;  2QK9 A;  4O0J A;  4HTL A;  3F5T A;  5HRS A;  4RWT A;  1JL2 A;  4M3X A;  3EZ5 A;  4CHY A;  1WSF A;  1GLB G;  2HVH A;  1NGF A;  3ZX0 A;  1Z25 A;  3UKU A;  5EXW A;  1UAX A;  3GDQ A;  3KK1 A;  4DV2 K;  2A5X A;  2VQF K;  2NNW A;  3DLK A;  1A5V A;  4BRE A;  2E2O A;  2ZJP L;  1S5J A;  5SWM A;  3HVR A;  5DMR A;  4JI5 K;  1KSP A;  1YTU A;  3A5N C;  4CZG A;  1XMO K;  3SUP A;  2F8T A;  4QAG A;  3CCJ N;  4CHN A;  3L8B A;  1S6Q A;  3OS2 A;  4I6M B;  3ZEU B;  2HBJ A;  4YDU C;  4DTS A;  3CG7 A;  4JN4 A;  3J7Z O;  4Z0U A;  2DFE A;  3G0Z A;  4H0Y B;  3OYF A;  1QQM A;  4CVN E;  3O4N A;  3NGY A;  4DQR A;  4FK4 A;  3NF7 A;  4UY8 O;  4CD3 A;  3C6U A;  4TSX A;  3ATU A;  3AVF A;  3ZYY X;  1T7P A;  3CCL N;  4I6M A;  1TK5 A;  3ZEU A;  3IAY A;  3L3V A;  1Z26 A;  4CHO A;  4JI0 K;  4BG9 A;  4DR4 K;  1W2B M;  2BGG A;  3L0Q A;  1OVQ A;  3OYL A;  1ZYQ A;  2NRT A;  1EO1 A;  3KLI A;  4BG8 A;  1HLU A;  4FJL A;  2B4J A;  3O4Q A;  2D0B A;  3CXC M;  5BPN A;  4PL8 A;  4Q0B A;  1HNI A;  5JS1 A;  3WEE B;  3WQT A;  3E1Y A;  2UUC K;  2VWJ A;  4B8C A;  1X3M A;  4NYN A;  4GVE A;  3LPT A;  1U48 A;  3T7Z A;  3CCV N;  4AIL C;  2IVO A;  3W0L A;  4EFH A;  3JYT A;  4Z4F A;  3NH2 A;  3CJC A;  4FJK A;  1BDG A;  4U7B A;  3KLG A;  4DUY K;  4DQ8 A;  1UWB A;  3C65 A;  3DLR A;  3K9J A;  1LAV A;  3CFO A;  3WEE A;  2HMP A;  4JD2 B;  1HPM A;  1C6V A;  4B1Z A;  2UU9 K;  2V7Z A;  2B5J A;  3WXJ A;  1QHA A;  1J5O A;  1I94 K;  2HHS A;  4AHS A;  2XHB A;  2B6A A;  2E1Z A;  3U9D A;  3EZW A;  2JWL A;  2PZS A;  2CGJ A;  5KQ8 A;  4FLW A;  4CFD A;  4JD2 A;  1IV0 A;  4FWN A;  1ZBI A;  1U4B A;  3TAF A;  3KHY A;  4GW6 A;  3C6H A;  4GNI A;  1JJ2 M;  4EZ6 A;  1W0H A;  3CHW A;  2WTU A;  1Q8I A;  4J2A A;  3ALY A;  2F96 A;  2VWB A;  4HCC A;  4FJ9 A;  2IVN A;  2IVP A;  4DG1 A;  1B9D A;  4CZL A;  1RTD A;  3HOT A;  4RW6 A;  4KHS A;  1O1W A;  2JWK A;  1T05 A;  3NAE A;  1BOT O;  1CZ9 A;  4O8U A;  4CJ5 A;  3OS1 A;  1GLJ O;  5IWA K;  5E41 A;  3NE6 A;  1NBW A;  1EWR A;  2NZT A;  1KLM A;  4WF9 L;  5ADX A;  1GLF O;  5DM7 L;  5J1E A;  4KHQ A;  3F73 A;  5JS2 A;  3JSM A;  3L4Q A;  5BR9 A;  3K9K A;  5M1Q A;  4BR4 A;  4CF8 A;  5J2P A;  2DFF A;  4BRN A;  2YHA A;  1RBU A;  3T69 A;  3ZSV A;  1TK8 A;  4WFA L;  2YI1 A;  4GY2 B;  3MEC A;  4Z4E A;  3C6A A;  5EVZ A;  3ATV A;  2I5J A;  4DFM A;  4Z4H A;  1JLF A;  3CJ1 A;  3O8M A;  4BC2 A;  3H1Q A;  1JLE A;  1QE1 A;  4ILJ A;  4NXN K;  1C0M A;  4BRO A;  3QEI A;  4BC3 A;  5J2N A;  3H45 C;  3EKU A;  1X9W A;  4FM2 A;  4PKI A;  3ZT2 A;  4I2P A;  4F2R A;  4MLE A;  5AQK A;  4A57 A;  4CFA A;  5AQT A;  2NLX A;  1RT6 A;  1S6P A;  3J81 O;  1HYV A;  2OZM A;  5EU7 A;  4CGI A;  4JKE A;  1BCO A;  2KTQ A;  1NJI O;  1KVC A;  2FC0 A;  4JKC A;  2BDP A;  1K9M O;  2HHQ A;  1NGA A;  1VAZ A;  2X78 A;  3LDO A;  4A2A A;  3HT3 A;  1O13 A;  3VF4 A;  4CF9 A;  3E01 A;  1JLA A;  5KGW A;  4B9U A;  4UQG A;  4DCH A;  5AFU A;  2W42 A;  1DTT A;  4CJK A;  1TL1 A;  4LF9 K;  1C1A A;  4LF4 K;  3KVG A;  3MX5 A;  3DAW A;  3TSU A;  3EL2 A;  2EHG A;  2QTD A;  4JI4 K;  4F4K A;  3FE1 A;  3CPE A;  1ZC6 A;  2G8U A;  4E19 A;  1T6D A;  4OX9 K;  4H0T B;  4J8F A;  4FM0 A;  3OS0 A;  1CZA N;  3O3G A;  1WB9 A;  4DSI A;  3NBP A;  3CJ9 A;  4KBO A;  4CIF A;  2A41 A;  4HHT A;  1T8E A;  3PSI A;  1XMQ K;  4CI6 A;  5BRE A;  4PKH A;  4CED A;  3OYA A;  1RTJ A;  2NRR A;  3I0S A;  5JLF A;  3PX6 A;  2FBX A;  5CYQ A;  1H1V A;  3LDP A;  3SUQ A;  4NXM K;  4JKF A;  1X1P A;  4FWM A;  3TAQ A;  3DRR A;  1TK0 A;  3NCI A;  3TSP A;  4I2Q A;  1IG9 A;  2G8I A;  1HNX K;  1TAU A;  3OYG A;  4H4M A;  4CJ4 A;  4X66 K;  3DRP A;  3H3O B;  2ZGZ A;  2E5L K;  3WXK A;  1N34 K;  1JCG A;  2FF3 B;  1D8Y A;  2QKB A;  3M3Z A;  4IJN A;  4B1U B;  1WOQ A;  4F3T A;  2Q3S A;  4BRL A;  3D0P A;  4DF4 A;  4B9T A;  1D9F A;  1JCE A;  4E1M A;  5JLH A;  2A1S A;  1C1C A;  4IDH A;  3QFU A;  4BVO A;  1WSH A;  3NDK A;  1NJX A;  4LFB K;  4IXC A;  2Z1H A;  1EKE A;  3B6P A;  4MFB A;  3S41 A;  4KI6 A;  2A40 A;  1MWK A;  3AVM A;  5CY4 A;  4W5N A;  2YNF A;  3QIP A;  4BAC A;  4CK1 A;  1YJ9 N;  1D4X A;  4ELV A;  2KHO A;  2G8H A;  1L3T A;  3AVB A;  3LP2 A;  1RIL A;  2GUI A;  4XH4 A;  4H0O A;  4DQQ A;  3DLL L;  2HW3 A;  3MAQ A;  5JVH L;  3KZB A;  3KTQ A;  2IC3 A;  3FGU A;  4RW4 A;  1BCM A;  4QS7 A;  1IG8 A;  2GBZ A;  3J8A A;  4EIA A;  1WNS A;  3FFI A;  4DU4 A;  4K41 A;  2OTJ N;  1N33 K;  3LZJ A;  1N8R O;  3AAP A;  1EWQ A;  4H0P A;  1RT7 A;  5M1K A;  3TR8 A;  5BRD A;  4LSN A;  1VQN N;  2QWM A;  4DQI A;  4KB1 A;  3QLH A;  2ITM A;  2WFB A;  3S9H A;  3SMP A;  2CH6 A;  3QNO A;  1WUA A;  3BUZ B;  4CZK A;  3V9Z A;  4BRP A;  4JYA K;  2XRI A;  3LWM A;  5AQF A;  4DS4 A;  1TVR A;  3CJA A;  3PX0 A;  3Q7B A;  2HHH K;  5FRN A;  3HJF A;  4MO5 A;  2HBM A;  2V51 B;  3AO3 A;  4JNE A;  1QTM A;  5J2Q A;  4AM7 A;  3B8A X;  2E2P A;  5HOO A;  1RBV A;  3DLH A;  1OVY A;  3I55 N;  3QIC A;  1S1U A;  1VSE A;  4IEI A;  2RKI A;  4L8R B;  2QWR A;  3RMA A;  3ENH A;  1KAX A;  4C8L A;  1TV6 A;  1VQ6 N;  4H5W A;  3SQ4 A;  3VGL A;  3PSF A;  3V4I A;  3ZT3 A;  3IKM A;  3QNN A;  3AVH A;  2QWQ A;  4C8N A;  4DR1 K;  5ELZ A;  4A62 A;  4DFP A;  1VSJ A;  4JI2 K;  4FVM A;  1RDA A;  5DK5 A;  5SZT A;  4H5V A;  4W5R A;  4DTU A;  4OPJ A;  3RR7 A;  4K43 A;  1DKG D;  4FK0 A;  4PY5 A;  2P9K B;  3FFK B;  1IJJ A;  5CHI A;  1NNE A;  4KTW A;  3WNH A;  4W5T A;  2A3Z A;  3P4I A;  1UA1 A;  3T1H K;  3D2E B;  2QWL A;  3HPO A;  3TTF A;  4B3M K;  1GOC A;  3RSE B;  3LAL A;  4G1Q A;  1FK9 A;  4IDK A;  3N4P A;  1N36 K;  2P9K A;  3MED A;  1CLQ A;  4CJU A;  3ZSO A;  2FSK A;  3CC4 N;  1KVA A;  1ZXO A;  4BRM A;  4BRH A;  4N56 A;  4PQU A;  5FPE A;  4Y1C A;  2E88 A;  3TI0 A;  2KW4 A;  1QVG M;  3M8P A;  5AQN A;  2YHY A;  1JLG A;  3LAM A;  3O08 A;  4IG3 A;  1EP4 A;  4B1W B;  4ELU A;  1BA1 A;  4FWK A;  1U04 A;  4Z4I A;  5AQI A;  2NRV A;  3RSE A;  1IBM K;  2D1K A;  1E4F T;  1TKZ A;  1R0A A;  1TAQ A;  3HP9 A;  2IOC A;  3NMU A;  1X3N A;  2DTU A;  2Y1J A;  4DLG A;  1GLA G;  4CIG A;  3EEQ A;  4HUE A;  2HBK A;  4NCA A;  2NUB A;  4KH5 A;  3VGK A;  3OYK A;  3MXM A;  1MDU B;  4X64 K;  4CEQ A;  5GAH P;  4DTO A;  3QIN A;  3BP8 A;  2VQE K;  5EOY A;  1ZBF A;  1NU0 A;  2Q31 A;  5AQZ A;  2YV0 X;  4CJQ A;  3NGZ A;  1SV5 A;  1S1T A;  4DR2 K;  5BRF A;  3CC2 N;  4OGE A;  4PWD A;  4LH4 A;  1DT9 A;  5HP1 A;  3QDK A;  4FWS A;  3CJB A;  2OZS A;  1FXX A;  4WQ4 A;  3DM2 A;  2OTL N;  4LFA K;  3OYM A;  4DTN A;  3ZLJ A;  1HKC A;  2UXC K;  5CR4 A;  5M1N A;  1GLD G;  4E7H A;  2BE2 A;  2UXB K;  3QES A;  2YKN A;  3BGR A;  4Z4C A;  3ZSZ A;  5AQM A;  3VQ7 A;  4B9S A;  3TAG A;  4OPA A;  1ATN A;  1OH7 A;  4KFB A;  4U67 L;  3MX2 A;  1QZ6 A;  1RDW X;  2O4I A;  3TU5 A;  3KWI A;  4K25 A;  3O6W A;  3VMF B;  3D45 A;  1VQL N;  1LW2 A;  3QFP A;  1CZB A;  3ZT1 A;  3FLC O;  4O5F A;  1OH5 A;  4YOR A;  1J9A A;  3IUC A;  4BGB A;  2GTD A;  1TKD A;  2G8F A;  3SJJ A;  5LJV A;  2FF6 A;  5CZ2 A;  1L3V A;  3ZET B;  3VEO A;  3BZC A;  1TUY A;  4JV5 K;  4BR7 A;  4E1J A;  5AR0 A;  3V9U A;  1HR0 K;  1Q18 A;  4F8R A;  1XWL A;  4RG8 A;  5KPT A;  1TKX A;  5H1S Q;  4B9M A;  5HLF A;  1EQY A;  4LFC K;  2E1Y A;  3SZ2 A;  2AP1 A;  3VES A;  3NHG A;  4HUF A;  4LF8 K;  5HRO A;  2FSN A;  3ZET A;  4FJX A;  4NLB A;  1D5A A;  1RDD A;  5LMN K;  1U49 A;  1BI4 B;  4B3O A;  3LDL A;  4Q5V A;  4KB0 A;  3E9L A;  1VSH A;  4CGD A;  4B9V A;  4A5A A;  4CZH A;  1P90 A;  2Z1G A;  5C15 A;  3MWP A;  4OO1 J;  4V19 S;  3TTC A;  1HQU A;  3VF6 A;  2PYJ A;  4YY3 K;  4YOY A;  4J2E A;  1NK5 A;  3VN5 A;  2P51 A;  2NRX A;  5BPM A;  4J2D A;  1BI4 A;  1RBS A;  3WXL A;  4DS5 A;  3NVK A;  3M1F A;  1WLJ A;  2F9T A;  3O1W A;  2I7P A;  3B6O A;  4H5N A;  4MDA A;  5CZ1 A;  1J6Z A;  3HZ6 A;  4AHR A;  4Z4G A;  1RT4 A;  4BRA A;  3AO5 A;  2AJQ A;  4CHQ A;  4FLV A;  5LJW A;  4IFE A;  2AA4 A;  4KHY A;  1NJY A;  2HBL A;  3H46 O;  3QER A;  1Q86 O;  4JHD B;  2YKM A;  3ITH A;  3LM9 A;  4Z94 A;  1ZBH A;  3O4W A;  4R5P A;  1SL0 A;  3L4I A;  3KK2 A;  3SQ2 A;  4CZJ A;  2YX6 A;  1LOT B;  4E7I A;  4E3S A;  4LD0 A;  4BVP A;  3ASM A;  4CZM A;  1BL3 A;  4B3R K;  2Q1N A;  4LF6 K;  4OLA A;  4BY9 C;  4ZTJ A;  3CCQ N;  4FLT A;  1IKV A;  4JHD A;  4CJV A;  2IDO A;  3VQ9 A;  1WSE A;  4DFK A;  4CIE A;  1BHL A;  2VGN A;  1GLE G;  2UUA K;  1BQN A;  2E8A A;  3V9X A;  2HHU A;  1CXU A;  5M1O A;  4PHT X;  1NK9 A;  2JLE A;  4OGC A;  2Q2R A;  4KH6 A;  1R59 O;  3OYI A;  4OKK A;  4DU1 A;  3HL8 A;  4WCE L;  4AM6 A;  3L2W A;  3NVM A;  1ZBL A;  3LDQ A;  4DV4 K;  4CJS A;  1KVB A;  2XO7 A;  2ZE2 A;  3CJ7 A;  4I9L A;  3MEE A;  2HHX A;  5JMV A;  4BGA A;  4M3R A;  1S72 N;  1WSG A;  3KIO A;  1NOZ A;  1D9D A;  5FRM A;  4O55 A;  3AVN A;  4FWR A;  4CK3 A;  2QI2 A;  3VTI A;  3K0S A;  4ID5 A;  5F2R A;  1S9G A;  5GIN A;  4CJT A;  4KI4 A;  4YFU A;  1HPZ A;  5C25 A;  3WT0 A;  4FSV A;  3O9T A;  1VRU A;  3JS6 A;  3BDP A;  1RGI A;  4M45 A;  4IG0 A;  3UE5 A;  1NM1 A;  3O9Q A;  3VQC A;  4C1N K;  4ISF A;  1REV A;  1RDU A;  2GWJ A;  4JKG B;  3SYZ A;  1VQ5 N;  3CCU N;  1X9S A;  1E4G T;  4NB4 A;  3SBT A;  5C2D A;  1MA9 B;  2G8K A;  3VQA A;  4WE1 A;  1OH6 A;  4BRC A;  4FOI A;  1HJR A;  4XEI A;  5LL6 Z;  3RTV A;  4IO8 A;  4DR3 K;  5E84 A;  1Q82 O;  3OBY A;  2IS3 A;  4BC4 A;  1YI2 N;  4JKG A;  3ID6 A;  4OPK A;  5AZI B;  4M41 A;  3HST B;  3O3F A;  3TWH A;  1L3S A;  1G99 A;  2KFZ A;  4CJP A;  4DQS A;  4FXD A;  5GIO A;  4F9O A;  4H03 B;  3UB5 A;  1HYZ A;  4K42 A;  1SKS A;  2DFH A;  1XNR K;  2YCH A;  3NH1 A;  4FJ8 A;  1KFD A;  2NRW A;  2FBV A;  3RWU A;  1K6Y A;  3VQB A;  2O8D B;  3LAK A;  5AZI A;  3A8Y A;  3MXJ A;  3MWT A;  3CIP A;  4H0X B;  4M3U A;  5C12 A;  4BE0 A;  1VSK A;  3D2F B;  3VA0 A;  1K8A O;  3CQX A;  4QS8 A;  5AQQ A;  3V9S A;  1F21 A;  1NMN A;  3SUO A;  2W6L A;  4LF7 K;  3H08 A;  3THX B;  4IFV A;  2YJE A;  4X62 K;  3E9P A;  2E6M A;  3O9U A;  2KZZ A;  4H5R A;  5JVG L;  1BA0 A;  3DI6 A;  1NGE A;  1B92 A;  2O8D A;  2GEM A;  5AQV A;  3C95 A;  4ISG A;  3UIQ A;  2CH5 A;  3UKR B;  4CK2 A;  1A5W A;  3D2F A;  3Q7C A;  3OW2 M;  4DUZ K;  3SUN A;  5KPZ A;  3ZSX A;  2O8E B;  3TAB A;  4FVU A;  4BRG A;  1Q7Y O;  4IKF A;  3V1O A;  1IKW A;  4LF5 K;  3AO4 A;  3CD6 N;  3THX A;  5TKY A;  1GOA A;  4CEO A;  1NK8 A;  3WNE A;  4JS5 A;  4AHV A;  3AO2 A;  4HVJ A;  3L2U A;  2OPS A;  2ZF5 O;  3PUF A;  2IGI A;  3UKR A;  2D0P A;  2E20 A;  1XI1 A;  3RR8 A;  3VF2 A;  4FLZ A;  2O8E A;  3QEV A;  4CJF A;  4ZHR A;  1RBT A;  5JIC A;  3G71 N;  1VQ9 N;  1QSL A;  3DJC A;  4KHW A;  4CHP A;  4XIU A;  3J7A P;  2YNH A;  3KLE A;  2I7N A;  2P9N B;  4DB3 A;  3WXI A;  3WNG A;  1KAY A;  3VEY A;  1XHX A;  1Z6R A;  3DLG A;  1L5U A;  1RDB A;  3NF9 A;  2D0O A;  2GV9 A;  2D4W A;  3SAF A;  5C0Y A;  1NJW A;  2HNZ A;  3HRG A;  1NK6 A;  4CEA A;  4PKG A;  2EX3 A;  3L6Q A;  3VQQ A;  2ZJQ L;  3L2Q A;  5A2Q O;  3CCM N;  5AQH A;  1HX1 A;  2P1J A;  4JK7 A;  1KC8 O;  2P9N A;  1YHQ N;  4OLB A;  4CE9 A;  3OHR A;  2IIR A;  5GIP A;  1I3A A;  4EZ9 A;  3W3D A;  4ILH A;  5HRN A;  3HI0 A;  1N6Q A;  4HWI A;  2WC9 A;  2G8W A;  4KHP K;  3GG4 A;  3IRX A;  3P38 A;  4AHT A;  4B9Q A;  2P5G A;  2BUP A;  3KD1 E;  4OVL A;  4BWJ A;  4CZI A;  3VQD A;  4XH1 A;  4CER A;  2UXD K;  4DSL A;  1LWC A;  3HOS A;  1KLN A;  3MMV A;  2VGM A;  4FJJ A;  1T3V A;  4A59 A;  4CGJ A;  2Z1J A;  1G15 A;  4JI1 K;  1TL3 A;  1TYQ B;  2D0C A;  3P5J A;  3AVI A;  4CFB A;  5AQP A;  2UYT A;  4JEP A;  2FBY A;  1JLC A;  1OKJ A;  2XY6 A;  1HYS A;  3G25 A;  4AHC A;  1Y97 A;  4AHU A;  4LSL A;  1EET A;  2VYP A;  3AY9 A;  5BN9 A;  2OPP A;  1P8Z A;  5ADX H;  3EKS A;  3SJH A;  4JS4 A;  4B3T K;  2ETJ A;  3THW B;  2A1R A;  1VQO N;  2OCE A;  3C0B A;  2O4G A;  1TYQ A;  3OVN A;  3S3M A;  4WQ4 C;  4KPY A;  4YHH K;  1HUX A;  2QWO A;  2QXL A;  4YOU A;  5F1X A;  1X9M A;  3AVG A;  3BEX A;  3THW A;  3SQ1 A;  5FPD A;  2RHK A;  3U3G A;  4BQL A;  3LAN A;  3MK6 A;  4FJI A;  1RNH A;  3HYF A;  3ZSQ A;  4CJE A;  4O5B A;  4NCB A;  1KAZ A;  2VCP A;  4CF0 A;  1BQM A;  5FLX O;  1HMV A;  2YHW A;  1QQC A;  3O9R A;  1K73 O;  2KFN A;  2GX9 A;  2H3G X;  1VSL A;  3LDS A;  5D3G A;  4MLH A;  2A6A A;  2ASM A;  1U2V B;  1IH7 A;  1TKT A;  2QW9 A;  3AA5 X;  3HPG A;  4H4O A;  3ENB A;  4B8A B;  3PV8 A;  4JKD A;  2X6N A;  1UA0 A;  2ZGY A;  3WNF A;  2BH1 A;  4FL9 A;  4DHY A;  5AQU A;  3D6R A;  4CF2 A;  2PAV A;  2HMI A;  4ELT A;  4DR6 K;  4CGH A;  4DWI A;  1J53 A;  2J4R A;  4CW7 B;  2Q36 A;  2V52 B;  2HOE A;  4JKH A;  2OA8 A;  5AJ3 K;  2P9I B;  4AF1 A;  4DF8 A;  1KXP A;  3M8R A;  1VSM A;  1T03 A;  3C7N B;  3OYN A;  2VG5 A;  1E3M A;  1ITG A;  5AFU H;  4BR0 A;  4KAZ A;  3VQP A;  1X9J A;  1SL1 A;  1U2V A;  4M3W A;  4M7Y A;  3CF5 L;  3D2E A;  4AH9 A;  1YJN N;  3DOK A;  4C23 A;  3L3U A;  2QKK A;  3P1G A;  3VQ4 A;  3BZK A;  4FOE A;  1NG9 A;  1YTA A;  2P9I A;  4DFJ A;  2XY8 A;  3QEP A;  2HVI A;  1MWM A;  1RFQ A;  1C1B A;  3I56 N;  3C7N A;  4JLH A;  2BTF A;  4K0K K;  2ATQ A;  1QHT A;  3O5B A;  4CF1 A;  3K59 A;  4NLC A;  4BR2 A;  5C42 A;  3OTO K;  4YOV A;  3SCX A;  3VQE A;  1HJO A;  3I8B A;  4LC9 B;  3EY1 A;  1EX4 A;  4BDP A;  3ISN C;  2R7Y A;  2YJF A;  3HPH A;  3CCS N;  1XC9 A;  5B8H A;  3BY5 A;  3OJS A;  4DKW A;  1ZBU A;  2P9P B;  1HNW K;  3LDN A;  4KH4 A;  5FDL A;  3U4L A;  1Y64 A;  3ZX2 A;  3R8E A;  5C2F A;  4FCY A;  4E1N A;  3R1X A;  4FLU A;  5KTQ A;  4RW9 A;  1W7A A;  2PYL A;  3VA3 A;  4FLY A;  3CFP A;  3F9K A;  3TAR A;  5LY3 A;  3C94 A;  4GV6 A;  2P9P A;  3QO9 A;  2Q97 A;  3QEW A;  4C1N I;  3R9P A;  3MN9 A;  1NGJ A;  2YHB A;  1WBD A;  5FPM A;  4IJA A;  2Z1I A;  4MQ3 A;  4W5Q A;  2D0A A;  1XNQ K;  1TUU A;  3S3O A;  1LAW A;  4KRE A;  3OJU A;  1SZ2 A;  2D5R A;  1QZ5 A;  2HF4 A;  3PO4 A;  3AGK A;  3AA3 A;  3KLF A;  1WN7 A;  2O8F B;  3CMA N;  2F9W A;  2HF3 A;  3HP6 A;  2Y1I A;  4DV3 K;  1HQE A;  2HND A;  3KK3 A;  4H0V B;  3AVJ A;  3O80 A;  4QOZ B;  2HHT A;  4C8M A;  1JXB A;  5I42 A;  3IG1 A;  3FZH A;  2PY5 A;  4YNQ A;  1BG3 A;  2VG6 A;  2Q0R A;  4IZ9 A;  4CJR A;  3ULD A;  5LMU K;  4A61 A;  1S9E A;  3NGI A;  2V7Y A;  1XQS C;  5AQL A;  2O8F A;  4JI3 K;  5AQX A;  4FJH A;  3VPZ A;  2NRZ A;  3LP0 A;  4BE1 A;  4GKK K;  4WFN L;  5F0X A;  3T3F A;  4KKO A;  4CGF A;  4Y1D A;  1S1X A;  3QBX A;  4M3Y A;  3M8Q A;  3C6T A;  3GOI A;  3T1A A;  1NGH A;  4DV1 K;  2RN2 A;  3SMS A;  2EWS A;  2QXF A;  3FR0 A;  1J54 A;  1NGI A;  4CEC A;  4JK8 A;  2RF2 A;  1YXQ A;  4QS9 A;  4QCL A;  3OYE A;  1VSI A;  4FWP A;  3I0R A;  5KQD A;  4CZE A;  3CFR A;  1RT1 A;  3VEX A;  1BIU A;  2P9U B;  1QS4 A;  3TAE A;  3TAM A;  5BPL A;  3CCE N;  5KGX A;  3ZX3 A;  3DOL A;  3AA2 A;  4WQ5 A;  3K5M A;  3DMJ A;  3AAR A;  5HRP A;  1NGB A;  4KTQ A;  4G9Z A;  3FZK A;  4I7F A;  3ULE B;  4EHT A;  4M3Z A;  1NGC A;  2NRH A;  4B1X B;  4EHU A;  1TGO A;  2QEX N;  3PLA A;  4H8K A;  3SPZ A;  3FZL A;  1HKG A;  3N4Q A;  5TKW A;  4H5T A;  2P9U A;  3HXM A;  4DTR A;  4Y0W A;  2ITG A;  4YOW A;  3ZT4 A;  1NKB A;  5M1F A;  5HL7 L;  3NF6 A;  4DSK A;  4KRF A;  4CJ7 A;  3EN9 A;  5AQO A;  5KPR A;  4GV9 A;  3ULE A;  1WBB A;  4CBW A;  2ASP A;  4DV6 K;  3AVK A;  1A5X A;  3K57 A;  2G8V A;  3P31 A;  1ATS A;  5FPN A;  3OYC A;  3TAN A;  4BC5 A;  3OYB A;  1DLO A;  3VET A;  3MN6 A;  1FW6 A;  5FRO A;  4N47 A;  1DGK N;  5EY4 A;  3A5L C;  4RTF D;  3QET A;  3OA9 A;  4CBX A;  4JI8 K;  5AQW A;  1LCU A;  5HRR A;  4JRQ A;  4DQP A;  3SBG A;  4PUO A;  1YJW N;  3NF8 A;  1DEJ A;  1VQM N;  4FW2 A;  1T44 A;  5E26 A;  4GKJ K;  3FZM A;  1SUQ A;  1S1V A;  4CCH A;  2ASO A;  4YOX A;  3SQ0 A;  4OPH A;  1OH8 A;  1BWF O;  1SS6 A;  3S3N A;  1C0T A;  4FJG A;  5BN8 A;  3SPY A;  4FK2 A;  4N76 A;  3MN5 A;  1ASV A;  4WYB A;  2LSN A;  3CME N;  4O8K A;  1BU6 O;  4HTU A;  4EP5 A;  3K2P A;  1N32 K;  4FW1 A;  4DSF A;  1QQN A;  2F4V K;  1NLV A;  3M5R A;  3OY9 A;  2JGU A;  1HNV A;  3CCR N;  1YVN A;  4BR9 A;  3HM9 A;  2QA4 N;  1NOY A;  4B9L A;  3AA4 A;  3IDH A;  1QVF M;  1GLC G;  4RCH A;  4GMJ B;  4IO9 L;  3F2K A;  3WUH A;  4B3S K;  1LWF A;  3PO5 A;  4YDU A;  3HVT A;  2HHW A;  3RMD A;  4HUG A;  3V6D A;  1VRT A;  1S1W A;  3NFA A;  3M6G A;  2BAN A;  4CEE A;  4ZTF A;  1NK7 A;  3M8S A;  1VK0 A;  4C8K A;  1VSF A;  3MCP A;  3O9S A;  2P9S B;  2GWK A;  1SKR A;  5AQS A;  4F3O A;  4CJL A;  4CZF A;  1VQ4 N;  1S3X A;  1J5E K;  4FLX A;  3TTD A;  3I8D A;  1FKO A;  3R3L A;  3AAQ A;  5CYM A;  1CXQ A;  2KZM A;  1HNZ K;  2FBT A;  1JCF A;  4JKB A;  5GAG P;  3VEZ A;  3FZF A;  4CJW A;  3AO1 A;  4A5B A;  4M3T A;  2P9S A;  1SL2 A;  1BIS A;  4DTJ A;  4FZX C;  4BWM A;  3OYD A;  4BDY A;  3MN7 A;  4JKA A;  1C0U A;  2O8C B;  2VWK A;  3LWL A;  4FJ5 A;  1I39 A;  4FWL A;  5I3U A;  2HHV A;  3U6F A;  4CFC A;  1XC3 A;  1IKX A;  3EE8 A;  4DV7 K;  3A5M C;  2IAJ A;  1YIJ N;  2KLA A;  4RW8 A;  3CER A;  3SK3 A;  3PX4 A;  3EO3 A;  2WUS A;  2FSJ A;  4EAH D;  3DLB A;  3SLC A;  1V4S A;  3LZI A;  4B1V A;  3IFR A;  2O8C A;  3DWL A;  1JLB A;  3RVC A;  3HM8 A;  4CD1 A;  2P9L B;  1SKW A;  4FWO A;  1M1K O;  3CQY A;  4FJN A;  4FZY A;  2KQ2 A;  4BRD A;  3K58 A;  1JKH A;  3CI5 A;  3T19 A;  1YUW A;  4E0D A;  5KRT A;  1YT3 A;  3BF1 A;  4JI7 K;  4ICL A;  1GOB A;  3RRG A;  3RMB A;  5GAD P;  4NO7 A;  1XHZ A;  1NGG A;  2P9L A;  4FJ7 A;  3LM2 A;  4IBN A;  3NH0 A;  4FPA A;  1NJZ A;  1NKE A;  1WAF A;  3CPW M;  1RT3 A;  1MU2 A;  3AVA A;  4EP4 A;  4KHN A;  1FJG K;  3GE1 A;  2DY4 A;  4J2B A;  3E66 A;  5EX5 A;  3ZSY A;  3GBT A;  5KI6 A;  3KWG A;  2GEL A;  4O44 A;  3VER A;  3THV A;  4OKJ A;  1IBL K;  4M63 C;  1NKC A;  3OYH A;  1IO2 A;  4PA1 A;  3IMX A;  1WSJ A;  4DV5 K;  1EXQ A;  2F7T A;  2XY7 A;  3VTH A;  3U9Z A;  5I9E B;  1M90 O;  3AVL A;  4FJM A;  4BRF A;  2RE2 A;  3QBW A;  3OBW A;  3U8X A;  2OAN A;  1IKY A;  1RT5 A;  1Q9Y A;  3P39 A;  4CES A;  3VEW A;  1VSD A;  3G6E N;  2XY5 A;  3KKR A;  1LW0 A;  4IOC L;  2CGK A;  4K8X A;  4CEZ A;  3MCA B;  1KFS A;  3O3H A;  3VEN A;  4DU3 A;  3J7Y P;  4B08 A;  2ZD1 A;  1RCH A;  1SQK A;  4M42 A;  1ATR A;  1LWE A;  4ILG B;  1KTQ A;  5C24 A;  4XH5 A;  1KQS M;  4KTZ A;  3DRS A;  3A2F A;  4IOX A;  3PIO L;  3CYM A;  1W9H A;  4OKE A;  1NGD A;  5AQG A;  4CGG A;  2F8S A;  5AZJ B;  3THY B;  1U47 A;  5GAE P;  5KRS A;  2QM1 A;  4FWQ A;  3O1B A;  3SV4 A;  3LP3 A;  4ID1 A;  1RT2 A;  3BF3 A;  4I9Q A;  3JXU A;  3HO1 A;  3T1Y K;  2WON A;  1BUP A;  3ID8 A;  2E4L A;  4KV8 A;  3DYA A;  4B1Y B;  4W5O A;  3EYZ A;  3TAP A;  3CM5 A;  1ZBS A;  2PBD A;  4FM1 A;  3VQ8 A;  3TSQ A;  4BE2 A;  4O4G A;  2VG7 A;  3CET A;  3WXM B;  4RW7 A;  2OYQ A;  1C0F A;  3SAG A;  5IT9 O;  1VQP N;  5AZJ A;  2DPN A;  3THY A;  3SAH A;  3PY8 A;  1WAJ A;  4R79 A;  3SI6 A;  5AQJ A;  4F2S A;  4BRK A;  3VQ5 A;  3ZSR A;  3LPU A;  1JLQ A;  4OJR A;  5T7B A;  3V1R A;  3AGR A;  4FZZ A;  2ZQB A;  2W6K A;  4CBU A;  4K8Z A;  3RRH A;  2WOM A;  4GV3 A;  3EE9 A;  4BRQ A;  3ZSW A;  1RBR A;  2A42 A;  3KKS A;  4DMN A;  4DSE A;  4BDZ A;  4DR7 K;  4N41 A;  3R6M A;  5M1P A;  3QB0 A;  2E2N A;  5J2M A;  2P5O A;  4DTX A;  1B9F A;  4FPB A;  5C10 A;  4MO4 A;  5BRH A;  4DTP A;  3OYJ A;  5MLC Q;  3E9O A;  3LP1 A;  4JAX A;  1NK4 A;  3A0I X;  2QWP A;  3VOV A;  4E89 A;  3U3Y A;  4A2B A;  3PIP L;  1YIT N;  1ASW A;  1QSS A;  3SNN A;  3AV9 A;  3V9W A;  3HBT A;  2ZWH A;  4HCB A;  3D7E O;  3VEV A;  3RMC A;  1Z05 A;  1NWK A;  1RDC A;  2WBN A;  4BR5 A;  4PL7 A;  1KD1 O;  4C8O A;  4DSJ A;  1T6C A;  3A5O C;  1KRP A;  2O8B B;  3G4S N;  2HB5 A;  3L2R A;  2OPR A;  4NYF A;  4B9N A;  4BRI A;  2W40 A;  3HSC A;  3VQ6 A;  2GUP A;  3CQ8 A;  4FO0 A;  5CE3 A;  3P83 D;  4KHU A;  3LL3 A;  3KD5 E;  1HRH A;  2UUB K;  3G10 A;  3MXI A;  3H1V X;  2E6L A;  3DXK B;  2O8B A;  3TPQ A;  1VQK N;  4LH5 A; 
#chains in the Genus database with same CATH homology
 3MEG A;  3K5O A;  2QXF A;  1J54 A;  4CK3 A;  4CEC A;  1D8Y A;  2RF2 A;  4QCL A;  2QKB A;  4F3T A;  2Q3S A;  3D0P A;  3OYE A;  4DF4 A;  1QSY A;  4JRP A;  1VSI A;  3SV3 A;  4B9T A;  3I0R A;  4ID5 A;  1D9F A;  1BGX T;  2OPQ A;  4E1M A;  2A1S A;  3CFR A;  1RT1 A;  1C1C A;  1BIU A;  1S9G A;  1DTQ A;  1WSH A;  3NDK A;  1NJX A;  2X74 A;  2Z1H A;  1EKE A;  1QS4 A;  3B6P A;  1ASU A;  4MFB A;  4CJT A;  3TAM A;  3TAE A;  2HNY A;  4YFU A;  1HPZ A;  5C25 A;  5KGX A;  4KI4 A;  3AVM A;  3AA2 A;  3DOL A;  5CY4 A;  4W5N A;  3K5M A;  3DMJ A;  2YNF A;  5HRP A;  3QIP A;  1VRU A;  4CEB A;  4BAC A;  4KTQ A;  4CK1 A;  4I7F A;  3K5N A;  3BDP A;  4M3Z A;  4ELV A;  4M45 A;  4IG0 A;  1TGO A;  2G8H A;  4IFY A;  3VQC A;  1L3T A;  3AVB A;  1REV A;  4H8K A;  4E7K A;  3SPZ A;  3LP2 A;  1RIL A;  3ZCM A;  2GUI A;  3SYZ A;  1X9S A;  1Q9X A;  4DQQ A;  2HW3 A;  1YVU A;  3CM6 A;  4O0I A;  3V1Q A;  2G8K A;  3MAQ A;  3VQA A;  4WE1 A;  3HXM A;  4DTR A;  3KTQ A;  2IC3 A;  2ITG A;  4RW4 A;  1HJR A;  1BCM A;  1LV5 A;  4CHZ A;  4DSK A;  3ZT4 A;  1NKB A;  3NF6 A;  2GBZ A;  1N5Y A;  4KRF A;  3RTV A;  4KI6 A;  1WNS A;  4LY7 A;  3FFI A;  4DU4 A;  2IS3 A;  3DLE A;  3AVK A;  1A5X A;  3K57 A;  3LZJ A;  1JL1 A;  3TAN A;  3L2V A;  3OYC A;  2G8V A;  1RT7 A;  1RTI A;  3TR8 A;  4OPK A;  4LSN A;  3OYB A;  1DLO A;  4M41 A;  3HST B;  3O3F A;  3TWH A;  1L3S A;  4N47 A;  4GVM A;  5FRO A;  4DLE A;  4NCG A;  4CJP A;  4DQS A;  3QLH A;  4DQI A;  4KB1 A;  4FXD A;  2KFZ A;  1JXE A;  5K14 A;  3S9H A;  2YNG A;  3KLH A;  2YNI A;  3HK2 A;  4CEF A;  4KO0 A;  3QNO A;  1HYZ A;  3K5L A;  3V9Z A;  3QET A;  1SKS A;  4FYD A;  2DFH A;  2RPI A;  2XRI A;  3LWM A;  2X6S A;  3ZT0 A;  1L3U A;  1FKP A;  3NH1 A;  4DS4 A;  4FJ8 A;  5HRR A;  4JRQ A;  5HBM A;  1KFD A;  4DQP A;  2FBV A;  1TVR A;  4E7L A;  3RWU A;  1K6Y A;  1NK0 A;  1RTH A;  3VQB A;  3PX0 A;  4PUO A;  1KCF A;  3NF8 A;  5FRN A;  3HJF A;  3LAK A;  3KJV A;  1UOC A;  3MXJ A;  4FW2 A;  4M3U A;  3AVC A;  3AO3 A;  1SUQ A;  1S1V A;  4CCH A;  1BIZ A;  4BE0 A;  3QIO A;  1VSK A;  3VA0 A;  3SQ0 A;  1WSI A;  4FJG A;  3S3N A;  1C0T A;  3V9S A;  1QTM A;  3SPY A;  5J2Q A;  1U45 A;  4N76 A;  4FK2 A;  1ASV A;  1F21 A;  4DTM A;  2LSN A;  3SUO A;  3QEX A;  4HTU A;  3H08 A;  3V81 A;  4EP5 A;  4IFV A;  1RBV A;  3DLH A;  3K2P A;  1S1U A;  4FW1 A;  1VSE A;  4DSF A;  2RKI A;  2E6M A;  4L8R B;  2KZZ A;  4E7J A;  3RMA A;  4C8L A;  3OY9 A;  3DI6 A;  1TV6 A;  1HNV A;  1B92 A;  2JGU A;  3IS9 A;  4J2E A;  3SQ4 A;  3HM9 A;  3C95 A;  3UIQ A;  1NOY A;  4N5S A;  3V4I A;  4CJ3 A;  2QK9 A;  4O0J A;  4CK2 A;  3ZT3 A;  5HRS A;  1A5W A;  1JL2 A;  3AA4 A;  4B9L A;  3EZ5 A;  4CHY A;  3QNN A;  4M3X A;  1WSF A;  3AVH A;  2HVH A;  3SUN A;  4GMJ B;  1Z25 A;  3ZSX A;  3TAB A;  1LWF A;  4IKF A;  3V1O A;  1UAX A;  4C8N A;  3KK1 A;  3PO5 A;  1IKW A;  4DFP A;  1VSJ A;  3AO4 A;  4FVM A;  1RDA A;  1GOA A;  5DK5 A;  4CEO A;  5SZT A;  1NK8 A;  3HVT A;  3WNE A;  4W5R A;  4JS5 A;  4DTU A;  3DLK A;  4O55 A;  4OPJ A;  1A5V A;  3RMD A;  2HHW A;  3RR7 A;  1S5J A;  4AHV A;  5SWM A;  3HVR A;  3AO2 A;  5DMR A;  4HUG A;  3V6D A;  1VRT A;  4HVJ A;  4FK0 A;  1KSP A;  3L2U A;  1YTU A;  2OPS A;  4PY5 A;  1S1W A;  3NFA A;  3SUP A;  2F8T A;  3PUF A;  4QAG A;  2BAN A;  4CEE A;  4ZTF A;  4CHN A;  3M8S A;  1VK0 A;  2IGI A;  1NK7 A;  3L8B A;  4C8K A;  1XI1 A;  4KTW A;  1VSF A;  1S6Q A;  3WNH A;  3RR8 A;  4W5T A;  3OS2 A;  4FLZ A;  1SKR A;  1UA1 A;  3QEV A;  4F3O A;  4CJL A;  4DTS A;  3CG7 A;  3HPO A;  4CJF A;  4ZHR A;  4Z0U A;  1GOC A;  2DFE A;  3G0Z A;  3LAL A;  4G1Q A;  3OYF A;  1FK9 A;  1RBT A;  4KHW A;  1QSL A;  3O4N A;  4FLX A;  4CHP A;  4XIU A;  3NGY A;  1FKO A;  2YNH A;  3I8D A;  3NF7 A;  4DQR A;  4FK4 A;  4IDK A;  3KLE A;  3C6U A;  5CYM A;  4TSX A;  1CXQ A;  3WNG A;  1XHX A;  2KZM A;  3DLG A;  3MED A;  1CLQ A;  2FBT A;  4CJU A;  3ZSO A;  1L5U A;  1KVA A;  1RDB A;  3NF9 A;  3AVF A;  4N56 A;  2GV9 A;  1T7P A;  4Y1C A;  4PQU A;  4CJW A;  3TI0 A;  1TK5 A;  2KW4 A;  3AO1 A;  3M8P A;  3IAY A;  3L3V A;  4M3T A;  1SL2 A;  1BIS A;  1Z26 A;  4CHO A;  4IG3 A;  1JLG A;  2HNZ A;  3LAM A;  4DTJ A;  1NJW A;  1NK6 A;  1EP4 A;  4BWM A;  4FZX C;  4CEA A;  3OYD A;  4ELU A;  1U04 A;  4BDY A;  4Z4I A;  2EX3 A;  2BGG A;  3OYL A;  3VQQ A;  1TKZ A;  1ZYQ A;  1C0U A;  3L2Q A;  2VWK A;  1R0A A;  3LWL A;  4FJ5 A;  3KLI A;  1TAQ A;  3HP9 A;  4FJL A;  2B4J A;  1I39 A;  2IOC A;  2P1J A;  3O4Q A;  2D0B A;  2Y1J A;  2DTU A;  4DLG A;  5I3U A;  2HHV A;  4Q0B A;  3U6F A;  4CE9 A;  4CFC A;  4OLB A;  4CIG A;  1HNI A;  1I3A A;  4EZ9 A;  5JS1 A;  1IKX A;  4HUE A;  5HRN A;  2IAJ A;  4NCA A;  2NUB A;  1N6Q A;  3OYK A;  3MXM A;  2G8W A;  4RW8 A;  2VWJ A;  4B8C A;  3PX4 A;  4NYN A;  3DLB A;  3IRX A;  4AHT A;  3LPT A;  1U48 A;  4CEQ A;  3LZI A;  2P5G A;  3KD1 E;  4OVL A;  4BWJ A;  3VQD A;  4AIL C;  4DTO A;  4CER A;  3JYT A;  1JLB A;  3QIN A;  4DSL A;  1LWC A;  1KLN A;  1ZBF A;  4FJJ A;  2YV0 X;  4CJQ A;  3NGZ A;  1SV5 A;  3NH2 A;  1SKW A;  4Z4F A;  4FJK A;  4CGJ A;  1S1T A;  2Z1J A;  3KLG A;  1G15 A;  1UWB A;  4FZY A;  4FJN A;  1TL3 A;  3DLR A;  2D0C A;  3P5J A;  1LAV A;  2KQ2 A;  3AVI A;  3CFO A;  4CFB A;  3K58 A;  1JKH A;  4OGE A;  4PWD A;  4LH4 A;  2FBY A;  1JLC A;  2XY6 A;  1HYS A;  3T19 A;  5HP1 A;  4E0D A;  4AHC A;  5KRT A;  2OZS A;  1YT3 A;  1Y97 A;  4AHU A;  1FXX A;  1C6V A;  4LSL A;  1EET A;  4ICL A;  1GOB A;  3DM2 A;  2B5J A;  3RRG A;  3RMB A;  2OPP A;  3OYM A;  4DTN A;  4JS4 A;  2ETJ A;  1XHZ A;  1J5O A;  2A1R A;  4AHS A;  2HHS A;  2XHB A;  4FJ7 A;  2B6A A;  4IBN A;  4E7H A;  3NH0 A;  1NKE A;  1NJZ A;  2BE2 A;  1WAF A;  1RT3 A;  1MU2 A;  3AVA A;  4EP4 A;  4KHN A;  2DY4 A;  3QES A;  4J2B A;  2O4G A;  2YKN A;  2PZS A;  3BGR A;  3OVN A;  4Z4C A;  4FLW A;  3ZSY A;  3S3M A;  3ZSZ A;  5KI6 A;  4CFD A;  4KPY A;  3VQ7 A;  3THV A;  4O44 A;  4B9S A;  4OKJ A;  3TAG A;  1ZBI A;  1U4B A;  3TAF A;  1NKC A;  3OYH A;  1IO2 A;  4KFB A;  4PA1 A;  4GW6 A;  1WSJ A;  4EZ6 A;  2O4I A;  1EXQ A;  1W0H A;  3AVG A;  1X9M A;  3SQ1 A;  2XY7 A;  3D45 A;  1LW2 A;  1Q8I A;  3U3G A;  4J2A A;  1CZB A;  3ALY A;  3AVL A;  3ZT1 A;  3LAN A;  2F96 A;  4FJI A;  4HCC A;  4FJM A;  4FJ9 A;  1RNH A;  3HYF A;  3ZSQ A;  4CJE A;  4O5B A;  4DG1 A;  1B9D A;  1RTD A;  1J9A A;  4NCB A;  4RW6 A;  4CF0 A;  1BQM A;  2G8F A;  1TKD A;  4KHS A;  1O1W A;  3SJJ A;  1IKY A;  1RT5 A;  1HMV A;  5CZ2 A;  1QQC A;  1Q9Y A;  1L3V A;  4CES A;  1T05 A;  1VSD A;  2KFN A;  3NAE A;  4CJ5 A;  1CZ9 A;  3OS1 A;  3KKR A;  2XY5 A;  1LW0 A;  1VSL A;  5E41 A;  3NE6 A;  4K8X A;  4CEZ A;  3LDS A;  1KLM A;  1KFS A;  3O3H A;  5D3G A;  3V9U A;  4F8R A;  5J1E A;  1IH7 A;  4DU3 A;  1TKT A;  3AA5 X;  1XWL A;  3HPG A;  4H4O A;  4RG8 A;  1TKX A;  5JS2 A;  4B8A B;  3JSM A;  3F73 A;  3PV8 A;  4B08 A;  2ZD1 A;  4CF8 A;  1RCH A;  2X6N A;  5J2P A;  1UA0 A;  3WNF A;  4B9M A;  2DFF A;  5HLF A;  4M42 A;  1LWE A;  4CF2 A;  2YHA A;  1RBU A;  3SZ2 A;  1KTQ A;  5C24 A;  3ZSV A;  1TK8 A;  2HMI A;  4ELT A;  4CGH A;  4DWI A;  1J53 A;  4KTZ A;  3DRS A;  3A2F A;  3MEC A;  4Z4E A;  3NHG A;  4HUF A;  2OA8 A;  4DF8 A;  5HRO A;  2I5J A;  3CYM A;  3M8R A;  4DFM A;  4FJX A;  1VSM A;  4Z4H A;  1T03 A;  1W9H A;  4OKE A;  1JLF A;  3OYN A;  1D5A A;  2VG5 A;  4CGG A;  2F8S A;  1ITG A;  1RDD A;  4KAZ A;  1JLE A;  1U49 A;  4KHQ A;  3VQP A;  1BI4 B;  1SL1 A;  4B3O A;  1QE1 A;  1U47 A;  4Q5V A;  4M3W A;  5KRS A;  4KB0 A;  1C0M A;  1VSH A;  4AH9 A;  3SV4 A;  3DOK A;  3LP3 A;  4ID1 A;  4CGD A;  1RT2 A;  3QEI A;  4B9V A;  3L3U A;  5J2N A;  2QKK A;  4I9Q A;  3HO1 A;  2Z1G A;  1X9W A;  4FM2 A;  2WON A;  3P1G A;  3VQ4 A;  3ZT2 A;  4KV8 A;  2E4L A;  4I2P A;  3DYA A;  4W5O A;  3EYZ A;  3TAP A;  3CM5 A;  4F2R A;  1HQU A;  1YTA A;  4DFJ A;  2PYJ A;  4FM1 A;  2XY8 A;  4CFA A;  3VQ8 A;  3QEP A;  2HVI A;  1C1B A;  2VG7 A;  4O4G A;  1RT6 A;  1S6P A;  4JLH A;  4RW7 A;  4BE2 A;  2OYQ A;  2ATQ A;  1QHT A;  4CF1 A;  3VN5 A;  3K59 A;  1NK5 A;  2P51 A;  5C42 A;  4J2D A;  1BI4 A;  1RBS A;  3PY8 A;  3SCX A;  3VQE A;  1WAJ A;  3SI6 A;  4BDP A;  3EY1 A;  1HYV A;  1EX4 A;  4DS5 A;  4F2S A;  2OZM A;  3ISN C;  5EU7 A;  2R7Y A;  1WLJ A;  3VQ5 A;  3HPH A;  3ZSR A;  4CGI A;  3LPU A;  1BCO A;  2KTQ A;  1XC9 A;  1KVC A;  1JLQ A;  2FC0 A;  2BDP A;  4OJR A;  3OJS A;  3B6O A;  1ZBU A;  3V1R A;  5T7B A;  5CZ1 A;  4FZZ A;  2HHQ A;  2ZQB A;  2X78 A;  4AHR A;  5FDL A;  3HT3 A;  4Z4G A;  1RT4 A;  4K8Z A;  3AO5 A;  3RRH A;  2WOM A;  2AJQ A;  4FCY A;  4CF9 A;  3ZSW A;  1RBR A;  4E1N A;  4CHQ A;  3E01 A;  1JLA A;  5KGW A;  3KKS A;  4FLU A;  4FLV A;  4B9U A;  5KTQ A;  4RW9 A;  4DMN A;  4DSE A;  4UQG A;  1NJY A;  4KHY A;  2W42 A;  4BDZ A;  1DTT A;  4CJK A;  1TL1 A;  4N41 A;  1C1A A;  5J2M A;  2PYL A;  3VA3 A;  3QER A;  2P5O A;  4FLY A;  3CFP A;  3F9K A;  1B9F A;  4DTX A;  3TAR A;  2YKM A;  4DTP A;  3ITH A;  3C94 A;  2EHG A;  3OYJ A;  1ZBH A;  3QO9 A;  3LP1 A;  3QEW A;  4R5P A;  1SL0 A;  3KK2 A;  3SQ2 A;  4F4K A;  1NK4 A;  2YHB A;  2G8U A;  4E19 A;  2Z1I A;  4E7I A;  4E3S A;  4MQ3 A;  4LD0 A;  4E89 A;  4W5Q A;  2D0A A;  3U3Y A;  3ASM A;  3S3O A;  1LAW A;  4KRE A;  3OJU A;  2D5R A;  1ASW A;  1QSS A;  1BL3 A;  3PO4 A;  3AA3 A;  3AV9 A;  1WN7 A;  3KLF A;  4FM0 A;  3V9W A;  3SNN A;  4OLA A;  4ZTJ A;  3OS0 A;  3HP6 A;  4HCB A;  2Y1I A;  4FLT A;  1IKV A;  1HQE A;  3O3G A;  2HND A;  4CJV A;  2IDO A;  3KK3 A;  3VQ9 A;  3RMC A;  3AVJ A;  1WSE A;  4QOZ B;  2HHT A;  4DFK A;  4CIE A;  1BHL A;  4C8M A;  4DSI A;  1RDC A;  3NBP A;  1JXB A;  5I42 A;  1BQN A;  3IG1 A;  4CIF A;  2PY5 A;  4C8O A;  4HHT A;  1T8E A;  4DSJ A;  4YNQ A;  3V9X A;  2VG6 A;  3ULD A;  4CJR A;  2HHU A;  1CXU A;  1NK9 A;  4CED A;  1KRP A;  3OYA A;  1RTJ A;  2JLE A;  1S9E A;  2HB5 A;  4OGC A;  3L2R A;  2OPR A;  3NGI A;  3I0S A;  4NYF A;  3OYI A;  4OKK A;  4DU1 A;  3HL8 A;  3PX6 A;  2FBX A;  4B9N A;  5CYQ A;  3L2W A;  4FJH A;  1ZBL A;  3VQ6 A;  3SUQ A;  1X1P A;  3LP0 A;  4BE1 A;  3CQ8 A;  3T3F A;  3TAQ A;  4CJS A;  3DRR A;  1KVB A;  3P83 D;  4KKO A;  4CGF A;  2XO7 A;  3KD5 E;  4KHU A;  1TK0 A;  2ZE2 A;  4Y1D A;  3NCI A;  1HRH A;  4I9L A;  3MEE A;  1S1X A;  2HHX A;  4M3Y A;  3M8Q A;  3C6T A;  3G10 A;  4I2Q A;  4M3R A;  3MXI A;  1IG9 A;  2G8I A;  1TAU A;  2E6L A;  3OYG A;  4H4M A;  1WSG A;  4CJ4 A;  3KIO A;  3T1A A;  3DRP A;  1NOZ A;  1D9D A;  5FRM A;  2RN2 A;  3AVN A;  4LH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...