1BL3A

Catalytic domain of hiv-1 integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna integration
molecule keywords INTEGRASE
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 47
structure length 142
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bl3A00
3ULDA 4FLYA 3M8PA 4I9QA 1QTMA 1JXBA 1UWBA 4I2QA 1W0HA 3U3YA 2OA8A 5HRSA 1QHTA 3HM9A 3HPOA 5C24A 4FJGA 1JKHA 4NCBA 1JLAA 2FBYA 4CJSA 4CK2A 4G1QA 4KTZA 4DTSA 3AVJA 2P5GA 4EZ6A 1WSJA 4FM0A 2ETJA 3LPUA 3K58A 3EYZA 4QCLA 1U47A 1LWCA 4KKOA 1VSFA 1VRUA 2Z1JA 4FLUA 4KB1A 4FCYA 4LH4A 4AHRA 4O5BA 3OYFA 3MXJA 1U4BA 4E1NA 4DSJA 1X1PA 5KGWA 1D5AA 3LP1A 3H08A 5FDLA 3OJSA 3QEIA 3MXMA 4CIGA 4E1MA 1KLNA 3O4QA 3WNEA 1S1VA 3KLGA 2ZD1A 3OS1A 4AHCA 2X6SA 1B9FA 3U3GA 1VSJA 4AHSA 4AHUA 4N56A 2HHSA 3PY8A 1RILA 1J53A 4CEBA 1ASVA 1DTQA 5KGXA 1JLCA 3HT3A 2R7YA 3QEPA 4CF2A 1BISA 4W5RA 3RMAA 3DMJA 1GOCA 3NH0A 3SV4A 4CF0A 3OS0A 3KLFA 3TARA 1ZBIA 1Z26A 4JRPA 1JXEA 2A1RA 1WAJA 4B8CA 1N5YA 4I2PA 3T1AA 4KRFA 2ATQA 4FK2A 2HHXA 1DTTA 4AH9A 1B9DA 4J2DA 5EU7A 1TK5A 1IO2A 4FK0A 4I7FA 1RT4A 5CYQA 2Z1GA 2XY7A 1LV5A 1KTQA 1VSHA 5D3GA 3PO5A 3LAKA 4IG3A 4KAZA 3V9ZA 2YNIA 3AVAA 1QSYA 2WONA 3I8DA 2YKNA 3CM6A 3RTVA 3V4IA 1JLQA 4FZXC 4OGCA 2OZMA 2BANA 4O55A 3QNNA 3V81A 3VQAA 4EP4A 4CK3A 4Z0UA 4UQGA 2X74A 1BCOA 2P1JA 3VQCA 3TWHA 4FLZA 4DTUA 3A2FA 1A5XA 2XY8A 1U49A 5HP1A 4CFAA 4CHZA 2Z1IA 3S9HA 4BWJA 4O0JA 3MEEA 1DLOA 2VG7A 3PV8A 4M3RA 4TSXA 1UA1A 1G15A 1SUQA 4CJTA 4ID5A 3CFPA 1U45A 1J5OA 2FBTA 1YT3A 3SQ2A 4RW7A 4J2BA 1ASUA 1GOAA 4M3YA 2HNDA 1VSMA 1EP4A 4CJFA 4DFPA 2HVIA 4Z4IA 3VQ6A 1WSEA 4KV8A 1TK8A 4CGGA 4F3OA 3V9XA 1HJRA 1RTJA 1UAXA 4Z4EA 3AO1A 1S9EA 5HRNA 1O1WA 1S1WA 1JL1A 3AA3A 4LSNA 4ZHRA 4NCGA 4Z4GA 3RRHA 1X9WA 4LD0A 1HNVA 1L3TA 2PYLA 3VQQA 4CJKA 1Y97A 3K2PA 4GMJB 1BL3A 4C8MA 4CGJA 3OS2A 2IS3A 4HHTA 2F8TA 2XRIA 2BE2A 4E0DA 2EX3A 4W5NA 2YHAA 1TKZA 3LZIA 2ITGA 1NK9A 1C6VA 3VQBA 3ZSZA 4FJ8A 3HO1A 3O3HA 4CIEA 1VSEA 3VQ7A 4DF8A 2X6NA 1NJYA 3DLGA 3C6UA 4DLEA 4BDYA 5J2MA 2Y1IA 3CFRA 4Y1CA 1JLGA 1FXXA 3NHGA 1U48A 4KI4A 1FK9A 4PUOA 1XWLA 3PUFA 3HVTA 1K6YA 2YNFA 4FVMA 4AILC 4M3UA 4B08A 1W9HA 1RDBA 2B4JA 3QESA 4MFBA 3AVMA 3OYJA 1KCFA 3VQ4A 3L2VA 2E6MA 1BHLA 4KPYA 1N6QA 2KFZA 4NYNA 5FROA 1YVUA 1NK6A 2O4IA 3LP3A 3U6FA 4BE0A 4ELTA 4PA1A 4LSLA 3LWLA 4IBNA 4OJRA 4GVMA 4H8KA 1I3AA 3OYMA 1LAVA 1CXQA 1IKYA 2XO7A 3OY9A 1HNIA 3HL8A 4DTJA 1RBTA 2JGUA 3MEGA 4CFCA 2O4GA 4DG1A 1S6PA 5HRPA 1BIZA 1BI4B 4CJ5A 3B6OA 3KK2A 3L8BA 3V6DA 1R0AA 3VQDA 4C8LA 1QSSA 3ZSRA 3QLHA 1Z25A 2I5JA 1RT5A 5HRRA 4CF1A 5J2PA 4BDPA 4DS5A 3LANA 3I0RA 4KHSA 2QXFA 1L3UA 4DF4A 2HNYA 3DM2A 1S1XA 3V1OA 4EZ9A 4CEQA 1RTHA 3AVKA 3LDSA 3QEVA 4M3XA 1VSLA 4M3ZA 4DFJA 1C0MA 3AVHA 5C25A 1IKVA 3QO9A 1T03A 1NK7A 4FLTA 2G8WA 1SL1A 1ZBFA 4H4MA 4N47A 3SPYA 3RMDA 2G8VA 2DFEA 1C1CA 4IFYA 1ZBHA 2W42A 2ZE2A 4DTPA 3VQPA 3T3FA 1NJZA 3AA4A 5I42A 3HK2A 3C94A 3IG1A 1IG9A 3RR8A 3TANA 1XI1A 1I39A 2DFHA 4W5TA 4CHYA 3MAQA 1IKXA 2VWJA 4FK4A 2HHWA 1L3SA 3BGRA 4CJWA 2KQ2A 1SL0A 1BI4A 3MECA 2DFFA 5HROA 2KFNA 3HP9A 4DTMA 4F4KA 4RG8A 2HMIA 3RMBA 1KSPA 1VK0A 1UA0A 4FZZA 1WSIA 1YTAA 1UOCA 3QIOA 3KJVA 3QETA 4RW8A 1NOYA 4FXDA 4CJEA 4HCCA 4B9NA 2PYJA 4RW9A 4E3SA 4CF9A 1L5UA 3AA5X 2KZZA 2OPRA 3ISNC 4B9LA 3VQ8A 1KRPA 3SJJA 3IRXA 4CEEA 1NK5A 2Y1JA 1SKSA 4M42A 5HLFA 2BGGA 2YV0X 4CIFA 3DI6A 3K5MA 1KVAA 4CHPA 3F73A 3LWMA 4JRQA 2X78A 1RBUA 3HJFA 3G10A 1S5JA 1C0UA 4C8OA 2EHGA 2A1SA 3ZSXA 3L2QA 3MXIA 1IH7A 3SUQA 3NH2A 3ZSWA 1JLEA 3UIQA 1TGOA 3SUPA 4N41A 2E4LA 2HNZA 3L3VA 1L3VA 4JLHA 1TKDA 5CYMA 4BE1A 4CE9A 3PX6A 4GW6A 2KW4A 3QIPA 4C8KA 4ELVA 1TKTA 2FC0A 3PO4A 4LY7A 2B6AA 3OYGA 4CJ3A 4FLWA 4E7KA 4QOZB 4FJ5A 4CCHA 4M3WA 5JS1A 4B9MA 1J9AA 3JYTA 3K5LA 4IKFA 2Q3SA 3HSTB 4DS4A 4FJ9A 1RCHA 2D0BA 2G8UA 2HHTA 4E7JA 3AVCA 3ZT1A 3OYLA 2D0CA 1RDAA 3TAGA 4H4OA 1NKEA 2G8HA 3QEWA 5FRNA 2E6LA 4CECA 4E7LA 1S6QA 1TVRA 1SKWA 3M8QA 1JLFA 2OPSA 3DLKA 1A5VA 2NUBA 2FBVA 1IKWA 3NF9A 1HYZA 1X9SA 1NOZA 3OYAA 2HHVA 4KFBA 2QKBA 3FFIA 3ALYA 3VQEA 3L3UA 3O4NA 3AVFA 1X9MA 4CHQA 4AHTA 2OYQA 4FYDA 3JSMA 3DLBA 1KLMA 4B9SA 3HVRA 4HVJA 3VQ5A 4CJQA 4DTOA 2DY4A 4KHYA 1TV6A 5KI6A 4DSLA 1CLQA 4MQ3A 4N5SA 3PX4A 1ZYQA 3S3NA 5E41A 1Q9YA 3F9KA 4CF8A 4Q5VA 3EY1A 3SI6A 5CY4A 1T7PA 2QKKA 3OYNA 3KK1A 1KVCA 4LH5A 5JS2A 1REVA 3D45A 3THVA 2HHUA 4OLBA 1BGXT 1RBSA 3TI0A 2YNHA 4CESA 3AVIA 3DRPA 2LSNA 3ZSYA 3CYMA 1WN7A 3CM5A 3VN5A 5HBMA 3OYCA 4CEOA 4CHOA 5KRSA 3EZ5A 3IAYA 4Y1DA 3G0ZA 3OYBA 4DTNA 4B9VA 3K5NA 1RTDA 3IS9A 3ASMA 3KKSA 1KFDA 4RW4A 4CFBA 3HPHA 4OPKA 1RT7A 1MU2A 4DFMA 1TAQA 1SL2A 4Z4CA 4KHQA 3DRSA 1U04A 4KTWA 1KVBA 3QERA 3TABA 1BQNA 4CGDA 5DK5A 3SQ1A 4FW1A 2GV9A 3AVBA 3QEXA 3V1QA 3ZSOA 2OPPA 3AA2A 1LWEA 3D0PA 2D0AA 4KB0A 3C95A 4EP5A 3LALA 4KHNA 3L2UA 2VG6A 3HPGA 3ZT4A 4IFVA 5I3UA 3SNNA 1HQEA 3OYHA 4BACA 1JLBA 2P5OA 4WE1A 5J1EA 3NE6A 1QSLA 4DSIA 1NKCA 4FJ7A 1HYSA 2WOMA 3DLRA 3L2WA 1B92A 2XHBA 4DU1A 2GUIA 5SWMA 3V9UA 4CJ4A 3I0SA 5J2QA 1ZBUA 3NH1A 5FRMA 2XY6A 4KREA 4B9UA 4PY5A 1LW2A 4CGIA 4E89A 3K57A 2KZMA 5J2NA 1LW0A 1WSHA 1RNHA 4FJNA 3ITHA 3DLHA 4B3OA 1EXQA 3K5OA 4OKJA 3LP2A 1BQMA 1RT3A 4PQUA 4KHWA 3AVGA 3AV9A 3C6TA 4FLVA 3HYFA 4O44A 3KK3A 1T8EA 3NDKA 1NKBA 2D5RA 3V9SA 1EX4A 4IDKA 3RR7A 3TR8A 4JS4A 3KLEA 3ZSVA 3DYAA 1TL3A 2IAJA 3SPZA 2IC3A 1ASWA 4W5OA 1Q8IA 2G8FA 2PY5A 2HHQA 1WLJA 3SUNA 4Z4FA 3VQ9A 1CZBA 2YHBA 3DLEA 4OGEA 1NK8A 4M3TA 2BDPA 2AJQA 4HUEA 4DSKA 4K8ZA 1RDCA 3LAMA 3NFAA 1NK4A 1TAUA 3LZJA 1QE1A 4BE2A 4CJLA 1CZ9A 3BDPA 2VG5A 4FM2A 4KTQA 3WNFA 4CJRA 2OZSA 4YNQA 4KHUA 1XC9A 1Q9XA 4W5QA 4E7HA 1ITGA 1QS4A 3KD1E 2RKIA 3SYZA 4CJVA 3O3GA 3ZCMA 4Q0BA 3E01A 1VSIA 4J2EA 4DMNA 1QQCA 4DSFA 1TK0A 4HTUA 4OKEA 3AO5A 1HPZA 3CFOA 4KI6A 2HB5A 3V1RA 1RT2A 2RF2A 4ID1A 1RTIA 3CG7A 2VWKA 4BDZA 1GOBA 4DQQA 2KTQA 4O4GA 1SV5A 1HQUA 1S1TA 1EKEA 1LAWA 4RW6A 3T19A 1C0TA 1C1BA 3LP0A 4QAGA 4CGHA 1RBVA 4JS5A 1RT6A 3OJUA 1D9DA 4HCBA 1FKOA 4ICLA 1WSGA 3SQ0A 3L2RA 2F8SA 5K14A 5KRTA 2YNGA 5CZ2A 3B6PA 3TAQA 4NYFA 1C1AA 1S9GA 3P1GA 3NGIA 3SV3A 1NJWA 4J2AA 4NCAA 4CEFA 4OKKA 1XHZA 4E7IA 4DU4A 3NF8A 3ZT3A 4O0IA 3HP6A 3P5JA 3QINA 3OYEA 2XY5A 2DTUA 2G8KA 4B9TA 1RT1A 3TAFA 3NAEA 4OLAA 3KKRA 3TAPA 2YKMA 3O3FA 3VA0A 2P51A 4FJLA 1CXUA 3OYIA 2F96A 2IGIA 5T7BA 3HXMA 4DTRA 4DSEA 2RN2A 4KO0A 3NGYA 3WNGA 4FJHA 1RDDA 2HVHA 4PWDA 3KTQA 3SCXA 4Z4HA 1SKRA 2G8IA 4FJXA 1LWFA 2GBZA 4OVLA 4FLXA 1ZBLA 3LPTA 3MEDA 3DOLA 4DU3A 4XIUA 1T05A 3NF7A 3OYKA 4DQSA 5CZ1A 2IOCA 3AO4A 1VRTA 3ZSQA 3AVNA 4R5PA 3NCIA 4CK1A 3KLHA 3NBPA 3M8RA 1D9FA 4ELUA 4DFKA 4C8NA 3OVNA 4FJIA 1YTUA 3AVLA 3RWUA 1JL2A 1FKPA 4CFDA 3OYDA 3V9WA 4FZYA 2IDOA 4CEZA 3CQ8A 3WNHA 2FBXA 3ZT0A 4FM1A 3KD5E 1J54A 1EETA 1WAFA 4YFUA 1WNSA 3SQ4A 1RBRA 4CJPA 4BWMA 4DWIA 1S1UA 4CHNA 4CJUA 3AO3A 1WSFA 1VSDA 4HUFA 3DRRA 3NGZA 5C42A 3VA3A 4CGFA 4F2RA 4DQPA 4FW2A 2JLEA 4L8RB 4E19A 4M41A 3K59A 4CERA 3S3OA 3S3MA 1NJXA 1KFSA 3M8SA 4FJMA 3DOKA 4DLGA 4ZTFA 1D8YA 2QK9A 3P83D 1BIUA 4F2SA 2OPQA 2Z1HA 3SZ2A 4M45A 4N76A 3ZT2A 4CEAA 4DTXA 3AO2A 4FJJA 3TAEA 3RRGA 1VSKA 3NF6A 4AHVA 5KTQA 4HUGA 4K8XA 4DQIA 4DQRA 1XHXA 4OPJA 1HMVA 5SZTA 1HRHA 3KIOA 3SUOA 1F21A 4B8AB 5DMRA 3RMCA 4IG0A 4FJKA 2RPIA 2PZSA 4F8RA 3KLIA 4CEDA 1A5WA 1TL1A 3PX0A 4I9LA 2B5JA 2ZQBA 1TKXA 1HYVA 3QNOA 4F3TA 4ZTJA 1BCMA 1NK0A 3TAMA 2HW3A
chains in the Genus database with same CATH superfamily
4I9QA 3THYA 3TSQA 1E3MA 1UWBA 1W0HA 3D2EB 5HRSA 3VMFB 1JKHA 4NCBA 2FBYA 4CJSA 4MO5A 2P5GA 2P9IB 3LM2A 4B3MK 2GTDA 2HOEA 2H3GX 1LWCA 1VSFA 2GEMA 3MCPA 4I6MB 4WFNL 1D5AA 4NLCA 3OJSA 5FDLA 3E1YA 3N4QA 3U8XA 4CIGA 2ZJPL 3O5BA 4BY9C 1JCFA 4YOUA 3OS1A 3ZX0A 4IZ9A 4AHSA 2UXDK 4BRGA 4DR3K 1QZ6A 3QEPA 4CF2A 1BISA 5GAGP 3RMAA 4CF0A 5JVHL 3KLFA 3TARA 4IJNA 1Z26A 3ZETA 3J81O 3T7ZA 5KQDA 4BQZA 4AH9A 2YI1A 3FZLA 4I7FA 1VSHA 3LAKA 4IG3A 3AVAA 3I8DA 1JLQA 4FZXC 3HZ6A 3R6MA 5EVZA 1VAZA 3UKUA 3VQAA 4EP4A 4CK3A 3CQYA 4Z0UA 4CJ7A 3TWHA 4FLZA 2NRXA 4H0OA 2XY8A 1N32K 5HP1A 3MWPA 2ZF5O 4CHZA 3S9HA 1X3MA 5BPLA 3MEEA 3O9QA 3CFPA 1JCGA 1U45A 1YT3A 4J2BA 3AY9A 1MA9B 3CJBA 4Z4IA 4F3OA 3V9XA 5HRNA 3AA3A 4X62K 2W41A 4JKCA 1L3TA 2PYLA 3K2PA 1HUXA 1BL3A 4BRMA 2F8TA 4JKEA 2XRIA 2BE2A 4W5NA 3DWLA 2KLAA 3VQBA 4FJ8A 3HO1A 5AQFA 3QBWA 3H6EA 4DF8A 3J7ZO 3C6UA 1KAXA 3THWA 1FXXA 3NHGA 2QEXN 2P9SA 1VQLN 4LF5K 1HJOA 4K43A 3NVMA 2B4JA 4MFBA 1KCFA 1BHLA 4FWSA 4NYNA 4JI2K 1NK6A 2O4IA 3GOIA 2VYPA 4ELTA 4PA1A 4KH5A 2QW9A 4OJRA 4H8KA 2QWRA 4EHTA 3OYMA 3GE1A 3OY9A 5EOYA 2JGUA 5HRPA 1BIZA 1Q7YO 4DV4K 3I55N 3MN5A 3H46O 3ZSRA 3OBWA 1RT5A 3GDQA 5HRRA 1ATSA 4JKAA 4EZ9A 1RTHA 2NRZA 3QEVA 3LDSA 4M3ZA 3LDQA 3QO9A 1DEJA 1SL1A 4N47A 2OTLN 2G8VA 1MDUB 2DFEA 1C1CA 2W42A 2ZE2A 4DTPA 1NJZA 1HNXK 3C94A 3IG1A 1IG9A 1BOTO 3TANA 1I39A 4YY3K 2CH5A 4K41A 2VWJA 2HHWA 1SL0A 1BI4A 2P9KB 4B1VA 4K42A 4DTMA 2UXCK 4RG8A 1VQ8N 1KSPA 4FZZA 3G6EN 5AQOA 4CZJA 3QIOA 4YORA 3QETA 4B9QA 4L3QA 4CJEA 5AZJB 2ZGYA 1S22A 1VHXA 2PYJA 4RW9A 1ATNA 4CF9A 2KZZA 3AA5X 4PKGA 3CCRN 4CIFA 3K5MA 3I33A 1KVAA 4CHPA 4JRQA 1RBUA 1C0UA 3D2FB 5AQHA 4C8OA 2EHGA 3L2QA 1K9MO 1IH7A 3MN6A 3UIQA 3SUPA 1QVGM 5FPEA 3O6WA 4ISFA 4BC3A 4C1NK 3VTHA 1KD1O 4C8KA 2FC0A 3E9OA 2B6AA 1XC3A 1J9AA 2OTJN 2Q3SA 3HSTB 4DKWA 4H4OA 3QEWA 2E6LA 1A5VA 2NUBA 1D4XA 1IKWA 4CBWA 4X64K 2QKBA 3FFIA 3ALYA 3O4NA 2O8BB 4JKHA 1YUWA 3RVCA 3AGKA 3VQ5A 4GKKK 2AA4A 4O8UA 2CGJA 4A5AA 5E41A 4BRQA 1WBDA 2QKKA 1CZAN 4LH5A 5GINA 4M63C 1BA0A 4OLBA 4Y0WA 3AVIA 5C15A 3IAYA 5MLCQ 4CEOA 1JJ2M 5KPRA 4DTNA 1RTDA 1MWKA 4OPKA 1MU2A 2P9UB 4DFMA 4Z4CA 4KHQA 3DRSA 4KTWA 3RSEA 1BQNA 1VQ9N 3SQ1A 1RGIA 2Q0RA 4K25A 3DLLL 3O1WA 4GV6A 3C95A 4DV1K 2VG6A 3QMLA 5I3UA 1GLAG 5EY4A 4DSIA 4FJ7A 1T6CA 2XHBA 3TTDA 4JI1K 3L2WA 4DU1A 2JWKA 3MWTA 4CJ4A 3I0SA 3NH1A 3U4LA 4PY5A 3CMAN 2NRRA 4E89A 5F2RA 2KZMA 5J2NA 4CD1A 1LW0A 1RNHA 3ITHA 3DLHA 1EXQA 4OKJA 1BQMA 3ZX3A 3C6TA 3AV9A 3SK3A 1T8EA 3QB0A 3TU5A 4JS4A 3DYAA 1RFQA 3CJ7A 5BR9A 1Q8IA 4BQLA 3VQ9A 1CZBA 5C0YA 3FR0A 4H5RA 4HUEA 4K8ZA 4BRFA 1U6ZA 4OPHA 1YVNA 4BVPA 1CZ9A 3O8MA 1XMOK 4FM2A 2FLOA 2A42A 3MCAB 4AQYK 4YHHK 1XC9A 4W5QA 1QS4A 3KD1E 4CJVA 3O9UA 3UE5A 5AQPA 2O8CB 4BR9A 1TK0A 3AO5A 1NMDA 3H1QA 3CG7A 4O4GA 3EZWA 1LAWA 4RW6A 1BUPA 3T19A 3LP0A 4DV2K 4QAGA 3OTOK 4F9OA 4HCBA 4ICLA 2F8SA 5K14A 2YNGA 5CZ2A 3TAQA 1C1AA 3SV3A 4FOEA 4MO4A 4YOXA 3NVKA 3OW2M 4E7IA 4DU4A 3OYEA 2XY5A 2ASPA 2E2NA 2F9TA 2FSKA 4OLAA 3VA0A 2P51A 4FJLA 1CXUA 2IGIA 4QS9A 4DSEA 3VETA 2PBDA 1LWFA 2GBZA 3KK7A 5ADXH 4OVLA 2ZJQL 5M1PA 3MEDA 3VPZA 4O8KA 1E4FT 3ZSQA 1WBBA 3J7YP 1D9FA 3NBPA 4IO8A 4JN4A 3OVNA 1Y64A 3EN9A 4BRHA 1FKPA 3CJ9A 3V9WA 3WNHA 4DV0K 4FWNA 4FWQA 3I56N 3CCEN 3KD5E 1WAFA 1WNSA 4JI5K 1RBRA 3CJCA 4CJUA 3AO3A 4BRAA 1VSDA 1KAYA 4CERA 3S3OA 3S3MA 2ASMA 1KFSA 2QK9A 4LF8K 1BIUA 3C0BA 4H5VA 1Q82O 4M45A 3ZT2A 1H1VA 4CEAA 3HOSA 3L0QA 3TAEA 1YF5L 5KTQA 2UU9K 4DQIA 1XHXA 2IVOA 1HRHA 4WQ4C 4B8AB 3RMCA 3BF3A 1HLUA 4FJKA 1A5WA 1TL1A 3PX0A 4BRNA 3C7NA 1BCMA 3TAMA 2HW3A 3ULDA 3J80O 1BA1A 1JXBA 4BC2A 3U3YA 2OA8A 2E88A 5C24A 3ZEUA 2O8FA 4FO0A 4CK2A 4KTZA 4DTSA 1LOTB 4EZ6A 2EWSA 4KKOA 1VRUA 2Z1JA 4NO7A 3T1YK 4FLUA 4KB1A 4FCYA 4LH4A 4AHRA 4O5BA 1X1PA 5KGWA 1KLNA 1NGDA 3WNEA 2KHOA 3H3OB 3LL3A 2ZD1A 4FL9A 1B9FA 1VSJA 2CH6A 4GY2B 4AHUA 4N56A 3PY8A 1RILA 5KGXA 3DMJA 1GOCA 1YITN 3D2EA 4A2AA 3CF5L 5BN8A 1N5YA 4I2PA 2HHXA 1HKBA 1DGKN 1DTTA 1B9DA 3AGRA 4FK0A 5CYQA 1EO1A 4OO1J 1GLLO 2XY7A 3O9TA 4BREA 2E1ZA 2Q97A 1WUAA 2YNIA 4I6MA 3CC2N 3FZFA 4OGCA 4O55A 3QNNA 3ATUA 3SLCA 3V81A 1QQNA 3G25A 2X74A 1BCOA 2P1JA 1NGFA 3VQCA 4DTUA 1U49A 4RTFD 3W0LA 5HOOA 1VQKN 4JI3K 1DLOA 2QWNA 3PV8A 4M3RA 1G15A 4DUYK 3H45C 3K0SA 4RW7A 1ASUA 1Q81O 4CJFA 2HVIA 3CQXA 4CGGA 1HJRA 1UAXA 3KVGA 4ZHRA 2FF3B 1VQ5N 1X9WA 1HNVA 3VQQA 3CIPA 4CGJA 3OS2A 2IS3A 4E0DA 1TKZA 2A3ZA 3W3DA 2OCEA 1G99A 2X6NA 5AQSA 5LMUK 2Y1IA 4JYAK 5J2MA 3TTCA 1U2VB 5AQMA 3M6GA 3F9MA 3HVTA 1NGGA 1ESVA 2NRVA 2YNFA 4QS8A 1RDBA 3O80A 4KPYA 1N6QA 2ZGZA 3U6FA 2UUBK 4PHTX 3LM9A 1I3AA 1LAVA 5BPMA 1HNIA 3HL8A 4CFCA 4DG1A 4DQ8A 1Q86O 4C8LA 5AQLA 3KK2A 3VQDA 4ILHA 3QLHA 1Z25A 2I5JA 4KHSA 2HNYA 5C12A 4CBXA 1S1XA 3V1OA 4DR5K 4CEQA 5E26A 3UKRB 4JKFA 5C25A 1NK7A 3TSUA 3AARA 4IFEA 5I42A 1S72N 5TKWA 4A2BA 4B3RK 4A57A 3E66A 3OA9A 4FPAA 5AQXA 3MAQA 1ZXOA 4BRCA 3L4QA 3MECA 3D6RA 3CJ1A 3ATVA 4O5FA 5F0XA 2HMIA 3SMSA 1UA0A 1WSIA 4OX9K 1YTAA 4FXDA 2Q2RA 2OPRA 3QBXA 4CZLA 3BZKA 1NK5A 3CCUN 4BE0A 3F73A 4UY8O 3G10A 5BRDA 3Q7CA 2GX9A 4JI6K 2A1SA 3ZSXA 4PKHA 4DR1K 1KAZA 4N41A 1TGOA 4A61A 4JLHA 1TKDA 5CYMA 2P9KA 4CE9A 3HSCA 3PO4A 4QOZB 3OYGA 4CJ3A 1EQYA 4E7KA 2QA4N 4B3TK 3FZHA 2W6LA 4XH4A 5CHIA 1HNZK 3DJCA 4JI7K 4BRDA 3K5LA 1RCHA 5AZJA 3AVCA 3ZT1A 1YJ9N 1NKEA 2G8HA 4CECA 5BRHA 4H0YB 2HMPA 1JLFA 3DLKA 3DXMB 2FBVA 1XNQK 3NF9A 3ID6A 3MDQA 3OYAA 2HHVA 4LF4K 3L3UA 4PL8A 1EWRA 4AHTA 3D2FA 1KLMA 4HVJA 1W97L 1VQON 3EE9A 5KPTA 1TV6A 1CLQA 1HX1A 1BO5O 1XUPO 3EY1A 1T7PA 4B1UB 4QS7A 3KK1A 4GVEA 5JS2A 1REVA 2HHUA 1BGXT 4CZMA 2YNHA 5AQUA 4IOXA 4EIAA 2GWKA 3ZSYA 3VN5A 1WN7A 3EZ5A 5HBMA 4CHOA 4BGBA 4Y1DA 3BY5A 1QVFM 4B9VA 4RW4A 3ASMA 3H3NO 2V52B 4GNIA 5AFUA 1TAQA 3FZMA 1VQNN 1U04A 2O8BA 5EX5A 4CGDA 1GLCG 3ZSOA 4JHDA 2D0AA 4KB0A 3EKSA 4BR4A 4EP5A 5IWAK 3L2UA 3HPGA 1HR0K 1Z6RA 3NE6A 4LF6K 1HYSA 2WBNA 4YDUC 4H03B 5M1OA 5H1SQ 1ZBUA 4JK7A 4KREA 1LW2A 4CGIA 2QXLA 1WSHA 3PSIA 3LP2A 3G4SN 3AVGA 1NJIO 2P9UA 4O44A 3NDKA 3IKMA 4WF9L 3SJHA 1K8AO 3ZSVA 2VWBA 1TL3A 3SPZA 3CC7N 3H1VX 4M7YA 4W5OA 3CCVN 1OH7A 2HHQA 3CI5A 2V7ZA 2AJQA 3LAMA 1QE1A 4BE2A 5GAHP 2WUSA 3R3LA 2OZSA 2V51B 5AQZA 3MMVA 1Q9XA 1ITGA 5C2DA 2RKIA 3O3GA 3ULEB 4J2EA 1DT9A 4DMNA 1QQCA 5M1FA 4HTUA 3O9SA 1HPZA 4KI6A 4PKIA 4IEIA 4CZHA 2RF2A 2ZWHA 4BDZA 1NGJA 5BRFA 1HQUA 4IJAA 5KQ8A 1YJWN 3SMPA 1C0TA 1RBVA 3P38A 1RT6A 4JS5A 1D9DA 4LF7K 5KRTA 1HKGA 3PIPL 3P1GA 2KKZA 1XHZA 2VGNA 3ZT3A 1ATRA 3HP6A 3CMEN 3NAEA 4B3SK 2YKMA 3O3FA 2O8CA 5M1QA 4JHDB 3HXMA 4IDHA 1RDDA 4B1YB 1SQKA 1J6ZA 1SKRA 4FJXA 5KPZA 4FLXA 4JNEA 1T05A 3OYKA 5CZ1A 2IOCA 3AO4A 1VRTA 3NCIA 3AVNA 4B1ZA 4CK1A 1VQPN 1N34K 4JD2B 4ELUA 3WXKA 2P9PB 1FW6A 2QWOA 3CCLN 4DV7K 4MLEA 2IDOA 4B1XB 4CEZA 4CI6A 5AJ3K 4CZEA 3ZT0A 1EETA 4CZIA 2YX6A 4DWIA 1WSFA 3NGZA 3WQTA 4FW2A 4L8RB 4E19A 1P90A 3CCSN 3M8SA 3DOKA 3WEEB 1D8YA 2OPQA 2Z1HA 3SZ2A 3AO2A 3NF6A 4ILJA 2UUAK 3K9KA 4OPJA 1F21A 2PZSA 3KLIA 2QWMA 4I9LA 2B5JA 1TKXA 1NK0A 4HCCA 1YHQN 4NXNK 2P9LA 4FLYA 3FGUA 5AQWA 2I7NA 2IIRA 1QHTA 3HPOA 4FJGA 4DCHA 1NMNA 1GLEG 1JLAA 4OPAA 1J5EK 5DM7L 4EFHA 3AVJA 2A5XA 2ETJA 4QCLA 3EYZA 3WXLA 3VEWA 4JEPA 4BR0A 3ENBA 3CD6N 3HBTA 4JKBA 4E1NA 4DSJA 3QEIA 3LP1A 4CW7B 3MXMA 4A5BA 4E1MA 3THXB 2BUPA 1S1VA 1ZC6A 1TUUA 3GBTA 2X6SA 3E9PA 3PIOL 2F7TA 4CEBA 3CETA 4BR2A 3IFRA 3TPQA 3WXJA 3NH0A 3EL2A 3M3ZA 3VEYA 1DKGD 1NG9A 3VF4A 1ZBIA 4JRPA 4IOCL 2A1RA 3T1AA 4KRFA 2ATQA 4B1WB 4J2DA 1KXPA 1TK5A 1IO2A 1RT4A 1LV5A 1T6DA 4KAZA 2WONA 1VQMN 2YKNA 3CM6A 3FE1A 5I9EB 5AZIB 2WTUA 4BC4A 2Q1NA 2V7YA 3WQUA 3T69A 1A5XA 4CFAA 1RDUA 3O4WA 4KH6A 2VG7A 4O0JA 5LL6Z 5AQKA 2UYTA 1UA1A 4CJTA 1J5OA 1X9JA 3TTFA 2FBTA 5LJWA 5AQYA 1V4TA 1VSMA 1BWFO 3LDNA 3VQ6A 1WSEA 4DV6K 1NGAA 4E1JA 1TK8A 4DV5K 5JLFA 1S9EA 1O1WA 1S1WA 1JL1A 2GWJA 1IBKK 4Z4GA 3RRHA 1XMQK 2QWLA 4V19S 1NU0A 1LCUA 1Y97A 4GMJB 4C8MA 3KHYA 2P9LB 3LZIA 1C6VA 4XH1A 3ZSZA 3O3HA 1VSEA 3KZBA 3VQ7A 1N33K 4JI8K 3DLGA 1M1KO 4BDYA 3CFRA 4Y1CA 1JLGA 2NRWA 3C65A 1U48A 4PUOA 1MWMA 1XWLA 3PUFA 1K6YA 3O9RA 2Q36A 3JAMO 3QESA 3AVMA 3VQ4A 3VERA 3L2VA 2E6MA 5FROA 4XH5A 4IBNA 4GVMA 3LDPA 4DV3K 1OKJA 1IBMK 2IVPA 3SBTA 4DTJA 4FWMA 3MEGA 2Q31A 3V6DA 1S6PA 3VGKA 3B6OA 4A62A 2F9WA 5J2PA 3LANA 2QXFA 1L3UA 1NGCA 1HPMA 5C2FA 1YXQA 5M1KA 3AVKA 4M3XA 1U2VA 2ZM6K 4WQ5C 4CZGA 3AVHA 4DFJA 2F4VK 1T03A 4FLTA 1ZBFA 4H4MA 4IFYA 4YDUA 3VQPA 2P9NB 2VQFK 3MX2A 5B8HA 3HRGA 2DFHA 4W5TA 4CHYA 1IKXA 4FK4A 3M1FA 1L3SA 2KQ2A 3BEXA 5HROA 3HP9A 4F4KA 3BF1A 3DAWA 1YJNN 3RMBA 1VK0A 4M7XA 2UUCK 1UOCA 3KJVA 4RW8A 1NOYA 4B9NA 3UKRA 3CCQN 3EKUA 4E3SA 2E20A 2YHWA 3ISNC 3FZKA 3SJJA 2Y1JA 1SKSA 4M42A 2BGGA 3MN9A 2YV0X 3MX5A 3VEZA 1IJJA 4BRIA 3LWMA 3IMXA 3HJFA 3ZX2A 4DR4K 3SUQA 3ZSWA 2E4LA 2HNZA 3L3VA 1L3VA 1HNWK 1NGBA 3TSPA 2HF4A 2HHHK 3PX6A 3A5LC 3HOTA 3MK6A 4FLWA 1XQSC 2DPNA 4CCHA 4M3WA 3VEVA 1SAZA 3OBYA 2O8EB 3EO3A 4FJ9A 4ISGA 2D0BA 2G8UA 4E7JA 5FRNA 3OYLA 4E7LA 1SKWA 1S6QA 1TVRA 2OPSA 3VEXA 3J7AP 4GKJK 4C23A 4KFBA 3VQEA 4U67L 1X9MA 3AVFA 4CHQA 2OYQA 4FYDA 5AQGA 4B9SA 3HVRA 3ID8A 3EEQA 4DTOA 3VF6A 5KI6A 4MQ3A 3VESA 2OANA 4N5SA 1ZYQA 4LFCK 3S3NA 1Q9YA 3F9KA 3SI6A 1T44A 1KVCA 3BP8A 4BR5A 1N36K 1RBSA 3TI0A 4CESA 3DRPA 2FSJA 2LSNA 4JKGB 3CYMA 3CM5A 3O08A 3IS9A 3KKSA 5EXWA 3DXMA 4CFBA 1RT7A 3ENHA 1SL2A 3CC4N 1T3VA 4KBOA 2E2PA 5DK5A 4FW1A 4H5NA 4CZFA 2GV9A 2OPPA 3AA2A 4C1NI 1LWEA 2HBLA 1TYQA 2A41A 4JKDA 3OYHA 5DM6L 2P5OA 2YJFA 5J1EA 4Z94A 2WOMA 1NBWA 1B92A 3WXIA 2GUIA 3IUCA 3V9UA 1C0GA 2FXUA 4BRKA 3FFKB 2XY6A 1X3NA 4B9UA 1KC8O 4BC5A 3R8EA 1OH8A 3K57A 4NXMK 1OH5A 1K8KB 3K5OA 5AFUH 2NLXA 1RT3A 4PQUA 1KQSM 3KK3A 2YHXA 3V9SA 4HTLA 2QTDA 3KLEA 2IAJA 1ASWA 1SZ2A 1WLJA 3SUNA 5HL7L 4Z4FA 3DLEA 4DR7K 3KWIA 1YAGA 4A59A 3F2KA 4BG8A 3NFAA 4CJLA 3KWGA 3WNFA 4GV9A 4YNQA 4E7HA 2D1KA 2VGMA 5GAEP 1VQ7N 1WOQA 3ZCMA 4Q0BA 3E01A 5AQNA 4DSFA 3F5TA 3CFOA 2HB5A 1GLJO 3GL1A 5FPNA 2VWKA 1GOBA 1SV5A 2HBKA 2O8DB 3S41A 5ELZA 4CGHA 1FKOA 3B6PA 4FPBA 4X66K 1S9GA 2FSNA 3NGIA 1NJWA 4RCHA 4NCAA 2YCHA 1NNEA 5BN9A 3NF8A 3P5JA 3QINA 3I8BA 2G8KA 4B9TA 1RT1A 3TAPA 5IT9O 4BGAA 3ULEA 5LJVA 1K73O 3OYIA 2F96A 4DTRA 2RN2A 4X65K 1TYQB 4CD3A 2HVHA 4FSVA 2RHKA 3KTQA 1W7AA 3DOLA 3N4PA 3R9PA 4XIUA 4NLBA 1BG3A 4FVUA 4DFKA 1BDGA 3WUHA 2NNWA 1YTUA 3AVLA 3RWUA 1JL2A 4CFDA 4FZYA 4H0VB 1J54A 3THYB 3SQ4A 5AQRA 4BWMA 1S1UA 4CHNA 4F2RA 3VA3A 5C42A 4DQPA 1VQ4N 4LFBK 3K59A 1NJXA 4FJMA 4ZTFA 4F2SA 4N76A 4DTXA 4FJJA 3RRGA 1P8ZA 4JI4K 1VSKA 1OVQA 4AHVA 4HUGA 4K8XA 1C0FA 3PSFA 4DQRA 3SUOA 4JD2A 4KH4A 4F8RA 3A8YA 5JLHA 2P9PA 3A0IX 3VGMA 4WQ4A 4WFBL 3QNOA 2D4WA 4Z4EA 3ZLJA 2HBJA 3M8PA 1QTMA 4I2QA 3CPEA 1VQ6N 3HM9A 3A5OC 1QHAA 5JICA 3ZETB 4G1QA 3BZCA 3R1XA 4LC9B 3WEEA 3D7EO 1WSJA 5AQVA 4FM0A 3LPUA 3K58A 1U47A 4EAHD 3JS6A 4WQ5A 3OYFA 4KHPK 3MXJA 1U4BA 3H08A 3O4QA 3UKUB 3KLGA 3JXUA 4AHCA 2HBMA 3U3GA 1NWKA 3A5NC 1WB9A 2HHSA 1J53A 2NRTA 1ASVA 1DTQA 1JLCA 3HT3A 2R7YA 2VQEK 3SAHA 4W5RA 3SV4A 3OS0A 4GV3A 5FLXO 3QFPA 2A6AA 3SBGA 1JXEA 1WAJA 4B8CA 4MDBA 5AR0A 4R79A 4FK2A 5EU7A 3C6AA 5D3GA 2Z1GA 1KTQA 1QQMA 5BR8K 3PO5A 2A40A 3BUZB 3V9ZA 2RE2A 2BH1A 1QSYA 3RTVA 3V4IA 1OH6A 5A2QO 1NLVA 2GUPA 2OZMA 2BANA 3THXA 2PAVA 4AM7A 4UQGA 2NZTA 3A2FA 3FLCO 4EHUA 5TKYA 2Z1IA 3THWB 1HKCA 4BWJA 1GLBG 5FPDA 1R59O 4TSXA 1SUQA 2P9SB 4ID5A 3CHWA 3SQ2A 1NGEA 2E1YA 4FOIA 4AM6A 1GOAA 4M3YA 2HNDA 4DFPA 1EP4A 3QDKA 4KV8A 1RDWX 1RTJA 3AO1A 4FWOA 4LSNA 3OHRA 4NCGA 4LD0A 4CJKA 5AZIA 3PLAA 4HHTA 1EWQA 1JCEA 2EX3A 2YHAA 2ITGA 1NK9A 3SAGA 4DUZK 1QZ5A 5GIOA 4CIEA 4ILGB 2I7PA 1NJYA 4DLEA 5JVGL 2BTFA 4KI4A 1FK9A 4M3UA 4FVMA 4AILC 4B08A 1W9HA 2WC9A 1V4SA 3OYJA 2KFZA 1YVUA 3HI0A 3LP3A 4IEEA 4BRPA 4LSLA 3LWLA 3L4IA 3VOVA 1O13A 4FWKA 1N8RO 1ILYA 1CXQA 1IKYA 2XO7A 2E2OA 4DHYA 1RBTA 2O4GA 1BI4B 4CJ5A 3L8BA 1W2BM 1R0AA 2J4RA 1QSSA 4JV5K 1QQOA 1NGHA 4FWLA 4CF1A 4BDPA 4XEIA 5CR4A 3I0RA 4DS5A 4DF4A 2ASOA 3DM2A 3M5RA 1VSLA 1C0MA 2Q0UA 4J8FA 1IKVA 4BROA 2G8WA 4YOVA 3CCMN 2WFBA 3RMDA 3SPYA 2GELA 4K0KK 5GADP 1ZBHA 3VENA 3T3FA 3AA4A 3HK2A 3RR8A 1XI1A 3VF2A 4YOYA 3LDOA 4WCEL 3BGRA 4CJWA 1M90O 3WXMB 2DFFA 1I94K 4CVNE 2KFNA 4H5TA 1NGIA 3C6HA 2HSTA 3EE8A 1L5UA 3E9LA 4B9LA 3VQ8A 2UXBK 4BRLA 1KRPA 3IRXA 4CEEA 3Q7BA 5HLFA 2W40A 5GIPA 3DI6A 2P9NA 2X78A 5F1XA 1S5JA 3MXIA 4FWPA 3NH2A 2ITMA 1JLEA 4IOAL 4BE1A 3AAQA 4GW6A 2KW4A 3QIPA 4ELVA 1TKTA 4LY7A 3ENOA 3GG4A 4FJ5A 3L6QA 5JS1A 4B9MA 3CERA 4JK9A 3JYTA 4IKFA 4DS4A 4DR6K 2HHTA 3QFUA 1YI2N 2D0CA 1RDAA 3TAGA 3ZYYX 3M8QA 3VEOA 1HYZA 1X9SA 1NOZA 5JMVA 3RSEB 2E2QA 3JSMA 3DLBA 5AQIA 2IVNA 4CJQA 2DY4A 4YOTA 3P39A 4KHYA 4DSLA 3PX4A 1IG8A 2E5LK 1IV0A 3CPWM 4CF8A 2PFUA 4Q5VA 1FJGK 5CY4A 1Q18A 5BREA 4PL7A 3OYNA 3D45A 3THVA 3T1HK 2O8EA 4AF1A 3CXCM 3OYCA 3CCJN 5KRSA 4LFAK 2FF6A 1XNRK 3G0ZA 4H0TB 4JK8A 3OYBA 3K5NA 1KFDA 2QI2A 3HPHA 4BVOA 5M1NA 3IDHA 3QERA 1KVBA 3TABA 3AVBA 3QEXA 2YHYA 3V1QA 4WYBA 4IWVA 2D0OA 3D0PA 3VGLA 2NRHA 3LALA 4KHNA 3ZT4A 4IFVA 3SNNA 1HQEA 2QWPA 4BACA 5CE3A 1JLBA 2AP1A 4WE1A 1QSLA 4H5WA 1NKCA 3DLRA 2ZJRL 2YJEA 5SWMA 5J2QA 4HWIA 5FRMA 1S3XA 4JKGA 4FJNA 4B3OA 5C10A 4H0PA 1GLDG 1GLFO 4KHWA 4FLVA 3HYFA 1NKBA 2D5RA 1EX4A 4IDKA 3RR7A 3TR8A 2IC3A 4FWRA 2PY5A 2G8FA 1OVYA 2YHBA 4JAXA 4OGEA 3QICA 5LY3A 1NK8A 4M3TA 2BDPA 4DSKA 1RDCA 1NK4A 2VCPA 1TAUA 4BG9A 3LZJA 3BDPA 2VG5A 2W6KA 4KTQA 4CJRA 1E4GT 1BU6O 4KHUA 2CGLA 2JWLA 4IXCA 3DXKA 3SYZA 3K9JA 1K8KA 3HTVA 2D0PA 3P31A 1VSIA 4DR2K 4OKEA 3P4IA 3V1RA 1RT2A 4ID1A 1RTIA 3SAFA 5LMNK 2KTQA 4DQQA 1S1TA 1EKEA 2P9IA 3LDLA 3B8AX 3VTIA 5ADXA 2QWQA 3HM8A 1ZBSA 1C1BA 4RWTA 3OJUA 5AQQA 1WSGA 3SQ0A 3L2RA 4NYFA 4J2AA 1NM1A 4CEFA 3NMUA 4OKKA 4IO9L 4O0IA 1IBLK 2DTUA 1SS6A 4LF9K 3TAFA 3KKRA 4CZKA 2QM1A 3J8AA 3U9DA 3WT0A 5T7BA 4H0XB 4FJHA 4KO0A 3NGYA 3WNGA 1YIJN 4PWDA 4G9ZA 3SCXA 4Z4HA 4MDAA 2G8IA 5FPMA 1TUYA 1ZBLA 3LPTA 4DU3A 3A5MC 3NF7A 4DQSA 2O8DA 4R5PA 3KLHA 3M8RA 2CGKA 3O1BA 4C8NA 4FJIA 2HF3A 2E8AA 3OYDA 4U7BA 3C7NB 3CQ8A 2FBXA 3MN7A 4FM1A 4YFUA 4CJPA 4MLHA 3CJAA 3ZEUB 4HUFA 3DRRA 2O8FB 4CGFA 2JLEA 4NB4A 4M41A 3UB5A 5BPNA 3U9ZA 4CBUA 4DLGA 3P83D 4JI0K 4YOWA 4ISEA 3AAPA 5AQJA 1Z05A 1HMVA 5SZTA 3KIOA 5DMRA 4BR7A 5AQTA 4IG0A 2RPIA 4CEDA 4WFAL 2ZQBA 3G71N 1HYVA 4F3TA 3DXKB 4ZTJA 5E84A 4DB3A
chains in the Genus database with same CATH topology
3ULDA 4FLYA 3M8PA 4I9QA 1QTMA 1JXBA 1UWBA 4I2QA 1W0HA 3U3YA 2OA8A 5HRSA 1QHTA 3HM9A 3HPOA 5C24A 4FJGA 1JKHA 4NCBA 1JLAA 2FBYA 4CJSA 4CK2A 4G1QA 4KTZA 4DTSA 3AVJA 2P5GA 4EZ6A 1WSJA 4FM0A 2ETJA 3LPUA 3K58A 3EYZA 4QCLA 1U47A 1LWCA 4KKOA 1VSFA 1VRUA 2Z1JA 4FLUA 4KB1A 4FCYA 4LH4A 4AHRA 4O5BA 3OYFA 3MXJA 1U4BA 4E1NA 4DSJA 1X1PA 5KGWA 1D5AA 3LP1A 3H08A 5FDLA 3OJSA 3QEIA 3MXMA 4CIGA 4E1MA 1KLNA 3O4QA 3WNEA 1S1VA 3KLGA 2ZD1A 3OS1A 4AHCA 2X6SA 1B9FA 3U3GA 1VSJA 4AHSA 4AHUA 4N56A 2HHSA 3PY8A 1RILA 1J53A 4CEBA 1ASVA 1DTQA 5KGXA 1JLCA 3HT3A 2R7YA 3QEPA 4CF2A 1BISA 4W5RA 3RMAA 3DMJA 1GOCA 3NH0A 3SV4A 4CF0A 3OS0A 3KLFA 3TARA 1ZBIA 1Z26A 4JRPA 1JXEA 2A1RA 1WAJA 4B8CA 1N5YA 4I2PA 3T1AA 4KRFA 2ATQA 4FK2A 2HHXA 1DTTA 4AH9A 1B9DA 4J2DA 5EU7A 1TK5A 1IO2A 4FK0A 4I7FA 1RT4A 5CYQA 2Z1GA 2XY7A 1LV5A 1KTQA 1VSHA 5D3GA 3PO5A 3LAKA 4IG3A 4KAZA 3V9ZA 2YNIA 3AVAA 1QSYA 2WONA 3I8DA 2YKNA 3CM6A 3RTVA 3V4IA 1JLQA 4FZXC 4OGCA 2OZMA 2BANA 4O55A 3QNNA 3V81A 3VQAA 4EP4A 4CK3A 4Z0UA 4UQGA 2X74A 1BCOA 2P1JA 3VQCA 3TWHA 4FLZA 4DTUA 3A2FA 1A5XA 2XY8A 1U49A 5HP1A 4CFAA 4CHZA 2Z1IA 3S9HA 4BWJA 4O0JA 3MEEA 1DLOA 2VG7A 3PV8A 4M3RA 4TSXA 1UA1A 1G15A 1SUQA 4CJTA 4ID5A 3CFPA 1U45A 1J5OA 2FBTA 1YT3A 3SQ2A 4RW7A 4J2BA 1ASUA 1GOAA 4M3YA 2HNDA 1VSMA 1EP4A 4CJFA 4DFPA 2HVIA 4Z4IA 3VQ6A 1WSEA 4KV8A 1TK8A 4CGGA 4F3OA 3V9XA 1HJRA 1RTJA 1UAXA 4Z4EA 3AO1A 1S9EA 5HRNA 1O1WA 1S1WA 1JL1A 3AA3A 4LSNA 4ZHRA 4NCGA 4Z4GA 3RRHA 1X9WA 4LD0A 1HNVA 1L3TA 2PYLA 3VQQA 4CJKA 1Y97A 3K2PA 4GMJB 1BL3A 4C8MA 4CGJA 3OS2A 2IS3A 4HHTA 2F8TA 2XRIA 2BE2A 4E0DA 2EX3A 4W5NA 2YHAA 1TKZA 3LZIA 2ITGA 1NK9A 1C6VA 3VQBA 3ZSZA 4FJ8A 3HO1A 3O3HA 4CIEA 1VSEA 3VQ7A 4DF8A 2X6NA 1NJYA 3DLGA 3C6UA 4DLEA 4BDYA 5J2MA 2Y1IA 3CFRA 4Y1CA 1JLGA 1FXXA 3NHGA 1U48A 4KI4A 1FK9A 4PUOA 1XWLA 3PUFA 3HVTA 1K6YA 2YNFA 4FVMA 4AILC 4M3UA 4B08A 1W9HA 1RDBA 2B4JA 3QESA 4MFBA 3AVMA 3OYJA 1KCFA 3VQ4A 3L2VA 2E6MA 1BHLA 4KPYA 1N6QA 2KFZA 4NYNA 5FROA 1YVUA 1NK6A 2O4IA 3LP3A 3U6FA 4BE0A 4ELTA 4PA1A 4LSLA 3LWLA 4IBNA 4OJRA 4GVMA 4H8KA 1I3AA 3OYMA 1LAVA 1CXQA 1IKYA 2XO7A 3OY9A 1HNIA 3HL8A 4DTJA 1RBTA 2JGUA 3MEGA 4CFCA 2O4GA 4DG1A 1S6PA 5HRPA 1BIZA 1BI4B 4CJ5A 3B6OA 3KK2A 3L8BA 3V6DA 1R0AA 3VQDA 4C8LA 1QSSA 3ZSRA 3QLHA 1Z25A 2I5JA 1RT5A 5HRRA 4CF1A 5J2PA 4BDPA 4DS5A 3LANA 3I0RA 4KHSA 2QXFA 1L3UA 4DF4A 2HNYA 3DM2A 1S1XA 3V1OA 4EZ9A 4CEQA 1RTHA 3AVKA 3LDSA 3QEVA 4M3XA 1VSLA 4M3ZA 4DFJA 1C0MA 3AVHA 5C25A 1IKVA 3QO9A 1T03A 1NK7A 4FLTA 2G8WA 1SL1A 1ZBFA 4H4MA 4N47A 3SPYA 3RMDA 2G8VA 2DFEA 1C1CA 4IFYA 1ZBHA 2W42A 2ZE2A 4DTPA 3VQPA 3T3FA 1NJZA 3AA4A 5I42A 3HK2A 3C94A 3IG1A 1IG9A 3RR8A 3TANA 1XI1A 1I39A 2DFHA 4W5TA 4CHYA 3MAQA 1IKXA 2VWJA 4FK4A 2HHWA 1L3SA 3BGRA 4CJWA 2KQ2A 1SL0A 1BI4A 3MECA 2DFFA 5HROA 2KFNA 3HP9A 4DTMA 4F4KA 4RG8A 2HMIA 3RMBA 1KSPA 1VK0A 1UA0A 4FZZA 1WSIA 1YTAA 1UOCA 3QIOA 3KJVA 3QETA 4RW8A 1NOYA 4FXDA 4CJEA 4HCCA 4B9NA 2PYJA 4RW9A 4E3SA 4CF9A 1L5UA 3AA5X 2KZZA 2OPRA 3ISNC 4B9LA 3VQ8A 1KRPA 3SJJA 3IRXA 4CEEA 1NK5A 2Y1JA 1SKSA 4M42A 5HLFA 2BGGA 2YV0X 4CIFA 3DI6A 3K5MA 1KVAA 4CHPA 3F73A 3LWMA 4JRQA 2X78A 1RBUA 3HJFA 3G10A 1S5JA 1C0UA 4C8OA 2EHGA 2A1SA 3ZSXA 3L2QA 3MXIA 1IH7A 3SUQA 3NH2A 3ZSWA 1JLEA 3UIQA 1TGOA 3SUPA 4N41A 2E4LA 2HNZA 3L3VA 1L3VA 4JLHA 1TKDA 5CYMA 4BE1A 4CE9A 3PX6A 4GW6A 2KW4A 3QIPA 4C8KA 4ELVA 1TKTA 2FC0A 3PO4A 4LY7A 2B6AA 3OYGA 4CJ3A 4FLWA 4E7KA 4QOZB 4FJ5A 4CCHA 4M3WA 5JS1A 4B9MA 1J9AA 3JYTA 3K5LA 4IKFA 2Q3SA 3HSTB 4DS4A 4FJ9A 1RCHA 2D0BA 2G8UA 2HHTA 4E7JA 3AVCA 3ZT1A 3OYLA 2D0CA 1RDAA 3TAGA 4H4OA 1NKEA 2G8HA 3QEWA 5FRNA 2E6LA 4CECA 4E7LA 1S6QA 1TVRA 1SKWA 3M8QA 1JLFA 2OPSA 3DLKA 1A5VA 2NUBA 2FBVA 1IKWA 3NF9A 1HYZA 1X9SA 1NOZA 3OYAA 2HHVA 4KFBA 2QKBA 3FFIA 3ALYA 3VQEA 3L3UA 3O4NA 3AVFA 1X9MA 4CHQA 4AHTA 2OYQA 4FYDA 3JSMA 3DLBA 1KLMA 4B9SA 3HVRA 4HVJA 3VQ5A 4CJQA 4DTOA 2DY4A 4KHYA 1TV6A 5KI6A 4DSLA 1CLQA 4MQ3A 4N5SA 3PX4A 1ZYQA 3S3NA 5E41A 1Q9YA 3F9KA 4CF8A 4Q5VA 3EY1A 3SI6A 5CY4A 1T7PA 2QKKA 3OYNA 3KK1A 1KVCA 4LH5A 5JS2A 1REVA 3D45A 3THVA 2HHUA 4OLBA 1BGXT 1RBSA 3TI0A 2YNHA 4CESA 3AVIA 3DRPA 2LSNA 3ZSYA 3CYMA 1WN7A 3CM5A 3VN5A 5HBMA 3OYCA 4CEOA 4CHOA 5KRSA 3EZ5A 3IAYA 4Y1DA 3G0ZA 3OYBA 4DTNA 4B9VA 3K5NA 1RTDA 3IS9A 3ASMA 3KKSA 1KFDA 4RW4A 4CFBA 3HPHA 4OPKA 1RT7A 1MU2A 4DFMA 1TAQA 1SL2A 4Z4CA 4KHQA 3DRSA 1U04A 4KTWA 1KVBA 3QERA 3TABA 1BQNA 4CGDA 5DK5A 3SQ1A 4FW1A 2GV9A 3AVBA 3QEXA 3V1QA 3ZSOA 2OPPA 3AA2A 1LWEA 3D0PA 2D0AA 4KB0A 3C95A 4EP5A 3LALA 4KHNA 3L2UA 2VG6A 3HPGA 3ZT4A 4IFVA 5I3UA 3SNNA 1HQEA 3OYHA 4BACA 1JLBA 2P5OA 4WE1A 5J1EA 3NE6A 1QSLA 4DSIA 1NKCA 4FJ7A 1HYSA 2WOMA 3DLRA 3L2WA 1B92A 2XHBA 4DU1A 2GUIA 5SWMA 3V9UA 4CJ4A 3I0SA 5J2QA 1ZBUA 3NH1A 5FRMA 2XY6A 4KREA 4B9UA 4PY5A 1LW2A 4CGIA 4E89A 3K57A 2KZMA 5J2NA 1LW0A 1WSHA 1RNHA 4FJNA 3ITHA 3DLHA 4B3OA 1EXQA 3K5OA 4OKJA 3LP2A 1BQMA 1RT3A 4PQUA 4KHWA 3AVGA 3AV9A 3C6TA 4FLVA 3HYFA 4O44A 3KK3A 1T8EA 3NDKA 1NKBA 2D5RA 3V9SA 1EX4A 4IDKA 3RR7A 3TR8A 4JS4A 3KLEA 3ZSVA 3DYAA 1TL3A 2IAJA 3SPZA 2IC3A 1ASWA 4W5OA 1Q8IA 2G8FA 2PY5A 2HHQA 1WLJA 3SUNA 4Z4FA 3VQ9A 1CZBA 2YHBA 3DLEA 4OGEA 1NK8A 4M3TA 2BDPA 2AJQA 4HUEA 4DSKA 4K8ZA 1RDCA 3LAMA 3NFAA 1NK4A 1TAUA 3LZJA 1QE1A 4BE2A 4CJLA 1CZ9A 3BDPA 2VG5A 4FM2A 4KTQA 3WNFA 4CJRA 2OZSA 4YNQA 4KHUA 1XC9A 1Q9XA 4W5QA 4E7HA 1ITGA 1QS4A 3KD1E 2RKIA 3SYZA 4CJVA 3O3GA 3ZCMA 4Q0BA 3E01A 1VSIA 4J2EA 4DMNA 1QQCA 4DSFA 1TK0A 4HTUA 4OKEA 3AO5A 1HPZA 3CFOA 4KI6A 2HB5A 3V1RA 1RT2A 2RF2A 4ID1A 1RTIA 3CG7A 2VWKA 4BDZA 1GOBA 4DQQA 2KTQA 4O4GA 1SV5A 1HQUA 1S1TA 1EKEA 1LAWA 4RW6A 3T19A 1C0TA 1C1BA 3LP0A 4QAGA 4CGHA 1RBVA 4JS5A 1RT6A 3OJUA 1D9DA 4HCBA 1FKOA 4ICLA 1WSGA 3SQ0A 3L2RA 2F8SA 5K14A 5KRTA 2YNGA 5CZ2A 3B6PA 3TAQA 4NYFA 1C1AA 1S9GA 3P1GA 3NGIA 3SV3A 1NJWA 4J2AA 4NCAA 4CEFA 4OKKA 1XHZA 4E7IA 4DU4A 3NF8A 3ZT3A 4O0IA 3HP6A 3P5JA 3QINA 3OYEA 2XY5A 2DTUA 2G8KA 4B9TA 1RT1A 3TAFA 3NAEA 4OLAA 3KKRA 3TAPA 2YKMA 3O3FA 3VA0A 2P51A 4FJLA 1CXUA 3OYIA 2F96A 2IGIA 5T7BA 3HXMA 4DTRA 4DSEA 2RN2A 4KO0A 3NGYA 3WNGA 4FJHA 1RDDA 2HVHA 4PWDA 3KTQA 3SCXA 4Z4HA 1SKRA 2G8IA 4FJXA 1LWFA 2GBZA 4OVLA 4FLXA 1ZBLA 3LPTA 3MEDA 3DOLA 4DU3A 4XIUA 1T05A 3NF7A 3OYKA 4DQSA 5CZ1A 2IOCA 3AO4A 1VRTA 3ZSQA 3AVNA 4R5PA 3NCIA 4CK1A 3KLHA 3NBPA 3M8RA 1D9FA 4ELUA 4DFKA 4C8NA 3OVNA 4FJIA 1YTUA 3AVLA 3RWUA 1JL2A 1FKPA 4CFDA 3OYDA 3V9WA 4FZYA 2IDOA 4CEZA 3CQ8A 3WNHA 2FBXA 3ZT0A 4FM1A 3KD5E 1J54A 1EETA 1WAFA 4YFUA 1WNSA 3SQ4A 1RBRA 4CJPA 4BWMA 4DWIA 1S1UA 4CHNA 4CJUA 3AO3A 1WSFA 1VSDA 4HUFA 3DRRA 3NGZA 5C42A 3VA3A 4CGFA 4F2RA 4DQPA 4FW2A 2JLEA 4L8RB 4E19A 4M41A 3K59A 4CERA 3S3OA 3S3MA 1NJXA 1KFSA 3M8SA 4FJMA 3DOKA 4DLGA 4ZTFA 1D8YA 2QK9A 3P83D 1BIUA 4F2SA 2OPQA 2Z1HA 3SZ2A 4M45A 4N76A 3ZT2A 4CEAA 4DTXA 3AO2A 4FJJA 3TAEA 3RRGA 1VSKA 3NF6A 4AHVA 5KTQA 4HUGA 4K8XA 4DQIA 4DQRA 1XHXA 4OPJA 1HMVA 5SZTA 1HRHA 3KIOA 3SUOA 1F21A 4B8AB 5DMRA 3RMCA 4IG0A 4FJKA 2RPIA 2PZSA 4F8RA 3KLIA 4CEDA 1A5WA 1TL1A 3PX0A 4I9LA 2B5JA 2ZQBA 1TKXA 1HYVA 3QNOA 4F3TA 4ZTJA 1BCMA 1NK0A 3TAMA 2HW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULD A;  4FLY A;  3M8P A;  4I9Q A;  1QTM A;  1JXB A;  1UWB A;  4I2Q A;  1W0H A;  3U3Y A;  2OA8 A;  5HRS A;  1QHT A;  3HM9 A;  3HPO A;  5C24 A;  4FJG A;  1JKH A;  4NCB A;  1JLA A;  2FBY A;  4CJS A;  4CK2 A;  4G1Q A;  4KTZ A;  4DTS A;  3AVJ A;  2P5G A;  4EZ6 A;  1WSJ A;  4FM0 A;  2ETJ A;  3LPU A;  3K58 A;  3EYZ A;  4QCL A;  1U47 A;  1LWC A;  4KKO A;  1VSF A;  1VRU A;  2Z1J A;  4FLU A;  4KB1 A;  4FCY A;  4LH4 A;  4AHR A;  4O5B A;  3OYF A;  3MXJ A;  1U4B A;  4E1N A;  4DSJ A;  1X1P A;  5KGW A;  1D5A A;  3LP1 A;  3H08 A;  5FDL A;  3OJS A;  3QEI A;  3MXM A;  4CIG A;  4E1M A;  1KLN A;  3O4Q A;  3WNE A;  1S1V A;  3KLG A;  2ZD1 A;  3OS1 A;  4AHC A;  2X6S A;  1B9F A;  3U3G A;  1VSJ A;  4AHS A;  4AHU A;  4N56 A;  2HHS A;  3PY8 A;  1RIL A;  1J53 A;  4CEB A;  1ASV A;  1DTQ A;  5KGX A;  1JLC A;  3HT3 A;  2R7Y A;  3QEP A;  4CF2 A;  1BIS A;  4W5R A;  3RMA A;  3DMJ A;  1GOC A;  3NH0 A;  3SV4 A;  4CF0 A;  3OS0 A;  3KLF A;  3TAR A;  1ZBI A;  1Z26 A;  4JRP A;  1JXE A;  2A1R A;  1WAJ A;  4B8C A;  1N5Y A;  4I2P A;  3T1A A;  4KRF A;  2ATQ A;  4FK2 A;  2HHX A;  1DTT A;  4AH9 A;  1B9D A;  4J2D A;  5EU7 A;  1TK5 A;  1IO2 A;  4FK0 A;  4I7F A;  1RT4 A;  5CYQ A;  2Z1G A;  2XY7 A;  1LV5 A;  1KTQ A;  1VSH A;  5D3G A;  3PO5 A;  3LAK A;  4IG3 A;  4KAZ A;  3V9Z A;  2YNI A;  3AVA A;  1QSY A;  2WON A;  3I8D A;  2YKN A;  3CM6 A;  3RTV A;  3V4I A;  1JLQ A;  4FZX C;  4OGC A;  2OZM A;  2BAN A;  4O55 A;  3QNN A;  3V81 A;  3VQA A;  4EP4 A;  4CK3 A;  4Z0U A;  4UQG A;  2X74 A;  1BCO A;  2P1J A;  3VQC A;  3TWH A;  4FLZ A;  4DTU A;  3A2F A;  1A5X A;  2XY8 A;  1U49 A;  5HP1 A;  4CFA A;  4CHZ A;  2Z1I A;  3S9H A;  4BWJ A;  4O0J A;  3MEE A;  1DLO A;  2VG7 A;  3PV8 A;  4M3R A;  4TSX A;  1UA1 A;  1G15 A;  1SUQ A;  4CJT A;  4ID5 A;  3CFP A;  1U45 A;  1J5O A;  2FBT A;  1YT3 A;  3SQ2 A;  4RW7 A;  4J2B A;  1ASU A;  1GOA A;  4M3Y A;  2HND A;  1VSM A;  1EP4 A;  4CJF A;  4DFP A;  2HVI A;  4Z4I A;  3VQ6 A;  1WSE A;  4KV8 A;  1TK8 A;  4CGG A;  4F3O A;  3V9X A;  1HJR A;  1RTJ A;  1UAX A;  4Z4E A;  3AO1 A;  1S9E A;  5HRN A;  1O1W A;  1S1W A;  1JL1 A;  3AA3 A;  4LSN A;  4ZHR A;  4NCG A;  4Z4G A;  3RRH A;  1X9W A;  4LD0 A;  1HNV A;  1L3T A;  2PYL A;  3VQQ A;  4CJK A;  1Y97 A;  3K2P A;  4GMJ B;  1BL3 A;  4C8M A;  4CGJ A;  3OS2 A;  2IS3 A;  4HHT A;  2F8T A;  2XRI A;  2BE2 A;  4E0D A;  2EX3 A;  4W5N A;  2YHA A;  1TKZ A;  3LZI A;  2ITG A;  1NK9 A;  1C6V A;  3VQB A;  3ZSZ A;  4FJ8 A;  3HO1 A;  3O3H A;  4CIE A;  1VSE A;  3VQ7 A;  4DF8 A;  2X6N A;  1NJY A;  3DLG A;  3C6U A;  4DLE A;  4BDY A;  5J2M A;  2Y1I A;  3CFR A;  4Y1C A;  1JLG A;  1FXX A;  3NHG A;  1U48 A;  4KI4 A;  1FK9 A;  4PUO A;  1XWL A;  3PUF A;  3HVT A;  1K6Y A;  2YNF A;  4FVM A;  4AIL C;  4M3U A;  4B08 A;  1W9H A;  1RDB A;  2B4J A;  3QES A;  4MFB A;  3AVM A;  3OYJ A;  1KCF A;  3VQ4 A;  3L2V A;  2E6M A;  1BHL A;  4KPY A;  1N6Q A;  2KFZ A;  4NYN A;  5FRO A;  1YVU A;  1NK6 A;  2O4I A;  3LP3 A;  3U6F A;  4BE0 A;  4ELT A;  4PA1 A;  4LSL A;  3LWL A;  4IBN A;  4OJR A;  4GVM A;  4H8K A;  1I3A A;  3OYM A;  1LAV A;  1CXQ A;  1IKY A;  2XO7 A;  3OY9 A;  1HNI A;  3HL8 A;  4DTJ A;  1RBT A;  2JGU A;  3MEG A;  4CFC A;  2O4G A;  4DG1 A;  1S6P A;  5HRP A;  1BIZ A;  1BI4 B;  4CJ5 A;  3B6O A;  3KK2 A;  3L8B A;  3V6D A;  1R0A A;  3VQD A;  4C8L A;  1QSS A;  3ZSR A;  3QLH A;  1Z25 A;  2I5J A;  1RT5 A;  5HRR A;  4CF1 A;  5J2P A;  4BDP A;  4DS5 A;  3LAN A;  3I0R A;  4KHS A;  2QXF A;  1L3U A;  4DF4 A;  2HNY A;  3DM2 A;  1S1X A;  3V1O A;  4EZ9 A;  4CEQ A;  1RTH A;  3AVK A;  3LDS A;  3QEV A;  4M3X A;  1VSL A;  4M3Z A;  4DFJ A;  1C0M A;  3AVH A;  5C25 A;  1IKV A;  3QO9 A;  1T03 A;  1NK7 A;  4FLT A;  2G8W A;  1SL1 A;  1ZBF A;  4H4M A;  4N47 A;  3SPY A;  3RMD A;  2G8V A;  2DFE A;  1C1C A;  4IFY A;  1ZBH A;  2W42 A;  2ZE2 A;  4DTP A;  3VQP A;  3T3F A;  1NJZ A;  3AA4 A;  5I42 A;  3HK2 A;  3C94 A;  3IG1 A;  1IG9 A;  3RR8 A;  3TAN A;  1XI1 A;  1I39 A;  2DFH A;  4W5T A;  4CHY A;  3MAQ A;  1IKX A;  2VWJ A;  4FK4 A;  2HHW A;  1L3S A;  3BGR A;  4CJW A;  2KQ2 A;  1SL0 A;  1BI4 A;  3MEC A;  2DFF A;  5HRO A;  2KFN A;  3HP9 A;  4DTM A;  4F4K A;  4RG8 A;  2HMI A;  3RMB A;  1KSP A;  1VK0 A;  1UA0 A;  4FZZ A;  1WSI A;  1YTA A;  1UOC A;  3QIO A;  3KJV A;  3QET A;  4RW8 A;  1NOY A;  4FXD A;  4CJE A;  4HCC A;  4B9N A;  2PYJ A;  4RW9 A;  4E3S A;  4CF9 A;  1L5U A;  3AA5 X;  2KZZ A;  2OPR A;  3ISN C;  4B9L A;  3VQ8 A;  1KRP A;  3SJJ A;  3IRX A;  4CEE A;  1NK5 A;  2Y1J A;  1SKS A;  4M42 A;  5HLF A;  2BGG A;  2YV0 X;  4CIF A;  3DI6 A;  3K5M A;  1KVA A;  4CHP A;  3F73 A;  3LWM A;  4JRQ A;  2X78 A;  1RBU A;  3HJF A;  3G10 A;  1S5J A;  1C0U A;  4C8O A;  2EHG A;  2A1S A;  3ZSX A;  3L2Q A;  3MXI A;  1IH7 A;  3SUQ A;  3NH2 A;  3ZSW A;  1JLE A;  3UIQ A;  1TGO A;  3SUP A;  4N41 A;  2E4L A;  2HNZ A;  3L3V A;  1L3V A;  4JLH A;  1TKD A;  5CYM A;  4BE1 A;  4CE9 A;  3PX6 A;  4GW6 A;  2KW4 A;  3QIP A;  4C8K A;  4ELV A;  1TKT A;  2FC0 A;  3PO4 A;  4LY7 A;  2B6A A;  3OYG A;  4CJ3 A;  4FLW A;  4E7K A;  4QOZ B;  4FJ5 A;  4CCH A;  4M3W A;  5JS1 A;  4B9M A;  1J9A A;  3JYT A;  3K5L A;  4IKF A;  2Q3S A;  3HST B;  4DS4 A;  4FJ9 A;  1RCH A;  2D0B A;  2G8U A;  2HHT A;  4E7J A;  3AVC A;  3ZT1 A;  3OYL A;  2D0C A;  1RDA A;  3TAG A;  4H4O A;  1NKE A;  2G8H A;  3QEW A;  5FRN A;  2E6L A;  4CEC A;  4E7L A;  1S6Q A;  1TVR A;  1SKW A;  3M8Q A;  1JLF A;  2OPS A;  3DLK A;  1A5V A;  2NUB A;  2FBV A;  1IKW A;  3NF9 A;  1HYZ A;  1X9S A;  1NOZ A;  3OYA A;  2HHV A;  4KFB A;  2QKB A;  3FFI A;  3ALY A;  3VQE A;  3L3U A;  3O4N A;  3AVF A;  1X9M A;  4CHQ A;  4AHT A;  2OYQ A;  4FYD A;  3JSM A;  3DLB A;  1KLM A;  4B9S A;  3HVR A;  4HVJ A;  3VQ5 A;  4CJQ A;  4DTO A;  2DY4 A;  4KHY A;  1TV6 A;  5KI6 A;  4DSL A;  1CLQ A;  4MQ3 A;  4N5S A;  3PX4 A;  1ZYQ A;  3S3N A;  5E41 A;  1Q9Y A;  3F9K A;  4CF8 A;  4Q5V A;  3EY1 A;  3SI6 A;  5CY4 A;  1T7P A;  2QKK A;  3OYN A;  3KK1 A;  1KVC A;  4LH5 A;  5JS2 A;  1REV A;  3D45 A;  3THV A;  2HHU A;  4OLB A;  1BGX T;  1RBS A;  3TI0 A;  2YNH A;  4CES A;  3AVI A;  3DRP A;  2LSN A;  3ZSY A;  3CYM A;  1WN7 A;  3CM5 A;  3VN5 A;  5HBM A;  3OYC A;  4CEO A;  4CHO A;  5KRS A;  3EZ5 A;  3IAY A;  4Y1D A;  3G0Z A;  3OYB A;  4DTN A;  4B9V A;  3K5N A;  1RTD A;  3IS9 A;  3ASM A;  3KKS A;  1KFD A;  4RW4 A;  4CFB A;  3HPH A;  4OPK A;  1RT7 A;  1MU2 A;  4DFM A;  1TAQ A;  1SL2 A;  4Z4C A;  4KHQ A;  3DRS A;  1U04 A;  4KTW A;  1KVB A;  3QER A;  3TAB A;  1BQN A;  4CGD A;  5DK5 A;  3SQ1 A;  4FW1 A;  2GV9 A;  3AVB A;  3QEX A;  3V1Q A;  3ZSO A;  2OPP A;  3AA2 A;  1LWE A;  3D0P A;  2D0A A;  4KB0 A;  3C95 A;  4EP5 A;  3LAL A;  4KHN A;  3L2U A;  2VG6 A;  3HPG A;  3ZT4 A;  4IFV A;  5I3U A;  3SNN A;  1HQE A;  3OYH A;  4BAC A;  1JLB A;  2P5O A;  4WE1 A;  5J1E A;  3NE6 A;  1QSL A;  4DSI A;  1NKC A;  4FJ7 A;  1HYS A;  2WOM A;  3DLR A;  3L2W A;  1B92 A;  2XHB A;  4DU1 A;  2GUI A;  5SWM A;  3V9U A;  4CJ4 A;  3I0S A;  5J2Q A;  1ZBU A;  3NH1 A;  5FRM A;  2XY6 A;  4KRE A;  4B9U A;  4PY5 A;  1LW2 A;  4CGI A;  4E89 A;  3K57 A;  2KZM A;  5J2N A;  1LW0 A;  1WSH A;  1RNH A;  4FJN A;  3ITH A;  3DLH A;  4B3O A;  1EXQ A;  3K5O A;  4OKJ A;  3LP2 A;  1BQM A;  1RT3 A;  4PQU A;  4KHW A;  3AVG A;  3AV9 A;  3C6T A;  4FLV A;  3HYF A;  4O44 A;  3KK3 A;  1T8E A;  3NDK A;  1NKB A;  2D5R A;  3V9S A;  1EX4 A;  4IDK A;  3RR7 A;  3TR8 A;  4JS4 A;  3KLE A;  3ZSV A;  3DYA A;  1TL3 A;  2IAJ A;  3SPZ A;  2IC3 A;  1ASW A;  4W5O A;  1Q8I A;  2G8F A;  2PY5 A;  2HHQ A;  1WLJ A;  3SUN A;  4Z4F A;  3VQ9 A;  1CZB A;  2YHB A;  3DLE A;  4OGE A;  1NK8 A;  4M3T A;  2BDP A;  2AJQ A;  4HUE A;  4DSK A;  4K8Z A;  1RDC A;  3LAM A;  3NFA A;  1NK4 A;  1TAU A;  3LZJ A;  1QE1 A;  4BE2 A;  4CJL A;  1CZ9 A;  3BDP A;  2VG5 A;  4FM2 A;  4KTQ A;  3WNF A;  4CJR A;  2OZS A;  4YNQ A;  4KHU A;  1XC9 A;  1Q9X A;  4W5Q A;  4E7H A;  1ITG A;  1QS4 A;  3KD1 E;  2RKI A;  3SYZ A;  4CJV A;  3O3G A;  3ZCM A;  4Q0B A;  3E01 A;  1VSI A;  4J2E A;  4DMN A;  1QQC A;  4DSF A;  1TK0 A;  4HTU A;  4OKE A;  3AO5 A;  1HPZ A;  3CFO A;  4KI6 A;  2HB5 A;  3V1R A;  1RT2 A;  2RF2 A;  4ID1 A;  1RTI A;  3CG7 A;  2VWK A;  4BDZ A;  1GOB A;  4DQQ A;  2KTQ A;  4O4G A;  1SV5 A;  1HQU A;  1S1T A;  1EKE A;  1LAW A;  4RW6 A;  3T19 A;  1C0T A;  1C1B A;  3LP0 A;  4QAG A;  4CGH A;  1RBV A;  4JS5 A;  1RT6 A;  3OJU A;  1D9D A;  4HCB A;  1FKO A;  4ICL A;  1WSG A;  3SQ0 A;  3L2R A;  2F8S A;  5K14 A;  5KRT A;  2YNG A;  5CZ2 A;  3B6P A;  3TAQ A;  4NYF A;  1C1A A;  1S9G A;  3P1G A;  3NGI A;  3SV3 A;  1NJW A;  4J2A A;  4NCA A;  4CEF A;  4OKK A;  1XHZ A;  4E7I A;  4DU4 A;  3NF8 A;  3ZT3 A;  4O0I A;  3HP6 A;  3P5J A;  3QIN A;  3OYE A;  2XY5 A;  2DTU A;  2G8K A;  4B9T A;  1RT1 A;  3TAF A;  3NAE A;  4OLA A;  3KKR A;  3TAP A;  2YKM A;  3O3F A;  3VA0 A;  2P51 A;  4FJL A;  1CXU A;  3OYI A;  2F96 A;  2IGI A;  5T7B A;  3HXM A;  4DTR A;  4DSE A;  2RN2 A;  4KO0 A;  3NGY A;  3WNG A;  4FJH A;  1RDD A;  2HVH A;  4PWD A;  3KTQ A;  3SCX A;  4Z4H A;  1SKR A;  2G8I A;  4FJX A;  1LWF A;  2GBZ A;  4OVL A;  4FLX A;  1ZBL A;  3LPT A;  3MED A;  3DOL A;  4DU3 A;  4XIU A;  1T05 A;  3NF7 A;  3OYK A;  4DQS A;  5CZ1 A;  2IOC A;  3AO4 A;  1VRT A;  3ZSQ A;  3AVN A;  4R5P A;  3NCI A;  4CK1 A;  3KLH A;  3NBP A;  3M8R A;  1D9F A;  4ELU A;  4DFK A;  4C8N A;  3OVN A;  4FJI A;  1YTU A;  3AVL A;  3RWU A;  1JL2 A;  1FKP A;  4CFD A;  3OYD A;  3V9W A;  4FZY A;  2IDO A;  4CEZ A;  3CQ8 A;  3WNH A;  2FBX A;  3ZT0 A;  4FM1 A;  3KD5 E;  1J54 A;  1EET A;  1WAF A;  4YFU A;  1WNS A;  3SQ4 A;  1RBR A;  4CJP A;  4BWM A;  4DWI A;  1S1U A;  4CHN A;  4CJU A;  3AO3 A;  1WSF A;  1VSD A;  4HUF A;  3DRR A;  3NGZ A;  5C42 A;  3VA3 A;  4CGF A;  4F2R A;  4DQP A;  4FW2 A;  2JLE A;  4L8R B;  4E19 A;  4M41 A;  3K59 A;  4CER A;  3S3O A;  3S3M A;  1NJX A;  1KFS A;  3M8S A;  4FJM A;  3DOK A;  4DLG A;  4ZTF A;  1D8Y A;  2QK9 A;  3P83 D;  1BIU A;  4F2S A;  2OPQ A;  2Z1H A;  3SZ2 A;  4M45 A;  4N76 A;  3ZT2 A;  4CEA A;  4DTX A;  3AO2 A;  4FJJ A;  3TAE A;  3RRG A;  1VSK A;  3NF6 A;  4AHV A;  5KTQ A;  4HUG A;  4K8X A;  4DQI A;  4DQR A;  1XHX A;  4OPJ A;  1HMV A;  5SZT A;  1HRH A;  3KIO A;  3SUO A;  1F21 A;  4B8A B;  5DMR A;  3RMC A;  4IG0 A;  4FJK A;  2RPI A;  2PZS A;  4F8R A;  3KLI A;  4CED A;  1A5W A;  1TL1 A;  3PX0 A;  4I9L A;  2B5J A;  2ZQB A;  1TKX A;  1HYV A;  3QNO A;  4F3T A;  4ZTJ A;  1BCM A;  1NK0 A;  3TAM A;  2HW3 A; 
#chains in the Genus database with same CATH topology
 4I9Q A;  3THY A;  3TSQ A;  1E3M A;  1UWB A;  1W0H A;  3D2E B;  5HRS A;  3VMF B;  1JKH A;  4NCB A;  2FBY A;  4CJS A;  4MO5 A;  2P5G A;  2P9I B;  3LM2 A;  4B3M K;  2GTD A;  2HOE A;  2H3G X;  1LWC A;  1VSF A;  2GEM A;  3MCP A;  4I6M B;  4WFN L;  1D5A A;  4NLC A;  3OJS A;  5FDL A;  3E1Y A;  3N4Q A;  3U8X A;  4CIG A;  2ZJP L;  3O5B A;  4BY9 C;  1JCF A;  4YOU A;  3OS1 A;  3ZX0 A;  4IZ9 A;  4AHS A;  2UXD K;  4BRG A;  4DR3 K;  1QZ6 A;  3QEP A;  4CF2 A;  1BIS A;  5GAG P;  3RMA A;  4CF0 A;  5JVH L;  3KLF A;  3TAR A;  4IJN A;  1Z26 A;  3ZET A;  3J81 O;  3T7Z A;  5KQD A;  4BQZ A;  4AH9 A;  2YI1 A;  3FZL A;  4I7F A;  1VSH A;  3LAK A;  4IG3 A;  3AVA A;  3I8D A;  1JLQ A;  4FZX C;  3HZ6 A;  3R6M A;  5EVZ A;  1VAZ A;  3UKU A;  3VQA A;  4EP4 A;  4CK3 A;  3CQY A;  4Z0U A;  4CJ7 A;  3TWH A;  4FLZ A;  2NRX A;  4H0O A;  2XY8 A;  1N32 K;  5HP1 A;  3MWP A;  2ZF5 O;  4CHZ A;  3S9H A;  1X3M A;  5BPL A;  3MEE A;  3O9Q A;  3CFP A;  1JCG A;  1U45 A;  1YT3 A;  4J2B A;  3AY9 A;  1MA9 B;  3CJB A;  4Z4I A;  4F3O A;  3V9X A;  5HRN A;  3AA3 A;  4X62 K;  2W41 A;  4JKC A;  1L3T A;  2PYL A;  3K2P A;  1HUX A;  1BL3 A;  4BRM A;  2F8T A;  4JKE A;  2XRI A;  2BE2 A;  4W5N A;  3DWL A;  2KLA A;  3VQB A;  4FJ8 A;  3HO1 A;  5AQF A;  3QBW A;  3H6E A;  4DF8 A;  3J7Z O;  3C6U A;  1KAX A;  3THW A;  1FXX A;  3NHG A;  2QEX N;  2P9S A;  1VQL N;  4LF5 K;  1HJO A;  4K43 A;  3NVM A;  2B4J A;  4MFB A;  1KCF A;  1BHL A;  4FWS A;  4NYN A;  4JI2 K;  1NK6 A;  2O4I A;  3GOI A;  2VYP A;  4ELT A;  4PA1 A;  4KH5 A;  2QW9 A;  4OJR A;  4H8K A;  2QWR A;  4EHT A;  3OYM A;  3GE1 A;  3OY9 A;  5EOY A;  2JGU A;  5HRP A;  1BIZ A;  1Q7Y O;  4DV4 K;  3I55 N;  3MN5 A;  3H46 O;  3ZSR A;  3OBW A;  1RT5 A;  3GDQ A;  5HRR A;  1ATS A;  4JKA A;  4EZ9 A;  1RTH A;  2NRZ A;  3QEV A;  3LDS A;  4M3Z A;  3LDQ A;  3QO9 A;  1DEJ A;  1SL1 A;  4N47 A;  2OTL N;  2G8V A;  1MDU B;  2DFE A;  1C1C A;  2W42 A;  2ZE2 A;  4DTP A;  1NJZ A;  1HNX K;  3C94 A;  3IG1 A;  1IG9 A;  1BOT O;  3TAN A;  1I39 A;  4YY3 K;  2CH5 A;  4K41 A;  2VWJ A;  2HHW A;  1SL0 A;  1BI4 A;  2P9K B;  4B1V A;  4K42 A;  4DTM A;  2UXC K;  4RG8 A;  1VQ8 N;  1KSP A;  4FZZ A;  3G6E N;  5AQO A;  4CZJ A;  3QIO A;  4YOR A;  3QET A;  4B9Q A;  4L3Q A;  4CJE A;  5AZJ B;  2ZGY A;  1S22 A;  1VHX A;  2PYJ A;  4RW9 A;  1ATN A;  4CF9 A;  2KZZ A;  3AA5 X;  4PKG A;  3CCR N;  4CIF A;  3K5M A;  3I33 A;  1KVA A;  4CHP A;  4JRQ A;  1RBU A;  1C0U A;  3D2F B;  5AQH A;  4C8O A;  2EHG A;  3L2Q A;  1K9M O;  1IH7 A;  3MN6 A;  3UIQ A;  3SUP A;  1QVG M;  5FPE A;  3O6W A;  4ISF A;  4BC3 A;  4C1N K;  3VTH A;  1KD1 O;  4C8K A;  2FC0 A;  3E9O A;  2B6A A;  1XC3 A;  1J9A A;  2OTJ N;  2Q3S A;  3HST B;  4DKW A;  4H4O A;  3QEW A;  2E6L A;  1A5V A;  2NUB A;  1D4X A;  1IKW A;  4CBW A;  4X64 K;  2QKB A;  3FFI A;  3ALY A;  3O4N A;  2O8B B;  4JKH A;  1YUW A;  3RVC A;  3AGK A;  3VQ5 A;  4GKK K;  2AA4 A;  4O8U A;  2CGJ A;  4A5A A;  5E41 A;  4BRQ A;  1WBD A;  2QKK A;  1CZA N;  4LH5 A;  5GIN A;  4M63 C;  1BA0 A;  4OLB A;  4Y0W A;  3AVI A;  5C15 A;  3IAY A;  5MLC Q;  4CEO A;  1JJ2 M;  5KPR A;  4DTN A;  1RTD A;  1MWK A;  4OPK A;  1MU2 A;  2P9U B;  4DFM A;  4Z4C A;  4KHQ A;  3DRS A;  4KTW A;  3RSE A;  1BQN A;  1VQ9 N;  3SQ1 A;  1RGI A;  2Q0R A;  4K25 A;  3DLL L;  3O1W A;  4GV6 A;  3C95 A;  4DV1 K;  2VG6 A;  3QML A;  5I3U A;  1GLA G;  5EY4 A;  4DSI A;  4FJ7 A;  1T6C A;  2XHB A;  3TTD A;  4JI1 K;  3L2W A;  4DU1 A;  2JWK A;  3MWT A;  4CJ4 A;  3I0S A;  3NH1 A;  3U4L A;  4PY5 A;  3CMA N;  2NRR A;  4E89 A;  5F2R A;  2KZM A;  5J2N A;  4CD1 A;  1LW0 A;  1RNH A;  3ITH A;  3DLH A;  1EXQ A;  4OKJ A;  1BQM A;  3ZX3 A;  3C6T A;  3AV9 A;  3SK3 A;  1T8E A;  3QB0 A;  3TU5 A;  4JS4 A;  3DYA A;  1RFQ A;  3CJ7 A;  5BR9 A;  1Q8I A;  4BQL A;  3VQ9 A;  1CZB A;  5C0Y A;  3FR0 A;  4H5R A;  4HUE A;  4K8Z A;  4BRF A;  1U6Z A;  4OPH A;  1YVN A;  4BVP A;  1CZ9 A;  3O8M A;  1XMO K;  4FM2 A;  2FLO A;  2A42 A;  3MCA B;  4AQY K;  4YHH K;  1XC9 A;  4W5Q A;  1QS4 A;  3KD1 E;  4CJV A;  3O9U A;  3UE5 A;  5AQP A;  2O8C B;  4BR9 A;  1TK0 A;  3AO5 A;  1NMD A;  3H1Q A;  3CG7 A;  4O4G A;  3EZW A;  1LAW A;  4RW6 A;  1BUP A;  3T19 A;  3LP0 A;  4DV2 K;  4QAG A;  3OTO K;  4F9O A;  4HCB A;  4ICL A;  2F8S A;  5K14 A;  2YNG A;  5CZ2 A;  3TAQ A;  1C1A A;  3SV3 A;  4FOE A;  4MO4 A;  4YOX A;  3NVK A;  3OW2 M;  4E7I A;  4DU4 A;  3OYE A;  2XY5 A;  2ASP A;  2E2N A;  2F9T A;  2FSK A;  4OLA A;  3VA0 A;  2P51 A;  4FJL A;  1CXU A;  2IGI A;  4QS9 A;  4DSE A;  3VET A;  2PBD A;  1LWF A;  2GBZ A;  3KK7 A;  5ADX H;  4OVL A;  2ZJQ L;  5M1P A;  3MED A;  3VPZ A;  4O8K A;  1E4F T;  3ZSQ A;  1WBB A;  3J7Y P;  1D9F A;  3NBP A;  4IO8 A;  4JN4 A;  3OVN A;  1Y64 A;  3EN9 A;  4BRH A;  1FKP A;  3CJ9 A;  3V9W A;  3WNH A;  4DV0 K;  4FWN A;  4FWQ A;  3I56 N;  3CCE N;  3KD5 E;  1WAF A;  1WNS A;  4JI5 K;  1RBR A;  3CJC A;  4CJU A;  3AO3 A;  4BRA A;  1VSD A;  1KAY A;  4CER A;  3S3O A;  3S3M A;  2ASM A;  1KFS A;  2QK9 A;  4LF8 K;  1BIU A;  3C0B A;  4H5V A;  1Q82 O;  4M45 A;  3ZT2 A;  1H1V A;  4CEA A;  3HOS A;  3L0Q A;  3TAE A;  1YF5 L;  5KTQ A;  2UU9 K;  4DQI A;  1XHX A;  2IVO A;  1HRH A;  4WQ4 C;  4B8A B;  3RMC A;  3BF3 A;  1HLU A;  4FJK A;  1A5W A;  1TL1 A;  3PX0 A;  4BRN A;  3C7N A;  1BCM A;  3TAM A;  2HW3 A;  3ULD A;  3J80 O;  1BA1 A;  1JXB A;  4BC2 A;  3U3Y A;  2OA8 A;  2E88 A;  5C24 A;  3ZEU A;  2O8F A;  4FO0 A;  4CK2 A;  4KTZ A;  4DTS A;  1LOT B;  4EZ6 A;  2EWS A;  4KKO A;  1VRU A;  2Z1J A;  4NO7 A;  3T1Y K;  4FLU A;  4KB1 A;  4FCY A;  4LH4 A;  4AHR A;  4O5B A;  1X1P A;  5KGW A;  1KLN A;  1NGD A;  3WNE A;  2KHO A;  3H3O B;  3LL3 A;  2ZD1 A;  4FL9 A;  1B9F A;  1VSJ A;  2CH6 A;  4GY2 B;  4AHU A;  4N56 A;  3PY8 A;  1RIL A;  5KGX A;  3DMJ A;  1GOC A;  1YIT N;  3D2E A;  4A2A A;  3CF5 L;  5BN8 A;  1N5Y A;  4I2P A;  2HHX A;  1HKB A;  1DGK N;  1DTT A;  1B9D A;  3AGR A;  4FK0 A;  5CYQ A;  1EO1 A;  4OO1 J;  1GLL O;  2XY7 A;  3O9T A;  4BRE A;  2E1Z A;  2Q97 A;  1WUA A;  2YNI A;  4I6M A;  3CC2 N;  3FZF A;  4OGC A;  4O55 A;  3QNN A;  3ATU A;  3SLC A;  3V81 A;  1QQN A;  3G25 A;  2X74 A;  1BCO A;  2P1J A;  1NGF A;  3VQC A;  4DTU A;  1U49 A;  4RTF D;  3W0L A;  5HOO A;  1VQK N;  4JI3 K;  1DLO A;  2QWN A;  3PV8 A;  4M3R A;  1G15 A;  4DUY K;  3H45 C;  3K0S A;  4RW7 A;  1ASU A;  1Q81 O;  4CJF A;  2HVI A;  3CQX A;  4CGG A;  1HJR A;  1UAX A;  3KVG A;  4ZHR A;  2FF3 B;  1VQ5 N;  1X9W A;  1HNV A;  3VQQ A;  3CIP A;  4CGJ A;  3OS2 A;  2IS3 A;  4E0D A;  1TKZ A;  2A3Z A;  3W3D A;  2OCE A;  1G99 A;  2X6N A;  5AQS A;  5LMU K;  2Y1I A;  4JYA K;  5J2M A;  3TTC A;  1U2V B;  5AQM A;  3M6G A;  3F9M A;  3HVT A;  1NGG A;  1ESV A;  2NRV A;  2YNF A;  4QS8 A;  1RDB A;  3O80 A;  4KPY A;  1N6Q A;  2ZGZ A;  3U6F A;  2UUB K;  4PHT X;  3LM9 A;  1I3A A;  1LAV A;  5BPM A;  1HNI A;  3HL8 A;  4CFC A;  4DG1 A;  4DQ8 A;  1Q86 O;  4C8L A;  5AQL A;  3KK2 A;  3VQD A;  4ILH A;  3QLH A;  1Z25 A;  2I5J A;  4KHS A;  2HNY A;  5C12 A;  4CBX A;  1S1X A;  3V1O A;  4DR5 K;  4CEQ A;  5E26 A;  3UKR B;  4JKF A;  5C25 A;  1NK7 A;  3TSU A;  3AAR A;  4IFE A;  5I42 A;  1S72 N;  5TKW A;  4A2B A;  4B3R K;  4A57 A;  3E66 A;  3OA9 A;  4FPA A;  5AQX A;  3MAQ A;  1ZXO A;  4BRC A;  3L4Q A;  3MEC A;  3D6R A;  3CJ1 A;  3ATV A;  4O5F A;  5F0X A;  2HMI A;  3SMS A;  1UA0 A;  1WSI A;  4OX9 K;  1YTA A;  4FXD A;  2Q2R A;  2OPR A;  3QBX A;  4CZL A;  3BZK A;  1NK5 A;  3CCU N;  4BE0 A;  3F73 A;  4UY8 O;  3G10 A;  5BRD A;  3Q7C A;  2GX9 A;  4JI6 K;  2A1S A;  3ZSX A;  4PKH A;  4DR1 K;  1KAZ A;  4N41 A;  1TGO A;  4A61 A;  4JLH A;  1TKD A;  5CYM A;  2P9K A;  4CE9 A;  3HSC A;  3PO4 A;  4QOZ B;  3OYG A;  4CJ3 A;  1EQY A;  4E7K A;  2QA4 N;  4B3T K;  3FZH A;  2W6L A;  4XH4 A;  5CHI A;  1HNZ K;  3DJC A;  4JI7 K;  4BRD A;  3K5L A;  1RCH A;  5AZJ A;  3AVC A;  3ZT1 A;  1YJ9 N;  1NKE A;  2G8H A;  4CEC A;  5BRH A;  4H0Y B;  2HMP A;  1JLF A;  3DLK A;  3DXM B;  2FBV A;  1XNQ K;  3NF9 A;  3ID6 A;  3MDQ A;  3OYA A;  2HHV A;  4LF4 K;  3L3U A;  4PL8 A;  1EWR A;  4AHT A;  3D2F A;  1KLM A;  4HVJ A;  1W97 L;  1VQO N;  3EE9 A;  5KPT A;  1TV6 A;  1CLQ A;  1HX1 A;  1BO5 O;  1XUP O;  3EY1 A;  1T7P A;  4B1U B;  4QS7 A;  3KK1 A;  4GVE A;  5JS2 A;  1REV A;  2HHU A;  1BGX T;  4CZM A;  2YNH A;  5AQU A;  4IOX A;  4EIA A;  2GWK A;  3ZSY A;  3VN5 A;  1WN7 A;  3EZ5 A;  5HBM A;  4CHO A;  4BGB A;  4Y1D A;  3BY5 A;  1QVF M;  4B9V A;  4RW4 A;  3ASM A;  3H3N O;  2V52 B;  4GNI A;  5AFU A;  1TAQ A;  3FZM A;  1VQN N;  1U04 A;  2O8B A;  5EX5 A;  4CGD A;  1GLC G;  3ZSO A;  4JHD A;  2D0A A;  4KB0 A;  3EKS A;  4BR4 A;  4EP5 A;  5IWA K;  3L2U A;  3HPG A;  1HR0 K;  1Z6R A;  3NE6 A;  4LF6 K;  1HYS A;  2WBN A;  4YDU C;  4H03 B;  5M1O A;  5H1S Q;  1ZBU A;  4JK7 A;  4KRE A;  1LW2 A;  4CGI A;  2QXL A;  1WSH A;  3PSI A;  3LP2 A;  3G4S N;  3AVG A;  1NJI O;  2P9U A;  4O44 A;  3NDK A;  3IKM A;  4WF9 L;  3SJH A;  1K8A O;  3ZSV A;  2VWB A;  1TL3 A;  3SPZ A;  3CC7 N;  3H1V X;  4M7Y A;  4W5O A;  3CCV N;  1OH7 A;  2HHQ A;  3CI5 A;  2V7Z A;  2AJQ A;  3LAM A;  1QE1 A;  4BE2 A;  5GAH P;  2WUS A;  3R3L A;  2OZS A;  2V51 B;  5AQZ A;  3MMV A;  1Q9X A;  1ITG A;  5C2D A;  2RKI A;  3O3G A;  3ULE B;  4J2E A;  1DT9 A;  4DMN A;  1QQC A;  5M1F A;  4HTU A;  3O9S A;  1HPZ A;  4KI6 A;  4PKI A;  4IEI A;  4CZH A;  2RF2 A;  2ZWH A;  4BDZ A;  1NGJ A;  5BRF A;  1HQU A;  4IJA A;  5KQ8 A;  1YJW N;  3SMP A;  1C0T A;  1RBV A;  3P38 A;  1RT6 A;  4JS5 A;  1D9D A;  4LF7 K;  5KRT A;  1HKG A;  3PIP L;  3P1G A;  2KKZ A;  1XHZ A;  2VGN A;  3ZT3 A;  1ATR A;  3HP6 A;  3CME N;  3NAE A;  4B3S K;  2YKM A;  3O3F A;  2O8C A;  5M1Q A;  4JHD B;  3HXM A;  4IDH A;  1RDD A;  4B1Y B;  1SQK A;  1J6Z A;  1SKR A;  4FJX A;  5KPZ A;  4FLX A;  4JNE A;  1T05 A;  3OYK A;  5CZ1 A;  2IOC A;  3AO4 A;  1VRT A;  3NCI A;  3AVN A;  4B1Z A;  4CK1 A;  1VQP N;  1N34 K;  4JD2 B;  4ELU A;  3WXK A;  2P9P B;  1FW6 A;  2QWO A;  3CCL N;  4DV7 K;  4MLE A;  2IDO A;  4B1X B;  4CEZ A;  4CI6 A;  5AJ3 K;  4CZE A;  3ZT0 A;  1EET A;  4CZI A;  2YX6 A;  4DWI A;  1WSF A;  3NGZ A;  3WQT A;  4FW2 A;  4L8R B;  4E19 A;  1P90 A;  3CCS N;  3M8S A;  3DOK A;  3WEE B;  1D8Y A;  2OPQ A;  2Z1H A;  3SZ2 A;  3AO2 A;  3NF6 A;  4ILJ A;  2UUA K;  3K9K A;  4OPJ A;  1F21 A;  2PZS A;  3KLI A;  2QWM A;  4I9L A;  2B5J A;  1TKX A;  1NK0 A;  4HCC A;  1YHQ N;  4NXN K;  2P9L A;  4FLY A;  3FGU A;  5AQW A;  2I7N A;  2IIR A;  1QHT A;  3HPO A;  4FJG A;  4DCH A;  1NMN A;  1GLE G;  1JLA A;  4OPA A;  1J5E K;  5DM7 L;  4EFH A;  3AVJ A;  2A5X A;  2ETJ A;  4QCL A;  3EYZ A;  3WXL A;  3VEW A;  4JEP A;  4BR0 A;  3ENB A;  3CD6 N;  3HBT A;  4JKB A;  4E1N A;  4DSJ A;  3QEI A;  3LP1 A;  4CW7 B;  3MXM A;  4A5B A;  4E1M A;  3THX B;  2BUP A;  1S1V A;  1ZC6 A;  1TUU A;  3GBT A;  2X6S A;  3E9P A;  3PIO L;  2F7T A;  4CEB A;  3CET A;  4BR2 A;  3IFR A;  3TPQ A;  3WXJ A;  3NH0 A;  3EL2 A;  3M3Z A;  3VEY A;  1DKG D;  1NG9 A;  3VF4 A;  1ZBI A;  4JRP A;  4IOC L;  2A1R A;  3T1A A;  4KRF A;  2ATQ A;  4B1W B;  4J2D A;  1KXP A;  1TK5 A;  1IO2 A;  1RT4 A;  1LV5 A;  1T6D A;  4KAZ A;  2WON A;  1VQM N;  2YKN A;  3CM6 A;  3FE1 A;  5I9E B;  5AZI B;  2WTU A;  4BC4 A;  2Q1N A;  2V7Y A;  3WQU A;  3T69 A;  1A5X A;  4CFA A;  1RDU A;  3O4W A;  4KH6 A;  2VG7 A;  4O0J A;  5LL6 Z;  5AQK A;  2UYT A;  1UA1 A;  4CJT A;  1J5O A;  1X9J A;  3TTF A;  2FBT A;  5LJW A;  5AQY A;  1V4T A;  1VSM A;  1BWF O;  3LDN A;  3VQ6 A;  1WSE A;  4DV6 K;  1NGA A;  4E1J A;  1TK8 A;  4DV5 K;  5JLF A;  1S9E A;  1O1W A;  1S1W A;  1JL1 A;  2GWJ A;  1IBK K;  4Z4G A;  3RRH A;  1XMQ K;  2QWL A;  4V19 S;  1NU0 A;  1LCU A;  1Y97 A;  4GMJ B;  4C8M A;  3KHY A;  2P9L B;  3LZI A;  1C6V A;  4XH1 A;  3ZSZ A;  3O3H A;  1VSE A;  3KZB A;  3VQ7 A;  1N33 K;  4JI8 K;  3DLG A;  1M1K O;  4BDY A;  3CFR A;  4Y1C A;  1JLG A;  2NRW A;  3C65 A;  1U48 A;  4PUO A;  1MWM A;  1XWL A;  3PUF A;  1K6Y A;  3O9R A;  2Q36 A;  3JAM O;  3QES A;  3AVM A;  3VQ4 A;  3VER A;  3L2V A;  2E6M A;  5FRO A;  4XH5 A;  4IBN A;  4GVM A;  3LDP A;  4DV3 K;  1OKJ A;  1IBM K;  2IVP A;  3SBT A;  4DTJ A;  4FWM A;  3MEG A;  2Q31 A;  3V6D A;  1S6P A;  3VGK A;  3B6O A;  4A62 A;  2F9W A;  5J2P A;  3LAN A;  2QXF A;  1L3U A;  1NGC A;  1HPM A;  5C2F A;  1YXQ A;  5M1K A;  3AVK A;  4M3X A;  1U2V A;  2ZM6 K;  4WQ5 C;  4CZG A;  3AVH A;  4DFJ A;  2F4V K;  1T03 A;  4FLT A;  1ZBF A;  4H4M A;  4IFY A;  4YDU A;  3VQP A;  2P9N B;  2VQF K;  3MX2 A;  5B8H A;  3HRG A;  2DFH A;  4W5T A;  4CHY A;  1IKX A;  4FK4 A;  3M1F A;  1L3S A;  2KQ2 A;  3BEX A;  5HRO A;  3HP9 A;  4F4K A;  3BF1 A;  3DAW A;  1YJN N;  3RMB A;  1VK0 A;  4M7X A;  2UUC K;  1UOC A;  3KJV A;  4RW8 A;  1NOY A;  4B9N A;  3UKR A;  3CCQ N;  3EKU A;  4E3S A;  2E20 A;  2YHW A;  3ISN C;  3FZK A;  3SJJ A;  2Y1J A;  1SKS A;  4M42 A;  2BGG A;  3MN9 A;  2YV0 X;  3MX5 A;  3VEZ A;  1IJJ A;  4BRI A;  3LWM A;  3IMX A;  3HJF A;  3ZX2 A;  4DR4 K;  3SUQ A;  3ZSW A;  2E4L A;  2HNZ A;  3L3V A;  1L3V A;  1HNW K;  1NGB A;  3TSP A;  2HF4 A;  2HHH K;  3PX6 A;  3A5L C;  3HOT A;  3MK6 A;  4FLW A;  1XQS C;  2DPN A;  4CCH A;  4M3W A;  3VEV A;  1SAZ A;  3OBY A;  2O8E B;  3EO3 A;  4FJ9 A;  4ISG A;  2D0B A;  2G8U A;  4E7J A;  5FRN A;  3OYL A;  4E7L A;  1SKW A;  1S6Q A;  1TVR A;  2OPS A;  3VEX A;  3J7A P;  4GKJ K;  4C23 A;  4KFB A;  3VQE A;  4U67 L;  1X9M A;  3AVF A;  4CHQ A;  2OYQ A;  4FYD A;  5AQG A;  4B9S A;  3HVR A;  3ID8 A;  3EEQ A;  4DTO A;  3VF6 A;  5KI6 A;  4MQ3 A;  3VES A;  2OAN A;  4N5S A;  1ZYQ A;  4LFC K;  3S3N A;  1Q9Y A;  3F9K A;  3SI6 A;  1T44 A;  1KVC A;  3BP8 A;  4BR5 A;  1N36 K;  1RBS A;  3TI0 A;  4CES A;  3DRP A;  2FSJ A;  2LSN A;  4JKG B;  3CYM A;  3CM5 A;  3O08 A;  3IS9 A;  3KKS A;  5EXW A;  3DXM A;  4CFB A;  1RT7 A;  3ENH A;  1SL2 A;  3CC4 N;  1T3V A;  4KBO A;  2E2P A;  5DK5 A;  4FW1 A;  4H5N A;  4CZF A;  2GV9 A;  2OPP A;  3AA2 A;  4C1N I;  1LWE A;  2HBL A;  1TYQ A;  2A41 A;  4JKD A;  3OYH A;  5DM6 L;  2P5O A;  2YJF A;  5J1E A;  4Z94 A;  2WOM A;  1NBW A;  1B92 A;  3WXI A;  2GUI A;  3IUC A;  3V9U A;  1C0G A;  2FXU A;  4BRK A;  3FFK B;  2XY6 A;  1X3N A;  4B9U A;  1KC8 O;  4BC5 A;  3R8E A;  1OH8 A;  3K57 A;  4NXM K;  1OH5 A;  1K8K B;  3K5O A;  5AFU H;  2NLX A;  1RT3 A;  4PQU A;  1KQS M;  3KK3 A;  2YHX A;  3V9S A;  4HTL A;  2QTD A;  3KLE A;  2IAJ A;  1ASW A;  1SZ2 A;  1WLJ A;  3SUN A;  5HL7 L;  4Z4F A;  3DLE A;  4DR7 K;  3KWI A;  1YAG A;  4A59 A;  3F2K A;  4BG8 A;  3NFA A;  4CJL A;  3KWG A;  3WNF A;  4GV9 A;  4YNQ A;  4E7H A;  2D1K A;  2VGM A;  5GAE P;  1VQ7 N;  1WOQ A;  3ZCM A;  4Q0B A;  3E01 A;  5AQN A;  4DSF A;  3F5T A;  3CFO A;  2HB5 A;  1GLJ O;  3GL1 A;  5FPN A;  2VWK A;  1GOB A;  1SV5 A;  2HBK A;  2O8D B;  3S41 A;  5ELZ A;  4CGH A;  1FKO A;  3B6P A;  4FPB A;  4X66 K;  1S9G A;  2FSN A;  3NGI A;  1NJW A;  4RCH A;  4NCA A;  2YCH A;  1NNE A;  5BN9 A;  3NF8 A;  3P5J A;  3QIN A;  3I8B A;  2G8K A;  4B9T A;  1RT1 A;  3TAP A;  5IT9 O;  4BGA A;  3ULE A;  5LJV A;  1K73 O;  3OYI A;  2F96 A;  4DTR A;  2RN2 A;  4X65 K;  1TYQ B;  4CD3 A;  2HVH A;  4FSV A;  2RHK A;  3KTQ A;  1W7A A;  3DOL A;  3N4P A;  3R9P A;  4XIU A;  4NLB A;  1BG3 A;  4FVU A;  4DFK A;  1BDG A;  3WUH A;  2NNW A;  1YTU A;  3AVL A;  3RWU A;  1JL2 A;  4CFD A;  4FZY A;  4H0V B;  1J54 A;  3THY B;  3SQ4 A;  5AQR A;  4BWM A;  1S1U A;  4CHN A;  4F2R A;  3VA3 A;  5C42 A;  4DQP A;  1VQ4 N;  4LFB K;  3K59 A;  1NJX A;  4FJM A;  4ZTF A;  4F2S A;  4N76 A;  4DTX A;  4FJJ A;  3RRG A;  1P8Z A;  4JI4 K;  1VSK A;  1OVQ A;  4AHV A;  4HUG A;  4K8X A;  1C0F A;  3PSF A;  4DQR A;  3SUO A;  4JD2 A;  4KH4 A;  4F8R A;  3A8Y A;  5JLH A;  2P9P A;  3A0I X;  3VGM A;  4WQ4 A;  4WFB L;  3QNO A;  2D4W A;  4Z4E A;  3ZLJ A;  2HBJ A;  3M8P A;  1QTM A;  4I2Q A;  3CPE A;  1VQ6 N;  3HM9 A;  3A5O C;  1QHA A;  5JIC A;  3ZET B;  4G1Q A;  3BZC A;  3R1X A;  4LC9 B;  3WEE A;  3D7E O;  1WSJ A;  5AQV A;  4FM0 A;  3LPU A;  3K58 A;  1U47 A;  4EAH D;  3JS6 A;  4WQ5 A;  3OYF A;  4KHP K;  3MXJ A;  1U4B A;  3H08 A;  3O4Q A;  3UKU B;  3KLG A;  3JXU A;  4AHC A;  2HBM A;  3U3G A;  1NWK A;  3A5N C;  1WB9 A;  2HHS A;  1J53 A;  2NRT A;  1ASV A;  1DTQ A;  1JLC A;  3HT3 A;  2R7Y A;  2VQE K;  3SAH A;  4W5R A;  3SV4 A;  3OS0 A;  4GV3 A;  5FLX O;  3QFP A;  2A6A A;  3SBG A;  1JXE A;  1WAJ A;  4B8C A;  4MDB A;  5AR0 A;  4R79 A;  4FK2 A;  5EU7 A;  3C6A A;  5D3G A;  2Z1G A;  1KTQ A;  1QQM A;  5BR8 K;  3PO5 A;  2A40 A;  3BUZ B;  3V9Z A;  2RE2 A;  2BH1 A;  1QSY A;  3RTV A;  3V4I A;  1OH6 A;  5A2Q O;  1NLV A;  2GUP A;  2OZM A;  2BAN A;  3THX A;  2PAV A;  4AM7 A;  4UQG A;  2NZT A;  3A2F A;  3FLC O;  4EHU A;  5TKY A;  2Z1I A;  3THW B;  1HKC A;  4BWJ A;  1GLB G;  5FPD A;  1R59 O;  4TSX A;  1SUQ A;  2P9S B;  4ID5 A;  3CHW A;  3SQ2 A;  1NGE A;  2E1Y A;  4FOI A;  4AM6 A;  1GOA A;  4M3Y A;  2HND A;  4DFP A;  1EP4 A;  3QDK A;  4KV8 A;  1RDW X;  1RTJ A;  3AO1 A;  4FWO A;  4LSN A;  3OHR A;  4NCG A;  4LD0 A;  4CJK A;  5AZI A;  3PLA A;  4HHT A;  1EWQ A;  1JCE A;  2EX3 A;  2YHA A;  2ITG A;  1NK9 A;  3SAG A;  4DUZ K;  1QZ5 A;  5GIO A;  4CIE A;  4ILG B;  2I7P A;  1NJY A;  4DLE A;  5JVG L;  2BTF A;  4KI4 A;  1FK9 A;  4M3U A;  4FVM A;  4AIL C;  4B08 A;  1W9H A;  2WC9 A;  1V4S A;  3OYJ A;  2KFZ A;  1YVU A;  3HI0 A;  3LP3 A;  4IEE A;  4BRP A;  4LSL A;  3LWL A;  3L4I A;  3VOV A;  1O13 A;  4FWK A;  1N8R O;  1ILY A;  1CXQ A;  1IKY A;  2XO7 A;  2E2O A;  4DHY A;  1RBT A;  2O4G A;  1BI4 B;  4CJ5 A;  3L8B A;  1W2B M;  1R0A A;  2J4R A;  1QSS A;  4JV5 K;  1QQO A;  1NGH A;  4FWL A;  4CF1 A;  4BDP A;  4XEI A;  5CR4 A;  3I0R A;  4DS5 A;  4DF4 A;  2ASO A;  3DM2 A;  3M5R A;  1VSL A;  1C0M A;  2Q0U A;  4J8F A;  1IKV A;  4BRO A;  2G8W A;  4YOV A;  3CCM N;  2WFB A;  3RMD A;  3SPY A;  2GEL A;  4K0K K;  5GAD P;  1ZBH A;  3VEN A;  3T3F A;  3AA4 A;  3HK2 A;  3RR8 A;  1XI1 A;  3VF2 A;  4YOY A;  3LDO A;  4WCE L;  3BGR A;  4CJW A;  1M90 O;  3WXM B;  2DFF A;  1I94 K;  4CVN E;  2KFN A;  4H5T A;  1NGI A;  3C6H A;  2HST A;  3EE8 A;  1L5U A;  3E9L A;  4B9L A;  3VQ8 A;  2UXB K;  4BRL A;  1KRP A;  3IRX A;  4CEE A;  3Q7B A;  5HLF A;  2W40 A;  5GIP A;  3DI6 A;  2P9N A;  2X78 A;  5F1X A;  1S5J A;  3MXI A;  4FWP A;  3NH2 A;  2ITM A;  1JLE A;  4IOA L;  4BE1 A;  3AAQ A;  4GW6 A;  2KW4 A;  3QIP A;  4ELV A;  1TKT A;  4LY7 A;  3ENO A;  3GG4 A;  4FJ5 A;  3L6Q A;  5JS1 A;  4B9M A;  3CER A;  4JK9 A;  3JYT A;  4IKF A;  4DS4 A;  4DR6 K;  2HHT A;  3QFU A;  1YI2 N;  2D0C A;  1RDA A;  3TAG A;  3ZYY X;  3M8Q A;  3VEO A;  1HYZ A;  1X9S A;  1NOZ A;  5JMV A;  3RSE B;  2E2Q A;  3JSM A;  3DLB A;  5AQI A;  2IVN A;  4CJQ A;  2DY4 A;  4YOT A;  3P39 A;  4KHY A;  4DSL A;  3PX4 A;  1IG8 A;  2E5L K;  1IV0 A;  3CPW M;  4CF8 A;  2PFU A;  4Q5V A;  1FJG K;  5CY4 A;  1Q18 A;  5BRE A;  4PL7 A;  3OYN A;  3D45 A;  3THV A;  3T1H K;  2O8E A;  4AF1 A;  3CXC M;  3OYC A;  3CCJ N;  5KRS A;  4LFA K;  2FF6 A;  1XNR K;  3G0Z A;  4H0T B;  4JK8 A;  3OYB A;  3K5N A;  1KFD A;  2QI2 A;  3HPH A;  4BVO A;  5M1N A;  3IDH A;  3QER A;  1KVB A;  3TAB A;  3AVB A;  3QEX A;  2YHY A;  3V1Q A;  4WYB A;  4IWV A;  2D0O A;  3D0P A;  3VGL A;  2NRH A;  3LAL A;  4KHN A;  3ZT4 A;  4IFV A;  3SNN A;  1HQE A;  2QWP A;  4BAC A;  5CE3 A;  1JLB A;  2AP1 A;  4WE1 A;  1QSL A;  4H5W A;  1NKC A;  3DLR A;  2ZJR L;  2YJE A;  5SWM A;  5J2Q A;  4HWI A;  5FRM A;  1S3X A;  4JKG A;  4FJN A;  4B3O A;  5C10 A;  4H0P A;  1GLD G;  1GLF O;  4KHW A;  4FLV A;  3HYF A;  1NKB A;  2D5R A;  1EX4 A;  4IDK A;  3RR7 A;  3TR8 A;  2IC3 A;  4FWR A;  2PY5 A;  2G8F A;  1OVY A;  2YHB A;  4JAX A;  4OGE A;  3QIC A;  5LY3 A;  1NK8 A;  4M3T A;  2BDP A;  4DSK A;  1RDC A;  1NK4 A;  2VCP A;  1TAU A;  4BG9 A;  3LZJ A;  3BDP A;  2VG5 A;  2W6K A;  4KTQ A;  4CJR A;  1E4G T;  1BU6 O;  4KHU A;  2CGL A;  2JWL A;  4IXC A;  3DXK A;  3SYZ A;  3K9J A;  1K8K A;  3HTV A;  2D0P A;  3P31 A;  1VSI A;  4DR2 K;  4OKE A;  3P4I A;  3V1R A;  1RT2 A;  4ID1 A;  1RTI A;  3SAF A;  5LMN K;  2KTQ A;  4DQQ A;  1S1T A;  1EKE A;  2P9I A;  3LDL A;  3B8A X;  3VTI A;  5ADX A;  2QWQ A;  3HM8 A;  1ZBS A;  1C1B A;  4RWT A;  3OJU A;  5AQQ A;  1WSG A;  3SQ0 A;  3L2R A;  4NYF A;  4J2A A;  1NM1 A;  4CEF A;  3NMU A;  4OKK A;  4IO9 L;  4O0I A;  1IBL K;  2DTU A;  1SS6 A;  4LF9 K;  3TAF A;  3KKR A;  4CZK A;  2QM1 A;  3J8A A;  3U9D A;  3WT0 A;  5T7B A;  4H0X B;  4FJH A;  4KO0 A;  3NGY A;  3WNG A;  1YIJ N;  4PWD A;  4G9Z A;  3SCX A;  4Z4H A;  4MDA A;  2G8I A;  5FPM A;  1TUY A;  1ZBL A;  3LPT A;  4DU3 A;  3A5M C;  3NF7 A;  4DQS A;  2O8D A;  4R5P A;  3KLH A;  3M8R A;  2CGK A;  3O1B A;  4C8N A;  4FJI A;  2HF3 A;  2E8A A;  3OYD A;  4U7B A;  3C7N B;  3CQ8 A;  2FBX A;  3MN7 A;  4FM1 A;  4YFU A;  4CJP A;  4MLH A;  3CJA A;  3ZEU B;  4HUF A;  3DRR A;  2O8F B;  4CGF A;  2JLE A;  4NB4 A;  4M41 A;  3UB5 A;  5BPN A;  3U9Z A;  4CBU A;  4DLG A;  3P83 D;  4JI0 K;  4YOW A;  4ISE A;  3AAP A;  5AQJ A;  1Z05 A;  1HMV A;  5SZT A;  3KIO A;  5DMR A;  4BR7 A;  5AQT A;  4IG0 A;  2RPI A;  4CED A;  4WFA L;  2ZQB A;  3G71 N;  1HYV A;  4F3T A;  3DXK B;  4ZTJ A;  5E84 A;  4DB3 A; 
#chains in the Genus database with same CATH homology
 3ULD A;  4FLY A;  3M8P A;  4I9Q A;  1QTM A;  1JXB A;  1UWB A;  4I2Q A;  1W0H A;  3U3Y A;  2OA8 A;  5HRS A;  1QHT A;  3HM9 A;  3HPO A;  5C24 A;  4FJG A;  1JKH A;  4NCB A;  1JLA A;  2FBY A;  4CJS A;  4CK2 A;  4G1Q A;  4KTZ A;  4DTS A;  3AVJ A;  2P5G A;  4EZ6 A;  1WSJ A;  4FM0 A;  2ETJ A;  3LPU A;  3K58 A;  3EYZ A;  4QCL A;  1U47 A;  1LWC A;  4KKO A;  1VSF A;  1VRU A;  2Z1J A;  4FLU A;  4KB1 A;  4FCY A;  4LH4 A;  4AHR A;  4O5B A;  3OYF A;  3MXJ A;  1U4B A;  4E1N A;  4DSJ A;  1X1P A;  5KGW A;  1D5A A;  3LP1 A;  3H08 A;  5FDL A;  3OJS A;  3QEI A;  3MXM A;  4CIG A;  4E1M A;  1KLN A;  3O4Q A;  3WNE A;  1S1V A;  3KLG A;  2ZD1 A;  3OS1 A;  4AHC A;  2X6S A;  1B9F A;  3U3G A;  1VSJ A;  4AHS A;  4AHU A;  4N56 A;  2HHS A;  3PY8 A;  1RIL A;  1J53 A;  4CEB A;  1ASV A;  1DTQ A;  5KGX A;  1JLC A;  3HT3 A;  2R7Y A;  3QEP A;  4CF2 A;  1BIS A;  4W5R A;  3RMA A;  3DMJ A;  1GOC A;  3NH0 A;  3SV4 A;  4CF0 A;  3OS0 A;  3KLF A;  3TAR A;  1ZBI A;  1Z26 A;  4JRP A;  1JXE A;  2A1R A;  1WAJ A;  4B8C A;  1N5Y A;  4I2P A;  3T1A A;  4KRF A;  2ATQ A;  4FK2 A;  2HHX A;  1DTT A;  4AH9 A;  1B9D A;  4J2D A;  5EU7 A;  1TK5 A;  1IO2 A;  4FK0 A;  4I7F A;  1RT4 A;  5CYQ A;  2Z1G A;  2XY7 A;  1LV5 A;  1KTQ A;  1VSH A;  5D3G A;  3PO5 A;  3LAK A;  4IG3 A;  4KAZ A;  3V9Z A;  2YNI A;  3AVA A;  1QSY A;  2WON A;  3I8D A;  2YKN A;  3CM6 A;  3RTV A;  3V4I A;  1JLQ A;  4FZX C;  4OGC A;  2OZM A;  2BAN A;  4O55 A;  3QNN A;  3V81 A;  3VQA A;  4EP4 A;  4CK3 A;  4Z0U A;  4UQG A;  2X74 A;  1BCO A;  2P1J A;  3VQC A;  3TWH A;  4FLZ A;  4DTU A;  3A2F A;  1A5X A;  2XY8 A;  1U49 A;  5HP1 A;  4CFA A;  4CHZ A;  2Z1I A;  3S9H A;  4BWJ A;  4O0J A;  3MEE A;  1DLO A;  2VG7 A;  3PV8 A;  4M3R A;  4TSX A;  1UA1 A;  1G15 A;  1SUQ A;  4CJT A;  4ID5 A;  3CFP A;  1U45 A;  1J5O A;  2FBT A;  1YT3 A;  3SQ2 A;  4RW7 A;  4J2B A;  1ASU A;  1GOA A;  4M3Y A;  2HND A;  1VSM A;  1EP4 A;  4CJF A;  4DFP A;  2HVI A;  4Z4I A;  3VQ6 A;  1WSE A;  4KV8 A;  1TK8 A;  4CGG A;  4F3O A;  3V9X A;  1HJR A;  1RTJ A;  1UAX A;  4Z4E A;  3AO1 A;  1S9E A;  5HRN A;  1O1W A;  1S1W A;  1JL1 A;  3AA3 A;  4LSN A;  4ZHR A;  4NCG A;  4Z4G A;  3RRH A;  1X9W A;  4LD0 A;  1HNV A;  1L3T A;  2PYL A;  3VQQ A;  4CJK A;  1Y97 A;  3K2P A;  4GMJ B;  1BL3 A;  4C8M A;  4CGJ A;  3OS2 A;  2IS3 A;  4HHT A;  2F8T A;  2XRI A;  2BE2 A;  4E0D A;  2EX3 A;  4W5N A;  2YHA A;  1TKZ A;  3LZI A;  2ITG A;  1NK9 A;  1C6V A;  3VQB A;  3ZSZ A;  4FJ8 A;  3HO1 A;  3O3H A;  4CIE A;  1VSE A;  3VQ7 A;  4DF8 A;  2X6N A;  1NJY A;  3DLG A;  3C6U A;  4DLE A;  4BDY A;  5J2M A;  2Y1I A;  3CFR A;  4Y1C A;  1JLG A;  1FXX A;  3NHG A;  1U48 A;  4KI4 A;  1FK9 A;  4PUO A;  1XWL A;  3PUF A;  3HVT A;  1K6Y A;  2YNF A;  4FVM A;  4AIL C;  4M3U A;  4B08 A;  1W9H A;  1RDB A;  2B4J A;  3QES A;  4MFB A;  3AVM A;  3OYJ A;  1KCF A;  3VQ4 A;  3L2V A;  2E6M A;  1BHL A;  4KPY A;  1N6Q A;  2KFZ A;  4NYN A;  5FRO A;  1YVU A;  1NK6 A;  2O4I A;  3LP3 A;  3U6F A;  4BE0 A;  4ELT A;  4PA1 A;  4LSL A;  3LWL A;  4IBN A;  4OJR A;  4GVM A;  4H8K A;  1I3A A;  3OYM A;  1LAV A;  1CXQ A;  1IKY A;  2XO7 A;  3OY9 A;  1HNI A;  3HL8 A;  4DTJ A;  1RBT A;  2JGU A;  3MEG A;  4CFC A;  2O4G A;  4DG1 A;  1S6P A;  5HRP A;  1BIZ A;  1BI4 B;  4CJ5 A;  3B6O A;  3KK2 A;  3L8B A;  3V6D A;  1R0A A;  3VQD A;  4C8L A;  1QSS A;  3ZSR A;  3QLH A;  1Z25 A;  2I5J A;  1RT5 A;  5HRR A;  4CF1 A;  5J2P A;  4BDP A;  4DS5 A;  3LAN A;  3I0R A;  4KHS A;  2QXF A;  1L3U A;  4DF4 A;  2HNY A;  3DM2 A;  1S1X A;  3V1O A;  4EZ9 A;  4CEQ A;  1RTH A;  3AVK A;  3LDS A;  3QEV A;  4M3X A;  1VSL A;  4M3Z A;  4DFJ A;  1C0M A;  3AVH A;  5C25 A;  1IKV A;  3QO9 A;  1T03 A;  1NK7 A;  4FLT A;  2G8W A;  1SL1 A;  1ZBF A;  4H4M A;  4N47 A;  3SPY A;  3RMD A;  2G8V A;  2DFE A;  1C1C A;  4IFY A;  1ZBH A;  2W42 A;  2ZE2 A;  4DTP A;  3VQP A;  3T3F A;  1NJZ A;  3AA4 A;  5I42 A;  3HK2 A;  3C94 A;  3IG1 A;  1IG9 A;  3RR8 A;  3TAN A;  1XI1 A;  1I39 A;  2DFH A;  4W5T A;  4CHY A;  3MAQ A;  1IKX A;  2VWJ A;  4FK4 A;  2HHW A;  1L3S A;  3BGR A;  4CJW A;  2KQ2 A;  1SL0 A;  1BI4 A;  3MEC A;  2DFF A;  5HRO A;  2KFN A;  3HP9 A;  4DTM A;  4F4K A;  4RG8 A;  2HMI A;  3RMB A;  1KSP A;  1VK0 A;  1UA0 A;  4FZZ A;  1WSI A;  1YTA A;  1UOC A;  3QIO A;  3KJV A;  3QET A;  4RW8 A;  1NOY A;  4FXD A;  4CJE A;  4HCC A;  4B9N A;  2PYJ A;  4RW9 A;  4E3S A;  4CF9 A;  1L5U A;  3AA5 X;  2KZZ A;  2OPR A;  3ISN C;  4B9L A;  3VQ8 A;  1KRP A;  3SJJ A;  3IRX A;  4CEE A;  1NK5 A;  2Y1J A;  1SKS A;  4M42 A;  5HLF A;  2BGG A;  2YV0 X;  4CIF A;  3DI6 A;  3K5M A;  1KVA A;  4CHP A;  3F73 A;  3LWM A;  4JRQ A;  2X78 A;  1RBU A;  3HJF A;  3G10 A;  1S5J A;  1C0U A;  4C8O A;  2EHG A;  2A1S A;  3ZSX A;  3L2Q A;  3MXI A;  1IH7 A;  3SUQ A;  3NH2 A;  3ZSW A;  1JLE A;  3UIQ A;  1TGO A;  3SUP A;  4N41 A;  2E4L A;  2HNZ A;  3L3V A;  1L3V A;  4JLH A;  1TKD A;  5CYM A;  4BE1 A;  4CE9 A;  3PX6 A;  4GW6 A;  2KW4 A;  3QIP A;  4C8K A;  4ELV A;  1TKT A;  2FC0 A;  3PO4 A;  4LY7 A;  2B6A A;  3OYG A;  4CJ3 A;  4FLW A;  4E7K A;  4QOZ B;  4FJ5 A;  4CCH A;  4M3W A;  5JS1 A;  4B9M A;  1J9A A;  3JYT A;  3K5L A;  4IKF A;  2Q3S A;  3HST B;  4DS4 A;  4FJ9 A;  1RCH A;  2D0B A;  2G8U A;  2HHT A;  4E7J A;  3AVC A;  3ZT1 A;  3OYL A;  2D0C A;  1RDA A;  3TAG A;  4H4O A;  1NKE A;  2G8H A;  3QEW A;  5FRN A;  2E6L A;  4CEC A;  4E7L A;  1S6Q A;  1TVR A;  1SKW A;  3M8Q A;  1JLF A;  2OPS A;  3DLK A;  1A5V A;  2NUB A;  2FBV A;  1IKW A;  3NF9 A;  1HYZ A;  1X9S A;  1NOZ A;  3OYA A;  2HHV A;  4KFB A;  2QKB A;  3FFI A;  3ALY A;  3VQE A;  3L3U A;  3O4N A;  3AVF A;  1X9M A;  4CHQ A;  4AHT A;  2OYQ A;  4FYD A;  3JSM A;  3DLB A;  1KLM A;  4B9S A;  3HVR A;  4HVJ A;  3VQ5 A;  4CJQ A;  4DTO A;  2DY4 A;  4KHY A;  1TV6 A;  5KI6 A;  4DSL A;  1CLQ A;  4MQ3 A;  4N5S A;  3PX4 A;  1ZYQ A;  3S3N A;  5E41 A;  1Q9Y A;  3F9K A;  4CF8 A;  4Q5V A;  3EY1 A;  3SI6 A;  5CY4 A;  1T7P A;  2QKK A;  3OYN A;  3KK1 A;  1KVC A;  4LH5 A;  5JS2 A;  1REV A;  3D45 A;  3THV A;  2HHU A;  4OLB A;  1BGX T;  1RBS A;  3TI0 A;  2YNH A;  4CES A;  3AVI A;  3DRP A;  2LSN A;  3ZSY A;  3CYM A;  1WN7 A;  3CM5 A;  3VN5 A;  5HBM A;  3OYC A;  4CEO A;  4CHO A;  5KRS A;  3EZ5 A;  3IAY A;  4Y1D A;  3G0Z A;  3OYB A;  4DTN A;  4B9V A;  3K5N A;  1RTD A;  3IS9 A;  3ASM A;  3KKS A;  1KFD A;  4RW4 A;  4CFB A;  3HPH A;  4OPK A;  1RT7 A;  1MU2 A;  4DFM A;  1TAQ A;  1SL2 A;  4Z4C A;  4KHQ A;  3DRS A;  1U04 A;  4KTW A;  1KVB A;  3QER A;  3TAB A;  1BQN A;  4CGD A;  5DK5 A;  3SQ1 A;  4FW1 A;  2GV9 A;  3AVB A;  3QEX A;  3V1Q A;  3ZSO A;  2OPP A;  3AA2 A;  1LWE A;  3D0P A;  2D0A A;  4KB0 A;  3C95 A;  4EP5 A;  3LAL A;  4KHN A;  3L2U A;  2VG6 A;  3HPG A;  3ZT4 A;  4IFV A;  5I3U A;  3SNN A;  1HQE A;  3OYH A;  4BAC A;  1JLB A;  2P5O A;  4WE1 A;  5J1E A;  3NE6 A;  1QSL A;  4DSI A;  1NKC A;  4FJ7 A;  1HYS A;  2WOM A;  3DLR A;  3L2W A;  1B92 A;  2XHB A;  4DU1 A;  2GUI A;  5SWM A;  3V9U A;  4CJ4 A;  3I0S A;  5J2Q A;  1ZBU A;  3NH1 A;  5FRM A;  2XY6 A;  4KRE A;  4B9U A;  4PY5 A;  1LW2 A;  4CGI A;  4E89 A;  3K57 A;  2KZM A;  5J2N A;  1LW0 A;  1WSH A;  1RNH A;  4FJN A;  3ITH A;  3DLH A;  4B3O A;  1EXQ A;  3K5O A;  4OKJ A;  3LP2 A;  1BQM A;  1RT3 A;  4PQU A;  4KHW A;  3AVG A;  3AV9 A;  3C6T A;  4FLV A;  3HYF A;  4O44 A;  3KK3 A;  1T8E A;  3NDK A;  1NKB A;  2D5R A;  3V9S A;  1EX4 A;  4IDK A;  3RR7 A;  3TR8 A;  4JS4 A;  3KLE A;  3ZSV A;  3DYA A;  1TL3 A;  2IAJ A;  3SPZ A;  2IC3 A;  1ASW A;  4W5O A;  1Q8I A;  2G8F A;  2PY5 A;  2HHQ A;  1WLJ A;  3SUN A;  4Z4F A;  3VQ9 A;  1CZB A;  2YHB A;  3DLE A;  4OGE A;  1NK8 A;  4M3T A;  2BDP A;  2AJQ A;  4HUE A;  4DSK A;  4K8Z A;  1RDC A;  3LAM A;  3NFA A;  1NK4 A;  1TAU A;  3LZJ A;  1QE1 A;  4BE2 A;  4CJL A;  1CZ9 A;  3BDP A;  2VG5 A;  4FM2 A;  4KTQ A;  3WNF A;  4CJR A;  2OZS A;  4YNQ A;  4KHU A;  1XC9 A;  1Q9X A;  4W5Q A;  4E7H A;  1ITG A;  1QS4 A;  3KD1 E;  2RKI A;  3SYZ A;  4CJV A;  3O3G A;  3ZCM A;  4Q0B A;  3E01 A;  1VSI A;  4J2E A;  4DMN A;  1QQC A;  4DSF A;  1TK0 A;  4HTU A;  4OKE A;  3AO5 A;  1HPZ A;  3CFO A;  4KI6 A;  2HB5 A;  3V1R A;  1RT2 A;  2RF2 A;  4ID1 A;  1RTI A;  3CG7 A;  2VWK A;  4BDZ A;  1GOB A;  4DQQ A;  2KTQ A;  4O4G A;  1SV5 A;  1HQU A;  1S1T A;  1EKE A;  1LAW A;  4RW6 A;  3T19 A;  1C0T A;  1C1B A;  3LP0 A;  4QAG A;  4CGH A;  1RBV A;  4JS5 A;  1RT6 A;  3OJU A;  1D9D A;  4HCB A;  1FKO A;  4ICL A;  1WSG A;  3SQ0 A;  3L2R A;  2F8S A;  5K14 A;  5KRT A;  2YNG A;  5CZ2 A;  3B6P A;  3TAQ A;  4NYF A;  1C1A A;  1S9G A;  3P1G A;  3NGI A;  3SV3 A;  1NJW A;  4J2A A;  4NCA A;  4CEF A;  4OKK A;  1XHZ A;  4E7I A;  4DU4 A;  3NF8 A;  3ZT3 A;  4O0I A;  3HP6 A;  3P5J A;  3QIN A;  3OYE A;  2XY5 A;  2DTU A;  2G8K A;  4B9T A;  1RT1 A;  3TAF A;  3NAE A;  4OLA A;  3KKR A;  3TAP A;  2YKM A;  3O3F A;  3VA0 A;  2P51 A;  4FJL A;  1CXU A;  3OYI A;  2F96 A;  2IGI A;  5T7B A;  3HXM A;  4DTR A;  4DSE A;  2RN2 A;  4KO0 A;  3NGY A;  3WNG A;  4FJH A;  1RDD A;  2HVH A;  4PWD A;  3KTQ A;  3SCX A;  4Z4H A;  1SKR A;  2G8I A;  4FJX A;  1LWF A;  2GBZ A;  4OVL A;  4FLX A;  1ZBL A;  3LPT A;  3MED A;  3DOL A;  4DU3 A;  4XIU A;  1T05 A;  3NF7 A;  3OYK A;  4DQS A;  5CZ1 A;  2IOC A;  3AO4 A;  1VRT A;  3ZSQ A;  3AVN A;  4R5P A;  3NCI A;  4CK1 A;  3KLH A;  3NBP A;  3M8R A;  1D9F A;  4ELU A;  4DFK A;  4C8N A;  3OVN A;  4FJI A;  1YTU A;  3AVL A;  3RWU A;  1JL2 A;  1FKP A;  4CFD A;  3OYD A;  3V9W A;  4FZY A;  2IDO A;  4CEZ A;  3CQ8 A;  3WNH A;  2FBX A;  3ZT0 A;  4FM1 A;  3KD5 E;  1J54 A;  1EET A;  1WAF A;  4YFU A;  1WNS A;  3SQ4 A;  1RBR A;  4CJP A;  4BWM A;  4DWI A;  1S1U A;  4CHN A;  4CJU A;  3AO3 A;  1WSF A;  1VSD A;  4HUF A;  3DRR A;  3NGZ A;  5C42 A;  3VA3 A;  4CGF A;  4F2R A;  4DQP A;  4FW2 A;  2JLE A;  4L8R B;  4E19 A;  4M41 A;  3K59 A;  4CER A;  3S3O A;  3S3M A;  1NJX A;  1KFS A;  3M8S A;  4FJM A;  3DOK A;  4DLG A;  4ZTF A;  1D8Y A;  2QK9 A;  3P83 D;  1BIU A;  4F2S A;  2OPQ A;  2Z1H A;  3SZ2 A;  4M45 A;  4N76 A;  3ZT2 A;  4CEA A;  4DTX A;  3AO2 A;  4FJJ A;  3TAE A;  3RRG A;  1VSK A;  3NF6 A;  4AHV A;  5KTQ A;  4HUG A;  4K8X A;  4DQI A;  4DQR A;  1XHX A;  4OPJ A;  1HMV A;  5SZT A;  1HRH A;  3KIO A;  3SUO A;  1F21 A;  4B8A B;  5DMR A;  3RMC A;  4IG0 A;  4FJK A;  2RPI A;  2PZS A;  4F8R A;  3KLI A;  4CED A;  1A5W A;  1TL1 A;  3PX0 A;  4I9L A;  2B5J A;  2ZQB A;  1TKX A;  1HYV A;  3QNO A;  4F3T A;  4ZTJ A;  1BCM A;  1NK0 A;  3TAM A;  2HW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...