1BL3A

Catalytic domain of hiv-1 integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
142
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Dna integration
source organism Human immunodeficiency virus 1
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
total genus 47
structure length 142
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bl3A00
3ZT0A 4NYNA 3HJFA 3F73A 3L2WA 1J5OA 2YKMA 1NK6A 4CJWA 4FK2A 1O1WA 3QEPA 3TAQA 5C24A 1RT3A 4KTWA 4OPJA 2A1SA 1VK0A 3LAKA 1SUQA 2HNZA 3WNGA 4FJ9A 3I0RA 3TI0A 4CE9A 3QINA 1RDBA 3H08A 3CFPA 1A5WA 1W0HA 4B08A 4KI6A 1D5AA 3QEXA 3HPHA 4O0JA 4OVLA 4DFJA 5J1EA 1I39A 1TKTA 2GBZA 5C42A 4CJSA 5EU7A 1JLEA 2IS3A 3G0ZA 3KLIA 1ASVA 2R7YA 4CIEA 4FM0A 1TGOA 3AVHA 4Q5VA 4CFBA 3V1QA 1UAXA 1QQCA 4FJNA 4FJ8A 3DI6A 1TV6A 4CEBA 4ID5A 1W9HA 4BE1A 1NKCA 2HVIA 2FBXA 2PY5A 3V9ZA 3TABA 3S9HA 1NJXA 4HCBA 4KHQA 1NK8A 3ASMA 1BHLA 3NF7A 4CHPA 1HNIA 5KRSA 4JRQA 4FM2A 3T1AA 4ID1A 2WOMA 4E7KA 4QOZB 1EETA 4CHZA 4RG8A 1LWEA 4W5QA 3NHGA 3MECA 1L5UA 3RMDA 1NK9A 3F9KA 3I8DA 3L2VA 3RWUA 3DMJA 4CJUA 3OS2A 2Y1IA 1ASWA 3KKRA 1D9FA 1CZBA 3V1RA 4B9LA 4CHOA 2B6AA 3SV4A 4I2QA 2QXFA 4FJHA 4LH4A 4CGIA 3M8PA 4Z4CA 3ULDA 3QEVA 4Z4FA 3OYLA 1RNHA 4CHYA 4M3UA 1LW0A 3NH1A 3P83D 4DTNA 4K8ZA 3P1GA 5DK5A 2HHUA 1QTMA 4M3RA 3K5MA 1J9AA 1DTTA 2YNGA 3SCXA 1C1BA 3MAQA 4AHRA 4FJIA 4DTUA 1C0TA 1NK5A 4KV8A 1KVAA 3SQ1A 1RT6A 1JLGA 1Y97A 4FK0A 1WSJA 1X1PA 3SQ4A 5HRPA 4E1MA 2KQ2A 4Z4HA 3NH2A 2Z1GA 1XHXA 1RBVA 4AHSA 1T05A 3V4IA 3ZT3A 4PY5A 3HSTB 1ASUA 1TAQA 3VQCA 4MQ3A 1JLFA 4C8KA 3D45A 1VRUA 2XY5A 2AJQA 4RW8A 1KVBA 4FJMA 4QCLA 3LP3A 4IG3A 1B92A 1S5JA 3O3GA 3AA4A 3VQBA 1U47A 3CYMA 5K14A 3MXIA 4E1NA 4CFAA 5J2NA 1RDAA 1C0UA 3K5OA 4FK4A 3ZSWA 5SWMA 1SV5A 1TKXA 3T19A 4W5OA 3M8RA 2XHBA 1ZBFA 2WONA 4O44A 1VSDA 4CF2A 1U49A 1X9MA 2G8FA 3DRRA 3KD5E 2O4GA 3U3YA 5CZ2A 1TVRA 2I5JA 4TSXA 3V81A 3TAEA 3UIQA 3V9XA 3SV3A 2YNHA 4M45A 4DF8A 1EP4A 4IFYA 3MEEA 5JS1A 3DRSA 3LAMA 1REVA 1VSKA 2D0CA 1RBRA 4M41A 4KKOA 3OYEA 3KTQA 3TAFA 1ZBLA 5FROA 1NK0A 4KB0A 4DFKA 2G8VA 3L2UA 5FRMA 2HVHA 4HCCA 1EKEA 4C8NA 4OKJA 4FLVA 2FBYA 1U48A 1RTJA 3L2RA 4B9TA 3A2FA 4B8CA 3NF9A 4FLXA 3E01A 1XWLA 3PUFA 2BANA 2X6SA 4KO0A 4I9LA 4CJ4A 1RBSA 4J2AA 2YHBA 1A5XA 3U3GA 3QETA 3AA2A 3TWHA 5HP1A 2G8WA 4FJGA 2P51A 3DLHA 2KTQA 5DMRA 3HVTA 4HUGA 4KREA 4DTRA 1JL2A 3ZT1A 2D5RA 4B9VA 4CF9A 1WAFA 4PQUA 4E7LA 3OYNA 3LDSA 5I3UA 2BGGA 4W5RA 4BE0A 4EZ6A 4M3TA 1HYVA 2XY7A 1TK5A 1X9SA 4KAZA 4RW7A 1EX4A 2RPIA 3FFIA 5HBMA 3ZSRA 4ELVA 4M3WA 4CEQA 4CK3A 2Z1JA 3CM6A 5T7BA 3ZSVA 3KJVA 1VSLA 4CJLA 4DLEA 4DU3A 4NCAA 3SUPA 3VN5A 5FRNA 5J2PA 3HYFA 4CHNA 4E7HA 1ITGA 4M3YA 4CGJA 4ICLA 1KCFA 1YVUA 1RDCA 2GV9A 1UWBA 4I2PA 4EP5A 4BDYA 1D9DA 1VSIA 4KI4A 2YNFA 3HK2A 3O4NA 4ZTFA 3PO4A 3HPGA 3O3HA 3QNNA 1RCHA 3AO2A 4CJQA 4HHTA 3MEDA 3TAMA 5J2QA 4W5NA 3HT3A 2HNYA 5KI6A 2IAJA 3WNHA 3TR8A 1BI4B 2KFNA 1BIUA 3ISNC 2XO7A 1VSHA 2DFFA 3NCIA 4CJTA 3OS0A 4KPYA 3K59A 4H4OA 4N56A 3LWMA 1IO2A 2XRIA 3PX4A 3RTVA 3HVRA 2XY6A 1QS4A 4CGDA 2OA8A 1DLOA 1BIZA 1HPZA 4CEZA 1U4BA 2OZSA 4FZXC 1GOAA 4B9SA 3B6PA 3I0SA 4DWIA 4N41A 2BE2A 3NFAA 4BDZA 4OJRA 3RRHA 3JSMA 3K5LA 3KK2A 4QAGA 1SKWA 4JS5A 4CECA 1HYSA 1BQMA 3AVNA 4CK1A 1DTQA 1KTQA 1YTUA 1X9WA 1BCMA 4E89A 4N5SA 3AA3A 3RRGA 1MU2A 4JRPA 2EHGA 3ITHA 2G8HA 4FCYA 1JLAA 1HRHA 2G8KA 3LWLA 1CXQA 1RBTA 4B3OA 3AVMA 4CGFA 1HJRA 4OKEA 4YNQA 1WAJA 3ZSOA 4CFDA 3SPYA 3L8BA 4DFMA 2OZMA 1Q8IA 3SUNA 5KGWA 2X78A 4CEEA 4C8OA 4DMNA 4CIGA 3IG1A 4M3ZA 5D3GA 4KHYA 4Z4IA 1A5VA 1NK4A 4CEOA 4I9QA 4F4KA 3RMBA 2ITGA 1KSPA 1HQUA 1FXXA 1JLQA 1S1UA 2E6MA 3M8SA 3IRXA 3LP1A 1RT4A 3C6UA 1B9DA 3RMAA 2O4IA 2EX3A 1JKHA 2FBVA 3LANA 3LPUA 3OYHA 3CM5A 1QSYA 1XC9A 4PWDA 3L3VA 3NAEA 2DFEA 1C1CA 3OYBA 3K57A 3PO5A 1VSEA 1JXBA 1QE1A 4FVMA 4BACA 1BGXT 2FBTA 1SL0A 4AH9A 4DTSA 2D0AA 2VG6A 4DTPA 4CJ5A 2YKNA 4DU1A 3DLKA 3TAPA 3S3OA 1L3TA 1QHTA 2ZE2A 3ZT2A 2OPQA 3QO9A 2XY8A 4N47A 3KLGA 4E7JA 3THVA 4AHVA 1TKDA 4CJVA 4JLHA 4CIFA 4FJXA 1T8EA 1U04A 4MFBA 1VRTA 1NJZA 5CYQA 3SJJA 3AVJA 3AO1A 3AVIA 1GOCA 4H8KA 3VQ6A 4CGHA 2Y1JA 4LY7A 4GMJB 3KKSA 4EP4A 4FZYA 4FXDA 3HP6A 4Z4EA 4HVJA 4FYDA 1RT7A 3PX6A 3OYGA 1IKYA 1C0MA 1RILA 4F2RA 1LAWA 2E4LA 3L2QA 4AHUA 2Z1HA 4AHTA 3VA0A 3ZSXA 1S1WA 4IBNA 4XIUA 3OYAA 4FJ7A 4CGGA 3EY1A 2PYLA 3AVCA 4KTZA 1KFSA 3MXMA 3DLGA 1C6VA 3CG7A 4B8AB 1KLNA 3M8QA 4G1QA 5HRRA 3KK3A 4JS4A 4HUFA 4J2DA 3HP9A 4C8LA 4CJFA 2YHAA 3RR7A 2ATQA 4RW4A 1KVCA 4DS4A 2OYQA 4CCHA 5SZTA 4AILC 3DOKA 3VQ9A 3ZSQA 2HHSA 2Z1IA 4DQPA 2DTUA 3NF6A 2JLEA 4KFBA 1IH7A 5E41A 1L3SA 4F8RA 1LAVA 4O4GA 3K5NA 5KTQA 1HQEA 1UOCA 1J54A 1Q9XA 4DSJA 3OYFA 1FK9A 4K8XA 3PX0A 3SUQA 1TK8A 1Q9YA 1CXUA 3VQPA 1KFDA 4NYFA 3LP2A 2A1RA 4FJLA 4DSLA 3AVBA 3SPZA 1HMVA 1SKSA 2VG7A 1XI1A 3KD1E 1NOYA 3PY8A 4KB1A 4E19A 4GW6A 1WSIA 4CHQA 3B6OA 3VQQA 4DQRA 4BDPA 3K58A 4FJKA 1S9EA 3V9WA 2HNDA 4FLUA 3AVFA 4CF0A 1VSFA 1WSHA 2YV0X 4CEDA 4DSEA 1NK7A 5KGXA 4DFPA 4PUOA 4B9MA 3SI6A 2IGIA 2X74A 4CJRA 1L3VA 4N76A 2W42A 2QK9A 4CF8A 4CEAA 2P5GA 2ZQBA 2B5JA 3C95A 4DQSA 5CYMA 5HLFA 2HHTA 1CZ9A 4CERA 1HYZA 1IKVA 4DTJA 1S9GA 3VQ5A 1I3AA 2X6NA 3CFRA 1XHZA 4LD0A 4DG1A 4F2SA 4KRFA 5CY4A 3JYTA 1NKBA 1SKRA 1C1AA 1GOBA 4LSNA 4OPKA 3OYMA 4KHUA 3SZ2A 4FLWA 4DSKA 3C94A 3HPOA 3AVLA 4IDKA 4KHWA 4DTMA 3QERA 2KZMA 4Q0BA 3VA3A 1KLMA 3HO1A 3V9UA 4ELTA 4I7FA 3S3MA 4E0DA 4E3SA 1BQNA 2Q3SA 5HROA 1G15A 4DS5A 3U6FA 2ETJA 2VG5A 5HRSA 4FW1A 4BE2A 4IFVA 4OKKA 4HUEA 4RW9A 3SQ0A 3V9SA 1UA1A 1NJWA 3LZIA 1TL3A 4GVMA 4NCGA 3WNEA 3OYIA 3O3FA 2QKKA 4Z0UA 1N6QA 1ZBHA 3DRPA 2VWKA 2KFZA 3EZ5A 3OJSA 3C6TA 4PA1A 3SUOA 4FLZA 1B9FA 1YTAA 3SQ2A 3K2PA 2HMIA 1JXEA 3TARA 3KK1A 4ZTJA 3OY9A 4OGCA 2FC0A 4DU4A 2BDPA 1LW2A 1FKOA 1WNSA 1RBUA 1S6PA 4UQGA 3QESA 4WE1A 4E7IA 1JLBA 3DLRA 4CF1A 3RMCA 3KIOA 2RF2A 3SYZA 2DFHA 4DQQA 4YFUA 4C8MA 4DTXA 1J53A 3IAYA 1Z26A 4EZ9A 3NH0A 4OLBA 2P5OA 2HHQA 4DSFA 2IC3A 3NGZA 1L3UA 3QLHA 1RTDA 3V6DA 4OLAA 4NCBA 3BGRA 1LWCA 3OVNA 4ELUA 1WN7A 4HTUA 3S3NA 3QIOA 2GUIA 1WSFA 2ZD1A 3ALYA 1TAUA 3MXJA 3VQEA 4H4MA 3EYZA 4AHCA 1QSLA 1WSEA 1U45A 2HHVA 4FLYA 2RN2A 3ZSZA 3VQAA 3NDKA 3LALA 1S1TA 4Y1CA 2F8TA 2PZSA 3AVGA 2HHXA 3DLEA 4Y1DA 2G8IA 3ZSYA 4B9NA 3KLHA 4R5PA 3HL8A 3OS1A 4DQIA 4F3TA 1N5YA 2B4JA 3CQ8A 4CK2A 4LH5A 2F96A 4DF4A 4KHNA 4KHSA 4M3XA 1EXQA 4FM1A 3D0PA 1NOZA 3LP0A 4O5BA 4FLTA 2PYJA 4DSIA 1VSMA 1Z25A 3TAGA 3V1OA 2NUBA 1ZBIA 1T03A 1F21A 1IKWA 1S6QA 3KLEA 4KTQA 3AV9A 1UA0A 3OYKA 4FW2A 2JGUA 1BISA 3P5JA 5I42A 2IOCA 4CESA 4L8RB 4IG0A 4M42A 2QKBA 2F8SA 1SL1A 1TK0A 2LSNA 4CJEA 3WNFA 5HRNA 3VQ8A 1S1VA 1YT3A 4J2EA 4LSLA 1VSJA 3SNNA 1R0AA 4ZHRA 2KW4A 1IG9A 3MEGA 4CEFA 4FJ5A 3G10A 3VQ7A 3T3FA 4IKFA 4Z4GA 2OPRA 2P1JA 1BL3A 3ZCMA 3AVKA 4CJPA 4CJKA 3OYCA 1CLQA 1WSGA 2RKIA 3QIPA 3VQ4A 2YNIA 3HM9A 2HB5A 4O55A 5KRTA 2IDOA 4F3OA 3NE6A 4FZZA 3OYDA 1JLCA 3DYAA 1FKPA 2DY4A 1BCOA 3AO3A 3O4QA 1RTHA 1RDDA 2OPSA 3NGYA 3OYJA 5J2MA 4DTOA 4RW6A 3AVAA 3CFOA 2VWJA 3RR8A 4B9UA 1K6YA 3QNOA 1S1XA 2D0BA 3KLFA 2OPPA 2KZZA 3AO4A 3L3UA 1T7PA 1RT2A 3IS9A 3OJUA 3QEIA 1ZYQA 2HHWA 4CFCA 1QSSA 5JS2A 1BI4A 1KRPA 1SL2A 3NBPA 4DLGA 3BDPA 1HNVA 1RT1A 5FDLA 4BWMA 3ZT4A 3PV8A 4OGEA 1D8YA 3HXMA 1RT5A 3TANA 1TKZA 4BWJA 3LZJA 4W5TA 1NKEA 3LPTA 1LV5A 3NF8A 3DLBA 3DOLA 3VQDA 4FJJA 4O0IA 1RTIA 4CJ3A 1IKXA 2HW3A 1ZBUA 3NGIA 1WLJA 1TL1A 4J2BA 3QEWA 1NJYA 3AO5A 3AA5X 1LWFA 2E6LA 2G8UA 5C25A 3DM2A 5CZ1A 1JL1A
chains in the Genus database with same CATH superfamily
3ZT0A 3CJAA 1NGHA 2YKMA 2QM1A 1O1WA 4MLEA 1GLEG 3THWB 4OPJA 4RWTA 1SUQA 3TI0A 4DR4K 4KI6A 4WCEL 1A5WA 3HPHA 3C6AA 4O0JA 2GBZA 4BRIA 2UYTA 1EO1A 5EU7A 2IS3A 3G0ZA 1HKCA 2GELA 4Y0WA 4FM0A 1TGOA 3AVHA 3V1QA 1YHQN 1SZ2A 4JI0K 4BE1A 1NKCA 3V9ZA 2HF4A 3ZX2A 1NJXA 4HCBA 1HKGA 1V4SA 1EWRA 3I55N 2WBNA 5KRSA 3SBTA 4FM2A 4CHZA 4RG8A 1LWEA 5HL7L 2O8CB 3MECA 3RMDA 3D2FB 3RWUA 3UKUB 5JVHL 1ASWA 3V1RA 1R59O 4LFBK 3J7YP 2B6AA 3SV4A 5ELZA 4ILHA 3M8PA 3FE1A 4YY3K 5BR9A 1ATSA 3EKSA 4IJAA 2E2PA 3U4LA 3K5MA 5AZIB 1Y64A 4AHRA 1KVAA 3SQ1A 3HRGA 3VPZA 3R6MA 3TPQA 5FLXO 1NBWA 2KQ2A 4Z4HA 1VAZA 3V4IA 1JLFA 2XY5A 3LP3A 1B92A 1S5JA 3O3GA 3AA4A 4EIAA 4IOAL 3ZSWA 1TKXA 4W5OA 2KHOA 2WONA 4O44A 1X9MA 3U3YA 2Q0UA 1TYQB 3TAEA 3V9XA 3MEEA 4M41A 3KTQA 2CGJA 1C0FA 3HBTA 1EKEA 2FBYA 4ISGA 4B9TA 3A2FA 3NF9A 4FLXA 1XWLA 4I9LA 4CJ4A 3VGKA 1RBSA 3CCVN 5DMRA 4YDUC 3ZT1A 2D5RA 3LDSA 1VHXA 1XMOK 2BGGA 3FZFA 1HYVA 2XY7A 2KLAA 1BOTO 2QWPA 4BRAA 4DV0K 2OTJN 1X9JA 5AQFA 5KPZA 4M3WA 4WYBA 2Z1JA 3CM6A 5M1QA 4CJLA 1E3MA 4RCHA 4NCAA 1XC3A 3HYFA 4M3YA 1RDCA 3O1WA 4BDYA 4KI4A 3SAFA 3HK2A 5C12A 3O3HA 2P9PB 1U2VB 1RCHA 5CR4A 4W5NA 3J81O 4H0XB 3HT3A 3VESA 3WNHA 1IBMK 1BIUA 2XO7A 1VSHA 3NCIA 4WFBL 3LWMA 4FSVA 4PKGA 4MLHA 3D2FA 1HPZA 3E1YA 3TU5A 4N41A 4B9SA 1MA9B 2BE2A 3NFAA 2A6AA 4EFHA 3KWIA 4Z94A 4BRLA 3JSMA 4QAGA 1BU6O 1BQMA 4CK1A 1DTQA 1X9WA 3SK3A 1HNWK 1ATNA 3VOVA 4CW7B 2EHGA 3E9PA 3F2KA 2G8KA 3E9LA 4CGFA 5M1KA 4OKEA 4YNQA 1WAJA 4CFDA 3MN5A 1Q7YO 1HPMA 3TTCA 4C8OA 4CIGA 4BR7A 3DXKB 1A5VA 3WQTA 4CEOA 3EEQA 2P9SB 3IRXA 5ADXH 1QQNA 2FBVA 4WFAL 3THYA 2DFEA 1C1CA 3OYBA 1JXBA 2NNWA 3F5TA 2D0AA 5JVGL 4DU1A 3FR0A 4JI1K 1QHTA 2ZE2A 3ZT2A 4H0PA 3ATUA 1TKDA 1WUAA 2E8AA 1LCUA 4H8KA 4B3RK 4O8KA 3QFPA 4FYDA 1IKYA 4F2RA 2E4LA 4B3TK 4AHUA 2ZJQL 2Z1HA 3VA0A 4IBNA 3DJCA 2VCPA 1M90O 4FWQA 1KFSA 3M8QA 3A0IX 5HRRA 3R8EA 4KH4A 1K8KA 3K0SA 4C8LA 3RVCA 1Q82O 4DS4A 4CCHA 3DOKA 3VQ9A 4MO5A 4DQPA 4FPBA 4K41A 4KFBA 1IH7A 4F8RA 1L3SA 4WQ4A 3K5NA 3CCMN 4K8XA 3SUQA 3AVBA 2E88A 1HMVA 3C0BA 1SKSA 1NOYA 3MN7A 5LJVA 1WSIA 4BR4A 3H6EA 3K58A 4FJKA 3CJ7A 2HNDA 3GOIA 4CEDA 4YOXA 1NK7A 4DFPA 4H0TB 2QK9A 4CEAA 5FPDA 2ZQBA 2B5JA 3O08A 4IZ9A 5DM6L 4CERA 1HYZA 1IKVA 2ZJPL 4F2SA 4KRFA 4LSNA 4OPKA 4O5FA 4KHUA 4FLWA 3CETA 2Q2RA 1DEJA 3AVLA 3H3OB 5AQTA 5ADXA 1P90A 3V9UA 4B1XB 4I7FA 1VQ8N 3SQ0A 4OKKA 1UA1A 1TL3A 5E84A 3O3FA 3DRPA 2YJEA 2KFZA 3EZ5A 3OJSA 3C6TA 4PA1A 3SUOA 1B9FA 1YTAA 2IIRA 2FC0A 4CZLA 1LW2A 5AFUH 5AQYA 3QESA 1VQON 1C0GA 3VETA 4CF1A 4B9QA 3SYZA 4K0KK 3FZHA 1Z26A 4DR5K 2P5OA 4DSFA 4YOTA 2IC3A 2D0PA 2NZTA 3QLHA 4CZEA 3V6DA 1TUUA 3BGRA 4JI3K 3OVNA 1WN7A 3P31A 3WEEA 1TAUA 1W97L 3EYZA 2W6LA 2HHVA 3NDKA 1IG8A 2F8TA 4JKHA 3DLEA 4Y1DA 2G8IA 3ZSYA 1Z6RA 4R5PA 3HL8A 4M7YA 5AJ3K 2P9SA 1N5YA 4KHSA 5C15A 4FM1A 3D0PA 4FLTA 2NRZA 3TAGA 3IUCA 4BR0A 4NO7A 1ZBIA 1F21A 3KLEA 4NXNK 3T1YK 4KTQA 1YF5L 4FW2A 2JGUA 5FPMA 4H0YB 4CESA 4DV4K 4DR2K 1TK0A 2LSNA 5GAGP 3I8BA 3WNFA 3VEOA 3VQ8A 1VQ6N 1BO5O 1ZC6A 4CEFA 3VQ7A 4IKFA 3J8AA 1CLQA 4CJPA 1WSGA 4BQZA 3HM9A 2HB5A 2IDOA 4A2AA 3NE6A 3OYDA 2DY4A 2ZF5O 3NGYA 4DTOA 3CFOA 4B9UA 3D6RA 1S1XA 2W41A 3KLFA 3OHRA 4BGBA 3IS9A 1ZYQA 2P9IB 4PKIA 2HHWA 1OH6A 3A5MC 4DLGA 1QVFM 4KH6A 1HNVA 3BDPA 5FDLA 4BWMA 4BROA 1D8YA 3TANA 1OH5A 4BWJA 5LJWA 3GDQA 3MWPA 4BR5A 5E26A 5C25A 5CZ1A 4NYNA 1HUXA 3CHWA 1ZBSA 3L2WA 3E66A 1NK6A 3L0QA 3WXJA 5C24A 2A1SA 3MN6A 3LAKA 3WXKA 2O8BB 1RDBA 3CFPA 1D5AA 3QEXA 4QS7A 4OVLA 1I39A 1TKTA 5C42A 4M7XA 4H5RA 4ISEA 3KLIA 1ASVA 1W7AA 2QTDA 2YX6A 4CFBA 4NXMK 3QICA 3SAHA 4FJ8A 3DI6A 1QVGM 3QDKA 3T1HK 2PY5A 2FF3B 3S9HA 1YJWN 3BF1A 4A5BA 4DV7K 1YITN 1OKJA 3ASMA 4CHPA 4BRNA 1HNIA 2AA4A 4JRQA 3T1AA 1YUWA 3AARA 4H5TA 5C0YA 2YCHA 4W5QA 1L5UA 1NK9A 2V51B 3DMJA 3OS2A 3O9QA 2NRRA 1GLCG 3VEWA 3MDQA 4BRMA 2ZM6K 4M3UA 1KAXA 4CHYA 4K8ZA 1GLLO 3P1GA 3GL1A 5DK5A 2HHUA 1QTMA 4B1UB 1J9AA 1DTTA 4CZMA 3N4PA 3SCXA 2QW9A 3IKMA 3OBYA 2A41A 4KV8A 3VGMA 2UUAK 4FK0A 1WSJA 4PL7A 4U67L 5HRPA 3NH2A 1XHXA 4OX9K 4JHDA 4BRFA 3U9DA 3HSTB 1ASUA 4MQ3A 4C8KA 3D45A 2AJQA 2HBLA 4FJMA 4YOUA 1GLBG 1U47A 2V52B 1SV5A 3M8RA 1ZBFA 4MO4A 1VSDA 2AP1A 4FL9A 4CF2A 1U49A 2WC9A 1TVRA 4JD2B 4TSXA 1ILYA 2P9PA 1EP4A 5JS1A 3VF4A 3THYB 5FROA 1NK0A 1Q86O 1U6ZA 4DFKA 2HVHA 5AQUA 4HCCA 4FLVA 1DKGD 1U48A 1RTJA 3D2EA 3SAGA 2YI1A 2X6SA 3QETA 4IJNA 3TWHA 5HP1A 2P9IA 2KTQA 2P51A 4DV1K 3HVTA 4HUGA 1I94K 4KREA 1WAFA 2F9WA 4A5AA 4YHHK 1KD1O 4EZ6A 4CZIA 1TK5A 3I56N 2RPIA 5BRDA 3ZSRA 4GKKK 4IEIA 5AQPA 4PKHA 3B8AX 1VSLA 4DLEA 4AQYK 1NGEA 1XNQK 4DV2K 5AZJA 3THXA 4ICLA 4I2PA 4KH5A 2UXDK 3R9PA 3A5LC 1BG3A 2YNFA 3T7ZA 3O4NA 4ZTFA 3QNNA 2FXUA 3AO2A 3HOSA 4HHTA 4H03B 5KPTA 2YHXA 1EWQA 5AQLA 2HNYA 1XQSC 2IAJA 5KI6A 3TR8A 2KFNA 2DFFA 4CJTA 3OS0A 4KPYA 3CJ1A 3PX4A 3RTVA 4CGDA 2OA8A 1DLOA 3E9OA 4CEZA 4FZXC 1Q18A 1GOAA 2RE2A 3D2EB 3G25A 3M3ZA 4YOWA 4BDZA 5A2QO 4JS5A 2ZJRL 4E89A 4N5SA 3AA3A 1HJOA 3W3DA 4GV3A 4K43A 4FCYA 1T6DA 1HRHA 1J6ZA 1RBTA 3LDQA 1DT9A 3L8BA 4DFMA 2QWLA 5KGWA 2X78A 5AQWA 2E1ZA 3ENBA 2QWOA 2QXLA 2CGLA 1CZAN 1G99A 3RMBA 1KSPA 4LF6K 1JLQA 4FOIA 2VYPA 2O4IA 4WF9L 1NGBA 1QSYA 1O13A 2CGKA 4CVNE 2HSTA 4FVMA 1BGXT 2FBTA 4DTSA 3LDNA 2YKNA 3S3OA 3DLKA 1DGKN 3N4QA 4N47A 3KLGA 4AHVA 3L6QA 4CIFA 1T8EA 4MFBA 1VRTA 3AO1A 3AVIA 1GOCA 2ZWHA 3VQ6A 3KKSA 4EP4A 1NGFA 4FXDA 4HVJA 1LOTB 1X3NA 3OYGA 2VGNA 4LC9B 1LAWA 4BRHA 1KC8O 2ZGZA 3T69A 3ZSXA 1S1WA 4BREA 3OYAA 4FJ7A 4CGGA 3M5RA 2WTUA 3DLGA 3CD6N 3KVGA 4BR9A 4JS4A 4YORA 4CJFA 2YHAA 3RR7A 2ATQA 3QBXA 4C1NK 1ATRA 2ZGYA 4H0OA 3FZLA 3ZSQA 2NRWA 3NF6A 2HOEA 5E41A 4O4GA 1UOCA 1Q9XA 3OYFA 5IWAK 3PX0A 1TK8A 3LP2A 2A1RA 3A5OC 4DUZK 1VQMN 4DSLA 3KD1E 4KB1A 1FJGK 4GW6A 4DB3A 3B6OA 1VQLN 3QFUA 4CD1A 1S9EA 3V9WA 3AVFA 3O1BA 1VSFA 2YV0X 5KGXA 2W40A 2WUSA 3SI6A 2IGIA 4CJRA 2QA4N 2BH1A 2W42A 2Q1NA 3FLCO 3C95A 5CYMA 4JI2K 4CBXA 1CZ9A 1ZXOA 4DTJA 1I3AA 1QZ6A 3CMEN 3LDPA 3CFRA 1XHZA 4DG1A 5CY4A 3JYTA 1NKBA 1NWKA 3OYMA 1KQSM 5DM7L 2VQEK 2OCEA 4C1NI 4U7BA 3HPOA 4DSKA 3QERA 4Q0BA 3DXMB 4E0DA 4E3SA 2Q3SA 3O9UA 4BE2A 4HUEA 4RW9A 3PIPL 1NJWA 3ZX0A 3WNEA 3OW2M 2QKKA 3AAPA 2GEMA 1ZBHA 1JCEA 4EHTA 3K2PA 2FSJA 2YJFA 3TARA 4ZTJA 1WNSA 1RBUA 4WE1A 4E7IA 5BN8A 3BZKA 3RMCA 2DFHA 3O4WA 4DQQA 4CBUA 4C8MA 4DTXA 1IBLK 1SQKA 4EZ9A 3TSQA 3K9JA 5BPMA 5M1NA 1L3UA 2UXCK 1LWCA 4ELUA 1T6CA 5BN9A 5M1PA 3QIOA 4MDAA 3H1VX 3Q7CA 1MWKA 3OTOK 1XMQK 4FLYA 1WBDA 3LALA 3JS6A 2O8FA 3AVGA 2HHXA 5BPLA 4DQIA 4LF5K 4FWRA 1NGIA 2B4JA 1N34K 3A8YA 3CCUN 4M3XA 1EXQA 2A5XA 3CJ9A 2PYJA 1Z25A 3GBTA 4JI5K 2NUBA 4NLBA 1IKWA 5C10A 5I42A 4A59A 1BISA 3P5JA 4L8RB 1NU0A 3EE8A 1SL1A 2F8SA 3D7EO 3RSEB 3QMLA 1S1VA 4WFNL 4LSLA 3SNNA 1R0AA 4ZHRA 2KW4A 1VQ9N 5AQJA 5F2RA 4GNIA 4I6MA 1OH7A 3QIPA 4IOCL 4BRCA 4FZZA 3DXKA 4F3OA 3DYAA 1BCOA 3OYJA 1NNEA 2VWJA 1J5EK 1IBKK 4UY8O 3JXUA 4GV9A 3L3UA 3OJUA 4JKAA 3LM9A 3QB0A 3VEXA 1QSSA 1BI4A 2IVNA 3ZT4A 3CC2N 5GIOA 2UUCK 2GX9A 3LZJA 1YVNA 4W5TA 1V4TA 1LV5A 2P9UB 1IKXA 3CXCM 1WLJA 1TL1A 2BUPA 2E6LA 2G8UA 1JL1A 3FZKA 3F73A 3DLLL 1J5OA 4DR1K 3CF5L 4CJWA 4JKCA 3QEPA 2P9KA 3C7NB 3HTVA 4KTWA 3K9KA 1VK0A 2HNZA 3I0RA 4I6MB 3AAQA 1JCGA 1WOQA 2P9NB 4CE9A 1W0HA 4B08A 4A2BA 5JLHA 1WBBA 2JWKA 1JLEA 4R79A 5GADP 5EY4A 2R7YA 4CIEA 3HSCA 3CI5A 4IXCA 2FLOA 4Q5VA 3CCRN 3VTHA 1UAXA 1QQCA 1K9MO 3J7AP 2Q31A 1E4GT 4ID5A 1W9HA 1GLFO 3OBWA 3HOTA 2HBJA 5AQGA 2FBXA 2HVIA 3ID6A 4H0VB 3ZEUB 4KHQA 3A5NC 4DV6K 1NK8A 5GINA 4BRQA 4E7KA 4ID1A 4QOZB 2QWMA 4IO9L 3QBWA 5LY3A 1MDUB 3J80O 4CJUA 2Y1IA 3SMSA 1D9FA 4B9LA 4BY9C 1OVYA 4LH4A 3ULDA 3CC4N 3CC7N 2NRVA 3EKUA 1LW0A 1JCFA 4X65K 5AR0A 3P83D 4DTNA 1VQ5N 2YNGA 1C1BA 4FJIA 2NRTA 1NK5A 1OVQA 1RT6A 1Y97A 4MDBA 3JAMO 3SQ4A 4DUYK 2Z1GA 4AHSA 1T05A 3P38A 1XNRK 3ZT3A 4PY5A 1TAQA 4BG8A 3VQCA 2GWJA 1VRUA 4PHTX 3WXMB 4RW8A 1KVBA 4QCLA 4IG3A 4ILGB 3CYMA 1C0UA 1VQNN 2E5LK 2O8DB 3MN9A 4FOEA 4JI8K 5LMUK 5BREA 2O4GA 3VEVA 4BQLA 2I5JA 3V81A 1N8RO 3CCLN 3UIQA 4HTLA 3GE1A 3OYEA 4B3SK 1REVA 1VSKA 4KHYA 1RBRA 4KKOA 3TAFA 1ZBLA 3TTFA 2G8VA 1RDWX 3L2UA 5FRMA 4C8NA 2RHKA 3L2RA 1TYQA 4RTFD 3HI0A 2J4RA 3PUFA 4F9OA 4KO0A 1E4FT 4J2AA 2YHBA 5LL6Z 3AA2A 4KBOA 3VGLA 2ITMA 3TTDA 1JL2A 4DTRA 4CF9A 4PQUA 4X62K 2PFUA 3OYNA 2O8BA 4IOXA 4W5RA 4BE0A 4M3TA 5JICA 4KAZA 4YDUA 3FFIA 3ZX3A 4ELVA 4FWKA 4CEQA 2A40A 5T7BA 3KJVA 2QEXN 3J7ZO 4JKDA 4O8UA 4BRGA 3SUPA 5J2PA 5TKWA 4CHNA 5BR8K 1KXPA 1ITGA 4E7HA 1IV0A 4CGJA 1KCFA 4EP5A 2GV9A 4BVOA 3HZ6A 3PO4A 3HPGA 4XH4A 3ZEUA 4CJQA 5AQVA 5AQZA 1QZ5A 1KAZA 4H4OA 4N56A 4V19S 1IO2A 2XRIA 3HVRA 2CH5A 2XY6A 2OZSA 1BIZA 4JAXA 1YJNN 1U2VA 3U9ZA 3RRHA 4JYAK 1N32K 2D1KA 4JKBA 3K5LA 3KK2A 1H1VA 4CECA 5H1SQ 1BDGA 4E1JA 3ENHA 4C23A 1KTQA 1OH8A 5KQ8A 2W6KA 3RRGA 4JRPA 3ITHA 2G8HA 4M63C 3ATVA 4CJ7A 1JLAA 4KHPK 4NLCA 4B3OA 3AVMA 2QWNA 3WXLA 1T3VA 4ILJA 2A42A 5EX5A 2OZMA 1Q8IA 4XH5A 4CEEA 3ULEA 4DMNA 1S72N 4FO0A 3IG1A 4M3ZA 5D3GA 4Z4IA 4EAHD 3MK6A 3CCJN 2IVOA 4JKFA 1FXXA 1S1UA 3M8SA 4BVPA 5IT9O 1Z05A 4BR2A 3LPUA 4GKJK 4PWDA 1P8ZA 3L3VA 3NAEA 3SBGA 4DV5K 5C2DA 1VSEA 3O6WA 4EHUA 3WQUA 1SL0A 4IWVA 4AH9A 3TAPA 2VG6A 4DTPA 2I7NA 3EN9A 1NMNA 4WQ5A 1L3TA 3QO9A 2I7PA 2NRHA 2XY8A 4E7JA 3KHYA 4JLHA 5CHIA 4FJXA 1NJZA 5CYQA 3SJJA 3PIOL 4GMJB 4DR3K 4FZYA 1NGAA 4Z4EA 4IEEA 3PX6A 1C0MA 5AQKA 4DR6K 1SAZA 3L2QA 3UE5A 4OO1J 3EY1A 3AVCA 4KTZA 3W0LA 4GV6A 4JI4K 5BPNA 3O8MA 4B8AB 1KLNA 3CPEA 4HUFA 3PLAA 1KVCA 5SZTA 3O80A 4A61A 4FVUA 5CE3A 1YI2N 3BEXA 3BY5A 3CERA 2O8EB 4L3QA 1HQEA 4DSJA 1FK9A 4JNEA 2HHQA 3VQPA 1KFDA 4NYFA 4CI6A 3SPZA 2VG7A 5EVZA 4JKEA 1W2BM 3SJHA 1NLVA 4CHQA 3WUHA 3VQQA 4BDPA 2P9LA 3ENOA 3THWA 4GVEA 1WSHA 4PUOA 4B9MA 2X74A 1L3VA 4N76A 2P5GA 1NMDA 4BC4A 4DQSA 4FWLA 4B1YB 4HWIA 5F0XA 1S9GA 4H5NA 2X6NA 4DHYA 1RGIA 1C1AA 1GOBA 4BG9A 3SZ2A 3C94A 5M1FA 4KHWA 4DTMA 2KZMA 2FF6A 4DS5A 3U6FA 5HRSA 3SMPA 4IFVA 4H5WA 5FPNA 1K8AO 1NG9A 4GVMA 2ASPA 3OYIA 5AQMA 3WXIA 3CCSN 1XUPO 4Z0UA 2VWKA 3ZYYX 4IDHA 1VQKN 3SQ2A 3KK7A 2UXBK 1BWFO 2HMIA 3KZBA 3OY9A 1FKOA 4UQGA 3DLRA 3KIOA 2RF2A 3DWLA 2GUPA 4DCHA 3IAYA 5AQSA 5GIPA 2P9UA 4OLBA 2A3ZA 2GWKA 4OLAA 4LF7K 4NCBA 4HTUA 1GLJO 3ALYA 2ZD1A 3MXJA 3VQEA 2Q0RA 1RDUA 3VQAA 2P9KB 3LDOA 2PZSA 2O8EA 5JLFA 4IO8A 2E2QA 3KLHA 4QS8A 4F3TA 1QQMA 4CK2A 3H45C 4LH5A 5BRFA 1T44A 2YHYA 2PBDA 4KHNA 3VEYA 4OPHA 3LP0A 5BRHA 2ASMA 4DSIA 4LF8K 3NMUA 3V1OA 1VQ7N 1T03A 3AV9A 3Q7BA 4JK8A 4IG0A 2QKBA 3G6EN 2HHHK 3CJBA 4CJEA 2E20A 1YT3A 4JKGB 4J2EA 5AZIA 1VSJA 3LM2A 1IG9A 3MEGA 4BRDA 1YIJN 2OPRA 2P1JA 4CJKA 2EWSA 3AVKA 3S41A 3P39A 3UKRA 3ZCMA 2YNIA 4CZHA 3MX2A 4JK9A 1S3XA 5KRTA 4CBWA 1QHAA 5AQRA 1FKPA 1NJIO 1HNZK 3NVMA 3O4QA 1RDDA 5J2MA 2E1YA 3IFRA 4RW6A 1NGJA 5AQIA 2KZZA 3AO4A 1RT2A 4AF1A 3LDLA 5KQDA 3G71N 1NGDA 3EL2A 1KRPA 4DV3K 3PV8A 4OGEA 3P4IA 3O9RA 2D0OA 1TKZA 3DLBA 3NF8A 3DOLA 4CJ3A 2HW3A 3FGUA 4J2BA 3QEWA 1LWFA 4ISFA 3HJFA 3NVKA 5I9EB 4B1VA 4FK2A 3VENA 3TAQA 3EE9A 1RT3A 4BRPA 1BA1A 2YHWA 3WNGA 4FJ9A 4B1WB 3QINA 3H08A 2E2OA 1NM1A 4DFJA 4FWPA 3L4IA 5J1EA 3EZWA 4CJSA 3CMAN 3AGKA 1D4XA 3BZCA 3VMFB 2HBMA 3L4QA 1JJ2M 2CH6A 4FJNA 1TV6A 4CEBA 3TABA 1BHLA 3NF7A 2O8FB 2WOMA 1N33K 1EETA 2O8DA 1GLAG 4OPAA 1NGGA 3NHGA 3IDHA 3F9KA 3MCPA 3I8DA 3L2VA 4K25A 1KAYA 3KKRA 1CZBA 4CHOA 3LL3A 4FJHA 4I2QA 2QXFA 4CGIA 4Z4CA 2QWRA 3MX5A 3QEVA 4Z4FA 3OYLA 1RNHA 5KPRA 2V7ZA 3C6HA 4YOYA 3NH1A 4YOVA 4M3RA 2UU9K 3MAQA 2IVPA 3PSFA 5HOOA 4DTUA 1YJ9N 1C0TA 3UKUA 1ESVA 3PSIA 4JI7K 1JLGA 1X1PA 4XH1A 3BF3A 4E1MA 5GAEP 1RBVA 1FW6A 4FWNA 2Q36A 5EOYA 3M1FA 3VERA 3HM8A 3VQBA 3MXIA 5K14A 4E1NA 4CFAA 5J2NA 1RDAA 3K5OA 4FK4A 5SWMA 3T19A 1HR0K 3ZLJA 2XHBA 1MWMA 4JKGA 2G8FA 4JHDB 3DRRA 3KD5E 4B1ZA 3THXB 5CZ2A 1GLDG 4FWSA 4DR7K 3SV3A 1HX1A 2YNHA 4M45A 4DF8A 4IFYA 3G4SN 3DRSA 3LAMA 2D0CA 1K8KB 4KB0A 5B8HA 5AQHA 4OKJA 2UUBK 4DQ8A 1X3MA 4B8CA 3E01A 2BANA 1BA0A 1A5XA 3U3GA 3ULEB 2G8WA 4FJGA 1EQYA 3DLHA 4B9VA 4DKWA 4LFCK 2ASOA 4J8FA 4E7LA 5I3UA 1YXQA 3CQXA 2FSNA 1X9SA 4RW7A 1EX4A 3CCEN 3FZMA 5HBMA 4G9ZA 4CK3A 3CCQN 3IMXA 3ZSVA 4K42A 4DU3A 2HF3A 3CJCA 5FRNA 3VN5A 2FSKA 2F7TA 1YVUA 1UWBA 1S22A 1D9DA 1VSIA 4PL8A 5J2QA 3BP8A 3MEDA 3TAMA 2VQFK 2O8CA 1BI4B 3ISNC 3K59A 4BC5A 2P9LB 1QS4A 4JN4A 3VEZA 1U4BA 4J2DA 4DWIA 3B6PA 3I0SA 1WB9A 3AY9A 4OJRA 4FWOA 2V7YA 1SKWA 1HYSA 3AVNA 4LF4K 1YTUA 1BCMA 1HKBA 4JEPA 4XEIA 5LMNK 1MU2A 2VGMA 3BUZB 4AM7A 4LFAK 2HMPA 4BGAA 3TSPA 3LWLA 1CXQA 3RSEA 3VF2A 4WQ5C 1HJRA 5AZJB 5M1OA 2NRXA 3C65A 3WEEB 3ZSOA 3SPYA 2BTFA 5MLCQ 3SUNA 2KKZA 2QWQA 3KWGA 1VQ4N 1BUPA 1NK4A 4I9QA 3MMVA 4F4KA 2ITGA 1HQUA 2E6MA 3SLCA 3LP1A 1RT4A 3C6UA 1B9DA 3RMAA 2EX3A 1JKHA 3LANA 5EXWA 3TSUA 5FPEA 4LF9K 4NB4A 3OYHA 3CM5A 1XC9A 3DAWA 3K57A 3PO5A 2P9NA 1QE1A 2D4WA 4BACA 5GAHP 1NGCA 4CJ5A 3R1XA 4AM6A 2OPQA 3THVA 4FPAA 4CJVA 1U04A 4B3MK 3AVJA 1HNXK 2Y1JA 4CGHA 4QS9A 4LY7A 3HP6A 5C2FA 1RT7A 1IJJA 1RILA 4AHTA 4XIUA 2PYLA 3ZETA 1N36K 3MXMA 3R3LA 1C6VA 3CG7A 4JV5K 4G1QA 3KK3A 4CZJA 3HP9A 2DPNA 4RW4A 2OYQA 4AILC 1SS6A 3FFKB 2HHSA 2Z1IA 4CZGA 2DTUA 3H1QA 2JLEA 4CZKA 4BC2A 1LAVA 3VTIA 5KTQA 1J54A 2VWBA 2WFBA 1Q9YA 1CXUA 4FJLA 1XI1A 3PY8A 4E19A 4DQRA 3O5BA 2HBKA 4FLUA 4CF0A 4DSEA 5AQNA 4CF8A 4A57A 5HLFA 2E2NA 4IFEA 2HHTA 3VQ5A 1QQOA 3CPWM 4LD0A 1SKRA 3UKRB 4IDKA 3VA3A 1KLMA 3HO1A 4ELTA 5AQXA 3S3MA 4FWMA 1BQNA 2OANA 3UB5A 5HROA 1G15A 2ETJA 2VG5A 4FW1A 3V9SA 3O9SA 3LZIA 2Q97A 4NCGA 1VQPN 3GG4A 1N6QA 4CD3A 4FLZA 1YAGA 1M1KO 1JXEA 4GY2B 3KK1A 1HLUA 4OGCA 4DU4A 2BDPA 1S6PA 5F1XA 1JLBA 2JWLA 3MWTA 5JMVA 4YFUA 1J53A 3U8XA 3AGRA 4WQ4C 3NH0A 1RFQA 3NGZA 2GTDA 1RTDA 3S3NA 2GUIA 3WT0A 1WSFA 3O9TA 2PAVA 1Q81O 4H4MA 4AHCA 1QSLA 1WSEA 1U45A 2F4VK 2RN2A 3CQYA 3M6GA 3ZSZA 3OA9A 1S1TA 4Y1CA 3DXMA 5AFUA 4B9NA 3I33A 3OS1A 3CQ8A 1K73O 2F96A 4DF4A 4X64K 3VF6A 1NOZA 4O5BA 1VSMA 2QI2A 1S6QA 3ZETB 2H3GX 1UA0A 5TKYA 3OYKA 4M42A 4BRKA 1TUYA 2IOCA 4X66K 2OTLN 4CZFA 5HRNA 4FJ5A 3G10A 3H3NO 3T3FA 4H5VA 4Z4GA 1BL3A 3OYCA 2RKIA 3VQ4A 4O55A 3F9MA 1JLCA 3AO3A 1RTHA 2OPSA 3ID8A 3AVAA 3RR8A 1K6YA 3QNOA 2D0BA 3CIPA 4BC3A 2OPPA 1T7PA 4JI6K 2NLXA 3MCAB 3QEIA 4CFCA 5AQOA 5JS2A 4A62A 3NBPA 1SL2A 5AQQA 1RT1A 4JD2A 3H46O 1RT5A 3HXMA 3EO3A 3C7NA 3LPTA 1NKEA 3VQDA 4FJJA 4O0IA 1RTIA 1ZBUA 3NGIA 2F9TA 4JK7A 1NJYA 3AO5A 3AA5X 3DM2A
chains in the Genus database with same CATH topology
3ZT0A 4NYNA 3HJFA 3F73A 3L2WA 1J5OA 2YKMA 1NK6A 4CJWA 4FK2A 1O1WA 3QEPA 3TAQA 5C24A 1RT3A 4KTWA 4OPJA 2A1SA 1VK0A 3LAKA 1SUQA 2HNZA 3WNGA 4FJ9A 3I0RA 3TI0A 4CE9A 3QINA 1RDBA 3H08A 3CFPA 1A5WA 1W0HA 4B08A 4KI6A 1D5AA 3QEXA 3HPHA 4O0JA 4OVLA 4DFJA 5J1EA 1I39A 1TKTA 2GBZA 5C42A 4CJSA 5EU7A 1JLEA 2IS3A 3G0ZA 3KLIA 1ASVA 2R7YA 4CIEA 4FM0A 1TGOA 3AVHA 4Q5VA 4CFBA 3V1QA 1UAXA 1QQCA 4FJNA 4FJ8A 3DI6A 1TV6A 4CEBA 4ID5A 1W9HA 4BE1A 1NKCA 2HVIA 2FBXA 2PY5A 3V9ZA 3TABA 3S9HA 1NJXA 4HCBA 4KHQA 1NK8A 3ASMA 1BHLA 3NF7A 4CHPA 1HNIA 5KRSA 4JRQA 4FM2A 3T1AA 4ID1A 2WOMA 4E7KA 4QOZB 1EETA 4CHZA 4RG8A 1LWEA 4W5QA 3NHGA 3MECA 1L5UA 3RMDA 1NK9A 3F9KA 3I8DA 3L2VA 3RWUA 3DMJA 4CJUA 3OS2A 2Y1IA 1ASWA 3KKRA 1D9FA 1CZBA 3V1RA 4B9LA 4CHOA 2B6AA 3SV4A 4I2QA 2QXFA 4FJHA 4LH4A 4CGIA 3M8PA 4Z4CA 3ULDA 3QEVA 4Z4FA 3OYLA 1RNHA 4CHYA 4M3UA 1LW0A 3NH1A 3P83D 4DTNA 4K8ZA 3P1GA 5DK5A 2HHUA 1QTMA 4M3RA 3K5MA 1J9AA 1DTTA 2YNGA 3SCXA 1C1BA 3MAQA 4AHRA 4FJIA 4DTUA 1C0TA 1NK5A 4KV8A 1KVAA 3SQ1A 1RT6A 1JLGA 1Y97A 4FK0A 1WSJA 1X1PA 3SQ4A 5HRPA 4E1MA 2KQ2A 4Z4HA 3NH2A 2Z1GA 1XHXA 1RBVA 4AHSA 1T05A 3V4IA 3ZT3A 4PY5A 3HSTB 1ASUA 1TAQA 3VQCA 4MQ3A 1JLFA 4C8KA 3D45A 1VRUA 2XY5A 2AJQA 4RW8A 1KVBA 4FJMA 4QCLA 3LP3A 4IG3A 1B92A 1S5JA 3O3GA 3AA4A 3VQBA 1U47A 3CYMA 5K14A 3MXIA 4E1NA 4CFAA 5J2NA 1RDAA 1C0UA 3K5OA 4FK4A 3ZSWA 5SWMA 1SV5A 1TKXA 3T19A 4W5OA 3M8RA 2XHBA 1ZBFA 2WONA 4O44A 1VSDA 4CF2A 1U49A 1X9MA 2G8FA 3DRRA 3KD5E 2O4GA 3U3YA 5CZ2A 1TVRA 2I5JA 4TSXA 3V81A 3TAEA 3UIQA 3V9XA 3SV3A 2YNHA 4M45A 4DF8A 1EP4A 4IFYA 3MEEA 5JS1A 3DRSA 3LAMA 1REVA 1VSKA 2D0CA 1RBRA 4M41A 4KKOA 3OYEA 3KTQA 3TAFA 1ZBLA 5FROA 1NK0A 4KB0A 4DFKA 2G8VA 3L2UA 5FRMA 2HVHA 4HCCA 1EKEA 4C8NA 4OKJA 4FLVA 2FBYA 1U48A 1RTJA 3L2RA 4B9TA 3A2FA 4B8CA 3NF9A 4FLXA 3E01A 1XWLA 3PUFA 2BANA 2X6SA 4KO0A 4I9LA 4CJ4A 1RBSA 4J2AA 2YHBA 1A5XA 3U3GA 3QETA 3AA2A 3TWHA 5HP1A 2G8WA 4FJGA 2P51A 3DLHA 2KTQA 5DMRA 3HVTA 4HUGA 4KREA 4DTRA 1JL2A 3ZT1A 2D5RA 4B9VA 4CF9A 1WAFA 4PQUA 4E7LA 3OYNA 3LDSA 5I3UA 2BGGA 4W5RA 4BE0A 4EZ6A 4M3TA 1HYVA 2XY7A 1TK5A 1X9SA 4KAZA 4RW7A 1EX4A 2RPIA 3FFIA 5HBMA 3ZSRA 4ELVA 4M3WA 4CEQA 4CK3A 2Z1JA 3CM6A 5T7BA 3ZSVA 3KJVA 1VSLA 4CJLA 4DLEA 4DU3A 4NCAA 3SUPA 3VN5A 5FRNA 5J2PA 3HYFA 4CHNA 4E7HA 1ITGA 4M3YA 4CGJA 4ICLA 1KCFA 1YVUA 1RDCA 2GV9A 1UWBA 4I2PA 4EP5A 4BDYA 1D9DA 1VSIA 4KI4A 2YNFA 3HK2A 3O4NA 4ZTFA 3PO4A 3HPGA 3O3HA 3QNNA 1RCHA 3AO2A 4CJQA 4HHTA 3MEDA 3TAMA 5J2QA 4W5NA 3HT3A 2HNYA 5KI6A 2IAJA 3WNHA 3TR8A 1BI4B 2KFNA 1BIUA 3ISNC 2XO7A 1VSHA 2DFFA 3NCIA 4CJTA 3OS0A 4KPYA 3K59A 4H4OA 4N56A 3LWMA 1IO2A 2XRIA 3PX4A 3RTVA 3HVRA 2XY6A 1QS4A 4CGDA 2OA8A 1DLOA 1BIZA 1HPZA 4CEZA 1U4BA 2OZSA 4FZXC 1GOAA 4B9SA 3B6PA 3I0SA 4DWIA 4N41A 2BE2A 3NFAA 4BDZA 4OJRA 3RRHA 3JSMA 3K5LA 3KK2A 4QAGA 1SKWA 4JS5A 4CECA 1HYSA 1BQMA 3AVNA 4CK1A 1DTQA 1KTQA 1YTUA 1X9WA 1BCMA 4E89A 4N5SA 3AA3A 3RRGA 1MU2A 4JRPA 2EHGA 3ITHA 2G8HA 4FCYA 1JLAA 1HRHA 2G8KA 3LWLA 1CXQA 1RBTA 4B3OA 3AVMA 4CGFA 1HJRA 4OKEA 4YNQA 1WAJA 3ZSOA 4CFDA 3SPYA 3L8BA 4DFMA 2OZMA 1Q8IA 3SUNA 5KGWA 2X78A 4CEEA 4C8OA 4DMNA 4CIGA 3IG1A 4M3ZA 5D3GA 4KHYA 4Z4IA 1A5VA 1NK4A 4CEOA 4I9QA 4F4KA 3RMBA 2ITGA 1KSPA 1HQUA 1FXXA 1JLQA 1S1UA 2E6MA 3M8SA 3IRXA 3LP1A 1RT4A 3C6UA 1B9DA 3RMAA 2O4IA 2EX3A 1JKHA 2FBVA 3LANA 3LPUA 3OYHA 3CM5A 1QSYA 1XC9A 4PWDA 3L3VA 3NAEA 2DFEA 1C1CA 3OYBA 3K57A 3PO5A 1VSEA 1JXBA 1QE1A 4FVMA 4BACA 1BGXT 2FBTA 1SL0A 4AH9A 4DTSA 2D0AA 2VG6A 4DTPA 4CJ5A 2YKNA 4DU1A 3DLKA 3TAPA 3S3OA 1L3TA 1QHTA 2ZE2A 3ZT2A 2OPQA 3QO9A 2XY8A 4N47A 3KLGA 4E7JA 3THVA 4AHVA 1TKDA 4CJVA 4JLHA 4CIFA 4FJXA 1T8EA 1U04A 4MFBA 1VRTA 1NJZA 5CYQA 3SJJA 3AVJA 3AO1A 3AVIA 1GOCA 4H8KA 3VQ6A 4CGHA 2Y1JA 4LY7A 4GMJB 3KKSA 4EP4A 4FZYA 4FXDA 3HP6A 4Z4EA 4HVJA 4FYDA 1RT7A 3PX6A 3OYGA 1IKYA 1C0MA 1RILA 4F2RA 1LAWA 2E4LA 3L2QA 4AHUA 2Z1HA 4AHTA 3VA0A 3ZSXA 1S1WA 4IBNA 4XIUA 3OYAA 4FJ7A 4CGGA 3EY1A 2PYLA 3AVCA 4KTZA 1KFSA 3MXMA 3DLGA 1C6VA 3CG7A 4B8AB 1KLNA 3M8QA 4G1QA 5HRRA 3KK3A 4JS4A 4HUFA 4J2DA 3HP9A 4C8LA 4CJFA 2YHAA 3RR7A 2ATQA 4RW4A 1KVCA 4DS4A 2OYQA 4CCHA 5SZTA 4AILC 3DOKA 3VQ9A 3ZSQA 2HHSA 2Z1IA 4DQPA 2DTUA 3NF6A 2JLEA 4KFBA 1IH7A 5E41A 1L3SA 4F8RA 1LAVA 4O4GA 3K5NA 5KTQA 1HQEA 1UOCA 1J54A 1Q9XA 4DSJA 3OYFA 1FK9A 4K8XA 3PX0A 3SUQA 1TK8A 1Q9YA 1CXUA 3VQPA 1KFDA 4NYFA 3LP2A 2A1RA 4FJLA 4DSLA 3AVBA 3SPZA 1HMVA 1SKSA 2VG7A 1XI1A 3KD1E 1NOYA 3PY8A 4KB1A 4E19A 4GW6A 1WSIA 4CHQA 3B6OA 3VQQA 4DQRA 4BDPA 3K58A 4FJKA 1S9EA 3V9WA 2HNDA 4FLUA 3AVFA 4CF0A 1VSFA 1WSHA 2YV0X 4CEDA 4DSEA 1NK7A 5KGXA 4DFPA 4PUOA 4B9MA 3SI6A 2IGIA 2X74A 4CJRA 1L3VA 4N76A 2W42A 2QK9A 4CF8A 4CEAA 2P5GA 2ZQBA 2B5JA 3C95A 4DQSA 5CYMA 5HLFA 2HHTA 1CZ9A 4CERA 1HYZA 1IKVA 4DTJA 1S9GA 3VQ5A 1I3AA 2X6NA 3CFRA 1XHZA 4LD0A 4DG1A 4F2SA 4KRFA 5CY4A 3JYTA 1NKBA 1SKRA 1C1AA 1GOBA 4LSNA 4OPKA 3OYMA 4KHUA 3SZ2A 4FLWA 4DSKA 3C94A 3HPOA 3AVLA 4IDKA 4KHWA 4DTMA 3QERA 2KZMA 4Q0BA 3VA3A 1KLMA 3HO1A 3V9UA 4ELTA 4I7FA 3S3MA 4E0DA 4E3SA 1BQNA 2Q3SA 5HROA 1G15A 4DS5A 3U6FA 2ETJA 2VG5A 5HRSA 4FW1A 4BE2A 4IFVA 4OKKA 4HUEA 4RW9A 3SQ0A 3V9SA 1UA1A 1NJWA 3LZIA 1TL3A 4GVMA 4NCGA 3WNEA 3OYIA 3O3FA 2QKKA 4Z0UA 1N6QA 1ZBHA 3DRPA 2VWKA 2KFZA 3EZ5A 3OJSA 3C6TA 4PA1A 3SUOA 4FLZA 1B9FA 1YTAA 3SQ2A 3K2PA 2HMIA 1JXEA 3TARA 3KK1A 4ZTJA 3OY9A 4OGCA 2FC0A 4DU4A 2BDPA 1LW2A 1FKOA 1WNSA 1RBUA 1S6PA 4UQGA 3QESA 4WE1A 4E7IA 1JLBA 3DLRA 4CF1A 3RMCA 3KIOA 2RF2A 3SYZA 2DFHA 4DQQA 4YFUA 4C8MA 4DTXA 1J53A 3IAYA 1Z26A 4EZ9A 3NH0A 4OLBA 2P5OA 2HHQA 4DSFA 2IC3A 3NGZA 1L3UA 3QLHA 1RTDA 3V6DA 4OLAA 4NCBA 3BGRA 1LWCA 3OVNA 4ELUA 1WN7A 4HTUA 3S3NA 3QIOA 2GUIA 1WSFA 2ZD1A 3ALYA 1TAUA 3MXJA 3VQEA 4H4MA 3EYZA 4AHCA 1QSLA 1WSEA 1U45A 2HHVA 4FLYA 2RN2A 3ZSZA 3VQAA 3NDKA 3LALA 1S1TA 4Y1CA 2F8TA 2PZSA 3AVGA 2HHXA 3DLEA 4Y1DA 2G8IA 3ZSYA 4B9NA 3KLHA 4R5PA 3HL8A 3OS1A 4DQIA 4F3TA 1N5YA 2B4JA 3CQ8A 4CK2A 4LH5A 2F96A 4DF4A 4KHNA 4KHSA 4M3XA 1EXQA 4FM1A 3D0PA 1NOZA 3LP0A 4O5BA 4FLTA 2PYJA 4DSIA 1VSMA 1Z25A 3TAGA 3V1OA 2NUBA 1ZBIA 1T03A 1F21A 1IKWA 1S6QA 3KLEA 4KTQA 3AV9A 1UA0A 3OYKA 4FW2A 2JGUA 1BISA 3P5JA 5I42A 2IOCA 4CESA 4L8RB 4IG0A 4M42A 2QKBA 2F8SA 1SL1A 1TK0A 2LSNA 4CJEA 3WNFA 5HRNA 3VQ8A 1S1VA 1YT3A 4J2EA 4LSLA 1VSJA 3SNNA 1R0AA 4ZHRA 2KW4A 1IG9A 3MEGA 4CEFA 4FJ5A 3G10A 3VQ7A 3T3FA 4IKFA 4Z4GA 2OPRA 2P1JA 1BL3A 3ZCMA 3AVKA 4CJPA 4CJKA 3OYCA 1CLQA 1WSGA 2RKIA 3QIPA 3VQ4A 2YNIA 3HM9A 2HB5A 4O55A 5KRTA 2IDOA 4F3OA 3NE6A 4FZZA 3OYDA 1JLCA 3DYAA 1FKPA 2DY4A 1BCOA 3AO3A 3O4QA 1RTHA 1RDDA 2OPSA 3NGYA 3OYJA 5J2MA 4DTOA 4RW6A 3AVAA 3CFOA 2VWJA 3RR8A 4B9UA 1K6YA 3QNOA 1S1XA 2D0BA 3KLFA 2OPPA 2KZZA 3AO4A 3L3UA 1T7PA 1RT2A 3IS9A 3OJUA 3QEIA 1ZYQA 2HHWA 4CFCA 1QSSA 5JS2A 1BI4A 1KRPA 1SL2A 3NBPA 4DLGA 3BDPA 1HNVA 1RT1A 5FDLA 4BWMA 3ZT4A 3PV8A 4OGEA 1D8YA 3HXMA 1RT5A 3TANA 1TKZA 4BWJA 3LZJA 4W5TA 1NKEA 3LPTA 1LV5A 3NF8A 3DLBA 3DOLA 3VQDA 4FJJA 4O0IA 1RTIA 4CJ3A 1IKXA 2HW3A 1ZBUA 3NGIA 1WLJA 1TL1A 4J2BA 3QEWA 1NJYA 3AO5A 3AA5X 1LWFA 2E6LA 2G8UA 5C25A 3DM2A 5CZ1A 1JL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT0 A;  4NYN A;  3HJF A;  3F73 A;  3L2W A;  1J5O A;  2YKM A;  1NK6 A;  4CJW A;  4FK2 A;  1O1W A;  3QEP A;  3TAQ A;  5C24 A;  1RT3 A;  4KTW A;  4OPJ A;  2A1S A;  1VK0 A;  3LAK A;  1SUQ A;  2HNZ A;  3WNG A;  4FJ9 A;  3I0R A;  3TI0 A;  4CE9 A;  3QIN A;  1RDB A;  3H08 A;  3CFP A;  1A5W A;  1W0H A;  4B08 A;  4KI6 A;  1D5A A;  3QEX A;  3HPH A;  4O0J A;  4OVL A;  4DFJ A;  5J1E A;  1I39 A;  1TKT A;  2GBZ A;  5C42 A;  4CJS A;  5EU7 A;  1JLE A;  2IS3 A;  3G0Z A;  3KLI A;  1ASV A;  2R7Y A;  4CIE A;  4FM0 A;  1TGO A;  3AVH A;  4Q5V A;  4CFB A;  3V1Q A;  1UAX A;  1QQC A;  4FJN A;  4FJ8 A;  3DI6 A;  1TV6 A;  4CEB A;  4ID5 A;  1W9H A;  4BE1 A;  1NKC A;  2HVI A;  2FBX A;  2PY5 A;  3V9Z A;  3TAB A;  3S9H A;  1NJX A;  4HCB A;  4KHQ A;  1NK8 A;  3ASM A;  1BHL A;  3NF7 A;  4CHP A;  1HNI A;  5KRS A;  4JRQ A;  4FM2 A;  3T1A A;  4ID1 A;  2WOM A;  4E7K A;  4QOZ B;  1EET A;  4CHZ A;  4RG8 A;  1LWE A;  4W5Q A;  3NHG A;  3MEC A;  1L5U A;  3RMD A;  1NK9 A;  3F9K A;  3I8D A;  3L2V A;  3RWU A;  3DMJ A;  4CJU A;  3OS2 A;  2Y1I A;  1ASW A;  3KKR A;  1D9F A;  1CZB A;  3V1R A;  4B9L A;  4CHO A;  2B6A A;  3SV4 A;  4I2Q A;  2QXF A;  4FJH A;  4LH4 A;  4CGI A;  3M8P A;  4Z4C A;  3ULD A;  3QEV A;  4Z4F A;  3OYL A;  1RNH A;  4CHY A;  4M3U A;  1LW0 A;  3NH1 A;  3P83 D;  4DTN A;  4K8Z A;  3P1G A;  5DK5 A;  2HHU A;  1QTM A;  4M3R A;  3K5M A;  1J9A A;  1DTT A;  2YNG A;  3SCX A;  1C1B A;  3MAQ A;  4AHR A;  4FJI A;  4DTU A;  1C0T A;  1NK5 A;  4KV8 A;  1KVA A;  3SQ1 A;  1RT6 A;  1JLG A;  1Y97 A;  4FK0 A;  1WSJ A;  1X1P A;  3SQ4 A;  5HRP A;  4E1M A;  2KQ2 A;  4Z4H A;  3NH2 A;  2Z1G A;  1XHX A;  1RBV A;  4AHS A;  1T05 A;  3V4I A;  3ZT3 A;  4PY5 A;  3HST B;  1ASU A;  1TAQ A;  3VQC A;  4MQ3 A;  1JLF A;  4C8K A;  3D45 A;  1VRU A;  2XY5 A;  2AJQ A;  4RW8 A;  1KVB A;  4FJM A;  4QCL A;  3LP3 A;  4IG3 A;  1B92 A;  1S5J A;  3O3G A;  3AA4 A;  3VQB A;  1U47 A;  3CYM A;  5K14 A;  3MXI A;  4E1N A;  4CFA A;  5J2N A;  1RDA A;  1C0U A;  3K5O A;  4FK4 A;  3ZSW A;  5SWM A;  1SV5 A;  1TKX A;  3T19 A;  4W5O A;  3M8R A;  2XHB A;  1ZBF A;  2WON A;  4O44 A;  1VSD A;  4CF2 A;  1U49 A;  1X9M A;  2G8F A;  3DRR A;  3KD5 E;  2O4G A;  3U3Y A;  5CZ2 A;  1TVR A;  2I5J A;  4TSX A;  3V81 A;  3TAE A;  3UIQ A;  3V9X A;  3SV3 A;  2YNH A;  4M45 A;  4DF8 A;  1EP4 A;  4IFY A;  3MEE A;  5JS1 A;  3DRS A;  3LAM A;  1REV A;  1VSK A;  2D0C A;  1RBR A;  4M41 A;  4KKO A;  3OYE A;  3KTQ A;  3TAF A;  1ZBL A;  5FRO A;  1NK0 A;  4KB0 A;  4DFK A;  2G8V A;  3L2U A;  5FRM A;  2HVH A;  4HCC A;  1EKE A;  4C8N A;  4OKJ A;  4FLV A;  2FBY A;  1U48 A;  1RTJ A;  3L2R A;  4B9T A;  3A2F A;  4B8C A;  3NF9 A;  4FLX A;  3E01 A;  1XWL A;  3PUF A;  2BAN A;  2X6S A;  4KO0 A;  4I9L A;  4CJ4 A;  1RBS A;  4J2A A;  2YHB A;  1A5X A;  3U3G A;  3QET A;  3AA2 A;  3TWH A;  5HP1 A;  2G8W A;  4FJG A;  2P51 A;  3DLH A;  2KTQ A;  5DMR A;  3HVT A;  4HUG A;  4KRE A;  4DTR A;  1JL2 A;  3ZT1 A;  2D5R A;  4B9V A;  4CF9 A;  1WAF A;  4PQU A;  4E7L A;  3OYN A;  3LDS A;  5I3U A;  2BGG A;  4W5R A;  4BE0 A;  4EZ6 A;  4M3T A;  1HYV A;  2XY7 A;  1TK5 A;  1X9S A;  4KAZ A;  4RW7 A;  1EX4 A;  2RPI A;  3FFI A;  5HBM A;  3ZSR A;  4ELV A;  4M3W A;  4CEQ A;  4CK3 A;  2Z1J A;  3CM6 A;  5T7B A;  3ZSV A;  3KJV A;  1VSL A;  4CJL A;  4DLE A;  4DU3 A;  4NCA A;  3SUP A;  3VN5 A;  5FRN A;  5J2P A;  3HYF A;  4CHN A;  4E7H A;  1ITG A;  4M3Y A;  4CGJ A;  4ICL A;  1KCF A;  1YVU A;  1RDC A;  2GV9 A;  1UWB A;  4I2P A;  4EP5 A;  4BDY A;  1D9D A;  1VSI A;  4KI4 A;  2YNF A;  3HK2 A;  3O4N A;  4ZTF A;  3PO4 A;  3HPG A;  3O3H A;  3QNN A;  1RCH A;  3AO2 A;  4CJQ A;  4HHT A;  3MED A;  3TAM A;  5J2Q A;  4W5N A;  3HT3 A;  2HNY A;  5KI6 A;  2IAJ A;  3WNH A;  3TR8 A;  1BI4 B;  2KFN A;  1BIU A;  3ISN C;  2XO7 A;  1VSH A;  2DFF A;  3NCI A;  4CJT A;  3OS0 A;  4KPY A;  3K59 A;  4H4O A;  4N56 A;  3LWM A;  1IO2 A;  2XRI A;  3PX4 A;  3RTV A;  3HVR A;  2XY6 A;  1QS4 A;  4CGD A;  2OA8 A;  1DLO A;  1BIZ A;  1HPZ A;  4CEZ A;  1U4B A;  2OZS A;  4FZX C;  1GOA A;  4B9S A;  3B6P A;  3I0S A;  4DWI A;  4N41 A;  2BE2 A;  3NFA A;  4BDZ A;  4OJR A;  3RRH A;  3JSM A;  3K5L A;  3KK2 A;  4QAG A;  1SKW A;  4JS5 A;  4CEC A;  1HYS A;  1BQM A;  3AVN A;  4CK1 A;  1DTQ A;  1KTQ A;  1YTU A;  1X9W A;  1BCM A;  4E89 A;  4N5S A;  3AA3 A;  3RRG A;  1MU2 A;  4JRP A;  2EHG A;  3ITH A;  2G8H A;  4FCY A;  1JLA A;  1HRH A;  2G8K A;  3LWL A;  1CXQ A;  1RBT A;  4B3O A;  3AVM A;  4CGF A;  1HJR A;  4OKE A;  4YNQ A;  1WAJ A;  3ZSO A;  4CFD A;  3SPY A;  3L8B A;  4DFM A;  2OZM A;  1Q8I A;  3SUN A;  5KGW A;  2X78 A;  4CEE A;  4C8O A;  4DMN A;  4CIG A;  3IG1 A;  4M3Z A;  5D3G A;  4KHY A;  4Z4I A;  1A5V A;  1NK4 A;  4CEO A;  4I9Q A;  4F4K A;  3RMB A;  2ITG A;  1KSP A;  1HQU A;  1FXX A;  1JLQ A;  1S1U A;  2E6M A;  3M8S A;  3IRX A;  3LP1 A;  1RT4 A;  3C6U A;  1B9D A;  3RMA A;  2O4I A;  2EX3 A;  1JKH A;  2FBV A;  3LAN A;  3LPU A;  3OYH A;  3CM5 A;  1QSY A;  1XC9 A;  4PWD A;  3L3V A;  3NAE A;  2DFE A;  1C1C A;  3OYB A;  3K57 A;  3PO5 A;  1VSE A;  1JXB A;  1QE1 A;  4FVM A;  4BAC A;  1BGX T;  2FBT A;  1SL0 A;  4AH9 A;  4DTS A;  2D0A A;  2VG6 A;  4DTP A;  4CJ5 A;  2YKN A;  4DU1 A;  3DLK A;  3TAP A;  3S3O A;  1L3T A;  1QHT A;  2ZE2 A;  3ZT2 A;  2OPQ A;  3QO9 A;  2XY8 A;  4N47 A;  3KLG A;  4E7J A;  3THV A;  4AHV A;  1TKD A;  4CJV A;  4JLH A;  4CIF A;  4FJX A;  1T8E A;  1U04 A;  4MFB A;  1VRT A;  1NJZ A;  5CYQ A;  3SJJ A;  3AVJ A;  3AO1 A;  3AVI A;  1GOC A;  4H8K A;  3VQ6 A;  4CGH A;  2Y1J A;  4LY7 A;  4GMJ B;  3KKS A;  4EP4 A;  4FZY A;  4FXD A;  3HP6 A;  4Z4E A;  4HVJ A;  4FYD A;  1RT7 A;  3PX6 A;  3OYG A;  1IKY A;  1C0M A;  1RIL A;  4F2R A;  1LAW A;  2E4L A;  3L2Q A;  4AHU A;  2Z1H A;  4AHT A;  3VA0 A;  3ZSX A;  1S1W A;  4IBN A;  4XIU A;  3OYA A;  4FJ7 A;  4CGG A;  3EY1 A;  2PYL A;  3AVC A;  4KTZ A;  1KFS A;  3MXM A;  3DLG A;  1C6V A;  3CG7 A;  4B8A B;  1KLN A;  3M8Q A;  4G1Q A;  5HRR A;  3KK3 A;  4JS4 A;  4HUF A;  4J2D A;  3HP9 A;  4C8L A;  4CJF A;  2YHA A;  3RR7 A;  2ATQ A;  4RW4 A;  1KVC A;  4DS4 A;  2OYQ A;  4CCH A;  5SZT A;  4AIL C;  3DOK A;  3VQ9 A;  3ZSQ A;  2HHS A;  2Z1I A;  4DQP A;  2DTU A;  3NF6 A;  2JLE A;  4KFB A;  1IH7 A;  5E41 A;  1L3S A;  4F8R A;  1LAV A;  4O4G A;  3K5N A;  5KTQ A;  1HQE A;  1UOC A;  1J54 A;  1Q9X A;  4DSJ A;  3OYF A;  1FK9 A;  4K8X A;  3PX0 A;  3SUQ A;  1TK8 A;  1Q9Y A;  1CXU A;  3VQP A;  1KFD A;  4NYF A;  3LP2 A;  2A1R A;  4FJL A;  4DSL A;  3AVB A;  3SPZ A;  1HMV A;  1SKS A;  2VG7 A;  1XI1 A;  3KD1 E;  1NOY A;  3PY8 A;  4KB1 A;  4E19 A;  4GW6 A;  1WSI A;  4CHQ A;  3B6O A;  3VQQ A;  4DQR A;  4BDP A;  3K58 A;  4FJK A;  1S9E A;  3V9W A;  2HND A;  4FLU A;  3AVF A;  4CF0 A;  1VSF A;  1WSH A;  2YV0 X;  4CED A;  4DSE A;  1NK7 A;  5KGX A;  4DFP A;  4PUO A;  4B9M A;  3SI6 A;  2IGI A;  2X74 A;  4CJR A;  1L3V A;  4N76 A;  2W42 A;  2QK9 A;  4CF8 A;  4CEA A;  2P5G A;  2ZQB A;  2B5J A;  3C95 A;  4DQS A;  5CYM A;  5HLF A;  2HHT A;  1CZ9 A;  4CER A;  1HYZ A;  1IKV A;  4DTJ A;  1S9G A;  3VQ5 A;  1I3A A;  2X6N A;  3CFR A;  1XHZ A;  4LD0 A;  4DG1 A;  4F2S A;  4KRF A;  5CY4 A;  3JYT A;  1NKB A;  1SKR A;  1C1A A;  1GOB A;  4LSN A;  4OPK A;  3OYM A;  4KHU A;  3SZ2 A;  4FLW A;  4DSK A;  3C94 A;  3HPO A;  3AVL A;  4IDK A;  4KHW A;  4DTM A;  3QER A;  2KZM A;  4Q0B A;  3VA3 A;  1KLM A;  3HO1 A;  3V9U A;  4ELT A;  4I7F A;  3S3M A;  4E0D A;  4E3S A;  1BQN A;  2Q3S A;  5HRO A;  1G15 A;  4DS5 A;  3U6F A;  2ETJ A;  2VG5 A;  5HRS A;  4FW1 A;  4BE2 A;  4IFV A;  4OKK A;  4HUE A;  4RW9 A;  3SQ0 A;  3V9S A;  1UA1 A;  1NJW A;  3LZI A;  1TL3 A;  4GVM A;  4NCG A;  3WNE A;  3OYI A;  3O3F A;  2QKK A;  4Z0U A;  1N6Q A;  1ZBH A;  3DRP A;  2VWK A;  2KFZ A;  3EZ5 A;  3OJS A;  3C6T A;  4PA1 A;  3SUO A;  4FLZ A;  1B9F A;  1YTA A;  3SQ2 A;  3K2P A;  2HMI A;  1JXE A;  3TAR A;  3KK1 A;  4ZTJ A;  3OY9 A;  4OGC A;  2FC0 A;  4DU4 A;  2BDP A;  1LW2 A;  1FKO A;  1WNS A;  1RBU A;  1S6P A;  4UQG A;  3QES A;  4WE1 A;  4E7I A;  1JLB A;  3DLR A;  4CF1 A;  3RMC A;  3KIO A;  2RF2 A;  3SYZ A;  2DFH A;  4DQQ A;  4YFU A;  4C8M A;  4DTX A;  1J53 A;  3IAY A;  1Z26 A;  4EZ9 A;  3NH0 A;  4OLB A;  2P5O A;  2HHQ A;  4DSF A;  2IC3 A;  3NGZ A;  1L3U A;  3QLH A;  1RTD A;  3V6D A;  4OLA A;  4NCB A;  3BGR A;  1LWC A;  3OVN A;  4ELU A;  1WN7 A;  4HTU A;  3S3N A;  3QIO A;  2GUI A;  1WSF A;  2ZD1 A;  3ALY A;  1TAU A;  3MXJ A;  3VQE A;  4H4M A;  3EYZ A;  4AHC A;  1QSL A;  1WSE A;  1U45 A;  2HHV A;  4FLY A;  2RN2 A;  3ZSZ A;  3VQA A;  3NDK A;  3LAL A;  1S1T A;  4Y1C A;  2F8T A;  2PZS A;  3AVG A;  2HHX A;  3DLE A;  4Y1D A;  2G8I A;  3ZSY A;  4B9N A;  3KLH A;  4R5P A;  3HL8 A;  3OS1 A;  4DQI A;  4F3T A;  1N5Y A;  2B4J A;  3CQ8 A;  4CK2 A;  4LH5 A;  2F96 A;  4DF4 A;  4KHN A;  4KHS A;  4M3X A;  1EXQ A;  4FM1 A;  3D0P A;  1NOZ A;  3LP0 A;  4O5B A;  4FLT A;  2PYJ A;  4DSI A;  1VSM A;  1Z25 A;  3TAG A;  3V1O A;  2NUB A;  1ZBI A;  1T03 A;  1F21 A;  1IKW A;  1S6Q A;  3KLE A;  4KTQ A;  3AV9 A;  1UA0 A;  3OYK A;  4FW2 A;  2JGU A;  1BIS A;  3P5J A;  5I42 A;  2IOC A;  4CES A;  4L8R B;  4IG0 A;  4M42 A;  2QKB A;  2F8S A;  1SL1 A;  1TK0 A;  2LSN A;  4CJE A;  3WNF A;  5HRN A;  3VQ8 A;  1S1V A;  1YT3 A;  4J2E A;  4LSL A;  1VSJ A;  3SNN A;  1R0A A;  4ZHR A;  2KW4 A;  1IG9 A;  3MEG A;  4CEF A;  4FJ5 A;  3G10 A;  3VQ7 A;  3T3F A;  4IKF A;  4Z4G A;  2OPR A;  2P1J A;  1BL3 A;  3ZCM A;  3AVK A;  4CJP A;  4CJK A;  3OYC A;  1CLQ A;  1WSG A;  2RKI A;  3QIP A;  3VQ4 A;  2YNI A;  3HM9 A;  2HB5 A;  4O55 A;  5KRT A;  2IDO A;  4F3O A;  3NE6 A;  4FZZ A;  3OYD A;  1JLC A;  3DYA A;  1FKP A;  2DY4 A;  1BCO A;  3AO3 A;  3O4Q A;  1RTH A;  1RDD A;  2OPS A;  3NGY A;  3OYJ A;  5J2M A;  4DTO A;  4RW6 A;  3AVA A;  3CFO A;  2VWJ A;  3RR8 A;  4B9U A;  1K6Y A;  3QNO A;  1S1X A;  2D0B A;  3KLF A;  2OPP A;  2KZZ A;  3AO4 A;  3L3U A;  1T7P A;  1RT2 A;  3IS9 A;  3OJU A;  3QEI A;  1ZYQ A;  2HHW A;  4CFC A;  1QSS A;  5JS2 A;  1BI4 A;  1KRP A;  1SL2 A;  3NBP A;  4DLG A;  3BDP A;  1HNV A;  1RT1 A;  5FDL A;  4BWM A;  3ZT4 A;  3PV8 A;  4OGE A;  1D8Y A;  3HXM A;  1RT5 A;  3TAN A;  1TKZ A;  4BWJ A;  3LZJ A;  4W5T A;  1NKE A;  3LPT A;  1LV5 A;  3NF8 A;  3DLB A;  3DOL A;  3VQD A;  4FJJ A;  4O0I A;  1RTI A;  4CJ3 A;  1IKX A;  2HW3 A;  1ZBU A;  3NGI A;  1WLJ A;  1TL1 A;  4J2B A;  3QEW A;  1NJY A;  3AO5 A;  3AA5 X;  1LWF A;  2E6L A;  2G8U A;  5C25 A;  3DM2 A;  5CZ1 A;  1JL1 A; 
#chains in the Genus database with same CATH topology
 3ZT0 A;  3CJA A;  1NGH A;  2YKM A;  2QM1 A;  1O1W A;  4MLE A;  1GLE G;  3THW B;  4OPJ A;  4RWT A;  1SUQ A;  3TI0 A;  4DR4 K;  4KI6 A;  4WCE L;  1A5W A;  3HPH A;  3C6A A;  4O0J A;  2GBZ A;  4BRI A;  2UYT A;  1EO1 A;  5EU7 A;  2IS3 A;  3G0Z A;  1HKC A;  2GEL A;  4Y0W A;  4FM0 A;  1TGO A;  3AVH A;  3V1Q A;  1YHQ N;  1SZ2 A;  4JI0 K;  4BE1 A;  1NKC A;  3V9Z A;  2HF4 A;  3ZX2 A;  1NJX A;  4HCB A;  1HKG A;  1V4S A;  1EWR A;  3I55 N;  2WBN A;  5KRS A;  3SBT A;  4FM2 A;  4CHZ A;  4RG8 A;  1LWE A;  5HL7 L;  2O8C B;  3MEC A;  3RMD A;  3D2F B;  3RWU A;  3UKU B;  5JVH L;  1ASW A;  3V1R A;  1R59 O;  4LFB K;  3J7Y P;  2B6A A;  3SV4 A;  5ELZ A;  4ILH A;  3M8P A;  3FE1 A;  4YY3 K;  5BR9 A;  1ATS A;  3EKS A;  4IJA A;  2E2P A;  3U4L A;  3K5M A;  5AZI B;  1Y64 A;  4AHR A;  1KVA A;  3SQ1 A;  3HRG A;  3VPZ A;  3R6M A;  3TPQ A;  5FLX O;  1NBW A;  2KQ2 A;  4Z4H A;  1VAZ A;  3V4I A;  1JLF A;  2XY5 A;  3LP3 A;  1B92 A;  1S5J A;  3O3G A;  3AA4 A;  4EIA A;  4IOA L;  3ZSW A;  1TKX A;  4W5O A;  2KHO A;  2WON A;  4O44 A;  1X9M A;  3U3Y A;  2Q0U A;  1TYQ B;  3TAE A;  3V9X A;  3MEE A;  4M41 A;  3KTQ A;  2CGJ A;  1C0F A;  3HBT A;  1EKE A;  2FBY A;  4ISG A;  4B9T A;  3A2F A;  3NF9 A;  4FLX A;  1XWL A;  4I9L A;  4CJ4 A;  3VGK A;  1RBS A;  3CCV N;  5DMR A;  4YDU C;  3ZT1 A;  2D5R A;  3LDS A;  1VHX A;  1XMO K;  2BGG A;  3FZF A;  1HYV A;  2XY7 A;  2KLA A;  1BOT O;  2QWP A;  4BRA A;  4DV0 K;  2OTJ N;  1X9J A;  5AQF A;  5KPZ A;  4M3W A;  4WYB A;  2Z1J A;  3CM6 A;  5M1Q A;  4CJL A;  1E3M A;  4RCH A;  4NCA A;  1XC3 A;  3HYF A;  4M3Y A;  1RDC A;  3O1W A;  4BDY A;  4KI4 A;  3SAF A;  3HK2 A;  5C12 A;  3O3H A;  2P9P B;  1U2V B;  1RCH A;  5CR4 A;  4W5N A;  3J81 O;  4H0X B;  3HT3 A;  3VES A;  3WNH A;  1IBM K;  1BIU A;  2XO7 A;  1VSH A;  3NCI A;  4WFB L;  3LWM A;  4FSV A;  4PKG A;  4MLH A;  3D2F A;  1HPZ A;  3E1Y A;  3TU5 A;  4N41 A;  4B9S A;  1MA9 B;  2BE2 A;  3NFA A;  2A6A A;  4EFH A;  3KWI A;  4Z94 A;  4BRL A;  3JSM A;  4QAG A;  1BU6 O;  1BQM A;  4CK1 A;  1DTQ A;  1X9W A;  3SK3 A;  1HNW K;  1ATN A;  3VOV A;  4CW7 B;  2EHG A;  3E9P A;  3F2K A;  2G8K A;  3E9L A;  4CGF A;  5M1K A;  4OKE A;  4YNQ A;  1WAJ A;  4CFD A;  3MN5 A;  1Q7Y O;  1HPM A;  3TTC A;  4C8O A;  4CIG A;  4BR7 A;  3DXK B;  1A5V A;  3WQT A;  4CEO A;  3EEQ A;  2P9S B;  3IRX A;  5ADX H;  1QQN A;  2FBV A;  4WFA L;  3THY A;  2DFE A;  1C1C A;  3OYB A;  1JXB A;  2NNW A;  3F5T A;  2D0A A;  5JVG L;  4DU1 A;  3FR0 A;  4JI1 K;  1QHT A;  2ZE2 A;  3ZT2 A;  4H0P A;  3ATU A;  1TKD A;  1WUA A;  2E8A A;  1LCU A;  4H8K A;  4B3R K;  4O8K A;  3QFP A;  4FYD A;  1IKY A;  4F2R A;  2E4L A;  4B3T K;  4AHU A;  2ZJQ L;  2Z1H A;  3VA0 A;  4IBN A;  3DJC A;  2VCP A;  1M90 O;  4FWQ A;  1KFS A;  3M8Q A;  3A0I X;  5HRR A;  3R8E A;  4KH4 A;  1K8K A;  3K0S A;  4C8L A;  3RVC A;  1Q82 O;  4DS4 A;  4CCH A;  3DOK A;  3VQ9 A;  4MO5 A;  4DQP A;  4FPB A;  4K41 A;  4KFB A;  1IH7 A;  4F8R A;  1L3S A;  4WQ4 A;  3K5N A;  3CCM N;  4K8X A;  3SUQ A;  3AVB A;  2E88 A;  1HMV A;  3C0B A;  1SKS A;  1NOY A;  3MN7 A;  5LJV A;  1WSI A;  4BR4 A;  3H6E A;  3K58 A;  4FJK A;  3CJ7 A;  2HND A;  3GOI A;  4CED A;  4YOX A;  1NK7 A;  4DFP A;  4H0T B;  2QK9 A;  4CEA A;  5FPD A;  2ZQB A;  2B5J A;  3O08 A;  4IZ9 A;  5DM6 L;  4CER A;  1HYZ A;  1IKV A;  2ZJP L;  4F2S A;  4KRF A;  4LSN A;  4OPK A;  4O5F A;  4KHU A;  4FLW A;  3CET A;  2Q2R A;  1DEJ A;  3AVL A;  3H3O B;  5AQT A;  5ADX A;  1P90 A;  3V9U A;  4B1X B;  4I7F A;  1VQ8 N;  3SQ0 A;  4OKK A;  1UA1 A;  1TL3 A;  5E84 A;  3O3F A;  3DRP A;  2YJE A;  2KFZ A;  3EZ5 A;  3OJS A;  3C6T A;  4PA1 A;  3SUO A;  1B9F A;  1YTA A;  2IIR A;  2FC0 A;  4CZL A;  1LW2 A;  5AFU H;  5AQY A;  3QES A;  1VQO N;  1C0G A;  3VET A;  4CF1 A;  4B9Q A;  3SYZ A;  4K0K K;  3FZH A;  1Z26 A;  4DR5 K;  2P5O A;  4DSF A;  4YOT A;  2IC3 A;  2D0P A;  2NZT A;  3QLH A;  4CZE A;  3V6D A;  1TUU A;  3BGR A;  4JI3 K;  3OVN A;  1WN7 A;  3P31 A;  3WEE A;  1TAU A;  1W97 L;  3EYZ A;  2W6L A;  2HHV A;  3NDK A;  1IG8 A;  2F8T A;  4JKH A;  3DLE A;  4Y1D A;  2G8I A;  3ZSY A;  1Z6R A;  4R5P A;  3HL8 A;  4M7Y A;  5AJ3 K;  2P9S A;  1N5Y A;  4KHS A;  5C15 A;  4FM1 A;  3D0P A;  4FLT A;  2NRZ A;  3TAG A;  3IUC A;  4BR0 A;  4NO7 A;  1ZBI A;  1F21 A;  3KLE A;  4NXN K;  3T1Y K;  4KTQ A;  1YF5 L;  4FW2 A;  2JGU A;  5FPM A;  4H0Y B;  4CES A;  4DV4 K;  4DR2 K;  1TK0 A;  2LSN A;  5GAG P;  3I8B A;  3WNF A;  3VEO A;  3VQ8 A;  1VQ6 N;  1BO5 O;  1ZC6 A;  4CEF A;  3VQ7 A;  4IKF A;  3J8A A;  1CLQ A;  4CJP A;  1WSG A;  4BQZ A;  3HM9 A;  2HB5 A;  2IDO A;  4A2A A;  3NE6 A;  3OYD A;  2DY4 A;  2ZF5 O;  3NGY A;  4DTO A;  3CFO A;  4B9U A;  3D6R A;  1S1X A;  2W41 A;  3KLF A;  3OHR A;  4BGB A;  3IS9 A;  1ZYQ A;  2P9I B;  4PKI A;  2HHW A;  1OH6 A;  3A5M C;  4DLG A;  1QVF M;  4KH6 A;  1HNV A;  3BDP A;  5FDL A;  4BWM A;  4BRO A;  1D8Y A;  3TAN A;  1OH5 A;  4BWJ A;  5LJW A;  3GDQ A;  3MWP A;  4BR5 A;  5E26 A;  5C25 A;  5CZ1 A;  4NYN A;  1HUX A;  3CHW A;  1ZBS A;  3L2W A;  3E66 A;  1NK6 A;  3L0Q A;  3WXJ A;  5C24 A;  2A1S A;  3MN6 A;  3LAK A;  3WXK A;  2O8B B;  1RDB A;  3CFP A;  1D5A A;  3QEX A;  4QS7 A;  4OVL A;  1I39 A;  1TKT A;  5C42 A;  4M7X A;  4H5R A;  4ISE A;  3KLI A;  1ASV A;  1W7A A;  2QTD A;  2YX6 A;  4CFB A;  4NXM K;  3QIC A;  3SAH A;  4FJ8 A;  3DI6 A;  1QVG M;  3QDK A;  3T1H K;  2PY5 A;  2FF3 B;  3S9H A;  1YJW N;  3BF1 A;  4A5B A;  4DV7 K;  1YIT N;  1OKJ A;  3ASM A;  4CHP A;  4BRN A;  1HNI A;  2AA4 A;  4JRQ A;  3T1A A;  1YUW A;  3AAR A;  4H5T A;  5C0Y A;  2YCH A;  4W5Q A;  1L5U A;  1NK9 A;  2V51 B;  3DMJ A;  3OS2 A;  3O9Q A;  2NRR A;  1GLC G;  3VEW A;  3MDQ A;  4BRM A;  2ZM6 K;  4M3U A;  1KAX A;  4CHY A;  4K8Z A;  1GLL O;  3P1G A;  3GL1 A;  5DK5 A;  2HHU A;  1QTM A;  4B1U B;  1J9A A;  1DTT A;  4CZM A;  3N4P A;  3SCX A;  2QW9 A;  3IKM A;  3OBY A;  2A41 A;  4KV8 A;  3VGM A;  2UUA K;  4FK0 A;  1WSJ A;  4PL7 A;  4U67 L;  5HRP A;  3NH2 A;  1XHX A;  4OX9 K;  4JHD A;  4BRF A;  3U9D A;  3HST B;  1ASU A;  4MQ3 A;  4C8K A;  3D45 A;  2AJQ A;  2HBL A;  4FJM A;  4YOU A;  1GLB G;  1U47 A;  2V52 B;  1SV5 A;  3M8R A;  1ZBF A;  4MO4 A;  1VSD A;  2AP1 A;  4FL9 A;  4CF2 A;  1U49 A;  2WC9 A;  1TVR A;  4JD2 B;  4TSX A;  1ILY A;  2P9P A;  1EP4 A;  5JS1 A;  3VF4 A;  3THY B;  5FRO A;  1NK0 A;  1Q86 O;  1U6Z A;  4DFK A;  2HVH A;  5AQU A;  4HCC A;  4FLV A;  1DKG D;  1U48 A;  1RTJ A;  3D2E A;  3SAG A;  2YI1 A;  2X6S A;  3QET A;  4IJN A;  3TWH A;  5HP1 A;  2P9I A;  2KTQ A;  2P51 A;  4DV1 K;  3HVT A;  4HUG A;  1I94 K;  4KRE A;  1WAF A;  2F9W A;  4A5A A;  4YHH K;  1KD1 O;  4EZ6 A;  4CZI A;  1TK5 A;  3I56 N;  2RPI A;  5BRD A;  3ZSR A;  4GKK K;  4IEI A;  5AQP A;  4PKH A;  3B8A X;  1VSL A;  4DLE A;  4AQY K;  1NGE A;  1XNQ K;  4DV2 K;  5AZJ A;  3THX A;  4ICL A;  4I2P A;  4KH5 A;  2UXD K;  3R9P A;  3A5L C;  1BG3 A;  2YNF A;  3T7Z A;  3O4N A;  4ZTF A;  3QNN A;  2FXU A;  3AO2 A;  3HOS A;  4HHT A;  4H03 B;  5KPT A;  2YHX A;  1EWQ A;  5AQL A;  2HNY A;  1XQS C;  2IAJ A;  5KI6 A;  3TR8 A;  2KFN A;  2DFF A;  4CJT A;  3OS0 A;  4KPY A;  3CJ1 A;  3PX4 A;  3RTV A;  4CGD A;  2OA8 A;  1DLO A;  3E9O A;  4CEZ A;  4FZX C;  1Q18 A;  1GOA A;  2RE2 A;  3D2E B;  3G25 A;  3M3Z A;  4YOW A;  4BDZ A;  5A2Q O;  4JS5 A;  2ZJR L;  4E89 A;  4N5S A;  3AA3 A;  1HJO A;  3W3D A;  4GV3 A;  4K43 A;  4FCY A;  1T6D A;  1HRH A;  1J6Z A;  1RBT A;  3LDQ A;  1DT9 A;  3L8B A;  4DFM A;  2QWL A;  5KGW A;  2X78 A;  5AQW A;  2E1Z A;  3ENB A;  2QWO A;  2QXL A;  2CGL A;  1CZA N;  1G99 A;  3RMB A;  1KSP A;  4LF6 K;  1JLQ A;  4FOI A;  2VYP A;  2O4I A;  4WF9 L;  1NGB A;  1QSY A;  1O13 A;  2CGK A;  4CVN E;  2HST A;  4FVM A;  1BGX T;  2FBT A;  4DTS A;  3LDN A;  2YKN A;  3S3O A;  3DLK A;  1DGK N;  3N4Q A;  4N47 A;  3KLG A;  4AHV A;  3L6Q A;  4CIF A;  1T8E A;  4MFB A;  1VRT A;  3AO1 A;  3AVI A;  1GOC A;  2ZWH A;  3VQ6 A;  3KKS A;  4EP4 A;  1NGF A;  4FXD A;  4HVJ A;  1LOT B;  1X3N A;  3OYG A;  2VGN A;  4LC9 B;  1LAW A;  4BRH A;  1KC8 O;  2ZGZ A;  3T69 A;  3ZSX A;  1S1W A;  4BRE A;  3OYA A;  4FJ7 A;  4CGG A;  3M5R A;  2WTU A;  3DLG A;  3CD6 N;  3KVG A;  4BR9 A;  4JS4 A;  4YOR A;  4CJF A;  2YHA A;  3RR7 A;  2ATQ A;  3QBX A;  4C1N K;  1ATR A;  2ZGY A;  4H0O A;  3FZL A;  3ZSQ A;  2NRW A;  3NF6 A;  2HOE A;  5E41 A;  4O4G A;  1UOC A;  1Q9X A;  3OYF A;  5IWA K;  3PX0 A;  1TK8 A;  3LP2 A;  2A1R A;  3A5O C;  4DUZ K;  1VQM N;  4DSL A;  3KD1 E;  4KB1 A;  1FJG K;  4GW6 A;  4DB3 A;  3B6O A;  1VQL N;  3QFU A;  4CD1 A;  1S9E A;  3V9W A;  3AVF A;  3O1B A;  1VSF A;  2YV0 X;  5KGX A;  2W40 A;  2WUS A;  3SI6 A;  2IGI A;  4CJR A;  2QA4 N;  2BH1 A;  2W42 A;  2Q1N A;  3FLC O;  3C95 A;  5CYM A;  4JI2 K;  4CBX A;  1CZ9 A;  1ZXO A;  4DTJ A;  1I3A A;  1QZ6 A;  3CME N;  3LDP A;  3CFR A;  1XHZ A;  4DG1 A;  5CY4 A;  3JYT A;  1NKB A;  1NWK A;  3OYM A;  1KQS M;  5DM7 L;  2VQE K;  2OCE A;  4C1N I;  4U7B A;  3HPO A;  4DSK A;  3QER A;  4Q0B A;  3DXM B;  4E0D A;  4E3S A;  2Q3S A;  3O9U A;  4BE2 A;  4HUE A;  4RW9 A;  3PIP L;  1NJW A;  3ZX0 A;  3WNE A;  3OW2 M;  2QKK A;  3AAP A;  2GEM A;  1ZBH A;  1JCE A;  4EHT A;  3K2P A;  2FSJ A;  2YJF A;  3TAR A;  4ZTJ A;  1WNS A;  1RBU A;  4WE1 A;  4E7I A;  5BN8 A;  3BZK A;  3RMC A;  2DFH A;  3O4W A;  4DQQ A;  4CBU A;  4C8M A;  4DTX A;  1IBL K;  1SQK A;  4EZ9 A;  3TSQ A;  3K9J A;  5BPM A;  5M1N A;  1L3U A;  2UXC K;  1LWC A;  4ELU A;  1T6C A;  5BN9 A;  5M1P A;  3QIO A;  4MDA A;  3H1V X;  3Q7C A;  1MWK A;  3OTO K;  1XMQ K;  4FLY A;  1WBD A;  3LAL A;  3JS6 A;  2O8F A;  3AVG A;  2HHX A;  5BPL A;  4DQI A;  4LF5 K;  4FWR A;  1NGI A;  2B4J A;  1N34 K;  3A8Y A;  3CCU N;  4M3X A;  1EXQ A;  2A5X A;  3CJ9 A;  2PYJ A;  1Z25 A;  3GBT A;  4JI5 K;  2NUB A;  4NLB A;  1IKW A;  5C10 A;  5I42 A;  4A59 A;  1BIS A;  3P5J A;  4L8R B;  1NU0 A;  3EE8 A;  1SL1 A;  2F8S A;  3D7E O;  3RSE B;  3QML A;  1S1V A;  4WFN L;  4LSL A;  3SNN A;  1R0A A;  4ZHR A;  2KW4 A;  1VQ9 N;  5AQJ A;  5F2R A;  4GNI A;  4I6M A;  1OH7 A;  3QIP A;  4IOC L;  4BRC A;  4FZZ A;  3DXK A;  4F3O A;  3DYA A;  1BCO A;  3OYJ A;  1NNE A;  2VWJ A;  1J5E K;  1IBK K;  4UY8 O;  3JXU A;  4GV9 A;  3L3U A;  3OJU A;  4JKA A;  3LM9 A;  3QB0 A;  3VEX A;  1QSS A;  1BI4 A;  2IVN A;  3ZT4 A;  3CC2 N;  5GIO A;  2UUC K;  2GX9 A;  3LZJ A;  1YVN A;  4W5T A;  1V4T A;  1LV5 A;  2P9U B;  1IKX A;  3CXC M;  1WLJ A;  1TL1 A;  2BUP A;  2E6L A;  2G8U A;  1JL1 A;  3FZK A;  3F73 A;  3DLL L;  1J5O A;  4DR1 K;  3CF5 L;  4CJW A;  4JKC A;  3QEP A;  2P9K A;  3C7N B;  3HTV A;  4KTW A;  3K9K A;  1VK0 A;  2HNZ A;  3I0R A;  4I6M B;  3AAQ A;  1JCG A;  1WOQ A;  2P9N B;  4CE9 A;  1W0H A;  4B08 A;  4A2B A;  5JLH A;  1WBB A;  2JWK A;  1JLE A;  4R79 A;  5GAD P;  5EY4 A;  2R7Y A;  4CIE A;  3HSC A;  3CI5 A;  4IXC A;  2FLO A;  4Q5V A;  3CCR N;  3VTH A;  1UAX A;  1QQC A;  1K9M O;  3J7A P;  2Q31 A;  1E4G T;  4ID5 A;  1W9H A;  1GLF O;  3OBW A;  3HOT A;  2HBJ A;  5AQG A;  2FBX A;  2HVI A;  3ID6 A;  4H0V B;  3ZEU B;  4KHQ A;  3A5N C;  4DV6 K;  1NK8 A;  5GIN A;  4BRQ A;  4E7K A;  4ID1 A;  4QOZ B;  2QWM A;  4IO9 L;  3QBW A;  5LY3 A;  1MDU B;  3J80 O;  4CJU A;  2Y1I A;  3SMS A;  1D9F A;  4B9L A;  4BY9 C;  1OVY A;  4LH4 A;  3ULD A;  3CC4 N;  3CC7 N;  2NRV A;  3EKU A;  1LW0 A;  1JCF A;  4X65 K;  5AR0 A;  3P83 D;  4DTN A;  1VQ5 N;  2YNG A;  1C1B A;  4FJI A;  2NRT A;  1NK5 A;  1OVQ A;  1RT6 A;  1Y97 A;  4MDB A;  3JAM O;  3SQ4 A;  4DUY K;  2Z1G A;  4AHS A;  1T05 A;  3P38 A;  1XNR K;  3ZT3 A;  4PY5 A;  1TAQ A;  4BG8 A;  3VQC A;  2GWJ A;  1VRU A;  4PHT X;  3WXM B;  4RW8 A;  1KVB A;  4QCL A;  4IG3 A;  4ILG B;  3CYM A;  1C0U A;  1VQN N;  2E5L K;  2O8D B;  3MN9 A;  4FOE A;  4JI8 K;  5LMU K;  5BRE A;  2O4G A;  3VEV A;  4BQL A;  2I5J A;  3V81 A;  1N8R O;  3CCL N;  3UIQ A;  4HTL A;  3GE1 A;  3OYE A;  4B3S K;  1REV A;  1VSK A;  4KHY A;  1RBR A;  4KKO A;  3TAF A;  1ZBL A;  3TTF A;  2G8V A;  1RDW X;  3L2U A;  5FRM A;  4C8N A;  2RHK A;  3L2R A;  1TYQ A;  4RTF D;  3HI0 A;  2J4R A;  3PUF A;  4F9O A;  4KO0 A;  1E4F T;  4J2A A;  2YHB A;  5LL6 Z;  3AA2 A;  4KBO A;  3VGL A;  2ITM A;  3TTD A;  1JL2 A;  4DTR A;  4CF9 A;  4PQU A;  4X62 K;  2PFU A;  3OYN A;  2O8B A;  4IOX A;  4W5R A;  4BE0 A;  4M3T A;  5JIC A;  4KAZ A;  4YDU A;  3FFI A;  3ZX3 A;  4ELV A;  4FWK A;  4CEQ A;  2A40 A;  5T7B A;  3KJV A;  2QEX N;  3J7Z O;  4JKD A;  4O8U A;  4BRG A;  3SUP A;  5J2P A;  5TKW A;  4CHN A;  5BR8 K;  1KXP A;  1ITG A;  4E7H A;  1IV0 A;  4CGJ A;  1KCF A;  4EP5 A;  2GV9 A;  4BVO A;  3HZ6 A;  3PO4 A;  3HPG A;  4XH4 A;  3ZEU A;  4CJQ A;  5AQV A;  5AQZ A;  1QZ5 A;  1KAZ A;  4H4O A;  4N56 A;  4V19 S;  1IO2 A;  2XRI A;  3HVR A;  2CH5 A;  2XY6 A;  2OZS A;  1BIZ A;  4JAX A;  1YJN N;  1U2V A;  3U9Z A;  3RRH A;  4JYA K;  1N32 K;  2D1K A;  4JKB A;  3K5L A;  3KK2 A;  1H1V A;  4CEC A;  5H1S Q;  1BDG A;  4E1J A;  3ENH A;  4C23 A;  1KTQ A;  1OH8 A;  5KQ8 A;  2W6K A;  3RRG A;  4JRP A;  3ITH A;  2G8H A;  4M63 C;  3ATV A;  4CJ7 A;  1JLA A;  4KHP K;  4NLC A;  4B3O A;  3AVM A;  2QWN A;  3WXL A;  1T3V A;  4ILJ A;  2A42 A;  5EX5 A;  2OZM A;  1Q8I A;  4XH5 A;  4CEE A;  3ULE A;  4DMN A;  1S72 N;  4FO0 A;  3IG1 A;  4M3Z A;  5D3G A;  4Z4I A;  4EAH D;  3MK6 A;  3CCJ N;  2IVO A;  4JKF A;  1FXX A;  1S1U A;  3M8S A;  4BVP A;  5IT9 O;  1Z05 A;  4BR2 A;  3LPU A;  4GKJ K;  4PWD A;  1P8Z A;  3L3V A;  3NAE A;  3SBG A;  4DV5 K;  5C2D A;  1VSE A;  3O6W A;  4EHU A;  3WQU A;  1SL0 A;  4IWV A;  4AH9 A;  3TAP A;  2VG6 A;  4DTP A;  2I7N A;  3EN9 A;  1NMN A;  4WQ5 A;  1L3T A;  3QO9 A;  2I7P A;  2NRH A;  2XY8 A;  4E7J A;  3KHY A;  4JLH A;  5CHI A;  4FJX A;  1NJZ A;  5CYQ A;  3SJJ A;  3PIO L;  4GMJ B;  4DR3 K;  4FZY A;  1NGA A;  4Z4E A;  4IEE A;  3PX6 A;  1C0M A;  5AQK A;  4DR6 K;  1SAZ A;  3L2Q A;  3UE5 A;  4OO1 J;  3EY1 A;  3AVC A;  4KTZ A;  3W0L A;  4GV6 A;  4JI4 K;  5BPN A;  3O8M A;  4B8A B;  1KLN A;  3CPE A;  4HUF A;  3PLA A;  1KVC A;  5SZT A;  3O80 A;  4A61 A;  4FVU A;  5CE3 A;  1YI2 N;  3BEX A;  3BY5 A;  3CER A;  2O8E B;  4L3Q A;  1HQE A;  4DSJ A;  1FK9 A;  4JNE A;  2HHQ A;  3VQP A;  1KFD A;  4NYF A;  4CI6 A;  3SPZ A;  2VG7 A;  5EVZ A;  4JKE A;  1W2B M;  3SJH A;  1NLV A;  4CHQ A;  3WUH A;  3VQQ A;  4BDP A;  2P9L A;  3ENO A;  3THW A;  4GVE A;  1WSH A;  4PUO A;  4B9M A;  2X74 A;  1L3V A;  4N76 A;  2P5G A;  1NMD A;  4BC4 A;  4DQS A;  4FWL A;  4B1Y B;  4HWI A;  5F0X A;  1S9G A;  4H5N A;  2X6N A;  4DHY A;  1RGI A;  1C1A A;  1GOB A;  4BG9 A;  3SZ2 A;  3C94 A;  5M1F A;  4KHW A;  4DTM A;  2KZM A;  2FF6 A;  4DS5 A;  3U6F A;  5HRS A;  3SMP A;  4IFV A;  4H5W A;  5FPN A;  1K8A O;  1NG9 A;  4GVM A;  2ASP A;  3OYI A;  5AQM A;  3WXI A;  3CCS N;  1XUP O;  4Z0U A;  2VWK A;  3ZYY X;  4IDH A;  1VQK N;  3SQ2 A;  3KK7 A;  2UXB K;  1BWF O;  2HMI A;  3KZB A;  3OY9 A;  1FKO A;  4UQG A;  3DLR A;  3KIO A;  2RF2 A;  3DWL A;  2GUP A;  4DCH A;  3IAY A;  5AQS A;  5GIP A;  2P9U A;  4OLB A;  2A3Z A;  2GWK A;  4OLA A;  4LF7 K;  4NCB A;  4HTU A;  1GLJ O;  3ALY A;  2ZD1 A;  3MXJ A;  3VQE A;  2Q0R A;  1RDU A;  3VQA A;  2P9K B;  3LDO A;  2PZS A;  2O8E A;  5JLF A;  4IO8 A;  2E2Q A;  3KLH A;  4QS8 A;  4F3T A;  1QQM A;  4CK2 A;  3H45 C;  4LH5 A;  5BRF A;  1T44 A;  2YHY A;  2PBD A;  4KHN A;  3VEY A;  4OPH A;  3LP0 A;  5BRH A;  2ASM A;  4DSI A;  4LF8 K;  3NMU A;  3V1O A;  1VQ7 N;  1T03 A;  3AV9 A;  3Q7B A;  4JK8 A;  4IG0 A;  2QKB A;  3G6E N;  2HHH K;  3CJB A;  4CJE A;  2E20 A;  1YT3 A;  4JKG B;  4J2E A;  5AZI A;  1VSJ A;  3LM2 A;  1IG9 A;  3MEG A;  4BRD A;  1YIJ N;  2OPR A;  2P1J A;  4CJK A;  2EWS A;  3AVK A;  3S41 A;  3P39 A;  3UKR A;  3ZCM A;  2YNI A;  4CZH A;  3MX2 A;  4JK9 A;  1S3X A;  5KRT A;  4CBW A;  1QHA A;  5AQR A;  1FKP A;  1NJI O;  1HNZ K;  3NVM A;  3O4Q A;  1RDD A;  5J2M A;  2E1Y A;  3IFR A;  4RW6 A;  1NGJ A;  5AQI A;  2KZZ A;  3AO4 A;  1RT2 A;  4AF1 A;  3LDL A;  5KQD A;  3G71 N;  1NGD A;  3EL2 A;  1KRP A;  4DV3 K;  3PV8 A;  4OGE A;  3P4I A;  3O9R A;  2D0O A;  1TKZ A;  3DLB A;  3NF8 A;  3DOL A;  4CJ3 A;  2HW3 A;  3FGU A;  4J2B A;  3QEW A;  1LWF A;  4ISF A;  3HJF A;  3NVK A;  5I9E B;  4B1V A;  4FK2 A;  3VEN A;  3TAQ A;  3EE9 A;  1RT3 A;  4BRP A;  1BA1 A;  2YHW A;  3WNG A;  4FJ9 A;  4B1W B;  3QIN A;  3H08 A;  2E2O A;  1NM1 A;  4DFJ A;  4FWP A;  3L4I A;  5J1E A;  3EZW A;  4CJS A;  3CMA N;  3AGK A;  1D4X A;  3BZC A;  3VMF B;  2HBM A;  3L4Q A;  1JJ2 M;  2CH6 A;  4FJN A;  1TV6 A;  4CEB A;  3TAB A;  1BHL A;  3NF7 A;  2O8F B;  2WOM A;  1N33 K;  1EET A;  2O8D A;  1GLA G;  4OPA A;  1NGG A;  3NHG A;  3IDH A;  3F9K A;  3MCP A;  3I8D A;  3L2V A;  4K25 A;  1KAY A;  3KKR A;  1CZB A;  4CHO A;  3LL3 A;  4FJH A;  4I2Q A;  2QXF A;  4CGI A;  4Z4C A;  2QWR A;  3MX5 A;  3QEV A;  4Z4F A;  3OYL A;  1RNH A;  5KPR A;  2V7Z A;  3C6H A;  4YOY A;  3NH1 A;  4YOV A;  4M3R A;  2UU9 K;  3MAQ A;  2IVP A;  3PSF A;  5HOO A;  4DTU A;  1YJ9 N;  1C0T A;  3UKU A;  1ESV A;  3PSI A;  4JI7 K;  1JLG A;  1X1P A;  4XH1 A;  3BF3 A;  4E1M A;  5GAE P;  1RBV A;  1FW6 A;  4FWN A;  2Q36 A;  5EOY A;  3M1F A;  3VER A;  3HM8 A;  3VQB A;  3MXI A;  5K14 A;  4E1N A;  4CFA A;  5J2N A;  1RDA A;  3K5O A;  4FK4 A;  5SWM A;  3T19 A;  1HR0 K;  3ZLJ A;  2XHB A;  1MWM A;  4JKG A;  2G8F A;  4JHD B;  3DRR A;  3KD5 E;  4B1Z A;  3THX B;  5CZ2 A;  1GLD G;  4FWS A;  4DR7 K;  3SV3 A;  1HX1 A;  2YNH A;  4M45 A;  4DF8 A;  4IFY A;  3G4S N;  3DRS A;  3LAM A;  2D0C A;  1K8K B;  4KB0 A;  5B8H A;  5AQH A;  4OKJ A;  2UUB K;  4DQ8 A;  1X3M A;  4B8C A;  3E01 A;  2BAN A;  1BA0 A;  1A5X A;  3U3G A;  3ULE B;  2G8W A;  4FJG A;  1EQY A;  3DLH A;  4B9V A;  4DKW A;  4LFC K;  2ASO A;  4J8F A;  4E7L A;  5I3U A;  1YXQ A;  3CQX A;  2FSN A;  1X9S A;  4RW7 A;  1EX4 A;  3CCE N;  3FZM A;  5HBM A;  4G9Z A;  4CK3 A;  3CCQ N;  3IMX A;  3ZSV A;  4K42 A;  4DU3 A;  2HF3 A;  3CJC A;  5FRN A;  3VN5 A;  2FSK A;  2F7T A;  1YVU A;  1UWB A;  1S22 A;  1D9D A;  1VSI A;  4PL8 A;  5J2Q A;  3BP8 A;  3MED A;  3TAM A;  2VQF K;  2O8C A;  1BI4 B;  3ISN C;  3K59 A;  4BC5 A;  2P9L B;  1QS4 A;  4JN4 A;  3VEZ A;  1U4B A;  4J2D A;  4DWI A;  3B6P A;  3I0S A;  1WB9 A;  3AY9 A;  4OJR A;  4FWO A;  2V7Y A;  1SKW A;  1HYS A;  3AVN A;  4LF4 K;  1YTU A;  1BCM A;  1HKB A;  4JEP A;  4XEI A;  5LMN K;  1MU2 A;  2VGM A;  3BUZ B;  4AM7 A;  4LFA K;  2HMP A;  4BGA A;  3TSP A;  3LWL A;  1CXQ A;  3RSE A;  3VF2 A;  4WQ5 C;  1HJR A;  5AZJ B;  5M1O A;  2NRX A;  3C65 A;  3WEE B;  3ZSO A;  3SPY A;  2BTF A;  5MLC Q;  3SUN A;  2KKZ A;  2QWQ A;  3KWG A;  1VQ4 N;  1BUP A;  1NK4 A;  4I9Q A;  3MMV A;  4F4K A;  2ITG A;  1HQU A;  2E6M A;  3SLC A;  3LP1 A;  1RT4 A;  3C6U A;  1B9D A;  3RMA A;  2EX3 A;  1JKH A;  3LAN A;  5EXW A;  3TSU A;  5FPE A;  4LF9 K;  4NB4 A;  3OYH A;  3CM5 A;  1XC9 A;  3DAW A;  3K57 A;  3PO5 A;  2P9N A;  1QE1 A;  2D4W A;  4BAC A;  5GAH P;  1NGC A;  4CJ5 A;  3R1X A;  4AM6 A;  2OPQ A;  3THV A;  4FPA A;  4CJV A;  1U04 A;  4B3M K;  3AVJ A;  1HNX K;  2Y1J A;  4CGH A;  4QS9 A;  4LY7 A;  3HP6 A;  5C2F A;  1RT7 A;  1IJJ A;  1RIL A;  4AHT A;  4XIU A;  2PYL A;  3ZET A;  1N36 K;  3MXM A;  3R3L A;  1C6V A;  3CG7 A;  4JV5 K;  4G1Q A;  3KK3 A;  4CZJ A;  3HP9 A;  2DPN A;  4RW4 A;  2OYQ A;  4AIL C;  1SS6 A;  3FFK B;  2HHS A;  2Z1I A;  4CZG A;  2DTU A;  3H1Q A;  2JLE A;  4CZK A;  4BC2 A;  1LAV A;  3VTI A;  5KTQ A;  1J54 A;  2VWB A;  2WFB A;  1Q9Y A;  1CXU A;  4FJL A;  1XI1 A;  3PY8 A;  4E19 A;  4DQR A;  3O5B A;  2HBK A;  4FLU A;  4CF0 A;  4DSE A;  5AQN A;  4CF8 A;  4A57 A;  5HLF A;  2E2N A;  4IFE A;  2HHT A;  3VQ5 A;  1QQO A;  3CPW M;  4LD0 A;  1SKR A;  3UKR B;  4IDK A;  3VA3 A;  1KLM A;  3HO1 A;  4ELT A;  5AQX A;  3S3M A;  4FWM A;  1BQN A;  2OAN A;  3UB5 A;  5HRO A;  1G15 A;  2ETJ A;  2VG5 A;  4FW1 A;  3V9S A;  3O9S A;  3LZI A;  2Q97 A;  4NCG A;  1VQP N;  3GG4 A;  1N6Q A;  4CD3 A;  4FLZ A;  1YAG A;  1M1K O;  1JXE A;  4GY2 B;  3KK1 A;  1HLU A;  4OGC A;  4DU4 A;  2BDP A;  1S6P A;  5F1X A;  1JLB A;  2JWL A;  3MWT A;  5JMV A;  4YFU A;  1J53 A;  3U8X A;  3AGR A;  4WQ4 C;  3NH0 A;  1RFQ A;  3NGZ A;  2GTD A;  1RTD A;  3S3N A;  2GUI A;  3WT0 A;  1WSF A;  3O9T A;  2PAV A;  1Q81 O;  4H4M A;  4AHC A;  1QSL A;  1WSE A;  1U45 A;  2F4V K;  2RN2 A;  3CQY A;  3M6G A;  3ZSZ A;  3OA9 A;  1S1T A;  4Y1C A;  3DXM A;  5AFU A;  4B9N A;  3I33 A;  3OS1 A;  3CQ8 A;  1K73 O;  2F96 A;  4DF4 A;  4X64 K;  3VF6 A;  1NOZ A;  4O5B A;  1VSM A;  2QI2 A;  1S6Q A;  3ZET B;  2H3G X;  1UA0 A;  5TKY A;  3OYK A;  4M42 A;  4BRK A;  1TUY A;  2IOC A;  4X66 K;  2OTL N;  4CZF A;  5HRN A;  4FJ5 A;  3G10 A;  3H3N O;  3T3F A;  4H5V A;  4Z4G A;  1BL3 A;  3OYC A;  2RKI A;  3VQ4 A;  4O55 A;  3F9M A;  1JLC A;  3AO3 A;  1RTH A;  2OPS A;  3ID8 A;  3AVA A;  3RR8 A;  1K6Y A;  3QNO A;  2D0B A;  3CIP A;  4BC3 A;  2OPP A;  1T7P A;  4JI6 K;  2NLX A;  3MCA B;  3QEI A;  4CFC A;  5AQO A;  5JS2 A;  4A62 A;  3NBP A;  1SL2 A;  5AQQ A;  1RT1 A;  4JD2 A;  3H46 O;  1RT5 A;  3HXM A;  3EO3 A;  3C7N A;  3LPT A;  1NKE A;  3VQD A;  4FJJ A;  4O0I A;  1RTI A;  1ZBU A;  3NGI A;  2F9T A;  4JK7 A;  1NJY A;  3AO5 A;  3AA5 X;  3DM2 A; 
#chains in the Genus database with same CATH homology
 3ZT0 A;  4NYN A;  3HJF A;  3F73 A;  3L2W A;  1J5O A;  2YKM A;  1NK6 A;  4CJW A;  4FK2 A;  1O1W A;  3QEP A;  3TAQ A;  5C24 A;  1RT3 A;  4KTW A;  4OPJ A;  2A1S A;  1VK0 A;  3LAK A;  1SUQ A;  2HNZ A;  3WNG A;  4FJ9 A;  3I0R A;  3TI0 A;  4CE9 A;  3QIN A;  1RDB A;  3H08 A;  3CFP A;  1A5W A;  1W0H A;  4B08 A;  4KI6 A;  1D5A A;  3QEX A;  3HPH A;  4O0J A;  4OVL A;  4DFJ A;  5J1E A;  1I39 A;  1TKT A;  2GBZ A;  5C42 A;  4CJS A;  5EU7 A;  1JLE A;  2IS3 A;  3G0Z A;  3KLI A;  1ASV A;  2R7Y A;  4CIE A;  4FM0 A;  1TGO A;  3AVH A;  4Q5V A;  4CFB A;  3V1Q A;  1UAX A;  1QQC A;  4FJN A;  4FJ8 A;  3DI6 A;  1TV6 A;  4CEB A;  4ID5 A;  1W9H A;  4BE1 A;  1NKC A;  2HVI A;  2FBX A;  2PY5 A;  3V9Z A;  3TAB A;  3S9H A;  1NJX A;  4HCB A;  4KHQ A;  1NK8 A;  3ASM A;  1BHL A;  3NF7 A;  4CHP A;  1HNI A;  5KRS A;  4JRQ A;  4FM2 A;  3T1A A;  4ID1 A;  2WOM A;  4E7K A;  4QOZ B;  1EET A;  4CHZ A;  4RG8 A;  1LWE A;  4W5Q A;  3NHG A;  3MEC A;  1L5U A;  3RMD A;  1NK9 A;  3F9K A;  3I8D A;  3L2V A;  3RWU A;  3DMJ A;  4CJU A;  3OS2 A;  2Y1I A;  1ASW A;  3KKR A;  1D9F A;  1CZB A;  3V1R A;  4B9L A;  4CHO A;  2B6A A;  3SV4 A;  4I2Q A;  2QXF A;  4FJH A;  4LH4 A;  4CGI A;  3M8P A;  4Z4C A;  3ULD A;  3QEV A;  4Z4F A;  3OYL A;  1RNH A;  4CHY A;  4M3U A;  1LW0 A;  3NH1 A;  3P83 D;  4DTN A;  4K8Z A;  3P1G A;  5DK5 A;  2HHU A;  1QTM A;  4M3R A;  3K5M A;  1J9A A;  1DTT A;  2YNG A;  3SCX A;  1C1B A;  3MAQ A;  4AHR A;  4FJI A;  4DTU A;  1C0T A;  1NK5 A;  4KV8 A;  1KVA A;  3SQ1 A;  1RT6 A;  1JLG A;  1Y97 A;  4FK0 A;  1WSJ A;  1X1P A;  3SQ4 A;  5HRP A;  4E1M A;  2KQ2 A;  4Z4H A;  3NH2 A;  2Z1G A;  1XHX A;  1RBV A;  4AHS A;  1T05 A;  3V4I A;  3ZT3 A;  4PY5 A;  3HST B;  1ASU A;  1TAQ A;  3VQC A;  4MQ3 A;  1JLF A;  4C8K A;  3D45 A;  1VRU A;  2XY5 A;  2AJQ A;  4RW8 A;  1KVB A;  4FJM A;  4QCL A;  3LP3 A;  4IG3 A;  1B92 A;  1S5J A;  3O3G A;  3AA4 A;  3VQB A;  1U47 A;  3CYM A;  5K14 A;  3MXI A;  4E1N A;  4CFA A;  5J2N A;  1RDA A;  1C0U A;  3K5O A;  4FK4 A;  3ZSW A;  5SWM A;  1SV5 A;  1TKX A;  3T19 A;  4W5O A;  3M8R A;  2XHB A;  1ZBF A;  2WON A;  4O44 A;  1VSD A;  4CF2 A;  1U49 A;  1X9M A;  2G8F A;  3DRR A;  3KD5 E;  2O4G A;  3U3Y A;  5CZ2 A;  1TVR A;  2I5J A;  4TSX A;  3V81 A;  3TAE A;  3UIQ A;  3V9X A;  3SV3 A;  2YNH A;  4M45 A;  4DF8 A;  1EP4 A;  4IFY A;  3MEE A;  5JS1 A;  3DRS A;  3LAM A;  1REV A;  1VSK A;  2D0C A;  1RBR A;  4M41 A;  4KKO A;  3OYE A;  3KTQ A;  3TAF A;  1ZBL A;  5FRO A;  1NK0 A;  4KB0 A;  4DFK A;  2G8V A;  3L2U A;  5FRM A;  2HVH A;  4HCC A;  1EKE A;  4C8N A;  4OKJ A;  4FLV A;  2FBY A;  1U48 A;  1RTJ A;  3L2R A;  4B9T A;  3A2F A;  4B8C A;  3NF9 A;  4FLX A;  3E01 A;  1XWL A;  3PUF A;  2BAN A;  2X6S A;  4KO0 A;  4I9L A;  4CJ4 A;  1RBS A;  4J2A A;  2YHB A;  1A5X A;  3U3G A;  3QET A;  3AA2 A;  3TWH A;  5HP1 A;  2G8W A;  4FJG A;  2P51 A;  3DLH A;  2KTQ A;  5DMR A;  3HVT A;  4HUG A;  4KRE A;  4DTR A;  1JL2 A;  3ZT1 A;  2D5R A;  4B9V A;  4CF9 A;  1WAF A;  4PQU A;  4E7L A;  3OYN A;  3LDS A;  5I3U A;  2BGG A;  4W5R A;  4BE0 A;  4EZ6 A;  4M3T A;  1HYV A;  2XY7 A;  1TK5 A;  1X9S A;  4KAZ A;  4RW7 A;  1EX4 A;  2RPI A;  3FFI A;  5HBM A;  3ZSR A;  4ELV A;  4M3W A;  4CEQ A;  4CK3 A;  2Z1J A;  3CM6 A;  5T7B A;  3ZSV A;  3KJV A;  1VSL A;  4CJL A;  4DLE A;  4DU3 A;  4NCA A;  3SUP A;  3VN5 A;  5FRN A;  5J2P A;  3HYF A;  4CHN A;  4E7H A;  1ITG A;  4M3Y A;  4CGJ A;  4ICL A;  1KCF A;  1YVU A;  1RDC A;  2GV9 A;  1UWB A;  4I2P A;  4EP5 A;  4BDY A;  1D9D A;  1VSI A;  4KI4 A;  2YNF A;  3HK2 A;  3O4N A;  4ZTF A;  3PO4 A;  3HPG A;  3O3H A;  3QNN A;  1RCH A;  3AO2 A;  4CJQ A;  4HHT A;  3MED A;  3TAM A;  5J2Q A;  4W5N A;  3HT3 A;  2HNY A;  5KI6 A;  2IAJ A;  3WNH A;  3TR8 A;  1BI4 B;  2KFN A;  1BIU A;  3ISN C;  2XO7 A;  1VSH A;  2DFF A;  3NCI A;  4CJT A;  3OS0 A;  4KPY A;  3K59 A;  4H4O A;  4N56 A;  3LWM A;  1IO2 A;  2XRI A;  3PX4 A;  3RTV A;  3HVR A;  2XY6 A;  1QS4 A;  4CGD A;  2OA8 A;  1DLO A;  1BIZ A;  1HPZ A;  4CEZ A;  1U4B A;  2OZS A;  4FZX C;  1GOA A;  4B9S A;  3B6P A;  3I0S A;  4DWI A;  4N41 A;  2BE2 A;  3NFA A;  4BDZ A;  4OJR A;  3RRH A;  3JSM A;  3K5L A;  3KK2 A;  4QAG A;  1SKW A;  4JS5 A;  4CEC A;  1HYS A;  1BQM A;  3AVN A;  4CK1 A;  1DTQ A;  1KTQ A;  1YTU A;  1X9W A;  1BCM A;  4E89 A;  4N5S A;  3AA3 A;  3RRG A;  1MU2 A;  4JRP A;  2EHG A;  3ITH A;  2G8H A;  4FCY A;  1JLA A;  1HRH A;  2G8K A;  3LWL A;  1CXQ A;  1RBT A;  4B3O A;  3AVM A;  4CGF A;  1HJR A;  4OKE A;  4YNQ A;  1WAJ A;  3ZSO A;  4CFD A;  3SPY A;  3L8B A;  4DFM A;  2OZM A;  1Q8I A;  3SUN A;  5KGW A;  2X78 A;  4CEE A;  4C8O A;  4DMN A;  4CIG A;  3IG1 A;  4M3Z A;  5D3G A;  4KHY A;  4Z4I A;  1A5V A;  1NK4 A;  4CEO A;  4I9Q A;  4F4K A;  3RMB A;  2ITG A;  1KSP A;  1HQU A;  1FXX A;  1JLQ A;  1S1U A;  2E6M A;  3M8S A;  3IRX A;  3LP1 A;  1RT4 A;  3C6U A;  1B9D A;  3RMA A;  2O4I A;  2EX3 A;  1JKH A;  2FBV A;  3LAN A;  3LPU A;  3OYH A;  3CM5 A;  1QSY A;  1XC9 A;  4PWD A;  3L3V A;  3NAE A;  2DFE A;  1C1C A;  3OYB A;  3K57 A;  3PO5 A;  1VSE A;  1JXB A;  1QE1 A;  4FVM A;  4BAC A;  1BGX T;  2FBT A;  1SL0 A;  4AH9 A;  4DTS A;  2D0A A;  2VG6 A;  4DTP A;  4CJ5 A;  2YKN A;  4DU1 A;  3DLK A;  3TAP A;  3S3O A;  1L3T A;  1QHT A;  2ZE2 A;  3ZT2 A;  2OPQ A;  3QO9 A;  2XY8 A;  4N47 A;  3KLG A;  4E7J A;  3THV A;  4AHV A;  1TKD A;  4CJV A;  4JLH A;  4CIF A;  4FJX A;  1T8E A;  1U04 A;  4MFB A;  1VRT A;  1NJZ A;  5CYQ A;  3SJJ A;  3AVJ A;  3AO1 A;  3AVI A;  1GOC A;  4H8K A;  3VQ6 A;  4CGH A;  2Y1J A;  4LY7 A;  4GMJ B;  3KKS A;  4EP4 A;  4FZY A;  4FXD A;  3HP6 A;  4Z4E A;  4HVJ A;  4FYD A;  1RT7 A;  3PX6 A;  3OYG A;  1IKY A;  1C0M A;  1RIL A;  4F2R A;  1LAW A;  2E4L A;  3L2Q A;  4AHU A;  2Z1H A;  4AHT A;  3VA0 A;  3ZSX A;  1S1W A;  4IBN A;  4XIU A;  3OYA A;  4FJ7 A;  4CGG A;  3EY1 A;  2PYL A;  3AVC A;  4KTZ A;  1KFS A;  3MXM A;  3DLG A;  1C6V A;  3CG7 A;  4B8A B;  1KLN A;  3M8Q A;  4G1Q A;  5HRR A;  3KK3 A;  4JS4 A;  4HUF A;  4J2D A;  3HP9 A;  4C8L A;  4CJF A;  2YHA A;  3RR7 A;  2ATQ A;  4RW4 A;  1KVC A;  4DS4 A;  2OYQ A;  4CCH A;  5SZT A;  4AIL C;  3DOK A;  3VQ9 A;  3ZSQ A;  2HHS A;  2Z1I A;  4DQP A;  2DTU A;  3NF6 A;  2JLE A;  4KFB A;  1IH7 A;  5E41 A;  1L3S A;  4F8R A;  1LAV A;  4O4G A;  3K5N A;  5KTQ A;  1HQE A;  1UOC A;  1J54 A;  1Q9X A;  4DSJ A;  3OYF A;  1FK9 A;  4K8X A;  3PX0 A;  3SUQ A;  1TK8 A;  1Q9Y A;  1CXU A;  3VQP A;  1KFD A;  4NYF A;  3LP2 A;  2A1R A;  4FJL A;  4DSL A;  3AVB A;  3SPZ A;  1HMV A;  1SKS A;  2VG7 A;  1XI1 A;  3KD1 E;  1NOY A;  3PY8 A;  4KB1 A;  4E19 A;  4GW6 A;  1WSI A;  4CHQ A;  3B6O A;  3VQQ A;  4DQR A;  4BDP A;  3K58 A;  4FJK A;  1S9E A;  3V9W A;  2HND A;  4FLU A;  3AVF A;  4CF0 A;  1VSF A;  1WSH A;  2YV0 X;  4CED A;  4DSE A;  1NK7 A;  5KGX A;  4DFP A;  4PUO A;  4B9M A;  3SI6 A;  2IGI A;  2X74 A;  4CJR A;  1L3V A;  4N76 A;  2W42 A;  2QK9 A;  4CF8 A;  4CEA A;  2P5G A;  2ZQB A;  2B5J A;  3C95 A;  4DQS A;  5CYM A;  5HLF A;  2HHT A;  1CZ9 A;  4CER A;  1HYZ A;  1IKV A;  4DTJ A;  1S9G A;  3VQ5 A;  1I3A A;  2X6N A;  3CFR A;  1XHZ A;  4LD0 A;  4DG1 A;  4F2S A;  4KRF A;  5CY4 A;  3JYT A;  1NKB A;  1SKR A;  1C1A A;  1GOB A;  4LSN A;  4OPK A;  3OYM A;  4KHU A;  3SZ2 A;  4FLW A;  4DSK A;  3C94 A;  3HPO A;  3AVL A;  4IDK A;  4KHW A;  4DTM A;  3QER A;  2KZM A;  4Q0B A;  3VA3 A;  1KLM A;  3HO1 A;  3V9U A;  4ELT A;  4I7F A;  3S3M A;  4E0D A;  4E3S A;  1BQN A;  2Q3S A;  5HRO A;  1G15 A;  4DS5 A;  3U6F A;  2ETJ A;  2VG5 A;  5HRS A;  4FW1 A;  4BE2 A;  4IFV A;  4OKK A;  4HUE A;  4RW9 A;  3SQ0 A;  3V9S A;  1UA1 A;  1NJW A;  3LZI A;  1TL3 A;  4GVM A;  4NCG A;  3WNE A;  3OYI A;  3O3F A;  2QKK A;  4Z0U A;  1N6Q A;  1ZBH A;  3DRP A;  2VWK A;  2KFZ A;  3EZ5 A;  3OJS A;  3C6T A;  4PA1 A;  3SUO A;  4FLZ A;  1B9F A;  1YTA A;  3SQ2 A;  3K2P A;  2HMI A;  1JXE A;  3TAR A;  3KK1 A;  4ZTJ A;  3OY9 A;  4OGC A;  2FC0 A;  4DU4 A;  2BDP A;  1LW2 A;  1FKO A;  1WNS A;  1RBU A;  1S6P A;  4UQG A;  3QES A;  4WE1 A;  4E7I A;  1JLB A;  3DLR A;  4CF1 A;  3RMC A;  3KIO A;  2RF2 A;  3SYZ A;  2DFH A;  4DQQ A;  4YFU A;  4C8M A;  4DTX A;  1J53 A;  3IAY A;  1Z26 A;  4EZ9 A;  3NH0 A;  4OLB A;  2P5O A;  2HHQ A;  4DSF A;  2IC3 A;  3NGZ A;  1L3U A;  3QLH A;  1RTD A;  3V6D A;  4OLA A;  4NCB A;  3BGR A;  1LWC A;  3OVN A;  4ELU A;  1WN7 A;  4HTU A;  3S3N A;  3QIO A;  2GUI A;  1WSF A;  2ZD1 A;  3ALY A;  1TAU A;  3MXJ A;  3VQE A;  4H4M A;  3EYZ A;  4AHC A;  1QSL A;  1WSE A;  1U45 A;  2HHV A;  4FLY A;  2RN2 A;  3ZSZ A;  3VQA A;  3NDK A;  3LAL A;  1S1T A;  4Y1C A;  2F8T A;  2PZS A;  3AVG A;  2HHX A;  3DLE A;  4Y1D A;  2G8I A;  3ZSY A;  4B9N A;  3KLH A;  4R5P A;  3HL8 A;  3OS1 A;  4DQI A;  4F3T A;  1N5Y A;  2B4J A;  3CQ8 A;  4CK2 A;  4LH5 A;  2F96 A;  4DF4 A;  4KHN A;  4KHS A;  4M3X A;  1EXQ A;  4FM1 A;  3D0P A;  1NOZ A;  3LP0 A;  4O5B A;  4FLT A;  2PYJ A;  4DSI A;  1VSM A;  1Z25 A;  3TAG A;  3V1O A;  2NUB A;  1ZBI A;  1T03 A;  1F21 A;  1IKW A;  1S6Q A;  3KLE A;  4KTQ A;  3AV9 A;  1UA0 A;  3OYK A;  4FW2 A;  2JGU A;  1BIS A;  3P5J A;  5I42 A;  2IOC A;  4CES A;  4L8R B;  4IG0 A;  4M42 A;  2QKB A;  2F8S A;  1SL1 A;  1TK0 A;  2LSN A;  4CJE A;  3WNF A;  5HRN A;  3VQ8 A;  1S1V A;  1YT3 A;  4J2E A;  4LSL A;  1VSJ A;  3SNN A;  1R0A A;  4ZHR A;  2KW4 A;  1IG9 A;  3MEG A;  4CEF A;  4FJ5 A;  3G10 A;  3VQ7 A;  3T3F A;  4IKF A;  4Z4G A;  2OPR A;  2P1J A;  1BL3 A;  3ZCM A;  3AVK A;  4CJP A;  4CJK A;  3OYC A;  1CLQ A;  1WSG A;  2RKI A;  3QIP A;  3VQ4 A;  2YNI A;  3HM9 A;  2HB5 A;  4O55 A;  5KRT A;  2IDO A;  4F3O A;  3NE6 A;  4FZZ A;  3OYD A;  1JLC A;  3DYA A;  1FKP A;  2DY4 A;  1BCO A;  3AO3 A;  3O4Q A;  1RTH A;  1RDD A;  2OPS A;  3NGY A;  3OYJ A;  5J2M A;  4DTO A;  4RW6 A;  3AVA A;  3CFO A;  2VWJ A;  3RR8 A;  4B9U A;  1K6Y A;  3QNO A;  1S1X A;  2D0B A;  3KLF A;  2OPP A;  2KZZ A;  3AO4 A;  3L3U A;  1T7P A;  1RT2 A;  3IS9 A;  3OJU A;  3QEI A;  1ZYQ A;  2HHW A;  4CFC A;  1QSS A;  5JS2 A;  1BI4 A;  1KRP A;  1SL2 A;  3NBP A;  4DLG A;  3BDP A;  1HNV A;  1RT1 A;  5FDL A;  4BWM A;  3ZT4 A;  3PV8 A;  4OGE A;  1D8Y A;  3HXM A;  1RT5 A;  3TAN A;  1TKZ A;  4BWJ A;  3LZJ A;  4W5T A;  1NKE A;  3LPT A;  1LV5 A;  3NF8 A;  3DLB A;  3DOL A;  3VQD A;  4FJJ A;  4O0I A;  1RTI A;  4CJ3 A;  1IKX A;  2HW3 A;  1ZBU A;  3NGI A;  1WLJ A;  1TL1 A;  4J2B A;  3QEW A;  1NJY A;  3AO5 A;  3AA5 X;  1LWF A;  2E6L A;  2G8U A;  5C25 A;  3DM2 A;  5CZ1 A;  1JL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...