1BL3A

Catalytic domain of hiv-1 integrase
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
142
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Crystal structures of the catalytic domain of HIV-1 integrase free and complexed with its metal cofactor: high level of similarity of the active site with other viral integrases.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Dna integration
total genus 47
structure length 142
sequence length 152
chains with identical sequence B, C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1bl3A00
2FBYA 2HNZA 2XY7A 2EX3A 1S6PA 1WSFA 3S3MA 1S9EA 4O4GA 1SKRA 3NGYA 1KLNA 3CYMA 1ZBFA 2G8VA 4FJNA 1JXEA 2Y1JA 2FC0A 3V1RA 4OLAA 4CEBA 4CEQA 1JXBA 1Q8IA 2A1SA 3NF9A 3T19A 4BE1A 3M8PA 4E7HA 4O0IA 3NHGA 1JLBA 1FXXA 3O3HA 5HRPA 4GVMA 4DU1A 1U04A 3EYZA 4EP4A 3B6OA 3NE6A 2E6LA 3DM2A 1WAJA 2YNIA 1IH7A 3KLIA 3NH0A 2OZMA 4CECA 3AVAA 4CERA 5SWMA 4CGIA 3IAYA 3K5OA 4L8RB 4F3TA 2ZQBA 2PYJA 3VA3A 3LDSA 2P5GA 2XHBA 1J53A 3QIOA 4DSFA 2ZD1A 5C25A 4XIUA 4E7KA 4CIFA 4JRQA 3HPHA 1ZBIA 4CEFA 3K58A 4FZYA 2GUIA 3QO9A 3O4NA 2B6AA 4GMJB 4CF1A 1XI1A 4DG1A 2G8HA 2G8UA 1GOCA 3CM5A 4CHYA 2DFFA 2HHVA 3AO3A 3MXJA 4KO0A 5HLFA 1NK8A 1S5JA 4DU4A 4KI4A 1J9AA 1KFDA 2YNGA 3OVNA 3TR8A 4O5BA 3CFPA 2RN2A 1WAFA 3K5MA 3DLKA 3CFRA 3LP0A 3T1AA 1F21A 4CF8A 2XY6A 1NK6A 3RWUA 3HO1A 4W5TA 3V9SA 2LSNA 4KHYA 3SUQA 1VSDA 1TKDA 4HCCA 3DI6A 1RT2A 3OYEA 4FJMA 1RBTA 3ZSWA 5JS1A 3ZSXA 3KIOA 1LV5A 1BI4B 4FM0A 2FBTA 5T7BA 4CK3A 2KTQA 1IG9A 3SYZA 1HRHA 4CJVA 1KSPA 2F96A 3KJVA 1ZYQA 2IGIA 4B9UA 4KHSA 3KK1A 1WSEA 4C8LA 5D3GA 2E4LA 3NGZA 3SV4A 3RR8A 1QSSA 2YV0X 4E0DA 4LY7A 2IC3A 4CJFA 3VQCA 1L3UA 1TAUA 1IKWA 1NKEA 3KTQA 1QSYA 4DSEA 3DLRA 1S1WA 4ICLA 4CEZA 3SUPA 3ZCMA 2ITGA 4OPKA 2EHGA 1J54A 3AO2A 5KTQA 3L2QA 2BE2A 3ZT1A 4CHOA 3QEXA 4DMNA 4JLHA 2KFNA 1Z25A 3NAEA 3K5LA 1L3TA 5CZ1A 1QSLA 4UQGA 1EP4A 3WNFA 3DOKA 4B08A 4YFUA 1L3SA 4KPYA 2R7YA 4EP5A 3LZIA 4ZHRA 4BACA 5J2NA 4CJUA 4C8NA 1C1CA 4E7IA 3SQ2A 2DFEA 3U3YA 1EETA 4DS5A 2D5RA 1U47A 3CG7A 1VSJA 1SUQA 3S9HA 1NOYA 4OGCA 5KGWA 3TARA 4N76A 1HQEA 1LAVA 3L3UA 1U49A 2HNDA 4W5RA 1WSJA 3VQ9A 3AVFA 1U4BA 3JYTA 4BDPA 4FXDA 3ITHA 1JLFA 2VG7A 2YKMA 3O4QA 3OYAA 5J2MA 3SPYA 4Z4GA 4DF8A 4OLBA 3TABA 1TK5A 3OJUA 5KRSA 2VWKA 4OKKA 1EXQA 4CGDA 4F3OA 4E7JA 3L2RA 3AVIA 1FKPA 4CESA 3QNNA 1BCOA 1ZBHA 5KRTA 3NBPA 3AVGA 5CYQA 3SCXA 3ZSYA 4Y1DA 4QAGA 1UA1A 1HMVA 4OKJA 3HPOA 1RT5A 3QEPA 3PUFA 4M41A 3SQ4A 4FZZA 4TSXA 4FLXA 3SUOA 3PX4A 4K8ZA 4KB1A 1HNVA 2ATQA 4AHVA 4CFAA 4M3UA 5E41A 2YKNA 1U48A 1HYZA 1YVUA 1C0MA 4DQQA 1QQCA 3OYFA 4KTZA 5FDLA 3TAFA 4KI6A 4CHPA 4BE2A 2QXFA 4KRFA 3ZT2A 2KW4A 4E7LA 3KKRA 1ITGA 1SL1A 1VK0A 5DK5A 3PO4A 4OVLA 2HNYA 3H08A 4Z0UA 1W9HA 1QTMA 4B9MA 4NCGA 4CJ5A 3AVLA 4R5PA 4IG3A 3C6UA 3VQ6A 2IDOA 2RPIA 2G8WA 1WN7A 3HT3A 3S3OA 4J2BA 1JL1A 1NK0A 4QOZB 3V4IA 1J5OA 5HRNA 4H8KA 3OS2A 3L2UA 3KD1E 3MXIA 4IFYA 1BHLA 3DYAA 4CEEA 1C0UA 3AO4A 3VQ8A 4CJQA 1SV5A 4FVMA 4IKFA 3RMBA 1VSKA 3AVJA 3I8DA 4WE1A 3OYGA 2PY5A 3RMCA 1A5XA 2Z1GA 3TI0A 1NK4A 1VRUA 4PUOA 3OYJA 3ZT0A 3CFOA 2Z1HA 1NKCA 3OS1A 1NJXA 2FBXA 1L5UA 3PX6A 3TAEA 1CXUA 4KHUA 3LWLA 3AA2A 1X9MA 4C8KA 2WONA 4M3YA 3WNHA 3U3GA 1TVRA 3VQ5A 2HMIA 2BDPA 4O44A 3OJSA 4CGJA 4F2RA 1Y97A 1TGOA 3HM9A 3RMDA 4Q0BA 1BISA 1I39A 1TKZA 4FJ7A 3M8QA 4M3WA 3AA5X 1KCFA 4N5SA 3OYLA 2Y1IA 3ZT3A 3ZSZA 3OYMA 3O3FA 3NF7A 4FLVA 1SKWA 3QLHA 2DFHA 5I3UA 1HYSA 3ZSOA 3LAKA 1CZ9A 4O55A 3LWMA 1RDBA 4DFJA 3TANA 4I9LA 1GOBA 1DLOA 3HL8A 3QESA 3LALA 4CHZA 4N56A 2OZSA 4B9SA 3SI6A 3VQ4A 4CGHA 1RCHA 3TAGA 2IAJA 1WLJA 1RT1A 1NOZA 3QEVA 4JS5A 1XHXA 4B9LA 1I3AA 4DFKA 1D8YA 1R0AA 1C6VA 3LP3A 2HB5A 3V81A 4ZTJA 3PO5A 3LAMA 1KVAA 2ZE2A 3C6TA 1Q9YA 3DRRA 3M8RA 4ELTA 1TL1A 3OY9A 1O1WA 4DS4A 4DFPA 4CFDA 1BQNA 4H4OA 1RTDA 2YHAA 3HVRA 4C8OA 2DY4A 2OA8A 4I2QA 4B8CA 1NJYA 2AJQA 3AVHA 1B9DA 1B9FA 1BIUA 4W5QA 3K5NA 4HUGA 3TAPA 1QHTA 4FLYA 3P83D 4FZXC 3OYBA 3RMAA 1RTJA 2RF2A 4W5OA 4ELVA 3NH1A 4RG8A 1DTTA 2RKIA 4DF4A 4HCBA 1CXQA 2G8KA 1RBRA 4CJTA 1JLQA 3DLGA 4DTNA 4EZ9A 5HRSA 1EKEA 3DRSA 4M3TA 3CM6A 1K6YA 2DTUA 1A5WA 4CJSA 3QERA 4BDZA 1VSEA 3AVNA 2BANA 4FK4A 1IKXA 4E19A 2PYLA 3P5JA 4LH5A 5CZ2A 5KGXA 1S1XA 3TAMA 3V1OA 3NDKA 4JS4A 3MEDA 3B6PA 3U6FA 4LSLA 3M8SA 4NCBA 2ETJA 2XO7A 4J2DA 4PY5A 4KAZA 3P1GA 1RILA 4Z4CA 3AVCA 4DTOA 1TL3A 3FFIA 3G0ZA 4AH9A 2HHTA 1WSHA 4ID5A 4RW7A 1HQUA 4B8AB 3QNOA 1JKHA 4RW8A 1BGXT 3PV8A 1UWBA 4F4KA 1RT3A 1BI4A 3DLBA 2HHUA 1HJRA 2JGUA 2KFZA 4RW4A 2E6MA 1LW2A 4CJ4A 1T05A 2HW3A 1DTQA 3AVMA 3KLEA 4E3SA 2F8SA 1VSHA 2QKBA 1IKYA 1RT6A 3EZ5A 1FKOA 4DTJA 4CFCA 5HROA 3OYIA 2YNFA 4KV8A 3O3GA 4F8RA 1JLCA 1X1PA 3E01A 1FK9A 3ALYA 1HPZA 3MEGA 4HVJA 3V9WA 4FJIA 2XY8A 1UAXA 4B9TA 4Z4HA 2KZMA 4FLTA 1JL2A 4ZTFA 2FBVA 3I0RA 4CHNA 3AA3A 3AVBA 4J2AA 4HHTA 1VSLA 5HP1A 1ZBUA 4E1MA 1LW0A 3NCIA 1U45A 1LWEA 4CCHA 4GW6A 1KTQA 3LPUA 2BGGA 2P1JA 3WNGA 1BIZA 3HVTA 3NGIA 2HVHA 1NK7A 3QIPA 2GBZA 2IOCA 4CJKA 4HUEA 4FLZA 3SNNA 4AILC 1NKBA 4FJJA 4CEOA 1EX4A 3D0PA 4KKOA 3V6DA 2QKKA 1Z26A 5FRNA 1MU2A 2B4JA 4NYNA 4CHQA 2VG5A 3OYNA 4DQRA 1QS4A 3MXMA 3DRPA 4FJXA 3NF6A 4N47A 4Z4EA 1NJZA 4W5NA 1T03A 4CEDA 3HJFA 4AHSA 4I9QA 3DMJA 4LSNA 3ZSQA 1YTAA 3A2FA 3OYCA 5DMRA 3HXMA 4PWDA 1LWFA 1SKSA 5I42A 1ASUA 3AV9A 3V9ZA 3ASMA 4QCLA 5CY4A 1XHZA 2D0AA 2P5OA 4Z4IA 3NFAA 4E89A 3VQQA 2HHWA 1RBSA 3QEWA 3IS9A 1X9SA 1VSMA 4BDYA 4FJ8A 2KZZA 5EU7A 2HHXA 1S6QA 4IDKA 4DSJA 3KLHA 3MEEA 4DLEA 3LP1A 3AO5A 4K8XA 1RT4A 3L2VA 4DTMA 1LAWA 2OPRA 4CJRA 3HP6A 1XWLA 3CQ8A 3K59A 4IBNA 1N5YA 3OS0A 3PY8A 4ELUA 3BDPA 2B5JA 2KQ2A 3NH2A 3JSMA 1RBVA 5J2QA 4CK2A 3KK2A 4PA1A 3S3NA 1WSGA 4NCAA 4EZ6A 3I0SA 3DOLA 1D5AA 3G10A 4N41A 3F9KA 4M3ZA 1NK5A 3RRGA 4OJRA 1JLAA 4FM1A 4CJ3A 1BQMA 1BCMA 3SV3A 1XC9A 4C8MA 3HYFA 4HTUA 4Q5VA 2X6SA 5SZTA 1X9WA 4IFVA 4Y1CA 3RR7A 4DSIA 1RNHA 1JLGA 1NK9A 4FJHA 1IO2A 1JLEA 1S9GA 4F2SA 1VRTA 3VQAA 1S1TA 4DTPA 3OYDA 2O4IA 4FJ5A 3AVKA 3F73A 3RRHA 4KFBA 4DTRA 3AA4A 1C0TA 4FW1A 2PZSA 3SQ0A 1N6QA 4CEAA 4DLGA 1G15A 5FROA 4CJEA 3KK3A 3QINA 2IS3A 3AO1A 1TKXA 3KKSA 3BGRA 5K14A 5KI6A 4AHRA 3KLFA 1RTHA 3WNEA 1QE1A 4CF9A 2W42A 4HUFA 4FM2A 1TK0A 2OPQA 3KD5E 3QEIA 1SL2A 4FYDA 1KVCA 2X6NA 3LP2A 1YT3A 4I2PA 2G8IA 3SPZA 1RTIA 1TKTA 1B92A 1D9DA 1TV6A 2QK9A 3V9XA 4JRPA 3PX0A 2I5JA 3VQDA 1L3VA 1HYVA 2YHBA 2WOMA 4FJKA 5JS2A 4B9VA 4RW6A 3DLHA 1VSFA 4KREA 2Z1JA 5FRMA 1RDDA 4MFBA 4CIGA 4DWIA 3IRXA 1ASVA 4I7FA 1KVBA 4AHCA 1TK8A 4KB0A 4J2EA 5CYMA 4PQUA 4FJ9A 4YNQA 3VA0A 3SUNA 2O4GA 4O0JA 2D0BA 4CJLA 3RTVA 2HHQA 2X74A 4DQSA 4CFBA 2JLEA 2Z1IA 4KTWA 3QETA 4AHUA 3KLGA 4DTSA 3LPTA 1VSIA 2GV9A 3HPGA 3ZT4A 4IG0A 3K57A 4CE9A 4DQPA 2HVIA 2A1RA 1S1VA 2G8FA 2VG6A 1S1UA 4BWJA 1D9FA 2OYQA 1YTUA 2D0CA 4M42A 4DTUA 2X78A 1BL3A 3HSTB 3ZSRA 2Q3SA 3LZJA 3SZ2A 3SJJA 4KHNA 4DQIA 4OKEA 3OYHA 3TAQA 4FK0A 1WSIA 4CJWA 4KTQA 1T7PA 1WNSA 4B3OA 3VQPA 1C1BA 4KHQA 1HNIA 4DSLA 1KLMA 1W0HA 4M45A 3VQ7A 3HP9A 3TWHA 1RBUA 4FCYA 4FJLA 3LANA 4OPJA 4M3XA 4CK1A 4FLUA 4BWMA 4FW2A 1LWCA 3NF8A 4LD0A 3V1QA 3SQ1A 1CLQA 2YNHA 5HBMA 3VQBA 4CGFA 5J1EA 3MECA 3T3FA 4DFMA 5HRRA 4CJPA 4E1NA 4OGEA 1TAQA 1RT7A 2HHSA 1GOAA 5C24A 3DLEA 3V9UA 4RW9A 1CZBA 4CF0A 5J2PA 4B9NA 4CIEA 4FLWA 3MAQA 3VN5A 4M3RA 4LH4A 3IG1A 1UA0A 1REVA 4KHWA 1KRPA 2OPSA 2F8TA 4G1QA 1KFSA 3UIQA 1NJWA 4CF2A 3C95A 4Z4FA 1RDAA 4H4MA 4NYFA 1RDCA 4AHTA 3EY1A 4FJGA 3L8BA 3K2PA 1Q9XA 4MQ3A 2NUBA 4CGGA 4DTXA 3HK2A 4ID1A 1ASWA 5C42A 1SL0A 2XY5A 3ZSVA 2P51A 1T8EA 3ISNC 3VQEA 4FK2A 2OPPA 1IKVA 4DU3A 3D45A 3ULDA 4BE0A 1A5VA 1UOCA 4DSKA 3L3VA 1C1AA 2VWJA 1ZBLA 3L2WA 3C94A 3OYKA 2XRIA 3THVA
chains in the Genus database with same CATH superfamily
1S9EA 3NGYA 1XUPO 1ZBFA 1JXEA 5FPEA 2FC0A 3FZFA 3M8PA 4R79A 3HBTA 1FXXA 5EXWA 3T7ZA 1U04A 5EX5A 3EYZA 4EP4A 5ADXH 3DM2A 1IH7A 2CH6A 3WXIA 3IAYA 4OO1J 4BVPA 1WBDA 2P5GA 1J53A 1YIJN 4JRQA 3D7EO 3G71N 3QO9A 4KH4A 3CIPA 3O4NA 3H46O 2B6AA 3BEXA 1M1KO 2G8UA 4DG1A 1GOCA 5GADP 3RVCA 4XEIA 2HMPA 3AO3A 3MXJA 3CJBA 4KHPK 1SS6A 2YNGA 3OVNA 3TR8A 4BVOA 1HNZK 4DR1K 3VEWA 3TU5A 1KQSM 3K5MA 3LP0A 1KD1O 2NRWA 4CZHA 5KPZA 3OYEA 5JS1A 1RBTA 3ZEUB 3ZSWA 1X3MA 2Q31A 4JI7K 4BR0A 1K73O 2AA4A 1HRHA 1SAZA 4KHSA 3KK1A 5M1PA 3SV4A 2O8EB 2YV0X 3MDQA 4E0DA 4LY7A 3DXKA 1BU6O 1JJ2M 3KTQA 3C6HA 5HL7L 3MN5A 3ZCMA 2ITGA 3AO2A 3ZT1A 4DMNA 4WQ5A 3JS6A 5CZ1A 4JEPA 2D0PA 1QVFM 5C0YA 2A6AA 2I7NA 2D5RA 1U47A 1VSJA 1SUQA 4ISEA 2O8BA 2GELA 1QQOA 1NJIO 1HQEA 3L3UA 1U49A 5LJVA 3JYTA 2E5LK 3WQTA 4FWRA 3ITHA 3HTVA 3Q7BA 1FW6A 4DF8A 1K8AO 4BRDA 1TK5A 3QBXA 3OJUA 4OKKA 3B8AX 3NBPA 3ZSYA 1T44A 1HMVA 3VESA 1ATNA 3HPOA 4IXCA 3QEPA 3VEVA 3CCSN 1IBMK 1QQMA 2ATQA 4JNEA 3TSPA 4DQQA 3OYFA 4KTZA 4BR7A 5KPTA 1V4SA 4BE2A 3CPWM 5C12A 1ITGA 2P9KB 4JKHA 4CVNE 1K9MO 1QZ6A 1VK0A 2QWOA 5DK5A 3M5RA 1QTMA 4FPAA 3AVLA 3I56N 2RPIA 2G8WA 1WN7A 3HT3A 3IMXA 3FE1A 3CERA 3THXA 3AO4A 2NRZA 1J5EK 3A5NC 4FVMA 3WEEA 5B8HA 4WE1A 4HTLA 3RMCA 1NK4A 3AY9A 4PUOA 1KAXA 4MDBA 1NKCA 1NJXA 4B3TK 1L5UA 4JI0K 3VEZA 3VTHA 1Z6RA 1CXUA 4WF9L 3J7ZO 3EEQA 2UYTA 1CZAN 1DGKN 2Q36A 3OJSA 1RFQA 4F2RA 2Q2RA 1TGOA 3HM9A 4Q0BA 2FXUA 1OH5A 2F7TA 3M8QA 4M3WA 3AA5X 4N5SA 4BRPA 3J7YP 4JD2B 4FLVA 2DFHA 5LMNK 1ILYA 4I9LA 1DLOA 3QESA 3LALA 4CZJA 3VQ4A 4CGHA 4CZEA 1NOZA 3CJAA 1XHXA 4M7YA 3LAMA 3C6TA 4A62A 3M8RA 3P31A 4B3MK 4DS4A 3TTDA 5C15A 1RTDA 2YHAA 4C8OA 3OHRA 4MDAA 4J8FA 4I2QA 1NG9A 3AVHA 3K5NA 3WXJA 3IKMA 4FLYA 3R8EA 2NRHA 3RMAA 4ELVA 4YOWA 4RG8A 1DTTA 2RKIA 5AZJB 4DF4A 4AQYK 1H1VA 3DLGA 5M1QA 4M3TA 3SAGA 1NWKA 4CJSA 2P9SB 3QERA 3AVNA 1IKXA 3F5TA 4E19A 4B1WB 3P5JA 5KGXA 3U6FA 2ITMA 4JS4A 5AQLA 4LSLA 3C0BA 2Q1NA 4NCBA 2XO7A 1N36K 3VMFB 4PY5A 1RILA 4BRQA 4Z4CA 4DTOA 3G0ZA 2O8DA 3I33A 4RW7A 1BI4A 3DLBA 1HJRA 4RW4A 4XH5A 1LW2A 1DTQA 2JWLA 4F9OA 1VSHA 3J7AP 1FKOA 4AM6A 5C10A 4KV8A 3O3GA 3CXCM 1X1PA 3E01A 3ALYA 4DV4K 4FJIA 4LF8K 1HNWK 3N4PA 4ZTFA 2FBVA 4CHNA 3U8XA 4J2AA 4GKJK 4HHTA 3W0LA 1U45A 1LWEA 4CCHA 2O8CB 5AQWA 2P9UA 1KTQA 1BIZA 3NGIA 3ZX0A 1NK7A 3EZWA 3QIPA 1VHXA 4FLZA 4HUEA 4OPHA 4KH6A 5FRNA 4CHQA 3L0QA 3T1HK 2VG5A 3OYNA 4DQRA 3H6EA 1QS4A 3DRPA 4N47A 1VQPN 3TPQA 4AHSA 4I9QA 3DMJA 4LSNA 1YTAA 4PWDA 3HXMA 1ASUA 4BC2A 2ZM6K 2P5OA 3VF2A 3CJ9A 3UB5A 1RBSA 3IS9A 1VSMA 1YF5L 3KVGA 3VEOA 2KZZA 2Q0UA 2HHXA 4JI6K 4LF5K 4E1JA 4CJRA 2YCHA 4A61A 3CQ8A 1N5YA 1QZ5A 4YOYA 3PY8A 3ID6A 1S3XA 4PA1A 1WSGA 3S3NA 2EWSA 4EZ6A 3I0SA 2WFBA 2FSNA 4OJRA 1JLAA 1BQMA 1GLCG 2ZJRL 3RR7A 2X6SA 4Y1CA 1XC3A 2FSJA 1NK9A 1JLEA 1S9GA 5C2DA 1XNRK 1VRTA 3A8YA 3THYA 2O4IA 1IBKK 2YHYA 3UKUB 3F73A 3U4LA 4KFBA 1C0TA 1G15A 1C0GA 3KK3A 2IS3A 4MLEA 4AHRA 1RTHA 3WNEA 3KD5E 4IEIA 4I2PA 3M1FA 3VQDA 4FJKA 4B9VA 1VSFA 5AQMA 4NLBA 2Z1JA 3H3NO 1RDDA 2WBNA 4MFBA 4CIGA 4DWIA 3AAPA 4YNQA 4CJLA 4XH1A 4B1XB 2X74A 4BG9A 4KTWA 3CC2N 3EKUA 3HPGA 3K57A 2ZWHA 4O8KA 2HVIA 1EQYA 2W41A 2FF3B 2A1RA 1S1UA 1YTUA 4H0PA 4DTUA 1WUAA 2X78A 3LZJA 4KHNA 3TAQA 3ULEA 2QI2A 3EO3A 4KTQA 3BP8A 3CI5A 5TKWA 4B3OA 4M45A 1VQON 3VGKA 4FJLA 2P9PB 3LANA 2JWKA 2QWPA 2UUCK 1NGBA 4FW2A 3NF8A 3IDHA 5DM7L 4JKEA 5HBMA 3WXKA 4DFMA 4JK9A 4AM7A 1TAQA 3BF1A 5C24A 4RW9A 1CZBA 4IDHA 3IG1A 4U7BA 4G1QA 3CCVN 4Z4FA 1RDAA 2E2OA 4NYFA 1RDCA 4A5BA 1NGGA 4AHTA 3EY1A 5AQNA 3MCPA 4MQ3A 2NUBA 3HK2A 4M63C 4NLCA 2J4RA 4RWTA 1TYQB 3JXUA 3L4QA 3VQEA 2O8FB 1W97L 4JKDA 2I7PA 4B1YB 2CGLA 3HOTA 3ULDA 4JI2K 1RGIA 2XRIA 3JAMO 2EX3A 3TSQA 2HF4A 3CYMA 2G8VA 2Y1JA 3V1RA 1VAZA 5JVHL 4BQLA 5KPRA 4BE1A 2E88A 1T3VA 5HRPA 4DU1A 3B6OA 4DV7K 3HSCA 5AQPA 4BRMA 3AVAA 4CGIA 3CMEN 3CPEA 4F3TA 2ZQBA 3CCUN 3VA3A 3LDSA 1XMQK 2ZD1A 4A2AA 5AQSA 5C25A 4XIUA 4CIFA 4PL7A 3F2KA 3M6GA 3FFKB 4JHDA 1XI1A 3MMVA 3CM5A 1KC8O 3R3LA 3ZX3A 2HHVA 1N33K 2NRVA 4DU4A 3PSIA 2NRRA 4JKGA 4FOEA 4YOVA 1NGJA 2Q97A 3CJ1A 3DLKA 3RWUA 1F21A 3WQUA 4GY2B 4QS8A 4JV5K 3J80O 1TKDA 2W6KA 1RT2A 3DI6A 3ZSXA 3KIOA 3QMLA 4CK3A 2QW9A 4CJVA 2F96A 3KWGA 4C8LA 1YJ9N 4DV2K 3VEYA 2IC3A 4FPBA 1IKWA 4O5FA 3NVKA 2PBDA 5EVZA 3RSEA 3UE5A 2UXCK 4JKBA 5KTQA 1U2VB 4WFAL 4UQGA 4B08A 3WNFA 1L3SA 4FWOA 4ZHRA 3BZKA 3CHWA 4BACA 3D2FB 4CJUA 4E7IA 3U3YA 1EETA 2HOEA 4DS5A 4GVEA 2QWMA 3S9HA 1ZC6A 4OGCA 5AFUH 3NVMA 5KGWA 3TARA 4N76A 2HNDA 4W5RA 3AVFA 3AGRA 3QB0A 3CCMN 4H5NA 4BY9C 3O4QA 3OYAA 3SPYA 4Z4GA 1MA9B 4OLBA 2IIRA 1YAGA 2GEMA 5KRSA 4CGDA 4F3OA 4DKWA 1RDWX 4Y1DA 4QAGA 4OKJA 2D1KA 3O80A 5BR8K 4FZZA 4YDUC 4FLXA 1HNVA 5E41A 5AQUA 1HYZA 5FDLA 4KI6A 4KRFA 3ZT2A 1GLFO 4JKCA 5GAGP 1X9JA 3O8MA 4NCGA 3O9UA 4I6MA 4BRLA 3VQ6A 4H0TB 3LM9A 2IVOA 1JL1A 1HKCA 5C2FA 4BGBA 5BPLA 4YDUA 1BHLA 3FZMA 1C0UA 3VQ8A 2P9NB 4XH4A 2Z1GA 3SBTA 3OYJA 3ZT0A 2Z1HA 1K8KA 1HX1A 1YHQN 4KHUA 4C8KA 1X9MA 4M3YA 4A59A 3WNHA 4ILJA 2HMIA 5GINA 4CGJA 1Y97A 3ENHA 3VTIA 2KLAA 2F4VK 1BISA 1I39A 5FPMA 1BA0A 4V19S 2QWNA 3HM8A 3QLHA 3SJHA 2D4WA 3LAKA 3ZSOA 3VOVA 4DFJA 3TANA 4FWPA 4M7XA 2GWJA 4CHZA 2OZSA 1VQ6N 2IAJA 3QEVA 2CH5A 1I3AA 3CC7N 1R0AA 1C6VA 2HHHK 3LP3A 2O8BB 3V81A 5JMVA 3PO5A 4LFAK 3DRRA 4FWLA 5LL6Z 2P9IB 1Z05A 3E66A 1LCUA 3HVRA 2DY4A 1NJYA 5BN9A 2E2NA 1B9DA 1R59O 1B9FA 1BIUA 2UXBK 3OYBA 3NH1A 1CXQA 2G8KA 1RBRA 2IVNA 1NGEA 1K6YA 3P4IA 2DTUA 1A5WA 4BDZA 3UKRB 4CI6A 1BG3A 2PYLA 3V1OA 3O9RA 5AQGA 4WYBA 4KAZA 2VYPA 1NBWA 5KQ8A 1WSHA 1HQUA 3VF4A 1JKHA 3PV8A 2HF3A 4LF6K 2JGUA 1T05A 3P38A 4E3SA 4C1NI 3EZ5A 5AQIA 3DAWA 5HROA 3SMSA 3OYIA 3DXMA 1JLCA 3THXB 4AF1A 5AQQA 1VQLN 1FK9A 4NO7A 4HVJA 4WFNL 3GBTA 2XY8A 1VQ7N 3ATVA 5CHIA 4YY3K 1JL2A 1N34K 4BR9A 1GLJO 3Q7CA 1VSLA 4DB3A 5HP1A 4GV9A 1VQMN 3NCIA 4GW6A 5E26A 2P1JA 2AP1A 3CCJN 2GBZA 2CGJA 4BR2A 3CD6N 4FJJA 1NKBA 3ZETA 1DT9A 3FZKA 3K9KA 3CMAN 3U9ZA 4FVUA 4CBWA 3SAFA 3A5LC 3K9JA 1T03A 4PKGA 3HJFA 1SKSA 4JN4A 4QCLA 4BR4A 3ASMA 5AQKA 3NFAA 3VQQA 2HHWA 1BDGA 1VQKN 4BDYA 3OBWA 1KAYA 3G25A 1C0FA 3MEEA 1KXPA 3L2VA 4BRNA 5CE3A 4A2BA 3TTCA 2HBJA 3BDPA 3SAHA 5J2QA 3KK2A 1P8ZA 4EIAA 1EWQA 1QQNA 1HKBA 1KAZA 4N41A 4CJ3A 1BCMA 3SV3A 4C8MA 5SZTA 1RNHA 3LL3A 1JLGA 3EN9A 1Q18A 4DTPA 3OYDA 5BN8A 3AVKA 3WXLA 3AA4A 1N6QA 4DLGA 1S72N 5DM6L 1OH7A 2O8DB 4O8UA 4FM2A 3A0IX 1SL2A 4IOXA 4FYDA 1KVCA 1TKTA 1D9DA 2QK9A 4JRPA 3PX0A 5F0XA 2I5JA 1L3VA 1HYVA 2YHBA 2WOMA 1BUPA 4DR2K 4KREA 3MWTA 5FRMA 3IRXA 4I7FA 4X64K 5CYMA 1BO5O 1HKGA 1NGDA 3KWIA 4NXMK 4DQSA 2YJFA 2JLEA 3QETA 4AHUA 1VSIA 4JD2A 4QS7A 2FF6A 4DUYK 4H0OA 3IUCA 2P9UB 3HSTB 3ZSRA 1ZXOA 2Q3SA 3SZ2A 4BRGA 4H5RA 4CJWA 1VQ4N 3HP9A 1W2BM 4OPJA 4M3XA 4CK1A 3LDNA 3MWPA 1CLQA 2ZF5O 2YNHA 4CGFA 3T3FA 4OGEA 3DLEA 4BREA 4CF0A 4MO4A 3MAQA 3VETA 2W40A 5BRDA 3AGKA 2ZJPL 1KRPA 2OPSA 4DR7K 1KFSA 3HI0A 4IWVA 3UIQA 2Q0RA 1NJWA 3C95A 4K25A 4DV0K 4FJGA 3GE1A 3TTFA 4CGGA 2ZGZA 1HLUA 3CJ7A 4BRFA 4OX9K 2E2QA 4FSVA 1SL0A 2XY5A 3ZSVA 2P51A 3ISNC 5BRHA 1Q86O 4EAHD 1NGAA 4DU3A 3CCEN 3D45A 4BE0A 1HJOA 4C23A 3CQYA 2QWLA 3VEXA 2FBYA 2HNZA 2A40A 1HPMA 1S6PA 1WSFA 2XY7A 4RCHA 4FWMA 4CEQA 1JXBA 1Q8IA 2A1SA 2A41A 3NF9A 4C1NK 3THYB 5FLXO 3OW2M 4E7HA 5JLFA 1JLBA 3O3HA 3O1BA 4PL8A 4CZIA 3NMUA 3KLIA 3NH0A 1OVYA 4CERA 1HNXK 4L8RB 3KHYA 3T1YK 2XHBA 3QIOA 1O13A 3HPHA 5JVGL 4CEFA 5BPMA 4EFHA 4PHTX 2GUIA 3K58A 4GNIA 2P9LB 2ASPA 5E84A 5BR9A 2O8CA 4DQ8A 4CHYA 5M1OA 5HLFA 1NK8A 1S5JA 4KI4A 3CFPA 5AQVA 3D2EB 4BRIA 2RN2A 1NK6A 3T1AA 3HO1A 2XY6A 4LF4K 3V9SA 1VSDA 3QFPA 1LV5A 2FBTA 5T7BA 3ULEB 2GX9A 2KTQA 4CD1A 1KSPA 1ZYQA 3MN9A 4YHHK 2IGIA 1ZBSA 1WSEA 5IT9O 5AQTA 3E1YA 5D3GA 2E4LA 4H0XB 5AZIA 4BQZA 4CJFA 1L3UA 3O1WA 1NKEA 4DSEA 4CEZA 3SUPA 2GWKA 1YI2N 3L2QA 2EHGA 3R6MA 2BE2A 2KHOA 1JCFA 4CHOA 2GUPA 4JLHA 1JCGA 1Z25A 4YORA 3C7NA 1QSLA 3DLLL 2NRXA 1EP4A 4YFUA 3DOKA 1WB9A 3PLAA 3AAQA 4KPYA 2R7YA 4MO5A 1Q7YO 3HRGA 4BRKA 4JI1K 1DEJA 2BUPA 4K42A 3BF3A 3O9SA 1LAVA 5A2QO 3R1XA 1WSJA 2BH1A 3THWB 1U4BA 4BDPA 3VERA 2VG7A 2VWKA 1EXQA 3AVIA 1BCOA 5KRTA 3GG4A 5EY4A 3SCXA 3F9MA 3ATUA 3SQ4A 4K41A 4TSXA 3SUOA 3PX4A 4K8ZA 4KB1A 5MLCQ 5ELZA 1HUXA 3HZ6A 3WT0A 4DR3K 1U48A 1YVUA 4JK8A 1QQCA 4CHPA 2QXFA 2VQEK 1SL1A 2VWBA 1DKGD 3J81O 4Z0UA 1VQ5N 4B9MA 4CJ5A 4IG3A 2IDOA 1BWFO 3S3OA 4QOZB 1J5OA 5HRNA 3OS2A 3L2UA 3H3OB 4DV3K 1YJWN 3DYAA 3ZYYX 5AQXA 4CJQA 4H0VB 4IKFA 3RMBA 1T6CA 3AVJA 3I8DA 3OYGA 2PY5A 3TI0A 2QWQA 1MWMA 4K0KK 1MDUB 3OS1A 2FBXA 3DWLA 3PX6A 3TAEA 3LWLA 3AA2A 1TVRA 4O44A 4H0YB 4IFEA 4FL9A 3VGLA 1TKZA 3OYLA 1TYQA 2Y1IA 3ZSZA 3ENBA 3NF7A 1E4GT 5I3UA 4HCCA 1CZ9A 4O55A 1RDBA 1GOBA 3HL8A 4DUZK 4B9SA 3SI6A 3KK7A 1RCHA 1WLJA 3I55N 4JI8K 1TUYA 4DFKA 1D8YA 2HB5A 4LF9K 4ZTJA 2ZE2A 1Q9YA 4IZ9A 4ELTA 2V52B 1O1WA 4DFPA 4CFDA 4CZFA 2QWRA 4B8CA 2AJQA 4HUGA 4FZXC 4ISFA 3TAPA 5M1KA 1QVGM 1RTJA 4OPAA 4W5OA 2HSTA 4QS9A 4CJTA 1JLQA 4EZ9A 4BROA 3DRSA 5HRSA 3CM6A 2QXLA 5LY3A 1VSEA 3LDQA 4A5AA 4FK4A 2ASMA 5CZ2A 3NDKA 1S1XA 4J2DA 4U67L 4H5WA 1TL3A 4CBUA 1BOTO 4B8AB 1VQ9N 4CW7B 4X66K 2HHUA 2KFZA 1NLVA 4JI5K 4DTJA 5I9EB 4CFCA 4CZKA 4CZGA 2YNFA 3VENA 3MEGA 1HPZA 3V9WA 4B9TA 4Z4HA 2UU9K 3AVBA 1U2VA 1K8KB 4WQ4C 4H5VA 3LPUA 2BGGA 4BG8A 3WNGA 1NGHA 2E8AA 4CJKA 4GV3A 4AILC 4CEOA 1G99A 3D0PA 2QKKA 1Z26A 3PIOL 2B4JA 3FR0A 1OKJA 2W6LA 4FWNA 1VQ8N 1BA1A 4FJXA 2ASOA 3NF6A 1NJZA 4CEDA 4KH5A 3LDOA 3A2FA 3OYCA 3BY5A 3OA9A 3N4QA 5CY4A 4IJNA 4WQ4A 2D0AA 1XHZA 1IJJA 3EL2A 1S22A 4FJ8A 3DXKB 1NNEA 5EU7A 1S6QA 4IDKA 4DSJA 2OANA 4IO9L 4B9QA 5JLHA 1RT4A 1XQSC 1LAWA 2OPRA 3HP6A 4DTMA 1XWLA 3K59A 4IBNA 4ELUA 3CJCA 5ADXA 3MX2A 1JCEA 3CCQN 3FGUA 3RRGA 1XC9A 3HYFA 4Q5VA 2YI1A 4IFVA 1YXQA 4BGAA 3MX5A 4F2SA 4LF7K 3VQAA 3O4WA 4ISGA 4FJ5A 5JICA 3RRHA 4DTRA 1LOTB 4FW1A 3SQ0A 4CEAA 2YHWA 4JK7A 5FROA 4CJEA 3KZBA 4WQ5C 5K14A 3AO1A 4F8RA 1TKXA 1QHAA 3KLFA 4HUFA 2P9NA 2W42A 3H1QA 4WFBL 3L4IA 3QEIA 2X6NA 4BC3A 1ATSA 1YT3A 3LP2A 2G8IA 3SPZA 4PKIA 1TV6A 5JS2A 4RW6A 4GV6A 3LDPA 1P90A 3DXMB 1ASVA 4AHCA 4BC4A 4KB0A 4J2EA 3GL1A 4FJ9A 3VA0A 2O4GA 4O0JA 1MWKA 1U6ZA 2QA4N 4G9ZA 3FLCO 4CFBA 4JI3K 4DTSA 2GV9A 3ZT4A 4DQPA 4CE9A 2VG6A 4BWJA 2OYQA 3ZEUA 2D0CA 2V7ZA 4OKEA 1T6DA 5H1SQ 4FK0A 4FWKA 1WSIA 1WNSA 1HNIA 1KLMA 1W0HA 3E9PA 3VQ7A 3ZETB 3TWHA 4FCYA 2O8EA 3SLCA 4BWMA 3O6WA 2YJEA 3V1QA 5GIPA 3SQ1A 4DR4K 2P9IA 3T69A 4A57A 3WEEB 2WTUA 1RT7A 2HHSA 1GOAA 5FPNA 5M1FA 4FLWA 5AQOA 3VN5A 1REVA 4KHWA 2BTFA 4DHYA 3O08A 4CF2A 4H4MA 1EWRA 4K43A 1OVQA 4BR5A 1Q9XA 2E1YA 4DTXA 3L6QA 5C42A 3PIPL 3UKRA 4FK2A 3QICA 2OPPA 2VGNA 3EKSA 3FZLA 1WOQA 1A5VA 2VGMA 1UOCA 4JYAK 1NGFA 4DSKA 2VWJA 1GLAG 3L2WA 3C94A 3OYKA 1TUUA 3THVA 3S3MA 1SKRA 4O4GA 5GAHP 1KLNA 1XMOK 4FJNA 2QEXN 2HBMA 4OLAA 4CEBA 3T19A 4O0IA 4Y0WA 5LJWA 2OCEA 3NHGA 1YJNN 3H1VX 4GVMA 3CETA 3NE6A 2E6LA 1WAJA 2YNIA 2OZMA 3U9DA 4CECA 5SWMA 3K5OA 2OTJN 2PYJA 4DSFA 1Y64A 4E7KA 4LFBK 1ZBIA 3O9TA 2P9KA 3QDKA 3CCLN 4FZYA 3QBWA 4GMJB 4CF1A 2G8HA 2FLOA 2DFFA 2F9TA 4KO0A 1J9AA 1KFDA 4O5BA 5IWAK 1WAFA 3CFRA 4CF8A 4W5TA 4KHYA 2LSNA 3SUQA 4FJMA 4BC5A 1BI4B 4FM0A 4ILGB 1Q82O 1IG9A 3SYZA 3KJVA 2FSKA 4B9UA 3C65A 5TKYA 3NGZA 3RR8A 1IG8A 1QSSA 4WCEL 3J8AA 3VQCA 1TAUA 1GLLO 2CGKA 1SZ2A 3O5BA 1QSYA 2WC9A 3DLRA 1S1WA 3TSUA 4ICLA 3MN7A 4RTFD 4OPKA 1J54A 3QEXA 2KFNA 3NAEA 1L3TA 3K5LA 5F2RA 2V51B 3K0SA 3ZLJA 4EP5A 3AARA 3MCAB 3LZIA 5BRFA 5LMUK 5J2NA 4C8NA 1C1CA 3SQ2A 2DFEA 3CF5L 3CG7A 3OBYA 1NOYA 1GLEG 3IFRA 4B1VA 4JI4K 4BRAA 3VQ9A 4FXDA 2QM1A 1YUWA 2YX6A 1JLFA 2YKMA 5J2MA 4YOUA 4X65K 1V4TA 3TABA 4IO8A 4E7JA 3L2RA 1FKPA 4Z94A 4CESA 3QNNA 1ZBHA 3CQXA 3AVGA 5CYQA 5AZJA 3SBGA 4IJAA 1UA1A 4CZMA 3ENOA 1RT5A 3PUFA 4M41A 2P9SA 4AHVA 1X3NA 4CFAA 4M3UA 2YKNA 4FWQA 4B3SK 1FJGK 2UUBK 1C0MA 2NLXA 5M1NA 3TAFA 4LC9B 1NGCA 2KW4A 4E7LA 3KKRA 4YOXA 3MN6A 3PO4A 4OVLA 2HNYA 3H08A 5AQJA 1W9HA 2IVPA 2KKZA 4DR5K 4R5PA 2HBLA 3C6UA 3H45C 4J2BA 1NK0A 1ATRA 3V4IA 3LDLA 3I8BA 4H8KA 3KD1E 3MXIA 4IFYA 4IEEA 4CEEA 1SV5A 1VSKA 2F9WA 1OH8A 3OTOK 5BREA 1A5XA 1GLBG 1VRUA 2OTLN 4PKHA 3CFOA 3A5OC 2VQFK 4FOIA 2WONA 3U3GA 3PSFA 3VQ5A 5AZIB 2ZJQL 2BDPA 1XNQK 3SK3A 4X62K 3RMDA 1J6ZA 4FJ7A 1KCFA 3LM2A 3ZT3A 3OYMA 2UXDK 3O3FA 1SKWA 5F1XA 1HYSA 3LWMA 3C7NB 3EE9A 2PFUA 1NMDA 4N56A 2RHKA 4EHTA 4H03B 3TAGA 1RT1A 3ZX2A 4JS5A 3R9PA 4CBXA 5AQHA 4B9LA 3CCRN 4B3RK 1I94K 4LFCK 1KVAA 4DCHA 1TL1A 3OY9A 5FPDA 1BQNA 4H4OA 3MK6A 1IV0A 2OA8A 4JKFA 2E20A 4W5QA 1QHTA 3P83D 2RF2A 4HCBA 4YOTA 2P9LA 4DTNA 1VQNN 1EKEA 3DJCA 1M90O 2BANA 4UY8O 4LH5A 2YHXA 1NMNA 3TAMA 3D2EA 1D4XA 3B6PA 3MEDA 3UKUA 3M8SA 2ETJA 1W7AA 3P1GA 3ID8A 5GIOA 3AVCA 1YVNA 3FFIA 4AH9A 3BUZB 1OH6A 2HHTA 2NRTA 4ID5A 2V7YA 3QNOA 4RW8A 1BGXT 4IOCL 1UWBA 4F4KA 1RT3A 2E1ZA 4DV5K 2E6MA 4CJ4A 2HW3A 5AQZA 3AVMA 3KLEA 4CD3A 2F8SA 2QKBA 3EE8A 1IKYA 1RT6A 1ESVA 5AJ3K 1NU0A 1UAXA 1N8RO 2KZMA 2UUAK 4FLTA 5AQFA 5CR4A 3S41A 3I0RA 3AA3A 2DPNA 4GKKK 2RE2A 1Q81O 1ZBUA 4E1MA 1HR0K 1LW0A 3CC4N 3VPZA 4JHDB 3HVTA 3C6AA 2HVHA 2IOCA 3SNNA 4JKGB 1WBBA 1EX4A 2P9PA 4KKOA 3V6DA 1MU2A 2A3ZA 4NYNA 3THWA 3MXMA 4Z4EA 4W5NA 2NZTA 3ZSQA 1E3MA 3WUHA 5DMRA 4BRHA 1LWFA 5I42A 3AV9A 3V9ZA 4KBOA 4Z4IA 4E89A 1X9SA 3QEWA 5HOOA 4B1ZA 3A5MC 2PAVA 4FWSA 3KLHA 4DLEA 3LP1A 2HBKA 3AO5A 4K8XA 3RSEB 4EHUA 2O8FA 3OS0A 2B5JA 2KQ2A 3NH2A 3JSMA 1RBVA 1IBLK 4CK2A 4NCAA 2VCPA 4JKAA 3VF6A 4DV6K 5BPNA 2H3GX 3DOLA 1D5AA 2NNWA 3G10A 3F9KA 4M3ZA 1NK5A 4FM1A 2WUSA 4HTUA 4HWIA 1X9WA 4DSIA 2GTDA 4FJHA 1IO2A 4MLHA 1S1TA 3O9QA 4DV1K 4BRCA 2PZSA 4DR6K 5EOYA 5GAEP 1N32K 4CJ7A 3QINA 3KKSA 3BGRA 5KI6A 4CF9A 1QE1A 1TK0A 2OPQA 4ILHA 1RTIA 1B92A 5AQRA 3V9XA 3VGMA 1NGIA 3DLHA 4CZLA 3D6RA 5AR0A 1TK8A 4PQUA 1KVBA 2QTDA 3GOIA 3SUNA 2D0BA 3RTVA 3P39A 3G4SN 2HHQA 2Z1IA 3KLGA 3LPTA 3HOSA 1EO1A 3FZHA 5KQDA 4IG0A 1E4FT 1S1VA 3GDQA 2G8FA 1D9FA 4M42A 1BL3A 3SJJA 1YITN 3BZCA 4DQIA 2E2PA 3OYHA 4I6MB 3E9LA 3SMPA 1T7PA 1NM1A 1C1BA 3VQPA 4KHQA 4DSLA 3E9OA 4IOAL 1RBUA 3WXMB 3W3DA 4FLUA 1LWCA 4NB4A 4LD0A 3M3ZA 1RDUA 2A42A 3VQBA 5J1EA 3MECA 5HRRA 4CJPA 4E1NA 4B1UB 3V9UA 5AFUA 5J2PA 4B9NA 4CIEA 2ZGYA 4M3RA 4LH4A 3G6EN 1UA0A 2F8TA 4FO0A 2D0OA 3L8BA 3D2FA 3K2PA 4ID1A 1ASWA 4NXNK 4JAXA 3QFUA 5AQYA 1T8EA 1SQKA 1IKVA 4L3QA 3L3VA 1C1AA 1GLDG 1ZBLA 4H5TA 2A5XA
chains in the Genus database with same CATH topology
2FBYA 2HNZA 2XY7A 2EX3A 1S6PA 1WSFA 3S3MA 1S9EA 4O4GA 1SKRA 3NGYA 1KLNA 3CYMA 1ZBFA 2G8VA 4FJNA 1JXEA 2Y1JA 2FC0A 3V1RA 4OLAA 4CEBA 4CEQA 1JXBA 1Q8IA 2A1SA 3NF9A 3T19A 4BE1A 3M8PA 4E7HA 4O0IA 3NHGA 1JLBA 1FXXA 3O3HA 5HRPA 4GVMA 4DU1A 1U04A 3EYZA 4EP4A 3B6OA 3NE6A 2E6LA 3DM2A 1WAJA 2YNIA 1IH7A 3KLIA 3NH0A 2OZMA 4CECA 3AVAA 4CERA 5SWMA 4CGIA 3IAYA 3K5OA 4L8RB 4F3TA 2ZQBA 2PYJA 3VA3A 3LDSA 2P5GA 2XHBA 1J53A 3QIOA 4DSFA 2ZD1A 5C25A 4XIUA 4E7KA 4CIFA 4JRQA 3HPHA 1ZBIA 4CEFA 3K58A 4FZYA 2GUIA 3QO9A 3O4NA 2B6AA 4GMJB 4CF1A 1XI1A 4DG1A 2G8HA 2G8UA 1GOCA 3CM5A 4CHYA 2DFFA 2HHVA 3AO3A 3MXJA 4KO0A 5HLFA 1NK8A 1S5JA 4DU4A 4KI4A 1J9AA 1KFDA 2YNGA 3OVNA 3TR8A 4O5BA 3CFPA 2RN2A 1WAFA 3K5MA 3DLKA 3CFRA 3LP0A 3T1AA 1F21A 4CF8A 2XY6A 1NK6A 3RWUA 3HO1A 4W5TA 3V9SA 2LSNA 4KHYA 3SUQA 1VSDA 1TKDA 4HCCA 3DI6A 1RT2A 3OYEA 4FJMA 1RBTA 3ZSWA 5JS1A 3ZSXA 3KIOA 1LV5A 1BI4B 4FM0A 2FBTA 5T7BA 4CK3A 2KTQA 1IG9A 3SYZA 1HRHA 4CJVA 1KSPA 2F96A 3KJVA 1ZYQA 2IGIA 4B9UA 4KHSA 3KK1A 1WSEA 4C8LA 5D3GA 2E4LA 3NGZA 3SV4A 3RR8A 1QSSA 2YV0X 4E0DA 4LY7A 2IC3A 4CJFA 3VQCA 1L3UA 1TAUA 1IKWA 1NKEA 3KTQA 1QSYA 4DSEA 3DLRA 1S1WA 4ICLA 4CEZA 3SUPA 3ZCMA 2ITGA 4OPKA 2EHGA 1J54A 3AO2A 5KTQA 3L2QA 2BE2A 3ZT1A 4CHOA 3QEXA 4DMNA 4JLHA 2KFNA 1Z25A 3NAEA 3K5LA 1L3TA 5CZ1A 1QSLA 4UQGA 1EP4A 3WNFA 3DOKA 4B08A 4YFUA 1L3SA 4KPYA 2R7YA 4EP5A 3LZIA 4ZHRA 4BACA 5J2NA 4CJUA 4C8NA 1C1CA 4E7IA 3SQ2A 2DFEA 3U3YA 1EETA 4DS5A 2D5RA 1U47A 3CG7A 1VSJA 1SUQA 3S9HA 1NOYA 4OGCA 5KGWA 3TARA 4N76A 1HQEA 1LAVA 3L3UA 1U49A 2HNDA 4W5RA 1WSJA 3VQ9A 3AVFA 1U4BA 3JYTA 4BDPA 4FXDA 3ITHA 1JLFA 2VG7A 2YKMA 3O4QA 3OYAA 5J2MA 3SPYA 4Z4GA 4DF8A 4OLBA 3TABA 1TK5A 3OJUA 5KRSA 2VWKA 4OKKA 1EXQA 4CGDA 4F3OA 4E7JA 3L2RA 3AVIA 1FKPA 4CESA 3QNNA 1BCOA 1ZBHA 5KRTA 3NBPA 3AVGA 5CYQA 3SCXA 3ZSYA 4Y1DA 4QAGA 1UA1A 1HMVA 4OKJA 3HPOA 1RT5A 3QEPA 3PUFA 4M41A 3SQ4A 4FZZA 4TSXA 4FLXA 3SUOA 3PX4A 4K8ZA 4KB1A 1HNVA 2ATQA 4AHVA 4CFAA 4M3UA 5E41A 2YKNA 1U48A 1HYZA 1YVUA 1C0MA 4DQQA 1QQCA 3OYFA 4KTZA 5FDLA 3TAFA 4KI6A 4CHPA 4BE2A 2QXFA 4KRFA 3ZT2A 2KW4A 4E7LA 3KKRA 1ITGA 1SL1A 1VK0A 5DK5A 3PO4A 4OVLA 2HNYA 3H08A 4Z0UA 1W9HA 1QTMA 4B9MA 4NCGA 4CJ5A 3AVLA 4R5PA 4IG3A 3C6UA 3VQ6A 2IDOA 2RPIA 2G8WA 1WN7A 3HT3A 3S3OA 4J2BA 1JL1A 1NK0A 4QOZB 3V4IA 1J5OA 5HRNA 4H8KA 3OS2A 3L2UA 3KD1E 3MXIA 4IFYA 1BHLA 3DYAA 4CEEA 1C0UA 3AO4A 3VQ8A 4CJQA 1SV5A 4FVMA 4IKFA 3RMBA 1VSKA 3AVJA 3I8DA 4WE1A 3OYGA 2PY5A 3RMCA 1A5XA 2Z1GA 3TI0A 1NK4A 1VRUA 4PUOA 3OYJA 3ZT0A 3CFOA 2Z1HA 1NKCA 3OS1A 1NJXA 2FBXA 1L5UA 3PX6A 3TAEA 1CXUA 4KHUA 3LWLA 3AA2A 1X9MA 4C8KA 2WONA 4M3YA 3WNHA 3U3GA 1TVRA 3VQ5A 2HMIA 2BDPA 4O44A 3OJSA 4CGJA 4F2RA 1Y97A 1TGOA 3HM9A 3RMDA 4Q0BA 1BISA 1I39A 1TKZA 4FJ7A 3M8QA 4M3WA 3AA5X 1KCFA 4N5SA 3OYLA 2Y1IA 3ZT3A 3ZSZA 3OYMA 3O3FA 3NF7A 4FLVA 1SKWA 3QLHA 2DFHA 5I3UA 1HYSA 3ZSOA 3LAKA 1CZ9A 4O55A 3LWMA 1RDBA 4DFJA 3TANA 4I9LA 1GOBA 1DLOA 3HL8A 3QESA 3LALA 4CHZA 4N56A 2OZSA 4B9SA 3SI6A 3VQ4A 4CGHA 1RCHA 3TAGA 2IAJA 1WLJA 1RT1A 1NOZA 3QEVA 4JS5A 1XHXA 4B9LA 1I3AA 4DFKA 1D8YA 1R0AA 1C6VA 3LP3A 2HB5A 3V81A 4ZTJA 3PO5A 3LAMA 1KVAA 2ZE2A 3C6TA 1Q9YA 3DRRA 3M8RA 4ELTA 1TL1A 3OY9A 1O1WA 4DS4A 4DFPA 4CFDA 1BQNA 4H4OA 1RTDA 2YHAA 3HVRA 4C8OA 2DY4A 2OA8A 4I2QA 4B8CA 1NJYA 2AJQA 3AVHA 1B9DA 1B9FA 1BIUA 4W5QA 3K5NA 4HUGA 3TAPA 1QHTA 4FLYA 3P83D 4FZXC 3OYBA 3RMAA 1RTJA 2RF2A 4W5OA 4ELVA 3NH1A 4RG8A 1DTTA 2RKIA 4DF4A 4HCBA 1CXQA 2G8KA 1RBRA 4CJTA 1JLQA 3DLGA 4DTNA 4EZ9A 5HRSA 1EKEA 3DRSA 4M3TA 3CM6A 1K6YA 2DTUA 1A5WA 4CJSA 3QERA 4BDZA 1VSEA 3AVNA 2BANA 4FK4A 1IKXA 4E19A 2PYLA 3P5JA 4LH5A 5CZ2A 5KGXA 1S1XA 3TAMA 3V1OA 3NDKA 4JS4A 3MEDA 3B6PA 3U6FA 4LSLA 3M8SA 4NCBA 2ETJA 2XO7A 4J2DA 4PY5A 4KAZA 3P1GA 1RILA 4Z4CA 3AVCA 4DTOA 1TL3A 3FFIA 3G0ZA 4AH9A 2HHTA 1WSHA 4ID5A 4RW7A 1HQUA 4B8AB 3QNOA 1JKHA 4RW8A 1BGXT 3PV8A 1UWBA 4F4KA 1RT3A 1BI4A 3DLBA 2HHUA 1HJRA 2JGUA 2KFZA 4RW4A 2E6MA 1LW2A 4CJ4A 1T05A 2HW3A 1DTQA 3AVMA 3KLEA 4E3SA 2F8SA 1VSHA 2QKBA 1IKYA 1RT6A 3EZ5A 1FKOA 4DTJA 4CFCA 5HROA 3OYIA 2YNFA 4KV8A 3O3GA 4F8RA 1JLCA 1X1PA 3E01A 1FK9A 3ALYA 1HPZA 3MEGA 4HVJA 3V9WA 4FJIA 2XY8A 1UAXA 4B9TA 4Z4HA 2KZMA 4FLTA 1JL2A 4ZTFA 2FBVA 3I0RA 4CHNA 3AA3A 3AVBA 4J2AA 4HHTA 1VSLA 5HP1A 1ZBUA 4E1MA 1LW0A 3NCIA 1U45A 1LWEA 4CCHA 4GW6A 1KTQA 3LPUA 2BGGA 2P1JA 3WNGA 1BIZA 3HVTA 3NGIA 2HVHA 1NK7A 3QIPA 2GBZA 2IOCA 4CJKA 4HUEA 4FLZA 3SNNA 4AILC 1NKBA 4FJJA 4CEOA 1EX4A 3D0PA 4KKOA 3V6DA 2QKKA 1Z26A 5FRNA 1MU2A 2B4JA 4NYNA 4CHQA 2VG5A 3OYNA 4DQRA 1QS4A 3MXMA 3DRPA 4FJXA 3NF6A 4N47A 4Z4EA 1NJZA 4W5NA 1T03A 4CEDA 3HJFA 4AHSA 4I9QA 3DMJA 4LSNA 3ZSQA 1YTAA 3A2FA 3OYCA 5DMRA 3HXMA 4PWDA 1LWFA 1SKSA 5I42A 1ASUA 3AV9A 3V9ZA 3ASMA 4QCLA 5CY4A 1XHZA 2D0AA 2P5OA 4Z4IA 3NFAA 4E89A 3VQQA 2HHWA 1RBSA 3QEWA 3IS9A 1X9SA 1VSMA 4BDYA 4FJ8A 2KZZA 5EU7A 2HHXA 1S6QA 4IDKA 4DSJA 3KLHA 3MEEA 4DLEA 3LP1A 3AO5A 4K8XA 1RT4A 3L2VA 4DTMA 1LAWA 2OPRA 4CJRA 3HP6A 1XWLA 3CQ8A 3K59A 4IBNA 1N5YA 3OS0A 3PY8A 4ELUA 3BDPA 2B5JA 2KQ2A 3NH2A 3JSMA 1RBVA 5J2QA 4CK2A 3KK2A 4PA1A 3S3NA 1WSGA 4NCAA 4EZ6A 3I0SA 3DOLA 1D5AA 3G10A 4N41A 3F9KA 4M3ZA 1NK5A 3RRGA 4OJRA 1JLAA 4FM1A 4CJ3A 1BQMA 1BCMA 3SV3A 1XC9A 4C8MA 3HYFA 4HTUA 4Q5VA 2X6SA 5SZTA 1X9WA 4IFVA 4Y1CA 3RR7A 4DSIA 1RNHA 1JLGA 1NK9A 4FJHA 1IO2A 1JLEA 1S9GA 4F2SA 1VRTA 3VQAA 1S1TA 4DTPA 3OYDA 2O4IA 4FJ5A 3AVKA 3F73A 3RRHA 4KFBA 4DTRA 3AA4A 1C0TA 4FW1A 2PZSA 3SQ0A 1N6QA 4CEAA 4DLGA 1G15A 5FROA 4CJEA 3KK3A 3QINA 2IS3A 3AO1A 1TKXA 3KKSA 3BGRA 5K14A 5KI6A 4AHRA 3KLFA 1RTHA 3WNEA 1QE1A 4CF9A 2W42A 4HUFA 4FM2A 1TK0A 2OPQA 3KD5E 3QEIA 1SL2A 4FYDA 1KVCA 2X6NA 3LP2A 1YT3A 4I2PA 2G8IA 3SPZA 1RTIA 1TKTA 1B92A 1D9DA 1TV6A 2QK9A 3V9XA 4JRPA 3PX0A 2I5JA 3VQDA 1L3VA 1HYVA 2YHBA 2WOMA 4FJKA 5JS2A 4B9VA 4RW6A 3DLHA 1VSFA 4KREA 2Z1JA 5FRMA 1RDDA 4MFBA 4CIGA 4DWIA 3IRXA 1ASVA 4I7FA 1KVBA 4AHCA 1TK8A 4KB0A 4J2EA 5CYMA 4PQUA 4FJ9A 4YNQA 3VA0A 3SUNA 2O4GA 4O0JA 2D0BA 4CJLA 3RTVA 2HHQA 2X74A 4DQSA 4CFBA 2JLEA 2Z1IA 4KTWA 3QETA 4AHUA 3KLGA 4DTSA 3LPTA 1VSIA 2GV9A 3HPGA 3ZT4A 4IG0A 3K57A 4CE9A 4DQPA 2HVIA 2A1RA 1S1VA 2G8FA 2VG6A 1S1UA 4BWJA 1D9FA 2OYQA 1YTUA 2D0CA 4M42A 4DTUA 2X78A 1BL3A 3HSTB 3ZSRA 2Q3SA 3LZJA 3SZ2A 3SJJA 4KHNA 4DQIA 4OKEA 3OYHA 3TAQA 4FK0A 1WSIA 4CJWA 4KTQA 1T7PA 1WNSA 4B3OA 3VQPA 1C1BA 4KHQA 1HNIA 4DSLA 1KLMA 1W0HA 4M45A 3VQ7A 3HP9A 3TWHA 1RBUA 4FCYA 4FJLA 3LANA 4OPJA 4M3XA 4CK1A 4FLUA 4BWMA 4FW2A 1LWCA 3NF8A 4LD0A 3V1QA 3SQ1A 1CLQA 2YNHA 5HBMA 3VQBA 4CGFA 5J1EA 3MECA 3T3FA 4DFMA 5HRRA 4CJPA 4E1NA 4OGEA 1TAQA 1RT7A 2HHSA 1GOAA 5C24A 3DLEA 3V9UA 4RW9A 1CZBA 4CF0A 5J2PA 4B9NA 4CIEA 4FLWA 3MAQA 3VN5A 4M3RA 4LH4A 3IG1A 1UA0A 1REVA 4KHWA 1KRPA 2OPSA 2F8TA 4G1QA 1KFSA 3UIQA 1NJWA 4CF2A 3C95A 4Z4FA 1RDAA 4H4MA 4NYFA 1RDCA 4AHTA 3EY1A 4FJGA 3L8BA 3K2PA 1Q9XA 4MQ3A 2NUBA 4CGGA 4DTXA 3HK2A 4ID1A 1ASWA 5C42A 1SL0A 2XY5A 3ZSVA 2P51A 1T8EA 3ISNC 3VQEA 4FK2A 2OPPA 1IKVA 4DU3A 3D45A 3ULDA 4BE0A 1A5VA 1UOCA 4DSKA 3L3VA 1C1AA 2VWJA 1ZBLA 3L2WA 3C94A 3OYKA 2XRIA 3THVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBY A;  2HNZ A;  2XY7 A;  2EX3 A;  1S6P A;  1WSF A;  3S3M A;  1S9E A;  4O4G A;  1SKR A;  3NGY A;  1KLN A;  3CYM A;  1ZBF A;  2G8V A;  4FJN A;  1JXE A;  2Y1J A;  2FC0 A;  3V1R A;  4OLA A;  4CEB A;  4CEQ A;  1JXB A;  1Q8I A;  2A1S A;  3NF9 A;  3T19 A;  4BE1 A;  3M8P A;  4E7H A;  4O0I A;  3NHG A;  1JLB A;  1FXX A;  3O3H A;  5HRP A;  4GVM A;  4DU1 A;  1U04 A;  3EYZ A;  4EP4 A;  3B6O A;  3NE6 A;  2E6L A;  3DM2 A;  1WAJ A;  2YNI A;  1IH7 A;  3KLI A;  3NH0 A;  2OZM A;  4CEC A;  3AVA A;  4CER A;  5SWM A;  4CGI A;  3IAY A;  3K5O A;  4L8R B;  4F3T A;  2ZQB A;  2PYJ A;  3VA3 A;  3LDS A;  2P5G A;  2XHB A;  1J53 A;  3QIO A;  4DSF A;  2ZD1 A;  5C25 A;  4XIU A;  4E7K A;  4CIF A;  4JRQ A;  3HPH A;  1ZBI A;  4CEF A;  3K58 A;  4FZY A;  2GUI A;  3QO9 A;  3O4N A;  2B6A A;  4GMJ B;  4CF1 A;  1XI1 A;  4DG1 A;  2G8H A;  2G8U A;  1GOC A;  3CM5 A;  4CHY A;  2DFF A;  2HHV A;  3AO3 A;  3MXJ A;  4KO0 A;  5HLF A;  1NK8 A;  1S5J A;  4DU4 A;  4KI4 A;  1J9A A;  1KFD A;  2YNG A;  3OVN A;  3TR8 A;  4O5B A;  3CFP A;  2RN2 A;  1WAF A;  3K5M A;  3DLK A;  3CFR A;  3LP0 A;  3T1A A;  1F21 A;  4CF8 A;  2XY6 A;  1NK6 A;  3RWU A;  3HO1 A;  4W5T A;  3V9S A;  2LSN A;  4KHY A;  3SUQ A;  1VSD A;  1TKD A;  4HCC A;  3DI6 A;  1RT2 A;  3OYE A;  4FJM A;  1RBT A;  3ZSW A;  5JS1 A;  3ZSX A;  3KIO A;  1LV5 A;  1BI4 B;  4FM0 A;  2FBT A;  5T7B A;  4CK3 A;  2KTQ A;  1IG9 A;  3SYZ A;  1HRH A;  4CJV A;  1KSP A;  2F96 A;  3KJV A;  1ZYQ A;  2IGI A;  4B9U A;  4KHS A;  3KK1 A;  1WSE A;  4C8L A;  5D3G A;  2E4L A;  3NGZ A;  3SV4 A;  3RR8 A;  1QSS A;  2YV0 X;  4E0D A;  4LY7 A;  2IC3 A;  4CJF A;  3VQC A;  1L3U A;  1TAU A;  1IKW A;  1NKE A;  3KTQ A;  1QSY A;  4DSE A;  3DLR A;  1S1W A;  4ICL A;  4CEZ A;  3SUP A;  3ZCM A;  2ITG A;  4OPK A;  2EHG A;  1J54 A;  3AO2 A;  5KTQ A;  3L2Q A;  2BE2 A;  3ZT1 A;  4CHO A;  3QEX A;  4DMN A;  4JLH A;  2KFN A;  1Z25 A;  3NAE A;  3K5L A;  1L3T A;  5CZ1 A;  1QSL A;  4UQG A;  1EP4 A;  3WNF A;  3DOK A;  4B08 A;  4YFU A;  1L3S A;  4KPY A;  2R7Y A;  4EP5 A;  3LZI A;  4ZHR A;  4BAC A;  5J2N A;  4CJU A;  4C8N A;  1C1C A;  4E7I A;  3SQ2 A;  2DFE A;  3U3Y A;  1EET A;  4DS5 A;  2D5R A;  1U47 A;  3CG7 A;  1VSJ A;  1SUQ A;  3S9H A;  1NOY A;  4OGC A;  5KGW A;  3TAR A;  4N76 A;  1HQE A;  1LAV A;  3L3U A;  1U49 A;  2HND A;  4W5R A;  1WSJ A;  3VQ9 A;  3AVF A;  1U4B A;  3JYT A;  4BDP A;  4FXD A;  3ITH A;  1JLF A;  2VG7 A;  2YKM A;  3O4Q A;  3OYA A;  5J2M A;  3SPY A;  4Z4G A;  4DF8 A;  4OLB A;  3TAB A;  1TK5 A;  3OJU A;  5KRS A;  2VWK A;  4OKK A;  1EXQ A;  4CGD A;  4F3O A;  4E7J A;  3L2R A;  3AVI A;  1FKP A;  4CES A;  3QNN A;  1BCO A;  1ZBH A;  5KRT A;  3NBP A;  3AVG A;  5CYQ A;  3SCX A;  3ZSY A;  4Y1D A;  4QAG A;  1UA1 A;  1HMV A;  4OKJ A;  3HPO A;  1RT5 A;  3QEP A;  3PUF A;  4M41 A;  3SQ4 A;  4FZZ A;  4TSX A;  4FLX A;  3SUO A;  3PX4 A;  4K8Z A;  4KB1 A;  1HNV A;  2ATQ A;  4AHV A;  4CFA A;  4M3U A;  5E41 A;  2YKN A;  1U48 A;  1HYZ A;  1YVU A;  1C0M A;  4DQQ A;  1QQC A;  3OYF A;  4KTZ A;  5FDL A;  3TAF A;  4KI6 A;  4CHP A;  4BE2 A;  2QXF A;  4KRF A;  3ZT2 A;  2KW4 A;  4E7L A;  3KKR A;  1ITG A;  1SL1 A;  1VK0 A;  5DK5 A;  3PO4 A;  4OVL A;  2HNY A;  3H08 A;  4Z0U A;  1W9H A;  1QTM A;  4B9M A;  4NCG A;  4CJ5 A;  3AVL A;  4R5P A;  4IG3 A;  3C6U A;  3VQ6 A;  2IDO A;  2RPI A;  2G8W A;  1WN7 A;  3HT3 A;  3S3O A;  4J2B A;  1JL1 A;  1NK0 A;  4QOZ B;  3V4I A;  1J5O A;  5HRN A;  4H8K A;  3OS2 A;  3L2U A;  3KD1 E;  3MXI A;  4IFY A;  1BHL A;  3DYA A;  4CEE A;  1C0U A;  3AO4 A;  3VQ8 A;  4CJQ A;  1SV5 A;  4FVM A;  4IKF A;  3RMB A;  1VSK A;  3AVJ A;  3I8D A;  4WE1 A;  3OYG A;  2PY5 A;  3RMC A;  1A5X A;  2Z1G A;  3TI0 A;  1NK4 A;  1VRU A;  4PUO A;  3OYJ A;  3ZT0 A;  3CFO A;  2Z1H A;  1NKC A;  3OS1 A;  1NJX A;  2FBX A;  1L5U A;  3PX6 A;  3TAE A;  1CXU A;  4KHU A;  3LWL A;  3AA2 A;  1X9M A;  4C8K A;  2WON A;  4M3Y A;  3WNH A;  3U3G A;  1TVR A;  3VQ5 A;  2HMI A;  2BDP A;  4O44 A;  3OJS A;  4CGJ A;  4F2R A;  1Y97 A;  1TGO A;  3HM9 A;  3RMD A;  4Q0B A;  1BIS A;  1I39 A;  1TKZ A;  4FJ7 A;  3M8Q A;  4M3W A;  3AA5 X;  1KCF A;  4N5S A;  3OYL A;  2Y1I A;  3ZT3 A;  3ZSZ A;  3OYM A;  3O3F A;  3NF7 A;  4FLV A;  1SKW A;  3QLH A;  2DFH A;  5I3U A;  1HYS A;  3ZSO A;  3LAK A;  1CZ9 A;  4O55 A;  3LWM A;  1RDB A;  4DFJ A;  3TAN A;  4I9L A;  1GOB A;  1DLO A;  3HL8 A;  3QES A;  3LAL A;  4CHZ A;  4N56 A;  2OZS A;  4B9S A;  3SI6 A;  3VQ4 A;  4CGH A;  1RCH A;  3TAG A;  2IAJ A;  1WLJ A;  1RT1 A;  1NOZ A;  3QEV A;  4JS5 A;  1XHX A;  4B9L A;  1I3A A;  4DFK A;  1D8Y A;  1R0A A;  1C6V A;  3LP3 A;  2HB5 A;  3V81 A;  4ZTJ A;  3PO5 A;  3LAM A;  1KVA A;  2ZE2 A;  3C6T A;  1Q9Y A;  3DRR A;  3M8R A;  4ELT A;  1TL1 A;  3OY9 A;  1O1W A;  4DS4 A;  4DFP A;  4CFD A;  1BQN A;  4H4O A;  1RTD A;  2YHA A;  3HVR A;  4C8O A;  2DY4 A;  2OA8 A;  4I2Q A;  4B8C A;  1NJY A;  2AJQ A;  3AVH A;  1B9D A;  1B9F A;  1BIU A;  4W5Q A;  3K5N A;  4HUG A;  3TAP A;  1QHT A;  4FLY A;  3P83 D;  4FZX C;  3OYB A;  3RMA A;  1RTJ A;  2RF2 A;  4W5O A;  4ELV A;  3NH1 A;  4RG8 A;  1DTT A;  2RKI A;  4DF4 A;  4HCB A;  1CXQ A;  2G8K A;  1RBR A;  4CJT A;  1JLQ A;  3DLG A;  4DTN A;  4EZ9 A;  5HRS A;  1EKE A;  3DRS A;  4M3T A;  3CM6 A;  1K6Y A;  2DTU A;  1A5W A;  4CJS A;  3QER A;  4BDZ A;  1VSE A;  3AVN A;  2BAN A;  4FK4 A;  1IKX A;  4E19 A;  2PYL A;  3P5J A;  4LH5 A;  5CZ2 A;  5KGX A;  1S1X A;  3TAM A;  3V1O A;  3NDK A;  4JS4 A;  3MED A;  3B6P A;  3U6F A;  4LSL A;  3M8S A;  4NCB A;  2ETJ A;  2XO7 A;  4J2D A;  4PY5 A;  4KAZ A;  3P1G A;  1RIL A;  4Z4C A;  3AVC A;  4DTO A;  1TL3 A;  3FFI A;  3G0Z A;  4AH9 A;  2HHT A;  1WSH A;  4ID5 A;  4RW7 A;  1HQU A;  4B8A B;  3QNO A;  1JKH A;  4RW8 A;  1BGX T;  3PV8 A;  1UWB A;  4F4K A;  1RT3 A;  1BI4 A;  3DLB A;  2HHU A;  1HJR A;  2JGU A;  2KFZ A;  4RW4 A;  2E6M A;  1LW2 A;  4CJ4 A;  1T05 A;  2HW3 A;  1DTQ A;  3AVM A;  3KLE A;  4E3S A;  2F8S A;  1VSH A;  2QKB A;  1IKY A;  1RT6 A;  3EZ5 A;  1FKO A;  4DTJ A;  4CFC A;  5HRO A;  3OYI A;  2YNF A;  4KV8 A;  3O3G A;  4F8R A;  1JLC A;  1X1P A;  3E01 A;  1FK9 A;  3ALY A;  1HPZ A;  3MEG A;  4HVJ A;  3V9W A;  4FJI A;  2XY8 A;  1UAX A;  4B9T A;  4Z4H A;  2KZM A;  4FLT A;  1JL2 A;  4ZTF A;  2FBV A;  3I0R A;  4CHN A;  3AA3 A;  3AVB A;  4J2A A;  4HHT A;  1VSL A;  5HP1 A;  1ZBU A;  4E1M A;  1LW0 A;  3NCI A;  1U45 A;  1LWE A;  4CCH A;  4GW6 A;  1KTQ A;  3LPU A;  2BGG A;  2P1J A;  3WNG A;  1BIZ A;  3HVT A;  3NGI A;  2HVH A;  1NK7 A;  3QIP A;  2GBZ A;  2IOC A;  4CJK A;  4HUE A;  4FLZ A;  3SNN A;  4AIL C;  1NKB A;  4FJJ A;  4CEO A;  1EX4 A;  3D0P A;  4KKO A;  3V6D A;  2QKK A;  1Z26 A;  5FRN A;  1MU2 A;  2B4J A;  4NYN A;  4CHQ A;  2VG5 A;  3OYN A;  4DQR A;  1QS4 A;  3MXM A;  3DRP A;  4FJX A;  3NF6 A;  4N47 A;  4Z4E A;  1NJZ A;  4W5N A;  1T03 A;  4CED A;  3HJF A;  4AHS A;  4I9Q A;  3DMJ A;  4LSN A;  3ZSQ A;  1YTA A;  3A2F A;  3OYC A;  5DMR A;  3HXM A;  4PWD A;  1LWF A;  1SKS A;  5I42 A;  1ASU A;  3AV9 A;  3V9Z A;  3ASM A;  4QCL A;  5CY4 A;  1XHZ A;  2D0A A;  2P5O A;  4Z4I A;  3NFA A;  4E89 A;  3VQQ A;  2HHW A;  1RBS A;  3QEW A;  3IS9 A;  1X9S A;  1VSM A;  4BDY A;  4FJ8 A;  2KZZ A;  5EU7 A;  2HHX A;  1S6Q A;  4IDK A;  4DSJ A;  3KLH A;  3MEE A;  4DLE A;  3LP1 A;  3AO5 A;  4K8X A;  1RT4 A;  3L2V A;  4DTM A;  1LAW A;  2OPR A;  4CJR A;  3HP6 A;  1XWL A;  3CQ8 A;  3K59 A;  4IBN A;  1N5Y A;  3OS0 A;  3PY8 A;  4ELU A;  3BDP A;  2B5J A;  2KQ2 A;  3NH2 A;  3JSM A;  1RBV A;  5J2Q A;  4CK2 A;  3KK2 A;  4PA1 A;  3S3N A;  1WSG A;  4NCA A;  4EZ6 A;  3I0S A;  3DOL A;  1D5A A;  3G10 A;  4N41 A;  3F9K A;  4M3Z A;  1NK5 A;  3RRG A;  4OJR A;  1JLA A;  4FM1 A;  4CJ3 A;  1BQM A;  1BCM A;  3SV3 A;  1XC9 A;  4C8M A;  3HYF A;  4HTU A;  4Q5V A;  2X6S A;  5SZT A;  1X9W A;  4IFV A;  4Y1C A;  3RR7 A;  4DSI A;  1RNH A;  1JLG A;  1NK9 A;  4FJH A;  1IO2 A;  1JLE A;  1S9G A;  4F2S A;  1VRT A;  3VQA A;  1S1T A;  4DTP A;  3OYD A;  2O4I A;  4FJ5 A;  3AVK A;  3F73 A;  3RRH A;  4KFB A;  4DTR A;  3AA4 A;  1C0T A;  4FW1 A;  2PZS A;  3SQ0 A;  1N6Q A;  4CEA A;  4DLG A;  1G15 A;  5FRO A;  4CJE A;  3KK3 A;  3QIN A;  2IS3 A;  3AO1 A;  1TKX A;  3KKS A;  3BGR A;  5K14 A;  5KI6 A;  4AHR A;  3KLF A;  1RTH A;  3WNE A;  1QE1 A;  4CF9 A;  2W42 A;  4HUF A;  4FM2 A;  1TK0 A;  2OPQ A;  3KD5 E;  3QEI A;  1SL2 A;  4FYD A;  1KVC A;  2X6N A;  3LP2 A;  1YT3 A;  4I2P A;  2G8I A;  3SPZ A;  1RTI A;  1TKT A;  1B92 A;  1D9D A;  1TV6 A;  2QK9 A;  3V9X A;  4JRP A;  3PX0 A;  2I5J A;  3VQD A;  1L3V A;  1HYV A;  2YHB A;  2WOM A;  4FJK A;  5JS2 A;  4B9V A;  4RW6 A;  3DLH A;  1VSF A;  4KRE A;  2Z1J A;  5FRM A;  1RDD A;  4MFB A;  4CIG A;  4DWI A;  3IRX A;  1ASV A;  4I7F A;  1KVB A;  4AHC A;  1TK8 A;  4KB0 A;  4J2E A;  5CYM A;  4PQU A;  4FJ9 A;  4YNQ A;  3VA0 A;  3SUN A;  2O4G A;  4O0J A;  2D0B A;  4CJL A;  3RTV A;  2HHQ A;  2X74 A;  4DQS A;  4CFB A;  2JLE A;  2Z1I A;  4KTW A;  3QET A;  4AHU A;  3KLG A;  4DTS A;  3LPT A;  1VSI A;  2GV9 A;  3HPG A;  3ZT4 A;  4IG0 A;  3K57 A;  4CE9 A;  4DQP A;  2HVI A;  2A1R A;  1S1V A;  2G8F A;  2VG6 A;  1S1U A;  4BWJ A;  1D9F A;  2OYQ A;  1YTU A;  2D0C A;  4M42 A;  4DTU A;  2X78 A;  1BL3 A;  3HST B;  3ZSR A;  2Q3S A;  3LZJ A;  3SZ2 A;  3SJJ A;  4KHN A;  4DQI A;  4OKE A;  3OYH A;  3TAQ A;  4FK0 A;  1WSI A;  4CJW A;  4KTQ A;  1T7P A;  1WNS A;  4B3O A;  3VQP A;  1C1B A;  4KHQ A;  1HNI A;  4DSL A;  1KLM A;  1W0H A;  4M45 A;  3VQ7 A;  3HP9 A;  3TWH A;  1RBU A;  4FCY A;  4FJL A;  3LAN A;  4OPJ A;  4M3X A;  4CK1 A;  4FLU A;  4BWM A;  4FW2 A;  1LWC A;  3NF8 A;  4LD0 A;  3V1Q A;  3SQ1 A;  1CLQ A;  2YNH A;  5HBM A;  3VQB A;  4CGF A;  5J1E A;  3MEC A;  3T3F A;  4DFM A;  5HRR A;  4CJP A;  4E1N A;  4OGE A;  1TAQ A;  1RT7 A;  2HHS A;  1GOA A;  5C24 A;  3DLE A;  3V9U A;  4RW9 A;  1CZB A;  4CF0 A;  5J2P A;  4B9N A;  4CIE A;  4FLW A;  3MAQ A;  3VN5 A;  4M3R A;  4LH4 A;  3IG1 A;  1UA0 A;  1REV A;  4KHW A;  1KRP A;  2OPS A;  2F8T A;  4G1Q A;  1KFS A;  3UIQ A;  1NJW A;  4CF2 A;  3C95 A;  4Z4F A;  1RDA A;  4H4M A;  4NYF A;  1RDC A;  4AHT A;  3EY1 A;  4FJG A;  3L8B A;  3K2P A;  1Q9X A;  4MQ3 A;  2NUB A;  4CGG A;  4DTX A;  3HK2 A;  4ID1 A;  1ASW A;  5C42 A;  1SL0 A;  2XY5 A;  3ZSV A;  2P51 A;  1T8E A;  3ISN C;  3VQE A;  4FK2 A;  2OPP A;  1IKV A;  4DU3 A;  3D45 A;  3ULD A;  4BE0 A;  1A5V A;  1UOC A;  4DSK A;  3L3V A;  1C1A A;  2VWJ A;  1ZBL A;  3L2W A;  3C94 A;  3OYK A;  2XRI A;  3THV A; 
#chains in the Genus database with same CATH topology
 1S9E A;  3NGY A;  1XUP O;  1ZBF A;  1JXE A;  5FPE A;  2FC0 A;  3FZF A;  3M8P A;  4R79 A;  3HBT A;  1FXX A;  5EXW A;  3T7Z A;  1U04 A;  5EX5 A;  3EYZ A;  4EP4 A;  5ADX H;  3DM2 A;  1IH7 A;  2CH6 A;  3WXI A;  3IAY A;  4OO1 J;  4BVP A;  1WBD A;  2P5G A;  1J53 A;  1YIJ N;  4JRQ A;  3D7E O;  3G71 N;  3QO9 A;  4KH4 A;  3CIP A;  3O4N A;  3H46 O;  2B6A A;  3BEX A;  1M1K O;  2G8U A;  4DG1 A;  1GOC A;  5GAD P;  3RVC A;  4XEI A;  2HMP A;  3AO3 A;  3MXJ A;  3CJB A;  4KHP K;  1SS6 A;  2YNG A;  3OVN A;  3TR8 A;  4BVO A;  1HNZ K;  4DR1 K;  3VEW A;  3TU5 A;  1KQS M;  3K5M A;  3LP0 A;  1KD1 O;  2NRW A;  4CZH A;  5KPZ A;  3OYE A;  5JS1 A;  1RBT A;  3ZEU B;  3ZSW A;  1X3M A;  2Q31 A;  4JI7 K;  4BR0 A;  1K73 O;  2AA4 A;  1HRH A;  1SAZ A;  4KHS A;  3KK1 A;  5M1P A;  3SV4 A;  2O8E B;  2YV0 X;  3MDQ A;  4E0D A;  4LY7 A;  3DXK A;  1BU6 O;  1JJ2 M;  3KTQ A;  3C6H A;  5HL7 L;  3MN5 A;  3ZCM A;  2ITG A;  3AO2 A;  3ZT1 A;  4DMN A;  4WQ5 A;  3JS6 A;  5CZ1 A;  4JEP A;  2D0P A;  1QVF M;  5C0Y A;  2A6A A;  2I7N A;  2D5R A;  1U47 A;  1VSJ A;  1SUQ A;  4ISE A;  2O8B A;  2GEL A;  1QQO A;  1NJI O;  1HQE A;  3L3U A;  1U49 A;  5LJV A;  3JYT A;  2E5L K;  3WQT A;  4FWR A;  3ITH A;  3HTV A;  3Q7B A;  1FW6 A;  4DF8 A;  1K8A O;  4BRD A;  1TK5 A;  3QBX A;  3OJU A;  4OKK A;  3B8A X;  3NBP A;  3ZSY A;  1T44 A;  1HMV A;  3VES A;  1ATN A;  3HPO A;  4IXC A;  3QEP A;  3VEV A;  3CCS N;  1IBM K;  1QQM A;  2ATQ A;  4JNE A;  3TSP A;  4DQQ A;  3OYF A;  4KTZ A;  4BR7 A;  5KPT A;  1V4S A;  4BE2 A;  3CPW M;  5C12 A;  1ITG A;  2P9K B;  4JKH A;  4CVN E;  1K9M O;  1QZ6 A;  1VK0 A;  2QWO A;  5DK5 A;  3M5R A;  1QTM A;  4FPA A;  3AVL A;  3I56 N;  2RPI A;  2G8W A;  1WN7 A;  3HT3 A;  3IMX A;  3FE1 A;  3CER A;  3THX A;  3AO4 A;  2NRZ A;  1J5E K;  3A5N C;  4FVM A;  3WEE A;  5B8H A;  4WE1 A;  4HTL A;  3RMC A;  1NK4 A;  3AY9 A;  4PUO A;  1KAX A;  4MDB A;  1NKC A;  1NJX A;  4B3T K;  1L5U A;  4JI0 K;  3VEZ A;  3VTH A;  1Z6R A;  1CXU A;  4WF9 L;  3J7Z O;  3EEQ A;  2UYT A;  1CZA N;  1DGK N;  2Q36 A;  3OJS A;  1RFQ A;  4F2R A;  2Q2R A;  1TGO A;  3HM9 A;  4Q0B A;  2FXU A;  1OH5 A;  2F7T A;  3M8Q A;  4M3W A;  3AA5 X;  4N5S A;  4BRP A;  3J7Y P;  4JD2 B;  4FLV A;  2DFH A;  5LMN K;  1ILY A;  4I9L A;  1DLO A;  3QES A;  3LAL A;  4CZJ A;  3VQ4 A;  4CGH A;  4CZE A;  1NOZ A;  3CJA A;  1XHX A;  4M7Y A;  3LAM A;  3C6T A;  4A62 A;  3M8R A;  3P31 A;  4B3M K;  4DS4 A;  3TTD A;  5C15 A;  1RTD A;  2YHA A;  4C8O A;  3OHR A;  4MDA A;  4J8F A;  4I2Q A;  1NG9 A;  3AVH A;  3K5N A;  3WXJ A;  3IKM A;  4FLY A;  3R8E A;  2NRH A;  3RMA A;  4ELV A;  4YOW A;  4RG8 A;  1DTT A;  2RKI A;  5AZJ B;  4DF4 A;  4AQY K;  1H1V A;  3DLG A;  5M1Q A;  4M3T A;  3SAG A;  1NWK A;  4CJS A;  2P9S B;  3QER A;  3AVN A;  1IKX A;  3F5T A;  4E19 A;  4B1W B;  3P5J A;  5KGX A;  3U6F A;  2ITM A;  4JS4 A;  5AQL A;  4LSL A;  3C0B A;  2Q1N A;  4NCB A;  2XO7 A;  1N36 K;  3VMF B;  4PY5 A;  1RIL A;  4BRQ A;  4Z4C A;  4DTO A;  3G0Z A;  2O8D A;  3I33 A;  4RW7 A;  1BI4 A;  3DLB A;  1HJR A;  4RW4 A;  4XH5 A;  1LW2 A;  1DTQ A;  2JWL A;  4F9O A;  1VSH A;  3J7A P;  1FKO A;  4AM6 A;  5C10 A;  4KV8 A;  3O3G A;  3CXC M;  1X1P A;  3E01 A;  3ALY A;  4DV4 K;  4FJI A;  4LF8 K;  1HNW K;  3N4P A;  4ZTF A;  2FBV A;  4CHN A;  3U8X A;  4J2A A;  4GKJ K;  4HHT A;  3W0L A;  1U45 A;  1LWE A;  4CCH A;  2O8C B;  5AQW A;  2P9U A;  1KTQ A;  1BIZ A;  3NGI A;  3ZX0 A;  1NK7 A;  3EZW A;  3QIP A;  1VHX A;  4FLZ A;  4HUE A;  4OPH A;  4KH6 A;  5FRN A;  4CHQ A;  3L0Q A;  3T1H K;  2VG5 A;  3OYN A;  4DQR A;  3H6E A;  1QS4 A;  3DRP A;  4N47 A;  1VQP N;  3TPQ A;  4AHS A;  4I9Q A;  3DMJ A;  4LSN A;  1YTA A;  4PWD A;  3HXM A;  1ASU A;  4BC2 A;  2ZM6 K;  2P5O A;  3VF2 A;  3CJ9 A;  3UB5 A;  1RBS A;  3IS9 A;  1VSM A;  1YF5 L;  3KVG A;  3VEO A;  2KZZ A;  2Q0U A;  2HHX A;  4JI6 K;  4LF5 K;  4E1J A;  4CJR A;  2YCH A;  4A61 A;  3CQ8 A;  1N5Y A;  1QZ5 A;  4YOY A;  3PY8 A;  3ID6 A;  1S3X A;  4PA1 A;  1WSG A;  3S3N A;  2EWS A;  4EZ6 A;  3I0S A;  2WFB A;  2FSN A;  4OJR A;  1JLA A;  1BQM A;  1GLC G;  2ZJR L;  3RR7 A;  2X6S A;  4Y1C A;  1XC3 A;  2FSJ A;  1NK9 A;  1JLE A;  1S9G A;  5C2D A;  1XNR K;  1VRT A;  3A8Y A;  3THY A;  2O4I A;  1IBK K;  2YHY A;  3UKU B;  3F73 A;  3U4L A;  4KFB A;  1C0T A;  1G15 A;  1C0G A;  3KK3 A;  2IS3 A;  4MLE A;  4AHR A;  1RTH A;  3WNE A;  3KD5 E;  4IEI A;  4I2P A;  3M1F A;  3VQD A;  4FJK A;  4B9V A;  1VSF A;  5AQM A;  4NLB A;  2Z1J A;  3H3N O;  1RDD A;  2WBN A;  4MFB A;  4CIG A;  4DWI A;  3AAP A;  4YNQ A;  4CJL A;  4XH1 A;  4B1X B;  2X74 A;  4BG9 A;  4KTW A;  3CC2 N;  3EKU A;  3HPG A;  3K57 A;  2ZWH A;  4O8K A;  2HVI A;  1EQY A;  2W41 A;  2FF3 B;  2A1R A;  1S1U A;  1YTU A;  4H0P A;  4DTU A;  1WUA A;  2X78 A;  3LZJ A;  4KHN A;  3TAQ A;  3ULE A;  2QI2 A;  3EO3 A;  4KTQ A;  3BP8 A;  3CI5 A;  5TKW A;  4B3O A;  4M45 A;  1VQO N;  3VGK A;  4FJL A;  2P9P B;  3LAN A;  2JWK A;  2QWP A;  2UUC K;  1NGB A;  4FW2 A;  3NF8 A;  3IDH A;  5DM7 L;  4JKE A;  5HBM A;  3WXK A;  4DFM A;  4JK9 A;  4AM7 A;  1TAQ A;  3BF1 A;  5C24 A;  4RW9 A;  1CZB A;  4IDH A;  3IG1 A;  4U7B A;  4G1Q A;  3CCV N;  4Z4F A;  1RDA A;  2E2O A;  4NYF A;  1RDC A;  4A5B A;  1NGG A;  4AHT A;  3EY1 A;  5AQN A;  3MCP A;  4MQ3 A;  2NUB A;  3HK2 A;  4M63 C;  4NLC A;  2J4R A;  4RWT A;  1TYQ B;  3JXU A;  3L4Q A;  3VQE A;  2O8F B;  1W97 L;  4JKD A;  2I7P A;  4B1Y B;  2CGL A;  3HOT A;  3ULD A;  4JI2 K;  1RGI A;  2XRI A;  3JAM O;  2EX3 A;  3TSQ A;  2HF4 A;  3CYM A;  2G8V A;  2Y1J A;  3V1R A;  1VAZ A;  5JVH L;  4BQL A;  5KPR A;  4BE1 A;  2E88 A;  1T3V A;  5HRP A;  4DU1 A;  3B6O A;  4DV7 K;  3HSC A;  5AQP A;  4BRM A;  3AVA A;  4CGI A;  3CME N;  3CPE A;  4F3T A;  2ZQB A;  3CCU N;  3VA3 A;  3LDS A;  1XMQ K;  2ZD1 A;  4A2A A;  5AQS A;  5C25 A;  4XIU A;  4CIF A;  4PL7 A;  3F2K A;  3M6G A;  3FFK B;  4JHD A;  1XI1 A;  3MMV A;  3CM5 A;  1KC8 O;  3R3L A;  3ZX3 A;  2HHV A;  1N33 K;  2NRV A;  4DU4 A;  3PSI A;  2NRR A;  4JKG A;  4FOE A;  4YOV A;  1NGJ A;  2Q97 A;  3CJ1 A;  3DLK A;  3RWU A;  1F21 A;  3WQU A;  4GY2 B;  4QS8 A;  4JV5 K;  3J80 O;  1TKD A;  2W6K A;  1RT2 A;  3DI6 A;  3ZSX A;  3KIO A;  3QML A;  4CK3 A;  2QW9 A;  4CJV A;  2F96 A;  3KWG A;  4C8L A;  1YJ9 N;  4DV2 K;  3VEY A;  2IC3 A;  4FPB A;  1IKW A;  4O5F A;  3NVK A;  2PBD A;  5EVZ A;  3RSE A;  3UE5 A;  2UXC K;  4JKB A;  5KTQ A;  1U2V B;  4WFA L;  4UQG A;  4B08 A;  3WNF A;  1L3S A;  4FWO A;  4ZHR A;  3BZK A;  3CHW A;  4BAC A;  3D2F B;  4CJU A;  4E7I A;  3U3Y A;  1EET A;  2HOE A;  4DS5 A;  4GVE A;  2QWM A;  3S9H A;  1ZC6 A;  4OGC A;  5AFU H;  3NVM A;  5KGW A;  3TAR A;  4N76 A;  2HND A;  4W5R A;  3AVF A;  3AGR A;  3QB0 A;  3CCM N;  4H5N A;  4BY9 C;  3O4Q A;  3OYA A;  3SPY A;  4Z4G A;  1MA9 B;  4OLB A;  2IIR A;  1YAG A;  2GEM A;  5KRS A;  4CGD A;  4F3O A;  4DKW A;  1RDW X;  4Y1D A;  4QAG A;  4OKJ A;  2D1K A;  3O80 A;  5BR8 K;  4FZZ A;  4YDU C;  4FLX A;  1HNV A;  5E41 A;  5AQU A;  1HYZ A;  5FDL A;  4KI6 A;  4KRF A;  3ZT2 A;  1GLF O;  4JKC A;  5GAG P;  1X9J A;  3O8M A;  4NCG A;  3O9U A;  4I6M A;  4BRL A;  3VQ6 A;  4H0T B;  3LM9 A;  2IVO A;  1JL1 A;  1HKC A;  5C2F A;  4BGB A;  5BPL A;  4YDU A;  1BHL A;  3FZM A;  1C0U A;  3VQ8 A;  2P9N B;  4XH4 A;  2Z1G A;  3SBT A;  3OYJ A;  3ZT0 A;  2Z1H A;  1K8K A;  1HX1 A;  1YHQ N;  4KHU A;  4C8K A;  1X9M A;  4M3Y A;  4A59 A;  3WNH A;  4ILJ A;  2HMI A;  5GIN A;  4CGJ A;  1Y97 A;  3ENH A;  3VTI A;  2KLA A;  2F4V K;  1BIS A;  1I39 A;  5FPM A;  1BA0 A;  4V19 S;  2QWN A;  3HM8 A;  3QLH A;  3SJH A;  2D4W A;  3LAK A;  3ZSO A;  3VOV A;  4DFJ A;  3TAN A;  4FWP A;  4M7X A;  2GWJ A;  4CHZ A;  2OZS A;  1VQ6 N;  2IAJ A;  3QEV A;  2CH5 A;  1I3A A;  3CC7 N;  1R0A A;  1C6V A;  2HHH K;  3LP3 A;  2O8B B;  3V81 A;  5JMV A;  3PO5 A;  4LFA K;  3DRR A;  4FWL A;  5LL6 Z;  2P9I B;  1Z05 A;  3E66 A;  1LCU A;  3HVR A;  2DY4 A;  1NJY A;  5BN9 A;  2E2N A;  1B9D A;  1R59 O;  1B9F A;  1BIU A;  2UXB K;  3OYB A;  3NH1 A;  1CXQ A;  2G8K A;  1RBR A;  2IVN A;  1NGE A;  1K6Y A;  3P4I A;  2DTU A;  1A5W A;  4BDZ A;  3UKR B;  4CI6 A;  1BG3 A;  2PYL A;  3V1O A;  3O9R A;  5AQG A;  4WYB A;  4KAZ A;  2VYP A;  1NBW A;  5KQ8 A;  1WSH A;  1HQU A;  3VF4 A;  1JKH A;  3PV8 A;  2HF3 A;  4LF6 K;  2JGU A;  1T05 A;  3P38 A;  4E3S A;  4C1N I;  3EZ5 A;  5AQI A;  3DAW A;  5HRO A;  3SMS A;  3OYI A;  3DXM A;  1JLC A;  3THX B;  4AF1 A;  5AQQ A;  1VQL N;  1FK9 A;  4NO7 A;  4HVJ A;  4WFN L;  3GBT A;  2XY8 A;  1VQ7 N;  3ATV A;  5CHI A;  4YY3 K;  1JL2 A;  1N34 K;  4BR9 A;  1GLJ O;  3Q7C A;  1VSL A;  4DB3 A;  5HP1 A;  4GV9 A;  1VQM N;  3NCI A;  4GW6 A;  5E26 A;  2P1J A;  2AP1 A;  3CCJ N;  2GBZ A;  2CGJ A;  4BR2 A;  3CD6 N;  4FJJ A;  1NKB A;  3ZET A;  1DT9 A;  3FZK A;  3K9K A;  3CMA N;  3U9Z A;  4FVU A;  4CBW A;  3SAF A;  3A5L C;  3K9J A;  1T03 A;  4PKG A;  3HJF A;  1SKS A;  4JN4 A;  4QCL A;  4BR4 A;  3ASM A;  5AQK A;  3NFA A;  3VQQ A;  2HHW A;  1BDG A;  1VQK N;  4BDY A;  3OBW A;  1KAY A;  3G25 A;  1C0F A;  3MEE A;  1KXP A;  3L2V A;  4BRN A;  5CE3 A;  4A2B A;  3TTC A;  2HBJ A;  3BDP A;  3SAH A;  5J2Q A;  3KK2 A;  1P8Z A;  4EIA A;  1EWQ A;  1QQN A;  1HKB A;  1KAZ A;  4N41 A;  4CJ3 A;  1BCM A;  3SV3 A;  4C8M A;  5SZT A;  1RNH A;  3LL3 A;  1JLG A;  3EN9 A;  1Q18 A;  4DTP A;  3OYD A;  5BN8 A;  3AVK A;  3WXL A;  3AA4 A;  1N6Q A;  4DLG A;  1S72 N;  5DM6 L;  1OH7 A;  2O8D B;  4O8U A;  4FM2 A;  3A0I X;  1SL2 A;  4IOX A;  4FYD A;  1KVC A;  1TKT A;  1D9D A;  2QK9 A;  4JRP A;  3PX0 A;  5F0X A;  2I5J A;  1L3V A;  1HYV A;  2YHB A;  2WOM A;  1BUP A;  4DR2 K;  4KRE A;  3MWT A;  5FRM A;  3IRX A;  4I7F A;  4X64 K;  5CYM A;  1BO5 O;  1HKG A;  1NGD A;  3KWI A;  4NXM K;  4DQS A;  2YJF A;  2JLE A;  3QET A;  4AHU A;  1VSI A;  4JD2 A;  4QS7 A;  2FF6 A;  4DUY K;  4H0O A;  3IUC A;  2P9U B;  3HST B;  3ZSR A;  1ZXO A;  2Q3S A;  3SZ2 A;  4BRG A;  4H5R A;  4CJW A;  1VQ4 N;  3HP9 A;  1W2B M;  4OPJ A;  4M3X A;  4CK1 A;  3LDN A;  3MWP A;  1CLQ A;  2ZF5 O;  2YNH A;  4CGF A;  3T3F A;  4OGE A;  3DLE A;  4BRE A;  4CF0 A;  4MO4 A;  3MAQ A;  3VET A;  2W40 A;  5BRD A;  3AGK A;  2ZJP L;  1KRP A;  2OPS A;  4DR7 K;  1KFS A;  3HI0 A;  4IWV A;  3UIQ A;  2Q0R A;  1NJW A;  3C95 A;  4K25 A;  4DV0 K;  4FJG A;  3GE1 A;  3TTF A;  4CGG A;  2ZGZ A;  1HLU A;  3CJ7 A;  4BRF A;  4OX9 K;  2E2Q A;  4FSV A;  1SL0 A;  2XY5 A;  3ZSV A;  2P51 A;  3ISN C;  5BRH A;  1Q86 O;  4EAH D;  1NGA A;  4DU3 A;  3CCE N;  3D45 A;  4BE0 A;  1HJO A;  4C23 A;  3CQY A;  2QWL A;  3VEX A;  2FBY A;  2HNZ A;  2A40 A;  1HPM A;  1S6P A;  1WSF A;  2XY7 A;  4RCH A;  4FWM A;  4CEQ A;  1JXB A;  1Q8I A;  2A1S A;  2A41 A;  3NF9 A;  4C1N K;  3THY B;  5FLX O;  3OW2 M;  4E7H A;  5JLF A;  1JLB A;  3O3H A;  3O1B A;  4PL8 A;  4CZI A;  3NMU A;  3KLI A;  3NH0 A;  1OVY A;  4CER A;  1HNX K;  4L8R B;  3KHY A;  3T1Y K;  2XHB A;  3QIO A;  1O13 A;  3HPH A;  5JVG L;  4CEF A;  5BPM A;  4EFH A;  4PHT X;  2GUI A;  3K58 A;  4GNI A;  2P9L B;  2ASP A;  5E84 A;  5BR9 A;  2O8C A;  4DQ8 A;  4CHY A;  5M1O A;  5HLF A;  1NK8 A;  1S5J A;  4KI4 A;  3CFP A;  5AQV A;  3D2E B;  4BRI A;  2RN2 A;  1NK6 A;  3T1A A;  3HO1 A;  2XY6 A;  4LF4 K;  3V9S A;  1VSD A;  3QFP A;  1LV5 A;  2FBT A;  5T7B A;  3ULE B;  2GX9 A;  2KTQ A;  4CD1 A;  1KSP A;  1ZYQ A;  3MN9 A;  4YHH K;  2IGI A;  1ZBS A;  1WSE A;  5IT9 O;  5AQT A;  3E1Y A;  5D3G A;  2E4L A;  4H0X B;  5AZI A;  4BQZ A;  4CJF A;  1L3U A;  3O1W A;  1NKE A;  4DSE A;  4CEZ A;  3SUP A;  2GWK A;  1YI2 N;  3L2Q A;  2EHG A;  3R6M A;  2BE2 A;  2KHO A;  1JCF A;  4CHO A;  2GUP A;  4JLH A;  1JCG A;  1Z25 A;  4YOR A;  3C7N A;  1QSL A;  3DLL L;  2NRX A;  1EP4 A;  4YFU A;  3DOK A;  1WB9 A;  3PLA A;  3AAQ A;  4KPY A;  2R7Y A;  4MO5 A;  1Q7Y O;  3HRG A;  4BRK A;  4JI1 K;  1DEJ A;  2BUP A;  4K42 A;  3BF3 A;  3O9S A;  1LAV A;  5A2Q O;  3R1X A;  1WSJ A;  2BH1 A;  3THW B;  1U4B A;  4BDP A;  3VER A;  2VG7 A;  2VWK A;  1EXQ A;  3AVI A;  1BCO A;  5KRT A;  3GG4 A;  5EY4 A;  3SCX A;  3F9M A;  3ATU A;  3SQ4 A;  4K41 A;  4TSX A;  3SUO A;  3PX4 A;  4K8Z A;  4KB1 A;  5MLC Q;  5ELZ A;  1HUX A;  3HZ6 A;  3WT0 A;  4DR3 K;  1U48 A;  1YVU A;  4JK8 A;  1QQC A;  4CHP A;  2QXF A;  2VQE K;  1SL1 A;  2VWB A;  1DKG D;  3J81 O;  4Z0U A;  1VQ5 N;  4B9M A;  4CJ5 A;  4IG3 A;  2IDO A;  1BWF O;  3S3O A;  4QOZ B;  1J5O A;  5HRN A;  3OS2 A;  3L2U A;  3H3O B;  4DV3 K;  1YJW N;  3DYA A;  3ZYY X;  5AQX A;  4CJQ A;  4H0V B;  4IKF A;  3RMB A;  1T6C A;  3AVJ A;  3I8D A;  3OYG A;  2PY5 A;  3TI0 A;  2QWQ A;  1MWM A;  4K0K K;  1MDU B;  3OS1 A;  2FBX A;  3DWL A;  3PX6 A;  3TAE A;  3LWL A;  3AA2 A;  1TVR A;  4O44 A;  4H0Y B;  4IFE A;  4FL9 A;  3VGL A;  1TKZ A;  3OYL A;  1TYQ A;  2Y1I A;  3ZSZ A;  3ENB A;  3NF7 A;  1E4G T;  5I3U A;  4HCC A;  1CZ9 A;  4O55 A;  1RDB A;  1GOB A;  3HL8 A;  4DUZ K;  4B9S A;  3SI6 A;  3KK7 A;  1RCH A;  1WLJ A;  3I55 N;  4JI8 K;  1TUY A;  4DFK A;  1D8Y A;  2HB5 A;  4LF9 K;  4ZTJ A;  2ZE2 A;  1Q9Y A;  4IZ9 A;  4ELT A;  2V52 B;  1O1W A;  4DFP A;  4CFD A;  4CZF A;  2QWR A;  4B8C A;  2AJQ A;  4HUG A;  4FZX C;  4ISF A;  3TAP A;  5M1K A;  1QVG M;  1RTJ A;  4OPA A;  4W5O A;  2HST A;  4QS9 A;  4CJT A;  1JLQ A;  4EZ9 A;  4BRO A;  3DRS A;  5HRS A;  3CM6 A;  2QXL A;  5LY3 A;  1VSE A;  3LDQ A;  4A5A A;  4FK4 A;  2ASM A;  5CZ2 A;  3NDK A;  1S1X A;  4J2D A;  4U67 L;  4H5W A;  1TL3 A;  4CBU A;  1BOT O;  4B8A B;  1VQ9 N;  4CW7 B;  4X66 K;  2HHU A;  2KFZ A;  1NLV A;  4JI5 K;  4DTJ A;  5I9E B;  4CFC A;  4CZK A;  4CZG A;  2YNF A;  3VEN A;  3MEG A;  1HPZ A;  3V9W A;  4B9T A;  4Z4H A;  2UU9 K;  3AVB A;  1U2V A;  1K8K B;  4WQ4 C;  4H5V A;  3LPU A;  2BGG A;  4BG8 A;  3WNG A;  1NGH A;  2E8A A;  4CJK A;  4GV3 A;  4AIL C;  4CEO A;  1G99 A;  3D0P A;  2QKK A;  1Z26 A;  3PIO L;  2B4J A;  3FR0 A;  1OKJ A;  2W6L A;  4FWN A;  1VQ8 N;  1BA1 A;  4FJX A;  2ASO A;  3NF6 A;  1NJZ A;  4CED A;  4KH5 A;  3LDO A;  3A2F A;  3OYC A;  3BY5 A;  3OA9 A;  3N4Q A;  5CY4 A;  4IJN A;  4WQ4 A;  2D0A A;  1XHZ A;  1IJJ A;  3EL2 A;  1S22 A;  4FJ8 A;  3DXK B;  1NNE A;  5EU7 A;  1S6Q A;  4IDK A;  4DSJ A;  2OAN A;  4IO9 L;  4B9Q A;  5JLH A;  1RT4 A;  1XQS C;  1LAW A;  2OPR A;  3HP6 A;  4DTM A;  1XWL A;  3K59 A;  4IBN A;  4ELU A;  3CJC A;  5ADX A;  3MX2 A;  1JCE A;  3CCQ N;  3FGU A;  3RRG A;  1XC9 A;  3HYF A;  4Q5V A;  2YI1 A;  4IFV A;  1YXQ A;  4BGA A;  3MX5 A;  4F2S A;  4LF7 K;  3VQA A;  3O4W A;  4ISG A;  4FJ5 A;  5JIC A;  3RRH A;  4DTR A;  1LOT B;  4FW1 A;  3SQ0 A;  4CEA A;  2YHW A;  4JK7 A;  5FRO A;  4CJE A;  3KZB A;  4WQ5 C;  5K14 A;  3AO1 A;  4F8R A;  1TKX A;  1QHA A;  3KLF A;  4HUF A;  2P9N A;  2W42 A;  3H1Q A;  4WFB L;  3L4I A;  3QEI A;  2X6N A;  4BC3 A;  1ATS A;  1YT3 A;  3LP2 A;  2G8I A;  3SPZ A;  4PKI A;  1TV6 A;  5JS2 A;  4RW6 A;  4GV6 A;  3LDP A;  1P90 A;  3DXM B;  1ASV A;  4AHC A;  4BC4 A;  4KB0 A;  4J2E A;  3GL1 A;  4FJ9 A;  3VA0 A;  2O4G A;  4O0J A;  1MWK A;  1U6Z A;  2QA4 N;  4G9Z A;  3FLC O;  4CFB A;  4JI3 K;  4DTS A;  2GV9 A;  3ZT4 A;  4DQP A;  4CE9 A;  2VG6 A;  4BWJ A;  2OYQ A;  3ZEU A;  2D0C A;  2V7Z A;  4OKE A;  1T6D A;  5H1S Q;  4FK0 A;  4FWK A;  1WSI A;  1WNS A;  1HNI A;  1KLM A;  1W0H A;  3E9P A;  3VQ7 A;  3ZET B;  3TWH A;  4FCY A;  2O8E A;  3SLC A;  4BWM A;  3O6W A;  2YJE A;  3V1Q A;  5GIP A;  3SQ1 A;  4DR4 K;  2P9I A;  3T69 A;  4A57 A;  3WEE B;  2WTU A;  1RT7 A;  2HHS A;  1GOA A;  5FPN A;  5M1F A;  4FLW A;  5AQO A;  3VN5 A;  1REV A;  4KHW A;  2BTF A;  4DHY A;  3O08 A;  4CF2 A;  4H4M A;  1EWR A;  4K43 A;  1OVQ A;  4BR5 A;  1Q9X A;  2E1Y A;  4DTX A;  3L6Q A;  5C42 A;  3PIP L;  3UKR A;  4FK2 A;  3QIC A;  2OPP A;  2VGN A;  3EKS A;  3FZL A;  1WOQ A;  1A5V A;  2VGM A;  1UOC A;  4JYA K;  1NGF A;  4DSK A;  2VWJ A;  1GLA G;  3L2W A;  3C94 A;  3OYK A;  1TUU A;  3THV A;  3S3M A;  1SKR A;  4O4G A;  5GAH P;  1KLN A;  1XMO K;  4FJN A;  2QEX N;  2HBM A;  4OLA A;  4CEB A;  3T19 A;  4O0I A;  4Y0W A;  5LJW A;  2OCE A;  3NHG A;  1YJN N;  3H1V X;  4GVM A;  3CET A;  3NE6 A;  2E6L A;  1WAJ A;  2YNI A;  2OZM A;  3U9D A;  4CEC A;  5SWM A;  3K5O A;  2OTJ N;  2PYJ A;  4DSF A;  1Y64 A;  4E7K A;  4LFB K;  1ZBI A;  3O9T A;  2P9K A;  3QDK A;  3CCL N;  4FZY A;  3QBW A;  4GMJ B;  4CF1 A;  2G8H A;  2FLO A;  2DFF A;  2F9T A;  4KO0 A;  1J9A A;  1KFD A;  4O5B A;  5IWA K;  1WAF A;  3CFR A;  4CF8 A;  4W5T A;  4KHY A;  2LSN A;  3SUQ A;  4FJM A;  4BC5 A;  1BI4 B;  4FM0 A;  4ILG B;  1Q82 O;  1IG9 A;  3SYZ A;  3KJV A;  2FSK A;  4B9U A;  3C65 A;  5TKY A;  3NGZ A;  3RR8 A;  1IG8 A;  1QSS A;  4WCE L;  3J8A A;  3VQC A;  1TAU A;  1GLL O;  2CGK A;  1SZ2 A;  3O5B A;  1QSY A;  2WC9 A;  3DLR A;  1S1W A;  3TSU A;  4ICL A;  3MN7 A;  4RTF D;  4OPK A;  1J54 A;  3QEX A;  2KFN A;  3NAE A;  1L3T A;  3K5L A;  5F2R A;  2V51 B;  3K0S A;  3ZLJ A;  4EP5 A;  3AAR A;  3MCA B;  3LZI A;  5BRF A;  5LMU K;  5J2N A;  4C8N A;  1C1C A;  3SQ2 A;  2DFE A;  3CF5 L;  3CG7 A;  3OBY A;  1NOY A;  1GLE G;  3IFR A;  4B1V A;  4JI4 K;  4BRA A;  3VQ9 A;  4FXD A;  2QM1 A;  1YUW A;  2YX6 A;  1JLF A;  2YKM A;  5J2M A;  4YOU A;  4X65 K;  1V4T A;  3TAB A;  4IO8 A;  4E7J A;  3L2R A;  1FKP A;  4Z94 A;  4CES A;  3QNN A;  1ZBH A;  3CQX A;  3AVG A;  5CYQ A;  5AZJ A;  3SBG A;  4IJA A;  1UA1 A;  4CZM A;  3ENO A;  1RT5 A;  3PUF A;  4M41 A;  2P9S A;  4AHV A;  1X3N A;  4CFA A;  4M3U A;  2YKN A;  4FWQ A;  4B3S K;  1FJG K;  2UUB K;  1C0M A;  2NLX A;  5M1N A;  3TAF A;  4LC9 B;  1NGC A;  2KW4 A;  4E7L A;  3KKR A;  4YOX A;  3MN6 A;  3PO4 A;  4OVL A;  2HNY A;  3H08 A;  5AQJ A;  1W9H A;  2IVP A;  2KKZ A;  4DR5 K;  4R5P A;  2HBL A;  3C6U A;  3H45 C;  4J2B A;  1NK0 A;  1ATR A;  3V4I A;  3LDL A;  3I8B A;  4H8K A;  3KD1 E;  3MXI A;  4IFY A;  4IEE A;  4CEE A;  1SV5 A;  1VSK A;  2F9W A;  1OH8 A;  3OTO K;  5BRE A;  1A5X A;  1GLB G;  1VRU A;  2OTL N;  4PKH A;  3CFO A;  3A5O C;  2VQF K;  4FOI A;  2WON A;  3U3G A;  3PSF A;  3VQ5 A;  5AZI B;  2ZJQ L;  2BDP A;  1XNQ K;  3SK3 A;  4X62 K;  3RMD A;  1J6Z A;  4FJ7 A;  1KCF A;  3LM2 A;  3ZT3 A;  3OYM A;  2UXD K;  3O3F A;  1SKW A;  5F1X A;  1HYS A;  3LWM A;  3C7N B;  3EE9 A;  2PFU A;  1NMD A;  4N56 A;  2RHK A;  4EHT A;  4H03 B;  3TAG A;  1RT1 A;  3ZX2 A;  4JS5 A;  3R9P A;  4CBX A;  5AQH A;  4B9L A;  3CCR N;  4B3R K;  1I94 K;  4LFC K;  1KVA A;  4DCH A;  1TL1 A;  3OY9 A;  5FPD A;  1BQN A;  4H4O A;  3MK6 A;  1IV0 A;  2OA8 A;  4JKF A;  2E20 A;  4W5Q A;  1QHT A;  3P83 D;  2RF2 A;  4HCB A;  4YOT A;  2P9L A;  4DTN A;  1VQN N;  1EKE A;  3DJC A;  1M90 O;  2BAN A;  4UY8 O;  4LH5 A;  2YHX A;  1NMN A;  3TAM A;  3D2E A;  1D4X A;  3B6P A;  3MED A;  3UKU A;  3M8S A;  2ETJ A;  1W7A A;  3P1G A;  3ID8 A;  5GIO A;  3AVC A;  1YVN A;  3FFI A;  4AH9 A;  3BUZ B;  1OH6 A;  2HHT A;  2NRT A;  4ID5 A;  2V7Y A;  3QNO A;  4RW8 A;  1BGX T;  4IOC L;  1UWB A;  4F4K A;  1RT3 A;  2E1Z A;  4DV5 K;  2E6M A;  4CJ4 A;  2HW3 A;  5AQZ A;  3AVM A;  3KLE A;  4CD3 A;  2F8S A;  2QKB A;  3EE8 A;  1IKY A;  1RT6 A;  1ESV A;  5AJ3 K;  1NU0 A;  1UAX A;  1N8R O;  2KZM A;  2UUA K;  4FLT A;  5AQF A;  5CR4 A;  3S41 A;  3I0R A;  3AA3 A;  2DPN A;  4GKK K;  2RE2 A;  1Q81 O;  1ZBU A;  4E1M A;  1HR0 K;  1LW0 A;  3CC4 N;  3VPZ A;  4JHD B;  3HVT A;  3C6A A;  2HVH A;  2IOC A;  3SNN A;  4JKG B;  1WBB A;  1EX4 A;  2P9P A;  4KKO A;  3V6D A;  1MU2 A;  2A3Z A;  4NYN A;  3THW A;  3MXM A;  4Z4E A;  4W5N A;  2NZT A;  3ZSQ A;  1E3M A;  3WUH A;  5DMR A;  4BRH A;  1LWF A;  5I42 A;  3AV9 A;  3V9Z A;  4KBO A;  4Z4I A;  4E89 A;  1X9S A;  3QEW A;  5HOO A;  4B1Z A;  3A5M C;  2PAV A;  4FWS A;  3KLH A;  4DLE A;  3LP1 A;  2HBK A;  3AO5 A;  4K8X A;  3RSE B;  4EHU A;  2O8F A;  3OS0 A;  2B5J A;  2KQ2 A;  3NH2 A;  3JSM A;  1RBV A;  1IBL K;  4CK2 A;  4NCA A;  2VCP A;  4JKA A;  3VF6 A;  4DV6 K;  5BPN A;  2H3G X;  3DOL A;  1D5A A;  2NNW A;  3G10 A;  3F9K A;  4M3Z A;  1NK5 A;  4FM1 A;  2WUS A;  4HTU A;  4HWI A;  1X9W A;  4DSI A;  2GTD A;  4FJH A;  1IO2 A;  4MLH A;  1S1T A;  3O9Q A;  4DV1 K;  4BRC A;  2PZS A;  4DR6 K;  5EOY A;  5GAE P;  1N32 K;  4CJ7 A;  3QIN A;  3KKS A;  3BGR A;  5KI6 A;  4CF9 A;  1QE1 A;  1TK0 A;  2OPQ A;  4ILH A;  1RTI A;  1B92 A;  5AQR A;  3V9X A;  3VGM A;  1NGI A;  3DLH A;  4CZL A;  3D6R A;  5AR0 A;  1TK8 A;  4PQU A;  1KVB A;  2QTD A;  3GOI A;  3SUN A;  2D0B A;  3RTV A;  3P39 A;  3G4S N;  2HHQ A;  2Z1I A;  3KLG A;  3LPT A;  3HOS A;  1EO1 A;  3FZH A;  5KQD A;  4IG0 A;  1E4F T;  1S1V A;  3GDQ A;  2G8F A;  1D9F A;  4M42 A;  1BL3 A;  3SJJ A;  1YIT N;  3BZC A;  4DQI A;  2E2P A;  3OYH A;  4I6M B;  3E9L A;  3SMP A;  1T7P A;  1NM1 A;  1C1B A;  3VQP A;  4KHQ A;  4DSL A;  3E9O A;  4IOA L;  1RBU A;  3WXM B;  3W3D A;  4FLU A;  1LWC A;  4NB4 A;  4LD0 A;  3M3Z A;  1RDU A;  2A42 A;  3VQB A;  5J1E A;  3MEC A;  5HRR A;  4CJP A;  4E1N A;  4B1U B;  3V9U A;  5AFU A;  5J2P A;  4B9N A;  4CIE A;  2ZGY A;  4M3R A;  4LH4 A;  3G6E N;  1UA0 A;  2F8T A;  4FO0 A;  2D0O A;  3L8B A;  3D2F A;  3K2P A;  4ID1 A;  1ASW A;  4NXN K;  4JAX A;  3QFU A;  5AQY A;  1T8E A;  1SQK A;  1IKV A;  4L3Q A;  3L3V A;  1C1A A;  1GLD G;  1ZBL A;  4H5T A;  2A5X A; 
#chains in the Genus database with same CATH homology
 2FBY A;  2HNZ A;  2XY7 A;  2EX3 A;  1S6P A;  1WSF A;  3S3M A;  1S9E A;  4O4G A;  1SKR A;  3NGY A;  1KLN A;  3CYM A;  1ZBF A;  2G8V A;  4FJN A;  1JXE A;  2Y1J A;  2FC0 A;  3V1R A;  4OLA A;  4CEB A;  4CEQ A;  1JXB A;  1Q8I A;  2A1S A;  3NF9 A;  3T19 A;  4BE1 A;  3M8P A;  4E7H A;  4O0I A;  3NHG A;  1JLB A;  1FXX A;  3O3H A;  5HRP A;  4GVM A;  4DU1 A;  1U04 A;  3EYZ A;  4EP4 A;  3B6O A;  3NE6 A;  2E6L A;  3DM2 A;  1WAJ A;  2YNI A;  1IH7 A;  3KLI A;  3NH0 A;  2OZM A;  4CEC A;  3AVA A;  4CER A;  5SWM A;  4CGI A;  3IAY A;  3K5O A;  4L8R B;  4F3T A;  2ZQB A;  2PYJ A;  3VA3 A;  3LDS A;  2P5G A;  2XHB A;  1J53 A;  3QIO A;  4DSF A;  2ZD1 A;  5C25 A;  4XIU A;  4E7K A;  4CIF A;  4JRQ A;  3HPH A;  1ZBI A;  4CEF A;  3K58 A;  4FZY A;  2GUI A;  3QO9 A;  3O4N A;  2B6A A;  4GMJ B;  4CF1 A;  1XI1 A;  4DG1 A;  2G8H A;  2G8U A;  1GOC A;  3CM5 A;  4CHY A;  2DFF A;  2HHV A;  3AO3 A;  3MXJ A;  4KO0 A;  5HLF A;  1NK8 A;  1S5J A;  4DU4 A;  4KI4 A;  1J9A A;  1KFD A;  2YNG A;  3OVN A;  3TR8 A;  4O5B A;  3CFP A;  2RN2 A;  1WAF A;  3K5M A;  3DLK A;  3CFR A;  3LP0 A;  3T1A A;  1F21 A;  4CF8 A;  2XY6 A;  1NK6 A;  3RWU A;  3HO1 A;  4W5T A;  3V9S A;  2LSN A;  4KHY A;  3SUQ A;  1VSD A;  1TKD A;  4HCC A;  3DI6 A;  1RT2 A;  3OYE A;  4FJM A;  1RBT A;  3ZSW A;  5JS1 A;  3ZSX A;  3KIO A;  1LV5 A;  1BI4 B;  4FM0 A;  2FBT A;  5T7B A;  4CK3 A;  2KTQ A;  1IG9 A;  3SYZ A;  1HRH A;  4CJV A;  1KSP A;  2F96 A;  3KJV A;  1ZYQ A;  2IGI A;  4B9U A;  4KHS A;  3KK1 A;  1WSE A;  4C8L A;  5D3G A;  2E4L A;  3NGZ A;  3SV4 A;  3RR8 A;  1QSS A;  2YV0 X;  4E0D A;  4LY7 A;  2IC3 A;  4CJF A;  3VQC A;  1L3U A;  1TAU A;  1IKW A;  1NKE A;  3KTQ A;  1QSY A;  4DSE A;  3DLR A;  1S1W A;  4ICL A;  4CEZ A;  3SUP A;  3ZCM A;  2ITG A;  4OPK A;  2EHG A;  1J54 A;  3AO2 A;  5KTQ A;  3L2Q A;  2BE2 A;  3ZT1 A;  4CHO A;  3QEX A;  4DMN A;  4JLH A;  2KFN A;  1Z25 A;  3NAE A;  3K5L A;  1L3T A;  5CZ1 A;  1QSL A;  4UQG A;  1EP4 A;  3WNF A;  3DOK A;  4B08 A;  4YFU A;  1L3S A;  4KPY A;  2R7Y A;  4EP5 A;  3LZI A;  4ZHR A;  4BAC A;  5J2N A;  4CJU A;  4C8N A;  1C1C A;  4E7I A;  3SQ2 A;  2DFE A;  3U3Y A;  1EET A;  4DS5 A;  2D5R A;  1U47 A;  3CG7 A;  1VSJ A;  1SUQ A;  3S9H A;  1NOY A;  4OGC A;  5KGW A;  3TAR A;  4N76 A;  1HQE A;  1LAV A;  3L3U A;  1U49 A;  2HND A;  4W5R A;  1WSJ A;  3VQ9 A;  3AVF A;  1U4B A;  3JYT A;  4BDP A;  4FXD A;  3ITH A;  1JLF A;  2VG7 A;  2YKM A;  3O4Q A;  3OYA A;  5J2M A;  3SPY A;  4Z4G A;  4DF8 A;  4OLB A;  3TAB A;  1TK5 A;  3OJU A;  5KRS A;  2VWK A;  4OKK A;  1EXQ A;  4CGD A;  4F3O A;  4E7J A;  3L2R A;  3AVI A;  1FKP A;  4CES A;  3QNN A;  1BCO A;  1ZBH A;  5KRT A;  3NBP A;  3AVG A;  5CYQ A;  3SCX A;  3ZSY A;  4Y1D A;  4QAG A;  1UA1 A;  1HMV A;  4OKJ A;  3HPO A;  1RT5 A;  3QEP A;  3PUF A;  4M41 A;  3SQ4 A;  4FZZ A;  4TSX A;  4FLX A;  3SUO A;  3PX4 A;  4K8Z A;  4KB1 A;  1HNV A;  2ATQ A;  4AHV A;  4CFA A;  4M3U A;  5E41 A;  2YKN A;  1U48 A;  1HYZ A;  1YVU A;  1C0M A;  4DQQ A;  1QQC A;  3OYF A;  4KTZ A;  5FDL A;  3TAF A;  4KI6 A;  4CHP A;  4BE2 A;  2QXF A;  4KRF A;  3ZT2 A;  2KW4 A;  4E7L A;  3KKR A;  1ITG A;  1SL1 A;  1VK0 A;  5DK5 A;  3PO4 A;  4OVL A;  2HNY A;  3H08 A;  4Z0U A;  1W9H A;  1QTM A;  4B9M A;  4NCG A;  4CJ5 A;  3AVL A;  4R5P A;  4IG3 A;  3C6U A;  3VQ6 A;  2IDO A;  2RPI A;  2G8W A;  1WN7 A;  3HT3 A;  3S3O A;  4J2B A;  1JL1 A;  1NK0 A;  4QOZ B;  3V4I A;  1J5O A;  5HRN A;  4H8K A;  3OS2 A;  3L2U A;  3KD1 E;  3MXI A;  4IFY A;  1BHL A;  3DYA A;  4CEE A;  1C0U A;  3AO4 A;  3VQ8 A;  4CJQ A;  1SV5 A;  4FVM A;  4IKF A;  3RMB A;  1VSK A;  3AVJ A;  3I8D A;  4WE1 A;  3OYG A;  2PY5 A;  3RMC A;  1A5X A;  2Z1G A;  3TI0 A;  1NK4 A;  1VRU A;  4PUO A;  3OYJ A;  3ZT0 A;  3CFO A;  2Z1H A;  1NKC A;  3OS1 A;  1NJX A;  2FBX A;  1L5U A;  3PX6 A;  3TAE A;  1CXU A;  4KHU A;  3LWL A;  3AA2 A;  1X9M A;  4C8K A;  2WON A;  4M3Y A;  3WNH A;  3U3G A;  1TVR A;  3VQ5 A;  2HMI A;  2BDP A;  4O44 A;  3OJS A;  4CGJ A;  4F2R A;  1Y97 A;  1TGO A;  3HM9 A;  3RMD A;  4Q0B A;  1BIS A;  1I39 A;  1TKZ A;  4FJ7 A;  3M8Q A;  4M3W A;  3AA5 X;  1KCF A;  4N5S A;  3OYL A;  2Y1I A;  3ZT3 A;  3ZSZ A;  3OYM A;  3O3F A;  3NF7 A;  4FLV A;  1SKW A;  3QLH A;  2DFH A;  5I3U A;  1HYS A;  3ZSO A;  3LAK A;  1CZ9 A;  4O55 A;  3LWM A;  1RDB A;  4DFJ A;  3TAN A;  4I9L A;  1GOB A;  1DLO A;  3HL8 A;  3QES A;  3LAL A;  4CHZ A;  4N56 A;  2OZS A;  4B9S A;  3SI6 A;  3VQ4 A;  4CGH A;  1RCH A;  3TAG A;  2IAJ A;  1WLJ A;  1RT1 A;  1NOZ A;  3QEV A;  4JS5 A;  1XHX A;  4B9L A;  1I3A A;  4DFK A;  1D8Y A;  1R0A A;  1C6V A;  3LP3 A;  2HB5 A;  3V81 A;  4ZTJ A;  3PO5 A;  3LAM A;  1KVA A;  2ZE2 A;  3C6T A;  1Q9Y A;  3DRR A;  3M8R A;  4ELT A;  1TL1 A;  3OY9 A;  1O1W A;  4DS4 A;  4DFP A;  4CFD A;  1BQN A;  4H4O A;  1RTD A;  2YHA A;  3HVR A;  4C8O A;  2DY4 A;  2OA8 A;  4I2Q A;  4B8C A;  1NJY A;  2AJQ A;  3AVH A;  1B9D A;  1B9F A;  1BIU A;  4W5Q A;  3K5N A;  4HUG A;  3TAP A;  1QHT A;  4FLY A;  3P83 D;  4FZX C;  3OYB A;  3RMA A;  1RTJ A;  2RF2 A;  4W5O A;  4ELV A;  3NH1 A;  4RG8 A;  1DTT A;  2RKI A;  4DF4 A;  4HCB A;  1CXQ A;  2G8K A;  1RBR A;  4CJT A;  1JLQ A;  3DLG A;  4DTN A;  4EZ9 A;  5HRS A;  1EKE A;  3DRS A;  4M3T A;  3CM6 A;  1K6Y A;  2DTU A;  1A5W A;  4CJS A;  3QER A;  4BDZ A;  1VSE A;  3AVN A;  2BAN A;  4FK4 A;  1IKX A;  4E19 A;  2PYL A;  3P5J A;  4LH5 A;  5CZ2 A;  5KGX A;  1S1X A;  3TAM A;  3V1O A;  3NDK A;  4JS4 A;  3MED A;  3B6P A;  3U6F A;  4LSL A;  3M8S A;  4NCB A;  2ETJ A;  2XO7 A;  4J2D A;  4PY5 A;  4KAZ A;  3P1G A;  1RIL A;  4Z4C A;  3AVC A;  4DTO A;  1TL3 A;  3FFI A;  3G0Z A;  4AH9 A;  2HHT A;  1WSH A;  4ID5 A;  4RW7 A;  1HQU A;  4B8A B;  3QNO A;  1JKH A;  4RW8 A;  1BGX T;  3PV8 A;  1UWB A;  4F4K A;  1RT3 A;  1BI4 A;  3DLB A;  2HHU A;  1HJR A;  2JGU A;  2KFZ A;  4RW4 A;  2E6M A;  1LW2 A;  4CJ4 A;  1T05 A;  2HW3 A;  1DTQ A;  3AVM A;  3KLE A;  4E3S A;  2F8S A;  1VSH A;  2QKB A;  1IKY A;  1RT6 A;  3EZ5 A;  1FKO A;  4DTJ A;  4CFC A;  5HRO A;  3OYI A;  2YNF A;  4KV8 A;  3O3G A;  4F8R A;  1JLC A;  1X1P A;  3E01 A;  1FK9 A;  3ALY A;  1HPZ A;  3MEG A;  4HVJ A;  3V9W A;  4FJI A;  2XY8 A;  1UAX A;  4B9T A;  4Z4H A;  2KZM A;  4FLT A;  1JL2 A;  4ZTF A;  2FBV A;  3I0R A;  4CHN A;  3AA3 A;  3AVB A;  4J2A A;  4HHT A;  1VSL A;  5HP1 A;  1ZBU A;  4E1M A;  1LW0 A;  3NCI A;  1U45 A;  1LWE A;  4CCH A;  4GW6 A;  1KTQ A;  3LPU A;  2BGG A;  2P1J A;  3WNG A;  1BIZ A;  3HVT A;  3NGI A;  2HVH A;  1NK7 A;  3QIP A;  2GBZ A;  2IOC A;  4CJK A;  4HUE A;  4FLZ A;  3SNN A;  4AIL C;  1NKB A;  4FJJ A;  4CEO A;  1EX4 A;  3D0P A;  4KKO A;  3V6D A;  2QKK A;  1Z26 A;  5FRN A;  1MU2 A;  2B4J A;  4NYN A;  4CHQ A;  2VG5 A;  3OYN A;  4DQR A;  1QS4 A;  3MXM A;  3DRP A;  4FJX A;  3NF6 A;  4N47 A;  4Z4E A;  1NJZ A;  4W5N A;  1T03 A;  4CED A;  3HJF A;  4AHS A;  4I9Q A;  3DMJ A;  4LSN A;  3ZSQ A;  1YTA A;  3A2F A;  3OYC A;  5DMR A;  3HXM A;  4PWD A;  1LWF A;  1SKS A;  5I42 A;  1ASU A;  3AV9 A;  3V9Z A;  3ASM A;  4QCL A;  5CY4 A;  1XHZ A;  2D0A A;  2P5O A;  4Z4I A;  3NFA A;  4E89 A;  3VQQ A;  2HHW A;  1RBS A;  3QEW A;  3IS9 A;  1X9S A;  1VSM A;  4BDY A;  4FJ8 A;  2KZZ A;  5EU7 A;  2HHX A;  1S6Q A;  4IDK A;  4DSJ A;  3KLH A;  3MEE A;  4DLE A;  3LP1 A;  3AO5 A;  4K8X A;  1RT4 A;  3L2V A;  4DTM A;  1LAW A;  2OPR A;  4CJR A;  3HP6 A;  1XWL A;  3CQ8 A;  3K59 A;  4IBN A;  1N5Y A;  3OS0 A;  3PY8 A;  4ELU A;  3BDP A;  2B5J A;  2KQ2 A;  3NH2 A;  3JSM A;  1RBV A;  5J2Q A;  4CK2 A;  3KK2 A;  4PA1 A;  3S3N A;  1WSG A;  4NCA A;  4EZ6 A;  3I0S A;  3DOL A;  1D5A A;  3G10 A;  4N41 A;  3F9K A;  4M3Z A;  1NK5 A;  3RRG A;  4OJR A;  1JLA A;  4FM1 A;  4CJ3 A;  1BQM A;  1BCM A;  3SV3 A;  1XC9 A;  4C8M A;  3HYF A;  4HTU A;  4Q5V A;  2X6S A;  5SZT A;  1X9W A;  4IFV A;  4Y1C A;  3RR7 A;  4DSI A;  1RNH A;  1JLG A;  1NK9 A;  4FJH A;  1IO2 A;  1JLE A;  1S9G A;  4F2S A;  1VRT A;  3VQA A;  1S1T A;  4DTP A;  3OYD A;  2O4I A;  4FJ5 A;  3AVK A;  3F73 A;  3RRH A;  4KFB A;  4DTR A;  3AA4 A;  1C0T A;  4FW1 A;  2PZS A;  3SQ0 A;  1N6Q A;  4CEA A;  4DLG A;  1G15 A;  5FRO A;  4CJE A;  3KK3 A;  3QIN A;  2IS3 A;  3AO1 A;  1TKX A;  3KKS A;  3BGR A;  5K14 A;  5KI6 A;  4AHR A;  3KLF A;  1RTH A;  3WNE A;  1QE1 A;  4CF9 A;  2W42 A;  4HUF A;  4FM2 A;  1TK0 A;  2OPQ A;  3KD5 E;  3QEI A;  1SL2 A;  4FYD A;  1KVC A;  2X6N A;  3LP2 A;  1YT3 A;  4I2P A;  2G8I A;  3SPZ A;  1RTI A;  1TKT A;  1B92 A;  1D9D A;  1TV6 A;  2QK9 A;  3V9X A;  4JRP A;  3PX0 A;  2I5J A;  3VQD A;  1L3V A;  1HYV A;  2YHB A;  2WOM A;  4FJK A;  5JS2 A;  4B9V A;  4RW6 A;  3DLH A;  1VSF A;  4KRE A;  2Z1J A;  5FRM A;  1RDD A;  4MFB A;  4CIG A;  4DWI A;  3IRX A;  1ASV A;  4I7F A;  1KVB A;  4AHC A;  1TK8 A;  4KB0 A;  4J2E A;  5CYM A;  4PQU A;  4FJ9 A;  4YNQ A;  3VA0 A;  3SUN A;  2O4G A;  4O0J A;  2D0B A;  4CJL A;  3RTV A;  2HHQ A;  2X74 A;  4DQS A;  4CFB A;  2JLE A;  2Z1I A;  4KTW A;  3QET A;  4AHU A;  3KLG A;  4DTS A;  3LPT A;  1VSI A;  2GV9 A;  3HPG A;  3ZT4 A;  4IG0 A;  3K57 A;  4CE9 A;  4DQP A;  2HVI A;  2A1R A;  1S1V A;  2G8F A;  2VG6 A;  1S1U A;  4BWJ A;  1D9F A;  2OYQ A;  1YTU A;  2D0C A;  4M42 A;  4DTU A;  2X78 A;  1BL3 A;  3HST B;  3ZSR A;  2Q3S A;  3LZJ A;  3SZ2 A;  3SJJ A;  4KHN A;  4DQI A;  4OKE A;  3OYH A;  3TAQ A;  4FK0 A;  1WSI A;  4CJW A;  4KTQ A;  1T7P A;  1WNS A;  4B3O A;  3VQP A;  1C1B A;  4KHQ A;  1HNI A;  4DSL A;  1KLM A;  1W0H A;  4M45 A;  3VQ7 A;  3HP9 A;  3TWH A;  1RBU A;  4FCY A;  4FJL A;  3LAN A;  4OPJ A;  4M3X A;  4CK1 A;  4FLU A;  4BWM A;  4FW2 A;  1LWC A;  3NF8 A;  4LD0 A;  3V1Q A;  3SQ1 A;  1CLQ A;  2YNH A;  5HBM A;  3VQB A;  4CGF A;  5J1E A;  3MEC A;  3T3F A;  4DFM A;  5HRR A;  4CJP A;  4E1N A;  4OGE A;  1TAQ A;  1RT7 A;  2HHS A;  1GOA A;  5C24 A;  3DLE A;  3V9U A;  4RW9 A;  1CZB A;  4CF0 A;  5J2P A;  4B9N A;  4CIE A;  4FLW A;  3MAQ A;  3VN5 A;  4M3R A;  4LH4 A;  3IG1 A;  1UA0 A;  1REV A;  4KHW A;  1KRP A;  2OPS A;  2F8T A;  4G1Q A;  1KFS A;  3UIQ A;  1NJW A;  4CF2 A;  3C95 A;  4Z4F A;  1RDA A;  4H4M A;  4NYF A;  1RDC A;  4AHT A;  3EY1 A;  4FJG A;  3L8B A;  3K2P A;  1Q9X A;  4MQ3 A;  2NUB A;  4CGG A;  4DTX A;  3HK2 A;  4ID1 A;  1ASW A;  5C42 A;  1SL0 A;  2XY5 A;  3ZSV A;  2P51 A;  1T8E A;  3ISN C;  3VQE A;  4FK2 A;  2OPP A;  1IKV A;  4DU3 A;  3D45 A;  3ULD A;  4BE0 A;  1A5V A;  1UOC A;  4DSK A;  3L3V A;  1C1A A;  2VWJ A;  1ZBL A;  3L2W A;  3C94 A;  3OYK A;  2XRI A;  3THV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...