4JI4K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji4K00
2E5LK 1IBKK 4DV7K 4DR4K 1J5EK 4JI6K 4LFCK 4LFAK 5FLXO 4LF9K 4JI2K 5LL6Z 1XMQK 4DR3K 4LF8K 2UXBK 2ZM6K 3JAMO 4AQYK 4DR2K 4DV3K 4DR5K 3T1YK 2UXCK 5BR8K 4KHPK 4X62K 3T1HK 1I94K 2UUCK 5LMNK 4JI5K 4DV0K 1N34K 1IBMK 4V19S 4DR1K 5A2QO 4DV1K 4DV2K 1N36K 4JI0K 4YY3K 4X64K 1XMOK 4JYAK 4GKJK 4DV6K 4NXNK 4JI4K 4LF6K 4OX9K 4JI8K 2UUBK 1HNZK 4NXMK 4K0KK 4LF5K 1N32K 4X66K 4B3RK 4DV5K 3J81O 4DR6K 2UXDK 4DV4K 5AJ3K 5LMUK 3J80O 4B3MK 4YHHK 4JV5K 2F4VK 5IWAK 1HR0K 4DUYK 2HHHK 2UU9K 3J7AP 4B3SK 1XNQK 3OTOK 1HNXK 3J7YP 4X65K 4JI7K 4CVNE 4B3TK 1FJGK 4JI1K 2VQFK 4LF7K 4LF4K 1IBLK 2UUAK 1N33K 4DUZK 5IT9O 1HNWK 1XNRK 4CW7B 4DR7K 4GKKK 4JI3K 2VQEK 4LFBK
chains in the Genus database with same CATH superfamily
1MU2A 3V9WA 2NLXA 2E5LK 2LSNA 3H3OB 4FW2A 3O3HA 4Q0BA 2GX9A 3NF9A 3GE1A 4FWRA 2HHQA 1J9AA 2E2PA 4LF9K 5CE3A 3ID8A 3V1RA 4H0OA 3LL3A 3C7NA 4B08A 3KLFA 1CZBA 3GOIA 4CEOA 2GUIA 3NFAA 3EL2A 1RDBA 2VWBA 3LDNA 3CCRN 1OKJA 1TK8A 5AFUH 3HPGA 3AARA 3GDQA 4BRCA 1VSEA 3DRSA 3MAQA 1HKCA 4CFBA 4YOVA 2HB5A 2P9LA 4CGGA 2PYJA 3VQCA 1L5UA 4KTQA 3P1GA 3VQDA 3K59A 5M1OA 1N34K 3PO5A 5BPMA 5FRMA 4BC3A 4KAZA 2W41A 3CIPA 4GY2B 4FK0A 5I42A 2DFFA 4DV6K 1T6CA 3F73A 4DQSA 4GMJB 2OA8A 3O5BA 1ATRA 1T8EA 4LF5K 1BIZA 1WUAA 2X78A 4BRKA 3M8QA 4O4GA 3M8SA 5AQPA 3THXB 1O1WA 4IO8A 3ZSQA 5CHIA 1YVUA 1X9MA 3PV8A 4KH5A 1ZBLA 1DGKN 4ISGA 2HHWA 4DSKA 3CERA 3HSTB 5AQUA 2BUPA 3VQ6A 2KQ2A 2AP1A 4WYBA 4FL9A 3TU5A 3O8MA 2FF3B 1RDDA 3QDKA 4M3UA 4DU1A 4TSXA 1LV5A 3WQTA 4B8CA 3PSFA 4XH4A 5AQSA 3CD6N 5GIPA 4LC9B 1V4SA 2P9PB 4CGIA 4B9QA 1OH8A 5AQQA 3TSUA 1RTDA 4H5RA 3DOLA 1J5EK 5I9EB 1K73O 4IOXA 1WSGA 1SL2A 1S1XA 1HNVA 1U49A 1UOCA 4WFNL 4CJWA 5KRSA 4CJVA 4IZ9A 3SPZA 2IVPA 4CZHA 1HLUA 3TANA 1RT1A 3HM8A 4W5NA 3H1QA 4IFYA 4IJAA 2ASMA 3LM2A 3C6UA 3KKRA 3SMSA 1ASVA 2Q0RA 3UKUA 3EKSA 1RDAA 4BRDA 3B6OA 4OPAA 1VQON 4Y0WA 2XHBA 3M1FA 1TYQB 4BR5A 4R79A 5M1KA 5GADP 3FR0A 1WSFA 3BF1A 5AQYA 3QEPA 1B92A 3KK3A 1FKPA 2OTJN 1T03A 3ULDA 4BWJA 2YNHA 3WXLA 2VCPA 4RW6A 3U8XA 3ITHA 5AQNA 1LOTB 3SJJA 2QA4N 2A41A 1Q82O 2P9UB 4OLBA 4IWVA 1GLJO 3TTCA 4CF8A 5ADXA 3I55N 3HVRA 3ZCMA 4PHTX 2QKBA 3HL8A 4CZFA 3MXMA 1S3XA 2YJEA 3JS6A 2QXFA 3T7ZA 4A5AA 3J8AA 3LWMA 1NJYA 3BY5A 3RWUA 1IKXA 2A5XA 2P1JA 1NWKA 3DXKB 1HRHA 3O9TA 3RSEB 4LF4K 4DUZK 5ELZA 3CMEN 4JN4A 4RCHA 5LJWA 3OYDA 3NCIA 4BE1A 3MCAB 3WUHA 3THVA 3CC2N 2Q0UA 3CC7N 4DTMA 2NRXA 4ZHRA 1NKEA 1NBWA 4BWMA 3O1WA 1U47A 3B6PA 4AH9A 4J8FA 4BRIA 1YJWN 3FZKA 3C65A 3HM9A 4LSLA 3SJHA 4EZ6A 3CI5A 2KHOA 3Q7CA 1YT3A 3G25A 4QAGA 4JS4A 4B9UA 2RE2A 1JXEA 4ISEA 3VQ5A 4CJSA 3JAMO 2E6LA 2YV0X 1BA0A 3W0LA 3P4IA 1NJXA 4CZIA 5BR8K 4QOZB 2ZJQL 1Z6RA 4BR9A 3UB5A 3K9KA 3OYBA 2G8UA 4C8MA 3KVGA 1BDGA 3SAGA 1VQMN 2HHXA 1BI4A 3F2KA 4QS9A 4CHOA 3O4QA 3HPHA 3VF4A 4HTUA 3UKRA 3VQEA 1VQ5N 3MN7A 1ZBFA 5J2MA 4CJ5A 3NF6A 4JD2A 4H5WA 1NGFA 4MLHA 1LWEA 3A5MC 1FKOA 4CEAA 1HYSA 3MWTA 2O8CB 4LD0A 5KQDA 3SK3A 5A2QO 5BPLA 3OYAA 3ID6A 1XC9A 3VF2A 5C12A 4LF6K 1HNZK 4NLCA 4FJLA 4KHUA 1WNSA 3FE1A 1I39A 1RCHA 4A2AA 3HT3A 5AQJA 3O9RA 1J5OA 4LY7A 4GVEA 3O6WA 4HUEA 2FSJA 2YX6A 4XEIA 2P9IA 2O8DB 5AJ3K 4KTZA 5C2FA 4B9LA 4B3MK 3F5TA 1BCMA 1TKTA 3HSCA 1HR0K 4A5BA 3J7AP 1OVQA 1S22A 4JK8A 4EIAA 1RTJA 1Q9YA 1CZ9A 2FXUA 3G4SN 2HBKA 3V9UA 1GLBG 4M3YA 3CF5L 3IDHA 3BP8A 4G1QA 1E3MA 2CH5A 1YUWA 4BVPA 4AHSA 4FVMA 3TARA 4K43A 3L2RA 4CEQA 3AO5A 4CJLA 5KTQA 2PYLA 2NRTA 1R59O 4JKCA 4O5BA 4IFEA 1VSKA 1ASUA 1GOAA 2HHTA 3CM6A 3P38A 3DLHA 3SNNA 3C0BA 5FLXO 1O13A 3DM2A 3KLEA 4BE0A 3PX4A 1ZXOA 3K5LA 1RGIA 4K8XA 1UWBA 4DSLA 1SZ2A 3A8YA 5CZ1A 2GWKA 2X6NA 3D2EA 1OH6A 4A61A 1NM1A 1SS6A 3VGMA 2KZMA 5F2RA 4H0PA 3CFRA 3IFRA 4YOTA 1SL0A 5SWMA 3PX0A 3HO1A 4E1NA 4W5QA 3R3LA 1NK8A 5EU7A 1DT9A 1BISA 5JS1A 1YVNA 3U9ZA 3ZX2A 5LMNK 4DHYA 1RFQA 3EZWA 4CEZA 3MMVA 3SV4A 2VG7A 1HKBA 3S3NA 4IEIA 1T6DA 1RT6A 3TWHA 2WBNA 1OVYA 1J53A 3CCSN 4K8ZA 4OPHA 2Z1GA 2EX3A 3MX5A 3S3MA 5TKWA 3SUPA 5F1XA 3NH1A 2P9KA 3DWLA 5C10A 1WBBA 1KXPA 1U48A 3SUOA 1BG3A 4AF1A 3T69A 4FM1A 3MWPA 3OYNA 1RT7A 4ICLA 1BQMA 4KFBA 3HPOA 5BRHA 4H4OA 3LZIA 1Q81O 4DUYK 1WAJA 3VMFB 3OJSA 4CF1A 4PKHA 5KQ8A 1VSDA 4JI7K 3N4QA 4IOAL 4JI1K 4O0JA 1VQ8N 2IOCA 2UUAK 4W5TA 1C0TA 3BUZB 3E01A 2FBXA 1BUPA 1EWRA 3ALYA 4L8RB 4JI3K 4NYNA 3DMJA 1NMDA 1A5XA 4DTRA 3ZEUB 3EEQA 4U67L 3I0SA 3QEWA 3QEVA 3EO3A 4BRMA 1S1WA 4CIGA 2O8EB 1YF5L 4DCHA 2WC9A 4M45A 3L0QA 3OYGA 3WT0A 4RWTA 5EVZA 3KWGA 4KV8A 5AQIA 4DS4A 1WBDA 2ZWHA 3RR7A 4FZXC 3CCLN 5KI6A 1MWMA 4JKGA 4K41A 1JJ2M 4E19A 1ZC6A 3T1HK 3K5MA 1KVCA 1YHQN 1VQKN 3CFPA 1BGXT 3NH0A 1YTAA 3D6RA 4FWOA 5AQMA 3K2PA 3MEEA 4OKKA 4WFBL 3VN5A 4LH5A 3QNNA 3CYMA 5AQRA 4OGCA 4N76A 3O08A 1Q9XA 2E1ZA 3P39A 5JVGL 1L3TA 1QSYA 3EY1A 3NBPA 2ZJPL 3WXIA 4DV1K 5C15A 4QCLA 1E4FT 4DSFA 3ZSWA 3NAEA 3LAKA 1QQOA 4A57A 4CFDA 2O4GA 2ZGYA 1KLNA 1UA1A 1A5VA 4RW7A 3PX6A 2GEMA 1NGCA 1D4XA 3VQBA 4FJKA 4I2QA 5AZJA 4DR6K 1QVGM 2UXDK 4DV4K 4CERA 1VSMA 3J80O 4FM0A 3A5LC 1X3NA 4YOUA 4JV5K 4DF4A 3FFKB 1RBVA 4M42A 4CJ7A 2Z1JA 1WSIA 1GLCG 1OH5A 5HROA 4BRGA 4PQUA 3WQUA 3AVFA 3A5OC 3BZCA 5CZ2A 2G8VA 4HCBA 4C8KA 1QZ5A 3CG7A 4BQZA 4E3SA 1WOQA 1Q86O 3M8PA 4PA1A 1MDUB 1W97L 3V81A 4CIEA 3V4IA 4DFJA 4FSVA 1W9HA 3MEGA 2A1SA 4H5TA 1T05A 3DLRA 1U45A 4WFAL 3M5RA 1JCEA 3VETA 3SPYA 3DLLL 3NGIA 2O8FA 1K8KB 4M7YA 3JYTA 4BC2A 3AO1A 2KZZA 3FLCO 3QIPA 3EE8A 3IS9A 2E2NA 3ZLJA 3AVLA 1Z05A 4CJRA 1C0UA 2XY6A 3O3FA 3HXMA 3T1YK 3DXMB 4E89A 3HVTA 1LWCA 2CGKA 4HCCA 3QLHA 3KWIA 4FLXA 4KI6A 2ITGA 3HP9A 2I7PA 4E7LA 1S1UA 1WSHA 2EHGA 2WOMA 3ENHA 1WB9A 2A42A 2IAJA 1LWFA 2QWNA 1KC8O 4KPYA 2ZF5O 2D4WA 1HQUA 5BN9A 1UA0A 4IFVA 2ASPA 2I5JA 4CD1A 1NJZA 4DV2K 4JKDA 5J1EA 2OANA 3KIOA 4CEFA 5GIOA 2RKIA 3QEIA 4O5FA 1M90O 4PUOA 4IKFA 2HMIA 4C1NK 3HP6A 3KLIA 3RVCA 2V51B 4CHYA 3V9XA 4CJEA 3G10A 4JHDA 2GTDA 1S9GA 4DV5K 1BIUA 5AZIA 1U04A 3DOKA 2RN2A 1JLQA 3F9MA 2E1YA 3OBYA 3K5NA 3UIQA 2QW9A 4HWIA 3HTVA 4UY8O 4RW4A 1P8ZA 3B8AX 1TUYA 1EP4A 3HOSA 4BGAA 3HJFA 3SV3A 4DF8A 5KRTA 3CCQN 3CFOA 5EXWA 3TR8A 1GOBA 3THWB 3LP1A 5AQKA 3RMCA 4EFHA 1RTHA 3WNGA 4B1XB 3CMAN 4BDYA 3FZMA 1HJOA 3OYEA 3OY9A 4CJPA 1VSIA 2FLOA 1WN7A 3AVMA 3V9SA 5TKYA 4DV7K 4B9NA 1BHLA 1X3MA 3QBWA 3ZT0A 4F2SA 4N56A 4LH4A 3S9HA 1X9SA 5AQOA 1S9EA 3MN6A 4AILC 3O9UA 1ZBSA 3AA4A 3EYZA 2UXCK 2F96A 3OYMA 4B1VA 4JRQA 2PAVA 4BRAA 3ZX0A 1CLQA 1HQEA 3VA3A 2QWQA 3FZFA 3ULEA 1ATSA 1XI1A 2UUCK 1U4BA 3WXJA 4JKBA 3T1AA 1KCFA 3VQ7A 4DV0K 3AO4A 1HJRA 3SUNA 3ZSVA 1S1TA 3HYFA 5C42A 1RDWX 1TGOA 2QWLA 3LDSA 4DSEA 2HOEA 2D0BA 2HNYA 3KK7A 3WXKA 3TAGA 2FSNA 4J2BA 4YORA 1RT4A 1DKGD 4OPKA 3ATUA 1YTUA 3CHWA 4K0KK 1TK5A 1X9WA 5H1SQ 4X66K 3J81O 3PLAA 5DM7L 3R8EA 3OBWA 4GVMA 4RTFD 4AM7A 1RDCA 2E2QA 2D1KA 3VEOA 2NZTA 4CJQA 2O8BB 2GBZA 1NKCA 2WUSA 2G8WA 1B9DA 2ATQA 2P9NA 5AQVA 3UE5A 2OZSA 4FWKA 1EO1A 4DFMA 1F21A 4BY9C 3L8BA 2YHAA 3H08A 3I0RA 2HHSA 2FBYA 3CJCA 3F9KA 3NHGA 3ZX3A 1EKEA 2WTUA 4FJHA 4OJRA 3MK6A 3G71N 2VQEK 4B9TA 4MO4A 4E0DA 4EAHD 1JXBA 3H1VX 4CHNA 1TKDA 1E4GT 4I6MA 3C6TA 1HPZA 4DQPA 3O4WA 3CXCM 3G6EN 3CCVN 1N5YA 3LALA 3AGRA 4FJXA 2UXBK 2ZM6K 4WQ5C 1DTTA 3WNFA 4AQYK 2VG6A 3NF8A 5BREA 4FJMA 2YCHA 3SBTA 4BDZA 3L6QA 4FWNA 4CIFA 4QS8A 5HOOA 1NLVA 4W5RA 2W42A 1SL1A 4O55A 4UQGA 4X62K 3I8DA 4DTSA 4M3ZA 1C6VA 4F8RA 3WEEB 3VEVA 2UYTA 1J54A 5HLFA 3D2FA 3ZETB 1U2VA 2R7YA 2KFZA 3QIOA 4FJ5A 1YJNN 3PY8A 1JL2A 5BPNA 4DWIA 3OYLA 1KTQA 5KGWA 3MECA 3W3DA 1HPMA 3AVKA 1W2BM 2YHXA 1FW6A 4YY3K 4WQ5A 4I2PA 4JI4K 1XHXA 1Y64A 3VQAA 5CY4A 4JKEA 3H3NO 4CK3A 4FCYA 4ZTJA 2NRZA 1IO2A 4QS7A 3U3YA 4FK4A 2KFNA 3ZT1A 3CJBA 5LMUK 1CXUA 3SBGA 4CHPA 1QSLA 2QM1A 2VYPA 1JKHA 1HKGA 3FFIA 4WCEL 3T3FA 3QESA 4MLEA 4IG0A 3KK2A 3EZ5A 4ELVA 3ZSYA 3KHYA 4GV3A 1XNRK 2OPSA 2HBJA 4CW7B 3TAMA 4FK2A 4FLUA 5DK5A 3LM9A 3VENA 4LFBK 4CEBA 2QEXN 1WSEA 4NYFA 4JI6K 3CJ9A 2P9SB 4CJ3A 3HRGA 3RMDA 4OKEA 4NCGA 5ADXH 1LW0A 1K9MO 2DTUA 3O1BA 4HHTA 3DLGA 3MN9A 4OO1J 2Y1IA 4LSNA 1TK0A 1RNHA 4MDBA 4KO0A 3M3ZA 2P51A 3AO3A 4H8KA 1KRPA 3U4LA 4PKIA 4EHUA 3OS2A 3THXA 3QO9A 2Z1IA 4Q5VA 1HUXA 5C25A 4JI5K 4KHQA 3KZBA 4RG8A 2B6AA 2F9WA 4OLAA 2W6LA 3T19A 4B9SA 4KH6A 1S1VA 2A40A 1D9DA 2KW4A 4OKJA 4H0VB 1VSFA 3CETA 3AA5X 3HOTA 3RRGA 3ENOA 1N36K 4ZTFA 2D0CA 4JK9A 4CBWA 3C7NB 4GKJK 4JI8K 1RBRA 4G9ZA 2P9PA 3OS0A 3V6DA 4BDPA 1C0FA 1RBSA 3CCUN 3NGYA 2H3GX 2XY7A 4N47A 1K6YA 3OYIA 4KREA 3TSQA 1N32K 3AVAA 2ZJRL 4CE9A 4B1ZA 2Q31A 2P9LB 4YHHK 4CBXA 3HZ6A 5IWAK 2CH6A 2D5RA 3OHRA 4KTWA 3WXMB 3AA3A 4WQ4C 1H1VA 3R9PA 4CI6A 3QEXA 4JNEA 3VOVA 2W6KA 2IGIA 4DQRA 4I9LA 4FPAA 1D9FA 1G99A 5IT9O 3CPWM 2W40A 4GNIA 3VGKA 1HNWK 3NVKA 3ASMA 4FJ7A 1VQLN 3PIOL 3KD5E 2HHUA 2F7TA 1TYQA 1S5JA 1SV5A 2GWJA 4BG8A 3K5OA 4FJNA 1XC3A 1RTIA 1NJIO 1QQCA 3BDPA 5AQTA 3TAEA 2V7YA 1IKWA 4NB4A 4M3XA 3E9LA 4Z4IA 1KVBA 1NGAA 4FLYA 3E9OA 4JLHA 4DS5A 1KFDA 3BGRA 2P9UA 3I56N 4WQ4A 2G8IA 1JCGA 3ZYYX 4CHZA 1S6PA 4MQ3A 1WSJA 5JICA 1C1BA 1NOZA 4OPJA 2ETJA 4CZKA 1EXQA 4BROA 1A5WA 4PL8A 4AHCA 2F8TA 1YAGA 1HX1A 1QHTA 4CFAA 1BOTO 4PY5A 1CZAN 4IDHA 3LPUA 1YITN 1XUPO 3A2FA 3DXKA 3RSEA 1QQMA 3NGZA 3NH2A 4F2RA 1NK5A 5JS2A 3ZT4A 3QMLA 4X64K 3SI6A 1VSHA 5M1QA 5C24A 3E66A 4GW6A 3D0PA 1KFSA 4CFCA 3AVJA 3IG1A 4B9VA 3MDQA 3LAMA 1NK6A 3L2VA 5AQXA 4KHWA 2KLAA 4YOXA 4CJ4A 4KBOA 3MXIA 3SCXA 3AA2A 4Z0UA 3N4PA 2CGJA 1CXQA 3VQ4A 5CYMA 3NDKA 4CZJA 3EE9A 2B5JA 5GAEP 4JS5A 3PO4A 3H46O 3ATVA 3P5JA 4BRFA 1RT3A 5C0YA 4A62A 1Q7YO 3UKUB 1T7PA 2JWLA 1DLOA 2D0AA 5JVHL 1FJGK 4ILHA 1N8RO 2QKKA 3QFPA 3Q7BA 2IVOA 1N33K 4FLWA 2YHWA 3M6GA 2DY4A 3GG4A 4AM6A 4HTLA 1BCOA 1LW2A 5E41A 3QBXA 1ASWA 2CGLA 5I3UA 4F3OA 4AHVA 1IBKK 4FWLA 2O8CA 4LFCK 2V7ZA 2VGMA 5AR0A 3VQPA 4JI2K 3EN9A 1ZYQA 3OW2M 4H4MA 2YHBA 4CHQA 1NMNA 1LAWA 4HUGA 1IV0A 3AO2A 1TKXA 4KB0A 4DV3K 1TAUA 4IXCA 1NGEA 4E7JA 2KTQA 1C0MA 4IEEA 4XH5A 1JLBA 4KHPK 2O8DA 1GOCA 2Q3SA 4FJJA 5M1PA 4DTOA 1Q8IA 3LANA 4YOYA 1N6QA 3VPZA 4DG1A 4PKGA 3OYFA 3CCEN 4C8OA 1ESVA 2JLEA 3TABA 5GAGP 3VTIA 4FWQA 3OS1A 3ZT3A 3TI0A 4HVJA 4CF2A 1NGJA 4JI0K 3GBTA 4JYAK 3HBTA 2AJQA 4WE1A 3VF6A 3RMBA 5JLHA 4FWPA 4M3RA 1VSLA 3MN5A 4KH4A 4ELTA 4M3WA 4E1JA 4DTJA 2A1RA 4J2AA 3U9DA 4DTXA 3VEZA 1BI4B 4F3TA 5F0XA 3U6FA 4BR0A 3UKRB 3KKSA 3OTOK 4FLVA 1TUUA 1HNXK 5M1FA 4JD2B 4FJ8A 4BC5A 3KK1A 3TSPA 3R6MA 3KLGA 4BC4A 4FZZA 1NGHA 1KD1O 4LF7K 3VESA 2QXLA 1YXQA 2FC0A 4JKHA 3NF7A 1TKZA 1KAXA 2QWRA 1FXXA 5B8HA 4WF9L 2QWMA 4DR7K 3OYHA 3TAQA 1C1AA 4H03B 4IJNA 5FRNA 2ZE2A 4DR4K 3K0SA 2RF2A 1IG8A 3CQYA 4ILGB 4LFAK 2QWOA 5JLFA 1VQ6N 2P9IB 3R1XA 1W7AA 4A2BA 3P31A 3LDOA 4DR3K 1IG9A 1NK0A 4KKOA 5HRSA 2F8SA 4DFKA 2NRHA 5BR9A 2HF4A 1QSSA 3LDQA 4BRHA 2YKNA 4FLZA 2OZMA 3I33A 4FO0A 3L3VA 3THYA 1L3SA 3A0IX 3CCJN 2BGGA 3QETA 2IDOA 4BRQA 2OTLN 1KLMA 1X9JA 5GAHP 1L3VA 1BQNA 3ZT2A 4B1UB 1VAZA 2V52B 4O8UA 1I3AA 3TAPA 3VQ9A 1YJ9N 1IBMK 3C95A 4IG3A 4CJUA 2NNWA 3VERA 3RR8A 4DQQA 3I8BA 4YDUC 2VGNA 1NGBA 4FW1A 4CECA 3SYZA 2O4IA 1JL1A 3O9SA 1KAYA 2HBLA 3D2EB 2YNFA 3VEWA 3IKMA 4CF9A 3JSMA 3ZEUA 3U3GA 5LY3A 3K58A 3ENBA 2NRWA 4C8LA 2O8EA 3NVMA 1SKSA 4N41A 5FROA 1Z26A 4JKFA 2XRIA 2P5OA 3L4IA 2HNZA 4H5NA 2HHHK 3K57A 3AY9A 4B8AB 4CEDA 4BRPA 5LJVA 4EHTA 2FSKA 4DU4A 2Z1HA 4M7XA 3J7ZO 4CEEA 1VQ4N 4H5VA 3SQ2A 3KD1E 3L3UA 5FDLA 2GV9A 4Z4GA 1ATNA 3WNHA 3O3GA 2KKZA 1GLEG 3RMAA 4YDUA 3K9JA 1LCUA 2FBVA 4FJ9A 4Y1DA 4BRLA 4FOIA 4CF0A 2P9KB 4DLGA 1BU6O 4H0XB 1BA1A 1EETA 5KPZA 1MA9B 2VWJA 2BH1A 1EWQA 3SLCA 1EQYA 3HK2A 4RW8A 4BR4A 2F9TA 4LF8K 1GLAG 2HMPA 1NK9A 2X74A 1RT5A 4O8KA 4MO5A 4DKWA 4YFUA 4BE2A 3G0ZA 3ZSRA 4DFPA 3IUCA 5C2DA 3S3OA 1ZBHA 4BACA 3BEXA 4EP5A 1I94K 5BRFA 4FXDA 2HSTA 4DTNA 4PWDA 1Q18A 4Z4FA 2GELA 1VQPN 1VQ7N 3P83D 4IOCL 4JEPA 4FM2A 3AVGA 4CJFA 5JMVA 4CZMA 1IJJA 2OPRA 1JLGA 3SQ4A 4M41A 4CCHA 2RHKA 2XO7A 5J2PA 1RBUA 1YI2N 3AVNA 4J2DA 4N5SA 2X6SA 3TTFA 4NXNK 4OX9K 4IO9L 2YNIA 1HNIA 2WONA 4KHNA 5AQGA 2D0OA 2YHYA 1GLDG 4ELUA 1NOYA 4XH1A 4B1YB 3VTHA 3QICA 3RRHA 4BG9A 4CK1A 1K8KA 4JKGB 4AHTA 1DEJA 5HP1A 1NGGA 1QZ6A 3KLHA 3OYCA 2XY8A 3L4QA 3C94A 4CJKA 3L2WA 1X1PA 5FPDA 3DXMA 4RW9A 2DFHA 3J7YP 3JXUA 4X65K 3E1YA 1NG9A 4FZYA 2E2OA 2FF6A 4KI4A 3VQQA 2JWKA 1IBLK 4Y1CA 1SQKA 5E84A 1XQSC 3M8RA 4PL7A 5MLCQ 1D8YA 4O44A 4I9QA 4FWSA 2PBDA 2YI1A 1R0AA 3CJAA 3LDPA 2ZGZA 1LAVA 4DQIA 4I7FA 3VEXA 2BDPA 4M3TA 3VQ8A 4BR2A 3SAHA 4BR7A 4DU3A 3SQ1A 2GUPA 4DTUA 5AZJB 1IKYA 1TL1A 1D5AA 5LL6Z 3TAFA 1VQNN 1MWKA 1XMQK 5SZTA 1JLFA 4AHUA 4JRPA 3DI6A 1WAFA 4CZGA 3KTQA 2IVNA 2QTDA 5J2NA 1RBTA 4ILJA 2E8AA 3MX2A 4DTPA 3BZKA 5K14A 1QE1A 5AQHA 1RDUA 1K8AO 1NU0A 1GLFO 2HW3A 1IKVA 4E7KA 1B9FA 3EKUA 2FBTA 4DSJA 2Y1JA 1QS4A 3H6EA 1T44A 4IBNA 4FYDA 1ZBIA 4J2EA 5EOYA 4B9MA 1VK0A 4GV9A 4DB3A 3TTDA 2WFBA 3IAYA 3LP0A 4Z4EA 2PFUA 4A59A 3THWA 2O8FB 1XMOK 3FZLA 1XWLA 2VG5A 4YOWA 3VA0A 1QTMA 1EX4A 4NXMK 2G8FA 3ZSZA 4JK7A 2YJFA 3PIPL 3KJVA 4CESA 1M1KO 3ISNC 3QINA 5DM6L 1L3UA 4JAXA 4KHYA 1U6ZA 2YNGA 1BWFO 2YKMA 1V4TA 3CJ7A 4C23A 3C6AA 4IDKA 2BTFA 3LDLA 3L2QA 1NK7A 3MXJA 3MEDA 4Z4HA 4B3SK 5AQZA 2OYQA 3C6HA 3L2UA 3BF3A 1GLLO 3IMXA 2XY5A 3SUQA 4NLBA 2AA4A 2PZSA 4EP4A 3DLBA 1TAQA 3DJCA 2RPIA 3ZSOA 4E7HA 2A3ZA 4C1NI 5AQWA 5DMRA 3AGKA 1TV6A 3FZHA 4DMNA 5KPTA 4FOEA 3OJUA 4NCBA 4FLTA 4Z94A 3FGUA 3V1QA 3SMPA 3V1OA 3OA9A 1C0GA 2NUBA 3AVBA 4JHDB 3NE6A 4CBUA 4H0TB 4YNQA 5AZIB 2ASOA 3H45C 2IC3A 3WNEA 2Q1NA 1JLAA 5M1NA 4DR2K 3CPEA 4BGBA 2E88A 3AV9A 4CGFA 1BO5O 2I7NA 4B1WB 4CGJA 2ZD1A 4KB1A 4M63C 1JLCA 2HNDA 4FVUA 1S6QA 2HVIA 3NMUA 2G8KA 3O9QA 2D0PA 3LWLA 2O8BA 3CQXA 2Q36A 4B3OA 2ITMA 2EWSA 3AAQA 1QQNA 5FPEA 4BQLA 3OYJA 1S72N 3DLEA 1RILA 3DLKA 5KPRA 4E1MA 1JLEA 1TVRA 3THYB 1YIJN 1HYZA 1QVFM 4ID1A 4H0YB 5BN8A 4V19S 4DR1K 1KSPA 1VRUA 3LZJA 4BVOA 1IH7A 1VQ9N 3LPTA 1JCFA 2A6AA 4R5PA 1HMVA 4AHRA 4HUFA 2P5GA 5HRNA 4DLEA 2NRVA 2DPNA 2QWPA 1SKRA 2UUBK 1NKBA 2OCEA 3V9ZA 4DQ8A 2E20A 1SAZA 1KQSM 1ILYA 4BRNA 5AQLA 5FPNA 1Y97A 2BE2A 3ULEB 5HL7L 1P90A 3D7EO 4U7BA 3AVIA 3OYKA 5FPMA 2Q2RA 2F4VK 1VRTA 3LP2A 1XNQK 4EZ9A 1SKWA 2IS3A 3MCPA 1SUQA 3OVNA 1NNEA 4B3TK 3AVHA 2E6MA 3QERA 5HRPA 3CCMN 5J2QA 1HYVA 3AVCA 3PSIA 2VQFK 4KRFA 3AAPA 4FJIA 1TL3A 1VHXA 3WEEA 4F4KA 4CZEA 3QNOA 1DTQA 3ZETA 3ZSXA 3LP3A 3D45A 5AFUA 2E4LA 3SZ2A 4NO7A 3O80A 3CJ1A 2B4JA 3DYAA 3CQ8A 4E7IA 4W5OA 4ID5A 3SAFA 4OGEA 1FK9A 4NCAA 3VEYA 4CGHA 4KHSA 4GV6A 1W0HA 4DR5K 2P9NB 2BANA 1C1CA 4MFBA 4ISFA 4FWMA 3CC4N 4FJGA 3RTVA 1XHZA 1T3VA 4OVLA 3QFUA 4CZLA 1OH7A 3HI0A 1WLJA 2PY5A 1ITGA 3CM5A 1NGIA 1ZBUA 4L3QA 2ZQBA 1QHAA 4FPBA 4CGDA 1RT2A 5BRDA 1NK4A 4I6MB 1VSJA 3DRRA 5EX5A 4JKAA 2J4RA 2OPQA 4XIUA 1J6ZA 4O0IA 3PUFA 3DRPA 3DAWA 4BREA 4K25A 1KAZA 1UAXA 5D3GA 4K42A 1NGDA 3IRXA 4MDAA 4F9OA 2OPPA 5GINA 3TPQA 2HBMA 3A5NC 4CK2A 1BL3A 4B3RK 2P9SA 5HBMA 2G8HA 4CJTA 4DSIA 3E9PA 3VGLA 1REVA 1NJWA 5KGXA 1Z25A 2QI2A 5EY4A 5CYQA 2JGUA 4Z4CA 3D2FB 2UU9K 1U2VB 2Q97A 4CD3A 1G15A 5AQFA 3S41A 2VWKA 5T7BA 3QB0A 4CVNE 2HHVA 1KVAA 2HF3A 2HVHA 3GL1A 2NRRA 4C8NA 5HRRA 3O4NA 2IIRA 5E26A 3SQ0A 2DFEA 2QK9A 4GKKK 5CR4A
chains in the Genus database with same CATH topology
2E5LK 1IBKK 4DV7K 4DR4K 1J5EK 4JI6K 4LFCK 4LFAK 5FLXO 4LF9K 4JI2K 5LL6Z 1XMQK 4DR3K 4LF8K 2UXBK 2ZM6K 3JAMO 4AQYK 4DR2K 4DV3K 4DR5K 3T1YK 2UXCK 5BR8K 4KHPK 4X62K 3T1HK 1I94K 2UUCK 5LMNK 4JI5K 4DV0K 1N34K 1IBMK 4V19S 4DR1K 5A2QO 4DV1K 4DV2K 1N36K 4JI0K 4YY3K 4X64K 1XMOK 4JYAK 4GKJK 4DV6K 4NXNK 4JI4K 4LF6K 4OX9K 4JI8K 2UUBK 1HNZK 4NXMK 4K0KK 4LF5K 1N32K 4X66K 4B3RK 4DV5K 3J81O 4DR6K 2UXDK 4DV4K 5AJ3K 5LMUK 3J80O 4B3MK 4YHHK 4JV5K 2F4VK 5IWAK 1HR0K 4DUYK 2HHHK 2UU9K 3J7AP 4B3SK 1XNQK 3OTOK 1HNXK 3J7YP 4X65K 4JI7K 4CVNE 4B3TK 1FJGK 4JI1K 2VQFK 4LF7K 4LF4K 1IBLK 2UUAK 1N33K 4DUZK 5IT9O 1HNWK 1XNRK 4CW7B 4DR7K 4GKKK 4JI3K 2VQEK 4LFBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L K;  1IBK K;  4DV7 K;  4DR4 K;  1J5E K;  4JI6 K;  4LFC K;  4LFA K;  5FLX O;  4LF9 K;  4JI2 K;  5LL6 Z;  1XMQ K;  4DR3 K;  4LF8 K;  2UXB K;  2ZM6 K;  3JAM O;  4AQY K;  4DR2 K;  4DV3 K;  4DR5 K;  3T1Y K;  2UXC K;  5BR8 K;  4KHP K;  4X62 K;  3T1H K;  1I94 K;  2UUC K;  5LMN K;  4JI5 K;  4DV0 K;  1N34 K;  1IBM K;  4V19 S;  4DR1 K;  5A2Q O;  4DV1 K;  4DV2 K;  1N36 K;  4JI0 K;  4YY3 K;  4X64 K;  1XMO K;  4JYA K;  4GKJ K;  4DV6 K;  4NXN K;  4JI4 K;  4LF6 K;  4OX9 K;  4JI8 K;  2UUB K;  1HNZ K;  4NXM K;  4K0K K;  4LF5 K;  1N32 K;  4X66 K;  4B3R K;  4DV5 K;  3J81 O;  4DR6 K;  2UXD K;  4DV4 K;  5AJ3 K;  5LMU K;  3J80 O;  4B3M K;  4YHH K;  4JV5 K;  2F4V K;  5IWA K;  1HR0 K;  4DUY K;  2HHH K;  2UU9 K;  3J7A P;  4B3S K;  1XNQ K;  3OTO K;  1HNX K;  3J7Y P;  4X65 K;  4JI7 K;  4CVN E;  4B3T K;  1FJG K;  4JI1 K;  2VQF K;  4LF7 K;  4LF4 K;  1IBL K;  2UUA K;  1N33 K;  4DUZ K;  5IT9 O;  1HNW K;  1XNR K;  4CW7 B;  4DR7 K;  4GKK K;  4JI3 K;  2VQE K;  4LFB K; 
#chains in the Genus database with same CATH topology
 1MU2 A;  3V9W A;  2NLX A;  2E5L K;  2LSN A;  3H3O B;  4FW2 A;  3O3H A;  4Q0B A;  2GX9 A;  3NF9 A;  3GE1 A;  4FWR A;  2HHQ A;  1J9A A;  2E2P A;  4LF9 K;  5CE3 A;  3ID8 A;  3V1R A;  4H0O A;  3LL3 A;  3C7N A;  4B08 A;  3KLF A;  1CZB A;  3GOI A;  4CEO A;  2GUI A;  3NFA A;  3EL2 A;  1RDB A;  2VWB A;  3LDN A;  3CCR N;  1OKJ A;  1TK8 A;  5AFU H;  3HPG A;  3AAR A;  3GDQ A;  4BRC A;  1VSE A;  3DRS A;  3MAQ A;  1HKC A;  4CFB A;  4YOV A;  2HB5 A;  2P9L A;  4CGG A;  2PYJ A;  3VQC A;  1L5U A;  4KTQ A;  3P1G A;  3VQD A;  3K59 A;  5M1O A;  1N34 K;  3PO5 A;  5BPM A;  5FRM A;  4BC3 A;  4KAZ A;  2W41 A;  3CIP A;  4GY2 B;  4FK0 A;  5I42 A;  2DFF A;  4DV6 K;  1T6C A;  3F73 A;  4DQS A;  4GMJ B;  2OA8 A;  3O5B A;  1ATR A;  1T8E A;  4LF5 K;  1BIZ A;  1WUA A;  2X78 A;  4BRK A;  3M8Q A;  4O4G A;  3M8S A;  5AQP A;  3THX B;  1O1W A;  4IO8 A;  3ZSQ A;  5CHI A;  1YVU A;  1X9M A;  3PV8 A;  4KH5 A;  1ZBL A;  1DGK N;  4ISG A;  2HHW A;  4DSK A;  3CER A;  3HST B;  5AQU A;  2BUP A;  3VQ6 A;  2KQ2 A;  2AP1 A;  4WYB A;  4FL9 A;  3TU5 A;  3O8M A;  2FF3 B;  1RDD A;  3QDK A;  4M3U A;  4DU1 A;  4TSX A;  1LV5 A;  3WQT A;  4B8C A;  3PSF A;  4XH4 A;  5AQS A;  3CD6 N;  5GIP A;  4LC9 B;  1V4S A;  2P9P B;  4CGI A;  4B9Q A;  1OH8 A;  5AQQ A;  3TSU A;  1RTD A;  4H5R A;  3DOL A;  1J5E K;  5I9E B;  1K73 O;  4IOX A;  1WSG A;  1SL2 A;  1S1X A;  1HNV A;  1U49 A;  1UOC A;  4WFN L;  4CJW A;  5KRS A;  4CJV A;  4IZ9 A;  3SPZ A;  2IVP A;  4CZH A;  1HLU A;  3TAN A;  1RT1 A;  3HM8 A;  4W5N A;  3H1Q A;  4IFY A;  4IJA A;  2ASM A;  3LM2 A;  3C6U A;  3KKR A;  3SMS A;  1ASV A;  2Q0R A;  3UKU A;  3EKS A;  1RDA A;  4BRD A;  3B6O A;  4OPA A;  1VQO N;  4Y0W A;  2XHB A;  3M1F A;  1TYQ B;  4BR5 A;  4R79 A;  5M1K A;  5GAD P;  3FR0 A;  1WSF A;  3BF1 A;  5AQY A;  3QEP A;  1B92 A;  3KK3 A;  1FKP A;  2OTJ N;  1T03 A;  3ULD A;  4BWJ A;  2YNH A;  3WXL A;  2VCP A;  4RW6 A;  3U8X A;  3ITH A;  5AQN A;  1LOT B;  3SJJ A;  2QA4 N;  2A41 A;  1Q82 O;  2P9U B;  4OLB A;  4IWV A;  1GLJ O;  3TTC A;  4CF8 A;  5ADX A;  3I55 N;  3HVR A;  3ZCM A;  4PHT X;  2QKB A;  3HL8 A;  4CZF A;  3MXM A;  1S3X A;  2YJE A;  3JS6 A;  2QXF A;  3T7Z A;  4A5A A;  3J8A A;  3LWM A;  1NJY A;  3BY5 A;  3RWU A;  1IKX A;  2A5X A;  2P1J A;  1NWK A;  3DXK B;  1HRH A;  3O9T A;  3RSE B;  4LF4 K;  4DUZ K;  5ELZ A;  3CME N;  4JN4 A;  4RCH A;  5LJW A;  3OYD A;  3NCI A;  4BE1 A;  3MCA B;  3WUH A;  3THV A;  3CC2 N;  2Q0U A;  3CC7 N;  4DTM A;  2NRX A;  4ZHR A;  1NKE A;  1NBW A;  4BWM A;  3O1W A;  1U47 A;  3B6P A;  4AH9 A;  4J8F A;  4BRI A;  1YJW N;  3FZK A;  3C65 A;  3HM9 A;  4LSL A;  3SJH A;  4EZ6 A;  3CI5 A;  2KHO A;  3Q7C A;  1YT3 A;  3G25 A;  4QAG A;  4JS4 A;  4B9U A;  2RE2 A;  1JXE A;  4ISE A;  3VQ5 A;  4CJS A;  3JAM O;  2E6L A;  2YV0 X;  1BA0 A;  3W0L A;  3P4I A;  1NJX A;  4CZI A;  5BR8 K;  4QOZ B;  2ZJQ L;  1Z6R A;  4BR9 A;  3UB5 A;  3K9K A;  3OYB A;  2G8U A;  4C8M A;  3KVG A;  1BDG A;  3SAG A;  1VQM N;  2HHX A;  1BI4 A;  3F2K A;  4QS9 A;  4CHO A;  3O4Q A;  3HPH A;  3VF4 A;  4HTU A;  3UKR A;  3VQE A;  1VQ5 N;  3MN7 A;  1ZBF A;  5J2M A;  4CJ5 A;  3NF6 A;  4JD2 A;  4H5W A;  1NGF A;  4MLH A;  1LWE A;  3A5M C;  1FKO A;  4CEA A;  1HYS A;  3MWT A;  2O8C B;  4LD0 A;  5KQD A;  3SK3 A;  5A2Q O;  5BPL A;  3OYA A;  3ID6 A;  1XC9 A;  3VF2 A;  5C12 A;  4LF6 K;  1HNZ K;  4NLC A;  4FJL A;  4KHU A;  1WNS A;  3FE1 A;  1I39 A;  1RCH A;  4A2A A;  3HT3 A;  5AQJ A;  3O9R A;  1J5O A;  4LY7 A;  4GVE A;  3O6W A;  4HUE A;  2FSJ A;  2YX6 A;  4XEI A;  2P9I A;  2O8D B;  5AJ3 K;  4KTZ A;  5C2F A;  4B9L A;  4B3M K;  3F5T A;  1BCM A;  1TKT A;  3HSC A;  1HR0 K;  4A5B A;  3J7A P;  1OVQ A;  1S22 A;  4JK8 A;  4EIA A;  1RTJ A;  1Q9Y A;  1CZ9 A;  2FXU A;  3G4S N;  2HBK A;  3V9U A;  1GLB G;  4M3Y A;  3CF5 L;  3IDH A;  3BP8 A;  4G1Q A;  1E3M A;  2CH5 A;  1YUW A;  4BVP A;  4AHS A;  4FVM A;  3TAR A;  4K43 A;  3L2R A;  4CEQ A;  3AO5 A;  4CJL A;  5KTQ A;  2PYL A;  2NRT A;  1R59 O;  4JKC A;  4O5B A;  4IFE A;  1VSK A;  1ASU A;  1GOA A;  2HHT A;  3CM6 A;  3P38 A;  3DLH A;  3SNN A;  3C0B A;  5FLX O;  1O13 A;  3DM2 A;  3KLE A;  4BE0 A;  3PX4 A;  1ZXO A;  3K5L A;  1RGI A;  4K8X A;  1UWB A;  4DSL A;  1SZ2 A;  3A8Y A;  5CZ1 A;  2GWK A;  2X6N A;  3D2E A;  1OH6 A;  4A61 A;  1NM1 A;  1SS6 A;  3VGM A;  2KZM A;  5F2R A;  4H0P A;  3CFR A;  3IFR A;  4YOT A;  1SL0 A;  5SWM A;  3PX0 A;  3HO1 A;  4E1N A;  4W5Q A;  3R3L A;  1NK8 A;  5EU7 A;  1DT9 A;  1BIS A;  5JS1 A;  1YVN A;  3U9Z A;  3ZX2 A;  5LMN K;  4DHY A;  1RFQ A;  3EZW A;  4CEZ A;  3MMV A;  3SV4 A;  2VG7 A;  1HKB A;  3S3N A;  4IEI A;  1T6D A;  1RT6 A;  3TWH A;  2WBN A;  1OVY A;  1J53 A;  3CCS N;  4K8Z A;  4OPH A;  2Z1G A;  2EX3 A;  3MX5 A;  3S3M A;  5TKW A;  3SUP A;  5F1X A;  3NH1 A;  2P9K A;  3DWL A;  5C10 A;  1WBB A;  1KXP A;  1U48 A;  3SUO A;  1BG3 A;  4AF1 A;  3T69 A;  4FM1 A;  3MWP A;  3OYN A;  1RT7 A;  4ICL A;  1BQM A;  4KFB A;  3HPO A;  5BRH A;  4H4O A;  3LZI A;  1Q81 O;  4DUY K;  1WAJ A;  3VMF B;  3OJS A;  4CF1 A;  4PKH A;  5KQ8 A;  1VSD A;  4JI7 K;  3N4Q A;  4IOA L;  4JI1 K;  4O0J A;  1VQ8 N;  2IOC A;  2UUA K;  4W5T A;  1C0T A;  3BUZ B;  3E01 A;  2FBX A;  1BUP A;  1EWR A;  3ALY A;  4L8R B;  4JI3 K;  4NYN A;  3DMJ A;  1NMD A;  1A5X A;  4DTR A;  3ZEU B;  3EEQ A;  4U67 L;  3I0S A;  3QEW A;  3QEV A;  3EO3 A;  4BRM A;  1S1W A;  4CIG A;  2O8E B;  1YF5 L;  4DCH A;  2WC9 A;  4M45 A;  3L0Q A;  3OYG A;  3WT0 A;  4RWT A;  5EVZ A;  3KWG A;  4KV8 A;  5AQI A;  4DS4 A;  1WBD A;  2ZWH A;  3RR7 A;  4FZX C;  3CCL N;  5KI6 A;  1MWM A;  4JKG A;  4K41 A;  1JJ2 M;  4E19 A;  1ZC6 A;  3T1H K;  3K5M A;  1KVC A;  1YHQ N;  1VQK N;  3CFP A;  1BGX T;  3NH0 A;  1YTA A;  3D6R A;  4FWO A;  5AQM A;  3K2P A;  3MEE A;  4OKK A;  4WFB L;  3VN5 A;  4LH5 A;  3QNN A;  3CYM A;  5AQR A;  4OGC A;  4N76 A;  3O08 A;  1Q9X A;  2E1Z A;  3P39 A;  5JVG L;  1L3T A;  1QSY A;  3EY1 A;  3NBP A;  2ZJP L;  3WXI A;  4DV1 K;  5C15 A;  4QCL A;  1E4F T;  4DSF A;  3ZSW A;  3NAE A;  3LAK A;  1QQO A;  4A57 A;  4CFD A;  2O4G A;  2ZGY A;  1KLN A;  1UA1 A;  1A5V A;  4RW7 A;  3PX6 A;  2GEM A;  1NGC A;  1D4X A;  3VQB A;  4FJK A;  4I2Q A;  5AZJ A;  4DR6 K;  1QVG M;  2UXD K;  4DV4 K;  4CER A;  1VSM A;  3J80 O;  4FM0 A;  3A5L C;  1X3N A;  4YOU A;  4JV5 K;  4DF4 A;  3FFK B;  1RBV A;  4M42 A;  4CJ7 A;  2Z1J A;  1WSI A;  1GLC G;  1OH5 A;  5HRO A;  4BRG A;  4PQU A;  3WQU A;  3AVF A;  3A5O C;  3BZC A;  5CZ2 A;  2G8V A;  4HCB A;  4C8K A;  1QZ5 A;  3CG7 A;  4BQZ A;  4E3S A;  1WOQ A;  1Q86 O;  3M8P A;  4PA1 A;  1MDU B;  1W97 L;  3V81 A;  4CIE A;  3V4I A;  4DFJ A;  4FSV A;  1W9H A;  3MEG A;  2A1S A;  4H5T A;  1T05 A;  3DLR A;  1U45 A;  4WFA L;  3M5R A;  1JCE A;  3VET A;  3SPY A;  3DLL L;  3NGI A;  2O8F A;  1K8K B;  4M7Y A;  3JYT A;  4BC2 A;  3AO1 A;  2KZZ A;  3FLC O;  3QIP A;  3EE8 A;  3IS9 A;  2E2N A;  3ZLJ A;  3AVL A;  1Z05 A;  4CJR A;  1C0U A;  2XY6 A;  3O3F A;  3HXM A;  3T1Y K;  3DXM B;  4E89 A;  3HVT A;  1LWC A;  2CGK A;  4HCC A;  3QLH A;  3KWI A;  4FLX A;  4KI6 A;  2ITG A;  3HP9 A;  2I7P A;  4E7L A;  1S1U A;  1WSH A;  2EHG A;  2WOM A;  3ENH A;  1WB9 A;  2A42 A;  2IAJ A;  1LWF A;  2QWN A;  1KC8 O;  4KPY A;  2ZF5 O;  2D4W A;  1HQU A;  5BN9 A;  1UA0 A;  4IFV A;  2ASP A;  2I5J A;  4CD1 A;  1NJZ A;  4DV2 K;  4JKD A;  5J1E A;  2OAN A;  3KIO A;  4CEF A;  5GIO A;  2RKI A;  3QEI A;  4O5F A;  1M90 O;  4PUO A;  4IKF A;  2HMI A;  4C1N K;  3HP6 A;  3KLI A;  3RVC A;  2V51 B;  4CHY A;  3V9X A;  4CJE A;  3G10 A;  4JHD A;  2GTD A;  1S9G A;  4DV5 K;  1BIU A;  5AZI A;  1U04 A;  3DOK A;  2RN2 A;  1JLQ A;  3F9M A;  2E1Y A;  3OBY A;  3K5N A;  3UIQ A;  2QW9 A;  4HWI A;  3HTV A;  4UY8 O;  4RW4 A;  1P8Z A;  3B8A X;  1TUY A;  1EP4 A;  3HOS A;  4BGA A;  3HJF A;  3SV3 A;  4DF8 A;  5KRT A;  3CCQ N;  3CFO A;  5EXW A;  3TR8 A;  1GOB A;  3THW B;  3LP1 A;  5AQK A;  3RMC A;  4EFH A;  1RTH A;  3WNG A;  4B1X B;  3CMA N;  4BDY A;  3FZM A;  1HJO A;  3OYE A;  3OY9 A;  4CJP A;  1VSI A;  2FLO A;  1WN7 A;  3AVM A;  3V9S A;  5TKY A;  4DV7 K;  4B9N A;  1BHL A;  1X3M A;  3QBW A;  3ZT0 A;  4F2S A;  4N56 A;  4LH4 A;  3S9H A;  1X9S A;  5AQO A;  1S9E A;  3MN6 A;  4AIL C;  3O9U A;  1ZBS A;  3AA4 A;  3EYZ A;  2UXC K;  2F96 A;  3OYM A;  4B1V A;  4JRQ A;  2PAV A;  4BRA A;  3ZX0 A;  1CLQ A;  1HQE A;  3VA3 A;  2QWQ A;  3FZF A;  3ULE A;  1ATS A;  1XI1 A;  2UUC K;  1U4B A;  3WXJ A;  4JKB A;  3T1A A;  1KCF A;  3VQ7 A;  4DV0 K;  3AO4 A;  1HJR A;  3SUN A;  3ZSV A;  1S1T A;  3HYF A;  5C42 A;  1RDW X;  1TGO A;  2QWL A;  3LDS A;  4DSE A;  2HOE A;  2D0B A;  2HNY A;  3KK7 A;  3WXK A;  3TAG A;  2FSN A;  4J2B A;  4YOR A;  1RT4 A;  1DKG D;  4OPK A;  3ATU A;  1YTU A;  3CHW A;  4K0K K;  1TK5 A;  1X9W A;  5H1S Q;  4X66 K;  3J81 O;  3PLA A;  5DM7 L;  3R8E A;  3OBW A;  4GVM A;  4RTF D;  4AM7 A;  1RDC A;  2E2Q A;  2D1K A;  3VEO A;  2NZT A;  4CJQ A;  2O8B B;  2GBZ A;  1NKC A;  2WUS A;  2G8W A;  1B9D A;  2ATQ A;  2P9N A;  5AQV A;  3UE5 A;  2OZS A;  4FWK A;  1EO1 A;  4DFM A;  1F21 A;  4BY9 C;  3L8B A;  2YHA A;  3H08 A;  3I0R A;  2HHS A;  2FBY A;  3CJC A;  3F9K A;  3NHG A;  3ZX3 A;  1EKE A;  2WTU A;  4FJH A;  4OJR A;  3MK6 A;  3G71 N;  2VQE K;  4B9T A;  4MO4 A;  4E0D A;  4EAH D;  1JXB A;  3H1V X;  4CHN A;  1TKD A;  1E4G T;  4I6M A;  3C6T A;  1HPZ A;  4DQP A;  3O4W A;  3CXC M;  3G6E N;  3CCV N;  1N5Y A;  3LAL A;  3AGR A;  4FJX A;  2UXB K;  2ZM6 K;  4WQ5 C;  1DTT A;  3WNF A;  4AQY K;  2VG6 A;  3NF8 A;  5BRE A;  4FJM A;  2YCH A;  3SBT A;  4BDZ A;  3L6Q A;  4FWN A;  4CIF A;  4QS8 A;  5HOO A;  1NLV A;  4W5R A;  2W42 A;  1SL1 A;  4O55 A;  4UQG A;  4X62 K;  3I8D A;  4DTS A;  4M3Z A;  1C6V A;  4F8R A;  3WEE B;  3VEV A;  2UYT A;  1J54 A;  5HLF A;  3D2F A;  3ZET B;  1U2V A;  2R7Y A;  2KFZ A;  3QIO A;  4FJ5 A;  1YJN N;  3PY8 A;  1JL2 A;  5BPN A;  4DWI A;  3OYL A;  1KTQ A;  5KGW A;  3MEC A;  3W3D A;  1HPM A;  3AVK A;  1W2B M;  2YHX A;  1FW6 A;  4YY3 K;  4WQ5 A;  4I2P A;  4JI4 K;  1XHX A;  1Y64 A;  3VQA A;  5CY4 A;  4JKE A;  3H3N O;  4CK3 A;  4FCY A;  4ZTJ A;  2NRZ A;  1IO2 A;  4QS7 A;  3U3Y A;  4FK4 A;  2KFN A;  3ZT1 A;  3CJB A;  5LMU K;  1CXU A;  3SBG A;  4CHP A;  1QSL A;  2QM1 A;  2VYP A;  1JKH A;  1HKG A;  3FFI A;  4WCE L;  3T3F A;  3QES A;  4MLE A;  4IG0 A;  3KK2 A;  3EZ5 A;  4ELV A;  3ZSY A;  3KHY A;  4GV3 A;  1XNR K;  2OPS A;  2HBJ A;  4CW7 B;  3TAM A;  4FK2 A;  4FLU A;  5DK5 A;  3LM9 A;  3VEN A;  4LFB K;  4CEB A;  2QEX N;  1WSE A;  4NYF A;  4JI6 K;  3CJ9 A;  2P9S B;  4CJ3 A;  3HRG A;  3RMD A;  4OKE A;  4NCG A;  5ADX H;  1LW0 A;  1K9M O;  2DTU A;  3O1B A;  4HHT A;  3DLG A;  3MN9 A;  4OO1 J;  2Y1I A;  4LSN A;  1TK0 A;  1RNH A;  4MDB A;  4KO0 A;  3M3Z A;  2P51 A;  3AO3 A;  4H8K A;  1KRP A;  3U4L A;  4PKI A;  4EHU A;  3OS2 A;  3THX A;  3QO9 A;  2Z1I A;  4Q5V A;  1HUX A;  5C25 A;  4JI5 K;  4KHQ A;  3KZB A;  4RG8 A;  2B6A A;  2F9W A;  4OLA A;  2W6L A;  3T19 A;  4B9S A;  4KH6 A;  1S1V A;  2A40 A;  1D9D A;  2KW4 A;  4OKJ A;  4H0V B;  1VSF A;  3CET A;  3AA5 X;  3HOT A;  3RRG A;  3ENO A;  1N36 K;  4ZTF A;  2D0C A;  4JK9 A;  4CBW A;  3C7N B;  4GKJ K;  4JI8 K;  1RBR A;  4G9Z A;  2P9P A;  3OS0 A;  3V6D A;  4BDP A;  1C0F A;  1RBS A;  3CCU N;  3NGY A;  2H3G X;  2XY7 A;  4N47 A;  1K6Y A;  3OYI A;  4KRE A;  3TSQ A;  1N32 K;  3AVA A;  2ZJR L;  4CE9 A;  4B1Z A;  2Q31 A;  2P9L B;  4YHH K;  4CBX A;  3HZ6 A;  5IWA K;  2CH6 A;  2D5R A;  3OHR A;  4KTW A;  3WXM B;  3AA3 A;  4WQ4 C;  1H1V A;  3R9P A;  4CI6 A;  3QEX A;  4JNE A;  3VOV A;  2W6K A;  2IGI A;  4DQR A;  4I9L A;  4FPA A;  1D9F A;  1G99 A;  5IT9 O;  3CPW M;  2W40 A;  4GNI A;  3VGK A;  1HNW K;  3NVK A;  3ASM A;  4FJ7 A;  1VQL N;  3PIO L;  3KD5 E;  2HHU A;  2F7T A;  1TYQ A;  1S5J A;  1SV5 A;  2GWJ A;  4BG8 A;  3K5O A;  4FJN A;  1XC3 A;  1RTI A;  1NJI O;  1QQC A;  3BDP A;  5AQT A;  3TAE A;  2V7Y A;  1IKW A;  4NB4 A;  4M3X A;  3E9L A;  4Z4I A;  1KVB A;  1NGA A;  4FLY A;  3E9O A;  4JLH A;  4DS5 A;  1KFD A;  3BGR A;  2P9U A;  3I56 N;  4WQ4 A;  2G8I A;  1JCG A;  3ZYY X;  4CHZ A;  1S6P A;  4MQ3 A;  1WSJ A;  5JIC A;  1C1B A;  1NOZ A;  4OPJ A;  2ETJ A;  4CZK A;  1EXQ A;  4BRO A;  1A5W A;  4PL8 A;  4AHC A;  2F8T A;  1YAG A;  1HX1 A;  1QHT A;  4CFA A;  1BOT O;  4PY5 A;  1CZA N;  4IDH A;  3LPU A;  1YIT N;  1XUP O;  3A2F A;  3DXK A;  3RSE A;  1QQM A;  3NGZ A;  3NH2 A;  4F2R A;  1NK5 A;  5JS2 A;  3ZT4 A;  3QML A;  4X64 K;  3SI6 A;  1VSH A;  5M1Q A;  5C24 A;  3E66 A;  4GW6 A;  3D0P A;  1KFS A;  4CFC A;  3AVJ A;  3IG1 A;  4B9V A;  3MDQ A;  3LAM A;  1NK6 A;  3L2V A;  5AQX A;  4KHW A;  2KLA A;  4YOX A;  4CJ4 A;  4KBO A;  3MXI A;  3SCX A;  3AA2 A;  4Z0U A;  3N4P A;  2CGJ A;  1CXQ A;  3VQ4 A;  5CYM A;  3NDK A;  4CZJ A;  3EE9 A;  2B5J A;  5GAE P;  4JS5 A;  3PO4 A;  3H46 O;  3ATV A;  3P5J A;  4BRF A;  1RT3 A;  5C0Y A;  4A62 A;  1Q7Y O;  3UKU B;  1T7P A;  2JWL A;  1DLO A;  2D0A A;  5JVH L;  1FJG K;  4ILH A;  1N8R O;  2QKK A;  3QFP A;  3Q7B A;  2IVO A;  1N33 K;  4FLW A;  2YHW A;  3M6G A;  2DY4 A;  3GG4 A;  4AM6 A;  4HTL A;  1BCO A;  1LW2 A;  5E41 A;  3QBX A;  1ASW A;  2CGL A;  5I3U A;  4F3O A;  4AHV A;  1IBK K;  4FWL A;  2O8C A;  4LFC K;  2V7Z A;  2VGM A;  5AR0 A;  3VQP A;  4JI2 K;  3EN9 A;  1ZYQ A;  3OW2 M;  4H4M A;  2YHB A;  4CHQ A;  1NMN A;  1LAW A;  4HUG A;  1IV0 A;  3AO2 A;  1TKX A;  4KB0 A;  4DV3 K;  1TAU A;  4IXC A;  1NGE A;  4E7J A;  2KTQ A;  1C0M A;  4IEE A;  4XH5 A;  1JLB A;  4KHP K;  2O8D A;  1GOC A;  2Q3S A;  4FJJ A;  5M1P A;  4DTO A;  1Q8I A;  3LAN A;  4YOY A;  1N6Q A;  3VPZ A;  4DG1 A;  4PKG A;  3OYF A;  3CCE N;  4C8O A;  1ESV A;  2JLE A;  3TAB A;  5GAG P;  3VTI A;  4FWQ A;  3OS1 A;  3ZT3 A;  3TI0 A;  4HVJ A;  4CF2 A;  1NGJ A;  4JI0 K;  3GBT A;  4JYA K;  3HBT A;  2AJQ A;  4WE1 A;  3VF6 A;  3RMB A;  5JLH A;  4FWP A;  4M3R A;  1VSL A;  3MN5 A;  4KH4 A;  4ELT A;  4M3W A;  4E1J A;  4DTJ A;  2A1R A;  4J2A A;  3U9D A;  4DTX A;  3VEZ A;  1BI4 B;  4F3T A;  5F0X A;  3U6F A;  4BR0 A;  3UKR B;  3KKS A;  3OTO K;  4FLV A;  1TUU A;  1HNX K;  5M1F A;  4JD2 B;  4FJ8 A;  4BC5 A;  3KK1 A;  3TSP A;  3R6M A;  3KLG A;  4BC4 A;  4FZZ A;  1NGH A;  1KD1 O;  4LF7 K;  3VES A;  2QXL A;  1YXQ A;  2FC0 A;  4JKH A;  3NF7 A;  1TKZ A;  1KAX A;  2QWR A;  1FXX A;  5B8H A;  4WF9 L;  2QWM A;  4DR7 K;  3OYH A;  3TAQ A;  1C1A A;  4H03 B;  4IJN A;  5FRN A;  2ZE2 A;  4DR4 K;  3K0S A;  2RF2 A;  1IG8 A;  3CQY A;  4ILG B;  4LFA K;  2QWO A;  5JLF A;  1VQ6 N;  2P9I B;  3R1X A;  1W7A A;  4A2B A;  3P31 A;  3LDO A;  4DR3 K;  1IG9 A;  1NK0 A;  4KKO A;  5HRS A;  2F8S A;  4DFK A;  2NRH A;  5BR9 A;  2HF4 A;  1QSS A;  3LDQ A;  4BRH A;  2YKN A;  4FLZ A;  2OZM A;  3I33 A;  4FO0 A;  3L3V A;  3THY A;  1L3S A;  3A0I X;  3CCJ N;  2BGG A;  3QET A;  2IDO A;  4BRQ A;  2OTL N;  1KLM A;  1X9J A;  5GAH P;  1L3V A;  1BQN A;  3ZT2 A;  4B1U B;  1VAZ A;  2V52 B;  4O8U A;  1I3A A;  3TAP A;  3VQ9 A;  1YJ9 N;  1IBM K;  3C95 A;  4IG3 A;  4CJU A;  2NNW A;  3VER A;  3RR8 A;  4DQQ A;  3I8B A;  4YDU C;  2VGN A;  1NGB A;  4FW1 A;  4CEC A;  3SYZ A;  2O4I A;  1JL1 A;  3O9S A;  1KAY A;  2HBL A;  3D2E B;  2YNF A;  3VEW A;  3IKM A;  4CF9 A;  3JSM A;  3ZEU A;  3U3G A;  5LY3 A;  3K58 A;  3ENB A;  2NRW A;  4C8L A;  2O8E A;  3NVM A;  1SKS A;  4N41 A;  5FRO A;  1Z26 A;  4JKF A;  2XRI A;  2P5O A;  3L4I A;  2HNZ A;  4H5N A;  2HHH K;  3K57 A;  3AY9 A;  4B8A B;  4CED A;  4BRP A;  5LJV A;  4EHT A;  2FSK A;  4DU4 A;  2Z1H A;  4M7X A;  3J7Z O;  4CEE A;  1VQ4 N;  4H5V A;  3SQ2 A;  3KD1 E;  3L3U A;  5FDL A;  2GV9 A;  4Z4G A;  1ATN A;  3WNH A;  3O3G A;  2KKZ A;  1GLE G;  3RMA A;  4YDU A;  3K9J A;  1LCU A;  2FBV A;  4FJ9 A;  4Y1D A;  4BRL A;  4FOI A;  4CF0 A;  2P9K B;  4DLG A;  1BU6 O;  4H0X B;  1BA1 A;  1EET A;  5KPZ A;  1MA9 B;  2VWJ A;  2BH1 A;  1EWQ A;  3SLC A;  1EQY A;  3HK2 A;  4RW8 A;  4BR4 A;  2F9T A;  4LF8 K;  1GLA G;  2HMP A;  1NK9 A;  2X74 A;  1RT5 A;  4O8K A;  4MO5 A;  4DKW A;  4YFU A;  4BE2 A;  3G0Z A;  3ZSR A;  4DFP A;  3IUC A;  5C2D A;  3S3O A;  1ZBH A;  4BAC A;  3BEX A;  4EP5 A;  1I94 K;  5BRF A;  4FXD A;  2HST A;  4DTN A;  4PWD A;  1Q18 A;  4Z4F A;  2GEL A;  1VQP N;  1VQ7 N;  3P83 D;  4IOC L;  4JEP A;  4FM2 A;  3AVG A;  4CJF A;  5JMV A;  4CZM A;  1IJJ A;  2OPR A;  1JLG A;  3SQ4 A;  4M41 A;  4CCH A;  2RHK A;  2XO7 A;  5J2P A;  1RBU A;  1YI2 N;  3AVN A;  4J2D A;  4N5S A;  2X6S A;  3TTF A;  4NXN K;  4OX9 K;  4IO9 L;  2YNI A;  1HNI A;  2WON A;  4KHN A;  5AQG A;  2D0O A;  2YHY A;  1GLD G;  4ELU A;  1NOY A;  4XH1 A;  4B1Y B;  3VTH A;  3QIC A;  3RRH A;  4BG9 A;  4CK1 A;  1K8K A;  4JKG B;  4AHT A;  1DEJ A;  5HP1 A;  1NGG A;  1QZ6 A;  3KLH A;  3OYC A;  2XY8 A;  3L4Q A;  3C94 A;  4CJK A;  3L2W A;  1X1P A;  5FPD A;  3DXM A;  4RW9 A;  2DFH A;  3J7Y P;  3JXU A;  4X65 K;  3E1Y A;  1NG9 A;  4FZY A;  2E2O A;  2FF6 A;  4KI4 A;  3VQQ A;  2JWK A;  1IBL K;  4Y1C A;  1SQK A;  5E84 A;  1XQS C;  3M8R A;  4PL7 A;  5MLC Q;  1D8Y A;  4O44 A;  4I9Q A;  4FWS A;  2PBD A;  2YI1 A;  1R0A A;  3CJA A;  3LDP A;  2ZGZ A;  1LAV A;  4DQI A;  4I7F A;  3VEX A;  2BDP A;  4M3T A;  3VQ8 A;  4BR2 A;  3SAH A;  4BR7 A;  4DU3 A;  3SQ1 A;  2GUP A;  4DTU A;  5AZJ B;  1IKY A;  1TL1 A;  1D5A A;  5LL6 Z;  3TAF A;  1VQN N;  1MWK A;  1XMQ K;  5SZT A;  1JLF A;  4AHU A;  4JRP A;  3DI6 A;  1WAF A;  4CZG A;  3KTQ A;  2IVN A;  2QTD A;  5J2N A;  1RBT A;  4ILJ A;  2E8A A;  3MX2 A;  4DTP A;  3BZK A;  5K14 A;  1QE1 A;  5AQH A;  1RDU A;  1K8A O;  1NU0 A;  1GLF O;  2HW3 A;  1IKV A;  4E7K A;  1B9F A;  3EKU A;  2FBT A;  4DSJ A;  2Y1J A;  1QS4 A;  3H6E A;  1T44 A;  4IBN A;  4FYD A;  1ZBI A;  4J2E A;  5EOY A;  4B9M A;  1VK0 A;  4GV9 A;  4DB3 A;  3TTD A;  2WFB A;  3IAY A;  3LP0 A;  4Z4E A;  2PFU A;  4A59 A;  3THW A;  2O8F B;  1XMO K;  3FZL A;  1XWL A;  2VG5 A;  4YOW A;  3VA0 A;  1QTM A;  1EX4 A;  4NXM K;  2G8F A;  3ZSZ A;  4JK7 A;  2YJF A;  3PIP L;  3KJV A;  4CES A;  1M1K O;  3ISN C;  3QIN A;  5DM6 L;  1L3U A;  4JAX A;  4KHY A;  1U6Z A;  2YNG A;  1BWF O;  2YKM A;  1V4T A;  3CJ7 A;  4C23 A;  3C6A A;  4IDK A;  2BTF A;  3LDL A;  3L2Q A;  1NK7 A;  3MXJ A;  3MED A;  4Z4H A;  4B3S K;  5AQZ A;  2OYQ A;  3C6H A;  3L2U A;  3BF3 A;  1GLL O;  3IMX A;  2XY5 A;  3SUQ A;  4NLB A;  2AA4 A;  2PZS A;  4EP4 A;  3DLB A;  1TAQ A;  3DJC A;  2RPI A;  3ZSO A;  4E7H A;  2A3Z A;  4C1N I;  5AQW A;  5DMR A;  3AGK A;  1TV6 A;  3FZH A;  4DMN A;  5KPT A;  4FOE A;  3OJU A;  4NCB A;  4FLT A;  4Z94 A;  3FGU A;  3V1Q A;  3SMP A;  3V1O A;  3OA9 A;  1C0G A;  2NUB A;  3AVB A;  4JHD B;  3NE6 A;  4CBU A;  4H0T B;  4YNQ A;  5AZI B;  2ASO A;  3H45 C;  2IC3 A;  3WNE A;  2Q1N A;  1JLA A;  5M1N A;  4DR2 K;  3CPE A;  4BGB A;  2E88 A;  3AV9 A;  4CGF A;  1BO5 O;  2I7N A;  4B1W B;  4CGJ A;  2ZD1 A;  4KB1 A;  4M63 C;  1JLC A;  2HND A;  4FVU A;  1S6Q A;  2HVI A;  3NMU A;  2G8K A;  3O9Q A;  2D0P A;  3LWL A;  2O8B A;  3CQX A;  2Q36 A;  4B3O A;  2ITM A;  2EWS A;  3AAQ A;  1QQN A;  5FPE A;  4BQL A;  3OYJ A;  1S72 N;  3DLE A;  1RIL A;  3DLK A;  5KPR A;  4E1M A;  1JLE A;  1TVR A;  3THY B;  1YIJ N;  1HYZ A;  1QVF M;  4ID1 A;  4H0Y B;  5BN8 A;  4V19 S;  4DR1 K;  1KSP A;  1VRU A;  3LZJ A;  4BVO A;  1IH7 A;  1VQ9 N;  3LPT A;  1JCF A;  2A6A A;  4R5P A;  1HMV A;  4AHR A;  4HUF A;  2P5G A;  5HRN A;  4DLE A;  2NRV A;  2DPN A;  2QWP A;  1SKR A;  2UUB K;  1NKB A;  2OCE A;  3V9Z A;  4DQ8 A;  2E20 A;  1SAZ A;  1KQS M;  1ILY A;  4BRN A;  5AQL A;  5FPN A;  1Y97 A;  2BE2 A;  3ULE B;  5HL7 L;  1P90 A;  3D7E O;  4U7B A;  3AVI A;  3OYK A;  5FPM A;  2Q2R A;  2F4V K;  1VRT A;  3LP2 A;  1XNQ K;  4EZ9 A;  1SKW A;  2IS3 A;  3MCP A;  1SUQ A;  3OVN A;  1NNE A;  4B3T K;  3AVH A;  2E6M A;  3QER A;  5HRP A;  3CCM N;  5J2Q A;  1HYV A;  3AVC A;  3PSI A;  2VQF K;  4KRF A;  3AAP A;  4FJI A;  1TL3 A;  1VHX A;  3WEE A;  4F4K A;  4CZE A;  3QNO A;  1DTQ A;  3ZET A;  3ZSX A;  3LP3 A;  3D45 A;  5AFU A;  2E4L A;  3SZ2 A;  4NO7 A;  3O80 A;  3CJ1 A;  2B4J A;  3DYA A;  3CQ8 A;  4E7I A;  4W5O A;  4ID5 A;  3SAF A;  4OGE A;  1FK9 A;  4NCA A;  3VEY A;  4CGH A;  4KHS A;  4GV6 A;  1W0H A;  4DR5 K;  2P9N B;  2BAN A;  1C1C A;  4MFB A;  4ISF A;  4FWM A;  3CC4 N;  4FJG A;  3RTV A;  1XHZ A;  1T3V A;  4OVL A;  3QFU A;  4CZL A;  1OH7 A;  3HI0 A;  1WLJ A;  2PY5 A;  1ITG A;  3CM5 A;  1NGI A;  1ZBU A;  4L3Q A;  2ZQB A;  1QHA A;  4FPB A;  4CGD A;  1RT2 A;  5BRD A;  1NK4 A;  4I6M B;  1VSJ A;  3DRR A;  5EX5 A;  4JKA A;  2J4R A;  2OPQ A;  4XIU A;  1J6Z A;  4O0I A;  3PUF A;  3DRP A;  3DAW A;  4BRE A;  4K25 A;  1KAZ A;  1UAX A;  5D3G A;  4K42 A;  1NGD A;  3IRX A;  4MDA A;  4F9O A;  2OPP A;  5GIN A;  3TPQ A;  2HBM A;  3A5N C;  4CK2 A;  1BL3 A;  4B3R K;  2P9S A;  5HBM A;  2G8H A;  4CJT A;  4DSI A;  3E9P A;  3VGL A;  1REV A;  1NJW A;  5KGX A;  1Z25 A;  2QI2 A;  5EY4 A;  5CYQ A;  2JGU A;  4Z4C A;  3D2F B;  2UU9 K;  1U2V B;  2Q97 A;  4CD3 A;  1G15 A;  5AQF A;  3S41 A;  2VWK A;  5T7B A;  3QB0 A;  4CVN E;  2HHV A;  1KVA A;  2HF3 A;  2HVH A;  3GL1 A;  2NRR A;  4C8N A;  5HRR A;  3O4N A;  2IIR A;  5E26 A;  3SQ0 A;  2DFE A;  2QK9 A;  4GKK K;  5CR4 A; 
#chains in the Genus database with same CATH homology
 2E5L K;  1IBK K;  4DV7 K;  4DR4 K;  1J5E K;  4JI6 K;  4LFC K;  4LFA K;  5FLX O;  4LF9 K;  4JI2 K;  5LL6 Z;  1XMQ K;  4DR3 K;  4LF8 K;  2UXB K;  2ZM6 K;  3JAM O;  4AQY K;  4DR2 K;  4DV3 K;  4DR5 K;  3T1Y K;  2UXC K;  5BR8 K;  4KHP K;  4X62 K;  3T1H K;  1I94 K;  2UUC K;  5LMN K;  4JI5 K;  4DV0 K;  1N34 K;  1IBM K;  4V19 S;  4DR1 K;  5A2Q O;  4DV1 K;  4DV2 K;  1N36 K;  4JI0 K;  4YY3 K;  4X64 K;  1XMO K;  4JYA K;  4GKJ K;  4DV6 K;  4NXN K;  4JI4 K;  4LF6 K;  4OX9 K;  4JI8 K;  2UUB K;  1HNZ K;  4NXM K;  4K0K K;  4LF5 K;  1N32 K;  4X66 K;  4B3R K;  4DV5 K;  3J81 O;  4DR6 K;  2UXD K;  4DV4 K;  5AJ3 K;  5LMU K;  3J80 O;  4B3M K;  4YHH K;  4JV5 K;  2F4V K;  5IWA K;  1HR0 K;  4DUY K;  2HHH K;  2UU9 K;  3J7A P;  4B3S K;  1XNQ K;  3OTO K;  1HNX K;  3J7Y P;  4X65 K;  4JI7 K;  4CVN E;  4B3T K;  1FJG K;  4JI1 K;  2VQF K;  4LF7 K;  4LF4 K;  1IBL K;  2UUA K;  1N33 K;  4DUZ K;  5IT9 O;  1HNW K;  1XNR K;  4CW7 B;  4DR7 K;  4GKK K;  4JI3 K;  2VQE K;  4LFB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...