4JI4K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji4K00
4DR5K 4JI8K 1N33K 4V19S 1IBLK 3J81O 4LF7K 4LF6K 4JYAK 2UXBK 4DV3K 4OX9K 4DV1K 1IBMK 1HNZK 5A2QO 4DUYK 4NXNK 4DV6K 4DR4K 4AQYK 2UU9K 5IWAK 1I94K 3J7YP 4JI0K 4JI5K 4YHHK 4X64K 4LF5K 4X66K 1N32K 5LMNK 4DR2K 5FLXO 4B3MK 4GKJK 2VQFK 3OTOK 2E5LK 4JV5K 1XMQK 4B3SK 4LF4K 5BR8K 3T1YK 1HR0K 1FJGK 4K0KK 2F4VK 1XNRK 4DR6K 4LFAK 2UUAK 1HNXK 4NXMK 4LF8K 2UUBK 5IT9O 4GKKK 5AJ3K 4DUZK 3J7AP 4X65K 4JI3K 1XNQK 4JI2K 4LF9K 2ZM6K 4DV7K 4LFBK 2UUCK 4JI4K 4DR7K 4JI6K 4DV2K 2UXDK 3JAMO 3T1HK 2UXCK 4B3RK 2VQEK 2HHHK 1HNWK 4YY3K 4DR1K 1N36K 1J5EK 5LL6Z 4X62K 5LMUK 4JI7K 4CVNE 4DV5K 4DV0K 4KHPK 4CW7B 1XMOK 1IBKK 4DR3K 1N34K 4B3TK 3J80O 4LFCK 4DV4K 4JI1K
chains in the Genus database with same CATH superfamily
1TKDA 4DR5K 5D3GA 3D2FB 2A42A 1GLCG 3J81O 4FJLA 2UXBK 3SV4A 3EY1A 2A3ZA 2IS3A 4CI6A 4NXNK 4DV6K 2HHSA 2IOCA 2Z1IA 3VMFB 4BRPA 4CF0A 5ELZA 3MXMA 4LF5K 2VWBA 4OKEA 3TTCA 4AHUA 4I9LA 4DFPA 3O4QA 3P83D 4N41A 1RDAA 1VQ6N 2Q0UA 2FXUA 3TSPA 4DR6K 2P9PA 1WSIA 4CF9A 3QEPA 3QESA 4H4OA 4CEAA 2OTJN 3A5NC 3KLGA 3S3OA 1XQSC 3PX4A 4KO0A 2V7YA 1LCUA 4JI3K 5C12A 3VN5A 3SBGA 4CGDA 5I9EB 4JI4K 4M3ZA 1TGOA 1U04A 3DOLA 3DLBA 3O80A 4C1NI 3AAQA 3OYEA 3HBTA 1S5JA 3DLGA 2NRVA 3CETA 1FW6A 1GLAG 3VQCA 2O8CA 5AFUA 1L3SA 3AVIA 2FSNA 1QZ5A 2YCHA 4DWIA 2DTUA 2QWLA 1RDUA 3IMXA 5BR9A 5JICA 3IDHA 4A62A 1VQMN 2E2NA 2P5OA 1HKGA 5EY4A 5FROA 1TKXA 3FZMA 5F1XA 2RE2A 1RBTA 1W9HA 2F8SA 3LDLA 1HYSA 2PFUA 1NJXA 3CCEN 4GMJB 1VSFA 3CJ7A 4E1MA 1WOQA 1DEJA 4IEEA 4BQLA 2PZSA 4H0OA 2P1JA 4KPYA 4O0JA 5GIPA 5DK5A 1KAZA 4FWLA 1N33K 3THXA 5EU7A 4O0IA 3ULEB 4UQGA 5AQKA 4CHZA 1HNVA 1VQKN 3L6QA 2V52B 4CJSA 1ATSA 3K5MA 1Z05A 3HTVA 1W97L 4N47A 4CFDA 4AQYK 1R0AA 2OPSA 1GLFO 3VQ8A 3HI0A 1IKVA 3MN6A 1RT2A 1RT7A 1RBRA 4BR5A 2XO7A 4AH9A 4KAZA 1C1CA 1SQKA 3OBYA 4GV9A 3M1FA 3D7EO 1TKZA 5BPLA 3TU5A 2DFHA 1SAZA 2Q97A 1HRHA 3LWLA 4W5RA 3V9XA 3NGIA 2P9KA 3J7AP 2D0AA 3TR8A 5M1QA 3DLEA 1W7AA 4OPAA 4RG8A 1MA9B 3M3ZA 1UA1A 1ZXOA 4IO9L 4E3SA 4MO5A 2HBMA 3SUPA 4AHSA 1HYVA 4A2BA 1EP4A 1RT6A 4FJ9A 1T03A 2YV0X 3T1HK 5DMRA 4J8FA 1VSMA 2IVNA 5AZJB 2NRHA 2WOMA 4BVPA 3I8BA 4C8OA 4QS7A 4M3XA 4JI7K 2HHVA 4DTXA 4BACA 1WSGA 4DV5K 1V4TA 1L3UA 3EO3A 1YHQN 4DV0K 4IO8A 1D8YA 4N5SA 1U48A 3UKRA 2HB5A 3TARA 1QHTA 1T7PA 1HPMA 4Y1CA 2A41A 3CCMN 4G1QA 4RW6A 1RT5A 3QO9A 4M45A 3KVGA 2FC0A 4CIGA 1VQON 4JI1K 4PL7A 2D4WA 4B3OA 4GY2B 3KHYA 4K41A 1RTHA 4OVLA 3VQ9A 1U4BA 3C0BA 4MLEA 4PQUA 5JVHL 5AQVA 3PO4A 1K8AO 1BI4A 5MLCQ 3CJ1A 4CHOA 3O08A 3IRXA 4IJNA 3CC7N 4E89A 3KD1E 1VQ7N 3SBTA 4O5FA 2FF6A 4BRNA 1YI2N 2OZMA 4CJUA 4EIAA 4Z4GA 2YHYA 2UYTA 1EQYA 3HP6A 2CGKA 4CGGA 1NOZA 4FWMA 3ATVA 1DTTA 4ZHRA 4QCLA 4J2EA 2F4VK 4YOXA 4LFAK 3AA5X 3AO3A 2HW3A 1GLJO 3I8DA 3L2WA 3H46O 1GLDG 1YTAA 5M1NA 2KLAA 3ZSOA 3V6DA 3J8AA 2E88A 3PLAA 3V4IA 1NOYA 3OYKA 2HVIA 1JLEA 3EZ5A 1S6PA 2JLEA 4DUZK 3K57A 2ZE2A 1ITGA 4W5QA 3OYJA 3CC4N 3SUNA 4CGIA 3EE9A 2QXLA 3TI0A 4LF9K 2WONA 4BR7A 4BR2A 4JRQA 4HTUA 3H1QA 3LDPA 4EZ6A 1D9DA 1QVFM 3VQ7A 4CZIA 4FWKA 3NHGA 2BUPA 3OS2A 1NK6A 3V81A 4LC9B 4JK8A 2ASPA 4FOEA 2CGJA 5KQ8A 2E1ZA 3VF4A 1BHLA 3BEXA 3DXMB 3D45A 4Z4CA 4GW6A 4A57A 5AQNA 3V9WA 4B8AB 5TKYA 3TAFA 4KB0A 3SYZA 3QFUA 1ZBHA 1HJOA 3U6FA 4OKJA 4CFCA 1VSKA 3IKMA 3J80O 1VRTA 4BR4A 3K5LA 3AVCA 4ISGA 3NH1A 1JLGA 1IG9A 3MX5A 1R59O 4H0XB 4AM6A 4BR9A 4E7LA 1WSJA 1VQNN 4LF6K 1DGKN 4JKHA 2NRTA 4FWPA 4W5OA 1HYZA 2P9IA 5FPNA 1VQ4N 3HOTA 4KI6A 3D0PA 1A5WA 5FPEA 4JI0K 1JLCA 3CJCA 3U9DA 4BRAA 1NK4A 4F3OA 3MXIA 4ELTA 1XC9A 1IKWA 1C1BA 1C0GA 1FKPA 2EX3A 2JGUA 2GX9A 5M1OA 4JRPA 4ILGB 3H6EA 1W2BM 3SPYA 3NBPA 3VEVA 4X65K 1BO5O 2X6SA 4HUGA 4JI2K 2XY8A 3O9QA 4ID1A 2GEMA 4PY5A 2P9LB 4BRDA 4JKFA 1YTUA 4PKHA 4DTJA 3WNHA 5BRFA 4A5AA 1KFDA 4IG3A 2P9PB 4BROA 3LP3A 1HKCA 3CQYA 3LZJA 4Q0BA 4JKDA 4JN4A 1KVAA 3ZSZA 4E1JA 3M8SA 3BGRA 4IKFA 4ICLA 1NU0A 5JS2A 2KFZA 4O44A 4CVNE 2Z1JA 1YJWN 4AHTA 2OZSA 3IS9A 3NGZA 4JKCA 2E6MA 2GUPA 5CHIA 3N4QA 3LP2A 4FWNA 4JAXA 4FM0A 1VHXA 3EKSA 3ZT1A 4DTOA 4LD0A 4MDAA 5AQYA 4FYDA 2O8CB 4PUOA 4CJEA 3E01A 2QI2A 4E7HA 1EX4A 1BU6O 1NGCA 3CM5A 3WXKA 2W6LA 3L0QA 4H5WA 3VPZA 3RVCA 3FFIA 3QICA 3KZBA 4BWJA 3HSTB 1SS6A 5FDLA 1RTIA 1TL1A 4FWRA 3I56N 4FWSA 3SAFA 2E5LK 3ISNC 5EVZA 4B3SK 2R7YA 1HR0K 1NK5A 4RTFD 2HF3A 2QA4N 3MEEA 1HNXK 3THXB 3ZETA 2RKIA 4FZYA 3QBXA 1L3TA 5AR0A 4CJPA 3NCIA 3KD5E 3EZWA 4IXCA 4CJVA 4Z0UA 3HT3A 2DPNA 3OYGA 2GELA 3KWIA 5AJ3K 3KK2A 5KRTA 3RWUA 4KKOA 4NCGA 3RR8A 1RBSA 4CJTA 1GOCA 5GAGP 4FLXA 1ZYQA 4NCBA 2ZM6K 1IKYA 3VA0A 4B9SA 2EWSA 5AQFA 5EXWA 3SK3A 3WQUA 3VQDA 3N4PA 4YOWA 1HUXA 3AV9A 3SUOA 2QKBA 2Z1GA 3AY9A 4FXDA 4IEIA 4GVMA 3L2VA 2XRIA 2VQEK 2O8DA 3DLRA 1BL3A 5SZTA 4FLZA 2D0BA 3P38A 3MXJA 3V9ZA 1VQ9N 3D2EA 3CJBA 4M41A 3FZKA 2P9KB 4JD2A 1XC3A 2NUBA 1NJYA 2ZGYA 3VQPA 3VQQA 4NO7A 3MCPA 1TYQA 1VSJA 1YT3A 1IV0A 4U67L 4WFNL 2YHWA 3FFKB 3SNNA 2XHBA 2GBZA 1NGFA 3H1VX 4CIFA 3CCRN 2D5RA 4JI8K 3K59A 2FLOA 4CJ4A 2F9TA 4OGEA 4OX9K 2B6AA 2YHBA 3O8MA 2PYLA 4CJRA 3G6EN 3MMVA 5AQSA 5AQQA 4IDHA 5EX5A 4JK9A 3O3GA 3L8BA 3AVJA 2E2PA 4BY9C 3UKRB 4GNIA 5KI6A 3L2UA 2KKZA 4BC4A 5FPDA 5J2PA 3SPZA 3D6RA 3NF6A 4H0VB 3ZYYX 1WN7A 5GINA 3L4IA 3CCJN 1G99A 4B9TA 3BZKA 3CI5A 3MEDA 2O4GA 4YORA 1LWCA 4CESA 1E4GT 3JXUA 4CGJA 1A5VA 3PV8A 4FZXC 4I2QA 3C95A 4DU1A 4E0DA 3CG7A 2YNFA 4U7BA 1MU2A 4E7KA 1I39A 1RDBA 4A5BA 1XNQK 4JHDA 4CJWA 2P5GA 4JKBA 1XHZA 3Q7BA 3HM8A 3OYBA 1OH7A 4F9OA 4RCHA 3MK6A 4IJAA 4FSVA 5GAHP 3RR7A 3QINA 4ZTFA 5CE3A 2Q0RA 3K9KA 2UXCK 3GBTA 4B1WB 1CZ9A 2ITGA 1TK0A 3QDKA 3RMCA 2KZMA 4KBOA 1VSDA 2HHHK 2QK9A 5CYMA 3TAGA 4L8RB 1YJNN 3HL8A 1J5EK 4BE0A 4XEIA 1D9FA 2J4RA 2YHXA 1NK9A 2OCEA 4YDUA 3ENBA 3AA4A 3MN9A 1JKHA 1KCFA 4ID5A 4H8KA 2PAVA 3MAQA 3QBWA 2P9UA 3AVKA 1IBKK 1WSFA 4CHNA 4MLHA 4CK2A 3HSCA 4B1VA 4DTUA 4FM2A 3A2FA 1CXUA 2BTFA 4B9LA 4LF7K 4DSEA 1VSEA 3LWMA 4FJJA 3LP0A 4CJLA 3TABA 4BWMA 1JL2A 4A2AA 4E7IA 4M3TA 5AQPA 4FLUA 4X64K 3SQ2A 5LMNK 4F2RA 3KLHA 3HRGA 2ZWHA 5BPNA 1N6QA 4EFHA 1NKEA 3BZCA 4LF4K 2HBKA 3CFRA 3M6GA 4YOYA 3W3DA 3ZEUA 1Z25A 4N56A 1Q9YA 3OYDA 4F4KA 1TK5A 4DU4A 1SL1A 4BC2A 3DRRA 3PSIA 3THWA 3QIOA 1C0MA 2O8EA 2LSNA 5AZIA 1NMNA 1X3NA 4DLEA 4CEOA 3RMBA 3ATUA 2P9IB 4JEPA 3VENA 5KTQA 1J5OA 2F9WA 3ZLJA 3SZ2A 1JLQA 4CK3A 4DS5A 2X6NA 3C7NA 5C15A 1DTQA 3SV3A 3PIPL 4H0TB 4BDZA 1Q18A 4K8XA 1VQ5N 4IFEA 3M5RA 4H4MA 4CJKA 3GOIA 3K5OA 4HCCA 3HVTA 3CCUN 4FK4A 3VQEA 1FXXA 4BRHA 4FJNA 2ETJA 3RSEA 3V1OA 5HROA 1S1WA 3VETA 3B8AX 4FLYA 4TSXA 4BRIA 3WT0A 3C94A 3QLHA 4EP4A 1RBUA 3EE8A 5BREA 2RF2A 1S1VA 2O8FA 1J9AA 2HHQA 5LMUK 1RDWX 1K8KB 1TV6A 3MN7A 3QEIA 1ASWA 3MWPA 4QS8A 1ZC6A 1IH7A 5J2NA 3KLEA 1TK8A 4MQ3A 1WAFA 1BUPA 3R3LA 2X74A 4WQ5C 4CW7B 2DY4A 5KQDA 5C42A 5AQJA 4FL9A 4CZLA 3WNFA 2OA8A 1WNSA 3LP1A 1A5XA 4NCAA 1QS4A 4R5PA 1P8ZA 3C6HA 3K0SA 1U2VA 1MWMA 5AQMA 4CE9A 3P5JA 1EO1A 1U45A 2Y1IA 1VRUA 3I0RA 2HHTA 1ZBUA 3R1XA 3THYA 3MECA 1BGXT 5M1FA 3C65A 2I7NA 4Q5VA 1JXEA 1U47A 4BR0A 4W5NA 2ATQA 2ITMA 4H5VA 3O5BA 3P4IA 1JCFA 2YNIA 3T1YK 1EKEA 3UKUB 3TANA 2G8VA 4JK7A 3OJUA 3T3FA 3DRPA 3SQ0A 4K43A 3CMEN 5FPMA 3LAKA 4KTQA 4HUFA 3F5TA 1VK0A 4M3RA 4CJ3A 1S6QA 2Q1NA 4HUEA 2FBTA 5HRPA 4AM7A 3WEEA 4DSIA 1NGEA 3MCAB 3VTIA 2PY5A 1NGDA 4CEZA 3AVGA 2RPIA 1TKTA 3AA3A 4M42A 2HBLA 2ZJQL 3O1BA 4DFJA 4C23A 5C25A 4MDBA 5EOYA 4B1UB 3NF9A 3TSUA 4BRQA 3JAMO 1RT4A 3ENOA 1QZ6A 1H1VA 4A61A 4OLBA 1IG8A 1QQOA 2BANA 4Y0WA 1YAGA 1RT3A 3I0SA 1RBVA 4YY3K 1S22A 4X62K 3AAPA 4LSNA 2HOEA 4ISEA 3CCQN 4OO1J 3FZLA 2YJEA 4CEDA 2QWRA 4GV6A 2YHAA 2QXFA 2GTDA 2VG5A 3M8QA 1NKCA 4CEQA 4CF2A 1XMOK 1N34K 1RILA 3L4QA 5JVGL 2Q2RA 1VAZA 1JLFA 3M8PA 3NFAA 4C8KA 4ZTJA 1T44A 2A6AA 4CEBA 3A5LC 1JL1A 4FVUA 2B5JA 5AQWA 4F8RA 5HBMA 4CZEA 2O8DB 3LDQA 3V9UA 4OLAA 2QWMA 4FLTA 4XH5A 3NH0A 3D2EB 4DTPA 5FRNA 4YNQA 1X9WA 3LPTA 2A1SA 4JD2B 5KGXA 4DR4K 1YIJN 1QSSA 3CQ8A 4OKKA 1D5AA 3T7ZA 4X66K 1TYQB 1M1KO 4FW1A 3S3NA 1BOTO 2XY5A 2VQFK 2Q36A 5GIOA 5DM7L 3OYCA 3C6AA 1C0TA 3ZSQA 1MWKA 1F21A 4IFVA 1K6YA 2VCPA 3CERA 1NJIO 3IAYA 3LM9A 1RDCA 3VQBA 4FK0A 1OVQA 4O55A 3JS6A 3OYAA 3ASMA 3CCVN 3AVBA 4NLBA 2IAJA 3ULEA 2E4LA 3RRGA 4CGFA 1SV5A 5HOOA 3THVA 1C6VA 1IKXA 3WQTA 4CJQA 4OPKA 1ESVA 4BREA 4EZ9A 4WE1A 2QKKA 2HF4A 3DM2A 3BF1A 2B4JA 4FCYA 2E1YA 2RN2A 5K14A 3HOSA 1GOBA 1LAVA 2IVPA 1NJZA 2E20A 3ZT3A 2IDOA 1RNHA 1RGIA 3CHWA 5CR4A 3QNOA 3RRHA 4G9ZA 3WXLA 4DB3A 4JNEA 5LL6Z 4B1ZA 4RW7A 3BDPA 1OH5A 5J2QA 1X9MA 3VQAA 4KFBA 4XH4A 4YOUA 3G10A 3I33A 3LDNA 5LY3A 4JHDB 1OH8A 3LANA 3DJCA 1E4FT 1HLUA 4H5NA 4C1NK 1VQLN 4CFBA 4B9UA 3MN5A 2HBJA 3AA2A 4Z94A 1ATNA 5F0XA 4WQ4C 3VEXA 2ZF5O 4BDYA 3FGUA 4FPBA 3OW2M 3ZX0A 2O8BA 1QHAA 1XUPO 1IBLK 4CBXA 1J6ZA 4O8KA 3R9PA 3LPUA 4NLCA 1LAWA 4KHYA 3O9UA 1M90O 1SKWA 4DV1K 3OBWA 4RW4A 3VEYA 1HNZK 2WTUA 1S1UA 3L2QA 1G15A 5J2MA 4DUYK 3IUCA 3OHRA 1KXPA 5I42A 5AQOA 5AQRA 1S1TA 2EHGA 4JI5K 4KHNA 4ELUA 3ZSWA 4IOAL 2YKMA 2BE2A 2YJFA 4Z4IA 3PY8A 4CIEA 4K0KK 4F2SA 2H3GX 3DRSA 3VQ5A 1B92A 3PIOL 1BQMA 1WAJA 5I3UA 3F73A 5BN9A 4LF8K 4J2AA 4M3UA 2KFNA 2Q3SA 2JWLA 3OA9A 4BRFA 3CPEA 4B8CA 2PYJA 3OJSA 1DLOA 3H08A 2QWQA 1XI1A 4HWIA 5AQZA 3O4NA 1K73O 1P90A 1SL2A 3P31A 3R6MA 4WQ5A 1J53A 4IG0A 3ZEUB 3AO2A 3ITHA 2OPQA 4B1XB 1RTJA 1SKRA 1QTMA 5BRHA 3THWB 4B3RK 1YVNA 1NGAA 2O8EB 1ILYA 1HX1A 3HXMA 3SQ1A 4W5TA 1HNWK 1BG3A 4H5RA 5AQHA 3T69A 4EP5A 3NDKA 4DU3A 2ZD1A 3U3YA 4ILJA 4DQSA 4KHWA 1Q82O 2HHUA 1NK8A 1GOAA 3CJ9A 2V51B 3HZ6A 3CMAN 3MDQA 1KRPA 3OYFA 3CFOA 4CHQA 3KKSA 2NZTA 4YOTA 2XY6A 3UB5A 5AQUA 4F3TA 5HRRA 5M1KA 3KK1A 4DFMA 4KH5A 1IBMK 3TSQA 3VTHA 5CY4A 4AHVA 2E2QA 3EL2A 4H03B 1SKSA 2Y1JA 1BIZA 3LDSA 5IWAK 1WBDA 1I94K 4FJHA 4H0YB 3LZIA 4LSLA 4YHHK 1N32K 3NGYA 2WC9A 4DR2K 4HHTA 3TAPA 3CF5L 1YXQA 3NVMA 4C8NA 3OTOK 3AVAA 1KQSM 5BR8K 4CJFA 4JKAA 4UY8O 3O3FA 1BISA 3H3OB 5JS1A 2WUSA 3GE1A 1HNIA 5CZ2A 2FSJA 2P9NA 2O4IA 1VQPN 2WBNA 4CCHA 3E9PA 3R8EA 4RWTA 1Q7YO 4DQIA 3FZFA 4CF1A 3DMJA 1NGHA 4LH5A 3TAQA 3CCSN 1XHXA 4KHUA 4DQ8A 5C10A 4GKKK 2ZQBA 1V4SA 1RCHA 1SUQA 3HK2A 1B9FA 4CEFA 3QB0A 4BGBA 4MO4A 3ZX3A 1JCEA 2HSTA 1SL0A 3CM6A 4O8UA 1OKJA 4KHSA 1KLMA 3DI6A 3E9LA 3J7ZO 4JS4A 2F96A 3VERA 3LM2A 1NK7A 3CJAA 1O13A 1U6ZA 4M63C 3O4WA 1BI4B 4XIUA 2HMPA 2DFEA 3ZSVA 2QWPA 1WSEA 4AF1A 4KV8A 4IBNA 3TTFA 3P39A 3WEEB 1JJ2M 1ZBFA 3EKUA 3W0LA 3GDQA 4CD1A 2G8HA 3ALYA 3FLCO 1T3VA 4AILC 3VEWA 4DR3K 2QTDA 3NVKA 3P1GA 1QE1A 2IVOA 1WSHA 3U4LA 1Z6RA 5KRSA 4DFKA 2BDPA 4NYNA 1X3MA 2P9LA 1JCGA 4C8MA 3H45C 3OYLA 4M3YA 3T19A 3UIQA 3E66A 3IFRA 3WNGA 4DF4A 5A2QO 4IDKA 4CHYA 1VSLA 1NWKA 4EAHD 3KK7A 4WCEL 1RT1A 4DQRA 4FWOA 1UWBA 3J7YP 4Z4HA 1QSYA 3CIPA 4DTSA 4B3MK 4O4GA 1Y64A 4FVMA 3VQ6A 1NGJA 1XMQK 3U8XA 4QS9A 3O9TA 2QWNA 1FJGK 1J54A 3FE1A 3DXKA 3G0ZA 1LV5A 4Z4FA 4FJKA 4A59A 2VWKA 3HYFA 4H0PA 3NAEA 4DQQA 3WXMB 3V1QA 4E19A 1CXQA 4PKGA 3NF8A 1L5UA 1BWFO 3PX6A 3VQ4A 1GLBG 1RFQA 3VESA 4KHQA 3A5MC 3MWTA 2Q31A 4FLWA 2P51A 4PL8A 1LWFA 1WLJA 2ASOA 3OYMA 1I3AA 4FJIA 4IZ9A 4DR7K 4JI6K 1T6DA 3B6OA 4CHPA 3KLIA 3SI6A 3K9JA 3U9ZA 4WQ4A 3RMAA 2OPPA 3G25A 5CZ1A 4DMNA 2CGLA 4FPAA 2HHXA 3ZT2A 3KLFA 4IOXA 3DLKA 4CBUA 3VOVA 2XY7A 2F8TA 1S72N 4DKWA 5C24A 4RW9A 2YNGA 2F7TA 5ADXA 1N8RO 4KHPK 3F9MA 1Q9XA 4I6MA 1Q86O 2D0PA 3G71N 3ZSRA 3SMSA 3GL1A 4HCBA 2P9SA 1VSIA 2AA4A 2QEXN 3SJHA 2D1KA 1Q81O 1BA0A 4KTWA 1CLQA 3NH2A 2I5JA 3HM9A 4BRKA 1NGIA 1C0FA 1DT9A 4V19S 5HP1A 4JYAK 1KVCA 2QM1A 4FJ8A 5H1SQ 4DLGA 3DYAA 3V1RA 1T8EA 1T05A 1NK0A 3ID8A 2G8UA 1KC8O 5AQXA 3NF7A 3QERA 3QNNA 1IO2A 4O5BA 3HPOA 2UU9K 2VG7A 3O1WA 1S1XA 3VF2A 1YF5L 4DSKA 5C2DA 4FJXA 1UAXA 3IG1A 5BRDA 4IWVA 2AP1A 2VYPA 5C2FA 1TUUA 4DTNA 3E1YA 4CZMA 1NKBA 1YITN 4Y1DA 2O8BB 4ILHA 4NXMK 1S9EA 3ZSYA 4BQZA 2ZGZA 5AFUH 4JKGA 3AVNA 3OY9A 1X1PA 4B9VA 5F2RA 4I9QA 1NLVA 1HKBA 3AVFA 3AGKA 5HL7L 2IIRA 1T6CA 2QWOA 2X78A 2NLXA 2VG6A 3VEOA 4FJ7A 3PO5A 4PWDA 2PBDA 4OPJA 3A8YA 4BVOA 4KI4A 4LFBK 3F9KA 3SAHA 4FJMA 2UXDK 4M7YA 1QQMA 1UOCA 1IJJA 5BPMA 1X9JA 1GLLO 4DSLA 1NMDA 3D2FA 3DAWA 1MDUB 2KHOA 4DR1K 1XWLA 1QVGM 1U49A 5ADXH 2V7ZA 3CD6N 3ENHA 2G8KA 3NMUA 3C6TA 1NNEA 1KD1O 3LL3A 2A40A 3SCXA 3VGKA 2G8WA 3OYHA 3BUZB 1LW0A 3HVRA 3OYIA 3AARA 1VQ8N 1OH6A 1WB9A 1Q8IA 3VEZA 2IC3A 1EETA 5AQLA 4FO0A 3ZETB 3L2RA 3TAEA 4DV4K 2E8AA 1JLBA 4CZKA 3AO4A 2NNWA 4CERA 1NJWA 1KVBA 4CGHA 2QW9A 1HMVA 5HRSA 4BRMA 3WNEA 5JLFA 2NRWA 3K5NA 4K42A 4WFBL 1BIUA 3DLLL 5KPTA 3NE6A 4CK1A 3C6UA 1B9DA 1BDGA 1K9MO 3SLCA 4GV3A 3KKRA 1LWEA 4QOZB 4DSFA 4JV5K 1NBWA 4DS4A 4FJGA 3O9RA 3M8RA 4DHYA 2YX6A 3WXJA 3S9HA 3KK3A 5KPZA 4FOIA 4MFBA 3U3GA 1WUAA 3BY5A 2HMIA 1L3VA 2YNHA 3LAMA 4KH4A 5IT9O 3TPQA 2BGGA 1C1AA 4N76A 3S41A 3QETA 4IFYA 1UA0A 2W42A 2GWKA 2FBYA 1FKOA 1TL3A 2NRZA 2OPRA 4CEEA 5KPRA 3VF6A 5FRMA 1Z26A 1NGBA 4CECA 4BE2A 1BCOA 2DFFA 3GG4A 1NG9A 1ZBIA 5B8HA 3CCLN 1TAQA 3MX2A 4OPHA 4HTLA 4YFUA 4DV2K 2G8FA 2OYQA 4CZHA 3OS0A 4DCHA 1C0UA 4JKEA 3ZT4A 5AQTA 2P9NB 3S3MA 3K58A 3CC2N 2ZJPL 1KSPA 1DKGD 1BCMA 4CZGA 2OANA 3QEVA 4K25A 1REVA 2NRRA 4CJ5A 4WF9L 3CPWM 4WFAL 4BE1A 5HLFA 5C0YA 2KTQA 3FR0A 2FBXA 4R79A 1LOTB 1ZBSA 4EHTA 4YDUC 3VGMA 3AO1A 4ISFA 1YJ9N 4I7FA 1E3MA 2VGMA 3G4SN 3AO5A 3ZCMA 4BRCA 3ZX2A 2KZZA 1OVYA 1EWQA 5GAEP 3HO1A 3PX0A 2HHWA 3VGLA 4LFCK 3HJFA 4QAGA 4YOVA 2I7PA 4H5TA 5LJVA 1CZAN 3QIPA 5HRNA 1VSHA 4CD3A 2GV9A 3JYTA 4FM1A 4OJRA 4ELVA 1O1WA 4PHTX 3EEQA 3DLHA 3T1AA 1N5YA 1JXBA 4E7JA 4BRGA 4C8LA 3ULDA 1K8KA 2HNYA 4B08A 5FLXO 3OVNA 4HVJA 5BN8A 3DOKA 3O3HA 1KAYA 4E1NA 3WUHA 4BC5A 3KTQA 1XNRK 1RDDA 2W41A 2UUAK 4KTZA 3SUQA 3CFPA 3O9SA 2UUBK 5AZJA 2HNDA 2YKNA 5J1EA 4BG9A 4M3WA 5JLHA 1YVUA 4K8ZA 2FSKA 3DWLA 4KH6A 1TVRA 4JS5A 4FJ5A 1HQUA 2CH6A 3HP9A 2P9UB 2CH5A 5GADP 5LJWA 4LY7A 3MEGA 3I55N 2Z1HA 1KAXA 1TUYA 3L3VA 1Y97A 4DV7K 3CQXA 1FK9A 3OYNA 3SQ4A 1ZBLA 1S3XA 2UUCK 1NGGA 3KIOA 4IOCL 5M1PA 3O6WA 1X9SA 2G8IA 3DXKB 1KLNA 5AQIA 5E84A 3AVHA 3UKUA 4NB4A 3KWGA 3B6PA 3EYZA 4B9QA 3Q7CA 4CF8A 3CXCM 1N36K 5AQGA 5SWMA 4I2PA 4CZFA 3QEXA 4DSJA 2WFBA 3TWHA 1HQEA 4M7XA 3BP8A 4FWQA 4BGAA 3QMLA 3K2PA 4DG1A 1ASVA 1JLAA 1WBBA 5E26A 4FLVA 4B3TK 4XH1A 2GWJA 3SAGA 1RTDA 4WYBA 4KB1A 1BA1A 4PA1A 4PKIA 2YI1A 3OS1A 2VWJA 3F2KA 4KREA 5AZIB 1ASUA 1CZBA 2W6KA 1D4XA 1QQCA 4DF8A 1S9GA 2IGIA 3JSMA 2VGNA 4DV3K 3QEWA 2KW4A 3CYMA 3RTVA 1HJRA 3C7NB 3WXIA 3LALA 4DQPA 3BF3A 2AJQA 1SZ2A 4AHCA 4I6MB 3TAMA 4FZZA 2JWKA 2P9SB 1ATRA 4GKJK 4DTMA 3RSEB 4RW8A 3A5OC 2RHKA 3PUFA 4BC3A 4KRFA 3ZSXA 3LDOA 1EXQA 2O8FB 4B1YB 5T7BA 4CBWA 5DM6L 2BH1A 4AHRA 2E6LA 2FBVA 3V9SA 1QSLA 4Z4EA 4LH4A 3A0IX 3DXMA 4OGCA 4NYFA 4J2DA 2NRXA 3ZT0A 5CYQA 3UE5A 1W0HA 3SJJA 3FZHA 1TAUA 4BRLA 4BDPA 2HVHA 2ASMA 3QFPA 4B9MA 1BQNA 4J2BA 2ZJRL 2HNZA 3AVMA 3VA3A 2A5XA 3L3UA 1QQNA 1U2VB 5KGWA 2A1RA 3KJVA 1EWRA 3TTDA 4CJ7A 1YUWA 1KTQA 4FK2A 3HPGA 4CZJA 2D0OA 3AVLA 4L3QA 4BG8A 5JMVA 5E41A 4JKGB 2E2OA 3THYB 2D0CA 4GVEA 2GUIA 4B9NA 4CFAA 3AGRA 1NM1A 1LW2A 3PSFA 2W40A 2KQ2A 3RMDA 4DTRA 4JLHA 1KFSA 4EHUA 3HPHA 1HPZA 3H3NO 3ID6A 3E9OA 4FW2A 2OTLN 5TKWA 3SMPA 2FF3B 3EN9A 1GLEG
chains in the Genus database with same CATH topology
4DR5K 4JI8K 1N33K 4V19S 1IBLK 3J81O 4LF7K 4LF6K 4JYAK 2UXBK 4DV3K 4OX9K 4DV1K 1IBMK 1HNZK 5A2QO 4DUYK 4NXNK 4DV6K 4DR4K 4AQYK 2UU9K 5IWAK 1I94K 3J7YP 4JI0K 4JI5K 4YHHK 4X64K 4LF5K 4X66K 1N32K 5LMNK 4DR2K 5FLXO 4B3MK 4GKJK 2VQFK 3OTOK 2E5LK 4JV5K 1XMQK 4B3SK 4LF4K 5BR8K 3T1YK 1HR0K 1FJGK 4K0KK 2F4VK 1XNRK 4DR6K 4LFAK 2UUAK 1HNXK 4NXMK 4LF8K 2UUBK 5IT9O 4GKKK 5AJ3K 4DUZK 3J7AP 4X65K 4JI3K 1XNQK 4JI2K 4LF9K 2ZM6K 4DV7K 4LFBK 2UUCK 4JI4K 4DR7K 4JI6K 4DV2K 2UXDK 3JAMO 3T1HK 2UXCK 4B3RK 2VQEK 2HHHK 1HNWK 4YY3K 4DR1K 1N36K 1J5EK 5LL6Z 4X62K 5LMUK 4JI7K 4CVNE 4DV5K 4DV0K 4KHPK 4CW7B 1XMOK 1IBKK 4DR3K 1N34K 4B3TK 3J80O 4LFCK 4DV4K 4JI1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 K;  4JI8 K;  1N33 K;  4V19 S;  1IBL K;  3J81 O;  4LF7 K;  4LF6 K;  4JYA K;  2UXB K;  4DV3 K;  4OX9 K;  4DV1 K;  1IBM K;  1HNZ K;  5A2Q O;  4DUY K;  4NXN K;  4DV6 K;  4DR4 K;  4AQY K;  2UU9 K;  5IWA K;  1I94 K;  3J7Y P;  4JI0 K;  4JI5 K;  4YHH K;  4X64 K;  4LF5 K;  4X66 K;  1N32 K;  5LMN K;  4DR2 K;  5FLX O;  4B3M K;  4GKJ K;  2VQF K;  3OTO K;  2E5L K;  4JV5 K;  1XMQ K;  4B3S K;  4LF4 K;  5BR8 K;  3T1Y K;  1HR0 K;  1FJG K;  4K0K K;  2F4V K;  1XNR K;  4DR6 K;  4LFA K;  2UUA K;  1HNX K;  4NXM K;  4LF8 K;  2UUB K;  5IT9 O;  4GKK K;  5AJ3 K;  4DUZ K;  3J7A P;  4X65 K;  4JI3 K;  1XNQ K;  4JI2 K;  4LF9 K;  2ZM6 K;  4DV7 K;  4LFB K;  2UUC K;  4JI4 K;  4DR7 K;  4JI6 K;  4DV2 K;  2UXD K;  3JAM O;  3T1H K;  2UXC K;  4B3R K;  2VQE K;  2HHH K;  1HNW K;  4YY3 K;  4DR1 K;  1N36 K;  1J5E K;  5LL6 Z;  4X62 K;  5LMU K;  4JI7 K;  4CVN E;  4DV5 K;  4DV0 K;  4KHP K;  4CW7 B;  1XMO K;  1IBK K;  4DR3 K;  1N34 K;  4B3T K;  3J80 O;  4LFC K;  4DV4 K;  4JI1 K; 
#chains in the Genus database with same CATH topology
 1TKD A;  4DR5 K;  5D3G A;  3D2F B;  2A42 A;  1GLC G;  3J81 O;  4FJL A;  2UXB K;  3SV4 A;  3EY1 A;  2A3Z A;  2IS3 A;  4CI6 A;  4NXN K;  4DV6 K;  2HHS A;  2IOC A;  2Z1I A;  3VMF B;  4BRP A;  4CF0 A;  5ELZ A;  3MXM A;  4LF5 K;  2VWB A;  4OKE A;  3TTC A;  4AHU A;  4I9L A;  4DFP A;  3O4Q A;  3P83 D;  4N41 A;  1RDA A;  1VQ6 N;  2Q0U A;  2FXU A;  3TSP A;  4DR6 K;  2P9P A;  1WSI A;  4CF9 A;  3QEP A;  3QES A;  4H4O A;  4CEA A;  2OTJ N;  3A5N C;  3KLG A;  3S3O A;  1XQS C;  3PX4 A;  4KO0 A;  2V7Y A;  1LCU A;  4JI3 K;  5C12 A;  3VN5 A;  3SBG A;  4CGD A;  5I9E B;  4JI4 K;  4M3Z A;  1TGO A;  1U04 A;  3DOL A;  3DLB A;  3O80 A;  4C1N I;  3AAQ A;  3OYE A;  3HBT A;  1S5J A;  3DLG A;  2NRV A;  3CET A;  1FW6 A;  1GLA G;  3VQC A;  2O8C A;  5AFU A;  1L3S A;  3AVI A;  2FSN A;  1QZ5 A;  2YCH A;  4DWI A;  2DTU A;  2QWL A;  1RDU A;  3IMX A;  5BR9 A;  5JIC A;  3IDH A;  4A62 A;  1VQM N;  2E2N A;  2P5O A;  1HKG A;  5EY4 A;  5FRO A;  1TKX A;  3FZM A;  5F1X A;  2RE2 A;  1RBT A;  1W9H A;  2F8S A;  3LDL A;  1HYS A;  2PFU A;  1NJX A;  3CCE N;  4GMJ B;  1VSF A;  3CJ7 A;  4E1M A;  1WOQ A;  1DEJ A;  4IEE A;  4BQL A;  2PZS A;  4H0O A;  2P1J A;  4KPY A;  4O0J A;  5GIP A;  5DK5 A;  1KAZ A;  4FWL A;  1N33 K;  3THX A;  5EU7 A;  4O0I A;  3ULE B;  4UQG A;  5AQK A;  4CHZ A;  1HNV A;  1VQK N;  3L6Q A;  2V52 B;  4CJS A;  1ATS A;  3K5M A;  1Z05 A;  3HTV A;  1W97 L;  4N47 A;  4CFD A;  4AQY K;  1R0A A;  2OPS A;  1GLF O;  3VQ8 A;  3HI0 A;  1IKV A;  3MN6 A;  1RT2 A;  1RT7 A;  1RBR A;  4BR5 A;  2XO7 A;  4AH9 A;  4KAZ A;  1C1C A;  1SQK A;  3OBY A;  4GV9 A;  3M1F A;  3D7E O;  1TKZ A;  5BPL A;  3TU5 A;  2DFH A;  1SAZ A;  2Q97 A;  1HRH A;  3LWL A;  4W5R A;  3V9X A;  3NGI A;  2P9K A;  3J7A P;  2D0A A;  3TR8 A;  5M1Q A;  3DLE A;  1W7A A;  4OPA A;  4RG8 A;  1MA9 B;  3M3Z A;  1UA1 A;  1ZXO A;  4IO9 L;  4E3S A;  4MO5 A;  2HBM A;  3SUP A;  4AHS A;  1HYV A;  4A2B A;  1EP4 A;  1RT6 A;  4FJ9 A;  1T03 A;  2YV0 X;  3T1H K;  5DMR A;  4J8F A;  1VSM A;  2IVN A;  5AZJ B;  2NRH A;  2WOM A;  4BVP A;  3I8B A;  4C8O A;  4QS7 A;  4M3X A;  4JI7 K;  2HHV A;  4DTX A;  4BAC A;  1WSG A;  4DV5 K;  1V4T A;  1L3U A;  3EO3 A;  1YHQ N;  4DV0 K;  4IO8 A;  1D8Y A;  4N5S A;  1U48 A;  3UKR A;  2HB5 A;  3TAR A;  1QHT A;  1T7P A;  1HPM A;  4Y1C A;  2A41 A;  3CCM N;  4G1Q A;  4RW6 A;  1RT5 A;  3QO9 A;  4M45 A;  3KVG A;  2FC0 A;  4CIG A;  1VQO N;  4JI1 K;  4PL7 A;  2D4W A;  4B3O A;  4GY2 B;  3KHY A;  4K41 A;  1RTH A;  4OVL A;  3VQ9 A;  1U4B A;  3C0B A;  4MLE A;  4PQU A;  5JVH L;  5AQV A;  3PO4 A;  1K8A O;  1BI4 A;  5MLC Q;  3CJ1 A;  4CHO A;  3O08 A;  3IRX A;  4IJN A;  3CC7 N;  4E89 A;  3KD1 E;  1VQ7 N;  3SBT A;  4O5F A;  2FF6 A;  4BRN A;  1YI2 N;  2OZM A;  4CJU A;  4EIA A;  4Z4G A;  2YHY A;  2UYT A;  1EQY A;  3HP6 A;  2CGK A;  4CGG A;  1NOZ A;  4FWM A;  3ATV A;  1DTT A;  4ZHR A;  4QCL A;  4J2E A;  2F4V K;  4YOX A;  4LFA K;  3AA5 X;  3AO3 A;  2HW3 A;  1GLJ O;  3I8D A;  3L2W A;  3H46 O;  1GLD G;  1YTA A;  5M1N A;  2KLA A;  3ZSO A;  3V6D A;  3J8A A;  2E88 A;  3PLA A;  3V4I A;  1NOY A;  3OYK A;  2HVI A;  1JLE A;  3EZ5 A;  1S6P A;  2JLE A;  4DUZ K;  3K57 A;  2ZE2 A;  1ITG A;  4W5Q A;  3OYJ A;  3CC4 N;  3SUN A;  4CGI A;  3EE9 A;  2QXL A;  3TI0 A;  4LF9 K;  2WON A;  4BR7 A;  4BR2 A;  4JRQ A;  4HTU A;  3H1Q A;  3LDP A;  4EZ6 A;  1D9D A;  1QVF M;  3VQ7 A;  4CZI A;  4FWK A;  3NHG A;  2BUP A;  3OS2 A;  1NK6 A;  3V81 A;  4LC9 B;  4JK8 A;  2ASP A;  4FOE A;  2CGJ A;  5KQ8 A;  2E1Z A;  3VF4 A;  1BHL A;  3BEX A;  3DXM B;  3D45 A;  4Z4C A;  4GW6 A;  4A57 A;  5AQN A;  3V9W A;  4B8A B;  5TKY A;  3TAF A;  4KB0 A;  3SYZ A;  3QFU A;  1ZBH A;  1HJO A;  3U6F A;  4OKJ A;  4CFC A;  1VSK A;  3IKM A;  3J80 O;  1VRT A;  4BR4 A;  3K5L A;  3AVC A;  4ISG A;  3NH1 A;  1JLG A;  1IG9 A;  3MX5 A;  1R59 O;  4H0X B;  4AM6 A;  4BR9 A;  4E7L A;  1WSJ A;  1VQN N;  4LF6 K;  1DGK N;  4JKH A;  2NRT A;  4FWP A;  4W5O A;  1HYZ A;  2P9I A;  5FPN A;  1VQ4 N;  3HOT A;  4KI6 A;  3D0P A;  1A5W A;  5FPE A;  4JI0 K;  1JLC A;  3CJC A;  3U9D A;  4BRA A;  1NK4 A;  4F3O A;  3MXI A;  4ELT A;  1XC9 A;  1IKW A;  1C1B A;  1C0G A;  1FKP A;  2EX3 A;  2JGU A;  2GX9 A;  5M1O A;  4JRP A;  4ILG B;  3H6E A;  1W2B M;  3SPY A;  3NBP A;  3VEV A;  4X65 K;  1BO5 O;  2X6S A;  4HUG A;  4JI2 K;  2XY8 A;  3O9Q A;  4ID1 A;  2GEM A;  4PY5 A;  2P9L B;  4BRD A;  4JKF A;  1YTU A;  4PKH A;  4DTJ A;  3WNH A;  5BRF A;  4A5A A;  1KFD A;  4IG3 A;  2P9P B;  4BRO A;  3LP3 A;  1HKC A;  3CQY A;  3LZJ A;  4Q0B A;  4JKD A;  4JN4 A;  1KVA A;  3ZSZ A;  4E1J A;  3M8S A;  3BGR A;  4IKF A;  4ICL A;  1NU0 A;  5JS2 A;  2KFZ A;  4O44 A;  4CVN E;  2Z1J A;  1YJW N;  4AHT A;  2OZS A;  3IS9 A;  3NGZ A;  4JKC A;  2E6M A;  2GUP A;  5CHI A;  3N4Q A;  3LP2 A;  4FWN A;  4JAX A;  4FM0 A;  1VHX A;  3EKS A;  3ZT1 A;  4DTO A;  4LD0 A;  4MDA A;  5AQY A;  4FYD A;  2O8C B;  4PUO A;  4CJE A;  3E01 A;  2QI2 A;  4E7H A;  1EX4 A;  1BU6 O;  1NGC A;  3CM5 A;  3WXK A;  2W6L A;  3L0Q A;  4H5W A;  3VPZ A;  3RVC A;  3FFI A;  3QIC A;  3KZB A;  4BWJ A;  3HST B;  1SS6 A;  5FDL A;  1RTI A;  1TL1 A;  4FWR A;  3I56 N;  4FWS A;  3SAF A;  2E5L K;  3ISN C;  5EVZ A;  4B3S K;  2R7Y A;  1HR0 K;  1NK5 A;  4RTF D;  2HF3 A;  2QA4 N;  3MEE A;  1HNX K;  3THX B;  3ZET A;  2RKI A;  4FZY A;  3QBX A;  1L3T A;  5AR0 A;  4CJP A;  3NCI A;  3KD5 E;  3EZW A;  4IXC A;  4CJV A;  4Z0U A;  3HT3 A;  2DPN A;  3OYG A;  2GEL A;  3KWI A;  5AJ3 K;  3KK2 A;  5KRT A;  3RWU A;  4KKO A;  4NCG A;  3RR8 A;  1RBS A;  4CJT A;  1GOC A;  5GAG P;  4FLX A;  1ZYQ A;  4NCB A;  2ZM6 K;  1IKY A;  3VA0 A;  4B9S A;  2EWS A;  5AQF A;  5EXW A;  3SK3 A;  3WQU A;  3VQD A;  3N4P A;  4YOW A;  1HUX A;  3AV9 A;  3SUO A;  2QKB A;  2Z1G A;  3AY9 A;  4FXD A;  4IEI A;  4GVM A;  3L2V A;  2XRI A;  2VQE K;  2O8D A;  3DLR A;  1BL3 A;  5SZT A;  4FLZ A;  2D0B A;  3P38 A;  3MXJ A;  3V9Z A;  1VQ9 N;  3D2E A;  3CJB A;  4M41 A;  3FZK A;  2P9K B;  4JD2 A;  1XC3 A;  2NUB A;  1NJY A;  2ZGY A;  3VQP A;  3VQQ A;  4NO7 A;  3MCP A;  1TYQ A;  1VSJ A;  1YT3 A;  1IV0 A;  4U67 L;  4WFN L;  2YHW A;  3FFK B;  3SNN A;  2XHB A;  2GBZ A;  1NGF A;  3H1V X;  4CIF A;  3CCR N;  2D5R A;  4JI8 K;  3K59 A;  2FLO A;  4CJ4 A;  2F9T A;  4OGE A;  4OX9 K;  2B6A A;  2YHB A;  3O8M A;  2PYL A;  4CJR A;  3G6E N;  3MMV A;  5AQS A;  5AQQ A;  4IDH A;  5EX5 A;  4JK9 A;  3O3G A;  3L8B A;  3AVJ A;  2E2P A;  4BY9 C;  3UKR B;  4GNI A;  5KI6 A;  3L2U A;  2KKZ A;  4BC4 A;  5FPD A;  5J2P A;  3SPZ A;  3D6R A;  3NF6 A;  4H0V B;  3ZYY X;  1WN7 A;  5GIN A;  3L4I A;  3CCJ N;  1G99 A;  4B9T A;  3BZK A;  3CI5 A;  3MED A;  2O4G A;  4YOR A;  1LWC A;  4CES A;  1E4G T;  3JXU A;  4CGJ A;  1A5V A;  3PV8 A;  4FZX C;  4I2Q A;  3C95 A;  4DU1 A;  4E0D A;  3CG7 A;  2YNF A;  4U7B A;  1MU2 A;  4E7K A;  1I39 A;  1RDB A;  4A5B A;  1XNQ K;  4JHD A;  4CJW A;  2P5G A;  4JKB A;  1XHZ A;  3Q7B A;  3HM8 A;  3OYB A;  1OH7 A;  4F9O A;  4RCH A;  3MK6 A;  4IJA A;  4FSV A;  5GAH P;  3RR7 A;  3QIN A;  4ZTF A;  5CE3 A;  2Q0R A;  3K9K A;  2UXC K;  3GBT A;  4B1W B;  1CZ9 A;  2ITG A;  1TK0 A;  3QDK A;  3RMC A;  2KZM A;  4KBO A;  1VSD A;  2HHH K;  2QK9 A;  5CYM A;  3TAG A;  4L8R B;  1YJN N;  3HL8 A;  1J5E K;  4BE0 A;  4XEI A;  1D9F A;  2J4R A;  2YHX A;  1NK9 A;  2OCE A;  4YDU A;  3ENB A;  3AA4 A;  3MN9 A;  1JKH A;  1KCF A;  4ID5 A;  4H8K A;  2PAV A;  3MAQ A;  3QBW A;  2P9U A;  3AVK A;  1IBK K;  1WSF A;  4CHN A;  4MLH A;  4CK2 A;  3HSC A;  4B1V A;  4DTU A;  4FM2 A;  3A2F A;  1CXU A;  2BTF A;  4B9L A;  4LF7 K;  4DSE A;  1VSE A;  3LWM A;  4FJJ A;  3LP0 A;  4CJL A;  3TAB A;  4BWM A;  1JL2 A;  4A2A A;  4E7I A;  4M3T A;  5AQP A;  4FLU A;  4X64 K;  3SQ2 A;  5LMN K;  4F2R A;  3KLH A;  3HRG A;  2ZWH A;  5BPN A;  1N6Q A;  4EFH A;  1NKE A;  3BZC A;  4LF4 K;  2HBK A;  3CFR A;  3M6G A;  4YOY A;  3W3D A;  3ZEU A;  1Z25 A;  4N56 A;  1Q9Y A;  3OYD A;  4F4K A;  1TK5 A;  4DU4 A;  1SL1 A;  4BC2 A;  3DRR A;  3PSI A;  3THW A;  3QIO A;  1C0M A;  2O8E A;  2LSN A;  5AZI A;  1NMN A;  1X3N A;  4DLE A;  4CEO A;  3RMB A;  3ATU A;  2P9I B;  4JEP A;  3VEN A;  5KTQ A;  1J5O A;  2F9W A;  3ZLJ A;  3SZ2 A;  1JLQ A;  4CK3 A;  4DS5 A;  2X6N A;  3C7N A;  5C15 A;  1DTQ A;  3SV3 A;  3PIP L;  4H0T B;  4BDZ A;  1Q18 A;  4K8X A;  1VQ5 N;  4IFE A;  3M5R A;  4H4M A;  4CJK A;  3GOI A;  3K5O A;  4HCC A;  3HVT A;  3CCU N;  4FK4 A;  3VQE A;  1FXX A;  4BRH A;  4FJN A;  2ETJ A;  3RSE A;  3V1O A;  5HRO A;  1S1W A;  3VET A;  3B8A X;  4FLY A;  4TSX A;  4BRI A;  3WT0 A;  3C94 A;  3QLH A;  4EP4 A;  1RBU A;  3EE8 A;  5BRE A;  2RF2 A;  1S1V A;  2O8F A;  1J9A A;  2HHQ A;  5LMU K;  1RDW X;  1K8K B;  1TV6 A;  3MN7 A;  3QEI A;  1ASW A;  3MWP A;  4QS8 A;  1ZC6 A;  1IH7 A;  5J2N A;  3KLE A;  1TK8 A;  4MQ3 A;  1WAF A;  1BUP A;  3R3L A;  2X74 A;  4WQ5 C;  4CW7 B;  2DY4 A;  5KQD A;  5C42 A;  5AQJ A;  4FL9 A;  4CZL A;  3WNF A;  2OA8 A;  1WNS A;  3LP1 A;  1A5X A;  4NCA A;  1QS4 A;  4R5P A;  1P8Z A;  3C6H A;  3K0S A;  1U2V A;  1MWM A;  5AQM A;  4CE9 A;  3P5J A;  1EO1 A;  1U45 A;  2Y1I A;  1VRU A;  3I0R A;  2HHT A;  1ZBU A;  3R1X A;  3THY A;  3MEC A;  1BGX T;  5M1F A;  3C65 A;  2I7N A;  4Q5V A;  1JXE A;  1U47 A;  4BR0 A;  4W5N A;  2ATQ A;  2ITM A;  4H5V A;  3O5B A;  3P4I A;  1JCF A;  2YNI A;  3T1Y K;  1EKE A;  3UKU B;  3TAN A;  2G8V A;  4JK7 A;  3OJU A;  3T3F A;  3DRP A;  3SQ0 A;  4K43 A;  3CME N;  5FPM A;  3LAK A;  4KTQ A;  4HUF A;  3F5T A;  1VK0 A;  4M3R A;  4CJ3 A;  1S6Q A;  2Q1N A;  4HUE A;  2FBT A;  5HRP A;  4AM7 A;  3WEE A;  4DSI A;  1NGE A;  3MCA B;  3VTI A;  2PY5 A;  1NGD A;  4CEZ A;  3AVG A;  2RPI A;  1TKT A;  3AA3 A;  4M42 A;  2HBL A;  2ZJQ L;  3O1B A;  4DFJ A;  4C23 A;  5C25 A;  4MDB A;  5EOY A;  4B1U B;  3NF9 A;  3TSU A;  4BRQ A;  3JAM O;  1RT4 A;  3ENO A;  1QZ6 A;  1H1V A;  4A61 A;  4OLB A;  1IG8 A;  1QQO A;  2BAN A;  4Y0W A;  1YAG A;  1RT3 A;  3I0S A;  1RBV A;  4YY3 K;  1S22 A;  4X62 K;  3AAP A;  4LSN A;  2HOE A;  4ISE A;  3CCQ N;  4OO1 J;  3FZL A;  2YJE A;  4CED A;  2QWR A;  4GV6 A;  2YHA A;  2QXF A;  2GTD A;  2VG5 A;  3M8Q A;  1NKC A;  4CEQ A;  4CF2 A;  1XMO K;  1N34 K;  1RIL A;  3L4Q A;  5JVG L;  2Q2R A;  1VAZ A;  1JLF A;  3M8P A;  3NFA A;  4C8K A;  4ZTJ A;  1T44 A;  2A6A A;  4CEB A;  3A5L C;  1JL1 A;  4FVU A;  2B5J A;  5AQW A;  4F8R A;  5HBM A;  4CZE A;  2O8D B;  3LDQ A;  3V9U A;  4OLA A;  2QWM A;  4FLT A;  4XH5 A;  3NH0 A;  3D2E B;  4DTP A;  5FRN A;  4YNQ A;  1X9W A;  3LPT A;  2A1S A;  4JD2 B;  5KGX A;  4DR4 K;  1YIJ N;  1QSS A;  3CQ8 A;  4OKK A;  1D5A A;  3T7Z A;  4X66 K;  1TYQ B;  1M1K O;  4FW1 A;  3S3N A;  1BOT O;  2XY5 A;  2VQF K;  2Q36 A;  5GIO A;  5DM7 L;  3OYC A;  3C6A A;  1C0T A;  3ZSQ A;  1MWK A;  1F21 A;  4IFV A;  1K6Y A;  2VCP A;  3CER A;  1NJI O;  3IAY A;  3LM9 A;  1RDC A;  3VQB A;  4FK0 A;  1OVQ A;  4O55 A;  3JS6 A;  3OYA A;  3ASM A;  3CCV N;  3AVB A;  4NLB A;  2IAJ A;  3ULE A;  2E4L A;  3RRG A;  4CGF A;  1SV5 A;  5HOO A;  3THV A;  1C6V A;  1IKX A;  3WQT A;  4CJQ A;  4OPK A;  1ESV A;  4BRE A;  4EZ9 A;  4WE1 A;  2QKK A;  2HF4 A;  3DM2 A;  3BF1 A;  2B4J A;  4FCY A;  2E1Y A;  2RN2 A;  5K14 A;  3HOS A;  1GOB A;  1LAV A;  2IVP A;  1NJZ A;  2E20 A;  3ZT3 A;  2IDO A;  1RNH A;  1RGI A;  3CHW A;  5CR4 A;  3QNO A;  3RRH A;  4G9Z A;  3WXL A;  4DB3 A;  4JNE A;  5LL6 Z;  4B1Z A;  4RW7 A;  3BDP A;  1OH5 A;  5J2Q A;  1X9M A;  3VQA A;  4KFB A;  4XH4 A;  4YOU A;  3G10 A;  3I33 A;  3LDN A;  5LY3 A;  4JHD B;  1OH8 A;  3LAN A;  3DJC A;  1E4F T;  1HLU A;  4H5N A;  4C1N K;  1VQL N;  4CFB A;  4B9U A;  3MN5 A;  2HBJ A;  3AA2 A;  4Z94 A;  1ATN A;  5F0X A;  4WQ4 C;  3VEX A;  2ZF5 O;  4BDY A;  3FGU A;  4FPB A;  3OW2 M;  3ZX0 A;  2O8B A;  1QHA A;  1XUP O;  1IBL K;  4CBX A;  1J6Z A;  4O8K A;  3R9P A;  3LPU A;  4NLC A;  1LAW A;  4KHY A;  3O9U A;  1M90 O;  1SKW A;  4DV1 K;  3OBW A;  4RW4 A;  3VEY A;  1HNZ K;  2WTU A;  1S1U A;  3L2Q A;  1G15 A;  5J2M A;  4DUY K;  3IUC A;  3OHR A;  1KXP A;  5I42 A;  5AQO A;  5AQR A;  1S1T A;  2EHG A;  4JI5 K;  4KHN A;  4ELU A;  3ZSW A;  4IOA L;  2YKM A;  2BE2 A;  2YJF A;  4Z4I A;  3PY8 A;  4CIE A;  4K0K K;  4F2S A;  2H3G X;  3DRS A;  3VQ5 A;  1B92 A;  3PIO L;  1BQM A;  1WAJ A;  5I3U A;  3F73 A;  5BN9 A;  4LF8 K;  4J2A A;  4M3U A;  2KFN A;  2Q3S A;  2JWL A;  3OA9 A;  4BRF A;  3CPE A;  4B8C A;  2PYJ A;  3OJS A;  1DLO A;  3H08 A;  2QWQ A;  1XI1 A;  4HWI A;  5AQZ A;  3O4N A;  1K73 O;  1P90 A;  1SL2 A;  3P31 A;  3R6M A;  4WQ5 A;  1J53 A;  4IG0 A;  3ZEU B;  3AO2 A;  3ITH A;  2OPQ A;  4B1X B;  1RTJ A;  1SKR A;  1QTM A;  5BRH A;  3THW B;  4B3R K;  1YVN A;  1NGA A;  2O8E B;  1ILY A;  1HX1 A;  3HXM A;  3SQ1 A;  4W5T A;  1HNW K;  1BG3 A;  4H5R A;  5AQH A;  3T69 A;  4EP5 A;  3NDK A;  4DU3 A;  2ZD1 A;  3U3Y A;  4ILJ A;  4DQS A;  4KHW A;  1Q82 O;  2HHU A;  1NK8 A;  1GOA A;  3CJ9 A;  2V51 B;  3HZ6 A;  3CMA N;  3MDQ A;  1KRP A;  3OYF A;  3CFO A;  4CHQ A;  3KKS A;  2NZT A;  4YOT A;  2XY6 A;  3UB5 A;  5AQU A;  4F3T A;  5HRR A;  5M1K A;  3KK1 A;  4DFM A;  4KH5 A;  1IBM K;  3TSQ A;  3VTH A;  5CY4 A;  4AHV A;  2E2Q A;  3EL2 A;  4H03 B;  1SKS A;  2Y1J A;  1BIZ A;  3LDS A;  5IWA K;  1WBD A;  1I94 K;  4FJH A;  4H0Y B;  3LZI A;  4LSL A;  4YHH K;  1N32 K;  3NGY A;  2WC9 A;  4DR2 K;  4HHT A;  3TAP A;  3CF5 L;  1YXQ A;  3NVM A;  4C8N A;  3OTO K;  3AVA A;  1KQS M;  5BR8 K;  4CJF A;  4JKA A;  4UY8 O;  3O3F A;  1BIS A;  3H3O B;  5JS1 A;  2WUS A;  3GE1 A;  1HNI A;  5CZ2 A;  2FSJ A;  2P9N A;  2O4I A;  1VQP N;  2WBN A;  4CCH A;  3E9P A;  3R8E A;  4RWT A;  1Q7Y O;  4DQI A;  3FZF A;  4CF1 A;  3DMJ A;  1NGH A;  4LH5 A;  3TAQ A;  3CCS N;  1XHX A;  4KHU A;  4DQ8 A;  5C10 A;  4GKK K;  2ZQB A;  1V4S A;  1RCH A;  1SUQ A;  3HK2 A;  1B9F A;  4CEF A;  3QB0 A;  4BGB A;  4MO4 A;  3ZX3 A;  1JCE A;  2HST A;  1SL0 A;  3CM6 A;  4O8U A;  1OKJ A;  4KHS A;  1KLM A;  3DI6 A;  3E9L A;  3J7Z O;  4JS4 A;  2F96 A;  3VER A;  3LM2 A;  1NK7 A;  3CJA A;  1O13 A;  1U6Z A;  4M63 C;  3O4W A;  1BI4 B;  4XIU A;  2HMP A;  2DFE A;  3ZSV A;  2QWP A;  1WSE A;  4AF1 A;  4KV8 A;  4IBN A;  3TTF A;  3P39 A;  3WEE B;  1JJ2 M;  1ZBF A;  3EKU A;  3W0L A;  3GDQ A;  4CD1 A;  2G8H A;  3ALY A;  3FLC O;  1T3V A;  4AIL C;  3VEW A;  4DR3 K;  2QTD A;  3NVK A;  3P1G A;  1QE1 A;  2IVO A;  1WSH A;  3U4L A;  1Z6R A;  5KRS A;  4DFK A;  2BDP A;  4NYN A;  1X3M A;  2P9L A;  1JCG A;  4C8M A;  3H45 C;  3OYL A;  4M3Y A;  3T19 A;  3UIQ A;  3E66 A;  3IFR A;  3WNG A;  4DF4 A;  5A2Q O;  4IDK A;  4CHY A;  1VSL A;  1NWK A;  4EAH D;  3KK7 A;  4WCE L;  1RT1 A;  4DQR A;  4FWO A;  1UWB A;  3J7Y P;  4Z4H A;  1QSY A;  3CIP A;  4DTS A;  4B3M K;  4O4G A;  1Y64 A;  4FVM A;  3VQ6 A;  1NGJ A;  1XMQ K;  3U8X A;  4QS9 A;  3O9T A;  2QWN A;  1FJG K;  1J54 A;  3FE1 A;  3DXK A;  3G0Z A;  1LV5 A;  4Z4F A;  4FJK A;  4A59 A;  2VWK A;  3HYF A;  4H0P A;  3NAE A;  4DQQ A;  3WXM B;  3V1Q A;  4E19 A;  1CXQ A;  4PKG A;  3NF8 A;  1L5U A;  1BWF O;  3PX6 A;  3VQ4 A;  1GLB G;  1RFQ A;  3VES A;  4KHQ A;  3A5M C;  3MWT A;  2Q31 A;  4FLW A;  2P51 A;  4PL8 A;  1LWF A;  1WLJ A;  2ASO A;  3OYM A;  1I3A A;  4FJI A;  4IZ9 A;  4DR7 K;  4JI6 K;  1T6D A;  3B6O A;  4CHP A;  3KLI A;  3SI6 A;  3K9J A;  3U9Z A;  4WQ4 A;  3RMA A;  2OPP A;  3G25 A;  5CZ1 A;  4DMN A;  2CGL A;  4FPA A;  2HHX A;  3ZT2 A;  3KLF A;  4IOX A;  3DLK A;  4CBU A;  3VOV A;  2XY7 A;  2F8T A;  1S72 N;  4DKW A;  5C24 A;  4RW9 A;  2YNG A;  2F7T A;  5ADX A;  1N8R O;  4KHP K;  3F9M A;  1Q9X A;  4I6M A;  1Q86 O;  2D0P A;  3G71 N;  3ZSR A;  3SMS A;  3GL1 A;  4HCB A;  2P9S A;  1VSI A;  2AA4 A;  2QEX N;  3SJH A;  2D1K A;  1Q81 O;  1BA0 A;  4KTW A;  1CLQ A;  3NH2 A;  2I5J A;  3HM9 A;  4BRK A;  1NGI A;  1C0F A;  1DT9 A;  4V19 S;  5HP1 A;  4JYA K;  1KVC A;  2QM1 A;  4FJ8 A;  5H1S Q;  4DLG A;  3DYA A;  3V1R A;  1T8E A;  1T05 A;  1NK0 A;  3ID8 A;  2G8U A;  1KC8 O;  5AQX A;  3NF7 A;  3QER A;  3QNN A;  1IO2 A;  4O5B A;  3HPO A;  2UU9 K;  2VG7 A;  3O1W A;  1S1X A;  3VF2 A;  1YF5 L;  4DSK A;  5C2D A;  4FJX A;  1UAX A;  3IG1 A;  5BRD A;  4IWV A;  2AP1 A;  2VYP A;  5C2F A;  1TUU A;  4DTN A;  3E1Y A;  4CZM A;  1NKB A;  1YIT N;  4Y1D A;  2O8B B;  4ILH A;  4NXM K;  1S9E A;  3ZSY A;  4BQZ A;  2ZGZ A;  5AFU H;  4JKG A;  3AVN A;  3OY9 A;  1X1P A;  4B9V A;  5F2R A;  4I9Q A;  1NLV A;  1HKB A;  3AVF A;  3AGK A;  5HL7 L;  2IIR A;  1T6C A;  2QWO A;  2X78 A;  2NLX A;  2VG6 A;  3VEO A;  4FJ7 A;  3PO5 A;  4PWD A;  2PBD A;  4OPJ A;  3A8Y A;  4BVO A;  4KI4 A;  4LFB K;  3F9K A;  3SAH A;  4FJM A;  2UXD K;  4M7Y A;  1QQM A;  1UOC A;  1IJJ A;  5BPM A;  1X9J A;  1GLL O;  4DSL A;  1NMD A;  3D2F A;  3DAW A;  1MDU B;  2KHO A;  4DR1 K;  1XWL A;  1QVG M;  1U49 A;  5ADX H;  2V7Z A;  3CD6 N;  3ENH A;  2G8K A;  3NMU A;  3C6T A;  1NNE A;  1KD1 O;  3LL3 A;  2A40 A;  3SCX A;  3VGK A;  2G8W A;  3OYH A;  3BUZ B;  1LW0 A;  3HVR A;  3OYI A;  3AAR A;  1VQ8 N;  1OH6 A;  1WB9 A;  1Q8I A;  3VEZ A;  2IC3 A;  1EET A;  5AQL A;  4FO0 A;  3ZET B;  3L2R A;  3TAE A;  4DV4 K;  2E8A A;  1JLB A;  4CZK A;  3AO4 A;  2NNW A;  4CER A;  1NJW A;  1KVB A;  4CGH A;  2QW9 A;  1HMV A;  5HRS A;  4BRM A;  3WNE A;  5JLF A;  2NRW A;  3K5N A;  4K42 A;  4WFB L;  1BIU A;  3DLL L;  5KPT A;  3NE6 A;  4CK1 A;  3C6U A;  1B9D A;  1BDG A;  1K9M O;  3SLC A;  4GV3 A;  3KKR A;  1LWE A;  4QOZ B;  4DSF A;  4JV5 K;  1NBW A;  4DS4 A;  4FJG A;  3O9R A;  3M8R A;  4DHY A;  2YX6 A;  3WXJ A;  3S9H A;  3KK3 A;  5KPZ A;  4FOI A;  4MFB A;  3U3G A;  1WUA A;  3BY5 A;  2HMI A;  1L3V A;  2YNH A;  3LAM A;  4KH4 A;  5IT9 O;  3TPQ A;  2BGG A;  1C1A A;  4N76 A;  3S41 A;  3QET A;  4IFY A;  1UA0 A;  2W42 A;  2GWK A;  2FBY A;  1FKO A;  1TL3 A;  2NRZ A;  2OPR A;  4CEE A;  5KPR A;  3VF6 A;  5FRM A;  1Z26 A;  1NGB A;  4CEC A;  4BE2 A;  1BCO A;  2DFF A;  3GG4 A;  1NG9 A;  1ZBI A;  5B8H A;  3CCL N;  1TAQ A;  3MX2 A;  4OPH A;  4HTL A;  4YFU A;  4DV2 K;  2G8F A;  2OYQ A;  4CZH A;  3OS0 A;  4DCH A;  1C0U A;  4JKE A;  3ZT4 A;  5AQT A;  2P9N B;  3S3M A;  3K58 A;  3CC2 N;  2ZJP L;  1KSP A;  1DKG D;  1BCM A;  4CZG A;  2OAN A;  3QEV A;  4K25 A;  1REV A;  2NRR A;  4CJ5 A;  4WF9 L;  3CPW M;  4WFA L;  4BE1 A;  5HLF A;  5C0Y A;  2KTQ A;  3FR0 A;  2FBX A;  4R79 A;  1LOT B;  1ZBS A;  4EHT A;  4YDU C;  3VGM A;  3AO1 A;  4ISF A;  1YJ9 N;  4I7F A;  1E3M A;  2VGM A;  3G4S N;  3AO5 A;  3ZCM A;  4BRC A;  3ZX2 A;  2KZZ A;  1OVY A;  1EWQ A;  5GAE P;  3HO1 A;  3PX0 A;  2HHW A;  3VGL A;  4LFC K;  3HJF A;  4QAG A;  4YOV A;  2I7P A;  4H5T A;  5LJV A;  1CZA N;  3QIP A;  5HRN A;  1VSH A;  4CD3 A;  2GV9 A;  3JYT A;  4FM1 A;  4OJR A;  4ELV A;  1O1W A;  4PHT X;  3EEQ A;  3DLH A;  3T1A A;  1N5Y A;  1JXB A;  4E7J A;  4BRG A;  4C8L A;  3ULD A;  1K8K A;  2HNY A;  4B08 A;  5FLX O;  3OVN A;  4HVJ A;  5BN8 A;  3DOK A;  3O3H A;  1KAY A;  4E1N A;  3WUH A;  4BC5 A;  3KTQ A;  1XNR K;  1RDD A;  2W41 A;  2UUA K;  4KTZ A;  3SUQ A;  3CFP A;  3O9S A;  2UUB K;  5AZJ A;  2HND A;  2YKN A;  5J1E A;  4BG9 A;  4M3W A;  5JLH A;  1YVU A;  4K8Z A;  2FSK A;  3DWL A;  4KH6 A;  1TVR A;  4JS5 A;  4FJ5 A;  1HQU A;  2CH6 A;  3HP9 A;  2P9U B;  2CH5 A;  5GAD P;  5LJW A;  4LY7 A;  3MEG A;  3I55 N;  2Z1H A;  1KAX A;  1TUY A;  3L3V A;  1Y97 A;  4DV7 K;  3CQX A;  1FK9 A;  3OYN A;  3SQ4 A;  1ZBL A;  1S3X A;  2UUC K;  1NGG A;  3KIO A;  4IOC L;  5M1P A;  3O6W A;  1X9S A;  2G8I A;  3DXK B;  1KLN A;  5AQI A;  5E84 A;  3AVH A;  3UKU A;  4NB4 A;  3KWG A;  3B6P A;  3EYZ A;  4B9Q A;  3Q7C A;  4CF8 A;  3CXC M;  1N36 K;  5AQG A;  5SWM A;  4I2P A;  4CZF A;  3QEX A;  4DSJ A;  2WFB A;  3TWH A;  1HQE A;  4M7X A;  3BP8 A;  4FWQ A;  4BGA A;  3QML A;  3K2P A;  4DG1 A;  1ASV A;  1JLA A;  1WBB A;  5E26 A;  4FLV A;  4B3T K;  4XH1 A;  2GWJ A;  3SAG A;  1RTD A;  4WYB A;  4KB1 A;  1BA1 A;  4PA1 A;  4PKI A;  2YI1 A;  3OS1 A;  2VWJ A;  3F2K A;  4KRE A;  5AZI B;  1ASU A;  1CZB A;  2W6K A;  1D4X A;  1QQC A;  4DF8 A;  1S9G A;  2IGI A;  3JSM A;  2VGN A;  4DV3 K;  3QEW A;  2KW4 A;  3CYM A;  3RTV A;  1HJR A;  3C7N B;  3WXI A;  3LAL A;  4DQP A;  3BF3 A;  2AJQ A;  1SZ2 A;  4AHC A;  4I6M B;  3TAM A;  4FZZ A;  2JWK A;  2P9S B;  1ATR A;  4GKJ K;  4DTM A;  3RSE B;  4RW8 A;  3A5O C;  2RHK A;  3PUF A;  4BC3 A;  4KRF A;  3ZSX A;  3LDO A;  1EXQ A;  2O8F B;  4B1Y B;  5T7B A;  4CBW A;  5DM6 L;  2BH1 A;  4AHR A;  2E6L A;  2FBV A;  3V9S A;  1QSL A;  4Z4E A;  4LH4 A;  3A0I X;  3DXM A;  4OGC A;  4NYF A;  4J2D A;  2NRX A;  3ZT0 A;  5CYQ A;  3UE5 A;  1W0H A;  3SJJ A;  3FZH A;  1TAU A;  4BRL A;  4BDP A;  2HVH A;  2ASM A;  3QFP A;  4B9M A;  1BQN A;  4J2B A;  2ZJR L;  2HNZ A;  3AVM A;  3VA3 A;  2A5X A;  3L3U A;  1QQN A;  1U2V B;  5KGW A;  2A1R A;  3KJV A;  1EWR A;  3TTD A;  4CJ7 A;  1YUW A;  1KTQ A;  4FK2 A;  3HPG A;  4CZJ A;  2D0O A;  3AVL A;  4L3Q A;  4BG8 A;  5JMV A;  5E41 A;  4JKG B;  2E2O A;  3THY B;  2D0C A;  4GVE A;  2GUI A;  4B9N A;  4CFA A;  3AGR A;  1NM1 A;  1LW2 A;  3PSF A;  2W40 A;  2KQ2 A;  3RMD A;  4DTR A;  4JLH A;  1KFS A;  4EHU A;  3HPH A;  1HPZ A;  3H3N O;  3ID6 A;  3E9O A;  4FW2 A;  2OTL N;  5TKW A;  3SMP A;  2FF3 B;  3EN9 A;  1GLE G; 
#chains in the Genus database with same CATH homology
 4DR5 K;  4JI8 K;  1N33 K;  4V19 S;  1IBL K;  3J81 O;  4LF7 K;  4LF6 K;  4JYA K;  2UXB K;  4DV3 K;  4OX9 K;  4DV1 K;  1IBM K;  1HNZ K;  5A2Q O;  4DUY K;  4NXN K;  4DV6 K;  4DR4 K;  4AQY K;  2UU9 K;  5IWA K;  1I94 K;  3J7Y P;  4JI0 K;  4JI5 K;  4YHH K;  4X64 K;  4LF5 K;  4X66 K;  1N32 K;  5LMN K;  4DR2 K;  5FLX O;  4B3M K;  4GKJ K;  2VQF K;  3OTO K;  2E5L K;  4JV5 K;  1XMQ K;  4B3S K;  4LF4 K;  5BR8 K;  3T1Y K;  1HR0 K;  1FJG K;  4K0K K;  2F4V K;  1XNR K;  4DR6 K;  4LFA K;  2UUA K;  1HNX K;  4NXM K;  4LF8 K;  2UUB K;  5IT9 O;  4GKK K;  5AJ3 K;  4DUZ K;  3J7A P;  4X65 K;  4JI3 K;  1XNQ K;  4JI2 K;  4LF9 K;  2ZM6 K;  4DV7 K;  4LFB K;  2UUC K;  4JI4 K;  4DR7 K;  4JI6 K;  4DV2 K;  2UXD K;  3JAM O;  3T1H K;  2UXC K;  4B3R K;  2VQE K;  2HHH K;  1HNW K;  4YY3 K;  4DR1 K;  1N36 K;  1J5E K;  5LL6 Z;  4X62 K;  5LMU K;  4JI7 K;  4CVN E;  4DV5 K;  4DV0 K;  4KHP K;  4CW7 B;  1XMO K;  1IBK K;  4DR3 K;  1N34 K;  4B3T K;  3J80 O;  4LFC K;  4DV4 K;  4JI1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...