4JI4K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji4K00
4DUYK 4LF7K 4DR5K 4GKJK 4DV0K 4DV7K 4DV2K 1IBLK 1XMOK 4B3MK 4LF4K 4LFAK 4JI5K 1FJGK 4B3TK 4JI2K 3J81O 2E5LK 1J5EK 3J7YP 1XNRK 4JI6K 3T1YK 4JI0K 1XNQK 4DR6K 5AJ3K 2VQEK 4JI7K 4CW7B 5LMUK 4B3RK 5A2QO 4X66K 5FLXO 4V19S 4GKKK 4JI8K 4DR1K 4X64K 1HNWK 1XMQK 1IBKK 4X65K 4YHHK 4NXMK 4JI1K 5BR8K 4DV6K 1N33K 4DV4K 4DR4K 4JV5K 1N36K 2UU9K 2UUAK 4DV5K 2UXBK 1HNXK 4NXNK 5IWAK 1IBMK 2UXDK 4YY3K 4AQYK 4LF9K 4DR2K 2HHHK 4DR7K 3OTOK 1N34K 4X62K 2ZM6K 1I94K 4JYAK 3J80O 4LF6K 4OX9K 4K0KK 4DUZK 3JAMO 1N32K 4LF8K 4DR3K 2UUCK 4DV1K 3J7AP 2VQFK 1HR0K 4LFCK 5LL6Z 4LFBK 2UUBK 4KHPK 5IT9O 5LMNK 1HNZK 4B3SK 4DV3K 2UXCK 4CVNE 4JI3K 2F4VK 3T1HK 4JI4K 4LF5K
chains in the Genus database with same CATH superfamily
3LM9A 5KQ8A 1BOTO 3THYB 4KHSA 4LFAK 4DB3A 3RR7A 2DY4A 2YJEA 5KRSA 4B3TK 1S9GA 2X6NA 4YNQA 3OYFA 3KZBA 4FLTA 3WXJA 3RSEA 1Q18A 3K9KA 4CIFA 4CGDA 3RMBA 3ZSZA 4I9QA 3OYJA 4X66K 1YAGA 4JI8K 3HK2A 1RDWX 4CJVA 4CESA 3ZT1A 3VENA 2EHGA 5B8HA 1D4XA 1S6PA 2VGNA 3CI5A 3L2RA 2IVPA 4RWTA 5C24A 2WONA 4O8UA 4AHTA 1SL2A 3DRRA 1RT4A 4F3TA 4CBUA 3QEPA 5AZIA 3U6FA 1NK0A 3OJSA 2QK9A 3TI0A 1RNHA 4A2AA 5BN8A 4GV3A 3CMAN 3OS2A 2HNDA 1HQEA 2KFNA 3P38A 4XH1A 5J1EA 4KRFA 1IG8A 1S22A 3P39A 4LF6K 3V1OA 3M6GA 3QERA 5JICA 1HKCA 2OPQA 3SAHA 2P9LB 4DR3K 1JLEA 1D5AA 2P9PB 3J7AP 4I9LA 4DSEA 1SAZA 1VQ8N 4CJUA 3IG1A 3T1AA 5AQGA 3AA4A 4JEPA 4QS8A 3SQ0A 5C2DA 1ASUA 1S5JA 4B9NA 2HBMA 1ZBFA 4CJQA 1XUPO 3J8AA 3O4QA 2X78A 3V81A 3EEQA 4FLZA 1GLBG 2ZE2A 5JVGL 2WC9A 2NRWA 1N5YA 4B3OA 1YUWA 5C2FA 3GOIA 4CVNE 1KCFA 1JCGA 4HUEA 3IUCA 4LF5K 3PX6A 3E9LA 3ENHA 1E3MA 4DV7K 2JGUA 4N56A 4H0OA 5HLFA 4FWKA 3V6DA 5KGXA 1YHQN 4BRNA 5AQYA 4W5OA 4DQPA 4OGCA 1FXXA 3O08A 4DR6K 3O9RA 1OH7A 3S3MA 1VQNN 4JKFA 2O8EB 1EQYA 3AVLA 4WE1A 5LMUK 1X3MA 3MAQA 1N8RO 3I56N 4N76A 2A1SA 4BRFA 1XC3A 1FK9A 4HWIA 2KTQA 3F73A 1IBKK 4YHHK 3THYA 4FCYA 1OVQA 3SAFA 1CZ9A 4H5NA 4J2AA 4KO0A 3BZKA 1MWMA 3EL2A 1A5XA 3O4WA 2XY6A 2XY7A 4FVMA 4KFBA 2FBVA 1K73O 4LH4A 1EWRA 3EZ5A 2P9SB 4IDKA 1SV5A 1L3UA 3WXLA 1E4FT 4DU1A 2HHSA 2D4WA 4O5FA 1RDDA 3DRPA 1TAQA 3QICA 4DQIA 3DYAA 3N4QA 4WCEL 1F21A 2E6LA 4K41A 2IVOA 2I7PA 4CEFA 3WT0A 4CF9A 4E1NA 5BPNA 1ILYA 3SMPA 2IAJA 1NGCA 1NG9A 3L6QA 3H46O 3B6OA 3TPQA 3GL1A 1NNEA 2V7ZA 2HMIA 4CJSA 3SQ2A 2UUBK 4CZEA 1S1WA 5IT9O 2BTFA 4JKBA 2O4GA 3SYZA 3SI6A 3VQ4A 1IO2A 5AQMA 3E01A 4B1VA 3SZ2A 4OLAA 1JL1A 3CXCM 3E9OA 4CHYA 2QWQA 1T6CA 2NRZA 3DAWA 4GKJK 1VQ7N 4DV0K 3ZX3A 1JLAA 2P9LA 1RBUA 4HUFA 1TKTA 2P9PA 4JI5K 3G10A 3AO2A 4BRIA 4CZJA 2FBYA 1IH7A 4ILGB 4O8KA 3CC2N 3VQQA 5F1XA 3SV4A 2IOCA 4C8MA 3UB5A 1U6ZA 4FJNA 3DLLL 3KIOA 4CEAA 2QM1A 3OJUA 4NYNA 3V9WA 3V9XA 1SL1A 3DLEA 3O9UA 4ISFA 1K9MO 3QETA 1TV6A 3LANA 5F2RA 5AQFA 1Y97A 4CEEA 1NWKA 3RRHA 3PX4A 4CHZA 1IV0A 3I55N 4CF2A 1JKHA 4X65K 1RBVA 4XIUA 1T6DA 4RW7A 3ZSXA 4FOIA 4EFHA 1NKCA 3EN9A 4H8KA 4CERA 5FROA 1J54A 1EETA 2ASPA 1WSIA 5DMRA 4DV5K 1LAWA 4NYFA 5C12A 4DSIA 2O8EA 3HPOA 3NF8A 2KLAA 5BPMA 3VQDA 3AVFA 2A40A 3ALYA 4DQRA 3KK3A 2QXLA 3VQ5A 3I8DA 2GEMA 3WNEA 2ZJRL 3SBTA 2E2PA 5KTQA 4HVJA 1ZBLA 2D0PA 3HSTB 3MX2A 4FJ9A 2FXUA 2UYTA 3EY1A 1FKPA 4DV1K 4DSLA 1VSIA 4FJJA 4G9ZA 5AQRA 4IO9L 1RBSA 2P9SA 2R7YA 1CLQA 2Q3SA 2G8IA 3HTVA 3SMSA 5C42A 4TSXA 1HUXA 4BE0A 1UOCA 1NMDA 3VEOA 3P31A 4F9OA 2UXCK 4QS7A 4FLWA 3CCEN 2ETJA 2VCPA 3EE9A 4IEIA 3HSCA 4BVPA 3L0QA 4OPKA 4M7YA 4CZLA 2KZZA 3NF7A 1TUUA 2ITMA 5MLCQ 4A2BA 2OYQA 1S72N 4DF8A 5FPNA 3W0LA 4N5SA 3SPYA 3ASMA 1LW2A 4JI6K 2P9KB 5CY4A 1YITN 5ADXH 1YXQA 5M1OA 3L4IA 2VQEK 2O4IA 1VQLN 4FM1A 3HBTA 4FZXC 1YJNN 4FYDA 1B92A 5M1NA 4CHPA 3O9TA 4WQ4A 3GDQA 5BRDA 3QEIA 1S1TA 4YOTA 1DT9A 3NCIA 1KVBA 2O8BB 4FJMA 5HBMA 4FK2A 5BRFA 2PZSA 4BACA 1MWKA 5BR8K 2BUPA 2VWJA 1N33K 3WNFA 5AZJB 4MFBA 3IMXA 1JXBA 4HCBA 2DFEA 2NUBA 4DV4K 2HHQA 4DR4K 1RT6A 5AQHA 4BRDA 3CQXA 2HNYA 4KH5A 3GG4A 4CEOA 3N4PA 4UY8O 1L3TA 4FWQA 3HL8A 5GADP 3RMDA 5ADXA 4OKKA 4O44A 3ULDA 2BH1A 1ZBHA 2ZM6K 1C0MA 4BREA 1TL1A 3F5TA 1QQCA 5SWMA 4AHUA 4KH4A 4EHTA 3G6EN 2HBLA 4CFAA 3OYKA 3O8MA 3VESA 3DWLA 4O55A 5HROA 3IS9A 3THXA 4EZ6A 4ID5A 3CQ8A 5LL6Z 3K57A 2G8WA 1DGKN 5JMVA 3HVTA 2JWLA 5HOOA 4KHNA 5LMNK 2RN2A 2YNIA 4M3ZA 3A5OC 3RR8A 3JYTA 2LSNA 3IKMA 1JL2A 2HBJA 1K8AO 3OBWA 4CF8A 4DFMA 4C8KA 2RHKA 3M8RA 1BIUA 1JLGA 3RMAA 4KHQA 1SL0A 4JHDB 3O1BA 5HRRA 1JXEA 3NVKA 3BGRA 2GV9A 3C94A 1JLBA 3M3ZA 2V52B 3VQ9A 4JI0K 4H5RA 3GE1A 3NH1A 2P9NB 4CFCA 4CIGA 1T03A 3NGYA 3DLBA 2P5GA 3WEEB 4DTUA 3RTVA 2YNGA 1K8KA 1C1CA 4DR1K 5AQVA 3PX0A 2O8CB 1KVCA 3NMUA 3A8YA 4GY2B 1XMQK 1B9DA 4Z0UA 3VETA 2O8FB 5E84A 4R79A 1TKZA 3A2FA 2E2OA 1W0HA 3CCMN 5FRNA 1BO5O 3NF9A 2YHXA 4JK9A 4BRPA 2OANA 4OPHA 3PO5A 3AVGA 1VSHA 2UU9K 2P9KA 1U47A 4JNEA 1MU2A 1VK0A 1WAFA 3SBGA 3DI6A 4DU4A 1NOZA 4KB0A 5CE3A 1Q7YO 3ZT4A 3L2VA 1Z05A 3S3OA 3O6WA 3OBYA 4GNIA 1HYZA 5FPMA 2O8BA 4CEBA 3SAGA 1KXPA 3S9HA 4CJ5A 1ATRA 3NFAA 2FSJA 5AFUH 3A5LC 4QAGA 5AZJA 4E7IA 4DUZK 4BROA 4DSFA 2CH5A 1N32K 3MEGA 3OYMA 2FSKA 3C65A 1NGDA 2NNWA 3SUQA 3AVCA 3CFOA 3SCXA 1P8ZA 4E1MA 1W7AA 3C0BA 3FE1A 3I0SA 3JSMA 1RTJA 4QOZB 4K25A 4FLXA 4CJPA 4KH6A 3ZCMA 3AVIA 4BRQA 4CECA 4WFNL 3KK2A 1QS4A 4WQ5C 1NGGA 3VEYA 5HRNA 1T3VA 4LY7A 1WSEA 3OS0A 1LOTB 4DV2K 3K5NA 2OPPA 3DLGA 1WSFA 3EKSA 1FJGK 5AFUA 4DLGA 4PA1A 4DQ8A 4BR0A 1QSSA 3IAYA 3NF6A 1J53A 4CJWA 3J7YP 2E5LK 3AV9A 2Q1NA 1KAXA 1MDUB 2GX9A 1RT3A 1KRPA 2YHAA 4FLVA 4EIAA 1GLAG 1VSFA 3CIPA 4OKEA 3OA9A 4V19S 1YVUA 4A57A 4IOCL 4H5WA 4JS4A 4CZHA 4NB4A 4NCBA 3CCLN 1KQSM 3VQBA 4FVUA 4FWNA 1SQKA 1LCUA 1EWQA 4NXMK 3OYDA 2QWOA 3I8BA 4AHRA 4JHDA 4CZFA 2ZGZA 4FLUA 1RILA 3FZKA 3UKUB 4BG9A 4GW6A 1I3AA 4YORA 1WB9A 2P9NA 3BUZB 3H45C 3VA3A 1Z26A 3VTIA 3LDOA 4CZGA 4C8LA 4CGHA 1HRHA 2X6SA 3OYNA 5DK5A 4AQYK 1HJRA 1MA9B 2KFZA 1T44A 3IDHA 4M3TA 3TTFA 3CCVN 4DR7K 4IFYA 3OYBA 2O8FA 5C15A 4E3SA 4FJKA 3JAMO 1ZBIA 4FM2A 3PO4A 3HI0A 4H4OA 3K9JA 4B08A 3PIPL 2NZTA 4KTZA 3ID8A 4ISEA 1HYSA 5BR9A 3LDLA 3U9DA 5D3GA 4N41A 4FJHA 1KSPA 3M1FA 3LDQA 4H03B 3AARA 1TYQB 2WOMA 4FLYA 4E0DA 4KHPK 4F8RA 1HPZA 2YKMA 1HNZK 5M1QA 4B3SK 2I5JA 4M3YA 3MN6A 3T19A 2ASOA 1KLMA 1IKWA 4JK8A 3K0SA 1QQNA 2HHUA 4DR5K 1IKVA 4KI4A 1I39A 1XMOK 1Q9YA 2O8DA 5KPRA 4ELUA 3CQYA 4E7LA 2A5XA 2A42A 2KZMA 4J2EA 2YX6A 3LZJA 2ZWHA 4CEQA 3KHYA 4AILC 5AQWA 4HHTA 2ASMA 3CCRN 1UWBA 3SQ1A 4YDUA 3QEVA 4Z4GA 3VOVA 2HSTA 5AR0A 3AA5X 4A62A 4DSKA 2OA8A 4FWSA 2ZJPL 3R9PA 4I2PA 2HMPA 3CF5L 1JCEA 4PKGA 1YVNA 4CF0A 1IG9A 3P1GA 3VQ8A 4BRGA 3KLHA 4CZKA 4ELVA 3AO3A 4A5BA 3OYEA 1P90A 5J2NA 3K2PA 2QWNA 4BWJA 2Z1JA 2FF6A 4IOXA 2DTUA 3WUHA 3T69A 4CCHA 4JK7A 5SZTA 2UXBK 4KTQA 5HRSA 4CBXA 1X3NA 4HCCA 2GWJA 1E4GT 3WXIA 4Z4FA 1VQPN 1HLUA 1GOBA 4Q0BA 4B1UB 3MECA 1EX4A 1YJ9N 1QVFM 3OTOK 3C7NB 3B6PA 1I94K 1HMVA 3J80O 4M41A 4DWIA 3K5OA 2P1JA 2V7YA 3UKUA 3DLKA 1D9FA 3LAKA 4KHUA 1CXUA 5ELZA 5AQQA 4BRLA 5HL7L 2FF3B 4WYBA 4H0TB 4LFBK 2Q2RA 3HM9A 3ATUA 4FM0A 4DCHA 3AVJA 1NGFA 4AM7A 4OPAA 4WF9L 2ZJQL 1HNVA 1WSGA 4DV3K 3PSFA 4CGGA 2F4VK 2YHYA 3LPTA 4BC4A 1OKJA 4XEIA 3MCPA 5AQJA 4LF7K 3ZSYA 4PY5A 3VEZA 3EE8A 4FWPA 4LSLA 4PKHA 1C1BA 3OHRA 4RW4A 5EXWA 3ID6A 4DTMA 3J81O 5J2PA 2RE2A 1W2BM 2ITGA 4FK4A 1J5OA 4M3XA 2VGMA 1UA0A 4DTNA 3JXUA 3K5LA 2XRIA 4F2RA 4CW7B 1BG3A 3HP9A 3SJJA 5A2QO 4YOVA 4IKFA 2XO7A 2OCEA 2F7TA 1VSLA 2IIRA 3ZLJA 4IJAA 2F9TA 5GINA 3SV3A 3LDNA 1HNWK 4NCGA 1QHTA 3G25A 5H1SQ 3D7EO 3G71N 1BIZA 4CJ7A 1VHXA 3L3UA 4H0YB 4CK2A 4OLBA 4KTWA 4DSJA 1HKBA 5I42A 2UUAK 5JLHA 2Q36A 3AA3A 1HX1A 5IWAK 5AQOA 2VG5A 3QIOA 4CBWA 1K6YA 2GUPA 1VQ5N 4ID1A 4LF9K 5FPEA 3C6HA 2B5JA 1WOQA 5GIPA 3MMVA 2HHXA 3THWB 4U7BA 2VYPA 3CM5A 3DM2A 3ENBA 4M3WA 3LDSA 4F2SA 2D0BA 1BA0A 4O5BA 3QNNA 3ZETB 3F9KA 4IG0A 4AH9A 3SK3A 4DMNA 1GLEG 3K5MA 4LFCK 4W5TA 4BC3A 1NJIO 1UAXA 4YOYA 2YJFA 4BR9A 1D9DA 4IEEA 2PFUA 1O13A 3R8EA 4DS5A 3AY9A 1KD1O 2HHWA 2VG7A 3TAGA 3H3OB 4O0JA 1DLOA 3CJBA 4CHQA 3VF2A 5I3UA 3MX5A 1OH8A 3CJCA 4I6MB 1HJOA 5DM7L 1WSHA 2XY8A 4PHTX 3VGKA 4CD3A 3RRGA 5AQSA 2Q31A 2QXFA 1BL3A 2KHOA 4CEZA 4CK3A 4FJIA 2NRVA 3O5BA 4IOAL 1NGJA 1REVA 3T3FA 3KK7A 4JI2K 2OTLN 3D2FB 1KAZA 4MO5A 3MXMA 5M1KA 1QZ6A 2Q0RA 5GAHP 4IFEA 4KI6A 4E1JA 3PUFA 1SUQA 1SS6A 2QW9A 1FW6A 3THVA 2D1KA 2QWMA 3ZEUB 5K14A 3TTDA 4DQQA 4GKKK 1KAYA 4BE1A 5E26A 2JLEA 1U48A 3HOSA 3DXMB 2BDPA 2HHVA 4YOWA 1OH6A 4KREA 1NOYA 3ISNC 5C25A 1TK0A 4JRPA 3MDQA 3M8PA 4KBOA 1FKOA 4MQ3A 1T05A 2WUSA 4B8CA 4H5VA 4MDBA 2F8TA 3FR0A 1NM1A 1IBMK 3T7ZA 4DR2K 3L2WA 3VTHA 5LJVA 1TGOA 2G8HA 4HUGA 3QIPA 4YFUA 1D8YA 4O0IA 2G8UA 4DQSA 1ZC6A 1DTQA 3KJVA 3S41A 5KPZA 1G99A 4CF1A 1X9JA 3A5MC 1CZBA 4MLHA 3HO1A 1BQNA 4RW6A 4C8OA 2P9IB 2F96A 2QI2A 3E1YA 4FOEA 1LWCA 3LZIA 2YI1A 1NGIA 4C1NI 1TKDA 4FPAA 3NE6A 1RTIA 4M42A 2HB5A 3CETA 3FZMA 3TAEA 3OW2M 3U4LA 2JWKA 1C6VA 5CZ1A 2OZSA 2HF3A 1C0UA 3CCUN 3NAEA 3F9MA 1WBDA 1NMNA 2EX3A 4F3OA 1RDAA 1JLQA 3P83D 1C0TA 4BDPA 1U4BA 3A5NC 1LV5A 4EZ9A 1S1UA 3SJHA 2QWRA 1NBWA 4PUOA 4B3RK 3K59A 3CCQN 4XH5A 4IZ9A 4I6MA 1GLJO 4H5TA 3BDPA 4B1YB 4B9SA 3TANA 4M3RA 4DTOA 1S1VA 2AJQA 4ILHA 3UKRB 3LDPA 5BREA 3FZHA 3ENOA 3MCAB 5KI6A 4DKWA 1KFSA 1JLFA 3DOKA 3D2FA 3DXKB 4CI6A 4FWLA 2IS3A 3U3GA 1XHXA 4JV5K 2P51A 5J2MA 2KKZA 5C0YA 4JKGB 3RVCA 4CJKA 3ZEUA 5AQNA 3ZX2A 2FLOA 4B9UA 3RSEB 5C10A 4KV8A 4MO4A 3P4IA 4FZYA 4ZHRA 3DXMA 1VQ6N 2VG6A 2NRXA 1NJXA 3Q7CA 3KD5E 3TARA 1VQON 4WFAL 4FW2A 4OX9K 1RBRA 3HZ6A 2CGKA 4YOUA 5CR4A 3CFRA 2YV0X 4OVLA 1UA1A 4BDYA 3VGLA 4BGBA 3CJ9A 3C6AA 3VGMA 3ZSQA 2PYLA 1A5VA 3EO3A 1NKEA 3O1WA 4H0PA 4BVOA 4ZTJA 4GMJB 4B8AB 3ULEB 5KQDA 2ZD1A 2PYJA 3NBPA 3U8XA 4KAZA 4ILJA 2Y1JA 3M8QA 4A61A 5AQZA 4BWMA 4CGFA 2FC0A 3AVBA 5KRTA 4O4GA 2GBZA 4PL8A 3FZFA 4CJTA 3TABA 3MK6A 4FL9A 3CMEN 1JLCA 4CJ3A 4K42A 4CE9A 2P9IA 3VQ6A 1VQMN 4FJLA 4FJXA 1NK4A 1QVGM 3AVHA 3QFPA 3QDKA 1NLVA 5CZ2A 3NGZA 3FFKB 2QWLA 3A0IX 2YHWA 4PKIA 3MXIA 4W5RA 4JD2B 4K8ZA 1BGXT 3VQPA 2RF2A 1IKXA 3AVAA 5EOYA 4BC5A 1KC8O 4CEDA 3AO1A 1J9AA 1RT5A 3OYCA 1LAVA 4PWDA 4FPBA 4DG1A 2HF4A 4KHYA 1ATSA 3WQTA 3FLCO 3ATVA 4NO7A 1NJZA 4LD0A 3ZSWA 4OO1J 3R1XA 4EHUA 3S3NA 1CXQA 5BN9A 2W42A 3DMJA 3LL3A 5T7BA 2YNHA 3IFRA 3QESA 3FZLA 1VSDA 4C23A 1BISA 1WAJA 3ZSVA 1QTMA 1EO1A 4M7XA 3U9ZA 4X62K 4JYAK 4Y1CA 2G8VA 3NDKA 4IDHA 4CD1A 1RBTA 3DXKA 1QSYA 2Q97A 2Z1GA 1N6QA 4M3UA 2UUCK 5AQLA 3CM6A 1S9EA 5GAEP 4C8NA 4JKGA 4BRMA 3WEEA 4DTSA 1XHZA 3CC4N 3ZYYX 3VF4A 2HBKA 2A3ZA 4RW8A 4W5NA 2KW4A 3AO4A 2O8CA 3KVGA 3OY9A 1RFQA 4KKOA 5KGWA 1ATNA 1BQMA 3V9SA 3JS6A 3CJAA 1SKRA 4RG8A 4CZIA 3VMFB 2V51B 3CERA 3VA0A 3BP8A 1LWEA 3KWGA 1X9SA 1IBLK 4JKDA 2W41A 4B3MK 4N47A 4BQZA 3QFUA 3BF1A 4IBNA 5KPTA 2E88A 1ASWA 3HOTA 4RW9A 4Z4IA 3HJFA 1J5EK 1BU6O 2X74A 3VQCA 4AHSA 2GUIA 3CHWA 1SKSA 1KVAA 2A6AA 3ULEA 3M5RA 2QKKA 1VSKA 3BZCA 1L5UA 1L3SA 3TWHA 3O9QA 3PIOL 3AVMA 2A41A 4FXDA 1RDUA 4FJ7A 3MN9A 4DHYA 3MN7A 3Q7BA 1NK7A 2CGJA 3H08A 1NU0A 1XQSC 3HYFA 1BCOA 3QMLA 1GOCA 1TUYA 2VWKA 3CC7N 4CJRA 1VQKN 3P5JA 4G1QA 4KB1A 2Z1HA 3AVNA 4DS4A 3O9SA 1S3XA 2ZQBA 5EY4A 4M45A 1WLJA 1LWFA 4NXNK 4L8RB 4EAHD 4B9LA 1U2VB 3O4NA 4JD2A 3CFPA 4QS9A 4OPJA 1LW0A 1TVRA 3CYMA 4JKEA 3VN5A 5I9EB 2ATQA 4KHWA 4CHNA 3VEVA 3L2UA 1N34K 4BRAA 2VWBA 3TAFA 3KWIA 1S1XA 3UE5A 3HP6A 1BA1A 3B8AX 3AGKA 1WSJA 4LC9B 4WQ4C 3CG7A 3J7ZO 4B9TA 3QNOA 4BDZA 1HR0K 3MEDA 2GELA 3KK1A 2P9UB 3CCSN 4CK1A 5HP1A 5J2QA 1C0FA 3KLGA 1ITGA 4E7HA 3C6UA 1NK8A 1Q86O 2NLXA 3TSQA 1Q81O 4IJNA 3OVNA 4B1WB 3FGUA 1RDBA 4FWRA 1RT7A 3DOLA 4E19A 2QKBA 5LY3A 5CYQA 5M1FA 3TTCA 3DRSA 3V9ZA 1EP4A 3MEEA 3GBTA 1QE1A 4E89A 4C1NK 1VSEA 2A1RA 3NH0A 4UQGA 4RCHA 1QSLA 5AJ3K 3QB0A 3WQUA 1KTQA 4YOXA 5AQKA 2Y1IA 3HM8A 5FDLA 4B1ZA 3L4QA 2G8KA 4FJGA 2HOEA 3D0PA 3VF6A 3KLEA 3D2EB 3F2KA 4H0XB 3EKUA 1RT2A 3EYZA 1C1AA 4OJRA 1QQMA 2J4RA 4BC2A 3HXMA 4JRQA 1TYQA 3ZT0A 2OZMA 2DFFA 4PL7A 2GTDA 3DLHA 1TK5A 1BDGA 3ZSOA 5FPDA 1RGIA 2H3GX 3V1QA 2BGGA 2I7NA 3VQ7A 2Z1IA 1RTDA 4ELTA 2PBDA 2E20A 2OTJN 2QTDA 4BQLA 1BWFO 4WQ5A 5AQXA 4BE2A 2QA4N 2E4LA 4AF1A 4YY3K 1YF5L 5GIOA 5BPLA 3V4IA 3AAPA 3NGIA 2W40A 2NRRA 4KPYA 3LP2A 4JKHA 1EXQA 1Q8IA 1O1WA 3L8BA 3RWUA 1BCMA 4JKCA 4FWMA 4K0KK 3M8SA 2RPIA 3TSPA 4Z94A 3V1RA 4DLEA 1HNIA 2E6MA 1YJWN 2DPNA 4IG3A 4Q5VA 3HPGA 4BR2A 4DFJA 1U2VA 4DTJA 2W6LA 2WTUA 1IKYA 1W9HA 1HKGA 3SUOA 4IFVA 1YTAA 3G4SN 2HW3A 1IJJA 1OVYA 3LP0A 3I33A 5JS1A 4E7KA 1ASVA 4JI4K 1VAZA 2WFBA 3CJ1A 4CZMA 1CZAN 3O3GA 3KTQA 1BHLA 3DJCA 3LWLA 2FBXA 4CJLA 3CPEA 1NK6A 4L3QA 3HVRA 4U67L 2P9UA 2QEXN 4OGEA 1VSJA 4ISGA 1GOAA 3VEXA 3QBWA 4BGAA 4A59A 5AQIA 3PV8A 1XNRK 2E8AA 1DTTA 1ZBUA 3C7NA 3K58A 3THXB 2FSNA 1DEJA 3AA2A 5FLXO 1VRUA 1R0AA 2D5RA 4K43A 4MDAA 3D6RA 3BF3A 4X64K 1U04A 1M90O 3R3LA 1T7PA 4B1XB 3LP1A 1SZ2A 3RMCA 3TAMA 1T8EA 4J2BA 1S6QA 4M63C 4LH5A 1HYVA 1NKBA 2XHBA 4DFKA 3D45A 1V4TA 5JLFA 5HRPA 1M1KO 1GLDG 2YCHA 3MN5A 2CH6A 4FZZA 2B6AA 3L2QA 3HPHA 1RDCA 3LWMA 5CHIA 4B9QA 4JAXA 3TAPA 1WNSA 4EP5A 3D2EA 4CJ4A 4CFBA 1QQOA 1X9MA 1QZ5A 3CPWM 2FBTA 4RTFD 4JS5A 3SUNA 4JKAA 1DKGD 2E1YA 4W5QA 4FJ5A 4Z4CA 1K8KB 4BRCA 4JLHA 4BY9C 4HTUA 1Q82O 4XH4A 1Y64A 2PAVA 5EX5A 3LM2A 4DU3A 3ZT3A 1GLLO 4BR5A 1L3VA 1Q9XA 3BEXA 3VQAA 1KLNA 1VQ4N 1VQ9N 1KFDA 1J6ZA 1NGBA 5CYMA 4ICLA 3PSIA 3AAQA 2F8SA 2B4JA 4AM6A 4FSVA 4IXCA 2RKIA 3ITHA 2BE2A 2CGLA 1Z25A 2W6KA 4JI3K 3VQEA 1NGHA 5JS2A 5BRHA 1H1VA 4I2QA 2DFHA 3H1VX 1ESVA 2ZGYA 4LSNA 1JCFA 4MLEA 5FRMA 1C0GA 2HHTA 4NLBA 4LF4K 4JN4A 3O3FA 4CJFA 2HVIA 2YKNA 4GV6A 1YT3A 1W97L 4B9MA 1XNQK 1BI4B 3THWA 1QHAA 2E1ZA 4CFDA 4BG8A 2E2QA 4B9VA 5AQPA 1ZXOA 3LAMA 3V9UA 1GLFO 2PY5A 3CD6N 5M1PA 3AVKA 2IC3A 3ZETA 3NH2A 1A5WA 4F4KA 4PQUA 4J8FA 3AGRA 5JVHL 4K8XA 4H0VB 4JI1K 3SPZA 1XWLA 3SUPA 4I7FA 4CIEA 1V4SA 2HVHA 5TKYA 1N36K 2OPSA 3CJ7A 4IWVA 1BUPA 5F0XA 3HRGA 3TAQA 3KKSA 2D0OA 3KD1E 1XC9A 4FWOA 4FJ8A 3QBXA 3SNNA 3O3HA 1JJ2M 1VRTA 3PLAA 3NHGA 3NVMA 4Z4HA 2G8FA 4AHCA 3O80A 5TKWA 3QINA 5AQTA 4Y0WA 3HT3A 1G15A 4YDUC 4DFPA 4CGIA 1NJWA 1VSMA 2IVNA 4LF8K 4E7JA 5AQUA 2KQ2A 3LALA 4DTXA 3G0ZA 3I0RA 4FW1A 3SQ4A 3L3VA 3R6MA 3ZX0A 1YI2N 1TL3A 3C95A 4H4MA 1ZYQA 3OYIA 3KLIA 4GVMA 2BANA 4ZTFA 3IRXA 3VPZA 1HQUA 4GV9A 5EU7A 2OPRA 1WBBA 2IGIA 3QO9A 1EKEA 1NGAA 4IO8A 3TSUA 1TKXA 3VERA 1TK8A 3QEXA 2EWSA 1R59O 3T1HK 4AHVA 4DUYK 4BR4A 2GWKA 3WNHA 3ZT2A 3BY5A 1SKWA 2XY5A 3PY8A 5LJWA 4DF4A 3OYAA 1YTUA 3EZWA 2F9WA 3TU5A 5E41A 1RTHA 3T1YK 1U49A 5AZIB 4FO0A 4DTPA 4NCAA 3MXJA 1X1PA 2YNFA 4JI7K 3LPUA 3FFIA 1TAUA 1GLCG 2QWPA 3VEWA 4R5PA 3KKRA 4QCLA 4GVEA 3H3NO 2Q0UA 1NK5A 4DV6K 3QEWA 4NLCA 5DM6L 1XI1A 3LP3A 1U45A 1NGEA 4EP4A 2YHBA 2NRHA 4BRKA 4A5AA 1X9WA 1OH5A 4BRHA 4Y1DA 2O8DB 2D0AA 2HNZA 1BI4A 1RT1A 1HNXK 1NJYA 3OS1A 1WUAA 4CHOA 4HTLA 4Z4EA 5EVZA 2UXDK 2ZF5O 3E9PA 1NK9A 2AP1A 3C6TA 2HHHK 3WXMB 3OYLA 4J2DA 3AO5A 3MWPA 2WBNA 4OKJA 4FK0A 2NRTA 1ZBSA 5GAGP 3CCJN 3UIQA 2VQFK 2IDOA 3H6EA 3ZSRA 3OYGA 2D0CA 3DLRA 4WFBL 3TR8A 3KLFA 4CJEA 4DTRA 1RCHA 3H1QA 3UKRA 3SLCA 1Z6RA 3E66A 3MWTA 3W3DA 1WN7A 3U3YA 3WNGA 1HPMA 3QLHA 2P5OA 2E2NA 3OYHA 3WXKA 4BR7A 2AA4A 4CGJA 1B9FA 1YIJN
chains in the Genus database with same CATH topology
4DUYK 4LF7K 4DR5K 4GKJK 4DV0K 4DV7K 4DV2K 1IBLK 1XMOK 4B3MK 4LF4K 4LFAK 4JI5K 1FJGK 4B3TK 4JI2K 3J81O 2E5LK 1J5EK 3J7YP 1XNRK 4JI6K 3T1YK 4JI0K 1XNQK 4DR6K 5AJ3K 2VQEK 4JI7K 4CW7B 5LMUK 4B3RK 5A2QO 4X66K 5FLXO 4V19S 4GKKK 4JI8K 4DR1K 4X64K 1HNWK 1XMQK 1IBKK 4X65K 4YHHK 4NXMK 4JI1K 5BR8K 4DV6K 1N33K 4DV4K 4DR4K 4JV5K 1N36K 2UU9K 2UUAK 4DV5K 2UXBK 1HNXK 4NXNK 5IWAK 1IBMK 2UXDK 4YY3K 4AQYK 4LF9K 4DR2K 2HHHK 4DR7K 3OTOK 1N34K 4X62K 2ZM6K 1I94K 4JYAK 3J80O 4LF6K 4OX9K 4K0KK 4DUZK 3JAMO 1N32K 4LF8K 4DR3K 2UUCK 4DV1K 3J7AP 2VQFK 1HR0K 4LFCK 5LL6Z 4LFBK 2UUBK 4KHPK 5IT9O 5LMNK 1HNZK 4B3SK 4DV3K 2UXCK 4CVNE 4JI3K 2F4VK 3T1HK 4JI4K 4LF5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY K;  4LF7 K;  4DR5 K;  4GKJ K;  4DV0 K;  4DV7 K;  4DV2 K;  1IBL K;  1XMO K;  4B3M K;  4LF4 K;  4LFA K;  4JI5 K;  1FJG K;  4B3T K;  4JI2 K;  3J81 O;  2E5L K;  1J5E K;  3J7Y P;  1XNR K;  4JI6 K;  3T1Y K;  4JI0 K;  1XNQ K;  4DR6 K;  5AJ3 K;  2VQE K;  4JI7 K;  4CW7 B;  5LMU K;  4B3R K;  5A2Q O;  4X66 K;  5FLX O;  4V19 S;  4GKK K;  4JI8 K;  4DR1 K;  4X64 K;  1HNW K;  1XMQ K;  1IBK K;  4X65 K;  4YHH K;  4NXM K;  4JI1 K;  5BR8 K;  4DV6 K;  1N33 K;  4DV4 K;  4DR4 K;  4JV5 K;  1N36 K;  2UU9 K;  2UUA K;  4DV5 K;  2UXB K;  1HNX K;  4NXN K;  5IWA K;  1IBM K;  2UXD K;  4YY3 K;  4AQY K;  4LF9 K;  4DR2 K;  2HHH K;  4DR7 K;  3OTO K;  1N34 K;  4X62 K;  2ZM6 K;  1I94 K;  4JYA K;  3J80 O;  4LF6 K;  4OX9 K;  4K0K K;  4DUZ K;  3JAM O;  1N32 K;  4LF8 K;  4DR3 K;  2UUC K;  4DV1 K;  3J7A P;  2VQF K;  1HR0 K;  4LFC K;  5LL6 Z;  4LFB K;  2UUB K;  4KHP K;  5IT9 O;  5LMN K;  1HNZ K;  4B3S K;  4DV3 K;  2UXC K;  4CVN E;  4JI3 K;  2F4V K;  3T1H K;  4JI4 K;  4LF5 K; 
#chains in the Genus database with same CATH topology
 3LM9 A;  5KQ8 A;  1BOT O;  3THY B;  4KHS A;  4LFA K;  4DB3 A;  3RR7 A;  2DY4 A;  2YJE A;  5KRS A;  4B3T K;  1S9G A;  2X6N A;  4YNQ A;  3OYF A;  3KZB A;  4FLT A;  3WXJ A;  3RSE A;  1Q18 A;  3K9K A;  4CIF A;  4CGD A;  3RMB A;  3ZSZ A;  4I9Q A;  3OYJ A;  4X66 K;  1YAG A;  4JI8 K;  3HK2 A;  1RDW X;  4CJV A;  4CES A;  3ZT1 A;  3VEN A;  2EHG A;  5B8H A;  1D4X A;  1S6P A;  2VGN A;  3CI5 A;  3L2R A;  2IVP A;  4RWT A;  5C24 A;  2WON A;  4O8U A;  4AHT A;  1SL2 A;  3DRR A;  1RT4 A;  4F3T A;  4CBU A;  3QEP A;  5AZI A;  3U6F A;  1NK0 A;  3OJS A;  2QK9 A;  3TI0 A;  1RNH A;  4A2A A;  5BN8 A;  4GV3 A;  3CMA N;  3OS2 A;  2HND A;  1HQE A;  2KFN A;  3P38 A;  4XH1 A;  5J1E A;  4KRF A;  1IG8 A;  1S22 A;  3P39 A;  4LF6 K;  3V1O A;  3M6G A;  3QER A;  5JIC A;  1HKC A;  2OPQ A;  3SAH A;  2P9L B;  4DR3 K;  1JLE A;  1D5A A;  2P9P B;  3J7A P;  4I9L A;  4DSE A;  1SAZ A;  1VQ8 N;  4CJU A;  3IG1 A;  3T1A A;  5AQG A;  3AA4 A;  4JEP A;  4QS8 A;  3SQ0 A;  5C2D A;  1ASU A;  1S5J A;  4B9N A;  2HBM A;  1ZBF A;  4CJQ A;  1XUP O;  3J8A A;  3O4Q A;  2X78 A;  3V81 A;  3EEQ A;  4FLZ A;  1GLB G;  2ZE2 A;  5JVG L;  2WC9 A;  2NRW A;  1N5Y A;  4B3O A;  1YUW A;  5C2F A;  3GOI A;  4CVN E;  1KCF A;  1JCG A;  4HUE A;  3IUC A;  4LF5 K;  3PX6 A;  3E9L A;  3ENH A;  1E3M A;  4DV7 K;  2JGU A;  4N56 A;  4H0O A;  5HLF A;  4FWK A;  3V6D A;  5KGX A;  1YHQ N;  4BRN A;  5AQY A;  4W5O A;  4DQP A;  4OGC A;  1FXX A;  3O08 A;  4DR6 K;  3O9R A;  1OH7 A;  3S3M A;  1VQN N;  4JKF A;  2O8E B;  1EQY A;  3AVL A;  4WE1 A;  5LMU K;  1X3M A;  3MAQ A;  1N8R O;  3I56 N;  4N76 A;  2A1S A;  4BRF A;  1XC3 A;  1FK9 A;  4HWI A;  2KTQ A;  3F73 A;  1IBK K;  4YHH K;  3THY A;  4FCY A;  1OVQ A;  3SAF A;  1CZ9 A;  4H5N A;  4J2A A;  4KO0 A;  3BZK A;  1MWM A;  3EL2 A;  1A5X A;  3O4W A;  2XY6 A;  2XY7 A;  4FVM A;  4KFB A;  2FBV A;  1K73 O;  4LH4 A;  1EWR A;  3EZ5 A;  2P9S B;  4IDK A;  1SV5 A;  1L3U A;  3WXL A;  1E4F T;  4DU1 A;  2HHS A;  2D4W A;  4O5F A;  1RDD A;  3DRP A;  1TAQ A;  3QIC A;  4DQI A;  3DYA A;  3N4Q A;  4WCE L;  1F21 A;  2E6L A;  4K41 A;  2IVO A;  2I7P A;  4CEF A;  3WT0 A;  4CF9 A;  4E1N A;  5BPN A;  1ILY A;  3SMP A;  2IAJ A;  1NGC A;  1NG9 A;  3L6Q A;  3H46 O;  3B6O A;  3TPQ A;  3GL1 A;  1NNE A;  2V7Z A;  2HMI A;  4CJS A;  3SQ2 A;  2UUB K;  4CZE A;  1S1W A;  5IT9 O;  2BTF A;  4JKB A;  2O4G A;  3SYZ A;  3SI6 A;  3VQ4 A;  1IO2 A;  5AQM A;  3E01 A;  4B1V A;  3SZ2 A;  4OLA A;  1JL1 A;  3CXC M;  3E9O A;  4CHY A;  2QWQ A;  1T6C A;  2NRZ A;  3DAW A;  4GKJ K;  1VQ7 N;  4DV0 K;  3ZX3 A;  1JLA A;  2P9L A;  1RBU A;  4HUF A;  1TKT A;  2P9P A;  4JI5 K;  3G10 A;  3AO2 A;  4BRI A;  4CZJ A;  2FBY A;  1IH7 A;  4ILG B;  4O8K A;  3CC2 N;  3VQQ A;  5F1X A;  3SV4 A;  2IOC A;  4C8M A;  3UB5 A;  1U6Z A;  4FJN A;  3DLL L;  3KIO A;  4CEA A;  2QM1 A;  3OJU A;  4NYN A;  3V9W A;  3V9X A;  1SL1 A;  3DLE A;  3O9U A;  4ISF A;  1K9M O;  3QET A;  1TV6 A;  3LAN A;  5F2R A;  5AQF A;  1Y97 A;  4CEE A;  1NWK A;  3RRH A;  3PX4 A;  4CHZ A;  1IV0 A;  3I55 N;  4CF2 A;  1JKH A;  4X65 K;  1RBV A;  4XIU A;  1T6D A;  4RW7 A;  3ZSX A;  4FOI A;  4EFH A;  1NKC A;  3EN9 A;  4H8K A;  4CER A;  5FRO A;  1J54 A;  1EET A;  2ASP A;  1WSI A;  5DMR A;  4DV5 K;  1LAW A;  4NYF A;  5C12 A;  4DSI A;  2O8E A;  3HPO A;  3NF8 A;  2KLA A;  5BPM A;  3VQD A;  3AVF A;  2A40 A;  3ALY A;  4DQR A;  3KK3 A;  2QXL A;  3VQ5 A;  3I8D A;  2GEM A;  3WNE A;  2ZJR L;  3SBT A;  2E2P A;  5KTQ A;  4HVJ A;  1ZBL A;  2D0P A;  3HST B;  3MX2 A;  4FJ9 A;  2FXU A;  2UYT A;  3EY1 A;  1FKP A;  4DV1 K;  4DSL A;  1VSI A;  4FJJ A;  4G9Z A;  5AQR A;  4IO9 L;  1RBS A;  2P9S A;  2R7Y A;  1CLQ A;  2Q3S A;  2G8I A;  3HTV A;  3SMS A;  5C42 A;  4TSX A;  1HUX A;  4BE0 A;  1UOC A;  1NMD A;  3VEO A;  3P31 A;  4F9O A;  2UXC K;  4QS7 A;  4FLW A;  3CCE N;  2ETJ A;  2VCP A;  3EE9 A;  4IEI A;  3HSC A;  4BVP A;  3L0Q A;  4OPK A;  4M7Y A;  4CZL A;  2KZZ A;  3NF7 A;  1TUU A;  2ITM A;  5MLC Q;  4A2B A;  2OYQ A;  1S72 N;  4DF8 A;  5FPN A;  3W0L A;  4N5S A;  3SPY A;  3ASM A;  1LW2 A;  4JI6 K;  2P9K B;  5CY4 A;  1YIT N;  5ADX H;  1YXQ A;  5M1O A;  3L4I A;  2VQE K;  2O4I A;  1VQL N;  4FM1 A;  3HBT A;  4FZX C;  1YJN N;  4FYD A;  1B92 A;  5M1N A;  4CHP A;  3O9T A;  4WQ4 A;  3GDQ A;  5BRD A;  3QEI A;  1S1T A;  4YOT A;  1DT9 A;  3NCI A;  1KVB A;  2O8B B;  4FJM A;  5HBM A;  4FK2 A;  5BRF A;  2PZS A;  4BAC A;  1MWK A;  5BR8 K;  2BUP A;  2VWJ A;  1N33 K;  3WNF A;  5AZJ B;  4MFB A;  3IMX A;  1JXB A;  4HCB A;  2DFE A;  2NUB A;  4DV4 K;  2HHQ A;  4DR4 K;  1RT6 A;  5AQH A;  4BRD A;  3CQX A;  2HNY A;  4KH5 A;  3GG4 A;  4CEO A;  3N4P A;  4UY8 O;  1L3T A;  4FWQ A;  3HL8 A;  5GAD P;  3RMD A;  5ADX A;  4OKK A;  4O44 A;  3ULD A;  2BH1 A;  1ZBH A;  2ZM6 K;  1C0M A;  4BRE A;  1TL1 A;  3F5T A;  1QQC A;  5SWM A;  4AHU A;  4KH4 A;  4EHT A;  3G6E N;  2HBL A;  4CFA A;  3OYK A;  3O8M A;  3VES A;  3DWL A;  4O55 A;  5HRO A;  3IS9 A;  3THX A;  4EZ6 A;  4ID5 A;  3CQ8 A;  5LL6 Z;  3K57 A;  2G8W A;  1DGK N;  5JMV A;  3HVT A;  2JWL A;  5HOO A;  4KHN A;  5LMN K;  2RN2 A;  2YNI A;  4M3Z A;  3A5O C;  3RR8 A;  3JYT A;  2LSN A;  3IKM A;  1JL2 A;  2HBJ A;  1K8A O;  3OBW A;  4CF8 A;  4DFM A;  4C8K A;  2RHK A;  3M8R A;  1BIU A;  1JLG A;  3RMA A;  4KHQ A;  1SL0 A;  4JHD B;  3O1B A;  5HRR A;  1JXE A;  3NVK A;  3BGR A;  2GV9 A;  3C94 A;  1JLB A;  3M3Z A;  2V52 B;  3VQ9 A;  4JI0 K;  4H5R A;  3GE1 A;  3NH1 A;  2P9N B;  4CFC A;  4CIG A;  1T03 A;  3NGY A;  3DLB A;  2P5G A;  3WEE B;  4DTU A;  3RTV A;  2YNG A;  1K8K A;  1C1C A;  4DR1 K;  5AQV A;  3PX0 A;  2O8C B;  1KVC A;  3NMU A;  3A8Y A;  4GY2 B;  1XMQ K;  1B9D A;  4Z0U A;  3VET A;  2O8F B;  5E84 A;  4R79 A;  1TKZ A;  3A2F A;  2E2O A;  1W0H A;  3CCM N;  5FRN A;  1BO5 O;  3NF9 A;  2YHX A;  4JK9 A;  4BRP A;  2OAN A;  4OPH A;  3PO5 A;  3AVG A;  1VSH A;  2UU9 K;  2P9K A;  1U47 A;  4JNE A;  1MU2 A;  1VK0 A;  1WAF A;  3SBG A;  3DI6 A;  4DU4 A;  1NOZ A;  4KB0 A;  5CE3 A;  1Q7Y O;  3ZT4 A;  3L2V A;  1Z05 A;  3S3O A;  3O6W A;  3OBY A;  4GNI A;  1HYZ A;  5FPM A;  2O8B A;  4CEB A;  3SAG A;  1KXP A;  3S9H A;  4CJ5 A;  1ATR A;  3NFA A;  2FSJ A;  5AFU H;  3A5L C;  4QAG A;  5AZJ A;  4E7I A;  4DUZ K;  4BRO A;  4DSF A;  2CH5 A;  1N32 K;  3MEG A;  3OYM A;  2FSK A;  3C65 A;  1NGD A;  2NNW A;  3SUQ A;  3AVC A;  3CFO A;  3SCX A;  1P8Z A;  4E1M A;  1W7A A;  3C0B A;  3FE1 A;  3I0S A;  3JSM A;  1RTJ A;  4QOZ B;  4K25 A;  4FLX A;  4CJP A;  4KH6 A;  3ZCM A;  3AVI A;  4BRQ A;  4CEC A;  4WFN L;  3KK2 A;  1QS4 A;  4WQ5 C;  1NGG A;  3VEY A;  5HRN A;  1T3V A;  4LY7 A;  1WSE A;  3OS0 A;  1LOT B;  4DV2 K;  3K5N A;  2OPP A;  3DLG A;  1WSF A;  3EKS A;  1FJG K;  5AFU A;  4DLG A;  4PA1 A;  4DQ8 A;  4BR0 A;  1QSS A;  3IAY A;  3NF6 A;  1J53 A;  4CJW A;  3J7Y P;  2E5L K;  3AV9 A;  2Q1N A;  1KAX A;  1MDU B;  2GX9 A;  1RT3 A;  1KRP A;  2YHA A;  4FLV A;  4EIA A;  1GLA G;  1VSF A;  3CIP A;  4OKE A;  3OA9 A;  4V19 S;  1YVU A;  4A57 A;  4IOC L;  4H5W A;  4JS4 A;  4CZH A;  4NB4 A;  4NCB A;  3CCL N;  1KQS M;  3VQB A;  4FVU A;  4FWN A;  1SQK A;  1LCU A;  1EWQ A;  4NXM K;  3OYD A;  2QWO A;  3I8B A;  4AHR A;  4JHD A;  4CZF A;  2ZGZ A;  4FLU A;  1RIL A;  3FZK A;  3UKU B;  4BG9 A;  4GW6 A;  1I3A A;  4YOR A;  1WB9 A;  2P9N A;  3BUZ B;  3H45 C;  3VA3 A;  1Z26 A;  3VTI A;  3LDO A;  4CZG A;  4C8L A;  4CGH A;  1HRH A;  2X6S A;  3OYN A;  5DK5 A;  4AQY K;  1HJR A;  1MA9 B;  2KFZ A;  1T44 A;  3IDH A;  4M3T A;  3TTF A;  3CCV N;  4DR7 K;  4IFY A;  3OYB A;  2O8F A;  5C15 A;  4E3S A;  4FJK A;  3JAM O;  1ZBI A;  4FM2 A;  3PO4 A;  3HI0 A;  4H4O A;  3K9J A;  4B08 A;  3PIP L;  2NZT A;  4KTZ A;  3ID8 A;  4ISE A;  1HYS A;  5BR9 A;  3LDL A;  3U9D A;  5D3G A;  4N41 A;  4FJH A;  1KSP A;  3M1F A;  3LDQ A;  4H03 B;  3AAR A;  1TYQ B;  2WOM A;  4FLY A;  4E0D A;  4KHP K;  4F8R A;  1HPZ A;  2YKM A;  1HNZ K;  5M1Q A;  4B3S K;  2I5J A;  4M3Y A;  3MN6 A;  3T19 A;  2ASO A;  1KLM A;  1IKW A;  4JK8 A;  3K0S A;  1QQN A;  2HHU A;  4DR5 K;  1IKV A;  4KI4 A;  1I39 A;  1XMO K;  1Q9Y A;  2O8D A;  5KPR A;  4ELU A;  3CQY A;  4E7L A;  2A5X A;  2A42 A;  2KZM A;  4J2E A;  2YX6 A;  3LZJ A;  2ZWH A;  4CEQ A;  3KHY A;  4AIL C;  5AQW A;  4HHT A;  2ASM A;  3CCR N;  1UWB A;  3SQ1 A;  4YDU A;  3QEV A;  4Z4G A;  3VOV A;  2HST A;  5AR0 A;  3AA5 X;  4A62 A;  4DSK A;  2OA8 A;  4FWS A;  2ZJP L;  3R9P A;  4I2P A;  2HMP A;  3CF5 L;  1JCE A;  4PKG A;  1YVN A;  4CF0 A;  1IG9 A;  3P1G A;  3VQ8 A;  4BRG A;  3KLH A;  4CZK A;  4ELV A;  3AO3 A;  4A5B A;  3OYE A;  1P90 A;  5J2N A;  3K2P A;  2QWN A;  4BWJ A;  2Z1J A;  2FF6 A;  4IOX A;  2DTU A;  3WUH A;  3T69 A;  4CCH A;  4JK7 A;  5SZT A;  2UXB K;  4KTQ A;  5HRS A;  4CBX A;  1X3N A;  4HCC A;  2GWJ A;  1E4G T;  3WXI A;  4Z4F A;  1VQP N;  1HLU A;  1GOB A;  4Q0B A;  4B1U B;  3MEC A;  1EX4 A;  1YJ9 N;  1QVF M;  3OTO K;  3C7N B;  3B6P A;  1I94 K;  1HMV A;  3J80 O;  4M41 A;  4DWI A;  3K5O A;  2P1J A;  2V7Y A;  3UKU A;  3DLK A;  1D9F A;  3LAK A;  4KHU A;  1CXU A;  5ELZ A;  5AQQ A;  4BRL A;  5HL7 L;  2FF3 B;  4WYB A;  4H0T B;  4LFB K;  2Q2R A;  3HM9 A;  3ATU A;  4FM0 A;  4DCH A;  3AVJ A;  1NGF A;  4AM7 A;  4OPA A;  4WF9 L;  2ZJQ L;  1HNV A;  1WSG A;  4DV3 K;  3PSF A;  4CGG A;  2F4V K;  2YHY A;  3LPT A;  4BC4 A;  1OKJ A;  4XEI A;  3MCP A;  5AQJ A;  4LF7 K;  3ZSY A;  4PY5 A;  3VEZ A;  3EE8 A;  4FWP A;  4LSL A;  4PKH A;  1C1B A;  3OHR A;  4RW4 A;  5EXW A;  3ID6 A;  4DTM A;  3J81 O;  5J2P A;  2RE2 A;  1W2B M;  2ITG A;  4FK4 A;  1J5O A;  4M3X A;  2VGM A;  1UA0 A;  4DTN A;  3JXU A;  3K5L A;  2XRI A;  4F2R A;  4CW7 B;  1BG3 A;  3HP9 A;  3SJJ A;  5A2Q O;  4YOV A;  4IKF A;  2XO7 A;  2OCE A;  2F7T A;  1VSL A;  2IIR A;  3ZLJ A;  4IJA A;  2F9T A;  5GIN A;  3SV3 A;  3LDN A;  1HNW K;  4NCG A;  1QHT A;  3G25 A;  5H1S Q;  3D7E O;  3G71 N;  1BIZ A;  4CJ7 A;  1VHX A;  3L3U A;  4H0Y B;  4CK2 A;  4OLB A;  4KTW A;  4DSJ A;  1HKB A;  5I42 A;  2UUA K;  5JLH A;  2Q36 A;  3AA3 A;  1HX1 A;  5IWA K;  5AQO A;  2VG5 A;  3QIO A;  4CBW A;  1K6Y A;  2GUP A;  1VQ5 N;  4ID1 A;  4LF9 K;  5FPE A;  3C6H A;  2B5J A;  1WOQ A;  5GIP A;  3MMV A;  2HHX A;  3THW B;  4U7B A;  2VYP A;  3CM5 A;  3DM2 A;  3ENB A;  4M3W A;  3LDS A;  4F2S A;  2D0B A;  1BA0 A;  4O5B A;  3QNN A;  3ZET B;  3F9K A;  4IG0 A;  4AH9 A;  3SK3 A;  4DMN A;  1GLE G;  3K5M A;  4LFC K;  4W5T A;  4BC3 A;  1NJI O;  1UAX A;  4YOY A;  2YJF A;  4BR9 A;  1D9D A;  4IEE A;  2PFU A;  1O13 A;  3R8E A;  4DS5 A;  3AY9 A;  1KD1 O;  2HHW A;  2VG7 A;  3TAG A;  3H3O B;  4O0J A;  1DLO A;  3CJB A;  4CHQ A;  3VF2 A;  5I3U A;  3MX5 A;  1OH8 A;  3CJC A;  4I6M B;  1HJO A;  5DM7 L;  1WSH A;  2XY8 A;  4PHT X;  3VGK A;  4CD3 A;  3RRG A;  5AQS A;  2Q31 A;  2QXF A;  1BL3 A;  2KHO A;  4CEZ A;  4CK3 A;  4FJI A;  2NRV A;  3O5B A;  4IOA L;  1NGJ A;  1REV A;  3T3F A;  3KK7 A;  4JI2 K;  2OTL N;  3D2F B;  1KAZ A;  4MO5 A;  3MXM A;  5M1K A;  1QZ6 A;  2Q0R A;  5GAH P;  4IFE A;  4KI6 A;  4E1J A;  3PUF A;  1SUQ A;  1SS6 A;  2QW9 A;  1FW6 A;  3THV A;  2D1K A;  2QWM A;  3ZEU B;  5K14 A;  3TTD A;  4DQQ A;  4GKK K;  1KAY A;  4BE1 A;  5E26 A;  2JLE A;  1U48 A;  3HOS A;  3DXM B;  2BDP A;  2HHV A;  4YOW A;  1OH6 A;  4KRE A;  1NOY A;  3ISN C;  5C25 A;  1TK0 A;  4JRP A;  3MDQ A;  3M8P A;  4KBO A;  1FKO A;  4MQ3 A;  1T05 A;  2WUS A;  4B8C A;  4H5V A;  4MDB A;  2F8T A;  3FR0 A;  1NM1 A;  1IBM K;  3T7Z A;  4DR2 K;  3L2W A;  3VTH A;  5LJV A;  1TGO A;  2G8H A;  4HUG A;  3QIP A;  4YFU A;  1D8Y A;  4O0I A;  2G8U A;  4DQS A;  1ZC6 A;  1DTQ A;  3KJV A;  3S41 A;  5KPZ A;  1G99 A;  4CF1 A;  1X9J A;  3A5M C;  1CZB A;  4MLH A;  3HO1 A;  1BQN A;  4RW6 A;  4C8O A;  2P9I B;  2F96 A;  2QI2 A;  3E1Y A;  4FOE A;  1LWC A;  3LZI A;  2YI1 A;  1NGI A;  4C1N I;  1TKD A;  4FPA A;  3NE6 A;  1RTI A;  4M42 A;  2HB5 A;  3CET A;  3FZM A;  3TAE A;  3OW2 M;  3U4L A;  2JWK A;  1C6V A;  5CZ1 A;  2OZS A;  2HF3 A;  1C0U A;  3CCU N;  3NAE A;  3F9M A;  1WBD A;  1NMN A;  2EX3 A;  4F3O A;  1RDA A;  1JLQ A;  3P83 D;  1C0T A;  4BDP A;  1U4B A;  3A5N C;  1LV5 A;  4EZ9 A;  1S1U A;  3SJH A;  2QWR A;  1NBW A;  4PUO A;  4B3R K;  3K59 A;  3CCQ N;  4XH5 A;  4IZ9 A;  4I6M A;  1GLJ O;  4H5T A;  3BDP A;  4B1Y B;  4B9S A;  3TAN A;  4M3R A;  4DTO A;  1S1V A;  2AJQ A;  4ILH A;  3UKR B;  3LDP A;  5BRE A;  3FZH A;  3ENO A;  3MCA B;  5KI6 A;  4DKW A;  1KFS A;  1JLF A;  3DOK A;  3D2F A;  3DXK B;  4CI6 A;  4FWL A;  2IS3 A;  3U3G A;  1XHX A;  4JV5 K;  2P51 A;  5J2M A;  2KKZ A;  5C0Y A;  4JKG B;  3RVC A;  4CJK A;  3ZEU A;  5AQN A;  3ZX2 A;  2FLO A;  4B9U A;  3RSE B;  5C10 A;  4KV8 A;  4MO4 A;  3P4I A;  4FZY A;  4ZHR A;  3DXM A;  1VQ6 N;  2VG6 A;  2NRX A;  1NJX A;  3Q7C A;  3KD5 E;  3TAR A;  1VQO N;  4WFA L;  4FW2 A;  4OX9 K;  1RBR A;  3HZ6 A;  2CGK A;  4YOU A;  5CR4 A;  3CFR A;  2YV0 X;  4OVL A;  1UA1 A;  4BDY A;  3VGL A;  4BGB A;  3CJ9 A;  3C6A A;  3VGM A;  3ZSQ A;  2PYL A;  1A5V A;  3EO3 A;  1NKE A;  3O1W A;  4H0P A;  4BVO A;  4ZTJ A;  4GMJ B;  4B8A B;  3ULE B;  5KQD A;  2ZD1 A;  2PYJ A;  3NBP A;  3U8X A;  4KAZ A;  4ILJ A;  2Y1J A;  3M8Q A;  4A61 A;  5AQZ A;  4BWM A;  4CGF A;  2FC0 A;  3AVB A;  5KRT A;  4O4G A;  2GBZ A;  4PL8 A;  3FZF A;  4CJT A;  3TAB A;  3MK6 A;  4FL9 A;  3CME N;  1JLC A;  4CJ3 A;  4K42 A;  4CE9 A;  2P9I A;  3VQ6 A;  1VQM N;  4FJL A;  4FJX A;  1NK4 A;  1QVG M;  3AVH A;  3QFP A;  3QDK A;  1NLV A;  5CZ2 A;  3NGZ A;  3FFK B;  2QWL A;  3A0I X;  2YHW A;  4PKI A;  3MXI A;  4W5R A;  4JD2 B;  4K8Z A;  1BGX T;  3VQP A;  2RF2 A;  1IKX A;  3AVA A;  5EOY A;  4BC5 A;  1KC8 O;  4CED A;  3AO1 A;  1J9A A;  1RT5 A;  3OYC A;  1LAV A;  4PWD A;  4FPB A;  4DG1 A;  2HF4 A;  4KHY A;  1ATS A;  3WQT A;  3FLC O;  3ATV A;  4NO7 A;  1NJZ A;  4LD0 A;  3ZSW A;  4OO1 J;  3R1X A;  4EHU A;  3S3N A;  1CXQ A;  5BN9 A;  2W42 A;  3DMJ A;  3LL3 A;  5T7B A;  2YNH A;  3IFR A;  3QES A;  3FZL A;  1VSD A;  4C23 A;  1BIS A;  1WAJ A;  3ZSV A;  1QTM A;  1EO1 A;  4M7X A;  3U9Z A;  4X62 K;  4JYA K;  4Y1C A;  2G8V A;  3NDK A;  4IDH A;  4CD1 A;  1RBT A;  3DXK A;  1QSY A;  2Q97 A;  2Z1G A;  1N6Q A;  4M3U A;  2UUC K;  5AQL A;  3CM6 A;  1S9E A;  5GAE P;  4C8N A;  4JKG A;  4BRM A;  3WEE A;  4DTS A;  1XHZ A;  3CC4 N;  3ZYY X;  3VF4 A;  2HBK A;  2A3Z A;  4RW8 A;  4W5N A;  2KW4 A;  3AO4 A;  2O8C A;  3KVG A;  3OY9 A;  1RFQ A;  4KKO A;  5KGW A;  1ATN A;  1BQM A;  3V9S A;  3JS6 A;  3CJA A;  1SKR A;  4RG8 A;  4CZI A;  3VMF B;  2V51 B;  3CER A;  3VA0 A;  3BP8 A;  1LWE A;  3KWG A;  1X9S A;  1IBL K;  4JKD A;  2W41 A;  4B3M K;  4N47 A;  4BQZ A;  3QFU A;  3BF1 A;  4IBN A;  5KPT A;  2E88 A;  1ASW A;  3HOT A;  4RW9 A;  4Z4I A;  3HJF A;  1J5E K;  1BU6 O;  2X74 A;  3VQC A;  4AHS A;  2GUI A;  3CHW A;  1SKS A;  1KVA A;  2A6A A;  3ULE A;  3M5R A;  2QKK A;  1VSK A;  3BZC A;  1L5U A;  1L3S A;  3TWH A;  3O9Q A;  3PIO L;  3AVM A;  2A41 A;  4FXD A;  1RDU A;  4FJ7 A;  3MN9 A;  4DHY A;  3MN7 A;  3Q7B A;  1NK7 A;  2CGJ A;  3H08 A;  1NU0 A;  1XQS C;  3HYF A;  1BCO A;  3QML A;  1GOC A;  1TUY A;  2VWK A;  3CC7 N;  4CJR A;  1VQK N;  3P5J A;  4G1Q A;  4KB1 A;  2Z1H A;  3AVN A;  4DS4 A;  3O9S A;  1S3X A;  2ZQB A;  5EY4 A;  4M45 A;  1WLJ A;  1LWF A;  4NXN K;  4L8R B;  4EAH D;  4B9L A;  1U2V B;  3O4N A;  4JD2 A;  3CFP A;  4QS9 A;  4OPJ A;  1LW0 A;  1TVR A;  3CYM A;  4JKE A;  3VN5 A;  5I9E B;  2ATQ A;  4KHW A;  4CHN A;  3VEV A;  3L2U A;  1N34 K;  4BRA A;  2VWB A;  3TAF A;  3KWI A;  1S1X A;  3UE5 A;  3HP6 A;  1BA1 A;  3B8A X;  3AGK A;  1WSJ A;  4LC9 B;  4WQ4 C;  3CG7 A;  3J7Z O;  4B9T A;  3QNO A;  4BDZ A;  1HR0 K;  3MED A;  2GEL A;  3KK1 A;  2P9U B;  3CCS N;  4CK1 A;  5HP1 A;  5J2Q A;  1C0F A;  3KLG A;  1ITG A;  4E7H A;  3C6U A;  1NK8 A;  1Q86 O;  2NLX A;  3TSQ A;  1Q81 O;  4IJN A;  3OVN A;  4B1W B;  3FGU A;  1RDB A;  4FWR A;  1RT7 A;  3DOL A;  4E19 A;  2QKB A;  5LY3 A;  5CYQ A;  5M1F A;  3TTC A;  3DRS A;  3V9Z A;  1EP4 A;  3MEE A;  3GBT A;  1QE1 A;  4E89 A;  4C1N K;  1VSE A;  2A1R A;  3NH0 A;  4UQG A;  4RCH A;  1QSL A;  5AJ3 K;  3QB0 A;  3WQU A;  1KTQ A;  4YOX A;  5AQK A;  2Y1I A;  3HM8 A;  5FDL A;  4B1Z A;  3L4Q A;  2G8K A;  4FJG A;  2HOE A;  3D0P A;  3VF6 A;  3KLE A;  3D2E B;  3F2K A;  4H0X B;  3EKU A;  1RT2 A;  3EYZ A;  1C1A A;  4OJR A;  1QQM A;  2J4R A;  4BC2 A;  3HXM A;  4JRQ A;  1TYQ A;  3ZT0 A;  2OZM A;  2DFF A;  4PL7 A;  2GTD A;  3DLH A;  1TK5 A;  1BDG A;  3ZSO A;  5FPD A;  1RGI A;  2H3G X;  3V1Q A;  2BGG A;  2I7N A;  3VQ7 A;  2Z1I A;  1RTD A;  4ELT A;  2PBD A;  2E20 A;  2OTJ N;  2QTD A;  4BQL A;  1BWF O;  4WQ5 A;  5AQX A;  4BE2 A;  2QA4 N;  2E4L A;  4AF1 A;  4YY3 K;  1YF5 L;  5GIO A;  5BPL A;  3V4I A;  3AAP A;  3NGI A;  2W40 A;  2NRR A;  4KPY A;  3LP2 A;  4JKH A;  1EXQ A;  1Q8I A;  1O1W A;  3L8B A;  3RWU A;  1BCM A;  4JKC A;  4FWM A;  4K0K K;  3M8S A;  2RPI A;  3TSP A;  4Z94 A;  3V1R A;  4DLE A;  1HNI A;  2E6M A;  1YJW N;  2DPN A;  4IG3 A;  4Q5V A;  3HPG A;  4BR2 A;  4DFJ A;  1U2V A;  4DTJ A;  2W6L A;  2WTU A;  1IKY A;  1W9H A;  1HKG A;  3SUO A;  4IFV A;  1YTA A;  3G4S N;  2HW3 A;  1IJJ A;  1OVY A;  3LP0 A;  3I33 A;  5JS1 A;  4E7K A;  1ASV A;  4JI4 K;  1VAZ A;  2WFB A;  3CJ1 A;  4CZM A;  1CZA N;  3O3G A;  3KTQ A;  1BHL A;  3DJC A;  3LWL A;  2FBX A;  4CJL A;  3CPE A;  1NK6 A;  4L3Q A;  3HVR A;  4U67 L;  2P9U A;  2QEX N;  4OGE A;  1VSJ A;  4ISG A;  1GOA A;  3VEX A;  3QBW A;  4BGA A;  4A59 A;  5AQI A;  3PV8 A;  1XNR K;  2E8A A;  1DTT A;  1ZBU A;  3C7N A;  3K58 A;  3THX B;  2FSN A;  1DEJ A;  3AA2 A;  5FLX O;  1VRU A;  1R0A A;  2D5R A;  4K43 A;  4MDA A;  3D6R A;  3BF3 A;  4X64 K;  1U04 A;  1M90 O;  3R3L A;  1T7P A;  4B1X B;  3LP1 A;  1SZ2 A;  3RMC A;  3TAM A;  1T8E A;  4J2B A;  1S6Q A;  4M63 C;  4LH5 A;  1HYV A;  1NKB A;  2XHB A;  4DFK A;  3D45 A;  1V4T A;  5JLF A;  5HRP A;  1M1K O;  1GLD G;  2YCH A;  3MN5 A;  2CH6 A;  4FZZ A;  2B6A A;  3L2Q A;  3HPH A;  1RDC A;  3LWM A;  5CHI A;  4B9Q A;  4JAX A;  3TAP A;  1WNS A;  4EP5 A;  3D2E A;  4CJ4 A;  4CFB A;  1QQO A;  1X9M A;  1QZ5 A;  3CPW M;  2FBT A;  4RTF D;  4JS5 A;  3SUN A;  4JKA A;  1DKG D;  2E1Y A;  4W5Q A;  4FJ5 A;  4Z4C A;  1K8K B;  4BRC A;  4JLH A;  4BY9 C;  4HTU A;  1Q82 O;  4XH4 A;  1Y64 A;  2PAV A;  5EX5 A;  3LM2 A;  4DU3 A;  3ZT3 A;  1GLL O;  4BR5 A;  1L3V A;  1Q9X A;  3BEX A;  3VQA A;  1KLN A;  1VQ4 N;  1VQ9 N;  1KFD A;  1J6Z A;  1NGB A;  5CYM A;  4ICL A;  3PSI A;  3AAQ A;  2F8S A;  2B4J A;  4AM6 A;  4FSV A;  4IXC A;  2RKI A;  3ITH A;  2BE2 A;  2CGL A;  1Z25 A;  2W6K A;  4JI3 K;  3VQE A;  1NGH A;  5JS2 A;  5BRH A;  1H1V A;  4I2Q A;  2DFH A;  3H1V X;  1ESV A;  2ZGY A;  4LSN A;  1JCF A;  4MLE A;  5FRM A;  1C0G A;  2HHT A;  4NLB A;  4LF4 K;  4JN4 A;  3O3F A;  4CJF A;  2HVI A;  2YKN A;  4GV6 A;  1YT3 A;  1W97 L;  4B9M A;  1XNQ K;  1BI4 B;  3THW A;  1QHA A;  2E1Z A;  4CFD A;  4BG8 A;  2E2Q A;  4B9V A;  5AQP A;  1ZXO A;  3LAM A;  3V9U A;  1GLF O;  2PY5 A;  3CD6 N;  5M1P A;  3AVK A;  2IC3 A;  3ZET A;  3NH2 A;  1A5W A;  4F4K A;  4PQU A;  4J8F A;  3AGR A;  5JVH L;  4K8X A;  4H0V B;  4JI1 K;  3SPZ A;  1XWL A;  3SUP A;  4I7F A;  4CIE A;  1V4S A;  2HVH A;  5TKY A;  1N36 K;  2OPS A;  3CJ7 A;  4IWV A;  1BUP A;  5F0X A;  3HRG A;  3TAQ A;  3KKS A;  2D0O A;  3KD1 E;  1XC9 A;  4FWO A;  4FJ8 A;  3QBX A;  3SNN A;  3O3H A;  1JJ2 M;  1VRT A;  3PLA A;  3NHG A;  3NVM A;  4Z4H A;  2G8F A;  4AHC A;  3O80 A;  5TKW A;  3QIN A;  5AQT A;  4Y0W A;  3HT3 A;  1G15 A;  4YDU C;  4DFP A;  4CGI A;  1NJW A;  1VSM A;  2IVN A;  4LF8 K;  4E7J A;  5AQU A;  2KQ2 A;  3LAL A;  4DTX A;  3G0Z A;  3I0R A;  4FW1 A;  3SQ4 A;  3L3V A;  3R6M A;  3ZX0 A;  1YI2 N;  1TL3 A;  3C95 A;  4H4M A;  1ZYQ A;  3OYI A;  3KLI A;  4GVM A;  2BAN A;  4ZTF A;  3IRX A;  3VPZ A;  1HQU A;  4GV9 A;  5EU7 A;  2OPR A;  1WBB A;  2IGI A;  3QO9 A;  1EKE A;  1NGA A;  4IO8 A;  3TSU A;  1TKX A;  3VER A;  1TK8 A;  3QEX A;  2EWS A;  1R59 O;  3T1H K;  4AHV A;  4DUY K;  4BR4 A;  2GWK A;  3WNH A;  3ZT2 A;  3BY5 A;  1SKW A;  2XY5 A;  3PY8 A;  5LJW A;  4DF4 A;  3OYA A;  1YTU A;  3EZW A;  2F9W A;  3TU5 A;  5E41 A;  1RTH A;  3T1Y K;  1U49 A;  5AZI B;  4FO0 A;  4DTP A;  4NCA A;  3MXJ A;  1X1P A;  2YNF A;  4JI7 K;  3LPU A;  3FFI A;  1TAU A;  1GLC G;  2QWP A;  3VEW A;  4R5P A;  3KKR A;  4QCL A;  4GVE A;  3H3N O;  2Q0U A;  1NK5 A;  4DV6 K;  3QEW A;  4NLC A;  5DM6 L;  1XI1 A;  3LP3 A;  1U45 A;  1NGE A;  4EP4 A;  2YHB A;  2NRH A;  4BRK A;  4A5A A;  1X9W A;  1OH5 A;  4BRH A;  4Y1D A;  2O8D B;  2D0A A;  2HNZ A;  1BI4 A;  1RT1 A;  1HNX K;  1NJY A;  3OS1 A;  1WUA A;  4CHO A;  4HTL A;  4Z4E A;  5EVZ A;  2UXD K;  2ZF5 O;  3E9P A;  1NK9 A;  2AP1 A;  3C6T A;  2HHH K;  3WXM B;  3OYL A;  4J2D A;  3AO5 A;  3MWP A;  2WBN A;  4OKJ A;  4FK0 A;  2NRT A;  1ZBS A;  5GAG P;  3CCJ N;  3UIQ A;  2VQF K;  2IDO A;  3H6E A;  3ZSR A;  3OYG A;  2D0C A;  3DLR A;  4WFB L;  3TR8 A;  3KLF A;  4CJE A;  4DTR A;  1RCH A;  3H1Q A;  3UKR A;  3SLC A;  1Z6R A;  3E66 A;  3MWT A;  3W3D A;  1WN7 A;  3U3Y A;  3WNG A;  1HPM A;  3QLH A;  2P5O A;  2E2N A;  3OYH A;  3WXK A;  4BR7 A;  2AA4 A;  4CGJ A;  1B9F A;  1YIJ N; 
#chains in the Genus database with same CATH homology
 4DUY K;  4LF7 K;  4DR5 K;  4GKJ K;  4DV0 K;  4DV7 K;  4DV2 K;  1IBL K;  1XMO K;  4B3M K;  4LF4 K;  4LFA K;  4JI5 K;  1FJG K;  4B3T K;  4JI2 K;  3J81 O;  2E5L K;  1J5E K;  3J7Y P;  1XNR K;  4JI6 K;  3T1Y K;  4JI0 K;  1XNQ K;  4DR6 K;  5AJ3 K;  2VQE K;  4JI7 K;  4CW7 B;  5LMU K;  4B3R K;  5A2Q O;  4X66 K;  5FLX O;  4V19 S;  4GKK K;  4JI8 K;  4DR1 K;  4X64 K;  1HNW K;  1XMQ K;  1IBK K;  4X65 K;  4YHH K;  4NXM K;  4JI1 K;  5BR8 K;  4DV6 K;  1N33 K;  4DV4 K;  4DR4 K;  4JV5 K;  1N36 K;  2UU9 K;  2UUA K;  4DV5 K;  2UXB K;  1HNX K;  4NXN K;  5IWA K;  1IBM K;  2UXD K;  4YY3 K;  4AQY K;  4LF9 K;  4DR2 K;  2HHH K;  4DR7 K;  3OTO K;  1N34 K;  4X62 K;  2ZM6 K;  1I94 K;  4JYA K;  3J80 O;  4LF6 K;  4OX9 K;  4K0K K;  4DUZ K;  3JAM O;  1N32 K;  4LF8 K;  4DR3 K;  2UUC K;  4DV1 K;  3J7A P;  2VQF K;  1HR0 K;  4LFC K;  5LL6 Z;  4LFB K;  2UUB K;  4KHP K;  5IT9 O;  5LMN K;  1HNZ K;  4B3S K;  4DV3 K;  2UXC K;  4CVN E;  4JI3 K;  2F4V K;  3T1H K;  4JI4 K;  4LF5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...