4JI4K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji4K00
4JYAK 4DR6K 2UUBK 4B3SK 4B3MK 4KHPK 3J7AP 4JI4K 4DR2K 4JI5K 1N34K 4JV5K 2UXBK 4AQYK 4NXNK 4X65K 1HNWK 4YY3K 3J81O 4JI2K 1I94K 3JAMO 4DR4K 4LF7K 4DV5K 2UUAK 4NXMK 5A2QO 4LFAK 4JI6K 1HR0K 4OX9K 4DV0K 4JI1K 1IBLK 4GKKK 4LF5K 4DR1K 1XNQK 4DR5K 1N36K 2UU9K 4GKJK 2UUCK 4JI8K 5LL6Z 5IT9O 5IWAK 4YHHK 4CVNE 4DV1K 1XMOK 4LF6K 4DV7K 5FLXO 2UXDK 4X62K 5LMUK 5AJ3K 1J5EK 4X64K 3J7YP 4DR7K 3T1HK 1IBMK 4DV3K 4B3TK 3J80O 4X66K 1HNZK 1FJGK 1N32K 4CW7B 5BR8K 2E5LK 2VQEK 4DV4K 4JI0K 2VQFK 4LF8K 4DV2K 4LF4K 5LMNK 4LFBK 4LF9K 4JI3K 4K0KK 4DR3K 4JI7K 1HNXK 1N33K 1IBKK 4DUZK 4V19S 1XMQK 3OTOK 2ZM6K 3T1YK 4LFCK 1XNRK 4B3RK 4DV6K 2HHHK 2UXCK 2F4VK 4DUYK
chains in the Genus database with same CATH superfamily
2PZSA 3MWPA 2UUBK 4YDUC 3HPOA 4PHTX 2QWQA 4DWIA 3ZLJA 2FBXA 1IO2A 3E01A 3WXJA 2ZJPL 4DFPA 4G1QA 2YCHA 4DQPA 1NJIO 3M8SA 4AQYK 3IKMA 4BR7A 4DF8A 1NMNA 1VK0A 5J2QA 3P5JA 2P9KB 3H3OB 3AVGA 3UKUB 5AFUA 5BRFA 2A5XA 4NXMK 1TAUA 1N8RO 3SUOA 3D45A 1U45A 5HL7L 3LDQA 3CCMN 2KQ2A 4IDKA 1YT3A 3KK2A 1W2BM 1WAJA 3ATVA 5JVGL 1IG9A 4CJFA 4RW8A 3KD5E 1XQSC 4YHHK 4CIFA 4OVLA 4N5SA 3ZSYA 5FLXO 1HPZA 2IVNA 4B9TA 1Z6RA 4F2RA 2W6KA 4RW9A 3T3FA 4UY8O 1EWRA 1Q82O 4M3ZA 2O8FA 3BY5A 1X3MA 3WXMB 2P9IA 3ZCMA 4X64K 5KPTA 2AP1A 3C6UA 3Q7BA 3S3OA 3SCXA 2KZMA 4CGHA 1SKSA 2ZWHA 1X9MA 5GAHP 2OA8A 3HT3A 3AO4A 4PL7A 2WC9A 2CH5A 4DU4A 4DSLA 4LFBK 3SNNA 3CPWM 3DM2A 1I39A 1ZYQA 3NH1A 2I7NA 4WFNL 3O4NA 5KRSA 1WN7A 3U6FA 4DCHA 5HRPA 4B3RK 4OGCA 4LSLA 3QEIA 4KH4A 1A5WA 1CZBA 1NJZA 2OPSA 1T7PA 3MDQA 3F2KA 3V4IA 3SAGA 4CZIA 4CD3A 1YJNN 1NK7A 4FSVA 4MLEA 3CCRN 4KHYA 3PLAA 3ENHA 3QMLA 3SAHA 1KSPA 1SL2A 3IMXA 4H5TA 4FK2A 3THYA 3SJJA 4A57A 1C0TA 4OPJA 1KAYA 2F9WA 4DU3A 3RVCA 1TV6A 1GOCA 4CHPA 4U7BA 3L2WA 4E7LA 1KAXA 4BC2A 2QK9A 4LFAK 4K42A 3OYEA 5T7BA 4M3XA 5LY3A 3CMEN 4A62A 2Q31A 3LAKA 3K5OA 4LC9B 3V9XA 3WXLA 5AQWA 3TAEA 1SZ2A 3I0RA 4CGJA 3VF4A 4CEZA 4J2DA 1XC9A 4CZFA 5AQMA 4IFEA 4ISGA 4JHDB 3LM2A 4QS7A 1SAZA 3GBTA 5DM7L 3LPUA 1LWCA 3EY1A 1RDCA 4CZJA 3S41A 1LW0A 3ZSXA 3KWIA 4W5QA 2KW4A 4ZHRA 2WTUA 1HLUA 3P4IA 2P9SB 3LP1A 1JLQA 1CXUA 1Z25A 3BEXA 2ZJQL 1ZBIA 2HNYA 2G8IA 3MXJA 3T1HK 4CF8A 4K8XA 3AO5A 4CK1A 4B3TK 1WNSA 5DK5A 5AZJB 1QVFM 4I9QA 1HNZK 3B6OA 4C1NI 2VG7A 4L3QA 2E2OA 3HM8A 4JKCA 3AVIA 5BR8K 3HXMA 4M63C 5BN8A 4CBUA 4DU1A 4B1UB 3MWTA 4JKGA 1LWFA 1JLFA 4MO5A 2O8EB 4HCBA 3QETA 3GDQA 4LF9K 3PX4A 3F73A 4JI7K 3TAMA 1C0GA 4C8OA 3AA4A 4B9SA 3EZ5A 5LJWA 4CFBA 2EHGA 1JLCA 4FJ5A 2O8BB 1NM1A 4IOAL 3D2FB 2BGGA 1NU0A 1ASWA 3BF1A 3O3FA 4MLHA 1M1KO 1S72N 2HVHA 1NGJA 3NHGA 3EYZA 3T19A 4IG0A 5AQVA 4B9NA 5KRTA 1J9AA 2OZSA 2CGJA 2HHSA 3MX2A 4FK4A 4CJ5A 4DKWA 3OYMA 1VQ4N 3CC7N 2VGNA 2WFBA 3V1QA 2VG5A 3VQ7A 1NBWA 2PYJA 1HNWK 4AH9A 4JLHA 3CM5A 1QZ5A 3OY9A 3NFAA 3VQ4A 3HK2A 2UUAK 3PX6A 2YX6A 2Q97A 4BR5A 1RBUA 3QINA 1NGHA 3O8MA 4GVMA 2E2QA 4JRQA 1IBLK 5DM6L 4BQZA 4YOTA 3TTFA 2F9TA 1Q9XA 5TKWA 4AM6A 3VQ8A 1CXQA 1Q86O 2ZJRL 3F5TA 1B9FA 3VMFB 3VQPA 4HHTA 3V9SA 4E7HA 5FPEA 2O8CB 4M3UA 3MXMA 3NGYA 4BRQA 3LZJA 3EN9A 2HHTA 4GMJB 1XHXA 5GAGP 2QWPA 4B1VA 3TTCA 1KQSM 4GY2B 3GOIA 4I2QA 3SYZA 1J54A 4BRMA 4FWLA 4CF2A 4EAHD 4O0IA 4Z0UA 4BRKA 4X66K 4OGEA 5EX5A 4CGDA 1HQUA 3OYJA 4KTZA 5CZ2A 5KQ8A 4B9QA 2XY5A 4AHCA 2HHQA 5GAEP 4YOVA 2X6NA 1X3NA 4CECA 2A41A 1HKBA 2GUPA 4KHQA 4ILHA 3ZEUA 4DLGA 1IBKK 2GBZA 4CIEA 2VCPA 3U8XA 1QQMA 4AHRA 3HPGA 3D2EA 4B1WB 3U9DA 4BDZA 3LM9A 2UYTA 4CK3A 2G8FA 3JXUA 1F21A 2QXLA 2NZTA 4MFBA 2D0AA 3O9RA 3LP2A 1EWQA 3VGMA 5AQZA 4CJLA 4WE1A 1VRTA 4FOIA 1GLEG 2RHKA 3G71N 3SUQA 1TYQA 4IFVA 1T44A 3OVNA 3RSEB 4IXCA 3DXMA 3FFKB 1NJYA 4DR4K 3O9UA 1D4XA 4JS4A 2NLXA 4BC5A 2GV9A 4DQ8A 1HR0K 4JD2A 2FF3B 1XUPO 3B8AX 1IG8A 5JLFA 1NJWA 2KTQA 4LF5K 3VENA 4KHSA 1S3XA 5M1QA 4NCAA 2OTLN 1ITGA 4BRNA 3HM9A 5AZIB 4JI8K 3KKSA 4LY7A 5IT9O 5GADP 3O9TA 1HRHA 4E89A 1BISA 1XHZA 1T05A 2X6SA 2IVOA 3V6DA 4CJPA 4M7YA 4GV3A 3AGKA 2HF4A 1U4BA 2E8AA 3WNEA 4NCBA 4M3WA 4HWIA 1RBTA 2R7YA 1L3SA 4EHUA 4Z4IA 4DFKA 2DFEA 1ZC6A 4FPBA 3C6AA 4WYBA 5FPMA 3NVMA 2DPNA 1UA1A 1QQNA 2FLOA 4IBNA 3CYMA 3ULEB 1T6DA 4FJHA 4MQ3A 4CGIA 4OO1J 3BZCA 5HRSA 4CJVA 3CQYA 3MX5A 3IG1A 5E84A 4BR2A 4BDYA 4CJSA 4FJGA 1HNIA 3BZKA 5M1FA 3K58A 4BRAA 3HVTA 1HKCA 4DUZK 4K25A 3FFIA 4BDPA 3V1OA 3QNNA 3T1YK 3WQTA 4CJQA 4DV6K 5KTQA 3OS2A 2QWNA 4JYAK 4DB3A 3ALYA 4FJJA 1VRUA 2D5RA 1NGDA 3K5LA 1FK9A 4BWJA 5EOYA 3WNHA 3OYDA 3THVA 3FZLA 4NCGA 4EIAA 3PV8A 4DTRA 1D9FA 1VSHA 1D8YA 4K41A 3E9PA 4CF9A 4PKIA 3OW2M 2HHVA 2XHBA 2P9PB 4GNIA 1JLBA 4DS4A 2ATQA 3K57A 5JLHA 3EE9A 1YF5L 4JKEA 3L2RA 4I2PA 4ICLA 5KPRA 1NGAA 4JI1K 1WSJA 1BU6O 3AVBA 2WUSA 3VEWA 2AJQA 1MU2A 4K8ZA 4F3OA 4NO7A 4BC4A 4DR1K 1M90O 4H5VA 1NG9A 1G99A 3VPZA 3OS1A 2UUCK 5LL6Z 1T8EA 4CEAA 2A6AA 5FPDA 1TKZA 2W42A 3CPEA 1RBSA 3K9JA 2FBYA 2AA4A 4DV7K 4NYFA 2F96A 2CGKA 4RCHA 4HTLA 3U3GA 1NGFA 3IUCA 3S3MA 2IGIA 3OYCA 2IAJA 4EZ6A 2G8HA 1KVCA 4E1JA 4XIUA 1VQ8N 3I56N 4FLYA 5C24A 1BI4B 2GX9A 1N32K 4LSNA 4ELVA 5AQFA 3C95A 2EWSA 5EU7A 1YITN 3EZWA 1RDDA 4CJTA 4FJLA 2D0BA 4DMNA 5GIOA 2E20A 3IRXA 3MEDA 3R8EA 3EL2A 4GV6A 1QHTA 1QQOA 4CIGA 4BACA 1QSLA 4B3SK 2D0OA 3ID8A 4CFCA 4KHPK 1Z26A 2YI1A 1KLMA 4DHYA 2VWBA 3L4QA 4H4MA 3SBGA 5B8HA 3W0LA 4FJ8A 2ZE2A 3RRHA 4BGAA 3KLIA 4R5PA 3JYTA 1L5UA 4G9ZA 4OPHA 5K14A 2YHBA 3TWHA 4B1ZA 4BC3A 3KZBA 3KJVA 5AQXA 2P9SA 2ASOA 1QHAA 3OHRA 2E4LA 5GIPA 5D3GA 4DV0K 3LL3A 2QXFA 1WAFA 4H0OA 1LOTB 3CQ8A 3FLCO 2FBVA 2XY8A 4O8UA 3SQ2A 5AZJA 5BR9A 2ASPA 4CF0A 3DLGA 4H4OA 1VQKN 2X78A 3O3GA 2KFNA 1EP4A 1VSDA 3AVHA 4AHTA 4CEFA 4CHYA 4DSEA 1K6YA 3CFOA 1XMOK 2O8EA 4E7KA 3NBPA 3CCSN 2ASMA 1ZBHA 3AVLA 4QOZB 1GLAG 4AF1A 1NOZA 4U67L 3K59A 2QI2A 3K2PA 3VQ6A 3LDNA 1KCFA 1BUPA 2P5GA 2YKNA 3O5BA 2O8BA 3NAEA 4OKJA 3MEEA 4FXDA 1KXPA 4C8MA 1NNEA 4RG8A 2E5LK 5AQJA 2VQEK 1C1AA 4IOXA 3N4PA 4A5BA 2F7TA 1CZ9A 1KVBA 4BVOA 4FZZA 1YJ9N 1BHLA 3PIOL 4BR9A 1BIUA 1N33K 5AFUH 1Q9YA 1UOCA 5FROA 1VSLA 5BPNA 1YUWA 1XNRK 1T03A 4KV8A 3THXB 4IFYA 5ELZA 3AGRA 3HOTA 3CC2N 3OS0A 1HMVA 3V81A 4BRHA 5CYMA 3QEVA 4DTPA 3NE6A 3ITHA 3QB0A 1QZ6A 3ID6A 4BROA 4B9MA 3AA2A 4KI6A 2BTFA 2IDOA 4JI4K 1ESVA 3HSCA 1ASUA 2I7PA 3U3YA 1LCUA 1N34K 1S22A 1UA0A 1S9GA 3A2FA 3A0IX 3IS9A 3HI0A 1QSYA 2O8CA 2QA4N 1REVA 4LF7K 4E1NA 4LD0A 3SQ4A 1VQ6N 2YHXA 4Z4FA 1S1XA 3CCVN 2OTJN 2NRHA 3VQQA 3L8BA 1NOYA 3MK6A 4CGFA 2Y1JA 2BDPA 3OBWA 5HRRA 4B9UA 4Z4EA 3VTHA 2QW9A 4CI6A 4CHQA 1TKXA 3C94A 2P9LB 4I6MB 5C15A 3ZT3A 5IWAK 3VESA 4FL9A 3NH0A 3NVKA 1YVNA 3ASMA 2JLEA 3DRSA 1DLOA 2E2NA 4X62K 5AQKA 1J5EK 3VEOA 4KI4A 1TVRA 3J8AA 3SZ2A 1RFQA 4M3RA 4EFHA 2GEMA 3VERA 2OPPA 1GLDG 5I42A 3KD1E 4BRDA 5CHIA 5LMNK 4KTQA 3AVFA 1L3VA 5JS2A 3MN7A 3VQCA 3CJ9A 3CQXA 4KO0A 1S5JA 2P9NA 1X9SA 2NRWA 1GLCG 2RPIA 1BIZA 4I7FA 4FOEA 4O44A 4B3MK 3G4SN 1DTQA 4RTFD 1HJRA 2P5OA 4C8LA 2XRIA 1RTDA 3HYFA 4IG3A 4KREA 3D7EO 4CHOA 1NWKA 1OVQA 1CZAN 1VHXA 3BF3A 3OYFA 3AA5X 4M3TA 2XO7A 5AZIA 2G8KA 2O4GA 4O55A 5KI6A 4CE9A 4YY3K 2HF3A 2VG6A 1U2VB 3EKSA 3LAMA 4YORA 3VF2A 4Y1DA 2ZD1A 3KWGA 4JK9A 3RR7A 1YTUA 2Q0RA 4WQ5A 5AQLA 5JS1A 1JL2A 3VEZA 4F2SA 3GL1A 1U47A 3L2QA 2WBNA 1UAXA 4FLUA 2PYLA 4GKKK 1BA0A 3NF9A 3I33A 3HL8A 1RTJA 1Y97A 4DR5K 1S1VA 1BGXT 3FE1A 1IJJA 4OPKA 2UU9K 1EX4A 4ID5A 3L2VA 3UIQA 1DEJA 2FSKA 4GW6A 2EX3A 4FLTA 4KB1A 3AO2A 3QFUA 2DFFA 5AQOA 4I9LA 4FWOA 1KC8O 4CESA 2XY6A 1KFSA 3QLHA 2P9IB 4F8RA 4H0XB 4BG8A 3DLBA 4O4GA 1HKGA 1RT5A 3SLCA 3IFRA 3TI0A 4HVJA 1FKOA 3UKRB 2E2PA 5F0XA 1C1CA 3CJBA 3ENBA 5AQPA 1W9HA 4A2AA 4YOXA 4JK7A 4BRCA 3BP8A 3OTOK 3QBXA 3OYAA 1S9EA 4FWKA 2P9PA 3AY9A 4H5WA 5J2PA 3JS6A 1C0UA 4CFAA 2Q36A 3TARA 3T1AA 4JKFA 3H1QA 2ETJA 5KPZA 3PX0A 4XEIA 3ZX0A 4FWRA 5M1OA 4C23A 2JWLA 2YJEA 3V9WA 3A8YA 5J2MA 3ULDA 1MWMA 3CFRA 3ZSZA 3PUFA 3THYB 4EP5A 2IIRA 2KFZA 3CF5L 3K0SA 3G0ZA 4ISEA 4BRFA 4OJRA 3QIOA 1P8ZA 5C10A 3PSIA 3O08A 4KH6A 5KGWA 2D0CA 4JKBA 2YHAA 1VSMA 1OVYA 2LSNA 3DLLL 2ZGZA 4FWQA 4Q5VA 4Z4GA 3H6EA 4W5OA 3L2UA 1VQLN 4CZMA 1RGIA 4CHNA 1N36K 1RT2A 3OA9A 3CD6N 1D9DA 1CLQA 1RTIA 4ELUA 4FK0A 4RW4A 4DG1A 3MN6A 4DTXA 3NF8A 1QE1A 3WXKA 4MDAA 1L3UA 3E9LA 1DKGD 4IOCL 3TU5A 2NUBA 1YI2N 4FPAA 3LANA 4XH5A 1NGBA 1LAWA 5BPMA 3EE8A 2YKMA 3HP9A 2BE2A 1YTAA 3KIOA 3VQAA 4WFBL 1VSEA 1Q8IA 2ZGYA 1SS6A 1JXBA 3THWB 4E1MA 1NGCA 3CMAN 4KHWA 4FJNA 1S1UA 3I8BA 4N76A 4KAZA 4OKKA 1TUYA 3QBWA 1XMQK 4B9VA 3VN5A 3C65A 4LFCK 1VQ9N 1R0AA 4DLEA 2HHHK 4KPYA 1YIJN 3GG4A 1ZBUA 4A59A 3ZSQA 4CEQA 4QCLA 2Q1NA 3TSPA 3LDLA 4M42A 2YNFA 4Y0WA 4M41A 1NK8A 3AO3A 3KLFA 4NB4A 1ZBLA 1NK5A 3O80A 1SKWA 1A5VA 4NLBA 3I55N 1EETA 3DRPA 2NRTA 5SZTA 2QEXN 1OH8A 3CJ7A 4FW1A 1NGEA 4DTSA 1YHQN 2KZZA 3LWLA 5JMVA 2HHWA 2P9KA 3UKUA 4DTNA 1GOBA 3TAFA 4YFUA 3LDOA 2HOEA 4DV5K 2WOMA 3WXIA 2F8TA 1RT7A 3VEYA 3MN9A 1B92A 4PQUA 3QO9A 4CFDA 2OANA 2P1JA 4J2AA 5FRMA 3M1FA 5I9EB 1VAZA 5AR0A 3ZT2A 1VQ5N 1XNQK 4CJRA 4IEIA 5HROA 1HYSA 4NYNA 3PO4A 4DQSA 3PO5A 3HJFA 5FDLA 3K5NA 1K8KB 3VTIA 4L8RB 1SV5A 3ENOA 1LV5A 4H5RA 3G10A 3M6GA 3KK1A 1WUAA 1WBDA 4YNQA 1RDBA 3KKRA 2FSNA 3LWMA 4O5BA 4WF9L 3U4LA 1HUXA 1NGGA 2VWKA 1QQCA 1X9JA 1MA9B 4IJNA 2Q2RA 2GWKA 1EXQA 3O4WA 3THXA 4N56A 3VETA 5E26A 1EO1A 3E66A 2Z1JA 1NK0A 3HSTB 3U9ZA 1HX1A 3DXKB 4KKOA 4B3OA 2I5JA 2BH1A 4DTJA 1ZBFA 1QSSA 4FM1A 2GUIA 1NGIA 2ITGA 3NDKA 2RF2A 3VQ5A 5ADXA 2HHUA 3CJ1A 3H45C 4DR3K 1HNXK 3DAWA 3LDSA 4ILJA 2V51B 3AVCA 1VQPN 3DOLA 4CJ4A 3H46O 4Q0BA 3L4IA 2HNZA 4FLVA 2W40A 5CYQA 4DUYK 2HMIA 2YHYA 3V1RA 1WSEA 1VQ7N 4F4KA 4DR6K 3ZT4A 4PKGA 1JXEA 4IEEA 3AO1A 2O8DB 3M3ZA 3OYLA 3M8RA 1IKVA 1OH7A 5AQHA 2Z1GA 2ZF5O 1TK0A 1K9MO 2QKKA 1X9WA 4JI5K 3NGZA 2P9LA 1ATRA 4FCYA 3E1YA 3C6HA 1VSKA 4I6MA 3UB5A 3CCEN 2YJFA 1JCGA 4X65K 2OZMA 1JL1A 1TYQB 2QWRA 1U6ZA 1WB9A 5FRNA 3DXMB 4FLWA 4O5FA 3Q7CA 4AM7A 3SI6A 4DTOA 4QS8A 4C8NA 3MCAB 3SV4A 4RW6A 4IJAA 3VEXA 5HOOA 4M3YA 2G8UA 3QFPA 4JHDA 4E0DA 3HZ6A 1RT3A 3RTVA 4FVMA 3ZX3A 3A5OC 2Z1HA 3CXCM 1S6QA 2B5JA 4H5NA 1MDUB 4BRGA 2A40A 3DLEA 4AHVA 2HNDA 2FXUA 4W5RA 3PY8A 5C25A 1NLVA 1IBMK 4YOWA 5GINA 1ASVA 4FWNA 3W3DA 3J80O 1HNVA 1EQYA 4OPAA 3V9ZA 5JVHL 3TAQA 1RDWX 3TAPA 1N6QA 3A5NC 3AVJA 5E41A 4LF8K 1ZXOA 4PY5A 3NF6A 4CGGA 2HW3A 1TK5A 1YAGA 3C0BA 2OCEA 4LF4K 3LZIA 2CGLA 1VSIA 4DSFA 4BGBA 4BE0A 1WBBA 2YHWA 1IKWA 2E88A 4V19S 3HO1A 1TUUA 1NKCA 2PAVA 1ATSA 1U2VA 3T69A 1G15A 1KFDA 5C12A 3SUNA 2UXCK 4B08A 3D2FA 4FLXA 3OJUA 4C8KA 3O3HA 4N41A 4CHZA 4PUOA 2YV0X 4WQ5C 1JLAA 5BPLA 5SWMA 1T6CA 1ZBSA 2V7YA 1O13A 3QICA 1XC3A 4XH1A 3C6TA 4H03B 5M1KA 3WEEB 3KLEA 1W7AA 2FBTA 3MECA 4FM0A 4M7XA 3RRGA 1RILA 1NKEA 5AQQA 2P9UB 3NCIA 5HBMA 3UE5A 5J2NA 5FPNA 2RN2A 1I94K 2O4IA 3SMPA 3VA3A 4IWVA 3MAQA 3CETA 3VQEA 3ZX2A 1BDGA 4TSXA 2Y1IA 3SPYA 2A1SA 4JK8A 2E6LA 1SQKA 2OPRA 3CIPA 4N47A 4W5NA 4QS9A 1BL3A 4E7IA 4H0YB 3FZFA 3SPZA 4B9LA 2GELA 3OYGA 3FZMA 3F9MA 4IO9L 3AVNA 3AV9A 3UKRA 4HTUA 1XI1A 3O1WA 3G25A 4BY9C 1DGKN 1KAZA 4ZTFA 1SL0A 4BE1A 1A5XA 3VQDA 3MCPA 3TSQA 1V4TA 1WSGA 2OPQA 1TK8A 1VQMN 4ID1A 3L3VA 1BO5O 4DFMA 1W97L 5AQNA 3ZSWA 4FW2A 4H0TB 4ZTJA 4JN4A 1WSHA 1Q18A 3P31A 4CCHA 3FGUA 4JEPA 3O9QA 1FJGK 3NMUA 2VWJA 1JCFA 4FM2A 3C7NB 5J1EA 3SBTA 3BDPA 4KB0A 1RT1A 4F9OA 3QIPA 4JI3K 3FR0A 4CZEA 1BCMA 4OKEA 4FWPA 4A5AA 1T3VA 3ZETB 1X1PA 2X74A 3TAGA 2Z1IA 4FO0A 5F2RA 3M5RA 5HP1A 3NGIA 1SUQA 4J2BA 3RMBA 2IOCA 4DTMA 2A1RA 5AQIA 3CHWA 4CZHA 1OH5A 3KK3A 3D6RA 3L6QA 4GVEA 1C1BA 4MDBA 4FJ7A 3SV3A 5AQTA 3CCQN 4DR2K 4A2BA 4QAGA 4B1XB 1TL3A 3DLHA 3BUZB 2NRZA 3I0SA 1RDUA 3RSEA 2NRVA 1FXXA 3J81O 1J5OA 1U48A 4AHSA 3KTQA 2CH6A 1RDAA 2WONA 3AVMA 1K73O 2A42A 2G8VA 1S1WA 2DTUA 4YDUA 1BQMA 1VSJA 2GTDA 3I8DA 1GLJO 2FF6A 3VA0A 3R6MA 4H0PA 1YJWN 1V4SA 2E1YA 2NRXA 1JLGA 4CEOA 2KLAA 2YNGA 4BWMA 3THWA 3O1BA 2HVIA 3AVKA 4DQIA 4JKHA 4DV1K 1XWLA 3ATUA 2KKZA 3D0PA 3DJCA 1FW6A 3RR8A 2YNIA 4RWTA 3LALA 5MLCQ 2PY5A 1QTMA 5KGXA 3OYIA 3M8QA 3WUHA 4FZYA 3CJAA 4CJWA 2GWJA 3FZHA 5I3UA 3SUPA 3RMCA 2QKBA 3VGLA 5HLFA 3EO3A 3IDHA 3ULEA 2H3GX 3M8PA 3CCLN 3RMAA 4CJ3A 3VEVA 2VQFK 2ITMA 3J7ZO 5TKYA 3DRRA 2OYQA 1R59O 4PWDA 1BG3A 3HP6A 5BREA 3LDPA 4BE2A 4CEEA 3DI6A 1ATNA 1RCHA 4KBOA 1C0FA 4CJUA 2ZM6K 2O8FB 3RMDA 3H1VX 1RTHA 4JRPA 4BG9A 3TR8A 3R3LA 2HBKA 4DSKA 4HCCA 2E6MA 3A5MC 3DWLA 3QEWA 1KLNA 1NJXA 4DFJA 3J7AP 4Y1CA 3ZT0A 1C0MA 2B6AA 4CD1A 1FKPA 1YVUA 4BREA 1K8KA 2DFHA 1U04A 3EEQA 3ZSVA 2QM1A 1Q7YO 2HHXA 1BQNA 3EKUA 4H8KA 1WSFA 4M45A 1BWFO 3DLRA 1MWKA 5A2QO 1KD1O 1E3MA 3SQ0A 4JI6K 3HPHA 1IKXA 1J6ZA 3CCJN 3H08A 4ISFA 3K9KA 4CK2A 1H1VA 2HB5A 3KK7A 4CZKA 4JS5A 4FJ9A 4OLAA 1Z05A 3A5LC 4FYDA 1YXQA 2Q0UA 3OYHA 3HTVA 3DXKA 1B9DA 4FLZA 5AQUA 3KHYA 3S3NA 1QVGM 4KH5A 1IH7A 3AAPA 3O4QA 3HBTA 2D0PA 2ZQBA 3HOSA 1LAVA 5LMUK 1NKBA 5HRNA 1TGOA 2D4WA 1I3AA 3OYKA 4O0JA 1W0HA 4CBXA 5CE3A 3MXIA 1JKHA 4DR7K 1IKYA 1HYZA 1IV0A 1BI4A 4E3SA 1BOTO 2FSJA 4FJMA 4EP4A 3ISNC 3TTDA 4OLBA 1J53A 2O8DA 4O8KA 4CERA 1JJ2M 3KLGA 1RNHA 2YNHA 4BRIA 3DOKA 3NF7A 2RKIA 2IC3A 4DV2K 2PBDA 3CG7A 1RBRA 3NH2A 4DF4A 2B4JA 1DT9A 1Y64A 2KHOA 1NMDA 4Z94A 3SJHA 4GV9A 3PSFA 2F4VK 3WQUA 4BRLA 4FZXC 2W6LA 3B6PA 2P9NB 3MMVA 4J8FA 4JKDA 1NK6A 2FC0A 4KHUA 5KQDA 4KFBA 4E7JA 4KRFA 3HVRA 3VQBA 3QDKA 4JKGB 3JSMA 3GE1A 4JNEA 3BGRA 3CM6A 3P1GA 2RE2A 5H1SQ 5C0YA 1DTTA 2IS3A 3CI5A 2UXBK 3E9OA 3WNFA 4NXNK 4E19A 5C42A 3WNGA 4WQ4C 4JI2K 4B1YB 3KVGA 3CC4N 1L3TA 4DSJA 3S9HA 5CY4A 5BRDA 5CR4A 3DLKA 1WSIA 4OX9K 3TPQA 1C6VA 1TKTA 4HUFA 3TSUA 4YOYA 1NK4A 2VYPA 2F8SA 4PA1A 4PL8A 1E4GT 4EZ9A 3FZKA 1BA1A 4PKHA 3PIPL 4CEBA 3CFPA 2NNWA 4K43A 3LPTA 3SMSA 4YOUA 4MO4A 4W5TA 1BCOA 4FJIA 5BRHA 2HBJA 3CJCA 2JGUA 4XH4A 4BQLA 4LF6K 4BRPA 4B8CA 3VOVA 5C2DA 2UXDK 5AQRA 1D5AA 1LW2A 5AJ3K 1JCEA 4CEDA 4JAXA 3TABA 1HPMA 3G6EN 1SL1A 3T7ZA 3QNOA 1QS4A 3MN5A 4DSIA 4RW7A 1EKEA 2NRRA 3ZSRA 4FWSA 5CZ1A 3V9UA 4CBWA 1RT4A 4Z4CA 4H0VB 4DV4K 3CCUN 3LP3A 2A3ZA 4AHUA 2HBMA 1U49A 3WEEA 3R9PA 1KVAA 1GOAA 4BR4A 1OH6A 2VGMA 3TANA 4K0KK 4A61A 2BANA 5EVZA 3AAQA 3ZYYX 2QTDA 1SKRA 3SK3A 2P9UA 3IAYA 1TAQA 4Z4HA 1LWEA 1WLJA 3N4QA 2V52B 2HBLA 4HUEA 3QERA 3AVAA 4IKFA 3L0QA 3SQ1A 4UQGA 2BUPA 1KTQA 2QWOA 4BR0A 3ZSOA 3DMJA 3O9SA 1OKJA 1HYVA 4JKAA 5BN9A 1JLEA 2XY7A 4CZGA 2Q3SA 3CERA 3ZEUB 1K8AO 2QWLA 2IVPA 5M1PA 4LH4A 3QESA 4JV5K 4B8AB 3P38A 3AARA 4R79A 1E4FT 1RBVA 3F9KA 5LJVA 3HRGA 3D2EB 5AQSA 3VGKA 3QEXA 1UWBA 1GLLO 3H3NO 3JAMO 1GLFO 1N5YA 3DYAA 5EXWA 4NLCA 1NK9A 2HMPA 1O1WA 3SAFA 4ELTA 2E1ZA 3P39A 4DS5A 3AA3A 4IO8A 1S1TA 3ZT1A 4BVPA 2HSTA 3O6WA 4KHNA 5AQGA 3P83D 1VQNN 4EHTA 4GKJK 4FJXA 5EY4A 1TKDA 5ADXH 3C7NA 4KTWA 2W41A 5C2FA 5JICA 1S6PA 4FJKA 1Q81O 4CVNE 3R1XA 2V7ZA 4CF1A 1KRPA 4DQRA 1P90A 1HQEA 2DY4A 4CJ7A 5AQYA 5F1XA 2G8WA 3ZETA 4FVUA 4JD2B 1HJOA 3J7YP 3OJSA 4J2EA 3OYNA 1TL1A 3QEPA 4DV3K 4CJKA 2PFUA 3LP0A 3MEGA 1ILYA 4CJEA 4LH5A 4CW7B 3OBYA 4C1NK 4F3TA 3L3UA 3RWUA 3WT0A 4WFAL 2D1KA 1GLBG 5DMRA 4WCEL 4JI0K 4IDHA 4WQ4A 3VF6A 4AILC 4DTUA 4HUGA 1VSFA 4DQQA 4IZ9A 4CZLA 2P51A 5M1NA 1VQON 2J4RA 1WOQA 2QWMA 3OYBA 1RT6A 3VQ9A 3KLHA 4ILGB 2JWKA 4FWMA 3K5MA
chains in the Genus database with same CATH topology
4JYAK 4DR6K 2UUBK 4B3SK 4B3MK 4KHPK 3J7AP 4JI4K 4DR2K 4JI5K 1N34K 4JV5K 2UXBK 4AQYK 4NXNK 4X65K 1HNWK 4YY3K 3J81O 4JI2K 1I94K 3JAMO 4DR4K 4LF7K 4DV5K 2UUAK 4NXMK 5A2QO 4LFAK 4JI6K 1HR0K 4OX9K 4DV0K 4JI1K 1IBLK 4GKKK 4LF5K 4DR1K 1XNQK 4DR5K 1N36K 2UU9K 4GKJK 2UUCK 4JI8K 5LL6Z 5IT9O 5IWAK 4YHHK 4CVNE 4DV1K 1XMOK 4LF6K 4DV7K 5FLXO 2UXDK 4X62K 5LMUK 5AJ3K 1J5EK 4X64K 3J7YP 4DR7K 3T1HK 1IBMK 4DV3K 4B3TK 3J80O 4X66K 1HNZK 1FJGK 1N32K 4CW7B 5BR8K 2E5LK 2VQEK 4DV4K 4JI0K 2VQFK 4LF8K 4DV2K 4LF4K 5LMNK 4LFBK 4LF9K 4JI3K 4K0KK 4DR3K 4JI7K 1HNXK 1N33K 1IBKK 4DUZK 4V19S 1XMQK 3OTOK 2ZM6K 3T1YK 4LFCK 1XNRK 4B3RK 4DV6K 2HHHK 2UXCK 2F4VK 4DUYK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA K;  4DR6 K;  2UUB K;  4B3S K;  4B3M K;  4KHP K;  3J7A P;  4JI4 K;  4DR2 K;  4JI5 K;  1N34 K;  4JV5 K;  2UXB K;  4AQY K;  4NXN K;  4X65 K;  1HNW K;  4YY3 K;  3J81 O;  4JI2 K;  1I94 K;  3JAM O;  4DR4 K;  4LF7 K;  4DV5 K;  2UUA K;  4NXM K;  5A2Q O;  4LFA K;  4JI6 K;  1HR0 K;  4OX9 K;  4DV0 K;  4JI1 K;  1IBL K;  4GKK K;  4LF5 K;  4DR1 K;  1XNQ K;  4DR5 K;  1N36 K;  2UU9 K;  4GKJ K;  2UUC K;  4JI8 K;  5LL6 Z;  5IT9 O;  5IWA K;  4YHH K;  4CVN E;  4DV1 K;  1XMO K;  4LF6 K;  4DV7 K;  5FLX O;  2UXD K;  4X62 K;  5LMU K;  5AJ3 K;  1J5E K;  4X64 K;  3J7Y P;  4DR7 K;  3T1H K;  1IBM K;  4DV3 K;  4B3T K;  3J80 O;  4X66 K;  1HNZ K;  1FJG K;  1N32 K;  4CW7 B;  5BR8 K;  2E5L K;  2VQE K;  4DV4 K;  4JI0 K;  2VQF K;  4LF8 K;  4DV2 K;  4LF4 K;  5LMN K;  4LFB K;  4LF9 K;  4JI3 K;  4K0K K;  4DR3 K;  4JI7 K;  1HNX K;  1N33 K;  1IBK K;  4DUZ K;  4V19 S;  1XMQ K;  3OTO K;  2ZM6 K;  3T1Y K;  4LFC K;  1XNR K;  4B3R K;  4DV6 K;  2HHH K;  2UXC K;  2F4V K;  4DUY K; 
#chains in the Genus database with same CATH topology
 2PZS A;  3MWP A;  2UUB K;  4YDU C;  3HPO A;  4PHT X;  2QWQ A;  4DWI A;  3ZLJ A;  2FBX A;  1IO2 A;  3E01 A;  3WXJ A;  2ZJP L;  4DFP A;  4G1Q A;  2YCH A;  4DQP A;  1NJI O;  3M8S A;  4AQY K;  3IKM A;  4BR7 A;  4DF8 A;  1NMN A;  1VK0 A;  5J2Q A;  3P5J A;  2P9K B;  3H3O B;  3AVG A;  3UKU B;  5AFU A;  5BRF A;  2A5X A;  4NXM K;  1TAU A;  1N8R O;  3SUO A;  3D45 A;  1U45 A;  5HL7 L;  3LDQ A;  3CCM N;  2KQ2 A;  4IDK A;  1YT3 A;  3KK2 A;  1W2B M;  1WAJ A;  3ATV A;  5JVG L;  1IG9 A;  4CJF A;  4RW8 A;  3KD5 E;  1XQS C;  4YHH K;  4CIF A;  4OVL A;  4N5S A;  3ZSY A;  5FLX O;  1HPZ A;  2IVN A;  4B9T A;  1Z6R A;  4F2R A;  2W6K A;  4RW9 A;  3T3F A;  4UY8 O;  1EWR A;  1Q82 O;  4M3Z A;  2O8F A;  3BY5 A;  1X3M A;  3WXM B;  2P9I A;  3ZCM A;  4X64 K;  5KPT A;  2AP1 A;  3C6U A;  3Q7B A;  3S3O A;  3SCX A;  2KZM A;  4CGH A;  1SKS A;  2ZWH A;  1X9M A;  5GAH P;  2OA8 A;  3HT3 A;  3AO4 A;  4PL7 A;  2WC9 A;  2CH5 A;  4DU4 A;  4DSL A;  4LFB K;  3SNN A;  3CPW M;  3DM2 A;  1I39 A;  1ZYQ A;  3NH1 A;  2I7N A;  4WFN L;  3O4N A;  5KRS A;  1WN7 A;  3U6F A;  4DCH A;  5HRP A;  4B3R K;  4OGC A;  4LSL A;  3QEI A;  4KH4 A;  1A5W A;  1CZB A;  1NJZ A;  2OPS A;  1T7P A;  3MDQ A;  3F2K A;  3V4I A;  3SAG A;  4CZI A;  4CD3 A;  1YJN N;  1NK7 A;  4FSV A;  4MLE A;  3CCR N;  4KHY A;  3PLA A;  3ENH A;  3QML A;  3SAH A;  1KSP A;  1SL2 A;  3IMX A;  4H5T A;  4FK2 A;  3THY A;  3SJJ A;  4A57 A;  1C0T A;  4OPJ A;  1KAY A;  2F9W A;  4DU3 A;  3RVC A;  1TV6 A;  1GOC A;  4CHP A;  4U7B A;  3L2W A;  4E7L A;  1KAX A;  4BC2 A;  2QK9 A;  4LFA K;  4K42 A;  3OYE A;  5T7B A;  4M3X A;  5LY3 A;  3CME N;  4A62 A;  2Q31 A;  3LAK A;  3K5O A;  4LC9 B;  3V9X A;  3WXL A;  5AQW A;  3TAE A;  1SZ2 A;  3I0R A;  4CGJ A;  3VF4 A;  4CEZ A;  4J2D A;  1XC9 A;  4CZF A;  5AQM A;  4IFE A;  4ISG A;  4JHD B;  3LM2 A;  4QS7 A;  1SAZ A;  3GBT A;  5DM7 L;  3LPU A;  1LWC A;  3EY1 A;  1RDC A;  4CZJ A;  3S41 A;  1LW0 A;  3ZSX A;  3KWI A;  4W5Q A;  2KW4 A;  4ZHR A;  2WTU A;  1HLU A;  3P4I A;  2P9S B;  3LP1 A;  1JLQ A;  1CXU A;  1Z25 A;  3BEX A;  2ZJQ L;  1ZBI A;  2HNY A;  2G8I A;  3MXJ A;  3T1H K;  4CF8 A;  4K8X A;  3AO5 A;  4CK1 A;  4B3T K;  1WNS A;  5DK5 A;  5AZJ B;  1QVF M;  4I9Q A;  1HNZ K;  3B6O A;  4C1N I;  2VG7 A;  4L3Q A;  2E2O A;  3HM8 A;  4JKC A;  3AVI A;  5BR8 K;  3HXM A;  4M63 C;  5BN8 A;  4CBU A;  4DU1 A;  4B1U B;  3MWT A;  4JKG A;  1LWF A;  1JLF A;  4MO5 A;  2O8E B;  4HCB A;  3QET A;  3GDQ A;  4LF9 K;  3PX4 A;  3F73 A;  4JI7 K;  3TAM A;  1C0G A;  4C8O A;  3AA4 A;  4B9S A;  3EZ5 A;  5LJW A;  4CFB A;  2EHG A;  1JLC A;  4FJ5 A;  2O8B B;  1NM1 A;  4IOA L;  3D2F B;  2BGG A;  1NU0 A;  1ASW A;  3BF1 A;  3O3F A;  4MLH A;  1M1K O;  1S72 N;  2HVH A;  1NGJ A;  3NHG A;  3EYZ A;  3T19 A;  4IG0 A;  5AQV A;  4B9N A;  5KRT A;  1J9A A;  2OZS A;  2CGJ A;  2HHS A;  3MX2 A;  4FK4 A;  4CJ5 A;  4DKW A;  3OYM A;  1VQ4 N;  3CC7 N;  2VGN A;  2WFB A;  3V1Q A;  2VG5 A;  3VQ7 A;  1NBW A;  2PYJ A;  1HNW K;  4AH9 A;  4JLH A;  3CM5 A;  1QZ5 A;  3OY9 A;  3NFA A;  3VQ4 A;  3HK2 A;  2UUA K;  3PX6 A;  2YX6 A;  2Q97 A;  4BR5 A;  1RBU A;  3QIN A;  1NGH A;  3O8M A;  4GVM A;  2E2Q A;  4JRQ A;  1IBL K;  5DM6 L;  4BQZ A;  4YOT A;  3TTF A;  2F9T A;  1Q9X A;  5TKW A;  4AM6 A;  3VQ8 A;  1CXQ A;  1Q86 O;  2ZJR L;  3F5T A;  1B9F A;  3VMF B;  3VQP A;  4HHT A;  3V9S A;  4E7H A;  5FPE A;  2O8C B;  4M3U A;  3MXM A;  3NGY A;  4BRQ A;  3LZJ A;  3EN9 A;  2HHT A;  4GMJ B;  1XHX A;  5GAG P;  2QWP A;  4B1V A;  3TTC A;  1KQS M;  4GY2 B;  3GOI A;  4I2Q A;  3SYZ A;  1J54 A;  4BRM A;  4FWL A;  4CF2 A;  4EAH D;  4O0I A;  4Z0U A;  4BRK A;  4X66 K;  4OGE A;  5EX5 A;  4CGD A;  1HQU A;  3OYJ A;  4KTZ A;  5CZ2 A;  5KQ8 A;  4B9Q A;  2XY5 A;  4AHC A;  2HHQ A;  5GAE P;  4YOV A;  2X6N A;  1X3N A;  4CEC A;  2A41 A;  1HKB A;  2GUP A;  4KHQ A;  4ILH A;  3ZEU A;  4DLG A;  1IBK K;  2GBZ A;  4CIE A;  2VCP A;  3U8X A;  1QQM A;  4AHR A;  3HPG A;  3D2E A;  4B1W B;  3U9D A;  4BDZ A;  3LM9 A;  2UYT A;  4CK3 A;  2G8F A;  3JXU A;  1F21 A;  2QXL A;  2NZT A;  4MFB A;  2D0A A;  3O9R A;  3LP2 A;  1EWQ A;  3VGM A;  5AQZ A;  4CJL A;  4WE1 A;  1VRT A;  4FOI A;  1GLE G;  2RHK A;  3G71 N;  3SUQ A;  1TYQ A;  4IFV A;  1T44 A;  3OVN A;  3RSE B;  4IXC A;  3DXM A;  3FFK B;  1NJY A;  4DR4 K;  3O9U A;  1D4X A;  4JS4 A;  2NLX A;  4BC5 A;  2GV9 A;  4DQ8 A;  1HR0 K;  4JD2 A;  2FF3 B;  1XUP O;  3B8A X;  1IG8 A;  5JLF A;  1NJW A;  2KTQ A;  4LF5 K;  3VEN A;  4KHS A;  1S3X A;  5M1Q A;  4NCA A;  2OTL N;  1ITG A;  4BRN A;  3HM9 A;  5AZI B;  4JI8 K;  3KKS A;  4LY7 A;  5IT9 O;  5GAD P;  3O9T A;  1HRH A;  4E89 A;  1BIS A;  1XHZ A;  1T05 A;  2X6S A;  2IVO A;  3V6D A;  4CJP A;  4M7Y A;  4GV3 A;  3AGK A;  2HF4 A;  1U4B A;  2E8A A;  3WNE A;  4NCB A;  4M3W A;  4HWI A;  1RBT A;  2R7Y A;  1L3S A;  4EHU A;  4Z4I A;  4DFK A;  2DFE A;  1ZC6 A;  4FPB A;  3C6A A;  4WYB A;  5FPM A;  3NVM A;  2DPN A;  1UA1 A;  1QQN A;  2FLO A;  4IBN A;  3CYM A;  3ULE B;  1T6D A;  4FJH A;  4MQ3 A;  4CGI A;  4OO1 J;  3BZC A;  5HRS A;  4CJV A;  3CQY A;  3MX5 A;  3IG1 A;  5E84 A;  4BR2 A;  4BDY A;  4CJS A;  4FJG A;  1HNI A;  3BZK A;  5M1F A;  3K58 A;  4BRA A;  3HVT A;  1HKC A;  4DUZ K;  4K25 A;  3FFI A;  4BDP A;  3V1O A;  3QNN A;  3T1Y K;  3WQT A;  4CJQ A;  4DV6 K;  5KTQ A;  3OS2 A;  2QWN A;  4JYA K;  4DB3 A;  3ALY A;  4FJJ A;  1VRU A;  2D5R A;  1NGD A;  3K5L A;  1FK9 A;  4BWJ A;  5EOY A;  3WNH A;  3OYD A;  3THV A;  3FZL A;  4NCG A;  4EIA A;  3PV8 A;  4DTR A;  1D9F A;  1VSH A;  1D8Y A;  4K41 A;  3E9P A;  4CF9 A;  4PKI A;  3OW2 M;  2HHV A;  2XHB A;  2P9P B;  4GNI A;  1JLB A;  4DS4 A;  2ATQ A;  3K57 A;  5JLH A;  3EE9 A;  1YF5 L;  4JKE A;  3L2R A;  4I2P A;  4ICL A;  5KPR A;  1NGA A;  4JI1 K;  1WSJ A;  1BU6 O;  3AVB A;  2WUS A;  3VEW A;  2AJQ A;  1MU2 A;  4K8Z A;  4F3O A;  4NO7 A;  4BC4 A;  4DR1 K;  1M90 O;  4H5V A;  1NG9 A;  1G99 A;  3VPZ A;  3OS1 A;  2UUC K;  5LL6 Z;  1T8E A;  4CEA A;  2A6A A;  5FPD A;  1TKZ A;  2W42 A;  3CPE A;  1RBS A;  3K9J A;  2FBY A;  2AA4 A;  4DV7 K;  4NYF A;  2F96 A;  2CGK A;  4RCH A;  4HTL A;  3U3G A;  1NGF A;  3IUC A;  3S3M A;  2IGI A;  3OYC A;  2IAJ A;  4EZ6 A;  2G8H A;  1KVC A;  4E1J A;  4XIU A;  1VQ8 N;  3I56 N;  4FLY A;  5C24 A;  1BI4 B;  2GX9 A;  1N32 K;  4LSN A;  4ELV A;  5AQF A;  3C95 A;  2EWS A;  5EU7 A;  1YIT N;  3EZW A;  1RDD A;  4CJT A;  4FJL A;  2D0B A;  4DMN A;  5GIO A;  2E20 A;  3IRX A;  3MED A;  3R8E A;  3EL2 A;  4GV6 A;  1QHT A;  1QQO A;  4CIG A;  4BAC A;  1QSL A;  4B3S K;  2D0O A;  3ID8 A;  4CFC A;  4KHP K;  1Z26 A;  2YI1 A;  1KLM A;  4DHY A;  2VWB A;  3L4Q A;  4H4M A;  3SBG A;  5B8H A;  3W0L A;  4FJ8 A;  2ZE2 A;  3RRH A;  4BGA A;  3KLI A;  4R5P A;  3JYT A;  1L5U A;  4G9Z A;  4OPH A;  5K14 A;  2YHB A;  3TWH A;  4B1Z A;  4BC3 A;  3KZB A;  3KJV A;  5AQX A;  2P9S A;  2ASO A;  1QHA A;  3OHR A;  2E4L A;  5GIP A;  5D3G A;  4DV0 K;  3LL3 A;  2QXF A;  1WAF A;  4H0O A;  1LOT B;  3CQ8 A;  3FLC O;  2FBV A;  2XY8 A;  4O8U A;  3SQ2 A;  5AZJ A;  5BR9 A;  2ASP A;  4CF0 A;  3DLG A;  4H4O A;  1VQK N;  2X78 A;  3O3G A;  2KFN A;  1EP4 A;  1VSD A;  3AVH A;  4AHT A;  4CEF A;  4CHY A;  4DSE A;  1K6Y A;  3CFO A;  1XMO K;  2O8E A;  4E7K A;  3NBP A;  3CCS N;  2ASM A;  1ZBH A;  3AVL A;  4QOZ B;  1GLA G;  4AF1 A;  1NOZ A;  4U67 L;  3K59 A;  2QI2 A;  3K2P A;  3VQ6 A;  3LDN A;  1KCF A;  1BUP A;  2P5G A;  2YKN A;  3O5B A;  2O8B A;  3NAE A;  4OKJ A;  3MEE A;  4FXD A;  1KXP A;  4C8M A;  1NNE A;  4RG8 A;  2E5L K;  5AQJ A;  2VQE K;  1C1A A;  4IOX A;  3N4P A;  4A5B A;  2F7T A;  1CZ9 A;  1KVB A;  4BVO A;  4FZZ A;  1YJ9 N;  1BHL A;  3PIO L;  4BR9 A;  1BIU A;  1N33 K;  5AFU H;  1Q9Y A;  1UOC A;  5FRO A;  1VSL A;  5BPN A;  1YUW A;  1XNR K;  1T03 A;  4KV8 A;  3THX B;  4IFY A;  5ELZ A;  3AGR A;  3HOT A;  3CC2 N;  3OS0 A;  1HMV A;  3V81 A;  4BRH A;  5CYM A;  3QEV A;  4DTP A;  3NE6 A;  3ITH A;  3QB0 A;  1QZ6 A;  3ID6 A;  4BRO A;  4B9M A;  3AA2 A;  4KI6 A;  2BTF A;  2IDO A;  4JI4 K;  1ESV A;  3HSC A;  1ASU A;  2I7P A;  3U3Y A;  1LCU A;  1N34 K;  1S22 A;  1UA0 A;  1S9G A;  3A2F A;  3A0I X;  3IS9 A;  3HI0 A;  1QSY A;  2O8C A;  2QA4 N;  1REV A;  4LF7 K;  4E1N A;  4LD0 A;  3SQ4 A;  1VQ6 N;  2YHX A;  4Z4F A;  1S1X A;  3CCV N;  2OTJ N;  2NRH A;  3VQQ A;  3L8B A;  1NOY A;  3MK6 A;  4CGF A;  2Y1J A;  2BDP A;  3OBW A;  5HRR A;  4B9U A;  4Z4E A;  3VTH A;  2QW9 A;  4CI6 A;  4CHQ A;  1TKX A;  3C94 A;  2P9L B;  4I6M B;  5C15 A;  3ZT3 A;  5IWA K;  3VES A;  4FL9 A;  3NH0 A;  3NVK A;  1YVN A;  3ASM A;  2JLE A;  3DRS A;  1DLO A;  2E2N A;  4X62 K;  5AQK A;  1J5E K;  3VEO A;  4KI4 A;  1TVR A;  3J8A A;  3SZ2 A;  1RFQ A;  4M3R A;  4EFH A;  2GEM A;  3VER A;  2OPP A;  1GLD G;  5I42 A;  3KD1 E;  4BRD A;  5CHI A;  5LMN K;  4KTQ A;  3AVF A;  1L3V A;  5JS2 A;  3MN7 A;  3VQC A;  3CJ9 A;  3CQX A;  4KO0 A;  1S5J A;  2P9N A;  1X9S A;  2NRW A;  1GLC G;  2RPI A;  1BIZ A;  4I7F A;  4FOE A;  4O44 A;  4B3M K;  3G4S N;  1DTQ A;  4RTF D;  1HJR A;  2P5O A;  4C8L A;  2XRI A;  1RTD A;  3HYF A;  4IG3 A;  4KRE A;  3D7E O;  4CHO A;  1NWK A;  1OVQ A;  1CZA N;  1VHX A;  3BF3 A;  3OYF A;  3AA5 X;  4M3T A;  2XO7 A;  5AZI A;  2G8K A;  2O4G A;  4O55 A;  5KI6 A;  4CE9 A;  4YY3 K;  2HF3 A;  2VG6 A;  1U2V B;  3EKS A;  3LAM A;  4YOR A;  3VF2 A;  4Y1D A;  2ZD1 A;  3KWG A;  4JK9 A;  3RR7 A;  1YTU A;  2Q0R A;  4WQ5 A;  5AQL A;  5JS1 A;  1JL2 A;  3VEZ A;  4F2S A;  3GL1 A;  1U47 A;  3L2Q A;  2WBN A;  1UAX A;  4FLU A;  2PYL A;  4GKK K;  1BA0 A;  3NF9 A;  3I33 A;  3HL8 A;  1RTJ A;  1Y97 A;  4DR5 K;  1S1V A;  1BGX T;  3FE1 A;  1IJJ A;  4OPK A;  2UU9 K;  1EX4 A;  4ID5 A;  3L2V A;  3UIQ A;  1DEJ A;  2FSK A;  4GW6 A;  2EX3 A;  4FLT A;  4KB1 A;  3AO2 A;  3QFU A;  2DFF A;  5AQO A;  4I9L A;  4FWO A;  1KC8 O;  4CES A;  2XY6 A;  1KFS A;  3QLH A;  2P9I B;  4F8R A;  4H0X B;  4BG8 A;  3DLB A;  4O4G A;  1HKG A;  1RT5 A;  3SLC A;  3IFR A;  3TI0 A;  4HVJ A;  1FKO A;  3UKR B;  2E2P A;  5F0X A;  1C1C A;  3CJB A;  3ENB A;  5AQP A;  1W9H A;  4A2A A;  4YOX A;  4JK7 A;  4BRC A;  3BP8 A;  3OTO K;  3QBX A;  3OYA A;  1S9E A;  4FWK A;  2P9P A;  3AY9 A;  4H5W A;  5J2P A;  3JS6 A;  1C0U A;  4CFA A;  2Q36 A;  3TAR A;  3T1A A;  4JKF A;  3H1Q A;  2ETJ A;  5KPZ A;  3PX0 A;  4XEI A;  3ZX0 A;  4FWR A;  5M1O A;  4C23 A;  2JWL A;  2YJE A;  3V9W A;  3A8Y A;  5J2M A;  3ULD A;  1MWM A;  3CFR A;  3ZSZ A;  3PUF A;  3THY B;  4EP5 A;  2IIR A;  2KFZ A;  3CF5 L;  3K0S A;  3G0Z A;  4ISE A;  4BRF A;  4OJR A;  3QIO A;  1P8Z A;  5C10 A;  3PSI A;  3O08 A;  4KH6 A;  5KGW A;  2D0C A;  4JKB A;  2YHA A;  1VSM A;  1OVY A;  2LSN A;  3DLL L;  2ZGZ A;  4FWQ A;  4Q5V A;  4Z4G A;  3H6E A;  4W5O A;  3L2U A;  1VQL N;  4CZM A;  1RGI A;  4CHN A;  1N36 K;  1RT2 A;  3OA9 A;  3CD6 N;  1D9D A;  1CLQ A;  1RTI A;  4ELU A;  4FK0 A;  4RW4 A;  4DG1 A;  3MN6 A;  4DTX A;  3NF8 A;  1QE1 A;  3WXK A;  4MDA A;  1L3U A;  3E9L A;  1DKG D;  4IOC L;  3TU5 A;  2NUB A;  1YI2 N;  4FPA A;  3LAN A;  4XH5 A;  1NGB A;  1LAW A;  5BPM A;  3EE8 A;  2YKM A;  3HP9 A;  2BE2 A;  1YTA A;  3KIO A;  3VQA A;  4WFB L;  1VSE A;  1Q8I A;  2ZGY A;  1SS6 A;  1JXB A;  3THW B;  4E1M A;  1NGC A;  3CMA N;  4KHW A;  4FJN A;  1S1U A;  3I8B A;  4N76 A;  4KAZ A;  4OKK A;  1TUY A;  3QBW A;  1XMQ K;  4B9V A;  3VN5 A;  3C65 A;  4LFC K;  1VQ9 N;  1R0A A;  4DLE A;  2HHH K;  4KPY A;  1YIJ N;  3GG4 A;  1ZBU A;  4A59 A;  3ZSQ A;  4CEQ A;  4QCL A;  2Q1N A;  3TSP A;  3LDL A;  4M42 A;  2YNF A;  4Y0W A;  4M41 A;  1NK8 A;  3AO3 A;  3KLF A;  4NB4 A;  1ZBL A;  1NK5 A;  3O80 A;  1SKW A;  1A5V A;  4NLB A;  3I55 N;  1EET A;  3DRP A;  2NRT A;  5SZT A;  2QEX N;  1OH8 A;  3CJ7 A;  4FW1 A;  1NGE A;  4DTS A;  1YHQ N;  2KZZ A;  3LWL A;  5JMV A;  2HHW A;  2P9K A;  3UKU A;  4DTN A;  1GOB A;  3TAF A;  4YFU A;  3LDO A;  2HOE A;  4DV5 K;  2WOM A;  3WXI A;  2F8T A;  1RT7 A;  3VEY A;  3MN9 A;  1B92 A;  4PQU A;  3QO9 A;  4CFD A;  2OAN A;  2P1J A;  4J2A A;  5FRM A;  3M1F A;  5I9E B;  1VAZ A;  5AR0 A;  3ZT2 A;  1VQ5 N;  1XNQ K;  4CJR A;  4IEI A;  5HRO A;  1HYS A;  4NYN A;  3PO4 A;  4DQS A;  3PO5 A;  3HJF A;  5FDL A;  3K5N A;  1K8K B;  3VTI A;  4L8R B;  1SV5 A;  3ENO A;  1LV5 A;  4H5R A;  3G10 A;  3M6G A;  3KK1 A;  1WUA A;  1WBD A;  4YNQ A;  1RDB A;  3KKR A;  2FSN A;  3LWM A;  4O5B A;  4WF9 L;  3U4L A;  1HUX A;  1NGG A;  2VWK A;  1QQC A;  1X9J A;  1MA9 B;  4IJN A;  2Q2R A;  2GWK A;  1EXQ A;  3O4W A;  3THX A;  4N56 A;  3VET A;  5E26 A;  1EO1 A;  3E66 A;  2Z1J A;  1NK0 A;  3HST B;  3U9Z A;  1HX1 A;  3DXK B;  4KKO A;  4B3O A;  2I5J A;  2BH1 A;  4DTJ A;  1ZBF A;  1QSS A;  4FM1 A;  2GUI A;  1NGI A;  2ITG A;  3NDK A;  2RF2 A;  3VQ5 A;  5ADX A;  2HHU A;  3CJ1 A;  3H45 C;  4DR3 K;  1HNX K;  3DAW A;  3LDS A;  4ILJ A;  2V51 B;  3AVC A;  1VQP N;  3DOL A;  4CJ4 A;  3H46 O;  4Q0B A;  3L4I A;  2HNZ A;  4FLV A;  2W40 A;  5CYQ A;  4DUY K;  2HMI A;  2YHY A;  3V1R A;  1WSE A;  1VQ7 N;  4F4K A;  4DR6 K;  3ZT4 A;  4PKG A;  1JXE A;  4IEE A;  3AO1 A;  2O8D B;  3M3Z A;  3OYL A;  3M8R A;  1IKV A;  1OH7 A;  5AQH A;  2Z1G A;  2ZF5 O;  1TK0 A;  1K9M O;  2QKK A;  1X9W A;  4JI5 K;  3NGZ A;  2P9L A;  1ATR A;  4FCY A;  3E1Y A;  3C6H A;  1VSK A;  4I6M A;  3UB5 A;  3CCE N;  2YJF A;  1JCG A;  4X65 K;  2OZM A;  1JL1 A;  1TYQ B;  2QWR A;  1U6Z A;  1WB9 A;  5FRN A;  3DXM B;  4FLW A;  4O5F A;  3Q7C A;  4AM7 A;  3SI6 A;  4DTO A;  4QS8 A;  4C8N A;  3MCA B;  3SV4 A;  4RW6 A;  4IJA A;  3VEX A;  5HOO A;  4M3Y A;  2G8U A;  3QFP A;  4JHD A;  4E0D A;  3HZ6 A;  1RT3 A;  3RTV A;  4FVM A;  3ZX3 A;  3A5O C;  2Z1H A;  3CXC M;  1S6Q A;  2B5J A;  4H5N A;  1MDU B;  4BRG A;  2A40 A;  3DLE A;  4AHV A;  2HND A;  2FXU A;  4W5R A;  3PY8 A;  5C25 A;  1NLV A;  1IBM K;  4YOW A;  5GIN A;  1ASV A;  4FWN A;  3W3D A;  3J80 O;  1HNV A;  1EQY A;  4OPA A;  3V9Z A;  5JVH L;  3TAQ A;  1RDW X;  3TAP A;  1N6Q A;  3A5N C;  3AVJ A;  5E41 A;  4LF8 K;  1ZXO A;  4PY5 A;  3NF6 A;  4CGG A;  2HW3 A;  1TK5 A;  1YAG A;  3C0B A;  2OCE A;  4LF4 K;  3LZI A;  2CGL A;  1VSI A;  4DSF A;  4BGB A;  4BE0 A;  1WBB A;  2YHW A;  1IKW A;  2E88 A;  4V19 S;  3HO1 A;  1TUU A;  1NKC A;  2PAV A;  1ATS A;  1U2V A;  3T69 A;  1G15 A;  1KFD A;  5C12 A;  3SUN A;  2UXC K;  4B08 A;  3D2F A;  4FLX A;  3OJU A;  4C8K A;  3O3H A;  4N41 A;  4CHZ A;  4PUO A;  2YV0 X;  4WQ5 C;  1JLA A;  5BPL A;  5SWM A;  1T6C A;  1ZBS A;  2V7Y A;  1O13 A;  3QIC A;  1XC3 A;  4XH1 A;  3C6T A;  4H03 B;  5M1K A;  3WEE B;  3KLE A;  1W7A A;  2FBT A;  3MEC A;  4FM0 A;  4M7X A;  3RRG A;  1RIL A;  1NKE A;  5AQQ A;  2P9U B;  3NCI A;  5HBM A;  3UE5 A;  5J2N A;  5FPN A;  2RN2 A;  1I94 K;  2O4I A;  3SMP A;  3VA3 A;  4IWV A;  3MAQ A;  3CET A;  3VQE A;  3ZX2 A;  1BDG A;  4TSX A;  2Y1I A;  3SPY A;  2A1S A;  4JK8 A;  2E6L A;  1SQK A;  2OPR A;  3CIP A;  4N47 A;  4W5N A;  4QS9 A;  1BL3 A;  4E7I A;  4H0Y B;  3FZF A;  3SPZ A;  4B9L A;  2GEL A;  3OYG A;  3FZM A;  3F9M A;  4IO9 L;  3AVN A;  3AV9 A;  3UKR A;  4HTU A;  1XI1 A;  3O1W A;  3G25 A;  4BY9 C;  1DGK N;  1KAZ A;  4ZTF A;  1SL0 A;  4BE1 A;  1A5X A;  3VQD A;  3MCP A;  3TSQ A;  1V4T A;  1WSG A;  2OPQ A;  1TK8 A;  1VQM N;  4ID1 A;  3L3V A;  1BO5 O;  4DFM A;  1W97 L;  5AQN A;  3ZSW A;  4FW2 A;  4H0T B;  4ZTJ A;  4JN4 A;  1WSH A;  1Q18 A;  3P31 A;  4CCH A;  3FGU A;  4JEP A;  3O9Q A;  1FJG K;  3NMU A;  2VWJ A;  1JCF A;  4FM2 A;  3C7N B;  5J1E A;  3SBT A;  3BDP A;  4KB0 A;  1RT1 A;  4F9O A;  3QIP A;  4JI3 K;  3FR0 A;  4CZE A;  1BCM A;  4OKE A;  4FWP A;  4A5A A;  1T3V A;  3ZET B;  1X1P A;  2X74 A;  3TAG A;  2Z1I A;  4FO0 A;  5F2R A;  3M5R A;  5HP1 A;  3NGI A;  1SUQ A;  4J2B A;  3RMB A;  2IOC A;  4DTM A;  2A1R A;  5AQI A;  3CHW A;  4CZH A;  1OH5 A;  3KK3 A;  3D6R A;  3L6Q A;  4GVE A;  1C1B A;  4MDB A;  4FJ7 A;  3SV3 A;  5AQT A;  3CCQ N;  4DR2 K;  4A2B A;  4QAG A;  4B1X B;  1TL3 A;  3DLH A;  3BUZ B;  2NRZ A;  3I0S A;  1RDU A;  3RSE A;  2NRV A;  1FXX A;  3J81 O;  1J5O A;  1U48 A;  4AHS A;  3KTQ A;  2CH6 A;  1RDA A;  2WON A;  3AVM A;  1K73 O;  2A42 A;  2G8V A;  1S1W A;  2DTU A;  4YDU A;  1BQM A;  1VSJ A;  2GTD A;  3I8D A;  1GLJ O;  2FF6 A;  3VA0 A;  3R6M A;  4H0P A;  1YJW N;  1V4S A;  2E1Y A;  2NRX A;  1JLG A;  4CEO A;  2KLA A;  2YNG A;  4BWM A;  3THW A;  3O1B A;  2HVI A;  3AVK A;  4DQI A;  4JKH A;  4DV1 K;  1XWL A;  3ATU A;  2KKZ A;  3D0P A;  3DJC A;  1FW6 A;  3RR8 A;  2YNI A;  4RWT A;  3LAL A;  5MLC Q;  2PY5 A;  1QTM A;  5KGX A;  3OYI A;  3M8Q A;  3WUH A;  4FZY A;  3CJA A;  4CJW A;  2GWJ A;  3FZH A;  5I3U A;  3SUP A;  3RMC A;  2QKB A;  3VGL A;  5HLF A;  3EO3 A;  3IDH A;  3ULE A;  2H3G X;  3M8P A;  3CCL N;  3RMA A;  4CJ3 A;  3VEV A;  2VQF K;  2ITM A;  3J7Z O;  5TKY A;  3DRR A;  2OYQ A;  1R59 O;  4PWD A;  1BG3 A;  3HP6 A;  5BRE A;  3LDP A;  4BE2 A;  4CEE A;  3DI6 A;  1ATN A;  1RCH A;  4KBO A;  1C0F A;  4CJU A;  2ZM6 K;  2O8F B;  3RMD A;  3H1V X;  1RTH A;  4JRP A;  4BG9 A;  3TR8 A;  3R3L A;  2HBK A;  4DSK A;  4HCC A;  2E6M A;  3A5M C;  3DWL A;  3QEW A;  1KLN A;  1NJX A;  4DFJ A;  3J7A P;  4Y1C A;  3ZT0 A;  1C0M A;  2B6A A;  4CD1 A;  1FKP A;  1YVU A;  4BRE A;  1K8K A;  2DFH A;  1U04 A;  3EEQ A;  3ZSV A;  2QM1 A;  1Q7Y O;  2HHX A;  1BQN A;  3EKU A;  4H8K A;  1WSF A;  4M45 A;  1BWF O;  3DLR A;  1MWK A;  5A2Q O;  1KD1 O;  1E3M A;  3SQ0 A;  4JI6 K;  3HPH A;  1IKX A;  1J6Z A;  3CCJ N;  3H08 A;  4ISF A;  3K9K A;  4CK2 A;  1H1V A;  2HB5 A;  3KK7 A;  4CZK A;  4JS5 A;  4FJ9 A;  4OLA A;  1Z05 A;  3A5L C;  4FYD A;  1YXQ A;  2Q0U A;  3OYH A;  3HTV A;  3DXK A;  1B9D A;  4FLZ A;  5AQU A;  3KHY A;  3S3N A;  1QVG M;  4KH5 A;  1IH7 A;  3AAP A;  3O4Q A;  3HBT A;  2D0P A;  2ZQB A;  3HOS A;  1LAV A;  5LMU K;  1NKB A;  5HRN A;  1TGO A;  2D4W A;  1I3A A;  3OYK A;  4O0J A;  1W0H A;  4CBX A;  5CE3 A;  3MXI A;  1JKH A;  4DR7 K;  1IKY A;  1HYZ A;  1IV0 A;  1BI4 A;  4E3S A;  1BOT O;  2FSJ A;  4FJM A;  4EP4 A;  3ISN C;  3TTD A;  4OLB A;  1J53 A;  2O8D A;  4O8K A;  4CER A;  1JJ2 M;  3KLG A;  1RNH A;  2YNH A;  4BRI A;  3DOK A;  3NF7 A;  2RKI A;  2IC3 A;  4DV2 K;  2PBD A;  3CG7 A;  1RBR A;  3NH2 A;  4DF4 A;  2B4J A;  1DT9 A;  1Y64 A;  2KHO A;  1NMD A;  4Z94 A;  3SJH A;  4GV9 A;  3PSF A;  2F4V K;  3WQU A;  4BRL A;  4FZX C;  2W6L A;  3B6P A;  2P9N B;  3MMV A;  4J8F A;  4JKD A;  1NK6 A;  2FC0 A;  4KHU A;  5KQD A;  4KFB A;  4E7J A;  4KRF A;  3HVR A;  3VQB A;  3QDK A;  4JKG B;  3JSM A;  3GE1 A;  4JNE A;  3BGR A;  3CM6 A;  3P1G A;  2RE2 A;  5H1S Q;  5C0Y A;  1DTT A;  2IS3 A;  3CI5 A;  2UXB K;  3E9O A;  3WNF A;  4NXN K;  4E19 A;  5C42 A;  3WNG A;  4WQ4 C;  4JI2 K;  4B1Y B;  3KVG A;  3CC4 N;  1L3T A;  4DSJ A;  3S9H A;  5CY4 A;  5BRD A;  5CR4 A;  3DLK A;  1WSI A;  4OX9 K;  3TPQ A;  1C6V A;  1TKT A;  4HUF A;  3TSU A;  4YOY A;  1NK4 A;  2VYP A;  2F8S A;  4PA1 A;  4PL8 A;  1E4G T;  4EZ9 A;  3FZK A;  1BA1 A;  4PKH A;  3PIP L;  4CEB A;  3CFP A;  2NNW A;  4K43 A;  3LPT A;  3SMS A;  4YOU A;  4MO4 A;  4W5T A;  1BCO A;  4FJI A;  5BRH A;  2HBJ A;  3CJC A;  2JGU A;  4XH4 A;  4BQL A;  4LF6 K;  4BRP A;  4B8C A;  3VOV A;  5C2D A;  2UXD K;  5AQR A;  1D5A A;  1LW2 A;  5AJ3 K;  1JCE A;  4CED A;  4JAX A;  3TAB A;  1HPM A;  3G6E N;  1SL1 A;  3T7Z A;  3QNO A;  1QS4 A;  3MN5 A;  4DSI A;  4RW7 A;  1EKE A;  2NRR A;  3ZSR A;  4FWS A;  5CZ1 A;  3V9U A;  4CBW A;  1RT4 A;  4Z4C A;  4H0V B;  4DV4 K;  3CCU N;  3LP3 A;  2A3Z A;  4AHU A;  2HBM A;  1U49 A;  3WEE A;  3R9P A;  1KVA A;  1GOA A;  4BR4 A;  1OH6 A;  2VGM A;  3TAN A;  4K0K K;  4A61 A;  2BAN A;  5EVZ A;  3AAQ A;  3ZYY X;  2QTD A;  1SKR A;  3SK3 A;  2P9U A;  3IAY A;  1TAQ A;  4Z4H A;  1LWE A;  1WLJ A;  3N4Q A;  2V52 B;  2HBL A;  4HUE A;  3QER A;  3AVA A;  4IKF A;  3L0Q A;  3SQ1 A;  4UQG A;  2BUP A;  1KTQ A;  2QWO A;  4BR0 A;  3ZSO A;  3DMJ A;  3O9S A;  1OKJ A;  1HYV A;  4JKA A;  5BN9 A;  1JLE A;  2XY7 A;  4CZG A;  2Q3S A;  3CER A;  3ZEU B;  1K8A O;  2QWL A;  2IVP A;  5M1P A;  4LH4 A;  3QES A;  4JV5 K;  4B8A B;  3P38 A;  3AAR A;  4R79 A;  1E4F T;  1RBV A;  3F9K A;  5LJV A;  3HRG A;  3D2E B;  5AQS A;  3VGK A;  3QEX A;  1UWB A;  1GLL O;  3H3N O;  3JAM O;  1GLF O;  1N5Y A;  3DYA A;  5EXW A;  4NLC A;  1NK9 A;  2HMP A;  1O1W A;  3SAF A;  4ELT A;  2E1Z A;  3P39 A;  4DS5 A;  3AA3 A;  4IO8 A;  1S1T A;  3ZT1 A;  4BVP A;  2HST A;  3O6W A;  4KHN A;  5AQG A;  3P83 D;  1VQN N;  4EHT A;  4GKJ K;  4FJX A;  5EY4 A;  1TKD A;  5ADX H;  3C7N A;  4KTW A;  2W41 A;  5C2F A;  5JIC A;  1S6P A;  4FJK A;  1Q81 O;  4CVN E;  3R1X A;  2V7Z A;  4CF1 A;  1KRP A;  4DQR A;  1P90 A;  1HQE A;  2DY4 A;  4CJ7 A;  5AQY A;  5F1X A;  2G8W A;  3ZET A;  4FVU A;  4JD2 B;  1HJO A;  3J7Y P;  3OJS A;  4J2E A;  3OYN A;  1TL1 A;  3QEP A;  4DV3 K;  4CJK A;  2PFU A;  3LP0 A;  3MEG A;  1ILY A;  4CJE A;  4LH5 A;  4CW7 B;  3OBY A;  4C1N K;  4F3T A;  3L3U A;  3RWU A;  3WT0 A;  4WFA L;  2D1K A;  1GLB G;  5DMR A;  4WCE L;  4JI0 K;  4IDH A;  4WQ4 A;  3VF6 A;  4AIL C;  4DTU A;  4HUG A;  1VSF A;  4DQQ A;  4IZ9 A;  4CZL A;  2P51 A;  5M1N A;  1VQO N;  2J4R A;  1WOQ A;  2QWM A;  3OYB A;  1RT6 A;  3VQ9 A;  3KLH A;  4ILG B;  2JWK A;  4FWM A;  3K5M A; 
#chains in the Genus database with same CATH homology
 4JYA K;  4DR6 K;  2UUB K;  4B3S K;  4B3M K;  4KHP K;  3J7A P;  4JI4 K;  4DR2 K;  4JI5 K;  1N34 K;  4JV5 K;  2UXB K;  4AQY K;  4NXN K;  4X65 K;  1HNW K;  4YY3 K;  3J81 O;  4JI2 K;  1I94 K;  3JAM O;  4DR4 K;  4LF7 K;  4DV5 K;  2UUA K;  4NXM K;  5A2Q O;  4LFA K;  4JI6 K;  1HR0 K;  4OX9 K;  4DV0 K;  4JI1 K;  1IBL K;  4GKK K;  4LF5 K;  4DR1 K;  1XNQ K;  4DR5 K;  1N36 K;  2UU9 K;  4GKJ K;  2UUC K;  4JI8 K;  5LL6 Z;  5IT9 O;  5IWA K;  4YHH K;  4CVN E;  4DV1 K;  1XMO K;  4LF6 K;  4DV7 K;  5FLX O;  2UXD K;  4X62 K;  5LMU K;  5AJ3 K;  1J5E K;  4X64 K;  3J7Y P;  4DR7 K;  3T1H K;  1IBM K;  4DV3 K;  4B3T K;  3J80 O;  4X66 K;  1HNZ K;  1FJG K;  1N32 K;  4CW7 B;  5BR8 K;  2E5L K;  2VQE K;  4DV4 K;  4JI0 K;  2VQF K;  4LF8 K;  4DV2 K;  4LF4 K;  5LMN K;  4LFB K;  4LF9 K;  4JI3 K;  4K0K K;  4DR3 K;  4JI7 K;  1HNX K;  1N33 K;  1IBK K;  4DUZ K;  4V19 S;  1XMQ K;  3OTO K;  2ZM6 K;  3T1Y K;  4LFC K;  1XNR K;  4B3R K;  4DV6 K;  2HHH K;  2UXC K;  2F4V K;  4DUY K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...