4JI4K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4ji4K00
4DR2K 1HNWK 4B3SK 1I94K 4CVNE 5IWAK 2VQFK 4DR1K 4JI4K 4LF4K 1IBKK 4JI8K 5LL6Z 1J5EK 4X64K 4GKJK 4DV4K 4DV7K 2UXCK 4LFBK 4X62K 4JI3K 3J80O 4JI1K 4AQYK 4DR7K 4X66K 1XNRK 4DUZK 4DV0K 4LF7K 3T1YK 4YHHK 4LF6K 1N33K 4LF8K 4DV2K 3J7YP 1XNQK 4NXMK 4DV5K 4JI6K 4LFCK 4JYAK 4JV5K 4DV6K 2UUAK 4DUYK 2UXDK 5LMNK 5A2QO 3OTOK 4DR6K 4V19S 4GKKK 4LF5K 1XMQK 5BR8K 4DV1K 5AJ3K 2HHHK 4LF9K 4LFAK 1XMOK 2UUCK 1N36K 4OX9K 3T1HK 2F4VK 5IT9O 1HR0K 3JAMO 1HNZK 4B3TK 1N32K 4YY3K 2VQEK 1N34K 2UXBK 4JI2K 1IBMK 4DR4K 4NXNK 4DV3K 4DR5K 5LMUK 4DR3K 2UUBK 3J7AP 4JI7K 3J81O 1HNXK 2ZM6K 1FJGK 4JI5K 5FLXO 4K0KK 2UU9K 4CW7B 4B3RK 4JI0K 4KHPK 1IBLK 2E5LK 4B3MK 4X65K
chains in the Genus database with same CATH superfamily
1JCEA 1YVUA 1CZ9A 3D2FB 4DR1K 2P9PB 4LF4K 4FOEA 5JICA 3S3OA 4I6MA 4DLEA 3ISNC 3G4SN 2O8EA 2B6AA 1KTQA 3ZT4A 5DK5A 3W3DA 3ZSQA 4FZXC 3AA2A 4NO7A 2CH5A 4OPHA 1Q8IA 3OYJA 2YCHA 1EXQA 4GY2B 3P38A 3QDKA 5BRFA 2IOCA 1N8RO 2HHVA 2D5RA 2LSNA 3R9PA 3WT0A 3R3LA 2NRZA 3CJ9A 2E4LA 1KLNA 1QSYA 3VQ5A 2PZSA 1K73O 2GWKA 1WNSA 3H46O 3LDNA 4FO0A 4KI4A 1NGBA 4FJLA 5C15A 4O5BA 1F21A 4CEOA 3UKRA 4LH4A 1U49A 3BZCA 1KAZA 4WF9L 1U04A 3EN9A 1VHXA 4DQ8A 2P1JA 1BIUA 4WFNL 3TAGA 3A5MC 4W5QA 3F73A 5AQMA 3WEEA 5F0XA 1JCFA 1VSDA 3ITHA 4FJ8A 4IJAA 3TPQA 4DTXA 4CCHA 4RWTA 4C8OA 1OH7A 4YDUC 3CJAA 3RMDA 5HP1A 1VAZA 3LDQA 3AO3A 4M45A 5FROA 2WC9A 3L8BA 1WSGA 3D6RA 3IDHA 1WAFA 4ILJA 3OYBA 1VRUA 4W5RA 3CC7N 4FJXA 3O08A 5HRPA 1RBTA 3DM2A 1SKRA 1KVAA 1KD1O 3UB5A 4M3XA 1RBRA 5ELZA 3M8QA 3L3VA 4CHYA 4DTSA 1Z05A 3VF6A 3LAMA 4HUFA 3GL1A 2VWBA 3U3GA 4B1UB 5AFUA 5GADP 4FK4A 1C0TA 2P9KB 4E19A 4N76A 3M8RA 3P31A 3F9KA 2A41A 2PYJA 1NWKA 1QHTA 2KTQA 4FK2A 1SL2A 1BI4A 1JLAA 4H0XB 4CEZA 3F5TA 1WSJA 1DGKN 1BISA 3VQDA 4GMJB 3KWIA 3ZCMA 4JEPA 5C24A 3NH2A 3LWMA 2P9PA 3NGZA 4FJJA 3V9SA 3LDLA 1VQON 1QTMA 2XHBA 2W40A 5BPMA 1UA1A 4M63C 1TAQA 4DCHA 1X3NA 3SUQA 4OO1J 3ZX0A 1G15A 3RSEA 2UXDK 3SMSA 5AQZA 1SKWA 3CERA 4IOCL 4DR6K 3DOLA 3GG4A 5GAEP 2JGUA 1XC3A 3RWUA 3FZFA 2QWNA 5FPDA 1YTUA 1X9SA 4KAZA 4PHTX 3KJVA 1BDGA 3EL2A 3QLHA 4OX9K 2ZF5O 1Y64A 3O4QA 3QO9A 3VQ9A 3ZSVA 1NM1A 3THXA 3C7NB 4PWDA 3C65A 4B08A 4B9UA 2P9LB 5J2QA 3G6EN 4DV3K 4DSFA 5HRNA 4DQPA 4KHQA 2JWLA 3ATUA 2IGIA 1RDBA 1IO2A 3K5NA 3HP9A 2W6LA 3HM8A 4UY8O 4DTNA 4DB3A 4AHUA 4B3RK 3L4QA 1T05A 4CGDA 5BR9A 4BRPA 3SPYA 1NGCA 1S1WA 4KREA 1JLEA 2E5LK 4FJIA 3VEYA 1U2VB 4GNIA 3KK3A 5C2FA 5AQNA 2E88A 1IV0A 4DMNA 3FR0A 4I6MB 1NGJA 4JKHA 3I0SA 4BR2A 1QSSA 3BZKA 4FJ9A 1NMNA 1VQ4N 1J9AA 2O8BB 4X62K 4Z4EA 2PYLA 3VA3A 4L8RB 3K5MA 4X66K 1HKBA 5KI6A 3IMXA 3C0BA 3VEVA 3VQEA 4CZFA 1N33K 4FWRA 5FRMA 4CJ4A 2OPSA 3J7YP 3OYCA 4J2EA 4IKFA 4C8LA 5FPNA 4KPYA 4LSNA 1NJXA 2FLOA 1WBBA 4A2BA 4MFBA 4OPJA 3O9SA 2OPPA 4JHDA 4F2SA 5B8HA 4J8FA 3RMAA 4DLGA 5A2QO 2A6AA 3AVLA 1SZ2A 2WONA 3VGLA 3TR8A 1VSJA 3SNNA 3MCAB 4HUGA 2D0OA 1Q81O 2NRXA 3SQ0A 4B1YB 4K43A 4CIFA 4QS7A 2P9LA 3KLEA 5AJ3K 5AQWA 2KFNA 4CZIA 4BQZA 3FZHA 1YXQA 3KKSA 4KTZA 1NJZA 2HNDA 1S1XA 1B92A 5AQHA 1N36K 1ASUA 1S9GA 4JK7A 4C8NA 2IVOA 1RTHA 5EXWA 3CJ7A 3SMPA 4HCCA 2B5JA 3T19A 3VTHA 1QQMA 3BDPA 3V81A 4BRNA 3PX6A 4FLTA 4CJTA 3CQXA 4K41A 4DR3K 3O4WA 4KHWA 4JKFA 2X78A 1HNXK 2Q3SA 1TV6A 3K0SA 3E9OA 4Z4CA 3HVRA 4B1ZA 5M1OA 3NVMA 5KRSA 3OYMA 2OZSA 5JS1A 2Q36A 2O4IA 4B3MK 2FBTA 5KQDA 5AQFA 3M1FA 1U47A 3TSUA 2Q0RA 3AGKA 1W97L 4JI4K 4PQUA 3OBWA 5AQIA 1IBKK 4WQ4C 4JI8K 2ZQBA 4KBOA 3J8AA 4WQ5C 4OLAA 2PFUA 3OYDA 2G8HA 3DI6A 4OLBA 3O3GA 2E20A 1BA1A 3RR7A 3C7NA 4CESA 3ZT2A 3DXMA 3P83D 4FJMA 1G99A 3T1YK 3GBTA 2HMIA 2OTLN 3WUHA 3VQPA 4LC9B 2HBJA 4FPBA 1CLQA 4H0VB 2VCPA 4E1NA 4FWLA 3BGRA 3WEEB 1EP4A 1K8AO 4JV5K 3EY1A 4O8UA 3ZEUB 3QEPA 4C8KA 2QWLA 3VQBA 3SZ2A 5KPTA 1N6QA 1W9HA 3PY8A 1T6CA 4LF5K 4DQIA 4JN4A 4DTOA 4JKAA 4FVUA 4OPAA 3V1QA 4H4OA 3ZETA 3WNFA 3K5LA 1MDUB 4BRLA 2E2QA 1RT7A 2P9SA 3I8BA 3DXKA 2V52B 1T3VA 3HOTA 3AVFA 3H3NO 5AQGA 1CZBA 3CIPA 3MX2A 3QFPA 3AO2A 2H3GX 3BP8A 3K9KA 2EWSA 1JL2A 3OA9A 3CPEA 3I0RA 2A42A 4NXNK 3A5OC 1NJIO 4O5FA 3ULEB 5FPMA 1IKWA 3QBXA 1WBDA 3E01A 4DU4A 5KPRA 1EWQA 4CIGA 2HHQA 4IOXA 1TUYA 1YT3A 1HUXA 1YVNA 3TANA 4JI5K 4H03B 5E26A 1HYSA 3A0IX 4HCBA 3CC2N 2HHTA 1J53A 1E4GT 5KQ8A 5HROA 4B9MA 3VENA 3O80A 4IOAL 3W0LA 2W6KA 4DQRA 4FCYA 3SV4A 4YOTA 4CF0A 4E7LA 4CVNE 1NGAA 1NK0A 3B6OA 4TSXA 3LDPA 2HBMA 4CJKA 4FLWA 3P39A 1OKJA 3Q7CA 3KK7A 4LFBK 2ZWHA 4JK9A 2FF3B 3WXKA 1KRPA 5CYMA 3HT3A 3J80O 4JI1K 3C6AA 2KZZA 4H5WA 1UA0A 1D9DA 3HJFA 4A57A 5J2NA 4BGAA 3VEOA 4WE1A 4DV2K 4PKGA 2IVPA 3OBYA 3NAEA 2XY6A 4RW7A 4CF9A 4DV5K 4FLVA 4M7XA 3UKUB 2QWMA 2X6SA 4YFUA 3V4IA 5I9EB 3MWPA 2E6MA 5F2RA 3V1RA 3CM6A 3NH0A 2YNHA 4FWOA 4PY5A 4JK8A 4DTPA 5BRHA 3U6FA 4JLHA 3O9TA 3VEZA 3VEWA 4LSLA 3UE5A 4J2DA 4BWMA 3DLHA 1KCFA 3HI0A 3AA3A 1XMQK 4FZYA 4FM0A 1JXEA 1RDAA 4CIEA 3CM5A 1GLJO 4N5SA 3K5OA 3HYFA 4GV6A 1NK9A 4ISFA 4CJ3A 2NRRA 3U9ZA 4M7YA 4DFMA 3OJSA 3QNNA 3PO5A 3AVBA 1HR0K 1BU6O 2QK9A 1HNZK 3SI6A 4KTQA 2NRTA 4CZLA 3KLGA 2BDPA 2FBYA 3NVKA 1VSIA 2HB5A 4FVMA 4FLUA 5EU7A 2FBXA 3KTQA 1YF5L 5KPZA 2RPIA 4A5BA 2HSTA 5DM6L 4B3OA 2ETJA 2QXFA 3M3ZA 3UKRB 1L5UA 4CEDA 2ZD1A 3VA0A 3CMEN 2BUPA 1X1PA 4FM2A 3E66A 4QOZB 3THWA 3QMLA 3AVNA 4JI0K 5AQSA 4BR4A 5DMRA 2F8TA 3VQAA 1GLBG 1HQUA 4ELVA 3AAPA 1HNWK 3QFUA 3ALYA 3SUOA 2FXUA 1C1AA 3OYAA 4HHTA 1HRHA 3TU5A 3S3NA 4MDBA 3ZYYX 4KFBA 2D1KA 2G8WA 2QA4N 2NLXA 3D7EO 4OKJA 4DSJA 1FKPA 2O8EB 5BN8A 1IG9A 1RDUA 2P5GA 1QZ5A 1Z25A 3E9PA 3IG1A 2E2OA 3VQ7A 1RT4A 1ZBIA 5EY4A 1JCGA 4BE1A 3RRHA 4M3WA 2OYQA 2A1SA 4NXMK 3V1OA 1VSKA 3RMBA 3CCRN 3PSIA 2YJEA 1NK5A 5H1SQ 2IS3A 2P9IB 3KLHA 1NOYA 4M3UA 3P1GA 4DFJA 3SBGA 5CR4A 2DFHA 2F96A 4U67L 5J1EA 2Q2RA 3G0ZA 1JXBA 1NGFA 3CCVN 1VQNN 2QWOA 4W5NA 3SQ1A 5K14A 3ZX3A 5CHIA 3EE9A 3MN7A 2WUSA 2Q0UA 3C6HA 3DYAA 3CXCM 1S1TA 4BR9A 2YNIA 3VF4A 2ZJRL 2V51B 3CQYA 4H5NA 4OPKA 2ITMA 2HHUA 4LF9K 1LW2A 3ID8A 2IAJA 3MN6A 3H1QA 3FFKB 1ATSA 3SJJA 4FWQA 3CPWM 3LPUA 4QAGA 5HRSA 2NRHA 1KXPA 5ADXA 2GBZA 4CJRA 4DR4K 3EKUA 3P5JA 1S6PA 1Z26A 2NRWA 5KRTA 4JI7K 5AQLA 1GLEG 1WN7A 2BH1A 2RE2A 1XUPO 4R79A 3DLBA 2G8FA 1OH8A 4O0IA 3LM2A 1ZBLA 1DT9A 1A5WA 3AVJA 5JVHL 2KKZA 1S5JA 3I8DA 3AA5X 3GDQA 4NLCA 4NYFA 3TWHA 4DV4K 4ISGA 3KHYA 4EHTA 1ZBFA 2Z1IA 4B9QA 4XH5A 3AV9A 1O1WA 3U4LA 4CBUA 4CFDA 2QWRA 4Z94A 4AQYK 1M90O 1Z6RA 1YJ9N 4FWMA 3IS9A 4AHCA 1WSEA 1QVGM 2E6LA 3H1VX 4ELTA 4DU3A 4BG9A 1KC8O 4ILHA 4H8KA 4MDAA 1A5XA 1U2VA 2FSNA 1VQ5N 3MEEA 2IC3A 3SV3A 1ITGA 1NOZA 3DLGA 3OYFA 1SQKA 4M41A 1EX4A 3QINA 2XY7A 1TYQA 3VQQA 3FZMA 2QTDA 4AF1A 1TYQB 1NKBA 2A40A 3OS1A 3OYGA 3DXKB 1HLUA 3SLCA 2BTFA 5AQJA 4CJLA 3O1WA 4C1NK 3QIPA 1GLLO 1BQNA 4NLBA 1S22A 4IBNA 1LCUA 3KZBA 4C1NI 2Q31A 5AFUH 1NG9A 3D2EA 4BDPA 3LPTA 1IBMK 4BRDA 4E89A 1QZ6A 4RW9A 4CJ5A 1BQMA 3OS0A 2UUBK 3CJBA 1TKXA 1SV5A 1FJGK 3LDSA 5E41A 3VQ4A 4CJSA 3MAQA 4RG8A 2GV9A 3NF9A 2ATQA 3DJCA 2GWJA 4EP5A 1W0HA 4CZGA 2IDOA 4G1QA 3O9RA 4X65K 3TAFA 1HNIA 3EZ5A 2O8DA 3SAHA 2JLEA 4GW6A 4IZ9A 3ATVA 2P9IA 3KD1E 3NGYA 3IFRA 5BPLA 2PBDA 1U48A 4IO8A 3T7ZA 1NJWA 4H5TA 4F4KA 5CZ2A 4UQGA 3HXMA 4BE0A 2YHXA 3R1XA 4NCAA 3G10A 4YOXA 1K8KA 3HPOA 1L3UA 1KAYA 4EZ6A 2WOMA 1WUAA 1BIZA 1HYVA 1OH5A 4KH6A 4FLYA 1GOCA 4EP4A 1NGIA 5D3GA 3O3FA 1R0AA 1TL1A 2QKKA 1EETA 4KH4A 3LWLA 1C0GA 3H3OB 4KH5A 5LJWA 1Q82O 2VG6A 2O8CA 5AZIA 3HM9A 3CYMA 2HHXA 4BROA 1HJRA 3NE6A 2G8IA 5BR8K 3QIOA 1ASVA 5SZTA 5C12A 4IG3A 2E1YA 3SQ4A 3QICA 1BA0A 4A2AA 4CHQA 3VQCA 2Z1JA 4K8ZA 4XH4A 1YJNN 4IFVA 4IFYA 3ULDA 3OW2M 2RHKA 1RGIA 1QQCA 3WXMB 3WQTA 1JLBA 5JS2A 4JRPA 3CMAN 1UAXA 4O0JA 3OJUA 3BEXA 2CGJA 4PUOA 1NGEA 2FBVA 1WSHA 3OHRA 4JHDB 4DKWA 3FZLA 2Q1NA 1RT2A 3TSQA 5KGXA 4DR5K 3SQ2A 4ISEA 1GOBA 4JKDA 4LD0A 5ADXH 4EHUA 3EKSA 3LL3A 4K25A 4H4MA 1HJOA 4Q5VA 3NDKA 1ASWA 2VGMA 4CJWA 5AQTA 3AAQA 1TVRA 3V9UA 1YUWA 2HOEA 1TKZA 5HOOA 3FZKA 3NCIA 3CG7A 1NBWA 1NU0A 4BRHA 1VQMN 4JRQA 3D2FA 1J5EK 4CJ7A 1JLQA 3K59A 3LZIA 4XH1A 2I5JA 3TABA 1HQEA 4Z4IA 4Y1DA 1RBVA 4N41A 1KVBA 1K9MO 3AVKA 4JKGB 4CZMA 4RW4A 3HP6A 3F2KA 4KHNA 3RRGA 4NYNA 3CCEN 2NZTA 4PL7A 1YAGA 3OYIA 2O8FB 3A8YA 3IAYA 4FWPA 3SUPA 4CERA 3HBTA 3CFRA 3BUZB 4NCBA 4M3YA 4CJEA 3HPHA 4CHZA 1TKDA 3NMUA 2E2NA 1VSLA 4OGCA 1EWRA 3UIQA 1DLOA 3D2EB 5AZJA 4EIAA 4WFBL 5C0YA 2FSJA 2G8UA 2BE2A 3NF7A 2Y1IA 1DKGD 3KK2A 2YHWA 1ZYQA 2D0BA 2F7TA 3T1AA 4AM6A 3AO4A 4CZEA 1RT6A 3R8EA 4W5OA 2YHAA 4QS9A 3SBTA 4CEEA 3FGUA 1D8YA 1B9DA 2HHHK 1XQSC 4B8AB 2UUCK 3RMCA 3DLKA 5HRRA 3SJHA 4BRQA 4DF4A 3R6MA 1W2BM 1BUPA 1Q18A 4JI2K 2E1ZA 1NK4A 4I7FA 3LP1A 2E2PA 3OYNA 4AHRA 4DF8A 5LMUK 4ICLA 1S6QA 3VGMA 3CC4N 3THYA 4MO5A 4K0KK 3DLLL 1JLCA 5TKYA 2QW9A 3WXJA 1OVYA 2GTDA 3QETA 1IBLK 4Q0BA 2O8BA 1N32K 4KB1A 3TAPA 1L3VA 4AHVA 1VQPN 3O1BA 4CJVA 3QEVA 2FC0A 1GLCG 2DFEA 1EKEA 4KV8A 4A5AA 4F3TA 1CZAN 1ESVA 3K9JA 3NBPA 3HO1A 3AVAA 3IRXA 4BC2A 1LW0A 3LP3A 3ENBA 3O4NA 3FFIA 2Z1HA 4OGEA 4BY9C 3ID6A 1XNQK 4DSKA 1NK7A 4IEIA 1QHAA 5CY4A 5SWMA 3AVHA 2FF6A 4KI6A 1DEJA 3O9QA 1UOCA 5AR0A 4DUYK 3VMFB 1K6YA 5LMNK 1IKVA 3GOIA 3EE8A 4V19S 3RTVA 4CJFA 3V6DA 2B4JA 1OH6A 1D9FA 3CCQN 4KKOA 4YOWA 4BG8A 1IKXA 2HVHA 1CXUA 2ASOA 3DLRA 3PLAA 1REVA 4BWJA 1IG8A 1RTJA 3L0QA 3OYEA 3L2RA 3E1YA 2OANA 4PKHA 5E84A 3EEQA 3VTIA 5LY3A 4DTMA 2Z1GA 1ZBUA 3V9WA 4OJRA 3K58A 3MN9A 3A5LC 5J2PA 3HSCA 4DFKA 2YJFA 2NRVA 1RILA 1TUUA 4A62A 4FJKA 4CK3A 1RDWX 3VN5A 1WSIA 4BRIA 1MA9B 4B8CA 3MCPA 4O8KA 1NKEA 4H0OA 4JD2A 4DTRA 4IEEA 1HNVA 2I7NA 3BY5A 3L4IA 4ILGB 1DTTA 2F9TA 2V7YA 3TTDA 3OYKA 1IH7A 1YTAA 4YDUA 1J54A 2VQFK 1MWMA 1BCOA 5DM7L 5LL6Z 3IUCA 3A2FA 2YV0X 4KHSA 2CGLA 5BN9A 1C6VA 1FXXA 4FL9A 5CZ1A 3RVCA 4QS8A 3MECA 4ZTJA 3HTVA 4DR7K 3L2WA 2HNYA 4DS5A 3PV8A 1U6ZA 4BDYA 2GUPA 4J2BA 4FWNA 3WXIA 4FWKA 4DV0K 3SPZA 3G71N 1ZC6A 3VETA 3CF5L 4CGHA 1BGXT 4RTFD 2BGGA 1ILYA 2RKIA 1C0UA 4HWIA 4JI6K 3IKMA 4JYAK 5EX5A 3ZSZA 3SAGA 4HVJA 1TK0A 1T7PA 1XC9A 3NF6A 2KLAA 3DRSA 4PA1A 4YORA 3PIOL 3OYLA 3CCMN 4FJHA 1JLGA 4MQ3A 1YITN 4JS5A 1X9WA 2HMPA 3THWB 2OPQA 1ZBHA 1IKYA 3MX5A 2PY5A 4H0PA 1BG3A 1ZBSA 3H08A 4DG1A 1BOTO 3I55N 5IT9O 2PAVA 1NMDA 4AHSA 1K8KB 3VERA 1TK8A 2Q97A 4BC3A 3J7ZO 3THXB 1SS6A 3O8MA 1WAJA 3ZT0A 5JMVA 2VQEK 1J6ZA 3VEXA 3P4IA 4HTLA 4A59A 4OVLA 4BR5A 1KQSM 4G9ZA 2I7PA 2YKNA 4A61A 3KVGA 3MDQA 4IJNA 4ID1A 3SAFA 4MO4A 4F8RA 4CK2A 4IG0A 4O4GA 3VF2A 3QERA 3A5NC 4E1JA 3MXIA 3O3HA 4FJNA 4Z0UA 5JVGL 5I3UA 3ZX2A 4LH5A 5EVZA 3CI5A 2J4RA 2ZJPL 5AQXA 2HF3A 4YOVA 3QESA 4B1WB 5GIOA 2V7ZA 3O9UA 5BRDA 4YOUA 4YOYA 5BREA 1TL3A 1S72N 4F3OA 3LAKA 5GAHP 3LDOA 3KK1A 3CCSN 4BACA 1QE1A 3KLIA 4Y1CA 3S3MA 2P9NA 4GVEA 4KO0A 3HZ6A 4YHHK 3OY9A 3LP0A 2P51A 4MLEA 4CBWA 4CGGA 1VK0A 4CZHA 4B9SA 3ULEA 3PUFA 3QNOA 4CBXA 1P8ZA 4LFCK 3KWGA 2FSKA 3WXLA 4KHUA 3G25A 3F9MA 4BC5A 3U9DA 4JKCA 2UUAK 2F9WA 4RCHA 2X6NA 3K57A 3E9LA 1V4TA 4Z4HA 1YIJN 4BRGA 4IDHA 3AVGA 2QEXN 1FW6A 1UWBA 3PSFA 2VWJA 3EZWA 3NF8A 4CJPA 1XI1A 4BGBA 5EOYA 4CI6A 4ZHRA 3HRGA 1U45A 4CZJA 1SKSA 5KTQA 5J2MA 4YNQA 2D0CA 3PIPL 1D5AA 5AQYA 3M5RA 4B1VA 2WTUA 3CD6N 3B8AX 1VQLN 2GX9A 2D4WA 3AVMA 5AQUA 5TKWA 1NK8A 1M1KO 3RSEB 3L2QA 3J7AP 2CGKA 3PX0A 4BRKA 2AP1A 3L2UA 3M6GA 1XWLA 4B9TA 4CFCA 4BVOA 4CW7B 4H0YB 1LWCA 2P9UA 3DRRA 2ZJQL 2ASMA 4AM7A 4N47A 1DTQA 1U4BA 4AHTA 1BWFO 1RNHA 4BRCA 1LV5A 5GIPA 4B3SK 1I94K 1QS4A 1TK5A 4B1XB 3SYZA 2ZE2A 2QWQA 3VQ8A 3D45A 3UKUA 4B9LA 1KAXA 1VSMA 3QB0A 3ZT1A 5AQKA 2KFZA 3VPZA 3L3UA 4JNEA 4NCGA 4FJ7A 2YX6A 1IJJA 3CFOA 3CCLN 4HTUA 3VQ6A 4JKEA 3WQUA 1C0MA 3AGRA 3MEGA 3ZSXA 4CHNA 4LF8K 4F9OA 3ASMA 3HOSA 2ZGYA 3AVIA 2VWKA 1RFQA 5HL7L 3BF3A 4IO9L 4KHYA 3S41A 5FRNA 4U7BA 4CEAA 1VQ6N 3TAEA 5AQOA 1I39A 2VGNA 1X9MA 3OTOK 1RBUA 1TKTA 1GLAG 4K42A 4FYDA 4E7JA 4FSVA 4CE9A 4MLHA 3TSPA 5FDLA 4AH9A 3CHWA 2HF4A 1T44A 4DSLA 2Y1JA 2ITGA 3ZEUA 4GV3A 4E1MA 1C1BA 4BE2A 1RDDA 2OTJN 3MEDA 3JAMO 3ZSWA 2A5XA 4FW1A 1O13A 3QEXA 1W7AA 3MN5A 2NUBA 2XRIA 1JL1A 3BF1A 3JS6A 5M1FA 4I2QA 2HHWA 3QBWA 1N34K 3H6EA 4I9QA 4GV9A 4BDZA 1HPMA 4FOIA 3PO4A 1ZXOA 2BANA 2QI2A 5M1PA 3SCXA 2P9SB 2YNGA 5I42A 1TGOA 3EYZA 5FLXO 3D0PA 3LALA 2P5OA 4N56A 4CJQA 1LWFA 3V9XA 1Q7YO 4B9NA 1YHQN 4JAXA 1LOTB 2ASPA 3VGKA 4JKBA 1RDCA 4K8XA 4CHPA 4KRFA 3LZJA 1QQOA 2A3ZA 3M8SA 3ENOA 1JLFA 1E4FT 2KQ2A 4CK1A 3S9HA 2HVIA 1N5YA 1HYZA 4BVPA 4Z4FA 3CJ1A 2OCEA 2ZGZA 3NFAA 4E3SA 1BO5O 2AA4A 4I9LA 3ZSOA 5BPNA 1EQYA 1CXQA 3CETA 1RBSA 1S1VA 3DXMB 3N4PA 5T7BA 4RW6A 2O4GA 1KSPA 4LF7K 3CJCA 4AILC 1NGDA 5AQVA 1WB9A 2W41A 4LY7A 3KLFA 4E0DA 3O5BA 3HL8A 1GLDG 1RT5A 2X74A 3MWTA 5AQRA 4ID5A 1JJ2M 3JXUA 1HMVA 3U3YA 5JLHA 1H1VA 4B9VA 4FZZA 3O6WA 3ZETB 3SUNA 1E3MA 4WQ5A 2NNWA 3CCUN 1X3MA 2RF2A 2W42A 3U8XA 4WQ4A 2VG5A 1VSFA 4GKKK 1KFDA 1XHXA 1GLFO 3RR8A 5C2DA 4M3ZA 3MK6A 3AO1A 4CHOA 3THVA 4DSEA 1VSEA 4I2PA 1L3SA 1VRTA 3DWLA 1VQKN 3ZLJA 2F4VK 2HNZA 3C6TA 2O8FA 1VSHA 3VESA 3C94A 3HVTA 2HW3A 3TTCA 1SL0A 4DQQA 4JKGA 1EO1A 1RT1A 2VYPA 4H0TB 3AO5A 5MLCQ 4FW2A 2OZMA 5AZIB 1QQNA 3TAMA 3J81O 4EZ9A 3JYTA 2QWPA 3MMVA 1S9EA 1LWEA 4CGFA 5F1XA 2RN2A 1D4XA 2A1RA 1NNEA 4Y0WA 4KHPK 3AVCA 4L3QA 1Q9YA 1FKOA 2P9KA 3FLCO 4J2AA 4DR2K 4DQSA 3MXMA 3DMJA 1SAZA 1MU2A 1TAUA 4X64K 4GKJK 1NGHA 3AARA 4CD1A 4KTWA 4M3TA 1JKHA 2DTUA 1FK9A 1B9FA 4JI3K 5LJVA 3ZSYA 2YKMA 4E7HA 4PKIA 4CGJA 1XNRK 4BQLA 2GELA 3NH1A 2EHGA 4CF2A 4DUZK 2D0AA 3B6PA 3C95A 3OYHA 3TTFA 3L2VA 3MXJA 5C10A 4FXDA 2XY5A 1QSLA 3WNGA 3DRPA 4M3RA 4RW8A 4JS4A 4F2RA 2QXLA 1RCHA 4HUEA 2YHBA 3JSMA 1Y97A 1NLVA 2YNFA 3C6UA 1HX1A 2G8VA 5GINA 3ZT3A 4FPAA 4C23A 2OPRA 4CEFA 4R5PA 1ATRA 2GUIA 4E7IA 3TAQA 4JD2B 4O44A 1V4SA 3SK3A 4OKEA 4KB0A 1KVCA 1YI2N 4DFPA 3I33A 5M1KA 4BR7A 5HLFA 2GEMA 2OA8A 4DHYA 2KHOA 3LM9A 1QVFM 1S3XA 4DV1K 3TI0A 1RTDA 2HHSA 4IXCA 3TARA 3N4QA 3EO3A 1XMOK 1GOAA 2D0PA 1KFSA 3T69A 2UYTA 4DTJA 2R7YA 4DTUA 3HK2A 3M8PA 3CCJN 3DLEA 3CQ8A 4BR0A 1NJYA 3I56N 3VOVA 4CGIA 1ATNA 2IIRA 2O8CB 1T03A 1BHLA 1VQ7N 4FJGA 2HBKA 1VQ8N 2JWKA 1BL3A 1BI4B 1NKCA 1T6DA 4CFAA 2ZM6K 1LAVA 5JLFA 2DFFA 1L3TA 1I3AA 1HPZA 3AA4A 2CH6A 5FPEA 4ELUA 3OVNA 3DOKA 3K2PA 5C25A 1R59O 2YHYA 3WNHA 4H5RA 1X9JA 5IWAK 3AY9A 4WCEL 3LANA 4NB4A 3OS2A 4DV7K 3KKRA 3FE1A 4EFHA 1T8EA 2UXCK 5HBMA 4XEIA 4CZKA 2WFBA 4WFAL 2HBLA 2DPNA 4PL8A 1WLJA 2F8SA 2VG7A 3LP2A 4EAHD 2P9UB 4FK0A 1WSFA 3ZSRA 2O8DB 4O55A 1WOQA 2EX3A 3THYB 1YJWN 4BREA 3GE1A 4Z4GA 4DU1A 1HKCA 4LF6K 4FLXA 1C0FA 3PX4A 5CE3A 4IDKA 1LAWA 1OVQA 3L6QA 3DAWA 4C8MA 2G8KA 4WYBA 4CD3A 4ZTFA 4BRMA 1SUQA 3CFPA 4DV6K 5AQPA 4CFBA 3V9ZA 4W5TA 1NGGA 2WBNA 4CF1A 1XHZA 4CECA 1NK6A 1VQ9N 1HKGA 3KIOA 2XY8A 4CEQA 4FLZA 3HPGA 1BCMA 5M1NA 4DS4A 4BRFA 5KGWA 3ENHA 1J5OA 3WNEA 1KLMA 2KW4A 4DSIA 3QEIA 3QEWA 1S1UA 4CF8A 4LFAK 2QKBA 3HSTB 4GVMA 4M42A 4QCLA 2KZMA 2IVNA 3T1HK 5CYQA 2XO7A 5GAGP 3KD5E 3T3FA 4H5VA 4B3TK 1C1CA 1RT3A 4YY3K 4FWSA 3NHGA 1P90A 2UXBK 4IFEA 5C42A 4CEBA 4IWVA 4OKKA 5AQQA 1SL1A 1MWKA 3H45C 4CJUA 4XIUA 2P9NB 1Q86O 4E7KA 1Q9XA 4FJ5A 4DWIA 2DY4A 3Q7BA 2UU9K 5AZJB 3NGIA 4BC4A 4BRAA 1RTIA 2E8AA 2QM1A 5M1QA 1A5VA 2YI1A 4FM1A 2AJQA
chains in the Genus database with same CATH topology
4DR2K 1HNWK 4B3SK 1I94K 4CVNE 5IWAK 2VQFK 4DR1K 4JI4K 4LF4K 1IBKK 4JI8K 5LL6Z 1J5EK 4X64K 4GKJK 4DV4K 4DV7K 2UXCK 4LFBK 4X62K 4JI3K 3J80O 4JI1K 4AQYK 4DR7K 4X66K 1XNRK 4DUZK 4DV0K 4LF7K 3T1YK 4YHHK 4LF6K 1N33K 4LF8K 4DV2K 3J7YP 1XNQK 4NXMK 4DV5K 4JI6K 4LFCK 4JYAK 4JV5K 4DV6K 2UUAK 4DUYK 2UXDK 5LMNK 5A2QO 3OTOK 4DR6K 4V19S 4GKKK 4LF5K 1XMQK 5BR8K 4DV1K 5AJ3K 2HHHK 4LF9K 4LFAK 1XMOK 2UUCK 1N36K 4OX9K 3T1HK 2F4VK 5IT9O 1HR0K 3JAMO 1HNZK 4B3TK 1N32K 4YY3K 2VQEK 1N34K 2UXBK 4JI2K 1IBMK 4DR4K 4NXNK 4DV3K 4DR5K 5LMUK 4DR3K 2UUBK 3J7AP 4JI7K 3J81O 1HNXK 2ZM6K 1FJGK 4JI5K 5FLXO 4K0KK 2UU9K 4CW7B 4B3RK 4JI0K 4KHPK 1IBLK 2E5LK 4B3MK 4X65K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 K;  1HNW K;  4B3S K;  1I94 K;  4CVN E;  5IWA K;  2VQF K;  4DR1 K;  4JI4 K;  4LF4 K;  1IBK K;  4JI8 K;  5LL6 Z;  1J5E K;  4X64 K;  4GKJ K;  4DV4 K;  4DV7 K;  2UXC K;  4LFB K;  4X62 K;  4JI3 K;  3J80 O;  4JI1 K;  4AQY K;  4DR7 K;  4X66 K;  1XNR K;  4DUZ K;  4DV0 K;  4LF7 K;  3T1Y K;  4YHH K;  4LF6 K;  1N33 K;  4LF8 K;  4DV2 K;  3J7Y P;  1XNQ K;  4NXM K;  4DV5 K;  4JI6 K;  4LFC K;  4JYA K;  4JV5 K;  4DV6 K;  2UUA K;  4DUY K;  2UXD K;  5LMN K;  5A2Q O;  3OTO K;  4DR6 K;  4V19 S;  4GKK K;  4LF5 K;  1XMQ K;  5BR8 K;  4DV1 K;  5AJ3 K;  2HHH K;  4LF9 K;  4LFA K;  1XMO K;  2UUC K;  1N36 K;  4OX9 K;  3T1H K;  2F4V K;  5IT9 O;  1HR0 K;  3JAM O;  1HNZ K;  4B3T K;  1N32 K;  4YY3 K;  2VQE K;  1N34 K;  2UXB K;  4JI2 K;  1IBM K;  4DR4 K;  4NXN K;  4DV3 K;  4DR5 K;  5LMU K;  4DR3 K;  2UUB K;  3J7A P;  4JI7 K;  3J81 O;  1HNX K;  2ZM6 K;  1FJG K;  4JI5 K;  5FLX O;  4K0K K;  2UU9 K;  4CW7 B;  4B3R K;  4JI0 K;  4KHP K;  1IBL K;  2E5L K;  4B3M K;  4X65 K; 
#chains in the Genus database with same CATH topology
 1JCE A;  1YVU A;  1CZ9 A;  3D2F B;  4DR1 K;  2P9P B;  4LF4 K;  4FOE A;  5JIC A;  3S3O A;  4I6M A;  4DLE A;  3ISN C;  3G4S N;  2O8E A;  2B6A A;  1KTQ A;  3ZT4 A;  5DK5 A;  3W3D A;  3ZSQ A;  4FZX C;  3AA2 A;  4NO7 A;  2CH5 A;  4OPH A;  1Q8I A;  3OYJ A;  2YCH A;  1EXQ A;  4GY2 B;  3P38 A;  3QDK A;  5BRF A;  2IOC A;  1N8R O;  2HHV A;  2D5R A;  2LSN A;  3R9P A;  3WT0 A;  3R3L A;  2NRZ A;  3CJ9 A;  2E4L A;  1KLN A;  1QSY A;  3VQ5 A;  2PZS A;  1K73 O;  2GWK A;  1WNS A;  3H46 O;  3LDN A;  4FO0 A;  4KI4 A;  1NGB A;  4FJL A;  5C15 A;  4O5B A;  1F21 A;  4CEO A;  3UKR A;  4LH4 A;  1U49 A;  3BZC A;  1KAZ A;  4WF9 L;  1U04 A;  3EN9 A;  1VHX A;  4DQ8 A;  2P1J A;  1BIU A;  4WFN L;  3TAG A;  3A5M C;  4W5Q A;  3F73 A;  5AQM A;  3WEE A;  5F0X A;  1JCF A;  1VSD A;  3ITH A;  4FJ8 A;  4IJA A;  3TPQ A;  4DTX A;  4CCH A;  4RWT A;  4C8O A;  1OH7 A;  4YDU C;  3CJA A;  3RMD A;  5HP1 A;  1VAZ A;  3LDQ A;  3AO3 A;  4M45 A;  5FRO A;  2WC9 A;  3L8B A;  1WSG A;  3D6R A;  3IDH A;  1WAF A;  4ILJ A;  3OYB A;  1VRU A;  4W5R A;  3CC7 N;  4FJX A;  3O08 A;  5HRP A;  1RBT A;  3DM2 A;  1SKR A;  1KVA A;  1KD1 O;  3UB5 A;  4M3X A;  1RBR A;  5ELZ A;  3M8Q A;  3L3V A;  4CHY A;  4DTS A;  1Z05 A;  3VF6 A;  3LAM A;  4HUF A;  3GL1 A;  2VWB A;  3U3G A;  4B1U B;  5AFU A;  5GAD P;  4FK4 A;  1C0T A;  2P9K B;  4E19 A;  4N76 A;  3M8R A;  3P31 A;  3F9K A;  2A41 A;  2PYJ A;  1NWK A;  1QHT A;  2KTQ A;  4FK2 A;  1SL2 A;  1BI4 A;  1JLA A;  4H0X B;  4CEZ A;  3F5T A;  1WSJ A;  1DGK N;  1BIS A;  3VQD A;  4GMJ B;  3KWI A;  3ZCM A;  4JEP A;  5C24 A;  3NH2 A;  3LWM A;  2P9P A;  3NGZ A;  4FJJ A;  3V9S A;  3LDL A;  1VQO N;  1QTM A;  2XHB A;  2W40 A;  5BPM A;  1UA1 A;  4M63 C;  1TAQ A;  4DCH A;  1X3N A;  3SUQ A;  4OO1 J;  3ZX0 A;  1G15 A;  3RSE A;  2UXD K;  3SMS A;  5AQZ A;  1SKW A;  3CER A;  4IOC L;  4DR6 K;  3DOL A;  3GG4 A;  5GAE P;  2JGU A;  1XC3 A;  3RWU A;  3FZF A;  2QWN A;  5FPD A;  1YTU A;  1X9S A;  4KAZ A;  4PHT X;  3KJV A;  1BDG A;  3EL2 A;  3QLH A;  4OX9 K;  2ZF5 O;  1Y64 A;  3O4Q A;  3QO9 A;  3VQ9 A;  3ZSV A;  1NM1 A;  3THX A;  3C7N B;  4PWD A;  3C65 A;  4B08 A;  4B9U A;  2P9L B;  5J2Q A;  3G6E N;  4DV3 K;  4DSF A;  5HRN A;  4DQP A;  4KHQ A;  2JWL A;  3ATU A;  2IGI A;  1RDB A;  1IO2 A;  3K5N A;  3HP9 A;  2W6L A;  3HM8 A;  4UY8 O;  4DTN A;  4DB3 A;  4AHU A;  4B3R K;  3L4Q A;  1T05 A;  4CGD A;  5BR9 A;  4BRP A;  3SPY A;  1NGC A;  1S1W A;  4KRE A;  1JLE A;  2E5L K;  4FJI A;  3VEY A;  1U2V B;  4GNI A;  3KK3 A;  5C2F A;  5AQN A;  2E88 A;  1IV0 A;  4DMN A;  3FR0 A;  4I6M B;  1NGJ A;  4JKH A;  3I0S A;  4BR2 A;  1QSS A;  3BZK A;  4FJ9 A;  1NMN A;  1VQ4 N;  1J9A A;  2O8B B;  4X62 K;  4Z4E A;  2PYL A;  3VA3 A;  4L8R B;  3K5M A;  4X66 K;  1HKB A;  5KI6 A;  3IMX A;  3C0B A;  3VEV A;  3VQE A;  4CZF A;  1N33 K;  4FWR A;  5FRM A;  4CJ4 A;  2OPS A;  3J7Y P;  3OYC A;  4J2E A;  4IKF A;  4C8L A;  5FPN A;  4KPY A;  4LSN A;  1NJX A;  2FLO A;  1WBB A;  4A2B A;  4MFB A;  4OPJ A;  3O9S A;  2OPP A;  4JHD A;  4F2S A;  5B8H A;  4J8F A;  3RMA A;  4DLG A;  5A2Q O;  2A6A A;  3AVL A;  1SZ2 A;  2WON A;  3VGL A;  3TR8 A;  1VSJ A;  3SNN A;  3MCA B;  4HUG A;  2D0O A;  1Q81 O;  2NRX A;  3SQ0 A;  4B1Y B;  4K43 A;  4CIF A;  4QS7 A;  2P9L A;  3KLE A;  5AJ3 K;  5AQW A;  2KFN A;  4CZI A;  4BQZ A;  3FZH A;  1YXQ A;  3KKS A;  4KTZ A;  1NJZ A;  2HND A;  1S1X A;  1B92 A;  5AQH A;  1N36 K;  1ASU A;  1S9G A;  4JK7 A;  4C8N A;  2IVO A;  1RTH A;  5EXW A;  3CJ7 A;  3SMP A;  4HCC A;  2B5J A;  3T19 A;  3VTH A;  1QQM A;  3BDP A;  3V81 A;  4BRN A;  3PX6 A;  4FLT A;  4CJT A;  3CQX A;  4K41 A;  4DR3 K;  3O4W A;  4KHW A;  4JKF A;  2X78 A;  1HNX K;  2Q3S A;  1TV6 A;  3K0S A;  3E9O A;  4Z4C A;  3HVR A;  4B1Z A;  5M1O A;  3NVM A;  5KRS A;  3OYM A;  2OZS A;  5JS1 A;  2Q36 A;  2O4I A;  4B3M K;  2FBT A;  5KQD A;  5AQF A;  3M1F A;  1U47 A;  3TSU A;  2Q0R A;  3AGK A;  1W97 L;  4JI4 K;  4PQU A;  3OBW A;  5AQI A;  1IBK K;  4WQ4 C;  4JI8 K;  2ZQB A;  4KBO A;  3J8A A;  4WQ5 C;  4OLA A;  2PFU A;  3OYD A;  2G8H A;  3DI6 A;  4OLB A;  3O3G A;  2E20 A;  1BA1 A;  3RR7 A;  3C7N A;  4CES A;  3ZT2 A;  3DXM A;  3P83 D;  4FJM A;  1G99 A;  3T1Y K;  3GBT A;  2HMI A;  2OTL N;  3WUH A;  3VQP A;  4LC9 B;  2HBJ A;  4FPB A;  1CLQ A;  4H0V B;  2VCP A;  4E1N A;  4FWL A;  3BGR A;  3WEE B;  1EP4 A;  1K8A O;  4JV5 K;  3EY1 A;  4O8U A;  3ZEU B;  3QEP A;  4C8K A;  2QWL A;  3VQB A;  3SZ2 A;  5KPT A;  1N6Q A;  1W9H A;  3PY8 A;  1T6C A;  4LF5 K;  4DQI A;  4JN4 A;  4DTO A;  4JKA A;  4FVU A;  4OPA A;  3V1Q A;  4H4O A;  3ZET A;  3WNF A;  3K5L A;  1MDU B;  4BRL A;  2E2Q A;  1RT7 A;  2P9S A;  3I8B A;  3DXK A;  2V52 B;  1T3V A;  3HOT A;  3AVF A;  3H3N O;  5AQG A;  1CZB A;  3CIP A;  3MX2 A;  3QFP A;  3AO2 A;  2H3G X;  3BP8 A;  3K9K A;  2EWS A;  1JL2 A;  3OA9 A;  3CPE A;  3I0R A;  2A42 A;  4NXN K;  3A5O C;  1NJI O;  4O5F A;  3ULE B;  5FPM A;  1IKW A;  3QBX A;  1WBD A;  3E01 A;  4DU4 A;  5KPR A;  1EWQ A;  4CIG A;  2HHQ A;  4IOX A;  1TUY A;  1YT3 A;  1HUX A;  1YVN A;  3TAN A;  4JI5 K;  4H03 B;  5E26 A;  1HYS A;  3A0I X;  4HCB A;  3CC2 N;  2HHT A;  1J53 A;  1E4G T;  5KQ8 A;  5HRO A;  4B9M A;  3VEN A;  3O80 A;  4IOA L;  3W0L A;  2W6K A;  4DQR A;  4FCY A;  3SV4 A;  4YOT A;  4CF0 A;  4E7L A;  4CVN E;  1NGA A;  1NK0 A;  3B6O A;  4TSX A;  3LDP A;  2HBM A;  4CJK A;  4FLW A;  3P39 A;  1OKJ A;  3Q7C A;  3KK7 A;  4LFB K;  2ZWH A;  4JK9 A;  2FF3 B;  3WXK A;  1KRP A;  5CYM A;  3HT3 A;  3J80 O;  4JI1 K;  3C6A A;  2KZZ A;  4H5W A;  1UA0 A;  1D9D A;  3HJF A;  4A57 A;  5J2N A;  4BGA A;  3VEO A;  4WE1 A;  4DV2 K;  4PKG A;  2IVP A;  3OBY A;  3NAE A;  2XY6 A;  4RW7 A;  4CF9 A;  4DV5 K;  4FLV A;  4M7X A;  3UKU B;  2QWM A;  2X6S A;  4YFU A;  3V4I A;  5I9E B;  3MWP A;  2E6M A;  5F2R A;  3V1R A;  3CM6 A;  3NH0 A;  2YNH A;  4FWO A;  4PY5 A;  4JK8 A;  4DTP A;  5BRH A;  3U6F A;  4JLH A;  3O9T A;  3VEZ A;  3VEW A;  4LSL A;  3UE5 A;  4J2D A;  4BWM A;  3DLH A;  1KCF A;  3HI0 A;  3AA3 A;  1XMQ K;  4FZY A;  4FM0 A;  1JXE A;  1RDA A;  4CIE A;  3CM5 A;  1GLJ O;  4N5S A;  3K5O A;  3HYF A;  4GV6 A;  1NK9 A;  4ISF A;  4CJ3 A;  2NRR A;  3U9Z A;  4M7Y A;  4DFM A;  3OJS A;  3QNN A;  3PO5 A;  3AVB A;  1HR0 K;  1BU6 O;  2QK9 A;  1HNZ K;  3SI6 A;  4KTQ A;  2NRT A;  4CZL A;  3KLG A;  2BDP A;  2FBY A;  3NVK A;  1VSI A;  2HB5 A;  4FVM A;  4FLU A;  5EU7 A;  2FBX A;  3KTQ A;  1YF5 L;  5KPZ A;  2RPI A;  4A5B A;  2HST A;  5DM6 L;  4B3O A;  2ETJ A;  2QXF A;  3M3Z A;  3UKR B;  1L5U A;  4CED A;  2ZD1 A;  3VA0 A;  3CME N;  2BUP A;  1X1P A;  4FM2 A;  3E66 A;  4QOZ B;  3THW A;  3QML A;  3AVN A;  4JI0 K;  5AQS A;  4BR4 A;  5DMR A;  2F8T A;  3VQA A;  1GLB G;  1HQU A;  4ELV A;  3AAP A;  1HNW K;  3QFU A;  3ALY A;  3SUO A;  2FXU A;  1C1A A;  3OYA A;  4HHT A;  1HRH A;  3TU5 A;  3S3N A;  4MDB A;  3ZYY X;  4KFB A;  2D1K A;  2G8W A;  2QA4 N;  2NLX A;  3D7E O;  4OKJ A;  4DSJ A;  1FKP A;  2O8E B;  5BN8 A;  1IG9 A;  1RDU A;  2P5G A;  1QZ5 A;  1Z25 A;  3E9P A;  3IG1 A;  2E2O A;  3VQ7 A;  1RT4 A;  1ZBI A;  5EY4 A;  1JCG A;  4BE1 A;  3RRH A;  4M3W A;  2OYQ A;  2A1S A;  4NXM K;  3V1O A;  1VSK A;  3RMB A;  3CCR N;  3PSI A;  2YJE A;  1NK5 A;  5H1S Q;  2IS3 A;  2P9I B;  3KLH A;  1NOY A;  4M3U A;  3P1G A;  4DFJ A;  3SBG A;  5CR4 A;  2DFH A;  2F96 A;  4U67 L;  5J1E A;  2Q2R A;  3G0Z A;  1JXB A;  1NGF A;  3CCV N;  1VQN N;  2QWO A;  4W5N A;  3SQ1 A;  5K14 A;  3ZX3 A;  5CHI A;  3EE9 A;  3MN7 A;  2WUS A;  2Q0U A;  3C6H A;  3DYA A;  3CXC M;  1S1T A;  4BR9 A;  2YNI A;  3VF4 A;  2ZJR L;  2V51 B;  3CQY A;  4H5N A;  4OPK A;  2ITM A;  2HHU A;  4LF9 K;  1LW2 A;  3ID8 A;  2IAJ A;  3MN6 A;  3H1Q A;  3FFK B;  1ATS A;  3SJJ A;  4FWQ A;  3CPW M;  3LPU A;  4QAG A;  5HRS A;  2NRH A;  1KXP A;  5ADX A;  2GBZ A;  4CJR A;  4DR4 K;  3EKU A;  3P5J A;  1S6P A;  1Z26 A;  2NRW A;  5KRT A;  4JI7 K;  5AQL A;  1GLE G;  1WN7 A;  2BH1 A;  2RE2 A;  1XUP O;  4R79 A;  3DLB A;  2G8F A;  1OH8 A;  4O0I A;  3LM2 A;  1ZBL A;  1DT9 A;  1A5W A;  3AVJ A;  5JVH L;  2KKZ A;  1S5J A;  3I8D A;  3AA5 X;  3GDQ A;  4NLC A;  4NYF A;  3TWH A;  4DV4 K;  4ISG A;  3KHY A;  4EHT A;  1ZBF A;  2Z1I A;  4B9Q A;  4XH5 A;  3AV9 A;  1O1W A;  3U4L A;  4CBU A;  4CFD A;  2QWR A;  4Z94 A;  4AQY K;  1M90 O;  1Z6R A;  1YJ9 N;  4FWM A;  3IS9 A;  4AHC A;  1WSE A;  1QVG M;  2E6L A;  3H1V X;  4ELT A;  4DU3 A;  4BG9 A;  1KC8 O;  4ILH A;  4H8K A;  4MDA A;  1A5X A;  1U2V A;  2FSN A;  1VQ5 N;  3MEE A;  2IC3 A;  3SV3 A;  1ITG A;  1NOZ A;  3DLG A;  3OYF A;  1SQK A;  4M41 A;  1EX4 A;  3QIN A;  2XY7 A;  1TYQ A;  3VQQ A;  3FZM A;  2QTD A;  4AF1 A;  1TYQ B;  1NKB A;  2A40 A;  3OS1 A;  3OYG A;  3DXK B;  1HLU A;  3SLC A;  2BTF A;  5AQJ A;  4CJL A;  3O1W A;  4C1N K;  3QIP A;  1GLL O;  1BQN A;  4NLB A;  1S22 A;  4IBN A;  1LCU A;  3KZB A;  4C1N I;  2Q31 A;  5AFU H;  1NG9 A;  3D2E A;  4BDP A;  3LPT A;  1IBM K;  4BRD A;  4E89 A;  1QZ6 A;  4RW9 A;  4CJ5 A;  1BQM A;  3OS0 A;  2UUB K;  3CJB A;  1TKX A;  1SV5 A;  1FJG K;  3LDS A;  5E41 A;  3VQ4 A;  4CJS A;  3MAQ A;  4RG8 A;  2GV9 A;  3NF9 A;  2ATQ A;  3DJC A;  2GWJ A;  4EP5 A;  1W0H A;  4CZG A;  2IDO A;  4G1Q A;  3O9R A;  4X65 K;  3TAF A;  1HNI A;  3EZ5 A;  2O8D A;  3SAH A;  2JLE A;  4GW6 A;  4IZ9 A;  3ATV A;  2P9I A;  3KD1 E;  3NGY A;  3IFR A;  5BPL A;  2PBD A;  1U48 A;  4IO8 A;  3T7Z A;  1NJW A;  4H5T A;  4F4K A;  5CZ2 A;  4UQG A;  3HXM A;  4BE0 A;  2YHX A;  3R1X A;  4NCA A;  3G10 A;  4YOX A;  1K8K A;  3HPO A;  1L3U A;  1KAY A;  4EZ6 A;  2WOM A;  1WUA A;  1BIZ A;  1HYV A;  1OH5 A;  4KH6 A;  4FLY A;  1GOC A;  4EP4 A;  1NGI A;  5D3G A;  3O3F A;  1R0A A;  1TL1 A;  2QKK A;  1EET A;  4KH4 A;  3LWL A;  1C0G A;  3H3O B;  4KH5 A;  5LJW A;  1Q82 O;  2VG6 A;  2O8C A;  5AZI A;  3HM9 A;  3CYM A;  2HHX A;  4BRO A;  1HJR A;  3NE6 A;  2G8I A;  5BR8 K;  3QIO A;  1ASV A;  5SZT A;  5C12 A;  4IG3 A;  2E1Y A;  3SQ4 A;  3QIC A;  1BA0 A;  4A2A A;  4CHQ A;  3VQC A;  2Z1J A;  4K8Z A;  4XH4 A;  1YJN N;  4IFV A;  4IFY A;  3ULD A;  3OW2 M;  2RHK A;  1RGI A;  1QQC A;  3WXM B;  3WQT A;  1JLB A;  5JS2 A;  4JRP A;  3CMA N;  1UAX A;  4O0J A;  3OJU A;  3BEX A;  2CGJ A;  4PUO A;  1NGE A;  2FBV A;  1WSH A;  3OHR A;  4JHD B;  4DKW A;  3FZL A;  2Q1N A;  1RT2 A;  3TSQ A;  5KGX A;  4DR5 K;  3SQ2 A;  4ISE A;  1GOB A;  4JKD A;  4LD0 A;  5ADX H;  4EHU A;  3EKS A;  3LL3 A;  4K25 A;  4H4M A;  1HJO A;  4Q5V A;  3NDK A;  1ASW A;  2VGM A;  4CJW A;  5AQT A;  3AAQ A;  1TVR A;  3V9U A;  1YUW A;  2HOE A;  1TKZ A;  5HOO A;  3FZK A;  3NCI A;  3CG7 A;  1NBW A;  1NU0 A;  4BRH A;  1VQM N;  4JRQ A;  3D2F A;  1J5E K;  4CJ7 A;  1JLQ A;  3K59 A;  3LZI A;  4XH1 A;  2I5J A;  3TAB A;  1HQE A;  4Z4I A;  4Y1D A;  1RBV A;  4N41 A;  1KVB A;  1K9M O;  3AVK A;  4JKG B;  4CZM A;  4RW4 A;  3HP6 A;  3F2K A;  4KHN A;  3RRG A;  4NYN A;  3CCE N;  2NZT A;  4PL7 A;  1YAG A;  3OYI A;  2O8F B;  3A8Y A;  3IAY A;  4FWP A;  3SUP A;  4CER A;  3HBT A;  3CFR A;  3BUZ B;  4NCB A;  4M3Y A;  4CJE A;  3HPH A;  4CHZ A;  1TKD A;  3NMU A;  2E2N A;  1VSL A;  4OGC A;  1EWR A;  3UIQ A;  1DLO A;  3D2E B;  5AZJ A;  4EIA A;  4WFB L;  5C0Y A;  2FSJ A;  2G8U A;  2BE2 A;  3NF7 A;  2Y1I A;  1DKG D;  3KK2 A;  2YHW A;  1ZYQ A;  2D0B A;  2F7T A;  3T1A A;  4AM6 A;  3AO4 A;  4CZE A;  1RT6 A;  3R8E A;  4W5O A;  2YHA A;  4QS9 A;  3SBT A;  4CEE A;  3FGU A;  1D8Y A;  1B9D A;  2HHH K;  1XQS C;  4B8A B;  2UUC K;  3RMC A;  3DLK A;  5HRR A;  3SJH A;  4BRQ A;  4DF4 A;  3R6M A;  1W2B M;  1BUP A;  1Q18 A;  4JI2 K;  2E1Z A;  1NK4 A;  4I7F A;  3LP1 A;  2E2P A;  3OYN A;  4AHR A;  4DF8 A;  5LMU K;  4ICL A;  1S6Q A;  3VGM A;  3CC4 N;  3THY A;  4MO5 A;  4K0K K;  3DLL L;  1JLC A;  5TKY A;  2QW9 A;  3WXJ A;  1OVY A;  2GTD A;  3QET A;  1IBL K;  4Q0B A;  2O8B A;  1N32 K;  4KB1 A;  3TAP A;  1L3V A;  4AHV A;  1VQP N;  3O1B A;  4CJV A;  3QEV A;  2FC0 A;  1GLC G;  2DFE A;  1EKE A;  4KV8 A;  4A5A A;  4F3T A;  1CZA N;  1ESV A;  3K9J A;  3NBP A;  3HO1 A;  3AVA A;  3IRX A;  4BC2 A;  1LW0 A;  3LP3 A;  3ENB A;  3O4N A;  3FFI A;  2Z1H A;  4OGE A;  4BY9 C;  3ID6 A;  1XNQ K;  4DSK A;  1NK7 A;  4IEI A;  1QHA A;  5CY4 A;  5SWM A;  3AVH A;  2FF6 A;  4KI6 A;  1DEJ A;  3O9Q A;  1UOC A;  5AR0 A;  4DUY K;  3VMF B;  1K6Y A;  5LMN K;  1IKV A;  3GOI A;  3EE8 A;  4V19 S;  3RTV A;  4CJF A;  3V6D A;  2B4J A;  1OH6 A;  1D9F A;  3CCQ N;  4KKO A;  4YOW A;  4BG8 A;  1IKX A;  2HVH A;  1CXU A;  2ASO A;  3DLR A;  3PLA A;  1REV A;  4BWJ A;  1IG8 A;  1RTJ A;  3L0Q A;  3OYE A;  3L2R A;  3E1Y A;  2OAN A;  4PKH A;  5E84 A;  3EEQ A;  3VTI A;  5LY3 A;  4DTM A;  2Z1G A;  1ZBU A;  3V9W A;  4OJR A;  3K58 A;  3MN9 A;  3A5L C;  5J2P A;  3HSC A;  4DFK A;  2YJF A;  2NRV A;  1RIL A;  1TUU A;  4A62 A;  4FJK A;  4CK3 A;  1RDW X;  3VN5 A;  1WSI A;  4BRI A;  1MA9 B;  4B8C A;  3MCP A;  4O8K A;  1NKE A;  4H0O A;  4JD2 A;  4DTR A;  4IEE A;  1HNV A;  2I7N A;  3BY5 A;  3L4I A;  4ILG B;  1DTT A;  2F9T A;  2V7Y A;  3TTD A;  3OYK A;  1IH7 A;  1YTA A;  4YDU A;  1J54 A;  2VQF K;  1MWM A;  1BCO A;  5DM7 L;  5LL6 Z;  3IUC A;  3A2F A;  2YV0 X;  4KHS A;  2CGL A;  5BN9 A;  1C6V A;  1FXX A;  4FL9 A;  5CZ1 A;  3RVC A;  4QS8 A;  3MEC A;  4ZTJ A;  3HTV A;  4DR7 K;  3L2W A;  2HNY A;  4DS5 A;  3PV8 A;  1U6Z A;  4BDY A;  2GUP A;  4J2B A;  4FWN A;  3WXI A;  4FWK A;  4DV0 K;  3SPZ A;  3G71 N;  1ZC6 A;  3VET A;  3CF5 L;  4CGH A;  1BGX T;  4RTF D;  2BGG A;  1ILY A;  2RKI A;  1C0U A;  4HWI A;  4JI6 K;  3IKM A;  4JYA K;  5EX5 A;  3ZSZ A;  3SAG A;  4HVJ A;  1TK0 A;  1T7P A;  1XC9 A;  3NF6 A;  2KLA A;  3DRS A;  4PA1 A;  4YOR A;  3PIO L;  3OYL A;  3CCM N;  4FJH A;  1JLG A;  4MQ3 A;  1YIT N;  4JS5 A;  1X9W A;  2HMP A;  3THW B;  2OPQ A;  1ZBH A;  1IKY A;  3MX5 A;  2PY5 A;  4H0P A;  1BG3 A;  1ZBS A;  3H08 A;  4DG1 A;  1BOT O;  3I55 N;  5IT9 O;  2PAV A;  1NMD A;  4AHS A;  1K8K B;  3VER A;  1TK8 A;  2Q97 A;  4BC3 A;  3J7Z O;  3THX B;  1SS6 A;  3O8M A;  1WAJ A;  3ZT0 A;  5JMV A;  2VQE K;  1J6Z A;  3VEX A;  3P4I A;  4HTL A;  4A59 A;  4OVL A;  4BR5 A;  1KQS M;  4G9Z A;  2I7P A;  2YKN A;  4A61 A;  3KVG A;  3MDQ A;  4IJN A;  4ID1 A;  3SAF A;  4MO4 A;  4F8R A;  4CK2 A;  4IG0 A;  4O4G A;  3VF2 A;  3QER A;  3A5N C;  4E1J A;  3MXI A;  3O3H A;  4FJN A;  4Z0U A;  5JVG L;  5I3U A;  3ZX2 A;  4LH5 A;  5EVZ A;  3CI5 A;  2J4R A;  2ZJP L;  5AQX A;  2HF3 A;  4YOV A;  3QES A;  4B1W B;  5GIO A;  2V7Z A;  3O9U A;  5BRD A;  4YOU A;  4YOY A;  5BRE A;  1TL3 A;  1S72 N;  4F3O A;  3LAK A;  5GAH P;  3LDO A;  3KK1 A;  3CCS N;  4BAC A;  1QE1 A;  3KLI A;  4Y1C A;  3S3M A;  2P9N A;  4GVE A;  4KO0 A;  3HZ6 A;  4YHH K;  3OY9 A;  3LP0 A;  2P51 A;  4MLE A;  4CBW A;  4CGG A;  1VK0 A;  4CZH A;  4B9S A;  3ULE A;  3PUF A;  3QNO A;  4CBX A;  1P8Z A;  4LFC K;  3KWG A;  2FSK A;  3WXL A;  4KHU A;  3G25 A;  3F9M A;  4BC5 A;  3U9D A;  4JKC A;  2UUA K;  2F9W A;  4RCH A;  2X6N A;  3K57 A;  3E9L A;  1V4T A;  4Z4H A;  1YIJ N;  4BRG A;  4IDH A;  3AVG A;  2QEX N;  1FW6 A;  1UWB A;  3PSF A;  2VWJ A;  3EZW A;  3NF8 A;  4CJP A;  1XI1 A;  4BGB A;  5EOY A;  4CI6 A;  4ZHR A;  3HRG A;  1U45 A;  4CZJ A;  1SKS A;  5KTQ A;  5J2M A;  4YNQ A;  2D0C A;  3PIP L;  1D5A A;  5AQY A;  3M5R A;  4B1V A;  2WTU A;  3CD6 N;  3B8A X;  1VQL N;  2GX9 A;  2D4W A;  3AVM A;  5AQU A;  5TKW A;  1NK8 A;  1M1K O;  3RSE B;  3L2Q A;  3J7A P;  2CGK A;  3PX0 A;  4BRK A;  2AP1 A;  3L2U A;  3M6G A;  1XWL A;  4B9T A;  4CFC A;  4BVO A;  4CW7 B;  4H0Y B;  1LWC A;  2P9U A;  3DRR A;  2ZJQ L;  2ASM A;  4AM7 A;  4N47 A;  1DTQ A;  1U4B A;  4AHT A;  1BWF O;  1RNH A;  4BRC A;  1LV5 A;  5GIP A;  4B3S K;  1I94 K;  1QS4 A;  1TK5 A;  4B1X B;  3SYZ A;  2ZE2 A;  2QWQ A;  3VQ8 A;  3D45 A;  3UKU A;  4B9L A;  1KAX A;  1VSM A;  3QB0 A;  3ZT1 A;  5AQK A;  2KFZ A;  3VPZ A;  3L3U A;  4JNE A;  4NCG A;  4FJ7 A;  2YX6 A;  1IJJ A;  3CFO A;  3CCL N;  4HTU A;  3VQ6 A;  4JKE A;  3WQU A;  1C0M A;  3AGR A;  3MEG A;  3ZSX A;  4CHN A;  4LF8 K;  4F9O A;  3ASM A;  3HOS A;  2ZGY A;  3AVI A;  2VWK A;  1RFQ A;  5HL7 L;  3BF3 A;  4IO9 L;  4KHY A;  3S41 A;  5FRN A;  4U7B A;  4CEA A;  1VQ6 N;  3TAE A;  5AQO A;  1I39 A;  2VGN A;  1X9M A;  3OTO K;  1RBU A;  1TKT A;  1GLA G;  4K42 A;  4FYD A;  4E7J A;  4FSV A;  4CE9 A;  4MLH A;  3TSP A;  5FDL A;  4AH9 A;  3CHW A;  2HF4 A;  1T44 A;  4DSL A;  2Y1J A;  2ITG A;  3ZEU A;  4GV3 A;  4E1M A;  1C1B A;  4BE2 A;  1RDD A;  2OTJ N;  3MED A;  3JAM O;  3ZSW A;  2A5X A;  4FW1 A;  1O13 A;  3QEX A;  1W7A A;  3MN5 A;  2NUB A;  2XRI A;  1JL1 A;  3BF1 A;  3JS6 A;  5M1F A;  4I2Q A;  2HHW A;  3QBW A;  1N34 K;  3H6E A;  4I9Q A;  4GV9 A;  4BDZ A;  1HPM A;  4FOI A;  3PO4 A;  1ZXO A;  2BAN A;  2QI2 A;  5M1P A;  3SCX A;  2P9S B;  2YNG A;  5I42 A;  1TGO A;  3EYZ A;  5FLX O;  3D0P A;  3LAL A;  2P5O A;  4N56 A;  4CJQ A;  1LWF A;  3V9X A;  1Q7Y O;  4B9N A;  1YHQ N;  4JAX A;  1LOT B;  2ASP A;  3VGK A;  4JKB A;  1RDC A;  4K8X A;  4CHP A;  4KRF A;  3LZJ A;  1QQO A;  2A3Z A;  3M8S A;  3ENO A;  1JLF A;  1E4F T;  2KQ2 A;  4CK1 A;  3S9H A;  2HVI A;  1N5Y A;  1HYZ A;  4BVP A;  4Z4F A;  3CJ1 A;  2OCE A;  2ZGZ A;  3NFA A;  4E3S A;  1BO5 O;  2AA4 A;  4I9L A;  3ZSO A;  5BPN A;  1EQY A;  1CXQ A;  3CET A;  1RBS A;  1S1V A;  3DXM B;  3N4P A;  5T7B A;  4RW6 A;  2O4G A;  1KSP A;  4LF7 K;  3CJC A;  4AIL C;  1NGD A;  5AQV A;  1WB9 A;  2W41 A;  4LY7 A;  3KLF A;  4E0D A;  3O5B A;  3HL8 A;  1GLD G;  1RT5 A;  2X74 A;  3MWT A;  5AQR A;  4ID5 A;  1JJ2 M;  3JXU A;  1HMV A;  3U3Y A;  5JLH A;  1H1V A;  4B9V A;  4FZZ A;  3O6W A;  3ZET B;  3SUN A;  1E3M A;  4WQ5 A;  2NNW A;  3CCU N;  1X3M A;  2RF2 A;  2W42 A;  3U8X A;  4WQ4 A;  2VG5 A;  1VSF A;  4GKK K;  1KFD A;  1XHX A;  1GLF O;  3RR8 A;  5C2D A;  4M3Z A;  3MK6 A;  3AO1 A;  4CHO A;  3THV A;  4DSE A;  1VSE A;  4I2P A;  1L3S A;  1VRT A;  3DWL A;  1VQK N;  3ZLJ A;  2F4V K;  2HNZ A;  3C6T A;  2O8F A;  1VSH A;  3VES A;  3C94 A;  3HVT A;  2HW3 A;  3TTC A;  1SL0 A;  4DQQ A;  4JKG A;  1EO1 A;  1RT1 A;  2VYP A;  4H0T B;  3AO5 A;  5MLC Q;  4FW2 A;  2OZM A;  5AZI B;  1QQN A;  3TAM A;  3J81 O;  4EZ9 A;  3JYT A;  2QWP A;  3MMV A;  1S9E A;  1LWE A;  4CGF A;  5F1X A;  2RN2 A;  1D4X A;  2A1R A;  1NNE A;  4Y0W A;  4KHP K;  3AVC A;  4L3Q A;  1Q9Y A;  1FKO A;  2P9K A;  3FLC O;  4J2A A;  4DR2 K;  4DQS A;  3MXM A;  3DMJ A;  1SAZ A;  1MU2 A;  1TAU A;  4X64 K;  4GKJ K;  1NGH A;  3AAR A;  4CD1 A;  4KTW A;  4M3T A;  1JKH A;  2DTU A;  1FK9 A;  1B9F A;  4JI3 K;  5LJV A;  3ZSY A;  2YKM A;  4E7H A;  4PKI A;  4CGJ A;  1XNR K;  4BQL A;  2GEL A;  3NH1 A;  2EHG A;  4CF2 A;  4DUZ K;  2D0A A;  3B6P A;  3C95 A;  3OYH A;  3TTF A;  3L2V A;  3MXJ A;  5C10 A;  4FXD A;  2XY5 A;  1QSL A;  3WNG A;  3DRP A;  4M3R A;  4RW8 A;  4JS4 A;  4F2R A;  2QXL A;  1RCH A;  4HUE A;  2YHB A;  3JSM A;  1Y97 A;  1NLV A;  2YNF A;  3C6U A;  1HX1 A;  2G8V A;  5GIN A;  3ZT3 A;  4FPA A;  4C23 A;  2OPR A;  4CEF A;  4R5P A;  1ATR A;  2GUI A;  4E7I A;  3TAQ A;  4JD2 B;  4O44 A;  1V4S A;  3SK3 A;  4OKE A;  4KB0 A;  1KVC A;  1YI2 N;  4DFP A;  3I33 A;  5M1K A;  4BR7 A;  5HLF A;  2GEM A;  2OA8 A;  4DHY A;  2KHO A;  3LM9 A;  1QVF M;  1S3X A;  4DV1 K;  3TI0 A;  1RTD A;  2HHS A;  4IXC A;  3TAR A;  3N4Q A;  3EO3 A;  1XMO K;  1GOA A;  2D0P A;  1KFS A;  3T69 A;  2UYT A;  4DTJ A;  2R7Y A;  4DTU A;  3HK2 A;  3M8P A;  3CCJ N;  3DLE A;  3CQ8 A;  4BR0 A;  1NJY A;  3I56 N;  3VOV A;  4CGI A;  1ATN A;  2IIR A;  2O8C B;  1T03 A;  1BHL A;  1VQ7 N;  4FJG A;  2HBK A;  1VQ8 N;  2JWK A;  1BL3 A;  1BI4 B;  1NKC A;  1T6D A;  4CFA A;  2ZM6 K;  1LAV A;  5JLF A;  2DFF A;  1L3T A;  1I3A A;  1HPZ A;  3AA4 A;  2CH6 A;  5FPE A;  4ELU A;  3OVN A;  3DOK A;  3K2P A;  5C25 A;  1R59 O;  2YHY A;  3WNH A;  4H5R A;  1X9J A;  5IWA K;  3AY9 A;  4WCE L;  3LAN A;  4NB4 A;  3OS2 A;  4DV7 K;  3KKR A;  3FE1 A;  4EFH A;  1T8E A;  2UXC K;  5HBM A;  4XEI A;  4CZK A;  2WFB A;  4WFA L;  2HBL A;  2DPN A;  4PL8 A;  1WLJ A;  2F8S A;  2VG7 A;  3LP2 A;  4EAH D;  2P9U B;  4FK0 A;  1WSF A;  3ZSR A;  2O8D B;  4O55 A;  1WOQ A;  2EX3 A;  3THY B;  1YJW N;  4BRE A;  3GE1 A;  4Z4G A;  4DU1 A;  1HKC A;  4LF6 K;  4FLX A;  1C0F A;  3PX4 A;  5CE3 A;  4IDK A;  1LAW A;  1OVQ A;  3L6Q A;  3DAW A;  4C8M A;  2G8K A;  4WYB A;  4CD3 A;  4ZTF A;  4BRM A;  1SUQ A;  3CFP A;  4DV6 K;  5AQP A;  4CFB A;  3V9Z A;  4W5T A;  1NGG A;  2WBN A;  4CF1 A;  1XHZ A;  4CEC A;  1NK6 A;  1VQ9 N;  1HKG A;  3KIO A;  2XY8 A;  4CEQ A;  4FLZ A;  3HPG A;  1BCM A;  5M1N A;  4DS4 A;  4BRF A;  5KGW A;  3ENH A;  1J5O A;  3WNE A;  1KLM A;  2KW4 A;  4DSI A;  3QEI A;  3QEW A;  1S1U A;  4CF8 A;  4LFA K;  2QKB A;  3HST B;  4GVM A;  4M42 A;  4QCL A;  2KZM A;  2IVN A;  3T1H K;  5CYQ A;  2XO7 A;  5GAG P;  3KD5 E;  3T3F A;  4H5V A;  4B3T K;  1C1C A;  1RT3 A;  4YY3 K;  4FWS A;  3NHG A;  1P90 A;  2UXB K;  4IFE A;  5C42 A;  4CEB A;  4IWV A;  4OKK A;  5AQQ A;  1SL1 A;  1MWK A;  3H45 C;  4CJU A;  4XIU A;  2P9N B;  1Q86 O;  4E7K A;  1Q9X A;  4FJ5 A;  4DWI A;  2DY4 A;  3Q7B A;  2UU9 K;  5AZJ B;  3NGI A;  4BC4 A;  4BRA A;  1RTI A;  2E8A A;  2QM1 A;  5M1Q A;  1A5V A;  2YI1 A;  4FM1 A;  2AJQ A; 
#chains in the Genus database with same CATH homology
 4DR2 K;  1HNW K;  4B3S K;  1I94 K;  4CVN E;  5IWA K;  2VQF K;  4DR1 K;  4JI4 K;  4LF4 K;  1IBK K;  4JI8 K;  5LL6 Z;  1J5E K;  4X64 K;  4GKJ K;  4DV4 K;  4DV7 K;  2UXC K;  4LFB K;  4X62 K;  4JI3 K;  3J80 O;  4JI1 K;  4AQY K;  4DR7 K;  4X66 K;  1XNR K;  4DUZ K;  4DV0 K;  4LF7 K;  3T1Y K;  4YHH K;  4LF6 K;  1N33 K;  4LF8 K;  4DV2 K;  3J7Y P;  1XNQ K;  4NXM K;  4DV5 K;  4JI6 K;  4LFC K;  4JYA K;  4JV5 K;  4DV6 K;  2UUA K;  4DUY K;  2UXD K;  5LMN K;  5A2Q O;  3OTO K;  4DR6 K;  4V19 S;  4GKK K;  4LF5 K;  1XMQ K;  5BR8 K;  4DV1 K;  5AJ3 K;  2HHH K;  4LF9 K;  4LFA K;  1XMO K;  2UUC K;  1N36 K;  4OX9 K;  3T1H K;  2F4V K;  5IT9 O;  1HR0 K;  3JAM O;  1HNZ K;  4B3T K;  1N32 K;  4YY3 K;  2VQE K;  1N34 K;  2UXB K;  4JI2 K;  1IBM K;  4DR4 K;  4NXN K;  4DV3 K;  4DR5 K;  5LMU K;  4DR3 K;  2UUB K;  3J7A P;  4JI7 K;  3J81 O;  1HNX K;  2ZM6 K;  1FJG K;  4JI5 K;  5FLX O;  4K0K K;  2UU9 K;  4CW7 B;  4B3R K;  4JI0 K;  4KHP K;  1IBL K;  2E5L K;  4B3M K;  4X65 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...