1FJGK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1fjgK00
3J81O 4CW7B 4YHHK 4LFAK 5AJ3K 4K0KK 4JI3K 4DV1K 1IBKK 4DV0K 4GKKK 4KHPK 4V19S 4B3SK 4JYAK 1XNQK 4X65K 2VQFK 3T1HK 5LL6Z 4DR6K 3JAMO 4GKJK 3OTOK 1XMQK 3T1YK 2E5LK 1N32K 4OX9K 4DUYK 2HHHK 4LF4K 4DR2K 2UXCK 4LF9K 4DR4K 5LMNK 4DR5K 5IT9O 5FLXO 4LF8K 4NXNK 4DV3K 4X64K 4DV6K 1N36K 4JI0K 1J5EK 4JV5K 4NXMK 4JI4K 4DR3K 4DR7K 4B3TK 4DUZK 1IBLK 5A2QO 2UUBK 1N34K 4X66K 4LF6K 4DR1K 4X62K 2UXBK 2UUAK 1N33K 4LFCK 4B3RK 2UUCK 4B3MK 4DV2K 4DV7K 4YY3K 5LMUK 3J7AP 4CVNE 4JI6K 4JI5K 2VQEK 1HNXK 1XNRK 4DV5K 1HNZK 4JI2K 5IWAK 4DV4K 4LF5K 4LF7K 2ZM6K 4JI7K 2F4VK 1HNWK 4LFBK 3J80O 1I94K 1IBMK 2UU9K 5BR8K 1XMOK 2UXDK 1HR0K 4AQYK 1FJGK 3J7YP 4JI8K 4JI1K
chains in the Genus database with same CATH superfamily
1VQ6N 1RFQA 4YDUC 5F0XA 3L2VA 4CZKA 1FK9A 3LP2A 4CFDA 3O8MA 4AHTA 3OJUA 1XNQK 4IZ9A 1TYQA 5KRSA 2IVOA 3VQ8A 1QQCA 3AGKA 4O8KA 4CK1A 1RT4A 5AQJA 5AZJA 2HBKA 3AO5A 1NM1A 2E5LK 1ESVA 4MLEA 2XY8A 3AVJA 4BE2A 1DTQA 2YJFA 1WNSA 3V6DA 3A5MC 4CJQA 3U6FA 2A1RA 4FJXA 4DR5K 3D45A 3K59A 4BR2A 1C1BA 4IJAA 1W9HA 2IOCA 3DLEA 4Z4HA 3TTFA 3SZ2A 2GWKA 2E6LA 3VN5A 4M3UA 1NGGA 1HKCA 4FLUA 1YTAA 2HNZA 1YJNN 3HPGA 1T7PA 5EVZA 3RMBA 4EHTA 4FJGA 5A2QO 4JKAA 2P51A 3DRPA 2EHGA 3MWPA 1NMDA 1N33K 3C6AA 3NCIA 2F8TA 2UUCK 4DTSA 2FF3B 4B9UA 3SI6A 3DM2A 4ILGB 1NGEA 4KFBA 1SQKA 4E7IA 3HXMA 4ELVA 4A62A 4I2QA 4JNEA 2XRIA 4FWKA 5FPNA 3D2EB 4FK2A 3O3FA 5SZTA 4DFJA 1HNZK 4E19A 3ZSXA 3NBPA 3MN9A 1OH8A 2FBYA 1H1VA 4I9LA 2O8DA 4N47A 2QWPA 2FSNA 5AQPA 4C1NK 3EE9A 1XMOK 3DLBA 3VGKA 5JVHL 4FWLA 3QFPA 1QVFM 3TARA 3LAKA 4B9TA 2HBLA 1VSDA 5JLFA 1N8RO 4ID5A 1NJYA 3O08A 2RPIA 1D5AA 2OPRA 3CM5A 4C8NA 2GV9A 3KJVA 1K8AO 2RKIA 3QNNA 5HRSA 1NK9A 1Q9XA 1FXXA 4IDHA 4XH5A 5KPRA 3CIPA 4CGGA 3AVLA 4G9ZA 1B9FA 4JD2B 1U04A 2NZTA 3VF6A 3O9RA 4NCBA 2ASMA 3TI0A 2HHHK 4M45A 4DR4K 4NLBA 1S22A 4JK7A 4AM7A 4WCEL 3G4SN 3P83D 5JS2A 1C1AA 4Y1DA 5E84A 3EO3A 4CEAA 4DWIA 3O4WA 3H46O 3VEOA 4CJ5A 5HRNA 1KAXA 1N36K 5CY4A 2V7YA 2IVNA 1NOYA 4C8OA 1J5EK 3TAQA 3DRRA 4DSKA 4JI4K 4M3ZA 5KGXA 1NWKA 2QWOA 1HJRA 3THXA 3LP3A 3VQ7A 3LL3A 2CH6A 2KFNA 2PY5A 4H5WA 1Z25A 4NO7A 3N4PA 1OH5A 3LZIA 3QMLA 1FKOA 1L3TA 2YCHA 4CIFA 4B3RK 1QSSA 4JN4A 1NG9A 3S41A 1EKEA 1S3XA 4CJSA 4LSNA 4CVNE 4FJJA 2FSJA 1YITN 2VWBA 2Q97A 1E3MA 3BGRA 3HM8A 4I9QA 3FZFA 1NGCA 3W3DA 4K8XA 1YXQA 3L0QA 3OYJA 5M1QA 1HKBA 1JCGA 2CGLA 4U67L 4DTPA 4WQ4A 3O9UA 2QWMA 4K43A 4DSJA 3AV9A 3H6EA 4A59A 3CPWM 3KLEA 1LWCA 3RMCA 3AY9A 3PIOL 4KTQA 2XY7A 3CC7N 4RW7A 3UB5A 1REVA 3TAPA 3C6TA 5KGWA 1YUWA 3MN7A 2YHAA 4KB1A 5LL6Z 3QBWA 4JKBA 3MX2A 2HW3A 3ENHA 3CQYA 5E41A 3ITHA 2ASPA 1GLFO 3VOVA 2Q2RA 3BZKA 3FZKA 4KAZA 1FW6A 1IKWA 3OS0A 4FOEA 3CFOA 3UKRA 4W5OA 2O4IA 2ATQA 5M1NA 3EEQA 3K9JA 1S72N 4C8KA 3K5NA 1T3VA 3ZX2A 4IEEA 4QS8A 4WFAL 4DTNA 4A5BA 5GIOA 4XIUA 4L8RB 2XO7A 4K42A 1TKTA 4ILJA 3SMSA 2YHWA 5C42A 1VQ5N 5H1SQ 2ZJRL 4LSLA 3RRGA 1JLEA 1NKEA 4X66K 3W0LA 1IKVA 4BGAA 4BRDA 1TKZA 4RW8A 4LFCK 3NGYA 1VQ7N 3A0IX 3L4QA 4DFPA 3PO4A 4NYNA 4J2EA 3O3GA 4FM2A 3TAGA 1WLJA 1NJZA 5CHIA 3PLAA 1Z05A 1RDCA 3FZMA 3AO4A 1NK5A 1VSMA 1K8KB 3L2UA 4Z4GA 4AM6A 1ATRA 4JK9A 4A61A 4DV5K 4O8UA 1U4BA 3I8BA 4NCAA 1BIZA 4JKHA 1RT5A 2A5XA 3A2FA 1KLNA 1T03A 4CESA 3MX5A 4HVJA 3KHYA 3THYA 3KTQA 2W6KA 3O1BA 4CJTA 3V1QA 3HO1A 2JLEA 3VQAA 4EZ6A 1DGKN 1K6YA 1BIUA 2NLXA 3K9KA 2P9UB 1KFDA 4M3XA 3SK3A 4CHYA 1EETA 1QQNA 4KI4A 4H0VB 2O8BB 4OLAA 1EX4A 2PZSA 2KZZA 2KFZA 3FZLA 4CEEA 3CJBA 4DS5A 4BR9A 2XHBA 1BCMA 5CZ2A 4CZLA 4AHUA 3F5TA 2IIRA 5AQMA 3SUOA 3G71N 3V9XA 2H3GX 3LDNA 4MDAA 3TPQA 1B92A 1QVGM 4FK0A 5AFUH 2E1ZA 4JHDA 5AZJB 5FLXO 1NK7A 3DLGA 3NDKA 2P9IB 2QKKA 1WB9A 2KTQA 3EN9A 3VF2A 3AVBA 3KKRA 1RTIA 5BN9A 4DV6K 3ALYA 1JL1A 1C0TA 1EWQA 2QTDA 4KKOA 4A5AA 4CZJA 4J2AA 1VAZA 3PV8A 4U7BA 1NJXA 1SUQA 4LF6K 2GEMA 3KIOA 5HBMA 2VWKA 4L3QA 1VQMN 2YKMA 1BISA 3KZBA 5K14A 5GIPA 1YF5L 3M8SA 4BC3A 4QS7A 3LDOA 4YY3K 3J7AP 3ZT0A 2A3ZA 4IKFA 3D7EO 4JRQA 4JEPA 3P38A 2VQEK 2FBVA 3VQ4A 1W7AA 2OCEA 2E4LA 4FM1A 3I0RA 1RDBA 4CF1A 1BG3A 2D0AA 2NRHA 4E7JA 2GTDA 1W97L 4CJVA 5GINA 3L2WA 4CGDA 4Z4CA 2P9LA 5CE3A 1T6CA 1VQLN 1VSJA 1E4GT 3H3OB 4DLEA 3ULEB 4CEOA 4JI1K 3KK2A 4Z4IA 2HVIA 3SUQA 3AVMA 4LFAK 4KHUA 1YTUA 4DTXA 2QKBA 1XC3A 1RT3A 1TK0A 4CZIA 3CCLN 4HCCA 4KHPK 5DM7L 2F9TA 5CR4A 4HCBA 2Q3SA 2YHXA 2YV0X 1RTDA 4IBNA 3JYTA 3RMAA 5J2NA 4BROA 4IOXA 2QWRA 3ZSQA 4E3SA 2WUSA 3TAMA 3VETA 4ELTA 3I0SA 4B9QA 3DRSA 1QSYA 4O5FA 1N32K 1S5JA 4B9VA 2AJQA 2ZJQL 2YJEA 4OVLA 2VCPA 3HP9A 4YNQA 5IT9O 1L3SA 3A5LC 3RSEA 3JSMA 3V1OA 1HX1A 2D5RA 5AQOA 5AQUA 3CJ9A 1KRPA 2X78A 1HLUA 1LAWA 3AVAA 3IG1A 2AP1A 1EO1A 4FWQA 1LAVA 4E89A 2X6SA 3S3MA 1DLOA 4FPAA 1JCEA 2OPQA 3NH2A 2JWKA 4GY2B 4KBOA 4OPJA 3B8AX 1IBLK 3BDPA 3SQ0A 1ILYA 1UAXA 3E9OA 3AA3A 1NU0A 3ZT1A 4NYFA 2HBMA 3CM6A 4DQ8A 4QOZB 3FE1A 3MXJA 3KK1A 2ZQBA 1ATNA 4DV7K 3VESA 3CCJN 4BG9A 4GVEA 1DT9A 1RT1A 2A1SA 3P5JA 3VQ9A 3CMAN 1S1XA 2GUIA 5FRMA 3E66A 3KLFA 2O8BA 3QEPA 3P39A 3DLKA 3VPZA 4F3OA 3FZHA 4DB3A 2PBDA 3MXMA 3LAMA 4E1JA 1KC8O 2KW4A 1RDDA 1RT6A 2V7ZA 5M1OA 2D0CA 1OKJA 4J2BA 5J2MA 1IBMK 3ATVA 3C0BA 3JXUA 3F2KA 3PSIA 4CGFA 3THYB 2BE2A 4PL8A 5KPZA 5JVGL 5GADP 1SL0A 4KHWA 5HRPA 3RR8A 1C1CA 5EX5A 1VQNN 4JI3K 4WQ4C 4V19S 4JYAK 3CQ8A 4Q5VA 4KHNA 1X9SA 1X9WA 1XUPO 4BVOA 3FGUA 3BEXA 2HMIA 4M7YA 1LW0A 3TSUA 2NRXA 3U9ZA 1RBVA 4OX9K 4CFBA 3PX4A 4DUYK 4LF4K 3LWLA 3AVKA 3LDQA 3LANA 1TV6A 4C23A 4GV6A 1QZ6A 2FLOA 4ZTJA 1HJOA 2FBTA 4JKCA 4I6MA 4X64K 4G1QA 3IAYA 5GAGP 3OS1A 3EKUA 1BUPA 4CFAA 3A5NC 3ZX3A 3U4LA 3DWLA 1NGIA 2VGMA 1N34K 4A2BA 1IG8A 3ULEA 4O5BA 3M8QA 1HYVA 3G6EN 2R7YA 1NK6A 3E1YA 1YIJN 2UXBK 3DYAA 2E2PA 2B6AA 2O8CB 1IH7A 4JI6K 1HQUA 3L4IA 1ITGA 3E9LA 3O6WA 3R1XA 3R3LA 2HBJA 3OYAA 1XNRK 4N41A 2E2NA 3ZYYX 3NFAA 4E7LA 1LOTB 5I42A 2G8WA 1NGDA 2IDOA 4MO5A 2P9KA 4N5SA 1VSEA 1VHXA 3NF8A 4B3OA 5AQIA 4O0JA 3QERA 2NUBA 1Q82O 3HSCA 1GLCG 1W0HA 3PUFA 3TAEA 4K41A 2A41A 1HR0K 3NVMA 3M3ZA 4H0XB 5AQSA 3GG4A 2RHKA 4K25A 5AQNA 4PL7A 4OPAA 4BG8A 2O8EA 1JKHA 1ZBSA 1IBKK 1Y64A 4ISEA 4FXDA 1VQ4N 5EY4A 4CEBA 3VEYA 5KRTA 1JL2A 3TSPA 2G8UA 3CC2N 2O8CA 4RG8A 1NGBA 3SCXA 3MEEA 1BQNA 2P9IA 4BE1A 1C0GA 5I3UA 5HLFA 4W5QA 2QM1A 1IKXA 5BPLA 4CF0A 3BY5A 5FROA 2IGIA 3THWA 2AA4A 2ITGA 2BGGA 3HPOA 1RILA 3OY9A 3CCRN 2OANA 5LMNK 3SPYA 2DFFA 4MO4A 4FYDA 1E4FT 1Q86O 1TK5A 3O80A 3D6RA 1R0AA 2ASOA 4IFEA 2JWLA 1RTHA 4CHZA 4DG1A 3OYEA 3T3FA 4HUEA 4KV8A 3SMPA 3ZSYA 3DI6A 2Z1IA 4BRLA 4B3TK 2VG5A 4FVUA 1SL1A 4BY9C 5BRFA 3L8BA 3VGLA 1O13A 3HL8A 3MK6A 4J2DA 4Y1CA 2HOEA 5SWMA 1UOCA 3CCUN 3KLIA 1LCUA 3B6PA 3NE6A 3SPZA 1T8EA 3NGZA 5EOYA 5TKYA 4FWPA 3L2QA 1CZAN 2O8DB 3A5OC 2Q0RA 3OYKA 5JICA 1C6VA 2IVPA 2WONA 1K8KA 3HYFA 4DTMA 2HHWA 4OKJA 3ZETA 4LF5K 4BDZA 1BL3A 2I7PA 3AA5X 2ZE2A 3NF6A 3MECA 1GOBA 3VQPA 1VQ9N 4IO8A 2YKNA 3U9DA 1I3AA 4HUGA 3AARA 5ADXA 3PY8A 1HYSA 3ZT4A 4E1MA 2D4WA 3QDKA 5J1EA 3HZ6A 3HOSA 3G25A 3MDQA 4FLYA 1VRTA 4UQGA 4PQUA 3ZT3A 3QESA 2P5GA 3OHRA 4DHYA 4IG0A 4GV3A 4Q0BA 1DTTA 1Y97A 4CFCA 3L2RA 2XY6A 4F2SA 3CI5A 3MN5A 2NRTA 4GW6A 3OBWA 1KCFA 2PYLA 4CIGA 1HNIA 2F96A 3NVKA 4FLXA 4DR6K 1YJWN 2OA8A 1NGHA 2A40A 4PA1A 3OTOK 3OYFA 3QEWA 4PY5A 3R9PA 1EP4A 1XHZA 4IWVA 1J54A 3T1AA 3C7NB 4DF8A 5FDLA 3ZSVA 1M90O 3TABA 4B1ZA 3BZCA 1NK0A 4BR4A 1N6QA 4BRFA 5C15A 2YNFA 4JKGA 1JLFA 3NAEA 1U6ZA 4DU4A 4FWOA 5CZ1A 3CCQN 3EZ5A 3VEZA 3V9WA 3GE1A 4B08A 1TKXA 3DXMB 3WQUA 3HSTB 3UKUB 5AQQA 1WUAA 1RDAA 4DR1K 5D3GA 1TAUA 2Q31A 2P9KB 1ASVA 2OTLN 4M3WA 4H0OA 1HPZA 3SLCA 4DMNA 4K8ZA 3PX0A 3CCMN 2P1JA 4LH5A 3TAFA 2V51B 2Z1JA 4FLZA 3KD5E 3K57A 2CH5A 2P5OA 1ZC6A 3NHGA 4DQPA 2DFHA 3RTVA 1S9EA 1NGJA 4PUOA 1J6ZA 3N4QA 3UIQA 5AZIB 1VSKA 3NGIA 4QAGA 3HK2A 1I94K 4B1VA 4BWMA 5T7BA 1YVUA 2BDPA 3L3UA 4CBWA 3VGMA 1L5UA 3CPEA 3CC4N 3ZEUA 3VEXA 4IEIA 4QCLA 4ELUA 3L3VA 5BN8A 3TU5A 4CECA 2BTFA 1BDGA 2QK9A 1DEJA 4Y0WA 1Q18A 1YT3A 3OYIA 1QHAA 3GOIA 4FJKA 3CJAA 1X9MA 1KQSM 4B1XB 4A2AA 4PKGA 2QXLA 4I6MB 3LPUA 4CBXA 4CJ4A 1TUUA 4I7FA 4PWDA 4MFBA 4YOUA 1GLLO 3EL2A 1BA0A 4E1NA 1CXQA 4RW4A 3CXCM 1RDWX 4H5RA 4CIEA 1S1TA 3FFIA 4FJ7A 3LM2A 1CXUA 5C0YA 4CJFA 3A8YA 4DTOA 4B8AB 1CLQA 2HNYA 3CJCA 4CEFA 1T05A 1HUXA 4NLCA 4AHRA 3PSFA 1TUYA 4DR7K 4YORA 1TVRA 3EZWA 4M3YA 3RMDA 4OKEA 3KK7A 1QSLA 1MA9B 3C6HA 2D0OA 2OPSA 3O4NA 1UA1A 3MEDA 1IG9A 3D2FB 4WFNL 1VQ8N 2E6MA 2NRZA 5C24A 4B3MK 3OYMA 4CEZA 1HNVA 4ILHA 2FXUA 5JLHA 1U45A 1WBDA 3FFKB 3U8XA 4CK2A 3SJHA 5BRDA 4FO0A 2OYQA 2FC0A 3TANA 4ICLA 5AQFA 1MU2A 1VQKN 4F8RA 2VG6A 3Q7BA 3QETA 3C95A 4WYBA 4CCHA 2P9PA 1WOQA 2ZM6K 1HRHA 3VEVA 1JLGA 1Q81O 4JI7K 3THXB 1LWFA 1IV0A 3SAHA 1YVNA 2RF2A 3C65A 3F9KA 4O55A 4O44A 4EFHA 2HVHA 3VQQA 4AHSA 4BC2A 1S6QA 2Q1NA 2O8FA 3CYMA 1WSHA 2VWJA 2YHBA 1C0FA 1RBUA 4LD0A 3V1RA 2P9PB 4OKKA 3AVHA 3H1QA 4FZZA 1ASWA 1JLCA 1LW2A 1NKCA 5AQGA 4WF9L 5AQRA 3ASMA 4GKKK 5JS1A 1C0UA 4HTLA 4IXCA 3V4IA 5KQ8A 3T1HK 4BRGA 4KO0A 3QBXA 4CF8A 1SV5A 3MCPA 2YX6A 1Z26A 3VQEA 1IJJA 4BQLA 3MN6A 1NOZA 2DPNA 5E26A 4FJIA 1KLMA 3ZSWA 3NH1A 4IOCL 3Q7CA 1YAGA 2ZJPL 3CMEN 2YI1A 4DTRA 3V9ZA 1HQEA 4H0TB 2OZMA 5B8HA 1D8YA 1GLBG 4CJ7A 3WEEB 4KI6A 5AQVA 3SNNA 4LF8K 2HHXA 4WQ5A 3SUNA 2HHUA 3NF7A 1ATSA 3VEWA 4ZHRA 4IFVA 4YOWA 3OYBA 4KHYA 4CJWA 4E7HA 3VQ6A 3HPHA 4JLHA 1X3MA 4CD3A 2YHYA 4DUZK 3DLHA 5FPMA 4ID1A 3F73A 4BWJA 3HVRA 3CFPA 1SKWA 3O9SA 4B9LA 5AQTA 4X62K 3P31A 3QIPA 1BQMA 3CCSN 4KB0A 2NRWA 4FK4A 1UWBA 4TSXA 4CI6A 3LP0A 4CZMA 4HTUA 4FZXC 1SAZA 4JKGB 3TTDA 1UA0A 3RR7A 4FVMA 4H0PA 4EP4A 2HSTA 4CF9A 3OYDA 4DSLA 2V52B 3VMFB 3ZSZA 4FL9A 4H5TA 2ZGYA 4I2PA 3OJSA 2CGJA 4EIAA 4MQ3A 3IS9A 2B4JA 3P1GA 2EWSA 5C25A 2YNHA 3ZEUB 3J80O 4JRPA 4GV9A 1JLBA 3JS6A 2FBXA 3AAPA 2Q36A 3ULDA 4BQZA 3DOKA 2E20A 4XEIA 4FJLA 3AVIA 4H4OA 2G8KA 3OS2A 1TK8A 2ZD1A 4DV1K 3P4IA 3BUZB 4DV0K 3CG7A 1RCHA 4BREA 2WC9A 3MMVA 2HHSA 1NGFA 3IMXA 3I33A 3AA4A 4IJNA 2G8FA 2GBZA 4GVMA 3QFUA 5JMVA 1ZBUA 4FSVA 4BRKA 1WSFA 1N5YA 3GBTA 1J9AA 4KH4A 3SJJA 3AO1A 1J5OA 4DR2K 4LF9K 2IS3A 3G0ZA 4OPHA 5FPDA 2Y1JA 3M8RA 4EZ9A 4AILC 2E88A 3CJ7A 4FZYA 4H5VA 4PHTX 3WQTA 4CZFA 4CGIA 2OTJN 4FJ9A 4DU1A 2HNDA 5I9EB 4NXMK 4DR3K 4CGHA 3OW2M 1NMNA 1CZBA 3HJFA 3C6UA 2CGKA 3KKSA 1SL2A 2HB5A 5CYQA 1Q8IA 1VQPN 4IOAL 3VA3A 2RN2A 3SV4A 2I7NA 1DKGD 3AVFA 4M63C 3ENBA 3M8PA 3WXMB 4AHVA 2ETJA 3J7ZO 1YJ9N 1BU6O 4AF1A 3RWUA 3OYGA 2GELA 4DV2K 4FCYA 3SQ2A 1U49A 1C0MA 1BOTO 1KAZA 4GMJB 4KTZA 5BR9A 1V4TA 2YNIA 4CE9A 4EAHD 1P90A 5AQYA 2HF4A 1A5VA 2W40A 4GNIA 4DCHA 1GOAA 4UY8O 3ID8A 5KQDA 2HHQA 4CGJA 1XWLA 2W6LA 4LFBK 1KSPA 5HL7L 2UXDK 3HI0A 4CZGA 1HMVA 3WNFA 3KLGA 3WXIA 4AHCA 1OH6A 4JI8K 4JHDB 4IG3A 3J81O 3OBYA 4K0KK 1GLEG 5AJ3K 3ZETB 4M3TA 1TGOA 5ELZA 5AQWA 5C12A 1X9JA 1VSLA 5BPMA 3D2EA 1HPMA 4FOIA 4LH4A 3F9MA 2QI2A 1BWFO 3DXKA 4N56A 4HWIA 2A6AA 3QINA 3UKRB 1XC9A 2X74A 5AQXA 4E0DA 3I56N 3HRGA 5F2RA 2E2OA 3M6GA 4FLVA 2UXCK 4FJNA 1VRUA 2YNGA 3WXJA 3ATUA 3CERA 2F8SA 1U2VB 3HP6A 2E2QA 3U3GA 4O4GA 4EHUA 3ISNC 4JKDA 4LY7A 4BRCA 4CEQA 1NK4A 1ASUA 2PYJA 4B9SA 5GAEP 1KVBA 2G8HA 2HF3A 3THVA 1A5WA 4H0YB 3VTIA 2UYTA 4WE1A 2D0PA 4FLWA 3O1WA 4CZEA 4JS5A 2P9NA 1D4XA 4BRHA 1L3UA 3TSQA 1LV5A 1JJ2M 1O1WA 1U2VA 4FPBA 4DFKA 1NJWA 3AO2A 4JKFA 4KREA 4JI5K 3SBGA 4BDYA 5GAHP 4N76A 1VSIA 3IFRA 2OZSA 3VENA 5F1XA 1EXQA 4M42A 4OPKA 1QQMA 3VERA 1ZXOA 1BO5O 4KRFA 1JCFA 4KH6A 4MDBA 1MWMA 3R8EA 5BR8K 4DTJA 3NF9A 3SBTA 1R59O 4YOTA 4CJRA 4BACA 3R6MA 1CZ9A 4AQYK 4PKIA 3DXMA 3SAGA 1QE1A 4CJEA 2NRRA 4YHHK 3J8AA 1JXBA 3WUHA 4IFYA 4C8MA 4CHQA 3G10A 3D0PA 3ZLJA 1K9MO 3ZX0A 3ZCMA 3CETA 2WFBA 4Z0UA 5KTQA 2ZF5O 1RBRA 4JK8A 4E7KA 4OJRA 4CJPA 4NCGA 3VQBA 1VSFA 4CJLA 3VTHA 1ZBHA 1EQYA 3PX6A 2DFEA 3WNEA 3FLCO 3K0SA 1NNEA 1KFSA 2B5JA 2NRVA 2FSKA 5MLCQ 3AVGA 1GLDG 2I5JA 3DXKB 3EKSA 4PKHA 4KH5A 4FLTA 1WSGA 3OYCA 1BI4B 2P9SA 5EU7A 3QNOA 4IDKA 3CCVN 4OGCA 2GX9A 3LDLA 1RGIA 3MWTA 3O9TA 3BF3A 4CJUA 1J53A 1SS6A 3MEGA 3ZSOA 3VQ5A 4ISGA 4FJ5A 3OA9A 5LMUK 2Z1HA 2GWJA 3KK3A 3QEVA 3E01A 3ZT2A 1HNXK 2ZWHA 3T69A 3OYLA 4DSFA 1TL1A 4CJKA 4JAXA 4M3RA 4F3TA 3EY1A 3EYZA 2G8IA 4LF7K 2ZGZA 2PAVA 2EX3A 5LJVA 3HT3A 4DQSA 4DFMA 3V9UA 4C1NI 3RRHA 4FW1A 3VF4A 3L6QA 1SZ2A 1TL3A 2WBNA 4DSIA 4FWRA 2OPPA 3S3NA 1GLJO 3QB0A 2IC3A 1A5XA 2HHTA 3K5LA 4OO1J 2FF6A 3WNHA 3J7YP 2F4VK 4M41A 4EP5A 2QEXN 3DAWA 5EXWA 5J2PA 4NB4A 2QW9A 1QZ5A 2Z1GA 1BI4A 2P9SB 3H45C 4ISFA 3U3YA 3PO5A 1QHTA 5AQHA 4X65K 2VQFK 1ZYQA 4BRPA 3V9SA 5HRRA 3LALA 4BC4A 4Z94A 1JLQA 3JAMO 2QA4N 1BGXT 2GUPA 2KLAA 3LZJA 2VG7A 4GKJK 1S1VA 1NJIO 3KD1E 1NGAA 3CJ1A 5AZIA 5C2DA 4BRQA 4FW2A 3DLRA 1BCOA 5FPEA 2D0BA 4FM0A 1F21A 3SQ1A 4KPYA 3SUPA 2BH1A 2P9UA 3DOLA 1KVCA 3E9PA 4YOVA 3QIOA 2PFUA 2QXFA 3SYZA 4B1WB 3WXLA 4B1YB 4CF2A 1YI2N 1ZBFA 2O8EB 3T19A 3AO3A 2UUBK 4J8FA 4JKEA 1WSEA 3WT0A 4KHSA 3S9HA 1WSJA 2O4GA 2QWQA 4DQRA 4OLBA 3O4QA 1XI1A 4AH9A 1B9DA 1RBSA 4F2RA 2DY4A 1S6PA 4BC5A 4W5TA 5ADXH 3CCEN 1WAFA 1G99A 4WFBL 1TYQB 3T7ZA 3MAQA 2NNWA 3WEEA 4F9OA 3CFRA 1XHXA 1D9DA 4B9NA 2BANA 5AR0A 3C7NA 4KTWA 4DV4K 3CHWA 3AVCA 1ZBIA 4DQIA 2VYPA 1KD1O 3HOTA 1JXEA 3DLLL 3K58A 3AA2A 4W5NA 3NH0A 1RNHA 4A57A 4B8CA 2UU9K 4BR0A 5M1FA 3BF1A 3M5RA 2P9NB 2P9LB 1WBBA 1Q9YA 1NBWA 1FJGK 2J4RA 3H3NO 3K2PA 4DS4A 1K73O 5DK5A 1TAQA 1RDUA 3BP8A 4DSEA 5AQLA 5CYMA 3UE5A 4WQ5C 4BVPA 5J2QA 3DMJA 3KWIA 1D9FA 3QEIA 3ID6A 3EE8A 3VQDA 5HROA 3I8DA 4CERA 4BE0A 1WN7A 4DKWA 1VK0A 1G15A 2JGUA 4BRIA 1LWEA 4CD1A 4HUFA 3CD6N 1KXPA 1VSHA 3LWMA 3T1YK 3LPTA 4JS4A 4YOYA 3SV3A 4H03B 4FJHA 3DJCA 5C2FA 5AQZA 3OYHA 4BRNA 3O9QA 3TR8A 1X3NA 4CJ3A 2Q0UA 4XH1A 1EWRA 3KVGA 2LSNA 4NXNK 3QO9A 1I39A 1RTJA 3HVTA 3OYNA 3IDHA 3WNGA 4H8KA 4BDPA 1IKYA 1S1UA 4BR5A 3PIPL 1VQON 2RE2A 5TKWA 3ZSRA 2KQ2A 4RWTA 3D2FA 1KAYA 1SKRA 4BR7A 5LJWA 4R5PA 1KTQA 1BA1A 1OH7A 3RVCA 3VQCA 3HBTA 3OVNA 2A42A 4B1UB 2UUAK 4H5NA 5KPTA 3C94A 4RW9A 3O3HA 4CHPA 2VGNA 4FWSA 5KI6A 2X6NA 4F4KA 3K5MA 4ZTFA 3IUCA 2DTUA 3AAQA 2KHOA 4BRAA 2WOMA 1NK8A 5FRNA 4KHQA 3THWB 3MCAB 3GL1A 1W2BM 4O0IA 2E8AA 3O5BA 4YOXA 3MXIA 1HNWK 2O8FB 2XY5A 2W41A 1S1WA 1U47A 1SKSA 3TWHA 4IO9L 3V81A 1T6DA 5BPNA 1FKPA 2IAJA 4RTFD 4DQQA 4B9MA 4FWMA 3SAFA 4BRMA 2ITMA 5M1PA 3CF5L 5M1KA 1Q7YO 2KZMA 4RCHA 1V4SA 3LDPA 2D1KA 3WXKA 1X1PA 1BHLA 3IRXA 4CW7B 3QEXA 4JD2A 5BREA 1QTMA 4BGBA 3S3OA 3ENOA 4B3SK 4FWNA 4MLHA 2F7TA 3LP1A 4XH4A 3GDQA 3KLHA 1NLVA 4RW6A 4CK3A 1RT2A 1YHQN 1XMQK 3RSEB 1GLAG 2F9WA 4CEDA 4M7XA 2WTUA 5C10A 4CHNA 2QWNA 5DMRA 5DM6L 1ZBLA 5AFUA 1MDUB 1WAJA 4Z4FA 4H4MA 4DLGA 4DV3K 5AQKA 4CBUA 5LY3A 3M1FA 4YDUA 4CHOA 4JI0K 3NMUA 4JV5K 3LDSA 1M1KO 2Y1IA 4CZHA 3H1VX 1HYZA 2HHVA 3AVNA 1HKGA 1MWKA 1OVQA 4DU3A 1WSIA 3I55N 3UKUA 4LC9B 1RT7A 1QS4A 4FJMA 3H08A 3HM9A 3QICA 3LM9A 1TKDA 1S9GA 1L3VA 1JLAA 4R79A 4HHTA 4OGEA 4FJ8A 5HOOA 2HMPA 3TTCA 1OVYA 3KWGA 1RBTA 4DF4A 2E1YA 2G8VA 5BRHA 1IO2A 1P8ZA 5HP1A 3SQ4A 4JI2K 5IWAK 3IKMA 1XQSC 4QS9A 2BUPA 3HTVA 4W5RA 1KVAA 1QQOA 4Z4EA 4YFUA 3QLHA 3AGRA 3B6OA 2KKZA 1U48A 3CQXA 1GOCA 1NKBA 3K5OA 4DTUA 3FR0A 1Z6RA 3VA0A 1T44A 2W42A 2QWLA 4C8LA
chains in the Genus database with same CATH topology
3J81O 4CW7B 4YHHK 4LFAK 5AJ3K 4K0KK 4JI3K 4DV1K 1IBKK 4DV0K 4GKKK 4KHPK 4V19S 4B3SK 4JYAK 1XNQK 4X65K 2VQFK 3T1HK 5LL6Z 4DR6K 3JAMO 4GKJK 3OTOK 1XMQK 3T1YK 2E5LK 1N32K 4OX9K 4DUYK 2HHHK 4LF4K 4DR2K 2UXCK 4LF9K 4DR4K 5LMNK 4DR5K 5IT9O 5FLXO 4LF8K 4NXNK 4DV3K 4X64K 4DV6K 1N36K 4JI0K 1J5EK 4JV5K 4NXMK 4JI4K 4DR3K 4DR7K 4B3TK 4DUZK 1IBLK 5A2QO 2UUBK 1N34K 4X66K 4LF6K 4DR1K 4X62K 2UXBK 2UUAK 1N33K 4LFCK 4B3RK 2UUCK 4B3MK 4DV2K 4DV7K 4YY3K 5LMUK 3J7AP 4CVNE 4JI6K 4JI5K 2VQEK 1HNXK 1XNRK 4DV5K 1HNZK 4JI2K 5IWAK 4DV4K 4LF5K 4LF7K 2ZM6K 4JI7K 2F4VK 1HNWK 4LFBK 3J80O 1I94K 1IBMK 2UU9K 5BR8K 1XMOK 2UXDK 1HR0K 4AQYK 1FJGK 3J7YP 4JI8K 4JI1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 O;  4CW7 B;  4YHH K;  4LFA K;  5AJ3 K;  4K0K K;  4JI3 K;  4DV1 K;  1IBK K;  4DV0 K;  4GKK K;  4KHP K;  4V19 S;  4B3S K;  4JYA K;  1XNQ K;  4X65 K;  2VQF K;  3T1H K;  5LL6 Z;  4DR6 K;  3JAM O;  4GKJ K;  3OTO K;  1XMQ K;  3T1Y K;  2E5L K;  1N32 K;  4OX9 K;  4DUY K;  2HHH K;  4LF4 K;  4DR2 K;  2UXC K;  4LF9 K;  4DR4 K;  5LMN K;  4DR5 K;  5IT9 O;  5FLX O;  4LF8 K;  4NXN K;  4DV3 K;  4X64 K;  4DV6 K;  1N36 K;  4JI0 K;  1J5E K;  4JV5 K;  4NXM K;  4JI4 K;  4DR3 K;  4DR7 K;  4B3T K;  4DUZ K;  1IBL K;  5A2Q O;  2UUB K;  1N34 K;  4X66 K;  4LF6 K;  4DR1 K;  4X62 K;  2UXB K;  2UUA K;  1N33 K;  4LFC K;  4B3R K;  2UUC K;  4B3M K;  4DV2 K;  4DV7 K;  4YY3 K;  5LMU K;  3J7A P;  4CVN E;  4JI6 K;  4JI5 K;  2VQE K;  1HNX K;  1XNR K;  4DV5 K;  1HNZ K;  4JI2 K;  5IWA K;  4DV4 K;  4LF5 K;  4LF7 K;  2ZM6 K;  4JI7 K;  2F4V K;  1HNW K;  4LFB K;  3J80 O;  1I94 K;  1IBM K;  2UU9 K;  5BR8 K;  1XMO K;  2UXD K;  1HR0 K;  4AQY K;  1FJG K;  3J7Y P;  4JI8 K;  4JI1 K; 
#chains in the Genus database with same CATH topology
 1VQ6 N;  1RFQ A;  4YDU C;  5F0X A;  3L2V A;  4CZK A;  1FK9 A;  3LP2 A;  4CFD A;  3O8M A;  4AHT A;  3OJU A;  1XNQ K;  4IZ9 A;  1TYQ A;  5KRS A;  2IVO A;  3VQ8 A;  1QQC A;  3AGK A;  4O8K A;  4CK1 A;  1RT4 A;  5AQJ A;  5AZJ A;  2HBK A;  3AO5 A;  1NM1 A;  2E5L K;  1ESV A;  4MLE A;  2XY8 A;  3AVJ A;  4BE2 A;  1DTQ A;  2YJF A;  1WNS A;  3V6D A;  3A5M C;  4CJQ A;  3U6F A;  2A1R A;  4FJX A;  4DR5 K;  3D45 A;  3K59 A;  4BR2 A;  1C1B A;  4IJA A;  1W9H A;  2IOC A;  3DLE A;  4Z4H A;  3TTF A;  3SZ2 A;  2GWK A;  2E6L A;  3VN5 A;  4M3U A;  1NGG A;  1HKC A;  4FLU A;  1YTA A;  2HNZ A;  1YJN N;  3HPG A;  1T7P A;  5EVZ A;  3RMB A;  4EHT A;  4FJG A;  5A2Q O;  4JKA A;  2P51 A;  3DRP A;  2EHG A;  3MWP A;  1NMD A;  1N33 K;  3C6A A;  3NCI A;  2F8T A;  2UUC K;  4DTS A;  2FF3 B;  4B9U A;  3SI6 A;  3DM2 A;  4ILG B;  1NGE A;  4KFB A;  1SQK A;  4E7I A;  3HXM A;  4ELV A;  4A62 A;  4I2Q A;  4JNE A;  2XRI A;  4FWK A;  5FPN A;  3D2E B;  4FK2 A;  3O3F A;  5SZT A;  4DFJ A;  1HNZ K;  4E19 A;  3ZSX A;  3NBP A;  3MN9 A;  1OH8 A;  2FBY A;  1H1V A;  4I9L A;  2O8D A;  4N47 A;  2QWP A;  2FSN A;  5AQP A;  4C1N K;  3EE9 A;  1XMO K;  3DLB A;  3VGK A;  5JVH L;  4FWL A;  3QFP A;  1QVF M;  3TAR A;  3LAK A;  4B9T A;  2HBL A;  1VSD A;  5JLF A;  1N8R O;  4ID5 A;  1NJY A;  3O08 A;  2RPI A;  1D5A A;  2OPR A;  3CM5 A;  4C8N A;  2GV9 A;  3KJV A;  1K8A O;  2RKI A;  3QNN A;  5HRS A;  1NK9 A;  1Q9X A;  1FXX A;  4IDH A;  4XH5 A;  5KPR A;  3CIP A;  4CGG A;  3AVL A;  4G9Z A;  1B9F A;  4JD2 B;  1U04 A;  2NZT A;  3VF6 A;  3O9R A;  4NCB A;  2ASM A;  3TI0 A;  2HHH K;  4M45 A;  4DR4 K;  4NLB A;  1S22 A;  4JK7 A;  4AM7 A;  4WCE L;  3G4S N;  3P83 D;  5JS2 A;  1C1A A;  4Y1D A;  5E84 A;  3EO3 A;  4CEA A;  4DWI A;  3O4W A;  3H46 O;  3VEO A;  4CJ5 A;  5HRN A;  1KAX A;  1N36 K;  5CY4 A;  2V7Y A;  2IVN A;  1NOY A;  4C8O A;  1J5E K;  3TAQ A;  3DRR A;  4DSK A;  4JI4 K;  4M3Z A;  5KGX A;  1NWK A;  2QWO A;  1HJR A;  3THX A;  3LP3 A;  3VQ7 A;  3LL3 A;  2CH6 A;  2KFN A;  2PY5 A;  4H5W A;  1Z25 A;  4NO7 A;  3N4P A;  1OH5 A;  3LZI A;  3QML A;  1FKO A;  1L3T A;  2YCH A;  4CIF A;  4B3R K;  1QSS A;  4JN4 A;  1NG9 A;  3S41 A;  1EKE A;  1S3X A;  4CJS A;  4LSN A;  4CVN E;  4FJJ A;  2FSJ A;  1YIT N;  2VWB A;  2Q97 A;  1E3M A;  3BGR A;  3HM8 A;  4I9Q A;  3FZF A;  1NGC A;  3W3D A;  4K8X A;  1YXQ A;  3L0Q A;  3OYJ A;  5M1Q A;  1HKB A;  1JCG A;  2CGL A;  4U67 L;  4DTP A;  4WQ4 A;  3O9U A;  2QWM A;  4K43 A;  4DSJ A;  3AV9 A;  3H6E A;  4A59 A;  3CPW M;  3KLE A;  1LWC A;  3RMC A;  3AY9 A;  3PIO L;  4KTQ A;  2XY7 A;  3CC7 N;  4RW7 A;  3UB5 A;  1REV A;  3TAP A;  3C6T A;  5KGW A;  1YUW A;  3MN7 A;  2YHA A;  4KB1 A;  5LL6 Z;  3QBW A;  4JKB A;  3MX2 A;  2HW3 A;  3ENH A;  3CQY A;  5E41 A;  3ITH A;  2ASP A;  1GLF O;  3VOV A;  2Q2R A;  3BZK A;  3FZK A;  4KAZ A;  1FW6 A;  1IKW A;  3OS0 A;  4FOE A;  3CFO A;  3UKR A;  4W5O A;  2O4I A;  2ATQ A;  5M1N A;  3EEQ A;  3K9J A;  1S72 N;  4C8K A;  3K5N A;  1T3V A;  3ZX2 A;  4IEE A;  4QS8 A;  4WFA L;  4DTN A;  4A5B A;  5GIO A;  4XIU A;  4L8R B;  2XO7 A;  4K42 A;  1TKT A;  4ILJ A;  3SMS A;  2YHW A;  5C42 A;  1VQ5 N;  5H1S Q;  2ZJR L;  4LSL A;  3RRG A;  1JLE A;  1NKE A;  4X66 K;  3W0L A;  1IKV A;  4BGA A;  4BRD A;  1TKZ A;  4RW8 A;  4LFC K;  3NGY A;  1VQ7 N;  3A0I X;  3L4Q A;  4DFP A;  3PO4 A;  4NYN A;  4J2E A;  3O3G A;  4FM2 A;  3TAG A;  1WLJ A;  1NJZ A;  5CHI A;  3PLA A;  1Z05 A;  1RDC A;  3FZM A;  3AO4 A;  1NK5 A;  1VSM A;  1K8K B;  3L2U A;  4Z4G A;  4AM6 A;  1ATR A;  4JK9 A;  4A61 A;  4DV5 K;  4O8U A;  1U4B A;  3I8B A;  4NCA A;  1BIZ A;  4JKH A;  1RT5 A;  2A5X A;  3A2F A;  1KLN A;  1T03 A;  4CES A;  3MX5 A;  4HVJ A;  3KHY A;  3THY A;  3KTQ A;  2W6K A;  3O1B A;  4CJT A;  3V1Q A;  3HO1 A;  2JLE A;  3VQA A;  4EZ6 A;  1DGK N;  1K6Y A;  1BIU A;  2NLX A;  3K9K A;  2P9U B;  1KFD A;  4M3X A;  3SK3 A;  4CHY A;  1EET A;  1QQN A;  4KI4 A;  4H0V B;  2O8B B;  4OLA A;  1EX4 A;  2PZS A;  2KZZ A;  2KFZ A;  3FZL A;  4CEE A;  3CJB A;  4DS5 A;  4BR9 A;  2XHB A;  1BCM A;  5CZ2 A;  4CZL A;  4AHU A;  3F5T A;  2IIR A;  5AQM A;  3SUO A;  3G71 N;  3V9X A;  2H3G X;  3LDN A;  4MDA A;  3TPQ A;  1B92 A;  1QVG M;  4FK0 A;  5AFU H;  2E1Z A;  4JHD A;  5AZJ B;  5FLX O;  1NK7 A;  3DLG A;  3NDK A;  2P9I B;  2QKK A;  1WB9 A;  2KTQ A;  3EN9 A;  3VF2 A;  3AVB A;  3KKR A;  1RTI A;  5BN9 A;  4DV6 K;  3ALY A;  1JL1 A;  1C0T A;  1EWQ A;  2QTD A;  4KKO A;  4A5A A;  4CZJ A;  4J2A A;  1VAZ A;  3PV8 A;  4U7B A;  1NJX A;  1SUQ A;  4LF6 K;  2GEM A;  3KIO A;  5HBM A;  2VWK A;  4L3Q A;  1VQM N;  2YKM A;  1BIS A;  3KZB A;  5K14 A;  5GIP A;  1YF5 L;  3M8S A;  4BC3 A;  4QS7 A;  3LDO A;  4YY3 K;  3J7A P;  3ZT0 A;  2A3Z A;  4IKF A;  3D7E O;  4JRQ A;  4JEP A;  3P38 A;  2VQE K;  2FBV A;  3VQ4 A;  1W7A A;  2OCE A;  2E4L A;  4FM1 A;  3I0R A;  1RDB A;  4CF1 A;  1BG3 A;  2D0A A;  2NRH A;  4E7J A;  2GTD A;  1W97 L;  4CJV A;  5GIN A;  3L2W A;  4CGD A;  4Z4C A;  2P9L A;  5CE3 A;  1T6C A;  1VQL N;  1VSJ A;  1E4G T;  3H3O B;  4DLE A;  3ULE B;  4CEO A;  4JI1 K;  3KK2 A;  4Z4I A;  2HVI A;  3SUQ A;  3AVM A;  4LFA K;  4KHU A;  1YTU A;  4DTX A;  2QKB A;  1XC3 A;  1RT3 A;  1TK0 A;  4CZI A;  3CCL N;  4HCC A;  4KHP K;  5DM7 L;  2F9T A;  5CR4 A;  4HCB A;  2Q3S A;  2YHX A;  2YV0 X;  1RTD A;  4IBN A;  3JYT A;  3RMA A;  5J2N A;  4BRO A;  4IOX A;  2QWR A;  3ZSQ A;  4E3S A;  2WUS A;  3TAM A;  3VET A;  4ELT A;  3I0S A;  4B9Q A;  3DRS A;  1QSY A;  4O5F A;  1N32 K;  1S5J A;  4B9V A;  2AJQ A;  2ZJQ L;  2YJE A;  4OVL A;  2VCP A;  3HP9 A;  4YNQ A;  5IT9 O;  1L3S A;  3A5L C;  3RSE A;  3JSM A;  3V1O A;  1HX1 A;  2D5R A;  5AQO A;  5AQU A;  3CJ9 A;  1KRP A;  2X78 A;  1HLU A;  1LAW A;  3AVA A;  3IG1 A;  2AP1 A;  1EO1 A;  4FWQ A;  1LAV A;  4E89 A;  2X6S A;  3S3M A;  1DLO A;  4FPA A;  1JCE A;  2OPQ A;  3NH2 A;  2JWK A;  4GY2 B;  4KBO A;  4OPJ A;  3B8A X;  1IBL K;  3BDP A;  3SQ0 A;  1ILY A;  1UAX A;  3E9O A;  3AA3 A;  1NU0 A;  3ZT1 A;  4NYF A;  2HBM A;  3CM6 A;  4DQ8 A;  4QOZ B;  3FE1 A;  3MXJ A;  3KK1 A;  2ZQB A;  1ATN A;  4DV7 K;  3VES A;  3CCJ N;  4BG9 A;  4GVE A;  1DT9 A;  1RT1 A;  2A1S A;  3P5J A;  3VQ9 A;  3CMA N;  1S1X A;  2GUI A;  5FRM A;  3E66 A;  3KLF A;  2O8B A;  3QEP A;  3P39 A;  3DLK A;  3VPZ A;  4F3O A;  3FZH A;  4DB3 A;  2PBD A;  3MXM A;  3LAM A;  4E1J A;  1KC8 O;  2KW4 A;  1RDD A;  1RT6 A;  2V7Z A;  5M1O A;  2D0C A;  1OKJ A;  4J2B A;  5J2M A;  1IBM K;  3ATV A;  3C0B A;  3JXU A;  3F2K A;  3PSI A;  4CGF A;  3THY B;  2BE2 A;  4PL8 A;  5KPZ A;  5JVG L;  5GAD P;  1SL0 A;  4KHW A;  5HRP A;  3RR8 A;  1C1C A;  5EX5 A;  1VQN N;  4JI3 K;  4WQ4 C;  4V19 S;  4JYA K;  3CQ8 A;  4Q5V A;  4KHN A;  1X9S A;  1X9W A;  1XUP O;  4BVO A;  3FGU A;  3BEX A;  2HMI A;  4M7Y A;  1LW0 A;  3TSU A;  2NRX A;  3U9Z A;  1RBV A;  4OX9 K;  4CFB A;  3PX4 A;  4DUY K;  4LF4 K;  3LWL A;  3AVK A;  3LDQ A;  3LAN A;  1TV6 A;  4C23 A;  4GV6 A;  1QZ6 A;  2FLO A;  4ZTJ A;  1HJO A;  2FBT A;  4JKC A;  4I6M A;  4X64 K;  4G1Q A;  3IAY A;  5GAG P;  3OS1 A;  3EKU A;  1BUP A;  4CFA A;  3A5N C;  3ZX3 A;  3U4L A;  3DWL A;  1NGI A;  2VGM A;  1N34 K;  4A2B A;  1IG8 A;  3ULE A;  4O5B A;  3M8Q A;  1HYV A;  3G6E N;  2R7Y A;  1NK6 A;  3E1Y A;  1YIJ N;  2UXB K;  3DYA A;  2E2P A;  2B6A A;  2O8C B;  1IH7 A;  4JI6 K;  1HQU A;  3L4I A;  1ITG A;  3E9L A;  3O6W A;  3R1X A;  3R3L A;  2HBJ A;  3OYA A;  1XNR K;  4N41 A;  2E2N A;  3ZYY X;  3NFA A;  4E7L A;  1LOT B;  5I42 A;  2G8W A;  1NGD A;  2IDO A;  4MO5 A;  2P9K A;  4N5S A;  1VSE A;  1VHX A;  3NF8 A;  4B3O A;  5AQI A;  4O0J A;  3QER A;  2NUB A;  1Q82 O;  3HSC A;  1GLC G;  1W0H A;  3PUF A;  3TAE A;  4K41 A;  2A41 A;  1HR0 K;  3NVM A;  3M3Z A;  4H0X B;  5AQS A;  3GG4 A;  2RHK A;  4K25 A;  5AQN A;  4PL7 A;  4OPA A;  4BG8 A;  2O8E A;  1JKH A;  1ZBS A;  1IBK K;  1Y64 A;  4ISE A;  4FXD A;  1VQ4 N;  5EY4 A;  4CEB A;  3VEY A;  5KRT A;  1JL2 A;  3TSP A;  2G8U A;  3CC2 N;  2O8C A;  4RG8 A;  1NGB A;  3SCX A;  3MEE A;  1BQN A;  2P9I A;  4BE1 A;  1C0G A;  5I3U A;  5HLF A;  4W5Q A;  2QM1 A;  1IKX A;  5BPL A;  4CF0 A;  3BY5 A;  5FRO A;  2IGI A;  3THW A;  2AA4 A;  2ITG A;  2BGG A;  3HPO A;  1RIL A;  3OY9 A;  3CCR N;  2OAN A;  5LMN K;  3SPY A;  2DFF A;  4MO4 A;  4FYD A;  1E4F T;  1Q86 O;  1TK5 A;  3O80 A;  3D6R A;  1R0A A;  2ASO A;  4IFE A;  2JWL A;  1RTH A;  4CHZ A;  4DG1 A;  3OYE A;  3T3F A;  4HUE A;  4KV8 A;  3SMP A;  3ZSY A;  3DI6 A;  2Z1I A;  4BRL A;  4B3T K;  2VG5 A;  4FVU A;  1SL1 A;  4BY9 C;  5BRF A;  3L8B A;  3VGL A;  1O13 A;  3HL8 A;  3MK6 A;  4J2D A;  4Y1C A;  2HOE A;  5SWM A;  1UOC A;  3CCU N;  3KLI A;  1LCU A;  3B6P A;  3NE6 A;  3SPZ A;  1T8E A;  3NGZ A;  5EOY A;  5TKY A;  4FWP A;  3L2Q A;  1CZA N;  2O8D B;  3A5O C;  2Q0R A;  3OYK A;  5JIC A;  1C6V A;  2IVP A;  2WON A;  1K8K A;  3HYF A;  4DTM A;  2HHW A;  4OKJ A;  3ZET A;  4LF5 K;  4BDZ A;  1BL3 A;  2I7P A;  3AA5 X;  2ZE2 A;  3NF6 A;  3MEC A;  1GOB A;  3VQP A;  1VQ9 N;  4IO8 A;  2YKN A;  3U9D A;  1I3A A;  4HUG A;  3AAR A;  5ADX A;  3PY8 A;  1HYS A;  3ZT4 A;  4E1M A;  2D4W A;  3QDK A;  5J1E A;  3HZ6 A;  3HOS A;  3G25 A;  3MDQ A;  4FLY A;  1VRT A;  4UQG A;  4PQU A;  3ZT3 A;  3QES A;  2P5G A;  3OHR A;  4DHY A;  4IG0 A;  4GV3 A;  4Q0B A;  1DTT A;  1Y97 A;  4CFC A;  3L2R A;  2XY6 A;  4F2S A;  3CI5 A;  3MN5 A;  2NRT A;  4GW6 A;  3OBW A;  1KCF A;  2PYL A;  4CIG A;  1HNI A;  2F96 A;  3NVK A;  4FLX A;  4DR6 K;  1YJW N;  2OA8 A;  1NGH A;  2A40 A;  4PA1 A;  3OTO K;  3OYF A;  3QEW A;  4PY5 A;  3R9P A;  1EP4 A;  1XHZ A;  4IWV A;  1J54 A;  3T1A A;  3C7N B;  4DF8 A;  5FDL A;  3ZSV A;  1M90 O;  3TAB A;  4B1Z A;  3BZC A;  1NK0 A;  4BR4 A;  1N6Q A;  4BRF A;  5C15 A;  2YNF A;  4JKG A;  1JLF A;  3NAE A;  1U6Z A;  4DU4 A;  4FWO A;  5CZ1 A;  3CCQ N;  3EZ5 A;  3VEZ A;  3V9W A;  3GE1 A;  4B08 A;  1TKX A;  3DXM B;  3WQU A;  3HST B;  3UKU B;  5AQQ A;  1WUA A;  1RDA A;  4DR1 K;  5D3G A;  1TAU A;  2Q31 A;  2P9K B;  1ASV A;  2OTL N;  4M3W A;  4H0O A;  1HPZ A;  3SLC A;  4DMN A;  4K8Z A;  3PX0 A;  3CCM N;  2P1J A;  4LH5 A;  3TAF A;  2V51 B;  2Z1J A;  4FLZ A;  3KD5 E;  3K57 A;  2CH5 A;  2P5O A;  1ZC6 A;  3NHG A;  4DQP A;  2DFH A;  3RTV A;  1S9E A;  1NGJ A;  4PUO A;  1J6Z A;  3N4Q A;  3UIQ A;  5AZI B;  1VSK A;  3NGI A;  4QAG A;  3HK2 A;  1I94 K;  4B1V A;  4BWM A;  5T7B A;  1YVU A;  2BDP A;  3L3U A;  4CBW A;  3VGM A;  1L5U A;  3CPE A;  3CC4 N;  3ZEU A;  3VEX A;  4IEI A;  4QCL A;  4ELU A;  3L3V A;  5BN8 A;  3TU5 A;  4CEC A;  2BTF A;  1BDG A;  2QK9 A;  1DEJ A;  4Y0W A;  1Q18 A;  1YT3 A;  3OYI A;  1QHA A;  3GOI A;  4FJK A;  3CJA A;  1X9M A;  1KQS M;  4B1X B;  4A2A A;  4PKG A;  2QXL A;  4I6M B;  3LPU A;  4CBX A;  4CJ4 A;  1TUU A;  4I7F A;  4PWD A;  4MFB A;  4YOU A;  1GLL O;  3EL2 A;  1BA0 A;  4E1N A;  1CXQ A;  4RW4 A;  3CXC M;  1RDW X;  4H5R A;  4CIE A;  1S1T A;  3FFI A;  4FJ7 A;  3LM2 A;  1CXU A;  5C0Y A;  4CJF A;  3A8Y A;  4DTO A;  4B8A B;  1CLQ A;  2HNY A;  3CJC A;  4CEF A;  1T05 A;  1HUX A;  4NLC A;  4AHR A;  3PSF A;  1TUY A;  4DR7 K;  4YOR A;  1TVR A;  3EZW A;  4M3Y A;  3RMD A;  4OKE A;  3KK7 A;  1QSL A;  1MA9 B;  3C6H A;  2D0O A;  2OPS A;  3O4N A;  1UA1 A;  3MED A;  1IG9 A;  3D2F B;  4WFN L;  1VQ8 N;  2E6M A;  2NRZ A;  5C24 A;  4B3M K;  3OYM A;  4CEZ A;  1HNV A;  4ILH A;  2FXU A;  5JLH A;  1U45 A;  1WBD A;  3FFK B;  3U8X A;  4CK2 A;  3SJH A;  5BRD A;  4FO0 A;  2OYQ A;  2FC0 A;  3TAN A;  4ICL A;  5AQF A;  1MU2 A;  1VQK N;  4F8R A;  2VG6 A;  3Q7B A;  3QET A;  3C95 A;  4WYB A;  4CCH A;  2P9P A;  1WOQ A;  2ZM6 K;  1HRH A;  3VEV A;  1JLG A;  1Q81 O;  4JI7 K;  3THX B;  1LWF A;  1IV0 A;  3SAH A;  1YVN A;  2RF2 A;  3C65 A;  3F9K A;  4O55 A;  4O44 A;  4EFH A;  2HVH A;  3VQQ A;  4AHS A;  4BC2 A;  1S6Q A;  2Q1N A;  2O8F A;  3CYM A;  1WSH A;  2VWJ A;  2YHB A;  1C0F A;  1RBU A;  4LD0 A;  3V1R A;  2P9P B;  4OKK A;  3AVH A;  3H1Q A;  4FZZ A;  1ASW A;  1JLC A;  1LW2 A;  1NKC A;  5AQG A;  4WF9 L;  5AQR A;  3ASM A;  4GKK K;  5JS1 A;  1C0U A;  4HTL A;  4IXC A;  3V4I A;  5KQ8 A;  3T1H K;  4BRG A;  4KO0 A;  3QBX A;  4CF8 A;  1SV5 A;  3MCP A;  2YX6 A;  1Z26 A;  3VQE A;  1IJJ A;  4BQL A;  3MN6 A;  1NOZ A;  2DPN A;  5E26 A;  4FJI A;  1KLM A;  3ZSW A;  3NH1 A;  4IOC L;  3Q7C A;  1YAG A;  2ZJP L;  3CME N;  2YI1 A;  4DTR A;  3V9Z A;  1HQE A;  4H0T B;  2OZM A;  5B8H A;  1D8Y A;  1GLB G;  4CJ7 A;  3WEE B;  4KI6 A;  5AQV A;  3SNN A;  4LF8 K;  2HHX A;  4WQ5 A;  3SUN A;  2HHU A;  3NF7 A;  1ATS A;  3VEW A;  4ZHR A;  4IFV A;  4YOW A;  3OYB A;  4KHY A;  4CJW A;  4E7H A;  3VQ6 A;  3HPH A;  4JLH A;  1X3M A;  4CD3 A;  2YHY A;  4DUZ K;  3DLH A;  5FPM A;  4ID1 A;  3F73 A;  4BWJ A;  3HVR A;  3CFP A;  1SKW A;  3O9S A;  4B9L A;  5AQT A;  4X62 K;  3P31 A;  3QIP A;  1BQM A;  3CCS N;  4KB0 A;  2NRW A;  4FK4 A;  1UWB A;  4TSX A;  4CI6 A;  3LP0 A;  4CZM A;  4HTU A;  4FZX C;  1SAZ A;  4JKG B;  3TTD A;  1UA0 A;  3RR7 A;  4FVM A;  4H0P A;  4EP4 A;  2HST A;  4CF9 A;  3OYD A;  4DSL A;  2V52 B;  3VMF B;  3ZSZ A;  4FL9 A;  4H5T A;  2ZGY A;  4I2P A;  3OJS A;  2CGJ A;  4EIA A;  4MQ3 A;  3IS9 A;  2B4J A;  3P1G A;  2EWS A;  5C25 A;  2YNH A;  3ZEU B;  3J80 O;  4JRP A;  4GV9 A;  1JLB A;  3JS6 A;  2FBX A;  3AAP A;  2Q36 A;  3ULD A;  4BQZ A;  3DOK A;  2E20 A;  4XEI A;  4FJL A;  3AVI A;  4H4O A;  2G8K A;  3OS2 A;  1TK8 A;  2ZD1 A;  4DV1 K;  3P4I A;  3BUZ B;  4DV0 K;  3CG7 A;  1RCH A;  4BRE A;  2WC9 A;  3MMV A;  2HHS A;  1NGF A;  3IMX A;  3I33 A;  3AA4 A;  4IJN A;  2G8F A;  2GBZ A;  4GVM A;  3QFU A;  5JMV A;  1ZBU A;  4FSV A;  4BRK A;  1WSF A;  1N5Y A;  3GBT A;  1J9A A;  4KH4 A;  3SJJ A;  3AO1 A;  1J5O A;  4DR2 K;  4LF9 K;  2IS3 A;  3G0Z A;  4OPH A;  5FPD A;  2Y1J A;  3M8R A;  4EZ9 A;  4AIL C;  2E88 A;  3CJ7 A;  4FZY A;  4H5V A;  4PHT X;  3WQT A;  4CZF A;  4CGI A;  2OTJ N;  4FJ9 A;  4DU1 A;  2HND A;  5I9E B;  4NXM K;  4DR3 K;  4CGH A;  3OW2 M;  1NMN A;  1CZB A;  3HJF A;  3C6U A;  2CGK A;  3KKS A;  1SL2 A;  2HB5 A;  5CYQ A;  1Q8I A;  1VQP N;  4IOA L;  3VA3 A;  2RN2 A;  3SV4 A;  2I7N A;  1DKG D;  3AVF A;  4M63 C;  3ENB A;  3M8P A;  3WXM B;  4AHV A;  2ETJ A;  3J7Z O;  1YJ9 N;  1BU6 O;  4AF1 A;  3RWU A;  3OYG A;  2GEL A;  4DV2 K;  4FCY A;  3SQ2 A;  1U49 A;  1C0M A;  1BOT O;  1KAZ A;  4GMJ B;  4KTZ A;  5BR9 A;  1V4T A;  2YNI A;  4CE9 A;  4EAH D;  1P90 A;  5AQY A;  2HF4 A;  1A5V A;  2W40 A;  4GNI A;  4DCH A;  1GOA A;  4UY8 O;  3ID8 A;  5KQD A;  2HHQ A;  4CGJ A;  1XWL A;  2W6L A;  4LFB K;  1KSP A;  5HL7 L;  2UXD K;  3HI0 A;  4CZG A;  1HMV A;  3WNF A;  3KLG A;  3WXI A;  4AHC A;  1OH6 A;  4JI8 K;  4JHD B;  4IG3 A;  3J81 O;  3OBY A;  4K0K K;  1GLE G;  5AJ3 K;  3ZET B;  4M3T A;  1TGO A;  5ELZ A;  5AQW A;  5C12 A;  1X9J A;  1VSL A;  5BPM A;  3D2E A;  1HPM A;  4FOI A;  4LH4 A;  3F9M A;  2QI2 A;  1BWF O;  3DXK A;  4N56 A;  4HWI A;  2A6A A;  3QIN A;  3UKR B;  1XC9 A;  2X74 A;  5AQX A;  4E0D A;  3I56 N;  3HRG A;  5F2R A;  2E2O A;  3M6G A;  4FLV A;  2UXC K;  4FJN A;  1VRU A;  2YNG A;  3WXJ A;  3ATU A;  3CER A;  2F8S A;  1U2V B;  3HP6 A;  2E2Q A;  3U3G A;  4O4G A;  4EHU A;  3ISN C;  4JKD A;  4LY7 A;  4BRC A;  4CEQ A;  1NK4 A;  1ASU A;  2PYJ A;  4B9S A;  5GAE P;  1KVB A;  2G8H A;  2HF3 A;  3THV A;  1A5W A;  4H0Y B;  3VTI A;  2UYT A;  4WE1 A;  2D0P A;  4FLW A;  3O1W A;  4CZE A;  4JS5 A;  2P9N A;  1D4X A;  4BRH A;  1L3U A;  3TSQ A;  1LV5 A;  1JJ2 M;  1O1W A;  1U2V A;  4FPB A;  4DFK A;  1NJW A;  3AO2 A;  4JKF A;  4KRE A;  4JI5 K;  3SBG A;  4BDY A;  5GAH P;  4N76 A;  1VSI A;  3IFR A;  2OZS A;  3VEN A;  5F1X A;  1EXQ A;  4M42 A;  4OPK A;  1QQM A;  3VER A;  1ZXO A;  1BO5 O;  4KRF A;  1JCF A;  4KH6 A;  4MDB A;  1MWM A;  3R8E A;  5BR8 K;  4DTJ A;  3NF9 A;  3SBT A;  1R59 O;  4YOT A;  4CJR A;  4BAC A;  3R6M A;  1CZ9 A;  4AQY K;  4PKI A;  3DXM A;  3SAG A;  1QE1 A;  4CJE A;  2NRR A;  4YHH K;  3J8A A;  1JXB A;  3WUH A;  4IFY A;  4C8M A;  4CHQ A;  3G10 A;  3D0P A;  3ZLJ A;  1K9M O;  3ZX0 A;  3ZCM A;  3CET A;  2WFB A;  4Z0U A;  5KTQ A;  2ZF5 O;  1RBR A;  4JK8 A;  4E7K A;  4OJR A;  4CJP A;  4NCG A;  3VQB A;  1VSF A;  4CJL A;  3VTH A;  1ZBH A;  1EQY A;  3PX6 A;  2DFE A;  3WNE A;  3FLC O;  3K0S A;  1NNE A;  1KFS A;  2B5J A;  2NRV A;  2FSK A;  5MLC Q;  3AVG A;  1GLD G;  2I5J A;  3DXK B;  3EKS A;  4PKH A;  4KH5 A;  4FLT A;  1WSG A;  3OYC A;  1BI4 B;  2P9S A;  5EU7 A;  3QNO A;  4IDK A;  3CCV N;  4OGC A;  2GX9 A;  3LDL A;  1RGI A;  3MWT A;  3O9T A;  3BF3 A;  4CJU A;  1J53 A;  1SS6 A;  3MEG A;  3ZSO A;  3VQ5 A;  4ISG A;  4FJ5 A;  3OA9 A;  5LMU K;  2Z1H A;  2GWJ A;  3KK3 A;  3QEV A;  3E01 A;  3ZT2 A;  1HNX K;  2ZWH A;  3T69 A;  3OYL A;  4DSF A;  1TL1 A;  4CJK A;  4JAX A;  4M3R A;  4F3T A;  3EY1 A;  3EYZ A;  2G8I A;  4LF7 K;  2ZGZ A;  2PAV A;  2EX3 A;  5LJV A;  3HT3 A;  4DQS A;  4DFM A;  3V9U A;  4C1N I;  3RRH A;  4FW1 A;  3VF4 A;  3L6Q A;  1SZ2 A;  1TL3 A;  2WBN A;  4DSI A;  4FWR A;  2OPP A;  3S3N A;  1GLJ O;  3QB0 A;  2IC3 A;  1A5X A;  2HHT A;  3K5L A;  4OO1 J;  2FF6 A;  3WNH A;  3J7Y P;  2F4V K;  4M41 A;  4EP5 A;  2QEX N;  3DAW A;  5EXW A;  5J2P A;  4NB4 A;  2QW9 A;  1QZ5 A;  2Z1G A;  1BI4 A;  2P9S B;  3H45 C;  4ISF A;  3U3Y A;  3PO5 A;  1QHT A;  5AQH A;  4X65 K;  2VQF K;  1ZYQ A;  4BRP A;  3V9S A;  5HRR A;  3LAL A;  4BC4 A;  4Z94 A;  1JLQ A;  3JAM O;  2QA4 N;  1BGX T;  2GUP A;  2KLA A;  3LZJ A;  2VG7 A;  4GKJ K;  1S1V A;  1NJI O;  3KD1 E;  1NGA A;  3CJ1 A;  5AZI A;  5C2D A;  4BRQ A;  4FW2 A;  3DLR A;  1BCO A;  5FPE A;  2D0B A;  4FM0 A;  1F21 A;  3SQ1 A;  4KPY A;  3SUP A;  2BH1 A;  2P9U A;  3DOL A;  1KVC A;  3E9P A;  4YOV A;  3QIO A;  2PFU A;  2QXF A;  3SYZ A;  4B1W B;  3WXL A;  4B1Y B;  4CF2 A;  1YI2 N;  1ZBF A;  2O8E B;  3T19 A;  3AO3 A;  2UUB K;  4J8F A;  4JKE A;  1WSE A;  3WT0 A;  4KHS A;  3S9H A;  1WSJ A;  2O4G A;  2QWQ A;  4DQR A;  4OLB A;  3O4Q A;  1XI1 A;  4AH9 A;  1B9D A;  1RBS A;  4F2R A;  2DY4 A;  1S6P A;  4BC5 A;  4W5T A;  5ADX H;  3CCE N;  1WAF A;  1G99 A;  4WFB L;  1TYQ B;  3T7Z A;  3MAQ A;  2NNW A;  3WEE A;  4F9O A;  3CFR A;  1XHX A;  1D9D A;  4B9N A;  2BAN A;  5AR0 A;  3C7N A;  4KTW A;  4DV4 K;  3CHW A;  3AVC A;  1ZBI A;  4DQI A;  2VYP A;  1KD1 O;  3HOT A;  1JXE A;  3DLL L;  3K58 A;  3AA2 A;  4W5N A;  3NH0 A;  1RNH A;  4A57 A;  4B8C A;  2UU9 K;  4BR0 A;  5M1F A;  3BF1 A;  3M5R A;  2P9N B;  2P9L B;  1WBB A;  1Q9Y A;  1NBW A;  1FJG K;  2J4R A;  3H3N O;  3K2P A;  4DS4 A;  1K73 O;  5DK5 A;  1TAQ A;  1RDU A;  3BP8 A;  4DSE A;  5AQL A;  5CYM A;  3UE5 A;  4WQ5 C;  4BVP A;  5J2Q A;  3DMJ A;  3KWI A;  1D9F A;  3QEI A;  3ID6 A;  3EE8 A;  3VQD A;  5HRO A;  3I8D A;  4CER A;  4BE0 A;  1WN7 A;  4DKW A;  1VK0 A;  1G15 A;  2JGU A;  4BRI A;  1LWE A;  4CD1 A;  4HUF A;  3CD6 N;  1KXP A;  1VSH A;  3LWM A;  3T1Y K;  3LPT A;  4JS4 A;  4YOY A;  3SV3 A;  4H03 B;  4FJH A;  3DJC A;  5C2F A;  5AQZ A;  3OYH A;  4BRN A;  3O9Q A;  3TR8 A;  1X3N A;  4CJ3 A;  2Q0U A;  4XH1 A;  1EWR A;  3KVG A;  2LSN A;  4NXN K;  3QO9 A;  1I39 A;  1RTJ A;  3HVT A;  3OYN A;  3IDH A;  3WNG A;  4H8K A;  4BDP A;  1IKY A;  1S1U A;  4BR5 A;  3PIP L;  1VQO N;  2RE2 A;  5TKW A;  3ZSR A;  2KQ2 A;  4RWT A;  3D2F A;  1KAY A;  1SKR A;  4BR7 A;  5LJW A;  4R5P A;  1KTQ A;  1BA1 A;  1OH7 A;  3RVC A;  3VQC A;  3HBT A;  3OVN A;  2A42 A;  4B1U B;  2UUA K;  4H5N A;  5KPT A;  3C94 A;  4RW9 A;  3O3H A;  4CHP A;  2VGN A;  4FWS A;  5KI6 A;  2X6N A;  4F4K A;  3K5M A;  4ZTF A;  3IUC A;  2DTU A;  3AAQ A;  2KHO A;  4BRA A;  2WOM A;  1NK8 A;  5FRN A;  4KHQ A;  3THW B;  3MCA B;  3GL1 A;  1W2B M;  4O0I A;  2E8A A;  3O5B A;  4YOX A;  3MXI A;  1HNW K;  2O8F B;  2XY5 A;  2W41 A;  1S1W A;  1U47 A;  1SKS A;  3TWH A;  4IO9 L;  3V81 A;  1T6D A;  5BPN A;  1FKP A;  2IAJ A;  4RTF D;  4DQQ A;  4B9M A;  4FWM A;  3SAF A;  4BRM A;  2ITM A;  5M1P A;  3CF5 L;  5M1K A;  1Q7Y O;  2KZM A;  4RCH A;  1V4S A;  3LDP A;  2D1K A;  3WXK A;  1X1P A;  1BHL A;  3IRX A;  4CW7 B;  3QEX A;  4JD2 A;  5BRE A;  1QTM A;  4BGB A;  3S3O A;  3ENO A;  4B3S K;  4FWN A;  4MLH A;  2F7T A;  3LP1 A;  4XH4 A;  3GDQ A;  3KLH A;  1NLV A;  4RW6 A;  4CK3 A;  1RT2 A;  1YHQ N;  1XMQ K;  3RSE B;  1GLA G;  2F9W A;  4CED A;  4M7X A;  2WTU A;  5C10 A;  4CHN A;  2QWN A;  5DMR A;  5DM6 L;  1ZBL A;  5AFU A;  1MDU B;  1WAJ A;  4Z4F A;  4H4M A;  4DLG A;  4DV3 K;  5AQK A;  4CBU A;  5LY3 A;  3M1F A;  4YDU A;  4CHO A;  4JI0 K;  3NMU A;  4JV5 K;  3LDS A;  1M1K O;  2Y1I A;  4CZH A;  3H1V X;  1HYZ A;  2HHV A;  3AVN A;  1HKG A;  1MWK A;  1OVQ A;  4DU3 A;  1WSI A;  3I55 N;  3UKU A;  4LC9 B;  1RT7 A;  1QS4 A;  4FJM A;  3H08 A;  3HM9 A;  3QIC A;  3LM9 A;  1TKD A;  1S9G A;  1L3V A;  1JLA A;  4R79 A;  4HHT A;  4OGE A;  4FJ8 A;  5HOO A;  2HMP A;  3TTC A;  1OVY A;  3KWG A;  1RBT A;  4DF4 A;  2E1Y A;  2G8V A;  5BRH A;  1IO2 A;  1P8Z A;  5HP1 A;  3SQ4 A;  4JI2 K;  5IWA K;  3IKM A;  1XQS C;  4QS9 A;  2BUP A;  3HTV A;  4W5R A;  1KVA A;  1QQO A;  4Z4E A;  4YFU A;  3QLH A;  3AGR A;  3B6O A;  2KKZ A;  1U48 A;  3CQX A;  1GOC A;  1NKB A;  3K5O A;  4DTU A;  3FR0 A;  1Z6R A;  3VA0 A;  1T44 A;  2W42 A;  2QWL A;  4C8L A; 
#chains in the Genus database with same CATH homology
 3J81 O;  4CW7 B;  4YHH K;  4LFA K;  5AJ3 K;  4K0K K;  4JI3 K;  4DV1 K;  1IBK K;  4DV0 K;  4GKK K;  4KHP K;  4V19 S;  4B3S K;  4JYA K;  1XNQ K;  4X65 K;  2VQF K;  3T1H K;  5LL6 Z;  4DR6 K;  3JAM O;  4GKJ K;  3OTO K;  1XMQ K;  3T1Y K;  2E5L K;  1N32 K;  4OX9 K;  4DUY K;  2HHH K;  4LF4 K;  4DR2 K;  2UXC K;  4LF9 K;  4DR4 K;  5LMN K;  4DR5 K;  5IT9 O;  5FLX O;  4LF8 K;  4NXN K;  4DV3 K;  4X64 K;  4DV6 K;  1N36 K;  4JI0 K;  1J5E K;  4JV5 K;  4NXM K;  4JI4 K;  4DR3 K;  4DR7 K;  4B3T K;  4DUZ K;  1IBL K;  5A2Q O;  2UUB K;  1N34 K;  4X66 K;  4LF6 K;  4DR1 K;  4X62 K;  2UXB K;  2UUA K;  1N33 K;  4LFC K;  4B3R K;  2UUC K;  4B3M K;  4DV2 K;  4DV7 K;  4YY3 K;  5LMU K;  3J7A P;  4CVN E;  4JI6 K;  4JI5 K;  2VQE K;  1HNX K;  1XNR K;  4DV5 K;  1HNZ K;  4JI2 K;  5IWA K;  4DV4 K;  4LF5 K;  4LF7 K;  2ZM6 K;  4JI7 K;  2F4V K;  1HNW K;  4LFB K;  3J80 O;  1I94 K;  1IBM K;  2UU9 K;  5BR8 K;  1XMO K;  2UXD K;  1HR0 K;  4AQY K;  1FJG K;  3J7Y P;  4JI8 K;  4JI1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...