1FJGK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1fjgK00
4DUZK 4DV0K 4GKJK 3J7YP 2UXBK 4NXNK 3J80O 4DR7K 4LF9K 4DV5K 4JI4K 1N34K 4KHPK 2UXCK 1IBLK 2HHHK 1J5EK 4V19S 1XMOK 4YY3K 2UUCK 5FLXO 4LF6K 5A2QO 4JI8K 4CVNE 4JI2K 1XMQK 5IWAK 4AQYK 4LF8K 2VQEK 4CW7B 4DV4K 3J81O 4DV3K 4OX9K 1HNXK 4JI6K 2F4VK 4JYAK 1IBMK 4DV2K 4LF5K 3T1YK 4K0KK 4LFAK 1N36K 4DUYK 5LMUK 4B3SK 2UUAK 4JI0K 4DR1K 1XNRK 5IT9O 3JAMO 5BR8K 1FJGK 4LF7K 4DR2K 2UU9K 4LF4K 2ZM6K 3T1HK 4X66K 1HNZK 1N32K 3OTOK 2VQFK 4DR3K 4DV1K 1IBKK 4B3TK 4GKKK 4X64K 4YHHK 4DR5K 4DR6K 4DR4K 3J7AP 1HNWK 4JI3K 4X62K 4DV7K 4NXMK 4JI5K 2UUBK 1HR0K 1XNQK 1I94K 4JI7K 4LFBK 4JV5K 5LL6Z 2E5LK 4B3MK 4DV6K 4LFCK 1N33K 5AJ3K 4B3RK 2UXDK 5LMNK 4X65K 4JI1K
chains in the Genus database with same CATH superfamily
4CZHA 4DTOA 1VK0A 3O3HA 3OW2M 1NGAA 3ZLJA 3SI6A 1QTMA 1KVCA 3ZCMA 4JK8A 3BP8A 1IV0A 3QFUA 3NVMA 2QKBA 1G99A 5HRSA 5KRTA 3O4QA 3ISNC 3ZEUA 2HHVA 3MX2A 3CJBA 1XMOK 2WC9A 4MO4A 3QESA 2YNHA 3OYLA 3U9DA 4BRGA 4FWSA 4KAZA 1S6QA 5K14A 4YOWA 3PX0A 1KXPA 1RBVA 4C8OA 2ZF5O 3P1GA 3I0SA 3DRPA 3L2QA 2RN2A 2G8HA 2F4VK 4BRAA 2HVIA 1X3NA 3OJUA 1HPZA 4DTMA 4H5VA 3EZWA 4DUYK 4JI0K 4CESA 4CEQA 5FPEA 5MLCQ 4H0XB 2F9TA 3D2EA 2P9UA 3CQXA 3P5JA 3VQ5A 3CQ8A 1EXQA 2HHWA 4CI6A 1NG9A 2HHQA 3VF6A 3KHYA 2IVOA 4ELUA 1HYVA 3L3UA 4BQLA 4MLHA 3OJSA 4CHNA 4QOZB 4AM7A 3BF1A 1LW2A 1BGXT 1SKSA 5GIOA 1NKCA 4JHDB 3KD1E 3FGUA 3OBWA 4FK0A 4Y1DA 2ETJA 4WCEL 4DSIA 1W9HA 2PYJA 3NGYA 2FSKA 3VA3A 4NXMK 3AVHA 1NK8A 4IO8A 3K58A 4DG1A 1TUUA 1T05A 3VESA 2XO7A 4ID5A 1WNSA 1C0TA 3VEVA 2RHKA 4KHQA 1BDGA 3HI0A 3U3GA 3W3DA 3CD6N 4LFCK 2CGKA 1CZAN 1DTTA 4Y1CA 1C1CA 3AVAA 3WQTA 3K59A 3VQPA 3OYAA 1UA0A 4A5AA 3RR8A 5JS1A 3SUOA 1JL1A 3NGZA 3MXIA 4E7JA 4DTXA 4WQ4C 3SQ0A 5M1NA 1SS6A 4EFHA 1W7AA 4JKCA 2P9LA 2YKNA 4WQ5A 4M7YA 4RWTA 3H1QA 1B92A 5HROA 4CZFA 1NOYA 4NCAA 4KREA 4CJEA 1C0GA 1T6CA 1YTAA 4DB3A 3AGKA 3A5NC 1R59O 4A62A 3M8RA 2HHXA 3TTFA 1D9DA 3OS2A 1WLJA 4OPAA 1NGBA 1RILA 4CJ7A 4B9TA 3RMBA 4FK4A 1BIUA 3C6HA 1OH5A 4PWDA 3WXKA 5AQGA 4FJLA 3L2RA 2XY7A 5BRDA 1DT9A 3TPQA 4A59A 1RT5A 3NF9A 4X66K 2P9PA 2B6AA 3WNEA 1EWRA 4BRIA 1LWEA 2GUIA 3DAWA 4CJWA 2HHSA 2VWBA 3MDQA 2D0AA 3U9ZA 1TL3A 3MN7A 1WN7A 3D2FB 1RDCA 4NCGA 3LWLA 3AGRA 1VRUA 4BC2A 1RTJA 4JNEA 2QWQA 1YAGA 2XHBA 4CF9A 2OTLN 3THYA 1TK0A 2E1YA 3JYTA 4FO0A 4BWMA 1JLCA 3RRHA 4PL7A 1W2BM 1U47A 4CJQA 4OPHA 3CQYA 4B3MK 1N6QA 3LWMA 3PV8A 2IS3A 4BG8A 1BQNA 2PZSA 4PUOA 1S6PA 2IGIA 3OYCA 2FSNA 2GBZA 2OCEA 3O9UA 5C2DA 3ZX2A 3DXKA 3LDSA 1RT2A 4OPJA 3J7YP 3ZT2A 1QSSA 1TKXA 3MECA 1BO5O 4FPBA 1IBLK 1VQMN 1BQMA 1NNEA 4PQUA 3AVJA 1IJJA 4CJFA 1E4GT 2VG5A 3CFOA 3MX5A 1X9SA 4FJ7A 2KFNA 1X9JA 4A61A 3TAMA 3VEOA 3ATUA 4R5PA 5GAEP 1RDDA 4EIAA 1SUQA 1KAYA 4C8MA 1NK4A 3KD5E 4JKGA 5AQOA 4Z4FA 5KTQA 5C0YA 4F3TA 2XRIA 4BGBA 3A5OC 3O1BA 4O8KA 4NCBA 4WFNL 3CJ9A 4QS9A 3VPZA 4IFVA 1WUAA 5AZIA 3BY5A 4AHCA 2RE2A 5BPNA 3G25A 3OTOK 2E2PA 2O8FB 1T44A 1UA1A 3AVIA 3PX4A 3VMFB 3THXB 1LWCA 2FBTA 3FLCO 4DTJA 3IS9A 3P31A 1BCMA 1RFQA 4M3WA 4FJKA 3B6OA 4O4GA 4X62K 4CE9A 4OLBA 4DV7K 2RPIA 4DQPA 4JD2B 4B9VA 4FYDA 4RTFD 4FJ8A 4FZZA 3V9SA 5I3UA 5FROA 1A5WA 2HHUA 4CEZA 3G71N 2P51A 2FF3B 4FJ5A 2HF3A 5AJ3K 4FOIA 4FW2A 2ITMA 3T3FA 2AA4A 1KAXA 2P9IA 3HP9A 4KTWA 3CJ7A 1JXEA 4K41A 4UQGA 1XWLA 3PX6A 5JLHA 1Q7YO 3Q7BA 1YF5L 4FJHA 2W6LA 1EETA 3ULEA 1Q81O 3MAQA 1HQEA 1L3UA 3SQ2A 4CF2A 4PA1A 4H4OA 4O44A 5JICA 4K8XA 4PKHA 1VSKA 2Y1JA 4I9QA 5FDLA 4FLTA 4EZ6A 4O8UA 5AQWA 4Z4GA 4KV8A 2A5XA 3F2KA 4KI4A 1JXBA 4IZ9A 3V9XA 2ZGYA 1C0UA 2GV9A 2WUSA 1U4BA 1JCFA 3KKRA 4W5QA 4FJGA 3L4IA 2AJQA 1F21A 5B8HA 3QFPA 2O4GA 3CERA 4WF9L 5CZ1A 4DTRA 3O3FA 3RTVA 3EE9A 3UKUA 1HMVA 3W0LA 3CC7N 2JWKA 2HSTA 3K9KA 3OYJA 4F2SA 3LANA 1FK9A 4LH4A 5BR8K 4DQSA 4FWRA 2ASMA 4DR2K 4DFKA 3ALYA 2VGNA 1X9WA 4GV6A 2WFBA 5T7BA 4J2AA 4FWMA 1VSEA 4K8ZA 4DV1K 2G8IA 1VSHA 4CECA 4E7KA 2GWKA 5KPTA 4KH5A 3TANA 5AZJA 3U8XA 4LY7A 3N4QA 4LH5A 2OA8A 3L0QA 3IG1A 3CIPA 1SKRA 2KLAA 3SK3A 3M3ZA 4BQZA 3JSMA 5BRFA 4HTUA 3RRGA 3CYMA 4BR7A 2Q3SA 3SQ4A 1YHQN 1NK5A 5AQZA 1IKVA 4M45A 4JKHA 3OA9A 2P9KB 3ENBA 4KPYA 1J53A 2VWJA 3DJCA 5AQNA 3VEZA 4KI6A 1ZBUA 1V4SA 4CJSA 1SL1A 1C1AA 5AQYA 1HNVA 3OYNA 5HBMA 3LDPA 3MK6A 3VQ9A 4NXNK 3LALA 2HMPA 1BI4A 4KHPK 5BREA 3V9ZA 3LDLA 4MDAA 3THYB 3UKRB 3S3MA 4JKBA 2RF2A 1HNIA 3CCLN 3QERA 3ID6A 2P5GA 3HYFA 3MN6A 4CGDA 1A5VA 4YOTA 4RW9A 3HTVA 4WE1A 1J9AA 2E2QA 5CZ2A 1TKTA 3TAPA 1WSEA 3TSQA 4G1QA 3HJFA 2QTDA 2GUPA 1MWMA 4BC3A 3T1HK 3WT0A 4DU3A 3D6RA 3HPGA 5EY4A 1RT7A 3IDHA 1YITN 3F5TA 5FPDA 3THWB 1VQ9N 3EKSA 4CIFA 1YVUA 1NWKA 3I0RA 2YCHA 4K42A 5KPRA 3CPEA 4CBWA 2E1ZA 2P9NA 3O9SA 3CCEN 4FJIA 2CH5A 3RSEA 3SQ1A 2CGJA 4JK7A 1O1WA 4B3OA 4RCHA 3DRSA 2V51B 1BU6O 2E2OA 4B1VA 1Q86O 3PSFA 3WEEB 5BR9A 4FZXC 1JLQA 2HBJA 2G8UA 4CZKA 1RT4A 4I6MB 2XY8A 3C65A 3K57A 1K73O 3BGRA 3Q7CA 4FM1A 4JS5A 4CEBA 3DLHA 4H0VB 4DKWA 4CF1A 4B3RK 4H0OA 4AHUA 4CZIA 3TI0A 1BHLA 3RR7A 2NUBA 5C15A 3H3OB 5AZIB 3ZSXA 4YOVA 3P4IA 1CXUA 2Q2RA 3VQ7A 1SL0A 4DSLA 2Q31A 4IEIA 1JLAA 2A41A 4GNIA 3CETA 1RDWX 3M1FA 1EWQA 5EU7A 1ASVA 1DGKN 4E7HA 2UXBK 3PO5A 4BR5A 3K5OA 4LF9K 1VQ8N 1YTUA 3OS1A 4B9NA 4V19S 3V9UA 3D45A 1Z26A 1NJYA 5JS2A 4J8FA 5A2QO 4JKDA 4H0PA 3T7ZA 1XMQK 4FM0A 1W0HA 1M90O 1KVAA 3NF7A 4DV4K 5JLFA 4BRNA 1NBWA 1U04A 5C25A 4L3QA 3C94A 1LCUA 2GWJA 4PKIA 3VTIA 2P9IB 3CXCM 1TAQA 4J2BA 4H03B 3DI6A 3MN5A 4MQ3A 3AVNA 1S9EA 4E7IA 3HO1A 4B9QA 1JL2A 2WBNA 2W40A 2IDOA 4DS4A 3ZT1A 3WXLA 3FFKB 3AO4A 4BVPA 4HUGA 4DU4A 3D0PA 3AA3A 3VQQA 4KTQA 4PY5A 1T3VA 2G8VA 5GADP 3NH0A 1JCGA 3C95A 3K9JA 3FZKA 3WNHA 4AF1A 3V1OA 3O1WA 3LL3A 2HHTA 3NMUA 4DR5K 2NLXA 3P39A 3M6GA 4ILHA 3GL1A 4CD3A 1QSLA 3LZIA 2QXLA 1X3MA 3C0BA 4OJRA 1LW0A 4GY2B 2A1RA 4CJPA 4J2DA 1N8RO 4DF8A 3QEVA 2O4IA 4LFBK 1BISA 1J6ZA 5J2MA 3QINA 5E84A 3VEXA 3HOSA 3QEIA 3CCRN 1SKWA 3ZSYA 4X65K 4IJAA 2NRTA 3B6PA 1L5UA 1VSLA 4DS5A 5CYMA 3UB5A 1DTQA 1TGOA 3SUPA 3DLEA 4CEAA 4IOCL 5E41A 1B9DA 2QWLA 3OYDA 4ID1A 1QQOA 1UOCA 2QWOA 3O08A 1ATNA 4FJNA 5DMRA 4NB4A 1WAFA 3C6AA 4OGEA 4FL9A 4I2QA 3O80A 1E4FT 4CVNE 3J8AA 1GLLO 3CM6A 3NVKA 1MU2A 3VETA 3S9HA 5IWAK 2YJEA 3HT3A 2HF4A 3I8BA 4GMJB 1QZ5A 3H46O 4ZTFA 3KKSA 4EHTA 4H5RA 4JI6K 4DF4A 4I7FA 2HNZA 1X9MA 2BGGA 4KHNA 3SUQA 1NK6A 3CCQN 4XIUA 2QKKA 1VQLN 5J2PA 2GTDA 3QIPA 3VTHA 1REVA 1QE1A 3KK3A 1VSFA 1ZBHA 2E2NA 3PO4A 4ZTJA 5FPNA 3G4SN 1BA1A 1XC3A 2O8CA 4M7XA 3LM2A 5AQRA 5BRHA 3AO2A 5BN8A 1L3SA 4B3TK 1IKYA 5DK5A 4CIGA 4CZJA 2EHGA 3EZ5A 4DFMA 3EYZA 2KQ2A 3O9TA 3DLBA 4FW1A 2A6AA 2OPPA 3M8SA 1RDAA 3IFRA 1T7PA 4E0DA 3EEQA 4B9MA 2QWNA 4ISGA 2YNIA 4OKKA 3ZSQA 2VG7A 4BDPA 3VOVA 1XI1A 4FLWA 2E6LA 1NMNA 4ZHRA 1JLEA 4CJ5A 3QEWA 1VRTA 1U2VA 1S1TA 3VENA 1WOQA 2W41A 3ID8A 3B8AX 4DLEA 1HRHA 4Z4IA 5FPMA 2O8EB 4BE2A 4CF8A 3SAFA 3F9KA 4O5FA 2ATQA 3E9OA 1ASWA 1NGEA 2P9NB 1NGIA 2X74A 3OYIA 4DHYA 4W5TA 2UXCK 4IG0A 1QZ6A 3VN5A 1VSJA 3V1QA 3O3GA 4EP4A 2E4LA 4BC4A 1C0FA 3S3NA 2VYPA 1GLDG 1CZ9A 4LF6K 3LDNA 3JS6A 4OVLA 3OYBA 2W42A 4FWQA 5GAGP 3HM9A 1JKHA 3CCJN 1VQ7N 5HRNA 1NJIO 3ENHA 1HNXK 2O8DA 4FWOA 3JXUA 4DV2K 3MXMA 1IBMK 4EAHD 3DYAA 4DU1A 2A1SA 1TV6A 1BWFO 1FKPA 1S1XA 3OYGA 3LZJA 4B3SK 2UUAK 3QB0A 2OTJN 5AQXA 2DFHA 1ZBIA 1BG3A 1LWFA 4KKOA 5GINA 4YDUA 3JAMO 3U3YA 3TAGA 3UIQA 1KVBA 1RTIA 4CEEA 5DM6L 3E1YA 3MCAB 1ZBSA 3HZ6A 4LF4K 5AFUH 3PLAA 3LDQA 1D9FA 4A57A 3ZETB 1NK9A 4CBUA 1ZYQA 4N5SA 1TYQA 4DTPA 4YFUA 4B1ZA 3BEXA 3P38A 4L8RB 3G0ZA 4JKEA 4IJNA 4FOEA 2BDPA 4ILGB 4DR6K 5M1OA 3HRGA 5KQDA 3J7AP 2QI2A 2O8BA 2JGUA 4A2AA 3NH2A 3BZCA 1T03A 3SPZA 5BPLA 4GVMA 1LAVA 1HR0K 1QQMA 2KHOA 3A5LC 4FJXA 3HSTB 3EKUA 3ZEUB 3VQEA 4N41A 3AO1A 5AQHA 4KH4A 2OPRA 4BGAA 3QMLA 4WYBA 2DY4A 2OPQA 2JLEA 2D0OA 3MWPA 1WSGA 1ZBFA 4CGFA 2KFZA 3R1XA 5C42A 4JAXA 3QIOA 5CR4A 4CK1A 3WUHA 1TKDA 4B1WB 1BOTO 3IMXA 4FPAA 4CHOA 4JI4K 4BC5A 2P9SA 2ZWHA 2P9UB 3D2EB 1KRPA 2PAVA 3THVA 1J5EK 1QHAA 2UUCK 4E3SA 3MEDA 4NYFA 2X6SA 1U48A 3RMAA 4CFAA 4CJVA 3FE1A 4DV3K 4FLYA 4QCLA 2X78A 3CI5A 4XH4A 1LAWA 2YHBA 4K0KK 4LFAK 3SV4A 1TKZA 1NGHA 1RT1A 5CY4A 1RCHA 1JLFA 4IOXA 2HVHA 1QVGM 3AVBA 2E6MA 3QBXA 4JKFA 1N32K 2YV0X 4KBOA 2ZJRL 4WQ5C 2F8SA 4CJ4A 4ELTA 4CEFA 2J4RA 2IIRA 1LOTB 3FZLA 4RW7A 3CC4N 1ATRA 3T1AA 3BDPA 3E01A 3DXMA 1KTQA 5HOOA 3K5LA 4CJUA 2Q0RA 4M3UA 2XY6A 3VGMA 4FJMA 1MA9B 2P9LB 2OYQA 4CZMA 4E1MA 2OZSA 2UYTA 2YNFA 4BE1A 3K5NA 4PHTX 3AO3A 3V9WA 1C1BA 4CHYA 4MFBA 4OKEA 1N33K 3KLGA 3AARA 2FXUA 3CMEN 1GLJO 4BRMA 4CJTA 4JHDA 3S41A 3ZSRA 4B1UB 1NKEA 2O8CB 1YVNA 4AH9A 3RMDA 3KIOA 1KCFA 1Y97A 1Q8IA 3CC2N 4GV9A 5C12A 3J80O 3VQ6A 4CBXA 2CGLA 1HQUA 1I39A 4DTUA 3V81A 2ZGZA 2HHHK 4O0JA 2WTUA 3WNFA 5FRNA 2Z1HA 4LD0A 2QEXN 4WFBL 4IOAL 1HYZA 4QS7A 5AQKA 3OYEA 4YORA 2P9PB 1QS4A 4BRPA 3RWUA 4UY8O 4JI2K 4H4MA 4BY9C 3KLEA 2IVNA 5AFUA 3VEWA 2HB5A 4R79A 4OX9K 1TUYA 3MWTA 1J54A 3E66A 1ESVA 5M1PA 3T1YK 4YOUA 2IAJA 3LM9A 1EP4A 5F0XA 4LSLA 1NKBA 5LMUK 1Z25A 3FFIA 3TSPA 4BRHA 3LP2A 4JEPA 2ASPA 4F3OA 3AVGA 3QDKA 2F9WA 2D0CA 4FWKA 1MDUB 2JWLA 3TARA 3SNNA 4PL8A 4IO9L 4O0IA 4DSFA 2PYLA 3MN9A 3SZ2A 3AVFA 2FBVA 4CK2A 1Q82O 2HW3A 4X64K 2R7YA 4BRLA 3KK1A 3QEPA 4WQ4A 3WXIA 1Q18A 5CYQA 5CHIA 3R6MA 2Q97A 3AAPA 3CJCA 2G8FA 3DXKB 5C2FA 1IH7A 3QNNA 5HP1A 1EX4A 1RNHA 1XHXA 3ZSVA 2HOEA 1NJXA 1DLOA 1S9GA 2Q0UA 4CHPA 5AR0A 4JLHA 3PY8A 4EZ9A 3OY9A 3SLCA 4KB0A 1L3TA 4BWJA 5F2RA 1YT3A 5LMNK 1KLNA 4FXDA 1BCOA 1QVFM 3D2FA 3V1RA 4M3ZA 2WONA 2BTFA 4ILJA 3NAEA 4AILC 3NFAA 4IG3A 2GEMA 1NU0A 1TYQB 4DSKA 4JKGB 1BL3A 3CCSN 3ZYYX 3SAGA 3L2WA 4DV5K 3GE1A 5M1QA 4U67L 1YI2N 4M3RA 5HLFA 5KQ8A 4IXCA 4CJLA 3CCUN 3A8YA 4RW4A 4B9UA 1JLBA 3EL2A 1KLMA 3KLIA 1VQ4N 1EQYA 5M1FA 1VQ6N 3R8EA 3SAHA 3SMSA 1GLBG 4HVJA 5SZTA 4FCYA 4LF8K 3EO3A 1H1VA 5J1EA 4DSEA 2NRWA 3GBTA 4FLUA 4F2RA 1NGJA 4TSXA 4B8AB 4LF5K 3H6EA 3F73A 3HK2A 2Z1IA 3AA5X 3SPYA 2PY5A 3A2FA 3KK2A 5E26A 3ZT0A 1IKWA 4Z4HA 3V4IA 4M3XA 3A5MC 2Y1IA 5GAHP 3WXJA 1S1UA 1QHTA 2P9SB 4DTNA 3LP1A 2YKMA 3AAQA 4CJRA 1NOZA 1S22A 3QO9A 2G8KA 4FWLA 4ELVA 3AO5A 3K0SA 5EX5A 2BH1A 4B9LA 1QQCA 3H3NO 1S1WA 4KFBA 5AQFA 3E9LA 4JS4A 3ULEB 3QICA 3OYFA 1YUWA 3KLHA 3IUCA 3CCMN 1RGIA 2G8WA 4HHTA 3AVLA 4KHWA 4H0YB 3ITHA 3KWIA 2NRHA 3OS0A 3O4NA 2O8FA 1KFSA 1RBSA 1VAZA 2EX3A 2DTUA 5D3GA 2GX9A 3AVKA 4BDYA 3THXA 3BZKA 4JRQA 2P1JA 3ASMA 2QWPA 3BUZB 3VQBA 4N76A 4AHRA 1B9FA 3O8MA 3FZHA 4JD2A 2HBLA 3UKUB 3TR8A 4CCHA 1YXQA 3T19A 2D4WA 2QWMA 3DXMB 5TKWA 4CEDA 2ZJQL 1P8ZA 3EY1A 4A2BA 1HKBA 4JK9A 4N47A 4DFPA 4FVUA 5BPMA 1TAUA 3ZT4A 4JI8K 4IEEA 1M1KO 5AQUA 1YJWN 2NRXA 1SQKA 4IFYA 4DCHA 2QWRA 4XH5A 2E8AA 3E9PA 3IRXA 3VQCA 2WOMA 2EWSA 5AQIA 5AZJB 4DQ8A 2PFUA 3M8PA 3GG4A 4CGJA 4FM2A 2AP1A 1OVQA 3DLLL 1JJ2M 4OO1J 1L3VA 1SV5A 3DWLA 3VEYA 4LSNA 2QK9A 5EXWA 4BREA 2IVPA 2UU9K 3C7NA 3HM8A 2B5JA 3VERA 2ZM6K 3DM2A 3AA2A 3L3VA 4WFAL 4BRFA 3K5MA 4XEIA 1S3XA 4DR3K 1WBBA 4CJKA 2NRVA 1IBKK 2DFFA 1GOBA 2OZMA 2E20A 1P90A 3H1VX 3SMPA 2V7YA 3PUFA 4OGCA 3MEGA 1ASUA 3UE5A 4CFCA 1HNWK 2Q1NA 3VQAA 4GVEA 3AVMA 4B08A 2OANA 4KRFA 1BI4B 4KO0A 1I94K 4JI7K 3KJVA 4G9ZA 4KB1A 2E5LK 3LPTA 2D0PA 3NBPA 1RTDA 1JLGA 1YJ9N 1HKCA 3WQUA 4CGGA 5F1XA 1T6DA 3KTQA 2UXDK 4E1JA 4BR0A 4DWIA 4YNQA 4J2EA 4E7LA 3HVRA 1FXXA 4HCBA 5ADXH 1NM1A 3HL8A 1KQSM 3G6EN 2FSJA 4ISEA 3LAKA 2D1KA 1VQKN 4KHSA 4BG9A 1V4TA 3AV9A 1K8KA 2YHXA 3NGIA 4BRQA 2HNDA 3DRRA 3ZSOA 1VHXA 1G15A 5LY3A 4BROA 3S3OA 2DPNA 1UAXA 4IBNA 4AHTA 2E88A 1IG9A 1HUXA 5H1SQ 1DEJA 4FK2A 3I8DA 3HP6A 4E89A 2YHYA 5EVZA 4Z4CA 3QLHA 4IKFA 4DQRA 4BACA 1NJWA 4H0TB 5C24A 4N56A 4M42A 2P9KA 4FWPA 2FBXA 3KVGA 2PBDA 4MO5A 2ZJPL 1VQPN 3RSEB 4CZEA 2FLOA 4U7BA 2ZD1A 1JCEA 3TAFA 3DLKA 2ZQBA 4BR4A 3O9QA 2D0BA 3IAYA 1XNRK 5IT9O 3WNGA 3RMCA 1WAJA 3UKRA 4Z94A 1VSIA 3HOTA 3ZSZA 5AQTA 4EP5A 1GLAG 1A5XA 1EO1A 1RBUA 3O4WA 3O9RA 3O6WA 4BR9A 3PSIA 3QEXA 3VQ8A 4DMNA 4EHUA 4GKKK 1XHZA 1IO2A 3MXJA 2BUPA 4KH6A 2QW9A 4CHQA 3CPWM 4B8CA 2VCPA 2BANA 3SJHA 3GDQA 4JI3K 4JKAA 4CERA 1U45A 1CXQA 3VF4A 4JI5K 3FZFA 4C1NI 4BE0A 3PIPL 1BIZA 3CM5A 2ASOA 4ISFA 1KD1O 4F9OA 3OHRA 1HPMA 5HRPA 1OH6A 5LL6Z 1GOCA 3C6TA 4M3TA 3L8BA 3CHWA 5AQPA 4Q5VA 3THWA 4B9SA 4CZLA 4FLZA 1Y64A 1U49A 1D8YA 2IOCA 5J2NA 1YJNN 3LAMA 2V52B 3TAQA 4Z4EA 1WSJA 5LJWA 2HNYA 3CMAN 1SAZA 1HJOA 3O5BA 4CFDA 3C6UA 3RVCA 3QETA 1I3AA 1RDUA 4DSJA 3M8QA 3ULDA 3OVNA 2HBKA 3KWGA 4GKJK 3F9MA 4FLXA 1ZBLA 1Z05A 4B1XB 3SJJA 4F8RA 4HUEA 2KTQA 3M5RA 2F7TA 3WEEA 2ITGA 1NLVA 4CGHA 4I6MA 3U4LA 2W6KA 1ITGA 5FLXO 1NGGA 3TTDA 2D5RA 4O5BA 5TKYA 1NMDA 1HYSA 1WSHA 1NJZA 4GV3A 5GIPA 3CFRA 3OYKA 1CLQA 4CF0A 5KGXA 4M63C 4Q0BA 4HUFA 3L2UA 1N36K 4KHUA 3HSCA 3AVCA 1ATSA 4NLBA 4CJ3A 4CZGA 1OKJA 3DMJA 2XY5A 4H5NA 4BR2A 5HRRA 3I55N 2RKIA 4RW6A 1RTHA 4CD1A 1FJGK 2DFEA 1BUPA 4BRDA 4FZYA 2VG6A 4CK3A 1K9MO 1HNZK 3FZMA 3OBYA 4H8KA 4RW8A 5DM7L 2VQFK 3MEEA 2GELA 4BRCA 5AQLA 1NGDA 1NK7A 3SV3A 5KRSA 2V7ZA 3NCIA 3I33A 3VQ4A 3TAEA 1C6VA 3OYHA 2A42A 1HLUA 3BF3A 1R0AA 1SZ2A 2YX6A 1KFDA 4M41A 3AA4A 4KTZA 1IG8A 3HBTA 2F8TA 1NGFA 4CGIA 1T8EA 2UUBK 1XNQK 1DKGD 5ADXA 4QS8A 2IC3A 3D7EO 1ZXOA 1U6ZA 3DLRA 4QAGA 4JV5K 1KC8O 3TWHA 2Z1GA 1TK5A 1HJRA 2F96A 3T69A 4DV6K 5I9EB 3P83D 3OYMA 3C7NB 3EE8A 2YJFA 4C8NA 2ZE2A 4JI1K 4DFJA 5KI6A 4B1YB 1K8AO 4C23A 4O55A 3WXMB 3HXMA 5AQMA 2NZTA 1VSDA 1IKXA 4HWIA 1OVYA 3NHGA 4DR7K 5BN9A 4FVMA 5CE3A 1ZC6A 1RT6A 1S72N 3R9PA 3SBGA 4HCCA 4YY3K 4YOYA 2YI1A 1EKEA 4OKJA 2CH6A 3A0IX 3SUNA 4W5RA 3K2PA 1WSIA 4Y0WA 4C1NK 5FRMA 1TVRA 4JN4A 3CJAA 4NLCA 4CW7B 5JVHL 3ENOA 2KW4A 4DLGA 4FJ9A 3SCXA 4KHYA 5KPZA 4JYAK 3DLGA 4MLEA 3QNOA 1BA0A 2I7NA 3HVTA 3ZT3A 1LV5A 1WSFA 2B4JA 2KKZA 1NK0A 4DQIA 3ZSWA 3VGKA 4Z0UA 4LC9B 4FWNA 1HX1A 4JRPA 1K8KB 3ZX0A 4A5BA 4OPKA 5J2QA 4IDHA 3J7ZO 5JVGL 3KLFA 3V6DA 4DQQA 3PIOL 3I56N 4IWVA 4MDBA 2QM1A 1VQNN 3N4PA 1MWKA 4ICLA 3AY9A 2KZMA 1GLEG 3H08A 2VGMA 1U2VB 4YHHK 1GLCG 1Q9YA 4YOXA 1S1VA 1ILYA 5LJVA 2YNGA 2VWKA 3LDOA 3TTCA 2Z1JA 3HPOA 1UWBA 1OH7A 3IKMA 2NRZA 4AHVA 4IFEA 2A3ZA 5C10A 1YIJN 1D4XA 3KK7A 3GOIA 1N5YA 4NO7A 4H5TA 1VQON 1CZBA 5I42A 4YDUC 3LPUA 1NGCA 2HBMA 5SWMA 2HMIA 1TL1A 1O13A 5EOYA 4FLVA 5AQVA 2I7PA 1K6YA 3DOLA 4XH1A 1TK8A 3L2VA 1RDBA 1QSYA 4K25A 3MMVA 1XQSC 4DUZK 4DV0K 2O8DB 3H45C 1HKGA 3CF5L 1FKOA 2I5JA 2BE2A 2H3GX 1RT3A 4FSVA 4HTLA 3LP3A 1WBDA 1N34K 1KSPA 2QA4N 2LSNA 4IDKA 5M1KA 3TSUA 3NE6A 4BRKA 3L6QA 4M3YA 4BDZA 3R3LA 3FR0A 4H5WA 3VA0A 4CHZA 3CJ1A 3U6FA 3VGLA 4AQYK 4FJJA 2X6NA 2YHWA 4I9LA 5AQSA 3TABA 3CFPA 3G10A 2VQEK 4C8LA 2NRRA 3J81O 1C0MA 4E19A 4CIEA 2OPSA 2O8EA 1E3MA 1SL2A 1Z6RA 2O8BB 2A40A 3VQDA 4OLAA 4DR1K 4W5NA 1FW6A 5ELZA 3L4QA 4CEOA 2QXFA 2P5OA 1KAZA 4LF7K 3CCVN 1OH8A 1J5OA 1RBRA 1D5AA 1WB9A 4C8KA 2FC0A 3SYZA 1QQNA 1W97L 5AQJA 5HL7L 4CFBA 1GLFO 3NH1A 2KZZA 1RBTA 3EN9A 4BVOA 5JMVA 4W5OA 3NDKA 1XC9A 4PKGA 3KZBA 4F4KA 4DR4K 1S5JA 3ATVA 3QBWA 3TU5A 1XUPO 4GW6A 4DTSA 4NYNA 4E1NA 3HPHA 1VQ5N 1VSMA 4I2PA 4AHSA 4RG8A 4AM6A 1Q9XA 5KGWA 3DOKA 3SBTA 5AQQA 3CG7A 4K43A 3ZETA 3VF2A 2YHAA 3NF6A 2FBYA 3MCPA 1GOAA 1X1PA 2Q36A 2FF6A 3LP0A 3ZX3A 3NF8A 2NNWA
chains in the Genus database with same CATH topology
4DUZK 4DV0K 4GKJK 3J7YP 2UXBK 4NXNK 3J80O 4DR7K 4LF9K 4DV5K 4JI4K 1N34K 4KHPK 2UXCK 1IBLK 2HHHK 1J5EK 4V19S 1XMOK 4YY3K 2UUCK 5FLXO 4LF6K 5A2QO 4JI8K 4CVNE 4JI2K 1XMQK 5IWAK 4AQYK 4LF8K 2VQEK 4CW7B 4DV4K 3J81O 4DV3K 4OX9K 1HNXK 4JI6K 2F4VK 4JYAK 1IBMK 4DV2K 4LF5K 3T1YK 4K0KK 4LFAK 1N36K 4DUYK 5LMUK 4B3SK 2UUAK 4JI0K 4DR1K 1XNRK 5IT9O 3JAMO 5BR8K 1FJGK 4LF7K 4DR2K 2UU9K 4LF4K 2ZM6K 3T1HK 4X66K 1HNZK 1N32K 3OTOK 2VQFK 4DR3K 4DV1K 1IBKK 4B3TK 4GKKK 4X64K 4YHHK 4DR5K 4DR6K 4DR4K 3J7AP 1HNWK 4JI3K 4X62K 4DV7K 4NXMK 4JI5K 2UUBK 1HR0K 1XNQK 1I94K 4JI7K 4LFBK 4JV5K 5LL6Z 2E5LK 4B3MK 4DV6K 4LFCK 1N33K 5AJ3K 4B3RK 2UXDK 5LMNK 4X65K 4JI1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ K;  4DV0 K;  4GKJ K;  3J7Y P;  2UXB K;  4NXN K;  3J80 O;  4DR7 K;  4LF9 K;  4DV5 K;  4JI4 K;  1N34 K;  4KHP K;  2UXC K;  1IBL K;  2HHH K;  1J5E K;  4V19 S;  1XMO K;  4YY3 K;  2UUC K;  5FLX O;  4LF6 K;  5A2Q O;  4JI8 K;  4CVN E;  4JI2 K;  1XMQ K;  5IWA K;  4AQY K;  4LF8 K;  2VQE K;  4CW7 B;  4DV4 K;  3J81 O;  4DV3 K;  4OX9 K;  1HNX K;  4JI6 K;  2F4V K;  4JYA K;  1IBM K;  4DV2 K;  4LF5 K;  3T1Y K;  4K0K K;  4LFA K;  1N36 K;  4DUY K;  5LMU K;  4B3S K;  2UUA K;  4JI0 K;  4DR1 K;  1XNR K;  5IT9 O;  3JAM O;  5BR8 K;  1FJG K;  4LF7 K;  4DR2 K;  2UU9 K;  4LF4 K;  2ZM6 K;  3T1H K;  4X66 K;  1HNZ K;  1N32 K;  3OTO K;  2VQF K;  4DR3 K;  4DV1 K;  1IBK K;  4B3T K;  4GKK K;  4X64 K;  4YHH K;  4DR5 K;  4DR6 K;  4DR4 K;  3J7A P;  1HNW K;  4JI3 K;  4X62 K;  4DV7 K;  4NXM K;  4JI5 K;  2UUB K;  1HR0 K;  1XNQ K;  1I94 K;  4JI7 K;  4LFB K;  4JV5 K;  5LL6 Z;  2E5L K;  4B3M K;  4DV6 K;  4LFC K;  1N33 K;  5AJ3 K;  4B3R K;  2UXD K;  5LMN K;  4X65 K;  4JI1 K; 
#chains in the Genus database with same CATH topology
 4CZH A;  4DTO A;  1VK0 A;  3O3H A;  3OW2 M;  1NGA A;  3ZLJ A;  3SI6 A;  1QTM A;  1KVC A;  3ZCM A;  4JK8 A;  3BP8 A;  1IV0 A;  3QFU A;  3NVM A;  2QKB A;  1G99 A;  5HRS A;  5KRT A;  3O4Q A;  3ISN C;  3ZEU A;  2HHV A;  3MX2 A;  3CJB A;  1XMO K;  2WC9 A;  4MO4 A;  3QES A;  2YNH A;  3OYL A;  3U9D A;  4BRG A;  4FWS A;  4KAZ A;  1S6Q A;  5K14 A;  4YOW A;  3PX0 A;  1KXP A;  1RBV A;  4C8O A;  2ZF5 O;  3P1G A;  3I0S A;  3DRP A;  3L2Q A;  2RN2 A;  2G8H A;  2F4V K;  4BRA A;  2HVI A;  1X3N A;  3OJU A;  1HPZ A;  4DTM A;  4H5V A;  3EZW A;  4DUY K;  4JI0 K;  4CES A;  4CEQ A;  5FPE A;  5MLC Q;  4H0X B;  2F9T A;  3D2E A;  2P9U A;  3CQX A;  3P5J A;  3VQ5 A;  3CQ8 A;  1EXQ A;  2HHW A;  4CI6 A;  1NG9 A;  2HHQ A;  3VF6 A;  3KHY A;  2IVO A;  4ELU A;  1HYV A;  3L3U A;  4BQL A;  4MLH A;  3OJS A;  4CHN A;  4QOZ B;  4AM7 A;  3BF1 A;  1LW2 A;  1BGX T;  1SKS A;  5GIO A;  1NKC A;  4JHD B;  3KD1 E;  3FGU A;  3OBW A;  4FK0 A;  4Y1D A;  2ETJ A;  4WCE L;  4DSI A;  1W9H A;  2PYJ A;  3NGY A;  2FSK A;  3VA3 A;  4NXM K;  3AVH A;  1NK8 A;  4IO8 A;  3K58 A;  4DG1 A;  1TUU A;  1T05 A;  3VES A;  2XO7 A;  4ID5 A;  1WNS A;  1C0T A;  3VEV A;  2RHK A;  4KHQ A;  1BDG A;  3HI0 A;  3U3G A;  3W3D A;  3CD6 N;  4LFC K;  2CGK A;  1CZA N;  1DTT A;  4Y1C A;  1C1C A;  3AVA A;  3WQT A;  3K59 A;  3VQP A;  3OYA A;  1UA0 A;  4A5A A;  3RR8 A;  5JS1 A;  3SUO A;  1JL1 A;  3NGZ A;  3MXI A;  4E7J A;  4DTX A;  4WQ4 C;  3SQ0 A;  5M1N A;  1SS6 A;  4EFH A;  1W7A A;  4JKC A;  2P9L A;  2YKN A;  4WQ5 A;  4M7Y A;  4RWT A;  3H1Q A;  1B92 A;  5HRO A;  4CZF A;  1NOY A;  4NCA A;  4KRE A;  4CJE A;  1C0G A;  1T6C A;  1YTA A;  4DB3 A;  3AGK A;  3A5N C;  1R59 O;  4A62 A;  3M8R A;  2HHX A;  3TTF A;  1D9D A;  3OS2 A;  1WLJ A;  4OPA A;  1NGB A;  1RIL A;  4CJ7 A;  4B9T A;  3RMB A;  4FK4 A;  1BIU A;  3C6H A;  1OH5 A;  4PWD A;  3WXK A;  5AQG A;  4FJL A;  3L2R A;  2XY7 A;  5BRD A;  1DT9 A;  3TPQ A;  4A59 A;  1RT5 A;  3NF9 A;  4X66 K;  2P9P A;  2B6A A;  3WNE A;  1EWR A;  4BRI A;  1LWE A;  2GUI A;  3DAW A;  4CJW A;  2HHS A;  2VWB A;  3MDQ A;  2D0A A;  3U9Z A;  1TL3 A;  3MN7 A;  1WN7 A;  3D2F B;  1RDC A;  4NCG A;  3LWL A;  3AGR A;  1VRU A;  4BC2 A;  1RTJ A;  4JNE A;  2QWQ A;  1YAG A;  2XHB A;  4CF9 A;  2OTL N;  3THY A;  1TK0 A;  2E1Y A;  3JYT A;  4FO0 A;  4BWM A;  1JLC A;  3RRH A;  4PL7 A;  1W2B M;  1U47 A;  4CJQ A;  4OPH A;  3CQY A;  4B3M K;  1N6Q A;  3LWM A;  3PV8 A;  2IS3 A;  4BG8 A;  1BQN A;  2PZS A;  4PUO A;  1S6P A;  2IGI A;  3OYC A;  2FSN A;  2GBZ A;  2OCE A;  3O9U A;  5C2D A;  3ZX2 A;  3DXK A;  3LDS A;  1RT2 A;  4OPJ A;  3J7Y P;  3ZT2 A;  1QSS A;  1TKX A;  3MEC A;  1BO5 O;  4FPB A;  1IBL K;  1VQM N;  1BQM A;  1NNE A;  4PQU A;  3AVJ A;  1IJJ A;  4CJF A;  1E4G T;  2VG5 A;  3CFO A;  3MX5 A;  1X9S A;  4FJ7 A;  2KFN A;  1X9J A;  4A61 A;  3TAM A;  3VEO A;  3ATU A;  4R5P A;  5GAE P;  1RDD A;  4EIA A;  1SUQ A;  1KAY A;  4C8M A;  1NK4 A;  3KD5 E;  4JKG A;  5AQO A;  4Z4F A;  5KTQ A;  5C0Y A;  4F3T A;  2XRI A;  4BGB A;  3A5O C;  3O1B A;  4O8K A;  4NCB A;  4WFN L;  3CJ9 A;  4QS9 A;  3VPZ A;  4IFV A;  1WUA A;  5AZI A;  3BY5 A;  4AHC A;  2RE2 A;  5BPN A;  3G25 A;  3OTO K;  2E2P A;  2O8F B;  1T44 A;  1UA1 A;  3AVI A;  3PX4 A;  3VMF B;  3THX B;  1LWC A;  2FBT A;  3FLC O;  4DTJ A;  3IS9 A;  3P31 A;  1BCM A;  1RFQ A;  4M3W A;  4FJK A;  3B6O A;  4O4G A;  4X62 K;  4CE9 A;  4OLB A;  4DV7 K;  2RPI A;  4DQP A;  4JD2 B;  4B9V A;  4FYD A;  4RTF D;  4FJ8 A;  4FZZ A;  3V9S A;  5I3U A;  5FRO A;  1A5W A;  2HHU A;  4CEZ A;  3G71 N;  2P51 A;  2FF3 B;  4FJ5 A;  2HF3 A;  5AJ3 K;  4FOI A;  4FW2 A;  2ITM A;  3T3F A;  2AA4 A;  1KAX A;  2P9I A;  3HP9 A;  4KTW A;  3CJ7 A;  1JXE A;  4K41 A;  4UQG A;  1XWL A;  3PX6 A;  5JLH A;  1Q7Y O;  3Q7B A;  1YF5 L;  4FJH A;  2W6L A;  1EET A;  3ULE A;  1Q81 O;  3MAQ A;  1HQE A;  1L3U A;  3SQ2 A;  4CF2 A;  4PA1 A;  4H4O A;  4O44 A;  5JIC A;  4K8X A;  4PKH A;  1VSK A;  2Y1J A;  4I9Q A;  5FDL A;  4FLT A;  4EZ6 A;  4O8U A;  5AQW A;  4Z4G A;  4KV8 A;  2A5X A;  3F2K A;  4KI4 A;  1JXB A;  4IZ9 A;  3V9X A;  2ZGY A;  1C0U A;  2GV9 A;  2WUS A;  1U4B A;  1JCF A;  3KKR A;  4W5Q A;  4FJG A;  3L4I A;  2AJQ A;  1F21 A;  5B8H A;  3QFP A;  2O4G A;  3CER A;  4WF9 L;  5CZ1 A;  4DTR A;  3O3F A;  3RTV A;  3EE9 A;  3UKU A;  1HMV A;  3W0L A;  3CC7 N;  2JWK A;  2HST A;  3K9K A;  3OYJ A;  4F2S A;  3LAN A;  1FK9 A;  4LH4 A;  5BR8 K;  4DQS A;  4FWR A;  2ASM A;  4DR2 K;  4DFK A;  3ALY A;  2VGN A;  1X9W A;  4GV6 A;  2WFB A;  5T7B A;  4J2A A;  4FWM A;  1VSE A;  4K8Z A;  4DV1 K;  2G8I A;  1VSH A;  4CEC A;  4E7K A;  2GWK A;  5KPT A;  4KH5 A;  3TAN A;  5AZJ A;  3U8X A;  4LY7 A;  3N4Q A;  4LH5 A;  2OA8 A;  3L0Q A;  3IG1 A;  3CIP A;  1SKR A;  2KLA A;  3SK3 A;  3M3Z A;  4BQZ A;  3JSM A;  5BRF A;  4HTU A;  3RRG A;  3CYM A;  4BR7 A;  2Q3S A;  3SQ4 A;  1YHQ N;  1NK5 A;  5AQZ A;  1IKV A;  4M45 A;  4JKH A;  3OA9 A;  2P9K B;  3ENB A;  4KPY A;  1J53 A;  2VWJ A;  3DJC A;  5AQN A;  3VEZ A;  4KI6 A;  1ZBU A;  1V4S A;  4CJS A;  1SL1 A;  1C1A A;  5AQY A;  1HNV A;  3OYN A;  5HBM A;  3LDP A;  3MK6 A;  3VQ9 A;  4NXN K;  3LAL A;  2HMP A;  1BI4 A;  4KHP K;  5BRE A;  3V9Z A;  3LDL A;  4MDA A;  3THY B;  3UKR B;  3S3M A;  4JKB A;  2RF2 A;  1HNI A;  3CCL N;  3QER A;  3ID6 A;  2P5G A;  3HYF A;  3MN6 A;  4CGD A;  1A5V A;  4YOT A;  4RW9 A;  3HTV A;  4WE1 A;  1J9A A;  2E2Q A;  5CZ2 A;  1TKT A;  3TAP A;  1WSE A;  3TSQ A;  4G1Q A;  3HJF A;  2QTD A;  2GUP A;  1MWM A;  4BC3 A;  3T1H K;  3WT0 A;  4DU3 A;  3D6R A;  3HPG A;  5EY4 A;  1RT7 A;  3IDH A;  1YIT N;  3F5T A;  5FPD A;  3THW B;  1VQ9 N;  3EKS A;  4CIF A;  1YVU A;  1NWK A;  3I0R A;  2YCH A;  4K42 A;  5KPR A;  3CPE A;  4CBW A;  2E1Z A;  2P9N A;  3O9S A;  3CCE N;  4FJI A;  2CH5 A;  3RSE A;  3SQ1 A;  2CGJ A;  4JK7 A;  1O1W A;  4B3O A;  4RCH A;  3DRS A;  2V51 B;  1BU6 O;  2E2O A;  4B1V A;  1Q86 O;  3PSF A;  3WEE B;  5BR9 A;  4FZX C;  1JLQ A;  2HBJ A;  2G8U A;  4CZK A;  1RT4 A;  4I6M B;  2XY8 A;  3C65 A;  3K57 A;  1K73 O;  3BGR A;  3Q7C A;  4FM1 A;  4JS5 A;  4CEB A;  3DLH A;  4H0V B;  4DKW A;  4CF1 A;  4B3R K;  4H0O A;  4AHU A;  4CZI A;  3TI0 A;  1BHL A;  3RR7 A;  2NUB A;  5C15 A;  3H3O B;  5AZI B;  3ZSX A;  4YOV A;  3P4I A;  1CXU A;  2Q2R A;  3VQ7 A;  1SL0 A;  4DSL A;  2Q31 A;  4IEI A;  1JLA A;  2A41 A;  4GNI A;  3CET A;  1RDW X;  3M1F A;  1EWQ A;  5EU7 A;  1ASV A;  1DGK N;  4E7H A;  2UXB K;  3PO5 A;  4BR5 A;  3K5O A;  4LF9 K;  1VQ8 N;  1YTU A;  3OS1 A;  4B9N A;  4V19 S;  3V9U A;  3D45 A;  1Z26 A;  1NJY A;  5JS2 A;  4J8F A;  5A2Q O;  4JKD A;  4H0P A;  3T7Z A;  1XMQ K;  4FM0 A;  1W0H A;  1M90 O;  1KVA A;  3NF7 A;  4DV4 K;  5JLF A;  4BRN A;  1NBW A;  1U04 A;  5C25 A;  4L3Q A;  3C94 A;  1LCU A;  2GWJ A;  4PKI A;  3VTI A;  2P9I B;  3CXC M;  1TAQ A;  4J2B A;  4H03 B;  3DI6 A;  3MN5 A;  4MQ3 A;  3AVN A;  1S9E A;  4E7I A;  3HO1 A;  4B9Q A;  1JL2 A;  2WBN A;  2W40 A;  2IDO A;  4DS4 A;  3ZT1 A;  3WXL A;  3FFK B;  3AO4 A;  4BVP A;  4HUG A;  4DU4 A;  3D0P A;  3AA3 A;  3VQQ A;  4KTQ A;  4PY5 A;  1T3V A;  2G8V A;  5GAD P;  3NH0 A;  1JCG A;  3C95 A;  3K9J A;  3FZK A;  3WNH A;  4AF1 A;  3V1O A;  3O1W A;  3LL3 A;  2HHT A;  3NMU A;  4DR5 K;  2NLX A;  3P39 A;  3M6G A;  4ILH A;  3GL1 A;  4CD3 A;  1QSL A;  3LZI A;  2QXL A;  1X3M A;  3C0B A;  4OJR A;  1LW0 A;  4GY2 B;  2A1R A;  4CJP A;  4J2D A;  1N8R O;  4DF8 A;  3QEV A;  2O4I A;  4LFB K;  1BIS A;  1J6Z A;  5J2M A;  3QIN A;  5E84 A;  3VEX A;  3HOS A;  3QEI A;  3CCR N;  1SKW A;  3ZSY A;  4X65 K;  4IJA A;  2NRT A;  3B6P A;  1L5U A;  1VSL A;  4DS5 A;  5CYM A;  3UB5 A;  1DTQ A;  1TGO A;  3SUP A;  3DLE A;  4CEA A;  4IOC L;  5E41 A;  1B9D A;  2QWL A;  3OYD A;  4ID1 A;  1QQO A;  1UOC A;  2QWO A;  3O08 A;  1ATN A;  4FJN A;  5DMR A;  4NB4 A;  1WAF A;  3C6A A;  4OGE A;  4FL9 A;  4I2Q A;  3O80 A;  1E4F T;  4CVN E;  3J8A A;  1GLL O;  3CM6 A;  3NVK A;  1MU2 A;  3VET A;  3S9H A;  5IWA K;  2YJE A;  3HT3 A;  2HF4 A;  3I8B A;  4GMJ B;  1QZ5 A;  3H46 O;  4ZTF A;  3KKS A;  4EHT A;  4H5R A;  4JI6 K;  4DF4 A;  4I7F A;  2HNZ A;  1X9M A;  2BGG A;  4KHN A;  3SUQ A;  1NK6 A;  3CCQ N;  4XIU A;  2QKK A;  1VQL N;  5J2P A;  2GTD A;  3QIP A;  3VTH A;  1REV A;  1QE1 A;  3KK3 A;  1VSF A;  1ZBH A;  2E2N A;  3PO4 A;  4ZTJ A;  5FPN A;  3G4S N;  1BA1 A;  1XC3 A;  2O8C A;  4M7X A;  3LM2 A;  5AQR A;  5BRH A;  3AO2 A;  5BN8 A;  1L3S A;  4B3T K;  1IKY A;  5DK5 A;  4CIG A;  4CZJ A;  2EHG A;  3EZ5 A;  4DFM A;  3EYZ A;  2KQ2 A;  3O9T A;  3DLB A;  4FW1 A;  2A6A A;  2OPP A;  3M8S A;  1RDA A;  3IFR A;  1T7P A;  4E0D A;  3EEQ A;  4B9M A;  2QWN A;  4ISG A;  2YNI A;  4OKK A;  3ZSQ A;  2VG7 A;  4BDP A;  3VOV A;  1XI1 A;  4FLW A;  2E6L A;  1NMN A;  4ZHR A;  1JLE A;  4CJ5 A;  3QEW A;  1VRT A;  1U2V A;  1S1T A;  3VEN A;  1WOQ A;  2W41 A;  3ID8 A;  3B8A X;  4DLE A;  1HRH A;  4Z4I A;  5FPM A;  2O8E B;  4BE2 A;  4CF8 A;  3SAF A;  3F9K A;  4O5F A;  2ATQ A;  3E9O A;  1ASW A;  1NGE A;  2P9N B;  1NGI A;  2X74 A;  3OYI A;  4DHY A;  4W5T A;  2UXC K;  4IG0 A;  1QZ6 A;  3VN5 A;  1VSJ A;  3V1Q A;  3O3G A;  4EP4 A;  2E4L A;  4BC4 A;  1C0F A;  3S3N A;  2VYP A;  1GLD G;  1CZ9 A;  4LF6 K;  3LDN A;  3JS6 A;  4OVL A;  3OYB A;  2W42 A;  4FWQ A;  5GAG P;  3HM9 A;  1JKH A;  3CCJ N;  1VQ7 N;  5HRN A;  1NJI O;  3ENH A;  1HNX K;  2O8D A;  4FWO A;  3JXU A;  4DV2 K;  3MXM A;  1IBM K;  4EAH D;  3DYA A;  4DU1 A;  2A1S A;  1TV6 A;  1BWF O;  1FKP A;  1S1X A;  3OYG A;  3LZJ A;  4B3S K;  2UUA K;  3QB0 A;  2OTJ N;  5AQX A;  2DFH A;  1ZBI A;  1BG3 A;  1LWF A;  4KKO A;  5GIN A;  4YDU A;  3JAM O;  3U3Y A;  3TAG A;  3UIQ A;  1KVB A;  1RTI A;  4CEE A;  5DM6 L;  3E1Y A;  3MCA B;  1ZBS A;  3HZ6 A;  4LF4 K;  5AFU H;  3PLA A;  3LDQ A;  1D9F A;  4A57 A;  3ZET B;  1NK9 A;  4CBU A;  1ZYQ A;  4N5S A;  1TYQ A;  4DTP A;  4YFU A;  4B1Z A;  3BEX A;  3P38 A;  4L8R B;  3G0Z A;  4JKE A;  4IJN A;  4FOE A;  2BDP A;  4ILG B;  4DR6 K;  5M1O A;  3HRG A;  5KQD A;  3J7A P;  2QI2 A;  2O8B A;  2JGU A;  4A2A A;  3NH2 A;  3BZC A;  1T03 A;  3SPZ A;  5BPL A;  4GVM A;  1LAV A;  1HR0 K;  1QQM A;  2KHO A;  3A5L C;  4FJX A;  3HST B;  3EKU A;  3ZEU B;  3VQE A;  4N41 A;  3AO1 A;  5AQH A;  4KH4 A;  2OPR A;  4BGA A;  3QML A;  4WYB A;  2DY4 A;  2OPQ A;  2JLE A;  2D0O A;  3MWP A;  1WSG A;  1ZBF A;  4CGF A;  2KFZ A;  3R1X A;  5C42 A;  4JAX A;  3QIO A;  5CR4 A;  4CK1 A;  3WUH A;  1TKD A;  4B1W B;  1BOT O;  3IMX A;  4FPA A;  4CHO A;  4JI4 K;  4BC5 A;  2P9S A;  2ZWH A;  2P9U B;  3D2E B;  1KRP A;  2PAV A;  3THV A;  1J5E K;  1QHA A;  2UUC K;  4E3S A;  3MED A;  4NYF A;  2X6S A;  1U48 A;  3RMA A;  4CFA A;  4CJV A;  3FE1 A;  4DV3 K;  4FLY A;  4QCL A;  2X78 A;  3CI5 A;  4XH4 A;  1LAW A;  2YHB A;  4K0K K;  4LFA K;  3SV4 A;  1TKZ A;  1NGH A;  1RT1 A;  5CY4 A;  1RCH A;  1JLF A;  4IOX A;  2HVH A;  1QVG M;  3AVB A;  2E6M A;  3QBX A;  4JKF A;  1N32 K;  2YV0 X;  4KBO A;  2ZJR L;  4WQ5 C;  2F8S A;  4CJ4 A;  4ELT A;  4CEF A;  2J4R A;  2IIR A;  1LOT B;  3FZL A;  4RW7 A;  3CC4 N;  1ATR A;  3T1A A;  3BDP A;  3E01 A;  3DXM A;  1KTQ A;  5HOO A;  3K5L A;  4CJU A;  2Q0R A;  4M3U A;  2XY6 A;  3VGM A;  4FJM A;  1MA9 B;  2P9L B;  2OYQ A;  4CZM A;  4E1M A;  2OZS A;  2UYT A;  2YNF A;  4BE1 A;  3K5N A;  4PHT X;  3AO3 A;  3V9W A;  1C1B A;  4CHY A;  4MFB A;  4OKE A;  1N33 K;  3KLG A;  3AAR A;  2FXU A;  3CME N;  1GLJ O;  4BRM A;  4CJT A;  4JHD A;  3S41 A;  3ZSR A;  4B1U B;  1NKE A;  2O8C B;  1YVN A;  4AH9 A;  3RMD A;  3KIO A;  1KCF A;  1Y97 A;  1Q8I A;  3CC2 N;  4GV9 A;  5C12 A;  3J80 O;  3VQ6 A;  4CBX A;  2CGL A;  1HQU A;  1I39 A;  4DTU A;  3V81 A;  2ZGZ A;  2HHH K;  4O0J A;  2WTU A;  3WNF A;  5FRN A;  2Z1H A;  4LD0 A;  2QEX N;  4WFB L;  4IOA L;  1HYZ A;  4QS7 A;  5AQK A;  3OYE A;  4YOR A;  2P9P B;  1QS4 A;  4BRP A;  3RWU A;  4UY8 O;  4JI2 K;  4H4M A;  4BY9 C;  3KLE A;  2IVN A;  5AFU A;  3VEW A;  2HB5 A;  4R79 A;  4OX9 K;  1TUY A;  3MWT A;  1J54 A;  3E66 A;  1ESV A;  5M1P A;  3T1Y K;  4YOU A;  2IAJ A;  3LM9 A;  1EP4 A;  5F0X A;  4LSL A;  1NKB A;  5LMU K;  1Z25 A;  3FFI A;  3TSP A;  4BRH A;  3LP2 A;  4JEP A;  2ASP A;  4F3O A;  3AVG A;  3QDK A;  2F9W A;  2D0C A;  4FWK A;  1MDU B;  2JWL A;  3TAR A;  3SNN A;  4PL8 A;  4IO9 L;  4O0I A;  4DSF A;  2PYL A;  3MN9 A;  3SZ2 A;  3AVF A;  2FBV A;  4CK2 A;  1Q82 O;  2HW3 A;  4X64 K;  2R7Y A;  4BRL A;  3KK1 A;  3QEP A;  4WQ4 A;  3WXI A;  1Q18 A;  5CYQ A;  5CHI A;  3R6M A;  2Q97 A;  3AAP A;  3CJC A;  2G8F A;  3DXK B;  5C2F A;  1IH7 A;  3QNN A;  5HP1 A;  1EX4 A;  1RNH A;  1XHX A;  3ZSV A;  2HOE A;  1NJX A;  1DLO A;  1S9G A;  2Q0U A;  4CHP A;  5AR0 A;  4JLH A;  3PY8 A;  4EZ9 A;  3OY9 A;  3SLC A;  4KB0 A;  1L3T A;  4BWJ A;  5F2R A;  1YT3 A;  5LMN K;  1KLN A;  4FXD A;  1BCO A;  1QVF M;  3D2F A;  3V1R A;  4M3Z A;  2WON A;  2BTF A;  4ILJ A;  3NAE A;  4AIL C;  3NFA A;  4IG3 A;  2GEM A;  1NU0 A;  1TYQ B;  4DSK A;  4JKG B;  1BL3 A;  3CCS N;  3ZYY X;  3SAG A;  3L2W A;  4DV5 K;  3GE1 A;  5M1Q A;  4U67 L;  1YI2 N;  4M3R A;  5HLF A;  5KQ8 A;  4IXC A;  4CJL A;  3CCU N;  3A8Y A;  4RW4 A;  4B9U A;  1JLB A;  3EL2 A;  1KLM A;  3KLI A;  1VQ4 N;  1EQY A;  5M1F A;  1VQ6 N;  3R8E A;  3SAH A;  3SMS A;  1GLB G;  4HVJ A;  5SZT A;  4FCY A;  4LF8 K;  3EO3 A;  1H1V A;  5J1E A;  4DSE A;  2NRW A;  3GBT A;  4FLU A;  4F2R A;  1NGJ A;  4TSX A;  4B8A B;  4LF5 K;  3H6E A;  3F73 A;  3HK2 A;  2Z1I A;  3AA5 X;  3SPY A;  2PY5 A;  3A2F A;  3KK2 A;  5E26 A;  3ZT0 A;  1IKW A;  4Z4H A;  3V4I A;  4M3X A;  3A5M C;  2Y1I A;  5GAH P;  3WXJ A;  1S1U A;  1QHT A;  2P9S B;  4DTN A;  3LP1 A;  2YKM A;  3AAQ A;  4CJR A;  1NOZ A;  1S22 A;  3QO9 A;  2G8K A;  4FWL A;  4ELV A;  3AO5 A;  3K0S A;  5EX5 A;  2BH1 A;  4B9L A;  1QQC A;  3H3N O;  1S1W A;  4KFB A;  5AQF A;  3E9L A;  4JS4 A;  3ULE B;  3QIC A;  3OYF A;  1YUW A;  3KLH A;  3IUC A;  3CCM N;  1RGI A;  2G8W A;  4HHT A;  3AVL A;  4KHW A;  4H0Y B;  3ITH A;  3KWI A;  2NRH A;  3OS0 A;  3O4N A;  2O8F A;  1KFS A;  1RBS A;  1VAZ A;  2EX3 A;  2DTU A;  5D3G A;  2GX9 A;  3AVK A;  4BDY A;  3THX A;  3BZK A;  4JRQ A;  2P1J A;  3ASM A;  2QWP A;  3BUZ B;  3VQB A;  4N76 A;  4AHR A;  1B9F A;  3O8M A;  3FZH A;  4JD2 A;  2HBL A;  3UKU B;  3TR8 A;  4CCH A;  1YXQ A;  3T19 A;  2D4W A;  2QWM A;  3DXM B;  5TKW A;  4CED A;  2ZJQ L;  1P8Z A;  3EY1 A;  4A2B A;  1HKB A;  4JK9 A;  4N47 A;  4DFP A;  4FVU A;  5BPM A;  1TAU A;  3ZT4 A;  4JI8 K;  4IEE A;  1M1K O;  5AQU A;  1YJW N;  2NRX A;  1SQK A;  4IFY A;  4DCH A;  2QWR A;  4XH5 A;  2E8A A;  3E9P A;  3IRX A;  3VQC A;  2WOM A;  2EWS A;  5AQI A;  5AZJ B;  4DQ8 A;  2PFU A;  3M8P A;  3GG4 A;  4CGJ A;  4FM2 A;  2AP1 A;  1OVQ A;  3DLL L;  1JJ2 M;  4OO1 J;  1L3V A;  1SV5 A;  3DWL A;  3VEY A;  4LSN A;  2QK9 A;  5EXW A;  4BRE A;  2IVP A;  2UU9 K;  3C7N A;  3HM8 A;  2B5J A;  3VER A;  2ZM6 K;  3DM2 A;  3AA2 A;  3L3V A;  4WFA L;  4BRF A;  3K5M A;  4XEI A;  1S3X A;  4DR3 K;  1WBB A;  4CJK A;  2NRV A;  1IBK K;  2DFF A;  1GOB A;  2OZM A;  2E20 A;  1P90 A;  3H1V X;  3SMP A;  2V7Y A;  3PUF A;  4OGC A;  3MEG A;  1ASU A;  3UE5 A;  4CFC A;  1HNW K;  2Q1N A;  3VQA A;  4GVE A;  3AVM A;  4B08 A;  2OAN A;  4KRF A;  1BI4 B;  4KO0 A;  1I94 K;  4JI7 K;  3KJV A;  4G9Z A;  4KB1 A;  2E5L K;  3LPT A;  2D0P A;  3NBP A;  1RTD A;  1JLG A;  1YJ9 N;  1HKC A;  3WQU A;  4CGG A;  5F1X A;  1T6D A;  3KTQ A;  2UXD K;  4E1J A;  4BR0 A;  4DWI A;  4YNQ A;  4J2E A;  4E7L A;  3HVR A;  1FXX A;  4HCB A;  5ADX H;  1NM1 A;  3HL8 A;  1KQS M;  3G6E N;  2FSJ A;  4ISE A;  3LAK A;  2D1K A;  1VQK N;  4KHS A;  4BG9 A;  1V4T A;  3AV9 A;  1K8K A;  2YHX A;  3NGI A;  4BRQ A;  2HND A;  3DRR A;  3ZSO A;  1VHX A;  1G15 A;  5LY3 A;  4BRO A;  3S3O A;  2DPN A;  1UAX A;  4IBN A;  4AHT A;  2E88 A;  1IG9 A;  1HUX A;  5H1S Q;  1DEJ A;  4FK2 A;  3I8D A;  3HP6 A;  4E89 A;  2YHY A;  5EVZ A;  4Z4C A;  3QLH A;  4IKF A;  4DQR A;  4BAC A;  1NJW A;  4H0T B;  5C24 A;  4N56 A;  4M42 A;  2P9K A;  4FWP A;  2FBX A;  3KVG A;  2PBD A;  4MO5 A;  2ZJP L;  1VQP N;  3RSE B;  4CZE A;  2FLO A;  4U7B A;  2ZD1 A;  1JCE A;  3TAF A;  3DLK A;  2ZQB A;  4BR4 A;  3O9Q A;  2D0B A;  3IAY A;  1XNR K;  5IT9 O;  3WNG A;  3RMC A;  1WAJ A;  3UKR A;  4Z94 A;  1VSI A;  3HOT A;  3ZSZ A;  5AQT A;  4EP5 A;  1GLA G;  1A5X A;  1EO1 A;  1RBU A;  3O4W A;  3O9R A;  3O6W A;  4BR9 A;  3PSI A;  3QEX A;  3VQ8 A;  4DMN A;  4EHU A;  4GKK K;  1XHZ A;  1IO2 A;  3MXJ A;  2BUP A;  4KH6 A;  2QW9 A;  4CHQ A;  3CPW M;  4B8C A;  2VCP A;  2BAN A;  3SJH A;  3GDQ A;  4JI3 K;  4JKA A;  4CER A;  1U45 A;  1CXQ A;  3VF4 A;  4JI5 K;  3FZF A;  4C1N I;  4BE0 A;  3PIP L;  1BIZ A;  3CM5 A;  2ASO A;  4ISF A;  1KD1 O;  4F9O A;  3OHR A;  1HPM A;  5HRP A;  1OH6 A;  5LL6 Z;  1GOC A;  3C6T A;  4M3T A;  3L8B A;  3CHW A;  5AQP A;  4Q5V A;  3THW A;  4B9S A;  4CZL A;  4FLZ A;  1Y64 A;  1U49 A;  1D8Y A;  2IOC A;  5J2N A;  1YJN N;  3LAM A;  2V52 B;  3TAQ A;  4Z4E A;  1WSJ A;  5LJW A;  2HNY A;  3CMA N;  1SAZ A;  1HJO A;  3O5B A;  4CFD A;  3C6U A;  3RVC A;  3QET A;  1I3A A;  1RDU A;  4DSJ A;  3M8Q A;  3ULD A;  3OVN A;  2HBK A;  3KWG A;  4GKJ K;  3F9M A;  4FLX A;  1ZBL A;  1Z05 A;  4B1X B;  3SJJ A;  4F8R A;  4HUE A;  2KTQ A;  3M5R A;  2F7T A;  3WEE A;  2ITG A;  1NLV A;  4CGH A;  4I6M A;  3U4L A;  2W6K A;  1ITG A;  5FLX O;  1NGG A;  3TTD A;  2D5R A;  4O5B A;  5TKY A;  1NMD A;  1HYS A;  1WSH A;  1NJZ A;  4GV3 A;  5GIP A;  3CFR A;  3OYK A;  1CLQ A;  4CF0 A;  5KGX A;  4M63 C;  4Q0B A;  4HUF A;  3L2U A;  1N36 K;  4KHU A;  3HSC A;  3AVC A;  1ATS A;  4NLB A;  4CJ3 A;  4CZG A;  1OKJ A;  3DMJ A;  2XY5 A;  4H5N A;  4BR2 A;  5HRR A;  3I55 N;  2RKI A;  4RW6 A;  1RTH A;  4CD1 A;  1FJG K;  2DFE A;  1BUP A;  4BRD A;  4FZY A;  2VG6 A;  4CK3 A;  1K9M O;  1HNZ K;  3FZM A;  3OBY A;  4H8K A;  4RW8 A;  5DM7 L;  2VQF K;  3MEE A;  2GEL A;  4BRC A;  5AQL A;  1NGD A;  1NK7 A;  3SV3 A;  5KRS A;  2V7Z A;  3NCI A;  3I33 A;  3VQ4 A;  3TAE A;  1C6V A;  3OYH A;  2A42 A;  1HLU A;  3BF3 A;  1R0A A;  1SZ2 A;  2YX6 A;  1KFD A;  4M41 A;  3AA4 A;  4KTZ A;  1IG8 A;  3HBT A;  2F8T A;  1NGF A;  4CGI A;  1T8E A;  2UUB K;  1XNQ K;  1DKG D;  5ADX A;  4QS8 A;  2IC3 A;  3D7E O;  1ZXO A;  1U6Z A;  3DLR A;  4QAG A;  4JV5 K;  1KC8 O;  3TWH A;  2Z1G A;  1TK5 A;  1HJR A;  2F96 A;  3T69 A;  4DV6 K;  5I9E B;  3P83 D;  3OYM A;  3C7N B;  3EE8 A;  2YJF A;  4C8N A;  2ZE2 A;  4JI1 K;  4DFJ A;  5KI6 A;  4B1Y B;  1K8A O;  4C23 A;  4O55 A;  3WXM B;  3HXM A;  5AQM A;  2NZT A;  1VSD A;  1IKX A;  4HWI A;  1OVY A;  3NHG A;  4DR7 K;  5BN9 A;  4FVM A;  5CE3 A;  1ZC6 A;  1RT6 A;  1S72 N;  3R9P A;  3SBG A;  4HCC A;  4YY3 K;  4YOY A;  2YI1 A;  1EKE A;  4OKJ A;  2CH6 A;  3A0I X;  3SUN A;  4W5R A;  3K2P A;  1WSI A;  4Y0W A;  4C1N K;  5FRM A;  1TVR A;  4JN4 A;  3CJA A;  4NLC A;  4CW7 B;  5JVH L;  3ENO A;  2KW4 A;  4DLG A;  4FJ9 A;  3SCX A;  4KHY A;  5KPZ A;  4JYA K;  3DLG A;  4MLE A;  3QNO A;  1BA0 A;  2I7N A;  3HVT A;  3ZT3 A;  1LV5 A;  1WSF A;  2B4J A;  2KKZ A;  1NK0 A;  4DQI A;  3ZSW A;  3VGK A;  4Z0U A;  4LC9 B;  4FWN A;  1HX1 A;  4JRP A;  1K8K B;  3ZX0 A;  4A5B A;  4OPK A;  5J2Q A;  4IDH A;  3J7Z O;  5JVG L;  3KLF A;  3V6D A;  4DQQ A;  3PIO L;  3I56 N;  4IWV A;  4MDB A;  2QM1 A;  1VQN N;  3N4P A;  1MWK A;  4ICL A;  3AY9 A;  2KZM A;  1GLE G;  3H08 A;  2VGM A;  1U2V B;  4YHH K;  1GLC G;  1Q9Y A;  4YOX A;  1S1V A;  1ILY A;  5LJV A;  2YNG A;  2VWK A;  3LDO A;  3TTC A;  2Z1J A;  3HPO A;  1UWB A;  1OH7 A;  3IKM A;  2NRZ A;  4AHV A;  4IFE A;  2A3Z A;  5C10 A;  1YIJ N;  1D4X A;  3KK7 A;  3GOI A;  1N5Y A;  4NO7 A;  4H5T A;  1VQO N;  1CZB A;  5I42 A;  4YDU C;  3LPU A;  1NGC A;  2HBM A;  5SWM A;  2HMI A;  1TL1 A;  1O13 A;  5EOY A;  4FLV A;  5AQV A;  2I7P A;  1K6Y A;  3DOL A;  4XH1 A;  1TK8 A;  3L2V A;  1RDB A;  1QSY A;  4K25 A;  3MMV A;  1XQS C;  4DUZ K;  4DV0 K;  2O8D B;  3H45 C;  1HKG A;  3CF5 L;  1FKO A;  2I5J A;  2BE2 A;  2H3G X;  1RT3 A;  4FSV A;  4HTL A;  3LP3 A;  1WBD A;  1N34 K;  1KSP A;  2QA4 N;  2LSN A;  4IDK A;  5M1K A;  3TSU A;  3NE6 A;  4BRK A;  3L6Q A;  4M3Y A;  4BDZ A;  3R3L A;  3FR0 A;  4H5W A;  3VA0 A;  4CHZ A;  3CJ1 A;  3U6F A;  3VGL A;  4AQY K;  4FJJ A;  2X6N A;  2YHW A;  4I9L A;  5AQS A;  3TAB A;  3CFP A;  3G10 A;  2VQE K;  4C8L A;  2NRR A;  3J81 O;  1C0M A;  4E19 A;  4CIE A;  2OPS A;  2O8E A;  1E3M A;  1SL2 A;  1Z6R A;  2O8B B;  2A40 A;  3VQD A;  4OLA A;  4DR1 K;  4W5N A;  1FW6 A;  5ELZ A;  3L4Q A;  4CEO A;  2QXF A;  2P5O A;  1KAZ A;  4LF7 K;  3CCV N;  1OH8 A;  1J5O A;  1RBR A;  1D5A A;  1WB9 A;  4C8K A;  2FC0 A;  3SYZ A;  1QQN A;  1W97 L;  5AQJ A;  5HL7 L;  4CFB A;  1GLF O;  3NH1 A;  2KZZ A;  1RBT A;  3EN9 A;  4BVO A;  5JMV A;  4W5O A;  3NDK A;  1XC9 A;  4PKG A;  3KZB A;  4F4K A;  4DR4 K;  1S5J A;  3ATV A;  3QBW A;  3TU5 A;  1XUP O;  4GW6 A;  4DTS A;  4NYN A;  4E1N A;  3HPH A;  1VQ5 N;  1VSM A;  4I2P A;  4AHS A;  4RG8 A;  4AM6 A;  1Q9X A;  5KGW A;  3DOK A;  3SBT A;  5AQQ A;  3CG7 A;  4K43 A;  3ZET A;  3VF2 A;  2YHA A;  3NF6 A;  2FBY A;  3MCP A;  1GOA A;  1X1P A;  2Q36 A;  2FF6 A;  3LP0 A;  3ZX3 A;  3NF8 A;  2NNW A; 
#chains in the Genus database with same CATH homology
 4DUZ K;  4DV0 K;  4GKJ K;  3J7Y P;  2UXB K;  4NXN K;  3J80 O;  4DR7 K;  4LF9 K;  4DV5 K;  4JI4 K;  1N34 K;  4KHP K;  2UXC K;  1IBL K;  2HHH K;  1J5E K;  4V19 S;  1XMO K;  4YY3 K;  2UUC K;  5FLX O;  4LF6 K;  5A2Q O;  4JI8 K;  4CVN E;  4JI2 K;  1XMQ K;  5IWA K;  4AQY K;  4LF8 K;  2VQE K;  4CW7 B;  4DV4 K;  3J81 O;  4DV3 K;  4OX9 K;  1HNX K;  4JI6 K;  2F4V K;  4JYA K;  1IBM K;  4DV2 K;  4LF5 K;  3T1Y K;  4K0K K;  4LFA K;  1N36 K;  4DUY K;  5LMU K;  4B3S K;  2UUA K;  4JI0 K;  4DR1 K;  1XNR K;  5IT9 O;  3JAM O;  5BR8 K;  1FJG K;  4LF7 K;  4DR2 K;  2UU9 K;  4LF4 K;  2ZM6 K;  3T1H K;  4X66 K;  1HNZ K;  1N32 K;  3OTO K;  2VQF K;  4DR3 K;  4DV1 K;  1IBK K;  4B3T K;  4GKK K;  4X64 K;  4YHH K;  4DR5 K;  4DR6 K;  4DR4 K;  3J7A P;  1HNW K;  4JI3 K;  4X62 K;  4DV7 K;  4NXM K;  4JI5 K;  2UUB K;  1HR0 K;  1XNQ K;  1I94 K;  4JI7 K;  4LFB K;  4JV5 K;  5LL6 Z;  2E5L K;  4B3M K;  4DV6 K;  4LFC K;  1N33 K;  5AJ3 K;  4B3R K;  2UXD K;  5LMN K;  4X65 K;  4JI1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...