1FJGK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1fjgK00
5AJ3K 2UXCK 5LMNK 1N33K 4DV4K 4DV0K 4B3TK 4DV5K 2VQEK 3J81O 4NXNK 1HNXK 4LFBK 4DV3K 3T1HK 4JI8K 4DV6K 1XNQK 4JI7K 4KHPK 5A2QO 4DR4K 4B3RK 4LF4K 4V19S 4LF5K 1HNZK 4X64K 4DUYK 1XMOK 4JI2K 2UUBK 2F4VK 4CVNE 4YY3K 4B3SK 5LL6Z 4LF9K 4X66K 2UU9K 3T1YK 1N32K 4DR2K 5BR8K 4JV5K 4DR6K 3OTOK 2HHHK 4LF6K 4JI6K 3JAMO 4JI0K 4X65K 4GKKK 4LF8K 2UUAK 2UUCK 1I94K 4DR1K 5FLXO 4GKJK 4DV1K 1J5EK 4LFAK 5IWAK 4CW7B 3J7YP 1IBMK 3J7AP 4JI1K 1XNRK 1N34K 1XMQK 1N36K 2ZM6K 4DR7K 4JI5K 4LFCK 4JI4K 1IBLK 4B3MK 4K0KK 5LMUK 4DUZK 4LF7K 4AQYK 2VQFK 4OX9K 2E5LK 1HNWK 4YHHK 1HR0K 3J80O 5IT9O 1FJGK 4DV2K 1IBKK 4DR3K 4JI3K 4DR5K 2UXDK 4NXMK 4X62K 4JYAK 2UXBK 4DV7K
chains in the Genus database with same CATH superfamily
4N47A 4N41A 3ZT4A 2NRVA 3E9LA 3HM8A 1UA0A 1BI4B 3O6WA 4JNEA 2XY5A 2G8KA 2QWRA 3SCXA 3BUZB 1HMVA 4XH1A 3ZEUA 3O3GA 5F0XA 2D1KA 4CF1A 2KFZA 2W41A 3V4IA 3LZIA 3F2KA 4DR4K 4EFHA 1KD1O 2Q36A 2VWKA 3SBGA 1KSPA 5LJVA 3MEGA 2GELA 3DLRA 4F3TA 1RDAA 3QEIA 4Z4HA 1RTHA 5SWMA 4DHYA 2ZJPL 2QW9A 2QWMA 3RRGA 2OTLN 2YKMA 3E01A 2OZMA 4QAGA 4BE0A 1FKPA 2HHVA 1MA9B 2E2NA 2HHHK 3H6EA 3IMXA 3K59A 1FW6A 4EP5A 2UUAK 1R0AA 3DRPA 1U48A 3LL3A 4B8AB 1TUYA 3J7AP 1XNRK 4FZXC 1D4XA 3MXJA 3M8PA 4BWMA 3OYAA 3DLHA 1NGIA 4ILHA 5CY4A 4E19A 2O8CB 4H0OA 4CHPA 4FO0A 4CESA 3GOIA 1HQEA 4DCHA 3HO1A 3HVTA 3OBYA 3LP0A 3RMDA 5DM7L 3OYMA 4B9SA 1S1TA 1WSHA 2IIRA 1VSEA 5BR9A 1UAXA 1TK5A 1SKWA 4DQPA 4CE9A 4KI6A 1HQUA 2DPNA 3VQ7A 4IJNA 4HCBA 5ADXH 1JLGA 1FK9A 3H08A 3WEEB 4BE1A 3A2FA 3RMAA 3NFAA 4I2QA 1KLNA 3K9JA 1WSFA 4X62K 4BE2A 4PHTX 1NOYA 4B9QA 1HPZA 1KC8O 5LMNK 3SV4A 2FBTA 2GV9A 4C8OA 1R59O 4K25A 1QSLA 1S6PA 3SMPA 4CD3A 4FLWA 3MCAB 3RSEA 4H5VA 1ASUA 2DFFA 4BC3A 4DSFA 1NK8A 1Y97A 1TYQA 3C95A 3D45A 1TL3A 1VQ4N 4FJHA 3G71N 4OKKA 4JKEA 4C1NI 2F4VK 2WTUA 3CQYA 1Q9XA 1IKVA 4QOZB 5AQZA 3HPOA 4BRMA 1N32K 5TKYA 1KTQA 1C0GA 4DR6K 1HPMA 4KH6A 3D2FB 5AQYA 5AQNA 1YVUA 3SAGA 3U6FA 5HRPA 4WF9L 1BWFO 3VF6A 4M42A 1SZ2A 1XHZA 2ZJRL 3PX6A 2Q97A 1T05A 3NDKA 2HOEA 3J7YP 1IBMK 3TAMA 4AHUA 4YOUA 4YORA 1CZBA 5EXWA 3U9ZA 4A61A 3JXUA 3VF2A 5JS2A 1IKWA 3SV3A 3VQAA 4ISGA 1F21A 3LDPA 4FJNA 2Y1JA 2Z1JA 3TI0A 3CM5A 2D0OA 4CFDA 3FFKB 2E4LA 4FM2A 3EE8A 4FW2A 5BN8A 4CGGA 2QTDA 1J54A 3WQUA 1WN7A 1RDCA 3DJCA 4GMJB 3AVJA 3QERA 4CHQA 1C0TA 1JL2A 4Y0WA 3PX4A 4CZIA 4A57A 3PO4A 3CM6A 3KKSA 1JLEA 1O1WA 2W42A 4JK8A 1KCFA 1VSJA 1NJWA 3WXMB 3L2RA 3O5BA 1YTAA 1V4SA 1Z25A 4E7LA 4FM0A 3H1QA 4CK2A 1EO1A 3OVNA 3E9OA 1VSMA 1VSIA 4K8XA 2JGUA 4JS5A 5AQWA 3DLBA 5JLHA 4B3TK 4CZJA 2VQEK 1GOAA 3M8SA 1RTDA 3TAGA 3T1HK 3ZX2A 4H8KA 4LH4A 3ZCMA 2NNWA 2E20A 2IGIA 5A2QO 2DFHA 4B1XB 3VA0A 3K5OA 4DQSA 4JHDA 3SUPA 2G8UA 3PV8A 4H0XB 4LSNA 4WQ5C 4N56A 2VG6A 2QXFA 2KW4A 1WAJA 4DF4A 3H3NO 4Y1DA 4DQQA 1NK6A 4CF2A 4W5TA 5AQFA 1EETA 1UA1A 4DTRA 4MLEA 1T7PA 3QB0A 4B9VA 1VSFA 3AVMA 3NE6A 2QWQA 3AVBA 4PKIA 1T03A 1VQNN 1CXUA 1KFSA 3MDQA 4DLGA 4L3QA 1IKYA 1J9AA 1BHLA 3MN6A 1DTQA 2Q0RA 5ELZA 4IG3A 3D2EB 2E2OA 4DR1K 2Z1HA 3KKRA 5IWAK 1DLOA 4CW7B 3KWGA 2VWJA 4QS7A 3DLKA 4CGHA 4FJGA 3PUFA 3KK7A 2ZE2A 2CH6A 3KLGA 3L4IA 3KJVA 1IV0A 3VTIA 4EP4A 4Q5VA 5KI6A 4CEDA 4QCLA 3NH0A 2F9TA 3WXLA 1NGCA 2Q1NA 5I3UA 1SL1A 1BQMA 3VGKA 4UY8O 3S3NA 4JKDA 1WAFA 2GEMA 2RE2A 1LWEA 2A5XA 5KPTA 3O9TA 3ZT2A 2G8WA 1FJGK 5ADXA 3HXMA 4E89A 4KBOA 5KPZA 4KFBA 3VQ4A 3QNNA 3F9KA 4OJRA 4CEAA 4Z4CA 1Z6RA 3TABA 4CJ7A 4Z94A 2YHAA 4CK3A 2HBLA 2GX9A 5LJWA 3R9PA 4DV5K 3OYEA 1KAZA 1WSGA 4RG8A 3GE1A 3L0QA 4WQ4C 1BU6O 4HCCA 3NF6A 4JI8K 1GLJO 2KZMA 4MO4A 4AF1A 2ASMA 4CIFA 1Q8IA 2YNIA 4GVEA 4JKGA 4YOTA 4JD2B 4KHPK 3UB5A 2KHOA 3R8EA 1KVBA 3KTQA 1RFQA 3S9HA 3THYB 4M3TA 2FXUA 5JVHL 1E4FT 3G4SN 1DEJA 4XH4A 4Z4FA 1Q18A 4JEPA 4IXCA 1A5XA 4E3SA 2AJQA 2W6LA 3FZFA 3MCPA 3L2UA 4CEZA 4BRPA 1S1VA 2I5JA 1JCGA 3QFUA 3V81A 2ZD1A 4KTQA 3P1GA 3CXCM 3ZSXA 5JMVA 3M5RA 3O4QA 4FJJA 3I33A 3A5OC 4CCHA 3L3VA 4J8FA 3DI6A 3OYGA 1KAXA 4XEIA 1OKJA 3CC2N 5AQKA 3S3OA 4BDZA 2CGLA 2QWNA 3QEXA 4LFCK 2OPPA 2JWLA 3PY8A 3G6EN 3WQTA 2HF4A 3ZT1A 3DOLA 2E2QA 1HR0K 1NGBA 4Z4IA 4ZTJA 2GBZA 2KZZA 3J8AA 1RT2A 1OH7A 4BRQA 3C6TA 3TR8A 3E1YA 3M1FA 4DSLA 3KHYA 2HHXA 4JRPA 3WNHA 5E41A 1LCUA 4RW9A 4CJUA 1NKBA 1D9FA 2XO7A 2A6AA 5C25A 1O13A 1NNEA 3RRHA 2Q0UA 2HHUA 4DFPA 3ENOA 4OKEA 2OYQA 2KFNA 1H1VA 3KK2A 3LWLA 3VETA 4BR4A 1W2BM 3HJFA 4DSIA 3ZT0A 4DV6K 4RCHA 2F8SA 2O8EB 1IJJA 3THXA 3EL2A 4B9NA 3JSMA 3LM9A 1BA0A 2NRXA 2Z1GA 5M1FA 2OPQA 4FK4A 1HJRA 3VENA 1TKDA 4FK0A 1XC3A 3IAYA 2P51A 1HYSA 1REVA 3VF4A 2UU9K 4ELTA 5KRSA 1GLDG 1B9DA 4F4KA 4A2BA 4H5NA 4OPKA 4J2BA 4FXDA 1XHXA 2HMPA 5E84A 1NGJA 3SQ4A 4KRFA 2FSJA 4JI0K 1RBRA 4C8LA 1X9JA 3NHGA 4BRHA 3EY1A 5J1EA 1IKXA 3BGRA 3ULEB 1VQ5N 3SAFA 1QQNA 1VRTA 4CECA 3SZ2A 3OYLA 2WC9A 1N36K 1D8YA 1OVYA 2YHYA 3VGMA 1DKGD 1WUAA 2HNDA 4F2RA 1IO2A 1ZXOA 1A5WA 1GLLO 3L6QA 3DWLA 1XI1A 3T69A 3NMUA 4CI6A 2W40A 1CLQA 3CFOA 5KTQA 1U04A 1T6DA 4BRAA 2P9PB 1JLBA 4A59A 3SUQA 4Q0BA 3SJHA 3K5MA 3V9WA 3ISNC 2ATQA 4DQ8A 3THWA 3NH1A 5BRDA 5AQOA 5M1NA 2KTQA 4MDBA 1TGOA 3T19A 4DR3K 4RW7A 1NGDA 2P9IA 1RBSA 4UQGA 1M90O 1RT4A 3JS6A 4B1WB 4LSLA 4J2EA 4FCYA 3FE1A 4CZFA 4DV4K 3CG7A 1NGEA 1SL2A 4BG8A 3OYIA 3V1OA 3TANA 3J81O 4K8ZA 3U3YA 1ILYA 4E1MA 2HNZA 3VQCA 4FL9A 4JI7K 1SKSA 4FWRA 3MXIA 4FVMA 4B3RK 1JCFA 4W5QA 3P83D 2KQ2A 5EOYA 1U45A 1EWQA 5AQGA 3LDSA 3CMAN 5C42A 2A1RA 3NF7A 4B9UA 3AVNA 3HVRA 4CJTA 4BQZA 1EKEA 2HNYA 3CETA 4CBXA 2D5RA 4E7HA 1RDWX 3KLIA 1TAUA 2PAVA 3LP3A 4IDHA 4BDYA 2BE2A 2ETJA 3K2PA 4FLZA 3I0SA 4H0TB 4F2SA 5MLCQ 1L5UA 4EZ6A 3MECA 3VQPA 4HHTA 4LF8K 3K5LA 3RMBA 2A1SA 1S1XA 5KPRA 2HBJA 1OH6A 3P31A 5KRTA 3VPZA 4OGEA 5DMRA 3QICA 2O8BB 4JI1K 2NUBA 3THWB 3V9XA 1KVCA 2E1ZA 1HJOA 3CJBA 1X9SA 3AO5A 3M3ZA 2PBDA 3ZETB 3EYZA 2B5JA 1NJZA 4KHQA 2QWPA 2O8DA 1NWKA 3UKUA 4NYNA 4LF7K 3MX5A 3O1WA 3OYNA 1S9GA 4C8MA 2GUPA 5FPDA 3TWHA 4FJKA 3TPQA 4BRFA 4O4GA 5BREA 1YI2N 3QIPA 4DU3A 3LPUA 1V4TA 3D7EO 2XRIA 4CZHA 5DK5A 2P9SB 3KVGA 4OPAA 3HPHA 4RWTA 1Q82O 3LWMA 5CYQA 3TTCA 3RR7A 1VHXA 3UE5A 4W5NA 3ZEUB 3SQ2A 2XY8A 4CZGA 1X9WA 3CIPA 1TK8A 2QKBA 3AV9A 4CHZA 3SQ0A 2P9KA 4FOEA 1TL1A 1C0FA 2FBXA 3NF8A 3DAWA 4B1VA 2D0BA 5KGXA 3CMEN 3UKRA 4LF4K 1SS6A 3DMJA 5GIPA 1TVRA 4KV8A 1YUWA 2KKZA 3V9SA 4JN4A 1B9FA 1NG9A 3HK2A 2NRHA 3I8BA 3SMSA 2E1YA 3DLGA 3NF9A 4IFYA 3DRRA 1YF5L 2YJFA 3CCSN 2O8DB 4B08A 3SAHA 2PY5A 1T6CA 4MLHA 3SYZA 2Q2RA 2FF6A 3CF5L 1C1AA 3HZ6A 1MU2A 4DU1A 3SPZA 3AAQA 3AO4A 4M7XA 2UUCK 4DWIA 2CH5A 4HUGA 4BRIA 4IFVA 3SJJA 3AVIA 2YCHA 3WUHA 3ZX0A 4WFBL 2XY7A 1ATRA 3HOSA 4LC9B 4CFCA 2RPIA 3DOKA 3AY9A 2ZM6K 2QM1A 4FPAA 4WYBA 1VQ7N 3LDOA 4ILJA 3ZSOA 3QLHA 3KD1E 4IKFA 1KLMA 3IKMA 3P4IA 4DS5A 2AP1A 4K0KK 4GNIA 3VEWA 1LW0A 2G8VA 3AVLA 3J80O 4DQRA 4FJLA 1UWBA 1U4BA 3BF1A 3HTVA 2HVIA 5IT9O 3VQEA 4AHRA 3L2VA 1RTJA 2IVOA 1NGAA 1W97L 3MAQA 3WXKA 1C1CA 2P9KB 4AHTA 2HF3A 2V7ZA 3L2QA 4FZYA 1X1PA 3AA2A 4B1YB 1CXQA 3WXJA 2RF2A 2NRRA 4NCGA 5AJ3K 5M1OA 4KREA 1LAVA 1IG8A 3VEYA 3O9SA 2X74A 3AA3A 4H5WA 2VYPA 4FJMA 4GV9A 3RSEB 5AQVA 3E66A 4BRNA 1NMNA 3RWUA 2VCPA 3A5NC 3ZSVA 1RBTA 3LDQA 1TYQB 1JLFA 1S1WA 2GWKA 1ASVA 1BGXT 2A41A 1BCOA 4JKHA 4WE1A 2IVPA 4WQ4A 4DB3A 4B9MA 2PFUA 3MN7A 4PA1A 1K8KA 3M8QA 3T1YK 2WOMA 4CJKA 3TTDA 1VSDA 3AVGA 4R5PA 4H0PA 1RCHA 3SK3A 4LF6K 3AVAA 3AVKA 3JAMO 3BDPA 3H3OB 2W6KA 3DXMA 2G8FA 3TAQA 1HRHA 4OKJA 2HBMA 2RHKA 1S1UA 2BH1A 1U2VA 2ZQBA 4NB4A 5FLXO 4IOAL 3CHWA 2X78A 3U4LA 1J5EK 4M3ZA 3HOTA 3A5MC 2FSNA 2P9LA 4RW6A 4KPYA 4FWLA 3OJSA 4YOYA 4FLVA 3MWPA 4OVLA 4WFNL 5BRHA 1NJIO 4KI4A 1Z26A 2BDPA 1QHAA 2O8FA 2FF3B 2F9WA 1VQMN 3T1AA 3FGUA 5BPLA 4FPBA 4DTNA 4B3MK 5AZIA 3QNOA 2VG7A 3D6RA 3KK1A 3IUCA 4A2AA 4OPHA 1YT3A 1NBWA 2YV0X 4CIGA 2ZWHA 3QEWA 1NLVA 5I42A 3C7NA 1RDUA 3CJ9A 2XY6A 4HUFA 3K5NA 4BRKA 2VGMA 3OYCA 4FVUA 4O8KA 4A5AA 3B6PA 4BR9A 1JL1A 1VRUA 1IG9A 1VSLA 5AZJA 2YNFA 3BF3A 3J7ZO 2QA4N 1VSHA 2I7NA 2IS3A 2UXCK 2ASOA 3Q7CA 4LD0A 2R7YA 1NOZA 2ITGA 1J6ZA 3VQBA 4C8KA 3VESA 4CZLA 4RTFD 4YFUA 4LFBK 5F1XA 4DV3K 1HKGA 1HKBA 5C2DA 4IEIA 4JHDB 3MMVA 3NH2A 4KHSA 3VEVA 4PKGA 3BP8A 4FLTA 4X64K 3WNFA 4CJ3A 1JJ2M 4JRQA 4CF9A 2HSTA 1XMOK 2IAJA 3AO2A 4CJ4A 1QSYA 3ZSQA 3LDLA 2UUBK 1QQMA 3KD5E 1TKXA 3SQ1A 4BVPA 4L8RB 2P1JA 2YHBA 4I9LA 3CFRA 3ZX3A 4DTMA 4CEQA 4DR2K 5BR8K 5CZ2A 1QQOA 3OYBA 4I6MA 2KLAA 4DFMA 3OTOK 4K43A 5J2MA 4OLBA 5HRSA 5B8HA 3GBTA 3LAMA 5BN9A 1QZ6A 4GKKK 5AZIB 1ZC6A 3U3GA 3PSIA 4JK7A 1NJXA 1GOCA 4FOIA 4CJFA 4JKAA 1RT5A 1L3UA 4KKOA 2BTFA 5FPEA 1WNSA 4HUEA 1DGKN 3P38A 3HL8A 4I7FA 4I2PA 4CEEA 1ZBUA 4BWJA 4BC4A 5AZJB 1N6QA 3LDNA 4JI4K 1NK4A 2EWSA 3ZSRA 4B9TA 3CD6N 1VK0A 1HNWK 3CI5A 3V1RA 3TARA 2P9NA 4FWMA 2OZSA 1X9MA 2FC0A 1B92A 4B8CA 2P9UA 2DY4A 1RDBA 4CZEA 1LW2A 4PUOA 3N4PA 1SV5A 4KH4A 3ZYYX 2OTJN 2NRWA 1SAZA 5AFUH 4JYAK 1KFDA 4CBUA 1ATSA 3CCJN 4O0IA 2X6SA 3ZT3A 5HRNA 4FK2A 4DV0K 2D0PA 4CJLA 3C6HA 3Q7BA 4ELVA 1N5YA 2J4RA 4JKGB 2ZF5O 3VQ5A 4W5OA 3AO1A 3G25A 1D9DA 3ASMA 2HHWA 4V19S 4LF5K 2YHWA 4PWDA 4DTOA 4ZHRA 1I3AA 3L4QA 1CZ9A 3VQQA 3OYFA 2A40A 4YNQA 1N8RO 3O08A 4TSXA 4C8NA 2A3ZA 1BO5O 4LF9K 3C94A 1X3NA 2JWKA 3DLEA 4EZ9A 1SUQA 4YDUA 4BR0A 4JK9A 4BROA 4BG9A 4I9QA 1S5JA 1MWMA 4JI6K 4A62A 3OS2A 3MX2A 1S72N 1RT7A 1JLQA 5CZ1A 5TKWA 4BREA 3LP2A 4ICLA 5C15A 3F5TA 3HSCA 3HT3A 1TK0A 4GKJK 4CJRA 3FZKA 1VQ6N 5CE3A 4LH5A 3EO3A 2PYLA 1VQON 3SUNA 3DM2A 4ILGB 3QFPA 3LZJA 4GW6A 4BVOA 3EEQA 1VAZA 1IH7A 2WFBA 5J2PA 1TKTA 2IVNA 4NLBA 1KXPA 1VQLN 3KLHA 2QWLA 1NMDA 4LY7A 4GVMA 4NO7A 4CJSA 3D0PA 3C6AA 3RVCA 4YHHK 3A8YA 1GLFO 3EN9A 1GLEG 5AQIA 2QK9A 2IOCA 1ZYQA 5GAGP 2FSKA 4N76A 3O9QA 1NJYA 3SI6A 1BOTO 2NLXA 1W0HA 1YITN 2UXBK 1QTMA 3EKUA 3NGIA 4JS4A 1BI4A 1N33K 1HX1A 3I55N 2QKKA 3B8AX 4HWIA 4CFAA 4DSKA 4H0YB 1NM1A 1E3MA 3THXB 3PX0A 4CGJA 3K0SA 2D4WA 4GV6A 3VERA 1HNZK 4M3WA 4M3UA 2RN2A 4IOXA 2V51B 2D0CA 4NLCA 3MN9A 4EHTA 4DTJA 1NKEA 5GAEP 4DTUA 4B3SK 3I56N 2OPSA 1ATNA 3ALYA 4ID5A 3T3FA 4KHNA 3IG1A 3H1VX 1RT6A 3CQXA 5M1PA 1C0UA 1I94K 4E0DA 1RBVA 1RBUA 3KZBA 1YIJN 4FJXA 3FZHA 4AILC 3AAPA 3TAFA 3TAPA 4CZMA 4G1QA 4CEFA 4IFEA 3G10A 4DMNA 2JLEA 1QSSA 2WUSA 1S3XA 1YJ9N 4BY9C 3M8RA 2ITMA 1Q81O 3LANA 5AQJA 1L3VA 1BL3A 5HOOA 4M3XA 3OHRA 4CJWA 2I7PA 1HLUA 3VQDA 2E5LK 3MEDA 3QBXA 2YKNA 5AQSA 1G15A 4DSJA 3O8MA 4CJEA 3FR0A 1QQCA 4MO5A 5F2RA 3WEEA 2E88A 3JYTA 4XH5A 3CCUN 2P9IB 4JKFA 4CK1A 1I39A 4KTWA 1U47A 2ZGYA 1Q9YA 1HYZA 3CERA 3OBWA 2CGJA 3SPYA 5AFUA 3KWIA 1KVAA 3EE9A 3ITHA 4FLUA 3KIOA 1T8EA 4FJIA 3LM2A 4IDKA 4OGCA 4FJ5A 3U8XA 1QS4A 3OY9A 1HNXK 2WBNA 4KH5A 1GLCG 4DKWA 1LV5A 3O80A 3CFPA 4CHYA 5CHIA 3C65A 3I0RA 3PSFA 1MDUB 2F7TA 2G8IA 2VWBA 3H45C 4O5BA 3HSTB 3SBTA 2E6LA 3KLFA 3HP6A 4E7KA 3VQ6A 3PIOL 4MDAA 3MEEA 3ZSWA 5GAHP 3QEVA 3THVA 5GIOA 3IFRA 3NVMA 1Z05A 5C12A 5HRRA 3U9DA 5EY4A 1M1KO 4DFJA 5H1SQ 4C1NK 3NCIA 4M7YA 4AHSA 1YJWN 5FROA 4DTPA 3D2FA 3CJ1A 1JXEA 4JLHA 4DLEA 3H46O 3PLAA 1HNVA 5D3GA 4OO1J 2NZTA 1QE1A 2DTUA 2O4GA 4DSEA 4DV1K 1HNIA 2FBYA 5FRMA 3B6OA 3KLEA 1N34K 1RT1A 3O9RA 4M41A 4FLXA 1Q7YO 4MQ3A 1VQ8N 4BDPA 3SLCA 1EX4A 1VQ9N 1TAQA 2Q3SA 3O4NA 4FJ7A 1T44A 4BR5A 4U7BA 3O1BA 4CJQA 3QINA 4WQ5A 4JI5K 1JLCA 3UKUB 2HHSA 4FZZA 3CCLN 5LMUK 5CR4A 1NGGA 2RKIA 4FWKA 4FM1A 3QESA 5HLFA 3GDQA 1CZAN 4F9OA 3VEOA 3NVKA 3CJCA 4E7IA 5AQMA 1UOCA 1NKCA 2NRZA 3CCMN 2PZSA 2P5OA 3O3HA 3RTVA 4BC5A 4DV2K 1VQPN 4JI3K 1BISA 2YHXA 2UXDK 1K8AO 3AARA 4IJAA 2CGKA 1EXQA 4U67L 5E26A 4F3OA 4FJ9A 2H3GX 4CF0A 4E7JA 3FFIA 1LAWA 4YOXA 1YTUA 1DTTA 1P90A 3BZCA 1X3MA 1C1BA 3HP9A 5DM6L 5BPNA 3A5LC 3O3FA 4DS4A 4CJPA 1ZBLA 4KO0A 3LPTA 4G9ZA 3T7ZA 1QVGM 4WFAL 2G8HA 3AGRA 2EHGA 4KTZA 4PKHA 4KHWA 5EX5A 3UKRB 3ZSZA 2BGGA 4OLAA 5JVGL 4BR2A 1J5OA 3NGYA 4BRCA 5KGWA 3V6DA 3DXKA 1L3TA 2B6AA 5T7BA 4JI2K 2GTDA 1ZBSA 5J2QA 3GL1A 4O44A 2E6MA 4X66K 4JKBA 4BGBA 4FLYA 4FWNA 2X6NA 1LWCA 3QETA 4CJVA 3PO5A 3VTHA 5C2FA 4K41A 4ID1A 4JKCA 3EKSA 1K73O 3D2EA 1ZBHA 4PL7A 3QDKA 2AA4A 4AM6A 5GINA 2Y1IA 2Q31A 1BG3A 4BGAA 3TSPA 4XIUA 4QS8A 1S22A 4H5TA 3UIQA 5FRNA 3CPEA 4O55A 2F96A 2E2PA 4ISFA 4DTSA 3VGLA 3HRGA 3CCVN 3NBPA 3K58A 1WBDA 1S6QA 4AHCA 1EQYA 2B4JA 3C0BA 3PIPL 3TAEA 1ASWA 1Y64A 2IC3A 1XUPO 4C23A 1IBLK 3QBWA 4DUZK 3VA3A 1OH8A 3EZ5A 4M3RA 1JCEA 1WSJA 1NK0A 2A42A 4FSVA 3MN5A 1JKHA 3WXIA 3OYJA 1S9EA 5KQDA 1ITGA 1RT3A 5GADP 4CBWA 2ZJQL 1RTIA 2OPRA 1NK9A 3HPGA 1GOBA 2QI2A 1BUPA 3WT0A 3R6MA 4Z4EA 4WCEL 3O4WA 4IBNA 1U6ZA 3W3DA 1XWLA 4YOWA 4DV7K 4DTXA 4A5BA 4H03B 4KB1A 1LOTB 3DXKB 3OS1A 3ID6A 3BZKA 4CEOA 4DQIA 3HM9A 4IG0A 2EX3A 2OA8A 5HL7L 5M1KA 3CCRN 4JAXA 3HYFA 4F8RA 3IRXA 4GY2B 4CFBA 1SL0A 4MFBA 5C0YA 1DT9A 4CERA 5AQQA 5AR0A 2V52B 2HHTA 1XNQK 1OVQA 1RGIA 5AQXA 4JD2A 4EIAA 3VEZA 5AQLA 4HVJA 3THYA 3CQ8A 4BR7A 3K57A 3ID8A 1L3SA 1J53A 1XC9A 3W0LA 4DUYK 1YXQA 4YY3K 1JLAA 1K8KB 5AQTA 4IO9L 2P5GA 4B3OA 1NK5A 4FW1A 3ENHA 5C10A 4J2DA 2YX6A 4M3YA 3DXMB 3L2WA 1YVNA 3S41A 3FZMA 3CJAA 4CEBA 3OW2M 1U2VB 1C6VA 4H5RA 4DG1A 4HTLA 2P9LB 3V9UA 4YOVA 4O8UA 4RW4A 1WBBA 1XMQK 2FLOA 1D5AA 2HMIA 2IDOA 1YJNN 2HVHA 3L3UA 3OYHA 5EU7A 1OH5A 4BQLA 3CC4N 2O8FB 3KK3A 4DR7K 5SZTA 3RMCA 3VEXA 4CF8A 5AQHA 2NRTA 4IWVA 3IDHA 2QEXN 1KQSM 1BCMA 4OX9K 4FJ8A 1BA1A 1YAGA 4IEEA 2GWJA 5M1QA 4W5RA 3BY5A 4KHYA 2BANA 1RDDA 3C6UA 3AGKA 2HBKA 3C7NB 4B9LA 5HBMA 3QEPA 3BEXA 3CYMA 5J2NA 3AA4A 5I9EB 2LSNA 5JLFA 3OJUA 4M45A 5EVZA 1QVFM 3IS9A 4NXMK 4B1UB 1C0MA 1TUUA 2OANA 2V7YA 3LALA 5AQUA 2QWOA 1HYVA 1WB9A 2FBVA 1MWKA 2HB5A 4DU4A 5KQ8A 3EZWA 1TV6A 4BRDA 3F9MA 1NGHA 3MK6A 4NXNK 3N4QA 1K9MO 4FYDA 3VOVA 3ATUA 3ATVA 4CZKA 2O8EA 4CJ5A 1FKOA 1HUXA 4FWPA 3LAKA 4ELUA 3TSUA 1WSEA 4CVNE 5FDLA 1GLBG 1WOQA 1E4GT 5LL6Z 3DYAA 4EAHD 3P5JA 4I6MB 3ZSYA 4BRGA 4IOCL 5HP1A 5C24A 1W7AA 1K6YA 3NAEA 1XQSC 3K9KA 1NU0A 3WNEA 3ULDA 3SUOA 1WSIA 1HKCA 4IZ9A 3AO3A 4KB0A 3AVCA 1VQKN 1NK7A 4CGIA 3ULEA 4H4OA 5JICA 4NCAA 4IO8A 2ZGZA 1TKZA 1GLAG 3A0IX 4FWSA 1SQKA 3CCEN 4AHVA 4GV3A 4HTUA 3V1QA 1FXXA 3AVFA 3FLCO 2VQFK 3CC7N 3LP1A 1NGFA 4CHNA 1KRPA 3L8BA 5K14A 3ZLJA 2P9NB 4H4MA 5LY3A 4ZTFA 2P9PA 1KAYA 2GUIA 2XHBA 2BUPA 3CJ7A 4DF8A 2P9UB 1EP4A 2HW3A 1IBKK 1VSKA 3WNGA 4DR5K 4E1JA 3TSQA 4PL8A 4B1ZA 5BRFA 3QO9A 4CGFA 3HBTA 4QS9A 1T3VA 4CGDA 3HI0A 3NGZA 3SNNA 5FPMA 3OA9A 4CIEA 3DLLL 1A5VA 1SKRA 1ESVA 4FWQA 4OPJA 1QZ5A 5FPNA 1RNHA 3MXMA 3I8DA 3DRSA 3VQ9A 2VGNA 4O0JA 2YNHA 2WONA 3CCQN 3S3MA 3M6GA 1JXBA 2YNGA 5CYMA 4CD1A 1Q86O 3MWTA 3OYKA 3R3LA 1YHQN 4H0VB 1RILA 4NYFA 4Y1CA 3VMFB 3F73A 2DFEA 4AM7A 1BDGA 4BC2A 4JV5K 4J2AA 3P39A 4X65K 2E8AA 2VG5A 4Z4GA 3E9PA 3QIOA 4RW8A 5AQRA 4AH9A 5JS1A 3ENBA 2PYJA 1BIZA 2YJEA 2YI1A 4FWOA 4LFAK 4PQUA 4BRLA 1U49A 3R1XA 4Z0UA 3GG4A 2O8BA 4EHUA 2D0AA 4KAZA 3TTFA 1W9HA 4BACA 3QMLA 4N5SA 4O5FA 4NCBA 1EWRA 1WLJA 1BQNA 3ZETA 4PY5A 2HHQA 2UYTA 1P8ZA 1ZBIA 5HROA 3CPWM 4AQYK 4M63C 1G99A 4DFKA 1BIUA 2F8TA 2Z1IA 3G0ZA 2ASPA 2O4IA 4K42A 3TU5A 3AVHA 4R79A 3AA5X 4ISEA 4KHUA 3RR8A 1LWFA 5AQPA 1QHTA 3FZLA 3O9UA 3V9ZA 4YDUC 3VN5A 2QXLA 2OCEA 3VQ8A 4E1NA 2P9SA 3OS0A 2O8CA 5BPMA 3OYDA 4CHOA 1ZBFA
chains in the Genus database with same CATH topology
5AJ3K 2UXCK 5LMNK 1N33K 4DV4K 4DV0K 4B3TK 4DV5K 2VQEK 3J81O 4NXNK 1HNXK 4LFBK 4DV3K 3T1HK 4JI8K 4DV6K 1XNQK 4JI7K 4KHPK 5A2QO 4DR4K 4B3RK 4LF4K 4V19S 4LF5K 1HNZK 4X64K 4DUYK 1XMOK 4JI2K 2UUBK 2F4VK 4CVNE 4YY3K 4B3SK 5LL6Z 4LF9K 4X66K 2UU9K 3T1YK 1N32K 4DR2K 5BR8K 4JV5K 4DR6K 3OTOK 2HHHK 4LF6K 4JI6K 3JAMO 4JI0K 4X65K 4GKKK 4LF8K 2UUAK 2UUCK 1I94K 4DR1K 5FLXO 4GKJK 4DV1K 1J5EK 4LFAK 5IWAK 4CW7B 3J7YP 1IBMK 3J7AP 4JI1K 1XNRK 1N34K 1XMQK 1N36K 2ZM6K 4DR7K 4JI5K 4LFCK 4JI4K 1IBLK 4B3MK 4K0KK 5LMUK 4DUZK 4LF7K 4AQYK 2VQFK 4OX9K 2E5LK 1HNWK 4YHHK 1HR0K 3J80O 5IT9O 1FJGK 4DV2K 1IBKK 4DR3K 4JI3K 4DR5K 2UXDK 4NXMK 4X62K 4JYAK 2UXBK 4DV7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 K;  2UXC K;  5LMN K;  1N33 K;  4DV4 K;  4DV0 K;  4B3T K;  4DV5 K;  2VQE K;  3J81 O;  4NXN K;  1HNX K;  4LFB K;  4DV3 K;  3T1H K;  4JI8 K;  4DV6 K;  1XNQ K;  4JI7 K;  4KHP K;  5A2Q O;  4DR4 K;  4B3R K;  4LF4 K;  4V19 S;  4LF5 K;  1HNZ K;  4X64 K;  4DUY K;  1XMO K;  4JI2 K;  2UUB K;  2F4V K;  4CVN E;  4YY3 K;  4B3S K;  5LL6 Z;  4LF9 K;  4X66 K;  2UU9 K;  3T1Y K;  1N32 K;  4DR2 K;  5BR8 K;  4JV5 K;  4DR6 K;  3OTO K;  2HHH K;  4LF6 K;  4JI6 K;  3JAM O;  4JI0 K;  4X65 K;  4GKK K;  4LF8 K;  2UUA K;  2UUC K;  1I94 K;  4DR1 K;  5FLX O;  4GKJ K;  4DV1 K;  1J5E K;  4LFA K;  5IWA K;  4CW7 B;  3J7Y P;  1IBM K;  3J7A P;  4JI1 K;  1XNR K;  1N34 K;  1XMQ K;  1N36 K;  2ZM6 K;  4DR7 K;  4JI5 K;  4LFC K;  4JI4 K;  1IBL K;  4B3M K;  4K0K K;  5LMU K;  4DUZ K;  4LF7 K;  4AQY K;  2VQF K;  4OX9 K;  2E5L K;  1HNW K;  4YHH K;  1HR0 K;  3J80 O;  5IT9 O;  1FJG K;  4DV2 K;  1IBK K;  4DR3 K;  4JI3 K;  4DR5 K;  2UXD K;  4NXM K;  4X62 K;  4JYA K;  2UXB K;  4DV7 K; 
#chains in the Genus database with same CATH topology
 4N47 A;  4N41 A;  3ZT4 A;  2NRV A;  3E9L A;  3HM8 A;  1UA0 A;  1BI4 B;  3O6W A;  4JNE A;  2XY5 A;  2G8K A;  2QWR A;  3SCX A;  3BUZ B;  1HMV A;  4XH1 A;  3ZEU A;  3O3G A;  5F0X A;  2D1K A;  4CF1 A;  2KFZ A;  2W41 A;  3V4I A;  3LZI A;  3F2K A;  4DR4 K;  4EFH A;  1KD1 O;  2Q36 A;  2VWK A;  3SBG A;  1KSP A;  5LJV A;  3MEG A;  2GEL A;  3DLR A;  4F3T A;  1RDA A;  3QEI A;  4Z4H A;  1RTH A;  5SWM A;  4DHY A;  2ZJP L;  2QW9 A;  2QWM A;  3RRG A;  2OTL N;  2YKM A;  3E01 A;  2OZM A;  4QAG A;  4BE0 A;  1FKP A;  2HHV A;  1MA9 B;  2E2N A;  2HHH K;  3H6E A;  3IMX A;  3K59 A;  1FW6 A;  4EP5 A;  2UUA K;  1R0A A;  3DRP A;  1U48 A;  3LL3 A;  4B8A B;  1TUY A;  3J7A P;  1XNR K;  4FZX C;  1D4X A;  3MXJ A;  3M8P A;  4BWM A;  3OYA A;  3DLH A;  1NGI A;  4ILH A;  5CY4 A;  4E19 A;  2O8C B;  4H0O A;  4CHP A;  4FO0 A;  4CES A;  3GOI A;  1HQE A;  4DCH A;  3HO1 A;  3HVT A;  3OBY A;  3LP0 A;  3RMD A;  5DM7 L;  3OYM A;  4B9S A;  1S1T A;  1WSH A;  2IIR A;  1VSE A;  5BR9 A;  1UAX A;  1TK5 A;  1SKW A;  4DQP A;  4CE9 A;  4KI6 A;  1HQU A;  2DPN A;  3VQ7 A;  4IJN A;  4HCB A;  5ADX H;  1JLG A;  1FK9 A;  3H08 A;  3WEE B;  4BE1 A;  3A2F A;  3RMA A;  3NFA A;  4I2Q A;  1KLN A;  3K9J A;  1WSF A;  4X62 K;  4BE2 A;  4PHT X;  1NOY A;  4B9Q A;  1HPZ A;  1KC8 O;  5LMN K;  3SV4 A;  2FBT A;  2GV9 A;  4C8O A;  1R59 O;  4K25 A;  1QSL A;  1S6P A;  3SMP A;  4CD3 A;  4FLW A;  3MCA B;  3RSE A;  4H5V A;  1ASU A;  2DFF A;  4BC3 A;  4DSF A;  1NK8 A;  1Y97 A;  1TYQ A;  3C95 A;  3D45 A;  1TL3 A;  1VQ4 N;  4FJH A;  3G71 N;  4OKK A;  4JKE A;  4C1N I;  2F4V K;  2WTU A;  3CQY A;  1Q9X A;  1IKV A;  4QOZ B;  5AQZ A;  3HPO A;  4BRM A;  1N32 K;  5TKY A;  1KTQ A;  1C0G A;  4DR6 K;  1HPM A;  4KH6 A;  3D2F B;  5AQY A;  5AQN A;  1YVU A;  3SAG A;  3U6F A;  5HRP A;  4WF9 L;  1BWF O;  3VF6 A;  4M42 A;  1SZ2 A;  1XHZ A;  2ZJR L;  3PX6 A;  2Q97 A;  1T05 A;  3NDK A;  2HOE A;  3J7Y P;  1IBM K;  3TAM A;  4AHU A;  4YOU A;  4YOR A;  1CZB A;  5EXW A;  3U9Z A;  4A61 A;  3JXU A;  3VF2 A;  5JS2 A;  1IKW A;  3SV3 A;  3VQA A;  4ISG A;  1F21 A;  3LDP A;  4FJN A;  2Y1J A;  2Z1J A;  3TI0 A;  3CM5 A;  2D0O A;  4CFD A;  3FFK B;  2E4L A;  4FM2 A;  3EE8 A;  4FW2 A;  5BN8 A;  4CGG A;  2QTD A;  1J54 A;  3WQU A;  1WN7 A;  1RDC A;  3DJC A;  4GMJ B;  3AVJ A;  3QER A;  4CHQ A;  1C0T A;  1JL2 A;  4Y0W A;  3PX4 A;  4CZI A;  4A57 A;  3PO4 A;  3CM6 A;  3KKS A;  1JLE A;  1O1W A;  2W42 A;  4JK8 A;  1KCF A;  1VSJ A;  1NJW A;  3WXM B;  3L2R A;  3O5B A;  1YTA A;  1V4S A;  1Z25 A;  4E7L A;  4FM0 A;  3H1Q A;  4CK2 A;  1EO1 A;  3OVN A;  3E9O A;  1VSM A;  1VSI A;  4K8X A;  2JGU A;  4JS5 A;  5AQW A;  3DLB A;  5JLH A;  4B3T K;  4CZJ A;  2VQE K;  1GOA A;  3M8S A;  1RTD A;  3TAG A;  3T1H K;  3ZX2 A;  4H8K A;  4LH4 A;  3ZCM A;  2NNW A;  2E20 A;  2IGI A;  5A2Q O;  2DFH A;  4B1X B;  3VA0 A;  3K5O A;  4DQS A;  4JHD A;  3SUP A;  2G8U A;  3PV8 A;  4H0X B;  4LSN A;  4WQ5 C;  4N56 A;  2VG6 A;  2QXF A;  2KW4 A;  1WAJ A;  4DF4 A;  3H3N O;  4Y1D A;  4DQQ A;  1NK6 A;  4CF2 A;  4W5T A;  5AQF A;  1EET A;  1UA1 A;  4DTR A;  4MLE A;  1T7P A;  3QB0 A;  4B9V A;  1VSF A;  3AVM A;  3NE6 A;  2QWQ A;  3AVB A;  4PKI A;  1T03 A;  1VQN N;  1CXU A;  1KFS A;  3MDQ A;  4DLG A;  4L3Q A;  1IKY A;  1J9A A;  1BHL A;  3MN6 A;  1DTQ A;  2Q0R A;  5ELZ A;  4IG3 A;  3D2E B;  2E2O A;  4DR1 K;  2Z1H A;  3KKR A;  5IWA K;  1DLO A;  4CW7 B;  3KWG A;  2VWJ A;  4QS7 A;  3DLK A;  4CGH A;  4FJG A;  3PUF A;  3KK7 A;  2ZE2 A;  2CH6 A;  3KLG A;  3L4I A;  3KJV A;  1IV0 A;  3VTI A;  4EP4 A;  4Q5V A;  5KI6 A;  4CED A;  4QCL A;  3NH0 A;  2F9T A;  3WXL A;  1NGC A;  2Q1N A;  5I3U A;  1SL1 A;  1BQM A;  3VGK A;  4UY8 O;  3S3N A;  4JKD A;  1WAF A;  2GEM A;  2RE2 A;  1LWE A;  2A5X A;  5KPT A;  3O9T A;  3ZT2 A;  2G8W A;  1FJG K;  5ADX A;  3HXM A;  4E89 A;  4KBO A;  5KPZ A;  4KFB A;  3VQ4 A;  3QNN A;  3F9K A;  4OJR A;  4CEA A;  4Z4C A;  1Z6R A;  3TAB A;  4CJ7 A;  4Z94 A;  2YHA A;  4CK3 A;  2HBL A;  2GX9 A;  5LJW A;  3R9P A;  4DV5 K;  3OYE A;  1KAZ A;  1WSG A;  4RG8 A;  3GE1 A;  3L0Q A;  4WQ4 C;  1BU6 O;  4HCC A;  3NF6 A;  4JI8 K;  1GLJ O;  2KZM A;  4MO4 A;  4AF1 A;  2ASM A;  4CIF A;  1Q8I A;  2YNI A;  4GVE A;  4JKG A;  4YOT A;  4JD2 B;  4KHP K;  3UB5 A;  2KHO A;  3R8E A;  1KVB A;  3KTQ A;  1RFQ A;  3S9H A;  3THY B;  4M3T A;  2FXU A;  5JVH L;  1E4F T;  3G4S N;  1DEJ A;  4XH4 A;  4Z4F A;  1Q18 A;  4JEP A;  4IXC A;  1A5X A;  4E3S A;  2AJQ A;  2W6L A;  3FZF A;  3MCP A;  3L2U A;  4CEZ A;  4BRP A;  1S1V A;  2I5J A;  1JCG A;  3QFU A;  3V81 A;  2ZD1 A;  4KTQ A;  3P1G A;  3CXC M;  3ZSX A;  5JMV A;  3M5R A;  3O4Q A;  4FJJ A;  3I33 A;  3A5O C;  4CCH A;  3L3V A;  4J8F A;  3DI6 A;  3OYG A;  1KAX A;  4XEI A;  1OKJ A;  3CC2 N;  5AQK A;  3S3O A;  4BDZ A;  2CGL A;  2QWN A;  3QEX A;  4LFC K;  2OPP A;  2JWL A;  3PY8 A;  3G6E N;  3WQT A;  2HF4 A;  3ZT1 A;  3DOL A;  2E2Q A;  1HR0 K;  1NGB A;  4Z4I A;  4ZTJ A;  2GBZ A;  2KZZ A;  3J8A A;  1RT2 A;  1OH7 A;  4BRQ A;  3C6T A;  3TR8 A;  3E1Y A;  3M1F A;  4DSL A;  3KHY A;  2HHX A;  4JRP A;  3WNH A;  5E41 A;  1LCU A;  4RW9 A;  4CJU A;  1NKB A;  1D9F A;  2XO7 A;  2A6A A;  5C25 A;  1O13 A;  1NNE A;  3RRH A;  2Q0U A;  2HHU A;  4DFP A;  3ENO A;  4OKE A;  2OYQ A;  2KFN A;  1H1V A;  3KK2 A;  3LWL A;  3VET A;  4BR4 A;  1W2B M;  3HJF A;  4DSI A;  3ZT0 A;  4DV6 K;  4RCH A;  2F8S A;  2O8E B;  1IJJ A;  3THX A;  3EL2 A;  4B9N A;  3JSM A;  3LM9 A;  1BA0 A;  2NRX A;  2Z1G A;  5M1F A;  2OPQ A;  4FK4 A;  1HJR A;  3VEN A;  1TKD A;  4FK0 A;  1XC3 A;  3IAY A;  2P51 A;  1HYS A;  1REV A;  3VF4 A;  2UU9 K;  4ELT A;  5KRS A;  1GLD G;  1B9D A;  4F4K A;  4A2B A;  4H5N A;  4OPK A;  4J2B A;  4FXD A;  1XHX A;  2HMP A;  5E84 A;  1NGJ A;  3SQ4 A;  4KRF A;  2FSJ A;  4JI0 K;  1RBR A;  4C8L A;  1X9J A;  3NHG A;  4BRH A;  3EY1 A;  5J1E A;  1IKX A;  3BGR A;  3ULE B;  1VQ5 N;  3SAF A;  1QQN A;  1VRT A;  4CEC A;  3SZ2 A;  3OYL A;  2WC9 A;  1N36 K;  1D8Y A;  1OVY A;  2YHY A;  3VGM A;  1DKG D;  1WUA A;  2HND A;  4F2R A;  1IO2 A;  1ZXO A;  1A5W A;  1GLL O;  3L6Q A;  3DWL A;  1XI1 A;  3T69 A;  3NMU A;  4CI6 A;  2W40 A;  1CLQ A;  3CFO A;  5KTQ A;  1U04 A;  1T6D A;  4BRA A;  2P9P B;  1JLB A;  4A59 A;  3SUQ A;  4Q0B A;  3SJH A;  3K5M A;  3V9W A;  3ISN C;  2ATQ A;  4DQ8 A;  3THW A;  3NH1 A;  5BRD A;  5AQO A;  5M1N A;  2KTQ A;  4MDB A;  1TGO A;  3T19 A;  4DR3 K;  4RW7 A;  1NGD A;  2P9I A;  1RBS A;  4UQG A;  1M90 O;  1RT4 A;  3JS6 A;  4B1W B;  4LSL A;  4J2E A;  4FCY A;  3FE1 A;  4CZF A;  4DV4 K;  3CG7 A;  1NGE A;  1SL2 A;  4BG8 A;  3OYI A;  3V1O A;  3TAN A;  3J81 O;  4K8Z A;  3U3Y A;  1ILY A;  4E1M A;  2HNZ A;  3VQC A;  4FL9 A;  4JI7 K;  1SKS A;  4FWR A;  3MXI A;  4FVM A;  4B3R K;  1JCF A;  4W5Q A;  3P83 D;  2KQ2 A;  5EOY A;  1U45 A;  1EWQ A;  5AQG A;  3LDS A;  3CMA N;  5C42 A;  2A1R A;  3NF7 A;  4B9U A;  3AVN A;  3HVR A;  4CJT A;  4BQZ A;  1EKE A;  2HNY A;  3CET A;  4CBX A;  2D5R A;  4E7H A;  1RDW X;  3KLI A;  1TAU A;  2PAV A;  3LP3 A;  4IDH A;  4BDY A;  2BE2 A;  2ETJ A;  3K2P A;  4FLZ A;  3I0S A;  4H0T B;  4F2S A;  5MLC Q;  1L5U A;  4EZ6 A;  3MEC A;  3VQP A;  4HHT A;  4LF8 K;  3K5L A;  3RMB A;  2A1S A;  1S1X A;  5KPR A;  2HBJ A;  1OH6 A;  3P31 A;  5KRT A;  3VPZ A;  4OGE A;  5DMR A;  3QIC A;  2O8B B;  4JI1 K;  2NUB A;  3THW B;  3V9X A;  1KVC A;  2E1Z A;  1HJO A;  3CJB A;  1X9S A;  3AO5 A;  3M3Z A;  2PBD A;  3ZET B;  3EYZ A;  2B5J A;  1NJZ A;  4KHQ A;  2QWP A;  2O8D A;  1NWK A;  3UKU A;  4NYN A;  4LF7 K;  3MX5 A;  3O1W A;  3OYN A;  1S9G A;  4C8M A;  2GUP A;  5FPD A;  3TWH A;  4FJK A;  3TPQ A;  4BRF A;  4O4G A;  5BRE A;  1YI2 N;  3QIP A;  4DU3 A;  3LPU A;  1V4T A;  3D7E O;  2XRI A;  4CZH A;  5DK5 A;  2P9S B;  3KVG A;  4OPA A;  3HPH A;  4RWT A;  1Q82 O;  3LWM A;  5CYQ A;  3TTC A;  3RR7 A;  1VHX A;  3UE5 A;  4W5N A;  3ZEU B;  3SQ2 A;  2XY8 A;  4CZG A;  1X9W A;  3CIP A;  1TK8 A;  2QKB A;  3AV9 A;  4CHZ A;  3SQ0 A;  2P9K A;  4FOE A;  1TL1 A;  1C0F A;  2FBX A;  3NF8 A;  3DAW A;  4B1V A;  2D0B A;  5KGX A;  3CME N;  3UKR A;  4LF4 K;  1SS6 A;  3DMJ A;  5GIP A;  1TVR A;  4KV8 A;  1YUW A;  2KKZ A;  3V9S A;  4JN4 A;  1B9F A;  1NG9 A;  3HK2 A;  2NRH A;  3I8B A;  3SMS A;  2E1Y A;  3DLG A;  3NF9 A;  4IFY A;  3DRR A;  1YF5 L;  2YJF A;  3CCS N;  2O8D B;  4B08 A;  3SAH A;  2PY5 A;  1T6C A;  4MLH A;  3SYZ A;  2Q2R A;  2FF6 A;  3CF5 L;  1C1A A;  3HZ6 A;  1MU2 A;  4DU1 A;  3SPZ A;  3AAQ A;  3AO4 A;  4M7X A;  2UUC K;  4DWI A;  2CH5 A;  4HUG A;  4BRI A;  4IFV A;  3SJJ A;  3AVI A;  2YCH A;  3WUH A;  3ZX0 A;  4WFB L;  2XY7 A;  1ATR A;  3HOS A;  4LC9 B;  4CFC A;  2RPI A;  3DOK A;  3AY9 A;  2ZM6 K;  2QM1 A;  4FPA A;  4WYB A;  1VQ7 N;  3LDO A;  4ILJ A;  3ZSO A;  3QLH A;  3KD1 E;  4IKF A;  1KLM A;  3IKM A;  3P4I A;  4DS5 A;  2AP1 A;  4K0K K;  4GNI A;  3VEW A;  1LW0 A;  2G8V A;  3AVL A;  3J80 O;  4DQR A;  4FJL A;  1UWB A;  1U4B A;  3BF1 A;  3HTV A;  2HVI A;  5IT9 O;  3VQE A;  4AHR A;  3L2V A;  1RTJ A;  2IVO A;  1NGA A;  1W97 L;  3MAQ A;  3WXK A;  1C1C A;  2P9K B;  4AHT A;  2HF3 A;  2V7Z A;  3L2Q A;  4FZY A;  1X1P A;  3AA2 A;  4B1Y B;  1CXQ A;  3WXJ A;  2RF2 A;  2NRR A;  4NCG A;  5AJ3 K;  5M1O A;  4KRE A;  1LAV A;  1IG8 A;  3VEY A;  3O9S A;  2X74 A;  3AA3 A;  4H5W A;  2VYP A;  4FJM A;  4GV9 A;  3RSE B;  5AQV A;  3E66 A;  4BRN A;  1NMN A;  3RWU A;  2VCP A;  3A5N C;  3ZSV A;  1RBT A;  3LDQ A;  1TYQ B;  1JLF A;  1S1W A;  2GWK A;  1ASV A;  1BGX T;  2A41 A;  1BCO A;  4JKH A;  4WE1 A;  2IVP A;  4WQ4 A;  4DB3 A;  4B9M A;  2PFU A;  3MN7 A;  4PA1 A;  1K8K A;  3M8Q A;  3T1Y K;  2WOM A;  4CJK A;  3TTD A;  1VSD A;  3AVG A;  4R5P A;  4H0P A;  1RCH A;  3SK3 A;  4LF6 K;  3AVA A;  3AVK A;  3JAM O;  3BDP A;  3H3O B;  2W6K A;  3DXM A;  2G8F A;  3TAQ A;  1HRH A;  4OKJ A;  2HBM A;  2RHK A;  1S1U A;  2BH1 A;  1U2V A;  2ZQB A;  4NB4 A;  5FLX O;  4IOA L;  3CHW A;  2X78 A;  3U4L A;  1J5E K;  4M3Z A;  3HOT A;  3A5M C;  2FSN A;  2P9L A;  4RW6 A;  4KPY A;  4FWL A;  3OJS A;  4YOY A;  4FLV A;  3MWP A;  4OVL A;  4WFN L;  5BRH A;  1NJI O;  4KI4 A;  1Z26 A;  2BDP A;  1QHA A;  2O8F A;  2FF3 B;  2F9W A;  1VQM N;  3T1A A;  3FGU A;  5BPL A;  4FPB A;  4DTN A;  4B3M K;  5AZI A;  3QNO A;  2VG7 A;  3D6R A;  3KK1 A;  3IUC A;  4A2A A;  4OPH A;  1YT3 A;  1NBW A;  2YV0 X;  4CIG A;  2ZWH A;  3QEW A;  1NLV A;  5I42 A;  3C7N A;  1RDU A;  3CJ9 A;  2XY6 A;  4HUF A;  3K5N A;  4BRK A;  2VGM A;  3OYC A;  4FVU A;  4O8K A;  4A5A A;  3B6P A;  4BR9 A;  1JL1 A;  1VRU A;  1IG9 A;  1VSL A;  5AZJ A;  2YNF A;  3BF3 A;  3J7Z O;  2QA4 N;  1VSH A;  2I7N A;  2IS3 A;  2UXC K;  2ASO A;  3Q7C A;  4LD0 A;  2R7Y A;  1NOZ A;  2ITG A;  1J6Z A;  3VQB A;  4C8K A;  3VES A;  4CZL A;  4RTF D;  4YFU A;  4LFB K;  5F1X A;  4DV3 K;  1HKG A;  1HKB A;  5C2D A;  4IEI A;  4JHD B;  3MMV A;  3NH2 A;  4KHS A;  3VEV A;  4PKG A;  3BP8 A;  4FLT A;  4X64 K;  3WNF A;  4CJ3 A;  1JJ2 M;  4JRQ A;  4CF9 A;  2HST A;  1XMO K;  2IAJ A;  3AO2 A;  4CJ4 A;  1QSY A;  3ZSQ A;  3LDL A;  2UUB K;  1QQM A;  3KD5 E;  1TKX A;  3SQ1 A;  4BVP A;  4L8R B;  2P1J A;  2YHB A;  4I9L A;  3CFR A;  3ZX3 A;  4DTM A;  4CEQ A;  4DR2 K;  5BR8 K;  5CZ2 A;  1QQO A;  3OYB A;  4I6M A;  2KLA A;  4DFM A;  3OTO K;  4K43 A;  5J2M A;  4OLB A;  5HRS A;  5B8H A;  3GBT A;  3LAM A;  5BN9 A;  1QZ6 A;  4GKK K;  5AZI B;  1ZC6 A;  3U3G A;  3PSI A;  4JK7 A;  1NJX A;  1GOC A;  4FOI A;  4CJF A;  4JKA A;  1RT5 A;  1L3U A;  4KKO A;  2BTF A;  5FPE A;  1WNS A;  4HUE A;  1DGK N;  3P38 A;  3HL8 A;  4I7F A;  4I2P A;  4CEE A;  1ZBU A;  4BWJ A;  4BC4 A;  5AZJ B;  1N6Q A;  3LDN A;  4JI4 K;  1NK4 A;  2EWS A;  3ZSR A;  4B9T A;  3CD6 N;  1VK0 A;  1HNW K;  3CI5 A;  3V1R A;  3TAR A;  2P9N A;  4FWM A;  2OZS A;  1X9M A;  2FC0 A;  1B92 A;  4B8C A;  2P9U A;  2DY4 A;  1RDB A;  4CZE A;  1LW2 A;  4PUO A;  3N4P A;  1SV5 A;  4KH4 A;  3ZYY X;  2OTJ N;  2NRW A;  1SAZ A;  5AFU H;  4JYA K;  1KFD A;  4CBU A;  1ATS A;  3CCJ N;  4O0I A;  2X6S A;  3ZT3 A;  5HRN A;  4FK2 A;  4DV0 K;  2D0P A;  4CJL A;  3C6H A;  3Q7B A;  4ELV A;  1N5Y A;  2J4R A;  4JKG B;  2ZF5 O;  3VQ5 A;  4W5O A;  3AO1 A;  3G25 A;  1D9D A;  3ASM A;  2HHW A;  4V19 S;  4LF5 K;  2YHW A;  4PWD A;  4DTO A;  4ZHR A;  1I3A A;  3L4Q A;  1CZ9 A;  3VQQ A;  3OYF A;  2A40 A;  4YNQ A;  1N8R O;  3O08 A;  4TSX A;  4C8N A;  2A3Z A;  1BO5 O;  4LF9 K;  3C94 A;  1X3N A;  2JWK A;  3DLE A;  4EZ9 A;  1SUQ A;  4YDU A;  4BR0 A;  4JK9 A;  4BRO A;  4BG9 A;  4I9Q A;  1S5J A;  1MWM A;  4JI6 K;  4A62 A;  3OS2 A;  3MX2 A;  1S72 N;  1RT7 A;  1JLQ A;  5CZ1 A;  5TKW A;  4BRE A;  3LP2 A;  4ICL A;  5C15 A;  3F5T A;  3HSC A;  3HT3 A;  1TK0 A;  4GKJ K;  4CJR A;  3FZK A;  1VQ6 N;  5CE3 A;  4LH5 A;  3EO3 A;  2PYL A;  1VQO N;  3SUN A;  3DM2 A;  4ILG B;  3QFP A;  3LZJ A;  4GW6 A;  4BVO A;  3EEQ A;  1VAZ A;  1IH7 A;  2WFB A;  5J2P A;  1TKT A;  2IVN A;  4NLB A;  1KXP A;  1VQL N;  3KLH A;  2QWL A;  1NMD A;  4LY7 A;  4GVM A;  4NO7 A;  4CJS A;  3D0P A;  3C6A A;  3RVC A;  4YHH K;  3A8Y A;  1GLF O;  3EN9 A;  1GLE G;  5AQI A;  2QK9 A;  2IOC A;  1ZYQ A;  5GAG P;  2FSK A;  4N76 A;  3O9Q A;  1NJY A;  3SI6 A;  1BOT O;  2NLX A;  1W0H A;  1YIT N;  2UXB K;  1QTM A;  3EKU A;  3NGI A;  4JS4 A;  1BI4 A;  1N33 K;  1HX1 A;  3I55 N;  2QKK A;  3B8A X;  4HWI A;  4CFA A;  4DSK A;  4H0Y B;  1NM1 A;  1E3M A;  3THX B;  3PX0 A;  4CGJ A;  3K0S A;  2D4W A;  4GV6 A;  3VER A;  1HNZ K;  4M3W A;  4M3U A;  2RN2 A;  4IOX A;  2V51 B;  2D0C A;  4NLC A;  3MN9 A;  4EHT A;  4DTJ A;  1NKE A;  5GAE P;  4DTU A;  4B3S K;  3I56 N;  2OPS A;  1ATN A;  3ALY A;  4ID5 A;  3T3F A;  4KHN A;  3IG1 A;  3H1V X;  1RT6 A;  3CQX A;  5M1P A;  1C0U A;  1I94 K;  4E0D A;  1RBV A;  1RBU A;  3KZB A;  1YIJ N;  4FJX A;  3FZH A;  4AIL C;  3AAP A;  3TAF A;  3TAP A;  4CZM A;  4G1Q A;  4CEF A;  4IFE A;  3G10 A;  4DMN A;  2JLE A;  1QSS A;  2WUS A;  1S3X A;  1YJ9 N;  4BY9 C;  3M8R A;  2ITM A;  1Q81 O;  3LAN A;  5AQJ A;  1L3V A;  1BL3 A;  5HOO A;  4M3X A;  3OHR A;  4CJW A;  2I7P A;  1HLU A;  3VQD A;  2E5L K;  3MED A;  3QBX A;  2YKN A;  5AQS A;  1G15 A;  4DSJ A;  3O8M A;  4CJE A;  3FR0 A;  1QQC A;  4MO5 A;  5F2R A;  3WEE A;  2E88 A;  3JYT A;  4XH5 A;  3CCU N;  2P9I B;  4JKF A;  4CK1 A;  1I39 A;  4KTW A;  1U47 A;  2ZGY A;  1Q9Y A;  1HYZ A;  3CER A;  3OBW A;  2CGJ A;  3SPY A;  5AFU A;  3KWI A;  1KVA A;  3EE9 A;  3ITH A;  4FLU A;  3KIO A;  1T8E A;  4FJI A;  3LM2 A;  4IDK A;  4OGC A;  4FJ5 A;  3U8X A;  1QS4 A;  3OY9 A;  1HNX K;  2WBN A;  4KH5 A;  1GLC G;  4DKW A;  1LV5 A;  3O80 A;  3CFP A;  4CHY A;  5CHI A;  3C65 A;  3I0R A;  3PSF A;  1MDU B;  2F7T A;  2G8I A;  2VWB A;  3H45 C;  4O5B A;  3HST B;  3SBT A;  2E6L A;  3KLF A;  3HP6 A;  4E7K A;  3VQ6 A;  3PIO L;  4MDA A;  3MEE A;  3ZSW A;  5GAH P;  3QEV A;  3THV A;  5GIO A;  3IFR A;  3NVM A;  1Z05 A;  5C12 A;  5HRR A;  3U9D A;  5EY4 A;  1M1K O;  4DFJ A;  5H1S Q;  4C1N K;  3NCI A;  4M7Y A;  4AHS A;  1YJW N;  5FRO A;  4DTP A;  3D2F A;  3CJ1 A;  1JXE A;  4JLH A;  4DLE A;  3H46 O;  3PLA A;  1HNV A;  5D3G A;  4OO1 J;  2NZT A;  1QE1 A;  2DTU A;  2O4G A;  4DSE A;  4DV1 K;  1HNI A;  2FBY A;  5FRM A;  3B6O A;  3KLE A;  1N34 K;  1RT1 A;  3O9R A;  4M41 A;  4FLX A;  1Q7Y O;  4MQ3 A;  1VQ8 N;  4BDP A;  3SLC A;  1EX4 A;  1VQ9 N;  1TAQ A;  2Q3S A;  3O4N A;  4FJ7 A;  1T44 A;  4BR5 A;  4U7B A;  3O1B A;  4CJQ A;  3QIN A;  4WQ5 A;  4JI5 K;  1JLC A;  3UKU B;  2HHS A;  4FZZ A;  3CCL N;  5LMU K;  5CR4 A;  1NGG A;  2RKI A;  4FWK A;  4FM1 A;  3QES A;  5HLF A;  3GDQ A;  1CZA N;  4F9O A;  3VEO A;  3NVK A;  3CJC A;  4E7I A;  5AQM A;  1UOC A;  1NKC A;  2NRZ A;  3CCM N;  2PZS A;  2P5O A;  3O3H A;  3RTV A;  4BC5 A;  4DV2 K;  1VQP N;  4JI3 K;  1BIS A;  2YHX A;  2UXD K;  1K8A O;  3AAR A;  4IJA A;  2CGK A;  1EXQ A;  4U67 L;  5E26 A;  4F3O A;  4FJ9 A;  2H3G X;  4CF0 A;  4E7J A;  3FFI A;  1LAW A;  4YOX A;  1YTU A;  1DTT A;  1P90 A;  3BZC A;  1X3M A;  1C1B A;  3HP9 A;  5DM6 L;  5BPN A;  3A5L C;  3O3F A;  4DS4 A;  4CJP A;  1ZBL A;  4KO0 A;  3LPT A;  4G9Z A;  3T7Z A;  1QVG M;  4WFA L;  2G8H A;  3AGR A;  2EHG A;  4KTZ A;  4PKH A;  4KHW A;  5EX5 A;  3UKR B;  3ZSZ A;  2BGG A;  4OLA A;  5JVG L;  4BR2 A;  1J5O A;  3NGY A;  4BRC A;  5KGW A;  3V6D A;  3DXK A;  1L3T A;  2B6A A;  5T7B A;  4JI2 K;  2GTD A;  1ZBS A;  5J2Q A;  3GL1 A;  4O44 A;  2E6M A;  4X66 K;  4JKB A;  4BGB A;  4FLY A;  4FWN A;  2X6N A;  1LWC A;  3QET A;  4CJV A;  3PO5 A;  3VTH A;  5C2F A;  4K41 A;  4ID1 A;  4JKC A;  3EKS A;  1K73 O;  3D2E A;  1ZBH A;  4PL7 A;  3QDK A;  2AA4 A;  4AM6 A;  5GIN A;  2Y1I A;  2Q31 A;  1BG3 A;  4BGA A;  3TSP A;  4XIU A;  4QS8 A;  1S22 A;  4H5T A;  3UIQ A;  5FRN A;  3CPE A;  4O55 A;  2F96 A;  2E2P A;  4ISF A;  4DTS A;  3VGL A;  3HRG A;  3CCV N;  3NBP A;  3K58 A;  1WBD A;  1S6Q A;  4AHC A;  1EQY A;  2B4J A;  3C0B A;  3PIP L;  3TAE A;  1ASW A;  1Y64 A;  2IC3 A;  1XUP O;  4C23 A;  1IBL K;  3QBW A;  4DUZ K;  3VA3 A;  1OH8 A;  3EZ5 A;  4M3R A;  1JCE A;  1WSJ A;  1NK0 A;  2A42 A;  4FSV A;  3MN5 A;  1JKH A;  3WXI A;  3OYJ A;  1S9E A;  5KQD A;  1ITG A;  1RT3 A;  5GAD P;  4CBW A;  2ZJQ L;  1RTI A;  2OPR A;  1NK9 A;  3HPG A;  1GOB A;  2QI2 A;  1BUP A;  3WT0 A;  3R6M A;  4Z4E A;  4WCE L;  3O4W A;  4IBN A;  1U6Z A;  3W3D A;  1XWL A;  4YOW A;  4DV7 K;  4DTX A;  4A5B A;  4H03 B;  4KB1 A;  1LOT B;  3DXK B;  3OS1 A;  3ID6 A;  3BZK A;  4CEO A;  4DQI A;  3HM9 A;  4IG0 A;  2EX3 A;  2OA8 A;  5HL7 L;  5M1K A;  3CCR N;  4JAX A;  3HYF A;  4F8R A;  3IRX A;  4GY2 B;  4CFB A;  1SL0 A;  4MFB A;  5C0Y A;  1DT9 A;  4CER A;  5AQQ A;  5AR0 A;  2V52 B;  2HHT A;  1XNQ K;  1OVQ A;  1RGI A;  5AQX A;  4JD2 A;  4EIA A;  3VEZ A;  5AQL A;  4HVJ A;  3THY A;  3CQ8 A;  4BR7 A;  3K57 A;  3ID8 A;  1L3S A;  1J53 A;  1XC9 A;  3W0L A;  4DUY K;  1YXQ A;  4YY3 K;  1JLA A;  1K8K B;  5AQT A;  4IO9 L;  2P5G A;  4B3O A;  1NK5 A;  4FW1 A;  3ENH A;  5C10 A;  4J2D A;  2YX6 A;  4M3Y A;  3DXM B;  3L2W A;  1YVN A;  3S41 A;  3FZM A;  3CJA A;  4CEB A;  3OW2 M;  1U2V B;  1C6V A;  4H5R A;  4DG1 A;  4HTL A;  2P9L B;  3V9U A;  4YOV A;  4O8U A;  4RW4 A;  1WBB A;  1XMQ K;  2FLO A;  1D5A A;  2HMI A;  2IDO A;  1YJN N;  2HVH A;  3L3U A;  3OYH A;  5EU7 A;  1OH5 A;  4BQL A;  3CC4 N;  2O8F B;  3KK3 A;  4DR7 K;  5SZT A;  3RMC A;  3VEX A;  4CF8 A;  5AQH A;  2NRT A;  4IWV A;  3IDH A;  2QEX N;  1KQS M;  1BCM A;  4OX9 K;  4FJ8 A;  1BA1 A;  1YAG A;  4IEE A;  2GWJ A;  5M1Q A;  4W5R A;  3BY5 A;  4KHY A;  2BAN A;  1RDD A;  3C6U A;  3AGK A;  2HBK A;  3C7N B;  4B9L A;  5HBM A;  3QEP A;  3BEX A;  3CYM A;  5J2N A;  3AA4 A;  5I9E B;  2LSN A;  5JLF A;  3OJU A;  4M45 A;  5EVZ A;  1QVF M;  3IS9 A;  4NXM K;  4B1U B;  1C0M A;  1TUU A;  2OAN A;  2V7Y A;  3LAL A;  5AQU A;  2QWO A;  1HYV A;  1WB9 A;  2FBV A;  1MWK A;  2HB5 A;  4DU4 A;  5KQ8 A;  3EZW A;  1TV6 A;  4BRD A;  3F9M A;  1NGH A;  3MK6 A;  4NXN K;  3N4Q A;  1K9M O;  4FYD A;  3VOV A;  3ATU A;  3ATV A;  4CZK A;  2O8E A;  4CJ5 A;  1FKO A;  1HUX A;  4FWP A;  3LAK A;  4ELU A;  3TSU A;  1WSE A;  4CVN E;  5FDL A;  1GLB G;  1WOQ A;  1E4G T;  5LL6 Z;  3DYA A;  4EAH D;  3P5J A;  4I6M B;  3ZSY A;  4BRG A;  4IOC L;  5HP1 A;  5C24 A;  1W7A A;  1K6Y A;  3NAE A;  1XQS C;  3K9K A;  1NU0 A;  3WNE A;  3ULD A;  3SUO A;  1WSI A;  1HKC A;  4IZ9 A;  3AO3 A;  4KB0 A;  3AVC A;  1VQK N;  1NK7 A;  4CGI A;  3ULE A;  4H4O A;  5JIC A;  4NCA A;  4IO8 A;  2ZGZ A;  1TKZ A;  1GLA G;  3A0I X;  4FWS A;  1SQK A;  3CCE N;  4AHV A;  4GV3 A;  4HTU A;  3V1Q A;  1FXX A;  3AVF A;  3FLC O;  2VQF K;  3CC7 N;  3LP1 A;  1NGF A;  4CHN A;  1KRP A;  3L8B A;  5K14 A;  3ZLJ A;  2P9N B;  4H4M A;  5LY3 A;  4ZTF A;  2P9P A;  1KAY A;  2GUI A;  2XHB A;  2BUP A;  3CJ7 A;  4DF8 A;  2P9U B;  1EP4 A;  2HW3 A;  1IBK K;  1VSK A;  3WNG A;  4DR5 K;  4E1J A;  3TSQ A;  4PL8 A;  4B1Z A;  5BRF A;  3QO9 A;  4CGF A;  3HBT A;  4QS9 A;  1T3V A;  4CGD A;  3HI0 A;  3NGZ A;  3SNN A;  5FPM A;  3OA9 A;  4CIE A;  3DLL L;  1A5V A;  1SKR A;  1ESV A;  4FWQ A;  4OPJ A;  1QZ5 A;  5FPN A;  1RNH A;  3MXM A;  3I8D A;  3DRS A;  3VQ9 A;  2VGN A;  4O0J A;  2YNH A;  2WON A;  3CCQ N;  3S3M A;  3M6G A;  1JXB A;  2YNG A;  5CYM A;  4CD1 A;  1Q86 O;  3MWT A;  3OYK A;  3R3L A;  1YHQ N;  4H0V B;  1RIL A;  4NYF A;  4Y1C A;  3VMF B;  3F73 A;  2DFE A;  4AM7 A;  1BDG A;  4BC2 A;  4JV5 K;  4J2A A;  3P39 A;  4X65 K;  2E8A A;  2VG5 A;  4Z4G A;  3E9P A;  3QIO A;  4RW8 A;  5AQR A;  4AH9 A;  5JS1 A;  3ENB A;  2PYJ A;  1BIZ A;  2YJE A;  2YI1 A;  4FWO A;  4LFA K;  4PQU A;  4BRL A;  1U49 A;  3R1X A;  4Z0U A;  3GG4 A;  2O8B A;  4EHU A;  2D0A A;  4KAZ A;  3TTF A;  1W9H A;  4BAC A;  3QML A;  4N5S A;  4O5F A;  4NCB A;  1EWR A;  1WLJ A;  1BQN A;  3ZET A;  4PY5 A;  2HHQ A;  2UYT A;  1P8Z A;  1ZBI A;  5HRO A;  3CPW M;  4AQY K;  4M63 C;  1G99 A;  4DFK A;  1BIU A;  2F8T A;  2Z1I A;  3G0Z A;  2ASP A;  2O4I A;  4K42 A;  3TU5 A;  3AVH A;  4R79 A;  3AA5 X;  4ISE A;  4KHU A;  3RR8 A;  1LWF A;  5AQP A;  1QHT A;  3FZL A;  3O9U A;  3V9Z A;  4YDU C;  3VN5 A;  2QXL A;  2OCE A;  3VQ8 A;  4E1N A;  2P9S A;  3OS0 A;  2O8C A;  5BPM A;  3OYD A;  4CHO A;  1ZBF A; 
#chains in the Genus database with same CATH homology
 5AJ3 K;  2UXC K;  5LMN K;  1N33 K;  4DV4 K;  4DV0 K;  4B3T K;  4DV5 K;  2VQE K;  3J81 O;  4NXN K;  1HNX K;  4LFB K;  4DV3 K;  3T1H K;  4JI8 K;  4DV6 K;  1XNQ K;  4JI7 K;  4KHP K;  5A2Q O;  4DR4 K;  4B3R K;  4LF4 K;  4V19 S;  4LF5 K;  1HNZ K;  4X64 K;  4DUY K;  1XMO K;  4JI2 K;  2UUB K;  2F4V K;  4CVN E;  4YY3 K;  4B3S K;  5LL6 Z;  4LF9 K;  4X66 K;  2UU9 K;  3T1Y K;  1N32 K;  4DR2 K;  5BR8 K;  4JV5 K;  4DR6 K;  3OTO K;  2HHH K;  4LF6 K;  4JI6 K;  3JAM O;  4JI0 K;  4X65 K;  4GKK K;  4LF8 K;  2UUA K;  2UUC K;  1I94 K;  4DR1 K;  5FLX O;  4GKJ K;  4DV1 K;  1J5E K;  4LFA K;  5IWA K;  4CW7 B;  3J7Y P;  1IBM K;  3J7A P;  4JI1 K;  1XNR K;  1N34 K;  1XMQ K;  1N36 K;  2ZM6 K;  4DR7 K;  4JI5 K;  4LFC K;  4JI4 K;  1IBL K;  4B3M K;  4K0K K;  5LMU K;  4DUZ K;  4LF7 K;  4AQY K;  2VQF K;  4OX9 K;  2E5L K;  1HNW K;  4YHH K;  1HR0 K;  3J80 O;  5IT9 O;  1FJG K;  4DV2 K;  1IBK K;  4DR3 K;  4JI3 K;  4DR5 K;  2UXD K;  4NXM K;  4X62 K;  4JYA K;  2UXB K;  4DV7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...