1JLAA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
553
structure length
546
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 140
structure length 546
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlaA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlaA05
2HW3A 3I0SA 4EZ6A 2PZSA 4FM1A 1JXBA 4I7FB 4WFYA 3OYKA 1BGXT 3Q8RB 3S3OA 4O4GA 4E1NA 5L1IA 5KFOA 4RNMA 4YFUA 1RT1B 1S6QA 4NLOA 5DLGA 4CHQA 2XY7A 2G8FA 3MR3A 5KG2A 1SH3A 3CG7A 4CJ5A 4IQXA 1JX4A 3VQPA 3L2VA 1NKEA 1LWFB 2XY8A 1J9AA 4FJGA 2YNIB 4KTQA 5KG7A 4DL7A 3AVCA 4L8RB 5KG1A 5KFYA 2OZMA 3CM5A 4QWCA 4LQ9A 4CEAA 2HVIA 5F8MA 3LPTA 2XI3A 4M3TA 2ETJA 1JKHB 3UPFA 1RA6A 1NJYA 3KLHA 2ASJA 1DLOB 3V1QA 1JLCB 3T5LA 3SZ2A 4IH6A 3OYEA 1LW0A 2E4LA 2W9BB 5EU7A 3ZCMA 3KLHB 2V4QA 4DSFA 4FZYA 3AO5A 5CYMB 3UIQA 3MXJA 3MAQA 2QKBA 3AA2A 4J2EA 3OLBA 3BR9A 1LW0B 3QLHB 2W42A 3AVJA 3TQ1A 4HUGA 3QEPA 4FVMA 1UA1A 1JLBA 4YP3A 5HP1A 2ATQA 5L1LA 1U09A 1ASUA 1DLOA 1SKWA 2AGQA 2AU0A 2DPIA 2ZE2A 1KHWA 4PWDA 3RB6A 1JKHA 3NAEA 1EP4B 1RILA 3RAXA 4CJ4A 1BISA 4H4OA 4DFKA 1VRUA 4FLXA 1DTQB 4ECVA 3O4NA 3LWMA 3FQKA 2ZD1B 3N6LA 3QEIA 3T19A 4RW8B 1Q9XA 5E41A 2VWJA 3RR8A 2YNFB 3DM2A 1S1XB 4NLTA 3D45A 3OYBA 3IGNA 1SV5A 3ZSOA 4W5RA 4NRUA 1C1CB 4DL5A 4DG1B 2OYQA 4CF0A 4OJRA 4URSA 3K5MA 3QEWA 5KFZA 1L3TA 1W9HA 2VA2A 4KHRA 1ZBFA 2W7PA 2HNDA 2FJWA 1VK0A 3HYFA 2IM0A 1TKTB 1RDBA 3S3NA 1N4LA 4Y3CA 3KTQA 5HLFB 4ELVA 3ZSYA 4KHSA 4ECWA 4DQRA 4NZ0A 1RTIB 3QIPA 2HHWA 4WXWA 5SWMA 1HNIA 4CK2A 2FBYA 4QWDA 3ZSQA 1KCFA 1NK0A 5KFPA 4N5SA 4CGJA 4TXSA 2PY5A 3Q8PB 1C1BB 1LW2A 3ZSXA 4FW2A 1RCHA 3NH1A 1WAFA 3DOKA 3UR0A 4CCHA 3TI0A 1RT7B 1HQEA 4IRDA 2FVQA 4KKOB 2VWKA 1A5WA 3NGIA 4YQWA 4KPYA 1NHVA 4FLWA 1IKVB 3NBPA 1SKSA 4CFDA 3NCIA 3OYAA 3FFIB 3V81B 1ASVA 4B8CA 4PUOB 4IR9A 4FLZA 5KFRA 2X6NA 1MU2A 1F21A 2WONA 4YMEA 2R2TA 4PUOA 2DFHA 4JLHA 1C0TA 3MR6A 3NBPB 1TQLA 2W8KA 1NJWA 4JRPA 1NJZA 2FJXA 4TYAA 3B6PA 4ZP9A 1X1PA 4DQPA 2IMWP 4FJKA 3O3FA 3SV3A 3V6JA 1IO2A 3MFIA 3ZT1A 3LP1A 4QOZB 3LP2B 2C2EA 3PZPA 3KNAA 3OY9A 4FK2A 3BSNA 2KFZA 4WFXA 3E01A 3ULDA 4DFJA 2RF2B 3BGRA 2LSNA 1QTMA 3NF6A 4E7JA 4KV8B 3RTVA 4IRCA 3H4BA 3RR7A 4K4ZA 2XCPA 3DLEB 4AHCA 4DSIA 5KG3A 1EP4A 3CM6A 3SFGA 1JLAB 1NK6A 1UWBA 1R0AA 1U04A 1ZBLA 4ECXA 1S1WB 4TY9A 4FCYA 5L9XA 1DTQA 3OYLA 3CYMA 1I39A 3TAFA 2BE2B 2DFFA 3DLEA 2OPQB 4CF9A 2ALZA 5KFJA 1UAXA 4DL3A 3MECA 4ID5B 5KRSA 4PQUB 4FLTA 1D1UA 1XI1A 3E01B 3VQSA 2W9AA 1VSIA 1WSEA 4ZHRB 3VA3A 3ISND 5I42B 2ZE2B 3UQSA 2ITGA 3AVBA 3HVTB 4KRFA 4TQRA 2FC0A 1K6YA 1IKYA 4F4YA 4CHOA 1JLBB 2C22A 4NLQA 4NLRA 2G8KA 3JSMB 3DOLB 4J9MA 4DF4A 4EO8A 4Y34A 4IDKA 1XC9A 3V9XA 3OLAA 3SQ4A 1HARA 4DSKA 5J2PA 1T05B 4K8XA 1DTTB 5DK5A 4M41A 4HCBA 3AV9A 3HM9A 3L2QA 3OYDA 4LSLA 3TARA 2KZZA 4JS5A 3PW0A 4ECYA 3EYZA 1WNEA 3AO2A 1RTDB 4O3QA 4J9KA 4K8ZA 1SUQA 4KFBB 2KW4A 4Z4IA 1QE1B 3K5NA 4O5BA 1HQEB 1SUQB 2EX3A 1RDDA 2BGGA 4ZP7A 1VSMA 2J6UA 3ZT2A 3OSPA 5CZ2A 2D41A 5F8LA 1C1BA 1LW2B 1NOYA 4MK7A 1ZBIA 1VSHA 1QAJA 4BE2A 1OS5A 5EWGA 1T03B 4IG0A 1JL1A 1S1TB 2GC8A 3CFPA 4J9SA 3AA5X 1IG9A 1HNIB 4WXOA 4K4UA 4E19A 3NAIA 1REVA 2X74A 2Z1GA 1TL1A 5KG4A 3O3GA 4CIEA 2RDIA 1SL2A 3KLVA 3WNGA 4O4GB 3RB3A 1BCOA 1QQCA 3KD5E 1FK9B 5KT2A 1QS4A 3QIOA 4FXDA 5KFIA 4O0IA 3K5OA 4Q5VA 3TAQA 5JS1A 4C8NA 2JEFA 1GOAA 1S5JA 2R8IA 1T94A 5KG5A 5KFQA 2YKNA 3OHBA 1C1CA 4CESA 5T14A 4CHPA 3LWLA 5F9LA 2BQUA 1YTAA 3BSCA 2ASDA 1KRPA 4NRTA 2BRKA 1WSHA 2FVPA 3JYTB 2IOCA 3RMBA 3RMCA 3HVRA 2E6MA 2IBKA 1HYZA 3PV8A 4FLYA 2XO7A 4KTZA 1FKPB 4CEBA 4TY8A 5KFNA 4H4OB 1RAJA 3HVWA 3EZUA 4KHMA 3AVIA 3AVLA 3LP2A 1X9MA 1RT4B 1HNVB 2UUWA 3KLFB 4FJ5A 4E89A 2RN2A 3V9ZA 1J5OA 3G6XA 3GIKA 3I0SB 4LQ3A 4J2AA 3MR2A 1L3SA 1WN7A 4M3UA 3E51A 2W7OA 1RNHA 3L2UA 3HT3A 4IKFA 1EETB 3M9NB 1B9FA 2GBZA 2IGIA 5KFBA 5KFKA 4DTSA 2FLNA 3KJVA 1KLMA 1ZYQA 3H5SA 4M3RA 2I1RA 3S9HA 1TAQA 3HO1A 4WE1A 4EP4A 4ED3A 4CFCA 4MK9A 4CF1A 1IKXA 1HQUB 5K14B 3ITHA 3OS1A 1T03A 4EBEA 3JSMA 1TKZA 3PW2A 3BSOA 2QV6A 4MKAA 3SUPA 3MXIA 1HJRA 4DF8A 3OYFA 3SQ2A 5J2QB 2IC3B 5F8HA 1HMVB 5F9NA 3OS0A 4R8UA 5HRNA 2FBVA 3MECB 4N47A 4GVMA 3V1OA 2Y1IA 4KSEB 1X9SA 1VSDA 2IJFA 1HPZA 2G8HA 2YNIA 1TV6A 4CERA 5KFUA 4NCGA 3ZT4A 3M8PB 3M9MB 3H5UA 2VG6A 4ICLB 1S0OA 2AX1A 4RW6A 3P1GA 4MIBA 1JXEA 4KV8A 4J9PA 3QNOA 4CHZA 3KK2B 1RT1A 1XHXA 2YKMB 4RW7B 4DL4A 2BDPA 3G10A 3LP1B 3VQ4A 4CF8A 3CJ3A 3HVTA 4IH5A 4RW9B 1D8YA 4FLVA 2JEJA 1KVCA 4LH5A 4PQUA 3LAKA 4NLVA 2X6SA 2W9CB 2FVRA 4RW6B 2WONB 2OH2A 1L5UA 1S1WA 3SPYA 4GC7A 1UWBB 1S1VA 1TV6B 1S9EA 3OYGA 3KLEA 1NJXA 3LZJA 1HRHA 2DY4A 2GIQA 3TAMB 4ED8A 2G8WA 1N5YB 1W0HA 3AO1A 3MEDA 4EZ9A 4BDYA 4F2RA 2J6TA 2RKIB 4DS4A 3BREA 1TVRA 2IAJB 3QEXA 4ELUA 3AVAA 4Y2CA 4FJLA 4MFBB 3TR8A 3KHGA 2X78A 4NLYA 1C0UB 2F96A 4F4WA 3C94A 3ZSZA 4WE1B 5J2NB 5C42A 3RRHA 3QIDA 2ILYA 2D0AA 1TKXB 3VQ8A 5EWEA 3QO9A 4DTJA 4FJJA 3H98A 1KTQA 4AHSA 1KLMB 3KD1E 4QPXA 3BJYA 4DTMA 4IR1A 3V9WA 2WK4A 2XCAA 2XY6A 1RT3A 4DSLA 3IRXB 1U49A 1U47A 1IH7A 3L3UA 3VQCA 4I9QA 3SCXA 1JLGB 2BANB 3P5JA 1UA0A 1YTUA 3SUNA 4CF2A 4J9OA 5C24B 3NHGA 2F8EX 1C0UA 4M3YA 3O3HA 4B9MA 2XGQA 5I3UA 4DTOA 4RW4A 5KFMA 4DQQA 5KFEA 1BI4A 5CYQB 1XWLA 2IAJA 3AVMA 1D9FA 3OYIA 4CEEA 3V6HA 1BL3A 1S6PA 4E3SA 4ZPDA 2HNYB 2YNHB 4RZRA 3PX0A 3FQLA 4KTWA 4CEQA 3LALA 3DRPB 3CJ2A 1YVUA 2D0BA 2GV9A 3NFAA 2JLEA 2R8JA 4NLWA 4O44A 1B92A 2QK9A 3QESA 5HBMB 2EHGA 2VG7A 4AHRA 3C6TA 3TWHA 2HHUA 4R5PA 1SH0A 3DRSA 2NUBA 3KIOA 3HP6A 2IM1A 4CJFA 3QEVA 1LWEB 4GC6A 1GOCA 1N6QB 5HP1B 3WNHA 1S10A 1BHLA 4CFBA 3ICLA 3MEGA 3DOLA 2B6AA 3CIZA 2FLPA 2OPSA 2G8VA 1MMLA 4B8AB 4RW9A 2OPPB 4FS2A 5J1EA 1C6VA 4K4WA 1EX4A 3K58A 5FRNA 3MEEB 5KFVA 2HHVA 5DQGA 2HNZB 2W9BA 3MEDB 3PUFA 4R5PB 4F8RA 4CJSA 4IRKA 3AVNA 2VG5A 4PY5A 3PO5A 5KFCA 4DLEA 2OPQA 3NGYA 2EC0A 2XHBA 3T5KA 5KFAA 3KLEB 4NCBA 4KB7A 2HMIA 1QE1A 1N56A 4JV2A 3DI6B 2DTUA 1Y97A 2A1SA 2D7SA 4CGHA 4Z4CA 3IS9B 2R8HA 3VQBA 1JXLA 5L1JA 2Y1JA 5HROA 3TAPA 2OPRB 4U6PA 2O4GA 4W5TA 3LAMA 3SPZA 4HYKA 3H40A 2Z1HA 1LWCA 3PW5A 3T3FA 4URGA 4CHNA 2IM3A 4CJ3A 4ED7A 3VQ7A 3DLGB 4ZTFA 4OKEA 2JC0A 4Q8EA 2B5JB 3P83D 1S4FA 3DLBA 4MK8A 4B9VA 4RNOA 4FJ9A 4KHYA 4H8KA 2FJVA 3DYAB 4O4RA 3IGVA 4HHTA 1Q9YA 3RWUA 4CIFA 1NKCA 3IN5A 2ZKUA 4Z4GA 1VSEA 4EEYA 1TAUA 2J6SA 3DLRA 3NH2A 3RMAA 4QW8A 3KMQA 1RT2B 1TKXA 2XC9A 2D3ZA 3M8RA 3D5MA 4IKAA 1JLQB 1IKWA 3HL8A 4F4ZA 3U6FA 1RTHB 2UVUA 4CJRA 2BE2A 1KSPA 1KVBA 3NF7A 4O0JA 3V9SA 4M45A 5FDLB 3PX6A 5DGBA 4FS1A 4DMNA 1TK8A 3NDKA 1D0EA 4FJHA 4J2DA 4QWBA 3I5BA 1CXQA 5FROA 2BRLA 3DOKB 4KREA 1BQMB 3EPIA 2R8KA 1FKPA 5C25A 4CHYA 1NK8A 2XWYA 5KFSA 2WOMB 3SYZA 3K5LA 3KHRA 2HWHA 4FBUA 4K4VA 4K4TA 4DU4A 3VQ6A 5JS2A 3NMAA 1WSIA 3QNNA 1C0MA 1NK4A 3OL7A 3L2RA 1B9DA 4O3NA 4CEOA 4CEZA 3SI8A 4Q8FA 4HUFA 2I5JA 3H08A 4W5QA 1TP7A 2HHXA 3BQ0A 4B08A 1LWEA 4KHWA 3SNNA 3I5AA 3B6OA 4CJTA 3HP9A 5L1KA 4OKKA 3I0RB 4FLUA 4I2PA 3I0RA 3QINA 1UOCA 4DTXA 1WAJA 4ECTA 3V9UA 2DFEA 2WTFA 1S0MA 2YNGB 3DLHA 3KHLA 4MKBA 4MH8A 1RDRA 3RB0A 2GIRA 1S97A 2I5JB 2JC1A 4FJXA 1BQMA 3PO4A 1NOZA 5CY4A 4YR0A 1CXUA 1S9FA 1WSFA 5D3GB 2OPRA 5JXSA 4NYNA 2R2SA 4FZXC 2XI2A 1BCMA 4DEZA 3U3GA 4CGIA 2YHBA 1IKWB 4U7CA 1C2PA 4KE5A 4ZVHA 3L8BA 4UQGA 4FJ7A 4J2BA 4BDPA 3GIJA 3HK2A 1TL3A 1KHVA 4KO0A 2ZQBA 1KFSA 2VG5B 3CWJA 4NLDA 5KFTA 3PR4A 3OSNA 4NLXA 5KFFA 3NL0A 2HNDB 5J2PB 5EUHA 4FBTA 4DQIA 2P5GA 2HNZA 5HRRA 3QETA 1YT3A 3RB4A 1RT2A 2B5JA 4XPEA 3NAHA 1WNSA 3KJVB 5HROB 3OVNA 1S1XA 3AVFA 3AVGA 4K4YA 2WB4A 5DG9A 4C8LA 1EETA 3FRZA 2FBXA 3WNEA 3KHHA 4CECA 4FJNA 3TAEA 2YV0X 4AILC 1J5OB 4QCLA 3H4DA 4CJKA 3T1AA 3KK3A 1VSLA 4KFBA 4EBDA 1RTDA 1S9GA 4CJUA 4DFMA 1LWFA 2YNHA 4NLUA 3C95A 5EWFA 4ZMMA 4RUCA 3RRGA 2G8UA 1GOBA 1JIHA 1QSYA 1JLFB 3AO4A 4IFYB 4JRQA 4Z4EA 1L3VA 2Z1IA 3RAQA 1BI4B 3QGGA 4JV1A 5J2MA 2C28A 2OA8A 1C1AA 2E9RX 1BIZA 2IA6A 4ZVEA 4C8KA 3OHAA 5J1EB 4RW7A 2IJNA 1L3UA 3KK1B 2YHAA 4XO0A 4O3SA 2OPSB 3DDKA 3VQQA 4N41A 1JLCA 3OYHA 1BQNB 4HVJA 3OJSA 2C2RA 3DLKB 3FDSA 4YR3A 3HPHA 4GMJB 3EPGA 2R7YA 3QO9B 2D5RA 1REVB 3NE6A 1CZ9A 2HNYA 1JLEB 4LH4A 2V9WA 3M8PA 4XPCA 4FJMA 3FFIA 1JLAA 5KT4A 1ZTWA 1TGOA 3D28A 3C6TB 2HB5A 3N6MA 5KT3A 3IAYA 4CK1A 3VQ5A 3SJJA 5HBMA 4X2BA 5F8GA 1QSSA 2Q3SA 1TL3B 4K50A 1VSKA 2P51A 4M42A 1VRTB 2P5OA 4ECUA 4G3IA 1T7PA 1S49A 3EY1A 4AH9A 3C6UA 2CKWA 1WSGA 4Q0BA 4E1MA 3GIIA 4Y1DA 1WLJA 4W5NA 4WZMA 3HPGA 3KOAA 5EDWA 1A5VA 1NK7A 3LP0B 4OLAA 2HHSA 3LZIA 5CYQA 5D3GA 4KAIA 3NF9A 1A5XA 1BIUA 4H54A 4J9RA 4ECZA 1HYSB 3QYYA 4ED0A 3TAGA 2BANA 1RBSA 4BWMA 1JLGA 4HKQA 4NYZA 4WFZA 4LD0A 3KKRA 3HSTB 1RT3B 3OL9A 3PX4A 2CJQA 2AQ4A 4IOBA 2R2UA 1X9WA 2XRIA 3QZ8A 4F4XA 4OPJA 3CVKA 4MFBA 2R2RA 1K1QA 4QW9A 5JUMA 3A2FA 4OL8A 1TKDA 4F4KA 1HYVA 1S1UB 3OYJA 4BE1A 2RKIA 3V6DB 2FBTA 4EBCA 1D9DA 1RT4A 1SL1A 5C42B 5KGWA 3ISNC 3SV4A 2WOMA 5DG7A 3FSIA 3G0ZA 4IG3B 3NH0A 2AGOA 4J9QA 1LV5A 1LAWA 4B9SA 2E9TA 1RTJB 3KLGA 3AVHA 3DRRB 2XY5A 5KFGA 2JEIA 4FM2A 4CK3A 3SFUA 2YNFA 4IFYA 1IM4A 1WSJA 1CZBA 3ZT3A 5KFWA 3SQ0A 2QKKA 5FDLA 4RNNA 4LSNA 3DRRA 4CJPA 4RU9A 1HPZB 1O1WA 5HLFA 4M95A 3HJFA 3OL8A 5DLFA 4O55A 3CJ0A 3M8SA 1VSJA 2PYLA 4TYBA 2BR0A 4FK0A 2D3UA 2GUIA 4R8UB 2ATLA 3D0PA 4FYDA 3QGHA 3KK3B 3BQ1A 4TN2A 1I6JA 4I2PB 4BACA 1RBUA 4E7LA 4AHVA 4C8OA 2UUTA 4CJEA 4YR2A 4ZPAA 3DYAA 1QAIA 3V4IA 1S48A 4ELTA 4FM0A 2HAIA 3ITHB 3H5YA 1FKOB 1C0TB 2AJQA 3LANA 2OZSA 3DM2B 3NF8A 4DL6A 1CSJA 3UDLA 3WNFA 4IG0B 1U48A 5KGXA 3VQ9A 2HWIA 5KT5A 4E7IA 4NCGB 3MR5A 3ASMA 4M3ZA 3NGDA 1IKVA 3SI6A 4ZP6A 5C25B 3KK2A 4CE9A 3IG1B 1SH2A 4J9NA 3C6UB 4ZTJA 4OLBA 4IBNA 3PJXA 4KKOA 3K59A 4DS5A 4CEDA 4OKJA 1VRTA 3I5CA 3M8QB 1RA7A 3QGIA 1RYRA 4WZQA 1XR5A 1TK0A 4DSJA 3PR5B 5KTQA 2IDOA 3H5XA 4CIGA 4Z0UA 3IG1A 2HHTA 2ASLA 5HRPA 5DMRA 4Q45A 5KFDA 4W5OA 4DU3A 4F2SA 3VN5A 4ZPBA 4B9LA 1JLEA 4CJLA 3MEEA 4ECRA 4RNFA 2HMIB 3CDUA 4F3OA 2B4JA 3OL6A 3T5HA 4FZZA 4ZPCA 1ITGA 4O3OA 1RTJA 3HVAA 1G15A 3CDWA 1T8EA 2F8TA 4CJQA 3N6NA 4PA1A 3G86A 1N6QA 1TKZB 1IKYB 4IFVB 3PVXA 2AWZA 5SZTA 4ECQA 2V4RA 4KI4A 3V6DA 3RBEA 3VQDA 4ED6A 5HRSA 3ZSRA 2BQ3A 3GIMA 3KLFA 3BSAA 4QWEA 3PW4A 2FVSA 4JS4A 4WYLA 4E7KA 1ZBUA 3CFOA 1ZBHA 2V0NA 4URQU 3DRPA 4K4SA 1KLNA 4C8MA 2KZMA 4EYHB 1JLFA 4HTUA 3TANA 1S6PB 1U4BA 5T7BA 3H59A 3DRSB 4DTRA 1S1TA 4HUEA 2VG7B 2E9ZA 4KHNA 2QE5A 4NLPA 3CJ4A 4RUAA 2HHQA 4OPKA 4O44B 1S6QB 4KB0A 2RF2A 2UVRA 1RT6A 5KT6A 3KKSA 3MTKA 1JL2A 1VRUB 1ZETA 1RT6B 4IG3A 4DU1A 2C2DA 5DG8A 1U45A 4B9NA 3GV7B 2RPIA 3CJ5A 4BE0A 4ZP8A 3RBDA 4PWDB 4R0EA 4Q44A 2UVVA 3IRXA 3F9KA 2OPPA 5KRTA 4HCCA 1T3NA 3RMDA 1LAVA 4LSLB 2HVHA 2F8SA 4J9LA 3MEGB 3QZ7A 1RTHA 4M3WA 4TSXA 1D5AA 1GX6A 5C24A 3QLHA 1EKEA 4DTNA 2RDJA 4M94A 4CGGA 1MU2B 2YKNB 3G6VA 4ED2A 4Z4FA 3BDPA 1RT5A 4F3TA 1J53A 1XR6A 4I9LA 4KBIA 2QXFA 4QAGA 1FK9A 3CFRA 3LP3A 1SKRA 1TVRB 4O3RA 3AO3A 3GV5B 1CLQA 3MF5A 1RBVA 1TL1B 4MIAA 4AHTA 4NCAA 4OGCA 3DLGA 3SQ1A 4I2QB 4RG8A 2B43A 1LWCB 3VA0A 4ID5A 1NK9A 4KB1A 4DFPA 1NHUA 3V1RA 3KLIB 3IS9A 4KI6A 1S1VB 2UVWA 2R8GA 3M8QA 4Q43A 1T05A 3VQAA 1N48A 2AX0A 4DQSA 3QIPB 1S0NA 2VA3A 2IS3A 4XIUA 4BDZA 1GX5A 1RDAA 5KG0A 1ASWA 2W9CA 3TAMA 1QSLA 3TVKA 5CZ1A 4Y1CA 1ZTTA 2O5DA 3DLKA 3CO9A 1S9GB 3ZSVA 4ZVFA 4E0DA 2WRMA 3ALYA 1DTTA 3GV8B 3VQEA 2XGPA 3HHKA 2G8IA 2W8LA 5F8NA 5I42A 4NYFA 4IFVA 4DG1A 2YKMA 5J2NA 3LPUA 4IDKB 4ZVGA 1Z4UA 1FKOA 3OYMA 3THVA 1SV5B 1NKBA 1K1SA 3ZSWA 5J2MB 4H4MB 2KFNA 4ICLA 2VG6B 4GW6A 4F50A 3OJUA 2IM2A 4FJIA 5KT7A 1KVAA 1VSFA 3V6KA 4G1QA 4ZHRA 3GYNA 4N56A 1NK5A 3GILA 3NGZA 4RNHA 4TQSA 3BQ2A 5FRMA 4KO0B 5KG6A 2WHOA 4WYWA 4OVLA 3T5JA 3G6YA 2JGUA 3HXMA 4AHUA 1HMVA 1S9EB 4G1QB 2IC3A 2JEGA 1RT7A 4B9TA 1Z26A 3L3VA 4DTPA 4B9UA 4LSNB 5KFHA 1R0AB 1XHZA 4M3XA 1Q8IA 4CJWA 3KLIA 4FK4A 2Z1JA 3KMSA 2A1RA 2FVCA 3KLGB 1NNDA 3DMJA 4B3OB 5F8JA 3AA4A 4CFAA 2KTQA 3BGRB 4RW4B 4I2QA 5KFXA 2AGPA 5C5JA 5I3UB 3PHEA 4CGDA 4ED1A 4FW1A 4N76A 3K57A 3HKWA 3MXMA 4KAZA 5CYMA 1RDCA 4O3PA 5J2QA 3PW7A 3AVKA 1TK5A 3OS2A 3K2PA 3GQCA 3H2LA 1Z25A 1RBRA 3V81A 3Q8QB 4YNQA 3Q8SB 3V4IB 3PJWA 4IH7A 1J54A 3SUOA 3CDEA 4MQ3A 4DL2A 4ID1A 4Y2AA 3LDSA 1RT5B 4FJ8A 1QHTA 3QERA 5KI6A 4E7HA 4DWIA 2ILZA 4QWAA 2O4IA 1HYSA 3MFHA 3I8DA 2BQRA 3HPOA 4NLGA 4KHQA 4DSEA 4JV0A 4CGFA 3EZ5A 3SUQA 4NLSA 3DMJB 4B3OA 3L2WA 3LP0A 3F73A 5F8IA 3TABA 3DI6A 1QUVA 1KFDA 2PYJA 4Q0BB 1FXXA 4RW8A 2ZD1A 4TLRA 1HNVA 1SL0A 1XR7A 4OGEA 1YVFA 1N5YA 4TY8B 3M9OB 4EYIB 3S3MA 2KQ2A 3OYNA 4K4XA 3PY8A 2YNGA 3OYCA 4I7FA 1EXQA 3AA3A 4DLGA 3ZT0A 3O4QA 3U3YA 3JYTA 5KFLA 1HQUA 1IKXB 5K14A 1S1UA 4CEFA 2DPJA 4CJVA 1W25A 5DGAA 4EP5A 2E6LA 4ECSA 1RTIA 1RBTA 4KHUA 2WCXA 4EO6A 2B6AB 3NKYA 2FLLA 4H4MA 5DQHA 4JUZA 1I3AA 4DTUA 4LY7A 2D0CA 1BQNA 4Z4HA 5DQIA 1JLQA 1TKTA 3KK1A 4BWJA 3CQ8A 2P1JA 1RYSA
chains in the Genus database with same CATH superfamily
2HW3A 3I0SA 4EZ6A 2RUSA 3Q8RB 4LC9B 2ZITA 2P9UB 2HVDA 5KFOA 5E5NA 1RT1B 4DUZJ 1M5HA 2KDOA 4DV6F 1HD1A 4DR1K 2PO4A 2G0CA 2XY7A 3ATUA 5KG2A 5AZIB 3KJNB 4DV5F 5AQSA 3R6GB 4FJGA 1RI7A 2YNIB 1FRIA 2AHOB 2EFOA 5KG7A 5KG1A 3CULA 3VGLA 2OZMA 3MUMP 4C11A 3VAFA 1NPKA 2OTJN 4LIRA 1QAYA 3AT1B 1JKHB 3UPFA 1B70B 2H9ZA 3V4MA 3IBWA 2O8DB 4MYUA 2ASJA 4YDXA 3RGIA 1VI7A 4MDAA 3T5LA 3MM6A 2PMZD 3T41A 3AXMA 3SZ2A 3OYEA 5D4LA 3ZCMA 3KLHB 2W4DA 2V4QA 4NOHA 4FZYA 4ED5A 4J8FA 5CYMB 4WP3A 2YJFA 4BRCA 3C16B 1LW0B 2BABA 5IV4A 2YX1A 1UA1A 2C3YA 4GVBA 5AQKA 3CT9A 4FSVA 5L1LA 3CCQN 3NGKA 4JKAA 1IBLK 1DLOA 2V4JB 5HOOA 4JI0J 2ZE2A 2QIFA 4PWDA 3NAEA 2DNKA 2J9DA 4P9SA 2DGVA 5J1PA 1X8DA 4H4OA 2MGZA 4DFKA 4WK1A 1E6VB 1DTQB 3RG6A 3O4NA 3LWMA 2XS5A 1S6UA 3VQTA 4WFNQ 5AQXA 3N6LA 2J0XA 3QEIA 3CD6S 1N32K 1M1KT 3G6ES 2HIYA 4LVOP 3QRRA 2G9OA 5IC6B 4DDFA 4ETXA 1S1XB 4NLTA 1BU6O 3D45A 5CD4H 2OMOA 1SV5A 4OYOA 3ZSOA 3THYB 1IWAA 1C1CB 3LQVA 4CF0A 3K5MA 3KWGA 5KFZA 1W9HA 3VAHA 3OVBA 4A8WA 4KHRA 1ZBFA 4GVEA 5A2QO 2FJWA 4E8UA 1GH8A 1UVKA 1IJEB 3M2UA 1ITPA 3HYFA 2IM0A 3DDNA 1ZM2A 1RDBA 2IVFB 2KT3A 4NLBA 1QVFR 2B7BB 4DHYA 2DNPA 3J7ZT 2PDAA 1HNXJ 1VR6A 5SWMA 4YY3F 1Y10A 4LBPA 1R8CA 1X4GA 2QI2A 4DR3J 3AODA 1NK0A 1UVNA 3I55S 2MY7A 3ATVA 3N5BA 2LA4A 2VGMA 3J80O 1S0VA 3Q8PB 3ZSXA 4FW2A 3DOKA 3E3XA 4BHQA 1HQEA 4IRDA 3QJJA 1R8AA 5M1KA 1T9YA 1TMMA 3WX8A 3D68A 1YXQA 1FEEA 3R5DA 4LF6F 4FLWA 1IKVB 1F9HA 2ZJPL 2MJUA 4YN3B 1Q82T 2CGJA 4MLEA 1P8GA 2R42A 2PGCA 3CCUN 1F21A 4QBUA 2RHKA 2WONA 4X4VA 4CIOA 1YUWA 4FNIA 3FFKB 3SSSA 3HSJA 4JRPA 4JD2A 2BJ1A 3C66A 5E33A 2OTLS 4DQPA 4HHHA 4AT1B 3MI7X 3MFIA 3LP1A 2VOPA 4I67A 5L46A 3PZPA 3OY9A 2PE8A 1QLNA 2KFZA 2OUGA 2LQ8A 3NF6A 4IRCA 3H4BA 7FD1A 4K4ZA 4AHCA 3DLEB 1Q7YT 3SFGA 4MTPA 4B3TK 2DBBA 3D6MB 3LL3A 1U6ZA 2CQHA 5AFUA 1S1WB 3P4UB 1OQ3A 2BE2B 4OHWA 1UAXA 4DL3A 1UFLA 1VOMA 5KRSA 4B1WB 4XTTA 3VQSA 2HK3A 3TA1A 2ZFHA 5I42B 2ZE2B 3E2EA 2POKA 1K6YA 1AFIA 2WVFA 4USMA 1MWQA 4JBCA 5C12A 1JLBB 1KAZA 3TZYA 2V7ZA 3JSMB 3AJ1A 4PAAA 3N5FA 1F0XA 4B1VA 4IDKA 2VB6A 1UVLA 4HDHA 5C15A 3VENA 4WP9A 3GCWP 4ZPWR 4K8XA 1Q86T 2DR5A 3RSEB 1DTTB 3MEKA 5DK5A 1B7YB 4G6VB 3J8AA 4M63C 3EYZA 1WNEA 3UI3A 4J9KA 1PYTA 3X3UA 1HQEB 4C48A 1SQKA 1SUQB 2EX3A 1E4GT 2UU9F 1VSMA 4K5SA 3ZT2A 3CJRA 5CZ2A 4NB4A 4O8KA 1YJWN 3RU0A 3M6VA 3N0VA 3MN6A 2NPIA 5EWGA 4IG0A 1AFJA 2L48A 4J9SA 3W9IA 1R27B 1IG9A 4WXOA 2ZH1A 3NAIA 2N82B 5KG4A 1KP6A 3OQ2A 3X1LB 1VRQC 2RDIA 1WHYA 4Y0FA 3KLVA 1VBKA 3WNGA 3RB3A 2RQMA 1QQCA 1LEOA 3TTDA 3PCOB 4MO5A 5KT2A 2YKQA 3QIOA 4FXDA 4O0IA 2MKJA 1KONA 3M7VA 4C8NA 2JEFA 2DNZA 1UEVA 4LRAA 1NEEA 5KFQA 2GAGC 1RAHB 2DNYA 5K8NA 2CVEA 4ZVUB 3P8BB 4CHPA 3KJFB 1OY9A 2BQUA 1YTAA 3TEGA 3BSCA 2ASDA 1I51B 3CQYA 2CPXA 3W66A 1GAOA 1WSHA 4LF4K 2P9EA 2H5EA 3RMCA 2FZKB 1YGYA 2W4PA 3E9LA 5DRKA 2IBKA 1HYZA 3ENBA 2PIIA 5C7PA 4FLYA 5KPTA 1N5TA 2J0QD 2XO7A 1FKPB 1CJVA 2ZUAA 4IXCA 3NP5A 1S59A 1SJ1A 4F3QA 3VERA 1X9MA 3LP2A 3AVLA 2DEIA 2NXNA 3N9UC 3UN2A 3CIPA 4JKHA 4LQ3A 4DR5F 3F56A 4AL6A 3MR2A 1RSCA 1L3SA 2FZGB 3ULHA 1F60B 1SI9A 4QS9A 3R5BA 1KR4A 1D4XA 4U9RA 2WVEA 4NX9A 3H5SA 3S9HA 1CG2A 1TAQA 1XQIA 1XBWA 3QSYB 4MT1A 1EWRA 2Z30B 3H6EA 5K14B 1LQ9A 3OS1A 2HQGA 1T03A 1SC6A 4ZLPA 3JSMA 3PW2A 4B1YB 3T6JA 3C46A 3SUPA 3MXIA 3L7UA 4B17A 4KHPK 2HS4A 2ZBPA 3MM7A 1ZOTA 4PPZA 2RE2A 5J2QB 4CT8A 2HSTA 1FTCA 4R0JA 1FVQA 4TNOA 1RJJA 2BACA 3FCVA 1W2BM 2XZWA 4BC3A 3TUIC 1Q78A 3KZBA 3M2VA 4UQTA 3U9DA 2CADA 2G8HA 3AH6A 1RDWX 3W8GA 2PSZA 3I4PA 4OYBA 1JJ2M 2E1CA 2AYMA 1T02A 3F41A 2AX1A 4USJC 4CZLA 3O9TA 1U8SA 2LFVA 4YOYA 4J9PA 2D1KA 4M5MA 3KK2B 3ZTOA 1RT1A 4ISFA 5BR9A 2XMAA 4EK2A 4DR6K 2YKMB 4A48A 1HNZJ 4CDIA 3C14A 3G10A 4CF8A 3UNGC 3CJ3A 4CH1A 4ER8A 2ZM6J 3TU5A 4RW9B 1BWFO 4J9VA 2QMXA 1X4HA 2O8FA 2JEJA 1FJGK 3SQOP 3T1YF 3BEXA 4PQUA 2OAUA 4NLVA 2PMWA 3O2IA 2X6SA 5A76A 3GPAA 3CJSA 3SAGA 4WQ4A 1L5UA 3A4TA 2MLXA 1F9EB 4GC7A 4BY9C 3A3NB 1UWBB 1S1VA 1V3RA 3SK3A 3LPEA 3LZJA 3OTCA 3SMSA 4DR3K 2JHEA 2DY4A 2GIQA 1FCAA 3TAMB 3IWXA 1HHTP 1N5YB 1OSDA 1HNWF 3RAMA 2BBEA 1X4DA 2CJXB 4Y6IA 1HNWJ 4H4KA 2RKIB 3G2XA 1NLKL 2FJAB 1OH6A 2A2DA 2V94A 3QEXA 4ELUA 4M7YA 3AVAA 3Q7BA 2X78A 5AE1A 4QR2A 1BQXA 4KH4A 2F96A 4CD3A 3ZSZA 2RIJA 3RRHA 2G2ZA 3WC0A 3QO9A 2WTUA 4CO4A 2UXCF 1Y7PA 1WF0A 3PIPL 3TJ9A 5EXWA 1OVQA 3ZNUA 3AGRA 5GMEA 3IRXB 1WC5A 4QIFA 1IH7A 4ALZA 4P10A 3VQCA 5B0CA 3SCXA 1YTUA 3SUNA 3DXKB 4CF2A 4J9OA 2F8EX 4BC7A 2E29A 1WHXA 1S76D 4M3YA 3UR3C 4PG8A 4B9MA 2XGQA 5I3UA 3O1LA 3FZLA 5FIIA 1WELA 5IT9U 4WBFA 4H0YB 4CEEA 4G1IA 2HYIB 4CZFA 2YNHB 2Q6BA 1DQ9A 3HCXA 3OFEA 2C3UA 4OZJA 1R0BG 2N7YA 3CJ2A 4YB7A 3VTHA 1XMQJ 1BMQB 2W24A 1TYQA 2Z57B 4BG9A 1S3XA 2YWKA 4FWOA 5K8MA 4E2FB 3MN5A 4ZLNA 4AHRA 4XAKA 3C6TA 3TWHA 2B4UA 3CJCA 4LF8K 2BZ2A 2NUBA 3KIOA 2LXIA 2DT9A 3HP6A 3NWRA 4WJBA 1QVGR 1EQ0A 2XBPA 2ZUGA 4A57A 4IO9Q 1N6QB 5HP1B 1BHLA 4CFBA 1RE1B 3MAAA 1VQ9S 3KUEA 3TX8A 3CIZA 2M70A 3KG0A 5T41A 1C6VA 5J1EA 3K7RA 3MHYA 4DI6A 5KFVA 4LF1A 2HBJA 2KN4A 4ILGB 4F8RA 4R5PB 2HBZB 2AJ1A 3CCMS 5B08A 1DHMA 4CZGA 3GOIA 1NDKA 5MLCQ 1MWYA 4JP8A 1CLFA 5KFAA 4KB7A 4HVZA 1QJHA 4OI3A 3DI6B 2DTUA 1Y97A 2J7WA 4IOCQ 4Z4CA 1TL7A 2HHHF 1M0SA 3GLJA 1M1HA 1K73O 4P7TA 4U6PA 2X3DA 2OTJS 4FXWA 2KG0A 4HYKA 4IJNA 1F5AA 4NXMK 4URGA 2RRAA 2IM3A 3VQ7A 3DLGB 1HD0A 2D3O1 4ILHA 4OKEA 3CJ8A 3DLBA 5B8HA 4FJ9A 1ELOA 2MKKA 2D9OA 2XYGB 2WBRA 3DDIA 1FDNA 4JI5J 3IGVA 4X64K 4HHTA 4H5WA 3IN5A 4Z4GA 4FKYA 1VSEA 1NGGA 4EEYA 4BGAA 2J6SA 1TKXA 2XC9A 4ZJLA 3HL8A 4QS8A 4F26A 2VZ9A 1Q5YA 3U6FA 3SIPB 4DR4F 2UVUA 3FEYB 4JN4A 4CJRA 2BE2A 2QA4S 5GAGP 5AQFA 4FWLA 3HHDA 3MN9A 4FS1A 1YVNA 4DMNA 5ETOA 4J2DA 4QWBA 3G4SS 3MUTP 3CPWR 3DOKB 4KREA 1K9MO 3E1YA 1BQMB 1TUUA 3MWTA 1KOOA 4DOZA 1Q82O 2CQ3A 3SYZA 2DR7A 2ZH5A 4DU4A 2Y8WA 1WSIA 2CQCA 3NOCA 1NBEB 4WIIA 3UD5A 2P9PB 5K5MA 4KGVB 1VK3A 3HRGA 2E2OA 2PT0A 2H48B 2IIHA 4DV1J 4W5QA 1TP7A 3BQ0A 2GVDA 2LQ9A 3FSXA 3NS6A 4NA1A 5L1KA 3NNHA 4L3QA 3VETA 5M1QA 2HKEA 1BXNA 4MH8A 1RDRA 2GIRA 4KJIA 4DHVA 2I5JB 1S97A 4FJXA 1BQMA 1GNKA 5CY4A 3SLCA 4IEIA 1CXUA 1S9FA 4WU3A 4JAXA 3BZQA 2NRTA 4NYNA 4DUYK 3M2VB 1XMOJ 3U3GA 3W0LA 3BN7A 2YHBA 2FB0A 1SJRA 4EGLA 3IAM9 1C2PA 1TL5A 4KE5A 5LXYA 2EBEA 5FLXO 2F9WA 1YBTA 2ZQBA 2J0SD 4S0MA 1Y00A 2MMYA 4NLDA 5KFTA 3NL0A 1VLOA 2R3VA 4DQIA 3QETA 1YT3A 3RB4A 2M52A 2P8IA 5CABA 2P9LA 3WX4A 3W62A 5HROB 3FCWA 3OVNA 1S1XA 4WFBL 2VKZG 4C8LA 1EETA 4LF4F 1XMBA 3KHHA 1Q8BA 1PAEX 3NMRA 3M1VA 2V2ZA 2IVMA 4X64J 4QCLA 4U7UK 3KK3A 3EM1A 1VSLA 4KFBA 4Q7AA 2BH1A 1S22A 2VJVA 3JSYA 4ILMA 2GX9A 1LWFA 3EVOA 4YOVA 1SCJB 2G8UA 4JKCA 3I9ZA 4K25A 4IFYB 2AEFA 4IO8A 1L3VA 2MB0B 2E2PA 3QNWB 1YBUA 3QGGA 5J2MA 5GAEU 2LKZA 4JI6F 5D8HB 3NGRA 4JHDB 3PEHA 4C1NI 2QSFA 3PRDA 4F3MA 3IA0A 4C8KA 1FX4A 3KUGA 3D2EA 4RW7A 3AD8C 2CPZA 4K59A 1L3UA 2YHAA 1BA1A 4N41A 2XS7A 3BKFA 1BQNB 3OJSA 1RQ0A 3I32A 1KWMA 3HPHA 1IV0A 3D6TB 3EPGA 1T44A 2D5RA 2E1ZA 3NE6A 3FBEA 2HNYA 1JLEB 4LH4A 2VHGA 2ASPA 4X4TA 5H9FJ 3D28A 3IAYA 2L9DA 4X2BA 5DZ6A 1QSSA 1TL3B 4K50A 1GXTA 4CLFA 2P51A 4FYVB 2ZM6K 1VRTB 2P5OA 4ECUA 3HHLC 3EY1A 4PG6A 3OBWA 4AH9A 3FRYA 1X5OA 1XMQF 2XMUA 3KOAA 2MZ1A 1NK7A 3UKRA 2MTLA 4OLAA 2Y9HA 3TJ8A 3LZIA 3M5RA 1WDTA 4ECZA 4YOTA 3TAGA 2FSKA 2V50A 4PCQA 3MAHA 3ILJA 2MZQA 4WFZA 2RQ4A 1VMBA 2IYIA 1RAOA 3AAPA 4JYAJ 4MFBA 1LKZA 5CE3A 4QW9A 3P45B 5LL6d 1TKDA 4F4KA 1HYVA 1WEZA 3OYJA 4AQYK 2RKIA 2ROGA 1NDLA 1D9DA 1SL1A 5KGWA 3DXMA 1J5EK 1G99A 1T9UA 1FDAA 1Y0HA 1WEYA 3NH0A 1XMOF 4J9QA 2KKZA 3OBYA 1FJCA 2PBDA 4FM2A 3VHQA 4C23A 4ZCMA 2J8SA 2YNFA 4IFYA 3D1HA 1IM4A 1QZ5A 4C1NK 4LSNA 1U0SA 1X4AA 1Q18A 4FF1A 3OHRA 3CJ0A 2VQEF 2MHEA 4X65J 4FYDA 4ISEA 3QGHA 1CC8A 1O13A 1RBUA 3TSPA 2CWKA 2BJ8A 3V4IA 1S48A 1HR0J 4M5LA 4FM0A 3QT7A 2G2YA 2HAIA 2JOQA 2L3MA 2RQCA 5LSRA 3ITHB 3P5BP 1NWKA 1C0TB 1UP1A 4B02A 3HM8A 4JK7A 1NXIA 4ZJOA 2VWBA 2OZSA 2VL1A 1ZH5A 2BVZA 4DL6A 2C2OB 4IG0B 3WNFA 5KQDA 1CJKB 3WZ0A 3ASMA 3NGDA 4TKTA 1EQYA 4ZP6A 3IG1B 4OLBA 4DV6J 3PJXA 4HLBA 1FFGB 2Y1LB 4OKJA 3GG4A 3A5NC 3M8QB 1RA7A 3JTPA 4K0KJ 2IDOA 2QGFB 3QBWA 5HRPA 5DMRA 4Q45A 5AQOA 5KFDA 3VN5A 4ZPBA 4OZ5A 3AOAA 4YOUA 4QYRA 4ZCKA 1X4EA 3BZCA 4PKIA 2X1AA 3T5HA 1NMEB 1WOPA 1C0FA 5I3PA 1HBNB 4PL8A 2JVRA 3B8AX 1VQOS 2P9UA 1RABB 1XNRK 4C3LA 4IFVB 5GINA 4W98A 3LGNA 4FF4A 3TX0A 2ZJRL 2MKHA 3DC2A 3VQDA 2ZGYA 3ZSRA 3GIMA 2KFYA 4L73A 3KG1A 4QS7A 4BRHA 2ZJPQ 4URQU 1M90T 3W9HA 1JQGA 8ATCB 1HW8A 1U4BA 2OFHX 2FDNA 5SUHA 1X0PA 1NPRA 2GO8A 3DLLQ 3R9PA 2GHVC 4CZEA 2E66A 2F3JA 4DR1J 4RUAA 4OPKA 4O44B 2RRNA 2AP6A 1IBCB 2ZDPA 2A18A 2JX2A 1U45A 1M5SA 4B9NA 1LOTB 3CJ5A 2JWNA 4L75A 1I5OB 3FR0A 1YJNN 3F9KA 2QT7A 4HCCA 3NG8A 2JVOA 4LSLB 4UT4A 4J9LA 3MEGB 1PC4A 1RTHA 2OEMA 4TSXA 4M3WA 3GG1A 1D5AA 1GX6A 1EKEA 4DTNA 2RDJA 5DM6L 3G6VA 2N3LA 4X65F 3CMAN 1K8AO 1F5CA 5B0FA 2ZBCA 4Z4FA 1UCNA 2ALYB 1NG9A 1RT5A 5ELZA 4A61A 1NB7A 2QXFA 1HFEL 1HR0F 1YI2S 2YKOA 2ZH6A 3CCQS 2A2CA 3MF5A 1RBVA 1KXPA 2QWNA 3CCRN 3VGKA 3DLGA 1RP5A 4ES1A 2D4WA 1KVJA 1HX1A 3ZZOA 4CH0S 1CPZA 3BGOP 4KB1A 1HLUA 4RUBA 3IS9A 4KI6A 1S1VB 2NSCA 4Q43A 4E98A 3QIPB 2IS3A 4XIUA 4BDZA 4I6MA 1HI8A 5LMNK 3TAMA 3N01A 1YTYA 3CO9A 3S41A 3ZSVA 1IWGA 2ZH4A 4ZCLA 4E0DA 1JXVA 2WRMA 3LH2S 3R7NB 2XGPA 3M1VB 3ZNJ1 1EX8A 5I42A 3SBTA 2YKMA 1VQNN 2GIFA 4LR9A 3CJ7A 1UVMA 4NA2A 5J2MB 2ASMA 4LRFA 1HWIA 4ICLA 4F50A 2H54B 3T1HK 4OYAA 2V68A 3J7Z5 1R8BA 4ZHRA 4BR5A 4N56A 5C2GA 4PG4A 4RNHA 3NGZA 2OFGX 2WBNA 4B3MF 5EVZA 2R7RA 5ETTA 2VF3A 3PYFA 2WHOA 1B64A 3T5JA 2PFFB 3HXMA 2JGUA 3I4HX 2OHDA 4NLCA 1S9EB 4LSNB 1S77D 1R0AB 3MXHP 4JYAK 3MM9A 3ZTSA 1NU0A 2P6SA 1SPBP 5JVHL 2Z1JA 4FPRA 2HBYB 2AIRB 4B3OB 3ET6A 3CCVS 1RWPB 1U26A 5KFXA 4CGDA 3QFPA 1UFKA 3K57A 3HKWA 2VFRA 3D7EO 2V67A 1YG0A 3CCRS 3MXMA 4KAZA 5GVQA 1AB8A 2XSJB 3PW7A 2XM3A 3GYXB 1TK5A 3OS2A 2ROEA 1ACMB 1VQ6S 3V81A 3MCAB 2A3ZA 5AQPA 3H2VE 4LF5K 3PJWA 4N8OA 2HBKA 4CT9A 5BN9A 5HQLA 4LMZA 5HN0A 3CDEA 1RWVB 4DL2A 4ID1A 3MCMA 4FJ8A 4ID8A 4M5KA 1P6TA 3CCLN 5L39A 4DCHA 2E1AA 4NYOA 1H0HB 2QA4N 3GR0A 1RBAA 3M05A 5F2RA 3DMJB 5AQUA 3I56S 5FPEA 4Q2MA 4A5AA 2HHHK 4Q0BB 1FXXA 4RW8A 2ZD1A 3AB2B 1HNVA 5M1PA 5J1NA 6FD1A 3TSUA 3S3MA 4BQZA 4C3KA 2KQ2A 3BN4A 3OYNA 4DPUA 4K4XA 1MN7A 4QIWD 1IKXB 1MNEA 2RHSB 3KJQB 1D3WA 1HJOA 2KHDA 4EP5A 2XTJP 2DNLA 2FLLA 3L6QA 3R3LA 1I3AA 5DQHA 3CCSS 4FPAA 4PKHA 2FGOA 4Z4HA 3RBXA 3ZTRA 2P9KB 1FWKA 1TKTA 4ZVQB 3J80Y 1YLXA 1WACA 4KH1B 2NYIA 1O8BA 3WT0A 3M8ZA 4FM1A 2V8GA 5LT5A 3EGVA 5GAHU 3MCNA 3R8EA 2FY8A 4D3GA 4O4GA 4E1NA 1IR2A 4RNMA 1IBKJ 2F40A 4YFUA 1PGZA 1UJ6A 4NLOA 3HBTA 4KT0C 1HBMA 1YHQS 4CHQA 1U7LA 1SH3A 4C11B 4ZPTR 2GELA 4DCJB 2XLIA 1VHIA 3L2VA 2XY8A 1W2IA 2ZC4A 1VQPN 5KFYA 2MKIA 4QWCA 1Q81T 3QRPA 2HVIA 3LPTA 1DT9A 2XI3A 4GKJK 2VQFK 1KAXA 1LFPA 2E5LF 2ETJA 1OYEA 2VJUA 1VQ7N 1VQMN 2HIQA 2CG8A 1NCLA 2XYHB 4DV7K 1EQMA 2EFVA 5FPDA 4HEA9 4JI7F 4IH6A 3EMTA 1LW0A 1PC5A 5E0OA 2W9BB 5H9FK 4FOEA 1LFWA 2QTWA 4IOXA 4J2EA 4NXMF 1KD1T 1RAEB 3BR9A 5AE3A 3QLHB 3J7A1 2W42A 3FEZA 1JLBA 5HP1A 4PL7A 1B0PA 5GAGU 2DPIA 2IVNA 3CE8A 1ZBTA 1JKHA 2LLZA 1RILA 3NXZA 3EGZA 3P96A 2HFVA 2GMHA 1BISA 1VRUA 2JDJA 2GQQA 4ECVA 3FQKA 2F63A 3FNNA 4OX6A 2W2NP 3T19A 4RW8B 3GIRA 5B7WA 1A6LA 3M6WA 4C97A 1B0TA 1M5OC 4BC9A 1WKJA 3VZIA 4LFAK 3IGNA 4NRUA 3HFVA 2YH0A 4JI4J 1AYEA 4OJRA 3QEWA 1OYDA 2E7VA 3VAMA 1V4SA 3R5CA 3UKUB 1BY9A 2FJDB 3L4IA 5B0DA 1VK0A 3LA0A 4DR5J 2DCLA 2R7VA 1P90A 3DOMB 5AJ3J 1N4LA 3JQKA 4Y3CA 3KTQA 1YSJA 4KH6A 4M5JA 2K1RB 5A0YA 1X5SA 4ELVA 4LJMA 2HHWA 2QA1A 4LFBK 4W90B 3FZBA 4QWDA 1FE4A 3HHEA 3ZSQA 4Z7CA 2B9YA 3E9OA 2RMLA 4QIVA 2OJ3A 2G4BA 2PY5A 3PRBA 4EUVA 5AJ3K 1WAFA 4P72A 1L3KA 3WEEA 1RT7B 2XHCA 5CA5A 2V63A 4KPYA 1LOUA 4LF6J 3ENOA 1IR1A 1SKSA 3G71N 2B9XA 3FFIB 3V81B 4IR9A 4FLZA 3QAUA 4IOCL 2X6NA 3U27A 2E5LJ 4QQBA 2KHOA 1JJCB 2GUPA 1N5QA 4BVPA 1TQLA 2DHGA 2I8EA 2JFKA 3Q23A 3M30A 2APOA 2IMWP 4FJKA 3FBCA 3SV3A 2CZVC 1IO2A 5BREA 1Q16B 2X1FA 3ZT1A 3LP2B 3Q22A 2ZM6F 1S79A 2KKHA 5JICA 3E01A 1QTMA 4E7JA 3RTVA 4V19S 3MX2A 2MZJA 5A8WA 2O8BB 5D0HA 2BM0A 1R0AA 1RB0A 2EK6A 1ZBLA 4NMXA 2KVQE 5L9XA 3TAFA 3O9RA 5IWAJ 4B3TF 5KFJA 2R4FA 3E01B 4A5BA 1WSEA 3JAMY 1O0PA 3Q89A 1I94F 3ISND 2C2KB 4GV9A 2CPFA 1E4FT 1IKYA 3FJ2A 3D67A 3VEWA 5M2RA 2UXBJ 4CLUA 3PSFA 2C22A 2HQDA 3BGUA 4NLRA 5LMUJ 3DOLB 4DF4A 2GGPB 1RU1A 2VKRA 4BR0A 3V9XA 1VQ8N 4GO7X 3J81j 1HARA 4M1KA 2BJDA 3J81Y 3L2QA 3BP8A 3VF6A 2WSCC 5KOWA 5CHIA 2E2QA 1ZPWX 3B8HA 3IAS9 5IOLA 2P2CB 4JS5A 2VBZA 4ECYA 5IT9Y 1RTDB 4O3QA 1SUQA 3JTOA 3OV7A 3IM8A 4BR4A 1QE1B 1OWXA 4O5BA 1RHRB 2K2PA 3GWCA 3ZC4A 1RDDA 2HQFA 4F02A 2D41A 2HEKA 5HO4A 2I0XA 4CLLA 5DM7L 1NOYA 2XMMA 1VSHA 1GQEA 1RWOB 4H0PA 3D66A 1NGCA 3EDRB 2GC8A 1HL6A 2YX6A 3AA5X 2MJNA 2DNRA 2XQCA 1REVA 2Z1GA 3IXQA 1GLCG 5L38A 4KPCA 1FA0A 3A13A 2V7YA 4O4GB 2BOAA 4BCAA 4IZ9A 2ZWHA 1F5BA 3K5OA 4Q5VA 1WB9A 2R7XA 4WIQA 2F4FA 1XNRJ 3TPQA 2R8IA 5KG5A 3QICA 5LJWA 3OHBA 1JCFA 4GKJJ 1PJ5A 4OHYA 5T14A 2MDAA 2ZZTA 1ZAXA 3LWLA 5F9LA 4WF9L 4PG5A 4UOCA 4OHZA 3EZWA 4OZ3A 3NS5A 4FYWB 2BRKA 4X4OA 1H38A 4M5GA 2M7SA 2A5XA 4F7VA 3JYTB 2EFGA 3H3NO 1WSVA 2PN6A 4KTZA 1HNZF 4TY8A 4H4OB 1MWMA 1RAJA 4LRBA 3HVWA 4CLTA 2FF3B 3PJ9A 4KHMA 3PYEA 4D3HA 3AVIA 1RT4B 4E89A 3V9ZA 3PYDA 2ZWOA 3S6EA 1DQ8A 3I0SB 2NXUA 3C15A 3R5AA 3E51A 1XTZA 2K7KA 2W7OA 1RNHA 1URNA 4ILLA 1B9FA 3RRKA 4XDCA 2WC9A 5KFKA 4YORA 3MM8B 4JKFA 4DTSA 2FLNA 3UN3A 3KJVA 1KLMA 2IRXA 2O8FB 3W8PA 2I1RA 4JB8B 1FRKA 1ESVA 5AFUH 3UE5A 4MO4A 1B4SA 4EP4A 4ED3A 4RX6A 2VPZB 1CEZA 3J7YP 4MK9A 1IKXA 3RJMB 4RPFA 4Z37A 3BSOA 5IQQA 2QV6A 1RU2A 3OFFA 4MKAA 1AA1B 1HJRA 2MPUA 3OYFA 1QQMA 4MAKA 1E3MA 3MCPA 2IC3B 4X62K 3OS0A 1BWEA 5HRNA 2FBVA 3MECB 2HBMA 4O0NA 3UB5A 4GVMA 4BRMA 3J81O 1NSKL 3V1OA 4KSEB 1X9SA 5G4DA 2M0GB 2Q1NA 2IJFA 1HPZA 3HSDA 1BWVA 2P9SA 3CO0P 5KFUA 1I94J 3ZT4A 5DZ7A 3B6BA 4RBTA 2Y3YA 3NGSA 4DX7A 3M9MB 2VG6A 2PFDA 1TR0A 4RW6A 1H7WA 4I6YA 1PG5B 4MIBA 2DGOA 4KV8A 2QMWA 1VQ4S 1RAIB 4OX8A 2NRZA 2BDPA 4WQ5C 3LP1B 3VQ4A 2BMBA 5HMXA 3VEOA 3D0HE 3DGPA 4DV0J 4USWA 4WFAQ 4IH5A 1D8YA 3MMJA 2NNWA 4ZKAA 3MMCB 4LH5A 3HLUA 4LF8F 1BHNA 1E6YB 3ZZZA 1ZC6A 3TP2A 4P71A 1S1WA 3BKUA 3ZZYA 3SPYA 2AV5A 1CJTA 4RJVA 3PIOL 1YK9A 3PKYA 5C0YA 3KLEA 5B0AA 1H1VA 1HRHA 4K0KK 1GFWB 3E8OA 2A6MA 1W0HA 5JLFA 1YI2N 3AO1A 3MEDA 4EZ9A 4BDYA 3HHLD 2J6TA 4CLWA 1ILYA 2W1BA 2JZ5A 1RWKB 1VISA 2YI1A 3TR8A 4A8MP 4FZVA 4LSZB 3ENAA 1EJ7L 1C0UB 1SC4B 3W65A 3AXKA 3D54A 3C94A 3J7YU 2YXLA 4WE1B 5J2NB 5C42A 4NEYA 4DTJA 1GMUA 4FJJA 3H98A 3VAIA 3K2YA 2OP5A 1OO0B 4QPXA 1M5KC 1JNZB 4CP5A 5IT9O 5E3PA 2L9WA 1U49A 4RBUA 2HZVA 1N33F 3L3UA 3AJ2A 4I9QA 1JLGB 1MDUB 1HHQA 3P5JA 3QBXA 1R89A 1UA0A 4IOAQ 3GJRB 3AQOA 3CJAA 5D4NA 3CC7S 3MK6A 4CZCA 3ILIA 1BI4A 4C2MA 1NM1A 4FYYB 1D9FA 4AXIA 4LF9F 3MMBB 1DRZA 2RT3A 1BL3A 3TUJC 9RUBA 3HMJG 4ZPDA 3PX0A 2UU9J 2MKYA 4N8NA 1APSA 5C2FA 2JLEA 4DR1F 4O44A 1B92A 2QK9A 4PXDA 3QESA 4NASA 4KQZA 2VG7A 4UTGA 2LQBA 2DJWA 5GAHI 2NXEA 2HHUA 1QZ6A 1ZZNA 3DRSA 1KS2A 4TU9A 2HOEA 4BC4A 4I0WA 2IM1A 2RU3A 2D1CA 3R9LA 1NH8A 3WIVA 3WNHA 1S10A 1YWXA 3NCPA 3ICLA 4CM0A 4HTIA 3DOLA 2A41A 4XH4A 4CI0B 2I38A 2FSJA 2OPSA 4HI1A 2OPPB 1P9QC 4OIXA 3DGPB 1EX4A 3OUYB 2B4VA 1F1BB 3MEEB 1HWKA 3AVNA 4PY5A 2GJFA 1RHQB 4N77A 3QMQA 2XHBA 2C3MA 3OR2A 5DM7Q 2LEBA 2MYFA 3KDNA 4LF5J 2HMIA 3ONQA 1UMJA 2VCPA 1WOSA 2Y0BB 1WUUA 3US5A 2AEJA 4BR7A 3QBCA 2Z0GA 2D7SA 4CGHA 4LBIA 4BR9A 1Z05A 2F65A 3VZHA 3TAPA 4W5TA 2O4GA 3LAMA 1NPPA 2YWWA 2FXUA 3H40A 1NGFA 1LWCA 4CHNA 4ED7A 4ZTFA 2H3EB 4CYUA 2P9NA 3P83D 2B5JB 1DBDA 4MK8A 3EXYA 4BC2A 1FERA 4KH5A 3G4SN 3ZEUB 2IRUA 1Q7YO 4TVAB 4J5OA 3J81U 3OT9A 1NKCA 2EK1A 3MX5A 4WF9Q 3NVKA 1BUPA 2W2QP 4FWSA 4ZK7M 3M8RA 3D5MA 1GLJO 2QWMA 4IKAA 1IKWA 1WI8A 5E2QA 3G96A 1FE0A 3C7NB 1BDGA 2AA4A 4F4ZA 1X4BA 1RTHB 5LM7E 3CJKA 5HANA 1VQON 3V9SA 4GKKF 3U8XA 1H2UX 5GADI 4FDFA 1IVZA 1TK8A 1SC1B 3SDEA 3HZEA 1RAAB 3FEXB 2GQ2A 1RGVA 1V9OA 2PEBA 1NBWA 3U7JA 1S7HA 3THWB 3EPIA 3GFZA 2E1PA 2N4DA 2XWYA 3A5OC 1I94K 5KFSA 2VYPA 3K5LA 3KHRA 2HWHA 4ZLJA 5G0RA 1U1QA 3MGJA 3NOGA 4YB6A 4X4RA 1R8HA 3BB5A 4OX9F 1HNWK 3HZGA 3EL2A 3W5XA 3IUCA 1YJTA 3MM8A 3BF1A 3I5AA 4CJTA 5GIPA 2OMLA 1GMWA 1UJ5A 1OVYA 1XMOK 1WAJA 1H98A 4U8VA 4DB3A 1QY7A 3V9UA 2WTFA 1TYQB 1GMVA 4MKBA 3W64A 4ZDNA 2HLTA 2ZH8A 4NA3A 4X64F 2BX6A 4DQ8A 1VBXA 3G87A 4LF7J 1N36F 2HZCA 3D3BJ 3VVTA 2VGNA 2R2SA 4C0HA 4M8LA 2IVOA 3QPIA 1DKGD 1OPZA 4U7CA 4UOGA 2MEWA 3VR1A 5HMYA 4ED4A 4ZVHA 2FZCB 4FJ7A 4KRWA 3QJPA 3TSQA 2IDLA 1OMSA 1U25A 2V4JA 1KHVA 4B3SJ 1WTFA 3CWJA 4ZA1A 3G71S 1ZAWA 3OSNA 3PR4A 5BR8J 3MMAA 3S7RA 2P9CA 1RT2A 2B5JA 3HD2A 1VDHA 1PIEA 4L74A 4K8RA 5LJ3Y 1MG7A 3NAHA 1WNSA 2FGCA 1VBZA 2JSXA 2ACMA 3MWPA 2NUUG 4F04B 3H3OB 2FBXA 2CNKB 4JV5J 1SBRA 5IXUA 2QLBB 1LXJA 1MN9A 3K89A 1J5OB 1YHQN 3SQGB 2HMPA 4CJKA 4RTFD 1G2EA 4JI3K 2I7PA 4LFBF 5LMNJ 2H5IB 1FDDA 4HTJA 4A4JA 3PYGA 5I4MA 2JJ4D 4RUCA 4GKKJ 1GOBA 1Q4RA 2GHWA 3THPA 4NYPA 2K8GA 1FX2A 4JV1A 1VQMS 1XERA 4ANCA 3R7BB 3OD2A 1ZM9A 4DPXA 1C1AA 2KVIA 2W01A 2ABYA 3FCHA 5HVGA 1BIZA 3EN9A 3A12A 4OI0A 4F25A 2VASA 2PMHA 3KK1B 4I1TA 3PSIA 3LM9A 3MZIA 2BE9B 3J7AN 1HWJA 4EAHD 4HVJA 3W2WA 3DLKB 4I64A 5FD1A 2R7YA 1Q53A 5A8KA 1REVB 1TU0B 1BE4A 3MD3A 3O44A 1CZ9A 3LOUA 2CJBA 2LQJA 2V9WA 1RKJA 3TVYA 2VQEK 2KXHA 1ZTWA 3UCUP 3C6TB 2VH7A 2F4VK 3N6MA 5D15A 1HLWA 1SJ3P 3E66A 3R1HA 2Q3SA 1FT8A 2YY3A 4DL0C 3R8YA 3LGHA 1SKUB 4LFAF 4JI1J 3L7PA 3SXLA 4A8OA 3LDLA 2ZOGA 3C6UA 4Q0BA 2QA2A 4H0OA 4E1MA 5EX0A 1EKRA 3GIIA 3DU5A 4OYZA 4WZMA 1VIOA 2CAJA 5EDWA 1A5VA 2MY8A 3LP0B 4X65K 3BO4A 1NRKA 5D0EA 3BF4A 3TEHB 5IS2A 3DLJA 1A5XA 2XULA 4H54A 3CCEN 4ED0A 1W26A 2XZDB 4BWMA 4FP9A 3ZXWA 2CH5A 2YKAA 3KKRA 2WAQD 2UXBF 1U2FA 1RT3B 2RU9A 3PX4A 4DUZF 2MQNA 2R2UA 2LU1A 4OPJA 2AYGA 3CVKA 3EZOA 8AT1B 4QPTA 2YX7A 1K1QA 1XN9A 1B7FA 4OL8A 1S1UB 2FBTA 1HKBA 4EBCA 2G0IA 2C3OA 2GMJA 1X3MA 2CRLA 5C42B 3VTIA 3SV4A 3CD5A 2OI2A 5DG7A 4U95A 3FSIA 1BD6A 4IG3B 1RWMB 1SQEA 4AQYF 2E9TA 3KLGA 2IDEA 2UU9K 3AVHA 2W6KA 3DRRB 2XY5A 5CR4A 5KFGA 2JEIA 4CK3A 5K9FA 2E5IA 5HAOA 4WTOB 3SQ0A 4WQ4C 2QKKA 2XZTB 4RNNA 1VQ5S 2CQDA 3DRRA 5C10A 3MM5A 3QFUA 5A8WB 2VOOA 5HLFA 2V8DA 1HKAA 3CJBA 3HJFA 2X1GA 1ZAVA 2P6TA 4WK3A 3M8SA 2C1EB 1ZZFA 4TYBA 3NCRA 4CQ1A 2GUIA 1NDPA 2YPZA 2ATLA 4P52A 3OXGA 3BQ1A 3G6EN 4TN2A 3S01A 4BACA 4CWBA 4E7LA 2W40A 4AHVA 2RVJA 1RLCL 2DTJA 3EXCX 2UUTA 4CJEA 3UO0A 3P39A 1G1XA 4ZPAA 3ZEUA 3DYAA 2VDHA 5T7LA 3C7NA 2AT1B 4ZPVR 3C16A 2HFNA 2AJQA 2HBLA 5FPMA 3MPYA 1WD6A 3NF8A 5CCLA 1CSJA 1VFJA 3CMEN 2NUHA 3KVGA 2RS8A 5JMVA 1N88A 2HWIA 5KT5A 1KC8O 3VEVA 2YQ3A 3CCVN 5BPNA 2MQLA 1SH2A 1V5IB 4J9NA 1SAZA 3BGLA 3C6UB 3UD3P 3AA8A 1OSCA 5DO2A 4KKOA 3K59A 3D1QA 4CEDA 1VQSA 3WHIA 3QGIA 5H9EK 2B0GA 4WZQA 3PR5B 4C98A 2P9IB 5KTQA 3H5XA 2CNOB 2I2YA 4CIGA 4Z0UA 3CDBA 3FKBA 2HHTA 4AFFA 2ASLA 3BEGB 4B3MJ 3P31A 2YKPA 5AQNA 3ZFVA 4F2SA 1IBKK 4B9LA 1JLEA 4CJLA 3MEEA 3GP9A 1BG3A 1UKUA 2B4JA 1HNZK 4NI2B 3L3CA 3D7SB 4ZPCA 2ZJRQ 2U2FA 3IFRA 3HVAA 3ULEA 1KKHA 3CDWA 1T8EA 2HGMA 4CJQA 1IXKA 3N6NA 3UDEA 1YRXA 1GEHA 2KLAA 3VALA 5BPMA 3B82A 1WG5A 3C15B 2V4RA 2E1RA 3V6DA 4KI4A 5H1SQ 4ZVPB 4DR3F 1XNRF 4OV6A 3PW4A 4FWRA 3DLLL 4NXMJ 1H74A 3A8EA 3R2CJ 1ZBHA 1OQ6A 1RBOB 4ZVRB 4C8MA 4EYHB 2UP1A 4C0BA 1JLFA 3TANA 1S6PB 1GLBG 5T7BA 2AJ2A 3OVSA 1FRJA 4PKDB 4DTRA 3QQCD 2Q36A 4A47A 3SCLE 2VG7B 1PYSB 4LF2A 5FLXY 1Q8KA 2FHJD 4NLPA 2HFUA 3CJ4A 4UOFA 2R7SA 5IT4A 1RT6A 1MW7A 3SCJE 3KKSA 3MTKA 5HMWA 1ZETA 2VFUA 1RT6B 4DU1A 2XMTA 2C2DA 3F44A 4OZ2A 2DRAA 2KB2A 3MUVP 3ZETA 3C6AA 2RPIA 3RBDA 1NZAA 3MMBA 3IWNC 4Q44A 2OPPA 1NGEA 5KRTA 1YIJS 3CJKB 3M6XA 2F8SA 4FXVA 5C24A 2W2MP 4M94A 4CGGA 4ED2A 5THWA 2ACYA 5GMKa 2VIHA 1XR6A 4I9LA 2W2PP 4QAGA 1UVJA 3TZZA 4ES2A 2CWXA 2KG1A 3NNCA 3BDEA 4LF4J 1IG8A 4DV5K 2DGTA 1YJNS 3TTFA 4YB5A 1Q8LA 4AHTA 1QDUB 2KRBA 4AD6A 4BR2A 4CJ7A 4RG8A 1NGAA 1LWCB 3VA0A 4ID5A 4J37A 2P5VA 1F3FA 1KAYA 1X4FA 2E7WA 5DETA 4GKJF 3ENVA 4KGKA 3CJQA 3V1RA 2LXUA 5EX3A 2X7IA 2UVWA 4HH0A 4OPAA 1T05A 2VA3A 4U7UD 1GX5A 3G9CA 1RDAA 1QSLA 3PFEA 1KEKA 1ZTTA 3DLKA 2LDYA 5HL7Q 2QWPA 4CZKA 3O8WA 4ZVFA 3SMPA 4PPDA 4UUWA 4WTYA 3EKUA 2BTFA 3HHKA 2F8HA 4MKVA 2W8LA 4PABA 4IFVA 3G8QA 3KK7A 2Z8QA 2EWSA 4IDKB 4ZVGA 4YS2A 2ZBRA 1Z4UA 1FKOA 2EG2A 3OYMA 2OELA 4N7TA 1NKBA 1K1SA 3KG4A 3NVMA 2CJ9A 3W3DA 2VG6B 4GW6A 3CCJS 3BYRA 1O6XA 3OJUA 1X7VA 2HRUA 1OH7A 3WQPA 5KT7A 2KO1A 3UDVA 2QC3A 4DV4F 4TQSA 4M5NA 3CF5L 1EAYC 2GX8A 5LOQA 2Z2ZA 2YWFA 3KXDA 4J90A 1S5ZA 2YX4A 1U2CA 4B9TA 2IC3A 3PIOQ 4B9UA 4LF9J 1MROA 4K2JA 1FHTA 4USIA 1VQNS 1Q8IA 4M3XA 3TRGA 1HBUB 3KLIA 1PILA 3ID8A 1REGX 2FSNA 1DARA 4FYXB 3KLGB 4ERDA 3VAKA 1SVDA 3I6PA 2R7TA 1NGHA 4I2QA 5C5JA 5I3UB 4N76A 4FW1A 3CD6N 3T1YK 1M1GA 5CYMA 3VPZA 4NWBA 4WPAA 3AVKA 3N28A 2V2QA 2AZ1A 5U47A 1RBRA 4U7BA 3KDOA 3W63A 2VICA 3U4LA 2DHXA 5JVGL 4YNQA 3Q8SB 3DOMA 3H46O 1K0TA 1J54A 4MQ3A 1NGDA 3CTRA 4Y2AA 3LDSA 3ENHA 3TR5A 1T6DA 1VCTA 1QHTA 2BE7D 1H7XA 2J4RA 4E7HA 4DWIA 2JLFA 2ILZA 4QWAA 4Y2KA 1HYSA 3MFHA 3WXLA 4XH5A 1V3SA 1R6VA 4NLGA 1TZ0A 3FGVA 4CVNE 3SUQA 4B3OA 1TUVA 3UKRB 3UFCX 1QUVA 3BPSP 1DZ5A 3TUZC 3D4JA 1P9YA 1SL0A 4HTLA 1XR7A 2V2KA 5LJVA 4TY8B 3PY8A 1YBAA 4I7FA 5KQ8A 4BRQA 3O4QA 1N34J 3HOTA 5ETNA 1S1UA 4CEFA 1H6KX 2VBYA 4JKGA 1V4TA 1RBTA 1N33K 4YOEA 2B6AB 3NKYA 3VV2B 4H4MA 4EIAA 6AT1B 2OLWA 5DQIA 1JLQA 2EFQA 4JI5F 2HRYA 2P1JA 2HS0A 2PZSA 3IR7B 3BBCA 2GO9A 3VAGA 1GTHA 1JXBA 3OYKA 3S3OA 3EUNA 4HH1A 1VQ7S 2XNRA 4CBUA 1S72N 2UXDF 2GW8A 1S6QA 1PSDA 2G2OA 3Q8UA 5DLGA 2X3GA 3O9QA 4I6MB 1ZPVA 5F0UA 2OCEA 1RK8A 2ERRA 2IVYA 3MR3A 2JWLA 1GK8A 4USKA 2DRBA 4DCPB 2OD4A 1JX4A 1F6TA 3VQPA 1NKEA 1LWFB 4Y0WA 3FK4A 4KTQA 4L8RB 4AM6A 3IWLA 1C4AA 3HJVA 5IZHA 4CEAA 3G8TA 2QEXN 2CQ2A 1YJ9S 4M3TA 2CQGA 2L41A 2UXBK 1RA6A 3KLHA 1SJQA 2ZH2A 1NJIT 2GZOA 3TUPA 3AHPA 3V1QA 1EKSA 3CD0A 1CJKA 2IHR1 3GCXP 2ZOMA 1SXLA 2NYHA 4AE5A 3AO5A 3R7SB 5BR8K 2WW4A 1P27B 3IO1A 2JL9A 4JI1K 3AVJA 5E3CA 3TQ1A 4HUGA 3OTOF 5AQLA 4YP3A 2M88A 1M5PC 2ATQA 4NPOA 2GEMA 2IRYA 1SKWA 4ATNA 2G0JA 3M6UA 3RB6A 3PTWA 2G1DA 4BLGA 2GWKA 1JCGA 4NXNJ 2CPEA 3QDKA 1JNRB 3J7AP 1U1KA 1IJJA 3A8YA 2ZBIA 2OD6A 4P2XA 4LBHA 1CBKA 2UUBK 2ZGZA 4H5TA 2MZTA 4GO5X 2NREA 5HJXA 2Q0RA 1CQMA 4DBQA 2YNFB 1IBLJ 1A7GE 3DM2A 3POTA 4A8FA 3DNCA 4OYIA 3HD1A 4B3SF 4W5RA 2AF6A 1HKGA 1VS3A 4URSA 2KT5A 2VA2A 1FF2A 2W7PA 3D2FA 2HNDA 2GA7A 4MYTA 5LY3A 1VQ8S 3A5MC 3D0GE 4CLYA 5E26A 3S3NA 2YQ1A 3C8YA 3MPVA 2B9EA 2DHAA 3GMGA 2H51B 5HLFB 4KHSA 4ECWA 3V2UC 4DQRA 2I9SA 1RTIB 2YHWA 3QIPA 2HZAA 2UYTA 1HNIA 4AYBD 1B3TA 3S8SA 4LFCF 2CGLA 1G7CB 3GFYA 2FBYA 2DIVA 2O8BA 2VC1A 2PAVA 2LXFA 5KFPA 4N5SA 1VC5A 4CGJA 4TXSA 5TKYA 4TU8A 1C1BB 1LW2A 2NLXA 1UEKA 3OR1B 1YJRA 2KHCA 1Y3JA 3NH1A 3G82A 2UXDJ 5HL7L 1U8WA 2CQ4A 4KR0B 2QM1A 1FKAF 3TI0A 1WEXA 3ILOA 2BEFA 3G82B 3T69A 1A5WA 3NGIA 4AUKA 1KTVA 4PQAA 3B78A 1WC1A 5ETLA 1KVIA 3QSIA 1HW9A 1PJ7A 1UW9A 2ZKTA 2COLA 3CW2C 4CFDA 2JNJA 3NCIA 3OYAA 3JQMA 1ASVA 2H4YB 5KFRA 1T6CA 4JI6K 1IBLF 2R2TA 2DFHA 4JLHA 3NBPB 2W8KA 5DM6Q 3MPUB 1NJWA 1FDBA 3O9UA 3I96A 2FJXA 1NJZA 4R79A 3PNIA 4ZP9A 4GV6A 3O3FA 3V6JA 2YWGA 4QZVB 3SEOA 1WBBA 2HQIA 4CZMA 2RS2A 3KNAA 2HGLA 4EFAC 1K44A 3BSNA 4GV3A 4DFJA 4CRJA 3OR1A 1Z6RA 2LSNA 4KV8B 1N32F 1S57A 2CIMA 2J9EA 5A2QU 3RR7A 2BYCA 1NSPA 2ZWPA 3POTB 1EP4A 4CLSA 1GMWD 2RNEA 3N79A 2EKYA 1U04A 4ECXA 4OZ1A 4TY9A 4FCYA 2UUAJ 1I39A 3M1FA 2K1RA 2OPQB 4P75A 2ALZA 4LUBA 3MECA 5JVGQ 2DGQA 2RSQA 2F1FA 2J9DE 3DXMB 4G9ZA 3AB4B 4JK8A 4ZHRB 1FNXH 3UQSA 2ITGA 3AVBA 4KRFA 2W4CA 3HHLB 2FC0A 4KHPJ 1KQSR 2QL5B 4F4YA 4CHOA 2AZ3A 1SIZA 1KBRA 4U8YA 5BJRA 1W97L 2P9LB 3CC2S 5HQ8A 5EY4A 2F8MA 3SQ4A 1MWKA 5DDRC 3MMAB 1T05B 3SSQA 3OA9A 3DXBA 2DRDA 3HM9A 2P9SB 1VK8A 3BY5A 4LSLA 1T9VA 2LEPA 2XWXA 3TARA 3P38A 3LO3A 4USHA 5DJBA 3UDCA 5AZIA 2XB2D 2VONA 2FHKA 4Z4IA 3K5NA 4DV3K 4DX6A 2J0WA 4YDUC 4DR7K 4OI2A 4ZP7A 2UUCJ 1FW6A 4QU7A 4KGMA 1N0VC 1XNQJ 5F8LA 1TMJA 1C1BA 1LW2B 3W1YC 4MK7A 1ZBIA 3R27A 3FUYA 1QAJA 1NM2A 3O5BA 1OS5A 3THTA 1T03B 3O1WA 3C6HA 1RWUA 1HNIB 4E19A 2YWEA 1TL1A 4OHVA 4CO0A 2FLOA 1CQNA 4CIEA 4JI8K 1BCOA 3KD5E 2MXYA 1FK9B 5AQTA 5KFIA 1R0CB 3D2EB 4LF7K 1GOAA 3EE9A 1U1NA 1S5JA 3VGTA 1NH7A 4BRFA 4Z2XA 4DU7A 1WG1A 2QWOA 2F4VJ 4CTAB 3WXJA 4CESA 2PI5A 1Y4ZB 3JTNA 2EEYA 5M1NA 1KRPA 1XMQK 4NRTA 3TA0A 3R6MA 4MJKA 3RMBA 2NRXA 3HVRA 2E6MA 3PV8A 5ETQA 3QWUA 2KH9A 4CNZA 2PFUA 4K41A 2HQCA 1K8AT 2UUWA 3KLFB 4FJ5A 2EW9A 2RN2A 2JWKA 1J5OA 2GS8A 3G6XA 3RBZA 1BOTO 3A3OB 1WN7A 4M3UA 4IKFA 2VQFJ 4ZIWA 2CQPA 3M9NB 2IGIA 1Z1ZA 5KFBA 4ZVTB 4QU6A 4M3RA 2NRHA 3HO1A 3LM2A 2IVPA 4CFCA 1NAQA 2QW9A 4CF1A 3IDHA 2GQCA 3QGPA 1TKZA 3Q7CA 2JLGA 1N8RT 4OJ3A 2ZDOA 5ETMA 4WKYA 4DF8A 3I8BA 4WP8A 3MOJB 3U9ZA 3SQ2A 3UVJB 1FFSB 5HSPA 4QR1A 1HMVB 3Q0AA 5F9NA 2CDRB 1MMNA 3HX9A 3CC7N 2UUAF 4R8UA 5IM0A 4C8ZA 5EN1A 2QWQA 2EFNA 4LF7F 3W5ZA 1AROP 2NS1B 3FLCO 4P2FA 2Y1IA 3T1HF 2XEXA 2F4VF 1VSDA 4HACA 1TV6A 5L9NA 4CERA 2GWJA 3IM9A 2P9IA 2CG4A 3M8PB 3WUHA 1OKJA 3DGVA 5BYSA 3H5UA 4ICLB 2XG8A 4DR6F 1Y5NB 3GZ7A 1G6BA 2VU5A 3NCQA 1JXEA 4DU8A 3QNOA 4CHZA 5GAEI 2XS2A 1U1PA 2DHSA 3VF0B 5D78A 8RUCA 4RW7B 4OLPA 3D9BA 2F7TA 4GY2B 3UD4P 4PHTX 1H72C 1K8KA 3EICA 4FNHA 3HVTA 3DXSX 3PRVA 4H0XB 2FYXA 4FVCA 1RGIA 5CH7B 7AT1B 3U1MA 4ZVSB 3A0IX 5GADU 1LXNA 2W9CB 2QLWA 4CLZA 2FVRA 3ENQA 2WONB 3DN9A 2CNNB 2ZHBA 4ZJQA 4LR7A 1TV6B 1S9EA 4U96A 4DPYA 4U67L 3OYGA 1NJXA 2HPUA 3OR2B 3R3TA 4L76A 2A10A 4DZDA 4BRAA 2PA3A 2RD5C 2BKPA 1FRXA 4F0MA 5LMNF 4ED8A 3SSRA 2DXEA 3L09A 3CCUS 2DR9A 2OTLN 3TOQA 3K5PA 3BREA 3CC4N 2GCFA 1TVRA 2IAJB 3O9SA 3HOSA 2GNKA 5FJ4A 4DV0K 1EO1A 4Y2CA 4FJLA 3ILLA 2QZ8A 1WOOA 3H8YA 4YB1P 4F4WA 3T9NA 3CMQA 5JJBA 4DN0A 3QIDA 2ILYA 1TKXB 3U1LA 2VFVA 3OTOK 4AHSA 1KLMB 2VC0A 4GVLA 3AY9A 3KD1E 3T6BA 2AMCB 1J6ZA 4DTMA 3V9WA 3Q8VA 4TLQA 1RT3A 4DSLA 3WXKA 1M90O 1U47A 2ZF5O 2M9KA 2C3PA 2BANB 2UUBJ 4DV2F 3ISZA 5C24B 2FC9A 2UUBF 3NHGA 2J9CA 1RADB 4DTOA 3OTEA 5KFMA 4DQQA 5KFEA 5CYQB 3EE8A 3AOCA 4K5RA 1A9NB 1XWLA 2YPYA 2IAJA 4ZIVA 1GTEA 3AVMA 3PEJA 4M5HA 1GLEG 2CXEA 3I9V9 3R97A 1S6PA 3DFEA 3F0NA 4DR2F 4E3SA 4RZRA 3FQLA 4KTWA 3LALA 2BM1A 2ZOFA 1YVUA 2D0BA 2AP1A 2E8AA 4NLWA 3C3LA 3CD7A 4R25A 2EHGA 2DKOB 4XH1A 4R5PA 1SH0A 2QO3A 4RBVA 2KJWA 2RH3A 1LWEB 4GC6A 5DDQC 4DR5K 3MEGA 4WKRA 2VPYB 5LXRA 1ATNA 5AQMA 3EGWB 2C2NA 2W41A 2PA8D 3LF0A 3K58A 1FRLA 2J76E 2HURA 1WORA 5LSLA 2HHVA 5DQGA 1N36J 2W9BA 3MEDB 4CO2A 3BV8A 4CJSA 4IRKA 1SB6A 4FWKA 2VG5A 1B99A 2BOPA 4DLEA 3ZZ0A 3LUYA 3H1QA 4DX8H 2MGZB 2E5LK 4HHJA 3KLEB 3LDPA 1HBOA 2FJBB 4NCBA 2CQ0A 4UW2A 1Q1KA 4I56A 2A1SA 2YCHA 3IS9B 2R8HA 4WU2A 3VQBA 1JXLA 4X62F 2Y1JA 4AF1A 1VQLN 3O1BA 2YWHA 3T3FA 4CJ3A 3DXKA 5BYRA 4KGZB 2H5JB 2JC0A 5HK4A 4JI5K 1YIJN 2K3IA 4DR2J 1QQOA 4RNOA 4KHYA 3WQTA 5HMZA 2FJVA 2FF6A 5L8RC 2HF3A 3N4PA 3RWUA 4CIFA 2UZAA 3OPKA 2YVSA 3T9ZA 1YRTA 1TAUA 3DLRA 3RMAA 3KMQA 2CZ9A 1RT2B 3AQPA 2D3ZA 1KDNA 4G65A 2O8EA 1JLQB 4DV3J 4MKYA 2BKOA 2Q6CA 1KSPA 1CVJA 4UUXA 1SIWB 1AZSB 4JKGB 1UETA 1U0HA 4K2XA 4M45A 3CCES 4CD1A 3IMQJ 3PX6A 2LA6A 2BUPA 1D0EA 1QHAA 1HHSA 3I5BA 5G0RB 2BRLA 5JMNA 4L72B 4X84A 3HDSA 2CYYA 2XMWA 3CC4S 2A1BA 1FKPA 1CJVB 5C25A 4CHYA 1VQKS 2MHNA 2WOMB 4P2SA 4CO1A 2E7XA 4OI4A 3WDOA 2AJ0A 4ZITA 4K4VA 4K4TA 2X51A 4X66F 1CC7A 3VQ6A 5JS2A 2Q43A 3NMAA 2K3KA 3P6YC 1B9DA 4O3NA 2YBVA 3M2RB 1U0HB 2OIHA 2XMJA 4CEZA 3AD7C 4Q8FA 4PZVA 4HUFA 3R2DJ 2I5JA 1E6YA 3QWPA 3H08A 4O8UA 3RUBL 4B08A 5GMDA 4KHWA 3DHWC 2ITMA 3HF5A 3SNNA 2I6WA 4OKKA 1J5EF 4FLUA 1D8ZA 4I2PA 1LCUA 1URRA 4M5IA 3K8WA 3CUNA 1UOCA 2DIUA 4ECTA 5ETVA 1RBLA 1NZ8A 5M1FA 2DB1A 1S0MA 3DLHA 3KHLA 2M4MA 4OLOA 4EWTA 4RL1A 3RB0A 2FTRA 1N36K 1NMDA 1YJ9N 3MN7A 5IQ6A 2M5YA 3AGKA 4MIWA 4OJHA 2J7KA 5C2DA 3A3PB 5H1SV 3D6FB 3I55N 3EO3A 2CPDA 1WDDA 4FZXC 2XI2A 3UNYA 2GJIA 2FC8A 4B1UB 4DEZA 1WKLA 4M5DA 1FNMA 3EVMA 4NO7A 3AA9A 3HHNB 4UQGA 5ADXH 4J2BA 5A0YB 4BDPA 1M1KO 4RLEA 4RCHA 3GIJA 3HK2A 4X4SA 2PC6A 3CF5Q 4KO0A 4ZVOB 2VG5B 4NLXA 1VQ9N 4KIAA 5GIOA 1KQKA 5J2PB