1JLAA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
553
structure length
546
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 140
structure length 546
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlaA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlaA05
1D8YA 3OL7A 2YKNB 1SH0A 2WTFA 3HHKA 3HPOA 1F21A 4NLUA 2O4GA 4CIGA 2OYQA 4WFYA 2IM1A 4IG3A 3DM2A 4E7HA 1LWCB 3P83D 4DSKA 2OPRB 3MEEA 4ZPDA 5KRTA 4ZTJA 1TKZA 1WSGA 3K5NA 1SV5B 1C6VA 3KLVA 3AVNA 4KHRA 1SL2A 2VA3A 2WONB 1IO2A 3QNNA 4GC6A 5J2PA 2JC1A 4E0DA 4FJ7A 1S6QA 3EY1A 5KFMA 4NLTA 3K5LA 4I7FB 5KFVA 3KLGB 3QEIA 1CXUA 2C2DA 1T3NA 4J9QA 1L3UA 3KHGA 4DSLA 3SYZA 5CYMA 3NHGA 1NHUA 2YNHA 3FQKA 2ZKUA 1BIUA 1Z26A 4E1NA 3HT3A 2JEJA 1U45A 4OKKA 1ZYQA 4HCBA 2DFEA 4ICLB 4MQ3A 3GIKA 3AA3A 2WOMB 3AVCA 4KHUA 4JV1A 4B9VA 3DRSA 4BWJA 1C0UB 2HAIA 1EXQA 1NK5A 2FJXA 3RMBA 1WSJA 2DFHA 4JRQA 5KG0A 4RU9A 1IH7A 4FJ9A 4W5NA 3M9MB 4YP3A 3V4IA 1J5OA 4B3OA 2IM0A 4EYHB 2D0BA 4IG3B 3DM2B 4Q44A 1X9MA 4O4RA 4FJIA 3BSOA 2V4RA 1RDCA 3MEEB 1TKZB 3N6LA 4NLXA 4QW9A 2IMWP 4OGCA 1KVAA 2BQ3A 4NCAA 5KFWA 4ZMMA 3C6TA 2A1SA 2X6NA 3OYIA 5J2PB 3BQ0A 4W5QA 4KI6A 4IOBA 1RYSA 3NF6A 1S6QB 4Q43A 4CF2A 3I0SA 1L3SA 2C2RA 3MAQA 3O4QA 5CYMB 5HROA 4RNOA 3HVWA 2AX1A 4W5OA 4RW7A 1DLOA 1NK4A 4JUZA 3IRXA 1W25A 4LSNB 2FVRA 4IH7A 2LSNA 1SH3A 4IG0A 4XPCA 3QETA 1SKWA 2HHTA 2UVVA 1LAWA 3DRSB 4RNHA 5DQHA 2W9BA 4PQUA 3HSTB 4HTUA 2G8UA 4DU3A 3SI6A 2Z1IA 2Z1HA 1C0MA 4OPKA 3G0ZA 1MMLA 3HKWA 3MXIA 1S1XA 2V4QA 3FFIA 3DMJA 3V4IB 1J5OB 1S48A 4AHCA 3ZT3A 3SJJA 4DTUA 4B3OB 5L1KA 3LP3A 1RDDA 5KFAA 4FS1A 4QCLA 4C8KA 1ASVA 1D9FA 2QK9A 2XY7A 4J2BA 1CSJA 3V1QA 4Z4CA 2CKWA 3DOLB 3E51A 3AO1A 3C94A 3NL0A 2HW3A 4F50A 5J2NA 3DLEA 5KG4A 3GYNA 3C6TB 5KG5A 2JEIA 4TY9A 4BWMA 4CEQA 2J6UA 4ED8A 3I0SB 2F96A 2BANA 1JX4A 3HO1A 4CEAA 5HROB 3KK1A 3KIOA 3GQCA 4RW7B 1DLOB 3LPTA 3G6VA 3IRXB 3OYHA 4YR2A 3TAGA 4IG0B 4DU4A 4B9NA 3PW0A 4AILC 2DTUA 2RDIA 2FVQA 3WNFA 3CJ5A 2W9BB 3SQ0A 2Q3SA 1VSLA 1NKEA 4FK0A 3TAEA 4I9QA 2X78A 4ID1A 1J54A 3QNOA 5F8MA 3LZIA 1S1XB 1B9DA 4KHWA 3FFIB 3DMJB 2IOCA 4ECXA 1A5VA 4C8NA 1SH2A 2C28A 1GX5A 4M94A 2J6TA 1J53A 3H2LA 3DYAA 5HRSA 2QXFA 4KV8A 1U4BA 3QESA 2D7SA 5CY4A 4IFVA 2ASJA 1JIHA 4N76A 1EX4A 1S1TA 2HMIA 1GOBA 4FS2A 1JLAA 3D5MA 1QAJA 2BQUA 2R8JA 1YVUA 5J2NB 3DLEB 3B6PA 3CYMA 2W42A 3T3FA 2ILYA 2E9ZA 3TAMA 1KLMA 4TN2A 4DU1A 3ZT2A 2V9WA 4FJKA 4ECTA 4ECVA 4IDKB 4WYWA 2BANB 1LW0B 4QWCA 3BJYA 2QKKA 5JS2A 3KK1B 2EHGA 1RT4A 3PR5B 4B08A 2ETJA 1IKVA 3CM6A 3HP6A 4MIBA 5HBMA 4WXWA 5J1EA 3KKSA 1I39A 1KTQA 4E7IA 4O3OA 5KG7A 3KK2A 2AQ4A 4B8CA 3RAQA 5KFTA 2IA6A 3L8BA 3RB3A 1HQUA 4NLYA 1WSIA 1YVFA 3L2VA 4K4YA 4Q45A 3RMCA 1SKSA 3KHRA 3V9UA 4RNMA 3D45A 3PW7A 3ALYA 4WFZA 2XI3A 4WE1A 5EWGA 2UVRA 1D9DA 2W9AA 4KV8B 4DFMA 5KFZA 2F8SA 2HHWA 4GVMA 5KFLA 4M3UA 1DTQA 4QWEA 4NYNA 3AVAA 3M8QA 2ZE2B 4IFVB 4IKAA 4I2QA 4M95A 2GC8A 3M8PB 4BDZA 3SPZA 5KFJA 1CLQA 3TAMB 2P5GA 3HVTA 4FJJA 5HRPA 3TWHA 1NNDA 4QW8A 1FKOB 4DQQA 4CEEA 3ZSOA 1VSEA 3RWUA 3BSAA 5KT4A 3HXMA 1QSSA 1RT4B 5F9LA 2OZSA 1IKVB 5L1LA 1W9HA 3ZT4A 5HBMB 4OLBA 3TAFA 1JLBB 4OKEA 1NJZA 4ED3A 2JEFA 3WNEA 3OYDA 3RAXA 3KK2B 3TABA 5T7BA 3OHBA 2IAJB 1GOCA 1HQUB 1YTUA 4F4WA 1NKBA 2YNIA 4L8RB 3PJXA 5DLFA 4X2BA 1NK9A 1WSEA 2BDPA 3QINA 4ZVHA 1RBVA 1C1BA 4DF8A 4CJPA 3PX4A 3VQQA 2D0CA 4YQWA 3VQ4A 3UQSA 3MECB 2QV6A 3AO2A 3JYTB 4WE1B 3LPUA 4KREA 4M3RA 3EZ5A 4DTNA 5DGAA 1DTQB 3UR0A 1RTIA 1BQNA 2D3UA 1IKYA 1S9GA 1X9WA 1NHVA 3LP2A 1RT3A 4CHZA 3PW5A 1ZBIA 2W8LA 5HP1A 5KFPA 2ITGA 1TAUA 1N5YA 2P51A 3KMSA 4RW9A 4OKJA 3NF8A 4CJWA 3HVTB 3GIIA 4H4MA 1NKCA 3V9ZA 4DFPA 3PZPA 4K4TA 3HJFA 4OGEA 5KFHA 2FVCA 3CJ4A 1RBRA 4KB0A 4F4YA 4CERA 4OL8A 1HRHA 3S3NA 2G8WA 3IAYA 4KI4A 3RTVA 3GV7B 4CECA 2DPIA 3SV4A 1T7PA 1S0NA 2PY5A 4CJTA 4E3SA 3UIQA 4KFBA 4NLGA 3DRRA 4DFKA 2YNIB 5KFIA 3GIJA 3LP0A 2FVSA 4CGGA 3VQEA 5KFBA 4K8ZA 3VA3A 1RILA 1WAJA 2E4LA 1VSFA 4MKAA 4I2PA 3KMQA 5FRMA 1C1AA 1RTIB 1BQNB 4EYIB 1IKYB 1S9GB 3M8RA 4FLXA 3LP2B 4MK8A 1RT3B 2FLPA 2D0AA 1U48A 1QS4A 3VQ7A 5HP1B 3PUFA 4ELUA 3ZSZA 3OL6A 1N5YB 4DF4A 2XY5A 4RW9B 3T5JA 3MEGA 2UVWA 4B9TA 3ZT1A 3EPIA 3Q8PB 5F8IA 4ICLA 2WK4A 2XRIA 4I9LA 3OJSA 2XO7A 2R2SA 4CJKA 4DEZA 3VQ6A 2R2RA 3Q8RB 4CEFA 3P1GA 2AGPA 4KHNA 4KPYA 3DLKA 1VSKA 1RBSA 2IBKA 3ISND 3QERA 2G8IA 1XHZA 4DTMA 3BSCA 1WSHA 5J2MA 4KFBB 3V9SA 4CE9A 3DRRB 3MFHA 5I42A 3N6NA 4DSFA 4RW4A 4FJXA 2I1RA 3V6JA 1TGOA 3QEPA 3PVXA 4J2EA 1XR5A 3DLRA 3Q8SB 3LP0B 2VG5B 4EZ9A 4CK1A 1RBTA 4XO0A 3DLBA 2RF2A 3H5UA 4LY7A 3CDUA 3IS9A 1S10A 1JXEA 1MU2B 4I2PB 4UQGA 4M45A 1KRPA 3TR8A 3HK2A 3LDSA 4KTQA 2RKIA 1ZBUA 3HVRA 2FJWA 1C2PA 1UA1A 4GW6A 4J2AA 1HNVA 3VA0A 3L3UA 4FLVA 2XGPA 1VSJA 3QGGA 3PR4A 3MEGB 1T94A 5L9XA 1HMVA 1S9EA 3NAHA 2JEGA 5KG2A 4DTOA 4CHOA 3T1AA 4LSNA 3AA4A 2D3ZA 1S0OA 2ZQBA 1TK0A 5J2QA 2FVPA 4MIAA 2B6AA 3G86A 4ECWA 1S1WA 2FJVA 4EO6A 4GMJB 4DS4A 4O0JA 1S6PA 4URSA 3THVA 3DLKB 2UVUA 1Q9XA 4DL2A 4O3QA 4CHNA 5KFOA 1JXBA 3SQ4A 5J2MB 3CFPA 3QYYA 3LWMA 2BRLA 5I42B 4F4KA 4IKFA 4RW4B 2IJFA 3TANA 4JLHA 1RT5A 5DK5A 4ED6A 2JGUA 1U49A 4FJ5A 2ATLA 3DOLA 3PW2A 2RF2B 4Y34A 1LWEA 3TVKA 1BISA 3IS9B 3ZSYA 2B4JA 5EU7A 4KTWA 4KAIA 3O3GA 2RKIB 3LWLA 3FSIA 4NZ0A 5KFFA 3G10A 4DQIA 3AO3A 2IGIA 1N48A 1HNVB 4URGA 4Z4EA 3WNGA 3HYFA 4XIUA 1Q8IA 3ZCMA 2XY6A 3AVKA 1HMVB 1S9EB 3PY8A 4PA1A 4DMNA 3NH0A 1JXLA 3QZ8A 3MR6A 4O5BA 4DS5A 2R2UA 4CFBA 4ZTFA 3OYAA 3GV5B 3WNHA 5J2QB 4DL3A 1FXXA 2B6AB 4IH6A 1S1WB 1HYZA 4IRKA 1TV6A 5DLGA 2XWYA 3SUOA 1S6PB 1TQLA 5KT7A 4CJ4A 4HKQA 4BE1A 2R8GA 3SI8A 5L1IA 3AVIA 2DPJA 4AHRA 5L1JA 1RT5B 4Y2AA 4N56A 4BDPA 4DQPA 2Y1JA 1QSYA 1S97A 4NYZA 3DI6A 1LWEB 4NCBA 4AHVA 1T05A 5KT2A 3NAEA 1BQMA 4LH4A 3C95A 3G6YA 2D5RA 1RT7A 3AVHA 4FK4A 1YT3A 3BQ1A 2FLLA 4KKOA 4LD0A 5KGXA 3SUQA 2E9RX 1JLCA 3OS2A 3AVFA 3S3MA 1WLJA 4IDKA 3KK3B 1LW0A 3ISNC 3MR3A 1T03A 3NMAA 3H98A 1L3TA 3QIDA 3OLBA 4DTSA 4G1QA 5HLFB 1C1CA 3H4DA 2YV0X 4CK2A 1JL2A 2VG6A 3H4BA 3RBDA 4Z0UA 4J2DA 4J9MA 4DQRA 1TKXA 3DLGA 4ED1A 1TV6B 1A5WA 4WZMA 3NFAA 3KTQA 3U3GA 1BGXT 3NGYA 1JLGB 4RNFA 3OYFA 2VA2A 3V1RA 4FLUA 2ASDA 4R5PA 2FBYA 1QAIA 4FJNA 3SUNA 1BI4A 4CESA 4G3IA 4CGHA 2AGQA 1WAFA 1Y97A 4RZRA 4TSXA 2Z1JA 3VQBA 3DI6B 2IDOA 2ZE2A 1T05B 1BQMB 3K58A 1RT7B 1REVA 2KZZA 4W5TA 3ZSVA 4QAGA 4ELTA 1TP7A 4GC7A 4DLEA 3M8PA 3I5BA 4IRCA 3H59A 3SZ2A 4KKOB 1FKOA 1JLCB 4K4SA 3HVAA 4LSLA 3KD1E 4RUCA 3NH2A 1JLFB 4DTPA 4B8AB 3QGIA 4FXDA 2B5JA 4ED7A 1XR6A 4OJRA 3OSNA 1T03B 4KSEB 1JLBA 1FK9A 4G1QB 4AH9A 3AVGA 4F2RA 1C1CB 4OLAA 2W7OA 3VQ9A 2G8KA 5HRRA 1RTDA 2VG6B 3CQ8A 2IM2A 2IAJA 4NLPA 1CZBA 5KG3A 1TKXB 1KLNA 3DLGB 5EUHA 2X74A 1VSDA 5I3UA 1N56A 4DTRA 4IRDA 3KJVA 5FRNA 4R5PB 1HNIA 3MECA 1DTTA 3PV8A 1K1SA 4FZXC 3JYTA 1BI4B 5DG9A 4WYLA 1K1QA 2FBTA 3O3FA 4HHTA 3EZUA 3BDPA 5CZ2A 2O4IA 3KLHA 3OYMA 2VG7A 4HYKA 5KFRA 4FLTA 2HHXA 3LZJA 5KT6A 3I8DA 1HARA 3OYBA 3BREA 4YNQA 1REVB 1I6JA 1N4LA 4M42A 4CGFA 5KFYA 3PHEA 4EP5A 4KBIA 4O4GA 4CIEA 4ECZA 4QWDA 3PO4A 4FLWA 3EYZA 3AO4A 1WNSA 1SUQA 4LSLB 2F8EX 4CJVA 5C24A 3ZSXA 1LW2A 4OVLA 2B5JB 1J9AA 5F8LA 3HL8A 4HUGA 1KHWA 1C0TA 4DQSA 4CJ3A 1HQEA 2HNZA 1FK9B 4AHUA 3CDWA 3V6KA 3KNAA 1RTDB 3V81A 4DL6A 3PW4A 1D5AA 2G8VA 2ILZA 3KHLA 2XCAA 4ZHRA 4K50A 4JS4A 1CZ9A 3K5OA 1S0MA 3ASMA 5I3UB 4O3SA 3LANA 4PWDA 2BR0A 4R8UA 2FBVA 3QIPB 1ITGA 3KJVB 3LP1A 4CJ5A 3QGHA 2KFZA 3CM5A 4EZ6A 2KFNA 4HUFA 1HNIB 3OS1A 4EBEA 1DTTB 3KHHA 2VWJA 2XHBA 2JLEA 1VRUA 4ED0A 3KLHB 2VG7B 3SQ1A 3IG1A 1EKEA 2IC3A 4MK9A 1RNHA 3ZT0A 4CIFA 4N47A 3E01A 4HUEA 4Q5VA 2IS3A 4O4GB 2BGGA 4FYDA 2YKMA 3L2QA 1S5JA 3F9KA 1SUQB 4W5RA 4J9NA 2V0NA 4IBNA 5C24B 3T5KA 4DFJA 1LW2B 3AV9A 4NRTA 4URQU 3MR2A 3RMDA 1BCOA 1C0TB 4B9MA 1HQEB 2HNZB 5JUMA 2XC9A 5DQIA 4QWBA 4JV2A 2IM3A 3VQSA 3V81B 4M3YA 2WRMA 3UPFA 2ALZA 4FW2A 4CEDA 2NUBA 2AX0A 4ZHRB 4WFXA 3NF9A 1O1WA 1UWBA 1S49A 4JRPA 5CZ1A 1RBUA 4PWDB 4TLRA 4R8UB 1N6QB 1G15A 4FJMA 2VG5A 3LP1B 4DWIA 5KFEA 5KFXA 3O4NA 4WXOA 1ZETA 1UAXA 4CFDA 5KGWA 4BE2A 3CDEA 4J9OA 1MU2A 5KT3A 3D0PA 1NJWA 4IH5A 5DG7A 1VRUB 1QE1A 3GV8B 3IG1B 2IC3B 4YR0A 1W0HA 4K4XA 1QHTA 4EO8A 3E01B 4ZVGA 3QIOA 3NGIA 3QZ7A 2YHAA 4J9PA 2YKMB 4KAZA 2WCXA 3CFRA 2XGQA 4O3PA 4FJLA 3SPYA 1RA6A 1JLQA 2HVHA 4KHSA 4DSIA 3K5MA 4CEOA 3TI0A 3C6UA 4FM0A 4EBCA 5KFSA 5E41A 3NGDA 2B43A 4IR1A 2KW4A 2QKBA 4CJUA 1UWBB 3CJ2A 4YMEA 4YR3A 4FJHA 4FBUA 2P1JA 4CJRA 4ECUA 5F8JA 3UDLA 3CO9A 4J9KA 4BACA 4F4XA 4Z4IA 3NCIA 2EC0A 1GOAA 3B6OA 1TVRA 3PO5A 4FCYA 3I5CA 4KO0A 5F9NA 4CJEA 3OYKA 1RYRA 2G8HA 3CJ0A 3SQ2A 4N41A 2HHVA 2ATQA 4JV0A 2BRKA 4KB1A 1QE1B 1IKWA 4NLOA 2OZMA 5C5JA 4F3TA 3AVLA 4AHTA 3OL9A 1SKRA 4FJGA 5KT5A 3RR7A 3KLIB 4F8RA 2PYJA 3MR5A 4B9SA 1TK8A 3KLEA 3M8SA 3NDKA 3HPHA 1VSIA 4TQSA 3LAKA 1BCMA 1IG9A 4N5SA 4ELVA 1JLQB 5EDWA 3OSPA 2OPPA 4IR9A 1RT2B 1QTMA 3OYCA 5SWMA 3RBEA 3C6UB 4ZP9A 2AJQA 3KOAA 1TKTA 3AO5A 4ECRA 2HHQA 3FRZA 1KSPA 1B9FA 2YHBA 3U6FA 3IGVA 4ZP8A 4LQ3A 3OYNA 1QQCA 4QOZB 4FW1A 3SUPA 4Z4FA 5JS1A 1XI1A 1RT6A 3RMAA 3DDKA 1TVRB 2GV9A 1WNEA 4KO0B 3DLHA 3G6XA 3AVBA 4CGIA 4IFYA 3PX0A 3LAMA 2GUIA 1HPZA 4RW8A 2GIRA 4CCHA 4C8OA 5CYQA 4DL7A 4MK7A 5FDLA 1IKWB 4ECQA 4O0IA 4MFBA 1JL1A 2HWHA 3Q8QB 4FZYA 3KK3A 3AA2A 3OHAA 4C8MA 2I5JA 2WHOA 4NRUA 4PUOA 3KLEB 3JSMA 3KKRA 4R0EA 3KD5E 3P5JA 4Y1DA 3V9WA 5HLFA 4RUAA 3L2RA 1VRTA 1S1VA 4WZQA 2OPPB 3K2PA 2W9CA 1XWLA 4NLDA 5DG8A 4NCGA 3RB4A 3ICLA 4ID5A 3S3OA 3D28A 2YNHB 2RN2A 3IN5A 1TKTB 4M3XA 5KG6A 4M3ZA 1JLGA 3HPGA 5K14A 4E89A 4ECSA 5T14A 1RTHA 4CFAA 3SFUA 2HHSA 4CGJA 3F73A 2IJNA 4Y2CA 4BDYA 4E1MA 4J9RA 1R0AA 3SCXA 1NK8A 4Q0BA 4FLZA 3NBPA 3L3VA 3A2FA 1RT6B 1LV5A 5C42A 3FDSA 1RDBA 4H8KA 3RB0A 3VQAA 3NKYA 4IFYB 5D3GA 4TXSA 5KFGA 1UOCA 3AVMA 3PJWA 1NJXA 3RRGA 4KHYA 1HPZB 4RW8B 1RCHA 3V6HA 3I5AA 2R8KA 4E7JA 1WSFA 1ASUA 2EX3A 5CYQB 5FDLB 1HJRA 3EPGA 1IM4A 3MXMA 4M41A 4MFBB 1S4FA 3DOKA 4ZP7A 1JLFA 4MKBA 1S1UA 3TAQA 4TY8A 4Y3CA 3U3YA 5JXSA 4CF0A 2I5JB 4FVMA 3LALA 3K57A 2OPSA 4PUOB 1LWFA 3VQCA 4FLYA 2J6SA 3JSMB 1I3AA 4CJLA 3NE6A 4PY5A 2Z1GA 2UUTA 1VRTB 1S1VB 3ZSWA 2YNGA 4CHPA 3CVKA 4KHQA 2W9CB 5F8GA 2BE2A 2HWIA 4NCGB 3SNNA 3M9OB 4ID5B 3GIMA 5C25A 1Z4UA 3CJ3A 1NOZA 4YFUA 2E9TA 1ASWA 1VSMA 3H08A 5K14B 1TL3A 1TKDA 4FZZA 1RTHB 1RAJA 1WN7A 3HP9A 4CHYA 1SL1A 3CFOA 4FM1A 5KFQA 5KRSA 4PQUB 5EWFA 3H5YA 2E6LA 1R0AB 4Q0BB 3NH1A 3NBPB 5HRNA 2P5OA 5C42B 4EEYA 1XR7A 4O3RA 2HVIA 5D3GB 3HM9A 1BHLA 4FBTA 2OPQA 3I0RA 4TYAA 3AVJA 4O55A 1EETA 2R8HA 3OY9A 4NLQA 3BR9A 3DOKB 1S1UB 3T19A 3OLAA 4TY8B 4OPJA 2ZD1A 2OPSB 1KVBA 1LWFB 3V1OA 1RT1A 1X9SA 3OYLA 3RB6A 3OJUA 2CJQA 1L3VA 1QSLA 2GBZA 4HVJA 2YNGB 2D41A 3KLFA 2BE2B 4DTXA 3QO9A 1U47A 4E7LA 4Q8FA 4CEBA 5C25B 3OYEA 2C22A 1NOYA 3QEWA 4FK2A 3RR8A 2Y1IA 1CXQA 3ULDA 4KHMA 3VQ8A 4CGDA 2HNYA 3QIPA 3GILA 2XI2A 3FQLA 1TL3B 4KE5A 3TARA 3MF5A 3K59A 2QE5A 4ZVEA 4H4OA 2W8KA 3MFIA 3TQ1A 1LAVA 3SFGA 2FBXA 3PX6A 2AWZA 4DL4A 2ASLA 1RTJA 4BE0A 2UUWA 4K4WA 4Y1CA 2KTQA 2YNFA 1OS5A 1KHVA 3V6DA 2OPQB 4B9UA 1NK6A 3BSNA 3I0RB 3DYAB 5KFDA 5DMRA 4DSEA 1EETB 2KZMA 2O5DA 4ECYA 4CHQA 2FC0A 4LQ9A 4ZPAA 1XC9A 2XCPA 5SZTA 5DQGA 1S1TB 2HMIB 4U7CA 5KI6A 2ZD1B 1JLAB 3VQ5A 1NK0A 4M3TA 1BL3A 1ZTWA 1YTAA 4NLRA 1RT1B 5FROA 1D0EA 4MH8A 4F2SA 1KLMB 2F8TA 4J9LA 4M3WA 4DG1A 2RDJA 1RDRA 3KLFB 3QO9B 1QUVA 1ZBHA 4E19A 1EP4A 3V9XA 2PZSA 3OYGA 1XHXA 1T8EA 3OS0A 2GIQA 2FLNA 1NK7A 4HCCA 2HB5A 2E6MA 4CEZA 2HNYB 5J1EB 1N6QA 1Q9YA 4B9LA 4AHSA 2R7YA 2KQ2A 3AA5X 3O3HA 4H4OB 4RW6A 2G8FA 1ZTTA 4NLWA 4NLSA 4DLGA 4CJSA 4CF8A 3VN5A 1BIZA 4ZPCA 1RTJB 4E7KA 1K6YA 3OYJA 2A1RA 1Z25A 3BQ2A 2YNFB 4QPXA 4CF1A 2X6SA 2RPIA 1FKPA 3V6DB 1ZBLA 4F3OA 3IGNA 4K8XA 1KVCA 1IKXA 5KFCA 4Z4HA 2VWKA 3QLHA 2DFFA 5KFNA 4RG8A 2DY4A 1X1PA 3M8QB 3L2WA 3OL8A 2OA8A 4I2QB 4CK3A 4FM2A 4O44A 4EBDA 3ITHA 1HYSA 3MEDA 1KFSA 4ZVFA 4CJQA 5KTQA 3NGZA 1JLEA 4DG1B 4QWAA 1TL1A 4NLVA 1GX6A 4CF9A 1JKHA 2C2EA 3DRPA 1HYVA 3H5SA 4EP4A 5F8NA 1EP4B 2HNDA 3OVNA 3QEVA 4RNNA 4KB7A 3VQDA 3T5HA 5EWEA 4KTZA 1U04A 4O3NA 5KFUA 2BQRA 4ZP6A 2OH2A 3BGRA 3RRHA 4RW6B 3H40A 4DSJA 4TYBA 4Q8EA 1NJYA 4CFCA 2R2TA 3MTKA 3T5LA 2XY8A 3CG7A 4FJ8A 2YKNA 4K4UA 1UA0A 5KFKA 4F4ZA 3N6MA 3ZSQA 3SV3A 3CIZA 1ZBFA 4NYFA 1RA7A 4ED2A 1C1BB 1LWCA 1FKPB 4U6PA 1D1UA 2OPRA 3KLIA 1SV5A 1L5UA 1IKXB 1S9FA 1VK0A 2HHUA 1TAQA 4IQXA 3CWJA 3QLHB 2WONA 4DTJA 2PYLA 4XPEA 4CJFA 3NF7A 3S9HA 3M9NB 1A5XA 3VQPA 1VSHA 4I7FA 3KLGA 1RT2A 4C8LA 4O44B 3QEXA 3ZSRA 1KFDA 3ITHB 4LH5A 1HYSB 3MEDB 4JS5A 4K4ZA 3NAIA 4ZPBA 4TQRA 4J9SA 4DL5A 3L2UA 3MXJA 1JLEB 2R8IA 1SL0A 5KG1A 1TL1B 4H4MB 5F8HA 2JC0A 1JKHB 3DRPB 1TK5A 2WB4A 2WOMA 3TAPA 2HNDB 4H54A 1B92A 4Z4GA 2AU0A 2AGOA 4KRFA 2W7PA 1RDAA 1C0UA 1U09A 1KCFA 3H5XA 3BGRB 5DGBA 4K4VA
chains in the Genus database with same CATH superfamily
1HNZK 3W3SA 1D8YA 3MCAB 4DHVA 2YKNB 3HPOA 3F5TA 2L9DA 4WIIA 1F21A 4NLUA 3K0SA 4U7BA 3W63A 4WQ5C 1RWNB 1YI2S 3WEEA 1HIYA 5IZHA 3EXCX 2OPRB 1TKZA 1BO5O 1SV5B 3MK6A 4Z7YA 3R6MA 1EB0A 2HOEA 4DKWA 3VEZA 1VFJA 2R7UA 5ETTA 2VA3A 3QNNA 1FDNA 3ZZUA 2JC1A 1UEKA 3ENVA 3EY1A 5KFMA 3T41A 3K5LA 2PI4A 4I7FB 1WHYA 2FD2A 1KAYA 2GO8A 1XNRJ 3GJSB 4ZVUB 5CYMA 1JK9B 1IWAA 1Z26A 3NS7B 3HT3A 4JI1F 2J7WA 2JEJA 1ZYQA 4YORA 2DFEA 3DXBA 2I38A 4ID8A 2VIHA 4JV1A 4B9VA 1VBYA 3DRSA 3CCTA 2UXCJ 1WORA 5AQSA 2VV5A 4JHDB 1NMNA 4JRQA 1SVDA 3ZX2A 4W5NA 3V4IA 3FZHA 1FD2A 3S6EA 3FBBA 3HMJG 1EQYA 4A5BA 4B3OA 3FBCA 1PC5A 4AT1B 2YQ3A 2IM0A 3NEKA 3CPWR 4IG3B 3M30B 4ES2A 4BQZA 2IIHA 4FJIA 1ILYA 1G3OA 4CP5A 3DNCA 3N6LA 4NLXA 3CCQN 4WFNQ 2P9SA 3DHWC 4OGCA 2BQ3A 3AAPA 4USKA 4FPIA 3HHLD 2WB1D 4KI6A 4IOBA 2N7CA 3CHWA 5CABA 3AD7C 5HOOA 1VQLN 2EC2A 3MDFA 3HVWA 3SQOP 2LEAA 4RW7A 3A0IX 4X4SA 3IRXA 1ZBSA 1VQMN 3BY5A 1J6ZA 4XPCA 1SJ4P 1O0PA 1SKWA 3S01A 1Q4RA 5IS2A 3CJTA 2W9BA 4PQUA 2MJNA 4H03B 4HTUA 4TNOA 2QZ8A 2PA3A 2Z1HA 2BTFA 4OPKA 4DV3K 3G0ZA 2GJIA 3HKWA 4DV0K 1S1XA 2V4QA 3MM5B 3A5LC 1J5OB 2EG2A 3U27A 4PZVA 5L1KA 2FSJA 4AFFA 1VC5A 1RDDA 5E0OA 5FJ4A 5LJ3Y 4C8KA 1ASVA 1D9FA 2LDIA 3LOUA 2XHWA 2L48A 3E51A 2W2MP 2AHOB 1P6TA 2EPIA 2F7VA 2E2QA 1M5OC 5KG4A 1IQTA 5KG5A 2XLKA 2JEIA 4BWMA 2ZH2A 3J7YU 4UW2A 2B4UA 1MWYA 3SEOA 3NOCA 3TVZA 3I0SB 3TJ8A 3VAHA 2CQ1A 3BB5A 2DY9A 1F5AA 3KK1A 4N77A 1Y64A 3LPTA 1GH8A 2GJFA 5HJYA 5AZIA 4LF1A 2JZ5A 3KUEA 4B9NA 2VQFF 2ZHBA 3D2EA 3SAHA 2FVQA 2DNHA 2NSCA 1Q8LA 4CO3A 3CIMA 2LA4A 3GR1A 1YK9A 1VQ8N 3W2VA 4I9QA 3HBTA 2X78A 1HHQA 3QNOA 1LKZA 2YWKA 3LZIA 4NOHA 3FFIB 2IOCA 4ECXA 3WIUA 2C28A 2DHGA 4M94A 1EHWA 1U4BA 2L9NA 4DCPB 2CPZA 4DR3K 2HK2A 3SJHA 4CLZA 3MPWA 5CY4A 2ASJA 3GG0A 1KVIA 1JIHA 1EX4A 1GOBA 1JLAA 5J2NB 3CJSA 1RB0A 3TUZC 2E9ZA 3K7RA 2AT1B 1KLMA 2H54B 4F0HA 3ZT2A 4ECVA 2NLXA 1SJ1A 3G2XA 4ZIWA 4MKVA 3BR8A 3EEQA 4LIWA 1R6YA 3BJYA 3J7AN 2BJ1A 1KS2A 2EHGA 4B08A 2AF6A 1KTQA 1I39A 4NA2A 5ITHA 1J5EF 2DK2A 4L75A 4YOVA 4X4NA 1HNXF 5LXRA 2WC9A 2K2PA 4JI1J 4KY3A 3RMCA 1Q78A 2ASPA 2F9DA 1WI8A 4W90B 4RNMA 2RQCA 4CH1A 3ALYA 2JLGA 1S6UA 1GLBG 4WE1A 1CEZA 2GS8A 4PYAA 3KHYA 5KFLA 1ZA2B 2CXEA 1DTQA 3ZZPA 1X9JA 3CCWA 2OJ3A 1CC7A 2Y8YA 3TRGA 1FFSB 4I2QA 2CVEA 4BRQA 1UMJA 2GC8A 3M8PB 4BDZA 4FJJA 3TWHA 4ANEA 1FKOB 1KQFB 2KXFA 2GMLA 3TO8A 4ZVQB 3MMAA 1XIQA 1I94F 1ITPA 3RWUA 3MXHP 1S3XA 1M1GA 3SSSA 1BA1A 3G8TA 2UYTA 2QMXA 2H3EB 4DR6K 3OYDA 4DUZK 3QJLA 3ZO7A 2YPYA 3PACA 2VFTA 4BRMA 4F4WA 2YNIA 1XTZA 5A0YB 3ZTRA 5DLFA 2JX2A 4ZVHA 1FW6A 3U7JA 3BM7A 4QIFA 4CJPA 2MZTA 2D0CA 2LVWA 4YQWA 2RE1A 3AO2A 2BE7D 3CMEN 3UR0A 5CYJA 3CPEA 3BEXA 1NCLA 4CHZA 3PW5A 1ZBIA 4OHYA 5HMZA 5KFPA 4HTLA 4AM6A 2J0WA 1N5YA 3KMSA 2QXLA 2EBEA 2YX1A 4CJWA 1RISA 3I31A 4NPOA 5IWAK 3NCQA 3V9ZA 3PZPA 5KFHA 1OH8A 4KB0A 1OJ4A 4HDHA 2YVSA 5HL7L 2DPIA 4AF1A 3SV4A 3VAKA 1S0NA 6AT1B 4CJTA 4J7CA 3UIQA 3DRRA 4DFKA 4WU2A 5KFIA 2Q97A 1VC6A 2PBDA 2WFBA 3LP0A 2A1BA 4WKYA 3O9SA 4CGGA 2YWGA 3G87A 1YGYA 3VQEA 2VQFJ 1B64A 1WC5A 5KFBA 1GLLO 2J7UA 2KYXA 1WAJA 2DR8A 3QNWB 3NVMA 3SAFA 2GO9A 3LA0A 2CPJA 4D3GA 1BQNB 1IKYB 2RQ4A 3L09A 2QN6B 4MK8A 2FLPA 1U48A 1R8HA 3MCNA 2FSKA 4ELUA 4UZBA 1CJVA 2XY5A 4RW9B 2HS3A 5KQ8A 5I3PA 3HD1A 1T6DA 1JMTA 4CZLA 3ZT1A 3EPIA 1BWEA 1HKGA 4QYRA 2XRIA 4I9LA 1HJOA 3J7YP 4KPCA 1F5BA 1MWZA 1I1GA 2XO7A 5GADP 3JQJA 4P2XA 4FOIA 3R5GA 1WTBA 4GV6A 2R2RA 1NJIT 2FIUA 3Q8RB 1SC4B 3O3LA 4V19S 2HQGA 2UV8A 1P90A 2YJEA 1XHZA 2QL7B 5J2MA 4IYQA 4CE9A 3MFHA 5I42A 4F25A 4DPWA 3THXB 2I1RA 3V6JA 3QEPA 1XR5A 3DLRA 1J5EJ 4CK1A 1ATNA 5HSPA 1RBTA 1HNXJ 3B78A 3DLBA 2O8DA 4LY7A 4DU7A 3IS9A 1DAXA 1S10A 3C19A 3JQKA 4UQGA 4AQYK 3UWTA 1V3SA 1SC1B 3EM1A 2LQBA 2KLAA 2HBYB 3BO2A 3N01A 1UA1A 1JCFA 4FLVA 1H3DA 1WUAA 3CIPA 2BJ8A 1T94A 1S9EA 4A4JA 1MSWD 5CR4A 4DTOA 4FPRA 5EXWA 2UUBK 2QSWA 3UNYA 2B56A 3TWZA 1TK0A 4PQAA 4DV4F 2FVPA 2FJVA 5H9FK 1R59O 1S6PA 2FYXA 1I94J 1Q9XA 4P74A 3KUGA 3MM5A 2JL9A 4IKFA 3TANA 1S76D 5MAOA 2R7TA 4MAKA 2MHNA 2GHPA 4ED6A 1WHXA 4FJ5A 2RF2B 4BS2A 4Y34A 5B0BA 5LJVA 2NUHA 4USJC 2R7OA 3ZX3A 2CGLA 4NZ6A 3QQCD 2WSFC 2RS2A 1HW8A 1YJUA 4CZMA 2YY3A 2MSSA 3W9HA 1U6BA 3P45B 4DQIA 4B1WB 2HVEA 2QLXA 1YXQA 2IGIA 2DB1A 5IV3A 4XIUA 4B1VA 2M52A 2EFPA 5GAGI 3C15A 3M2UB 4ZCLA 1RZMA 2F9TA 2XY6A 5ETOA 3PXGa 1FRMA 3OA9A 3QZ8A 4K42A 3GV5B 4BRAA 5J2QB 2KXNB 3LM2A 2B6AB 4BRNA 1S1WB 1OYEA 4LFBF 2HPUA 1U1MA 4ZA1A 2IVOA 1TQLA 4C4WA 5KT7A 1BMQB 4I64A 3CCZA 4BE1A 4CT8A 3AVIA 2WVBA 2DPJA 2CGKA 4BDPA 4N56A 1S97A 3A3NB 3X3UA 2MQLA 1PBAA 4XDDA 3DI6A 4AHVA 5KT2A 2RD5C 1BQMA 3C95A 2D5RA 2AV5A 2PIIA 4DV5K 2PFUA 3G6EN 2KM8C 1UVMA 2EG1A 1M1HA 1Q95G 2V8VA 1B70B 3R5AA 5KGXA 2OSQA 1X5OA 1P9QC 1WLJA 2HG4A 2BZ2A 4NI2B 3ENWA 3MR3A 4C3LA 1WBBA 2VU5A 2J0QD 1IVZA 2YWWA 3QIDA 3R7BB 2YV0X 4A2BA 3UR3C 1JL2A 5HJXA 2NLWA 2HBQB 1NJIO 4J2DA 1WWHA 4J9MA 2J4RA 1TKXA 2XM3A 1TV6B 1X4GA 1N5SA 1NLKL 3U3GA 5GAEI 2P9KB 2Y1LB 1NU0A 4RNFA 2FJDB 2VA2A 3V1RA 5LXYA 3VAJA 3PSFA 2ZJQQ 1RHKB 1HI1A 4CGHA 2AGQA 1VHIA 1UPPA 4NO7A 2DNLA 1REVA 2KZZA 2VFRA 4ELTA 4W5TA 4GC7A 2QL5B 1GQEA 3M8PA 1G2EA 1N5TA 4ISFA 3R5JB 1FKOA 3HVAA 4DL0C 2E1PA 2I7NA 2ACYA 1OPIA 1Q5YA 4FXDA 2B5JA 4JNEA 1O13A 3D6HB 3TTCA 4KC5A 4JI8K 1TR0A 2CA9A 2ABYA 1VQ7N 1XBWA 1U1OA 4M63C 1X4BA 3C7NB 3BKFA 4NLPA 1ZM2A 2E1MC 3M6GA 5A0YA 1VSDA 5I3UA 4GVBB 4R5PB 1HNIA 4FF3A 4G1IA 1YJ9S 4AL6A 5BRHA 3F41A 1WKLA 3BDPA 5CZ2A 1KKHA 4FLTA 2DNMA 3DHXA 3I8DA 4CLPA 3CQXA 4YNQA 4DR7K 4FVCA 3MOZA 1N4LA 5KPRA 4CGFA 3VF2A 3O5TB 4O4GA 3TTFA 5AQMA 4BR0A 4CIEA 4PEOA 2G1HA 2P9LB 4LSLB 4GRSA 2QA1A 5GINA 5LMNJ 3T69A 1J9AA 3D0GE 5BREA 5DDOC 3HL8A 3GG1A 4ALZA 3MHYA 3OW2R 2Z56B 3CDWA 4RWTA 3FJ2A 2X3GA 3KWMA 2HFSA 5IC6B 4CZHA 2AKWB 1QHAA 3MMJA 2NQPA 5D4NA 3KHLA 2XCAA 4ZHRA 4K50A 4JS4A 5EX5A 3K5OA 3LANA 3OVSA 4R8UA 2F9WA 1XN9A 1P1LA 2KFZA 4PKGA 3CM5A 3J80O 4USWA 4X65K 1DTTB 3AXMA 4LFBJ 2DNGA 3C65A 1KQSR 2XHBA 5LSOA 2K8GA 1FE4A 4USUA 2VG7B 3SQ1A 1EKEA 4MK9A 4FYVB 3JS9A 4OX8A 3CCES 2B4PA 1S6OA 2ITMA 1UEUA 2GWJA 4CM2A 2OTLN 4Q5VA 1HBUB 3BYRA 4FZVA 2Z4PA 2IS3A 1BY9A 3GJRB 3LL3A 2YKMA 1WDTA 2VPXB 3A13A 2NZCA 4YOYA 4W5RA 4J9NA 4JI6K 3U4LA 4DFJA 3AV9A 4JKCA 3FRYA 4EU0A 4ZVOB 4LT6A 4URQU 3RMDA 4L6V3 2Z2MA 4PAAA 3U02A 2FJAB 2XC9A 2QLFB 5THWA 2IM3A 3VQSA 3V81B 2E1AA 1NGFA 4IOXA 2A2CA 7AT1B 4A8OA 2NUBA 2YJFA 2R7QA 3I9ZA 4ITSA 4CNYA 4Y65A 4ZN3A 1RBUA 4QYZK 1G15A 1N6QB 3NGTA 3LP1B 3D2FA 1UAXA 4ZKAA 5KGWA 4H5VA 1RHMB 3CB4A 4X62K 4QS7A 4ZN1A 4CO1A 3CJBA 3BGOP 1VISA 1N0VC 3D0PA 2I6WA 1QE1A 2ZUGA 5EX0A 2FC8A 1N36F 3GV8B 3IG1B 4DUYK 4K4XA 1QHTA 2GQ2A 2ZH1A 4QIGA 1IBLJ 3CCLS 2B9XA 1LQ9A 4Q2LA 4F36A 2BJ7A 4M8LA 1Y9OA 3HSZA 3EE3A 5E5NA 4O3PA 1ZS6A 3QFWA 3CC4N 4FJLA 3AAQA 4KHSA 4DSIA 4GV9A 3QT6A 1RU2A 2YQ0A 2E2OA 4A8MP 2AYBA 1R89A 5KFSA 3CCUS 3C14A 1KP6A 3ULEB 4Q7AA 1C0FA 4ZK7M 5AXLA 1QD1A 4ER8A 2VF3A 1XJWB 3CJ2A 4FJHA 4FBUA 3TX8A 4DN9A 2AJ1A 3UDLA 4J9KA 3NCIA 5JVGL 3B6OA 1TVRA 4B9QA 4FCYA 5J1PA 3I5CA 3FFKB 4KO0A 2M8HA 5F9NA 1NXIA 3SQ2A 1TUUA 2QFIA 4P2MA 2ATQA 3E8OA 3J80Y 3VAGA 3POTB 1AXQA 2OZMA 1MN7A 4F3TA 3VWSA 1SKRA 4AHTA 2OFGX 3RR7A 4QIVA 1URRA 1QQNA 3U1NA 2Q3PA 1TK8A 3LTOA 2K3KA 3M8SA 3NDKA 3D2WA 1N5QA 2K7KA 1VQNN 1LOTB 2JFKA 1RT2B 1SJ3P 4DJBA 2EFNA 1N33F 1QVFR 1IBMF 3KOAA 1TKTA 5AQTA 4ECRA 5E7OB 2AEFA 1BU6O 5K9FA 2RJZA 3DLLQ 2XLIA 4F26A 4Y00A 4FWNA 1KQKA 2ZGYA 4FW1A 1A0OB 3D54A 1XMOK 2W1BA 2LEPA 3N4WA 3KKFA 4ES1A 5D78A 4FKXA 2JWKA 5BRDA 2QWOA 5RUBA 3DDKA 1DFDA 2F7TA 2GV9A 1WNEA 4UY8T 4GKJK 1DJ0A 3PX0A 1HPZA 4RW8A 3IO1A 2QFJA 3DGPA 5CYQA 4TLQA 5BN8A 2CQ0A 2E44A 3Q22A 4E8UA 1S77D 3SCLE 4QZVB 3VAMA 4GY2B 4DR1K 3KLEB 2MQPA 4Y1DA 3V9WA 2UUAF 2CJAA 3OTBA 2OPPB 5CZVA 5F1XA 1YIJS 1BUXA 4M3XA 3IN5A 5KG6A 3G82B 3HPGA 5D8HB 4EAHD 4ECSA 1K44A 3CDAA 2HHSA 4CGJA 4EUVA 3F73A 2IJNA 3HULA 5ETNA 4IQMA 4E1MA 1R0AA 3D1HA 3ATVA 1LV5A 4RBUA 2WTUA 4B3MK 3GG4A 2O8FB 4N7TA 4KH6A 4MYTA 1G4CA 3TEHB 3VQAA 5KFGA 3PJWA 2FQQB 2CNKB 4HHHA 3OR1B 3F56A 4WFAL 3I5AA 4E7JA 1NGAA 1U1KA 4F4AA 2VC1A 3J80U 1RGVA 3EPGA 2P9NA 1IM4A 3MXMA 4M41A 2Y1RI 5AJ3F 5DM6L 2QA2A 1S1UA 3TAQA 4X64K 3N79A 5JXSA 2CWKA 2I5JB 5ETVA 1HL6A 3VQCA 1N36J 2J6SA 3NCPA 3HF5A 4PY5A 3CETA 3VEVA 4X4UA 3J7Z5 3CXCM 3FEZA 4CHPA 2K1RA 3MOJB 1HWJA 1WEXA 5EY4A 4EHTA 1HNWJ 1Z4UA 3CJ3A 4YFUA 1P27B 1ASWA 4ED5A 1S59A 3H08A 1UKUA 1T3OA 1TKDA 1MLAA 1U1NA 1D8ZA 4LF5F 4OI1A 3C6HA 3CFOA 2E7WA 3DDIA 5KRSA 5EWFA 4FN5A 3H5YA 5DO2A 3RU0A 3NH1A 3NBPB 5HRNA 5AXMA 1U6FA 4DR2K 2CYYA 1N52B 2P5OA 5C42B 1FWLA 2M2BA 4EEYA 3HOTA 3OR2B 3VZHA 4O3RA 1WEZA 2RILA 2F4VF 2B9YA 3SAGA 3VGMA 1BHLA 2OPQA 1XUPO 4H0OA 2CJYB 4DBQA 2A5XA 2HQCA 3ILIA 4CZCA 3DOKB 2X7IA 1VK8A 1QAYA 4TY8B 1UCNA 3OQ2A 2ZD1A 1OH7A 1OSDA 2UUCF 4FWKA 3SLCA 1X9SA 2D3O1 2XHCA 1RE1B 4WIQA 4MO5A 1NRKA 2GBZA 4OYZA 3KLFA 3EZWA 4IJNA 4E7LA 2UXDJ 2LP4A 2BM0A 3OYEA 3M8YA 5AQRA 2B7BB 2XI2A 4KE5A 3MF5A 3FGVA 1EARA 3K59A 3MM9A 2GVZA 2HBMA 1N33J 4LF7K 3SFGA 1IBMJ 1UW4A 3AOBA 1H2UX 1RTJA 4GVEA 4YB6A 5EGYA 1YJWN 3IRWP 3VGUA 2NPIA 4G1PA 4UY8O 2YHYA 3V2UC 4JI4K 1ZM3A 5A2QO 4NXNF 2V2ZA 3BSNA 3I0RB 2CQGA 5DMRA 2O5DA 5B08A 4ECYA 2HQ3A 4C2MA 1Q1KA 2XYHB 4CLTA 2LU1A 1SCJB 2ZBPA 5SZTA 2EK6A 4H4KC 4EFAC 5DQGA 4OPAA 2QGFB 2DD8S 3J7YI 4M3TA 3EGWB 1NK0A 5GADI 3C6AA 1ZTWA 1YTAA 4NLRA 1D0EA 4YUDA 3MCMA 4RR5A 5LMUF 3MI7X 4YB5A 4OYWA 1RDRA 3OTDA 1WBDA 3ZYYX 1QUVA 5AZJA 3N5BA 1WOPA 5E33A 4C0HA 2NRXA 4KHPK 1NM1A 4HR2A 5IV4A 3NGRA 2E6MA 4CEZA 1N6QA 2UUAJ 4BLGA 4AHSA 2KQ2A 4R79A 4PWWA 5HI7A 4P9SA 3BH7B 4H4OB 5GAHU 3QWUA 4YDDB 3THYB 1URNA 1YX2A 1VHXA 4CF8A 3ZLJA 4ZPCA 1YI2N 2MQNA 1PG5B 4YY3K 1FJGF 2FTRA 2F1FA 3R2DJ 1Z25A 2GMJA 4CF1A 5GIPA 2E1YA 2RPIA 3V6DB 1ZBLA 4FWQA 4OYAA 4ED4A 4NA1A 5KFCA 2VWKA 4BRFA 3QLHA 5KFNA 4RG8A 1X1PA 3C46A 1OH6A 3MN7A 2CH6A 4CK3A 2YI1A 2K7JA 1KAZA 1FRIA 1HKBA 5DDQC 3MEDA 3CCVS 5FD1A 4ZVFA 4I67A 3NGZA 5AJ3J 1W7WA 5BR8K 1X4EA 1NEEA 2HIYA 1GX6A 1JKHA 2C2EA 1VIXA 4C1NK 1MWKA 1RWPB 4JOUA 4USIA 4DV6F 2HRYA 2BV3A 2HNDA 4RNNA 2EFVA 3T5HA 2Q79A 4BGAA 3JTOA 4MJKA 2LLZA 4ZP6A 2OH2A 4RW6B 2J76E 4DZDA 2R2TA 3MTKA 1Q82T 2XBPA 3T5LA 3CG7A 5KPTA 3Q2SC 2BJ3A 2NCKL 2G4BA 5KFKA 2DCUB 3ZSQA 3MAAB 2CPFA 4NYFA 4LF5J 4ILMA 5D0RA 1LWCA 3A4TA 1FKPB 2VOOA 2ZM6K 3C16B 2ZWOA 2RNEA 2DNRA 1HHSA 5L39A 3I8BA 1VK3A 2WONA 4DTJA 3AARA 3D3BJ 2F4VJ 3S9HA 2H51B 1A5XA 3VQPA 1T0TV 1YSJA 3GE9A 1RT2A 1W2IA 4O44B 2M9KA 3OFFA 1KFDA 4LH5A 4JS5A 5HATA 1YUWA 3NAIA 4ZPBA 4LFAK 2P8IA 1RBLA 3CJ9A 2XNRA 5KG1A 2A10A 4DX5A 2JC0A 4IEIA 3DRPB 2WB4A 5HMXA 1Z2ZA 2ZJPL 4L3QA 2MKYA 2UUCJ 4KRFA 1U09A 5D4PA 3FC9A 1WG5A 1YAGA 3H5XA 4X4OA 3ZEUA 5HVGA 4AXIA 4J90A 3GBTA 3O08A 2V94A 4K43A 4PXDA 1RUSA 1VLOA 1TFYA 1LEOA 2MKHA 3K8VA 4ILGB 1H73A 3CCRS 2O4GA 3H1QA 2IM1A 3DM2A 1NH7A 3FMBA 1AZSB 3DOMB 2QWQA 4ZPDA 1S4EA 1B0PA 4ZTJA 2QMWA 3P6YC 1BA0A 1C6VA 3KLVA 4DR4F 3GMGA 4KHRA 3A3OB 2J8AA 1X4FA 3MPDA 1IO2A 3T6BA 5E3QA 2DGXA 4NXNJ 1S6QA 4FKYA 2A6AA 3KLGB 2DXEA 2G2ZA 2QA4S 1CXUA 4AUKA 1T3NA 1L3UA 3KHGA 4DSLA 4W4MA 4WQ4C 4LSZB 1NHUA 4F02A 1BIUA 4H0TB 2LA6A 4JI3K 3G82A 4LFCK 5L9NA 3RW6A 1U45A 5M2PA 4HCBA 3HFVA 5LSRA 2FSNA 3MX5A 4KHUA 1IWGA 3DXKA 2CJXB 2ZZTA 2XMVA 5LMUJ 2YHWA 2APOA 3J81O 1TL7A 1EXQA 2E7VA 2FJXA 1KWMA 2FC9A 3RMBA 2DFHA 1NB7A 1HX1A 5KG0A 2P2CB 2CQHA 1QZ6A 3CJKB 4F9OA 2VL1A 1T6CA 1F60B 4EYHB 3R9PA 2RVJA 2PI5A 4O4RA 2V4RA 1FF2A 1RWOB 1K73T 1RDCA 5AQHA 3VERA 3MEEB 4OZ0A 1GMVA 4QW9A 2IMWP 1UJ4A 1YVNA 1VLYA 2HK3A 4CZGA 5ETRA 1U25A 1FJGJ 2X6NA 4TVAB 5J2PB 3BQ0A 2H48B 1HLWA 2DIVA 2W4DA 1RYSA 4QS8A 4BY9C 5A2QU 2POKA 4DV1F 4Y0WA 4RO0A 1L3SA 3IXQA 3E66A 3MAQA 5HROA 3CNQP 4RNOA 2FUG9 2AX1A 4W5OA 1ESVA 6FDRA 4WTYA 5EX3A 4JUZA 4BC3A 1NB2A 2RHKA 4LSNB 2HF4A 2DEIA 5MLCV 4IG0A 4YOWA 2XULA 4ZJLA 2UVVA 1SC6A 2DH8A 2HBKA 1H7WA 4RNHA 3HSTB 1ZM9A 1E4GT 1NGEA 3O9TA 2ZH3A 4DV6J 5C7PA 3MXIA 4WFNL 4A47A 1Q82O 4ZOSA 2DITA 3J8AA 1TFWA 1NPRA 2UU9F 3LP3A 2WSEC 2DJWA 3TX0A 3Q23A 2GV1A 3BF4A 3PIPQ 2QK9A 4J2BA 1CSJA 3VR1A 3V1QA 4Z4CA 3DOLB 4JB8B 2HBZB 1C4AA 3C94A 3CQYA 3W9IA 3H3NO 4M5NA 4CH7A 3C6TB 1ZAWA 4DCJB 3ETMA 4M5JA 4UZCA 3B4MA 3LDQA 4ZJQA 4ED8A 2NRWA 2F96A 2BANA 1SKUB 2R3VA 5LL6Z 4LF6F 4CEAA 2ZVSA 3KIOA 5AQWA 2P9IA 3MCOA 2JSXA 1DLOB 5K8PA 3G6VA 2XYGB 3FSXA 2D3OR 3TAGA 1ZXOA 1D09B 1R6VA 3H25A 4TU9A 2YCHA 2V6AA 1FTCA 3PW0A 4LF8F 4AILC 2RDIA 4JI7F 2VONA 3SQ0A 2Z58B 4WKRA 1REGX 3IP0A 2OKQA 2DVIA 4UOHA 1J54A 1ZBTA 1SJFA 3HDSA 5E3RA 1B9DA 3NP5A 3VVUA 3DMJB 2IPOB 3J81Y 1I5OB 1A5VA 1T9UA 4C8NA 1NPKA 1SH2A 3C2PA 1J53A 1NSAA 1RP5A 3RJMB 4K5RA 3SMPA 2D7SA 3QJJA 1N88A 2J0SD 4IFVA 4N76A 1QAJA 2BQUA 1IJJA 3DLEB 3N4PA 3CYMA 2W42A 2ILYA 1FVSA 1Y5NB 2QT7A 1XMQF 4DU1A 2Q6BA 2V9WA 1UFKA 2ADCA 2OEJA 5D4LA 1LW0B 4DR4J 3UE5A 4O8UA 1RT4A 2DHAA 1XNQF 3UW1A 3MWTA 1N34J 4MIBA 3HRGA 5HBMA 1SI9A 4E7IA 4CJ7A 2FHJA 3ET6B 5KG7A 3KK2A 2AQ4A 3RAQA 5KFTA 2V4JA 3MCSA 2V51B 3L4IA 3L8BA 1HQUA 4NLYA 4A2AA 3O9QA 3N4QA 1YJTA 3L2VA 3QT5A 2C3YA 4K4YA 4Q45A 3UNGC 1SKSA 4FL9A 3FLCO 4QR1A 3KHRA 3V9UA 4PYDA 1V5IB 1NH8A 1H6KX 1WKKA 3SDEB 1DT9A 3R5DA 2QTDA 5EWGA 4KV8B 4CT9A 5KFZA 1YJNS 4IWVA 1C4CA 3QRQA 2WBNA 2AJ2A 4HL9A 1K73O 3AVAA 3OTOK 3G4SS 4IKAA 2GGPB 1T44A 5T7LB 4ETZA 3EVOA 3TJ9A 4M95A 1CLQA 3TAMB 2C2NA 2Q31A 4DQQA 1WI6A 5JMVA 3R6LB 5ETPA 3A8IA 1VSEA 5KT4A 2J7KA 3AA9A 1QSSA 3PYFA 5K20B 1IKVB 4YS2A 2ZOGA 3V4MA 5HQMA 4DV1J 4ED3A 3FR0A 3RAXA 2WW8A 1EQ0A 2H5EA 1K8AT 5T7BA 2O66A 4B3SK 5AE3A 3IR7B 1CPZA 3LUYA 2CH5A 3OUYA 1OQ3A 1E3MA 4L8RB 2BE9B 3C3LA 4X2BA 4PG4A 1WSEA 3MAAA 1AB8A 4USMA 4DF8A 2RHSB 2WW4A 1O51A 2QV6A 3J81U 1QY7A 4RUHA 4M3RA 3GB0A 4DTNA 4BREA 1X9WA 4BRKA 2UU9J 1IUJA 3AT1B 4BRPA 2ITGA 3U8XA 3MAHA 3HVTB 2Z57B 2NPFA 1RDUA 3GIIA 1HKCA 2HEKA 3TA1A 2RUSA 3HI0A 3CJ4A 2GNKA 3DKDA 1GLAG 4HEA9 1E4FT 2EXUA 4DV3F 1MG7A 1AROP 4DV0F 2GTDA 3S3NA 1YITS 7FDRA 3TU5A 3KDOA 5E3PA 5D77A 1OWXA 1H38A 4WQ5A 1Y4ZB 3W7BA 3UB5A 2P9PB 3KYLA 2EK1A 1RAOA 1VBZA 4PG6A 4YDUC 1VQ9S 1RGIA 1DBDA 4ZVPB 1ZOTA 4CLKA 3PIOQ 4DCHA 2QEXS 4JI7J 3VA3A 4LBIA 3GWCA 4MKAA 3OVBA 4I2PA 3KMQA 1KVKA 5FRMA 1C1AA 1RTIB 4LVNP 1S9GB 2JFDA 3M8RA 3LP2B 1RT3B 5HP1B 3AODA 5HMWA 1N5VA 3GU0A 2HBJA 4DF4A 4IOAQ 4OZ1A 2J9DA 2VHGA 3MEGA 1VQYA 3P96A 2QLJB 3M5RA 4H0YB 4B9TA 2Q1LA 3L0QA 5F8IA 2WK4A 5K8OA 4CJKA 3VQ6A 3UKUA 1XMQJ 4CEFA 2DR9A 4WPAA 4KHNA 3ULHA 4KPYA 3NMRA 3L7PA 3DLKA 4QIWD 2LXIA 1MMDA 1QQMA 4RCHA 4UT4A 3BSCA 1XNQJ 5DRKA 4KFBB 3V9SA 3MUTP 1RSCA 1HA1A 4BRHA 3PVXA 3A12A 3GL1A 4EZ9A 1EQMA 3M1VB 1K0VA 4HTIA 3R8YA 3FZFA 5AQUA 1CULA 4M45A 2AEJA 4KQZA 2BJEA 3I32A 4ZCKA 3LDSA 2UXBK 2WBRA 4Y0FA 1ZBUA 1HNVA 3VA0A 3MD3A 4LUBA 4M5DA 1VSJA 5A8WB 2G2YA 5L9XA 3ZC4A 1HMVA 3DXMB 2E1CA 2JWLA 4CHOA 3T1AA 4LSNA 1CJUB 3IBWA 2D3ZA 4FDFA 1S79A 3IUCA 3MMCB 3W5YA 3G86A 4FWSA 4GMJB 4DS4A 2HHHF 3DDNA 1PILA 4URSA 1K8AO 2DGUA 4WCEQ 5KFOA 3W60A 3SQ4A 3QYYA 2BRLA 4RW4B 2G0IA 4U95A 3JXOA 5FIIA 4JLHA 3PJ9A 2IDLA 8RUCA 2DXDA 1U49A 2BEFA 3DOLA 3PW2A 2RQKA 1LWEA 2R7XA 5CCMA 2CPYA 2YBVA 1IR0A 5AQNA 1K8KA 2P5VA 1R0BG 2CG8A 3O3GA 2RKIB 1CJKB 3FSIA 3G10A 3AO3A 3P49B 1N48A 3DGVA 4GKKK 4Z4EA 5CQGA 3HYFA 3GTYX 1Q8IA 4DR6F 4YHHK 4DUZF 1GXLA 4JI2K 3TSUA 2HS0A 2G0JA 3AVKA 4PA1A 1JXLA 5CA5A 3CDBA 4DS5A 4ZCMA 5LY3A 5IM0A 3OYAA 2MXYA 4QR2A 3Q0AA 1RFQA 4IH6A 4LF4K 1VMBA 1LXNA 5DLGA 1NM2A 1YJ9N 3BBBA 4F04B 4HKQA 4DV3J 1U2FA 3H2VE 3ENAA 4DV0J 2C2OB 2AZ3A 1HHTP 3CI5A 1RT5B 5AQXA 2W2NP 4P73A 2MLYA 2Y1JA 1QSYA 5HAOA 4USVA 3QB0A 2VQEF 5C2DA 3OBIA 3PYDA 1H98A 2ZFHA 3M2VB 4YOUA 1T05A 3US5A 5IWAF 1WC6A 3THWB 3AVHA 1RT7A 3MEKA 3VMFB 3GYXB 2HURA 1NSKL 3IKMA 3UDVA 2XSJA 1JNZB 1NUEA 3QFPA 4MIWA 2E9RX 1JLCA 3OS2A 1X31C 2R9LA 3KK3B 1LW0A 3ISNC 1R3NA 4EMDA 1T95A 2PA8D 1MROB 4W92B 3H98A 1Q0NA 1L3TA 2IHR1 3O1LA 2FZCB 1D9AA 4DTSA 2Z0GA 5FPNA 1C1CA 1RAIB 1YLXA 3RBDA 4LF9F 4FF2A 3NNAA 5LM7E 3W5XA 4DQRA 5IFMA 2Z30B 4WZMA 3NFAA 3QMQA 4BC9A 3NGYA 4FLUA 3TUJC 2X1BA 2ASDA 2FBYA 1OPZA 2HYIB 4JV5F 1BI4A 4G3IA 1WAFA 2H4YB 3LH2S 5ETKA 4RZRA 3CCEN 3VF6A 1UL3A 3VQBA 2BA9A 3O2IA 3HFKA 5AQIA 4QAGA 3CMAS 3CCQS 3FVYA 3ZXWA 4KKOB 2JHEA 3L4QA 4K4SA 4RUCA 3NH2A 1NBEB 4DTPA 4B8AB 3QGIA 4OHZA 1PKUA 3W1YC 5FLXY 3H2UB 4OJRA 1T03B 3K2YA 1VQLS 3Q8YA 3A8KA 3R7SB 4KSEB 3ZETA 1GXUA 1FK9A 4G1QB 2VGNA 2W7OA 3VQ9A 2V9KA 3UVJA 5A8RB 5LL6d 2VG6B 2ZBCA 4O0NA 2ZJQL 3VEWA 3HHLB 1VQKN 2EI5A 4L3NA 1CZBA 2D0PA 3BDEA 4ETXA 3DLGB 3FZKA 5EUHA 1F9EB 2BVZA 2X74A 4DV4K 1NG9A 1AYEA 4BRDA 4J8FA 3KJVA 2X1GA 4QPTA 3VCDA 4AQYF 3LDLA 4CBWA 4MTPA 4X4VA 2HHHJ 4NMLA 1E6YB 3QAUA 1YQHA 4KT0C 1EWRA 3EZUA 4J5OA 2O4IA 1VBKA 3OYMA 5F2RA 2OELA 4HYKA 4X4RA 5KT6A 4ZLNA 1HARA 3CCLN 3UCUP 3PHEA 2D1CA 3PO4A 4FXVA 4QWDA 3UCZP 2IA0A 5A8KB 1SUQA 1U1LA 2XZTB 3OFGA 2QL9B 4OVLA 5GVQA 2CJBA 1F5CA 4IO1A 4A5AA 2RH3A 2DNZA 2OD6A 4HUGA 1EO1A 2ZH7A 4DQSA 5AQOA 1YF5L 4CJ3A 1FI4A 3LQVA 2O8BB 3V6KA 2DPNA 1RTDB 2DO0A 2ZDPA 4DR6J 2R42A 2DNKA 2ZITA 4DUZJ 4DL6A 2DR6A 2G8VA 2ILZA 2H5IB 2D9PA 1CZ9A 3M32B 1S0MA 4O3SA 2BR0A 2CPXA 3QIPB 1P8GA 3P38A 3UFCX 1NGHA 4NXMK 2V67A 3W8GA 4EZ6A 2KFNA 3OS1A 2AA4A 1RAGB 1YHQS 3CGIA 1RHUB 4U7UD 1H72C 4KH4A 3VVTA 1WACA 5GAEP 1VRUA 3OXGA 5M1FA 3KLHB 2H4WB 1JB0C 1JJ2R 3H0PA 3LO3A 4NE9C 2W2PP 3NG8A 1KD1T 1Z2LA 4J9UE 2VQEJ 4FYDA 3SIPB 3WXMB 4AE5A 3EL2A 2V0NA 5IWAJ 3RBXA 5C24B 3T5KA 2FXUA 3R5CA 1LW2B 4FSVA 2HSEB 3MR2A 1RU1A 5KPZA 1RAEB 2O8EB 3CEDA 1C0TB 2LQJA 4B9MA 1HQEB 2HNZB 2EBGA 1YZ6A 2OIHA 1DKGD 4JV2A 2XSFA 3UO0A 3UPFA 4B3RK 4FW2A 3QJPA 3NF9A 1UWBA 4JRPA 1HPMA 3RG6A 4E2FB 4PWDB 4UOFA 2ZH4A 4DV5F 5FPDA 4LF9J 4CFDA 1XERA 1CS4A 3R9LA 2IVPA 2RRBA 1TUWA 4HACB 3EGNA 4DUTA 2R7WA 1NJWA 2CQBA 4IH5A 2KHCA 1PAUB 4I6AA 4GV3A 2BKNA 1DEJA 4WTOB 3VZIA 1VQSA 3W62A 2IC3B 1QAXA 1W0HA 4JV5J 3E01B 4ZVGA 3PNIA 2YHAA 4WP9A 4J9PA 3WC0A 3PKMA 4K25A 2I9SA 3CFRA 1FDAA 4HTJA 1XQSC 1JLQA 4LRBA 2VBZA 4CEOA 4EBCA 3F2KA 2DR5A 4Z37A 2E20A 2EFQA 4JI5K 2CZVC 5JLHA 3SBTA 3NGDA 2A6MA 2KHOA 1V3RA 2LXUA 3THPA 4IR1A 2KW4A 1H2TZ 2QKBA 4KRWA 3MMBA 4FWRA 2KJVA 3FZLA 4H0XB 4CJUA 4YMEA 4E1JA 4LBHA 2GMHA 3N5FA 3A1YG 1OVQA 4P7VA 1YRUA 1SPBP 1TUYA 2Q2RA 2KRRA 4F7VA 4KB1A 4CO5A 3CMES 3TZXA 1FRXA 1CJKA 4AQYJ 4ISGA 4X4QA 3OL9A 3KLIB 4F8RA 2PYJA 1X60A 2B3TB 1MN9A 4WWSA 4OYMA 3QAEA 3UKRA 1BCMA 4ELVA 4NWBA 1U0HA 2EW9A 1FVQA 4OZ2A 5K8MA 3OSPA 3RBEA 3MM7B 2HQDA 2E2NA 3C6UB 2GELA 4FF4A 4LC9B 1KSPA 4CLFA 5H9FJ 4BR9A 1S12A 1JCEA 3IGVA 4ZP8A 3BZKA 1HQ2A 2A2DA 1WC4A 2DNNA 3OYNA 3LF0A 1H7XA 4JYAK 4QOZB 1RQ0A 1T9YA 4JAXA 1Y5IB 3G8SA 4MLEA 2CPEA 4DR7F 1RT6A 4J91A 3RMAA 2O8CB 1CBKA 1QM9A 3G6XA 3DLHA 3AVBA 4CGIA 4IFYA 5K8NA 2GUIA 1LWXA 2VUGA 4C8OA 1CC8A 2GVDB 2KRBA 4DL7A 4MK7A 5FDLA 1IKWB 9ATCB 1UWAA 1JL1A 3E3XA 5F0WA 2HZVA 2NNWA 1WHWA 3KK3A 1KD1O 5LOQA 2V5HG 4J37A 4C11B 4OZ5A 1WKJA 2IFXA 2WHOA 4NRUA 1Q79A 3JSMA 2IY5B 5SUHA 4B02A 3KKRA 3DLLL 3P5JA 3D6RA 3L2RA 4WZQA 1S1VA 1I51B 5L8RC 3K2PA 2W9CA 1XWLA 4NLDA 5DG8A 4CBUA 2YH0A 3BGFA 1PYSB 4K2JA 3IFEA 1EAYC 4ID5A 2BABA 3I9V9 3SMZA 2YNHB 3PEHA 4ATNA 3M1FA 3GFYA 5K14A 2J0XA 3PYGA 5T14A 4S0MA 3R97A 4K59A 2HIQA 1RADB 1CLFA 4YOXA 3Q83A 3VEOA 1UVKA 3B82A 4OYPA 3L3VA 3A2FA 3NWGA 4DN0A 1HBNB 3R2CJ 4JD2B 1RLDA 3RRGA 1NJXA 1UOCA 4KHYA 1RCHA 2M8DB 1JJHA 2BKOA 4JI6F 2W4PA 2QIFA 3J7ZT 1WSFA 1FRKA 1ASUA 2EX3A 2J8SA 6FD1A 4DV5J 2GAGC 2L41A 4EWTA 1HJRA 4KJIA 1H74A 4MFBB 3DCAA 2HZCA 1GT8A 3K9JA 2A3ZA 2RIJA 2PO4A 4CF0A 4FVMA 3LALA 2OPSA 4PUOB 1LWFA 4CI0B 4M63A 1VR6A 1SJQA 2F8HA 2F3JA 3NE6A 1VRTB 5A8RA 3ZSWA 2YNGA 3AH6A 4M5GA 4KHQA 2BE2A 4NCGB 3SNNA 3GIMA 5C25A 1PO6A 1IR2A 2E9TA 2VASA 1HI0P 2OO4A 4X62F 4FZZA 2XTJP 2QWRA 1RTHB 3HP9A 1SL1A 2NR0A 4FM1A 2OAUA 5KFQA 4Q0BB 5TKWA 2OTJN 2FJBB 3JAMO 2YWHA 4BBYA 4NZ7A 3BBFA 1GLDG 2DTJA 3S8SA 5D3GB 3HM9A 4FBTA 3MM6B 1Q8KA 2EVZA 5B0GA 2E5LK 3AVJA 1EETA 1UVNA 2MSTA 4XDCA 5A8KA 1OH5A 4DPTA 3BR9A 1NSQA 1IXKA 3T19A 3QICA 4OPJA 3CCVN 2CNOB 2YX7A 4WP8A 1U2VA 1ZC6A 1L3VA 1QSLA 2D69A 1UVLA 4HVJA 2QLBB 4IO9Q 1BOTO 3H3OB 4DV2K 4Q8FA 2JVRA 3M6XA 3U9DA 3BEGB 2P6TA 2C22A 3BZCA 3QEWA 1NOYA 4JI0K 1PYOB 3RR8A 1FESA 1CXQA 3P39A 4CGDA 2HNYA 3QIPA 2ZNZA 3GILA 1N33K 1CJTB 1TL3B 1G6BA 4NL5A 4A8QA 2W8KA 4PKIA 2DGVA 2VKZG 5EVZA 5CHCB 4Z7CA 4USHA 2AWZA 2ZKTA 4DL4A 2C3MA 1SXLA 3AB4B 2IVFB 3CF5Q 4Y1CA 1Q7LB 1JQGA 2EFGA 4B3TK 2YNFA 1OS5A 2ZWPA 5KFDA 4DSEA 4DR7J 2JWNA 4BR5A 4LQ9A 4ZPAA 1XC9A 3JSYA 3HZGA 4C3MA 4ANDA 4RLEA 4U7CA 2HMIB 2QWLA 3GJTB 4C98A 1BL3A 2P9UB 2L08A 1RT1B 1IJFB 5FROA 4MH8A 2HBRB 2F8TA 4M3WA 2V8DA 4DG1A 3AY0A 4MKYA 2ACMA 1XMOF 4KH1B 3QO9B 3QBXA 1ZBHA 2M0GB 1EP4A 2UUAK 2KYZA 3W0LA 3OS0A 3LDNA 3M2RB 2FLNA 1TYQB 4HCCA 4W98A 1Y3KA 1BLUA 4M7YA 2MYFA 1BQXA 3AA5X 3I4HX 1ZTTA 4NLWA 4BQLA 3B6BA 4CYUA 4CJSA 3CCRN 3P5TL 2HQIA 1RBOB 4CTAB 3VF0B 3D0HE 4MLHA 3K17A 4DOZA 4JKBA 3OYJA 2AJ0A 2IRUA 4DR1F 4OZ3A 1HLUA 2LQ8A 2ZBIA 5T41A 4F3OA 5LJWA 3IA0A 1PAEX 3J7ZO 1KVCA 3ZZTA 3B54A 3SQGA 1IKXA 2DY1A 1IBKK 2N82B 1ZPWX 3NMUA 2RU9A 3O44A 3M8QB 3L2WA 4P75A 1VBXA 2OA8A 4QQBA 1IN0A 3HJVA 4JI6J 2WVEA 2CQ2A 4EBDA 1B0VA 2WBMA 1Y00A 3ITHA 5K5MA 1HYSA 3CJCA 2VBYA 1JLEA 1HWIA 4QWAA 1TL1A 4NLVA 2M3DA 4P2SA 4EP4A 1HYVA 2HFNA 3CCSN 2E2PA 3VPZA 2VPYB 1VQ7S 1KR4A 1F1BB 3QEVA 4B3MF 2A41A 5EWEA 4KTZA 5KFUA 2BQRA 3BGRA 3RRHA 4BC5A 4QYZJ 4DSJA 4TYBA 4Q8EA 4OX9K 4FO0A 4CFCA 2MGZB 2XY8A 4FJ8A 2YKNA 4K4UA 2PDAA 4I6MB 4LF5K 4CO4A 4F4ZA 4X62J 3N6MA 3JSRA 1VJWA 4ED2A 1C1BB 2VFVA 2YX4A 3KG0A 3MCPA 4HVZA 3K5PA 3QSYB 2OPRA 3KLIA 4Z2XA 1SV5A 1L5UA 2E1RA 4DUYJ 3CJ7A 1S9FA 1VK0A 2F4VK 4IQXA 3A8JA 3CWJA 3Q7BA 4XPEA 1WF2A 3K8WA 4CJFA 3NF7A 5GAGU 4C0BA 3R8EA 4I7FA 3MM8B 4WF9Q 3QEXA 4CZKA 3ZSRA 4BC2A 4K4ZA 4DL5A 4TQRA 4J9SA 3L2UA 2R8IA 3CD5A 1AFIA 2CQDA 5I9EB 1SBRA 1WG4A 3I87A 4XH1A 2RSQA 2Z2LA 4H54A 4ZCIA 4DR2F 5F3ZA 2VZ9A 5AQGA 2C3PA 4KGXB 2ROEA 1MA9B 4JHDA 2O8CA 5DGBA 1CVJA 4K4VA 1G99A 3OW2M 3H20A 4CZFA 3I96A 1JJCB 3BF3A 1DRZA 4WFYA 1UJ5A 4IG3A 1H0HB 2QJ3A 3M30A 5H1SV 3VETA 3MDQA 4E7HA 4OFZA 4D3HA 1R8PA 2L9WA 1WSGA 3K5NA 2PC6A 2OMLA 3PTWA 1X4AA 2OTLS 3JAMU 1KQSM 3I55S 1KTVA 4FJ7A 2B51A 3PDNA 4NLTA 2KHDA 4PWUA 3QEIA 1R8CA 4OYOA 3SYZA 1FD8A 3NHGA 2YNHA 4E1NA 3IBCB 2Y9HA 3WQTA 2CQPA 2CUYA 3W2WB 5JLFA 4LF7F 4ICLB 3GIKA 4K0KK 3AA3A 2A42A 1TUGB 2WOMB 3AVCA 1C0UB 3H6EA 1NK5A 4YOTA 1RAAB 4JI4F 2KDOA 4PG5A 4C0OC 3TP2A 1XMOJ 3EDRB 1HBNA 1RACB 2QMUB 4IOCQ 4JD2A 1VS3A 4WP3A 1IBCB 1IH7A 4FJ9A 3M9MB 4YP3A 1J5OA 5HVFA 4O8KA 4IXCA 3D7EO 2D0BA 4I6YA 2B8QA 1R31A 5HN0A 2FHMA 1X9MA 3QWPA 1VCTA 5G4DA 2P9GA 5EOYA 1FJGK 4ZPVR 1TKZB 3G71S 4RTFD 2Q0UA 3CC7N 5LMNF 4NCAA 1FERA 3NRBA 4ZMMA 3HFZB 4FYXB 4W5QA 1NAQA 3NF6A 4DR1J 4Q43A 5IXUA 4CF2A 1HI8A 2W24A 2CIMA 3I33A 1NMEB 3I0SA 1NDLA 2XB2D 3O4QA 5CYMB 3D67A 2HSTA 1MDUB 4PG8A 1VQOS 2FVRA 2LSNA 4DV7K 1SH3A 1FEEA 1Q8BA 3PLAA 3QETA 1PIEA 4YY3F 3L7UA 1LAWA 3DRSB 5DQHA 4V19X 2EKYA 4DU3A 4EHUA 5M1KA 1C0MA 2WVCA 3PRVA 2JLFA 1GMWA 4DPOA 3FFIA 4B3MJ 3V4IB 2ZH8A 1YJNN 4AHCA 5AQKA 1A9NB 3ZT3A 4B3OB 4HDGA 2W2OP 1OVYA 2XMTA 5B8HA 2XY7A 1PYTA 2CKWA 5AXKA 2HLUA 3E9LA 1N8RT 2J9DE 2P9SB 2HW3A 4F50A 2HGLA 5J2NA 2GZOA 4X64J 2P6SA 2ASMA 2DHHA 4CEQA 2OSRA 2RQMA 3L9ZA 1FCAA 3BKUA 1T9TA 3KJFB 2B0GA 4DPUA 5C15A 2QI2A 1NGCA 4OIXA 5BXIA 4RW7B 2QWPA 4WFBL 3IRXB 4YR2A 4GO7X 2HFVA 1YBUA 4DU4A 4LRFA 3FBEA 3BGUA 2DTUA 3CJ5A 2W9BB 3OFHA 1FX4A 1VC0A 1VSLA 3VEYA 3SCIE 2DNQA 3PIPL 2HVDA 1NKEA 4FK0A 1QVFM 2XYPB 3U1LA 1S1XB 4KHWA 4DR2J 2AZ1A 3B8AX 4E98A 5GIOA 2FHOB 3H2LA 1IBLF 4H4KA 1RAHB 4M5IA 1Q53A 2PMWA 3FCWA 3UDCA 2ZEJA 1NO8A 2ZHOA 2DGWA 1S22A 4IO8A 4LFAF 3IDHA 3TUPA 2HMIA 1K9MT 4FS2A 1NHKL 3CD0A 2R8JA 3B6PA 3T3FA 2BH1A 3H46O 4NB4A 1KBRA 3CCMS 4FJKA 4HT7A 1QVGR 5TKYA 3CCJS 1WC1A 2NRTA 4IDKB 1UAWA 2F9JA 3VGTA 4QWCA 2QKKA 2C1EB 4K7QA 3KK1B 2OCEA 1HD1A 1U1RA 1NGDA 1TYQA 4DXLA 3HP6A 2KVQE 3KKSA 4WXWA 5AZIB 4O3OA 1OIAA 3BN4A 4BHQA 5KAKA 1VQ4N 2H5JB 4RBVA 3D2EB 4CNZA 3EGVA 4OJGA 3RB3A 3GLJA 2YKQA 4JKFA 2XZDB 1YVFA 2Z8QA 1DGKN 3O4WA 4LF7J 3W2VB 4PXEA 5H9EJ 2PT0A 3HHLC 1FXLA 3ELHA 2Q1NA 3B8HA 2XI3A 3B4DA 2UVRA 4JI4J 4DFMA 2O3DA 2ALYB 1RWKB 3VV2B 1F3VA 1UFWA 4NYNA 2QG9B 3M8QA 3ATUA 1AT1B 3G96A 3KUHA 2GFFA 4JI3F 4LFCF 4PKDB 4R25A 2G1DA 5KFJA 2P5GA 1QTNB 4PG7A 1NNDA 4QW8A 1AUSL 2MKJA 1EJ7L 2VWBA 2YX6A 1B7YB 1LNQA 3BSAA 2RDDA 3IWXA 4IJAA 5F9LA 2OZSA 3M4XA 5L1LA 1W9HA 3ZT4A 4OLBA 4OKEA 1NJZA 1F2GA 2KJWA 3TABA 3TPQA 3OHBA 2IAJB 3D9BA 3IAM9 1GOCA 3CO0P 4ZLLA 2WZ1A 2MKIA 1WC0A 2IBOA 3PJXA 1R43A 2BDPA 3QINA 1FFWB 2OI2A 1RBVA 4OX6A 1C1BA 1U6ZA 3FUYA 4YY3J 1HR0F 1G1XA 4OYBA 3UQSA 3MECB 1WEYA 4JKEA 3JYTB 4WE1B 5KOWA 3UN5A 2UZAA 3HD2A 3GR0A 2FZGB 3UD3P 4JKAA 5I4MA 3D6MB 1DTQB 1BQNA 1IKYA 5IT9O 1N8RO 3T9NA 3MM8A 2P51A 3VGVA 4RW9A 4OKJA 2WAQD 3IM8A 3ENQA 3G25A 4NLCA 4OGEA 2ZZNA 1TELA 2FVCA 3PCOB 4F4YA 3P8BB 4CO2A 4OL8A 1TTHB 1HRHA 4EIAA 2G8WA 3IAYA 4KI4A 3IMQJ 3TJAA 3ZZRA 4LF6K 2GQQA 1P8ZA 4QR0A 4CECA 4DMZA 1T7PA 4E3SA 3V5RA 1RABB 1N32K 3IC1A 2YNIB 2VD3A 3THXA 4LF8K 3R3TA 4A8XA 4U9RA 2FVSA 3WC2A 4DCOB 1YJWS 2G9OA 3RBZA 3DWLA 5B0EA 3OD2A 4K8ZA 1ELOA 3CC2S 2KN4A 1VSFA 1NGBA 1RTZA 1OY6A 4WQ4A 4IZ9A 2G0CA 4FLXA 2D0AA 1WDDA 1K9MO 3GFHA 2XEXA 5AXNA 3OL6A 5BYSA 1N5YB 4AL7A 3TVYA 1O5JA 1E6VB 3T5JA 3ZTPA 1HNWF 1WC3A 2KKZA 4OMFG 4FNIA 3Q8PB 4LFAJ 4ICLA 4BGBA 3OJSA 4KGZB 1OMSA 2R2SA 4DEZA 3HT0A 4CM0A 4ZDNA 2DRAA 1J2VA 1IM6A 3BH6B 4DR5K 3P1GA 2CG4A 3PIOL 1XNQK 3LPYA 4UOCA 2AEMA 3DU6A 2XQCA 3E2EA 3QERA 1TL5A 3F9MA 3KZBA 1CQNA 4B1ZA 3FZ2A 3DRRB 4DSFA 3N6NA 2K06A 4U8YA 2WUSA 1TGOA 4J2EA 5AE2A 3Q8SB 3LP0B 4CLUA 3UD5A 2O01C 3NVKA 1U02A 2RF2A 4IOAL 2G2OA 2ZOFA 5A76A 1W2BM 1YRXA 3FK4A 2OFHX 3IM9A 1DQ9A 5DETA 3HK2A 5CE3A 4KTQA 3CJAA 4KYZA 2DCLA 3HVRA 2FJWA 1FX2A 3JSBA 4GW6A 1B99A 4J2AA 3L3UA 2XGPA 5F3TA 1CJVB 3L3CA 4CQ1A 2YKAA 2I8EA 3M2UA 5IT9Y 2C3OA 2UXDF 2VDIA 3NAHA 8ATCB 5JJBA 3AA4A 4JI3J 4QU7A 5DJBA 1RHQB 2V52B 4LFCJ 2VH7A 1S0OA 5J2QA 3JS6A 4MIAA 3EMTA 2B6AA 4ECWA 1S1WA 4EO6A 2FJEB 4FOEA 2UP1A 4O0JA 4JKHA 2UV8G 1DHMA 2HFZA 4BVPA 4Y2KA 2CQ4A 1JXBA 4FYWB 5J2MB 5I42B 4F4KA 2IJFA 2GJ2A 5DK5A 3OTOF 2JGUA 3EXYA 4HWIA 2O8DB 1FO1A 4M5MA 2DHXA 3CULA 2PMZD 3TVKA 3CMAN 2KT2A 3IS9B 4OI4A 2B4JA 4OQJA 2W6LA 4BR7A 5BPLA 3EWGA 4KTWA 5B09A 2A3JA 1VJQA 4KAIA 4A8WA 4F0MA 4QU6A 1HR0J 1ZH5A 1EX8A 5KFFA 1TMMA 3T7ZA 4I0WA 2XMAA 1QJHA 2VB6A 4NI2A 1WUUA 3A3PB 4EGLA 3ZCMA 3M6VA 1S9EB 3PY8A 1YKWA 4B3SF 4WCEL 3WNHA 3EDQB 1FXXA 1R7IA 2VICA 3HZ6A 1TV6A 1S6PB 2GA7A 2P9KA 2N4DA 4MDAA 4CJ4A 4A57A 2R8GA 2O67A 5L1IA 1QUPA 1GNKA 4LJMA 3KG1A 4AHRA 4RPFA 4N8NA 2DEJA 4NYZA 2IMOA 3HHNB 4XTTA 5D0HA 4NCBA 3QATA 4PL7A 3NAEA 2DT9A 3G6YA 3CJRA 1S0VA 4I6WA 3T1YK 3AD9C 2V7YA 2FLLA 3A8YA 1XC3A 1YTYA 5GADU 3AVFA 1SS6A 2M70A 1BXNA 3S3MA 2Q43A 3CERA 4X66K 4IDKA 1JWWA 5G0RB 3C15B 3NMAA 2VCPA 2LCWA 2V63A 3MZIA 4CZIA 5IT9U 1T02A 2WVDA 3EGZA 3H4DA 1T9VA 1S5ZA 4CK2A 2DH7A 2HMPA 3H4BA 4U7UK 3C7NA 4Z0UA 3KG4A 5HK4A 2HHPA 3NGKA 3KJQB 4N8OA 1A5WA 3KTQA 4A46A 3K9KA 1JLGB 3OYFA 1YHQN 2HRTA 4GVBA 4R5PA 1QAIA 1MWQA 3EE8A 4CESA 3G8QA 3HX9A 2GX8A 2AD9A 2KU7A 5ADXA 1Y97A 2C2MB 1Y0HA 4TSXA 1VQ5S 4YDXA 2G13A 4XK8C 2PFDA 3DI6B 2IDOA 1AUDA 3ENHA 1BQMB 2FGCA 1TUVA 3EJMA 3A8EA 3ZSVA 2MZ1A 4O23A 3I5BA 2F5GA 4IRCA 3SZ2A 1W7AA 4PR6A 3T6JA 4BC7A 2P9LA 5KQDA 2ZVIA 4LSLA 1RHRB 3KD1E 3QRRA 2IYIA 1XR6A 4C97A 1EIYB 3CJ8A 4A61A 2NSBA 2YHXA 1EZZB 1GK8A 5B0AA 5BRFA 3AVGA 4OLAA 1VQPS 1FDBA 2KKHA 2IAJA 1TKXB 1JCGA 4JP8A 1PC4A 2GEMA 2IRXA 5FRNA 3AQOA 1JJ4A 4CD1A 2HHHK 5E26A 3MECA 1DTTA 3PV8A 1K1SA 4FZXC 2UXBF 1IQZA 3JYTA 3OPKA 5DG9A 4WYLA 1X5SA 2H9ZA 3L95X 4HHTA 2VG7A 2E5IA 5KFRA 2HS4A 4DX8H 2HHXA 3LZJA 2XLJA 5F0XA 2QW9A 2MKSA 3BREA 4YEAA 1REVB 1I6JA 3OTOJ 1HBUA 3AA8A 2A40A 4CRJA 4UUWA 5ETQA 3AO4A 1V3ZA 1WNSA 3ZX0A 2R7SA 3U9ZA 3H7HB 4LRAA 1BWVA 2LU2A 4MT1A 1SB6A 2B5JB 1EKRA 1GAOA 4UF4A 1NLVA 4RWWA 1KHWA 2MTLA 2BJDA 3KNAA 1KC8T 4YDUA 3V81A 2D1KA 2V50A 3GPAA 5DS7A 3ASMA 4B3SJ 5I3UB 1RWMB 2FBVA 2EEYA 1ITGA 2H1YA 3LP1A 4CJ5A 3QGHA 3F44A 4HUFA 2N3LA