1JLAA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
553
structure length
546
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 140
structure length 546
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlaA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlaA05
2BANB 4KRFA 4RW7A 3GYNA 4NLSA 1RTJA 1ZBUA 1NJYA 3E01B 3LP2A 4NYNA 1S0MA 4ZVFA 3WNFA 1X9WA 1DTQB 4O4RA 2YKMA 3BQ2A 4CE9A 4O44A 3HVWA 3ASMA 4FJ9A 4CJ3A 2YNHB 3K5MA 5KT5A 3RB0A 4AHUA 2IM2A 4DEZA 4O4GA 3N6MA 2BR0A 3H5SA 2FJWA 4CJKA 5KFOA 1RCHA 3DM2B 3KHLA 4LH4A 4NLXA 2IC3B 4XIUA 1N48A 2KTQA 4C8KA 2CKWA 2F8SA 1D5AA 2HHWA 3MTKA 5CYQA 3M8PB 5F8GA 1U47A 3RB6A 2W9CA 4R0EA 2GIQA 4O3NA 1KVBA 3T19A 2DY4A 4CEFA 2ASDA 2BQUA 4DFMA 4FBTA 2FJXA 2ZE2B 3N6LA 2Z1GA 3OYEA 3KHGA 5KT4A 1TKZB 5D3GA 3QNNA 4WFXA 4CECA 2JLEA 3VA3A 3PW0A 2JC0A 4RW7B 1IKXA 1ZBFA 2YNGA 1VRUA 1C6VA 3DLBA 1S9GB 1S48A 3D28A 2LSNA 2XI2A 4EP5A 2RN2A 4KHNA 5CZ1A 4B9TA 3S3MA 3JYTB 1QS4A 4FLXA 4RNOA 1FK9A 2YNHA 3QO9A 3IS9B 2UUTA 1TKTB 2W9AA 4ED0A 5E41A 4YR2A 1CSJA 1KFSA 1EKEA 4DLGA 3SCXA 2J6UA 2P5OA 4CFBA 3KKRA 2E6LA 3CWJA 3BQ1A 1JKHB 4H4OB 2OPPA 1JLAA 3VQ9A 3OS0A 4K4SA 2JGUA 2YKNB 5KFEA 3AA4A 4NLPA 3IG1B 4KB0A 1SKSA 2OPRA 5KG4A 3BSCA 2FLPA 1RTHB 4M3XA 3S9HA 3SJJA 3NE6A 1TV6A 1SL0A 2QE5A 1N6QA 4ID5A 2XCAA 4BE0A 4CHNA 4DFPA 1LAVA 4K4WA 5EUHA 3OYJA 1TVRB 3CIZA 4TYAA 4FYDA 1RDAA 1RDRA 2VG6B 4OKKA 3QEIA 4NYFA 1LW2B 4FK2A 2KFZA 4W5OA 4QWDA 3M9NB 3LALA 2HVIA 1JL2A 3KK3B 3FFIB 4DL6A 3TABA 4F8RA 1RT2A 4HTUA 1KHWA 1W0HA 4FLWA 4CF0A 2WB4A 4QWCA 4OVLA 3SQ4A 5F8LA 4RW9A 2YNGB 1TKXA 3IS9A 4OLBA 1WSEA 4FBUA 4EP4A 4DFJA 2Z1IA 3LZJA 3BSAA 1ZYQA 3KJVA 1RAJA 1NHUA 4TSXA 4FCYA 4OPKA 1XI1A 4Z4CA 2FVPA 1N4LA 3EZUA 1ZETA 4RZRA 3MR2A 4K4TA 1S10A 3RMCA 3GIKA 3KLHA 4ZPDA 1NK0A 2IDOA 1HQUA 2IS3A 2HNZA 1SH0A 2RDIA 1IH7A 4ECSA 1RTDB 1HYSB 1YVFA 2AGQA 1SH2A 3RTVA 3T1AA 1A5XA 4ED1A 4CHPA 1N56A 4EO8A 4AH9A 3SQ1A 1R0AA 4HKQA 4IRCA 4KO0B 3EZ5A 1DLOB 3LP0B 5DGBA 4W5NA 3K58A 3H4BA 4KHUA 3ZT3A 3OS1A 3TANA 1SV5A 5J2QB 3NGIA 4ID5B 4CGJA 4KKOA 2JEIA 5KFUA 3RAQA 1W9HA 4IKFA 4ECXA 3UQSA 4BE2A 2G8IA 5HLFA 5L1IA 1ASUA 3ZSRA 4RW9B 4KHYA 3A2FA 1VSMA 4J2AA 4ZP8A 3HXMA 4FLZA 1RT3B 3RBDA 1Y97A 3SI8A 2X6NA 1JLBB 3G6YA 4DS5A 3U6FA 3QEPA 4CF1A 4H4MB 1C2PA 1CXUA 2BGGA 4KHRA 3BJYA 2DFHA 2E6MA 3SPZA 4CJWA 4FM2A 2AWZA 3S3OA 2VG7A 3KLFA 5T14A 2IM0A 1B92A 4ED2A 4Y1CA 3RMBA 3NF9A 2IAJB 1TL1B 1RA7A 4E1MA 1RA6A 2OPQA 2Z1HA 1GX6A 4ECVA 4FJMA 3LPTA 3PJXA 1IKYA 3SZ2A 4HVJA 3T3FA 4N5SA 3D0PA 1CXQA 2XY7A 2D0AA 5KFSA 5KG5A 1JLEB 4E7LA 1HQUB 1K1QA 4O3QA 3RB3A 4EBDA 1RBTA 4MH8A 1RDDA 2HHXA 4DS4A 3AO4A 3NKYA 1NKBA 4ZMMA 1K6YA 4URSA 4O3RA 4J9MA 4PQUB 4KTZA 3QEXA 5FRNA 1YTAA 4FJNA 3OLAA 4MQ3A 4YP3A 4ECQA 4OKJA 1C1BA 4QWBA 4FLVA 2KQ2A 1HNVB 1HPZA 2ITGA 4RNNA 1RT5B 3VQ6A 5HRNA 3OYGA 4ECWA 1BI4B 4DF4A 1L3SA 3PO5A 4PUOB 2G8VA 2AGOA 3M9OB 4OGEA 1XR5A 4ECUA 2XY5A 1BQMB 1U45A 1S49A 4FS1A 2UVVA 4PA1A 3O3HA 1REVB 2B4JA 1RT4A 4IBNA 3I0RA 4NLDA 3AO2A 3CJ3A 2BE2B 4FM0A 1TK8A 4FJIA 3PX0A 3MFHA 1U09A 2P1JA 4W5QA 3WNHA 2G8HA 2OPQB 3IN5A 2R8HA 3OYKA 1C1CB 4C8MA 4CIGA 2VG6A 2W9BB 1JLEA 2XWYA 3LDSA 3OL6A 3EY1A 4CK3A 3CQ8A 4JRPA 3E01A 3L8BA 5HBMB 4KSEB 3ICLA 4FW1A 4B9NA 3THVA 1HMVA 1VSEA 1RTIB 1GOCA 1T03A 1RT5A 4IH5A 2HB5A 4RU9A 1JLQB 1WSHA 4DG1A 1RT1B 1KVAA 2B5JA 4IQXA 1G15A 2IJFA 1SKRA 3QIOA 3HPGA 1BQNA 4Y34A 1U49A 4NLRA 4ZP9A 3OL7A 4KREA 2O5DA 3F9KA 1S97A 3CG7A 2RKIB 1WAJA 1BI4A 4DF8A 4IDKA 1QTMA 1RT7B 4CEAA 2HHSA 2YNIA 3G86A 3OVNA 1WSFA 3QNOA 1QAJA 3DM2A 1RTDA 1VSLA 5KG2A 3TAMB 4E7IA 5KFCA 4ZTFA 3TAPA 2D5RA 5DG7A 4GC7A 3TR8A 3FRZA 4BWMA 4NCGB 4TY8B 4IG3A 4Q0BA 1QSLA 2IM3A 3I0RB 4NZ0A 3MEGA 4CJVA 5KFXA 4B8CA 5HP1A 1K1SA 3QZ7A 3V6HA 3I5BA 3U3YA 1IG9A 4E3SA 4ICLB 4I7FB 5JUMA 1KVCA 4B9MA 4DU1A 3QEVA 3BR9A 2RF2B 3RBEA 3TVKA 2FBYA 1IKWB 5F9LA 3JYTA 2W8LA 4MK8A 5KFDA 4EYHB 4F2RA 3NHGA 2GIRA 4CEQA 3HYFA 3MXJA 5T7BA 4Z4GA 2FVRA 1Z4UA 1RTIA 2V4RA 4DG1B 5HRPA 2RKIA 1RBUA 3OS2A 3L2QA 5C25B 3LAKA 3V1RA 4BDPA 2V0NA 4NCBA 3CM6A 4ELUA 4ZHRB 2F96A 2C2EA 1Z26A 1ZTWA 3B6OA 1RNHA 4CJFA 3V81B 3KK2B 4J2BA 3SPYA 3OYDA 3K5NA 3OHBA 3C6TA 2OPSB 3RMAA 5C42A 3NH0A 1SL1A 2YV0X 1RBVA 4H8KA 4NYZA 4KTQA 4YQWA 4ZPBA 4MKBA 2C22A 5DMRA 4KHSA 4LSLA 1N5YB 3AVMA 3LANA 4CJSA 4CK2A 1N6QB 2AJQA 4ICLA 1L3UA 2R8GA 3BDPA 2FBXA 4NCGA 4CGGA 4ZPAA 3TARA 1DTTA 1UA0A 1TK5A 5KFNA 2WTFA 3OYIA 2WCXA 4DTNA 1S1XA 4FLTA 3KOAA 2VG5A 3HP9A 2ZQBA 2R2RA 3AVFA 5L1KA 1D1UA 5J1EA 1HNVA 4TQRA 3OYNA 2IGIA 4KPYA 1S1UB 1JXBA 2Z1JA 3O4QA 4O3OA 4CJ5A 4AHVA 3SUPA 3LWMA 4J9KA 4W5RA 2E9ZA 1HARA 4I2QB 2FVSA 3KD1E 4B9LA 4FJ7A 4RUCA 1T3NA 4F4ZA 3H5UA 2XGPA 1JLFA 2V9WA 4ZVEA 4YNQA 2I1RA 2B43A 2XC9A 5F8JA 1UOCA 3T5HA 1S1WB 3DOKA 4CHOA 3ZT4A 4CESA 3GV8B 2ATLA 3ITHB 2VA3A 4TLRA 4IR1A 4EZ6A 4C8OA 4ED6A 2DPIA 3U3GA 5DQHA 2X78A 1SL2A 3M8QA 1NOZA 1RYRA 2PZSA 3RR8A 4TYBA 3FDSA 5F8HA 3PZPA 1UAXA 4MKAA 4AHRA 5C42B 4FJGA 3KD5E 2D41A 4J2DA 2BRLA 2AQ4A 4RG8A 5KFTA 4MIBA 4H54A 1BL3A 3SV3A 1JX4A 4KTWA 2X6SA 4URQU 2VWKA 4F4WA 1LWFA 1QQCA 4DSIA 2BRKA 3VQAA 4MK7A 4ED8A 3PO4A 3HVTA 2D0BA 1J5OA 3QGHA 4CJTA 3I0SA 4Q8EA 1HNIA 1QSSA 2FLNA 4YR0A 2G8KA 3AO3A 2FBVA 3AVJA 1EP4A 4IH6A 1IKYB 4ECTA 1BIUA 1S1WA 3OL8A 1YVUA 2GUIA 3OYHA 3ITHA 4AHSA 1FXXA 4DSFA 3OLBA 2PYJA 3H40A 2IAJA 2WOMA 3PHEA 4O3SA 5FDLA 1C0TB 3FQKA 4CHYA 3KLIB 3KMQA 2FLLA 1KSPA 3V6JA 4TY8A 4CJRA 3GIIA 2ASJA 3AV9A 2OYQA 5KG7A 4TN2A 1LW2A 4DTRA 5K14B 2PYLA 4QOZB 2P5GA 3OSPA 3H59A 2QKBA 3NBPA 3H5XA 4M94A 2QKKA 3T5KA 1Z25A 3GIMA 3ZSQA 3VQEA 1TKXB 3VN5A 4M42A 3C6UB 3VQBA 3MEDA 2ZD1B 3RMDA 1ZBHA 3SI6A 3PX4A 3QESA 4MK9A 4GMJB 3HPHA 1L3VA 1S0NA 3O3FA 3KHRA 1MU2A 4DL3A 2R8IA 2R7YA 3D45A 1Q8IA 3BGRA 2DFFA 4Z4HA 1KHVA 3DYAA 3DRSA 2JEJA 3GV7B 3SUQA 3C94A 1L5UA 1HNIB 4DL5A 1NNDA 4GVMA 2D3UA 3OYMA 3DRRB 4J9RA 1EETA 3LP3A 1BQMA 4H4OA 4B8AB 3V9WA 2A1RA 4N56A 3KK2A 1TQLA 4EYIB 2FBTA 4NRTA 4OKEA 3KMSA 4UQGA 1REVA 3M8PA 3IG1A 3MF5A 4K8ZA 4M3YA 2GV9A 3VQ7A 3AO5A 3TAQA 3AVGA 3SFGA 4LSLB 4Y1DA 4FZXC 4B3OB 4ZP7A 4HYKA 5EDWA 5KFZA 1NKEA 2R8KA 4LH5A 3DOLA 2J6SA 4CF9A 3OYFA 4GW6A 2AX0A 4FJHA 3V9ZA 4CFCA 3KK3A 3P83D 5KG3A 3UR0A 1S5JA 1NK5A 5KFMA 3QINA 4DQRA 3KK1A 4CGIA 3MEDB 3QERA 2IJNA 4HUEA 4O5BA 5DG8A 2GC8A 2XI3A 5DQGA 4I2PA 4IRKA 3FSIA 2HHUA 4YMEA 2XRIA 3NAHA 4QWAA 3KJVB 4M95A 4TXSA 4F4XA 2IA6A 2O4GA 3WNEA 4JRQA 1TL1A 2X74A 5KFIA 4ELVA 5F8NA 1MU2B 5KG0A 3VQPA 4DLEA 3HM9A 4RW8A 5JXSA 3KLHB 3CO9A 3PW4A 3DYAB 2BQ3A 1JKHA 4FJJA 1JLCA 1RILA 2D0CA 2QK9A 4XPEA 3AVKA 2NUBA 4FM1A 1XR6A 2YNIB 3MEGB 4EZ9A 4Q8FA 5F8MA 4LY7A 2C2RA 3PY8A 2BDPA 1NHVA 3AA3A 4E89A 2HNYB 4EO6A 3OJUA 4Y2AA 3ZSOA 4CF2A 3OY9A 3CFRA 4I7FA 3DLEA 3NH2A 4O0JA 1QSYA 3G6VA 3Q8RB 5EWEA 3MR6A 3FFIA 1BCOA 4RNMA 1VSDA 4WFZA 1RDBA 3KLGB 5HRRA 2PY5A 4I2PB 5C24A 2I5JB 1J5OB 3NH1A 4ECZA 3ZSYA 4J9SA 2A1SA 4CJLA 3DMJB 2J6TA 3KK1B 1FKPA 4KAIA 3B6PA 4L8RB 5SWMA 4LD0A 4K50A 4DU4A 3CJ2A 3PVXA 4IOBA 3S3NA 1EP4B 4Q44A 3NF7A 3D5MA 3TI0A 2KFNA 1TL3B 1OS5A 4WZQA 3AVAA 3GQCA 4R5PB 4RNHA 4KB1A 1HYZA 1RT4B 3M8RA 4ZVHA 4FK4A 5KGXA 4PWDB 4R8UB 1F21A 3K2PA 3LP1B 4ZHRA 1S6QB 1HYVA 3BREA 4DQSA 4RW8B 3V81A 3CVKA 4BACA 3NL0A 1BGXT 3K57A 1IO2A 4IFVA 3LZIA 1S1VA 4O55A 5J2NA 5EWFA 3V9UA 4KHWA 3NBPB 4FJLA 3BQ0A 3SQ0A 1W25A 3ULDA 4FK0A 4IG0B 1JLQA 2OA8A 5KFQA 5HLFB 4AHCA 1LWEB 1NKCA 2HHQA 1VRTA 1S1XB 3N6NA 3H2LA 1QUVA 2YKMB 5KGWA 3BSOA 1ZBLA 1IKVB 3H4DA 5J1EB 4K4UA 3SUNA 1UA1A 3RWUA 5J2PA 4CEOA 4H4MA 3NAIA 2R2UA 2ATQA 4ELTA 1QHTA 5I3UB 3DRSB 3K5OA 4LQ9A 4DTSA 4FJ8A 2WRMA 4Z4FA 4CCHA 3MEEB 4M45A 4GC6A 2HW3A 1X1PA 2WONA 3VQSA 3QYYA 3KLVA 2JEGA 4G3IA 4CEEA 3RRHA 3KIOA 1EETB 3E51A 1KCFA 3JSMB 2DFEA 5KFPA 1LAWA 1NJWA 3GV5B 4PY5A 1SUQA 4KE5A 1TL3A 1JL1A 3DOKB 5L9XA 2OH2A 1RT6B 2AGPA 4CIEA 3I5AA 4NLUA 1B9DA 2V4QA 3L3UA 4M3UA 1NK9A 4PWDA 4FLYA 4LQ3A 1X9SA 3DI6B 1WAFA 3LP1A 4QW9A 1NK4A 4RNFA 2HHVA 4J9NA 4M3WA 1CLQA 3H08A 1JLGA 2OZMA 4DL7A 4JS5A 3HPOA 4IG0A 4Q45A 4B9VA 4KV8B 2AU0A 2YHBA 2E9RX 1S1TA 1HMVB 1CZBA 1S1VB 5J2NB 3QLHB 4JUZA 1C1BB 3MXMA 4FS2A 4E7HA 3O3GA 2Y1JA 2IBKA 3PR4A 1LWFB 2OZSA 4F2SA 3SUOA 5KTQA 4O44B 5FRMA 5I3UA 1D9FA 2FVCA 4JV2A 4OPJA 3V9SA 1JIHA 5C25A 1KTQA 3OYCA 4PUOA 4KHQA 3LAMA 1Q9YA 4QAGA 4E7JA 2DTUA 3ZT1A 3JSMA 2WOMB 3MFIA 1QE1A 3PR5B 2R8JA 4HCBA 5HRSA 2C28A 1YTUA 4EBEA 1C0TA 4K4XA 4DQIA 5CYQB 4CJUA 2JEFA 2OPSA 4HUGA 2HAIA 4XO0A 3RR7A 3QIDA 3IRXA 3TAMA 2E9TA 4Q43A 1S4FA 2HMIA 3DI6A 2HNYA 3EPGA 4FLUA 4CK1A 3LWLA 4DSJA 3TWHA 2HNDA 4OL8A 3NF8A 2W7PA 3VA0A 2W9BA 4WZMA 4CEDA 1IKXB 4NLTA 1S1TB 1XR7A 1VRUB 4Y2CA 5K14A 2Y1IA 1EX4A 5JS2A 1S9EA 4U6PA 4DL4A 3ZSXA 3HK2A 2BANA 2VWJA 4DWIA 1RTJB 1JLGB 3AVCA 4FZZA 2F8TA 4IH7A 2BQRA 4ECRA 4CGHA 3DRPB 4DTMA 3IAYA 4HUFA 1ZTTA 3QZ8A 2E4LA 3NF6A 3NCIA 4OGCA 3BGRB 3ISNC 1FKOB 4I9LA 3DMJA 4I2QA 3C6UA 3T5JA 1RBSA 3SNNA 2ZD1A 3L3VA 4W5TA 4KHMA 2UUWA 1BQNB 1JLFB 5KFWA 5KFHA 4ZTJA 3HT3A 3FQLA 3QIPA 4DU3A 3VQ5A 3RB4A 5I42A 4E0DA 3PUFA 3ALYA 4DQPA 2IC3A 3DRRA 1XHZA 3Q8SB 2KZMA 3V6DB 4CFAA 3M8QB 4E1NA 3C6TB 5KT6A 1L3TA 4U7CA 4G1QB 3LP0A 3HP6A 3P5JA 3AVBA 2W8KA 2UVRA 2HNDB 4WYLA 4BDYA 2R2TA 4RW6A 4WYWA 4NLVA 3TAEA 3H98A 5KT7A 3RAXA 3ZSWA 1BIZA 2HMIB 4NLWA 2ASLA 1I6JA 4KFBB 1HRHA 2FC0A 3M8SA 1LWCA 4EBCA 3DOLB 3K5LA 2B6AB 1B9FA 1S9GA 1EXQA 2UVWA 4ZP6A 1ITGA 4BDZA 1HQEA 1C0MA 5L1JA 3KHHA 1GOAA 2YHAA 2KW4A 1D0EA 4C8NA 4WFYA 1FK9B 5KFFA 4CJQA 3VQ8A 1U48A 4TY9A 4N76A 1S6PB 4CERA 4E19A 4K4VA 4F3OA 4CGFA 3KLEA 4FJXA 4F4KA 1VSJA 2O4IA 1TAUA 1A5VA 1I3AA 2G8UA 2HNZB 3G6XA 3WNGA 1JLAB 1RBRA 3I5CA 4ED7A 4NLYA 3PW5A 4G1QA 3KNAA 4CF8A 4M3TA 1WLJA 3V4IA 5KFLA 3OYBA 3QEWA 1DLOA 1TVRA 3PW7A 4CHQA 4AILC 2IOCA 4DL2A 1TP7A 4IFYA 4N47A 3L2UA 5J2MA 3AVLA 4B08A 1DTTB 4RW6B 3UIQA 3VQCA 4K4ZA 1DTQA 3I8DA 2VG5B 1HQEB 1RT3A 4RUAA 1BISA 4JLHA 3ZCMA 5C5JA 2IMWP 4Y3CA 3LP2B 3ZT0A 1BHLA 2W42A 1KLMB 4DTJA 3IGNA 5FROA 4FJKA 5F9NA 3MECA 1CZ9A 3TQ1A 3NAEA 4KI4A 2DPJA 1FKPB 4K4YA 3KLEB 5KRSA 3ZSZA 1RYSA 3NFAA 4R8UA 4ZPCA 3UPFA 2FVQA 3QGGA 3QETA 1TK0A 1XC9A 3KTQA 3DDKA 3QGIA 3IRXB 4R5PA 2ETJA 2RPIA 2VA2A 3HSTB 1HYSA 1J53A 2YNFB 3VQQA 5EU7A 1TAQA 4O3PA 1LV5A 2G8WA 4NLGA 4CEZA 4DTOA 5KFYA 1VK0A 1NK7A 1TKZA 1S6QA 5D3GB 5CYMB 4MFBB 1KFDA 1D9DA 4IFYB 5DLGA 2XO7A 1NK8A 5KRTA 4Z4EA 4YR3A 2ZE2A 1LWEA 4QPXA 1SV5B 5J2QA 1BCMA 4CEBA 3AVIA 4KKOB 4CHZA 4CJ4A 2XY6A 1RT1A 4RW4A 3T5LA 1NJXA 3OYAA 3NGYA 4URGA 3DRPA 4JV0A 5KFBA 4AHTA 5KFGA 5DG9A 3Q8PB 1JLBA 1VRTB 3I0SB 3AVNA 4Z0UA 3MEEA 1WN7A 4MIAA 2IM1A 2XY8A 4XPCA 3QO9B 4BE1A 3VQ4A 4DMNA 2KZZA 5J2PB 3OL9A 2C2DA 1TKTA 1RT7A 1KLMA 3CM5A 2HWIA 1T94A 1GOBA 2VG7B 3KLFB 3IGVA 1ZBIA 3MECB 3OJSA 3DLGB 5KT2A 2OPRB 3G10A 2BE2A 1TV6B 4IRDA 3NDKA 2RDJA 2OPPB 4J2EA 2HHTA 4WXOA 1XHXA 1SUQB 2YKNA 4Q0BB 4CFDA 1VSKA 5CYMA 3CFPA 3CDWA 2ILYA 3CDEA 3NGZA 3EYZA 4F50A 1O1WA 2YNFA 4KV8A 2W7OA 1A5WA 4QCLA 1RT2B 4DTUA 2EC0A 3L2WA 3HVAA 4KFBA 5EWGA 1SKWA 2JC1A 4K8XA 1IKWA 4KB7A 3HVRA 1LWCB 3HJFA 4KBIA 3BSNA 4CIFA 3KKSA 3PW2A 4HCCA 1T03B 3L2RA 5KFAA 2G8FA 3HHKA 1WNSA 4FW2A 2CJQA 5KFRA 2HWHA 4FVMA 3MAQA 4IR9A 3EPIA 3QLHA 2D7SA 4DTPA 1UWBA 3CFOA 1U4BA 1D8YA 5HROB 1S0OA 3HO1A 4O4GB 4F3TA 1Q9XA 3OSNA 3H5YA 4I9QA 4ECYA 3CJ5A 3DLGA 1GX5A 3CJ4A 3ISND 3SFUA 3PV8A 1KLNA 4JS4A 5KFKA 2UVUA 1T7PA 1JLCB 2XGQA 2P51A 4YFUA 1QE1B 3AVHA 1QAIA 2FJVA 3V1OA 3ZT2A 4DSKA 2W9CB 1HJRA 5CZ2A 1WSJA 4ID1A 3CJ0A 4WE1B 3AA2A 3Q8QB 1LW0A 4X2BA 4IG3B 4J9LA 4FXDA 3CYMA 5F8IA 3ZSVA 3RRGA 4BWJA 4J9OA 4DQQA 3GIJA 1R0AB 4B3OA 3DLEB 1C1CA 1YT3A 3K59A 4HHTA 4ZVGA 4O0IA 4KO0A 1SH3A 1T05A 5KI6A 1TGOA 1IM4A 5J2MB 4QW8A 3V6KA 3V9XA 1FKOA 1JXLA 4OJRA 5C24B 3HL8A 2B5JB 1C1AA 5HROA 4NRUA 2QV6A 3OHAA 4EEYA 3O4NA 2ZKUA 3QIPB 1VSFA 1J9AA 2WONB 1ASVA 1MMLA 4LSNB 5I42B 1UWBB 1S9FA 4NLOA 3V6DA 5SZTA 5DQIA 4IDKB 3MR3A 3LPUA 3TAGA 4M3RA 1U04A 4WE1A 4M41A 5L1LA 1J54A 1RTHA 4Z4IA 1WSGA 3TAFA 3DLKB 1N5YA 3SQ2A 2EX3A 4MFBA 3CDUA 1WNEA 1T05B 5HP1B 4TQSA 3DLHA 4B9UA 1C0UA 1LW0B 4JV1A 3SYZA 2B6AA 4DSEA 2F8EX 1JXEA 4WXWA 2QXFA 3L2VA 1NJZA 4CJEA 4B9SA 4N41A 4PQUA 4KAZA 1VSIA 4J9QA 1NOYA 3P1GA 3HVTB 4RW4B 2RF2A 5JS1A 3G0ZA 1WSIA 5CY4A 3PJWA 1S1UA 4KI6A 4M3ZA 1X9MA 4C8LA 3KLGA 2ILZA 4CGDA 1IKVA 2I5JA 1S6PA 1I39A 5DLFA 4IKAA 1HPZB 3V1QA 3UDLA 2XCPA 2EHGA 4OLAA 4LSNA 1RDCA 2ALZA 3VQDA 1TKDA 4QWEA 3OYLA 5KFVA 4J9PA 3PX6A 2AX1A 5KT3A 5KFJA 2WHOA 5DGAA 3M9MB 4DSLA 2HVHA 2Q3SA 4DTXA 5KG1A 5FDLB 3V4IB 3HKWA 1XWLA 3KLIA 3NGDA 1VSHA 1NK6A 5DK5A 3DLRA 1RT6A 3NMAA 4FJ5A 4F4YA 3MR5A 2WK4A 4NLQA 4CJPA 3GILA 2D3ZA 4E7KA 1C0UB 3SV4A 5KG6A 3AA5X 4Q5VA 4DFKA 5HBMA 4FZYA 3F73A 4IFVB 3MXIA 1KRPA 3AO1A 3DLKA 4ED3A 2GBZA 2R2SA 1ASWA 4NCAA 1S9EB 3C95A 2XHBA 1T8EA
chains in the Genus database with same CATH superfamily
3HDSA 2G1HA 3RSEA 2EI5A 1RTJA 3VOVA 1NJYA 3E01B 3LP2A 4NYNA 3LM2A 3TUZC 4ZVFA 3W61A 4O44A 2OANA 5MLCQ 3H7HB 4DV4J 1SQGA 2YNHB 3SBTA 1TR0A 3RB0A 2E1MC 1WHXA 3WZ0A 3BZCA 4DV6F 2QWOA 4CJKA 3WQPA 3EJMA 4M8LA 3O1WA 2IC3B 1X4DA 4DPXA 2CKWA 2Q79A 5CYQA 4WF9Q 2JVRA 5F8GA 4OX9J 4R0EA 3BM7A 2GIQA 1H38A 2VGMA 2MJUA 3CCSN 4O5FA 2J9DA 1VQKS 4RJVA 4DFMA 3PXGa 2ZE2B 4ZCKA 1Y9OA 5D3GA 4WFXA 2A6OA 1IR0A 1YBTA 1HL6A 1ZBFA 5D0HA 5LMNK 1SC4B 1NG9A 4GO5X 1VAZA 3D54A 5A6PA 2LSNA 1Y5LB 4FF1A 5M1OA 2ZDOA 3HD2A 4LF4F 5LM7E 4RNOA 2YNHA 2UUTA 1TKTB 1QAYA 5E3RA 4YR2A 1UFKA 1KFSA 5BXIA 1FX2A 2GO8A 4ANDA 2J6UA 1BY9A 4KH5A 3KKRA 2E6LA 4MT1A 2F8HA 2Q3PA 4U95A 1WORA 2WSCC 2OPPA 1JLAA 3OS0A 4Z7YA 2OAUA 4CD3A 5KFEA 3D2EB 5HMYA 3AA4A 2VWBA 5KG4A 2XSJB 3GFXA 2FLPA 1RTHB 3S8SA 2HLUA 3W8PA 4AM6A 1FCAA 1YITN 4ZDNA 1N6QA 9ATCB 3AAPA 4FYDA 3IXQA 5IV4A 3QEIA 4BRNA 1IBLK 4LF5F 4ZJOA 3J7A1 4F8RA 3FFIB 3OD2A 5AE3A 3A0IX 2WB4A 4OVLA 3JQJA 5F8LA 3O44A 4L3KA 2IVYA 2YNGB 1M1HA 5FPMA 3IS9A 4OLBA 4DFJA 5JVGL 3K8VA 3CCUS 2O1PA 3BSAA 2H5JB 3ZX3A 1NHUA 5HAOA 1VJWA 3HZEA 3FCWA 2A3ZA 1ZETA 1OY9A 4YS2A 2NZTA 1KD1T 3NS5A 4UTGA 3MMJA 4OV6A 3KLHA 4ZPDA 1NK0A 3CC4N 1M1KO 1SH0A 2RDIA 5AQSA 1HYSB 1X4BA 2PI4A 2AGQA 2MGZA 2FF3B 1HWKA 3ILOA 4ED1A 3DLJA 2DCLA 3HSZA 2OP5A 4DU7A 1GLEG 4J8FA 4IRCA 5A2QY 1VBYA 4W5NA 3CF5Q 4AT1B 5LY3A 1VQNS 4C6AA 1SV5A 4HDGA 4CGJA 2JEIA 2APOA 3N01A 1BU6O 5L8RC 3Q7CA 5HOOA 4F3QA 4DPYA 1SJ1A 1KAYA 2NRWA 1N33J 3AGRA 2VDHA 3G8SA 4ZP8A 1DGKN 2G0CA 3RBDA 3SI8A 2FXUA 3G6YA 3ZZTA 4BRHA 3GSIA 3WEEA 2EFNA 2BW7A 4OI6A 4FWNA 2OFHX 5DDRC 2Y9HA 4WFAL 2E6MA 5E5NA 1M90T 3S3OA 1ZOTA 2Q66A 1PG5B 2E5JA 3Q86A 1B92A 3A8YA 2CPYA 4Y1CA 5HSPA 1REGX 2W24A 3RMBA 1TL1B 1RA7A 1LWXA 4ILRA 4DUZK 4J9UE 3DOMB 2HGNA 2RJZA 1GX6A 1S4EA 4FJMA 3QQCD 3MWBA 4YOUA 1Z1ZA 2CJAA 3C7NA 4LFAF 2PE8A 2D0AA 4YOYA 4YORA 5LJWA 4DB3A 1M5OC 2QFJA 1JLEB 1HQUB 2X3GA 2XMVA 4ZVPB 1LEOA 3AO4A 4CLPA 3T69A 4QIVA 1RHRB 4URSA 1HWJA 3ZZUA 1YZ6A 2ZH9A 3EVOA 1CC7A 1GMUA 4YP3A 1TMJA 2FSNA 3R5AA 2ZH2A 1C1BA 2PFDA 1EQ0A 4RNNA 4WK1A 3OYGA 1DHMA 4ECWA 1BI4B 4DF4A 1AYEA 1HR0K 3FZFA 2XMMA 1J2VA 1Y5IB 4OGEA 2GS8A 4JI1J 3FMBA 3OFGA 4RUBA 3RW6A 3CCVN 3PKMA 3CI5A 1Z6RA 2UVVA 4PA1A 3RRKA 3O3HA 2YCHA 3KG1A 4KR0B 3C19A 2MXYA 4FJIA 3PX0A 4GVBA 2W4PA 3O4WA 2G8HA 4CO1A 2M52A 2MDAA 4JI0F 3OYKA 2HIQA 1HBNB 4C8MA 2QLBB 4ES1A 3M1FA 3J8AA 1YI2S 3HULA 4M5NA 4GV6A 2W9BB 3LDSA 3IWLA 2N4DA 3OL6A 1B3TA 4JRPA 4KSEB 2FJEB 4DR3J 4B9NA 3THVA 1HMVA 3JTPA 2ASOA 1GOCA 2HB5A 2FSKA 3HKZD 5CHIA 1RT1B 5B0FA 2DIVA 1IBKF 3EX7B 1BQNA 4Y34A 1DEJA 3OT9A 1U49A 5D77A 4KREA 2LKZA 4JI1K 4JI5F 2BJ3A 2RKIB 3I8BA 3A8IA 2AP1A 2VPYB 1MROA 1R6YA 3QNWB 4IQMA 5D6GA 2DGXA 2RRNA 1HUXA 5AJ3K 1B4SA 2YI1A 2VQFF 2HHSA 2NXEA 3G86A 3J80Y 3TJAA 3OVNA 2KT3A 3QNOA 5AR0A 2CJKA 2OLWA 3DM2A 2P9LA 5KG2A 2ZBPA 4E7IA 5KFCA 2DH7A 4M5MA 3QFHA 2D5RA 3GCWP 2BMBA 1JCFA 3G6EN 4NCGB 1QSLA 1S12A 3I0RB 2DNHA 1KONA 1QZ6A 3W9IA 4CJVA 5KFXA 5HP1A 1VDHA 1K1SA 2OSRA 3QZ7A 4JKGA 3V6HA 2CPJA 2C42A 4QR1A 3U3YA 2L41A 4IEIA 4BGBA 1WUUA 4USMA 1D4XA 4I7FB 3AT1B 3LTOA 2FZCB 1UKUA 4B9MA 1UTAA 3BR9A 3GU0A 1O0PA 1XTZA 1IKWB 2W8LA 1IUJA 2GNKA 4EYHB 2GX9A 3Q24A 2RILA 3QFUA 2GIRA 4V19S 3ATVA 3Q2SC 2XNRA 1YRUA 1RAFB 4NXNK 1B64A 5DM7Q 2ASYA 3J81U 1HNWJ 5HRPA 3X1LB 5CD4A 1RBUA 3OS2A 4FP9A 2JDJA 1NM1A 3R97A 3W3DA 4ZVUB 3W5XA 3L2QA 2EBEA 3A5LC 2BM1A 1YVNA 4HH0A 3DRYA 4NXNF 5D0GA 3R7SB 4YY3F 3B6OA 2O8CA 3V81B 1JXVA 1WHYA 3OHBA 4V1Ak 3C6TA 3FZ2A 1SL1A 3NH0A 4E8UA 4KTQA 4H8KA 4NYZA 2BVZA 4YQWA 5BR9A 2HURA 3RAMA 2AYEA 2H3GX 2WTUA 4WKRA 3LANA 4ICLA 2CWXA 3KVGA 3O2IA 3R7NB 3D1OA 4XH4A 2AHOB 4ZPAA 3TARA 1DTTA 1TK5A 5KFNA 4X4VA 5LOQA 3OYIA 2WCXA 4DTNA 1S1XA 4CZGA 2HPUA 2ROGA 4JKGB 3GFYA 2XBPA 2R2RA 2HBQB 2GO9A 3AVFA 5J1EA 4P2MA 3OYNA 4W98A 1KP6A 3WQTA 4WIIA 4KPYA 1S1UB 2W40A 1CJVB 3QDKA 3ENBA 2XMAA 3M5RA 4O3OA 4CJ5A 3SUPA 2E9ZA 2FVSA 1KOHA 1FD8A 1V4SA 4ZVEA 2GAHC 1U8SA 5GAEI 1WKLA 2MLXA 3MMAA 4YNQA 2I1RA 3G82B 3SQGA 2HBJA 2E7WA 4CHOA 4CESA 3TA1A 1CS4A 2ATLA 2VA3A 1N34J 2FTRA 4ED6A 3U3GA 2H54B 5DDOC 1P9QC 4RWXA 5DQHA 4USTA 2F7TA 5F8HA 1R8CA 4LBIA 4AHRA 4BG9A 1G99A 4FJGA 4CLUA 4FWSA 5HMZA 2BRLA 2AQ4A 1T9WA 3IAS9 3MMVA 2L48A 4H54A 3AJ2A 2VZ9A 2VFTA 2Q36A 5ADXH 2X6SA 2WBRA 4MDBA 4Y6IA 2MSTA 1QQCA 2VWKA 4B1YB 4CBUA 3PO4A 4CJTA 1HNIA 3NGSA 3K7RA 3R8YA 2HVDA 4FWOA 1YHQS 4YR0A 4LF5K 2HBYB 3AVJA 1EP4A 4IH6A 3SQGB 1RCXB 1WOOA 1R43A 3ITHA 2NCKL 1FXXA 3OLBA 3H40A 4KGKA 3IA0A 2LU1A 1CJUA 2GUPA 3TA2A 5FDLA 1C0TB 4OQJA 2XMKA 3B8AX 1VISA 3GFZA 1KSPA 3JSBA 4NWBA 1Q82T 3AV9A 3UE5A 2VONA 2OYQA 3P4UB 2YKAA 4EI2A 1LW2A 3W2WA 3O3LA 3G25A 1EZZB 3H59A 3NRBA 2YXLA 3H5XA 2QC3A 2KXHA 2HBLA 3ZZRA 2QWRA 3GIMA 3Q8YA 4DV1F 1UEUA 2HVZA 3ZSQA 3OFEA 3VQEA 1TKXB 1BD6A 3VN5A 3MMCA 2AIRB 2ZD1B 3BZQA 1ZBHA 1HHTP 3SI6A 2LQJA 3E3XA 3QESA 3PFOA 2B4PA 2R7RA 4DL3A 1MU2A 1XNRF 2R8IA 1Q8IA 4AQYK 1KHVA 4DL0C 2E1RA 4A8QA 1JJHA 1UWAA 3KHYA 3C94A 1L5UA 3DRRB 2VOOA 5JJBA 1ZPWX 2EK6A 1CPZA 1U26A 1BQMA 4H4OA 1DRZA 4NRTA 4UQGA 3KMSA 4MMOA 3IG1A 2HSEB 4K8ZA 2J7WA 1U0HB 3QSYB 3AVGA 4FWKA 1YJ9S 2E2NA 2RRAA 2CJ9A 3OUYB 1YZ7A 1FE4A 4HYKA 5KFZA 3UE2A 1YX2A 5M1QA 2YKQA 2AJ0A 3ZTQA 2AX0A 4CZJA 3TOQA 3V9ZA 8RUCA 3KK3A 3P83D 1TUWA 5B0GA 4DQRA 3KK1A 3FZLA 3QERA 1XMQK 4KH4A 2NLWA 3CO0P 2NRVA 5H9EJ 3SSQA 1IVZA 1VHXA 1W2BM 3NAHA 4ITSA 5LJVA 5DM7L 4TXSA 1RAIB 3WT0A 4PXCA 1EB0A 3WNEA 1CJKA 1TL1A 2X74A 2XHCA 1VQON 1KDNA 1VQNN 5F8NA 5KG0A 4DLEA 3HM9A 3DJCA 4RW8A 2A6MA 2BQ3A 4OJHA 1MN7A 1JKHA 1FE0A 4NMXA 1MDUB 5CH7B 2DNRA 3CIPA 3BEGB 1S0VA 4XPEA 4FWRA 4A2AA 3AVKA 2NUBA 2QK9A 2BABA 3P45B 4C11A 4LY7A 3PY8A 4A8OA 3EM1A 4E89A 3OJUA 5IV3A 4Y2AA 3LDLA 3OY9A 1XIQA 3CFRA 4KGMA 2Y1LB 1NB7A 4AUKA 2JWNA 2J9DE 2NZCA 1J5EJ 2NNWA 3G6VA 3MEKA 1S22A 2HS4A 1BCOA 4H5VA 2ZM6J 4BR2A 2PO4A 3AGKA 5HRRA 2M5YA 1J5OB 2FC9A 3NH1A 3AAQA 4DPOA 4ECZA 3PIPQ 1TUVA 4QR2A 2A1SA 4CJLA 4PEOA 4X66F 2J6TA 3IC1A 3KK1B 1FKPA 5HI7A 1YLXA 3B6PA 3VGUA 3F41A 3NGTA 3AOBA 2A2DA 2J8SA 3CJ2A 5AQRA 4Q44A 5EVZA 2Q97A 1OS5A 4FOEA 4ISGA 1R6VA 3K2PA 4ZHRA 1WTFA 3V81A 2RQMA 2ADBA 1HBOA 1Q7LB 3W9HA 1FJGF 3LZIA 2HFUA 4YHHF 5DM6L 2PMHA 5EWFA 5M2RA 3T1HF 1VQLS 4M5DA 4KHWA 4IOCQ 3ENVA 2I0XA 2XTJP 5KFQA 2QA4G 1LWEB 1NNEA 1VRTA 1V5VA 3P3DA 3H2LA 3OTOK 2YKMB 1MN9A 3BSOA 1HPMA 1IKVB 2AA4A 1UA1A 1K44A 3MURP 3RWUA 5J2PA 1WACA 2F4VK 1UEKA 2VUGA 1HI1A 3LO3A 2ZOFA 4DV5F 4U7UK 4FWQA 4JKEA 4I67A 4FWLA 4FJ8A 2ZJPL 3MEEB 2WONA 3CCZA 5AJ3J 2JEGA 4CEEA 1EETB 1RABB 4K7QA 3CULA 2DFEA 1XMOJ 3GV5B 2I2YA 4AXIA 1U2RA 4DN0A 3AHPA 4CYUB 1PYOB 1IBMK 3TZWA 5IWAK 2UUBK 1U0HA 1JL1A 2AGPA 2VFUA 6FDRA 2V4QA 2CQGA 2OSQA 3DI6B 1WAFA 2XLJA 1NK4A 4M3WA 2E8AA 1HNWF 4WCEL 3FGUA 3H08A 2OZMA 2HYIB 5M2PA 3H90A 2XS7A 4HHUA 3IMXA 4OV1A 1CZBA 2DR7A 2CZVC 1TTHB 3QLHB 4JUZA 2QYGA 4FS2A 3NMUA 4Y65A 4E7HA 3PR4A 2OZSA 3SUOA 4A61A 3O1LA 2HOEA 1ICEB 1WC1A 1RGIA 4OPJA 8AT1B 1JIHA 4OI2A 5C25A 4B3MJ 4CWBA 5DDPC 1Q9YA 4QAGA 3NOCA 4E7JA 2IVPA 4I4BA 1AUDA 2WOMB 1QE1A 5HRSA 2KN4A 2KDOA 2GGPB 5K5MA 1YTUA 2GW8A 3F0NA 3T1YJ 1LFPA 4K4XA 4K43A 3SEOA 4EHTA 4XO0A 5LMNF 5AQOA 3LDPA 3TA0A 2Z8QA 4Q43A 1VQ7S 3CDAA 4A48A 2HMIA 2P9SA 3DI6A 3C14A 3OW2M 2HNYA 1Y00A 1F60B 4YB7A 3WXLA 3LWLA 5EX5A 2DEIA 4CBWA 2HNDA 4BG8A 1FESA 2W7PA 4JI2J 1IKXB 2Q0RA 3OPKA 5K9FA 1S1TB 2LDIA 1WDTA 5JS2A 3HK2A 2VU5A 1O6XA 2VF3A 4DHYA 2GV1A 4P7TA 4DWIA 5GAEP 1JLGB 2BQRA 4CGHA 2BTFA 3NCIA 2KHCA 4E98A 1N5SA 2X51A 4OGCA 5J1PA 5LL6Z 1I3OB 4IOXA 2ZD1A 3L3VA 1N32J 1BQNB 1S5ZA 4LF5J 5GAEU 2HK2A 3QRQA 2QWMA 5AFUA 2CPIA 1SS6A 3BH7B 3VTHA 3HT3A 3BKTA 3FQLA 4DU3A 3RB4A 2QW9A 2EXUA 4LBHA 5D4NA 1Q7YT 3Q8SB 5AZIB 3I56S 4XDDA 2K7JA 3KXDA 2KG1A 5DM6Q 5C2DA 3LP0A 3P5JA 2WVCA 5C7PA 2V2VA 4RW6A 1IR2A 4WYWA 3TAEA 1IV0A 3RAXA 4Z37A 4NLWA 1I6JA 2FC0A 4OIXA 3M8YA 3LW5C 3M8SA 2UYTA 3DOLB 4OZLA 2B6AB 2GAGC 1B9FA 3VGSA 1WC6A 2NS1B 1TELA 4BDZA 4JYAF 1F2GA 1N52B 5AQVA 2MQPA 2KI2A 1MLAA 2XWXA 5L1JA 1GOAA 2YHAA 2KW4A 1X4AA 4C8NA 2V94A 3QRRA 1OQ3A 4K41A 4TY9A 1S6PB 1FWLA 5HVHA 2NR0A 4ED5A 4PG6A 5IQ6A 1VQ8N 4HI1A 3FCVA 2W2MP 4CZEA 4ZLLA 1Y5NB 5GMDA 2NPFA 4F4KA 1TAUA 1UMJA 1B99A 3PRVA 4ILHA 3PKYA 3KWIA 4C98A 1JLAB 2B0GA 3ZETA 4NLYA 5T7LB 3PW5A 3KNAA 1H2TZ 1WLJA 3V4IA 3MXHP 1GLFO 3A12A 1TVRA 3ET6B 3DGPA 3PW7A 1T9UA 3IR6B 2ZVIA 1HFEL 1ACMB 4DL2A 4JI7J 4ZKAA 2YWWA 4CLYA 3OR1B 4DZ6A 5ITHA 4K8RA 1QQNA 4JI4K 2CVEA 3AVLA 3FKBA 3EKUA 4USHA 1DJ0A 5HJXA 3DGVA 3BO3A 3VQCA 3H1QA 4OPHA 1UCNA 1N88A 4BRQA 1DTQA 3M6VA 2VG5B 3M2RA 3BP8A 1BISA 1S6UA 2V68A 2UV8G 2VC0A 3U27A 2IMWP 3ZT0A 1BHLA 5BYSA 4DTJA 3IGNA 2MHEA 2UXDF 5F9NA 1Y64A 1IN0A 2VQEF 4CT8A 4GVLA 1YHQN 3NAEA 1UEVA 5E26A 1RYSA 4YB5A 3GJSB 2CXEA 2AKWB 3MD3A 3O08A 1FRJA 2KYZA 3MAAB 1I94K 1TK0A 4JNEA 1XC9A 3DDKA 3QGIA 1U6FA 2AW0A 1HYSA 3UWTA 4LF8F 5EU7A 1C4AA 1VLYA 1VK0A 2ZBQA 4EGLA 1TKZA 5FLXU 1WTBA 5CYMB 1AUSL 3BGOP 1QVGR 4I6YA 1KFDA 2FJDB 3HFKA 3D0IE 1PC4A 1KC8O 5KRTA 2V69A 1RDUA 1LWEA 2XYPB 4QPXA 1BCMA 2EFPA 4KKOB 5AQNA 3IUCA 3DGPB 1SIZA 2BJ8A 3NGYA 2KXFA 4Y28C 4NXMK 3DRPA 5KFBA 1I51B 3FK4A 2XLKA 4AHTA 4G9ZA 5KFGA 3Q8PB 4A46A 2QXLA 2CGLA 4CZMA 4OZNA 3I0SB 4DOZA 3MN9A 5D4PA 1WN7A 3QO9B 4BE1A 1K0VA 4DMNA 2QGFB 3OL9A 2OGUA 2ZBRA 2O67A 3BGFA 2J9CA 4AXJA 1HR0F 3T1YF 4PWUA 3GJRB 1ZBIA 4CTAA 3DLGB 2DNGA 3G10A 5A8WB 2VJUA 2BE2A 1TV6B 4RU2A 1JK9B 2CQ4A 1NGAA 1XHXA 1F1BB 2VPZB 3CDWA 2KYXA 2ILYA 3V2UC 3CDEA 2HZCA 3ULEB 2OEJA 2ZJQL 4OFZA 1ATSA 4F50A 4DV2F 4KV8A 1RT2B 4DTUA 5DRKA 5D4LA 4ES2A 3HVAA 1HWUA 5EWGA 2OTLN 5LT5A 1XN9A 3MM6A 4ZVRB 4K8XA 4KB7A 1LWCB 4KBIA 2MLZA 4PQAA 4CNYA 5CZVA 2XQCA 4DR1J 3EN9A 3UCGA 2R7OA 3ID8A 4CBXA 1QJHA 5KFRA 3O80A 4FVMA 1T11A 2E2OA 3Q2TC 2QWPA 4M63C 3QLHA 2L9DA 1H1VA 2X1GA 3TO8A 4WJBA 3HTVA 2XMTA 1NSKL 4F3TA 3ZO7A 4I9QA 3P5BP 3R7BB 4ECYA 4S0MA 3DLGA 1X4EA 3SFUA 1GAOA 2R42A 1XMOK 2UUBJ 4FN5A 2P51A 3AVHA 1HJRA 5AXLA 5CZ2A 1WSJA 4ID1A 2QWQA 4CO2A 3Q8QB 2UUCK 4X2BA 2HRTA 4DR6F 2YTCA 1VQ7N 1J6ZA 4DQQA 3GIJA 4OYIA 3K59A 1Q4RA 4DUYK 4KO0A 4OYWA 1TGOA 4NXNJ 1IM4A 1PC5A 4HT7A 2FZGB 3CD5A 3AFGA 4DR6K 2LXIA 4DR1K 2J0QD 3I55S 5IWAF 3ETMA 1FKOA 1M90O 2HRUA 4I6MB 4KH1B 2EBGA 3J7ZT 5LMUJ 2L9NA 1U2VB 5GVQA 3VALA 5HROA 1SBRA 1NH8A 2ZKUA 3VGVA 4LFCF 3AD9C 1FNOA 3CB4A 1HHQA 4NLOA 2GVZB 1VYAA 1HNXJ 1RAAB 4CZHA 5DQIA 4ZVQB 1VI7A 3NGKA 3MR3A 4LF2A 5JMVA 2E44A 2OTLS 1SB6A 5EX0A 3J80O 2GMJA 3QPIA 1RTHA 4B3RJ 3DLKB 4PL7A 1RXOB 4WIQA 1FXRA 5IS2A 3CMAS 2KVIA 1T05B 5CR4A 2MKYA 1YJTA 4B1XB 3MUTP 1C0UA 1GNKA 3SYZA 2B6AA 4DSEA 2F8EX 3GCXP 2EW9A 1KD1O 4B9SA 1KWMA 3JAMU 4I6AA 4J9QA 4DUTA 3P1GA 3NVMA 2RMLA 4RW4B 2RF2A 3G0ZA 1WSIA 3W5ZA 3PJWA 3MM8A 1S1UA 3L7UA 4C8LA 1U2VA 4M5HA 1S6PA 1HPZB 3V1QA 3M6UA 3UDLA 2EHGA 4LSNA 3A5NC 4B3MK 1TUGB 4YN3B 2CZ9A 2MQQA 2AX1A 3Q23A 5EY4A 1AT1B 4H5TA 4M1KA 3UI3A 4LF4K 2E2QA 4ZK7M 3TR5A 3HJVA 5B8HA 4DV4F 3V4IB 5LXYA 3HKWA 3NCQA 3R1XA 3NGDA 3QBCA 3DLRA 1G7CB 3TVYA 2M9KA 2GQ2A 1FDDA 2GMHA 2AYGA 3RBXA 4QBUA 3NP5A 5F0WA 3GILA 3BV8A 2D3ZA 3DDNA 5BN8A 1C0UB 2MTLA 5HBMA 2KM8B 3MXIA 2JL9A 1RWWB 5L39A 2R2SA 1ASWA 5GADI 2ZVSA 1T8EA 1RISA 2BANB 1JWWA 1DQAA 4RW7A 4NLSA 1ZBUA 4X4UA 4IEEA 1T44A 4OHVA 4ZVSB 2R7UA 3LUYA 1DTQB 3IDHA 2B9XA 2DR8A 2C2OB 4CE9A 4BLGA 3FLCO 3MAHA 4FJ9A 4CJ3A 3GBTA 4DCOB 3K17A 4K0KK 4QIEA 4AHUA 3K0SA 2N3LA 3BBBA 1OIAA 2IM2A 4O4GA 2BR0A 4JN4A 2FJWA 4ZJQA 1RCHA 3T41A 4IDHA 3W63A 3CJTA 1M5KC 3HCXA 2CQ2A 2MHNA 4NLXA 2DHSA 1N48A 2KTQA 2QSFA 5ETNA 1D5AA 3H2VE 4PWWA 3A8JA 2HHWA 1BG3A 2WUSA 2YH0A 1NLVA 2PAVA 4DV1K 1KS2A 3T19A 2A6AA 2NSBA 1CVJA 2EK1A 2FJXA 2RNEA 4BCAA 1FERA 4KGXB 1WD6A 2Z1GA 4JK8A 1H7WA 1TKZB 2O8DA 2JLEA 3TZYA 4U8VA 4GY2B 2H5EA 2BH1A 2YQ1A 3DLBA 1RQ0A 3HOTA 1MWQA 1M5PC 3TEGA 3RG6A 3KWMA 2P9GA 2HHHF 3LH2S 4B02A 4MO5A 1WBBA 4JD2A 4EP5A 2Q6CA 4B3TJ 4DV7J 2RN2A 2RS2A 1QS4A 3DHXA 1FK9A 3OW2R 3QO9A 3IS9B 3KDNA 2VOPA 3IWNC 3I31A 2E29A 2DGVA 3EO3A 1ATNA 1EKEA 2P5OA 1HLWA 2V5HG 1RLDA 3U1MA 3BQ1A 4UT4A 1OYEA 1RTZA 1G4CA 1VQ4S 4H5NA 3UD5A 4FXVA 1WF2A 1SKSA 2FY1A 2AJ1A 4DR6J 1Q18A 4M3XA 1ROFA 4ID5A 3MM7A 3CJ1A 4UUWA 1VQ4N 3PLAA 2A40A 3OYJA 1TVRB 3CIZA 2IRYA 3VAJA 1FXDA 5IT9Y 4DUZF 1RDAA 1IXKA 1RDRA 3MN6A 4OZJA 4OKKA 1LW2B 4FKYA 1BOTO 4FK2A 5MLCV 2KFZA 3QJLA 2HVIA 1JL2A 3W1YC 3EICA 3TRGA 5IWAJ 4HTUA 1W0HA 2DXEA 3CC7S 3M32B 2HIYA 4DX8H 3DXKA 4BVPA 4L74A 3JTOA 4OJ3A 1PBAA 4EP4A 4NOHA 3WXKA 2EPIA 4DV3K 1O8BA 4HACA 4CH7A 2LDYA 3KJVA 3PSFA 1RAJA 2M70A 2G4BA 2Z58B 1RAHB 4FCYA 4Z4CA 2FVPA 3VTIA 5M1FA 3MK6A 4Y2KA 1SJRA 3SCIE 1FRKA 1TMMA 5A76A 3MR2A 4KGZB 4K4TA 1S10A 4QS9A 4B1VA 1HW8A 1I1GA 1HQUA 2IS3A 3PACA 2HNZA 1IH7A 4ZLPA 4ECSA 1RTDB 4X64K 4DR4F 4CHPA 1N56A 3UDCA 4EO8A 5GMEA 1NCLA 3F44A 4A5BA 2ZC3A 4KO0B 3UCZP 2DCUB 3T9ZA 4PPDA 3H4BA 1CJTA 3JSYA 4UY8T 3ZT3A 5C2GA 3NGIA 4KKOA 1RU1A 4ECXA 1FJ7A 3AA8A 1HR0J 3ZSRA 2DR5A 4KHYA 3DXSX 3A2FA 5GAHP 3LA0A 4J2AA 3HXMA 1RT3B 4JI3F 1Y97A 1DKGD 2IRXA 2QTDA 1PKUA 4L76A 3AY9A 4DN9A 3CJBA 4GKKF 5JICA 2LMIA 3SPZA 5IC6B 5IOLA 4FM2A 2AWZA 2F65A 3BF3A 2VG7A 1E6YA 2IM0A 2VKRA 1W2BR 4LRAA 2V7ZA 1T0TV 3CCTA 4GO7X 4FPRA 1L3KA 1RA6A 4A8XA 2OPQA 3DFEA 4DR5K 1PCAA 4WP9A 3SZ2A 4HVJA 1RWNB 3T3FA 4FWMA 1GH8A 4N5SA 2A10A 5F41A 2XY7A 4JI1F 5KFSA 3WIUA 3PCOB 4E7LA 3KUHA 4O3QA 5MAOA 2C2NA 1YTYA 1RBTA 5AQTA 1BQXA 3NKYA 2R7XA 1IJJA 1WC0A 1NKBA 1K6YA 4KTZA 4DV5K 3HMJG 4C1NK 1Q53A 1XMOF 4DJBA 1N36F 3ILJA 4P6QA 4ZPVR 2DYAA 3DCAA 3VEXA 4OKJA 2YVSA 4IO1A 5G0RA 2KQ2A 4OJGA 1HNVB 1HPZA 2BKPA 4JKCA 5EOYA 5B08A 3Q22A 3QJJA 2HS3A 2QM1A 3NMRA 3W2VA 3OTOF 2AGOA 3VF0B 1NJIO 1XR5A 3SMSA 5AQFA 2XY5A 1W26A 2VC1A 1OH8A 4WFNQ 2F4VF 1H2VZ 3K8WA 1REVB 1BA1A 2FB0A 5HQMA 3I0RA 3AO2A 3EKSA 2LQ8A 2P1JA 4W5QA 2P9SB 2OPQB 4HDHA 3DOMA 3C2PA 2GWJA 4OI4A 3M2VB 3US5A 4ZVTB 1C1CB 4LFCK 3H6EA 4CVNE 2U2FA 1HNZK 4CLKA 4FNIA 1JLEA 3R5BA 2E2PA 4YOTA 3CQ8A 1UJ5A 4OYBA 4AYBD 3L8BA 1IJFB 4FW1A 3HZGA 2UU9J 1XBWA 3J81O 3EGNA 1RTIB 3KK7A 2HBMA 1RWXB 4DG1A 5CAAA 1KVAA 1F6TA 4F9OA 2GHPA 3QWPA 3QIOA 3HPGA 4NLRA 1K73T 1WAJA 2EFQA 2EWSA 4DF8A 1RT7B 1FA0A 1T9YA 2J76E 1KQKA 1VC6A 4JP8A 1QAJA 4EFHA 1RTDA 2QO3A 3MPDA 2MGZB 4BC9A 2HBZB 1ATRA 5DG7A 3TTFA 4M5LA 3FRZA 4BWMA 1QLNA 1T02A 4TY8B 4DUZJ 4LRFA 3RZAA 4JHDA 4YY3J 2ZBIA 4DR2K 3TQEA 1A7GE 1KQSM 3TUPA 1IG9A 3CJKB 5JUMA 2JHEA 2B4UA 3L0QA 3QEVA 2MKJA 2RF2B 3J7YP 2RS8A 2FBYA 2ZNYA 2JJ4D 2GHVC 3NHGA 3VEVA 1ZA2B 4BRGA 1OKJA 2FVRA 4A4JA 4ANEA 5F2RA 5AQPA 2M4MA 4ZCMA 2RU3A 2V4RA 2XMJA 2P2CB 2RKIA 2RSQA 4X4OA 1LXNA 2K06A 3V1RA 4BDPA 4FYWB 4P71A 1X5PA 2EFGA 3CM6A 4ELUA 2F96A 4USJC 2BUNA 2IYIA 4CJFA 1RNHA 1W7WA 1HBUA 4J2BA 3SPYA 3OYDA 3N5BA 3K5NA 2OPSB 5C42A 1HHSA 4USKA 2QMUB 4UOGA 1RBVA 4HL9A 4EWTA 2MZTA 2C22A 4C23A 3VGMA 3L4IA 5H9EK 5F0UA 2CADA 1KXPA 3TEHB 4I6WA 1N6QB 1HBOB 2CDRB 4FPAA 3BDPA 3W8GA 2FBXA 4NCGA 3HSCA 3N4QA 2QLWA 1Q1KA 4A57A 3I33A 1IWAA 1Z05A 3R2DJ 2Z2MA 3VERA 1QTNB 2IGIA 4C0BA 1GMWA 2YWGA 4X4TA 3VGLA 2PMWA 2E5LJ 2Z1JA 4AFFA 2UXBJ 4CZLA 4AHVA 4JI8K 1HARA 3NNCA 2MEWA 1EWQA 4RUCA 4F4ZA 3PDNA 1P8ZA 2ZH6A 2DH9A 1E6VA 5F8JA 2XC9A 4K2JA 4NA1A 1RKIA 1S1WB 3GV8B 3WX4A 3ITHB 1ZBTA 4TLRA 4IR1A 4EZ6A 3AJDA 4C8OA 3IBWA 1PYTA 1LK5A 4CI0B 1SL2A 2UXDJ 2PZSA 4ED4A 3RR8A 1U02A 4TYBA 1HBUB 1UAXA 2V8PA 5E7OB 4PKDB 3THWB 2XEXA 2LQBA 3LQVA 4ER8A 2ZJQQ 1BL3A 3H46O 3MMCB 2KU7A 3EE9A 3K89A 2LU2A 4KTWA 4CLFA 3MR7A 4H0VB 3VQAA 4MK7A 4ED8A 2CWKA 2EKNA 4J5OA 1WOSA 3MN5A 5GAHU 4Q8EA 4F0MA 1LNQA 1QSSA 3ENQA 3R1HA 4ANCA 2G8KA 4DV1J 4JK9A 2RDDA 5AQIA 1JMTA 1F0XA 2AJ2A 1BIUA 2DIUA 3CCLS 3OL8A 2GUIA 3OYHA 2MKKA 2K7KA 3MMBB 1U2CA 1P1LA 1WHVA 2ZC4A 4HLBA 3OUYA 2RE1A 1R8HA 4ID8A 2ZKTA 4CLLA 3UN5A 4CHYA 1R7IA 1UJ4A 1GXLA 3V6JA 4MIWA 2VH7A 3GIIA 2ASJA 2FYXA 4J91A 1N0UA 1WF1A 2QKBA 3JB9k 2H48B 4M94A 2QKKA 3SIPB 5BYQA 5ETTA 2GA7A 1VQPN 3ETOA 4HTJA 3U1LA 3I87A 4EHUA 3C6UB 2IY5B 5AQQA 3VQBA 3HFVA 4BBYA 3PX4A 2RE2A 5BRHA 2ROEA 4DZDA 5BRFA 1L3VA 4I56A 3HPHA 4YOXA 3KHRA 1XUPO 2BJ1A 4L75A 4NXMF 4Z4HA 5HL7Q 2DFFA 3DYAA 1DARA 2L3MA 2JEJA 2B8QA 3PRBA 1HNIB 3DAWA 3R6GB 2NRRA 1Q8BA 3TP2A 5DJBA 1T3VA 4CO5A 3CMES 3DN9A 3D0GE 4N56A 5ADZA 3TJ9A 3KK2A 4JKHA 1U6ZA 1TQLA 4EYIB 2FBTA 5ELZA 1REVA 3M8PA 3MF5A 1VBXA 2YKPA 1GLAG 3I56N 1YJ7A 4LSLB 2V34A 1CJUB 2CVIA 5L9NA 2ZFHA 4ZP7A 5EDWA 3E9OA 2O8DB 4YOVA 3OVBA 3R5GA 2P9CA 3UR0A 2D9OA 1NK5A 2W7AA 5KFMA 3QINA 4OYAA 3MEDB 3IP0A 1U0SA 1FXLA 2IJNA 4HUEA 5GADU 2LYVA 2XI3A 3GTYX 1BLUA 1UVMA 2HHUA 2M8HA 2AV5A 3VVUA 3IMQJ 1CQNA 4HVZA 4F4XA 1PYSB 2F3JA 1RDWX 2KRRA 2NRHA 4ELVA 4OHWA 1MU2B 1NMNA 3K9JA 2GGPA 3KLHB 5AJ3F 3PW4A 2QG9B 2QFIA 1X3MA 4FJJA 5KPRA 2ITMA 1NPRA 2D0CA 4UY85 4U67L 4KH0B 3VETA 2PA8D 4KY3A 3M6XA 4EZ9A 4Q8FA 2C2RA 1RAGB 1K73O 4WFBL 3OHRA 2HFZA 4EO6A 3ZSOA 3THTA 3DLEA 3WXJA 4CD1A 4WK3A 3KG4A 4CM2A 3OTOJ 3BR8A 1D3WA 4O0JA 2CIMA 4ETXA 1FJEB 5C10A 3Q8RB 3UN2A 4BRFA 1GTHA 3O5TB 1T6DA 2MKSA 3FFIA 4DCHA 1RE1B 2FHOB 4WFZA 4OI0A 3BGUA 1RDBA 5DS7A 1A6LA 1VQMN 1A9NB 3HBTA 3ZSYA 4PZVA 2AEFA 1XNRJ 3DMJB 5C12A 3CCJS 1H73A 1OPIA 4USVA 4LD0A 3R9LA 4K50A 2P9IB 2FQQB 3THPA 2G13A 5AXMA 4LT6A 4KT0C 1MWYA 5I3PA 3D5MA 1TL3B 5B7WA 4R5PB 2PBDA 4ZVHA 1MMNA 1HJOA 5KGXA 1UVIA 2ZZNA 2UU9F 3HOSA 3WHIA 4BACA 3NL0A 4BC4A 1F2HA 3K57A 3VEWA 1SIWB 2O8FA 2HQIA 5AQHA 2LCWA 2VYPA 1BA0A 4FXWA 3HHLB 1NDPA 4O55A 5J2NA 3PFEA 1RHMB 3C66A 3FMWA 1W25A 4IG0B 1JLQA 2AJ4A 2FJAB 4UW2A 1S7IA 4AHCA 2HFOA 3VAHA 3MM8B 3P8BB 5D78A 5FPNA 4DUYJ 1ZBLA 3CD6S 5HO4A 3GG4A 4KGVB 1FDNA 3SAFA 2Y8YA 3JXOA 5I3UB 4RWTA 3K5OA 4DTSA 4Z4FA 4PG5A 2YJEA 5HVFA 2QSWA 3VQSA 5AQJA 4RL1A 4O8KA 3OTDA 1KCFA 4U96A 2CJYB 1NJWA 3AQPA 4PY5A 3PYEA 4CLTA 1BO5O 2AMCB 3R8EA 5ETPA 3SAHA 1TL3A 3DOKB 2IFXA 1RT6B 5D8HB 2GWKA 4DX5A 2BUPA 3L3UA 1NK9A 3R27A 4FLYA 3KJNB 4LQ3A 2G9OA 3LP1A 4KHPK 4RNFA 2HHVA 4J9NA 5AFUH 2V67A 2HWTA 5DO2A 3HPOA 4Q45A 2ZWPA 1DZ5A 2AU0A 3AOAA 3BN7A 5CD4H 4PPZA 1S1VB 1WEXA 1FHTA 5G0RB 2H9ZA 1GEHA 2HRYA 2Y1JA 2CNOB 4F2SA 1DFDA 1BWFO 2XZDB 5IC4B 1D9FA 2UUAK 5AE1A 3OYCA 2N3OA 4KHQA 2OO4A 3LAMA 2EWHA 2C2MB 2KT2A 4F0KA 2DY1A 1T3OA 2RRBA 3JSMA 5A2QO 2OHDA 1QUPA 1OVQA 2DNOA 4EBEA 2OTJS 3IKMA 4WTYA 5E3QA 3Q8UA 4DQIA 4CJUA 2HAIA 2DRDA 3RR7A 3IRXA 3TAMA 4WKYA 1U1NA 1LXJA 3MMBA 3GYGA 3MM7B 3CCRS 1XQIA 4JV5K 3N4PA 2GX8A 3J7ZO 2NRTA 3EPGA 3M2VA 4MKVA 3NY0A 1XEZA 2HHPA 3VF6A 2W9BA 4WZMA 4M5GA 4CEDA 4NLTA 3GJQB 4Y2CA 4JI0J 4H0XB 1S9EA 3ZSXA 1BHNA 3ZC4A 1AA1B 2A41A 3E9PA 2VWJA 1CJVA 1UW9A 3IM9A 4IH7A 3CHWA 2KJWA 3DRPB 1VBZA 1ZTTA 2Q0UA 2W41A 3NLCA 2D9PA 3BGRB 3GE1A 2J9EA 3ISNC 4I9LA 5BREA 3DMJA 2JWLA 3C6UA 4RBTA 3T5JA 3VZIA 2OFGX 4W5TA 1RHJB 2UUWA 2GVZA 1JLFB 3KDOA 3GB0A 1SPBP 2QEXS 2F40A 2YJFA 4X65J 3FZMA 5KFHA 3ZZ0A 2JSXA 1YRXA 3VQ5A 3OVSA 4E0DA 3ILIA 3ALYA 3EGZA 3DRRA 4X4RA 4K0KJ 3M8QB 3C6TB 5KT6A 3EEQA 3FBEA 1AB8A 3CSKA 3C14B 3FE1A 4CJ7A 4OX9K 3J81j 4G1QB 1GK8A 2MQLA 2QLXA 2W2QP 1NB2A 1RZMA 3NCPA 3G9CA 1G3OA 2W8KA 2UVRA 4LFAK 5KT7A 3ZSWA 1Y0HA 2HMIB 3NGRA 3WC2A 4ZN1A 3B4MA 4B3TK 5DETA 1LWCA 3K5LA 2G1DA 5GAHI 4JBCA 3M32A 1EXQA 3H20A 1ILYA 1C0MA 2GQQA 1TFYA 3C16A 1WJ9A 1H98A 3VQ8A 4N76A 2ERRA 1E6YB 2R4FA 4CERA 2E5HA 2V8GA 4NI2A 3ONQA 4AQYJ 2YHYA 4FJXA 2O4IA 4ZVOB 3MCOA 1RI7A 2HVEA 1N32K 4I64A 4G6VB 1P8GA 2QA1A 1AXQA 4RR5A 4K5RA 3CCQS 4GKKJ 4CF8A 3EE3A 2XS5A 2FHJA 1JNRB 3S1TA 4GKKK 4QPTA 1CJTB 1TP7A 1I5OB 2CA9A 2M2BA 1FX4A 5J2MA 2QL5B 4PABA 3OTBA 3UIQA 1T95A 3FGVA 4B3SK 4DX6A 3S01A 4K4ZA 3D3BJ 2HF3A 4JOUA 4JLHA 3ZCMA 5C5JA 2YH1A 3C16B 1HIYA 2Z57B 3DLLL 2A18A 3LP2B 2W42A 1ZAWA 1XMQJ 1VCTA 4R25A 3CCJN 1FNXH 4NEYA 5ETSA 1CZ9A 2DPJA 2EFVA 1FKPB 2RU9A 1YRTA 1SXLA 3NFAA 2YY3A 1PIEA 4DV3J 2FVQA 1NGIA 2RPIA 2IMOA 2QA4S 1J53A 3VQQA 4YOWA 2GCFA 2HZVA 2VQFK 4NLGA 3BY5A 5KFYA 3NVKA 1NK7A 5D3GB 4CQ1A 4DKWA 1P9YA 2H65B 1GMVA 1D9DA 3W0LA 2XO7A 4R0JA 1VHFA 5EN1A 2KKHA 4Z4EA 7FDRA 3SCLE 5J2QA 4CEBA 4USUA 4CHZA 5DZ7A 2WZ1A 3TZXA 4J37A 4M5JA 4URGA 4JV0A 1X5TA 4CDIA 3EDRB 4LF7K 1QQOA 4PG8A 4NASA 3D4JA 3AVNA 3VEOA 1PBUA 4MIAA 3K0JA 2IM1A 4DPWA 4DR1F 3D2FB 2KZZA 2RHSB 1GOBA 2VG7B 3IGVA 1T9TA 2DNZA 4XDCA 5KT2A 1X0PA 4IOAQ 2W1BA 3E1YA 2A2CA 2OPPB 3J7AP 1IBMF 1SUQB 4TVAB 2YKNA 4Q0BB 4CFDA 1VSKA 3CFPA 1OMSA 4JKBA 1O1WA 2DNNA 2E5GA 1N5TA 2W7OA 3PYFA 4QCLA 3MX5A 3L2WA 4YUDA 1T9VA 5SUHA 3B8HA 2VFVA 1XNQJ 3JQMA 3L2RA 3HHKA 3B6BA 4FW2A 2K2PA 4ZIWA 2HWHA 4YB1P 4F3MA 4IR9A 3EPIA 3TUIC 3BF4A 5I4MA 1UWBA 2MQMA 4JKAA 5IM0A 1D8YA 3O1BA 4IJNA 2RQ4A 4O4GB 4A47A 1Q9XA 3OSNA 3TX8A 3D7EO 1D8ZA 1GX5A 3W3SA 2FF6A 4F7VA 5KFKA 1QVFR 1HA1A 4A2BA 1T7PA 5AQLA 2HQGA 4BRPA 1QE1B 1TUUA 4RBUA 2W9CB 3W7BA 2Z2YB 4C7QA 4AL7A 3CJ0A 3PG9A 5HQLA 4WE1B 4C11B 3AA2A 4WTOB 4IG3B 3ZSVA 4BWJA 1VHIA 4J9OA 4HHTA 3MUVP 4ZVGA 1NU4A 5KI6A 1T05A 4PAAA 1M5SA 4RPFA 4FZVA 1S6OA 3LF0A 1Q86T 3GZ7A 3UCUP 2RD5C 2Z56B 3A8KA 4DI6A 1WWHA 3R9PA 2YWKA 4F26A 1EJ7L 4EEYA 3O4NA 4N8OA 1J9AA 1ASVA 5I42B 4ZCLA 4Q2LA 1S9FA 2AP6A 1YI2N 2PSZA 3V6DA 3DXMB 2O01C 1FRXA 1URRA 5KAKA 1FVQA 3SBMA 5EX3A 3MM9B 2O8CB 2YQ0A 2DHAA 3PIOL 3CF5L 3VWSA 1U04A 2DNPA 3A1YG 3CGIA 5F3ZA 2IYGA 3D66A 4M41A 2E5LF 5L1LA 2R7VA 4LREA 4EIAA 4F02A 2XSFA 1N5YA 4A62A 3SQ2A 3UVJA 4WFBQ 2EX3A 3VAIA 1JJ2M 4MFBA 4UOHA 1IBLF 1NH7A 2K8GA 1UW4A 2G2ZA 4U67Q 5C2CA 4TQSA 3DLHA 3N9UC 3SK3A 2O8EA 4JV1A 3I32A 4DCJB 3PIOQ 2E5LK 1R3NA 1JXEA 4WXWA 4IXCA 2PDAA 3AY0A 3IRWP 3P49B 2OUGA 4OI3A 4KAZA 2P6SA 1PJ7A 3V4MA 4WWSA 5CY4A 4ISEA 2KHDA 4KI6A 2N7CA 5L46A 4BGAA 5C2FA 2VHGA 2YQ3A 4OX8A 5IQQA 2XCPA 2HQFA 5GAGP 3GMGA 3HLUA 2DKOB 4QWEA 3D2FA 5KFVA 4J9PA 3PX6A 4B3SJ 3DXMA 4X65K 5KFJA 4X66J 1D09B 5GIOA 4OO1J 5DGAA 4V19J 4GVBB 3M9MB 4DSLA 4MAKA 1CBKA 1RFQA 1RU2A 1Y3KA 1JJ4A 1WI6A 1SCJB 1GXUA 2IDLA 1RT6A 2YBVA 3LDQA 4F4YA 2PC6A 2I6WA 4E2FB 4NLQA 4EFAC 4DR5J 1NZAA 5A0YA 5KG6A 4H0PA 2HBRB 4FZYA 2V2ZA 4K2XA 4IFVB 3G8QA 1RADB 2GBZA 4NCAA 3OTCA 4FL9A 2BKNA 3I6PA 3LGMA 3DWLA 5HMXA 1O13A 4I0WA 1S0MA 4ZPWR 1VLOA 1Y10A 5GINA 3WNFA 4LBPA 4O4RA 1X9JA 2H4WB 3HVWA 3ASMA 2Z2ZA 4XK8C 5KT5A 3TSQA 1VQSA 4DEZA 1F3FA 3N6MA 1RWOB 2B56A 1SAZA 3MCPA 1GLLO 3D2EA 5KFOA 3LGNA 4B3TF 5H1SQ 3KHLA 3CXCM 2RQCA 4C8KA 2F8SA 4BR0A 1FJGJ 1I94F 2G2YA 4KH6A 2JH3A 4AL6A 3WC0A 2DR6A 4O3NA 1KVBA 4W4MA 2CQIA 1QY7A 4LF8K 2MZ1A 1EWRA 2DY4A 1N0VC 3OR2B 3P4IA 2ASDA 3QAEA 2BQUA 3VV2B 4IZ9A 2D3O1 5LJ5Y 4ZN3A 3FSXA 3OYEA 3NXZA 3QNNA 3TTCA 2DRBA 3MWTA 3QRPA 3VA3A 3PW0A 3UNYA 1IKXA 4OI1A 1VRUA 1S9GB 2BKOA 2D1KA 2HK3A 2UXCK 3UDVA 4KHNA 3NCRA 4B9TA 3S3MA 4FLXA 4OHXA 5E41A 1CSJA 1PAUB 4A8YA 3VPZA 3SCXA 4KPCA 1VGYA 2O8BB 4CFBA 1TL7A 4X66K 3CWJA 2V50A 1JKHB 4H4OB 3VAGA 1C4CA 2ZHBA 1S99A 2VQFJ 2WVFA 4GMKA 2POKA 4NLPA 3IG1B 4KB0A 4CZCA 3BSCA 1NM2A 5CE3A 4WU3A 3SJJA 1TV6A 1SL0A 1LFWA 3HHLD 3T9NA 4DFPA 4CHNA 1LAVA 4K4WA 3QT7A 3SXLA 2DY9A 2E1ZA 1R0BG 3FBCA 5KOWA 3LOUA 3FEYB 4QWDA 3M9NB 4R79A 3TABA 4DL6A 3H2UB 1KHWA 4LFBJ 4CF0A 3M2RB 2E5IA 3SQ4A 3RVCA 4RW9A 3T1HK 4A8KA 1TKXA 2BV3A 1WSEA 2DJWA 1FVSA 2XULA 2HGLA 4YEAA 3TPQA 3M05A 4O0NA 2V6AA 4OPKA 4NMLA 1N4LA 3WUHA 2E7VA 3EWGA 1HI8A 3GIKA 2UXCJ 1BC6A 1GLDG 3WXIA 2WB1D 4YDDB 4JI6J 1VQKN 1R8AA 3E8OA 2XMWA 1OY8A 3HHDA 1YVFA 1SH2A 3BBFA 3RTVA 3T1AA 2IPOB 4C2MA 4C0HA 3SQ1A 3JQKA 1R0AA 2O8FB 1FWKA 4HKQA 1HQ2A 3ZZPA 3CPWM 1DLOB 3POTB 2IVFB 1T9XA 3L09A 3TANA 3OS1A 1VR6A 5J2QB 4ID5B 5KFUA 4RX6A 1W9HA 4IKFA 2C2ZB 3UQSA 2G8IA 1DAXA 1RP5A 1H2UX 4DV7F 1S57A 1VFJA 3CMEN 2DD8S 3A3PB 3N5FA 4LVNP 2X6NA 4CZIA 1JLBB 2CUYA 3HI0A 1TZ0A 4DS5A 2BJ9A 3U6FA 3MCNA 3QEPA 4EUVA 1C2PA 1NBWA 3TNVA 4I6MA 4BC3A 2BGGA 3BJYA 4DR4J 3DXKB 3MHYA 1RWKB 3D6MB 5T14A 2FGCA 4FF3A 5CABA 4ED2A 4E1MA 3D7SB 1VC0A 1ULRA 1IQZA 5AQYA 2Z1HA 3LPTA 3PTWA 1O51A 3D0PA 1CXQA 4Y0WA 1BUXA 4P73A 1YUWA 3M2UB 3RB3A 2A42A 3NNHA 4EBDA 4MH8A 2WBMA 4DS4A 2UU9K 2NREA 1SJFA 4J9MA 5FRNA 4FJNA 4A8MP 4JYAJ 2ZGYA 4FLVA 3GJTB 5E0OA 1MW7A 2E66A 1RT5B 3VQ6A 5K20B 5H9FJ 3ZTSA 4LF8J 1R27B 3CTRA 3R5JB 1L3SA 3I9V9 3PO5A 1FEEA 4PUOB 3FJ2A 5AT1B 2WSEC 3CT9A 4ECUA 5BPMA 2MPUA 1BQMB 3ADAC 1U45A 1S49A 4N7TA 4FS1A 1LKZA 1X0FA 2FY8A 2ASMA 4CTAB 2FC8A 1YQHA 1RT4A 3UO0A 4IBNA 3CJ3A 2BE2B 1TK8A 4FM0A 2H5IB 1U09A 1YJNS 1HBMB 5ETQA 1DQ9A 1RACB 2R8HA 2QA2A 2CQPA 1O5JA 4CIGA 1BXNA 2VG6A 4U9RA 2PN6A 1BWEA 2NSCA 2XWYA 2ZBCA 3EY1A 1H72C 3M2UA 3GPAA 3QFPA 4LVOP 1WKKA 4WFNL 2ZM6K 1VSEA 1S72S 1BDGA 1RT5A 1WSHA 4ATNA 1G15A 2VODA 5H9FK 1ZBSA 1K47A 1SKRA 2P9KB 2P9NB 1CJKB 1R31A 3HX9A 3AODA 2CFXA 2NYHA 2BJEA 4QIGA 3F9KA 5LSLA 2DHXA 3CG7A 2Q6BA 1IM6A 1IBLJ 4IDKA 1QTMA 2GVDB 2HLTA 2YNIA 3UNGC 4Z94A 1FKAF 1Q8KA 1KC8T 1VSLA 4ZTFA 3GL1A 3GSDA 2DXFA 3M7VA 4LFBK 4GC7A 3TR8A 4BQLA 2NYIA 3O5BA 2CQBA 4JKDA 2B7CB 1NDKA 3CMQA 4IG3A 2IM3A 2BW2A 5EGYA 4B8CA 4X65F 2VPWB 3JAMO 2LEAA 4ICLB 3CJ9A 4LFBF 1CZAN 2Y1RI 2FLOA 4DU1A 2BEFA 4JEPA 3JYTA 1Y11A 3ZNJ1 3TW0A 4F2RA 4C8YA 4OYPA 4JK7A 3H25A 3MXJA 4NB4A 3BF1A 3NG8A 4AQYF 2GTDA 3S41A 1BWVA 3W5YA 3W64A 3TYTA 3RGIA 1KQSR 1RCOB 4DG1B 2P9PA 4AD6A 4BR4A 5C25B 1NPPA 3F56A 2EKYA 2UXDK 5AQKA 2BACA 3SDEA 4DX7A 3UD3P 2VQEK 1IBKJ 1Z26A 1WOQA 2GHWA 2ACYA 2RHKA 1H3DA 4YB6A 2I7PA 1UZHA 2YV0X 1QM9A 3VGKA 1RKJA 4L6V3 5DMRA 1WSRA 2JNJA 2RB7A 1KTVA 4M5DB 2B9EA 3CC4S 2AJQA 4CJSA 4UF4A 2R8GA 2WTFA 2QIFA 3FZBA 5B0AA 4OYOA 3KOAA 2VG5A 3HP9A 3O8MA 5KOXA 1GXTA 1HNVA 4TQRA 1HKAA 2YX7A 5AXNA 1X8DA 5EXWA 1JXBA 2H1YA 4LF9J 3O4QA 2P5VA 4DV3F 4I2QB 3KD1E 2B51A 1XMBA 3PYDA 4B9LA 4NZ6A 4FJ7A 4LF9K 5I9EB 3H5UA 1B70B 2XGPA 1JLFA 2PFUA 2KO1A 4F67A 1N34K 2V9WA 1Q86O 1U8WA 4BREA 3R5CA 2OKQA 2M0GB 5I3QA 3DOKA 3ZT4A 3CNQP 3O8WA 3MZIA 1ZAVA 3W9JA 3UDEA 2QRRA 2BOPA 1WHWA 4DR4K 1U1KA 2YKOA 4V19X 1RYRA 4CYUA 1S7HA 1RHKB 3PZPA 4BRDA 2BE7D 3G2XA 2QLJB 5C42B 3ZZZA 4JI0K 3KD5E 2D69A 3ILLA 1Q7YO 1YKWA 1B7YB 3RBZA 1BUPA 3KZBA 5KFTA 4RG8A 4MIBA 1OH7A 2OTJN 3POTA 5LXRA 4LSZB 3D3CJ 3SV3A 2B8PA 1JX4A 2F9WA 2Y3YA 4OZ5A 2DITA 4DSIA 4F4WA 1Y7PA 2BRKA 1WBDA 3HVTA 1GFWB 2D0BA 1J5OA 3QGHA 4LFCJ 3D6HB 4NE9C 4P75A 3AB2B 2EG2A 2ASPA 2XYHB 4NPOA 4TLQA 3P6YC 2DGOA 1JCEA 2ZH5A 5G4DA 1F9FA 2ATCB 4OLPA 4DMZA 4M5IA 2E20A 4TU9A 4CI6A 1S1WA 5A8WA 5HANA 3QMQA 1SC3B 3CC2N 4DSFA 1SC6A 1VRQC 3D1HA 2PYJA 2WOMA 4OHZA 3QMLA 5CA5A 4O3SA 5M1NA 3Q8VA 3FQKA 5AQXA 3D0HE 3AD7C 3MTJA 4TY8A 4CJRA 4Y00A 3CQXA 3CETA 4I1TA 2CJBA 4JHDB 4DTRA 5K14B 2PYLA 5CHCB 2P5GA 3CCEN 1FFGB 2VFRA 1IQTA 3C3LA 3NBPA 4XAKA 3EGWB 4CZKA 1NGEA 1M5HA 2P6TA 1EQMA 1MMDA 5LJ3Y 2V2KA 3MCSA 2IRUA 4WQ4A 4ZA1A 3SCJE 3CD0A 2UXBF 1ZPVA 4DHVA 2CGJA 3J81Y 4GMJB 1Q95G 3A5MC 3M8WA 2R7YA 3BGRA 3DRSA 3GV7B 3SUQA 2CNLB 3L4BC 2JRSA 4DL5A 2MSSA 4K42A 4GVMA 2D3UA 3OYMA 4J9RA 3A8EA 4PYAA 3O6QA 1NMDA 3FSYA 4IYQA 2FDNA 1FRLA 2DTJA 2A1RA 1K9MO 3GYXB 2OCEA 4YY3K 3G4SN 4M3YA 3VQ7A 2HF4A 1R8PA 2J7UA 2LFVA 4BR7A 4Y1DA 4FZXC 4B3OB 1B7FA 4KBOA 1HNWK 2MYFA 2AEMA 3PYGA 2HG4A 1EKSA 1NKEA 2R8KA 2ZH3A 3EMTA 3DOLA 2AZ3A 5LMUK 3OYFA 4GW6A 3AQOA 4FJHA 4CFCA 4Y2IA 2DO0A 5KG3A 4UZCA 2GJFA 1S5JA 5IFMA 2Q43A 1H74A 3QFWA 4CGIA 1F5CA 3WQUA 2VIHA 4O5BA 4JB8B 5DG8A 1GLCG 3HSDA 2CRLA 3TSPA 4UOFA 4I2PA 2XG8A 3MPUB 4YMEA 1RWPB 2DGUA 2XRIA 4QWAA 4CH0S 3CCVS 4M95A 1UJ6A 2IA6A 1RB0A 2WVEA 4LR7A 4Z2XA 4NZ7A 5KFIA 3EXYA 1Y3JA 3VQPA 2CJXB 3BKUA 3CO9A 4OYMA 3VZHA 3DYAB 1QZ5A 5HMWA 3CCMN 4ALZA 1RILA 2LXUA 4GV3A 4FM1A 1XR6A 2YNIB 1GT8A 2BDPA 1YWXA 1NHVA 1RWUA 1UAWA 5T7LA 1U7LA 3GR0A 4K59A 3CJKA 2W2OP 3HF5A 4IOAL 2Q1LA 2QX0A 3A5OC 1YJ9N 2BJDA 4RNMA 1VSDA 1QQMA 1WELA 4GKJJ 3GWCA 3KLGB 2PY5A 4I2PB 2I5JB 3H42A 4RWWA 2RT3A 5K8NA 5B0CA 1FRIA 2N82B 4KAIA 1PILA 4Z7CA 4L8RB 5SWMA 2DK2A 3CDBA 2VB6A 1VK3A 1YF5L 4DU4A 1WC4A 1SKUB 4IOBA 3S3NA 2DNYA 2JFDA 4RO0A 3GLJA 4LRCA 3K9KA 4CT9A 2KFNA 3TI0A 4WZQA 3H0PA 3NS6A 3AVAA 3GQCA 3U1NA 3M6GA 3M8RA 4FK4A 4DPTA 4PWDB 4R8UB 2HBKA 2BX6A 3P31A 1F21A 1S6QB 2RUSA 2WC9A 3P5TL 3UKUA 1OQ6A 4RW8B 3CVKA 7FD1A 1YBUA 2F1FA 4XEIA 4B1ZA 5D0RA 1SQKA 4RKUC 4K25A 3V9UA 1URNA 2HQ3A 5FLXY 1A0OB 2ZOGA 2IVOA 3SQ0A 4W92B 1HKCA 3E66A 2UZAA 1NKCA 5D15A 1U1MA 3N6NA 3DHWC 4QZVB 3MM5B 1VQ8S 2A5XA 3CERA 2D74B 3H4DA 2L08A 5J1EB