1JLAA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
553
structure length
546
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 140
structure length 546
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlaA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlaA05
3K5LA 4MK8A 4E1MA 3VQSA 3KMSA 1Q9YA 5KG5A 3AO4A 3MEEA 2E6LA 5HBMA 3I0RA 2XY7A 2VG6A 1O1WA 3DYAB 3FQKA 4DFJA 3BSCA 4Y3CA 3OS2A 1C1CA 1KLMB 4U7CA 1KLNA 4CERA 1SV5B 4NCGB 2OPRB 1WSHA 2VG5B 4DFMA 3IAYA 1JXLA 1N6QB 1CXQA 5CYMA 5KFQA 2WB4A 2G8KA 4ECXA 1KLMA 1N48A 3LWLA 2HHTA 4DL2A 1SV5A 4NCGA 2OPRA 2VG5A 4ECSA 4FZXC 4C8KA 3UPFA 2JC1A 3KK1B 4DF8A 4RW8B 3KLHB 3V81B 5J2PB 3MR2A 3NBPB 3AA5X 2JEFA 1VK0A 4K4WA 4IDKB 5DLGA 2HWIA 3KKRA 3HVTB 2R8IA 3KLHA 3V81A 5J2PA 1FKOA 2Z1HA 3L2RA 4E7JA 2IGIA 4CCHA 2OPQB 1C0UB 2FVCA 3AVMA 1X9MA 1IKWA 1IH7A 3PX0A 4IDKA 4OGEA 3VQ7A 2D0AA 2X74A 2V9WA 3HVTA 1N4LA 4ED0A 2HVHA 3HKWA 3PVXA 2I5JB 4NLPA 1HRHA 2OPQA 3FRZA 1NHUA 4K4ZA 4RUAA 1TKZA 1I6JA 1W25A 3ISNC 4DU4A 4FM1A 2WCXA 2Y1JA 3ZCMA 4KHUA 3TVKA 4CGDA 1D9FA 3WNGA 4FS1A 4MQ3A 4NLXA 4G1QB 3NF6A 4OPJA 3NAHA 2A1RA 5I42B 4CJRA 1S9EB 4B08A 4M3YA 4DU3A 2J6TA 5HRRA 4RNOA 1HYVA 4B9SA 1SKSA 4G1QA 1QAIA 4XIUA 1XC9A 3PR5B 4J9KA 2WTFA 5I42A 4CJEA 1S9EA 4TYAA 3V4IB 5KT2A 3ZSQA 2W9BB 4DTNA 2FVPA 1JLFB 4ED7A 5C25B 3C6TB 3OJSA 1D1UA 4KHRA 4DSFA 2OYQA 3U3YA 1RBUA 2F8SA 3LANA 3V4IA 3HXMA 2D3ZA 1RTHB 2RF2B 3ZT0A 3QEXA 1Z26A 1JLFA 3AVKA 2AGOA 5JS2A 4CEEA 3NFAA 4J9MA 3QIDA 4ED6A 3T5HA 4O3OA 1NKCA 3KLEB 4CHOA 3DLEB 3CJ4A 3GV5B 1L3VA 1RTHA 4CJWA 3TAGA 2RF2A 4TQRA 1IKYB 1RDCA 2IM2A 3SUPA 1J54A 3DRRB 3K58A 3TAMB 3H40A 4NLYA 3AVCA 4F4XA 3DLEA 1X9WA 2OH2A 3T5JA 1IKYA 3ZSVA 1C6VA 1NJYA 3VA3A 3DRRA 3TAMA 3GIJA 2PZSA 3PJWA 5EUHA 2YKNB 1JL1A 2DPJA 3SFGA 3LP3A 3OJUA 4I2QB 3SQ0A 1TK5A 2G8VA 3PJXA 1HYSB 4Y34A 1B9FA 1LWEB 2IBKA 4DG1B 2C2RA 2YNHB 2XY5A 1QHTA 3ZT3A 3HPGA 5F9NA 1S10A 1YVFA 3KHGA 1KCFA 1HYSA 4FJHA 5J1EB 1HYZA 3V6DB 4OPKA 1LWEA 3I5BA 2R2UA 2YNHA 3FFIB 4KAIA 1QSSA 4DL7A 5JXSA 4URSA 3V6DA 1TL1B 2PYJA 3ALYA 3E01B 2HHUA 3LP1A 2BQ3A 1SL2A 4FJ8A 3NGZA 4IH7A 1T7PA 3FFIA 4IOBA 4IBNA 4CF8A 3H2LA 1JXEA 2ZKUA 1BGXT 3KHLA 1TL1A 3O4NA 3O4QA 1RDDA 3Q8QB 2WONB 1WSEA 4NLWA 4OJRA 2FVQA 3M8QB 1RT5A 5F8MA 2O4GA 3V1QA 2ALZA 2JEGA 4HKQA 2D5RA 5KRSA 2B6AB 4M3XA 3VQEA 1JLAA 2YNGB 5EWGA 2WONA 3VN5A 1WNEA 3F73A 1NK5A 3M8QA 4ECYA 5HRPA 2B6AA 4RNNA 4DTOA 4FLYA 3L2QA 1KVCA 2YNGA 5EWEA 2CKWA 3G10A 3UQSA 2R2TA 3GQCA 1S9FA 3K5NA 4H8KA 3VQ4A 5DLFA 4FJ5A 4RNMA 1TV6B 1WSJA 4YR3A 2C2DA 3KMQA 4ZTJA 1WSFA 3KTQA 1LWFB 2W42A 3QGGA 4O0IA 4FLWA 2XRIA 1JLEB 2ZD1B 3G0ZA 3JYTB 4FJNA 2W9CB 4ZVFA 1LWFA 1EKEA 1WNSA 4LSNA 3DLHA 4NLQA 3LPUA 2KZMA 1KHVA 3KLVA 3QIPB 2G8FA 4JS4A 1JLEA 3SZ2A 4QPXA 3SUNA 1L3SA 3JYTA 3H98A 3N6MA 2W9CA 4CJ3A 3KHRA 3SQ2A 4CJPA 3OLBA 4Z4HA 3QNNA 4KHWA 3NH1A 3QIPA 1KVBA 3M8SA 4K4VA 2FJWA 3BQ2A 4EYIB 4O3QA 3EPIA 2YNFB 4J9SA 1SUQA 1KFDA 3HL8A 4FJLA 2IS3A 2ATLA 5FROA 2XC9A 4M3RA 4ZMMA 2QKBA 4DTPA 4E7HA 4OKEA 2YNFA 3RAXA 3T19A 1A5WA 3M9NB 3GIKA 5KFCA 2FLNA 4DSEA 2A1SA 4E19A 1IG9A 3U6FA 1RT2B 3VQ5A 4CJFA 4NYZA 3SQ1A 1RDRA 2GIRA 3HM9A 1A5XA 2IA6A 4ECZA 4RG8A 4DSLA 3L8BA 4YMEA 3AVBA 1KFSA 1VSHA 1C0TB 1RT2A 2P1JA 4M3UA 5DQIA 1C1BB 3OS0A 4MFBB 3H59A 1HQEB 3JSMB 1S1WB 1ZYQA 1U47A 1C0TA 2IC3B 1NKBA 2R8GA 2X78A 3IG1B 4WE1A 1C1BA 4PA1A 4MFBA 1HQEA 1BI4B 5KT7A 4EO8A 4AHVA 4UQGA 1S1WA 5KFKA 2OPSB 2EC0A 2XI3A 3CQ8A 1RA6A 4J2AA 3IG1A 2W8LA 4RW7A 4IR1A 1BI4A 1S6QB 4CFDA 1NK0A 1NK4A 1ASVA 4HUGA 3EPGA 4ECTA 2YHBA 2V4RA 1C0MA 2UVUA 4KHYA 3IGNA 3KHHA 1BIZA 1S6QA 4KHQA 3RBDA 3RRGA 3KNAA 1TK8A 1C2PA 4JRQA 3G86A 4N41A 5F8JA 3U3GA 4IG0B 2DFFA 3BGRB 3QZ7A 1SL1A 3MEGB 3KLGB 2WOMA 4I9QA 2IJFA 4MIAA 1Q8IA 1NK6A 2BE2A 1YTAA 4W5RA 1UA0A 3LALA 3VQPA 2QKKA 1WN7A 4IG0A 4KTQA 1VSMA 5I3UB 1GX5A 3VQ8A 3MEGA 2WHOA 4IRDA 3NL0A 3DLBA 4E7KA 5FRNA 4NLGA 3GIMA 4ELTA 2FC0A 4IRCA 3VQCA 1L3UA 3DM2B 2D41A 3PW5A 4WYLA 4B3OA 1EXQA 1VRTB 4C8OA 4CJSA 5KFWA 1WSIA 4JRPA 4HTUA 4GVMA 2BQRA 4DTUA 5F8HA 4EYHB 3PW7A 3HPHA 4J9PA 1I39A 3DM2A 4BE1A 1RTIA 2RPIA 2XCAA 4EP5A 2GIQA 3PZPA 2ILZA 4RNFA 2AX0A 4Q8FA 4K50A 3ZSXA 4F3TA 1SKRA 3M9MB 3HO1A 2JGUA 4PUOA 4WYWA 5KG4A 3BQ1A 4GC7A 4ED3A 2QK9A 3AA3A 3IRXA 4RW4B 3C6UB 1JL2A 2BANB 4AHSA 3DLKB 5KTQA 1SH2A 4DU1A 4LD0A 1HMVB 3GV7B 3SPYA 3ZT1A 2G8IA 4RW4A 2IJNA 1ZBUA 3PY8A 4WZQA 2BANA 1ZTWA 3DLKA 4XO0A 4M45A 2B43A 1GOAA 5F8IA 4AHUA 3HJFA 4DTMA 1ZTTA 4IRKA 3OYBA 4URGA 2AX1A 3CDEA 4JUZA 3HSTB 3SJJA 4EBCA 5FDLB 1FKPB 3KIOA 1RDAA 3VQQA 3DYAA 1N5YB 3KK2B 1FK9B 3MR5A 2Y1IA 2AWZA 5J2NB 4F4ZA 4O3PA 1S9GB 3DRSB 2Z1JA 4HHTA 2CJQA 4EZ9A 3I0SB 4KAZA 4KFBB 1D5AA 1N6QA 4ZTFA 3KK2A 3OVNA 3T1AA 1FK9A 4CHPA 4ID5B 3B6OA 4KREA 5J2NA 3DRSA 1CSJA 5KT6A 4CJKA 4KKOB 1ZETA 3I0SA 1B9DA 4CGHA 2HHQA 4KFBA 4O3NA 3KK1A 3F9KA 3IN5A 2ETJA 4N5SA 3L2WA 4DS4A 4RW8A 4ZP8A 4QW9A 4KKOA 4XPEA 4OVLA 5KFTA 3M9OB 3S3NA 3NBPA 4U6PA 1L3TA 4TN2A 4C8NA 1OS5A 4IR9A 4M3TA 3MXJA 3B6PA 3HHKA 4K8XA 2HHVA 4BWJA 4W5NA 2EX3A 4DWIA 2IM3A 1C0UA 1UAXA 1CXUA 3BJYA 2QXFA 1UOCA 3V9WA 4CJTA 1LV5A 2ILYA 1SKWA 2I5JA 1T3NA 3CWJA 3N6LA 4EZ6A 4FLUA 4ZP7A 5KG2A 2R2SA 3D28A 3MR6A 3QGHA 5KG1A 2QV6A 4KE5A 3OYFA 4WZMA 3LWMA 1RAJA 4IKFA 4J2EA 3WNHA 3LP0B 3CJ5A 2JEIA 2V4QA 3MECB 4M95A 1TAUA 5C24B 1RNHA 1W9HA 4YR2A 3ZSZA 1S0OA 3HVWA 4E1NA 3GIIA 2VG7B 5KT4A 3M8RA 3L3UA 1JLQB 3MECA 4C8MA 3ZSWA 2XHBA 2HB5A 4WXWA 4OKJA 5C24A 3PUFA 2YV0X 5K14B 4W5OA 1HNIB 4B9NA 3TAPA 4KPYA 4JV1A 2VG7A 4KTZA 3NCIA 4E3SA 2W9BA 3RB4A 1JLQA 1YVUA 4F8RA 3TAEA 2HNZB 5C25A 4J9RA 3C6TA 3OSNA 1NK9A 1HNIA 4ZP9A 4QWDA 1RBSA 2GC8A 3MXIA 1B92A 3C95A 2HNZA 1HPZB 1BCMA 3L3VA 1L5UA 1U45A 2C2EA 3KLEA 2D0CA 2HHSA 4ED2A 1VSIA 4CEZA 5KFDA 4B9TA 4FM2A 4ICLB 1HPZA 2B4JA 4FCYA 3BREA 1KRPA 4DLGA 4Z4FA 2P5GA 2HMIB 5KFGA 1SH0A 4FJJA 4ICLA 3OHBA 4H4MB 1QTMA 2KZZA 2NUBA 3AVFA 3RR7A 1HNVB 4XPCA 3OL9A 2KFZA 2FLPA 2YKNA 4JV2A 2FLLA 1S0MA 4CHQA 2ZQBA 3OYHA 1ZBLA 4F2SA 1TKXB 3MEDB 1U49A 4M3WA 4I2QA 5KFIA 5KFBA 4E89A 4HCBA 1X9SA 2R2RA 3AVNA 3NGDA 1TQLA 4Z4GA 4FYDA 3PO5A 4QOZB 1XHZA 3MEDA 2V0NA 4JS5A 4DG1A 4ZVGA 1BHLA 1D9DA 2HNYB 5L1KA 2X6SA 3BSOA 4Z4EA 3DMJB 3O3GA 2ASLA 5J1EA 2R7YA 3KKSA 4KHMA 4BE2A 3LP2B 5KFRA 5T7BA 2C28A 1XR6A 4FJKA 5DMRA 2LSNA 1S1UB 3TAQA 3TR8A 4IFYB 3MR3A 4LY7A 3DOKB 4H4OB 3CG7A 3HVRA 3KD1E 4ZPBA 1RBTA 4NRUA 2AJQA 3E01A 5DG9A 1WAJA 3V6KA 3ZSYA 1S1UA 4IFYA 1JLGB 1DTTB 4LH4A 1BCOA 4K4UA 2FBTA 1NK8A 3H5UA 1K1SA 3CFPA 4J2DA 3G6VA 4CESA 3CJ2A 1BISA 4IFVB 3AA2A 3I5CA 1JLGA 4O4RA 1R0AB 2XY8A 2GV9A 4F50A 1RT4B 1QQCA 4CGFA 4IFVA 4KB0A 4ECUA 3LPTA 4DF4A 4WFZA 1TP7A 3WNFA 1R0AA 3QEWA 3TAFA 4CJ5A 1UWBB 3HYFA 4G3IA 2OPPB 4YNQA 3PX4A 1TV6A 2HAIA 4KTWA 2RDJA 5DQHA 3PW4A 4DTJA 3OYNA 3VA0A 1WAFA 4ECVA 3RRHA 1RBVA 1UWBA 2AGQA 1RT1B 4E7LA 2OPPA 4AHRA 2VWJA 1G15A 2ZD1A 1J9AA 2FJXA 4MKAA 3HP9A 3RTVA 3LZJA 4NLRA 1ASWA 3QNOA 4CJVA 2KTQA 5KGWA 3UIQA 1DTQB 3DLRA 5KI6A 5D3GB 5KFHA 3UR0A 3TQ1A 1U09A 2BRLA 3MAQA 1IKVB 4IG3B 4R0EA 3SUOA 1XI1A 3DRPB 1EP4B 1TKDA 5D3GA 5HROB 3RR8A 2BQUA 4FW2A 2DPIA 4AILC 1NJZA 1IKVA 2R8JA 2XO7A 2JEJA 4IG3A 4IQXA 3DRPA 4DQQA 2HNDB 1EP4A 4DL6A 4DS5A 4URQU 3AO2A 5J2MB 5HROA 4BE0A 4DL4A 4HVJA 3SQ4A 3CIZA 1I3AA 3PW0A 4CIEA 3OYJA 5L1LA 1VSJA 3OYKA 4J9LA 2BRKA 4NLOA 3LAMA 2WK4A 1KSPA 4RU9A 4Q5VA 5J2MA 4NCBA 1RT7B 4EBDA 4ECRA 2D7SA 1RT7A 1RYRA 3TANA 3JSMA 3UDLA 3RB3A 4DSJA 4CEOA 3N6NA 2IC3A 1UA1A 3ISND 1KVAA 1LW0B 2UVVA 3NHGA 3I8DA 2Q3SA 3NGIA 3OHAA 2OPSA 4FJ9A 3GILA 4FVMA 2ASJA 5CYQB 2OZSA 5KFMA 3SNNA 4I2PB 5HRSA 3T5LA 2HHWA 3QETA 5F8NA 3T5KA 3H4BA 5KFNA 4B9VA 4CFAA 4IKAA 4FS2A 4ED8A 1D0EA 2G8UA 5CYQA 3THVA 4I2PA 5KFEA 4DQRA 4O0JA 4Z4CA 4W5QA 3V1OA 3D0PA 3S3OA 3QESA 2IAJB 3BGRA 3H08A 2FBVA 3KLGA 1S97A 5JUMA 2BDPA 4DLEA 1S1XB 3BSAA 3QEIA 3V9UA 4KV8B 3T3FA 4EP4A 3DI6B 3NAIA 5I3UA 2EHGA 3KJVB 1JIHA 3OYMA 3BQ0A 1EX4A 1S1XA 4CE9A 4LSLB 3CJ3A 1NOZA 3HK2A 1BQNB 2E4LA 3DI6A 1GX6A 3KJVA 1VRTA 5KFYA 2HWHA 4DTSA 4LSLA 2FJVA 5KFAA 2XI2A 1J5OB 1C1AA 3QERA 1BQNA 5DG8A 3IS9B 1QSYA 3M8PB 3K57A 4BDZA 1VRUB 1T05B 2DTUA 4K4YA 4FK0A 4MH8A 1VSLA 3ICLA 1J5OA 4X2BA 3DOLB 1D8YA 3IS9A 1LAVA 3ZT2A 1LAWA 1JKHB 1VRUA 1T05A 1NOYA 1RT3B 4PQUB 1NKEA 4CECA 2E6MA 4O3SA 2D0BA 4H54A 3OL8A 1JKHA 3AV9A 1RT3A 2R8KA 3AVGA 4TY8B 1Q9XA 3EZ5A 3C6UA 2GBZA 4DMNA 1U48A 3BDPA 5KFOA 3KLFB 1HMVA 4YFUA 4Q0BB 3I5AA 3OYDA 3D45A 5KG7A 4TY8A 1VSDA 5CY4A 4FJIA 5HBMB 2IM1A 3V6HA 4FBTA 3I0RB 3NF7A 3QIOA 4AHTA 2ATQA 2W8KA 3AVIA 2VG6B 4J9OA 2VA2A 3K2PA 4B8CA 1C1CB 2FVRA 4CIFA 3AA4A 3MFIA 2JLEA 1S4FA 5SZTA 1ITGA 1LW2B 1N56A 3G6XA 5CYMB 1FKPA 5FDLA 2AGPA 3NAEA 3Q8SB 4TSXA 4ELVA 4FJXA 5C5JA 5KFPA 4KHNA 4Y2CA 3RWUA 1N5YA 4I9LA 1TKTB 3OY9A 4O4GB 2RN2A 3NDKA 3D5MA 4MK9A 1LW2A 4CF1A 4GMJB 1S9GA 3OSPA 1F21A 4E7IA 2B5JB 3MTKA 4CEBA 1DLOB 3OLAA 2YKMB 5HRNA 3VQ9A 4FM0A 5F8LA 1TKTA 5KRTA 4ID5A 4O4GA 2DY4A 4R5PB 4QWAA 4OL8A 4CJUA 1HARA 2B5JA 3RAQA 1JX4A 4TY9A 1DLOA 2YKMA 1FKOB 2IOCA 5T14A 4I7FB 1ZBIA 1MU2B 4TYBA 1Y97A 4CJQA 4ECQA 4R5PA 2ZE2B 1S48A 3PW2A 3V6JA 1IKWB 3C94A 4OKKA 3V1RA 1QUVA 5DK5A 3K5MA 4FXDA 3AO1A 3OS1A 4I7FA 3QEVA 2XGQA 5KG3A 4AH9A 1MU2A 4Y1DA 4PY5A 4M3ZA 3P83D 1RT6B 2ZE2A 2F8EX 2FVSA 3CVKA 1TKZB 4J2BA 4PWDB 4K4TA 3NF8A 4CJLA 5HLFB 3K59A 3NGYA 1A5VA 2KQ2A 3K5OA 3CJ0A 4TQSA 5C42B 3H5SA 1RT6A 1RTDB 4OGCA 4DEZA 5KFFA 3OL7A 3OYGA 3FDSA 4FK2A 4PWDA 5HLFA 1QSLA 3DLGB 4Q43A 2DFEA 5C42A 3OYCA 1RTDA 4YP3A 4QW8A 2UUTA 4O5BA 5J2QB 3Q8RB 4ED1A 1TAQA 3VQBA 2E9ZA 3AVHA 4F4KA 3LP0A 3DLGA 1KHWA 2IDOA 4NYNA 4MK7A 3TWHA 3KK3B 1K6YA 3BR9A 5J2QA 2QE5A 1XWLA 4NLSA 2AQ4A 3E51A 3HVAA 3IGVA 4WFYA 3SI8A 3KK3A 2XY6A 2I1RA 5K14A 5FRMA 4K4SA 4QWBA 3H5XA 3QZ8A 5F9LA 1Z25A 3HT3A 4QWCA 3CDWA 2PYLA 1ASUA 4CEQA 3TARA 3AVJA 4GC6A 3RMAA 4ZVHA 1KTQA 4QCLA 1U4BA 1RCHA 3RMDA 1XR7A 3FQLA 1NJWA 4OLAA 3LDSA 4TLRA 4GW6A 2BR0A 4Q8EA 3NH0A 3A2FA 4CJ4A 4FK4A 1WLJA 3NF9A 3QYYA 2DFHA 3ASMA 4NCAA 2YNIB 4HCCA 4KB1A 3EZUA 1LWCB 5SWMA 4HYKA 4F2RA 1YTUA 4FJ7A 1VSEA 4EEYA 2G8HA 2F8TA 4QWEA 4KRFA 2FBXA 2UVWA 4IH5A 1QS4A 4CHZA 2HMIA 2YNIA 1VSKA 3RMCA 1NJXA 1LWCA 4H4MA 5DG7A 5KG6A 1HNVA 5F8GA 3OYEA 3EYZA 1RDBA 3P1GA 3AO3A 3AO5A 1T03B 1K1QA 3V9SA 1TKXA 4DFKA 1WSGA 4Q45A 4NRTA 3Q8PB 2XCPA 1VSFA 2RDIA 3QO9B 3S3MA 1T03A 4BACA 3L2VA 4HUEA 4DL5A 4CHNA 1TVRB 4KO0B 2HNYA 3GYNA 4FLXA 3DMJA 3LP1B 3QO9A 1EETB 3G6YA 2VA3A 1TK0A 4Z4IA 2X6NA 5E41A 5KFVA 4KSEB 3LZIA 3LP2A 4B9MA 4DQIA 5EWFA 1TVRA 4KO0A 3MF5A 4NLTA 4LQ3A 4ZP6A 4FLZA 4ZVEA 1EETA 1MMLA 3DOKA 4H4OA 3SI6A 1HJRA 1IKXB 5DQGA 3WNEA 5JS1A 1RT5B 5CZ2A 4CF2A 4MIBA 1SH3A 3MFHA 4O3RA 4YQWA 1IM4A 3KLIB 1JLAB 3KD5E 4DQPA 1JLCB 4DTXA 4RUCA 1DTTA 1GOCA 4CEAA 1IKXA 3TABA 3SYZA 2O5DA 4ZPCA 4DTRA 3VQDA 3BSNA 3KOAA 3KLIA 1RYSA 4KBIA 1CZBA 2WRMA 1Z4UA 1JLCA 4NLVA 3HPOA 2G8WA 1RT4A 4CK2A 4MKBA 3RBEA 2XWYA 4N47A 4W5TA 4ZPAA 4JV0A 2J6UA 2YHAA 4FLTA 3NKYA 4QAGA 2D3UA 4RNHA 4K4XA 4FZYA 3V9XA 4LSNB 3GV8B 1J53A 3RB6A 2KW4A 3SPZA 2P51A 1T8EA 1S1VB 5DGAA 4NZ0A 5KT3A 4BDYA 1QAJA 1S5JA 3CM6A 4CFCA 4KI4A 1RT1A 1GOBA 4CGGA 1CZ9A 4LQ9A 1S1VA 4CEDA 3H5YA 4ZPDA 3NE6A 1RTJB 1ZBHA 3PHEA 2IMWP 4JLHA 1SUQB 3SFUA 3SV4A 4CF9A 1DTQA 1CLQA 1TGOA 3RB0A 1BIUA 2OA8A 1RTJA 3QEPA 2W7OA 4Y1CA 3RMBA 4M41A 3ITHB 2XGPA 3OYIA 3CO9A 3CDUA 3ZT4A 5L1JA 2UVRA 3NMAA 4M94A 5EDWA 4CEFA 2J6SA 3ULDA 1S6PB 2AU0A 1NHVA 2FBYA 3ITHA 2R8HA 2HNDA 3OL6A 1HQUB 4WXOA 3DDKA 4FBUA 3CFOA 1S6PA 4BDPA 4YR0A 1JLBB 2HVIA 3AVLA 4B8AB 3S9HA 5KFZA 4F3OA 4OLBA 1HQUA 3QINA 4K8ZA 1JXBA 4DSIA 4WE1B 4L8RB 4O55A 4ELUA 4KHSA 1JLBA 3PR4A 4LH5A 2W7PA 3CFRA 1T94A 1XHXA 1S49A 1BL3A 4J9QA 3ZSRA 3QLHB 2P5OA 3HP6A 4M42A 4RZRA 3SCXA 2RKIB 4RW7B 4B9LA 4FLVA 1S1TB 2JC0A 5KG0A 4CHYA 2HW3A 1LW0A 4NLDA 4F4YA 2Z1GA 3CYMA 4KI6A 3QLHA 5KFJA 4O44B 3O3HA 2RKIA 1BQMB 4WFXA 5KFLA 1S1TA 1TL3B 3PX6A 3VQAA 3MXMA 1RBRA 1NNDA 3EY1A 4O44A 2UUWA 1BQMA 4DSKA 4CFBA 4DL3A 2ASDA 2WOMB 1TL3A 4EO6A 4FW1A 3ZSOA 2BE2B 4F4WA 2HHXA 4Q44A 4NYFA 4IH6A 4ZHRB 1YT3A 4R8UB 3V9ZA 2IAJA 1REVB 2E9RX 2IM0A 4HUFA 4Z0UA 4E0DA 4CK3A 2ITGA 4ZHRA 4B3OB 5KFXA 3PV8A 4KV8A 3FSIA 5HP1B 4EBEA 4R8UA 4DQSA 3P5JA 2VWKA 3H4DA 3SUQA 1REVA 5EU7A 2BGGA 1IO2A 1RTIB 4CIGA 2W9AA 5HP1A 4CGJA 5L1IA 1X1PA 3OYAA 2PY5A 3PO4A 3NH2A 2GUIA 5L9XA 3L2UA 4RW6B 1RA7A 2E9TA 4FJGA 5KFUA 2KFNA 4NLUA 1NK7A 5KFSA 3M8PA 2Z1IA 4RW9B 1S0NA 5KT5A 2O4IA 1RILA 4FZZA 4PUOB 3VQ6A 3SV3A 4RW6A 1ZBFA 3TI0A 1QE1B 4B9UA 3DOLA 3LAKA 5DGBA 3IRXB 4KB7A 4CGIA 4RW9A 2OZMA 3OYLA 3CM5A 5KGXA 4PQUA 4N56A 1U04A 4CK1A 1QE1A 2F96A 3QGIA 4DFPA 4C8LA 1XR5A 3O3FA 3MEEB 4Y2AA 1FXXA 4J9NA 5CZ1A 4AHCA 4CF0A 1SL0A 4ECWA 2C22A 4FJMA 4ID1A 3KLFA 4N76A 3AVAA 1W0HA 4Q0BA 4TXSA 4BWMA
chains in the Genus database with same CATH superfamily
3ZX2A 2AF6A 2FUG9 1HBNB 3KMSA 2E6LA 2HOEA 1FF2A 4B3SJ 3FQKA 1N5QA 2XEXA 4C1NI 4CERA 4NCGB 2VG5B 2HRUA 4WFNQ 1DRZA 4PWUA 4ANCA 5AFUH 1GNKA 1HLWA 5CYMA 2WB4A 2GW8A 2YWEA 2HHTA 2VL1A 2ZITA 4DPXA 4DL2A 1SV5A 1XNQJ 5CHIA 4FZXC 1LOTB 4Z7CA 3KK1B 2MQ8A 3TO8A 4CLYA 4RW8B 3KLHB 3NGKA 5J2PB 2PMHA 3C16B 4LF9J 1VK0A 2HK2A 2RH3A 3FCWA 4P2MA 5HANA 1WC1A 1AFJA 1WHXA 3M7VA 1FKOA 3L2RA 2IGIA 2OPQB 2HFUA 1VR6A 4L73A 4OGEA 3VQ7A 1VQ4N 2V9WA 3HVTA 4QJVA 2ZH2A 2E1CA 1HRHA 4IO8A 4CZMA 1FWKA 1FD8A 1LFPA 3RU0A 4LC9B 3OUYA 4BHQA 3OR1B 1TKZA 2VHGA 3RBXA 1W25A 3ISNC 3IBCB 3VALA 4X84A 4DU4A 3NVKA 1S99A 1S57A 2WCXA 2ZH5A 3ZCMA 5HMYA 3QPIA 2V8DA 1IR0A 3IM8A 3WNGA 2QXLA 4NLXA 3NF6A 2P9IB 2L41A 2B9EA 5I42B 2KJVA 1WF1A 4ZOSA 3M8WA 5KAKA 2Q31A 5HRRA 1GAOA 4B9SA 4NXNJ 5LMUJ 2YY3A 1N32K 4DV2J 1TL7A 4CJEA 2CG8A 1VQKN 4DR2F 2QX0A 2VD3A 4ED7A 1Z6RA 2CPHA 3KKFA 5C25B 5AZIA 1NSQA 1F6TA 1FTCA 1YRUA 3HHLD 2FB0A 1RTHB 3F44A 2F4VF 2W2PP 1FVSA 3EXCX 2AGOA 1ZAXA 3MD1A 4J9MA 3O9UA 3QIDA 1ZXOA 2M8DB 3OW2M 3DLEB 1L3VA 2VFUA 3HKZD 5AE1A 2XMJA 4YB7A 4TQRA 3T6JA 4MDAA 1J54A 3DRRB 4Y00A 3H40A 2GMLA 3AVCA 3TZXA 4DR6K 4HWIA 1NGBA 1C6VA 3MX5A 5CE3A 2H9ZA 3AARA 3WDOA 2PZSA 3PJWA 5GMEA 1JL1A 5C12A 3MCMA 2ERRA 4NYOA 4V19X 3CNQP 2RMLA 3CJBA 1DAXA 1BA1A 3ONQA 2YHYA 1HYSB 1VQKS 2QWNA 1A9NB 1RISA 2C2RA 2YHXA 1KCFA 4FKYA 3T41A 1XQIA 4ID8A 1CQNA 1E4FT 1LWEA 1BA0A 2YNHA 4CLSA 5HJXA 3M4XA 5A2QY 1HWLA 3CCLN 5AQHA 3V6DA 2Y1LB 2OUGA 4XDCA 3NGZA 4DPOA 5JLHA 4OHZA 3FFIA 3H6EA 4IOBA 4IBNA 4CF8A 3MCPA 4Y0WA 1FVQA 2RRBA 4OJHA 1NG9A 4M5IA 2ZKUA 3Q0AA 4JYAF 3TSQA 1X4FA 1X3MA 5D4NA 5E3RA 1P1LA 5GMKa 2ALZA 2FD2A 3R9PA 5KRSA 1K44A 5ETNA 2BUPA 1V4TA 4X66J 2X1BA 5EWGA 1CJVB 2WONA 3Q86A 3F73A 3H90A 3CULA 2KYZA 3CD0A 4A8WA 3KUGA 3FKBA 3PDNA 4RNNA 4DTOA 2CH5A 4M7XA 2CKWA 2APOA 3DXBA 3G10A 3UQSA 5I4MA 4ENOA 4DUYF 5LJ5Y 3K5NA 4H8KA 4CO0A 2DEJA 3DXMA 1WSJA 4ZTJA 2MGZB 1HBUA 2IYIA 2W42A 3LM2A 1RHKB 2E7VA 1FEEA 2MQNA 2XRIA 4UUWA 3T1HJ 2ZD1B 2ZKTA 2FSJA 2J8SA 3EKSA 4ZVFA 3MM6A 2WSCC 3C2PA 2GAHC 1Y5IB 3DLHA 1MROA 3KLVA 4JI1F 4JS4A 3FZ2A 2XB2D 3GP9A 4QPXA 1L3SA 2ZHAA 3JYTA 1TYQB 3UNYA 4Q2LA 4CNZA 1HD0A 4CJPA 3W9HA 4Z4HA 3HOTA 4KHWA 3G6EN 3QIPA 4K4VA 2Z4PA 3H0PA 4PQAA 4OX6A 4O3QA 3EPIA 4J7CA 2ATLA 2RNEA 1U1KA 2XC9A 1SJRA 2BOAA 2ZFHA 3MWTA 4ZMMA 4DTPA 1A5WA 1WKLA 5KFCA 2A1SA 3GONA 3MMAB 3UN3A 1HQ2A 4BRLA 3U6FA 3BPSP 2BACA 1YRXA 4CZEA 1HKCA 1RDRA 2QIFA 3CXCM 2YWFA 2IA6A 3G96A 5ETLA 3L8BA 2PI4A 2GQ2A 3QBXA 5CZVA 3EGNA 3OS0A 3PM9A 1HQEB 1P9YA 3I4HX 3BKFA 4ISGA 3P4IA 2GVZB 4KY3A 1U47A 2IC3B 2L3MA 1F2GA 3BO3A 1C1BA 3S7RA 1BI4B 3JS9A 5KT7A 4EO8A 1S1WA 4LF5K 2XI3A 1RA6A 3R8EA 2NPIA 3IA0A 1AXQA 2HS4A 2DXDA 2V4JA 3HSGA 4P52A 2L9WA 3PIOQ 4CFDA 3KZBA 3QMQA 4ZVTB 4HUGA 5EXWA 3CC7N 2W2QP 3UD5A 4YDXA 3IGNA 1QAYA 1Q0NA 3RRGA 3KNAA 3G86A 2CA9A 1ELOA 5EX0A 1FDDA 4I9QA 1NK6A 2Y3YA 1UEUA 4JKHA 4W5RA 1G2EA 3VQPA 4BG9A 4IG0A 5AT1B 4BROA 1GLBG 3VEYA 3DLBA 5GADU 2RQCA 3ATVA 3SAFA 2B4PA 4NLGA 5FRNA 4A5BA 1L3UA 3SCIE 4WFAQ 2GWJA 4B3OA 2IRXA 3K2YA 5CR4A 3BZKA 4CLLA 3I8BA 4J9PA 4LFBK 2AJ0A 3THPA 4JK8A 1EHWA 1RTIA 2RPIA 2GIQA 3PZPA 2ILZA 3CC7S 2PD1A 1NH8A 2LQBA 3KUHA 2W2MP 2DTJA 3ZSXA 4WIIA 1SC1B 3TQEA 3ETMA 2BKOA 1JJHA 2EFNA 3DRXA 3HO1A 4KHPK 3WEEA 4PUOA 1VQ6S 2BJ9A 2FTRA 1HKGA 3AA3A 5EX3A 4RW4B 5GAHP 3S1TA 2FHJD 3DLKB 1WACA 3FZKA 4GO5X 2AKWB 2G8IA 3BPDA 2CADA 1FX4A 2VQEJ 2CDRB 1ZTWA 2B43A 2B51A 4WBFA 4AHUA 3O3LA 1ZTTA 2DH9A 3LF0A 4URGA 1R3NA 1JNZB 1YJVA 1ZBSA 3GG4A 2V2KA 1AFIA 2CGKA 2OD6A 1T44A 5HMWA 3U1NA 4NA2A 3TZWA 4LREA 3VQQA 3UB5A 3KK2B 1XN9A 4JV5F 2G2ZA 2VV5A 1S9GB 3DRSB 4CI6A 4LF4K 1S72N 2YWKA 5A0YA 3I0SB 2FF6A 2DNGA 2NRRA 2KI2A 1CSJA 5AQGA 3D68A 2B3TB 1ZETA 1ZH5A 1B9DA 1FNXH 2CUYA 4O3NA 4DS4A 2IRUA 4B3TK 4ZP8A 4QW9A 1UCNA 3HSJA 4K5SA 2A6MA 4C8NA 1OS5A 3BM7A 1M90O 3OBIA 2HHVA 5LMNJ 4TLQA 2EX3A 3U1MA 5AQJA 1C0UA 1UAXA 1CXUA 4DV5J 3E2EA 1NSAA 4ZVOB 2A18A 1LV5A 2I5JA 4DR4K 4P10A 2OCEA 3C14A 3OFGA 3OPKA 3GWCA 2HF4A 3VGTA 3N01A 1S72S 2HEKA 5KG1A 2GVDA 3CHWA 3LWMA 1RAJA 3UVJB 4J2EA 3LP0B 1NMDA 3L4BC 3MECB 1TAUA 3W9JA 7FD1A 4YR2A 2O01C 1S0OA 2QLFB 4XAKA 3HOSA 2VG7B 2K1RB 1JLQB 3ZSWA 4OKJA 5C24A 1GXUA 3PUFA 2EK6A 4DV7K 1K0TA 1H7WA 1EQMA 1LK5A 3NCIA 4E3SA 4C11A 4DHYA 1YVUA 4F8RA 5EHHA 1DQ9A 3C6TA 3OSNA 2DEIA 3MXHP 4OYIA 2GC8A 4OHXA 1IWGA 1YDLA 2GMHA 1B92A 1NXIA 1LCUA 3L3VA 4USHA 4CEZA 5KFDA 4ICLB 4P2FA 3MAAA 4HHJA 5AQFA 2P2CB 5ETTA 4BRNA 4B3MJ 1HPZA 5C2GA 2OMLA 3Q2SC 3J7AP 4EMDA 4FCYA 4Z4FA 2B8QA 1IM6A 2HMIB 4OHWA 1SH0A 3WXIA 2X51A 4H4MB 2KZZA 4FXVA 5LSRA 2J0QD 3AVFA 3MM5B 1KC8O 2Q36A 2UUBK 2FLPA 1S0MA 4AM7A 2ZQBA 3OYHA 4JKGA 1EKRA 1EWQA 3MEDB 4PRFA 4IDHA 4M3WA 1Y11A 1OH7A 2Q0RA 1NB2A 4E89A 2KT5A 3CB4A 3AGRA 4HCBA 4PXDA 3AVNA 1SQKA 4ILHA 3O5BA 1XHZA 2V0NA 2HNYB 3BSOA 5AQXA 3L95X 3O3GA 1FFGB 5J1EA 3LGHA 4DR7F 3LP2B 4MLHA 5KFRA 2V69A 1XR6A 4FJKA 4JI2F 4FNIA 4ZPBA 2CWXA 1HBOA 2BKPA 4DL0C 1CC8A 3K8WA 2LEAA 2E5LF 2HGNA 4K4UA 4DMZA 3FZFA 4G1PA 2FY8A 1RBOB 2HBJA 3VMFB 3I5CA 4O4RA 3FGVA 2HHPA 4X65F 2XY8A 5ITHA 2CAJA 1NM1A 4CGFA 5HVHA 2IDLA 3THXA 3G8SA 2LEBA 2CDQA 4WFZA 2WSFC 2ZNYA 5AQYA 4JI0F 1SVDA 4PCQA 1HNZF 3P31A 2O8FA 1UWBB 2OPPB 2HAIA 3EGZA 5DQHA 3PW4A 2LCWA 3VA0A 4FWMA 1KQSR 1HNXF 4H03B 3AGKA 3RRHA 2GAGC 4M1KA 4E7LA 1UW4A 1T02A 4AHRA 2VWJA 4BR7A 3NS7B 2W40A 4F3QA 1WOPA 3FGUA 3AOCA 3RTVA 2OEMA 3LZJA 1WKJA 4PXEA 3QNOA 1MWQA 4CJVA 1S3XA 5KGWA 2O1PA 5KI6A 3E1YA 2HIYA 4DR2J 3TQ1A 2FXUA 1IKVB 1MDUB 4R0EA 2Q1NA 1CVJA 1UVMA 4A2BA 5D3GA 5EY4A 5HROB 1U6ZA 4GKJF 3FE1A 4AILC 3OTEA 2F4VJ 1OPZA 3P5TL 4IQXA 3OTCA 2D69A 2DISA 1EP4A 4BLGA 1DARA 4URQU 2HSTA 3AO2A 3W2VA 4BRFA 5J2MB 2E88A 1ZM3A 2ZBQA 3SQ4A 1CJUB 1YXQA 1GLEG 2JNJA 5HQMA 3OYJA 1IBMK 5M1FA 4WKYA 4NLOA 3LAMA 1DBDA 1FXDA 4OYBA 5ADXA 2Y0BB 3HHLC 2DRAA 5AQSA 2D9OA 3TANA 1SQFA 3UDLA 4MKYA 4JD2B 3WHIA 1LW0B 2NPFA 5L38A 1UP1A 4K2XA 4V19J 2CQ2A 2OPSA 2DR6A 5H9FK 3OR2A 5CYQB 3GL1A 1IJFB 3UCUP 1T9VA 5HRSA 3I55S 2HHWA 1WB9A 4IKAA 4FS2A 3CMAS 3TZZA 4I2PA 5KFEA 5B0CA 4DQRA 1KD1O 3SJHA 2A3JA 2YWGA 2NRZA 3S3OA 1WOQA 1RWVB 3H08A 3GJTB 4JYAJ 2DPNA 4CTAB 1S97A 2CG4A 2BDPA 2VGNA 4L6V3 3BSAA 3CJKB 3QEIA 4BREA 1KDNA 1XBWA 1W2BR 2BX6A 4BRGA 4X4QA 3KJVB 1U6FA 2X3GA 2GGPB 4MMOA 4C2MA 3QFWA 3HI0A 4ES3A 3RSEB 4KGVB 1QY7A 2GEMA 2MLZA 2RUGA 1KAZA 4BVPA 1R8AA 1VRTA 4ZPTR 1M1GA 4DUYJ 2BJ7A 3VWSA 2CH6A 1J5OB 3JTOA 2E1RA 2CYYA 1BQNA 4LFAF 3IS9B 5D4OA 1LNQA 5G4DA 1GMWD 1RHRB 3QATA 3HHDA 1VRUB 2OTJS 2VPWB 4HT7A 4FWNA 1VQYA 3PEHA 5HOOA 4HH0A 1DEJA 2V6AA 1D8YA 2VC1A 3ATUA 4NA3A 1FRJA 3M6XA 2V2ZA 1WC6A 1NOYA 1RT3B 3L7OA 5K5MA 4JI1J 3W61A 2E6MA 3RYLA 5DS7A 3H42A 3O44A 3MM7B 1CJKB 2DY1A 4WQ4A 2GJFA 3OL8A 2NYIA 4TY8B 3C6UA 4ZLLA 2GBZA 1U48A 2ALYB 3KLFB 1HMVA 2G2YA 4Q0BB 3DNCA 4K8RA 2H4WB 5GADI 2JHEA 4N77A 1RE1B 1TFYA 2KVIA 1SQEA 3I0RB 3NF7A 4AHTA 2ATQA 3CW2C 2W8KA 2VG6B 3AVIA 3OVBA 3VF0B 3K2PA 3V5RA 4B8CA 2WBRA 4I0WA 2GO9A 5F3TA 1E3MA 1R7IA 3BGUA 1S4FA 4JI6K 5K8NA 3BO4A 4P6QA 4CZFA 1FKPA 2L08A 5EGYA 3R3TA 4KHNA 4Y2CA 2B8PA 2KLAA 1TKTB 1NMEB 2Z2YB 3JQJA 4O4GB 3OTDA 3OY9A 2RN2A 3D5MA 1S6OA 2W1BA 3K0SA 1H6KX 5IQ6A 4E7IA 3MTKA 3CQXA 1OVYA 4CEBA 2AJ2A 2ADBA 2ZH3A 1DLOB 3VQ9A 2KHDA 4IO9Q 3QB0A 2HQ3A 3U4LA 5IT9Y 1VIOA 3VF4A 2AYMA 2B5JA 1GXTA 1JX4A 4FF1A 1GLLO 2W6LA 3J81U 5FPNA 4I7FB 3FBEA 3CCUN 3Q89A 1MU2B 4TYBA 2ZJPL 4OZ3A 2NXJA 1Q8KA 4BC3A 2LA4A 1IKWB 1YUWA 3V1RA 3K5MA 4FXDA 4R79A 2VPZB 2M9KA 3QEVA 4YHHF 3TRGA 1RT6B 3P83D 5C2DA 2ZE2A 2J0WA 3CC2N 3ZZRA 3MPWA 4ED4A 3CVKA 4DUZK 5C2FA 5HLFB 3K59A 2JL9A 1A5VA 3NGYA 4BG8A 3D54A 3CJ0A 4TQSA 3AH6A 3SDEA 1OY6A 3NP5A 5KFFA 3OYGA 3FDSA 2LMIA 3TSUA 4FK2A 2QTDA 3P38A 2VBZA 2HZVA 1QSLA 2N7YA 1EO1A 5AQQA 4YP3A 3VAKA 5J2QB 1ATSA 1RAEB 3O6QA 4ED1A 1TAQA 3ETOA 3DLGA 2IDOA 3NNCA 3UCZP 8RUCA 1K6YA 1EQYA 3LDLA 4UOHA 3CCUS 4AL5A 4QR0A 1SKUB 4KPCA 2Y8YA 4GVLA 3C15A 1XMOK 2I9SA 3QZ8A 1M5KC 1HPMA 3HT3A 2PYLA 3CC2S 1Y3JA 3TARA 5BRDA 4ZVHA 1AA1B 2C3MA 4BR9A 1NJWA 4OLAA 5ETPA 3M1VA 5IQQA 4DV6K 1RU1A 3NH0A 4ATNA 3CCVN 4FK4A 2XYHB 4RX6A 4HYKA 3BGFA 4G65A 1W7AA 3POTA 5A76A 3Q23A 4EEYA 2F8TA 2KKZA 2UVWA 4IH5A 3D2WA 2YNIA 5JJBA 1VSKA 1LWCA 4HHUA 1NGCA 1Q86T 1Q7YT 5DG7A 3CCES 1XQSC 7FDRA 1HNVA 5D77A 3HJVA 2ZUAA 1JCGA 1T03B 2V67A 3OA9A 4DFKA 3LQVA 1NGAA 3IXQA 3S3MA 4JV5J 3CJ9A 2QA2A 1BWVA 4BACA 2P9SA 2PEHA 4YN3B 4DL5A 1P6TA 4QS8A 5HQ8A 1WORA 3EN9A 3LP1B 3QO9A 3RW6A 3IM9A 4NMXA 4UZBA 2JVRA 3H46O 3PEJA 1LOUA 1TK0A 1QM9A 4KSEB 1A0OB 1FRHA 3MF5A 5H1SQ 3CCJN 4F9OA 4FLZA 4ZVEA 3CCVS 2QN6B 1C0GA 2DHAA 1HJRA 2B4UA 3WNEA 4CF2A 4OPAA 5LM7E 5A2QU 3MFHA 2VQFK 2KM8C 3UDVA 2PE8A 1DTTA 5ETQA 1GMVA 3N5FA 1IJJA 3GJRB 3SYZA 1SBRA 4LUBA 3WC0A 2OI2A 2HZAA 1R6YA 2DHHA 1RYSA 1NJIO 2WRMA 5HN0A 1X4HA 4DPUA 5J1NA 4LF8K 1J2VA 2PA8D 4FYVB 3W2WA 3LTOA 2LQ9A 4MKBA 3NCQA 4ITSA 4I1TA 5F0WA 3J81O 3KG0A 3S01A 4ZPAA 4J91A 2WVCA 1CQMA 2Y1RI 2YBVA 4LIRA 3FC9A 4LR7A 2AW0A 2V8GA 1XNRK 2MSSA 1KWMA 3AJ1A 2QLXA 2CNOB 1ZPVA 4LF7K 1QAJA 2PO4A 1M5OC 3CM6A 3TOQA 4CFCA 1VJQA 3CCJS 3W7BA 3THWA 4LQ9A 3ZC4A 2QI2A 1NGFA 1WI8A 2GHVC 1EQ0A 4JLHA 1Q18A 2NYHA 1HUXA 4CF9A 3F41A 5IM0B 1BIUA 4BRAA 5A8KA 3M6VA 1RTJA 3TJ9A 3G71N 2W7OA 3RMBA 5B8HA 2QWPA 4A8OA 2XGPA 3OHRA 3J7YU 3OYIA 3CO9A 2HLTA 4ZJLA 2UVRA 4KH5A 3VENA 4NPOA 2F40A 2XHWA 4P74A 1KAYA 2RJZA 1QDUB 2MQOA 5B0EA 2J9CA 1KQKA 3F56A 3GCXP 3DDKA 3CFOA 4GO7X 4A4JA 1S6PA 3F0NA 3NVMA 1X9JA 3VEWA 3S9HA 3FUYA 1YI2N 4CO5A 4F3OA 3W5XA 1JXBA 4ELUA 2XQCA 3O6WA 3DN9A 2C42A 1X5PA 1TTHB 1YGYA 1PBAA 3CCMN 3VGKA 2P5OA 3SCXA 2RKIB 4RW7B 4B9LA 2RUSA 4LFCK 3TR5A 4CHYA 4F4YA 3WZ0A 3NCRA 2Z1GA 3G71S 3I56N 1B7YB 1X4AA 2HBZB 5KFLA 3VAIA 1S1TA 2BZ2A 1TL3B 5FPDA 3MXMA 1FA0A 1MN7A 3HLUA 3QAEA 1Q8BA 3MN9A 1NNDA 3D2EB 3KDOA 3CDBA 1Y9OA 3FSXA 4DL3A 2ASDA 3ZETA 4EO6A 1U8SA 4FW1A 3QRRA 3ZSOA 4XEIA 2HHXA 2EEYA 3KUEA 5KOXA 1FCAA 2W01A 4FL9A 4ZHRB 1YT3A 4NWBA 3P96A 4OI3A 2E5LJ 4R8UB 1YI2S 2H48B 3IC1A 3QJLA 1R0CB 1WC5A 1QQMA 1REVB 4USVA 1ACMB 4HUFA 2EWSA 3CJRA 3DOMB 5KFXA 3CCMS 4IFEA 3G8QA 4X65J 3H4DA 2BGGA 5AQMA 4LFBF 3T6BA 1K73T 4X4RA 4CIGA 1KVKA 1NLKL 2EXUA 4CGJA 3UNGC 3I56S 4JI0J 2D0PA 3NH2A 5FIIA 6FD1A 1HNZJ 2F9JA 1PAEX 1QVFM 3L2UA 3HHEA 4RW6B 3MAHA 1RA7A 4FJGA 4NLUA 3DJCA 1RHQB 1WOOA 2NXCA 1HNXJ 4KHPF 1S0NA 5KT5A 3RJMB 1RILA 4FZZA 3SV3A 3TI0A 3IKMA 1QE1B 4B9UA 3DOLA 2A5XA 3CM5A 1ULRA 3LGNA 1U04A 1DKGD 4UY85 4CZGA 5F1XA 2BE9B 1RABB 2F96A 5AQPA 3B6BA 2VFSA 3O3FA 2AYBA 1FXXA 1NZAA 5B7WA 4GKJJ 3T9ZA 2DNPA 1NBWA 1MWMA 2AJ4A 3UKRA 3GFZA 4E1MA 5T41A 2JSXA 3SSSA 1ZA2B 5HBMA 3H2VE 1O1WA 4PG4A 3CD5A 4DFJA 2DXEA 4IJNA 4U7CA 1SV5B 1HI0P 4LF4F 3BF4A 1S4EA 2YI1A 4CVNE 1UEKA 2ZUGA 1REGX 3B4DA 4DFMA 4DV1K 4NE9C 2NXNA 5LXYA 4ECXA 1KLMA 4DCPB 3LWLA 1N48A 1G1XA 2OPRA 3CO0P 1UETA 3UPFA 5CHCB 4U7UD 1U24A 4N8NA 2Z30B 4B3TF 3NBPB 3J80U 3AA5X 4M5KA 2I7NA 4K4WA 2NXEA 4B1UB 3HVTB 2IIRA 2HQCA 5IV4A 4OQJA 4M5DA 4CCHA 4IZ9A 4TNOA 1YX2A 3OUYB 3AVMA 1WSRA 8ATCB 4IDKA 1BG3A 1N4LA 2HVHA 1K0VA 1BHNA 5H1SV 3U02A 2Z2LA 2BTFA 1SB6A 1BUPA 4FOIA 3FRZA 4QIEA 1XK8A 4MKVA 2W2NP 1WKKA 4CZHA 1H2VZ 4CLPA 4YDDB 2WC9A 3DC2A 2RDDA 3ZZYA 4NZ6A 5AQUA 4CGDA 2VOPA 4MQ3A 5BYQA 1UPPA 1H2UX 2Z2ZA 4WU3A 4HACA 2N7CA 1TL7B 4M3YA 4B08A 2LVWA 1BMQB 1RTZA 2V2VA 4DV7F 3H45C 3PLAA 4XIUA 1XC9A 5AZIB 1TUVA 3PR5B 1ATNA 1H3DA 1S9EA 4U7UK 3ZSQA 1Q81O 2W9BB 4DTNA 3EXYA 1FE0A 4KHRA 4DSFA 4LFAJ 4RTFD 1CLFA 2D3ZA 3AB4B 1RWUA 3ZT0A 1Z26A 1JLFA 5JS2A 4M63A 4CEEA 3FMBA 1SJ3P 4EI2A 4Z2XA 4O3OA 3KLEB 1M1KO 2RF2A 5IXUA 5G0RA 1RFQA 1K9MO 1F3FA 2H54B 2DNYA 2LEPA 1IKYA 1NJYA 2MEWA 3CCQN 4DPWA 3E8OA 4U67L 3GIJA 3M2UA 3UO0A 4CLTA 3G9CA 2UUBF 4CJ7A 1FESA 3AA8A 4HEA9 2OIHA 2PFDA 4I2QB 3SQ0A 5EX5A 3IR5B 1TK5A 5B0FA 1ZPWX 3PRDA 4M8LA 4F25A 1NM2A 1TU0B 2X1AA 2M70A 5CZXA 2QFIA 2Q97A 1LWEB 3TUIC 4DG1B 5D0HA 2YNHB 2Q66A 2QA4G 4JNEA 3HPGA 5DM6L 1S10A 3JSRA 5CD4A 1YVFA 3KHGA 2YPZA 4FJHA 3AY9A 4FWOA 3V6DB 1U1RA 3CSKA 1HKBA 1WHVA 4DPTA 4B1YB 2CPEA 3FFIB 4ZIVA 1ZZFA 4F0KA 2F8HA 5JXSA 4URSA 3MUMP 3W62A 3ALYA 3E01B 2HHUA 2BQ3A 2HHHK 4FJ8A 4DZ6A 1S22A 2MZQA 1APSA 1WTBA 2B9WA 2ADCA 1BGXT 3O4NA 3VTHA 2WONB 4O5FA 2XLIA 1IBLK 1RT5A 2RS8A 4ANEA 5F8MA 1U7LA 4HKQA 1YF5L 3VQEA 5D0EA 2EG1A 1JLAA 4YHHJ 2P9NB 1NK5A 4JI5K 3QAUA 3M05A 3M8QA 3TA1A 5E33A 3DXMB 2BXJA 3TX0A 2XMAA 3CE8A 4C8YA 2B6AA 2JWLA 4FSVA 1HBUB 2Q6CA 4W98A 2JLGA 3L2QA 2MZRA 2YNGA 5EWEA 1H73A 5E0OA 2OFGX 3J80O 3T1YK 1TV6B 4L3NA 4FYYB 1WSFA 4CYUA 3KTQA 2RQKA 3GE1A 4FLWA 1VBXA 1MROB 3O1LA 4YB5A 1VHFA 1Q5VA 2I38A 1YG0A 3JYTB 3H2UB 2F1FA 4FJNA 1GLAG 3C6AA 1EKEA 1WNSA 2OSQA 4LSNA 1RAIB 1UJ6A 2FQQB 4NLQA 4WIQA 3QIPB 2WZ1A 3SZ2A 1OSDA 2IY5B 5BPMA 3H98A 3N6MA 4C4WA 5AQIA 3KHRA 3SQ2A 4K5RA 4EIAA 1UZDA 2ZGYA 3QNNA 2NUUG 2G1HA 3BQ2A 1C4AA 1ZAVA 2F3JA 1SUQA 5ELZA 3DU6A 2ZDOA 3WIVA 3R3LA 1TUYA 2LDIA 1NCLA 2YNFA 2RQ4A 3L7PA 3M9NB 1Q82O 2E8AA 3IDHA 3DDIA 1IBMF 3VQ5A 4F04B 3SQ1A 2E1YA 1A5XA 4OHYA 4YMEA 5CH7B 3AVBA 1KFSA 1VSHA 5HK4A 1RT2A 4RBVA 4M3UA 4B3RF 1NWKA 3RW7A 2P9LA 1C1BB 1RHJB 2RHQB 3JSMB 3JSBA 1S1WB 1KOHA 2RAQA 3J7ZT 4DOZA 1C0TA 1U0SA 2YXLA 1F2HA 2V5HG 4LF6F 3AXMA 4WE1A 1SC3B 2V4JB 3ZLJA 4DBQA 1M0SA 2QGFB 4UQGA 2JOQA 3KWIA 1U2RA 2HZCA 2J5AA 1B64A 4UQTA 2DGVA 4X64K 3J7YI 1S6QA 3Q2TC 3RBDA 1TK8A 2R7TA 2HFSA 1RWOB 5E7OB 4RUBA 1SZ2A 2ATCB 5E3QA 5F8JA 3U3GA 2NLWA 2VDIA 4IG0B 2DFFA 3BGRB 4FNHA 2O3DA 1B99A 2WOMA 5F0XA 2H3GX 3NGTA 2BE2A 2F4FA 1YTAA 2UXBK 1WN7A 4R25A 5I3UB 1GX5A 2JJ4D 2WHOA 4KGKA 2JFDA 1HW8A 3NL0A 3HDSA 4I69A 4ELTA 2RU3A 1VLYA 3E9OA 3VQCA 1RACB 2HK3A 1B3TA 5LMUK 3SIPB 1CBKA 4BGBA 3GG1A 4DV2K 2V94A 5KFWA 5E3AA 2BQRA 4DTUA 3PW7A 5A8RB 3HPHA 2C1EB 4W4MA 3GIRA 2DIUA 4DX6A 1T0TV 4EP5A 4ZPWR 3FEXB 2ZBRA 4RNFA 2QT7A 2KB2A 3WEEB 1S59A 4F3TA 3GCWP 4ZVSB 3MCNA 1SKRA 2CQCA 4CT8A 2VKRA 4WYWA 5KG4A 4OX7A 1R8CA 4GC7A 2RILA 2QK9A 3GSIA 1F1BB 3M32A 2XTJP 4Y0FA 5FLXU 5GADP 2GZOA 5KTQA 4LD0A 3GV7B 1JJ2M 4XH1A 3SPYA 3SAHA 2P6SA 3ZT1A 4WZQA 2VONA 4F26A 2YJEA 4HDHA 4FN5A 3FR0A 4RWWA 4KR0B 4DI6A 3CPWR 4DTMA 3OYBA 1FRIA 4JI6F 1FJ7A 4WK3A 2YX6A 3HSTB 3FEZA 4K0KK 3SJJA 1RU2A 4EBCA 1HBNA 1RDAA 9RUBA 1QVGM 4X62K 3W5ZA 2O8DB 1N5YB 1UVJA 2Y1IA 2AWZA 2KO1A 4F4ZA 5HSPA 4O3PA 4HHTA 2CJQA 1RHUB 3HD1A 3BGLA 4KAZA 3OVNA 3G4SN 1FK9A 4FWKA 4ID5B 1Q81T 2UUCK 5DM7L 2MKJA 5J2NA 5KT6A 3N0VA 2GX9A 3ZXWA 4KFBA 3KK1A 3BDEA 1RXOB 1YQHA 3IN5A 2ETJA 2H51B 2DGUA 2H5EA 4RW8A 4ILJA 3C16A 4XPEA 3OFFA 2X1FA 4JK7A 4WP9A 4U6PA 4IR9A 1BO5O 1OQ6A 2ASYA 2LA6A 4CZKA 2BEFA 3HHKA 4K8XA 2W7AA 3C14B 4GRSA 4DUZF 2W41A 4KIAA 2EBEA 3C6HA 1UOCA 4JI3K 1R27B 1TMJA 1VJWA 2GVDB 3LW5C 2WBNA 3D6MB 3OR1A 2E5IA 3D28A 3VZHA 2QV6A 4FZVA 3GR0A 3MI7X 3ELHA 2EC2A 2LKZA 3CJ5A 4ERDA 4M95A 5C24B 4L75A 2P9IA 1T3VA 4A57A 2R7OA 3HVWA 3SCKE 5KT4A 5DDOC 4C11B 4QS9A 4LFBJ 4Y2MA 1SJ4P 2HB5A 3S8SA 5ADXH 3TAPA 3ISZA 3F5TA 5ETOA 4KTZA 3W63A 4YY3K 2ROGA 3TAEA 5C25A 1HNIA 3MM9A 4DHVA 2KHOA 1IR2A 4KHPJ 3MAAB 4UY8T 3C95A 3UI3A 4BR2A 4C48A 1HPZB 5B0GA 2IBOA 1L5UA 2D0CA 2P9CA 1YHQN 4B9TA 5E26A 1Y10A 4P7TA 3BF1A 2YQ3A 5D0GA 4USIA 2B4JA 2DVIA 2P5GA 4FJJA 4QS7A 4JKGB 2ASMA 4KGZB 1BUXA 3J7AN 1GLDG 4XPCA 3OL9A 4IYQA 2F9DA 2RSQA 4MLEA 2AIRB 2FZCB 2YJFA 3K9JA 3QNWB 4AL7A 2E5HA 2FJAB 2IVPA 1MW7A 1ZBLA 1TKXB 1U49A 1NGIA 5KFIA 3WBZA 3L6QA 2E5GA 4OMFG 3P3DA 2E2OA 1X9SA 4LVOP 3NGDA 1TQLA 5FLXO 4Z4GA 2E7XA 4QOZB 4LF4J 4ZVGA 2NSCA 2KL8A 5L1KA 3KG1A 3PSFA 2ASLA 2R7YA 1HBOB 2CJ9A 1TZ0A 2EVZA 2LLZA 5T7BA 2C28A 3MD3A 1H0HB 5DDPC 5DMRA 2LSNA 3VETA 3TAQA 1OIAA 1YHQS 3DOKB 3CG7A 3KD1E 3MPDA 1RBTA 5DG9A 4B3TJ 2C2MB 2VQFF 3V6KA 2QC3A 1J5EK 4OPHA 5DZ7A 4OHVA 2FBTA 3H5UA 4CESA 2AV5A 4JKDA 3HULA 4LF8F 4TVAB 3PHTA 1KVIA 2GV9A 8AT1B 4DR4J 1QQCA 3JAMY 3W5YA 4CLZA 2VJUA 1U6BA 3ILIA 4HLBA 4UTGA 4DF4A 1KONA 2RVJA 3FZHA 4PABA 3QEWA 4E8UA 2VFTA 4CJ5A 3SSQA 2DGQA 5BR8F 3NEKA 2PIIA 3PX4A 4O23A 5L9NA 1RT1B 2MQMA 2ZD1A 3D7EO 3DXSX 2Z0GA 1YVNA 1I1GA 3HP9A 4OIXA 2HGLA 4NLRA 1WUUA 2MPUA 4DV7J 4DCJB 3UIQA 4EFAC 5D3GB 1TYQA 1U09A 3TYTA 1U1LA 1RB0A 1EP4B 2NRXA 4YB6A 3LL3A 3W2VB 2MQLA 5AQNA 2DPIA 1TFWA 1D8ZA 2PT0A 3HM8A 1VBKA 4FDFA 2JEJA 3DRPA 2OJ3A 4DQQA 2HNDB 4ISFA 4ZLNA 1V9OA 2H3EB 2RU9A 1WSVA 1UFWA 4OZ0A 4ES1A 2GJ2A 1NSKL 4CIEA 5L1LA 1VSJA 2ZH9A 2GS8A 4RU9A 3OXGA 2E1AA 5D8HB 4J90A 3RGIA 4JKAA 3VAFA 2KVQE 2PFUA 3UD3P 1P90A 2UUAF 2UUBJ 1RT7A 4M5LA 3DFEA 4J5OA 4CEOA 2IC3A 1UA1A 2HS3A 4HR2A 4LFCF 3VAJA 1X4BA 3QT6A 5HQLA 3BB5A 1EARA 2Q3SA 4U67Q 4IOCL 3B78A 4FJ9A 1RQ0A 1U2VA 2LYVA 2ASJA 1UWAA 2VASA 2EFQA 2BMBA 4I2PB 3IAM9 5F8NA 3T5KA 5KFNA 4WFBQ 4DV5K 1D0EA 4NA1A 2MQPA 2MKKA 3R5DA 4ZDNA 1IUJA 3THVA 1EX8A 4C6AA 4Z4CA 2VPYB 5DM6Q 2M3DA 1VMBA 5H9EJ 2QWOA 3D0PA 4M7YA 3QESA 2PAVA 2IAJB 3CJ7A 3Q7BA 3QT7A 3U27A 2E1ZA 5JUMA 4JI7K 3GFHA 4DLEA 2XYPB 1SIWB 1WD6A 2KXFA 3T3FA 4ZITA 2A2DA 1OY9A 2QYGA 4ES2A 2EHGA 3BQ0A 1S1XA 4CE9A 3D4JA 2KJWA 2OELA 2EFGA 5KPRA 3HK2A 1N33K 1BQNB 2DR7A 2E4LA 2GIFA 5FPEA 1HR0K 4PG6A 4WWSA 1KTVA 4ZS6A 4CD1A 5IV3A 2HWHA 2QMWA 3PTWA 2HVDA 2XI2A 1RAOA 5DG8A 5TKWA 3M8PB 2AZ3A 4Y65A 1QHAA 1VSLA 2RB7A 3DKDA 5AZJB 2UXCF 3ZT2A 3CUNA 1F9HA 1RAHB 1NKEA 3BO2A 4LBPA 2FSKA 2NRVA 3FCHA 5BYRA 3HTVA 4U96A 4H54A 4B3MK 4CM2A 2EI5A 3AVGA 3KNGA 1YAGA 2BW7A 4DMNA 4JAXA 1XMQK 1FT8A 5M2RA 4YFUA 2PI5A 4ZVUB 2LXFA 5KG7A 3D0HE 4FJIA 3MWPA 2MHEA 3QIOA 1K8AO 4J9OA 4P75A 1C1CB 2L9NA 2HWTA 1HL6A 1IBMJ 2LFVA 5IC6B 2CWKA 3BZCA 4NXMK 2KU7A 1ITGA 1N56A 3MDFA 3G6XA 2AGPA 3NAEA 1FJGK 3Q8SB 4ELVA 1O13A 4TSXA 4FJXA 2HFNA 3T7ZA 4WF9L 2K8GA 3VVTA 3O1WA 2M2BA 4B3RJ 4MK9A 3EE9A 4CF1A 3EGVA 1S9GA 2YX1A 2B5JB 2W2OP 3CF5L 3T69A 4FM0A 3IFEA 2DR9A 4WYBA 4LF6J 2OKQA 3MN7A 1HARA 2DIVA 4J9UE 1SJQA 2IOCA 4CJQA 4ECQA 1CPZA 1S6UA 2ZE2B 3D6RA 1S48A 2SXLA 3M3ZA 3EUNA 2M88A 2OHDA 2V2QA 2ZNZA 2VICA 2OSRA 3DHWC 4AH9A 4Y1DA 4PY5A 3MWBA 2BBEA 2I2YA 1QZ6A 3PFEA 3SDEB 2MHNA 2F8EX 3UR3C 1CS4A 4J2BA 4LBIA 2IVFB 4EAHD 3O9SA 3K5OA 3H5SA 5DDRC 1FI4A 2R7QA 3NWRA 2DCUB 2AYEA 3WXJA 3DLGB 4AYBD 5GVQA 2DFEA 2IFXA 4CDIA 1RTDA 4PG7A 4WP3A 2A3ZA 4ZJOA 2POKA 3VQBA 3TUJC 3LP0A 4A59A 4FVCA 4N7TA 3TWHA 4RLEA 3BR9A 5CAAA 3MN6A 1R6VA 3C15B 2KRBA 1XWLA 2AQ4A 3HRGA 3E51A 4OZ2A 4KRWA 3IGVA 2BJ3A 4WFYA 4GV6A 2RRAA 3OXFA 1JWWA 1ITPA 5F9LA 4QWCA 3M1VB 1ASUA 3IFRA 1ZM4A 4CEQA 1VQ4S 4I6MA 1B7FA 2V7YA 4A2AA 3A5OC 1XR7A 2LQ5A 4TLRA 1I94K 1ZC6A 5ETVA 4MYTA 3POTB 1VBYA 4RKUC 4Q8EA 4JKEA 3A5MC 3A2FA 4HHHA 4CJ4A 5GAGU 3NF9A 1GTHA 4NCAA 2YNIB 3A3PB 1LWCB 4PWWA 5SWMA 1YTUA 3ILJA 3FMWA 4FJ7A 2E66A 4O0NA 2R7XA 2I7PA 4QWEA 1N54B 5EVZA 1RBLA 2FBXA 1VAZA 4CHZA 2HMIA 5FPMA 1NJXA 1YJNN 4H4MA 4FWQA 2BUNA 4IUFA 1Q1KA 3MM5A 3OYEA 3EYZA 4JI6J 3RUBL 3P1GA 3AO3A 1U1MA 1D3WA 2P9SB 2ZVIA 1K1QA 2RHSB 3V9SA 1IBKK 2XCPA 2RDIA 3QO9B 1BWEA 4CH1A 1T9TA 4X4TA 4CHNA 2HQIA 1NBEB 2HNYA 3QQCD 1E4GT 3QGPA 5L8RC 2VA3A 2XLKA 5KFVA 3LP2A 4A5AA 5EWFA 1TVRA 4K59A 4KO0A 1NPKA 1SC6A 4A8QA 2R7SA 4ZP6A 1E6YA 3M6UA 1EETA 1MMLA 3SI6A 5DQGA 5IOLA 5JS1A 1U1OA 1IBLF 5CZ2A 4JYAK 4H0VB 4O3RA 4YQWA 4DQPA 4DTXA 1QQNA 5DM7Q 1GOCA 4JI5F 1IKXA 4DV4F 3TABA 4NX9A 2O5DA 3W2WB 3VQDA 3OBWA 4WCEL 2W4PA 3G87A 3KOAA 3KLIA 1X5SA 3MUTP 1FNMA 1CZBA 4BQZA 4DUZJ 4NLVA 3UKUA 3HPOA 3OTOK 3T1YF 1FTRA 3TTFA 2EG2A 3CD6N 3RBEA 1VK3A 4N47A 4IOAL 3PYGA 4AT1B 3VCDA 4JV0A 5JVHL 2HGMA 3WIUA 4FLTA 4QAGA 1FO1A 4RNHA 4K4XA 2CZ9A 3V9XA 4YOXA 1J53A 3THWB 2H4YB 2YKQA 5F3ZA 1P8ZA 4G9ZA 4NZ0A 5KT3A 1YJWN 4BDYA 3A3NB 1S5JA 3ZYYX 3CCLS 1GOBA 1VYAA 2AHOB 4NEZA 3Q8YA 4CGGA 5DDQC 4B17A 1HX1A 1S1VA 4CZJA 4ZPDA 3NE6A 1RTJB 3PHEA 2IMWP 4OZJA 3US5A 2OTLN 1MA9B 3M2VB 3R5JB 1TGOA 4BBYA 4BR5A 1QD1A 4ZA1A 2OA8A 3ULEB 1U2FA 4Y1CA 4H4KC 4MO5A 4C9DA 3CDUA 3ZT4A 3NMAA 4MT1A 2KM8B 3JQKA 4CEFA 2WUSA 3FVYA 4KC5A 4NI2B 3OXLA 3R7SB 2QEXN 1S6PB 5E5NA 5LL6d 1W26A 3CD6S 3ITHA 4DV6J 2R8HA 5TKYA 2HG4A 3R5CA 3OL6A 2X1GA 2M8HA 4J9VA 4K2JA 2ZH1A 4FP9A 3W64A 1WF2A 4YR0A 1NHKL 2CIMA 1QLNA 3CGIA 1X4GA 2DNLA 5C2CA 1G7CB 3I6PA 3TU5A 1HQUA 4K8ZA 2DCLA 2LU1A 1PC4A 4YORA 2B9YA 2AP6A 4O55A 4PYAA 1JLBA 4E1JA 2W7PA 2RT3A 3CFRA 1XHXA 3BBBA 3C66A 1MWZA 4A8KA 2OTLS 4I6AA 5JICA 5BR9A 1S1TB 3A4TA 4C0BA 1LW0A 3G6ES 3J7YP 3OW2R 4KI6A 3QLHA 2JLFA 5KFJA 4AF1A 4WTOB 1U25A 4X64F 2ZHOA 1VS3A 3Q8VA 2E2NA 3ZETB 2F63A 4MJKA 2QA4N 2IJRA 4ZVPB 2MKHA 5CQGA 3O2IA 3VQAA 1CC7A 3GFXA 1RWKB 2UUWA 5M1PA 1BQMA 3MM8A 5AJ3K 4CFBA 4IOXA 3GMGA 1UFLA 2D3OR 4Q44A 1U0HA 3K0JA 4ED5A 4IH6A 2UXBF 2VQFJ 2ROPA 4H4KA 1N5SA 2DBBA 1Y5NB 2RE2A 3KJQB 2IM0A 4ZVRB 2VBWA 2ZVSA 1URNA 2X7IA 3PV8A 1H98A 4LBHA 4LF8J 5EU7A 2Q3PA 2GGPA 3R97A 2YCHA 3RSEA 3MCSA 1UVIA 1WEZA 2W9AA 4QYZK 5HP1A 1X1PA 1H2TZ 1R31A 3VVUA 3VF2A 5BR8J 2AP1A 1ZM9A 1XNRJ 2QA4S 4BRHA 2XZTB 1NDKA 1NK7A 3FEYB 5IT4A 4YOVA 3CJ1A 2Z1IA 5GINA 4DV0K 4LF7J 3EWGA 3WQUA 1V5VA 4B1ZA 4N8OA 2O4IA 1U26A 3P45B 2Y8WA 3LAKA 3IRXB 4KB7A 3A8KA 4CGIA 1T3OA 5CD4H 4ZCKA 1EWRA 4A62A 3K5PA 3KJNB 2FJEB 3MMCB 4CK1A 3AOBA 2A0FB 5LJ3Y 2XSFA 3BKUA 3VGVA 3UKRB 3IAS9 5CZ1A 1YK9A 4AHCA 4CF0A 3RAMA 4ECWA 4ID1A 3KLFA 4Q0BA 3TVZA 1ZBTA 3K5LA 2HQGA 4K0KF 4MK8A 3MURP 1Q9YA 5KG5A 3AO4A 3MEEA 3I0RA 1WDTA 2XY7A 2VG6A 3DYAB 2MLYA 4X62F 1RUSA 3OS2A 3O4WA 2NUHA 1KLMB 1KLNA 2C3OA 2OPRB 2WVFA 2XSJA 1N6QB 3IUCA 1M1HA 2G8KA 2MTLA 2UUCF 1CJTA 4LF1A 4ECSA 4GVBB 1OWXA 2UUAJ 2JC1A 1S7IA 2L9DA 4AL6A 3EO3A 3EVWA 4M5DB 3MR2A 2LP4A 5JMNA 4LFCJ 3R5BA 2JEFA 1Y4ZB 2MKIA 4IDKB 5DLGA 3GTYX 2HWIA 3KKRA 3V81A 2A10A 2Z1HA 2F65A 2ZGZA 4DKWA 2D1KA 2YX4A 1Z2LA 1MG7A 1IKWA 3PX0A 2D0AA 2X74A 3CXCR 1KVJA 4JI3F 3HKWA 3MMJA 5DETA 2O8CB 3R6MA 6FDRA 1NHUA 5KPZA 3KK7A 1VK8A 4K4ZA 5BRFA 4QOTA 4RUAA 3ZTPA 1Y7PA 3V2UC 2A40A 1I6JA 5LL6Z 2XMKA 3RZAA 4LR9A 4HACB 1YTYA 2G13A 2XMUA 5GMDA 1SJ1A 4FS1A 3ZZPA 2XM3A 4ZJQA 2YHWA 4CJRA 1S9EB 2J6TA 3ILLA 4RNOA 4CLUA 3M2RB 1SKSA 4G1QA 4B1WB 1KBRA 3GE9A 3GZ7A 2XNRA 5C15A 2VDHA 2G2OA 4I68A 4YY3F 1QUPA 1CULB 5ETMA 2ZC3A 1JLFB 2KKHA 1VQON 3GR1A 2QYCA 2EPIA 2M52A 3H8YA 3OJSA 1D1UA 4YOUA 2OYQA 3U3YA 1EJ7L 1RBUA 4FKXA 3V4IA 1OVQA 2RF2B 4CH7A 3QEXA 5G0RB 1S5ZA 2BJ8A 1RGVA 2VODA 3NFAA 4AUKA 4CHOA 2UXCJ 3GV5B 5ETSA 1RDCA 1IKYB 1YITN 2IM2A 3SUPA 2F7VA 2N4CA 3K58A 2D0OA 2U2FA 2GHPA 1X9WA 4CIOA 4JEPA 2CQDA 2OH2A 1QAXA 2PA3A 3VA3A 3PIOL 5HO4A 4QQBA 3TAMA 1HHTP 3PRBA 3IMQJ 2YKNB 1WEXA 1W97L 4U95A 3L4IA 5D4LA 4QU6A 4OZNA 3OJUA 2PBDA 1PJ6A 3N9UC 2KT3A 5HMXA 4DB3A 1FRMA 3D3CJ 1N36K 2NR0A 2HFZA 3TJ8A 4A48A 2IBKA 1RAFB 2AEMA 1QHTA 1Q53A 4U8VA 4LRAA 1LEOA 1O6XA 4BC9A 1C0FA 3SCLE 3I5BA 4HL9A 3CCWA 4KAIA 4DR7K 1KP6A 1QSSA 4J37A 3PSIA 5HATA 2VC0A 4JI2K 3LP1A 2NXUA 3K7RA 1NDLA 3EM1A 4PR6A 1FDBA 3MCOA 4WF9Q 2MQQA 1JXEA 1TL1A 3NG8A 2NZTA 1RDDA 3NNHA 2GCFA 4CBXA 5GAGI 4NLWA 5BPNA 3M8QB 1HBMA 1CEZA 1FRLA 2O4GA 1HI1A 3R6GB 3V1QA 2JEGA 2ZF5O 2D5RA 2B6AB 3LO3A 4RPFA 1FJCA 4H0PA 2Z2MA 3CF5Q 2YNGB 1P27B 1WNEA 4ECYA 2BJEA 3E3XA 4RU2A 2VYPA 4CYUB 1UEVA 4FLYA 2R7RA 2VZ9A 3MPUB 1UKUA 2ZH6A 3C65A 4YR3A 3QICA 3KMQA 4UF4A 4YS2A 2VWBA 2KG1A 1PC5A 2IIHA 3QGGA 4O0IA 2YH0A 3T9NA 4HDGA 2Q6BA 4V19S 3JAMU 4CM0A 2E7WA 3G0ZA 3KWGA 2K3KA 2O67A 3I4PA 4QYRA 3UCGA 1LWFA 1G4CA 4RR5A 4NASA 4R0JA 2KZMA 4W92B 1KHVA 2G8FA 1JLEA 3W9IA 2NQPA 5M1KA 2W9CA 5AXKA 3AFGA 4CJ3A 3CCSN 3OLBA 1W7WA 1N34K 4K43A 3NH1A 2FJWA 1TUWA 2FC8A 2YNFB 4J9SA 3AOAA 3HL8A 2RQMA 4PG8A 3RRKA 2CNKB 2IS3A 3WXKA 1SQGA 3M5RA 1RCOB 2OEKA 4IJAA 3HZGA 3R27A 2OFHX 2QKBA 4E7HA 5M2PA 3RAXA 4I67A 4OYOA 3GIKA 4DSEA 2FLNA 1WC4A 4E19A 4CLWA 1RT2B 5IWAK 4X4UA 2GIRA 4ECZA 4DSLA 1YJTA 3H1QA 1C0TB 4X4PA 2P1JA 1HNWK 5DQIA 1GH8A 3H59A 3QFHA 1RP5A 2RRNA 3D66A 1U1PA 2CGJA 2VB6A 3O5TB 4IQMA 3CCZA 5LOQA 1NKBA 2X78A 1OMSA 4MFBA 2FJDB 3Q7CA 3U8XA 2YX7A 2O8EA 4Y6IA 2A41A 4CQ1A 4J2AA 3BN4A 3IG1A 2ZC4A 2W8LA 5D15A 5BPLA 4B9QA 3ADAC 4RW7A 3PKYA 4IR1A 3I33A 1S6QB 3LOUA 2IVNA 1T9UA 1NK0A 2GQQA 4UOFA 1ASVA 1WELA 4ECTA 4B1XB 1WG4A 1C0MA 1D4XA 5T7LB 4ZCLA 2UYTA 1PYOB 4KHYA 1YKWA 1B70B 2CQ0A 4PL7A 3KHHA 3PYFA 4BC7A 3CTRA 5M1NA 4KHQA 1X60A 2DGSA 5LSLA 3CJCA 4JRQA 3FJ2A 2O8BA 1F5BA 1XERA 3N4PA 1HWKA 1SL1A 2FJBB 3KLGB 2BM1A 2XMWA 4JI7F 3M6GA 4MIAA 1IBLJ 4USMA 2JH3A 1UA0A 3LALA 2QKKA 5I3PA 4MAKA 1OKJA 2J9DE 1VSMA 4XH4A 3VQ8A 3MEGA 1MWKA 2PSZA 4JI5J 2QSFA 4DV4J 3VEXA 3MEKA 2FC0A 1A6LA 1N33F 5A8WA 3LPEA 1VBZA 4PKDB 1HR0F 2QWQA 2D41A 4L3QA 4BR4A 4ZN1A 3PW5A 4WYLA 1EXQA 1BOTO 4USJC 5BN9A 5E2QA 4JRPA 3T1YJ 4GVMA 5F8HA 1FKAF 3O80A 1FFSB 1S76D 3DM2A 3DDNA 5K8OA 2P9PB 2DNOA 2XCAA 2ROEA 1UTAA 1T9XA 3U9DA 4LFAK 3H3OB 1NEEA 5HJYA 1VQMN 4HT5A 2AX0A 4K25A 3OVSA 2FGOA 1HIYA 2ASPA 3HHLA 4EFHA 2YKAA 4PXCA 3CJAA 1A7GE 3M9MB 3ZTRA 2JGUA 4IOAQ 2GFFA 5IT0A 3BQ1A 4ED3A 3PNIA 1IN0A 5JVHQ 4RWXA 1M90T 1T6DA 4PKIA 4AHSA 4C3MA 2N4DA 1XMQF 1SH2A 4DU1A 1ZAWA 3D2FA 3VZIA 1UAWA 1YBUA 4QZVB 4C98A 3IBWA 1PJ5A 2BANA 3DRYA 2FC9A 2HFOA 4M45A 4K41A 2AJFE 5F8IA 1R0BG 2V8VA 3VAHA 5HVGA 2BOPA 2EWHA 3HJFA 4IRKA 4NXMF 1MN9A 4USWA 3CDEA 5FDLB 1FJGF 3KIOA 2GO8A 2HRYA 2GUPA 3SCJE 1FK9B 1VQMS 4OI6A 5J2NB 3TJAA 3J81Y 1OH5A 4MIWA 4JI4K 2MSTA 4EZ9A 2CPJA 3BKTA 4KFBB 1H7XA 1D5AA 3ZX0A 4CHPA 4CJKA 3EZWA 3BV8A 3SQGA 4ZK7M 2OMOA 1Y0HA 1BD6A 4IWVA 2HHQA 4CGHA 2MDAA 1E6VA 3ENHA 1MMDA 2ZM6K 4C8ZA 4KKOA 5KFTA 3NBPA 3FZMA 2V68A 1RADB 4TN2A 2AT1B 4XTTA 3OQ2A 4V1Ak 5RUBA 3B6PA 3UE2A 4X64J 4MDBA 3OTBA 5F2RA 4BWJA 5AXLA 4YHHK 4W5NA 4EK2A 2IM3A 5D4PA 3BJYA 1NUEA 4QR2A 5LSOA 4PXBA 1SKWA 3BP8A 3DGPB 4FLUA 4ZP7A 5KG2A 3Q83A 2UXBJ 1RKIA 3QGHA 4WZMA 1B4SA 1NDPA 1KC8T 2W4DA 4KJIA 4TKTA 3L4QA 2JEIA 1OH6A 2V4QA 1AT1B 3BY5A 1RNHA 1W9HA 4DR3K 1NGDA 3DXKB 4E1NA 3GIIA 1N32F 3M8RA 3L3UA 3L3CA 4WXWA 1FDNA 2YV0X 5K14B 2N82B 1HNIB 3MM9B 2EFOA 4B9NA 2CPDA 2R7WA 4H0XB 4KPYA 4JV1A 3C7NA 3CCRN 4JKBA 3HF5A 2W9BA 3ZO7A 3EGWB 4GKKK 2V51B 4DV3K 4M5MA 4E98A 4NYPA 4J9RA 2M4MA 4ZP9A 1RBSA 3EZOA 2U1AA 4QPTA 5A6PA 3MXIA 1I94F 2VJVA 1GEHA 2HNZA 2XNQA 1U45A 2C2EA 3KLEA 2HHSA 5AR0A 2DGXA 1VSIA 3IWNC 4D3HA 4DDFA 1S12A 2IPOB 4DR6F 2WVEA 3HX9A 1KRPA 4DLGA 1N8RO 2AZ1A 5KFGA 1GK8A 2J76E 4QIWD 1QTMA 2LECA 1YZ6A 1AROP 3MPYA 3RR7A 3DWLA 2PEBA 2ACYA 2B9XA 4BGAA 1XIQA 1N0VC 4K0KJ 4F2SA 2I8EA 4C0OC 3A8EA 4OX9K 4I2QA 1IBKF 2KH9A 3IR6B 3GFYA 4X62J 3QMLA 2D3O1 3I32A 3CCRS 1JJ4A 3AT1B 1DY3A 2PGCA 4FYDA 1D09B 4OZLA 3CCTA 1SIZA 4DG1A 4JS5A 2X6SA 1Q16B 3KDNA 3DMJB 1PG5B 3TTDA 4A8XA 2UUCJ 1LK7A 4BE2A 2DD8S 3VHQA 1AZSA 3B54A 5EOYA 4JI8K 4WJBA 3MR3A 3HD2A 5L46A 4LY7A 4H4OB 2O66A 3HVRA 4NRUA 1T11A 3E01A 1PSDA 2I6WA 3K17A 3ENWA 1S1UA 1WG5A 4K7QA 1SS6A 4IFYA 4PKHA 3O9RA 1BCOA 3LDQA 5HL7L 1K1SA 2P6TA 3A1YG 2E1MC 3CJ2A 4GMKA 3Q24A 2DGWA 4OV1A 4JBCA 1R8PA 5AQWA 3FSYA 4I4BA 1JLGA 1YJ9N 3OTOF 3IMXA 2EW9A 4JI3J 3HMJG 1HHSA 2CNNB 1RT4B 2P9NA 4IFVA 1KEKA 3E9LA 3AD8C 3MMBB 4DR1K 3LPTA 1FXRA 1TP7A 3WNFA 1R0AA 4Z7YA 3TAFA 1WHWA 3S6EA 1TV6A 1WDDA 3KJFB 4KTWA 2RDJA 1FW6A 2J7KA 4DTJA 3OYNA 2XWXA 1WAFA 1JMTA 4ECVA 4YOWA 2QJ3A 1J9AA 3MDQA 4OFZA 3VAGA 2C2OB 3D6FB 4CZLA 3GSDA 1ASWA 2FF3B 3EJMA 1DTQB 1MNEA 4LIWA 3N4WA 3DLRA 5AQTA 3UFCX 3UR0A 4YY3J 2BRLA 4DUTA 1YLXA 1O51A 2FHJA 3ET6A 2QTWA 3SUOA 1XI1A 3DRPB 4UUXA 2UU9K 4U9RA 4OX8A 1TKDA 4ANDA 1YWXA 1YJ9S 1B0PA 3RR8A 3W3DA 2A42A 2XMTA 1KD1T 4IG3A 2NRTA 4DL6A 1BDGA 4IO9L 4YDUC 2P9UA 4DL4A 4HVJA 2HRTA 3CIZA 2Q0UA 1LXJA 3PW0A 5IS2A 5CA5A 2BRKA 2HF3A 3JXUA 1KSPA 4Q5VA 2MYFA 4P73A 1RT7B 2YTCA 1VQ7N 1QZ5A 1P8GA 5LXRA 3THTA 4EBDA 4BRIA 2OGUA 1DGKN 3A8IA 4ECRA 2D7SA 1RYRA 3JSMA 1NU4A 3HCXA 3RB3A 4W90B 3G82A 4DSJA 1K8KA 4PZVA 1KVAA 1R59O 4L76A 1U2VB 3BEGB 4LF5F 1H74A 1HFEL 2HURA 1X7VA 3B4MA 1RI7A 1WTFA 2AMCB 4ILRA 1O5JA 3NGIA 3FNNA 3OHAA 3C8YA 4AQYK 3Q8UA 4FVMA 4WU2A 4YUDA 3D9BA 1X8DA 2OZSA 2YKOA 1KN6A 5K9FA 3SNNA 2Q43A 3H4BA 4B9VA 3AODA 1YJ7A 5AJ3F 2I0XA 1O8BA 2ZH4A 3QJPA 4JHDB 2HBQB 4HTJA 5CCMA 4ZN3A 2QL9B 4DX5A 2UZAA 2X3DA 1VQ6N 3JXOA 1VQNN 4W5QA 3CMQA 3N28A 1J5EJ 2UV8G 2BJDA 1JK9B 1C4CA 3BGRA 1VQ7S 2P9KA 2HBMA 1MWYA 3TP2A 1ROFA 1S1XB 4BS2A 4FPIA 3V9UA 1FEHA 4KV8B 5M2UA 1N5VA 1CZAN 5K20B 1PBUA 1ZS6A 4YDUA 5I3UA 2CQ3A 1JIHA