1JLAA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
553
structure length
546
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 140
structure length 546
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlaA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlaA05
4J9RA 1HRHA 1LWFA 4CJWA 2G8HA 3LP1A 4CJEA 3K5MA 5F8LA 3TQ1A 3S9HA 4EBEA 4HUEA 1T03B 3IAYA 3EY1A 3DRRB 5DMRA 3DDKA 3UR0A 4NCBA 2XY5A 1J5OA 4KHQA 2QKBA 3MEEB 3NCIA 4NLXA 3NF9A 1U09A 2OH2A 1RDBA 4FBTA 2YKMB 1JLFB 4NRTA 5KFXA 4Y34A 2C2DA 2XO7A 2YNIA 2YKNB 1S10A 2XWYA 1T05A 3MR6A 2IS3A 3OS1A 4DLEA 3E01A 1S9GB 1SV5A 4ZVGA 1WAJA 4FJMA 4IR9A 3PV8A 4E1NA 3K59A 1JXLA 2YNGB 2HAIA 1X9SA 3D5MA 5CYMA 2GIQA 1TP7A 3GV8B 4ZPAA 5F9LA 4GW6A 4DL4A 3AO4A 2D5RA 3EPGA 3AV9A 3KMSA 3LP0A 4Y2CA 4I2QB 2G8UA 4TY8B 1TKTB 4ECYA 3ZSOA 5KFAA 3QINA 3T5HA 2W8KA 1C1BA 1JLEA 3PHEA 4YP3A 2UUTA 4DQPA 3TWHA 3DRPB 4I9LA 4CERA 4FCYA 1S1VA 3QLHA 2C2RA 4E19A 4NLSA 1S0MA 3ZT1A 3KTQA 4IFYB 2HNDB 2HWHA 1RT5A 1KHWA 3CJ4A 1NK0A 3KHGA 1BQMA 3MEGA 1SKWA 1D0EA 4BE2A 1NK4A 1Q9YA 4CGIA 4ED0A 2G8FA 4XPEA 3OSPA 5CY4A 3OYFA 3K2PA 2JLEA 2P5GA 3OJSA 4F4WA 4X2BA 1W9HA 3ITHB 3RMBA 3IG1B 3OHBA 3QEWA 2JC0A 2F8TA 5KFVA 3EZ5A 3B6PA 1HYVA 4KKOB 3DRRA 3ZCMA 5DG7A 2X6NA 4LD0A 3JYTB 4CGDA 4B9UA 3KHRA 2YKMA 5J2PB 1JLFA 4ECVA 4NLPA 1J54A 4W5QA 1QUVA 1LW2A 1L3SA 3MXJA 3O4QA 5J1EB 5C5JA 3EPIA 4NLYA 2RKIB 1S9GA 2E4LA 2IM2A 3LPTA 3DMJB 4RW8B 2FC0A 4B9TA 3SV4A 1RBTA 2WHOA 3GIIA 3BJYA 2W8LA 3QEPA 3DYAA 4FLWA 1N5YA 2YNGA 2XC9A 2HHTA 3PY8A 4FZYA 3KK2A 5KFQA 4NYNA 1I39A 2KZZA 4RW7B 3VQCA 1RT2B 1U47A 4BE0A 5EDWA 2OPQB 3U6FA 4KV8B 1QAJA 4I2QA 4CJTA 3ZT4A 4BACA 4TY8A 4Y3CA 1GX5A 2AQ4A 4YR0A 4HUFA 3D0PA 4EO8A 4CHNA 1N4LA 3IS9B 5FRNA 3HKWA 4FBUA 4Z4FA 3H40A 4K4VA 2RF2A 3VQSA 3H4DA 4F3TA 3DRPA 1QSSA 4CCHA 2E9RX 4LSLB 4CK3A 2BANA 2XI2A 4DF8A 3TAFA 4FJXA 4IFYA 2HNDA 1BIUA 1RILA 2WB4A 3OL6A 1D9DA 4NLTA 4M3ZA 4OLAA 4QW9A 4E7LA 5JS1A 3QESA 1T7PA 3F9KA 5T7BA 2VG5B 5KG2A 1TGOA 5KFBA 2C22A 1GOAA 4CK1A 2BQUA 3KK1B 3KD1E 3RTVA 4CEBA 3DLBA 3ITHA 1JLGB 1RBUA 3OYEA 1NK6A 3IG1A 1IO2A 1KHVA 3V1OA 1NHVA 1L3VA 2PY5A 3DLEA 2OZMA 4GC6A 3KIOA 4K4SA 4NLVA 3NKYA 2QK9A 1S1XA 1JLBA 5F8JA 3VQ9A 2JGUA 2R8JA 1VSLA 3HP6A 4DQRA 1KLNA 3V6DB 4K4YA 3ZSXA 1TQLA 4ZPDA 5J1EA 4KAIA 4AHTA 3HVRA 4ECRA 4NLDA 5KT2A 1XC9A 1YT3A 2RKIA 3PUFA 2IJFA 4YNQA 4R5PB 3DMJA 4RW8A 1UA1A 3V6JA 4QWDA 5KFJA 2IBKA 3NGZA 3CJ3A 4WYLA 1JX4A 4FM1A 5HRSA 3HXMA 4DLGA 4MK9A 4OGEA 4DU3A 4BWJA 4F4KA 1RT2A 3PR5B 4RU9A 4KV8A 3K5OA 3LZIA 1S6PB 4U7CA 4WZQA 3ISND 1LWCB 4KHWA 2BGGA 3BSAA 3H2LA 1TKZB 3FQKA 5KFMA 1BHLA 3SZ2A 4DSJA 1FKOA 1L3UA 1ASVA 2UVUA 2ZE2B 4IFVB 5SZTA 4DTPA 1HMVB 1VSJA 1BL3A 1JIHA 4TQSA 3OYNA 3KHLA 4KAZA 4LSLA 2YHAA 3KD5E 4CJQA 3CFOA 4FJNA 1Z4UA 4F50A 2IA6A 4CECA 4RW4B 4ZP7A 4FLVA 1NOYA 4LY7A 2ATLA 1EX4A 1REVB 4KTZA 5EWFA 4CE9A 3M9MB 3HYFA 2B5JB 3CFRA 4ZHRB 4FLTA 1IKWA 3OYLA 4B9LA 1RNHA 1S0NA 4TXSA 3I5BA 1Q9XA 2IM3A 4NYZA 2OPSB 1B92A 5L1LA 1NJXA 2OZSA 1NJZA 3LAMA 3BDPA 3P83D 3HVWA 4URQU 1BQNA 3KJVB 3KK1A 5F9NA 3LP3A 3TAGA 1JLGA 4F4ZA 5I42A 2B43A 1MU2B 3AO5A 5KRSA 4DEZA 4OKKA 3PR4A 3HM9A 3FQLA 2GC8A 3AA3A 2WONB 3VQ6A 4DTXA 2FJVA 5KGXA 4CJKA 4HKQA 1TKXB 1FKPB 4BDZA 3QNOA 5EUHA 3BSOA 3NF6A 2JEJA 2PYJA 4FLYA 3MEDB 3V6DA 3OL9A 2XI3A 4ECSA 3V9WA 5KFSA 4Q8EA 2HNYA 1QTMA 1EKEA 1RT6A 1XR6A 4YFUA 1HNVA 5I3UA 1XR7A 4R5PA 3TABA 3NF7A 4AHSA 1KRPA 5KT6A 1RTIB 4B9SA 4N5SA 5DGBA 1TK5A 1S4FA 2IC3A 1R0AB 4HCCA 4FW1A 1BGXT 1WSEA 2QV6A 4QCLA 4DTUA 4ZVHA 2ASDA 5C42B 2GIRA 5HRNA 3GV7B 1S6PA 1X1PA 1LAWA 1Z25A 2DY4A 1LWCA 3FSIA 1TKZA 2XGQA 1VSEA 4IQXA 2KW4A 1ZTWA 4IFVA 2FVRA 3SUPA 4BDPA 1HMVA 2KFZA 3SUQA 3ASMA 4J2BA 3BGRB 3SQ1A 4IH7A 4RNFA 4IG0B 3TVKA 2Y1IA 5DK5A 2GBZA 2IDOA 4E1MA 3SQ4A 3OYDA 3VQ7A 2R8IA 2B5JA 4DQQA 3DLHA 4O3QA 2EX3A 4ZHRA 4ED3A 4BDYA 1ASWA 3AVLA 3HJFA 4AILC 3T5JA 1ZBIA 3GQCA 3LP2B 3VQ5A 3L3UA 4FS2A 1VSKA 3VQDA 3ZSYA 1QHTA 4ID1A 3WNFA 3M8PB 3KJVA 5D3GB 1TL3B 4ED2A 1RBSA 4EYIB 4E3SA 4PQUA 4FJ8A 1A5XA 1ZYQA 2B4JA 4MK7A 4O3RA 4XIUA 1MU2A 2UVVA 3NH2A 1TAQA 2RDIA 4DTRA 3I5CA 4CJVA 2UUWA 3PX6A 5KFTA 5KGWA 4CEDA 4NCGB 3QYYA 1RT4B 1D1UA 2WONA 1RBRA 2P51A 4ZP8A 3HSTB 2C2EA 4URSA 4WZMA 4M3UA 2PYLA 4RUAA 2W9CB 2OPPA 3MEDA 4KBIA 3ZT0A 5HP1B 5E41A 3BSNA 3OL7A 1IKXB 4NRUA 1WLJA 3ULDA 2HHWA 4IR1A 1K1SA 4B9MA 5KG3A 3ZSZA 4IKAA 4J9KA 4O44B 2I1RA 3OHAA 1JLAA 1C2PA 4M3RA 4CHZA 1L3TA 2HHVA 5C24B 1R0AA 3O4NA 3QIOA 4OKEA 1TK8A 2G8VA 3MXMA 4B8AB 4IDKB 5C42A 3QGHA 4N47A 3HK2A 2G8WA 3I0RB 5JXSA 2WTFA 4MFBB 5F8GA 3KKSA 3M9OB 4DTOA 4ZTFA 2XY8A 1XHXA 4MK8A 4Z4GA 4AHUA 1N6QB 2ATQA 3BGRA 2F8SA 3NL0A 1J53A 4ID5B 4YQWA 2IJNA 2KFNA 4DTJA 5KFRA 1DTQB 2FVCA 4F2SA 1WNSA 2QE5A 4W5NA 4DTMA 1S6QB 2AU0A 2R8KA 4FJGA 5FRMA 4ED7A 1OS5A 1RBVA 3MAQA 1K6YA 2XRIA 3N6NA 3CO9A 3QERA 1XR5A 3VA0A 4AHVA 2FLNA 4LH5A 4R8UB 3CJ0A 3L2QA 1WSJA 4CF9A 1U48A 4KO0A 1EETB 2ITGA 5KFDA 1TL3A 4I2PB 4WE1B 1WSFA 4IRDA 1C1CB 2DFHA 2W7OA 4FJHA 3QO9B 4Y2AA 4W5OA 3AVBA 3ICLA 4RNMA 2J6TA 4J9PA 4NCGA 2X6SA 1RT4A 3MR3A 4CF2A 4IRKA 3ZSQA 2VWKA 4DL6A 4YR3A 5KT4A 4CFCA 1ZBLA 4FLZA 3V9SA 2BRKA 1JLQB 2W9CA 4KI6A 2FVQA 5HBMB 4LQ9A 5KG4A 3JSMB 5HP1A 1BCMA 4G3IA 4JS4A 1RTDB 3HPHA 3RBEA 1CZBA 3OYMA 3F73A 3KLHB 3SI8A 4ZTJA 3OYBA 2BE2B 1NNDA 4O44A 1IM4A 3NH1A 5HRPA 4WFXA 2IGIA 3AA5X 3K58A 2FLPA 3OS2A 5C24A 3TR8A 4ECQA 1QE1B 4TY9A 4LSNA 1HYZA 2XY6A 4ICLB 5KFUA 3I0RA 4DSIA 4MFBA 1WNEA 1KFSA 4F8RA 4K8ZA 3O3GA 4K8XA 1T03A 3L2VA 4WFZA 2KTQA 4O4RA 4TYAA 3MEEA 2AJQA 2FVSA 3AVHA 4JRQA 4E0DA 4KHMA 4L8RB 2F96A 4ID5A 3ZSWA 2D0AA 1D9FA 1DTQA 1U49A 3RBDA 4DU1A 4DU4A 5L9XA 3AO1A 2I5JB 3OYKA 2YKNA 3IGVA 3PZPA 3RMAA 3GILA 4MQ3A 4CFDA 1C0UB 2ZQBA 3SYZA 3KHHA 4JLHA 1RTHB 3D45A 4AHCA 3SI6A 3BSCA 3CDEA 2W9AA 1RT3B 4R8UA 4TN2A 4MIAA 1VK0A 4ZPCA 3RB0A 1EETA 1SH0A 4I2PA 4WE1A 2XY7A 3LPUA 3QO9A 1IKYB 2ILYA 3CVKA 4C8MA 4B9VA 2AGPA 1I6JA 4MH8A 1TKTA 3IRXB 3VN5A 5KFHA 1C0TB 1KLMB 3PO5A 2RPIA 2FJXA 3DI6B 4RZRA 2RDJA 4QWCA 5KT5A 4EEYA 3KMQA 5HBMA 1HQEB 3JSMA 4K4WA 1RTDA 2JC1A 1QAIA 2FBXA 4FZZA 2IM0A 2ZKUA 1LW0B 2C28A 2X74A 4H8KA 3TAQA 1RDCA 3AA2A 1TAUA 1BIZA 3IGNA 4YMEA 4ZVFA 2Z1IA 1VSHA 4CF8A 3AO2A 1W25A 3BQ0A 1WN7A 4DSKA 2F8EX 1N56A 4RW6B 4N41A 1C0MA 2VG7B 3RWUA 3DLKB 4E7KA 1RT1B 2W7PA 4DL3A 4FJJA 3B6OA 4ICLA 2DFEA 3WNHA 1RYSA 4QOZB 1F21A 4QAGA 1TKDA 3LAKA 1HYSB 4O3SA 3V4IB 4FM2A 2R2UA 3V81B 4KKOA 3V6KA 4Z4HA 1Q8IA 1HQUB 4DSEA 3JYTA 2FBTA 3TAMB 4DQSA 4H4MB 3NGYA 3I0SB 3AVIA 1ZETA 3BQ1A 5J2PA 4HHTA 2OA8A 3UPFA 4B9NA 3OL8A 3GYNA 1K1QA 3H59A 4FS1A 4KB1A 3OLAA 2I5JA 4CFAA 2X78A 2CKWA 4ECUA 4PUOB 3V9ZA 2Z1JA 1RTHA 4M94A 3N6MA 3O3FA 4J9LA 1SL0A 4OJRA 4DTSA 4NZ0A 3MECB 4DS4A 4OPJA 3LANA 4RW7A 2QXFA 3H5XA 3PW0A 3SJJA 4OLBA 1DLOB 1IKYA 3PVXA 2OPQA 5CYQB 3AVNA 1NK7A 2VA2A 1HPZB 4EO6A 4C8NA 4DF4A 1S9EB 1RDAA 4B3OB 1CXQA 3AVMA 1T94A 3ZSVA 1SKRA 3L3VA 1S1WB 1C0TA 1KSPA 5EWGA 3IS9A 4PWDB 4O0IA 1VSIA 3SPZA 3NMAA 2HVIA 4IH5A 4RNNA 1D8YA 3DI6A 3HP9A 2QKKA 3RB3A 3KLGB 2DFFA 1HQEA 4CJRA 4Q0BB 4ED8A 2FLLA 1LW0A 1S97A 2WOMB 3AO3A 4CEAA 3HT3A 2HW3A 3BQ2A 2B6AB 3RAQA 2IAJB 1KFDA 3MFHA 3T5KA 4NLRA 5KFYA 2VG5A 3HO1A 4CJ5A 4OVLA 2RN2A 4RW6A 3Q8PB 2LSNA 1MMLA 2G8KA 2E6MA 3KKRA 1RT1A 3AVCA 4DL2A 2YNHB 1S9FA 1X9WA 3KOAA 3QEVA 1HYSA 1S48A 3V4IA 1CXUA 3VQAA 3T3FA 3V81A 4CJ3A 1HQUA 1VSDA 4ED1A 2D7SA 1A5VA 3OYAA 3TAMA 3U3YA 2VA3A 3EZUA 4U6PA 4JV2A 2BQRA 4QW8A 4JRPA 5DQGA 4GVMA 1TV6B 1A5WA 4FZXC 4DMNA 3G0ZA 4CGHA 4Z4CA 3C94A 4ZVEA 4K4XA 1JKHB 1IH7A 4DSFA 3PX4A 1TVRB 3H5SA 3G10A 1XWLA 3PO4A 1S1TB 4W5TA 3K5LA 4PUOA 4HYKA 4XPCA 4CEEA 1T8EA 2DPIA 3DRSB 1SH2A 5SWMA 3SQ2A 2WRMA 4E89A 1EP4B 3MECA 4CFBA 2YNFB 2EC0A 3RR7A 3NE6A 4EP4A 1D5AA 2BR0A 1DLOA 4DG1B 3RR8A 3I5AA 2HHQA 5CYQA 1SUQB 4PA1A 4UQGA 1HPZA 4H4OB 5KT3A 1S9EA 3PX0A 3QIPB 4B3OA 1L5UA 4CIGA 4M3YA 2E6LA 4PWDA 1NK5A 2O5DA 1DTTB 2ZE2A 3IN5A 2HHXA 5DG9A 3KLGA 3T5LA 3NFAA 4IG3B 2P1JA 2W9BB 1CSJA 4Z4IA 3LP1B 1UOCA 4RW4A 2WOMA 3CM5A 5JS2A 3CDWA 1REVA 3UIQA 1J5OB 3KLEB 4F2RA 1ZTTA 2DTUA 2B6AA 2IAJA 5DQHA 4I7FB 3LDSA 3AA4A 2OPSA 2EHGA 4J2EA 3AVAA 4O4GB 4WYWA 3WNGA 2AGOA 4JUZA 4KHUA 4B08A 4QWAA 2YNHA 4YR2A 5EU7A 4CIEA 2KQ2A 3K57A 4KI4A 4FM0A 4RG8A 4KHYA 4O0JA 4Q43A 3CIZA 3VQ8A 4IOBA 2A1SA 3N6LA 5FROA 3CYMA 4ZP9A 1TKXA 4DQIA 4CHOA 5CYMB 1FKPA 3OYIA 1NK8A 1YTAA 3VQQA 1YTUA 3QZ8A 1W0HA 4NLOA 1JKHA 5KG6A 1KVBA 5KFZA 4R0EA 2HHSA 4ECTA 1S1TA 2O4GA 1C1BB 3NH0A 1JLEB 4Q44A 4CJFA 1RTIA 3RB4A 3RRHA 4NYFA 2R7YA 4DFMA 2R8GA 2YNFA 3QLHB 4ECWA 4J9MA 4Y1CA 4O55A 1RT7B 1ZBHA 2V4RA 3QIPA 1JXBA 3QNNA 4MIBA 5J2NB 2ILZA 2R2SA 4FJ7A 4W5RA 4EZ9A 4OPKA 4CHQA 3L2WA 5CZ2A 4QWBA 4ZPBA 4O3OA 1G15A 4IG3A 3KLVA 2W9BA 4IG0A 5J2MB 5KG5A 1HNIB 2D3UA 3RMDA 3RAXA 5KFWA 3PJWA 3ZT2A 1SL1A 1RDRA 5KTQA 1JL1A 3KLEA 5T14A 5KFPA 1KCFA 3U3GA 4I7FA 3DLRA 3DOKB 4M41A 3LP2A 3QEXA 1GOBA 4TYBA 1LW2B 4O4GA 4Z0UA 3KLIB 3NDKA 3M8PA 2ZD1B 3LWMA 5HROB 5D3GA 4M3XA 3RRGA 3THVA 3SUOA 3C6TB 5FDLB 5DLGA 3OJUA 2HMIB 5J2QB 3OVNA 4CGJA 4E7JA 1EXQA 5HRRA 4M45A 2DPJA 3P5JA 5KRTA 4K4TA 1GOCA 3FDSA 3DYAB 3T19A 1N5YB 3H98A 1VRUB 3KK2B 3QIDA 2AX1A 3SCXA 2AX0A 2XCPA 1KVAA 4KTWA 4ELUA 3OY9A 1C1AA 4Q5VA 1IKXA 2JEIA 1QQCA 1YVUA 4KB0A 4WFYA 2VG6B 3ALYA 2ALZA 2RF2B 1WSIA 3PW2A 2BANB 1ZBFA 1S49A 3QEIA 3UDLA 4KSEB 5EWEA 3NAEA 2BQ3A 4IDKA 1RT7A 4JS5A 5CZ1A 3EYZA 1VSFA 5C25B 4MKBA 3GIMA 2J6UA 4CF1A 3GV5B 4BWMA 5J2NA 4ECZA 4M95A 4CEZA 4PY5A 3Q8RB 1N6QA 1NJWA 3O3HA 3L2UA 2HNZB 2GUIA 4CJUA 3NF8A 2OYQA 3E51A 3NBPB 1I3AA 2OPRB 5J2MA 4QPXA 1HNIA 1RDDA 4OKJA 4KTQA 3BR9A 5KG0A 4MKAA 1S6QA 5DLFA 3DLEB 2Q3SA 4RNHA 3H5UA 5F8NA 3T1AA 3FRZA 1VRTB 3LZJA 3DOKA 1S1XB 3CM6A 5DQIA 1JLBB 3V6HA 3Q8QB 4GMJB 1NOZA 2IM1A 1S0OA 3KLIA 3SUNA 4O5BA 2ZD1A 5HROA 5KFCA 4DFPA 2JEFA 3C6TA 5FDLA 1C1CA 5DG8A 4DL7A 2HMIA 4KHNA 4K4UA 4CEFA 5KFGA 3KK3B 2XCAA 4IRCA 3PW4A 5J2QA 1IG9A 2WK4A 3Q8SB 5K14B 3NGIA 3HVAA 1SH3A 3DLGB 4CEOA 4M42A 1VRUA 4G1QB 5DGAA 2UVWA 1JLQA 1RA7A 3QETA 4J2DA 1U45A 3OYCA 1ZBUA 1QSLA 4TSXA 2CJQA 4Z4EA 4KHRA 3VQBA 3V9XA 5F8MA 3KLHA 1FKOB 4URGA 2VG6A 2FJWA 1C6VA 4C8OA 4N76A 5L1KA 2BE2A 1JL2A 2HVHA 2FVPA 4NLGA 1XHZA 4C8KA 5L1JA 1XI1A 1HJRA 1O1WA 4CJSA 2V4QA 1RA6A 2NUBA 4CJ4A 1QE1A 4J9QA 1UWBB 4J2AA 1IKWB 3CFPA 3HVTB 5C25A 2P5OA 2Z1GA 4EBDA 2ETJA 4FXDA 3S3MA 3MTKA 4Q45A 4XO0A 3KLFB 4DWIA 1BQNB 4JV1A 2HNZA 3MXIA 4O3NA 4NCAA 5KG7A 3HHKA 3CJ2A 4IH6A 3NBPA 3C6UB 5I42B 2KZMA 4M3WA 2OPRA 3SNNA 3FFIB 1B9DA 4FK4A 4KB7A 4I9QA 4RUCA 3UQSA 4FJIA 2R2TA 4ED6A 2PZSA 1C0UA 1VRTA 4FJLA 1SKSA 3ZSRA 1RT3A 1QS4A 1N48A 5KFIA 4H54A 3AVGA 4DFKA 3AVKA 1BI4B 2BRLA 5KFFA 4KFBB 1NKEA 3NAHA 4WXOA 1LAVA 5HLFB 2HNYB 5KFNA 4F4YA 3KK3A 1RT6B 3RMCA 1HNVB 3TAPA 4KPYA 5I3UB 1JXEA 1VSMA 1HARA 4NLWA 3IRXA 5K14A 5KFOA 3L8BA 2YHBA 3SQ0A 3DLGA 1NK9A 1KLMA 2V0NA 4Q8FA 4G1QA 4CGGA 2IC3B 3CDUA 3M8RA 4LH4A 1BISA 3D28A 2D3ZA 4F3OA 3OYJA 4AH9A 2XHBA 3SFGA 1CZ9A 1UAXA 1RCHA 4IBNA 3HL8A 3H4BA 2D41A 4HCBA 3K5NA 4K4ZA 3VQPA 2Y1JA 1B9FA 3CG7A 3OYGA 2VWJA 4EBCA 3A2FA 3C95A 3CWJA 1IKVB 5KFKA 2XGPA 4OGCA 1RYRA 4CHPA 2VG7A 4TLRA 2R2RA 3DLKA 4LQ3A 4JV0A 4ZMMA 1ITGA 1WSHA 4DFJA 3HPGA 5F8IA 4CESA 1UWBA 3TI0A 3HVTA 4M3TA 1LWEB 3ZT3A 3G86A 4Y1DA 1YVFA 3DOLB 1T3NA 3OYHA 3S3NA 4H4MA 3KLFA 3I0SA 4ELTA 1NKBA 2HWIA 3VQEA 3M8QB 3SV3A 3BREA 2HHUA 3MF5A 3C6UA 4PQUB 3PW5A 3DM2B 4KREA 3P1GA 4ELVA 4FK2A 2R8HA 1FXXA 3FFIA 3LALA 4O3PA 3LWLA 3AVJA 4AHRA 4J9SA 4CF0A 3H08A 1TL1B 1RAJA 3NAIA 1TK0A 3H5YA 4FLXA 1RTJB 3OS0A 4E7HA 4EYHB 4HUGA 4J9NA 1BI4A 3G6YA 1S5JA 2OPPB 2E9ZA 4KFBA 3WNEA 2AGQA 1JLCB 4EP5A 5HLFA 1NHUA 3GIKA 4HVJA 4DSLA 2HB5A 5KFLA 3QZ7A 3CJ5A 3G6XA 2J6SA 3TAEA 1QSYA 4RW9B 2BDPA 1J9AA 3G6VA 3NHGA 4E7IA 1S1WA 1JLAB 3V9UA 1Z26A 4FJ5A 4OL8A 3HPOA 1FK9B 3CQ8A 1S1UB 1X9MA 4CIFA 4FLUA 4CJLA 2ASJA 1ASUA 4Q0BA 4FK0A 4CGFA 1LWFB 3MFIA 4NLUA 3SPYA 1KVCA 2Z1HA 2UVRA 3MR2A 4RNOA 3NGDA 4FYDA 3V1QA 4CJPA 3OLBA 2JEGA 1WSGA 3V1RA 2D0BA 1IKVA 4FVMA 3SFUA 1NKCA 4WXWA 2FBYA 2FBVA 5KT7A 1GX6A 2YNIB 5KG1A 2ASLA 1UA0A 3OSNA 1T05B 2V9WA 3I8DA 1LWEA 3E01B 4IKFA 1SV5B 3QGGA 3MR5A 3DOLA 2GV9A 3TANA 4NLQA 2AWZA 2WCXA 3QGIA 3S3OA 1U4BA 4KO0B 5KI6A 1TV6A 4K50A 3M8QA 2E9TA 4CHYA 3DM2A 5F8HA 4GC7A 3LP0B 2A1RA 1SL2A 4TQRA 3PW7A 2D0CA 4CK2A 4FJ9A 1TVRA 5KFEA 1KTQA 1BCOA 1WAFA 5L1IA 5JUMA 1LV5A 1TL1A 3M8SA 2G8IA 4KRFA 2IMWP 3ISNC 2YV0X 1RTJA 4J9OA 3DRSA 3M9NB 4C8LA 4N56A 3L2RA 3AVFA 1EP4A 3GIJA 4FW2A 1S1VB 2W42A 1JLCA 2IOCA 4DTNA 4BE1A 3VQ4A 4DL5A 1RT5B 3PJXA 4FJKA 4DG1A 4HTUA 4KE5A 1SUQA 4F4XA 4KHSA 4H4OA 1CLQA 1BQMB 3MEGB 4RW9A 4EZ6A 3TARA 4ZP6A 4B8CA 3KNAA 1Y97A 3VA3A 2O4IA 1FK9A 1DTTA 1S1UA 4QWEA 3RB6A 1U04A 4CEQA 4DS5A 4LSNB 1NJYA 4ECXA
chains in the Genus database with same CATH superfamily
1R59O 2G8HA 4MLEA 3S9HA 4HUEA 1I3OB 3IAYA 5AJ3J 1MWMA 3DDKA 3UR0A 4NCBA 2XY5A 3NCIA 1IN0A 4NLXA 3SCIE 4NWBA 3DHXA 1RDBA 2OH2A 3Q8YA 1XNQK 1JLFB 2A0FB 3RSEB 2ZM6K 3GCXP 5KFXA 4Y34A 1NCLA 4X4SA 2AYBA 1AUDA 1H7XA 2WB1D 3G6EN 4FPIA 2R7VA 1NMDA 2YNIA 3ATVA 1TTHB 4GVLA 4D3GA 2V69A 2IIRA 2PSZA 1S9GB 3SBGA 4A8XA 5EGYA 1IBKF 2LECA 4HVZA 2DT9A 3K59A 3D1HA 2HAIA 4P73A 4OX6A 4P7TA 3ZX2A 4B3TF 1WC4A 1VQOS 3AV9A 3OUYA 2AMCB 3VAFA 1VRQC 3W65A 2W8KA 1I5OB 5CCLA 3PHEA 2DGUA 2F9DA 5F0UA 5LMNK 4DQPA 1UWAA 4WQ4C 3IR7B 4I9LA 2EXUA 3QLHA 3ZT1A 4B1VA 2HNDB 2HHHF 4BR0A 2MY8A 4DR4K 3WC2A 3S41A 1V3RA 3MEGA 3JAMY 2E5GA 1JQGA 1Q9YA 1OIAA 1WG4A 4XPEA 3OSPA 5CY4A 3P5TL 2V7YA 4EI2A 1U1QA 1FXLA 3K2PA 1Y3JA 2H65B 2C3UA 3OJSA 3GONA 3T1HK 4IO9L 3ITHB 1H73A 3OHBA 2VF3A 3J7AP 3OD2A 5EHHA 5A8RB 4P10A 2JWNA 3ZNJ1 4KKOB 1Z2LA 2UXBF 4K0KF 4X62F 1WOQA 2X6NA 3MM6B 2NLWA 4CGDA 1CEZA 2PDAA 3KHRA 1OH7A 1JLFA 4ECVA 1J54A 1AZSB 3RSEA 1YRTA 1LW2A 1UL3A 3MXJA 4CYUB 5J1EB 5C5JA 2GAGC 2HBYB 2VFSA 5K9FA 1R6VA 2PO4A 3EPIA 4ILLA 2LFVA 3VAKA 1S9GA 3ISZA 3E66A 4DR6K 3SV4A 1BO5O 1FW6A 1RBTA 2DH7A 3GIIA 3QEPA 4FLWA 3AQOA 2XC9A 2HHTA 5HQMA 3MTJA 3SDEA 4NYNA 1OJ4A 5BYRA 3RW7A 1RT2B 1U47A 1YJUA 2VQFF 2MLXA 5EDWA 2OPQB 3A3OB 3D3BJ 2E7XA 4CJTA 4BACA 3A3NB 2AQ4A 3WIVA 3D0PA 3GR1A 4CHNA 2NRZA 4RCHA 3IS9B 4CBUA 5FRNA 3CD5A 1BD6A 1LXJA 1NGAA 3SK3A 3J7A1 3ZTSA 3PIOL 2Z57B 1XN9A 1X3MA 4Z37A 4F3TA 2G9OA 4CK3A 1G1XA 4W92B 3POTA 2VQEK 3TAFA 3HT0A 1PG5B 1XQIA 2HNDA 5JICA 3O3LA 4LF6K 1D9DA 4JYAJ 2ZOMA 3K9JA 4DV3F 4DOZA 4M3ZA 5ETPA 4QW9A 1U8SA 3MZIA 5GADU 3M2RB 1TGOA 1NH8A 5KFBA 4JI8J 1GOAA 2BH1A 3D7EO 3QSYB 2ABYA 3KD1E 3DLBA 3ITHA 1RBUA 2HQFA 3CJ9A 3N5FA 1KHVA 5AQNA 3QBXA 5A8RA 1NAQA 2G0IA 1XMOK 1NHVA 2PY5A 4DUZF 1EZZB 3DLEA 3MM6A 2OZMA 3KIOA 1YZ6A 3BZQA 5F8JA 1NWKA 2V34A 3HP6A 4DQRA 3HI9A 4DR3K 3ZSXA 3KWIA 1WF0A 2KXNB 5J1EA 4AHTA 2MTLA 2FGOA 2UUCF 3UDVA 3PUFA 2RT3A 1N32F 4YNQA 4A2AA 4R5PB 4K5SA 4B3MF 2VJUA 1UA1A 2IBKA 3CCLS 4LF9J 1ZZFA 4FM1A 3HXMA 5HRSA 4DLGA 1RFQA 2JFDA 5IXUA 4OGEA 1RT2A 5LJ3Y 3AOAA 4C48A 4DUYF 4WZQA 3UI3A 1LWCB 4KHWA 2C2OB 3H2LA 1T6CA 3A5NC 4JBCA 3H1QA 3UCGA 3WXIA 4DSJA 1ASVA 4LFBJ 4LRFA 2HLTA 1FJGF 1HMVB 4XTTA 4TQSA 3OYNA 3MM5A 3AT1B 5AQWA 3SMPA 3KD5E 4CJQA 1FESA 7AT1B 1RAIB 4F50A 1H38A 3BKUA 5M2PA 3D2FB 4OI4A 2HFUA 5EWFA 2B5JB 3K8VA 3A5LC 2UYTA 4ZHRB 1IKWA 3ENWA 4V19S 4B9LA 4TXSA 4CVNE 1Q9XA 4LBHA 2OPSB 1ICEB 1TELA 2Q1LA 1NJZA 3LAMA 2F9TA 2H54B 4URQU 4B02A 1BQNA 2MHEA 2QFIA 5I42A 2JSXA 3AO5A 1FRXA 2AYEA 4WF9L 4JI1F 1HFEL 2WBRA 1R43A 2BVZA 2O01C 3M32B 2FXUA 1TKXB 2JWLA 3CCQS 3F0NA 5B0FA 3QMLA 3QNOA 3NF6A 2DNMA 4BRLA 4FLYA 4X4UA 2XI3A 3V9WA 2CPXA 1XNQJ 1QTMA 1RT6A 2DXFA 1VQ6S 4R5PA 3RBZA 4AHSA 5KT6A 4B9SA 5K8OA 5DGBA 3KK7A 2QO3A 4WP9A 2CGLA 3OFHA 3HHEA 4F0HA 5D4LA 1BGXT 4FW1A 2EWHA 4CH7A 4DTUA 2K2PA 1HNZJ 2GIRA 5HRNA 4RWXA 4H0PA 5DM6Q 1LAWA 1LWCA 2VPYB 1D3WA 5HO4A 2DHHA 1C0GA 2CIMA 3D6HB 4FP9A 3WDOA 4CLKA 2WVFA 4PWUA 2LDYA 4CZKA 4BDPA 1N8RT 1HMVA 2FSKA 4DR5J 3ASMA 4J2BA 3BGRB 3JQMA 2NRWA 1T44A 1NSKL 8RUCA 4RNFA 3TVKA 2N4DA 4ES3A 1VBZA 4DB3A 1LFWA 3BYRA 2R8IA 3A4TA 2B5JA 3CT9A 4DQQA 4O3QA 4ZHRA 3TR5A 3HJVA 2RQCA 5DDOC 1ASWA 3UVJB 3U9ZA 3LP2B 4BCAA 4A46A 1VMBA 4DR4J 2EG2A 1HHQA 3LDLA 3CCJN 4DV6F 3S7RA 2GWKA 4BC9A 5HVHA 5D3GB 1HNXK 1TL3B 1RBSA 2C2KB 3E1YA 4E3SA 2F4VJ 2B4JA 3AGRA 3OPKA 2VPZB 5AQUA 4RX6A 2RDIA 5K5MA 4CJVA 4DTRA 2ZUGA 5KFTA 4GRSA 3CCRN 4CEDA 3MM9B 3P49B 2AYGA 3ENVA 3CJ8A 3W60A 2MQNA 4WZMA 5AXKA 4KBIA 4A8SA 5E41A 4WKRA 3ZZTA 1VQLN 3M1VA 3OFGA 5IT4A 4U96A 1K1SA 4B9MA 2FD2A 3THWB 2I1RA 1C2PA 3E8OA 1B70B 4CHZA 3ZZPA 2FUG9 4JKDA 2KDOA 3TA0A 3QIOA 3U1NA 3O9UA 1TK8A 4UZCA 1FNMA 5HJYA 3I0RB 1RLDA 1KDNA 2WW4A 2KFYA 2WTFA 3KKSA 3CB4A 1NBEB 2LCWA 3EUNA 1Z2ZA 3BGRA 1VQPN 3NL0A 4NXMK 4YQWA 2XLKA 4O8UA 3ILIA 4K25A 5HAOA 2LEBA 3CJTA 3OXLA 3J7ZO 4F2SA 1NPKA 1HR0K 1WNSA 4W5NA 1J5EK 2R7UA 1S6QB 2R8KA 4FJGA 4JV5F 2CPJA 5BJRA 1NLKL 1KXPA 1U1KA 3N6NA 4AM7A 4PZVA 3RUBL 1U48A 1WSJA 3UN5A 4KO0A 2Y1RI 4I67A 5KFDA 1TL3A 3J7YI 2DFHA 4CLSA 1NSAA 2AD9A 1Q79A 3AVBA 4RNMA 2J6TA 5B0BA 3B6BA 3MM9A 1XMQJ 1DAXA 2QA4G 2DYAA 3ZSQA 1VQMN 1Q82T 1VISA 3IP0A 4CFCA 4FLZA 1QZ6A 1JLQB 2J0XA 2CQ1A 3HULA 4LQ9A 4JI0F 2HQCA 1BCMA 2DEIA 4UQTA 1P6TA 4JI6K 1CZBA 2VKRA 1Q86T 4CDIA 1WC5A 4AQYK 2UV8G 3KLHB 3R7SB 4RPFA 4OI3A 4LF7K 2LA6A 3THWA 3L9ZA 2BE7D 4PRFA 5BR8F 1K73O 4DV1K 4ECQA 3VAIA 3BS9A 3T9NA 5BPNA 2VBYA 4ICLB 1RCOB 2KKHA 5KFUA 3I0RA 4K2XA 3GSIA 3EKSA 2ASPA 3IC1A 4YOEA 4O5FA 5AQJA 2DR9A 4WFZA 2KTQA 2FHMA 4OHYA 4JRQA 3PKMA 1NM1A 1NU0A 2W25A 2RHKA 2D0AA 1L3KA 5MLCV 3M6XA 2RRBA 2AJFE 1HNWK 3IMXA 3HSZA 4YDUA 3VGMA 2I5JB 2YKNA 3IGVA 1HKCA 2XYHB 3BH6B 4CFDA 3SQOP 4AHCA 3SI6A 4LF5F 3H20A 1TUYA 1RT3B 2HSEB 3RB0A 3VGKA 1NJIT 3AOCA 4B9QA 2HS3A 2YKPA 3X1LB 2ILYA 5D8HB 3CVKA 4B9VA 2E20A 1O8BA 1NSQA 3TWZA 1C0TB 3KUEA 3EMTA 2FJXA 2RDJA 4QWCA 3KMQA 1UVIA 1HQEB 2B8QA 3CW2C 4FZZA 2FBXA 4JHDA 2IM0A 1LW0B 5D4NA 1A6LA 1OWXA 2KO1A 2QG9B 3IAM9 3OHRA 5AQRA 2KL8A 1BIZA 3IGNA 5DETA 2VOOA 4QIEA 2OTJS 4WJBA 2VBZA 5C2DA 3TRGA 1RT1B 1W2IA 2W7PA 2YHYA 3KYLA 3QICA 4ICLA 1RYSA 4QAGA 3FZLA 3D6FB 3V4IB 1Q8IA 2IVFB 3IWNC 2F63A 2EKYA 2FBTA 3TAMB 4DQSA 3I0SB 4NXNJ 1CVJA 3J7ZT 2DTJA 3UPFA 3M6UA 1UFLA 4FNIA 3OL8A 3VPZA 3MMCB 2I5JA 3CCES 2DGQA 3V9ZA 2Z1JA 3N4PA 2K8GA 3FCVA 1KOOA 2EFVA 5BR9A 2NPIA 2HK2A 5LMUF 4DTSA 3T69A 4NZ0A 3MECB 4RLEA 2CDQA 2HIYA 4RW7A 2ZKTA 4OX9K 2CPDA 4J9UE 1NK7A 4C8NA 4EO6A 1S7HA 4B3OB 5FLXO 2A2CA 2GTDA 1K9MO 1C0TA 5EWGA 4O0IA 3PYFA 2HVIA 4IH5A 3IA0A 3PTWA 3HP9A 4M63A 2QKKA 3RB3A 2DNHA 2D0OA 3KLGB 1HQEA 4C11B 4Q0BB 3THTA 1S76D 5BRFA 4ZITA 4BHQA 2U2FA 5AZIA 1GQEA 1LW0A 1S97A 4USMA 4GKKK 4XH5A 3ID6A 4DPUA 4PPZA 4JB8B 4WBFA 3BQ2A 1YGYA 2IAJB 4DR7F 1KFDA 3GIRA 1K73T 2VG5A 3U1LA 4M5NA 3HO1A 3CC4S 4NO7A 4BRQA 2G8KA 2E6MA 1RBAA 1RT1A 3AVCA 2YNHB 1X9WA 4WFAL 3QEVA 2WVEA 3V4IA 3BH7B 3T3FA 3DDNA 1FVSA 4TU9A 4EUVA 3CIMA 3OYAA 3TAMA 5KOWA 1TV6B 1A5WA 4H5VA 2OP5A 2MZJA 2OTLS 2M3DA 4Z4CA 2E5LK 3MXHP 1KP6A 3US5A 1JKHB 3MMCA 5IM0A 3PX4A 3CJAA 3PO4A 4W5TA 3MOJB 2PBDA 1T8EA 3DRSB 5SWMA 3J7Z5 3HM8A 1PAUB 4E89A 1VHIA 1IBCB 1EP4B 3MECA 4CFBA 2YNFB 3J81j 3PIPQ 2VD3A 2MPUA 3I5AA 1HWUA 3CXCM 5L39A 4PA1A 1SUQB 3H3NO 4H4OB 5KT3A 3PX0A 3TP2A 3QIPB 4B3OA 1YLXA 3AXKA 4M3YA 4FF4A 3BBFA 2F4FA 2U1AA 2BKPA 2MZRA 1N34J 3HKZD 2ZE2A 3IN5A 2HHXA 5L38A 1TUUA 3KLGA 3BPSP 3NFAA 4IG3B 1CSJA 3LP1B 3UKUB 1RAOA 4RUBA 2XWXA 3TOQA 2DO4A 1REVA 2D9OA 1X31C 3DLLQ 1ZTTA 2DTUA 4UF4A 1ZM2A 2IAJA 2UU9J 4I7FB 2B3TB 4E2FB 1H1VA 1DHMA 2VFVA 5LL6Z 3UDEA 4DCHA 2F1FA 1O51A 3MUVP 4WFNL 4BRNA 4LF7J 3EVMA 3PCOB 4KHUA 3R27A 4B08A 2YNHA 2ZC3A 4CIEA 4LUBA 4J7CA 2KQ2A 2IPOB 1KNZA 1WTBA 1WSRA 3TNVA 2XZWA 2L9DA 1H6KX 2NPFA 4CWBA 4ZIWA 4RG8A 3DOMA 4DV1J 5FLXU 4IOBA 5FROA 1AUSL 1MROA 3HLUA 3CYMA 2UXDJ 2LYVA 1JB0C 1YJWS 3O5TB 3LO3A 2WFBA 4ILGB 1URRA 4DN9A 4P7VA 4H5TA 1QQMA 1TR0A 3CMAS 1JKHA 5KG6A 1WUUA 3LPYA 3UW1A 3K89A 1E6YB 1JLEB 1WG5A 1HNWJ 4CH1A 2YX4A 3RRHA 2LA4A 4PG7A 3JB9k 2R8GA 2YNFA 3CF5Q 5IWAF 4ECWA 3CUNA 2BKNA 1H98A 3E9LA 2BUPA 1VBYA 4Y1CA 4O55A 3OTBA 3QIPA 1JXBA 1KVJA 2ZITA 5J2NB 4EZ9A 3WQTA 4C8YA 2VOPA 3M7VA 4O3OA 4IG3A 3KLVA 1ACMB 1DQ8A 4OV1A 4IG0A 3AODA 1GXLA 3WX4A 3RMDA 4Z7YA 5ETSA 5KFWA 1IG8A 5DZ7A 5D4OA 3ZT2A 4FXWA 4OLOA 5KFPA 2B4UA 4I7FA 4M41A 3P38A 1Q0NA 4BR7A 4BG9A 3M8PA 2ZD1B 5HROB 5F0WA 3ZZUA 4BRMA 3C6TB 5FDLB 5DLGA 1MMDA 4PKHA 4JI4F 3CMEN 4E7JA 1LEOA 2G1DA 2M70A 2J7UA 5HRRA 2AJ4A 4K4TA 3A12A 3H98A 3M8YA 4YDUC 2L3MA 1X5SA 2XCPA 2OMLA 1KVAA 5IT9O 4I69A 1DURA 1NB2A 5IQ6A 2ZF5O 2CJBA 4Q5VA 1QQCA 2B9WA 1YVUA 2HS0A 5AJ3F 2VG6B 3ALYA 4MT1A 1VQ8N 1K8KB 2GHPA 2RF2B 2ZVSA 3PG9A 3QT6A 2MKSA 2BJ8A 1ZBFA 5AQXA 2O8FB 3QEIA 3UDLA 3UO0A 2VKZG 5EWEA 8ATCB 3P3DA 1UVLA 2QLBB 5T7LB 4QU6A 1KKHA 3F5TA 4KH6A 1ZH5A 3PLAA 2DGSA 5KAKA 3HZ6A 2DR8A 3GV5B 4OX9J 5J2NA 2ROPA 4YUDA 2VICA 2DR6A 2DY1A 1N6QA 1K0TA 3FGUA 5HQ8A 5DDRC 2XMWA 3L2UA 5F0XA 4F3MA 2HNZB 2OYQA 4CJUA 3RZAA 1OH6A 3SJHA 4KTQA 4MKAA 3BR8A 2Q3SA 2V2ZA 2LKZA 1GLFO 2IVYA 3T1AA 2NSCA 1K8AT 2VPWB 1FWLA 1Q18A 3LDPA 1RAAB 1UTAA 4GKKJ 4HI2A 2RUSA 2PA3A 3NGSA 4NLBA 2GWJA 2F7VA 2EBGA 4O5BA 2ZD1A 5HROA 1S6UA 5AXMA 1M90T 3CSKA 3C6TA 5FDLA 3R97A 1C1CA 1NNEA 4K4UA 2NZ4A 2HRYA 1B0PA 3BKTA 3TJ8A 4EIAA 1LCUA 3EE3A 2P9EA 1SH3A 2Q2RA 4OI2A 1T0TV 4G1QB 1TL5A 3L3CA 5FJ4A 5E84A 5FLXY 5H9EK 3O2IA 3QETA 3VERA 3O6QA 2ZH7A 3TVZA 5F3ZA 2A10A 2J0QD 4KHRA 5F8MA 3I6PA 1FKOB 2VG6A 1Y5LB 3CJ1A 2FJWA 1FRMA 2JLFA 2HVEA 1JL2A 3W66A 1BU6O 2FVPA 5L1JA 3MX5A 1XI1A 1HJRA 4CJSA 2CQCA 1DBDA 1QE1A 2RHSB 4OHZA 4FN5A 5T7LA 1R8AA 3G4SN 4J9QA 2EFGA 3CFPA 3HVTB 1V5IB 2Z1GA 4M63C 4HTLA 4EBDA 2ETJA 2XBPA 4OYBA 5F1XA 3MTKA 2YBVA 4Q45A 2HGMA 3KLFB 1YI2S 2CJXB 1A0OB 2HNZA 1AT1B 3HHKA 4IH6A 3LA0A 2MQLA 3SNNA 1M5OC 5M2UA 4ATNA 1FTRA 4I9QA 4RUCA 3OBWA 2WC9A 3NNCA 3IXQA 2ASOA 2ZOFA 1NGDA 1SKSA 3T41A 3EE9A 3WX8A 1QS4A 1N48A 4H54A 3AVGA 1IM6A 5E5NA 2XYPB 3LDOA 4KFBB 3D0IE 1NKEA 5HLFB 4ANEA 5HMWA 5AE2A 4KPYA 3RMCA 5I3UB 1GXTA 1RJJA 5CA5A 1VSMA 4JYAF 2LEAA 3IRXA 3WC0A 4YHHF 2YHBA 1KLMA 2DGOA 3K7RA 2MGZB 1WJ9A 3MN7A 4G1QA 1X0PA 1FEHA 4JI8F 3CPWM 1ZM4A 3HHLD 2NREA 1YIJN 2XHBA 1RCHA 3UB5A 1NZ8A 4HI1A 3F44A 4DX6A 3ZETB 2PA8D 3IFRA 4U9RA 1YBUA 3UNGC 2YJEA 2WZ1A 4OZ2A 3A2FA 1V3ZA 4ZCKA 3AB4B 3Q24A 1RYRA 4CHPA 2COLA 4M5KA 2R2RA 1ITGA 4QS9A 4BQZA 2RUGA 4PYDA 4PXDA 3HVTA 4R25A 3ZT3A 1EO1A 1YVFA 3NVMA 3U8XA 2HEKA 2E1YA 1PKUA 4L3NA 3DAWA 3KLFA 5A2QO 4ELTA 1NKBA 1ATNA 4LF9F 3UD4P 2E2NA 3FZKA 1K47A 2LLZA 4PQUB 1H3DA 2D0PA 4X84A 2MKJA 3IBCB 4KREA 4FK2A 2R8HA 4BRCA 3LALA 1E3MA 3CNQP 2ERRA 2A6OA 1VQ9N 4O3PA 1F9FA 2CZVC 4USKA 1NBWA 2W4DA 1TL1B 1RAJA 3A3PB 3H5YA 2VZ9A 4LFBF 3LTOA 4E7HA 2V8HA 3B4MA 4CRJA 4EYHB 2F3JA 4J9NA 3G6YA 1S5JA 2OPPB 2LEPA 5HI7A 5T41A 2E9ZA 4KFBA 3AFGA 5AXNA 4FPAA 5HLFA 3ET6B 2HB5A 3ENHA 3CJ5A 4BR4A 4F67A 4U7UD 2QTWA 2FTRA 4FKXA 2BDPA 2GO9A 1S1WA 4YDXA 2MGZA 2G2YA 2F40A 3VAMA 2KYZA 4CIFA 1ZAWA 2ASJA 1DEJA 3W8PA 4C9DA 4FK0A 2HFSA 2QJ3A 4NLUA 4A61A 1KVCA 4FPRA 1KQFB 1KONA 3ZETA 2ASYA 3FZFA 3Q2TC 4OZLA 2Y8WA 4RNOA 2QLXA 3NGDA 2HQGA 1HI1A 1N33K 4I6AA 2ZWHA 1V4TA 1HKAA 4ES1A 1SPBP 3EZWA 2FBVA 5A8WB 4KC5A 1RDWX 4MIWA 3EKUA 5KG1A 3RAMA 3JQJA 2ASLA 3OSNA 2PAVA 1XNQF 1T05B 3Q22A 5B08A 3VF2A 3MCPA 2GV9A 4LC9B 4C23A 3W9HA 3RRKA 4K50A 5DS7A 4JN4A 2FF3B 3EICA 3CC7N 1X7VA 4NE9C 3LP0B 1FDDA 1SL2A 4TQRA 2GMHA 3PW7A 1HNZF 1KTQA 5IT9Y 5DDPC 2AEMA 2DIVA 5F3TA 3GP9A 4B1ZA 3FUYA 1TL1A 2FJBB 2G8IA 1MN7A 2ZDOA 1R6YA 4KRFA 2BE9B 3OVSA 2IMWP 2DXDA 4DR5F 2CVIA 1R0CB 1GLEG 3L2RA 3AVFA 1S1VB 5E26A 3OXGA 2IOCA 2UUBK 2LVWA 4JI5K 2B51A 1ZAXA 3ET6A 3AA8A 1PC5A 1IBKJ 4GKJK 1RDUA 4EZ6A 1HHTP 4LF4K 3TARA 4ZP6A 4K5RA 1ZA2B 4YY3J 3A8KA 1BWFO 1DTTA 1X5PA 3SSSA 4DR4F 1N5QA 2GHVC 2ZBPA 2HPUA 4KHPK 5L8RC 3RB6A 3GE1A 1JMTA 1NJYA 4ECXA 1GTHA 3UWTA 4PG5A 3K5MA 1DKGD 5F8LA 2F4VF 4H4KA 3DRRB 1J5OA 4M5MA 3MEEB 4CLWA 1JK9B 2ASMA 3LM9A 3ENQA 2NRHA 2QA4N 3Q7BA 1N0VC 1S79A 4NRTA 2MKHA 1AFJA 5A8WA 2OUGA 5LY3A 2KVQE 1H74A 2R7WA 3J7AN 2XO7A 1QHAA 2OKQA 3DXKB 1T05A 4UTGA 1YJRA 3OS1A 4FKYA 3CCUN 1WAJA 4FJMA 2FJAB 3PV8A 4E1NA 1T9TA 1JXLA 4ZCMA 5IS2A 3D5MA 5CYMA 1TP7A 3NEKA 4PR6A 4ZPAA 4YN3B 3CMQA 2RRNA 2D5RA 1RBOB 2HGNA 2HBLA 1QUPA 3LP0A 2DKOB 3HBTA 2ZBCA 2M88A 1QJHA 4BY9C 1TKTB 1X4BA 2DVIA 2DGWA 4G9ZA 5A6PA 4CBXA 1C1BA 5CZXA 2ZBIA 4AE5A 2MQQA 2UUTA 1S6OA 2O8DB 1W26A 2GGPB 4LBPA 3DRPB 4C4WA 1X4GA 4CERA 2N7CA 2MSSA 1S1VA 2EW9A 2BJ1A 2SXLA 2DO0A 3IWLA 4FSVA 1F5AA 2XMAA 1SJFA 4AL6A 3NCRA 1NK0A 1GMWD 1YVNA 4ZDNA 3FC9A 1WHWA 1D0EA 1YHQN 1R3NA 4CGIA 4ED0A 2VPXB 5D15A 3BBCA 3OYFA 5B7WA 1SJ3P 1LK7A 5K20B 4CO4A 1OSDA 4DV2K 3RMBA 3M2UB 2JC0A 2QWOA 5KFVA 4A5BA 1WI8A 4O8KA 2XSFA 3DRRA 1O5JA 4LD0A 2QM1A 3JYTB 4CNZA 3DGPB 1BHNA 2CYYA 1CQMA 2W6LA 3J81O 4NLPA 3KJNB 1HLUA 1YK9A 1U1MA 4IEIA 1I94J 2RS8A 3AAWB 3DXKA 2FZCB 4NLYA 2GZOA 3TSPA 2UUAK 2E4LA 4QR0A 1UVJA 3LPTA 3V2UC 1FEEA 2W8LA 4B1XB 3PY8A 1PYSB 5KFQA 3FZHA 3GU0A 1S7IA 1MWKA 4LJMA 4OYAA 4Y3CA 4BRDA 2GX9A 4YR0A 2MY7A 4MTPA 3HKWA 4Z4FA 4E1JA 4NMXA 1F9EB 1KS2A 3VQSA 3DRPA 2L9NA 4CCHA 3MM7B 4MAKA 2BANA 2QMXA 2PGCA 4FJXA 2GVDB 1Y3KA 5LSLA 2WB4A 3O08A 1BMQB 4J8FA 3NMUA 4NLTA 2B7BB 1APSA 3ZYYX 1HWIA 3CE8A 1CJKA 2OO4A 5T7BA 5KG2A 4HTIA 5SUHA 5G0RA 1IBLK 2Q0UA 4CK1A 2HZCA 2BQUA 2G2ZA 4A4JA 3EZOA 4OZ0A 3RTVA 4CEBA 1U24A 1NK6A 2BABA 2YI1A 1IO2A 2HHPA 2ZH3A 3V1OA 2MJUA 5A2QY 3G6ES 1FJGJ 2CJAA 3CJQA 3FZBA 4GC6A 3DGPA 1KD1O 3W5XA 3NKYA 2QK9A 2CQ0A 1JLBA 1VQ4N 2O8BA 3VQ9A 2JGUA 2R8JA 1VSLA 2QRRA 4O0NA 2JVOA 4FO0A 3D2EB 4ZPDA 3M6WA 1N33J 5BYSA 4KAIA 1DGKN 4ECRA 4NLDA 2C3YA 1N5SA 2IJFA 2LXIA 1EJ7L 3V6JA 5KQ8A 3CMAN 5KFJA 3CJ3A 1JX4A 4MK9A 3R1LA 4DU3A 4BWJA 1WF2A 2KI2A 1GLCG 3PR5B 2ADCA 1JJHA 1HD0A 1S6PB 4U7CA 3ISND 4ER8A 1CZAN 1FX2A 5J1PA 2BGGA 1VHFA 2HF3A 2FPHX 3B8HA 3FQKA 4ITSA 5KFMA 3SZ2A 3RGIA 2RS2A 1L3UA 4L76A 2UVUA 4DR2K 3NVKA 1YJNN 3CJSA 1F2GA 1YJVA 2P9NA 1BL3A 1SQEA 1JIHA 3MM7A 1H72C 3TZZA 4KAZA 2YHAA 3GLJA 1UEKA 2GVDA 1SQFA 4BREA 2DCUB 4LF8K 2IDEA 4ZP7A 3MR7A 1BOTO 1NOYA 3KWMA 1MLAA 3IDHA 4CE9A 3HYFA 3WXJA 4FWMA 2BW2A 4FWSA 3P96A 1RU2A 1RNHA 4A57A 2YKOA 1O6XA 1QQOA 1DJ0A 1B92A 3BDEA 2HLUA 5L1LA 2OZSA 3MGJA 1T3VA 3P83D 3HVWA 4LF4J 5F9NA 4MDAA 4USTA 2IIHA 3L7UA 2B4VA 2B43A 2M8HA 1MU2B 4IUFA 4OKKA 3PR4A 4F26A 4KHPJ 3HM9A 4CTAB 3RBXA 3AA3A 2E8AA 3VQ6A 1U6ZA 2FJVA 3R7BB 4HKQA 1GNKA 1S99A 5ITHA 4ZS6A 3BSOA 2CQBA 3R3LA 2HNYA 4MYTA 3MUTP 2F5GA 3G8TA 2NXCA 1TU0B 4QPTA 2WSFC 3D54A 3TABA 1RTIB 4N5SA 1TK5A 1CJTB 2L41A 5HOOA 1IJJA 1R0AB 2QV6A 2Z2LA 2P9LB 4ZVHA 5C42B 2DNRA 3P8BB 2B4PA 1S6PA 1Z25A 4JKHA 2Z0GA 1VSEA 4IQXA 1OH8A 4YOWA 4FOIA 4CD3A 1XBWA 3TYTA 3SUQA 1BUPA 3E2EA 4QS8A 4IOCL 1Y7PA 1M5KC 2KM8B 2GBZA 4CZCA 3SQ4A 3OYDA 3VQ7A 3QRQA 4RL1A 2KH9A 2R3VA 4ED3A 4DR1K 3G9CA 4BDYA 4AILC 3T5JA 3X3UA 3GQCA 2JLGA 3A8YA 4FS2A 4WKYA 1YRUA 1VSKA 3ZSYA 3HDSA 1HR0F 4YDDB 3MN5A 1QHTA 2V2KA 2RE2A 3J7YP 1GLJO 2PFFB 4UOFA 2CGJA 4EYIB 3UD5A 3MMBB 3QGPA 1ZYQA 3L4IA 4F3QA 4MK7A 4XIUA 3QBWA 1MU2A 1GLLO 9RUBA 3VTIA 4JI2K 3PX6A 4P2FA 3V5RA 3VEXA 4CTAA 2IY5B 2OD4A 1RBRA 5IT0A 2V8DA 2YQ3A 3Q23A 3OTOJ 4DV2J 4M5LA 3HSTB 2C2EA 4URSA 1N34F 1XUPO 5A0YB 4RUAA 2W9CB 5TKWA 1BC6A 3ZT0A 5HP1B 4OJ1A 2VGNA 3G8QA 3BSNA 3OL7A 1T9XA 4JP8A 1IKXB 4JI3J 2P2CB 3BN4A 3ULDA 1BY9A 1FNXH 1SB6A 3VQTA 2EFNA 4IKAA 4K8RA 5JMVA 3EVOA 2UU9F 3U7JA 1CJTA 3VR1A 1L3TA 2HHVA 1R0AA 4AD6A 4OKEA 2G8VA 1KWMA 3PSFA 4LF7F 2P9LA 3EGWB 4PYAA 3MXMA 4B8AB 4IDKB 5C42A 2YJFA 2G8WA 1SJRA 5IC6B 5F8GA 1VLYA 3LUYA 4DV1F 2E2OA 4B1YB 5G4DA 2F8SA 2UXDF 1I1GA 3I32A 4QYZK 5RUBA 3SQGB 3DLLL 4NYOA 4A8FA 3VETA 4YOXA 3J81Y 5GMDA 4ED7A 5H9FJ 2XRIA 2Q3PA 3L09A 2A1BA 3VA0A 1HNWF 4AHVA 4A59A 3CJ0A 1EETB 2ITGA 3NGRA 2PEHA 3MMBA 1WSFA 3P4IA 4Y2AA 2G2OA 4W5OA 5JJBA 1LOUA 4UOCA 2GMLA 3ICLA 4J9PA 4GVBB 2GAHC 4PG6A 3MR3A 4C0BA 4CZEA 2MXYA 3OV7A 2FJDB 4YR3A 4LFCK 3R2CJ 1ZBLA 3D67A 2BRKA 5A0YA 5K8MA 2DY9A 2W9CA 2FVQA 2JNJA 5KG4A 3QFPA 3JSMB 5HP1A 3KWGA 4JS4A 4LRBA 3VESA 3HPHA 5E2QA 5M1NA 2KHCA 3F73A 1F0XA 3SI8A 4KYZA 4LF5J 4ZVSB 4Y65A 3OYBA 5EX5A 3HX9A 2V8PA 3CF5L 5AQHA 4BQLA 2ZUAA 4MJKA 1BLUA 2FLPA 4TY9A 1HYZA 2AT1B 3EL2A 2VYPA 4DSIA 1WNEA 3NWGA 4K8ZA 1YWXA 4K8XA 1T03A 3BKFA 2FVSA 4E0DA 1FI4A 4KHMA 2W2NP 1KR4A 1MMNA 1FKAF 4EFHA 4UOGA 3SQGA 3CCJS 4DV7K 1S3XA 1U49A 3SAFA 3RBDA 4DU1A 4DU4A 5L9XA 5EVZA 2DR5A 2GHWA 3T6BA 1XQSC 4MQ3A 2B0GA 3KHHA 5AFUH 2MQOA 3UD3P 1KVIA 3CDEA 2W9AA 4YORA 3CCRS 2QW9A 5C0YA 1VK0A 1YJ7A 4ZPCA 1EETA 4DCOB 2WSCC 2XY7A 2LQ5A 3C3LA 4ZLLA 3TZYA 4C8MA 5A8KA 2AGPA 4MH8A 3UR3C 2CJYB 4GVBA 4QJVA 2QGFB 2Z30B 5KFHA 1VQLS 3PO5A 2HHHK 3GJTB 3O5BA 4OX9F 4G65A 3DI6B 4RZRA 3C7NB 1RLCL 2ZZNA 4I6MB 2D9PA 3JSMA 3SAHA 2VL1A 4K4WA 2JC1A 1QAIA 2CQHA 2P9KB 2ZKUA 2C28A 2RQMA 2X74A 2WTUA 3OFEA 4EFAC 1RDCA 2PE8A 5DM7L 4A62A 2ALYB 4YMEA 5H1SQ 4ZVFA 4C3KA 2ITMA 1VSHA 4CF8A 5ETQA 3BQ0A 1WN7A 3NCPA 2BM1A 2F8EX 2WUSA 4RW6B 2PI4A 2ZJPL 1VLOA 4GKKF 2UXBK 1C0MA 2VG7B 2AP1A 4K0KK 4X62K 2H4WB 3DLKB 1VQPS 3ZZ0A 3B6OA 1XJWB 4QOZB 3LAKA 3FMBA 1EKRA 1UP1A 4M8LA 1RWUA 3S6EA 2AJ1A 3O80A 2R7SA 4DQ8A 1U0HB 4U95A 2DNPA 2Y9HA 4H4MB 1SJ1A 2XO6A 4KH1B 2BZ2A 1ZETA 5J2PA 5M2RA 3KJFB 1QLNA 2CADA 4ALZA 1K1QA 3H59A 4DU8A 4GO5X 4FS1A 3FLCO 3AY0A 3C14B 3DU5A 4ZLPA 1VGYA 3F9MA 2CKWA 5ETNA 3VF6A 3A13A 2VQFK 2NSBA 1PAEX 1ZXOA 3W63A 3O3FA 1SL0A 3JS9A 2AZ3A 4OJRA 3SMSA 4DR1J 2QL7B 3A8EA 4DS4A 1VQMS 4DCJB 4PG8A 2MQ8A 1GK8A 4FYYB 2QXFA 3PW0A 5M1PA 4ID8A 3JS6A 3B78A 4DF4A 1RDAA 2P6TA 1WC6A 3ZSVA 2NYIA 3L3VA 3JSYA 3FSXA 2MKIA 4PWDB 3SPZA 3QWUA 3NMAA 1YKWA 1Y5IB 3EEQA 1TZ0A 5D0GA 3DI6A 3MMAB 4WYBA 2N7YA 3QJJA 2J9CA 4DV3K 2DFFA 3R1HA 4BR9A 3RJMB 3BF1A 3W7BA 4ED8A 1MDUB 4OHWA 1U1RA 4DZDA 1Y64A 2P9KA 3JTPA 3PRBA 3RW6A 2OAUA 1IWGA 3DDIA 2D1KA 4FWQA 4B17A 4BRIA 3T5KA 2JZ5A 2LP4A 5KFYA 3CCTA 2VHGA 4RW6A 2LSNA 1T95A 1MMLA 4DUZK 4HHUA 1WOPA 2ZOGA 2EPIA 1S9FA 4IQMA 4WFNQ 3SLCA 3KOAA 2XB2D 4AL7A 1RGVA 1CXUA 3C6AA 1H0HB 1ZOTA 1FXDA 1LXNA 3G2XA 1Y5NB 4CJ3A 4BRHA 4Y00A 1RUSA 1U0HA 2D7SA 4ED1A 4YOVA 4F25A 4M7YA 2VA3A 4K42A 4CLYA 4GVMA 2UUCK 1IVZA 4X64K 3AH6A 1N32K 3C94A 4B3MK 5HVFA 3N28A 4RUHA 4PXEA 3G10A 1XWLA 3SAGA 3I56N 2XNQA 4HEA9 4R0JA 4DUYK 3GOIA 4JI7K 2XS7A 2FSNA 3RR7A 1LOTB 3VCDA 1LWXA 3OTDA 3JAMU 1D5AA 2KJWA 1E4FT 4DG1B 1IUJA 3R8YA 3RR8A 2E5JA 3O1LA 3MEKA 1X4DA 1ILYA 3CD7A 3P45B 3O8WA 4CIGA 5M1FA 4PWDA 2IVNA 4W90B 5DG9A 1HJOA 4CD1A 3RYLA 3UDCA 2ACMA 1ULRA 2W9BB 3N0VA 3W5ZA 1HI0P 4RW4A 3EDRB 3CM5A 3HRGA 2ZNYA 2JVRA 1FDNA 2PEBA 1OVQA 2M8DB 4DV5J 3H25A 3LDSA 5U47A 3AA4A 3OXFA 2EHGA 2V51B 4JI1K 1TYQA 2V8GA 3O9QA 1FF2A 1IR1A 4QWAA 3I9ZA 4NPOA 4P71A 4B3SJ 3CCSS 2QLFB 2DJWA 1FDAA 3VQ8A 2IVMA 1UFWA 2V94A 4DQIA 3BO3A 1FKPA 2GFFA 3QWPA 1NK8A 1HPMA 3CJKB 5AE1A 1YTAA 3VQQA 4CZMA 4KH0B 4CZFA 1M5HA 1N54B 2V2QA 4BC5A 4R0EA 1R8BA 2HHSA 5ETTA 3ZTOA 1N36J 4ECTA 3CD6N 3TSUA 3TU5A 3FEZA 4DV7J 2YVSA 4CT9A 3RB4A 4CZJA 4DFMA 2KRBA 1S0VA 3QLHB 2AJ2A 2CAJA 2HZAA 4BLGA 2D3O1 5AQPA 4BR5A 4EAHD 1RT7B 1CJUB 4LFAK 2QIFA 4BC7A 1R27B 3MAHA 4DV0K 3PYDA 1RWWB 4B3RJ 4FJ7A 4W5RA 2W24A 4Y0WA 4OPKA 3L2WA 2NLXA 1KBRA 1G15A 3N79A 2W9BA 2NXEA 2I6WA 1QZ5A 5KG5A 1HNIB 1NGFA 3RAXA 4DV6K 2PT0A 5HJXA 2QL9B 2OFGX 3NCQA 1JL1A 4P74A 2OHDA 1KCFA 2NQPA 4WP3A 3QEXA 1KEKA 2HFZA 3FRYA 4U8VA 1LW2B 2YXLA 3LWMA 4M3XA 1IV0A 3C15B 5THWA 3THVA 2YWGA 2HMIB 3LM2A 4Y2KA 4JKGB 5J2QB 3WXLA 1EXQA 1FERA 4YY3F 1VRUB 3SDEB 4U67Q 3CJKA 3WXKA 4FYVB 3GG4A 4ILJA 1VQNN 2AX0A 3GYGA 1VC5A 1Y4ZB 1C1AA 5B8HA 1VJWA 2PFDA 2YCHA 1WEYA 4KB0A 3ZZZA 1RI7A 3ZZYA 2ALZA 2GMJA 2BM0A 2Z58B 1NGGA 3PW2A 3POTB 3GSDA 2H3GX 2IRUA 1S49A 4ES2A 1OYDA 2W2MP 3NAEA 1V5VA 1CC8A 5MAOA 3ZTQA 2BQ3A 2KXHA 1R89A 1RT7A 1CJUA 4BC2A 2MKKA 2CQ3A 5CZ1A 2E5IA 1VSFA 2J6UA 6FDRA 4PHTX 2R7TA 1UPPA 4M95A 3MCOA 3TSQA 3Q8RB 1NJWA 4X66J 3CJBA 2Z56B 3NBPB 4CLZA 1F3VA 2OPRB 1HNIA 4I1TA 1FRLA 2DCLA 5IZHA 3Q8UA 2WVBA 5DLFA 3DLEB 4NA2A 2Q1NA 3H5UA 2YWEA 4B1WB 3FRZA 5I4MA 5DQIA 1PBAA 3Q8QB 1UJ6A 2IM1A 2VGMA 1U1NA 3QDKA 3SUNA 3C46A 4DFPA 3C15A 4DL7A 2HMIA 4DX7A 4JKGA 3PW4A 5J2QA 4JI0K 1IG9A 2WK4A 4UY8T 3DLGB 1WEXA 5C2GA 3HOSA 3P31A 5GAHP 1VRUA 4QS7A 1I51B 5K8NA 3BZCA 2HYIB 2GS8A 4J2DA 2D3OR 4K41A 2Y0SD 1ZBUA 5AQOA 1QSLA 1WOOA 5KOXA 1ZS6A 2QLJB 2CJQA 5L9NA 4CM0A 3VQBA 5BR8K 4X64J 1QM9A 3F2KA 1OY8A 4CO2A 1WHXA 4JKCA 1XNRK 2X3GA 3OBIA 1OH5A 5GAEP 4I0WA 4C8OA 1RKJA 2BE2A 4A2BA 3A0IX 2QYCA 4C8KA 4UT4A 1UETA 3MM5B 1N8RO 2NUBA 3NLCA 2CFXA 4BRKA 4MYUA 3VVUA 2YPYA 5AQZA 4F0MA 1I94F 1VQ7N 3R9PA 4JI7J 1UWBB 4YHHJ 1IKWB 2AEJA 2MSTA 1HWJA 3H42A 2RIJA 4FXDA 4XO0A 4HDHA 4DWIA 1BQNB 4KT0C 4NCAA 2DNNA 2MZ1A 3NBPA 3T1YJ 5I42B 2HQ3A 4M3WA 2OPRA 4J90A 5D4PA 1GMVA 5A76A 3P4UB 4FK4A 2A18A 3UQSA 4FJIA 1C0UA 4OZNA 4I6YA 3CMES 2WSEC 3C66A 4L73A 5KFIA 4WPAA 2QWPA 4J37A 5KFFA 4IOAQ 3NAHA 4WXOA 2EC2A 4F4YA 1RT6B 1ATSA 1VI7A 3I33A 4NLWA 5BN8A 2P8IA 2P6SA 1X4FA 3DLGA 2JHEA 2V0NA 3LF0A 3ZZOA 3QSIA 1VQ8S 3M8RA 4LH4A 1UMJA 3D28A 2D3ZA 1WUAA 1CZ9A 2FHJD 2UXCK 3HL8A 2D41A 4HCBA 3K5NA 4PL8A 3VQPA 3FBCA 2VASA 4UZBA 3CG7A 2YQ0A 4EK2A 1UFKA 3QJLA 3OYGA 4EBCA 3Q7CA 3TPQA 4RJVA 4TLRA 1SIZA 1QTNB 3IM8A 4ZMMA 2QWLA 3HPGA 5F8IA 1UWBA 1N33F 3BYPA 2R9LA 2QLWA 1IWAA 1OKJA 4LBIA 1R7IA 3GFZA 3DOLB 2V6AA 3OYHA 3U9DA 3M6VA 2RD5C 3CETA 3D6TB 3FEXB 2VWBA 1R31A 3R5CA 2IMOA 5GAGP 3W2VB 3FGVA 3SV3A 5HVGA 2QEXN 1Q78A 1HUXA 2DHGA 3U4LA 4F02A 4ETZA 2ZC4A 4H0VB 3LWLA 3AVJA 4J9SA 3FJ2A 3ZEUB 5IV3A 3NAIA 1YX2A 3ZNUA 2ACYA 2L08A 2CXEA 1Q82O 3ID8A 4FWNA 4FWLA 3LPEA 3GFHA 2CZ4A 4CLFA 1S12A 2BACA 4EP5A 1NHUA 3GIKA 1PYOB 4HVJA 3M1VB 2ZM6J 3QZ7A 4OJHA 1Q86O 4GV9A 3AD8C 4C7QA 3B8AX 1PC4A 3V9UA 2LQJA 4FJ5A 3K0JA 1X9MA 1M5PC 5C2FA 4OMFG 1ASUA 2XYGB 1EAYC 3W1YC 4LF4F 4DR7K 4CGFA 5GVQA 1LWFB 1P1TA 3SPYA 2AIRB 1UZDA 3I8BA 3ELHA 1X4EA 2CWXA 3MR2A 1M1GA 3G4SS 4KHPF 2J0SD 4ZN3A 4QR1A 4FYDA 3OLBA 4WFBL 3SFUA 4CI0B 1RWMB 1YBAA 1P1LA 2AF6A 2NXNA 4CO5A 5LMNJ 3R6LB 1UA0A 5CD4A 2QSWA 1RCXB 1SV5B 3TUPA 2I8EA 2NR0A 3DOLA 1X4AA 2J9EA 1HKGA 2G0JA 1C4CA 2EBEA 2UV8A 4KO0B 5KI6A 3W2VA 1CS4A 4ISEA 4OZ3A 2XSJB 5E3QA 5F8HA 3UN2A 1NJIO 3NRBA 3EX7B 4GC7A 5KPRA 1TUGB 1P9YA 1TVRA 5KFEA 4GO7X 1PCAA 3ZLJA 1Y11A 1WAFA 3ZEUA 4A48A 1LV5A 5JUMA 3T1HJ 4BRGA 3M8SA 3D6MB 4PKGA 4OX8A 4J9OA 4C8LA 2RILA 4W98A 3GIJA 1F6TA 4FW2A 1F5BA 4V19J 2XHCA 1CQNA 4BE1A 1H2UX 4FJKA 4AF1A 3WUHA 2C2NA 3WEEA 1YIJS 3PYEA 1U2VA 4MKYA 1IXKA 1BQMB 1IBMK 4B8CA 3KNAA 4AXJA 2O4IA 3QMQA 3A1YG 5AT1B 4DR6J 5EY4A 3M6GA 4J9RA 1LWFA 6AT1B 3TQ1A 4EBEA 2BEFA 1LFPA 3P5BP 2EEYA 1XEZA 1NEEA 5CE3A 1U09A 3OTOF 2XMJA 4DV2F 4FBTA 5LJVA 2YKMB 1W2BR 3DXBA 4KGMA 4U7BA 2A42A 3DRYA 1RKIA 2C2DA 1XNRJ 4RO0A 2YKNB 3MDFA 1S10A 2XWYA 4XDCA 3MR6A 4JI3F 2VQEJ 1Q81T 2IS3A 4DLEA 2EG1A 1SV5A 5BRHA 1VQ9S 4LF6J 3ZFVA 4IR9A 2J5AA 4LVNP 4ZVPB 2YNGB 1X9SA 4CZGA 2XSJA 3MPWA 3GV8B 3VGUA 4GW6A 3U1MA 4I2QB 3HD2A 2G8UA 4I6WA 4ECYA 1CBKA 2DNLA 2DNOA 3ZSOA 5IWAK 1FFGB 1U8WA 2JX2A 5AQVA 2ZHBA 4YP3A 3NNHA 2YPZA 1XMOJ 1NMNA 2OEKA 4Q2LA 3ENOA 3G71N 3M8WA 1YZ7A 4FCYA 2V7ZA 1FFSB 4E19A 3KXDA 1QD1A 3KTQA 4IFYB 4JHDB 1H2TZ 2QA1A 1KHWA 2AHOB 5ETRA 2I7PA 2HRTA 3LDNA 2HBRB 4DR3J 1BQMA 4XK8C 1SKWA 1QY7A 1Q7YT 4BE2A 2L9WA 4OO1J 1HQ2A 2IBOA 2G8FA 4C0OC 4WP8A 3NG8A 1NB7A 2P5GA 3O6WA 5D6GA 3GWCA 4F4WA 2P5VA 3WHIA 1X3NA 2RNEA 2OEJA 3FBEA 1W9HA 2OGUA 5CH7B 1U1LA 2WW8A 3QEWA 3LDQA 2F8TA 2CZ9A 3EZ5A 5EN1A 3WXMB 3KFWX 2CDRB 2DPNA 2F7TA 4B9UA 2YKMA 3EE8A 2UXCJ 2ROEA 4JI4K 1WC0A 4W5QA 1OYEA 1BWEA 1QUVA 4ANCA 4G1IA 4Y0FA 2DEJA 2C3MA 2A5XA 3MHYA 4P2SA 3MM8A 2ZH2A 3CC7S 2RKIB 1PILA 2HVZA 1DZ5A 3DMJB 4RW8B 2FC0A 4B9TA 5GMKa 1UEVA 1UEUA 2CQPA 2CPHA 9ATCB 3EDQB 3DYAA 1N5YA 2YNGA 4FZYA 2EK6A 3KK2A 2H3EB 2KZZA 3PFOA 4RW7B 5AJ3K 3S1TA 4G6VB 3CO0P 1QAJA 4DU7A 4I2QA 2YHWA 1VHXA 1GX5A 2AZ1A 1RXOB 1JJCB 4FBUA 1HI8A 2BW7A 4ZPVR 3H40A 2K3KA 2FGCA 3ILJA 5BN9A 2YX1A 3OW2M 2DRBA 4F04B 4IFYA 3DFEA 3CTRA 1AXQA 5AZIB 1BIUA 1NPPA 3H8YA 4NI2A 3QAEA 4LVOP 3OL6A 1JCEA 2E5HA 1H7WA 1WI6A 4E7LA 3QESA 3UN3A 1T7PA 2VG5B 4MMOA 1OQ6A 2MKCA 3NY0A 3V4MA 4OI1A 5EOYA 2VCPA 1IR0A 2QA4S 3MCAB 3KK1B 4UUWA 2HBMA 2W2PP 2J76E 1JLGB 2CJKA 3OYEA 3MN6A 5D0EA 1L3VA 5HSPA 3C8YA 2MQPA 1UVNA 2K7JA 1J2VA 1AW0A 1S1XA 3CCUS 2KHDA 4KGXB 2O3DA 1WACA 1G2EA 3CCSN 2HMPA 2PMHA 3CD0A 5IM0B 1TQLA 1WD6A 3FFKB 4QYRA 5DRKA 3TA2A 3HVRA 2DK2A 2NXJA 5LSOA 1XC9A 3GJRB 2RKIA 4JK8A 2B7CB 4Y6IA 3DMJA 4RW8A 3AOBA 4QWDA 2LXUA 1YXQA 1FNOA 3MI7X 4F4KA 2DITA 2AKWB 3KHYA 2J8SA 2GUPA 3K5OA 3LZIA 1JJ2M 3DJCA 2APOA 3OVAA 2QL5B 1HNXJ 3BSAA 3CC2N 1VQKN 4BGAA 1BHLA 3R6MA 2H9ZA 2ZE2B 4IFVB 2K1RA 3EXYA 3RG6A 3W0LA 1VSJA 1YHQS 3KHLA 3R1XA 2M9KA 1YAGA 4OYOA 4ZLJA 2IA6A 4IOCQ 3VF4A 4FLVA 4LY7A 4L3KA 1REVB 4KTZA 3I87A 3CFRA 2EWSA 2CNOB 2O1PA 4WCEL 4FLTA 3GFXA 1UVMA 3I5BA 2IM3A 1NGHA 4NYZA 3BDPA 4L3QA 1IBMJ 4DR1F 3Q0AA 3KJVB 3KK1A 1H2VZ 3SSRA 1LNQA 5I9EB 1JLGA 3WQPA 5KRSA 2ZNZA 3ULHA 2MZSA 3DOMB 2GC8A 3K0SA 3TX8A 4DTXA 2ZZMA 1MROB 3L4QA 4CJKA 5KGXA 4J5OA 4CLPA 4BRPA 3NS7B 3PHTA 3VEYA 1HA1A 2YX7A 5EUHA 4JYAK 3I96A 4K59A 2CUYA 2E66A 2ZHOA 5KFSA 1M0SA 3BGOP 3EVWA 1VS3A 4DPOA 2LXFA 1EKEA 4NXMJ 3DN9A 1XR6A 4YFUA 1HNVA 2H1YA 1RWNB 5LJWA 2E1RA 1XR7A 1FCAA 3GE9A 3E3XA 2CGKA 3CGIA 1HR0J 3NF7A 1KRPA 1J5EJ 2RE1A 2XULA 1OPIA 2IC3A 1KQSR 4L6V3 3TW0A 3EO3A 1WSEA 1DARA 3LGNA 3W9JA 4QCLA 4BRAA 4Y28C 2ASDA 3THPA 3GV7B 1X1PA 2DY4A 3FSIA 2BV3A 3NOGA 1FD8A 3OTEA 2XGQA 2KW4A 1ZTWA 4IFVA 2FVRA 3ATUA 2KFZA 1NDCA 3THXB 4IH7A 4IG0B 1NUEA 1G6BA 2G1HA 2Y1IA 4E1MA 2XQCA 2CPZA 4X65K 4DHYA 1RWOB 3DLHA 4OPAA 1BUXA 2XS2A 4F9OA 4LF9K 2IA0A 4JI6J 4N8NA 3I55N 1ZBIA 4AQYJ 4OZ5A 3L3UA 1KAXA 2V67A 1K8AO 4RTFD 4DN0A 1B0VA 3M8PB 2CPEA 3KJVA 4ED2A 1VQ4S 2N3OA 4X4NA 3R5AA 4FJ8A 1A5XA 1M90O 3NH2A 4I4BA 3I5CA 3QYYA 1RT4B 2RU9A 4C6AA 1SIWB 4OYIA 4C3LA 3H6EA 2HZVA 2JDJA 3CCVN 4HH1A 5AQIA 2P9SA 4HACB 3DWLA 3QFHA 5IOLA 1N0UA 3GG1A 4KRWA 3FBBA 2W01A 4UOHA 1HBUA 2HHWA 5ETVA 2AP6A 4F0KA 2DIUA 5KG3A 3PJ9A 2NRVA 3ZSZA 3DGVA 1P90A 2J7KA 3OHAA 1JLAA 4M3RA 4DV5F 2MHNA 1NU4A 3AAQA 1YJNS 1UZHA 4DX5A 2F8MA 4RWTA 2C3OA 3HK2A 3CCZA 4MFBB 4B3SF 2YKAA 2FJEB 4DTOA 3C6HA 4ZTFA 1XHXA 4Z4GA 2OSRA 3BBBA 4HH0A 1N6QB 2ATQA 3THXA 5LXRA 2XLIA 1J53A 2X1FA 2GJ2A 2DBBA 4DTJA 5C12A 2FVCA 1RACB 4ZPWR 4OFZA 5B0CA 4DTMA 2AU0A 4GVEA 1N36F 1OS5A 1RBVA 3MAQA 1K6YA 3CO9A 5M1QA 4J91A 3HHLA 4DV7F 3QERA 2HF4A 4R8UB 2NRTA 1HNZK 2QFJA 2XG8A 2NZCA 4CF9A 4I2PB 4ED5A 4WE1B 5JLHA 2N82B 1C1CB 2YWFA 2OELA 2A3ZA 1AB8A 4MDBA 4DR5K 1RT4A 3MK6A 4FVUA 4CF2A 3AARA 5FPDA 2Z4PA 4WWSA 2XS5A 4IRKA 1F9HA 4ED4A 4DL6A 4B3RF 2W40A 1PBUA 2K7KA 4HACA 4KI6A 1YRXA 1WWHA 4G3IA 4A8KA 3RBEA 4NZ6A 5CHIA 4GV6A 1TL4A 3VVTA 4RBTA 2DGTA 4ZTJA 1NNDA 4PKIA 4IOXA 5DM7Q 1IM4A 4WFXA 2F4VK 1W7AA 2HURA 3AA5X 3VGLA 2B8PA 3J7YU 4EWTA 1QE1B 4LSNA 2ZJPQ 2AYMA 1O0PA 4K7QA 2WBMA 4IYQA 5E33A 1SJ4P 4MFBA 1KFSA 4M5DB 3O3GA 3L2VA 4TYAA 2VFUA 1FRIA 1CPZA 2HVDA 3PRVA 2F96A 3ZSWA 2C2MB 5AQKA 3PACA 1D9FA 1FRJA 2IHR1 3AO1A 1VAZA 4ZJQA 3BO4A 3PZPA 2N3LA 1FRKA 2GNKA 1FO1A 2ZQBA 3D0GE 4GNIA 1P8ZA 3D45A 5FPMA 4R8UA 4TN2A 3SEOA 1EHWA 2IYGA 1YUWA 2ROGA 4JKEA 4I2PA 4WE1A 1U6BA 1RAHB 2FHKA 1IKYB 4PCQA 5CZVA 3IRXB 2ZH4A 1G3OA 2Y3YA 1AYEA 4U67L 2JL9A 2O66A 1KLMB 2RPIA 1KAZA 4M1KA 2DH8A 4EEYA 5KT5A 4X66F 3IBWA 1MNEA 4N8OA 4M5GA 1SKUB 1YJ9N 1X0FA 2Q6BA 2J0WA 2E5LJ 3ETMA 1EX8A 4I64A 1SC4B 2JJ4D 3QB0A 4DSKA 2HKEA 3L7PA 1N56A 3D1QA 4N41A 5LL6d 4E7KA 2V68A 2A41A 2FY8A 1HBMB 1XMQK 4FJJA 3WNHA 3AD7C 4DI6A 4M5DA 2QXLA 3C0BA 4FM2A 3FE1A 2KYXA 4KKOA 3V6KA 2H5IB 4F36A 3AVIA 1VYAA 2LU2A 2NCKL 3BEGB 4MKVA 3BQ1A 4U7UK 1AZSA 5IT9U 2RMLA 3GYNA 3FCHA 3D66A 2CVEA 4EU0A 1NGJA 5LT5A 1A7GE 2R7OA 1UPMB 4CYUA 1HWKA 2W2OP 2ZH8A 2LMIA 1RAEB 2X78A 2CPFA 3FSYA 3IM9A 4PUOB 4X64F 2RDDA 3VHQA 3O8MA 1ESVA 4TLQA 2MZTA 2XMUA 4X65J 2Q79A 4LIRA 5E7OB 4TU7A 4OPJA 3SJJA 4OLBA 3W61A 1DLOB 1VQ5N 1IKYA 2QZ8A 2OPQA 5CYQB 5AQYA 2ADBA 2FZKB 1WBBA 4JI7F 1CXQA 3AVMA 4NZ7A 1S1WB 2BBEA 2VU5A 1NH7A 3IS9A 1VSIA 1YITN 1ZA1B 3UE5A 5GAHI 2A2DA 2HG4A 3VAJA 2V4JB 3CPEA 2FLLA 1XK8A 3T1YF 4AM6A 2WOMB 1NRKA 4CEAA 3HT3A 2HW3A 2E44A 3RAQA 4H0OA 3PKYA 3MFHA 2KT2A 5GAEI 3MUMP 3M2RA 3TTCA 4CJ5A 3HZEA 4OVLA 1RADB 2RN2A 3WZ0A 3VALA 1GXUA 1HW9A 4DL2A 1HBMA 2CNLB 4KGVB 4PKDB 1ZPVA 1S48A 3VQAA 3ZXWA 3HCXA 1U2CA 4PWWA 2DISA 4KY3A 4DMZA 1VSDA 1A5VA 4DX8H 4XH4A 2C2ZB 2M52A 4U6PA 3H2UB 4QW8A 2BQRA 1IQTA 5DQGA 4JRPA 1GMWA 5D77A 2V9KA 4HTJA 3PSIA 1PIEA 3U02A 3KG4A 1IH7A 2W6KA 1ZM9A 2XMMA 4OZJA 4GV3A 3H5SA 3DU6A 2HSTA 4USWA 2CPIA 2X1AA 4DPTA 4PUOA 2M2BA 3PXGa 5FD1A 3HSCA 4CEEA 5AQSA 1QVGR 2DPIA 4IOAL 3FR0A 1KTVA 4JAXA 4DCPB 3NE6A 4EP4A 5BPLA 1BXNA 3GMGA 2H48B 2BR0A 4LRDA 3C65A 1DLOA 4H0TB 2FC8A 5CYQA 2KG0A 1FX4A 3EN9A 1T11A 2QT7A 4BRFA 4NXNK 4M5JA 1L5UA 3ULEB 2E6LA 2CQIA 4RWWA 3UKRB 1DTTB 1SZ2A 4BC3A 3VTHA 3HFKA 1NGBA 3PYGA 3FCWA 4LFAF