4DUZK

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4duzK00
4B3RK 4K0KK 4DR1K 1N34K 2F4VK 4AQYK 1XMOK 4DUYK 3J7YP 2UXDK 5IWAK 1IBKK 3JAMO 1HNWK 4JI4K 3J80O 4LFCK 4GKKK 4LF7K 4DUZK 4B3MK 4JV5K 5BR8K 4DV2K 3T1HK 4NXNK 2E5LK 2UXCK 4DV4K 2UUCK 4JI2K 4B3TK 4JI5K 4DV7K 2VQEK 4DV0K 4JI1K 5A2QO 4LF8K 4X66K 4OX9K 4YY3K 3J81O 3T1YK 1I94K 1IBMK 4JI3K 4LF5K 4GKJK 4JYAK 4DR5K 4V19S 5AJ3K 4DR3K 1FJGK 4NXMK 4YHHK 1IBLK 4DV1K 2UU9K 5IT9O 4DR6K 1XMQK 4LF9K 5LMUK 2HHHK 1HNXK 4LFBK 4LF6K 2ZM6K 2VQFK 5FLXO 4X62K 4DV6K 4DV3K 4LF4K 1XNRK 4X64K 4CW7B 4JI7K 3J7AP 4LFAK 3OTOK 1N33K 4DR7K 4CVNE 1HNZK 4DV5K 1HR0K 4KHPK 1N36K 2UUBK 2UXBK 4JI6K 4X65K 4DR2K 4JI0K 5LMNK 2UUAK 1N32K 4B3SK 4DR4K 5LL6Z 1J5EK 4JI8K 1XNQK
chains in the Genus database with same CATH superfamily
1G99A 3L3UA 4MFBA 4FZXC 5CYMA 2O8CB 4WQ4A 4K41A 5GIOA 3KZBA 3ZEUB 3CJBA 2P9KA 1HJOA 3CD6N 3PY8A 1KFSA 1H1VA 4DV2K 1SQKA 1NK9A 2HVHA 3F9KA 4FL9A 5AQVA 4Z4GA 3OJUA 2UUCK 1ASVA 2KZMA 3MEEA 4B9MA 4ZTFA 3EO3A 1BIUA 3LPUA 1C0MA 3K2PA 1W9HA 1B92A 4JK7A 2XY7A 3PX6A 3THVA 1HRHA 4WFNL 1I94K 4FWSA 4FLXA 1YT3A 3TAEA 4J2BA 3P38A 4PHTX 1VSIA 3D2EB 3K58A 2WOMA 2BGGA 1Z25A 2ZGZA 1RT1A 4YORA 4BR7A 5KPRA 3LAMA 4FLUA 4DQIA 1HKGA 3WEEA 4M3UA 5HBMA 3AO1A 3BZKA 5SWMA 2E20A 1QZ6A 3VGMA 3UKUB 4JKHA 5HRSA 2A42A 3TPQA 4AHVA 2O8DA 1KSPA 2VYPA 4DV6K 1P8ZA 2WONA 2HHQA 3M8RA 5AQZA 4ISGA 4CJUA 3V81A 2NRVA 2NUBA 3H45C 4M3TA 4B8CA 3CETA 3KVGA 1EWRA 2Q0UA 2QWOA 3SQ2A 1TK0A 3DXMA 3N4QA 4GNIA 4KHPK 2AJQA 3AVBA 3E9OA 4MO4A 1HYZA 3HPGA 4CJKA 5AQHA 4W5NA 5KPZA 3T19A 4BC5A 1S6QA 1YVUA 1YAGA 4B3SK 3SK3A 2FSJA 2KHOA 1XNQK 4B3RK 3TTDA 2D0OA 3LZJA 1X9SA 2OA8A 3EL2A 3VQ6A 1T05A 3ZSRA 4CHNA 3M8PA 3LDNA 1D9FA 4Y0WA 4BC3A 1J54A 1VSJA 1N6QA 3HXMA 3RR8A 3FFIA 4CF1A 4XIUA 2P9IA 4IDKA 1BWFO 5E84A 2A5XA 4N5SA 3DJCA 4BC4A 2JWLA 1RDAA 1IO2A 3AARA 3ENHA 1NK8A 4FK0A 2CH5A 4H0XB 3OYIA 5GADP 3WUHA 4ISFA 4FWOA 3K0SA 3K5MA 1ASUA 1QVGM 4CJPA 1YVNA 3HM9A 3NFAA 5KGXA 1KAXA 3O1BA 4JI3K 3VQDA 4YOYA 4JYAK 2CGKA 1YUWA 3HL8A 3O6WA 3QIPA 1D5AA 3IG1A 4I6MB 1QQCA 4K8XA 1VRTA 4BVOA 3RWUA 5AZJB 3OY9A 1IBLK 3G10A 5SZTA 4HTLA 4DV1K 4CJWA 2PBDA 1W97L 3LAKA 1UAXA 1BGXT 5AQJA 4B1UB 4NCBA 3SBGA 3MN9A 4IFYA 2BUPA 4FLVA 3AVNA 1SKSA 3F9MA 4MO5A 1OVQA 3SAFA 3D45A 1U2VB 3AO5A 3RTVA 4BREA 1NM1A 1HPZA 4JRPA 4IKFA 5FPEA 3LPTA 3CQ8A 5AQKA 5I42A 4RCHA 3SUQA 4IO9L 3KLIA 4KH5A 1CZ9A 2D0BA 3NGYA 3VGKA 4DG1A 5AQXA 1J5OA 3NBPA 1Y97A 4CECA 1ZYQA 3LDLA 2E2NA 1KC8O 4BR2A 4CHQA 3OYBA 3O4NA 4E7KA 3L2UA 1NGFA 3TWHA 1B9FA 1TKTA 4E0DA 4F2SA 1NKEA 4CBWA 2KFNA 4H5NA 4DQQA 1WSIA 3QBWA 4UQGA 3NH2A 3LP1A 2E2PA 4KRFA 2HNDA 4CBXA 1UWBA 4FO0A 4E89A 1WSGA 1B9DA 3OS0A 3T1HK 4EAHD 2HW3A 4W5OA 3CC7N 2YJEA 4KBOA 1DTQA 3MN7A 2QM1A 1RBUA 2OPPA 3C65A 1LV5A 4QS8A 4BRIA 3AGRA 2XY5A 1L3SA 4IG0A 3SV4A 4IBNA 1KFDA 4YOXA 3NAEA 3U6FA 3OBWA 5AQTA 4BRLA 4BRPA 1TYQA 3GBTA 4CI6A 2DTUA 3O3FA 1NJXA 3C0BA 3MECA 4GY2B 5BPMA 4J2EA 3HVRA 3CCSN 1NG9A 2ASPA 1R59O 3SUPA 4QS9A 1TL3A 3AVHA 2FF3B 5AQPA 3OA9A 4BE2A 2PY5A 4OPAA 4M42A 3AGKA 4DV3K 3H1QA 4OPHA 3H46O 1TKXA 2RPIA 1D4XA 4FK4A 3E01A 2ZGYA 2G8IA 4JD2B 1SKRA 5CR4A 1Y64A 3W0LA 3O9RA 4DFMA 1HX1A 3C7NB 3CF5L 1N36K 3QERA 2UUBK 4OGEA 2PFUA 2RF2A 4AHCA 4KTZA 4JI0K 3P1GA 4YFUA 3IDHA 1RFQA 2BTFA 3VEZA 1JLEA 2F9TA 3AA2A 4MQ3A 1JXBA 5EXWA 2EWSA 2YX6A 1BU6O 3EN9A 5M1NA 2P5OA 1LW0A 2KZZA 4Y1CA 2O8BA 4JN4A 1NKCA 4KH4A 1Q86O 4PQUA 1BQMA 1VSEA 4C8NA 1T8EA 3VQ5A 3GE1A 4BRNA 3FZKA 3I56N 3H3OB 1ZBIA 3F5TA 2G8VA 3UE5A 1RTDA 4JV5K 4FM0A 5CYQA 1NJYA 2ZWHA 4CEEA 3U4LA 4CF2A 1GLLO 1YI2N 4CJTA 5AQLA 1WUAA 2I7NA 3MX2A 4FWRA 4XH5A 1D9DA 1XQSC 3MWTA 3VF4A 4OLAA 4OLBA 2QKKA 4BGAA 2IGIA 4JRQA 3AAQA 1A5VA 2V52B 2FC0A 2VCPA 4PKHA 4KHSA 3T3FA 4YY3K 3MEGA 3CJCA 3CG7A 3AVKA 4JAXA 4DLGA 1NOYA 3LM2A 3K5LA 4V19S 4Z4EA 1RDUA 3QEWA 1OH6A 5HOOA 5KRTA 3KWIA 4GW6A 4PL7A 3RRGA 5J2PA 2FLOA 2PZSA 1SAZA 3ZSZA 4B9VA 4YOTA 4WF9L 1FKPA 4FJ9A 3GL1A 5LMUK 1TKZA 5F2RA 2XHBA 1VQON 4CJ3A 4FJGA 4N76A 1NWKA 2QWQA 1VSMA 4KFBA 2Q2RA 3A5OC 4BRFA 3B8AX 2YKNA 4BE0A 3J7AP 1X9MA 1OKJA 2P9NB 1QS4A 3SZ2A 1RT5A 3HP9A 2IDOA 3DLBA 4H0PA 4FLTA 4B08A 4KTQA 1NK6A 4C8LA 1QHAA 1Q9XA 1SL2A 4OO1J 4M3RA 3CJ7A 2DY4A 2F9WA 3N4PA 4OVLA 1Q9YA 1IV0A 1TL1A 3AVAA 4K25A 3V1QA 3KHYA 2OPRA 3THWA 5AFUH 4FZZA 1VSHA 3U3YA 4B9QA 3MDQA 1VQPN 4HTUA 3SUOA 3EYZA 3MWPA 4RW7A 1HYSA 3HTVA 2P1JA 4DR1K 3ZT0A 3G71N 2D5RA 3RMDA 1BOTO 4CEDA 3O5BA 1HUXA 1WAFA 4DUYK 1HYVA 2P9KB 4IFEA 1JLBA 1NBWA 1BA1A 4FYDA 4ID5A 4CK3A 1S1VA 4AM7A 3NE6A 1QQNA 2H3GX 4R5PA 1JL1A 1GOBA 5AQRA 1TVRA 4GV3A 5GAGP 1HKCA 2HVIA 3K5NA 4BRAA 4KPYA 3R8EA 3ALYA 4DB3A 1KTQA 5JVHL 1IG8A 2QXFA 1GLFO 2O8EA 2IOCA 2EX3A 3DOLA 2HSTA 4CEBA 4M41A 2FSNA 3KLHA 2KKZA 3J81O 3JYTA 1W7AA 1P90A 5AFUA 2Q36A 3CFOA 5KI6A 4DR5K 4FPAA 1NGHA 4J2DA 3AO3A 1JLFA 4PL8A 3WEEB 1QSSA 2E2OA 4HCBA 3HI0A 3KIOA 3LP2A 1D8YA 3ZSQA 4JS4A 1EO1A 2PYLA 3K59A 2O8DB 2E1YA 3C95A 4BRGA 5AQMA 4X62K 3CCRN 1S1UA 3CC2N 1XNRK 3C6UA 3QESA 3V9XA 1L3UA 3CCEN 4J2AA 3F73A 4QAGA 4CGJA 3AVIA 4W5RA 3DRRA 3DXMB 4DQ8A 4WCEL 3ID6A 1C0GA 4U7BA 4E3SA 3K57A 5BPNA 3MN5A 3AVMA 4C8MA 1S22A 1GLBG 4H4OA 4FOEA 2UUAK 4H0TB 2QWNA 4B1WB 1NGJA 4C1NK 3MMVA 3VQ8A 3I55N 4DCHA 3G0ZA 3O9UA 5DMRA 3RR7A 1ZBSA 4CHZA 1RTIA 4CGDA 3FR0A 1EKEA 4ZTJA 4JI8K 3TARA 1BL3A 2CGJA 3CPEA 4NO7A 3KK3A 1ESVA 1RDCA 3QICA 4AQYK 1I3AA 4FJMA 1KCFA 2P9IB 1UA1A 2BE2A 4CFDA 1KQSM 4JKEA 4OKEA 4B9SA 3O9SA 3VQEA 2YJFA 1HQEA 2W6KA 3LALA 1L5UA 5CZ1A 5LJVA 1TUYA 2YCHA 1EETA 1XC3A 4DV4K 3CJ1A 4CFBA 4DS5A 3VEYA 4YOWA 3EE9A 1RT6A 1VQMN 1IKWA 1DKGD 4G9ZA 2F96A 3ENBA 3QETA 2D4WA 1RBTA 4M45A 1VRUA 3AVFA 2OTJN 5J2NA 3CQYA 3CCLN 4EHUA 2QW9A 1RILA 3ISNC 4A2AA 4KAZA 4FWMA 2HOEA 3BEXA 2V51B 4DTXA 2NRTA 4KV8A 3QEIA 4FVUA 3L0QA 4NYNA 4LF9K 2KFZA 5HRNA 3R3LA 1JXEA 5KGWA 5KQDA 3IFRA 3TTFA 3QNOA 4H5VA 1GOAA 2HHHK 5B8HA 2ASOA 4KB1A 1BHLA 4DLEA 5LY3A 4Z4IA 4IDHA 4A62A 3A5NC 3SUNA 4KHWA 4LF4K 1KXPA 4DTPA 1KAZA 3DLGA 4CW7B 4XEIA 3DRSA 5DM6L 3THXA 1ITGA 1S3XA 2KTQA 3TAFA 5AQOA 4DSIA 3KK7A 5JMVA 2E88A 3AAPA 3I8DA 1RNHA 3TANA 3H3NO 3PV8A 1Q8IA 4CZKA 3D7EO 3HYFA 2GTDA 4BRKA 4EP5A 4HHTA 2AA4A 1O1WA 4A61A 4CJVA 4DQSA 5KTQA 3O3GA 4CZMA 4KB0A 2RKIA 4Q5VA 4N41A 4BE1A 4ILHA 3ZLJA 4FLZA 2O8FA 1V4TA 1EP4A 4W5QA 3CI5A 3MXMA 1X3NA 4BDZA 3L4QA 3M8SA 3WXLA 1IBKK 2P5GA 1ILYA 4LSNA 1CXUA 4ZHRA 3EZWA 3E9PA 1IKXA 1YITN 4B9LA 3SNNA 2P9UA 3ITHA 5J2MA 1QQOA 4FXDA 2IS3A 4B8AB 1WOQA 1YHQN 3DLLL 3I33A 4E1MA 4PY5A 2RHKA 4I2PA 5M1KA 2G8UA 5FPNA 4H03B 1ZC6A 2XRIA 2ZJPL 3G6EN 3RMAA 3LM9A 4FWLA 5J2QA 1SUQA 4FJ8A 4DV0K 1VAZA 1VSDA 5A2QO 2P9PA 1WSFA 1U48A 2YNFA 4ID1A 4JLHA 1TV6A 3L2VA 3OYMA 3QFUA 2DFHA 1LAWA 1K8AO 1TYQB 3OYEA 3Q7CA 4Z4CA 3SPYA 4JKBA 1W2BM 4B1ZA 1TGOA 4BRHA 4Z4FA 4CJEA 2Y1IA 4AH9A 1JL2A 2FBVA 3Q7BA 3OS1A 5FPMA 4AHUA 3TTCA 2I7PA 4NLBA 5JICA 3ZX0A 4WFAL 2X74A 4H8KA 3AY9A 3EKUA 3CFRA 3FZFA 4AHSA 2Q1NA 1YJNN 2G8FA 4DR7K 4CHPA 3VQ4A 3OS2A 4QS7A 3LWLA 3NGIA 1JCEA 4H0VB 1KAYA 4HUGA 3C6TA 3L2WA 5HROA 4B9NA 1T3VA 4RW4A 3IRXA 2UYTA 1MU2A 2DFFA 1LCUA 2HB5A 2Z1GA 4DSJA 1BCMA 2P9LA 2YI1A 4LD0A 1DEJA 1NK5A 4FPBA 2O8BB 4A57A 2A3ZA 3NVKA 4CJ7A 2F8SA 3SAHA 5DK5A 2JWKA 3MEDA 2Q31A 1GLAG 1RTHA 2UXDK 3TAPA 1T6DA 3ZSXA 1HJRA 2QWMA 3T1AA 3J80O 4EHTA 3PO4A 5F0XA 1U45A 4PA1A 4OJRA 3ZT3A 5BR8K 2O4IA 3IKMA 3O1WA 2V7YA 4FVMA 3VTHA 3THYA 2GUIA 1N8RO 1QVFM 2VGNA 2E1ZA 1GLJO 3VEVA 4R79A 1NJIO 1K9MO 4X66K 1JLQA 4CJSA 3IS9A 5HRPA 5CE3A 2QWPA 3T1YK 4ELVA 2OYQA 3M8QA 5TKWA 4RW8A 5KPTA 4DSLA 4JKDA 3VQPA 3FZHA 3AVGA 2VWBA 1SKWA 4JKGA 4DQRA 3PUFA 3R1XA 3SPZA 3SI6A 2X6SA 1SV5A 4H0YB 1MDUB 3AA5X 3OYKA 4LF6K 1DTTA 4FLWA 2WC9A 3FE1A 5AZIA 2G8HA 3BZCA 1VQ4N 3CCUN 1TUUA 1U47A 2OPSA 2EHGA 2ZD1A 4BWJA 4OGCA 3VF6A 2CGLA 2YHWA 1RT4A 3DOKA 3NF8A 3OYLA 2QA4N 3ZYYX 3SJJA 3RSEA 3THWB 4DWIA 4HVJA 2VG7A 3V9UA 3A2FA 4JKFA 3BY5A 3ZSOA 4CESA 4BRDA 1KRPA 3WQUA 3VF2A 5JLFA 4B3OA 3SQ1A 3HSTB 3L2RA 1MWKA 4FM1A 1YJ9N 2KW4A 3OYFA 4MLHA 3NDKA 4DSFA 1E3MA 3NF6A 4FWKA 4O55A 2HBMA 3M6GA 4ILJA 3UIQA 3LL3A 1VK0A 3NF7A 3LDQA 4F2RA 4RW6A 3WNFA 4CGIA 4M3YA 3S3MA 1U4BA 4GVEA 4LY7A 3OJSA 2FXUA 2D0PA 3G4SN 5MLCQ 1V4SA 3MCPA 2GELA 4GKKK 1K6YA 2HBKA 4BC2A 1TKDA 4B3MK 4U67L 2O8EB 4C23A 4E7IA 3TR8A 2UXCK 4OPJA 1QE1A 2FBTA 4DSEA 1YF5L 5ADXH 1NJZA 4KI6A 3P5JA 4CZHA 4JI1K 1NK4A 4CGHA 4DFPA 4OX9K 3WNEA 1BA0A 5CZ2A 3F2KA 5ELZA 4IOAL 1NK7A 2B4JA 3HP6A 5C15A 1CZAN 3KLFA 5C12A 4JKCA 2ETJA 1LWEA 5FDLA 3WNGA 1XMQK 3TAMA 1WNSA 4B9TA 4BR4A 5M1OA 4IOCL 2E6LA 1TAUA 3O80A 5HLFA 5BRDA 4E1JA 4X64K 4KI4A 1N5YA 4AF1A 3KJVA 3PX0A 2HHUA 1XHZA 1G15A 5BR9A 5BN8A 3OYHA 4EZ6A 1C0UA 4JKAA 3OYNA 4AHTA 2J4RA 2ITMA 3U3GA 3DXKA 4C8OA 3CC4N 3OW2M 1TK5A 3T69A 4BG8A 4F4KA 4O0JA 3HPHA 1BO5O 4ILGB 1S1TA 4YOVA 3VQ9A 3CJ9A 3EKSA 2IAJA 5LJWA 4KHUA 2I5JA 4CGFA 3IUCA 1XHXA 3DLKA 4FJLA 3SQ0A 3H6EA 4C8KA 1I39A 4BROA 1NGAA 3RMBA 1HPMA 3E1YA 4WFBL 1VSFA 2W41A 2WTUA 4CJRA 2A40A 3UKRA 1T03A 3KD1E 1GLCG 3AO4A 4O8KA 4GV9A 2IVOA 3I0RA 1LAVA 2YHYA 4MLEA 3OHRA 2HHXA 3QLHA 3C94A 3NH1A 1WBDA 5TKYA 4CHOA 1VQ5N 4MDAA 3VQAA 2NRHA 4O4GA 4LF8K 5C2DA 1VQ8N 2E4LA 2YNHA 2E6MA 2G8WA 4DR3K 3ENOA 1FJGK 4M63C 3ZSVA 5EOYA 4YDUC 4IXCA 4HWIA 2ZJRL 1IKYA 3HBTA 3VEWA 1NU0A 5HP1A 4EIAA 3D2FA 3KK2A 1LOTB 3PX4A 5C10A 1F21A 3RVCA 3H1VX 2P9SA 1RDDA 2ZF5O 2GX9A 4M3ZA 4DFJA 1LW2A 1T6CA 2OCEA 3HVTA 4O5FA 3WQTA 4CEQA 1KVCA 3U9ZA 3THXB 2OZSA 4JI7K 4JHDA 3V1OA 4IG3A 4RW9A 2IVNA 2O4GA 5I3UA 4GV6A 4FWNA 1M1KO 5BN9A 5FPDA 3HJFA 3VQCA 4YDUA 2R7YA 4DTOA 3HSCA 1QQMA 1LWCA 4BRQA 3CJAA 1WSHA 4WYBA 1KVBA 4FJJA 2O8FB 4ICLA 4CJLA 3ZT4A 1VQ9N 4M3WA 4PUOA 5AQWA 3PSIA 1LWFA 1HNIA 3D0PA 1X9JA 3L6QA 1N34K 3GDQA 2XY6A 4CEZA 1TK8A 1Z05A 3VETA 3J7YP 2P9UB 3JAMO 1FW6A 4XH4A 2NRRA 3VA3A 3G25A 5KRSA 2B5JA 1QSLA 3KKRA 3ZSWA 4LF7K 4DUZK 3NGZA 3QEVA 3SLCA 1HKBA 4O0IA 2Z1HA 2IIRA 3CYMA 4FCYA 5M1PA 3LDOA 1RTJA 4DHYA 3OYCA 4B3TK 4JI5K 3CCVN 2P9PB 5J1EA 2GV9A 2A1RA 4BR0A 3DM2A 4KH6A 4DQPA 1BCOA 3WNHA 4LF5K 4GKJK 4ELTA 4DU1A 3AA4A 1GLDG 4EZ9A 1C0FA 1S9GA 3IMXA 3AVJA 5IT9O 1C6VA 4B1VA 2GUPA 4DTRA 4Q0BA 1JCFA 2WUSA 3DWLA 4FLYA 4E1NA 3ULEA 4DU3A 2KLAA 1NNEA 5JVGL 3UB5A 3A8YA 1O13A 4PKIA 5FROA 4AILC 1VQKN 4CZLA 3VEXA 2E2QA 3KD5E 3L8BA 1U04A 2NLXA 2F8TA 1EWQA 4H0OA 4YNQA 3CHWA 5EX5A 4CIGA 2UXBK 2BDPA 4O5BA 4E19A 3CCMN 1N32K 3ATVA 3ZETA 1NGEA 1VQ6N 3O9TA 3DAWA 3FGUA 3U9DA 4DSKA 2P9LB 3MN6A 3GG4A 1XI1A 3AVCA 4TSXA 3SCXA 1WB9A 3FFKB 4IFVA 1WLJA 5C2FA 4IJNA 2V7ZA 3QIOA 2X6NA 3MK6A 3T7ZA 3EE8A 1YJWN 1TAQA 4M3XA 3BF3A 3WT0A 1YXQA 3LZIA 3AV9A 1HNWK 4JI4K 2NZTA 3P31A 4B1XB 2YNIA 3L4IA 2B6AA 3QINA 4KTWA 4OKJA 4RG8A 3NHGA 3H08A 3THYB 1VSLA 2HBLA 2E5LK 2HNYA 4F3TA 1NGCA 3HOTA 4F9OA 4O8UA 1K8KA 5KQ8A 5HRRA 4NLCA 1HQUA 4J8FA 3KLEA 4DU4A 4KHYA 5T7BA 1BG3A 4FWPA 1VSKA 1YTAA 5K14A 3JXUA 3ASMA 3VESA 2A1SA 3MX5A 5AQSA 4DS4A 1IBMK 3NVMA 4I9QA 1A5XA 1R0AA 3OYGA 4QCLA 2PYJA 3WXJA 2YHBA 4HCCA 4JKGB 3P39A 4CIFA 1VQLN 3FZLA 1X1PA 3VTIA 3DMJA 3JSMA 4BR5A 1JLGA 4CF9A 3KLGA 3SYZA 5AZIB 4E7LA 2X78A 1REVA 2IC3A 4LFBK 2Z1IA 4CGGA 4Z4HA 4JNEA 4WQ5C 2OZMA 5EU7A 3VQ7A 4DTJA 1QZ5A 3HK2A 3TSPA 3DLRA 4GVMA 4I7FA 3VOVA 3V4IA 4CZJA 3K9JA 2A6AA 4CVNE 1NGBA 5GIPA 4H4MA 4OKKA 3RSEB 3HRGA 2HHSA 4C1NI 1IJJA 3NF9A 1T44A 3W3DA 4G1QA 2YKMA 4DR2K 1RBRA 5LMNK 4CZEA 3BGRA 4FZYA 1GLEG 4CHYA 3NCIA 1J5EK 4UY8O 4KO0A 4B9UA 1WN7A 2JLEA 2Q3SA 3HPOA 1BI4A 1X9WA 1XWLA 2YHXA 3VA0A 4WQ5A 3ZCMA 3VENA 2GWJA 1XMOK 1HNVA 2BANA 3A0IX 2O8CA 5IWAK 4E7JA 4BGBA 3FZMA 3ZEUA 3DLEA 4LFCK 1NJWA 5C25A 3A5MC 4BQZA 1HLUA 4IWVA 4DKWA 3BUZB 3CERA 4A59A 3OBYA 3R9PA 5C0YA 3I8BA 1S6PA 1NKBA 2CH6A 3CIPA 4IZ9A 4Z94A 3L2QA 3SMPA 2VWJA 4H5RA 3ZSYA 4ISEA 2VWKA 3S9HA 3M5RA 3EZ5A 4DTSA 1J9AA 3TSUA 4BR9A 3P83D 2QXLA 3D2EA 3CCJN 3S3NA 1SS6A 3DRPA 3KK1A 3V9ZA 4BY9C 3VN5A 4EP4A 3ZT2A 3PIOL 2WFBA 2GEMA 2D0CA 2UU9K 3OVNA 1SL1A 2YV0X 2P51A 3OYAA 3AVLA 1HNXK 3KWGA 4CZFA 1CXQA 2ZM6K 2HMPA 5FLXO 1NGIA 1DLOA 4BG9A 4CEOA 3UKUA 2OPQA 2F7TA 4DTUA 4BRMA 5AQGA 3B6PA 1CZBA 5BPLA 3ZX3A 4K43A 2QEXN 3E9LA 3OTOK 2ASMA 3O8MA 1L3VA 2VG6A 3DXKB 4KKOA 3HO1A 3KTQA 3RMCA 3EEQA 1HNZK 1RBVA 4DV5K 3V9SA 4PWDA 4FWQA 2QWRA 4JI6K 1SZ2A 4CJ5A 5DM7L 4ELUA 1NMDA 1WBBA 4FM2A 4FSVA 4NCAA 4DR4K 3D6RA 1VQ7N 3EY1A 4GMJB 4H5WA 3QMLA 3J7ZO 1Z26A 4K0KK 4DTMA 4DTNA 1RDWX 2Q97A 2ZJQL 2F4VK 1BDGA 4YOUA 3DLHA 2FBYA 5AQQA 2OTLN 1BIZA 3SJHA 2QWLA 3CM5A 4L3QA 1DGKN 3UKRB 4JS5A 1U6ZA 1Q7YO 3SBTA 4N56A 1FK9A 2NRWA 4Y1DA 5E41A 1SL0A 1BUPA 2ATQA 3FLCO 3WXMB 4LC9B 3PIPL 4A5AA 3CCQN 2QK9A 3AO2A 3QDKA 4I9LA 3TI0A 4KHQA 3CFPA 1ZXOA 1EX4A 3LP0A 3P4IA 1FXXA 3BDPA 5D3GA 5GINA 3ZT1A 4M7XA 2Y1JA 2HHWA 3LDSA 5EY4A 3TU5A 3MCAB 2Z1JA 5BREA 4CJ4A 3O9QA 1NMNA 3D2FB 2HF3A 2WBNA 1KLMA 4I6MA 4YHHK 1C1BA 4CBUA 3QB0A 1YIJN 2DFEA 4XH1A 4HUFA 1RBSA 2P9SB 2IVPA 4LH4A 5AZJA 1NGDA 2W6LA 4DR6K 3S41A 2NNWA 2DPNA 4N47A 4CF8A 3PSFA 4CD1A 1WSJA 3BP8A 2D0AA 4BWMA 4FJIA 4JHDB 1KLNA 2KQ2A 5M1QA 1KVAA 4RTFD 1OH7A 4RWTA 1CLQA 4K8ZA 1U2VA 4NB4A 4CFCA 3WXKA 4DFKA 4F3OA 1ZBLA 2GBZA 5M1FA 2E8AA 4X65K 1W0HA 3ATUA 4DMNA 5CY4A 1S9EA 1BQNA 3A5LC 1L3TA 4AM6A 5BRFA 1A5WA 3QNNA 5H1SQ 1Q82O 1VHXA 2FBXA 3C6HA 5ADXA 3O3HA 5JS1A 1UOCA 3JS6A 2A41A 3NMUA 3QEXA 1RGIA 3VEOA 4NYFA 3K5OA 2HHVA 5AR0A 1Q81O 5FRNA 1NOZA 4CEAA 4CJQA 4FW1A 2NRZA 2ZE2A 4BDYA 1FKOA 1Z6RA 2QKBA 5CHIA 3LWMA 4FJXA 3J8AA 3I0SA 4BVPA 1JJ2M 3AA3A 1ASWA 4FJHA 3CMEN 4CEFA 4CD3A 1BISA 3ULDA 2FF6A 1QSYA 1OH5A 1MA9B 2W42A 5AQIA 5JS2A 1RT2A 4H5TA 4W5TA 3QEPA 1YTUA 5BRHA 4HUEA 4A2BA 4CE9A 3WXIA 4CFAA 4NCGA 1S72N 3CMAN 1RT7A 4F8RA 3O08A 5AJ3K 2Q0RA 2RN2A 1NGGA 2AP1A 1KD1O 4WE1A 4BDPA 4NXMK 3HOSA 1QHTA 3E66A 1WSEA 3LANA 3VQBA 3DI6A 5C24A 2QTDA 1IG9A 4CZGA 3MXJA 3R6MA 4IO8A 3SV3A 1QTMA 1ATNA 3O4QA 3OYDA 1JCGA 2LSNA 4LH5A 4BACA 3PLAA 2VGMA 1EXQA 2D1KA 3ULEB 1RCHA 3SAGA 1X3MA 3QFPA 1WAJA 3CXCM 1JKHA 3L3VA 3VMFB 3BF1A 1U49A 4CF0A 2XY8A 3ID8A 3TAGA 4JEPA 4K42A 4LFAK 3O4WA 3VPZA 2YNGA 3C6AA 4JK8A 4O44A 1HMVA 3LP3A 4BQLA 3NH0A 4JD2A 4I2QA 3VQQA 3V9WA 3HM8A 4IJAA 1HR0K 5AQNA 4FK2A 1OH8A 3RRHA 3SMSA 3C7NA 3ZETB 3ZX2A 5AQUA 1NLVA 5AQYA 4LSLA 3TABA 1XUPO 4BRCA 1C0TA 2HNZA 2HHTA 4CZIA 3VERA 1XC9A 2HF4A 3OYJA 3TSQA 3VGLA 1T7PA 3QBXA 1Q18A 3V1RA 4IOXA 1J6ZA 3TAQA 4FJKA 1GOCA 2BH1A 4CJFA 3M3ZA 5E26A 3B6OA 2HBJA 3HT3A 2RE2A 3K9KA 1J53A 1JLAA 3GOIA 2ZQBA 4MDBA 4NXNK 2G8KA 2W40A 1K8KB 4CCHA 1MWMA 1NK0A 4JI2K 1E4GT 2PAVA 3IAYA 1UA0A 4DV7K 2VQEK 4FOIA 4CERA 4EFHA 3V6DA 4A5BA 3CPWM 1DT9A 3QO9A 2JGUA 4L8RB 1ATSA 1JLCA 1ZBFA 1ATRA 1S1WA 5GAEP 4KREA 3MAQA 4CK2A 5C42A 2GWKA 5F1XA 3PO5A 1S5JA 4Z0UA 5I9EB 4OPKA 4E7HA 1IH7A 3S3OA 1E4FT 4DF4A 4FJ7A 3CQXA 2VQFK 3DYAA 2ITGA 1ZBUA 4JK9A 2VG5A 4B1YB 4CIEA 3MXIA 3CM6A 4WQ4C 4CK1A 2FSKA 1S1XA 4IEEA 4M7YA 4DF8A 2NRXA 3U8XA 5AQFA 1N33K 4FW2A 1K73O 3KKSA 1RDBA 1EQYA 5HL7L 2P9NA 5JLHA 4IEIA 1ZBHA 3LDPA 5GAHP 1C1CA 4PKGA 2XO7A 5EVZA 1VQNN 3HZ6A 4KHNA 1M90O 4FJNA 1C1AA 5FRMA 4FJ5A 2QI2A 3M1FA 1BI4B 5LL6Z 4AHRA 2OANA 4QOZB 1OVYA 1RT3A 1IKVA 2HMIA 2YHAA 3SQ4A
chains in the Genus database with same CATH topology
4B3RK 4K0KK 4DR1K 1N34K 2F4VK 4AQYK 1XMOK 4DUYK 3J7YP 2UXDK 5IWAK 1IBKK 3JAMO 1HNWK 4JI4K 3J80O 4LFCK 4GKKK 4LF7K 4DUZK 4B3MK 4JV5K 5BR8K 4DV2K 3T1HK 4NXNK 2E5LK 2UXCK 4DV4K 2UUCK 4JI2K 4B3TK 4JI5K 4DV7K 2VQEK 4DV0K 4JI1K 5A2QO 4LF8K 4X66K 4OX9K 4YY3K 3J81O 3T1YK 1I94K 1IBMK 4JI3K 4LF5K 4GKJK 4JYAK 4DR5K 4V19S 5AJ3K 4DR3K 1FJGK 4NXMK 4YHHK 1IBLK 4DV1K 2UU9K 5IT9O 4DR6K 1XMQK 4LF9K 5LMUK 2HHHK 1HNXK 4LFBK 4LF6K 2ZM6K 2VQFK 5FLXO 4X62K 4DV6K 4DV3K 4LF4K 1XNRK 4X64K 4CW7B 4JI7K 3J7AP 4LFAK 3OTOK 1N33K 4DR7K 4CVNE 1HNZK 4DV5K 1HR0K 4KHPK 1N36K 2UUBK 2UXBK 4JI6K 4X65K 4DR2K 4JI0K 5LMNK 2UUAK 1N32K 4B3SK 4DR4K 5LL6Z 1J5EK 4JI8K 1XNQK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R K;  4K0K K;  4DR1 K;  1N34 K;  2F4V K;  4AQY K;  1XMO K;  4DUY K;  3J7Y P;  2UXD K;  5IWA K;  1IBK K;  3JAM O;  1HNW K;  4JI4 K;  3J80 O;  4LFC K;  4GKK K;  4LF7 K;  4DUZ K;  4B3M K;  4JV5 K;  5BR8 K;  4DV2 K;  3T1H K;  4NXN K;  2E5L K;  2UXC K;  4DV4 K;  2UUC K;  4JI2 K;  4B3T K;  4JI5 K;  4DV7 K;  2VQE K;  4DV0 K;  4JI1 K;  5A2Q O;  4LF8 K;  4X66 K;  4OX9 K;  4YY3 K;  3J81 O;  3T1Y K;  1I94 K;  1IBM K;  4JI3 K;  4LF5 K;  4GKJ K;  4JYA K;  4DR5 K;  4V19 S;  5AJ3 K;  4DR3 K;  1FJG K;  4NXM K;  4YHH K;  1IBL K;  4DV1 K;  2UU9 K;  5IT9 O;  4DR6 K;  1XMQ K;  4LF9 K;  5LMU K;  2HHH K;  1HNX K;  4LFB K;  4LF6 K;  2ZM6 K;  2VQF K;  5FLX O;  4X62 K;  4DV6 K;  4DV3 K;  4LF4 K;  1XNR K;  4X64 K;  4CW7 B;  4JI7 K;  3J7A P;  4LFA K;  3OTO K;  1N33 K;  4DR7 K;  4CVN E;  1HNZ K;  4DV5 K;  1HR0 K;  4KHP K;  1N36 K;  2UUB K;  2UXB K;  4JI6 K;  4X65 K;  4DR2 K;  4JI0 K;  5LMN K;  2UUA K;  1N32 K;  4B3S K;  4DR4 K;  5LL6 Z;  1J5E K;  4JI8 K;  1XNQ K; 
#chains in the Genus database with same CATH topology
 1G99 A;  3L3U A;  4MFB A;  4FZX C;  5CYM A;  2O8C B;  4WQ4 A;  4K41 A;  5GIO A;  3KZB A;  3ZEU B;  3CJB A;  2P9K A;  1HJO A;  3CD6 N;  3PY8 A;  1KFS A;  1H1V A;  4DV2 K;  1SQK A;  1NK9 A;  2HVH A;  3F9K A;  4FL9 A;  5AQV A;  4Z4G A;  3OJU A;  2UUC K;  1ASV A;  2KZM A;  3MEE A;  4B9M A;  4ZTF A;  3EO3 A;  1BIU A;  3LPU A;  1C0M A;  3K2P A;  1W9H A;  1B92 A;  4JK7 A;  2XY7 A;  3PX6 A;  3THV A;  1HRH A;  4WFN L;  1I94 K;  4FWS A;  4FLX A;  1YT3 A;  3TAE A;  4J2B A;  3P38 A;  4PHT X;  1VSI A;  3D2E B;  3K58 A;  2WOM A;  2BGG A;  1Z25 A;  2ZGZ A;  1RT1 A;  4YOR A;  4BR7 A;  5KPR A;  3LAM A;  4FLU A;  4DQI A;  1HKG A;  3WEE A;  4M3U A;  5HBM A;  3AO1 A;  3BZK A;  5SWM A;  2E20 A;  1QZ6 A;  3VGM A;  3UKU B;  4JKH A;  5HRS A;  2A42 A;  3TPQ A;  4AHV A;  2O8D A;  1KSP A;  2VYP A;  4DV6 K;  1P8Z A;  2WON A;  2HHQ A;  3M8R A;  5AQZ A;  4ISG A;  4CJU A;  3V81 A;  2NRV A;  2NUB A;  3H45 C;  4M3T A;  4B8C A;  3CET A;  3KVG A;  1EWR A;  2Q0U A;  2QWO A;  3SQ2 A;  1TK0 A;  3DXM A;  3N4Q A;  4GNI A;  4KHP K;  2AJQ A;  3AVB A;  3E9O A;  4MO4 A;  1HYZ A;  3HPG A;  4CJK A;  5AQH A;  4W5N A;  5KPZ A;  3T19 A;  4BC5 A;  1S6Q A;  1YVU A;  1YAG A;  4B3S K;  3SK3 A;  2FSJ A;  2KHO A;  1XNQ K;  4B3R K;  3TTD A;  2D0O A;  3LZJ A;  1X9S A;  2OA8 A;  3EL2 A;  3VQ6 A;  1T05 A;  3ZSR A;  4CHN A;  3M8P A;  3LDN A;  1D9F A;  4Y0W A;  4BC3 A;  1J54 A;  1VSJ A;  1N6Q A;  3HXM A;  3RR8 A;  3FFI A;  4CF1 A;  4XIU A;  2P9I A;  4IDK A;  1BWF O;  5E84 A;  2A5X A;  4N5S A;  3DJC A;  4BC4 A;  2JWL A;  1RDA A;  1IO2 A;  3AAR A;  3ENH A;  1NK8 A;  4FK0 A;  2CH5 A;  4H0X B;  3OYI A;  5GAD P;  3WUH A;  4ISF A;  4FWO A;  3K0S A;  3K5M A;  1ASU A;  1QVG M;  4CJP A;  1YVN A;  3HM9 A;  3NFA A;  5KGX A;  1KAX A;  3O1B A;  4JI3 K;  3VQD A;  4YOY A;  4JYA K;  2CGK A;  1YUW A;  3HL8 A;  3O6W A;  3QIP A;  1D5A A;  3IG1 A;  4I6M B;  1QQC A;  4K8X A;  1VRT A;  4BVO A;  3RWU A;  5AZJ B;  3OY9 A;  1IBL K;  3G10 A;  5SZT A;  4HTL A;  4DV1 K;  4CJW A;  2PBD A;  1W97 L;  3LAK A;  1UAX A;  1BGX T;  5AQJ A;  4B1U B;  4NCB A;  3SBG A;  3MN9 A;  4IFY A;  2BUP A;  4FLV A;  3AVN A;  1SKS A;  3F9M A;  4MO5 A;  1OVQ A;  3SAF A;  3D45 A;  1U2V B;  3AO5 A;  3RTV A;  4BRE A;  1NM1 A;  1HPZ A;  4JRP A;  4IKF A;  5FPE A;  3LPT A;  3CQ8 A;  5AQK A;  5I42 A;  4RCH A;  3SUQ A;  4IO9 L;  3KLI A;  4KH5 A;  1CZ9 A;  2D0B A;  3NGY A;  3VGK A;  4DG1 A;  5AQX A;  1J5O A;  3NBP A;  1Y97 A;  4CEC A;  1ZYQ A;  3LDL A;  2E2N A;  1KC8 O;  4BR2 A;  4CHQ A;  3OYB A;  3O4N A;  4E7K A;  3L2U A;  1NGF A;  3TWH A;  1B9F A;  1TKT A;  4E0D A;  4F2S A;  1NKE A;  4CBW A;  2KFN A;  4H5N A;  4DQQ A;  1WSI A;  3QBW A;  4UQG A;  3NH2 A;  3LP1 A;  2E2P A;  4KRF A;  2HND A;  4CBX A;  1UWB A;  4FO0 A;  4E89 A;  1WSG A;  1B9D A;  3OS0 A;  3T1H K;  4EAH D;  2HW3 A;  4W5O A;  3CC7 N;  2YJE A;  4KBO A;  1DTQ A;  3MN7 A;  2QM1 A;  1RBU A;  2OPP A;  3C65 A;  1LV5 A;  4QS8 A;  4BRI A;  3AGR A;  2XY5 A;  1L3S A;  4IG0 A;  3SV4 A;  4IBN A;  1KFD A;  4YOX A;  3NAE A;  3U6F A;  3OBW A;  5AQT A;  4BRL A;  4BRP A;  1TYQ A;  3GBT A;  4CI6 A;  2DTU A;  3O3F A;  1NJX A;  3C0B A;  3MEC A;  4GY2 B;  5BPM A;  4J2E A;  3HVR A;  3CCS N;  1NG9 A;  2ASP A;  1R59 O;  3SUP A;  4QS9 A;  1TL3 A;  3AVH A;  2FF3 B;  5AQP A;  3OA9 A;  4BE2 A;  2PY5 A;  4OPA A;  4M42 A;  3AGK A;  4DV3 K;  3H1Q A;  4OPH A;  3H46 O;  1TKX A;  2RPI A;  1D4X A;  4FK4 A;  3E01 A;  2ZGY A;  2G8I A;  4JD2 B;  1SKR A;  5CR4 A;  1Y64 A;  3W0L A;  3O9R A;  4DFM A;  1HX1 A;  3C7N B;  3CF5 L;  1N36 K;  3QER A;  2UUB K;  4OGE A;  2PFU A;  2RF2 A;  4AHC A;  4KTZ A;  4JI0 K;  3P1G A;  4YFU A;  3IDH A;  1RFQ A;  2BTF A;  3VEZ A;  1JLE A;  2F9T A;  3AA2 A;  4MQ3 A;  1JXB A;  5EXW A;  2EWS A;  2YX6 A;  1BU6 O;  3EN9 A;  5M1N A;  2P5O A;  1LW0 A;  2KZZ A;  4Y1C A;  2O8B A;  4JN4 A;  1NKC A;  4KH4 A;  1Q86 O;  4PQU A;  1BQM A;  1VSE A;  4C8N A;  1T8E A;  3VQ5 A;  3GE1 A;  4BRN A;  3FZK A;  3I56 N;  3H3O B;  1ZBI A;  3F5T A;  2G8V A;  3UE5 A;  1RTD A;  4JV5 K;  4FM0 A;  5CYQ A;  1NJY A;  2ZWH A;  4CEE A;  3U4L A;  4CF2 A;  1GLL O;  1YI2 N;  4CJT A;  5AQL A;  1WUA A;  2I7N A;  3MX2 A;  4FWR A;  4XH5 A;  1D9D A;  1XQS C;  3MWT A;  3VF4 A;  4OLA A;  4OLB A;  2QKK A;  4BGA A;  2IGI A;  4JRQ A;  3AAQ A;  1A5V A;  2V52 B;  2FC0 A;  2VCP A;  4PKH A;  4KHS A;  3T3F A;  4YY3 K;  3MEG A;  3CJC A;  3CG7 A;  3AVK A;  4JAX A;  4DLG A;  1NOY A;  3LM2 A;  3K5L A;  4V19 S;  4Z4E A;  1RDU A;  3QEW A;  1OH6 A;  5HOO A;  5KRT A;  3KWI A;  4GW6 A;  4PL7 A;  3RRG A;  5J2P A;  2FLO A;  2PZS A;  1SAZ A;  3ZSZ A;  4B9V A;  4YOT A;  4WF9 L;  1FKP A;  4FJ9 A;  3GL1 A;  5LMU K;  1TKZ A;  5F2R A;  2XHB A;  1VQO N;  4CJ3 A;  4FJG A;  4N76 A;  1NWK A;  2QWQ A;  1VSM A;  4KFB A;  2Q2R A;  3A5O C;  4BRF A;  3B8A X;  2YKN A;  4BE0 A;  3J7A P;  1X9M A;  1OKJ A;  2P9N B;  1QS4 A;  3SZ2 A;  1RT5 A;  3HP9 A;  2IDO A;  3DLB A;  4H0P A;  4FLT A;  4B08 A;  4KTQ A;  1NK6 A;  4C8L A;  1QHA A;  1Q9X A;  1SL2 A;  4OO1 J;  4M3R A;  3CJ7 A;  2DY4 A;  2F9W A;  3N4P A;  4OVL A;  1Q9Y A;  1IV0 A;  1TL1 A;  3AVA A;  4K25 A;  3V1Q A;  3KHY A;  2OPR A;  3THW A;  5AFU H;  4FZZ A;  1VSH A;  3U3Y A;  4B9Q A;  3MDQ A;  1VQP N;  4HTU A;  3SUO A;  3EYZ A;  3MWP A;  4RW7 A;  1HYS A;  3HTV A;  2P1J A;  4DR1 K;  3ZT0 A;  3G71 N;  2D5R A;  3RMD A;  1BOT O;  4CED A;  3O5B A;  1HUX A;  1WAF A;  4DUY K;  1HYV A;  2P9K B;  4IFE A;  1JLB A;  1NBW A;  1BA1 A;  4FYD A;  4ID5 A;  4CK3 A;  1S1V A;  4AM7 A;  3NE6 A;  1QQN A;  2H3G X;  4R5P A;  1JL1 A;  1GOB A;  5AQR A;  1TVR A;  4GV3 A;  5GAG P;  1HKC A;  2HVI A;  3K5N A;  4BRA A;  4KPY A;  3R8E A;  3ALY A;  4DB3 A;  1KTQ A;  5JVH L;  1IG8 A;  2QXF A;  1GLF O;  2O8E A;  2IOC A;  2EX3 A;  3DOL A;  2HST A;  4CEB A;  4M41 A;  2FSN A;  3KLH A;  2KKZ A;  3J81 O;  3JYT A;  1W7A A;  1P90 A;  5AFU A;  2Q36 A;  3CFO A;  5KI6 A;  4DR5 K;  4FPA A;  1NGH A;  4J2D A;  3AO3 A;  1JLF A;  4PL8 A;  3WEE B;  1QSS A;  2E2O A;  4HCB A;  3HI0 A;  3KIO A;  3LP2 A;  1D8Y A;  3ZSQ A;  4JS4 A;  1EO1 A;  2PYL A;  3K59 A;  2O8D B;  2E1Y A;  3C95 A;  4BRG A;  5AQM A;  4X62 K;  3CCR N;  1S1U A;  3CC2 N;  1XNR K;  3C6U A;  3QES A;  3V9X A;  1L3U A;  3CCE N;  4J2A A;  3F73 A;  4QAG A;  4CGJ A;  3AVI A;  4W5R A;  3DRR A;  3DXM B;  4DQ8 A;  4WCE L;  3ID6 A;  1C0G A;  4U7B A;  4E3S A;  3K57 A;  5BPN A;  3MN5 A;  3AVM A;  4C8M A;  1S22 A;  1GLB G;  4H4O A;  4FOE A;  2UUA K;  4H0T B;  2QWN A;  4B1W B;  1NGJ A;  4C1N K;  3MMV A;  3VQ8 A;  3I55 N;  4DCH A;  3G0Z A;  3O9U A;  5DMR A;  3RR7 A;  1ZBS A;  4CHZ A;  1RTI A;  4CGD A;  3FR0 A;  1EKE A;  4ZTJ A;  4JI8 K;  3TAR A;  1BL3 A;  2CGJ A;  3CPE A;  4NO7 A;  3KK3 A;  1ESV A;  1RDC A;  3QIC A;  4AQY K;  1I3A A;  4FJM A;  1KCF A;  2P9I B;  1UA1 A;  2BE2 A;  4CFD A;  1KQS M;  4JKE A;  4OKE A;  4B9S A;  3O9S A;  3VQE A;  2YJF A;  1HQE A;  2W6K A;  3LAL A;  1L5U A;  5CZ1 A;  5LJV A;  1TUY A;  2YCH A;  1EET A;  1XC3 A;  4DV4 K;  3CJ1 A;  4CFB A;  4DS5 A;  3VEY A;  4YOW A;  3EE9 A;  1RT6 A;  1VQM N;  1IKW A;  1DKG D;  4G9Z A;  2F96 A;  3ENB A;  3QET A;  2D4W A;  1RBT A;  4M45 A;  1VRU A;  3AVF A;  2OTJ N;  5J2N A;  3CQY A;  3CCL N;  4EHU A;  2QW9 A;  1RIL A;  3ISN C;  4A2A A;  4KAZ A;  4FWM A;  2HOE A;  3BEX A;  2V51 B;  4DTX A;  2NRT A;  4KV8 A;  3QEI A;  4FVU A;  3L0Q A;  4NYN A;  4LF9 K;  2KFZ A;  5HRN A;  3R3L A;  1JXE A;  5KGW A;  5KQD A;  3IFR A;  3TTF A;  3QNO A;  4H5V A;  1GOA A;  2HHH K;  5B8H A;  2ASO A;  4KB1 A;  1BHL A;  4DLE A;  5LY3 A;  4Z4I A;  4IDH A;  4A62 A;  3A5N C;  3SUN A;  4KHW A;  4LF4 K;  1KXP A;  4DTP A;  1KAZ A;  3DLG A;  4CW7 B;  4XEI A;  3DRS A;  5DM6 L;  3THX A;  1ITG A;  1S3X A;  2KTQ A;  3TAF A;  5AQO A;  4DSI A;  3KK7 A;  5JMV A;  2E88 A;  3AAP A;  3I8D A;  1RNH A;  3TAN A;  3H3N O;  3PV8 A;  1Q8I A;  4CZK A;  3D7E O;  3HYF A;  2GTD A;  4BRK A;  4EP5 A;  4HHT A;  2AA4 A;  1O1W A;  4A61 A;  4CJV A;  4DQS A;  5KTQ A;  3O3G A;  4CZM A;  4KB0 A;  2RKI A;  4Q5V A;  4N41 A;  4BE1 A;  4ILH A;  3ZLJ A;  4FLZ A;  2O8F A;  1V4T A;  1EP4 A;  4W5Q A;  3CI5 A;  3MXM A;  1X3N A;  4BDZ A;  3L4Q A;  3M8S A;  3WXL A;  1IBK K;  2P5G A;  1ILY A;  4LSN A;  1CXU A;  4ZHR A;  3EZW A;  3E9P A;  1IKX A;  1YIT N;  4B9L A;  3SNN A;  2P9U A;  3ITH A;  5J2M A;  1QQO A;  4FXD A;  2IS3 A;  4B8A B;  1WOQ A;  1YHQ N;  3DLL L;  3I33 A;  4E1M A;  4PY5 A;  2RHK A;  4I2P A;  5M1K A;  2G8U A;  5FPN A;  4H03 B;  1ZC6 A;  2XRI A;  2ZJP L;  3G6E N;  3RMA A;  3LM9 A;  4FWL A;  5J2Q A;  1SUQ A;  4FJ8 A;  4DV0 K;  1VAZ A;  1VSD A;  5A2Q O;  2P9P A;  1WSF A;  1U48 A;  2YNF A;  4ID1 A;  4JLH A;  1TV6 A;  3L2V A;  3OYM A;  3QFU A;  2DFH A;  1LAW A;  1K8A O;  1TYQ B;  3OYE A;  3Q7C A;  4Z4C A;  3SPY A;  4JKB A;  1W2B M;  4B1Z A;  1TGO A;  4BRH A;  4Z4F A;  4CJE A;  2Y1I A;  4AH9 A;  1JL2 A;  2FBV A;  3Q7B A;  3OS1 A;  5FPM A;  4AHU A;  3TTC A;  2I7P A;  4NLB A;  5JIC A;  3ZX0 A;  4WFA L;  2X74 A;  4H8K A;  3AY9 A;  3EKU A;  3CFR A;  3FZF A;  4AHS A;  2Q1N A;  1YJN N;  2G8F A;  4DR7 K;  4CHP A;  3VQ4 A;  3OS2 A;  4QS7 A;  3LWL A;  3NGI A;  1JCE A;  4H0V B;  1KAY A;  4HUG A;  3C6T A;  3L2W A;  5HRO A;  4B9N A;  1T3V A;  4RW4 A;  3IRX A;  2UYT A;  1MU2 A;  2DFF A;  1LCU A;  2HB5 A;  2Z1G A;  4DSJ A;  1BCM A;  2P9L A;  2YI1 A;  4LD0 A;  1DEJ A;  1NK5 A;  4FPB A;  2O8B B;  4A57 A;  2A3Z A;  3NVK A;  4CJ7 A;  2F8S A;  3SAH A;  5DK5 A;  2JWK A;  3MED A;  2Q31 A;  1GLA G;  1RTH A;  2UXD K;  3TAP A;  1T6D A;  3ZSX A;  1HJR A;  2QWM A;  3T1A A;  3J80 O;  4EHT A;  3PO4 A;  5F0X A;  1U45 A;  4PA1 A;  4OJR A;  3ZT3 A;  5BR8 K;  2O4I A;  3IKM A;  3O1W A;  2V7Y A;  4FVM A;  3VTH A;  3THY A;  2GUI A;  1N8R O;  1QVF M;  2VGN A;  2E1Z A;  1GLJ O;  3VEV A;  4R79 A;  1NJI O;  1K9M O;  4X66 K;  1JLQ A;  4CJS A;  3IS9 A;  5HRP A;  5CE3 A;  2QWP A;  3T1Y K;  4ELV A;  2OYQ A;  3M8Q A;  5TKW A;  4RW8 A;  5KPT A;  4DSL A;  4JKD A;  3VQP A;  3FZH A;  3AVG A;  2VWB A;  1SKW A;  4JKG A;  4DQR A;  3PUF A;  3R1X A;  3SPZ A;  3SI6 A;  2X6S A;  1SV5 A;  4H0Y B;  1MDU B;  3AA5 X;  3OYK A;  4LF6 K;  1DTT A;  4FLW A;  2WC9 A;  3FE1 A;  5AZI A;  2G8H A;  3BZC A;  1VQ4 N;  3CCU N;  1TUU A;  1U47 A;  2OPS A;  2EHG A;  2ZD1 A;  4BWJ A;  4OGC A;  3VF6 A;  2CGL A;  2YHW A;  1RT4 A;  3DOK A;  3NF8 A;  3OYL A;  2QA4 N;  3ZYY X;  3SJJ A;  3RSE A;  3THW B;  4DWI A;  4HVJ A;  2VG7 A;  3V9U A;  3A2F A;  4JKF A;  3BY5 A;  3ZSO A;  4CES A;  4BRD A;  1KRP A;  3WQU A;  3VF2 A;  5JLF A;  4B3O A;  3SQ1 A;  3HST B;  3L2R A;  1MWK A;  4FM1 A;  1YJ9 N;  2KW4 A;  3OYF A;  4MLH A;  3NDK A;  4DSF A;  1E3M A;  3NF6 A;  4FWK A;  4O55 A;  2HBM A;  3M6G A;  4ILJ A;  3UIQ A;  3LL3 A;  1VK0 A;  3NF7 A;  3LDQ A;  4F2R A;  4RW6 A;  3WNF A;  4CGI A;  4M3Y A;  3S3M A;  1U4B A;  4GVE A;  4LY7 A;  3OJS A;  2FXU A;  2D0P A;  3G4S N;  5MLC Q;  1V4S A;  3MCP A;  2GEL A;  4GKK K;  1K6Y A;  2HBK A;  4BC2 A;  1TKD A;  4B3M K;  4U67 L;  2O8E B;  4C23 A;  4E7I A;  3TR8 A;  2UXC K;  4OPJ A;  1QE1 A;  2FBT A;  4DSE A;  1YF5 L;  5ADX H;  1NJZ A;  4KI6 A;  3P5J A;  4CZH A;  4JI1 K;  1NK4 A;  4CGH A;  4DFP A;  4OX9 K;  3WNE A;  1BA0 A;  5CZ2 A;  3F2K A;  5ELZ A;  4IOA L;  1NK7 A;  2B4J A;  3HP6 A;  5C15 A;  1CZA N;  3KLF A;  5C12 A;  4JKC A;  2ETJ A;  1LWE A;  5FDL A;  3WNG A;  1XMQ K;  3TAM A;  1WNS A;  4B9T A;  4BR4 A;  5M1O A;  4IOC L;  2E6L A;  1TAU A;  3O80 A;  5HLF A;  5BRD A;  4E1J A;  4X64 K;  4KI4 A;  1N5Y A;  4AF1 A;  3KJV A;  3PX0 A;  2HHU A;  1XHZ A;  1G15 A;  5BR9 A;  5BN8 A;  3OYH A;  4EZ6 A;  1C0U A;  4JKA A;  3OYN A;  4AHT A;  2J4R A;  2ITM A;  3U3G A;  3DXK A;  4C8O A;  3CC4 N;  3OW2 M;  1TK5 A;  3T69 A;  4BG8 A;  4F4K A;  4O0J A;  3HPH A;  1BO5 O;  4ILG B;  1S1T A;  4YOV A;  3VQ9 A;  3CJ9 A;  3EKS A;  2IAJ A;  5LJW A;  4KHU A;  2I5J A;  4CGF A;  3IUC A;  1XHX A;  3DLK A;  4FJL A;  3SQ0 A;  3H6E A;  4C8K A;  1I39 A;  4BRO A;  1NGA A;  3RMB A;  1HPM A;  3E1Y A;  4WFB L;  1VSF A;  2W41 A;  2WTU A;  4CJR A;  2A40 A;  3UKR A;  1T03 A;  3KD1 E;  1GLC G;  3AO4 A;  4O8K A;  4GV9 A;  2IVO A;  3I0R A;  1LAV A;  2YHY A;  4MLE A;  3OHR A;  2HHX A;  3QLH A;  3C94 A;  3NH1 A;  1WBD A;  5TKY A;  4CHO A;  1VQ5 N;  4MDA A;  3VQA A;  2NRH A;  4O4G A;  4LF8 K;  5C2D A;  1VQ8 N;  2E4L A;  2YNH A;  2E6M A;  2G8W A;  4DR3 K;  3ENO A;  1FJG K;  4M63 C;  3ZSV A;  5EOY A;  4YDU C;  4IXC A;  4HWI A;  2ZJR L;  1IKY A;  3HBT A;  3VEW A;  1NU0 A;  5HP1 A;  4EIA A;  3D2F A;  3KK2 A;  1LOT B;  3PX4 A;  5C10 A;  1F21 A;  3RVC A;  3H1V X;  2P9S A;  1RDD A;  2ZF5 O;  2GX9 A;  4M3Z A;  4DFJ A;  1LW2 A;  1T6C A;  2OCE A;  3HVT A;  4O5F A;  3WQT A;  4CEQ A;  1KVC A;  3U9Z A;  3THX B;  2OZS A;  4JI7 K;  4JHD A;  3V1O A;  4IG3 A;  4RW9 A;  2IVN A;  2O4G A;  5I3U A;  4GV6 A;  4FWN A;  1M1K O;  5BN9 A;  5FPD A;  3HJF A;  3VQC A;  4YDU A;  2R7Y A;  4DTO A;  3HSC A;  1QQM A;  1LWC A;  4BRQ A;  3CJA A;  1WSH A;  4WYB A;  1KVB A;  4FJJ A;  2O8F B;  4ICL A;  4CJL A;  3ZT4 A;  1VQ9 N;  4M3W A;  4PUO A;  5AQW A;  3PSI A;  1LWF A;  1HNI A;  3D0P A;  1X9J A;  3L6Q A;  1N34 K;  3GDQ A;  2XY6 A;  4CEZ A;  1TK8 A;  1Z05 A;  3VET A;  3J7Y P;  2P9U B;  3JAM O;  1FW6 A;  4XH4 A;  2NRR A;  3VA3 A;  3G25 A;  5KRS A;  2B5J A;  1QSL A;  3KKR A;  3ZSW A;  4LF7 K;  4DUZ K;  3NGZ A;  3QEV A;  3SLC A;  1HKB A;  4O0I A;  2Z1H A;  2IIR A;  3CYM A;  4FCY A;  5M1P A;  3LDO A;  1RTJ A;  4DHY A;  3OYC A;  4B3T K;  4JI5 K;  3CCV N;  2P9P B;  5J1E A;  2GV9 A;  2A1R A;  4BR0 A;  3DM2 A;  4KH6 A;  4DQP A;  1BCO A;  3WNH A;  4LF5 K;  4GKJ K;  4ELT A;  4DU1 A;  3AA4 A;  1GLD G;  4EZ9 A;  1C0F A;  1S9G A;  3IMX A;  3AVJ A;  5IT9 O;  1C6V A;  4B1V A;  2GUP A;  4DTR A;  4Q0B A;  1JCF A;  2WUS A;  3DWL A;  4FLY A;  4E1N A;  3ULE A;  4DU3 A;  2KLA A;  1NNE A;  5JVG L;  3UB5 A;  3A8Y A;  1O13 A;  4PKI A;  5FRO A;  4AIL C;  1VQK N;  4CZL A;  3VEX A;  2E2Q A;  3KD5 E;  3L8B A;  1U04 A;  2NLX A;  2F8T A;  1EWQ A;  4H0O A;  4YNQ A;  3CHW A;  5EX5 A;  4CIG A;  2UXB K;  2BDP A;  4O5B A;  4E19 A;  3CCM N;  1N32 K;  3ATV A;  3ZET A;  1NGE A;  1VQ6 N;  3O9T A;  3DAW A;  3FGU A;  3U9D A;  4DSK A;  2P9L B;  3MN6 A;  3GG4 A;  1XI1 A;  3AVC A;  4TSX A;  3SCX A;  1WB9 A;  3FFK B;  4IFV A;  1WLJ A;  5C2F A;  4IJN A;  2V7Z A;  3QIO A;  2X6N A;  3MK6 A;  3T7Z A;  3EE8 A;  1YJW N;  1TAQ A;  4M3X A;  3BF3 A;  3WT0 A;  1YXQ A;  3LZI A;  3AV9 A;  1HNW K;  4JI4 K;  2NZT A;  3P31 A;  4B1X B;  2YNI A;  3L4I A;  2B6A A;  3QIN A;  4KTW A;  4OKJ A;  4RG8 A;  3NHG A;  3H08 A;  3THY B;  1VSL A;  2HBL A;  2E5L K;  2HNY A;  4F3T A;  1NGC A;  3HOT A;  4F9O A;  4O8U A;  1K8K A;  5KQ8 A;  5HRR A;  4NLC A;  1HQU A;  4J8F A;  3KLE A;  4DU4 A;  4KHY A;  5T7B A;  1BG3 A;  4FWP A;  1VSK A;  1YTA A;  5K14 A;  3JXU A;  3ASM A;  3VES A;  2A1S A;  3MX5 A;  5AQS A;  4DS4 A;  1IBM K;  3NVM A;  4I9Q A;  1A5X A;  1R0A A;  3OYG A;  4QCL A;  2PYJ A;  3WXJ A;  2YHB A;  4HCC A;  4JKG B;  3P39 A;  4CIF A;  1VQL N;  3FZL A;  1X1P A;  3VTI A;  3DMJ A;  3JSM A;  4BR5 A;  1JLG A;  4CF9 A;  3KLG A;  3SYZ A;  5AZI B;  4E7L A;  2X78 A;  1REV A;  2IC3 A;  4LFB K;  2Z1I A;  4CGG A;  4Z4H A;  4JNE A;  4WQ5 C;  2OZM A;  5EU7 A;  3VQ7 A;  4DTJ A;  1QZ5 A;  3HK2 A;  3TSP A;  3DLR A;  4GVM A;  4I7F A;  3VOV A;  3V4I A;  4CZJ A;  3K9J A;  2A6A A;  4CVN E;  1NGB A;  5GIP A;  4H4M A;  4OKK A;  3RSE B;  3HRG A;  2HHS A;  4C1N I;  1IJJ A;  3NF9 A;  1T44 A;  3W3D A;  4G1Q A;  2YKM A;  4DR2 K;  1RBR A;  5LMN K;  4CZE A;  3BGR A;  4FZY A;  1GLE G;  4CHY A;  3NCI A;  1J5E K;  4UY8 O;  4KO0 A;  4B9U A;  1WN7 A;  2JLE A;  2Q3S A;  3HPO A;  1BI4 A;  1X9W A;  1XWL A;  2YHX A;  3VA0 A;  4WQ5 A;  3ZCM A;  3VEN A;  2GWJ A;  1XMO K;  1HNV A;  2BAN A;  3A0I X;  2O8C A;  5IWA K;  4E7J A;  4BGB A;  3FZM A;  3ZEU A;  3DLE A;  4LFC K;  1NJW A;  5C25 A;  3A5M C;  4BQZ A;  1HLU A;  4IWV A;  4DKW A;  3BUZ B;  3CER A;  4A59 A;  3OBY A;  3R9P A;  5C0Y A;  3I8B A;  1S6P A;  1NKB A;  2CH6 A;  3CIP A;  4IZ9 A;  4Z94 A;  3L2Q A;  3SMP A;  2VWJ A;  4H5R A;  3ZSY A;  4ISE A;  2VWK A;  3S9H A;  3M5R A;  3EZ5 A;  4DTS A;  1J9A A;  3TSU A;  4BR9 A;  3P83 D;  2QXL A;  3D2E A;  3CCJ N;  3S3N A;  1SS6 A;  3DRP A;  3KK1 A;  3V9Z A;  4BY9 C;  3VN5 A;  4EP4 A;  3ZT2 A;  3PIO L;  2WFB A;  2GEM A;  2D0C A;  2UU9 K;  3OVN A;  1SL1 A;  2YV0 X;  2P51 A;  3OYA A;  3AVL A;  1HNX K;  3KWG A;  4CZF A;  1CXQ A;  2ZM6 K;  2HMP A;  5FLX O;  1NGI A;  1DLO A;  4BG9 A;  4CEO A;  3UKU A;  2OPQ A;  2F7T A;  4DTU A;  4BRM A;  5AQG A;  3B6P A;  1CZB A;  5BPL A;  3ZX3 A;  4K43 A;  2QEX N;  3E9L A;  3OTO K;  2ASM A;  3O8M A;  1L3V A;  2VG6 A;  3DXK B;  4KKO A;  3HO1 A;  3KTQ A;  3RMC A;  3EEQ A;  1HNZ K;  1RBV A;  4DV5 K;  3V9S A;  4PWD A;  4FWQ A;  2QWR A;  4JI6 K;  1SZ2 A;  4CJ5 A;  5DM7 L;  4ELU A;  1NMD A;  1WBB A;  4FM2 A;  4FSV A;  4NCA A;  4DR4 K;  3D6R A;  1VQ7 N;  3EY1 A;  4GMJ B;  4H5W A;  3QML A;  3J7Z O;  1Z26 A;  4K0K K;  4DTM A;  4DTN A;  1RDW X;  2Q97 A;  2ZJQ L;  2F4V K;  1BDG A;  4YOU A;  3DLH A;  2FBY A;  5AQQ A;  2OTL N;  1BIZ A;  3SJH A;  2QWL A;  3CM5 A;  4L3Q A;  1DGK N;  3UKR B;  4JS5 A;  1U6Z A;  1Q7Y O;  3SBT A;  4N56 A;  1FK9 A;  2NRW A;  4Y1D A;  5E41 A;  1SL0 A;  1BUP A;  2ATQ A;  3FLC O;  3WXM B;  4LC9 B;  3PIP L;  4A5A A;  3CCQ N;  2QK9 A;  3AO2 A;  3QDK A;  4I9L A;  3TI0 A;  4KHQ A;  3CFP A;  1ZXO A;  1EX4 A;  3LP0 A;  3P4I A;  1FXX A;  3BDP A;  5D3G A;  5GIN A;  3ZT1 A;  4M7X A;  2Y1J A;  2HHW A;  3LDS A;  5EY4 A;  3TU5 A;  3MCA B;  2Z1J A;  5BRE A;  4CJ4 A;  3O9Q A;  1NMN A;  3D2F B;  2HF3 A;  2WBN A;  1KLM A;  4I6M A;  4YHH K;  1C1B A;  4CBU A;  3QB0 A;  1YIJ N;  2DFE A;  4XH1 A;  4HUF A;  1RBS A;  2P9S B;  2IVP A;  4LH4 A;  5AZJ A;  1NGD A;  2W6L A;  4DR6 K;  3S41 A;  2NNW A;  2DPN A;  4N47 A;  4CF8 A;  3PSF A;  4CD1 A;  1WSJ A;  3BP8 A;  2D0A A;  4BWM A;  4FJI A;  4JHD B;  1KLN A;  2KQ2 A;  5M1Q A;  1KVA A;  4RTF D;  1OH7 A;  4RWT A;  1CLQ A;  4K8Z A;  1U2V A;  4NB4 A;  4CFC A;  3WXK A;  4DFK A;  4F3O A;  1ZBL A;  2GBZ A;  5M1F A;  2E8A A;  4X65 K;  1W0H A;  3ATU A;  4DMN A;  5CY4 A;  1S9E A;  1BQN A;  3A5L C;  1L3T A;  4AM6 A;  5BRF A;  1A5W A;  3QNN A;  5H1S Q;  1Q82 O;  1VHX A;  2FBX A;  3C6H A;  5ADX A;  3O3H A;  5JS1 A;  1UOC A;  3JS6 A;  2A41 A;  3NMU A;  3QEX A;  1RGI A;  3VEO A;  4NYF A;  3K5O A;  2HHV A;  5AR0 A;  1Q81 O;  5FRN A;  1NOZ A;  4CEA A;  4CJQ A;  4FW1 A;  2NRZ A;  2ZE2 A;  4BDY A;  1FKO A;  1Z6R A;  2QKB A;  5CHI A;  3LWM A;  4FJX A;  3J8A A;  3I0S A;  4BVP A;  1JJ2 M;  3AA3 A;  1ASW A;  4FJH A;  3CME N;  4CEF A;  4CD3 A;  1BIS A;  3ULD A;  2FF6 A;  1QSY A;  1OH5 A;  1MA9 B;  2W42 A;  5AQI A;  5JS2 A;  1RT2 A;  4H5T A;  4W5T A;  3QEP A;  1YTU A;  5BRH A;  4HUE A;  4A2B A;  4CE9 A;  3WXI A;  4CFA A;  4NCG A;  1S72 N;  3CMA N;  1RT7 A;  4F8R A;  3O08 A;  5AJ3 K;  2Q0R A;  2RN2 A;  1NGG A;  2AP1 A;  1KD1 O;  4WE1 A;  4BDP A;  4NXM K;  3HOS A;  1QHT A;  3E66 A;  1WSE A;  3LAN A;  3VQB A;  3DI6 A;  5C24 A;  2QTD A;  1IG9 A;  4CZG A;  3MXJ A;  3R6M A;  4IO8 A;  3SV3 A;  1QTM A;  1ATN A;  3O4Q A;  3OYD A;  1JCG A;  2LSN A;  4LH5 A;  4BAC A;  3PLA A;  2VGM A;  1EXQ A;  2D1K A;  3ULE B;  1RCH A;  3SAG A;  1X3M A;  3QFP A;  1WAJ A;  3CXC M;  1JKH A;  3L3V A;  3VMF B;  3BF1 A;  1U49 A;  4CF0 A;  2XY8 A;  3ID8 A;  3TAG A;  4JEP A;  4K42 A;  4LFA K;  3O4W A;  3VPZ A;  2YNG A;  3C6A A;  4JK8 A;  4O44 A;  1HMV A;  3LP3 A;  4BQL A;  3NH0 A;  4JD2 A;  4I2Q A;  3VQQ A;  3V9W A;  3HM8 A;  4IJA A;  1HR0 K;  5AQN A;  4FK2 A;  1OH8 A;  3RRH A;  3SMS A;  3C7N A;  3ZET B;  3ZX2 A;  5AQU A;  1NLV A;  5AQY A;  4LSL A;  3TAB A;  1XUP O;  4BRC A;  1C0T A;  2HNZ A;  2HHT A;  4CZI A;  3VER A;  1XC9 A;  2HF4 A;  3OYJ A;  3TSQ A;  3VGL A;  1T7P A;  3QBX A;  1Q18 A;  3V1R A;  4IOX A;  1J6Z A;  3TAQ A;  4FJK A;  1GOC A;  2BH1 A;  4CJF A;  3M3Z A;  5E26 A;  3B6O A;  2HBJ A;  3HT3 A;  2RE2 A;  3K9K A;  1J53 A;  1JLA A;  3GOI A;  2ZQB A;  4MDB A;  4NXN K;  2G8K A;  2W40 A;  1K8K B;  4CCH A;  1MWM A;  1NK0 A;  4JI2 K;  1E4G T;  2PAV A;  3IAY A;  1UA0 A;  4DV7 K;  2VQE K;  4FOI A;  4CER A;  4EFH A;  3V6D A;  4A5B A;  3CPW M;  1DT9 A;  3QO9 A;  2JGU A;  4L8R B;  1ATS A;  1JLC A;  1ZBF A;  1ATR A;  1S1W A;  5GAE P;  4KRE A;  3MAQ A;  4CK2 A;  5C42 A;  2GWK A;  5F1X A;  3PO5 A;  1S5J A;  4Z0U A;  5I9E B;  4OPK A;  4E7H A;  1IH7 A;  3S3O A;  1E4F T;  4DF4 A;  4FJ7 A;  3CQX A;  2VQF K;  3DYA A;  2ITG A;  1ZBU A;  4JK9 A;  2VG5 A;  4B1Y B;  4CIE A;  3MXI A;  3CM6 A;  4WQ4 C;  4CK1 A;  2FSK A;  1S1X A;  4IEE A;  4M7Y A;  4DF8 A;  2NRX A;  3U8X A;  5AQF A;  1N33 K;  4FW2 A;  1K73 O;  3KKS A;  1RDB A;  1EQY A;  5HL7 L;  2P9N A;  5JLH A;  4IEI A;  1ZBH A;  3LDP A;  5GAH P;  1C1C A;  4PKG A;  2XO7 A;  5EVZ A;  1VQN N;  3HZ6 A;  4KHN A;  1M90 O;  4FJN A;  1C1A A;  5FRM A;  4FJ5 A;  2QI2 A;  3M1F A;  1BI4 B;  5LL6 Z;  4AHR A;  2OAN A;  4QOZ B;  1OVY A;  1RT3 A;  1IKV A;  2HMI A;  2YHA A;  3SQ4 A; 
#chains in the Genus database with same CATH homology
 4B3R K;  4K0K K;  4DR1 K;  1N34 K;  2F4V K;  4AQY K;  1XMO K;  4DUY K;  3J7Y P;  2UXD K;  5IWA K;  1IBK K;  3JAM O;  1HNW K;  4JI4 K;  3J80 O;  4LFC K;  4GKK K;  4LF7 K;  4DUZ K;  4B3M K;  4JV5 K;  5BR8 K;  4DV2 K;  3T1H K;  4NXN K;  2E5L K;  2UXC K;  4DV4 K;  2UUC K;  4JI2 K;  4B3T K;  4JI5 K;  4DV7 K;  2VQE K;  4DV0 K;  4JI1 K;  5A2Q O;  4LF8 K;  4X66 K;  4OX9 K;  4YY3 K;  3J81 O;  3T1Y K;  1I94 K;  1IBM K;  4JI3 K;  4LF5 K;  4GKJ K;  4JYA K;  4DR5 K;  4V19 S;  5AJ3 K;  4DR3 K;  1FJG K;  4NXM K;  4YHH K;  1IBL K;  4DV1 K;  2UU9 K;  5IT9 O;  4DR6 K;  1XMQ K;  4LF9 K;  5LMU K;  2HHH K;  1HNX K;  4LFB K;  4LF6 K;  2ZM6 K;  2VQF K;  5FLX O;  4X62 K;  4DV6 K;  4DV3 K;  4LF4 K;  1XNR K;  4X64 K;  4CW7 B;  4JI7 K;  3J7A P;  4LFA K;  3OTO K;  1N33 K;  4DR7 K;  4CVN E;  1HNZ K;  4DV5 K;  1HR0 K;  4KHP K;  1N36 K;  2UUB K;  2UXB K;  4JI6 K;  4X65 K;  4DR2 K;  4JI0 K;  5LMN K;  2UUA K;  1N32 K;  4B3S K;  4DR4 K;  5LL6 Z;  1J5E K;  4JI8 K;  1XNQ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...