4DUZK

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4duzK00
5AJ3K 4YHHK 2UXCK 3J80O 4JI7K 4JI4K 3J81O 4DUZK 4DR5K 4NXMK 3T1YK 4X64K 4K0KK 3J7YP 5LMUK 4DR1K 4JI3K 4B3SK 1N36K 2UXBK 1XNQK 4LF7K 1HR0K 4LFCK 4LF6K 1IBKK 1IBLK 2E5LK 4DUYK 2UUBK 2UUCK 2HHHK 1HNXK 4DR3K 4DR6K 1XNRK 3OTOK 1XMOK 4LFBK 4DV3K 3J7AP 4JI2K 4LF8K 4LF4K 4DV2K 4DV7K 2UUAK 5IT9O 2VQFK 4JYAK 1FJGK 2UU9K 4DV5K 4LFAK 1N33K 4CVNE 4NXNK 4DV6K 4DV0K 4JI0K 2F4VK 4OX9K 1N32K 2VQEK 5IWAK 4JV5K 4DR2K 1N34K 2ZM6K 3T1HK 4X65K 4LF9K 1XMQK 1J5EK 1IBMK 5LL6Z 1HNWK 4X62K 1I94K 2UXDK 4B3RK 4KHPK 5FLXO 5A2QO 4DR7K 5BR8K 4DR4K 4JI1K 3JAMO 4JI5K 4GKKK 4AQYK 4V19S 4X66K 4JI6K 4CW7B 4DV4K 1HNZK 4B3MK 5LMNK 4LF5K 4GKJK 4YY3K 4B3TK 4DV1K 4JI8K
chains in the Genus database with same CATH superfamily
4FJ9A 1LAVA 2WONA 3CJAA 4CEOA 4CJVA 4FO0A 5KTQA 2V7ZA 1X9MA 1R0AA 4ID5A 2NRXA 4C1NI 1VSDA 3AA5X 4CJ7A 1GLLO 3J7ZO 4CF8A 3P31A 4WQ4C 1EQYA 3T69A 4M3UA 3NF8A 2P9SB 1ZBUA 4LD0A 3EZ5A 3DYAA 2UUBK 1NJZA 4EIAA 4DR6K 1JXBA 2D0AA 4MLHA 4EAHD 1QQNA 3CJBA 1L3VA 2BH1A 1TUUA 3KK1A 1Z25A 4KHNA 3SV4A 2YKMA 3H45C 4BR0A 1SKSA 3EZWA 4LFBK 4H5RA 3GL1A 4Y1CA 4JI2K 4FM0A 4NCGA 4N41A 5IT9O 1SS6A 5CZ2A 3CM5A 1BHLA 4O5FA 5C0YA 3OYIA 1VRUA 1HPMA 2A40A 4MFBA 5HRSA 4DV5K 2B6AA 2OTJN 5AQKA 5C10A 1D8YA 3THYB 4A62A 3CJ9A 5HRRA 3ZSOA 4YFUA 5HRPA 4ISGA 3F9MA 4YOTA 1ATRA 3CC7N 1HYVA 3AVFA 4HVJA 1QQCA 4K8ZA 1MWKA 3LDOA 1HKBA 3ULEB 2VCPA 5KPTA 4BQLA 5M1PA 1MA9B 3AA2A 3O3GA 4O5BA 5ELZA 4BRFA 5BRDA 1S72N 2BDPA 5MLCQ 1KAZA 2E2OA 1Q7YO 3V9XA 3QIPA 4FJ5A 1VHXA 1C1BA 1RDAA 4OO1J 2OYQA 3T3FA 4CJ5A 1KVCA 4YNQA 1LV5A 1KAYA 1XI1A 4DTMA 3NF9A 4DQPA 2FXUA 4OKEA 2PY5A 3LM9A 2OPQA 3EKSA 4JK7A 1YF5L 3ZX3A 1RDUA 1DEJA 1T03A 4M7XA 4IWVA 3VF4A 4JI4K 2ZWHA 3O9TA 4I6MA 4DTSA 1GLBG 2ZD1A 2FBXA 1JL1A 3KLEA 3BZKA 3NBPA 4K0KK 3ZSWA 4NCAA 2V51B 5J1EA 4JI3K 2Y1JA 1V4TA 2XY5A 4DSJA 1Y64A 1S1VA 4GVEA 5ADXH 3K5OA 4HTUA 5BN9A 4OKKA 5BPLA 1S9EA 3SAHA 1YIJN 4PHTX 5JICA 3HT3A 3WQTA 5AQNA 3OTOK 1I39A 4BWMA 4U67L 4F2SA 1ZBIA 2FBVA 3SLCA 4KTZA 4CHOA 3V1OA 2V7YA 4DQ8A 1C0GA 2QXFA 2OA8A 2RKIA 3RTVA 4JS4A 4YOUA 2DY4A 4CJUA 5FPEA 2AP1A 1KAXA 3TAPA 2V52B 1W0HA 4OPKA 3JSMA 1TL3A 2PBDA 3DXKB 3V1QA 2WBNA 4B1YB 1IBMK 3HP9A 4RTFD 4MO5A 1B9FA 5J2QA 3TARA 1RGIA 3U8XA 3BGRA 4GW6A 4WCEL 1NGIA 4CD3A 3C7NB 4WQ5A 3D2EB 1IV0A 3UB5A 4DR7K 5AQVA 1TKZA 4DR4K 4E7LA 4BRLA 3AA3A 5KRSA 1VQMN 1YJ9N 4PA1A 2HMIA 4L8RB 4FWPA 1BOTO 4CW7B 4LSLA 2O8BB 2P9NB 5LMNK 4M3WA 1FW6A 1WSGA 3CC4N 4DSKA 4FOIA 3WEEB 5I9EB 3J81O 2ZJQL 1BU6O 2GBZA 3HPOA 3A0IX 1Q18A 2IOCA 4JKDA 2QM1A 1RDCA 4C8LA 2DPNA 3KLGA 1ILYA 1VSKA 1KC8O 2GWKA 3MX2A 2KZMA 3QFPA 4KH5A 2YJFA 4FOEA 4F3TA 3E9LA 1NGBA 4FJMA 3V9UA 1YUWA 3AO5A 4CF1A 1TK0A 2IC3A 3S41A 1NJWA 4FSVA 4H0TB 1BGXT 4B1VA 4CIEA 5H1SQ 4G9ZA 2FSKA 5T7BA 2QWLA 2P9IB 3KK3A 3ZT3A 4FJLA 1JXEA 4DKWA 3ATUA 4IFYA 3KJVA 1U47A 2OPRA 4FWNA 5AFUH 4DV0K 4CHZA 4CHQA 2HSTA 3F9KA 4JD2A 3UIQA 4KV8A 1DTTA 2EWSA 4CEQA 1Y97A 3AGRA 4E0DA 2QWPA 3T1AA 1SKWA 4M41A 3KZBA 1D9FA 3BEXA 4CFDA 4FJKA 3C6UA 5A2QO 3DLRA 4KHSA 1EXQA 4FWRA 4BQZA 4AM7A 5JS1A 5BRFA 4FLYA 3M8QA 4Z0UA 3VQAA 3ZSXA 3BY5A 3VN5A 1HNIA 1HNVA 3KLFA 4GKKK 3S3NA 2I7PA 3R6MA 3VEZA 4IG0A 2O8CA 4G1QA 1TK8A 4CIFA 5I42A 1GOCA 2NLXA 2QXLA 3RR7A 4DFKA 4BREA 2P9LA 4JEPA 3CM6A 1I3AA 1C0UA 1CZAN 2NUBA 3JYTA 4FW1A 5DM7L 4CGFA 3HVTA 4FWMA 1SUQA 4NXMK 3NCIA 1BISA 2I7NA 2DTUA 3OYEA 3UKUB 5KQDA 4A57A 1NJIO 1JL2A 4BR9A 1DKGD 1HJRA 4FLVA 1M90O 2P5GA 1NK0A 4GV3A 4B1UB 1NMDA 1NK7A 3CCQN 1HKGA 3CETA 3P5JA 3LDPA 3TU5A 3DLLL 1XNRK 4A59A 1ASVA 4I6MB 1BQNA 4BROA 4CEBA 4MO4A 1EX4A 5GIOA 1YI2N 2D5RA 3ZT0A 4FWKA 3QBXA 2X78A 3O4NA 1P90A 4LF4K 3GDQA 1YHQN 4CEFA 3HSCA 1XUPO 2BUPA 3OW2M 1YJWN 4PL7A 1YXQA 3K9KA 1REVA 3NVKA 4JK9A 2VQEK 1T44A 2ZGZA 2NRHA 1EETA 4IJNA 4FCYA 4JV5K 1VSLA 4IJAA 2ZM6K 3THWA 4ISFA 5EXWA 4E7HA 3DWLA 3NH1A 1NGFA 4MDBA 5M1KA 3M8PA 3WT0A 4KH4A 5D3GA 4PUOA 3AVGA 3A5LC 4Z94A 1JCFA 4BGAA 4M45A 1IJJA 1C6VA 4HTLA 4WYBA 3NH2A 3L2RA 2JLEA 3QERA 3I0RA 3THVA 4N56A 1QE1A 5C42A 4FWQA 5CY4A 1SL0A 1LWCA 4BE1A 5BR9A 2GELA 2PYLA 3QEIA 3I55N 2G8VA 1X9JA 1T05A 3OS0A 2B5JA 2G8FA 1RTHA 2DFEA 5AQJA 4DU4A 4K25A 3D45A 5CZ1A 4QOZB 2YCHA 1NGAA 4I7FA 4CGDA 4KHUA 4BRGA 4QS7A 3EEQA 2E5LK 3LDNA 1RT6A 2OPSA 1HYSA 1BIUA 1JLAA 2CGKA 4H5NA 2DFHA 3SMPA 3GE1A 4Q5VA 4O44A 4H03B 3BZCA 2IAJA 1VSMA 2OTLN 2HF4A 3CCVN 3H1VX 5AR0A 4JKGA 5JVHL 5KGWA 1QZ6A 1IKXA 2ASMA 3G0ZA 2GX9A 2ZQBA 4AHCA 1QQMA 1L3SA 3SJJA 3RR8A 1E4FT 1OH5A 4I2QA 3U9DA 3TWHA 2J4RA 3LALA 4J2DA 2OPPA 1O13A 3O4WA 4WQ4A 4RWTA 3FZMA 3KHYA 3VQ9A 4HUGA 2VG7A 1JLEA 4AHUA 1BUPA 2BANA 4JD2B 4A5BA 2HBKA 3PO4A 4MQ3A 3S3OA 3H3NO 4CESA 2GEMA 3NHGA 2PAVA 4FWOA 3VQCA 5C12A 1IKYA 2AJQA 3CCRN 4NB4A 3WNFA 4CGJA 4E1NA 1U45A 4DSEA 1TYQA 5KQ8A 3A8YA 3UKRA 4Z4EA 4H0PA 4DV1K 3L6QA 3KLIA 1JLCA 3H08A 2G8HA 2HHUA 4IFVA 3ENHA 3VERA 1TGOA 2W42A 2KW4A 1NK9A 5DK5A 4YORA 1U2VA 3SYZA 4CGHA 4K42A 2XHBA 4CFCA 2O8CB 4DSLA 1HR0K 3A5NC 2D4WA 3CCMN 5FPDA 4F8RA 1RFQA 3SZ2A 2P9LB 3ZCMA 3C6AA 3RRHA 2GUIA 3WNGA 3C6HA 4QCLA 1D4XA 2VYPA 3RMCA 3SV3A 4FLXA 1ESVA 4IBNA 4CZMA 3EKUA 1NGDA 3FZLA 5EOYA 3OY9A 5E41A 4IOXA 4BDYA 1T6DA 4CJTA 3FGUA 1XC9A 3AO1A 2YV0X 3AARA 4CIGA 2XO7A 4CVNE 3RWUA 3SJHA 1SZ2A 4OLBA 4BC3A 3AVNA 3L2UA 3HPGA 2GWJA 4KAZA 4IG3A 1N34K 3R1XA 1E4GT 4R79A 4DFMA 4PKGA 5F1XA 4AHTA 1ASWA 2QI2A 4M42A 4YOWA 4GV9A 3SMSA 4CF2A 2X74A 4CZJA 4CZHA 1S1WA 3ITHA 4CZFA 5DM6L 1WOQA 3AO2A 4BC5A 4I9QA 3AVAA 3THXA 1NGCA 5AQZA 4CECA 1LCUA 4B08A 3THWB 1W7AA 2BGGA 2ASOA 2QWQA 5LY3A 2WFBA 4E3SA 3D7EO 4FPBA 1W2BM 4OPHA 4DQIA 1B9DA 2ZF5O 1K8KA 2HBMA 1SKRA 2Q3SA 2OZSA 3W0LA 4XH1A 4KB1A 1U4BA 4A5AA 2HNYA 4PKIA 3FFKB 4CEAA 4XIUA 4KREA 1C0MA 3ASMA 3G6EN 1WAFA 3CJCA 1WSFA 1HLUA 3WUHA 2O8DA 3QLHA 1ITGA 4M7YA 5JVGL 4RW8A 4F3OA 1KVBA 3HRGA 4IO9L 3QETA 4JKFA 4LFCK 4KBOA 1HPZA 4DF4A 4DTNA 4E19A 4B9TA 4EHTA 2HHHK 3FE1A 5FPNA 1WBBA 4N5SA 1G99A 1RBTA 1MWMA 4BVOA 1ZC6A 3TTCA 2O8EA 3CJ7A 3W3DA 3VA3A 3QEPA 3C6TA 4WF9L 4BE2A 3O3FA 3NMUA 3HL8A 3RMDA 3KK2A 2A1RA 4FM1A 1GOBA 5C2FA 2UU9K 1S5JA 4OGEA 1NM1A 3PIOL 2QWRA 1RTJA 2Q31A 5AQGA 3RMAA 3IS9A 4W5QA 3ZSQA 4EP4A 4XH4A 4W5RA 4CZEA 2QWNA 4U7BA 3ENBA 4JS5A 5DMRA 3B6OA 2A5XA 4JKGB 4LY7A 3BDPA 3LL3A 4H5VA 2HNZA 4PL8A 2CH5A 4IXCA 4B3RK 2UYTA 2ASPA 4FLUA 4BRNA 4DQSA 3EE9A 5BR8K 3S3MA 1GLAG 3L4QA 4DLGA 1IO2A 3DMJA 1J9AA 2JWKA 5HOOA 4IEEA 4BR5A 2QKKA 4JKHA 2Z1IA 3PLAA 2KTQA 2HHXA 2OANA 4IDKA 2E2NA 4JKAA 3DXMA 4N76A 3MEEA 3KKSA 4B3MK 4H4OA 3LDLA 3KTQA 5HLFA 4J2BA 1TKXA 1TAQA 1GLFO 3M6GA 2P9UA 4M3TA 1NG9A 5GAGP 2BE2A 3K5LA 4CFAA 3QNOA 1IG9A 3DRRA 1J53A 3J7YP 3G10A 1JCGA 3DI6A 5LMUK 4EZ9A 3P83D 1RT5A 3AAPA 3FLCO 3MN5A 3WQUA 5BPMA 4QAGA 1RTIA 1TYQB 3ENOA 3R3LA 5FROA 3UKRB 3HZ6A 4A2AA 2F7TA 4CEEA 1HNXK 2HF3A 3CYMA 2NRWA 3TSUA 2QA4N 2E4LA 4FLWA 3SQ4A 1U2VB 3DAWA 1VSJA 1XMOK 3IAYA 3RVCA 3QEVA 1KD1O 3WXIA 1RDWX 3DRPA 1LWEA 4KFBA 2IVOA 2UUAK 2VQFK 2LSNA 1FJGK 3UE5A 5JLFA 3OYMA 1OVQA 2F8TA 3VEOA 3TPQA 3SAGA 1S1UA 4YOVA 1XWLA 1JJ2M 4H5TA 3NDKA 1NK5A 2WTUA 2YHAA 4DLEA 3U3YA 4DU1A 4ILGB 4ELTA 3AVHA 1ZYQA 4B8CA 4AHVA 4WFAL 3MMVA 4BWJA 4OPJA 4A61A 3SAFA 3NE6A 3AVLA 2IGIA 5I3UA 3SPYA 2I5JA 4DS4A 4LH4A 3LZIA 3F2KA 2E88A 3NGIA 4DTOA 3SBGA 2KKZA 1BA0A 1KLMA 1GLDG 2QWOA 2PZSA 2HNDA 3VPZA 3K5MA 3H6EA 2FBTA 3JAMO 1DGKN 4O8KA 4CEDA 3IUCA 1YVUA 4JI6K 5AQQA 3KIOA 4RW7A 3QNNA 3ZT4A 3CERA 4DV4K 2XY7A 1HNZK 5KGXA 4H4MA 5AQWA 2E20A 1CLQA 4B3TK 1XHXA 1J6ZA 4WQ5C 2R7YA 3HVRA 3THXB 4Z4FA 1KFSA 4YHHK 5J2MA 3OJSA 4JI7K 3O1BA 4DUZK 3SBTA 3TAFA 4L3QA 4DSIA 1EP4A 4FWLA 3TABA 2O8FA 1WLJA 2IIRA 2YNIA 4NLBA 4OVLA 3HXMA 1E3MA 3OYFA 4LF6K 2NNWA 5KPZA 3OYKA 1K8KB 2VGMA 4FJ8A 3JXUA 4PQUA 2FC0A 5C25A 3L3VA 3V4IA 4BG9A 4DSFA 2VG5A 3R8EA 1OH6A 1DT9A 3ZETA 1K6YA 4FK0A 5EX5A 2FLOA 3IMXA 3OVNA 3IKMA 4FJGA 3KWGA 3WNEA 2O8DB 5K14A 3N4PA 3LPUA 4B8AB 3OS2A 4B9MA 1W9HA 4XEIA 2HBJA 4LFAK 3DLEA 3ZSZA 4IO8A 1RDBA 4LC9B 1X3NA 4YDUA 1FKPA 3L2QA 1TKTA 3AVJA 1C1AA 4CFBA 5ADXA 4JI0K 2O8EB 1JLGA 4E7KA 3AO3A 5F0XA 4BRQA 1NGHA 1T3VA 3CCUN 5F2RA 1BDGA 2FF6A 2GTDA 2WUSA 4K41A 3CQXA 2D0PA 3K2PA 3HPHA 3SCXA 2GV9A 4JKCA 4BRMA 1CZBA 3OYHA 2ETJA 5HBMA 1IG8A 2A41A 5LL6Z 3TSQA 4AILC 4CK1A 1BQMA 1WSEA 4KHPK 1EO1A 1VQ8N 3DLKA 1L3TA 3CF5L 3RRGA 1FK9A 2RN2A 3HOTA 3P4IA 2G8WA 4I9LA 2A1SA 3MN7A 4KB0A 1V4SA 4H0XB 4CBWA 2DFFA 3ZX2A 4C8MA 3R9PA 4X66K 3O5BA 3HO1A 3CIPA 3PX0A 1N5YA 4RCHA 4KHWA 5AQRA 4BRHA 4K43A 4JNEA 3OYAA 4DS5A 3THYA 1GOAA 1NGJA 3VQQA 1DLOA 1L3UA 4C8OA 5C2DA 3MDQA 1RBVA 3LWMA 2Z1HA 1HMVA 3NGZA 3NF7A 4DR5K 3AVBA 3E1YA 3ZLJA 2W40A 4CJLA 4Z4CA 3SUOA 1VQ9N 1XC3A 1IBKK 3DXMB 1IBLK 1ASUA 3LZJA 2CGJA 1JLQA 4IOAL 3SQ0A 2UUCK 3SI6A 2P9UB 4KHQA 4CGIA 5C15A 3LP2A 3TAMA 5GAHP 1VQ7N 3L2VA 3QIOA 1DTQA 5AQPA 3NH0A 4CJ4A 4DB3A 1FKOA 4CEZA 4LSNA 4LF8K 4BVPA 4W5OA 4DV7K 3OYJA 1IKWA 5AZJA 1U49A 1LW0A 4DCHA 2E1ZA 1X9SA 2YHYA 5AQTA 4NXNK 2NRRA 5LJVA 3O9RA 3ZT1A 3OBYA 1NK4A 3B6PA 4AHRA 3SPZA 3TTFA 5AQOA 4GV6A 3VGMA 1ZXOA 1VSFA 3MEGA 2RHKA 3U6FA 4CJQA 4OPAA 4B3OA 2NRZA 3BF3A 2YHWA 4JKBA 3ZSRA 2A6AA 3ZEUA 3O9UA 3ID8A 1HNWK 4M63C 2IDOA 3MCPA 1NWKA 1BCOA 3HSTB 1YJNN 3AGKA 1VQNN 3ZT2A 3EE8A 3QB0A 1SV5A 1WSJA 3CPWM 3TAEA 3V9WA 5J2PA 1HKCA 3AV9A 2OZMA 3FZKA 1MU2A 4CBUA 5AFUA 4V19S 3VTHA 1QS4A 3VQ4A 4AHSA 1VSHA 1NKEA 1T6CA 4DTJA 4K8XA 1CXQA 4KI4A 2P9KA 3DLHA 1GLJO 4AF1A 5AJ3K 2P1JA 3O8MA 4ICLA 4KI6A 3T19A 2CGLA 3TAGA 3DOLA 3FZHA 4NLCA 1WUAA 1S9GA 3WNHA 3DXKA 4FYDA 4R5PA 1J5OA 3OYCA 1VQON 3MXIA 4KTQA 4BDPA 1VQ6N 1T7PA 4DUYK 4NYNA 3CHWA 5E84A 3OYDA 2NRVA 5AQFA 3TR8A 3GOIA 1EWRA 2E6LA 4B1ZA 1SL1A 4ZHRA 4BG8A 3A5MC 2E6MA 2O4IA 2O8FB 3O6WA 3M5RA 4Y1DA 1WN7A 1ZBSA 1HRHA 4C23A 4FZYA 3HOSA 1WAJA 1VK0A 3ATVA 1NKBA 1Q8IA 4KH6A 3SUNA 3QEWA 1RT7A 1N33K 3EL2A 3K5NA 3MWPA 3M8SA 2HHVA 5CYQA 3VQ8A 3LANA 2W6LA 5FRNA 3KLHA 2XY6A 4FLTA 4JAXA 5AQIA 2Q97A 3AY9A 2YKNA 3PSFA 4GY2B 4CK2A 4EZ6A 3VF2A 4FJNA 4BR7A 3HJFA 2HMPA 3AO4A 2ZE2A 3QDKA 2D0CA 4NO7A 1NMNA 1N6QA 2NRTA 4CF0A 3MK6A 1QVGM 3O1WA 3E66A 2X6SA 5EVZA 3LWLA 3LPTA 4QS9A 1KTQA 4F4KA 4E1JA 1S6QA 1M1KO 2FSNA 1KFDA 4DWIA 4BE0A 4AQYK 3OYGA 3PX6A 2P9PA 3ULDA 4Z4GA 1D5AA 3TTDA 3SNNA 1YTAA 2P9IA 1OVYA 2W6KA 3VEVA 3I8BA 3BUZB 3PV8A 3FR0A 4LF5K 4RG8A 1X1PA 4CJFA 4O0JA 2IVPA 3K59A 4CJ3A 1VSIA 3NFAA 3CPEA 1LW2A 3D0PA 2QK9A 4TSXA 1X3MA 3CCSN 4EHUA 4FK4A 3T1YK 4W5NA 1H1VA 1Z6RA 4ZTJA 4FJIA 4ID1A 2YHBA 4KKOA 5AZIA 3MEDA 2ITMA 4KO0A 2ITGA 4UQGA 3F73A 4ILHA 3C95A 1QQOA 4BRKA 4DR3K 3HM8A 3LP3A 4HHTA 1VRTA 3D6RA 3PIPL 3CMAN 3K9JA 4CI6A 5BRHA 1B92A 4BRDA 3PSIA 1NOZA 1TK5A 3J7AP 3HP6A 1VQLN 4JRQA 4JYAK 2WC9A 4FZZA 2ZJPL 1QZ5A 3P39A 5AQMA 3L2WA 4FL9A 2ZGYA 1HJOA 3CD6N 2BTFA 3SUPA 1P8ZA 4OX9K 3HM9A 3CC2N 3QINA 4IFEA 3N4QA 2OCEA 1RTDA 1BO5O 3OS1A 2YX6A 5EU7A 3UKUA 4FJHA 2KLAA 4C8NA 4BACA 4O8UA 4CHPA 4IZ9A 3Q7BA 5AZJB 4CJSA 3CCLN 3MN6A 1HQEA 3VGKA 1KRPA 4B9SA 3DLBA 3PUFA 3O9SA 1Q86O 3L4IA 1JLBA 5AQUA 4DQQA 3OA9A 4BY9C 2ZJRL 3ZSVA 3KKRA 3P38A 3L8BA 1S22A 4WE1A 3U9ZA 1HUXA 3D2FA 3O3HA 1VAZA 2RF2A 1IH7A 3B8AX 2Q2RA 5LJWA 2W41A 4OGCA 2PYJA 4FPAA 4HCCA 2G8KA 1HYZA 3SUQA 4FLZA 3ZEUB 2Q1NA 1RDDA 1A5XA 3ID6A 1WNSA 1U48A 1CXUA 3QEXA 4PWDA 2HW3A 3VQDA 4DTRA 3C94A 4FM2A 3LDQA 4FWSA 4O55A 4PKHA 4EFHA 5HROA 1EKEA 3I8DA 1S1TA 3VESA 3TI0A 1NKCA 1R59O 3KD5E 2UXCK 1QSYA 5FRMA 2P51A 3J8AA 4X64K 1UA0A 3MN9A 4GMJB 1BI4A 4B3SK 4CCHA 3LDSA 2UXBK 1XNQK 3Q7CA 3VENA 3H46O 3VQ5A 4ZTFA 4MLEA 5KI6A 4WFBL 3CFPA 4FJ7A 4B9VA 3NGYA 4FJJA 2Z1JA 1O1WA 3ZX0A 1S1XA 2P9KB 1Z05A 1W97L 5HL7L 1VQ4N 1QHTA 1A5WA 1RBUA 4JRPA 3S9HA 4DF8A 3VQ6A 3K0SA 1BCMA 5AQYA 1C0TA 1RT1A 3EN9A 2D0OA 3WXMB 3VQPA 4H5WA 3VMFB 4KRFA 2KFNA 3O08A 4RW4A 3AAQA 2IS3A 4GVMA 1YITN 4FJXA 1U6ZA 4OLAA 4J8FA 1Z26A 1NNEA 3LP0A 1ZBHA 3HI0A 1NK6A 4B9NA 3V1RA 2F4VK 4I2PA 1N32K 1RILA 4RW6A 3M3ZA 1TL1A 3RSEA 4ELVA 1ZBFA 3VOVA 4CK3A 1T8EA 1Q81O 3CQ8A 3E9OA 5AQXA 3T7ZA 2YNGA 4CHNA 3IDHA 5SZTA 3E01A 5KPRA 3V81A 4JLHA 5GAEP 5BREA 5M1NA 2QEXN 1SQKA 4KTWA 4BRPA 1YVNA 2AA4A 4O4GA 3TANA 4X62K 1I94K 1WSIA 3CG7A 4CJEA 3GBTA 3K57A 3CCEN 4CZKA 3WXKA 2YJEA 5FLXO 4OJRA 4DFJA 2HOEA 4JN4A 3FZFA 3MCAB 4IDHA 3A2FA 3HBTA 4C8KA 1XQSC 4JI5K 4M3XA 1UA1A 4A2BA 1RT2A 3V9ZA 4NYFA 4H0OA 2H3GX 3DM2A 4BDZA 2E8AA 3AVIA 2HB5A 2VWBA 2RPIA 4Z4HA 1NOYA 3KD1E 3MWTA 4E7IA 1SAZA 4BRIA 2Q0UA 5AQHA 3J80O 4DMNA 3EY1A 3I56N 3SQ1A 5CHIA 4AH9A 2F9TA 4H0YB 1BA1A 3CFOA 3BP8A 3I0SA 3M8RA 2P9PB 4B9QA 1UAXA 4DR1K 3LAMA 1KVAA 4LF7K 1SL2A 4NCBA 4FVMA 3BF1A 1VQ5N 4CZGA 4E89A 1EWQA 1NGGA 2FBYA 3VQBA 2HHTA 4BR2A 4CZIA 3VQEA 4B9LA 4J2AA 3OHRA 2HHQA 1VQPN 4GNIA 4BGBA 3AVMA 3OJUA 1NGEA 3OYLA 3VQ7A 3MXMA 1KQSM 4DG1A 2FF3B 2PFUA 2VGNA 3E9PA 1WB9A 2ATQA 3TAQA 1NU0A 3NVMA 4DTXA 5AZIB 1QSSA 4HUFA 5AQSA 3VEYA 3GG4A 3U3GA 2JGUA 4E1MA 2NZTA 5AQLA 3CI5A 1TKDA 1G15A 3HYFA 1GLEG 3QBWA 1LAWA 3AA4A 4CD1A 1S6PA 4DV6K 1LWFA 3NF6A 2IVNA 3AVCA 5IWAK 5FDLA 3A5OC 3DOKA 3HTVA 3O4QA 4LH5A 4B1XB 4DTPA 1K8AO 2D1KA 1RT4A 1RCHA 3LP1A 4JHDA 3G4SN 2HBLA 1U04A 5BPNA 5GIPA 2EX3A 3CMEN 4J2EA 4BRAA 2UXDK 3KVGA 4CHYA 1WBDA 3U4LA 4FW2A 1HQUA 2RE2A 5CE3A 4CJWA 3AVKA 1FXXA 3L0QA 4RW9A 3KWIA 4JI1K 3QFUA 5B8HA 5TKYA 3VEXA 4Y0WA 5M1OA 1JKHA 5TKWA 5JLHA 3RMBA 1QSLA 4XH5A 2YHXA 2JWLA 4BC2A 3OYBA 1VQKN 2XY8A 3C0BA 3IFRA 2P9SA 4GKJK 4YY3K 2F9WA 5GADP 2KHOA 4F9OA 3JS6A 3D2FB 5CR4A 4MDAA 3SQ2A 4O0IA 5JS2A 3QO9A 1S3XA 1UOCA 3V9SA 1MDUB 5FPMA 5EY4A 1KSPA 1NLVA 3ISNC 2P5OA 3M1FA 1TVRA 3LAKA 1C1CA 2X6NA 4PY5A 3ZSYA 4B1WB 4H8KA 3SK3A 3VA0A 3QMLA 2EHGA 2VG6A 1BIZA 3DRSA 4KPYA 1C0FA 4FK2A 5M1FA 3VF6A 4DV3K 1BI4B 4DHYA 1OH7A 3I33A 4IEIA 4ISEA 3H1QA 1RBSA 2E1YA 3PX4A 4CZLA 1J54A 3ULEA 2E2QA 3C65A 3VGLA 4Q0BA 3O9QA 2WOMA 4JK8A 1NBWA 2YNHA 1NJYA 4M3YA 4N47A 3QICA 3NAEA 2QW9A 3T1HK 1K9MO 1RBRA 1RNHA 2B4JA 4X65K 5HRNA 4CJKA 1NK8A 5SWMA 2VWJA 3MX5A 4LF9K 3LM2A 1XMQK 1Q9XA 4DQRA 4CERA 2G8IA 1OH8A 1JLFA 2D0BA 3MECA 4CJRA 1BWFO 4AM6A 5C24A 4BC4A 4YDUC 5JMVA 2HHWA 1RT3A 3G25A 4HWIA 4CJPA 4CGGA 3CFRA 2A3ZA 4Z4IA 3WXLA 3OYNA 1UWBA 3VETA 3RSEB 2HHSA 4YOXA 4E7JA 1TV6A 3VTIA 4EP5A 5M1QA 3TSPA 4JKEA 3V6DA 1ATNA 3FFIA 1QHAA 3O80A 1X9WA 4W5TA 3F5TA 1JCEA 3ZYYX 3IRXA 3WXJA 2F96A 1YT3A 4B9UA 3CXCM 1NJXA 3PY8A 5HP1A 2A42A 1ZBLA 4CF9A 1YTUA 2E2PA 3HK2A 4FVUA 1L5UA 4H0VB 1LOTB 2QTDA 1N36K 2HVIA 2QWMA 1Q82O 4KHYA 4FZXC 4FXDA 3EYZA 4C1NK 1HX1A 1KXPA 4ELUA 1TAUA 5J2NA 4DU3A 4QS8A 3EO3A 1OKJA 4F2RA 2CH6A 3MAQA 2KZZA 3CJ1A 3DLGA 2Q36A 3CCJN 1N8RO 2Q0RA 2FSJA 3H3OB 4ILJA 4DV2K 3VEWA 3QESA 4DTUA 1TUYA 3G71N 2HVHA 2Z1GA 4DFPA 2GUPA 4IKFA 1Q9YA 2KFZA 3K58A 1KCFA 1XHZA 3ALYA 3C7NA 3D2EA 3KK7A 4DR2K 2Y1IA 5CYMA 2XRIA 4HUEA 4YOYA 3DJCA 3OBWA 3MXJA 3PO5A 2VWKA 1VSEA 4BRCA 1K73O 1QTMA 1J5EK 1QVFM 2YNFA 4M3RA 4HCBA 2F8SA 2O8BA 3IG1A 1D9DA 2P9NA 3CQYA 5E26A 1F21A 3ZETB 5BN8A 4M3ZA 1YAGA 3WEEA 1ATSA 2G8UA 4OKJA 4JHDB 4BR4A 2YI1A 1CZ9A 5GINA 1BL3A 5KRTA 2O4GA 4WFNL 4IOCL 1KLNA 1A5VA 1WSHA 1GLCG 4CBXA 1BG3A 3P1GA 4UY8O 2KQ2A 4CE9A 4JI8K 3L3UA 1IKVA 2QKBA
chains in the Genus database with same CATH topology
5AJ3K 4YHHK 2UXCK 3J80O 4JI7K 4JI4K 3J81O 4DUZK 4DR5K 4NXMK 3T1YK 4X64K 4K0KK 3J7YP 5LMUK 4DR1K 4JI3K 4B3SK 1N36K 2UXBK 1XNQK 4LF7K 1HR0K 4LFCK 4LF6K 1IBKK 1IBLK 2E5LK 4DUYK 2UUBK 2UUCK 2HHHK 1HNXK 4DR3K 4DR6K 1XNRK 3OTOK 1XMOK 4LFBK 4DV3K 3J7AP 4JI2K 4LF8K 4LF4K 4DV2K 4DV7K 2UUAK 5IT9O 2VQFK 4JYAK 1FJGK 2UU9K 4DV5K 4LFAK 1N33K 4CVNE 4NXNK 4DV6K 4DV0K 4JI0K 2F4VK 4OX9K 1N32K 2VQEK 5IWAK 4JV5K 4DR2K 1N34K 2ZM6K 3T1HK 4X65K 4LF9K 1XMQK 1J5EK 1IBMK 5LL6Z 1HNWK 4X62K 1I94K 2UXDK 4B3RK 4KHPK 5FLXO 5A2QO 4DR7K 5BR8K 4DR4K 4JI1K 3JAMO 4JI5K 4GKKK 4AQYK 4V19S 4X66K 4JI6K 4CW7B 4DV4K 1HNZK 4B3MK 5LMNK 4LF5K 4GKJK 4YY3K 4B3TK 4DV1K 4JI8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJ3 K;  4YHH K;  2UXC K;  3J80 O;  4JI7 K;  4JI4 K;  3J81 O;  4DUZ K;  4DR5 K;  4NXM K;  3T1Y K;  4X64 K;  4K0K K;  3J7Y P;  5LMU K;  4DR1 K;  4JI3 K;  4B3S K;  1N36 K;  2UXB K;  1XNQ K;  4LF7 K;  1HR0 K;  4LFC K;  4LF6 K;  1IBK K;  1IBL K;  2E5L K;  4DUY K;  2UUB K;  2UUC K;  2HHH K;  1HNX K;  4DR3 K;  4DR6 K;  1XNR K;  3OTO K;  1XMO K;  4LFB K;  4DV3 K;  3J7A P;  4JI2 K;  4LF8 K;  4LF4 K;  4DV2 K;  4DV7 K;  2UUA K;  5IT9 O;  2VQF K;  4JYA K;  1FJG K;  2UU9 K;  4DV5 K;  4LFA K;  1N33 K;  4CVN E;  4NXN K;  4DV6 K;  4DV0 K;  4JI0 K;  2F4V K;  4OX9 K;  1N32 K;  2VQE K;  5IWA K;  4JV5 K;  4DR2 K;  1N34 K;  2ZM6 K;  3T1H K;  4X65 K;  4LF9 K;  1XMQ K;  1J5E K;  1IBM K;  5LL6 Z;  1HNW K;  4X62 K;  1I94 K;  2UXD K;  4B3R K;  4KHP K;  5FLX O;  5A2Q O;  4DR7 K;  5BR8 K;  4DR4 K;  4JI1 K;  3JAM O;  4JI5 K;  4GKK K;  4AQY K;  4V19 S;  4X66 K;  4JI6 K;  4CW7 B;  4DV4 K;  1HNZ K;  4B3M K;  5LMN K;  4LF5 K;  4GKJ K;  4YY3 K;  4B3T K;  4DV1 K;  4JI8 K; 
#chains in the Genus database with same CATH topology
 4FJ9 A;  1LAV A;  2WON A;  3CJA A;  4CEO A;  4CJV A;  4FO0 A;  5KTQ A;  2V7Z A;  1X9M A;  1R0A A;  4ID5 A;  2NRX A;  4C1N I;  1VSD A;  3AA5 X;  4CJ7 A;  1GLL O;  3J7Z O;  4CF8 A;  3P31 A;  4WQ4 C;  1EQY A;  3T69 A;  4M3U A;  3NF8 A;  2P9S B;  1ZBU A;  4LD0 A;  3EZ5 A;  3DYA A;  2UUB K;  1NJZ A;  4EIA A;  4DR6 K;  1JXB A;  2D0A A;  4MLH A;  4EAH D;  1QQN A;  3CJB A;  1L3V A;  2BH1 A;  1TUU A;  3KK1 A;  1Z25 A;  4KHN A;  3SV4 A;  2YKM A;  3H45 C;  4BR0 A;  1SKS A;  3EZW A;  4LFB K;  4H5R A;  3GL1 A;  4Y1C A;  4JI2 K;  4FM0 A;  4NCG A;  4N41 A;  5IT9 O;  1SS6 A;  5CZ2 A;  3CM5 A;  1BHL A;  4O5F A;  5C0Y A;  3OYI A;  1VRU A;  1HPM A;  2A40 A;  4MFB A;  5HRS A;  4DV5 K;  2B6A A;  2OTJ N;  5AQK A;  5C10 A;  1D8Y A;  3THY B;  4A62 A;  3CJ9 A;  5HRR A;  3ZSO A;  4YFU A;  5HRP A;  4ISG A;  3F9M A;  4YOT A;  1ATR A;  3CC7 N;  1HYV A;  3AVF A;  4HVJ A;  1QQC A;  4K8Z A;  1MWK A;  3LDO A;  1HKB A;  3ULE B;  2VCP A;  5KPT A;  4BQL A;  5M1P A;  1MA9 B;  3AA2 A;  3O3G A;  4O5B A;  5ELZ A;  4BRF A;  5BRD A;  1S72 N;  2BDP A;  5MLC Q;  1KAZ A;  2E2O A;  1Q7Y O;  3V9X A;  3QIP A;  4FJ5 A;  1VHX A;  1C1B A;  1RDA A;  4OO1 J;  2OYQ A;  3T3F A;  4CJ5 A;  1KVC A;  4YNQ A;  1LV5 A;  1KAY A;  1XI1 A;  4DTM A;  3NF9 A;  4DQP A;  2FXU A;  4OKE A;  2PY5 A;  3LM9 A;  2OPQ A;  3EKS A;  4JK7 A;  1YF5 L;  3ZX3 A;  1RDU A;  1DEJ A;  1T03 A;  4M7X A;  4IWV A;  3VF4 A;  4JI4 K;  2ZWH A;  3O9T A;  4I6M A;  4DTS A;  1GLB G;  2ZD1 A;  2FBX A;  1JL1 A;  3KLE A;  3BZK A;  3NBP A;  4K0K K;  3ZSW A;  4NCA A;  2V51 B;  5J1E A;  4JI3 K;  2Y1J A;  1V4T A;  2XY5 A;  4DSJ A;  1Y64 A;  1S1V A;  4GVE A;  5ADX H;  3K5O A;  4HTU A;  5BN9 A;  4OKK A;  5BPL A;  1S9E A;  3SAH A;  1YIJ N;  4PHT X;  5JIC A;  3HT3 A;  3WQT A;  5AQN A;  3OTO K;  1I39 A;  4BWM A;  4U67 L;  4F2S A;  1ZBI A;  2FBV A;  3SLC A;  4KTZ A;  4CHO A;  3V1O A;  2V7Y A;  4DQ8 A;  1C0G A;  2QXF A;  2OA8 A;  2RKI A;  3RTV A;  4JS4 A;  4YOU A;  2DY4 A;  4CJU A;  5FPE A;  2AP1 A;  1KAX A;  3TAP A;  2V52 B;  1W0H A;  4OPK A;  3JSM A;  1TL3 A;  2PBD A;  3DXK B;  3V1Q A;  2WBN A;  4B1Y B;  1IBM K;  3HP9 A;  4RTF D;  4MO5 A;  1B9F A;  5J2Q A;  3TAR A;  1RGI A;  3U8X A;  3BGR A;  4GW6 A;  4WCE L;  1NGI A;  4CD3 A;  3C7N B;  4WQ5 A;  3D2E B;  1IV0 A;  3UB5 A;  4DR7 K;  5AQV A;  1TKZ A;  4DR4 K;  4E7L A;  4BRL A;  3AA3 A;  5KRS A;  1VQM N;  1YJ9 N;  4PA1 A;  2HMI A;  4L8R B;  4FWP A;  1BOT O;  4CW7 B;  4LSL A;  2O8B B;  2P9N B;  5LMN K;  4M3W A;  1FW6 A;  1WSG A;  3CC4 N;  4DSK A;  4FOI A;  3WEE B;  5I9E B;  3J81 O;  2ZJQ L;  1BU6 O;  2GBZ A;  3HPO A;  3A0I X;  1Q18 A;  2IOC A;  4JKD A;  2QM1 A;  1RDC A;  4C8L A;  2DPN A;  3KLG A;  1ILY A;  1VSK A;  1KC8 O;  2GWK A;  3MX2 A;  2KZM A;  3QFP A;  4KH5 A;  2YJF A;  4FOE A;  4F3T A;  3E9L A;  1NGB A;  4FJM A;  3V9U A;  1YUW A;  3AO5 A;  4CF1 A;  1TK0 A;  2IC3 A;  3S41 A;  1NJW A;  4FSV A;  4H0T B;  1BGX T;  4B1V A;  4CIE A;  5H1S Q;  4G9Z A;  2FSK A;  5T7B A;  2QWL A;  2P9I B;  3KK3 A;  3ZT3 A;  4FJL A;  1JXE A;  4DKW A;  3ATU A;  4IFY A;  3KJV A;  1U47 A;  2OPR A;  4FWN A;  5AFU H;  4DV0 K;  4CHZ A;  4CHQ A;  2HST A;  3F9K A;  4JD2 A;  3UIQ A;  4KV8 A;  1DTT A;  2EWS A;  4CEQ A;  1Y97 A;  3AGR A;  4E0D A;  2QWP A;  3T1A A;  1SKW A;  4M41 A;  3KZB A;  1D9F A;  3BEX A;  4CFD A;  4FJK A;  3C6U A;  5A2Q O;  3DLR A;  4KHS A;  1EXQ A;  4FWR A;  4BQZ A;  4AM7 A;  5JS1 A;  5BRF A;  4FLY A;  3M8Q A;  4Z0U A;  3VQA A;  3ZSX A;  3BY5 A;  3VN5 A;  1HNI A;  1HNV A;  3KLF A;  4GKK K;  3S3N A;  2I7P A;  3R6M A;  3VEZ A;  4IG0 A;  2O8C A;  4G1Q A;  1TK8 A;  4CIF A;  5I42 A;  1GOC A;  2NLX A;  2QXL A;  3RR7 A;  4DFK A;  4BRE A;  2P9L A;  4JEP A;  3CM6 A;  1I3A A;  1C0U A;  1CZA N;  2NUB A;  3JYT A;  4FW1 A;  5DM7 L;  4CGF A;  3HVT A;  4FWM A;  1SUQ A;  4NXM K;  3NCI A;  1BIS A;  2I7N A;  2DTU A;  3OYE A;  3UKU B;  5KQD A;  4A57 A;  1NJI O;  1JL2 A;  4BR9 A;  1DKG D;  1HJR A;  4FLV A;  1M90 O;  2P5G A;  1NK0 A;  4GV3 A;  4B1U B;  1NMD A;  1NK7 A;  3CCQ N;  1HKG A;  3CET A;  3P5J A;  3LDP A;  3TU5 A;  3DLL L;  1XNR K;  4A59 A;  1ASV A;  4I6M B;  1BQN A;  4BRO A;  4CEB A;  4MO4 A;  1EX4 A;  5GIO A;  1YI2 N;  2D5R A;  3ZT0 A;  4FWK A;  3QBX A;  2X78 A;  3O4N A;  1P90 A;  4LF4 K;  3GDQ A;  1YHQ N;  4CEF A;  3HSC A;  1XUP O;  2BUP A;  3OW2 M;  1YJW N;  4PL7 A;  1YXQ A;  3K9K A;  1REV A;  3NVK A;  4JK9 A;  2VQE K;  1T44 A;  2ZGZ A;  2NRH A;  1EET A;  4IJN A;  4FCY A;  4JV5 K;  1VSL A;  4IJA A;  2ZM6 K;  3THW A;  4ISF A;  5EXW A;  4E7H A;  3DWL A;  3NH1 A;  1NGF A;  4MDB A;  5M1K A;  3M8P A;  3WT0 A;  4KH4 A;  5D3G A;  4PUO A;  3AVG A;  3A5L C;  4Z94 A;  1JCF A;  4BGA A;  4M45 A;  1IJJ A;  1C6V A;  4HTL A;  4WYB A;  3NH2 A;  3L2R A;  2JLE A;  3QER A;  3I0R A;  3THV A;  4N56 A;  1QE1 A;  5C42 A;  4FWQ A;  5CY4 A;  1SL0 A;  1LWC A;  4BE1 A;  5BR9 A;  2GEL A;  2PYL A;  3QEI A;  3I55 N;  2G8V A;  1X9J A;  1T05 A;  3OS0 A;  2B5J A;  2G8F A;  1RTH A;  2DFE A;  5AQJ A;  4DU4 A;  4K25 A;  3D45 A;  5CZ1 A;  4QOZ B;  2YCH A;  1NGA A;  4I7F A;  4CGD A;  4KHU A;  4BRG A;  4QS7 A;  3EEQ A;  2E5L K;  3LDN A;  1RT6 A;  2OPS A;  1HYS A;  1BIU A;  1JLA A;  2CGK A;  4H5N A;  2DFH A;  3SMP A;  3GE1 A;  4Q5V A;  4O44 A;  4H03 B;  3BZC A;  2IAJ A;  1VSM A;  2OTL N;  2HF4 A;  3CCV N;  3H1V X;  5AR0 A;  4JKG A;  5JVH L;  5KGW A;  1QZ6 A;  1IKX A;  2ASM A;  3G0Z A;  2GX9 A;  2ZQB A;  4AHC A;  1QQM A;  1L3S A;  3SJJ A;  3RR8 A;  1E4F T;  1OH5 A;  4I2Q A;  3U9D A;  3TWH A;  2J4R A;  3LAL A;  4J2D A;  2OPP A;  1O13 A;  3O4W A;  4WQ4 A;  4RWT A;  3FZM A;  3KHY A;  3VQ9 A;  4HUG A;  2VG7 A;  1JLE A;  4AHU A;  1BUP A;  2BAN A;  4JD2 B;  4A5B A;  2HBK A;  3PO4 A;  4MQ3 A;  3S3O A;  3H3N O;  4CES A;  2GEM A;  3NHG A;  2PAV A;  4FWO A;  3VQC A;  5C12 A;  1IKY A;  2AJQ A;  3CCR N;  4NB4 A;  3WNF A;  4CGJ A;  4E1N A;  1U45 A;  4DSE A;  1TYQ A;  5KQ8 A;  3A8Y A;  3UKR A;  4Z4E A;  4H0P A;  4DV1 K;  3L6Q A;  3KLI A;  1JLC A;  3H08 A;  2G8H A;  2HHU A;  4IFV A;  3ENH A;  3VER A;  1TGO A;  2W42 A;  2KW4 A;  1NK9 A;  5DK5 A;  4YOR A;  1U2V A;  3SYZ A;  4CGH A;  4K42 A;  2XHB A;  4CFC A;  2O8C B;  4DSL A;  1HR0 K;  3A5N C;  2D4W A;  3CCM N;  5FPD A;  4F8R A;  1RFQ A;  3SZ2 A;  2P9L B;  3ZCM A;  3C6A A;  3RRH A;  2GUI A;  3WNG A;  3C6H A;  4QCL A;  1D4X A;  2VYP A;  3RMC A;  3SV3 A;  4FLX A;  1ESV A;  4IBN A;  4CZM A;  3EKU A;  1NGD A;  3FZL A;  5EOY A;  3OY9 A;  5E41 A;  4IOX A;  4BDY A;  1T6D A;  4CJT A;  3FGU A;  1XC9 A;  3AO1 A;  2YV0 X;  3AAR A;  4CIG A;  2XO7 A;  4CVN E;  3RWU A;  3SJH A;  1SZ2 A;  4OLB A;  4BC3 A;  3AVN A;  3L2U A;  3HPG A;  2GWJ A;  4KAZ A;  4IG3 A;  1N34 K;  3R1X A;  1E4G T;  4R79 A;  4DFM A;  4PKG A;  5F1X A;  4AHT A;  1ASW A;  2QI2 A;  4M42 A;  4YOW A;  4GV9 A;  3SMS A;  4CF2 A;  2X74 A;  4CZJ A;  4CZH A;  1S1W A;  3ITH A;  4CZF A;  5DM6 L;  1WOQ A;  3AO2 A;  4BC5 A;  4I9Q A;  3AVA A;  3THX A;  1NGC A;  5AQZ A;  4CEC A;  1LCU A;  4B08 A;  3THW B;  1W7A A;  2BGG A;  2ASO A;  2QWQ A;  5LY3 A;  2WFB A;  4E3S A;  3D7E O;  4FPB A;  1W2B M;  4OPH A;  4DQI A;  1B9D A;  2ZF5 O;  1K8K A;  2HBM A;  1SKR A;  2Q3S A;  2OZS A;  3W0L A;  4XH1 A;  4KB1 A;  1U4B A;  4A5A A;  2HNY A;  4PKI A;  3FFK B;  4CEA A;  4XIU A;  4KRE A;  1C0M A;  3ASM A;  3G6E N;  1WAF A;  3CJC A;  1WSF A;  1HLU A;  3WUH A;  2O8D A;  3QLH A;  1ITG A;  4M7Y A;  5JVG L;  4RW8 A;  4F3O A;  1KVB A;  3HRG A;  4IO9 L;  3QET A;  4JKF A;  4LFC K;  4KBO A;  1HPZ A;  4DF4 A;  4DTN A;  4E19 A;  4B9T A;  4EHT A;  2HHH K;  3FE1 A;  5FPN A;  1WBB A;  4N5S A;  1G99 A;  1RBT A;  1MWM A;  4BVO A;  1ZC6 A;  3TTC A;  2O8E A;  3CJ7 A;  3W3D A;  3VA3 A;  3QEP A;  3C6T A;  4WF9 L;  4BE2 A;  3O3F A;  3NMU A;  3HL8 A;  3RMD A;  3KK2 A;  2A1R A;  4FM1 A;  1GOB A;  5C2F A;  2UU9 K;  1S5J A;  4OGE A;  1NM1 A;  3PIO L;  2QWR A;  1RTJ A;  2Q31 A;  5AQG A;  3RMA A;  3IS9 A;  4W5Q A;  3ZSQ A;  4EP4 A;  4XH4 A;  4W5R A;  4CZE A;  2QWN A;  4U7B A;  3ENB A;  4JS5 A;  5DMR A;  3B6O A;  2A5X A;  4JKG B;  4LY7 A;  3BDP A;  3LL3 A;  4H5V A;  2HNZ A;  4PL8 A;  2CH5 A;  4IXC A;  4B3R K;  2UYT A;  2ASP A;  4FLU A;  4BRN A;  4DQS A;  3EE9 A;  5BR8 K;  3S3M A;  1GLA G;  3L4Q A;  4DLG A;  1IO2 A;  3DMJ A;  1J9A A;  2JWK A;  5HOO A;  4IEE A;  4BR5 A;  2QKK A;  4JKH A;  2Z1I A;  3PLA A;  2KTQ A;  2HHX A;  2OAN A;  4IDK A;  2E2N A;  4JKA A;  3DXM A;  4N76 A;  3MEE A;  3KKS A;  4B3M K;  4H4O A;  3LDL A;  3KTQ A;  5HLF A;  4J2B A;  1TKX A;  1TAQ A;  1GLF O;  3M6G A;  2P9U A;  4M3T A;  1NG9 A;  5GAG P;  2BE2 A;  3K5L A;  4CFA A;  3QNO A;  1IG9 A;  3DRR A;  1J53 A;  3J7Y P;  3G10 A;  1JCG A;  3DI6 A;  5LMU K;  4EZ9 A;  3P83 D;  1RT5 A;  3AAP A;  3FLC O;  3MN5 A;  3WQU A;  5BPM A;  4QAG A;  1RTI A;  1TYQ B;  3ENO A;  3R3L A;  5FRO A;  3UKR B;  3HZ6 A;  4A2A A;  2F7T A;  4CEE A;  1HNX K;  2HF3 A;  3CYM A;  2NRW A;  3TSU A;  2QA4 N;  2E4L A;  4FLW A;  3SQ4 A;  1U2V B;  3DAW A;  1VSJ A;  1XMO K;  3IAY A;  3RVC A;  3QEV A;  1KD1 O;  3WXI A;  1RDW X;  3DRP A;  1LWE A;  4KFB A;  2IVO A;  2UUA K;  2VQF K;  2LSN A;  1FJG K;  3UE5 A;  5JLF A;  3OYM A;  1OVQ A;  2F8T A;  3VEO A;  3TPQ A;  3SAG A;  1S1U A;  4YOV A;  1XWL A;  1JJ2 M;  4H5T A;  3NDK A;  1NK5 A;  2WTU A;  2YHA A;  4DLE A;  3U3Y A;  4DU1 A;  4ILG B;  4ELT A;  3AVH A;  1ZYQ A;  4B8C A;  4AHV A;  4WFA L;  3MMV A;  4BWJ A;  4OPJ A;  4A61 A;  3SAF A;  3NE6 A;  3AVL A;  2IGI A;  5I3U A;  3SPY A;  2I5J A;  4DS4 A;  4LH4 A;  3LZI A;  3F2K A;  2E88 A;  3NGI A;  4DTO A;  3SBG A;  2KKZ A;  1BA0 A;  1KLM A;  1GLD G;  2QWO A;  2PZS A;  2HND A;  3VPZ A;  3K5M A;  3H6E A;  2FBT A;  3JAM O;  1DGK N;  4O8K A;  4CED A;  3IUC A;  1YVU A;  4JI6 K;  5AQQ A;  3KIO A;  4RW7 A;  3QNN A;  3ZT4 A;  3CER A;  4DV4 K;  2XY7 A;  1HNZ K;  5KGX A;  4H4M A;  5AQW A;  2E20 A;  1CLQ A;  4B3T K;  1XHX A;  1J6Z A;  4WQ5 C;  2R7Y A;  3HVR A;  3THX B;  4Z4F A;  1KFS A;  4YHH K;  5J2M A;  3OJS A;  4JI7 K;  3O1B A;  4DUZ K;  3SBT A;  3TAF A;  4L3Q A;  4DSI A;  1EP4 A;  4FWL A;  3TAB A;  2O8F A;  1WLJ A;  2IIR A;  2YNI A;  4NLB A;  4OVL A;  3HXM A;  1E3M A;  3OYF A;  4LF6 K;  2NNW A;  5KPZ A;  3OYK A;  1K8K B;  2VGM A;  4FJ8 A;  3JXU A;  4PQU A;  2FC0 A;  5C25 A;  3L3V A;  3V4I A;  4BG9 A;  4DSF A;  2VG5 A;  3R8E A;  1OH6 A;  1DT9 A;  3ZET A;  1K6Y A;  4FK0 A;  5EX5 A;  2FLO A;  3IMX A;  3OVN A;  3IKM A;  4FJG A;  3KWG A;  3WNE A;  2O8D B;  5K14 A;  3N4P A;  3LPU A;  4B8A B;  3OS2 A;  4B9M A;  1W9H A;  4XEI A;  2HBJ A;  4LFA K;  3DLE A;  3ZSZ A;  4IO8 A;  1RDB A;  4LC9 B;  1X3N A;  4YDU A;  1FKP A;  3L2Q A;  1TKT A;  3AVJ A;  1C1A A;  4CFB A;  5ADX A;  4JI0 K;  2O8E B;  1JLG A;  4E7K A;  3AO3 A;  5F0X A;  4BRQ A;  1NGH A;  1T3V A;  3CCU N;  5F2R A;  1BDG A;  2FF6 A;  2GTD A;  2WUS A;  4K41 A;  3CQX A;  2D0P A;  3K2P A;  3HPH A;  3SCX A;  2GV9 A;  4JKC A;  4BRM A;  1CZB A;  3OYH A;  2ETJ A;  5HBM A;  1IG8 A;  2A41 A;  5LL6 Z;  3TSQ A;  4AIL C;  4CK1 A;  1BQM A;  1WSE A;  4KHP K;  1EO1 A;  1VQ8 N;  3DLK A;  1L3T A;  3CF5 L;  3RRG A;  1FK9 A;  2RN2 A;  3HOT A;  3P4I A;  2G8W A;  4I9L A;  2A1S A;  3MN7 A;  4KB0 A;  1V4S A;  4H0X B;  4CBW A;  2DFF A;  3ZX2 A;  4C8M A;  3R9P A;  4X66 K;  3O5B A;  3HO1 A;  3CIP A;  3PX0 A;  1N5Y A;  4RCH A;  4KHW A;  5AQR A;  4BRH A;  4K43 A;  4JNE A;  3OYA A;  4DS5 A;  3THY A;  1GOA A;  1NGJ A;  3VQQ A;  1DLO A;  1L3U A;  4C8O A;  5C2D A;  3MDQ A;  1RBV A;  3LWM A;  2Z1H A;  1HMV A;  3NGZ A;  3NF7 A;  4DR5 K;  3AVB A;  3E1Y A;  3ZLJ A;  2W40 A;  4CJL A;  4Z4C A;  3SUO A;  1VQ9 N;  1XC3 A;  1IBK K;  3DXM B;  1IBL K;  1ASU A;  3LZJ A;  2CGJ A;  1JLQ A;  4IOA L;  3SQ0 A;  2UUC K;  3SI6 A;  2P9U B;  4KHQ A;  4CGI A;  5C15 A;  3LP2 A;  3TAM A;  5GAH P;  1VQ7 N;  3L2V A;  3QIO A;  1DTQ A;  5AQP A;  3NH0 A;  4CJ4 A;  4DB3 A;  1FKO A;  4CEZ A;  4LSN A;  4LF8 K;  4BVP A;  4W5O A;  4DV7 K;  3OYJ A;  1IKW A;  5AZJ A;  1U49 A;  1LW0 A;  4DCH A;  2E1Z A;  1X9S A;  2YHY A;  5AQT A;  4NXN K;  2NRR A;  5LJV A;  3O9R A;  3ZT1 A;  3OBY A;  1NK4 A;  3B6P A;  4AHR A;  3SPZ A;  3TTF A;  5AQO A;  4GV6 A;  3VGM A;  1ZXO A;  1VSF A;  3MEG A;  2RHK A;  3U6F A;  4CJQ A;  4OPA A;  4B3O A;  2NRZ A;  3BF3 A;  2YHW A;  4JKB A;  3ZSR A;  2A6A A;  3ZEU A;  3O9U A;  3ID8 A;  1HNW K;  4M63 C;  2IDO A;  3MCP A;  1NWK A;  1BCO A;  3HST B;  1YJN N;  3AGK A;  1VQN N;  3ZT2 A;  3EE8 A;  3QB0 A;  1SV5 A;  1WSJ A;  3CPW M;  3TAE A;  3V9W A;  5J2P A;  1HKC A;  3AV9 A;  2OZM A;  3FZK A;  1MU2 A;  4CBU A;  5AFU A;  4V19 S;  3VTH A;  1QS4 A;  3VQ4 A;  4AHS A;  1VSH A;  1NKE A;  1T6C A;  4DTJ A;  4K8X A;  1CXQ A;  4KI4 A;  2P9K A;  3DLH A;  1GLJ O;  4AF1 A;  5AJ3 K;  2P1J A;  3O8M A;  4ICL A;  4KI6 A;  3T19 A;  2CGL A;  3TAG A;  3DOL A;  3FZH A;  4NLC A;  1WUA A;  1S9G A;  3WNH A;  3DXK A;  4FYD A;  4R5P A;  1J5O A;  3OYC A;  1VQO N;  3MXI A;  4KTQ A;  4BDP A;  1VQ6 N;  1T7P A;  4DUY K;  4NYN A;  3CHW A;  5E84 A;  3OYD A;  2NRV A;  5AQF A;  3TR8 A;  3GOI A;  1EWR A;  2E6L A;  4B1Z A;  1SL1 A;  4ZHR A;  4BG8 A;  3A5M C;  2E6M A;  2O4I A;  2O8F B;  3O6W A;  3M5R A;  4Y1D A;  1WN7 A;  1ZBS A;  1HRH A;  4C23 A;  4FZY A;  3HOS A;  1WAJ A;  1VK0 A;  3ATV A;  1NKB A;  1Q8I A;  4KH6 A;  3SUN A;  3QEW A;  1RT7 A;  1N33 K;  3EL2 A;  3K5N A;  3MWP A;  3M8S A;  2HHV A;  5CYQ A;  3VQ8 A;  3LAN A;  2W6L A;  5FRN A;  3KLH A;  2XY6 A;  4FLT A;  4JAX A;  5AQI A;  2Q97 A;  3AY9 A;  2YKN A;  3PSF A;  4GY2 B;  4CK2 A;  4EZ6 A;  3VF2 A;  4FJN A;  4BR7 A;  3HJF A;  2HMP A;  3AO4 A;  2ZE2 A;  3QDK A;  2D0C A;  4NO7 A;  1NMN A;  1N6Q A;  2NRT A;  4CF0 A;  3MK6 A;  1QVG M;  3O1W A;  3E66 A;  2X6S A;  5EVZ A;  3LWL A;  3LPT A;  4QS9 A;  1KTQ A;  4F4K A;  4E1J A;  1S6Q A;  1M1K O;  2FSN A;  1KFD A;  4DWI A;  4BE0 A;  4AQY K;  3OYG A;  3PX6 A;  2P9P A;  3ULD A;  4Z4G A;  1D5A A;  3TTD A;  3SNN A;  1YTA A;  2P9I A;  1OVY A;  2W6K A;  3VEV A;  3I8B A;  3BUZ B;  3PV8 A;  3FR0 A;  4LF5 K;  4RG8 A;  1X1P A;  4CJF A;  4O0J A;  2IVP A;  3K59 A;  4CJ3 A;  1VSI A;  3NFA A;  3CPE A;  1LW2 A;  3D0P A;  2QK9 A;  4TSX A;  1X3M A;  3CCS N;  4EHU A;  4FK4 A;  3T1Y K;  4W5N A;  1H1V A;  1Z6R A;  4ZTJ A;  4FJI A;  4ID1 A;  2YHB A;  4KKO A;  5AZI A;  3MED A;  2ITM A;  4KO0 A;  2ITG A;  4UQG A;  3F73 A;  4ILH A;  3C95 A;  1QQO A;  4BRK A;  4DR3 K;  3HM8 A;  3LP3 A;  4HHT A;  1VRT A;  3D6R A;  3PIP L;  3CMA N;  3K9J A;  4CI6 A;  5BRH A;  1B92 A;  4BRD A;  3PSI A;  1NOZ A;  1TK5 A;  3J7A P;  3HP6 A;  1VQL N;  4JRQ A;  4JYA K;  2WC9 A;  4FZZ A;  2ZJP L;  1QZ5 A;  3P39 A;  5AQM A;  3L2W A;  4FL9 A;  2ZGY A;  1HJO A;  3CD6 N;  2BTF A;  3SUP A;  1P8Z A;  4OX9 K;  3HM9 A;  3CC2 N;  3QIN A;  4IFE A;  3N4Q A;  2OCE A;  1RTD A;  1BO5 O;  3OS1 A;  2YX6 A;  5EU7 A;  3UKU A;  4FJH A;  2KLA A;  4C8N A;  4BAC A;  4O8U A;  4CHP A;  4IZ9 A;  3Q7B A;  5AZJ B;  4CJS A;  3CCL N;  3MN6 A;  1HQE A;  3VGK A;  1KRP A;  4B9S A;  3DLB A;  3PUF A;  3O9S A;  1Q86 O;  3L4I A;  1JLB A;  5AQU A;  4DQQ A;  3OA9 A;  4BY9 C;  2ZJR L;  3ZSV A;  3KKR A;  3P38 A;  3L8B A;  1S22 A;  4WE1 A;  3U9Z A;  1HUX A;  3D2F A;  3O3H A;  1VAZ A;  2RF2 A;  1IH7 A;  3B8A X;  2Q2R A;  5LJW A;  2W41 A;  4OGC A;  2PYJ A;  4FPA A;  4HCC A;  2G8K A;  1HYZ A;  3SUQ A;  4FLZ A;  3ZEU B;  2Q1N A;  1RDD A;  1A5X A;  3ID6 A;  1WNS A;  1U48 A;  1CXU A;  3QEX A;  4PWD A;  2HW3 A;  3VQD A;  4DTR A;  3C94 A;  4FM2 A;  3LDQ A;  4FWS A;  4O55 A;  4PKH A;  4EFH A;  5HRO A;  1EKE A;  3I8D A;  1S1T A;  3VES A;  3TI0 A;  1NKC A;  1R59 O;  3KD5 E;  2UXC K;  1QSY A;  5FRM A;  2P51 A;  3J8A A;  4X64 K;  1UA0 A;  3MN9 A;  4GMJ B;  1BI4 A;  4B3S K;  4CCH A;  3LDS A;  2UXB K;  1XNQ K;  3Q7C A;  3VEN A;  3H46 O;  3VQ5 A;  4ZTF A;  4MLE A;  5KI6 A;  4WFB L;  3CFP A;  4FJ7 A;  4B9V A;  3NGY A;  4FJJ A;  2Z1J A;  1O1W A;  3ZX0 A;  1S1X A;  2P9K B;  1Z05 A;  1W97 L;  5HL7 L;  1VQ4 N;  1QHT A;  1A5W A;  1RBU A;  4JRP A;  3S9H A;  4DF8 A;  3VQ6 A;  3K0S A;  1BCM A;  5AQY A;  1C0T A;  1RT1 A;  3EN9 A;  2D0O A;  3WXM B;  3VQP A;  4H5W A;  3VMF B;  4KRF A;  2KFN A;  3O08 A;  4RW4 A;  3AAQ A;  2IS3 A;  4GVM A;  1YIT N;  4FJX A;  1U6Z A;  4OLA A;  4J8F A;  1Z26 A;  1NNE A;  3LP0 A;  1ZBH A;  3HI0 A;  1NK6 A;  4B9N A;  3V1R A;  2F4V K;  4I2P A;  1N32 K;  1RIL A;  4RW6 A;  3M3Z A;  1TL1 A;  3RSE A;  4ELV A;  1ZBF A;  3VOV A;  4CK3 A;  1T8E A;  1Q81 O;  3CQ8 A;  3E9O A;  5AQX A;  3T7Z A;  2YNG A;  4CHN A;  3IDH A;  5SZT A;  3E01 A;  5KPR A;  3V81 A;  4JLH A;  5GAE P;  5BRE A;  5M1N A;  2QEX N;  1SQK A;  4KTW A;  4BRP A;  1YVN A;  2AA4 A;  4O4G A;  3TAN A;  4X62 K;  1I94 K;  1WSI A;  3CG7 A;  4CJE A;  3GBT A;  3K57 A;  3CCE N;  4CZK A;  3WXK A;  2YJE A;  5FLX O;  4OJR A;  4DFJ A;  2HOE A;  4JN4 A;  3FZF A;  3MCA B;  4IDH A;  3A2F A;  3HBT A;  4C8K A;  1XQS C;  4JI5 K;  4M3X A;  1UA1 A;  4A2B A;  1RT2 A;  3V9Z A;  4NYF A;  4H0O A;  2H3G X;  3DM2 A;  4BDZ A;  2E8A A;  3AVI A;  2HB5 A;  2VWB A;  2RPI A;  4Z4H A;  1NOY A;  3KD1 E;  3MWT A;  4E7I A;  1SAZ A;  4BRI A;  2Q0U A;  5AQH A;  3J80 O;  4DMN A;  3EY1 A;  3I56 N;  3SQ1 A;  5CHI A;  4AH9 A;  2F9T A;  4H0Y B;  1BA1 A;  3CFO A;  3BP8 A;  3I0S A;  3M8R A;  2P9P B;  4B9Q A;  1UAX A;  4DR1 K;  3LAM A;  1KVA A;  4LF7 K;  1SL2 A;  4NCB A;  4FVM A;  3BF1 A;  1VQ5 N;  4CZG A;  4E89 A;  1EWQ A;  1NGG A;  2FBY A;  3VQB A;  2HHT A;  4BR2 A;  4CZI A;  3VQE A;  4B9L A;  4J2A A;  3OHR A;  2HHQ A;  1VQP N;  4GNI A;  4BGB A;  3AVM A;  3OJU A;  1NGE A;  3OYL A;  3VQ7 A;  3MXM A;  1KQS M;  4DG1 A;  2FF3 B;  2PFU A;  2VGN A;  3E9P A;  1WB9 A;  2ATQ A;  3TAQ A;  1NU0 A;  3NVM A;  4DTX A;  5AZI B;  1QSS A;  4HUF A;  5AQS A;  3VEY A;  3GG4 A;  3U3G A;  2JGU A;  4E1M A;  2NZT A;  5AQL A;  3CI5 A;  1TKD A;  1G15 A;  3HYF A;  1GLE G;  3QBW A;  1LAW A;  3AA4 A;  4CD1 A;  1S6P A;  4DV6 K;  1LWF A;  3NF6 A;  2IVN A;  3AVC A;  5IWA K;  5FDL A;  3A5O C;  3DOK A;  3HTV A;  3O4Q A;  4LH5 A;  4B1X B;  4DTP A;  1K8A O;  2D1K A;  1RT4 A;  1RCH A;  3LP1 A;  4JHD A;  3G4S N;  2HBL A;  1U04 A;  5BPN A;  5GIP A;  2EX3 A;  3CME N;  4J2E A;  4BRA A;  2UXD K;  3KVG A;  4CHY A;  1WBD A;  3U4L A;  4FW2 A;  1HQU A;  2RE2 A;  5CE3 A;  4CJW A;  3AVK A;  1FXX A;  3L0Q A;  4RW9 A;  3KWI A;  4JI1 K;  3QFU A;  5B8H A;  5TKY A;  3VEX A;  4Y0W A;  5M1O A;  1JKH A;  5TKW A;  5JLH A;  3RMB A;  1QSL A;  4XH5 A;  2YHX A;  2JWL A;  4BC2 A;  3OYB A;  1VQK N;  2XY8 A;  3C0B A;  3IFR A;  2P9S A;  4GKJ K;  4YY3 K;  2F9W A;  5GAD P;  2KHO A;  4F9O A;  3JS6 A;  3D2F B;  5CR4 A;  4MDA A;  3SQ2 A;  4O0I A;  5JS2 A;  3QO9 A;  1S3X A;  1UOC A;  3V9S A;  1MDU B;  5FPM A;  5EY4 A;  1KSP A;  1NLV A;  3ISN C;  2P5O A;  3M1F A;  1TVR A;  3LAK A;  1C1C A;  2X6N A;  4PY5 A;  3ZSY A;  4B1W B;  4H8K A;  3SK3 A;  3VA0 A;  3QML A;  2EHG A;  2VG6 A;  1BIZ A;  3DRS A;  4KPY A;  1C0F A;  4FK2 A;  5M1F A;  3VF6 A;  4DV3 K;  1BI4 B;  4DHY A;  1OH7 A;  3I33 A;  4IEI A;  4ISE A;  3H1Q A;  1RBS A;  2E1Y A;  3PX4 A;  4CZL A;  1J54 A;  3ULE A;  2E2Q A;  3C65 A;  3VGL A;  4Q0B A;  3O9Q A;  2WOM A;  4JK8 A;  1NBW A;  2YNH A;  1NJY A;  4M3Y A;  4N47 A;  3QIC A;  3NAE A;  2QW9 A;  3T1H K;  1K9M O;  1RBR A;  1RNH A;  2B4J A;  4X65 K;  5HRN A;  4CJK A;  1NK8 A;  5SWM A;  2VWJ A;  3MX5 A;  4LF9 K;  3LM2 A;  1XMQ K;  1Q9X A;  4DQR A;  4CER A;  2G8I A;  1OH8 A;  1JLF A;  2D0B A;  3MEC A;  4CJR A;  1BWF O;  4AM6 A;  5C24 A;  4BC4 A;  4YDU C;  5JMV A;  2HHW A;  1RT3 A;  3G25 A;  4HWI A;  4CJP A;  4CGG A;  3CFR A;  2A3Z A;  4Z4I A;  3WXL A;  3OYN A;  1UWB A;  3VET A;  3RSE B;  2HHS A;  4YOX A;  4E7J A;  1TV6 A;  3VTI A;  4EP5 A;  5M1Q A;  3TSP A;  4JKE A;  3V6D A;  1ATN A;  3FFI A;  1QHA A;  3O80 A;  1X9W A;  4W5T A;  3F5T A;  1JCE A;  3ZYY X;  3IRX A;  3WXJ A;  2F96 A;  1YT3 A;  4B9U A;  3CXC M;  1NJX A;  3PY8 A;  5HP1 A;  2A42 A;  1ZBL A;  4CF9 A;  1YTU A;  2E2P A;  3HK2 A;  4FVU A;  1L5U A;  4H0V B;  1LOT B;  2QTD A;  1N36 K;  2HVI A;  2QWM A;  1Q82 O;  4KHY A;  4FZX C;  4FXD A;  3EYZ A;  4C1N K;  1HX1 A;  1KXP A;  4ELU A;  1TAU A;  5J2N A;  4DU3 A;  4QS8 A;  3EO3 A;  1OKJ A;  4F2R A;  2CH6 A;  3MAQ A;  2KZZ A;  3CJ1 A;  3DLG A;  2Q36 A;  3CCJ N;  1N8R O;  2Q0R A;  2FSJ A;  3H3O B;  4ILJ A;  4DV2 K;  3VEW A;  3QES A;  4DTU A;  1TUY A;  3G71 N;  2HVH A;  2Z1G A;  4DFP A;  2GUP A;  4IKF A;  1Q9Y A;  2KFZ A;  3K58 A;  1KCF A;  1XHZ A;  3ALY A;  3C7N A;  3D2E A;  3KK7 A;  4DR2 K;  2Y1I A;  5CYM A;  2XRI A;  4HUE A;  4YOY A;  3DJC A;  3OBW A;  3MXJ A;  3PO5 A;  2VWK A;  1VSE A;  4BRC A;  1K73 O;  1QTM A;  1J5E K;  1QVF M;  2YNF A;  4M3R A;  4HCB A;  2F8S A;  2O8B A;  3IG1 A;  1D9D A;  2P9N A;  3CQY A;  5E26 A;  1F21 A;  3ZET B;  5BN8 A;  4M3Z A;  1YAG A;  3WEE A;  1ATS A;  2G8U A;  4OKJ A;  4JHD B;  4BR4 A;  2YI1 A;  1CZ9 A;  5GIN A;  1BL3 A;  5KRT A;  2O4G A;  4WFN L;  4IOC L;  1KLN A;  1A5V A;  1WSH A;  1GLC G;  4CBX A;  1BG3 A;  3P1G A;  4UY8 O;  2KQ2 A;  4CE9 A;  4JI8 K;  3L3U A;  1IKV A;  2QKB A; 
#chains in the Genus database with same CATH homology
 5AJ3 K;  4YHH K;  2UXC K;  3J80 O;  4JI7 K;  4JI4 K;  3J81 O;  4DUZ K;  4DR5 K;  4NXM K;  3T1Y K;  4X64 K;  4K0K K;  3J7Y P;  5LMU K;  4DR1 K;  4JI3 K;  4B3S K;  1N36 K;  2UXB K;  1XNQ K;  4LF7 K;  1HR0 K;  4LFC K;  4LF6 K;  1IBK K;  1IBL K;  2E5L K;  4DUY K;  2UUB K;  2UUC K;  2HHH K;  1HNX K;  4DR3 K;  4DR6 K;  1XNR K;  3OTO K;  1XMO K;  4LFB K;  4DV3 K;  3J7A P;  4JI2 K;  4LF8 K;  4LF4 K;  4DV2 K;  4DV7 K;  2UUA K;  5IT9 O;  2VQF K;  4JYA K;  1FJG K;  2UU9 K;  4DV5 K;  4LFA K;  1N33 K;  4CVN E;  4NXN K;  4DV6 K;  4DV0 K;  4JI0 K;  2F4V K;  4OX9 K;  1N32 K;  2VQE K;  5IWA K;  4JV5 K;  4DR2 K;  1N34 K;  2ZM6 K;  3T1H K;  4X65 K;  4LF9 K;  1XMQ K;  1J5E K;  1IBM K;  5LL6 Z;  1HNW K;  4X62 K;  1I94 K;  2UXD K;  4B3R K;  4KHP K;  5FLX O;  5A2Q O;  4DR7 K;  5BR8 K;  4DR4 K;  4JI1 K;  3JAM O;  4JI5 K;  4GKK K;  4AQY K;  4V19 S;  4X66 K;  4JI6 K;  4CW7 B;  4DV4 K;  1HNZ K;  4B3M K;  5LMN K;  4LF5 K;  4GKJ K;  4YY3 K;  4B3T K;  4DV1 K;  4JI8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...