4DUZK

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4duzK00
4LF9K 4LFAK 2E5LK 3T1HK 4OX9K 4B3RK 3J7YP 4X65K 1N34K 4JI2K 4B3SK 4DUZK 5IT9O 1XMOK 4DV7K 1N33K 4YY3K 4V19S 1IBMK 5LMUK 3J81O 4DV3K 2UXCK 3JAMO 1XMQK 2HHHK 4LF8K 4B3MK 1XNRK 2ZM6K 4AQYK 4CW7B 4X64K 2VQEK 4K0KK 4NXNK 4DV0K 2UUBK 4LFCK 3J80O 5FLXO 4JI7K 4DR6K 4DV4K 4YHHK 5IWAK 3T1YK 2F4VK 3OTOK 1HNXK 5LL6Z 1IBLK 4JV5K 4KHPK 2VQFK 4DR1K 1I94K 4DV2K 4DR7K 4LF6K 2UXDK 5A2QO 4LF5K 4GKJK 4X66K 1IBKK 4DV6K 1HNWK 3J7AP 4LFBK 5AJ3K 4JI3K 1HNZK 4JYAK 4JI1K 1N32K 4JI4K 4NXMK 4B3TK 4LF7K 4DR5K 2UU9K 4JI0K 2UUCK 4JI5K 4LF4K 4CVNE 4JI8K 1FJGK 4DR4K 4DUYK 5LMNK 5BR8K 4DV5K 4X62K 1J5EK 4DV1K 1XNQK 4DR2K 4DR3K 4GKKK 2UUAK 1N36K 2UXBK 4JI6K 1HR0K
chains in the Genus database with same CATH superfamily
2AP1A 1NGFA 3I55N 1NOZA 2EX3A 5ADXH 2P5OA 4DSLA 2QXLA 3TSQA 5DMRA 5M1KA 2X74A 1ZBIA 2KZZA 4E19A 5AZJA 3ZEUB 3QEVA 1RDDA 1YHQN 2FXUA 4CERA 4M63C 4CZGA 1NKCA 4BRCA 2IIRA 5HBMA 3T7ZA 4OLAA 1NJXA 2P9PB 3ZSOA 1NOYA 4JK8A 4EIAA 4IJNA 3ULEB 4B1WB 1XI1A 3OYFA 4CHQA 3TAQA 1F21A 1NGCA 4WE1A 1BIUA 5JS1A 4FJNA 3NGYA 3FE1A 3FLCO 3VF6A 2V7ZA 2H3GX 1YVNA 3P31A 3KWIA 2ZWHA 3HT3A 4AILC 1SKSA 1E4FT 5ELZA 4KHPK 4IKFA 2LSNA 3H46O 1KD1O 3THWB 3PLAA 4RTFD 3CFPA 4E1MA 1KAXA 3LP0A 3SBTA 3HM9A 2AA4A 4B1VA 1HNZK 1RCHA 2IGIA 1VRTA 3AA3A 1BCOA 3K9KA 4JYAK 3KLIA 4DTOA 1N32K 4QAGA 2QM1A 1NGJA 1W2BM 3C6AA 4C1NI 3U3YA 3ZYYX 4EP4A 1KCFA 3QBWA 4DTPA 1C0FA 1TL1A 4WF9L 1KXPA 4DF8A 4CZIA 3KIOA 2DFHA 1WLJA 3ZT4A 1U6ZA 2HB5A 5AFUH 4FZXC 5FPDA 3HOTA 4HHTA 3MCPA 4LY7A 1OH6A 3BY5A 3LP2A 1NGEA 3NH2A 3C7NB 4CFDA 3OYDA 1MWMA 3O4NA 4B1YB 3KHYA 3MN6A 3JSMA 4KBOA 2KZMA 1T44A 4M41A 2HNYA 1SL0A 2FSJA 3NH1A 2GWJA 1YTUA 2GUIA 1S1VA 1RBTA 3TWHA 3ZT3A 4BDZA 3TR8A 4M3XA 4F9OA 2O4IA 5KGWA 1HKBA 1OH7A 4DSEA 5LMUK 4K41A 3K58A 2BANA 5JS2A 1TKDA 4CF2A 3BP8A 4BVPA 4CEAA 3AO3A 3U9DA 1T05A 2HBJA 4Z4CA 4OPHA 2ZM6K 4QS7A 5AQSA 2HHVA 3SAFA 1S72N 4DFPA 2E20A 2P1JA 5FPMA 1VQ6N 3H3NO 3MEDA 4FLUA 3VQQA 3AVMA 2YHXA 1E4GT 4AHRA 5FLXO 1XHXA 2E88A 3SZ2A 3BF3A 4O5FA 3ZETB 3THYB 3HSCA 3L6QA 2AJQA 4AM7A 5LL6Z 4CFBA 1XUPO 1B9DA 4OPAA 3ZT0A 4DS5A 2D0BA 2CH5A 1NMDA 4BC5A 4JKHA 5A2QO 3DLRA 1NK6A 1JKHA 3BDPA 4QS8A 1GLEG 4DKWA 3KVGA 3IRXA 1RBUA 4A2AA 3THVA 2WBNA 3J8AA 1QVFM 4CHYA 2YNGA 4C8OA 4FWPA 1VAZA 4NO7A 4CE9A 3CYMA 3IDHA 1P8ZA 4M42A 3ZT1A 3ID6A 1IG8A 3OJSA 1S1XA 3AVLA 3KTQA 3AY9A 2QKBA 1GLLO 3QEPA 2FSKA 3VTIA 5J1EA 4DSIA 5AQRA 3C6UA 4CJUA 3LZJA 2W42A 4BG8A 2IVPA 4M3TA 4DV1K 1S1UA 1IKWA 2HSTA 4M7XA 2Z1JA 5CZ2A 3DJCA 4A5BA 4JK9A 4LSNA 3NGZA 1XHZA 4CK2A 3VQAA 3EE8A 5H1SQ 5C42A 1LWCA 4DHYA 3I0SA 2QWPA 1K73O 1JXBA 4CD3A 3CF5L 3P38A 3OJUA 4M3UA 4GVMA 5BRHA 1FKOA 1TKXA 3N4PA 3NF6A 5GIPA 3AVCA 3QICA 5FDLA 4CW7B 3A5OC 1NM1A 4CGDA 3G4SN 3MXMA 1NK7A 2KHOA 3S9HA 1RDUA 1RDCA 5KPZA 1U49A 1SV5A 2DPNA 1ASWA 1ITGA 4NLBA 1Q86O 1HKGA 3AVAA 4JV5K 4E89A 3MMVA 3E9OA 2I7PA 3GDQA 2Z1HA 2PBDA 3VQCA 4IEEA 1JXEA 3L2UA 3DLHA 1BL3A 4N5SA 2CGKA 2Z1GA 4JI3K 2KKZA 3KJVA 2IC3A 4FM1A 3RR8A 4FK4A 2GX9A 1CXQA 2A6AA 4IOXA 2YKNA 4OKKA 5KI6A 3NH0A 2E2NA 1KC8O 2E2QA 4BY9C 3O4QA 1D4XA 4JD2B 4CK3A 3C6HA 1Q7YO 5AQFA 4NCGA 1XQSC 3O8MA 3SMSA 2F9TA 3KLHA 4KHWA 4JI5K 2E2PA 1TK0A 1RGIA 5C10A 3KWGA 2QWRA 5KRTA 3VGKA 3QESA 1YUWA 2GTDA 2W6KA 3O9RA 3QFUA 3DM2A 4IWVA 4DU3A 1K9MO 1D9DA 5AZIB 3SMPA 4Q0BA 1LAVA 5J2NA 3FZMA 1WSFA 1BISA 3NGIA 4EHTA 3THWA 1BA1A 4JI2K 2FBXA 4FJGA 1MU2A 2XHBA 4DTJA 4B08A 4DSFA 2OCEA 5AQWA 2W6LA 4QOZB 2HNDA 1YF5L 3H45C 1JLGA 4Z4IA 4CK1A 4MDAA 4CJEA 2GBZA 1QVGM 1IKXA 5ADXA 3EY1A 1RBSA 1U48A 1V4TA 3D2EB 2ZGZA 2HHQA 2O4GA 3MX5A 3NF8A 2ZF5O 4Y0WA 3QO9A 4RW7A 3QB0A 3OY9A 2D5RA 3C7NA 3PX6A 3T1YK 4FJIA 2ZJQL 3MEGA 4IXCA 4JS4A 4E7KA 3OTOK 4KTWA 2X6NA 3FFKB 3NFAA 4JKDA 2BDPA 1SKRA 1A5WA 2VQFK 1Z6RA 1LOTB 4MLHA 4DR7K 3DRPA 4JHDA 3B6OA 1FKPA 1TYQA 2G8WA 4CEFA 3HYFA 3OYGA 4JHDB 1TUUA 3VEYA 3DWLA 1Q9XA 4HTLA 4CD1A 4YOTA 3L2WA 1XC3A 2VWKA 3V1RA 2BH1A 2NRVA 3L4IA 2QWLA 3KKRA 4YOYA 3O9QA 3AVJA 1X9JA 3JS6A 1X3MA 2XY8A 2G8KA 1JL2A 5AQIA 1WN7A 5AZJB 2FC0A 3VN5A 4AF1A 3SV3A 1VK0A 3TPQA 3DMJA 3HP6A 3SUPA 1BU6O 2F7TA 3SJHA 1TK8A 5CYMA 3KD1E 2WFBA 3SAHA 2QTDA 3MN9A 1VSJA 4JKBA 3G6EN 1W0HA 3DXKA 4IEIA 4H0PA 1T3VA 1WSHA 1TL3A 2YNHA 3GE1A 1YJWN 4E7JA 4DFMA 4GV9A 2HVHA 3TTFA 2DY4A 3P39A 2G8VA 1DT9A 3MAQA 2YJFA 4B3RK 1C0UA 4CEDA 3GBTA 1X9MA 3KKSA 5AQYA 4LH5A 5E84A 3OYAA 1S3XA 1GOBA 4DV7K 1B9FA 5B8HA 3TANA 1VHXA 3CG7A 3JYTA 4EZ6A 1Y64A 4C23A 3R1XA 1SS6A 4JRPA 3O08A 4BRGA 4BR0A 1Z05A 4LF8K 3VEVA 3SLCA 4HVJA 1OVQA 4CZKA 1L5UA 3PX4A 4B8AB 3VGLA 4ICLA 1ZBFA 2XY5A 2QWNA 3P83D 4CGFA 3IMXA 2CGLA 1ZBLA 4DR6K 3A5MC 5C15A 3VEWA 3O1WA 1RDWX 5BN9A 4CZEA 1RTHA 2RE2A 4RW4A 1Z25A 1L3VA 4Z94A 1S6PA 4U7BA 4W5NA 4LH4A 1JCEA 2DFFA 4DV2K 3QDKA 4J2BA 3K5OA 2QWQA 4G9ZA 5AQMA 1NJYA 3HSTB 3PX0A 2FSNA 3RMDA 3T19A 5EOYA 4HWIA 1BCMA 4HUGA 2YNFA 4BRAA 1O1WA 1S1WA 2YV0X 4ILJA 4TSXA 3SCXA 1ZYQA 5AQUA 3CHWA 4CF9A 5EVZA 2XY7A 2F8SA 3OW2M 2PYJA 1C0MA 4JNEA 2V7YA 1VQNN 3NF7A 1RBRA 2Q2RA 5AQVA 1S1TA 4GMJB 3NE6A 1S22A 4DCHA 1M90O 4OLBA 5CZ1A 3A5LC 4N56A 2NZTA 3ATVA 2NRHA 1DLOA 3CJ1A 4ELUA 4CEQA 4JKGA 1U04A 4C8MA 3M8SA 4FZZA 1G15A 3K0SA 3LZIA 5D3GA 4F3TA 3MWPA 4JKGB 4W5OA 1RTJA 4GY2B 3AVKA 4BC2A 1YIJN 4KH6A 1QE1A 3CCVN 3CCMN 3M1FA 1RT4A 3OHRA 1WUAA 5JLHA 3PO5A 1O13A 4DQRA 2YNIA 3CXCM 2IAJA 4O8UA 2P9SB 2O8FB 2OPRA 5EX5A 4KI4A 4CJPA 3ZSWA 3DI6A 3O9UA 1NGIA 4BREA 4FOEA 2HBMA 4N76A 3E9LA 2E8AA 3H6EA 3RRHA 1XMQK 3SPZA 3AA4A 1NKEA 4FVUA 2P51A 5GAHP 3CCLN 1GLCG 4FW2A 3CERA 3FZHA 4DG1A 1XNRK 4CHNA 4DTUA 1NG9A 3OYJA 4K0KK 5KRSA 2YHWA 3SQ1A 2VYPA 2UUBK 3B6PA 3HVTA 3VQ7A 3LP1A 1MDUB 4JI7K 2P9UA 3CM6A 4CF1A 2P9LB 4DV4K 1SL2A 3UB5A 4XEIA 4PY5A 3QMLA 5I9EB 2IVNA 3MCAB 1HX1A 2NRTA 4Z4HA 4FXDA 1T8EA 4Z4GA 3L4QA 1D9FA 4W5QA 3CC7N 5C0YA 2HF3A 2XO7A 4GKJK 1TUYA 3V9UA 1HNWK 3OBYA 4KH4A 1KTQA 1IKVA 4JI1K 3AO5A 3LAKA 3ZETA 3THYA 3WXKA 3U6FA 3EE9A 2J4RA 1S6QA 5CR4A 3OYBA 3RMAA 1L3TA 4DSKA 1EO1A 3IKMA 3HVRA 3CJBA 1OH5A 3NVKA 3I8BA 1T6CA 5AQPA 2VGMA 3K2PA 1KLNA 1UA1A 4F3OA 2A1SA 4DU1A 4AHVA 1W97L 1C1CA 4YDUA 3I8DA 1QQNA 5BRDA 3AAPA 1NJWA 2OTLN 1YAGA 1NK9A 3R9PA 2I7NA 1VQ4N 3K59A 2I5JA 3OA9A 1NGAA 4WFNL 4WQ5C 4CJTA 1U47A 5BPNA 2Q97A 3RSEA 4DTSA 3G0ZA 1NGBA 3FFIA 3CCUN 4R5PA 3CC4N 3VF4A 2HMIA 3LP3A 1XMOK 3C94A 2OZSA 4F2SA 4DWIA 4FVMA 3SUQA 5T7BA 2IOCA 5HRSA 2HHWA 2HMPA 3WXMB 4O8KA 3CQXA 4YOXA 4ID1A 4JKAA 2HBKA 3GL1A 3I0RA 4MDBA 1C1BA 4KO0A 4CEOA 4FWRA 2WTUA 2ZJPL 3FR0A 2Z1IA 3BF1A 4NXNK 5BPLA 4CJLA 1DTTA 3CCJN 4PKGA 3H3OB 1N6QA 4KV8A 3K5MA 2PFUA 3RTVA 4YOVA 4ZTFA 1K8AO 3AV9A 3D7EO 1QQMA 3CJAA 3HPGA 1ZBHA 2NUBA 1TK5A 3CCSN 4JAXA 4H5VA 4BE0A 5AQXA 3LM2A 4X66K 1VSEA 3WEEA 3MN5A 2HW3A 4XIUA 4F2RA 4GV6A 4AHUA 1IG9A 1VQKN 4BRLA 2QK9A 3L3UA 1KQSM 3G10A 2ZD1A 3OYLA 4H5RA 1A5VA 3FZLA 1SL1A 3VQ8A 3TTDA 3EL2A 3Q7CA 1GLBG 2NRZA 1EP4A 3U8XA 4B9QA 3S3MA 4AH9A 4DQPA 4E0DA 3WXLA 4R79A 4M45A 2HOEA 4CVNE 4H4OA 4Z0UA 1NK8A 3LWMA 1J9AA 2A1RA 3ULDA 2D0OA 5AZIA 5BR8K 3D0PA 4C1NK 3CJ7A 4DTXA 1Q82O 4OKJA 4KFBA 3RWUA 1J5EK 1XNQK 1HUXA 5M1NA 4GKKK 4PL8A 2DFEA 3A2FA 3UKRB 4IDKA 3HPOA 4OVLA 4CZFA 1JL1A 1X3NA 3OS1A 3AA2A 2YCHA 3N4QA 1YVUA 3VERA 1FW6A 1HYSA 4RW8A 1J53A 1UOCA 3KD5E 3M8RA 1KVBA 4B9UA 4FLWA 4AHSA 1QHTA 5LY3A 2UXCK 4IOCL 4GV3A 1WB9A 4BRMA 1LW0A 1T03A 4QCLA 1QHAA 4IZ9A 3ASMA 4YNQA 3S3NA 3V1OA 2OPSA 4DV0K 5BPMA 5BN8A 4B9MA 2ETJA 4CGGA 1HMVA 3DLKA 4ISEA 1VQ5N 1A5XA 3CETA 4YHHK 3HI0A 1YJNN 1NK5A 3W3DA 5CY4A 1HNXK 4DFKA 2OANA 4DR1K 1GOCA 5C2DA 3QEIA 4XH4A 4NCAA 1BIZA 4E1NA 3A0IX 3KK3A 3AVBA 3CJ9A 3UIQA 4IFEA 4W5RA 4LFBK 3LPTA 3OYMA 3QNNA 3P1GA 2QWOA 3AA5X 3LDOA 1VSMA 1KAZA 3C95A 3LDNA 1HNIA 2RF2A 4FJ7A 3SUNA 5FRMA 3BGRA 4JI0K 3AVFA 3H1VX 3F9MA 3OBWA 1MA9B 1S9EA 3KLEA 3DLGA 3TAEA 4H5NA 4QS9A 1H1VA 4HCBA 3FGUA 2WUSA 1VSDA 3PSIA 3CJCA 4LC9B 3IS9A 1U2VA 4BVOA 2YJEA 4Q5VA 2P9IB 5GINA 3E9PA 3I56N 1YITN 5EU7A 2UXBK 1N36K 3V9WA 3L2QA 2ASOA 4LFAK 2E5LK 3VEOA 3VEXA 1EXQA 4KH5A 3F2KA 1QZ6A 2RN2A 4CGJA 3U9ZA 4DQSA 4IFYA 3VEZA 2PAVA 1D8YA 1BI4A 1WBBA 2OPQA 3B8AX 3C0BA 3K57A 3L3VA 3ZX3A 3GOIA 2G8UA 4B3MK 4DMNA 4PKHA 4H0XB 5JMVA 2BE2A 3WNHA 1CXUA 3ATUA 3QBXA 1X1PA 5KQ8A 4CFAA 1GLJO 4LFCK 3ZX2A 3SQ0A 1NNEA 4K43A 3NMUA 1FXXA 2P9KB 3VQ9A 5KQDA 4E7LA 3SBGA 1HPMA 4FJ5A 5LJVA 4O55A 2E1YA 1IBLK 2E1ZA 4FLVA 3C65A 5I3UA 1NU0A 2EWSA 3PSFA 1EWQA 4IBNA 2E6LA 4JLHA 2DTUA 4EFHA 2UXDK 2O8DA 4DQQA 4FO0A 4KHUA 4ISFA 1NJIO 2FF3B 1IJJA 1REVA 4BRHA 3R8EA 3O4WA 4I6MA 4B3TK 3QETA 1KSPA 2UU9K 4DU4A 2Q0UA 4BR2A 5CE3A 1WSGA 4FPAA 3G25A 5DM6L 3QERA 2VCPA 4RW9A 3ULEA 2D4WA 1K8KB 3ITHA 3EEQA 2YHBA 4H0VB 3TAMA 2BUPA 3AVIA 4DV5K 4FWMA 5LJWA 2WC9A 3OYKA 4H4MA 4X62K 1Q9YA 3HTVA 1RILA 3T69A 2Q1NA 1J54A 2UUAK 3ENHA 1HR0K 2WOMA 4IDHA 3VPZA 3FZKA 4OX9K 3O3HA 3VETA 1YTAA 3H08A 1BQMA 2EHGA 4MLEA 3LANA 4N47A 1WOQA 2VWBA 4AHTA 1N33K 2HHUA 1CZAN 4XH1A 2V52B 1HQEA 4IJAA 4OGCA 1OH8A 3A5NC 4BRPA 4WFAL 1C6VA 2HHHK 1C0TA 5DM7L 2KQ2A 2QI2A 5BREA 1EQYA 3D45A 1KVCA 2E4LA 5EY4A 3HXMA 1TV6A 5AQOA 4RG8A 3T3FA 3WUHA 1D5AA 4GW6A 4KTZA 3TSPA 1I3AA 5M1OA 3MXIA 3OS0A 3HL8A 3M8QA 4JRQA 2B5JA 4EP5A 4L8RB 3C6TA 5HRPA 2Y1JA 2F9WA 4B9LA 2G8HA 3VF2A 1UA0A 4A57A 3EKSA 3VOVA 4KB0A 2UYTA 5TKYA 2WONA 3AGKA 3AVNA 3O9SA 3WNGA 2KW4A 2IVOA 4CFCA 2O8CA 4BR4A 3DRSA 4OPJA 4B3OA 4ILGB 1HKCA 2P9NB 2P9LA 2QW9A 1P90A 1TVRA 1SQKA 4HUFA 1WAJA 1K6YA 4CF8A 5GADP 4O4GA 3D2EA 3HBTA 3HO1A 5C25A 4JKCA 5HRRA 5CYQA 3CCQN 2ZGYA 3KLGA 4JEPA 4CEZA 1DKGD 3WT0A 1WBDA 4LF4K 2D1KA 4DR4K 4B1ZA 3RMBA 3MECA 4WQ4A 1R0AA 2O8BA 4BE2A 1ASUA 1WSIA 2P9NA 4B9TA 1M1KO 4IOAL 3EN9A 4O44A 2KTQA 4CBWA 3TU5A 2O8CB 5E41A 4H5WA 2XY6A 3ALYA 3CM5A 1KFDA 3HRGA 3NAEA 3SQ4A 4EZ9A 4CIGA 4KREA 2HBLA 4ILHA 4HTUA 3UE5A 1VRUA 3QEWA 1RTIA 3QINA 4EHUA 3WXIA 4YY3K 4FWNA 1YJ9N 3S3OA 3O5BA 1KFSA 2YI1A 4K25A 1HLUA 4DV3K 4FJKA 1G99A 1RDAA 3ZSZA 4DS4A 2ZE2A 4E1JA 4FJ9A 3WNEA 4FPBA 5F0XA 4AQYK 4BR7A 3AVGA 1LV5A 4IO8A 3Q7BA 1IO2A 3EYZA 4A61A 4CJQA 2P9PA 4RWTA 3K5NA 2Q0RA 4BGBA 5M1FA 1S5JA 4HUEA 1RT6A 5EXWA 4DLGA 3CQ8A 2PYLA 5FROA 4Z4FA 2VGNA 4I2QA 3F73A 4OKEA 3KZBA 2B6AA 3KLFA 1HPZA 3A8YA 3CI5A 1SKWA 4DSJA 1J6ZA 5E26A 4LF5K 5M1PA 4GNIA 4DV6K 1BGXT 4BRFA 3M8PA 3TABA 1GOAA 4DFJA 3U3GA 1NK0A 3J7ZO 1OKJA 4FK2A 3OYEA 4KPYA 3WXJA 4BRNA 1TGOA 4RCHA 1GLAG 3HP9A 4DR5K 3GG4A 1RFQA 4W5TA 1VSKA 5HRNA 1ZC6A 1ZBSA 3EZ5A 4KKOA 2G8IA 1I39A 3QFPA 4JI8K 2PZSA 4WFBL 1VSFA 4J2AA 4DUYK 3CPEA 4OO1J 4B1XB 4J8FA 3K5LA 1W9HA 4CEBA 3OYHA 4F8RA 3AGRA 4FL9A 4DR2K 4DR3K 5AQJA 4FWLA 1T6DA 4CJ5A 3NDKA 3NHGA 1KAYA 1SAZA 1N34K 3QLHA 1RT1A 1BHLA 2QWMA 3O3GA 1ATNA 4FM0A 3V4IA 4MO5A 3O3FA 3AARA 2RKIA 1HYVA 4BWJA 3O9TA 3TSUA 3V81A 1JLQA 1B92A 4XH5A 2A42A 2HHTA 4WQ4C 1RDBA 1E3MA 5HL7L 3ID8A 4O0JA 3MEEA 4OGEA 5KGXA 1VSHA 5JLFA 4H03B 4GVEA 3SV4A 5BR9A 5GIOA 1JLCA 3BZKA 4AM6A 5KTQA 2F4VK 2OYQA 4Z4EA 3W0LA 1HJRA 4KHNA 1GLFO 1NMNA 5AR0A 4CJ4A 4M3RA 1QSSA 3VQ6A 4FLZA 1I94K 3SJJA 2HHXA 1NBWA 4KHQA 3CQYA 4B8CA 4CJVA 4BDPA 4U67L 3K9JA 3VQEA 3LL3A 1IBKK 4CZJA 1NKBA 4FLTA 4BRKA 4DQ8A 5AQLA 1RTDA 3RR7A 5FRNA 4A5AA 4PA1A 3TAGA 4KB1A 4CZMA 3CIPA 2F96A 3NVMA 4ELTA 3KK1A 2VG6A 5AQZA 1VQLN 1BA0A 3NBPA 2Q31A 1LWEA 4BRIA 4KHYA 1FJGK 1EETA 3OYNA 3ENOA 2HNZA 4JD2A 4A59A 1GLDG 2JWKA 3VTHA 4K8ZA 1QS4A 4K42A 2D0PA 2GV9A 5JVGL 2P9UB 2Y1IA 1JCFA 3VMFB 2VG7A 1V4SA 4BC3A 1T7PA 1IKYA 3D6RA 1IH7A 3R6MA 4JI6K 3WNFA 4OJRA 2ASPA 4LF9K 1VSLA 1RT3A 1QSYA 4FWQA 4M3YA 4NYNA 3BZCA 5JICA 3OVNA 4ZTJA 4JS5A 2G8FA 3BEXA 5IT9O 1KRPA 3RSEB 4B1UB 4O0IA 1OVYA 3SNNA 3DXKB 1TAUA 2FBYA 4B9NA 4NB4A 3J81O 4CBXA 3VQDA 4WQ5A 2P9SA 2O8FA 4FWKA 3O1BA 3MXJA 3AAQA 2A40A 3TARA 3M6GA 3SAGA 5FPEA 1QSLA 3J80O 3M5RA 3IUCA 3NCIA 1N5YA 3ZSRA 2NRRA 4MQ3A 4BACA 4FLXA 1JCGA 1FK9A 4J2EA 2V51B 1EWRA 4ID5A 3MX2A 1U4BA 1CLQA 4H8KA 4PKIA 4PHTX 1HJOA 1LW2A 2A41A 3CMEN 2ITGA 5AQTA 3QIPA 4CJ3A 4I7FA 4NYFA 5JVHL 1TAQA 4UQGA 3TAFA 4FJMA 2P9KA 1NWKA 2D0AA 4CZLA 2QA4N 4JI4K 4BRQA 2NNWA 4G1QA 3E66A 3LDQA 3P4IA 3THXA 1QTMA 3D2FB 3MDQA 3F9KA 4BWMA 1DGKN 4DF4A 5BRFA 1VQMN 2OTJN 3SUOA 5GAEP 3OYCA 1YXQA 4KHSA 3T1AA 3ZLJA 3L0QA 4KI6A 4NLCA 5J2MA 3PIOL 5LMNK 2Q3SA 3CFRA 4PUOA 4EAHD 1ZBUA 4F4KA 2FBTA 2GELA 1CZBA 3V6DA 2ASMA 2E2OA 1VQ7N 1JLAA 1Q81O 3CPWM 1EX4A 3SPYA 4CGHA 2B4JA 4M3WA 1NGDA 1QZ5A 5AQNA 1RNHA 3M3ZA 4B3SK 4M3ZA 2HVIA 1BOTO 5I42A 5C2FA 2ZJRL 5C12A 4M7YA 3KK2A 1WSJA 4FK0A 4C8KA 1NLVA 4CJFA 5AQGA 4H5TA 3FZFA 1HQUA 4E7HA 5DK5A 4CJSA 4BG9A 2QEXN 1J5OA 1BQNA 1Q8IA 1VSIA 4CJWA 3AO4A 1UAXA 3E01A 3KK7A 4X64K 2FLOA 4BROA 5AFUA 4YFUA 3OS2A 4B9SA 4CHPA 2W41A 1N8RO 3HM8A 4YOUA 4LSLA 3U4LA 1ASVA 1L3SA 5HP1A 4BRDA 4ELVA 4IG3A 3WQTA 4JKFA 2FBVA 3VA0A 3V9SA 1U2VB 4CZHA 4JN4A 2Q36A 2FF6A 4KRFA 4RW6A 3S41A 4DB3A 1K8KA 4CJKA 1ATRA 3HJFA 4LF6K 2KFNA 4FJ8A 4FZYA 3SI6A 4OPKA 5J2PA 5AJ3K 2OZMA 1TKZA 3VQBA 4MO4A 4I9QA 3AO1A 3ZSQA 5HLFA 2A3ZA 4I6MB 1C0GA 1BI4B 3PY8A 4NXMK 1MWKA 4A62A 1VQPN 1YI2N 2ATQA 3WEEB 1IV0A 3CCRN 4FJLA 5HOOA 1LCUA 4FOIA 4DTMA 4FJXA 3ZSVA 5F2RA 1XC9A 4YOWA 2KLAA 2QXFA 1JJ2M 4CJ7A 3CCEN 2CH6A 2BTFA 4CGIA 3UKRA 2JWLA 5J2QA 4BE1A 1C1AA 1RT7A 3LDSA 3QNOA 2D0CA 3AO2A 3LWLA 4FWSA 4LD0A 4CHZA 3CD6N 4E3SA 4BQLA 3H1QA 4FJJA 4H0OA 4CHOA 3DXMB 1DEJA 4Y1DA 3DOKA 3LPUA 4IFVA 3ZEUA 3ZX0A 3DLBA 2GWKA 3T1HK 4Y1CA 4X65K 4K8XA 1HNVA 3VENA 4A2BA 4N41A 1Y97A 1VQ9N 4DUZK 2GUPA 2BGGA 3UKUB 3CC2N 2HF4A 2W40A 4V19S 3I33A 3JXUA 2NLXA 3RRGA 1NJZA 2E6MA 3ZSYA 2XRIA 4FLYA 3JAMO 3HZ6A 2VWJA 3EKUA 4DLEA 1U45A 5C24A 4WYBA 1X9WA 2VQEK 5GAGP 2X78A 1CZ9A 4BDYA 3SK3A 2P9IA 1Q18A 4FM2A 2GEMA 5IWAK 2PY5A 4KAZA 1BUPA 2HHSA 2JGUA 3VQPA 1X9SA 1SUQA 3HOSA 5KPRA 3LDLA 4DQIA 1UWBA 3V9XA 5CHIA 1JLFA 4PL7A 3TTCA 3LAMA 1SZ2A 3RMCA 3J7AP 4BQZA 4CBUA 5F1XA 1VQON 3DXMA 3TI0A 1KLMA 3VQ4A 3LM9A 1EKEA 2IS3A 1KVAA 5TKWA 2F8TA 1YT3A 2ZQBA 3BUZB 3UKUA 3RVCA 1L3UA 2CGJA 4DTNA 4NCBA 4FCYA 2UUCK 1WSEA 1TKTA 3NF9A 1RT2A 3THXB 3DLLL 1WAFA 3SYZA 3V1QA 3OYIA 1R59O 3DLEA 3IAYA 2O8EA 4C8LA 3VQ5A 1VQ8N 3LALA 4IO9L 1JLBA 2O8EB 4ISGA 5KPTA 4L3QA 4ZHRA 1ILYA 2JLEA 3DOLA 4H0TB 4PQUA 3MWTA 5AQKA 4HCCA 4YORA 3J7YP 3ZCMA 3PO4A 4KTQA 3HPHA 2O8DB 4CI6A 5M1QA 1QQOA 2OA8A 1S9GA 2YHAA 1BDGA 2YX6A 1RBVA 5SWMA 1IBMK 1HRHA 4C8NA 5AQHA 3VA3A 2RHKA 3E1YA 4FW1A 4FSVA 2ITMA 1LWFA 3VGMA 4AHCA 4PWDA 2P5GA 3WQUA 3O6WA 1TYQB 4CIEA 3LDPA 3ENBA 4JKEA 4CEEA 3G71N 1NK4A 1W7AA 3DYAA 3ZSXA 1NGHA 2KFZA 4CIFA 1Z26A 2YHYA 1ZXOA 3TAPA 2IDOA 3AVHA 2OPPA 1DTQA 2RPIA 3MN7A 3R3LA 3L2RA 2O8BB 5AQQA 3F5TA 3HK2A 1RT5A 1ESVA 1NGGA 3ISNC 3MK6A 3DAWA 4CJRA 4CCHA 2NRXA 4UY8O 2X6SA 4I9LA 3QEXA 3IFRA 3PUFA 4DTRA 3D2FA 2A5XA 2R7YA 4I2PA 3CMAN 3EZWA 3PIPL 2YKMA 3L8BA 2QKKA 2VG5A 3SQ2A 1XWLA 1QQCA 4CF0A 1LAWA 4WCEL 4IG0A 3VESA 4CESA 4FWOA 3QIOA 1BWFO 1BG3A 4LF7K 1HYZA 4BGAA 4BR5A 4JK7A 4CECA 5FPNA 4FYDA 3EO3A 1WNSA 4O5BA 3IG1A 5SZTA 4B9VA 4H0YB 1ATSA 5HROA 1BO5O 5K14A 4FJHA 1JLEA 3CFOA 4E7IA 5MLCQ 3ZT2A 3P5JA 3V9ZA 4J2DA 2NRWA 4BR9A 3DRRA 4BC4A 3PV8A 4MFBA 4YDUC 3O80A 3L2VA
chains in the Genus database with same CATH topology
4LF9K 4LFAK 2E5LK 3T1HK 4OX9K 4B3RK 3J7YP 4X65K 1N34K 4JI2K 4B3SK 4DUZK 5IT9O 1XMOK 4DV7K 1N33K 4YY3K 4V19S 1IBMK 5LMUK 3J81O 4DV3K 2UXCK 3JAMO 1XMQK 2HHHK 4LF8K 4B3MK 1XNRK 2ZM6K 4AQYK 4CW7B 4X64K 2VQEK 4K0KK 4NXNK 4DV0K 2UUBK 4LFCK 3J80O 5FLXO 4JI7K 4DR6K 4DV4K 4YHHK 5IWAK 3T1YK 2F4VK 3OTOK 1HNXK 5LL6Z 1IBLK 4JV5K 4KHPK 2VQFK 4DR1K 1I94K 4DV2K 4DR7K 4LF6K 2UXDK 5A2QO 4LF5K 4GKJK 4X66K 1IBKK 4DV6K 1HNWK 3J7AP 4LFBK 5AJ3K 4JI3K 1HNZK 4JYAK 4JI1K 1N32K 4JI4K 4NXMK 4B3TK 4LF7K 4DR5K 2UU9K 4JI0K 2UUCK 4JI5K 4LF4K 4CVNE 4JI8K 1FJGK 4DR4K 4DUYK 5LMNK 5BR8K 4DV5K 4X62K 1J5EK 4DV1K 1XNQK 4DR2K 4DR3K 4GKKK 2UUAK 1N36K 2UXBK 4JI6K 1HR0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 K;  4LFA K;  2E5L K;  3T1H K;  4OX9 K;  4B3R K;  3J7Y P;  4X65 K;  1N34 K;  4JI2 K;  4B3S K;  4DUZ K;  5IT9 O;  1XMO K;  4DV7 K;  1N33 K;  4YY3 K;  4V19 S;  1IBM K;  5LMU K;  3J81 O;  4DV3 K;  2UXC K;  3JAM O;  1XMQ K;  2HHH K;  4LF8 K;  4B3M K;  1XNR K;  2ZM6 K;  4AQY K;  4CW7 B;  4X64 K;  2VQE K;  4K0K K;  4NXN K;  4DV0 K;  2UUB K;  4LFC K;  3J80 O;  5FLX O;  4JI7 K;  4DR6 K;  4DV4 K;  4YHH K;  5IWA K;  3T1Y K;  2F4V K;  3OTO K;  1HNX K;  5LL6 Z;  1IBL K;  4JV5 K;  4KHP K;  2VQF K;  4DR1 K;  1I94 K;  4DV2 K;  4DR7 K;  4LF6 K;  2UXD K;  5A2Q O;  4LF5 K;  4GKJ K;  4X66 K;  1IBK K;  4DV6 K;  1HNW K;  3J7A P;  4LFB K;  5AJ3 K;  4JI3 K;  1HNZ K;  4JYA K;  4JI1 K;  1N32 K;  4JI4 K;  4NXM K;  4B3T K;  4LF7 K;  4DR5 K;  2UU9 K;  4JI0 K;  2UUC K;  4JI5 K;  4LF4 K;  4CVN E;  4JI8 K;  1FJG K;  4DR4 K;  4DUY K;  5LMN K;  5BR8 K;  4DV5 K;  4X62 K;  1J5E K;  4DV1 K;  1XNQ K;  4DR2 K;  4DR3 K;  4GKK K;  2UUA K;  1N36 K;  2UXB K;  4JI6 K;  1HR0 K; 
#chains in the Genus database with same CATH topology
 2AP1 A;  1NGF A;  3I55 N;  1NOZ A;  2EX3 A;  5ADX H;  2P5O A;  4DSL A;  2QXL A;  3TSQ A;  5DMR A;  5M1K A;  2X74 A;  1ZBI A;  2KZZ A;  4E19 A;  5AZJ A;  3ZEU B;  3QEV A;  1RDD A;  1YHQ N;  2FXU A;  4CER A;  4M63 C;  4CZG A;  1NKC A;  4BRC A;  2IIR A;  5HBM A;  3T7Z A;  4OLA A;  1NJX A;  2P9P B;  3ZSO A;  1NOY A;  4JK8 A;  4EIA A;  4IJN A;  3ULE B;  4B1W B;  1XI1 A;  3OYF A;  4CHQ A;  3TAQ A;  1F21 A;  1NGC A;  4WE1 A;  1BIU A;  5JS1 A;  4FJN A;  3NGY A;  3FE1 A;  3FLC O;  3VF6 A;  2V7Z A;  2H3G X;  1YVN A;  3P31 A;  3KWI A;  2ZWH A;  3HT3 A;  4AIL C;  1SKS A;  1E4F T;  5ELZ A;  4KHP K;  4IKF A;  2LSN A;  3H46 O;  1KD1 O;  3THW B;  3PLA A;  4RTF D;  3CFP A;  4E1M A;  1KAX A;  3LP0 A;  3SBT A;  3HM9 A;  2AA4 A;  4B1V A;  1HNZ K;  1RCH A;  2IGI A;  1VRT A;  3AA3 A;  1BCO A;  3K9K A;  4JYA K;  3KLI A;  4DTO A;  1N32 K;  4QAG A;  2QM1 A;  1NGJ A;  1W2B M;  3C6A A;  4C1N I;  3U3Y A;  3ZYY X;  4EP4 A;  1KCF A;  3QBW A;  4DTP A;  1C0F A;  1TL1 A;  4WF9 L;  1KXP A;  4DF8 A;  4CZI A;  3KIO A;  2DFH A;  1WLJ A;  3ZT4 A;  1U6Z A;  2HB5 A;  5AFU H;  4FZX C;  5FPD A;  3HOT A;  4HHT A;  3MCP A;  4LY7 A;  1OH6 A;  3BY5 A;  3LP2 A;  1NGE A;  3NH2 A;  3C7N B;  4CFD A;  3OYD A;  1MWM A;  3O4N A;  4B1Y B;  3KHY A;  3MN6 A;  3JSM A;  4KBO A;  2KZM A;  1T44 A;  4M41 A;  2HNY A;  1SL0 A;  2FSJ A;  3NH1 A;  2GWJ A;  1YTU A;  2GUI A;  1S1V A;  1RBT A;  3TWH A;  3ZT3 A;  4BDZ A;  3TR8 A;  4M3X A;  4F9O A;  2O4I A;  5KGW A;  1HKB A;  1OH7 A;  4DSE A;  5LMU K;  4K41 A;  3K58 A;  2BAN A;  5JS2 A;  1TKD A;  4CF2 A;  3BP8 A;  4BVP A;  4CEA A;  3AO3 A;  3U9D A;  1T05 A;  2HBJ A;  4Z4C A;  4OPH A;  2ZM6 K;  4QS7 A;  5AQS A;  2HHV A;  3SAF A;  1S72 N;  4DFP A;  2E20 A;  2P1J A;  5FPM A;  1VQ6 N;  3H3N O;  3MED A;  4FLU A;  3VQQ A;  3AVM A;  2YHX A;  1E4G T;  4AHR A;  5FLX O;  1XHX A;  2E88 A;  3SZ2 A;  3BF3 A;  4O5F A;  3ZET B;  3THY B;  3HSC A;  3L6Q A;  2AJQ A;  4AM7 A;  5LL6 Z;  4CFB A;  1XUP O;  1B9D A;  4OPA A;  3ZT0 A;  4DS5 A;  2D0B A;  2CH5 A;  1NMD A;  4BC5 A;  4JKH A;  5A2Q O;  3DLR A;  1NK6 A;  1JKH A;  3BDP A;  4QS8 A;  1GLE G;  4DKW A;  3KVG A;  3IRX A;  1RBU A;  4A2A A;  3THV A;  2WBN A;  3J8A A;  1QVF M;  4CHY A;  2YNG A;  4C8O A;  4FWP A;  1VAZ A;  4NO7 A;  4CE9 A;  3CYM A;  3IDH A;  1P8Z A;  4M42 A;  3ZT1 A;  3ID6 A;  1IG8 A;  3OJS A;  1S1X A;  3AVL A;  3KTQ A;  3AY9 A;  2QKB A;  1GLL O;  3QEP A;  2FSK A;  3VTI A;  5J1E A;  4DSI A;  5AQR A;  3C6U A;  4CJU A;  3LZJ A;  2W42 A;  4BG8 A;  2IVP A;  4M3T A;  4DV1 K;  1S1U A;  1IKW A;  2HST A;  4M7X A;  2Z1J A;  5CZ2 A;  3DJC A;  4A5B A;  4JK9 A;  4LSN A;  3NGZ A;  1XHZ A;  4CK2 A;  3VQA A;  3EE8 A;  5H1S Q;  5C42 A;  1LWC A;  4DHY A;  3I0S A;  2QWP A;  1K73 O;  1JXB A;  4CD3 A;  3CF5 L;  3P38 A;  3OJU A;  4M3U A;  4GVM A;  5BRH A;  1FKO A;  1TKX A;  3N4P A;  3NF6 A;  5GIP A;  3AVC A;  3QIC A;  5FDL A;  4CW7 B;  3A5O C;  1NM1 A;  4CGD A;  3G4S N;  3MXM A;  1NK7 A;  2KHO A;  3S9H A;  1RDU A;  1RDC A;  5KPZ A;  1U49 A;  1SV5 A;  2DPN A;  1ASW A;  1ITG A;  4NLB A;  1Q86 O;  1HKG A;  3AVA A;  4JV5 K;  4E89 A;  3MMV A;  3E9O A;  2I7P A;  3GDQ A;  2Z1H A;  2PBD A;  3VQC A;  4IEE A;  1JXE A;  3L2U A;  3DLH A;  1BL3 A;  4N5S A;  2CGK A;  2Z1G A;  4JI3 K;  2KKZ A;  3KJV A;  2IC3 A;  4FM1 A;  3RR8 A;  4FK4 A;  2GX9 A;  1CXQ A;  2A6A A;  4IOX A;  2YKN A;  4OKK A;  5KI6 A;  3NH0 A;  2E2N A;  1KC8 O;  2E2Q A;  4BY9 C;  3O4Q A;  1D4X A;  4JD2 B;  4CK3 A;  3C6H A;  1Q7Y O;  5AQF A;  4NCG A;  1XQS C;  3O8M A;  3SMS A;  2F9T A;  3KLH A;  4KHW A;  4JI5 K;  2E2P A;  1TK0 A;  1RGI A;  5C10 A;  3KWG A;  2QWR A;  5KRT A;  3VGK A;  3QES A;  1YUW A;  2GTD A;  2W6K A;  3O9R A;  3QFU A;  3DM2 A;  4IWV A;  4DU3 A;  1K9M O;  1D9D A;  5AZI B;  3SMP A;  4Q0B A;  1LAV A;  5J2N A;  3FZM A;  1WSF A;  1BIS A;  3NGI A;  4EHT A;  3THW A;  1BA1 A;  4JI2 K;  2FBX A;  4FJG A;  1MU2 A;  2XHB A;  4DTJ A;  4B08 A;  4DSF A;  2OCE A;  5AQW A;  2W6L A;  4QOZ B;  2HND A;  1YF5 L;  3H45 C;  1JLG A;  4Z4I A;  4CK1 A;  4MDA A;  4CJE A;  2GBZ A;  1QVG M;  1IKX A;  5ADX A;  3EY1 A;  1RBS A;  1U48 A;  1V4T A;  3D2E B;  2ZGZ A;  2HHQ A;  2O4G A;  3MX5 A;  3NF8 A;  2ZF5 O;  4Y0W A;  3QO9 A;  4RW7 A;  3QB0 A;  3OY9 A;  2D5R A;  3C7N A;  3PX6 A;  3T1Y K;  4FJI A;  2ZJQ L;  3MEG A;  4IXC A;  4JS4 A;  4E7K A;  3OTO K;  4KTW A;  2X6N A;  3FFK B;  3NFA A;  4JKD A;  2BDP A;  1SKR A;  1A5W A;  2VQF K;  1Z6R A;  1LOT B;  4MLH A;  4DR7 K;  3DRP A;  4JHD A;  3B6O A;  1FKP A;  1TYQ A;  2G8W A;  4CEF A;  3HYF A;  3OYG A;  4JHD B;  1TUU A;  3VEY A;  3DWL A;  1Q9X A;  4HTL A;  4CD1 A;  4YOT A;  3L2W A;  1XC3 A;  2VWK A;  3V1R A;  2BH1 A;  2NRV A;  3L4I A;  2QWL A;  3KKR A;  4YOY A;  3O9Q A;  3AVJ A;  1X9J A;  3JS6 A;  1X3M A;  2XY8 A;  2G8K A;  1JL2 A;  5AQI A;  1WN7 A;  5AZJ B;  2FC0 A;  3VN5 A;  4AF1 A;  3SV3 A;  1VK0 A;  3TPQ A;  3DMJ A;  3HP6 A;  3SUP A;  1BU6 O;  2F7T A;  3SJH A;  1TK8 A;  5CYM A;  3KD1 E;  2WFB A;  3SAH A;  2QTD A;  3MN9 A;  1VSJ A;  4JKB A;  3G6E N;  1W0H A;  3DXK A;  4IEI A;  4H0P A;  1T3V A;  1WSH A;  1TL3 A;  2YNH A;  3GE1 A;  1YJW N;  4E7J A;  4DFM A;  4GV9 A;  2HVH A;  3TTF A;  2DY4 A;  3P39 A;  2G8V A;  1DT9 A;  3MAQ A;  2YJF A;  4B3R K;  1C0U A;  4CED A;  3GBT A;  1X9M A;  3KKS A;  5AQY A;  4LH5 A;  5E84 A;  3OYA A;  1S3X A;  1GOB A;  4DV7 K;  1B9F A;  5B8H A;  3TAN A;  1VHX A;  3CG7 A;  3JYT A;  4EZ6 A;  1Y64 A;  4C23 A;  3R1X A;  1SS6 A;  4JRP A;  3O08 A;  4BRG A;  4BR0 A;  1Z05 A;  4LF8 K;  3VEV A;  3SLC A;  4HVJ A;  1OVQ A;  4CZK A;  1L5U A;  3PX4 A;  4B8A B;  3VGL A;  4ICL A;  1ZBF A;  2XY5 A;  2QWN A;  3P83 D;  4CGF A;  3IMX A;  2CGL A;  1ZBL A;  4DR6 K;  3A5M C;  5C15 A;  3VEW A;  3O1W A;  1RDW X;  5BN9 A;  4CZE A;  1RTH A;  2RE2 A;  4RW4 A;  1Z25 A;  1L3V A;  4Z94 A;  1S6P A;  4U7B A;  4W5N A;  4LH4 A;  1JCE A;  2DFF A;  4DV2 K;  3QDK A;  4J2B A;  3K5O A;  2QWQ A;  4G9Z A;  5AQM A;  1NJY A;  3HST B;  3PX0 A;  2FSN A;  3RMD A;  3T19 A;  5EOY A;  4HWI A;  1BCM A;  4HUG A;  2YNF A;  4BRA A;  1O1W A;  1S1W A;  2YV0 X;  4ILJ A;  4TSX A;  3SCX A;  1ZYQ A;  5AQU A;  3CHW A;  4CF9 A;  5EVZ A;  2XY7 A;  2F8S A;  3OW2 M;  2PYJ A;  1C0M A;  4JNE A;  2V7Y A;  1VQN N;  3NF7 A;  1RBR A;  2Q2R A;  5AQV A;  1S1T A;  4GMJ B;  3NE6 A;  1S22 A;  4DCH A;  1M90 O;  4OLB A;  5CZ1 A;  3A5L C;  4N56 A;  2NZT A;  3ATV A;  2NRH A;  1DLO A;  3CJ1 A;  4ELU A;  4CEQ A;  4JKG A;  1U04 A;  4C8M A;  3M8S A;  4FZZ A;  1G15 A;  3K0S A;  3LZI A;  5D3G A;  4F3T A;  3MWP A;  4JKG B;  4W5O A;  1RTJ A;  4GY2 B;  3AVK A;  4BC2 A;  1YIJ N;  4KH6 A;  1QE1 A;  3CCV N;  3CCM N;  3M1F A;  1RT4 A;  3OHR A;  1WUA A;  5JLH A;  3PO5 A;  1O13 A;  4DQR A;  2YNI A;  3CXC M;  2IAJ A;  4O8U A;  2P9S B;  2O8F B;  2OPR A;  5EX5 A;  4KI4 A;  4CJP A;  3ZSW A;  3DI6 A;  3O9U A;  1NGI A;  4BRE A;  4FOE A;  2HBM A;  4N76 A;  3E9L A;  2E8A A;  3H6E A;  3RRH A;  1XMQ K;  3SPZ A;  3AA4 A;  1NKE A;  4FVU A;  2P51 A;  5GAH P;  3CCL N;  1GLC G;  4FW2 A;  3CER A;  3FZH A;  4DG1 A;  1XNR K;  4CHN A;  4DTU A;  1NG9 A;  3OYJ A;  4K0K K;  5KRS A;  2YHW A;  3SQ1 A;  2VYP A;  2UUB K;  3B6P A;  3HVT A;  3VQ7 A;  3LP1 A;  1MDU B;  4JI7 K;  2P9U A;  3CM6 A;  4CF1 A;  2P9L B;  4DV4 K;  1SL2 A;  3UB5 A;  4XEI A;  4PY5 A;  3QML A;  5I9E B;  2IVN A;  3MCA B;  1HX1 A;  2NRT A;  4Z4H A;  4FXD A;  1T8E A;  4Z4G A;  3L4Q A;  1D9F A;  4W5Q A;  3CC7 N;  5C0Y A;  2HF3 A;  2XO7 A;  4GKJ K;  1TUY A;  3V9U A;  1HNW K;  3OBY A;  4KH4 A;  1KTQ A;  1IKV A;  4JI1 K;  3AO5 A;  3LAK A;  3ZET A;  3THY A;  3WXK A;  3U6F A;  3EE9 A;  2J4R A;  1S6Q A;  5CR4 A;  3OYB A;  3RMA A;  1L3T A;  4DSK A;  1EO1 A;  3IKM A;  3HVR A;  3CJB A;  1OH5 A;  3NVK A;  3I8B A;  1T6C A;  5AQP A;  2VGM A;  3K2P A;  1KLN A;  1UA1 A;  4F3O A;  2A1S A;  4DU1 A;  4AHV A;  1W97 L;  1C1C A;  4YDU A;  3I8D A;  1QQN A;  5BRD A;  3AAP A;  1NJW A;  2OTL N;  1YAG A;  1NK9 A;  3R9P A;  2I7N A;  1VQ4 N;  3K59 A;  2I5J A;  3OA9 A;  1NGA A;  4WFN L;  4WQ5 C;  4CJT A;  1U47 A;  5BPN A;  2Q97 A;  3RSE A;  4DTS A;  3G0Z A;  1NGB A;  3FFI A;  3CCU N;  4R5P A;  3CC4 N;  3VF4 A;  2HMI A;  3LP3 A;  1XMO K;  3C94 A;  2OZS A;  4F2S A;  4DWI A;  4FVM A;  3SUQ A;  5T7B A;  2IOC A;  5HRS A;  2HHW A;  2HMP A;  3WXM B;  4O8K A;  3CQX A;  4YOX A;  4ID1 A;  4JKA A;  2HBK A;  3GL1 A;  3I0R A;  4MDB A;  1C1B A;  4KO0 A;  4CEO A;  4FWR A;  2WTU A;  2ZJP L;  3FR0 A;  2Z1I A;  3BF1 A;  4NXN K;  5BPL A;  4CJL A;  1DTT A;  3CCJ N;  4PKG A;  3H3O B;  1N6Q A;  4KV8 A;  3K5M A;  2PFU A;  3RTV A;  4YOV A;  4ZTF A;  1K8A O;  3AV9 A;  3D7E O;  1QQM A;  3CJA A;  3HPG A;  1ZBH A;  2NUB A;  1TK5 A;  3CCS N;  4JAX A;  4H5V A;  4BE0 A;  5AQX A;  3LM2 A;  4X66 K;  1VSE A;  3WEE A;  3MN5 A;  2HW3 A;  4XIU A;  4F2R A;  4GV6 A;  4AHU A;  1IG9 A;  1VQK N;  4BRL A;  2QK9 A;  3L3U A;  1KQS M;  3G10 A;  2ZD1 A;  3OYL A;  4H5R A;  1A5V A;  3FZL A;  1SL1 A;  3VQ8 A;  3TTD A;  3EL2 A;  3Q7C A;  1GLB G;  2NRZ A;  1EP4 A;  3U8X A;  4B9Q A;  3S3M A;  4AH9 A;  4DQP A;  4E0D A;  3WXL A;  4R79 A;  4M45 A;  2HOE A;  4CVN E;  4H4O A;  4Z0U A;  1NK8 A;  3LWM A;  1J9A A;  2A1R A;  3ULD A;  2D0O A;  5AZI A;  5BR8 K;  3D0P A;  4C1N K;  3CJ7 A;  4DTX A;  1Q82 O;  4OKJ A;  4KFB A;  3RWU A;  1J5E K;  1XNQ K;  1HUX A;  5M1N A;  4GKK K;  4PL8 A;  2DFE A;  3A2F A;  3UKR B;  4IDK A;  3HPO A;  4OVL A;  4CZF A;  1JL1 A;  1X3N A;  3OS1 A;  3AA2 A;  2YCH A;  3N4Q A;  1YVU A;  3VER A;  1FW6 A;  1HYS A;  4RW8 A;  1J53 A;  1UOC A;  3KD5 E;  3M8R A;  1KVB A;  4B9U A;  4FLW A;  4AHS A;  1QHT A;  5LY3 A;  2UXC K;  4IOC L;  4GV3 A;  1WB9 A;  4BRM A;  1LW0 A;  1T03 A;  4QCL A;  1QHA A;  4IZ9 A;  3ASM A;  4YNQ A;  3S3N A;  3V1O A;  2OPS A;  4DV0 K;  5BPM A;  5BN8 A;  4B9M A;  2ETJ A;  4CGG A;  1HMV A;  3DLK A;  4ISE A;  1VQ5 N;  1A5X A;  3CET A;  4YHH K;  3HI0 A;  1YJN N;  1NK5 A;  3W3D A;  5CY4 A;  1HNX K;  4DFK A;  2OAN A;  4DR1 K;  1GOC A;  5C2D A;  3QEI A;  4XH4 A;  4NCA A;  1BIZ A;  4E1N A;  3A0I X;  3KK3 A;  3AVB A;  3CJ9 A;  3UIQ A;  4IFE A;  4W5R A;  4LFB K;  3LPT A;  3OYM A;  3QNN A;  3P1G A;  2QWO A;  3AA5 X;  3LDO A;  1VSM A;  1KAZ A;  3C95 A;  3LDN A;  1HNI A;  2RF2 A;  4FJ7 A;  3SUN A;  5FRM A;  3BGR A;  4JI0 K;  3AVF A;  3H1V X;  3F9M A;  3OBW A;  1MA9 B;  1S9E A;  3KLE A;  3DLG A;  3TAE A;  4H5N A;  4QS9 A;  1H1V A;  4HCB A;  3FGU A;  2WUS A;  1VSD A;  3PSI A;  3CJC A;  4LC9 B;  3IS9 A;  1U2V A;  4BVO A;  2YJE A;  4Q5V A;  2P9I B;  5GIN A;  3E9P A;  3I56 N;  1YIT N;  5EU7 A;  2UXB K;  1N36 K;  3V9W A;  3L2Q A;  2ASO A;  4LFA K;  2E5L K;  3VEO A;  3VEX A;  1EXQ A;  4KH5 A;  3F2K A;  1QZ6 A;  2RN2 A;  4CGJ A;  3U9Z A;  4DQS A;  4IFY A;  3VEZ A;  2PAV A;  1D8Y A;  1BI4 A;  1WBB A;  2OPQ A;  3B8A X;  3C0B A;  3K57 A;  3L3V A;  3ZX3 A;  3GOI A;  2G8U A;  4B3M K;  4DMN A;  4PKH A;  4H0X B;  5JMV A;  2BE2 A;  3WNH A;  1CXU A;  3ATU A;  3QBX A;  1X1P A;  5KQ8 A;  4CFA A;  1GLJ O;  4LFC K;  3ZX2 A;  3SQ0 A;  1NNE A;  4K43 A;  3NMU A;  1FXX A;  2P9K B;  3VQ9 A;  5KQD A;  4E7L A;  3SBG A;  1HPM A;  4FJ5 A;  5LJV A;  4O55 A;  2E1Y A;  1IBL K;  2E1Z A;  4FLV A;  3C65 A;  5I3U A;  1NU0 A;  2EWS A;  3PSF A;  1EWQ A;  4IBN A;  2E6L A;  4JLH A;  2DTU A;  4EFH A;  2UXD K;  2O8D A;  4DQQ A;  4FO0 A;  4KHU A;  4ISF A;  1NJI O;  2FF3 B;  1IJJ A;  1REV A;  4BRH A;  3R8E A;  3O4W A;  4I6M A;  4B3T K;  3QET A;  1KSP A;  2UU9 K;  4DU4 A;  2Q0U A;  4BR2 A;  5CE3 A;  1WSG A;  4FPA A;  3G25 A;  5DM6 L;  3QER A;  2VCP A;  4RW9 A;  3ULE A;  2D4W A;  1K8K B;  3ITH A;  3EEQ A;  2YHB A;  4H0V B;  3TAM A;  2BUP A;  3AVI A;  4DV5 K;  4FWM A;  5LJW A;  2WC9 A;  3OYK A;  4H4M A;  4X62 K;  1Q9Y A;  3HTV A;  1RIL A;  3T69 A;  2Q1N A;  1J54 A;  2UUA K;  3ENH A;  1HR0 K;  2WOM A;  4IDH A;  3VPZ A;  3FZK A;  4OX9 K;  3O3H A;  3VET A;  1YTA A;  3H08 A;  1BQM A;  2EHG A;  4MLE A;  3LAN A;  4N47 A;  1WOQ A;  2VWB A;  4AHT A;  1N33 K;  2HHU A;  1CZA N;  4XH1 A;  2V52 B;  1HQE A;  4IJA A;  4OGC A;  1OH8 A;  3A5N C;  4BRP A;  4WFA L;  1C6V A;  2HHH K;  1C0T A;  5DM7 L;  2KQ2 A;  2QI2 A;  5BRE A;  1EQY A;  3D45 A;  1KVC A;  2E4L A;  5EY4 A;  3HXM A;  1TV6 A;  5AQO A;  4RG8 A;  3T3F A;  3WUH A;  1D5A A;  4GW6 A;  4KTZ A;  3TSP A;  1I3A A;  5M1O A;  3MXI A;  3OS0 A;  3HL8 A;  3M8Q A;  4JRQ A;  2B5J A;  4EP5 A;  4L8R B;  3C6T A;  5HRP A;  2Y1J A;  2F9W A;  4B9L A;  2G8H A;  3VF2 A;  1UA0 A;  4A57 A;  3EKS A;  3VOV A;  4KB0 A;  2UYT A;  5TKY A;  2WON A;  3AGK A;  3AVN A;  3O9S A;  3WNG A;  2KW4 A;  2IVO A;  4CFC A;  2O8C A;  4BR4 A;  3DRS A;  4OPJ A;  4B3O A;  4ILG B;  1HKC A;  2P9N B;  2P9L A;  2QW9 A;  1P90 A;  1TVR A;  1SQK A;  4HUF A;  1WAJ A;  1K6Y A;  4CF8 A;  5GAD P;  4O4G A;  3D2E A;  3HBT A;  3HO1 A;  5C25 A;  4JKC A;  5HRR A;  5CYQ A;  3CCQ N;  2ZGY A;  3KLG A;  4JEP A;  4CEZ A;  1DKG D;  3WT0 A;  1WBD A;  4LF4 K;  2D1K A;  4DR4 K;  4B1Z A;  3RMB A;  3MEC A;  4WQ4 A;  1R0A A;  2O8B A;  4BE2 A;  1ASU A;  1WSI A;  2P9N A;  4B9T A;  1M1K O;  4IOA L;  3EN9 A;  4O44 A;  2KTQ A;  4CBW A;  3TU5 A;  2O8C B;  5E41 A;  4H5W A;  2XY6 A;  3ALY A;  3CM5 A;  1KFD A;  3HRG A;  3NAE A;  3SQ4 A;  4EZ9 A;  4CIG A;  4KRE A;  2HBL A;  4ILH A;  4HTU A;  3UE5 A;  1VRU A;  3QEW A;  1RTI A;  3QIN A;  4EHU A;  3WXI A;  4YY3 K;  4FWN A;  1YJ9 N;  3S3O A;  3O5B A;  1KFS A;  2YI1 A;  4K25 A;  1HLU A;  4DV3 K;  4FJK A;  1G99 A;  1RDA A;  3ZSZ A;  4DS4 A;  2ZE2 A;  4E1J A;  4FJ9 A;  3WNE A;  4FPB A;  5F0X A;  4AQY K;  4BR7 A;  3AVG A;  1LV5 A;  4IO8 A;  3Q7B A;  1IO2 A;  3EYZ A;  4A61 A;  4CJQ A;  2P9P A;  4RWT A;  3K5N A;  2Q0R A;  4BGB A;  5M1F A;  1S5J A;  4HUE A;  1RT6 A;  5EXW A;  4DLG A;  3CQ8 A;  2PYL A;  5FRO A;  4Z4F A;  2VGN A;  4I2Q A;  3F73 A;  4OKE A;  3KZB A;  2B6A A;  3KLF A;  1HPZ A;  3A8Y A;  3CI5 A;  1SKW A;  4DSJ A;  1J6Z A;  5E26 A;  4LF5 K;  5M1P A;  4GNI A;  4DV6 K;  1BGX T;  4BRF A;  3M8P A;  3TAB A;  1GOA A;  4DFJ A;  3U3G A;  1NK0 A;  3J7Z O;  1OKJ A;  4FK2 A;  3OYE A;  4KPY A;  3WXJ A;  4BRN A;  1TGO A;  4RCH A;  1GLA G;  3HP9 A;  4DR5 K;  3GG4 A;  1RFQ A;  4W5T A;  1VSK A;  5HRN A;  1ZC6 A;  1ZBS A;  3EZ5 A;  4KKO A;  2G8I A;  1I39 A;  3QFP A;  4JI8 K;  2PZS A;  4WFB L;  1VSF A;  4J2A A;  4DUY K;  3CPE A;  4OO1 J;  4B1X B;  4J8F A;  3K5L A;  1W9H A;  4CEB A;  3OYH A;  4F8R A;  3AGR A;  4FL9 A;  4DR2 K;  4DR3 K;  5AQJ A;  4FWL A;  1T6D A;  4CJ5 A;  3NDK A;  3NHG A;  1KAY A;  1SAZ A;  1N34 K;  3QLH A;  1RT1 A;  1BHL A;  2QWM A;  3O3G A;  1ATN A;  4FM0 A;  3V4I A;  4MO5 A;  3O3F A;  3AAR A;  2RKI A;  1HYV A;  4BWJ A;  3O9T A;  3TSU A;  3V81 A;  1JLQ A;  1B92 A;  4XH5 A;  2A42 A;  2HHT A;  4WQ4 C;  1RDB A;  1E3M A;  5HL7 L;  3ID8 A;  4O0J A;  3MEE A;  4OGE A;  5KGX A;  1VSH A;  5JLF A;  4H03 B;  4GVE A;  3SV4 A;  5BR9 A;  5GIO A;  1JLC A;  3BZK A;  4AM6 A;  5KTQ A;  2F4V K;  2OYQ A;  4Z4E A;  3W0L A;  1HJR A;  4KHN A;  1GLF O;  1NMN A;  5AR0 A;  4CJ4 A;  4M3R A;  1QSS A;  3VQ6 A;  4FLZ A;  1I94 K;  3SJJ A;  2HHX A;  1NBW A;  4KHQ A;  3CQY A;  4B8C A;  4CJV A;  4BDP A;  4U67 L;  3K9J A;  3VQE A;  3LL3 A;  1IBK K;  4CZJ A;  1NKB A;  4FLT A;  4BRK A;  4DQ8 A;  5AQL A;  1RTD A;  3RR7 A;  5FRN A;  4A5A A;  4PA1 A;  3TAG A;  4KB1 A;  4CZM A;  3CIP A;  2F96 A;  3NVM A;  4ELT A;  3KK1 A;  2VG6 A;  5AQZ A;  1VQL N;  1BA0 A;  3NBP A;  2Q31 A;  1LWE A;  4BRI A;  4KHY A;  1FJG K;  1EET A;  3OYN A;  3ENO A;  2HNZ A;  4JD2 A;  4A59 A;  1GLD G;  2JWK A;  3VTH A;  4K8Z A;  1QS4 A;  4K42 A;  2D0P A;  2GV9 A;  5JVG L;  2P9U B;  2Y1I A;  1JCF A;  3VMF B;  2VG7 A;  1V4S A;  4BC3 A;  1T7P A;  1IKY A;  3D6R A;  1IH7 A;  3R6M A;  4JI6 K;  3WNF A;  4OJR A;  2ASP A;  4LF9 K;  1VSL A;  1RT3 A;  1QSY A;  4FWQ A;  4M3Y A;  4NYN A;  3BZC A;  5JIC A;  3OVN A;  4ZTJ A;  4JS5 A;  2G8F A;  3BEX A;  5IT9 O;  1KRP A;  3RSE B;  4B1U B;  4O0I A;  1OVY A;  3SNN A;  3DXK B;  1TAU A;  2FBY A;  4B9N A;  4NB4 A;  3J81 O;  4CBX A;  3VQD A;  4WQ5 A;  2P9S A;  2O8F A;  4FWK A;  3O1B A;  3MXJ A;  3AAQ A;  2A40 A;  3TAR A;  3M6G A;  3SAG A;  5FPE A;  1QSL A;  3J80 O;  3M5R A;  3IUC A;  3NCI A;  1N5Y A;  3ZSR A;  2NRR A;  4MQ3 A;  4BAC A;  4FLX A;  1JCG A;  1FK9 A;  4J2E A;  2V51 B;  1EWR A;  4ID5 A;  3MX2 A;  1U4B A;  1CLQ A;  4H8K A;  4PKI A;  4PHT X;  1HJO A;  1LW2 A;  2A41 A;  3CME N;  2ITG A;  5AQT A;  3QIP A;  4CJ3 A;  4I7F A;  4NYF A;  5JVH L;  1TAQ A;  4UQG A;  3TAF A;  4FJM A;  2P9K A;  1NWK A;  2D0A A;  4CZL A;  2QA4 N;  4JI4 K;  4BRQ A;  2NNW A;  4G1Q A;  3E66 A;  3LDQ A;  3P4I A;  3THX A;  1QTM A;  3D2F B;  3MDQ A;  3F9K A;  4BWM A;  1DGK N;  4DF4 A;  5BRF A;  1VQM N;  2OTJ N;  3SUO A;  5GAE P;  3OYC A;  1YXQ A;  4KHS A;  3T1A A;  3ZLJ A;  3L0Q A;  4KI6 A;  4NLC A;  5J2M A;  3PIO L;  5LMN K;  2Q3S A;  3CFR A;  4PUO A;  4EAH D;  1ZBU A;  4F4K A;  2FBT A;  2GEL A;  1CZB A;  3V6D A;  2ASM A;  2E2O A;  1VQ7 N;  1JLA A;  1Q81 O;  3CPW M;  1EX4 A;  3SPY A;  4CGH A;  2B4J A;  4M3W A;  1NGD A;  1QZ5 A;  5AQN A;  1RNH A;  3M3Z A;  4B3S K;  4M3Z A;  2HVI A;  1BOT O;  5I42 A;  5C2F A;  2ZJR L;  5C12 A;  4M7Y A;  3KK2 A;  1WSJ A;  4FK0 A;  4C8K A;  1NLV A;  4CJF A;  5AQG A;  4H5T A;  3FZF A;  1HQU A;  4E7H A;  5DK5 A;  4CJS A;  4BG9 A;  2QEX N;  1J5O A;  1BQN A;  1Q8I A;  1VSI A;  4CJW A;  3AO4 A;  1UAX A;  3E01 A;  3KK7 A;  4X64 K;  2FLO A;  4BRO A;  5AFU A;  4YFU A;  3OS2 A;  4B9S A;  4CHP A;  2W41 A;  1N8R O;  3HM8 A;  4YOU A;  4LSL A;  3U4L A;  1ASV A;  1L3S A;  5HP1 A;  4BRD A;  4ELV A;  4IG3 A;  3WQT A;  4JKF A;  2FBV A;  3VA0 A;  3V9S A;  1U2V B;  4CZH A;  4JN4 A;  2Q36 A;  2FF6 A;  4KRF A;  4RW6 A;  3S41 A;  4DB3 A;  1K8K A;  4CJK A;  1ATR A;  3HJF A;  4LF6 K;  2KFN A;  4FJ8 A;  4FZY A;  3SI6 A;  4OPK A;  5J2P A;  5AJ3 K;  2OZM A;  1TKZ A;  3VQB A;  4MO4 A;  4I9Q A;  3AO1 A;  3ZSQ A;  5HLF A;  2A3Z A;  4I6M B;  1C0G A;  1BI4 B;  3PY8 A;  4NXM K;  1MWK A;  4A62 A;  1VQP N;  1YI2 N;  2ATQ A;  3WEE B;  1IV0 A;  3CCR N;  4FJL A;  5HOO A;  1LCU A;  4FOI A;  4DTM A;  4FJX A;  3ZSV A;  5F2R A;  1XC9 A;  4YOW A;  2KLA A;  2QXF A;  1JJ2 M;  4CJ7 A;  3CCE N;  2CH6 A;  2BTF A;  4CGI A;  3UKR A;  2JWL A;  5J2Q A;  4BE1 A;  1C1A A;  1RT7 A;  3LDS A;  3QNO A;  2D0C A;  3AO2 A;  3LWL A;  4FWS A;  4LD0 A;  4CHZ A;  3CD6 N;  4E3S A;  4BQL A;  3H1Q A;  4FJJ A;  4H0O A;  4CHO A;  3DXM B;  1DEJ A;  4Y1D A;  3DOK A;  3LPU A;  4IFV A;  3ZEU A;  3ZX0 A;  3DLB A;  2GWK A;  3T1H K;  4Y1C A;  4X65 K;  4K8X A;  1HNV A;  3VEN A;  4A2B A;  4N41 A;  1Y97 A;  1VQ9 N;  4DUZ K;  2GUP A;  2BGG A;  3UKU B;  3CC2 N;  2HF4 A;  2W40 A;  4V19 S;  3I33 A;  3JXU A;  2NLX A;  3RRG A;  1NJZ A;  2E6M A;  3ZSY A;  2XRI A;  4FLY A;  3JAM O;  3HZ6 A;  2VWJ A;  3EKU A;  4DLE A;  1U45 A;  5C24 A;  4WYB A;  1X9W A;  2VQE K;  5GAG P;  2X78 A;  1CZ9 A;  4BDY A;  3SK3 A;  2P9I A;  1Q18 A;  4FM2 A;  2GEM A;  5IWA K;  2PY5 A;  4KAZ A;  1BUP A;  2HHS A;  2JGU A;  3VQP A;  1X9S A;  1SUQ A;  3HOS A;  5KPR A;  3LDL A;  4DQI A;  1UWB A;  3V9X A;  5CHI A;  1JLF A;  4PL7 A;  3TTC A;  3LAM A;  1SZ2 A;  3RMC A;  3J7A P;  4BQZ A;  4CBU A;  5F1X A;  1VQO N;  3DXM A;  3TI0 A;  1KLM A;  3VQ4 A;  3LM9 A;  1EKE A;  2IS3 A;  1KVA A;  5TKW A;  2F8T A;  1YT3 A;  2ZQB A;  3BUZ B;  3UKU A;  3RVC A;  1L3U A;  2CGJ A;  4DTN A;  4NCB A;  4FCY A;  2UUC K;  1WSE A;  1TKT A;  3NF9 A;  1RT2 A;  3THX B;  3DLL L;  1WAF A;  3SYZ A;  3V1Q A;  3OYI A;  1R59 O;  3DLE A;  3IAY A;  2O8E A;  4C8L A;  3VQ5 A;  1VQ8 N;  3LAL A;  4IO9 L;  1JLB A;  2O8E B;  4ISG A;  5KPT A;  4L3Q A;  4ZHR A;  1ILY A;  2JLE A;  3DOL A;  4H0T B;  4PQU A;  3MWT A;  5AQK A;  4HCC A;  4YOR A;  3J7Y P;  3ZCM A;  3PO4 A;  4KTQ A;  3HPH A;  2O8D B;  4CI6 A;  5M1Q A;  1QQO A;  2OA8 A;  1S9G A;  2YHA A;  1BDG A;  2YX6 A;  1RBV A;  5SWM A;  1IBM K;  1HRH A;  4C8N A;  5AQH A;  3VA3 A;  2RHK A;  3E1Y A;  4FW1 A;  4FSV A;  2ITM A;  1LWF A;  3VGM A;  4AHC A;  4PWD A;  2P5G A;  3WQU A;  3O6W A;  1TYQ B;  4CIE A;  3LDP A;  3ENB A;  4JKE A;  4CEE A;  3G71 N;  1NK4 A;  1W7A A;  3DYA A;  3ZSX A;  1NGH A;  2KFZ A;  4CIF A;  1Z26 A;  2YHY A;  1ZXO A;  3TAP A;  2IDO A;  3AVH A;  2OPP A;  1DTQ A;  2RPI A;  3MN7 A;  3R3L A;  3L2R A;  2O8B B;  5AQQ A;  3F5T A;  3HK2 A;  1RT5 A;  1ESV A;  1NGG A;  3ISN C;  3MK6 A;  3DAW A;  4CJR A;  4CCH A;  2NRX A;  4UY8 O;  2X6S A;  4I9L A;  3QEX A;  3IFR A;  3PUF A;  4DTR A;  3D2F A;  2A5X A;  2R7Y A;  4I2P A;  3CMA N;  3EZW A;  3PIP L;  2YKM A;  3L8B A;  2QKK A;  2VG5 A;  3SQ2 A;  1XWL A;  1QQC A;  4CF0 A;  1LAW A;  4WCE L;  4IG0 A;  3VES A;  4CES A;  4FWO A;  3QIO A;  1BWF O;  1BG3 A;  4LF7 K;  1HYZ A;  4BGA A;  4BR5 A;  4JK7 A;  4CEC A;  5FPN A;  4FYD A;  3EO3 A;  1WNS A;  4O5B A;  3IG1 A;  5SZT A;  4B9V A;  4H0Y B;  1ATS A;  5HRO A;  1BO5 O;  5K14 A;  4FJH A;  1JLE A;  3CFO A;  4E7I A;  5MLC Q;  3ZT2 A;  3P5J A;  3V9Z A;  4J2D A;  2NRW A;  4BR9 A;  3DRR A;  4BC4 A;  3PV8 A;  4MFB A;  4YDU C;  3O80 A;  3L2V A; 
#chains in the Genus database with same CATH homology
 4LF9 K;  4LFA K;  2E5L K;  3T1H K;  4OX9 K;  4B3R K;  3J7Y P;  4X65 K;  1N34 K;  4JI2 K;  4B3S K;  4DUZ K;  5IT9 O;  1XMO K;  4DV7 K;  1N33 K;  4YY3 K;  4V19 S;  1IBM K;  5LMU K;  3J81 O;  4DV3 K;  2UXC K;  3JAM O;  1XMQ K;  2HHH K;  4LF8 K;  4B3M K;  1XNR K;  2ZM6 K;  4AQY K;  4CW7 B;  4X64 K;  2VQE K;  4K0K K;  4NXN K;  4DV0 K;  2UUB K;  4LFC K;  3J80 O;  5FLX O;  4JI7 K;  4DR6 K;  4DV4 K;  4YHH K;  5IWA K;  3T1Y K;  2F4V K;  3OTO K;  1HNX K;  5LL6 Z;  1IBL K;  4JV5 K;  4KHP K;  2VQF K;  4DR1 K;  1I94 K;  4DV2 K;  4DR7 K;  4LF6 K;  2UXD K;  5A2Q O;  4LF5 K;  4GKJ K;  4X66 K;  1IBK K;  4DV6 K;  1HNW K;  3J7A P;  4LFB K;  5AJ3 K;  4JI3 K;  1HNZ K;  4JYA K;  4JI1 K;  1N32 K;  4JI4 K;  4NXM K;  4B3T K;  4LF7 K;  4DR5 K;  2UU9 K;  4JI0 K;  2UUC K;  4JI5 K;  4LF4 K;  4CVN E;  4JI8 K;  1FJG K;  4DR4 K;  4DUY K;  5LMN K;  5BR8 K;  4DV5 K;  4X62 K;  1J5E K;  4DV1 K;  1XNQ K;  4DR2 K;  4DR3 K;  4GKK K;  2UUA K;  1N36 K;  2UXB K;  4JI6 K;  1HR0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...