4HTUA

Structure of 5-chlorouracil modified a:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
molecule keywords Ribonuclease H
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4htuA00
4DSEA 3HPHA 3EY1A 2QKKA 3QIOA 4H8KA 5CZ1A 2P5OA 5T7BA 2DTUA 1BQNA 2RF2A 1KRPA 4HVJA 2YV0X 1REVA 3DMJA 3DRPA 4Y1DA 3VQ5A 4G1QA 3L2WA 4DF4A 1TK5A 1BCOA 4FW1A 1T7PA 4IBNA 3THVA 5CY4A 2D0AA 1NKEA 4E7KA 4FJ7A 4N5SA 3AVNA 1JLQA 2JGUA 2VG7A 3RR7A 4FM0A 3IAYA 4ELTA 4E89A 1D8YA 3TWHA 3HSTB 4E19A 3LWMA 4B9UA 4CIFA 2D0CA 3SUPA 1SV5A 2KQ2A 4PA1A 3OYKA 3VQCA 3F9KA 1WSFA 3V1RA 4CEEA 4FJNA 3HVTA 4KREA 1FKPA 4FJIA 1HNIA 4N56A 1U4BA 3LPUA 4HUEA 4DQPA 3V1OA 3QEIA 1S6PA 3O4NA 4KV8A 1BISA 4AHVA 1IKVA 4FZXC 4N41A 4OKKA 4O5BA 2XHBA 1NJYA 1RDCA 4ID5A 4E1NA 3ASMA 4CGHA 2HMIA 1L3TA 2Z1JA 4AHRA 4Z4HA 1FXXA 4LH4A 4B9LA 3P83D 1KFSA 2BGGA 1CXQA 3RMBA 4HUFA 1EX4A 1IH7A 4FK4A 3SV4A 1KTQA 4DTOA 1TKTA 3OYLA 3LP1A 3NF7A 4DFKA 4FJ9A 4EP4A 3B6PA 2EX3A 1RDAA 2ATQA 4CJ5A 4JRPA 3SQ1A 3LZJA 1RBRA 5KI6A 5SWMA 3K5OA 4B9VA 4KPYA 3AO1A 3AVCA 2HHSA 4EP5A 3KLFA 3L2RA 3RRGA 4DFMA 1WSJA 3T3FA 3AO4A 2OPPA 3NDKA 3B6OA 3OYMA 2G8IA 4C8NA 3MEGA 5E41A 4W5RA 5I42A 1C0MA 3MXIA 2HNZA 1JLCA 3DYAA 3IRXA 3HP9A 1GOAA 3AA3A 4IG3A 5CYMA 1BI4B 4O0IA 3K57A 1WAFA 4H4MA 3U3GA 1HNVA 4ICLA 3KLGA 2E6MA 3S3NA 1S6QA 5KTQA 1JXBA 1TAQA 4O4GA 3ZT4A 4DU3A 3QETA 3RWUA 4MQ3A 4L8RB 3HK2A 4YNQA 1N6QA 4RW4A 2YNHA 3VQ6A 4CECA 1L5UA 4DTRA 4CEFA 3ULDA 4HTUA 4M3RA 3KK2A 4FM2A 4ELVA 4O44A 1J5OA 1S1VA 2IDOA 1Z26A 3KLIA 3SNNA 1NKCA 3VQQA 3QERA 4FW2A 2QXFA 5C25A 1BQMA 1X9MA 1JKHA 1RILA 1WSIA 1RTJA 1YT3A 4CEQA 4DLEA 3K5NA 3AVFA 3HXMA 1SKRA 1VSLA 4OPJA 4FZZA 4OJRA 4CEAA 1NK5A 4ELUA 4DQQA 1JLGA 1J54A 4KTZA 2IC3A 4Z0UA 4DU1A 1WSEA 1UOCA 4OGEA 1LV5A 4FK0A 2E4LA 1LWEA 2I5JA 3PX4A 3ISNC 4RW9A 1D5AA 2HNDA 4RW7A 5KRTA 1RBVA 3OYEA 3NCIA 3KD1E 2OA8A 2Q3SA 4NYFA 5J2QA 3LP3A 1WSGA 2F96A 1RDDA 3VQDA 3VA3A 4PUOA 3C6UA 3U3YA 3I0SA 1EP4A 3RTVA 4ID1A 1LWCA 3CFPA 3V9SA 4M3XA 1RT3A 3QEPA 3HPOA 1VSMA 4M41A 1TAUA 3A2FA 3OJUA 3V9WA 4BACA 3AVKA 3AVMA 1IKYA 5HRPA 5JS1A 3TI0A 3HYFA 2G8KA 4FLYA 3QEXA 4CJSA 3L3UA 1TL3A 2ZD1A 4K8ZA 4CFBA 2A1SA 1GOCA 2KFZA 3OYBA 4CJUA 4W5OA 5KGXA 1RT1A 3LP2A 3OYDA 4E7HA 2XO7A 1Q9YA 4CJPA 3CM6A 2B5JA 5FRNA 3KLHA 1RBTA 4FLWA 4CHOA 1VSKA 1JLEA 4CK1A 5CYQA 4HCCA 4CGFA 2XY8A 3EZ5A 3KJVA 4CGJA 3ZSRA 2QKBA 3QIPA 4EZ6A 5J2PA 4FJKA 4CIGA 4CJWA 3KTQA 4DWIA 4Q5VA 1JLBA 3QESA 3TAQA 4OLBA 3SJJA 4M3TA 5FDLA 1RBSA 4KB1A 3HL8A 1IG9A 3L8BA 2G8HA 4DSJA 1QSSA 1C1CA 4FYDA 3VQ8A 1NK6A 4PQUA 1HYSA 1T05A 3AO3A 1QHTA 3S9HA 5HBMA 3SI6A 4HCBA 3C94A 3K58A 1RCHA 1KVBA 4M3UA 4CHYA 4FCYA 2ITGA 4I9QA 1L3VA 4OLAA 4Z4IA 2YHAA 4Z4CA 3SUQA 4ZTJA 1C6VA 1XWLA 1S9EA 2D5RA 3NF9A 5HRNA 3AVLA 1ZYQA 3PV8A 4BDPA 3ZSXA 3LWLA 3FFIA 4FJMA 3M8QA 3CG7A 4FLXA 1SUQA 1BIUA 3AVJA 2XRIA 4B08A 1ZBFA 2ZE2A 1HPZA 4BWJA 1VSDA 3TAFA 2Y1JA 2OZSA 4F3TA 4CK2A 2HHVA 2P51A 4CHQA 2GV9A 3RR8A 3MEDA 1EXQA 3OS1A 4FM1A 1GOBA 2XY7A 4FJ8A 1X9WA 3VQ7A 1NK4A 1LWFA 2DY4A 3KD5E 1TVRA 4M42A 4F2SA 1RBUA 1TK0A 1RT7A 1L3SA 2PYLA 3KK3A 4CF1A 3VQAA 3V81A 3ZT2A 4B9TA 2YHBA 1B9DA 1ITGA 2WOMA 3AA2A 3MXJA 3PUFA 4CJFA 3OJSA 3TARA 1L3UA 4QAGA 4C8OA 1LAWA 3AA4A 1DLOA 4CEBA 3K59A 3H08A 3AVGA 3C95A 1VSFA 1SL1A 4B9NA 1CZBA 4CHZA 3O3GA 4Z4FA 5FRMA 3AVBA 4NCGA 4DTXA 4IKFA 1X9SA 3VQ4A 2IGIA 2LSNA 4BDZA 4KKOA 4KFBA 3KIOA 1CLQA 3O3HA 5J2NA 3SQ4A 1UA1A 2HB5A 4ZTFA 4CF9A 4FLUA 3QO9A 1WNSA 3ZSVA 3NF6A 3V9UA 1KSPA 2AJQA 1B9FA 3V9XA 4CFCA 1KVCA 1XC9A 3DLGA 4CEDA 4AHCA 2WONA 1VSJA 3TABA 3OYIA 4IFYA 4C8LA 1LW2A 1DTTA 1Q8IA 1VK0A 3VA0A 3ITHA 4CCHA 3JSMA 4KTQA 4Z4GA 4CFAA 1UA0A 1YTUA 3HPGA 3WNFA 2FBYA 3KLEA 3ZT3A 1BI4A 1K6YA 2OPQA 1JLFA 3NFAA 3P5JA 3NE6A 4KHSA 4DTUA 4EZ9A 4AH9A 1FKOA 1NJZA 4BE1A 4CF8A 4NCBA 3AVAA 3LANA 2E6LA 4I9LA 4J2EA 1A5XA 3LAMA 3OVNA 2FBTA 4TSXA 3SV3A 4DTMA 4FLTA 1QSLA 3L2VA 3V9ZA 2ZQBA 4I7FA 1C1AA 3L2UA 4FJGA 3WNHA 3SPZA 3DRRA 2PY5A 1FK9A 4KHYA 3PX6A 3SUOA 1U04A 3WNEA 1YVUA 3QNOA 3ZSOA 3NGIA 4DS5A 4FVMA 3DI6A 3V1QA 3L2QA 1I3AA 4DTJA 5HROA 5HRSA 4BE2A 1U45A 3AVIA 1DTQA 2PYJA 3SPYA 4PY5A 4GVMA 1TKXA 3P1GA 3K5MA 1RDBA 3S3MA 2BDPA 2OPSA 4W5TA 5J2MA 4CFDA 3LALA 4BWMA 3SQ0A 3QLHA 3ZT1A 1U49A 3VQBA 3S3OA 1LW0A 4E7JA 1ASVA 4E1MA 2VWKA 4B8AB 4KAZA 1MU2A 3V6DA 2O4IA 1HYVA 2Z1IA 4M3YA 5C24A 4O0JA 4IG0A 1WN7A 1QTMA 3CYMA 1ZBIA 1A5WA 3K5LA 2FC0A 4LD0A 1N5YA 1JXEA 2B6AA 2VG5A 2G8VA 4FK2A 4Z4EA 4W5QA 2X74A 3D45A 1EKEA 3NH2A 3BDPA 2GBZA 1KCFA 4GMJB 1ASWA 1ASUA 2B4JA 4CK3A 4UQGA 4DTNA 1S1XA 5HRRA 4CJLA 3O4QA 4I2QA 4LSLA 4NYNA 3NH1A 3RRHA 3OYNA 3RMAA 4OKJA 4E0DA 3RMDA 1RT4A 1YTAA 4DS4A 4IFVA 1G15A 4I2PA 3ZT0A 1D9FA 4DSIA 3OYFA 1VRUA 2P1JA 1XI1A 4KI4A 3L3VA 2OPRA 3QEWA 1LAVA 4CERA 1WLJA 2KZZA 2G8UA 4AHUA 1VSEA 2VG6A 3QINA 4OKEA 3QEVA 3AO5A 1HQUA 5CZ2A 2O4GA 4CGIA 4CEOA 4HUGA 4BE0A 1T03A 4DQRA 2XY6A 1Y97A 4J2DA 3IG1A 1W0HA 3VN5A 1IKXA 3F73A 4H4OA 4AHTA 3V4IA 2Z1GA 4LSNA 3SCXA 3M8RA 1RTDA 1JL1A 4FJLA 1WAJA 3SQ2A 3HT3A 4DTPA 2RPIA 1U48A 3NGZA 3M8PA 2RKIA 3I8DA 4C8MA 3WNGA 4KO0A 3MAQA 2RN2A 1EETA 1NOZA 4DU4A 3AO2A 4CJKA 3QNNA 1BCMA 1HQEA 3ZSYA 4K8XA 3SUNA 4CF2A 3PO5A 1O1WA 3NAEA 4DQSA 4DSKA 4ZHRA 2PZSA 1TGOA 3NH0A 4KHUA 4BDYA 4DFPA 3OYCA 3ALYA 2X78A 3KKSA 1IO2A 2HNYA 2X6SA 1T8EA 1CZ9A 4CJTA 1ZBHA 1TKDA 1KLNA 1RT5A 4CHNA 1NK8A 2HHXA 4FXDA 3TAEA 3ZSQA 5HP1A 2KW4A 3KK1A 4FJJA 2BANA 5I3UA 3G0ZA 4FJXA 2F8SA 2IOCA 3K2PA 4M3ZA 1C0TA 3PX0A 4YFUA 2KFNA 5J1EA 4LH5A 4RW8A 1NK7A 4CJEA 1SKSA 4DF8A 4DFJA 3PY8A 3OS2A 3DOLA 3NGYA 4MFBA 4JRQA 5DK5A 2HVIA 2HHWA 1VSHA 4O55A 2NUBA 4DLGA 3TAGA 5D3GA 1VSIA 2X6NA 1NKBA 3ZSWA 1CXUA 4CJ3A 1RNHA 1BHLA 1S1TA 4CJQA 1XHZA 4CJ4A 1HRHA 5JS2A 2XY5A 4RW6A 4E7IA 2HHUA 3VQ9A 3LAKA 2YNIA 5KGWA 2OYQA 3U6FA 4B9MA 4J2BA 1HYZA 4E3SA 1ZBUA 3T1AA 5KRSA 4AHSA 1NK9A 2QK9A 1SL0A 4KRFA 4CEZA 4CF0A 2YNGA 1QSYA 1X1PA 3NHGA 3TR8A 4DMNA 1IKWA 2IS3A 4GW6A 4DSLA 1SKWA 4KHWA 1RTIA 4KTWA 4DG1A 1QQCA 1BIZA 1HJRA 1RT2A 1S5JA 1XHXA 2EHGA 1B92A 1JL2A 2JLEA 5C42A 3OYGA 3DLKA 2G8FA 1A5VA 4CESA 2DFEA 1D9DA 3TANA 2HW3A 3M8SA 1RTHA 3DLBA 4C8KA 2D0BA 3NF8A 3JYTA 5HLFA 4J2AA 1NOYA 4CIEA 4N76A 3IS9A 4JLHA 4PWDA 4CJVA 3CFOA 4M3WA 1J9AA 3LDSA 4B9SA 1HMVA 2BE2A 2YNFA 4F2RA 2W42A 3MXMA 1NJXA 2KZMA 4CHPA 2YKNA 2DFHA 4WE1A 4F3OA 3NBPA 4Q0BA 1Z25A 4JS4A 3ZCMA 3LZIA 1I39A 2Z1HA 4N47A 4LY7A 3O3FA 5EU7A 3PO4A 2DFFA 2FBXA 3DLHA 3EYZA 2FBVA 2F8TA 2VWJA 3CM5A 2HHQA 5DMRA 3LPTA 2IAJA 3KKRA 5FROA 3DRSA 3VQEA 4R5PA 4JS5A 4CJRA 3DLEA 1SL2A 4RG8A 1BGXT 4Y1CA 1WSHA 3MECA 4F4KA 3ZSZA 3HM9A 4FZYA 4KB0A 2YKMA 4OGCA 1J53A 3I0RA 4M45A 1RT6A 1S9GA 1KLMA 1S1WA 3AVHA 2KTQA 1ZBLA 1VRTA 3HJFA 3HVRA 4FLZA 3DOKA 3G10A 4E7LA 4OPKA 1Q9XA 3UIQA 4XIUA 2GUIA 4AILC 2P5GA 4CE9A 3VQPA 1JLAA 1TV6A 4B8CA 1QS4A 3OS0A 1TKZA 3TAPA 4FJ5A 2HHTA 1TK8A 1R0AA 3AA5X 1U47A 3MEEA 4CGDA 2ETJA 3DLRA 4QCLA 3BGRA 1UWBA 3DM2A 2HVHA 1W9HA 1F21A 5K14A 3OYJA 4DTSA 3OY9A 5SZTA 3C6TA 3HP6A 2A1RA 1NK0A 1NJWA 1QE1A 1KFDA 3CQ8A 3T19A 4W5NA 2Y1IA 4FLVA 1KVAA 4IDKA 3OYAA 4F8RA 3RMCA 3E01A 3OYHA 4NCAA 4KHNA 3AV9A 2G8WA 1TL1A 3SYZA 1BL3A 4OVLA 1UAXA 4CGGA 4DQIA 1S1UA 3D0PA 3HO1A 4KI6A 4KHQA 4QOZB 4DSFA 3SZ2A 4HHTA 3TAMA 1C1BA 3CFRA 4B3OA 2R7YA 4FJHA 2OZMA 3LP0A 1C0UA
chains in the Genus database with same CATH superfamily
3HPHA 3EY1A 2FF6A 5CZ1A 2DTUA 1KRPA 5AQFA 3DRPA 1TK5A 4KBOA 1BCOA 5CY4A 3P4IA 1NKEA 3VTHA 4YHHK 3IAYA 4ELTA 3HSTB 3D7EO 5CR4A 3FZLA 1YI2N 4B9UA 2E5LK 3OYKA 4PA1A 3F9KA 4H0TB 4H5TA 4BC3A 1WSFA 4CEEA 2QA4N 4JK9A 5BPMA 3QEIA 4BRAA 5M1OA 1WUAA 4AHVA 4N41A 4OKKA 1HNZK 2P9PB 4CGHA 2Z1JA 5KQ8A 4AHRA 1FXXA 3PIPL 1U2VB 3D2EB 3P83D 2NNWA 4FPAA 1KFSA 3RMBA 4HUFA 1EX4A 1HUXA 2V7ZA 3FLCO 2ATQA 4B9VA 4CJ5A 1Q81O 2HBJA 1RBRA 5KI6A 3LZJA 5FPEA 2HHSA 1BA0A 1NGEA 4MLEA 4DFMA 1QQOA 2OPPA 3NDKA 2G8IA 5E41A 4W5RA 5I42A 2HNZA 3AA3A 3O5BA 1WAFA 4ISGA 3U3GA 1MA9B 4IOAL 1S6QA 2KZMA 1TAQA 1K8AO 4H03B 3I55N 3OA9A 1L5UA 3ULDA 3D2FB 4M3RA 3FZFA 5A2QO 3KK2A 4ELVA 3EKSA 1NKCA 4F9OA 5C25A 2QXFA 4DU1A 1J6ZA 3PX4A 3M5RA 1D5AA 2HNDA 3KD1E 1RBVA 5AQRA 1GLBG 5M1NA 1ESVA 1RDDA 3VQDA 4PUOA 3C6UA 3ID8A 3I0SA 3RTVA 4R79A 4ID1A 1NGJA 1LWCA 1VSMA 3CCSN 4M41A 3A2FA 3OJUA 3V9WA 5JS1A 3AVMA 3WEEA 3CC7N 4JK7A 4Z94A 3O8MA 4CFBA 3THYB 1GOCA 4CJUA 1RT1A 4CZIA 1CZAN 3DLLL 3OYDA 3O1WA 3VESA 4B3SK 2QWLA 4WQ5A 5FRNA 2B5JA 4FLWA 4CHOA 4X62K 3F5TA 5AQSA 2XY8A 4V19S 4BC4A 3GDQA 3QIPA 4MLHA 3O6WA 4FJKA 4Q5VA 1IBKK 3QESA 4M3TA 4M63C 5FDLA 1RBSA 3VETA 2UUAK 3P39A 3L8BA 1C1CA 4DKWA 4FYDA 1HYSA 4FWLA 5JICA 2CH6A 3G71N 3K58A 1RCHA 2ZWHA 4FCYA 2ITGA 5AQNA 4OLAA 3ATUA 1C6VA 2D5RA 1S9EA 2WC9A 3ENOA 2P9UB 3EO3A 3CHWA 3PV8A 2OTJN 3K9KA 3FFIA 4FJMA 3L4QA 3M8QA 3EEQA 3AVJA 1ZBFA 1HPZA 5BREA 1VSDA 1N32K 4DV4K 4CHQA 2GV9A 4DV3K 3KD5E 1TVRA 1L3SA 2P9NB 2QXLA 4JKHA 4BGAA 2YHBA 3CQXA 3MXJA 1L3UA 2BTFA 4QAGA 1LAWA 2A6AA 1OH5A 1VSFA 5HOOA 1XC3A 3O3GA 4BY9C 4NCGA 1UA1A 4ZTFA 3QO9A 3ZSVA 3NF6A 2A42A 4CZLA 4YDUA 3CF5L 3V9UA 1B9FA 3DLGA 2RHKA 4CZHA 2QWOA 1VSJA 5B8HA 1LW2A 4DR6K 2NRHA 3P31A 2P9UA 4IJAA 3JSMA 4MO5A 1UA0A 3WNFA 2FBYA 1K6YA 3NFAA 3P5JA 1I94K 1GLJO 4DTUA 4CF8A 4IEIA 1OVQA 3C65A 3ZETA 3OVNA 1QSLA 1J5EK 3L2UA 3E9LA 3DRRA 3O9SA 3O9QA 3WNEA 4BRKA 4B3RK 2P9NA 1W97L 4DTJA 1OH7A 1DTQA 4PY5A 3M3ZA 5LJWA 4W5TA 5J2MA 1NGCA 4E7JA 4DR1K 4AQYK 1ASVA 3IKMA 4E1MA 3GE1A 3MX5A 3L4IA 1MU2A 2O4IA 5KQDA 4O0JA 2P9LB 4IG0A 3OW2M 1ZBIA 4Z4EA 1N5YA 1JXEA 2VG5A 2GUPA 4DR5K 4LF6K 1M1KO 3BDPA 5EOYA 3CJBA 2O8DB 5HRRA 4NYNA 3RRHA 1VHXA 4OKJA 2FSNA 4U7BA 4I2PA 3SAGA 3J7ZO 3A8YA 3L3VA 1IV0A 4BRMA 1VSEA 3QEVA 2WBNA 4CEOA 4DQRA 4B1UB 3CC4N 3IG1A 1IKXA 4HTLA 3CCMN 4O8KA 3HBTA 3AGKA 3HRGA 4LSNA 2WUSA 4WFBL 3HT3A 1U48A 2RPIA 2RKIA 5AQLA 5AQWA 3QNNA 2F8TA 2KZZA 1X9JA 4CF2A 3NAEA 2E88A 4DSKA 3GOIA 4BDYA 4WCEL 2ASPA 1IO2A 2HNYA 2X6SA 4CJTA 4CHNA 3L6QA 4GKKK 4FXDA 5HP1A 2KW4A 4FJJA 3G0ZA 2IOCA 3PX0A 4YFUA 3WXJA 4BROA 3PY8A 4DFJA 3CETA 3OS2A 3NGYA 2F9WA 1VSHA 4O55A 4JI8K 2X6NA 4H0YB 3LDQA 1ATNA 1S1TA 3FE1A 4JI3K 3UKUB 4CZEA 1QHAA 1XNQK 2HHUA 1GLFO 3LAKA 1NNEA 2YNIA 5C12A 4CD1A 1C0GA 1HYZA 1NK9A 4AHSA 4CEZA 1QSYA 4H0PA 1X1PA 3TTDA 1YUWA 2IS3A 4DSLA 1V4TA 1QQCA 1XHXA 4FM0A 3OYGA 1BU6O 1B92A 5C42A 4CESA 2I7NA 2GELA 2O8CA 5EXWA 5AQUA 3JYTA 2P9IB 3J8AA 4Y0WA 2GTDA 5HLFA 4J2AA 1KD1O 3VMFB 4PWDA 1J9AA 1OH6A 2BE2A 3CIPA 4KH4A 4DHYA 4EHTA 1NGHA 3MXMA 2Q2RA 3NBPA 4Q0BA 4IFEA 3LZIA 3O3FA 3PO4A 1D4XA 2FBXA 4A62A 3EYZA 3BEXA 2A40A 1GLCG 4FO0A 5FROA 3DRSA 3ID6A 4JS5A 1SL2A 2GX9A 1BGXT 1WSHA 1SS6A 4F4KA 3ZSZA 3HM9A 3AY9A 1VQKN 4GKJK 2UXBK 2KTQA 2FLOA 4YOTA 3HJFA 3HVRA 4FLZA 3QBWA 4FWSA 5H1SQ 4IO8A 4B8CA 3OS0A 2FF3B 3CPEA 2HHTA 2O8CB 4CGDA 4J8FA 2P9IA 4DUZK 4X66K 4IJNA 3DM2A 2O8BB 3CJ9A 5C15A 3OYJA 4DV0K 5SZTA 3A5OC 3RVCA 4AM7A 3CCQN 4W5NA 3T19A 4NO7A 3MCAB 4FLVA 1R59O 3N4PA 3OYAA 4KHNA 3AV9A 5AZJA 4CGGA 5C10A 4DQIA 4C1NK 1S1UA 4BR2A 3QFPA 3RSEB 5C0YA 4JI6K 4YDUC 4HHTA 1C1BA 1HKCA 2FXUA 4FJHA 4GVEA 2OZMA 1T44A 4DSEA 2A3ZA 1BQNA 1EO1A 4H5RA 2QI2A 4Y1DA 1S22A 4IBNA 1WB9A 4PL8A 1IJJA 2JGUA 2VG7A 3RR7A 4JHDA 1VAZA 3LWMA 4U67L 1Q82O 3SUPA 1SV5A 4KREA 1HNIA 4N56A 2GWJA 1U4BA 3LPUA 4DQPA 1S6PA 2NRWA 1VQ4N 4KV8A 5KPZA 1BISA 1ZC6A 2XHBA 4YOUA 4CBXA 4EIAA 4DR3K 2QWNA 1CXQA 3CD6N 3NVMA 3SV4A 4JRPA 4KPYA 3K5OA 4IO9L 3AO1A 3O9TA 1NJIO 3KLFA 3L2RA 4HWIA 1WSJA 3WT0A 5ADXH 3T3FA 3AO4A 5IT9O 3B6OA 1QVGM 4BC2A 4C8NA 3MEGA 2YHYA 1C0MA 3MXIA 1VQLN 1GLEG 3DYAA 3V6DA 3HP9A 1BI4B 4LFCK 1HNVA 4ICLA 1HX1A 1YVNA 1JXBA 3ZT4A 4JHDB 5LMNK 3R3LA 5FPNA 3RWUA 3HK2A 3J80O 5GIPA 4XH4A 1N6QA 4RW4A 1P8ZA 4CEFA 4JKGB 2HOEA 4O44A 2UUBK 3VQQA 4OPHA 4FW2A 3QERA 1X9MA 2P9SA 3AVFA 4CEAA 4ELUA 3BF1A 1YJ9N 4DQQA 4DR7K 1J54A 4Z0UA 2IC3A 1U2VA 3ISNC 1DKGD 3LP3A 5GIOA 1SQKA 1ZXOA 3U3YA 4H0OA 3V9SA 4M3XA 1QZ6A 3LDPA 5HRPA 3TI0A 4FLYA 1IBMK 3U9DA 5FLXO 4CJSA 2Q1NA 3L3UA 1TL3A 2QWRA 5JMVA 2P9KA 4W5OA 1HNWK 3CM6A 1RBTA 3DXMB 1JLEA 4B3TK 2CH5A 3VF6A 4NXNK 4YOYA 1Z6RA 3KJVA 4ISFA 4CIGA 3KTQA 4OO1J 3CXCM 1KC8O 4DWIA 5LJVA 2V7YA 2VWBA 1IG9A 4DSJA 1QSSA 3Q7BA 4PQUA 3S9HA 5HBMA 3JXUA 3C94A 4JD2B 5GAHP 4M3UA 5AQMA 4Z4IA 4OPAA 1NGBA 1ZYQA 4BDPA 5M1FA 4CZJA 3CG7A 2QM1A 4FLXA 1BIUA 4BWJA 3C7NB 3VGKA 5BN8A 3RR8A 4FM1A 5AQTA 4FJ8A 1X9WA 1NK4A 2OCEA 2DY4A 4MDBA 2RE2A 3DXMA 1XUPO 4F2SA 1RBUA 1TK0A 3AAPA 3KK3A 1YJNN 3ZYYX 4B9TA 1B9DA 3FZMA 1K73O 1RDUA 5LMUK 3AA4A 1DLOA 3K59A 1SL1A 3AVGA 4GV9A 4CHZA 3D6RA 3U4LA 1E4GT 1X9SA 3VQ4A 2IGIA 2HF4A 3KIOA 2HB5A 5GINA 1WNSA 1KSPA 4RWTA 2ZF5O 3LM2A 3V9XA 4CFCA 1NWKA 4AHCA 2A41A 3DAWA 1DTTA 1Q8IA 4Z4GA 3OTOK 4LF5K 1HKBA 2VGNA 3WUHA 3KLEA 3NE6A 4KHSA 4EZ9A 4AH9A 2OANA 1NJZA 4M7YA 3C7NA 2GEMA 2F4VK 2H3GX 3AVAA 1A5XA 4A59A 4DB3A 4DTMA 1Q7YO 4FJGA 1K9MO 1BO5O 4IDHA 3PX6A 3FR0A 3VEOA 3G6EN 5BRDA 4DS5A 3KZBA 3DI6A 4FVMA 3V1QA 3L2QA 1U45A 5AQXA 2PYJA 2HSTA 3SPYA 3P1GA 1RDBA 3S3MA 3CQYA 2BDPA 3MN9A 4CFDA 3LALA 3QLHA 3ZT1A 4FWMA 3UKRB 3CCUN 4I6MA 4JKCA 4M3YA 3TSPA 1QTMA 3VEVA 1A5WA 3BF3A 2FC0A 2G8VA 4LF8K 2IIRA 3F9MA 5TKWA 4W5QA 2VQFK 3NH2A 1OKJA 4H5WA 1KCFA 1ASUA 5KPRA 2E1YA 4UQGA 5E84A 1S1XA 4CJLA 1RT4A 1YTAA 4DS4A 4IFVA 3OBWA 4WFAL 2V52B 1VQ5N 4WFNL 1XI1A 2J4RA 4KI4A 2OPRA 3QEWA 4IZ9A 2G8UA 2PBDA 2OTLN 4AM6A 1HQUA 3HOSA 2XY6A 3KVGA 3VN5A 1U6ZA 3V4IA 3SMSA 2Z1GA 4CJ7A 4FJLA 3A0IX 4DTPA 1Q86O 1MWMA 3VPZA 3NGZA 1Y64A 4C8MA 3WNGA 3AO2A 4BVOA 4JI0K 1BCMA 4K8XA 3SUNA 2P9LA 3PO5A 1NGFA 2NRRA 1O13A 3N4QA 3VGMA 4ZHRA 2PZSA 3NH0A 3ALYA 4GV6A 1S72N 1CZ9A 3AARA 3JS6A 3KHYA 1RT5A 4BR7A 1NK8A 1N36K 4NLBA 2HHXA 2F8SA 2E1ZA 3K2PA 4M3ZA 1C0TA 4BR9A 4JYAK 4PKGA 4LH5A 3NMUA 1SKSA 4DF8A 1DEJA 2VYPA 3IMXA 2UU9K 3CCEN 5DK5A 2NUBA 4JKAA 1EWQA 1RNHA 1BHLA 4K43A 5ELZA 1HRHA 5JS2A 4CVNE 4E7IA 4O5FA 1H1VA 5KGWA 3U6FA 3ZLJA 1ATSA 2YNGA 3NHGA 3TR8A 4B1VA 4DMNA 1IKWA 2KLAA 2PFUA 1RTIA 4KTWA 4DG1A 1HJRA 2AJQA 4YY3K 2JWKA 1D9DA 4A57A 1RTHA 3H45C 4C8KA 4KH5A 2D0BA 3NF8A 4YOXA 5JLHA 5AQZA 3IS9A 4JLHA 4JI1K 4YOVA 4CJVA 3CFOA 1QZ5A 1VQNN 2YNFA 2HBKA 4F2RA 2W42A 3VEYA 4FVUA 2DFHA 1Z25A 3QFUA 4IXCA 4JS4A 2F7TA 4IOCL 2DFFA 3R8EA 3SJHA 1E4FT 3KKRA 3VQEA 4R5PA 3DLEA 5JVHL 3I0RA 4PL7A 1RT6A 3WEEB 2IVOA 4IOXA 3QICA 3QB0A 3ZX2A 2WFBA 4OPKA 3WXMB 5MLCQ 4XIUA 3UIQA 4AILC 1JLAA 2AP1A 4MO4A 4JEPA 1Z05A 4EFHA 3TAPA 4BQLA 1TK8A 1U47A 2ETJA 4QCLA 3UB5A 1WBBA 1T6CA 1W9HA 3O9RA 2HVHA 1F21A 4DTSA 2D1KA 2NLXA 3R1XA 4FWOA 3C6TA 5F2RA 3HTVA 1QE1A 3K9JA 3CQ8A 3R9PA 1KVAA 4IDKA 4F8RA 2O8FB 3OYHA 1TL1A 3SYZA 1BL3A 1UAXA 3D0PA 2QWMA 1JCEA 3HO1A 3O80A 4KHQA 4DSFA 3GBTA 5BN9A 3CFRA 1C0UA 3THWA 3QIOA 4A5AA 5T7BA 3UE5A 1YHQN 2RF2A 1IG8A 2YV0X 3DMJA 3MN7A 3VQ5A 5AQQA 3VTIA 4DF4A 4H5NA 4FW1A 3THVA 2D0AA 1NBWA 5AFUH 1YXQA 4N5SA 4X65K 4E7KA 1JLQA 4FJ7A 4B1WB 1KAZA 1YF5L 4E89A 1NGIA 3P38A 4CIFA 2D0CA 3M6GA 3ZX3A 3V1RA 4FJNA 3HVTA 3MN5A 2YCHA 4HUEA 2CGJA 4O8UA 5F1XA 4CZMA 1K8KA 3O4NA 4FZXC 1RDCA 1GLAG 3ASMA 2HMIA 3DXKB 1L3TA 3EE9A 1TUYA 4LH4A 4B9LA 1XMQK 1MWKA 1NGGA 4FK4A 1IH7A 1KTQA 1TKTA 3CPWM 2QWPA 2BH1A 3NF7A 4DFKA 2EX3A 3B6PA 1RDAA 1NMDA 3THWB 3VF4A 4BRLA 2YJEA 5TKYA 5AQIA 4O0IA 3IRXA 1GOAA 4IG3A 5CYMA 3K57A 3TTCA 5ADXA 3KLGA 2E6MA 1HPMA 4A2BA 3QETA 4O4GA 2YNHA 4CECA 4DTRA 4HTUA 4NXMK 5EX5A 4K25A 3SAFA 1S1VA 3KLIA 3SNNA 4BQZA 1JKHA 1WSIA 4CEQA 1RTJA 4B3MK 4DLEA 3C0BA 3MK6A 3HXMA 1SKRA 1VSLA 4DV2K 1JLGA 2NZTA 4BRIA 3MN6A 2V51B 3LDLA 4OGEA 1LV5A 1VQ7N 4FK0A 4RW9A 4RW7A 3THXA 4A5BA 4B9QA 1X3NA 5J2QA 1TUUA 2F96A 3CCJN 1EP4A 4A61A 3CFPA 3EZWA 3HM8A 3HPOA 4BRNA 3OHRA 3H3OB 1TAUA 1YITN 4BACA 3AVKA 1IBLK 2G8KA 2NRXA 4PKIA 3QEXA 4JI7K 1OH8A 4DUYK 4QS8A 2A1SA 5C2DA 2KFZA 2Q31A 4E7HA 2W40A 2XO7A 4BVPA 2YJFA 3KLHA 2NRVA 1ILYA 4HCCA 4CGFA 3EZ5A 5FPDA 2QKBA 1N33K 4K42A 4RCHA 4CJWA 1JLBA 3TAQA 4OLBA 3SJJA 5IWAK 5EY4A 2G8HA 1EQYA 3VQ8A 1NK6A 1XMOK 1T05A 1QHTA 4XH1A 1WBDA 3SI6A 4X64K 4HCBA 4ISEA 1KVBA 4UY8O 4CBWA 1L3VA 2YHAA 4Z4CA 1W7AA 3SUQA 4ZTJA 1XWLA 5BPLA 3NF9A 2W41A 5GAEP 2F9TA 1VQON 4B08A 4F3TA 2ZE2A 2Y1JA 5BR9A 3ATVA 4CK2A 2P51A 3TSUA 1EXQA 2XY7A 1LWFA 3BUZB 1ATRA 3PSIA 1RT7A 2GWKA 2PYLA 4KH6A 1JJ2M 3E9OA 3ENHA 3VEXA 5AZIB 3L0QA 1ITGA 2WOMA 3PUFA 3AA2A 4CJFA 4BC5A 3VEZA 1LOTB 3UKUA 4CEBA 3H08A 4GY2B 4LC9B 1CZBA 3WQUA 4JI2K 4DTXA 2ZGZA 4IKFA 1RDWX 2LSNA 4KFBA 1CLQA 5J2NA 3G25A 4BRGA 3MWPA 3CCRN 4JD2A 1KVCA 1XC9A 2YHWA 2WONA 4IFYA 4CZFA 3VA0A 3ITHA 4CCHA 4A2AA 1YTUA 5AJ3K 1BI4A 3I56N 5M1KA 4FWRA 3T1YK 4BE1A 4NCBA 4DR2K 2E6LA 4I9LA 4J2EA 3LAMA 3SV3A 1BDGA 1T3VA 2ZQBA 4I7FA 3T69A 4JV5K 1KQSM 3PIOL 2KHOA 2HF3A 1YVUA 3QNOA 5AQVA 3NGIA 5HROA 4BE2A 3LL3A 3K5MA 2OPSA 3WXKA 4B1YB 4BWMA 2UXDK 1U49A 3R6MA 3VQBA 1NGAA 3S3OA 3O08A 4KAZA 2WTUA 1HYVA 2Z1IA 3LDOA 5C24A 4DV7K 3H3NO 3CYMA 3SK3A 3K5LA 3FGUA 4LD0A 2B6AA 4YOWA 4FK2A 2X74A 3D45A 3SBTA 1NGDA 2GBZA 4GMJB 1KAYA 2VQEK 4DTNA 3O4QA 2KKZA 4DSIA 4PKHA 1LAVA 1NLVA 1WLJA 4CERA 4AHUA 3E66A 3QINA 1KXPA 3AO5A 5CZ2A 1NG9A 4HUGA 3I8BA 1OVYA 4BE0A 3SBGA 3IDHA 3H1QA 1QQMA 3TU5A 4J2DA 4WF9L 4H4OA 1TYQB 4CBUA 5AQYA 3SCXA 1RGIA 3RSEA 3O9UA 1RTDA 1JL1A 4I6MB 5LL6Z 5AFUA 3M8PA 3I8DA 4C23A 2D0OA 3MAQA 1EETA 4CJKA 3ZSYA 1O1WA 1VQPN 5DM6L 4DQSA 2E2QA 1TGOA 4KHUA 5AQKA 4BRFA 3OYCA 2X78A 3KKSA 3QMLA 1T8EA 2VCPA 1ZBHA 3TAEA 3ZSQA 3KK1A 5I3UA 2ITMA 2KFNA 3PLAA 3E9PA 5J1EA 4EHUA 3DOLA 3VEWA 4MFBA 4DLGA 3TAGA 3A5MC 5D3GA 3ZSWA 3D2EA 1T6DA 4CJ3A 2QEXN 4CJQA 3C6HA 1XHZA 4CJ4A 1TYQA 3CCLN 4RW6A 3TSQA 3VQ9A 5AQJA 3T1AA 5KRSA 4KRFA 3W0LA 2UYTA 1SL0A 4CF0A 4BREA 4KHWA 5I9EB 4JAXA 4OX9K 3CMEN 3DLKA 5KPTA 2HW3A 2DFEA 1YJWN 3M8SA 4LF9K 4JKFA 3DLBA 4AF1A 4CZKA 1DT9A 4N76A 2QTDA 4H5VA 4M3WA 3CCVN 2Q97A 5BRHA 4B9SA 2HBMA 4WE1A 3HZ6A 2CGKA 3ZCMA 4N47A 2UXCK 4JNEA 2FBVA 3CJ1A 2E20A 3WXLA 3I33A 4CJRA 4Y1CA 4FZYA 3CERA 2E2OA 2YKMA 2FSJA 1GLLO 1ZBLA 4LF7K 1QQNA 1VRTA 3G10A 1Q9XA 4BG9A 1TV6A 3J81O 2O8DA 4LF4K 3HOTA 5BR8K 3MEEA 1UWBA 1GLDG 4IEEA 3OY9A 3M1FA 3HP6A 2A1RA 1NK0A 1NJWA 1BOTO 3H1VX 3E01A 4NCAA 2HBLA 4OVLA 2E2NA 1W2BM 2ZJPL 2JWLA 4FOIA 1VQMN 4QOZB 3SZ2A 3TAMA 3LP0A 1XNRK 3JAMO 2QKKA 4H8KA 2P5OA 4HVJA 3L2WA 1REVA 3GG4A 4G1QA 2HHHK 4GV3A 1T7PA 3AVNA 4DV6K 1D8YA 3TWHA 5BPNA 4E19A 4FPBA 4FWNA 2KQ2A 3VQCA 3D2FA 3FZKA 2QW9A 1FKPA 4FJIA 1V4SA 3V1OA 4BRHA 4DCHA 4ILJA 3G4SN 4QS9A 1IKVA 4O5BA 1NJYA 4ID5A 4E1NA 5AQHA 2ZJRL 3H6EA 4Z4HA 3NVKA 2BGGA 2YX6A 4MDAA 4DTOA 3OYLA 3LP1A 4FJ9A 5AR0A 2NRZA 5AQGA 4EP4A 3SQ1A 1N34K 5SWMA 3AVCA 3KWGA 4EP5A 4CD3A 3RRGA 1LCUA 1HLUA 3IUCA 3KWIA 4DV5K 3OYMA 1JLCA 1WOQA 1HR0K 4H4MA 2IVNA 3THYA 3S3NA 5BRFA 2A5XA 5KTQA 4L8RB 3MDQA 4DU3A 4MQ3A 1HJOA 3ZETB 4YNQA 3MCPA 4BRDA 3VQ6A 4FOEA 1Q18A 4FM2A 1J5OA 2IDOA 5EVZA 1Z26A 3ULEB 1BQMA 1YT3A 1RILA 2Q36A 3K5NA 4FZZA 4OPJA 4G9ZA 4OJRA 1NK5A 3EN9A 5M1PA 4KTZA 1WSEA 1UOCA 1E3MA 2E4LA 1LWEA 2I5JA 1G99A 3OYEA 5KRTA 3NCIA 2OA8A 2BUPA 2Q3SA 4NYFA 1HKGA 1WSGA 3MMVA 3VA3A 1RT3A 3QEPA 4E1JA 3U8XA 5GAGP 5DM7L 1IKYA 3HYFA 4JKDA 4K8ZA 2ZD1A 4EAHD 1NU0A 3W3DA 3OYBA 5KGXA 3LP2A 2HMPA 3SAHA 1Q9YA 4CJPA 1VSKA 3FZHA 4CK1A 3VERA 4GNIA 3ULEA 5CYQA 4CGJA 3ZSRA 3A5NC 4EZ6A 5J2PA 3C6AA 3CJAA 2W6KA 1VQ6N 1BWFO 5AQPA 3THXB 4KB1A 3HL8A 1VQ9N 1N8RO 3AO3A 3O4WA 1VQ8N 3AAQA 3AGRA 4CHYA 4I9QA 2IVPA 5HRNA 3VENA 3AVLA 3A5LC 3SMPA 3T1HK 4QS7A 3ZSXA 3LWLA 5AQOA 1SUQA 2XRIA 3TAFA 2HHVA 2OZSA 1XQSC 4XEIA 4ILGB 3MEDA 3BZCA 4BR5A 3OS1A 1S3XA 1GOBA 3VQ7A 5CHIA 4M42A 4WQ4C 2ZJQL 4CF1A 3VQAA 3V81A 2Q0UA 3ZT2A 1K8KB 1KAXA 1JCFA 3OJSA 2EWSA 3TARA 4C8OA 4CI6A 3J7YP 1BA1A 3C95A 4Z4FA 4B9NA 5FRMA 3AVBA 2D4WA 4YORA 4BDZA 2Q0RA 3BY5A 4KKOA 3O3HA 3SQ4A 1DGKN 4CF9A 4FLUA 3MX2A 4CEDA 3TABA 4C8LA 3OYIA 1VK0A 4KTQA 3DWLA 4BR4A 4CFAA 3HPGA 3ZT3A 2OPQA 4JKBA 4BGBA 1JLFA 3TTFA 1FKOA 4WQ4A 3LANA 4DV1K 2FBTA 4TSXA 2O8EA 4FLTA 1ZBSA 2VGMA 3L2VA 3V9ZA 3OBYA 1C1AA 3GL1A 3WNHA 3SPZA 2PY5A 1FK9A 4KHYA 4JKGA 3QBXA 3SUOA 1U04A 1HNXK 1FW6A 3ZSOA 2W6LA 1I3AA 5AZIA 5HRSA 2QWQA 3AVIA 4GVMA 1TKXA 5CE3A 3SQ0A 3EL2A 1LW0A 1X3MA 4BG8A 1JCGA 4NLCA 2VWKA 4B8AB 4C1NI 1WN7A 4WQ5C 1FJGK 4FWQA 3SLCA 3EE8A 3T7ZA 4CZGA 1EKEA 4CK3A 4B1XB 1ASWA 2B4JA 1SZ2A 4BRQA 3NH1A 4I2QA 4LSLA 5JVGL 3OYNA 3RMAA 4BR0A 4E0DA 4DR4K 3RMDA 1D9FA 3CMAN 2P9KB 1G15A 3ZT0A 2AA4A 2O8BA 3OYFA 5C2FA 1VRUA 2O8EB 2P1JA 3ENBA 1BUPA 3HSCA 2VG6A 4OKEA 4JN4A 3EKUA 4JKEA 2O4GA 3E1YA 5E26A 4CGIA 1T03A 2O8FA 1Y97A 5HL7L 1W0HA 5AZJB 3F73A 4AHTA 3ZEUB 2CGLA 3M8RA 2ASOA 1WAJA 3SQ2A 4H0VB 3HI0A 3FFKB 3O1BA 4KO0A 4BRCA 1TKDA 2RN2A 1NOZA 4DU4A 1RFQA 1HQEA 1YAGA 2YI1A 1M90O 4JI4K 5JLFA 3KK7A 3WXIA 4B1ZA 4DFPA 4DQ8A 3VOVA 1KLNA 3IFRA 4PHTX 2BANA 4FJXA 4K41A 2ZGYA 1C0FA 4RW8A 1NK7A 4CJEA 3Q7CA 4M7XA 4JRQA 3DXKA 2HVIA 2HHWA 3K0SA 1VSIA 4RTFD 3H46O 2DPNA 1NKBA 1CXUA 2NRTA 3U9ZA 3ZEUA 3CJCA 2XY5A 3CJ7A 2OYQA 4B9MA 4J2BA 1SAZA 4E3SA 1ZBUA 3DJCA 2QK9A 2ASMA 3CI5A 4FL9A 4GW6A 1SKWA 4LFAK 1BIZA 1RT2A 1S5JA 2EHGA 2JLEA 2G8FA 4JI5K 1JL2A 4FSVA 1A5VA 3TANA 3VF2A 3BP8A 1NOYA 4FWPA 4LFBK 4IWVA 2D0PA 4CIEA 4NB4A 5FPMA 1QVFM 3F2KA 3LDSA 1YIJN 1HMVA 2P9SB 1NJXA 4CHPA 2YKNA 2PAVA 4F3OA 3B8AX 1I39A 2Z1HA 2E2PA 4LY7A 3LM9A 5EU7A 1EWRA 4JK8A 3DLHA 4BRPA 2I7PA 2VWJA 3CM5A 2HHQA 1NM1A 3PSFA 3LPTA 1NMNA 1P90A 2IAJA 4L3QA 5DMRA 3ZX0A 4RG8A 3UKRA 3CC2N 3MECA 4KB0A 3TPQA 4OGCA 1J53A 4M45A 1S9GA 1KLMA 1S1WA 1MDUB 3AVHA 4CW7B 3DOKA 4E7LA 2P5GA 2GUIA 4CE9A 3VQPA 3VGLA 1BG3A 5F0XA 4ILHA 1QS4A 5LY3A 1TKZA 4FJ5A 1R0AA 3AA5X 2E8AA 3S41A 3DLRA 3BGRA 4WYBA 4XH5A 5K14A 3MWTA 1KFDA 2YHXA 2Y1IA 2P9PA 3QDKA 3RMCA 2G8WA 4KHPK 3WQTA 3J7AP 4K0KK 4KI6A 2FSKA 3LDNA 5M1QA 2UUCK 2ZM6K 5GADP 4FWKA 4B3OA 2R7YA 3BZKA 4H0XB
chains in the Genus database with same CATH topology
4DSEA 3HPHA 3EY1A 2QKKA 3QIOA 4H8KA 5CZ1A 2P5OA 5T7BA 2DTUA 1BQNA 2RF2A 1KRPA 4HVJA 2YV0X 1REVA 3DMJA 3DRPA 4Y1DA 3VQ5A 4G1QA 3L2WA 4DF4A 1TK5A 1BCOA 4FW1A 1T7PA 4IBNA 3THVA 5CY4A 2D0AA 1NKEA 4E7KA 4FJ7A 4N5SA 3AVNA 1JLQA 2JGUA 2VG7A 3RR7A 4FM0A 3IAYA 4ELTA 4E89A 1D8YA 3TWHA 3HSTB 4E19A 3LWMA 4B9UA 4CIFA 2D0CA 3SUPA 1SV5A 2KQ2A 4PA1A 3OYKA 3VQCA 3F9KA 1WSFA 3V1RA 4CEEA 4FJNA 3HVTA 4KREA 1FKPA 4FJIA 1HNIA 4N56A 1U4BA 3LPUA 4HUEA 4DQPA 3V1OA 3QEIA 1S6PA 3O4NA 4KV8A 1BISA 4AHVA 1IKVA 4FZXC 4N41A 4OKKA 4O5BA 2XHBA 1NJYA 1RDCA 4ID5A 4E1NA 3ASMA 4CGHA 2HMIA 1L3TA 2Z1JA 4AHRA 4Z4HA 1FXXA 4LH4A 4B9LA 3P83D 1KFSA 2BGGA 1CXQA 3RMBA 4HUFA 1EX4A 1IH7A 4FK4A 3SV4A 1KTQA 4DTOA 1TKTA 3OYLA 3LP1A 3NF7A 4DFKA 4FJ9A 4EP4A 3B6PA 2EX3A 1RDAA 2ATQA 4CJ5A 4JRPA 3SQ1A 3LZJA 1RBRA 5KI6A 5SWMA 3K5OA 4B9VA 4KPYA 3AO1A 3AVCA 2HHSA 4EP5A 3KLFA 3L2RA 3RRGA 4DFMA 1WSJA 3T3FA 3AO4A 2OPPA 3NDKA 3B6OA 3OYMA 2G8IA 4C8NA 3MEGA 5E41A 4W5RA 5I42A 1C0MA 3MXIA 2HNZA 1JLCA 3DYAA 3IRXA 3HP9A 1GOAA 3AA3A 4IG3A 5CYMA 1BI4B 4O0IA 3K57A 1WAFA 4H4MA 3U3GA 1HNVA 4ICLA 3KLGA 2E6MA 3S3NA 1S6QA 5KTQA 1JXBA 1TAQA 4O4GA 3ZT4A 4DU3A 3QETA 3RWUA 4MQ3A 4L8RB 3HK2A 4YNQA 1N6QA 4RW4A 2YNHA 3VQ6A 4CECA 1L5UA 4DTRA 4CEFA 3ULDA 4HTUA 4M3RA 3KK2A 4FM2A 4ELVA 4O44A 1J5OA 1S1VA 2IDOA 1Z26A 3KLIA 3SNNA 1NKCA 3VQQA 3QERA 4FW2A 2QXFA 5C25A 1BQMA 1X9MA 1JKHA 1RILA 1WSIA 1RTJA 1YT3A 4CEQA 4DLEA 3K5NA 3AVFA 3HXMA 1SKRA 1VSLA 4OPJA 4FZZA 4OJRA 4CEAA 1NK5A 4ELUA 4DQQA 1JLGA 1J54A 4KTZA 2IC3A 4Z0UA 4DU1A 1WSEA 1UOCA 4OGEA 1LV5A 4FK0A 2E4LA 1LWEA 2I5JA 3PX4A 3ISNC 4RW9A 1D5AA 2HNDA 4RW7A 5KRTA 1RBVA 3OYEA 3NCIA 3KD1E 2OA8A 2Q3SA 4NYFA 5J2QA 3LP3A 1WSGA 2F96A 1RDDA 3VQDA 3VA3A 4PUOA 3C6UA 3U3YA 3I0SA 1EP4A 3RTVA 4ID1A 1LWCA 3CFPA 3V9SA 4M3XA 1RT3A 3QEPA 3HPOA 1VSMA 4M41A 1TAUA 3A2FA 3OJUA 3V9WA 4BACA 3AVKA 3AVMA 1IKYA 5HRPA 5JS1A 3TI0A 3HYFA 2G8KA 4FLYA 3QEXA 4CJSA 3L3UA 1TL3A 2ZD1A 4K8ZA 4CFBA 2A1SA 1GOCA 2KFZA 3OYBA 4CJUA 4W5OA 5KGXA 1RT1A 3LP2A 3OYDA 4E7HA 2XO7A 1Q9YA 4CJPA 3CM6A 2B5JA 5FRNA 3KLHA 1RBTA 4FLWA 4CHOA 1VSKA 1JLEA 4CK1A 5CYQA 4HCCA 4CGFA 2XY8A 3EZ5A 3KJVA 4CGJA 3ZSRA 2QKBA 3QIPA 4EZ6A 5J2PA 4FJKA 4CIGA 4CJWA 3KTQA 4DWIA 4Q5VA 1JLBA 3QESA 3TAQA 4OLBA 3SJJA 4M3TA 5FDLA 1RBSA 4KB1A 3HL8A 1IG9A 3L8BA 2G8HA 4DSJA 1QSSA 1C1CA 4FYDA 3VQ8A 1NK6A 4PQUA 1HYSA 1T05A 3AO3A 1QHTA 3S9HA 5HBMA 3SI6A 4HCBA 3C94A 3K58A 1RCHA 1KVBA 4M3UA 4CHYA 4FCYA 2ITGA 4I9QA 1L3VA 4OLAA 4Z4IA 2YHAA 4Z4CA 3SUQA 4ZTJA 1C6VA 1XWLA 1S9EA 2D5RA 3NF9A 5HRNA 3AVLA 1ZYQA 3PV8A 4BDPA 3ZSXA 3LWLA 3FFIA 4FJMA 3M8QA 3CG7A 4FLXA 1SUQA 1BIUA 3AVJA 2XRIA 4B08A 1ZBFA 2ZE2A 1HPZA 4BWJA 1VSDA 3TAFA 2Y1JA 2OZSA 4F3TA 4CK2A 2HHVA 2P51A 4CHQA 2GV9A 3RR8A 3MEDA 1EXQA 3OS1A 4FM1A 1GOBA 2XY7A 4FJ8A 1X9WA 3VQ7A 1NK4A 1LWFA 2DY4A 3KD5E 1TVRA 4M42A 4F2SA 1RBUA 1TK0A 1RT7A 1L3SA 2PYLA 3KK3A 4CF1A 3VQAA 3V81A 3ZT2A 4B9TA 2YHBA 1B9DA 1ITGA 2WOMA 3AA2A 3MXJA 3PUFA 4CJFA 3OJSA 3TARA 1L3UA 4QAGA 4C8OA 1LAWA 3AA4A 1DLOA 4CEBA 3K59A 3H08A 3AVGA 3C95A 1VSFA 1SL1A 4B9NA 1CZBA 4CHZA 3O3GA 4Z4FA 5FRMA 3AVBA 4NCGA 4DTXA 4IKFA 1X9SA 3VQ4A 2IGIA 2LSNA 4BDZA 4KKOA 4KFBA 3KIOA 1CLQA 3O3HA 5J2NA 3SQ4A 1UA1A 2HB5A 4ZTFA 4CF9A 4FLUA 3QO9A 1WNSA 3ZSVA 3NF6A 3V9UA 1KSPA 2AJQA 1B9FA 3V9XA 4CFCA 1KVCA 1XC9A 3DLGA 4CEDA 4AHCA 2WONA 1VSJA 3TABA 3OYIA 4IFYA 4C8LA 1LW2A 1DTTA 1Q8IA 1VK0A 3VA0A 3ITHA 4CCHA 3JSMA 4KTQA 4Z4GA 4CFAA 1UA0A 1YTUA 3HPGA 3WNFA 2FBYA 3KLEA 3ZT3A 1BI4A 1K6YA 2OPQA 1JLFA 3NFAA 3P5JA 3NE6A 4KHSA 4DTUA 4EZ9A 4AH9A 1FKOA 1NJZA 4BE1A 4CF8A 4NCBA 3AVAA 3LANA 2E6LA 4I9LA 4J2EA 1A5XA 3LAMA 3OVNA 2FBTA 4TSXA 3SV3A 4DTMA 4FLTA 1QSLA 3L2VA 3V9ZA 2ZQBA 4I7FA 1C1AA 3L2UA 4FJGA 3WNHA 3SPZA 3DRRA 2PY5A 1FK9A 4KHYA 3PX6A 3SUOA 1U04A 3WNEA 1YVUA 3QNOA 3ZSOA 3NGIA 4DS5A 4FVMA 3DI6A 3V1QA 3L2QA 1I3AA 4DTJA 5HROA 5HRSA 4BE2A 1U45A 3AVIA 1DTQA 2PYJA 3SPYA 4PY5A 4GVMA 1TKXA 3P1GA 3K5MA 1RDBA 3S3MA 2BDPA 2OPSA 4W5TA 5J2MA 4CFDA 3LALA 4BWMA 3SQ0A 3QLHA 3ZT1A 1U49A 3VQBA 3S3OA 1LW0A 4E7JA 1ASVA 4E1MA 2VWKA 4B8AB 4KAZA 1MU2A 3V6DA 2O4IA 1HYVA 2Z1IA 4M3YA 5C24A 4O0JA 4IG0A 1WN7A 1QTMA 3CYMA 1ZBIA 1A5WA 3K5LA 2FC0A 4LD0A 1N5YA 1JXEA 2B6AA 2VG5A 2G8VA 4FK2A 4Z4EA 4W5QA 2X74A 3D45A 1EKEA 3NH2A 3BDPA 2GBZA 1KCFA 4GMJB 1ASWA 1ASUA 2B4JA 4CK3A 4UQGA 4DTNA 1S1XA 5HRRA 4CJLA 3O4QA 4I2QA 4LSLA 4NYNA 3NH1A 3RRHA 3OYNA 3RMAA 4OKJA 4E0DA 3RMDA 1RT4A 1YTAA 4DS4A 4IFVA 1G15A 4I2PA 3ZT0A 1D9FA 4DSIA 3OYFA 1VRUA 2P1JA 1XI1A 4KI4A 3L3VA 2OPRA 3QEWA 1LAVA 4CERA 1WLJA 2KZZA 2G8UA 4AHUA 1VSEA 2VG6A 3QINA 4OKEA 3QEVA 3AO5A 1HQUA 5CZ2A 2O4GA 4CGIA 4CEOA 4HUGA 4BE0A 1T03A 4DQRA 2XY6A 1Y97A 4J2DA 3IG1A 1W0HA 3VN5A 1IKXA 3F73A 4H4OA 4AHTA 3V4IA 2Z1GA 4LSNA 3SCXA 3M8RA 1RTDA 1JL1A 4FJLA 1WAJA 3SQ2A 3HT3A 4DTPA 2RPIA 1U48A 3NGZA 3M8PA 2RKIA 3I8DA 4C8MA 3WNGA 4KO0A 3MAQA 2RN2A 1EETA 1NOZA 4DU4A 3AO2A 4CJKA 3QNNA 1BCMA 1HQEA 3ZSYA 4K8XA 3SUNA 4CF2A 3PO5A 1O1WA 3NAEA 4DQSA 4DSKA 4ZHRA 2PZSA 1TGOA 3NH0A 4KHUA 4BDYA 4DFPA 3OYCA 3ALYA 2X78A 3KKSA 1IO2A 2HNYA 2X6SA 1T8EA 1CZ9A 4CJTA 1ZBHA 1TKDA 1KLNA 1RT5A 4CHNA 1NK8A 2HHXA 4FXDA 3TAEA 3ZSQA 5HP1A 2KW4A 3KK1A 4FJJA 2BANA 5I3UA 3G0ZA 4FJXA 2F8SA 2IOCA 3K2PA 4M3ZA 1C0TA 3PX0A 4YFUA 2KFNA 5J1EA 4LH5A 4RW8A 1NK7A 4CJEA 1SKSA 4DF8A 4DFJA 3PY8A 3OS2A 3DOLA 3NGYA 4MFBA 4JRQA 5DK5A 2HVIA 2HHWA 1VSHA 4O55A 2NUBA 4DLGA 3TAGA 5D3GA 1VSIA 2X6NA 1NKBA 3ZSWA 1CXUA 4CJ3A 1RNHA 1BHLA 1S1TA 4CJQA 1XHZA 4CJ4A 1HRHA 5JS2A 2XY5A 4RW6A 4E7IA 2HHUA 3VQ9A 3LAKA 2YNIA 5KGWA 2OYQA 3U6FA 4B9MA 4J2BA 1HYZA 4E3SA 1ZBUA 3T1AA 5KRSA 4AHSA 1NK9A 2QK9A 1SL0A 4KRFA 4CEZA 4CF0A 2YNGA 1QSYA 1X1PA 3NHGA 3TR8A 4DMNA 1IKWA 2IS3A 4GW6A 4DSLA 1SKWA 4KHWA 1RTIA 4KTWA 4DG1A 1QQCA 1BIZA 1HJRA 1RT2A 1S5JA 1XHXA 2EHGA 1B92A 1JL2A 2JLEA 5C42A 3OYGA 3DLKA 2G8FA 1A5VA 4CESA 2DFEA 1D9DA 3TANA 2HW3A 3M8SA 1RTHA 3DLBA 4C8KA 2D0BA 3NF8A 3JYTA 5HLFA 4J2AA 1NOYA 4CIEA 4N76A 3IS9A 4JLHA 4PWDA 4CJVA 3CFOA 4M3WA 1J9AA 3LDSA 4B9SA 1HMVA 2BE2A 2YNFA 4F2RA 2W42A 3MXMA 1NJXA 2KZMA 4CHPA 2YKNA 2DFHA 4WE1A 4F3OA 3NBPA 4Q0BA 1Z25A 4JS4A 3ZCMA 3LZIA 1I39A 2Z1HA 4N47A 4LY7A 3O3FA 5EU7A 3PO4A 2DFFA 2FBXA 3DLHA 3EYZA 2FBVA 2F8TA 2VWJA 3CM5A 2HHQA 5DMRA 3LPTA 2IAJA 3KKRA 5FROA 3DRSA 3VQEA 4R5PA 4JS5A 4CJRA 3DLEA 1SL2A 4RG8A 1BGXT 4Y1CA 1WSHA 3MECA 4F4KA 3ZSZA 3HM9A 4FZYA 4KB0A 2YKMA 4OGCA 1J53A 3I0RA 4M45A 1RT6A 1S9GA 1KLMA 1S1WA 3AVHA 2KTQA 1ZBLA 1VRTA 3HJFA 3HVRA 4FLZA 3DOKA 3G10A 4E7LA 4OPKA 1Q9XA 3UIQA 4XIUA 2GUIA 4AILC 2P5GA 4CE9A 3VQPA 1JLAA 1TV6A 4B8CA 1QS4A 3OS0A 1TKZA 3TAPA 4FJ5A 2HHTA 1TK8A 1R0AA 3AA5X 1U47A 3MEEA 4CGDA 2ETJA 3DLRA 4QCLA 3BGRA 1UWBA 3DM2A 2HVHA 1W9HA 1F21A 5K14A 3OYJA 4DTSA 3OY9A 5SZTA 3C6TA 3HP6A 2A1RA 1NK0A 1NJWA 1QE1A 1KFDA 3CQ8A 3T19A 4W5NA 2Y1IA 4FLVA 1KVAA 4IDKA 3OYAA 4F8RA 3RMCA 3E01A 3OYHA 4NCAA 4KHNA 3AV9A 2G8WA 1TL1A 3SYZA 1BL3A 4OVLA 1UAXA 4CGGA 4DQIA 1S1UA 3D0PA 3HO1A 4KI6A 4KHQA 4QOZB 4DSFA 3SZ2A 4HHTA 3TAMA 1C1BA 3CFRA 4B3OA 2R7YA 4FJHA 2OZMA 3LP0A 1C0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSE A;  3HPH A;  3EY1 A;  2QKK A;  3QIO A;  4H8K A;  5CZ1 A;  2P5O A;  5T7B A;  2DTU A;  1BQN A;  2RF2 A;  1KRP A;  4HVJ A;  2YV0 X;  1REV A;  3DMJ A;  3DRP A;  4Y1D A;  3VQ5 A;  4G1Q A;  3L2W A;  4DF4 A;  1TK5 A;  1BCO A;  4FW1 A;  1T7P A;  4IBN A;  3THV A;  5CY4 A;  2D0A A;  1NKE A;  4E7K A;  4FJ7 A;  4N5S A;  3AVN A;  1JLQ A;  2JGU A;  2VG7 A;  3RR7 A;  4FM0 A;  3IAY A;  4ELT A;  4E89 A;  1D8Y A;  3TWH A;  3HST B;  4E19 A;  3LWM A;  4B9U A;  4CIF A;  2D0C A;  3SUP A;  1SV5 A;  2KQ2 A;  4PA1 A;  3OYK A;  3VQC A;  3F9K A;  1WSF A;  3V1R A;  4CEE A;  4FJN A;  3HVT A;  4KRE A;  1FKP A;  4FJI A;  1HNI A;  4N56 A;  1U4B A;  3LPU A;  4HUE A;  4DQP A;  3V1O A;  3QEI A;  1S6P A;  3O4N A;  4KV8 A;  1BIS A;  4AHV A;  1IKV A;  4FZX C;  4N41 A;  4OKK A;  4O5B A;  2XHB A;  1NJY A;  1RDC A;  4ID5 A;  4E1N A;  3ASM A;  4CGH A;  2HMI A;  1L3T A;  2Z1J A;  4AHR A;  4Z4H A;  1FXX A;  4LH4 A;  4B9L A;  3P83 D;  1KFS A;  2BGG A;  1CXQ A;  3RMB A;  4HUF A;  1EX4 A;  1IH7 A;  4FK4 A;  3SV4 A;  1KTQ A;  4DTO A;  1TKT A;  3OYL A;  3LP1 A;  3NF7 A;  4DFK A;  4FJ9 A;  4EP4 A;  3B6P A;  2EX3 A;  1RDA A;  2ATQ A;  4CJ5 A;  4JRP A;  3SQ1 A;  3LZJ A;  1RBR A;  5KI6 A;  5SWM A;  3K5O A;  4B9V A;  4KPY A;  3AO1 A;  3AVC A;  2HHS A;  4EP5 A;  3KLF A;  3L2R A;  3RRG A;  4DFM A;  1WSJ A;  3T3F A;  3AO4 A;  2OPP A;  3NDK A;  3B6O A;  3OYM A;  2G8I A;  4C8N A;  3MEG A;  5E41 A;  4W5R A;  5I42 A;  1C0M A;  3MXI A;  2HNZ A;  1JLC A;  3DYA A;  3IRX A;  3HP9 A;  1GOA A;  3AA3 A;  4IG3 A;  5CYM A;  1BI4 B;  4O0I A;  3K57 A;  1WAF A;  4H4M A;  3U3G A;  1HNV A;  4ICL A;  3KLG A;  2E6M A;  3S3N A;  1S6Q A;  5KTQ A;  1JXB A;  1TAQ A;  4O4G A;  3ZT4 A;  4DU3 A;  3QET A;  3RWU A;  4MQ3 A;  4L8R B;  3HK2 A;  4YNQ A;  1N6Q A;  4RW4 A;  2YNH A;  3VQ6 A;  4CEC A;  1L5U A;  4DTR A;  4CEF A;  3ULD A;  4HTU A;  4M3R A;  3KK2 A;  4FM2 A;  4ELV A;  4O44 A;  1J5O A;  1S1V A;  2IDO A;  1Z26 A;  3KLI A;  3SNN A;  1NKC A;  3VQQ A;  3QER A;  4FW2 A;  2QXF A;  5C25 A;  1BQM A;  1X9M A;  1JKH A;  1RIL A;  1WSI A;  1RTJ A;  1YT3 A;  4CEQ A;  4DLE A;  3K5N A;  3AVF A;  3HXM A;  1SKR A;  1VSL A;  4OPJ A;  4FZZ A;  4OJR A;  4CEA A;  1NK5 A;  4ELU A;  4DQQ A;  1JLG A;  1J54 A;  4KTZ A;  2IC3 A;  4Z0U A;  4DU1 A;  1WSE A;  1UOC A;  4OGE A;  1LV5 A;  4FK0 A;  2E4L A;  1LWE A;  2I5J A;  3PX4 A;  3ISN C;  4RW9 A;  1D5A A;  2HND A;  4RW7 A;  5KRT A;  1RBV A;  3OYE A;  3NCI A;  3KD1 E;  2OA8 A;  2Q3S A;  4NYF A;  5J2Q A;  3LP3 A;  1WSG A;  2F96 A;  1RDD A;  3VQD A;  3VA3 A;  4PUO A;  3C6U A;  3U3Y A;  3I0S A;  1EP4 A;  3RTV A;  4ID1 A;  1LWC A;  3CFP A;  3V9S A;  4M3X A;  1RT3 A;  3QEP A;  3HPO A;  1VSM A;  4M41 A;  1TAU A;  3A2F A;  3OJU A;  3V9W A;  4BAC A;  3AVK A;  3AVM A;  1IKY A;  5HRP A;  5JS1 A;  3TI0 A;  3HYF A;  2G8K A;  4FLY A;  3QEX A;  4CJS A;  3L3U A;  1TL3 A;  2ZD1 A;  4K8Z A;  4CFB A;  2A1S A;  1GOC A;  2KFZ A;  3OYB A;  4CJU A;  4W5O A;  5KGX A;  1RT1 A;  3LP2 A;  3OYD A;  4E7H A;  2XO7 A;  1Q9Y A;  4CJP A;  3CM6 A;  2B5J A;  5FRN A;  3KLH A;  1RBT A;  4FLW A;  4CHO A;  1VSK A;  1JLE A;  4CK1 A;  5CYQ A;  4HCC A;  4CGF A;  2XY8 A;  3EZ5 A;  3KJV A;  4CGJ A;  3ZSR A;  2QKB A;  3QIP A;  4EZ6 A;  5J2P A;  4FJK A;  4CIG A;  4CJW A;  3KTQ A;  4DWI A;  4Q5V A;  1JLB A;  3QES A;  3TAQ A;  4OLB A;  3SJJ A;  4M3T A;  5FDL A;  1RBS A;  4KB1 A;  3HL8 A;  1IG9 A;  3L8B A;  2G8H A;  4DSJ A;  1QSS A;  1C1C A;  4FYD A;  3VQ8 A;  1NK6 A;  4PQU A;  1HYS A;  1T05 A;  3AO3 A;  1QHT A;  3S9H A;  5HBM A;  3SI6 A;  4HCB A;  3C94 A;  3K58 A;  1RCH A;  1KVB A;  4M3U A;  4CHY A;  4FCY A;  2ITG A;  4I9Q A;  1L3V A;  4OLA A;  4Z4I A;  2YHA A;  4Z4C A;  3SUQ A;  4ZTJ A;  1C6V A;  1XWL A;  1S9E A;  2D5R A;  3NF9 A;  5HRN A;  3AVL A;  1ZYQ A;  3PV8 A;  4BDP A;  3ZSX A;  3LWL A;  3FFI A;  4FJM A;  3M8Q A;  3CG7 A;  4FLX A;  1SUQ A;  1BIU A;  3AVJ A;  2XRI A;  4B08 A;  1ZBF A;  2ZE2 A;  1HPZ A;  4BWJ A;  1VSD A;  3TAF A;  2Y1J A;  2OZS A;  4F3T A;  4CK2 A;  2HHV A;  2P51 A;  4CHQ A;  2GV9 A;  3RR8 A;  3MED A;  1EXQ A;  3OS1 A;  4FM1 A;  1GOB A;  2XY7 A;  4FJ8 A;  1X9W A;  3VQ7 A;  1NK4 A;  1LWF A;  2DY4 A;  3KD5 E;  1TVR A;  4M42 A;  4F2S A;  1RBU A;  1TK0 A;  1RT7 A;  1L3S A;  2PYL A;  3KK3 A;  4CF1 A;  3VQA A;  3V81 A;  3ZT2 A;  4B9T A;  2YHB A;  1B9D A;  1ITG A;  2WOM A;  3AA2 A;  3MXJ A;  3PUF A;  4CJF A;  3OJS A;  3TAR A;  1L3U A;  4QAG A;  4C8O A;  1LAW A;  3AA4 A;  1DLO A;  4CEB A;  3K59 A;  3H08 A;  3AVG A;  3C95 A;  1VSF A;  1SL1 A;  4B9N A;  1CZB A;  4CHZ A;  3O3G A;  4Z4F A;  5FRM A;  3AVB A;  4NCG A;  4DTX A;  4IKF A;  1X9S A;  3VQ4 A;  2IGI A;  2LSN A;  4BDZ A;  4KKO A;  4KFB A;  3KIO A;  1CLQ A;  3O3H A;  5J2N A;  3SQ4 A;  1UA1 A;  2HB5 A;  4ZTF A;  4CF9 A;  4FLU A;  3QO9 A;  1WNS A;  3ZSV A;  3NF6 A;  3V9U A;  1KSP A;  2AJQ A;  1B9F A;  3V9X A;  4CFC A;  1KVC A;  1XC9 A;  3DLG A;  4CED A;  4AHC A;  2WON A;  1VSJ A;  3TAB A;  3OYI A;  4IFY A;  4C8L A;  1LW2 A;  1DTT A;  1Q8I A;  1VK0 A;  3VA0 A;  3ITH A;  4CCH A;  3JSM A;  4KTQ A;  4Z4G A;  4CFA A;  1UA0 A;  1YTU A;  3HPG A;  3WNF A;  2FBY A;  3KLE A;  3ZT3 A;  1BI4 A;  1K6Y A;  2OPQ A;  1JLF A;  3NFA A;  3P5J A;  3NE6 A;  4KHS A;  4DTU A;  4EZ9 A;  4AH9 A;  1FKO A;  1NJZ A;  4BE1 A;  4CF8 A;  4NCB A;  3AVA A;  3LAN A;  2E6L A;  4I9L A;  4J2E A;  1A5X A;  3LAM A;  3OVN A;  2FBT A;  4TSX A;  3SV3 A;  4DTM A;  4FLT A;  1QSL A;  3L2V A;  3V9Z A;  2ZQB A;  4I7F A;  1C1A A;  3L2U A;  4FJG A;  3WNH A;  3SPZ A;  3DRR A;  2PY5 A;  1FK9 A;  4KHY A;  3PX6 A;  3SUO A;  1U04 A;  3WNE A;  1YVU A;  3QNO A;  3ZSO A;  3NGI A;  4DS5 A;  4FVM A;  3DI6 A;  3V1Q A;  3L2Q A;  1I3A A;  4DTJ A;  5HRO A;  5HRS A;  4BE2 A;  1U45 A;  3AVI A;  1DTQ A;  2PYJ A;  3SPY A;  4PY5 A;  4GVM A;  1TKX A;  3P1G A;  3K5M A;  1RDB A;  3S3M A;  2BDP A;  2OPS A;  4W5T A;  5J2M A;  4CFD A;  3LAL A;  4BWM A;  3SQ0 A;  3QLH A;  3ZT1 A;  1U49 A;  3VQB A;  3S3O A;  1LW0 A;  4E7J A;  1ASV A;  4E1M A;  2VWK A;  4B8A B;  4KAZ A;  1MU2 A;  3V6D A;  2O4I A;  1HYV A;  2Z1I A;  4M3Y A;  5C24 A;  4O0J A;  4IG0 A;  1WN7 A;  1QTM A;  3CYM A;  1ZBI A;  1A5W A;  3K5L A;  2FC0 A;  4LD0 A;  1N5Y A;  1JXE A;  2B6A A;  2VG5 A;  2G8V A;  4FK2 A;  4Z4E A;  4W5Q A;  2X74 A;  3D45 A;  1EKE A;  3NH2 A;  3BDP A;  2GBZ A;  1KCF A;  4GMJ B;  1ASW A;  1ASU A;  2B4J A;  4CK3 A;  4UQG A;  4DTN A;  1S1X A;  5HRR A;  4CJL A;  3O4Q A;  4I2Q A;  4LSL A;  4NYN A;  3NH1 A;  3RRH A;  3OYN A;  3RMA A;  4OKJ A;  4E0D A;  3RMD A;  1RT4 A;  1YTA A;  4DS4 A;  4IFV A;  1G15 A;  4I2P A;  3ZT0 A;  1D9F A;  4DSI A;  3OYF A;  1VRU A;  2P1J A;  1XI1 A;  4KI4 A;  3L3V A;  2OPR A;  3QEW A;  1LAV A;  4CER A;  1WLJ A;  2KZZ A;  2G8U A;  4AHU A;  1VSE A;  2VG6 A;  3QIN A;  4OKE A;  3QEV A;  3AO5 A;  1HQU A;  5CZ2 A;  2O4G A;  4CGI A;  4CEO A;  4HUG A;  4BE0 A;  1T03 A;  4DQR A;  2XY6 A;  1Y97 A;  4J2D A;  3IG1 A;  1W0H A;  3VN5 A;  1IKX A;  3F73 A;  4H4O A;  4AHT A;  3V4I A;  2Z1G A;  4LSN A;  3SCX A;  3M8R A;  1RTD A;  1JL1 A;  4FJL A;  1WAJ A;  3SQ2 A;  3HT3 A;  4DTP A;  2RPI A;  1U48 A;  3NGZ A;  3M8P A;  2RKI A;  3I8D A;  4C8M A;  3WNG A;  4KO0 A;  3MAQ A;  2RN2 A;  1EET A;  1NOZ A;  4DU4 A;  3AO2 A;  4CJK A;  3QNN A;  1BCM A;  1HQE A;  3ZSY A;  4K8X A;  3SUN A;  4CF2 A;  3PO5 A;  1O1W A;  3NAE A;  4DQS A;  4DSK A;  4ZHR A;  2PZS A;  1TGO A;  3NH0 A;  4KHU A;  4BDY A;  4DFP A;  3OYC A;  3ALY A;  2X78 A;  3KKS A;  1IO2 A;  2HNY A;  2X6S A;  1T8E A;  1CZ9 A;  4CJT A;  1ZBH A;  1TKD A;  1KLN A;  1RT5 A;  4CHN A;  1NK8 A;  2HHX A;  4FXD A;  3TAE A;  3ZSQ A;  5HP1 A;  2KW4 A;  3KK1 A;  4FJJ A;  2BAN A;  5I3U A;  3G0Z A;  4FJX A;  2F8S A;  2IOC A;  3K2P A;  4M3Z A;  1C0T A;  3PX0 A;  4YFU A;  2KFN A;  5J1E A;  4LH5 A;  4RW8 A;  1NK7 A;  4CJE A;  1SKS A;  4DF8 A;  4DFJ A;  3PY8 A;  3OS2 A;  3DOL A;  3NGY A;  4MFB A;  4JRQ A;  5DK5 A;  2HVI A;  2HHW A;  1VSH A;  4O55 A;  2NUB A;  4DLG A;  3TAG A;  5D3G A;  1VSI A;  2X6N A;  1NKB A;  3ZSW A;  1CXU A;  4CJ3 A;  1RNH A;  1BHL A;  1S1T A;  4CJQ A;  1XHZ A;  4CJ4 A;  1HRH A;  5JS2 A;  2XY5 A;  4RW6 A;  4E7I A;  2HHU A;  3VQ9 A;  3LAK A;  2YNI A;  5KGW A;  2OYQ A;  3U6F A;  4B9M A;  4J2B A;  1HYZ A;  4E3S A;  1ZBU A;  3T1A A;  5KRS A;  4AHS A;  1NK9 A;  2QK9 A;  1SL0 A;  4KRF A;  4CEZ A;  4CF0 A;  2YNG A;  1QSY A;  1X1P A;  3NHG A;  3TR8 A;  4DMN A;  1IKW A;  2IS3 A;  4GW6 A;  4DSL A;  1SKW A;  4KHW A;  1RTI A;  4KTW A;  4DG1 A;  1QQC A;  1BIZ A;  1HJR A;  1RT2 A;  1S5J A;  1XHX A;  2EHG A;  1B92 A;  1JL2 A;  2JLE A;  5C42 A;  3OYG A;  3DLK A;  2G8F A;  1A5V A;  4CES A;  2DFE A;  1D9D A;  3TAN A;  2HW3 A;  3M8S A;  1RTH A;  3DLB A;  4C8K A;  2D0B A;  3NF8 A;  3JYT A;  5HLF A;  4J2A A;  1NOY A;  4CIE A;  4N76 A;  3IS9 A;  4JLH A;  4PWD A;  4CJV A;  3CFO A;  4M3W A;  1J9A A;  3LDS A;  4B9S A;  1HMV A;  2BE2 A;  2YNF A;  4F2R A;  2W42 A;  3MXM A;  1NJX A;  2KZM A;  4CHP A;  2YKN A;  2DFH A;  4WE1 A;  4F3O A;  3NBP A;  4Q0B A;  1Z25 A;  4JS4 A;  3ZCM A;  3LZI A;  1I39 A;  2Z1H A;  4N47 A;  4LY7 A;  3O3F A;  5EU7 A;  3PO4 A;  2DFF A;  2FBX A;  3DLH A;  3EYZ A;  2FBV A;  2F8T A;  2VWJ A;  3CM5 A;  2HHQ A;  5DMR A;  3LPT A;  2IAJ A;  3KKR A;  5FRO A;  3DRS A;  3VQE A;  4R5P A;  4JS5 A;  4CJR A;  3DLE A;  1SL2 A;  4RG8 A;  1BGX T;  4Y1C A;  1WSH A;  3MEC A;  4F4K A;  3ZSZ A;  3HM9 A;  4FZY A;  4KB0 A;  2YKM A;  4OGC A;  1J53 A;  3I0R A;  4M45 A;  1RT6 A;  1S9G A;  1KLM A;  1S1W A;  3AVH A;  2KTQ A;  1ZBL A;  1VRT A;  3HJF A;  3HVR A;  4FLZ A;  3DOK A;  3G10 A;  4E7L A;  4OPK A;  1Q9X A;  3UIQ A;  4XIU A;  2GUI A;  4AIL C;  2P5G A;  4CE9 A;  3VQP A;  1JLA A;  1TV6 A;  4B8C A;  1QS4 A;  3OS0 A;  1TKZ A;  3TAP A;  4FJ5 A;  2HHT A;  1TK8 A;  1R0A A;  3AA5 X;  1U47 A;  3MEE A;  4CGD A;  2ETJ A;  3DLR A;  4QCL A;  3BGR A;  1UWB A;  3DM2 A;  2HVH A;  1W9H A;  1F21 A;  5K14 A;  3OYJ A;  4DTS A;  3OY9 A;  5SZT A;  3C6T A;  3HP6 A;  2A1R A;  1NK0 A;  1NJW A;  1QE1 A;  1KFD A;  3CQ8 A;  3T19 A;  4W5N A;  2Y1I A;  4FLV A;  1KVA A;  4IDK A;  3OYA A;  4F8R A;  3RMC A;  3E01 A;  3OYH A;  4NCA A;  4KHN A;  3AV9 A;  2G8W A;  1TL1 A;  3SYZ A;  1BL3 A;  4OVL A;  1UAX A;  4CGG A;  4DQI A;  1S1U A;  3D0P A;  3HO1 A;  4KI6 A;  4KHQ A;  4QOZ B;  4DSF A;  3SZ2 A;  4HHT A;  3TAM A;  1C1B A;  3CFR A;  4B3O A;  2R7Y A;  4FJH A;  2OZM A;  3LP0 A;  1C0U A; 
#chains in the Genus database with same CATH topology
 3HPH A;  3EY1 A;  2FF6 A;  5CZ1 A;  2DTU A;  1KRP A;  5AQF A;  3DRP A;  1TK5 A;  4KBO A;  1BCO A;  5CY4 A;  3P4I A;  1NKE A;  3VTH A;  4YHH K;  3IAY A;  4ELT A;  3HST B;  3D7E O;  5CR4 A;  3FZL A;  1YI2 N;  4B9U A;  2E5L K;  3OYK A;  4PA1 A;  3F9K A;  4H0T B;  4H5T A;  4BC3 A;  1WSF A;  4CEE A;  2QA4 N;  4JK9 A;  5BPM A;  3QEI A;  4BRA A;  5M1O A;  1WUA A;  4AHV A;  4N41 A;  4OKK A;  1HNZ K;  2P9P B;  4CGH A;  2Z1J A;  5KQ8 A;  4AHR A;  1FXX A;  3PIP L;  1U2V B;  3D2E B;  3P83 D;  2NNW A;  4FPA A;  1KFS A;  3RMB A;  4HUF A;  1EX4 A;  1HUX A;  2V7Z A;  3FLC O;  2ATQ A;  4B9V A;  4CJ5 A;  1Q81 O;  2HBJ A;  1RBR A;  5KI6 A;  3LZJ A;  5FPE A;  2HHS A;  1BA0 A;  1NGE A;  4MLE A;  4DFM A;  1QQO A;  2OPP A;  3NDK A;  2G8I A;  5E41 A;  4W5R A;  5I42 A;  2HNZ A;  3AA3 A;  3O5B A;  1WAF A;  4ISG A;  3U3G A;  1MA9 B;  4IOA L;  1S6Q A;  2KZM A;  1TAQ A;  1K8A O;  4H03 B;  3I55 N;  3OA9 A;  1L5U A;  3ULD A;  3D2F B;  4M3R A;  3FZF A;  5A2Q O;  3KK2 A;  4ELV A;  3EKS A;  1NKC A;  4F9O A;  5C25 A;  2QXF A;  4DU1 A;  1J6Z A;  3PX4 A;  3M5R A;  1D5A A;  2HND A;  3KD1 E;  1RBV A;  5AQR A;  1GLB G;  5M1N A;  1ESV A;  1RDD A;  3VQD A;  4PUO A;  3C6U A;  3ID8 A;  3I0S A;  3RTV A;  4R79 A;  4ID1 A;  1NGJ A;  1LWC A;  1VSM A;  3CCS N;  4M41 A;  3A2F A;  3OJU A;  3V9W A;  5JS1 A;  3AVM A;  3WEE A;  3CC7 N;  4JK7 A;  4Z94 A;  3O8M A;  4CFB A;  3THY B;  1GOC A;  4CJU A;  1RT1 A;  4CZI A;  1CZA N;  3DLL L;  3OYD A;  3O1W A;  3VES A;  4B3S K;  2QWL A;  4WQ5 A;  5FRN A;  2B5J A;  4FLW A;  4CHO A;  4X62 K;  3F5T A;  5AQS A;  2XY8 A;  4V19 S;  4BC4 A;  3GDQ A;  3QIP A;  4MLH A;  3O6W A;  4FJK A;  4Q5V A;  1IBK K;  3QES A;  4M3T A;  4M63 C;  5FDL A;  1RBS A;  3VET A;  2UUA K;  3P39 A;  3L8B A;  1C1C A;  4DKW A;  4FYD A;  1HYS A;  4FWL A;  5JIC A;  2CH6 A;  3G71 N;  3K58 A;  1RCH A;  2ZWH A;  4FCY A;  2ITG A;  5AQN A;  4OLA A;  3ATU A;  1C6V A;  2D5R A;  1S9E A;  2WC9 A;  3ENO A;  2P9U B;  3EO3 A;  3CHW A;  3PV8 A;  2OTJ N;  3K9K A;  3FFI A;  4FJM A;  3L4Q A;  3M8Q A;  3EEQ A;  3AVJ A;  1ZBF A;  1HPZ A;  5BRE A;  1VSD A;  1N32 K;  4DV4 K;  4CHQ A;  2GV9 A;  4DV3 K;  3KD5 E;  1TVR A;  1L3S A;  2P9N B;  2QXL A;  4JKH A;  4BGA A;  2YHB A;  3CQX A;  3MXJ A;  1L3U A;  2BTF A;  4QAG A;  1LAW A;  2A6A A;  1OH5 A;  1VSF A;  5HOO A;  1XC3 A;  3O3G A;  4BY9 C;  4NCG A;  1UA1 A;  4ZTF A;  3QO9 A;  3ZSV A;  3NF6 A;  2A42 A;  4CZL A;  4YDU A;  3CF5 L;  3V9U A;  1B9F A;  3DLG A;  2RHK A;  4CZH A;  2QWO A;  1VSJ A;  5B8H A;  1LW2 A;  4DR6 K;  2NRH A;  3P31 A;  2P9U A;  4IJA A;  3JSM A;  4MO5 A;  1UA0 A;  3WNF A;  2FBY A;  1K6Y A;  3NFA A;  3P5J A;  1I94 K;  1GLJ O;  4DTU A;  4CF8 A;  4IEI A;  1OVQ A;  3C65 A;  3ZET A;  3OVN A;  1QSL A;  1J5E K;  3L2U A;  3E9L A;  3DRR A;  3O9S A;  3O9Q A;  3WNE A;  4BRK A;  4B3R K;  2P9N A;  1W97 L;  4DTJ A;  1OH7 A;  1DTQ A;  4PY5 A;  3M3Z A;  5LJW A;  4W5T A;  5J2M A;  1NGC A;  4E7J A;  4DR1 K;  4AQY K;  1ASV A;  3IKM A;  4E1M A;  3GE1 A;  3MX5 A;  3L4I A;  1MU2 A;  2O4I A;  5KQD A;  4O0J A;  2P9L B;  4IG0 A;  3OW2 M;  1ZBI A;  4Z4E A;  1N5Y A;  1JXE A;  2VG5 A;  2GUP A;  4DR5 K;  4LF6 K;  1M1K O;  3BDP A;  5EOY A;  3CJB A;  2O8D B;  5HRR A;  4NYN A;  3RRH A;  1VHX A;  4OKJ A;  2FSN A;  4U7B A;  4I2P A;  3SAG A;  3J7Z O;  3A8Y A;  3L3V A;  1IV0 A;  4BRM A;  1VSE A;  3QEV A;  2WBN A;  4CEO A;  4DQR A;  4B1U B;  3CC4 N;  3IG1 A;  1IKX A;  4HTL A;  3CCM N;  4O8K A;  3HBT A;  3AGK A;  3HRG A;  4LSN A;  2WUS A;  4WFB L;  3HT3 A;  1U48 A;  2RPI A;  2RKI A;  5AQL A;  5AQW A;  3QNN A;  2F8T A;  2KZZ A;  1X9J A;  4CF2 A;  3NAE A;  2E88 A;  4DSK A;  3GOI A;  4BDY A;  4WCE L;  2ASP A;  1IO2 A;  2HNY A;  2X6S A;  4CJT A;  4CHN A;  3L6Q A;  4GKK K;  4FXD A;  5HP1 A;  2KW4 A;  4FJJ A;  3G0Z A;  2IOC A;  3PX0 A;  4YFU A;  3WXJ A;  4BRO A;  3PY8 A;  4DFJ A;  3CET A;  3OS2 A;  3NGY A;  2F9W A;  1VSH A;  4O55 A;  4JI8 K;  2X6N A;  4H0Y B;  3LDQ A;  1ATN A;  1S1T A;  3FE1 A;  4JI3 K;  3UKU B;  4CZE A;  1QHA A;  1XNQ K;  2HHU A;  1GLF O;  3LAK A;  1NNE A;  2YNI A;  5C12 A;  4CD1 A;  1C0G A;  1HYZ A;  1NK9 A;  4AHS A;  4CEZ A;  1QSY A;  4H0P A;  1X1P A;  3TTD A;  1YUW A;  2IS3 A;  4DSL A;  1V4T A;  1QQC A;  1XHX A;  4FM0 A;  3OYG A;  1BU6 O;  1B92 A;  5C42 A;  4CES A;  2I7N A;  2GEL A;  2O8C A;  5EXW A;  5AQU A;  3JYT A;  2P9I B;  3J8A A;  4Y0W A;  2GTD A;  5HLF A;  4J2A A;  1KD1 O;  3VMF B;  4PWD A;  1J9A A;  1OH6 A;  2BE2 A;  3CIP A;  4KH4 A;  4DHY A;  4EHT A;  1NGH A;  3MXM A;  2Q2R A;  3NBP A;  4Q0B A;  4IFE A;  3LZI A;  3O3F A;  3PO4 A;  1D4X A;  2FBX A;  4A62 A;  3EYZ A;  3BEX A;  2A40 A;  1GLC G;  4FO0 A;  5FRO A;  3DRS A;  3ID6 A;  4JS5 A;  1SL2 A;  2GX9 A;  1BGX T;  1WSH A;  1SS6 A;  4F4K A;  3ZSZ A;  3HM9 A;  3AY9 A;  1VQK N;  4GKJ K;  2UXB K;  2KTQ A;  2FLO A;  4YOT A;  3HJF A;  3HVR A;  4FLZ A;  3QBW A;  4FWS A;  5H1S Q;  4IO8 A;  4B8C A;  3OS0 A;  2FF3 B;  3CPE A;  2HHT A;  2O8C B;  4CGD A;  4J8F A;  2P9I A;  4DUZ K;  4X66 K;  4IJN A;  3DM2 A;  2O8B B;  3CJ9 A;  5C15 A;  3OYJ A;  4DV0 K;  5SZT A;  3A5O C;  3RVC A;  4AM7 A;  3CCQ N;  4W5N A;  3T19 A;  4NO7 A;  3MCA B;  4FLV A;  1R59 O;  3N4P A;  3OYA A;  4KHN A;  3AV9 A;  5AZJ A;  4CGG A;  5C10 A;  4DQI A;  4C1N K;  1S1U A;  4BR2 A;  3QFP A;  3RSE B;  5C0Y A;  4JI6 K;  4YDU C;  4HHT A;  1C1B A;  1HKC A;  2FXU A;  4FJH A;  4GVE A;  2OZM A;  1T44 A;  4DSE A;  2A3Z A;  1BQN A;  1EO1 A;  4H5R A;  2QI2 A;  4Y1D A;  1S22 A;  4IBN A;  1WB9 A;  4PL8 A;  1IJJ A;  2JGU A;  2VG7 A;  3RR7 A;  4JHD A;  1VAZ A;  3LWM A;  4U67 L;  1Q82 O;  3SUP A;  1SV5 A;  4KRE A;  1HNI A;  4N56 A;  2GWJ A;  1U4B A;  3LPU A;  4DQP A;  1S6P A;  2NRW A;  1VQ4 N;  4KV8 A;  5KPZ A;  1BIS A;  1ZC6 A;  2XHB A;  4YOU A;  4CBX A;  4EIA A;  4DR3 K;  2QWN A;  1CXQ A;  3CD6 N;  3NVM A;  3SV4 A;  4JRP A;  4KPY A;  3K5O A;  4IO9 L;  3AO1 A;  3O9T A;  1NJI O;  3KLF A;  3L2R A;  4HWI A;  1WSJ A;  3WT0 A;  5ADX H;  3T3F A;  3AO4 A;  5IT9 O;  3B6O A;  1QVG M;  4BC2 A;  4C8N A;  3MEG A;  2YHY A;  1C0M A;  3MXI A;  1VQL N;  1GLE G;  3DYA A;  3V6D A;  3HP9 A;  1BI4 B;  4LFC K;  1HNV A;  4ICL A;  1HX1 A;  1YVN A;  1JXB A;  3ZT4 A;  4JHD B;  5LMN K;  3R3L A;  5FPN A;  3RWU A;  3HK2 A;  3J80 O;  5GIP A;  4XH4 A;  1N6Q A;  4RW4 A;  1P8Z A;  4CEF A;  4JKG B;  2HOE A;  4O44 A;  2UUB K;  3VQQ A;  4OPH A;  4FW2 A;  3QER A;  1X9M A;  2P9S A;  3AVF A;  4CEA A;  4ELU A;  3BF1 A;  1YJ9 N;  4DQQ A;  4DR7 K;  1J54 A;  4Z0U A;  2IC3 A;  1U2V A;  3ISN C;  1DKG D;  3LP3 A;  5GIO A;  1SQK A;  1ZXO A;  3U3Y A;  4H0O A;  3V9S A;  4M3X A;  1QZ6 A;  3LDP A;  5HRP A;  3TI0 A;  4FLY A;  1IBM K;  3U9D A;  5FLX O;  4CJS A;  2Q1N A;  3L3U A;  1TL3 A;  2QWR A;  5JMV A;  2P9K A;  4W5O A;  1HNW K;  3CM6 A;  1RBT A;  3DXM B;  1JLE A;  4B3T K;  2CH5 A;  3VF6 A;  4NXN K;  4YOY A;  1Z6R A;  3KJV A;  4ISF A;  4CIG A;  3KTQ A;  4OO1 J;  3CXC M;  1KC8 O;  4DWI A;  5LJV A;  2V7Y A;  2VWB A;  1IG9 A;  4DSJ A;  1QSS A;  3Q7B A;  4PQU A;  3S9H A;  5HBM A;  3JXU A;  3C94 A;  4JD2 B;  5GAH P;  4M3U A;  5AQM A;  4Z4I A;  4OPA A;  1NGB A;  1ZYQ A;  4BDP A;  5M1F A;  4CZJ A;  3CG7 A;  2QM1 A;  4FLX A;  1BIU A;  4BWJ A;  3C7N B;  3VGK A;  5BN8 A;  3RR8 A;  4FM1 A;  5AQT A;  4FJ8 A;  1X9W A;  1NK4 A;  2OCE A;  2DY4 A;  4MDB A;  2RE2 A;  3DXM A;  1XUP O;  4F2S A;  1RBU A;  1TK0 A;  3AAP A;  3KK3 A;  1YJN N;  3ZYY X;  4B9T A;  1B9D A;  3FZM A;  1K73 O;  1RDU A;  5LMU K;  3AA4 A;  1DLO A;  3K59 A;  1SL1 A;  3AVG A;  4GV9 A;  4CHZ A;  3D6R A;  3U4L A;  1E4G T;  1X9S A;  3VQ4 A;  2IGI A;  2HF4 A;  3KIO A;  2HB5 A;  5GIN A;  1WNS A;  1KSP A;  4RWT A;  2ZF5 O;  3LM2 A;  3V9X A;  4CFC A;  1NWK A;  4AHC A;  2A41 A;  3DAW A;  1DTT A;  1Q8I A;  4Z4G A;  3OTO K;  4LF5 K;  1HKB A;  2VGN A;  3WUH A;  3KLE A;  3NE6 A;  4KHS A;  4EZ9 A;  4AH9 A;  2OAN A;  1NJZ A;  4M7Y A;  3C7N A;  2GEM A;  2F4V K;  2H3G X;  3AVA A;  1A5X A;  4A59 A;  4DB3 A;  4DTM A;  1Q7Y O;  4FJG A;  1K9M O;  1BO5 O;  4IDH A;  3PX6 A;  3FR0 A;  3VEO A;  3G6E N;  5BRD A;  4DS5 A;  3KZB A;  3DI6 A;  4FVM A;  3V1Q A;  3L2Q A;  1U45 A;  5AQX A;  2PYJ A;  2HST A;  3SPY A;  3P1G A;  1RDB A;  3S3M A;  3CQY A;  2BDP A;  3MN9 A;  4CFD A;  3LAL A;  3QLH A;  3ZT1 A;  4FWM A;  3UKR B;  3CCU N;  4I6M A;  4JKC A;  4M3Y A;  3TSP A;  1QTM A;  3VEV A;  1A5W A;  3BF3 A;  2FC0 A;  2G8V A;  4LF8 K;  2IIR A;  3F9M A;  5TKW A;  4W5Q A;  2VQF K;  3NH2 A;  1OKJ A;  4H5W A;  1KCF A;  1ASU A;  5KPR A;  2E1Y A;  4UQG A;  5E84 A;  1S1X A;  4CJL A;  1RT4 A;  1YTA A;  4DS4 A;  4IFV A;  3OBW A;  4WFA L;  2V52 B;  1VQ5 N;  4WFN L;  1XI1 A;  2J4R A;  4KI4 A;  2OPR A;  3QEW A;  4IZ9 A;  2G8U A;  2PBD A;  2OTL N;  4AM6 A;  1HQU A;  3HOS A;  2XY6 A;  3KVG A;  3VN5 A;  1U6Z A;  3V4I A;  3SMS A;  2Z1G A;  4CJ7 A;  4FJL A;  3A0I X;  4DTP A;  1Q86 O;  1MWM A;  3VPZ A;  3NGZ A;  1Y64 A;  4C8M A;  3WNG A;  3AO2 A;  4BVO A;  4JI0 K;  1BCM A;  4K8X A;  3SUN A;  2P9L A;  3PO5 A;  1NGF A;  2NRR A;  1O13 A;  3N4Q A;  3VGM A;  4ZHR A;  2PZS A;  3NH0 A;  3ALY A;  4GV6 A;  1S72 N;  1CZ9 A;  3AAR A;  3JS6 A;  3KHY A;  1RT5 A;  4BR7 A;  1NK8 A;  1N36 K;  4NLB A;  2HHX A;  2F8S A;  2E1Z A;  3K2P A;  4M3Z A;  1C0T A;  4BR9 A;  4JYA K;  4PKG A;  4LH5 A;  3NMU A;  1SKS A;  4DF8 A;  1DEJ A;  2VYP A;  3IMX A;  2UU9 K;  3CCE N;  5DK5 A;  2NUB A;  4JKA A;  1EWQ A;  1RNH A;  1BHL A;  4K43 A;  5ELZ A;  1HRH A;  5JS2 A;  4CVN E;  4E7I A;  4O5F A;  1H1V A;  5KGW A;  3U6F A;  3ZLJ A;  1ATS A;  2YNG A;  3NHG A;  3TR8 A;  4B1V A;  4DMN A;  1IKW A;  2KLA A;  2PFU A;  1RTI A;  4KTW A;  4DG1 A;  1HJR A;  2AJQ A;  4YY3 K;  2JWK A;  1D9D A;  4A57 A;  1RTH A;  3H45 C;  4C8K A;  4KH5 A;  2D0B A;  3NF8 A;  4YOX A;  5JLH A;  5AQZ A;  3IS9 A;  4JLH A;  4JI1 K;  4YOV A;  4CJV A;  3CFO A;  1QZ5 A;  1VQN N;  2YNF A;  2HBK A;  4F2R A;  2W42 A;  3VEY A;  4FVU A;  2DFH A;  1Z25 A;  3QFU A;  4IXC A;  4JS4 A;  2F7T A;  4IOC L;  2DFF A;  3R8E A;  3SJH A;  1E4F T;  3KKR A;  3VQE A;  4R5P A;  3DLE A;  5JVH L;  3I0R A;  4PL7 A;  1RT6 A;  3WEE B;  2IVO A;  4IOX A;  3QIC A;  3QB0 A;  3ZX2 A;  2WFB A;  4OPK A;  3WXM B;  5MLC Q;  4XIU A;  3UIQ A;  4AIL C;  1JLA A;  2AP1 A;  4MO4 A;  4JEP A;  1Z05 A;  4EFH A;  3TAP A;  4BQL A;  1TK8 A;  1U47 A;  2ETJ A;  4QCL A;  3UB5 A;  1WBB A;  1T6C A;  1W9H A;  3O9R A;  2HVH A;  1F21 A;  4DTS A;  2D1K A;  2NLX A;  3R1X A;  4FWO A;  3C6T A;  5F2R A;  3HTV A;  1QE1 A;  3K9J A;  3CQ8 A;  3R9P A;  1KVA A;  4IDK A;  4F8R A;  2O8F B;  3OYH A;  1TL1 A;  3SYZ A;  1BL3 A;  1UAX A;  3D0P A;  2QWM A;  1JCE A;  3HO1 A;  3O80 A;  4KHQ A;  4DSF A;  3GBT A;  5BN9 A;  3CFR A;  1C0U A;  3THW A;  3QIO A;  4A5A A;  5T7B A;  3UE5 A;  1YHQ N;  2RF2 A;  1IG8 A;  2YV0 X;  3DMJ A;  3MN7 A;  3VQ5 A;  5AQQ A;  3VTI A;  4DF4 A;  4H5N A;  4FW1 A;  3THV A;  2D0A A;  1NBW A;  5AFU H;  1YXQ A;  4N5S A;  4X65 K;  4E7K A;  1JLQ A;  4FJ7 A;  4B1W B;  1KAZ A;  1YF5 L;  4E89 A;  1NGI A;  3P38 A;  4CIF A;  2D0C A;  3M6G A;  3ZX3 A;  3V1R A;  4FJN A;  3HVT A;  3MN5 A;  2YCH A;  4HUE A;  2CGJ A;  4O8U A;  5F1X A;  4CZM A;  1K8K A;  3O4N A;  4FZX C;  1RDC A;  1GLA G;  3ASM A;  2HMI A;  3DXK B;  1L3T A;  3EE9 A;  1TUY A;  4LH4 A;  4B9L A;  1XMQ K;  1MWK A;  1NGG A;  4FK4 A;  1IH7 A;  1KTQ A;  1TKT A;  3CPW M;  2QWP A;  2BH1 A;  3NF7 A;  4DFK A;  2EX3 A;  3B6P A;  1RDA A;  1NMD A;  3THW B;  3VF4 A;  4BRL A;  2YJE A;  5TKY A;  5AQI A;  4O0I A;  3IRX A;  1GOA A;  4IG3 A;  5CYM A;  3K57 A;  3TTC A;  5ADX A;  3KLG A;  2E6M A;  1HPM A;  4A2B A;  3QET A;  4O4G A;  2YNH A;  4CEC A;  4DTR A;  4HTU A;  4NXM K;  5EX5 A;  4K25 A;  3SAF A;  1S1V A;  3KLI A;  3SNN A;  4BQZ A;  1JKH A;  1WSI A;  4CEQ A;  1RTJ A;  4B3M K;  4DLE A;  3C0B A;  3MK6 A;  3HXM A;  1SKR A;  1VSL A;  4DV2 K;  1JLG A;  2NZT A;  4BRI A;  3MN6 A;  2V51 B;  3LDL A;  4OGE A;  1LV5 A;  1VQ7 N;  4FK0 A;  4RW9 A;  4RW7 A;  3THX A;  4A5B A;  4B9Q A;  1X3N A;  5J2Q A;  1TUU A;  2F96 A;  3CCJ N;  1EP4 A;  4A61 A;  3CFP A;  3EZW A;  3HM8 A;  3HPO A;  4BRN A;  3OHR A;  3H3O B;  1TAU A;  1YIT N;  4BAC A;  3AVK A;  1IBL K;  2G8K A;  2NRX A;  4PKI A;  3QEX A;  4JI7 K;  1OH8 A;  4DUY K;  4QS8 A;  2A1S A;  5C2D A;  2KFZ A;  2Q31 A;  4E7H A;  2W40 A;  2XO7 A;  4BVP A;  2YJF A;  3KLH A;  2NRV A;  1ILY A;  4HCC A;  4CGF A;  3EZ5 A;  5FPD A;  2QKB A;  1N33 K;  4K42 A;  4RCH A;  4CJW A;  1JLB A;  3TAQ A;  4OLB A;  3SJJ A;  5IWA K;  5EY4 A;  2G8H A;  1EQY A;  3VQ8 A;  1NK6 A;  1XMO K;  1T05 A;  1QHT A;  4XH1 A;  1WBD A;  3SI6 A;  4X64 K;  4HCB A;  4ISE A;  1KVB A;  4UY8 O;  4CBW A;  1L3V A;  2YHA A;  4Z4C A;  1W7A A;  3SUQ A;  4ZTJ A;  1XWL A;  5BPL A;  3NF9 A;  2W41 A;  5GAE P;  2F9T A;  1VQO N;  4B08 A;  4F3T A;  2ZE2 A;  2Y1J A;  5BR9 A;  3ATV A;  4CK2 A;  2P51 A;  3TSU A;  1EXQ A;  2XY7 A;  1LWF A;  3BUZ B;  1ATR A;  3PSI A;  1RT7 A;  2GWK A;  2PYL A;  4KH6 A;  1JJ2 M;  3E9O A;  3ENH A;  3VEX A;  5AZI B;  3L0Q A;  1ITG A;  2WOM A;  3PUF A;  3AA2 A;  4CJF A;  4BC5 A;  3VEZ A;  1LOT B;  3UKU A;  4CEB A;  3H08 A;  4GY2 B;  4LC9 B;  1CZB A;  3WQU A;  4JI2 K;  4DTX A;  2ZGZ A;  4IKF A;  1RDW X;  2LSN A;  4KFB A;  1CLQ A;  5J2N A;  3G25 A;  4BRG A;  3MWP A;  3CCR N;  4JD2 A;  1KVC A;  1XC9 A;  2YHW A;  2WON A;  4IFY A;  4CZF A;  3VA0 A;  3ITH A;  4CCH A;  4A2A A;  1YTU A;  5AJ3 K;  1BI4 A;  3I56 N;  5M1K A;  4FWR A;  3T1Y K;  4BE1 A;  4NCB A;  4DR2 K;  2E6L A;  4I9L A;  4J2E A;  3LAM A;  3SV3 A;  1BDG A;  1T3V A;  2ZQB A;  4I7F A;  3T69 A;  4JV5 K;  1KQS M;  3PIO L;  2KHO A;  2HF3 A;  1YVU A;  3QNO A;  5AQV A;  3NGI A;  5HRO A;  4BE2 A;  3LL3 A;  3K5M A;  2OPS A;  3WXK A;  4B1Y B;  4BWM A;  2UXD K;  1U49 A;  3R6M A;  3VQB A;  1NGA A;  3S3O A;  3O08 A;  4KAZ A;  2WTU A;  1HYV A;  2Z1I A;  3LDO A;  5C24 A;  4DV7 K;  3H3N O;  3CYM A;  3SK3 A;  3K5L A;  3FGU A;  4LD0 A;  2B6A A;  4YOW A;  4FK2 A;  2X74 A;  3D45 A;  3SBT A;  1NGD A;  2GBZ A;  4GMJ B;  1KAY A;  2VQE K;  4DTN A;  3O4Q A;  2KKZ A;  4DSI A;  4PKH A;  1LAV A;  1NLV A;  1WLJ A;  4CER A;  4AHU A;  3E66 A;  3QIN A;  1KXP A;  3AO5 A;  5CZ2 A;  1NG9 A;  4HUG A;  3I8B A;  1OVY A;  4BE0 A;  3SBG A;  3IDH A;  3H1Q A;  1QQM A;  3TU5 A;  4J2D A;  4WF9 L;  4H4O A;  1TYQ B;  4CBU A;  5AQY A;  3SCX A;  1RGI A;  3RSE A;  3O9U A;  1RTD A;  1JL1 A;  4I6M B;  5LL6 Z;  5AFU A;  3M8P A;  3I8D A;  4C23 A;  2D0O A;  3MAQ A;  1EET A;  4CJK A;  3ZSY A;  1O1W A;  1VQP N;  5DM6 L;  4DQS A;  2E2Q A;  1TGO A;  4KHU A;  5AQK A;  4BRF A;  3OYC A;  2X78 A;  3KKS A;  3QML A;  1T8E A;  2VCP A;  1ZBH A;  3TAE A;  3ZSQ A;  3KK1 A;  5I3U A;  2ITM A;  2KFN A;  3PLA A;  3E9P A;  5J1E A;  4EHU A;  3DOL A;  3VEW A;  4MFB A;  4DLG A;  3TAG A;  3A5M C;  5D3G A;  3ZSW A;  3D2E A;  1T6D A;  4CJ3 A;  2QEX N;  4CJQ A;  3C6H A;  1XHZ A;  4CJ4 A;  1TYQ A;  3CCL N;  4RW6 A;  3TSQ A;  3VQ9 A;  5AQJ A;  3T1A A;  5KRS A;  4KRF A;  3W0L A;  2UYT A;  1SL0 A;  4CF0 A;  4BRE A;  4KHW A;  5I9E B;  4JAX A;  4OX9 K;  3CME N;  3DLK A;  5KPT A;  2HW3 A;  2DFE A;  1YJW N;  3M8S A;  4LF9 K;  4JKF A;  3DLB A;  4AF1 A;  4CZK A;  1DT9 A;  4N76 A;  2QTD A;  4H5V A;  4M3W A;  3CCV N;  2Q97 A;  5BRH A;  4B9S A;  2HBM A;  4WE1 A;  3HZ6 A;  2CGK A;  3ZCM A;  4N47 A;  2UXC K;  4JNE A;  2FBV A;  3CJ1 A;  2E20 A;  3WXL A;  3I33 A;  4CJR A;  4Y1C A;  4FZY A;  3CER A;  2E2O A;  2YKM A;  2FSJ A;  1GLL O;  1ZBL A;  4LF7 K;  1QQN A;  1VRT A;  3G10 A;  1Q9X A;  4BG9 A;  1TV6 A;  3J81 O;  2O8D A;  4LF4 K;  3HOT A;  5BR8 K;  3MEE A;  1UWB A;  1GLD G;  4IEE A;  3OY9 A;  3M1F A;  3HP6 A;  2A1R A;  1NK0 A;  1NJW A;  1BOT O;  3H1V X;  3E01 A;  4NCA A;  2HBL A;  4OVL A;  2E2N A;  1W2B M;  2ZJP L;  2JWL A;  4FOI A;  1VQM N;  4QOZ B;  3SZ2 A;  3TAM A;  3LP0 A;  1XNR K;  3JAM O;  2QKK A;  4H8K A;  2P5O A;  4HVJ A;  3L2W A;  1REV A;  3GG4 A;  4G1Q A;  2HHH K;  4GV3 A;  1T7P A;  3AVN A;  4DV6 K;  1D8Y A;  3TWH A;  5BPN A;  4E19 A;  4FPB A;  4FWN A;  2KQ2 A;  3VQC A;  3D2F A;  3FZK A;  2QW9 A;  1FKP A;  4FJI A;  1V4S A;  3V1O A;  4BRH A;  4DCH A;  4ILJ A;  3G4S N;  4QS9 A;  1IKV A;  4O5B A;  1NJY A;  4ID5 A;  4E1N A;  5AQH A;  2ZJR L;  3H6E A;  4Z4H A;  3NVK A;  2BGG A;  2YX6 A;  4MDA A;  4DTO A;  3OYL A;  3LP1 A;  4FJ9 A;  5AR0 A;  2NRZ A;  5AQG A;  4EP4 A;  3SQ1 A;  1N34 K;  5SWM A;  3AVC A;  3KWG A;  4EP5 A;  4CD3 A;  3RRG A;  1LCU A;  1HLU A;  3IUC A;  3KWI A;  4DV5 K;  3OYM A;  1JLC A;  1WOQ A;  1HR0 K;  4H4M A;  2IVN A;  3THY A;  3S3N A;  5BRF A;  2A5X A;  5KTQ A;  4L8R B;  3MDQ A;  4DU3 A;  4MQ3 A;  1HJO A;  3ZET B;  4YNQ A;  3MCP A;  4BRD A;  3VQ6 A;  4FOE A;  1Q18 A;  4FM2 A;  1J5O A;  2IDO A;  5EVZ A;  1Z26 A;  3ULE B;  1BQM A;  1YT3 A;  1RIL A;  2Q36 A;  3K5N A;  4FZZ A;  4OPJ A;  4G9Z A;  4OJR A;  1NK5 A;  3EN9 A;  5M1P A;  4KTZ A;  1WSE A;  1UOC A;  1E3M A;  2E4L A;  1LWE A;  2I5J A;  1G99 A;  3OYE A;  5KRT A;  3NCI A;  2OA8 A;  2BUP A;  2Q3S A;  4NYF A;  1HKG A;  1WSG A;  3MMV A;  3VA3 A;  1RT3 A;  3QEP A;  4E1J A;  3U8X A;  5GAG P;  5DM7 L;  1IKY A;  3HYF A;  4JKD A;  4K8Z A;  2ZD1 A;  4EAH D;  1NU0 A;  3W3D A;  3OYB A;  5KGX A;  3LP2 A;  2HMP A;  3SAH A;  1Q9Y A;  4CJP A;  1VSK A;  3FZH A;  4CK1 A;  3VER A;  4GNI A;  3ULE A;  5CYQ A;  4CGJ A;  3ZSR A;  3A5N C;  4EZ6 A;  5J2P A;  3C6A A;  3CJA A;  2W6K A;  1VQ6 N;  1BWF O;  5AQP A;  3THX B;  4KB1 A;  3HL8 A;  1VQ9 N;  1N8R O;  3AO3 A;  3O4W A;  1VQ8 N;  3AAQ A;  3AGR A;  4CHY A;  4I9Q A;  2IVP A;  5HRN A;  3VEN A;  3AVL A;  3A5L C;  3SMP A;  3T1H K;  4QS7 A;  3ZSX A;  3LWL A;  5AQO A;  1SUQ A;  2XRI A;  3TAF A;  2HHV A;  2OZS A;  1XQS C;  4XEI A;  4ILG B;  3MED A;  3BZC A;  4BR5 A;  3OS1 A;  1S3X A;  1GOB A;  3VQ7 A;  5CHI A;  4M42 A;  4WQ4 C;  2ZJQ L;  4CF1 A;  3VQA A;  3V81 A;  2Q0U A;  3ZT2 A;  1K8K B;  1KAX A;  1JCF A;  3OJS A;  2EWS A;  3TAR A;  4C8O A;  4CI6 A;  3J7Y P;  1BA1 A;  3C95 A;  4Z4F A;  4B9N A;  5FRM A;  3AVB A;  2D4W A;  4YOR A;  4BDZ A;  2Q0R A;  3BY5 A;  4KKO A;  3O3H A;  3SQ4 A;  1DGK N;  4CF9 A;  4FLU A;  3MX2 A;  4CED A;  3TAB A;  4C8L A;  3OYI A;  1VK0 A;  4KTQ A;  3DWL A;  4BR4 A;  4CFA A;  3HPG A;  3ZT3 A;  2OPQ A;  4JKB A;  4BGB A;  1JLF A;  3TTF A;  1FKO A;  4WQ4 A;  3LAN A;  4DV1 K;  2FBT A;  4TSX A;  2O8E A;  4FLT A;  1ZBS A;  2VGM A;  3L2V A;  3V9Z A;  3OBY A;  1C1A A;  3GL1 A;  3WNH A;  3SPZ A;  2PY5 A;  1FK9 A;  4KHY A;  4JKG A;  3QBX A;  3SUO A;  1U04 A;  1HNX K;  1FW6 A;  3ZSO A;  2W6L A;  1I3A A;  5AZI A;  5HRS A;  2QWQ A;  3AVI A;  4GVM A;  1TKX A;  5CE3 A;  3SQ0 A;  3EL2 A;  1LW0 A;  1X3M A;  4BG8 A;  1JCG A;  4NLC A;  2VWK A;  4B8A B;  4C1N I;  1WN7 A;  4WQ5 C;  1FJG K;  4FWQ A;  3SLC A;  3EE8 A;  3T7Z A;  4CZG A;  1EKE A;  4CK3 A;  4B1X B;  1ASW A;  2B4J A;  1SZ2 A;  4BRQ A;  3NH1 A;  4I2Q A;  4LSL A;  5JVG L;  3OYN A;  3RMA A;  4BR0 A;  4E0D A;  4DR4 K;  3RMD A;  1D9F A;  3CMA N;  2P9K B;  1G15 A;  3ZT0 A;  2AA4 A;  2O8B A;  3OYF A;  5C2F A;  1VRU A;  2O8E B;  2P1J A;  3ENB A;  1BUP A;  3HSC A;  2VG6 A;  4OKE A;  4JN4 A;  3EKU A;  4JKE A;  2O4G A;  3E1Y A;  5E26 A;  4CGI A;  1T03 A;  2O8F A;  1Y97 A;  5HL7 L;  1W0H A;  5AZJ B;  3F73 A;  4AHT A;  3ZEU B;  2CGL A;  3M8R A;  2ASO A;  1WAJ A;  3SQ2 A;  4H0V B;  3HI0 A;  3FFK B;  3O1B A;  4KO0 A;  4BRC A;  1TKD A;  2RN2 A;  1NOZ A;  4DU4 A;  1RFQ A;  1HQE A;  1YAG A;  2YI1 A;  1M90 O;  4JI4 K;  5JLF A;  3KK7 A;  3WXI A;  4B1Z A;  4DFP A;  4DQ8 A;  3VOV A;  1KLN A;  3IFR A;  4PHT X;  2BAN A;  4FJX A;  4K41 A;  2ZGY A;  1C0F A;  4RW8 A;  1NK7 A;  4CJE A;  3Q7C A;  4M7X A;  4JRQ A;  3DXK A;  2HVI A;  2HHW A;  3K0S A;  1VSI A;  4RTF D;  3H46 O;  2DPN A;  1NKB A;  1CXU A;  2NRT A;  3U9Z A;  3ZEU A;  3CJC A;  2XY5 A;  3CJ7 A;  2OYQ A;  4B9M A;  4J2B A;  1SAZ A;  4E3S A;  1ZBU A;  3DJC A;  2QK9 A;  2ASM A;  3CI5 A;  4FL9 A;  4GW6 A;  1SKW A;  4LFA K;  1BIZ A;  1RT2 A;  1S5J A;  2EHG A;  2JLE A;  2G8F A;  4JI5 K;  1JL2 A;  4FSV A;  1A5V A;  3TAN A;  3VF2 A;  3BP8 A;  1NOY A;  4FWP A;  4LFB K;  4IWV A;  2D0P A;  4CIE A;  4NB4 A;  5FPM A;  1QVF M;  3F2K A;  3LDS A;  1YIJ N;  1HMV A;  2P9S B;  1NJX A;  4CHP A;  2YKN A;  2PAV A;  4F3O A;  3B8A X;  1I39 A;  2Z1H A;  2E2P A;  4LY7 A;  3LM9 A;  5EU7 A;  1EWR A;  4JK8 A;  3DLH A;  4BRP A;  2I7P A;  2VWJ A;  3CM5 A;  2HHQ A;  1NM1 A;  3PSF A;  3LPT A;  1NMN A;  1P90 A;  2IAJ A;  4L3Q A;  5DMR A;  3ZX0 A;  4RG8 A;  3UKR A;  3CC2 N;  3MEC A;  4KB0 A;  3TPQ A;  4OGC A;  1J53 A;  4M45 A;  1S9G A;  1KLM A;  1S1W A;  1MDU B;  3AVH A;  4CW7 B;  3DOK A;  4E7L A;  2P5G A;  2GUI A;  4CE9 A;  3VQP A;  3VGL A;  1BG3 A;  5F0X A;  4ILH A;  1QS4 A;  5LY3 A;  1TKZ A;  4FJ5 A;  1R0A A;  3AA5 X;  2E8A A;  3S41 A;  3DLR A;  3BGR A;  4WYB A;  4XH5 A;  5K14 A;  3MWT A;  1KFD A;  2YHX A;  2Y1I A;  2P9P A;  3QDK A;  3RMC A;  2G8W A;  4KHP K;  3WQT A;  3J7A P;  4K0K K;  4KI6 A;  2FSK A;  3LDN A;  5M1Q A;  2UUC K;  2ZM6 K;  5GAD P;  4FWK A;  4B3O A;  2R7Y A;  3BZK A;  4H0X B; 
#chains in the Genus database with same CATH homology
 4DSE A;  3HPH A;  3EY1 A;  2QKK A;  3QIO A;  4H8K A;  5CZ1 A;  2P5O A;  5T7B A;  2DTU A;  1BQN A;  2RF2 A;  1KRP A;  4HVJ A;  2YV0 X;  1REV A;  3DMJ A;  3DRP A;  4Y1D A;  3VQ5 A;  4G1Q A;  3L2W A;  4DF4 A;  1TK5 A;  1BCO A;  4FW1 A;  1T7P A;  4IBN A;  3THV A;  5CY4 A;  2D0A A;  1NKE A;  4E7K A;  4FJ7 A;  4N5S A;  3AVN A;  1JLQ A;  2JGU A;  2VG7 A;  3RR7 A;  4FM0 A;  3IAY A;  4ELT A;  4E89 A;  1D8Y A;  3TWH A;  3HST B;  4E19 A;  3LWM A;  4B9U A;  4CIF A;  2D0C A;  3SUP A;  1SV5 A;  2KQ2 A;  4PA1 A;  3OYK A;  3VQC A;  3F9K A;  1WSF A;  3V1R A;  4CEE A;  4FJN A;  3HVT A;  4KRE A;  1FKP A;  4FJI A;  1HNI A;  4N56 A;  1U4B A;  3LPU A;  4HUE A;  4DQP A;  3V1O A;  3QEI A;  1S6P A;  3O4N A;  4KV8 A;  1BIS A;  4AHV A;  1IKV A;  4FZX C;  4N41 A;  4OKK A;  4O5B A;  2XHB A;  1NJY A;  1RDC A;  4ID5 A;  4E1N A;  3ASM A;  4CGH A;  2HMI A;  1L3T A;  2Z1J A;  4AHR A;  4Z4H A;  1FXX A;  4LH4 A;  4B9L A;  3P83 D;  1KFS A;  2BGG A;  1CXQ A;  3RMB A;  4HUF A;  1EX4 A;  1IH7 A;  4FK4 A;  3SV4 A;  1KTQ A;  4DTO A;  1TKT A;  3OYL A;  3LP1 A;  3NF7 A;  4DFK A;  4FJ9 A;  4EP4 A;  3B6P A;  2EX3 A;  1RDA A;  2ATQ A;  4CJ5 A;  4JRP A;  3SQ1 A;  3LZJ A;  1RBR A;  5KI6 A;  5SWM A;  3K5O A;  4B9V A;  4KPY A;  3AO1 A;  3AVC A;  2HHS A;  4EP5 A;  3KLF A;  3L2R A;  3RRG A;  4DFM A;  1WSJ A;  3T3F A;  3AO4 A;  2OPP A;  3NDK A;  3B6O A;  3OYM A;  2G8I A;  4C8N A;  3MEG A;  5E41 A;  4W5R A;  5I42 A;  1C0M A;  3MXI A;  2HNZ A;  1JLC A;  3DYA A;  3IRX A;  3HP9 A;  1GOA A;  3AA3 A;  4IG3 A;  5CYM A;  1BI4 B;  4O0I A;  3K57 A;  1WAF A;  4H4M A;  3U3G A;  1HNV A;  4ICL A;  3KLG A;  2E6M A;  3S3N A;  1S6Q A;  5KTQ A;  1JXB A;  1TAQ A;  4O4G A;  3ZT4 A;  4DU3 A;  3QET A;  3RWU A;  4MQ3 A;  4L8R B;  3HK2 A;  4YNQ A;  1N6Q A;  4RW4 A;  2YNH A;  3VQ6 A;  4CEC A;  1L5U A;  4DTR A;  4CEF A;  3ULD A;  4HTU A;  4M3R A;  3KK2 A;  4FM2 A;  4ELV A;  4O44 A;  1J5O A;  1S1V A;  2IDO A;  1Z26 A;  3KLI A;  3SNN A;  1NKC A;  3VQQ A;  3QER A;  4FW2 A;  2QXF A;  5C25 A;  1BQM A;  1X9M A;  1JKH A;  1RIL A;  1WSI A;  1RTJ A;  1YT3 A;  4CEQ A;  4DLE A;  3K5N A;  3AVF A;  3HXM A;  1SKR A;  1VSL A;  4OPJ A;  4FZZ A;  4OJR A;  4CEA A;  1NK5 A;  4ELU A;  4DQQ A;  1JLG A;  1J54 A;  4KTZ A;  2IC3 A;  4Z0U A;  4DU1 A;  1WSE A;  1UOC A;  4OGE A;  1LV5 A;  4FK0 A;  2E4L A;  1LWE A;  2I5J A;  3PX4 A;  3ISN C;  4RW9 A;  1D5A A;  2HND A;  4RW7 A;  5KRT A;  1RBV A;  3OYE A;  3NCI A;  3KD1 E;  2OA8 A;  2Q3S A;  4NYF A;  5J2Q A;  3LP3 A;  1WSG A;  2F96 A;  1RDD A;  3VQD A;  3VA3 A;  4PUO A;  3C6U A;  3U3Y A;  3I0S A;  1EP4 A;  3RTV A;  4ID1 A;  1LWC A;  3CFP A;  3V9S A;  4M3X A;  1RT3 A;  3QEP A;  3HPO A;  1VSM A;  4M41 A;  1TAU A;  3A2F A;  3OJU A;  3V9W A;  4BAC A;  3AVK A;  3AVM A;  1IKY A;  5HRP A;  5JS1 A;  3TI0 A;  3HYF A;  2G8K A;  4FLY A;  3QEX A;  4CJS A;  3L3U A;  1TL3 A;  2ZD1 A;  4K8Z A;  4CFB A;  2A1S A;  1GOC A;  2KFZ A;  3OYB A;  4CJU A;  4W5O A;  5KGX A;  1RT1 A;  3LP2 A;  3OYD A;  4E7H A;  2XO7 A;  1Q9Y A;  4CJP A;  3CM6 A;  2B5J A;  5FRN A;  3KLH A;  1RBT A;  4FLW A;  4CHO A;  1VSK A;  1JLE A;  4CK1 A;  5CYQ A;  4HCC A;  4CGF A;  2XY8 A;  3EZ5 A;  3KJV A;  4CGJ A;  3ZSR A;  2QKB A;  3QIP A;  4EZ6 A;  5J2P A;  4FJK A;  4CIG A;  4CJW A;  3KTQ A;  4DWI A;  4Q5V A;  1JLB A;  3QES A;  3TAQ A;  4OLB A;  3SJJ A;  4M3T A;  5FDL A;  1RBS A;  4KB1 A;  3HL8 A;  1IG9 A;  3L8B A;  2G8H A;  4DSJ A;  1QSS A;  1C1C A;  4FYD A;  3VQ8 A;  1NK6 A;  4PQU A;  1HYS A;  1T05 A;  3AO3 A;  1QHT A;  3S9H A;  5HBM A;  3SI6 A;  4HCB A;  3C94 A;  3K58 A;  1RCH A;  1KVB A;  4M3U A;  4CHY A;  4FCY A;  2ITG A;  4I9Q A;  1L3V A;  4OLA A;  4Z4I A;  2YHA A;  4Z4C A;  3SUQ A;  4ZTJ A;  1C6V A;  1XWL A;  1S9E A;  2D5R A;  3NF9 A;  5HRN A;  3AVL A;  1ZYQ A;  3PV8 A;  4BDP A;  3ZSX A;  3LWL A;  3FFI A;  4FJM A;  3M8Q A;  3CG7 A;  4FLX A;  1SUQ A;  1BIU A;  3AVJ A;  2XRI A;  4B08 A;  1ZBF A;  2ZE2 A;  1HPZ A;  4BWJ A;  1VSD A;  3TAF A;  2Y1J A;  2OZS A;  4F3T A;  4CK2 A;  2HHV A;  2P51 A;  4CHQ A;  2GV9 A;  3RR8 A;  3MED A;  1EXQ A;  3OS1 A;  4FM1 A;  1GOB A;  2XY7 A;  4FJ8 A;  1X9W A;  3VQ7 A;  1NK4 A;  1LWF A;  2DY4 A;  3KD5 E;  1TVR A;  4M42 A;  4F2S A;  1RBU A;  1TK0 A;  1RT7 A;  1L3S A;  2PYL A;  3KK3 A;  4CF1 A;  3VQA A;  3V81 A;  3ZT2 A;  4B9T A;  2YHB A;  1B9D A;  1ITG A;  2WOM A;  3AA2 A;  3MXJ A;  3PUF A;  4CJF A;  3OJS A;  3TAR A;  1L3U A;  4QAG A;  4C8O A;  1LAW A;  3AA4 A;  1DLO A;  4CEB A;  3K59 A;  3H08 A;  3AVG A;  3C95 A;  1VSF A;  1SL1 A;  4B9N A;  1CZB A;  4CHZ A;  3O3G A;  4Z4F A;  5FRM A;  3AVB A;  4NCG A;  4DTX A;  4IKF A;  1X9S A;  3VQ4 A;  2IGI A;  2LSN A;  4BDZ A;  4KKO A;  4KFB A;  3KIO A;  1CLQ A;  3O3H A;  5J2N A;  3SQ4 A;  1UA1 A;  2HB5 A;  4ZTF A;  4CF9 A;  4FLU A;  3QO9 A;  1WNS A;  3ZSV A;  3NF6 A;  3V9U A;  1KSP A;  2AJQ A;  1B9F A;  3V9X A;  4CFC A;  1KVC A;  1XC9 A;  3DLG A;  4CED A;  4AHC A;  2WON A;  1VSJ A;  3TAB A;  3OYI A;  4IFY A;  4C8L A;  1LW2 A;  1DTT A;  1Q8I A;  1VK0 A;  3VA0 A;  3ITH A;  4CCH A;  3JSM A;  4KTQ A;  4Z4G A;  4CFA A;  1UA0 A;  1YTU A;  3HPG A;  3WNF A;  2FBY A;  3KLE A;  3ZT3 A;  1BI4 A;  1K6Y A;  2OPQ A;  1JLF A;  3NFA A;  3P5J A;  3NE6 A;  4KHS A;  4DTU A;  4EZ9 A;  4AH9 A;  1FKO A;  1NJZ A;  4BE1 A;  4CF8 A;  4NCB A;  3AVA A;  3LAN A;  2E6L A;  4I9L A;  4J2E A;  1A5X A;  3LAM A;  3OVN A;  2FBT A;  4TSX A;  3SV3 A;  4DTM A;  4FLT A;  1QSL A;  3L2V A;  3V9Z A;  2ZQB A;  4I7F A;  1C1A A;  3L2U A;  4FJG A;  3WNH A;  3SPZ A;  3DRR A;  2PY5 A;  1FK9 A;  4KHY A;  3PX6 A;  3SUO A;  1U04 A;  3WNE A;  1YVU A;  3QNO A;  3ZSO A;  3NGI A;  4DS5 A;  4FVM A;  3DI6 A;  3V1Q A;  3L2Q A;  1I3A A;  4DTJ A;  5HRO A;  5HRS A;  4BE2 A;  1U45 A;  3AVI A;  1DTQ A;  2PYJ A;  3SPY A;  4PY5 A;  4GVM A;  1TKX A;  3P1G A;  3K5M A;  1RDB A;  3S3M A;  2BDP A;  2OPS A;  4W5T A;  5J2M A;  4CFD A;  3LAL A;  4BWM A;  3SQ0 A;  3QLH A;  3ZT1 A;  1U49 A;  3VQB A;  3S3O A;  1LW0 A;  4E7J A;  1ASV A;  4E1M A;  2VWK A;  4B8A B;  4KAZ A;  1MU2 A;  3V6D A;  2O4I A;  1HYV A;  2Z1I A;  4M3Y A;  5C24 A;  4O0J A;  4IG0 A;  1WN7 A;  1QTM A;  3CYM A;  1ZBI A;  1A5W A;  3K5L A;  2FC0 A;  4LD0 A;  1N5Y A;  1JXE A;  2B6A A;  2VG5 A;  2G8V A;  4FK2 A;  4Z4E A;  4W5Q A;  2X74 A;  3D45 A;  1EKE A;  3NH2 A;  3BDP A;  2GBZ A;  1KCF A;  4GMJ B;  1ASW A;  1ASU A;  2B4J A;  4CK3 A;  4UQG A;  4DTN A;  1S1X A;  5HRR A;  4CJL A;  3O4Q A;  4I2Q A;  4LSL A;  4NYN A;  3NH1 A;  3RRH A;  3OYN A;  3RMA A;  4OKJ A;  4E0D A;  3RMD A;  1RT4 A;  1YTA A;  4DS4 A;  4IFV A;  1G15 A;  4I2P A;  3ZT0 A;  1D9F A;  4DSI A;  3OYF A;  1VRU A;  2P1J A;  1XI1 A;  4KI4 A;  3L3V A;  2OPR A;  3QEW A;  1LAV A;  4CER A;  1WLJ A;  2KZZ A;  2G8U A;  4AHU A;  1VSE A;  2VG6 A;  3QIN A;  4OKE A;  3QEV A;  3AO5 A;  1HQU A;  5CZ2 A;  2O4G A;  4CGI A;  4CEO A;  4HUG A;  4BE0 A;  1T03 A;  4DQR A;  2XY6 A;  1Y97 A;  4J2D A;  3IG1 A;  1W0H A;  3VN5 A;  1IKX A;  3F73 A;  4H4O A;  4AHT A;  3V4I A;  2Z1G A;  4LSN A;  3SCX A;  3M8R A;  1RTD A;  1JL1 A;  4FJL A;  1WAJ A;  3SQ2 A;  3HT3 A;  4DTP A;  2RPI A;  1U48 A;  3NGZ A;  3M8P A;  2RKI A;  3I8D A;  4C8M A;  3WNG A;  4KO0 A;  3MAQ A;  2RN2 A;  1EET A;  1NOZ A;  4DU4 A;  3AO2 A;  4CJK A;  3QNN A;  1BCM A;  1HQE A;  3ZSY A;  4K8X A;  3SUN A;  4CF2 A;  3PO5 A;  1O1W A;  3NAE A;  4DQS A;  4DSK A;  4ZHR A;  2PZS A;  1TGO A;  3NH0 A;  4KHU A;  4BDY A;  4DFP A;  3OYC A;  3ALY A;  2X78 A;  3KKS A;  1IO2 A;  2HNY A;  2X6S A;  1T8E A;  1CZ9 A;  4CJT A;  1ZBH A;  1TKD A;  1KLN A;  1RT5 A;  4CHN A;  1NK8 A;  2HHX A;  4FXD A;  3TAE A;  3ZSQ A;  5HP1 A;  2KW4 A;  3KK1 A;  4FJJ A;  2BAN A;  5I3U A;  3G0Z A;  4FJX A;  2F8S A;  2IOC A;  3K2P A;  4M3Z A;  1C0T A;  3PX0 A;  4YFU A;  2KFN A;  5J1E A;  4LH5 A;  4RW8 A;  1NK7 A;  4CJE A;  1SKS A;  4DF8 A;  4DFJ A;  3PY8 A;  3OS2 A;  3DOL A;  3NGY A;  4MFB A;  4JRQ A;  5DK5 A;  2HVI A;  2HHW A;  1VSH A;  4O55 A;  2NUB A;  4DLG A;  3TAG A;  5D3G A;  1VSI A;  2X6N A;  1NKB A;  3ZSW A;  1CXU A;  4CJ3 A;  1RNH A;  1BHL A;  1S1T A;  4CJQ A;  1XHZ A;  4CJ4 A;  1HRH A;  5JS2 A;  2XY5 A;  4RW6 A;  4E7I A;  2HHU A;  3VQ9 A;  3LAK A;  2YNI A;  5KGW A;  2OYQ A;  3U6F A;  4B9M A;  4J2B A;  1HYZ A;  4E3S A;  1ZBU A;  3T1A A;  5KRS A;  4AHS A;  1NK9 A;  2QK9 A;  1SL0 A;  4KRF A;  4CEZ A;  4CF0 A;  2YNG A;  1QSY A;  1X1P A;  3NHG A;  3TR8 A;  4DMN A;  1IKW A;  2IS3 A;  4GW6 A;  4DSL A;  1SKW A;  4KHW A;  1RTI A;  4KTW A;  4DG1 A;  1QQC A;  1BIZ A;  1HJR A;  1RT2 A;  1S5J A;  1XHX A;  2EHG A;  1B92 A;  1JL2 A;  2JLE A;  5C42 A;  3OYG A;  3DLK A;  2G8F A;  1A5V A;  4CES A;  2DFE A;  1D9D A;  3TAN A;  2HW3 A;  3M8S A;  1RTH A;  3DLB A;  4C8K A;  2D0B A;  3NF8 A;  3JYT A;  5HLF A;  4J2A A;  1NOY A;  4CIE A;  4N76 A;  3IS9 A;  4JLH A;  4PWD A;  4CJV A;  3CFO A;  4M3W A;  1J9A A;  3LDS A;  4B9S A;  1HMV A;  2BE2 A;  2YNF A;  4F2R A;  2W42 A;  3MXM A;  1NJX A;  2KZM A;  4CHP A;  2YKN A;  2DFH A;  4WE1 A;  4F3O A;  3NBP A;  4Q0B A;  1Z25 A;  4JS4 A;  3ZCM A;  3LZI A;  1I39 A;  2Z1H A;  4N47 A;  4LY7 A;  3O3F A;  5EU7 A;  3PO4 A;  2DFF A;  2FBX A;  3DLH A;  3EYZ A;  2FBV A;  2F8T A;  2VWJ A;  3CM5 A;  2HHQ A;  5DMR A;  3LPT A;  2IAJ A;  3KKR A;  5FRO A;  3DRS A;  3VQE A;  4R5P A;  4JS5 A;  4CJR A;  3DLE A;  1SL2 A;  4RG8 A;  1BGX T;  4Y1C A;  1WSH A;  3MEC A;  4F4K A;  3ZSZ A;  3HM9 A;  4FZY A;  4KB0 A;  2YKM A;  4OGC A;  1J53 A;  3I0R A;  4M45 A;  1RT6 A;  1S9G A;  1KLM A;  1S1W A;  3AVH A;  2KTQ A;  1ZBL A;  1VRT A;  3HJF A;  3HVR A;  4FLZ A;  3DOK A;  3G10 A;  4E7L A;  4OPK A;  1Q9X A;  3UIQ A;  4XIU A;  2GUI A;  4AIL C;  2P5G A;  4CE9 A;  3VQP A;  1JLA A;  1TV6 A;  4B8C A;  1QS4 A;  3OS0 A;  1TKZ A;  3TAP A;  4FJ5 A;  2HHT A;  1TK8 A;  1R0A A;  3AA5 X;  1U47 A;  3MEE A;  4CGD A;  2ETJ A;  3DLR A;  4QCL A;  3BGR A;  1UWB A;  3DM2 A;  2HVH A;  1W9H A;  1F21 A;  5K14 A;  3OYJ A;  4DTS A;  3OY9 A;  5SZT A;  3C6T A;  3HP6 A;  2A1R A;  1NK0 A;  1NJW A;  1QE1 A;  1KFD A;  3CQ8 A;  3T19 A;  4W5N A;  2Y1I A;  4FLV A;  1KVA A;  4IDK A;  3OYA A;  4F8R A;  3RMC A;  3E01 A;  3OYH A;  4NCA A;  4KHN A;  3AV9 A;  2G8W A;  1TL1 A;  3SYZ A;  1BL3 A;  4OVL A;  1UAX A;  4CGG A;  4DQI A;  1S1U A;  3D0P A;  3HO1 A;  4KI6 A;  4KHQ A;  4QOZ B;  4DSF A;  3SZ2 A;  4HHT A;  3TAM A;  1C1B A;  3CFR A;  4B3O A;  2R7Y A;  4FJH A;  2OZM A;  3LP0 A;  1C0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...