4HTUA

Structure of 5-chlorouracil modified a:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
molecule keywords Ribonuclease H
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4htuA00
4I2PA 1BHLA 2PZSA 2WOMA 4Z4CA 3HP9A 2VWJA 1F21A 2P5GA 1GOBA 3NFAA 1L3UA 3G0ZA 4E1MA 3V9XA 3NH1A 3OYMA 2O4IA 1RCHA 1O1WA 4LSNA 3VA3A 2VG6A 1R0AA 5HRSA 1GOAA 1S6QA 3AO4A 3HYFA 3LALA 4IFVA 4M3WA 3ZSZA 2RF2A 2X6NA 5T7BA 2R7YA 4DF4A 3VQCA 5SZTA 3DRPA 4W5TA 3L2UA 4CGJA 1JLFA 4EP5A 3RMDA 3AA3A 2FBXA 4ICLA 1Q9XA 4QAGA 1WSEA 1VRTA 4E7KA 1VSHA 1YT3A 4DU4A 4M41A 5I3UA 3OYDA 1ITGA 4CK1A 4BE1A 3QEIA 1QSSA 3HT3A 4IG0A 4CGIA 3IS9A 4F2RA 4DFPA 2KW4A 3SPZA 2D0AA 1TGOA 1DTTA 4DTJA 3CG7A 3T3FA 1JLAA 4KB0A 2HHWA 3CYMA 3DM2A 3IAYA 3TAGA 3MEDA 2HNDA 3RRGA 3OYAA 5CY4A 3DLRA 3TWHA 4ID1A 4PA1A 1ASVA 4M45A 3KLFA 1VRUA 3PX0A 2BE2A 2HNYA 1VSIA 3V1RA 3V4IA 3F9KA 1BGXT 1RBVA 4CHNA 1TKDA 3AA2A 4AHTA 3KTQA 1JLGA 1WAJA 4F3OA 3T19A 3S9HA 2HNZA 1SL1A 4Z4EA 1KVCA 3SUOA 4FLVA 1L3VA 2RKIA 2HVIA 5DMRA 3L2QA 4CEAA 1RTDA 3AVLA 1D9DA 4DQIA 3SQ4A 3K57A 3HXMA 1U49A 4FJ9A 4JS5A 2NUBA 4W5NA 3NGYA 3QINA 1RT5A 1Z25A 4DU3A 3AVAA 3L2RA 4Z0UA 3DOKA 3DRSA 3LAMA 1C0TA 1RBUA 1TAQA 3OYHA 4DU1A 3RMAA 1S1XA 1WLJA 2IC3A 3C94A 4Q5VA 3V81A 5HROA 4KI4A 4DFJA 3L3VA 4R5PA 1IKXA 4J2DA 5CYQA 4HUFA 3SJJA 1NJZA 2F8TA 1NK7A 3OYGA 1BISA 3VQ7A 3KKRA 1BIUA 4C8MA 3ULDA 1T05A 1QSYA 1QQCA 5CYMA 4MQ3A 3ITHA 5K14A 4CE9A 4CIGA 2XHBA 2E6MA 4CFDA 5J1EA 4NCGA 1SKRA 1T03A 4OLAA 4AHRA 2G8KA 2X74A 4CEZA 4F2SA 3OYEA 4E7HA 4FJGA 4J2AA 2B5JA 4E89A 2BDPA 1RILA 3A2FA 4FZXC 3K2PA 4CHOA 1FKPA 1KVBA 1LAWA 2OPPA 1RNHA 5KRSA 3NF7A 4O0JA 3KLHA 4O5BA 3AO2A 2RN2A 4CK3A 4M3YA 1L5UA 4CJ4A 3O3HA 4KHYA 1LV5A 3NH2A 3SYZA 1HYZA 3IRXA 4BDYA 3DLEA 3AO3A 3ZT3A 1YTUA 4AHCA 3RMBA 1CZBA 1W9HA 3DOLA 4HCCA 1DLOA 1CXQA 1ASWA 3K59A 3OYLA 4CHQA 1VSDA 2X78A 2XY8A 5J2NA 4Z4GA 4DTMA 1UOCA 3HP6A 3SUQA 2A1RA 2OZSA 3VQEA 3ISNC 2FC0A 4CFAA 3EYZA 1KLMA 3SI6A 4CJPA 4E19A 4XIUA 3ZSWA 4CK2A 1J5OA 3JSMA 4CHYA 4B3OA 2Z1GA 3C6TA 1X9SA 4RW7A 4PY5A 1JXEA 3RTVA 4J2BA 1VSFA 5HRNA 4EZ6A 1A5VA 4FLZA 3M8SA 4AHUA 5D3GA 1LWFA 3U6FA 2QKKA 1Q9YA 2Z1HA 1ZBHA 3AO1A 4KTZA 4FJ7A 2DY4A 1U04A 3C95A 1D9FA 4FLWA 4CGFA 3V1OA 2ZD1A 4E7JA 4M42A 1I3AA 2YHBA 4CJLA 3NE6A 1UA1A 1RTHA 4LSLA 2AJQA 2OYQA 1LW2A 4N41A 4I9QA 2ZQBA 4F8RA 3HPGA 1N5YA 3E01A 1S6PA 4HUGA 4DQSA 3F73A 1WSFA 1EKEA 2OZMA 4CJFA 1SUQA 4CEFA 4B9NA 4ELUA 1HPZA 1Y97A 1XI1A 4FJ8A 3LPTA 4CCHA 2X6SA 3ZT1A 1CZ9A 4M3XA 2Z1JA 2P5OA 1I39A 3ZSRA 4DSIA 1JL1A 3P83D 3WNGA 4FLTA 1SL2A 3BDPA 4CEQA 2DFHA 2I5JA 5C25A 5SWMA 1ZYQA 2G8HA 3LP0A 5J2PA 3DRRA 2E6LA 3I0RA 3HVRA 1KCFA 3LPUA 2GV9A 4KRFA 3HPOA 3TAMA 3PX6A 1HYSA 4B8AB 4C8NA 4DTPA 2EHGA 2YNGA 2F8SA 3AVJA 5DK5A 3LANA 3MAQA 1JLEA 1UWBA 1WSGA 4CF9A 4KTWA 3CM6A 1NK8A 3HM9A 5HP1A 2P1JA 2YKMA 4PQUA 1FXXA 5C42A 4BACA 4PWDA 2VG5A 2HB5A 4CJWA 5J2MA 1SKWA 4CF1A 2XRIA 3SCXA 1HQEA 3HVTA 3KKSA 3SV4A 4GVMA 1KSPA 4C8OA 4KHNA 3SPYA 3B6OA 4M3RA 3VQ4A 2OPSA 5HRPA 4CFCA 4BDPA 5CZ2A 1WSIA 1HMVA 3LP3A 3PY8A 3RR7A 2HHSA 3CFOA 3VQDA 1S1WA 4DTUA 3THVA 4NCAA 3MXJA 3QEPA 1U48A 3WNHA 4FK0A 1WSJA 5HRRA 4CF0A 4DSFA 4CJEA 4OGEA 1QS4A 3TAPA 4OGCA 1RT1A 4B9MA 4DWIA 3OS2A 1L3TA 4UQGA 2BANA 5I42A 4N76A 3CM5A 3V1QA 4CESA 3OY9A 5FRMA 4FYDA 4DMNA 4RW4A 2KZMA 1JLCA 4E7LA 2KZZA 1S9GA 4MFBA 3HSTB 2PYJA 4FJLA 4N56A 1U45A 3BGRA 3M8PA 1QSLA 3ZT2A 1BQNA 1RDAA 1C0UA 1B9FA 4GMJB 1C0MA 2G8FA 4CF8A 4B8CA 1BQMA 1ZBFA 3ZSVA 3S3OA 3LP2A 4DS5A 4FCYA 3MXMA 2A1SA 4CJVA 1J54A 2ITGA 3O4QA 4CEDA 4BWJA 5C24A 4DTSA 1XWLA 3OYIA 1TK0A 5FRNA 3KK3A 1A5WA 1S9EA 2EX3A 2FBYA 1T8EA 4ELVA 4FW2A 4IFYA 4OLBA 1SL0A 3SQ1A 1T7PA 3CQ8A 3QNNA 2YNIA 4DLEA 2QXFA 3QIOA 3DLGA 3QERA 3QESA 2HHVA 2DFFA 4AHSA 4LY7A 3OYBA 3ASMA 1TKXA 2YHAA 3VQ9A 1TAUA 4OKJA 3ZSQA 2OPRA 2HMIA 2IOCA 4FJHA 1TL1A 4KI6A 4C8KA 3EY1A 4CECA 1KFSA 4IKFA 1LAVA 4BE0A 4DSKA 3M8QA 5EU7A 4FK4A 1C1BA 3L2VA 1VSMA 2VG7A 2HVHA 5CZ1A 3QEXA 4DQRA 3KD5E 5KTQA 4CEOA 3D0PA 1XC9A 1JLBA 3K5OA 4RG8A 2RPIA 3NBPA 4WE1A 4CGGA 4FZZA 4DFKA 3AA4A 4K8ZA 1HRHA 3LP1A 1W0HA 4DG1A 3DMJA 4LD0A 3KLEA 1XHZA 1NJYA 3MEGA 3PO4A 1EETA 3AA5X 3S3MA 3AV9A 2JGUA 3KJVA 3SUPA 3HJFA 3VN5A 4W5RA 4CJSA 3OJSA 3O4NA 4K8XA 4BWMA 1B9DA 3AVKA 4AHVA 3NH0A 1BI4A 3AVNA 4KV8A 1EXQA 3CFRA 1CLQA 3AVFA 1IKWA 1J53A 4B9VA 4GW6A 1VSJA 4CHZA 2GUIA 1S1UA 3D45A 1NKCA 1KVAA 2G8VA 3DYAA 4C8LA 3LAKA 4FJ5A 4KHQA 3K58A 4DTXA 1HNIA 2Y1IA 3NGZA 2Z1IA 3VQAA 4CIFA 4CJKA 4RW8A 4YNQA 1S5JA 3OS0A 4IDKA 4HUEA 1HYVA 4OPJA 4CGHA 3QNOA 4FJIA 2ATQA 4O4GA 3NF6A 1D5AA 5E41A 1IO2A 3C6UA 4JS4A 4KREA 2YKNA 2KFZA 4ZTJA 4DSLA 4QCLA 1IG9A 3AVBA 1TK5A 3ZSYA 3QETA 2PY5A 1JLQA 1IH7A 3SQ2A 2G8WA 1NOYA 1RTIA 1YVUA 4I7FA 3RMCA 3OYJA 4EZ9A 1RDCA 4OJRA 3DLBA 4FXDA 4BDZA 1SV5A 3I0SA 3KLIA 4DSEA 2XY5A 1U4BA 3VQBA 2G8UA 3NCIA 3T1AA 1NK4A 4Y1DA 4CJQA 3PV8A 3U3YA 2ZE2A 2G8IA 4E7IA 4JLHA 1XHXA 1X9MA 4DSJA 1IKYA 1TKZA 3OVNA 3QO9A 3ZT0A 2HHTA 4KAZA 3K5MA 2KTQA 2XY6A 4NCBA 1BL3A 2B6AA 2OPQA 2Q3SA 4B9TA 1C1AA 1VSKA 1GOCA 1RBTA 4O44A 3V9SA 4CIEA 3HL8A 1MU2A 4HTUA 3TABA 4B9UA 1ASUA 1U47A 4RW6A 2OA8A 2XO7A 3HO1A 1FKOA 4FZYA 3DI6A 3AO5A 3U3GA 4CF2A 3KIOA 3RR8A 4E0DA 1BI4B 4B08A 1Q8IA 4DTRA 2HW3A 1TKTA 4KHWA 4AH9A 4Q0BA 3L2WA 3MEEA 4FJMA 1J9AA 1TVRA 2WONA 5KI6A 3KK1A 3ZSXA 1KTQA 4FM0A 3SV3A 4ZHRA 3PUFA 1RBRA 1X1PA 1WN7A 2FBVA 5JS2A 5HBMA 4DQPA 4DLGA 1C1CA 4W5QA 3M8RA 3OYCA 4OPKA 4B9SA 3V9UA 3MXIA 4B9LA 3CFPA 2HHQA 1DTQA 1JXBA 4CGDA 3ZCMA 3VQ8A 1BIZA 4H4OA 4KTQA 3B6PA 4BE2A 3TI0A 1D8YA 2D5RA 5JS1A 3VA0A 3KLGA 4CFBA 3TAQA 4M3ZA 3L3UA 4KB1A 1JL2A 4FLXA 2VWKA 4KPYA 1KFDA 3ZSOA 4CJTA 4OKKA 3QEWA 4KO0A 3NAEA 3LWLA 1A5XA 4F3TA 4I9LA 1LW0A 3PO5A 1RT4A 2D0BA 4KFBA 3OYFA 1QHTA 4Z4HA 1RT3A 4O55A 2DFEA 3S3NA 3HPHA 1WNSA 3NHGA 4HVJA 4CHPA 1YTAA 1RTJA 4N5SA 2Y1JA 1QE1A 1IKVA 2YV0X 3H08A 4FJKA 3AVHA 1NOZA 3V9WA 1RDDA 1RT7A 4E3SA 4IG3A 3LDSA 1SKSA 4Z4IA 3OJUA 3P5JA 3EZ5A 2XY7A 4FJNA 1LWEA 2KFNA 3VQQA 3NF9A 3O3FA 3K5LA 2HHUA 2HHXA 2F96A 5FDLA 4EP4A 1EX4A 1L3SA 3JYTA 3TANA 1Z26A 3TAEA 1HNVA 2FBTA 3DLKA 1NKEA 5KGXA 3TARA 2IS3A 4H4MA 4FW1A 2ETJA 1UAXA 4DTNA 4FLUA 3OYKA 1G15A 1S1VA 3V6DA 3KK2A 1LWCA 3AVCA 1BCOA 4NYNA 1RBSA 3NGIA 2PYLA 4CJ5A 3SQ0A 3VQ5A 3ZT4A 2GBZA 3G10A 4I2QA 1X9WA 1NJXA 4FJJA 4DS4A 4LH4A 4FK2A 2D0CA 4E1NA 1NJWA 1QTMA 4JRQA 5HLFA 2YNHA 3OYNA 4LH5A 4FM1A 3MECA 4CEEA 4O0IA 1WSHA 1UA0A 4FJXA 4ZTFA 1FK9A 3AVMA 4JRPA 2JLEA 1B92A 3IG1A 1C6VA 3QIPA 2W42A 3L8BA 1KRPA 4H8KA 3OS1A 5KRTA 4FLYA 1HJRA 2QK9A 2YNFA 1REVA 4AILC 1ZBUA 2KQ2A 4PUOA 2E4LA 3QLHA 4HHTA 4KHSA 1NKBA 3FFIA 1TL3A 3O3GA 4FVMA 3WNEA 1WAFA 3WNFA 1KLNA 2DTUA 1RT6A 2IAJA 2IGIA 4TSXA 1NK9A 3DLHA 2B4JA 3SZ2A 4HCBA 2P51A 4QOZB 3SNNA 2IDOA 4W5OA 1TK8A 3UIQA 1K6YA 5KGWA 4YFUA 4F4KA 4OVLA 1CXUA 1BCMA 3NDKA 4DTOA 3LWMA 4KHUA 4J2EA 4DFMA 1JKHA 1HQUA 1VSEA 2O4GA 3P1GA 4Y1CA 1NK5A 4M3TA 4NYFA 1VSLA 3QEVA 3RRHA 1NK0A 1EP4A 4CJ3A 4Z4FA 1S1TA 3V9ZA 3TAFA 4KKOA 4FM2A 4ELTA 4RW9A 3RWUA 3LZJA 1NK6A 2QKBA 4M3UA 2BGGA 4CJRA 3VQ6A 4CJUA 4DQQA 1ZBIA 4N47A 4DF8A 3ALYA 3VQPA 4CEBA 3AVIA 1N6QA 4L8RB 3I8DA 3AVGA 4ID5A 3LZIA 2LSNA 1TV6A 4G1QA 4IBNA 3TR8A 3SUNA 1ZBLA 3NF8A 3KD1E 1RT2A 1VK0A 3PX4A 3HK2A 5FROA 5J2QA 4OKEA 4CERA 3K5NA 1RDBA
chains in the Genus database with same CATH superfamily
2ZJPL 1BHLA 4JI8K 2YI1A 3ZETB 2BUPA 3NH1A 3DLLL 1O1WA 3VA3A 1RFQA 2P9LB 4CZEA 1GOAA 3VQCA 4CZLA 1NBWA 5LJWA 3L2UA 3CCUN 1JLFA 4EP5A 5BREA 5I9EB 5JLHA 3IMXA 2HBLA 4YY3K 2BTFA 1NGIA 4BE1A 4IG0A 4F2RA 2KW4A 4H5RA 2OCEA 4DTJA 1QQNA 2HHWA 3DM2A 3TAGA 3AAPA 3RRGA 3PIOL 1MA9B 4ID1A 3KLFA 1ASVA 2J4RA 3ENOA 3J7YP 3TWHA 2BE2A 1VSIA 3V1RA 4CHNA 4LF9K 3CCEN 1ATRA 4ISFA 4H5NA 4ISGA 4NLCA 4BC3A 3SBGA 2FF3B 1XMOK 4CEAA 1D9DA 2FSNA 3VESA 3VF4A 5AR0A 4FJ9A 2P9PA 1EO1A 1Z25A 3L2RA 3DOKA 3DRSA 3OYHA 5HROA 1WLJA 3C7NB 1DKGD 2HBMA 4R5PA 4JD2A 3SJJA 4JK9A 5EX5A 5H1SQ 2F8TA 4BROA 5KPZA 3KKRA 3DXMB 1OVYA 4C8MA 1V4TA 3ULDA 5K14A 4CE9A 1SKRA 5BRFA 5JMVA 1HKBA 1Y64A 2G8KA 2X74A 4CEZA 4FJGA 4E89A 4FZXC 2VYPA 1KVBA 2OPPA 4XH4A 3VEWA 3HZ6A 4O0JA 3JAMO 4LFAK 1L5UA 3O3HA 4KHYA 1YJNN 1HYZA 4BRMA 3IRXA 1VQKN 1YTUA 5DM6L 5BRHA 1CZBA 4NXNK 1W9HA 3C65A 3RSEB 1ASWA 2H3GX 3K59A 1WB9A 4CHQA 1VSDA 3TSQA 4DTMA 1UOCA 2P9SA 2FC0A 3EYZA 4XIUA 1NGCA 3ZSWA 3J7AP 5FLXO 2NRHA 1X9SA 4RW7A 4PY5A 2P9LA 3E9PA 3SLCA 1XQSC 3MX5A 3M8SA 4AM6A 4AHUA 5GIOA 1LWFA 1ZBHA 4BVOA 3C95A 4FWOA 5FPMA 1UA1A 2O8CA 4N41A 1VQMN 1XUPO 4FWPA 1WSFA 4CJFA 1SUQA 4CEFA 1K8KA 4ELUA 4FJ8A 5AQGA 4FL9A 4YDUA 3QDKA 3ZSRA 4DSIA 3CD6N 2V7ZA 4LFBK 3BDPA 4JKBA 2I5JA 1NGAA 3P4IA 5J2PA 3DRRA 3I0RA 3G25A 1KCFA 3LPUA 3WXIA 3TAMA 1C0GA 3A5MC 1N32K 4DTPA 2EHGA 2HBKA 2YNGA 4MO5A 2F8SA 3AVJA 4KH4A 1UWBA 1WSGA 1NK8A 1CLQA 1FXXA 4BACA 5CE3A 2HB5A 1QZ6A 4CF1A 4GVMA 3SPYA 4BRQA 5HRPA 4HTLA 5CZ2A 1WSIA 4ILHA 5AQNA 4A61A 4WFNL 3G71N 3PY8A 2HHSA 3CFOA 4DTUA 3THVA 4NCAA 2Q1NA 5IWAK 2W40A 4B9MA 4OGCA 4NB4A 4QS9A 1L3TA 5FPEA 2KZMA 4CESA 3OY9A 5FRMA 3UKRA 3QFPA 4FVUA 2KZZA 1S9GA 3HSTB 3M8PA 3SMSA 1RDAA 4CF8A 3ZSVA 1ZBFA 5C12A 2FLOA 3EE8A 3MXMA 2QEXN 1Z6RA 1W97L 4H0XB 4DTSA 1TK0A 5FRNA 3KK3A 4BG8A 1A5WA 2NRVA 4JI2K 4FW2A 4ILGB 3QNNA 4A62A 1IG8A 3DLGA 3OYBA 1O13A 2YHAA 3ASMA 1TAUA 3WQUA 2IOCA 4BE0A 4DSKA 2NRTA 3DWLA 4FK4A 2NLXA 1R59O 4B3SK 1VSMA 3KD5E 3H1VX 5AQKA 1JCEA 2RPIA 3NBPA 4WE1A 4FZZA 4DFKA 3AA4A 3WEEA 1HRHA 3T7ZA 3LP1A 3K9JA 5GAHP 1SAZA 3S3MA 3KJVA 4LF5K 3VN5A 4W5RA 4CJSA 3TU5A 4YHHK 3I8BA 3O4NA 4K8XA 1WBBA 3EO3A 4AHVA 1MWMA 3FE1A 3CFRA 4YDUC 5C15A 4CHZA 4JHDA 4DCHA 4C8LA 4FJ5A 4A2AA 2W6KA 3CI5A 1J5EK 1S5JA 4HUEA 2UUBK 3QNOA 4FJIA 3NF6A 3UKRB 1MDUB 3SJHA 2KFZA 4DSLA 4JHDB 3SAGA 1TK5A 1KD1O 3ZSYA 4XEIA 5M1NA 4YOTA 3CPEA 2ZGYA 2UXCK 2W6LA 1RDCA 3MDQA 3DLBA 5JVHL 1XNRK 2G8UA 2QA4N 3UKUB 4DV3K 1BA1A 3QFUA 4CJQA 3H3OB 4JI1K 3EL2A 4WF9L 4I6MA 3K5MA 2KTQA 1BL3A 3OBWA 3EKSA 3D2EB 4O44A 1GOCA 1RBTA 3L4IA 5AQMA 3F2KA 2P9KA 1E3MA 2OA8A 3GOIA 1FKOA 3DI6A 3RR8A 3TSPA 4JKEA 3KWIA 3MN6A 4EHUA 4AH9A 2BH1A 4K41A 3SV3A 4Z94A 4ZHRA 2IVNA 5JS2A 1HNWK 1C1CA 4H0TB 2A5XA 4W5QA 1QVGM 4OPKA 1RGIA 4IXCA 3CFPA 3FGUA 1JXBA 3ZCMA 3MCPA 3TI0A 2GWKA 3WEEB 4CFBA 3TAQA 1JL2A 1Q18A 1KFDA 4CJTA 3NAEA 4LFCK 2O8EB 2E2QA 4I9LA 1RT4A 2D0BA 1GLCG 4WFAL 4O55A 3HPHA 4CHPA 1RTJA 1IKVA 4LF8K 3VEVA 3HOSA 4K43A 3LDSA 1VQ8N 3OJUA 1OH6A 3CXCM 3P5JA 1LWEA 3VQQA 3O3FA 1VQ6N 2HHUA 3BY5A 3KVGA 1Z26A 4WQ5C 3TAEA 5BN8A 4YOYA 3OYKA 3V6DA 1RBSA 4WQ4A 2E5LK 3ZT4A 3G10A 2E88A 4I2QA 1X9WA 4L3QA 4FJJA 4DS4A 4DR4K 4E1NA 5FPDA 3OYNA 3MECA 1KC8O 4BRNA 4DR7K 2JLEA 4BR2A 4RTFD 3QIPA 4FWKA 4H8KA 3OS1A 3A5NC 5KRTA 4FLYA 4AILC 2E1ZA 2KQ2A 4BRAA 5F2RA 3EKUA 2Q0UA 4FVMA 1YXQA 2QWOA 3M1FA 3BZKA 5AQZA 4TSXA 2IGIA 4EIAA 2B4JA 3CCVN 4JKHA 4F4KA 3QICA 4YFUA 4OVLA 3LWMA 5AQOA 2OTLN 4M3TA 4NYFA 4GNIA 4B3MK 4CBXA 4RW9A 3LZJA 2BGGA 4CJRA 4CJUA 3U9DA 4N47A 1N6QA 3VQPA 4X65K 3AVGA 1RDWX 3HBTA 3CPWM 3CJ7A 3SUNA 2ZJQL 4FK0A 3ID6A 2PZSA 2WOMA 3VEXA 4Z4CA 2P5GA 4MDBA 4RCHA 3G0ZA 4E1MA 3V9XA 1JJ2M 2O4IA 1IBKK 1RCHA 3CJCA 2VG6A 3BEXA 1R0AA 3H6EA 5HRSA 1S6QA 2PFUA 4IFVA 3LALA 4M3WA 3GG4A 2X6NA 4M63C 4PKGA 5T7BA 2R7YA 3DRPA 4W5TA 5AQVA 2F4VK 3J8AA 1T44A 5B8HA 3FR0A 1Q9XA 4E7KA 1WSEA 4BRFA 2P9SB 5I3UA 3LM2A 3HSCA 4IEEA 3J80O 3HT3A 4CGIA 4DFPA 4A59A 4FPBA 4IDHA 1DTTA 1Q7YO 3MEDA 3OYAA 3DLRA 4PA1A 3CJAA 3L4QA 2HNYA 5AQSA 3V4IA 1EWQA 3F9KA 1BGXT 3LDPA 3KTQA 4F3OA 3T19A 4Z4EA 3SUOA 1VQPN 3L2QA 4DUZK 3HXMA 4JKGA 3NGYA 3QINA 1RT5A 4Z0UA 2GELA 1Q86O 4DU1A 1S1XA 2GWJA 5M1OA 1BISA 3VQ7A 1YIJN 4WFBL 5CYMA 3ITHA 4BRPA 2E6MA 1VAZA 4CFDA 5J1EA 3P38A 1NGDA 2P9IA 4R79A 3OYEA 4J2AA 5HL7L 3K2PA 2CGLA 5AQUA 2RHKA 1LAWA 4BQLA 4IO8A 1RNHA 5A2QO 5KRSA 2GUPA 3KLHA 1D4XA 3AO2A 1I94K 1DGKN 2UUCK 5AFUA 4M3YA 1WOQA 1XMQK 2QXLA 3NH2A 4BC4A 2ASOA 3SYZA 1NNEA 4BDYA 3DLEA 3PIPL 4IZ9A 3OYLA 2X78A 4Z4GA 2OZSA 3CC7N 3VQEA 3ISNC 3SI6A 4CJPA 4E19A 2O8CB 4CK2A 3I56N 4QS8A 3JSMA 2RE2A 5GAGP 1SS6A 3H45C 5BR9A 1YAGA 1ATNA 2QKKA 3U6FA 4C1NK 5AQLA 4FJ7A 4CZHA 2GEMA 2A40A 4OX9K 3B8AX 3DXMA 1I3AA 2YHBA 2NRRA 3NE6A 4BRKA 1LW2A 1NMNA 4F8RA 4DQSA 4CI6A 3F73A 4DV2K 3DJCA 3U4LA 1ZC6A 3WXMB 2CH5A 1HKGA 3VEYA 1SL2A 4NO7A 1KAYA 3VETA 2DFHA 2QW9A 3SAFA 5CHIA 4KRFA 3MWTA 4FSVA 2I7PA 3PX6A 1HYSA 1GLEG 3JS6A 5DK5A 3LANA 4KTWA 1ESVA 2O8BA 3TSUA 4PWDA 3TTDA 2VG5A 5GADP 4IOCL 1SKWA 4KHNA 4BG9A 3SV4A 2UU9K 2Q31A 2ZWHA 3B6OA 2CH6A 1N8RO 4CFCA 3LP3A 4JN4A 4BGAA 4H03B 4I6MB 4FWNA 3WNHA 5HRRA 1KQSM 1IV0A 1RT1A 5AQQA 3CCMN 4FYDA 4DMNA 4RW4A 4C1NI 2VWBA 4MFBA 2PYJA 3BP8A 3ZT2A 1BQNA 3CCQN 1BQMA 3LP2A 2P9NA 4FCYA 1IJJA 4CJVA 2ITGA 4CEDA 2GTDA 2W41A 2YHXA 5C24A 1XWLA 3OYIA 4U67L 2FBYA 4IFYA 1YVNA 4DLEA 4IOXA 3QIOA 4JKFA 4AHSA 5KPTA 3MN5A 3VQ9A 4IFEA 4OKJA 4X62K 3ZSQA 2HMIA 1TL1A 3EY1A 4CECA 4DR2K 5EU7A 2YCHA 1C1BA 3HTVA 2P9KB 4BRHA 4CZGA 3QEXA 1VQON 1XC9A 1NGGA 4CGGA 4JK7A 5ELZA 4GKKK 3DMJA 4LD0A 1XHZA 4CZIA 3MEGA 3AA5X 3AV9A 3Q7BA 3HJFA 1KAXA 4BGBA 3DXKB 4H0PA 3OJSA 3AVKA 1BO5O 3AVNA 1EXQA 4JKCA 2F9WA 1J53A 2GUIA 1S1UA 3D45A 1NKCA 2G8VA 2HF4A 4DTXA 1HNIA 2D0PA 2Z1IA 3D6RA 3HM8A 4RW8A 4IDKA 4CGHA 4JYAK 2ATQA 1ZXOA 4KREA 1IO2A 3C6UA 4ZTJA 4QCLA 3VEOA 1U2VB 4PL7A 1HLUA 3CHWA 3OYJA 5BPLA 1GLJO 2HBJA 2XY5A 1U4BA 5AQRA 4GVEA 4H0YB 1Z05A 3O1BA 3J81O 3PV8A 1NM1A 2G8IA 1P8ZA 2ASMA 4DSJA 1TKZA 2HHTA 5C0YA 4KAZA 4YOUA 1BUPA 3V9SA 3HL8A 1MU2A 4O8UA 4HTUA 4B9UA 3U3GA 3KIOA 4B08A 2HW3A 1NLVA 4K0KK 4JKDA 4OO1J 2WONA 3ZSXA 2WBNA 3ULEB 3LDOA 3PUFA 2OANA 1X1PA 3LL3A 1WN7A 3OA9A 5HBMA 1BDGA 4DLGA 3OYCA 2HSTA 4B9SA 2HHQA 5MLCQ 4DB3A 4BE2A 4JEPA 1VQ4N 1D8YA 5JS1A 4KB1A 4PL8A 5AQWA 5AZJA 5BPMA 4OKKA 4KO0A 3T1HK 3ZX0A 3LWLA 1A5XA 2O8FB 4JAXA 4XH5A 1P90A 4KFBA 4CD1A 3WQTA 1QHTA 5JICA 1RT3A 2DFEA 2ZGZA 4HVJA 3MMVA 4K42A 4N5SA 1QE1A 1U2VA 2EWSA 4Z4IA 3TTFA 3NF9A 3CMEN 5FDLA 4EP4A 1EX4A 3O9UA 1VQNN 1DEJA 4JV5K 5JVGL 1NKEA 1N34K 5KGXA 3TARA 2IS3A 4H4MA 2UUAK 4KH6A 4H0OA 1G15A 1S1VA 5LY3A 3KZBA 1M1KO 4NYNA 2PYLA 3R9PA 4JK8A 3VGKA 1NJXA 4FK2A 2D0CA 3IUCA 1HPMA 4JRQA 2YNHA 4O0IA 1OH7A 4BRIA 1WSHA 3T1YK 4WQ5A 2QTDA 1HR0K 4JRPA 4PKIA 2QWQA 4DV1K 3IG1A 1KRPA 4WQ4C 3CF5L 1REVA 3LDNA 1ATSA 3FLCO 4PUOA 3QLHA 3FZKA 3O3GA 3WNFA 4MO4A 4CBUA 1W2BM 2DTUA 2IAJA 1NK9A 3SZ2A 4B1YB 5AQFA 4HCBA 1TK8A 3UIQA 5KGWA 1BCMA 4B9QA 1VQ5N 4DFMA 3CJ9A 3O9SA 3O8MA 3E9OA 3QEVA 4BRGA 3RRHA 1YHQN 1EP4A 4Z4FA 1E4GT 1S1TA 3V9ZA 2VGNA 4BREA 1HUXA 1NK6A 2QKBA 4M3UA 3VQ6A 3ALYA 3AGRA 3I8DA 5GAEP 3LDLA 4B1XB 1ZBLA 3NF8A 3KD1E 5AJ3K 3PX4A 3N4QA 3HK2A 3K5NA 1NGJA 3CIPA 2VWJA 1F21A 3NFAA 1L3UA 4Y0WA 3UKUA 1T6DA 2WUSA 4IWVA 4LSNA 3HYFA 5M1KA 3ZSZA 2RF2A 4DF4A 3CCRN 1HNZK 3ZLJA 2P9IB 4CGJA 5C2FA 3RMDA 3EE9A 3VTIA 2FBXA 4ICLA 4JI7K 4QAGA 1MWKA 4DU4A 1VSHA 1YT3A 4M41A 3OYDA 4CK1A 4B3TK 4B1WB 1QSSA 3IS9A 2D0AA 5AQHA 3CG7A 2E2NA 4BR0A 1TYQA 4NXMK 1VRUA 3PX0A 4B1ZA 1NG9A 1TKDA 3AA2A 2A41A 4AHTA 1JLGA 3UB5A 2HNZA 1KVCA 4CZKA 4FLVA 1L3VA 2HVIA 1N33K 2ZM6K 1RTDA 1BWFO 1U49A 2NUBA 4W5NA 4DU3A 1TUUA 3LAMA 4BQZA 1C0TA 3MX2A 1TAQA 3EN9A 3MWPA 4Q5VA 3NMUA 4KI4A 2WFBA 4DFJA 4HUFA 1QQMA 3M6GA 1NJZA 1NJIO 1IBMK 1WUAA 5M1FA 1S3XA 4MQ3A 2XHBA 3THYA 3HOTA 3THXA 3C6HA 4NCGA 1T03A 3CCLN 2NRXA 4E7HA 4JI4K 2BDPA 5F0XA 1RILA 4CHOA 1FKPA 3WXJA 2RN2A 1BOTO 5AFUH 4V19S 3AO3A 5AZIA 4AHCA 3RSEA 3RMBA 2QWPA 3O9RA 4HCCA 2XY8A 5J2NA 4CW7B 3HP6A 2A1RA 4FOIA 4DV5K 1KLMA 4A57A 1J5OA 4B3OA 3O1WA 1VQLN 1VSFA 4EZ6A 3FZHA 1A5VA 4C23A 4FLZA 3MCAB 5D3GA 2NRWA 3WXLA 1OKJA 3C0BA 2Z1HA 1QHAA 4KTZA 3VOVA 1U04A 1D9FA 3VEZA 1X3MA 4RWTA 3T69A 4CJLA 5ADXA 2AJQA 2O8EA 4O8KA 3Q7CA 4JD2B 3PSFA 2E8AA 1N5YA 3E01A 2O8DA 1YJWN 2OZMA 3ENHA 3CC2N 3LPTA 5E26A 3ZT1A 2Z1JA 4JI6K 3P83D 4FLTA 4CEQA 1ZYQA 4BC5A 1J6ZA 5C25A 5SWMA 2G8HA 3HVRA 2GV9A 3HPOA 1V4SA 2QM1A 4CD3A 4B8AB 3IDHA 4C8NA 2UXBK 3MAQA 1JLEA 4CF9A 3CM6A 3HM9A 5HP1A 2P1JA 4PQUA 5J2MA 3C6AA 2XRIA 1KSPA 1HQEA 3HVTA 4C8OA 4HWIA 3VQ4A 1G99A 2OPSA 3KWGA 1GLDG 4FO0A 1HMVA 3KHYA 4BRDA 4H0VB 5C2DA 3E1YA 3MXJA 5FPNA 1XNQK 1QS4A 1S22A 4DWIA 3H46O 4UQGA 5I42A 3CM5A 5M1PA 4M7XA 4FJLA 3BGRA 1QSLA 1QZ5A 1TUYA 4GMJB 1C0MA 2G8FA 4DS5A 2WC9A 1J54A 1RDUA 3D2EA 3ID8A 4BWJA 3M3ZA 4YORA 4GV6A 1S9EA 3KK7A 3SQ1A 1T7PA 2QXFA 4FOEA 3QESA 2DFFA 4LY7A 3SBTA 4DV0K 4C8KA 4BVPA 3O9QA 4X66K 1OH5A 3W0LA 4PHTX 4ISEA 3L2VA 5CZ1A 5EOYA 2IVOA 4CEOA 3OTOK 3O6WA 1JLBA 1YUWA 3K5OA 3M5RA 4RG8A 4H5WA 3KLEA 3WXKA 1EETA 3C7NA 1GLAG 2JGUA 1FW6A 3AY9A 4BWMA 5EXWA 1BI4A 4KV8A 4BY9C 1EWRA 2NNWA 3P31A 5GIPA 3AVFA 1IKWA 3GDQA 4CJ7A 4B9VA 2PBDA 4IEIA 1KVAA 3LAKA 4LF6K 3NGZA 3VQAA 4CIFA 5AQJA 5KQ8A 4CJKA 5HOOA 3OS0A 2O8DB 1EQYA 1D5AA 2V51B 2YKNA 5ADXH 3LM9A 4YOWA 1IG9A 4QS7A 2VQEK 2PY5A 2QWLA 1RTIA 2UYTA 3IKMA 3RMCA 2V52B 4EZ9A 3BZCA 3QBWA 4BDZA 3KLIA 4DSEA 3VQBA 2A42A 2O8FA 4AM7A 2D0OA 3T1AA 2WTUA 4Y1DA 3FZMA 2ZE2A 4E7IA 1XHXA 1IKYA 3R6MA 3ZT0A 3ATUA 4NCBA 2OPQA 5LMNK 2Q3SA 4B9TA 1VSKA 2O8BB 4CIEA 1Q81O 1U47A 1XC3A 2XO7A 4LC9B 3K9KA 5AQPA 1KAZA 4E0DA 4YOXA 4DTRA 2PAVA 2Q2RA 4BR7A 3CC4N 4JNEA 4GKJK 4Q0BA 4FJMA 2P9UB 4AQYK 1KTQA 4FM0A 3FZFA 1RBRA 1K8KB 4B3RK 1YI2N 3V9UA 1DTQA 3ZEUB 3TPQA 4CGDA 3VQ8A 4KTQA 3THYB 2D5RA 2YHWA 5AQXA 3KLGA 4M3ZA 4FLXA 4KPYA 3ZSOA 2CGJA 4F3TA 1BG3A 2VQFK 3PO5A 4JKAA 3S3NA 2YJEA 3NHGA 1KXPA 4K25A 3CJBA 3D2FB 1QVFM 3ZYYX 3SAHA 2YV0X 1K9MO 2P9UA 3H08A 3H1QA 4FJKA 1TYQB 1NOZA 3V9WA 1RT7A 1OVQA 1SKSA 1YF5L 1HKCA 5KPRA 2XY7A 2HHXA 1L3SA 3MN7A 3JYTA 2FBTA 4NLBA 4IO9L 4DTNA 1UAXA 2YX6A 2E2OA 1LWCA 3AVCA 3NGIA 4J8FA 4BR5A 4CJ5A 3P39A 3SQ0A 3R8EA 2GBZA 3DXKA 5HLFA 3OW2M 4LH5A 4FM1A 3HI0A 4EAHD 4DV6K 3AVMA 5KQDA 1B92A 1QQOA 3G4SN 1HNXK 4A5BA 2W42A 1X9JA 1HJRA 2QK9A 1C0FA 2YNFA 3SK3A 1ZBUA 1NKBA 1TL3A 1OH8A 3WNEA 4DR5K 2JWKA 1CZAN 3ZEUA 4QOZB 3J7ZO 3WT0A 3UE5A 4W5OA 1K6YA 4DTOA 4KHUA 1VSEA 4Y1CA 2O4GA 3P1GA 4JI5K 1VSLA 1NGHA 4DV7K 1NK0A 3TAFA 4KKOA 4FM2A 3RWUA 2GX9A 3QMLA 4DQQA 3O08A 3AVIA 4BR4A 4L8RB 4ID5A 2LSNA 1TV6A 4G1QA 4IBNA 1RT2A 5FROA 5J2QA 3TANA 4CERA 2FF6A 1RDBA 4I2PA 2F7TA 3HP9A 1GLBG 4YOVA 4B1UB 1GOBA 3OYMA 4FWRA 2FSJA 2P9PB 4EFHA 3AO4A 5SZTA 2E20A 3VF6A 3AA3A 4E1JA 1T6CA 1VRTA 4A2BA 3OHRA 3D7EO 3GBTA 4CBWA 1ITGA 3QEIA 4DV4K 2QI2A 3SPZA 1K73O 1TGOA 4KB0A 3T3FA 1JLAA 3CYMA 1IBLK 3IAYA 4FPAA 2HNDA 3R1XA 4FWQA 5CY4A 2ASPA 4M45A 2OTJN 2HOEA 4FWLA 3ULEA 1RBVA 1WAJA 3S9HA 1SL1A 2RKIA 5DMRA 3N4PA 4DQIA 3AVLA 1VHXA 3SQ4A 2YHYA 3K57A 4JS5A 5EVZA 4CZJA 3LDQA 3AVAA 5TKYA 2D4WA 1RBUA 3RMAA 2IC3A 2Q97A 3C94A 3V81A 3L3VA 4MLEA 1IKXA 4F9OA 2F9TA 5CYQA 4J2DA 4UY8O 1NK7A 3OYGA 3A5OC 1BIUA 4BR9A 1LOTB 5BRDA 1T05A 1QSYA 1QQCA 5GINA 3VGLA 4CIGA 3VMFB 5IT9O 4OLAA 4AHRA 4F2SA 2A3ZA 2B5JA 4WYBA 3A2FA 3AGKA 3NF7A 3TTCA 4O5BA 4CK3A 4CJ4A 3CCJN 4CZFA 1LV5A 3ZT3A 2YJFA 3DOLA 1DLOA 1CXQA 4H5VA 2HMPA 4O5FA 3SUQA 3IFRA 4CFAA 2ZJRL 3U8XA 1JCFA 1FJGK 4BRCA 4CHYA 1SZ2A 4JI0K 2Z1GA 3C6TA 3AAQA 3K0SA 1JXEA 2Q36A 3RTVA 4KHPK 4J2BA 5HRNA 3U9ZA 1YJ9N 4PKHA 1Q9YA 2I7NA 3AO1A 2DY4A 4FLWA 4CGFA 1HJOA 3V1OA 2ZD1A 4E7JA 1W7AA 4M42A 4H5TA 1HX1A 1RTHA 4LSLA 1N36K 2OYQA 1GLFO 3THXB 4I9QA 3VPZA 2ZQBA 3THWA 3HPGA 1S6PA 4HUGA 1EKEA 4B9NA 1HPZA 1Y97A 1XI1A 2QWMA 4M3XA 4CCHA 2X6SA 1CZ9A 5C10A 1NMDA 2P5OA 1I39A 1JL1A 4OPAA 3WNGA 2NZTA 4BC2A 3LP0A 4JKGB 1NGBA 2E6LA 3JXUA 5AQIA 3O5BA 4EHTA 1VQ9N 3CQYA 2Q0RA 2QWNA 4CVNE 2YKMA 4FWMA 2QWRA 5C42A 3VERA 4CJWA 2IVPA 1S72N 1M90O 3KKSA 4M3RA 3THWB 4M7YA 4BDPA 3HRGA 3MK6A 4DKWA 3E66A 3O4WA 3RR7A 3VQDA 1S1WA 3QEPA 1U48A 1WSJA 4CF0A 4DSFA 4CJEA 4OGEA 4CZMA 3TAPA 4DQ8A 4LF7K 3L6QA 3OS2A 3G6EN 2BANA 4N76A 3V1QA 4DR6K 1JLCA 4E7LA 1SQKA 1DT9A 3QBXA 5BPNA 4N56A 1U45A 3NVMA 1C0UA 1B9FA 4B8CA 3S3OA 2A1SA 3O4QA 2AA4A 1ILYA 3CQXA 4IJAA 2EX3A 1T8EA 4ELVA 4OLBA 3D2FA 1SL0A 1NGEA 3CQ8A 2YNIA 3QERA 2HHVA 1TKXA 5E84A 4FJHA 2OPRA 4KI6A 2UXDK 2D1KA 4A5AA 2AP1A 3VGMA 1KFSA 4IKFA 3CETA 1LAVA 3DAWA 5BN9A 3M8QA 3O9TA 3I33A 2VG7A 2HVHA 3EEQA 3ZETA 5LL6Z 4DQRA 5KTQA 4OPHA 3W3DA 3D0PA 1YITN 3GL1A 4K8ZA 4BRLA 3EZWA 2E1YA 3FFKB 1W0HA 4DG1A 1NJYA 3PO4A 4DR3K 3SUPA 4B1VA 5LJVA 1NU0A 1U6ZA 4LF4K 1B9DA 3NH0A 5AQYA 3VENA 4GW6A 1VSJA 2VCPA 4KHQA 1ZBSA 3DYAA 3K58A 2Y1IA 2VGMA 3BUZB 3CERA 3SMPA 4YNQA 2JWLA 1HYVA 3H3NO 4KH5A 5CR4A 4OPJA 4GV9A 4O4GA 5E41A 4JS4A 3AVBA 4GV3A 3QETA 2A6AA 4IJNA 3O80A 1JLQA 1IH7A 4MDAA 3SQ2A 2G8WA 1NOYA 3A0IX 4X64K 1YVUA 4I7FA 4OJRA 4FXDA 1SV5A 3I0SA 3CMAN 3NCIA 4GY2B 3RVCA 1NK4A 3WUHA 2KLAA 3U3YA 2HF3A 4JLHA 1X9MA 5TKWA 3OVNA 3QO9A 3PSIA 2XY6A 2B6AA 2V7YA 4ILJA 1C1AA 3L0QA 4DR1K 4AF1A 3TABA 1ASUA 3NVKA 2ZF5O 4RW6A 3HO1A 4FZYA 1GLLO 3AO5A 2KHOA 1E4FT 4CF2A 3CJ1A 1BI4B 3S41A 1Q8IA 1TKTA 4KHWA 1K8AO 3L2WA 2HHHK 3MEEA 1J9AA 1TVRA 3R3LA 5KI6A 3KK1A 5EY4A 2KKZA 4FWSA 2FBVA 3A8YA 4DQPA 3M8RA 3MXIA 4B9LA 3E9LA 3MN9A 3F9MA 1BIZA 2CGKA 2DPNA 4H4OA 3B6PA 3VA0A 3L3UA 3ZX2A 2E2PA 2VWKA 3AARA 3QEWA 3GE1A 2FXUA 1LW0A 1BA0A 3OYFA 3I55N 4Z4HA 1WBDA 1WNSA 1YTAA 2Y1JA 3BF3A 3AVHA 3PLAA 1RDDA 1JCGA 4IG3A 4E3SA 5BR8K 3EZ5A 2KFNA 4FJNA 1H1VA 3VF2A 3VTHA 3K5LA 2P9NB 2F96A 1Q82O 1HNVA 3DLKA 2FSKA 5AZIB 4WCEL 4FW1A 2ETJA 4JI3K 4FLUA 3KK2A 1BCOA 3VQ5A 5JLFA 1T3VA 4LH4A 1VQ7N 1NJWA 4DHYA 2NRZA 3F5TA 1QTMA 5M1QA 4FJXA 4CEEA 1UA0A 4ZTFA 1FK9A 5LMUK 5AQTA 3L8BA 1C6VA 1NGFA 4MLHA 4G9ZA 3ENBA 1LCUA 1X3NA 1NWKA 2E4LA 2IIRA 4HHTA 3CCSN 5AZJB 4KHSA 3FFIA 4KBOA 1WAFA 1KLNA 1RT6A 3DLHA 2ITMA 2P51A 3OBYA 3SNNA 2IDOA 1CXUA 3NDKA 4U7BA 5DM7L 4J2EA 1JKHA 1HQUA 1NK5A 3QB0A 3A5LC 4IOAL 4CJ3A 5F1XA 4ELTA 3BF1A 4DUYK 4DF8A 1ZBIA 4XH1A 4CEBA 3LZIA 3ZX3A 3TR8A 1VK0A 3FZLA 1BU6O 4OKEA 3ATVA 3SCXA
chains in the Genus database with same CATH topology
4I2PA 1BHLA 2PZSA 2WOMA 4Z4CA 3HP9A 2VWJA 1F21A 2P5GA 1GOBA 3NFAA 1L3UA 3G0ZA 4E1MA 3V9XA 3NH1A 3OYMA 2O4IA 1RCHA 1O1WA 4LSNA 3VA3A 2VG6A 1R0AA 5HRSA 1GOAA 1S6QA 3AO4A 3HYFA 3LALA 4IFVA 4M3WA 3ZSZA 2RF2A 2X6NA 5T7BA 2R7YA 4DF4A 3VQCA 5SZTA 3DRPA 4W5TA 3L2UA 4CGJA 1JLFA 4EP5A 3RMDA 3AA3A 2FBXA 4ICLA 1Q9XA 4QAGA 1WSEA 1VRTA 4E7KA 1VSHA 1YT3A 4DU4A 4M41A 5I3UA 3OYDA 1ITGA 4CK1A 4BE1A 3QEIA 1QSSA 3HT3A 4IG0A 4CGIA 3IS9A 4F2RA 4DFPA 2KW4A 3SPZA 2D0AA 1TGOA 1DTTA 4DTJA 3CG7A 3T3FA 1JLAA 4KB0A 2HHWA 3CYMA 3DM2A 3IAYA 3TAGA 3MEDA 2HNDA 3RRGA 3OYAA 5CY4A 3DLRA 3TWHA 4ID1A 4PA1A 1ASVA 4M45A 3KLFA 1VRUA 3PX0A 2BE2A 2HNYA 1VSIA 3V1RA 3V4IA 3F9KA 1BGXT 1RBVA 4CHNA 1TKDA 3AA2A 4AHTA 3KTQA 1JLGA 1WAJA 4F3OA 3T19A 3S9HA 2HNZA 1SL1A 4Z4EA 1KVCA 3SUOA 4FLVA 1L3VA 2RKIA 2HVIA 5DMRA 3L2QA 4CEAA 1RTDA 3AVLA 1D9DA 4DQIA 3SQ4A 3K57A 3HXMA 1U49A 4FJ9A 4JS5A 2NUBA 4W5NA 3NGYA 3QINA 1RT5A 1Z25A 4DU3A 3AVAA 3L2RA 4Z0UA 3DOKA 3DRSA 3LAMA 1C0TA 1RBUA 1TAQA 3OYHA 4DU1A 3RMAA 1S1XA 1WLJA 2IC3A 3C94A 4Q5VA 3V81A 5HROA 4KI4A 4DFJA 3L3VA 4R5PA 1IKXA 4J2DA 5CYQA 4HUFA 3SJJA 1NJZA 2F8TA 1NK7A 3OYGA 1BISA 3VQ7A 3KKRA 1BIUA 4C8MA 3ULDA 1T05A 1QSYA 1QQCA 5CYMA 4MQ3A 3ITHA 5K14A 4CE9A 4CIGA 2XHBA 2E6MA 4CFDA 5J1EA 4NCGA 1SKRA 1T03A 4OLAA 4AHRA 2G8KA 2X74A 4CEZA 4F2SA 3OYEA 4E7HA 4FJGA 4J2AA 2B5JA 4E89A 2BDPA 1RILA 3A2FA 4FZXC 3K2PA 4CHOA 1FKPA 1KVBA 1LAWA 2OPPA 1RNHA 5KRSA 3NF7A 4O0JA 3KLHA 4O5BA 3AO2A 2RN2A 4CK3A 4M3YA 1L5UA 4CJ4A 3O3HA 4KHYA 1LV5A 3NH2A 3SYZA 1HYZA 3IRXA 4BDYA 3DLEA 3AO3A 3ZT3A 1YTUA 4AHCA 3RMBA 1CZBA 1W9HA 3DOLA 4HCCA 1DLOA 1CXQA 1ASWA 3K59A 3OYLA 4CHQA 1VSDA 2X78A 2XY8A 5J2NA 4Z4GA 4DTMA 1UOCA 3HP6A 3SUQA 2A1RA 2OZSA 3VQEA 3ISNC 2FC0A 4CFAA 3EYZA 1KLMA 3SI6A 4CJPA 4E19A 4XIUA 3ZSWA 4CK2A 1J5OA 3JSMA 4CHYA 4B3OA 2Z1GA 3C6TA 1X9SA 4RW7A 4PY5A 1JXEA 3RTVA 4J2BA 1VSFA 5HRNA 4EZ6A 1A5VA 4FLZA 3M8SA 4AHUA 5D3GA 1LWFA 3U6FA 2QKKA 1Q9YA 2Z1HA 1ZBHA 3AO1A 4KTZA 4FJ7A 2DY4A 1U04A 3C95A 1D9FA 4FLWA 4CGFA 3V1OA 2ZD1A 4E7JA 4M42A 1I3AA 2YHBA 4CJLA 3NE6A 1UA1A 1RTHA 4LSLA 2AJQA 2OYQA 1LW2A 4N41A 4I9QA 2ZQBA 4F8RA 3HPGA 1N5YA 3E01A 1S6PA 4HUGA 4DQSA 3F73A 1WSFA 1EKEA 2OZMA 4CJFA 1SUQA 4CEFA 4B9NA 4ELUA 1HPZA 1Y97A 1XI1A 4FJ8A 3LPTA 4CCHA 2X6SA 3ZT1A 1CZ9A 4M3XA 2Z1JA 2P5OA 1I39A 3ZSRA 4DSIA 1JL1A 3P83D 3WNGA 4FLTA 1SL2A 3BDPA 4CEQA 2DFHA 2I5JA 5C25A 5SWMA 1ZYQA 2G8HA 3LP0A 5J2PA 3DRRA 2E6LA 3I0RA 3HVRA 1KCFA 3LPUA 2GV9A 4KRFA 3HPOA 3TAMA 3PX6A 1HYSA 4B8AB 4C8NA 4DTPA 2EHGA 2YNGA 2F8SA 3AVJA 5DK5A 3LANA 3MAQA 1JLEA 1UWBA 1WSGA 4CF9A 4KTWA 3CM6A 1NK8A 3HM9A 5HP1A 2P1JA 2YKMA 4PQUA 1FXXA 5C42A 4BACA 4PWDA 2VG5A 2HB5A 4CJWA 5J2MA 1SKWA 4CF1A 2XRIA 3SCXA 1HQEA 3HVTA 3KKSA 3SV4A 4GVMA 1KSPA 4C8OA 4KHNA 3SPYA 3B6OA 4M3RA 3VQ4A 2OPSA 5HRPA 4CFCA 4BDPA 5CZ2A 1WSIA 1HMVA 3LP3A 3PY8A 3RR7A 2HHSA 3CFOA 3VQDA 1S1WA 4DTUA 3THVA 4NCAA 3MXJA 3QEPA 1U48A 3WNHA 4FK0A 1WSJA 5HRRA 4CF0A 4DSFA 4CJEA 4OGEA 1QS4A 3TAPA 4OGCA 1RT1A 4B9MA 4DWIA 3OS2A 1L3TA 4UQGA 2BANA 5I42A 4N76A 3CM5A 3V1QA 4CESA 3OY9A 5FRMA 4FYDA 4DMNA 4RW4A 2KZMA 1JLCA 4E7LA 2KZZA 1S9GA 4MFBA 3HSTB 2PYJA 4FJLA 4N56A 1U45A 3BGRA 3M8PA 1QSLA 3ZT2A 1BQNA 1RDAA 1C0UA 1B9FA 4GMJB 1C0MA 2G8FA 4CF8A 4B8CA 1BQMA 1ZBFA 3ZSVA 3S3OA 3LP2A 4DS5A 4FCYA 3MXMA 2A1SA 4CJVA 1J54A 2ITGA 3O4QA 4CEDA 4BWJA 5C24A 4DTSA 1XWLA 3OYIA 1TK0A 5FRNA 3KK3A 1A5WA 1S9EA 2EX3A 2FBYA 1T8EA 4ELVA 4FW2A 4IFYA 4OLBA 1SL0A 3SQ1A 1T7PA 3CQ8A 3QNNA 2YNIA 4DLEA 2QXFA 3QIOA 3DLGA 3QERA 3QESA 2HHVA 2DFFA 4AHSA 4LY7A 3OYBA 3ASMA 1TKXA 2YHAA 3VQ9A 1TAUA 4OKJA 3ZSQA 2OPRA 2HMIA 2IOCA 4FJHA 1TL1A 4KI6A 4C8KA 3EY1A 4CECA 1KFSA 4IKFA 1LAVA 4BE0A 4DSKA 3M8QA 5EU7A 4FK4A 1C1BA 3L2VA 1VSMA 2VG7A 2HVHA 5CZ1A 3QEXA 4DQRA 3KD5E 5KTQA 4CEOA 3D0PA 1XC9A 1JLBA 3K5OA 4RG8A 2RPIA 3NBPA 4WE1A 4CGGA 4FZZA 4DFKA 3AA4A 4K8ZA 1HRHA 3LP1A 1W0HA 4DG1A 3DMJA 4LD0A 3KLEA 1XHZA 1NJYA 3MEGA 3PO4A 1EETA 3AA5X 3S3MA 3AV9A 2JGUA 3KJVA 3SUPA 3HJFA 3VN5A 4W5RA 4CJSA 3OJSA 3O4NA 4K8XA 4BWMA 1B9DA 3AVKA 4AHVA 3NH0A 1BI4A 3AVNA 4KV8A 1EXQA 3CFRA 1CLQA 3AVFA 1IKWA 1J53A 4B9VA 4GW6A 1VSJA 4CHZA 2GUIA 1S1UA 3D45A 1NKCA 1KVAA 2G8VA 3DYAA 4C8LA 3LAKA 4FJ5A 4KHQA 3K58A 4DTXA 1HNIA 2Y1IA 3NGZA 2Z1IA 3VQAA 4CIFA 4CJKA 4RW8A 4YNQA 1S5JA 3OS0A 4IDKA 4HUEA 1HYVA 4OPJA 4CGHA 3QNOA 4FJIA 2ATQA 4O4GA 3NF6A 1D5AA 5E41A 1IO2A 3C6UA 4JS4A 4KREA 2YKNA 2KFZA 4ZTJA 4DSLA 4QCLA 1IG9A 3AVBA 1TK5A 3ZSYA 3QETA 2PY5A 1JLQA 1IH7A 3SQ2A 2G8WA 1NOYA 1RTIA 1YVUA 4I7FA 3RMCA 3OYJA 4EZ9A 1RDCA 4OJRA 3DLBA 4FXDA 4BDZA 1SV5A 3I0SA 3KLIA 4DSEA 2XY5A 1U4BA 3VQBA 2G8UA 3NCIA 3T1AA 1NK4A 4Y1DA 4CJQA 3PV8A 3U3YA 2ZE2A 2G8IA 4E7IA 4JLHA 1XHXA 1X9MA 4DSJA 1IKYA 1TKZA 3OVNA 3QO9A 3ZT0A 2HHTA 4KAZA 3K5MA 2KTQA 2XY6A 4NCBA 1BL3A 2B6AA 2OPQA 2Q3SA 4B9TA 1C1AA 1VSKA 1GOCA 1RBTA 4O44A 3V9SA 4CIEA 3HL8A 1MU2A 4HTUA 3TABA 4B9UA 1ASUA 1U47A 4RW6A 2OA8A 2XO7A 3HO1A 1FKOA 4FZYA 3DI6A 3AO5A 3U3GA 4CF2A 3KIOA 3RR8A 4E0DA 1BI4B 4B08A 1Q8IA 4DTRA 2HW3A 1TKTA 4KHWA 4AH9A 4Q0BA 3L2WA 3MEEA 4FJMA 1J9AA 1TVRA 2WONA 5KI6A 3KK1A 3ZSXA 1KTQA 4FM0A 3SV3A 4ZHRA 3PUFA 1RBRA 1X1PA 1WN7A 2FBVA 5JS2A 5HBMA 4DQPA 4DLGA 1C1CA 4W5QA 3M8RA 3OYCA 4OPKA 4B9SA 3V9UA 3MXIA 4B9LA 3CFPA 2HHQA 1DTQA 1JXBA 4CGDA 3ZCMA 3VQ8A 1BIZA 4H4OA 4KTQA 3B6PA 4BE2A 3TI0A 1D8YA 2D5RA 5JS1A 3VA0A 3KLGA 4CFBA 3TAQA 4M3ZA 3L3UA 4KB1A 1JL2A 4FLXA 2VWKA 4KPYA 1KFDA 3ZSOA 4CJTA 4OKKA 3QEWA 4KO0A 3NAEA 3LWLA 1A5XA 4F3TA 4I9LA 1LW0A 3PO5A 1RT4A 2D0BA 4KFBA 3OYFA 1QHTA 4Z4HA 1RT3A 4O55A 2DFEA 3S3NA 3HPHA 1WNSA 3NHGA 4HVJA 4CHPA 1YTAA 1RTJA 4N5SA 2Y1JA 1QE1A 1IKVA 2YV0X 3H08A 4FJKA 3AVHA 1NOZA 3V9WA 1RDDA 1RT7A 4E3SA 4IG3A 3LDSA 1SKSA 4Z4IA 3OJUA 3P5JA 3EZ5A 2XY7A 4FJNA 1LWEA 2KFNA 3VQQA 3NF9A 3O3FA 3K5LA 2HHUA 2HHXA 2F96A 5FDLA 4EP4A 1EX4A 1L3SA 3JYTA 3TANA 1Z26A 3TAEA 1HNVA 2FBTA 3DLKA 1NKEA 5KGXA 3TARA 2IS3A 4H4MA 4FW1A 2ETJA 1UAXA 4DTNA 4FLUA 3OYKA 1G15A 1S1VA 3V6DA 3KK2A 1LWCA 3AVCA 1BCOA 4NYNA 1RBSA 3NGIA 2PYLA 4CJ5A 3SQ0A 3VQ5A 3ZT4A 2GBZA 3G10A 4I2QA 1X9WA 1NJXA 4FJJA 4DS4A 4LH4A 4FK2A 2D0CA 4E1NA 1NJWA 1QTMA 4JRQA 5HLFA 2YNHA 3OYNA 4LH5A 4FM1A 3MECA 4CEEA 4O0IA 1WSHA 1UA0A 4FJXA 4ZTFA 1FK9A 3AVMA 4JRPA 2JLEA 1B92A 3IG1A 1C6VA 3QIPA 2W42A 3L8BA 1KRPA 4H8KA 3OS1A 5KRTA 4FLYA 1HJRA 2QK9A 2YNFA 1REVA 4AILC 1ZBUA 2KQ2A 4PUOA 2E4LA 3QLHA 4HHTA 4KHSA 1NKBA 3FFIA 1TL3A 3O3GA 4FVMA 3WNEA 1WAFA 3WNFA 1KLNA 2DTUA 1RT6A 2IAJA 2IGIA 4TSXA 1NK9A 3DLHA 2B4JA 3SZ2A 4HCBA 2P51A 4QOZB 3SNNA 2IDOA 4W5OA 1TK8A 3UIQA 1K6YA 5KGWA 4YFUA 4F4KA 4OVLA 1CXUA 1BCMA 3NDKA 4DTOA 3LWMA 4KHUA 4J2EA 4DFMA 1JKHA 1HQUA 1VSEA 2O4GA 3P1GA 4Y1CA 1NK5A 4M3TA 4NYFA 1VSLA 3QEVA 3RRHA 1NK0A 1EP4A 4CJ3A 4Z4FA 1S1TA 3V9ZA 3TAFA 4KKOA 4FM2A 4ELTA 4RW9A 3RWUA 3LZJA 1NK6A 2QKBA 4M3UA 2BGGA 4CJRA 3VQ6A 4CJUA 4DQQA 1ZBIA 4N47A 4DF8A 3ALYA 3VQPA 4CEBA 3AVIA 1N6QA 4L8RB 3I8DA 3AVGA 4ID5A 3LZIA 2LSNA 1TV6A 4G1QA 4IBNA 3TR8A 3SUNA 1ZBLA 3NF8A 3KD1E 1RT2A 1VK0A 3PX4A 3HK2A 5FROA 5J2QA 4OKEA 4CERA 3K5NA 1RDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2P A;  1BHL A;  2PZS A;  2WOM A;  4Z4C A;  3HP9 A;  2VWJ A;  1F21 A;  2P5G A;  1GOB A;  3NFA A;  1L3U A;  3G0Z A;  4E1M A;  3V9X A;  3NH1 A;  3OYM A;  2O4I A;  1RCH A;  1O1W A;  4LSN A;  3VA3 A;  2VG6 A;  1R0A A;  5HRS A;  1GOA A;  1S6Q A;  3AO4 A;  3HYF A;  3LAL A;  4IFV A;  4M3W A;  3ZSZ A;  2RF2 A;  2X6N A;  5T7B A;  2R7Y A;  4DF4 A;  3VQC A;  5SZT A;  3DRP A;  4W5T A;  3L2U A;  4CGJ A;  1JLF A;  4EP5 A;  3RMD A;  3AA3 A;  2FBX A;  4ICL A;  1Q9X A;  4QAG A;  1WSE A;  1VRT A;  4E7K A;  1VSH A;  1YT3 A;  4DU4 A;  4M41 A;  5I3U A;  3OYD A;  1ITG A;  4CK1 A;  4BE1 A;  3QEI A;  1QSS A;  3HT3 A;  4IG0 A;  4CGI A;  3IS9 A;  4F2R A;  4DFP A;  2KW4 A;  3SPZ A;  2D0A A;  1TGO A;  1DTT A;  4DTJ A;  3CG7 A;  3T3F A;  1JLA A;  4KB0 A;  2HHW A;  3CYM A;  3DM2 A;  3IAY A;  3TAG A;  3MED A;  2HND A;  3RRG A;  3OYA A;  5CY4 A;  3DLR A;  3TWH A;  4ID1 A;  4PA1 A;  1ASV A;  4M45 A;  3KLF A;  1VRU A;  3PX0 A;  2BE2 A;  2HNY A;  1VSI A;  3V1R A;  3V4I A;  3F9K A;  1BGX T;  1RBV A;  4CHN A;  1TKD A;  3AA2 A;  4AHT A;  3KTQ A;  1JLG A;  1WAJ A;  4F3O A;  3T19 A;  3S9H A;  2HNZ A;  1SL1 A;  4Z4E A;  1KVC A;  3SUO A;  4FLV A;  1L3V A;  2RKI A;  2HVI A;  5DMR A;  3L2Q A;  4CEA A;  1RTD A;  3AVL A;  1D9D A;  4DQI A;  3SQ4 A;  3K57 A;  3HXM A;  1U49 A;  4FJ9 A;  4JS5 A;  2NUB A;  4W5N A;  3NGY A;  3QIN A;  1RT5 A;  1Z25 A;  4DU3 A;  3AVA A;  3L2R A;  4Z0U A;  3DOK A;  3DRS A;  3LAM A;  1C0T A;  1RBU A;  1TAQ A;  3OYH A;  4DU1 A;  3RMA A;  1S1X A;  1WLJ A;  2IC3 A;  3C94 A;  4Q5V A;  3V81 A;  5HRO A;  4KI4 A;  4DFJ A;  3L3V A;  4R5P A;  1IKX A;  4J2D A;  5CYQ A;  4HUF A;  3SJJ A;  1NJZ A;  2F8T A;  1NK7 A;  3OYG A;  1BIS A;  3VQ7 A;  3KKR A;  1BIU A;  4C8M A;  3ULD A;  1T05 A;  1QSY A;  1QQC A;  5CYM A;  4MQ3 A;  3ITH A;  5K14 A;  4CE9 A;  4CIG A;  2XHB A;  2E6M A;  4CFD A;  5J1E A;  4NCG A;  1SKR A;  1T03 A;  4OLA A;  4AHR A;  2G8K A;  2X74 A;  4CEZ A;  4F2S A;  3OYE A;  4E7H A;  4FJG A;  4J2A A;  2B5J A;  4E89 A;  2BDP A;  1RIL A;  3A2F A;  4FZX C;  3K2P A;  4CHO A;  1FKP A;  1KVB A;  1LAW A;  2OPP A;  1RNH A;  5KRS A;  3NF7 A;  4O0J A;  3KLH A;  4O5B A;  3AO2 A;  2RN2 A;  4CK3 A;  4M3Y A;  1L5U A;  4CJ4 A;  3O3H A;  4KHY A;  1LV5 A;  3NH2 A;  3SYZ A;  1HYZ A;  3IRX A;  4BDY A;  3DLE A;  3AO3 A;  3ZT3 A;  1YTU A;  4AHC A;  3RMB A;  1CZB A;  1W9H A;  3DOL A;  4HCC A;  1DLO A;  1CXQ A;  1ASW A;  3K59 A;  3OYL A;  4CHQ A;  1VSD A;  2X78 A;  2XY8 A;  5J2N A;  4Z4G A;  4DTM A;  1UOC A;  3HP6 A;  3SUQ A;  2A1R A;  2OZS A;  3VQE A;  3ISN C;  2FC0 A;  4CFA A;  3EYZ A;  1KLM A;  3SI6 A;  4CJP A;  4E19 A;  4XIU A;  3ZSW A;  4CK2 A;  1J5O A;  3JSM A;  4CHY A;  4B3O A;  2Z1G A;  3C6T A;  1X9S A;  4RW7 A;  4PY5 A;  1JXE A;  3RTV A;  4J2B A;  1VSF A;  5HRN A;  4EZ6 A;  1A5V A;  4FLZ A;  3M8S A;  4AHU A;  5D3G A;  1LWF A;  3U6F A;  2QKK A;  1Q9Y A;  2Z1H A;  1ZBH A;  3AO1 A;  4KTZ A;  4FJ7 A;  2DY4 A;  1U04 A;  3C95 A;  1D9F A;  4FLW A;  4CGF A;  3V1O A;  2ZD1 A;  4E7J A;  4M42 A;  1I3A A;  2YHB A;  4CJL A;  3NE6 A;  1UA1 A;  1RTH A;  4LSL A;  2AJQ A;  2OYQ A;  1LW2 A;  4N41 A;  4I9Q A;  2ZQB A;  4F8R A;  3HPG A;  1N5Y A;  3E01 A;  1S6P A;  4HUG A;  4DQS A;  3F73 A;  1WSF A;  1EKE A;  2OZM A;  4CJF A;  1SUQ A;  4CEF A;  4B9N A;  4ELU A;  1HPZ A;  1Y97 A;  1XI1 A;  4FJ8 A;  3LPT A;  4CCH A;  2X6S A;  3ZT1 A;  1CZ9 A;  4M3X A;  2Z1J A;  2P5O A;  1I39 A;  3ZSR A;  4DSI A;  1JL1 A;  3P83 D;  3WNG A;  4FLT A;  1SL2 A;  3BDP A;  4CEQ A;  2DFH A;  2I5J A;  5C25 A;  5SWM A;  1ZYQ A;  2G8H A;  3LP0 A;  5J2P A;  3DRR A;  2E6L A;  3I0R A;  3HVR A;  1KCF A;  3LPU A;  2GV9 A;  4KRF A;  3HPO A;  3TAM A;  3PX6 A;  1HYS A;  4B8A B;  4C8N A;  4DTP A;  2EHG A;  2YNG A;  2F8S A;  3AVJ A;  5DK5 A;  3LAN A;  3MAQ A;  1JLE A;  1UWB A;  1WSG A;  4CF9 A;  4KTW A;  3CM6 A;  1NK8 A;  3HM9 A;  5HP1 A;  2P1J A;  2YKM A;  4PQU A;  1FXX A;  5C42 A;  4BAC A;  4PWD A;  2VG5 A;  2HB5 A;  4CJW A;  5J2M A;  1SKW A;  4CF1 A;  2XRI A;  3SCX A;  1HQE A;  3HVT A;  3KKS A;  3SV4 A;  4GVM A;  1KSP A;  4C8O A;  4KHN A;  3SPY A;  3B6O A;  4M3R A;  3VQ4 A;  2OPS A;  5HRP A;  4CFC A;  4BDP A;  5CZ2 A;  1WSI A;  1HMV A;  3LP3 A;  3PY8 A;  3RR7 A;  2HHS A;  3CFO A;  3VQD A;  1S1W A;  4DTU A;  3THV A;  4NCA A;  3MXJ A;  3QEP A;  1U48 A;  3WNH A;  4FK0 A;  1WSJ A;  5HRR A;  4CF0 A;  4DSF A;  4CJE A;  4OGE A;  1QS4 A;  3TAP A;  4OGC A;  1RT1 A;  4B9M A;  4DWI A;  3OS2 A;  1L3T A;  4UQG A;  2BAN A;  5I42 A;  4N76 A;  3CM5 A;  3V1Q A;  4CES A;  3OY9 A;  5FRM A;  4FYD A;  4DMN A;  4RW4 A;  2KZM A;  1JLC A;  4E7L A;  2KZZ A;  1S9G A;  4MFB A;  3HST B;  2PYJ A;  4FJL A;  4N56 A;  1U45 A;  3BGR A;  3M8P A;  1QSL A;  3ZT2 A;  1BQN A;  1RDA A;  1C0U A;  1B9F A;  4GMJ B;  1C0M A;  2G8F A;  4CF8 A;  4B8C A;  1BQM A;  1ZBF A;  3ZSV A;  3S3O A;  3LP2 A;  4DS5 A;  4FCY A;  3MXM A;  2A1S A;  4CJV A;  1J54 A;  2ITG A;  3O4Q A;  4CED A;  4BWJ A;  5C24 A;  4DTS A;  1XWL A;  3OYI A;  1TK0 A;  5FRN A;  3KK3 A;  1A5W A;  1S9E A;  2EX3 A;  2FBY A;  1T8E A;  4ELV A;  4FW2 A;  4IFY A;  4OLB A;  1SL0 A;  3SQ1 A;  1T7P A;  3CQ8 A;  3QNN A;  2YNI A;  4DLE A;  2QXF A;  3QIO A;  3DLG A;  3QER A;  3QES A;  2HHV A;  2DFF A;  4AHS A;  4LY7 A;  3OYB A;  3ASM A;  1TKX A;  2YHA A;  3VQ9 A;  1TAU A;  4OKJ A;  3ZSQ A;  2OPR A;  2HMI A;  2IOC A;  4FJH A;  1TL1 A;  4KI6 A;  4C8K A;  3EY1 A;  4CEC A;  1KFS A;  4IKF A;  1LAV A;  4BE0 A;  4DSK A;  3M8Q A;  5EU7 A;  4FK4 A;  1C1B A;  3L2V A;  1VSM A;  2VG7 A;  2HVH A;  5CZ1 A;  3QEX A;  4DQR A;  3KD5 E;  5KTQ A;  4CEO A;  3D0P A;  1XC9 A;  1JLB A;  3K5O A;  4RG8 A;  2RPI A;  3NBP A;  4WE1 A;  4CGG A;  4FZZ A;  4DFK A;  3AA4 A;  4K8Z A;  1HRH A;  3LP1 A;  1W0H A;  4DG1 A;  3DMJ A;  4LD0 A;  3KLE A;  1XHZ A;  1NJY A;  3MEG A;  3PO4 A;  1EET A;  3AA5 X;  3S3M A;  3AV9 A;  2JGU A;  3KJV A;  3SUP A;  3HJF A;  3VN5 A;  4W5R A;  4CJS A;  3OJS A;  3O4N A;  4K8X A;  4BWM A;  1B9D A;  3AVK A;  4AHV A;  3NH0 A;  1BI4 A;  3AVN A;  4KV8 A;  1EXQ A;  3CFR A;  1CLQ A;  3AVF A;  1IKW A;  1J53 A;  4B9V A;  4GW6 A;  1VSJ A;  4CHZ A;  2GUI A;  1S1U A;  3D45 A;  1NKC A;  1KVA A;  2G8V A;  3DYA A;  4C8L A;  3LAK A;  4FJ5 A;  4KHQ A;  3K58 A;  4DTX A;  1HNI A;  2Y1I A;  3NGZ A;  2Z1I A;  3VQA A;  4CIF A;  4CJK A;  4RW8 A;  4YNQ A;  1S5J A;  3OS0 A;  4IDK A;  4HUE A;  1HYV A;  4OPJ A;  4CGH A;  3QNO A;  4FJI A;  2ATQ A;  4O4G A;  3NF6 A;  1D5A A;  5E41 A;  1IO2 A;  3C6U A;  4JS4 A;  4KRE A;  2YKN A;  2KFZ A;  4ZTJ A;  4DSL A;  4QCL A;  1IG9 A;  3AVB A;  1TK5 A;  3ZSY A;  3QET A;  2PY5 A;  1JLQ A;  1IH7 A;  3SQ2 A;  2G8W A;  1NOY A;  1RTI A;  1YVU A;  4I7F A;  3RMC A;  3OYJ A;  4EZ9 A;  1RDC A;  4OJR A;  3DLB A;  4FXD A;  4BDZ A;  1SV5 A;  3I0S A;  3KLI A;  4DSE A;  2XY5 A;  1U4B A;  3VQB A;  2G8U A;  3NCI A;  3T1A A;  1NK4 A;  4Y1D A;  4CJQ A;  3PV8 A;  3U3Y A;  2ZE2 A;  2G8I A;  4E7I A;  4JLH A;  1XHX A;  1X9M A;  4DSJ A;  1IKY A;  1TKZ A;  3OVN A;  3QO9 A;  3ZT0 A;  2HHT A;  4KAZ A;  3K5M A;  2KTQ A;  2XY6 A;  4NCB A;  1BL3 A;  2B6A A;  2OPQ A;  2Q3S A;  4B9T A;  1C1A A;  1VSK A;  1GOC A;  1RBT A;  4O44 A;  3V9S A;  4CIE A;  3HL8 A;  1MU2 A;  4HTU A;  3TAB A;  4B9U A;  1ASU A;  1U47 A;  4RW6 A;  2OA8 A;  2XO7 A;  3HO1 A;  1FKO A;  4FZY A;  3DI6 A;  3AO5 A;  3U3G A;  4CF2 A;  3KIO A;  3RR8 A;  4E0D A;  1BI4 B;  4B08 A;  1Q8I A;  4DTR A;  2HW3 A;  1TKT A;  4KHW A;  4AH9 A;  4Q0B A;  3L2W A;  3MEE A;  4FJM A;  1J9A A;  1TVR A;  2WON A;  5KI6 A;  3KK1 A;  3ZSX A;  1KTQ A;  4FM0 A;  3SV3 A;  4ZHR A;  3PUF A;  1RBR A;  1X1P A;  1WN7 A;  2FBV A;  5JS2 A;  5HBM A;  4DQP A;  4DLG A;  1C1C A;  4W5Q A;  3M8R A;  3OYC A;  4OPK A;  4B9S A;  3V9U A;  3MXI A;  4B9L A;  3CFP A;  2HHQ A;  1DTQ A;  1JXB A;  4CGD A;  3ZCM A;  3VQ8 A;  1BIZ A;  4H4O A;  4KTQ A;  3B6P A;  4BE2 A;  3TI0 A;  1D8Y A;  2D5R A;  5JS1 A;  3VA0 A;  3KLG A;  4CFB A;  3TAQ A;  4M3Z A;  3L3U A;  4KB1 A;  1JL2 A;  4FLX A;  2VWK A;  4KPY A;  1KFD A;  3ZSO A;  4CJT A;  4OKK A;  3QEW A;  4KO0 A;  3NAE A;  3LWL A;  1A5X A;  4F3T A;  4I9L A;  1LW0 A;  3PO5 A;  1RT4 A;  2D0B A;  4KFB A;  3OYF A;  1QHT A;  4Z4H A;  1RT3 A;  4O55 A;  2DFE A;  3S3N A;  3HPH A;  1WNS A;  3NHG A;  4HVJ A;  4CHP A;  1YTA A;  1RTJ A;  4N5S A;  2Y1J A;  1QE1 A;  1IKV A;  2YV0 X;  3H08 A;  4FJK A;  3AVH A;  1NOZ A;  3V9W A;  1RDD A;  1RT7 A;  4E3S A;  4IG3 A;  3LDS A;  1SKS A;  4Z4I A;  3OJU A;  3P5J A;  3EZ5 A;  2XY7 A;  4FJN A;  1LWE A;  2KFN A;  3VQQ A;  3NF9 A;  3O3F A;  3K5L A;  2HHU A;  2HHX A;  2F96 A;  5FDL A;  4EP4 A;  1EX4 A;  1L3S A;  3JYT A;  3TAN A;  1Z26 A;  3TAE A;  1HNV A;  2FBT A;  3DLK A;  1NKE A;  5KGX A;  3TAR A;  2IS3 A;  4H4M A;  4FW1 A;  2ETJ A;  1UAX A;  4DTN A;  4FLU A;  3OYK A;  1G15 A;  1S1V A;  3V6D A;  3KK2 A;  1LWC A;  3AVC A;  1BCO A;  4NYN A;  1RBS A;  3NGI A;  2PYL A;  4CJ5 A;  3SQ0 A;  3VQ5 A;  3ZT4 A;  2GBZ A;  3G10 A;  4I2Q A;  1X9W A;  1NJX A;  4FJJ A;  4DS4 A;  4LH4 A;  4FK2 A;  2D0C A;  4E1N A;  1NJW A;  1QTM A;  4JRQ A;  5HLF A;  2YNH A;  3OYN A;  4LH5 A;  4FM1 A;  3MEC A;  4CEE A;  4O0I A;  1WSH A;  1UA0 A;  4FJX A;  4ZTF A;  1FK9 A;  3AVM A;  4JRP A;  2JLE A;  1B92 A;  3IG1 A;  1C6V A;  3QIP A;  2W42 A;  3L8B A;  1KRP A;  4H8K A;  3OS1 A;  5KRT A;  4FLY A;  1HJR A;  2QK9 A;  2YNF A;  1REV A;  4AIL C;  1ZBU A;  2KQ2 A;  4PUO A;  2E4L A;  3QLH A;  4HHT A;  4KHS A;  1NKB A;  3FFI A;  1TL3 A;  3O3G A;  4FVM A;  3WNE A;  1WAF A;  3WNF A;  1KLN A;  2DTU A;  1RT6 A;  2IAJ A;  2IGI A;  4TSX A;  1NK9 A;  3DLH A;  2B4J A;  3SZ2 A;  4HCB A;  2P51 A;  4QOZ B;  3SNN A;  2IDO A;  4W5O A;  1TK8 A;  3UIQ A;  1K6Y A;  5KGW A;  4YFU A;  4F4K A;  4OVL A;  1CXU A;  1BCM A;  3NDK A;  4DTO A;  3LWM A;  4KHU A;  4J2E A;  4DFM A;  1JKH A;  1HQU A;  1VSE A;  2O4G A;  3P1G A;  4Y1C A;  1NK5 A;  4M3T A;  4NYF A;  1VSL A;  3QEV A;  3RRH A;  1NK0 A;  1EP4 A;  4CJ3 A;  4Z4F A;  1S1T A;  3V9Z A;  3TAF A;  4KKO A;  4FM2 A;  4ELT A;  4RW9 A;  3RWU A;  3LZJ A;  1NK6 A;  2QKB A;  4M3U A;  2BGG A;  4CJR A;  3VQ6 A;  4CJU A;  4DQQ A;  1ZBI A;  4N47 A;  4DF8 A;  3ALY A;  3VQP A;  4CEB A;  3AVI A;  1N6Q A;  4L8R B;  3I8D A;  3AVG A;  4ID5 A;  3LZI A;  2LSN A;  1TV6 A;  4G1Q A;  4IBN A;  3TR8 A;  3SUN A;  1ZBL A;  3NF8 A;  3KD1 E;  1RT2 A;  1VK0 A;  3PX4 A;  3HK2 A;  5FRO A;  5J2Q A;  4OKE A;  4CER A;  3K5N A;  1RDB A; 
#chains in the Genus database with same CATH topology
 2ZJP L;  1BHL A;  4JI8 K;  2YI1 A;  3ZET B;  2BUP A;  3NH1 A;  3DLL L;  1O1W A;  3VA3 A;  1RFQ A;  2P9L B;  4CZE A;  1GOA A;  3VQC A;  4CZL A;  1NBW A;  5LJW A;  3L2U A;  3CCU N;  1JLF A;  4EP5 A;  5BRE A;  5I9E B;  5JLH A;  3IMX A;  2HBL A;  4YY3 K;  2BTF A;  1NGI A;  4BE1 A;  4IG0 A;  4F2R A;  2KW4 A;  4H5R A;  2OCE A;  4DTJ A;  1QQN A;  2HHW A;  3DM2 A;  3TAG A;  3AAP A;  3RRG A;  3PIO L;  1MA9 B;  4ID1 A;  3KLF A;  1ASV A;  2J4R A;  3ENO A;  3J7Y P;  3TWH A;  2BE2 A;  1VSI A;  3V1R A;  4CHN A;  4LF9 K;  3CCE N;  1ATR A;  4ISF A;  4H5N A;  4ISG A;  4NLC A;  4BC3 A;  3SBG A;  2FF3 B;  1XMO K;  4CEA A;  1D9D A;  2FSN A;  3VES A;  3VF4 A;  5AR0 A;  4FJ9 A;  2P9P A;  1EO1 A;  1Z25 A;  3L2R A;  3DOK A;  3DRS A;  3OYH A;  5HRO A;  1WLJ A;  3C7N B;  1DKG D;  2HBM A;  4R5P A;  4JD2 A;  3SJJ A;  4JK9 A;  5EX5 A;  5H1S Q;  2F8T A;  4BRO A;  5KPZ A;  3KKR A;  3DXM B;  1OVY A;  4C8M A;  1V4T A;  3ULD A;  5K14 A;  4CE9 A;  1SKR A;  5BRF A;  5JMV A;  1HKB A;  1Y64 A;  2G8K A;  2X74 A;  4CEZ A;  4FJG A;  4E89 A;  4FZX C;  2VYP A;  1KVB A;  2OPP A;  4XH4 A;  3VEW A;  3HZ6 A;  4O0J A;  3JAM O;  4LFA K;  1L5U A;  3O3H A;  4KHY A;  1YJN N;  1HYZ A;  4BRM A;  3IRX A;  1VQK N;  1YTU A;  5DM6 L;  5BRH A;  1CZB A;  4NXN K;  1W9H A;  3C65 A;  3RSE B;  1ASW A;  2H3G X;  3K59 A;  1WB9 A;  4CHQ A;  1VSD A;  3TSQ A;  4DTM A;  1UOC A;  2P9S A;  2FC0 A;  3EYZ A;  4XIU A;  1NGC A;  3ZSW A;  3J7A P;  5FLX O;  2NRH A;  1X9S A;  4RW7 A;  4PY5 A;  2P9L A;  3E9P A;  3SLC A;  1XQS C;  3MX5 A;  3M8S A;  4AM6 A;  4AHU A;  5GIO A;  1LWF A;  1ZBH A;  4BVO A;  3C95 A;  4FWO A;  5FPM A;  1UA1 A;  2O8C A;  4N41 A;  1VQM N;  1XUP O;  4FWP A;  1WSF A;  4CJF A;  1SUQ A;  4CEF A;  1K8K A;  4ELU A;  4FJ8 A;  5AQG A;  4FL9 A;  4YDU A;  3QDK A;  3ZSR A;  4DSI A;  3CD6 N;  2V7Z A;  4LFB K;  3BDP A;  4JKB A;  2I5J A;  1NGA A;  3P4I A;  5J2P A;  3DRR A;  3I0R A;  3G25 A;  1KCF A;  3LPU A;  3WXI A;  3TAM A;  1C0G A;  3A5M C;  1N32 K;  4DTP A;  2EHG A;  2HBK A;  2YNG A;  4MO5 A;  2F8S A;  3AVJ A;  4KH4 A;  1UWB A;  1WSG A;  1NK8 A;  1CLQ A;  1FXX A;  4BAC A;  5CE3 A;  2HB5 A;  1QZ6 A;  4CF1 A;  4GVM A;  3SPY A;  4BRQ A;  5HRP A;  4HTL A;  5CZ2 A;  1WSI A;  4ILH A;  5AQN A;  4A61 A;  4WFN L;  3G71 N;  3PY8 A;  2HHS A;  3CFO A;  4DTU A;  3THV A;  4NCA A;  2Q1N A;  5IWA K;  2W40 A;  4B9M A;  4OGC A;  4NB4 A;  4QS9 A;  1L3T A;  5FPE A;  2KZM A;  4CES A;  3OY9 A;  5FRM A;  3UKR A;  3QFP A;  4FVU A;  2KZZ A;  1S9G A;  3HST B;  3M8P A;  3SMS A;  1RDA A;  4CF8 A;  3ZSV A;  1ZBF A;  5C12 A;  2FLO A;  3EE8 A;  3MXM A;  2QEX N;  1Z6R A;  1W97 L;  4H0X B;  4DTS A;  1TK0 A;  5FRN A;  3KK3 A;  4BG8 A;  1A5W A;  2NRV A;  4JI2 K;  4FW2 A;  4ILG B;  3QNN A;  4A62 A;  1IG8 A;  3DLG A;  3OYB A;  1O13 A;  2YHA A;  3ASM A;  1TAU A;  3WQU A;  2IOC A;  4BE0 A;  4DSK A;  2NRT A;  3DWL A;  4FK4 A;  2NLX A;  1R59 O;  4B3S K;  1VSM A;  3KD5 E;  3H1V X;  5AQK A;  1JCE A;  2RPI A;  3NBP A;  4WE1 A;  4FZZ A;  4DFK A;  3AA4 A;  3WEE A;  1HRH A;  3T7Z A;  3LP1 A;  3K9J A;  5GAH P;  1SAZ A;  3S3M A;  3KJV A;  4LF5 K;  3VN5 A;  4W5R A;  4CJS A;  3TU5 A;  4YHH K;  3I8B A;  3O4N A;  4K8X A;  1WBB A;  3EO3 A;  4AHV A;  1MWM A;  3FE1 A;  3CFR A;  4YDU C;  5C15 A;  4CHZ A;  4JHD A;  4DCH A;  4C8L A;  4FJ5 A;  4A2A A;  2W6K A;  3CI5 A;  1J5E K;  1S5J A;  4HUE A;  2UUB K;  3QNO A;  4FJI A;  3NF6 A;  3UKR B;  1MDU B;  3SJH A;  2KFZ A;  4DSL A;  4JHD B;  3SAG A;  1TK5 A;  1KD1 O;  3ZSY A;  4XEI A;  5M1N A;  4YOT A;  3CPE A;  2ZGY A;  2UXC K;  2W6L A;  1RDC A;  3MDQ A;  3DLB A;  5JVH L;  1XNR K;  2G8U A;  2QA4 N;  3UKU B;  4DV3 K;  1BA1 A;  3QFU A;  4CJQ A;  3H3O B;  4JI1 K;  3EL2 A;  4WF9 L;  4I6M A;  3K5M A;  2KTQ A;  1BL3 A;  3OBW A;  3EKS A;  3D2E B;  4O44 A;  1GOC A;  1RBT A;  3L4I A;  5AQM A;  3F2K A;  2P9K A;  1E3M A;  2OA8 A;  3GOI A;  1FKO A;  3DI6 A;  3RR8 A;  3TSP A;  4JKE A;  3KWI A;  3MN6 A;  4EHU A;  4AH9 A;  2BH1 A;  4K41 A;  3SV3 A;  4Z94 A;  4ZHR A;  2IVN A;  5JS2 A;  1HNW K;  1C1C A;  4H0T B;  2A5X A;  4W5Q A;  1QVG M;  4OPK A;  1RGI A;  4IXC A;  3CFP A;  3FGU A;  1JXB A;  3ZCM A;  3MCP A;  3TI0 A;  2GWK A;  3WEE B;  4CFB A;  3TAQ A;  1JL2 A;  1Q18 A;  1KFD A;  4CJT A;  3NAE A;  4LFC K;  2O8E B;  2E2Q A;  4I9L A;  1RT4 A;  2D0B A;  1GLC G;  4WFA L;  4O55 A;  3HPH A;  4CHP A;  1RTJ A;  1IKV A;  4LF8 K;  3VEV A;  3HOS A;  4K43 A;  3LDS A;  1VQ8 N;  3OJU A;  1OH6 A;  3CXC M;  3P5J A;  1LWE A;  3VQQ A;  3O3F A;  1VQ6 N;  2HHU A;  3BY5 A;  3KVG A;  1Z26 A;  4WQ5 C;  3TAE A;  5BN8 A;  4YOY A;  3OYK A;  3V6D A;  1RBS A;  4WQ4 A;  2E5L K;  3ZT4 A;  3G10 A;  2E88 A;  4I2Q A;  1X9W A;  4L3Q A;  4FJJ A;  4DS4 A;  4DR4 K;  4E1N A;  5FPD A;  3OYN A;  3MEC A;  1KC8 O;  4BRN A;  4DR7 K;  2JLE A;  4BR2 A;  4RTF D;  3QIP A;  4FWK A;  4H8K A;  3OS1 A;  3A5N C;  5KRT A;  4FLY A;  4AIL C;  2E1Z A;  2KQ2 A;  4BRA A;  5F2R A;  3EKU A;  2Q0U A;  4FVM A;  1YXQ A;  2QWO A;  3M1F A;  3BZK A;  5AQZ A;  4TSX A;  2IGI A;  4EIA A;  2B4J A;  3CCV N;  4JKH A;  4F4K A;  3QIC A;  4YFU A;  4OVL A;  3LWM A;  5AQO A;  2OTL N;  4M3T A;  4NYF A;  4GNI A;  4B3M K;  4CBX A;  4RW9 A;  3LZJ A;  2BGG A;  4CJR A;  4CJU A;  3U9D A;  4N47 A;  1N6Q A;  3VQP A;  4X65 K;  3AVG A;  1RDW X;  3HBT A;  3CPW M;  3CJ7 A;  3SUN A;  2ZJQ L;  4FK0 A;  3ID6 A;  2PZS A;  2WOM A;  3VEX A;  4Z4C A;  2P5G A;  4MDB A;  4RCH A;  3G0Z A;  4E1M A;  3V9X A;  1JJ2 M;  2O4I A;  1IBK K;  1RCH A;  3CJC A;  2VG6 A;  3BEX A;  1R0A A;  3H6E A;  5HRS A;  1S6Q A;  2PFU A;  4IFV A;  3LAL A;  4M3W A;  3GG4 A;  2X6N A;  4M63 C;  4PKG A;  5T7B A;  2R7Y A;  3DRP A;  4W5T A;  5AQV A;  2F4V K;  3J8A A;  1T44 A;  5B8H A;  3FR0 A;  1Q9X A;  4E7K A;  1WSE A;  4BRF A;  2P9S B;  5I3U A;  3LM2 A;  3HSC A;  4IEE A;  3J80 O;  3HT3 A;  4CGI A;  4DFP A;  4A59 A;  4FPB A;  4IDH A;  1DTT A;  1Q7Y O;  3MED A;  3OYA A;  3DLR A;  4PA1 A;  3CJA A;  3L4Q A;  2HNY A;  5AQS A;  3V4I A;  1EWQ A;  3F9K A;  1BGX T;  3LDP A;  3KTQ A;  4F3O A;  3T19 A;  4Z4E A;  3SUO A;  1VQP N;  3L2Q A;  4DUZ K;  3HXM A;  4JKG A;  3NGY A;  3QIN A;  1RT5 A;  4Z0U A;  2GEL A;  1Q86 O;  4DU1 A;  1S1X A;  2GWJ A;  5M1O A;  1BIS A;  3VQ7 A;  1YIJ N;  4WFB L;  5CYM A;  3ITH A;  4BRP A;  2E6M A;  1VAZ A;  4CFD A;  5J1E A;  3P38 A;  1NGD A;  2P9I A;  4R79 A;  3OYE A;  4J2A A;  5HL7 L;  3K2P A;  2CGL A;  5AQU A;  2RHK A;  1LAW A;  4BQL A;  4IO8 A;  1RNH A;  5A2Q O;  5KRS A;  2GUP A;  3KLH A;  1D4X A;  3AO2 A;  1I94 K;  1DGK N;  2UUC K;  5AFU A;  4M3Y A;  1WOQ A;  1XMQ K;  2QXL A;  3NH2 A;  4BC4 A;  2ASO A;  3SYZ A;  1NNE A;  4BDY A;  3DLE A;  3PIP L;  4IZ9 A;  3OYL A;  2X78 A;  4Z4G A;  2OZS A;  3CC7 N;  3VQE A;  3ISN C;  3SI6 A;  4CJP A;  4E19 A;  2O8C B;  4CK2 A;  3I56 N;  4QS8 A;  3JSM A;  2RE2 A;  5GAG P;  1SS6 A;  3H45 C;  5BR9 A;  1YAG A;  1ATN A;  2QKK A;  3U6F A;  4C1N K;  5AQL A;  4FJ7 A;  4CZH A;  2GEM A;  2A40 A;  4OX9 K;  3B8A X;  3DXM A;  1I3A A;  2YHB A;  2NRR A;  3NE6 A;  4BRK A;  1LW2 A;  1NMN A;  4F8R A;  4DQS A;  4CI6 A;  3F73 A;  4DV2 K;  3DJC A;  3U4L A;  1ZC6 A;  3WXM B;  2CH5 A;  1HKG A;  3VEY A;  1SL2 A;  4NO7 A;  1KAY A;  3VET A;  2DFH A;  2QW9 A;  3SAF A;  5CHI A;  4KRF A;  3MWT A;  4FSV A;  2I7P A;  3PX6 A;  1HYS A;  1GLE G;  3JS6 A;  5DK5 A;  3LAN A;  4KTW A;  1ESV A;  2O8B A;  3TSU A;  4PWD A;  3TTD A;  2VG5 A;  5GAD P;  4IOC L;  1SKW A;  4KHN A;  4BG9 A;  3SV4 A;  2UU9 K;  2Q31 A;  2ZWH A;  3B6O A;  2CH6 A;  1N8R O;  4CFC A;  3LP3 A;  4JN4 A;  4BGA A;  4H03 B;  4I6M B;  4FWN A;  3WNH A;  5HRR A;  1KQS M;  1IV0 A;  1RT1 A;  5AQQ A;  3CCM N;  4FYD A;  4DMN A;  4RW4 A;  4C1N I;  2VWB A;  4MFB A;  2PYJ A;  3BP8 A;  3ZT2 A;  1BQN A;  3CCQ N;  1BQM A;  3LP2 A;  2P9N A;  4FCY A;  1IJJ A;  4CJV A;  2ITG A;  4CED A;  2GTD A;  2W41 A;  2YHX A;  5C24 A;  1XWL A;  3OYI A;  4U67 L;  2FBY A;  4IFY A;  1YVN A;  4DLE A;  4IOX A;  3QIO A;  4JKF A;  4AHS A;  5KPT A;  3MN5 A;  3VQ9 A;  4IFE A;  4OKJ A;  4X62 K;  3ZSQ A;  2HMI A;  1TL1 A;  3EY1 A;  4CEC A;  4DR2 K;  5EU7 A;  2YCH A;  1C1B A;  3HTV A;  2P9K B;  4BRH A;  4CZG A;  3QEX A;  1VQO N;  1XC9 A;  1NGG A;  4CGG A;  4JK7 A;  5ELZ A;  4GKK K;  3DMJ A;  4LD0 A;  1XHZ A;  4CZI A;  3MEG A;  3AA5 X;  3AV9 A;  3Q7B A;  3HJF A;  1KAX A;  4BGB A;  3DXK B;  4H0P A;  3OJS A;  3AVK A;  1BO5 O;  3AVN A;  1EXQ A;  4JKC A;  2F9W A;  1J53 A;  2GUI A;  1S1U A;  3D45 A;  1NKC A;  2G8V A;  2HF4 A;  4DTX A;  1HNI A;  2D0P A;  2Z1I A;  3D6R A;  3HM8 A;  4RW8 A;  4IDK A;  4CGH A;  4JYA K;  2ATQ A;  1ZXO A;  4KRE A;  1IO2 A;  3C6U A;  4ZTJ A;  4QCL A;  3VEO A;  1U2V B;  4PL7 A;  1HLU A;  3CHW A;  3OYJ A;  5BPL A;  1GLJ O;  2HBJ A;  2XY5 A;  1U4B A;  5AQR A;  4GVE A;  4H0Y B;  1Z05 A;  3O1B A;  3J81 O;  3PV8 A;  1NM1 A;  2G8I A;  1P8Z A;  2ASM A;  4DSJ A;  1TKZ A;  2HHT A;  5C0Y A;  4KAZ A;  4YOU A;  1BUP A;  3V9S A;  3HL8 A;  1MU2 A;  4O8U A;  4HTU A;  4B9U A;  3U3G A;  3KIO A;  4B08 A;  2HW3 A;  1NLV A;  4K0K K;  4JKD A;  4OO1 J;  2WON A;  3ZSX A;  2WBN A;  3ULE B;  3LDO A;  3PUF A;  2OAN A;  1X1P A;  3LL3 A;  1WN7 A;  3OA9 A;  5HBM A;  1BDG A;  4DLG A;  3OYC A;  2HST A;  4B9S A;  2HHQ A;  5MLC Q;  4DB3 A;  4BE2 A;  4JEP A;  1VQ4 N;  1D8Y A;  5JS1 A;  4KB1 A;  4PL8 A;  5AQW A;  5AZJ A;  5BPM A;  4OKK A;  4KO0 A;  3T1H K;  3ZX0 A;  3LWL A;  1A5X A;  2O8F B;  4JAX A;  4XH5 A;  1P90 A;  4KFB A;  4CD1 A;  3WQT A;  1QHT A;  5JIC A;  1RT3 A;  2DFE A;  2ZGZ A;  4HVJ A;  3MMV A;  4K42 A;  4N5S A;  1QE1 A;  1U2V A;  2EWS A;  4Z4I A;  3TTF A;  3NF9 A;  3CME N;  5FDL A;  4EP4 A;  1EX4 A;  3O9U A;  1VQN N;  1DEJ A;  4JV5 K;  5JVG L;  1NKE A;  1N34 K;  5KGX A;  3TAR A;  2IS3 A;  4H4M A;  2UUA K;  4KH6 A;  4H0O A;  1G15 A;  1S1V A;  5LY3 A;  3KZB A;  1M1K O;  4NYN A;  2PYL A;  3R9P A;  4JK8 A;  3VGK A;  1NJX A;  4FK2 A;  2D0C A;  3IUC A;  1HPM A;  4JRQ A;  2YNH A;  4O0I A;  1OH7 A;  4BRI A;  1WSH A;  3T1Y K;  4WQ5 A;  2QTD A;  1HR0 K;  4JRP A;  4PKI A;  2QWQ A;  4DV1 K;  3IG1 A;  1KRP A;  4WQ4 C;  3CF5 L;  1REV A;  3LDN A;  1ATS A;  3FLC O;  4PUO A;  3QLH A;  3FZK A;  3O3G A;  3WNF A;  4MO4 A;  4CBU A;  1W2B M;  2DTU A;  2IAJ A;  1NK9 A;  3SZ2 A;  4B1Y B;  5AQF A;  4HCB A;  1TK8 A;  3UIQ A;  5KGW A;  1BCM A;  4B9Q A;  1VQ5 N;  4DFM A;  3CJ9 A;  3O9S A;  3O8M A;  3E9O A;  3QEV A;  4BRG A;  3RRH A;  1YHQ N;  1EP4 A;  4Z4F A;  1E4G T;  1S1T A;  3V9Z A;  2VGN A;  4BRE A;  1HUX A;  1NK6 A;  2QKB A;  4M3U A;  3VQ6 A;  3ALY A;  3AGR A;  3I8D A;  5GAE P;  3LDL A;  4B1X B;  1ZBL A;  3NF8 A;  3KD1 E;  5AJ3 K;  3PX4 A;  3N4Q A;  3HK2 A;  3K5N A;  1NGJ A;  3CIP A;  2VWJ A;  1F21 A;  3NFA A;  1L3U A;  4Y0W A;  3UKU A;  1T6D A;  2WUS A;  4IWV A;  4LSN A;  3HYF A;  5M1K A;  3ZSZ A;  2RF2 A;  4DF4 A;  3CCR N;  1HNZ K;  3ZLJ A;  2P9I B;  4CGJ A;  5C2F A;  3RMD A;  3EE9 A;  3VTI A;  2FBX A;  4ICL A;  4JI7 K;  4QAG A;  1MWK A;  4DU4 A;  1VSH A;  1YT3 A;  4M41 A;  3OYD A;  4CK1 A;  4B3T K;  4B1W B;  1QSS A;  3IS9 A;  2D0A A;  5AQH A;  3CG7 A;  2E2N A;  4BR0 A;  1TYQ A;  4NXM K;  1VRU A;  3PX0 A;  4B1Z A;  1NG9 A;  1TKD A;  3AA2 A;  2A41 A;  4AHT A;  1JLG A;  3UB5 A;  2HNZ A;  1KVC A;  4CZK A;  4FLV A;  1L3V A;  2HVI A;  1N33 K;  2ZM6 K;  1RTD A;  1BWF O;  1U49 A;  2NUB A;  4W5N A;  4DU3 A;  1TUU A;  3LAM A;  4BQZ A;  1C0T A;  3MX2 A;  1TAQ A;  3EN9 A;  3MWP A;  4Q5V A;  3NMU A;  4KI4 A;  2WFB A;  4DFJ A;  4HUF A;  1QQM A;  3M6G A;  1NJZ A;  1NJI O;  1IBM K;  1WUA A;  5M1F A;  1S3X A;  4MQ3 A;  2XHB A;  3THY A;  3HOT A;  3THX A;  3C6H A;  4NCG A;  1T03 A;  3CCL N;  2NRX A;  4E7H A;  4JI4 K;  2BDP A;  5F0X A;  1RIL A;  4CHO A;  1FKP A;  3WXJ A;  2RN2 A;  1BOT O;  5AFU H;  4V19 S;  3AO3 A;  5AZI A;  4AHC A;  3RSE A;  3RMB A;  2QWP A;  3O9R A;  4HCC A;  2XY8 A;  5J2N A;  4CW7 B;  3HP6 A;  2A1R A;  4FOI A;  4DV5 K;  1KLM A;  4A57 A;  1J5O A;  4B3O A;  3O1W A;  1VQL N;  1VSF A;  4EZ6 A;  3FZH A;  1A5V A;  4C23 A;  4FLZ A;  3MCA B;  5D3G A;  2NRW A;  3WXL A;  1OKJ A;  3C0B A;  2Z1H A;  1QHA A;  4KTZ A;  3VOV A;  1U04 A;  1D9F A;  3VEZ A;  1X3M A;  4RWT A;  3T69 A;  4CJL A;  5ADX A;  2AJQ A;  2O8E A;  4O8K A;  3Q7C A;  4JD2 B;  3PSF A;  2E8A A;  1N5Y A;  3E01 A;  2O8D A;  1YJW N;  2OZM A;  3ENH A;  3CC2 N;  3LPT A;  5E26 A;  3ZT1 A;  2Z1J A;  4JI6 K;  3P83 D;  4FLT A;  4CEQ A;  1ZYQ A;  4BC5 A;  1J6Z A;  5C25 A;  5SWM A;  2G8H A;  3HVR A;  2GV9 A;  3HPO A;  1V4S A;  2QM1 A;  4CD3 A;  4B8A B;  3IDH A;  4C8N A;  2UXB K;  3MAQ A;  1JLE A;  4CF9 A;  3CM6 A;  3HM9 A;  5HP1 A;  2P1J A;  4PQU A;  5J2M A;  3C6A A;  2XRI A;  1KSP A;  1HQE A;  3HVT A;  4C8O A;  4HWI A;  3VQ4 A;  1G99 A;  2OPS A;  3KWG A;  1GLD G;  4FO0 A;  1HMV A;  3KHY A;  4BRD A;  4H0V B;  5C2D A;  3E1Y A;  3MXJ A;  5FPN A;  1XNQ K;  1QS4 A;  1S22 A;  4DWI A;  3H46 O;  4UQG A;  5I42 A;  3CM5 A;  5M1P A;  4M7X A;  4FJL A;  3BGR A;  1QSL A;  1QZ5 A;  1TUY A;  4GMJ B;  1C0M A;  2G8F A;  4DS5 A;  2WC9 A;  1J54 A;  1RDU A;  3D2E A;  3ID8 A;  4BWJ A;  3M3Z A;  4YOR A;  4GV6 A;  1S9E A;  3KK7 A;  3SQ1 A;  1T7P A;  2QXF A;  4FOE A;  3QES A;  2DFF A;  4LY7 A;  3SBT A;  4DV0 K;  4C8K A;  4BVP A;  3O9Q A;  4X66 K;  1OH5 A;  3W0L A;  4PHT X;  4ISE A;  3L2V A;  5CZ1 A;  5EOY A;  2IVO A;  4CEO A;  3OTO K;  3O6W A;  1JLB A;  1YUW A;  3K5O A;  3M5R A;  4RG8 A;  4H5W A;  3KLE A;  3WXK A;  1EET A;  3C7N A;  1GLA G;  2JGU A;  1FW6 A;  3AY9 A;  4BWM A;  5EXW A;  1BI4 A;  4KV8 A;  4BY9 C;  1EWR A;  2NNW A;  3P31 A;  5GIP A;  3AVF A;  1IKW A;  3GDQ A;  4CJ7 A;  4B9V A;  2PBD A;  4IEI A;  1KVA A;  3LAK A;  4LF6 K;  3NGZ A;  3VQA A;  4CIF A;  5AQJ A;  5KQ8 A;  4CJK A;  5HOO A;  3OS0 A;  2O8D B;  1EQY A;  1D5A A;  2V51 B;  2YKN A;  5ADX H;  3LM9 A;  4YOW A;  1IG9 A;  4QS7 A;  2VQE K;  2PY5 A;  2QWL A;  1RTI A;  2UYT A;  3IKM A;  3RMC A;  2V52 B;  4EZ9 A;  3BZC A;  3QBW A;  4BDZ A;  3KLI A;  4DSE A;  3VQB A;  2A42 A;  2O8F A;  4AM7 A;  2D0O A;  3T1A A;  2WTU A;  4Y1D A;  3FZM A;  2ZE2 A;  4E7I A;  1XHX A;  1IKY A;  3R6M A;  3ZT0 A;  3ATU A;  4NCB A;  2OPQ A;  5LMN K;  2Q3S A;  4B9T A;  1VSK A;  2O8B B;  4CIE A;  1Q81 O;  1U47 A;  1XC3 A;  2XO7 A;  4LC9 B;  3K9K A;  5AQP A;  1KAZ A;  4E0D A;  4YOX A;  4DTR A;  2PAV A;  2Q2R A;  4BR7 A;  3CC4 N;  4JNE A;  4GKJ K;  4Q0B A;  4FJM A;  2P9U B;  4AQY K;  1KTQ A;  4FM0 A;  3FZF A;  1RBR A;  1K8K B;  4B3R K;  1YI2 N;  3V9U A;  1DTQ A;  3ZEU B;  3TPQ A;  4CGD A;  3VQ8 A;  4KTQ A;  3THY B;  2D5R A;  2YHW A;  5AQX A;  3KLG A;  4M3Z A;  4FLX A;  4KPY A;  3ZSO A;  2CGJ A;  4F3T A;  1BG3 A;  2VQF K;  3PO5 A;  4JKA A;  3S3N A;  2YJE A;  3NHG A;  1KXP A;  4K25 A;  3CJB A;  3D2F B;  1QVF M;  3ZYY X;  3SAH A;  2YV0 X;  1K9M O;  2P9U A;  3H08 A;  3H1Q A;  4FJK A;  1TYQ B;  1NOZ A;  3V9W A;  1RT7 A;  1OVQ A;  1SKS A;  1YF5 L;  1HKC A;  5KPR A;  2XY7 A;  2HHX A;  1L3S A;  3MN7 A;  3JYT A;  2FBT A;  4NLB A;  4IO9 L;  4DTN A;  1UAX A;  2YX6 A;  2E2O A;  1LWC A;  3AVC A;  3NGI A;  4J8F A;  4BR5 A;  4CJ5 A;  3P39 A;  3SQ0 A;  3R8E A;  2GBZ A;  3DXK A;  5HLF A;  3OW2 M;  4LH5 A;  4FM1 A;  3HI0 A;  4EAH D;  4DV6 K;  3AVM A;  5KQD A;  1B92 A;  1QQO A;  3G4S N;  1HNX K;  4A5B A;  2W42 A;  1X9J A;  1HJR A;  2QK9 A;  1C0F A;  2YNF A;  3SK3 A;  1ZBU A;  1NKB A;  1TL3 A;  1OH8 A;  3WNE A;  4DR5 K;  2JWK A;  1CZA N;  3ZEU A;  4QOZ B;  3J7Z O;  3WT0 A;  3UE5 A;  4W5O A;  1K6Y A;  4DTO A;  4KHU A;  1VSE A;  4Y1C A;  2O4G A;  3P1G A;  4JI5 K;  1VSL A;  1NGH A;  4DV7 K;  1NK0 A;  3TAF A;  4KKO A;  4FM2 A;  3RWU A;  2GX9 A;  3QML A;  4DQQ A;  3O08 A;  3AVI A;  4BR4 A;  4L8R B;  4ID5 A;  2LSN A;  1TV6 A;  4G1Q A;  4IBN A;  1RT2 A;  5FRO A;  5J2Q A;  3TAN A;  4CER A;  2FF6 A;  1RDB A;  4I2P A;  2F7T A;  3HP9 A;  1GLB G;  4YOV A;  4B1U B;  1GOB A;  3OYM A;  4FWR A;  2FSJ A;  2P9P B;  4EFH A;  3AO4 A;  5SZT A;  2E20 A;  3VF6 A;  3AA3 A;  4E1J A;  1T6C A;  1VRT A;  4A2B A;  3OHR A;  3D7E O;  3GBT A;  4CBW A;  1ITG A;  3QEI A;  4DV4 K;  2QI2 A;  3SPZ A;  1K73 O;  1TGO A;  4KB0 A;  3T3F A;  1JLA A;  3CYM A;  1IBL K;  3IAY A;  4FPA A;  2HND A;  3R1X A;  4FWQ A;  5CY4 A;  2ASP A;  4M45 A;  2OTJ N;  2HOE A;  4FWL A;  3ULE A;  1RBV A;  1WAJ A;  3S9H A;  1SL1 A;  2RKI A;  5DMR A;  3N4P A;  4DQI A;  3AVL A;  1VHX A;  3SQ4 A;  2YHY A;  3K57 A;  4JS5 A;  5EVZ A;  4CZJ A;  3LDQ A;  3AVA A;  5TKY A;  2D4W A;  1RBU A;  3RMA A;  2IC3 A;  2Q97 A;  3C94 A;  3V81 A;  3L3V A;  4MLE A;  1IKX A;  4F9O A;  2F9T A;  5CYQ A;  4J2D A;  4UY8 O;  1NK7 A;  3OYG A;  3A5O C;  1BIU A;  4BR9 A;  1LOT B;  5BRD A;  1T05 A;  1QSY A;  1QQC A;  5GIN A;  3VGL A;  4CIG A;  3VMF B;  5IT9 O;  4OLA A;  4AHR A;  4F2S A;  2A3Z A;  2B5J A;  4WYB A;  3A2F A;  3AGK A;  3NF7 A;  3TTC A;  4O5B A;  4CK3 A;  4CJ4 A;  3CCJ N;  4CZF A;  1LV5 A;  3ZT3 A;  2YJF A;  3DOL A;  1DLO A;  1CXQ A;  4H5V A;  2HMP A;  4O5F A;  3SUQ A;  3IFR A;  4CFA A;  2ZJR L;  3U8X A;  1JCF A;  1FJG K;  4BRC A;  4CHY A;  1SZ2 A;  4JI0 K;  2Z1G A;  3C6T A;  3AAQ A;  3K0S A;  1JXE A;  2Q36 A;  3RTV A;  4KHP K;  4J2B A;  5HRN A;  3U9Z A;  1YJ9 N;  4PKH A;  1Q9Y A;  2I7N A;  3AO1 A;  2DY4 A;  4FLW A;  4CGF A;  1HJO A;  3V1O A;  2ZD1 A;  4E7J A;  1W7A A;  4M42 A;  4H5T A;  1HX1 A;  1RTH A;  4LSL A;  1N36 K;  2OYQ A;  1GLF O;  3THX B;  4I9Q A;  3VPZ A;  2ZQB A;  3THW A;  3HPG A;  1S6P A;  4HUG A;  1EKE A;  4B9N A;  1HPZ A;  1Y97 A;  1XI1 A;  2QWM A;  4M3X A;  4CCH A;  2X6S A;  1CZ9 A;  5C10 A;  1NMD A;  2P5O A;  1I39 A;  1JL1 A;  4OPA A;  3WNG A;  2NZT A;  4BC2 A;  3LP0 A;  4JKG B;  1NGB A;  2E6L A;  3JXU A;  5AQI A;  3O5B A;  4EHT A;  1VQ9 N;  3CQY A;  2Q0R A;  2QWN A;  4CVN E;  2YKM A;  4FWM A;  2QWR A;  5C42 A;  3VER A;  4CJW A;  2IVP A;  1S72 N;  1M90 O;  3KKS A;  4M3R A;  3THW B;  4M7Y A;  4BDP A;  3HRG A;  3MK6 A;  4DKW A;  3E66 A;  3O4W A;  3RR7 A;  3VQD A;  1S1W A;  3QEP A;  1U48 A;  1WSJ A;  4CF0 A;  4DSF A;  4CJE A;  4OGE A;  4CZM A;  3TAP A;  4DQ8 A;  4LF7 K;  3L6Q A;  3OS2 A;  3G6E N;  2BAN A;  4N76 A;  3V1Q A;  4DR6 K;  1JLC A;  4E7L A;  1SQK A;  1DT9 A;  3QBX A;  5BPN A;  4N56 A;  1U45 A;  3NVM A;  1C0U A;  1B9F A;  4B8C A;  3S3O A;  2A1S A;  3O4Q A;  2AA4 A;  1ILY A;  3CQX A;  4IJA A;  2EX3 A;  1T8E A;  4ELV A;  4OLB A;  3D2F A;  1SL0 A;  1NGE A;  3CQ8 A;  2YNI A;  3QER A;  2HHV A;  1TKX A;  5E84 A;  4FJH A;  2OPR A;  4KI6 A;  2UXD K;  2D1K A;  4A5A A;  2AP1 A;  3VGM A;  1KFS A;  4IKF A;  3CET A;  1LAV A;  3DAW A;  5BN9 A;  3M8Q A;  3O9T A;  3I33 A;  2VG7 A;  2HVH A;  3EEQ A;  3ZET A;  5LL6 Z;  4DQR A;  5KTQ A;  4OPH A;  3W3D A;  3D0P A;  1YIT N;  3GL1 A;  4K8Z A;  4BRL A;  3EZW A;  2E1Y A;  3FFK B;  1W0H A;  4DG1 A;  1NJY A;  3PO4 A;  4DR3 K;  3SUP A;  4B1V A;  5LJV A;  1NU0 A;  1U6Z A;  4LF4 K;  1B9D A;  3NH0 A;  5AQY A;  3VEN A;  4GW6 A;  1VSJ A;  2VCP A;  4KHQ A;  1ZBS A;  3DYA A;  3K58 A;  2Y1I A;  2VGM A;  3BUZ B;  3CER A;  3SMP A;  4YNQ A;  2JWL A;  1HYV A;  3H3N O;  4KH5 A;  5CR4 A;  4OPJ A;  4GV9 A;  4O4G A;  5E41 A;  4JS4 A;  3AVB A;  4GV3 A;  3QET A;  2A6A A;  4IJN A;  3O80 A;  1JLQ A;  1IH7 A;  4MDA A;  3SQ2 A;  2G8W A;  1NOY A;  3A0I X;  4X64 K;  1YVU A;  4I7F A;  4OJR A;  4FXD A;  1SV5 A;  3I0S A;  3CMA N;  3NCI A;  4GY2 B;  3RVC A;  1NK4 A;  3WUH A;  2KLA A;  3U3Y A;  2HF3 A;  4JLH A;  1X9M A;  5TKW A;  3OVN A;  3QO9 A;  3PSI A;  2XY6 A;  2B6A A;  2V7Y A;  4ILJ A;  1C1A A;  3L0Q A;  4DR1 K;  4AF1 A;  3TAB A;  1ASU A;  3NVK A;  2ZF5 O;  4RW6 A;  3HO1 A;  4FZY A;  1GLL O;  3AO5 A;  2KHO A;  1E4F T;  4CF2 A;  3CJ1 A;  1BI4 B;  3S41 A;  1Q8I A;  1TKT A;  4KHW A;  1K8A O;  3L2W A;  2HHH K;  3MEE A;  1J9A A;  1TVR A;  3R3L A;  5KI6 A;  3KK1 A;  5EY4 A;  2KKZ A;  4FWS A;  2FBV A;  3A8Y A;  4DQP A;  3M8R A;  3MXI A;  4B9L A;  3E9L A;  3MN9 A;  3F9M A;  1BIZ A;  2CGK A;  2DPN A;  4H4O A;  3B6P A;  3VA0 A;  3L3U A;  3ZX2 A;  2E2P A;  2VWK A;  3AAR A;  3QEW A;  3GE1 A;  2FXU A;  1LW0 A;  1BA0 A;  3OYF A;  3I55 N;  4Z4H A;  1WBD A;  1WNS A;  1YTA A;  2Y1J A;  3BF3 A;  3AVH A;  3PLA A;  1RDD A;  1JCG A;  4IG3 A;  4E3S A;  5BR8 K;  3EZ5 A;  2KFN A;  4FJN A;  1H1V A;  3VF2 A;  3VTH A;  3K5L A;  2P9N B;  2F96 A;  1Q82 O;  1HNV A;  3DLK A;  2FSK A;  5AZI B;  4WCE L;  4FW1 A;  2ETJ A;  4JI3 K;  4FLU A;  3KK2 A;  1BCO A;  3VQ5 A;  5JLF A;  1T3V A;  4LH4 A;  1VQ7 N;  1NJW A;  4DHY A;  2NRZ A;  3F5T A;  1QTM A;  5M1Q A;  4FJX A;  4CEE A;  1UA0 A;  4ZTF A;  1FK9 A;  5LMU K;  5AQT A;  3L8B A;  1C6V A;  1NGF A;  4MLH A;  4G9Z A;  3ENB A;  1LCU A;  1X3N A;  1NWK A;  2E4L A;  2IIR A;  4HHT A;  3CCS N;  5AZJ B;  4KHS A;  3FFI A;  4KBO A;  1WAF A;  1KLN A;  1RT6 A;  3DLH A;  2ITM A;  2P51 A;  3OBY A;  3SNN A;  2IDO A;  1CXU A;  3NDK A;  4U7B A;  5DM7 L;  4J2E A;  1JKH A;  1HQU A;  1NK5 A;  3QB0 A;  3A5L C;  4IOA L;  4CJ3 A;  5F1X A;  4ELT A;  3BF1 A;  4DUY K;  4DF8 A;  1ZBI A;  4XH1 A;  4CEB A;  3LZI A;  3ZX3 A;  3TR8 A;  1VK0 A;  3FZL A;  1BU6 O;  4OKE A;  3ATV A;  3SCX A; 
#chains in the Genus database with same CATH homology
 4I2P A;  1BHL A;  2PZS A;  2WOM A;  4Z4C A;  3HP9 A;  2VWJ A;  1F21 A;  2P5G A;  1GOB A;  3NFA A;  1L3U A;  3G0Z A;  4E1M A;  3V9X A;  3NH1 A;  3OYM A;  2O4I A;  1RCH A;  1O1W A;  4LSN A;  3VA3 A;  2VG6 A;  1R0A A;  5HRS A;  1GOA A;  1S6Q A;  3AO4 A;  3HYF A;  3LAL A;  4IFV A;  4M3W A;  3ZSZ A;  2RF2 A;  2X6N A;  5T7B A;  2R7Y A;  4DF4 A;  3VQC A;  5SZT A;  3DRP A;  4W5T A;  3L2U A;  4CGJ A;  1JLF A;  4EP5 A;  3RMD A;  3AA3 A;  2FBX A;  4ICL A;  1Q9X A;  4QAG A;  1WSE A;  1VRT A;  4E7K A;  1VSH A;  1YT3 A;  4DU4 A;  4M41 A;  5I3U A;  3OYD A;  1ITG A;  4CK1 A;  4BE1 A;  3QEI A;  1QSS A;  3HT3 A;  4IG0 A;  4CGI A;  3IS9 A;  4F2R A;  4DFP A;  2KW4 A;  3SPZ A;  2D0A A;  1TGO A;  1DTT A;  4DTJ A;  3CG7 A;  3T3F A;  1JLA A;  4KB0 A;  2HHW A;  3CYM A;  3DM2 A;  3IAY A;  3TAG A;  3MED A;  2HND A;  3RRG A;  3OYA A;  5CY4 A;  3DLR A;  3TWH A;  4ID1 A;  4PA1 A;  1ASV A;  4M45 A;  3KLF A;  1VRU A;  3PX0 A;  2BE2 A;  2HNY A;  1VSI A;  3V1R A;  3V4I A;  3F9K A;  1BGX T;  1RBV A;  4CHN A;  1TKD A;  3AA2 A;  4AHT A;  3KTQ A;  1JLG A;  1WAJ A;  4F3O A;  3T19 A;  3S9H A;  2HNZ A;  1SL1 A;  4Z4E A;  1KVC A;  3SUO A;  4FLV A;  1L3V A;  2RKI A;  2HVI A;  5DMR A;  3L2Q A;  4CEA A;  1RTD A;  3AVL A;  1D9D A;  4DQI A;  3SQ4 A;  3K57 A;  3HXM A;  1U49 A;  4FJ9 A;  4JS5 A;  2NUB A;  4W5N A;  3NGY A;  3QIN A;  1RT5 A;  1Z25 A;  4DU3 A;  3AVA A;  3L2R A;  4Z0U A;  3DOK A;  3DRS A;  3LAM A;  1C0T A;  1RBU A;  1TAQ A;  3OYH A;  4DU1 A;  3RMA A;  1S1X A;  1WLJ A;  2IC3 A;  3C94 A;  4Q5V A;  3V81 A;  5HRO A;  4KI4 A;  4DFJ A;  3L3V A;  4R5P A;  1IKX A;  4J2D A;  5CYQ A;  4HUF A;  3SJJ A;  1NJZ A;  2F8T A;  1NK7 A;  3OYG A;  1BIS A;  3VQ7 A;  3KKR A;  1BIU A;  4C8M A;  3ULD A;  1T05 A;  1QSY A;  1QQC A;  5CYM A;  4MQ3 A;  3ITH A;  5K14 A;  4CE9 A;  4CIG A;  2XHB A;  2E6M A;  4CFD A;  5J1E A;  4NCG A;  1SKR A;  1T03 A;  4OLA A;  4AHR A;  2G8K A;  2X74 A;  4CEZ A;  4F2S A;  3OYE A;  4E7H A;  4FJG A;  4J2A A;  2B5J A;  4E89 A;  2BDP A;  1RIL A;  3A2F A;  4FZX C;  3K2P A;  4CHO A;  1FKP A;  1KVB A;  1LAW A;  2OPP A;  1RNH A;  5KRS A;  3NF7 A;  4O0J A;  3KLH A;  4O5B A;  3AO2 A;  2RN2 A;  4CK3 A;  4M3Y A;  1L5U A;  4CJ4 A;  3O3H A;  4KHY A;  1LV5 A;  3NH2 A;  3SYZ A;  1HYZ A;  3IRX A;  4BDY A;  3DLE A;  3AO3 A;  3ZT3 A;  1YTU A;  4AHC A;  3RMB A;  1CZB A;  1W9H A;  3DOL A;  4HCC A;  1DLO A;  1CXQ A;  1ASW A;  3K59 A;  3OYL A;  4CHQ A;  1VSD A;  2X78 A;  2XY8 A;  5J2N A;  4Z4G A;  4DTM A;  1UOC A;  3HP6 A;  3SUQ A;  2A1R A;  2OZS A;  3VQE A;  3ISN C;  2FC0 A;  4CFA A;  3EYZ A;  1KLM A;  3SI6 A;  4CJP A;  4E19 A;  4XIU A;  3ZSW A;  4CK2 A;  1J5O A;  3JSM A;  4CHY A;  4B3O A;  2Z1G A;  3C6T A;  1X9S A;  4RW7 A;  4PY5 A;  1JXE A;  3RTV A;  4J2B A;  1VSF A;  5HRN A;  4EZ6 A;  1A5V A;  4FLZ A;  3M8S A;  4AHU A;  5D3G A;  1LWF A;  3U6F A;  2QKK A;  1Q9Y A;  2Z1H A;  1ZBH A;  3AO1 A;  4KTZ A;  4FJ7 A;  2DY4 A;  1U04 A;  3C95 A;  1D9F A;  4FLW A;  4CGF A;  3V1O A;  2ZD1 A;  4E7J A;  4M42 A;  1I3A A;  2YHB A;  4CJL A;  3NE6 A;  1UA1 A;  1RTH A;  4LSL A;  2AJQ A;  2OYQ A;  1LW2 A;  4N41 A;  4I9Q A;  2ZQB A;  4F8R A;  3HPG A;  1N5Y A;  3E01 A;  1S6P A;  4HUG A;  4DQS A;  3F73 A;  1WSF A;  1EKE A;  2OZM A;  4CJF A;  1SUQ A;  4CEF A;  4B9N A;  4ELU A;  1HPZ A;  1Y97 A;  1XI1 A;  4FJ8 A;  3LPT A;  4CCH A;  2X6S A;  3ZT1 A;  1CZ9 A;  4M3X A;  2Z1J A;  2P5O A;  1I39 A;  3ZSR A;  4DSI A;  1JL1 A;  3P83 D;  3WNG A;  4FLT A;  1SL2 A;  3BDP A;  4CEQ A;  2DFH A;  2I5J A;  5C25 A;  5SWM A;  1ZYQ A;  2G8H A;  3LP0 A;  5J2P A;  3DRR A;  2E6L A;  3I0R A;  3HVR A;  1KCF A;  3LPU A;  2GV9 A;  4KRF A;  3HPO A;  3TAM A;  3PX6 A;  1HYS A;  4B8A B;  4C8N A;  4DTP A;  2EHG A;  2YNG A;  2F8S A;  3AVJ A;  5DK5 A;  3LAN A;  3MAQ A;  1JLE A;  1UWB A;  1WSG A;  4CF9 A;  4KTW A;  3CM6 A;  1NK8 A;  3HM9 A;  5HP1 A;  2P1J A;  2YKM A;  4PQU A;  1FXX A;  5C42 A;  4BAC A;  4PWD A;  2VG5 A;  2HB5 A;  4CJW A;  5J2M A;  1SKW A;  4CF1 A;  2XRI A;  3SCX A;  1HQE A;  3HVT A;  3KKS A;  3SV4 A;  4GVM A;  1KSP A;  4C8O A;  4KHN A;  3SPY A;  3B6O A;  4M3R A;  3VQ4 A;  2OPS A;  5HRP A;  4CFC A;  4BDP A;  5CZ2 A;  1WSI A;  1HMV A;  3LP3 A;  3PY8 A;  3RR7 A;  2HHS A;  3CFO A;  3VQD A;  1S1W A;  4DTU A;  3THV A;  4NCA A;  3MXJ A;  3QEP A;  1U48 A;  3WNH A;  4FK0 A;  1WSJ A;  5HRR A;  4CF0 A;  4DSF A;  4CJE A;  4OGE A;  1QS4 A;  3TAP A;  4OGC A;  1RT1 A;  4B9M A;  4DWI A;  3OS2 A;  1L3T A;  4UQG A;  2BAN A;  5I42 A;  4N76 A;  3CM5 A;  3V1Q A;  4CES A;  3OY9 A;  5FRM A;  4FYD A;  4DMN A;  4RW4 A;  2KZM A;  1JLC A;  4E7L A;  2KZZ A;  1S9G A;  4MFB A;  3HST B;  2PYJ A;  4FJL A;  4N56 A;  1U45 A;  3BGR A;  3M8P A;  1QSL A;  3ZT2 A;  1BQN A;  1RDA A;  1C0U A;  1B9F A;  4GMJ B;  1C0M A;  2G8F A;  4CF8 A;  4B8C A;  1BQM A;  1ZBF A;  3ZSV A;  3S3O A;  3LP2 A;  4DS5 A;  4FCY A;  3MXM A;  2A1S A;  4CJV A;  1J54 A;  2ITG A;  3O4Q A;  4CED A;  4BWJ A;  5C24 A;  4DTS A;  1XWL A;  3OYI A;  1TK0 A;  5FRN A;  3KK3 A;  1A5W A;  1S9E A;  2EX3 A;  2FBY A;  1T8E A;  4ELV A;  4FW2 A;  4IFY A;  4OLB A;  1SL0 A;  3SQ1 A;  1T7P A;  3CQ8 A;  3QNN A;  2YNI A;  4DLE A;  2QXF A;  3QIO A;  3DLG A;  3QER A;  3QES A;  2HHV A;  2DFF A;  4AHS A;  4LY7 A;  3OYB A;  3ASM A;  1TKX A;  2YHA A;  3VQ9 A;  1TAU A;  4OKJ A;  3ZSQ A;  2OPR A;  2HMI A;  2IOC A;  4FJH A;  1TL1 A;  4KI6 A;  4C8K A;  3EY1 A;  4CEC A;  1KFS A;  4IKF A;  1LAV A;  4BE0 A;  4DSK A;  3M8Q A;  5EU7 A;  4FK4 A;  1C1B A;  3L2V A;  1VSM A;  2VG7 A;  2HVH A;  5CZ1 A;  3QEX A;  4DQR A;  3KD5 E;  5KTQ A;  4CEO A;  3D0P A;  1XC9 A;  1JLB A;  3K5O A;  4RG8 A;  2RPI A;  3NBP A;  4WE1 A;  4CGG A;  4FZZ A;  4DFK A;  3AA4 A;  4K8Z A;  1HRH A;  3LP1 A;  1W0H A;  4DG1 A;  3DMJ A;  4LD0 A;  3KLE A;  1XHZ A;  1NJY A;  3MEG A;  3PO4 A;  1EET A;  3AA5 X;  3S3M A;  3AV9 A;  2JGU A;  3KJV A;  3SUP A;  3HJF A;  3VN5 A;  4W5R A;  4CJS A;  3OJS A;  3O4N A;  4K8X A;  4BWM A;  1B9D A;  3AVK A;  4AHV A;  3NH0 A;  1BI4 A;  3AVN A;  4KV8 A;  1EXQ A;  3CFR A;  1CLQ A;  3AVF A;  1IKW A;  1J53 A;  4B9V A;  4GW6 A;  1VSJ A;  4CHZ A;  2GUI A;  1S1U A;  3D45 A;  1NKC A;  1KVA A;  2G8V A;  3DYA A;  4C8L A;  3LAK A;  4FJ5 A;  4KHQ A;  3K58 A;  4DTX A;  1HNI A;  2Y1I A;  3NGZ A;  2Z1I A;  3VQA A;  4CIF A;  4CJK A;  4RW8 A;  4YNQ A;  1S5J A;  3OS0 A;  4IDK A;  4HUE A;  1HYV A;  4OPJ A;  4CGH A;  3QNO A;  4FJI A;  2ATQ A;  4O4G A;  3NF6 A;  1D5A A;  5E41 A;  1IO2 A;  3C6U A;  4JS4 A;  4KRE A;  2YKN A;  2KFZ A;  4ZTJ A;  4DSL A;  4QCL A;  1IG9 A;  3AVB A;  1TK5 A;  3ZSY A;  3QET A;  2PY5 A;  1JLQ A;  1IH7 A;  3SQ2 A;  2G8W A;  1NOY A;  1RTI A;  1YVU A;  4I7F A;  3RMC A;  3OYJ A;  4EZ9 A;  1RDC A;  4OJR A;  3DLB A;  4FXD A;  4BDZ A;  1SV5 A;  3I0S A;  3KLI A;  4DSE A;  2XY5 A;  1U4B A;  3VQB A;  2G8U A;  3NCI A;  3T1A A;  1NK4 A;  4Y1D A;  4CJQ A;  3PV8 A;  3U3Y A;  2ZE2 A;  2G8I A;  4E7I A;  4JLH A;  1XHX A;  1X9M A;  4DSJ A;  1IKY A;  1TKZ A;  3OVN A;  3QO9 A;  3ZT0 A;  2HHT A;  4KAZ A;  3K5M A;  2KTQ A;  2XY6 A;  4NCB A;  1BL3 A;  2B6A A;  2OPQ A;  2Q3S A;  4B9T A;  1C1A A;  1VSK A;  1GOC A;  1RBT A;  4O44 A;  3V9S A;  4CIE A;  3HL8 A;  1MU2 A;  4HTU A;  3TAB A;  4B9U A;  1ASU A;  1U47 A;  4RW6 A;  2OA8 A;  2XO7 A;  3HO1 A;  1FKO A;  4FZY A;  3DI6 A;  3AO5 A;  3U3G A;  4CF2 A;  3KIO A;  3RR8 A;  4E0D A;  1BI4 B;  4B08 A;  1Q8I A;  4DTR A;  2HW3 A;  1TKT A;  4KHW A;  4AH9 A;  4Q0B A;  3L2W A;  3MEE A;  4FJM A;  1J9A A;  1TVR A;  2WON A;  5KI6 A;  3KK1 A;  3ZSX A;  1KTQ A;  4FM0 A;  3SV3 A;  4ZHR A;  3PUF A;  1RBR A;  1X1P A;  1WN7 A;  2FBV A;  5JS2 A;  5HBM A;  4DQP A;  4DLG A;  1C1C A;  4W5Q A;  3M8R A;  3OYC A;  4OPK A;  4B9S A;  3V9U A;  3MXI A;  4B9L A;  3CFP A;  2HHQ A;  1DTQ A;  1JXB A;  4CGD A;  3ZCM A;  3VQ8 A;  1BIZ A;  4H4O A;  4KTQ A;  3B6P A;  4BE2 A;  3TI0 A;  1D8Y A;  2D5R A;  5JS1 A;  3VA0 A;  3KLG A;  4CFB A;  3TAQ A;  4M3Z A;  3L3U A;  4KB1 A;  1JL2 A;  4FLX A;  2VWK A;  4KPY A;  1KFD A;  3ZSO A;  4CJT A;  4OKK A;  3QEW A;  4KO0 A;  3NAE A;  3LWL A;  1A5X A;  4F3T A;  4I9L A;  1LW0 A;  3PO5 A;  1RT4 A;  2D0B A;  4KFB A;  3OYF A;  1QHT A;  4Z4H A;  1RT3 A;  4O55 A;  2DFE A;  3S3N A;  3HPH A;  1WNS A;  3NHG A;  4HVJ A;  4CHP A;  1YTA A;  1RTJ A;  4N5S A;  2Y1J A;  1QE1 A;  1IKV A;  2YV0 X;  3H08 A;  4FJK A;  3AVH A;  1NOZ A;  3V9W A;  1RDD A;  1RT7 A;  4E3S A;  4IG3 A;  3LDS A;  1SKS A;  4Z4I A;  3OJU A;  3P5J A;  3EZ5 A;  2XY7 A;  4FJN A;  1LWE A;  2KFN A;  3VQQ A;  3NF9 A;  3O3F A;  3K5L A;  2HHU A;  2HHX A;  2F96 A;  5FDL A;  4EP4 A;  1EX4 A;  1L3S A;  3JYT A;  3TAN A;  1Z26 A;  3TAE A;  1HNV A;  2FBT A;  3DLK A;  1NKE A;  5KGX A;  3TAR A;  2IS3 A;  4H4M A;  4FW1 A;  2ETJ A;  1UAX A;  4DTN A;  4FLU A;  3OYK A;  1G15 A;  1S1V A;  3V6D A;  3KK2 A;  1LWC A;  3AVC A;  1BCO A;  4NYN A;  1RBS A;  3NGI A;  2PYL A;  4CJ5 A;  3SQ0 A;  3VQ5 A;  3ZT4 A;  2GBZ A;  3G10 A;  4I2Q A;  1X9W A;  1NJX A;  4FJJ A;  4DS4 A;  4LH4 A;  4FK2 A;  2D0C A;  4E1N A;  1NJW A;  1QTM A;  4JRQ A;  5HLF A;  2YNH A;  3OYN A;  4LH5 A;  4FM1 A;  3MEC A;  4CEE A;  4O0I A;  1WSH A;  1UA0 A;  4FJX A;  4ZTF A;  1FK9 A;  3AVM A;  4JRP A;  2JLE A;  1B92 A;  3IG1 A;  1C6V A;  3QIP A;  2W42 A;  3L8B A;  1KRP A;  4H8K A;  3OS1 A;  5KRT A;  4FLY A;  1HJR A;  2QK9 A;  2YNF A;  1REV A;  4AIL C;  1ZBU A;  2KQ2 A;  4PUO A;  2E4L A;  3QLH A;  4HHT A;  4KHS A;  1NKB A;  3FFI A;  1TL3 A;  3O3G A;  4FVM A;  3WNE A;  1WAF A;  3WNF A;  1KLN A;  2DTU A;  1RT6 A;  2IAJ A;  2IGI A;  4TSX A;  1NK9 A;  3DLH A;  2B4J A;  3SZ2 A;  4HCB A;  2P51 A;  4QOZ B;  3SNN A;  2IDO A;  4W5O A;  1TK8 A;  3UIQ A;  1K6Y A;  5KGW A;  4YFU A;  4F4K A;  4OVL A;  1CXU A;  1BCM A;  3NDK A;  4DTO A;  3LWM A;  4KHU A;  4J2E A;  4DFM A;  1JKH A;  1HQU A;  1VSE A;  2O4G A;  3P1G A;  4Y1C A;  1NK5 A;  4M3T A;  4NYF A;  1VSL A;  3QEV A;  3RRH A;  1NK0 A;  1EP4 A;  4CJ3 A;  4Z4F A;  1S1T A;  3V9Z A;  3TAF A;  4KKO A;  4FM2 A;  4ELT A;  4RW9 A;  3RWU A;  3LZJ A;  1NK6 A;  2QKB A;  4M3U A;  2BGG A;  4CJR A;  3VQ6 A;  4CJU A;  4DQQ A;  1ZBI A;  4N47 A;  4DF8 A;  3ALY A;  3VQP A;  4CEB A;  3AVI A;  1N6Q A;  4L8R B;  3I8D A;  3AVG A;  4ID5 A;  3LZI A;  2LSN A;  1TV6 A;  4G1Q A;  4IBN A;  3TR8 A;  3SUN A;  1ZBL A;  3NF8 A;  3KD1 E;  1RT2 A;  1VK0 A;  3PX4 A;  3HK2 A;  5FRO A;  5J2Q A;  4OKE A;  4CER A;  3K5N A;  1RDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...