4HTUA

Structure of 5-chlorouracil modified a:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4htuA00
3D45A 1IKVA 4KTZA 5JS1A 2YNHA 4AHRA 2YNFA 3OS2A 1NKBA 4MFBA 1Z26A 1A5XA 4BWMA 3KK1A 5DMRA 3KLGA 3L3VA 1TV6A 4G1QA 1LW0A 5FRNA 4FLWA 4F4KA 1RDBA 3NHGA 4OPJA 1T05A 2PZSA 4DSIA 3SNNA 3LP0A 2HHQA 4DTJA 2YHAA 3KLFA 1Y97A 4FVMA 4FYDA 2IC3A 4MQ3A 2YNIA 3UIQA 3B6OA 2HW3A 1EP4A 1ZBIA 3EY1A 3DI6A 2RPIA 3QIPA 3HK2A 1ZBUA 4Z4FA 4ICLA 3EZ5A 4M3TA 4NCGA 1BGXT 3P5JA 2HB5A 1BQMA 1WSGA 3L2VA 4J2BA 5KRTA 4E1MA 2B4JA 3NF7A 4N41A 1RNHA 4E0DA 2JGUA 4RG8A 2DTUA 3VA0A 3MEDA 4KAZA 3DRRA 4ELUA 4ZHRA 1LV5A 3M8QA 4DU1A 4OLBA 2IAJA 3VQAA 3OY9A 4CJSA 1LWEA 4YNQA 3ZT1A 4FJGA 1IH7A 3QO9A 4N47A 1CXQA 3ZT4A 4CIFA 2G8UA 4LY7A 4FM2A 3AA4A 3AVMA 1S5JA 3DMJA 2QKKA 3ZSWA 3OYBA 1WAJA 3WNGA 2RF2A 2BGGA 4M3RA 3P83D 1Q8IA 3M8RA 4AH9A 4KHNA 1TAUA 4M3YA 4LSNA 3KLEA 4KB1A 4CIGA 3G0ZA 2XY5A 4CHQA 2BANA 5HP1A 1TAQA 1U47A 4ELVA 3AVBA 2F8SA 4C8NA 4JRQA 1L3VA 3SZ2A 4HCBA 2D0AA 2Z1GA 4QAGA 1SV5A 2Z1HA 2OPPA 3THVA 2G8FA 1G15A 3AVGA 4DS4A 1ITGA 3OYLA 5J2PA 3HPOA 4FCYA 1ASWA 1ZBFA 1A5WA 2LSNA 3O3HA 3HT3A 4BE1A 4CGDA 5T7BA 4FM0A 1UOCA 5J2MA 4OKJA 5J2QA 1D9DA 4J2DA 1ZBHA 2XY8A 3MEGA 2Z1IA 4FW2A 4E19A 4M3XA 2GUIA 1J9AA 2FC0A 2ZE2A 2PYLA 3ZSVA 4M41A 4JS5A 1U04A 1HQEA 1S6QA 3OYIA 4CFAA 1J54A 3LAKA 1WLJA 1TGOA 4K8XA 1QQCA 5KTQA 1VSIA 3OYKA 3OYGA 1RT2A 1U45A 3PO5A 3QETA 3ALYA 4CF8A 4CFDA 4Z4GA 3CYMA 1HYVA 1KVCA 1N6QA 4KHYA 3PX4A 3VQQA 4BWJA 4FJ7A 1JLEA 3HSTB 1LAWA 3QINA 3DLGA 1T03A 2G8KA 3I0RA 1VSDA 4LH4A 3ISNC 4KFBA 3VQBA 1IKXA 5KGWA 2F96A 5HRNA 3QNOA 2P5GA 2OZMA 4M3WA 1TK5A 4IG3A 2OPRA 4B8CA 3ZT3A 4CHOA 1NK9A 1VSKA 3TAFA 4HVJA 4Z4EA 5CZ1A 2QXFA 2BDPA 4DU4A 3L2UA 3TAPA 3V1RA 1I39A 4B9UA 3SPYA 1TKDA 3C95A 4RW9A 4DTSA 4DTUA 4CHPA 3TANA 1HYSA 1X9MA 3ZT2A 3T19A 1VRUA 4HUFA 2WOMA 1VK0A 4CJFA 3OS0A 4DTMA 1BI4A 4CE9A 1YT3A 3CM5A 4K8ZA 1HRHA 1FKPA 1S1UA 3OYFA 1U49A 5C24A 4NCAA 4FJIA 2HNYA 5I3UA 2IDOA 2KTQA 5HRRA 3WNHA 3LZJA 3ZSOA 3RMDA 1BHLA 2YV0X 1C0MA 1C1BA 4RW4A 4W5TA 1D8YA 4CERA 1C1AA 4BE2A 1FK9A 3LWLA 3L2WA 3TI0A 3RRGA 4ID1A 3NF9A 4CJPA 4M3ZA 2ZD1A 3DOLA 1TL3A 3KK2A 1NJYA 3OYNA 1NK0A 4Q0BA 3OYAA 4B08A 1JLQA 3U3YA 2AJQA 3KLIA 2XHBA 2Y1JA 2EHGA 1KCFA 4CJWA 1U48A 4KREA 2QKBA 4O0IA 1JLCA 5J2NA 3RTVA 1ZYQA 1B9FA 1IKYA 3JSMA 1RT6A 4EP5A 1WSFA 4FXDA 3LPUA 4CJTA 3AVIA 3ZSYA 3K5MA 4C8MA 2XY6A 4OKKA 2A1RA 1WNSA 2IOCA 5KI6A 4N56A 3NF8A 1HJRA 4IBNA 2HVIA 3HO1A 3H08A 3MECA 1L3SA 1WAFA 2ZQBA 3AVKA 3NAEA 4CCHA 3T3FA 4PA1A 3V9XA 4FJXA 1S6PA 4W5OA 4EZ6A 2HHWA 5HROA 4F2RA 3OVNA 3MAQA 1SL0A 1S1WA 4GW6A 3QERA 3IG1A 4NYNA 3ZSXA 3M8PA 4CJ5A 4CJQA 4W5QA 3QEXA 3LP3A 1GOAA 4E7JA 4CGJA 4W5RA 3CQ8A 4BDZA 3KTQA 1RT5A 4OPKA 2DY4A 4F8RA 4FLXA 3DM2A 1RT3A 3L3UA 1BCMA 5FDLA 2HNZA 3K5OA 4CJKA 2Y1IA 3AO3A 4DWIA 4FJMA 1XWLA 4CFBA 3SV3A 1TKZA 1CXUA 4B9SA 1KRPA 1S1TA 1QSLA 1K6YA 4IFVA 3S3OA 4E7IA 3LP2A 4LD0A 2FBVA 2VG7A 4J2AA 4KB0A 4KHSA 3AVCA 5EU7A 4HUEA 1SL2A 3VQ9A 3LAMA 3HXMA 1L3TA 1RBVA 3VQ6A 1QSSA 4N76A 3SCXA 3DRSA 1X9SA 4CEDA 4FJJA 2OYQA 1RBRA 4EP4A 1BL3A 1JXBA 1B92A 1RTIA 4M45A 4DTXA 1NK8A 2Z1JA 4HHTA 2D0CA 4I2PA 3KKRA 3PY8A 4FK0A 1F21A 2RKIA 4O0JA 4HTUA 4FLUA 4O55A 1NOYA 4BACA 1TL1A 3EYZA 3AA5X 4PWDA 2G8VA 1QS4A 4CJRA 4BE0A 4CJLA 2B5JA 4B9MA 4KHWA 2GBZA 3TAEA 1LW2A 1SKRA 4KPYA 2YNGA 2KFNA 3TWHA 3QEIA 1BI4B 4C8KA 5HRSA 2HHXA 4YFUA 3SJJA 4CF0A 1IO2A 3O4QA 3SQ0A 3OS1A 4FZXC 4AHSA 3ASMA 1IG9A 1WSIA 4DSLA 1SKSA 4FJLA 3MXJA 3NH1A 1BISA 3PX0A 1TVRA 3AV9A 4E7KA 4CGGA 1BIUA 1JKHA 3O3FA 2ATQA 3V6DA 3VQPA 4FLZA 2DFHA 2OA8A 2HHUA 4E89A 4Z4CA 4AHTA 4FLTA 3IS9A 4IFYA 4DSKA 4W5NA 3K57A 3SQ4A 3NE6A 3SI6A 3PX6A 3V9UA 3OYJA 4NYFA 1NK5A 1EKEA 1CZ9A 2FBTA 3VQ7A 4FM1A 1JXEA 2XY7A 4DLEA 4E7LA 2W42A 4Y1CA 3HPHA 4OGCA 1VSJA 3HL8A 3HP6A 1C0UA 1RDAA 3VQ8A 3ZT0A 3RMCA 3G10A 4ELTA 3LALA 3DLEA 3CFRA 3RMAA 4DFMA 2E6MA 3SQ2A 1BIZA 3SV4A 1KTQA 4H4OA 2Q3SA 4AHVA 4CF9A 4O44A 1TKTA 3AVLA 4CHYA 3NCIA 2I5JA 1C0TA 3SUQA 1TK0A 1B9DA 4O4GA 1NJZA 2A1SA 4TSXA 1I3AA 2VG5A 4DTPA 1WSEA 1RILA 1VSHA 3LPTA 1HNIA 3TR8A 4UQGA 3RMBA 4FJ9A 1Q9XA 3DRPA 5FROA 3SYZA 1QSYA 1RT4A 4CGHA 2RN2A 4CIEA 4DQRA 3VA3A 3SUNA 2KZZA 4JLHA 3HPGA 1QTMA 4CEEA 4HUGA 3PUFA 1RTHA 5I42A 4Q5VA 4DQSA 3PO4A 2OZSA 1WSJA 3MXMA 4CJEA 1GOBA 1GOCA 4FK4A 3CFPA 3LWMA 1JLGA 4N5SA 4DTNA 1RCHA 2B6AA 1L5UA 2R7YA 1KFSA 3AVJA 4RW7A 3AVFA 2O4GA 1O1WA 4RW6A 4QOZB 1XI1A 3V1QA 4FLYA 3AVAA 3FFIA 1VRTA 1RT1A 3AO1A 4CK1A 3ITHA 4OKEA 4KHUA 1W0HA 2JLEA 4E3SA 3SPZA 3DLHA 4E7HA 3IRXA 2HNDA 3AO2A 2X6SA 3VQEA 3VQ4A 3OYHA 4HCCA 4DF4A 3K59A 3ULDA 3RRHA 1RBTA 1U4BA 4DTRA 1KLNA 3C94A 1LAVA 4AHUA 4WE1A 3KD1E 3L2RA 1C1CA 3NGIA 3V4IA 1YTUA 2P1JA 4KO0A 4I9LA 4R5PA 3CM6A 1UA1A 4FJNA 4PY5A 4FLVA 3QLHA 1L3UA 4FJ8A 3AVHA 5HRPA 3RR8A 3ZSQA 4DMNA 5SWMA 2X6NA 1D5AA 1S9GA 4OGEA 1TK8A 4LSLA 3OYDA 1QHTA 3OYCA 1KLMA 2NUBA 4F2SA 4CK3A 3K58A 3HVTA 4BDYA 1KSPA 3E01A 2PY5A 1WN7A 3QEPA 4CEAA 4KTQA 1DLOA 3IAYA 4DLGA 1UWBA 3SUPA 5CZ2A 3ZSRA 1NKEA 3TAQA 1RT7A 4OJRA 2HVHA 4DSEA 3AO5A 3I0SA 5JS2A 4KV8A 4ZTJA 1EX4A 1RBSA 1RTJA 4Y1DA 2HMIA 2XO7A 3V9ZA 4I2QA 2D5RA 1R0AA 3HJFA 4M3UA 1Z25A 1D9FA 4IKFA 3OYMA 3CG7A 3BGRA 3AA2A 3VQCA 3PV8A 4FJ5A 3VN5A 4FZYA 4CHZA 3O3GA 3NH2A 3U3GA 4FJKA 3HP9A 4KRFA 5DK5A 1CLQA 3NH0A 2ITGA 4H4MA 5C25A 3L8BA 1J53A 1EETA 4B9TA 1RDDA 2E4LA 2FBYA 1HYZA 3LDSA 4OLAA 3DLRA 2OPSA 2HHSA 4B9NA 3KD5E 1BCOA 1IKWA 3I8DA 3V9SA 1SUQA 5HBMA 2YKMA 4Z0UA 4C8LA 2DFFA 1NJWA 4IG0A 3V1OA 5KRSA 4DFJA 2YKNA 3NGZA 3QNNA 4KI6A 3TAMA 1LWFA 2YHBA 2G8WA 5J1EA 5KGXA 1CZBA 4CGFA 1ASVA 3KK3A 4DSFA 1UAXA 4CEBA 1VSEA 3F73A 4CECA 3TAGA 2KQ2A 1HQUA 3K5LA 2PYJA 4DQPA 3S3MA 2KFZA 4I9QA 4Z4IA 1FXXA 2ETJA 4CGIA 1X9WA 2X74A 4EZ9A 4OVLA 4DQIA 4CHNA 1JLFA 5FRMA 3WNFA 3K5NA 4KTWA 4CEOA 4M42A 4CJVA 4JS4A 1HMVA 1BQNA 1NOZA 4DFKA 2WONA 3DYAA 1LWCA 4BDPA 1T7PA 5SZTA 3M8SA 3F9KA 3LZIA 2F8TA 1XHZA 1VSFA 1VSLA 2FBXA 4CEQA 1NJXA 4F3OA 4L8RB 2XRIA 5D3GA 3KIOA 4E1NA 4B9LA 2D0BA 4LH5A 3O4NA 1JL1A 1RDCA 4FK2A 2HHTA 1DTQA 2QK9A 3VQDA 3TABA 3NF6A 3DLBA 3RR7A 3P1GA 1FKOA 3AA3A 1XHXA 5HLFA 3KKSA 1NK4A 4DSJA 3U6FA 4B9VA 4FJHA 4DG1A 4KHQA 3LP1A 3OJSA 3OJUA 3DLKA 2VG6A 4FW1A 4B3OA 4DTOA 2E6LA 3CFOA 3V81A 1A5VA 3ZSZA 1NK7A 3SQ1A 1S1XA 4C8OA 2KZMA 4ZTFA 1ZBLA 2G8HA 3RWUA 1REVA 4ID5A 1RTDA 2KW4A 3QEWA 3V9WA 2O4IA 2HHVA 1KFDA 2VWKA 3VQ5A 4CFCA 2GV9A 3HYFA 2P5OA 4CF1A 3NFAA 1JLAA 1KVBA 1EXQA 5CYMA 4CJ4A 4CF2A 3D0PA 1NK6A 2VWJA 3A2FA 3B6PA 1DTTA 3ZCMA 3QIOA 3DOKA 3LANA 1S9EA 3NBPA 4CEZA 4Z4HA 4DFPA 4QCLA 1J5OA 4I7FA 1HPZA 1W9HA 3KLHA 3K2PA 1SKWA 5CY4A 2IGIA 4PUOA 3C6UA 4KI4A 5E41A 3MEEA 1YTAA 4KKOA 4DS5A 5K14A 4DU3A 4RW8A 1X1PA 3S3NA 1UA0A 4H8KA 1C6VA 1RBUA 3HVRA 1XC9A 3L2QA 4XIUA 4JRPA 3SUOA 3S9HA 1MU2A 5CYQA 1T8EA 4CEFA 3KJVA 3T1AA 3QEVA 2DFEA 1JL2A 3HM9A 3JYTA 1VSMA 3MXIA 4CK2A 2EX3A 2IS3A 3BDPA 4GMJB 5C42A 1Q9YA 4CESA 4DQQA 3AO4A 4DF8A 1TKXA 2P51A 2G8IA 1YVUA 1S1VA 4GVMA 4PQUA 1NKCA 3QESA 4B8AB 4CJUA 4FZZA 4O5BA 3WNEA 4NCBA 1N5YA 1JLBA 1SL1A 4F3TA 3TARA 1KVAA 2OPQA 3C6TA 4CJ3A 4AHCA 2X78A 3NDKA 4AILC 3OYEA 1QE1A 3NGYA 1ASUA 1HNVA 4J2EA 4IDKA 2BE2A 1WSHA 3AVNA
chains in the Genus database with same CATH superfamily
1IKVA 4EHTA 2YNHA 1NKBA 3H3NO 1Z26A 4MFBA 1A5XA 5F1XA 3EEQA 3L3VA 1TV6A 2W6LA 4G1QA 4IJAA 3UKUB 1LW0A 5FRNA 5C2DA 3NHGA 4DSIA 4DTJA 4FYDA 3PSIA 1Y97A 3KLFA 3CCJN 4JI4K 3C0BA 1EP4A 1ZBIA 3QIPA 4FWNA 4ICLA 4CBXA 4NCGA 4E1JA 3JS6A 2EWSA 2HB5A 1VHXA 5AQOA 4BR4A 1RFQA 2CGJA 4E0DA 4BRLA 2DTUA 3VA0A 4KAZA 2IAJA 4BRHA 4FPBA 3OY9A 5F2RA 1GLJO 4CJSA 4YNQA 3QO9A 3AGRA 5F0XA 2G8UA 4JV5K 3AA4A 3N4QA 2QKKA 3ZSWA 3EE9A 3RSEA 3MCPA 3KLEA 4CIGA 2XY5A 4CHQA 2BANA 3AVBA 4FWLA 2F8SA 3C6HA 2Z1GA 1SV5A 2FSKA 1GLBG 5C10A 5J2PA 4CD1A 1ZBFA 4BE1A 1SS6A 2E1YA 4E19A 3PLAA 2YX6A 1OH8A 2GUIA 1J9AA 2ZE2A 2PYLA 3ZSVA 1HQEA 3G25A 3LAKA 3AAPA 3WXJA 1VSIA 3OW2M 3QETA 4PL7A 4H03B 5E84A 1DT9A 1KVCA 1N6QA 1ILYA 3EZWA 1LAWA 3QINA 2VYPA 3I0RA 5HRNA 2O8BA 4M3WA 2OPRA 3LDOA 4BQZA 3O9QA 3ZYYX 2BDPA 2KKZA 3L2UA 4B9UA 3V1RA 2OTJN 1TKDA 3C95A 2NRXA 4CHPA 4DR6K 4HUFA 4CJFA 1VK0A 5CHIA 1YT3A 1FKPA 2QW9A 3ENBA 3ZSOA 4BRPA 4W5TA 4FWSA 4CERA 1C1AA 4BE2A 3LWLA 3RRGA 3FGUA 3NF9A 2WUSA 4CJPA 4H5VA 3MCAB 3FZLA 1JLQA 4NO7A 2YHXA 2Y1JA 3UE5A 1Z6RA 3QICA 1U48A 4KREA 1VQ8N 3RTVA 1ZYQA 4A5BA 1NGIA 1IKYA 2VQEK 1RT6A 4EP5A 3WEEA 4FXDA 1O13A 4RTFD 2XY6A 4OKKA 3NF8A 1HJRA 4IBNA 3RSEB 4WFNL 3H08A 3HO1A 1WAFA 2A5XA 4O8UA 4CCHA 1OH7A 4DR1K 1ZXOA 4F2RA 3MAQA 3QERA 4GW6A 4BR9A 5AFUA 3O1WA 1YITN 4E7JA 5BR9A 4CGJA 4BDZA 1JJ2M 3VGLA 4XH1A 2O8DA 3MX2A 4F8RA 1NGGA 4FLXA 1RT3A 3DXMB 2HNZA 3MWPA 3SJHA 5AZJA 4JI1K 4CJKA 2Y1IA 2WFBA 3FZKA 4CFBA 1CXUA 2WC9A 3R9PA 1SL2A 3VQ9A 1YJ9N 4JKDA 1RBVA 1V4SA 3R8EA 1NK8A 2O8BB 4HHTA 2AP1A 3CIPA 3CCQN 2RKIA 4HTUA 2CH5A 4RCHA 1QS4A 4BE0A 4CJLA 4B9MA 3TAEA 1LW2A 1JCFA 3QEIA 1Y64A 5HRSA 4WCEL 2O8CA 3MN5A 4AHSA 3ASMA 1IG9A 1WSIA 1SKSA 3PX0A 1TVRA 4E7KA 2KLAA 4CGGA 1KC8O 4FWRA 3CHWA 3CETA 4DSKA 4W5NA 3NE6A 1NGFA 4OO1J 4GNIA 3OYJA 2ASOA 1NK5A 2WBNA 3VQ7A 4FM1A 2W42A 4OGCA 1VSJA 3TI0A 1RDAA 3HOSA 2E1ZA 3TSUA 4BVOA 5GAGP 3WEEB 3CFRA 2E6MA 3SQ2A 2Q0UA 3VGMA 2WTUA 4CF9A 5AQHA 3C7NB 3NCIA 3M3ZA 1HJOA 4O4GA 1IG8A 1WSEA 1RILA 1Q9XA 1SQKA 1RT4A 3E9LA 5H1SQ 4CIEA 3THYA 3VA3A 3SUNA 1N36K 2FSNA 5I42A 4Q5VA 4DQSA 3E66A 3GL1A 1GOBA 1BDGA 2A41A 3HTVA 4FK4A 3CFPA 1JLGA 2O8DB 3LDPA 2B6AA 1JCGA 5E26A 4RWTA 3AVJA 4IO9L 4RW7A 5AZJB 1X3MA 2F9WA 3QDKA 1XI1A 4EFHA 4DCHA 3FFIA 4JKGB 1VRTA 1RT1A 4J8FA 3WXKA 4OKEA 3CI5A 4E3SA 3AO2A 3VQEA 3OYHA 4DF4A 3TTFA 3A8YA 3ULDA 3RRHA 4DTRA 1I94K 2QI2A 4WE1A 3L2RA 4MLEA 3OBWA 2IVNA 4YORA 4BR2A 4FLVA 3QLHA 4K41A 3PIPL 3AVHA 3O5BA 4FL9A 1D5AA 4PL8A 4OGEA 4FOEA 1TK8A 2P9NA 4BROA 3OYCA 1NGJA 1EQYA 2O8CB 3K58A 3HVTA 2IVOA 4NLCA 1QVGM 5CE3A 3ZX2A 2E20A 4CEAA 3VEOA 1DLOA 3IAYA 4DLGA 2FF6A 1XUPO 3ZSRA 1NKEA 1LCUA 4DSEA 3I0SA 4KV8A 4ZTJA 1EX4A 4K0KK 3TTCA 2HMIA 1YAGA 3V9ZA 1QQOA 4I2QA 4K43A 3HJFA 1HLUA 3CJCA 4JKCA 3BGRA 2P9PA 4U7BA 4FJ5A 4JEPA 3NH2A 1P90A 1CLQA 2Q2RA 5LJVA 3OHRA 5C25A 2UXBK 1K9MO 4OLAA 5GIOA 3KD5E 4YOTA 1VQ7N 4H0VB 1SZ2A 4Z0UA 2DFFA 4IG0A 3THYB 3NGZA 3G4SN 2G8WA 1RDWX 5J1EA 1ASVA 4DSFA 2KQ2A 1HQUA 3K5LA 2H3GX 2KFZA 1KQSM 4CGIA 2NRHA 4KH6A 4IEIA 4MO4A 4H5TA 2UXCK 1HUXA 1JLFA 4CEOA 1HMVA 1LOTB 3ATVA 1VQ9N 2QWMA 4FWKA 3M8SA 3SLCA 3F9KA 3EE8A 5EXWA 1NJXA 1VSFA 4L8RB 5D3GA 5AQFA 3KIOA 4LH5A 1RDCA 1E4GT 2HHTA 4FSVA 3NF6A 3P1GA 3KKSA 4BC4A 3OJSA 2VWBA 2P9NB 4FW1A 3B8AX 4B3OA 4DTOA 1A5VA 5KQDA 3CJ7A 5JVGL 1XQSC 4ID5A 4Z94A 3QEWA 3V9WA 1KFDA 2VWKA 4CFCA 2O8FA 4CF1A 3NFAA 1JLAA 3DLBA 3D0PA 3B6PA 3ZX0A 1NG9A 1BA0A 5HOOA 1W9HA 5CY4A 2P9PB 4A59A 3GOIA 1WBDA 4JRPA 2NRVA 2W40A 4JI8K 4NB4A 3QEVA 1NGHA 2IS3A 4LF9K 5AZIA 1CZAN 4DQQA 3AO4A 2G8IA 5BPMA 5FPNA 3WNEA 1KVAA 4AHCA 4AILC 3VESA 4J2EA 1RGIA 4KTZA 4FOIA 2E2OA 2W6KA 4JKAA 5DMRA 1S22A 3UB5A 4C1NK 4FLWA 3GG4A 4F4KA 3ULEA 3SNNA 2YHAA 4FVMA 3THWA 4MQ3A 1J5EK 3MN6A 3B6OA 2HW3A 4BG9A 3N4PA 4YOXA 3A5MC 4BC2A 1ZBUA 3EZ5A 4M3TA 1BGXT 2UUCK 3WXIA 5I9EB 3L2VA 4E1MA 2B4JA 3NF7A 5AQXA 1BWFO 2V51B 2JGUA 4RG8A 1HPMA 4ELUA 3HBTA 3CCMN 1HR0K 3ZT1A 1OKJA 1Q86O 4FJGA 2O8FB 4N47A 3AVMA 3R6MA 1S5JA 3OYBA 4WYBA 2BGGA 2A42A 3P83D 1Q8IA 4M3YA 4LSNA 4KB1A 1U47A 4B1ZA 4ELVA 4PHTX 4LFAK 3NMUA 3SZ2A 3ENOA 1Q7YO 2Z1HA 4L3QA 3HPOA 4CZKA 3HI0A 1DKGD 2LSNA 3HT3A 5J2QA 5T7BA 4GVEA 1RDUA 4OKJA 2FC0A 4GV3A 5AZIB 4NXNK 2GWKA 1WLJA 1QQNA 1RT2A 5TKYA 3ALYA 3VF6A 4CF8A 4CFDA 1HYVA 3PX4A 4DKWA 3VQQA 1NMDA 3EL2A 4H0YB 2G8KA 1VSDA 3VQBA 5KGWA 2F96A 4CBWA 2P5GA 4A62A 4IG3A 4CHOA 1TK5A 1VSKA 4HVJA 4Z4EA 5CZ1A 2QXFA 3D2FA 3TAPA 5M1QA 3TANA 3VETA 2NRRA 1W97L 3T19A 1VRUA 4FWQA 3ULEB 1BI4A 3THWB 5AQKA 4K8ZA 4ISEA 4FO0A 5C24A 3WNHA 4BRCA 3LZJA 1M90O 4DV7K 1BHLA 2YV0X 1QVFM 4WF9L 3VF4A 4ID1A 4KBOA 4M3ZA 5C0YA 2ZD1A 3KK2A 1TL3A 4EIAA 4DV2K 4WQ5C 2UYTA 4Q0BA 1BA1A 2RE2A 3U3YA 2AJQA 2ASPA 2XHBA 2EHGA 1VQON 4CJWA 3CCLN 1K8AO 5J2NA 4YOWA 1OH6A 1NGBA 2QM1A 1H1VA 5ADXA 1M1KO 3O8MA 1FJGK 4CJTA 2E8AA 3ZSYA 4C8MA 3MECA 4BRNA 1NGAA 4PA1A 4QS9A 4CZHA 5HROA 1QZ5A 3J7ZO 4AQYK 1XNQK 2P9LA 1SL0A 1S1WA 2A6AA 3IG1A 4NYNA 4HWIA 2HBKA 2NRZA 4CJQA 3VTIA 4W5QA 2F9TA 3LP3A 1GOAA 3H45C 3CQ8A 1RT5A 5BPLA 2QWRA 1EWRA 4I6MA 5GIPA 1X3NA 4AF1A 2HBJA 4DWIA 3K5OA 2AA4A 4FJMA 1XWLA 4IXCA 1Q18A 1VQ4N 4B9SA 4K42A 3VEWA 1K6YA 4IFVA 5DM6L 4NLBA 3LP2A 4LD0A 2VG7A 4KHSA 5EU7A 4HUEA 3U9DA 1L3TA 4CJ7A 1QSSA 3SCXA 3DRSA 5MLCQ 2OYQA 5JVHL 3CJ1A 1JXBA 2Z1JA 2DPNA 1NOYA 1TL1A 3D2FB 2G8VA 3BP8A 4CJRA 2B5JA 2YNGA 1BI4B 2IIRA 4CF0A 4B1XB 3SQ0A 1YF5L 4DSLA 4JK7A 4A2BA 3MXJA 2PFUA 2V7ZA 2UUBK 2GELA 4R79A 4E89A 5FPEA 3IS9A 3SI6A 3DXMA 2Q1NA 4NYFA 2FLOA 3O9TA 4CI6A 4DLEA 4E7LA 3HL8A 1C0UA 3ZT0A 4WFBL 4KHPK 3LALA 2PBDA 3RMAA 3QBXA 4LC9B 1S72N 1X9JA 4AHVA 4CHYA 4O44A 3TSPA 5KPZA 1B9DA 1NMNA 4DB3A 1NJZA 5C2FA 4TSXA 1I3AA 2VG5A 4M7YA 3LPTA 2A40A 1QSYA 2UXDK 3SAFA 2P9LB 4CGHA 2RN2A 2KZZA 3HPGA 1RTHA 4WFAL 4ILGB 3MXMA 4BG8A 3WT0A 4N5SA 4DTNA 4DQ8A 3SK3A 4I6MB 4DV5K 4QOZB 1NLVA 4FLYA 1BG3A 3TPQA 4CK1A 1NNEA 2HNDA 3VQ4A 3K59A 4ILJA 3J8AA 4AHUA 1C0GA 1YTUA 5GAEP 4KO0A 3C7NA 3A5LC 5HRPA 3RR8A 4IOCL 2X6NA 1S9GA 1KLMA 4MLHA 2FSJA 1ESVA 4F2SA 5AJ3K 3E01A 2HSTA 2P9UA 2CGKA 1RT7A 4M7XA 4OJRA 5AQSA 3CJ9A 5FPDA 1BO5O 2XO7A 1R0AA 3IMXA 5EVZA 4DR5K 2CH6A 3CERA 5IWAK 3FZMA 1D9FA 2GUPA 3CG7A 4XEIA 4JKGA 3VPZA 3AA2A 3P4IA 4B1WB 3VN5A 4FZYA 3O3GA 3U3GA 2FF3B 3HP9A 3NH0A 2ITGA 4H4MA 4H5NA 1KD1O 3MX5A 2HHSA 4B9NA 3BZKA 4JKHA 3V9SA 3DXKA 5AQZA 1U2VA 5KRSA 2YKNA 3VF2A 3TAMA 3KWGA 1LWFA 4JKBA 1WUAA 3F73A 4MDAA 3CMEN 3HRGA 3TSQA 4I9QA 4Z4IA 1FXXA 2ETJA 4EZ9A 4OVLA 4DQIA 1MA9B 3WQUA 4CHNA 4F9OA 1VQKN 3ZLJA 3K5NA 4JS4A 2D4WA 3QFUA 2WONA 3CJBA 3DYAA 1LWCA 1VQMN 1T7PA 4LF4K 5SZTA 4F3OA 4CEQA 1TUUA 4IDHA 1JL1A 5M1FA 1DTQA 3TABA 3AA3A 3M1FA 4DSJA 3FE1A 1WBBA 4FJHA 4KHQA 1P8ZA 3CXCM 3SBGA 5ADXH 4BRQA 2E6LA 3CFOA 3V81A 1SAZA 3D7EO 3SQ1A 1S1XA 4C8OA 2KZMA 1ZBLA 2O4IA 2HHVA 2P9UB 3VQ5A 2ZM6K 2GV9A 4BGBA 3P38A 1KVBA 1EXQA 2VWJA 4B3MK 1DTTA 4YHHK 2GX9A 5AQMA 4QCLA 4IOXA 5AQGA 3W0LA 3KLHA 1SKWA 2IGIA 2D0PA 1YHQN 4KKOA 3G6EN 5K14A 4RW8A 1X1PA 1UA0A 4H8KA 3L2QA 3SUOA 1OVYA 4OPAA 1JL2A 3HM9A 3M5RA 3MXIA 1YI2N 4GMJB 4DF8A 3DXKB 3SAGA 3L4IA 1U2VB 1YVUA 3O80A 4B9QA 4B8AB 4FZZA 1JLBA 3HSCA 1SL1A 3HZ6A 3VERA 1N8RO 4CJ3A 1ASUA 4IDKA 5FROA 2BE2A 1WSHA 1XNRK 5JS1A 4AHRA 2YNFA 3OS2A 1S3XA 2J4RA 2KHOA 5M1PA 4ISGA 3KLGA 1QQMA 5ELZA 1QZ6A 5EOYA 4AM7A 4OPJA 1T05A 2PZSA 3LP0A 4JI6K 3SBTA 5BREA 5LL6Z 3DI6A 2ZGZA 4Z4FA 3KHYA 4BRMA 1T44A 1BQMA 1WSGA 5FLXO 4NXMK 4CZGA 2VCPA 2YHWA 5BRFA 4ZHRA 1EWQA 1ATRA 3K0SA 3VQAA 2QA4N 4LFCK 1YUWA 4LY7A 4FM2A 3FLCO 3DMJA 3WNGA 1NGEA 2RF2A 4M3RA 1HNXK 4CZJA 4AH9A 1TAUA 2VGMA 3G0ZA 5HP1A 1TAQA 1YIJN 4JRQA 3CC7N 3THVA 2OPPA 4DS4A 1ITGA 3OYLA 2HF4A 3CJAA 1ASWA 1A5WA 4MO5A 4CGDA 5J2MA 1D9DA 3LDLA 3MEGA 2F4VK 2Z1IA 4FW2A 4M3XA 4X66K 4M41A 1S6QA 4GV9A 4CFAA 1J54A 4MDBA 1T3VA 1TGOA 3FZFA 3LM9A 4K8XA 5KTQA 3VEZA 3JAMO 3S41A 1U45A 3PO5A 4Z4GA 3U4LA 4KHYA 4PKHA 4H0XB 1JLEA 3DLGA 1IBMK 4LH4A 4KFBA 1IKXA 2OZMA 3QNOA 4XH5A 4B8CA 1NK9A 3ZT3A 5JLFA 3MN9A 4DU4A 2ITMA 4BQLA 4RW9A 4DTSA 4Y0WA 3ZT2A 3KZBA 4DHYA 4CE9A 3VOVA 3CM5A 3F5TA 1HRHA 1HKBA 3OYFA 3SMPA 3P39A 3UKRA 4NCAA 5I3UA 2IDOA 5HRRA 3J80O 3O9UA 1IJJA 2IVPA 2OANA 2P9SA 1FK9A 4O8KA 4BRAA 4WQ4A 3DOLA 1VQ6N 1NJYA 1NK0A 2ZGYA 3OYAA 3U9ZA 4WQ5A 3WXMB 1Z05A 2E2PA 3CMAN 1B9FA 3JSMA 4O5FA 1WSFA 5LMUK 3K5MA 2A1RA 1WNSA 2IOCA 1BUPA 4N56A 2HVIA 1VQLN 2BUPA 4FWPA 2ZQBA 3NAEA 4FJXA 3V9XA 4H0TB 2HHWA 4GKJK 1YJNN 3FR0A 3OVNA 2ZJRL 3M8PA 3CQXA 4BRFA 3CF5L 3QEXA 5AQJA 2NRTA 3H46O 4W5RA 3KTQA 4OPKA 3WXLA 4IWVA 2FXUA 3AO3A 3L6QA 1QSLA 3CC2N 4DUYK 4J2AA 2FBVA 4KB0A 3AVCA 3LAMA 5AQYA 1K8KA 4A5AA 3DLLL 3LDQA 1X9SA 4FJJA 1RBRA 1BL3A 3VGKA 5BN9A 3JXUA 3KKRA 4EAHD 4FK0A 4O0JA 1DEJA 4BACA 3AA5X 4KHWA 3PSFA 4KPYA 5EY4A 3TWHA 4C8KA 2HHXA 4DR7K 4YFUA 3SJJA 3OS1A 4FZXC 4BRGA 3H1QA 3UKRB 4FJLA 1BISA 3AV9A 1BIUA 1JKHA 3V6DA 3VQPA 4FLZA 2DFHA 4XH4A 2P9SB 3BZCA 3MMVA 4Z4CA 2HHUA 4IFYA 3K57A 2ZJQL 3V9UA 3O6WA 1EKEA 1CZ9A 2FBTA 4BY9C 1JXEA 4CZLA 4Y1CA 3O1BA 3HP6A 3RMCA 5C12A 4ELTA 3G10A 3DLEA 4CW7B 3BY5A 3SV4A 1KTQA 2Q3SA 1NGDA 1TKTA 2QEXN 3P31A 1C0TA 3SUQA 1TK0A 5AQQA 5GAHP 1YVNA 4DTPA 1VSHA 1HNIA 4JKFA 4UQGA 2NRWA 3DRPA 3T1HK 4JLHA 1QTMA 3R1XA 3PUFA 4LF6K 1OH5A 2NZTA 3PO4A 1WSJA 2ASMA 4CVNE 1NJIO 3MWTA 1TYQA 1GOCA 3LWMA 1L5UA 2R7YA 4WQ4C 4B3SK 2BH1A 1YXQA 3AVFA 4RW6A 5AQRA 3V1QA 3AO1A 1GLFO 4KHUA 1W0HA 3ATUA 3IRXA 1K8KB 2X6SA 3K9JA 4PKGA 1KLNA 1U4BA 4IOAL 3C94A 1LAVA 4IJNA 3W3DA 3T7ZA 4IO8A 3V4IA 3H1VX 2P1JA 4I9LA 1UA1A 3CM6A 4PY5A 5KPRA 4DV3K 1IBLK 5SWMA 3BF1A 3ZEUA 2PAVA 3OYDA 2NUBA 2RHKA 4BDYA 2Q0RA 3A0IX 1WN7A 2PY5A 4B1UB 4JYAK 1UWBA 3BUZB 3ID6A 5C15A 3CCEN 2HVHA 3AO5A 4JAXA 1RBSA 2QTDA 4CZIA 1HX1A 1Z25A 3EN9A 3THXA 1T6CA 3I55N 3KWIA 3OBYA 5BR8K 5DK5A 1OVQA 4B9TA 1J53A 1DGKN 2E4LA 2FBYA 1HYZA 4H5WA 3LDSA 4FWOA 3DLRA 2ZJPL 3NVKA 1IKWA 3E9PA 4FPAA 4DR4K 2YKMA 4C8LA 1V4TA 5DM7L 3I33A 1NJWA 3O08A 4DFJA 4BGAA 5KGXA 3IFRA 4CGFA 1TYQB 4M63C 1UAXA 4CEBA 1VSEA 5IT9O 5EX5A 2PYJA 3S3MA 4BR7A 1X9WA 2VGNA 3EO3A 5LMNK 1HNZK 1NM1A 3WNFA 4M42A 4DFKA 3R3LA 3FFKB 5AQUA 4BDPA 3G71N 4ILHA 3LZIA 2F8TA 1VSLA 1KAXA 2FBXA 1GLLO 2E2QA 4E1NA 3O4NA 3RR7A 5HLFA 2QWNA 3U6FA 4B9VA 3LP1A 4JK8A 2O8EA 3VEYA 3ZEUB 1NK7A 3ZSZA 2HOEA 4BC3A 2YJFA 5HL7L 2G8HA 1REVA 4DV6K 1RTDA 3CCUN 5M1OA 5AQNA 3DAWA 3DOKA 3LANA 2V52B 4Z4HA 2VQFK 1J5OA 4I7FA 1NBWA 3THXB 3K2PA 4PUOA 3C6UA 1ZBSA 1HNWK 3MEEA 2E5LK 4DR3K 4DU3A 1XC9A 1K73O 1C6VA 1RBUA 3HVRA 4BRDA 4XIUA 3IDHA 5LY3A 1MU2A 5CYQA 1GLCG 2E2NA 1T8EA 3KJVA 2DFEA 3CPWM 1ZC6A 3BDPA 5C42A 4KH5A 4CESA 1Q9YA 1GLDG 2P51A 3BF3A 2HF3A 1S1VA 2A3ZA 3C65A 3GE1A 4CJUA 4JD2A 4O5BA 4NCBA 4F3TA 4B1YB 1NU0A 3UIQA 4V19S 4H5RA 3OYEA 1HNVA 5BPNA 3Q7CA 4JI0K 1TKXA 3D45A 5AQLA 3SMSA 3AY9A 4BWMA 3KK1A 3K9KA 3VEVA 1E4FT 1RDBA 2HHQA 1N34K 2Q31A 2IC3A 2YCHA 1Q82O 2YNIA 3EY1A 3QB0A 1NWKA 2RPIA 3HK2A 3P5JA 3GBTA 2O8EB 4J2BA 1EO1A 5KRTA 3U8XA 4N41A 1RNHA 3MEDA 3DRRA 1LV5A 3M8QA 4DU1A 4OLBA 4EHUA 1LWEA 1IH7A 4GKKK 3EKSA 1CXQA 3ZT4A 3ID8A 4CIFA 3HM8A 3IKMA 4JI3K 1WAJA 3M8RA 4KHNA 3L0QA 3QMLA 4K25A 1BOTO 4IFEA 4C8NA 1L3VA 5GADP 3VEXA 3ZETA 4HCBA 2D0AA 2ZWHA 4QAGA 2G8FA 4QS7A 4JHDA 1G15A 3AVGA 5KQ8A 4FCYA 1ATNA 3O3HA 4FM0A 3QESA 4J2DA 1UOCA 1ZBHA 2XY8A 2I7NA 4JS5A 1U04A 3OYIA 1JCEA 2I7PA 4JI5K 1QQCA 4IZ9A 1KAZA 3OYKA 3J7AP 3OYGA 4JD2B 3CYMA 3T69A 4BWJA 4FJ7A 1KAYA 3HSTB 1T03A 1E3MA 4BREA 3ISNC 5JMVA 3O9SA 4B3TK 3TAFA 1T6DA 1I39A 3CC4N 3SPYA 4UY8O 4DTUA 1HYSA 1X9MA 2CGLA 3LM2A 3KVGA 2WOMA 3OS0A 4DTMA 2D0OA 1GLEG 1S1UA 3EKUA 1U49A 2UUAK 4FJIA 2HNYA 2KTQA 3RMDA 4C1NI 1D8YA 1C0MA 1C1BA 4RW4A 3DJCA 4JI7K 5AQVA 3L2WA 3OTOK 1KXPA 3I8BA 3OYNA 4LF7K 4ISFA 4B08A 2ZF5O 3KLIA 1KCFA 2YJEA 2QKBA 1Q81O 4O0IA 1JLCA 2P9IA 5BRDA 4OX9K 4QS8A 3LPUA 4A61A 4IEEA 2D1KA 3AVIA 4BRKA 2OCEA 2YI1A 5KI6A 3CCSN 1L3SA 3AVKA 5BN8A 3T3FA 1S6PA 4W5OA 4EZ6A 3RVCA 4B1VA 3ZETB 3MK6A 3ZSXA 4JHDB 3CPEA 4CJ5A 3O4WA 3O9RA 1VQ5N 2DY4A 3DM2A 3L3UA 1BCMA 5FDLA 3TU5A 4DV0K 5A2QO 3CCVN 3SV3A 1TKZA 1KRPA 1S1TA 1IV0A 3S3OA 4E7IA 3J7YP 3HXMA 3VQ6A 4N76A 2W41A 4CEDA 2QWOA 2HBMA 3TTDA 4EP4A 1B92A 1RTIA 4M45A 4DTXA 3A5NC 2D0CA 4I2PA 3PY8A 4JN4A 1F21A 4FLUA 4O55A 1GLAG 4DUZK 1U6ZA 3AARA 3EYZA 1HKCA 3Q7BA 2GBZA 1SKRA 1MWMA 2KFNA 5AQWA 1IBKK 3C6AA 5CR4A 1J6ZA 1IO2A 3O4QA 3A5OC 3NH1A 3O3FA 2ATQA 3VENA 2OA8A 3WUHA 4AHTA 4FLTA 3SQ4A 3PX6A 4X65K 5B8HA 1VQNN 4BC5A 4BR5A 2XY7A 3HPHA 3VQ8A 2P9IB 1HKGA 3SAHA 3J81O 3AGKA 4JNEA 4G9ZA 4DFMA 1BIZA 1W7AA 4H4OA 3AVLA 3PIOL 2I5JA 2A1SA 5FPMA 4YDUA 4A57A 3TR8A 3RMBA 4FJ9A 5LJWA 3ENHA 5AQPA 3SYZA 2UU9K 4DQRA 3HOTA 2NNWA 3VMFB 4CEEA 4HUGA 1MWKA 2OZSA 4CJEA 4DV1K 4GY2B 1RCHA 4H0OA 2QXLA 1KFSA 5AFUH 1R59O 3H3OB 2O4GA 1O1WA 4BVPA 3AVAA 3T1YK 3CD6N 1C0FA 3ITHA 3DLHA 2JLEA 2V7YA 3SPZA 4A2AA 4E7HA 4DV4K 3H6EA 4HCCA 3DWLA 4YOUA 4FVUA 1RBTA 4PKIA 2QWLA 3KD1E 1C1CA 4OPHA 3NGIA 3F2KA 4R5PA 4FJNA 1L3UA 4FJ8A 1XMQK 3VTHA 1ATSA 3MN7A 1VAZA 3ZSQA 4DMNA 4CBUA 3GDQA 3AAQA 5TKWA 2YHYA 3E9OA 4AM6A 3L4QA 4LSLA 4CZFA 1QHTA 4U67L 4H0PA 2Q36A 4CK3A 2QWQA 1KSPA 3QFPA 4YOYA 3QEPA 4KTQA 3IUCA 2HBLA 3SUPA 5CZ2A 2HHHK 3TAQA 5JS2A 1RTJA 4Y1DA 3D2EA 4FWMA 2D5RA 4HTLA 3M6GA 2QWPA 4M3UA 4IKFA 1G99A 3OYMA 3PV8A 3VQCA 4CHZA 1YJWN 3MDQA 4FJKA 4KRFA 3L8BA 1EETA 1RDDA 1TUYA 2OPSA 2NLXA 3BEXA 3I8DA 1SUQA 5HBMA 2E88A 4LFBK 3V1OA 5BRHA 3D6RA 4JKEA 3QNNA 4KI6A 2YHBA 2P9KA 5KPTA 4B3RK 1CZBA 3KK3A 4CECA 3TAGA 4DQPA 1VQPN 1WOQA 4C23A 2X74A 1WB9A 2GEMA 2OTLN 5FRMA 4KTWA 4X64K 4CJVA 1BQNA 1NOZA 3UKUA 4KH4A 1FW6A 3KK7A 4CD3A 1XHZA 1XMOK 2XRIA 4B9LA 2D0BA 1N33K 4FK2A 4YDUC 5GINA 2QK9A 3QBWA 5AQTA 2F7TA 4JI2K 3VQDA 1W2BM 1FKOA 1NK4A 1XHXA 2GWJA 4DR2K 4CZMA 4DG1A 1N32K 3OJUA 3DLKA 2VG6A 5M1KA 2JWLA 1BU6O 2BTFA 3E1YA 2HMPA 4BRIA 4ZTFA 3RWUA 1QHAA 2KW4A 5M1NA 3WQTA 3HYFA 4CZEA 2P5OA 4LF8K 4CJ4A 4LF5K 4PWDA 5CYMA 4CF2A 1NK6A 3A2FA 3ZCMA 3QIOA 3D2EB 1S9EA 3NBPA 4CEZA 4DFPA 1HPZA 3FZHA 3CCRN 3LL3A 3OA9A 4KI4A 3CQYA 5E41A 1YTAA 4YY3K 4DS5A 3F9MA 3S3NA 1MDUB 2GTDA 1D4XA 3S9HA 4CEFA 3NVMA 3T1AA 2Q97A 3JYTA 1VSMA 4CK2A 2EX3A 4X62K 5AR0A 3LDNA 4GVMA 2JWKA 1XC3A 4JK9A 4PQUA 1NKCA 5JICA 2P9KB 1N5YA 1NGCA 5AQIA 3TARA 5JLHA 3ZX3A 2OPQA 3C6TA 3NDKA 4GV6A 2X78A 4YOVA 1QE1A 3NGYA 4BR0A 3I56N 1BCOA 3AVNA
chains in the Genus database with same CATH topology
3D45A 1IKVA 4KTZA 5JS1A 2YNHA 4AHRA 2YNFA 3OS2A 1NKBA 4MFBA 1Z26A 1A5XA 4BWMA 3KK1A 5DMRA 3KLGA 3L3VA 1TV6A 4G1QA 1LW0A 5FRNA 4FLWA 4F4KA 1RDBA 3NHGA 4OPJA 1T05A 2PZSA 4DSIA 3SNNA 3LP0A 2HHQA 4DTJA 2YHAA 3KLFA 1Y97A 4FVMA 4FYDA 2IC3A 4MQ3A 2YNIA 3UIQA 3B6OA 2HW3A 1EP4A 1ZBIA 3EY1A 3DI6A 2RPIA 3QIPA 3HK2A 1ZBUA 4Z4FA 4ICLA 3EZ5A 4M3TA 4NCGA 1BGXT 3P5JA 2HB5A 1BQMA 1WSGA 3L2VA 4J2BA 5KRTA 4E1MA 2B4JA 3NF7A 4N41A 1RNHA 4E0DA 2JGUA 4RG8A 2DTUA 3VA0A 3MEDA 4KAZA 3DRRA 4ELUA 4ZHRA 1LV5A 3M8QA 4DU1A 4OLBA 2IAJA 3VQAA 3OY9A 4CJSA 1LWEA 4YNQA 3ZT1A 4FJGA 1IH7A 3QO9A 4N47A 1CXQA 3ZT4A 4CIFA 2G8UA 4LY7A 4FM2A 3AA4A 3AVMA 1S5JA 3DMJA 2QKKA 3ZSWA 3OYBA 1WAJA 3WNGA 2RF2A 2BGGA 4M3RA 3P83D 1Q8IA 3M8RA 4AH9A 4KHNA 1TAUA 4M3YA 4LSNA 3KLEA 4KB1A 4CIGA 3G0ZA 2XY5A 4CHQA 2BANA 5HP1A 1TAQA 1U47A 4ELVA 3AVBA 2F8SA 4C8NA 4JRQA 1L3VA 3SZ2A 4HCBA 2D0AA 2Z1GA 4QAGA 1SV5A 2Z1HA 2OPPA 3THVA 2G8FA 1G15A 3AVGA 4DS4A 1ITGA 3OYLA 5J2PA 3HPOA 4FCYA 1ASWA 1ZBFA 1A5WA 2LSNA 3O3HA 3HT3A 4BE1A 4CGDA 5T7BA 4FM0A 1UOCA 5J2MA 4OKJA 5J2QA 1D9DA 4J2DA 1ZBHA 2XY8A 3MEGA 2Z1IA 4FW2A 4E19A 4M3XA 2GUIA 1J9AA 2FC0A 2ZE2A 2PYLA 3ZSVA 4M41A 4JS5A 1U04A 1HQEA 1S6QA 3OYIA 4CFAA 1J54A 3LAKA 1WLJA 1TGOA 4K8XA 1QQCA 5KTQA 1VSIA 3OYKA 3OYGA 1RT2A 1U45A 3PO5A 3QETA 3ALYA 4CF8A 4CFDA 4Z4GA 3CYMA 1HYVA 1KVCA 1N6QA 4KHYA 3PX4A 3VQQA 4BWJA 4FJ7A 1JLEA 3HSTB 1LAWA 3QINA 3DLGA 1T03A 2G8KA 3I0RA 1VSDA 4LH4A 3ISNC 4KFBA 3VQBA 1IKXA 5KGWA 2F96A 5HRNA 3QNOA 2P5GA 2OZMA 4M3WA 1TK5A 4IG3A 2OPRA 4B8CA 3ZT3A 4CHOA 1NK9A 1VSKA 3TAFA 4HVJA 4Z4EA 5CZ1A 2QXFA 2BDPA 4DU4A 3L2UA 3TAPA 3V1RA 1I39A 4B9UA 3SPYA 1TKDA 3C95A 4RW9A 4DTSA 4DTUA 4CHPA 3TANA 1HYSA 1X9MA 3ZT2A 3T19A 1VRUA 4HUFA 2WOMA 1VK0A 4CJFA 3OS0A 4DTMA 1BI4A 4CE9A 1YT3A 3CM5A 4K8ZA 1HRHA 1FKPA 1S1UA 3OYFA 1U49A 5C24A 4NCAA 4FJIA 2HNYA 5I3UA 2IDOA 2KTQA 5HRRA 3WNHA 3LZJA 3ZSOA 3RMDA 1BHLA 2YV0X 1C0MA 1C1BA 4RW4A 4W5TA 1D8YA 4CERA 1C1AA 4BE2A 1FK9A 3LWLA 3L2WA 3TI0A 3RRGA 4ID1A 3NF9A 4CJPA 4M3ZA 2ZD1A 3DOLA 1TL3A 3KK2A 1NJYA 3OYNA 1NK0A 4Q0BA 3OYAA 4B08A 1JLQA 3U3YA 2AJQA 3KLIA 2XHBA 2Y1JA 2EHGA 1KCFA 4CJWA 1U48A 4KREA 2QKBA 4O0IA 1JLCA 5J2NA 3RTVA 1ZYQA 1B9FA 1IKYA 3JSMA 1RT6A 4EP5A 1WSFA 4FXDA 3LPUA 4CJTA 3AVIA 3ZSYA 3K5MA 4C8MA 2XY6A 4OKKA 2A1RA 1WNSA 2IOCA 5KI6A 4N56A 3NF8A 1HJRA 4IBNA 2HVIA 3HO1A 3H08A 3MECA 1L3SA 1WAFA 2ZQBA 3AVKA 3NAEA 4CCHA 3T3FA 4PA1A 3V9XA 4FJXA 1S6PA 4W5OA 4EZ6A 2HHWA 5HROA 4F2RA 3OVNA 3MAQA 1SL0A 1S1WA 4GW6A 3QERA 3IG1A 4NYNA 3ZSXA 3M8PA 4CJ5A 4CJQA 4W5QA 3QEXA 3LP3A 1GOAA 4E7JA 4CGJA 4W5RA 3CQ8A 4BDZA 3KTQA 1RT5A 4OPKA 2DY4A 4F8RA 4FLXA 3DM2A 1RT3A 3L3UA 1BCMA 5FDLA 2HNZA 3K5OA 4CJKA 2Y1IA 3AO3A 4DWIA 4FJMA 1XWLA 4CFBA 3SV3A 1TKZA 1CXUA 4B9SA 1KRPA 1S1TA 1QSLA 1K6YA 4IFVA 3S3OA 4E7IA 3LP2A 4LD0A 2FBVA 2VG7A 4J2AA 4KB0A 4KHSA 3AVCA 5EU7A 4HUEA 1SL2A 3VQ9A 3LAMA 3HXMA 1L3TA 1RBVA 3VQ6A 1QSSA 4N76A 3SCXA 3DRSA 1X9SA 4CEDA 4FJJA 2OYQA 1RBRA 4EP4A 1BL3A 1JXBA 1B92A 1RTIA 4M45A 4DTXA 1NK8A 2Z1JA 4HHTA 2D0CA 4I2PA 3KKRA 3PY8A 4FK0A 1F21A 2RKIA 4O0JA 4HTUA 4FLUA 4O55A 1NOYA 4BACA 1TL1A 3EYZA 3AA5X 4PWDA 2G8VA 1QS4A 4CJRA 4BE0A 4CJLA 2B5JA 4B9MA 4KHWA 2GBZA 3TAEA 1LW2A 1SKRA 4KPYA 2YNGA 2KFNA 3TWHA 3QEIA 1BI4B 4C8KA 5HRSA 2HHXA 4YFUA 3SJJA 4CF0A 1IO2A 3O4QA 3SQ0A 3OS1A 4FZXC 4AHSA 3ASMA 1IG9A 1WSIA 4DSLA 1SKSA 4FJLA 3MXJA 3NH1A 1BISA 3PX0A 1TVRA 3AV9A 4E7KA 4CGGA 1BIUA 1JKHA 3O3FA 2ATQA 3V6DA 3VQPA 4FLZA 2DFHA 2OA8A 2HHUA 4E89A 4Z4CA 4AHTA 4FLTA 3IS9A 4IFYA 4DSKA 4W5NA 3K57A 3SQ4A 3NE6A 3SI6A 3PX6A 3V9UA 3OYJA 4NYFA 1NK5A 1EKEA 1CZ9A 2FBTA 3VQ7A 4FM1A 1JXEA 2XY7A 4DLEA 4E7LA 2W42A 4Y1CA 3HPHA 4OGCA 1VSJA 3HL8A 3HP6A 1C0UA 1RDAA 3VQ8A 3ZT0A 3RMCA 3G10A 4ELTA 3LALA 3DLEA 3CFRA 3RMAA 4DFMA 2E6MA 3SQ2A 1BIZA 3SV4A 1KTQA 4H4OA 2Q3SA 4AHVA 4CF9A 4O44A 1TKTA 3AVLA 4CHYA 3NCIA 2I5JA 1C0TA 3SUQA 1TK0A 1B9DA 4O4GA 1NJZA 2A1SA 4TSXA 1I3AA 2VG5A 4DTPA 1WSEA 1RILA 1VSHA 3LPTA 1HNIA 3TR8A 4UQGA 3RMBA 4FJ9A 1Q9XA 3DRPA 5FROA 3SYZA 1QSYA 1RT4A 4CGHA 2RN2A 4CIEA 4DQRA 3VA3A 3SUNA 2KZZA 4JLHA 3HPGA 1QTMA 4CEEA 4HUGA 3PUFA 1RTHA 5I42A 4Q5VA 4DQSA 3PO4A 2OZSA 1WSJA 3MXMA 4CJEA 1GOBA 1GOCA 4FK4A 3CFPA 3LWMA 1JLGA 4N5SA 4DTNA 1RCHA 2B6AA 1L5UA 2R7YA 1KFSA 3AVJA 4RW7A 3AVFA 2O4GA 1O1WA 4RW6A 4QOZB 1XI1A 3V1QA 4FLYA 3AVAA 3FFIA 1VRTA 1RT1A 3AO1A 4CK1A 3ITHA 4OKEA 4KHUA 1W0HA 2JLEA 4E3SA 3SPZA 3DLHA 4E7HA 3IRXA 2HNDA 3AO2A 2X6SA 3VQEA 3VQ4A 3OYHA 4HCCA 4DF4A 3K59A 3ULDA 3RRHA 1RBTA 1U4BA 4DTRA 1KLNA 3C94A 1LAVA 4AHUA 4WE1A 3KD1E 3L2RA 1C1CA 3NGIA 3V4IA 1YTUA 2P1JA 4KO0A 4I9LA 4R5PA 3CM6A 1UA1A 4FJNA 4PY5A 4FLVA 3QLHA 1L3UA 4FJ8A 3AVHA 5HRPA 3RR8A 3ZSQA 4DMNA 5SWMA 2X6NA 1D5AA 1S9GA 4OGEA 1TK8A 4LSLA 3OYDA 1QHTA 3OYCA 1KLMA 2NUBA 4F2SA 4CK3A 3K58A 3HVTA 4BDYA 1KSPA 3E01A 2PY5A 1WN7A 3QEPA 4CEAA 4KTQA 1DLOA 3IAYA 4DLGA 1UWBA 3SUPA 5CZ2A 3ZSRA 1NKEA 3TAQA 1RT7A 4OJRA 2HVHA 4DSEA 3AO5A 3I0SA 5JS2A 4KV8A 4ZTJA 1EX4A 1RBSA 1RTJA 4Y1DA 2HMIA 2XO7A 3V9ZA 4I2QA 2D5RA 1R0AA 3HJFA 4M3UA 1Z25A 1D9FA 4IKFA 3OYMA 3CG7A 3BGRA 3AA2A 3VQCA 3PV8A 4FJ5A 3VN5A 4FZYA 4CHZA 3O3GA 3NH2A 3U3GA 4FJKA 3HP9A 4KRFA 5DK5A 1CLQA 3NH0A 2ITGA 4H4MA 5C25A 3L8BA 1J53A 1EETA 4B9TA 1RDDA 2E4LA 2FBYA 1HYZA 3LDSA 4OLAA 3DLRA 2OPSA 2HHSA 4B9NA 3KD5E 1BCOA 1IKWA 3I8DA 3V9SA 1SUQA 5HBMA 2YKMA 4Z0UA 4C8LA 2DFFA 1NJWA 4IG0A 3V1OA 5KRSA 4DFJA 2YKNA 3NGZA 3QNNA 4KI6A 3TAMA 1LWFA 2YHBA 2G8WA 5J1EA 5KGXA 1CZBA 4CGFA 1ASVA 3KK3A 4DSFA 1UAXA 4CEBA 1VSEA 3F73A 4CECA 3TAGA 2KQ2A 1HQUA 3K5LA 2PYJA 4DQPA 3S3MA 2KFZA 4I9QA 4Z4IA 1FXXA 2ETJA 4CGIA 1X9WA 2X74A 4EZ9A 4OVLA 4DQIA 4CHNA 1JLFA 5FRMA 3WNFA 3K5NA 4KTWA 4CEOA 4M42A 4CJVA 4JS4A 1HMVA 1BQNA 1NOZA 4DFKA 2WONA 3DYAA 1LWCA 4BDPA 1T7PA 5SZTA 3M8SA 3F9KA 3LZIA 2F8TA 1XHZA 1VSFA 1VSLA 2FBXA 4CEQA 1NJXA 4F3OA 4L8RB 2XRIA 5D3GA 3KIOA 4E1NA 4B9LA 2D0BA 4LH5A 3O4NA 1JL1A 1RDCA 4FK2A 2HHTA 1DTQA 2QK9A 3VQDA 3TABA 3NF6A 3DLBA 3RR7A 3P1GA 1FKOA 3AA3A 1XHXA 5HLFA 3KKSA 1NK4A 4DSJA 3U6FA 4B9VA 4FJHA 4DG1A 4KHQA 3LP1A 3OJSA 3OJUA 3DLKA 2VG6A 4FW1A 4B3OA 4DTOA 2E6LA 3CFOA 3V81A 1A5VA 3ZSZA 1NK7A 3SQ1A 1S1XA 4C8OA 2KZMA 4ZTFA 1ZBLA 2G8HA 3RWUA 1REVA 4ID5A 1RTDA 2KW4A 3QEWA 3V9WA 2O4IA 2HHVA 1KFDA 2VWKA 3VQ5A 4CFCA 2GV9A 3HYFA 2P5OA 4CF1A 3NFAA 1JLAA 1KVBA 1EXQA 5CYMA 4CJ4A 4CF2A 3D0PA 1NK6A 2VWJA 3A2FA 3B6PA 1DTTA 3ZCMA 3QIOA 3DOKA 3LANA 1S9EA 3NBPA 4CEZA 4Z4HA 4DFPA 4QCLA 1J5OA 4I7FA 1HPZA 1W9HA 3KLHA 3K2PA 1SKWA 5CY4A 2IGIA 4PUOA 3C6UA 4KI4A 5E41A 3MEEA 1YTAA 4KKOA 4DS5A 5K14A 4DU3A 4RW8A 1X1PA 3S3NA 1UA0A 4H8KA 1C6VA 1RBUA 3HVRA 1XC9A 3L2QA 4XIUA 4JRPA 3SUOA 3S9HA 1MU2A 5CYQA 1T8EA 4CEFA 3KJVA 3T1AA 3QEVA 2DFEA 1JL2A 3HM9A 3JYTA 1VSMA 3MXIA 4CK2A 2EX3A 2IS3A 3BDPA 4GMJB 5C42A 1Q9YA 4CESA 4DQQA 3AO4A 4DF8A 1TKXA 2P51A 2G8IA 1YVUA 1S1VA 4GVMA 4PQUA 1NKCA 3QESA 4B8AB 4CJUA 4FZZA 4O5BA 3WNEA 4NCBA 1N5YA 1JLBA 1SL1A 4F3TA 3TARA 1KVAA 2OPQA 3C6TA 4CJ3A 4AHCA 2X78A 3NDKA 4AILC 3OYEA 1QE1A 3NGYA 1ASUA 1HNVA 4J2EA 4IDKA 2BE2A 1WSHA 3AVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D45 A;  1IKV A;  4KTZ A;  5JS1 A;  2YNH A;  4AHR A;  2YNF A;  3OS2 A;  1NKB A;  4MFB A;  1Z26 A;  1A5X A;  4BWM A;  3KK1 A;  5DMR A;  3KLG A;  3L3V A;  1TV6 A;  4G1Q A;  1LW0 A;  5FRN A;  4FLW A;  4F4K A;  1RDB A;  3NHG A;  4OPJ A;  1T05 A;  2PZS A;  4DSI A;  3SNN A;  3LP0 A;  2HHQ A;  4DTJ A;  2YHA A;  3KLF A;  1Y97 A;  4FVM A;  4FYD A;  2IC3 A;  4MQ3 A;  2YNI A;  3UIQ A;  3B6O A;  2HW3 A;  1EP4 A;  1ZBI A;  3EY1 A;  3DI6 A;  2RPI A;  3QIP A;  3HK2 A;  1ZBU A;  4Z4F A;  4ICL A;  3EZ5 A;  4M3T A;  4NCG A;  1BGX T;  3P5J A;  2HB5 A;  1BQM A;  1WSG A;  3L2V A;  4J2B A;  5KRT A;  4E1M A;  2B4J A;  3NF7 A;  4N41 A;  1RNH A;  4E0D A;  2JGU A;  4RG8 A;  2DTU A;  3VA0 A;  3MED A;  4KAZ A;  3DRR A;  4ELU A;  4ZHR A;  1LV5 A;  3M8Q A;  4DU1 A;  4OLB A;  2IAJ A;  3VQA A;  3OY9 A;  4CJS A;  1LWE A;  4YNQ A;  3ZT1 A;  4FJG A;  1IH7 A;  3QO9 A;  4N47 A;  1CXQ A;  3ZT4 A;  4CIF A;  2G8U A;  4LY7 A;  4FM2 A;  3AA4 A;  3AVM A;  1S5J A;  3DMJ A;  2QKK A;  3ZSW A;  3OYB A;  1WAJ A;  3WNG A;  2RF2 A;  2BGG A;  4M3R A;  3P83 D;  1Q8I A;  3M8R A;  4AH9 A;  4KHN A;  1TAU A;  4M3Y A;  4LSN A;  3KLE A;  4KB1 A;  4CIG A;  3G0Z A;  2XY5 A;  4CHQ A;  2BAN A;  5HP1 A;  1TAQ A;  1U47 A;  4ELV A;  3AVB A;  2F8S A;  4C8N A;  4JRQ A;  1L3V A;  3SZ2 A;  4HCB A;  2D0A A;  2Z1G A;  4QAG A;  1SV5 A;  2Z1H A;  2OPP A;  3THV A;  2G8F A;  1G15 A;  3AVG A;  4DS4 A;  1ITG A;  3OYL A;  5J2P A;  3HPO A;  4FCY A;  1ASW A;  1ZBF A;  1A5W A;  2LSN A;  3O3H A;  3HT3 A;  4BE1 A;  4CGD A;  5T7B A;  4FM0 A;  1UOC A;  5J2M A;  4OKJ A;  5J2Q A;  1D9D A;  4J2D A;  1ZBH A;  2XY8 A;  3MEG A;  2Z1I A;  4FW2 A;  4E19 A;  4M3X A;  2GUI A;  1J9A A;  2FC0 A;  2ZE2 A;  2PYL A;  3ZSV A;  4M41 A;  4JS5 A;  1U04 A;  1HQE A;  1S6Q A;  3OYI A;  4CFA A;  1J54 A;  3LAK A;  1WLJ A;  1TGO A;  4K8X A;  1QQC A;  5KTQ A;  1VSI A;  3OYK A;  3OYG A;  1RT2 A;  1U45 A;  3PO5 A;  3QET A;  3ALY A;  4CF8 A;  4CFD A;  4Z4G A;  3CYM A;  1HYV A;  1KVC A;  1N6Q A;  4KHY A;  3PX4 A;  3VQQ A;  4BWJ A;  4FJ7 A;  1JLE A;  3HST B;  1LAW A;  3QIN A;  3DLG A;  1T03 A;  2G8K A;  3I0R A;  1VSD A;  4LH4 A;  3ISN C;  4KFB A;  3VQB A;  1IKX A;  5KGW A;  2F96 A;  5HRN A;  3QNO A;  2P5G A;  2OZM A;  4M3W A;  1TK5 A;  4IG3 A;  2OPR A;  4B8C A;  3ZT3 A;  4CHO A;  1NK9 A;  1VSK A;  3TAF A;  4HVJ A;  4Z4E A;  5CZ1 A;  2QXF A;  2BDP A;  4DU4 A;  3L2U A;  3TAP A;  3V1R A;  1I39 A;  4B9U A;  3SPY A;  1TKD A;  3C95 A;  4RW9 A;  4DTS A;  4DTU A;  4CHP A;  3TAN A;  1HYS A;  1X9M A;  3ZT2 A;  3T19 A;  1VRU A;  4HUF A;  2WOM A;  1VK0 A;  4CJF A;  3OS0 A;  4DTM A;  1BI4 A;  4CE9 A;  1YT3 A;  3CM5 A;  4K8Z A;  1HRH A;  1FKP A;  1S1U A;  3OYF A;  1U49 A;  5C24 A;  4NCA A;  4FJI A;  2HNY A;  5I3U A;  2IDO A;  2KTQ A;  5HRR A;  3WNH A;  3LZJ A;  3ZSO A;  3RMD A;  1BHL A;  2YV0 X;  1C0M A;  1C1B A;  4RW4 A;  4W5T A;  1D8Y A;  4CER A;  1C1A A;  4BE2 A;  1FK9 A;  3LWL A;  3L2W A;  3TI0 A;  3RRG A;  4ID1 A;  3NF9 A;  4CJP A;  4M3Z A;  2ZD1 A;  3DOL A;  1TL3 A;  3KK2 A;  1NJY A;  3OYN A;  1NK0 A;  4Q0B A;  3OYA A;  4B08 A;  1JLQ A;  3U3Y A;  2AJQ A;  3KLI A;  2XHB A;  2Y1J A;  2EHG A;  1KCF A;  4CJW A;  1U48 A;  4KRE A;  2QKB A;  4O0I A;  1JLC A;  5J2N A;  3RTV A;  1ZYQ A;  1B9F A;  1IKY A;  3JSM A;  1RT6 A;  4EP5 A;  1WSF A;  4FXD A;  3LPU A;  4CJT A;  3AVI A;  3ZSY A;  3K5M A;  4C8M A;  2XY6 A;  4OKK A;  2A1R A;  1WNS A;  2IOC A;  5KI6 A;  4N56 A;  3NF8 A;  1HJR A;  4IBN A;  2HVI A;  3HO1 A;  3H08 A;  3MEC A;  1L3S A;  1WAF A;  2ZQB A;  3AVK A;  3NAE A;  4CCH A;  3T3F A;  4PA1 A;  3V9X A;  4FJX A;  1S6P A;  4W5O A;  4EZ6 A;  2HHW A;  5HRO A;  4F2R A;  3OVN A;  3MAQ A;  1SL0 A;  1S1W A;  4GW6 A;  3QER A;  3IG1 A;  4NYN A;  3ZSX A;  3M8P A;  4CJ5 A;  4CJQ A;  4W5Q A;  3QEX A;  3LP3 A;  1GOA A;  4E7J A;  4CGJ A;  4W5R A;  3CQ8 A;  4BDZ A;  3KTQ A;  1RT5 A;  4OPK A;  2DY4 A;  4F8R A;  4FLX A;  3DM2 A;  1RT3 A;  3L3U A;  1BCM A;  5FDL A;  2HNZ A;  3K5O A;  4CJK A;  2Y1I A;  3AO3 A;  4DWI A;  4FJM A;  1XWL A;  4CFB A;  3SV3 A;  1TKZ A;  1CXU A;  4B9S A;  1KRP A;  1S1T A;  1QSL A;  1K6Y A;  4IFV A;  3S3O A;  4E7I A;  3LP2 A;  4LD0 A;  2FBV A;  2VG7 A;  4J2A A;  4KB0 A;  4KHS A;  3AVC A;  5EU7 A;  4HUE A;  1SL2 A;  3VQ9 A;  3LAM A;  3HXM A;  1L3T A;  1RBV A;  3VQ6 A;  1QSS A;  4N76 A;  3SCX A;  3DRS A;  1X9S A;  4CED A;  4FJJ A;  2OYQ A;  1RBR A;  4EP4 A;  1BL3 A;  1JXB A;  1B92 A;  1RTI A;  4M45 A;  4DTX A;  1NK8 A;  2Z1J A;  4HHT A;  2D0C A;  4I2P A;  3KKR A;  3PY8 A;  4FK0 A;  1F21 A;  2RKI A;  4O0J A;  4HTU A;  4FLU A;  4O55 A;  1NOY A;  4BAC A;  1TL1 A;  3EYZ A;  3AA5 X;  4PWD A;  2G8V A;  1QS4 A;  4CJR A;  4BE0 A;  4CJL A;  2B5J A;  4B9M A;  4KHW A;  2GBZ A;  3TAE A;  1LW2 A;  1SKR A;  4KPY A;  2YNG A;  2KFN A;  3TWH A;  3QEI A;  1BI4 B;  4C8K A;  5HRS A;  2HHX A;  4YFU A;  3SJJ A;  4CF0 A;  1IO2 A;  3O4Q A;  3SQ0 A;  3OS1 A;  4FZX C;  4AHS A;  3ASM A;  1IG9 A;  1WSI A;  4DSL A;  1SKS A;  4FJL A;  3MXJ A;  3NH1 A;  1BIS A;  3PX0 A;  1TVR A;  3AV9 A;  4E7K A;  4CGG A;  1BIU A;  1JKH A;  3O3F A;  2ATQ A;  3V6D A;  3VQP A;  4FLZ A;  2DFH A;  2OA8 A;  2HHU A;  4E89 A;  4Z4C A;  4AHT A;  4FLT A;  3IS9 A;  4IFY A;  4DSK A;  4W5N A;  3K57 A;  3SQ4 A;  3NE6 A;  3SI6 A;  3PX6 A;  3V9U A;  3OYJ A;  4NYF A;  1NK5 A;  1EKE A;  1CZ9 A;  2FBT A;  3VQ7 A;  4FM1 A;  1JXE A;  2XY7 A;  4DLE A;  4E7L A;  2W42 A;  4Y1C A;  3HPH A;  4OGC A;  1VSJ A;  3HL8 A;  3HP6 A;  1C0U A;  1RDA A;  3VQ8 A;  3ZT0 A;  3RMC A;  3G10 A;  4ELT A;  3LAL A;  3DLE A;  3CFR A;  3RMA A;  4DFM A;  2E6M A;  3SQ2 A;  1BIZ A;  3SV4 A;  1KTQ A;  4H4O A;  2Q3S A;  4AHV A;  4CF9 A;  4O44 A;  1TKT A;  3AVL A;  4CHY A;  3NCI A;  2I5J A;  1C0T A;  3SUQ A;  1TK0 A;  1B9D A;  4O4G A;  1NJZ A;  2A1S A;  4TSX A;  1I3A A;  2VG5 A;  4DTP A;  1WSE A;  1RIL A;  1VSH A;  3LPT A;  1HNI A;  3TR8 A;  4UQG A;  3RMB A;  4FJ9 A;  1Q9X A;  3DRP A;  5FRO A;  3SYZ A;  1QSY A;  1RT4 A;  4CGH A;  2RN2 A;  4CIE A;  4DQR A;  3VA3 A;  3SUN A;  2KZZ A;  4JLH A;  3HPG A;  1QTM A;  4CEE A;  4HUG A;  3PUF A;  1RTH A;  5I42 A;  4Q5V A;  4DQS A;  3PO4 A;  2OZS A;  1WSJ A;  3MXM A;  4CJE A;  1GOB A;  1GOC A;  4FK4 A;  3CFP A;  3LWM A;  1JLG A;  4N5S A;  4DTN A;  1RCH A;  2B6A A;  1L5U A;  2R7Y A;  1KFS A;  3AVJ A;  4RW7 A;  3AVF A;  2O4G A;  1O1W A;  4RW6 A;  4QOZ B;  1XI1 A;  3V1Q A;  4FLY A;  3AVA A;  3FFI A;  1VRT A;  1RT1 A;  3AO1 A;  4CK1 A;  3ITH A;  4OKE A;  4KHU A;  1W0H A;  2JLE A;  4E3S A;  3SPZ A;  3DLH A;  4E7H A;  3IRX A;  2HND A;  3AO2 A;  2X6S A;  3VQE A;  3VQ4 A;  3OYH A;  4HCC A;  4DF4 A;  3K59 A;  3ULD A;  3RRH A;  1RBT A;  1U4B A;  4DTR A;  1KLN A;  3C94 A;  1LAV A;  4AHU A;  4WE1 A;  3KD1 E;  3L2R A;  1C1C A;  3NGI A;  3V4I A;  1YTU A;  2P1J A;  4KO0 A;  4I9L A;  4R5P A;  3CM6 A;  1UA1 A;  4FJN A;  4PY5 A;  4FLV A;  3QLH A;  1L3U A;  4FJ8 A;  3AVH A;  5HRP A;  3RR8 A;  3ZSQ A;  4DMN A;  5SWM A;  2X6N A;  1D5A A;  1S9G A;  4OGE A;  1TK8 A;  4LSL A;  3OYD A;  1QHT A;  3OYC A;  1KLM A;  2NUB A;  4F2S A;  4CK3 A;  3K58 A;  3HVT A;  4BDY A;  1KSP A;  3E01 A;  2PY5 A;  1WN7 A;  3QEP A;  4CEA A;  4KTQ A;  1DLO A;  3IAY A;  4DLG A;  1UWB A;  3SUP A;  5CZ2 A;  3ZSR A;  1NKE A;  3TAQ A;  1RT7 A;  4OJR A;  2HVH A;  4DSE A;  3AO5 A;  3I0S A;  5JS2 A;  4KV8 A;  4ZTJ A;  1EX4 A;  1RBS A;  1RTJ A;  4Y1D A;  2HMI A;  2XO7 A;  3V9Z A;  4I2Q A;  2D5R A;  1R0A A;  3HJF A;  4M3U A;  1Z25 A;  1D9F A;  4IKF A;  3OYM A;  3CG7 A;  3BGR A;  3AA2 A;  3VQC A;  3PV8 A;  4FJ5 A;  3VN5 A;  4FZY A;  4CHZ A;  3O3G A;  3NH2 A;  3U3G A;  4FJK A;  3HP9 A;  4KRF A;  5DK5 A;  1CLQ A;  3NH0 A;  2ITG A;  4H4M A;  5C25 A;  3L8B A;  1J53 A;  1EET A;  4B9T A;  1RDD A;  2E4L A;  2FBY A;  1HYZ A;  3LDS A;  4OLA A;  3DLR A;  2OPS A;  2HHS A;  4B9N A;  3KD5 E;  1BCO A;  1IKW A;  3I8D A;  3V9S A;  1SUQ A;  5HBM A;  2YKM A;  4Z0U A;  4C8L A;  2DFF A;  1NJW A;  4IG0 A;  3V1O A;  5KRS A;  4DFJ A;  2YKN A;  3NGZ A;  3QNN A;  4KI6 A;  3TAM A;  1LWF A;  2YHB A;  2G8W A;  5J1E A;  5KGX A;  1CZB A;  4CGF A;  1ASV A;  3KK3 A;  4DSF A;  1UAX A;  4CEB A;  1VSE A;  3F73 A;  4CEC A;  3TAG A;  2KQ2 A;  1HQU A;  3K5L A;  2PYJ A;  4DQP A;  3S3M A;  2KFZ A;  4I9Q A;  4Z4I A;  1FXX A;  2ETJ A;  4CGI A;  1X9W A;  2X74 A;  4EZ9 A;  4OVL A;  4DQI A;  4CHN A;  1JLF A;  5FRM A;  3WNF A;  3K5N A;  4KTW A;  4CEO A;  4M42 A;  4CJV A;  4JS4 A;  1HMV A;  1BQN A;  1NOZ A;  4DFK A;  2WON A;  3DYA A;  1LWC A;  4BDP A;  1T7P A;  5SZT A;  3M8S A;  3F9K A;  3LZI A;  2F8T A;  1XHZ A;  1VSF A;  1VSL A;  2FBX A;  4CEQ A;  1NJX A;  4F3O A;  4L8R B;  2XRI A;  5D3G A;  3KIO A;  4E1N A;  4B9L A;  2D0B A;  4LH5 A;  3O4N A;  1JL1 A;  1RDC A;  4FK2 A;  2HHT A;  1DTQ A;  2QK9 A;  3VQD A;  3TAB A;  3NF6 A;  3DLB A;  3RR7 A;  3P1G A;  1FKO A;  3AA3 A;  1XHX A;  5HLF A;  3KKS A;  1NK4 A;  4DSJ A;  3U6F A;  4B9V A;  4FJH A;  4DG1 A;  4KHQ A;  3LP1 A;  3OJS A;  3OJU A;  3DLK A;  2VG6 A;  4FW1 A;  4B3O A;  4DTO A;  2E6L A;  3CFO A;  3V81 A;  1A5V A;  3ZSZ A;  1NK7 A;  3SQ1 A;  1S1X A;  4C8O A;  2KZM A;  4ZTF A;  1ZBL A;  2G8H A;  3RWU A;  1REV A;  4ID5 A;  1RTD A;  2KW4 A;  3QEW A;  3V9W A;  2O4I A;  2HHV A;  1KFD A;  2VWK A;  3VQ5 A;  4CFC A;  2GV9 A;  3HYF A;  2P5O A;  4CF1 A;  3NFA A;  1JLA A;  1KVB A;  1EXQ A;  5CYM A;  4CJ4 A;  4CF2 A;  3D0P A;  1NK6 A;  2VWJ A;  3A2F A;  3B6P A;  1DTT A;  3ZCM A;  3QIO A;  3DOK A;  3LAN A;  1S9E A;  3NBP A;  4CEZ A;  4Z4H A;  4DFP A;  4QCL A;  1J5O A;  4I7F A;  1HPZ A;  1W9H A;  3KLH A;  3K2P A;  1SKW A;  5CY4 A;  2IGI A;  4PUO A;  3C6U A;  4KI4 A;  5E41 A;  3MEE A;  1YTA A;  4KKO A;  4DS5 A;  5K14 A;  4DU3 A;  4RW8 A;  1X1P A;  3S3N A;  1UA0 A;  4H8K A;  1C6V A;  1RBU A;  3HVR A;  1XC9 A;  3L2Q A;  4XIU A;  4JRP A;  3SUO A;  3S9H A;  1MU2 A;  5CYQ A;  1T8E A;  4CEF A;  3KJV A;  3T1A A;  3QEV A;  2DFE A;  1JL2 A;  3HM9 A;  3JYT A;  1VSM A;  3MXI A;  4CK2 A;  2EX3 A;  2IS3 A;  3BDP A;  4GMJ B;  5C42 A;  1Q9Y A;  4CES A;  4DQQ A;  3AO4 A;  4DF8 A;  1TKX A;  2P51 A;  2G8I A;  1YVU A;  1S1V A;  4GVM A;  4PQU A;  1NKC A;  3QES A;  4B8A B;  4CJU A;  4FZZ A;  4O5B A;  3WNE A;  4NCB A;  1N5Y A;  1JLB A;  1SL1 A;  4F3T A;  3TAR A;  1KVA A;  2OPQ A;  3C6T A;  4CJ3 A;  4AHC A;  2X78 A;  3NDK A;  4AIL C;  3OYE A;  1QE1 A;  3NGY A;  1ASU A;  1HNV A;  4J2E A;  4IDK A;  2BE2 A;  1WSH A;  3AVN A; 
#chains in the Genus database with same CATH topology
 1IKV A;  4EHT A;  2YNH A;  1NKB A;  3H3N O;  1Z26 A;  4MFB A;  1A5X A;  5F1X A;  3EEQ A;  3L3V A;  1TV6 A;  2W6L A;  4G1Q A;  4IJA A;  3UKU B;  1LW0 A;  5FRN A;  5C2D A;  3NHG A;  4DSI A;  4DTJ A;  4FYD A;  3PSI A;  1Y97 A;  3KLF A;  3CCJ N;  4JI4 K;  3C0B A;  1EP4 A;  1ZBI A;  3QIP A;  4FWN A;  4ICL A;  4CBX A;  4NCG A;  4E1J A;  3JS6 A;  2EWS A;  2HB5 A;  1VHX A;  5AQO A;  4BR4 A;  1RFQ A;  2CGJ A;  4E0D A;  4BRL A;  2DTU A;  3VA0 A;  4KAZ A;  2IAJ A;  4BRH A;  4FPB A;  3OY9 A;  5F2R A;  1GLJ O;  4CJS A;  4YNQ A;  3QO9 A;  3AGR A;  5F0X A;  2G8U A;  4JV5 K;  3AA4 A;  3N4Q A;  2QKK A;  3ZSW A;  3EE9 A;  3RSE A;  3MCP A;  3KLE A;  4CIG A;  2XY5 A;  4CHQ A;  2BAN A;  3AVB A;  4FWL A;  2F8S A;  3C6H A;  2Z1G A;  1SV5 A;  2FSK A;  1GLB G;  5C10 A;  5J2P A;  4CD1 A;  1ZBF A;  4BE1 A;  1SS6 A;  2E1Y A;  4E19 A;  3PLA A;  2YX6 A;  1OH8 A;  2GUI A;  1J9A A;  2ZE2 A;  2PYL A;  3ZSV A;  1HQE A;  3G25 A;  3LAK A;  3AAP A;  3WXJ A;  1VSI A;  3OW2 M;  3QET A;  4PL7 A;  4H03 B;  5E84 A;  1DT9 A;  1KVC A;  1N6Q A;  1ILY A;  3EZW A;  1LAW A;  3QIN A;  2VYP A;  3I0R A;  5HRN A;  2O8B A;  4M3W A;  2OPR A;  3LDO A;  4BQZ A;  3O9Q A;  3ZYY X;  2BDP A;  2KKZ A;  3L2U A;  4B9U A;  3V1R A;  2OTJ N;  1TKD A;  3C95 A;  2NRX A;  4CHP A;  4DR6 K;  4HUF A;  4CJF A;  1VK0 A;  5CHI A;  1YT3 A;  1FKP A;  2QW9 A;  3ENB A;  3ZSO A;  4BRP A;  4W5T A;  4FWS A;  4CER A;  1C1A A;  4BE2 A;  3LWL A;  3RRG A;  3FGU A;  3NF9 A;  2WUS A;  4CJP A;  4H5V A;  3MCA B;  3FZL A;  1JLQ A;  4NO7 A;  2YHX A;  2Y1J A;  3UE5 A;  1Z6R A;  3QIC A;  1U48 A;  4KRE A;  1VQ8 N;  3RTV A;  1ZYQ A;  4A5B A;  1NGI A;  1IKY A;  2VQE K;  1RT6 A;  4EP5 A;  3WEE A;  4FXD A;  1O13 A;  4RTF D;  2XY6 A;  4OKK A;  3NF8 A;  1HJR A;  4IBN A;  3RSE B;  4WFN L;  3H08 A;  3HO1 A;  1WAF A;  2A5X A;  4O8U A;  4CCH A;  1OH7 A;  4DR1 K;  1ZXO A;  4F2R A;  3MAQ A;  3QER A;  4GW6 A;  4BR9 A;  5AFU A;  3O1W A;  1YIT N;  4E7J A;  5BR9 A;  4CGJ A;  4BDZ A;  1JJ2 M;  3VGL A;  4XH1 A;  2O8D A;  3MX2 A;  4F8R A;  1NGG A;  4FLX A;  1RT3 A;  3DXM B;  2HNZ A;  3MWP A;  3SJH A;  5AZJ A;  4JI1 K;  4CJK A;  2Y1I A;  2WFB A;  3FZK A;  4CFB A;  1CXU A;  2WC9 A;  3R9P A;  1SL2 A;  3VQ9 A;  1YJ9 N;  4JKD A;  1RBV A;  1V4S A;  3R8E A;  1NK8 A;  2O8B B;  4HHT A;  2AP1 A;  3CIP A;  3CCQ N;  2RKI A;  4HTU A;  2CH5 A;  4RCH A;  1QS4 A;  4BE0 A;  4CJL A;  4B9M A;  3TAE A;  1LW2 A;  1JCF A;  3QEI A;  1Y64 A;  5HRS A;  4WCE L;  2O8C A;  3MN5 A;  4AHS A;  3ASM A;  1IG9 A;  1WSI A;  1SKS A;  3PX0 A;  1TVR A;  4E7K A;  2KLA A;  4CGG A;  1KC8 O;  4FWR A;  3CHW A;  3CET A;  4DSK A;  4W5N A;  3NE6 A;  1NGF A;  4OO1 J;  4GNI A;  3OYJ A;  2ASO A;  1NK5 A;  2WBN A;  3VQ7 A;  4FM1 A;  2W42 A;  4OGC A;  1VSJ A;  3TI0 A;  1RDA A;  3HOS A;  2E1Z A;  3TSU A;  4BVO A;  5GAG P;  3WEE B;  3CFR A;  2E6M A;  3SQ2 A;  2Q0U A;  3VGM A;  2WTU A;  4CF9 A;  5AQH A;  3C7N B;  3NCI A;  3M3Z A;  1HJO A;  4O4G A;  1IG8 A;  1WSE A;  1RIL A;  1Q9X A;  1SQK A;  1RT4 A;  3E9L A;  5H1S Q;  4CIE A;  3THY A;  3VA3 A;  3SUN A;  1N36 K;  2FSN A;  5I42 A;  4Q5V A;  4DQS A;  3E66 A;  3GL1 A;  1GOB A;  1BDG A;  2A41 A;  3HTV A;  4FK4 A;  3CFP A;  1JLG A;  2O8D B;  3LDP A;  2B6A A;  1JCG A;  5E26 A;  4RWT A;  3AVJ A;  4IO9 L;  4RW7 A;  5AZJ B;  1X3M A;  2F9W A;  3QDK A;  1XI1 A;  4EFH A;  4DCH A;  3FFI A;  4JKG B;  1VRT A;  1RT1 A;  4J8F A;  3WXK A;  4OKE A;  3CI5 A;  4E3S A;  3AO2 A;  3VQE A;  3OYH A;  4DF4 A;  3TTF A;  3A8Y A;  3ULD A;  3RRH A;  4DTR A;  1I94 K;  2QI2 A;  4WE1 A;  3L2R A;  4MLE A;  3OBW A;  2IVN A;  4YOR A;  4BR2 A;  4FLV A;  3QLH A;  4K41 A;  3PIP L;  3AVH A;  3O5B A;  4FL9 A;  1D5A A;  4PL8 A;  4OGE A;  4FOE A;  1TK8 A;  2P9N A;  4BRO A;  3OYC A;  1NGJ A;  1EQY A;  2O8C B;  3K58 A;  3HVT A;  2IVO A;  4NLC A;  1QVG M;  5CE3 A;  3ZX2 A;  2E20 A;  4CEA A;  3VEO A;  1DLO A;  3IAY A;  4DLG A;  2FF6 A;  1XUP O;  3ZSR A;  1NKE A;  1LCU A;  4DSE A;  3I0S A;  4KV8 A;  4ZTJ A;  1EX4 A;  4K0K K;  3TTC A;  2HMI A;  1YAG A;  3V9Z A;  1QQO A;  4I2Q A;  4K43 A;  3HJF A;  1HLU A;  3CJC A;  4JKC A;  3BGR A;  2P9P A;  4U7B A;  4FJ5 A;  4JEP A;  3NH2 A;  1P90 A;  1CLQ A;  2Q2R A;  5LJV A;  3OHR A;  5C25 A;  2UXB K;  1K9M O;  4OLA A;  5GIO A;  3KD5 E;  4YOT A;  1VQ7 N;  4H0V B;  1SZ2 A;  4Z0U A;  2DFF A;  4IG0 A;  3THY B;  3NGZ A;  3G4S N;  2G8W A;  1RDW X;  5J1E A;  1ASV A;  4DSF A;  2KQ2 A;  1HQU A;  3K5L A;  2H3G X;  2KFZ A;  1KQS M;  4CGI A;  2NRH A;  4KH6 A;  4IEI A;  4MO4 A;  4H5T A;  2UXC K;  1HUX A;  1JLF A;  4CEO A;  1HMV A;  1LOT B;  3ATV A;  1VQ9 N;  2QWM A;  4FWK A;  3M8S A;  3SLC A;  3F9K A;  3EE8 A;  5EXW A;  1NJX A;  1VSF A;  4L8R B;  5D3G A;  5AQF A;  3KIO A;  4LH5 A;  1RDC A;  1E4G T;  2HHT A;  4FSV A;  3NF6 A;  3P1G A;  3KKS A;  4BC4 A;  3OJS A;  2VWB A;  2P9N B;  4FW1 A;  3B8A X;  4B3O A;  4DTO A;  1A5V A;  5KQD A;  3CJ7 A;  5JVG L;  1XQS C;  4ID5 A;  4Z94 A;  3QEW A;  3V9W A;  1KFD A;  2VWK A;  4CFC A;  2O8F A;  4CF1 A;  3NFA A;  1JLA A;  3DLB A;  3D0P A;  3B6P A;  3ZX0 A;  1NG9 A;  1BA0 A;  5HOO A;  1W9H A;  5CY4 A;  2P9P B;  4A59 A;  3GOI A;  1WBD A;  4JRP A;  2NRV A;  2W40 A;  4JI8 K;  4NB4 A;  3QEV A;  1NGH A;  2IS3 A;  4LF9 K;  5AZI A;  1CZA N;  4DQQ A;  3AO4 A;  2G8I A;  5BPM A;  5FPN A;  3WNE A;  1KVA A;  4AHC A;  4AIL C;  3VES A;  4J2E A;  1RGI A;  4KTZ A;  4FOI A;  2E2O A;  2W6K A;  4JKA A;  5DMR A;  1S22 A;  3UB5 A;  4C1N K;  4FLW A;  3GG4 A;  4F4K A;  3ULE A;  3SNN A;  2YHA A;  4FVM A;  3THW A;  4MQ3 A;  1J5E K;  3MN6 A;  3B6O A;  2HW3 A;  4BG9 A;  3N4P A;  4YOX A;  3A5M C;  4BC2 A;  1ZBU A;  3EZ5 A;  4M3T A;  1BGX T;  2UUC K;  3WXI A;  5I9E B;  3L2V A;  4E1M A;  2B4J A;  3NF7 A;  5AQX A;  1BWF O;  2V51 B;  2JGU A;  4RG8 A;  1HPM A;  4ELU A;  3HBT A;  3CCM N;  1HR0 K;  3ZT1 A;  1OKJ A;  1Q86 O;  4FJG A;  2O8F B;  4N47 A;  3AVM A;  3R6M A;  1S5J A;  3OYB A;  4WYB A;  2BGG A;  2A42 A;  3P83 D;  1Q8I A;  4M3Y A;  4LSN A;  4KB1 A;  1U47 A;  4B1Z A;  4ELV A;  4PHT X;  4LFA K;  3NMU A;  3SZ2 A;  3ENO A;  1Q7Y O;  2Z1H A;  4L3Q A;  3HPO A;  4CZK A;  3HI0 A;  1DKG D;  2LSN A;  3HT3 A;  5J2Q A;  5T7B A;  4GVE A;  1RDU A;  4OKJ A;  2FC0 A;  4GV3 A;  5AZI B;  4NXN K;  2GWK A;  1WLJ A;  1QQN A;  1RT2 A;  5TKY A;  3ALY A;  3VF6 A;  4CF8 A;  4CFD A;  1HYV A;  3PX4 A;  4DKW A;  3VQQ A;  1NMD A;  3EL2 A;  4H0Y B;  2G8K A;  1VSD A;  3VQB A;  5KGW A;  2F96 A;  4CBW A;  2P5G A;  4A62 A;  4IG3 A;  4CHO A;  1TK5 A;  1VSK A;  4HVJ A;  4Z4E A;  5CZ1 A;  2QXF A;  3D2F A;  3TAP A;  5M1Q A;  3TAN A;  3VET A;  2NRR A;  1W97 L;  3T19 A;  1VRU A;  4FWQ A;  3ULE B;  1BI4 A;  3THW B;  5AQK A;  4K8Z A;  4ISE A;  4FO0 A;  5C24 A;  3WNH A;  4BRC A;  3LZJ A;  1M90 O;  4DV7 K;  1BHL A;  2YV0 X;  1QVF M;  4WF9 L;  3VF4 A;  4ID1 A;  4KBO A;  4M3Z A;  5C0Y A;  2ZD1 A;  3KK2 A;  1TL3 A;  4EIA A;  4DV2 K;  4WQ5 C;  2UYT A;  4Q0B A;  1BA1 A;  2RE2 A;  3U3Y A;  2AJQ A;  2ASP A;  2XHB A;  2EHG A;  1VQO N;  4CJW A;  3CCL N;  1K8A O;  5J2N A;  4YOW A;  1OH6 A;  1NGB A;  2QM1 A;  1H1V A;  5ADX A;  1M1K O;  3O8M A;  1FJG K;  4CJT A;  2E8A A;  3ZSY A;  4C8M A;  3MEC A;  4BRN A;  1NGA A;  4PA1 A;  4QS9 A;  4CZH A;  5HRO A;  1QZ5 A;  3J7Z O;  4AQY K;  1XNQ K;  2P9L A;  1SL0 A;  1S1W A;  2A6A A;  3IG1 A;  4NYN A;  4HWI A;  2HBK A;  2NRZ A;  4CJQ A;  3VTI A;  4W5Q A;  2F9T A;  3LP3 A;  1GOA A;  3H45 C;  3CQ8 A;  1RT5 A;  5BPL A;  2QWR A;  1EWR A;  4I6M A;  5GIP A;  1X3N A;  4AF1 A;  2HBJ A;  4DWI A;  3K5O A;  2AA4 A;  4FJM A;  1XWL A;  4IXC A;  1Q18 A;  1VQ4 N;  4B9S A;  4K42 A;  3VEW A;  1K6Y A;  4IFV A;  5DM6 L;  4NLB A;  3LP2 A;  4LD0 A;  2VG7 A;  4KHS A;  5EU7 A;  4HUE A;  3U9D A;  1L3T A;  4CJ7 A;  1QSS A;  3SCX A;  3DRS A;  5MLC Q;  2OYQ A;  5JVH L;  3CJ1 A;  1JXB A;  2Z1J A;  2DPN A;  1NOY A;  1TL1 A;  3D2F B;  2G8V A;  3BP8 A;  4CJR A;  2B5J A;  2YNG A;  1BI4 B;  2IIR A;  4CF0 A;  4B1X B;  3SQ0 A;  1YF5 L;  4DSL A;  4JK7 A;  4A2B A;  3MXJ A;  2PFU A;  2V7Z A;  2UUB K;  2GEL A;  4R79 A;  4E89 A;  5FPE A;  3IS9 A;  3SI6 A;  3DXM A;  2Q1N A;  4NYF A;  2FLO A;  3O9T A;  4CI6 A;  4DLE A;  4E7L A;  3HL8 A;  1C0U A;  3ZT0 A;  4WFB L;  4KHP K;  3LAL A;  2PBD A;  3RMA A;  3QBX A;  4LC9 B;  1S72 N;  1X9J A;  4AHV A;  4CHY A;  4O44 A;  3TSP A;  5KPZ A;  1B9D A;  1NMN A;  4DB3 A;  1NJZ A;  5C2F A;  4TSX A;  1I3A A;  2VG5 A;  4M7Y A;  3LPT A;  2A40 A;  1QSY A;  2UXD K;  3SAF A;  2P9L B;  4CGH A;  2RN2 A;  2KZZ A;  3HPG A;  1RTH A;  4WFA L;  4ILG B;  3MXM A;  4BG8 A;  3WT0 A;  4N5S A;  4DTN A;  4DQ8 A;  3SK3 A;  4I6M B;  4DV5 K;  4QOZ B;  1NLV A;  4FLY A;  1BG3 A;  3TPQ A;  4CK1 A;  1NNE A;  2HND A;  3VQ4 A;  3K59 A;  4ILJ A;  3J8A A;  4AHU A;  1C0G A;  1YTU A;  5GAE P;  4KO0 A;  3C7N A;  3A5L C;  5HRP A;  3RR8 A;  4IOC L;  2X6N A;  1S9G A;  1KLM A;  4MLH A;  2FSJ A;  1ESV A;  4F2S A;  5AJ3 K;  3E01 A;  2HST A;  2P9U A;  2CGK A;  1RT7 A;  4M7X A;  4OJR A;  5AQS A;  3CJ9 A;  5FPD A;  1BO5 O;  2XO7 A;  1R0A A;  3IMX A;  5EVZ A;  4DR5 K;  2CH6 A;  3CER A;  5IWA K;  3FZM A;  1D9F A;  2GUP A;  3CG7 A;  4XEI A;  4JKG A;  3VPZ A;  3AA2 A;  3P4I A;  4B1W B;  3VN5 A;  4FZY A;  3O3G A;  3U3G A;  2FF3 B;  3HP9 A;  3NH0 A;  2ITG A;  4H4M A;  4H5N A;  1KD1 O;  3MX5 A;  2HHS A;  4B9N A;  3BZK A;  4JKH A;  3V9S A;  3DXK A;  5AQZ A;  1U2V A;  5KRS A;  2YKN A;  3VF2 A;  3TAM A;  3KWG A;  1LWF A;  4JKB A;  1WUA A;  3F73 A;  4MDA A;  3CME N;  3HRG A;  3TSQ A;  4I9Q A;  4Z4I A;  1FXX A;  2ETJ A;  4EZ9 A;  4OVL A;  4DQI A;  1MA9 B;  3WQU A;  4CHN A;  4F9O A;  1VQK N;  3ZLJ A;  3K5N A;  4JS4 A;  2D4W A;  3QFU A;  2WON A;  3CJB A;  3DYA A;  1LWC A;  1VQM N;  1T7P A;  4LF4 K;  5SZT A;  4F3O A;  4CEQ A;  1TUU A;  4IDH A;  1JL1 A;  5M1F A;  1DTQ A;  3TAB A;  3AA3 A;  3M1F A;  4DSJ A;  3FE1 A;  1WBB A;  4FJH A;  4KHQ A;  1P8Z A;  3CXC M;  3SBG A;  5ADX H;  4BRQ A;  2E6L A;  3CFO A;  3V81 A;  1SAZ A;  3D7E O;  3SQ1 A;  1S1X A;  4C8O A;  2KZM A;  1ZBL A;  2O4I A;  2HHV A;  2P9U B;  3VQ5 A;  2ZM6 K;  2GV9 A;  4BGB A;  3P38 A;  1KVB A;  1EXQ A;  2VWJ A;  4B3M K;  1DTT A;  4YHH K;  2GX9 A;  5AQM A;  4QCL A;  4IOX A;  5AQG A;  3W0L A;  3KLH A;  1SKW A;  2IGI A;  2D0P A;  1YHQ N;  4KKO A;  3G6E N;  5K14 A;  4RW8 A;  1X1P A;  1UA0 A;  4H8K A;  3L2Q A;  3SUO A;  1OVY A;  4OPA A;  1JL2 A;  3HM9 A;  3M5R A;  3MXI A;  1YI2 N;  4GMJ B;  4DF8 A;  3DXK B;  3SAG A;  3L4I A;  1U2V B;  1YVU A;  3O80 A;  4B9Q A;  4B8A B;  4FZZ A;  1JLB A;  3HSC A;  1SL1 A;  3HZ6 A;  3VER A;  1N8R O;  4CJ3 A;  1ASU A;  4IDK A;  5FRO A;  2BE2 A;  1WSH A;  1XNR K;  5JS1 A;  4AHR A;  2YNF A;  3OS2 A;  1S3X A;  2J4R A;  2KHO A;  5M1P A;  4ISG A;  3KLG A;  1QQM A;  5ELZ A;  1QZ6 A;  5EOY A;  4AM7 A;  4OPJ A;  1T05 A;  2PZS A;  3LP0 A;  4JI6 K;  3SBT A;  5BRE A;  5LL6 Z;  3DI6 A;  2ZGZ A;  4Z4F A;  3KHY A;  4BRM A;  1T44 A;  1BQM A;  1WSG A;  5FLX O;  4NXM K;  4CZG A;  2VCP A;  2YHW A;  5BRF A;  4ZHR A;  1EWQ A;  1ATR A;  3K0S A;  3VQA A;  2QA4 N;  4LFC K;  1YUW A;  4LY7 A;  4FM2 A;  3FLC O;  3DMJ A;  3WNG A;  1NGE A;  2RF2 A;  4M3R A;  1HNX K;  4CZJ A;  4AH9 A;  1TAU A;  2VGM A;  3G0Z A;  5HP1 A;  1TAQ A;  1YIJ N;  4JRQ A;  3CC7 N;  3THV A;  2OPP A;  4DS4 A;  1ITG A;  3OYL A;  2HF4 A;  3CJA A;  1ASW A;  1A5W A;  4MO5 A;  4CGD A;  5J2M A;  1D9D A;  3LDL A;  3MEG A;  2F4V K;  2Z1I A;  4FW2 A;  4M3X A;  4X66 K;  4M41 A;  1S6Q A;  4GV9 A;  4CFA A;  1J54 A;  4MDB A;  1T3V A;  1TGO A;  3FZF A;  3LM9 A;  4K8X A;  5KTQ A;  3VEZ A;  3JAM O;  3S41 A;  1U45 A;  3PO5 A;  4Z4G A;  3U4L A;  4KHY A;  4PKH A;  4H0X B;  1JLE A;  3DLG A;  1IBM K;  4LH4 A;  4KFB A;  1IKX A;  2OZM A;  3QNO A;  4XH5 A;  4B8C A;  1NK9 A;  3ZT3 A;  5JLF A;  3MN9 A;  4DU4 A;  2ITM A;  4BQL A;  4RW9 A;  4DTS A;  4Y0W A;  3ZT2 A;  3KZB A;  4DHY A;  4CE9 A;  3VOV A;  3CM5 A;  3F5T A;  1HRH A;  1HKB A;  3OYF A;  3SMP A;  3P39 A;  3UKR A;  4NCA A;  5I3U A;  2IDO A;  5HRR A;  3J80 O;  3O9U A;  1IJJ A;  2IVP A;  2OAN A;  2P9S A;  1FK9 A;  4O8K A;  4BRA A;  4WQ4 A;  3DOL A;  1VQ6 N;  1NJY A;  1NK0 A;  2ZGY A;  3OYA A;  3U9Z A;  4WQ5 A;  3WXM B;  1Z05 A;  2E2P A;  3CMA N;  1B9F A;  3JSM A;  4O5F A;  1WSF A;  5LMU K;  3K5M A;  2A1R A;  1WNS A;  2IOC A;  1BUP A;  4N56 A;  2HVI A;  1VQL N;  2BUP A;  4FWP A;  2ZQB A;  3NAE A;  4FJX A;  3V9X A;  4H0T B;  2HHW A;  4GKJ K;  1YJN N;  3FR0 A;  3OVN A;  2ZJR L;  3M8P A;  3CQX A;  4BRF A;  3CF5 L;  3QEX A;  5AQJ A;  2NRT A;  3H46 O;  4W5R A;  3KTQ A;  4OPK A;  3WXL A;  4IWV A;  2FXU A;  3AO3 A;  3L6Q A;  1QSL A;  3CC2 N;  4DUY K;  4J2A A;  2FBV A;  4KB0 A;  3AVC A;  3LAM A;  5AQY A;  1K8K A;  4A5A A;  3DLL L;  3LDQ A;  1X9S A;  4FJJ A;  1RBR A;  1BL3 A;  3VGK A;  5BN9 A;  3JXU A;  3KKR A;  4EAH D;  4FK0 A;  4O0J A;  1DEJ A;  4BAC A;  3AA5 X;  4KHW A;  3PSF A;  4KPY A;  5EY4 A;  3TWH A;  4C8K A;  2HHX A;  4DR7 K;  4YFU A;  3SJJ A;  3OS1 A;  4FZX C;  4BRG A;  3H1Q A;  3UKR B;  4FJL A;  1BIS A;  3AV9 A;  1BIU A;  1JKH A;  3V6D A;  3VQP A;  4FLZ A;  2DFH A;  4XH4 A;  2P9S B;  3BZC A;  3MMV A;  4Z4C A;  2HHU A;  4IFY A;  3K57 A;  2ZJQ L;  3V9U A;  3O6W A;  1EKE A;  1CZ9 A;  2FBT A;  4BY9 C;  1JXE A;  4CZL A;  4Y1C A;  3O1B A;  3HP6 A;  3RMC A;  5C12 A;  4ELT A;  3G10 A;  3DLE A;  4CW7 B;  3BY5 A;  3SV4 A;  1KTQ A;  2Q3S A;  1NGD A;  1TKT A;  2QEX N;  3P31 A;  1C0T A;  3SUQ A;  1TK0 A;  5AQQ A;  5GAH P;  1YVN A;  4DTP A;  1VSH A;  1HNI A;  4JKF A;  4UQG A;  2NRW A;  3DRP A;  3T1H K;  4JLH A;  1QTM A;  3R1X A;  3PUF A;  4LF6 K;  1OH5 A;  2NZT A;  3PO4 A;  1WSJ A;  2ASM A;  4CVN E;  1NJI O;  3MWT A;  1TYQ A;  1GOC A;  3LWM A;  1L5U A;  2R7Y A;  4WQ4 C;  4B3S K;  2BH1 A;  1YXQ A;  3AVF A;  4RW6 A;  5AQR A;  3V1Q A;  3AO1 A;  1GLF O;  4KHU A;  1W0H A;  3ATU A;  3IRX A;  1K8K B;  2X6S A;  3K9J A;  4PKG A;  1KLN A;  1U4B A;  4IOA L;  3C94 A;  1LAV A;  4IJN A;  3W3D A;  3T7Z A;  4IO8 A;  3V4I A;  3H1V X;  2P1J A;  4I9L A;  1UA1 A;  3CM6 A;  4PY5 A;  5KPR A;  4DV3 K;  1IBL K;  5SWM A;  3BF1 A;  3ZEU A;  2PAV A;  3OYD A;  2NUB A;  2RHK A;  4BDY A;  2Q0R A;  3A0I X;  1WN7 A;  2PY5 A;  4B1U B;  4JYA K;  1UWB A;  3BUZ B;  3ID6 A;  5C15 A;  3CCE N;  2HVH A;  3AO5 A;  4JAX A;  1RBS A;  2QTD A;  4CZI A;  1HX1 A;  1Z25 A;  3EN9 A;  3THX A;  1T6C A;  3I55 N;  3KWI A;  3OBY A;  5BR8 K;  5DK5 A;  1OVQ A;  4B9T A;  1J53 A;  1DGK N;  2E4L A;  2FBY A;  1HYZ A;  4H5W A;  3LDS A;  4FWO A;  3DLR A;  2ZJP L;  3NVK A;  1IKW A;  3E9P A;  4FPA A;  4DR4 K;  2YKM A;  4C8L A;  1V4T A;  5DM7 L;  3I33 A;  1NJW A;  3O08 A;  4DFJ A;  4BGA A;  5KGX A;  3IFR A;  4CGF A;  1TYQ B;  4M63 C;  1UAX A;  4CEB A;  1VSE A;  5IT9 O;  5EX5 A;  2PYJ A;  3S3M A;  4BR7 A;  1X9W A;  2VGN A;  3EO3 A;  5LMN K;  1HNZ K;  1NM1 A;  3WNF A;  4M42 A;  4DFK A;  3R3L A;  3FFK B;  5AQU A;  4BDP A;  3G71 N;  4ILH A;  3LZI A;  2F8T A;  1VSL A;  1KAX A;  2FBX A;  1GLL O;  2E2Q A;  4E1N A;  3O4N A;  3RR7 A;  5HLF A;  2QWN A;  3U6F A;  4B9V A;  3LP1 A;  4JK8 A;  2O8E A;  3VEY A;  3ZEU B;  1NK7 A;  3ZSZ A;  2HOE A;  4BC3 A;  2YJF A;  5HL7 L;  2G8H A;  1REV A;  4DV6 K;  1RTD A;  3CCU N;  5M1O A;  5AQN A;  3DAW A;  3DOK A;  3LAN A;  2V52 B;  4Z4H A;  2VQF K;  1J5O A;  4I7F A;  1NBW A;  3THX B;  3K2P A;  4PUO A;  3C6U A;  1ZBS A;  1HNW K;  3MEE A;  2E5L K;  4DR3 K;  4DU3 A;  1XC9 A;  1K73 O;  1C6V A;  1RBU A;  3HVR A;  4BRD A;  4XIU A;  3IDH A;  5LY3 A;  1MU2 A;  5CYQ A;  1GLC G;  2E2N A;  1T8E A;  3KJV A;  2DFE A;  3CPW M;  1ZC6 A;  3BDP A;  5C42 A;  4KH5 A;  4CES A;  1Q9Y A;  1GLD G;  2P51 A;  3BF3 A;  2HF3 A;  1S1V A;  2A3Z A;  3C65 A;  3GE1 A;  4CJU A;  4JD2 A;  4O5B A;  4NCB A;  4F3T A;  4B1Y B;  1NU0 A;  3UIQ A;  4V19 S;  4H5R A;  3OYE A;  1HNV A;  5BPN A;  3Q7C A;  4JI0 K;  1TKX A;  3D45 A;  5AQL A;  3SMS A;  3AY9 A;  4BWM A;  3KK1 A;  3K9K A;  3VEV A;  1E4F T;  1RDB A;  2HHQ A;  1N34 K;  2Q31 A;  2IC3 A;  2YCH A;  1Q82 O;  2YNI A;  3EY1 A;  3QB0 A;  1NWK A;  2RPI A;  3HK2 A;  3P5J A;  3GBT A;  2O8E B;  4J2B A;  1EO1 A;  5KRT A;  3U8X A;  4N41 A;  1RNH A;  3MED A;  3DRR A;  1LV5 A;  3M8Q A;  4DU1 A;  4OLB A;  4EHU A;  1LWE A;  1IH7 A;  4GKK K;  3EKS A;  1CXQ A;  3ZT4 A;  3ID8 A;  4CIF A;  3HM8 A;  3IKM A;  4JI3 K;  1WAJ A;  3M8R A;  4KHN A;  3L0Q A;  3QML A;  4K25 A;  1BOT O;  4IFE A;  4C8N A;  1L3V A;  5GAD P;  3VEX A;  3ZET A;  4HCB A;  2D0A A;  2ZWH A;  4QAG A;  2G8F A;  4QS7 A;  4JHD A;  1G15 A;  3AVG A;  5KQ8 A;  4FCY A;  1ATN A;  3O3H A;  4FM0 A;  3QES A;  4J2D A;  1UOC A;  1ZBH A;  2XY8 A;  2I7N A;  4JS5 A;  1U04 A;  3OYI A;  1JCE A;  2I7P A;  4JI5 K;  1QQC A;  4IZ9 A;  1KAZ A;  3OYK A;  3J7A P;  3OYG A;  4JD2 B;  3CYM A;  3T69 A;  4BWJ A;  4FJ7 A;  1KAY A;  3HST B;  1T03 A;  1E3M A;  4BRE A;  3ISN C;  5JMV A;  3O9S A;  4B3T K;  3TAF A;  1T6D A;  1I39 A;  3CC4 N;  3SPY A;  4UY8 O;  4DTU A;  1HYS A;  1X9M A;  2CGL A;  3LM2 A;  3KVG A;  2WOM A;  3OS0 A;  4DTM A;  2D0O A;  1GLE G;  1S1U A;  3EKU A;  1U49 A;  2UUA K;  4FJI A;  2HNY A;  2KTQ A;  3RMD A;  4C1N I;  1D8Y A;  1C0M A;  1C1B A;  4RW4 A;  3DJC A;  4JI7 K;  5AQV A;  3L2W A;  3OTO K;  1KXP A;  3I8B A;  3OYN A;  4LF7 K;  4ISF A;  4B08 A;  2ZF5 O;  3KLI A;  1KCF A;  2YJE A;  2QKB A;  1Q81 O;  4O0I A;  1JLC A;  2P9I A;  5BRD A;  4OX9 K;  4QS8 A;  3LPU A;  4A61 A;  4IEE A;  2D1K A;  3AVI A;  4BRK A;  2OCE A;  2YI1 A;  5KI6 A;  3CCS N;  1L3S A;  3AVK A;  5BN8 A;  3T3F A;  1S6P A;  4W5O A;  4EZ6 A;  3RVC A;  4B1V A;  3ZET B;  3MK6 A;  3ZSX A;  4JHD B;  3CPE A;  4CJ5 A;  3O4W A;  3O9R A;  1VQ5 N;  2DY4 A;  3DM2 A;  3L3U A;  1BCM A;  5FDL A;  3TU5 A;  4DV0 K;  5A2Q O;  3CCV N;  3SV3 A;  1TKZ A;  1KRP A;  1S1T A;  1IV0 A;  3S3O A;  4E7I A;  3J7Y P;  3HXM A;  3VQ6 A;  4N76 A;  2W41 A;  4CED A;  2QWO A;  2HBM A;  3TTD A;  4EP4 A;  1B92 A;  1RTI A;  4M45 A;  4DTX A;  3A5N C;  2D0C A;  4I2P A;  3PY8 A;  4JN4 A;  1F21 A;  4FLU A;  4O55 A;  1GLA G;  4DUZ K;  1U6Z A;  3AAR A;  3EYZ A;  1HKC A;  3Q7B A;  2GBZ A;  1SKR A;  1MWM A;  2KFN A;  5AQW A;  1IBK K;  3C6A A;  5CR4 A;  1J6Z A;  1IO2 A;  3O4Q A;  3A5O C;  3NH1 A;  3O3F A;  2ATQ A;  3VEN A;  2OA8 A;  3WUH A;  4AHT A;  4FLT A;  3SQ4 A;  3PX6 A;  4X65 K;  5B8H A;  1VQN N;  4BC5 A;  4BR5 A;  2XY7 A;  3HPH A;  3VQ8 A;  2P9I B;  1HKG A;  3SAH A;  3J81 O;  3AGK A;  4JNE A;  4G9Z A;  4DFM A;  1BIZ A;  1W7A A;  4H4O A;  3AVL A;  3PIO L;  2I5J A;  2A1S A;  5FPM A;  4YDU A;  4A57 A;  3TR8 A;  3RMB A;  4FJ9 A;  5LJW A;  3ENH A;  5AQP A;  3SYZ A;  2UU9 K;  4DQR A;  3HOT A;  2NNW A;  3VMF B;  4CEE A;  4HUG A;  1MWK A;  2OZS A;  4CJE A;  4DV1 K;  4GY2 B;  1RCH A;  4H0O A;  2QXL A;  1KFS A;  5AFU H;  1R59 O;  3H3O B;  2O4G A;  1O1W A;  4BVP A;  3AVA A;  3T1Y K;  3CD6 N;  1C0F A;  3ITH A;  3DLH A;  2JLE A;  2V7Y A;  3SPZ A;  4A2A A;  4E7H A;  4DV4 K;  3H6E A;  4HCC A;  3DWL A;  4YOU A;  4FVU A;  1RBT A;  4PKI A;  2QWL A;  3KD1 E;  1C1C A;  4OPH A;  3NGI A;  3F2K A;  4R5P A;  4FJN A;  1L3U A;  4FJ8 A;  1XMQ K;  3VTH A;  1ATS A;  3MN7 A;  1VAZ A;  3ZSQ A;  4DMN A;  4CBU A;  3GDQ A;  3AAQ A;  5TKW A;  2YHY A;  3E9O A;  4AM6 A;  3L4Q A;  4LSL A;  4CZF A;  1QHT A;  4U67 L;  4H0P A;  2Q36 A;  4CK3 A;  2QWQ A;  1KSP A;  3QFP A;  4YOY A;  3QEP A;  4KTQ A;  3IUC A;  2HBL A;  3SUP A;  5CZ2 A;  2HHH K;  3TAQ A;  5JS2 A;  1RTJ A;  4Y1D A;  3D2E A;  4FWM A;  2D5R A;  4HTL A;  3M6G A;  2QWP A;  4M3U A;  4IKF A;  1G99 A;  3OYM A;  3PV8 A;  3VQC A;  4CHZ A;  1YJW N;  3MDQ A;  4FJK A;  4KRF A;  3L8B A;  1EET A;  1RDD A;  1TUY A;  2OPS A;  2NLX A;  3BEX A;  3I8D A;  1SUQ A;  5HBM A;  2E88 A;  4LFB K;  3V1O A;  5BRH A;  3D6R A;  4JKE A;  3QNN A;  4KI6 A;  2YHB A;  2P9K A;  5KPT A;  4B3R K;  1CZB A;  3KK3 A;  4CEC A;  3TAG A;  4DQP A;  1VQP N;  1WOQ A;  4C23 A;  2X74 A;  1WB9 A;  2GEM A;  2OTL N;  5FRM A;  4KTW A;  4X64 K;  4CJV A;  1BQN A;  1NOZ A;  3UKU A;  4KH4 A;  1FW6 A;  3KK7 A;  4CD3 A;  1XHZ A;  1XMO K;  2XRI A;  4B9L A;  2D0B A;  1N33 K;  4FK2 A;  4YDU C;  5GIN A;  2QK9 A;  3QBW A;  5AQT A;  2F7T A;  4JI2 K;  3VQD A;  1W2B M;  1FKO A;  1NK4 A;  1XHX A;  2GWJ A;  4DR2 K;  4CZM A;  4DG1 A;  1N32 K;  3OJU A;  3DLK A;  2VG6 A;  5M1K A;  2JWL A;  1BU6 O;  2BTF A;  3E1Y A;  2HMP A;  4BRI A;  4ZTF A;  3RWU A;  1QHA A;  2KW4 A;  5M1N A;  3WQT A;  3HYF A;  4CZE A;  2P5O A;  4LF8 K;  4CJ4 A;  4LF5 K;  4PWD A;  5CYM A;  4CF2 A;  1NK6 A;  3A2F A;  3ZCM A;  3QIO A;  3D2E B;  1S9E A;  3NBP A;  4CEZ A;  4DFP A;  1HPZ A;  3FZH A;  3CCR N;  3LL3 A;  3OA9 A;  4KI4 A;  3CQY A;  5E41 A;  1YTA A;  4YY3 K;  4DS5 A;  3F9M A;  3S3N A;  1MDU B;  2GTD A;  1D4X A;  3S9H A;  4CEF A;  3NVM A;  3T1A A;  2Q97 A;  3JYT A;  1VSM A;  4CK2 A;  2EX3 A;  4X62 K;  5AR0 A;  3LDN A;  4GVM A;  2JWK A;  1XC3 A;  4JK9 A;  4PQU A;  1NKC A;  5JIC A;  2P9K B;  1N5Y A;  1NGC A;  5AQI A;  3TAR A;  5JLH A;  3ZX3 A;  2OPQ A;  3C6T A;  3NDK A;  4GV6 A;  2X78 A;  4YOV A;  1QE1 A;  3NGY A;  4BR0 A;  3I56 N;  1BCO A;  3AVN A; 
#chains in the Genus database with same CATH homology
 3D45 A;  1IKV A;  4KTZ A;  5JS1 A;  2YNH A;  4AHR A;  2YNF A;  3OS2 A;  1NKB A;  4MFB A;  1Z26 A;  1A5X A;  4BWM A;  3KK1 A;  5DMR A;  3KLG A;  3L3V A;  1TV6 A;  4G1Q A;  1LW0 A;  5FRN A;  4FLW A;  4F4K A;  1RDB A;  3NHG A;  4OPJ A;  1T05 A;  2PZS A;  4DSI A;  3SNN A;  3LP0 A;  2HHQ A;  4DTJ A;  2YHA A;  3KLF A;  1Y97 A;  4FVM A;  4FYD A;  2IC3 A;  4MQ3 A;  2YNI A;  3UIQ A;  3B6O A;  2HW3 A;  1EP4 A;  1ZBI A;  3EY1 A;  3DI6 A;  2RPI A;  3QIP A;  3HK2 A;  1ZBU A;  4Z4F A;  4ICL A;  3EZ5 A;  4M3T A;  4NCG A;  1BGX T;  3P5J A;  2HB5 A;  1BQM A;  1WSG A;  3L2V A;  4J2B A;  5KRT A;  4E1M A;  2B4J A;  3NF7 A;  4N41 A;  1RNH A;  4E0D A;  2JGU A;  4RG8 A;  2DTU A;  3VA0 A;  3MED A;  4KAZ A;  3DRR A;  4ELU A;  4ZHR A;  1LV5 A;  3M8Q A;  4DU1 A;  4OLB A;  2IAJ A;  3VQA A;  3OY9 A;  4CJS A;  1LWE A;  4YNQ A;  3ZT1 A;  4FJG A;  1IH7 A;  3QO9 A;  4N47 A;  1CXQ A;  3ZT4 A;  4CIF A;  2G8U A;  4LY7 A;  4FM2 A;  3AA4 A;  3AVM A;  1S5J A;  3DMJ A;  2QKK A;  3ZSW A;  3OYB A;  1WAJ A;  3WNG A;  2RF2 A;  2BGG A;  4M3R A;  3P83 D;  1Q8I A;  3M8R A;  4AH9 A;  4KHN A;  1TAU A;  4M3Y A;  4LSN A;  3KLE A;  4KB1 A;  4CIG A;  3G0Z A;  2XY5 A;  4CHQ A;  2BAN A;  5HP1 A;  1TAQ A;  1U47 A;  4ELV A;  3AVB A;  2F8S A;  4C8N A;  4JRQ A;  1L3V A;  3SZ2 A;  4HCB A;  2D0A A;  2Z1G A;  4QAG A;  1SV5 A;  2Z1H A;  2OPP A;  3THV A;  2G8F A;  1G15 A;  3AVG A;  4DS4 A;  1ITG A;  3OYL A;  5J2P A;  3HPO A;  4FCY A;  1ASW A;  1ZBF A;  1A5W A;  2LSN A;  3O3H A;  3HT3 A;  4BE1 A;  4CGD A;  5T7B A;  4FM0 A;  1UOC A;  5J2M A;  4OKJ A;  5J2Q A;  1D9D A;  4J2D A;  1ZBH A;  2XY8 A;  3MEG A;  2Z1I A;  4FW2 A;  4E19 A;  4M3X A;  2GUI A;  1J9A A;  2FC0 A;  2ZE2 A;  2PYL A;  3ZSV A;  4M41 A;  4JS5 A;  1U04 A;  1HQE A;  1S6Q A;  3OYI A;  4CFA A;  1J54 A;  3LAK A;  1WLJ A;  1TGO A;  4K8X A;  1QQC A;  5KTQ A;  1VSI A;  3OYK A;  3OYG A;  1RT2 A;  1U45 A;  3PO5 A;  3QET A;  3ALY A;  4CF8 A;  4CFD A;  4Z4G A;  3CYM A;  1HYV A;  1KVC A;  1N6Q A;  4KHY A;  3PX4 A;  3VQQ A;  4BWJ A;  4FJ7 A;  1JLE A;  3HST B;  1LAW A;  3QIN A;  3DLG A;  1T03 A;  2G8K A;  3I0R A;  1VSD A;  4LH4 A;  3ISN C;  4KFB A;  3VQB A;  1IKX A;  5KGW A;  2F96 A;  5HRN A;  3QNO A;  2P5G A;  2OZM A;  4M3W A;  1TK5 A;  4IG3 A;  2OPR A;  4B8C A;  3ZT3 A;  4CHO A;  1NK9 A;  1VSK A;  3TAF A;  4HVJ A;  4Z4E A;  5CZ1 A;  2QXF A;  2BDP A;  4DU4 A;  3L2U A;  3TAP A;  3V1R A;  1I39 A;  4B9U A;  3SPY A;  1TKD A;  3C95 A;  4RW9 A;  4DTS A;  4DTU A;  4CHP A;  3TAN A;  1HYS A;  1X9M A;  3ZT2 A;  3T19 A;  1VRU A;  4HUF A;  2WOM A;  1VK0 A;  4CJF A;  3OS0 A;  4DTM A;  1BI4 A;  4CE9 A;  1YT3 A;  3CM5 A;  4K8Z A;  1HRH A;  1FKP A;  1S1U A;  3OYF A;  1U49 A;  5C24 A;  4NCA A;  4FJI A;  2HNY A;  5I3U A;  2IDO A;  2KTQ A;  5HRR A;  3WNH A;  3LZJ A;  3ZSO A;  3RMD A;  1BHL A;  2YV0 X;  1C0M A;  1C1B A;  4RW4 A;  4W5T A;  1D8Y A;  4CER A;  1C1A A;  4BE2 A;  1FK9 A;  3LWL A;  3L2W A;  3TI0 A;  3RRG A;  4ID1 A;  3NF9 A;  4CJP A;  4M3Z A;  2ZD1 A;  3DOL A;  1TL3 A;  3KK2 A;  1NJY A;  3OYN A;  1NK0 A;  4Q0B A;  3OYA A;  4B08 A;  1JLQ A;  3U3Y A;  2AJQ A;  3KLI A;  2XHB A;  2Y1J A;  2EHG A;  1KCF A;  4CJW A;  1U48 A;  4KRE A;  2QKB A;  4O0I A;  1JLC A;  5J2N A;  3RTV A;  1ZYQ A;  1B9F A;  1IKY A;  3JSM A;  1RT6 A;  4EP5 A;  1WSF A;  4FXD A;  3LPU A;  4CJT A;  3AVI A;  3ZSY A;  3K5M A;  4C8M A;  2XY6 A;  4OKK A;  2A1R A;  1WNS A;  2IOC A;  5KI6 A;  4N56 A;  3NF8 A;  1HJR A;  4IBN A;  2HVI A;  3HO1 A;  3H08 A;  3MEC A;  1L3S A;  1WAF A;  2ZQB A;  3AVK A;  3NAE A;  4CCH A;  3T3F A;  4PA1 A;  3V9X A;  4FJX A;  1S6P A;  4W5O A;  4EZ6 A;  2HHW A;  5HRO A;  4F2R A;  3OVN A;  3MAQ A;  1SL0 A;  1S1W A;  4GW6 A;  3QER A;  3IG1 A;  4NYN A;  3ZSX A;  3M8P A;  4CJ5 A;  4CJQ A;  4W5Q A;  3QEX A;  3LP3 A;  1GOA A;  4E7J A;  4CGJ A;  4W5R A;  3CQ8 A;  4BDZ A;  3KTQ A;  1RT5 A;  4OPK A;  2DY4 A;  4F8R A;  4FLX A;  3DM2 A;  1RT3 A;  3L3U A;  1BCM A;  5FDL A;  2HNZ A;  3K5O A;  4CJK A;  2Y1I A;  3AO3 A;  4DWI A;  4FJM A;  1XWL A;  4CFB A;  3SV3 A;  1TKZ A;  1CXU A;  4B9S A;  1KRP A;  1S1T A;  1QSL A;  1K6Y A;  4IFV A;  3S3O A;  4E7I A;  3LP2 A;  4LD0 A;  2FBV A;  2VG7 A;  4J2A A;  4KB0 A;  4KHS A;  3AVC A;  5EU7 A;  4HUE A;  1SL2 A;  3VQ9 A;  3LAM A;  3HXM A;  1L3T A;  1RBV A;  3VQ6 A;  1QSS A;  4N76 A;  3SCX A;  3DRS A;  1X9S A;  4CED A;  4FJJ A;  2OYQ A;  1RBR A;  4EP4 A;  1BL3 A;  1JXB A;  1B92 A;  1RTI A;  4M45 A;  4DTX A;  1NK8 A;  2Z1J A;  4HHT A;  2D0C A;  4I2P A;  3KKR A;  3PY8 A;  4FK0 A;  1F21 A;  2RKI A;  4O0J A;  4HTU A;  4FLU A;  4O55 A;  1NOY A;  4BAC A;  1TL1 A;  3EYZ A;  3AA5 X;  4PWD A;  2G8V A;  1QS4 A;  4CJR A;  4BE0 A;  4CJL A;  2B5J A;  4B9M A;  4KHW A;  2GBZ A;  3TAE A;  1LW2 A;  1SKR A;  4KPY A;  2YNG A;  2KFN A;  3TWH A;  3QEI A;  1BI4 B;  4C8K A;  5HRS A;  2HHX A;  4YFU A;  3SJJ A;  4CF0 A;  1IO2 A;  3O4Q A;  3SQ0 A;  3OS1 A;  4FZX C;  4AHS A;  3ASM A;  1IG9 A;  1WSI A;  4DSL A;  1SKS A;  4FJL A;  3MXJ A;  3NH1 A;  1BIS A;  3PX0 A;  1TVR A;  3AV9 A;  4E7K A;  4CGG A;  1BIU A;  1JKH A;  3O3F A;  2ATQ A;  3V6D A;  3VQP A;  4FLZ A;  2DFH A;  2OA8 A;  2HHU A;  4E89 A;  4Z4C A;  4AHT A;  4FLT A;  3IS9 A;  4IFY A;  4DSK A;  4W5N A;  3K57 A;  3SQ4 A;  3NE6 A;  3SI6 A;  3PX6 A;  3V9U A;  3OYJ A;  4NYF A;  1NK5 A;  1EKE A;  1CZ9 A;  2FBT A;  3VQ7 A;  4FM1 A;  1JXE A;  2XY7 A;  4DLE A;  4E7L A;  2W42 A;  4Y1C A;  3HPH A;  4OGC A;  1VSJ A;  3HL8 A;  3HP6 A;  1C0U A;  1RDA A;  3VQ8 A;  3ZT0 A;  3RMC A;  3G10 A;  4ELT A;  3LAL A;  3DLE A;  3CFR A;  3RMA A;  4DFM A;  2E6M A;  3SQ2 A;  1BIZ A;  3SV4 A;  1KTQ A;  4H4O A;  2Q3S A;  4AHV A;  4CF9 A;  4O44 A;  1TKT A;  3AVL A;  4CHY A;  3NCI A;  2I5J A;  1C0T A;  3SUQ A;  1TK0 A;  1B9D A;  4O4G A;  1NJZ A;  2A1S A;  4TSX A;  1I3A A;  2VG5 A;  4DTP A;  1WSE A;  1RIL A;  1VSH A;  3LPT A;  1HNI A;  3TR8 A;  4UQG A;  3RMB A;  4FJ9 A;  1Q9X A;  3DRP A;  5FRO A;  3SYZ A;  1QSY A;  1RT4 A;  4CGH A;  2RN2 A;  4CIE A;  4DQR A;  3VA3 A;  3SUN A;  2KZZ A;  4JLH A;  3HPG A;  1QTM A;  4CEE A;  4HUG A;  3PUF A;  1RTH A;  5I42 A;  4Q5V A;  4DQS A;  3PO4 A;  2OZS A;  1WSJ A;  3MXM A;  4CJE A;  1GOB A;  1GOC A;  4FK4 A;  3CFP A;  3LWM A;  1JLG A;  4N5S A;  4DTN A;  1RCH A;  2B6A A;  1L5U A;  2R7Y A;  1KFS A;  3AVJ A;  4RW7 A;  3AVF A;  2O4G A;  1O1W A;  4RW6 A;  4QOZ B;  1XI1 A;  3V1Q A;  4FLY A;  3AVA A;  3FFI A;  1VRT A;  1RT1 A;  3AO1 A;  4CK1 A;  3ITH A;  4OKE A;  4KHU A;  1W0H A;  2JLE A;  4E3S A;  3SPZ A;  3DLH A;  4E7H A;  3IRX A;  2HND A;  3AO2 A;  2X6S A;  3VQE A;  3VQ4 A;  3OYH A;  4HCC A;  4DF4 A;  3K59 A;  3ULD A;  3RRH A;  1RBT A;  1U4B A;  4DTR A;  1KLN A;  3C94 A;  1LAV A;  4AHU A;  4WE1 A;  3KD1 E;  3L2R A;  1C1C A;  3NGI A;  3V4I A;  1YTU A;  2P1J A;  4KO0 A;  4I9L A;  4R5P A;  3CM6 A;  1UA1 A;  4FJN A;  4PY5 A;  4FLV A;  3QLH A;  1L3U A;  4FJ8 A;  3AVH A;  5HRP A;  3RR8 A;  3ZSQ A;  4DMN A;  5SWM A;  2X6N A;  1D5A A;  1S9G A;  4OGE A;  1TK8 A;  4LSL A;  3OYD A;  1QHT A;  3OYC A;  1KLM A;  2NUB A;  4F2S A;  4CK3 A;  3K58 A;  3HVT A;  4BDY A;  1KSP A;  3E01 A;  2PY5 A;  1WN7 A;  3QEP A;  4CEA A;  4KTQ A;  1DLO A;  3IAY A;  4DLG A;  1UWB A;  3SUP A;  5CZ2 A;  3ZSR A;  1NKE A;  3TAQ A;  1RT7 A;  4OJR A;  2HVH A;  4DSE A;  3AO5 A;  3I0S A;  5JS2 A;  4KV8 A;  4ZTJ A;  1EX4 A;  1RBS A;  1RTJ A;  4Y1D A;  2HMI A;  2XO7 A;  3V9Z A;  4I2Q A;  2D5R A;  1R0A A;  3HJF A;  4M3U A;  1Z25 A;  1D9F A;  4IKF A;  3OYM A;  3CG7 A;  3BGR A;  3AA2 A;  3VQC A;  3PV8 A;  4FJ5 A;  3VN5 A;  4FZY A;  4CHZ A;  3O3G A;  3NH2 A;  3U3G A;  4FJK A;  3HP9 A;  4KRF A;  5DK5 A;  1CLQ A;  3NH0 A;  2ITG A;  4H4M A;  5C25 A;  3L8B A;  1J53 A;  1EET A;  4B9T A;  1RDD A;  2E4L A;  2FBY A;  1HYZ A;  3LDS A;  4OLA A;  3DLR A;  2OPS A;  2HHS A;  4B9N A;  3KD5 E;  1BCO A;  1IKW A;  3I8D A;  3V9S A;  1SUQ A;  5HBM A;  2YKM A;  4Z0U A;  4C8L A;  2DFF A;  1NJW A;  4IG0 A;  3V1O A;  5KRS A;  4DFJ A;  2YKN A;  3NGZ A;  3QNN A;  4KI6 A;  3TAM A;  1LWF A;  2YHB A;  2G8W A;  5J1E A;  5KGX A;  1CZB A;  4CGF A;  1ASV A;  3KK3 A;  4DSF A;  1UAX A;  4CEB A;  1VSE A;  3F73 A;  4CEC A;  3TAG A;  2KQ2 A;  1HQU A;  3K5L A;  2PYJ A;  4DQP A;  3S3M A;  2KFZ A;  4I9Q A;  4Z4I A;  1FXX A;  2ETJ A;  4CGI A;  1X9W A;  2X74 A;  4EZ9 A;  4OVL A;  4DQI A;  4CHN A;  1JLF A;  5FRM A;  3WNF A;  3K5N A;  4KTW A;  4CEO A;  4M42 A;  4CJV A;  4JS4 A;  1HMV A;  1BQN A;  1NOZ A;  4DFK A;  2WON A;  3DYA A;  1LWC A;  4BDP A;  1T7P A;  5SZT A;  3M8S A;  3F9K A;  3LZI A;  2F8T A;  1XHZ A;  1VSF A;  1VSL A;  2FBX A;  4CEQ A;  1NJX A;  4F3O A;  4L8R B;  2XRI A;  5D3G A;  3KIO A;  4E1N A;  4B9L A;  2D0B A;  4LH5 A;  3O4N A;  1JL1 A;  1RDC A;  4FK2 A;  2HHT A;  1DTQ A;  2QK9 A;  3VQD A;  3TAB A;  3NF6 A;  3DLB A;  3RR7 A;  3P1G A;  1FKO A;  3AA3 A;  1XHX A;  5HLF A;  3KKS A;  1NK4 A;  4DSJ A;  3U6F A;  4B9V A;  4FJH A;  4DG1 A;  4KHQ A;  3LP1 A;  3OJS A;  3OJU A;  3DLK A;  2VG6 A;  4FW1 A;  4B3O A;  4DTO A;  2E6L A;  3CFO A;  3V81 A;  1A5V A;  3ZSZ A;  1NK7 A;  3SQ1 A;  1S1X A;  4C8O A;  2KZM A;  4ZTF A;  1ZBL A;  2G8H A;  3RWU A;  1REV A;  4ID5 A;  1RTD A;  2KW4 A;  3QEW A;  3V9W A;  2O4I A;  2HHV A;  1KFD A;  2VWK A;  3VQ5 A;  4CFC A;  2GV9 A;  3HYF A;  2P5O A;  4CF1 A;  3NFA A;  1JLA A;  1KVB A;  1EXQ A;  5CYM A;  4CJ4 A;  4CF2 A;  3D0P A;  1NK6 A;  2VWJ A;  3A2F A;  3B6P A;  1DTT A;  3ZCM A;  3QIO A;  3DOK A;  3LAN A;  1S9E A;  3NBP A;  4CEZ A;  4Z4H A;  4DFP A;  4QCL A;  1J5O A;  4I7F A;  1HPZ A;  1W9H A;  3KLH A;  3K2P A;  1SKW A;  5CY4 A;  2IGI A;  4PUO A;  3C6U A;  4KI4 A;  5E41 A;  3MEE A;  1YTA A;  4KKO A;  4DS5 A;  5K14 A;  4DU3 A;  4RW8 A;  1X1P A;  3S3N A;  1UA0 A;  4H8K A;  1C6V A;  1RBU A;  3HVR A;  1XC9 A;  3L2Q A;  4XIU A;  4JRP A;  3SUO A;  3S9H A;  1MU2 A;  5CYQ A;  1T8E A;  4CEF A;  3KJV A;  3T1A A;  3QEV A;  2DFE A;  1JL2 A;  3HM9 A;  3JYT A;  1VSM A;  3MXI A;  4CK2 A;  2EX3 A;  2IS3 A;  3BDP A;  4GMJ B;  5C42 A;  1Q9Y A;  4CES A;  4DQQ A;  3AO4 A;  4DF8 A;  1TKX A;  2P51 A;  2G8I A;  1YVU A;  1S1V A;  4GVM A;  4PQU A;  1NKC A;  3QES A;  4B8A B;  4CJU A;  4FZZ A;  4O5B A;  3WNE A;  4NCB A;  1N5Y A;  1JLB A;  1SL1 A;  4F3T A;  3TAR A;  1KVA A;  2OPQ A;  3C6T A;  4CJ3 A;  4AHC A;  2X78 A;  3NDK A;  4AIL C;  3OYE A;  1QE1 A;  3NGY A;  1ASU A;  1HNV A;  4J2E A;  4IDK A;  2BE2 A;  1WSH A;  3AVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...