4HTUA

Structure of 5-chlorouracil modified a:u base pair
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
134
structure length
134
Chain Sequence
EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease H
publication title Structure, stability and function of 5-chlorouracil modified A:U and G:U base pairs.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 43
structure length 134
sequence length 134
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4htuA00
1KTQA 2HMIA 4F3TA 1I39A 4CGHA 4ZHRA 4J2EA 3KLIA 1WSIA 4H8KA 1XHZA 3TABA 1NOZA 2FBVA 3OYNA 4DU3A 2R7YA 3VQ4A 3MXJA 4NCAA 4Z4HA 3LWLA 1NK7A 4OGCA 3EY1A 2KZMA 3DMJA 5HP1A 4CF8A 1U48A 5D3GA 4DSFA 3DLRA 5DMRA 4IKFA 4BACA 3RMCA 4CGJA 3WNGA 3KLHA 3LDSA 3PX6A 2G8UA 4CHOA 2ETJA 2GV9A 4PQUA 4C8OA 3DRSA 4CIGA 4KHUA 1FKOA 3M8QA 1VSFA 1Q9YA 1LWCA 4PY5A 4LD0A 3QEXA 3UIQA 2DTUA 3A2FA 3NBPA 4KTQA 3ASMA 1BL3A 3LWMA 3VA0A 5HROA 2RF2A 1HRHA 4FLWA 1RTIA 3D0PA 4DTJA 3DLHA 2F8SA 3TR8A 3HXMA 2Q3SA 4DG1A 3U3YA 3V9ZA 1UOCA 1TK8A 3AVJA 2HNDA 3AA5X 4IFYA 1CXUA 4DQQA 2O4GA 2YNFA 4BWJA 1O1WA 3E01A 4DTPA 4CJEA 3P1GA 5J1EA 2KW4A 3O3FA 4JS4A 3V1OA 4EZ9A 1U4BA 1QTMA 1EX4A 1FK9A 3ZSZA 2X6NA 5CYQA 3THVA 3AVGA 4F2RA 1RT6A 1T8EA 5I42A 3MEGA 2G8VA 3AVLA 3TWHA 1SL1A 1ZBHA 4C8NA 3IRXA 4QCLA 4CJRA 3DRPA 4OKKA 2YHAA 4CJLA 4HHTA 1G15A 3C6TA 3SQ0A 3P5JA 1KSPA 3TAQA 1BGXT 3VQ5A 1LV5A 4O44A 4RG8A 3SQ1A 3DRRA 1CZBA 4DFKA 4FLXA 1RDCA 4DTRA 4ID1A 2OPRA 4J2BA 1VK0A 1C6VA 1FXXA 3NF6A 1TL1A 4O0JA 3KKSA 4XIUA 1RT2A 3O4NA 1LAWA 4CFDA 2BE2A 1K6YA 4FJ5A 1IH7A 1WSFA 3V6DA 3HVTA 3QESA 4CK1A 4NYNA 4YFUA 3JSMA 2F96A 4DMNA 4C8LA 2IAJA 3HPOA 1SKSA 1J54A 4KHQA 3LP2A 3S3MA 2JGUA 3NHGA 1QS4A 1S9EA 1W9HA 4B9TA 1NKEA 3AVNA 3K2PA 3VQ9A 3VQCA 3KLEA 4B9VA 4ELUA 4KI6A 4IDKA 1D9FA 3SYZA 1ASVA 5HRNA 1TVRA 1J9AA 1WAJA 1CZ9A 1S5JA 1I3AA 1LAVA 1Y97A 4LH5A 1KVCA 1EXQA 4FCYA 4RW8A 4CEAA 3K5MA 3SNNA 5HRRA 1RDAA 4Z4EA 1JXBA 5FDLA 2YNIA 4CEOA 1WSHA 3NGYA 1U47A 4N47A 4BE2A 4CJUA 3S3NA 3BGRA 1L3SA 2G8FA 3ZT4A 1N5YA 4I2PA 2PYJA 4CJ4A 3OS2A 1C0MA 2RKIA 2ZE2A 4FJ9A 1HYVA 4M42A 2FBYA 5FRMA 4YNQA 4M3ZA 3B6OA 3QO9A 1JLGA 2F8TA 4DWIA 1B9DA 3PO5A 4TSXA 3QNNA 4KI4A 1A5XA 4Z4IA 3AO5A 4CEBA 1IG9A 4KHYA 2Y1IA 2ZD1A 4FJGA 3HPHA 3ISNC 2XY7A 3TAEA 5HLFA 4OGEA 4M3XA 1S1XA 1VSJA 3KK2A 2Z1JA 3VQQA 3DI6A 3B6PA 5DK5A 5CZ2A 4FM1A 3F73A 2VG6A 4FK0A 3T1AA 1RT7A 3OYEA 4B3OA 1J53A 4DFPA 3FFIA 2X74A 1S6PA 3O4QA 1VSLA 3O3HA 4K8XA 2IS3A 4I2QA 3ZT3A 4I9QA 4AHVA 3V9WA 3OVNA 3LZJA 4CFCA 1VSKA 1RTHA 4KV8A 1NK9A 3M8SA 3KTQA 4FZYA 2ATQA 4Q5VA 4DSLA 4PUOA 3NH2A 2IGIA 4DSEA 3OYMA 1TKTA 1TAUA 1A5VA 3DLEA 2QKBA 3C95A 3AVFA 1YTAA 2B6AA 3QINA 4CERA 4KAZA 4Z4FA 3ZCMA 3G0ZA 3OYCA 2XHBA 4JS5A 4DLGA 3ZSYA 1CXQA 3CFRA 1Z26A 1UA1A 4E7LA 1D9DA 4E0DA 1NJWA 1RT5A 3P83D 1VSDA 1C1CA 1D5AA 4B08A 3MEDA 1D8YA 4I9LA 1X1PA 3VQEA 4W5QA 1ASWA 5HBMA 2FC0A 1WSJA 3OYJA 1L3VA 4M3TA 2P1JA 4FLTA 5CYMA 3LZIA 3MXIA 1NJXA 4F2SA 1EETA 2XY6A 4CJFA 2E4LA 2A1SA 1GOBA 4M3RA 3ULDA 3SPZA 3AO1A 1RBVA 3V1RA 4JRQA 4ZTJA 1T05A 3KKRA 4CESA 1RTDA 3HT3A 4OLBA 2KTQA 1ASUA 3SPYA 4AHSA 2IC3A 3SQ2A 4LY7A 2YHBA 4FVMA 4E7HA 3CFOA 2OZSA 4E3SA 4NCBA 2PZSA 1T03A 1T7PA 1RT1A 4IFVA 3V9XA 4FJJA 3LP1A 3TI0A 3AVHA 2OYQA 1KRPA 2VG7A 1KFSA 3H08A 1HNVA 3OJUA 1TGOA 4DFJA 3KJVA 3SUOA 3SCXA 1TV6A 1HYSA 3OY9A 3L2VA 3DLKA 3TANA 3RMAA 4OLAA 3L2QA 1S9GA 4CEEA 3OYHA 1HQUA 5KRSA 2PYLA 4BDZA 4FK4A 3CFPA 3K5LA 4IBNA 4LH4A 3SV3A 1KVBA 1S1UA 1RILA 1RBRA 4E7IA 1XI1A 4CK2A 1RDBA 5SWMA 4BDPA 1NK5A 1ZBLA 3V9SA 1JLQA 3NH1A 4G1QA 2Z1GA 4DS5A 4CJ3A 3OJSA 2B5JA 2X6SA 3OS1A 3LP0A 1U45A 1JLBA 2G8KA 4E89A 1SKRA 4DSKA 3AA4A 2OPPA 2FBTA 1C1BA 3DLBA 1JLCA 4CIFA 3EZ5A 1DLOA 3KLFA 4M45A 4AH9A 4DQRA 4DTSA 1UWBA 3NFAA 4E7KA 3SUPA 3HSTB 4FLUA 2G8HA 4OPJA 4KREA 5FRNA 1RCHA 3CYMA 1RTJA 3V1QA 4CE9A 3ZSWA 3HP6A 1JLAA 3DYAA 1L5UA 1UA0A 2G8IA 3AO2A 5J2PA 2P5GA 3AVCA 1IKWA 4CHZA 3OYLA 4KHNA 4W5TA 3JYTA 5HRSA 4FM0A 2JLEA 3DOLA 3AVIA 4BDYA 4FJIA 4B8CA 3MAQA 2DY4A 3LALA 4DLEA 2DFFA 3IG1A 3ZSXA 4CF0A 3NDKA 3T3FA 4KHWA 1HPZA 2HHXA 3SJJA 4FYDA 4W5NA 4CFAA 1BI4B 3VQAA 3NH0A 1QSYA 4JLHA 1NJZA 4KPYA 2HHQA 3ZSOA 3ZSVA 4M3UA 3K57A 4K8ZA 1BIUA 3K5NA 3NGIA 1FKPA 2HB5A 4M3WA 3QERA 1IKXA 3LPTA 2XY8A 1KVAA 3ZT1A 3NF8A 3DM2A 3OYGA 3TARA 3QETA 3LP3A 1IKYA 4CJQA 3AVMA 3VQDA 1IKVA 3ITHA 4Z4GA 3OYKA 1ZBUA 4EP4A 2EX3A 4OJRA 3NE6A 4HUFA 5KGWA 3L8BA 4DFMA 1F21A 3MECA 4HUEA 4DTUA 4DTXA 1LWFA 1DTTA 1GOCA 1REVA 2ITGA 3K58A 5CY4A 4CJPA 3PY8A 2HHTA 3AVKA 4O5BA 4Z0UA 3WNFA 3CM5A 3RRGA 1VSMA 1UAXA 3SUQA 4FW1A 2G8WA 1TKDA 1YTUA 4MFBA 1SKWA 3QIOA 4CGFA 5JS1A 3LANA 5C25A 4DF4A 1RBUA 1BI4A 2OA8A 3DLGA 1KFDA 1TKXA 4KTZA 1TKZA 2E6LA 5HRPA 1BIZA 5C24A 4CECA 4E7JA 1Q9XA 2D0BA 3L2UA 3SUNA 2WONA 3HL8A 1ZYQA 3DOKA 2IDOA 3AO3A 1NK8A 2Z1HA 1S1TA 2YKMA 2O4IA 2HVHA 4FJXA 4KB1A 3RR8A 2W42A 1RBSA 1RBTA 1LW0A 2I5JA 3NF9A 4KO0A 3ALYA 5SZTA 1NK0A 4GMJB 4CHPA 2GUIA 1LWEA 3S9HA 4CJ5A 3V81A 2IOCA 3QEPA 3ZT2A 4CJVA 4FJ8A 4HTUA 3PO4A 3IAYA 3I8DA 2HNYA 1LW2A 3RTVA 2LSNA 3RRHA 2RN2A 1Z25A 3G10A 3LAKA 4KHSA 1RT4A 4B8AB 4QAGA 1X9MA 3OS0A 4Y1CA 4R5PA 4O0IA 1VRTA 4JRPA 1BQMA 3OYFA 3KLGA 4FJLA 4NCGA 4CEQA 4ID5A 4DU4A 3VN5A 3RMDA 3VQBA 4RW6A 1NK6A 5J2QA 4FLVA 4B9SA 3L3UA 4OVLA 1SUQA 1QSSA 3OYBA 4M3YA 2BANA 4L8RB 4J2DA 2HNZA 1VSIA 1VSEA 1WAFA 3KK3A 5FROA 1HMVA 2RPIA 3AV9A 3TAFA 4DSJA 5C42A 1BCMA 4CGIA 4CIEA 4FZZA 5CZ1A 1BCOA 4PWDA 4AHTA 4IG0A 1U49A 1KCFA 1RDDA 2WOMA 3I0RA 5JS2A 1XHXA 2YNGA 1A5WA 3CQ8A 1NKBA 3V4IA 2BGGA 4FJNA 3AO4A 4CHNA 4LSNA 2HHUA 2AJQA 4KTWA 3K59A 3QLHA 4Q0BA 4DTMA 3RMBA 4OKEA 1X9SA 3BDPA 4DSIA 4B9UA 4N5SA 1VRUA 1TAQA 3TAMA 1JLFA 4FW2A 1JL1A 5J2MA 2EHGA 2X78A 3ZSRA 5J2NA 3LPUA 3QEWA 4FJKA 2KFNA 1VSHA 3HYFA 3KIOA 1NOYA 1ZBFA 1C0UA 2PY5A 1JLEA 4C8KA 2QKKA 4OKJA 3SI6A 4MQ3A 4CGDA 4B9LA 4DTNA 1DTQA 2OZMA 2HHVA 2OPSA 3VQ6A 3SZ2A 4FK2A 2Y1JA 1KLMA 4W5RA 2FBXA 3SV4A 1NJYA 4FJMA 3QIPA 3AVBA 3PV8A 1SL0A 4EP5A 2HVIA 3AA3A 2Z1IA 4E1NA 4RW7A 3NCIA 1SL2A 4DU1A 4DTOA 3PX0A 1RT3A 1N6QA 4H4OA 4UQGA 4CCHA 4ELVA 1QE1A 4FJHA 1W0HA 1QHTA 4BE0A 4FM2A 3QEIA 3U6FA 4DF8A 4KB0A 5EU7A 4N56A 4CFBA 3ZSQA 1L3UA 1U04A 1HJRA 3CG7A 4N76A 3KK1A 5KTQA 2XY5A 2P51A 4AHRA 4QOZB 5K14A 3QEVA 1JXEA 3MXMA 3WNEA 2XO7A 4CHYA 3L2RA 1B9FA 3O3GA 3ZT0A 3OYAA 1ITGA 2DFHA 5KGXA 3SQ4A 3HO1A 4B9NA 4M41A 1NK4A 1X9WA 2ZQBA 2NUBA 3QNOA 2VWJA 4DQIA 4IG3A 3IS9A 1EP4A 1HQEA 2P5OA 4OPKA 2KFZA 5I3UA 4W5OA 4KFBA 3M8PA 3S3OA 3EYZA 2VG5A 1S1WA 3HM9A 3HVRA 4KKOA 3KD5E 2YKNA 2A1RA 1XC9A 1WSEA 4B9MA 4CF2A 1C1AA 4E1MA 1TL3A 2D5RA 1YT3A 4CHQA 4BE1A 1HNIA 3CM6A 1QSLA 4F4KA 4BWMA 4KRFA 3WNHA 2B4JA 2HHWA 1IO2A 4Y1DA 4ELTA 2HHSA 3C6UA 4H4MA 1S1VA 3L3VA 3L2WA 3AA2A 2BDPA 3C94A 1WSGA 3RR7A 5E41A 4DQSA 4FXDA 4CJWA 1GOAA 4WE1A 4HCCA 1JKHA 1BQNA 3VA3A 4HCBA 1JL2A 4GVMA 3OYIA 4RW4A 4CF9A 2XRIA 4CEFA 2E6MA 5T7BA 2HW3A 4F8RA 3HP9A 1RNHA 4FJ7A 1S6QA 4DQPA 3HK2A 3PUFA 1NKCA 3U3GA 4CJSA 4CJTA 3MEEA 1SV5A 4NYFA 4CJKA 1MU2A 2OPQA 3OYDA 4CK3A 5KRTA 2KQ2A 1HYZA 1BISA 1WLJA 1QQCA 4GW6A 4PA1A 4I7FA 4EZ6A 3D45A 1Q8IA 2YNHA 1EKEA 2QK9A 3F9KA 1YVUA 4RW9A 1WN7A 1BHLA 1CLQA 4ICLA 3M8RA 3NF7A 1C0TA 2D0CA 4DS4A 3T19A 3VQ7A 4CGGA 4FLYA 3PX4A 1ZBIA 4E19A 4HVJA 4O4GA 3TAPA 3VQPA 1L3TA 3KD1E 4F3OA 4HUGA 1TK0A 4J2AA 3VQ8A 1B92A 4CEDA 3AVAA 3NGZA 4AHUA 4LSLA 2DFEA 4C8MA 4AILC 2VWKA 1TK5A 3V9UA 4Z4CA 4FLZA 4O55A 3RWUA 3HPGA 1WNSA 2GBZA 4ZTFA 1XWLA 3LAMA 4CEZA 1KLNA 4FZXC 2QXFA 4AHCA 1R0AA 5KI6A 4CF1A 4N41A 3HJFA 2D0AA 2YV0X 3TAGA 1J5OA 3I0SA 2KZZA 3NAEA 3K5OA
chains in the Genus database with same CATH superfamily
4A5BA 2D1KA 3LL3A 4ZHRA 3VEZA 4FWMA 1WSIA 1NLVA 3VQ4A 3MXJA 3LWLA 3CCEN 4DUZK 3EY1A 4X64K 5HP1A 3FE1A 4CF8A 5D3GA 4IKFA 2E2OA 2P9LA 3RMCA 5C15A 2RHKA 3KLHA 4BR0A 2ZF5O 1VQ6N 4CHOA 3SAGA 3OHRA 1TYQA 1VSFA 1Q9YA 3OTOK 5JLHA 4LD0A 3QEXA 4PY5A 2CH6A 3VA0A 2UYTA 5HROA 3J7AP 4DTJA 3NMUA 3HXMA 2Q3SA 4DG1A 3NVKA 4B1VA 4V19S 3VGKA 1CXUA 4DQQA 2O4GA 2YNFA 1O1WA 2HBLA 3SJHA 3J7ZO 1TUYA 3THVA 2X6NA 3AVGA 2RE2A 1RT6A 5I42A 4QS8A 3BUZB 3AVLA 4JEPA 3TWHA 1SS6A 4QCLA 3ZEUB 1GLCG 4DCHA 3ULEB 4YOTA 3TAQA 3VQ5A 5AZJB 2UXBK 2NRTA 1LV5A 4DV1K 4RG8A 1E4FT 3SQ1A 1CZBA 4FLXA 1RDCA 3F5TA 1VK0A 4U67L 4O0JA 1V4TA 3RSEA 3O4NA 1KAZA 1LAWA 1WSFA 4CK1A 5AQIA 4C8LA 1S3XA 1SKSA 3FZLA 4MLHA 5BN8A 1IBKK 1QS4A 1S9EA 4JKCA 1QVGM 3KLEA 3K9JA 4IDKA 1ASVA 1TVRA 1J9AA 4LH5A 3BF1A 1LAVA 3SNNA 5AFUH 4RW8A 5CE3A 1HR0K 4MO5A 5HRRA 1JXBA 3NGYA 1U47A 4N47A 2GEMA 4CZKA 2G8FA 1L3SA 1N5YA 3WXJA 4LF6K 1LOTB 2ZE2A 5FRMA 4M42A 4YORA 4YNQA 3A5NC 3AO5A 1IG9A 4QS9A 1NM1A 1VQLN 3ZX3A 2ZD1A 1YI2N 3EO3A 4OGEA 1S1XA 3KK2A 1O13A 5EY4A 3DI6A 3JAMO 4FM1A 3VTHA 2YX6A 1D4XA 3UKRA 4DR1K 5FLXO 1J53A 2X74A 1VSLA 2IS3A 4I2QA 3ZT3A 4YY3K 4AHVA 3EE8A 5JVHL 4BG8A 1RTHA 3F9MA 4Q5VA 4DSLA 1QQNA 5GADP 2UUCK 3CMEN 1A5VA 4H0PA 2QKBA 3LDOA 3VMFB 4DUYK 2VYPA 2B6AA 4KAZA 2W6LA 3OYCA 1UA1A 4E0DA 3VEXA 4H0YB 5BRHA 3CXCM 1NJWA 3P83D 2QWMA 3N4PA 1VSDA 3MEDA 3VQEA 1QZ5A 2FC0A 3OW2M 4K41A 1L3VA 3A5LC 2P1JA 4FLTA 5CYMA 3LZIA 1T6DA 1NJXA 2E4LA 4BC4A 2A40A 3ZX0A 3AO1A 3KKRA 4CESA 5EVZA 4A62A 1ASUA 2ZGZA 5DM7L 4IOXA 3SQ2A 2YHBA 4M7YA 3M6GA 4E3SA 4FJJA 3HI0A 4ILHA 1EQYA 1OH6A 1TGOA 3KJVA 2A42A 4FOEA 3OY9A 3DLKA 3MCAB 3UKUA 4BG9A 3L2QA 2F8TA 2IVNA 1RILA 1NK5A 4JI6K 4BRNA 4G1QA 2Z1GA 4CJ3A 3PIPL 2X6SA 2G8KA 1SKRA 1C1BA 1JLCA 3SAFA 4AH9A 4DQRA 4DTSA 4M7XA 3HSTB 5FRNA 4YOVA 3CYMA 3GOIA 3ZSWA 5LY3A 4DR6K 3I8BA 1UA0A 4IO8A 5HRSA 3T1HK 1MWMA 2F7TA 3AVIA 4DV3K 4BDYA 4FJIA 4AM6A 3MAQA 3LALA 3IG1A 1KD1O 3T3FA 5AQLA 4W5NA 3VQAA 3GE1A 3NH0A 4KPYA 3LDPA 1NJZA 2P9PA 3ZSOA 2QW9A 4JKAA 4K8ZA 5AQWA 3TSQA 1FKPA 2HB5A 1IKXA 4BRMA 1IKYA 1T3VA 3VQDA 1IKVA 3OYKA 1ZBUA 3QDKA 5KGWA 4BY9C 3L8BA 2HBJA 1XNQK 4BRHA 2NLXA 2HHTA 5CY4A 4CJPA 2GWJA 4O5BA 3CM5A 3SUQA 2QI2A 1SKWA 2OCEA 5C25A 2V51B 2KHOA 2IVOA 3VESA 1TKXA 4WQ4A 1DGKN 4H5WA 3CJBA 3E9OA 4BRFA 4NLBA 5HL7L 1ZYQA 2V7ZA 1U6ZA 3LM9A 3G71N 3AO3A 1NK8A 3RR8A 2W42A 1C0GA 3NF9A 5SZTA 3R9PA 1NK0A 2E8AA 1R59O 3S9HA 3V81A 2IOCA 3ZT2A 4FJ8A 4X66K 3ZX2A 3I8DA 1SQKA 1ZC6A 4BRKA 1Z25A 3D2EB 1KXPA 1YUWA 4Y1CA 4NXNK 1YF5L 4LF5K 4FJLA 4NCGA 4BRLA 2O8EB 2QWNA 3VETA 3QMLA 5AQSA 3TPQA 3O80A 3UKUB 3HOSA 2I7NA 4M3YA 2V7YA 3WQUA 1X9JA 4J2DA 2HNZA 3WUHA 1HMVA 2RPIA 4CGIA 4CIEA 4AHTA 1RDDA 3I0RA 1NKBA 3V4IA 4JKDA 1IBMK 2NRRA 4CHNA 4X65K 2WTUA 4OPHA 4KTWA 3K59A 4DTMA 5AQOA 1X9SA 4OKEA 3BDPA 2FSJA 4B9UA 2DPNA 3SAHA 4N5SA 3THWA 1HNXK 2QWLA 1Q82O 4JHDB 2EHGA 2X78A 5M1PA 1VSHA 3KIOA 1NOYA 1JLEA 3CF5L 4JI8K 2YJFA 4DTNA 2OZMA 3GG4A 2Y1JA 3SV4A 3WT0A 3QIPA 3O9RA 2HVIA 4E1NA 1SL2A 4BRIA 4DTOA 5AQJA 1N6QA 4H4OA 1QE1A 3CJ9A 1W0HA 4FM2A 3U6FA 5BN9A 5DM6L 3J81O 3B8AX 3KK1A 4QOZB 2P51A 4AHRA 4CHYA 2HMPA 2CGJA 3HZ6A 4M41A 5MLCQ 1YHQN 3QNOA 4EFHA 2P9SA 1HQEA 4OPKA 3P38A 4X62K 3WXIA 2P9KA 3HM9A 3O1WA 3FZKA 1XC9A 4JI0K 1E4GT 3VGMA 4JI1K 2NRZA 1WB9A 4DHYA 1HNIA 2A3ZA 3L3VA 3CCSN 1GOAA 1BQNA 4HWIA 3VA3A 5AQMA 1JL2A 4RW4A 4WYBA 4CEFA 5LMUK 3C7NB 4MLEA 2HW3A 4H0OA 4F8RA 4DQPA 1BWFO 2YI1A 2PBDA 1MU2A 1WOQA 5GAGP 1BISA 1WLJA 4I7FA 3D45A 1Q8IA 4DQ8A 1EKEA 4DB3A 4JKFA 1C0TA 5BPNA 4FLYA 4CGGA 3EEQA 3VQPA 3AAQA 1L3TA 3KD1E 5F2RA 1TK0A 1BA1A 4LSLA 4C8MA 1TK5A 3HPGA 2GUPA 4PKIA 5C2DA 4FZXC 1KLNA 3WEEB 2QXFA 4YOUA 5I9EB 3C6AA 2D0AA 3K5OA 1Q86O 3E66A 1I39A 3KLIA 4H8KA 1XHZA 3TABA 2O8FA 5IT9O 5AQNA 1EWRA 3T69A 4KH5A 4BR9A 1NK7A 1K9MO 3A0IX 4BR7A 3NVMA 2E2NA 3VF2A 3LDSA 3PX6A 4O8KA 1YITN 2BUPA 2ETJA 4C8OA 4KHUA 3L4IA 1LWCA 3FFKB 3NBPA 1NGFA 4KTQA 1BL3A 4A2AA 2RF2A 3DLHA 1RTIA 3BZKA 3TSPA 3THXB 4FWNA 1TK8A 4IFYA 1J5EK 1BOTO 1QHAA 4CJEA 4JS4A 3V1OA 5CYQA 4F2RA 3I33A 4OO1J 2D0OA 4A57A 2Q1NA 1SL1A 4CBWA 5TKWA 4CJRA 4WQ5A 1G15A 4HHTA 3DRRA 2ZWHA 4J2BA 2OPRA 3HTVA 5AQFA 4CI6A 3EZWA 3H46O 4FJ5A 3FGUA 3V6DA 5KPRA 4JKGB 3QESA 5AQKA 1NJIO 2UXCK 4CZHA 3W3DA 2JGUA 5ELZA 3ZEUA 3AVNA 3K2PA 3VQ9A 3VQCA 2YJEA 3ULEA 5AZJA 5HRNA 3CJ1A 4WCEL 4FCYA 3MDQA 2OTJN 3K5MA 3GDQA 3Q7BA 4JNEA 3N4QA 3ZYYX 4BE2A 4CJUA 4C1NK 3S3NA 4I2PA 2PYJA 2RKIA 1HYVA 4A59A 3QO9A 5HOOA 4TSXA 2P9UB 2E1YA 1KC8O 4FJGA 2XY7A 3TAEA 1VSJA 4FPAA 4IO9L 2A6AA 5DK5A 5CZ2A 3H3OB 4ILGB 4FWQA 4FK0A 2YHXA 2ZJPL 1HX1A 3FFIA 3EN9A 1S6PA 3O4QA 1NG9A 5IWAK 1VSKA 2OANA 4KV8A 1NK9A 1YVNA 3CCUN 4ILJA 3C95A 4U7BA 1HLUA 1BU6O 3QINA 5AQPA 4FWLA 2E2QA 1GLLO 3G0ZA 2XHBA 4JS5A 4DLGA 3ZSYA 3CFRA 1D9DA 3DXKB 1C1CA 4IWVA 1NGJA 4B08A 4I9LA 1N32K 3J7YP 2QA4N 1WSJA 1FW6A 4F2SA 2AA4A 1MDUB 3MXIA 1EETA 4AQYK 1HKCA 4I6MB 3MN6A 4Y0WA 1GOBA 4M3RA 3ULDA 2KTQA 1KAYA 4FWOA 4LY7A 3CFOA 4NCBA 1YIJN 2PZSA 1RT1A 4IFVA 4BRPA 4GV6A 1NU0A 3C0BA 4B1WB 2OYQA 4K0KK 2P9NB 4DFJA 1HNVA 3SUOA 3OA9A 1TV6A 3CC7N 4IXCA 3L2VA 3TANA 3RMAA 4OLAA 5TKYA 3OYHA 1T6CA 3SV3A 4IBNA 4LH4A 1SAZA 4BDPA 2HSTA 4JK9A 4PQUA 3P31A 2ASOA 3V9SA 3NH1A 3C6HA 1ZBLA 3L4QA 3OJSA 3OS1A 1G99A 4LF4K 1OH7A 3D2FB 3EZ5A 1UWBA 1YJNN 4KBOA 4FLUA 5BPLA 4CE9A 3DYAA 3WXMB 5J2PA 3OYLA 4KHNA 3JYTA 3VERA 2Q0RA 3SK3A 3DOLA 3ZSXA 3NDKA 4KHWA 3ID8A 1HPZA 4FYDA 3ID6A 1GLJO 2HF3A 5GIOA 2HOEA 3K5NA 3CQYA 4HTLA 4J8FA 3LPTA 2XY8A 3VEOA 3NF8A 3DM2A 3OYGA 1HKBA 3QETA 4CJQA 3EL2A 4HUFA 1F21A 4HUEA 4DTUA 4DTXA 1GOCA 1REVA 2ITGA 4L3QA 4DR5K 4JI4K 3WNFA 3RRGA 1YTUA 4WFBL 4JK8A 4FW1A 2G8WA 3EKUA 3QIOA 4CGFA 5JS1A 1V4SA 3MN9A 4WFAL 4IEEA 5FPMA 1NMDA 5HRPA 3M5RA 4CECA 1Q9XA 3U4LA 1VQ7N 3HL8A 5C12A 2VGMA 2E5LK 3HBTA 4FJXA 5FPEA 1RBTA 4GMJB 4DKWA 4GKJK 4FWPA 4NLCA 5ADXA 1LW2A 3RTVA 2LSNA 3RRHA 3G10A 4KHSA 1X9MA 2HBKA 3OS0A 1KAXA 2UU9K 4XH4A 4JRPA 3OYFA 4DU4A 3VN5A 3RMDA 2EWSA 4MO4A 5M1NA 1QSSA 3O4WA 3OYBA 3W0LA 4L8RB 3MN5A 3EE9A 3MN7A 5FROA 5KPTA 1N36K 4H5TA 4PWDA 5CZ1A 4IG0A 2WOMA 5JS2A 3CQ8A 1A5WA 2GELA 2BGGA 3AO4A 4IOAL 2QEXN 3CCLN 4PHTX 3RMBA 3D2EA 3CCQN 4BC3A 2Q0UA 1JLFA 2O8EA 4FW2A 1BA0A 5J2NA 4FJKA 4RCHA 1J6ZA 1XQSC 1C0UA 1S72N 3SI6A 3U9ZA 4R79A 4CGDA 5C2FA 1Y64A 2GX9A 2HHVA 2OPSA 2E88A 4JAXA 1P90A 4W5RA 4H5VA 4FJMA 3U8XA 1SL0A 5M1OA 4B1UB 3AA3A 4RW7A 3PX0A 1QHTA 3QEIA 3O6WA 4KB0A 4JHDA 3ZSQA 3CG7A 4N76A 5KTQA 2XY5A 1VQ4N 5K14A 3QEVA 1JXEA 3WNEA 2XO7A 3L2RA 3MMVA 1ITGA 3AGKA 4YDUA 1X9WA 4B3TK 2NUBA 3PSFA 4O5FA 3PLAA 4QS7A 4FL9A 2P5OA 1QQMA 1IG8A 3M8PA 3EYZA 3ENHA 4KKOA 4B9MA 3BY5A 3P39A 1TL3A 4CHQA 1HKGA 4BE1A 3CM6A 4BWMA 3TTDA 4KRFA 3C65A 2HHWA 1S1VA 4BRGA 3L2WA 2BDPA 3C94A 1WSGA 4BQZA 4HCCA 1JKHA 3SMSA 4GVMA 2HBMA 2E6MA 3HP9A 1S6QA 3PUFA 1FJGK 4CJKA 5KRTA 4GVEA 1HYZA 1QQCA 4EZ6A 2HF4A 1HNZK 1ESVA 2YNHA 3LM2A 4RW9A 1YVUA 3NF7A 4DS4A 3T19A 3PX4A 1DKGD 4HVJA 4HUGA 4J2AA 4CEDA 3CCRN 2Q97A 3NGZA 3O8MA 4FLZA 4DR4K 3DXMB 3C7NA 4ZTFA 4YOYA 3LAMA 5E84A 5EOYA 5KI6A 4CF1A 2YV0X 3I0SA 2KZZA 3NAEA 1KTQA 4O8UA 2HMIA 4LC9B 4F3TA 4CGHA 5C10A 5AZIB 2BTFA 4J2EA 4EHTA 1N33K 3THYA 1NOZA 3OYNA 4DU3A 2R7YA 1MWKA 3WXKA 4Z4HA 2UUAK 4OGCA 4LF8K 4ISGA 5DMRA 3LDLA 4BACA 4AM7A 5FPDA 1W7AA 2PAVA 3WEEA 2V52B 4CIGA 3M8QA 1JCFA 1ZXOA 4JYAK 3CJCA 3UIQA 5AQTA 2A5XA 4DR3K 3ASMA 3LWMA 3CPWM 4FLWA 2F8SA 3D0PA 1BO5O 3TR8A 4CBUA 3BF3A 4CD3A 2HNDA 3AA5X 3VPZA 4NXMK 4BWJA 3E01A 5J1EA 2KW4A 3O3FA 1QTMA 3ZSZA 1FK9A 3RVCA 5M1FA 3O1BA 4CW7B 1ZBHA 2FF6A 3DRPA 3O9TA 4OKKA 4FVUA 3SQ0A 3C6TA 5H1SQ 3CHWA 1NMNA 2JWKA 2ITMA 1YAGA 1NGDA 4DFKA 1XUPO 3THXA 3CCMN 1SZ2A 3DWLA 4DTRA 1GLDG 3D6RA 4DV6K 1C6VA 1JCEA 4BR5A 3NF6A 4GNIA 3WXLA 2P9IB 5LMNK 1RT2A 4CFDA 2BE2A 1HUXA 1IH7A 4E1JA 4DMNA 2J4RA 3IFRA 3HPOA 1J54A 3LP2A 3S3MA 2VWBA 1WBDA 3NHGA 1W9HA 4B9VA 1NKEA 3A5OC 3IDHA 1D9FA 5F0XA 1CZ9A 1S5JA 4FWSA 1Y97A 3H3NO 1E3MA 2O8BB 5FPNA 3MX2A 2YNIA 1WSHA 3ZT4A 1C0MA 5KQDA 2FBYA 4M3ZA 4JKGA 4LF7K 1JLGA 3H1QA 2QWRA 1B9DA 3PO5A 3QNNA 3THYB 4KHYA 2Y1IA 3ZETB 3CJ7A 3ISNC 2ZJQL 3E9LA 5GINA 3VQQA 5AFUA 3SLCA 3F73A 2VG6A 3T1AA 1RT7A 4IDHA 3OYEA 4DFPA 1IBLK 4CVNE 4B3MK 1ATRA 4K8XA 2VGNA 1NGIA 1GLBG 3KVGA 4CFCA 4DV5K 3AAPA 4K25A 3NH2A 4H0TB 4DSEA 3AY9A 3OYMA 1TKTA 5E26A 4A61A 5M1KA 2P9UA 4K42A 4BRAA 4EHUA 3CMAN 3AVFA 1YTAA 4Z4FA 1CXQA 1Z26A 3WQTA 1RT5A 3OYJA 4M3TA 4CBXA 2XY6A 4CJFA 1K8KB 5AQHA 4BC5A 3SPZA 1RBVA 1T05A 4CZMA 1RTDA 1XMQK 3MCPA 4BQLA 4OLBA 3SPYA 4AHSA 3Q7CA 3D7EO 4BR2A 2IC3A 4B9QA 2QTDA 3ENBA 2OZSA 3QB0A 1T7PA 4ISFA 3V9XA 2O8CB 5A2QO 2NRWA 3BP8A 3VF4A 1KFSA 3DXKA 3MWPA 3CETA 4CEEA 3ATUA 5KRSA 2PYLA 3CFPA 3M1FA 1XI1A 4I6MA 1JLQA 4DS5A 2WBNA 2B5JA 1U45A 1JLBA 4DSKA 3AA4A 1VHXA 5BPMA 4JI2K 1DLOA 1QQOA 4M45A 1NGGA 1X3NA 3SUPA 1W97L 5AQGA 2G8HA 4BRCA 1RCHA 2QM1A 3V1QA 3HP6A 1JLAA 2G8IA 4F9OA 3AVCA 1IKWA 2CH5A 2P9NA 4CHZA 4W5TA 3EKSA 4B8CA 2ZM6K 4DLEA 2DFFA 4CF0A 3SJJA 3GBTA 4CFAA 1BI4B 1VQKN 2HHQA 1OKJA 3ZLJA 3ZSVA 4M3UA 5CR4A 3NGIA 1NGHA 4M3WA 3D2FA 2NRVA 1CZAN 3T1YK 3TARA 1Q81O 5BRFA 5JICA 3AVMA 4EP4A 4DR2K 3TSUA 4WQ5C 4JI3K 3MECA 1LWFA 3K58A 3AVKA 4Z0UA 1Q18A 1UAXA 1TKDA 4MFBA 4MDAA 1S22A 2KKZA 4KTZA 2BH1A 2NNWA 1VQMN 2D0BA 3L2UA 3SUNA 2WONA 1BDGA 3AARA 3DOKA 1U2VB 3MWTA 2IVPA 1QVFM 2D4WA 3KWIA 2HVHA 3JS6A 3KZBA 4EZ9A 4KO0A 4CHPA 5KQ8A 2FF3B 4LFAK 3R8EA 2I7PA 2HNYA 2RN2A 2WFBA 3LAKA 1RT4A 3M3ZA 4QAGA 1VQPN 4R5PA 1NGAA 1VRTA 3KLGA 4CEQA 1OH8A 4G9ZA 1NK6A 5J2QA 4FLVA 4B9SA 3L3UA 4OVLA 1SUQA 4EAHD 5AQXA 4BRDA 1WAFA 1MA9B 3TAFA 4DSJA 1LCUA 1BCMA 1VQ9N 1KCFA 2UXDK 2YNGA 4FJNA 5AQUA 3KHYA 2HHUA 4M63C 1C0FA 1IJJA 4Q0BA 2ZJRL 3VF6A 4PL7A 5JMVA 1VRUA 4BROA 1TAQA 3TAMA 5J2MA 2PFUA 2KFNA 3QEWA 4RWTA 1ZBFA 2PY5A 2ASMA 2QKKA 4OKJA 4KH4A 4MQ3A 1DTQA 3VQ6A 4FWRA 3SZ2A 1KLMA 2FBXA 4BR4A 3K9KA 4BVOA 2Z1IA 3J8AA 4B3SK 1RT3A 5BRDA 3R1XA 4UQGA 4DV0K 4CCHA 4AF1A 4FJHA 4CZGA 4BE0A 5EU7A 1TUUA 4CFBA 1L3UA 1U04A 5AQVA 1NWKA 3LDQA 4KH6A 5BR9A 1OVYA 1B9FA 5BR8K 2F4VK 1VQ8N 5KGXA 3SQ4A 1NK4A 4JKEA 1GLFO 3IS9A 1ATSA 2O8DB 4CJ7A 3S3OA 2VQFK 3G4SN 1S1WA 3HVRA 2YKNA 2A1RA 4CF2A 1C1AA 4JD2B 5JVGL 1QSLA 4F4KA 2F9TA 3WNHA 2B4JA 1IO2A 4Y1DA 5BREA 4ELTA 2HHSA 4CZFA 5E41A 2QXLA 4DQSA 4FXDA 4CJWA 4HCBA 3OYIA 4BVPA 4CF9A 4MDBA 4KHPK 4FJ7A 5AQQA 3HK2A 4CJSA 1VQ5N 4CJTA 3MEEA 1SV5A 4NYFA 3HOTA 2OPQA 4CK3A 3FLCO 4PKGA 3CQXA 3L0QA 4PA1A 3F9KA 3IUCA 5LL6Z 1BHLA 2D0CA 4JKHA 3FR0A 3VEWA 3A8YA 4FOIA 4O4GA 3TAPA 4F3OA 3HM8A 3VQ8A 4UY8O 1YJ9N 3CCVN 3H6EA 2VWKA 4AILC 3TTFA 4O55A 3MX5A 2P9LB 3G6EN 2WUSA 3I55N 4AHCA 1R0AA 5AQRA 4N41A 1M90O 3HJFA 4GKKK 1I94K 1TYQB 2CGKA 5B8HA 1EO1A 1QZ6A 2IIRA 3OBYA 2FBVA 3JXUA 4NCAA 3G25A 1GLEG 2VQEK 4IJNA 2KZMA 3DMJA 1U48A 4DSFA 3DLRA 3DXMA 5AR0A 4BGAA 2E20A 3WNGA 4CGJA 3DLLL 5LJWA 2G8UA 2GV9A 3DRSA 4JI5K 2Q31A 1FKOA 2DTUA 3A2FA 5AQZA 5AZIA 1HRHA 3U3YA 3V9ZA 2W6KA 1UOCA 3AVJA 4XEIA 3RSEB 4DTPA 4BREA 3P1GA 1U4BA 1EX4A 4WFNL 1ATNA 1T8EA 2AP1A 3MEGA 2A41A 2G8VA 3VENA 3O9QA 3HSCA 4C8NA 3IRXA 2YHAA 4JN4A 4GY2B 4CJLA 1KSPA 3P5JA 3F2KA 1BGXT 4BRQA 3QBXA 1K8AO 2QWPA 4O44A 2W40A 3FZFA 4ID1A 4IEIA 2UUBK 1FXXA 1TL1A 3KKSA 4XIUA 1RFQA 1K6YA 3SBGA 1GLAG 3QFUA 4FWKA 3HVTA 3I56N 4NYNA 4YFUA 3JSMA 2F96A 3E9PA 4EIAA 2IAJA 3O08A 4KHQA 5C0YA 4CZLA 1NGEA 5AQYA 2GWKA 4B9TA 4KI6A 3SYZA 3VOVA 1WAJA 1I3AA 4B9NA 1KVCA 1EXQA 4CEAA 1RDAA 4Z4EA 3UKRB 5FDLA 4DR7K 4CEOA 1RDUA 1RDWX 1WUAA 5M1QA 3OBWA 2P9IA 3BZCA 4JI7K 3CERA 3BGRA 5GAHP 4CZIA 2CGLA 4CJ4A 3OS2A 4FJ9A 3BEXA 3QBWA 3B6OA 2HHHK 4H0XB 4DWIA 4KI4A 4YDUC 4Z4IA 1A5XA 1T44A 4CEBA 4LFCK 1Z05A 3HPHA 3ENOA 5HLFA 1YXQA 1ZBSA 4M3XA 2E1ZA 2Z1JA 1K73O 3PSIA 3B6PA 3CPEA 4PL8A 2O8BA 2W41A 4B1ZA 4B3OA 3L6QA 3O3HA 4A2BA 3KWGA 4I9QA 3V9WA 3OVNA 3LZJA 4XH1A 4YOWA 3M8SA 3KTQA 4FZYA 2ATQA 4PUOA 2IGIA 3DJCA 1TAUA 4ISEA 3DLEA 4WQ4C 3ZETA 4CERA 3UB5A 3ZCMA 3SBTA 4E7LA 5EXWA 1D5AA 1D8YA 1X1PA 4W5QA 1ASWA 5HBMA 1NNEA 4IZ9A 4GV3A 2Q36A 2A1SA 4JRQA 3V1RA 4ZTJA 2F9WA 3HT3A 4K43A 2Q2RA 3PIOL 3LDNA 4YHHK 3MK6A 4E7HA 4FVMA 2H3GX 3DAWA 1T03A 1WBBA 3LP1A 3TI0A 4WF9L 3AVHA 1HNWK 1KRPA 1XNRK 2NRXA 2VG7A 3CD6N 3FZHA 3U9DA 2OTLN 3H08A 4IFEA 3OJUA 3SCXA 1HYSA 4FSVA 1VQNN 4JV5K 1S9GA 3CC4N 1HQUA 4FK4A 4BDZA 3K5LA 4E7IA 4KREA 1S1UA 1KVBA 1RBRA 1K8KA 1RDBA 3ATVA 4CK2A 5SWMA 4DV4K 2P9PB 3LP0A 1CLQA 4E89A 2FBTA 2OPPA 3DLBA 3H1VX 4CIFA 3KLFA 2FSNA 3O5BA 3NFAA 4E7KA 1VAZA 1XC3A 4OPJA 3P4IA 1RTJA 2O8CA 1L5UA 1JCGA 3AO2A 2P5GA 4FM0A 2ASPA 2JLEA 1NBWA 1Q7YO 3E1YA 1OVQA 3CC2N 2DY4A 2HHXA 2YCHA 1QSYA 4JLHA 2GTDA 4B1YB 2NZTA 3K57A 1BIUA 1RGIA 1P8ZA 1KQSM 4OPAA 2YHYA 3QERA 3ZT1A 1KVAA 4H5RA 3S41A 2YHWA 1X3MA 3O9SA 3LP3A 3CJAA 3ITHA 4Z4GA 4BGBA 3NE6A 2EX3A 4OJRA 4DFMA 4IOCL 1DTTA 3PY8A 3VEVA 1EWQA 1VSMA 5ADXH 3LANA 4DF4A 1RBUA 1BI4A 1N34K 3UE5A 2OA8A 3DLGA 3QFPA 1KFDA 1TKZA 2E6LA 5AJ3K 1BIZA 5EX5A 5C24A 4E7JA 4RTFD 4H0VB 2IDOA 3K0SA 4DV2K 1HJOA 1S1TA 2VCPA 2WC9A 2YKMA 2Z1HA 2O4IA 3SMPA 4KB1A 1RBSA 1LW0A 2I5JA 3ALYA 2GUIA 1LWEA 4CJ5A 3QEPA 4CJVA 4NO7A 4HTUA 3PO4A 3IAYA 2JWLA 2FSKA 4YOXA 2FLOA 4LF9K 5GIPA 4BC2A 4B8AB 3AGRA 4O0IA 1BQMA 3THWB 4ID5A 3VQBA 4RW6A 1XMOK 3VTIA 2ZGYA 2BANA 1U2VA 5F1XA 4JKBA 3HRGA 1VSIA 4C1NI 1VSEA 3KK3A 3AV9A 4FZZA 5C42A 1NGBA 5CHIA 1BCOA 1U49A 3O9UA 3R3LA 1XHXA 4FO0A 4LSNA 2D0PA 2AJQA 3QLHA 3GL1A 3CCJN 2KLAA 4DSIA 1VQON 5KPZA 3A5MC 4H5NA 1JL1A 3ZSRA 3LPUA 3HYFA 1IV0A 4FPBA 1BUPA 3TTCA 3KK7A 4C8KA 4GV9A 4B9LA 4PKHA 2P9SB 4FK2A 1NJYA 1DEJA 4CZEA 3AVBA 3PV8A 2P9KB 4EP5A 3J80O 3NCIA 4DU1A 4ELVA 4DF8A 3CIPA 4N56A 2QWQA 1HPMA 1HJRA 4XH5A 4LFBK 4OX9K 3MXMA 3O3GA 3ZT0A 3OYAA 2DFHA 3HO1A 4C23A 2ZQBA 2VWJA 4DQIA 4IG3A 2KFZA 1EP4A 5LJVA 4NB4A 5I3UA 4H03B 4W5OA 4KFBA 2VG5A 3TU5A 3KD5E 1WSEA 4JK7A 4A5AA 3FZMA 3T7ZA 4E1MA 2D5RA 1YT3A 3VEYA 4B1XB 4IJAA 3H45C 1Z6RA 1H1VA 2NRHA 3C6UA 4H4MA 4ELUA 3RR7A 3AA2A 1YJWN 3CI5A 5GAEP 3R6MA 4WE1A 2XRIA 3VGLA 5T7BA 1RNHA 4DV7K 1NKCA 3U3GA 4Z94A 2O8DA 4CD1A 3OYDA 3IMXA 1JJ2M 2KQ2A 4GW6A 1NGCA 4B3RK 5JLFA 3IKMA 1ILYA 3QICA 4JD2A 2QK9A 1WN7A 4ICLA 4CZJA 3M8RA 2O8FB 1DT9A 2E2PA 3VQ7A 1ZBIA 4E19A 1N8RO 1B92A 3AVAA 4AHUA 2DFEA 2QWOA 3V9UA 4Z4CA 3RWUA 1OH5A 1WNSA 1W2BM 2GBZA 1BG3A 1XWLA 4CEZA 2FXUA 3TAGA 1J5OA 1M1KO
chains in the Genus database with same CATH topology
1KTQA 2HMIA 4F3TA 1I39A 4CGHA 4ZHRA 4J2EA 3KLIA 1WSIA 4H8KA 1XHZA 3TABA 1NOZA 2FBVA 3OYNA 4DU3A 2R7YA 3VQ4A 3MXJA 4NCAA 4Z4HA 3LWLA 1NK7A 4OGCA 3EY1A 2KZMA 3DMJA 5HP1A 4CF8A 1U48A 5D3GA 4DSFA 3DLRA 5DMRA 4IKFA 4BACA 3RMCA 4CGJA 3WNGA 3KLHA 3LDSA 3PX6A 2G8UA 4CHOA 2ETJA 2GV9A 4PQUA 4C8OA 3DRSA 4CIGA 4KHUA 1FKOA 3M8QA 1VSFA 1Q9YA 1LWCA 4PY5A 4LD0A 3QEXA 3UIQA 2DTUA 3A2FA 3NBPA 4KTQA 3ASMA 1BL3A 3LWMA 3VA0A 5HROA 2RF2A 1HRHA 4FLWA 1RTIA 3D0PA 4DTJA 3DLHA 2F8SA 3TR8A 3HXMA 2Q3SA 4DG1A 3U3YA 3V9ZA 1UOCA 1TK8A 3AVJA 2HNDA 3AA5X 4IFYA 1CXUA 4DQQA 2O4GA 2YNFA 4BWJA 1O1WA 3E01A 4DTPA 4CJEA 3P1GA 5J1EA 2KW4A 3O3FA 4JS4A 3V1OA 4EZ9A 1U4BA 1QTMA 1EX4A 1FK9A 3ZSZA 2X6NA 5CYQA 3THVA 3AVGA 4F2RA 1RT6A 1T8EA 5I42A 3MEGA 2G8VA 3AVLA 3TWHA 1SL1A 1ZBHA 4C8NA 3IRXA 4QCLA 4CJRA 3DRPA 4OKKA 2YHAA 4CJLA 4HHTA 1G15A 3C6TA 3SQ0A 3P5JA 1KSPA 3TAQA 1BGXT 3VQ5A 1LV5A 4O44A 4RG8A 3SQ1A 3DRRA 1CZBA 4DFKA 4FLXA 1RDCA 4DTRA 4ID1A 2OPRA 4J2BA 1VK0A 1C6VA 1FXXA 3NF6A 1TL1A 4O0JA 3KKSA 4XIUA 1RT2A 3O4NA 1LAWA 4CFDA 2BE2A 1K6YA 4FJ5A 1IH7A 1WSFA 3V6DA 3HVTA 3QESA 4CK1A 4NYNA 4YFUA 3JSMA 2F96A 4DMNA 4C8LA 2IAJA 3HPOA 1SKSA 1J54A 4KHQA 3LP2A 3S3MA 2JGUA 3NHGA 1QS4A 1S9EA 1W9HA 4B9TA 1NKEA 3AVNA 3K2PA 3VQ9A 3VQCA 3KLEA 4B9VA 4ELUA 4KI6A 4IDKA 1D9FA 3SYZA 1ASVA 5HRNA 1TVRA 1J9AA 1WAJA 1CZ9A 1S5JA 1I3AA 1LAVA 1Y97A 4LH5A 1KVCA 1EXQA 4FCYA 4RW8A 4CEAA 3K5MA 3SNNA 5HRRA 1RDAA 4Z4EA 1JXBA 5FDLA 2YNIA 4CEOA 1WSHA 3NGYA 1U47A 4N47A 4BE2A 4CJUA 3S3NA 3BGRA 1L3SA 2G8FA 3ZT4A 1N5YA 4I2PA 2PYJA 4CJ4A 3OS2A 1C0MA 2RKIA 2ZE2A 4FJ9A 1HYVA 4M42A 2FBYA 5FRMA 4YNQA 4M3ZA 3B6OA 3QO9A 1JLGA 2F8TA 4DWIA 1B9DA 3PO5A 4TSXA 3QNNA 4KI4A 1A5XA 4Z4IA 3AO5A 4CEBA 1IG9A 4KHYA 2Y1IA 2ZD1A 4FJGA 3HPHA 3ISNC 2XY7A 3TAEA 5HLFA 4OGEA 4M3XA 1S1XA 1VSJA 3KK2A 2Z1JA 3VQQA 3DI6A 3B6PA 5DK5A 5CZ2A 4FM1A 3F73A 2VG6A 4FK0A 3T1AA 1RT7A 3OYEA 4B3OA 1J53A 4DFPA 3FFIA 2X74A 1S6PA 3O4QA 1VSLA 3O3HA 4K8XA 2IS3A 4I2QA 3ZT3A 4I9QA 4AHVA 3V9WA 3OVNA 3LZJA 4CFCA 1VSKA 1RTHA 4KV8A 1NK9A 3M8SA 3KTQA 4FZYA 2ATQA 4Q5VA 4DSLA 4PUOA 3NH2A 2IGIA 4DSEA 3OYMA 1TKTA 1TAUA 1A5VA 3DLEA 2QKBA 3C95A 3AVFA 1YTAA 2B6AA 3QINA 4CERA 4KAZA 4Z4FA 3ZCMA 3G0ZA 3OYCA 2XHBA 4JS5A 4DLGA 3ZSYA 1CXQA 3CFRA 1Z26A 1UA1A 4E7LA 1D9DA 4E0DA 1NJWA 1RT5A 3P83D 1VSDA 1C1CA 1D5AA 4B08A 3MEDA 1D8YA 4I9LA 1X1PA 3VQEA 4W5QA 1ASWA 5HBMA 2FC0A 1WSJA 3OYJA 1L3VA 4M3TA 2P1JA 4FLTA 5CYMA 3LZIA 3MXIA 1NJXA 4F2SA 1EETA 2XY6A 4CJFA 2E4LA 2A1SA 1GOBA 4M3RA 3ULDA 3SPZA 3AO1A 1RBVA 3V1RA 4JRQA 4ZTJA 1T05A 3KKRA 4CESA 1RTDA 3HT3A 4OLBA 2KTQA 1ASUA 3SPYA 4AHSA 2IC3A 3SQ2A 4LY7A 2YHBA 4FVMA 4E7HA 3CFOA 2OZSA 4E3SA 4NCBA 2PZSA 1T03A 1T7PA 1RT1A 4IFVA 3V9XA 4FJJA 3LP1A 3TI0A 3AVHA 2OYQA 1KRPA 2VG7A 1KFSA 3H08A 1HNVA 3OJUA 1TGOA 4DFJA 3KJVA 3SUOA 3SCXA 1TV6A 1HYSA 3OY9A 3L2VA 3DLKA 3TANA 3RMAA 4OLAA 3L2QA 1S9GA 4CEEA 3OYHA 1HQUA 5KRSA 2PYLA 4BDZA 4FK4A 3CFPA 3K5LA 4IBNA 4LH4A 3SV3A 1KVBA 1S1UA 1RILA 1RBRA 4E7IA 1XI1A 4CK2A 1RDBA 5SWMA 4BDPA 1NK5A 1ZBLA 3V9SA 1JLQA 3NH1A 4G1QA 2Z1GA 4DS5A 4CJ3A 3OJSA 2B5JA 2X6SA 3OS1A 3LP0A 1U45A 1JLBA 2G8KA 4E89A 1SKRA 4DSKA 3AA4A 2OPPA 2FBTA 1C1BA 3DLBA 1JLCA 4CIFA 3EZ5A 1DLOA 3KLFA 4M45A 4AH9A 4DQRA 4DTSA 1UWBA 3NFAA 4E7KA 3SUPA 3HSTB 4FLUA 2G8HA 4OPJA 4KREA 5FRNA 1RCHA 3CYMA 1RTJA 3V1QA 4CE9A 3ZSWA 3HP6A 1JLAA 3DYAA 1L5UA 1UA0A 2G8IA 3AO2A 5J2PA 2P5GA 3AVCA 1IKWA 4CHZA 3OYLA 4KHNA 4W5TA 3JYTA 5HRSA 4FM0A 2JLEA 3DOLA 3AVIA 4BDYA 4FJIA 4B8CA 3MAQA 2DY4A 3LALA 4DLEA 2DFFA 3IG1A 3ZSXA 4CF0A 3NDKA 3T3FA 4KHWA 1HPZA 2HHXA 3SJJA 4FYDA 4W5NA 4CFAA 1BI4B 3VQAA 3NH0A 1QSYA 4JLHA 1NJZA 4KPYA 2HHQA 3ZSOA 3ZSVA 4M3UA 3K57A 4K8ZA 1BIUA 3K5NA 3NGIA 1FKPA 2HB5A 4M3WA 3QERA 1IKXA 3LPTA 2XY8A 1KVAA 3ZT1A 3NF8A 3DM2A 3OYGA 3TARA 3QETA 3LP3A 1IKYA 4CJQA 3AVMA 3VQDA 1IKVA 3ITHA 4Z4GA 3OYKA 1ZBUA 4EP4A 2EX3A 4OJRA 3NE6A 4HUFA 5KGWA 3L8BA 4DFMA 1F21A 3MECA 4HUEA 4DTUA 4DTXA 1LWFA 1DTTA 1GOCA 1REVA 2ITGA 3K58A 5CY4A 4CJPA 3PY8A 2HHTA 3AVKA 4O5BA 4Z0UA 3WNFA 3CM5A 3RRGA 1VSMA 1UAXA 3SUQA 4FW1A 2G8WA 1TKDA 1YTUA 4MFBA 1SKWA 3QIOA 4CGFA 5JS1A 3LANA 5C25A 4DF4A 1RBUA 1BI4A 2OA8A 3DLGA 1KFDA 1TKXA 4KTZA 1TKZA 2E6LA 5HRPA 1BIZA 5C24A 4CECA 4E7JA 1Q9XA 2D0BA 3L2UA 3SUNA 2WONA 3HL8A 1ZYQA 3DOKA 2IDOA 3AO3A 1NK8A 2Z1HA 1S1TA 2YKMA 2O4IA 2HVHA 4FJXA 4KB1A 3RR8A 2W42A 1RBSA 1RBTA 1LW0A 2I5JA 3NF9A 4KO0A 3ALYA 5SZTA 1NK0A 4GMJB 4CHPA 2GUIA 1LWEA 3S9HA 4CJ5A 3V81A 2IOCA 3QEPA 3ZT2A 4CJVA 4FJ8A 4HTUA 3PO4A 3IAYA 3I8DA 2HNYA 1LW2A 3RTVA 2LSNA 3RRHA 2RN2A 1Z25A 3G10A 3LAKA 4KHSA 1RT4A 4B8AB 4QAGA 1X9MA 3OS0A 4Y1CA 4R5PA 4O0IA 1VRTA 4JRPA 1BQMA 3OYFA 3KLGA 4FJLA 4NCGA 4CEQA 4ID5A 4DU4A 3VN5A 3RMDA 3VQBA 4RW6A 1NK6A 5J2QA 4FLVA 4B9SA 3L3UA 4OVLA 1SUQA 1QSSA 3OYBA 4M3YA 2BANA 4L8RB 4J2DA 2HNZA 1VSIA 1VSEA 1WAFA 3KK3A 5FROA 1HMVA 2RPIA 3AV9A 3TAFA 4DSJA 5C42A 1BCMA 4CGIA 4CIEA 4FZZA 5CZ1A 1BCOA 4PWDA 4AHTA 4IG0A 1U49A 1KCFA 1RDDA 2WOMA 3I0RA 5JS2A 1XHXA 2YNGA 1A5WA 3CQ8A 1NKBA 3V4IA 2BGGA 4FJNA 3AO4A 4CHNA 4LSNA 2HHUA 2AJQA 4KTWA 3K59A 3QLHA 4Q0BA 4DTMA 3RMBA 4OKEA 1X9SA 3BDPA 4DSIA 4B9UA 4N5SA 1VRUA 1TAQA 3TAMA 1JLFA 4FW2A 1JL1A 5J2MA 2EHGA 2X78A 3ZSRA 5J2NA 3LPUA 3QEWA 4FJKA 2KFNA 1VSHA 3HYFA 3KIOA 1NOYA 1ZBFA 1C0UA 2PY5A 1JLEA 4C8KA 2QKKA 4OKJA 3SI6A 4MQ3A 4CGDA 4B9LA 4DTNA 1DTQA 2OZMA 2HHVA 2OPSA 3VQ6A 3SZ2A 4FK2A 2Y1JA 1KLMA 4W5RA 2FBXA 3SV4A 1NJYA 4FJMA 3QIPA 3AVBA 3PV8A 1SL0A 4EP5A 2HVIA 3AA3A 2Z1IA 4E1NA 4RW7A 3NCIA 1SL2A 4DU1A 4DTOA 3PX0A 1RT3A 1N6QA 4H4OA 4UQGA 4CCHA 4ELVA 1QE1A 4FJHA 1W0HA 1QHTA 4BE0A 4FM2A 3QEIA 3U6FA 4DF8A 4KB0A 5EU7A 4N56A 4CFBA 3ZSQA 1L3UA 1U04A 1HJRA 3CG7A 4N76A 3KK1A 5KTQA 2XY5A 2P51A 4AHRA 4QOZB 5K14A 3QEVA 1JXEA 3MXMA 3WNEA 2XO7A 4CHYA 3L2RA 1B9FA 3O3GA 3ZT0A 3OYAA 1ITGA 2DFHA 5KGXA 3SQ4A 3HO1A 4B9NA 4M41A 1NK4A 1X9WA 2ZQBA 2NUBA 3QNOA 2VWJA 4DQIA 4IG3A 3IS9A 1EP4A 1HQEA 2P5OA 4OPKA 2KFZA 5I3UA 4W5OA 4KFBA 3M8PA 3S3OA 3EYZA 2VG5A 1S1WA 3HM9A 3HVRA 4KKOA 3KD5E 2YKNA 2A1RA 1XC9A 1WSEA 4B9MA 4CF2A 1C1AA 4E1MA 1TL3A 2D5RA 1YT3A 4CHQA 4BE1A 1HNIA 3CM6A 1QSLA 4F4KA 4BWMA 4KRFA 3WNHA 2B4JA 2HHWA 1IO2A 4Y1DA 4ELTA 2HHSA 3C6UA 4H4MA 1S1VA 3L3VA 3L2WA 3AA2A 2BDPA 3C94A 1WSGA 3RR7A 5E41A 4DQSA 4FXDA 4CJWA 1GOAA 4WE1A 4HCCA 1JKHA 1BQNA 3VA3A 4HCBA 1JL2A 4GVMA 3OYIA 4RW4A 4CF9A 2XRIA 4CEFA 2E6MA 5T7BA 2HW3A 4F8RA 3HP9A 1RNHA 4FJ7A 1S6QA 4DQPA 3HK2A 3PUFA 1NKCA 3U3GA 4CJSA 4CJTA 3MEEA 1SV5A 4NYFA 4CJKA 1MU2A 2OPQA 3OYDA 4CK3A 5KRTA 2KQ2A 1HYZA 1BISA 1WLJA 1QQCA 4GW6A 4PA1A 4I7FA 4EZ6A 3D45A 1Q8IA 2YNHA 1EKEA 2QK9A 3F9KA 1YVUA 4RW9A 1WN7A 1BHLA 1CLQA 4ICLA 3M8RA 3NF7A 1C0TA 2D0CA 4DS4A 3T19A 3VQ7A 4CGGA 4FLYA 3PX4A 1ZBIA 4E19A 4HVJA 4O4GA 3TAPA 3VQPA 1L3TA 3KD1E 4F3OA 4HUGA 1TK0A 4J2AA 3VQ8A 1B92A 4CEDA 3AVAA 3NGZA 4AHUA 4LSLA 2DFEA 4C8MA 4AILC 2VWKA 1TK5A 3V9UA 4Z4CA 4FLZA 4O55A 3RWUA 3HPGA 1WNSA 2GBZA 4ZTFA 1XWLA 3LAMA 4CEZA 1KLNA 4FZXC 2QXFA 4AHCA 1R0AA 5KI6A 4CF1A 4N41A 3HJFA 2D0AA 2YV0X 3TAGA 1J5OA 3I0SA 2KZZA 3NAEA 3K5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTQ A;  2HMI A;  4F3T A;  1I39 A;  4CGH A;  4ZHR A;  4J2E A;  3KLI A;  1WSI A;  4H8K A;  1XHZ A;  3TAB A;  1NOZ A;  2FBV A;  3OYN A;  4DU3 A;  2R7Y A;  3VQ4 A;  3MXJ A;  4NCA A;  4Z4H A;  3LWL A;  1NK7 A;  4OGC A;  3EY1 A;  2KZM A;  3DMJ A;  5HP1 A;  4CF8 A;  1U48 A;  5D3G A;  4DSF A;  3DLR A;  5DMR A;  4IKF A;  4BAC A;  3RMC A;  4CGJ A;  3WNG A;  3KLH A;  3LDS A;  3PX6 A;  2G8U A;  4CHO A;  2ETJ A;  2GV9 A;  4PQU A;  4C8O A;  3DRS A;  4CIG A;  4KHU A;  1FKO A;  3M8Q A;  1VSF A;  1Q9Y A;  1LWC A;  4PY5 A;  4LD0 A;  3QEX A;  3UIQ A;  2DTU A;  3A2F A;  3NBP A;  4KTQ A;  3ASM A;  1BL3 A;  3LWM A;  3VA0 A;  5HRO A;  2RF2 A;  1HRH A;  4FLW A;  1RTI A;  3D0P A;  4DTJ A;  3DLH A;  2F8S A;  3TR8 A;  3HXM A;  2Q3S A;  4DG1 A;  3U3Y A;  3V9Z A;  1UOC A;  1TK8 A;  3AVJ A;  2HND A;  3AA5 X;  4IFY A;  1CXU A;  4DQQ A;  2O4G A;  2YNF A;  4BWJ A;  1O1W A;  3E01 A;  4DTP A;  4CJE A;  3P1G A;  5J1E A;  2KW4 A;  3O3F A;  4JS4 A;  3V1O A;  4EZ9 A;  1U4B A;  1QTM A;  1EX4 A;  1FK9 A;  3ZSZ A;  2X6N A;  5CYQ A;  3THV A;  3AVG A;  4F2R A;  1RT6 A;  1T8E A;  5I42 A;  3MEG A;  2G8V A;  3AVL A;  3TWH A;  1SL1 A;  1ZBH A;  4C8N A;  3IRX A;  4QCL A;  4CJR A;  3DRP A;  4OKK A;  2YHA A;  4CJL A;  4HHT A;  1G15 A;  3C6T A;  3SQ0 A;  3P5J A;  1KSP A;  3TAQ A;  1BGX T;  3VQ5 A;  1LV5 A;  4O44 A;  4RG8 A;  3SQ1 A;  3DRR A;  1CZB A;  4DFK A;  4FLX A;  1RDC A;  4DTR A;  4ID1 A;  2OPR A;  4J2B A;  1VK0 A;  1C6V A;  1FXX A;  3NF6 A;  1TL1 A;  4O0J A;  3KKS A;  4XIU A;  1RT2 A;  3O4N A;  1LAW A;  4CFD A;  2BE2 A;  1K6Y A;  4FJ5 A;  1IH7 A;  1WSF A;  3V6D A;  3HVT A;  3QES A;  4CK1 A;  4NYN A;  4YFU A;  3JSM A;  2F96 A;  4DMN A;  4C8L A;  2IAJ A;  3HPO A;  1SKS A;  1J54 A;  4KHQ A;  3LP2 A;  3S3M A;  2JGU A;  3NHG A;  1QS4 A;  1S9E A;  1W9H A;  4B9T A;  1NKE A;  3AVN A;  3K2P A;  3VQ9 A;  3VQC A;  3KLE A;  4B9V A;  4ELU A;  4KI6 A;  4IDK A;  1D9F A;  3SYZ A;  1ASV A;  5HRN A;  1TVR A;  1J9A A;  1WAJ A;  1CZ9 A;  1S5J A;  1I3A A;  1LAV A;  1Y97 A;  4LH5 A;  1KVC A;  1EXQ A;  4FCY A;  4RW8 A;  4CEA A;  3K5M A;  3SNN A;  5HRR A;  1RDA A;  4Z4E A;  1JXB A;  5FDL A;  2YNI A;  4CEO A;  1WSH A;  3NGY A;  1U47 A;  4N47 A;  4BE2 A;  4CJU A;  3S3N A;  3BGR A;  1L3S A;  2G8F A;  3ZT4 A;  1N5Y A;  4I2P A;  2PYJ A;  4CJ4 A;  3OS2 A;  1C0M A;  2RKI A;  2ZE2 A;  4FJ9 A;  1HYV A;  4M42 A;  2FBY A;  5FRM A;  4YNQ A;  4M3Z A;  3B6O A;  3QO9 A;  1JLG A;  2F8T A;  4DWI A;  1B9D A;  3PO5 A;  4TSX A;  3QNN A;  4KI4 A;  1A5X A;  4Z4I A;  3AO5 A;  4CEB A;  1IG9 A;  4KHY A;  2Y1I A;  2ZD1 A;  4FJG A;  3HPH A;  3ISN C;  2XY7 A;  3TAE A;  5HLF A;  4OGE A;  4M3X A;  1S1X A;  1VSJ A;  3KK2 A;  2Z1J A;  3VQQ A;  3DI6 A;  3B6P A;  5DK5 A;  5CZ2 A;  4FM1 A;  3F73 A;  2VG6 A;  4FK0 A;  3T1A A;  1RT7 A;  3OYE A;  4B3O A;  1J53 A;  4DFP A;  3FFI A;  2X74 A;  1S6P A;  3O4Q A;  1VSL A;  3O3H A;  4K8X A;  2IS3 A;  4I2Q A;  3ZT3 A;  4I9Q A;  4AHV A;  3V9W A;  3OVN A;  3LZJ A;  4CFC A;  1VSK A;  1RTH A;  4KV8 A;  1NK9 A;  3M8S A;  3KTQ A;  4FZY A;  2ATQ A;  4Q5V A;  4DSL A;  4PUO A;  3NH2 A;  2IGI A;  4DSE A;  3OYM A;  1TKT A;  1TAU A;  1A5V A;  3DLE A;  2QKB A;  3C95 A;  3AVF A;  1YTA A;  2B6A A;  3QIN A;  4CER A;  4KAZ A;  4Z4F A;  3ZCM A;  3G0Z A;  3OYC A;  2XHB A;  4JS5 A;  4DLG A;  3ZSY A;  1CXQ A;  3CFR A;  1Z26 A;  1UA1 A;  4E7L A;  1D9D A;  4E0D A;  1NJW A;  1RT5 A;  3P83 D;  1VSD A;  1C1C A;  1D5A A;  4B08 A;  3MED A;  1D8Y A;  4I9L A;  1X1P A;  3VQE A;  4W5Q A;  1ASW A;  5HBM A;  2FC0 A;  1WSJ A;  3OYJ A;  1L3V A;  4M3T A;  2P1J A;  4FLT A;  5CYM A;  3LZI A;  3MXI A;  1NJX A;  4F2S A;  1EET A;  2XY6 A;  4CJF A;  2E4L A;  2A1S A;  1GOB A;  4M3R A;  3ULD A;  3SPZ A;  3AO1 A;  1RBV A;  3V1R A;  4JRQ A;  4ZTJ A;  1T05 A;  3KKR A;  4CES A;  1RTD A;  3HT3 A;  4OLB A;  2KTQ A;  1ASU A;  3SPY A;  4AHS A;  2IC3 A;  3SQ2 A;  4LY7 A;  2YHB A;  4FVM A;  4E7H A;  3CFO A;  2OZS A;  4E3S A;  4NCB A;  2PZS A;  1T03 A;  1T7P A;  1RT1 A;  4IFV A;  3V9X A;  4FJJ A;  3LP1 A;  3TI0 A;  3AVH A;  2OYQ A;  1KRP A;  2VG7 A;  1KFS A;  3H08 A;  1HNV A;  3OJU A;  1TGO A;  4DFJ A;  3KJV A;  3SUO A;  3SCX A;  1TV6 A;  1HYS A;  3OY9 A;  3L2V A;  3DLK A;  3TAN A;  3RMA A;  4OLA A;  3L2Q A;  1S9G A;  4CEE A;  3OYH A;  1HQU A;  5KRS A;  2PYL A;  4BDZ A;  4FK4 A;  3CFP A;  3K5L A;  4IBN A;  4LH4 A;  3SV3 A;  1KVB A;  1S1U A;  1RIL A;  1RBR A;  4E7I A;  1XI1 A;  4CK2 A;  1RDB A;  5SWM A;  4BDP A;  1NK5 A;  1ZBL A;  3V9S A;  1JLQ A;  3NH1 A;  4G1Q A;  2Z1G A;  4DS5 A;  4CJ3 A;  3OJS A;  2B5J A;  2X6S A;  3OS1 A;  3LP0 A;  1U45 A;  1JLB A;  2G8K A;  4E89 A;  1SKR A;  4DSK A;  3AA4 A;  2OPP A;  2FBT A;  1C1B A;  3DLB A;  1JLC A;  4CIF A;  3EZ5 A;  1DLO A;  3KLF A;  4M45 A;  4AH9 A;  4DQR A;  4DTS A;  1UWB A;  3NFA A;  4E7K A;  3SUP A;  3HST B;  4FLU A;  2G8H A;  4OPJ A;  4KRE A;  5FRN A;  1RCH A;  3CYM A;  1RTJ A;  3V1Q A;  4CE9 A;  3ZSW A;  3HP6 A;  1JLA A;  3DYA A;  1L5U A;  1UA0 A;  2G8I A;  3AO2 A;  5J2P A;  2P5G A;  3AVC A;  1IKW A;  4CHZ A;  3OYL A;  4KHN A;  4W5T A;  3JYT A;  5HRS A;  4FM0 A;  2JLE A;  3DOL A;  3AVI A;  4BDY A;  4FJI A;  4B8C A;  3MAQ A;  2DY4 A;  3LAL A;  4DLE A;  2DFF A;  3IG1 A;  3ZSX A;  4CF0 A;  3NDK A;  3T3F A;  4KHW A;  1HPZ A;  2HHX A;  3SJJ A;  4FYD A;  4W5N A;  4CFA A;  1BI4 B;  3VQA A;  3NH0 A;  1QSY A;  4JLH A;  1NJZ A;  4KPY A;  2HHQ A;  3ZSO A;  3ZSV A;  4M3U A;  3K57 A;  4K8Z A;  1BIU A;  3K5N A;  3NGI A;  1FKP A;  2HB5 A;  4M3W A;  3QER A;  1IKX A;  3LPT A;  2XY8 A;  1KVA A;  3ZT1 A;  3NF8 A;  3DM2 A;  3OYG A;  3TAR A;  3QET A;  3LP3 A;  1IKY A;  4CJQ A;  3AVM A;  3VQD A;  1IKV A;  3ITH A;  4Z4G A;  3OYK A;  1ZBU A;  4EP4 A;  2EX3 A;  4OJR A;  3NE6 A;  4HUF A;  5KGW A;  3L8B A;  4DFM A;  1F21 A;  3MEC A;  4HUE A;  4DTU A;  4DTX A;  1LWF A;  1DTT A;  1GOC A;  1REV A;  2ITG A;  3K58 A;  5CY4 A;  4CJP A;  3PY8 A;  2HHT A;  3AVK A;  4O5B A;  4Z0U A;  3WNF A;  3CM5 A;  3RRG A;  1VSM A;  1UAX A;  3SUQ A;  4FW1 A;  2G8W A;  1TKD A;  1YTU A;  4MFB A;  1SKW A;  3QIO A;  4CGF A;  5JS1 A;  3LAN A;  5C25 A;  4DF4 A;  1RBU A;  1BI4 A;  2OA8 A;  3DLG A;  1KFD A;  1TKX A;  4KTZ A;  1TKZ A;  2E6L A;  5HRP A;  1BIZ A;  5C24 A;  4CEC A;  4E7J A;  1Q9X A;  2D0B A;  3L2U A;  3SUN A;  2WON A;  3HL8 A;  1ZYQ A;  3DOK A;  2IDO A;  3AO3 A;  1NK8 A;  2Z1H A;  1S1T A;  2YKM A;  2O4I A;  2HVH A;  4FJX A;  4KB1 A;  3RR8 A;  2W42 A;  1RBS A;  1RBT A;  1LW0 A;  2I5J A;  3NF9 A;  4KO0 A;  3ALY A;  5SZT A;  1NK0 A;  4GMJ B;  4CHP A;  2GUI A;  1LWE A;  3S9H A;  4CJ5 A;  3V81 A;  2IOC A;  3QEP A;  3ZT2 A;  4CJV A;  4FJ8 A;  4HTU A;  3PO4 A;  3IAY A;  3I8D A;  2HNY A;  1LW2 A;  3RTV A;  2LSN A;  3RRH A;  2RN2 A;  1Z25 A;  3G10 A;  3LAK A;  4KHS A;  1RT4 A;  4B8A B;  4QAG A;  1X9M A;  3OS0 A;  4Y1C A;  4R5P A;  4O0I A;  1VRT A;  4JRP A;  1BQM A;  3OYF A;  3KLG A;  4FJL A;  4NCG A;  4CEQ A;  4ID5 A;  4DU4 A;  3VN5 A;  3RMD A;  3VQB A;  4RW6 A;  1NK6 A;  5J2Q A;  4FLV A;  4B9S A;  3L3U A;  4OVL A;  1SUQ A;  1QSS A;  3OYB A;  4M3Y A;  2BAN A;  4L8R B;  4J2D A;  2HNZ A;  1VSI A;  1VSE A;  1WAF A;  3KK3 A;  5FRO A;  1HMV A;  2RPI A;  3AV9 A;  3TAF A;  4DSJ A;  5C42 A;  1BCM A;  4CGI A;  4CIE A;  4FZZ A;  5CZ1 A;  1BCO A;  4PWD A;  4AHT A;  4IG0 A;  1U49 A;  1KCF A;  1RDD A;  2WOM A;  3I0R A;  5JS2 A;  1XHX A;  2YNG A;  1A5W A;  3CQ8 A;  1NKB A;  3V4I A;  2BGG A;  4FJN A;  3AO4 A;  4CHN A;  4LSN A;  2HHU A;  2AJQ A;  4KTW A;  3K59 A;  3QLH A;  4Q0B A;  4DTM A;  3RMB A;  4OKE A;  1X9S A;  3BDP A;  4DSI A;  4B9U A;  4N5S A;  1VRU A;  1TAQ A;  3TAM A;  1JLF A;  4FW2 A;  1JL1 A;  5J2M A;  2EHG A;  2X78 A;  3ZSR A;  5J2N A;  3LPU A;  3QEW A;  4FJK A;  2KFN A;  1VSH A;  3HYF A;  3KIO A;  1NOY A;  1ZBF A;  1C0U A;  2PY5 A;  1JLE A;  4C8K A;  2QKK A;  4OKJ A;  3SI6 A;  4MQ3 A;  4CGD A;  4B9L A;  4DTN A;  1DTQ A;  2OZM A;  2HHV A;  2OPS A;  3VQ6 A;  3SZ2 A;  4FK2 A;  2Y1J A;  1KLM A;  4W5R A;  2FBX A;  3SV4 A;  1NJY A;  4FJM A;  3QIP A;  3AVB A;  3PV8 A;  1SL0 A;  4EP5 A;  2HVI A;  3AA3 A;  2Z1I A;  4E1N A;  4RW7 A;  3NCI A;  1SL2 A;  4DU1 A;  4DTO A;  3PX0 A;  1RT3 A;  1N6Q A;  4H4O A;  4UQG A;  4CCH A;  4ELV A;  1QE1 A;  4FJH A;  1W0H A;  1QHT A;  4BE0 A;  4FM2 A;  3QEI A;  3U6F A;  4DF8 A;  4KB0 A;  5EU7 A;  4N56 A;  4CFB A;  3ZSQ A;  1L3U A;  1U04 A;  1HJR A;  3CG7 A;  4N76 A;  3KK1 A;  5KTQ A;  2XY5 A;  2P51 A;  4AHR A;  4QOZ B;  5K14 A;  3QEV A;  1JXE A;  3MXM A;  3WNE A;  2XO7 A;  4CHY A;  3L2R A;  1B9F A;  3O3G A;  3ZT0 A;  3OYA A;  1ITG A;  2DFH A;  5KGX A;  3SQ4 A;  3HO1 A;  4B9N A;  4M41 A;  1NK4 A;  1X9W A;  2ZQB A;  2NUB A;  3QNO A;  2VWJ A;  4DQI A;  4IG3 A;  3IS9 A;  1EP4 A;  1HQE A;  2P5O A;  4OPK A;  2KFZ A;  5I3U A;  4W5O A;  4KFB A;  3M8P A;  3S3O A;  3EYZ A;  2VG5 A;  1S1W A;  3HM9 A;  3HVR A;  4KKO A;  3KD5 E;  2YKN A;  2A1R A;  1XC9 A;  1WSE A;  4B9M A;  4CF2 A;  1C1A A;  4E1M A;  1TL3 A;  2D5R A;  1YT3 A;  4CHQ A;  4BE1 A;  1HNI A;  3CM6 A;  1QSL A;  4F4K A;  4BWM A;  4KRF A;  3WNH A;  2B4J A;  2HHW A;  1IO2 A;  4Y1D A;  4ELT A;  2HHS A;  3C6U A;  4H4M A;  1S1V A;  3L3V A;  3L2W A;  3AA2 A;  2BDP A;  3C94 A;  1WSG A;  3RR7 A;  5E41 A;  4DQS A;  4FXD A;  4CJW A;  1GOA A;  4WE1 A;  4HCC A;  1JKH A;  1BQN A;  3VA3 A;  4HCB A;  1JL2 A;  4GVM A;  3OYI A;  4RW4 A;  4CF9 A;  2XRI A;  4CEF A;  2E6M A;  5T7B A;  2HW3 A;  4F8R A;  3HP9 A;  1RNH A;  4FJ7 A;  1S6Q A;  4DQP A;  3HK2 A;  3PUF A;  1NKC A;  3U3G A;  4CJS A;  4CJT A;  3MEE A;  1SV5 A;  4NYF A;  4CJK A;  1MU2 A;  2OPQ A;  3OYD A;  4CK3 A;  5KRT A;  2KQ2 A;  1HYZ A;  1BIS A;  1WLJ A;  1QQC A;  4GW6 A;  4PA1 A;  4I7F A;  4EZ6 A;  3D45 A;  1Q8I A;  2YNH A;  1EKE A;  2QK9 A;  3F9K A;  1YVU A;  4RW9 A;  1WN7 A;  1BHL A;  1CLQ A;  4ICL A;  3M8R A;  3NF7 A;  1C0T A;  2D0C A;  4DS4 A;  3T19 A;  3VQ7 A;  4CGG A;  4FLY A;  3PX4 A;  1ZBI A;  4E19 A;  4HVJ A;  4O4G A;  3TAP A;  3VQP A;  1L3T A;  3KD1 E;  4F3O A;  4HUG A;  1TK0 A;  4J2A A;  3VQ8 A;  1B92 A;  4CED A;  3AVA A;  3NGZ A;  4AHU A;  4LSL A;  2DFE A;  4C8M A;  4AIL C;  2VWK A;  1TK5 A;  3V9U A;  4Z4C A;  4FLZ A;  4O55 A;  3RWU A;  3HPG A;  1WNS A;  2GBZ A;  4ZTF A;  1XWL A;  3LAM A;  4CEZ A;  1KLN A;  4FZX C;  2QXF A;  4AHC A;  1R0A A;  5KI6 A;  4CF1 A;  4N41 A;  3HJF A;  2D0A A;  2YV0 X;  3TAG A;  1J5O A;  3I0S A;  2KZZ A;  3NAE A;  3K5O A; 
#chains in the Genus database with same CATH topology
 4A5B A;  2D1K A;  3LL3 A;  4ZHR A;  3VEZ A;  4FWM A;  1WSI A;  1NLV A;  3VQ4 A;  3MXJ A;  3LWL A;  3CCE N;  4DUZ K;  3EY1 A;  4X64 K;  5HP1 A;  3FE1 A;  4CF8 A;  5D3G A;  4IKF A;  2E2O A;  2P9L A;  3RMC A;  5C15 A;  2RHK A;  3KLH A;  4BR0 A;  2ZF5 O;  1VQ6 N;  4CHO A;  3SAG A;  3OHR A;  1TYQ A;  1VSF A;  1Q9Y A;  3OTO K;  5JLH A;  4LD0 A;  3QEX A;  4PY5 A;  2CH6 A;  3VA0 A;  2UYT A;  5HRO A;  3J7A P;  4DTJ A;  3NMU A;  3HXM A;  2Q3S A;  4DG1 A;  3NVK A;  4B1V A;  4V19 S;  3VGK A;  1CXU A;  4DQQ A;  2O4G A;  2YNF A;  1O1W A;  2HBL A;  3SJH A;  3J7Z O;  1TUY A;  3THV A;  2X6N A;  3AVG A;  2RE2 A;  1RT6 A;  5I42 A;  4QS8 A;  3BUZ B;  3AVL A;  4JEP A;  3TWH A;  1SS6 A;  4QCL A;  3ZEU B;  1GLC G;  4DCH A;  3ULE B;  4YOT A;  3TAQ A;  3VQ5 A;  5AZJ B;  2UXB K;  2NRT A;  1LV5 A;  4DV1 K;  4RG8 A;  1E4F T;  3SQ1 A;  1CZB A;  4FLX A;  1RDC A;  3F5T A;  1VK0 A;  4U67 L;  4O0J A;  1V4T A;  3RSE A;  3O4N A;  1KAZ A;  1LAW A;  1WSF A;  4CK1 A;  5AQI A;  4C8L A;  1S3X A;  1SKS A;  3FZL A;  4MLH A;  5BN8 A;  1IBK K;  1QS4 A;  1S9E A;  4JKC A;  1QVG M;  3KLE A;  3K9J A;  4IDK A;  1ASV A;  1TVR A;  1J9A A;  4LH5 A;  3BF1 A;  1LAV A;  3SNN A;  5AFU H;  4RW8 A;  5CE3 A;  1HR0 K;  4MO5 A;  5HRR A;  1JXB A;  3NGY A;  1U47 A;  4N47 A;  2GEM A;  4CZK A;  2G8F A;  1L3S A;  1N5Y A;  3WXJ A;  4LF6 K;  1LOT B;  2ZE2 A;  5FRM A;  4M42 A;  4YOR A;  4YNQ A;  3A5N C;  3AO5 A;  1IG9 A;  4QS9 A;  1NM1 A;  1VQL N;  3ZX3 A;  2ZD1 A;  1YI2 N;  3EO3 A;  4OGE A;  1S1X A;  3KK2 A;  1O13 A;  5EY4 A;  3DI6 A;  3JAM O;  4FM1 A;  3VTH A;  2YX6 A;  1D4X A;  3UKR A;  4DR1 K;  5FLX O;  1J53 A;  2X74 A;  1VSL A;  2IS3 A;  4I2Q A;  3ZT3 A;  4YY3 K;  4AHV A;  3EE8 A;  5JVH L;  4BG8 A;  1RTH A;  3F9M A;  4Q5V A;  4DSL A;  1QQN A;  5GAD P;  2UUC K;  3CME N;  1A5V A;  4H0P A;  2QKB A;  3LDO A;  3VMF B;  4DUY K;  2VYP A;  2B6A A;  4KAZ A;  2W6L A;  3OYC A;  1UA1 A;  4E0D A;  3VEX A;  4H0Y B;  5BRH A;  3CXC M;  1NJW A;  3P83 D;  2QWM A;  3N4P A;  1VSD A;  3MED A;  3VQE A;  1QZ5 A;  2FC0 A;  3OW2 M;  4K41 A;  1L3V A;  3A5L C;  2P1J A;  4FLT A;  5CYM A;  3LZI A;  1T6D A;  1NJX A;  2E4L A;  4BC4 A;  2A40 A;  3ZX0 A;  3AO1 A;  3KKR A;  4CES A;  5EVZ A;  4A62 A;  1ASU A;  2ZGZ A;  5DM7 L;  4IOX A;  3SQ2 A;  2YHB A;  4M7Y A;  3M6G A;  4E3S A;  4FJJ A;  3HI0 A;  4ILH A;  1EQY A;  1OH6 A;  1TGO A;  3KJV A;  2A42 A;  4FOE A;  3OY9 A;  3DLK A;  3MCA B;  3UKU A;  4BG9 A;  3L2Q A;  2F8T A;  2IVN A;  1RIL A;  1NK5 A;  4JI6 K;  4BRN A;  4G1Q A;  2Z1G A;  4CJ3 A;  3PIP L;  2X6S A;  2G8K A;  1SKR A;  1C1B A;  1JLC A;  3SAF A;  4AH9 A;  4DQR A;  4DTS A;  4M7X A;  3HST B;  5FRN A;  4YOV A;  3CYM A;  3GOI A;  3ZSW A;  5LY3 A;  4DR6 K;  3I8B A;  1UA0 A;  4IO8 A;  5HRS A;  3T1H K;  1MWM A;  2F7T A;  3AVI A;  4DV3 K;  4BDY A;  4FJI A;  4AM6 A;  3MAQ A;  3LAL A;  3IG1 A;  1KD1 O;  3T3F A;  5AQL A;  4W5N A;  3VQA A;  3GE1 A;  3NH0 A;  4KPY A;  3LDP A;  1NJZ A;  2P9P A;  3ZSO A;  2QW9 A;  4JKA A;  4K8Z A;  5AQW A;  3TSQ A;  1FKP A;  2HB5 A;  1IKX A;  4BRM A;  1IKY A;  1T3V A;  3VQD A;  1IKV A;  3OYK A;  1ZBU A;  3QDK A;  5KGW A;  4BY9 C;  3L8B A;  2HBJ A;  1XNQ K;  4BRH A;  2NLX A;  2HHT A;  5CY4 A;  4CJP A;  2GWJ A;  4O5B A;  3CM5 A;  3SUQ A;  2QI2 A;  1SKW A;  2OCE A;  5C25 A;  2V51 B;  2KHO A;  2IVO A;  3VES A;  1TKX A;  4WQ4 A;  1DGK N;  4H5W A;  3CJB A;  3E9O A;  4BRF A;  4NLB A;  5HL7 L;  1ZYQ A;  2V7Z A;  1U6Z A;  3LM9 A;  3G71 N;  3AO3 A;  1NK8 A;  3RR8 A;  2W42 A;  1C0G A;  3NF9 A;  5SZT A;  3R9P A;  1NK0 A;  2E8A A;  1R59 O;  3S9H A;  3V81 A;  2IOC A;  3ZT2 A;  4FJ8 A;  4X66 K;  3ZX2 A;  3I8D A;  1SQK A;  1ZC6 A;  4BRK A;  1Z25 A;  3D2E B;  1KXP A;  1YUW A;  4Y1C A;  4NXN K;  1YF5 L;  4LF5 K;  4FJL A;  4NCG A;  4BRL A;  2O8E B;  2QWN A;  3VET A;  3QML A;  5AQS A;  3TPQ A;  3O80 A;  3UKU B;  3HOS A;  2I7N A;  4M3Y A;  2V7Y A;  3WQU A;  1X9J A;  4J2D A;  2HNZ A;  3WUH A;  1HMV A;  2RPI A;  4CGI A;  4CIE A;  4AHT A;  1RDD A;  3I0R A;  1NKB A;  3V4I A;  4JKD A;  1IBM K;  2NRR A;  4CHN A;  4X65 K;  2WTU A;  4OPH A;  4KTW A;  3K59 A;  4DTM A;  5AQO A;  1X9S A;  4OKE A;  3BDP A;  2FSJ A;  4B9U A;  2DPN A;  3SAH A;  4N5S A;  3THW A;  1HNX K;  2QWL A;  1Q82 O;  4JHD B;  2EHG A;  2X78 A;  5M1P A;  1VSH A;  3KIO A;  1NOY A;  1JLE A;  3CF5 L;  4JI8 K;  2YJF A;  4DTN A;  2OZM A;  3GG4 A;  2Y1J A;  3SV4 A;  3WT0 A;  3QIP A;  3O9R A;  2HVI A;  4E1N A;  1SL2 A;  4BRI A;  4DTO A;  5AQJ A;  1N6Q A;  4H4O A;  1QE1 A;  3CJ9 A;  1W0H A;  4FM2 A;  3U6F A;  5BN9 A;  5DM6 L;  3J81 O;  3B8A X;  3KK1 A;  4QOZ B;  2P51 A;  4AHR A;  4CHY A;  2HMP A;  2CGJ A;  3HZ6 A;  4M41 A;  5MLC Q;  1YHQ N;  3QNO A;  4EFH A;  2P9S A;  1HQE A;  4OPK A;  3P38 A;  4X62 K;  3WXI A;  2P9K A;  3HM9 A;  3O1W A;  3FZK A;  1XC9 A;  4JI0 K;  1E4G T;  3VGM A;  4JI1 K;  2NRZ A;  1WB9 A;  4DHY A;  1HNI A;  2A3Z A;  3L3V A;  3CCS N;  1GOA A;  1BQN A;  4HWI A;  3VA3 A;  5AQM A;  1JL2 A;  4RW4 A;  4WYB A;  4CEF A;  5LMU K;  3C7N B;  4MLE A;  2HW3 A;  4H0O A;  4F8R A;  4DQP A;  1BWF O;  2YI1 A;  2PBD A;  1MU2 A;  1WOQ A;  5GAG P;  1BIS A;  1WLJ A;  4I7F A;  3D45 A;  1Q8I A;  4DQ8 A;  1EKE A;  4DB3 A;  4JKF A;  1C0T A;  5BPN A;  4FLY A;  4CGG A;  3EEQ A;  3VQP A;  3AAQ A;  1L3T A;  3KD1 E;  5F2R A;  1TK0 A;  1BA1 A;  4LSL A;  4C8M A;  1TK5 A;  3HPG A;  2GUP A;  4PKI A;  5C2D A;  4FZX C;  1KLN A;  3WEE B;  2QXF A;  4YOU A;  5I9E B;  3C6A A;  2D0A A;  3K5O A;  1Q86 O;  3E66 A;  1I39 A;  3KLI A;  4H8K A;  1XHZ A;  3TAB A;  2O8F A;  5IT9 O;  5AQN A;  1EWR A;  3T69 A;  4KH5 A;  4BR9 A;  1NK7 A;  1K9M O;  3A0I X;  4BR7 A;  3NVM A;  2E2N A;  3VF2 A;  3LDS A;  3PX6 A;  4O8K A;  1YIT N;  2BUP A;  2ETJ A;  4C8O A;  4KHU A;  3L4I A;  1LWC A;  3FFK B;  3NBP A;  1NGF A;  4KTQ A;  1BL3 A;  4A2A A;  2RF2 A;  3DLH A;  1RTI A;  3BZK A;  3TSP A;  3THX B;  4FWN A;  1TK8 A;  4IFY A;  1J5E K;  1BOT O;  1QHA A;  4CJE A;  4JS4 A;  3V1O A;  5CYQ A;  4F2R A;  3I33 A;  4OO1 J;  2D0O A;  4A57 A;  2Q1N A;  1SL1 A;  4CBW A;  5TKW A;  4CJR A;  4WQ5 A;  1G15 A;  4HHT A;  3DRR A;  2ZWH A;  4J2B A;  2OPR A;  3HTV A;  5AQF A;  4CI6 A;  3EZW A;  3H46 O;  4FJ5 A;  3FGU A;  3V6D A;  5KPR A;  4JKG B;  3QES A;  5AQK A;  1NJI O;  2UXC K;  4CZH A;  3W3D A;  2JGU A;  5ELZ A;  3ZEU A;  3AVN A;  3K2P A;  3VQ9 A;  3VQC A;  2YJE A;  3ULE A;  5AZJ A;  5HRN A;  3CJ1 A;  4WCE L;  4FCY A;  3MDQ A;  2OTJ N;  3K5M A;  3GDQ A;  3Q7B A;  4JNE A;  3N4Q A;  3ZYY X;  4BE2 A;  4CJU A;  4C1N K;  3S3N A;  4I2P A;  2PYJ A;  2RKI A;  1HYV A;  4A59 A;  3QO9 A;  5HOO A;  4TSX A;  2P9U B;  2E1Y A;  1KC8 O;  4FJG A;  2XY7 A;  3TAE A;  1VSJ A;  4FPA A;  4IO9 L;  2A6A A;  5DK5 A;  5CZ2 A;  3H3O B;  4ILG B;  4FWQ A;  4FK0 A;  2YHX A;  2ZJP L;  1HX1 A;  3FFI A;  3EN9 A;  1S6P A;  3O4Q A;  1NG9 A;  5IWA K;  1VSK A;  2OAN A;  4KV8 A;  1NK9 A;  1YVN A;  3CCU N;  4ILJ A;  3C95 A;  4U7B A;  1HLU A;  1BU6 O;  3QIN A;  5AQP A;  4FWL A;  2E2Q A;  1GLL O;  3G0Z A;  2XHB A;  4JS5 A;  4DLG A;  3ZSY A;  3CFR A;  1D9D A;  3DXK B;  1C1C A;  4IWV A;  1NGJ A;  4B08 A;  4I9L A;  1N32 K;  3J7Y P;  2QA4 N;  1WSJ A;  1FW6 A;  4F2S A;  2AA4 A;  1MDU B;  3MXI A;  1EET A;  4AQY K;  1HKC A;  4I6M B;  3MN6 A;  4Y0W A;  1GOB A;  4M3R A;  3ULD A;  2KTQ A;  1KAY A;  4FWO A;  4LY7 A;  3CFO A;  4NCB A;  1YIJ N;  2PZS A;  1RT1 A;  4IFV A;  4BRP A;  4GV6 A;  1NU0 A;  3C0B A;  4B1W B;  2OYQ A;  4K0K K;  2P9N B;  4DFJ A;  1HNV A;  3SUO A;  3OA9 A;  1TV6 A;  3CC7 N;  4IXC A;  3L2V A;  3TAN A;  3RMA A;  4OLA A;  5TKY A;  3OYH A;  1T6C A;  3SV3 A;  4IBN A;  4LH4 A;  1SAZ A;  4BDP A;  2HST A;  4JK9 A;  4PQU A;  3P31 A;  2ASO A;  3V9S A;  3NH1 A;  3C6H A;  1ZBL A;  3L4Q A;  3OJS A;  3OS1 A;  1G99 A;  4LF4 K;  1OH7 A;  3D2F B;  3EZ5 A;  1UWB A;  1YJN N;  4KBO A;  4FLU A;  5BPL A;  4CE9 A;  3DYA A;  3WXM B;  5J2P A;  3OYL A;  4KHN A;  3JYT A;  3VER A;  2Q0R A;  3SK3 A;  3DOL A;  3ZSX A;  3NDK A;  4KHW A;  3ID8 A;  1HPZ A;  4FYD A;  3ID6 A;  1GLJ O;  2HF3 A;  5GIO A;  2HOE A;  3K5N A;  3CQY A;  4HTL A;  4J8F A;  3LPT A;  2XY8 A;  3VEO A;  3NF8 A;  3DM2 A;  3OYG A;  1HKB A;  3QET A;  4CJQ A;  3EL2 A;  4HUF A;  1F21 A;  4HUE A;  4DTU A;  4DTX A;  1GOC A;  1REV A;  2ITG A;  4L3Q A;  4DR5 K;  4JI4 K;  3WNF A;  3RRG A;  1YTU A;  4WFB L;  4JK8 A;  4FW1 A;  2G8W A;  3EKU A;  3QIO A;  4CGF A;  5JS1 A;  1V4S A;  3MN9 A;  4WFA L;  4IEE A;  5FPM A;  1NMD A;  5HRP A;  3M5R A;  4CEC A;  1Q9X A;  3U4L A;  1VQ7 N;  3HL8 A;  5C12 A;  2VGM A;  2E5L K;  3HBT A;  4FJX A;  5FPE A;  1RBT A;  4GMJ B;  4DKW A;  4GKJ K;  4FWP A;  4NLC A;  5ADX A;  1LW2 A;  3RTV A;  2LSN A;  3RRH A;  3G10 A;  4KHS A;  1X9M A;  2HBK A;  3OS0 A;  1KAX A;  2UU9 K;  4XH4 A;  4JRP A;  3OYF A;  4DU4 A;  3VN5 A;  3RMD A;  2EWS A;  4MO4 A;  5M1N A;  1QSS A;  3O4W A;  3OYB A;  3W0L A;  4L8R B;  3MN5 A;  3EE9 A;  3MN7 A;  5FRO A;  5KPT A;  1N36 K;  4H5T A;  4PWD A;  5CZ1 A;  4IG0 A;  2WOM A;  5JS2 A;  3CQ8 A;  1A5W A;  2GEL A;  2BGG A;  3AO4 A;  4IOA L;  2QEX N;  3CCL N;  4PHT X;  3RMB A;  3D2E A;  3CCQ N;  4BC3 A;  2Q0U A;  1JLF A;  2O8E A;  4FW2 A;  1BA0 A;  5J2N A;  4FJK A;  4RCH A;  1J6Z A;  1XQS C;  1C0U A;  1S72 N;  3SI6 A;  3U9Z A;  4R79 A;  4CGD A;  5C2F A;  1Y64 A;  2GX9 A;  2HHV A;  2OPS A;  2E88 A;  4JAX A;  1P90 A;  4W5R A;  4H5V A;  4FJM A;  3U8X A;  1SL0 A;  5M1O A;  4B1U B;  3AA3 A;  4RW7 A;  3PX0 A;  1QHT A;  3QEI A;  3O6W A;  4KB0 A;  4JHD A;  3ZSQ A;  3CG7 A;  4N76 A;  5KTQ A;  2XY5 A;  1VQ4 N;  5K14 A;  3QEV A;  1JXE A;  3WNE A;  2XO7 A;  3L2R A;  3MMV A;  1ITG A;  3AGK A;  4YDU A;  1X9W A;  4B3T K;  2NUB A;  3PSF A;  4O5F A;  3PLA A;  4QS7 A;  4FL9 A;  2P5O A;  1QQM A;  1IG8 A;  3M8P A;  3EYZ A;  3ENH A;  4KKO A;  4B9M A;  3BY5 A;  3P39 A;  1TL3 A;  4CHQ A;  1HKG A;  4BE1 A;  3CM6 A;  4BWM A;  3TTD A;  4KRF A;  3C65 A;  2HHW A;  1S1V A;  4BRG A;  3L2W A;  2BDP A;  3C94 A;  1WSG A;  4BQZ A;  4HCC A;  1JKH A;  3SMS A;  4GVM A;  2HBM A;  2E6M A;  3HP9 A;  1S6Q A;  3PUF A;  1FJG K;  4CJK A;  5KRT A;  4GVE A;  1HYZ A;  1QQC A;  4EZ6 A;  2HF4 A;  1HNZ K;  1ESV A;  2YNH A;  3LM2 A;  4RW9 A;  1YVU A;  3NF7 A;  4DS4 A;  3T19 A;  3PX4 A;  1DKG D;  4HVJ A;  4HUG A;  4J2A A;  4CED A;  3CCR N;  2Q97 A;  3NGZ A;  3O8M A;  4FLZ A;  4DR4 K;  3DXM B;  3C7N A;  4ZTF A;  4YOY A;  3LAM A;  5E84 A;  5EOY A;  5KI6 A;  4CF1 A;  2YV0 X;  3I0S A;  2KZZ A;  3NAE A;  1KTQ A;  4O8U A;  2HMI A;  4LC9 B;  4F3T A;  4CGH A;  5C10 A;  5AZI B;  2BTF A;  4J2E A;  4EHT A;  1N33 K;  3THY A;  1NOZ A;  3OYN A;  4DU3 A;  2R7Y A;  1MWK A;  3WXK A;  4Z4H A;  2UUA K;  4OGC A;  4LF8 K;  4ISG A;  5DMR A;  3LDL A;  4BAC A;  4AM7 A;  5FPD A;  1W7A A;  2PAV A;  3WEE A;  2V52 B;  4CIG A;  3M8Q A;  1JCF A;  1ZXO A;  4JYA K;  3CJC A;  3UIQ A;  5AQT A;  2A5X A;  4DR3 K;  3ASM A;  3LWM A;  3CPW M;  4FLW A;  2F8S A;  3D0P A;  1BO5 O;  3TR8 A;  4CBU A;  3BF3 A;  4CD3 A;  2HND A;  3AA5 X;  3VPZ A;  4NXM K;  4BWJ A;  3E01 A;  5J1E A;  2KW4 A;  3O3F A;  1QTM A;  3ZSZ A;  1FK9 A;  3RVC A;  5M1F A;  3O1B A;  4CW7 B;  1ZBH A;  2FF6 A;  3DRP A;  3O9T A;  4OKK A;  4FVU A;  3SQ0 A;  3C6T A;  5H1S Q;  3CHW A;  1NMN A;  2JWK A;  2ITM A;  1YAG A;  1NGD A;  4DFK A;  1XUP O;  3THX A;  3CCM N;  1SZ2 A;  3DWL A;  4DTR A;  1GLD G;  3D6R A;  4DV6 K;  1C6V A;  1JCE A;  4BR5 A;  3NF6 A;  4GNI A;  3WXL A;  2P9I B;  5LMN K;  1RT2 A;  4CFD A;  2BE2 A;  1HUX A;  1IH7 A;  4E1J A;  4DMN A;  2J4R A;  3IFR A;  3HPO A;  1J54 A;  3LP2 A;  3S3M A;  2VWB A;  1WBD A;  3NHG A;  1W9H A;  4B9V A;  1NKE A;  3A5O C;  3IDH A;  1D9F A;  5F0X A;  1CZ9 A;  1S5J A;  4FWS A;  1Y97 A;  3H3N O;  1E3M A;  2O8B B;  5FPN A;  3MX2 A;  2YNI A;  1WSH A;  3ZT4 A;  1C0M A;  5KQD A;  2FBY A;  4M3Z A;  4JKG A;  4LF7 K;  1JLG A;  3H1Q A;  2QWR A;  1B9D A;  3PO5 A;  3QNN A;  3THY B;  4KHY A;  2Y1I A;  3ZET B;  3CJ7 A;  3ISN C;  2ZJQ L;  3E9L A;  5GIN A;  3VQQ A;  5AFU A;  3SLC A;  3F73 A;  2VG6 A;  3T1A A;  1RT7 A;  4IDH A;  3OYE A;  4DFP A;  1IBL K;  4CVN E;  4B3M K;  1ATR A;  4K8X A;  2VGN A;  1NGI A;  1GLB G;  3KVG A;  4CFC A;  4DV5 K;  3AAP A;  4K25 A;  3NH2 A;  4H0T B;  4DSE A;  3AY9 A;  3OYM A;  1TKT A;  5E26 A;  4A61 A;  5M1K A;  2P9U A;  4K42 A;  4BRA A;  4EHU A;  3CMA N;  3AVF A;  1YTA A;  4Z4F A;  1CXQ A;  1Z26 A;  3WQT A;  1RT5 A;  3OYJ A;  4M3T A;  4CBX A;  2XY6 A;  4CJF A;  1K8K B;  5AQH A;  4BC5 A;  3SPZ A;  1RBV A;  1T05 A;  4CZM A;  1RTD A;  1XMQ K;  3MCP A;  4BQL A;  4OLB A;  3SPY A;  4AHS A;  3Q7C A;  3D7E O;  4BR2 A;  2IC3 A;  4B9Q A;  2QTD A;  3ENB A;  2OZS A;  3QB0 A;  1T7P A;  4ISF A;  3V9X A;  2O8C B;  5A2Q O;  2NRW A;  3BP8 A;  3VF4 A;  1KFS A;  3DXK A;  3MWP A;  3CET A;  4CEE A;  3ATU A;  5KRS A;  2PYL A;  3CFP A;  3M1F A;  1XI1 A;  4I6M A;  1JLQ A;  4DS5 A;  2WBN A;  2B5J A;  1U45 A;  1JLB A;  4DSK A;  3AA4 A;  1VHX A;  5BPM A;  4JI2 K;  1DLO A;  1QQO A;  4M45 A;  1NGG A;  1X3N A;  3SUP A;  1W97 L;  5AQG A;  2G8H A;  4BRC A;  1RCH A;  2QM1 A;  3V1Q A;  3HP6 A;  1JLA A;  2G8I A;  4F9O A;  3AVC A;  1IKW A;  2CH5 A;  2P9N A;  4CHZ A;  4W5T A;  3EKS A;  4B8C A;  2ZM6 K;  4DLE A;  2DFF A;  4CF0 A;  3SJJ A;  3GBT A;  4CFA A;  1BI4 B;  1VQK N;  2HHQ A;  1OKJ A;  3ZLJ A;  3ZSV A;  4M3U A;  5CR4 A;  3NGI A;  1NGH A;  4M3W A;  3D2F A;  2NRV A;  1CZA N;  3T1Y K;  3TAR A;  1Q81 O;  5BRF A;  5JIC A;  3AVM A;  4EP4 A;  4DR2 K;  3TSU A;  4WQ5 C;  4JI3 K;  3MEC A;  1LWF A;  3K58 A;  3AVK A;  4Z0U A;  1Q18 A;  1UAX A;  1TKD A;  4MFB A;  4MDA A;  1S22 A;  2KKZ A;  4KTZ A;  2BH1 A;  2NNW A;  1VQM N;  2D0B A;  3L2U A;  3SUN A;  2WON A;  1BDG A;  3AAR A;  3DOK A;  1U2V B;  3MWT A;  2IVP A;  1QVF M;  2D4W A;  3KWI A;  2HVH A;  3JS6 A;  3KZB A;  4EZ9 A;  4KO0 A;  4CHP A;  5KQ8 A;  2FF3 B;  4LFA K;  3R8E A;  2I7P A;  2HNY A;  2RN2 A;  2WFB A;  3LAK A;  1RT4 A;  3M3Z A;  4QAG A;  1VQP N;  4R5P A;  1NGA A;  1VRT A;  3KLG A;  4CEQ A;  1OH8 A;  4G9Z A;  1NK6 A;  5J2Q A;  4FLV A;  4B9S A;  3L3U A;  4OVL A;  1SUQ A;  4EAH D;  5AQX A;  4BRD A;  1WAF A;  1MA9 B;  3TAF A;  4DSJ A;  1LCU A;  1BCM A;  1VQ9 N;  1KCF A;  2UXD K;  2YNG A;  4FJN A;  5AQU A;  3KHY A;  2HHU A;  4M63 C;  1C0F A;  1IJJ A;  4Q0B A;  2ZJR L;  3VF6 A;  4PL7 A;  5JMV A;  1VRU A;  4BRO A;  1TAQ A;  3TAM A;  5J2M A;  2PFU A;  2KFN A;  3QEW A;  4RWT A;  1ZBF A;  2PY5 A;  2ASM A;  2QKK A;  4OKJ A;  4KH4 A;  4MQ3 A;  1DTQ A;  3VQ6 A;  4FWR A;  3SZ2 A;  1KLM A;  2FBX A;  4BR4 A;  3K9K A;  4BVO A;  2Z1I A;  3J8A A;  4B3S K;  1RT3 A;  5BRD A;  3R1X A;  4UQG A;  4DV0 K;  4CCH A;  4AF1 A;  4FJH A;  4CZG A;  4BE0 A;  5EU7 A;  1TUU A;  4CFB A;  1L3U A;  1U04 A;  5AQV A;  1NWK A;  3LDQ A;  4KH6 A;  5BR9 A;  1OVY A;  1B9F A;  5BR8 K;  2F4V K;  1VQ8 N;  5KGX A;  3SQ4 A;  1NK4 A;  4JKE A;  1GLF O;  3IS9 A;  1ATS A;  2O8D B;  4CJ7 A;  3S3O A;  2VQF K;  3G4S N;  1S1W A;  3HVR A;  2YKN A;  2A1R A;  4CF2 A;  1C1A A;  4JD2 B;  5JVG L;  1QSL A;  4F4K A;  2F9T A;  3WNH A;  2B4J A;  1IO2 A;  4Y1D A;  5BRE A;  4ELT A;  2HHS A;  4CZF A;  5E41 A;  2QXL A;  4DQS A;  4FXD A;  4CJW A;  4HCB A;  3OYI A;  4BVP A;  4CF9 A;  4MDB A;  4KHP K;  4FJ7 A;  5AQQ A;  3HK2 A;  4CJS A;  1VQ5 N;  4CJT A;  3MEE A;  1SV5 A;  4NYF A;  3HOT A;  2OPQ A;  4CK3 A;  3FLC O;  4PKG A;  3CQX A;  3L0Q A;  4PA1 A;  3F9K A;  3IUC A;  5LL6 Z;  1BHL A;  2D0C A;  4JKH A;  3FR0 A;  3VEW A;  3A8Y A;  4FOI A;  4O4G A;  3TAP A;  4F3O A;  3HM8 A;  3VQ8 A;  4UY8 O;  1YJ9 N;  3CCV N;  3H6E A;  2VWK A;  4AIL C;  3TTF A;  4O55 A;  3MX5 A;  2P9L B;  3G6E N;  2WUS A;  3I55 N;  4AHC A;  1R0A A;  5AQR A;  4N41 A;  1M90 O;  3HJF A;  4GKK K;  1I94 K;  1TYQ B;  2CGK A;  5B8H A;  1EO1 A;  1QZ6 A;  2IIR A;  3OBY A;  2FBV A;  3JXU A;  4NCA A;  3G25 A;  1GLE G;  2VQE K;  4IJN A;  2KZM A;  3DMJ A;  1U48 A;  4DSF A;  3DLR A;  3DXM A;  5AR0 A;  4BGA A;  2E20 A;  3WNG A;  4CGJ A;  3DLL L;  5LJW A;  2G8U A;  2GV9 A;  3DRS A;  4JI5 K;  2Q31 A;  1FKO A;  2DTU A;  3A2F A;  5AQZ A;  5AZI A;  1HRH A;  3U3Y A;  3V9Z A;  2W6K A;  1UOC A;  3AVJ A;  4XEI A;  3RSE B;  4DTP A;  4BRE A;  3P1G A;  1U4B A;  1EX4 A;  4WFN L;  1ATN A;  1T8E A;  2AP1 A;  3MEG A;  2A41 A;  2G8V A;  3VEN A;  3O9Q A;  3HSC A;  4C8N A;  3IRX A;  2YHA A;  4JN4 A;  4GY2 B;  4CJL A;  1KSP A;  3P5J A;  3F2K A;  1BGX T;  4BRQ A;  3QBX A;  1K8A O;  2QWP A;  4O44 A;  2W40 A;  3FZF A;  4ID1 A;  4IEI A;  2UUB K;  1FXX A;  1TL1 A;  3KKS A;  4XIU A;  1RFQ A;  1K6Y A;  3SBG A;  1GLA G;  3QFU A;  4FWK A;  3HVT A;  3I56 N;  4NYN A;  4YFU A;  3JSM A;  2F96 A;  3E9P A;  4EIA A;  2IAJ A;  3O08 A;  4KHQ A;  5C0Y A;  4CZL A;  1NGE A;  5AQY A;  2GWK A;  4B9T A;  4KI6 A;  3SYZ A;  3VOV A;  1WAJ A;  1I3A A;  4B9N A;  1KVC A;  1EXQ A;  4CEA A;  1RDA A;  4Z4E A;  3UKR B;  5FDL A;  4DR7 K;  4CEO A;  1RDU A;  1RDW X;  1WUA A;  5M1Q A;  3OBW A;  2P9I A;  3BZC A;  4JI7 K;  3CER A;  3BGR A;  5GAH P;  4CZI A;  2CGL A;  4CJ4 A;  3OS2 A;  4FJ9 A;  3BEX A;  3QBW A;  3B6O A;  2HHH K;  4H0X B;  4DWI A;  4KI4 A;  4YDU C;  4Z4I A;  1A5X A;  1T44 A;  4CEB A;  4LFC K;  1Z05 A;  3HPH A;  3ENO A;  5HLF A;  1YXQ A;  1ZBS A;  4M3X A;  2E1Z A;  2Z1J A;  1K73 O;  3PSI A;  3B6P A;  3CPE A;  4PL8 A;  2O8B A;  2W41 A;  4B1Z A;  4B3O A;  3L6Q A;  3O3H A;  4A2B A;  3KWG A;  4I9Q A;  3V9W A;  3OVN A;  3LZJ A;  4XH1 A;  4YOW A;  3M8S A;  3KTQ A;  4FZY A;  2ATQ A;  4PUO A;  2IGI A;  3DJC A;  1TAU A;  4ISE A;  3DLE A;  4WQ4 C;  3ZET A;  4CER A;  3UB5 A;  3ZCM A;  3SBT A;  4E7L A;  5EXW A;  1D5A A;  1D8Y A;  1X1P A;  4W5Q A;  1ASW A;  5HBM A;  1NNE A;  4IZ9 A;  4GV3 A;  2Q36 A;  2A1S A;  4JRQ A;  3V1R A;  4ZTJ A;  2F9W A;  3HT3 A;  4K43 A;  2Q2R A;  3PIO L;  3LDN A;  4YHH K;  3MK6 A;  4E7H A;  4FVM A;  2H3G X;  3DAW A;  1T03 A;  1WBB A;  3LP1 A;  3TI0 A;  4WF9 L;  3AVH A;  1HNW K;  1KRP A;  1XNR K;  2NRX A;  2VG7 A;  3CD6 N;  3FZH A;  3U9D A;  2OTL N;  3H08 A;  4IFE A;  3OJU A;  3SCX A;  1HYS A;  4FSV A;  1VQN N;  4JV5 K;  1S9G A;  3CC4 N;  1HQU A;  4FK4 A;  4BDZ A;  3K5L A;  4E7I A;  4KRE A;  1S1U A;  1KVB A;  1RBR A;  1K8K A;  1RDB A;  3ATV A;  4CK2 A;  5SWM A;  4DV4 K;  2P9P B;  3LP0 A;  1CLQ A;  4E89 A;  2FBT A;  2OPP A;  3DLB A;  3H1V X;  4CIF A;  3KLF A;  2FSN A;  3O5B A;  3NFA A;  4E7K A;  1VAZ A;  1XC3 A;  4OPJ A;  3P4I A;  1RTJ A;  2O8C A;  1L5U A;  1JCG A;  3AO2 A;  2P5G A;  4FM0 A;  2ASP A;  2JLE A;  1NBW A;  1Q7Y O;  3E1Y A;  1OVQ A;  3CC2 N;  2DY4 A;  2HHX A;  2YCH A;  1QSY A;  4JLH A;  2GTD A;  4B1Y B;  2NZT A;  3K57 A;  1BIU A;  1RGI A;  1P8Z A;  1KQS M;  4OPA A;  2YHY A;  3QER A;  3ZT1 A;  1KVA A;  4H5R A;  3S41 A;  2YHW A;  1X3M A;  3O9S A;  3LP3 A;  3CJA A;  3ITH A;  4Z4G A;  4BGB A;  3NE6 A;  2EX3 A;  4OJR A;  4DFM A;  4IOC L;  1DTT A;  3PY8 A;  3VEV A;  1EWQ A;  1VSM A;  5ADX H;  3LAN A;  4DF4 A;  1RBU A;  1BI4 A;  1N34 K;  3UE5 A;  2OA8 A;  3DLG A;  3QFP A;  1KFD A;  1TKZ A;  2E6L A;  5AJ3 K;  1BIZ A;  5EX5 A;  5C24 A;  4E7J A;  4RTF D;  4H0V B;  2IDO A;  3K0S A;  4DV2 K;  1HJO A;  1S1T A;  2VCP A;  2WC9 A;  2YKM A;  2Z1H A;  2O4I A;  3SMP A;  4KB1 A;  1RBS A;  1LW0 A;  2I5J A;  3ALY A;  2GUI A;  1LWE A;  4CJ5 A;  3QEP A;  4CJV A;  4NO7 A;  4HTU A;  3PO4 A;  3IAY A;  2JWL A;  2FSK A;  4YOX A;  2FLO A;  4LF9 K;  5GIP A;  4BC2 A;  4B8A B;  3AGR A;  4O0I A;  1BQM A;  3THW B;  4ID5 A;  3VQB A;  4RW6 A;  1XMO K;  3VTI A;  2ZGY A;  2BAN A;  1U2V A;  5F1X A;  4JKB A;  3HRG A;  1VSI A;  4C1N I;  1VSE A;  3KK3 A;  3AV9 A;  4FZZ A;  5C42 A;  1NGB A;  5CHI A;  1BCO A;  1U49 A;  3O9U A;  3R3L A;  1XHX A;  4FO0 A;  4LSN A;  2D0P A;  2AJQ A;  3QLH A;  3GL1 A;  3CCJ N;  2KLA A;  4DSI A;  1VQO N;  5KPZ A;  3A5M C;  4H5N A;  1JL1 A;  3ZSR A;  3LPU A;  3HYF A;  1IV0 A;  4FPB A;  1BUP A;  3TTC A;  3KK7 A;  4C8K A;  4GV9 A;  4B9L A;  4PKH A;  2P9S B;  4FK2 A;  1NJY A;  1DEJ A;  4CZE A;  3AVB A;  3PV8 A;  2P9K B;  4EP5 A;  3J80 O;  3NCI A;  4DU1 A;  4ELV A;  4DF8 A;  3CIP A;  4N56 A;  2QWQ A;  1HPM A;  1HJR A;  4XH5 A;  4LFB K;  4OX9 K;  3MXM A;  3O3G A;  3ZT0 A;  3OYA A;  2DFH A;  3HO1 A;  4C23 A;  2ZQB A;  2VWJ A;  4DQI A;  4IG3 A;  2KFZ A;  1EP4 A;  5LJV A;  4NB4 A;  5I3U A;  4H03 B;  4W5O A;  4KFB A;  2VG5 A;  3TU5 A;  3KD5 E;  1WSE A;  4JK7 A;  4A5A A;  3FZM A;  3T7Z A;  4E1M A;  2D5R A;  1YT3 A;  3VEY A;  4B1X B;  4IJA A;  3H45 C;  1Z6R A;  1H1V A;  2NRH A;  3C6U A;  4H4M A;  4ELU A;  3RR7 A;  3AA2 A;  1YJW N;  3CI5 A;  5GAE P;  3R6M A;  4WE1 A;  2XRI A;  3VGL A;  5T7B A;  1RNH A;  4DV7 K;  1NKC A;  3U3G A;  4Z94 A;  2O8D A;  4CD1 A;  3OYD A;  3IMX A;  1JJ2 M;  2KQ2 A;  4GW6 A;  1NGC A;  4B3R K;  5JLF A;  3IKM A;  1ILY A;  3QIC A;  4JD2 A;  2QK9 A;  1WN7 A;  4ICL A;  4CZJ A;  3M8R A;  2O8F B;  1DT9 A;  2E2P A;  3VQ7 A;  1ZBI A;  4E19 A;  1N8R O;  1B92 A;  3AVA A;  4AHU A;  2DFE A;  2QWO A;  3V9U A;  4Z4C A;  3RWU A;  1OH5 A;  1WNS A;  1W2B M;  2GBZ A;  1BG3 A;  1XWL A;  4CEZ A;  2FXU A;  3TAG A;  1J5O A;  1M1K O; 
#chains in the Genus database with same CATH homology
 1KTQ A;  2HMI A;  4F3T A;  1I39 A;  4CGH A;  4ZHR A;  4J2E A;  3KLI A;  1WSI A;  4H8K A;  1XHZ A;  3TAB A;  1NOZ A;  2FBV A;  3OYN A;  4DU3 A;  2R7Y A;  3VQ4 A;  3MXJ A;  4NCA A;  4Z4H A;  3LWL A;  1NK7 A;  4OGC A;  3EY1 A;  2KZM A;  3DMJ A;  5HP1 A;  4CF8 A;  1U48 A;  5D3G A;  4DSF A;  3DLR A;  5DMR A;  4IKF A;  4BAC A;  3RMC A;  4CGJ A;  3WNG A;  3KLH A;  3LDS A;  3PX6 A;  2G8U A;  4CHO A;  2ETJ A;  2GV9 A;  4PQU A;  4C8O A;  3DRS A;  4CIG A;  4KHU A;  1FKO A;  3M8Q A;  1VSF A;  1Q9Y A;  1LWC A;  4PY5 A;  4LD0 A;  3QEX A;  3UIQ A;  2DTU A;  3A2F A;  3NBP A;  4KTQ A;  3ASM A;  1BL3 A;  3LWM A;  3VA0 A;  5HRO A;  2RF2 A;  1HRH A;  4FLW A;  1RTI A;  3D0P A;  4DTJ A;  3DLH A;  2F8S A;  3TR8 A;  3HXM A;  2Q3S A;  4DG1 A;  3U3Y A;  3V9Z A;  1UOC A;  1TK8 A;  3AVJ A;  2HND A;  3AA5 X;  4IFY A;  1CXU A;  4DQQ A;  2O4G A;  2YNF A;  4BWJ A;  1O1W A;  3E01 A;  4DTP A;  4CJE A;  3P1G A;  5J1E A;  2KW4 A;  3O3F A;  4JS4 A;  3V1O A;  4EZ9 A;  1U4B A;  1QTM A;  1EX4 A;  1FK9 A;  3ZSZ A;  2X6N A;  5CYQ A;  3THV A;  3AVG A;  4F2R A;  1RT6 A;  1T8E A;  5I42 A;  3MEG A;  2G8V A;  3AVL A;  3TWH A;  1SL1 A;  1ZBH A;  4C8N A;  3IRX A;  4QCL A;  4CJR A;  3DRP A;  4OKK A;  2YHA A;  4CJL A;  4HHT A;  1G15 A;  3C6T A;  3SQ0 A;  3P5J A;  1KSP A;  3TAQ A;  1BGX T;  3VQ5 A;  1LV5 A;  4O44 A;  4RG8 A;  3SQ1 A;  3DRR A;  1CZB A;  4DFK A;  4FLX A;  1RDC A;  4DTR A;  4ID1 A;  2OPR A;  4J2B A;  1VK0 A;  1C6V A;  1FXX A;  3NF6 A;  1TL1 A;  4O0J A;  3KKS A;  4XIU A;  1RT2 A;  3O4N A;  1LAW A;  4CFD A;  2BE2 A;  1K6Y A;  4FJ5 A;  1IH7 A;  1WSF A;  3V6D A;  3HVT A;  3QES A;  4CK1 A;  4NYN A;  4YFU A;  3JSM A;  2F96 A;  4DMN A;  4C8L A;  2IAJ A;  3HPO A;  1SKS A;  1J54 A;  4KHQ A;  3LP2 A;  3S3M A;  2JGU A;  3NHG A;  1QS4 A;  1S9E A;  1W9H A;  4B9T A;  1NKE A;  3AVN A;  3K2P A;  3VQ9 A;  3VQC A;  3KLE A;  4B9V A;  4ELU A;  4KI6 A;  4IDK A;  1D9F A;  3SYZ A;  1ASV A;  5HRN A;  1TVR A;  1J9A A;  1WAJ A;  1CZ9 A;  1S5J A;  1I3A A;  1LAV A;  1Y97 A;  4LH5 A;  1KVC A;  1EXQ A;  4FCY A;  4RW8 A;  4CEA A;  3K5M A;  3SNN A;  5HRR A;  1RDA A;  4Z4E A;  1JXB A;  5FDL A;  2YNI A;  4CEO A;  1WSH A;  3NGY A;  1U47 A;  4N47 A;  4BE2 A;  4CJU A;  3S3N A;  3BGR A;  1L3S A;  2G8F A;  3ZT4 A;  1N5Y A;  4I2P A;  2PYJ A;  4CJ4 A;  3OS2 A;  1C0M A;  2RKI A;  2ZE2 A;  4FJ9 A;  1HYV A;  4M42 A;  2FBY A;  5FRM A;  4YNQ A;  4M3Z A;  3B6O A;  3QO9 A;  1JLG A;  2F8T A;  4DWI A;  1B9D A;  3PO5 A;  4TSX A;  3QNN A;  4KI4 A;  1A5X A;  4Z4I A;  3AO5 A;  4CEB A;  1IG9 A;  4KHY A;  2Y1I A;  2ZD1 A;  4FJG A;  3HPH A;  3ISN C;  2XY7 A;  3TAE A;  5HLF A;  4OGE A;  4M3X A;  1S1X A;  1VSJ A;  3KK2 A;  2Z1J A;  3VQQ A;  3DI6 A;  3B6P A;  5DK5 A;  5CZ2 A;  4FM1 A;  3F73 A;  2VG6 A;  4FK0 A;  3T1A A;  1RT7 A;  3OYE A;  4B3O A;  1J53 A;  4DFP A;  3FFI A;  2X74 A;  1S6P A;  3O4Q A;  1VSL A;  3O3H A;  4K8X A;  2IS3 A;  4I2Q A;  3ZT3 A;  4I9Q A;  4AHV A;  3V9W A;  3OVN A;  3LZJ A;  4CFC A;  1VSK A;  1RTH A;  4KV8 A;  1NK9 A;  3M8S A;  3KTQ A;  4FZY A;  2ATQ A;  4Q5V A;  4DSL A;  4PUO A;  3NH2 A;  2IGI A;  4DSE A;  3OYM A;  1TKT A;  1TAU A;  1A5V A;  3DLE A;  2QKB A;  3C95 A;  3AVF A;  1YTA A;  2B6A A;  3QIN A;  4CER A;  4KAZ A;  4Z4F A;  3ZCM A;  3G0Z A;  3OYC A;  2XHB A;  4JS5 A;  4DLG A;  3ZSY A;  1CXQ A;  3CFR A;  1Z26 A;  1UA1 A;  4E7L A;  1D9D A;  4E0D A;  1NJW A;  1RT5 A;  3P83 D;  1VSD A;  1C1C A;  1D5A A;  4B08 A;  3MED A;  1D8Y A;  4I9L A;  1X1P A;  3VQE A;  4W5Q A;  1ASW A;  5HBM A;  2FC0 A;  1WSJ A;  3OYJ A;  1L3V A;  4M3T A;  2P1J A;  4FLT A;  5CYM A;  3LZI A;  3MXI A;  1NJX A;  4F2S A;  1EET A;  2XY6 A;  4CJF A;  2E4L A;  2A1S A;  1GOB A;  4M3R A;  3ULD A;  3SPZ A;  3AO1 A;  1RBV A;  3V1R A;  4JRQ A;  4ZTJ A;  1T05 A;  3KKR A;  4CES A;  1RTD A;  3HT3 A;  4OLB A;  2KTQ A;  1ASU A;  3SPY A;  4AHS A;  2IC3 A;  3SQ2 A;  4LY7 A;  2YHB A;  4FVM A;  4E7H A;  3CFO A;  2OZS A;  4E3S A;  4NCB A;  2PZS A;  1T03 A;  1T7P A;  1RT1 A;  4IFV A;  3V9X A;  4FJJ A;  3LP1 A;  3TI0 A;  3AVH A;  2OYQ A;  1KRP A;  2VG7 A;  1KFS A;  3H08 A;  1HNV A;  3OJU A;  1TGO A;  4DFJ A;  3KJV A;  3SUO A;  3SCX A;  1TV6 A;  1HYS A;  3OY9 A;  3L2V A;  3DLK A;  3TAN A;  3RMA A;  4OLA A;  3L2Q A;  1S9G A;  4CEE A;  3OYH A;  1HQU A;  5KRS A;  2PYL A;  4BDZ A;  4FK4 A;  3CFP A;  3K5L A;  4IBN A;  4LH4 A;  3SV3 A;  1KVB A;  1S1U A;  1RIL A;  1RBR A;  4E7I A;  1XI1 A;  4CK2 A;  1RDB A;  5SWM A;  4BDP A;  1NK5 A;  1ZBL A;  3V9S A;  1JLQ A;  3NH1 A;  4G1Q A;  2Z1G A;  4DS5 A;  4CJ3 A;  3OJS A;  2B5J A;  2X6S A;  3OS1 A;  3LP0 A;  1U45 A;  1JLB A;  2G8K A;  4E89 A;  1SKR A;  4DSK A;  3AA4 A;  2OPP A;  2FBT A;  1C1B A;  3DLB A;  1JLC A;  4CIF A;  3EZ5 A;  1DLO A;  3KLF A;  4M45 A;  4AH9 A;  4DQR A;  4DTS A;  1UWB A;  3NFA A;  4E7K A;  3SUP A;  3HST B;  4FLU A;  2G8H A;  4OPJ A;  4KRE A;  5FRN A;  1RCH A;  3CYM A;  1RTJ A;  3V1Q A;  4CE9 A;  3ZSW A;  3HP6 A;  1JLA A;  3DYA A;  1L5U A;  1UA0 A;  2G8I A;  3AO2 A;  5J2P A;  2P5G A;  3AVC A;  1IKW A;  4CHZ A;  3OYL A;  4KHN A;  4W5T A;  3JYT A;  5HRS A;  4FM0 A;  2JLE A;  3DOL A;  3AVI A;  4BDY A;  4FJI A;  4B8C A;  3MAQ A;  2DY4 A;  3LAL A;  4DLE A;  2DFF A;  3IG1 A;  3ZSX A;  4CF0 A;  3NDK A;  3T3F A;  4KHW A;  1HPZ A;  2HHX A;  3SJJ A;  4FYD A;  4W5N A;  4CFA A;  1BI4 B;  3VQA A;  3NH0 A;  1QSY A;  4JLH A;  1NJZ A;  4KPY A;  2HHQ A;  3ZSO A;  3ZSV A;  4M3U A;  3K57 A;  4K8Z A;  1BIU A;  3K5N A;  3NGI A;  1FKP A;  2HB5 A;  4M3W A;  3QER A;  1IKX A;  3LPT A;  2XY8 A;  1KVA A;  3ZT1 A;  3NF8 A;  3DM2 A;  3OYG A;  3TAR A;  3QET A;  3LP3 A;  1IKY A;  4CJQ A;  3AVM A;  3VQD A;  1IKV A;  3ITH A;  4Z4G A;  3OYK A;  1ZBU A;  4EP4 A;  2EX3 A;  4OJR A;  3NE6 A;  4HUF A;  5KGW A;  3L8B A;  4DFM A;  1F21 A;  3MEC A;  4HUE A;  4DTU A;  4DTX A;  1LWF A;  1DTT A;  1GOC A;  1REV A;  2ITG A;  3K58 A;  5CY4 A;  4CJP A;  3PY8 A;  2HHT A;  3AVK A;  4O5B A;  4Z0U A;  3WNF A;  3CM5 A;  3RRG A;  1VSM A;  1UAX A;  3SUQ A;  4FW1 A;  2G8W A;  1TKD A;  1YTU A;  4MFB A;  1SKW A;  3QIO A;  4CGF A;  5JS1 A;  3LAN A;  5C25 A;  4DF4 A;  1RBU A;  1BI4 A;  2OA8 A;  3DLG A;  1KFD A;  1TKX A;  4KTZ A;  1TKZ A;  2E6L A;  5HRP A;  1BIZ A;  5C24 A;  4CEC A;  4E7J A;  1Q9X A;  2D0B A;  3L2U A;  3SUN A;  2WON A;  3HL8 A;  1ZYQ A;  3DOK A;  2IDO A;  3AO3 A;  1NK8 A;  2Z1H A;  1S1T A;  2YKM A;  2O4I A;  2HVH A;  4FJX A;  4KB1 A;  3RR8 A;  2W42 A;  1RBS A;  1RBT A;  1LW0 A;  2I5J A;  3NF9 A;  4KO0 A;  3ALY A;  5SZT A;  1NK0 A;  4GMJ B;  4CHP A;  2GUI A;  1LWE A;  3S9H A;  4CJ5 A;  3V81 A;  2IOC A;  3QEP A;  3ZT2 A;  4CJV A;  4FJ8 A;  4HTU A;  3PO4 A;  3IAY A;  3I8D A;  2HNY A;  1LW2 A;  3RTV A;  2LSN A;  3RRH A;  2RN2 A;  1Z25 A;  3G10 A;  3LAK A;  4KHS A;  1RT4 A;  4B8A B;  4QAG A;  1X9M A;  3OS0 A;  4Y1C A;  4R5P A;  4O0I A;  1VRT A;  4JRP A;  1BQM A;  3OYF A;  3KLG A;  4FJL A;  4NCG A;  4CEQ A;  4ID5 A;  4DU4 A;  3VN5 A;  3RMD A;  3VQB A;  4RW6 A;  1NK6 A;  5J2Q A;  4FLV A;  4B9S A;  3L3U A;  4OVL A;  1SUQ A;  1QSS A;  3OYB A;  4M3Y A;  2BAN A;  4L8R B;  4J2D A;  2HNZ A;  1VSI A;  1VSE A;  1WAF A;  3KK3 A;  5FRO A;  1HMV A;  2RPI A;  3AV9 A;  3TAF A;  4DSJ A;  5C42 A;  1BCM A;  4CGI A;  4CIE A;  4FZZ A;  5CZ1 A;  1BCO A;  4PWD A;  4AHT A;  4IG0 A;  1U49 A;  1KCF A;  1RDD A;  2WOM A;  3I0R A;  5JS2 A;  1XHX A;  2YNG A;  1A5W A;  3CQ8 A;  1NKB A;  3V4I A;  2BGG A;  4FJN A;  3AO4 A;  4CHN A;  4LSN A;  2HHU A;  2AJQ A;  4KTW A;  3K59 A;  3QLH A;  4Q0B A;  4DTM A;  3RMB A;  4OKE A;  1X9S A;  3BDP A;  4DSI A;  4B9U A;  4N5S A;  1VRU A;  1TAQ A;  3TAM A;  1JLF A;  4FW2 A;  1JL1 A;  5J2M A;  2EHG A;  2X78 A;  3ZSR A;  5J2N A;  3LPU A;  3QEW A;  4FJK A;  2KFN A;  1VSH A;  3HYF A;  3KIO A;  1NOY A;  1ZBF A;  1C0U A;  2PY5 A;  1JLE A;  4C8K A;  2QKK A;  4OKJ A;  3SI6 A;  4MQ3 A;  4CGD A;  4B9L A;  4DTN A;  1DTQ A;  2OZM A;  2HHV A;  2OPS A;  3VQ6 A;  3SZ2 A;  4FK2 A;  2Y1J A;  1KLM A;  4W5R A;  2FBX A;  3SV4 A;  1NJY A;  4FJM A;  3QIP A;  3AVB A;  3PV8 A;  1SL0 A;  4EP5 A;  2HVI A;  3AA3 A;  2Z1I A;  4E1N A;  4RW7 A;  3NCI A;  1SL2 A;  4DU1 A;  4DTO A;  3PX0 A;  1RT3 A;  1N6Q A;  4H4O A;  4UQG A;  4CCH A;  4ELV A;  1QE1 A;  4FJH A;  1W0H A;  1QHT A;  4BE0 A;  4FM2 A;  3QEI A;  3U6F A;  4DF8 A;  4KB0 A;  5EU7 A;  4N56 A;  4CFB A;  3ZSQ A;  1L3U A;  1U04 A;  1HJR A;  3CG7 A;  4N76 A;  3KK1 A;  5KTQ A;  2XY5 A;  2P51 A;  4AHR A;  4QOZ B;  5K14 A;  3QEV A;  1JXE A;  3MXM A;  3WNE A;  2XO7 A;  4CHY A;  3L2R A;  1B9F A;  3O3G A;  3ZT0 A;  3OYA A;  1ITG A;  2DFH A;  5KGX A;  3SQ4 A;  3HO1 A;  4B9N A;  4M41 A;  1NK4 A;  1X9W A;  2ZQB A;  2NUB A;  3QNO A;  2VWJ A;  4DQI A;  4IG3 A;  3IS9 A;  1EP4 A;  1HQE A;  2P5O A;  4OPK A;  2KFZ A;  5I3U A;  4W5O A;  4KFB A;  3M8P A;  3S3O A;  3EYZ A;  2VG5 A;  1S1W A;  3HM9 A;  3HVR A;  4KKO A;  3KD5 E;  2YKN A;  2A1R A;  1XC9 A;  1WSE A;  4B9M A;  4CF2 A;  1C1A A;  4E1M A;  1TL3 A;  2D5R A;  1YT3 A;  4CHQ A;  4BE1 A;  1HNI A;  3CM6 A;  1QSL A;  4F4K A;  4BWM A;  4KRF A;  3WNH A;  2B4J A;  2HHW A;  1IO2 A;  4Y1D A;  4ELT A;  2HHS A;  3C6U A;  4H4M A;  1S1V A;  3L3V A;  3L2W A;  3AA2 A;  2BDP A;  3C94 A;  1WSG A;  3RR7 A;  5E41 A;  4DQS A;  4FXD A;  4CJW A;  1GOA A;  4WE1 A;  4HCC A;  1JKH A;  1BQN A;  3VA3 A;  4HCB A;  1JL2 A;  4GVM A;  3OYI A;  4RW4 A;  4CF9 A;  2XRI A;  4CEF A;  2E6M A;  5T7B A;  2HW3 A;  4F8R A;  3HP9 A;  1RNH A;  4FJ7 A;  1S6Q A;  4DQP A;  3HK2 A;  3PUF A;  1NKC A;  3U3G A;  4CJS A;  4CJT A;  3MEE A;  1SV5 A;  4NYF A;  4CJK A;  1MU2 A;  2OPQ A;  3OYD A;  4CK3 A;  5KRT A;  2KQ2 A;  1HYZ A;  1BIS A;  1WLJ A;  1QQC A;  4GW6 A;  4PA1 A;  4I7F A;  4EZ6 A;  3D45 A;  1Q8I A;  2YNH A;  1EKE A;  2QK9 A;  3F9K A;  1YVU A;  4RW9 A;  1WN7 A;  1BHL A;  1CLQ A;  4ICL A;  3M8R A;  3NF7 A;  1C0T A;  2D0C A;  4DS4 A;  3T19 A;  3VQ7 A;  4CGG A;  4FLY A;  3PX4 A;  1ZBI A;  4E19 A;  4HVJ A;  4O4G A;  3TAP A;  3VQP A;  1L3T A;  3KD1 E;  4F3O A;  4HUG A;  1TK0 A;  4J2A A;  3VQ8 A;  1B92 A;  4CED A;  3AVA A;  3NGZ A;  4AHU A;  4LSL A;  2DFE A;  4C8M A;  4AIL C;  2VWK A;  1TK5 A;  3V9U A;  4Z4C A;  4FLZ A;  4O55 A;  3RWU A;  3HPG A;  1WNS A;  2GBZ A;  4ZTF A;  1XWL A;  3LAM A;  4CEZ A;  1KLN A;  4FZX C;  2QXF A;  4AHC A;  1R0A A;  5KI6 A;  4CF1 A;  4N41 A;  3HJF A;  2D0A A;  2YV0 X;  3TAG A;  1J5O A;  3I0S A;  2KZZ A;  3NAE A;  3K5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...