2W6KA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
GSHMPLPIPSLLIAGIGCRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLTER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COBE
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6kA00
2W6LA 3EEQA 2W6KA 3BY5A
chains in the Genus database with same CATH superfamily
3OYLA 1HKGA 2QWLA 3MWPA 4BRGA 1X3NA 1DT9A 3WNEA 1U4BA 4BR0A 2QWQA 1U04A 1NK7A 5BPNA 3G10A 3RSEA 4X65K 3MN5A 1NGHA 1EWRA 5HROA 5AQRA 3VA0A 4JKEA 4IG0A 3MMVA 3SUNA 4ZHRA 3ITHA 4I9LA 4GVMA 5C42A 1QVFM 4DMNA 3EYZA 2E88A 3NGYA 2RE2A 1WNSA 1NGJA 1VHXA 1U48A 3ZT1A 5AJ3K 2X74A 2WC9A 3VEVA 1OH7A 1GOBA 4F2RA 1HYSA 1D5AA 2ASMA 4FLZA 5KTQA 3NF6A 3WUHA 2W42A 3UKUB 4CZFA 3QIPA 5GAHP 1Q86O 5AFUH 1ITGA 3GBTA 4KFBA 3I33A 4FWSA 1IO2A 3CC7N 3KLEA 2HHHK 4CGDA 3ZEUB 4QS9A 3HZ6A 4BRMA 2O8FB 3VERA 2O8EB 3F2KA 4HHTA 2BDPA 4FVUA 2A5XA 3OS1A 4JNEA 2IVNA 1HYZA 3PUFA 3UKRB 3ZYYX 1HR0K 1NG9A 1S9GA 4AF1A 4MLEA 3LP2A 3D0PA 3O8MA 4DS5A 1SV5A 2QXFA 2YJFA 4OGEA 1C1AA 4MO5A 4F3OA 4LF7K 4B3OA 4MDBA 3NGIA 4NCBA 2ETJA 2P9KB 1YHQN 4JK7A 4OPKA 1J5OA 3L3UA 1NJXA 1HNZK 1S6PA 2HMIA 3FZKA 3AARA 3K9KA 1XMOK 4JEPA 4E7KA 1VSKA 1XNRK 4DUYK 4YHHK 2HW3A 3TAFA 3ZSYA 1Y64A 1BI4B 3ATVA 4CI6A 3RRGA 1EKEA 1NGIA 1O1WA 3MCPA 3WEEA 3P38A 1RNHA 5J2QA 5CHIA 4CF8A 1WBBA 3VENA 4BR7A 3AVFA 3KLHA 1D9DA 1W97L 3SQ2A 4FWRA 4FJ9A 3J7YP 1TGOA 1E4GT 2YKMA 5JS2A 4CD3A 3C6HA 1ZBFA 4B8CA 2EX3A 4HTLA 3VA3A 3L3VA 3FFIA 3IG1A 4CE9A 4H5TA 1RDAA 2YHAA 4F9OA 1OH6A 4M42A 3LPTA 5CR4A 1XQSC 4DQPA 3CPWM 1DTQA 1NK5A 1WN7A 4O55A 5AQIA 1HNWK 5AZIA 4L3QA 4BR5A 3T1AA 3KD1E 3TU5A 2XY6A 4A62A 3O4WA 1KVCA 1SQKA 4FJ7A 4H03B 2I7PA 4O44A 1NJZA 1VQ8N 4DU4A 4JAXA 1KSPA 1WSJA 3EY1A 5AQMA 2F4VK 1KAZA 3KHYA 3IUCA 4LSLA 4E7IA 3SV4A 4IKFA 1S9EA 3VESA 1I3AA 4DCHA 5M1OA 4KHUA 4WE1A 2YV0X 1VSEA 1T8EA 2UXCK 1ASWA 1WSEA 3R8EA 3LM2A 1NK9A 3GG4A 4I7FA 3DRSA 3NBPA 1TK0A 4LFBK 1BCMA 3P83D 3M6GA 3ZX0A 1WLJA 3ZSOA 2VQFK 4G9ZA 4OPHA 4O8UA 1JCEA 3O1BA 4B1UB 4UQGA 2W40A 4FLVA 1BQMA 2YI1A 4KHWA 3NH2A 4KAZA 1HPZA 1QQCA 4OX9K 1HKCA 5ADXA 3LPUA 5GIOA 1QQNA 3A8YA 2QK9A 5FRNA 1KFSA 1KAYA 3ISNC 1TKTA 1VSDA 3U4LA 4EIAA 3MXIA 1J53A 4MO4A 2A1SA 4DTOA 5CZ1A 3ZSVA 2WTUA 1T7PA 2ZF5O 4IXCA 2G8FA 4M3UA 4KHQA 3VQBA 1NM1A 3U3GA 1TL1A 4DV4K 4BRFA 3THXB 3MCAB 1W7AA 4RCHA 1R59O 4BRPA 4CFCA 3T1HK 2VWJA 4PUOA 4JHDA 5EY4A 3SLCA 4YOTA 3ALYA 4O0IA 1UA1A 2GWJA 3A5NC 5IT9O 3CF5L 4H0VB 1GLJO 2FBVA 3CC2N 5AQQA 4W5RA 4KI4A 2KHOA 2GBZA 1ZBHA 3ULEB 1HQUA 4YOWA 1N33K 4CJ3A 4A5AA 4FM0A 1SZ2A 5JVHL 2ATQA 4OLAA 2HBKA 2P9LB 1UOCA 5HRNA 3UE5A 3RMDA 3EE8A 3OTOK 4WQ4C 1YJ9N 3KK2A 4Q5VA 3CIPA 1T03A 3RR7A 2XY7A 3K5OA 3LAMA 3HSTB 5EVZA 5BRFA 5DK5A 4PQUA 4DTMA 3QESA 5SWMA 3BZCA 3QB0A 4BQLA 1XHXA 2R7YA 4Z4EA 3VQ8A 5AQSA 2P5OA 4DTPA 4KB0A 1TV6A 2ZWHA 4N56A 3G0ZA 1RCHA 4ISGA 2KZMA 3FGUA 3U3YA 1XC3A 2W41A 4BACA 1X1PA 3DI6A 1ASUA 4CVNE 4BE2A 1IKWA 4DV7K 4DTJA 2P9PB 4CHZA 2HHTA 3CM6A 2G8WA 3OYGA 2YHXA 3HBTA 3WXMB 1C0TA 3VEXA 2IOCA 3EN9A 4XH5A 4DF8A 2QI2A 5BN8A 3NFAA 2WOMA 4BR4A 4DF4A 3QEXA 1XWLA 3AVAA 1T44A 1SKRA 4QCLA 2P51A 3AVIA 4XEIA 1KQSM 4AHRA 1QQMA 3A5LC 2HHSA 4YY3K 4M63C 4KHPK 3DRPA 3O1WA 5FRMA 4Y0WA 4CGGA 1VSIA 1GLCG 2D0PA 4DQQA 4DQSA 4J8FA 1RBVA 3HTVA 5HRRA 1A5VA 4DTSA 4CFBA 4M7XA 3EKSA 2AJQA 2KFNA 4H8KA 2CGKA 3V9ZA 1LAWA 2OTLN 4IEEA 1TK8A 4DQIA 5E26A 2QKKA 3LZJA 4JD2A 2Z1GA 4PY5A 4B9LA 4CHPA 5AZJA 2QA4N 3H6EA 4OPJA 1WBDA 4LFAK 1WSFA 3D6RA 2V7YA 1JKHA 5J2NA 3M5RA 3L6QA 5M1FA 1VQKN 1IH7A 4DFJA 1BHLA 4FWKA 2A40A 3QMLA 3MK6A 4BVPA 1ZBLA 3K58A 4JKGA 1U2VB 1QZ6A 3L2UA 3ASMA 3DLLL 3F9KA 4DLGA 1IKYA 3ATUA 5TKWA 4H0TB 5K14A 5CYMA 5AQVA 5C25A 4LY7A 1NNEA 4N41A 3MDQA 1J54A 3RSEB 4EHTA 3PLAA 4X64K 3OA9A 2ITMA 1FJGK 4OLBA 3AGKA 3T7ZA 5EX5A 3LWLA 3RTVA 4IDKA 2ASPA 5C2FA 2V7ZA 3WXJA 5GADP 3OY9A 1RBTA 4KHSA 5FPNA 4DV0K 3G25A 3H3OB 3OYIA 1S1WA 4A59A 5F2RA 3CJAA 2XO7A 3PIOL 2BE2A 3V9XA 2HMPA 2O4IA 4CZJA 1Q7YO 3L2WA 3H46O 4MFBA 3ZT4A 3VN5A 3ENBA 4FZZA 4FLXA 3HVTA 1L5UA 4MLHA 1N5YA 2LSNA 4DR4K 1BOTO 3KK3A 4CESA 4AHUA 4CJQA 1OH8A 3SBTA 5HOOA 4BDZA 2XHBA 2Z1HA 3QBWA 1UA0A 3O08A 4JV5K 4DKWA 4BWJA 4CJLA 1TKDA 3KD5E 3G4SN 3K0SA 4E1NA 3VQAA 4E7HA 3WT0A 3TI0A 3BF1A 3HSCA 3O80A 3VF6A 4BG9A 3ZETA 2D4WA 3CERA 4WQ5A 3K5NA 1KLNA 5KGWA 3NH0A 3PV8A 3CMEN 3KLIA 4QS7A 2RN2A 3T69A 2UUCK 3DXMA 3DLRA 4L8RB 1K9MO 3VMFB 2P9UA 3O9TA 2RKIA 3H1VX 4Z94A 2D0BA 4M45A 1SUQA 1SS6A 3CG7A 3DM2A 4B3SK 4FWQA 4H4MA 4Z0UA 3U9ZA 3SV3A 4YORA 3WEEB 1OVYA 3HM9A 1YIJN 4B08A 1LWEA 4BDYA 1G99A 3RMBA 4MQ3A 4CHYA 5M1KA 1Q9XA 1YVNA 2HBLA 3CM5A 1U49A 3H1QA 1VQ5N 3W3DA 4JK8A 1GOAA 2HB5A 2P9SB 1EWQA 5JLFA 4BROA 3A5MC 3QO9A 1NGGA 4CIEA 1WB9A 2KTQA 1MU2A 4DQRA 3DOKA 4DQ8A 3BY5A 3MN7A 1QQOA 4IFVA 5JS1A 3ENHA 2YHYA 5BN9A 3DWLA 4DR3K 4FZXC 3VGLA 4J2AA 1HYVA 5AZIB 3NCIA 1KD1O 5AR0A 1TUUA 3D2EA 3TTCA 3SPZA 3LALA 5LY3A 4CEBA 4BREA 4FLYA 3AVKA 4CJWA 1WSIA 4QOZB 4KHYA 3EZWA 2BTFA 3ZSXA 3BUZB 3VGKA 1NKEA 1K8KA 3SZ2A 4XH1A 5J2PA 4DR2K 1DGKN 1NJWA 2HF3A 3O4NA 4YDUA 1RDWX 3THWB 3P4IA 2O8DA 2FF3B 3AVMA 3CCEN 2Z1JA 2GTDA 5EOYA 4CJUA 4H0XB 4EFHA 1VRUA 1RT7A 3E66A 3FFKB 3VQ4A 3TPQA 4CK3A 1SKSA 2YNHA 2Q36A 2NUBA 1SKWA 5C10A 3SMPA 2E5LK 1JXBA 2O8CA 3AAPA 4ELUA 4C8OA 2G8VA 4E0DA 3TAPA 1C6VA 2G8HA 2F9WA 3TAEA 2AA4A 4BC5A 5GAGP 3CJ9A 5HP1A 1LAVA 1D4XA 2FBYA 3NF7A 3KJVA 3ZX2A 3QEVA 3TARA 2VYPA 3K59A 3J7AP 1LCUA 4RG8A 1CXUA 3V6DA 1NKCA 3PY8A 4CZIA 4RW8A 2E2PA 2I5JA 1VQNN 2NRZA 2FBXA 3OS0A 4Z4CA 3TABA 4CGFA 2OZSA 5BREA 4DHYA 3SYZA 3E9LA 3KZBA 1CZAN 4JHDB 3CHWA 2HOEA 2ZGYA 2B4JA 3ZSWA 4CZMA 3PX6A 1LW0A 2P9IA 4IEIA 4DTUA 1B9FA 3SI6A 1L3VA 1HX1A 1M90O 4FPAA 3S41A 3SBGA 2IGIA 3AVNA 3WNFA 3C7NA 1N32K 2YNIA 1H1VA 3F9MA 4E19A 4DSLA 4KI6A 4BRNA 4JI2K 1VQPN 3CCSN 5M1QA 4BQZA 4BG8A 4B1YB 1JCFA 1WUAA 4DSEA 1U47A 1JLAA 1KCFA 3CFRA 2A1RA 3C6TA 4M3RA 1RILA 4EHUA 4CBUA 3O3GA 2E1YA 1HPMA 4PHTX 4WQ4A 5AQJA 3VF4A 3MXJA 3WQUA 4E7JA 4TSXA 4DR7K 4IBNA 2QWNA 3HP6A 3E1YA 2HHQA 1Q81O 2Q0RA 4K43A 2OZMA 2FF6A 1C1CA 1XI1A 5EU7A 1S1UA 3C6UA 3LAKA 4EZ9A 4GKJK 1KTQA 2Q2RA 3GDQA 2UYTA 2G8KA 3HL8A 2UXBK 4FPBA 4E1MA 3CC4N 5C0YA 3ID6A 2YNFA 5FPDA 3CFOA 2KFZA 3MEEA 1KAXA 4BC2A 1ILYA 4ID5A 3IS9A 3EE9A 3MWTA 3KTQA 4KPYA 1FKOA 3IRXA 3VTIA 3H45C 3LDLA 4CBXA 4CEZA 3BZKA 1WAJA 2YX6A 3J8AA 4BRKA 3CCQN 5AQNA 1BWFO 4B1WB 1JLQA 5J1EA 3SQ1A 4IOAL 4BRCA 2OPRA 3CETA 3LDPA 1ZC6A 2VWBA 1O13A 3CMAN 3OYCA 1YF5L 3SAFA 5BR8K 4FXDA 3CYMA 1BIUA 1YT3A 2KKZA 3KKSA 4JRQA 3AA3A 4CJTA 1BU6O 4DLEA 1NMDA 2PY5A 5AQUA 1ZXOA 3OYDA 4CF1A 1IG8A 4B3TK 2Q1NA 3AVJA 4F3TA 3JSMA 4LF4K 1A5WA 2GX9A 4JD2B 3M8PA 1ASVA 1U45A 3PSIA 1J5EK 4HCCA 2KZZA 1TKXA 5LJVA 4KH6A 4HUFA 2GV9A 3AV9A 5M1PA 3QETA 4EAHD 1VQLN 1WSHA 3BDPA 3FLCO 1ATSA 2WONA 1ZBIA 2O4GA 4CJ5A 4N76A 4JKGB 3ZLJA 4RW6A 1SL0A 4OO1J 1KC8O 2F7TA 3UKUA 3QEIA 2E2NA 3HVRA 3FZLA 4DV1K 4FLTA 1B92A 4A2AA 4PKHA 3FR0A 4DFKA 4F8RA 1RT4A 2P9NA 2E20A 3ZEUA 3IKMA 3NDKA 1S5JA 3B6OA 1CXQA 4M3YA 2D0CA 3DJCA 3S3OA 5FPMA 1M1KO 1J9AA 1A5XA 1X9WA 3PSFA 1X9JA 2Y1JA 3HP9A 3UIQA 1W9HA 4RTFD 3LANA 4AH9A 2QWMA 1B9DA 2QKBA 3D7EO 4BE1A 1I94K 4AHTA 4DR6K 1BISA 3UKRA 3HT3A 3SNNA 1TK5A 1F21A 1P90A 3N4PA 2W6KA 4FYDA 1IBMK 2DTUA 3T1YK 3BF3A 3TTDA 3DLGA 4Q0BA 2WBNA 3Q7BA 4CJSA 3JS6A 3NVMA 3M8RA 1HQEA 4CJRA 3TSQA 4NXMK 3FZFA 3LDSA 3TTFA 3W0LA 4X66K 3KVGA 2P9KA 2FBTA 2I7NA 5I9EB 3SQ0A 1CZBA 4O5FA 3H08A 4CIGA 1S1VA 3CJCA 2X6SA 1RDUA 3QFUA 1NGDA 3SJHA 2FSKA 2QW9A 2ZQBA 4CGJA 1IKVA 3AO5A 4CERA 4DB3A 4FJHA 5HBMA 4JS4A 1RTJA 4WF9L 2QEXN 1BI4A 1GLLO 3THYA 3G71N 4BRHA 3P1GA 1HNXK 1FW6A 4K8ZA 4B9QA 1RDCA 2V52B 3VQ9A 1HNIA 3AO4A 3HYFA 4DR5K 3A2FA 3DAWA 5ADXH 2OCEA 4FSVA 3VPZA 1K6YA 4K42A 3K5MA 2A6AA 3DRRA 4I9QA 3VQPA 3O9QA 3SPYA 4NXNK 2PAVA 1S3XA 2F9TA 3HI0A 2VGMA 2Z1IA 4F4KA 3DXMB 3TANA 3IAYA 3OW2M 2P9UB 1VSLA 3QINA 4OKEA 1CLQA 3A0IX 4DV6K 4KH5A 4J2EA 2ZGZA 4ILGB 4Y1DA 1IKXA 3O6WA 3DOLA 3AY9A 3LDNA 4DV5K 4B1XB 4Z4IA 2J4RA 2HHVA 5AQYA 4KBOA 4NYNA 4JKAA 2E2OA 4CEDA 3VEYA 1FKPA 4B9TA 3DXKA 1BQNA 3V9UA 3ZT0A 2PYLA 2OA8A 3L2VA 4GNIA 2NRWA 3VQQA 3QICA 1YUWA 5AQZA 3NH1A 5FLXO 4FJGA 1REVA 3O5BA 4BR2A 4DTNA 4JN4A 4ZTJA 4DSFA 5CYQA 4CBWA 1LWFA 5F1XA 4HWIA 3D2EB 3B6PA 3D2FA 1VSJA 4WFAL 3RMAA 3RRHA 2E6MA 1RTHA 4E7LA 1MA9B 4CD1A 3T19A 4FJXA 4KRFA 4IOXA 5T7BA 3BEXA 3N4QA 3PX0A 1K8KB 5CE3A 1TYQA 3KK7A 4LH4A 3WQTA 3AA5X 4CZGA 3THXA 3FZHA 3DYAA 2CGLA 4PA1A 3KK1A 3PO4A 5LMUK 3SK3A 4KTZA 1KRPA 1NGFA 3HK2A 2RHKA 5C24A 5C15A 4CEOA 4CEQA 3TAGA 2KQ2A 4BRIA 4RW7A 4V19S 3K57A 4ZTFA 1LOTB 1MWKA 4DR1K 4B9UA 3NHGA 1MWMA 3VGMA 1JLCA 4E89A 3V4IA 3QBXA 4NCGA 4FWMA 3MN9A 3RVCA 3CCRN 1QSSA 4B3RK 3HPHA 4Z4HA 3OJSA 4RWTA 4AM6A 4DSKA 4FL9A 4DTXA 3KKRA 3OYJA 4MDAA 4AQYK 4CF9A 2P1JA 4IJNA 5KI6A 4LD0A 4CJ4A 3L4QA 1MDUB 1HRHA 2QWPA 3M1FA 4ICLA 4LSNA 3VTHA 4PKGA 2PZSA 5KQDA 3MEGA 2RF2A 2XY5A 2NZTA 5KPZA 1NOZA 5AQXA 5FDLA 5I3UA 1E4FT 1HKBA 2HVIA 4E1JA 4JI4K 3P5JA 3Q7CA 1VQ4N 2E6LA 3GOIA 3C7NB 3FZMA 4W5TA 4LC9B 4OKJA 3SQ4A 1K8AO 1JLEA 4Z4FA 1DTTA 2D0OA 4J2BA 3CCMN 3CXCM 2QM1A 2D0AA 4FJJA 2HBJA 2QWOA 1X3MA 4IO8A 1VSHA 1N36K 1ESVA 2DY4A 1C0UA 5DMRA 3OYKA 1GLBG 1NJIO 3ZX3A 1QS4A 3M8QA 4CJKA 4DFMA 3WXIA 4C1NK 1ZYQA 3QNNA 3AVHA 3MECA 4BRLA 2OYQA 3VQ7A 2HNYA 2PYJA 2PFUA 3ULDA 2JLEA 2XRIA 1BG3A 2UUAK 5BR9A 1VSMA 2UXDK 1NGBA 3NGZA 4O4GA 3NMUA 3L2QA 1BO5O 3EL2A 5AFUA 3WNGA 5LL6Z 4CJPA 5BRDA 4NO7A 4JI1K 5JLHA 1NGCA 3C6AA 3L8BA 4HTUA 4U67L 4A57A 3AO3A 4J2DA 3OYNA 1SAZA 2F8SA 5GIPA 4BGAA 2B6AA 4K41A 4M41A 5HL7L 2BUPA 3KLGA 2A3ZA 4CF2A 3V9WA 4GVEA 3MEDA 2NRTA 3OYAA 3HPOA 5ELZA 1T05A 2HF4A 1YVUA 3SCXA 4BE0A 5KRTA 3E9OA 3ID8A 2WUSA 3LWMA 4FM2A 4F2SA 1TAQA 2CGJA 4O0JA 4WCEL 3CCLN 4E3SA 2IS3A 5M1NA 3LDQA 5AQLA 3AVGA 4BWMA 1RBSA 4EP4A 4FJMA 3QERA 1XHZA 4PKIA 1QVGM 3HJFA 3E9PA 4H4OA 3E01A 2IDOA 1YJNN 1N34K 3QIOA 2YHBA 4JRPA 2FSJA 4FK2A 3AVBA 1NK4A 1S6QA 3EKUA 4IFYA 2ZJQL 3LL3A 4K0KK 4FW1A 1BA0A 4C8KA 5EXWA 1Q8IA 4CFAA 2NLXA 4M3XA 4N47A 3NAEA 4FK0A 1KXPA 5KRSA 4CFDA 2IVPA 1ATRA 4B9MA 2F8TA 1GLAG 3L2RA 4ELTA 4O8KA 3U8XA 3AA4A 1VK0A 1KLMA 4ID1A 2ZE2A 3CJ1A 5I42A 4OPAA 4FLUA 1BA1A 3CCVN 3R9PA 4HUGA 1RGIA 4YFUA 4DFPA 2FXUA 4KTWA 2EHGA 1BCOA 4JS5A 1VSFA 3I8BA 1Z25A 3C94A 1C1BA 2GWKA 3EO3A 4ILHA 2B5JA 1SL1A 5JVGL 2P9NB 4M3ZA 1BUPA 3U6FA 4KV8A 4GV6A 1RBRA 5AQFA 4IJAA 4CCHA 3VQDA 3TSUA 4IDHA 3I0RA 1U6ZA 4IG3A 2OPQA 1QE1A 4KH4A 4C8NA 4JKCA 1TKZA 2G8UA 1C0FA 1KFDA 4CW7B 4HCBA 2WFBA 3J81O 3V81A 4BVOA 4QAGA 4WQ5C 4IO9L 3UB5A 3WNHA 1DEJA 3ZT2A 4JI3K 4CGHA 3HO1A 1JLBA 1Z26A 2O8BA 1JXEA 2FC0A 3F73A 2IC3A 4ELVA 2JGUA 1GLDG 5AQKA 1JJ2M 1YAGA 4OJRA 2BGGA 4X62K 2OPSA 1HJOA 4OKKA 3JYTA 1D8YA 4B9NA 1NLVA 4CK1A 5SZTA 4CECA 2A41A 4C8LA 1N6QA 3NF9A 1L3SA 1S1XA 4LF5K 1UAXA 1TVRA 4W5OA 5AQWA 3THYB 1EP4A 1TUYA 4FLWA 3S3MA 2YNGA 1QHTA 3C65A 1XNQK 1BIZA 1VAZA 1QSYA 3M8SA 1S1TA 3OYFA 4BC4A 3LDOA 4CZEA 1G15A 1NJYA 3RMCA 2Q97A 3A5OC 4A5BA 4RW9A 4A2BA 2P9SA 3OS2A 1ZBUA 1GLFO 2NRVA 1OKJA 3L4IA 2HHWA 4FOIA 4BRAA 3C0BA 4HUEA 4PL7A 4FWPA 1UWBA 3KWIA 2YHWA 1JL2A 4CHQA 4CZKA 1HNVA 4GV9A 2RPIA 3AGRA 1XC9A 1QSLA 2Q3SA 4FJNA 3CQ8A 4KB1A 4K8XA 3I55N 4CJVA 1T6DA 4FM1A 4G1QA 4I6MA 2QWRA 4FO0A 3QEPA 3VQEA 4KTQA 2NRHA 4FZYA 4YDUC 3U9DA 3J80O 2IIRA 3VEOA 3M3ZA 1ATNA 3D45A 3DLKA 3CI5A 5BRHA 4WYBA 3CCJN 3DXKB 3THWA 4M3TA 3NE6A 1TAUA 3ZCMA 4CIFA 3MXMA 4IZ9A 3F5TA 3OYBA 3TWHA 1OVQA 2FLOA 1I39A 2V51B 1WSGA 5AZJB 1VRTA 2ITGA 3CPEA 5C12A 3VETA 4A61A 3PX4A 2H3GX 4KHNA 2VQEK 3OBWA 2P5GA 4JI5K 4JYAK 4FK4A 2YJEA 3MAQA 2DFFA 1NBWA 4ISFA 1IJJA 1Z6RA 1C0MA 4GMJB 1QHAA 2NNWA 2VWKA 3H3NO 5AQOA 5AQTA 3AVCA 4YOYA 5LJWA 3KLFA 3D2FB 4M3WA 1X9MA 5JICA 3R6MA 4LH5A 1VQ9N 4W5QA 4IWVA 3BGRA 4I2PA 3TR8A 3VQ5A 5A2QO 4KKOA 1Q18A 5FPEA 2QXLA 3SUOA 1TYQB 2KLAA 4OVLA 4CHNA 3NF8A 1IG9A 4YOVA 1FXXA 2O8FA 4NB4A 3RR8A 2O8EA 3CJBA 3BP8A 4C8MA 3J7ZO 1HUXA 2ZJPL 4H5VA 1N8RO 3B8AX 4CGIA 2GELA 3VEZA 2D5RA 3ZSZA 3EEQA 3WXLA 3S9HA 1BDGA 5E41A 2X6NA 5HLFA 3G6EN 4W5NA 4JI0K 3R1XA 1GLEG 1RTDA 5D3GA 3K2PA 4B1VA 4JI6K 1KVAA 2YKNA 4JLHA 5MLCQ 2GUPA 5AQPA 5KQ8A 1BGXT 4IFEA 4CJEA 3I56N 2ZM6K 1EXQA 2YCHA 1Q9YA 5B8HA 4BGBA 2BH1A 5GINA 2VCPA 5TKYA 4H0OA 1NOYA 3L0QA 3VQ6A 4EP5A 4PWDA 1RDDA 5AQGA 3DMJA 1LW2A 3K5LA 2W6LA 3JXUA 2VGNA 3DLBA 4HVJA 1YI2N 4QS8A 3O9RA 5KPRA 1V4TA 4K25A 3HOTA 4RW4A 2OANA 1KVBA 2HHUA 3ZETB 3QNOA 4B8AB 1VQMN 4CJ7A 3NVKA 4C23A 1NMNA 3OYEA 2HSTA 4AHSA 4DSJA 4I2QA 4CHOA 5KPTA 4FOEA 3P39A 1T6CA 3HOSA 1S22A 2HNDA 4UY8O 4B1ZA 4B3MK 4AHVA 2IVOA 4LF6K 4JKDA 1QTMA 3SUPA 4DV3K 5GAEP 1Q82O 3LM9A 4AHCA 3IDHA 1NGAA 2UUBK 2PBDA 3FE1A 1EX4A 4BRDA 3VOVA 1YTAA 3KWGA 2ZJRL 1L3UA 4KREA 4OGCA 4DG1A 4JKBA 5BPMA 1WAFA 1QZ5A 3OVNA 4GKKK 2FSNA 3SAHA 1NKBA 4CZLA 2GUIA 2ASOA 4DWIA 3QLHA 3I8DA 3GL1A 3AO2A 5DM7L 4O5BA 4H0PA 4JK9A 2DFHA 4M7YA 3OJUA 4XH4A 3ENOA 2CH5A 5KGXA 1RDBA 2HBMA 3TAQA 4WFBL 3AAQA 3V9SA 4DS4A 4CZHA 4BDPA 1JCGA 4FWLA 4CEAA 1RFQA 2A42A 4NLCA 4Z4GA 4LFCK 1TL3A 3QEWA 1RT5A 3CQYA 2OPPA 3LP1A 4DU3A 4EZ6A 1DKGD 4GV3A 4BC3A 4CEEA 5HRSA 1JL1A 1YXQA 2F96A 3KIOA 4N5SA 2O8DB 4NLBA 2DPNA 1XMQK 2OTJN 1BL3A 1JLGA 4B9SA 3CFPA 3LP3A 1ZBSA 4AILC 3S3NA 3HXMA 4FJKA 2JWKA 3O9UA 3OBYA 3MX2A 1C0GA 5JMVA 4R79A 2D1KA 3ULEA 4CF0A 3V1RA 2O8CB 3O3FA 3O4QA 5AQHA 1E3MA 1IBLK 1GOCA 1RT1A 1WOQA 1NK0A 5J2MA 3K9JA 4ILJA 3CQXA 4JKHA 4DUZK 2UU9K 3SMSA 4FJIA 4NCAA 2VG5A 5DM6L 1RBUA 3THVA 3AA2A 1VQ7N 2P9LA 3EZ5A 3HM8A 4FWOA 4BR9A 3VF2A 1JLFA 1HLUA 5CY4A 2VG6A 1W2BM 1LV5A 4LF9K 5E84A 5H1SQ 3QDKA 4Y1CA 2Y1IA 4R5PA 1D9FA 1LWCA 2NRRA 3SJJA 3PO5A 2HNZA 3LZIA 3LP0A 4B9VA 4YOXA 3OHRA 1EO1A 2HHXA 4JKFA 3MX5A 2AP1A 4PL8A 3I0SA 1HMVA 5C2DA 4WFNL 3O3HA 4BRQA 1YITN 1IV0A 3DLHA 2EWSA 2CH6A 2P9IB 4CJFA 4BY9C 3TSPA 1NWKA 1S72N 1VQON 2E8AA 1DLOA 2E2QA 3OYMA 1Y97A 4YNQA 4FCYA 1RT2A 2E4LA 1HJRA 4YOUA 3T3FA 4CEFA 4H5WA 3ZSRA 3RWUA 1T3VA 1R0AA 2P9PA 4FWNA 4CK2A 3O9SA 5FROA 2QTDA 5IWAK 3VEWA 3ZT3A 2IAJA 4FJLA 2DFEA 2O8BB 4DSIA 4JI7K 1CZ9A 4DV2K 3HPGA 3AO1A 1OH5A 4LF8K 4GY2B 3HRGA 3JAMO 4GW6A 4DTRA 1SL2A 4U7BA 3WXKA 4H5NA 5F0XA 3R3LA 4AM7A 2ZD1A 2VG7A 4ISEA 2G8IA 1EQYA 5CZ2A 4XIUA 3SUQA 3CCUN 3AVLA 1RT3A 2Q31A 4NYFA 1YJWN 4FJ8A 3SAGA 2XY8A 3ZSQA 1NGEA 3V1QA 2X78A 4H5RA 1EETA 1W0HA 4FVMA 3IMXA 1L3TA 1NK6A 4FW2A 5BPLA 1XUPO 2Q0UA 3MN6A 1VQ6N 2GEMA 4KO0A 1P8ZA 4H0YB 4C1NI 3TAMA 1X9SA 1RT6A 1IBKK 1YTUA 1NU0A 3V1OA 3P31A 3DLEA 4DU1A 3CJ7A 1RTIA 1V4SA 3GE1A 5LMNK 4JI8K 4IOCL 3PIPL 2NRXA 1Z05A 2E1ZA 2KW4A 2HVHA 3CD6N 1U2VA 3OYHA 2JWLA 1K73O 3IFRA 3VQCA 4I6MB 1J6ZA 2BANA 1NK8A 4FJ5A 3C95A 1FK9A 3QFPA 5HRPA
chains in the Genus database with same CATH topology
2W6LA 3EEQA 2W6KA 3BY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W6L A;  3EEQ A;  2W6K A;  3BY5 A; 
#chains in the Genus database with same CATH topology
 3OYL A;  1HKG A;  2QWL A;  3MWP A;  4BRG A;  1X3N A;  1DT9 A;  3WNE A;  1U4B A;  4BR0 A;  2QWQ A;  1U04 A;  1NK7 A;  5BPN A;  3G10 A;  3RSE A;  4X65 K;  3MN5 A;  1NGH A;  1EWR A;  5HRO A;  5AQR A;  3VA0 A;  4JKE A;  4IG0 A;  3MMV A;  3SUN A;  4ZHR A;  3ITH A;  4I9L A;  4GVM A;  5C42 A;  1QVF M;  4DMN A;  3EYZ A;  2E88 A;  3NGY A;  2RE2 A;  1WNS A;  1NGJ A;  1VHX A;  1U48 A;  3ZT1 A;  5AJ3 K;  2X74 A;  2WC9 A;  3VEV A;  1OH7 A;  1GOB A;  4F2R A;  1HYS A;  1D5A A;  2ASM A;  4FLZ A;  5KTQ A;  3NF6 A;  3WUH A;  2W42 A;  3UKU B;  4CZF A;  3QIP A;  5GAH P;  1Q86 O;  5AFU H;  1ITG A;  3GBT A;  4KFB A;  3I33 A;  4FWS A;  1IO2 A;  3CC7 N;  3KLE A;  2HHH K;  4CGD A;  3ZEU B;  4QS9 A;  3HZ6 A;  4BRM A;  2O8F B;  3VER A;  2O8E B;  3F2K A;  4HHT A;  2BDP A;  4FVU A;  2A5X A;  3OS1 A;  4JNE A;  2IVN A;  1HYZ A;  3PUF A;  3UKR B;  3ZYY X;  1HR0 K;  1NG9 A;  1S9G A;  4AF1 A;  4MLE A;  3LP2 A;  3D0P A;  3O8M A;  4DS5 A;  1SV5 A;  2QXF A;  2YJF A;  4OGE A;  1C1A A;  4MO5 A;  4F3O A;  4LF7 K;  4B3O A;  4MDB A;  3NGI A;  4NCB A;  2ETJ A;  2P9K B;  1YHQ N;  4JK7 A;  4OPK A;  1J5O A;  3L3U A;  1NJX A;  1HNZ K;  1S6P A;  2HMI A;  3FZK A;  3AAR A;  3K9K A;  1XMO K;  4JEP A;  4E7K A;  1VSK A;  1XNR K;  4DUY K;  4YHH K;  2HW3 A;  3TAF A;  3ZSY A;  1Y64 A;  1BI4 B;  3ATV A;  4CI6 A;  3RRG A;  1EKE A;  1NGI A;  1O1W A;  3MCP A;  3WEE A;  3P38 A;  1RNH A;  5J2Q A;  5CHI A;  4CF8 A;  1WBB A;  3VEN A;  4BR7 A;  3AVF A;  3KLH A;  1D9D A;  1W97 L;  3SQ2 A;  4FWR A;  4FJ9 A;  3J7Y P;  1TGO A;  1E4G T;  2YKM A;  5JS2 A;  4CD3 A;  3C6H A;  1ZBF A;  4B8C A;  2EX3 A;  4HTL A;  3VA3 A;  3L3V A;  3FFI A;  3IG1 A;  4CE9 A;  4H5T A;  1RDA A;  2YHA A;  4F9O A;  1OH6 A;  4M42 A;  3LPT A;  5CR4 A;  1XQS C;  4DQP A;  3CPW M;  1DTQ A;  1NK5 A;  1WN7 A;  4O55 A;  5AQI A;  1HNW K;  5AZI A;  4L3Q A;  4BR5 A;  3T1A A;  3KD1 E;  3TU5 A;  2XY6 A;  4A62 A;  3O4W A;  1KVC A;  1SQK A;  4FJ7 A;  4H03 B;  2I7P A;  4O44 A;  1NJZ A;  1VQ8 N;  4DU4 A;  4JAX A;  1KSP A;  1WSJ A;  3EY1 A;  5AQM A;  2F4V K;  1KAZ A;  3KHY A;  3IUC A;  4LSL A;  4E7I A;  3SV4 A;  4IKF A;  1S9E A;  3VES A;  1I3A A;  4DCH A;  5M1O A;  4KHU A;  4WE1 A;  2YV0 X;  1VSE A;  1T8E A;  2UXC K;  1ASW A;  1WSE A;  3R8E A;  3LM2 A;  1NK9 A;  3GG4 A;  4I7F A;  3DRS A;  3NBP A;  1TK0 A;  4LFB K;  1BCM A;  3P83 D;  3M6G A;  3ZX0 A;  1WLJ A;  3ZSO A;  2VQF K;  4G9Z A;  4OPH A;  4O8U A;  1JCE A;  3O1B A;  4B1U B;  4UQG A;  2W40 A;  4FLV A;  1BQM A;  2YI1 A;  4KHW A;  3NH2 A;  4KAZ A;  1HPZ A;  1QQC A;  4OX9 K;  1HKC A;  5ADX A;  3LPU A;  5GIO A;  1QQN A;  3A8Y A;  2QK9 A;  5FRN A;  1KFS A;  1KAY A;  3ISN C;  1TKT A;  1VSD A;  3U4L A;  4EIA A;  3MXI A;  1J53 A;  4MO4 A;  2A1S A;  4DTO A;  5CZ1 A;  3ZSV A;  2WTU A;  1T7P A;  2ZF5 O;  4IXC A;  2G8F A;  4M3U A;  4KHQ A;  3VQB A;  1NM1 A;  3U3G A;  1TL1 A;  4DV4 K;  4BRF A;  3THX B;  3MCA B;  1W7A A;  4RCH A;  1R59 O;  4BRP A;  4CFC A;  3T1H K;  2VWJ A;  4PUO A;  4JHD A;  5EY4 A;  3SLC A;  4YOT A;  3ALY A;  4O0I A;  1UA1 A;  2GWJ A;  3A5N C;  5IT9 O;  3CF5 L;  4H0V B;  1GLJ O;  2FBV A;  3CC2 N;  5AQQ A;  4W5R A;  4KI4 A;  2KHO A;  2GBZ A;  1ZBH A;  3ULE B;  1HQU A;  4YOW A;  1N33 K;  4CJ3 A;  4A5A A;  4FM0 A;  1SZ2 A;  5JVH L;  2ATQ A;  4OLA A;  2HBK A;  2P9L B;  1UOC A;  5HRN A;  3UE5 A;  3RMD A;  3EE8 A;  3OTO K;  4WQ4 C;  1YJ9 N;  3KK2 A;  4Q5V A;  3CIP A;  1T03 A;  3RR7 A;  2XY7 A;  3K5O A;  3LAM A;  3HST B;  5EVZ A;  5BRF A;  5DK5 A;  4PQU A;  4DTM A;  3QES A;  5SWM A;  3BZC A;  3QB0 A;  4BQL A;  1XHX A;  2R7Y A;  4Z4E A;  3VQ8 A;  5AQS A;  2P5O A;  4DTP A;  4KB0 A;  1TV6 A;  2ZWH A;  4N56 A;  3G0Z A;  1RCH A;  4ISG A;  2KZM A;  3FGU A;  3U3Y A;  1XC3 A;  2W41 A;  4BAC A;  1X1P A;  3DI6 A;  1ASU A;  4CVN E;  4BE2 A;  1IKW A;  4DV7 K;  4DTJ A;  2P9P B;  4CHZ A;  2HHT A;  3CM6 A;  2G8W A;  3OYG A;  2YHX A;  3HBT A;  3WXM B;  1C0T A;  3VEX A;  2IOC A;  3EN9 A;  4XH5 A;  4DF8 A;  2QI2 A;  5BN8 A;  3NFA A;  2WOM A;  4BR4 A;  4DF4 A;  3QEX A;  1XWL A;  3AVA A;  1T44 A;  1SKR A;  4QCL A;  2P51 A;  3AVI A;  4XEI A;  1KQS M;  4AHR A;  1QQM A;  3A5L C;  2HHS A;  4YY3 K;  4M63 C;  4KHP K;  3DRP A;  3O1W A;  5FRM A;  4Y0W A;  4CGG A;  1VSI A;  1GLC G;  2D0P A;  4DQQ A;  4DQS A;  4J8F A;  1RBV A;  3HTV A;  5HRR A;  1A5V A;  4DTS A;  4CFB A;  4M7X A;  3EKS A;  2AJQ A;  2KFN A;  4H8K A;  2CGK A;  3V9Z A;  1LAW A;  2OTL N;  4IEE A;  1TK8 A;  4DQI A;  5E26 A;  2QKK A;  3LZJ A;  4JD2 A;  2Z1G A;  4PY5 A;  4B9L A;  4CHP A;  5AZJ A;  2QA4 N;  3H6E A;  4OPJ A;  1WBD A;  4LFA K;  1WSF A;  3D6R A;  2V7Y A;  1JKH A;  5J2N A;  3M5R A;  3L6Q A;  5M1F A;  1VQK N;  1IH7 A;  4DFJ A;  1BHL A;  4FWK A;  2A40 A;  3QML A;  3MK6 A;  4BVP A;  1ZBL A;  3K58 A;  4JKG A;  1U2V B;  1QZ6 A;  3L2U A;  3ASM A;  3DLL L;  3F9K A;  4DLG A;  1IKY A;  3ATU A;  5TKW A;  4H0T B;  5K14 A;  5CYM A;  5AQV A;  5C25 A;  4LY7 A;  1NNE A;  4N41 A;  3MDQ A;  1J54 A;  3RSE B;  4EHT A;  3PLA A;  4X64 K;  3OA9 A;  2ITM A;  1FJG K;  4OLB A;  3AGK A;  3T7Z A;  5EX5 A;  3LWL A;  3RTV A;  4IDK A;  2ASP A;  5C2F A;  2V7Z A;  3WXJ A;  5GAD P;  3OY9 A;  1RBT A;  4KHS A;  5FPN A;  4DV0 K;  3G25 A;  3H3O B;  3OYI A;  1S1W A;  4A59 A;  5F2R A;  3CJA A;  2XO7 A;  3PIO L;  2BE2 A;  3V9X A;  2HMP A;  2O4I A;  4CZJ A;  1Q7Y O;  3L2W A;  3H46 O;  4MFB A;  3ZT4 A;  3VN5 A;  3ENB A;  4FZZ A;  4FLX A;  3HVT A;  1L5U A;  4MLH A;  1N5Y A;  2LSN A;  4DR4 K;  1BOT O;  3KK3 A;  4CES A;  4AHU A;  4CJQ A;  1OH8 A;  3SBT A;  5HOO A;  4BDZ A;  2XHB A;  2Z1H A;  3QBW A;  1UA0 A;  3O08 A;  4JV5 K;  4DKW A;  4BWJ A;  4CJL A;  1TKD A;  3KD5 E;  3G4S N;  3K0S A;  4E1N A;  3VQA A;  4E7H A;  3WT0 A;  3TI0 A;  3BF1 A;  3HSC A;  3O80 A;  3VF6 A;  4BG9 A;  3ZET A;  2D4W A;  3CER A;  4WQ5 A;  3K5N A;  1KLN A;  5KGW A;  3NH0 A;  3PV8 A;  3CME N;  3KLI A;  4QS7 A;  2RN2 A;  3T69 A;  2UUC K;  3DXM A;  3DLR A;  4L8R B;  1K9M O;  3VMF B;  2P9U A;  3O9T A;  2RKI A;  3H1V X;  4Z94 A;  2D0B A;  4M45 A;  1SUQ A;  1SS6 A;  3CG7 A;  3DM2 A;  4B3S K;  4FWQ A;  4H4M A;  4Z0U A;  3U9Z A;  3SV3 A;  4YOR A;  3WEE B;  1OVY A;  3HM9 A;  1YIJ N;  4B08 A;  1LWE A;  4BDY A;  1G99 A;  3RMB A;  4MQ3 A;  4CHY A;  5M1K A;  1Q9X A;  1YVN A;  2HBL A;  3CM5 A;  1U49 A;  3H1Q A;  1VQ5 N;  3W3D A;  4JK8 A;  1GOA A;  2HB5 A;  2P9S B;  1EWQ A;  5JLF A;  4BRO A;  3A5M C;  3QO9 A;  1NGG A;  4CIE A;  1WB9 A;  2KTQ A;  1MU2 A;  4DQR A;  3DOK A;  4DQ8 A;  3BY5 A;  3MN7 A;  1QQO A;  4IFV A;  5JS1 A;  3ENH A;  2YHY A;  5BN9 A;  3DWL A;  4DR3 K;  4FZX C;  3VGL A;  4J2A A;  1HYV A;  5AZI B;  3NCI A;  1KD1 O;  5AR0 A;  1TUU A;  3D2E A;  3TTC A;  3SPZ A;  3LAL A;  5LY3 A;  4CEB A;  4BRE A;  4FLY A;  3AVK A;  4CJW A;  1WSI A;  4QOZ B;  4KHY A;  3EZW A;  2BTF A;  3ZSX A;  3BUZ B;  3VGK A;  1NKE A;  1K8K A;  3SZ2 A;  4XH1 A;  5J2P A;  4DR2 K;  1DGK N;  1NJW A;  2HF3 A;  3O4N A;  4YDU A;  1RDW X;  3THW B;  3P4I A;  2O8D A;  2FF3 B;  3AVM A;  3CCE N;  2Z1J A;  2GTD A;  5EOY A;  4CJU A;  4H0X B;  4EFH A;  1VRU A;  1RT7 A;  3E66 A;  3FFK B;  3VQ4 A;  3TPQ A;  4CK3 A;  1SKS A;  2YNH A;  2Q36 A;  2NUB A;  1SKW A;  5C10 A;  3SMP A;  2E5L K;  1JXB A;  2O8C A;  3AAP A;  4ELU A;  4C8O A;  2G8V A;  4E0D A;  3TAP A;  1C6V A;  2G8H A;  2F9W A;  3TAE A;  2AA4 A;  4BC5 A;  5GAG P;  3CJ9 A;  5HP1 A;  1LAV A;  1D4X A;  2FBY A;  3NF7 A;  3KJV A;  3ZX2 A;  3QEV A;  3TAR A;  2VYP A;  3K59 A;  3J7A P;  1LCU A;  4RG8 A;  1CXU A;  3V6D A;  1NKC A;  3PY8 A;  4CZI A;  4RW8 A;  2E2P A;  2I5J A;  1VQN N;  2NRZ A;  2FBX A;  3OS0 A;  4Z4C A;  3TAB A;  4CGF A;  2OZS A;  5BRE A;  4DHY A;  3SYZ A;  3E9L A;  3KZB A;  1CZA N;  4JHD B;  3CHW A;  2HOE A;  2ZGY A;  2B4J A;  3ZSW A;  4CZM A;  3PX6 A;  1LW0 A;  2P9I A;  4IEI A;  4DTU A;  1B9F A;  3SI6 A;  1L3V A;  1HX1 A;  1M90 O;  4FPA A;  3S41 A;  3SBG A;  2IGI A;  3AVN A;  3WNF A;  3C7N A;  1N32 K;  2YNI A;  1H1V A;  3F9M A;  4E19 A;  4DSL A;  4KI6 A;  4BRN A;  4JI2 K;  1VQP N;  3CCS N;  5M1Q A;  4BQZ A;  4BG8 A;  4B1Y B;  1JCF A;  1WUA A;  4DSE A;  1U47 A;  1JLA A;  1KCF A;  3CFR A;  2A1R A;  3C6T A;  4M3R A;  1RIL A;  4EHU A;  4CBU A;  3O3G A;  2E1Y A;  1HPM A;  4PHT X;  4WQ4 A;  5AQJ A;  3VF4 A;  3MXJ A;  3WQU A;  4E7J A;  4TSX A;  4DR7 K;  4IBN A;  2QWN A;  3HP6 A;  3E1Y A;  2HHQ A;  1Q81 O;  2Q0R A;  4K43 A;  2OZM A;  2FF6 A;  1C1C A;  1XI1 A;  5EU7 A;  1S1U A;  3C6U A;  3LAK A;  4EZ9 A;  4GKJ K;  1KTQ A;  2Q2R A;  3GDQ A;  2UYT A;  2G8K A;  3HL8 A;  2UXB K;  4FPB A;  4E1M A;  3CC4 N;  5C0Y A;  3ID6 A;  2YNF A;  5FPD A;  3CFO A;  2KFZ A;  3MEE A;  1KAX A;  4BC2 A;  1ILY A;  4ID5 A;  3IS9 A;  3EE9 A;  3MWT A;  3KTQ A;  4KPY A;  1FKO A;  3IRX A;  3VTI A;  3H45 C;  3LDL A;  4CBX A;  4CEZ A;  3BZK A;  1WAJ A;  2YX6 A;  3J8A A;  4BRK A;  3CCQ N;  5AQN A;  1BWF O;  4B1W B;  1JLQ A;  5J1E A;  3SQ1 A;  4IOA L;  4BRC A;  2OPR A;  3CET A;  3LDP A;  1ZC6 A;  2VWB A;  1O13 A;  3CMA N;  3OYC A;  1YF5 L;  3SAF A;  5BR8 K;  4FXD A;  3CYM A;  1BIU A;  1YT3 A;  2KKZ A;  3KKS A;  4JRQ A;  3AA3 A;  4CJT A;  1BU6 O;  4DLE A;  1NMD A;  2PY5 A;  5AQU A;  1ZXO A;  3OYD A;  4CF1 A;  1IG8 A;  4B3T K;  2Q1N A;  3AVJ A;  4F3T A;  3JSM A;  4LF4 K;  1A5W A;  2GX9 A;  4JD2 B;  3M8P A;  1ASV A;  1U45 A;  3PSI A;  1J5E K;  4HCC A;  2KZZ A;  1TKX A;  5LJV A;  4KH6 A;  4HUF A;  2GV9 A;  3AV9 A;  5M1P A;  3QET A;  4EAH D;  1VQL N;  1WSH A;  3BDP A;  3FLC O;  1ATS A;  2WON A;  1ZBI A;  2O4G A;  4CJ5 A;  4N76 A;  4JKG B;  3ZLJ A;  4RW6 A;  1SL0 A;  4OO1 J;  1KC8 O;  2F7T A;  3UKU A;  3QEI A;  2E2N A;  3HVR A;  3FZL A;  4DV1 K;  4FLT A;  1B92 A;  4A2A A;  4PKH A;  3FR0 A;  4DFK A;  4F8R A;  1RT4 A;  2P9N A;  2E20 A;  3ZEU A;  3IKM A;  3NDK A;  1S5J A;  3B6O A;  1CXQ A;  4M3Y A;  2D0C A;  3DJC A;  3S3O A;  5FPM A;  1M1K O;  1J9A A;  1A5X A;  1X9W A;  3PSF A;  1X9J A;  2Y1J A;  3HP9 A;  3UIQ A;  1W9H A;  4RTF D;  3LAN A;  4AH9 A;  2QWM A;  1B9D A;  2QKB A;  3D7E O;  4BE1 A;  1I94 K;  4AHT A;  4DR6 K;  1BIS A;  3UKR A;  3HT3 A;  3SNN A;  1TK5 A;  1F21 A;  1P90 A;  3N4P A;  2W6K A;  4FYD A;  1IBM K;  2DTU A;  3T1Y K;  3BF3 A;  3TTD A;  3DLG A;  4Q0B A;  2WBN A;  3Q7B A;  4CJS A;  3JS6 A;  3NVM A;  3M8R A;  1HQE A;  4CJR A;  3TSQ A;  4NXM K;  3FZF A;  3LDS A;  3TTF A;  3W0L A;  4X66 K;  3KVG A;  2P9K A;  2FBT A;  2I7N A;  5I9E B;  3SQ0 A;  1CZB A;  4O5F A;  3H08 A;  4CIG A;  1S1V A;  3CJC A;  2X6S A;  1RDU A;  3QFU A;  1NGD A;  3SJH A;  2FSK A;  2QW9 A;  2ZQB A;  4CGJ A;  1IKV A;  3AO5 A;  4CER A;  4DB3 A;  4FJH A;  5HBM A;  4JS4 A;  1RTJ A;  4WF9 L;  2QEX N;  1BI4 A;  1GLL O;  3THY A;  3G71 N;  4BRH A;  3P1G A;  1HNX K;  1FW6 A;  4K8Z A;  4B9Q A;  1RDC A;  2V52 B;  3VQ9 A;  1HNI A;  3AO4 A;  3HYF A;  4DR5 K;  3A2F A;  3DAW A;  5ADX H;  2OCE A;  4FSV A;  3VPZ A;  1K6Y A;  4K42 A;  3K5M A;  2A6A A;  3DRR A;  4I9Q A;  3VQP A;  3O9Q A;  3SPY A;  4NXN K;  2PAV A;  1S3X A;  2F9T A;  3HI0 A;  2VGM A;  2Z1I A;  4F4K A;  3DXM B;  3TAN A;  3IAY A;  3OW2 M;  2P9U B;  1VSL A;  3QIN A;  4OKE A;  1CLQ A;  3A0I X;  4DV6 K;  4KH5 A;  4J2E A;  2ZGZ A;  4ILG B;  4Y1D A;  1IKX A;  3O6W A;  3DOL A;  3AY9 A;  3LDN A;  4DV5 K;  4B1X B;  4Z4I A;  2J4R A;  2HHV A;  5AQY A;  4KBO A;  4NYN A;  4JKA A;  2E2O A;  4CED A;  3VEY A;  1FKP A;  4B9T A;  3DXK A;  1BQN A;  3V9U A;  3ZT0 A;  2PYL A;  2OA8 A;  3L2V A;  4GNI A;  2NRW A;  3VQQ A;  3QIC A;  1YUW A;  5AQZ A;  3NH1 A;  5FLX O;  4FJG A;  1REV A;  3O5B A;  4BR2 A;  4DTN A;  4JN4 A;  4ZTJ A;  4DSF A;  5CYQ A;  4CBW A;  1LWF A;  5F1X A;  4HWI A;  3D2E B;  3B6P A;  3D2F A;  1VSJ A;  4WFA L;  3RMA A;  3RRH A;  2E6M A;  1RTH A;  4E7L A;  1MA9 B;  4CD1 A;  3T19 A;  4FJX A;  4KRF A;  4IOX A;  5T7B A;  3BEX A;  3N4Q A;  3PX0 A;  1K8K B;  5CE3 A;  1TYQ A;  3KK7 A;  4LH4 A;  3WQT A;  3AA5 X;  4CZG A;  3THX A;  3FZH A;  3DYA A;  2CGL A;  4PA1 A;  3KK1 A;  3PO4 A;  5LMU K;  3SK3 A;  4KTZ A;  1KRP A;  1NGF A;  3HK2 A;  2RHK A;  5C24 A;  5C15 A;  4CEO A;  4CEQ A;  3TAG A;  2KQ2 A;  4BRI A;  4RW7 A;  4V19 S;  3K57 A;  4ZTF A;  1LOT B;  1MWK A;  4DR1 K;  4B9U A;  3NHG A;  1MWM A;  3VGM A;  1JLC A;  4E89 A;  3V4I A;  3QBX A;  4NCG A;  4FWM A;  3MN9 A;  3RVC A;  3CCR N;  1QSS A;  4B3R K;  3HPH A;  4Z4H A;  3OJS A;  4RWT A;  4AM6 A;  4DSK A;  4FL9 A;  4DTX A;  3KKR A;  3OYJ A;  4MDA A;  4AQY K;  4CF9 A;  2P1J A;  4IJN A;  5KI6 A;  4LD0 A;  4CJ4 A;  3L4Q A;  1MDU B;  1HRH A;  2QWP A;  3M1F A;  4ICL A;  4LSN A;  3VTH A;  4PKG A;  2PZS A;  5KQD A;  3MEG A;  2RF2 A;  2XY5 A;  2NZT A;  5KPZ A;  1NOZ A;  5AQX A;  5FDL A;  5I3U A;  1E4F T;  1HKB A;  2HVI A;  4E1J A;  4JI4 K;  3P5J A;  3Q7C A;  1VQ4 N;  2E6L A;  3GOI A;  3C7N B;  3FZM A;  4W5T A;  4LC9 B;  4OKJ A;  3SQ4 A;  1K8A O;  1JLE A;  4Z4F A;  1DTT A;  2D0O A;  4J2B A;  3CCM N;  3CXC M;  2QM1 A;  2D0A A;  4FJJ A;  2HBJ A;  2QWO A;  1X3M A;  4IO8 A;  1VSH A;  1N36 K;  1ESV A;  2DY4 A;  1C0U A;  5DMR A;  3OYK A;  1GLB G;  1NJI O;  3ZX3 A;  1QS4 A;  3M8Q A;  4CJK A;  4DFM A;  3WXI A;  4C1N K;  1ZYQ A;  3QNN A;  3AVH A;  3MEC A;  4BRL A;  2OYQ A;  3VQ7 A;  2HNY A;  2PYJ A;  2PFU A;  3ULD A;  2JLE A;  2XRI A;  1BG3 A;  2UUA K;  5BR9 A;  1VSM A;  2UXD K;  1NGB A;  3NGZ A;  4O4G A;  3NMU A;  3L2Q A;  1BO5 O;  3EL2 A;  5AFU A;  3WNG A;  5LL6 Z;  4CJP A;  5BRD A;  4NO7 A;  4JI1 K;  5JLH A;  1NGC A;  3C6A A;  3L8B A;  4HTU A;  4U67 L;  4A57 A;  3AO3 A;  4J2D A;  3OYN A;  1SAZ A;  2F8S A;  5GIP A;  4BGA A;  2B6A A;  4K41 A;  4M41 A;  5HL7 L;  2BUP A;  3KLG A;  2A3Z A;  4CF2 A;  3V9W A;  4GVE A;  3MED A;  2NRT A;  3OYA A;  3HPO A;  5ELZ A;  1T05 A;  2HF4 A;  1YVU A;  3SCX A;  4BE0 A;  5KRT A;  3E9O A;  3ID8 A;  2WUS A;  3LWM A;  4FM2 A;  4F2S A;  1TAQ A;  2CGJ A;  4O0J A;  4WCE L;  3CCL N;  4E3S A;  2IS3 A;  5M1N A;  3LDQ A;  5AQL A;  3AVG A;  4BWM A;  1RBS A;  4EP4 A;  4FJM A;  3QER A;  1XHZ A;  4PKI A;  1QVG M;  3HJF A;  3E9P A;  4H4O A;  3E01 A;  2IDO A;  1YJN N;  1N34 K;  3QIO A;  2YHB A;  4JRP A;  2FSJ A;  4FK2 A;  3AVB A;  1NK4 A;  1S6Q A;  3EKU A;  4IFY A;  2ZJQ L;  3LL3 A;  4K0K K;  4FW1 A;  1BA0 A;  4C8K A;  5EXW A;  1Q8I A;  4CFA A;  2NLX A;  4M3X A;  4N47 A;  3NAE A;  4FK0 A;  1KXP A;  5KRS A;  4CFD A;  2IVP A;  1ATR A;  4B9M A;  2F8T A;  1GLA G;  3L2R A;  4ELT A;  4O8K A;  3U8X A;  3AA4 A;  1VK0 A;  1KLM A;  4ID1 A;  2ZE2 A;  3CJ1 A;  5I42 A;  4OPA A;  4FLU A;  1BA1 A;  3CCV N;  3R9P A;  4HUG A;  1RGI A;  4YFU A;  4DFP A;  2FXU A;  4KTW A;  2EHG A;  1BCO A;  4JS5 A;  1VSF A;  3I8B A;  1Z25 A;  3C94 A;  1C1B A;  2GWK A;  3EO3 A;  4ILH A;  2B5J A;  1SL1 A;  5JVG L;  2P9N B;  4M3Z A;  1BUP A;  3U6F A;  4KV8 A;  4GV6 A;  1RBR A;  5AQF A;  4IJA A;  4CCH A;  3VQD A;  3TSU A;  4IDH A;  3I0R A;  1U6Z A;  4IG3 A;  2OPQ A;  1QE1 A;  4KH4 A;  4C8N A;  4JKC A;  1TKZ A;  2G8U A;  1C0F A;  1KFD A;  4CW7 B;  4HCB A;  2WFB A;  3J81 O;  3V81 A;  4BVO A;  4QAG A;  4WQ5 C;  4IO9 L;  3UB5 A;  3WNH A;  1DEJ A;  3ZT2 A;  4JI3 K;  4CGH A;  3HO1 A;  1JLB A;  1Z26 A;  2O8B A;  1JXE A;  2FC0 A;  3F73 A;  2IC3 A;  4ELV A;  2JGU A;  1GLD G;  5AQK A;  1JJ2 M;  1YAG A;  4OJR A;  2BGG A;  4X62 K;  2OPS A;  1HJO A;  4OKK A;  3JYT A;  1D8Y A;  4B9N A;  1NLV A;  4CK1 A;  5SZT A;  4CEC A;  2A41 A;  4C8L A;  1N6Q A;  3NF9 A;  1L3S A;  1S1X A;  4LF5 K;  1UAX A;  1TVR A;  4W5O A;  5AQW A;  3THY B;  1EP4 A;  1TUY A;  4FLW A;  3S3M A;  2YNG A;  1QHT A;  3C65 A;  1XNQ K;  1BIZ A;  1VAZ A;  1QSY A;  3M8S A;  1S1T A;  3OYF A;  4BC4 A;  3LDO A;  4CZE A;  1G15 A;  1NJY A;  3RMC A;  2Q97 A;  3A5O C;  4A5B A;  4RW9 A;  4A2B A;  2P9S A;  3OS2 A;  1ZBU A;  1GLF O;  2NRV A;  1OKJ A;  3L4I A;  2HHW A;  4FOI A;  4BRA A;  3C0B A;  4HUE A;  4PL7 A;  4FWP A;  1UWB A;  3KWI A;  2YHW A;  1JL2 A;  4CHQ A;  4CZK A;  1HNV A;  4GV9 A;  2RPI A;  3AGR A;  1XC9 A;  1QSL A;  2Q3S A;  4FJN A;  3CQ8 A;  4KB1 A;  4K8X A;  3I55 N;  4CJV A;  1T6D A;  4FM1 A;  4G1Q A;  4I6M A;  2QWR A;  4FO0 A;  3QEP A;  3VQE A;  4KTQ A;  2NRH A;  4FZY A;  4YDU C;  3U9D A;  3J80 O;  2IIR A;  3VEO A;  3M3Z A;  1ATN A;  3D45 A;  3DLK A;  3CI5 A;  5BRH A;  4WYB A;  3CCJ N;  3DXK B;  3THW A;  4M3T A;  3NE6 A;  1TAU A;  3ZCM A;  4CIF A;  3MXM A;  4IZ9 A;  3F5T A;  3OYB A;  3TWH A;  1OVQ A;  2FLO A;  1I39 A;  2V51 B;  1WSG A;  5AZJ B;  1VRT A;  2ITG A;  3CPE A;  5C12 A;  3VET A;  4A61 A;  3PX4 A;  2H3G X;  4KHN A;  2VQE K;  3OBW A;  2P5G A;  4JI5 K;  4JYA K;  4FK4 A;  2YJE A;  3MAQ A;  2DFF A;  1NBW A;  4ISF A;  1IJJ A;  1Z6R A;  1C0M A;  4GMJ B;  1QHA A;  2NNW A;  2VWK A;  3H3N O;  5AQO A;  5AQT A;  3AVC A;  4YOY A;  5LJW A;  3KLF A;  3D2F B;  4M3W A;  1X9M A;  5JIC A;  3R6M A;  4LH5 A;  1VQ9 N;  4W5Q A;  4IWV A;  3BGR A;  4I2P A;  3TR8 A;  3VQ5 A;  5A2Q O;  4KKO A;  1Q18 A;  5FPE A;  2QXL A;  3SUO A;  1TYQ B;  2KLA A;  4OVL A;  4CHN A;  3NF8 A;  1IG9 A;  4YOV A;  1FXX A;  2O8F A;  4NB4 A;  3RR8 A;  2O8E A;  3CJB A;  3BP8 A;  4C8M A;  3J7Z O;  1HUX A;  2ZJP L;  4H5V A;  1N8R O;  3B8A X;  4CGI A;  2GEL A;  3VEZ A;  2D5R A;  3ZSZ A;  3EEQ A;  3WXL A;  3S9H A;  1BDG A;  5E41 A;  2X6N A;  5HLF A;  3G6E N;  4W5N A;  4JI0 K;  3R1X A;  1GLE G;  1RTD A;  5D3G A;  3K2P A;  4B1V A;  4JI6 K;  1KVA A;  2YKN A;  4JLH A;  5MLC Q;  2GUP A;  5AQP A;  5KQ8 A;  1BGX T;  4IFE A;  4CJE A;  3I56 N;  2ZM6 K;  1EXQ A;  2YCH A;  1Q9Y A;  5B8H A;  4BGB A;  2BH1 A;  5GIN A;  2VCP A;  5TKY A;  4H0O A;  1NOY A;  3L0Q A;  3VQ6 A;  4EP5 A;  4PWD A;  1RDD A;  5AQG A;  3DMJ A;  1LW2 A;  3K5L A;  2W6L A;  3JXU A;  2VGN A;  3DLB A;  4HVJ A;  1YI2 N;  4QS8 A;  3O9R A;  5KPR A;  1V4T A;  4K25 A;  3HOT A;  4RW4 A;  2OAN A;  1KVB A;  2HHU A;  3ZET B;  3QNO A;  4B8A B;  1VQM N;  4CJ7 A;  3NVK A;  4C23 A;  1NMN A;  3OYE A;  2HST A;  4AHS A;  4DSJ A;  4I2Q A;  4CHO A;  5KPT A;  4FOE A;  3P39 A;  1T6C A;  3HOS A;  1S22 A;  2HND A;  4UY8 O;  4B1Z A;  4B3M K;  4AHV A;  2IVO A;  4LF6 K;  4JKD A;  1QTM A;  3SUP A;  4DV3 K;  5GAE P;  1Q82 O;  3LM9 A;  4AHC A;  3IDH A;  1NGA A;  2UUB K;  2PBD A;  3FE1 A;  1EX4 A;  4BRD A;  3VOV A;  1YTA A;  3KWG A;  2ZJR L;  1L3U A;  4KRE A;  4OGC A;  4DG1 A;  4JKB A;  5BPM A;  1WAF A;  1QZ5 A;  3OVN A;  4GKK K;  2FSN A;  3SAH A;  1NKB A;  4CZL A;  2GUI A;  2ASO A;  4DWI A;  3QLH A;  3I8D A;  3GL1 A;  3AO2 A;  5DM7 L;  4O5B A;  4H0P A;  4JK9 A;  2DFH A;  4M7Y A;  3OJU A;  4XH4 A;  3ENO A;  2CH5 A;  5KGX A;  1RDB A;  2HBM A;  3TAQ A;  4WFB L;  3AAQ A;  3V9S A;  4DS4 A;  4CZH A;  4BDP A;  1JCG A;  4FWL A;  4CEA A;  1RFQ A;  2A42 A;  4NLC A;  4Z4G A;  4LFC K;  1TL3 A;  3QEW A;  1RT5 A;  3CQY A;  2OPP A;  3LP1 A;  4DU3 A;  4EZ6 A;  1DKG D;  4GV3 A;  4BC3 A;  4CEE A;  5HRS A;  1JL1 A;  1YXQ A;  2F96 A;  3KIO A;  4N5S A;  2O8D B;  4NLB A;  2DPN A;  1XMQ K;  2OTJ N;  1BL3 A;  1JLG A;  4B9S A;  3CFP A;  3LP3 A;  1ZBS A;  4AIL C;  3S3N A;  3HXM A;  4FJK A;  2JWK A;  3O9U A;  3OBY A;  3MX2 A;  1C0G A;  5JMV A;  4R79 A;  2D1K A;  3ULE A;  4CF0 A;  3V1R A;  2O8C B;  3O3F A;  3O4Q A;  5AQH A;  1E3M A;  1IBL K;  1GOC A;  1RT1 A;  1WOQ A;  1NK0 A;  5J2M A;  3K9J A;  4ILJ A;  3CQX A;  4JKH A;  4DUZ K;  2UU9 K;  3SMS A;  4FJI A;  4NCA A;  2VG5 A;  5DM6 L;  1RBU A;  3THV A;  3AA2 A;  1VQ7 N;  2P9L A;  3EZ5 A;  3HM8 A;  4FWO A;  4BR9 A;  3VF2 A;  1JLF A;  1HLU A;  5CY4 A;  2VG6 A;  1W2B M;  1LV5 A;  4LF9 K;  5E84 A;  5H1S Q;  3QDK A;  4Y1C A;  2Y1I A;  4R5P A;  1D9F A;  1LWC A;  2NRR A;  3SJJ A;  3PO5 A;  2HNZ A;  3LZI A;  3LP0 A;  4B9V A;  4YOX A;  3OHR A;  1EO1 A;  2HHX A;  4JKF A;  3MX5 A;  2AP1 A;  4PL8 A;  3I0S A;  1HMV A;  5C2D A;  4WFN L;  3O3H A;  4BRQ A;  1YIT N;  1IV0 A;  3DLH A;  2EWS A;  2CH6 A;  2P9I B;  4CJF A;  4BY9 C;  3TSP A;  1NWK A;  1S72 N;  1VQO N;  2E8A A;  1DLO A;  2E2Q A;  3OYM A;  1Y97 A;  4YNQ A;  4FCY A;  1RT2 A;  2E4L A;  1HJR A;  4YOU A;  3T3F A;  4CEF A;  4H5W A;  3ZSR A;  3RWU A;  1T3V A;  1R0A A;  2P9P A;  4FWN A;  4CK2 A;  3O9S A;  5FRO A;  2QTD A;  5IWA K;  3VEW A;  3ZT3 A;  2IAJ A;  4FJL A;  2DFE A;  2O8B B;  4DSI A;  4JI7 K;  1CZ9 A;  4DV2 K;  3HPG A;  3AO1 A;  1OH5 A;  4LF8 K;  4GY2 B;  3HRG A;  3JAM O;  4GW6 A;  4DTR A;  1SL2 A;  4U7B A;  3WXK A;  4H5N A;  5F0X A;  3R3L A;  4AM7 A;  2ZD1 A;  2VG7 A;  4ISE A;  2G8I A;  1EQY A;  5CZ2 A;  4XIU A;  3SUQ A;  3CCU N;  3AVL A;  1RT3 A;  2Q31 A;  4NYF A;  1YJW N;  4FJ8 A;  3SAG A;  2XY8 A;  3ZSQ A;  1NGE A;  3V1Q A;  2X78 A;  4H5R A;  1EET A;  1W0H A;  4FVM A;  3IMX A;  1L3T A;  1NK6 A;  4FW2 A;  5BPL A;  1XUP O;  2Q0U A;  3MN6 A;  1VQ6 N;  2GEM A;  4KO0 A;  1P8Z A;  4H0Y B;  4C1N I;  3TAM A;  1X9S A;  1RT6 A;  1IBK K;  1YTU A;  1NU0 A;  3V1O A;  3P31 A;  3DLE A;  4DU1 A;  3CJ7 A;  1RTI A;  1V4S A;  3GE1 A;  5LMN K;  4JI8 K;  4IOC L;  3PIP L;  2NRX A;  1Z05 A;  2E1Z A;  2KW4 A;  2HVH A;  3CD6 N;  1U2V A;  3OYH A;  2JWL A;  1K73 O;  3IFR A;  3VQC A;  4I6M B;  1J6Z A;  2BAN A;  1NK8 A;  4FJ5 A;  3C95 A;  1FK9 A;  3QFP A;  5HRP A; 
#chains in the Genus database with same CATH homology
 2W6L A;  3EEQ A;  2W6K A;  3BY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...