2W6KA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
GSHMPLPIPSLLIAGIGCRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLTER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords COBE
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
source organism Pseudomonas aeruginosa
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6kA00
2W6KA 3EEQA 3BY5A 2W6LA
chains in the Genus database with same CATH superfamily
4OPHA 2VWKA 3SUPA 4DV5K 1KSPA 1JCGA 4ELUA 1KLNA 1YJ9N 4WE1A 3AVBA 3DXKA 3FFKB 4WFBL 3AVNA 3D2EA 2YJFA 2CH6A 4N47A 5J2PA 1VSMA 4Z4CA 3NF6A 5K14A 3NCIA 2P5OA 1YT3A 2P9KB 3ZSOA 3SZ2A 4CZLA 3AVJA 1LAVA 5EX5A 3WUHA 4A5BA 4XIUA 4Z4GA 4CFBA 4JNEA 4K41A 3VEWA 3F73A 4YHHK 2QWQA 3TAGA 1C0TA 2P9NB 3RWUA 3ZX2A 5M1OA 4DTMA 3OYAA 1QSYA 5FRNA 4KO0A 4LFBK 4ILJA 1RDDA 4WFAL 4DSEA 4C8MA 3V6DA 4DS4A 4CGFA 3LP1A 4WQ5A 3T7ZA 4BY9C 2UUAK 1RBTA 2QWOA 5E26A 4DLEA 4JKCA 3VN5A 2E1YA 3RVCA 2OZSA 3H3OB 3PX0A 2VG7A 1RBUA 4CJVA 1HKBA 4HCBA 4YDUA 3MN5A 3M3ZA 3E1YA 2V7ZA 3EE8A 4FOIA 4CF1A 4DU1A 3FGUA 2D0CA 4B3SK 3CFOA 3QEPA 4LSLA 3MCPA 2JGUA 4LH5A 4JK9A 1NGAA 1P90A 3KK2A 1DT9A 1HPZA 1IG8A 2KKZA 3IRXA 4B3TK 3AA2A 4CJTA 3Q7CA 4C8KA 2WONA 2QXLA 4R79A 3KVGA 1Z05A 2NRTA 1NGFA 3J80O 2KFNA 1GOAA 1XNQK 3SPZA 1R59O 5DM6L 3T69A 3MECA 1RT2A 3FE1A 4JI1K 4KHWA 3SNNA 1TYQA 3OS2A 4B3MK 3L0QA 1A5VA 5F2RA 3VQ9A 2YCHA 5JICA 5FROA 5HL7L 3NF7A 1J53A 2ASOA 5KGXA 1TL3A 1EETA 3SK3A 1VQ9N 3C6UA 1N36K 4YOTA 2EWSA 3KTQA 3OYNA 2HVIA 3C7NA 3CJBA 2ASPA 2ETJA 2Q36A 3LDLA 4A59A 3U9ZA 1NK5A 3ZSYA 1ZBSA 3HP6A 3ALYA 2VGMA 4ICLA 2IVNA 4NCGA 4HHTA 4OO1J 4KRFA 3R3LA 1L3SA 1M1KO 1BL3A 3MXIA 1EX4A 1YHQN 3LP2A 1WBBA 4WYBA 5TKYA 3VEOA 5EXWA 1HYZA 4Z4IA 4PA1A 2ZQBA 1BQMA 3OHRA 4OLBA 1EWQA 1S1TA 2Q0UA 1S9EA 3TSQA 3FFIA 2KLAA 3TR8A 2QKKA 1LAWA 4QCLA 3MEDA 1D9DA 2W6LA 1F21A 3DOKA 1Q18A 4KB0A 4ISEA 4W5RA 2O8FA 3R6MA 4H0TB 3HP9A 4FVMA 3FLCO 4E3SA 4CK2A 3SAHA 4JV5K 4EZ6A 3NH2A 4JS5A 4FWSA 3M8QA 2P9SB 1WAFA 4JD2A 4BR2A 1HYSA 3EKSA 4H5RA 3MN9A 1DGKN 3SQ0A 3UIQA 4BRKA 3TAEA 5AR0A 2QXFA 3CFRA 3L3VA 3VESA 3HPOA 1BA1A 1NK9A 3MWTA 1JCEA 4X62K 2D0OA 3PSIA 5M1PA 3CERA 3DLBA 4JKBA 4AHCA 4ID5A 3HVRA 3KLHA 3OS0A 3K59A 4EIAA 4FYDA 4KKOA 1XQSC 1TV6A 3WNEA 1NK4A 4EFHA 5CY4A 1JL2A 1OH8A 4HVJA 4U7BA 3QO9A 1FKOA 3SUOA 4JI8K 3OYJA 3LDQA 1TKZA 4A61A 1HPMA 3THWB 3OTOK 4O5BA 3LM2A 1NOYA 1NGIA 4KREA 4BG8A 5EU7A 4H0YB 5AQSA 3P39A 3VEYA 1R0AA 3BF3A 2VQEK 4LFAK 3CQYA 3THYB 3ZLJA 3SCXA 2G8FA 1S6QA 4PQUA 3THXA 4IFEA 4NLCA 2O8DB 4B9QA 3SJJA 1L5UA 1I39A 4BVPA 1VQNN 4BWMA 3LDSA 4DU3A 1FK9A 3H6EA 4DWIA 4PKGA 3F9KA 4FK4A 2OTJN 4BDZA 3ZX0A 1X9JA 1S72N 3OYGA 4FW2A 4FLZA 4LF5K 3VEZA 4F8RA 5KTQA 4W5QA 5FRMA 3SMPA 4CEDA 3SQ1A 5A2QO 1VSHA 3FZKA 4C8LA 2XY6A 3LZJA 1QSSA 3HPHA 1T8EA 4JKAA 4H4MA 3WT0A 4DSJA 4H5TA 3K5OA 1WAJA 4BRLA 2YHBA 4JRPA 3QB0A 1ATRA 3P38A 3MAQA 4CCHA 3L2RA 3TAMA 4DFPA 3HO1A 1NJWA 3K5LA 4H0VB 2PBDA 3L6QA 2WBNA 3K0SA 2IC3A 1TK0A 3NMUA 5BN9A 5CYQA 2HBKA 1OKJA 4KV8A 3LWLA 5HP1A 4PWDA 3T1YK 1VRTA 4KTWA 4FJ9A 1SQKA 4C1NK 2XHBA 2HF4A 1P8ZA 1WOQA 3L2UA 3S3MA 2VG6A 3AGRA 4PUOA 5J2NA 3AVGA 3Q7BA 4H0XB 1WB9A 4V19S 1UWBA 4DR3K 3L4QA 3J81O 3EZ5A 4LF7K 4FJHA 2ZWHA 4ZTFA 3OA9A 3DMJA 4O0IA 1ASUA 2FBTA 3B8AX 4JK7A 3NH1A 3BZKA 3KLEA 3SUQA 4FLVA 2HHQA 1QVGM 3QEVA 1KVCA 4J2AA 1KAYA 5C24A 3P5JA 1YUWA 4BC4A 4ELVA 2E1ZA 2IS3A 4FWLA 4FK0A 3V9XA 4FWNA 1LV5A 4A2AA 3NVKA 3QEXA 5LMUK 1LW2A 1U6ZA 1QQOA 4GW6A 4AHVA 4FM2A 4DG1A 1NJIO 4IG3A 1KXPA 5ELZA 4DTXA 1OH7A 4DTPA 2P9KA 4JAXA 3CPEA 3SYZA 1E4GT 2ZE2A 4QS7A 2D0BA 2HHTA 4IOAL 3KZBA 4QS8A 3LAKA 4EHTA 3CC2N 4DTRA 3DLGA 1KQSM 2P9NA 3HL8A 3ENBA 5B8HA 3VF4A 3CCSN 4FO0A 5KPTA 1CLQA 5D3GA 3IMXA 5CHIA 1OH5A 1YXQA 3DLKA 4DFMA 1QVFM 1Q81O 4YDUC 2E6LA 3VQ8A 3I33A 4A2BA 3G10A 1NG9A 2UXCK 1DTQA 3VQEA 4YOUA 4QS9A 5AQJA 4EHUA 1VSEA 2UUBK 1IH7A 5BPMA 4WF9L 5KI6A 4CHYA 2G8KA 4L3QA 4KB1A 3JAMO 4H5VA 1JLAA 3TI0A 4E7IA 4LF4K 1UA0A 2O8BB 4AM7A 3KJVA 2QKBA 1VQ5N 4RWTA 3H3NO 5AQUA 1NBWA 4DQQA 4B1WB 1QS4A 3RMDA 4B9NA 3OYCA 4Z4EA 2YX6A 3PV8A 4FJNA 4BRMA 4BC2A 5AZJA 2A41A 1Q82O 1RT7A 3C6HA 3VQQA 2FF3B 4BDPA 4E7LA 4WFNL 4I7FA 4M7XA 1JJ2M 2HNDA 4JEPA 1HNIA 5BREA 4O8UA 2WTUA 2AA4A 1O1WA 1W9HA 4KHYA 3PY8A 1SAZA 4CZIA 5TKWA 4IWVA 3R1XA 4CEQA 4FJLA 1NMDA 1K8KB 4CJUA 1W0HA 1XC9A 5BRHA 1EO1A 3OY9A 3O9RA 2Z1JA 4F9OA 2NNWA 4RCHA 1N33K 1E3MA 3RTVA 2HMIA 1BDGA 1C1CA 3OJSA 4F3TA 2Y1JA 4LFCK 4MO5A 4M3YA 1RTHA 4C1NI 3QMLA 4B9VA 4X65K 2Q97A 2OA8A 4E0DA 4CD1A 3D2FB 3V1QA 3OYHA 3MCAB 3P31A 4C8NA 3DRSA 4B9SA 1TGOA 1OVQA 5AQXA 4W5TA 2HHXA 3V1RA 1SZ2A 3AVIA 5HROA 1HNXK 1NJYA 1OH6A 1YAGA 4BRFA 3WNGA 3DLEA 4JYAK 2E2QA 2PYLA 4EZ9A 3SV4A 4IFVA 1IKYA 4KTQA 3VMFB 4CHOA 2UU9K 1GLJO 3DRPA 4O0JA 2Z1GA 4M3XA 4JI0K 4M42A 1S3XA 1LWCA 1L3VA 4KHQA 5AQOA 4KPYA 3QEWA 2KW4A 3HPGA 3I0RA 4CJPA 3SBGA 1JXBA 1RTDA 4NXNK 3O1BA 3AAQA 4CJKA 3E9OA 3CXCM 3G4SN 2P9SA 4FK2A 4BRCA 1Y97A 2ITGA 1FKPA 4XH4A 4DMNA 4BRGA 5BR8K 5C2FA 4I9QA 4KH6A 3SI6A 3LANA 4RW4A 5MLCQ 3L3UA 1XHZA 3VGLA 1LW0A 4H4OA 1NU0A 2KHOA 1ATSA 2PY5A 1KRPA 3DLRA 3LDNA 1NNEA 3HJFA 3OYFA 5J2QA 4B9UA 2RPIA 3M1FA 4AHSA 4YOYA 3S3OA 1K9MO 3U3YA 4H0OA 3UKRB 5JMVA 1YJNN 4ISFA 1T05A 2RF2A 3TAPA 1SL1A 1U47A 3E01A 1NK0A 4BE1A 3OYMA 3THWA 2HB5A 3C0BA 1YITN 4B1UB 4CE9A 4J2EA 4KH4A 2WOMA 2X6NA 2QM1A 3LDOA 3NH0A 3O1WA 3WNHA 4RW8A 3QBWA 1O13A 3KK7A 3THYA 1GLCG 3TANA 1X1PA 4CHPA 3DYAA 2V52B 3QINA 4OKJA 2ZF5O 2O8DA 3PO4A 3ULEB 4IBNA 2VWBA 1YJWN 4FZXC 4CF9A 3SLCA 1BCOA 4PY5A 4EP4A 4GV9A 4GV3A 4FJIA 2ZJQL 1HX1A 2W41A 4FWPA 1CZ9A 3VQ5A 3CQ8A 5M1QA 2UXBK 1EP4A 1BG3A 2I7PA 1JLBA 1QSLA 3K57A 4DV6K 3K9JA 1RT5A 1TKXA 4FJJA 3OVNA 4CZHA 5DMRA 5CYMA 4CJRA 4KFBA 1NGHA 4O4GA 1SL2A 1RT4A 2OZMA 5M1NA 3IFRA 5AQQA 3WXKA 4OX9K 1GLEG 4EAHD 3MDQA 1D4XA 4E7KA 3O08A 4YFUA 3HOSA 3KWGA 4F3OA 3WXJA 4H0PA 1QQNA 3VF6A 3TAQA 1Z25A 4BC3A 1KTQA 3CI5A 2OPRA 2IDOA 4DB3A 4H8KA 4FWQA 3DI6A 1YF5L 5AFUA 1IKWA 2KQ2A 3TARA 3M8PA 2KZZA 3RMCA 2RN2A 4IDKA 1GLAG 2XY5A 4M7YA 4FZYA 2HW3A 3H1QA 1Q86O 2IOCA 1S1VA 1VQON 4DSFA 1XMQK 1JCFA 3THVA 1V4SA 4GY2B 2DTUA 1ZBHA 2ZJRL 3AVCA 1B92A 5LL6Z 4BR7A 2O8CB 3DXMB 2I7NA 2J4RA 1WBDA 4E19A 3AVFA 1MU2A 1OVYA 1DKGD 4LY7A 1SKSA 4JI3K 2V51B 4B1YB 1ZBLA 1VQMN 4GKJK 3RMAA 3BF1A 1CXUA 3HBTA 3BEXA 3O4WA 3CJ9A 4CW7B 3JSMA 3TSPA 3V81A 3NHGA 3HXMA 3MK6A 2DFHA 3AA5X 1NM1A 1NWKA 2YHAA 4OKKA 3GOIA 4X66K 2WUSA 2IAJA 4PL7A 4CEAA 1Z6RA 2ASMA 1T6CA 1H1VA 3PO5A 3UE5A 5AJ3K 1U49A 2YKMA 3QFUA 1IBLK 3MXMA 4FLTA 3LDPA 1XMOK 3JXUA 3O9TA 2FSJA 4EP5A 1YIJN 1SKRA 4YOWA 1MDUB 2OCEA 3AA4A 4KH5A 3WQTA 5KPRA 3WNFA 1RTIA 1HMVA 4NLBA 3PLAA 3LM9A 3TAFA 4E7JA 1VQPN 4DFJA 1C0GA 4JS4A 4M41A 1K73O 4KHNA 1NKEA 4DR4K 1HR0K 5J2MA 5AQGA 3O6WA 2P9UB 4JHDB 2BANA 3GDQA 2G8UA 1HKGA 3VQBA 1S22A 4JKDA 2FBVA 1C1BA 4CZGA 4GVEA 1V4TA 1RGIA 3WEEB 1I94K 3WQUA 2G8VA 2O8BA 5EOYA 4K25A 1QZ5A 4YNQA 4OKEA 1VRUA 3SAFA 1X9SA 1GLFO 1XWLA 2E20A 4JLHA 4JI7K 3U4LA 3ZSWA 2F8SA 3LP0A 4Y1DA 2VWJA 2DY4A 3F9MA 2CGLA 5LMNK 3SPYA 3G25A 3NBPA 4O8KA 1TKTA 2VGNA 4O44A 4H5NA 5JLFA 2GX9A 4LF8K 2HHVA 3CJAA 3CMAN 5F1XA 4DTOA 5BRFA 2P9IB 2YJEA 4IOXA 4W5NA 4CJQA 3U8XA 2ZD1A 4LD0A 3KKRA 3CG7A 2DPNA 5AQNA 1ILYA 4XEIA 3JYTA 3M5RA 2RE2A 1NGJA 1K8KA 2IVOA 2B6AA 2YNFA 5BPLA 2GUIA 4YOXA 2R7YA 2VQFK 3ZX3A 4KI6A 3DXKB 4AH9A 4OPAA 5HLFA 4IZ9A 3K58A 2FSNA 4CIEA 3VGMA 2P9LA 4DF8A 1VQKN 4FJ7A 3MEEA 4HUGA 2ZM6K 1U45A 4Q0BA 2IIRA 4FWRA 5E84A 3VQPA 3ZT1A 5FPDA 4CK3A 1HKCA 5C12A 3D2FA 3TABA 2O8EB 1T44A 4DHYA 2HHHK 2QTDA 4FWMA 3VENA 4CIFA 2QW9A 1JLCA 3AA3A 3SJHA 4FVUA 4OPKA 3R9PA 1ASWA 4K8ZA 3AVAA 3B6OA 3PIOL 3E9PA 3SUNA 3EL2A 1I3AA 3LZIA 4F4KA 1B9FA 3KK1A 3A8YA 1XC3A 1YVUA 3DM2A 5C42A 3ZSQA 4OGEA 4FM0A 3RRHA 2NZTA 2G8IA 1KFDA 4UQGA 3VQAA 3M8SA 3CCQN 4FWKA 3DLLL 1G99A 2NLXA 2YKNA 2ZGZA 3O9QA 3LPTA 4MDBA 3CC7N 4Y1CA 4E1JA 4B1ZA 3W3DA 4H03B 2G8HA 5AQWA 4FCYA 4B08A 4M63C 2YHXA 1DEJA 2OPPA 4CGDA 1BWFO 4ELTA 3S9HA 1UAXA 3TU5A 3EN9A 4DQ8A 1S5JA 3ULDA 2ATQA 4MLEA 1KAZA 5T7BA 4AHTA 1ZYQA 4DSLA 3BP8A 3VQDA 1RDAA 5KRSA 4FJGA 1Z26A 2O4IA 4BWJA 1XNRK 4NYNA 2A42A 2GUPA 2P5GA 4IDHA 1JXEA 5GAHP 2AJQA 4FL9A 1WSHA 1VSIA 1MA9B 3ISNC 1KD1O 3E9LA 4NYFA 2B5JA 3SQ4A 3HSTB 2W40A 3UKRA 5GIPA 4CHQA 1Q8IA 4CFAA 3CCUN 1SUQA 4B8AB 3O5BA 2A6AA 2QWPA 5HBMA 2NRRA 3UKUB 2A1SA 1CZAN 5HRPA 1BIUA 1T03A 2CGKA 2OTLN 1WSGA 5JS1A 1NGCA 2X78A 2HBMA 5KQ8A 2WC9A 4FJXA 1DLOA 4H5WA 1YVNA 3NGIA 4Y0WA 2HOEA 4WQ5C 1JLEA 4RG8A 3ULEA 3NFAA 2Q0RA 3SQ2A 2QA4N 4IJAA 1S1XA 5FDLA 3T1HK 3CCVN 4BRPA 3IG1A 3AO5A 5CR4A 4IO8A 2FC0A 4RW9A 3PIPL 3VPZA 4QOZB 5C10A 5HOOA 5KRTA 1TAQA 1LWEA 5CZ2A 4NCBA 1G15A 2EX3A 2EHGA 1T7PA 2CGJA 4BGBA 3QBXA 1S6PA 3OYLA 3SBTA 1J6ZA 3OYKA 4BACA 1RDUA 3GE1A 4JKHA 5GADP 3IDHA 4XH5A 4Z4HA 2XY8A 3L2QA 2HVHA 1ZC6A 4FPBA 4B3OA 5FPEA 3M8RA 2ZGYA 3MWPA 3AO3A 3IUCA 2HNZA 4HTUA 4B9LA 4FLYA 4M3WA 1GOCA 4CZFA 5I3UA 3V9UA 3AARA 2FXUA 3O9SA 1YI2N 5JVGL 3WXIA 2YHWA 3MX2A 3ZETB 1BUPA 1WUAA 3CYMA 4CJ5A 4LSNA 2XRIA 1IV0A 3K5NA 1HNVA 1IKVA 1YTAA 4M45A 5KPZA 4LF6K 3MEGA 3KLGA 3KWIA 4HCCA 5C15A 4CVNE 2E2PA 1EWRA 1Q9YA 1FW6A 5SWMA 1S1UA 1J5EK 3QIPA 3VA3A 1WLJA 1JLGA 4E1NA 2O8CA 3DXMA 4IJNA 4BROA 1S9GA 4DTNA 4AHRA 1NOZA 3RRGA 3RMBA 3TTFA 4MLHA 5C25A 3LPUA 1CXQA 4CF2A 4N5SA 2NRZA 1NK8A 1GOBA 4DUYK 4K0KK 1XUPO 1TAUA 4LF9K 3BUZB 5JVHL 5IT9O 5AFUH 5HRRA 4N76A 3HVTA 3AO1A 2E6MA 5C2DA 1VAZA 3H1VX 4JKGB 3VEXA 5DM7L 1HJOA 1VK0A 4IEIA 1NK7A 4BRDA 4E89A 2KTQA 3NGYA 4QAGA 5LJVA 3MN6A 4FJ8A 3T1AA 5I9EB 1QTMA 4MO4A 3CETA 4FJKA 4DSKA 2GTDA 1HNZK 1WSEA 4O55A 4CGHA 1N34K 5JS2A 5AQTA 5IWAK 4CJ7A 2Y1IA 4BQLA 1N32K 3EEQA 3VQ6A 3LWMA 2PAVA 1K6YA 1NMNA 3ASMA 4RTFD 4BR0A 4DKWA 4M3UA 3CD6N 2P9UA 4JHDA 4BRQA 5AQHA 4J8FA 4A5AA 3WEEA 3A5MC 4CZJA 2D1KA 3PX6A 4ID1A 1W2BM 3OYBA 3QERA 4AF1A 1BO5O 3VTHA 1A5XA 1TUUA 1QZ6A 4CEEA 3I56N 3ZT3A 3BDPA 1KVAA 1ZBIA 2HF3A 1JLFA 4Z94A 1HRHA 3DOLA 3HOTA 1Q7YO 4TSXA 3NF8A 4MDAA 2YNGA 1TK5A 4BGAA 1L3UA 4CZMA 4BRHA 1RBRA 1BOTO 3C94A 2P9IA 2P9PB 3DRRA 3CPWM 4B1VA 1RILA 3O9UA 2E2OA 3IS9A 4BR4A 4Z0UA 3AV9A 2LSNA 4ILGB 4DR7K 1U04A 4G1QA 3J7AP 4KBOA 3JS6A 1IBKK 5AQKA 3CCEN 4M3TA 2V7YA 3F2KA 3I8DA 1VSDA 2GV9A 1L3TA 4FPAA 4CERA 1VHXA 2QEXN 1BQNA 4CECA 3J8AA 3MMVA 3WXMB 5FLXO 1QHAA 4B8CA 3KKSA 2NRHA 2G8WA 4DTJA 2BE2A 4WQ4A 4FJ5A 1QHTA 3O80A 3NVMA 3ZCMA 3KD1E 2O8EA 3F5TA 3LALA 2NRVA 1IKXA 2QWRA 4DV0K 3CJCA 3O8MA 4RW7A 1MWKA 3VGKA 4UY8O 3MN7A 4I2PA 4LC9B 4IOCL 1X3MA 2HHWA 3O4QA 4CJSA 5KGWA 2X74A 5DK5A 1S1WA 4CI6A 3A5OC 3FR0A 2E8AA 2YNHA 1CZBA 3N4QA 4X64K 2FLOA 1T6DA 5AQLA 4CEZA 4FM1A 4ZHRA 3ZEUB 3CM6A 3AVMA 5KQDA 1EKEA 4FZZA 1NJZA 3KLIA 2BH1A 4B9TA 1VSLA 4NXMK 4W5OA 1U2VB 3QNOA 4KHUA 4A57A 4CEFA 3G71N 3QETA 3BGRA 2NUBA 4M3RA 3AVLA 4CHZA 4BREA 4K42A 4K43A 4CJLA 2P1JA 2HSTA 2A40A 5JLHA 2JLEA 3KLFA 1WNSA 5ADXH 3ZSXA 1BA0A 4CIGA 3I0SA 4CEBA 4DFKA 2OYQA 4NCAA 5FPNA 5AZJB 3OYEA 2Z1IA 1N6QA 1NGEA 2DFFA 3ID8A 1QQCA 1RT3A 3A5NC 3VETA 1HQUA 3NAEA 4GKKK 4DR5K 5EVZA 3KHYA 1NKCA 1A5WA 1BISA 1REVA 4CFDA 3VOVA 3UKUA 4CJFA 3FZHA 4JKFA 3U6FA 1GLBG 1ITGA 1BI4B 1SL0A 3QFPA 4CF8A 4I6MB 1BHLA 3D45A 3OS1A 3AVHA 2F4VK 1NKBA 4KTZA 1SS6A 3CFPA 4K8XA 5FPMA 2E2NA 2HBJA 2YHYA 5BPNA 1ATNA 2NRXA 2CH5A 3HK2A 2VYPA 4CJWA 1HUXA 4LH4A 2YV0X 5SZTA 2H3GX 1GLDG 3EYZA 3S41A 3KK3A 1T3VA 2HMPA 4FWOA 1HYVA 2W42A 4F2SA 3OYIA 1VSJA 1KLMA 3FZLA 4Q5VA 3AO2A 1FXXA 3I8BA 2HBLA 2A3ZA 4MFBA 3K2PA 2D4WA 3ZSZA 2IVPA 2QWMA 1XI1A 3ENHA 4GMJB 2W6KA 2OPQA 4BDYA 2FBXA 2QWLA 3RSEB 3AGKA 1VQ8N 4DQIA 4DSIA 1J5OA 1JLQA 3SV3A 2O4GA 4AM6A 2OPSA 1RNHA 4IKFA 3U3GA 4KI4A 3L2WA 4BQZA 2Q1NA 3EO3A 1Y64A 3CCRN 5AQRA 3ID6A 3LL3A 3H45C 1WSJA 4CEOA 4BE2A 3T3FA 2QWNA 4DV1K 1KFSA 3H08A 5H1SQ 5AQMA 2A1RA 4N56A 3MX5A 3L8BA 3ZETA 1X9MA 2ITMA 4IXCA 4FXDA 3TTCA 4FLWA 5AZIB 1EQYA 2Z1HA 4PHTX 4ILHA 3FZMA 3C95A 2ZJPL 2GELA 5HRNA 4DR6K 3HM9A 4B9MA 3UB5A 1KCFA 4R5PA 1TL1A 3CCLN 5GAGP 2B4JA 1U4BA 3OBYA 3HM8A 4CF0A 3PSFA 5HRSA 2FF6A 3ZYYX 1YTUA 3D2EB 3EY1A 1JL1A 4B3RK 4IEEA 3ENOA 2HHSA 2E4LA 3QLHA 3T19A 4DV2K 3AY9A 5CZ1A 2QK9A 1KAXA 4DR1K 2BTFA 4JKGA 1ZXOA 1M90O 1KVBA 4JI6K 1RT1A 3CQXA 1NGGA 3NGZA 1VSFA 4HWIA 3EZWA 2KZMA 2GEMA 2FSKA 5AQFA 1C0UA 3TTDA 4YOVA 4CD3A 2UXDK 5ADXA 2PZSA 3C6TA 2RKIA 5LJWA 4CZKA 1HQEA 3CIPA 3L4IA 3ZSVA 3A0IX 3E66A 3K5MA 3GBTA 3V9SA 4BR5A 3CMEN 3I55N 3HYFA 3P83D 2VG5A 3CC4N 4OLAA 4J2BA 1TKDA 1LCUA 4YY3K 5AQPA 5GIOA 1D5AA 3D7EO 1N5YA 3NF9A 3BZCA 4O5FA 4I9LA 1WN7A 2Q31A 4RW6A 4CGGA 2OANA 5M1FA 1RTJA 2QI2A 3D0PA 4JN4A 2F7TA 4DV7K 3SAGA 3QDKA 1HNWK 2F8TA 1ZBUA 2KFZA 4DV3K 2FBYA 3OW2M 3G0ZA 4WCEL 3RR8A 5AQYA 4IO9L 4AILC 5LY3A 3HT3A 2GWJA 4OPJA 4DTUA 2XO7A 3ITHA 1ESVA 1B9DA 3EKUA 4B1XB 1UOCA 2Q2RA 3A5LC 1TYQB 4JRQA 4E7HA 4JI5K 3IKMA 3A2FA 1ASVA 2BUPA 5M1KA 2P9PA 1WSFA 4CZEA 1BCMA 4CHNA 5BN8A 2PFUA 1JKHA 3R8EA 4G9ZA 4HUEA 1KC8O 1RBSA 4BRNA 1UA1A 4JK8A 4C23A 3C7NB 3VF2A 4FJMA 1IBMK 4Z4FA 1FJGK 1QE1A 3SMSA 4IFYA 3CCMN 4WQ4C 1VQ6N 4U67L 4BC5A 3MXJA 3AO4A 3BY5A 2F96A 1LWFA 2Q3SA 4CBWA 1GLLO 4CJ3A 3VA0A 3QEIA 4IG0A 1IJJA 1C0MA 2UUCK 4DUZK 4OVLA 2IGIA 4I2QA 3IAYA 3DJCA 3O3GA 2HNYA 4DR2K 1TK8A 2AP1A 1HLUA 3ZT0A 4FOEA 1HJRA 1WSIA 2BDPA 4NB4A 1TUYA 3ZT4A 4N41A 5F0XA 4E1MA 3GL1A 4KHSA 4DLGA 1TVRA 4HTLA 1J9AA 4GVMA 1J54A 3ATUA 3P4IA 3VERA 3VQ4A 4GNIA 2F9WA 4CJ4A 3ATVA 4DS5A 3CJ7A 3V9ZA 2O8FB 4FW1A 4CGIA 1X9WA 1BGXT 3WXLA 4OGCA 2D0AA 5BRDA 4CJEA 3ZEUA 2E5LK 2E88A 3HRGA 4KHPK 2JWKA 3CF5L 3LAMA 1D8YA 5BR9A 4JD2B 3PX4A 1DTTA 1U2VA 4L8RB 4J2DA 3HI0A 1NJXA 1W97L 4JI2K 4XH1A 3TWHA 1XHXA 4BVOA 5C0YA 2JWLA 5EY4A 3DWLA 1VQ7N 3NDKA 3G6EN 1VQ4N 1Q9XA 1NGBA 1X3NA 1RT6A 4DQRA 3OYDA 4DCHA 1C1AA 2P51A 3TPQA 3QESA 3O3HA 2BGGA 4CBUA 3HTVA 4FLXA 3CM5A 5GINA 3C65A 3FZFA 5CE3A 5I42A 3K9KA 4ISGA 1K8AO 3V9WA 3OBWA 3J7ZO 1QQMA 4JI4K 4CGJA 3NE6A 4DV4K 3L2VA 3CCJN 1IO2A 3VQ7A 4PKIA 4KAZA 3HSCA 1RCHA 3V4IA 1LOTB 1W7AA 3THXB 2RHKA 5J1EA 2D5RA 1C6VA 3AAPA 4BRIA 2NRWA 1BI4A 1MWMA 4CBXA 2YNIA 4I6MA 1RBVA 3VEVA 2P9LB 4BE0A 2VCPA 2HHUA 1SKWA 4FSVA 3P1GA 4CFCA 3DAWA 1EXQA 4MQ3A 3EE9A 4F2RA 4BRAA 1IG9A 4CESA 4ZTJA 1RDCA 3W0LA 2WFBA 1E4FT 5AQVA 1BU6O 3CHWA 3D6RA 4C8OA 3AVKA 3S3NA 3RR7A 1C0FA 3LP3A 3DLHA 1RDWX 1SV5A 3ZSRA 2A5XA 2GBZA 4DTSA 4GV6A 4OJRA 2PYJA 5E41A 2YI1A 4NO7A 3OJUA 4PKHA 3B6PA 1BIZA 1RFQA 3RSEA 4HUFA 3N4PA 3KD5E 3H46O 4DQPA 4DQSA 4DU4A 4AHUA 2XY7A 1ZBFA 5AQIA 3KIOA 3VTIA 4PL8A 3O4NA 4YORA 1NK6A 1VQLN 3U9DA 4CK1A 4A62A 3QNNA 1D9FA 2I5JA 2GWKA 3O3FA 4DF4A 3M6GA 2DFEA 3CJ1A 3HZ6A 3VQCA 3GG4A 1NLVA 5GAEP 2D0PA 4AQYK 4M3ZA 3C6AA 5AZIA 4FLUA 1VSKA 3J7YP 3QICA 3V1OA 2F9TA 4BR9A 1U48A 1RDBA 4JKEA 5AQZA 3QIOA 3PUFA 2X6SA 3ZT2A 3TSUA 2UYTA 4BG9A 1NGDA 1N8RO
chains in the Genus database with same CATH topology
2W6KA 3EEQA 3BY5A 2W6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W6K A;  3EEQ A;  3BY5 A;  2W6L A; 
#chains in the Genus database with same CATH topology
 4OPH A;  2VWK A;  3SUP A;  4DV5 K;  1KSP A;  1JCG A;  4ELU A;  1KLN A;  1YJ9 N;  4WE1 A;  3AVB A;  3DXK A;  3FFK B;  4WFB L;  3AVN A;  3D2E A;  2YJF A;  2CH6 A;  4N47 A;  5J2P A;  1VSM A;  4Z4C A;  3NF6 A;  5K14 A;  3NCI A;  2P5O A;  1YT3 A;  2P9K B;  3ZSO A;  3SZ2 A;  4CZL A;  3AVJ A;  1LAV A;  5EX5 A;  3WUH A;  4A5B A;  4XIU A;  4Z4G A;  4CFB A;  4JNE A;  4K41 A;  3VEW A;  3F73 A;  4YHH K;  2QWQ A;  3TAG A;  1C0T A;  2P9N B;  3RWU A;  3ZX2 A;  5M1O A;  4DTM A;  3OYA A;  1QSY A;  5FRN A;  4KO0 A;  4LFB K;  4ILJ A;  1RDD A;  4WFA L;  4DSE A;  4C8M A;  3V6D A;  4DS4 A;  4CGF A;  3LP1 A;  4WQ5 A;  3T7Z A;  4BY9 C;  2UUA K;  1RBT A;  2QWO A;  5E26 A;  4DLE A;  4JKC A;  3VN5 A;  2E1Y A;  3RVC A;  2OZS A;  3H3O B;  3PX0 A;  2VG7 A;  1RBU A;  4CJV A;  1HKB A;  4HCB A;  4YDU A;  3MN5 A;  3M3Z A;  3E1Y A;  2V7Z A;  3EE8 A;  4FOI A;  4CF1 A;  4DU1 A;  3FGU A;  2D0C A;  4B3S K;  3CFO A;  3QEP A;  4LSL A;  3MCP A;  2JGU A;  4LH5 A;  4JK9 A;  1NGA A;  1P90 A;  3KK2 A;  1DT9 A;  1HPZ A;  1IG8 A;  2KKZ A;  3IRX A;  4B3T K;  3AA2 A;  4CJT A;  3Q7C A;  4C8K A;  2WON A;  2QXL A;  4R79 A;  3KVG A;  1Z05 A;  2NRT A;  1NGF A;  3J80 O;  2KFN A;  1GOA A;  1XNQ K;  3SPZ A;  1R59 O;  5DM6 L;  3T69 A;  3MEC A;  1RT2 A;  3FE1 A;  4JI1 K;  4KHW A;  3SNN A;  1TYQ A;  3OS2 A;  4B3M K;  3L0Q A;  1A5V A;  5F2R A;  3VQ9 A;  2YCH A;  5JIC A;  5FRO A;  5HL7 L;  3NF7 A;  1J53 A;  2ASO A;  5KGX A;  1TL3 A;  1EET A;  3SK3 A;  1VQ9 N;  3C6U A;  1N36 K;  4YOT A;  2EWS A;  3KTQ A;  3OYN A;  2HVI A;  3C7N A;  3CJB A;  2ASP A;  2ETJ A;  2Q36 A;  3LDL A;  4A59 A;  3U9Z A;  1NK5 A;  3ZSY A;  1ZBS A;  3HP6 A;  3ALY A;  2VGM A;  4ICL A;  2IVN A;  4NCG A;  4HHT A;  4OO1 J;  4KRF A;  3R3L A;  1L3S A;  1M1K O;  1BL3 A;  3MXI A;  1EX4 A;  1YHQ N;  3LP2 A;  1WBB A;  4WYB A;  5TKY A;  3VEO A;  5EXW A;  1HYZ A;  4Z4I A;  4PA1 A;  2ZQB A;  1BQM A;  3OHR A;  4OLB A;  1EWQ A;  1S1T A;  2Q0U A;  1S9E A;  3TSQ A;  3FFI A;  2KLA A;  3TR8 A;  2QKK A;  1LAW A;  4QCL A;  3MED A;  1D9D A;  2W6L A;  1F21 A;  3DOK A;  1Q18 A;  4KB0 A;  4ISE A;  4W5R A;  2O8F A;  3R6M A;  4H0T B;  3HP9 A;  4FVM A;  3FLC O;  4E3S A;  4CK2 A;  3SAH A;  4JV5 K;  4EZ6 A;  3NH2 A;  4JS5 A;  4FWS A;  3M8Q A;  2P9S B;  1WAF A;  4JD2 A;  4BR2 A;  1HYS A;  3EKS A;  4H5R A;  3MN9 A;  1DGK N;  3SQ0 A;  3UIQ A;  4BRK A;  3TAE A;  5AR0 A;  2QXF A;  3CFR A;  3L3V A;  3VES A;  3HPO A;  1BA1 A;  1NK9 A;  3MWT A;  1JCE A;  4X62 K;  2D0O A;  3PSI A;  5M1P A;  3CER A;  3DLB A;  4JKB A;  4AHC A;  4ID5 A;  3HVR A;  3KLH A;  3OS0 A;  3K59 A;  4EIA A;  4FYD A;  4KKO A;  1XQS C;  1TV6 A;  3WNE A;  1NK4 A;  4EFH A;  5CY4 A;  1JL2 A;  1OH8 A;  4HVJ A;  4U7B A;  3QO9 A;  1FKO A;  3SUO A;  4JI8 K;  3OYJ A;  3LDQ A;  1TKZ A;  4A61 A;  1HPM A;  3THW B;  3OTO K;  4O5B A;  3LM2 A;  1NOY A;  1NGI A;  4KRE A;  4BG8 A;  5EU7 A;  4H0Y B;  5AQS A;  3P39 A;  3VEY A;  1R0A A;  3BF3 A;  2VQE K;  4LFA K;  3CQY A;  3THY B;  3ZLJ A;  3SCX A;  2G8F A;  1S6Q A;  4PQU A;  3THX A;  4IFE A;  4NLC A;  2O8D B;  4B9Q A;  3SJJ A;  1L5U A;  1I39 A;  4BVP A;  1VQN N;  4BWM A;  3LDS A;  4DU3 A;  1FK9 A;  3H6E A;  4DWI A;  4PKG A;  3F9K A;  4FK4 A;  2OTJ N;  4BDZ A;  3ZX0 A;  1X9J A;  1S72 N;  3OYG A;  4FW2 A;  4FLZ A;  4LF5 K;  3VEZ A;  4F8R A;  5KTQ A;  4W5Q A;  5FRM A;  3SMP A;  4CED A;  3SQ1 A;  5A2Q O;  1VSH A;  3FZK A;  4C8L A;  2XY6 A;  3LZJ A;  1QSS A;  3HPH A;  1T8E A;  4JKA A;  4H4M A;  3WT0 A;  4DSJ A;  4H5T A;  3K5O A;  1WAJ A;  4BRL A;  2YHB A;  4JRP A;  3QB0 A;  1ATR A;  3P38 A;  3MAQ A;  4CCH A;  3L2R A;  3TAM A;  4DFP A;  3HO1 A;  1NJW A;  3K5L A;  4H0V B;  2PBD A;  3L6Q A;  2WBN A;  3K0S A;  2IC3 A;  1TK0 A;  3NMU A;  5BN9 A;  5CYQ A;  2HBK A;  1OKJ A;  4KV8 A;  3LWL A;  5HP1 A;  4PWD A;  3T1Y K;  1VRT A;  4KTW A;  4FJ9 A;  1SQK A;  4C1N K;  2XHB A;  2HF4 A;  1P8Z A;  1WOQ A;  3L2U A;  3S3M A;  2VG6 A;  3AGR A;  4PUO A;  5J2N A;  3AVG A;  3Q7B A;  4H0X B;  1WB9 A;  4V19 S;  1UWB A;  4DR3 K;  3L4Q A;  3J81 O;  3EZ5 A;  4LF7 K;  4FJH A;  2ZWH A;  4ZTF A;  3OA9 A;  3DMJ A;  4O0I A;  1ASU A;  2FBT A;  3B8A X;  4JK7 A;  3NH1 A;  3BZK A;  3KLE A;  3SUQ A;  4FLV A;  2HHQ A;  1QVG M;  3QEV A;  1KVC A;  4J2A A;  1KAY A;  5C24 A;  3P5J A;  1YUW A;  4BC4 A;  4ELV A;  2E1Z A;  2IS3 A;  4FWL A;  4FK0 A;  3V9X A;  4FWN A;  1LV5 A;  4A2A A;  3NVK A;  3QEX A;  5LMU K;  1LW2 A;  1U6Z A;  1QQO A;  4GW6 A;  4AHV A;  4FM2 A;  4DG1 A;  1NJI O;  4IG3 A;  1KXP A;  5ELZ A;  4DTX A;  1OH7 A;  4DTP A;  2P9K A;  4JAX A;  3CPE A;  3SYZ A;  1E4G T;  2ZE2 A;  4QS7 A;  2D0B A;  2HHT A;  4IOA L;  3KZB A;  4QS8 A;  3LAK A;  4EHT A;  3CC2 N;  4DTR A;  3DLG A;  1KQS M;  2P9N A;  3HL8 A;  3ENB A;  5B8H A;  3VF4 A;  3CCS N;  4FO0 A;  5KPT A;  1CLQ A;  5D3G A;  3IMX A;  5CHI A;  1OH5 A;  1YXQ A;  3DLK A;  4DFM A;  1QVF M;  1Q81 O;  4YDU C;  2E6L A;  3VQ8 A;  3I33 A;  4A2B A;  3G10 A;  1NG9 A;  2UXC K;  1DTQ A;  3VQE A;  4YOU A;  4QS9 A;  5AQJ A;  4EHU A;  1VSE A;  2UUB K;  1IH7 A;  5BPM A;  4WF9 L;  5KI6 A;  4CHY A;  2G8K A;  4L3Q A;  4KB1 A;  3JAM O;  4H5V A;  1JLA A;  3TI0 A;  4E7I A;  4LF4 K;  1UA0 A;  2O8B B;  4AM7 A;  3KJV A;  2QKB A;  1VQ5 N;  4RWT A;  3H3N O;  5AQU A;  1NBW A;  4DQQ A;  4B1W B;  1QS4 A;  3RMD A;  4B9N A;  3OYC A;  4Z4E A;  2YX6 A;  3PV8 A;  4FJN A;  4BRM A;  4BC2 A;  5AZJ A;  2A41 A;  1Q82 O;  1RT7 A;  3C6H A;  3VQQ A;  2FF3 B;  4BDP A;  4E7L A;  4WFN L;  4I7F A;  4M7X A;  1JJ2 M;  2HND A;  4JEP A;  1HNI A;  5BRE A;  4O8U A;  2WTU A;  2AA4 A;  1O1W A;  1W9H A;  4KHY A;  3PY8 A;  1SAZ A;  4CZI A;  5TKW A;  4IWV A;  3R1X A;  4CEQ A;  4FJL A;  1NMD A;  1K8K B;  4CJU A;  1W0H A;  1XC9 A;  5BRH A;  1EO1 A;  3OY9 A;  3O9R A;  2Z1J A;  4F9O A;  2NNW A;  4RCH A;  1N33 K;  1E3M A;  3RTV A;  2HMI A;  1BDG A;  1C1C A;  3OJS A;  4F3T A;  2Y1J A;  4LFC K;  4MO5 A;  4M3Y A;  1RTH A;  4C1N I;  3QML A;  4B9V A;  4X65 K;  2Q97 A;  2OA8 A;  4E0D A;  4CD1 A;  3D2F B;  3V1Q A;  3OYH A;  3MCA B;  3P31 A;  4C8N A;  3DRS A;  4B9S A;  1TGO A;  1OVQ A;  5AQX A;  4W5T A;  2HHX A;  3V1R A;  1SZ2 A;  3AVI A;  5HRO A;  1HNX K;  1NJY A;  1OH6 A;  1YAG A;  4BRF A;  3WNG A;  3DLE A;  4JYA K;  2E2Q A;  2PYL A;  4EZ9 A;  3SV4 A;  4IFV A;  1IKY A;  4KTQ A;  3VMF B;  4CHO A;  2UU9 K;  1GLJ O;  3DRP A;  4O0J A;  2Z1G A;  4M3X A;  4JI0 K;  4M42 A;  1S3X A;  1LWC A;  1L3V A;  4KHQ A;  5AQO A;  4KPY A;  3QEW A;  2KW4 A;  3HPG A;  3I0R A;  4CJP A;  3SBG A;  1JXB A;  1RTD A;  4NXN K;  3O1B A;  3AAQ A;  4CJK A;  3E9O A;  3CXC M;  3G4S N;  2P9S A;  4FK2 A;  4BRC A;  1Y97 A;  2ITG A;  1FKP A;  4XH4 A;  4DMN A;  4BRG A;  5BR8 K;  5C2F A;  4I9Q A;  4KH6 A;  3SI6 A;  3LAN A;  4RW4 A;  5MLC Q;  3L3U A;  1XHZ A;  3VGL A;  1LW0 A;  4H4O A;  1NU0 A;  2KHO A;  1ATS A;  2PY5 A;  1KRP A;  3DLR A;  3LDN A;  1NNE A;  3HJF A;  3OYF A;  5J2Q A;  4B9U A;  2RPI A;  3M1F A;  4AHS A;  4YOY A;  3S3O A;  1K9M O;  3U3Y A;  4H0O A;  3UKR B;  5JMV A;  1YJN N;  4ISF A;  1T05 A;  2RF2 A;  3TAP A;  1SL1 A;  1U47 A;  3E01 A;  1NK0 A;  4BE1 A;  3OYM A;  3THW A;  2HB5 A;  3C0B A;  1YIT N;  4B1U B;  4CE9 A;  4J2E A;  4KH4 A;  2WOM A;  2X6N A;  2QM1 A;  3LDO A;  3NH0 A;  3O1W A;  3WNH A;  4RW8 A;  3QBW A;  1O13 A;  3KK7 A;  3THY A;  1GLC G;  3TAN A;  1X1P A;  4CHP A;  3DYA A;  2V52 B;  3QIN A;  4OKJ A;  2ZF5 O;  2O8D A;  3PO4 A;  3ULE B;  4IBN A;  2VWB A;  1YJW N;  4FZX C;  4CF9 A;  3SLC A;  1BCO A;  4PY5 A;  4EP4 A;  4GV9 A;  4GV3 A;  4FJI A;  2ZJQ L;  1HX1 A;  2W41 A;  4FWP A;  1CZ9 A;  3VQ5 A;  3CQ8 A;  5M1Q A;  2UXB K;  1EP4 A;  1BG3 A;  2I7P A;  1JLB A;  1QSL A;  3K57 A;  4DV6 K;  3K9J A;  1RT5 A;  1TKX A;  4FJJ A;  3OVN A;  4CZH A;  5DMR A;  5CYM A;  4CJR A;  4KFB A;  1NGH A;  4O4G A;  1SL2 A;  1RT4 A;  2OZM A;  5M1N A;  3IFR A;  5AQQ A;  3WXK A;  4OX9 K;  1GLE G;  4EAH D;  3MDQ A;  1D4X A;  4E7K A;  3O08 A;  4YFU A;  3HOS A;  3KWG A;  4F3O A;  3WXJ A;  4H0P A;  1QQN A;  3VF6 A;  3TAQ A;  1Z25 A;  4BC3 A;  1KTQ A;  3CI5 A;  2OPR A;  2IDO A;  4DB3 A;  4H8K A;  4FWQ A;  3DI6 A;  1YF5 L;  5AFU A;  1IKW A;  2KQ2 A;  3TAR A;  3M8P A;  2KZZ A;  3RMC A;  2RN2 A;  4IDK A;  1GLA G;  2XY5 A;  4M7Y A;  4FZY A;  2HW3 A;  3H1Q A;  1Q86 O;  2IOC A;  1S1V A;  1VQO N;  4DSF A;  1XMQ K;  1JCF A;  3THV A;  1V4S A;  4GY2 B;  2DTU A;  1ZBH A;  2ZJR L;  3AVC A;  1B92 A;  5LL6 Z;  4BR7 A;  2O8C B;  3DXM B;  2I7N A;  2J4R A;  1WBD A;  4E19 A;  3AVF A;  1MU2 A;  1OVY A;  1DKG D;  4LY7 A;  1SKS A;  4JI3 K;  2V51 B;  4B1Y B;  1ZBL A;  1VQM N;  4GKJ K;  3RMA A;  3BF1 A;  1CXU A;  3HBT A;  3BEX A;  3O4W A;  3CJ9 A;  4CW7 B;  3JSM A;  3TSP A;  3V81 A;  3NHG A;  3HXM A;  3MK6 A;  2DFH A;  3AA5 X;  1NM1 A;  1NWK A;  2YHA A;  4OKK A;  3GOI A;  4X66 K;  2WUS A;  2IAJ A;  4PL7 A;  4CEA A;  1Z6R A;  2ASM A;  1T6C A;  1H1V A;  3PO5 A;  3UE5 A;  5AJ3 K;  1U49 A;  2YKM A;  3QFU A;  1IBL K;  3MXM A;  4FLT A;  3LDP A;  1XMO K;  3JXU A;  3O9T A;  2FSJ A;  4EP5 A;  1YIJ N;  1SKR A;  4YOW A;  1MDU B;  2OCE A;  3AA4 A;  4KH5 A;  3WQT A;  5KPR A;  3WNF A;  1RTI A;  1HMV A;  4NLB A;  3PLA A;  3LM9 A;  3TAF A;  4E7J A;  1VQP N;  4DFJ A;  1C0G A;  4JS4 A;  4M41 A;  1K73 O;  4KHN A;  1NKE A;  4DR4 K;  1HR0 K;  5J2M A;  5AQG A;  3O6W A;  2P9U B;  4JHD B;  2BAN A;  3GDQ A;  2G8U A;  1HKG A;  3VQB A;  1S22 A;  4JKD A;  2FBV A;  1C1B A;  4CZG A;  4GVE A;  1V4T A;  1RGI A;  3WEE B;  1I94 K;  3WQU A;  2G8V A;  2O8B A;  5EOY A;  4K25 A;  1QZ5 A;  4YNQ A;  4OKE A;  1VRU A;  3SAF A;  1X9S A;  1GLF O;  1XWL A;  2E20 A;  4JLH A;  4JI7 K;  3U4L A;  3ZSW A;  2F8S A;  3LP0 A;  4Y1D A;  2VWJ A;  2DY4 A;  3F9M A;  2CGL A;  5LMN K;  3SPY A;  3G25 A;  3NBP A;  4O8K A;  1TKT A;  2VGN A;  4O44 A;  4H5N A;  5JLF A;  2GX9 A;  4LF8 K;  2HHV A;  3CJA A;  3CMA N;  5F1X A;  4DTO A;  5BRF A;  2P9I B;  2YJE A;  4IOX A;  4W5N A;  4CJQ A;  3U8X A;  2ZD1 A;  4LD0 A;  3KKR A;  3CG7 A;  2DPN A;  5AQN A;  1ILY A;  4XEI A;  3JYT A;  3M5R A;  2RE2 A;  1NGJ A;  1K8K A;  2IVO A;  2B6A A;  2YNF A;  5BPL A;  2GUI A;  4YOX A;  2R7Y A;  2VQF K;  3ZX3 A;  4KI6 A;  3DXK B;  4AH9 A;  4OPA A;  5HLF A;  4IZ9 A;  3K58 A;  2FSN A;  4CIE A;  3VGM A;  2P9L A;  4DF8 A;  1VQK N;  4FJ7 A;  3MEE A;  4HUG A;  2ZM6 K;  1U45 A;  4Q0B A;  2IIR A;  4FWR A;  5E84 A;  3VQP A;  3ZT1 A;  5FPD A;  4CK3 A;  1HKC A;  5C12 A;  3D2F A;  3TAB A;  2O8E B;  1T44 A;  4DHY A;  2HHH K;  2QTD A;  4FWM A;  3VEN A;  4CIF A;  2QW9 A;  1JLC A;  3AA3 A;  3SJH A;  4FVU A;  4OPK A;  3R9P A;  1ASW A;  4K8Z A;  3AVA A;  3B6O A;  3PIO L;  3E9P A;  3SUN A;  3EL2 A;  1I3A A;  3LZI A;  4F4K A;  1B9F A;  3KK1 A;  3A8Y A;  1XC3 A;  1YVU A;  3DM2 A;  5C42 A;  3ZSQ A;  4OGE A;  4FM0 A;  3RRH A;  2NZT A;  2G8I A;  1KFD A;  4UQG A;  3VQA A;  3M8S A;  3CCQ N;  4FWK A;  3DLL L;  1G99 A;  2NLX A;  2YKN A;  2ZGZ A;  3O9Q A;  3LPT A;  4MDB A;  3CC7 N;  4Y1C A;  4E1J A;  4B1Z A;  3W3D A;  4H03 B;  2G8H A;  5AQW A;  4FCY A;  4B08 A;  4M63 C;  2YHX A;  1DEJ A;  2OPP A;  4CGD A;  1BWF O;  4ELT A;  3S9H A;  1UAX A;  3TU5 A;  3EN9 A;  4DQ8 A;  1S5J A;  3ULD A;  2ATQ A;  4MLE A;  1KAZ A;  5T7B A;  4AHT A;  1ZYQ A;  4DSL A;  3BP8 A;  3VQD A;  1RDA A;  5KRS A;  4FJG A;  1Z26 A;  2O4I A;  4BWJ A;  1XNR K;  4NYN A;  2A42 A;  2GUP A;  2P5G A;  4IDH A;  1JXE A;  5GAH P;  2AJQ A;  4FL9 A;  1WSH A;  1VSI A;  1MA9 B;  3ISN C;  1KD1 O;  3E9L A;  4NYF A;  2B5J A;  3SQ4 A;  3HST B;  2W40 A;  3UKR A;  5GIP A;  4CHQ A;  1Q8I A;  4CFA A;  3CCU N;  1SUQ A;  4B8A B;  3O5B A;  2A6A A;  2QWP A;  5HBM A;  2NRR A;  3UKU B;  2A1S A;  1CZA N;  5HRP A;  1BIU A;  1T03 A;  2CGK A;  2OTL N;  1WSG A;  5JS1 A;  1NGC A;  2X78 A;  2HBM A;  5KQ8 A;  2WC9 A;  4FJX A;  1DLO A;  4H5W A;  1YVN A;  3NGI A;  4Y0W A;  2HOE A;  4WQ5 C;  1JLE A;  4RG8 A;  3ULE A;  3NFA A;  2Q0R A;  3SQ2 A;  2QA4 N;  4IJA A;  1S1X A;  5FDL A;  3T1H K;  3CCV N;  4BRP A;  3IG1 A;  3AO5 A;  5CR4 A;  4IO8 A;  2FC0 A;  4RW9 A;  3PIP L;  3VPZ A;  4QOZ B;  5C10 A;  5HOO A;  5KRT A;  1TAQ A;  1LWE A;  5CZ2 A;  4NCB A;  1G15 A;  2EX3 A;  2EHG A;  1T7P A;  2CGJ A;  4BGB A;  3QBX A;  1S6P A;  3OYL A;  3SBT A;  1J6Z A;  3OYK A;  4BAC A;  1RDU A;  3GE1 A;  4JKH A;  5GAD P;  3IDH A;  4XH5 A;  4Z4H A;  2XY8 A;  3L2Q A;  2HVH A;  1ZC6 A;  4FPB A;  4B3O A;  5FPE A;  3M8R A;  2ZGY A;  3MWP A;  3AO3 A;  3IUC A;  2HNZ A;  4HTU A;  4B9L A;  4FLY A;  4M3W A;  1GOC A;  4CZF A;  5I3U A;  3V9U A;  3AAR A;  2FXU A;  3O9S A;  1YI2 N;  5JVG L;  3WXI A;  2YHW A;  3MX2 A;  3ZET B;  1BUP A;  1WUA A;  3CYM A;  4CJ5 A;  4LSN A;  2XRI A;  1IV0 A;  3K5N A;  1HNV A;  1IKV A;  1YTA A;  4M45 A;  5KPZ A;  4LF6 K;  3MEG A;  3KLG A;  3KWI A;  4HCC A;  5C15 A;  4CVN E;  2E2P A;  1EWR A;  1Q9Y A;  1FW6 A;  5SWM A;  1S1U A;  1J5E K;  3QIP A;  3VA3 A;  1WLJ A;  1JLG A;  4E1N A;  2O8C A;  3DXM A;  4IJN A;  4BRO A;  1S9G A;  4DTN A;  4AHR A;  1NOZ A;  3RRG A;  3RMB A;  3TTF A;  4MLH A;  5C25 A;  3LPU A;  1CXQ A;  4CF2 A;  4N5S A;  2NRZ A;  1NK8 A;  1GOB A;  4DUY K;  4K0K K;  1XUP O;  1TAU A;  4LF9 K;  3BUZ B;  5JVH L;  5IT9 O;  5AFU H;  5HRR A;  4N76 A;  3HVT A;  3AO1 A;  2E6M A;  5C2D A;  1VAZ A;  3H1V X;  4JKG B;  3VEX A;  5DM7 L;  1HJO A;  1VK0 A;  4IEI A;  1NK7 A;  4BRD A;  4E89 A;  2KTQ A;  3NGY A;  4QAG A;  5LJV A;  3MN6 A;  4FJ8 A;  3T1A A;  5I9E B;  1QTM A;  4MO4 A;  3CET A;  4FJK A;  4DSK A;  2GTD A;  1HNZ K;  1WSE A;  4O55 A;  4CGH A;  1N34 K;  5JS2 A;  5AQT A;  5IWA K;  4CJ7 A;  2Y1I A;  4BQL A;  1N32 K;  3EEQ A;  3VQ6 A;  3LWM A;  2PAV A;  1K6Y A;  1NMN A;  3ASM A;  4RTF D;  4BR0 A;  4DKW A;  4M3U A;  3CD6 N;  2P9U A;  4JHD A;  4BRQ A;  5AQH A;  4J8F A;  4A5A A;  3WEE A;  3A5M C;  4CZJ A;  2D1K A;  3PX6 A;  4ID1 A;  1W2B M;  3OYB A;  3QER A;  4AF1 A;  1BO5 O;  3VTH A;  1A5X A;  1TUU A;  1QZ6 A;  4CEE A;  3I56 N;  3ZT3 A;  3BDP A;  1KVA A;  1ZBI A;  2HF3 A;  1JLF A;  4Z94 A;  1HRH A;  3DOL A;  3HOT A;  1Q7Y O;  4TSX A;  3NF8 A;  4MDA A;  2YNG A;  1TK5 A;  4BGA A;  1L3U A;  4CZM A;  4BRH A;  1RBR A;  1BOT O;  3C94 A;  2P9I A;  2P9P B;  3DRR A;  3CPW M;  4B1V A;  1RIL A;  3O9U A;  2E2O A;  3IS9 A;  4BR4 A;  4Z0U A;  3AV9 A;  2LSN A;  4ILG B;  4DR7 K;  1U04 A;  4G1Q A;  3J7A P;  4KBO A;  3JS6 A;  1IBK K;  5AQK A;  3CCE N;  4M3T A;  2V7Y A;  3F2K A;  3I8D A;  1VSD A;  2GV9 A;  1L3T A;  4FPA A;  4CER A;  1VHX A;  2QEX N;  1BQN A;  4CEC A;  3J8A A;  3MMV A;  3WXM B;  5FLX O;  1QHA A;  4B8C A;  3KKS A;  2NRH A;  2G8W A;  4DTJ A;  2BE2 A;  4WQ4 A;  4FJ5 A;  1QHT A;  3O80 A;  3NVM A;  3ZCM A;  3KD1 E;  2O8E A;  3F5T A;  3LAL A;  2NRV A;  1IKX A;  2QWR A;  4DV0 K;  3CJC A;  3O8M A;  4RW7 A;  1MWK A;  3VGK A;  4UY8 O;  3MN7 A;  4I2P A;  4LC9 B;  4IOC L;  1X3M A;  2HHW A;  3O4Q A;  4CJS A;  5KGW A;  2X74 A;  5DK5 A;  1S1W A;  4CI6 A;  3A5O C;  3FR0 A;  2E8A A;  2YNH A;  1CZB A;  3N4Q A;  4X64 K;  2FLO A;  1T6D A;  5AQL A;  4CEZ A;  4FM1 A;  4ZHR A;  3ZEU B;  3CM6 A;  3AVM A;  5KQD A;  1EKE A;  4FZZ A;  1NJZ A;  3KLI A;  2BH1 A;  4B9T A;  1VSL A;  4NXM K;  4W5O A;  1U2V B;  3QNO A;  4KHU A;  4A57 A;  4CEF A;  3G71 N;  3QET A;  3BGR A;  2NUB A;  4M3R A;  3AVL A;  4CHZ A;  4BRE A;  4K42 A;  4K43 A;  4CJL A;  2P1J A;  2HST A;  2A40 A;  5JLH A;  2JLE A;  3KLF A;  1WNS A;  5ADX H;  3ZSX A;  1BA0 A;  4CIG A;  3I0S A;  4CEB A;  4DFK A;  2OYQ A;  4NCA A;  5FPN A;  5AZJ B;  3OYE A;  2Z1I A;  1N6Q A;  1NGE A;  2DFF A;  3ID8 A;  1QQC A;  1RT3 A;  3A5N C;  3VET A;  1HQU A;  3NAE A;  4GKK K;  4DR5 K;  5EVZ A;  3KHY A;  1NKC A;  1A5W A;  1BIS A;  1REV A;  4CFD A;  3VOV A;  3UKU A;  4CJF A;  3FZH A;  4JKF A;  3U6F A;  1GLB G;  1ITG A;  1BI4 B;  1SL0 A;  3QFP A;  4CF8 A;  4I6M B;  1BHL A;  3D45 A;  3OS1 A;  3AVH A;  2F4V K;  1NKB A;  4KTZ A;  1SS6 A;  3CFP A;  4K8X A;  5FPM A;  2E2N A;  2HBJ A;  2YHY A;  5BPN A;  1ATN A;  2NRX A;  2CH5 A;  3HK2 A;  2VYP A;  4CJW A;  1HUX A;  4LH4 A;  2YV0 X;  5SZT A;  2H3G X;  1GLD G;  3EYZ A;  3S41 A;  3KK3 A;  1T3V A;  2HMP A;  4FWO A;  1HYV A;  2W42 A;  4F2S A;  3OYI A;  1VSJ A;  1KLM A;  3FZL A;  4Q5V A;  3AO2 A;  1FXX A;  3I8B A;  2HBL A;  2A3Z A;  4MFB A;  3K2P A;  2D4W A;  3ZSZ A;  2IVP A;  2QWM A;  1XI1 A;  3ENH A;  4GMJ B;  2W6K A;  2OPQ A;  4BDY A;  2FBX A;  2QWL A;  3RSE B;  3AGK A;  1VQ8 N;  4DQI A;  4DSI A;  1J5O A;  1JLQ A;  3SV3 A;  2O4G A;  4AM6 A;  2OPS A;  1RNH A;  4IKF A;  3U3G A;  4KI4 A;  3L2W A;  4BQZ A;  2Q1N A;  3EO3 A;  1Y64 A;  3CCR N;  5AQR A;  3ID6 A;  3LL3 A;  3H45 C;  1WSJ A;  4CEO A;  4BE2 A;  3T3F A;  2QWN A;  4DV1 K;  1KFS A;  3H08 A;  5H1S Q;  5AQM A;  2A1R A;  4N56 A;  3MX5 A;  3L8B A;  3ZET A;  1X9M A;  2ITM A;  4IXC A;  4FXD A;  3TTC A;  4FLW A;  5AZI B;  1EQY A;  2Z1H A;  4PHT X;  4ILH A;  3FZM A;  3C95 A;  2ZJP L;  2GEL A;  5HRN A;  4DR6 K;  3HM9 A;  4B9M A;  3UB5 A;  1KCF A;  4R5P A;  1TL1 A;  3CCL N;  5GAG P;  2B4J A;  1U4B A;  3OBY A;  3HM8 A;  4CF0 A;  3PSF A;  5HRS A;  2FF6 A;  3ZYY X;  1YTU A;  3D2E B;  3EY1 A;  1JL1 A;  4B3R K;  4IEE A;  3ENO A;  2HHS A;  2E4L A;  3QLH A;  3T19 A;  4DV2 K;  3AY9 A;  5CZ1 A;  2QK9 A;  1KAX A;  4DR1 K;  2BTF A;  4JKG A;  1ZXO A;  1M90 O;  1KVB A;  4JI6 K;  1RT1 A;  3CQX A;  1NGG A;  3NGZ A;  1VSF A;  4HWI A;  3EZW A;  2KZM A;  2GEM A;  2FSK A;  5AQF A;  1C0U A;  3TTD A;  4YOV A;  4CD3 A;  2UXD K;  5ADX A;  2PZS A;  3C6T A;  2RKI A;  5LJW A;  4CZK A;  1HQE A;  3CIP A;  3L4I A;  3ZSV A;  3A0I X;  3E66 A;  3K5M A;  3GBT A;  3V9S A;  4BR5 A;  3CME N;  3I55 N;  3HYF A;  3P83 D;  2VG5 A;  3CC4 N;  4OLA A;  4J2B A;  1TKD A;  1LCU A;  4YY3 K;  5AQP A;  5GIO A;  1D5A A;  3D7E O;  1N5Y A;  3NF9 A;  3BZC A;  4O5F A;  4I9L A;  1WN7 A;  2Q31 A;  4RW6 A;  4CGG A;  2OAN A;  5M1F A;  1RTJ A;  2QI2 A;  3D0P A;  4JN4 A;  2F7T A;  4DV7 K;  3SAG A;  3QDK A;  1HNW K;  2F8T A;  1ZBU A;  2KFZ A;  4DV3 K;  2FBY A;  3OW2 M;  3G0Z A;  4WCE L;  3RR8 A;  5AQY A;  4IO9 L;  4AIL C;  5LY3 A;  3HT3 A;  2GWJ A;  4OPJ A;  4DTU A;  2XO7 A;  3ITH A;  1ESV A;  1B9D A;  3EKU A;  4B1X B;  1UOC A;  2Q2R A;  3A5L C;  1TYQ B;  4JRQ A;  4E7H A;  4JI5 K;  3IKM A;  3A2F A;  1ASV A;  2BUP A;  5M1K A;  2P9P A;  1WSF A;  4CZE A;  1BCM A;  4CHN A;  5BN8 A;  2PFU A;  1JKH A;  3R8E A;  4G9Z A;  4HUE A;  1KC8 O;  1RBS A;  4BRN A;  1UA1 A;  4JK8 A;  4C23 A;  3C7N B;  3VF2 A;  4FJM A;  1IBM K;  4Z4F A;  1FJG K;  1QE1 A;  3SMS A;  4IFY A;  3CCM N;  4WQ4 C;  1VQ6 N;  4U67 L;  4BC5 A;  3MXJ A;  3AO4 A;  3BY5 A;  2F96 A;  1LWF A;  2Q3S A;  4CBW A;  1GLL O;  4CJ3 A;  3VA0 A;  3QEI A;  4IG0 A;  1IJJ A;  1C0M A;  2UUC K;  4DUZ K;  4OVL A;  2IGI A;  4I2Q A;  3IAY A;  3DJC A;  3O3G A;  2HNY A;  4DR2 K;  1TK8 A;  2AP1 A;  1HLU A;  3ZT0 A;  4FOE A;  1HJR A;  1WSI A;  2BDP A;  4NB4 A;  1TUY A;  3ZT4 A;  4N41 A;  5F0X A;  4E1M A;  3GL1 A;  4KHS A;  4DLG A;  1TVR A;  4HTL A;  1J9A A;  4GVM A;  1J54 A;  3ATU A;  3P4I A;  3VER A;  3VQ4 A;  4GNI A;  2F9W A;  4CJ4 A;  3ATV A;  4DS5 A;  3CJ7 A;  3V9Z A;  2O8F B;  4FW1 A;  4CGI A;  1X9W A;  1BGX T;  3WXL A;  4OGC A;  2D0A A;  5BRD A;  4CJE A;  3ZEU A;  2E5L K;  2E88 A;  3HRG A;  4KHP K;  2JWK A;  3CF5 L;  3LAM A;  1D8Y A;  5BR9 A;  4JD2 B;  3PX4 A;  1DTT A;  1U2V A;  4L8R B;  4J2D A;  3HI0 A;  1NJX A;  1W97 L;  4JI2 K;  4XH1 A;  3TWH A;  1XHX A;  4BVO A;  5C0Y A;  2JWL A;  5EY4 A;  3DWL A;  1VQ7 N;  3NDK A;  3G6E N;  1VQ4 N;  1Q9X A;  1NGB A;  1X3N A;  1RT6 A;  4DQR A;  3OYD A;  4DCH A;  1C1A A;  2P51 A;  3TPQ A;  3QES A;  3O3H A;  2BGG A;  4CBU A;  3HTV A;  4FLX A;  3CM5 A;  5GIN A;  3C65 A;  3FZF A;  5CE3 A;  5I42 A;  3K9K A;  4ISG A;  1K8A O;  3V9W A;  3OBW A;  3J7Z O;  1QQM A;  4JI4 K;  4CGJ A;  3NE6 A;  4DV4 K;  3L2V A;  3CCJ N;  1IO2 A;  3VQ7 A;  4PKI A;  4KAZ A;  3HSC A;  1RCH A;  3V4I A;  1LOT B;  1W7A A;  3THX B;  2RHK A;  5J1E A;  2D5R A;  1C6V A;  3AAP A;  4BRI A;  2NRW A;  1BI4 A;  1MWM A;  4CBX A;  2YNI A;  4I6M A;  1RBV A;  3VEV A;  2P9L B;  4BE0 A;  2VCP A;  2HHU A;  1SKW A;  4FSV A;  3P1G A;  4CFC A;  3DAW A;  1EXQ A;  4MQ3 A;  3EE9 A;  4F2R A;  4BRA A;  1IG9 A;  4CES A;  4ZTJ A;  1RDC A;  3W0L A;  2WFB A;  1E4F T;  5AQV A;  1BU6 O;  3CHW A;  3D6R A;  4C8O A;  3AVK A;  3S3N A;  3RR7 A;  1C0F A;  3LP3 A;  3DLH A;  1RDW X;  1SV5 A;  3ZSR A;  2A5X A;  2GBZ A;  4DTS A;  4GV6 A;  4OJR A;  2PYJ A;  5E41 A;  2YI1 A;  4NO7 A;  3OJU A;  4PKH A;  3B6P A;  1BIZ A;  1RFQ A;  3RSE A;  4HUF A;  3N4P A;  3KD5 E;  3H46 O;  4DQP A;  4DQS A;  4DU4 A;  4AHU A;  2XY7 A;  1ZBF A;  5AQI A;  3KIO A;  3VTI A;  4PL8 A;  3O4N A;  4YOR A;  1NK6 A;  1VQL N;  3U9D A;  4CK1 A;  4A62 A;  3QNN A;  1D9F A;  2I5J A;  2GWK A;  3O3F A;  4DF4 A;  3M6G A;  2DFE A;  3CJ1 A;  3HZ6 A;  3VQC A;  3GG4 A;  1NLV A;  5GAE P;  2D0P A;  4AQY K;  4M3Z A;  3C6A A;  5AZI A;  4FLU A;  1VSK A;  3J7Y P;  3QIC A;  3V1O A;  2F9T A;  4BR9 A;  1U48 A;  1RDB A;  4JKE A;  5AQZ A;  3QIO A;  3PUF A;  2X6S A;  3ZT2 A;  3TSU A;  2UYT A;  4BG9 A;  1NGD A;  1N8R O; 
#chains in the Genus database with same CATH homology
 2W6K A;  3EEQ A;  3BY5 A;  2W6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...