2W6KA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
GSHMPLPIPSLLIAGIGCRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLTER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
molecule keywords COBE
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6kA00
3EEQA 3BY5A 2W6LA 2W6KA
chains in the Genus database with same CATH superfamily
3GOIA 3H1VX 4DTPA 1VQPN 4MLHA 2ZJPL 3LAMA 2ZGZA 4M7YA 4J2BA 1VRTA 3VF6A 3EL2A 1UA1A 1RBTA 1SL2A 1QVFM 4IOAL 4FLZA 2UXCK 4DTXA 3DM2A 3VEOA 1XHZA 3AO2A 3WXMB 3O9TA 4FOEA 3LWLA 4HCBA 2ZWHA 5AR0A 4CJSA 1IBKK 4FWKA 5E41A 1RT4A 1WSFA 4AHCA 4DTJA 3VF2A 4LF7K 3WEEA 3C6HA 4B1UB 4E89A 4CECA 3OJSA 1JCGA 2YHXA 1RT2A 2E2PA 2O8EA 3DXKB 4FPBA 4BE2A 1TAQA 4KHSA 1Z25A 3FZLA 1RT6A 5AQNA 4B9NA 4H4OA 2YNFA 4RWTA 3SQ2A 4F4KA 4O4GA 4BC5A 1K8AO 2IVNA 3J7ZO 3VQEA 1NKBA 4FJHA 4BR9A 3O9UA 2W42A 4WQ4C 4LD0A 1Q9YA 1QSYA 1S5JA 4G9ZA 4CHZA 3I0SA 4CGDA 2PYLA 1JCEA 3LDLA 3UKRB 3L2QA 3BDPA 5J2PA 1WUAA 3ZT4A 3CJ1A 3AA4A 3LAKA 3VQ4A 1BCMA 1OH6A 1GLAG 1VQLN 3UB5A 4QS7A 5GIPA 4YOXA 2G8IA 3CMAN 4FOIA 3DRSA 2FXUA 2HNZA 3ZYYX 4Z4EA 2KLAA 3SQ4A 1B92A 2HBKA 4LFBK 2ETJA 3DMJA 4KHPK 4CJRA 4DR6K 3E01A 2QWQA 4C8KA 2OCEA 1NMNA 1TVRA 3MEDA 4CIGA 4JI3K 5AQUA 4NXMK 3LP2A 4BQZA 3RRHA 4LSNA 1ILYA 4FWPA 4CBWA 1BQMA 1VQ4N 4FLVA 3O80A 1SL1A 4B3OA 5HOOA 3BEXA 1EP4A 1LCUA 3D0PA 3LANA 4M41A 3HM9A 2YHBA 1EWRA 4H5RA 3LDNA 2W6KA 1X3NA 2YHWA 4JI8K 3MN6A 3K5LA 2P9LA 4LF5K 4M45A 2A42A 2OPQA 1KXPA 3P38A 3K9KA 3HYFA 4CF2A 1U6ZA 1N33K 4GW6A 1E3MA 1HQEA 4YHHK 4RW4A 3CMEN 1GLDG 4AM6A 4BRNA 1XNRK 4WQ5C 4GKKK 1ATNA 4K42A 1JJ2M 4CEQA 4E1NA 4DR1K 3SI6A 4CVNE 4DV5K 2HHUA 1VSMA 2E4LA 5AQIA 1QZ5A 3HK2A 3QICA 3PV8A 4V19S 4N5SA 4CJWA 3L2RA 5AQOA 3DLHA 3ID8A 2V51B 2YNGA 5EXWA 4LY7A 1X9MA 1N8RO 3LALA 4AHRA 3C95A 1DKGD 3O6WA 1RFQA 3QMLA 3HJFA 3MN7A 2DFFA 4B1WB 2FLOA 2YJFA 4ILGB 4PA1A 4DV3K 2QKKA 3JYTA 4CHPA 3LDPA 3TTDA 2O8CA 3DLKA 1X9JA 1GLBG 3SYZA 2NRRA 1NU0A 3KVGA 4JI6K 3QB0A 1LW0A 4BE0A 2NRXA 4C1NK 3FZMA 4DU1A 3DJCA 3U9ZA 3V9XA 4F2SA 4F2RA 3DXKA 4H0TB 4LF9K 1DT9A 2F9TA 1M1KO 4CJFA 3EE9A 2IGIA 1VQON 4KREA 1KSPA 4CJQA 4DKWA 3H3OB 5B8HA 1NGJA 2F4VK 4JS5A 2JWLA 4CW7B 4NO7A 4CCHA 2QEXN 3NF9A 3P5JA 3THXA 2P9PA 4PL7A 3QEPA 1Q81O 1X3MA 2BE2A 1U45A 3MXIA 3CD6N 4BVPA 5KQ8A 3BGRA 3WXJA 4B9VA 4X62K 4C1NI 4JRQA 4IO9L 2ASOA 3QIOA 3WNGA 4CF8A 3WXKA 2HOEA 4B1XB 2P9NA 3BZKA 4DFPA 4CJ7A 4YOTA 1HUXA 3G10A 3VN5A 3QESA 2KZZA 4K25A 3BY5A 3RVCA 3KLIA 1RDCA 4CBUA 1JLQA 1FW6A 4B3RK 4R5PA 3EN9A 4E7KA 2O8FA 4LH5A 2AJQA 4FJXA 1RDDA 3T1AA 4FWNA 2WC9A 4CJPA 2Z1GA 1Z05A 4WFAL 5C0YA 2GTDA 2CGLA 3CJ7A 4B8CA 1S22A 3E1YA 2VQFK 3T1YK 4M3YA 3EZWA 2E88A 3HOTA 3SUQA 4F8RA 4OO1J 1JXEA 3QINA 2O8BB 3V1RA 4YOVA 3DAWA 1ZBLA 2FBTA 4QAGA 5FPDA 4AM7A 2QWNA 3QBXA 2P9KB 4DFJA 1N36K 3W3DA 4MDBA 4FK0A 5CZ2A 3RMBA 4FJLA 1HKBA 2RN2A 3M3ZA 4N47A 3PX4A 4KRFA 2IIRA 2VQEK 1RTHA 3PSIA 2Q0RA 4AF1A 4BWMA 4DQ8A 2RHKA 4X66K 4A2AA 2P9UB 3ZSQA 5LMNK 3P39A 2E20A 3TSQA 3RMCA 4GV6A 2DPNA 4BRHA 2FBYA 3O9SA 1RTJA 3CJ9A 5TKWA 2DFHA 3VQCA 1NGBA 4IZ9A 3L3UA 2O8DB 4XIUA 5I3UA 4JEPA 3OYLA 2E8AA 3CCJN 3VQ7A 5ADXH 4DTUA 4FJ7A 2HHVA 4DR2K 1YHQN 4FM0A 3HSCA 5BR9A 2ZGYA 2QWRA 4A2BA 2XY8A 4CEZA 2HW3A 4JV5K 4CEOA 3CERA 1QVGM 3T69A 1Q86O 1YVUA 4CD3A 3NCIA 4N76A 1LV5A 2G8UA 3WQTA 1D5AA 1X9WA 2B5JA 3BF3A 3U4LA 4CERA 3TWHA 2UUBK 4R79A 4GKJK 4JKAA 4KTQA 3TR8A 4CFBA 3SV3A 3H46O 4CJLA 1SL0A 4B08A 1XQSC 1VQMN 4KAZA 2O8EB 1NJIO 4IXCA 1TL1A 3FZHA 4KTWA 4L3QA 4CGHA 2FBVA 3VGMA 3O3HA 4I2PA 3G4SN 1WOQA 3L2VA 5J2MA 5MLCQ 4FCYA 2YHYA 5FPNA 3KZBA 4CZJA 3A0IX 3ZT0A 1B9DA 1BISA 1GOBA 4M3ZA 4CI6A 3NF8A 3OYMA 1E4FT 2V52B 1I39A 5BPMA 4PWDA 3QEWA 1OVQA 5BRDA 1EETA 4FL9A 3AVIA 4QS8A 3CCVN 4PHTX 3F73A 3UKUB 3DRRA 1QS4A 3TI0A 4IDKA 5C12A 4CESA 2P9IB 4ID5A 3VEWA 2W41A 2EHGA 5JICA 1TYQB 4FJIA 3BF1A 5JVHL 3QBWA 2J4RA 5EX5A 4M7XA 3KWGA 2E2QA 2NUBA 1WSHA 4FO0A 1DTQA 3OYGA 4CJKA 4Y1DA 3MX5A 5TKYA 4HUEA 1JL1A 3OS0A 3ULEA 3RWUA 2FF6A 1SKSA 2KZMA 3LDSA 2ZJQL 1ZBUA 1HNVA 1T8EA 1RTDA 3CFRA 4KH5A 3VEXA 4PY5A 4YOUA 2ZF5O 4H5TA 2P5GA 3CC4N 2H3GX 3R6MA 2IVOA 4DR4K 3DOLA 4YY3K 3O3GA 5AQVA 3KK2A 3K2PA 1NK8A 3SJHA 3UKRA 3MEEA 4JAXA 3MN5A 2EX3A 2QWLA 1N5YA 4DTRA 4CZEA 2GWKA 3LDQA 3A5LC 4FZXC 4Z4CA 4C23A 1NK4A 4NCBA 1C0TA 1RCHA 3CI5A 3QEVA 1TL3A 1K8KA 3AA3A 4O8KA 3KKSA 1L3VA 3CCQN 2JGUA 1IBMK 4I2QA 1CZ9A 2IC3A 4JK7A 3THYA 3CCLN 1XNQK 4FJ9A 4WFNL 4H0XB 2YV0X 3OA9A 2GBZA 3HRGA 4FK2A 3ULEB 3HT3A 4EZ6A 5IT9O 4FW2A 1VQ9N 1U2VA 3GBTA 4UY8O 1QQMA 3T3FA 1TUUA 3OYNA 2HF4A 5J2NA 3IRXA 4CEEA 3ZX3A 1XC3A 1U2VB 5AQPA 3AVHA 4I6MA 3SMPA 3A5NC 1LWEA 2CGKA 4CK3A 1QTMA 4F3OA 1RT7A 1JL2A 3QIPA 2X6NA 2D0AA 1OVYA 3ZETB 4Y1CA 4DTNA 4JK8A 1UOCA 4DU4A 2OYQA 2QWMA 1C0FA 4RW8A 4DHYA 3SMSA 1NM1A 4JD2B 3QETA 5GINA 2HF3A 3OVNA 1K6YA 1SAZA 3LM9A 2HHXA 1S1VA 1YF5L 1IG8A 4BDZA 2G8FA 4LFAK 3DRPA 4GVMA 1LWFA 4ELVA 3CETA 2E2NA 3OYDA 3NH0A 1HYVA 5LJWA 4B8AB 3KK7A 4BWJA 3TAEA 4CF9A 4M63C 3DLEA 4I9QA 4YFUA 5CY4A 4FLUA 4OKKA 3EO3A 1RBSA 1VAZA 4KHYA 4J8FA 1C1AA 4DUZK 2CGJA 3H08A 1QQNA 1KTQA 1Q82O 4EHTA 1U48A 3LP0A 1BIUA 2YKNA 2DTUA 4RCHA 4CHQA 4BR7A 1XUPO 3VGKA 2O4IA 3N4QA 1E4GT 1D4XA 4AH9A 1KLNA 3O1BA 3VEYA 4CFAA 2F8SA 1WSEA 3D2FB 1LOTB 1NGGA 3FZFA 3LL3A 5BRFA 4OLBA 3QLHA 4DR3K 4FVMA 5DM7L 4DV7K 1ASUA 2IAJA 5FDLA 2KFZA 2NLXA 1JLAA 3IDHA 2YI1A 3NVKA 4DQRA 4FWMA 1EO1A 3A5MC 5AQTA 4ISGA 4CJ3A 4JKCA 5AQKA 2KHOA 4CJ4A 4HTUA 4F9OA 1ZBIA 3SCXA 3L0QA 3PX0A 2HMIA 4ELTA 3K59A 3M5RA 4Q0BA 1CZBA 1BL3A 3MAQA 4E19A 3VTHA 4YORA 2GUIA 1EXQA 3ENOA 1S6PA 4FLYA 2E1ZA 1MWKA 1XMOK 3PIPL 2FSJA 1P8ZA 3OYJA 2F8TA 2D4WA 3SLCA 1K8KB 3NGIA 4L8RB 3OTOK 3K57A 4JI1K 1YJWN 1KFSA 4BRAA 1T6DA 3FFKB 3CG7A 2QKBA 1RDBA 4DS4A 5FRNA 4ID1A 3E9PA 2ZJRL 3OYFA 2HVIA 2VGNA 1ATRA 1LW2A 1CLQA 3AO4A 2IDOA 4JI4K 1D9DA 3FLCO 3VERA 1YJNN 4K8ZA 5F0XA 2ASPA 1J54A 3U3GA 3F9KA 3HPGA 1F21A 3NF6A 3WXLA 4IDHA 1C6VA 2E1YA 3JSMA 3ZX2A 1IO2A 1BDGA 3AAPA 3ZSYA 1Q9XA 4OGEA 1NGHA 4CJUA 4ZTFA 2FSKA 4HHTA 1RDWX 5BRHA 2XHBA 3NHGA 4NLCA 2JWKA 2NRTA 3QEXA 3FGUA 3V81A 3NFAA 1NK7A 2V7ZA 3AVGA 1WN7A 3I55N 2NRWA 1DLOA 2P9LB 4KHNA 1T6CA 3I56N 3M8SA 3ZSWA 1TUYA 1HJRA 3AGKA 3LWMA 1HNIA 3H1QA 4FWOA 4IBNA 3EY1A 2WTUA 1IJJA 4DSEA 2QW9A 4KFBA 5EVZA 4BR0A 3NBPA 3CFPA 3VTIA 1WBBA 2BUPA 3KWIA 2HHSA 4HUFA 1RT3A 3HPHA 4JNEA 4GV9A 2D1KA 3T1HK 3VQQA 3RR7A 3S3MA 3ZT3A 3CF5L 5AQRA 3SUNA 3OYCA 1Q18A 4CZIA 4B3MK 5FPMA 1N34K 3MN9A 2Z1IA 3GL1A 4C8MA 4CEBA 2A5XA 1KC8O 2P9NB 1WLJA 4CZGA 3VEVA 5EY4A 4PKHA 3HXMA 4DQSA 4JI0K 4FM2A 5M1QA 2ASMA 1O13A 3HM8A 5BPLA 3KD5E 1Z6RA 3M8RA 5JLFA 1Y97A 3HZ6A 3G25A 4HWIA 1U47A 4BC2A 4RTFD 2P9SB 4BRGA 1BGXT 1W2BM 5M1PA 3WQUA 4DSFA 1HX1A 3AAQA 1HNZK 4CGGA 5C24A 3SQ0A 3MEGA 1S72N 5E26A 3TSPA 4BRPA 3AY9A 1IKXA 1VSLA 1L3TA 3WNHA 1FXXA 5KGWA 3AVAA 4W5QA 1BI4A 1XI1A 1R59O 4H0OA 5GIOA 5KPRA 4JKDA 4GV3A 3C6UA 1JLFA 5AQQA 4EZ9A 3O08A 1ZYQA 3SPZA 4KKOA 4LF4K 2D5RA 4CEFA 1O1WA 4OLAA 4XEIA 2YJEA 4CJ5A 4H8KA 3ULDA 1JLBA 3V9WA 4M42A 3C94A 5DMRA 1ZC6A 3FFIA 3CJBA 3KK3A 1XWLA 4RG8A 1BG3A 4KV8A 3OYHA 1VSKA 2P9PB 3MXMA 4IOXA 3CJCA 3SPYA 5JS1A 4OPJA 3WXIA 1VQ6N 4BDPA 2NRVA 4DSIA 3SV4A 1NJZA 4LF8K 2IVPA 3RSEB 1S1XA 3VETA 3GE1A 3C7NA 3MK6A 3ID6A 4O5FA 3SZ2A 2X74A 3K5NA 3LPTA 4DV4K 5AZJA 5KPZA 1YI2N 3P4IA 5AQZA 3NH1A 3C7NB 3MXJA 3SBGA 3M8QA 4BRFA 1ESVA 2P9IA 3ZT2A 2XY6A 2I7NA 4IG3A 4CJTA 3OY9A 2Z1JA 1YTUA 2O8FB 4E7IA 5AFUH 4K8XA 3O8MA 1YIJN 3OJUA 1KCFA 5C2DA 2BANA 3TABA 4H5VA 3J8AA 1WSJA 4CE9A 2OTJN 1VK0A 3H45C 4KI6A 1ASVA 3B6PA 3TARA 3U6FA 3NGZA 1VQ7N 1OH7A 2YNHA 3R1XA 3V9ZA 3HVTA 1D8YA 2F9WA 3DWLA 4FJGA 1BO5O 2HHQA 3M8PA 4J2EA 4ISFA 3ENBA 3G0ZA 1T3VA 4MO5A 3LZJA 1HPMA 4JI5K 3RSEA 4RW9A 3LZIA 3IG1A 1ASWA 1T44A 1IBLK 1YTAA 2RF2A 2OPRA 5C42A 2NRZA 4IEIA 4AILC 5AQXA 3BP8A 1BWFO 4FJKA 4DLEA 5HP1A 3AARA 4FPAA 3L2UA 3HP9A 5HBMA 4DV6K 3HL8A 3VGLA 4JD2A 4DSLA 3THYB 3U8XA 2KTQA 1S6QA 4F3TA 4IFEA 3QNNA 2P9SA 3QEIA 1RDAA 1RNHA 2G8HA 3S9HA 3F9MA 3EKSA 4FJ8A 4OPKA 2XY7A 4BR2A 2YX6A 3EE8A 2XY5A 2HNDA 4I9LA 1RT1A 5LMUK 5J2QA 1CZAN 3L6QA 2E6MA 2W40A 4FW1A 4CIEA 1BU6O 3CCRN 4NYFA 3CFOA 2E6LA 1NKEA 3AO3A 1OKJA 5AQLA 5AQJA 3G6EN 1HLUA 1HR0K 4KB1A 4JI2K 2I5JA 4DFKA 1YXQA 2G8KA 3BUZB 4FVUA 2P1JA 1ZBHA 1D9FA 1SKWA 2PZSA 2IS3A 1GLEG 5HRRA 3J7YP 4W5TA 5CR4A 1H1VA 4KTZA 3O3FA 2KQ2A 3AA2A 3F5TA 4DF4A 1NJXA 1RBUA 3MX2A 3T7ZA 4RW6A 1VQ5N 4JI7K 2QXLA 3HTVA 2YNIA 3IKMA 4JKBA 4OKJA 2UXDK 4XH5A 4KI4A 3VMFB 1RILA 1IV0A 4FYDA 4DTMA 4BG9A 3TTFA 3SAFA 4A59A 3CCMN 3SJJA 4Z4IA 2RKIA 3AVLA 3BZCA 5A2QO 2UU9K 5FRMA 2OZSA 1NGAA 3OYEA 2QTDA 1YVNA 2Q0UA 2HSTA 1VQKN 1C1CA 5HRNA 4GY2B 5LY3A 3HI0A 4YDUC 2QI2A 4JLHA 1GLJO 5AQWA 4WQ5A 2DFEA 3DXMA 1VSIA 4JHDA 4CHOA 3TAGA 3NGYA 1VQ8N 3WT0A 5DM6L 2D0CA 4O44A 1J53A 4CZMA 4HUGA 3L4QA 1JLEA 3SUOA 4CEDA 1SKRA 1I3AA 3K9JA 2BDPA 2VWBA 5BPNA 4MDAA 4BRIA 3PUFA 2VG7A 3ZSVA 3FE1A 4B9QA 1S3XA 4PL8A 4A61A 4DCHA 3VA3A 4DQPA 2O8DA 2O8BA 1RBRA 3KJVA 2UUAK 3IUCA 1NLVA 3AVMA 3LP3A 4DTSA 1T7PA 1A5VA 4IJAA 4IJNA 4GNIA 2B4JA 1NNEA 1FJGK 3O4NA 4MQ3A 4WCEL 4DB3A 3J7AP 5KQDA 1R0AA 1NK5A 1VHXA 5T7BA 3B8AX 3NVMA 1NK0A 4KH6A 4XH1A 5C25A 4BRLA 3QFUA 3L2WA 3O4QA 3TAMA 5ELZA 2ZQBA 4IFVA 3RMDA 1V4SA 3AA5X 1TK5A 3ATUA 1W0HA 4H4MA 3LDOA 5CE3A 2UYTA 1T05A 3A2FA 5M1NA 4FK4A 1LAWA 4FJMA 4CJEA 1NWKA 3VA0A 4TSXA 2FBXA 4MLEA 1CXUA 3KLHA 2FF3B 3P31A 4K43A 3K5MA 4NLBA 4EP5A 4QOZB 3THXB 1HYSA 5F1XA 4IWVA 1NG9A 5GAGP 2W6LA 3AVBA 4N56A 2F96A 3D2EB 3VQDA 4O5BA 3J81O 3KTQA 4FWSA 4CGFA 4IOCL 4DWIA 4BRMA 3WEEB 3QFPA 1SV5A 3PY8A 4JKHA 2ZD1A 3HVRA 4HVJA 3DOKA 4DLGA 4WQ4A 4FWQA 1U04A 1I94K 3THVA 2P9UA 5GADP 4PQUA 2KW4A 3ZSXA 2WOMA 1MA9B 2EWSA 4JKEA 2ITMA 1HNWK 4B9UA 2JLEA 1FK9A 5JMVA 2E2OA 1Q7YO 4LC9B 3NDKA 4C8OA 4M3RA 1TV6A 4XH4A 1HRHA 5GAEP 4AHUA 2Z1HA 4JN4A 3CQXA 2QWOA 5BN8A 4DR7K 1BI4B 1MDUB 4EP4A 2G8WA 4FZYA 2HHTA 1MWMA 1TKDA 4Z0UA 1YUWA 5AQGA 5AZJB 4E1MA 2NRHA 2PY5A 3G71N 4OPAA 1NMDA 5H1SQ 3MWPA 1A5WA 1S9GA 2GELA 4MFBA 1HNXK 3ENHA 4DQIA 3WNEA 3O9QA 4LH4A 2VG6A 5CYMA 1TYQA 5HROA 1OH8A 1HPZA 4J2AA 3I33A 1C1BA 3CQ8A 3KLFA 3SQ1A 2HBJA 1WBDA 4B3TK 3T19A 5SWMA 1W97L 3HPOA 4IO8A 1XHXA 3IS9A 4C8NA 1VSHA 1L3SA 3RR8A 5AQHA 1BUPA 1ZBFA 3V1QA 3VQ6A 1IH7A 3DLGA 1K73O 3NH2A 4G1QA 2QM1A 1EQYA 3UE5A 2UXBK 3IAYA 3KLGA 4JRPA 3Q7BA 1NK6A 4EIAA 1WNSA 1WAFA 1NJWA 2WFBA 2B6AA 1SS6A 3TAPA 3ZSOA 2I7PA 3D2EA 4OX9K 1L3UA 3CM6A 4ZTJA 3OBYA 3CPEA 5BR8K 4H0PA 4EFHA 2GV9A 1JXBA 2D0OA 5KRSA 4E7JA 3SBTA 4HCCA 3AV9A 4CD1A 4DSKA 4U7BA 3OYAA 2WUSA 3O5BA 4QS9A 5C10A 1UWBA 4BC3A 4DMNA 1GOAA 4DTOA 2PYJA 4B1ZA 3NF7A 4X65K 4BRCA 4CFCA 3CCEN 4W5NA 2WONA 3W0LA 3SK3A 2OTLN 4H03B 2A6AA 1CXQA 3KD1E 1P90A 4M3TA 4H0VB 3C6AA 4BVOA 2QK9A 4K41A 3AO5A 3F2KA 3AVKA 5HL7L 3ZCMA 3WUHA 4Z4HA 1BIZA 3HO1A 2G8VA 2QWPA 3ALYA 2A40A 3R9PA 4CZKA 1KQSM 4C8LA 3JS6A 3OYBA 3V9UA 3TPQA 3IMXA 3SAHA 1BOTO 1YAGA 5AFUA 2VWKA 1FKOA 3N4PA 5AJ3K 5KTQA 1K9MO 2A1SA 4OGCA 4FM1A 5KPTA 1NBWA 3V6DA 4KHWA 3VPZA 2GX9A 5AQFA 4DSJA 3VESA 3B6OA 4ICLA 1QQOA 1B9FA 1RT5A 1S1TA 4JKGA 4KHQA 3MDQA 1QHTA 4YNQA 5EU7A 2V7YA 4E1JA 3KIOA 1GOCA 3DYAA 4CZHA 2VCPA 3CCUN 3OS2A 3VQPA 1BQNA 1QQCA 5HRPA 5AZIB 4BQLA 1KAXA 3AVCA 4Z4GA 1DEJA 3KHYA 1HMVA 1QE1A 2DY4A 1HQUA 3UIQA 4O8UA 2O4GA 4O0IA 3D7EO 2YCHA 2PBDA 3OYKA 2YHAA 4B3SK 3A5OC 4IFYA 3O1WA 1G15A 3EZ5A 1EKEA 1MU2A 3M6GA 4E3SA 1J5OA 3E66A 4KH4A 1A5XA 3LM2A 3TAFA 1IKVA 3L3VA 5AQYA 4E7HA 4OKEA 1KAYA 1C0UA 1RTIA 3D45A 3VOVA 1U4BA 4M3WA 1TKXA 4LSLA 2ITGA 1TKTA 2WBNA 2VWJA 1WSIA 2BGGA 2P5OA 3MECA 4B1YB 3ZEUA 5CZ1A 1BA1A 5I9EB 3P83D 2VGMA 4BRDA 3CYMA 4H0YB 1XMQK 1TK0A 2GUPA 3R8EA 4AHVA 4JS4A 1ZXOA 4YDUA 5M1KA 1TK8A 4FJNA 4UQGA 4AHTA 2Q97A 3TAQA 3DXMB 1J9AA 3K5OA 4DS5A 4H5WA 2VG5A 1JCFA 3ISNC 1VRUA 3VQAA 4Z94A 4DUYK 4DF8A 1KD1O 4BY9C 3S3NA 1NGEA 4GMJB 1JKHA 1IKYA 4DV0K 3AO1A 1DTTA 3TSUA 4DU3A 5M1OA 1RBVA 1HJOA 3EKUA 3ZLJA 3IFRA 1V4TA 3MCPA 4IEEA 5JVGL 3VENA 4J2DA 1SZ2A 5HLFA 4LF6K 5IWAK 5JLHA 2CH5A 4JKGB 4YOYA 2KKZA 2LSNA 4B9MA 4MO4A 4CIFA 1W7AA 4CGJA 3VQ9A 3V9SA 4ILJA 3OS1A 1G99A 4A62A 1VSFA 1HYZA 5SZTA 4W5OA 2D0BA 4CZFA 4OJRA 1X9SA 1TAUA 4AQYK 1M90O 4KHUA 4DQQA 3OBWA 3MMVA 3DLRA 4KPYA 2A3ZA 2X78A 2ZM6K 3QO9A 4EAHD 1YITN 3D6RA 1JLCA 3I0RA 1HKCA 1DGKN 3NAEA 4HTLA 1VSJA 3QNOA 3M1FA 4DV1K 1QZ6A 2Q31A 1TKZA 4LFCK 4WFBL 1NGIA 4FWLA 3J80O 4B9SA 4WYBA 3KLEA 1REVA 3O4WA 3KKRA 3PO5A 1KVBA 1TGOA 4I7FA 1UAXA 5EOYA 2Q1NA 1QHAA 1NOYA 2HHHK 3ZEUB 3C0BA 4X64K 4ELUA 1QSSA 3THWB 3DLLL 3E9LA 2P9KA 4FZZA 3FR0A 2BTFA 1BCOA 3DI6A 4CEAA 2HBMA 5JS2A 3GG4A 2D0PA 4GVEA 3A8YA 3H6EA 1UA0A 1BHLA 3OHRA 2CH6A 4JK9A 3U9DA 3CJAA 5FROA 1ZBSA 1VSDA 1KVCA 4NYNA 4E7LA 4BACA 3WNFA 5E84A 2VYPA 1C0GA 5J1EA 4BDYA 4Q5VA 4NB4A 3TTCA 3GDQA 3S41A 1J6ZA 1EX4A 2NZTA 2OZMA 5FPEA 2HVHA 4JYAK 1NGDA 1NKCA 3VQBA 4JKFA 1Q8IA 4OVLA 4KO0A 4Z4FA 4ISEA 4BREA 4DR5K 4WF9L 5LJVA 3TANA 4I6MB 1IG9A 3ZT1A 4ZHRA 4M3UA 2Q36A 3O9RA 3ITHA 4ILHA 2F7TA 3QERA 4E0DA 5AQMA 3L8BA 3I8DA 1X1PA 3ZETA 4DG1A 3AGRA 5K14A 3NE6A 3HSTB 5I42A 3CXCM 4CBXA 1WAJA 4CHNA 1RDUA 5GAHP 1Z26A 4CFDA 4CJVA 3OW2M 2Q2RA 3R3LA 3ZSZA 2O8CB 4PKGA 3E9OA 3CM5A 4PUOA 2IOCA 3D2FA 2GWJA 1XC9A 2P51A 4CK2A 1N32K 3CPWM 5BREA 3VEZA 1GLFO 1VSEA 2HHWA 1NJYA 3QDKA 3THWA 3CIPA 2XO7A 1GLCG 4CGIA 3SUPA 1IKWA 4A5BA 1LAVA 3PIOL 3CC2N 3EYZA 1GLLO 3VQ8A 4IKFA 2OPSA 1T03A 4A57A 3V4IA 1NK9A 1QSLA 3PSFA 4QCLA 2FC0A 2E5LK 4JHDB 3FZKA 4BR5A 1LWCA 4NCAA 3S3OA 1KRPA 1NOZA 3VF4A 1S1UA 3RRGA 5F2RA 3P1GA 5AQSA 2QXFA 4O55A 1J5EK 4PKIA 4FJJA 1NGCA 5D3GA 4H5NA 4BGAA 1L5UA 5BN9A 3PX6A 2RPIA 3CCSN 3ASMA 2FSNA 4M3XA 1HKGA 4FXDA 4KB0A 1ATSA 1ITGA 2A41A 2PFUA 2GEMA 3U3YA 1FKPA 2HB5A 2AA4A 3CHWA 3EEQA 4O0JA 4DV2K 2QA4N 2KFNA 4K0KK 2OPPA 3AVFA 5ADXA 2HBLA 5CYQA 4BROA 3K58A 4BRQA 1BA0A 1KVAA 1Y64A 4BRKA 3SNNA 3TU5A 4CZLA 3V1OA 3Q7CA 1YJ9N 1YT3A 4B1VA 2BH1A 1C0MA 3ZSRA 2RE2A 3KK1A 3UKUA 1VQNN 4BR4A 2Q3SA 3ZX0A 1KAZA 4IG0A 5LL6Z 4WE1A 5KI6A 2OANA 4EHUA 5C15A 1KFDA 4B9LA 2Y1IA 4YOWA 3PO4A 3AVNA 4Y0WA 4AHSA 2PAVA 5M1FA 3ATVA 1U49A 3H3NO 2OA8A 3HOSA 1SQKA 3SAGA 3HP6A 1SUQA 3LPUA 2X6SA 4B9TA 4FSVA 5KGXA 2R7YA 2A1RA 3OYIA 1JLGA 3NMUA 4N41A 1S1WA 3AVJA 4BGBA 2ZE2A 1EWQA 4A5AA 3L4IA 1W9HA 4OPHA 1RGIA 3MCAB 3CQYA 1N6QA 4CK1A 3JAMO 4KBOA 4BE1A 5DK5A 3CC7N 2AP1A 5FLXO 4FLXA 1OH5A 2HNYA 3K0SA 3PLAA 4BG8A 4FLTA 1KLMA 4FLWA 1S9EA 3C6TA 1WB9A 3JXUA 3RMAA 4CF0A 2XRIA 2YKMA 3HBTA 1NGFA 4BC4A 2Y1JA 3I8BA 4NCGA 2ATQA 4U67L 2UUCK 5KRTA 4FWRA 4W5RA 3MWTA 4RW7A 2HMPA 4CF1A 4CHYA 3VQ5A 3LP1A 5C2FA 3C65A 4DFMA 2NNWA 1WSGA 5HRSA 3DLBA 5AZIA 3RTVA 5CHIA 4FJ5A 4NXNK
chains in the Genus database with same CATH topology
3EEQA 3BY5A 2W6LA 2W6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EEQ A;  3BY5 A;  2W6L A;  2W6K A; 
#chains in the Genus database with same CATH topology
 3GOI A;  3H1V X;  4DTP A;  1VQP N;  4MLH A;  2ZJP L;  3LAM A;  2ZGZ A;  4M7Y A;  4J2B A;  1VRT A;  3VF6 A;  3EL2 A;  1UA1 A;  1RBT A;  1SL2 A;  1QVF M;  4IOA L;  4FLZ A;  2UXC K;  4DTX A;  3DM2 A;  3VEO A;  1XHZ A;  3AO2 A;  3WXM B;  3O9T A;  4FOE A;  3LWL A;  4HCB A;  2ZWH A;  5AR0 A;  4CJS A;  1IBK K;  4FWK A;  5E41 A;  1RT4 A;  1WSF A;  4AHC A;  4DTJ A;  3VF2 A;  4LF7 K;  3WEE A;  3C6H A;  4B1U B;  4E89 A;  4CEC A;  3OJS A;  1JCG A;  2YHX A;  1RT2 A;  2E2P A;  2O8E A;  3DXK B;  4FPB A;  4BE2 A;  1TAQ A;  4KHS A;  1Z25 A;  3FZL A;  1RT6 A;  5AQN A;  4B9N A;  4H4O A;  2YNF A;  4RWT A;  3SQ2 A;  4F4K A;  4O4G A;  4BC5 A;  1K8A O;  2IVN A;  3J7Z O;  3VQE A;  1NKB A;  4FJH A;  4BR9 A;  3O9U A;  2W42 A;  4WQ4 C;  4LD0 A;  1Q9Y A;  1QSY A;  1S5J A;  4G9Z A;  4CHZ A;  3I0S A;  4CGD A;  2PYL A;  1JCE A;  3LDL A;  3UKR B;  3L2Q A;  3BDP A;  5J2P A;  1WUA A;  3ZT4 A;  3CJ1 A;  3AA4 A;  3LAK A;  3VQ4 A;  1BCM A;  1OH6 A;  1GLA G;  1VQL N;  3UB5 A;  4QS7 A;  5GIP A;  4YOX A;  2G8I A;  3CMA N;  4FOI A;  3DRS A;  2FXU A;  2HNZ A;  3ZYY X;  4Z4E A;  2KLA A;  3SQ4 A;  1B92 A;  2HBK A;  4LFB K;  2ETJ A;  3DMJ A;  4KHP K;  4CJR A;  4DR6 K;  3E01 A;  2QWQ A;  4C8K A;  2OCE A;  1NMN A;  1TVR A;  3MED A;  4CIG A;  4JI3 K;  5AQU A;  4NXM K;  3LP2 A;  4BQZ A;  3RRH A;  4LSN A;  1ILY A;  4FWP A;  4CBW A;  1BQM A;  1VQ4 N;  4FLV A;  3O80 A;  1SL1 A;  4B3O A;  5HOO A;  3BEX A;  1EP4 A;  1LCU A;  3D0P A;  3LAN A;  4M41 A;  3HM9 A;  2YHB A;  1EWR A;  4H5R A;  3LDN A;  2W6K A;  1X3N A;  2YHW A;  4JI8 K;  3MN6 A;  3K5L A;  2P9L A;  4LF5 K;  4M45 A;  2A42 A;  2OPQ A;  1KXP A;  3P38 A;  3K9K A;  3HYF A;  4CF2 A;  1U6Z A;  1N33 K;  4GW6 A;  1E3M A;  1HQE A;  4YHH K;  4RW4 A;  3CME N;  1GLD G;  4AM6 A;  4BRN A;  1XNR K;  4WQ5 C;  4GKK K;  1ATN A;  4K42 A;  1JJ2 M;  4CEQ A;  4E1N A;  4DR1 K;  3SI6 A;  4CVN E;  4DV5 K;  2HHU A;  1VSM A;  2E4L A;  5AQI A;  1QZ5 A;  3HK2 A;  3QIC A;  3PV8 A;  4V19 S;  4N5S A;  4CJW A;  3L2R A;  5AQO A;  3DLH A;  3ID8 A;  2V51 B;  2YNG A;  5EXW A;  4LY7 A;  1X9M A;  1N8R O;  3LAL A;  4AHR A;  3C95 A;  1DKG D;  3O6W A;  1RFQ A;  3QML A;  3HJF A;  3MN7 A;  2DFF A;  4B1W B;  2FLO A;  2YJF A;  4ILG B;  4PA1 A;  4DV3 K;  2QKK A;  3JYT A;  4CHP A;  3LDP A;  3TTD A;  2O8C A;  3DLK A;  1X9J A;  1GLB G;  3SYZ A;  2NRR A;  1NU0 A;  3KVG A;  4JI6 K;  3QB0 A;  1LW0 A;  4BE0 A;  2NRX A;  4C1N K;  3FZM A;  4DU1 A;  3DJC A;  3U9Z A;  3V9X A;  4F2S A;  4F2R A;  3DXK A;  4H0T B;  4LF9 K;  1DT9 A;  2F9T A;  1M1K O;  4CJF A;  3EE9 A;  2IGI A;  1VQO N;  4KRE A;  1KSP A;  4CJQ A;  4DKW A;  3H3O B;  5B8H A;  1NGJ A;  2F4V K;  4JS5 A;  2JWL A;  4CW7 B;  4NO7 A;  4CCH A;  2QEX N;  3NF9 A;  3P5J A;  3THX A;  2P9P A;  4PL7 A;  3QEP A;  1Q81 O;  1X3M A;  2BE2 A;  1U45 A;  3MXI A;  3CD6 N;  4BVP A;  5KQ8 A;  3BGR A;  3WXJ A;  4B9V A;  4X62 K;  4C1N I;  4JRQ A;  4IO9 L;  2ASO A;  3QIO A;  3WNG A;  4CF8 A;  3WXK A;  2HOE A;  4B1X B;  2P9N A;  3BZK A;  4DFP A;  4CJ7 A;  4YOT A;  1HUX A;  3G10 A;  3VN5 A;  3QES A;  2KZZ A;  4K25 A;  3BY5 A;  3RVC A;  3KLI A;  1RDC A;  4CBU A;  1JLQ A;  1FW6 A;  4B3R K;  4R5P A;  3EN9 A;  4E7K A;  2O8F A;  4LH5 A;  2AJQ A;  4FJX A;  1RDD A;  3T1A A;  4FWN A;  2WC9 A;  4CJP A;  2Z1G A;  1Z05 A;  4WFA L;  5C0Y A;  2GTD A;  2CGL A;  3CJ7 A;  4B8C A;  1S22 A;  3E1Y A;  2VQF K;  3T1Y K;  4M3Y A;  3EZW A;  2E88 A;  3HOT A;  3SUQ A;  4F8R A;  4OO1 J;  1JXE A;  3QIN A;  2O8B B;  3V1R A;  4YOV A;  3DAW A;  1ZBL A;  2FBT A;  4QAG A;  5FPD A;  4AM7 A;  2QWN A;  3QBX A;  2P9K B;  4DFJ A;  1N36 K;  3W3D A;  4MDB A;  4FK0 A;  5CZ2 A;  3RMB A;  4FJL A;  1HKB A;  2RN2 A;  3M3Z A;  4N47 A;  3PX4 A;  4KRF A;  2IIR A;  2VQE K;  1RTH A;  3PSI A;  2Q0R A;  4AF1 A;  4BWM A;  4DQ8 A;  2RHK A;  4X66 K;  4A2A A;  2P9U B;  3ZSQ A;  5LMN K;  3P39 A;  2E20 A;  3TSQ A;  3RMC A;  4GV6 A;  2DPN A;  4BRH A;  2FBY A;  3O9S A;  1RTJ A;  3CJ9 A;  5TKW A;  2DFH A;  3VQC A;  1NGB A;  4IZ9 A;  3L3U A;  2O8D B;  4XIU A;  5I3U A;  4JEP A;  3OYL A;  2E8A A;  3CCJ N;  3VQ7 A;  5ADX H;  4DTU A;  4FJ7 A;  2HHV A;  4DR2 K;  1YHQ N;  4FM0 A;  3HSC A;  5BR9 A;  2ZGY A;  2QWR A;  4A2B A;  2XY8 A;  4CEZ A;  2HW3 A;  4JV5 K;  4CEO A;  3CER A;  1QVG M;  3T69 A;  1Q86 O;  1YVU A;  4CD3 A;  3NCI A;  4N76 A;  1LV5 A;  2G8U A;  3WQT A;  1D5A A;  1X9W A;  2B5J A;  3BF3 A;  3U4L A;  4CER A;  3TWH A;  2UUB K;  4R79 A;  4GKJ K;  4JKA A;  4KTQ A;  3TR8 A;  4CFB A;  3SV3 A;  3H46 O;  4CJL A;  1SL0 A;  4B08 A;  1XQS C;  1VQM N;  4KAZ A;  2O8E B;  1NJI O;  4IXC A;  1TL1 A;  3FZH A;  4KTW A;  4L3Q A;  4CGH A;  2FBV A;  3VGM A;  3O3H A;  4I2P A;  3G4S N;  1WOQ A;  3L2V A;  5J2M A;  5MLC Q;  4FCY A;  2YHY A;  5FPN A;  3KZB A;  4CZJ A;  3A0I X;  3ZT0 A;  1B9D A;  1BIS A;  1GOB A;  4M3Z A;  4CI6 A;  3NF8 A;  3OYM A;  1E4F T;  2V52 B;  1I39 A;  5BPM A;  4PWD A;  3QEW A;  1OVQ A;  5BRD A;  1EET A;  4FL9 A;  3AVI A;  4QS8 A;  3CCV N;  4PHT X;  3F73 A;  3UKU B;  3DRR A;  1QS4 A;  3TI0 A;  4IDK A;  5C12 A;  4CES A;  2P9I B;  4ID5 A;  3VEW A;  2W41 A;  2EHG A;  5JIC A;  1TYQ B;  4FJI A;  3BF1 A;  5JVH L;  3QBW A;  2J4R A;  5EX5 A;  4M7X A;  3KWG A;  2E2Q A;  2NUB A;  1WSH A;  4FO0 A;  1DTQ A;  3OYG A;  4CJK A;  4Y1D A;  3MX5 A;  5TKY A;  4HUE A;  1JL1 A;  3OS0 A;  3ULE A;  3RWU A;  2FF6 A;  1SKS A;  2KZM A;  3LDS A;  2ZJQ L;  1ZBU A;  1HNV A;  1T8E A;  1RTD A;  3CFR A;  4KH5 A;  3VEX A;  4PY5 A;  4YOU A;  2ZF5 O;  4H5T A;  2P5G A;  3CC4 N;  2H3G X;  3R6M A;  2IVO A;  4DR4 K;  3DOL A;  4YY3 K;  3O3G A;  5AQV A;  3KK2 A;  3K2P A;  1NK8 A;  3SJH A;  3UKR A;  3MEE A;  4JAX A;  3MN5 A;  2EX3 A;  2QWL A;  1N5Y A;  4DTR A;  4CZE A;  2GWK A;  3LDQ A;  3A5L C;  4FZX C;  4Z4C A;  4C23 A;  1NK4 A;  4NCB A;  1C0T A;  1RCH A;  3CI5 A;  3QEV A;  1TL3 A;  1K8K A;  3AA3 A;  4O8K A;  3KKS A;  1L3V A;  3CCQ N;  2JGU A;  1IBM K;  4I2Q A;  1CZ9 A;  2IC3 A;  4JK7 A;  3THY A;  3CCL N;  1XNQ K;  4FJ9 A;  4WFN L;  4H0X B;  2YV0 X;  3OA9 A;  2GBZ A;  3HRG A;  4FK2 A;  3ULE B;  3HT3 A;  4EZ6 A;  5IT9 O;  4FW2 A;  1VQ9 N;  1U2V A;  3GBT A;  4UY8 O;  1QQM A;  3T3F A;  1TUU A;  3OYN A;  2HF4 A;  5J2N A;  3IRX A;  4CEE A;  3ZX3 A;  1XC3 A;  1U2V B;  5AQP A;  3AVH A;  4I6M A;  3SMP A;  3A5N C;  1LWE A;  2CGK A;  4CK3 A;  1QTM A;  4F3O A;  1RT7 A;  1JL2 A;  3QIP A;  2X6N A;  2D0A A;  1OVY A;  3ZET B;  4Y1C A;  4DTN A;  4JK8 A;  1UOC A;  4DU4 A;  2OYQ A;  2QWM A;  1C0F A;  4RW8 A;  4DHY A;  3SMS A;  1NM1 A;  4JD2 B;  3QET A;  5GIN A;  2HF3 A;  3OVN A;  1K6Y A;  1SAZ A;  3LM9 A;  2HHX A;  1S1V A;  1YF5 L;  1IG8 A;  4BDZ A;  2G8F A;  4LFA K;  3DRP A;  4GVM A;  1LWF A;  4ELV A;  3CET A;  2E2N A;  3OYD A;  3NH0 A;  1HYV A;  5LJW A;  4B8A B;  3KK7 A;  4BWJ A;  3TAE A;  4CF9 A;  4M63 C;  3DLE A;  4I9Q A;  4YFU A;  5CY4 A;  4FLU A;  4OKK A;  3EO3 A;  1RBS A;  1VAZ A;  4KHY A;  4J8F A;  1C1A A;  4DUZ K;  2CGJ A;  3H08 A;  1QQN A;  1KTQ A;  1Q82 O;  4EHT A;  1U48 A;  3LP0 A;  1BIU A;  2YKN A;  2DTU A;  4RCH A;  4CHQ A;  4BR7 A;  1XUP O;  3VGK A;  2O4I A;  3N4Q A;  1E4G T;  1D4X A;  4AH9 A;  1KLN A;  3O1B A;  3VEY A;  4CFA A;  2F8S A;  1WSE A;  3D2F B;  1LOT B;  1NGG A;  3FZF A;  3LL3 A;  5BRF A;  4OLB A;  3QLH A;  4DR3 K;  4FVM A;  5DM7 L;  4DV7 K;  1ASU A;  2IAJ A;  5FDL A;  2KFZ A;  2NLX A;  1JLA A;  3IDH A;  2YI1 A;  3NVK A;  4DQR A;  4FWM A;  1EO1 A;  3A5M C;  5AQT A;  4ISG A;  4CJ3 A;  4JKC A;  5AQK A;  2KHO A;  4CJ4 A;  4HTU A;  4F9O A;  1ZBI A;  3SCX A;  3L0Q A;  3PX0 A;  2HMI A;  4ELT A;  3K59 A;  3M5R A;  4Q0B A;  1CZB A;  1BL3 A;  3MAQ A;  4E19 A;  3VTH A;  4YOR A;  2GUI A;  1EXQ A;  3ENO A;  1S6P A;  4FLY A;  2E1Z A;  1MWK A;  1XMO K;  3PIP L;  2FSJ A;  1P8Z A;  3OYJ A;  2F8T A;  2D4W A;  3SLC A;  1K8K B;  3NGI A;  4L8R B;  3OTO K;  3K57 A;  4JI1 K;  1YJW N;  1KFS A;  4BRA A;  1T6D A;  3FFK B;  3CG7 A;  2QKB A;  1RDB A;  4DS4 A;  5FRN A;  4ID1 A;  3E9P A;  2ZJR L;  3OYF A;  2HVI A;  2VGN A;  1ATR A;  1LW2 A;  1CLQ A;  3AO4 A;  2IDO A;  4JI4 K;  1D9D A;  3FLC O;  3VER A;  1YJN N;  4K8Z A;  5F0X A;  2ASP A;  1J54 A;  3U3G A;  3F9K A;  3HPG A;  1F21 A;  3NF6 A;  3WXL A;  4IDH A;  1C6V A;  2E1Y A;  3JSM A;  3ZX2 A;  1IO2 A;  1BDG A;  3AAP A;  3ZSY A;  1Q9X A;  4OGE A;  1NGH A;  4CJU A;  4ZTF A;  2FSK A;  4HHT A;  1RDW X;  5BRH A;  2XHB A;  3NHG A;  4NLC A;  2JWK A;  2NRT A;  3QEX A;  3FGU A;  3V81 A;  3NFA A;  1NK7 A;  2V7Z A;  3AVG A;  1WN7 A;  3I55 N;  2NRW A;  1DLO A;  2P9L B;  4KHN A;  1T6C A;  3I56 N;  3M8S A;  3ZSW A;  1TUY A;  1HJR A;  3AGK A;  3LWM A;  1HNI A;  3H1Q A;  4FWO A;  4IBN A;  3EY1 A;  2WTU A;  1IJJ A;  4DSE A;  2QW9 A;  4KFB A;  5EVZ A;  4BR0 A;  3NBP A;  3CFP A;  3VTI A;  1WBB A;  2BUP A;  3KWI A;  2HHS A;  4HUF A;  1RT3 A;  3HPH A;  4JNE A;  4GV9 A;  2D1K A;  3T1H K;  3VQQ A;  3RR7 A;  3S3M A;  3ZT3 A;  3CF5 L;  5AQR A;  3SUN A;  3OYC A;  1Q18 A;  4CZI A;  4B3M K;  5FPM A;  1N34 K;  3MN9 A;  2Z1I A;  3GL1 A;  4C8M A;  4CEB A;  2A5X A;  1KC8 O;  2P9N B;  1WLJ A;  4CZG A;  3VEV A;  5EY4 A;  4PKH A;  3HXM A;  4DQS A;  4JI0 K;  4FM2 A;  5M1Q A;  2ASM A;  1O13 A;  3HM8 A;  5BPL A;  3KD5 E;  1Z6R A;  3M8R A;  5JLF A;  1Y97 A;  3HZ6 A;  3G25 A;  4HWI A;  1U47 A;  4BC2 A;  4RTF D;  2P9S B;  4BRG A;  1BGX T;  1W2B M;  5M1P A;  3WQU A;  4DSF A;  1HX1 A;  3AAQ A;  1HNZ K;  4CGG A;  5C24 A;  3SQ0 A;  3MEG A;  1S72 N;  5E26 A;  3TSP A;  4BRP A;  3AY9 A;  1IKX A;  1VSL A;  1L3T A;  3WNH A;  1FXX A;  5KGW A;  3AVA A;  4W5Q A;  1BI4 A;  1XI1 A;  1R59 O;  4H0O A;  5GIO A;  5KPR A;  4JKD A;  4GV3 A;  3C6U A;  1JLF A;  5AQQ A;  4EZ9 A;  3O08 A;  1ZYQ A;  3SPZ A;  4KKO A;  4LF4 K;  2D5R A;  4CEF A;  1O1W A;  4OLA A;  4XEI A;  2YJE A;  4CJ5 A;  4H8K A;  3ULD A;  1JLB A;  3V9W A;  4M42 A;  3C94 A;  5DMR A;  1ZC6 A;  3FFI A;  3CJB A;  3KK3 A;  1XWL A;  4RG8 A;  1BG3 A;  4KV8 A;  3OYH A;  1VSK A;  2P9P B;  3MXM A;  4IOX A;  3CJC A;  3SPY A;  5JS1 A;  4OPJ A;  3WXI A;  1VQ6 N;  4BDP A;  2NRV A;  4DSI A;  3SV4 A;  1NJZ A;  4LF8 K;  2IVP A;  3RSE B;  1S1X A;  3VET A;  3GE1 A;  3C7N A;  3MK6 A;  3ID6 A;  4O5F A;  3SZ2 A;  2X74 A;  3K5N A;  3LPT A;  4DV4 K;  5AZJ A;  5KPZ A;  1YI2 N;  3P4I A;  5AQZ A;  3NH1 A;  3C7N B;  3MXJ A;  3SBG A;  3M8Q A;  4BRF A;  1ESV A;  2P9I A;  3ZT2 A;  2XY6 A;  2I7N A;  4IG3 A;  4CJT A;  3OY9 A;  2Z1J A;  1YTU A;  2O8F B;  4E7I A;  5AFU H;  4K8X A;  3O8M A;  1YIJ N;  3OJU A;  1KCF A;  5C2D A;  2BAN A;  3TAB A;  4H5V A;  3J8A A;  1WSJ A;  4CE9 A;  2OTJ N;  1VK0 A;  3H45 C;  4KI6 A;  1ASV A;  3B6P A;  3TAR A;  3U6F A;  3NGZ A;  1VQ7 N;  1OH7 A;  2YNH A;  3R1X A;  3V9Z A;  3HVT A;  1D8Y A;  2F9W A;  3DWL A;  4FJG A;  1BO5 O;  2HHQ A;  3M8P A;  4J2E A;  4ISF A;  3ENB A;  3G0Z A;  1T3V A;  4MO5 A;  3LZJ A;  1HPM A;  4JI5 K;  3RSE A;  4RW9 A;  3LZI A;  3IG1 A;  1ASW A;  1T44 A;  1IBL K;  1YTA A;  2RF2 A;  2OPR A;  5C42 A;  2NRZ A;  4IEI A;  4AIL C;  5AQX A;  3BP8 A;  1BWF O;  4FJK A;  4DLE A;  5HP1 A;  3AAR A;  4FPA A;  3L2U A;  3HP9 A;  5HBM A;  4DV6 K;  3HL8 A;  3VGL A;  4JD2 A;  4DSL A;  3THY B;  3U8X A;  2KTQ A;  1S6Q A;  4F3T A;  4IFE A;  3QNN A;  2P9S A;  3QEI A;  1RDA A;  1RNH A;  2G8H A;  3S9H A;  3F9M A;  3EKS A;  4FJ8 A;  4OPK A;  2XY7 A;  4BR2 A;  2YX6 A;  3EE8 A;  2XY5 A;  2HND A;  4I9L A;  1RT1 A;  5LMU K;  5J2Q A;  1CZA N;  3L6Q A;  2E6M A;  2W40 A;  4FW1 A;  4CIE A;  1BU6 O;  3CCR N;  4NYF A;  3CFO A;  2E6L A;  1NKE A;  3AO3 A;  1OKJ A;  5AQL A;  5AQJ A;  3G6E N;  1HLU A;  1HR0 K;  4KB1 A;  4JI2 K;  2I5J A;  4DFK A;  1YXQ A;  2G8K A;  3BUZ B;  4FVU A;  2P1J A;  1ZBH A;  1D9F A;  1SKW A;  2PZS A;  2IS3 A;  1GLE G;  5HRR A;  3J7Y P;  4W5T A;  5CR4 A;  1H1V A;  4KTZ A;  3O3F A;  2KQ2 A;  3AA2 A;  3F5T A;  4DF4 A;  1NJX A;  1RBU A;  3MX2 A;  3T7Z A;  4RW6 A;  1VQ5 N;  4JI7 K;  2QXL A;  3HTV A;  2YNI A;  3IKM A;  4JKB A;  4OKJ A;  2UXD K;  4XH5 A;  4KI4 A;  3VMF B;  1RIL A;  1IV0 A;  4FYD A;  4DTM A;  4BG9 A;  3TTF A;  3SAF A;  4A59 A;  3CCM N;  3SJJ A;  4Z4I A;  2RKI A;  3AVL A;  3BZC A;  5A2Q O;  2UU9 K;  5FRM A;  2OZS A;  1NGA A;  3OYE A;  2QTD A;  1YVN A;  2Q0U A;  2HST A;  1VQK N;  1C1C A;  5HRN A;  4GY2 B;  5LY3 A;  3HI0 A;  4YDU C;  2QI2 A;  4JLH A;  1GLJ O;  5AQW A;  4WQ5 A;  2DFE A;  3DXM A;  1VSI A;  4JHD A;  4CHO A;  3TAG A;  3NGY A;  1VQ8 N;  3WT0 A;  5DM6 L;  2D0C A;  4O44 A;  1J53 A;  4CZM A;  4HUG A;  3L4Q A;  1JLE A;  3SUO A;  4CED A;  1SKR A;  1I3A A;  3K9J A;  2BDP A;  2VWB A;  5BPN A;  4MDA A;  4BRI A;  3PUF A;  2VG7 A;  3ZSV A;  3FE1 A;  4B9Q A;  1S3X A;  4PL8 A;  4A61 A;  4DCH A;  3VA3 A;  4DQP A;  2O8D A;  2O8B A;  1RBR A;  3KJV A;  2UUA K;  3IUC A;  1NLV A;  3AVM A;  3LP3 A;  4DTS A;  1T7P A;  1A5V A;  4IJA A;  4IJN A;  4GNI A;  2B4J A;  1NNE A;  1FJG K;  3O4N A;  4MQ3 A;  4WCE L;  4DB3 A;  3J7A P;  5KQD A;  1R0A A;  1NK5 A;  1VHX A;  5T7B A;  3B8A X;  3NVM A;  1NK0 A;  4KH6 A;  4XH1 A;  5C25 A;  4BRL A;  3QFU A;  3L2W A;  3O4Q A;  3TAM A;  5ELZ A;  2ZQB A;  4IFV A;  3RMD A;  1V4S A;  3AA5 X;  1TK5 A;  3ATU A;  1W0H A;  4H4M A;  3LDO A;  5CE3 A;  2UYT A;  1T05 A;  3A2F A;  5M1N A;  4FK4 A;  1LAW A;  4FJM A;  4CJE A;  1NWK A;  3VA0 A;  4TSX A;  2FBX A;  4MLE A;  1CXU A;  3KLH A;  2FF3 B;  3P31 A;  4K43 A;  3K5M A;  4NLB A;  4EP5 A;  4QOZ B;  3THX B;  1HYS A;  5F1X A;  4IWV A;  1NG9 A;  5GAG P;  2W6L A;  3AVB A;  4N56 A;  2F96 A;  3D2E B;  3VQD A;  4O5B A;  3J81 O;  3KTQ A;  4FWS A;  4CGF A;  4IOC L;  4DWI A;  4BRM A;  3WEE B;  3QFP A;  1SV5 A;  3PY8 A;  4JKH A;  2ZD1 A;  3HVR A;  4HVJ A;  3DOK A;  4DLG A;  4WQ4 A;  4FWQ A;  1U04 A;  1I94 K;  3THV A;  2P9U A;  5GAD P;  4PQU A;  2KW4 A;  3ZSX A;  2WOM A;  1MA9 B;  2EWS A;  4JKE A;  2ITM A;  1HNW K;  4B9U A;  2JLE A;  1FK9 A;  5JMV A;  2E2O A;  1Q7Y O;  4LC9 B;  3NDK A;  4C8O A;  4M3R A;  1TV6 A;  4XH4 A;  1HRH A;  5GAE P;  4AHU A;  2Z1H A;  4JN4 A;  3CQX A;  2QWO A;  5BN8 A;  4DR7 K;  1BI4 B;  1MDU B;  4EP4 A;  2G8W A;  4FZY A;  2HHT A;  1MWM A;  1TKD A;  4Z0U A;  1YUW A;  5AQG A;  5AZJ B;  4E1M A;  2NRH A;  2PY5 A;  3G71 N;  4OPA A;  1NMD A;  5H1S Q;  3MWP A;  1A5W A;  1S9G A;  2GEL A;  4MFB A;  1HNX K;  3ENH A;  4DQI A;  3WNE A;  3O9Q A;  4LH4 A;  2VG6 A;  5CYM A;  1TYQ A;  5HRO A;  1OH8 A;  1HPZ A;  4J2A A;  3I33 A;  1C1B A;  3CQ8 A;  3KLF A;  3SQ1 A;  2HBJ A;  1WBD A;  4B3T K;  3T19 A;  5SWM A;  1W97 L;  3HPO A;  4IO8 A;  1XHX A;  3IS9 A;  4C8N A;  1VSH A;  1L3S A;  3RR8 A;  5AQH A;  1BUP A;  1ZBF A;  3V1Q A;  3VQ6 A;  1IH7 A;  3DLG A;  1K73 O;  3NH2 A;  4G1Q A;  2QM1 A;  1EQY A;  3UE5 A;  2UXB K;  3IAY A;  3KLG A;  4JRP A;  3Q7B A;  1NK6 A;  4EIA A;  1WNS A;  1WAF A;  1NJW A;  2WFB A;  2B6A A;  1SS6 A;  3TAP A;  3ZSO A;  2I7P A;  3D2E A;  4OX9 K;  1L3U A;  3CM6 A;  4ZTJ A;  3OBY A;  3CPE A;  5BR8 K;  4H0P A;  4EFH A;  2GV9 A;  1JXB A;  2D0O A;  5KRS A;  4E7J A;  3SBT A;  4HCC A;  3AV9 A;  4CD1 A;  4DSK A;  4U7B A;  3OYA A;  2WUS A;  3O5B A;  4QS9 A;  5C10 A;  1UWB A;  4BC3 A;  4DMN A;  1GOA A;  4DTO A;  2PYJ A;  4B1Z A;  3NF7 A;  4X65 K;  4BRC A;  4CFC A;  3CCE N;  4W5N A;  2WON A;  3W0L A;  3SK3 A;  2OTL N;  4H03 B;  2A6A A;  1CXQ A;  3KD1 E;  1P90 A;  4M3T A;  4H0V B;  3C6A A;  4BVO A;  2QK9 A;  4K41 A;  3AO5 A;  3F2K A;  3AVK A;  5HL7 L;  3ZCM A;  3WUH A;  4Z4H A;  1BIZ A;  3HO1 A;  2G8V A;  2QWP A;  3ALY A;  2A40 A;  3R9P A;  4CZK A;  1KQS M;  4C8L A;  3JS6 A;  3OYB A;  3V9U A;  3TPQ A;  3IMX A;  3SAH A;  1BOT O;  1YAG A;  5AFU A;  2VWK A;  1FKO A;  3N4P A;  5AJ3 K;  5KTQ A;  1K9M O;  2A1S A;  4OGC A;  4FM1 A;  5KPT A;  1NBW A;  3V6D A;  4KHW A;  3VPZ A;  2GX9 A;  5AQF A;  4DSJ A;  3VES A;  3B6O A;  4ICL A;  1QQO A;  1B9F A;  1RT5 A;  1S1T A;  4JKG A;  4KHQ A;  3MDQ A;  1QHT A;  4YNQ A;  5EU7 A;  2V7Y A;  4E1J A;  3KIO A;  1GOC A;  3DYA A;  4CZH A;  2VCP A;  3CCU N;  3OS2 A;  3VQP A;  1BQN A;  1QQC A;  5HRP A;  5AZI B;  4BQL A;  1KAX A;  3AVC A;  4Z4G A;  1DEJ A;  3KHY A;  1HMV A;  1QE1 A;  2DY4 A;  1HQU A;  3UIQ A;  4O8U A;  2O4G A;  4O0I A;  3D7E O;  2YCH A;  2PBD A;  3OYK A;  2YHA A;  4B3S K;  3A5O C;  4IFY A;  3O1W A;  1G15 A;  3EZ5 A;  1EKE A;  1MU2 A;  3M6G A;  4E3S A;  1J5O A;  3E66 A;  4KH4 A;  1A5X A;  3LM2 A;  3TAF A;  1IKV A;  3L3V A;  5AQY A;  4E7H A;  4OKE A;  1KAY A;  1C0U A;  1RTI A;  3D45 A;  3VOV A;  1U4B A;  4M3W A;  1TKX A;  4LSL A;  2ITG A;  1TKT A;  2WBN A;  2VWJ A;  1WSI A;  2BGG A;  2P5O A;  3MEC A;  4B1Y B;  3ZEU A;  5CZ1 A;  1BA1 A;  5I9E B;  3P83 D;  2VGM A;  4BRD A;  3CYM A;  4H0Y B;  1XMQ K;  1TK0 A;  2GUP A;  3R8E A;  4AHV A;  4JS4 A;  1ZXO A;  4YDU A;  5M1K A;  1TK8 A;  4FJN A;  4UQG A;  4AHT A;  2Q97 A;  3TAQ A;  3DXM B;  1J9A A;  3K5O A;  4DS5 A;  4H5W A;  2VG5 A;  1JCF A;  3ISN C;  1VRU A;  3VQA A;  4Z94 A;  4DUY K;  4DF8 A;  1KD1 O;  4BY9 C;  3S3N A;  1NGE A;  4GMJ B;  1JKH A;  1IKY A;  4DV0 K;  3AO1 A;  1DTT A;  3TSU A;  4DU3 A;  5M1O A;  1RBV A;  1HJO A;  3EKU A;  3ZLJ A;  3IFR A;  1V4T A;  3MCP A;  4IEE A;  5JVG L;  3VEN A;  4J2D A;  1SZ2 A;  5HLF A;  4LF6 K;  5IWA K;  5JLH A;  2CH5 A;  4JKG B;  4YOY A;  2KKZ A;  2LSN A;  4B9M A;  4MO4 A;  4CIF A;  1W7A A;  4CGJ A;  3VQ9 A;  3V9S A;  4ILJ A;  3OS1 A;  1G99 A;  4A62 A;  1VSF A;  1HYZ A;  5SZT A;  4W5O A;  2D0B A;  4CZF A;  4OJR A;  1X9S A;  1TAU A;  4AQY K;  1M90 O;  4KHU A;  4DQQ A;  3OBW A;  3MMV A;  3DLR A;  4KPY A;  2A3Z A;  2X78 A;  2ZM6 K;  3QO9 A;  4EAH D;  1YIT N;  3D6R A;  1JLC A;  3I0R A;  1HKC A;  1DGK N;  3NAE A;  4HTL A;  1VSJ A;  3QNO A;  3M1F A;  4DV1 K;  1QZ6 A;  2Q31 A;  1TKZ A;  4LFC K;  4WFB L;  1NGI A;  4FWL A;  3J80 O;  4B9S A;  4WYB A;  3KLE A;  1REV A;  3O4W A;  3KKR A;  3PO5 A;  1KVB A;  1TGO A;  4I7F A;  1UAX A;  5EOY A;  2Q1N A;  1QHA A;  1NOY A;  2HHH K;  3ZEU B;  3C0B A;  4X64 K;  4ELU A;  1QSS A;  3THW B;  3DLL L;  3E9L A;  2P9K A;  4FZZ A;  3FR0 A;  2BTF A;  1BCO A;  3DI6 A;  4CEA A;  2HBM A;  5JS2 A;  3GG4 A;  2D0P A;  4GVE A;  3A8Y A;  3H6E A;  1UA0 A;  1BHL A;  3OHR A;  2CH6 A;  4JK9 A;  3U9D A;  3CJA A;  5FRO A;  1ZBS A;  1VSD A;  1KVC A;  4NYN A;  4E7L A;  4BAC A;  3WNF A;  5E84 A;  2VYP A;  1C0G A;  5J1E A;  4BDY A;  4Q5V A;  4NB4 A;  3TTC A;  3GDQ A;  3S41 A;  1J6Z A;  1EX4 A;  2NZT A;  2OZM A;  5FPE A;  2HVH A;  4JYA K;  1NGD A;  1NKC A;  3VQB A;  4JKF A;  1Q8I A;  4OVL A;  4KO0 A;  4Z4F A;  4ISE A;  4BRE A;  4DR5 K;  4WF9 L;  5LJV A;  3TAN A;  4I6M B;  1IG9 A;  3ZT1 A;  4ZHR A;  4M3U A;  2Q36 A;  3O9R A;  3ITH A;  4ILH A;  2F7T A;  3QER A;  4E0D A;  5AQM A;  3L8B A;  3I8D A;  1X1P A;  3ZET A;  4DG1 A;  3AGR A;  5K14 A;  3NE6 A;  3HST B;  5I42 A;  3CXC M;  4CBX A;  1WAJ A;  4CHN A;  1RDU A;  5GAH P;  1Z26 A;  4CFD A;  4CJV A;  3OW2 M;  2Q2R A;  3R3L A;  3ZSZ A;  2O8C B;  4PKG A;  3E9O A;  3CM5 A;  4PUO A;  2IOC A;  3D2F A;  2GWJ A;  1XC9 A;  2P51 A;  4CK2 A;  1N32 K;  3CPW M;  5BRE A;  3VEZ A;  1GLF O;  1VSE A;  2HHW A;  1NJY A;  3QDK A;  3THW A;  3CIP A;  2XO7 A;  1GLC G;  4CGI A;  3SUP A;  1IKW A;  4A5B A;  1LAV A;  3PIO L;  3CC2 N;  3EYZ A;  1GLL O;  3VQ8 A;  4IKF A;  2OPS A;  1T03 A;  4A57 A;  3V4I A;  1NK9 A;  1QSL A;  3PSF A;  4QCL A;  2FC0 A;  2E5L K;  4JHD B;  3FZK A;  4BR5 A;  1LWC A;  4NCA A;  3S3O A;  1KRP A;  1NOZ A;  3VF4 A;  1S1U A;  3RRG A;  5F2R A;  3P1G A;  5AQS A;  2QXF A;  4O55 A;  1J5E K;  4PKI A;  4FJJ A;  1NGC A;  5D3G A;  4H5N A;  4BGA A;  1L5U A;  5BN9 A;  3PX6 A;  2RPI A;  3CCS N;  3ASM A;  2FSN A;  4M3X A;  1HKG A;  4FXD A;  4KB0 A;  1ATS A;  1ITG A;  2A41 A;  2PFU A;  2GEM A;  3U3Y A;  1FKP A;  2HB5 A;  2AA4 A;  3CHW A;  3EEQ A;  4O0J A;  4DV2 K;  2QA4 N;  2KFN A;  4K0K K;  2OPP A;  3AVF A;  5ADX A;  2HBL A;  5CYQ A;  4BRO A;  3K58 A;  4BRQ A;  1BA0 A;  1KVA A;  1Y64 A;  4BRK A;  3SNN A;  3TU5 A;  4CZL A;  3V1O A;  3Q7C A;  1YJ9 N;  1YT3 A;  4B1V A;  2BH1 A;  1C0M A;  3ZSR A;  2RE2 A;  3KK1 A;  3UKU A;  1VQN N;  4BR4 A;  2Q3S A;  3ZX0 A;  1KAZ A;  4IG0 A;  5LL6 Z;  4WE1 A;  5KI6 A;  2OAN A;  4EHU A;  5C15 A;  1KFD A;  4B9L A;  2Y1I A;  4YOW A;  3PO4 A;  3AVN A;  4Y0W A;  4AHS A;  2PAV A;  5M1F A;  3ATV A;  1U49 A;  3H3N O;  2OA8 A;  3HOS A;  1SQK A;  3SAG A;  3HP6 A;  1SUQ A;  3LPU A;  2X6S A;  4B9T A;  4FSV A;  5KGX A;  2R7Y A;  2A1R A;  3OYI A;  1JLG A;  3NMU A;  4N41 A;  1S1W A;  3AVJ A;  4BGB A;  2ZE2 A;  1EWQ A;  4A5A A;  3L4I A;  1W9H A;  4OPH A;  1RGI A;  3MCA B;  3CQY A;  1N6Q A;  4CK1 A;  3JAM O;  4KBO A;  4BE1 A;  5DK5 A;  3CC7 N;  2AP1 A;  5FLX O;  4FLX A;  1OH5 A;  2HNY A;  3K0S A;  3PLA A;  4BG8 A;  4FLT A;  1KLM A;  4FLW A;  1S9E A;  3C6T A;  1WB9 A;  3JXU A;  3RMA A;  4CF0 A;  2XRI A;  2YKM A;  3HBT A;  1NGF A;  4BC4 A;  2Y1J A;  3I8B A;  4NCG A;  2ATQ A;  4U67 L;  2UUC K;  5KRT A;  4FWR A;  4W5R A;  3MWT A;  4RW7 A;  2HMP A;  4CF1 A;  4CHY A;  3VQ5 A;  3LP1 A;  5C2F A;  3C65 A;  4DFM A;  2NNW A;  1WSG A;  5HRS A;  3DLB A;  5AZI A;  3RTV A;  5CHI A;  4FJ5 A;  4NXN K; 
#chains in the Genus database with same CATH homology
 3EEQ A;  3BY5 A;  2W6L A;  2W6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...