2W6KA

The crystal structure at 1.7 a resolution of cobe, a protein from the cobalamin (vitamin b12) biosynthetic pathway
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
142
structure length
142
Chain Sequence
GSHMPLPIPSLLIAGIGCRRGCSAEHLRALLERTLGEHGRSLAELDALASIDGKRDEPGLRQLATLLERPVHFLAPAVLHDYEPRLLSPSAVALRETGCSSVAEAAALALAERLGGGRADLLGAKRSDDRASIALARLLTER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COBE
publication title The Crystal Structure at 1.7 A Resolution of Cobe, a Protein from the Cobalamin (Vitamin B12) Biosynthetic Pathway
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
total genus 41
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01890 CbiG_C Cobalamin synthesis G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.180 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 CobE/GbiG C-terminal domain 2w6kA00
2W6KA 2W6LA 3EEQA 3BY5A
chains in the Genus database with same CATH superfamily
3EO3A 3VF2A 1NOZA 5CHIA 1IJJA 5KTQA 1SUQA 3PX0A 4CJKA 3U6FA 4FL9A 5GAEP 4JI6K 3CD6N 1WSJA 4BQLA 1LV5A 2Z1JA 2O4IA 4IOCL 3RR8A 3KK1A 4JYAK 2UYTA 4MFBA 1DTQA 3CETA 3FZMA 4M63C 1WN7A 1NJXA 4M3ZA 3J7AP 3BZKA 3HPHA 3N4QA 3WT0A 3SAGA 2FBYA 4IFEA 3D6RA 2ZJQL 3AVGA 4G9ZA 2VWBA 3NVKA 1C1CA 1C1AA 3L3VA 2AA4A 4GW6A 4DQSA 4ISEA 2OPRA 2HBKA 1XUPO 3AVLA 3UKUB 3ZSYA 1Z6RA 2FF6A 3UKRB 1LW2A 3O9RA 4YHHK 4BWMA 4YNQA 2VGNA 1CZ9A 3M8RA 3ZCMA 3AY9A 1JCFA 2YNGA 3GDQA 3I33A 4OGEA 3ENBA 4KB0A 4GKKK 4CJRA 2V7ZA 2X78A 4Z4IA 3K9JA 3CCMN 4LFAK 2KHOA 4M7XA 2WFBA 2FC0A 3T3FA 4FM2A 3VA0A 1SL2A 4CJVA 3EN9A 3J7YP 4FWPA 3NF8A 4NCAA 1G99A 1TUUA 2XRIA 1P8ZA 3ZYYX 3DXMB 4CHNA 4JD2A 3DLHA 4JI3K 3IRXA 1KLNA 2VGMA 1VQON 4B3OA 4CEZA 3KLHA 4FYDA 4Z4GA 3DOLA 2E20A 4PKIA 2FSNA 2OYQA 5CYQA 4AQYK 5AQWA 3O4WA 4CFAA 3K0SA 1HYZA 4AM6A 4CZLA 4O8KA 4N5SA 4M42A 1RBUA 4GMJB 3I56N 4JKGA 2A41A 4KREA 4CJEA 3I0SA 4CW7B 4JRPA 1JXBA 3B8AX 4JKHA 1BIZA 3ISNC 1VQNN 1KCFA 4Z4FA 4R79A 1CLQA 1X9MA 3O08A 1OH5A 4DFPA 4BR7A 4BRGA 4CZEA 4ELUA 5FPMA 3WEEB 2HNDA 3LANA 2P9KA 2QWMA 5AQIA 2G8UA 5KPZA 3ZT1A 4CZKA 1VQ5N 4JNEA 3VEVA 4CEOA 4DTRA 1WOQA 3DI6A 2UXDK 1N5YA 1QE1A 1K8KA 4EFHA 5HL7L 1NKEA 4DU4A 3R6MA 2Q1NA 1C0GA 4Z4CA 4GV6A 4DSEA 4FJ7A 1WSHA 4DMNA 2NRVA 1JLGA 1KLMA 3E01A 1IKWA 3V9XA 4DTPA 1CZBA 3MX5A 1U45A 4W5OA 5FRNA 3CQ8A 1I94K 3THYA 3WXIA 4J2DA 4IG0A 3L2UA 2BTFA 1TKTA 3ZETB 2G8KA 2X74A 3TU5A 1QHAA 2ZGZA 1EX4A 4DS5A 4X65K 3AARA 5M1QA 2E6LA 3D0PA 1X9WA 1IKYA 3WXMB 5F2RA 1JKHA 4KRFA 4E0DA 3TAQA 3JAMO 1RBVA 1Q82O 4HCCA 4K25A 4WFNL 2PZSA 3KIOA 2HF3A 4FWSA 5EU7A 1W9HA 1UA0A 2P9LA 2B4JA 3KLIA 4ELVA 3H08A 3RMDA 3CC7N 5JLHA 3ZT3A 5IWAK 4KHNA 1JLBA 3OW2M 4FSVA 3SBTA 4U7BA 2HVHA 3D2FB 1ITGA 1LW0A 2O8EB 3DLEA 4H4OA 2RE2A 4J8FA 4RWTA 3OYDA 4GV3A 5AZIB 3W3DA 4JK9A 4BRPA 2QKKA 5BREA 4OO1J 4HTUA 1SAZA 4M3YA 4KB1A 3EEQA 3O9TA 1BA1A 3F2KA 4N47A 3HI0A 4HUEA 1J5OA 3NF9A 4RW8A 3OYFA 1EKEA 5C42A 1WSGA 4E1MA 3EE8A 3VENA 3S3NA 5BRDA 4DSLA 3IDHA 2F8TA 2E6MA 2O8CA 5ADXA 1NGEA 4K43A 3TARA 5BR8K 3VGMA 3DJCA 3I0RA 1L5UA 1CZAN 3ZX2A 1P90A 3QBWA 1YJWN 4FOEA 5AQMA 5LL6Z 4B1WB 3QEPA 2Q31A 4DQQA 3CERA 2VCPA 1X9SA 3M8QA 1QTMA 4RW7A 4DTJA 1VK0A 2EHGA 3SLCA 1WLJA 1CXQA 1D9FA 1NGBA 1EQYA 5E26A 4C8LA 2F7TA 4BR4A 5HRSA 4CE9A 3TAFA 4JKAA 3H6EA 3AVCA 1GLDG 1Q81O 4LH5A 4H5TA 3AA4A 4FO0A 2O4GA 5BN9A 2P9UA 3L4QA 3KLEA 4NCBA 5HRNA 4H0OA 3PV8A 3LP3A 5IT9O 4B1ZA 5LY3A 3OYAA 4OLBA 1E3MA 2W42A 4FK4A 3QNNA 4OLAA 1KTQA 4PKHA 3P31A 1S1UA 4DR5K 3ATUA 1EXQA 1D8YA 2GUPA 1YTUA 2QEXN 1NNEA 4OJRA 2Q97A 3PX6A 4CHOA 3PUFA 3N4PA 1NK4A 5KGXA 2D0PA 1NK7A 2CH6A 1NMDA 3ZEUA 4M41A 3OYGA 4XH1A 3VN5A 3V4IA 4WFAL 3SUOA 3AO2A 4Y0WA 2XY7A 3FZKA 2KW4A 4JKBA 2IC3A 4YDUC 4BVPA 1VSFA 2W40A 3TTCA 4DSFA 4XIUA 4F4KA 4CZJA 3SQ4A 1BOTO 5F1XA 1VSIA 2NRHA 3VEYA 3TABA 4OPJA 5DM6L 4LSLA 2BANA 4Z94A 1QHTA 1L3TA 4BGAA 4BG9A 1T6DA 4EIAA 2P9SB 3P1GA 4BGBA 3AAPA 3J7ZO 5JICA 4JI7K 2I7PA 4FZXC 3TTDA 1FKPA 3HVRA 5KI6A 3O4NA 1XHXA 1RT5A 1GOAA 3J80O 1QSYA 4KHUA 5HRRA 3VTIA 4JHDA 1XC3A 5LMUK 1QQOA 1H1VA 1A5VA 1S9EA 2OZSA 2Z1GA 4CCHA 3ALYA 5GIOA 1BWFO 1SV5A 4MDAA 4E7LA 4LF5K 2HHXA 4NLBA 3VEZA 4YOYA 3OYBA 1U47A 4IEEA 4BRFA 4EP4A 3CJ1A 3OYEA 4FPBA 5JS1A 5C2FA 3F9MA 2KTQA 3V9UA 4J2AA 3GOIA 2ASPA 5FDLA 3O9QA 1NMNA 4DQIA 3QICA 4CHYA 5JMVA 1T8EA 1RTJA 4A5BA 1NGAA 3NDKA 1ASUA 2O8DB 2A1SA 1NG9A 1B9FA 4M3XA 3ULEA 5AFUA 4EZ6A 1NJIO 4MLEA 5C15A 3GL1A 1RT7A 3L2QA 3MECA 2HHHK 3KD5E 4MO4A 5J2QA 4JKFA 1HYVA 2HNYA 2D0CA 3A2FA 4DWIA 1TKDA 1RT4A 3FR0A 3WNFA 4YOUA 4BVOA 1X3NA 1JL1A 2FBXA 3NH0A 3RWUA 4O4GA 5GAGP 4JLHA 3V9WA 2YNIA 3RRGA 3O9UA 3DLKA 2BH1A 1ATNA 4XH5A 3NF6A 3PLAA 2O8FB 5AQNA 4JS4A 4BRCA 2QWRA 4XH4A 3THVA 1KAYA 1QQNA 2BDPA 3KK7A 4BR5A 1IV0A 1XMQK 3A8YA 3NVMA 2GWKA 3ZSRA 2DFHA 3DLBA 1KAXA 3OS0A 3GG4A 1NK8A 3HO1A 1VRUA 3ZSXA 3BDPA 4I9QA 3D7EO 4JRQA 3A5LC 3VPZA 1RT1A 4KHSA 3DLLL 4PY5A 3U9DA 2P9NA 3SV3A 1FW6A 2HBLA 3ENHA 3NFAA 1KRPA 2YJFA 3VQQA 4ISGA 5HRPA 2P9PB 4CI6A 4EP5A 2YJEA 4CIEA 4BRHA 1S22A 4FOIA 1IKVA 4CK3A 4H0TB 4BDYA 3C7NB 1YT3A 1YF5L 2PYLA 3HL8A 3VF6A 5AQZA 3HPOA 4Y1DA 5KGWA 2ZWHA 1NU0A 2CGLA 4KTWA 1QQCA 4YORA 2Q2RA 3HT3A 1RDWX 3CHWA 5EOYA 5AQRA 3SZ2A 4KV8A 1NK5A 5AQOA 1Q86O 2E2OA 1SKSA 1BL3A 1J5EK 4BRQA 3MN7A 4EHTA 5EY4A 3OYMA 4CERA 4H03B 3KLFA 3VQCA 4BC4A 5FRMA 1OH8A 4W5RA 1WSFA 1HPMA 5DMRA 3OTOK 1QSSA 1RDAA 4HCBA 3NH1A 2G8HA 1WSIA 3L2VA 1YJNN 4B3RK 3UKUA 4WFBL 4O8UA 4CGFA 3R8EA 4ICLA 4Y1CA 1GLAG 4CEFA 3NH2A 3LZJA 3O9SA 3DAWA 4AHTA 3QO9A 3EL2A 4LD0A 3I8DA 4BY9C 4EZ9A 3S9HA 4KI6A 1IBLK 4CHQA 1REVA 2Z1HA 1JLFA 3QBXA 1XMOK 4H0PA 4B1YB 1TKXA 1TK0A 1HNIA 3D2EB 1TYQB 2DY4A 3W0LA 3LWMA 4CJFA 3EYZA 5CYMA 4C8MA 1J6ZA 4K8XA 3JSMA 4O5BA 3QINA 2YHYA 3DXMA 3LDNA 1VQKN 5M1KA 4DKWA 4LY7A 2RHKA 4CK2A 2IVNA 1HPZA 3DRRA 1Q7YO 1TAQA 4Z4EA 5LMNK 2ZJPL 2QXLA 4HUFA 4BACA 3LP2A 2QWLA 4KHQA 1Z25A 2F9TA 4FWKA 1HUXA 3ZT4A 2RF2A 3BY5A 4BROA 2HVIA 3AVBA 4B1VA 1GLEG 5BPNA 4DR3K 1YITN 5KRTA 3M8PA 2D0BA 3KVGA 1O1WA 4FVMA 3AVHA 4CVNE 2OZMA 3SPZA 2P5GA 1GLCG 2YHAA 3NGZA 4I2PA 3IS9A 4ZTJA 2PBDA 1KVAA 1BA0A 2GTDA 3IKMA 3LDQA 5DM7L 4DV0K 4JI8K 4J2EA 3RMBA 3OVNA 1TL3A 2ZD1A 3WEEA 5HBMA 3WQUA 1HX1A 1SL0A 2ZJRL 2F96A 1WB9A 1BG3A 4ILGB 2D1KA 4A59A 1W2BM 4CZMA 1RTIA 4FJGA 4WCEL 1HMVA 2HHWA 4CBUA 4CGHA 2DFEA 4B9QA 4MLHA 4FM0A 3AAQA 4DV4K 5LJVA 4X62K 1XC9A 2YKNA 3TR8A 4PL8A 1JL2A 3BF1A 2VYPA 2YNFA 4E7JA 3FFIA 4HHTA 3HXMA 4FWQA 3AVNA 4QS8A 1W7AA 1XHZA 2NRZA 3S3MA 3NF7A 3C6HA 2QI2A 3K5NA 4ID5A 3VESA 4DTNA 3TSUA 3THWB 3U3YA 1K73O 2GELA 1IBMK 2FXUA 3O4QA 2E88A 3ZSVA 1YI2N 1J54A 4FJXA 1X9JA 1U2VB 4QS9A 2YI1A 1JLEA 3AGKA 4KH4A 2R7YA 3OBYA 5AQJA 4DHYA 4KO0A 3D2FA 3FLCO 2O8EA 3HOSA 1EETA 3VEOA 3VQBA 3M3ZA 3QEXA 5AZIA 3ITHA 1J9AA 4IDKA 4CZGA 1VAZA 4K8ZA 1JLCA 3AA2A 5E41A 3ASMA 4JAXA 1VQ4N 3CM5A 4ZTFA 1I39A 4CIGA 1NKCA 3SV4A 2AP1A 3H3NO 4JKCA 4X66K 4FJIA 3CYMA 4GV9A 3VEWA 4IO9L 2HBMA 5BN8A 4BC3A 1VSJA 5M1NA 4YOVA 2Q36A 3WXJA 1WUAA 2Q0UA 3CCEN 4YOXA 4DSIA 1MWMA 2VG5A 3PSFA 4CECA 2GUIA 3DXKB 5HROA 4JEPA 5KQDA 1L3SA 4FJLA 1VRTA 3EY1A 1VSEA 3L4IA 3OHRA 3P4IA 4N76A 4BC5A 1ZBLA 4CEBA 5CR4A 3KD1E 4I9LA 4JD2B 3NHGA 3O3FA 4CEAA 3MXMA 1U04A 4FJ9A 3K5MA 1FK9A 3TAMA 5H1SQ 4KI4A 3MK6A 3CQXA 3ZLJA 1RTDA 3CC4N 3KKSA 3VQ7A 4AH9A 1S3XA 4C8KA 3E9LA 3CCLN 3UB5A 3T7ZA 3AVMA 4KH5A 5F0XA 3RMCA 4WF9L 4CF8A 3HJFA 3CPEA 3ENOA 5ADXH 4CEDA 4NXMK 2KFNA 1NKBA 3GBTA 3CI5A 4FLXA 4BE2A 4FK0A 4DTMA 2QWPA 3NGIA 2HOEA 5FPDA 1ILYA 4DTXA 2WBNA 4A5AA 3MEEA 3FGUA 2LSNA 4QCLA 5BRHA 1BCOA 3B6OA 3C65A 3OJUA 3R3LA 4MO5A 4MQ3A 2I5JA 3G25A 1QQMA 3UE5A 4UY8O 2NNWA 3SCXA 3DMJA 1TGOA 2NZTA 1BGXT 3QESA 4F8RA 1IG8A 2KKZA 4WQ4C 1BHLA 4C1NK 5HLFA 4GKJK 1TAUA 1N6QA 4B9UA 2VG6A 2JLEA 4KBOA 1L3UA 3R9PA 2UXBK 4C23A 1LAWA 3VGKA 1KVCA 3H3OB 3NMUA 2IVPA 3OS1A 4B3SK 4PHTX 1VQ8N 3IUCA 2OPSA 4IJNA 3CCQN 1YUWA 2D0OA 2VQEK 3PSIA 1ZBUA 4FXDA 3EKSA 1NLVA 3TSPA 3I8BA 3BF3A 3LM9A 4MDBA 3O3GA 4DB3A 3CCSN 3JYTA 3THXB 4NLCA 1NGIA 3S3OA 3H1QA 5CE3A 1D4XA 4W5NA 2BGGA 4IFYA 3K2PA 3VQ9A 2EX3A 4FWNA 3VQ5A 4CIFA 3R1XA 4CD3A 2E1ZA 1NK0A 1DEJA 3LAKA 4IG3A 1XQSC 1VSDA 4ZHRA 1A5WA 1LOTB 5FPNA 2F8SA 1HKGA 4J2BA 3P83D 5AQSA 5EVZA 2P9IB 3WXLA 1HLUA 3VMFB 3WUHA 2GX9A 4BRMA 4BDPA 4OGCA 2QW9A 3KLGA 1G15A 1BU6O 1FKOA 3HP9A 4A61A 1VQ7N 2P5OA 1HJOA 1BDGA 4OPHA 4OPKA 2WTUA 2F9WA 3HZ6A 2W41A 2H3GX 4E1NA 4ILJA 3LDOA 4JKEA 5ELZA 4DR7K 4AHUA 2O8DA 4OPAA 1EP4A 5C25A 4BE0A 1TV6A 1S1WA 3NE6A 5AQYA 3MX2A 3O6WA 3OBWA 3U9ZA 1C6VA 4I6MB 2PAVA 4FWLA 4LC9B 4OVLA 3AA3A 5J1EA 2DPNA 3SJHA 3EZ5A 1T7PA 4L8RB 3ZSOA 4FJNA 4C8NA 1XNRK 3CPWM 3HSTB 4RW6A 3C6UA 4IKFA 3L8BA 1BUPA 3WXKA 4DQPA 1QZ6A 1N32K 4RTFD 1HNWK 2KZZA 4CD1A 4DV6K 1T44A 3Q7CA 4JN4A 2HNZA 1WBBA 2FLOA 4H5RA 4JV5K 1IH7A 2E2NA 3FZFA 4FM1A 4DR4K 2QWQA 4FLWA 2O8FA 4H5NA 4JI5K 2W6KA 2YX6A 1K9MO 5CZ2A 3VTHA 5B8HA 4BDZA 1ZBFA 4KFBA 2EWSA 5AFUH 2DTUA 3LALA 4CF0A 3KK3A 2ETJA 1RDCA 4EHUA 4DLGA 3RSEB 3MDQA 1GLJO 4DLEA 2W6LA 2O8BB 2KQ2A 4CESA 5A2QO 2D4WA 4A2AA 3CFPA 3QB0A 2YHXA 2P9PA 4CGIA 3PX4A 3QDKA 4IOAL 4FZZA 4NCGA 3SQ2A 3C7NA 2OPPA 1MWKA 4YOTA 3T19A 1EO1A 1GLFO 4HWIA 3CJ7A 1KQSM 1UAXA 3HK2A 4GVMA 3LM2A 1ZC6A 4NYNA 4BRIA 4DV5K 5I3UA 3CJ9A 1NM1A 1UWBA 1WNSA 4GY2B 4JI2K 2HB5A 5BPLA 4B9MA 3AO3A 4OKEA 4M3TA 3DLRA 4FJMA 3G0ZA 1NJZA 1C0MA 1UA1A 1BQNA 5AQUA 4DTUA 3SUNA 1RILA 1T6CA 3CMAN 2PY5A 1DT9A 2UXCK 3WNHA 2OTJN 2P1JA 3T1HK 1NK6A 4A2BA 4PL7A 4M7YA 5JS2A 3RVCA 4KPYA 5FROA 1SQKA 1Z26A 4DCHA 4DG1A 1UOCA 1RDDA 3QERA 1TK8A 3QFPA 4IBNA 4F9OA 1TYQA 3TANA 2A1RA 4Z0UA 2OANA 4N41A 1RNHA 1NGJA 4K41A 3OYHA 1C0FA 1BI4B 1QVFM 5EXWA 3VF4A 1TKZA 5I42A 3ZT0A 2Z1IA 4O0IA 1YHQN 2ZE2A 3P5JA 4BRLA 3KJVA 4BR2A 2A5XA 1VQMN 2Q0RA 4DUYK 3SNNA 1QVGM 2B5JA 3AVKA 3TSQA 4FLYA 5D3GA 4BC2A 5AZJB 5BR9A 2WUSA 3WNGA 3IG1A 1L3VA 3M1FA 1XNQK 1HJRA 1RT6A 1GOCA 1U6ZA 5DK5A 1K6YA 3RRHA 3VQ8A 3RR7A 4M3UA 4B1UB 4E7HA 4IWVA 5JVHL 3NGYA 4DQRA 2UUBK 3K5OA 4YDUA 4C8OA 3DLGA 3UKRA 2HW3A 5AQQA 3CMEN 4DTOA 4X64K 1JLQA 3F9KA 3SPYA 3DWLA 2CGKA 3ATVA 2NRXA 3BEXA 4IOXA 1KC8O 3CM6A 2ASMA 5SWMA 3L2RA 1QS4A 3TWHA 5AQFA 2RKIA 1U48A 4CBXA 2ITGA 4O5FA 1Y97A 3SUQA 1MU2A 4LFCK 1NJYA 4IFVA 2HMPA 1JXEA 3A5OC 3O3HA 1C0UA 2P9NB 1DKGD 3L6QA 4CJ5A 3OYIA 3VQ4A 5MLCQ 3L0QA 2HHTA 1ATRA 4JK8A 2E8AA 4DUZK 1VSHA 1DGKN 2YCHA 3BP8A 4HTLA 1HYSA 4CF1A 3KKRA 3M5RA 5J2PA 2E2QA 1RFQA 3S41A 4B08A 1S1TA 2V52B 4QS7A 3TPQA 3THWA 3A0IX 4F2SA 4BRNA 2JWLA 1BO5O 4CJ7A 1U2VA 3F73A 3HP6A 1HKCA 4L3QA 3LZIA 3MEDA 4B9VA 2Y1JA 3SBGA 1KFDA 3SMSA 4CJUA 4H0YB 4O44A 4YOWA 3O80A 2V7YA 2WC9A 4LF6K 3U4LA 4PA1A 1VSKA 4G1QA 3OYCA 3TAPA 2F4VK 3V81A 3CJBA 1JLAA 2XY8A 1SKRA 4DU1A 3E1YA 4DTSA 4FCYA 1GLLO 2E2PA 3O5BA 1T03A 2ZQBA 2J4RA 4RG8A 2GEMA 3EKUA 1XI1A 2HHUA 4CFCA 3VQ6A 1HR0K 1ASVA 1ESVA 3SQ1A 1RBRA 1VQPN 3OYLA 1S1XA 2OA8A 1VHXA 2G8FA 4BE1A 4DFMA 3V9SA 4DF4A 4FPAA 2CH5A 1SZ2A 4H8KA 1TUYA 3VQPA 1FXXA 4B3TK 3DXKA 3VQAA 1N8RO 4CZFA 1KXPA 3AVAA 5BPMA 1LWEA 3ZETA 4DR1K 4A57A 4CZIA 1OH6A 5AQHA 4E7KA 3LWLA 3AO5A 3J8AA 4DSKA 1RBTA 4E7IA 1S5JA 3H46O 1V4SA 3KTQA 1HNZK 4LF9K 2X6NA 4IXCA 2NRRA 2OTLN 2OPQA 5T7BA 3CXCM 3C6AA 5GINA 4CJTA 5LJWA 4CJ4A 3LDLA 5C24A 4CJWA 2PFUA 4B8AB 3I55N 4FZYA 3DM2A 5M1PA 5GADP 1ATSA 3VA3A 1KFSA 2ITMA 3T1YK 3JXUA 5JVGL 3ID8A 4CFDA 1E4FT 5AQKA 5C0YA 4PUOA 2QXFA 3EE9A 2QTDA 4OKKA 2IIRA 2B6AA 5JLFA 3U3GA 4CEEA 3VEXA 3CCRN 4E19A 5AQVA 1NJWA 3FZLA 4M3RA 1ZBSA 2KLAA 3CCVN 4LFBK 2ASOA 1ZBIA 5AJ3K 1HNXK 1EWQA 1O13A 4A62A 3MWPA 4OX9K 4DFJA 4CGDA 2Q3SA 3CG7A 4WYBA 4Q5VA 4BG8A 1ZBHA 4EAHD 1NBWA 5CY4A 2V51B 3CFOA 4FWOA 1HQUA 1OVQA 3KWIA 3HYFA 3AGRA 3QIOA 4GVEA 4FJ5A 4HVJA 3KWGA 3HM8A 3LAMA 3G4SN 3MN6A 4B3MK 4B9LA 3MXIA 1BISA 1KVBA 1LWCA 2A40A 2QA4N 3HSCA 3LPTA 2GWJA 1YIJN 2AJQA 2RPIA 5M1FA 1VSMA 2NUBA 4M45A 4LF8K 3THXA 3AVFA 4CHPA 4E89A 1R0AA 3CJCA 1T05A 4E3SA 4BREA 4JKGB 4YFUA 3HBTA 2UUCK 1X1PA 3QFUA 4DR6K 1TVRA 4BR9A 4DF8A 2IGIA 5GAHP 3G6EN 3MWTA 1W97L 2NRTA 4HUGA 5I9EB 2VWJA 3FE1A 3BUZB 3HVTA 4BRAA 3OJSA 2FSJA 1JCEA 1WSEA 4FJHA 5TKWA 3CFRA 1X3MA 3KK2A 2P9IA 2P9KB 3AV9A 4NYFA 4RCHA 4AHSA 3ZX3A 3AVJA 4DV2K 3G10A 3H1VX 4AHCA 3L3UA 3FFKB 4WE1A 5FLXO 4ELTA 4YY3K 4CGGA 1K8KB 3MCPA 2QKBA 2YHBA 4ILHA 4KKOA 1XWLA 3P39A 4PKGA 1C1BA 5E84A 3WNEA 5AQPA 1JJ2M 1DLOA 4LF4K 1LCUA 4DS4A 1S6QA 1KD1O 1U49A 3K59A 3C95A 2I7NA 3QEVA 2E1YA 4FLZA 3TAGA 2PYJA 1DTTA 5BRFA 4DFKA 3F5TA 2ZGYA 3THYB 4M3WA 4BRDA 3ID6A 4I6MA 4DQ8A 5SZTA 3NAEA 2G8VA 4QOZB 1N34K 2UU9K 4DR2K 3TI0A 3CQYA 2D0AA 3DYAA 1S1VA 4KHPK 2UUAK 4DV3K 5HP1A 3EZWA 1NGFA 2P9SA 4F3OA 3P38A 3NCIA 1U4BA 3V1QA 1RT3A 4FJJA 4KHWA 3DOKA 1E4GT 4JS5A 4KHYA 3IFRA 3E9OA 2P9LB 2X6SA 2ZM6K 4JI0K 3KZBA 3MXJA 5EX5A 4CK1A 1QSLA 4BRKA 2HSTA 2HHVA 1KAZA 4H4MA 5TKYA 1RDBA 4K0KK 4H0VB 1BCMA 3ZX0A 3QMLA 4K42A 5AR0A 1Q9YA 5AQXA 4ID1A 1OKJA 1KSPA 1RGIA 2FBVA 1LWFA 3RSEA 4O55A 3A5MC 2QK9A 2XO7A 4B9SA 3OYKA 4NXNK 2A42A 2O8BA 3PIPL 4KTQA 4B1XB 1NGCA 2HMIA 3G71N 3HRGA 4N56A 1WAFA 3SI6A 1IG9A 2IVOA 1Q9XA 4CEQA 5AQLA 4ISFA 4DU3A 1S72N 2O8CB 2IAJA 1ZXOA 2YHWA 3RTVA 1NOYA 3SQ0A 2HF4A 4AM7A 4JKDA 4OKJA 4CFBA 3SAHA 1D9DA 5AQGA 4CJSA 3LPUA 4FWMA 1HNVA 4NB4A 1GLBG 4IO8A 3MN5A 1OVYA 3GE1A 4FLVA 3ZSZA 3QETA 3K57A 4CBWA 3HPGA 1YAGA 4AF1A 3AO4A 4CJ3A 2ATQA 2IS3A 4WQ5C 2FSKA 3K58A 1S6PA 3SJJA 2JGUA 2P51A 3QNOA 1RBSA 3C6TA 4LH4A 1VQ6N 1VSLA 4PQUA 3U8XA 3AA5X 4AILC 4F3TA 2KFZA 5M1OA 1C0TA 3BZCA 3KHYA 1N36K 2BUPA 1MDUB 2VWKA 2YKMA 2G8WA 4F2RA 4FW2A 3IAYA 2XY6A 5CZ1A 4R5PA 2P9UB 3CF5L 1SS6A 1FJGK 4CF2A 3PY8A 3LDPA 4Q0BA 3E66A 4TSXA 3LP1A 5C10A 4CJLA 2QWNA 1Q18A 3LL3A 3K5LA 2E5LK 4RW4A 3UIQA 3OA9A 4FWRA 3AVIA 3DRSA 4FW1A 1MA9B 3T1AA 1VQ9N 3H45C 2IOCA 3WQTA 4B9TA 3VETA 3QEWA 3VGLA 3J81O 1IO2A 1BI4A 2CGJA 4CGJA 3SUPA 3O1BA 4V19S 4H5VA 3ZEUB 1NGDA 1A5XA 4FJ8A 3HTVA 1GOBA 3M8SA 3SYZA 2YV0X 4H0XB 3ULDA 3JS6A 1YVUA 1WAJA 2BE2A 3CCUN 5AZJA 4JK7A 2HHQA 1BQMA 1NGHA 3A5NC 4LSNA 4WQ4A 3TAEA 3C94A 1SKWA 2GV9A 1EWRA 2QWOA 1HQEA 2VG7A 4BWJA 3SMPA 3MAQA 3NBPA 3OYNA 1RCHA 1F21A 2JWKA 4IZ9A 2FF3B 4DV1K 3RMAA 4RW9A 1ZYQA 1Y64A 1YVNA 1M1KO 1B9DA 3LDSA 4CJQA 4H5WA 2YNHA 1I3AA 3M6GA 3QEIA 2WONA 2GBZA 4B8CA 2G8IA 1HKBA 4DSJA 2NLXA 4DV7K 1YXQA 3PO4A 4GNIA 2ZF5O 4JHDB 3TTFA 3V6DA 1T3VA 1Z05A 4AHRA 1TL1A 4Z4HA 1LAVA 2WOMA 4BQZA 3HM9A 3CCJN 1IBKK 1V4TA 1M90O 3D2EA 2KZMA 5HOOA 3FZHA 4E1JA 1R59O 1OH7A 3LP0A 1RT2A 1TK5A 5C2DA 4FVUA 4FK2A 2QM1A 1RTHA 2E4LA 1NWKA 1QZ5A 4XEIA 4I7FA 1Q8IA 3D45A 1JCGA 3BGRA 2XHBA 1N33K 4AHVA 2Y1IA 4W5TA 3VQEA 3O1WA 1ASWA 3QLHA 4FLUA 4B9NA 3PO5A 3MN9A 3ZSWA 1IKXA 4UQGA 3V9ZA 3VQDA 2A3ZA 1VQLN 2A6AA 1RDUA 2NRWA 3ULEB 1SL1A 1BIUA 1J53A 4CF9A 5C12A 4NO7A 1S9GA 4KAZA 3QIPA 3VOVA 3MEGA 4C1NI 3T69A 4BR0A 3MCAB 3V1OA 1NGGA 4IJAA 4CJPA 3SK3A 4KH6A 4IDHA 2IDOA 4FLTA 2XY5A 4CZHA 3SAFA 5KPRA 1WBDA 5KRSA 5FPEA 4U67L 3IMXA 1NK9A 4W5QA 4O0JA 1HRHA 2D5RA 4PWDA 2FBTA 4CHZA 5GIPA 5J2MA 5K14A 3ZT2A 3CC2N 3OS2A 4FJKA 1B92A 2HBJA 4WQ5A 5KPTA 3C0BA 1YTAA 3CJAA 3MMVA 3OYJA 3Q7BA 5KQ8A 3E9PA 4IEIA 3L2WA 1D5AA 2HHSA 5AQTA 4KTZA 4I2QA 2DFFA 3HOTA 3ZSQA 2RN2A 3VERA 1W0HA 4QAGA 4JI1K 3DRPA 3CIPA 4LF7K 3K9KA 1CXUA 3AO1A 3V1RA 5J2NA 4JI4K 3OY9A 3O8MA 1YJ9N 3PIOL 2OCEA 2VQFK 3B6PA 1K8AO
chains in the Genus database with same CATH topology
2W6KA 2W6LA 3EEQA 3BY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W6K A;  2W6L A;  3EEQ A;  3BY5 A; 
#chains in the Genus database with same CATH topology
 3EO3 A;  3VF2 A;  1NOZ A;  5CHI A;  1IJJ A;  5KTQ A;  1SUQ A;  3PX0 A;  4CJK A;  3U6F A;  4FL9 A;  5GAE P;  4JI6 K;  3CD6 N;  1WSJ A;  4BQL A;  1LV5 A;  2Z1J A;  2O4I A;  4IOC L;  3RR8 A;  3KK1 A;  4JYA K;  2UYT A;  4MFB A;  1DTQ A;  3CET A;  3FZM A;  4M63 C;  1WN7 A;  1NJX A;  4M3Z A;  3J7A P;  3BZK A;  3HPH A;  3N4Q A;  3WT0 A;  3SAG A;  2FBY A;  4IFE A;  3D6R A;  2ZJQ L;  3AVG A;  4G9Z A;  2VWB A;  3NVK A;  1C1C A;  1C1A A;  3L3V A;  2AA4 A;  4GW6 A;  4DQS A;  4ISE A;  2OPR A;  2HBK A;  1XUP O;  3AVL A;  3UKU B;  3ZSY A;  1Z6R A;  2FF6 A;  3UKR B;  1LW2 A;  3O9R A;  4YHH K;  4BWM A;  4YNQ A;  2VGN A;  1CZ9 A;  3M8R A;  3ZCM A;  3AY9 A;  1JCF A;  2YNG A;  3GDQ A;  3I33 A;  4OGE A;  3ENB A;  4KB0 A;  4GKK K;  4CJR A;  2V7Z A;  2X78 A;  4Z4I A;  3K9J A;  3CCM N;  4LFA K;  2KHO A;  4M7X A;  2WFB A;  2FC0 A;  3T3F A;  4FM2 A;  3VA0 A;  1SL2 A;  4CJV A;  3EN9 A;  3J7Y P;  4FWP A;  3NF8 A;  4NCA A;  1G99 A;  1TUU A;  2XRI A;  1P8Z A;  3ZYY X;  3DXM B;  4CHN A;  4JD2 A;  3DLH A;  4JI3 K;  3IRX A;  1KLN A;  2VGM A;  1VQO N;  4B3O A;  4CEZ A;  3KLH A;  4FYD A;  4Z4G A;  3DOL A;  2E20 A;  4PKI A;  2FSN A;  2OYQ A;  5CYQ A;  4AQY K;  5AQW A;  3O4W A;  4CFA A;  3K0S A;  1HYZ A;  4AM6 A;  4CZL A;  4O8K A;  4N5S A;  4M42 A;  1RBU A;  4GMJ B;  3I56 N;  4JKG A;  2A41 A;  4KRE A;  4CJE A;  3I0S A;  4CW7 B;  4JRP A;  1JXB A;  3B8A X;  4JKH A;  1BIZ A;  3ISN C;  1VQN N;  1KCF A;  4Z4F A;  4R79 A;  1CLQ A;  1X9M A;  3O08 A;  1OH5 A;  4DFP A;  4BR7 A;  4BRG A;  4CZE A;  4ELU A;  5FPM A;  3WEE B;  2HND A;  3LAN A;  2P9K A;  2QWM A;  5AQI A;  2G8U A;  5KPZ A;  3ZT1 A;  4CZK A;  1VQ5 N;  4JNE A;  3VEV A;  4CEO A;  4DTR A;  1WOQ A;  3DI6 A;  2UXD K;  1N5Y A;  1QE1 A;  1K8K A;  4EFH A;  5HL7 L;  1NKE A;  4DU4 A;  3R6M A;  2Q1N A;  1C0G A;  4Z4C A;  4GV6 A;  4DSE A;  4FJ7 A;  1WSH A;  4DMN A;  2NRV A;  1JLG A;  1KLM A;  3E01 A;  1IKW A;  3V9X A;  4DTP A;  1CZB A;  3MX5 A;  1U45 A;  4W5O A;  5FRN A;  3CQ8 A;  1I94 K;  3THY A;  3WXI A;  4J2D A;  4IG0 A;  3L2U A;  2BTF A;  1TKT A;  3ZET B;  2G8K A;  2X74 A;  3TU5 A;  1QHA A;  2ZGZ A;  1EX4 A;  4DS5 A;  4X65 K;  3AAR A;  5M1Q A;  2E6L A;  3D0P A;  1X9W A;  1IKY A;  3WXM B;  5F2R A;  1JKH A;  4KRF A;  4E0D A;  3TAQ A;  3JAM O;  1RBV A;  1Q82 O;  4HCC A;  4K25 A;  4WFN L;  2PZS A;  3KIO A;  2HF3 A;  4FWS A;  5EU7 A;  1W9H A;  1UA0 A;  2P9L A;  2B4J A;  3KLI A;  4ELV A;  3H08 A;  3RMD A;  3CC7 N;  5JLH A;  3ZT3 A;  5IWA K;  4KHN A;  1JLB A;  3OW2 M;  4FSV A;  3SBT A;  4U7B A;  2HVH A;  3D2F B;  1ITG A;  1LW0 A;  2O8E B;  3DLE A;  4H4O A;  2RE2 A;  4J8F A;  4RWT A;  3OYD A;  4GV3 A;  5AZI B;  3W3D A;  4JK9 A;  4BRP A;  2QKK A;  5BRE A;  4OO1 J;  4HTU A;  1SAZ A;  4M3Y A;  4KB1 A;  3EEQ A;  3O9T A;  1BA1 A;  3F2K A;  4N47 A;  3HI0 A;  4HUE A;  1J5O A;  3NF9 A;  4RW8 A;  3OYF A;  1EKE A;  5C42 A;  1WSG A;  4E1M A;  3EE8 A;  3VEN A;  3S3N A;  5BRD A;  4DSL A;  3IDH A;  2F8T A;  2E6M A;  2O8C A;  5ADX A;  1NGE A;  4K43 A;  3TAR A;  5BR8 K;  3VGM A;  3DJC A;  3I0R A;  1L5U A;  1CZA N;  3ZX2 A;  1P90 A;  3QBW A;  1YJW N;  4FOE A;  5AQM A;  5LL6 Z;  4B1W B;  3QEP A;  2Q31 A;  4DQQ A;  3CER A;  2VCP A;  1X9S A;  3M8Q A;  1QTM A;  4RW7 A;  4DTJ A;  1VK0 A;  2EHG A;  3SLC A;  1WLJ A;  1CXQ A;  1D9F A;  1NGB A;  1EQY A;  5E26 A;  4C8L A;  2F7T A;  4BR4 A;  5HRS A;  4CE9 A;  3TAF A;  4JKA A;  3H6E A;  3AVC A;  1GLD G;  1Q81 O;  4LH5 A;  4H5T A;  3AA4 A;  4FO0 A;  2O4G A;  5BN9 A;  2P9U A;  3L4Q A;  3KLE A;  4NCB A;  5HRN A;  4H0O A;  3PV8 A;  3LP3 A;  5IT9 O;  4B1Z A;  5LY3 A;  3OYA A;  4OLB A;  1E3M A;  2W42 A;  4FK4 A;  3QNN A;  4OLA A;  1KTQ A;  4PKH A;  3P31 A;  1S1U A;  4DR5 K;  3ATU A;  1EXQ A;  1D8Y A;  2GUP A;  1YTU A;  2QEX N;  1NNE A;  4OJR A;  2Q97 A;  3PX6 A;  4CHO A;  3PUF A;  3N4P A;  1NK4 A;  5KGX A;  2D0P A;  1NK7 A;  2CH6 A;  1NMD A;  3ZEU A;  4M41 A;  3OYG A;  4XH1 A;  3VN5 A;  3V4I A;  4WFA L;  3SUO A;  3AO2 A;  4Y0W A;  2XY7 A;  3FZK A;  2KW4 A;  4JKB A;  2IC3 A;  4YDU C;  4BVP A;  1VSF A;  2W40 A;  3TTC A;  4DSF A;  4XIU A;  4F4K A;  4CZJ A;  3SQ4 A;  1BOT O;  5F1X A;  1VSI A;  2NRH A;  3VEY A;  3TAB A;  4OPJ A;  5DM6 L;  4LSL A;  2BAN A;  4Z94 A;  1QHT A;  1L3T A;  4BGA A;  4BG9 A;  1T6D A;  4EIA A;  2P9S B;  3P1G A;  4BGB A;  3AAP A;  3J7Z O;  5JIC A;  4JI7 K;  2I7P A;  4FZX C;  3TTD A;  1FKP A;  3HVR A;  5KI6 A;  3O4N A;  1XHX A;  1RT5 A;  1GOA A;  3J80 O;  1QSY A;  4KHU A;  5HRR A;  3VTI A;  4JHD A;  1XC3 A;  5LMU K;  1QQO A;  1H1V A;  1A5V A;  1S9E A;  2OZS A;  2Z1G A;  4CCH A;  3ALY A;  5GIO A;  1BWF O;  1SV5 A;  4MDA A;  4E7L A;  4LF5 K;  2HHX A;  4NLB A;  3VEZ A;  4YOY A;  3OYB A;  1U47 A;  4IEE A;  4BRF A;  4EP4 A;  3CJ1 A;  3OYE A;  4FPB A;  5JS1 A;  5C2F A;  3F9M A;  2KTQ A;  3V9U A;  4J2A A;  3GOI A;  2ASP A;  5FDL A;  3O9Q A;  1NMN A;  4DQI A;  3QIC A;  4CHY A;  5JMV A;  1T8E A;  1RTJ A;  4A5B A;  1NGA A;  3NDK A;  1ASU A;  2O8D B;  2A1S A;  1NG9 A;  1B9F A;  4M3X A;  3ULE A;  5AFU A;  4EZ6 A;  1NJI O;  4MLE A;  5C15 A;  3GL1 A;  1RT7 A;  3L2Q A;  3MEC A;  2HHH K;  3KD5 E;  4MO4 A;  5J2Q A;  4JKF A;  1HYV A;  2HNY A;  2D0C A;  3A2F A;  4DWI A;  1TKD A;  1RT4 A;  3FR0 A;  3WNF A;  4YOU A;  4BVO A;  1X3N A;  1JL1 A;  2FBX A;  3NH0 A;  3RWU A;  4O4G A;  5GAG P;  4JLH A;  3V9W A;  2YNI A;  3RRG A;  3O9U A;  3DLK A;  2BH1 A;  1ATN A;  4XH5 A;  3NF6 A;  3PLA A;  2O8F B;  5AQN A;  4JS4 A;  4BRC A;  2QWR A;  4XH4 A;  3THV A;  1KAY A;  1QQN A;  2BDP A;  3KK7 A;  4BR5 A;  1IV0 A;  1XMQ K;  3A8Y A;  3NVM A;  2GWK A;  3ZSR A;  2DFH A;  3DLB A;  1KAX A;  3OS0 A;  3GG4 A;  1NK8 A;  3HO1 A;  1VRU A;  3ZSX A;  3BDP A;  4I9Q A;  3D7E O;  4JRQ A;  3A5L C;  3VPZ A;  1RT1 A;  4KHS A;  3DLL L;  4PY5 A;  3U9D A;  2P9N A;  3SV3 A;  1FW6 A;  2HBL A;  3ENH A;  3NFA A;  1KRP A;  2YJF A;  3VQQ A;  4ISG A;  5HRP A;  2P9P B;  4CI6 A;  4EP5 A;  2YJE A;  4CIE A;  4BRH A;  1S22 A;  4FOI A;  1IKV A;  4CK3 A;  4H0T B;  4BDY A;  3C7N B;  1YT3 A;  1YF5 L;  2PYL A;  3HL8 A;  3VF6 A;  5AQZ A;  3HPO A;  4Y1D A;  5KGW A;  2ZWH A;  1NU0 A;  2CGL A;  4KTW A;  1QQC A;  4YOR A;  2Q2R A;  3HT3 A;  1RDW X;  3CHW A;  5EOY A;  5AQR A;  3SZ2 A;  4KV8 A;  1NK5 A;  5AQO A;  1Q86 O;  2E2O A;  1SKS A;  1BL3 A;  1J5E K;  4BRQ A;  3MN7 A;  4EHT A;  5EY4 A;  3OYM A;  4CER A;  4H03 B;  3KLF A;  3VQC A;  4BC4 A;  5FRM A;  1OH8 A;  4W5R A;  1WSF A;  1HPM A;  5DMR A;  3OTO K;  1QSS A;  1RDA A;  4HCB A;  3NH1 A;  2G8H A;  1WSI A;  3L2V A;  1YJN N;  4B3R K;  3UKU A;  4WFB L;  4O8U A;  4CGF A;  3R8E A;  4ICL A;  4Y1C A;  1GLA G;  4CEF A;  3NH2 A;  3LZJ A;  3O9S A;  3DAW A;  4AHT A;  3QO9 A;  3EL2 A;  4LD0 A;  3I8D A;  4BY9 C;  4EZ9 A;  3S9H A;  4KI6 A;  1IBL K;  4CHQ A;  1REV A;  2Z1H A;  1JLF A;  3QBX A;  1XMO K;  4H0P A;  4B1Y B;  1TKX A;  1TK0 A;  1HNI A;  3D2E B;  1TYQ B;  2DY4 A;  3W0L A;  3LWM A;  4CJF A;  3EYZ A;  5CYM A;  4C8M A;  1J6Z A;  4K8X A;  3JSM A;  4O5B A;  3QIN A;  2YHY A;  3DXM A;  3LDN A;  1VQK N;  5M1K A;  4DKW A;  4LY7 A;  2RHK A;  4CK2 A;  2IVN A;  1HPZ A;  3DRR A;  1Q7Y O;  1TAQ A;  4Z4E A;  5LMN K;  2ZJP L;  2QXL A;  4HUF A;  4BAC A;  3LP2 A;  2QWL A;  4KHQ A;  1Z25 A;  2F9T A;  4FWK A;  1HUX A;  3ZT4 A;  2RF2 A;  3BY5 A;  4BRO A;  2HVI A;  3AVB A;  4B1V A;  1GLE G;  5BPN A;  4DR3 K;  1YIT N;  5KRT A;  3M8P A;  2D0B A;  3KVG A;  1O1W A;  4FVM A;  3AVH A;  4CVN E;  2OZM A;  3SPZ A;  2P5G A;  1GLC G;  2YHA A;  3NGZ A;  4I2P A;  3IS9 A;  4ZTJ A;  2PBD A;  1KVA A;  1BA0 A;  2GTD A;  3IKM A;  3LDQ A;  5DM7 L;  4DV0 K;  4JI8 K;  4J2E A;  3RMB A;  3OVN A;  1TL3 A;  2ZD1 A;  3WEE A;  5HBM A;  3WQU A;  1HX1 A;  1SL0 A;  2ZJR L;  2F96 A;  1WB9 A;  1BG3 A;  4ILG B;  2D1K A;  4A59 A;  1W2B M;  4CZM A;  1RTI A;  4FJG A;  4WCE L;  1HMV A;  2HHW A;  4CBU A;  4CGH A;  2DFE A;  4B9Q A;  4MLH A;  4FM0 A;  3AAQ A;  4DV4 K;  5LJV A;  4X62 K;  1XC9 A;  2YKN A;  3TR8 A;  4PL8 A;  1JL2 A;  3BF1 A;  2VYP A;  2YNF A;  4E7J A;  3FFI A;  4HHT A;  3HXM A;  4FWQ A;  3AVN A;  4QS8 A;  1W7A A;  1XHZ A;  2NRZ A;  3S3M A;  3NF7 A;  3C6H A;  2QI2 A;  3K5N A;  4ID5 A;  3VES A;  4DTN A;  3TSU A;  3THW B;  3U3Y A;  1K73 O;  2GEL A;  1IBM K;  2FXU A;  3O4Q A;  2E88 A;  3ZSV A;  1YI2 N;  1J54 A;  4FJX A;  1X9J A;  1U2V B;  4QS9 A;  2YI1 A;  1JLE A;  3AGK A;  4KH4 A;  2R7Y A;  3OBY A;  5AQJ A;  4DHY A;  4KO0 A;  3D2F A;  3FLC O;  2O8E A;  3HOS A;  1EET A;  3VEO A;  3VQB A;  3M3Z A;  3QEX A;  5AZI A;  3ITH A;  1J9A A;  4IDK A;  4CZG A;  1VAZ A;  4K8Z A;  1JLC A;  3AA2 A;  5E41 A;  3ASM A;  4JAX A;  1VQ4 N;  3CM5 A;  4ZTF A;  1I39 A;  4CIG A;  1NKC A;  3SV4 A;  2AP1 A;  3H3N O;  4JKC A;  4X66 K;  4FJI A;  3CYM A;  4GV9 A;  3VEW A;  4IO9 L;  2HBM A;  5BN8 A;  4BC3 A;  1VSJ A;  5M1N A;  4YOV A;  2Q36 A;  3WXJ A;  1WUA A;  2Q0U A;  3CCE N;  4YOX A;  4DSI A;  1MWM A;  2VG5 A;  3PSF A;  4CEC A;  2GUI A;  3DXK B;  5HRO A;  4JEP A;  5KQD A;  1L3S A;  4FJL A;  1VRT A;  3EY1 A;  1VSE A;  3L4I A;  3OHR A;  3P4I A;  4N76 A;  4BC5 A;  1ZBL A;  4CEB A;  5CR4 A;  3KD1 E;  4I9L A;  4JD2 B;  3NHG A;  3O3F A;  4CEA A;  3MXM A;  1U04 A;  4FJ9 A;  3K5M A;  1FK9 A;  3TAM A;  5H1S Q;  4KI4 A;  3MK6 A;  3CQX A;  3ZLJ A;  1RTD A;  3CC4 N;  3KKS A;  3VQ7 A;  4AH9 A;  1S3X A;  4C8K A;  3E9L A;  3CCL N;  3UB5 A;  3T7Z A;  3AVM A;  4KH5 A;  5F0X A;  3RMC A;  4WF9 L;  4CF8 A;  3HJF A;  3CPE A;  3ENO A;  5ADX H;  4CED A;  4NXM K;  2KFN A;  1NKB A;  3GBT A;  3CI5 A;  4FLX A;  4BE2 A;  4FK0 A;  4DTM A;  2QWP A;  3NGI A;  2HOE A;  5FPD A;  1ILY A;  4DTX A;  2WBN A;  4A5A A;  3MEE A;  3FGU A;  2LSN A;  4QCL A;  5BRH A;  1BCO A;  3B6O A;  3C65 A;  3OJU A;  3R3L A;  4MO5 A;  4MQ3 A;  2I5J A;  3G25 A;  1QQM A;  3UE5 A;  4UY8 O;  2NNW A;  3SCX A;  3DMJ A;  1TGO A;  2NZT A;  1BGX T;  3QES A;  4F8R A;  1IG8 A;  2KKZ A;  4WQ4 C;  1BHL A;  4C1N K;  5HLF A;  4GKJ K;  1TAU A;  1N6Q A;  4B9U A;  2VG6 A;  2JLE A;  4KBO A;  1L3U A;  3R9P A;  2UXB K;  4C23 A;  1LAW A;  3VGK A;  1KVC A;  3H3O B;  3NMU A;  2IVP A;  3OS1 A;  4B3S K;  4PHT X;  1VQ8 N;  3IUC A;  2OPS A;  4IJN A;  3CCQ N;  1YUW A;  2D0O A;  2VQE K;  3PSI A;  1ZBU A;  4FXD A;  3EKS A;  1NLV A;  3TSP A;  3I8B A;  3BF3 A;  3LM9 A;  4MDB A;  3O3G A;  4DB3 A;  3CCS N;  3JYT A;  3THX B;  4NLC A;  1NGI A;  3S3O A;  3H1Q A;  5CE3 A;  1D4X A;  4W5N A;  2BGG A;  4IFY A;  3K2P A;  3VQ9 A;  2EX3 A;  4FWN A;  3VQ5 A;  4CIF A;  3R1X A;  4CD3 A;  2E1Z A;  1NK0 A;  1DEJ A;  3LAK A;  4IG3 A;  1XQS C;  1VSD A;  4ZHR A;  1A5W A;  1LOT B;  5FPN A;  2F8S A;  1HKG A;  4J2B A;  3P83 D;  5AQS A;  5EVZ A;  2P9I B;  3WXL A;  1HLU A;  3VMF B;  3WUH A;  2GX9 A;  4BRM A;  4BDP A;  4OGC A;  2QW9 A;  3KLG A;  1G15 A;  1BU6 O;  1FKO A;  3HP9 A;  4A61 A;  1VQ7 N;  2P5O A;  1HJO A;  1BDG A;  4OPH A;  4OPK A;  2WTU A;  2F9W A;  3HZ6 A;  2W41 A;  2H3G X;  4E1N A;  4ILJ A;  3LDO A;  4JKE A;  5ELZ A;  4DR7 K;  4AHU A;  2O8D A;  4OPA A;  1EP4 A;  5C25 A;  4BE0 A;  1TV6 A;  1S1W A;  3NE6 A;  5AQY A;  3MX2 A;  3O6W A;  3OBW A;  3U9Z A;  1C6V A;  4I6M B;  2PAV A;  4FWL A;  4LC9 B;  4OVL A;  3AA3 A;  5J1E A;  2DPN A;  3SJH A;  3EZ5 A;  1T7P A;  4L8R B;  3ZSO A;  4FJN A;  4C8N A;  1XNR K;  3CPW M;  3HST B;  4RW6 A;  3C6U A;  4IKF A;  3L8B A;  1BUP A;  3WXK A;  4DQP A;  1QZ6 A;  1N32 K;  4RTF D;  1HNW K;  2KZZ A;  4CD1 A;  4DV6 K;  1T44 A;  3Q7C A;  4JN4 A;  2HNZ A;  1WBB A;  2FLO A;  4H5R A;  4JV5 K;  1IH7 A;  2E2N A;  3FZF A;  4FM1 A;  4DR4 K;  2QWQ A;  4FLW A;  2O8F A;  4H5N A;  4JI5 K;  2W6K A;  2YX6 A;  1K9M O;  5CZ2 A;  3VTH A;  5B8H A;  4BDZ A;  1ZBF A;  4KFB A;  2EWS A;  5AFU H;  2DTU A;  3LAL A;  4CF0 A;  3KK3 A;  2ETJ A;  1RDC A;  4EHU A;  4DLG A;  3RSE B;  3MDQ A;  1GLJ O;  4DLE A;  2W6L A;  2O8B B;  2KQ2 A;  4CES A;  5A2Q O;  2D4W A;  4A2A A;  3CFP A;  3QB0 A;  2YHX A;  2P9P A;  4CGI A;  3PX4 A;  3QDK A;  4IOA L;  4FZZ A;  4NCG A;  3SQ2 A;  3C7N A;  2OPP A;  1MWK A;  4YOT A;  3T19 A;  1EO1 A;  1GLF O;  4HWI A;  3CJ7 A;  1KQS M;  1UAX A;  3HK2 A;  4GVM A;  3LM2 A;  1ZC6 A;  4NYN A;  4BRI A;  4DV5 K;  5I3U A;  3CJ9 A;  1NM1 A;  1UWB A;  1WNS A;  4GY2 B;  4JI2 K;  2HB5 A;  5BPL A;  4B9M A;  3AO3 A;  4OKE A;  4M3T A;  3DLR A;  4FJM A;  3G0Z A;  1NJZ A;  1C0M A;  1UA1 A;  1BQN A;  5AQU A;  4DTU A;  3SUN A;  1RIL A;  1T6C A;  3CMA N;  2PY5 A;  1DT9 A;  2UXC K;  3WNH A;  2OTJ N;  2P1J A;  3T1H K;  1NK6 A;  4A2B A;  4PL7 A;  4M7Y A;  5JS2 A;  3RVC A;  4KPY A;  5FRO A;  1SQK A;  1Z26 A;  4DCH A;  4DG1 A;  1UOC A;  1RDD A;  3QER A;  1TK8 A;  3QFP A;  4IBN A;  4F9O A;  1TYQ A;  3TAN A;  2A1R A;  4Z0U A;  2OAN A;  4N41 A;  1RNH A;  1NGJ A;  4K41 A;  3OYH A;  1C0F A;  1BI4 B;  1QVF M;  5EXW A;  3VF4 A;  1TKZ A;  5I42 A;  3ZT0 A;  2Z1I A;  4O0I A;  1YHQ N;  2ZE2 A;  3P5J A;  4BRL A;  3KJV A;  4BR2 A;  2A5X A;  1VQM N;  2Q0R A;  4DUY K;  3SNN A;  1QVG M;  2B5J A;  3AVK A;  3TSQ A;  4FLY A;  5D3G A;  4BC2 A;  5AZJ B;  5BR9 A;  2WUS A;  3WNG A;  3IG1 A;  1L3V A;  3M1F A;  1XNQ K;  1HJR A;  1RT6 A;  1GOC A;  1U6Z A;  5DK5 A;  1K6Y A;  3RRH A;  3VQ8 A;  3RR7 A;  4M3U A;  4B1U B;  4E7H A;  4IWV A;  5JVH L;  3NGY A;  4DQR A;  2UUB K;  3K5O A;  4YDU A;  4C8O A;  3DLG A;  3UKR A;  2HW3 A;  5AQQ A;  3CME N;  4DTO A;  4X64 K;  1JLQ A;  3F9K A;  3SPY A;  3DWL A;  2CGK A;  3ATV A;  2NRX A;  3BEX A;  4IOX A;  1KC8 O;  3CM6 A;  2ASM A;  5SWM A;  3L2R A;  1QS4 A;  3TWH A;  5AQF A;  2RKI A;  1U48 A;  4CBX A;  2ITG A;  4O5F A;  1Y97 A;  3SUQ A;  1MU2 A;  4LFC K;  1NJY A;  4IFV A;  2HMP A;  1JXE A;  3A5O C;  3O3H A;  1C0U A;  2P9N B;  1DKG D;  3L6Q A;  4CJ5 A;  3OYI A;  3VQ4 A;  5MLC Q;  3L0Q A;  2HHT A;  1ATR A;  4JK8 A;  2E8A A;  4DUZ K;  1VSH A;  1DGK N;  2YCH A;  3BP8 A;  4HTL A;  1HYS A;  4CF1 A;  3KKR A;  3M5R A;  5J2P A;  2E2Q A;  1RFQ A;  3S41 A;  4B08 A;  1S1T A;  2V52 B;  4QS7 A;  3TPQ A;  3THW A;  3A0I X;  4F2S A;  4BRN A;  2JWL A;  1BO5 O;  4CJ7 A;  1U2V A;  3F73 A;  3HP6 A;  1HKC A;  4L3Q A;  3LZI A;  3MED A;  4B9V A;  2Y1J A;  3SBG A;  1KFD A;  3SMS A;  4CJU A;  4H0Y B;  4O44 A;  4YOW A;  3O80 A;  2V7Y A;  2WC9 A;  4LF6 K;  3U4L A;  4PA1 A;  1VSK A;  4G1Q A;  3OYC A;  3TAP A;  2F4V K;  3V81 A;  3CJB A;  1JLA A;  2XY8 A;  1SKR A;  4DU1 A;  3E1Y A;  4DTS A;  4FCY A;  1GLL O;  2E2P A;  3O5B A;  1T03 A;  2ZQB A;  2J4R A;  4RG8 A;  2GEM A;  3EKU A;  1XI1 A;  2HHU A;  4CFC A;  3VQ6 A;  1HR0 K;  1ASV A;  1ESV A;  3SQ1 A;  1RBR A;  1VQP N;  3OYL A;  1S1X A;  2OA8 A;  1VHX A;  2G8F A;  4BE1 A;  4DFM A;  3V9S A;  4DF4 A;  4FPA A;  2CH5 A;  1SZ2 A;  4H8K A;  1TUY A;  3VQP A;  1FXX A;  4B3T K;  3DXK A;  3VQA A;  1N8R O;  4CZF A;  1KXP A;  3AVA A;  5BPM A;  1LWE A;  3ZET A;  4DR1 K;  4A57 A;  4CZI A;  1OH6 A;  5AQH A;  4E7K A;  3LWL A;  3AO5 A;  3J8A A;  4DSK A;  1RBT A;  4E7I A;  1S5J A;  3H46 O;  1V4S A;  3KTQ A;  1HNZ K;  4LF9 K;  2X6N A;  4IXC A;  2NRR A;  2OTL N;  2OPQ A;  5T7B A;  3CXC M;  3C6A A;  5GIN A;  4CJT A;  5LJW A;  4CJ4 A;  3LDL A;  5C24 A;  4CJW A;  2PFU A;  4B8A B;  3I55 N;  4FZY A;  3DM2 A;  5M1P A;  5GAD P;  1ATS A;  3VA3 A;  1KFS A;  2ITM A;  3T1Y K;  3JXU A;  5JVG L;  3ID8 A;  4CFD A;  1E4F T;  5AQK A;  5C0Y A;  4PUO A;  2QXF A;  3EE9 A;  2QTD A;  4OKK A;  2IIR A;  2B6A A;  5JLF A;  3U3G A;  4CEE A;  3VEX A;  3CCR N;  4E19 A;  5AQV A;  1NJW A;  3FZL A;  4M3R A;  1ZBS A;  2KLA A;  3CCV N;  4LFB K;  2ASO A;  1ZBI A;  5AJ3 K;  1HNX K;  1EWQ A;  1O13 A;  4A62 A;  3MWP A;  4OX9 K;  4DFJ A;  4CGD A;  2Q3S A;  3CG7 A;  4WYB A;  4Q5V A;  4BG8 A;  1ZBH A;  4EAH D;  1NBW A;  5CY4 A;  2V51 B;  3CFO A;  4FWO A;  1HQU A;  1OVQ A;  3KWI A;  3HYF A;  3AGR A;  3QIO A;  4GVE A;  4FJ5 A;  4HVJ A;  3KWG A;  3HM8 A;  3LAM A;  3G4S N;  3MN6 A;  4B3M K;  4B9L A;  3MXI A;  1BIS A;  1KVB A;  1LWC A;  2A40 A;  2QA4 N;  3HSC A;  3LPT A;  2GWJ A;  1YIJ N;  2AJQ A;  2RPI A;  5M1F A;  1VSM A;  2NUB A;  4M45 A;  4LF8 K;  3THX A;  3AVF A;  4CHP A;  4E89 A;  1R0A A;  3CJC A;  1T05 A;  4E3S A;  4BRE A;  4JKG B;  4YFU A;  3HBT A;  2UUC K;  1X1P A;  3QFU A;  4DR6 K;  1TVR A;  4BR9 A;  4DF8 A;  2IGI A;  5GAH P;  3G6E N;  3MWT A;  1W97 L;  2NRT A;  4HUG A;  5I9E B;  2VWJ A;  3FE1 A;  3BUZ B;  3HVT A;  4BRA A;  3OJS A;  2FSJ A;  1JCE A;  1WSE A;  4FJH A;  5TKW A;  3CFR A;  1X3M A;  3KK2 A;  2P9I A;  2P9K B;  3AV9 A;  4NYF A;  4RCH A;  4AHS A;  3ZX3 A;  3AVJ A;  4DV2 K;  3G10 A;  3H1V X;  4AHC A;  3L3U A;  3FFK B;  4WE1 A;  5FLX O;  4ELT A;  4YY3 K;  4CGG A;  1K8K B;  3MCP A;  2QKB A;  2YHB A;  4ILH A;  4KKO A;  1XWL A;  3P39 A;  4PKG A;  1C1B A;  5E84 A;  3WNE A;  5AQP A;  1JJ2 M;  1DLO A;  4LF4 K;  1LCU A;  4DS4 A;  1S6Q A;  1KD1 O;  1U49 A;  3K59 A;  3C95 A;  2I7N A;  3QEV A;  2E1Y A;  4FLZ A;  3TAG A;  2PYJ A;  1DTT A;  5BRF A;  4DFK A;  3F5T A;  2ZGY A;  3THY B;  4M3W A;  4BRD A;  3ID6 A;  4I6M A;  4DQ8 A;  5SZT A;  3NAE A;  2G8V A;  4QOZ B;  1N34 K;  2UU9 K;  4DR2 K;  3TI0 A;  3CQY A;  2D0A A;  3DYA A;  1S1V A;  4KHP K;  2UUA K;  4DV3 K;  5HP1 A;  3EZW A;  1NGF A;  2P9S A;  4F3O A;  3P38 A;  3NCI A;  1U4B A;  3V1Q A;  1RT3 A;  4FJJ A;  4KHW A;  3DOK A;  1E4G T;  4JS5 A;  4KHY A;  3IFR A;  3E9O A;  2P9L B;  2X6S A;  2ZM6 K;  4JI0 K;  3KZB A;  3MXJ A;  5EX5 A;  4CK1 A;  1QSL A;  4BRK A;  2HST A;  2HHV A;  1KAZ A;  4H4M A;  5TKY A;  1RDB A;  4K0K K;  4H0V B;  1BCM A;  3ZX0 A;  3QML A;  4K42 A;  5AR0 A;  1Q9Y A;  5AQX A;  4ID1 A;  1OKJ A;  1KSP A;  1RGI A;  2FBV A;  1LWF A;  3RSE A;  4O55 A;  3A5M C;  2QK9 A;  2XO7 A;  4B9S A;  3OYK A;  4NXN K;  2A42 A;  2O8B A;  3PIP L;  4KTQ A;  4B1X B;  1NGC A;  2HMI A;  3G71 N;  3HRG A;  4N56 A;  1WAF A;  3SI6 A;  1IG9 A;  2IVO A;  1Q9X A;  4CEQ A;  5AQL A;  4ISF A;  4DU3 A;  1S72 N;  2O8C B;  2IAJ A;  1ZXO A;  2YHW A;  3RTV A;  1NOY A;  3SQ0 A;  2HF4 A;  4AM7 A;  4JKD A;  4OKJ A;  4CFB A;  3SAH A;  1D9D A;  5AQG A;  4CJS A;  3LPU A;  4FWM A;  1HNV A;  4NB4 A;  1GLB G;  4IO8 A;  3MN5 A;  1OVY A;  3GE1 A;  4FLV A;  3ZSZ A;  3QET A;  3K57 A;  4CBW A;  3HPG A;  1YAG A;  4AF1 A;  3AO4 A;  4CJ3 A;  2ATQ A;  2IS3 A;  4WQ5 C;  2FSK A;  3K58 A;  1S6P A;  3SJJ A;  2JGU A;  2P51 A;  3QNO A;  1RBS A;  3C6T A;  4LH4 A;  1VQ6 N;  1VSL A;  4PQU A;  3U8X A;  3AA5 X;  4AIL C;  4F3T A;  2KFZ A;  5M1O A;  1C0T A;  3BZC A;  3KHY A;  1N36 K;  2BUP A;  1MDU B;  2VWK A;  2YKM A;  2G8W A;  4F2R A;  4FW2 A;  3IAY A;  2XY6 A;  5CZ1 A;  4R5P A;  2P9U B;  3CF5 L;  1SS6 A;  1FJG K;  4CF2 A;  3PY8 A;  3LDP A;  4Q0B A;  3E66 A;  4TSX A;  3LP1 A;  5C10 A;  4CJL A;  2QWN A;  1Q18 A;  3LL3 A;  3K5L A;  2E5L K;  4RW4 A;  3UIQ A;  3OA9 A;  4FWR A;  3AVI A;  3DRS A;  4FW1 A;  1MA9 B;  3T1A A;  1VQ9 N;  3H45 C;  2IOC A;  3WQT A;  4B9T A;  3VET A;  3QEW A;  3VGL A;  3J81 O;  1IO2 A;  1BI4 A;  2CGJ A;  4CGJ A;  3SUP A;  3O1B A;  4V19 S;  4H5V A;  3ZEU B;  1NGD A;  1A5X A;  4FJ8 A;  3HTV A;  1GOB A;  3M8S A;  3SYZ A;  2YV0 X;  4H0X B;  3ULD A;  3JS6 A;  1YVU A;  1WAJ A;  2BE2 A;  3CCU N;  5AZJ A;  4JK7 A;  2HHQ A;  1BQM A;  1NGH A;  3A5N C;  4LSN A;  4WQ4 A;  3TAE A;  3C94 A;  1SKW A;  2GV9 A;  1EWR A;  2QWO A;  1HQE A;  2VG7 A;  4BWJ A;  3SMP A;  3MAQ A;  3NBP A;  3OYN A;  1RCH A;  1F21 A;  2JWK A;  4IZ9 A;  2FF3 B;  4DV1 K;  3RMA A;  4RW9 A;  1ZYQ A;  1Y64 A;  1YVN A;  1M1K O;  1B9D A;  3LDS A;  4CJQ A;  4H5W A;  2YNH A;  1I3A A;  3M6G A;  3QEI A;  2WON A;  2GBZ A;  4B8C A;  2G8I A;  1HKB A;  4DSJ A;  2NLX A;  4DV7 K;  1YXQ A;  3PO4 A;  4GNI A;  2ZF5 O;  4JHD B;  3TTF A;  3V6D A;  1T3V A;  1Z05 A;  4AHR A;  1TL1 A;  4Z4H A;  1LAV A;  2WOM A;  4BQZ A;  3HM9 A;  3CCJ N;  1IBK K;  1V4T A;  1M90 O;  3D2E A;  2KZM A;  5HOO A;  3FZH A;  4E1J A;  1R59 O;  1OH7 A;  3LP0 A;  1RT2 A;  1TK5 A;  5C2D A;  4FVU A;  4FK2 A;  2QM1 A;  1RTH A;  2E4L A;  1NWK A;  1QZ5 A;  4XEI A;  4I7F A;  1Q8I A;  3D45 A;  1JCG A;  3BGR A;  2XHB A;  1N33 K;  4AHV A;  2Y1I A;  4W5T A;  3VQE A;  3O1W A;  1ASW A;  3QLH A;  4FLU A;  4B9N A;  3PO5 A;  3MN9 A;  3ZSW A;  1IKX A;  4UQG A;  3V9Z A;  3VQD A;  2A3Z A;  1VQL N;  2A6A A;  1RDU A;  2NRW A;  3ULE B;  1SL1 A;  1BIU A;  1J53 A;  4CF9 A;  5C12 A;  4NO7 A;  1S9G A;  4KAZ A;  3QIP A;  3VOV A;  3MEG A;  4C1N I;  3T69 A;  4BR0 A;  3MCA B;  3V1O A;  1NGG A;  4IJA A;  4CJP A;  3SK3 A;  4KH6 A;  4IDH A;  2IDO A;  4FLT A;  2XY5 A;  4CZH A;  3SAF A;  5KPR A;  1WBD A;  5KRS A;  5FPE A;  4U67 L;  3IMX A;  1NK9 A;  4W5Q A;  4O0J A;  1HRH A;  2D5R A;  4PWD A;  2FBT A;  4CHZ A;  5GIP A;  5J2M A;  5K14 A;  3ZT2 A;  3CC2 N;  3OS2 A;  4FJK A;  1B92 A;  2HBJ A;  4WQ5 A;  5KPT A;  3C0B A;  1YTA A;  3CJA A;  3MMV A;  3OYJ A;  3Q7B A;  5KQ8 A;  3E9P A;  4IEI A;  3L2W A;  1D5A A;  2HHS A;  5AQT A;  4KTZ A;  4I2Q A;  2DFF A;  3HOT A;  3ZSQ A;  2RN2 A;  3VER A;  1W0H A;  4QAG A;  4JI1 K;  3DRP A;  3CIP A;  4LF7 K;  3K9K A;  1CXU A;  3AO1 A;  3V1R A;  5J2N A;  4JI4 K;  3OY9 A;  3O8M A;  1YJ9 N;  3PIO L;  2OCE A;  2VQF K;  3B6P A;  1K8A O; 
#chains in the Genus database with same CATH homology
 2W6K A;  2W6L A;  3EEQ A;  3BY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...