2VG6A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
550
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 131
structure length 548
sequence length 550
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg6A05
3KK1B 3I5BA 4F2RA 4NCAA 2FJWA 2A1RA 1ZTTA 2BRLA 3DRSA 4ZP6A 1N48A 1J5OA 1A5WA 3I0SA 4CJWA 4FLVA 5J2PA 1HNIA 3PV8A 3HPHA 1HYVA 3SV3A 4JV1A 1NK4A 3VQEA 4F4YA 2UVVA 3T5JA 3S3OA 3Q8PB 1NOZA 4CJLA 2GBZA 2J6TA 4YQWA 3EZ5A 3VQSA 3VQ8A 3KD1E 3TAQA 4FJ5A 4FW2A 3HP6A 1Q8IA 1XR7A 2D7SA 2BQRA 1TKXB 3NGZA 4KAZA 4KV8B 2DY4A 1W0HA 4FJ9A 3QEPA 3IG1A 3MEDB 4DTRA 3CO9A 2DTUA 4B8CA 1XR5A 1I3AA 4OLAA 3FRZA 2XCPA 1QTMA 3NDKA 3VQQA 1FXXA 3PX6A 4DWIA 4BDPA 1JLAA 5HLFA 3V6HA 5F8NA 4DSLA 4Y2AA 3OYBA 4WYLA 2IJFA 5KG2A 5HP1B 1S49A 4K4YA 4ECWA 1VRTA 3CM6A 3ITHA 4CECA 4EO8A 1DTQB 5KFAA 4DSJA 4CFCA 3LAMA 1GOBA 3ZSQA 1C0TB 3VQAA 2HAIA 3ZT3A 1Z4UA 4NLRA 3LANA 3AVMA 3H59A 3VQ4A 3RMCA 4KPYA 3DLEB 4X2BA 4RUAA 3LP1B 4TQRA 5T14A 4E1MA 1VRUB 4JS4A 2KZMA 3LP2A 4F8RA 4PWDA 3HSTB 1T03B 1JLQA 4I2QA 1NJYA 2FLNA 3CDEA 1QE1B 3MXMA 4CEAA 1JXEA 4TYBA 4C8OA 3FDSA 3NF7A 1MU2B 2KFNA 1JLEB 3ASMA 4DTJA 1RTHA 3KJVB 1O1WA 2VG5B 2GIQA 3AVJA 3MEEB 3TQ1A 4TSXA 4H4OB 2IM0A 1C1CA 3PW4A 2VWKA 5E41A 1NK5A 1S1XB 4PQUB 2HNZB 3CVKA 1RBTA 3PW0A 2DFHA 4KHQA 3DM2B 1NNDA 3EZUA 1Z26A 4FLUA 5J1EA 2OA8A 2A1SA 3P5JA 4E7LA 2HMIB 5J2NA 3K5OA 1LW2A 4R0EA 4TQSA 1SUQA 1WSFA 1TL1A 5C24B 5FDLA 3T5LA 5JS2A 3JYTB 2HVIA 4CEBA 4F4XA 1B9FA 1HQEA 5EUHA 2D41A 1N6QB 5C5JA 3TI0A 1WSHA 3RR8A 4KREA 1WNEA 4CJ4A 4KKOA 4LSNB 2Q3SA 4AH9A 1S9GA 2AGPA 2YHAA 3BDPA 3PO5A 3RRGA 3L3VA 5KFWA 1RTDB 3GIIA 3UR0A 4O55A 4IR1A 4KSEB 4F4KA 4Z4GA 1CXQA 3OHBA 4DMNA 3H08A 4RUCA 4RNHA 3M9OB 2XHBA 1HNVA 1YVFA 4NLXA 5CYMA 2B43A 1LW0B 2YNIB 3H5XA 3G6YA 4ZPBA 4CGDA 2FVRA 3QNOA 3T5KA 1S1WA 4IFVA 3TAMB 3OYGA 2G8KA 1VSHA 3OJUA 4JUZA 4IBNA 4GW6A 3OLAA 4LH4A 5CYQB 3MR2A 3FQLA 3V81B 3O3HA 1RT1A 1J9AA 1B9DA 1QUVA 4ZVEA 3H5SA 3KLIA 3SZ2A 4CF0A 4ID5B 4I9QA 2CJQA 4CJUA 4Z0UA 4IH7A 2OPRA 1DTTA 4DU1A 4HYKA 1S1TB 4FJ7A 4IRCA 2BE2A 2PY5A 3AVBA 2X74A 3V4IA 3KLHA 5KFHA 2D3UA 4DQPA 2VG6B 3GYNA 2KW4A 3RBEA 1WSEA 3MECB 3UPFA 3KHHA 4LH5A 4Z4FA 4F50A 4LY7A 2VG7A 2OPQA 1REVA 2G8VA 4KRFA 4IOBA 2B5JA 4CHYA 3TAEA 3AA2A 3KLEB 1EX4A 2DFFA 4CEQA 4O0JA 3C6TB 2ETJA 3OYCA 4NLTA 4G1QA 2JC1A 2UVWA 3V1QA 3AVHA 2XY8A 2W42A 2YNGA 4RG8A 1U4BA 3H98A 5DLGA 2B4JA 4KO0A 3M8QB 4ELUA 4CF1A 4Y1CA 1QSLA 4RW8B 5HBMA 4GC6A 3VQ7A 3DDKA 2RPIA 1TAQA 1FK9A 4B3OA 3DI6A 4WZQA 2UUWA 4DTUA 4FLWA 4O3NA 3I0RB 2ZE2B 1HYSA 3PUFA 4IH5A 4WFZA 2R8JA 3AVNA 3OL9A 2FVQA 1FKOB 3ZT2A 3K58A 4AHRA 2WONB 2NUBA 1RT7A 4N47A 4O4RA 2Y1JA 4B9SA 3TARA 1Q9YA 2W9AA 3SUNA 3QIPA 3C95A 3EPGA 2W9CA 2XRIA 1R0AA 4M42A 4M3XA 1RT4B 1BL3A 4FW1A 4K8XA 3ZCMA 3QYYA 1IKYB 4ED0A 1RCHA 4PUOA 3AVIA 4KB1A 3QZ7A 4C8NA 5KRTA 4YMEA 1KSPA 3BGRA 2ASJA 4ZTJA 4ZP7A 5KTQA 3OYAA 2D3ZA 2D0CA 3C6UA 4E3SA 4I2PA 3NHGA 3TAGA 1D5AA 5KG0A 1NJWA 4CCHA 1ASVA 4DFJA 3OL8A 3KLFA 4JRPA 2HHXA 3OJSA 4O44A 4HCBA 2XO7A 3G0ZA 4K4VA 4Q45A 1KVAA 3NBPB 2VWJA 3M8PB 4OKJA 3IAYA 2PZSA 5I42B 3NE6A 4KI6A 4KHUA 3DMJB 2V9WA 3OLBA 1HPZB 4KB0A 1CXUA 1VSMA 3AO4A 1RT3A 2WCXA 4Q5VA 2IAJA 2QV6A 3PX4A 3LDSA 2ZD1A 3MFIA 4RW4B 4EYHB 4TN2A 4CFDA 3KK3B 3PJWA 3SPZA 2IM1A 3L2UA 3AO1A 4FJHA 4R8UA 4CHZA 1ASWA 3TR8A 4J9SA 3H5UA 3HK2A 4B9LA 3V9WA 3NH2A 4Q8FA 4KFBB 5DMRA 3OYLA 3KHRA 4FVMA 1SH2A 5HROA 2X78A 4CGGA 4DSKA 4O4GB 3LPTA 1RTIA 4RW7A 3AV9A 4ELVA 5KG4A 3AA3A 4CIGA 3LP0B 3DLRA 1SKWA 4DL5A 3ZSZA 3NH1A 4M3TA 4URQU 4KHSA 1QAIA 2G8FA 4QAGA 1UWBA 1VSLA 4KTZA 4CE9A 4E1NA 3QGHA 4DG1A 1GX6A 3UQSA 1SL0A 5KFQA 1RDAA 3VQ9A 4F2SA 4Q0BA 3ZT0A 4MIAA 3IN5A 1N5YA 1X9MA 3U3GA 2YNHB 4O3PA 4Z4IA 2ZKUA 3RB4A 1ITGA 4YP3A 2D0AA 5KG1A 4K4XA 3L2WA 4ZVFA 2RN2A 3DOKA 4YR0A 1FKPA 3SQ0A 4DQIA 4DL7A 3SV4A 4NLOA 1C0UB 5J2MB 3KK2B 4TLRA 4HUGA 1WNSA 1IKVA 2BDPA 1T3NA 3TWHA 3MR6A 1BISA 3OL6A 3OY9A 3NL0A 3MXJA 4WFYA 2F8SA 4ZVGA 3RMDA 4QOZB 4O3QA 4MK9A 2QXFA 3SJJA 4MFBB 5J2QA 1C1BA 1ZBUA 2FBYA 4ED3A 4EZ9A 4RZRA 5I3UB 3O4NA 4BE2A 3BQ1A 1N56A 4CHNA 2I5JA 3LP3A 5KFZA 3PW5A 2EX3A 4NLPA 5DLFA 2WRMA 3IGVA 3H2LA 4IG3B 2GC8A 4DLGA 4NLGA 3L2RA 5KT2A 1JLBB 4FS1A 4TXSA 3NAEA 3NAIA 1WAJA 1RTJA 2AX1A 3GV7B 3KD5E 2Z1JA 4UQGA 3JSMB 3RMBA 4O3SA 4MH8A 4M3RA 1S1VA 5F8GA 3N6MA 4J2BA 3VQDA 1TKTA 1XHXA 1JLFB 5D3GB 3GIJA 3V6DB 1VSEA 2YNFB 4CEDA 3LWMA 3VQ6A 2IGIA 5DGBA 4HUFA 4DSIA 2GUIA 4NYZA 2HHVA 1CLQA 3SQ4A 1RA6A 3AVKA 1ASUA 2IM3A 2P5OA 4HCCA 1HMVB 3S3MA 5EDWA 1BHLA 1UAXA 1JLCA 4BE1A 3PR5B 3E01A 3KLGB 4J2DA 3RRHA 2AX0A 2HNYB 2RF2A 1JL2A 3V1RA 4TY8A 1BQNB 1NKEA 2KFZA 4FZXC 5KG3A 2FBTA 3QEVA 1HYZA 1HJRA 1U45A 5HRNA 4DQQA 3WNFA 2XY6A 1SV5B 2RKIA 1TL3B 3TABA 1OS5A 4J2AA 3LPUA 4Q44A 3S3NA 3QLHA 1LWEA 3IS9B 3OSPA 4ED6A 4DFKA 3SQ1A 2W9BA 4M45A 4EBEA 1WSJA 1T94A 2IBKA 1RT2B 1S6QB 1I39A 3V6JA 1IKWB 4KE5A 3OS0A 2Z1HA 3P83D 3BREA 1NOYA 3I5AA 4I7FB 2OPPA 3OVNA 3DLKB 3IRXB 4QCLA 4ZPCA 1TQLA 3A2FA 4NYFA 1CZ9A 4E89A 4ZHRB 4QWBA 4WE1A 3BSAA 4FCYA 4CJRA 3UDLA 1ZETA 3KK1A 4FS2A 4Z4CA 4LSLA 3KIOA 3DRSB 2XY5A 1TKZA 4CHOA 1LWCA 4CIFA 5FROA 3DLGA 3I0SB 1N4LA 3AA5X 1EP4A 2J6UA 5J2PB 1HNIB 1K1SA 3D5MA 4H54A 3T1AA 1B92A 4ICLB 1EETA 4IR9A 2HHSA 2JLEA 4M3UA 4XPEA 3ZSRA 4Z4HA 4EP5A 4G3IA 2GV9A 3VQ5A 4QW8A 1A5VA 3CJ5A 2FVSA 3BJYA 3MR5A 5KGWA 2WB4A 4J9LA 4URSA 4FLXA 4KV8A 1LWFA 3BSNA 4WXWA 2R2SA 1KVCA 1QAJA 1BIZA 4M95A 5KT4A 4CIEA 2RDIA 3S9HA 4O3RA 4ZTFA 3HYFA 1UOCA 3NGDA 3MR3A 1UA0A 4HTUA 1JLAB 5HLFB 2OPSA 1YVUA 4CEOA 2B6AB 1JLGB 4ED1A 1L3TA 2QKKA 1NHUA 5HP1A 2XI2A 1VRTB 4W5QA 3ITHB 1DTQA 1RDRA 2YKMB 4CF8A 1LV5A 3V9UA 3CJ4A 4WYWA 4ECVA 3CJ0A 3F73A 4ECSA 3M9MB 4OGEA 4MK8A 4CHPA 3DLEA 1S48A 2E9ZA 4FJXA 2HHUA 1TAUA 1IG9A 3PR4A 3KHGA 4CGFA 2VA2A 4QWAA 1VRUA 3LP2B 4PWDB 5DK5A 4DTOA 3DYAA 3FQKA 4WFXA 2R2UA 4I2QB 4XIUA 3QO9B 1QE1A 4NLVA 3HVTA 4J9PA 4DFPA 3SUOA 3QIDA 4CK3A 1KCFA 2HB5A 2G8WA 4DTPA 3AA4A 5L1LA 1NJXA 1JLEA 2WTFA 1TVRB 4KHMA 2AWZA 4AHSA 2R7YA 1L3UA 5DG7A 1RTHB 4U6PA 1D9DA 2VG5A 3NCIA 1HARA 3DOLA 5C25B 1RYSA 2X6NA 4CJEA 3LZJA 1BQMB 1KLMB 4J2EA 3ZSVA 4FJJA 5KGXA 4B9MA 1QS4A 1SH3A 4IFYA 3DRRB 2WOMA 2I1RA 4N41A 4PQUA 2LSNA 4IDKA 4Z4EA 2FVPA 4B9TA 1CZBA 3DRPA 5J1EB 5KFXA 3PY8A 1SL1A 1NKBA 1J54A 5L1JA 2HMIA 1KRPA 3K5MA 2HNDB 1U49A 5J2NB 2CKWA 1JKHB 4KHRA 1D1UA 4YR3A 3PJXA 3D45A 5FDLB 3RR7A 2AQ4A 4EP4A 3JYTA 3OS2A 4DEZA 5K14B 1KHWA 2BQ3A 1JL1A 3L2QA 1IKXA 4Y2CA 1L5UA 4KI4A 3FSIA 4JS5A 1JX4A 3LZIA 3OYDA 1T7PA 5KFEA 4KKOB 4LSNA 3L3UA 4CF9A 3BSCA 3HO1A 4ZMMA 1BI4B 1RT6A 3OYFA 3GV8B 4DSEA 4RW9B 5KFFA 5KG5A 2XCAA 4FBTA 5KFVA 4F3OA 3QIOA 4QW9A 3MXIA 4DQSA 3SFUA 4W5NA 3G86A 4R5PA 4CJQA 1ZBHA 1HNVB 3GV5B 1VSKA 4BWMA 4NCBA 1LW0A 1C1AA 2UUTA 3MEGB 2ATLA 4I9LA 1YTAA 2FLLA 4AHTA 4H4MA 2P51A 3QNNA 5CYQA 3VA0A 1RT1B 1JIHA 2E9RX 4ECYA 4MKAA 3KLIB 4Y34A 4KBIA 3L2VA 3ISND 3AO3A 3M9NB 4FLTA 2KZZA 3EY1A 3RB6A 4ID5A 3ZT4A 1S1UB 2OYQA 1S9EA 2GIRA 4JLHA 5CZ1A 1DTTB 4N56A 3HP9A 4WXOA 3SPYA 1XHZA 4CJVA 3V4IB 4FJ8A 5HRSA 4JV2A 2VG6A 4NCGA 2QE5A 1C2PA 3G6XA 3MECA 3HVAA 3CFPA 4RNNA 2IC3B 3V6KA 4FJGA 2O5DA 2VG7B 2OPQB 4DL3A 4FJMA 2G8IA 2C22A 3EPIA 3KLEA 3QEWA 1S4FA 2P5GA 2R2RA 1L3SA 3FFIB 3C94A 2BANA 4G1QB 2C28A 4H8KA 2R8KA 4FM0A 1RYRA 1RT5A 1VSDA 4YFUA 1Z25A 4DTSA 2YNGB 4DL6A 4IG0A 4KO0B 2VA3A 1DLOB 1S6PA 3PZPA 3HVRA 3NF8A 5HBMB 4DTMA 2ALZA 1SL2A 1FK9B 5KFNA 4YR2A 3THVA 5KG6A 4NLWA 5KG7A 4FK4A 3VN5A 5EU7A 3QETA 3ALYA 3ISNC 5FRMA 4NRUA 3CDUA 4E7JA 4J9MA 5KT3A 1FKOA 3E51A 4KTWA 3WNGA 4DSFA 4XPCA 2YKNA 3KKSA 2WONA 1HQUA 3SYZA 3PO4A 4ZPDA 5KI6A 4QWEA 1C0MA 5KT5A 5FRNA 1Y97A 1VSFA 2ASDA 4EYIB 4FZZA 5F9NA 5DG8A 4EBDA 3QERA 4HUEA 3HJFA 4PUOB 5SWMA 4RW6B 1YTUA 4AHUA 2W7PA 2FBXA 5F8MA 4IKFA 3NFAA 3SUQA 3OYKA 4M3ZA 4OLBA 4CJFA 2IJNA 2HWHA 3SNNA 4DLEA 4I2PB 2YV0X 2XY7A 1TV6A 1XWLA 3V9ZA 3KLFB 1T05B 4BWJA 3CFRA 1RNHA 3OYMA 1D9FA 1QQCA 4NRTA 4DU3A 5DQIA 4J9QA 4K4SA 5C42B 4M41A 3KKRA 3NF6A 3UIQA 4EEYA 1J5OB 1U09A 3WNEA 5I42A 3HT3A 3RWUA 3DMJA 2ATQA 4OKKA 1A5XA 2BRKA 1RT3B 3OYEA 3L8BA 2IAJB 4EBCA 4HHTA 3KHLA 2V4RA 3KOAA 1VK0A 1U04A 2ZQBA 3AVFA 1IO2A 2O4IA 4AILC 4QWDA 4N76A 4R8UB 1NHVA 4CJKA 1QSSA 4KFBA 1TKXA 3I5CA 3ZSXA 5HROB 3IG1B 3MEDA 2J6SA 4O4GA 5KFLA 2JEJA 3OYIA 1RTIB 4K50A 4RW7B 2UVRA 1NKCA 3HKWA 4B9NA 3LP0A 2YHBA 3OS1A 3LWLA 1IH7A 2P1JA 5JUMA 5EWGA 4FK2A 3VQPA 2W8LA 1XI1A 4Q0BB 4E7HA 3ZSOA 1N5YB 1SH0A 4KB7A 2HWIA 2F8TA 3H40A 1C0TA 4M3WA 2RDJA 3CWJA 2DPJA 3O4QA 4XO0A 4IQXA 1QHTA 1RBRA 4CESA 4CEZA 4DFMA 1VSIA 3CYMA 1FKPB 1C0UA 3LP1A 1BCOA 3Q8QB 3KK2A 5J2MA 1TK0A 1WSIA 2QK9A 3HPOA 2R8HA 3QEXA 1T03A 3N6NA 5F9LA 3MAQA 4K4TA 1JLQB 2C2EA 4FM1A 3PX0A 1TKDA 3AVAA 2D5RA 2E9TA 2HHTA 1TK8A 5JXSA 2ILZA 1WSGA 1MU2A 4ELTA 1I6JA 3KMSA 4NLUA 4OL8A 3KJVA 1Q9XA 4ID1A 3ZSYA 2I5JB 3MEEA 3P1GA 4GVMA 2QKBA 1RBUA 1L3VA 4H4OA 1C1CB 3RAQA 4FLZA 1LAVA 4CEFA 2IS3A 4OGCA 1S1XA 3K59A 3G6VA 5KFOA 3G10A 2HNZA 3QGIA 3CJ2A 3CM5A 3DM2A 1RTJB 3JSMA 3LALA 5CY4A 1KTQA 1JXLA 3WNHA 4KAIA 1C6VA 4M3YA 3QINA 1JLFA 5D3GA 1LW2B 3OYJA 2YNFA 2OZSA 1SUQB 2Y1IA 4PA1A 4B9VA 4DF4A 4CJ3A 1TL1B 5C24A 2KQ2A 1EXQA 3OHAA 1HQEB 4URGA 1N6QA 2R2TA 5KT7A 1KLNA 3H4DA 3U3YA 3NKYA 4CJ5A 5F8LA 1KHVA 1S9GB 1S9FA 4MQ3A 4RNMA 1GOCA 1HMVA 4EZ6A 4CEEA 3OL7A 1NK6A 1RTDA 1J53A 4PY5A 3E01B 1ZBIA 4Q8EA 2HNYA 2RF2B 1RBVA 2PYLA 2E6LA 5CYMB 2DPIA 4GC7A 2YNIA 4CGIA 3RTVA 1X1PA 1TP7A 1S1WB 4IFVB 3TAMA 4GMJB 3EYZA 1SV5A 2BQUA 2EHGA 4LD0A 3K5LA 4K4WA 4BDYA 3GIMA 5KRSA 4FJLA 4F4ZA 3V81A 1F21A 4CJTA 1LWEB 4RNOA 1XC9A 1ZTWA 4L8RB 2OPRB 1S5JA 5HRRA 1NJZA 4Y1DA 3K57A 1S1TA 1ZBLA 2BE2B 4DTXA 1X9SA 3KLHB 1IKWA 4W5OA 4DF8A 1BCMA 3Q8SB 4E7IA 3B6OA 3HXMA 3DLKA 3IRXA 3F9KA 3V9SA 4FJKA 4CFBA 1HRHA 3PHEA 1REVB 2JGUA 2B5JB 2IMWP 3LAKA 2D0BA 4LSLB 4J9RA 5KFBA 2F96A 1TKZB 5DGAA 1LWCB 5CZ2A 3DLGB 3C6TA 1GOAA 1EP4B 2E4LA 3QEIA 1KVBA 3ZSWA 4ICLA 1EETB 1XR6A 5DQGA 3HHKA 2AGOA 2KTQA 2Z1IA 3VQCA 4FBUA 3AVLA 5L1IA 3M8QA 4O5BA 2X6SA 2HVHA 1S0MA 4RW8A 1RDBA 4BE0A 4IKAA 4B3OB 4NLDA 3DI6B 4FJIA 5JS1A 1LWFB 4DS4A 4C8MA 3I0RA 4Y3CA 2ZE2A 2FC0A 4CFAA 4TY9A 3TAFA 4CF2A 4N5SA 1HYSB 5KFYA 2G8UA 3AO5A 3TAPA 3BR9A 5KFIA 3KTQA 1NK9A 1RT7B 1X9WA 3RAXA 3MF5A 3CFOA 3M8RA 2OPSB 2B6AA 1JLGA 4O0IA 3CDWA 3QIPB 5KFJA 3B6PA 2E6MA 2W9CB 1R0AB 1RT4A 4K8ZA 3QZ8A 4QPXA 2YKMA 1IKYA 3SCXA 2ASLA 1ZYQA 4NLYA 3O3GA 2UVUA 3BGRB 4IH6A 4M94A 4LQ3A 3C6UB 2C2RA 4KHWA 1RDCA 1SKSA 5F8JA 1QSYA 1NK0A 3H4BA 1IM4A 1U48A 4DL4A 2ITGA 3KLVA 5KFCA 3ZT1A 3DYAB 4K4ZA 3NF9A 3OYHA 4KHYA 4NLQA 4O44B 3QO9A 2V4QA 3VQBA 3HVTB 2XGPA 4NYNA 4CGHA 3PVXA 3NBPA 3HPGA 2EC0A 4WZMA 2OZMA 3M8PA 1TVRA 4ZVHA 1NK7A 4QWCA 3DOLB 5C25A 2WHOA 4IRKA 1HPZA 4ECUA 1ZBFA 4MK7A 3NAHA 4MKBA 1BQMA 3N6LA 1KLMA 5KFTA 4DQRA 2BR0A 4IRDA 2ZD1B 4RW4A 3ULDA 3KK3A 4IFYB 3DRRA 4HKQA 3D0PA 4ED7A 3SFGA 2WOMB 2JC0A 4IDKB 1JXBA 5L1KA 3SI6A 3NMAA 4RU9A 4ECQA 1YT3A 3DRPB 3OYNA 3NGIA 4B08A 1VSJA 3D28A 1K6YA 3HVWA 4ECTA 1CSJA 4W5RA 4F3TA 3T5HA 3BQ0A 2PYJA 2HNDA 4FK0A 2BGGA 4ZP8A 5DQHA 3KMQA 1JKHA 2XWYA 2WK4A 4O3OA 2AU0A 4C8LA 3H5YA 4F4WA 4E7KA 1UWBB 3K2PA 3V9XA 2JEFA 5K14A 2JEIA 4DG1B 1IKXB 2F8EX 1S0NA 2R8IA 1WLJA 5SZTA 2YNHA 3BSOA 2ILYA 5KFGA 4J9KA 4MIBA 4ECRA 1KFSA 4DU4A 1BI4A 1RT6B 3GILA 3SUPA 3DOKB 2Z1GA 4RW9A 4K4UA 3ICLA 1K1QA 3HM9A 4NZ0A 1TK5A 1RA7A 4FZYA 4R5PB 5KFMA 4Q43A 1IKVB 2DFEA 1BGXT 4FXDA 3AO2A 3K5NA 4OPJA 1KFDA 3MEGA 4HVJA 3AVGA 3DLHA 5HRPA 4JRQA 3M8SA 1NK8A 4H4MB 4MFBA 3MTKA 5J2QB 1C1BB 3T19A 3CJ3A 2HHQA 5KT6A 2FLPA 5I3UA 1RAJA 3O3FA 1S0OA 4ZPAA 4CK1A 1S1UA 1SKRA 1S9EB 1D0EA 2R8GA 4FYDA 3SQ2A 4NLSA 1UA1A 2HHWA 4CERA 2IM2A 4ECXA 3DLBA 4IG3A 3KNAA 5KFRA 5KFSA 1JLBA 2FJVA 5KFDA 4TYAA 5F8HA 1W25A 4NCGB 5KFPA 4RNFA 2G8HA 2IC3A 1U47A 4KTQA 4YNQA 4ED8A 5KFKA 4BACA 2XI3A 3QESA 4FLYA 1S1VB 5DG9A 3PW7A 3CIZA 3GIKA 1RILA 4J9OA 3HL8A 1TKTB 5EWFA 3V6DA 3FFIA 3BQ2A 2BANB 1TGOA 4AHVA 3OSNA 2XC9A 3AVCA 1LAWA 1RT5B 4AHCA 4IG0B 1S97A 1S10A 4U7CA 4E0DA 4OKEA 4FM2A 3GQCA 4B8AB 3RB3A 2FVCA 2AJQA 1DLOA 1S6PB 1EKEA 3SI8A 1MMLA 4OVLA 4B9UA 4OJRA 4C8KA 5L9XA 4W5TA 2IA6A 3NGYA 3V1OA 1JLCB 4OPKA 4BDZA 4DL2A 2IOCA 3KLGA 1W9HA 1WAFA 2AGQA 3PW2A 1D8YA 4TY8B 4CK2A 2W8KA 3RBDA 2O4GA 1BQNA 4FJNA 4DS5A 4J9NA 2W7OA 3IGNA 4ED2A 2YKNB 2FBVA 3I8DA 1GX5A 1HQUB 3T3FA 3QGGA 2IDOA 3U6FA 3RB0A 4CHQA 1RDDA 3VA3A 5EWEA 2RKIB 1TL3A 2OH2A 3CG7A 5KFUA 2V0NA 3TVKA 2C2DA 3IS9A 3QLHB 3RMAA 1G15A 4RW6A 2W9BB 4CJSA 3Q8RB 4LQ9A 1RBSA 2FJXA 3TANA 4CGJA 2XGQA 2JEGA 1RT2A 1S6QA 4DTNA 5F8IA 4ZP9A 2HW3A 1TV6B 4ECZA 4EO6A 4E19A 4I7FA 2OPPB 5T7BA 3CQ8A 1T05A 4CJPA 4KHNA 3NH0A 1BIUA 1WN7A 1T8EA 4ZHRA 4WE1B 4JV0A 3MFHA 5C42A
chains in the Genus database with same CATH superfamily
2FJWA 2A1RA 3DRSA 3TEHB 2W4DA 1N48A 1A5WA 4FLVA 3VQEA 4PPZA 3Q7CA 3VALA 1NOZA 2A6MA 3P49B 4YS2A 3LOUA 3VQSA 3KD1E 1DBDA 2AP6A 4FJ5A 4MIWA 2HFUA 2BQRA 4LFAJ 2DY4A 1SIZA 4FJ9A 1XMOF 4B8CA 1HLUA 4NB4A 1K0TA 1HKCA 2NNWA 2QA4S 4DWIA 4K2XA 5LSOA 1RISA 2HRUA 5HLFA 3GFYA 3V6HA 2ADBA 5HO4A 1LXJA 2MLYA 3OYBA 4WYLA 4JI3J 1X8DA 4ECWA 3CM6A 4OZ2A 4QS8A 4CECA 2ZH8A 3OXGA 5KFAA 4DSJA 1B7FA 2CPEA 2O8BB 2F4VF 3O3LA 2C2NA 4PPDA 1BD6A 2EPIA 2HAIA 4Y6IA 3ZT3A 1DQAA 2E2QA 3BO2A 3QDKA 2YJFA 2C2KB 4H0PA 1JCFA 3BZCA 4RUAA 3MN5A 3O1WA 1EKRA 4E1MA 4FDFA 1X5TA 4PG4A 1VRUB 2NQPA 3HSTB 2K1RB 1TUYA 3Q8YA 1NJYA 2FLNA 4PG6A 4YOXA 1JXEA 3V5RA 3OR2A 1NBWA 2GO9A 7AT1B 2ZH1A 2Q2RA 3CCWA 3NF7A 1RDUA 3M30B 1YJWS 4IZ9A 1JLEB 1WC5A 3GONA 1RTHA 2ALYB 2QI2A 6FD1A 4L3QA 4A8SA 3NRBA 3AVJA 4ZK7M 3X3UA 4ETXA 3TQ1A 2ITMA 1CQMA 3OR1B 2A40A 2PA3A 3SAFA 2MKSA 3M8YA 4BRAA 2HNZB 1EB0A 2M52A 4FOIA 3A8EA 1Z26A 2NRXA 1TFWA 5J1EA 1C4CA 3CCJN 3ELHA 1JB0C 2A1SA 3PHTA 3K9JA 1IR2A 1ZOTA 2OTJS 3A12A 2U2FA 4G6VB 1W7WA 3HJVA 1YK9A 2QO3A 2Y8WA 3UDEA 1B9FA 4ZDNA 1WI6A 2I8EA 3L7OA 1MG7A 3CJBA 1WSHA 4KREA 4AYBD 1OVQA 2YWHA 2UXDF 1S9GA 3TTFA 4J9UE 3PO5A 3BR8A 1RTDB 3P31A 4IR1A 4WU2A 4KSEB 4Z4GA 2NLXA 3H08A 1N52B 4A47A 2V2QA 4RUCA 2QLBB 1NDLA 4RNHA 2XHBA 1HNVA 4NLXA 2RUSA 2XS2A 1N5VA 2FF3B 3ATVA 2QLFB 1NLKL 5DDRC 3T5KA 2DY1A 1YHQN 1VSHA 3OJUA 3SK3A 1KQFB 4JUZA 4JV5K 2D3O1 3OLAA 3FQLA 2Z30B 2LEPA 2A3ZA 3KLIA 3SZ2A 3MCSA 3D6MB 2OTLS 4I9QA 4AUKA 4CJUA 4IH7A 2OPRA 1DTTA 1SC1B 5A0YA 4HYKA 2UU9J 4IRCA 5D8HB 3V4IA 5KFHA 2W4PA 1EJ7L 2DO0A 3QMQA 3MECB 1Q8LA 1ACMB 4Z4FA 4F50A 2GVDA 1JJ2M 3W2VB 3Q22A 4CHYA 1U25A 3KLEB 3J7AN 4MDAA 2E5GA 5IT0A 4O0JA 4B3SK 3D3CJ 3C6TB 1MSWD 3OYCA 1G7CB 4NLTA 3AA9A 5LMNK 1L3KA 2XY8A 2W42A 1Q82O 2YNGA 4BRMA 4HTJA 2VFRA 4RPFA 5GMEA 1XMOK 3AJ1A 4LF8K 2HGNA 1XNQF 1WJ9A 3ET6B 4ELUA 3R2CJ 2AJ0A 4YUDA 4GC6A 4B3OA 3EJMA 1FD8A 3OQ2A 4FLWA 4TLQA 2YX7A 3SCLE 2W25A 3WC0A 1YIJS 5AQYA 4WFZA 4BC4A 2R8JA 2CAJA 3RW7A 1FKOB 3ZT2A 2HVDA 2ASPA 2NUBA 2EFVA 4BG9A 3M1VA 5B0GA 4B9SA 4HACA 3SBGA 2W9AA 5MLCQ 4AXJA 3SUNA 3QIPA 3S01A 1U2RA 1KVKA 2W9CA 5ITHA 1RE1B 4CBWA 1OVYA 1R0AA 1RT4B 3QT6A 2ZBPA 4DV4J 4K8XA 2E1AA 3ENHA 4KB1A 3R5DA 1B0VA 4YMEA 1VQNN 4Y0WA 1KSPA 3BGRA 2Q79A 2D3ZA 3HSZA 5AFUA 1YUWA 4I2PA 1D5AA 3W61A 2LA6A 1XNQJ 1VHIA 4UW2A 3J8AA 2P9SA 3KLFA 3KYLA 4JRPA 3O2IA 1P8ZA 2CG8A 1YJNN 4OJ3A 1UW4A 2GQCA 4NWBA 4ZA1A 1KVAA 3NGUA 3IAYA 1SJQA 1VQLN 4KHUA 3OLBA 1LCUA 4H0TB 3AO4A 2WCXA 2X1AA 1BOTO 3IC1A 2CQIA 2QV6A 4QS7A 5BREA 4CTAA 1RGVA 2DNYA 4CFDA 3PJWA 2LU1A 4DUYK 4YOWA 5D0HA 4CBXA 2RE2A 4F67A 4R8UA 3HK2A 2EFQA 3N5BA 5KQ8A 3KHRA 1XJWB 1NM2A 4DR4F 1WC4A 4DSKA 5BR8K 3LPTA 1RTIA 2DXFA 2M88A 5A6PA 4RW7A 2YH1A 3AV9A 2X3DA 1NB7A 4KC5A 4F0KA 1Q8KA 4P10A 3O9QA 3ZSZA 4M3TA 2UXCJ 2WBMA 2G8FA 4QAGA 4KTZA 3OTOJ 6AT1B 1OIAA 3VQ9A 1FCAA 2NRRA 5HQ8A 3ZT0A 2YY3A 2B9WA 3IN5A 4ISFA 3BBFA 1Y64A 3VAMA 5AT1B 3RB4A 1VQON 5EX3A 1U1QA 3IFEA 2IY5B 3DOKA 4GRSA 4YR0A 4DQIA 2VF3A 5J2MB 3CCMS 1WNSA 3EX7B 3U02A 3TWHA 4K41A 2KVIA 3MR6A 1BISA 2KU7A 2P8IA 3OY9A 4K59A 5C15A 1GNKA 1M90O 4QOZB 3O5BA 2KFYA 5AQIA 2PGCA 4OYBA 3OV7A 4JEPA 2QWRA 3MN6A 1R89A 3SLCA 2K3KA 2HMPA 3CQYA 4RZRA 3O4NA 1IBLK 1KXPA 4LJMA 1VDHA 2CRLA 5I9EB 1XEZA 1Q0NA 2AJ1A 3PW5A 2J0XA 2EX3A 3JB9k 3FZKA 3IGVA 1DJ0A 4IG3B 4J8FA 1LWXA 4DLGA 3TUIC 3A3NB 4X62F 5CE3A 1RTJA 2AX1A 5AQVA 4UQGA 4IO9Q 3QSIA 4O3SA 5HJXA 1FWKA 1P27B 5F8GA 1ZA2B 2YVSA 3VQDA 4KGKA 4JI5K 5FIIA 4JI6F 1Q86O 4CLWA 2GHWA 2NREA 4K0KJ 2N7CA 4JI2J 1RWVB 2IGIA 3RZAA 4PL8A 4PXEA 4ZVRB 3OHRA 2GAGC 1ASUA 2IM3A 1R6YA 2UXBK 5GIOA 2IRYA 4ZN3A 4MKYA 3R1HA 2YPYA 3C46A 4HCCA 2UXBF 2VUGA 5EDWA 4X62K 3BO4A 2CQCA 3CC7S 3E01A 3KLGB 1IBKF 4NA1A 3RRHA 4I6MB 3Q2TC 4J2DA 2AX0A 2HIQA 3V1RA 1ILYA 4TY8A 1NKEA 2FIUA 1YVNA 2J5AA 2DEJA 1T0TV 2FBTA 5AQXA 1HJRA 5CHCB 1X4EA 3WNFA 4YY3J 3O5TB 4QYZK 1HFEL 2RKIA 2C3PA 3RG6A 2VFVA 3CCUN 4J2AA 2E7WA 3S3NA 4DFKA 1TL7A 4DBQA 2GJFA 3DRXA 5I3PA 1T94A 1I51B 3VEZA 4G1IA 1I39A 2FTRA 1I3OB 3DLLL 1RACB 3DLKB 3Q0AA 1JJHA 3A2FA 3KDNA 3CCLS 2EFNA 4LFAK 4Y28C 4XTTA 4E89A 4BRFA 4QWBA 3D7EO 4OPAA 5JLHA 3MAHA 5DM7L 3KK1A 1PC4A 3TEGA 4ZS6A 1TKZA 1LWCA 3TSPA 2AYMA 4CIFA 2XMVA 1N4LA 2LYVA 2BKPA 2J6UA 2DPNA 3KVGA 1RHKB 4ZCKA 3D5MA 1WD6A 1S22A 4CLKA 1LKZA 2A2DA 2ZWPA 1RBOB 1MROB 2BW2A 1M0SA 1PC5A 1T3VA 2GV9A 2HFVA 3C16B 4QW8A 1A5VA 2FVSA 3BJYA 2HBJA 2HHPA 1S6UA 4J9LA 1MW7A 1TR0A 3DCAA 4DR5J 1LWFA 1SJ1A 3M4XA 4CO4A 3BSNA 3BEXA 3BGFA 1Q7LB 3W8GA 3S9HA 4ZTFA 3U1NA 4CLFA 3ULEB 3MR3A 1JLAB 2OPSA 4ED1A 1JLGB 1WG5A 3W63A 1L3TA 1NHUA 2E7XA 5HP1A 2XI2A 1VRTB 2CJKA 1W7AA 4W5QA 2W4CA 4ERDA 1IBCB 3OW2R 4U95A 3CTRA 4CF8A 4KT0C 1R7IA 5FPMA 4GKJJ 4XK8C 1ATSA 3PTWA 5LJWA 4HHUA 2E5IA 4OGEA 1IBMK 1H0HB 4B3RJ 2RQCA 3A5OC 3HTVA 3DLEA 4FJXA 1VK3A 3AH6A 3GZ7A 3FC9A 4ILJA 2VA2A 4QWAA 4B1WB 2MQLA 2K8GA 3I9ZA 3VPZA 4BQZA 2J8AA 4PWDB 5DK5A 4DTOA 4LC9B 2ZJPL 1RQ0A 2E2PA 4XIUA 5K9FA 3HVTA 1SC6A 1YI2N 4GKKJ 2V8VA 4DTPA 3AA4A 5L1LA 2EBEA 2AWZA 1L3UA 2MXYA 5D77A 3QFPA 1NGFA 1HARA 1WC3A 2VPXB 1WC1A 2E44A 3AGKA 1OYDA 1SS6A 4K43A 1BQMB 1KLMB 3WXMB 3ZSVA 1WELA 2LA4A 4FJJA 4DN0A 4B9MA 2CZ4A 2P9PA 4IFYA 3DRRB 4P6QA 4N41A 3ZZOA 2MKHA 3LPYA 4IDKA 5BN9A 3CF5L 2JVOA 2JSXA 3B4DA 5IT9Y 1CZBA 1UKUA 3DRPA 1S99A 2MSSA 1H38A 3PY8A 4PABA 2QC3A 1J54A 3NOGA 1YBUA 5IS2A 2JVRA 3K5MA 5J2NB 2POKA 1UZDA 4H0XB 2YKOA 5LMNF 2LU2A 3WXKA 2J0SD 1D1UA 1MWQA 1ZC6A 5FDLB 3AJ2A 4A5BA 3B78A 3H3NO 1JL1A 4Y2CA 3TX0A 1UJ4A 2MHEA 2EC2A 5KPRA 4JS5A 4KKOB 4CF9A 3BSCA 1VQKN 2KO1A 2ZOGA 1G4CA 2FZCB 3QWUA 1QVGR 5AQOA 2VPWB 5KG5A 3ZNUA 4FBTA 4LFBK 5KFVA 2I0XA 1RAAB 3G86A 3FVYA 1U6ZA 3NS7B 1ZBHA 1VSKA 4JK9A 1CJKB 1FNOA 2AEJA 3OFGA 2A42A 4DU7A 4KGVB 4H4KC 2J0QD 1VJQA 1YTAA 4H4MA 1KQSM 1K8AT 3P5TL 1JIHA 4FN5A 2QLXA 4MKAA 4Y34A 4KBIA 5LMNJ 2E1MC 4FNIA 3ZT4A 1S1UB 5HMXA 1S9EA 5B0BA 4A61A 3RYLA 3PIPQ 1SQFA 1TUGB 4P73A 4FJ8A 3E9OA 4NCGA 4USUA 3G6XA 4DCJB 1XN9A 4FJGA 4MTPA 2O5DA 1CBKA 2VG7B 4U7UK 2Y0BB 4FJMA 2C22A 1QLNA 3CJ7A 2DNMA 1MN7A 5M1NA 1UEKA 3MX2A 3K8WA 2XMUA 3MMJA 4G1QB 3HHDA 2R8KA 1RYRA 1VSDA 4WFAQ 3UB5A 2JJ4D 3DC2A 1ELOA 1FF2A 2FQQB 2JH3A 2DGVA 4JKFA 2ZHAA 1DLOB 2Z57B 3R6LB 1T6DA 4B3MK 1I5OB 4JI1J 3CPWR 2MQMA 1FK9B 3BGOP 1R27B 5BXIA 2HF3A 2LKZA 1PG5B 4YR2A 3THVA 5KG6A 5BYQA 2RRAA 5EU7A 3QETA 4CZEA 4NRUA 3CDUA 5AQMA 4DSFA 2WONA 4BR2A 3O1LA 5FRNA 4DHYA 3BKTA 5DG8A 1FFSB 2MZRA 3HJFA 4PUOB 4RW6B 3HM8A 2J8SA 2FBXA 1FJGJ 4GO7X 3GL1A 3OYKA 4C48A 4RWXA 3D1OA 3O8WA 4CJFA 2PEHA 4C0BA 8AT1B 4GKJK 1KOOA 4C1NK 2XY7A 4M5JA 4A8MP 4BWJA 3SMZA 1RNHA 1CC7A 1BE4A 4NRTA 4DU3A 2AV5A 2Q0RA 4FYYB 2QMXA 5EVZA 4OYOA 4EIAA 4XH1A 1RWPB 2BW7A 3N79A 3VAIA 5I3QA 3W60A 2X51A 1U09A 3H90A 5I42A 3RWUA 3DMJA 1AUDA 1X3MA 5AQHA 4FVUA 1RT3B 2IAJB 3KOAA 1VK0A 2QMUB 1U04A 2ZQBA 2K7JA 5DM6L 1F2HA 2G9OA 3NS5A 2HSTA 2B9YA 2OTLN 3I55N 1RI7A 3GFXA 4QWDA 4WQ5A 2ZBCA 3PRVA 3AD8C 4KFBA 1SQKA 1TKXA 1A6LA 1YDLA 3THPA 3ILLA 4KH1B 3ZSXA 3BYRA 3NMRA 4O4GA 3OUYA 2WVCA 2UVRA 2B51A 3AY0A 3HKWA 2P6TA 2V7ZA 3PRBA 2PMHA 5AQGA 3OS1A 4TNOA 1IH7A 4L74A 5EY4A 5JUMA 4PXCA 4CM2A 4ZVOB 3VQPA 3HRGA 2P9IB 3UDCA 1H1VA 1GLAG 3ZSOA 1ZM2A 1IBLJ 2GZOA 2HWIA 2P9LB 1C0TA 1QTNB 3CWJA 4BRIA 2DEIA 4QIGA 4YOYA 4RKUC 4ENOA 4CESA 1M90T 4WFNQ 2XHCA 1FKPB 4KJIA 1XC3A 3CPWM 1C0UA 3Q8QB 2DH7A 1TK0A 3OD2A 3QFUA 5AQNA 3T7ZA 1Y10A 4OHVA 2KHCA 4CO1A 3QT7A 2FJDB 5C2CA 4FM1A 3H20A 4A59A 2D5RA 4DV6K 1WKLA 1PSDA 1WSGA 2NLWA 4X4PA 2XYHB 2FHMA 3KJVA 3MEEA 4OHYA 3U4LA 2MQQA 2QKBA 2V9KA 4H4OA 5ETLA 5FPDA 1C1CB 4UQTA 3RAQA 2UUBF 1IBMF 1S1XA 2ZWOA 3K59A 2Y8YA 3BYPA 3GSDA 2DO4A 4FWOA 4IJAA 1FDAA 4P74A 1HHTP 1VAZA 4ISEA 3CCJS 3JSMA 1AW0A 6FDRA 1FFGB 1WEZA 2L48A 1KQSR 4M3YA 5AR0A 1LW2B 3OYJA 2YNFA 1SUQB 4JB8B 4M5NA 3JSYA 4CJ3A 1TL1B 2YPZA 3ULHA 5IOLA 2PO4A 4DV3K 3OHAA 4URGA 3TNVA 1VK8A 1AB8A 2I38A 4YHHF 3NNAA 5F8LA 4MQ3A 1GOCA 1HMVA 4EZ6A 1NK6A 2UUAJ 1FRJA 1J53A 3TZWA 4DR7J 4HTIA 1ZBIA 2MDAA 2HNYA 2PYLA 1WC0A 3PCOB 2E6LA 5CYMB 4JI4F 4OIXA 2E29A 5ETOA 1MN9A 2V2KA 2DNRA 2LXFA 2R9LA 3TAMA 4PKIA 2BQUA 2EHGA 3K5LA 1KQGB 4DV7J 2QT7A 4H0OA 2JOQA 1HNWK 4UOGA 4DR3J 3FK4A 5F41A 1LWEB 4RNOA 1ZTWA 4WCEL 2FD2A 3O44A 2ZOMA 4L8RB 2D69A 4P52A 4LF9F 4LF5K 2GA7A 5HRRA 4EHTA 1T02A 4MLHA 5H9FJ 1NMNA 1IKWA 3VGLA 1FJGK 2GVZB 4DF8A 2QRRA 1RWOB 3HXMA 3BEGB 2DD8S 3F9KA 3N9UC 4RUBA 4G9ZA 5D0RA 3WEEB 1VHXA 1REVB 2JGUA 2B5JB 2DCUB 1NM1A 2IMWP 2IRXA 4ZLJA 4J9RA 5KFBA 1Q7YO 4BRPA 5DGAA 2YX4A 5JVGL 5F1XA 3JTOA 2ZZNA 1BHNA 1NB2A 4CO2A 3GIRA 5AE3A 1IVZA 4GV9A 2BYCA 1R8PA 3GJQB 1WBDA 1YRUA 5L1IA 3M8QA 2QTDA 4O5BA 1VQPS 1IWAA 1S0MA 4RW8A 2VQEF 5EX0A 1UTAA 3MM8A 4IKAA 4HI2A 4NLDA 3DI6B 2FJBB 1IJEB 4F3QA 2HGLA 3LGHA 4DV0J 4DS4A 2KG1A 2MKIA 5ADXH 4ZCIA 3AT1B 4Y3CA 3TAFA 2JRSA 2XYPB 5CR4A 4JKDA 3KTQA 1CS4A 3NEKA 2VU5A 5H9FK 3DJCA 2CPIA 3HSJA 3RAXA 4YB1P 3M8RA 3W2WA 5AJ3J 5KFJA 1FWPA 3QNWB 2V4JA 1VQMN 1UPPA 4QYZJ 4MAKA 4QPXA 2YKMA 3N01A 4OLPA 1AFJA 1ZYQA 2GWKA 1BQXA 1WHXA 4M7XA 2BOAA 3IAM9 5A76A 2OANA 2FC9A 2HLUA 2YWFA 3PIOQ 1RDCA 1SKSA 5F8JA 1QSYA 1RWUA 1VGYA 2KHDA 1W26A 3IRWP 2ZZMA 1U48A 4DL4A 4L73A 2R4FA 3TJ9A 3TZYA 2VCPA 3NF9A 4KHYA 1OPIA 3FZHA 4ILLA 4NYNA 2ZC4A 3PVXA 3NBPA 3S1TA 2YKAA 3C65A 3O80A 3AAQA 3Q89A 2XMKA 3ZYYX 5HN0A 3DOLB 2WHOA 4AQYK 3CD7A 5M2PA 3N6LA 4O8KA 4DQRA 2BR0A 1YZ6A 2ZD1B 4RW4A 2R7VA 1GMVA 1F3VA 3KK3A 5GAEU 3MCNA 4LF7J 3CMQA 2Q66A 2JNJA 2FGOA 1JXBA 4MKVA 5MAOA 3BGLA 2HS0A 1O6XA 4DR5K 4B08A 3FFKB 4LFCF 4M5DB 4ECTA 2FDNA 2JFDA 4F3TA 4ZLPA 3T5HA 3BQ0A 2HNDA 1VS3A 2PBDA 3KMQA 5B0DA 2XWYA 1VQ4N 4O3OA 3R7SB 3BN4A 3EZOA 2KYZA 3IBFB 4DG1B 1IKXB 5E3QA 1TFYA 4CYUA 2DISA 4DR4K 2MEWA 1NHKL 4YOTA 3BSOA 5KFGA 2YKPA 4DR6F 4IQMA 2GV1A 5IM0A 5B0CA 1UMJA 1VQYA 4USJC 4P2XA 2Y0SD 3VERA 2OMLA 4WIIA 2XLIA 2PFUA 1TK5A 4NXMF 1RA7A 4FZYA 4R5PB 4DX6A 5KFMA 1IKVB 3DKDA 1HHSA 4C98A 4CW7B 4JD2A 4JNEA 4KHPK 1HR0J 1KFDA 2BBEA 1GLJO 2FGCA 3GR1A 4JRQA 2O8CB 1M1GA 4PYAA 4MFBA 3J81U 3CJ3A 1H72C 3R5CA 4X4RA 2QWNA 5I3UA 3POTB 4ZPAA 4CK1A 3DU6A 1OWXA 2O8FB 2HFZA 3HD2A 5LOQA 4NLSA 5CQGA 3J7YI 2OAUA 1UA1A 2LVWA 4CERA 5LMUF 3R97A 3DLBA 4F7VA 1NMDA 2BJ8A 3ID6A 2CQ1A 5F8HA 1W25A 4C3KA 5KFPA 2MQOA 1G3OA 2G8HA 2D0PA 1RDWX 4ED8A 2FY8A 4I56A 2XI3A 1RCOB 4OV1A 4FLYA 1S1VB 3C15B 2VHGA 2XO6A 3HZGA 2E5LJ 4BROA 2HBKA 3HMJG 3D9BA 3HL8A 2E7VA 2ZM6F 1NPPA 3V6DA 4ES3A 3LH2S 4OQJA 4L6V3 1LAWA 5BPMA 1RT5B 1FJCA 3TSUA 2F5GA 4KHPJ 1S10A 5E3RA 3FSYA 1NGAA 2AJQA 4M1KA 3AXMA 3SI8A 1MMLA 2V69A 1HWIA 2G2ZA 4B9UA 4WQ4C 3ZEUB 4C8KA 5L9XA 2GELA 2P9UA 4X65F 4MT1A 4XH4A 4DL2A 3JSBA 1W9HA 2AGQA 1WF2A 2XBPA 1D8YA 4FPAA 3O9UA 2O4GA 3EDQB 4DS5A 4J9NA 2W7OA 3IGNA 3TA1A 2HQDA 3I8DA 1GX5A 1HQUB 3QGGA 1ZXOA 3AOAA 1JJCB 4OYWA 4CHQA 1RDDA 2W24A 2ROEA 4WWSA 4JKGB 3M8WA 3TVKA 2B56A 4PRFA 3VENA 3QLHB 3IR5B 3RMAA 2V51B 2X1GA 3LW5C 3IA0A 4C11A 4CLYA 1Q79A 3MMAB 5A2QO 2FJXA 3TANA 3HFZB 4JV5J 2XGQA 1TUVA 5FPEA 1YJWN 3S41A 4ECZA 3D2WA 3FBEA 1FVSA 1AXQA 5AXLA 3L4BC 4KHNA 4U67L 4NLCA 2WC9A 3VF2A 2CGLA 4GNIA 5EX5A 4ZP6A 1J5OA 2WVFA 5L9NA 5F2RA 1HNIA 1KEKA 3HPHA 1HYVA 1HKAA 2M2BA 2C3YA 1F3FA 3S3OA 4MJKA 3Q8PB 2HS3A 2RHSB 2GBZA 1CULA 2NZTA 4NE9C 2VV5A 3EZ5A 3TAQA 4R0JA 4FW2A 3HP6A 1Q8IA 2ZH6A 2QFJA 3HI9A 4KV8B 3R7BB 4LF4J 3WX4A 3WIVA 4DTRA 1APSA 1Y5NB 4BVOA 2B4PA 1I3AA 3G6EN 3FRZA 5BRHA 3D0GE 1QTMA 1OJ4A 3VAGA 1DFDA 3MM7B 4BDPA 3FZFA 5F8NA 4DSLA 3G8SA 4OZ5A 2IJFA 5D0GA 4YOEA 2APOA 5G0RB 1DTQB 2ZJPQ 1VQLS 5EN1A 3EE8A 2E88A 5E33A 1E6VA 4ALZA 3OPKA 4LIWA 1UVMA 5IQ6A 3H59A 3UR3C 2E5JA 2M8HA 3CDBA 3AB2B 4KPYA 3RMCA 4L3KA 4USHA 4X2BA 3LP1B 5THWA 4JS4A 2KZMA 4F8RA 3H25A 1HNZK 1Q81O 1JLQA 4I2QA 3CDEA 2UUAK 1QE1B 1FWLA 3WHIA 3CE8A 2E1RA 2OO4A 4DR7F 2LDYA 4KBOA 2M5YA 1MU2B 2KFNA 1KBRA 3G9CA 1X4BA 1QJHA 3I8BA 2HK2A 4JKCA 1X5SA 1V5VA 4O8UA 4TSXA 2YCHA 2CUYA 2QL9B 4G1PA 2DGQA 2MKKA 3CMEN 4UZBA 4PQUB 3H42A 2A18A 3TRGA 4KHQA 2V8PA 2F9JA 4K2JA 3SBTA 4ZJQA 4LF5J 3MPVA 1HBOA 3TPQA 3J80U 2P9NB 2RUGA 4DX7A 2K3IA 3P5JA 3MMCB 2HMIB 3AODA 2QL5B 1FX2A 3CJCA 2BV3A 4BR0A 4IOXA 5F0XA 3T5LA 2QGFB 2O3DA 3I4PA 4F4XA 5EUHA 1HNZJ 3CCQS 1N6QB 3UFCX 1V3SA 3UD4P 5BR9A 4LSNB 3M2VB 3GLJA 3THWA 1HBMB 2K2PA 2EVZA 3F41A 2B9EA 2M70A 3RRGA 1TYQA 2KG0A 3GIIA 1HWLA 2H9ZA 4RCHA 3MAAA 4DMNA 2QYGA 2G1HA 1AROP 4B1ZA 2XSJB 1YVFA 5IC6B 1R43A 2CADA 3H5XA 2LEBA 1XTZA 4IFVA 2CFXA 1DQ9A 1RBLA 3U1LA 4IBNA 4CZFA 1Y4ZB 4CVNE 1U6FA 1VBZA 5CYQB 3MR2A 4LH4A 1URNA 3O3HA 1VJWA 3THTA 3H5SA 2CPYA 4DPTA 2B4VA 4CF0A 3GJRB 1UL3A 3W8PA 2ZH9A 1SI9A 1KAXA 4NXMK 4GKJF 2DGTA 4FJ7A 2FY1A 2PY5A 2X74A 3KLHA 4J5OA 4JKHA 4CLLA 2WAQD 5J1PA 2VG6B 1NEEA 3RBEA 1UVIA 5HQLA 1VC5A 3G82A 3UPFA 5LM7E 4HVZA 3C66A 2L9WA 4LY7A 2OPQA 4KRFA 3EGWB 2G8VA 3DOMB 3ZZYA 3AA2A 3O6WA 2DFFA 1N33F 5LL6Z 2BUPA 4X4SA 3E1YA 4B1YB 2Q0UA 1UVKA 1IQZA 2G1DA 3SMPA 2F40A 2UVWA 2JL9A 3V1QA 3AVHA 3UCGA 1U4BA 2OP5A 5ETVA 4JKEA 1FFWB 4CO0A 2A1BA 3TTDA 1M5VC 3DDKA 3RJMB 8ATCB 2K06A 2ZBRA 2UUWA 4WZQA 1Q8BA 4O3NA 3DGPB 2ZE2B 1HYSA 1BWEA 3HZ6A 3OL9A 4E8UA 5L46A 1NGGA 1N88A 2ABYA 1RT7A 2BE9B 4O4RA 1T95A 3FJ2A 3M5RA 5A8WA 5M2RA 3BF3A 2XRIA 1R8CA 4RTFD 1X4GA 4M8LA 3EUNA 3RSEA 2ZEJA 3R1LA 4PEOA 4ED0A 3AVIA 3QZ7A 5KRTA 2ASJA 4ZTJA 1U0HA 3FE1A 3O9RA 3IBCB 2D0CA 2XYGB 1AZSA 3R2DJ 4WJBA 2FLOA 1J5EF 4DFJA 5LL6d 3OL8A 3OJSA 1WB9A 1FXRA 4B1UB 4O44A 1HI1A 2XMTA 4I1TA 4C23A 3T41A 4Q45A 1Z2ZA 3TVZA 2W01A 1KC8T 3PG9A 3NE6A 3PKYA 2IVYA 1N36F 2CPDA 2D1KA 4HTLA 2ZNZA 2H3GX 2LQBA 4WFAL 4OJGA 4OI4A 3SPZA 2IM1A 3L2UA 1NU4A 1QUPA 5ETQA 2E20A 3H5UA 1U1RA 4B9LA 2NXNA 3H2VE 1YAGA 3DXMA 4JYAJ 1KP6A 2RE1A 4DV0K 4BR5A 3M2UA 1JCEA 2WVBA 1CJVB 4ELVA 3TX8A 4KH0B 2KT3A 3LP0B 1OO0B 4DL5A 1U2CA 1UWBA 4CE9A 1GX6A 2WW8A 3FSXA 3UQSA 2N3OA 4F2SA 4Q0BA 4C4WA 4MIAA 1N5YA 1RP5A 1PKUA 5DDPC 4O3PA 2MPUA 2FHJD 1ITGA 2AEFA 2B7BB 3SQ0A 4QIVA 4NLOA 3AOCA 3KK2B 1UP1A 4TLRA 1HUXA 5GAEI 1T3NA 3OL6A 2F8SA 4ZVGA 4JYAF 3RBXA 3RMDA 2OFGX 4ZVSB 2QXFA 5AZIB 1NPRA 4OYIA 5J2QA 3MOJB 2VC0A 2DGOA 1C1BA 4IEEA 2I2YA 4C1NI 5ETNA 3BQ1A 2BA9A 1GXLA 3ZTQA 3CETA 2I5JA 2KRBA 3US5A 5KFZA 4M7YA 3GYXB 3ZETA 3H2LA 2CGJA 4GKKK 2UXCK 4NLGA 5KT2A 1JLBB 3SXLA 2ZDPA 3NAIA 2YWKA 1VQKS 3KG0A 4PQAA 3GV7B 3KD5E 2Z1JA 4I6YA 3ZTSA 4KGZB 4LF8J 4QIFA 4MH8A 2IVMA 1BG3A 1VQ5S 3MURP 4J2BA 3FMWA 1TKTA 4K5SA 2DR8A 1MWMA 4X66J 4FKYA 1EO1A 3S7RA 3HOSA 2VQFF 1NO8A 2CQ3A 5F0UA 3LWMA 1GTEA 2D0OA 4HUFA 4DV5F 3I96A 4NYZA 2HHVA 2QL7B 2I7PA 3CJQA 3FGVA 2MQ8A 3BH7B 3PRDA 4OFZA 1PBAA 2FF6A 1OH6A 2RB7A 1BHLA 4NZ7A 3K7RA 2NYHA 2UXCF 3P4IA 4DV2K 4F4AA 2RF2A 1AUSL 2VJVA 4OJ1A 2Z56B 1FI4A 2MYFA 2KFZA 4P7TA 3EN9A 1D8ZA 4BR7A 2XY6A 3GB0A 1SV5B 3HFVA 5K8MA 2F1FA 1VC0A 2HK3A 1XNRK 5ETRA 3TABA 4DV1J 3CEDA 4ZIVA 3QJJA 3HCXA 5IXUA 3LPUA 5LJVA 3IS9B 3EDRB 4NI2B 4ED6A 1I94J 4BR9A 1MWYA 5TKYA 3RBZA 4U7BA 2Z2LA 5K8NA 4A2BA 4EBEA 4I69A 1RT2B 3D2FB 3L0QA 4ZPVR 2GGPA 4KE5A 3MDFA 3OS0A 2QA2A 2HZAA 3JS9A 1ATRA 3P83D 3BREA 4DUZK 4I7FB 2OPPA 1ZAXA 3UKUB 3MXHP 4QCLA 4ZPCA 3MD3A 4ZHRB 4CLZA 4FCYA 4CJRA 1ZETA 1WORA 3SQGB 2KHOA 4FO0A 4UUWA 3O9SA 3DRSB 2XY5A 4CHOA 1NGEA 3AA5X 2H4YB 3ZFVA 2FHJA 1Y3JA 4H54A 1E3MA 4ICLB 1EETA 4JI3K 4K25A 2HHHF 4RR5A 3CJ1A 4M3UA 1XQSC 2AYBA 3W66A 4AL5A 1AA1B 4Z4HA 1UVNA 2MKCA 4BRQA 3VGUA 4YY3K 2QLWA 3D6RA 2BM1A 5KGWA 1M5HA 4WP9A 3CNQP 2QIFA 3PACA 5F3TA 3MUMP 4WXWA 3JTPA 1QAJA 1VMBA 5KAKA 2VJUA 1O13A 3NGDA 3CD6S 5HLFB 1YVUA 4IOCQ 5U47A 1HNXJ 4PWWA 3T9NA 3UW1A 4J37A 3CCUS 3FZLA 3MMBB 2O8BA 2GJIA 2DHXA 3HF5A 3A0IX 1X4DA 3CJ4A 2MGZA 3PM9A 3L4QA 2MY8A 4WYWA 3CJ0A 2QSWA 1NDKA 4CHPA 3CC2S 1S48A 2E9ZA 1YF5L 1WUAA 1MA9B 4CGFA 4ZPTR 4DL0C 2F4FA 1VRUA 5BYRA 1Q53A 1SPBP 2K1RA 3ONQA 4OI3A 5M1PA 3OR2B 4CI6A 4KH5A 1CPZA 3SUOA 2X7IA 2G8WA 3HBTA 3PYDA 1JLEA 5G4DA 3J81j 1N8RT 4AHSA 4EAHD 1RGIA 4OYXA 5DG7A 1RTHB 4U6PA 1YLXA 3DGVA 5K5MA 2PMWA 5C25B 2Q6BA 2X6NA 4J2EA 2YKQA 4A8XA 2FJAB 1RWKB 2WUSA 1O5JA 1QS4A 1SH3A 2I9SA 2WOMA 3LA0A 2LSNA 4Z4EA 1XK8A 2CWKA 4IJNA 4B3MF 4B9TA 3H45C 5J1EB 1WOPA 4ZOSA 1SL1A 1KD1O 5IV3A 5L1JA 1VQPN 1U49A 2CKWA 2UP1A 4LF6J 1JKHB 3I6PA 5HK4A 3CCMN 3D45A 4JI5J 2AQ4A 3VZIA 1IJJA 1K47A 1KHWA 2BQ3A 3Q8VA 3L2QA 2DHHA 2RD5C 1PILA 3FSIA 3ZNJ1 3AXKA 4P9SA 3L3UA 1U2VA 1S72N 2BJDA 1BI4B 1YZ7A 3VWSA 3EZWA 4DSEA 4RW9B 3WXIA 2RHQB 3QIOA 1HIYA 2RRNA 4AM6A 3SFUA 2Q31A 3DU5A 3FEYB 1HNVB 5T7LA 4K0KF 2UUTA 1C1AA 4DZDA 2BE7D 3EMTA 3MEGB 4JI2F 1RTZA 2KXFA 4I9LA 5ETTA 2P51A 2YWEA 3L7UA 2CWXA 3KLIB 3L2VA 2VH7A 3EY1A 1FRKA 2OYQA 5GADU 1R31A 3KUHA 5CZ1A 1DTTB 4N56A 3HP9A 1WHWA 4WXOA 2VPZB 4CO3A 3V4IB 3TYTA 1XMQJ 1WKJA 1C2PA 3G8TA 3MECA 3CFPA 1UWAA 2YJEA 2IC3B 5JVHQ 1GEHA 3T9ZA 1NGDA 2M7SA 4X4VA 1BXNA 4DL3A 3W2VA 2HPUA 2UV8A 4CH0S 5HQMA 4GVBB 3KLEA 3EPIA 3QEWA 1S4FA 3I55S 4BRLA 1KVIA 1VQ9N 3C94A 2BANA 3EXCX 1S4EA 4ER8A 2DNPA 4LBPA 1Z25A 2YNGB 4IG0A 4CLUA 2ZGYA 4X4UA 4CH7A 2HS4A 1NSPA 4LF4F 3W3SA 3ET6A 3BBCA 1TUUA 4IOCL 1SL2A 1CLFA 1NLVA 1WEXA 5IWAJ 4IO8A 5M1KA 4NLWA 3UVJA 3VN5A 3ALYA 3LM2A 3ISNC 5FRMA 4DR2J 1MWZA 4J9MA 4QQBA 4KTWA 1FKOA 3WNGA 4LRDA 2UUCJ 3WQUA 1F5AA 3I32A 3KKSA 1N32J 2VBXA 3P39A 3M1VB 3W1YC 4HACB 4FXVA 4QWEA 5KT5A 1UFKA 1T9YA 1NCLA 2ASDA 5HJYA 3WXJA 1VBYA 1FEHA 4BS2A 2WW4A 3QERA 1HNXK 1TUWA 4BVPA 2ZBQA 2GMHA 1YTUA 2J76E 1IN0A 3QAUA 4HEA9 4OLBA 1RB0A 4I2PB 2KB2A 2P9KB 2WSFC 1HW8A 4CJ7A 2BXJA 1Z2LA 4K8RA 1XWLA 3V9ZA 4AFFA 3KLFB 2QLJB 3OYMA 2XQCA 1QVFM 1R8AA 1V4SA 4P2FA 5C42B 4F02A 3AD7C 2DB1A 3D2EA 3KKRA 4WYBA 1JMTA 3WNEA 2QEXN 3HT3A 4Z7CA 1JJ4A 4KY3A 2ATQA 1A5XA 3OYEA 4HHTA 3CSKA 1Q86T 2V4RA 3LL3A 4CTAB 4BRDA 2O4IA 4AILC 3FCVA 3VETA 4JI0K 1OH5A 4R8UB 2ZKTA 1KKHA 2ZC3A 1EZZB 2W2QP 4B1XB 4CZJA 2PC6A 3IG1B 3MEDA 3JQJA 5KFLA 3NNHA 2IPOB 2WSCC 3OYIA 2JX2A 1RTIB 4RW7B 4M5IA 2DNOA 1NKCA 3ENWA 1KC8O 4XDCA 1ESVA 2P1JA 1LXNA 4PR6A 1Q1KA 5EWGA 5DZ6A 1ZZFA 2ASOA 3CULA 1XI1A 3B54A 1P9QC 2IMOA 1X5PA 4LREA 2F8TA 3H40A 1K0VA 1WTFA 4IQXA 2MY7A 3GSIA 4HWIA 2DY9A 2QA4G 2Z58B 1BA0A 4UUXA 4MO4A 1BCOA 3DAWA 5J2MA 3EEQA 1WSIA 2IYIA 3E66A 3NCQA 2QWOA 3GBTA 1T03A 3N6NA 3MAQA 1LFWA 4HDGA 2C2EA 2F7TA 1TKDA 1OPZA 1EWRA 3OA9A 3TOQA 3T1YF 7FD1A 4ELTA 4S0MA 3TZXA 1VR6A 4ES1A 4OL8A 2A2CA 3E2EA 2OELA 1L3VA 2CG4A 2A3JA 3CMES 4O0NA 4H5VA 2IS3A 3HHLB 1F9FA 3G6VA 3G10A 3QGIA 3CJ2A 2CQDA 3DM2A 1RTJB 3LALA 5M1OA 5DJBA 3OW2M 3WNHA 4KAIA 4BREA 5BR8J 3HI0A 4HHHA 1Z05A 3DDNA 2EKNA 2D74B 2OZSA 4OX6A 3CCZA 4PA1A 2RILA 5C24A 3ATUA 1EXQA 1CJUA 3WIUA 3J7ZT 4JI6K 2QG9B 3P5BP 1YITS 1MLAA 1HQEB 1CJTA 2OUGA 3VEOA 1KLNA 3H4DA 3U3YA 1RWMB 4HH1A 3CUNA 1Q81T 3R9PA 4M5LA 3OL7A 2H48B 1M1KT 4Y00A 3E01B 4I6MA 2O8DA 4Q8EA 2CJYB 3A8JA 1Z6RA 4DUZJ 2BACA 1NSQA 3HZEA 2YNIA 2OMOA 4USKA 4CGIA 3RTVA 1IBLF 1LNQA 1S1WB 4GMJB 1T9UA 2ZM6K 4J90A 4LD0A 4BDYA 5KOWA 3V81A 1F21A 4CJTA 1DEJA 1RAOA 4ETZA 3A5NC 1S5JA 4WIQA 1RAEB 2DNZA 4W4MA 1S1TA 1ZBLA 2BE2B 1PAEX 1Y3KA 1EHWA 1WF1A 3PDNA 1H74A 1BCMA 4E7IA 3B6OA 3JSRA 3DLKA 3T1HF 2CQHA 1HRHA 4BY9C 3K8VA 1N5SA 1YHQS 3FLCO 2C42A 4Z2XA 1TKZB 4LRFA 1Q5VA 1LWCB 4X4QA 1GOAA 1BDGA 2E4LA 4OZ1A 3TO8A 4K0KK 2QWQA 2HQGA 4FZVA 1HBUA 2Q97A 3ZSWA 1XR6A 5DQGA 4LFCK 3HHKA 1MROA 2KTQA 4ZITA 3SIPB 4QR1A 3AVLA 4BCAA 4DR6K 2CH6A 4DV7K 2C3UA 3EL2A 3O4WA 4X62J 5JS1A 2BTFA 4K42A 1G2EA 1LWFB 4DUYF 3I0RA 4CRJA 3CCQN 2FC0A 2QM1A 4Q7AA 4CF2A 2NSBA 2G8UA 1YJNS 3AO5A 3ENQA 3R3TA 3BF4A 1ZBTA 4NXNJ 1NG9A 3T69A 3ULEA 3BB5A 4IDHA 2KM8C 4YHHJ 3R5BA 3GJTB 2Y3YA 2OPSB 2CVEA 3MPYA 1JLGA 3G71N 3FZBA 2XNQA 2R3VA 1LQ9A 1F9HA 1G99A 1S0VA 3R8YA 4JAXA 3J7YP 1GTHA 1IKYA 3IWNC 2G2OA 1K73T 4IH6A 1ULRA 2HG4A 2HIYA 4FOEA 2IVNA 4BR4A 3C6UB 4YB6A 3NGTA 3MZIA 2C2OB 4ATNA 3H4BA 1IV0A 4AL6A 4C0OC 4K4ZA 3P96A 2V4QA 1QY7A 3HVTB 2A0FB 2XGPA 1GK8A 2XMAA 7FDRA 1RLDA 2EC0A 1BA1A 2NXJA 2WTUA 3M8PA 2YI1A 4JK8A 1BUXA 2X1FA 2XS5A 1HPZA 1Q78A 4ECUA 3EE9A 1BQMA 1KLMA 5KFTA 3ULDA 4I64A 3U1MA 4IFYB 3DRRA 4HKQA 1D3WA 3CJTA 2V63A 1WDDA 3GG0A 4IDKB 3W3DA 1HI8A 1RWXB 2VQEK 1K9MT 2G4BA 3Q2SC 4ECQA 1XNQK 1LOUA 3DRPB 1CVJA 3NGIA 2FPHX 4YB5A 2VFUA 3EKUA 3WT0A 4FK0A 4ZP8A 2BVZA 2RJZA 5DQHA 4C0HA 2WK4A 4C8LA 3H5YA 2J4RA 1ZBSA 4NZ6A 2Z2ZA 4BC5A 3V9XA 2JEIA 3OTDA 5IFMA 3QRQA 4WK1A 4DV0F 2NRZA 2QMWA 2DYAA 2OSRA 5SZTA 5D4NA 2YNHA 1X9JA 4J9KA 1FT8A 4MIBA 4JI8K 1HNWJ 3GILA 3SUPA 4K4UA 3B6BA 3KJFB 1VQ9S 2MLXA 1N54B 4OZJA 1XMQK 2OGUA 3A8KA 1YJ9S 3SBMA 1BGXT 1SB6A 3M8SA 4LSZB 4H4MB 3MTKA 1GAOA 3T19A 2VICA 3K0JA 3KG4A 2HHQA 2ZF5O 2C2ZB 1RAJA 3OTOK 3NWGA 3C14B 1S1UA 4QR0A 1S9EB 1D0EA 5GAGP 2CPJA 1A7GE 1T11A 1SC4B 2DXDA 2IM2A 1F5BA 3KNAA 5KFRA 4JHDB 5KFSA 3C6AA 4NCGB 2HBZB 3VEYA 4RNFA 3DXBA 2F63A 3TA0A 2IIRA 3KNGA 2HURA 4BACA 3QESA 4ZLLA 2DHAA 5A2QU 1NAQA 3CIMA 1EARA 1V6HA 1TGOA 4AHVA 2KXNB 3AVCA 1T9VA 2YHWA 2ERRA 3J80Y 2CJXB 4OI2A 4BBYA 1S97A 4FNHA 3TW0A 3VVTA 4ZN1A 3IM8A 4CO5A 4U7CA 4E0DA 4OKEA 2AJFE 4DXLA 3GQCA 3RB3A 1DLOA 4OX9F 4LFCJ 2E1CA 3X1LB 5LSLA 4PKGA 4CZMA 3M3ZA 1XMBA 2IA6A 2CJ9A 1JLCB 3D1QA 3PIPL 3W62A 4CD1A 2D1CA 2KYXA 2VKZG 3THYA 1AFIA 4Z37A 3PW2A 3CIPA 4OJHA 4KYZA 5C12A 4CK2A 3RBDA 1BQNA 4O23A 2LEAA 3QMLA 4ED2A 2XLJA 3T3FA 1DY3A 1YIJN 1N33K 4ZCMA 1FDBA 2QWMA 1TL3A 4A8FA 3CG7A 4B3TK 1SAZA 4MYTA 2C2DA 1WC6A 4RW6A 2XHWA 1PIEA 2E5LK 2CQ4A 2VKRA 3ILIA 2W9BB 3QBWA 4LQ9A 1RBSA 4CGJA 4DR1F 1HR0F 1S6QA 2MMYA 4ITSA 1GLEG 5T7BA 2G0CA 2NXUA 4PWUA 1RAHB 1HHQA 3R7NB 1WACA 3LDNA 1IXKA 2OD6A 1T8EA 4WE1B 4F2RA 4NCAA 3OXFA 4D3GA 2BRLA 4DV6F 4I67A 2QW9A 4ZKAA 3M8ZA 3TJ8A 3I0SA 2RQ4A 4CJWA 5J2PA 5A8KB 2E1ZA 2VWBA 2L3MA 1NK4A 2GHPA 1B7YB 1UAWA 4GMKA 4F4YA 3T5JA 3LDOA 2N4DA 1F2GA 3PIOL 4A46A 4GV6A 4B3SJ 3IKMA 2EFGA 5JVGQ 1XR7A 2D7SA 5ADZA 1VISA 1TKXB 5HSPA 1W0HA 3CCLN 4LF8F 3DHXA 2MZ1A 3MM9B 3IM9A 1VLOA 3D7SB 4DR2K 4TKTA 4WF9Q 2XCPA 3CJKA 1FXXA 4CNZA 3CD0A 2ZJRQ 4A48A 3PX6A 4U8VA 1U0SA 4AF1A 4TU8A 4Y2AA 5KG2A 3IUCA 1S49A 3NY0A 3ITHA 4EO8A 1FEEA 3PXGa 1GOBA 3JS6A 4EFAC 1Q82T 1S72S 3ZSQA 3CGIA 2P9LA 1C0TB 2YX1A 3IO1A 2H51B 1ZAVA 4BLGA 3LM9A 3CD5A 4NLRA 1U1OA 3VR1A 1G1XA 4QS9A 5FPNA 1WWHA 1Q18A 2AYGA 4TQRA 2D9PA 3A13A 3G2XA 1VQ4S 4OPHA 2KLAA 3LP2A 1YJVA 4EI2A 1F0XA 3CF5Q 3KFWX 4FF3A 4CEAA 4B3TF 3WXLA 1BLUA 4DR7K 3FDSA 3GYGA 2OEKA 4OZ0A 3MDQA 2AP1A 2VOPA 5M1FA 1YX2A 5HVFA 4PKDB 4OI1A 1RCXB 4L3NA 4NOHA 3SAGA 3KJVB 1O1WA 2VG5B 2R7UA 2GIQA 3MWPA 4O5FA 3MEEB 3EVWA 5EOYA 1N34J 4H4OB 1IR1A 2IM0A 1C1CA 3PW4A 3F44A 5E41A 1UJ6A 3BGUA 4X4TA 1PYOB 1S1XB 1UCNA 1DHMA 5E26A 3CVKA 2PD1A 4BGBA 4B17A 1FTRA 3EZUA 2IFXA 3A5MC 4CLTA 4WTOB 3KUGA 1N0VC 4WCEQ 3Q24A 4E7LA 2UYTA 3ENOA 3GCWP 3SSRA 3LUYA 1LW2A 1SUQA 1WSFA 2Z8QA 3N4WA 1TL1A 5JS2A 3JYTB 2HVIA 2YQ3A 4CEBA 4NLBA 1KAZA 4F0HA 2D41A 2F4VJ 4DR3K 3PEHA 3TI0A 1VQ7N 1PJ5A 3MEKA 2VZ9A 2AGPA 2BABA 3BDPA 2JFKA 1B99A 2KM8B 4O55A 3HKZD 2ZH2A 3O08A 3FEXB 5L38A 4MYUA 1CXQA 1RKIA 2CPFA 3L3CA 2DXEA 2A6AA 3U7JA 3M9OB 3Q83A 2V2VA 2DRAA 2HKEA 2CQBA 3BP8A 5CYMA 3BKUA 1LW0B 3G6YA 2JLFA 4DHVA 3OTOF 4ZPBA 4CGDA 3QNOA 1KQKA 5BPLA 4YOVA 1RLCL 1FE4A 3OYGA 2G8KA 3TAMB 3UDVA 3GR0A 4WFNL 3VAJA 2LQ8A 4E1JA 1RAFB 4YDUA 2W2OP 1RT1A 1B9DA 1QUVA 4ZVEA 2FZKB 1BC6A 3VEXA 4IO1A 1J6ZA 3G4SN 3J7A1 4FYXB 4ID5B 2CJQA 4Z0UA 1N5TA 3AVBA 4IOAL 2GVZA 2D3UA 4A8OA 3HHNB 3KHHA 2HVEA 3WEEA 1REVA 4IOBA 2B5JA 4F9OA 1VQ7S 1K8KA 1EX4A 1NPKA 1U8SA 4CEQA 2AIRB 3PYEA 2IVPA 3D66A 3A4TA 1DURA 2DIUA 2VB6A 1KTVA 3MWTA 4RG8A 3H6EA 2MZTA 4EGLA 1PYSB 3H98A 4LFBF 2HQ3A 2M9KA 3AHPA 2ZWHA 2B4JA 4KO0A 3M8QB 1E4FT 3M32B 3MWBA 3WZ0A 5IT4A 4RUHA 4Y1CA 1QSLA 4RW8B 5HBMA 2AF6A 3MM8B 4ILMA 1XBWA 1TAQA 4CI0B 2MKJA 3DI6A 1FNXH 4CZLA 1WBBA 2EFOA 4DTUA 1SIWB 4PAAA 3AVNA 2QYCA 2FVQA 3B82A 1RHMB 3K58A 5BPNA 3FZMA 2Y1JA 4IOAQ 1Q9YA 1Q16B 3C95A 4DV2J 2V4JB 2B0GA 4USTA 4M42A 3MM5A 2ACYA 4FW1A 4CNYA 3ZCMA 3QYYA 1RCHA 2PAVA 3THXA 4C8NA 2BH1A 4FPBA 3M6GA 2DH8A 5GAHI 4P7VA 1XNRJ 2FHOB 1H3DA 4E3SA 3GCXP 4WKYA 5DM6Q 1NJWA 3DDIA 4CCHA 1ASVA 2E5LF 4IO9L 1SVDA 2DNNA 4X4OA 5AQFA 4HCBA 2MJUA 2H1YA 2D3OR 2XO7A 3G0ZA 4JI1F 4IEIA 3TR5A 3QPIA 4YOUA 3NBPB 1RU2A 2VWJA 3VTIA 2NZCA 3AY9A 1S7IA 4M5KA 4KI6A 4KHPF 5AE2A 4FYVB 2V9WA 1S3XA 4KB0A 4Q5VA 3PX4A 3LDSA 1X0PA 1M5PC 2ZD1A 4DV2F 3MFIA 4RW4B 4EYHB 1RUSA 3KK3B 4KGXB 1N34K 2ZH7A 2KJWA 3HSDA 3AO1A 4FJHA 4CHZA 3SDEB 3V9WA 4Q8FA 1SBRA 5DMRA 2R7OA 3OYLA 1SH2A 5K8PA 4BC3A 5HROA 2ZHOA 4M5DA 4F36A 2M4MA 2DCLA 2HEKA 3AA3A 3PKMA 2K7KA 1SKWA 4URQU 3CDAA 4KHSA 1QAIA 1VSLA 3GP9A 3QGHA 4DG1A 5GMKa 4CYUB 2LFVA 1GQEA 3W9HA 1HKGA 1X9MA 3U3GA 4Z4IA 2ZKUA 5F3ZA 4FWRA 4YP3A 2D0AA 5IM0B 4K4XA 3RUBL 3L2WA 2RN2A 3I87A 3VHQA 5AXKA 3SV4A 1J27A 4HUGA 4LVNP 3E9LA 1IKVA 5E0OA 2PIIA 3J81Y 3CXCR 4AQYF 3CI5A 3OFHA 2DRDA 3UO0A 2DHGA 3MXJA 3MK6A 3N4PA 4EWTA 1MWKA 3SQOP 4O3QA 1TELA 5T41A 5D15A 4MFBB 1YTYA 1ZBUA 1NBEB 4JYAK 2KT2A 4EZ9A 1DAXA 1YI2S 5I3UB 3ILOA 4M63A 2GO8A 3H8YA 3POTA 4BE2A 3R9LA 1N56A 1FX4A 2RS2A 4CHNA 3B8AX 2XMWA 4NLPA 3EXYA 2NXEA 5DLFA 2WRMA 5A8RB 2O01C 3TUPA 2GC8A 4IUFA 2PT0A 3L2RA 1VQOS 4FS1A 3GTYX 3NAEA 4PL7A 3N4QA 1NGJA 5M2UA 4WU3A 3RMBA 4M3RA 2QZ8A 4FPRA 3BF1A 2C1EB 1S1VA 3N6MA 5J1NA 5CHIA 3AAPA 1LK5A 1SKUB 1JLFB 5D3GB 2YTCA 2FYXA 3V6DB 1VSEA 1WEYA 4QBUA 4CEDA 2RNEA 1B64A 2FUG9 3VQ6A 2CDRB 5DGBA 4DSIA 3Q8UA 4P2SA 2CH5A 1CLQA 3QFHA 3ISZA 2F7VA 3AVKA 3EGNA 2EW9A 4X65K 3MX5A 2P5OA 3CW2C 2RRBA 1HQ2A 4W90B 3ZEUA 1RHQB 3S3MA 2P9UB 4P2MA 3PR5B 3E3XA 3HHLC 4JI3F 1NGCA 5B0FA 2AT1B 4UF4A 4FZXC 2VASA 1U2FA 3JXUA 2N7YA 1U45A 2ZOFA 2MKYA 2U1AA 2YHYA 2FB0A 1AT1B 2ZBIA 1OS5A 2QTWA 3W5ZA 4JKGA 1W2IA 1TTHB 3QLHA 3OSPA 4OZ3A 4D3HA 1EQYA 4M5GA 3SQ1A 3HT0A 4M45A 3OVSA 1H2VZ 3D1HA 1WSJA 2P9CA 2RU9A 5AJ3F 3H3OB 4DMZA 2IBKA 3V6JA 2JWKA 3I9V9 3ILJA 2VBWA 5CCMA 4LF5F 2Z1HA 1NOYA 2VC1A 2BJ1A 3IRXB 4YDXA 1X4FA 2C2MB 3FEZA 4NASA 4OYPA 3P45B 3BSAA 3GOIA 4LSLA 1PGZA 3KIOA 3DLGA 1EP4A 4OHXA 1HNIB 4QZVB 3T1AA 1WF0A 3A3OB 3F2KA 1B92A 4IR9A 4A4JA 2B8QA 2DJWA 2XULA 2JLEA 4CBUA 2HF4A 3DXKB 1H7WA 2YQ0A 1R8BA 2B7CB 1UEVA 2JLGA 4G3IA 4EP5A 4USVA 3VQ5A 1YGYA 1NWKA 2LQ5A 4DV7F 1NGHA 2BKNA 1NMEB 1JNRB 4URSA 3AA8A 4FLXA 4KV8A 1N34F 4UZCA 3MD1A 3IFRA 2R2SA 1KVCA 4N8NA 3QJLA 3LDPA 4M95A 5DS7A 3G6ES 4CIEA 2RDIA 1RZMA 2ZUAA 3A5LC 3HYFA 3P8BB 1HBNB 1GMWD 1CC8A 4FVCA 2VPYB 2B6AB 1UFLA 4KH6A 1TU0B 2R7WA 1UFWA 1B0TA 2BJ9A 5G0RA 1DTQA 1V3RA 1KDNA 1RDRA 2YWGA 2D4WA 1M5OC 2XSFA 3V9UA 2XG8A 1PYTA 5DDQC 1NSAA 4ECVA 3F73A 3M6XA 3I33A 2F9TA 4AL7A 1VIXA 3RGIA 4NA3A 2HHUA 1TAUA 1IG9A 1X5OA 3FKBA 2V34A 1YJ7A 4DCPB 4DPXA 2J7KA 3DYAA 5BRDA 4WFXA 2XS7A 2R2UA 4I2QB 3QO9B 1QE1A 4J9PA 2G0JA 5C7PA 4DFPA 3O8MA 1PCAA 5AFUH 5CZXA 4PXDA 2DR6A 2ZJRL 1GMUA 2WTFA 1TVRB 3SMSA 3PSIA 5FLXY 5A2QY 3NCIA 1RYSA 3LZJA 2XLKA 2WSEC 2FSNA 4ZVUB 5KGXA 3TA2A 3M2RA 1VQ6S 3ZLJA 4HT7A 4ZLNA 2CDQA 4PQUA 4I6WA 4Y0FA 4UOFA 2PFDA 2EI5A 3PSFA 4LF4K 2H5EA 2UXBJ 2YBVA 2MSTA 1NKBA 4PG8A 2P9NA 2GQ2A 3F9MA 2HMIA 1RABB 5DRKA 2UU9F 3ADAC 2NRWA 1FESA 2P2CB 1BO5O 4YR3A 3R27A 3C7NA 3AAWB 3M1FA 2YX6A 4DEZA 5K14B 1WKKA 3UN2A 3EE3A 1PAUB 3F56A 2F9DA 1JX4A 4F26A 5KFEA 4LSNA 5AZJA 1HBMA 3R8EA 1M5SA 3HO1A 5LJ3Y 1TYQB 4ZMMA 3I82A 1RT6A 3OYFA 3GV8B 3LO3A 2HQFA 3IMQJ 4WTYA 3MXIA 1DGKN 4FF1A 4CJQA 1N36K 2XSJA 1VQNS 4PHTX 5D6GA 4BWMA 3TZZA 2E66A 4DOZA 4CZIA 2DKOB 4LF7F 3QBXA 1DARA 3QNNA 5CYQA 4JOUA 3VA0A 3MUTP 2E9RX 4ECYA 4ZVQB 3AO3A 2NR0A 3M9NB 2KZZA 3NG8A 2GIRA 1JCGA 3GPAA 1I94K 1FJGF 3SPYA 3VAHA 4CJVA 3UI3A 4JI8J 2VG6A 4DV6J 1N5QA 1U1MA 5HMZA 4RNNA 5LSRA 5KPZA 3V6KA 4AXIA 1CEZA 4LR7A 2OPQB 4ES2A 2BKOA 1O8BA 2G8IA 4JV5F 5DETA 4MDBA 2P5GA 1P1TA 2R2RA 3VZHA 3LGNA 3FFIB 1R6VA 3R5JB 2C28A 4H8KA 4JI4K 4FM0A 1VYAA 2V8GA 4YFUA 4DTSA 4DL6A 2FC8A 3VF6A 2W6KA 3ZZTA 3H1QA 5E3AA 2VA3A 2A41A 4FP9A 8RUCA 1S6PA 1E6YB 3PZPA 3HX9A 2UXDK 3GG1A 4MO5A 2HFSA 5KG7A 3DGPA 4X84A 3VVUA 3MM6B 3ID8A 4E7JA 5KT3A 3E51A 4XPCA 2YKNA 4EMDA 4DB3A 3SYZA 3PO4A 1S5ZA 4ZPDA 5A8WB 1C0MA 4YEAA 2OD4A 1JWWA 1Y97A 2YHXA 3U9DA 3BV8A 4EYIB 3TTCA 2FZGB 5F9NA 4EBDA 1BMQB 4HUEA 3G87A 4BQLA 5SWMA 1VQMS 2W7PA 1EAYC 3NFAA 1U0HB 3M6WA 3SUQA 4QIEA 2ZM6J 3AFGA