2VG6A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
550
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
total genus 131
structure length 548
sequence length 550
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg6A05
3DLKB 2P1JA 4ZVHA 4W5OA 3V6DA 4KO0B 4CJSA 4IRDA 4Z4CA 1U49A 1NKCA 4OVLA 4HKQA 2QKBA 4EEYA 2IOCA 1RTJA 4YR2A 2ATQA 4CK2A 4BACA 1T03A 4DTPA 1RTIA 3SFGA 3KIOA 1ZBHA 4N41A 4EO8A 4J9MA 1SL1A 4FJGA 2VG6A 3SQ4A 1HPZA 2HHWA 1C1CA 4I2QB 3CQ8A 4E7KA 2W9CB 1QS4A 4DTNA 4KB7A 4IKFA 4KI4A 2KZMA 4ZVEA 3RB6A 3AO1A 4ZPCA 4KHNA 4ICLB 3NDKA 3CDWA 3SNNA 4CJTA 3QO9A 4YMEA 3V1RA 4CEDA 2OPQA 4J2AA 4O5BA 3L3UA 1QSSA 1TKZA 4F4YA 3B6PA 5HRPA 4DFPA 4OLBA 1JLBB 1YTUA 2YNHB 1L5UA 2OH2A 5KT2A 1TL1A 2C28A 1ASUA 3ALYA 5KFNA 1RTDA 4RW9B 4R5PA 1RA7A 1RCHA 1BL3A 2UVWA 1S1VB 3M9OB 3OYEA 1RTIB 1RA6A 1S9FA 4KHUA 3ISND 3DM2A 1SV5A 1T03B 5F8IA 1C1BA 4M3RA 4G1QB 3RRHA 4CGHA 3FQLA 4FJLA 3D45A 3MFHA 1C0UB 3HM9A 2BRKA 4R8UB 2R2TA 4CJQA 1JLAA 3M8PB 1MU2B 3GV5B 3OYAA 1ZTTA 1QUVA 1LWEB 5F8NA 2J6UA 4C8NA 3QZ8A 3FFIB 1VRUA 1D1UA 1JKHA 3OYKA 1S1XA 1CXUA 2BANB 1S9GA 4Q0BA 4B9NA 3PX4A 3NGZA 2NUBA 4Q44A 4MFBB 1VSFA 4Z4EA 3QO9B 4KO0A 3CDEA 3FQKA 1RYRA 3HPOA 4J2EA 4NLVA 1R0AA 3IG1B 2F96A 3BSAA 4KHSA 1RDAA 3I0SA 2D7SA 1RT3B 2HWIA 4ZTJA 3I0RA 3BSCA 1KVCA 2BE2B 2OPRB 1UWBB 1A5VA 2DFFA 4UQGA 5DMRA 5C25B 3V4IB 4M3UA 3KLVA 3GV7B 1LW0B 5DQHA 3IGNA 1T7PA 4O4GA 3MEDA 5DG9A 4CF1A 4DL5A 3ZSOA 3GIMA 4CEAA 4OJRA 4CEZA 4L8RB 1A5XA 3BREA 2FBXA 5KFQA 4MK8A 1RBSA 4NLWA 1KCFA 4HUGA 3VQQA 4KTZA 1S1WB 4W5NA 1RT5B 2BRLA 4OPKA 1RILA 2R8JA 2YNFB 1L3SA 4LSNB 5DQGA 3CJ2A 4ECWA 4JV2A 1RT2A 4K4UA 4Q0BB 4BDZA 1SL2A 1SKRA 2OYQA 3M8QB 3HVTB 3UR0A 3HHKA 3PX6A 4CEFA 1RT4A 2RKIA 5KG2A 4E0DA 2IC3A 4M45A 3BSNA 3T5KA 4CE9A 3SUQA 2O5DA 3WNHA 2A1SA 2G8FA 1RTHA 1XR7A 1B9FA 4K8ZA 3RWUA 4FM2A 3MXJA 3KLEB 3CO9A 3K5NA 1C0TB 3JSMB 2ILYA 1RTHB 2G8KA 2E9ZA 2KZZA 1XR5A 4J9LA 4KHWA 3L2WA 3KLEA 3HPGA 3QIDA 1L3VA 1U48A 5KFOA 1NNDA 1EETA 3BQ2A 1WSGA 1LWCA 1HQUA 3JYTA 4FK2A 4IH7A 1NK6A 2XY8A 1REVB 1K6YA 4DTUA 4ZP8A 3AVCA 1SKWA 3KHLA 2QE5A 4FS1A 3V9XA 3H5UA 3FRZA 4ICLA 3MR5A 4IRKA 4NLUA 2UVVA 4E89A 1HQEA 1S48A 2RKIB 4Y34A 4TSXA 3BSOA 2OA8A 4O3NA 1EKEA 4B08A 3C6UA 2C22A 3L2QA 1HYSA 4MFBA 4J9RA 1BCMA 4AHRA 5KG0A 4OGEA 4M3TA 1C1AA 2D0BA 3DLKA 1KSPA 2PYLA 3ISNC 3IS9B 5L1JA 3QNOA 3PO4A 1VSEA 3GIKA 2WONA 4TXSA 4DL6A 3OYIA 1LAVA 3KLIA 4CCHA 4ZP7A 3M9NB 4QWCA 3FDSA 3OHAA 3OYGA 1JX4A 3AA5X 3G0ZA 3C6TB 2VA2A 4KRFA 4GC7A 1T8EA 4TQRA 2FLLA 2ZKUA 3H5SA 4MKAA 1IKYA 2R8IA 1REVA 3LP3A 2ITGA 2JC0A 3QNNA 3ITHA 1TP7A 1ITGA 3DLBA 4IG0A 2HNZB 2IM0A 3OYCA 3MEEB 3LZIA 1HQEB 4K4YA 1R0AB 3HJFA 4IQXA 1BQNA 1X9MA 2XGQA 2BR0A 1WAJA 3RR7A 1EXQA 4FLTA 3KLHB 3RMCA 4BE2A 3PVXA 3IS9A 4J9SA 3C94A 2RDJA 1YVUA 3JSMA 1QTMA 4DTMA 1TK5A 2OPSA 2XHBA 1KVAA 5KFIA 3Q8RB 4I2QA 2V4RA 5KGXA 1JLQB 4G1QA 2IAJB 4KE5A 4EYHB 5KG6A 5HBMA 4X2BA 4FK4A 1FKPA 4PUOB 2C2RA 3RB3A 4TY8B 1TAUA 1QAIA 4CFBA 1RT2B 1TK8A 3PW5A 4K4XA 5EU7A 4LSNA 1RT4B 4JRQA 1ZTWA 5L1KA 2GUIA 4CIGA 3NGDA 3AVAA 1S9GB 5KRTA 3DOLB 3TAPA 5KT5A 4F4KA 3M8QA 3TAFA 1S0OA 1NK0A 2IGIA 4CGJA 4NLDA 1VSKA 2YNHA 4DG1A 1TKXA 1BQNB 1JXBA 2QKKA 3DLEB 3SUOA 3PW4A 2Z1HA 1LV5A 2KFNA 3ZT3A 5HRRA 3OYDA 1RAJA 3OYJA 3OL6A 1F21A 3SUNA 3SJJA 4B3OB 1Z4UA 3AVJA 3OHBA 2HW3A 5DK5A 4H54A 2DFEA 4FLUA 5KI6A 1C1BB 2XY7A 2JEGA 3AVFA 4FLXA 2I1RA 3S3NA 2BE2A 2HNDB 2IAJA 3QEVA 4RW4B 1NHUA 5HBMB 3EPGA 1TV6B 4FJJA 3KHHA 4QWEA 1LWFA 3DI6B 3T19A 4B9VA 4K4WA 4RW7A 2YKNB 2FJWA 2OZSA 2WTFA 2W7PA 4K4TA 1RT5A 3NF9A 4AHCA 4NLTA 1U47A 3K57A 4NLQA 3HKWA 3MF5A 3UPFA 3OSPA 3LP1B 1WNSA 3DRRA 3WNGA 4CJVA 4CHQA 1SH3A 3IN5A 2O4GA 3DMJB 1GOBA 2HHQA 1ZBUA 3MEGB 2WRMA 1IKWA 3C95A 1KHVA 2W42A 3C6UB 2AGPA 3ZSQA 3PV8A 5C25A 3RRGA 1UA0A 4RNHA 4MKBA 3PJWA 1RBTA 1TVRA 2XGPA 3NCIA 4RNOA 3BJYA 1JL1A 3KLIB 2IJNA 4Y2CA 3NH2A 4CJFA 5C5JA 3I5BA 3QINA 3BGRA 3HSTB 2E4LA 1BI4A 4FJNA 1SV5B 1XHXA 4KHYA 5CYMA 2G8VA 3SV3A 1RDDA 3VQEA 3DI6A 1U4BA 2DPIA 4I7FB 3QETA 4H4MB 3OY9A 3M8PA 2OPQB 4Y3CA 3CWJA 4KB1A 3AVIA 1ASWA 1VRUB 3G10A 3H4BA 2ILZA 1BISA 3RBEA 3SUPA 2KW4A 2O4IA 3ZT4A 1N48A 1IO2A 3HP9A 4DQIA 4FLVA 2AX1A 4RW6A 3MXIA 4JLHA 4M95A 1N56A 3NFAA 1S4FA 3TARA 4F4ZA 2HNDA 2OPSB 4DS4A 2YNIA 5J2NA 5K14A 4M3WA 3VA3A 5F8LA 4FJ7A 5KT6A 3DDKA 2B5JB 1JLFA 1JLEB 1HNIB 1C6VA 4CJ3A 4HTUA 3QLHB 1UAXA 4DU4A 3Q8SB 1J9AA 3LWLA 3QIPB 1IG9A 4H4MA 1NKBA 1Y97A 4TY9A 2YHBA 4BDYA 2X6NA 4RG8A 4I2PB 2WK4A 2AGQA 3OJSA 4FW1A 4WE1A 4B9UA 3LZJA 5KFSA 4DQQA 5KFDA 3CJ3A 3ZSWA 3KK1A 3HYFA 4FS2A 1QE1B 2JLEA 3RB4A 3PHEA 3KD5E 1KTQA 4ZVGA 4KKOB 2CKWA 4PY5A 2P5OA 1HNVB 1JXEA 1KVBA 3BR9A 4CECA 1NJZA 4W5QA 1RT3A 3LP2B 4IG0B 3QESA 3DRSB 1BQMA 1JIHA 2W9BA 4U6PA 3AVGA 3K59A 4J9NA 3HT3A 3CDUA 4C8MA 1SUQA 5KFLA 3QZ7A 1IKVA 4FM1A 3KJVA 3M9MB 2UUWA 4NCGA 3HXMA 1RBVA 4FBTA 4LD0A 4QPXA 4M41A 4Z4IA 4I7FA 5KFEA 2YV0X 1IKVB 1DTTB 5HROB 4ECXA 4F50A 1VSDA 2UVRA 4RW4A 4RU9A 4ECVA 1FK9A 4URSA 3QEXA 4NLXA 3TR8A 5KFFA 2HHVA 1T3NA 4CGIA 1QAJA 2B6AA 2Q3SA 4KFBB 4HUFA 5EDWA 3VQ7A 1Z25A 1LWCB 4JRPA 1ZBIA 2VG5A 1FXXA 4CJRA 1NJYA 3CJ0A 5KFMA 3O3GA 5F8HA 2FLNA 4H4OB 3V6HA 1BCOA 4LY7A 3DOLA 1RTDB 2E6LA 1DTQA 4EBEA 4I9QA 4DG1B 3V9SA 1JLEA 5J2QA 4IH6A 4IKAA 2C2DA 1ZBLA 4AHUA 1WLJA 4F4WA 3VQ5A 3F73A 1BHLA 1QSLA 4J2DA 2D41A 3ZSVA 4YFUA 3DYAA 5JS1A 2HAIA 3RAXA 4NLRA 1CLQA 4KV8B 3GILA 1JLAB 4EO6A 2YNIB 4WZQA 4ZPDA 5KFVA 2F8TA 2HHXA 4FBUA 4TYBA 4IBNA 4OKKA 3S9HA 4K4VA 3TVKA 2GIQA 5DLFA 3EZUA 4JS5A 4N56A 2W9CA 3V1OA 4PQUA 3VQSA 2PZSA 4CIEA 4XO0A 4FVMA 3P83D 2OPPA 1S1TB 1N5YB 4O4RA 4GVMA 3UIQA 4DSJA 3GIIA 1SL0A 3AA4A 3RMAA 4ZMMA 4E19A 2ATLA 1DTQB 2P5GA 3LANA 1K1SA 5CZ2A 4WYWA 3THVA 4EZ6A 1WNEA 3U6FA 4NYFA 3KHGA 4F3TA 4IG3B 3CVKA 3TAMA 2A1RA 5L9XA 4CF0A 3SCXA 3T5LA 2JEJA 5KGWA 2HHTA 3WNEA 3TQ1A 4DSIA 4KPYA 1JLQA 1UA1A 5C42B 5SWMA 1NK7A 3H59A 3VQ6A 1S6PA 1VRTA 2GC8A 1JLCA 3E01A 5I42A 3NAIA 2JEFA 3V81A 1NOZA 3GIJA 2HHSA 5KT7A 3SPZA 3V6KA 4Q43A 4HVJA 3S3MA 2EX3A 1HARA 4DTRA 2HMIB 2V0NA 3PW2A 3FSIA 4DFKA 1YT3A 3VQDA 1SUQB 4KHRA 4ZP9A 4FYDA 4ECUA 3H98A 4QWBA 3IRXA 1X1PA 2W8LA 2FBTA 1C0MA 4WFZA 1LW2B 4B9MA 2BQ3A 4YQWA 3AVLA 5KT4A 3MECA 2F8SA 4CGDA 4ELVA 1L3TA 4TQSA 1KFDA 3HL8A 4DQPA 1UWBA 4DS5A 5KG5A 3SPYA 4LSLB 3AVKA 1S0MA 2XO7A 5FDLB 4E7LA 2JEIA 4OLAA 1NK8A 1NK9A 4KREA 1VSLA 4KBIA 4CJ5A 1N5YA 4ED8A 5KFYA 3ASMA 4R8UA 2V9WA 2E9TA 2Y1JA 2B4JA 1RT1A 4RNMA 4NLPA 3GQCA 4H4OA 4DFMA 1YVFA 3KHRA 4EP5A 4KAIA 3K58A 3MFIA 4O3OA 4DTSA 1KHWA 5KFJA 4ECQA 3CG7A 4ID1A 1XWLA 3O4QA 3MEGA 3QGIA 5HRNA 4Y1CA 3MECB 3LWMA 3RR8A 4FJKA 4ELTA 4BE0A 3PO5A 4MIAA 5HRSA 4K50A 4Z4HA 4Q45A 2XY6A 4F3OA 3DYAB 3ZSRA 4CHZA 3AA2A 1EX4A 2RPIA 1TKTB 2HVHA 4YR0A 3H40A 4J9OA 1I6JA 2XCPA 1D0EA 3TAEA 1RT1B 2F8EX 1S9EA 3MEEA 3NKYA 4DTJA 2VG6B 4EP4A 4NLSA 3DOKA 3LP0A 4PUOA 3OYHA 3OSNA 2XI3A 1BQMB 4BDPA 2LSNA 4KSEB 4NYZA 2IC3B 5F9LA 4CF9A 3NH1A 3V1QA 3E51A 4IR9A 1HYZA 2KTQA 2HHUA 4DQRA 1GX5A 3QIOA 3KOAA 3AO4A 4Q8EA 3IG1A 3KK2B 4MK9A 3MR6A 4Y1DA 3HVTA 2FJVA 3RAQA 3I0RB 2CJQA 3KNAA 4OKJA 4AH9A 1VSHA 3MAQA 4FJHA 4KB0A 4O55A 1EP4A 4M3XA 1VSJA 2I5JB 1J5OB 1B92A 1RBUA 1MU2A 1LWEA 1S9EB 3NMAA 3ZT0A 4F2RA 1WSIA 1FKPB 1TV6A 4DQSA 1GOAA 2J6TA 1LWFB 4O3RA 1T05B 4WFYA 2ZD1A 4F2SA 4NCBA 4FJ8A 2AJQA 3V81B 3QGHA 4M3ZA 4ID5B 5KFRA 2HNZA 1S6PB 1VRTB 4DL3A 3I5CA 3EZ5A 4ZP6A 3OYFA 4RW8A 1J54A 2BDPA 2KQ2A 1Q8IA 1RT6B 1RDBA 5EWGA 2IM3A 1X9SA 3NF7A 1XR6A 1JLBA 4R5PB 2YNGB 4QW8A 1YTAA 4DSEA 1S6QB 1ZETA 1N6QB 4B3OA 2X74A 3SQ2A 3PR5B 5T14A 3ULDA 4DL2A 4RW9A 5C24B 2D3ZA 4CK3A 4QW9A 3AO5A 1TKDA 4ED1A 1HNIA 1OS5A 3AVNA 2Z1JA 4EZ9A 5HLFB 4CJ4A 3QLHA 3GV8B 4DTOA 1S1UB 5EWEA 4KAZA 5KFAA 4CJWA 1S0NA 3NBPA 4BWMA 3UDLA 2AGOA 5KFKA 3I8DA 3LAKA 2R2SA 4BE1A 3K5MA 1XC9A 4B8AB 3VQAA 1RDCA 1T05A 1U04A 3QERA 2RF2B 1SKSA 4U7CA 2IA6A 4JV0A 2ZE2B 3MXMA 3DRRB 3LAMA 1X9WA 3JYTB 4WFXA 5J2PB 4RZRA 3OLBA 3PX0A 1A5WA 3HP6A 2DPJA 2BGGA 3OYLA 2HB5A 1HYVA 3NL0A 3HPHA 4R0EA 1RDRA 3BQ1A 3CYMA 4LH5A 3VQ9A 2HMIA 4IFVB 4KHQA 2WOMB 5KG3A 2XY5A 2FBVA 4TN2A 4NCGB 3CJ4A 1IKXA 4M94A 4YNQA 1S6QA 1J5OA 4FZYA 4HYKA 4CFDA 2X6SA 5DGBA 2PYJA 2QV6A 2Y1IA 4WXWA 1HRHA 1SH0A 3NF8A 3PZPA 1IM4A 4E1MA 4Q5VA 1D9DA 2HNYB 5J1EB 5KFXA 3KLGA 5F8MA 1QSYA 3KKSA 1S97A 1HPZB 1B9DA 3D0PA 1HQUB 3SZ2A 1WSEA 1TQLA 3B6OA 4FZZA 5KG1A 5J1EA 3AO3A 4J9PA 3KK1B 3OLAA 2X78A 5F8GA 2R8HA 3P1GA 3TABA 2GIRA 3L2VA 1VSIA 2UVUA 5D3GA 4DTXA 4TY8A 4WXOA 1U09A 5J2QB 4XIUA 2Z1GA 3ICLA 3PJXA 3AA3A 1NJWA 4ECSA 4LQ9A 1HNVA 1RBRA 4IFVA 4K4SA 3KD1E 4JS4A 1JLFB 1S5JA 3PW7A 4FLWA 1NK5A 4CJEA 3NBPB 5KFBA 1S1VA 3M8RA 4RUCA 5L1LA 4EBCA 4E7HA 1C0UA 4B9LA 4WYLA 4CFCA 3T3FA 2AU0A 5KG7A 2VG7B 4TLRA 1EETB 4FLZA 3H08A 4PA1A 1WSFA 3TAQA 2VWJA 3CFPA 4E3SA 1Z26A 4NLYA 3ZSZA 4AHTA 4FM0A 4ED7A 4ZTFA 3A2FA 3KTQA 3D28A 3NE6A 1O1WA 5I42B 4RW8B 3DRPA 2XRIA 3DLHA 4ED3A 4CJPA 3KK3B 3CM6A 1L3UA 4I9LA 3M8SA 1WSHA 3SFUA 3G6XA 3V9ZA 1BGXT 3GYNA 4F8RA 2AWZA 4RW6B 3KLGB 3MEDB 3ZT2A 3O3HA 5HROA 4ZPBA 5DG8A 4FCYA 4HUEA 1LW2A 3RTVA 4MH8A 4AILC 4K4ZA 4KTQA 4CK1A 4KV8A 4IFYB 3NH0A 1FKOB 2ALZA 4RNFA 3NF6A 4CJKA 2C2EA 3VQCA 3PR4A 2Z1IA 4FLYA 5HP1B 5J2PA 3N6MA 4M42A 4F4XA 2VWKA 3OS1A 3SI8A 1S1WA 3HVAA 2YKNA 1TAQA 1T94A 3LPTA 4O3PA 5JXSA 2G8HA 3O3FA 4FZXC 5F8JA 3P5JA 1S1XB 3LP2A 1TL3A 3TANA 4NLGA 3WNFA 4QWAA 4RUAA 3DMJA 1XHZA 3CJ5A 1TKXB 3Q8PB 2JGUA 4FJIA 4IFYA 1GOCA 4B9TA 4CEOA 1WN7A 4FK0A 1DTTA 1BIUA 4J2BA 1MMLA 5K14B 4PWDB 4CFAA 4W5TA 4MK7A 2W7OA 3G6YA 1W0HA 2JC1A 3CM5A 1JLGA 2YKMA 3T5JA 4KI6A 5E41A 3HVWA 3EPIA 3RBDA 4ID5A 2VG5B 1W9HA 1Q9XA 5EUHA 3VQ8A 3UQSA 3VQ4A 3RMBA 2P51A 3PY8A 5KT3A 1D9FA 2IBKA 3LP0B 1RYSA 2DY4A 1QQCA 5KG4A 4NZ0A 3LALA 5KFWA 3L3VA 3V6DB 2IM2A 4DF4A 3OL9A 3SI6A 3L8BA 4O3SA 2FC0A 4TYAA 5C24A 5KFUA 3ZSYA 3VA0A 3KK3A 1S1UA 4Q8FA 4BWJA 3F9KA 2J6SA 2R2UA 4DL4A 4J9QA 4NCAA 4O0JA 2ASLA 1U45A 4K8XA 2ASJA 4FJ9A 4CEQA 4GC6A 1NKEA 2OZMA 1JXLA 2YHAA 3EYZA 4LH4A 3QGGA 2I5JA 2WHOA 4Z4GA 2B5JA 3TAGA 3O4NA 4DF8A 4LSLA 1KLMA 3BDPA 1IKYB 2FVRA 4C8LA 2VG7A 3VQPA 3T1AA 3AVHA 1ZYQA 4IDKB 2D0CA 5EWFA 2UUTA 3ZCMA 4OL8A 2XCAA 3OS2A 2HWHA 4NYNA 4QWDA 3ITHB 4E1NA 2YNFA 4NLOA 1QE1A 2XC9A 2FVPA 4HHTA 4QOZB 5I3UB 5KTQA 4HCCA 5SZTA 3IRXB 1JKHB 4DSKA 1TGOA 4B8CA 5DLGA 5FROA 4ZHRA 3V9UA 3IAYA 5I3UA 4O44A 2B43A 3MTKA 4DEZA 1EP4B 3KLHA 3DRSA 4QAGA 4JV1A 4ZPAA 3ZSXA 4O44B 1K1QA 1VSMA 4DU1A 2G8IA 1KRPA 2IM1A 3V4IA 1TKTA 3MR3A 1KFSA 3KJVB 2IDOA 3BGRB 4RW7B 3DLRA 2G8WA 4FJMA 2IS3A 2WB4A 5DGAA 4CHYA 2D0AA 1KLMB 4NRTA 4DL7A 5T7BA 1NJXA 1FK9B 3AV9A 3DOKB 4GMJB 2R2RA 4N76A 3PW0A 2DFHA 4WZMA 1RT7A 5KFPA 3OYNA 2HVIA 2EC0A 3QEWA 2ASDA 4CF8A 4ELUA 3DLEA 2WCXA 2GBZA 2FBYA 3D5MA 2GV9A 1HYSB 2WOMA 5J2MB 2RN2A 2W9AA 2FJXA 4FW2A 3U3YA 5DQIA 3CFRA 3EY1A 2W9BB 4XPCA 2QK9A 2IMWP 3LDSA 3DM2B 4QCLA 5J2NB 4CEEA 4JUZA 4OKEA 4URQU 2RDIA 3NAHA 4O0IA 3OYMA 3OVNA 3AVBA 4GW6A 4MIBA 2E6MA 2RF2A 1QHTA 5KFZA 4MQ3A 2ZD1B 3KKRA 3SQ0A 1I39A 2DTUA 5CZ1A 4KTWA 4DSFA 3KLFB 3CFOA 4I2PA 2R8GA 4E7IA 3V6JA 3DLGB 1JLGB 5HP1A 3DRPB 4LQ3A 1TKZB 1NHVA 2D3UA 2BQRA 4DFJA 1S49A 1CZ9A 3N6NA 2FVSA 5C42A 3KLFA 3CIZA 1ASVA 1S1TA 4Z0UA 4ECYA 2R7YA 3KK2A 4G3IA 4HCBA 5KFCA 2V4QA 1N6QA 5KFTA 3KMSA 2YNGA 4XPEA 5CY4A 1G15A 2OPRA 2HNYA 1W25A 3KMQA 3PUFA 1BI4B 3QEIA 3ZT1A 1WAFA 1TVRB 4YR3A 4IG3A 2PY5A 1D5AA 1CZBA 1CXQA 2AQ4A 4EYIB 1FKOA 4URGA 3H2LA 4H8KA 4Y2AA 3DLGA 4OGCA 3FFIA 4CJLA 2WONB 3HK2A 2OPPB 3MR2A 3H4DA 2BANA 3QEPA 3N6LA 1S10A 3HO1A 1JLCB 3E01B 3IGVA 1SH2A 5D3GB 3RMDA 5CYQA 4Z4FA 3SYZA 1ZBFA 4DLGA 2ZE2A 4CIFA 3H5YA 1BIZA 3HVRA 4KKOA 4RNNA 1IKXB 5KRSA 4CGGA 1DLOB 3TAMB 2XI2A 4ECRA 1UOCA 1IKWB 5JS2A 1JL2A 1TL1B 4N47A 4AHVA 2VA3A 3OL8A 4PWDA 3RB0A 4ECZA 3OS0A 2QXFA 3K5LA 4C8KA 2BQUA 4ZVFA 1J53A 3QIPA 4CF2A 4J9KA 3U3GA 1C0TA 2KFZA 4WE1B 4IH5A 3V9WA 3S3OA 3SV4A 3NGIA 5FDLA 3L2UA 4ED6A 2D5RA 4OPJA 4M3YA 3AO2A 3AVMA 3BQ0A 5JUMA 4CHNA 4PQUB 1KLNA 4FJXA 1RT7B 1D8YA 1HMVB 4ED2A 3NGYA 4B9SA 3LPUA 1RT6A 5KFGA 5CYQB 4CHOA 4DMNA 4DU3A 4KFBA 5KFHA 3VQBA 1Q9YA 3NAEA 4O3QA 5F9NA 1DLOA 2E9RX 4CGFA 1HMVA 4CESA 3NHGA 4DSLA 4C8OA 1HJRA 2ZQBA 5DG7A 4IR1A 1N4LA 5J2MA 4CHPA 4E7JA 1C2PA 3G6VA 4ZHRB 2W8KA 1RTJB 1GX6A 1LAWA 3G86A 3QYYA 5HLFA 1TK0A 3OYBA 5FRMA 4W5RA 4O4GB 1NOYA 3SQ1A 4IRCA 5FRNA 1RNHA 4CJUA 1IH7A 4CERA 5CYMB 4DLEA 2G8UA 2ETJA 1VK0A 3TWHA 2EHGA 1CSJA 1LW0A 3L2RA 1NK4A 4CEBA 4AHSA 4ED0A 4IDKA 1WSJA 2B6AB 2IJFA 1C1CB 2R8KA 3C6TA 3T5HA 3H5XA 4NRUA 3K5OA 2FVQA 4KHMA 2FLPA 3TI0A 4EBDA 4YP3A 4FXDA 1I3AA 4IOBA 5L1IA 2YKMB 2FVCA 2XWYA 3OJUA 1TL3B 1XI1A 4N5SA 4DWIA 2AX0A 3I0SB 3OL7A 3K2PA 4ECTA 3VN5A 3I5AA 4FJ5A 3LP1A 3Q8QB
chains in the Genus database with same CATH superfamily
3P5BP 3DLKB 3C3LA 3TQEA 4W5OA 4KO0B 5K20B 4IRDA 1U49A 4WPAA 1H72C 3M6GA 2H48B 4LMZA 2EFVA 1RTJA 4CK2A 3QJLA 4DB3A 2KYXA 1GLAG 4DTPA 4M63C 2VC0A 2QYCA 3SFGA 3KIOA 4S0MA 4BREA 3TX8A 2X1FA 4J9MA 2GEMA 2F8MA 1W2IA 4LFAJ 2AJFE 3UB5A 3B8AX 3SQ4A 1S72S 1HD0A 1C1CA 3WQPA 1TELA 4E7KA 1QS4A 4DTNA 4KB7A 2EEYA 4KI4A 4B1ZA 3R3TA 2LYVA 2YH0A 3AO1A 1NGFA 4KHNA 4ICLB 4CO4A 5AXNA 2YX7A 5DDPC 1ESVA 4WYBA 4B1UB 3QO9A 4YMEA 1PJ5A 4CT8A 1QSSA 5HRPA 4WCEL 4GY2B 3VERA 2ZH5A 4J90A 3OXLA 1ASUA 4JI0J 3N9UC 3VCDA 5CD4A 4R5PA 1R7IA 2KO1A 3T7ZA 4AUKA 2UVWA 2HS0A 2V50A 1T11A 5ETSA 1GAOA 3CJTA 3FZBA 1SV5A 3FQLA 2MQNA 3LGMA 1C0UB 3HM9A 2CDQA 4R8UB 5IXUA 4PXBA 1JLAA 2ZNYA 1LWEB 5F8NA 2X7IA 3FFIB 1VRUA 1D1UA 3VVUA 2KN4A 2QWLA 1PJ6A 2QWMA 4B9NA 3PX4A 2NUBA 2VQEJ 1J2VA 2DNKA 5T41A 2MGZA 1CLFA 4Z4EA 3LDLA 3CDEA 4J2EA 3CNQP 1R0AA 3K2YA 3MHYA 1RACB 3BSAA 1HNWJ 5C2DA 4YDUC 3I0SA 2V7ZA 4DXLA 2CYYA 4ZTJA 2UU9K 3LDQA 4KGZB 4ANDA 4CLTA 3D54A 5IT9U 4M3UA 4FWNA 2GVDA 2UUCF 3R27A 1YITN 1LW0B 4O4GA 3MEDA 5DG9A 2EKNA 2R7VA 4L8RB 3BREA 3CSKA 1RBSA 3EVOA 1KCFA 3VQQA 1S1WB 4W5NA 4LSNB 2VPYB 4ILHA 5DQGA 4WF9L 5B09A 1RT2A 4IEIA 4ISEA 2DCUB 3HHKA 1OWXA 4CEFA 4NLBA 5GADP 2UXCK 4OHXA 2NRRA 1UMJA 3LTOA 2VFTA 2RHSB 3HFKA 3D68A 2O8CB 1L3KA 2O5DA 4RLEA 3WNHA 2A1SA 2B0GA 1B9FA 4B1VA 4K8ZA 4FM2A 1WEYA 3KLEB 1C0TB 2DGQA 2ILYA 4YOYA 2E9ZA 4V19S 1XR5A 5CZXA 4J9LA 3L2WA 1CULB 3QIDA 2VHGA 5H9FK 3UN2A 1LWCA 4FK2A 4IH7A 1WI6A 4X4VA 1QVGR 2N4CA 4FS1A 2ZZTA 2B7CB 4ICLA 1WHXA 2YJEA 3H2VE 4NLUA 1OY8A 4CWBA 4EI2A 1S57A 3FGVA 2HQ3A 4B08A 1X60A 3F9MA 4UOCA 3CCWA 5L38A 1C0FA 3A3NB 1WUAA 2D0BA 5AFUH 3VETA 1KSPA 1IUJA 3QNOA 3M2RA 1VSEA 3GIKA 4HTLA 2O67A 5BPMA 1MWQA 3KLIA 4CCHA 4CIOA 1LAVA 4OI2A 3M9NB 1VHFA 2Z56B 3FDSA 1EB0A 1JX4A 1WUUA 2WUSA 5JLFA 3C6TB 2VA2A 3DJCA 5CR4A 2MKCA 1T8EA 2ZUGA 3SIPB 2GMHA 2GVZA 1REVA 1J27A 2ZF5O 3QNNA 3DLJA 4ZIWA 2K3KA 5F3ZA 4DR1K 4QS8A 4N8NA 3AOAA 4P2MA 2M7SA 4K4YA 2UUBK 5EOYA 1WTBA 2ZGYA 3HJFA 1X9MA 2BR0A 4CQ1A 4CM2A 1WAJA 1CQNA 4FLTA 5GVQA 2VKZG 3PVXA 3IS9A 3C94A 4C8ZA 4MYTA 1QTMA 5BJRA 3BKTA 5L39A 4YOTA 3CC2S 4OV1A 4NYPA 1JJ2M 4I2QA 4LF7F 4O5FA 1FFSB 1EZZB 2CJXB 3C2PA 3NY0A 2HZAA 4G1PA 4UOFA 4KIAA 4DZDA 1S12A 1NRKA 2DR5A 1FKPA 3QMQA 4M5JA 4TY8B 1TAUA 1RGVA 4GRSA 4CFBA 1FD8A 1SQGA 4DV6K 1RT2B 2B4OA 3PW5A 3OTOJ 1WACA 4LSNA 1RT4B 1UFLA 5L1KA 2HBJA 4GVBB 3EGVA 1S9GB 3RBXA 3TAPA 3CCMN 5KT5A 4F4KA 3M8QA 5EX0A 3AT1B 3TAFA 4Y0FA 3AQOA 2IGIA 4JI6K 4NLDA 1VSKA 1FCAA 2R7XA 5GAGU 1BQNB 3PHTA 1U1RA 1ZZNA 4OZLA 2QKKA 3DLEB 3CCEN 4WFNL 3OYDA 1RAJA 3OYJA 1Z4UA 1YHQS 2HW3A 1NGBA 3OTOK 2EXUA 4FLUA 4NX9A 5KI6A 1C1BB 2XY7A 4FLXA 1FRJA 1VIXA 4IOAL 4MDBA 3AHPA 3RBZA 4RW4B 1FRIA 2MQ8A 2KT3A 4QBUA 3KHHA 4H5RA 1NU0A 1FDBA 2UXBF 2OZSA 3LW5C 2PE8A 2KT5A 1KAYA 1UEKA 3BO4A 3DXMB 2DJWA 3D6RA 1HW8A 3OSPA 5C7PA 1WNSA 4EFHA 4USTA 1FXLA 1SC6A 4PG7A 3A1YG 3FBCA 3DMJB 1ZBUA 2GFFA 3T1HK 2QZ8A 2AZ3A 1UEVA 2Z8QA 2W42A 3W5ZA 5C25A 1DFDA 1QHAA 4KH4A 4RNHA 4PWUA 3D7SB 2FJEB 5KQDA 1N36K 3CCJN 3NH2A 3A8KA 4JI3F 3HSTB 3ETMA 3S1TA 4K0KF 1Y5IB 4PKHA 2EVZA 2ZITA 3WIUA 4I6WA 2QL7B 4Y3CA 3AVIA 1VQSA 4EK2A 4E2FB 3F44A 1BISA 4M5DA 3TA2A 2FHJD 3POTA 3RBEA 1S99A 2O4IA 3CPEA 1SVDA 4WP9A 3QAUA 5E0OA 1K0VA 3HP9A 1KAXA 4FLVA 3MXIA 2JLFA 4IJNA 1U24A 4JLHA 3J7AN 2ZBPA 3TZZA 1N56A 3NFAA 5JICA 2JRSA 4OYIA 2HNDA 3CJSA 1B64A 2BV3A 4M5NA 1HNIB 2A6OA 3Q2TC 3P4UB 1ZM4A 1J9AA 4KBOA 3D9BA 2DD8S 4DR3K 1Y97A 2UXDJ 2WK4A 2EPIA 2CXEA 3OJSA 1Q8BA 3LZJA 3C6HA 1TUGB 5KFSA 1U6ZA 3HYFA 1S0VA 4FS2A 2IVMA 1QE1B 2JLEA 2EFNA 2KJVA 3IXQA 4HT7A 2YTCA 2V7YA 1UFKA 2CKWA 3IBCB 2C2OB 2CNNB 2JL9A 1JXEA 2ZDOA 5AR0A 3DRSB 1BQMA 2W9BA 2MMYA 3AVGA 3K59A 1ZC6A 1EQ0A 4FZVA 1MDUB 3O9QA 3HHLB 4C8MA 5AQIA 2H4YB 4DV6F 3M9MB 1PO6A 4LR7A 2HSEB 4QPXA 2VUGA 4JK8A 4Z4IA 4M5LA 2HHPA 2YV0X 1QZ5A 1DTTB 4ECXA 4KH5A 5BRDA 4QIEA 4CRJA 2UVRA 4RU9A 3C7NB 2XNQA 3HJVA 3AY9A 1HBMB 3D2EA 3TR8A 1T3NA 4DPOA 1QAJA 2B6AA 3JTNA 4OYPA 1F9HA 4HUFA 5EDWA 3VQ7A 4H03B 3D6HB 1FXXA 4PRFA 3CJKA 2HLTA 2BABA 1NJYA 3HI9A 1VISA 3CQYA 4K5SA 1UPPA 4NA3A 1FRMA 4H4OB 3V6HA 4DV1F 1BCOA 5D0GA 1YWXA 2X1GA 2BKPA 4BGAA 5G4DA 5BYQA 1RTDB 2E6LA 3PKMA 1Q7YO 4I9QA 4DG1B 3V9SA 5IT9Y 3VAHA 1I94F 2C2DA 2WSEC 3W65A 1ZBLA 3I33A 3A8EA 4JYAJ 2D41A 4KQZA 4YFUA 1M5SA 5JS1A 3RAXA 1PBAA 2YVSA 2HHHK 3GILA 2EFPA 4EO6A 3MMBB 2YNIB 2QI2A 2XMTA 4ZN3A 2XYHB 1X4GA 4JYAF 4TYBA 4OKKA 3FCWA 5F1XA 5B0BA 2A1BA 3HSGA 3OTEA 3CPWR 1A6LA 3M1VA 3TVKA 3R3LA 5BXIA 3EM1A 5LMNK 3RYLA 2ZH4A 4XO0A 3VV2B 3R1HA 1F5AA 3P83D 1K9MO 2O8BA 2H4WB 1YBTA 1BD6A 4O4RA 4DSJA 4PXEA 3SXLA 5IM0B 3QFUA 2PMWA 2PDAA 4YDXA 2MPUA 3ELHA 4AFFA 1VQ6S 3MEKA 4A8FA 1SQEA 1FFWB 1Q95G 5EXWA 1K1SA 1RAOA 2XSFA 4WYWA 3CJ9A 4KGMA 4CO0A 1QY7A 4EZ6A 3RW6A 5C2GA 2VGNA 5GMEA 4CF0A 3JQJA 1V9OA 4JI5J 3FZLA 1XUPO 1T6CA 3C14B 1LCUA 2HPUA 3WNEA 1ZS6A 3ETOA 3RU0A 5AQJA 3H3OB 1NK7A 1P1LA 3CCLS 2WBNA 1S6PA 2GC8A 4OMFG 1WKJA 1XTZA 1UVMA 1NOZA 2LXIA 3GSDA 5E3AA 5KT7A 4HVJA 1ITPA 3GONA 4GV9A 1GLFO 1HARA 4NXMJ 4HH0A 4DTRA 3MX5A 4UZBA 4YB1P 4DFKA 3OR2B 3HOTA 3D2FB 4FYDA 1KONA 4BRPA 5CD4H 3FE1A 1X1PA 2B4VA 2PSZA 2FBTA 3U1LA 3AD7C 3BEGB 2BQ3A 3AVLA 2CAJA 2AV5A 4L72B 1L3TA 1Q0NA 2DNNA 2DEIA 3TVYA 3OFFA 4DQPA 3ONQA 4HDGA 1VBYA 5C15A 1UVNA 4QS9A 4F67A 5KG5A 3W3SA 5DM6L 1NBEB 2JEIA 2RVJA 4QYZK 3ZNUA 3CHWA 4C9DA 2RD5C 1NK9A 2KRRA 2H54B 3CUNA 1OH6A 3H3NO 1N5YA 4X66K 3THYB 3PXGa 2ZWPA 3E8OA 4RTFD 2V4JA 3VAKA 4DFMA 1YVFA 1S59A 1MN9A 3ATVA 2R9LA 3HOSA 1EX8A 4DTSA 2QWQA 1KHWA 3FZFA 5J1PA 1XMOJ 1IBKF 5DM7Q 2IY5B 1FWKA 1XN9A 1VC5A 3QGIA 1BQXA 5LSLA 4HLBA 1RGIA 3ET6A 3LWMA 3RR8A 1FF2A 1UVLA 2JH3A 3EKUA 4AL7A 4ELTA 3PO5A 5HRSA 2K8GA 4Z4HA 4Q45A 4ILLA 3DYAB 4CLWA 4Y65A 2NUUG 2HVHA 5D0EA 2W01A 4YR0A 3BBCA 1KD1T 1I6JA 3WXMB 2F5GA 2YHXA 4YY3F 3TAEA 3G82B 3DRXA 1QLNA 4EP4A 4DV4J 1EIYB 4PUOA 2P9CA 2W7AA 3BYRA 3UO0A 2B3TB 3I32A 4MDAA 1MWZA 3O3LA 3E51A 4DPUA 4IR9A 1SQKA 1HYZA 3ULEA 1RBAA 2VZ9A 1GX5A 3G8QA 3M2UB 4IYQA 4MK9A 3FZKA 4Y1DA 3RAQA 3I0RB 3H1QA 3KWGA 3KNAA 1G1XA 1WF0A 4BRLA 1YLXA 1W2BM 4FF4A 1VSHA 3MAQA 1OPZA 1VSJA 4KH6A 4A8SA 2I5JB 1J5OB 2EK1A 2RHQB 1KQFB 1MU2A 2YQ3A 2YHWA 3NMAA 4M7YA 3VOVA 1GOAA 1R8AA 2ZZMA 2GW8A 2E20A 1KS2A 4ILRA 4DV4K 3CC7N 4F7VA 4NCBA 4PAAA 2AJQA 3Q7BA 1OQ6A 3M1VB 4UUXA 2HNZA 3L6QA 3R6MA 2CPEA 3EZ5A 3VAIA 4DU7A 4KPCA 4ZP6A 3WC0A 1RWMB 2BX6A 4USVA 1U25A 2BDPA 1N33K 1Q8IA 4RUBA 4MKYA 1RDBA 2IRUA 2MKIA 4FL9A 2QL5B 4DV2J 1XR6A 4QOTA 4YOUA 1YBAA 1JLBA 3AY0A 4P7VA 3TTDA 4YHHK 1H74A 3OTDA 4DSEA 1N6QB 2DO0A 2E1CA 2X74A 3ULDA 3P6YC 2F7VA 4DL2A 5C24B 4CK3A 3I8BA 2YWWA 2Z1JA 4LF4F 3US5A 3VGLA 1IBLJ 1OQ3A 3EE8A 4H5NA 3QMLA 4IO9Q 3LAKA 2R2SA 4L3KA 3U02A 3J7Z5 1UJ4A 5E84A 3HULA 2LEPA 4H4KC 2IA6A 4PXCA 4DPXA 3DRRB 3MMJA 1Q82T 1X9WA 2IRXA 1GXUA 3HP6A 2NLXA 4DV3K 4OPAA 2DPJA 2G4BA 3OYLA 1H6KX 4AXIA 2XHCA 1HBNB 1KD1O 2LKZA 2OTLN 4NI2B 4IFVB 2R7WA 1F3VA 2WOMB 2HFOA 5KG3A 1ZA2B 5MAOA 2XY5A 2FBVA 1IKXA 2ZH2A 1OVYA 2Q79A 2GVDB 5CHIA 4HYKA 4CFDA 2EW9A 3LGNA 2X6SA 5BPNA 1E6YB 4Q2MA 5DGBA 1ZM9A 3VR1A 1XK8A 3QT7A 2PYJA 2MJNA 4WXWA 1HRHA 2XZDB 2Y0SD 2DGWA 4Q5VA 3J7AP 2HNYB 5J1EB 2CPXA 3KLGA 3TX0A 2E5LK 2XWXA 1B9DA 2VBZA 1HQUB 4DCHA 3MM7A 2E88A 3E9PA 3B6OA 1M1GA 4JI7F 4QIGA 2FJBB 3PFEA 3CCQS 5BRHA 1B0PA 1V3ZA 2LMIA 2A2CA 4OX8A 2LA6A 4DTXA 4WXOA 1U09A 1GXTA 3AQPA 1YJTA 2NS1B 4NA1A 3ICLA 4JKBA 5A2QY 4O23A 1NJWA 4OYXA 4MAKA 2V94A 3W64A 1RHUB 1B7FA 5A8WB 4X65K 1S5JA 3OFGA 3JXOA 2MXYA 1HFEL 3PIOQ 3M8RA 2CQBA 2CVEA 5FJ4A 4JI4J 3X3UA 3HHNB 3I6PA 1VQKS 2OTJS 4B9LA 4OV6A 2JVRA 4WYLA 3J81Y 2AU0A 5KG7A 4ZIVA 2ZHOA 3P5TL 1AUDA 4WBFA 1B3TA 3TUZC 2VWJA 3IAM9 2P9LB 4E3SA 1FW6A 3GG0A 4JI4K 3AJ2A 1TFWA 2KJWA 3BP8A 1CPZA 1TFYA 2GZOA 2XRIA 5HVFA 2EK6A 3FUYA 3CM6A 3SJHA 2M2BA 3M8SA 3CMAS 3G6XA 3V9ZA 3EZWA 3UKRB 4FP9A 4F8RA 3HTVA 2AWZA 1FRHA 3PIPQ 3MEDB 3TSPA 1DY3A 3O3HA 1F0XA 2DHXA 3PDNA 2YPYA 4MH8A 3TEHB 4JNEA 1N34F 4KTQA 3HT0A 5AZIA 1WKKA 3HSCA 1FKOB 2D9OA 3R5DA 2PEHA 2P9UA 2CQ3A 1XNRF 4F4XA 1S1WA 4OPHA 3HVAA 4A4JA 1Y5LB 4HDHA 4CP5A 2G8HA 4FZXC 1RZMA 4GV6A 1T3OA 1B99A 4NLGA 3G9CA 1FNMA 3BO2A 5ADXH 1BU6O 3AARA 2VQFJ 2PI5A 3VEZA 4WIQA 3UFCX 1XMQJ 4RUAA 3NGRA 3DDNA 3E2EA 2BOPA 1Q8KA 3Q8PB 2NRHA 3A5MC 2HG4A 4I64A 2PC6A 4CEOA 1WN7A 3VTHA 1DTTA 5K8OA 1WC5A 4RWTA 2E2QA 3MCAB 4GO7X 2AIRB 4F4AA 4CFAA 4MK7A 1W0HA 2ZJPQ 3OUYB 3PIOL 5HJYA 4WU3A 2XBPA 3H2UB 4C0HA 2YKMA 4KI6A 2VV5A 4PEOA 4CLPA 3VQ8A 2CFXA 3VQ4A 2P51A 3MGJA 4BG9A 1JJ4A 2CQCA 3LP0B 1M1KT 3KHYA 3VEYA 3LALA 3L3VA 5U47A 3GIRA 2YPZA 4TYAA 4FYVB 5DDRC 4DUYK 1V3RA 3KK3A 1S1UA 4IOAQ 5L8RC 4BWJA 1NJIT 2I6WA 2D3O1 2UV8G 4A57A 1MMNA 3BPSP 4ATNA 2YWGA 4FNIA 1HKBA 1NKEA 1CJUB 2YHAA 4G6VB 5FD1A 2DGUA 4DN9A 4WFNQ 4ZLPA 2L08A 2BJ3A 1Y5NB 2ZUAA 1KLMA 4JI6J 4USHA 2HQIA 5ADZA 4C8LA 4IDKB 2D0CA 3ZCMA 1BUXA 2DITA 1S3XA 2JVOA 2GVZB 2VASA 4CLZA 2HWHA 4E1NA 2YNFA 4NLOA 3UE5A 4R79A 4WFBL 4K7QA 1VQOS 3IRXB 2GJ2A 2MKSA 2XZWA 4OYBA 3TR5A 1X4BA 5LY3A 3K9KA 4O44A 2GAGC 5AFUA 1KC8O 4H0PA 4FNHA 2LA4A 1EP4B 3KLHA 3GR1A 3OVBA 4QAGA 2VD3A 4JK9A 4J9UE 2QLJB 3ZSXA 4DU1A 1CZAN 5LJ3Y 3MOJB 4DI6A 1KRPA 2RNEA 3KXDA 2E1MC 3KJVB 5F0XA 1XMOK 2H5JB 4LBHA 2IS3A 1HBUB 1OH7A 3EDQB 3DC2A 2GIFA 4C3LA 4CHYA 4DZ6A 1P9QC 1Y9OA 4YEAA 3WUHA 3CGIA 3DOKB 4X64F 3DXKA 3DOMA 4CZJA 3OUYA 2DFHA 1PYTA 3KZBA 3Q22A 1IJFB 3A8JA 3OYNA 2EC0A 3IKMA 1U1OA 3DU5A 4ES3A 3QEWA 4J9VA 3ZZUA 4ZS6A 4GVLA 1EKSA 3DLEA 1B0TA 5GAHI 2LDIA 2FY8A 3MN7A 2GV9A 4CBWA 2FF6A 1M1HA 2RN2A 2E5JA 3U3YA 4H0YB 4UOGA 5BR8K 2XZTB 2ZHAA 1DQ9A 2PA3A 3LDSA 3NGKA 4QCLA 4CEEA 4JUZA 4L75A 4OYZA 3GPAA 4O0IA 4URQU 3NAHA 3HI0A 1HJOA 3BZCA 4RO0A 3KKRA 3SQ0A 4RPFA 4DSFA 4ID8A 2R8GA 3GR0A 2VBXA 3BBFA 1VQLS 4DFJA 4DV7J 1CZ9A 1WG4A 2FVSA 4QU6A 3L4QA 3OXGA 1ASVA 1U1KA 4BHQA 2FHJA 2VF3A 4Z0UA 1WHVA 2RE2A 4ECYA 3OXFA 5KFTA 4BRGA 3KMSA 3ENOA 1ZA1B 2KYZA 4USIA 3Q7CA 1R31A 2CPJA 1GTEA 5ETOA 4CO2A 2PGCA 3WXIA 3AFGA 1NGGA 3P39A 3HSZA 1FKOA 1BWVA 1FWLA 1UJ5A 2MZJA 3AB4B 4XTTA 3FFIA 2QMXA 4AXJA 2XMMA 3QRRA 3O5TB 2JSXA 5EY4A 1M1KO 3CC4S 4F02A 3H4DA 1IR1A 1ILYA 3RMDA 1N52B 4Z4FA 1HNWF 3W63A 1ZBFA 3WXKA 4FOEA 5AT1B 4RBTA 2UXBJ 5IV4A 3FZ2A 3H5YA 1BIZA 4GVEA 3HVRA 4RNNA 4FSVA 5KRSA 4CGGA 1S77D 5D78A 3ZZ0A 2XI2A 2MEWA 3E66A 5GIOA 1WC6A 4BQLA 1JL2A 4P52A 2IYIA 2G13A 3AXMA 4CM0A 4PWDA 4CZEA 1CJKA 4ECZA 4C8KA 2BQUA 1J53A 4LIRA 3U3GA 1N5SA 3V9WA 3S3OA 5IT9O 4PG8A 4PQAA 4M3YA 2KHOA 3RVCA 3P3DA 1NJIO 4WWSA 4CHNA 4PQUB 3M7VA 1LOUA 3IM8A 4KRWA 1HMVB 3H25A 3NGYA 2QMWA 3NP5A 4CZLA 5CYQB 4CHOA 3L0QA 2HRYA 2J9DA 1Q9YA 3NAEA 1VQ4N 5F9NA 4JI7K 4F25A 2O8CA 3NHGA 4A47A 1BG3A 1R8PA 1HJRA 2ZQBA 4B3TK 1O13A 1WDDA 3HHEA 5DG7A 3CCZA 3H42A 5J2MA 3FCHA 3W5YA 5AQMA 4E7JA 3VEVA 4LT6A 1VK8A 4ZHRB 2W8KA 3VGUA 3G86A 3QYYA 2E1RA 1H73A 2C2ZB 4W5RA 2VC1A 5FRNA 1IH7A 4DLEA 2ETJA 5HSPA 5GAHU 2EHGA 3T6BA 4DR5F 4CEBA 4B1XB 4K0KK 2KT2A 4RX6A 4DV1J 2UUCJ 1ATSA 2CG4A 3K5OA 5LJWA 4DR5J 1SKUB 4EBDA 1VQ6N 1M90T 4FXDA 1I3AA 4IOBA 2YKMB 4OX9F 3AGKA 4N5SA 1GT8A 3FEYB 1N32K 1DGKN 3I5AA 2OHDA 4FJ5A 4DV0K 1GLEG 2OEMA 3VF2A 4HT5A 1KWMA 2I0XA 3FMBA 1JJ2R 3V6DA 4CJSA 4Z4CA 1NKCA 4OVLA 2QKBA 4EEYA 1MLAA 4YR2A 4BACA 4M5HA 2FSNA 2NZTA 2LQ5A 1G4CA 4G1IA 4Z37A 3DCAA 4AQYJ 4NO7A 2ZH1A 2HHWA 1HPZA 4JKFA 3DDIA 2LQJA 2P9IB 3UVJB 2Z30B 2F63A 2KZMA 5ETTA 4ZVEA 1ICEB 3RB6A 1YITS 1NDLA 3G8TA 5BYSA 3DXBA 3SNNA 4YORA 4CJTA 3V1RA 2YX4A 4J2AA 3B6PA 4OLBA 1JLBB 3DGVA 3OVAA 2YNHB 1L5UA 5IQQA 2OH2A 4JI3J 2M4MA 2ZJRQ 3LQVA 2BE9B 1RCHA 3PRDA 1HNZK 5I3QA 1WG5A 3PLAA 3MAHA 1S9FA 4KHUA 3ISND 3DM2A 3K0SA 2VU5A 3RRHA 4DR1J 4FJLA 3TOQA 3D45A 3ZEUA 1NDPA 3AD8C 5A6PA 1NB7A 2IDEA 4LRFA 2R2TA 2VH7A 2D4WA 2CGLA 4CJQA 4RKUC 2VICA 2E1ZA 3IR5B 1MU2B 4DR1F 3OFHA 1B7YB 2ZOFA 4C8NA 3OYKA 1JKHA 2BANB 4Q0BA 4ZPWR 2Q36A 2O8DA 3TZWA 3A8YA 3NGZA 3LO3A 4DR3J 4OLPA 3QO9B 1H7XA 4KO0A 3BN4A 3IWLA 3ZX2A 4NWBA 1LWXA 1HNXJ 1RT3B 2XS7A 3BSCA 1UWBB 2HSTA 1HR0F 5DMRA 3KLVA 1MMDA 5DQHA 3IGNA 1SJFA 2NRTA 4I4BA 3MK6A 4BRHA 4X62F 4CEAA 4CEZA 4HUGA 3OFEA 4K59A 1RT5B 2BRLA 3MM9B 5B08A 1XMQK 2YNFB 3WQTA 4LF7J 3BM7A 4MO4A 1VJWA 2VFUA 2KVQE 1R8BA 4K4UA 2DR6A 1SL2A 4PKGA 4JN4A 3HVTB 3UR0A 2FY1A 1EWQA 2J7UA 5SUHA 2SXLA 4ZA1A 3IFRA 1NBWA 4LF6J 4JV5J 1YK9A 4K8RA 3AJ1A 3CF5L 1G99A 3RGIA 1XR7A 3JTPA 2CQPA 2PMHA 3MXJA 2Q0RA 2E44A 1UZHA 2F9JA 3JSMB 1GNKA 3N79A 4X4TA 3KLEA 2MTLA 3PYGA 2AP6A 4RBUA 2D1CA 1U48A 1VQ9S 1NNDA 1EETA 4W98A 3BQ2A 1XNQJ 1WSGA 4C1NI 4YHHJ 1NK6A 2XY8A 1REVB 2QGFB 1SKWA 3AVCA 3LUYA 1GQEA 2CZVC 2QE5A 2LU2A 3FRZA 3BUZB 8ATCB 4DX6A 2OLWA 1SS6A 3AGRA 2UVVA 2D1KA 4E89A 1HQEA 1S48A 2RKIB 1WHWA 1EKEA 4J9RA 1BCMA 2J9EA 4OGEA 9ATCB 2ZC3A 4BG8A 2AMCB 2PYLA 3PO4A 3D0IE 1YIJN 5HOOA 4TXSA 4DL6A 3CE8A 1JCFA 4QWCA 1HR0J 4OX9J 2C3PA 3IUCA 1X8DA 1XNQK 4GKKF 4KRFA 4GC7A 5FLXO 4A8QA 3IR7B 2ZKUA 3H5SA 4MKAA 1IKYA 2ASYA 1TP7A 1ITGA 2HNZB 2YI1A 2AEMA 2YKQA 4NZ6A 3D66A 1EQMA 1HQEB 1R0AB 3D3CJ 3RSEA 3UD3P 4B3SK 4LF6F 3TRGA 4IQXA 2XGQA 5G0RA 1RWXB 4ZPTR 4J9SA 1IBKK 2HBMA 2IDLA 2DGTA 1TK5A 1HNZF 2OPSA 4LVNP 2GWKA 2QMUB 4DUZK 1RE1B 2GUPA 1RHQB 3A4TA 1JLQB 3R9LA 2QTWA 1WBBA 1EHWA 1CS4A 3MM5A 2DBBA 4EYHB 5HBMA 2M3DA 2ZEJA 2P9KA 2L48A 3H20A 4KH1B 3M32B 2AF6A 3FSXA 4PUOB 1FDDA 4NA2A 2G2OA 1QAIA 4BC5A 3CXCM 4JI0F 3D6FB 4K4XA 4G65A 4H5TA 5EU7A 2BACA 4JRQA 3G4SS 2GUIA 4CIGA 4FDFA 3NGDA 2CVIA 5KRTA 2DY1A 5LM7E 1Z2LA 1NK0A 3J7YP 2Z2YB 5E3RA 3JAMU 3OBWA 3NNAA 4I6MB 2WW8A 3SUOA 3H0PA 1RBLA 2XS5A 1VQKN 4FXVA 2K06A 2MLZA 3SUNA 3OL6A 4B3OB 3AVJA 2E29A 3FBFA 4ZVPB 2E1AA 4ZVSB 2QL9B 4RUHA 3AVFA 2MQMA 3D6MB 3ATUA 3R1XA 2I1RA 2BJ8A 3S3NA 2WVFA 3UE2A 1TL7B 4NASA 3N5FA 5LL6Z 2HFNA 3VEWA 3EPGA 1TV6B 2MKJA 2BM1A 4QWEA 3DI6B 1P9YA 4B9VA 3QFPA 4RW7A 2YKNB 2FJWA 3PJ9A 2VDHA 2JWLA 2WTFA 2K1RB 2W7PA 1RT5A 3NF9A 4AHCA 4NLTA 2QLFB 4ED4A 4DV1K 1GMUA 3LP1B 3WNGA 4CHQA 3R7SB 4YY3K 1GOBA 3MEGB 3G2XA 1IKWA 3C95A 3C6UB 2AGPA 1R0CB 3PV8A 2Z2LA 5FLXY 3PJWA 1RBTA 2UXBK 1TVRA 4DR7J 3BJYA 1SJ3P 4PR6A 5AQFA 2MKHA 2IJNA 4Y2CA 2E5LJ 1HKCA 2NR0A 3BGRA 5E3CA 4FJNA 1SBRA 2I38A 3AA8A 2G8VA 2QT7A 1ZBTA 4CD1A 3DI6A 3NLCA 2V6AA 3MDFA 4I7FB 3QT8A 1KKHA 4H4MB 3PYFA 2W6KA 2RRBA 2OPQB 3CWJA 2W2NP 4P2FA 1RDUA 2HZVA 3G71N 1GEHA 1VQMS 2HQFA 4EIAA 3EGNA 3PG9A 5MLCQ 2XULA 4Z94A 4WF9Q 2VODA 4M5DB 5K9FA 3BGOP 2AHOB 3QICA 1S4FA 2XMWA 2W25A 2KXHA 1KP6A 3PYEA 4GKJK 2OPSB 5I4MA 1D3WA 1X5SA 5J2NA 4FYWB 5K14A 1YUWA 4M3WA 1FDAA 4FJ7A 3DDKA 3MR7A 5T7LA 1JWWA 1C6VA 2HBYB 1HNWK 1UAXA 3Q8SB 3G6EN 3QIPB 2DYAA 5K8PA 1NKBA 3M5RA 3MTJA 2P9KB 3ULHA 4BDYA 1X31C 2BMBA 1ZH5A 3ZSWA 1Q81T 4C0BA 2EC2A 3PHEA 1IBCB 2NPFA 5THWA 3CCUS 2EI5A 4B9QA 1PAUB 3R2CJ 4BRKA 3LP2B 4IG0B 2RQKA 3CIMA 5A0YA 1IBMK 4CBUA 4NXMK 2BTFA 2P9PB 4J9NA 3HT3A 2MDAA 3QFHA 3M05A 2YWFA 4JI5F 1SUQA 3CDAA 3QZ7A 2MYFA 2GTDA 3GCXP 1RBVA 4YB6A 4FBTA 5JMVA 4LD0A 1HWLA 4CT9A 3G6ES 4BRCA 4OYAA 5E26A 5BR8F 4LFBJ 4I7FA 5KFEA 1IKVB 5HROB 3VWSA 4PYAA 1Q5VA 4OO1J 1FVSA 3NVKA 3BEXA 2HKEA 1VSDA 1YJVA 4RW4A 4ECVA 3QBWA 4URSA 4BR0A 1HBOA 2CQHA 2YX6A 2JHEA 2Q3SA 1IR0A 1Z25A 2VG5A 1NXIA 1FD2A 4CLYA 3C46A 3MUTP 2UXCJ 1QZ6A 3I87A 3CD5A 3BN7A 4ALZA 2AA4A 3W8PA 1FO1A 2MGZB 1ZAXA 3CCMS 3MAAA 4EBEA 4X4RA 4ZN1A 4A8XA 1JLEA 5J2QA 3GZ7A 2I2YA 3SK3A 4BC4A 2Y9HA 4AHUA 2A41A 1QSLA 1BHLA 4J7CA 3ZSVA 2RDDA 5F41A 2HAIA 5FLXU 3IFEA 1NMNA 1JLAB 1FRXA 3CJAA 2IHR1 5KFVA 4J37A 2DHHA 4CLFA 2HHXA 4FBUA 3S9HA 1MW7A 3PM9A 4K4VA 1LKZA 5DLFA 3EZUA 4JS5A 3MOZA 4PQUA 3VQSA 2PZSA 4CIEA 1PC5A 2LQ8A 1VQNN 2WBRA 2OPPA 1R27B 1HUXA 4C0OC 1N5YB 4CTAB 4GVMA 3UIQA 3GIIA 1BMQB 4GNIA 4N8OA 2DEJA 5DETA 3AA4A 4ZMMA 1NH8A 2J8SA 3FMWA 4WQ4A 3C19A 3CIPA 1DTQB 2J76E 5IZHA 2P5GA 4XK8C 5CZ2A 2GWJA 5H1SV 3DU6A 4AYBD 1WNEA 3KHGA 2UUAJ 4A8KA 3CVKA 2Y0BB 2MB0B 1R59O 1MA9B 2ZZNA 3IO1A 2Q66A 1N36J 4FO0A 2FD2A 5KGWA 1URRA 2HHTA 4KPYA 4Z7CA 1JLQA 1UA1A 5AE2A 2DNQA 3CJCA 1HHTP 5C42B 2CPFA 3CXCR 5E2QA 3H59A 2AEFA 1SJ4P 2NZ4A 5AQVA 2WSFC 3CD0A 3D6TB 1JK9B 3NAIA 1TMJA 3H7HB 2VBYA 1RJJA 4CTAA 1CULA 4IO1A 3EE3A 2O8DB 1M5PC 2HHSA 4Q43A 1O51A 2JZ5A 3BZKA 2GA7A 4NI2A 2V0NA 4HHHA 1VBKA 4JV5F 1VQPS 3L95X 4KHRA 4ZP9A 4ECUA 4QWBA 3IBWA 2OEJA 1C0MA 1QQNA 4B9MA 1RTZA 3SCKE 3MECA 5HN0A 4CGDA 2AW0A 3ENQA 4LR9A 1CJUA 2EG1A 4TQSA 1KFDA 4PZVA 1CBKA 3NWRA 4DS5A 4F0HA 3G4SN 3AVKA 5FDLB 1NK8A 1EQYA 5L9NA 4I68A 3C15A 4OYMA 1VSLA 4KBIA 4CJ5A 1X4EA 2V9WA 2E9TA 2IFXA 2C3MA 3G82A 5DM7L 4CH0S 4W90B 2QWNA 4NLPA 4H4OA 3N4PA 3KHRA 2OCEA 1ZZFA 3MFIA 3KFWX 2ACMA 2GQQA 4A2BA 4ECQA 2QFIA 1CG2A 4DOZA 1U1NA 4Y1CA 3S6EA 5C2FA 2CJYB 1IQTA 4DU8A 3TP2A 3SCIE 4BE0A 3MD1A 4MIAA 4A48A 3UKUA 3ZSRA 4OI6A 3U7JA 2FZGB 3AA2A 5HQMA 2FLOA 4BR4A 3H40A 3OR1B 2HHHF 1VJQA 3QFWA 3M1FA 2HGLA 1D0EA 4USJC 3H45C 3ILIA 3NKYA 4DTJA 1H0HB 3DOKA 4ZCIA 4IFEA 5AQGA 1BQMB 2LSNA 4P72A 4KSEB 4NYZA 1VK3A 2CNLB 2E2NA 1C4AA 2CWXA 2XB2D 3EX7B 2VFVA 2HHUA 4W92B 3KOAA 4B3RK 3OQ2A 1N34K 4JKCA 1K47A 3HVTA 3MXHP 2DNPA 2ZJPL 2X3GA 1EAYC 3O1LA 3SEOA 4FJHA 1EP4A 3DGPB 3ZNJ1 4WJBA 3L7OA 1B92A 5B0AA 3MCMA 1Y64A 3O8WA 3B4MA 1S9EB 3K0JA 3ZT0A 4F2RA 1TV6A 3SBGA 1LWFB 4O3RA 1T05B 2R7SA 4WFYA 3CJ8A 3D4JA 3QGHA 1RWPB 4M3ZA 1FXRA 1S6PB 4DL3A 5LJVA 2LXUA 2G0IA 3FBEA 2VOPA 2RIJA 3ZXWA 1XMOF 2Y3YA 1RT6B 2EFQA 4JBCA 2OD6A 5EWGA 2IM3A 3JXUA 5IWAJ 5H9EK 3NF7A 5MLCV 2IVYA 1JJCB 2KFYA 4U7UD 1YTAA 4FWQA 4ZCLA 2XSJB 1DHMA 4QW9A 3AO5A 3MI7X 4ED1A 5HLFB 3CEDA 3QLHA 3GV8B 3IMXA 1S1UB 2WFBA 4KAZA 1GH8A 4CJWA 3W9HA 1S0NA 3ZC4A 1KXPA 3UDLA 4RWWA 2JDJA 3K7RA 2F7TA 1JNRB 3VQAA 1RDCA 2ZKTA 5ITHA 1T05A 1R43A 1SKSA 2Z57B 5GAGP 2OI2A 2COLA 2H3EB 5AQNA 3PX0A 2DRDA 5KQ8A 3LOUA 2BGGA 4LFCF 3HPHA 1CC7A 1OJ4A 1MROA 5ETNA 3R7NB 1BO5O 1HI0P 4KHQA 2HBZB 2G0JA 1E4GT 2DR9A 3N4WA 4TN2A 1URNA 4YNQA 1RWOB 1S6QA 2HMPA 1YJ7A 1VR6A 2ZOGA 1OH5A 3M6XA 4BS2A 2MY8A 4QIFA 3H90A 4J91A 3G25A 3SBTA 3NF8A 4E1MA 1D9DA 3D1HA 2EBGA 4MLHA 4QJVA 3W2VB 1HPZB 3T41A 3FJ2A 1WSEA 2P9GA 1TQLA 2HFSA 3VAFA 2VONA 3AO3A 2L41A 5C10A 2R8HA 2Q43A 3QB0A 1YSJA 2GIRA 3FLCO 2QM1A 1U6FA 2CZ9A 3L2VA 3DFEA 3M8YA 1TL4A 1YJNN 4XIUA 2Z1GA 1RLDA 3AA3A 3FSYA 4GKJJ 1CC8A 3EEQA 4KT0C 5JVGQ 1D9AA 2P9PA 2KVIA 1X5TA 3L7UA 3PW7A 1NK5A 2J7WA 2POKA 1NWKA 5L1LA 1IWGA 2V8DA 2XHWA 3OTBA 4E7HA 5HMYA 4IUFA 1C0UA 3RW7A 3HLUA 3F56A 3FGUA 2ZJQQ 2RAQA 1PAEX 3KYLA 3BDEA 4LF4J 4I1TA 4CFCA 4U95A 5E5NA 2VG7B 4TLRA 1FHTA 5HL7L 3TAQA 1WSFA 4PA1A 2HGMA 1U02A 2C42A 3CFPA 1Z26A 4ISFA 2MZRA 1VI7A 3A2FA 3TUPA 3D28A 3NE6A 4G9ZA 2MZTA 5A6WA 5FIIA 3FCVA 1D4XA 4HHJA 3DLHA 4CJPA 4CJ7A 5B0CA 3SFUA 4B02A 2CG8A 4WIIA 3WDOA 4LF5J 1PYSB 3HHLC 2VIHA 1HPMA 4HUEA 4CZMA 2A2DA 1LW2A 4JI2F 4K4ZA 3EICA 4CK1A 4KV8A 2M70A 4JAXA 2XQCA 3R1LA 2ALZA 4FPIA 4RNFA 3PR4A 2Z1IA 4CDIA 3OS1A 3SI8A 3LPTA 2HK2A 1Z2ZA 2R7QA 3O3FA 3LL3A 5F8JA 5AZJA 3LDOA 2B9YA 3B82A 1TL3A 4DMZA 3CCTA 1F3FA 1O8BA 4XAKA 5F0WA 3SQGA 2VL1A 2IIRA 4DX8H 4ILMA 1E6YA 4M63A 1H2TZ 1TKXB 3QATA 2FTRA 5IT0A 1GLDG 1GOCA 3ENAA 4B9TA 2RSQA 5HL7Q 2NRXA 1MMLA 1DURA 4PPDA 4W5TA 2QJ3A 2G1HA 1QM9A 3SMSA 1IBLF 2M0GB 2GQCA 3EPIA 3RBDA 4HH1A 2DH7A 4ID5A 1IBKJ 2VG5B 4X66J 4JI5K 1YBUA 3OPKA 2KH9A 1W9HA 1Q9XA 3DNCA 5EUHA 3UQSA 5JJBA 3AOCA 3RMBA 1QVFR 4EHUA 4LVOP 5HO4A 2NRZA 1V4SA 3D2FA 2E66A 4KH0B 1IM6A 3J8AA 5HK4A 5KFWA 4JEPA 3OL9A 3BH7B 9RUBA 3TA1A 3U8XA 3VA0A 2C3YA 3F9KA 4DCPB 2DGVA 3CJ1A 4DL4A 4JKEA 1CQMA 2JWNA 5LMUJ 4LF9F 1LFWA 4Y0WA 1HLUA 4FWSA 2I5JA 2F65A 2Z4PA 2B5JA 1K8KA 3TAGA 3O4NA 1R8HA 2VPZB 3C15B 3I31A 5JVHL 1M0SA 3VQPA 4F9OA 2XLKA 3T1AA 1YIJS 5EWFA 1G7CB 1SZ2A 3OW2R 1N33J 4OL8A 1DARA 3OS2A 2YXLA 2P9NB 4QWDA 2N7YA 2Q0UA 1NGCA 2XC9A 1VQPN 4HHTA 4H0TB 2MHNA 2YX1A 3R7BB 1JKHB 1YDLA 2ZBIA 5IC6B 5LXYA 4DSKA 1BUPA 2Q31A 1KVJA 5I3UA 1Y4ZB 2K7KA 4F36A 1TUVA 2B43A 1N0VC 2P9EA 4PABA 4XEIA 4GMKA 5AQLA 1ZPWX 2FB0A 4O44B 1K1QA 5AQTA 1OKJA 5IWAF 3W2VA 2HOEA 1UPMB 2XLJA 1M5HA 2RU3A 3V4IA 3MR3A 2DHAA 1GXLA 3B4DA 4FJMA 3MZIA 4LC9B 3TW0A 4DHYA 3UN3A 1RSCA 1VQ4S 2D0AA 1RCOB 1WELA 4NRTA 5A2QU 1FK9B 3AV9A 4GMJB 4BQZA 4XH1A 1FDNA 1HNXF 3PW0A 2QIFA 3LPEA 1RT7A 5KFPA 2DXDA 4CVNE 1IR2A 4IQMA 2XYPB 2DO4A 2ASDA 4QYRA 3SMZA 4ELUA 2EG2A 3GFXA 2ROGA 2GBZA 2FBYA 3D5MA 5H9EJ 5IWAK 1NEEA 2W9AA 2XYGB 1OY9A 3MN5A 4FW2A 3CMAN 1TUUA 1WTFA 4NXMF 2RS8A 4ZLLA 4FVUA 3A5NC 3CO0P 4GV3A 2ASOA 1J6ZA 4E1JA 3R8YA 3T1YF 2RDIA 3OVNA 3R5JB 4MIBA 2RF2A 5AQRA 3EMTA 5A76A 1DT9A 4MQ3A 1RQ0A 1VCTA 3D1QA 3PIPL 4KTWA 3KLFB 3KG1A 4I2PA 3V6JA 4LQ3A 1TKZB 4ZDNA 2R42A 3N6NA 3MUMP 2E2PA 3CIZA 2DNZA 3MAAB 1N33F 4U67Q 5DDQC 2XG8A 2R7YA 1XNRK 1Q86O 5JVGL 3K8VA 5LXRA 4B3SF 3V4MA 4OHVA 2YNGA 4WFBQ 3RZAA 4XPEA 2CNKB 1VIOA 4WQ4C 4CLLA 2MKKA 2HNYA 2DGSA 3T6JA 3PUFA 1BI4B 4X4SA 2GO9A 3EL2A 3ZT1A 2O8FB 3NGTA 4IG3A 1D5AA 2RRNA 1CXQA 2AQ4A 1FRLA 4OHYA 1F5CA 4C11B 1T44A 2DH9A 1T9UA 2Q3PA 4DDFA 1RWUA 3M4XA 3HK2A 2G2ZA 2BANA 3LM9A 3QEPA 1S10A 1HX1A 2H51B 3M6UA 5CYQA 2F4VJ 2DKOB 1R6YA 5KOWA 1U1LA 1TZ0A 4CIFA 4AM6A 3C66A 2C2MB 1IKXB 4JKAA 2ZOMA 2HIYA 4ECRA 1ELOA 1UOCA 4QIWD 3BYPA 4CYUB 1TL1B 4MT1A 2W1BA 4KC5A 1WC0A 2VA3A 4NXNK 3TJ9A 3OS0A 2QXFA 5AQWA 2V2ZA 1FNXH 2YKOA 3ID8A 3IWXA 4LF9K 1F2HA 1SC3B 4V19X 3GL1A 4BR5A 5FDLA 1PSDA 3O9SA 2P9LA 2V8HA 3MM6A 5JUMA 3MN6A 4ZKAA 4LFAF 2O01C 2PD1A 4AQYK 1Y3KA 4JI1K 2RMLA 4KFBA 5KFHA 2CADA 4O3QA 2E9RX 2E1YA 4CESA 4C8OA 4WTYA 4X4OA 4IR1A 4KY3A 4IOXA 2FSKA 4K0KJ 1SIWB 2KHCA 3WZ0A 1YJ9S 2R3VA 3G6VA 2BOAA 4A62A 5HLFA 4X62K 4A2AA 4IO9L 1QQMA 3SQ1A 2D0OA 4CJUA 5CYMB 1NAQA 2DRBA 2G8UA 3VEXA 3TWHA 3LF0A 2PMZD 4AHSA 1QVGM 4ED0A 1MG7A 2V63A 1WSJA 3CETA 1RWKB 3MD3A 2R8KA 3H5XA 1XEZA 1DQAA 2FVQA 2FPHX 2R7UA 3C0BA 3OD2A 4CBXA 2FLPA 3TI0A 4N77A 4YP3A 1RAEB 3AXKA 4DUTA 5L1IA 3OJUA 2MJUA 3VAJA 4DWIA 4NLCA 3I0SB 3OL7A 2ADBA 1K0TA 3VZIA 5FPNA 3Q8QB 1GLBG 4MO5A 2P1JA 4NB4A 4ZVHA 4D3GA 3A5LC 1X4DA 4QR0A 2E5HA 1KN6A 2O66A 3NS7B 2FC9A 1KVIA 4X4NA 2ATQA 3Q24A 3PSIA 1T03A 2CPZA 2NREA 4M5KA 4K43A 1RTIA 1P6TA 4DV5J 1ZBHA 1HW9A 4N41A 1H2UX 3DXSX 1SL1A 2O8EB 4FJGA 3CTRA 2RQMA 4DV0F 1EO1A 1QD1A 4I2QB 2YKPA 2QWRA 3CQ8A 3G8SA 1NSQA 1P27B 1TMMA 1WC4A 5F2RA 4IKFA 5LMUF 1YAGA 4MLEA 3VPZA 4D3HA 3FK4A 3W7BA 4K5RA 3NDKA 3O1WA 3CDWA 2UUBF 3MM9A 4O5BA 2PN6A 1TKZA 2OD4A 5D77A 2WAQD 1W7AA 3UDVA 5KT2A 3VESA 1RAFB 2CPIA 3J80U 1K8AT 3ALYA 3HBTA 1RA7A 4PG5A 3MCOA 3D1OA 3VGVA 1S1VB 1UEUA 3DHWC 3M9OB 3UKUB 5A8RB 3ZZPA 1RTIB 5ETMA 2GHWA 2MY7A 1T03B 4G1QB 4DV4F 1Z6RA 3MFHA 1PGZA 2UUBJ 3GDQA 3MPVA 5DRKA 1VC0A 2F9WA 2NNWA 3CJBA 3M8PB 4ANEA 3GV5B 3OYAA 1ZTTA 3WC2A 1QUVA 4BC2A 1KNZA 1REGX 1R3NA 4NXNF 1QQOA 1S1XA 1CXUA 3KJNB 3GJTB 5BYRA 2LQ9A 4P2SA 4Q44A 3BF3A 1VSFA 3I82A 2UXDF 3HPOA 2QN6B 2F96A 1NZ8A 2RILA 2QSFA 3OHRA 2QC3A 3RSEB 1VQ9N 2DB1A 4EFAC 3T1YK 2HWIA 2PA8D 2HFZA 3AODA 1YI2S 3I0RA 2CA9A 2BE2B 2OPRB 1A5VA 4C23A 4UQGA 2OGUA 5C25B 1KDNA 3SSRA 3V4IB 4L6V3 1SJ1A 3GV7B 2YHYA 1NGIA 2YJFA 1U0SA 3IC1A 1TYQA 4YUDA 3GIMA 3GFYA 2J9CA 1IQZA 4CLSA 3CC7S 1A5XA 5KFQA 3Q8YA 2LDYA 4NLWA 3NGSA 4KTZA 5AZIB 5BRFA 3B6BA 4OPKA 4B3TJ 1NPPA 2Y8WA 1VAZA 2ZJRL 3C16A 2DNRA 1HR0K 4ED5A 3CJ2A 4ECWA 1KR4A 6FDRA 4JV2A 3TTCA 2O8BB 1QAYA 3R2DJ 4WP8A 1KEKA 1SKRA 1NH7A 3M8QB 2IA0A 1J5EJ 2DXEA 3PX6A 1RT4A 2DNGA 2RKIA 3QGPA 4TKTA 2HBKA 3B78A 3ET6B 1Q53A 1I3OB 4AT1B 4CE9A 3T5KA 1FX4A 1T0TV 2QA2A 2QXLA 1NPRA 2J8AA 3RWUA 1DKGD 2DGXA 3K5NA 3GTYX 3BGUA 4B3TF 1I51B 5T7LB 2R7TA 5GAEP 1T95A 2G8KA 2P9IA 4KHWA 4HEA9 2EWSA 4LBPA 1UVKA 3HPGA 2B4PA 4E98A 1L3VA 1S79A 3CC2N 5GADU 3IMQJ 3JYTA 2ZH6A 3Q89A 3ID6A 4OYWA 4ZP8A 3IA0A 3KHLA 2DTJA 1NLKL 3H5UA 4IRKA 4HL9A 5I9EB 2RS2A 2V8PA 4JHDB 4I6AA 1Y10A 4Y34A 3BSOA 4O3NA 2CZ4A 4JV5K 3C6UA 2G1DA 5GAEU 1X4AA 3O1BA 4AHRA 3LH2S 3WIVA 3IS9B 4ZVTB 4CZCA 5L1JA 1RADB 2C1EB 3DGPA 4NXNJ 3FC9A 3OYIA 1XQSC 4LSZB 3OYGA 4WP3A 1HBMA 4CZHA 2UP1A 1QAXA 2PFFB 3TTFA 4JB8B 3DWLA 2R8IA 3VAMA 2ITGA 1KQSM 1PCAA 2JC0A 3THWB 2BXJA 2E2OA 3DLBA 1PIEA 2ABYA 1JB0C 3MEEB 1VQ8S 2ZBRA 3F5TA 3W3DA 4QR2A 3GSIA 2M88A 4B3MK 1BE4A 4C2MA 4DPTA 1U2FA 1EXQA 3KLHB 4NPOA 3LGHA 3RMCA 4BE2A 4BC7A 2RDJA 1NMDA 4DTMA 4Y28C 4DV3F 3TU5A 8RUCA 2HF3A 2XHBA 1TL7A 1Q18A 3HM8A 2V68A 5A2QO 2GCFA 4BC9A 3K9JA 5KGXA 3T1HJ 2NXEA 5HANA 2J0QD 2IAJB 2B8PA 4UZCA 1G2EA 5KG6A 2V8GA 2APOA 3VGKA 4DR7K 2C2RA 4KHPK 3RB3A 3CCVN 1TK8A 1DZ5A 4TLQA 1ZTWA 3DHXA 3J81O 2FXUA 1TUYA 1JNZB 5G0RB 4LR8A 2YNHA 2PFDA 1U26A 1LV5A 2KFNA 2M5YA 4XH5A 2HFVA 3HD1A 3ZT3A 1NPKA 2DT9A 1F21A 2RRAA 1AZSA 1UFWA 3T9ZA 4I67A 3GU0A 4WFAQ 1XNRJ 4JI8F 3NWGA 4KGVB 1S72N 2JEGA 3W2WB 4CZFA 2BE2A 2R7OA 3QEVA 1QJHA 1S22A 3AAQA 3I9ZA 5H9FJ 2LECA 2HVZA 1FTRA 2MLXA 3QRQA 2DCLA 3T19A 1N5TA 4K4WA 4LF1A 4Y2MA 1Q8LA 4DR4F 4HVZA 4K4TA 4DV5F 2W2QP 3J80O 3K57A 1S76D 3NMRA 3HKWA 3M30B 3UPFA 1SI9A 1VHXA 5JLHA 3DRRA 1R0BG 7FDRA 4CJVA 1SH3A 3IN5A 2O4GA 2HHQA 3UDCA 4EGLA 2GJFA 2WRMA 1YX2A 4ES2A 2AYMA 1F60B 3UCZP 2D3OR 3A5OC 3ULEB 2QLBB 3RRGA 5J1NA 3MCNA 2ZH9A 4YOVA 1UA0A 2DNMA 4MKBA 2XGPA 4C97A 4WCEQ 1NM1A 3NCIA 2CQ2A 1JL1A 2FGOA 5C5JA 3M8WA 3W2WA 1BI4A 1SV5B 1XHXA 4KHYA 3L7PA 2ZDPA 3SV3A 4BROA 4USWA 1X9JA 4PG4A 4O8KA 2DPIA 2Q97A 2VQEK 7AT1B 3OY9A 3M8PA 1RUSA 1WOQA 1ASWA 3BGFA 1N32F 1VRUB 1UETA 3H4BA 3UDEA 1FVQA 2ILZA 2W2OP 2OJ3A 2O1PA 2VJVA 1IO2A 4NZ7A 4DQIA 2AX1A 1U7LA 3DN9A 4BRFA 1FERA 4LIWA 5DS7A 3AH6A 1HWUA 3TARA 3FEXB 4F4ZA 4DS4A 4R25A 1LNQA 3VA3A 3KUEA 5F8LA 4JI7J 2BJ9A 2NUHA 1BDGA 5KT6A 3WEEB 2XMJA 2OSRA 4CJ3A 4HTUA 3EO3A 3QLHB 4DU4A 1IG9A 4H4MA 2CQGA 2VQEF 3W0LA 2YHBA 5FPEA 3WBZA 2I8EA 4I2PB 2AGQA 3SDEB 1F9FA 2HF4A 3KK1A 2OFHX 4P2XA 3MMCA 1N54B 2LCWA 3BPDA 8AT1B 3KD5E 4KYZA 5TKYA 4KKOB 3NRBA 1HNVB 1KVBA 5E33A 4W5QA 1T9YA 1RT3A 1HQ2A 1Q5YA 1MWMA 5CXTA 1JIHA 3UNGC 2CPHA 2QA1A 5A8WA 2HS3A 2A5XA 2FHOB 2UZAA 2P9SB 4P73A 3VF6A 5KFLA 1CVJA 3BBBA 4BR7A 1IKVA 1VQNS 4FM1A 1T9TA 2VB6A 2UUWA 4NCGA 3SCJE 3RRKA 2FUG9 2QEXN 3CMEN 4DV3J 4F50A 4U7BA 4B1YB 1J5EK 4UY8O 1FK9A 3QEXA 3HKZD 2WBMA 1SPBP 1Y0HA 3OW2M 4KFBB 3QT5A 1GFWB 3QDKA 3PRVA 1LWCB 1ZBIA 4CJRA 3QBCA 4OHZA 4BRAA 3O3GA 2FLNA 2LQBA 2GMLA 4IWVA 2HAFA 2QG9B 1WEXA 3DOLA 3LDPA 4JI2J 3WQUA 1HWJA 4CO3A 3A12A 2NXJA 4NMLA 2W40A 4IH6A 2LP4A 1HKGA 1ZAWA 3EJMA 3CMES 3DRYA 1LOTB 3MUVP 3F41A 2AYEA 5D4NA 4ZPDA 2ACYA 2F8TA 3AOBA 2J0SD 4BRDA 2P9NA 4FWPA 3O9TA 2GIQA 3EXCX 4WKYA 3MM6B 3DLLL 2W9CA 4P6QA 3N4QA 4FVMA 4A8MP 1RCXB 1WHYA 2YWKA 2IIHA 5AQOA 2CQ4A 3KJQB 3ILOA 2FDNA 3M30A 3C16B 2HGNA 2D0PA 1UKUA 1WOOA 1RK8A 4OJHA 4E19A 4OLOA 2ATLA 2BBEA 4LF7K 2FQQB 1FNOA 3THVA 3TJ8A 3KUGA 1F5BA 4NYFA 2GS8A 4F3TA 4IG3B 2KM8C 3TAMA 2A1RA 3QSYB 5L9XA 3SCXA 4XDCA 2JEJA 5D4PA 3N28A 1Z05A 1WEZA 2BJEA 3TQ1A 4DSIA 2PBDA 3L4IA 2VFRA 5F3TA 4DV2K 2PT0A 2L9NA 4TVAB 5SWMA 3E01A 2O8EA 2W2MP 4HI2A 2JEFA 3THXB 1ULRA 2K2PA 3JQMA 3SPZA 3V6KA 3S3MA 4V19J 2D9PA 3PW2A 2BJ7A 3FSIA 1JCEA 3R6LB 2I9SA 4PG6A 3IRXA 4DR6F 1VLOA 2IVOA 2Q2RA 4WFZA 2BEFA 3ADAC 1LW2B 4YQWA 5KT4A 1HI8A 3MMBA 2F8SA 1W26A 1H1VA 4USKA 4XH4A 1OIAA 3TNVA 2RT3A 3MM8A 4F3QA 2F4VK 3HL8A 1UWBA 3SPYA 1S0MA 4E7LA 4OLAA 2KI2A 2QA4G 4PXDA 4F26A 3NOCA 5D15A 1U1QA 3I4PA 2P5VA 4R8UA 3ASMA 2Y1JA 1M5VC 2B4JA 1RT1A 3GE9A 2MQOA 3RAMA 3E9LA 2AD9A 3GQCA 2Q6BA 4IOCQ 1K73T 4KAIA 3K58A 1B4SA 3I55N 3CG7A 2U1AA 3QJPA 1RXOB 1XWLA 3O4QA 3ILJA 3MEGA 5HRNA 1NMEB 2W2PP 4A8WA 3PRBA 4FJKA 4K50A 2XY6A 1KVKA 1LK5A 1NGJA 1WORA 4CHZA 2B9XA 2WC9A 4J9OA 4JKDA 2AEJA 3TO8A 5ETQA 3ZZRA 3MMVA 3MEEA 1RISA 1HNXK 1YJWN 4NLSA 1RKJA 1VQ8N 2QWOA 3LP0A 3LPYA 3U9ZA 3EE9A 3CD6N 3OYHA 4RJVA 3W61A 2QLXA 2JOQA 2GELA 5F9LA 4FPRA 1AT1B 5EX3A 2KTQA 1OYEA 1U6BA 2QYGA 2B51A 5D4OA 4Q8EA 3IG1A 1Q1KA 5EGYA 2FJVA 2CJQA 3QWPA 1A9NB 4PYDA 2VFSA 4FYXB 3TVZA 2UUCK 5I3PA 1EWRA 2D74B 1FJEB 2E8AA 4KB0A 4O55A 5M1NA 2DH8A 3VGTA 4ZITA 2HRUA 2M9KA 2KXNB 4UY8T 2YY3A 1IG8A 2BA9A 5CCLA 2AKWB 1QVFM 3CCVS 3GOIA 1YJWS 2ZWOA 1OSDA 4FJ8A 3V81B 5KFRA 1VRTB 3CCSN 1Q79A 4OI3A 3OYFA 3WX4A 4RW8A 1OO0B 1J54A 4JD2B 3CPWM 2KQ2A 1VGYA 2F1FA 4USUA 3SCLE 3J7YI 2HQDA 4PCQA 1RAHB 2V8VA 1UP1A 3MPWA 1AZSB 2YNGB 1G6BA 3H1VX 1S6QB 3SQ2A 3H8YA 3PR5B 5T14A