2VG6A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
550
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 131
structure length 548
sequence length 550
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg6A05
3QEIA 5J2PA 5K14B 2XCPA 3KK1B 3JSMB 3HVWA 1U04A 4I2QB 1REVB 4K8XA 4B9UA 1LWCA 4U7CA 2R8HA 4DTMA 2JEIA 1O1WA 3AV9A 4Z4HA 3LP0A 3U3YA 3BSOA 3D45A 2FVSA 1VK0A 5J2NB 1IKXB 2JEJA 4DTPA 5KG1A 3QERA 4DL6A 2BQRA 3OL7A 5F9LA 4FLWA 1WNSA 4TYAA 3PO5A 4MIAA 4JRQA 1NK0A 1LWFB 4DG1A 2GIQA 3CJ4A 2DY4A 4HUEA 4FLVA 4ECUA 4O4GA 1W0HA 1X9MA 2IGIA 1D5AA 3V81B 2W9AA 3Q8QB 2Q3SA 4QW9A 4O44A 3V9WA 2WB4A 2YNIB 1BI4B 4DTXA 3V4IB 3H4BA 3B6PA 4CHZA 1BIZA 4CGGA 2C2DA 3V9ZA 3TI0A 5KFFA 5DLGA 5D3GA 1JLQB 1JXBA 1VSJA 2GBZA 5KFZA 4O5BA 2DPIA 3ITHA 1FK9B 4YQWA 4HUGA 4ZP7A 3PVXA 1WSFA 3UPFA 1IKYA 1GOCA 4C8LA 3RBDA 3CDWA 2J6UA 4ZVEA 1QSLA 1Q9YA 3ZSVA 2R8IA 4LSLB 1KTQA 2Z1HA 3KLHB 1KHVA 1RTIA 1W9HA 4OPKA 3M8PA 1CZBA 5CZ2A 1Y97A 4OVLA 3G0ZA 3HPHA 1BQMA 2VWKA 1TP7A 4RW7B 1QHTA 4QCLA 4O3QA 1JXLA 1S1TB 2F8EX 1WSIA 2YV0X 2RF2A 1U09A 5KFYA 1ITGA 4LSNA 4IFVB 4H8KA 1ASUA 4NYZA 2OPQB 3K5LA 3EZ5A 4Q43A 1C1BB 1GX5A 3VQ9A 3H5XA 4NRTA 3ZT0A 1ZBLA 1TV6B 3DRRA 3NF9A 1BL3A 4M45A 5KRSA 4ID1A 2IC3B 5FRNA 1CSJA 4TSXA 3IGNA 1JL1A 4IDKA 5KG0A 5JS2A 5KFRA 4MK9A 4NYNA 5I3UA 1S9EB 4E0DA 1SL0A 3FRZA 4ZVGA 4B3OA 3PZPA 2G8VA 1RT7A 5J2MA 1HYVA 1S6QB 4Q8EA 1JX4A 1C0TA 2UVVA 3NDKA 5KFDA 4RW4A 4WFZA 3LWLA 4B8CA 1HMVB 5C24B 4PQUA 2YNGA 1A5VA 1L3TA 3MTKA 4IR1A 3C6UB 4URGA 3HPGA 4FJXA 3PR4A 1KLMA 2E9RX 4U6PA 3DM2B 3E01B 4IH6A 3MR3A 2RDJA 2FVQA 1RT1B 2R7YA 4HVJA 1IH7A 1SV5A 2FJWA 4CF8A 1JLBB 3TAMA 3NE6A 4EEYA 4RW8B 3WNHA 5C42A 4Y3CA 2W42A 3OLBA 1XWLA 1JXEA 2BGGA 1WSEA 2KZZA 3M9OB 5KG6A 1S6PB 5HLFB 4KFBA 3FFIA 4DU1A 2G8FA 3GV7B 1HPZA 1R0AA 1JLAA 4KO0A 1S9GB 1S0OA 2ZE2B 1N5YA 3AVIA 3BJYA 3DLRA 4KHUA 4Y1CA 1KVCA 4MKBA 1D1UA 2QKBA 4K4TA 2HHXA 4FJKA 5KG5A 2UVWA 4B9NA 3LAMA 4I2PA 1NJWA 3T5JA 3TQ1A 4IH7A 3DOLB 5FDLB 3HVTA 4O0IA 2VG7A 2ZKUA 2B4JA 3D28A 4ECZA 3I5AA 3DLGA 3DLKB 2E9ZA 1RBRA 1QSYA 1ASWA 2P5OA 1RNHA 2UUWA 5L1IA 2R2UA 2V0NA 1D0EA 2XWYA 4DFPA 3HK2A 2X6SA 4IFYA 3KHLA 5EUHA 3KMQA 4MQ3A 4HKQA 3OL6A 3KKSA 3KLFA 3VA0A 4C8OA 5KGXA 1S97A 3OYNA 5HBMA 5L1JA 3ZT2A 2YHBA 3GIMA 2I5JA 2NUBA 2DFEA 1K6YA 2D0CA 5KFIA 1TK8A 4KBIA 3OJSA 4FS1A 4KI6A 3CYMA 4DFJA 1RBTA 1ZBIA 4DSKA 3QEXA 5J2QA 3AVHA 2DFFA 2YKNB 2IBKA 2OPSB 3MXMA 4KSEB 4BACA 2OPPB 1IKWA 2R2SA 4KRFA 3VN5A 3SJJA 1L3VA 3OY9A 4TY8A 4XO0A 5DQIA 4O3NA 4CJ3A 4FZZA 2YKMB 3BSNA 2XO7A 5KG2A 5E41A 4I7FA 4ECWA 3N6NA 5C25A 4CECA 4LD0A 3CVKA 5F8LA 3AA4A 4F3TA 5KFVA 1S1VB 4MK7A 2W9BA 4LY7A 1DTTB 5L1KA 2ZQBA 3SV3A 4QPXA 4EP5A 1MU2A 4DLEA 3OS2A 1VSKA 2D41A 3GV5B 3HO1A 3LAKA 1C2PA 1TQLA 2XY5A 3PX0A 1TVRA 3NAEA 3RMBA 1ZTWA 1TKZB 4CJFA 4FJ5A 1RT4B 4IG3B 4CE9A 4DF4A 1LWEA 1T94A 1G15A 4MH8A 4F4ZA 3OSPA 1C6VA 4Z0UA 4CJRA 2HNZA 1JLGA 4ZVFA 4F4WA 4WZMA 1KSPA 4K8ZA 3VQDA 4WXOA 4J9OA 3VA3A 4I9QA 4QAGA 4CJWA 2EX3A 4AHSA 3CFPA 4OGCA 4QWCA 4WYWA 4BE1A 2BANB 4NLRA 4IRKA 3VQ4A 3G6XA 2KTQA 3QEPA 2W9CB 2E6MA 2VWJA 3SFUA 3M8SA 1VRTA 4FK0A 4JV1A 1MMLA 3DYAB 2R2RA 1KLNA 1ZBHA 1RT5A 1RTHB 3NAHA 3S3NA 3OYKA 3M9MB 4N5SA 1JLEB 2AX0A 4LQ3A 3NGIA 4WFXA 3C6TB 4IKAA 1X1PA 2WCXA 3I0SB 3PW4A 4CF0A 3QINA 4B9MA 4M3XA 3QLHB 2JLEA 1S0MA 2P5GA 4FJ9A 2IM0A 2B6AB 2JC1A 3OJUA 1C0UB 4DL3A 1LW2A 3SNNA 4OLAA 3IG1A 3IN5A 4R5PB 3H98A 3NH2A 1B9DA 3QEWA 1NOZA 4ZHRB 1NHUA 4YR3A 2YNFA 2A1RA 4CHOA 2VG6B 3DOKB 3TR8A 4KHRA 3CIZA 4N41A 3OYIA 5DK5A 3BREA 4MFBA 2WOMB 3SPZA 2DFHA 3P1GA 1LAWA 3ZSYA 4IOBA 3IRXB 3ZSRA 4NRUA 4CJUA 1JLCA 4WE1B 2E4LA 4IRDA 3DLEA 3KLEA 2Z1IA 2FVRA 4AH9A 4DSLA 1JKHB 5T7BA 4BDYA 1VRUB 4CHNA 1HQEB 4E7LA 3PW5A 4C8KA 4JUZA 3WNEA 1D9DA 4N47A 4K4ZA 1Z25A 4FJ8A 3CJ5A 3QYYA 1EP4A 4H4MB 4MK8A 4FJNA 4W5RA 4H4OA 3NH0A 2V4RA 4FVMA 3H5SA 3MECB 3MEGA 3H40A 4B9TA 4CJEA 1RTJB 1RDBA 4PUOA 2RDIA 1LAVA 4DTUA 1J5OB 3NBPA 2YNHB 2XI2A 3E51A 3I5BA 1SUQA 1NKCA 4W5NA 4CJPA 3TANA 4ECVA 1BISA 2VG5B 3KK3A 3I0RA 2BE2B 4RNMA 1FKPA 4KV8A 1VSHA 3AVFA 3AVCA 2D7SA 2OYQA 4G1QA 3NHGA 3KLGB 3DI6B 2HWHA 4J9KA 2GUIA 1QAIA 2XGPA 1TL1B 1RT2B 4YMEA 3HYFA 4YR0A 4M3TA 4Q0BA 3QIOA 2RKIB 3NKYA 4F4YA 4DFKA 3KHRA 2B43A 2IM3A 1T05B 1BIUA 4J2EA 3LZIA 1B92A 4NCGA 2C2RA 5KTQA 1S1XB 4ZVHA 1NK8A 2B5JB 3M9NB 4FW1A 4KTZA 3RWUA 3AVMA 1UWBA 4DTOA 1KFSA 3NMAA 4BDPA 4JRPA 2FLPA 2ZD1A 3MEEB 2WK4A 1T03A 2AJQA 1RAJA 4CGDA 1U4BA 1I6JA 4DL2A 4KHMA 3SQ4A 1IKXA 3TVKA 3UIQA 4QOZB 1QE1B 5KFNA 4ED3A 4CEEA 4J2DA 3PX4A 4W5QA 4CGFA 4BDZA 2FBTA 3EZUA 4URSA 2LSNA 4AHUA 4KTWA 3H59A 3OYMA 1RT3B 3EYZA 1HARA 4FK4A 5J2PB 4N56A 2XY7A 3WNFA 1VSMA 4Z4EA 4Y1DA 2R8JA 4ED0A 1LWCB 3SYZA 4NLWA 4RW6A 5KFAA 3OYDA 3NH1A 4RUAA 1LW0A 1S5JA 3LP0B 3V4IA 2E9TA 2V9WA 3Q8PB 3WNGA 3QESA 1HNVA 3HL8A 1S1UA 3LP2A 3GYNA 2G8KA 3T5KA 3K57A 5L9XA 3ZSWA 4HTUA 4CK3A 5SZTA 1S48A 4DG1B 3HKWA 3G10A 3DDKA 4CEFA 4CF1A 3N6LA 4YP3A 4O4GB 4Z4FA 4EO6A 1K1QA 4CFCA 2EHGA 2XCAA 2HWIA 2BQ3A 1IM4A 2HVHA 1EKEA 1IG9A 4URQU 4PWDA 4O44B 4ECSA 1D9FA 3G86A 3GQCA 4YR2A 4J9RA 2X74A 4J9PA 4RW7A 1HNIA 3HM9A 3TAPA 4AHVA 2P1JA 4KKOA 4FS2A 1DTQA 5F9NA 3ASMA 1KRPA 4IFVA 4KB1A 3BDPA 5D3GB 1XHXA 1YTUA 4IR9A 1SKRA 4WFYA 4J2BA 3H08A 3MF5A 3SV4A 3ITHB 3NCIA 3H2LA 1IKYB 3RB6A 4DFMA 1NJYA 4FLUA 1NKBA 3KJVA 1QUVA 2JGUA 1IKVA 1WSJA 1QQCA 1W25A 4F4XA 1RTIB 3HP9A 3M8PB 4HHTA 1S9EA 3AO4A 1BQMB 3N6MA 4KHNA 1SL1A 4CEQA 1NK5A 4ICLA 1C1CB 4ZPDA 2RF2B 3PX6A 1A5XA 2UVRA 4C8MA 4NLPA 4CK1A 4CEOA 1KVBA 1HMVA 5C24A 4K4WA 4NLVA 1I3AA 3V9UA 1BQNA 3F9KA 3CFRA 4CJKA 4IQXA 2KW4A 2IJNA 3DRRB 3GV8B 4L8RB 3OYHA 3VQSA 3PW7A 1J53A 4GC7A 4CERA 4FZXC 1SL2A 4IDKB 4CEBA 4CFDA 5I3UB 3L2VA 4RNHA 3LZJA 3SPYA 3UQSA 2IAJA 3AVLA 1DLOA 4B3OB 3O3GA 1RT7B 4M3UA 1C0TB 3PY8A 2F8TA 4RW4B 4DQRA 1ZTTA 5JS1A 4PQUB 2RN2A 2YNGB 2G8UA 1QAJA 4R8UA 4CCHA 4FCYA 4DMNA 4NLGA 3ISND 1KLMB 2WHOA 1RILA 3HT3A 3HVRA 3JYTA 5KFOA 1RDDA 5CYQA 3CQ8A 4ED6A 4CGJA 4KREA 1RA6A 3KHHA 3NF6A 2ITGA 3MFIA 1HQUA 1SV5B 3QIPA 5FDLA 2A1SA 4CF2A 3L8BA 3Q8RB 2F8SA 3TAMB 3MXJA 5DMRA 5C42B 5KT5A 4FJ7A 4E7IA 5F8GA 3C95A 4DQSA 2KFNA 4EO8A 4PA1A 3AO3A 4WZQA 3F73A 4KFBB 3OL9A 1TKTA 2FBXA 1HPZB 1R0AB 1JLAB 4KO0B 2DPJA 3PV8A 2IM1A 5KFTA 1GX6A 3OHAA 1N5YB 1J54A 2IA6A 3ULDA 2I1RA 2OZMA 5KT7A 1JLFA 5KFLA 3MR5A 3S9HA 4I2PB 2R8GA 1EETA 3BGRA 4TQSA 3HPOA 4E89A 2VG7B 4ECRA 1WSHA 3ZT4A 4RUCA 3L3UA 2FJXA 3LP3A 3DLGB 3VQBA 4ZPBA 4WXWA 3VQ8A 2C2EA 1C1AA 1ZBFA 2Z1JA 2QK9A 3QIDA 4CF9A 3THVA 4ZP8A 2W7PA 1UAXA 1GOAA 3QO9A 2HNDA 2WTFA 1GOBA 4Q5VA 4YFUA 3AVBA 1RBUA 2WONA 1S1WA 5JUMA 4RW9A 4NLTA 3O4QA 3VQQA 3O3HA 3QGHA 4FLXA 5HBMB 2I5JB 4M3WA 4EP4A 3RAQA 3OS0A 3LWMA 4M94A 4Q45A 4QWEA 2D0AA 5J2QB 2FLLA 3RBEA 4CESA 1BCOA 4CJ5A 3BQ0A 5KFEA 3HP6A 3MR2A 4KHSA 3HJFA 3L2RA 3QNNA 1TKXA 2FVCA 4ECXA 3D0PA 3GIJA 4HUFA 2Y1JA 4YNQA 4TY8B 3ZSOA 1BHLA 3NGYA 1TK5A 1NHVA 4XPEA 4Y2CA 2AQ4A 3TAEA 3MR6A 5C25B 3BSCA 3BQ2A 1HYSA 4DQIA 3OS1A 4KB0A 4FJMA 2AWZA 2W9BB 4CEAA 3CJ2A 4E7KA 5F8IA 4JS5A 2HB5A 4WYLA 5CYMA 5KRTA 4ZP9A 2EC0A 1TVRB 1U49A 1S49A 4Z4IA 3C94A 4Y2AA 3DYAA 1TK0A 5J1EA 2AGQA 1LWEB 3DRSA 4NLOA 3K5MA 2ALZA 1RT6A 1HYZA 2D3UA 4KB7A 2HNZB 1JLGB 4CHQA 1L5UA 1RBVA 1RYSA 2R8KA 4IRCA 4G3IA 4CEDA 1Z4UA 5L1LA 4ZTFA 2E6LA 3S3OA 4OGEA 4NYFA 3DLBA 3CWJA 5JXSA 3LPTA 1OS5A 2W8LA 1XI1A 2UVUA 4RNNA 4BWJA 1VRTB 3DMJA 4ECTA 2GC8A 4O3SA 3OYJA 1RT5B 5I42A 4E7HA 3LALA 4B8AB 2FBYA 3MEDA 3L2UA 3MXIA 4LH5A 3AVAA 3OHBA 3OL8A 3T19A 4KHQA 2WOMA 3AVNA 1YT3A 4FBUA 4ED2A 1RTDB 2O5DA 3D5MA 4MKAA 5DGAA 4DL7A 3V6HA 3IRXA 4JV2A 4Q44A 3V6KA 3LP1A 1N48A 4M3YA 2HHTA 3VQ6A 3HHKA 3DRPA 3IG1B 3QNOA 3M8QA 3V1QA 1BGXT 1SH2A 5F8JA 2IOCA 1FKOA 1CXUA 2YNFB 3RR7A 2PYLA 1KFDA 3CJ3A 4X2BA 4J9LA 4CFAA 5HP1A 3T3FA 2BRLA 1RDAA 2HMIA 3KK2A 2KZMA 3RRGA 3IAYA 1U48A 3SQ2A 3KLIA 3CG7A 1J5OA 2FVPA 3G6VA 1N6QA 3NF8A 1JLCB 4DTSA 5KFBA 1X9WA 1RA7A 4F2RA 3DLEB 4TLRA 4B9SA 3OVNA 3KLEB 5HROA 4DSEA 4AILC 2F96A 5HRNA 4ID5A 1CZ9A 4RNFA 3V6DA 1KCFA 1JL2A 2VA3A 1S4FA 2GIRA 4IH5A 3TARA 4GC6A 5C5JA 1EP4B 1FXXA 4FLZA 2FLNA 3TAFA 5KG7A 4H4OB 2JC0A 3QZ7A 3ZSXA 3MEGB 1KHWA 5KI6A 4PUOB 4TN2A 3NBPB 2XI3A 3EY1A 2GV9A 2HNYA 1TL3A 3IS9A 4QW8A 1N56A 3AA3A 4CJSA 1SUQB 3CM6A 3BQ1A 3AA2A 1UA0A 4IG0A 3L2QA 4ECQA 3I5CA 2B5JA 5DLFA 4DWIA 3KK3B 3I0RB 4CFBA 1FKPB 4KV8B 2ATQA 4F8RA 5K14A 1WN7A 3KK1A 4IBNA 3OYGA 3JSMA 3CM5A 4FJIA 4I2QA 4AHRA 2ASJA 4G1QB 5DG8A 4KAZA 1K1SA 4FYDA 1REVA 4O0JA 3AO5A 3VQ7A 1S0NA 1QE1A 5EWFA 3PW0A 3K2PA 4ED8A 4ZPAA 5J2NA 3SCXA 3UR0A 2OPRB 1ZETA 2QV6A 5CY4A 3L3VA 2JEGA 4NCGB 3O4NA 3OYCA 5EWGA 5SWMA 1LWFA 1UWBB 4B08A 1TAQA 4OKEA 4HCBA 4KTQA 2ZD1B 3V81A 2HHVA 1T03B 4DTRA 2YNIA 1XR5A 4DTNA 1BI4A 5HRPA 2IS3A 5KT3A 3O3FA 3VQCA 5KG4A 3UDLA 2DTUA 3QEVA 4F3OA 1VSLA 4DSIA 3NGZA 5T14A 1JLQA 5KFSA 1WNEA 4MIBA 4O3RA 3KNAA 1SKWA 3RTVA 2OH2A 2AU0A 1NK6A 1NK4A 3PJXA 1FK9A 3ZT3A 3CDUA 4RW6B 4OL8A 4NZ0A 1LW0B 5KFHA 1A5WA 2HHSA 4LSLA 5DG9A 4FM1A 3KLHA 5KT4A 4DQQA 4FXDA 1HNVB 2ETJA 1S1UB 1YVUA 4DL5A 3LP2B 5KG3A 1S1TA 1CXQA 2OZSA 4OJRA 3CFOA 2D3ZA 3MFHA 2OPQA 3T5HA 4M3ZA 1WAJA 4EZ9A 1C1BA 4PWDB 4DSJA 2YHAA 3FQLA 3A2FA 3RMCA 4J9NA 2X78A 2HHWA 3BSAA 3U3GA 4CEZA 1TV6A 5FROA 5KFWA 3ALYA 2IC3A 4NLDA 5DGBA 5DQHA 1C1CA 3NGDA 1HNIB 2BRKA 1NJXA 4KKOB 1DTQB 1RDCA 4DEZA 2KQ2A 5DG7A 4CJ4A 4NLSA 2WRMA 3VQ5A 1S6QA 2C28A 3FSIA 3OYAA 2D5RA 4K4VA 4CIEA 4LSNB 1B9FA 2ASDA 4TY9A 4EYHB 3KKRA 4W5OA 3KJVB 1XC9A 5EDWA 1IKVB 3C6UA 3VQPA 3M8RA 3PHEA 3H5UA 3OYBA 1N4LA 1WSGA 5F8HA 3DM2A 3E01A 4ICLB 1RT1A 2ILYA 4FM0A 4QWDA 4LH4A 3K5OA 3PO4A 3S3MA 3ZT1A 3QGGA 1NNDA 2AGPA 5J2MB 1JLBA 5KFGA 2HVIA 3U6FA 1BQNB 4CK2A 4NCBA 3KMSA 4XIUA 4RW8A 4ED1A 2X6NA 2HHQA 2KFZA 3G6YA 3SQ0A 4KHYA 4E1NA 3ZCMA 4DF8A 3MAQA 3NF7A 1NKEA 5HRSA 1S6PA 5HLFA 4Z4CA 3LDSA 2O4GA 4KAIA 4ED7A 3FDSA 2IJFA 5EU7A 5HRRA 1QTMA 1S9GA 4ELVA 2ZE2A 5F8NA 3CJ0A 4K4XA 2IAJB 1DLOB 2BR0A 4KI4A 3B6OA 1WAFA 2QE5A 3AVKA 1SH3A 3V1OA 4HYKA 3DOLA 3I8DA 3SUOA 4BE2A 2HW3A 1U45A 4CJQA 1UOCA 3FQKA 4J9QA 4R8UB 3KTQA 3DLKA 2Y1IA 3RB3A 3OYFA 1CLQA 4QWBA 2XHBA 1Z26A 2UUTA 4EBEA 4OPJA 2PYJA 3RR8A 2FBVA 4CHPA 1RYRA 4QWAA 3VQAA 4DQPA 3JYTB 3QGIA 4BWMA 3FFIB 5CYQB 3GIIA 4CJLA 1XR6A 4NLXA 4RU9A 4RNOA 3AO2A 4CIFA 4GMJB 1HQUB 3QIPB 5CZ1A 3KHGA 1I39A 4K4SA 5KFMA 3OSNA 4KE5A 3V1RA 3HVTB 3KLVA 2QKKA 4TXSA 4JS4A 4K50A 3KD5E 4FJLA 4F50A 1S10A 1TKTB 4KHWA 2YKNA 2OPSA 3GILA 4K4UA 4F4KA 3BR9A 2OPPA 4FLTA 3RB0A 3PR5B 1RBSA 1JLFB 1EETB 4IFYB 3BGRB 4NLQA 1T3NA 2YKMA 3KLFB 4NLYA 1T7PA 3TAGA 3K58A 1QS4A 3RB4A 5FRMA 1S1VA 1DTTA 2G8IA 1U47A 1TGOA 4O3PA 2IM2A 5KFUA 2R2TA 3NL0A 3RRHA 5DQGA 3QO9B 1TKZA 2HNDB 4XPCA 1L3UA 1RT4A 1D8YA 2AGOA 4IG3A 4W5TA 4ECYA 2PY5A 1IKWB 3VQEA 2WONB 1S1WB 4RW9B 4JV0A 4AHTA 3ICLA 4TYBA 1QSSA 1F21A 1RDRA 5KGWA 1VSEA 1Q9XA 1LV5A 1YVFA 4J2AA 2G8WA 3HSTB 4I7FB 4CJTA 4DLGA 4TQRA 1NK7A 4Z4GA 3KD1E 2BANA 1MU2B 2FC0A 2QXFA 3T5LA 3AVGA 2G8HA 3QZ8A 2W9CA 4FLYA 3AA5X 1TKXB 4HCCA 1HJRA 4LQ9A 1UA1A 4DU4A 2PZSA 3K59A 3AVJA 3SQ1A 4ZPCA 1RTHA 1XR7A 4M42A 2CKWA 1NOYA 5KT2A 4Y34A 4DS4A 4FZYA 1HYSB 1JLEA 3DLHA 3C6TA 3I0SA 4C8NA 3OLAA 3SI8A 5KFKA 2J6TA 4OLBA 5KFPA 4K4YA 3QLHA 5CYMB 5KFJA 1S9FA 3EPIA 1YTAA 4EBDA 5F8MA 4IKFA 3V9SA 4F2SA 5EWEA 2B6AA 2D0BA 5J1EB 5KFQA 4E3SA 1EXQA 4FK2A 5KT6A 3V6JA 4OKJA 3DRSB 1C0UA 4DTJA 2AX1A 1RT6B 4R5PA 4ZHRA 2XY8A 3ZSQA 2VG6A 2OA8A 3DOKA 3K5NA 3SUQA 1RTDA 1SKSA 3V9XA 1ASVA 3T1AA 3TWHA 2IMWP 3P83D 2CJQA 3GIKA 3RMAA 4ZTJA 4DSFA 3DMJB 2RPIA 1VSIA 4NCAA 4WE1A 5I42B 1LW2B 4CIGA 3MEDB 4FM2A 4B9VA 1JKHA 4FW2A 1VRUA 3HXMA 1HQEA 1T8EA 3NAIA 4ZP6A 1Q8IA 2JEFA 1C0MA 4EYIB 1TKDA 3Q8SB 4FBTA 4H4MA 4DU3A 4BE0A 4R0EA 3P5JA 4MFBB 4M95A 3L2WA 3RAXA 2VA2A 4B9LA 3MECA 1NJZA 4ELTA 3LP1B 1JIHA 4M3RA 3SUPA 4FJHA 1RTJA 3SFGA 3RMDA 2YNHA 3DRPB 2C22A 3M8QB 1HRHA 4EZ6A 1SH0A 4FJGA 3KIOA 4PY5A 4GVMA 4RZRA 1FKOB 2XY6A 2BDPA 4DS5A 3AO1A 2P51A 2VG5A 5HP1B 3NFAA 4M41A 4CGHA 2BE2A 4EBCA 3CO9A 4OKKA 2HMIB 2W7OA 2XRIA 3KK2B 3CDEA 4NLUA 1IO2A 4H54A 3TABA 4J9MA 4ELUA 3KLGA 3DI6A 2Z1GA 4Q8FA 4UQGA 2HAIA 3EPGA 3KLIB 3OYLA 1ZYQA 3ISNC 1TL1A 1KVAA 1RT2A 1NK9A 3PW2A 2XGQA 1BCMA 4CJVA 4GW6A 3LPUA 1N6QB 3PUFA 2BQUA 3ZSZA 2RKIA 1VSFA 4E1MA 3SUNA 1XHZA 4E19A 3QETA 1T05A 5HROB 4JLHA 3SI6A 4RG8A 4ID5B 4CHYA 2O4IA 3V6DB 1EX4A 3HVAA 1S1XA 4CGIA 1WLJA 4AHCA 3OYEA 2W8KA 4E7JA 5KFXA 1TAUA 4DL4A 4I9LA 4KPYA 2HHUA 3KOAA 2ASLA 3IGVA 4J9SA 1RCHA 3TAQA 3MEEA 1ZBUA 3LANA 1VSDA 4O3OA 2XC9A 4FJJA 2OPRA 3PJWA 1X9SA 2J6SA 2V4QA 4O4RA 2HNYB 3SZ2A 1TL3B 1J9AA 4O55A 3IS9B 2ATLA 4Q0BB 3H4DA 2ILZA 1L3SA 4ZMMA 2FJVA 4N76A 4IG0B 3H5YA 5KFCA 2IDOA 1RT3A
chains in the Genus database with same CATH superfamily
3CC4N 2A5XA 5J2PA 3AJDA 2X51A 3JSMB 4I2QB 5AQMA 3D1HA 3MDQA 5AR0A 1A0OB 4OI1A 3P4UB 4JI4K 2QL9B 4DTMA 1O1WA 2U1AA 3AV9A 4YDXA 1VK0A 2H5IB 3A8JA 2JEJA 4ZK7M 5KG1A 4Y0FA 5JLFA 4QYRA 5IT9U 2CH6A 4CZLA 1WG4A 2H5JB 1G1XA 4MIAA 4ZLJA 1HA1A 3QWPA 3CJ4A 2GIQA 2DY4A 4ZA1A 4HUEA 1W0HA 3W2VA 1TL7B 2IGIA 1YQHA 3N5BA 3RSEA 1E6VB 2FHJD 3CCQS 2CPYA 2MQNA 2Z56B 1C0GA 2OI2A 1HX1A 2JSXA 3S01A 2DIUA 3B6PA 1NLKL 1H7WA 1X4GA 2MSSA 3V9ZA 2XYGB 1FWPA 4FWPA 1JLQB 1VSJA 4QYZK 2GBZA 3OR2B 5KOXA 2IIRA 2DPIA 4YQWA 1FK9B 4ZP7A 3M05A 3OA9A 1A6LA 1TELA 4C8LA 1SJ1A 2P9NB 1AZSB 4YY3K 2J6UA 4ZVEA 3EGVA 3ZSVA 1KTQA 3M8PA 1CZBA 2HBKA 1SQFA 1J5EF 1VQ6S 2XHWA 4YB5A 4QCLA 2XZWA 4H5VA 1CBKA 2YV0X 2O8EB 5KFYA 1ITGA 3LDLA 1G99A 3PKYA 4LSNA 4IFVB 2E5GA 2D1KA 4L3NA 3CUNA 1EQ0A 4BRFA 1C1BB 1GX5A 2QLXA 3BM7A 1B0TA 5F1XA 3Q8YA 4LJMA 5AE2A 3ZT0A 1ZBLA 1YUWA 3WXJA 1UFWA 2IC3B 4CZEA 4ZS6A 4TSXA 3SK3A 2H5EA 1Z6RA 4CZJA 4K0KK 5KG0A 1N5QA 1KONA 3CMES 3R27A 1NSPA 4MK9A 4NYNA 3ZX2A 1IN0A 4E0DA 3P5BP 2GELA 4ZVGA 4B3OA 3D2EB 2Q2RA 2Z2YB 3O9TA 4X65J 1JX4A 2GGPA 3FZMA 4B8CA 1HMVB 1A5VA 4DR3K 4BREA 1IR0A 1AROP 1T3OA 4IO8A 2VQEJ 2VYPA 3DM2B 1GMUA 3ZNUA 4IH6A 3MR3A 1VAZA 3J80Y 4HT5A 1IH7A 1SV5A 3CCZA 1U2VA 3TAMA 2DGUA 3OTOF 4ZCKA 2BGGA 1WSEA 2KZZA 4OZJA 1OQ3A 3A12A 5KG6A 4LR9A 4KFBA 3SBMA 4C9DA 3FFIA 4DU1A 2G8FA 2ZZMA 1ACMB 3KWIA 4M5KA 1VQ4N 3AVIA 3BJYA 3DLRA 4KHUA 2V94A 3O3LA 4MKBA 4KGMA 4FJKA 4BVPA 4X66J 3TQ1A 3DOLB 2VG7A 2ZKUA 4BRKA 3I5AA 4BG8A 4CZGA 4EK2A 2HQGA 3K89A 3E9OA 3W61A 1ELOA 2O8CA 3SQOP 3ATVA 2UU9F 1RBRA 4UUWA 1QSYA 2D74B 2B4UA 3GOIA 1D8ZA 1RNHA 2UUWA 3DNCA 2VPWB 1KD1O 2RRBA 2R2UA 3OTCA 5D0EA 3KHYA 2X6SA 4E1JA 1IWAA 3CCUN 4HKQA 1HHSA 2CH5A 3ID8A 5ETRA 3VA0A 2B7CB 4RU2A 2W24A 3GG1A 2FC8A 3R2DJ 3ZT2A 2D0CA 2RU9A 4KBIA 4DFJA 4DSKA 3QEXA 3QJJA 2I2YA 3THYB 2YKNB 4Y2MA 2IBKA 3DOMB 2BBEA 4ZLLA 2WUSA 3MXMA 1BLUA 1NAQA 1M1KO 3A13A 3LF0A 1YJUA 1IKWA 1VFJA 4B3SK 4ILJA 4DR7K 3SJJA 5DETA 4J9VA 2YKMB 1O13A 1KQGB 3PHTA 4I7FA 4H0OA 5C25A 2KVIA 1UW4A 4LD0A 1JNRB 3UKRA 1NU4A 3AA4A 3G82B 1R8HA 4MK7A 4KPCA 1XNRJ 4UY8T 3EVWA 1MU2A 4HTLA 3FZFA 3OS2A 2O67A 2BJ1A 4DHVA 2MQPA 3NAEA 4PXBA 4IG3B 4CE9A 1OH5A 1LWEA 2OCEA 5HANA 1C6VA 4A8OA 1J2VA 2VJUA 1JLGA 1EWQA 2ZNZA 1SB6A 2MMYA 4JBCA 1R3NA 2BJ9A 3UKUB 1NDPA 3M3ZA 4JI6K 4PKIA 2OD6A 1HLUA 2OANA 3VGLA 2CQBA 4OGCA 4WYWA 2XHCA 5AXLA 3MGJA 4IRKA 4OPAA 2D1CA 3CF5L 3G6XA 2F9WA 2BUPA 1RDUA 2VWJA 1FE4A 3BZQA 2P9SB 3M8SA 1VRTA 4NZ6A 4FK0A 5IS2A 1MMLA 2ERRA 3C14A 1RT5A 4EIAA 2HFZA 1GLDG 1UL3A 1R43A 2CGLA 1NJIT 2VOOA 3SSQA 3M9MB 3C6TB 3PW4A 1H3DA 3OTEA 4FWRA 3ELHA 3L7OA 3QLHB 2FY1A 2JC1A 2PEBA 2FHJA 2VHGA 4R5PB 3P8BB 3CJ9A 4UT4A 3ENQA 1NOZA 2A1RA 3OW2R 1WC3A 3MPDA 5GAGI 2YQ1A 3FZKA 4CZIA 1J5EJ 5DK5A 1FD8A 1FXLA 3HM8A 1OPZA 4MFBA 2F9JA 4OV6A 4CZCA 5D0HA 2DFHA 1IJFB 3CQYA 2CQ4A 4IOBA 1JLCA 4IRDA 1N5SA 2IVPA 3Q8VA 4FWKA 3KLEA 2FVRA 5K8MA 4UZBA 4DSLA 5T7BA 3FUYA 3PW5A 2WAQD 1Z2ZA 4EI2A 1YZ6A 1EP4A 4X4TA 2ZZNA 4FJNA 1FF2A 4GV9A 2F7VA 4B9TA 1QVGM 4KH5A 2E1CA 1GLJO 1RDBA 3VEZA 4N7TA 4DTUA 1J5OB 3F5TA 2YNHB 2RDDA 4IEEA 4RCHA 4Y00A 3W3SA 3TANA 5AE1A 3MR7A 3AOAA 3OXLA 1YGYA 2DYAA 3O1LA 3GCWP 4TKTA 3CC7S 1Y9OA 4GO5X 3NHGA 3KLGB 2Q6CA 2GUIA 5AQPA 2QA1A 2A2CA 2ZJQL 2GQCA 1RT2B 4YMEA 1WKKA 4YR0A 1VQ8S 1RAOA 4Q0BA 5LXRA 4CZMA 3PFEA 4UW2A 3U1NA 2IM3A 1T05B 3J80O 4J2EA 3LZIA 5H1SQ 2LQJA 5KTQA 3VZHA 3D3BJ 4YHHK 2CJXB 2WVCA 4FW1A 3AVMA 1UWBA 4ILMA 2VZ9A 1KFSA 3A0IX 3DXKB 1FWLA 1RAJA 4DL2A 2W40A 2LMIA 1IKXA 3MN5A 3TVKA 3UIQA 2W2OP 1QE1B 3JSYA 3B8HA 3VMFB 5BYQA 1RCXB 3VV2B 5EOYA 2LSNA 2VOPA 4KTWA 1FERA 2IPOB 3EYZA 4CLFA 2UU9J 4LFBJ 5J2PB 4DI6A 3CF5Q 5C15A 1BHNA 5KPRA 3VGVA 2ZM6J 3UCUP 3QFUA 1URNA 4ED0A 5D4PA 5ETNA 4ERDA 1S5JA 3V4IA 3CERA 5ADXA 4F0KA 3I96A 2RVJA 3JQMA 1FXDA 2PFFB 4C48A 5AXKA 1S1UA 4IO1A 3LP2A 3VVTA 2ZHAA 3T5KA 4K25A 1HHTP 4DN9A 3ZSWA 4HTUA 3ZETA 5GAHU 5BYSA 4CF1A 2G13A 3HKZD 4P7VA 3W2VB 2KM8B 2BQ3A 2HVHA 3RSEB 5T7LA 2X3DA 4PWDA 1D9FA 3AGRA 5HAOA 4GVBA 2OHDA 3EO3A 4CLUA 1H6KX 3Q23A 4PG7A 4DUZF 2OIHA 1DTQA 5F9NA 1KRPA 3BDPA 3KUGA 4IR9A 2O8BA 5C7PA 1UVMA 1VRQC 2DGSA 3TVYA 3I55S 1YG0A 2HHPA 4WFYA 3P31A 2HS3A 2BABA 3TJAA 5B0DA 3A3OB 2KXHA 3HDSA 1NKBA 1M5PC 4OZ5A 1T6DA 1IKVA 2IA0A 1QQCA 4ED5A 1PBUA 2MLXA 2XQCA 1ESVA 3M8PB 1CJTA 2QSWA 3AO4A 3SQGA 3N6MA 1HI0P 4CEQA 4ICLA 1C1CB 4A8WA 1PYSB 2YCHA 2G1HA 3CCJN 5F2RA 1Q5YA 3PX6A 2G0JA 3BUZB 4UTGA 4CEOA 3D6TB 4BG9A 1I3AA 3V9UA 2UUBF 1S57A 2IJNA 5FPDA 4M5NA 2XWXA 4MLHA 3VQSA 4C1NI 3VAMA 4NMLA 1SL2A 4OZ3A 1TMMA 4M1KA 4A47A 3LZJA 3SPYA 4USTA 1DLOA 3AT1B 5LJ3Y 4WPAA 4B3OB 1WSRA 4ZVSB 4U67L 3VCDA 1VQ7N 3MMCA 4KGVB 2UV8A 2F8TA 2NRWA 1BMQB 4YORA 3ULEA 4YOVA 1FX4A 3J80U 3AH6A 3UN3A 4FCYA 4DMNA 4NLGA 3ISND 4EWTA 4L72B 1RILA 2RT3A 2CAJA 1AA1B 3HVRA 3JYTA 2OTJS 4ES1A 1F9EB 2FZCB 1SC6A 4CGJA 3GJSB 4WIIA 3OUYA 1HQUA 1SV5B 1NDLA 2NRZA 5FDLA 1OIAA 1HFEL 3CXCR 2A1SA 1IBMK 3Q8RB 1U2VB 3IR6B 3TAMB 2CQCA 4NXMJ 4NWBA 4FJ7A 3BBBA 2QTDA 1RAAB 4EO8A 2C2MB 3ZO7A 3AO3A 2ZOGA 3CIMA 2IHR1 3F73A 4KFBB 3OL9A 2GWJA 5DM7L 2EK1A 2OSRA 2Z4PA 5LMNK 1GX6A 2BW2A 1J54A 3W63A 2VGMA 2FSKA 4A8SA 3R9PA 3G6ES 4LMZA 2JWNA 3VETA 3MMVA 5K5MA 2EFPA 3H1VX 3HPOA 4E89A 2VG7B 2J8SA 4FZVA 2V63A 2O8CB 2IIHA 3KJNB 3HHLC 4JV5J 1RWKB 1TFYA 2CGKA 1UAXA 3J7YI 4ZVTB 1NGEA 1GOBA 3D1QA 4ZN1A 3AVBA 2VD3A 1CS4A 4RW9A 4NLTA 2DH9A 3TR5A 1WOSA 3QGHA 2OD4A 2CJYB 1HNXF 2C3OA 4M3WA 1QM9A 5D0RA 1R8PA 3CGIA 4LF8J 1BDGA 5LT5A 2D0AA 3FZBA 1MWKA 3BQ0A 3MR2A 2DHXA 3L2RA 1U0SA 3D0PA 4LVOP 3RYLA 3RBZA 4HUFA 4QS8A 1H2TZ 3ZSOA 3MD1A 1NHVA 3X3UA 2VB6A 2V4JA 4Y2CA 1HWKA 2CPFA 3MR6A 5C25B 1HYSA 1DEJA 3UKRB 3EX7B 1SQKA 2C2NA 3U1MA 4CEAA 1WC1A 1UJ4A 2HB5A 1XN9A 2LXFA 2VBZA 5KRTA 2F9DA 4K41A 2Y1RI 3DYAA 2LVWA 1FRJA 1LWEB 2MJNA 3G8TA 3DRSA 4NLOA 4KHPF 3GFZA 3HOSA 2L3MA 2A41A 2P9CA 4KB7A 2WSCC 5A6PA 1JLGB 2CG8A 3TA2A 1L5UA 2DNRA 4DR4K 4LBPA 1FNXH 2QFIA 4QJVA 2KFYA 2GVDA 3EXCX 3JQKA 1VQKN 4MDBA 3U9ZA 3ZXWA 1T0TV 3T69A 2GWKA 5E3CA 2W8LA 2UVUA 3LM9A 4BRGA 4NPOA 1VRTB 1P1TA 1BY9A 2GC8A 3C14B 4O3SA 1RT5B 5I42A 3N0VA 1ZPWX 2FBYA 3MEDA 2ZBCA 3L2UA 3OHBA 4CTAA 4AYBD 4CM0A 2WOMA 1M1HA 2W6KA 4DUZJ 3UVJA 4FWQA 4HH0A 3UI3A 3M7VA 4C97A 4A46A 3V6KA 1KKHA 3VQ6A 2K3IA 3A4TA 2VICA 3E66A 4ISGA 4U7UD 3HHKA 1S22A 1BGXT 5HMYA 4CZHA 1HBOA 5HMWA 5K9FA 1FKOA 1RHMB 2GJFA 1R8AA 4OZ0A 4DR5J 2M88A 5DM7Q 3CJ3A 4MIWA 4CFAA 2BRLA 1RDAA 4YOXA 4ANCA 5B7WA 2KZMA 4CO2A 2R7UA 3SQ2A 2PI5A 2BVZA 2V2ZA 3CG7A 5E0OA 2EG2A 2ZC3A 3CCTA 1JLCB 1R6VA 4K42A 2JHEA 1VLYA 3PCOB 4B9SA 1IV0A 2E2PA 3VGKA 3KLEB 2YX1A 2PGCA 4IJAA 3ONQA 2ZBQA 4LF7F 1JL2A 4PL8A 2VA3A 1S4FA 1GTHA 2GIRA 4IH5A 3N4QA 5BRDA 1EP4B 5IT4A 4FLZA 2FLNA 2ALYB 3FNNA 5KG7A 2D0PA 3QZ7A 5ITHA 1BUXA 3WC2A 2XI3A 2HNYA 1VMBA 2EFOA 4IG0A 1QQOA 3I5CA 3M8YA 2HS0A 4KC5A 1XMOK 4F8RA 3KK1A 3CM5A 3NNCA 4L73A 2MKKA 4AF1A 2FPHX 1S0NA 1CLFA 4GMKA 1FCAA 5EWFA 3PW0A 4JI8J 2C2ZB 3SCXA 1ZETA 2OPRB 5CY4A 4USKA 3L3VA 4M5LA 4JI1K 5D4NA 2JVRA 3IFEA 2JL9A 1UWBB 3MN6A 4OKEA 1YBUA 4KTQA 3ENAA 2Y9HA 3KJFB 3H20A 2MJUA 4NASA 4GKKF 2LP4A 3K5PA 4LVNP 2IS3A 3BYRA 3NWGA 3O3FA 2XBPA 2EC2A 3RUBL 1FO1A 3QEVA 3R1HA 4F3OA 2LQBA 2LEPA 3MK6A 2FZKB 4OO1J 5KAKA 1WNEA 3TZWA 1SKWA 4O3RA 4BGBA 1YJNN 2F4FA 3MWTA 4B1XB 1NK4A 3PJXA 3CCES 1VHXA 5AQGA 4JEPA 1A9NB 5KFHA 3LA0A 5D8HB 1A5WA 5LM7E 5DG9A 4FM1A 3KLHA 2BUNA 3AOCA 3NMRA 5E33A 1HNXJ 2GEMA 2ETJA 1S1UB 2RHSB 1YVUA 4J9UE 4C1NK 3LP2B 3ZETB 4HI1A 3KZBA 4OJRA 3TSPA 2DK2A 3A8IA 5IC4B 2AA4A 2OPQA 4DV2F 1PJ7A 3FRYA 1R7IA 5T7LB 4PWDB 4IDHA 1Y10A 4DSJA 1NGIA 3FQLA 4OI6A 1ZAVA 1JJHA 5BPNA 1FXRA 2HURA 3ZZOA 2MY7A 2X78A 5A8RB 3BSAA 1XERA 3IXQA 1K73O 1JNZB 5DQHA 1JK9B 1QQMA 2OFGX 2YHXA 4X4QA 1KBRA 2GQ2A 4ZCLA 1DTQB 1RDCA 1X4AA 2NRHA 3ZZPA 2Y8YA 3BZCA 4WIQA 3VHQA 3FSIA 3HSCA 3TEHB 3CE8A 1KTVA 3W8PA 1YKWA 3AAPA 5EDWA 4KHPJ 1IKVB 1YI2S 3C6UA 2YBVA 3H5UA 3I56N 1N4LA 1CJTB 1S99A 1WSGA 2ZBRA 4RBUA 3SQGB 5D4LA 4AFFA 3E01A 4ICLB 3HOTA 2JRSA 4RBTA 3U4LA 4FM0A 3CSKA 5JVHL 3D7EO 4LF5F 4DV4F 3PO4A 2FHKA 3K8WA 1CJVA 1NNDA 3O9SA 2ZJRL 3Q83A 5KFGA 1CVJA 4CK2A 3KMSA 2HHQA 2E1MC 2M52A 4N8NA 3M6WA 4KHYA 4E1NA 2X1AA 1VR6A 3MAQA 3OBYA 3A5LC 3LDSA 2DR7A 2O4GA 3CMQA 4ED7A 5EU7A 1ATSA 1QTMA 3DCAA 1T02A 4K4XA 3GIRA 5M1QA 3SAHA 1DLOB 3B6OA 2BKPA 3MMCB 2EFVA 2XLJA 3MUTP 5AQUA 2KKZA 4HYKA 3I8DA 2UZAA 5BPLA 2BOPA 4CI0B 1T95A 2UXBK 2F4VF 2Y1IA 3OYFA 1CLQA 2XHBA 3RR8A 2QL7B 1RYRA 4DQPA 1NXIA 3JYTB 3R1XA 2VCPA 4NLXA 3C65A 5DJBA 3OUYB 2PC6A 4GMJB 2RMLA 1HQUB 7FDRA 5CZ1A 3L3CA 1P90A 3BGOP 3BGLA 3KHGA 3ID6A 1I39A 2DR6A 5KFMA 3LDOA 1Y5LB 2XMKA 4HHUA 3V1RA 3HVTB 1XJWB 2QKKA 1K47A 1HWUA 4DR2F 4ZIWA 2OPSA 2BE7D 4KR0B 3CCWA 1P1LA 2OPPA 4WF9L 2E5LJ 1XNRK 4IFYB 2ZDOA 4DV1F 4NLQA 3TJ8A 1MWQA 2ZFHA 4NOHA 3KLFB 1ZBSA 1T7PA 1N34F 3TAGA 4E98A 3K58A 3RB4A 1KXPA 3K9JA 2B9EA 5FRMA 3GJRB 2LU1A 2J7UA 3U8XA 3G87A 1KQSR 2FD2A 2IM2A 5DO2A 2R2TA 5AQRA 1RT4A 2AGOA 5AQZA 1NGCA 1IBLF 2CVEA 2VJVA 3OT9A 1CS4B 4RW9B 1ZA1B 2MXYA 1N8RO 1KWMA 2DVIA 1RDRA 1VSEA 1KVJA 1M5SA 1YVFA 1M5HA 4EHTA 3CJQA 2K3KA 3Q86A 3CCMN 4TQRA 1EZZB 4Z4GA 5LJWA 2DGOA 3GLJA 3VAIA 4H0VB 2VF3A 2FC0A 2QMWA 3T5LA 3UE2A 4FLYA 3AA5X 4HCCA 5GVQA 3RJMB 1YDLA 2V5HG 3AVJA 4F9OA 3MM5A 3KFWX 2V4JB 1XR7A 4GKKJ 4DS4A 1HYSB 3I9ZA 5IV4A 3I0SA 3OLAA 3EE9A 5A2QO 2FDNA 4OZ1A 1RU2A 2ZWOA 5A6WA 3LPYA 5KFJA 3W66A 4I6AA 4F2SA 1UTAA 3FEZA 3GJQB 1XTZA 1HWLA 1FE0A 5KT6A 5HVFA 3DRSB 1C0UA 1NMNA 1HD0A 2AX1A 1I3OB 3B4MA 1IQZA 4K2XA 3NCRA 4KBOA 3CHWA 1OMSA 3WDOA 3ZSQA 3DOKA 1IBKF 4CO5A 2R7WA 2GVDB 1SKSA 4DPOA 1XK8A 1LFPA 3T1AA 3PLAA 3WQUA 2NCKL 2AJ1A 1VC0A 1FRMA 4PEOA 1S7IA 2E5HA 3MM9A 4DSFA 3VESA 3ZZ0A 3G2XA 4DV2J 2KVQE 1VSIA 1WORA 2XMVA 4WE1A 5I42B 4WFAL 3FC9A 4A4JA 1JB0C 3MEDB 3Q2SC 1VQ9S 1G4CA 3CXCM 4PKDB 1JKHA 4WU2A 1VRUA 4FW2A 1T8EA 4CTAB 1UFLA 3NAIA 3AHPA 2E1ZA 3HSGA 1TKDA 3Q8SB 1AW0A 3EKUA 1JJ2R 4BE0A 4I1TA 3AQOA 1W2IA 4ELTA 3L95X 4HR2A 2MKHA 1QZ6A 2A0FB 3THPA 4DCOB 5LJ5Y 2DIVA 5E84A 4MDAA 4FJGA 1HBOB 4K43A 1FKOB 1IM6A 2MQMA 5B0FA 1UW9A 3R7BB 2JFDA 2VG5A 4M41A 4OKKA 3F0NA 4WF9Q 2RQCA 3OTOK 3TABA 1WUUA 1QHAA 3QDKA 4ELUA 2HRYA 4UQGA 4LF5J 2PFDA 2L48A 1SCJB 3T6JA 1QY7A 4E1MA 3SI6A 1RWPB 1XQSC 2WVBA 4QQBA 1EX4A 1WLJA 5GAGU 2KXFA 1F2GA 2ZJPL 1F60B 4DL4A 1VGYA 4J9SA 2MPUA 3TAQA 4P2XA 3SBTA 4AUKA 4O4RA 5F0XA 3SZ2A 2HNYB 2BW7A 1LFWA 1P27B 3QQCD 4GKJF 2ATLA 4BRQA 2O3DA 3G8SA 3H4DA 2ILZA 1GXUA 1JCFA 1LEOA 1WELA 4IG0B 4M7XA 5KFCA 3M5RA 3QRPA 1WB9A 1RWXB 2F4VJ 2JFKA 1BC6A 4G6VB 3IAS9 3KK1B 2XCPA 1WI6A 4USJC 3TP2A 2E1RA 3THXA 4QU6A 2RJZA 4C11A 4B9UA 1AFJA 4KGKA 2HLUA 5HSPA 1Q4RA 3UB5A 1EJ7L 5ETSA 4Z4HA 3LP0A 3U3YA 1H2UX 4JK9A 3SCJE 3D45A 4YB1P 2FVSA 2YWFA 3QERA 4MJKA 2FF6A 1HLWA 4A8MP 2ZH5A 5A2QU 2XMMA 4FLWA 3PYDA 5CCLA 1G3OA 1NK0A 5AJ3F 4FLVA 4DR2J 4UOHA 4ECUA 1RJJA 3QSIA 1V5IB 2W9AA 3L4BC 2UXDJ 2VFRA 2WB4A 4DU8A 4DV1J 4DTXA 2KN4A 3UN5A 5IXUA 3CTRA 3ET6A 3PM9A 1N34J 1P9YA 3C15A 1Q86O 5CYJA 4CH7A 1YJ7A 5DDQC 5EVZA 1W2BM 3BPDA 1LXNA 1U02A 4HWIA 2HYIB 3ITHA 4HUGA 4WFAQ 3PVXA 1WSFA 3L7PA 3UPFA 1IBLJ 2W01A 1LWXA 3RBDA 4C7QA 1U1OA 4MLEA 3GFXA 1PGZA 2J7KA 3KLHB 2A6OA 1RTIA 3CIPA 4OVLA 4F36A 2VWKA 4RW7B 4IYQA 3Q8UA 4P2MA 3CMAN 2QSFA 1FWKA 4H8KA 1NGGA 5CHIA 1ASUA 4JI7K 2QLBB 3R8YA 2OPQB 5GADU 3CCQN 3EZ5A 4X4RA 4Q43A 2GHPA 4UOGA 3VQ9A 2XNRA 1X9JA 5AQNA 1B7FA 1E6YA 3UD5A 2QLFB 3DRRA 2GHWA 3NF9A 3MM7A 4HEA9 2DRAA 5FRNA 2CFXA 1CSJA 2QRRA 3M32A 1JL1A 5GADP 5BJRA 5AZJB 1HKAA 5I3UA 2L9WA 3O1BA 1SL0A 4UUXA 1V9OA 1WF1A 4FOEA 3OXGA 2LQ8A 3CDBA 4Q8EA 1UEUA 4RW4A 2AJFE 3MAHA 3ENWA 3LWLA 2NUUG 1HR0F 3M2UA 3C6UB 4URGA 1RWMB 2B9YA 2MDAA 4X64K 3PR4A 3AB4B 4U6PA 3EWGA 3E01B 1OSDA 4WK3A 1QVFR 1IBKJ 3J81j 2I38A 2FVQA 3SCKE 1YAGA 3DU5A 1S72N 3PSIA 3FBCA 5FJ4A 5JJBA 3FGVA 2FJWA 1CJVB 2A2DA 4EEYA 3WNHA 5C42A 4Y3CA 3SCIE 2KYXA 5DM6L 3CMEN 3T1YF 4EMDA 2YKAA 5HQMA 4DPYA 1HKBA 2V50A 4FF1A 2ATCB 1HPZA 1JLAA 1PIEA 5H9FK 1S0OA 5B09A 4JI2F 4CH1A 2HWTA 5BXIA 2HHXA 5KG5A 4B9NA 3LAMA 3T5JA 3TX0A 1DRZA 5G4DA 2B4JA 4XH4A 1UJ5A 3TTDA 3OD2A 3DLGA 5DZ7A 4WCEL 2E9ZA 2DD8S 1BE4A 5AQXA 3TUPA 2V0NA 1Q79A 1RZMA 2XWYA 4OX8A 3HK2A 1N32K 1FRXA 1BU6O 2OMOA 4OYIA 3KKSA 4M7YA 4C8OA 5KGXA 3ZX3A 4NMXA 2QTWA 4MMOA 2XMJA 2I5JA 2DFEA 3O9RA 2QWLA 1V6HA 3OJSA 4FS1A 4KI6A 1HNZF 2QT7A 3CYMA 4ZPVR 2CIMA 1ZBIA 1RBTA 2RE1A 4ZPWR 3MTJA 4O8KA 3Q7BA 2OPSB 2DCLA 2K1RA 4KSEB 2V2VA 2OPPB 3D1OA 5IQQA 2R2SA 3VN5A 1FX2A 3OY9A 3BDEA 2M2BA 2ZGZA 3H3NO 4O3NA 4CJ3A 4FZZA 4WKRA 3QT5A 2GMJA 3EKSA 1PC5A 4J7CA 1O8BA 3CVKA 5F8LA 4FXWA 3ILLA 4GKJJ 1QAYA 5L1KA 3E9LA 4S0MA 4BLGA 1RI7A 1YZ7A 1Y0HA 3KG4A 4WQ5A 1VSKA 3HO1A 2HQ3A 4R25A 2XZTB 1C2PA 2IVYA 5GIOA 3RMBA 1ZTWA 3R3LA 4FJ5A 1RT4B 2UXCF 5DDOC 5JVGL 1RLDA 2CUYA 3BF4A 2VBYA 1T94A 3E8OA 1LXJA 4L3QA 1HBNB 4CH0S 4F4WA 1PG5B 4PYAA 5C2CA 2Y0SD 4K8ZA 4PG8A 4EFHA 3VQDA 2HGMA 4DX6A 4WP9A 4AHSA 4FL9A 2CQGA 1BO5O 3VQ4A 1VQPS 3SMZA 3JTPA 2KTQA 3WC0A 3J7YU 3O9QA 2B0GA 1NCLA 3MHYA 1OYEA 4OX9K 1ZBHA 2CNNB 4KIAA 2YKPA 3NAHA 2PMHA 4LQ3A 1OPIA 3J7YP 2HBRB 2WCXA 1X1PA 3I0SB 2QLJB 2CPXA 4CF0A 3QINA 3G25A 3MMAA 5B0BA 2DNPA 4M3XA 1DQ8A 2W4PA 4BQZA 4LF6F 2MZSA 4DUTA 1VQ5S 2P5GA 1OWXA 2XM3A 5CR4A 1C0UB 4DL3A 2ZH9A 3R5CA 3IG1A 1U26A 2M5YA 3H98A 2V8DA 5DM6Q 4CWBA 1B9DA 4YR3A 2YNFA 2JX2A 4QZVB 1JCEA 3DOKB 3TR8A 4KHRA 3CIZA 3WXIA 5M1NA 4DUYK 3OYIA 2P9LA 3C2PA 2YWGA 4KRWA 2HFOA 2E7VA 2HBZB 1LK7A 5LOQA 4B1UB 4O5FA 3P1GA 3W60A 2UUBK 2FF3B 3JAMY 4NO7A 1A7GE 4LIRA 3MM9B 2I7NA 4F3QA 4JKGA 2N4DA 4NRUA 4WE1B 4H4KC 3J7Z5 4A5AA 3U7JA 3QT6A 2PA3A 2LXIA 1RWWB 3THWA 3NGKA 2Z1IA 2KJVA 1JKHB 3CD6S 4BDYA 1VRUB 1FT8A 5H9EK 1D3WA 4C8KA 1D9DA 3H25A 3ENBA 4K4ZA 2HBMA 1X8DA 4MK8A 1CJKA 5ETMA 3NH0A 2V4RA 3H5SA 3H40A 2B3TB 3AY0A 3ETOA 1DURA 3N4WA 1GXLA 1F5AA 2XI2A 4JHDA 1WDTA 1M90T 1SUQA 1HR0J 3GSDA 1CQNA 4X62K 2VG5B 3KK3A 4KV8A 2DKOB 1VSHA 4LF4K 2IDEA 4RLEA 3AVCA 1LQ9A 4RR5A 2D7SA 4DDFA 2OYQA 2HHHK 3LM2A 4IO9L 3SAGA 2HWHA 4J9KA 1QAIA 1KVIA 1KQSM 3THTA 1P6TA 2PT0A 3HYFA 3WQPA 2NNWA 3TTCA 4M3TA 2OEMA 3NKYA 4YDDB 4ZJQA 3KHRA 2KM8C 2X7IA 3J7AN 3T1YJ 3T1HF 1Y64A 2J0XA 1RK8A 2W4DA 4DTOA 4BDPA 5JVGQ 3MUMP 1SVDA 4OHZA 1UP1A 4JI2J 3UWTA 2HOEA 3IBWA 3DDNA 1NM1A 3N9UC 3TYTA 2HIQA 3SQ4A 4QOZB 1T9XA 1R0BG 4P7TA 1X5OA 4CEEA 2QZ8A 2N7YA 2BA9A 2VFTA 2G9OA 3S6EA 4BDZA 3ZTRA 3CC7N 3BF1A 2EG1A 2H51B 4BC3A 2JNJA 4FK4A 2LA4A 4Z4EA 1AUSL 3THXB 4F25A 1B4SA 2EI5A 2R8JA 4C11B 1VQ8N 4NXNF 3ZX0A 2RHKA 4OZLA 3LP0B 2YX6A 2E9TA 3ZNJ1 2VDIA 1VQOS 5C0YA 1T9VA 4OPHA 5HO4A 3QESA 4QIFA 3ADAC 1HNVA 5GMKa 3OFEA 4LFCJ 4BRHA 3GYNA 1HNZJ 1SZ2A 1RBAA 4R79A 5THWA 4CK3A 4B3MJ 3G10A 3DDKA 3EN9A 1PKUA 2YI1A 3N6LA 4Z4FA 4CFCA 2EHGA 2HWIA 4N8OA 1IM4A 2DXEA 1EKEA 1IG9A 4URQU 2YVSA 3G86A 3GQCA 4YR2A 3IBFB 2RUSA 4J9RA 2X74A 3ET6B 3C15B 2GJ2A 5ETQA 3UNYA 1S59A 2AHOB 1RBOB 4AHVA 2BJEA 4FS2A 3W0LA 3GR1A 3BO2A 4KHPK 4IFVA 2FGCA 1XHXA 1X7VA 4WFBL 4DV0F 4E8UA 4HTIA 2HZVA 2BE9B 3MF5A 1EIYB 3SV4A 5SUHA 4KQZA 3ITHB 2UXCJ 2HQDA 1WTFA 1JJ2M 3O4WA 4FF4A 2QA4G 4K7QA 1QUVA 2V2QA 1WSJA 3CO0P 1W25A 2O01C 1RTIB 5IT0A 1VBKA 2XNQA 1FHTA 1EB0A 5CZXA 4KHNA 4F0HA 3GDQA 5BR8F 4PKGA 2AEFA 4ZPDA 3IWLA 3D2FA 1T9WA 4N77A 5K8PA 2XLIA 1A5XA 2UVRA 2VPYB 1KVBA 1HMVA 2NS1B 1W26A 1BQNA 3F9KA 3DXMA 3CCVS 1E6YB 2KW4A 1EAYC 3DRRB 4L8RB 3MM7B 1RHUB 5HI7A 1H7XA 2QWMA 4FZXC 3M32B 4CFDA 3OR1A 3SEOA 2IFXA 5I3UB 4WQ4C 4CVNE 4A2AA 3I55N 4RNHA 4IO9Q 2P2CB 4C0HA 3BZKA 4QBUA 1S7HA 3PY8A 4MAKA 2OUGA 4RW4B 3MN7A 3KK7A 3M2UB 3J8AA 2G8UA 5IWAK 1U1KA 2HK2A 2X1FA 1OO0B 2E2NA 3ZZZA 3TZYA 3R1LA 2WHOA 5LXYA 2CJAA 1VQLS 4TVAB 2ZEJA 4YOEA 4M63C 3CQ8A 4ED6A 3VF4A 4KREA 4ZN3A 1RA6A 2AW0A 3KHHA 2VFVA 3QMLA 4LF7K 4CF2A 3QGPA 2F8SA 1RHRB 3MXJA 4A61A 1QD1A 5C42B 2JH3A 5KT5A 2FHOB 4E7IA 5F8GA 2CQPA 1FRHA 1GXTA 2GA7A 4PA1A 2P5VA 3JAMO 4WZQA 3FGUA 4GO7X 2FBXA 1HPZB 4L74A 1JLAB 5LMUF 3PV8A 1GFWB 5KFTA 3OHAA 2IA6A 5JMVA 2MKSA 2LXUA 2JWKA 2BYCA 1JLFA 4U8VA 4CBXA 3EMTA 5KFLA 1DAXA 1Y5NB 2LEAA 2ZH4A 4LRFA 1U6ZA 5HMZA 4NA3A 3PKMA 4AM7A 1WSHA 1RBLA 3VAHA 3L3UA 3J7ZT 3DLGB 4ZPBA 3VQ8A 4H5WA 4JI4F 3I4PA 1RAEB 2C2EA 1C1AA 2QK9A 2RH3A 2E88A 4ZP8A 3W64A 2W7PA 1GOAA 3QO9A 4IOAL 2WBRA 2QA2A 4C4WA 3QB0A 1RBUA 2WONA 2BJ7A 3QRRA 3VQQA 2J5AA 1RAFB 4FLXA 4DOZA 2I5JB 2XS5A 4W98A 4JI3K 2YPZA 2V2KA 4HT7A 3LWMA 3VTIA 3CW2C 3MOJB 4LRDA 3WHIA 4M94A 4Q45A 3GYGA 5I3QA 3I32A 3RBEA 4CESA 4HACA 1TL4A 4GKKK 3HP6A 2A3JA 2K1RB 2QGFB 4C3MA 3T1HJ 4KHSA 5E2QA 2LQ9A 1TKXA 2FVCA 4ECXA 3P4IA 4ZLNA 4YOYA 4FPRA 1BHLA 4XPEA 3OQ2A 3BSCA 4CLWA 4DQIA 2XB2D 2BACA 2AWZA 2Z30B 2G1DA 2Q1NA 2ACYA 5F8IA 3MPVA 3R6LB 4WYLA 2DBBA 3QWUA 2HF3A 5KPZA 5CYMA 2A1BA 3AFGA 2EC0A 3IMXA 2XO6A 4YY3F 2DRBA 2PDAA 4H5RA 1FJ7A 1TK0A 3BV8A 4V1Ak 4GV3A 3K5MA 4NXNJ 1RT6A 2QA4S 2NXCA 3BGFA 3O08A 2K2PA 4IZ9A 3IRWP 2D9PA 3DGVA 2R8KA 3W9JA 1F5CA 1NB7A 4TU9A 4IRCA 1U0HA 1T9UA 3F9MA 4NEYA 4DV7K 2RNEA 4DR1J 4OYBA 3CPWM 5A76A 4OGEA 2VQFK 4NYFA 3DLBA 4WFNQ 1KOHA 2NREA 5FPEA 1RQ0A 1XI1A 2H54B 2ZUAA 4DZ6A 4ECTA 3DDIA 3NS5A 4K0KF 3LQVA 4B3TJ 2A18A 3UDVA 2VBXA 4OFZA 3OL8A 1YT3A 3MMAB 4FBUA 2Q36A 2O5DA 3WIUA 1RHJB 4R0JA 5EHHA 3J7AP 2WFBA 3V6HA 1HBUA 4Q44A 1N48A 1X4EA 2HHTA 2GW8A 1MMNA 2AIRB 3DRPA 1G2EA 3IG1B 3M8QA 2DNKA 1SH2A 1DKGD 5F8JA 3JAMU 4HHHA 1RLCL 2R7XA 2MEWA 2YNFB 4ZIVA 2PYLA 3ZTSA 4DV4K 5HP1A 2OLWA 4EUVA 3B78A 1Q82T 3RRGA 5BR8J 4HDGA 1Z05A 2I8EA 4ZOSA 1YRXA 2NZCA 4CZFA 4JKAA 3KLIA 1J5OA 2MHNA 2YKOA 5B08A 4JKGB 2DY1A 4DR6K 2ZBIA 1OY8A 4YS2A 4U8YA 2EWSA 3MN9A 3VTHA 4DV6K 2JVOA 3THWB 5HROA 2YWHA 4AILC 1NMDA 4KJIA 4M5GA 4ID5A 1U8SA 3HSZA 2MYFA 1R6YA 4FVCA 2XMTA 3J81Y 1ZA2B 3TARA 3M6UA 4IOAQ 2RSQA 1FXXA 1CJKB 2JC0A 4PZVA 1UEKA 4A59A 1N33K 4IEIA 1U2FA 4TN2A 3H7HB 1VC5A 4JHDB 1TL3A 2Y0BB 3QSYB 5EX0A 1N56A 1SUQB 2ZH7A 3CM6A 3AA2A 1UA0A 3L2QA 5IC6B 3HRGA 5DLFA 1Q1KA 3KK3B 4BR5A 4JYAK 4CFBA 2DO0A 4Y6IA 4KV8B 4LRBA 1WTBA 1XEZA 4IBNA 5AFUH 4FJIA 1XC3A 2PA8D 1CQMA 3NRBA 4O0JA 2BV3A 2FY8A 3AO5A 4F0MA 4CDIA 3C19A 1QE1A 2DNZA 3K2PA 1WD6A 4ED8A 1EKRA 2BXJA 1LNQA 5J2NA 4KH4A 4ES2A 3PYFA 2DHGA 4B3SF 4LFAJ 3UE5A 3OYCA 4DR7F 3D2WA 5SWMA 1HUXA 5LMUJ 3R6MA 2Q66A 4OZNA 3EDRB 3R5AA 2DPNA 1U1LA 3V81A 2HHVA 1X0FA 1F0XA 3CJ8A 2YNIA 1BI4A 3SDEA 2WSFC 3HHEA 5BPMA 4X4PA 1KS2A 3VQCA 3O8MA 4Z7YA 4JI4J 1FNMA 2LQ5A 4MIBA 2FXUA 3DKDA 3RTVA 2BJDA 3FSXA 4FXVA 4OHYA 3CCJS 3CDUA 4OL8A 3C6AA 4U95A 4PPDA 4IOCQ 2HHSA 4LSLA 2ZDPA 1HNVB 4LF9F 3EVMA 4WKYA 2PBDA 5AQHA 1NSKL 4USMA 2CQDA 1S1TA 2KHDA 1CXQA 4OLPA 2OZSA 1TU0B 4H0XB 4DMZA 3SBGA 1DGKN 3EJMA 3H46O 3AD9C 3LL3A 2XMWA 1GLLO 4X4UA 4EZ9A 4L76A 4FPBA 2I9SA 1IJEB 3A2FA 3RMCA 1WWHA 4TU8A 1VQ7S 4CEZA 1TV6A 3MX5A 3Q7CA 4JI0K 5DGBA 1C1CA 2ADBA 2PN6A 2BRKA 2KI2A 4YOWA 1NJXA 4QYZJ 1M1KT 3AA9A 4RUBA 2AYGA 3ZZYA 2KQ2A 5DG7A 1TUVA 1S76D 3CCEN 3MD3A 1S6QA 2C28A 4K4VA 2BMBA 4YEAA 4YY3J 4TY9A 1T6CA 4EYHB 3I33A 2AJ2A 3EVOA 1XC9A 3WZ0A 3M8RA 3VQPA 4RX6A 2GFFA 3OYBA 1NGAA 4A8QA 3FEYB 1RT1A 1FEHA 2LFVA 3D2FB 4LF1A 4LRCA 4QWDA 3K5OA 2DNYA 2AGPA 5J2MB 3GFHA 4HH1A 1X31C 5EX5A 1BQNB 4NCBA 4RW8A 3DXMB 2MHEA 3MURP 4K0KJ 4BRPA 2ASMA 3N79A 4DF8A 4JKFA 1S6PA 3GP9A 4Z4CA 1WI8A 3FDSA 5AQQA 3OR1B 1CJUB 4CLKA 1SJRA 3QT8A 2NRXA 3W62A 3IUCA 5AQOA 4KI4A 1RABB 3I6PA 1WAFA 2ZHBA 1SH3A 4DR3J 1VOMA 2NLWA 1UVIA 2HW3A 1HI8A 1M5KC 3FQKA 1PAUB 3SCLE 3GYXB 3KTQA 3SLCA 1T3VA 4QWBA 4OHVA 1Z26A 4EBEA 2PYJA 2FBVA 5ETLA 2F9TA 3VQAA 3QGIA 2E5IA 3GIIA 4CJLA 4PPZA 1DQ9A 5BN8A 3BF3A 2E8AA 4WQ4A 5M2UA 3EEQA 2VU5A 1N0UA 4K4SA 2E1PA 3OSNA 3VF6A 3JSBA 4KE5A 2AYMA 3EDQB 4LFBF 2X1GA 4L75A 4TXSA 4Z2XA 4XH5A 4K50A 1U1NA 2ZM6F 4F50A 1S10A 3O80A 1VLOA 3UNGC 2E7WA 5BYRA 3CCSN 3BR9A 4ANEA 1HBMA 1KDNA 4UF4A 2HVZA 1JLFB 2YTCA 2R3VA 2QX0A 2EBGA 4M63A 3KYLA 2B4PA 1NZ8A 3J81O 2ZNYA 1QTNB 4NLYA 4LSZB 2CZ4A 1U24A 3BB5A 1TR0A 2DEJA 2Y1LB 3QPIA 1S1VA 4CBUA 4OI3A 2FSJA 1DTTA 2NZTA 4B3RF 2G8IA 2XSFA 1V3SA 1YTYA 4O3PA 5IV3A 4C6AA 5KFUA 3NL0A 5DQGA 3QO9B 1TKZA 4W5TA 1CULA 4ECYA 1C4CA 3CPEA 2WONB 6AT1B 5L38A 1VQKS 2A6MA 4AHTA 3ICLA 3QAEA 4BRMA 1TMJA 5K8OA 5KGWA 2COLA 5AJ3K 3HFZB 4XEIA 4J2AA 2CYYA 4RUHA 4FYVB 2G8WA 3MCNA 3ZZUA 1NPPA 3DRXA 2HQCA 4ZDNA 1NK7A 4PWWA 2RQ4A 1MDUB 4JI5K 4B3SJ 4HACB 4DR7J 2BANA 2QXFA 4NEZA 3AVGA 4HTJA 4P72A 3QZ8A 2PD1A 1TKXB 1OH8A 4NZ7A 1UA1A 2POKA 4P6QA 2R7RA 5HOOA 1BWVA 1RTHA 2DITA 2CKWA 1NOYA 2C3UA 4OYAA 4G1IA 4I64A 2HAFA 2Q6BA 4FKXA 4NA1A 1XMBA 3AD8C 1NNEA 4C8NA 5ETOA 5M1OA 1PCAA 5CYMB 1EX8A 1S6OA 4EBDA 3V9SA 1DZ5A 1RE1B 5TKYA 4ISEA 4BS2A 1UWAA 4JI6J 1RT6B 4BRAA 3SJHA 3TRGA 3TUJC 2VG6A 1N36K 2ITMA 3K5NA 4LF9J 1U0HB 4GY2B 3E1YA 1ASVA 2CQHA 4YOUA 3P83D 3H8YA 1V4TA 1V4SA 5KQDA 3NOCA 3FEXB 1KAZA 1G7CB 4LR7A 4J5OA 1I51B 1LW2B 2P9IA 3HXMA 1NLVA 2V8VA 2JEFA 3LGNA 3NS6A 1FFGB 2HZAA 1RXOB 4EYIB 1C0MA 2Z2MA 4Q2LA 3NY0A 2W25A 3IWNC 2WVEA 4H4MA 4FBTA 4DU3A 3A8KA 2E5JA 3P5JA 4M95A 4NXMF 2P9EA 4B9LA 3MWPA 3CDAA 1HBUB 3VF2A 2R7OA 2Q31A 1KEKA 4XAKA 1JIHA 4FJHA 1E3MA 1FTCA 3I82A 4OHWA 5KQ8A 1N52B 3RMDA 3DRPB 3M8QB 1HRHA 4EZ6A 1SH0A 1R59O 4PY5A 2JDJA 2GO8A 2XY6A 2BDPA 2KT2A 5FLXY 3AO1A 2P51A 5HP1B 1BA1A 4CGHA 2M4MA 2GO9A 4EBCA 1C0FA 3CDEA 4NLUA 4CLLA 5J1PA 1UVKA 2YJFA 3T1YK 1BD6A 3KLIB 1ZYQA 3OYLA 3ISNC 3MCAB 4MYUA 3J81U 3OFFA 4CJVA 4GW6A 3PUFA 2BQUA 2RKIA 3QRQA 4E19A 4JV5F 3MCSA 5HROB 2N4CA 3GE9A 4KH6A 4ID5B 4CHYA 5HL7L 2O4IA 1FNOA 4BRLA 3HT0A 4AXIA 2W8KA 2J0WA 1D09B 1O51A 3UO0A 4CM2A 4I9LA 4KPYA 3KOAA 2DEIA 2F1FA 3MXHP 2CPDA 1RDWX 1RCHA 4CLPA 1S79A 2OPRA 3PJWA 1YJNS 3CB4A 4LF8F 4BC7A 1TL3B 3MWBA 4I68A 1Q7YT 4O55A 1F3VA 4IWVA 3FBBA 1L3SA 4ZMMA 2CPJA 3CJSA 1RT3A 4BR9A 4JP8A 1YX2A 4G9ZA 3SSSA 3ENHA 3HVWA 1UEVA 2DISA 1UPPA 4PG5A 2OSQA 1HNWK 2R8HA 2AEJA 4RL1A 2JEIA 3M8ZA 2UUAF 3V4MA 1GK8A 4CT8A 2WVFA 5J2NB 4DTPA 3VQTA 4YHHJ 4DL6A 2Q3PA 1Q0NA 2VKRA 2BQRA 3GBTA 5F9LA 3AARA 1WNSA 2ZWPA 3U27A 5GADI 4DG1A 1KR4A 4O4GA 1X9MA 4OJHA 1D5AA 1FDNA 3V81B 2QM1A 3Q8QB 2OTLS 2Q3SA 4O44A 3V9WA 1K9MO 4DPWA 2YNIB 3EGNA 2I7PA 1BI4B 4DN0A 2GMLA 2GV1A 3SDEB 4CYUA 3KKFA 2ZH6A 2WTUA 2V7ZA 4CGGA 2C2DA 1KNZA 5LSLA 3J7A1 1WSVA 4QR1A 4V19S 5KFFA 3A5OC 4B3RJ 4C3KA 5C2DA 5KFZA 4O5BA 4DR4F 5ELZA 1U6BA 2W41A 4A8XA 1X3MA 4X4OA 5A8RA 5HVHA 1WBDA 3CDWA 1ZM3A 1W7AA 2GZOA 1WF0A 5HATA 6FDRA 1QSLA 2R8IA 1YJ9N 4LSLB 3NLCA 1KHVA 1WKJA 2VPZB 2W4CA 1VQNN 4BR2A 1QHTA 3Q22A 2M3DA 4O3QA 1JXLA 5C2FA 1S1TB 3HTVA 4CO3A 1WSIA 1S5ZA 1BOTO 1WOQA 7AT1B 5HJXA 4I6MA 1RACB 3GE1A 4TLQA 4DR5F 3W8GA 4GNIA 3HI9A 4JB8B 1U1QA 4NRTA 1TV6B 4LF6K 5KRSA 4BBYA 4ID1A 2HVEA 4USHA 3IGNA 4AXJA 5JS2A 5HJYA 1S9EB 1YJWS 5MLCV 3VENA 1FJGK 1UZHA 3PZPA 2G8VA 4RPFA 1HYVA 1S6QB 5CD4H 3HX9A 1T9TA 1I94K 4WFZA 5C24B 1L3TA 2YNGA 3D54A 4IXCA 3D4JA 4FJXA 1KLMA 3W2WA 5F3ZA 1RUSA 3LGHA 2E9RX 4USUA 3MCMA 4TU7A 4OI0A 2IMOA 3CULA 2J4RA 2RDJA 1RT1B 2ZJQQ 4P73A 4HVJA 5I4MA 3B6BA 4CF8A 5LY3A 2CNKB 2N3LA 3NE6A 4RW8B 1B64A 1NGFA 2W42A 1XWLA 1JXEA 4C8YA 3M9OB 1MMDA 2VIHA 1S6PB 2N3OA 1HL6A 1B0PA 1PAEX 3P49B 4KO0A 3TPQA 4JD2A 4Y1CA 2MKYA 4JI8F 1D1UA 2Y3YA 4DPXA 4I6WA 4BR7A 4OJGA 4I2PA 2IDLA 2QJ3A 1GLEG 4IH7A 3HVTA 4DX5A 4AQYK 1F1BB 1XMOF 1UVLA 4X4VA 3CCRS 3LW5C 4K59A 4OZ2A 1WHWA 3IR5B 2ZWHA 1ASWA 2L08A 5L1IA 3CCMS 2FJDB 1QVGR 1BWEA 3P39A 1KP6A 4IFYA 1P8GA 3KHLA 1ZOTA 1T9YA 5FLXO 3HF5A 3ULHA 3AD7C 1Q95G 2GX8A 3KLFA 3SMPA 2R7VA 4JI1F 3T1HK 5ADZA 1S97A 3OYNA 1XMQK 2AZ3A 2CQ3A 5HBMA 2WW4A 5F0WA 3GIMA 2NUBA 1S77D 4ATNA 1K6YA 5BRHA 5LMNJ 2QC3A 1RISA 3TVZA 2XG8A 5J2QA 4P52A 1EHWA 3AVHA 1X3NA 5M2RA 1NHKL 2QL5B 4XDCA 2RIJA 1HBMB 4BACA 4DV3K 3D68A 1L3VA 3A8YA 3CC2N 2ZVIA 4PG6A 2FUG9 1NH8A 4ECWA 5D78A 1DT9A 4NB4A 2CRLA 4P74A 4F3TA 5KFVA 1S1VB 5CHCB 5CABA 1DTTB 3G71S 3HZ6A 5JLHA 4DLEA 3ENVA 5GAEP 4OI2A 5L9NA 2D41A 3GV5B 2WC9A 3CJ7A 3LAKA 1TQLA 3PX0A 1NEEA 1AFIA 2QEXS 1TKZB 4HDHA 1CULB 2AEMA 4MH8A 2NLXA 1UZDA 4F4ZA 2OELA 4Z0UA 5LSOA 2UUAJ 2PIIA 4WZMA 1KSPA 2QN6B 3H6EA 5GMEA 5CD4A 4WXOA 3VA3A 1X5SA 4I9QA 4QAGA 4M8LA 2EX3A 3CFPA 2KT3A 4QWCA 5LSRA 5HK4A 2BANB 1YIJS 3KUHA 3QEPA 2P6TA 2Q1LA 4DCPB 2E6MA 2FB0A 3AY9A 1Q7LB 1VQSA 1R8CA 4JV1A 1YHQN 3ILIA 1KLNA 3ZTQA 1RTHB 1SIZA 4DV0K 1IQTA 3OYKA 1GLAG 1M5OC 2ZH1A 3KXDA 2KG1A 1QDUB 3D3CJ 4U67Q 5TKWA 1AUDA 3AJ1A 1UPMB 2JLEA 4ANDA 1S0MA 2D3OR 2IM0A 1FKAF 3OTBA 2HGLA 4DR4J 4OLAA 3VGMA 2I0XA 2VH7A 3NH2A 3QEWA 2HEKA 1NHUA 4QOTA 3NGRA 2CWKA 4CHOA 2VG6B 1K8AO 4FWSA 1VQPN 3FE1A 3J7ZO 2GMHA 2HBYB 1E4GT 1Y3KA 2D0OA 1LAWA 3PTWA 1ATRA 3IRXB 2EWHA 3ZSRA 1PJ5A 2GIFA 4BCAA 3UD3P 1X60A 2E4LA 3DLEA 1Q18A 3ZTOA 2P9IB 2V7YA 4AH9A 4CHNA 2QG9B 4E7LA 4JAXA 3NXZA 2GJIA 4N47A 5AQJA 1EKSA 1SAZA 1Z25A 4FJ8A 1XNQF 5AQYA 1VQ5N 3RAMA 4H4MB 1FEEA 4ETXA 1FFSB 4RO0A 4WBFA 5FLXU 5G0RA 4H4OA 4FVMA 1OYDA 3MMBA 4CJEA 1MA9B 2RDIA 2LECA 1YBAA 2IVMA 3NBPA 3LGMA 1Q81T 3MZIA 3E2EA 5HQLA 2HPUA 4H03B 2VBWA 4W5NA 4CJPA 4ECVA 1BISA 4L6V3 2QYGA 3I0RA 2E5LF 2U2FA 1DHMA 4RNMA 1YITN 4A8KA 1UETA 2GVZA 3S8SA 5M1KA 4G1QA 3A3NB 2P9KA 4KH0B 3EXYA 2XGPA 3QFHA 3BH7B 3JS6A 3QIOA 2RKIB 2G2YA 4FP9A 1RFQA 1BIUA 2NZ4A 1B92A 4PABA 2C2RA 2UUCF 4FNIA 4OYOA 1NK8A 2J9EA 2B5JB 4KTZA 4FPAA 4ALZA 2V8PA 2J9DA 4ZVPB 2FLPA 2ZD1A 1NH7A 2NYIA 6FD1A 4CGDA 1WEYA 4OLOA 2LDIA 2CQ2A 3PRBA 2APOA 4J2DA 4W5QA 4CGFA 4A2BA 1XMOJ 3EZUA 1FW6A 1PBAA 4AHUA 2AF6A 3H59A 1DBDA 3OYMA 1RT3B 2AJ0A 1HARA 2D69A 4N56A 4C2MA 4QR2A 2XY7A 5T41A 1WEXA 1VSMA 3JS9A 4Y1DA 3GPAA 2R7QA 5A2QY 1ZAWA 3OFHA 3SYZA 4RW6A 1FDDA 3CMAS 4H0TB 3OYDA 3PRDA 3KDOA 4RUAA 1X4CA 1LW0A 4CO0A 4MTPA 4JI1J 3Q8PB 1RWUA 3HL8A 3BS9A 2DGXA 5L9XA 2CPHA 4DG1B 2YX4A 4YP3A 4O4GB 1QLNA 1PSDA 4EO6A 1K1QA 4RBVA 1Q82O 2OFHX 2G0CA 4O44B 1W97L 4CYUB 4UQTA 1KC8O 4RW7A 2DXDA 3UD4P 2E7XA 4Z7CA 2BX6A 3GZ7A 3OW2M 3PG9A 3VZIA 2MZJA 3HZGA 1VBZA 3FCVA 1QUPA 3G96A 2G4BA 3RGIA 1WEZA 3S1TA 3VEOA 4F7VA 3HBTA 1WC6A 3NCIA 1VQON 3H2LA 4X65K 3RB6A 4DFMA 1AB8A 2Z0GA 4D3HA 1RSCA 1NJYA 4FLUA 1S72S 2GX9A 3HP9A 5AZJA 3VEYA 5GMDA 2AJ4A 1NZAA 1GTEA 2R7SA 2VQEK 1BWFO 4I6MB 1VJQA 3NS7B 4PXDA 4C8MA 1N8RT 4NLPA 4CK1A 3CD7A 1SPBP 2MKCA 4K4WA 4NLVA 2YWEA 3FZHA 2DB1A 3B54A 3TTFA 3N28A 3A1YG 4CJKA 4IQXA 3ZFVA 3GV8B 3IA0A 2ZOMA 2XEXA 4CERA 1ZPVA 3FMWA 3OBIA 1RWNB 1NBWA 1FDBA 3G4SS 3UQSA 2JLGA 3AVLA 5LJVA 1WHYA 3GG4A 3O3GA 3E9PA 4H0YB 4WP8A 1Q78A 1RAIB 2M8DB 2Z2ZA 3R97A 4DQRA 4CIOA 1ZTTA 3HSJA 4CT9A 2YNGB 5MLCQ 3MUVP 1ZS6A 4X66K 1QAJA 5HQ8A 2EEYA 2OP5A 1IWGA 4Q2MA 1KLMB 3W2WB 8RUCA 3HT3A 5E7OB 2EXUA 5B0CA 4NLCA 1YBTA 3WBZA 5KFOA 2QIFA 1RDDA 5CYQA 3PFOA 2JOQA 1IG8A 4KGZB 2DNNA 3QIPA 4KT0C 2QMUB 1IVZA 3EE8A 2BOAA 3CCVN 2CZ9A 3UDEA 4LBHA 4UZCA 3C95A 1VQMN 1SJQA 2KFNA 3TUIC 3O1WA 4DV5F 3DHXA 1TKTA 3MEKA 4KO0B 2DPJA 5AE3A 2IM1A 1YXQA 2X3GA 2XYPB 2LEBA 3KNGA 1XNQJ 4JD2B 5KT7A 4P2FA 2XMAA 3S9HA 4I2PB 4CP5A 1EETA 2R8GA 3BGRA 2UXBJ 4PKHA 4H0PA 4WQ5C 4ISFA 4OMFG 2YQ3A 4RUCA 2DXFA 4B9QA 5DDPC 3LP3A 1VQLN 3RBXA 4WXWA 3RW7A 1ZBFA 2B7BB 3AXMA 3QIDA 2ADCA 3F2KA 1SC3B 2UXDF 2Q79A 2HNDA 2WTFA 1T11A 4CRJA 3TSUA 1Y4ZB 4Q5VA 4ZVRB 4YFUA 2HFSA 3CT9A 1HIYA 1S1WA 5JUMA 3O4QA 1U25A 3O3HA 1LK5A 1X0PA 3EGWB 5HBMB 4FF3A 2MLYA 3RAQA 3ATUA 2DR8A 3OS0A 4J37A 2CWXA 2HKEA 4QWEA 5J2QB 2FLLA 2UUCJ 2H1YA 5KFEA 3ZEUA 4O23A 4CJ7A 2VL1A 5B0EA 4E2FB 4YNQA 1HBNA 2KKHA 4ZVUB 1TK5A 5CQGA 2FTRA 1VBYA 3TAEA 3BQ2A 3OS1A 4KB0A 4E7KA 4EFAC 3QT7A 1LOTB 2ASYA 3D6RA 3IC1A 5CAAA 4U7UK 1U49A 4JK7A 1S49A 3L0QA 4Z4IA 3C94A 4Y2AA 4LF9K 1MW7A 1KN6A 5J1EA 3ETMA 1VS3A 2ALZA 4WJBA 2D3UA 2FJAB 4CHQA 4PRFA 1ITPA 3AXKA 5CA5A 2AYEA 1RBVA 5B8HA 3BBFA 4JI7F 1RAHB 5JVHQ 3M30A 2YJEA 2CQIA 2VGNA 5IFMA 2DR5A 2ZJRQ 2J0QD 1Z4UA 5ADXH 3GFYA 1QZ5A 2E6LA 2CPIA 3S3OA 1K0TA 1J5EK 1WDDA 4RKUC 5HVGA 3P5TL 3CWJA 3LPTA 3K17A 3D0IE 4BWJA 3TQEA 1FESA 3DMJA 4JKDA 3UN2A 2MQQA 3LDQA 2MSTA 1V3RA 2MQLA 3OYJA 4E7HA 4QU7A 3QATA 3GU0A 4B8AB 4ZCMA 2JLFA 3AVAA 4NE9C 2RRNA 3VVUA 1UVNA 1F5BA 3M1FA 5ETTA 1QQNA 3O5BA 1AXQA 1RTDB 2AZ1A 3D5MA 4DL7A 3OVBA 5RUBA 2QA4N 4X64F 9RUBA 2EKYA 8AT1B 1MWMA 2KO1A 3V1QA 1Q86T 4FN5A 1CXUA 3K7RA 2VKZG