2VG6A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
550
structure length
548
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 131
structure length 548
sequence length 550
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg6A05
4URSA 5DLGA 1TKXA 3H2LA 2XGQA 3OYHA 4FCYA 2Y1JA 4TY8A 4QOZB 4I9LA 2HVHA 3DRPA 4AHRA 2EX3A 3LP1A 3NBPA 1SKWA 1UAXA 3LAKA 4CGJA 4IBNA 2RKIA 2JEIA 2B43A 1VSHA 3H5UA 3QGIA 2IJFA 2E9RX 2J6TA 2HNYA 1ZYQA 3V9UA 1DTQA 3C6UA 5F8HA 2IM3A 5HLFB 3KHRA 3U6FA 4QWDA 4BDZA 1NK9A 1S9EB 4ED8A 2D41A 4C8KA 1KHVA 3CYMA 4JV0A 4IFVA 2W8KA 4Z4EA 4KHUA 1I3AA 1TL1A 1DLOA 4FLWA 2GV9A 1FKPB 4YR0A 2KZMA 3LP3A 3D5MA 3TQ1A 1WAFA 5KRSA 4G1QA 3SV3A 3VQ8A 4MH8A 1KVCA 5J2PB 3SZ2A 3QYYA 3CIZA 1QTMA 3HO1A 2YKMB 4FK4A 4NCGB 3CJ3A 4W5QA 3ULDA 1VRUB 1MU2B 1NK7A 4ELVA 1WSIA 1S10A 1D5AA 1IKYA 1G15A 3TABA 1EXQA 1KFDA 3WNFA 3PW0A 1KLMB 1JLEA 2FC0A 1IH7A 3RWUA 3NF7A 3AVCA 4IRKA 4E19A 3Q8PB 5CYQB 1IKVB 3OSNA 3RB0A 3QIPA 1J5OA 3NGYA 2R8KA 2BE2B 4HCCA 5J2PA 1NKBA 3F73A 1C1AA 1EP4B 3K57A 1CSJA 3B6OA 4R5PA 3KLFB 3CJ2A 2G8KA 3RAQA 2YKMA 4NCGA 2A1RA 2X6SA 3H08A 3HPGA 2D7SA 4YR2A 1VRUA 5HRRA 1LWCB 2V9WA 1BIZA 3AVAA 1Q9YA 4LSNA 1EKEA 1W25A 4K4XA 2HHVA 2F96A 3L2VA 1WSHA 4KB0A 4DU4A 4HUEA 4YP3A 3G6YA 3QIDA 4Y3CA 3G6VA 4KHRA 1A5XA 4W5NA 1HQUA 5J2MA 2YKNB 2R2TA 5FRMA 3IN5A 1RT3B 2B4JA 4NLTA 3MR2A 3H40A 3SQ4A 4EBEA 2QV6A 4K4ZA 4HHTA 5HRPA 4RNFA 4DTOA 4M3RA 1KRPA 4JUZA 3HT3A 2OPRB 4QWAA 4IG3A 4DEZA 5KFFA 1IKWA 3QEPA 4ZVGA 1RT4B 4J9OA 3ZSXA 1LWCA 3K2PA 3JYTB 4ZP9A 5CYMB 2VG6B 1C6VA 1NJYA 3CM5A 4BE2A 1CZ9A 1MMLA 1TK8A 1I6JA 4ZVFA 3CDEA 3GIMA 1YTAA 2G8VA 4LH5A 4BACA 3OL7A 3CJ4A 1NK5A 3E01B 4DFKA 2IAJB 4GW6A 3ZSOA 2O4GA 4OKEA 3V81A 2JEFA 4CEAA 3OYKA 2AX1A 2R7YA 3V1QA 1L3VA 3DOLB 4K4UA 4DL2A 4RNMA 4FBUA 5KGWA 5FRNA 1LWFA 4KHQA 1RT5B 3HVTA 2R8HA 5KFDA 1VSIA 5D3GA 5KG0A 3QO9A 4EZ6A 4XIUA 4O3NA 5C5JA 3KK3B 4Q43A 3EPIA 3MEEB 4IQXA 1CXQA 3SI6A 5CYMA 2KTQA 2VA3A 4RW7B 3MECA 3IRXA 1U48A 4ZP8A 4EP5A 5J2NB 3KLEA 4YQWA 4F4XA 2OA8A 1U04A 1Q8IA 3EY1A 4CEDA 3KTQA 4KHNA 4RG8A 4YFUA 1NOYA 4CHOA 1RILA 4M41A 3DDKA 4AHSA 4C8OA 4WZQA 1S4FA 1NHUA 4KO0A 1U49A 3O4QA 5KG5A 5KFGA 4CJWA 1JLBB 1BQMB 4O44A 4WE1B 1JLQB 1RTDA 1SUQA 3TR8A 2XCPA 4MQ3A 4OPKA 2BANA 4Y1DA 4AHVA 4M42A 2IMWP 4KV8B 4DS4A 1TV6A 4KTWA 4XO0A 3MEEA 2C22A 3N6LA 5KFVA 4H4MB 3T5JA 2W9BA 2FBVA 1RDDA 1RT7A 4PWDB 1BQNB 4Y34A 1KCFA 1WSGA 4KHMA 1TP7A 3H5SA 3CFRA 5CY4A 2AWZA 2YNHB 4I7FB 2WONB 4I2QA 2KW4A 2OZSA 4CGIA 4DSEA 3V4IA 4J9MA 4CGFA 2HW3A 1J53A 3BREA 4M3YA 2YNGB 4KFBA 1SH0A 3QGGA 4URGA 3SPZA 1RCHA 4EO8A 5HRSA 3RAXA 4CJFA 1I39A 4CFAA 3NGZA 1RTIA 1XR6A 2DPJA 3P5JA 4ECVA 3LP0B 4CFCA 4PQUA 5KFYA 3QNOA 4NLPA 5KFWA 2OPSB 2JC0A 3DRSB 3ZSZA 3NE6A 4NLGA 2AX0A 1TKTB 4O4RA 4NYZA 3V6JA 3PZPA 5CZ1A 3OYJA 5DG8A 4DSFA 4ZPDA 2YNIA 3KJVB 4ED6A 4KTZA 4DTNA 4M3ZA 2C2RA 1JLAB 3NMAA 4RW6B 2PYJA 3K5NA 1VRTA 1QSYA 3V1RA 2P1JA 2HAIA 2PYLA 3OS0A 1JX4A 2R8GA 2XI3A 4DSJA 2PZSA 1TK5A 3L2QA 1IO2A 3GILA 2XY8A 3NF8A 4OKJA 4E7IA 3AV9A 1T7PA 3HVAA 2QXFA 4FJ9A 1UA0A 2OH2A 1ZETA 2XGPA 3N6MA 1HNVA 3QEXA 4B3OB 3V6KA 1R0AA 4R8UB 3I8DA 4Z4CA 3NH2A 1RT1A 3NGDA 1GOAA 3OS1A 3PVXA 4KKOA 1DTTB 4FZYA 4ECYA 4ED7A 4CJTA 3RR8A 2P5OA 5I42B 4AH9A 3TANA 3KLGB 4KHYA 4LY7A 1Z26A 4DLEA 3GV7B 1C0UB 3BSNA 3ZT4A 4DQSA 5HP1A 1S48A 4IOBA 2IOCA 2VWJA 3L2RA 3I5BA 4NLYA 4MFBA 3CM6A 4BWJA 3T5LA 4ID5A 3AO4A 5T14A 3Q8SB 5L1KA 3CDUA 3MEGB 4DSKA 4F50A 2DFHA 3KD1E 3OYIA 3NAIA 4B3OA 1QSLA 4R8UA 4KB7A 1S6PA 5C42A 4B9TA 4IFYB 3CWJA 3AVGA 4ECUA 2Z1HA 4B8CA 1SKRA 4O3OA 1XHXA 1DTTA 3SQ2A 1RT2A 2IBKA 1WN7A 1S6QA 3V6DA 1JLCA 1J54A 3SFUA 3QIOA 5DQIA 4Q45A 3RMCA 4DTPA 3PX4A 4ZMMA 3DMJB 4FJXA 3VQDA 1TL3B 4FS1A 5SZTA 1HJRA 4QCLA 4RUCA 2C2EA 1BCMA 4FM2A 3SYZA 3DI6A 2HHXA 4Y1CA 1W9HA 3THVA 3TARA 2FBXA 3KOAA 2QE5A 3VN5A 2ZE2B 3ZT3A 4M3WA 1S5JA 3SQ0A 3O3FA 3KLIB 3KIOA 3RRHA 3FFIB 2DFEA 1FKOB 4J9LA 5KFAA 4KRFA 3PR5B 2BGGA 5DK5A 3JSMB 3G0ZA 3M8QA 1BCOA 5EWGA 3MR5A 4NRTA 4FXDA 3OJSA 4RW8B 5KT4A 4JLHA 2AGQA 3G10A 1WNEA 3DRRB 3VA0A 1RAJA 4DL6A 1X9MA 3AVHA 2HHWA 1HMVB 3BQ0A 2GBZA 1TKXB 3NGIA 4ECZA 4TY8B 1J9AA 4ZPBA 3DRPB 3TAQA 3LP1B 3PO5A 3NBPB 3K58A 4ID1A 4M3TA 3IG1A 3PO4A 5F8JA 3HP6A 3MF5A 2KFNA 2RKIB 1BGXT 2VWKA 3K5OA 1SL2A 5L1IA 2HNYB 1BHLA 1DTQB 3C6UB 3ALYA 3DM2A 4K8XA 2XC9A 3PJWA 3SPYA 4CK1A 4FJHA 1SH2A 4B9SA 4LSLA 2OPPA 3FRZA 1T3NA 4NRUA 4TQSA 4NYFA 1T05A 4IFVB 1QS4A 1TL1B 1DLOB 3V1OA 3KK1A 4CHZA 5C24A 5EWFA 4W5OA 3SFGA 3OYLA 3H98A 4CJEA 2D3UA 4G1QB 1JL2A 3VQSA 2F8TA 3HPOA 4HUFA 1RA7A 4OVLA 1LWEA 4LD0A 4F4ZA 3VQ9A 4Z4GA 3OYBA 3TAEA 2FJVA 3M8PA 2W7PA 4ED1A 3AVKA 4OJRA 4CFDA 2G8HA 2XY5A 3PW5A 5E41A 4QPXA 1RBUA 2X78A 4MKBA 3AA5X 1IKYB 3UR0A 1VSDA 2Z1IA 4DLGA 3KNAA 2ILZA 3K5MA 4I9QA 2FVCA 4IH5A 3OL8A 1JLEB 4CEZA 1U47A 2BQUA 3SUOA 4ZVHA 1D9FA 3ICLA 3M8SA 5EU7A 3RMDA 4CJ3A 4MK8A 2IM2A 4ZPAA 1S1TA 3MR6A 1RA6A 3DLRA 3EPGA 3KHLA 3VQPA 3QIPB 2RN2A 1J5OB 3G86A 4DTRA 3OLAA 4TSXA 3BSOA 4Q44A 4PUOA 4ECXA 4DL3A 1XI1A 2X74A 4R5PB 2FLPA 1Q9XA 3VQ6A 4DQRA 2B5JA 2ZD1A 4Y2AA 1BI4A 4CJLA 4BDPA 1HYZA 3T3FA 3I0SA 2IS3A 4GC6A 3KHHA 1KTQA 4ELTA 4DQPA 4M3XA 3GIKA 1VSMA 4AHUA 4KAIA 4LSNB 4FK2A 2FBYA 3BJYA 3MXJA 1XHZA 4OL8A 4IKAA 1ITGA 1HQUB 2IA6A 4DU1A 5J2MB 4LH4A 5KFTA 1S49A 1S0MA 1SH3A 1RYRA 2ASJA 3VQAA 5F9NA 3OLBA 4B8AB 3OL9A 1UA1A 4JS5A 4FJNA 3AVBA 4O3RA 3FQLA 3BGRA 4IG3B 3A2FA 1IKWB 2ASLA 3LPTA 3HK2A 5JUMA 2RPIA 4CJVA 1S9GA 4O3SA 5C25A 2VG7A 5EWEA 1ASVA 4OPJA 3B6PA 5JS2A 3OYAA 4CJSA 3OL6A 3V6HA 2V0NA 3V81B 4J9KA 4HKQA 4Z4IA 1U45A 4EYIB 1B9DA 3CQ8A 3BSCA 4BE0A 4DU3A 4OGEA 3LANA 1XR5A 3SCXA 1RBVA 5FDLA 1TGOA 1LWFB 3OYDA 1C2PA 3ZT2A 3M9MB 3LDSA 3CVKA 3HVTB 2UUTA 5I3UA 1JKHA 5EDWA 5KT7A 5D3GB 4CCHA 3T1AA 3QO9B 2FVSA 4IG0A 3LZJA 3MFIA 5JS1A 4BWMA 3M8RA 2KZZA 2I1RA 4OKKA 4FLZA 4DTXA 3QEIA 3MECB 3IRXB 4NCBA 3KLEB 3FSIA 4KI6A 3DYAA 1W0HA 3NF6A 4DS5A 3PX6A 4LQ9A 3EYZA 4W5TA 3PR4A 5KG3A 3K5LA 3VQQA 3GIJA 1OS5A 4KO0B 4DTUA 3RBDA 3DLKA 4J2AA 2KQ2A 4CECA 4NLRA 4DFJA 4BDYA 2RF2A 1C1CA 3NAEA 2VA2A 4O44B 1RTDB 4CIFA 1A5VA 1SUQB 4QWEA 3F9KA 2BANB 3O3GA 1KVAA 4E7JA 4FLVA 4TN2A 4EZ9A 2JEGA 3OYFA 4RW4A 1TV6B 3ZT0A 2W9BB 5J1EA 1RT7B 3VQ5A 4C8LA 4FYDA 2GIQA 1RBRA 5KTQA 2HB5A 1S9FA 4X2BA 3HSTB 4QWBA 3VQ4A 3AVIA 4FJGA 3KHGA 2CJQA 5KFSA 4I2QB 3DOKA 3V4IB 3KLHA 2FVPA 2XO7A 1RDBA 4HUGA 5HROB 1QHTA 4TQRA 4FS2A 2QKBA 4KFBB 1S1XA 2ITGA 2WK4A 2ZQBA 1FXXA 4CEQA 2ILYA 2Y1IA 4E0DA 3VA3A 3ISNC 4FJIA 3ZSRA 3H4DA 1B92A 1RTIB 2WOMA 2YNFA 4F4WA 4QWCA 3V9SA 4O0IA 3D45A 4IKFA 3OSPA 4PQUB 3QETA 2FJXA 1T8EA 3AVJA 3TAGA 1QQCA 1A5WA 1O1WA 1N6QA 1QUVA 3KKRA 4ICLA 1YT3A 2P5GA 2YNIB 1QSSA 4GVMA 4B9LA 1X1PA 1HPZA 3DLEA 5HROA 5F8NA 1HYVA 3VQBA 4NLQA 5HBMA 4YMEA 3AO1A 5J2QA 4KBIA 3UPFA 5KFEA 1HYSA 1VRTB 3S3NA 1JL1A 5KG7A 3ISND 3L2WA 2XWYA 3BQ1A 4DG1A 4F8RA 4DSLA 4WYLA 1S1UB 3I0RA 4WFXA 3T5KA 4Q5VA 4F3TA 3MEDA 2HWIA 4H54A 2IJNA 4EBDA 4RU9A 1HNVB 4DFPA 1TAUA 1R0AB 3WNEA 3SV4A 2JGUA 1RT1B 1WSJA 3PW4A 3HVWA 2ATLA 4KKOB 4FJKA 2HHTA 4DWIA 2BQ3A 4FJ7A 4CE9A 1QE1A 3ITHA 2J6UA 1B9FA 4IDKB 2B6AA 2E9TA 5CZ2A 2D0AA 1FK9A 2FJWA 2D0BA 4IRDA 3AA3A 4O4GA 4H4OA 1TVRA 1NK8A 5HP1B 3O3HA 4FBTA 3HVRA 3QLHB 2OPQA 5KT2A 2AQ4A 4MFBB 1IG9A 3PJXA 1S1UA 4ID5B 4ZHRA 2GC8A 4URQU 3NFAA 3QINA 4N47A 1K1QA 3AO2A 3ZT1A 2QKKA 4C8NA 1S6PB 5C42B 4Y2CA 4B9MA 4FZZA 1IKXA 3AVMA 1S1WA 1LAVA 3SUPA 1RT2B 1D9DA 1S6QB 4CESA 3V6DB 3WNHA 2WB4A 4J9SA 1JLCB 4IDKA 4B9VA 1JLGA 1HRHA 2XCAA 1NOZA 1KFSA 2AGOA 3SUQA 4OLBA 5K14A 4RNHA 4TYAA 1RDAA 4NLWA 5DGAA 4O3QA 3QLHA 1VSFA 3DI6B 3MR3A 3SI8A 2W9CA 1YVUA 3VQEA 4TY9A 4EYHB 3PW2A 2BDPA 2W7OA 3QEVA 3HHKA 4WFYA 4AHTA 1ZBLA 5KT3A 1LV5A 3M8QB 3H4BA 1RDRA 4DTSA 1HQEA 4FJ8A 2V4QA 2ASDA 3C95A 4ED2A 1ZBIA 4ZP6A 5KG4A 1D8YA 4CK3A 4OLAA 4FW2A 3LWLA 2D3ZA 3VQCA 2IC3A 2O5DA 3IG1B 4WFZA 2FVQA 3ZSYA 2KFZA 1GX5A 3KMQA 1NK4A 3P1GA 3OYNA 4DL4A 3QESA 5F9LA 4B9UA 4G3IA 4Q0BA 3NF9A 4CHNA 2IM0A 3RB3A 3LP2A 4KREA 2FVRA 1CZBA 3GYNA 1YVFA 3GIIA 3T19A 3DM2B 4DQQA 5EUHA 2FBTA 4YNQA 5KFLA 2W8LA 3C6TA 2A1SA 4LSLB 3UIQA 4ZP7A 2OPPB 2JEJA 1T05B 1LW0B 4PA1A 3KK1B 5C24B 2BRKA 3S3MA 3RMBA 3CO9A 4LQ3A 3KKSA 5L1JA 1LWEB 1EETA 3IS9A 3V9XA 3U3YA 1YTUA 2G8FA 4NLUA 3M8PB 5KFNA 1ZTTA 1RBTA 2IM1A 4CJUA 2YHAA 4N41A 3SJJA 1LW2A 5DQGA 3L8BA 1TKZA 4H8KA 3FQKA 1WSFA 1GX6A 1TKDA 1N48A 1K6YA 3PV8A 1BL3A 3KK2A 5L9XA 2E6MA 1LW0A 3UQSA 3M9NB 2HNZA 1TK0A 4CERA 2OYQA 5F8MA 4IR9A 3AVFA 1S1TB 1ASUA 3DLGA 1TQLA 1UWBA 1U4BA 1ZTWA 2Q3SA 2IDOA 3S9HA 1RT6A 4J2EA 1UOCA 1RTJA 4PUOB 5KFZA 1SV5A 1QAJA 4NLDA 2B5JB 2ZD1B 3H5XA 1BI4B 4Z0UA 3I0SB 1N5YA 4KAZA 5KT5A 1HNIA 4E1MA 2GUIA 4E1NA 1REVA 4M3UA 1RTHA 4FK0A 4IH6A 3ZSWA 2D5RA 5JXSA 3D0PA 4KHWA 4FVMA 4CEEA 4UQGA 4JS4A 3MTKA 4CJRA 5KFXA 4RW9A 4DF8A 4J9QA 1S0OA 4NLXA 1JLFA 4MKAA 1T03A 3LAMA 1VSJA 1T94A 2XHBA 4NLVA 4XPCA 3MFHA 2WRMA 5KFJA 3BGRB 5L1LA 5DGBA 4TYBA 3RBEA 3HYFA 2Z1GA 5KG6A 4MIBA 1ZBHA 1S9GB 3E51A 1C1BB 4RUAA 5C25B 1HARA 3I5CA 2VG7B 2V4RA 2G8WA 4C8MA 2R2UA 3EZUA 5HLFA 1SKSA 4CEBA 3GV5B 3LWMA 1S9EA 5FDLB 4CEFA 3N6NA 5KI6A 4KI4A 1LAWA 2XI2A 3HM9A 5I3UB 2LSNA 3PUFA 3OHBA 2DFFA 1JKHB 3RMAA 4QW9A 2QK9A 4U7CA 4CF1A 3AA2A 5KFUA 4IG0B 4FJMA 4HVJA 1WLJA 1FKPA 4K4SA 4CFBA 3L3UA 2HHQA 1NJXA 4JV1A 4E7LA 1S97A 1C1BA 2FLLA 4IR1A 3DYAB 4JV2A 2FLNA 3VQ7A 3ZCMA 3IGVA 4CHPA 2C2DA 3OY9A 2E9ZA 1MU2A 4M94A 1N56A 3DLKB 2NUBA 1RBSA 2RF2B 1C1CB 3QNNA 4U6PA 4E7KA 4K4VA 1IM4A 1KLMA 4RNOA 4J9PA 4RZRA 4GMJB 2WCXA 4HCBA 4N76A 2AGPA 4CK2A 3OVNA 1VSLA 5KFIA 4DQIA 1ZBUA 4RW4B 4N5SA 5DG9A 5CYQA 4M45A 1IKVA 1EX4A 3QERA 4DF4A 5J1EB 5F8LA 4F4KA 2BE2A 2G8IA 3ZSVA 3CDWA 4ZTJA 1EP4A 1RNHA 3KLFA 3BSAA 3QZ8A 2R2SA 3OYEA 4JRQA 2O4IA 1SL1A 3DOKB 4CJ5A 3FDSA 3KLHB 5KG2A 4CJ4A 2ZKUA 1U09A 3PX0A 4CHQA 2EC0A 1C0TB 4DTJA 1N4LA 1S1XB 1SL0A 3OJUA 4GC7A 2D0CA 2E4LA 1L3SA 2RDIA 2C28A 2YKNA 3AVNA 4EEYA 4RNNA 1RT3A 2WOMB 2YNFB 3ZSQA 2BQRA 4QW8A 1WNSA 3L2UA 4FLYA 3AO5A 4K4TA 4DFMA 3MXIA 4EBCA 3QZ7A 4KB1A 4ZPCA 3NHGA 5KRTA 1N6QB 3HP9A 4FZXC 2OPRA 2ATQA 4CGGA 1Y97A 4ICLB 1Z25A 4FJLA 2F8EX 1RT4A 1NJZA 5KFRA 4E7HA 4CF9A 1HPZB 3JYTA 2XRIA 3DLEB 3V9WA 4ED3A 4MK9A 2VG6A 4ECTA 1C0TA 5HBMB 5J2QB 2AJQA 3IAYA 4KTQA 1HYSB 2DPIA 2ETJA 3E01A 3HL8A 2IAJA 4J2BA 5F8GA 3RR7A 5KFPA 1ASWA 4ELUA 3AVLA 4DG1B 4O5BA 1NK6A 4O55A 3DOLA 3I0RB 1NKEA 4Q8FA 3MEDB 2UVUA 1RT5A 4BE1A 3Q8QB 5KFHA 2G8UA 4E89A 4KE5A 1KHWA 1KVBA 3M9OB 4FJJA 3KK3A 4KPYA 1QE1B 3ITHB 3DLBA 3QEWA 2DTUA 2UVWA 2B6AB 3KMSA 4RW7A 1D0EA 4W5RA 3BQ2A 5J2NA 4HTUA 1FK9B 4E3SA 4CEOA 4J9NA 3TWHA 3SNNA 4WYWA 3AO3A 4O4GB 4H4OB 1KLNA 4FM1A 3C94A 3MAQA 1JIHA 1TVRB 1QAIA 3G6XA 3NH1A 2OPQB 1L3UA 2W9AA 1K1SA 3TI0A 3I5AA 2YHBA 3LPUA 1JLBA 2XY7A 4ZHRB 3RB4A 1BQMA 3NL0A 4WE1A 3HKWA 1JLQA 4ZTFA 3CFPA 2DY4A 3SUNA 3NH0A 1IKXB 1S1WB 4KV8A 4AILC 3PY8A 3TAPA 4ECWA 2I5JB 2JLEA 4H4MA 2CKWA 5SWMA 1BISA 4IH7A 1JLGB 4FLXA 4PWDA 2UUWA 4DSIA 4Z4HA 1BQNA 1Z4UA 5K14B 3CJ0A 1NK0A 5DQHA 4CF8A 2P51A 4O0JA 2YNHA 4I7FA 2WTFA 3BDPA 1TAQA 2WONA 2AU0A 3K59A 4YR3A 3LZIA 4HYKA 1CXUA 4ECSA 4K4WA 2W9CB 2YNGA 3P83D 2YV0X 5F8IA 4WXOA 3GV8B 3V9ZA 2Z1JA 2GIRA 4AHCA 4IRCA 1S1VB 2PY5A 2EHGA 3O4NA 1XC9A 2ALZA 1NJWA 1HQEB 3S3OA 4ECQA 3RRGA 2UVRA 3OYCA 2I5JA 4CF0A 5FROA 3DLHA 3LP0A 4CGHA 1C0MA 4CJKA 4B08A 1VSKA 1L3TA 2BRLA 4DTMA 4CF2A 2OPSA 3DRSA 1BIUA 3AA4A 1JXEA 1TKTA 2IC3B 1S0NA 4NZ0A 1RYSA 4N56A 3KJVA 2IGIA 1GOBA 4Q0BB 3RTVA 3HJFA 5KFKA 3LP2B 1JLAA 3HPHA 4RW6A 3NAHA 1S1VA 3TAFA 3HXMA 4KSEB 5HRNA 4DL5A 4CJQA 3D28A 4PY5A 4M95A 1X9SA 2R8IA 4J9RA 3C6TB 3T5HA 3WNGA 5KFQA 3CG7A 4ECRA 2HMIB 5DLFA 2WHOA 1RDCA 3OHAA 2XY6A 1D1UA 5DG7A 2HHSA 4DL7A 4FJ5A 4KHSA 1JXBA 3ASMA 3SQ1A 3PHEA 2BR0A 5KFCA 3IGNA 1EETB 3IS9B 1WSEA 5KGXA 4O3PA 5I42A 3NDKA 2R2RA 3KLGA 1ZBFA 4ZVEA 2VG5B 4QAGA 4CJPA 3KLVA 4NLSA 2UVVA 4I2PB 4WXWA 2OZMA 1C0UA 1LW2B 1KSPA 3RB6A 4CIGA 4F3OA 4MK7A 1TKZB 1XWLA 1F21A 3LALA 4ED0A 3TAMB 4F4YA 4CHYA 5DMRA 3Q8RB 4NYNA 1VK0A 3NKYA 2RDJA 3KK2B 4Q8EA 2HMIA 4K8ZA 4K50A 3MEGA 4FLTA 3QGHA 3H5YA 2HNZB 5KFOA 2HNDB 3L3VA 4OGCA 4NCAA 4IFYA 4B9NA 4NLOA 4EP4A 4MIAA 3PW7A 1NNDA 4DMNA 4J2DA 4EO6A 3DLGB 3GQCA 4CIEA 1UWBB 3TVKA 3OYMA 3EZ5A 4R0EA 5KT6A 3MXMA 4F2RA 1RT6B 4TLRA 2W42A 1NKCA 4FLUA 1CLQA 1RTJB 3UDLA 3NCIA 1SV5B 1NHVA 2R8JA 1X9WA 3H59A 1L5UA 2F8SA 5KFMA 2VG5A 3U3GA 4I2PA 3DMJA 4K4YA 3BR9A 1N5YB 1TL3A 1HNIB 4FM0A 3KD5E 2E6LA 1JXLA 1REVB 1WAJA 1RTHB 2JC1A 3CJ5A 3TAMA 2X6NA 2HWHA 3CFOA 1GOCA 2ZE2A 3OYGA 5KG1A 1XR7A 3KLIA 2HHUA 3FFIA 4WZMA 2J6SA 4L8RB 4F2SA 1FKOA 4Z4FA 2HNDA 4RW9B 3JSMA 5T7BA 2HVIA 5KFBA 4TXSA 3OS2A 4XPEA 4RW8A 4JRPA 3DRRA 1JLFB 4CGDA 1T03B 1VSEA 4FW1A 1HMVA
chains in the Genus database with same CATH superfamily
4URSA 5DLGA 2XGQA 4P10A 2Y1JA 2O3DA 4TY8A 4BROA 1VHIA 3NBPA 3W3SA 2J7UA 1G4CA 1KS2A 1VIOA 3UDEA 2RKIA 2B43A 4Z7CA 3QMQA 5JICA 1VSHA 3H5UA 2HS4A 5AQMA 4YHHF 2WVCA 2ZOFA 5B09A 4KPCA 4EGLA 3V9UA 1DTQA 2EK1A 3C6UA 2BW2A 2KKHA 5HLFB 4JI0J 3T6JA 3U6FA 5AXNA 4BDZA 2VPYB 1RB0A 1S77D 2G4BA 4YB1P 3CYMA 5A8WA 4PRFA 1WC3A 4Z4EA 1IBKJ 4KHUA 3BO4A 1TL1A 2DJWA 4FWPA 1YZ6A 3D5MA 4Y00A 3UN5A 2C3OA 3CMAS 2XEXA 1HW8A 5J2PB 1QTMA 2EPIA 4Y0FA 3T7ZA 2PIIA 3W60A 2GVDB 3SMPA 3G71N 5EN1A 3B78A 1D5AA 5CZVA 3M8YA 3OV7A 1Q7YT 1EXQA 1KFDA 4IYQA 4DV0F 4BRDA 1RAFB 5DM7L 1NU4A 2CIMA 2BOPA 2FC0A 3SAHA 1WEYA 1TL4A 1G3OA 3AVCA 3CJBA 5AJ3K 5BREA 3EZWA 5THWA 1S12A 5K5MA 5J2PA 1Y5IB 3K57A 3DRYA 3R9PA 1GLFO 3H08A 4YR2A 4FYXB 1LWCB 2GVDA 2H3EB 3ENQA 1BIZA 3NGUA 3AVAA 5HVGA 1IQTA 3ENWA 1KVJA 2HHVA 3ZZYA 4I64A 1WSHA 2QC3A 4KB0A 3QIDA 4KHRA 1A5XA 1HQUA 5I9EB 5J2MA 1U2CA 3C0BA 5FRMA 1SKUB 2AEFA 3H40A 4USUA 5E33A 2O8FA 4HHTA 2VL1A 4YY3K 1OVQA 3IR6B 1CG2A 4ZVSB 4J90A 3D2FA 2RDDA 1CS4B 2CGKA 3IKMA 2IA0A 4JI3K 1LWCA 1VC6A 3K2PA 3Q2TC 5HANA 3ID6A 1FFSB 1NJYA 4PYDA 3D1QA 4KGMA 3ETOA 4LH5A 1VQ9N 3OL7A 4LF8J 3QSYB 4H0PA 1J6ZA 2IAJB 3AD9C 4GW6A 2L48A 3ZSOA 4OX9F 2JEFA 2H1YA 1OPIA 3OYKA 2AX1A 2HURA 4AFFA 4NB4A 4OQJA 3C46A 3TR5A 4QIGA 1LWFA 1F1BB 4HEA9 3HVTA 2FHMA 5LSRA 1VSIA 5D3GA 5KG0A 1HI0P 2NREA 3QO9A 4EZ6A 2VQFK 5LL6Z 4K2JA 4PABA 1U1QA 4IQXA 2ZKTA 2KTQA 1VJWA 1N34F 3KLEA 3HLUA 2OA8A 3KTQA 4RG8A 4HH0A 4K0KF 2GMJA 4W4MA 2Y0SD 4AQYK 2WW4A 5GAGU 5GMEA 1M5OC 4AHSA 4KO0A 5ADXA 3N5BA 4O44A 1KVKA 4IZ9A 1KBRA 4DV2K 3TUJC 5AQTA 4KV8B 4DS4A 1O0PA 1RAEB 4HHJA 5F2RA 1V4TA 5KFVA 3T5JA 4WFBL 3JXOA 4CO2A 1HWIA 3TJ9A 4Y34A 5HL7Q 2KM8B 3K17A 5CY4A 3PG9A 1RTZA 1WKJA 4I7FB 2QA4S 2QA1A 2HLUA 3M5RA 3C6HA 1HNZK 4E2FB 2L41A 2IPOB 1J53A 1AT1B 3BREA 2E44A 1KEKA 4KFBA 3THYA 3H1VX 2C3YA 1ROFA 4EO8A 3CTRA 3ZC4A 3QATA 1VK3A 2HF4A 3MEKA 3O9QA 3DXKA 2B3TB 1T3OA 1E6YB 5LM7E 2DEJA 3KNGA 4ECVA 3ZTSA 3E3XA 4CFCA 1QTNB 1D09B 1F9FA 1IV0A 1RE1B 5CZXA 2OPSB 2WBRA 3ZSZA 3NE6A 1FRHA 4O4RA 2R7RA 5FPDA 5CZ1A 3QB0A 3SCKE 3KJVB 4ED6A 1VQ6N 4YB7A 2LQJA 4ZCMA 2FSNA 4KTZA 2OFHX 2KRBA 1RLDA 1JLAB 3NMAA 4BR9A 2R7OA 2QTWA 3Q89A 3N5FA 1K8KB 1QSYA 3FZHA 5A2QU 1HLWA 3OBYA 1HBMB 3V1RA 2P1JA 1WJ9A 3NLCA 4JI8J 4OHYA 3TYTA 2XI3A 2KJVA 4WCEL 4DSJA 2MLYA 5AQGA 1E6YA 1IO2A 3GILA 3NF8A 1WG4A 4OKJA 2K1RA 3UN3A 2NR0A 5EX5A 1ZETA 4C1NI 1R0AA 5DS7A 4Z4CA 3CCVS 1RT1A 2P8IA 1TELA 5M1FA 5A2QO 3HSDA 3D6MB 2Q79A 3EZOA 4DR4F 1S0VA 1RHQB 3ZZTA 2ZH8A 3W9JA 2DR5A 1XMQF 1M90O 5I42B 1IG8A 4ZLPA 4AH9A 1U0HA 1ZM3A 5L8RC 3G6EN 3FMWA 1HBMA 1Q5VA 1APSA 2VWJA 3L2RA 3TSUA 3DNCA 2YWEA 2L3MA 2QLXA 4LSZB 2K7KA 4WQ5A 3T5LA 1AYEA 3SBTA 5LMNJ 3HD2A 5L1KA 4DV3K 4F50A 2DFHA 2Q31A 3KD1E 3MCNA 3C3LA 3NAIA 1S6PA 1YRTA 4IFYB 4QR2A 4GV3A 1SKRA 1NBEB 4O3OA 4EMDA 1XHXA 1Y0HA 2IBKA 1WN7A 4QU6A 3V6DA 4PG5A 1XBWA 3PNIA 2VQEK 3EKSA 5DQIA 4Q45A 1PBAA 1UEKA 2RILA 2UXCK 4FJXA 1RCXB 3TTFA 1CLFA 4RUCA 2C2EA 2C2OB 3DI6A 4Y1CA 3TARA 2ZE2B 1V3SA 1AW0A 3O3FA 3KIOA 3FFIB 4W98A 4X65F 1FKOB 4J9LA 5KFAA 3PR5B 5DK5A 3JSMB 4F0MA 1S76D 3CJAA 4QPTA 2O8EB 3AH6A 4NA1A 2LYVA 4FXDA 2V7ZA 4JLHA 2AGQA 1WNEA 4CQ1A 1N33F 3AVHA 2HHWA 1HMVB 2A41A 1TKXB 3GMGA 2QLBB 1K9MT 3O9UA 3NGIA 4A62A 2VUGA 2FHJD 1J9AA 2HBKA 4ZPBA 3DRPB 2IYGA 3TSPA 2Z8QA 4ID1A 3BP8A 1V5IB 3R8YA 1VQLS 1Q81O 3T1YJ 3FR0A 4UW2A 1SL2A 1BD6A 2HNYB 1X4HA 4CDIA 4CIOA 1NGIA 1HA1A 5EHHA 2XC9A 4B1VA 5B7WA 4U7BA 3OR1A 3NS7B 3DHXA 4CT9A 1T3NA 4DR3F 3EX7B 2LEPA 3I31A 2UXBK 4UOHA 3BZQA 4FSVA 1NLKL 3V1OA 1BQXA 5LJWA 5C24A 4W5OA 1YJ9S 3M2UB 2F4VK 2D3UA 4G1QB 2YBVA 3ZETA 3WC2A 4LFBK 3VQ9A 1LWEA 3T69A 3TAEA 2FJVA 4EHTA 2FZGB 3A0IX 2W7PA 2MJUA 3KWGA 2KRRA 2XS7A 1Q16B 2XY5A 2B4OA 4DMZA 4QPXA 2X78A 1NCLA 2XSJA 1N88A 3K5MA 4I9QA 1HD0A 3HD1A 3JS6A 3I6PA 4ZCIA 5G0RB 4Q2MA 4CEZA 2BQUA 1KQFB 5EGYA 3ICLA 2BVZA 2M70A 3Q8YA 4CJ3A 4E1JA 4LRBA 2JJ4D 2CPJA 1S1TA 3VQPA 3QIPB 1WEZA 1J5OB 1HUXA 4ITSA 4PG4A 4DTRA 3OLAA 3BSOA 1JNRB 3CW2C 2FLPA 3UDCA 1QY7A 4DQRA 2ZD1A 4CJLA 3CCTA 3I0SA 3WXMB 4I6AA 4JYAK 1N8RT 2J7KA 3PKMA 4LSNB 1HWLA 1RBAA 2FBYA 4A8MP 2BXJA 3BJYA 1JJ2R 1YI2N 2YX4A 2LXIA 2ZJQL 3W66A 2E1RA 1S0MA 2YKQA 3RSEB 1R27B 1P8ZA 3MN7A 3L4BC 3FCWA 2IVYA 2Z0GA 2GO8A 3UKRA 2BACA 3BGRA 1WBDA 4P2SA 3IFRA 1IKWB 3IA0A 3CCMS 3HK2A 1H7XA 4RUBA 2X7IA 2VDHA 2Z2MA 3HOSA 4O3SA 5C25A 4X66F 2AF6A 2A40A 4CJSA 2BA9A 2EKYA 2E1CA 3V81B 4Z4IA 3FBEA 2BJ8A 3CQ8A 1REGX 2FSKA 4NEZA 2QXLA 2DH9A 2VFVA 2YQ3A 3MMAA 4A8OA 1RBVA 1C2PA 3ZT2A 4DQ8A 1YK9A 3LDSA 2O8BB 3CVKA 1E3MA 2GW8A 3IUCA 4K5SA 2G0IA 2QL5B 3VGTA 3LZJA 1EX8A 4LF4K 4DUZJ 3M8RA 4FLZA 4DTXA 3QEIA 3DU5A 1XNQK 7FDRA 3IRXB 2HMPA 3US5A 5D78A 2GX9A 4O5FA 3IC1A 1W0HA 4DS5A 3Q7BA 2DD8S 3PX6A 2NRZA 4OLPA 1DFDA 2BJ9A 3VQQA 3GIJA 4DTUA 4HI1A 1UVLA 5E3PA 4YHHJ 2ZM6F 1NJIO 4DFJA 2MKJA 2RF2A 3J7YI 2VA2A 2V69A 2J9EA 5LOQA 4LF2A 3ENHA 4B1YB 2JOQA 1V9OA 3JSYA 4Y0WA 1KVAA 1DURA 1TTHB 1UVKA 4RW4A 1YIJS 1KQSM 1EO1A 2W9BB 1XMBA 2CNNB 2YKAA 3R3TA 3P31A 3IO1A 4QYZJ 1EARA 1RBRA 2V34A 1OH6A 2HB5A 2ZZMA 1S9FA 4X2BA 3IAM9 3HSTB 3DXSX 5KOWA 3AVIA 4FJGA 2OLWA 2CJQA 3KHGA 4I2QB 3DOKA 3GU0A 4K7QA 2FVPA 1RDBA 2BKPA 2DHGA 2QKBA 1S1XA 5D4NA 3A3PB 4LF7K 1YITS 4CEQA 1HI8A 3TRGA 1J5EF 3VA3A 5C2DA 3ISNC 2HQDA 1V6HA 4K41A 4DV0J 5AT1B 1R6VA 3H4DA 2ZITA 5BYQA 1RTIB 4F4WA 1OY8A 3L95X 4O0IA 3PRBA 3MM5A 1VQ5S 3OSPA 4IKFA 3W3DA 1OYEA 4X4VA 1O1WA 1N6QA 3KKRA 4ICLA 1RLCL 3QJPA 3AA9A 2E66A 5AQYA 2YNIB 1RAIB 4FDFA 2M7SA 3VGSA 2CQBA 3CXCR 5F8NA 1HYVA 3UPFA 2XNRA 3LA0A 1HYSA 2N4CA 3R97A 4DPUA 2CNKB 5AE3A 2XWYA 3VGKA 2XM3A 1Q8KA 4DSLA 2G9OA 1S1UB 2BYCA 1CZAN 1JJCB 3I96A 4CLFA 5C12A 4USJC 2W4CA 2IJNA 2CZ9A 1SIZA 4O0NA 2RE1A 4JD2B 2DR8A 1WSJA 1DJ0A 3HVWA 3FJ2A 1KKHA 5D4OA 1S4EA 1EZZB 3VAKA 2J0WA 4F26A 2VU5A 2YVSA 2D0AA 4WQ4A 4N7TA 4PYAA 2HBQB 2GGPB 4D3HA 2Q0RA 1TVRA 1NK8A 3A5NC 5HP1B 3O3HA 1U8WA 2HWTA 3QLHB 2OPQA 2GVZA 2FJAB 3H42A 4DCJB 4DR5F 1IG9A 1S1UA 1VYAA 2HHHF 4ZHRA 1XERA 2GC8A 2VBYA 3NFAA 4OX9J 4B3MK 1XK8A 3P4UB 3AO2A 2QKKA 4GO5X 4DKWA 4GKJF 4B9MA 2YWWA 1S1WA 3EVMA 1GNKA 5BR8F 2WVDA 1EHWA 2GHWA 3CDBA 4KH0B 1WELA 4CESA 4JN4A 4J9SA 3PYFA 3JQMA 4JK8A 2F8MA 4MYTA 5B0DA 1RAHB 2WUSA 2I2YA 4NLWA 3D68A 3QLHA 2PEBA 3PJ9A 2ZFHA 4X4PA 4B1XB 3BBBA 4LRDA 4K0KJ 2W7OA 5IWAK 3WT0A 4EU0A 5KT3A 1Q0NA 3M8QB 3VEYA 4V19J 3HI9A 2H65B 1RDRA 1OVYA 4DV7F 5AZJA 3E66A 3IBFB 4RBVA 2DNLA 4M5MA 2GMHA 3D2WA 3VAIA 1D8YA 2R4FA 1OQ6A 3VQCA 1Y7PA 5A76A 2ZJRL 4IO9L 4KH1B 3IG1B 2CNOB 3PEHA 2FVQA 3ZSYA 1GX5A 3P1GA 2P9NA 4G3IA 4CZLA 1QJHA 3B8HA 2IM0A 2FZCB 4C9DA 3R1LA 4MKVA 5M1KA 3SQGA 4KREA 4P71A 3GFYA 4ENOA 2J9DE 1PYSB 4X84A 4H0VB 5KFLA 1BWEA 4LF9J 2DY9A 3C6TA 3U1NA 4LSLB 1RU1A 4YOEA 2OPPB 4GY2B 2E5LF 1T9YA 3MK6A 3WHIA 5L38A 4PPDA 4GO7X 2QA4N 2BMBA 4EK2A 5LJ3Y 3S3MA 1FRXA 1Y64A 1DQ9A 2DY1A 2VPWB 1EETA 2G8FA 3PKYA 2KLAA 5DM6L 1HFEL 1N36F 2IM1A 2HS3A 2AV5A 1LW2A 1RWXB 1TKZA 4BBYA 3WXLA 2HGMA 1HR0F 1GX6A 3ILOA 2F65A 4LR7A 4P7TA 4MMOA 3BEGB 3LOUA 1CVJA 4H5WA 2HHPA 2FUG9 1TK0A 2O8CA 1IR2A 1ASUA 4OPAA 1NSPA 3UKUB 3CJRA 1TYQB 3MDFA 3M32A 1Y00A 3VV2B 1RT6A 4LFCK 1SV5A 1RAOA 5T7LB 3H5XA 4DR4J 5IV4A 1BI4B 4FWOA 4DHYA 1XMQJ 1HNIA 4CEEA 4QOTA 3W5XA 4QIVA 2NCKL 1JCFA 3DXBA 3CCVN 2DGXA 5F0XA 1HBNA 4B3RK 4JI6K 3DHWC 1H38A 2JL9A 4MKAA 1EQ0A 1T03A 1T94A 2W2OP 3M8ZA 1RI7A 2KHOA 3MFHA 5L1LA 2OANA 1HKAA 3W0LA 4CO4A 3RBEA 2YWGA 4FL9A 3TNVA 3UD5A 2PN6A 3G8QA 4DHVA 4DX8H 4DX7A 3I5CA 3L09A 2I0XA 2QIFA 1FCAA 3C15B 1H2TZ 2R2UA 1FWPA 1ZPVA 3G96A 3QBXA 1KAYA 3I9ZA 1XNRK 2D74B 1S9EA 2P9LA 3VERA 1F3FA 4X65J 3HM9A 5I3UB 3P5TL 1JKHB 2YHYA 3OTDA 1YG0A 3CF5Q 4QW9A 4U7CA 1BWVA 4JI5K 4IG0B 3CB4A 2AHOB 3MX5A 1Q78A 2HHQA 2ZUGA 1N33J 4CLPA 1NJXA 2C3MA 2QEXS 4ZA1A 3GG0A 3BF4A 5BYSA 2APOA 4JV2A 2RAQA 2FLNA 3ZCMA 1U6ZA 3D6RA 3IGVA 4PXBA 3OY9A 2CGJA 2COLA 1H3DA 4M94A 3DLKB 2C1EB 3QNNA 1JJ4A 4MJKA 2VB6A 4K4VA 2ROGA 2NLXA 4RZRA 3D4JA 1VBXA 2N3LA 4N76A 2W40A 3EGWB 2J9DA 3OVNA 2EFVA 1JK9B 5KFIA 3H45C 1J2VA 4DR3J 5CYQA 4M45A 1VQLN 5FPEA 3CCUN 2BE2A 5BRFA 3FRYA 2G8IA 3ZSVA 4ZTJA 1EP4A 1PJ5A 1SQFA 4ILJA 3CD6N 1VQKS 2ZBCA 4P75A 3QZ8A 2HK3A 2R2SA 4LC9B 5CAAA 1I94F 2W1BA 3KLHB 5KG2A 2D0PA 1WOOA 1VQMS 2AA4A 2H9ZA 3H6EA 2XMJA 3W9HA 2CA9A 1SL0A 2A6AA 1KD1T 1K8AO 2D0CA 1WDDA 5GINA 2E4LA 1N52B 1HHTP 2RDIA 2F8HA 4JI7J 2BJ7A 2OFGX 1YJ9N 1X5SA 4I69A 1A7GE 1NPPA 3ZX3A 1EWQA 3SBMA 4FLYA 3AO5A 4DFMA 3MXIA 3QAEA 3CNQP 4EBCA 2U2FA 2QWMA 2HSTA 3PFEA 1M1KT 5CHIA 3RZAA 4QIEA 5KRTA 3C66A 3N01A 1RT4A 1NJZA 5KFRA 3RJMB 3CJKA 1Y5NB 3JYTA 1FWLA 1YGYA 2AJQA 4DCHA 5AZIA 4XDDA 3L6QA 2DPIA 3MMCB 3HL8A 2X1BA 4F7VA 2P9KB 5F8GA 1GQEA 4AL6A 1ZOTA 2ZH9A 1ASWA 4B3TK 2DNOA 3AVLA 3ENBA 3QMLA 3F56A 2NXUA 3I0RB 2DPNA 4KBOA 4BE1A 3GLJA 3Q8QB 1WC1A 1NRKA 5KFHA 4E89A 3VF0B 4DN0A 1MWYA 1KHWA 4FJJA 3KK3A 4NI2A 4RW7A 1D0EA 3QDKA 4DPXA 3THXB 4HTUA 4CEOA 4JHDB 3SNNA 1KLNA 4FM1A 5GMDA 2D1CA 4F9OA 2MKHA 2P9KA 1K1SA 3TI0A 5C2GA 4XDCA 1BQMA 3NL0A 4U8YA 4WE1A 4C3KA 2JDJA 2RS8A 2WB1D 3I55S 3CCMN 3MCPA 1PGZA 1HHSA 4ECWA 4IH7A 4PWDA 2UUWA 3R6LB 4DSIA 1BQNA 3ZZ0A 1P90A 5DETA 3THXA 2HQIA 4FPBA 5DQHA 4O0JA 2E20A 2RD5C 1TAQA 3UO0A 4IOCQ 2AU0A 2MQQA 3O5BA 4HYKA 4C2MA 1CXUA 4ECSA 4K4WA 2Z58B 1VHFA 2YV0X 5J1NA 2HRTA 3UE5A 3V9ZA 2Z1JA 2ZM6J 3DLJA 1S1VB 4DV5F 1YRXA 4BQZA 2N4DA 1XC9A 3EE3A 2ALZA 3CSKA 1NJWA 1FJCA 1HQEB 3RRGA 2QWPA 3SCIE 3KJQB 2A10A 3TJAA 1L3TA 2BRLA 1YJNS 2H5EA 2NRHA 2OTLS 2KL8A 4OI0A 3KXDA 2YI1A 3UVJB 3R8EA 3DRSA 3FCHA 1LFPA 4KH6A 4Z94A 1TKTA 2IC3B 4NZ0A 1RYSA 4BRCA 1CJTA 1FD2A 1CJKB 3QT7A 2IGIA 4ATNA 4FNIA 5EOYA 1S1VA 3CEDA 1YIJN 2QFIA 4PY5A 3VF6A 2R8IA 5GAHU 1NB2A 3H2VE 4WFNL 1SPBP 2IBOA 1MROB 5D8HB 1ICEB 2UUAJ 2FJEB 4OZNA 4FJ5A 1JXBA 2P9UA 3ASMA 1CJKA 1H6KX 4XK8C 4YN3B 5KFCA 3IGNA 4JKDA 2GELA 3NDKA 2R2RA 2D9OA 3VEVA 1YITN 3KLGA 4PWUA 4ZVEA 2VG5B 3KLVA 2UVVA 4C3MA 3U1MA 4CIGA 4MK7A 1PYTA 4H0XB 2FF3B 1VQ5N 3NKYA 4Q8EA 2PA3A 3VGVA 2C2NA 2OP5A 1HNXF 4KQZA 1GT8A 3H5YA 5K8OA 5KFOA 2HNDB 4NCAA 4LF6J 3GFZA 2MKSA 4BRMA 4EP4A 1YXQA 4MIAA 1O5JA 1LK5A 2G2YA 3OA9A 5KT6A 3MD3A 3ULHA 3CD7A 4QYRA 3VOVA 2R8JA 1X9WA 2F8SA 5F41A 2VG5A 2UUBJ 1E6VB 1N5YB 3AD7C 4Y2MA 1IBMF 1REVB 3GE9A 4CH1A 3CJ5A 3QJLA 4LFAK 4FNHA 4OI2A 4CWBA 2YH1A 2O67A 2HHUA 8ATCB 4F2SA 4ZCKA 4DR5J 2HHHJ 4OIXA 2HNDA 1NSAA 1V5VA 4YOXA 2IVFB 1S72S 5JLHA 3KUEA 3OVAA 4RW8A 4PXCA 3UNGC 4JRPA 4GKJJ 3SSQA 2HS0A 5LL6d 5BR8J 5H9EK 3ET6B 3HHLD 4YDUC 4RTFD 1Y10A 1CJUA 2RH3A 1SKWA 2AJ4A 1UAXA 3DCAA 3ZTPA 3OFEA 2RIJA 2XMKA 4A8XA 2XZDB 3JQKA 3IXQA 3A5OC 2E9RX 1ZYQA 2J6TA 5TKWA 1HNWK 3VGUA 3K0JA 1RWPB 2OELA 4LF5F 5AXLA 2MQMA 1NK9A 4OI4A 4ED8A 2VGMA 4KHPK 4L3KA 2D41A 2F1FA 4FF2A 5E2QA 4IFVA 2F7VA 2W8KA 4OO1J 1X4EA 4F67A 4DV1K 4MKYA 1VQSA 3UWTA 1FKPB 2ADCA 3LP3A 3DLLL 2RT3A 1WAFA 2AJ2A 4UY8T 5KRSA 3M2RA 4A8WA 1G2EA 2BKOA 3SV3A 3VQ8A 3NCQA 4U7UD 4CBXA 2H5IB 2VYPA 3QYYA 3UNYA 2KT5A 5AQKA 3ZX2A 4FK4A 4W5QA 3ULDA 3J7ZO 1VRUB 3VAHA 1WF1A 1G15A 4USMA 5AQWA 3FGUA 3R5DA 2DXEA 4UOCA 2IFXA 3WNFA 1EKSA 1K44A 4JKGA 1KLMB 4HDGA 5A0YB 1IH7A 3NF7A 2G13A 3ID8A 4IRKA 3AY9A 1OKJA 4ILGB 2DK2A 3RB0A 3NGYA 4QIWD 2R8KA 1NKBA 1R8PA 2FC8A 3F73A 2I7PA 5RUBA 1RQ0A 3LDNA 4R5PA 1XUPO 2KB2A 5AQZA 2EFPA 3HPGA 4X64K 1VRUA 2CQHA 2OD4A 3GONA 1N36J 2ZHAA 1EKEA 3L2VA 1HR0J 4BRNA 4W5NA 2R2TA 4RR5A 3K5PA 3EM1A 3IN5A 1W26A 4I6MA 1IJFB 3N4WA 2CQDA 3D6TB 4EBEA 2RSQA 2N7YA 3B4DA 4PKIA 3MN5A 4OMFG 3UD4P 2IJRA 5HRPA 4RNFA 3POTB 4M3RA 4JUZA 3HT3A 3RRKA 1FJGK 2HOEA 1ZAXA 4G6VB 3OXGA 3O9RA 3KK7A 4AYBD 1Q18A 3BPDA 2MGZB 3ZSXA 3H20A 2HFVA 1I5OB 5CYMB 4NLCA 2VG6B 3FEYB 3CM5A 4BE2A 2NZCA 1TK8A 1FRLA 1AFJA 2D69A 4L73A 3CJ4A 3EWGA 1NK5A 2NXCA 4AT1B 4WP3A 2IVOA 2GQ2A 1R3NA 1L3VA 4LMZA 3V1QA 3DOLB 3MCOA 2ROEA 4K4UA 5C10A 1FW6A 4DL2A 1EIYB 4KHQA 1RT5B 2NQPA 1TL7A 5KFDA 4OHXA 4O8KA 4GKKK 4H5VA 4O3NA 2P6SA 1UJ6A 4KGKA 2XMMA 4Q43A 1ZBSA 5CYMA 4DV4J 2RHSB 2JLFA 3MECA 4YOTA 1U48A 4ZP8A 2MMYA 1ZPWX 5J2NB 4EP5A 4F4XA 2ZOGA 1Q8IA 4HTIA 3EY1A 4CEDA 4KHNA 2DIUA 4ISGA 3I82A 4BRQA 4CHOA 4C8OA 2EBGA 4LJMA 2Y3YA 1WEXA 5KFGA 1JLBB 2KM8C 5M2UA 1LCUA 4LF1A 1RTDA 3VCDA 3OVSA 4JI4F 3VF2A 1SUQA 2XCPA 4MQ3A 5LMUK 2BANA 2R7VA 4OYXA 1LKZA 2CYYA 3X3UA 3OQ2A 1DARA 4KTWA 1MDUB 2GAGC 2VOPA 4H4MB 2FBVA 1GFWB 1TUUA 1YX2A 2GWKA 3FNNA 3BN4A 3MCMA 2EWSA 4HVZA 4CLZA 2V7YA 5AFUH 2YNHB 3WEEB 3RW7A 3M30A 3F44A 2OZSA 1YQHA 1KAZA 4OYBA 2EXUA 3J7AN 4CGFA 3N4QA 3PHTA 3D7EO 4M3YA 2YNGB 1SH0A 5BPLA 3FEZA 3MM8B 4OHVA 1Y4ZB 3RAXA 4CJFA 1QM9A 2ZH5A 1AUSL 4OHWA 2QLWA 1MG7A 3HSJA 4CFAA 4K8RA 5CABA 4HACB 2FIUA 3KDOA 1PC5A 2QEXN 3P5JA 3SQOP 4RWWA 4PQUA 5KFYA 5KFWA 2V8HA 3MN9A 1GXUA 5EX3A 3V6JA 3PZPA 2P9PB 1AZSA 1KP6A 3FKBA 1B99A 2E1PA 4OZLA 3PIPL 5IT9U 4U67Q 1I94J 3OXLA 2Y1LB 5FPMA 3TO8A 2DHAA 3VENA 2HAIA 3OS0A 1JX4A 3KG1A 2HBYB 3MWBA 1TK5A 3L2QA 4JV5F 1WSRA 2A3JA 2ZH6A 3HVAA 2C3PA 4FJ9A 1UA0A 2XGPA 2GWJA 3N6MA 1HNVA 2XG8A 4R8UB 3I8DA 1N34K 5LSOA 4J91A 4DDFA 3OS1A 1QD1A 3PVXA 3VEXA 5IM0A 1VQMN 3LGMA 1WC6A 4CJTA 5JMNA 4FOEA 4M5IA 4F04B 4CH7A 3TANA 4KHYA 2RB7A 1WF2A 2OEMA 2NUUG 3TJ8A 2CJ9A 4DLEA 1C0UB 1CJVA 3ZT4A 2OD6A 4M5HA 4IFEA 4YORA 3AO4A 2WTUA 3QBWA 4DSKA 5BXIA 4A8FA 3OYIA 4XEIA 1QSLA 4R8UA 6FD1A 5C42A 4ECUA 4B8CA 4L74A 1S6QA 1HWUA 1UJ4A 2CPHA 3BDEA 5IFMA 1J54A 3FE1A 3QIOA 1OH5A 3PX4A 3DMJB 4CLSA 1SIWB 1TL3B 2HAFA 1HQ2A 3MAHA 4F02A 5IT9Y 3M6XA 2Y8WA 4FM2A 4BRIA 2HHXA 1W9HA 1LNQA 3MM7B 3KOAA 2QE5A 3VTHA 3W1YC 3SQ0A 2BUPA 3RRHA 1HBUB 2YX6A 3LH2S 1MSWD 4L3QA 2HGLA 1VQ4S 2BGGA 4DPYA 1KC8T 4NRTA 2HK2A 2QN6B 2HFZA 3DRRB 3I4HX 3VA0A 1RAJA 1A0OB 3ZNJ1 2KVIA 3VAGA 5AJ3F 1UVJA 2GBZA 2MZ1A 3CD5A 1HLUA 4OYIA 3TAQA 3LP1B 2K3KA 3K58A 4PL8A 2JVOA 3C14A 4CZEA 2ZH7A 2CJYB 3M2VA 3RBXA 3I55N 3DM2A 3Q7CA 3HRGA 3SPYA 3HSCA 2FHJA 4DUTA 5ADXH 4FJHA 4C11B 1SH2A 1UZHA 4B9SA 3SIPB 1R59O 4DV5J 3O2IA 1GMUA 2B9YA 4NRUA 1VQ9S 1Z1ZA 3FZKA 1T05A 2QX0A 1TFYA 3R5CA 4WTYA 1DLOB 3RAMA 3VESA 4AL5A 3EGVA 3KK1A 2DKOB 3SFGA 3OYLA 4ZJLA 1Q86O 1IBLK 2QG9B 3S1TA 3VEOA 1RA7A 2CPIA 1SJ4P 1B7YB 3M8PA 3AVKA 3BBFA 4CFDA 2OEKA 4JI3F 2WSFC 2V50A 2EC2A 3WX8A 3PW5A 4MKBA 1IKYB 2NPFA 3EDQB 1VSDA 3T6BA 4X62J 4BREA 5HQ8A 3MM6A 4ER8A 1RZMA 4IH5A 3OL8A 2V63A 1JLEB 1FA0A 1U47A 2OTLN 1D9FA 4NXMK 5GAEU 4MK8A 2VWBA 2BABA 3QICA 2IM2A 4DUYJ 2A6MA 3DLRA 4NXNJ 5ETLA 1N0VC 3OFHA 2ZHBA 3S6EA 2OTJS 4PUOA 5ETVA 1N54B 4DL3A 1FO1A 3EXYA 5L46A 1Y3JA 4ISEA 2VHGA 2Y9HA 3OFGA 3T3FA 3N9UC 2J8SA 1M5KC 2IS3A 2QM1A 3KHHA 5KOXA 4ELTA 3KHYA 4AUKA 4DQPA 4BRFA 4M3XA 3EDRB 4WIIA 4AQYF 1NZ8A 4OL8A 3DGPB 1F9HA 4IKAA 1ITGA 2IA6A 4DU1A 4BRHA 4LH4A 3R5AA 2IVPA 4CYUB 3MM9B 2DRAA 1XQSC 3V5RA 1JCGA 1RADB 4ZS6A 1UA1A 1RWVB 1F3VA 2YQ0A 4ZK7M 2ACYA 3EXCX 2EG1A 4PCQA 2VJVA 4IG3B 3PYDA 1NBWA 4IO1A 3HSGA 3L7PA 5JUMA 1I51B 3JAMO 2MQNA 3GJRB 4RLEA 4GVEA 4M5NA 2VG7A 3O8MA 1ASVA 4OPJA 3B6PA 5JS2A 1IBMJ 1HNZF 3V6HA 2V0NA 3TZXA 1N5TA 4HKQA 1U45A 1B9DA 1RBLA 1T9WA 2O1PA 3F41A 1VQ6S 4GVBB 3LANA 1Q82T 5M1QA 3SCXA 3HBTA 1J27A 5DZ7A 3M9MB 4FVCA 4PXDA 5GIPA 5EDWA 4DPWA 4CCHA 3T1AA 5JS1A 1FRIA 4WF9Q 1U1LA 1IXKA 2QW9A 3CJQA 4IDHA 3DYAA 3EYZA 5AQJA 4W5TA 3PR4A 1VC0A 4ID8A 4OYZA 1S72N 3RBDA 2A3ZA 3HX9A 3ZTRA 1Z6RA 1C1CA 1YUWA 3DXMB 3NAEA 1VQOS 3HI0A 4LF5J 1HKGA 3F9KA 2E1YA 3O3GA 3H46O 4PPZA 3M6UA 3PIOL 5HJYA 2E2QA 4FLVA 1YHQS 1DRZA 4EZ9A 1TV6B 2A2DA 3BO2A 2E7VA 5K8NA 1Q8BA 2CVEA 1U26A 4ZCLA 5J1EA 1RT7B 2Q66A 4FYDA 1MMDA 5KTQA 5CCMA 3C7NB 1ITPA 4QWBA 4JI1K 4KRWA 2P9EA 4H5RA 4CP5A 3D2EA 3T1HK 4KGXB 2OHDA 3V4IB 3J81Y 4HHHA 4HUGA 4TQRA 1QHTA 4P72A 3OW2R 4PXEA 2ZQBA 1ZAWA 2ILYA 4E0DA 2ZC3A 2ZJPQ 2YNFA 4QWCA 1BC6A 2FY1A 3V9SA 4DV3F 4A5AA 3QETA 3AVJA 3TAGA 4TKTA 2BBEA 4TVAB 1A5WA 1UCNA 2DCUB 4X66K 2CZVC 4ALZA 3S7RA 1P1TA 5M1OA 2QYGA 1QSSA 4B9LA 4DI6A 2VQEF 1HHQA 1HPZA 2AYBA 4V19S 4A8QA 4NLQA 3UCUP 5HBMA 4YMEA 2UXCF 4J9UE 2DGWA 1VRTB 3S3NA 5LY3A 1B0TA 4DR7K 1U2VB 3L2WA 2A2CA 1PO6A 3CC4N 4CLLA 4PKDB 2CH6A 5GAGI 3IWXA 1JWWA 4DG1A 4F8RA 4WYLA 3T5KA 4Q5VA 3ONQA 3OXFA 1C4AA 2BJDA 3MOZA 1TUYA 3MEDA 3F0NA 4J8FA 2VASA 3DN9A 4WP9A 5FLXO 1R8HA 4DFPA 2GX8A 2YX1A 2QRRA 3WNEA 2DGVA 4A2AA 2QWRA 3PW4A 2FHKA 1YZ7A 4KKOB 2HHTA 5KAKA 2BQ3A 3TUPA 4CE9A 1PBUA 3ITHA 1NJIT 1B9FA 5HL7L 1R43A 4MDAA 5CZ2A 2FJWA 1K9MO 3T1YF 1FXLA 3AA3A 4O4GA 3R2CJ 1RHUB 4LRAA 3ULEA 5KT2A 4MFBB 2HQCA 1YBAA 1Q95G 3OBIA 3PJXA 4LUBA 1H1VA 4ID5B 4BC4A 1NGAA 4URQU 1ACMB 2XLJA 5C7PA 2FTRA 2EEYA 3JTOA 1FTCA 3TA0A 5FIIA 1OYDA 2MQPA 4FZZA 2PFUA 2P5VA 2NYIA 3H0PA 2GIFA 3KUHA 5HMYA 1RT2B 1D9DA 3WNHA 2AP1A 1JLCB 2UXBF 4CTAA 3OVBA 1JLGA 3DKDA 2F9DA 1S79A 4DJBA 2LU2A 3SUQA 4OLBA 5K14A 4DN9A 3ZNUA 3A3NB 1RWKB 3DGVA 1TZ0A 4LFBF 1L3KA 2E7WA 1J5EK 3TX8A 3MMBB 5A8RA 3MR3A 4NASA 2W9CA 4LBIA 4NMLA 1YVUA 4TY9A 3PW2A 1R7IA 2BDPA 3QEVA 4CRJA 1ZBLA 4P52A 1NM2A 3AA8A 1QUPA 1LV5A 3H4BA 4JI4J 4X4QA 2QO3A 3PEJA 4ANCA 2V94A 1N32K 3PXGa 3BPSP 1RU2A 2HBMA 5EXWA 2YQ1A 4ZP6A 4WP8A 3FK4A 4CK3A 5DM6Q 3LWLA 4H0YB 1X4CA 4FPAA 4Y6IA 3NVKA 4P7VA 4WFZA 4FYWB 4TLQA 5K8MA 4B9UA 3C6AA 3QNWB 2LDIA 4Q0BA 3NF9A 4CHNA 3M6WA 3LP2A 2R7UA 1ZM9A 4JYAF 1CZBA 2CXEA 3ZEUA 3K0SA 3AQOA 5EUHA 2LA6A 4WK3A 5H9FJ 4KH5A 1N8RO 4YNQA 3G82B 3P4IA 4EIAA 4NYPA 2C42A 4ZP7A 4PG7A 1B70B 3ZTOA 3SSSA 4PA1A 2CPXA 2GNKA 3GP9A 3EO3A 1O6XA 4RUHA 3FZ2A 4IJNA 3RMBA 3CO9A 2UV8A 2FLOA 4LQ3A 3KKSA 5AQFA 2EFNA 1SQKA 5L1JA 3U3YA 3IS9A 3V9XA 1YTUA 4NLUA 3OTOK 2ROPA 2WVFA 5B0CA 3SJJA 2MQ8A 4H8KA 4QS9A 3MPWA 4CLYA 4CO5A 3FZBA 3IRWP 4CM2A 3KK2A 3U8XA 1AROP 1WWHA 4JV5J 2O8DB 1W7AA 4CERA 2OYQA 1P6TA 4OX7A 1NMDA 1MLAA 3AVFA 4CD1A 3TEHB 3DLGA 1QAYA 1TQLA 1UWBA 2P9SA 3CCQN 1ZTWA 5HMXA 4J2EA 1UOCA 1R89A 4LF4F 2RQ4A 1NNEA 1JJ2M 2HPUA 3D0HE 2B5JB 4WFAQ 7AT1B 3THTA 2C2KB 1XNQF 1WUAA 3DOMA 4M3UA 1RTHA 4IH6A 1X7VA 4OZ5A 2EKNA 2KG0A 5JXSA 3D0PA 1NH8A 1W7WA 1WC0A 4DV7K 3R9LA 2V2VA 1GH8A 4OI6A 2O8DA 2V4JA 3A8IA 2E2NA 5D0GA 3LM2A 2IVNA 1Q4RA 1U1PA 4BLGA 2Z2YB 3L7UA 2FDNA 3CCWA 3LAMA 1VSJA 4CI0B 2Z30B 2WRMA 1UETA 4G9ZA 3MWPA 3QT5A 1S9GB 2IRXA 3E51A 1CBKA 1HARA 1VLOA 1X4GA 4V19X 1KN6A 4OZJA 5E3CA 4KJIA 2E5LK 3EZUA 2ACMA 5HLFA 2D9PA 1VCTA 3TVYA 4LF7F 4G1IA 3GV5B 2CRLA 5FDLB 4YDUA 4BG8A 4BGBA 1TR0A 4CEFA 4LR8A 3WX4A 4CM0A 3P38A 3SDEB 1N5QA 2V2ZA 3OHBA 3RMAA 1HD1A 1OY6A 3CD0A 4HLBA 2HRUA 4CF1A 2F5GA 2MZSA 3M05A 3I56S 3PYEA 2FY8A 1WLJA 5AJ3J 4UOGA 4E7LA 1S97A 1R8AA 2ZH3A 3A8EA 2AMCB 2FLLA 4IR1A 5F0WA 1X4DA 2ZZNA 4DR6K 1MW7A 3VQ7A 1IN0A 3AOCA 1VQ4N 2XB2D 1N56A 2VH7A 3KWMA 1TFWA 3MTJA 1UPPA 4TU8A 2WCXA 3R1HA 4KIAA 2M2BA 2AGPA 1VSLA 2B9EA 4ZOSA 4DCPB 4TU7A 1EX4A 2Q2RA 5FPNA 2WW8A 5F8LA 4W90B 2KYXA 3M1FA 1TUWA 2DGSA 2UXDK 2XZTB 2LXFA 5IS2A 2K7JA 2VIHA 2XYHB 2HZVA 4ILLA 4YY3J 3CT9A 3MMVA 2V68A 2QJ3A 4CJ5A 2GO9A 1BMQB 4CJ4A 3MUVP 1U1NA 4JI3J 1N4LA 1K0TA 2DNQA 5AR0A 1YJTA 4M5JA 3GJTB 2GUPA 2C28A 1ZZNA 4EHUA 2MPUA 1FKAF 3AVNA 4RNNA 2M8DB 2WOMB 4B3MF 2BQRA 3L2UA 2DT9A 1X9JA 4KB1A 4ZPCA 2MDAA 3CXCM 5DRKA 3HP9A 1HW9A 5CXTA 2ATQA 1GMVA 1Y97A 1CS4A 4ZJQA 1RSCA 2VQFJ 1ATSA 2E7XA 3D3BJ 3DLEB 2XRIA 2BX6A 3V9WA 4MK9A 2AYGA 4ECTA 2GJFA 5J2QB 4MTPA 2ABYA 1NAQA 3IAYA 2VC0A 4WTOB 4KTQA 4FWMA 2GJIA 4WKRA 2IAJA 1FNMA 2XNQA 1UFWA 3RR7A 2Y0BB 4AQYJ 1XTZA 1R0CB 5IWAF 2UVUA 2OTJN 3I32A 3FC9A 4F3QA 2G8UA 3LDLA 3GJSB 4DV2J 1VQ7N 4AL7A 4C0OC 4KPYA 1NGHA 1QE1B 3DLBA 3QEWA 2B6AB 1GEHA 3BQ2A 4YDDB 1FK9B 1XN9A 4E3SA 4J9NA 2HBLA 2EI5A 4H4OB 3MAQA 2UU9K 2LQ8A 3G6XA 2CNLB 4X4NA 3GFHA 5AQUA 3I5AA 2YHBA 4AXIA 4Y65A 1MN7A 1HNZJ 4LF9F 3R7NB 1U8SA 3QRRA 1ZXOA 1WG1A 2DY4A 1VRQC 1IKXB 4KV8A 4OV6A 4H5TA 4AILC 4RJVA 2JLEA 3R7BB 1NDPA 3HT0A 3QPIA 1K8AT 1Z4UA 3CJ0A 4CF8A 4QBUA 2V51B 4I7FA 3BDPA 3DC2A 1F2GA 1E4GT 3MAAB 4ISFA 1YJ7A 4B3SK 5F8IA 2YHXA 5E84A 4NZ6A 4AHCA 4IRCA 2EHGA 4JAXA 3EVOA 2LVWA 4U8VA 1U0SA 3OYCA 4BCAA 4CF0A 5FROA 2DNZA 1HBOB 5MAOA 3E1YA 1VSKA 4DTMA 4CF2A 2OPSA 2G0CA 1VGYA 4LFCF 2XWXA 3KJVA 1QVGR 1OO0B 1BG3A 4U96A 1VQON 2WC9A 5KFKA 1JLAA 3HPHA 4N77A 2BW7A 3TP2A 1PILA 1K8KA 5AQXA 2N3OA 4KSEB 1YHQN 5HRNA 2WVBA 2DO0A 2PMHA 2R7QA 4DL5A 3D28A 1X9SA 1BHNA 2PMWA 1W2BR 5KQDA 3M6GA 1DQ8A 1WKLA 3CG7A 2HMIB 5DLFA 2WHOA 3U9ZA 3NNCA 4CW7B 5ETMA 3NMRA 1IWAA 3OHAA 4DV3J 1D1UA 2NNWA 1OMSA 2NXEA 4MO5A 3EICA 2HHSA 2W6LA 1MWQA 4KHSA 2BR0A 4K42A 3THWB 3MUMP 1TU0B 3MOJB 4O3PA 2HEKA 1NM1A 5I42A 2P6TA 4CNYA 2DGQA 1ZBFA 1P8GA 2VQEJ 2UUCK 4WXWA 2OZMA 2Y8YA 2UXCJ 4YOUA 4QQBA 3LALA 1WG5A 2G1HA 4ED0A 2P9IB 4JI2K 1PAEX 1PJ7A 1UEUA 3B8AX 2RDJA 4CNZA 1IM6A 2XHWA 2HMIA 3MI7X 3SAGA 4K8ZA 2NPIA 4K50A 1XNRF 4FLTA 3C16B 3HSZA 1H72C 3QGHA 2HNZB 4IFYA 4B9NA 1SZ2A 4NA2A 2U1AA 3B6BA 4DMNA 2YJEA 4EO6A 3TVKA 3EZ5A 4R0EA 4JI5F 3W7BA 1NKCA 1XEZA 4FLUA 1RTJB 1ZAVA 5AQHA 1RDWX 3U3GA 3W64A 1N5SA 4JB8B 4OJ3A 3BR9A 4I67A 1QVFR 3F5TA 4FM0A 3KD5E 3VALA 4F0KA 3G8TA 3BYPA 1WD6A 1Y11A 3CCUS 2HWHA 2BZ2A 1K73O 3CFOA 5GAHP 3TW0A 2ZE2A 3H3NO 2NRWA 3O1WA 3CD6S 3FFIA 4MYUA 4EFHA 4L8RB 1DHMA 1FKOA 3CGIA 2V2KA 3TZYA 4RW9B 3JSMA 4UZCA 2O8EA 2I9SA 3HHLB 1FFWB 2Z56B 1IVZA 1XQIA 3MPUB 1JLFB 4GV9A 1OJ4A 3DLLQ 4CGDA 2OKQA 1VSEA 4EWTA 3I8BA 1HMVA 5ADZA 2XMUA 4JOUA 1TKXA 3D0IE 4JNEA 4PKHA 4QOZB 4I9LA 3DRPA 2A0FB 2UXBJ 2EX3A 2XZWA 2E5HA 3K2YA 2K3IA 5IZHA 3T9NA 4CGJA 4USHA 2F4VJ 4IBNA 1RXOB 3QWPA 4LFBJ 3QGIA 3NRBA 4K2XA 4ED5A 1EQMA 2NUHA 3W2VB 3TZZA 2HNYA 2XYGB 2ZGYA 2J9CA 2M4MA 5HVHA 5KPRA 5F8HA 4IO8A 2WFBA 3KHRA 5E0OA 3WQPA 4QWDA 2XO6A 2H51B 2X1GA 3KFWX 4JI7F 3A1YG 4BQLA 1KDNA 4C8KA 5JVGL 1BUPA 1I3AA 4C23A 1RWMB 3PSIA 2GV9A 1S3XA 3M2UA 3QRPA 3TQ1A 1NGFA 4G1QA 1UW4A 4MH8A 3SZ2A 3CIZA 1QAXA 4UY85 1EWRA 3HOTA 3HF5A 2HGNA 3CJ3A 3NY0A 1MU2B 4BR4A 1HNXK 4ELVA 1WSIA 1V3ZA 3TABA 4JYAJ 3BN7A 1NHKL 3ILLA 5G0RA 3VAJA 4IOXA 2OMOA 3RWUA 3ENVA 1OWXA 5AXMA 4B3TF 5F1XA 2EFQA 2Q0UA 2B8QA 3B54A 4E19A 4DCOB 3Q8PB 2DNMA 1IKVB 3OSNA 2W25A 3MDQA 3QIPA 1J5OA 1O8BA 4A46A 5CD4H 2DVIA 2POKA 2QWLA 3Q2SC 3GDQA 2BE7D 3OR2B 1CSJA 2D3O1 4L76A 4ILMA 3K8WA 2O01C 3KLFB 2G8KA 4KT0C 2A1RA 1U2FA 2ZBQA 3O8WA 2D7SA 2HG4A 1M5VC 2V9WA 2A1BA 4LSNA 4HHUA 1W25A 4QS7A 2VBXA 3MHYA 2F96A 3PRVA 3EN9A 4YP3A 4HUEA 4PEOA 4Y3CA 3G6VA 4KR0B 2YKNB 2NRXA 2MZQA 3W5YA 1SJQA 1RT3B 2AJ0A 3RSEA 4NLTA 1Q5YA 1VQPN 4YOVA 5D0RA 3CF5L 1VMBA 4K4ZA 3ZLJA 4AD6A 4DTOA 3DDIA 1SJFA 1KRPA 5D77A 1QLNA 3ENOA 4H5NA 2OPRB 4QWAA 5DDPC 1FE0A 1IKWA 3QEPA 4ZVGA 3C8YA 4J9OA 3UDVA 4LF4J 2DGOA 1X5PA 3CIMA 4ZP9A 4NYOA 3WQTA 4LF5K 2H48B 4NEYA 2WZ1A 3GIMA 2G8VA 1YTAA 4F3MA 3M1VB 1XNQJ 4BACA 3E01B 4DFKA 1VQNN 2KI2A 2GV1A 3NG8A 4RCHA 3D66A 4NE9C 2E1ZA 3V81A 2O4GA 4OKEA 4CEAA 2Q6BA 4DR1K 4A8YA 2ZWHA 4OZ3A 5KGWA 4RNMA 1SC4B 4AM7A 3ZZZA 3CHWA 3NOCA 2O8BA 4ZPTR 2R8HA 1GXLA 4H0TB 1FEHA 1GXTA 1XJWB 4C1NK 1P1LA 1H98A 1XMOK 4W92B 1CXQA 3NVMA 1BWFO 2MY8A 4U95A 5BPNA 4FPRA 3IRXA 1GTEA 2AZ1A 1U25A 2DR7A 1U04A 2OAUA 1SJ1A 4YFUA 1LOUA 5A6WA 1RILA 2FF6A 4M41A 1GMWA 3TA1A 4WZQA 1ATNA 1S4FA 4JKHA 1FNOA 3D67A 4M5LA 1JLQB 1X4AA 2HIYA 3B4MA 2LCWA 4LF7J 4OPKA 4AHVA 4M42A 4MDBA 3J80U 2IMWP 1M5HA 4XO0A 2C22A 2W9BA 2UUAF 4CZGA 4GNIA 3FBFA 1KCFA 1WSGA 1TP7A 2HSEB 3H5SA 1NGDA 2AWZA 4AXJA 2WONB 4I2QA 2KW4A 2DIVA 4DSEA 3S8SA 2HW3A 2AYMA 4OI3A 4URGA 3QGGA 1RCHA 2G2OA 3E9PA 4L3NA 4O8UA 3I56N 1RHRB 3MPVA 3HZ6A 3C65A 4DV6K 3NGZA 4P2FA 1WBBA 1RTIA 2HLTA 1UVMA 5LSLA 1XR6A 2DPJA 1RGIA 4LF6F 3LP0B 2FZKB 2FSJA 3CI5A 2ZVSA 4PG6A 3S41A 1GLBG 4JP8A 4NLGA 2AX0A 4BRGA 3W8GA 5IQQA 5DG8A 4DSFA 4ZPDA 3A5MC 2YNIA 2UUBF 2XLIA 4B17A 2MLXA 3EMTA 2W4PA 1NG9A 1HIYA 4FWSA 4M3ZA 2V9KA 2C2RA 1RAGB 1BA1A 4RW6B 2DH7A 2UYTA 3CJTA 5K8PA 2PYLA 4A57A 4LFAF 5DZ6A 1SQEA 4EI2A 2R8GA 4M7YA 5H1SV 4RWTA 2PZSA 3LGNA 2XY8A 5DDQC 3JB9k 4E7IA 1T7PA 3J80Y 2E5IA 1AA1B 1MN9A 5A8KB 2OH2A 4GRSA 3SJHA 3QEXA 4TNOA 3V6KA 1BO5O 4B3MJ 4JD2A 3QFHA 1LFWA 3NGDA 1FRJA 2YHWA 1IWGA 3GR1A 5GADU 1X5TA 2H5JB 2ZBIA 3HMJG 2Q6CA 4H4KC 9ATCB 4OYPA 2GGPA 4LY7A 2HFOA 3CUNA 3AT1B 4OJGA 3DJCA 3GV7B 1KOOA 5HP1A 1S48A 1D3WA 3I5BA 4NLYA 1H0HB 2PT0A 3P6YC 2VZ9A 1OSCA 3D7SB 1HNWF 2RQCA 3Q8SB 4M5DB 3CDUA 3MEGB 3NNAA 4B9TA 5IWAJ 4KHPF 3AVGA 2Z1HA 5BRHA 1QQMA 2CQ4A 5SUHA 2YXLA 1BOTO 1T11A 4DV1F 2K8GA 3IR5B 4WIQA 4ZVQB 3SFUA 3UI3A 3AXKA 3NEKA 1RABB 1RKIA 3MXHP 3CCSN 2ZHOA 1HJOA 1HJRA 4UY8O 1BCMA 1JMTA 3SYZA 2FBXA 1V3RA 2WSCC 3ZT3A 4F25A 1S5JA 4KY3A 3KLIB 2DRBA 3JSRA 3D1HA 2XQCA 4LR9A 2M3DA 4X4SA 3G0ZA 1ELOA 4RL1A 3M8QA 1BCOA 5EWGA 3MR5A 2KDOA 5GVQA 1F9EB 3U27A 3G10A 3E8OA 3HHEA 3TZWA 2E8AA 1C4CA 2QA4G 4DL6A 5GAHI 3CMEN 3V4MA 2HYIB 4CZFA 5BJRA 4FXVA 4BRLA 1Z05A 1H2VZ 3MGJA 4ECZA 4TY8B 2SXLA 3NBPB 4M3TA 3IG1A 3PO4A 3GG1A 1CC7A 3MF5A 2KFNA 2RKIB 5CHCB 5AQRA 1BGXT 1PJ6A 2VWKA 3K5OA 1JJHA 4IOAQ 3ZZUA 4P73A 4X64F 3WXJA 1DTQB 3C6UB 4DU8A 4DR2K 4K8XA 4ZN3A 4FPIA 3LPEA 5H1SQ 3EUNA 1YAGA 4LSLA 2OPPA 4OYWA 3FRZA 1KONA 5A8WB 2FPHX 4TQSA 4NYFA 4ZLLA 1QS4A 1TL1B 1QHAA 4DZ6A 2NRRA 1WHXA 1X0PA 3IBCB 4R25A 4I68A 4CJEA 2B0GA 5T41A 1JL2A 3VQSA 2DRDA 3HPOA 1RHMB 4OVLA 4HUFA 1FJGF 4LD0A 4PG8A 4F4ZA 3NS5A 4Z4GA 4Y28C 4UF4A 4LFCJ 2AP6A 2G8HA 4ANEA 4JI0K 1UJ5A 4NWBA 5E41A 1RBUA 3AA5X 2Q1LA 2A42A 2BJ3A 2Z1IA 3KNAA 3N79A 2ZVIA 3H1QA 1IBKK 1FDDA 2M88A 2GCFA 3O1LA 2CQPA 3A3OB 5EU7A 2R7WA 2ZC4A 1N0UA 1UVIA 1LEOA 2I8EA 4ZPAA 3MR6A 3UKUA 3EPGA 3KHLA 1TYQA 2RVJA 2KO1A 2RN2A 3G86A 4B3RJ 4JI6J 5F0UA 4TSXA 3MR7A 3BZKA 4GKKF 4Q44A 3AODA 2V67A 2X74A 4DV4F 1T9TA 3VQ6A 5T7LA 2JVRA 4Y2AA 5L39A 1BI4A 1P9QC 4JK7A 1HYZA 5HMWA 4GC6A 3I33A 3GIKA 3M6VA 2QMXA 1VSMA 5HO4A 4KAIA 4FK2A 3G4SS 5JLFA 2XLKA 5HQLA 2LFVA 3FCVA 1U24A 3ATUA 4J37A 1HQUB 5J2MB 1EAYC 2L9WA 5DDOC 1KXPA 2BM1A 2NXJA 5KFTA 1SI9A 1Q1KA 3GIRA 1S49A 2PE8A 1NU0A 3VQAA 5F9NA 3CO0P 3C19A 4EFAC 4PHTX 1XNRJ 4B8AB 3OL9A 5LMUF 4RWXA 2O8FB 5E3AA 5IOLA 2GAHC 1ZA2B 2PFDA 1ESVA 1PKUA 5D4PA 3D2FB 1YJRA 3O4WA 4FP9A 3A2FA 3SMSA 2ASLA 1Q7LB 2FYXA 4JI5J 2ASOA 3O1BA 2RPIA 3VETA 1YWXA 2MKIA 2FD2A 5EWEA 3C15A 4X4UA 3OYAA 3OL6A 2XS5A 4N8NA 4JKAA 4K43A 4J9KA 1RAAB 4C98A 4EYIB 2DEIA 2Y1RI 5GAEP 3BSCA 3PLAA 4BE0A 2E2PA 2W41A 1Q86T 3PIOQ 1XR5A 3RVCA 2DNHA 1TGOA 1LWFB 3OYDA 3HVTB 4F4AA 2UUTA 5I3UA 3NGTA 1JKHA 4AE5A 5KT7A 2XMTA 1X4FA 5D3GB 3QO9B 1RFQA 5B08A 4IG0A 1RJJA 2GQQA 4C3LA 2ZOMA 2PA8D 2Q3PA 3W2WB 2I1RA 4OKKA 3VZIA 4LF8K 3KLEB 3FSIA 1IJEB 3NF6A 3CPWR 4FKYA 5KG3A 3K5LA 2WVEA 3TVZA 4UQTA 1GLDG 1OS5A 4KO0B 1W97L 3DLKA 2KHCA 1ZH5A 4CECA 4BDYA 4O44B 3JTPA 2LXUA 4E7JA 2GZOA 4U9RA 2R9LA 2JEGA 2ZH2A 2MKKA 3M3ZA 3W2WA 5F3TA 3E2EA 3PSFA 3J7YP 2CPDA 1NXIA 2G0JA 3BH7B 3VQ5A 3D0GE 3CJ8A 1FI4A 2GIQA 2UP1A 4DX6A 2IRYA 3CJ9A 3VQ4A 2KN4A 2AT1B 5E26A 5BN9A 4H0OA 3KLHA 1UMJA 2XO7A 3BKTA 5HROB 4FS2A 1LWXA 2B4UA 4KFBB 3THYB 3EL2A 2PC6A 2WK4A 4ZLJA 2N7CA 4CD3A 4FJIA 2KT3A 3ZSRA 4ES2A 2EG2A 3CIPA 3DXKB 3NWGA 5JVHQ 1B92A 2BEFA 3AXMA 2IDEA 3D6FB 1NH7A 4B3TJ 2FJBB 3QAUA 2FJXA 3D9BA 3KJNB 5K20B 1QUVA 3EE8A 1SC1B 3H2UB 4ZITA 1UAWA 1YT3A 2BE9B 2P5GA 1X1PA 5HROA 2D3OR 3THPA 3VQBA 3I87A 1HWKA 1YJWN 1RACB 3OBWA 4OHZA 4YOWA 4HH1A 3J81j 1TMMA 3MMCA 2IMOA 5KG7A 2MQLA 3ISND 3KKFA 4BVPA 1O13A 1NGCA 3DFEA 2FXUA 2VF3A 1RGVA 1KWMA 5KPTA 1ZA1B 3I0RA 4OZ2A 2K1RB 3NS6A 3VVUA 5ITHA 3HDSA 2L08A 4H54A 4P2XA 3UB5A 4RU9A 1R0AB 3W5ZA 2JGUA 1RT1B 3W63A 1KC8O 4DBQA 2ATLA 2V5HG 4ZVUB 3FMBA 4DWIA 3IR7B 2VV5A 2DYAA 3ZZPA 4ZJOA 1U0HB 3GE1A 2F40A 4JHDA 2D0BA 4IRDA 2HF3A 4JI8K 2PBDA 2F9JA 3HVRA 4FBTA 3MZIA 3AAPA 5IV3A 2H4WB 1UFLA 2NZ4A 3AAWB 3ZT1A 1S6PB 3AOBA 3UE2A 1LXJA 5HI7A 3PTWA 3AVMA 1SAZA 1HL6A 5CD4A 3MPYA 3V6DB 1R8CA 1XC3A 4NLBA 1HRHA 5L9NA 1NOZA 1YJUA 3D54A 2FC9A 1WORA 3HHNB 3VAFA 2DHSA 2AGOA 2A5XA 2FHOB 1IBLF 3ZX0A 5DGAA 1QDUB 4O3QA 1DKGD 3KG4A 3PYGA 4U67L 3DI6B 3SI8A 5LMNK 3A13A 3VQEA 4EYHB 1VQ8S 1RHJB 2XHCA 4M5KA 4HL9A 4X62F 3CQXA 1I3OB 2Z2ZA 3L7OA 3VHQA 3VWSA 2D0OA 2VDIA 2M8HA 2GEMA 4BVOA 4DTSA 1HQEA 2XMAA 3CE8A 2V4QA 4NXMF 4M8LA 2HFUA 3GWCA 4DUYF 3ZO7A 3MPDA 3TOQA 3C95A 4NXNF 4ED2A 2KT2A 3N0VA 4CI6A 1X8DA 1FXDA 5KG4A 2PMZD 3UVJA 3ZFVA 2DNYA 4BR7A 4OLAA 4FW2A 2D3ZA 3KZBA 2IC3A 1EB0A 5HAOA 4ZLNA 3SK3A 3KMQA 3OYNA 5ETSA 2KJW