2VG6A

Crystal structures of hiv-1 reverse transcriptase complexes with thiocarbamate non-nucleoside inhibitors
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
550
structure length
548
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE/RIBONUCLEASE H
publication title Crystal Structures of HIV-1 Reverse Transcriptase Complexes with Thiocarbamate Non-Nucleoside Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 131
structure length 548
sequence length 550
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2vg6A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vg6A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2vg6A05
3OHBA 1BCMA 1C0UA 3M8SA 1TV6A 3BREA 3KHRA 3MEGA 4DF4A 4WE1A 4DQPA 5J2NB 3TI0A 1ZBHA 1TKXA 5F9NA 4FLZA 3AO1A 2KTQA 3VQ4A 4FJMA 3CJ4A 2F8EX 4IFVA 1QTMA 3IGNA 1ITGA 1X9SA 1JLCB 1J53A 3DYAB 5HLFB 4HCCA 3TAMB 3GV8B 4DSLA 4DQQA 4F50A 1TK0A 4PUOA 2P1JA 3F73A 4QWEA 2HHWA 3BDPA 4K8XA 4MK9A 1LWFA 2BRLA 4TQRA 4Z4EA 1FKOA 4FM0A 1HARA 2JEIA 2HMIA 3TR8A 4NLUA 4TSXA 4O3PA 1RNHA 1RBUA 4CF2A 3EYZA 1CZ9A 3OYNA 4O44A 4E7JA 3MEDB 3M8QB 1C0TB 3BQ2A 2X74A 3IAYA 1DTTA 1CXUA 4U6PA 3BGRB 4IH7A 2BR0A 2W9CA 4O4RA 1BI4B 2HHUA 1UOCA 2KFNA 1NKCA 3PW7A 3FFIA 4EYIB 4QWCA 1ZTWA 1RTHA 3V9XA 1I3AA 5L1JA 2IC3B 3K5LA 2I5JA 1YT3A 4J9RA 3AA3A 4KPYA 1C1BA 3SQ4A 1QSYA 3TAGA 2RDIA 2VA2A 3HK2A 4ID5B 2R2SA 3SYZA 3KLFA 5DGAA 3CWJA 4RW9A 2C2EA 3TAFA 3OHAA 3RB0A 3VQPA 4R8UA 3T5LA 4C8LA 3DOKA 2F8SA 2HNDA 2E6MA 3O3GA 4KO0A 3SQ2A 3DMJB 3H59A 1X1PA 3NH2A 4TQSA 2IMWP 1WLJA 2HNZA 4BDYA 1JLQB 2VG7A 4RZRA 4YMEA 4O55A 1RBTA 3I8DA 3HT3A 5DQHA 1KTQA 3LP0A 4NLVA 2ILZA 4J9PA 1S6PB 1C2PA 2FVPA 4LH5A 4Z0UA 3KKRA 1YVUA 1U4BA 3MFIA 1LWCB 4X2BA 4CGDA 3GIKA 2KQ2A 1JXEA 3DM2B 4LSNB 1JLAA 2G8HA 3M9NB 1XI1A 4M3ZA 1T03A 4RNOA 4E19A 2R8HA 2P5GA 1NK5A 3L3VA 1JLBB 2AWZA 1X9WA 2VG6A 3NBPA 3C6TA 5KGWA 3T3FA 2FLNA 3BSCA 4KB7A 2ILYA 1I6JA 4DSEA 5F8HA 2YKMA 4MK7A 5F8MA 3NGYA 2ALZA 4LQ3A 4CIGA 4JV0A 1EETB 1Z25A 4IQXA 4RG8A 1N6QB 3QNOA 3OYLA 2E9TA 4ED0A 1HQUA 2J6SA 4FJXA 4JV2A 3OS1A 4B9MA 1I39A 2GC8A 1XHXA 3I5AA 2HHXA 4I9LA 4O3RA 2LSNA 2AQ4A 2WTFA 4OLAA 2IAJB 2FVRA 4FK2A 4CJLA 1VRTB 4DS4A 4I2PB 1NK8A 3OL8A 4KHYA 3HXMA 2A1RA 3MR5A 1RT1A 2RDJA 4BDZA 3KLIB 2FVCA 3NAIA 4C8OA 4I7FA 4KE5A 4O3NA 4QW9A 1KRPA 3SUQA 4K4XA 4KSEB 2R8GA 2VG5A 3MF5A 2KZZA 4DQIA 1HMVB 3P1GA 1C1CB 4NLSA 3MR3A 1SV5A 1FKPA 3CDWA 4EZ6A 4NLOA 1HJRA 4FZXC 4DU4A 4CJEA 1R0AA 1IG9A 5FDLA 1NHVA 4TN2A 3K2PA 5EDWA 3SV3A 4J9SA 3ZT0A 4B9SA 1EX4A 4CJFA 1GOBA 2G8IA 3O3FA 1REVB 1SKWA 3FRZA 5KGXA 5C24A 1SL0A 2Z1GA 1RT4B 4O3OA 2BRKA 4ZVHA 1ZYQA 4CJUA 2Q3SA 2DFHA 3OS2A 3OYEA 3TVKA 5KT7A 3F9KA 5J1EA 3NAEA 2EX3A 3L2RA 1U09A 4M3RA 2IJFA 3SUPA 4RW8B 1ASWA 2GIRA 3HVWA 4W5NA 4K4YA 5HROB 4NCGA 2RN2A 4M41A 1YTAA 5DLGA 2ZQBA 2ASDA 1RT5B 4ZHRB 5KG6A 2RPIA 2Z1JA 3BSNA 2ITGA 1VSDA 3LZIA 4URSA 5DLFA 3AA2A 3DLGB 3OLBA 1HYVA 2A1SA 4LY7A 4OKJA 3ALYA 5KT5A 3EZUA 4O0JA 1KLMA 4IRKA 5SZTA 1BHLA 3LP1B 1HPZA 1QUVA 3FQLA 4TY8A 1ZBFA 3LPUA 3VQQA 4CJ4A 3OJSA 3CJ5A 4B9VA 4IOBA 3M9OB 4DTPA 4AH9A 4QWDA 1C1AA 4DTRA 3AVJA 3PJXA 1JX4A 3VQ7A 3KJVB 3U3YA 5DK5A 3NH0A 4MH8A 4DFKA 4N56A 4DF8A 4DG1A 4QWBA 1S1XB 1JXBA 1GOCA 5J2NA 3NKYA 3UQSA 1U47A 4J9LA 2DTUA 3ZSOA 3P5JA 2BE2B 2XCPA 2JGUA 1U49A 1JKHB 1JLCA 1RT3B 4TXSA 3DYAA 5HLFA 3QEVA 3TAMA 1EP4A 5KFEA 4F2RA 2HVHA 3QGHA 2YNGB 1S9EB 3LALA 1N56A 3V6HA 3ITHB 4ECUA 3OYHA 2UVVA 3EPGA 3DRRB 3IS9A 2V9WA 4TY9A 3SI8A 4M42A 4W5RA 3V1OA 2AJQA 2HVIA 3AVFA 1TGOA 4FS1A 1UWBB 2FJWA 4CJPA 2E9ZA 4NLTA 4ED1A 1T8EA 1G15A 3V9SA 1WSIA 3MEDA 1SH2A 1C0TA 3BSOA 2AU0A 1SKRA 3AVLA 5EU7A 2UVWA 1KHWA 1TKZB 2ZE2B 3SQ1A 3S3NA 5DGBA 5HRSA 2F8TA 2OYQA 4IFYB 3QEPA 3KHLA 1BI4A 3IN5A 2D0BA 3LP2B 4NLPA 2QKKA 3KLHB 4J9NA 5KFPA 3EZ5A 4CFDA 2Y1JA 3AA5X 2PZSA 4KREA 3FQKA 4RW4B 2D41A 2IC3A 3OSNA 2VA3A 1ZETA 3QEWA 4M95A 4CHOA 5FRNA 1QS4A 3L3UA 3G0ZA 3RBEA 4ID5A 4LSLB 2X6NA 4FM1A 4KRFA 1JLGB 1UAXA 4CHYA 3L8BA 4B9NA 3M9MB 5I42B 1NJZA 3DMJA 4M3YA 4DEZA 5KG3A 3AVNA 5DG8A 2FVSA 4CJVA 3UDLA 5JXSA 3Q8SB 3SCXA 1TVRB 1JLQA 3C95A 4ICLB 5KFAA 3DI6B 4NRUA 4KB1A 1S6QB 3NCIA 3KLEB 1YTUA 4YR0A 2XRIA 3HP9A 1IH7A 3D5MA 2AGQA 5KFMA 1N48A 1BISA 1S6PA 3AV9A 1RDRA 3AA4A 4BE0A 3QGGA 2OA8A 4O3QA 3QZ7A 2W7OA 4AHRA 4NCAA 3PW0A 1LWCA 4GC7A 1S97A 3LPTA 4PA1A 1BIUA 1DTQB 4G1QB 1WNSA 1T05B 1T7PA 3DM2A 4XPEA 5KFBA 3OL6A 4LSNA 3LP3A 3QIOA 2UUTA 2EC0A 3DLKB 3N6LA 4FJNA 4IRCA 1DLOB 1NKBA 3PW5A 3QZ8A 2JC1A 4PY5A 3THVA 1JLBA 1S49A 1A5XA 5DG9A 2JC0A 4E7KA 3MAQA 3PJWA 1GX6A 3E01A 3MECB 5SWMA 1RDBA 3BQ0A 3DDKA 1XR7A 3VQCA 2QKBA 3CIZA 5KFFA 4Z4GA 3PV8A 1EETA 3OVNA 3FDSA 5KG0A 1N6QA 2DPIA 1TP7A 1BQMA 1VRUB 1ZBUA 3QO9B 2CKWA 5KFUA 2B4JA 3KLGB 5C42B 2B43A 2XI2A 1BCOA 4LH4A 5DQGA 3V6KA 2G8KA 2IAJA 3CJ3A 3NDKA 4I2PA 4EO8A 4J9KA 3CFPA 3H4DA 4MIBA 3OYFA 4PQUB 2OPQB 4FS2A 3OL7A 3D45A 3ASMA 1U48A 1WSEA 1RT7B 4CFAA 3PUFA 3G6VA 4QCLA 1Z4UA 3K58A 5KFIA 4M94A 4O5BA 3GV5B 3L2VA 3PW2A 1HMVA 2Z1IA 1C1CA 3WNEA 4F4KA 4Q43A 1S5JA 4IG0B 2QXFA 5EWEA 1T94A 3MXJA 3RMAA 4O0IA 4ZP6A 4NLXA 1KVAA 4DQRA 4MQ3A 1ZBIA 4EBDA 1IKXB 4HYKA 3QESA 1REVA 4KV8B 3DOLB 1RT4A 2IM3A 2QV6A 3AVAA 4YFUA 2JLEA 2HHSA 5CY4A 4Q44A 1SL2A 2XY8A 1TAQA 4CGFA 3IG1A 4ZTJA 5KFZA 4RW8A 3V81B 1TAUA 3UPFA 3V9UA 4WZQA 1JXLA 5HROA 4FK4A 3VQEA 2RKIB 3NHGA 2V4RA 4TLRA 1RT2B 1C6VA 4E1NA 2NUBA 3OSPA 3QIDA 1RT5A 4ZHRA 3S9HA 3MTKA 1MMLA 3I0RB 1NNDA 4KHRA 3DLGA 2DFEA 5F8GA 2PYJA 3T5HA 3MXIA 3M8RA 3I5CA 4JUZA 1SKSA 3LP1A 4BDPA 3OYBA 4E89A 2XCAA 1S1WB 4EEYA 5J2QB 4K4SA 3BJYA 1W0HA 3VQ9A 2P5OA 1WAJA 4JV1A 1J5OA 4QW8A 2JEFA 4IH5A 2XO7A 4N5SA 3KJVA 3ISND 1D5AA 4DS5A 4EP5A 1BGXT 5F8LA 1KVBA 5KFLA 4J2AA 3VA3A 5C25B 2IM0A 1S48A 1Q9YA 3OS0A 4K4WA 1S1XA 2W8LA 2BANB 5KG1A 4C8NA 4DL2A 2ZD1B 2FLPA 4M3XA 2Y1IA 4WYWA 5KFSA 2BE2A 4OPKA 4DTUA 5KFHA 1JKHA 3DRPA 1RT3A 1SUQB 4B08A 3ZT2A 4KHWA 3GILA 2O5DA 3HPHA 4ZPBA 3CVKA 4I2QB 5HRPA 4KHUA 1NK6A 5DQIA 2OPPB 4ZVEA 4BE2A 2YNGA 1K1SA 3QYYA 2HWHA 3ITHA 5T14A 3G86A 3ZSYA 1ZBLA 3DRRA 3OYDA 2G8FA 4RNMA 2OPRB 3QETA 2UUWA 1NOZA 4CJKA 1A5WA 4ECTA 4CFCA 2HHTA 4LD0A 1CZBA 1UWBA 4CEFA 3H5SA 3HP6A 3K59A 4FLUA 3CDUA 1OS5A 5HBMB 2AX0A 2FC0A 2QK9A 3SFGA 1D9DA 1TKZA 1S0MA 3UR0A 1IM4A 1RBVA 4ZPCA 1SH3A 3ZSXA 4FJKA 3KD5E 4IFYA 2IOCA 3CFRA 4OKKA 3V9ZA 3TARA 2R8JA 4CF0A 3KLHA 3I5BA 3HPOA 4E3SA 5CYQB 1C0UB 4XIUA 3CYMA 1TV6B 1QHTA 2BDPA 1RTDB 3QINA 1WAFA 4RW4A 1EXQA 3VN5A 3LAMA 2YHAA 4WE1B 1W25A 1RA6A 4WFZA 1BIZA 2W8KA 4K4ZA 4RU9A 2YNIB 1RDAA 1MU2B 3SQ0A 4ID1A 4LSLA 4DSIA 4K8ZA 3ZSVA 3HPGA 4ELTA 2UVRA 1JLGA 4ZP7A 4F4ZA 4RUAA 5I42A 4CF1A 3VQ8A 3P83D 3PO4A 1RTJB 3H2LA 3LWMA 2X6SA 4J9QA 3QLHB 3N6MA 4ICLA 4KHNA 3DI6A 3UIQA 5HP1B 2R7YA 3KLEA 1TL3B 5KT2A 4Q8FA 1D9FA 4YR3A 4FLXA 2WK4A 4Q5VA 3OJUA 4J2EA 3CO9A 4QAGA 1XR6A 3Q8QB 4KKOB 4DLGA 5JS1A 2YNFB 3IRXB 4MKAA 4JLHA 1ZTTA 4CECA 1VSLA 3HL8A 3VQ5A 4MKBA 4PWDB 1DTQA 1RTIB 4G1QA 3LAKA 1T05A 1RT6A 2DPJA 3DLKA 1DLOA 3C6UB 1FXXA 1WSHA 4ELUA 3D0PA 3FFIB 2EHGA 1NJXA 2XY6A 4NLGA 3T19A 1N4LA 2GIQA 3CJ2A 3LANA 3MECA 4DTMA 5KT6A 2XGQA 1HNIA 4FK0A 3DLRA 3HVTB 1JIHA 3TABA 1RA7A 3KLFB 1VRUA 3KK2B 2I1RA 1TKDA 3QO9A 2WONA 3D28A 3KLGA 2AX1A 4LQ9A 4ECYA 1VSKA 1LWEB 5KRSA 2HW3A 4CIEA 4F3OA 3AO5A 3S3MA 4CF8A 2HWIA 3CM5A 2J6UA 1HRHA 4ED8A 1LV5A 4PQUA 3PR5B 1KFSA 2OPQA 2W9AA 5L1LA 5KFWA 4K4VA 3MEEB 4FJ7A 4FZYA 3RB3A 3TQ1A 3V6JA 1RT7A 3G10A 2RF2B 1VSIA 5KTQA 1L3SA 3DLBA 4QOZB 2UVUA 1XWLA 2B5JB 1RILA 3WNGA 2IM1A 4FJJA 1QAJA 1JLFB 4FCYA 2GBZA 4FVMA 4KTZA 2IGIA 1JLAB 4IG0A 3TWHA 1VSHA 1T03B 3M8PB 1U04A 1S4FA 1GOAA 4FBUA 3KKSA 4U7CA 5J2PB 4B9UA 1S9FA 3PZPA 4ED2A 4FZZA 2BQRA 4H4MB 4FYDA 2JEGA 4MFBB 3M8QA 3KLVA 3QEXA 3O3HA 1IKXA 2YKMB 2ZKUA 4YQWA 4JS4A 4KV8A 2ASLA 3RMDA 1QAIA 2D0AA 4OGCA 1S0NA 4ECRA 5L1IA 3BGRA 3V9WA 5EUHA 1RYSA 4B8CA 1D1UA 2G8UA 4FW1A 3ULDA 1EKEA 2FLLA 2XY7A 4KI4A 3V81A 1HQEB 4DTOA 4Y34A 3KK3B 4C8MA 2RKIA 2F96A 2V4QA 2YKNB 2C28A 4DL4A 1RT2A 4RNNA 3KTQA 4ED3A 1J54A 3DRSB 4KHQA 5I3UB 4B9LA 4DL3A 4ECXA 4BE1A 1UA0A 2C2DA 3I0RA 2R8IA 3CM6A 4NZ0A 4FLYA 4AHCA 2C22A 2FBVA 1X9MA 3AVBA 1FK9B 3BSAA 4Q8EA 2IDOA 4HHTA 3VQDA 4OPJA 2W9BB 1QQCA 3OLAA 1XHZA 1S1WA 4DTXA 5J2QA 3PX0A 4IR1A 1IKVB 1TKTB 4WZMA 3E51A 3G6XA 4H8KA 2KFZA 1RDCA 5HRNA 4OL8A 2R2TA 4CEQA 4DWIA 1XC9A 2R2RA 4WYLA 4F2SA 1XR5A 3JYTB 5C25A 1VSJA 3RMBA 4KAIA 3H40A 4JRQA 2XI3A 4AILC 5FROA 4IDKB 2BANA 5C24B 1VSEA 3VA0A 4F3TA 2ZD1A 1IKYB 4DFMA 1LW0B 1S1UB 1KVCA 3NAHA 5CZ1A 5KFXA 4JS5A 4ECWA 1QE1B 1SUQA 3V1RA 5J1EB 4HUGA 4F4XA 5CYMB 4CHNA 4I2QA 1RCHA 1TK5A 2OPPA 3RAXA 1W9HA 4EZ9A 1LW2B 1NK9A 2BGGA 2FVQA 3CJ0A 2OPRA 1KHVA 4GVMA 4IKFA 4FJHA 2AGPA 4E7IA 4MIAA 5K14B 4R5PB 4RW7B 4DSKA 4URGA 3PY8A 3KMQA 4ELVA 3GIMA 4J2DA 1O1WA 1KLNA 4K50A 1C0MA 3NGDA 3T5KA 1ASUA 3KMSA 4URQU 3I0SB 4Z4FA 4Z4IA 3NF9A 1VRTA 1TL1B 4WXOA 2OZSA 2WB4A 4NLYA 1S1VB 4RW6B 3KLIA 2IBKA 3HYFA 4FJGA 1JLEB 5CYQA 3MFHA 4Y1CA 4Y3CA 3LDSA 4DG1B 1RTDA 4IH6A 4GMJB 1NK7A 5KFJA 4JRPA 3G6YA 4CESA 4DFPA 1CSJA 4ZP9A 5KG7A 4DL7A 3V6DB 3A2FA 3NGIA 5EWFA 3RR7A 2YNHB 1S0OA 3HKWA 1NJYA 2YNIA 4HUFA 1MU2A 1BQNB 3QNNA 2ASJA 3CG7A 3PVXA 4M3UA 1WSGA 3KIOA 3ZSRA 1Q9XA 4O4GB 4IR9A 3CDEA 1EP4B 2XGPA 1K6YA 4B3OB 4KFBB 3QIPB 3NMAA 2GUIA 5C5JA 3NF6A 1RTJA 3OYIA 4XO0A 3AVHA 4DL6A 3PR4A 3IS9B 3N6NA 4KBIA 3QLHA 2Z1HA 2WHOA 4HVJA 2C2RA 1KSPA 4QWAA 1IKWB 5HP1A 4FJLA 1TL3A 2OPSB 2J6TA 2D3UA 4WXWA 5KFVA 3MR6A 2FBYA 4CK2A 4FW2A 2OZMA 4ZP8A 4CJ5A 4KKOA 1B9FA 2YNFA 3IRXA 4WFXA 3WNFA 3SJJA 1B9DA 3O4NA 2JEJA 1VK0A 3AO3A 2IS3A 2KW4A 4PWDA 1RTIA 1WN7A 4KHMA 4KI6A 1VSFA 1KCFA 4NCBA 4W5QA 1RBRA 3C6UA 3RMCA 4Y2AA 4N41A 4NRTA 1Q8IA 4BWMA 4ED6A 2IJNA 5KFQA 3LZJA 3V4IB 3NF8A 2WOMB 3HVRA 4EYHB 3HO1A 4BWJA 2B6AB 3RRGA 4CERA 4CJ3A 2ETJA 1HNVB 5JUMA 1S1TB 4H4OB 4ECSA 3HVTA 4FLVA 4N47A 4ECVA 4UQGA 3SZ2A 4J9OA 4DQSA 3AVCA 1S9GB 3BR9A 3KK2A 4OKEA 3NL0A 1SL1A 4GW6A 4K4TA 4IG3B 5KG2A 1WSFA 1LWEA 5J2MB 4WFYA 3CFOA 3H98A 3ZT4A 5T7BA 3OL9A 3WNHA 5JS2A 4GC6A 4Q0BB 3T1AA 4CEDA 3MEEA 2FBXA 4QPXA 2R2UA 2R8KA 2RF2A 1UA1A 2W42A 4KTQA 2B5JA 3V1QA 2ATQA 2XY5A 3CQ8A 1JLFA 3DLEB 4KAZA 1HYSB 1TQLA 4CHZA 1S9EA 1N5YB 2HB5A 1U45A 4CIFA 3KK1B 2HNYB 4W5TA 3M8PA 4DL5A 4CF9A 3H5UA 5J2PA 5D3GB 1BL3A 1CLQA 4HCBA 3PHEA 3OYAA 3E01B 1S10A 4H4MA 4MFBA 4TYBA 3ZT1A 1YVFA 2ZE2A 1RYRA 4AHUA 4OLBA 3IGVA 4Y2CA 1L3TA 4EO6A 3JSMB 1LAVA 4YP3A 3AVKA 3L2QA 4DTSA 4J9MA 1BQMB 3Q8RB 3DLHA 2P51A 3SPYA 3LP2A 4Z4HA 5KT3A 4FLTA 4KB0A 4ECQA 4CK1A 1L3VA 3K5MA 3KHGA 1HQEA 3PW4A 3K57A 3MEGB 3KK3A 4CGGA 2YKNA 3ICLA 4CK3A 2YV0X 3OYGA 4FJ8A 3S3OA 1TKXB 3DRSA 4DU1A 5I3UA 4IFVB 3GV7B 1J9AA 5KI6A 1CXQA 3VQAA 3ZCMA 3KNAA 3KD1E 1FK9A 1SH0A 4ECZA 3LWLA 5F8IA 4PUOB 4CGJA 5KFOA 2W9BA 1Z26A 1NKEA 1TVRA 3C94A 1LWFB 1IKVA 2D0CA 1TKTA 1FKOB 2HMIB 3HSTB 4G3IA 3SUOA 2DY4A 1S6QA 3SNNA 2D5RA 4L8RB 3L2WA 3NF7A 5DG7A 4DSJA 5KG5A 4EBEA 3ZT3A 4E7LA 4O44B 3RB6A 1NHUA 1NK4A 4ZVFA 4FXDA 1K1QA 3JYTA 4M3WA 4ED7A 1L5UA 4IDKA 3VQ6A 1WNEA 3O4QA 1DTTB 5KFTA 1IKYA 4E1MA 1LW0A 1S1UA 4OGEA 2HHQA 4Z4CA 3PO5A 3RBDA 4CEBA 2W9CB 5KFDA 1D8YA 2DFFA 4F4WA 1QE1A 3GIIA 2KZMA 4F8RA 2XHBA 3IG1B 2HAIA 5CYMA 4FJIA 3RAQA 3Q8PB 1RTHB 2AGOA 3HM9A 4NLQA 3MR2A 4MK8A 2I5JB 4CHQA 5L9XA 5F9LA 5KFNA 2HHVA 1LW2A 4FM2A 1C1BB 4CE9A 4CJTA 3SUNA 3NFAA 2BQ3A 1D0EA 1QSSA 4O3SA 4DLEA 5K14A 5KG4A 4FJ5A 1NJWA 4RW9B 4R5PA 4RW7A 4R8UB 4CHPA 3DOKB 2HNDB 4CGHA 1Y97A 4KO0B 3AO4A 5C42A 4RUCA 3BQ1A 2IM2A 3PX6A 5KFRA 3OYMA 4CJQA 2HNZB 3I0SA 3TANA 2VG7B 3EY1A 2FBTA 1TL1A 1J5OB 2BQUA 4KHSA 3LP0B 3ZSZA 4CEEA 1S1VA 5CZ2A 4RW6A 2QE5A 1JLEA 5KFGA 3RR8A 4HUEA 4OJRA 3AVIA 1WSJA 4YNQA 3U6FA 3RB4A 3V6DA 3HJFA 5HRRA 4EP4A 1TK8A 4N76A 4CJRA 2YNHA 4R0EA 1JL2A 1RDDA 3QEIA 5KFKA 3H4BA 1BQNA 4CJWA 2E9RX 4CCHA 3DRPB 4CFBA 3RWUA 4I9QA 2WCXA 4NLDA 4O4GA 2CJQA 4TYAA 4Q45A 3HHKA 3K5NA 2VG6B 3ZSQA 3NBPB 1VSMA 3QGIA 4B3OA 4KFBA 3FSIA 3QIPA 3C6TB 4CEAA 4Y1DA 1JL1A 3H5XA 4CGIA 4M45A 4IRDA 3TAPA 4AHVA 2IA6A 3DOLA 2O4GA 2O4IA 2PY5A 1IKWA 3T5JA 3EPIA 2OPSA 3B6PA 4AHTA 3SPZA 5KT4A 1B92A 4ZTFA 4FJ9A 1HQUB 4DU3A 4OVLA 4ZMMA 4DFJA 3KHHA 2D7SA 1ASVA 1LAWA 4NYFA 3GIJA 2OH2A 4CEZA 1IO2A 4IBNA 3AO2A 1L3UA 4ZVGA 5F8NA 1RT1B 4K4UA 4F4YA 3PX4A 2XWYA 3SFUA 2E4LA 3RRHA 4BACA 4I7FB 3TAEA 4XPCA 5KRTA 3HVAA 5EWGA 5KFYA 3H5YA 2VWKA 3VQBA 3V4IA 2WOMA 3ZSWA 2B6AA 1GX5A 4C8KA 2VG5B 1HNVA 5DMRA 3L2UA 5FRMA 1SV5B 1FKPB 1S1TA 2V0NA 4H4OA 4DMNA 4E0DA 3U3GA 4B8AB 4EBCA 3KOAA 4H54A 2X78A 1S9GA 1R0AB 2XC9A 2E6LA 5FDLB 4J2BA 2FJXA 4NYZA 1NK0A 2D3ZA 3GYNA 4KTWA 4E7HA 4IG3A 1T3NA 4DTNA 5J2MA 3NGZA 2PYLA 4NLWA 3OYJA 4RNFA 4ZPDA 1HYZA 5L1KA 3QERA 4Q0BA 4RNHA 1KFDA 4AHSA 3ISNC 3SV4A 5F8JA 2FJVA 3AVMA 3K5OA 4B9TA 2WRMA 2W7PA 3DLEA 4ZPAA 1RBSA 1HYSA 4NCGB 1N5YA 4IKAA 2ATLA 3SI6A 2G8WA 1RT6B 3KK1A 2HNYA 3NH1A 3OY9A 4DSFA 1NOYA 3H08A 4DTJA 3GQCA 5E41A 4W5OA 5D3GA 1RAJA 3OYKA 4FLWA 4M3TA 3OYCA 4CJSA 5HBMA 3NE6A 3B6OA 4NYNA 3RTVA 3TAQA 4HTUA 4CEOA 1KLMB 2G8VA 2YHBA 4YR2A 1HPZB 1HNIB 3JSMA 4TY8B 4HKQA 4NLRA 3VQSA 3MXMA 1QSLA 4FBTA 3AVGA 2GV9A 5KFCA 1F21A 1A5VA 2WONB 2VWJA
chains in the Genus database with same CATH superfamily
1BCMA 2AJ2A 3KFWX 1V4SA 2Z8QA 1C0UA 2KXHA 3UWTA 1LOUA 3DXKA 2WC9A 4ZS6A 1ZBHA 3L09A 4DQ8A 3AO1A 3CDAA 2KTQA 2HBYB 3VQ4A 4FJMA 1I94K 1NDLA 3WXKA 4DR7K 1X9SA 1FNOA 4PPDA 4C6AA 3KUEA 4ZCMA 2AEMA 2RILA 4CT9A 5LJ3Y 4DV2K 2WUSA 3IM8A 4DV0F 5M1QA 2HHWA 8AT1B 2C3MA 3S7RA 3BDPA 4MK9A 1KEKA 1LWFA 2BRLA 1B70B 1EQYA 3OTOJ 2MQOA 4ZKAA 2JEIA 2WBNA 2EWHA 4DX7A 3IO1A 4B3SF 5A8RA 1CQMA 1RBUA 1RNHA 2NSCA 2CJYB 4JI6F 3T1HJ 2LEAA 3HHLC 4O44A 3TSUA 3PKMA 2E2OA 2ZNZA 3IAYA 2X74A 2RUGA 3ILLA 2ZH5A 4ZPVR 1YI2S 5A2QY 2CNLB 3FUYA 4IH7A 4BR9A 1YK9A 4O4RA 1BI4B 1OIAA 3IWLA 2KFNA 1UOCA 3CNQP 4RL1A 4GRSA 3W9JA 3P96A 1U1RA 4FL9A 1QY7A 2QMWA 5K8NA 1UW4A 1H2UX 1YT3A 2CIMA 2VD3A 1BU6O 3LGMA 5M1OA 3HK2A 1UEVA 3SYZA 1HR0J 5DGAA 3CWJA 3OHAA 4R8UA 2YHWA 4C8LA 2F8SA 2HNDA 4KO0A 3DMJB 1GXLA 1X1PA 4FXVA 3D66A 2IMWP 4A62A 4B3TJ 4CM0A 4BDYA 1JLQB 2VG7A 4M5LA 1I3OB 2QYGA 5E0OA 1Y10A 1R0CB 1VQPN 5L38A 1CULA 1RBAA 3ZEUB 1KR4A 4FYYB 3EDQB 3L4IA 2MSSA 2NQPA 1S6PB 2FHKA 2FVPA 4Z0UA 5AQJA 2LKZA 4CGDA 2CNKB 2NRVA 5BPMA 2VQFK 2YWFA 4XTTA 3M4XA 4LBHA 5HO4A 4LSNB 2DY1A 2G8HA 3W60A 4WTYA 4M3ZA 5GIOA 3WEEA 2KB2A 1NK5A 1X9WA 2VG6A 5KGWA 1R3NA 3T3FA 1ATNA 4RJVA 3BSCA 1VQMN 4C7QA 2YJEA 1FRJA 1Z25A 4H5NA 4IQXA 4RG8A 2V2KA 1NBWA 5BR8F 1IBKJ 3CMAS 4FJXA 5H9FJ 3C14A 5DM7Q 2LSNA 2WTFA 4RUBA 3Q7BA 4JI7K 2DIUA 4JP8A 4FK2A 2GO9A 4HWIA 4CJLA 1NK8A 4ES1A 3ENWA 3MCMA 1UEKA 2VBYA 3OL8A 3HXMA 2RQCA 1WOOA 4ZITA 4BDZA 5BRFA 3M6XA 3KLIB 4J91A 2N7CA 2QMXA 4NASA 4C8OA 4KE5A 2VIHA 2K1RA 4K4XA 4KSEB 2QTDA 4RBUA 1N32F 2CADA 4X65K 4JBCA 2EBGA 4EWTA 2VG5A 1HNWK 2VONA 4DQIA 2P9UB 3MR3A 5AQHA 2K2PA 1W2IA 2DH7A 4BC4A 2G9OA 3HKZD 5IXUA 4FZXC 2X3DA 4CJEA 5FDLA 2YPZA 2VQEK 1WG5A 3FMWA 3WX4A 3BO3A 3JSBA 2L9DA 2GUPA 5M2UA 2DNQA 2YHYA 4JI3K 4XH1A 1OH7A 5I3PA 4ZVTB 2FHOB 2ZUGA 2Q3SA 2H4YB 3OS2A 1RCOB 2YKPA 1T9VA 1VDHA 3BO2A 1N5SA 4K4YA 1MWMA 2G0JA 1R89A 3L4QA 4R0JA 4M41A 1J5EK 1RKIA 2NRHA 4IOAL 2RE1A 2A3ZA 2UXDF 2Z1JA 1KAXA 4JI0F 4DZ6A 3VEXA 1HYVA 4MYTA 4LY7A 1VISA 2PE8A 2CQIA 2ZBQA 3D68A 3CQYA 1KLMA 4IRKA 5SZTA 2CJAA 4PKIA 3FQLA 2HBZB 4TY8A 1X4GA 3LPUA 3VQQA 3PYGA 3M9OB 3T1YF 2Y3YA 1NGBA 1QZ6A 5JVHL 3U3YA 4FWNA 4MH8A 4DFKA 2CNOB 4N56A 3ZFVA 2NXCA 4QWBA 3QSYB 1KP6A 1JXBA 5J2NA 3CIPA 3ZSOA 3CCQN 5AQMA 2BE2B 4K5SA 2ZBIA 5DS7A 1NM1A 4C97A 2JGUA 1U49A 4TXSA 2F40A 3THXA 2XS7A 3TAMA 2XSJB 2LQ9A 2CPJA 2O8EB 3QGHA 4YHHJ 5GMKa 1UETA 3OYHA 2UVVA 3NGKA 3JSYA 2DGWA 4ITSA 4M42A 5BR9A 1X8DA 3AVFA 3RG6A 3K9KA 4NXMJ 2E9ZA 1X3MA 5D4NA 1XJWB 1G15A 5E3CA 3B4MA 2A2CA 1KQGB 3OW2M 4BR7A 2UVWA 4YOXA 1YJNS 2BW7A 2BKOA 5DGBA 3M2VB 4YUDA 2FC8A 4DR1K 4IFYB 5FPDA 1JMTA 1VQNN 2GJ2A 3ELHA 2DYAA 4YEAA 1CJTA 3BH6B 4NLPA 3H3OB 4IO1A 5AJ3J 4J9NA 4DV4J 1YSJA 1P1LA 2Y1JA 4RW4B 2D41A 2IC3A 1TL7A 1T0TV 4WFNQ 2VF3A 3QBWA 5FRNA 2V5HG 1KOOA 1KS2A 2CQGA 3RBEA 5MLCQ 2J4RA 2FGCA 4E2FB 1F1BB 1YGYA 4B9NA 2P9SA 1RP5A 2QA4G 5KG3A 1SAZA 1K8AO 3VEWA 2RJZA 4CJVA 4B1WB 1UJ5A 1O6XA 3LW5C 3SCXA 3C95A 1UVKA 2UUBK 5KFAA 3DI6B 4NRUA 1RCXB 3NCIA 2POKA 2J7WA 3BH7B 1RBLA 1RGVA 2QT7A 1N48A 1BISA 4JD2B 4U96A 3GE1A 4NCAA 3RYLA 1LWCA 3PW0A 1SQGA 2EXUA 1WDTA 2FF6A 1S97A 2DT9A 1DTQB 4G1QB 3DM2A 3OL6A 1HBNA 2W25A 3ZZOA 4FJNA 5IWAJ 3TEGA 1Q7YO 2JC1A 1S22A 3OTOF 3THVA 3T6JA 5CXTA 2OI2A 3CC2S 1UZHA 5KOXA 4E7KA 1GX6A 4C0HA 1RDBA 3BQ0A 3T1HF 4HVZA 2QKBA 3CIZA 4Z4GA 4LMZA 4JI1K 2D4WA 3SSSA 3PV8A 4QU6A 1URNA 3A3OB 1N6QA 2Y9HA 2AZ1A 4ZVUB 2CKWA 4YDXA 5KFUA 2KT3A 3KLGB 1EHWA 2W2MP 1ESVA 5T7LB 4OZ1A 2PMWA 1RHJB 4YY3K 4ANEA 3VPZA 3P45B 1EZZB 3SAHA 1UJ6A 2PN6A 3GDQA 1OYEA 4CH0S 3OL7A 2AV5A 2LDIA 4M5NA 1WSEA 3K8WA 2AYGA 3SXLA 3G6VA 1Z4UA 2EFVA 1HR0F 3TA1A 1RAOA 3PW2A 2GGPB 2E5LK 1C1CA 4MDAA 2DXEA 2JFKA 4IG0B 2CA9A 4PZVA 2FJDB 4B3TF 3CCLS 1HL6A 4BRMA 3LM9A 1FRMA 2Z2YB 3O08A 1H6KX 2B8PA 4MQ3A 4H0TB 2KT2A 3NCQA 4DR2J 4EBDA 5AZJA 4H0VB 4HYKA 3QESA 3M2RB 3DOLB 4ZDNA 1QVFM 2CH6A 5C2CA 1FRHA 3CGIA 3VTIA 3EE8A 1Q82O 5CY4A 3ISZA 2VICA 1TAQA 4KGVB 3IG1A 1PC4A 5HSPA 4RW8A 3V81B 1TAUA 4ZLPA 3ZTOA 2Q6CA 4S0MA 4FK4A 3UE2A 4MLEA 3BYRA 2L9WA 5LSLA 2BJ8A 2Q36A 3EICA 4E1NA 2NUBA 2O67A 1TL4A 1RT5A 5ITHA 5LJ5Y 1MMLA 4WKYA 2ZBPA 3G87A 5F8GA 3MXIA 1LFWA 1IBKF 2MGZB 3DOMA 1RHRB 2BM0A 3Q89A 1SKSA 4OX7A 5FLXU 1U26A 4NE9C 2XCAA 2HLTA 4ER8A 4K4SA 1K73O 2DNMA 1N34K 4CO3A 2F65A 1NXIA 1FJGJ 2NRZA 4HDGA 4JV1A 2Y0BB 5KPTA 4HR2A 2K7JA 3KJVA 4M5KA 1D5AA 4EP5A 1FVSA 3A5NC 3N28A 1HI0P 5HQ8A 5KFLA 3VA3A 2HRTA 2IM0A 4K4WA 3F44A 5KG1A 5CH7B 1FNMA 2NYHA 4WYWA 2KLAA 4B1XB 5KFHA 1RT3A 1SUQB 3R6MA 5IZHA 5M2PA 4KHWA 1Y0HA 3GILA 2O5DA 4NA1A 1FESA 2EW9A 3MM8A 1VQOS 2YCHA 4GKKK 4KHUA 5DQIA 2OPPB 2V34A 4ZVEA 4PG7A 3HX9A 2HWHA 3MDFA 4CLZA 5K8PA 1ZBLA 1K8AT 3DRRA 2G8FA 2MKHA 2RDDA 2A2DA 5KQDA 4CJKA 1A5WA 3DGPB 4NZ6A 4ZJLA 4FLUA 1FXDA 1OS5A 3W5ZA 4BVPA 1Q7LB 4QYRA 3CJ1A 3SFGA 2H1YA 3BP8A 2E1AA 4DHVA 3QT7A 1KDNA 2NZCA 4CZJA 3CB4A 3BS9A 2R8JA 1GLJO 2CQ4A 4YN3B 3I5BA 3HPOA 3VESA 2B4PA 4NL5A 1Y5IB 1QHTA 2BDPA 3U1MA 3J80O 1KVJA 3QINA 2J0QD 2YHAA 4WE1B 4OZNA 1B3TA 4B3SK 1W25A 1RA6A 4WFZA 4JI6K 1KC8O 3G2XA 3CCSS 1HFEL 4LT6A 3FZLA 2W8KA 3M32B 2QEXN 2CQ0A 3A3NB 1T3VA 1OYDA 4JYAJ 3CCRN 3ZSVA 2DK2A 4JOUA 5DDQC 1YBUA 1OQ6A 5B0EA 3H2LA 4WWSA 1FFGB 2WVFA 4J9QA 4JNEA 3QLHB 3N6MA 2BKNA 1RAHB 1IWGA 3SAFA 1VR6A 2GWJA 1TL3B 5KT2A 1D9FA 1I51B 1MWZA 4FLXA 4Q5VA 3OJUA 2RRAA 4J2EA 2UP1A 4A59A 3RGIA 1HKCA 3RUBL 3Q8QB 4KKOB 3HMJG 3IRXB 5A8KB 1GMWA 2QJ3A 3EEQA 3HL8A 5IT9Y 1T05A 4YHHF 2FC9A 2DPJA 3Q86A 3FZKA 3DLKA 4FOEA 3TYTA 1JJ2R 2M5YA 2VB6A 2MKCA 4NLGA 2CVIA 2HG4A 4DJBA 3LANA 2HVEA 3A0IX 4NXMF 4JK8A 4DTMA 5KT6A 2QWLA 1AT1B 4A2AA 3ENQA 1HNIA 3HVTB 1FFSB 1UFKA 1IR2A 3KLFB 2I1RA 1PILA 3QO9A 3D28A 3CXCM 1ZS6A 4M5JA 3CULA 5KRSA 4M5DA 1NM2A 2VBXA 4DV4F 3S3MA 4LF9J 1TZ0A 1W26A 2BJ7A 4ED8A 4PQUA 2OPQA 3IR7B 1SJFA 1N52B 3J7AN 3RB3A 2HSTA 4G65A 3G10A 1KBRA 2UVUA 1UCNA 2B5JB 4FJJA 3W63A 1QAJA 1FDDA 1S6UA 1UAWA 5BR8K 4FVMA 2GBZA 3TX8A 2IGIA 4BRCA 3NGTA 1VSHA 2C2ZB 3EUNA 1T03B 1C0FA 1R6VA 1PJ5A 1S4FA 1GOAA 4FBUA 3KKSA 1K73T 3HOSA 1S9FA 4DUTA 4ED2A 1TR0A 4HHUA 1BQXA 3KJFB 2DNPA 2OCEA 4H4MB 3M8QA 4YORA 3QEXA 1X4HA 4YQWA 4KV8A 3ZTQA 1S0NA 3EGZA 3MWBA 5L1IA 3CQXA 1SC3B 4OIXA 1RYSA 4B8CA 5CHIA 1N32K 5ELZA 1K9MO 3W64A 2FLLA 4I69A 5IWAF 3VGKA 1FRIA 3H8YA 2AEJA 4V19S 3OVSA 2RKIA 2MLYA 2QI2A 4IEEA 2YKNB 3T69A 2C28A 4DL4A 3O9TA 5DM6L 3V5RA 2VL1A 4WQ5C 2C2DA 4NZ0A 4FLYA 4H0XB 1GXTA 3BPDA 5GVQA 1FK9B 2J5AA 3BSAA 3ILJA 4Q8EA 2NPIA 4HHTA 5IC4B 1YTYA 3C2PA 3IKMA 3ZLJA 2V68A 5J2QA 3BV8A 4CLYA 4ZLLA 3IXQA 5JJBA 4IYQA 2V4JA 4H8KA 2KFZA 1BDGA 1OO0B 4CEQA 3I82A 1VQ6N 1HX1A 4WYLA 4PKDB 3JYTB 5C25A 2EFPA 2EI5A 4KAIA 2UXDK 2CNNB 4F9OA 2XI3A 5FROA 4IDKB 5C24B 1ZA2B 2WBRA 9ATCB 3OBIA 1HBOB 2LQ8A 1SQKA 3CCMN 1UFLA 4ECWA 3V1RA 1WUUA 2CPYA 3BF1A 4DV1J 1ZBSA 2IRXA 3RAXA 3T1YK 3VGMA 2NXUA 2BGGA 1KHVA 4DR2F 1H7XA 3R8EA 4WU3A 5L46A 4IKFA 3CD7A 2L41A 5K14B 2R3VA 2JOQA 3I56S 4ELVA 3GIMA 2VHGA 3HSDA 1DY3A 1C0MA 4DX6A 3E66A 3C19A 4AL5A 1VRTA 2YXLA 3W2VB 4IOCL 3HYFA 2B9XA 2QX0A 1PJ7A 3MFHA 5DZ6A 4Y1CA 1YJWS 5HAOA 2Z58B 4O5FA 4B1ZA 2RD5C 3G6YA 3N79A 4ZP9A 4F0MA 5AXKA 3NGIA 5C2GA 4GV3A 2Q6BA 2HVZA 4AYBD 2ASJA 1NMDA 3JS6A 5AQGA 4FZVA 1Q9XA 1PYOB 3SMSA 1FJGF 1SI9A 5D15A 4B3OB 4KFBB 3I4HX 3FK4A 2NZ4A 2GUIA 5C5JA 3NF6A 2PIIA 1RTJA 4EMDA 4QYZK 3PR4A 3IS9B 3N6NA 2DB1A 3R2DJ 4KBIA 1DQAA 2Z1HA 2MJUA 1VC5A 1GAOA 3U1NA 1IKWB 5HP1A 2ZGZA 5JICA 4V19X 2P9EA 2J6TA 4WFBQ 1KOHA 3ONQA 3MR6A 4CK2A 4DCHA 3EO3A 3GJQB 4JB8B 2J76E 3TR5A 3G4SS 4CM2A 4J37A 1U8WA 5GINA 5LJVA 3DHWC 1FDBA 3ZTRA 3AJ1A 2WVDA 2R7XA 4DPOA 5JVGL 1E4FT 2GMHA 2DBBA 4WFAL 1FX2A 3OV7A 3AO3A 3UKRA 1RWXB 2P9IA 4PWDA 1RTIA 2P9LA 2XYPB 2L48A 2D1KA 2BMBA 3MPWA 2KKZA 2VGMA 4IJNA 1NGEA 3CJ8A 1HPMA 4W92B 2IJNA 5KFQA 3LZJA 3GCWP 4DR3J 3NF8A 2WOMB 1CS4B 3HO1A 3VZIA 4BWJA 3HHDA 3SDEB 3G71N 2ZH3A 2BVZA 4ECSA 4FLVA 4N47A 1S7HA 2WBMA 4DQSA 3BR9A 4NA2A 3NL0A 3HZ6A 1T9UA 1YJ9N 2PGCA 2BJDA 1K9MT 1LWEA 2MKSA 4AQYJ 4WFYA 3OUYB 3OTOK 5A76A 2DGXA 4W98A 1VBYA 2JWLA 3T1AA 4CEDA 4X4SA 3T1HK 2HGLA 4QPXA 1WDDA 2R8KA 3D1QA 5CAAA 4XDDA 4WK3A 5HI7A 2MQPA 2ZWHA 3QJJA 4JYAF 2W42A 3CCZA 2XY5A 4BROA 1JLFA 4YS2A 3WBZA 4CHZA 1S9EA 1N5YB 2HB5A 1NO8A 3PRDA 1U45A 3KK1B 2HNYB 3BKTA 2V7ZA 4W5TA 1PKUA 1W2BM 2V2VA 3M8PA 3EXCX 4LFCJ 3IBCB 3BKFA 1BL3A 1WBDA 4HCBA 1HNZJ 5CD4H 4LR7A 2HWTA 3UN5A 4MFBA 3D2EA 1O8BA 2FGOA 3N4PA 4B9QA 2ZE2A 3GG1A 2HVDA 1MMDA 3M1VA 3UKUA 4J9MA 1HR0K 1BQMB 2NUUG 3DLHA 5KT3A 4FLTA 4ECQA 2EFGA 2HQFA 3K5MA 3ENHA 1Z2ZA 2IVMA 3KHGA 3KVGA 3UI3A 3CJ9A 5SUHA 1M90O 4B3TK 4EGLA 3DXKB 4CK3A 5D0RA 2WTUA 3DRSA 2XSFA 4ZJOA 1XQSC 5I3UA 1MMNA 4PWWA 2E66A 5AQIA 4LF7J 1J9AA 3AAQA 4UUWA 3VQAA 3KD1E 3POTA 4M5HA 1X31C 2AYBA 1PBAA 5A2QU 2H65B 5KFOA 1Z26A 2CZVC 2KJWA 2HRUA 2W01A 3M8WA 1TVRA 1LWFB 1IKVA 4JI8J 1S6QA 4LF9F 4L8RB 4MT1A 5A8RB 3NF7A 1VBZA 1UVJA 4K25A 4QZVB 4O44B 1E3MA 2WB1D 2HBJA 3MM7A 3EX7B 1YIJS 1XC3A 2B56A 1L5UA 5KFTA 1IKYA 1S1UA 3MUMP 2CZ4A 4Z4CA 2JLGA 3L3CA 3RBDA 1IBKK 1ZC6A 1QE1A 3GIIA 2JWNA 3K17A 2P9GA 5H9FK 4FJIA 3UDCA 1GTHA 2VBWA 4UY8T 4NLQA 2DH9A 4MK8A 4Z2XA 1Q16B 5F9LA 1REGX 3HLUA 2HHVA 1RWKB 3S01A 4LVNP 1FRLA 3NFAA 2HS0A 2XMJA 1PGZA 2BQ3A 3TPQA 4DLEA 2O66A 1FW6A 1MWYA 1N5VA 3CD6N 2DGUA 4R8UB 2H3GX 4YOTA 2HNDB 4KO0B 1X5OA 3AO4A 1YWXA 1D9AA 4DKWA 3CCMS 3PX6A 2IM2A 3JAMU 3OTDA 1NDCA 2XMKA 2VG7B 5C2FA 1HIYA 5GAGP 2P8IA 2ROEA 1J5OB 3QPIA 2C3YA 2DY9A 4NB4A 4WFBL 4YDUA 2ADCA 4RW6A 3FJ2A 3B82A 2CGLA 1JLEA 4UF4A 2IY5B 3AVIA 2F4VJ 3HI0A 4HACA 3T41A 3C66A 4EP4A 1TK8A 3QAUA 2YNHA 3H4BA 4LF4J 5AQWA 1U1OA 4CJWA 2OTLS 3WEEB 4NLDA 3PIPL 2CJQA 3K8VA 4UW2A 4IJAA 2VG6B 5GAHI 4CEAA 3QT6A 4E1JA 1Q4RA 1JL1A 4CGIA 2JSXA 1YAGA 5EOYA 5ADXA 4J5OA 4F0HA 2O4GA 1N33J 3T5JA 2OPSA 1YG0A 2D9PA 4AHTA 1YJVA 3ZNUA 5KT4A 3CCUS 1B92A 4ZTFA 2HF3A 1B0VA 4BHQA 3VALA 5AQVA 3PYEA 2HMPA 2X1FA 4ZMMA 3ET6A 1VAZA 3DDIA 2D7SA 1ASVA 1BA1A 4FWPA 4C2MA 4DV1F 2O8BA 5IV3A 1H0HB 3AO2A 1NSKL 1L3UA 2RNEA 4X4TA 4F4YA 6AT1B 4CP5A 1QVFR 1HHQA 2E4LA 1NMEB 4BQZA 1VQ5S 2K1RB 5EWGA 1F5BA 3H5YA 3V4IA 1UTAA 2WW8A 1U1LA 2B6AA 1GX5A 2VG5B 1VLYA 1HNVA 5LXRA 4E0DA 3UW1A 4ILJA 3LA0A 5ETSA 4H54A 2XC9A 5FDLB 4J2BA 2KXNB 2V6AA 3BBFA 2DH8A 3IMQJ 2D3ZA 1EQMA 3VAFA 3E1YA 4IG3A 4YHHK 4I0WA 2DR7A 5J2MA 4J7CA 5HMWA 5M1PA 1GEHA 1YJTA 3AD9C 4ZPDA 4OYOA 1N8RO 2ASMA 1EB0A 4K2XA 4F25A 4OX9J 3HSGA 3MUVP 1WUAA 4GNIA 1KFDA 2LQ5A 1AUSL 4JKEA 4NXMK 3SV4A 1DZ5A 2XS5A 2W7PA 4QIGA 2AJ0A 3DLEA 1RBSA 1HYSA 3OA9A 3SI6A 3NH1A 3HFVA 4DSFA 2VYPA 3O2IA 3FSYA 3MX2A 2WVEA 3GQCA 5EX0A 5ETTA 5D3GA 2R9LA 2F8MA 4DV4K 1GXUA 4NYNA 1KLMB 4GVBA 3R1HA 4TY8B 2XQCA 4HKQA 5D4PA 2ZJPQ 3AVGA 3NCPA 1JCFA 3JQMA 4OJGA 5KFCA 4DV3F 1A5VA 4GKJJ 2VWJA 2OO4A 4PXCA 3TVZA 1ZAXA 3UB5A 3M8SA 1TV6A 3BREA 3KHRA 1SJQA 1U0HA 2J8AA 3MEGA 4DF4A 1VHFA 2YWWA 4A8OA 3I9V9 4GV6A 5THWA 5J2NB 2APOA 3ZO7A 1A6LA 4NEZA 4DR3F 5F9NA 3H90A 2KFYA 5D0HA 1G4CA 2VOPA 1RI7A 3IGNA 2M7SA 5LMUJ 5AZIA 1N0VC 3THXB 3D4JA 2NNWA 3TAMB 3GV8B 2GQQA 3KWGA 4EFHA 3CDBA 4OHWA 2GNKA 4F50A 4PUOA 2P1JA 3UN3A 2NLWA 4QWEA 2EKNA 4AFFA 3VAKA 3JTPA 1I1GA 4TQRA 4AD6A 4AQYF 5IWAK 1HARA 2HMIA 3TR8A 4NLUA 1FD8A 5K20B 1X5PA 2NCKL 5BN9A 5BJRA 4I1TA 1CZ9A 3W5XA 3BQ2A 2W2NP 2GVDA 2OMLA 1CXUA 4QIFA 4H03B 2A6AA 4U6PA 4A8KA 3BGRB 3C7NA 3ZZ0A 2FZKB 2HFSA 3EVOA 2HHUA 1CJTB 1NHKL 1NKCA 3AARA 2DIVA 3PW7A 1IUJA 4NLBA 4LFCF 4EYIB 4X4UA 5L1JA 2PT0A 2IC3B 3PIOL 3VWSA 4ENOA 1TL7B 2E5IA 1DQ8A 1HNZF 3E3XA 1NEEA 4BRPA 1C1BA 1OJ4A 3L4BC 4KR0B 2R2SA 4U8VA 1X4AA 1X4EA 2QXLA 4RW9A 2C2EA 3TAFA 3T5LA 1HI8A 2HIQA 2P9SB 3O3GA 3SQ2A 3S8SA 4WIIA 5GAHU 3ZX2A 5HN0A 1UZDA 1WLJA 4JI7J 4TU7A 4RZRA 4YMEA 3C8YA 1AFIA 3I8DA 3HT3A 1Q8LA 3R8YA 3LP0A 4L6V3 1QZ5A 2F3JA 2ILZA 2GCFA 3O5TB 1XEZA 1C2PA 1LFPA 2XEXA 2MZQA 4DR2K 5MLCV 3MPDA 4OZ5A 3C15B 4LF7F 3GR0A 1LWCB 4X2BA 2H5JB 3UCZP 2FSJA 2KQ2A 3DM2B 1FO1A 4WBFA 1JLAA 3VF2A 3R5CA 3KWIA 4LUBA 2KKHA 4RNOA 2ZHBA 2ZHAA 2P9NA 3F56A 1IQZA 4PL7A 1GLBG 2LQJA 3C6TA 1VQ9S 3DXSX 2DNNA 2IYIA 2W2QP 1FXLA 3SBMA 4DSEA 2YKMA 3NGYA 4Z7YA 4FWSA 4L75A 2D69A 2O1PA 5C15A 4LRAA 3HD2A 3Q8YA 1NSAA 5T41A 1N6QB 2J7KA 1R7IA 1GT8A 2YH1A 3CE8A 2HEKA 3QFWA 4OHXA 1I39A 4QPTA 3I5AA 3O6QA 2KH9A 4CZLA 4KHPJ 2RRNA 2VKZG 1B4SA 3R3LA 3VEVA 2Z56B 4DS4A 1FJGK 3CC4N 4Y2IA 2D74B 3BN7A 3MR5A 5AQXA 2DKOB 4EU0A 3NAIA 4O3NA 4L74A 4QW9A 3TUJC 4Y28C 1R43A 3GYGA 3MWPA 2YKQA 1N88A 2Q3PA 3MMBA 1SIZA 3MF5A 4YB7A 1HBMA 1S3XA 1C1CB 1FKPA 3CDWA 2C2MB 2IIRA 1XERA 5HL7L 4FYWB 1HJRA 1Q8KA 3DDNA 3I87A 2M2BA 2Q97A 1NHVA 3UD5A 3K2PA 4J9SA 3ZT0A 2CWKA 2DJWA 4CJFA 5AZJB 3AOCA 2QWRA 2G8IA 1NSPA 2P9PA 2F4VF 5KGXA 3I9ZA 2Z1GA 1VQLS 2EKYA 4CT8A 4TKTA 3TVKA 1YVNA 5KT7A 5J1EA 4KQZA 3WX8A 2EX3A 3NAEA 1U09A 1IJJA 2IJFA 2FZCB 4RW8B 5G4DA 4BRQA 4PXEA 2GIRA 3HVWA 4W5NA 2B4OA 2RS8A 5BRHA 2YWEA 3L7PA 2RN2A 5DLGA 4ID8A 1VS3A 2LXFA 2ZQBA 2I7NA 2ASDA 1RT5B 5KG6A 2JZ5A 2RPIA 3B78A 3LZIA 1V3ZA 1N33F 1CG2A 4OKJA 4FYXB 2OMOA 3ZETB 4PRFA 3AOAA 3DOMB 2OD6A 3N4WA 1HPZA 1QUVA 3MN5A 3JQKA 3MM6A 2HQGA 2HSEB 1ZBFA 3EM1A 3NGRA 4CJ4A 3OJSA 4JYAK 2A6MA 3RAMA 4B9VA 3CD0A 3D2FA 2ERRA 4QWDA 1C1AA 4DTRA 3PJXA 2E44A 4X4PA 3KJVB 2CQHA 3EVMA 1FCAA 2MXYA 3P38A 3O1BA 4DF8A 4DG1A 5F0UA 3SMZA 3VMFB 5HVGA 2QTWA 4J9LA 5F2RA 3P5JA 2ZUAA 2UYTA 1R31A 3VEYA 3FNNA 3R2CJ 2Z0GA 1JLCA 1RT3B 2QIFA 5HLFA 2GQCA 2YQ0A 4WU2A 1RLDA 1EP4A 3NLCA 1VBXA 3MM8B 2FY8A 4A57A 1HJOA 1RWNB 1RU1A 3C16A 1TUWA 1N56A 3B6BA 4HL9A 3DGVA 3PEHA 3DRRB 1KAZA 1KAYA 4U95A 3VGVA 2AJQA 4P71A 3QATA 5ETOA 1NGCA 3ADAC 3K5PA 5EX5A 2W1BA 4OX9F 2MDAA 3V4MA 3O9SA 3V9SA 5JLHA 3MEDA 4OYMA 5GMDA 5B0GA 5EHHA 2AU0A 4LVOP 5EU7A 5HJXA 5HRSA 2OYQA 1V3SA 4QBUA 3QEPA 2V67A 3KHLA 4TU8A 1VQ4S 3IN5A 4AT1B 3LP2B 2D0OA 3M8ZA 1TFYA 1HLWA 5KFPA 2OSRA 4DPXA 4CFDA 3OBYA 3AA5X 3CJTA 4LF9K 1G3OA 1ZETA 2BXJA 3QEWA 3BBBA 4LIWA 2H48B 2C2KB 3O44A 1IBCB 4JI1J 2Q43A 4F7VA 3D3CJ 4ID5A 1EARA 4BRAA 2O8DA 1M1KO 2KVQE 1OQ3A 7FD1A 4KRFA 1YHQN 3QICA 2YVSA 1D09B 1QAYA 3OPKA 1NJZA 2HZCA 3AVNA 5DG8A 2XS2A 5IT9U 5HK4A 1IBLJ 4GKJF 4QU7A 3GTYX 3HM8A 5ETVA 1YITS 2H5EA 1NSQA 2HK2A 1WORA 1YTUA 4YR0A 2XRIA 3WDOA 3QT8A 1IH7A 5HOOA 2VV5A 2W7AA 3FFKB 5LMNJ 1NLKL 3I31A 3SCLE 4BE0A 3QGGA 4DX5A 2OA8A 4M63A 5LMUF 1T9TA 3MMCA 5HMZA 4GC7A 4PA1A 1BIUA 1WNSA 2L08A 1T05B 4OI6A 1T7PA 4ES3A 3DLKB 3IAM9 1NKBA 2IA0A 3QJPA 3M3ZA 4ALZA 3QZ8A 4PY5A 1FFWB 2E2QA 1JLBA 2MZ1A 1KONA 1IM6A 2NZTA 4AM6A 1F6TA 3TA2A 2W4CA 3MAQA 3PJWA 5KPZA 4I56A 5SWMA 4Z7CA 1C4AA 3VQCA 4E98A 4JKBA 3OT9A 1EETA 4OFZA 3OVNA 2NR0A 1RUSA 5KG0A 3LDNA 3D6HB 2AA4A 3QO9B 4JI4J 3QMQA 1W2BR 1DGKN 1RTZA 5C42B 2JH3A 3UVJA 3W8PA 1HHSA 1BCOA 3MMJA 1ZM2A 4DB3A 4M5DB 1L3KA 2XNRA 3C65A 4FSVA 2G8KA 3CJ3A 4BRFA 4CI0B 4EO8A 1GLAG 1OY6A 2CPXA 4PQUB 2OPQB 4FS2A 3RSEA 2CJ9A 4CFAA 4PG4A 3K58A 5KFIA 3L2VA 1FXRA 2ZOGA 1Q78A 2BTFA 2PFUA 4F4KA 2PC6A 4Q43A 3JXOA 1JCEA 3F5TA 2VOOA 2BA9A 2XMWA 2DR5A 3X3UA 3TZXA 4ZN3A 3ENOA 3H6EA 4DV1K 3CC4S 2FZGB 3CMEN 3D0IE 1VHIA 3F41A 3SLCA 4ZVOB 3GMGA 3A3PB 4L3KA 2UXCJ 3HDSA 3T9NA 4KV8B 2DGTA 4EAHD 4LR8A 3H1QA 2GELA 4U7UK 4J9VA 2IM3A 4NI2A 3HSJA 1N54B 3CCES 2HHSA 1SL2A 2VPZB 3NCRA 1GLFO 1AFJA 3CPEA 2Q66A 2AP1A 4BRKA 3V9UA 4WZQA 1XTZA 2RKIB 2VZ9A 4PHTX 4EIAA 2HFNA 1GLDG 4TLRA 3OSPA 7AT1B 4UY85 3MTKA 2LEBA 1LEOA 4O23A 3DLGA 2DFEA 3IUCA 2D3O1 1NGIA 1T9XA 5F41A 2A18A 1Y9OA 3M8RA 2EWSA 4NYPA 4JUZA 4BDPA 2VH7A 1UVMA 2VFVA 5J2QB 1W7WA 1W0HA 1MG7A 3CC7N 2P5OA 4KHPF 3TW0A 2YTCA 1NPPA 4QW8A 2JEFA 2V4JB 4IH5A 2XO7A 2KO1A 3ISND 2N7YA 4DBQA 1RAGB 5F8LA 2R7WA 4ERDA 5C25B 1S6OA 3IWXA 1S48A 1Q9YA 2QGFB 5JMNA 5CABA 1Y11A 4M3XA 1XNQF 2FUG9 5KFSA 4OPKA 4WJBA 1DHMA 1JKHA 4ILRA 2OHDA 4PXDA 2XYHB 3HPHA 5CCMA 1SC6A 5MAOA 1M1KT 5HRPA 4RLEA 1NK6A 1U25A 2YNGA 1K1SA 4OO1J 2XMTA 2WFBA 4DV3K 3ITHA 3G86A 4IWVA 1DEJA 3U9ZA 2JL9A 3QETA 1WSVA 1NOZA 5F3ZA 4ECTA 2HHTA 3ZTSA 3CJCA 2GIFA 2KDOA 4FYVB 1CZBA 1UWBA 3H5SA 1K8KB 3K59A 3R7NB 3CDUA 4CLPA 4DR3K 2FC0A 2QA4S 2QK9A 1XUPO 3QBCA 3Q23A 1D9DA 2Y1LB 1TKZA 4A47A 4RU2A 1IM4A 1RBVA 3ZSXA 4N8OA 5AR0A 1BG3A 3CFRA 3V9ZA 3AA9A 3TARA 2ACYA 3G25A 4E3SA 2SXLA 3CYMA 4AQYK 3EJMA 3AXKA 4YB5A 2XLKA 1NU0A 2HKEA 2WSCC 1BIZA 1T3OA 1RDAA 3SQ0A 4LSLA 1H72C 3A13A 2UVRA 1JLGA 2HFVA 4RUAA 4IZ9A 3G82A 2QWNA 2ZH4A 1UJ4A 4CF1A 2YKAA 4OJ3A 3VQ8A 3FMBA 3PO4A 1RTJB 2ZJRQ 4JKGA 5B0CA 3WUHA 1WC3A 4BR2A 2X6SA 4PR6A 1U24A 3DXBA 3BB5A 1EWRA 4ICLA 2PBDA 4KHNA 4LFCK 1Y3KA 5HP1B 1VQ8N 2R7YA 3KLEA 4Q8FA 3GSDA 1NJIO 3FZHA 2WK4A 5LL6d 3CO9A 1HNZK 2VU5A 1XR6A 4JK7A 5AQZA 3VGLA 2EBEA 3D0HE 4MKAA 4JLHA 1ZTTA 1VSLA 1O5JA 2FXUA 4MKBA 3UKRB 2P9IB 4PWDB 4K42A 1M5HA 1RTIB 2PA3A 1RT6A 4MO4A 2MY8A 5J1NA 1WSHA 3D0PA 3FFIB 2BOPA 1NJXA 4F04B 1WG1A 2GIQA 2CQCA 2RS2A 3IM9A 2XGQA 2JJ4D 1YJ7A 4FK0A 3EMTA 4CLFA 1R6YA 1Q81O 4LF7K 3QRPA 4BS2A 1TKDA 4CLWA 2WONA 2GWKA 5E5NA 3B54A 2AX1A 1LWEB 4MIWA 2ZH8A 2OEJA 3K0JA 5AQOA 3M8YA 4CF8A 3WQPA 1Y4ZB 3CM5A 1CJVA 4FJ7A 5AQTA 4JI1F 2FSKA 5KOWA 1RT7A 1L3SA 2O8FA 2ZJQQ 4Q2LA 3WNGA 2UZAA 3HT0A 1JLFB 4FCYA 3GPAA 3M6GA 1UPPA 4KTZA 2VASA 2DRDA 3TWHA 1IBLF 3W61A 4MDBA 4Z94A 3FZ2A 3M8PB 1U04A 1S0VA 3WIUA 4U7CA 3P39A 5F0WA 4BY9C 2W2PP 4FZZA 3CJQA 3W9HA 2W4DA 4MFBB 3D2EB 3KLVA 2V50A 3K0SA 1IKXA 5LMNF 3RMDA 3P8BB 2D0AA 3M1VB 4ECRA 1V6HA 3UKUB 3GFYA 1LQ9A 3ULDA 3MMAB 4H0OA 1B64A 1EKEA 2XY7A 4ANCA 3TUPA 4DTOA 2Q0UA 4C8MA 1IWAA 3G6EN 4P2MA 4BGAA 4Y0FA 3DRSB 4KHQA 5I3UB 4KH6A 4DL3A 3I0RA 2R8IA 3CF5L 1H74A 4U7BA 2F4VK 1K44A 3AVBA 3POTB 1KVKA 4OQJA 1NGDA 1NH7A 3VF4A 3VQDA 3VV2B 4DL0C 2CQPA 3N5FA 4JI4F 3J7YI 1QQCA 4OPJA 3MMVA 3OLAA 2E1RA 2AD9A 1LK5A 3PX0A 5AFUH 1IKVB 4WZMA 3E51A 2C2NA 3G6XA 5LM7E 3DLLL 4F4AA 2IPOB 5DDPC 1RDCA 2B7BB 1DURA 4M7XA 4U8YA 3VEZA 2R2RA 4F2SA 3MM7B 3TQEA 1U2FA 3EKSA 4AILC 5AXLA 1JJ2M 3VA0A 4F3TA 4DN0A 1IKYB 4GO7X 3HHEA 1N33K 1S1UB 1S59A 2RU3A 4OYPA 3HHNB 3NAHA 5CZ1A 2C3OA 2DHAA 1QE1B 4HUGA 2ZHOA 1RJJA 1VHXA 2YJFA 2Q0RA 4WYBA 3Q0AA 1W9HA 2E5GA 4ZVSB 1NK9A 3EDRB 3KZBA 1X4CA 2OPRA 2IVNA 2CPFA 3L6QA 4B1VA 2UXCF 4NMLA 2DNGA 4FJHA 3AAPA 1TMJA 3L7OA 2AGPA 4MIAA 2MMYA 4MKYA 3KG1A 2FJEB 1F2GA 4BC3A 3PY8A 4J2DA 2ZBCA 1KLNA 3NGDA 4URQU 2OGUA 4Z4IA 3NF9A 5FLXO 3DN9A 3Q7CA 4RW6B 3KLIA 1K47A 4FJGA 4U9RA 1JLEB 5CYQA 1GMVA 5BREA 3Q8UA 3LDSA 2XLIA 5KFJA 4HACB 2VJUA 4DFPA 1OY9A 2DD8S 1JCGA 5KG7A 4DL7A 2UV8G 1CQNA 4OX9K 2YNHB 1S0OA 5AE2A 2YNIA 1MU2A 1OH6A 2VODA 2PSZA 1NGJA 4AL7A 3OD2A 1ZH5A 5E26A 3CDEA 5IC6B 1Q81T 1Y5NB 1SKUB 4P74A 3AVHA 5J1PA 4JKDA 4C1NI 2WHOA 2HAFA 1XMQJ 2WW4A 3PLAA 2C2RA 1F9HA 4Y2KA 4QWAA 4FJLA 2OPSB 3VF6A 3IR6B 5KFVA 2FBYA 1P8GA 1WC1A 5GADI 4CBUA 2OZMA 4ZLJA 4FNHA 1EX8A 2YNFA 3ET6B 2GA7A 2Y0SD 3WNFA 3SJJA 2ZH1A 1B9DA 2GEMA 1VK0A 5HJYA 3GFXA 1WN7A 3JTNA 2O8BB 3AH6A 2A40A 2BEFA 4NCBA 1RBRA 3ULEB 3RMCA 4GKJK 1RAIB 2GVZA 2DNZA 4F36A 2FB0A 3HSZA 2LFVA 3V4IB 2VFUA 2CQBA 2DNKA 2B6AB 4CERA 1HNVB 4AE5A 2KHCA 3PHTA 3AQPA 3TVYA 2DGQA 4CNYA 2MQLA 1VQ7N 4M5IA 5LMUK 4J9OA 3AVCA 5KAKA 1CZAN 3KK2A 4A8FA 4ILLA 1TL5A 3CO0P 4GW6A 2MJNA 4K4TA 1YRUA 4IG3B 2E5JA 3NWGA 3D6FB 5J2MB 1FD2A 1CEZA 2CDRB 4C3MA 3N0VA 2R7VA 3ZT4A 3WNHA 4OYBA 4LF6K 3MEEA 5E3QA 5F1XA 4X84A 3TUZC 1LNQA 1BOTO 1UA1A 4NEYA 2BZ2A 1NDKA 3BZQA 4JKHA 2EFQA 3DLEB 4KAZA 1HYSB 1KVIA 1DBDA 4OLOA 2CGJA 4DL5A 2UUAJ 4L3NA 5J2PA 5D3GB 2LCWA 4A8XA 4RCHA 4G9ZA 1CLQA 1AA1B 1SIWB 3KNGA 3GR1A 2RUSA 1WWHA 3E01B 4OYZA 4OZLA 4IO8A 2W2OP 3OR2A 4GVBB 3FLCO 3J7YU 4AHUA 3CCVS 2QN6B 4EO6A 4Y6IA 1F5CA 1LAVA 3O1WA 2CPHA 4DTSA 4OPHA 3Q8RB 2P51A 4Z4HA 3F9MA 4ED4A 4KB0A 4CK1A 2BE7D 1HQEA 1U0HB 3MEGB 4J8FA 2G2YA 4A8QA 3MK6A 3A4TA 4FJ8A 2X7IA 2QRRA 3BPSP 4DU1A 4LFBJ 4DN9A 2Z2MA 5AZIB 3AQOA 5KI6A 2F7TA 1F9FA 3CMQA 4ECZA 4PUOB 2W9BA 3C94A 2D0CA 1P1TA 2HMIB 2DY4A 1RABB 1OVQA 2VFSA 4RTFD 2IVOA 1YF5L 1B0PA 1NHUA 1NK4A 2MB0B 1WHVA 4FXDA 1K1QA 4ISGA 2GVDB 4ED7A 3VQ6A 2AJFE 1WNEA 3MAAB 3UFCX 3JXUA 2HHQA 2I8EA 3C7NB 3PO5A 4DCOB 3CD5A 5KFDA 3P3DA 3O5BA 4NLCA 1BWVA 1M1GA 2Y1RI 3IWNC 3GG0A 1QJHA 4KHPK 3UN2A 2DCLA 2BX6A 4CHQA 1LW2A 1TUGB 4PQAA 1NU4A 1C1BB 4CE9A 1GMWD 2C2OB 3KXDA 3CJBA 1HHTP 3ENBA 5GAEI 5B7WA 4RW9B 3SQOP 4RW7A 2VC0A 3BN4A 2QFJA 2KYXA 4FF3A 4CGHA 1XNQK 3SCJE 2V63A 1X3NA 1FWLA 3I0SA 6FD1A 1U1NA 5ETNA 2FBTA 4JKCA 3FGUA 2YPYA 4QIWD 1TL1A 2PI5A 2NRWA 3DHXA 1RAFB 4KHSA 3LP0B 1T11A 3IA0A 3G8SA 1S1VA 4BQLA 4YB1P 1BHNA 3SJHA 4IO9Q 1UW9A 5GADU 3RR8A 4OJRA 1WEYA 4MTPA 5E3RA 4YNQA 3U6FA 4ZVPB 2E8AA 3G8QA 4FWKA 3DU5A 4K5RA 3RB4A 3EZOA 5HRRA 3QNWB 3DKDA 4ANDA 2Q1LA 4R0EA 1RDDA 3QEIA 2D3OR 4ZVRB 3MTJA 1HBUA 2E9RX 4CCHA 3DRPB 1CVJA 3RWUA 2O3DA 5C0YA 4HH0A 2HBQB 2QL9B 1Z6RA 4BC7A 2P9NB 2ZEJA 3MUTP 3K2YA 3C6TB 4Y1DA 1Q0NA 2PD1A 3TSPA 3H5XA 4M45A 1ZAWA 3CJAA 5D4LA 2ZM6J 2RSQA 5AQPA 3TAPA 1SZ2A 4AHVA 3M2RA 3DOLA 3IR5B 2H4WB 2NRRA 3EPIA 3RZAA 3HF5A 3MCOA 3P5TL 2QG9B 4UUXA 2HURA 3DCAA 2CG8A 4OVLA 4KRWA 1RWOB 2Q79A 3KHHA 5FJ4A 1NMNA 4G6VB 1VQKN 4NYFA 2MHEA 2OH2A 4CEZA 2AW0A 2PAVA 1YX2A 3FBBA 1H98A 2YWHA 4H5VA 3C6AA 4YOEA 3TAEA 1O0PA 4FXWA 1KNZA 1WOSA 3VQBA 1CC8A 3RJMB 2LECA 3MMBB 1HBMB 4CNZA 1AUDA 4OZ0A 1FKPB 5G0RA 3R97A 1XBWA 2HGMA 2RE2A 4EBCA 3HBTA 2X78A 1S9GA 2F8HA 5CCLA 3P6YC 3GYNA 1T3NA 2YHXA 1SC1B 2PYLA 2MKJA 2VPWB 4RPFA 4F26A 2P9PB 4LC9B 3QERA 1D4XA 4Q0BA 3PRBA 5BPLA 5IQ6A 4AHSA 1SB6A 3GJTB 3AHPA 2CH5A 2Q31A 4P2SA 5DM7L 1BO5O 4B9TA 3CT9A 3WXMB 3KG0A 4DR4J 4YOVA 4ZCIA 4IKAA 2IDEA 4B17A 3EGNA 3OY9A 4WCEQ 4ED5A 4GO5X 1VK8A 5E41A 2VFTA 2DVIA 4DV7J 1XMQF 2OTJN 3K9JA 4X4RA 1VQPS 1QQNA 3OYCA 3UNYA 3D67A 2NXJA 3SSRA 2BH1A 3TAQA 2PMZD 2G8VA 1HPZB 1SXLA 1OH8A 3MM6B 3R9LA 3JSMA 4WP9A 4NLRA 3VQSA 1FA0A 1QSLA 3D2FB 4RWXA 3MN9A 4F3QA 1XN9A 4UOHA 3CHWA 3H2VE 1IBLK 2AZ3A 2MLXA 2GZOA 3CCJN 1FRKA 4WE1A 5EX3A 4DQPA 3TI0A 1NB2A 3HTVA 5A8WA 1TKXA 3NGSA 2MHNA 3M32A 1TELA 2F8EX 4IFVA 1QTMA 2XTJP 1VQMS 1JLCB 1J53A 5LMNK 5HLFB 3JS9A 1M5SA 1ZM3A 3PFOA 1TK0A 4P9SA 3F73A 3C16B 2HK3A 4K8XA 4AL6A 1FKOA 4LRBA 3E9LA 3U9DA 4TSXA 2RQ4A 4O3PA 3FE1A 5GAEU 3EYZA 3OYNA 4E7JA 4K7QA 1ZZNA 3MEDB 4UOCA 4M7YA 2W24A 2ZITA 2ITMA 5U47A 1WD6A 5A6PA 3NMRA 1DTTA 4PAAA 1W7AA 3US5A 1NBEB 2Q2RA 3W62A 2BUNA 4MAKA 1B99A 1F5AA 4JI4K 2JX2A 4KJIA 3GCXP 2UUAF 4C1NK 1CBKA 2YWGA 5BN8A 1ZTWA 3V9XA 3H20A 3M5RA 2I5JA 4HHJA 1M1HA 4J9RA 3AA3A 1KTVA 4DR6F 3TAGA 1F60B 1TMMA 2RDIA 2VA2A 2KL8A 4ID5B 4TNOA 1OWXA 2O8DB 4DI6A 1RE1B 3KLFA 1GTEA 2DITA 1U0SA 2ASPA 1O13A 4ILHA 2E6MA 4TQSA 3DAWA 4AXJA 2LYVA 2HNZA 2AT1B 3OFFA 1RBTA 2MPUA 5DQHA 1KTQA 3Q83A 2IIHA 3A8YA 2KHDA 3UD3P 2J0XA 3QFUA 4LFBF 3KDOA 2UXCK 3KKRA 3MMCB 3D1HA 1U4BA 3JQJA 3CJSA 2XZDB 1NPKA 1OH5A 3M9NB 1XI1A 2DISA 1T03A 3PM9A 4E19A 3BGFA 2P5GA 3L3VA 1JLBB 1PIEA 3NBPA 3NS5A 4QR0A 3R1LA 1X5TA 3KJQB 4YDUC 4PABA 2FLNA 2GHWA 4WFNL 1I6JA 2RRBA 4MK7A 5F8MA 3D9BA 2ALZA 3VHQA 4CIGA 1G99A 4JV0A 1EETB 4HI1A 2Z4PA 1B7FA 4CBXA 4PG8A 3QNOA 2E9TA 4ED0A 1VLOA 2J6SA 3OS1A 3CCQS 4CWBA 3PKYA 3UVJB 2GC8A 1XHXA 2EK1A 2YY3A 4QR2A 1U1QA 2AQ4A 2WZ1A 5M1KA 4OLAA 3A8IA 3JAMO 4OHZA 4OHYA 2EG1A 4KHYA 2A1RA 1RT1A 1S79A 2FDNA 3VEOA 4KGZB 2RDJA 2B9WA 1EKSA 2FVCA 3O9QA 4UT4A 1EQ0A 2WSFC 3MN6A 3NOCA 4I7FA 1Q7YT 1YI2N 5HMYA 1KRPA 1CPZA 3SUQA 3LL3A 2V2QA 2R8GA 3R6LB 4YDDB 3WXLA 3I96A 4NLSA 3P1GA 4EZ6A 2GAGC 4NLOA 4N77A 5EGYA 1KKHA 4DU4A 1R0AA 1YJRA 1IG9A 4I68A 4QJVA 1FTRA 3VVTA 3QT5A 5EDWA 2LDYA 4B9SA 1VQNS 1EX4A 2K06A 1GOBA 5DDOC 2FSNA 4ZCLA 3O3FA 5IT0A 1SKWA 3FRZA 5C24A 4LFAJ 1G7CB 4PXBA 2BRKA 4O3OA 4CJUA 2DFHA 4NI2B 2MEWA 4OX6A 1A9NB 1O51A 4M3RA 2V8PA 5LT5A 3SUPA 3M2UA 5AQFA 1ASWA 3HZEA 1WOQA 1SC4B 4YOUA 5BYQA 2AHOB 2P5VA 2ZM6F 2ALYB 5B0BA 3BSNA 1VSDA 2HBMA 2GMLA 2OIHA 3DLGB 3EGWB 2A1SA 3ALYA 5KT5A 2F9TA 4O0JA 2ZVSA 2NREA 3LTOA 1CJKA 1YJUA 1QD1A 4IOBA 4DTPA 3KKFA 4AH9A 2E1MC 5CR4A 2QZ8A 2Y8WA 1JX4A 1Q82T 3DC2A 5DK5A 4NWBA 2QLXA 3W9IA 2YKOA 1XQIA 1N0UA 3IFRA 1G6BA 3JTOA 4I6YA 1U47A 3CMAN 3LPEA 2QO3A 4BRNA 2DTUA 4FWMA 1PO6A 2J0SD 1VFJA 4DX8H 3BR8A 1JKHB 3DYAA 1U8SA 3BYPA 2I6WA 4F2RA 2HVHA 3TP2A 2YNGB 3AGRA 3LALA 3V6HA 3B8AX 3ITHB 1Z1ZA 4ECUA 3EPGA 3IS9A 1PYSB 2DR9A 3QFPA 2D0PA 1WKKA 2V9WA 4TY9A 3SI8A 4W5RA 1FWKA 1R8CA 2HVIA 2KRRA 3NGUA 3VAJA 4FS1A 3GL1A 1UWBB 5IS2A 4NLTA 3R27A 4PG6A 4ED1A 1WSIA 1WI8A 3MPVA 1SH2A 3P5BP 1C0TA 3BSOA 1KHWA 1TKZB 3SQ1A 3AD7C 1RWWB 2N4CA 1ULRA 2F8TA 4CIOA 2XMUA 4DR4F 3J7AP 4X64K 4V19J 2QKKA 5IOLA 3EZ5A 3OFEA 3THYA 1BUXA 4DV7F 2VA3A 3OSNA 3MPYA 2CZ9A 3FEXB 1U2CA 3H2UB 4CHOA 4ATNA 3LO3A 1FTCA 2Z57B 5CA5A 1QS4A 4HHHA 1H38A 4USJC 4LSLB 2X6NA 5AQLA 1JLGB 1UAXA 3M9MB 4CH7A 4DEZA 4UOFA 2FVSA 3UDLA 4JKGB 5JXSA 4USUA 3Q8SB 4CZGA 2VBZA 4ICLB 4FPAA 5IT4A 1WJ9A 2N82B 3NNCA 3BKUA 3I32A 4OPAA 3KLEB 2BJ1A 3ENAA 3HFZB 5B0AA 3H7HB 3HP9A 3L9ZA 3D5MA 2AGQA 5KFMA 4Z37A 2NS1B 1NZAA 1RDRA 3OVBA 2LU1A 3N9UC 4O3QA 2W7OA 1R0BG 4DXLA 4AHRA 3THWA 4K8RA 3LM2A 2F9DA 4USTA 5KFBA 1KC8T 3LP3A 4HTIA 1ELOA 3N6LA 4IRCA 3PW5A 3R7SB 4FWRA 4JKFA 5DG9A 3EVWA 1V9OA 2JC0A 4LF5J 2GJIA 1XR7A 3VAMA 1X4BA 2HYIB 4NMXA 4QR1A 2HFZA 3MM9B 1BQMA 1ZBUA 1QQMA 3MD3A 1WTBA 1IBMJ 1FEHA 3CCTA 4C0OC 5DDRC 1NNEA 5DQGA 2IAJA 3NDKA 1JQGA 3G96A 2B4UA 4I2PA 2XMAA 3H4DA 1CJVB 2P6TA 4IOAQ 2IDLA 4ZPWR 3U8XA 4HI2A 4OYAA 3D45A 2OEKA 1U48A 5FPNA 1RT7B 1FJCA 2MYFA 2GFFA 1YJNN 3PUFA 3KJNB 4QCLA 2QSFA 4DUYJ 5FIIA 2O8FB 2CQ3A 4M94A 4O5BA 1R8PA 1HMVA 3CCWA 2Z1IA 3NG8A 3WNEA 4ZIWA 4RUHA 4F67A 1S5JA 4XDCA 5HANA 1E6YA 1WC4A 3DFEA 2QXFA 4C11A 1T94A 3QWUA 5AXNA 4OI2A 2GHPA 4ZP6A 4JKAA 3P49B 4NLXA 5JVHQ 3VOVA 4DQRA 4OI3A 2UUCF 1F3FA 1IKXB 2QMUB 1REVA 1HWUA 1KQSM 1RT4A 1HW9A 4LF1A 2V8HA 2VDHA 2PO4A 1XNRK 3OVAA 2JLEA 4HLBA 4LRFA 2HFUA 4WQ4A 2XY8A 2FJBB 4CGFA 1VMBA 2QEXS 4ZTJA 5KFZA 1HQ2A 3Q24A 1CJUA 3CCRS 2B0GA 1JXLA 5HROA 2I2YA 2OJ3A 5EXWA 1S4EA 3VQEA 4DV3J 5C10A 5D78A 3QIDA 3E2EA 1APSA 4ZHRA 2OSQA 3I0RB 4ISEA 5E7OB 4KHRA 1YLXA 1YZ7A 3T5HA 5DZ7A 3I5CA 2DGOA 2QFIA 3LP1A 3GU0A 1EAYC 3J81U 3BJYA 3CC2N 4A61A 1WAJA 1LWXA 1J5OA 5H9EK 3UR3C 2C3PA 4N5SA 2ADBA 1MROA 1Q18A 3J7ZO 2EPIA 1BGXT 3GOIA 1KVBA 4J2AA 3MOJB 1S1XA 3H25A 2W8LA 4K43A 1MDUB 4DL2A 1XMQK 2ZNYA 5E3AA 3JAMY 1RHKB 2Y1IA 3SBGA 1NPRA 3W2WA 4XAKA 4LF8J 3MWTA 1HD1A 4DTUA 1IV0A 4B08A 1RAAB 3WC2A 3OQ2A 2MY7A 4ZPBA 3CVKA 4EK2A 1TFWA 3BO4A 3O4WA 3J80Y 3NEKA 4BE2A 2OFGX 1VC0A 3D3BJ 1IXKA 4RNMA 2OPRB 1DQ9A 2K3IA 2UUWA 4CEFA 3HP6A 1X0FA 4MYUA 4LFAF 1X9JA 5HBMB 2ZH2A 2NRTA 1MW7A 4XH4A 2X3GA 4BC5A 4KH0B 4I4BA 4BRGA 3CCLN 2NUHA 3BDEA 4DHYA 1SH3A 4FJKA 1EJ7L 2IOCA 4NXNJ 4OKKA 3GYXB 1R8BA 3D7SB 4CF0A 3KLHA 1IJFB 1VRQC 2XMVA 5CYQB 1C0UB 4XIUA 4KGKA 2K3KA 4MKVA 1WAFA 1EXQA 1Q8BA 3UCGA 5IFMA 4TLQA 4K4ZA 4YOYA 4RU9A 2MZTA 1KWMA 2YNIB 3LDOA 1MU2B 4O0NA 4ID1A 4FPRA 4A2BA 4BLGA 3EKUA 4ZJQA 4KPCA 1YDLA 4DCJB 5I42A 2DHSA 3HHLD 3P83D 4AF1A 1E6VA 3LGNA 3LWMA 1NGGA 4XK8C 4C4WA 4OYIA 4KIAA 2UUAK 2NSBA 3I6PA 4YR3A 4U67Q 1ZBTA 4QAGA 1RKJA 2DGSA 4DR6K 1JNZB 4DLGA 2YNFB 2IRYA 2B8QA 4CECA 4CLUA 1ZPVA 3EN9A 3VQ5A 3X1LB 3QQCD 3LAKA 4BRIA 3BZCA 1U2VA 5ETRA 2ACMA 1DLOA 1FXXA 3O6WA 4ELUA 9RUBA 2GVZB 2EHGA 2XY6A 2PEHA 3LDPA 4L73A 2JFDA 3T19A 1N4LA 3J81j 3MECA 1ZA1B 1JWWA 5EVZA 3GJRB 1VQ6S 2RQMA 5CZVA 4M63C 4LFBK 2X51A 3UDVA 1JIHA 1VQON 1HW8A 2DO0A 1B7YB 4BVOA 5D4OA 5AXMA 1VRUA 3KK2B 2L3MA 2MKIA 3M30A 2BJ3A 2G2ZA 4LQ9A 4CZMA 4Q7AA 4ECYA 1VSKA 1YRXA 4CIEA 1RK8A 4F3OA 2MQNA 3AO5A 1YKWA 2E20A 5IT9O 2A6OA 2HWIA 2WVCA 3AOBA 2J6UA 3OBWA 1CULB 3PCOB 1LV5A 3PR5B 3MEEB 1UPMB 2YX7A 3TQ1A 3DLBA 2NPFA 1VSIA 4OYXA 4QOZB 5ETPA 5B0FA 1Y3JA 3TJ8A 1XWLA 3H1VX 3L7UA 3U02A 1FWPA 3KK7A 1WI6A 1YBAA 3EXYA 1NG9A 4USKA 2OANA 1SPBP 2LMIA 3TUIC 4FF2A 3BGLA 5LOQA 5J2PB 4IFEA 2BBEA 3ZZTA 3BZKA 2IVYA 3CCSN 3SQGA 1FVQA 2KU7A 3J7ZT 3OR2B 2QW9A 1QTNB 4OX8A 3TZWA 4W90B 2ASLA 2HPUA 2DR8A 3FZFA 2P9KA 3D0GE 3BGRA 3V9WA 2DXFA 2E7XA 1D1UA 2G8UA 4DDFA 4FW1A 3QWPA 1GQEA 5A0YA 1UEUA 4M5GA 1B0TA 3C14B 1HQEB 2J7UA 3T6BA 4PCQA 4Y34A 3TU5A 2QYCA 4J9UE 3HI9A 1RT2A 2E7VA 4LF5F 4RNNA 4FDFA 2W6LA 2R7RA 3UDEA 4B9LA 2B9EA 3THPA 3U27A 4BE1A 2CFXA 3CM6A