2ZD1A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
554
structure length
554
Chain Sequence
b'MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase/inhibitor
total genus 159
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2zd1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2zd1A05
4JS4A 4Z0UA 2G8WA 2XO7A 1XR6A 1WNSA 3N6LA 4H54A 3O3FA 4DG1A 3BQ0A 1L3TA 5F9NA 4W5OA 3AO2A 3OYEA 4RW4A 3DI6B 3PHEA 1TVRA 1T05A 2BRLA 5KFPA 3SNNA 5CZ1A 3PVXA 4M3RA 4FLYA 2XC9A 4J9MA 4IRCA 3OL9A 4CJTA 4Y1CA 3OL8A 2PYJA 5F8HA 5KFNA 4FS2A 1J9AA 3MR6A 3DM2B 4EYIB 4HYKA 4Z4CA 4AH9A 1VSFA 3KKRA 3KLFB 3PO4A 4B9VA 3V4IA 1OS5A 4FLUA 3QO9A 3CIZA 2D3UA 1S97A 4QAGA 5CYQA 4B9UA 5F8LA 1UAXA 4MKAA 4CFDA 3VQCA 5C24A 2P1JA 4O3QA 5KFXA 3HHKA 4DL4A 4IFYB 1VRTB 4O4GA 2XHBA 4RG8A 4WXOA 3MR5A 1RTJB 1RDRA 5KFHA 3KHRA 2OZSA 4DFPA 4H4OA 2E6LA 2AJQA 3S3OA 1YVUA 3VN5A 2ITGA 3T5LA 2UUTA 5KG2A 1S6PB 2IMWP 2BANA 2FVQA 4NLPA 1D8YA 3KK3A 1RT1A 4FZXC 1T03A 3CJ2A 3M9OB 2WB4A 3ZT1A 3HPGA 2HNYB 3DOKA 1LV5A 5KG5A 2X78A 3OHAA 4RW6A 5F8IA 2OPPA 3RRGA 4OJRA 4F4YA 4ZPBA 4EZ6A 4TYBA 4CGHA 1HPZB 4HKQA 2R8IA 3DRRB 4E1MA 2CKWA 1RT6B 3OS2A 4CEDA 4ICLB 3VQSA 3QEWA 2OA8A 4URGA 3RB0A 2DPIA 1RCHA 3RAXA 4CGFA 4QWCA 3SUNA 1FKPA 3VQQA 4F2RA 3HVRA 4NYFA 4DU4A 3KMSA 2B6AA 4ED3A 4I2PB 4RZRA 1R0AA 4NLWA 1TAQA 2ATQA 3NAEA 1CZBA 3I0RB 1CXUA 1IG9A 4RW4B 1RTIA 4ED8A 3RBDA 3K2PA 3DYAA 5FROA 4K4VA 1TVRB 3KOAA 4LH5A 4O3RA 4WE1B 4AHCA 5KFZA 4G1QA 1JLAA 4F8RA 1TP7A 3OLAA 2BR0A 2R2TA 5C25A 4OPJA 3IG1A 3L2QA 3LP1A 4JV2A 1HQEB 2D0AA 4CESA 1L3UA 2EHGA 4TYAA 3AVAA 1NK0A 2IJFA 3QEPA 3SI8A 2D5RA 4C8LA 3LPTA 1EKEA 2R8KA 1MU2A 4W5TA 1RBSA 3V4IB 4NLYA 3QO9B 5CY4A 3K57A 1UWBA 2FLLA 1QHTA 5DG7A 4E7LA 3AVMA 5KFWA 4PUOA 2YNFB 3T19A 5C24B 3AVCA 4FJKA 1IKXA 5KFGA 3RMCA 1XHZA 5JS1A 1N6QA 3BSAA 3JYTA 4O4GB 5SZTA 3PW5A 1VSEA 3OYFA 2PY5A 4W5QA 1HYSA 1S1VB 4TY9A 2YNIB 2WOMB 4NLQA 3P5JA 3NH0A 4CF9A 2EC0A 4ELUA 3KLHB 4B9MA 4YP3A 5FDLB 3D28A 3FSIA 5J2PB 5J1EA 2RDIA 5KFUA 2BANB 2O4IA 3MEEA 4R0EA 3KK3B 3NE6A 1T03B 4Y34A 2IOCA 2R2RA 5JXSA 3V6DB 1VRUA 3TQ1A 1S1WA 3TAPA 3CJ4A 1U48A 3CWJA 1HRHA 1LW2A 2OPPB 2AU0A 3V6JA 5KG4A 3QZ8A 4M42A 4KTQA 1QAIA 2V9WA 4X2BA 4ZMMA 4IH6A 3O4NA 3S3MA 2VG6A 3AA3A 5EWFA 3MXIA 3O4QA 2ZD1B 3B6PA 3HPOA 1C6VA 4ZVFA 4DL7A 5CZ2A 4C8NA 2P5GA 4IR1A 1RT4A 1IKYB 1FK9A 3NMAA 1B9FA 1MMLA 3VQ7A 3DLKA 1R0AB 1HNIB 4B08A 1S0OA 3MXMA 1RYSA 3IS9A 3DYAB 2XY5A 4YMEA 1IO2A 2WONA 4HTUA 3MFIA 3MEDA 4I2QA 5KFFA 4FJMA 1A5XA 2IM0A 5K14A 2IC3A 5C25B 3NL0A 1G15A 1ZBIA 3LP1B 1BHLA 4ECRA 3ZCMA 3OYIA 1N5YA 3G6VA 1I39A 1DTQA 1SV5A 5KFTA 4M45A 3EYZA 4K8ZA 5KTQA 4ECUA 5F8NA 4CFBA 4FLTA 4IG3B 4CF1A 1MU2B 1S1XA 4RW7A 1TV6A 1S1UB 3OYMA 1GOAA 2AX0A 1D9DA 4PY5A 1UWBB 1VSLA 4GW6A 5L1KA 3CDUA 2R7YA 1QS4A 1O1WA 2HHXA 4M3XA 4QWAA 5DLFA 2E9ZA 1N6QB 3KLIA 3G6XA 3CJ3A 3NAHA 4J2AA 2HHVA 2JC0A 2RDJA 3M9MB 1HYSB 4O3OA 3L2UA 2HWHA 2OPSA 3H08A 2XI2A 3KJVA 1I3AA 2IGIA 4EO6A 2G8KA 3KTQA 3K58A 1BI4A 2R8HA 5J1EB 4FJ5A 3MEEB 2F8SA 5DG9A 3G6YA 4CGGA 3DLEA 1VRUB 1A5WA 1SL1A 2C2DA 3PW0A 2QE5A 1LW2B 3QLHA 2HNDB 4PQUA 4FK4A 3VQAA 4I7FB 1S49A 2R8JA 3O3HA 4DQIA 4Y2CA 3AVLA 4EP4A 3MTKA 1J53A 4DSEA 1WSJA 4RW8A 3CM5A 1C0TB 3BR9A 1RT5A 4KHRA 3OYCA 3QIPB 3LPUA 3EPGA 2ZE2A 3OHBA 1C2PA 1IH7A 2Y1JA 3ZSZA 4O3NA 4NLSA 4XPCA 3K5OA 1UA0A 2WHOA 1RT4B 1L3VA 1HMVB 1UA1A 3SQ1A 2O4GA 4ZVGA 3PV8A 2YHBA 3OYKA 4MIBA 1S1TB 3FRZA 1LWEB 1EX4A 3IRXB 5DLGA 2VA3A 1KLNA 3AA2A 4CHOA 4OGCA 4NLOA 2WONB 2OH2A 3DRPB 3NF9A 1NK7A 4QW8A 2HHQA 4NLVA 2JC1A 3KHHA 1U4BA 2W9BB 4KTWA 4KI6A 3MEGB 3L2VA 3RAQA 3GIKA 2FC0A 1DTQB 3DI6A 3HL8A 1JL1A 3HVTB 2YV0X 1ZTTA 5HRRA 3QNOA 1X1PA 4O0IA 3FDSA 4L8RB 1RBUA 1RTHB 2IM2A 2KFZA 1YVFA 4GC7A 4KKOA 1VK0A 3MFHA 3AVNA 2HMIB 4IH5A 4J9LA 1RDDA 2VWKA 1KTQA 3M8QB 2FVPA 1GX6A 3DM2A 4PA1A 3V1QA 3FQKA 4IKFA 3KLFA 1NKEA 4TN2A 1D0EA 4OPKA 5KG7A 1JLCB 2FJXA 1TKTA 5KFKA 5DK5A 2ZQBA 4IG0B 3NF6A 1BI4B 2KW4A 1HJRA 3C6UB 4IFYA 1T94A 4DU1A 1VRTA 5C5JA 4H8KA 2XY6A 3M8SA 4DWIA 3HK2A 4FLZA 1JLEB 1K1SA 4CHZA 3PJXA 4EBDA 1TK5A 3VA3A 4B3OA 3G0ZA 3LAKA 3RB3A 2W7OA 4O44B 3LDSA 2OZMA 3OVNA 5L1LA 1S6PA 4FXDA 3V9ZA 4AHSA 5KG6A 4DSJA 2HNYA 2FBYA 4JUZA 3PX6A 3PW2A 4FJ7A 4KB7A 3P83D 4F4XA 4U7CA 1HPZA 4ELVA 4CF2A 3THVA 1DLOB 4MK9A 3DRRA 2C28A 3U3YA 3CVKA 4FK0A 1RDCA 1RT6A 4MQ3A 3K5NA 1SL2A 4KFBB 4KO0B 3VQBA 3Q8SB 1B9DA 4QOZB 2I5JB 4PWDB 4J9RA 3UDLA 4QCLA 4MFBA 4ID5B 2ASLA 5EWEA 4I2PA 1TKDA 4GVMA 2KZMA 2Z1JA 5KFMA 4E1NA 3SZ2A 3I0RA 4N5SA 5EDWA 2QXFA 1RT2B 1QE1B 1S5JA 4WE1A 3M8RA 2A1SA 3L3VA 1IKWB 4DFJA 1VSMA 1T8EA 1ZBFA 4E19A 4CIFA 3TAQA 5SWMA 1XR5A 4KKOB 3H4BA 2VG5A 1SKRA 1Z25A 3UR0A 1HQEA 5KI6A 1CZ9A 1S9EB 1D9FA 4NLGA 2DFHA 3WNFA 3V6HA 4LSNA 3LP2B 2RKIB 3LP0B 4CERA 3QGGA 1VSHA 1NHUA 5HBMB 3QGHA 5HLFB 1UOCA 4YQWA 1HQUB 2YNFA 1TKTB 1JL2A 2HHWA 3PJWA 5KT3A 1T3NA 3FFIA 4NYNA 3Q8PB 3HP6A 4CJSA 3NBPA 4B8AB 4CJEA 1S1VA 2ALZA 2YNIA 2WOMA 1WAJA 3GIJA 5KFYA 2DFEA 1NK6A 2GIRA 4B3OB 1YTUA 2AWZA 4M95A 3NH2A 3H5UA 3KLHA 5FDLA 1QAJA 5J2PA 4DTSA 3RB4A 4B9LA 4E7IA 4C8OA 1U47A 3V6DA 4FZZA 4K4TA 3ZSRA 4DSFA 4RU9A 3HO1A 1WLJA 5HROB 4E7JA 1REVB 2R8GA 4DLGA 1S10A 5JUMA 4JS5A 1VSKA 1CXQA 4IQXA 2FLPA 4EBEA 4BDZA 1ZBLA 4CIEA 2YNHB 2XY8A 4ZTFA 3SFUA 1S0MA 4DTXA 2NUBA 1HYZA 3CFPA 2O5DA 4ECVA 1S4FA 4KSEB 5KFSA 4CK2A 2ZD1A 3D5MA 4IBNA 1IKYA 4MFBB 1JXEA 2BGGA 2G8FA 5KFDA 2UVUA 3H4DA 2ASJA 1RTDB 1WSFA 3H98A 2ZKUA 1HNIA 4OLBA 3OSNA 3GIIA 1K6YA 2B4JA 3KIOA 2IJNA 1JX4A 3VQ8A 1LAVA 4Q8FA 5KT2A 4DLEA 3BSOA 3KNAA 5EWGA 4J2BA 2E9RX 4WXWA 3HT3A 1ZYQA 1TQLA 3HYFA 3DLBA 4Z4EA 5F9LA 5KT7A 4ZP8A 2VG5B 4DL5A 3PUFA 3CDWA 2Z1IA 3I5BA 1JLQB 1QSYA 4ECQA 4IG3A 4FJHA 1S1UA 1ASVA 3PX0A 4LSNB 1N4LA 5FRNA 4OGEA 1LW0B 4FJ8A 4MKBA 4IOBA 3HKWA 1WSGA 4HUGA 4NCGB 3TAEA 3CJ0A 3F73A 2LSNA 2JLEA 4CEOA 3HP9A 3FFIB 5KGWA 4E3SA 3RMDA 1KHVA 4CEAA 3NBPB 3BGRB 3H5YA 4FJNA 2E9TA 1FKOB 1X9MA 3EZUA 3RB6A 4CEEA 4URQU 4ED6A 3SCXA 4FLWA 2D0CA 4N47A 4CJLA 2VA2A 2GIQA 4H4MA 4RNHA 4NCAA 3AO5A 3NF8A 4FM0A 3NDKA 1SKWA 2RF2A 4Z4FA 3KMQA 3NGYA 2D7SA 2HHUA 5L1IA 1BISA 2Z1GA 3PW4A 4FS1A 3V9WA 4J9NA 2GV9A 2G8IA 2HNDA 4I7FA 3BSCA 5HRPA 3QESA 4TXSA 4ZPCA 1C0TA 1S48A 2ATLA 3VA0A 3VQ6A 4CEBA 3EZ5A 3QIPA 4ZPAA 4Z4GA 1T7PA 2XI3A 4DFKA 2XGQA 4Q43A 3IGNA 3OYGA 4NRUA 3LP3A 4RNNA 4DTJA 3Q8QB 4ECWA 2IM1A 3SQ2A 1JKHB 3I8DA 4F4ZA 4FJGA 3LWMA 3QEIA 1HMVA 4AHUA 4ED1A 4J9KA 3HM9A 1ZTWA 1DTTB 3BSNA 4DQQA 2FLNA 2BQUA 4YR3A 2R2SA 2OYQA 1U04A 2KTQA 1S1TA 1LWEA 2IM3A 3IRXA 4F4KA 5HRSA 4FM2A 4KHMA 4O5BA 3V6KA 2UVWA 3DRPA 2YNGA 1RYRA 3V1OA 2BE2B 5KG3A 1KVAA 4ZVHA 1GX5A 3VQ9A 4RNMA 4TY8A 4DTPA 1KRPA 2W9BA 4KHWA 3MEGA 3HVTA 1RBVA 4EYHB 1BIUA 5J2MA 3AVKA 1RTHA 3ICLA 3FQLA 2XGPA 4CFAA 3CQ8A 4O4RA 4HVJA 2FJVA 2UVRA 2HMIA 3ZSOA 4R5PB 3GIMA 5HRNA 4QWDA 1SKSA 5J2NA 2W9AA 4O55A 3M8QA 3D45A 5CYMA 1RT7B 5KFEA 2JGUA 4LH4A 4HCCA 3TABA 4E7KA 2HNZA 1JLCA 1KVBA 4CJUA 1QTMA 1W25A 4KHQA 2AGOA 4CFCA 4O3SA 4IG0A 4AHTA 4NRTA 3UIQA 4H4MB 1NJYA 1JXBA 4WZQA 3C6UA 5L9XA 3TAMA 2RF2B 1NJWA 2VG7A 3NKYA 2ASDA 3QIDA 3JSMB 3BQ2A 4ED2A 1A5VA 2IAJA 2Z1HA 1JLEA 3NAIA 3OLBA 3TR8A 5KFQA 3OS1A 5L1JA 2A1RA 4HHTA 1TL3B 4CJKA 3N6MA 3A2FA 4O44A 4FJ9A 3H5XA 1U49A 4K50A 4Q5VA 4K4SA 4CF8A 3C6TB 3S3NA 4FLXA 5DQHA 2J6UA 2X6SA 1EP4B 4OL8A 3NH1A 1LWCA 1C0MA 4TLRA 2Y1IA 3GILA 1WAFA 4Q44A 4NLXA 4DSKA 1C1BB 3ALYA 3MAQA 3AO1A 2XWYA 4DL3A 4IRKA 1DLOA 2HVHA 4CHYA 4YFUA 5KFCA 4J9PA 4DSIA 3HPHA 4KHYA 4RW9B 3OYHA 2YKNB 4KFBA 3GYNA 4KO0A 1QSSA 3ZT3A 3OS0A 2FJWA 3VQPA 4F3OA 3LWLA 2Q3SA 3ZT4A 4E89A 3GV7B 4RUCA 3KD1E 1EETB 2I5JA 4PWDA 4K4YA 3EY1A 1LAWA 4ID5A 4KBIA 2B43A 2YNGB 3OL6A 4DTUA 2J6TA 4URSA 4Q8EA 4KTZA 4XPEA 3UQSA 4TY8B 1KHWA 2HHTA 2BQ3A 2ILYA 4IDKA 4J2EA 5DQGA 1RT2A 5HP1B 5J2QB 4W5NA 3NHGA 1QE1A 3DLHA 4CE9A 2AGPA 2FVCA 5J2MB 1IKWA 5F8GA 1BCMA 4M41A 3V81B 3TI0A 3ZSVA 3E01B 3T1AA 4DF4A 4WZMA 4YNQA 1C1AA 1D5AA 3KK1B 5KFLA 3ZT0A 5J2NB 2YKMA 1S9EA 5CYMB 3SI6A 1BGXT 4UQGA 3DRSA 3E51A 2E4LA 3SV4A 4NLTA 3VQ4A 3K59A 1S6QA 3LP2A 2RKIA 3I5AA 2HAIA 3LP0A 4NZ0A 2HNZB 4M3ZA 5HBMA 5KFOA 5HLFA 2EX3A 1RDAA 3SPYA 1HQUA 3IAYA 2HVIA 4FBTA 4N41A 4FLVA 5KRTA 3LZJA 3SJJA 1WN7A 1RA7A 1XI1A 1C1CB 3NFAA 3TAMB 3ITHB 2VG7B 4FJLA 1XR7A 2XCPA 4Z4HA 2IAJB 4MH8A 4DTNA 3U3GA 1N48A 1QUVA 4BWMA 3TAGA 1IKVA 5F8MA 2BDPA 4DTRA 3RMBA 4LSLB 3KK2B 3NF7A 3B6OA 1TKXA 4F50A 1BL3A 4AHRA 3EPIA 2W42A 4FJJA 2DTUA 1LWCB 5KFRA 1LWFB 1JLGB 3HSTB 4CHNA 2QKBA 4J9OA 5HROA 4U6PA 1REVA 4DEZA 4FZYA 4FW1A 2XCAA 4TQRA 2YHAA 3QINA 4DU3A 1BQMB 4CJVA 1Y97A 3KLGB 3AA5X 4QWEA 3LANA 3AO4A 5KRSA 2YNHA 3VQEA 4K4XA 4DTMA 2GUIA 1ASUA 1ZBHA 2JEJA 1NKCA 3SPZA 4QPXA 3OYJA 4Q45A 3OYDA 3ISNC 1W0HA 2FVRA 2V0NA 4DMNA 3PR5B 1RTDA 3T5JA 4ZP9A 2D0BA 3U6FA 3DOLB 3BQ1A 4EZ9A 1JIHA 3ZSXA 2W9CB 4CIGA 4B9SA 4IDKB 5I42B 3DLGB 1BIZA 3M9NB 5KG1A 4R8UB 4CF0A 4O0JA 3V9UA 2VWJA 2QKKA 4ED0A 2B5JA 4OKJA 4DSLA 4LQ3A 4YR0A 1NOZA 2HW3A 4JRPA 4ZP6A 3DMJB 4CJ3A 3SYZA 3PW7A 4RNOA 2CJQA 2YKMB 4E7HA 3KLVA 3BJYA 3G10A 1JLQA 4RUAA 3DRSB 4IRDA 3RWUA 4M3YA 3KD5E 4DQRA 2XY7A 1LW0A 1S6QB 3RBEA 4BWJA 2FBXA 1C0UB 4NCGA 4WFYA 1ITGA 5EU7A 4Q0BB 1HNVB 1KVCA 4CGIA 3PZPA 4DFMA 4KHNA 4KAZA 4B9NA 4CJPA 3AVFA 3ZSYA 2AX1A 5DGAA 1BCOA 3BGRA 2G8UA 3OL7A 3OJUA 3SQ4A 4KRFA 1KFDA 1FKOA 2D3ZA 1IKVB 3IN5A 3IGVA 1YT3A 1KLMB 2C2RA 1JLBA 4FW2A 4NLUA 3NGIA 4F2SA 5DG8A 4N56A 1TKXB 1KCFA 2KFNA 3AO3A 2FBVA 2W7PA 1U09A 4W5RA 4FK2A 5EUHA 3SUQA 3AVIA 1WSEA 4EO8A 2OPQA 2I1RA 3RRHA 1J5OA 3GV8B 3ISND 4LD0A 3QGIA 2C2EA 5C42A 1HARA 5F8JA 1ZBUA 1JKHA 4DTOA 4FCYA 3TANA 4ZHRB 4MK7A 3F9KA 1DTTA 3WNHA 2WRMA 2XRIA 3BDPA 3RMAA 3CJ5A 2ILZA 4KREA 4CEQA 4KHSA 1VSIA 4KAIA 1Q8IA 5I3UB 4WFZA 4DS5A 4J9SA 1B92A 2B5JB 2BE2A 2UUWA 4DG1B 1WNEA 3L8BA 1RBTA 1QSLA 3MECA 4NCBA 1T05B 4CJWA 3UPFA 4Z4IA 2G8VA 1VSJA 1SH2A 3T5KA 3H59A 3VQDA 1XHXA 5KG0A 3RR7A 4FM1A 4R5PA 2JEGA 4CEZA 4BDYA 3BREA 4DS4A 4I9QA 4LY7A 1RT7A 2ETJA 3KKSA 1IM4A 4EEYA 3PO5A 2IDOA 3G86A 1CLQA 1RA6A 4NLDA 1BQNA 4BE0A 2FBTA 5CYQB 4J2DA 3C94A 4CGDA 4CJ5A 4DQSA 2AGQA 4KB0A 4IFVA 4JRQA 4E0DA 3PX4A 3Q8RB 1Q9YA 2WTFA 1JLBB 3P1GA 2HWIA 4BACA 5KT4A 1QQCA 1ASWA 3JSMA 4I9LA 4CJFA 2DPJA 1Z4UA 4H4OB 3ZSQA 1TL3A 5KFVA 4HUEA 1CSJA 2W8KA 3OYNA 1EXQA 2JEIA 2OPQB 3C6TA 2IBKA 1RT1B 5KFBA 3GV5B 1EP4A 4MK8A 3CYMA 4O3PA 4EP5A 3K5MA 4J9QA 3SQ0A 3DOKB 1XWLA 1J5OB 5D3GA 4WYLA 4CK3A 2X74A 4RW6B 1NKBA 3T3FA 3OYLA 2PYLA 1C1BA 4CECA 5C42B 4OKKA 3NCIA 4M3TA 4M94A 1JLFA 3SV3A 1ZETA 2D41A 4Y3CA 1GOCA 4RW9A 5KT5A 4IKAA 2YKNA 1L5UA 4K4ZA 3CM6A 3O3GA 4B8CA 4ELTA 1EETA 4IH7A 4MIAA 1FXXA 2GBZA 1FKPB 2P51A 4FVMA 2B6AB 1NK8A 4C8MA 4CEFA 2AQ4A 3DDKA 4B9TA 1WSIA 3AV9A 3HJFA 4KV8A 4KI4A 3KHLA 3QNNA 2J6SA 1TAUA 3RTVA 4NLRA 1RTIB 3MECB 3AVBA 2E6MA 4ED7A 5HP1A 3CG7A 5J2QA 3V1RA 1Z26A 3S9HA 3LAMA 4G1QB 1JLAB 3V81A 5T7BA 3E01A 3IG1B 2OPRA 4EBCA 3DLRA 3KK1A 1D1UA 4TSXA 3PY8A 1F21A 4CCHA 4DQPA 3CFOA 3SUOA 1BQNB 1X9SA 4G3IA 4XIUA 4OVLA 1KFSA 4M3UA 1NJXA 1NOYA 2V4RA 4PUOB 4IFVB 3OSPA 1Q9XA 1IKXB 4F3TA 3CDEA 4C8KA 1K1QA 1W9HA 2HHSA 4DL2A 4CK1A 2G8HA 1C1CA 4OLAA 3JYTB 3WNGA 3ITHA 4QW9A 3I0SA 1NNDA 4BE1A 3ZT2A 3ASMA 3MR2A 4CJ4A 1TL1A 3AVJA 4ECTA 4LSLA 3ULDA 1RT3A 3TWHA 3KK2A 2QK9A 1JXLA 1SH3A 3T5HA 2BRKA 1RNHA 4ID1A 3L2RA 1S9GA 1KSPA 1SUQA 1LWFA 1S1WB 1JLGA 3AVHA 5D3GB 2R2UA 3NGZA 5KFIA 2HB5A 4CGJA 3D0PA 4BE2A 1BQMA 3OYAA 1JLFB 4ZP7A 5DQIA 1NHVA 3KLGA 4DL6A 3QIOA 1TKZA 3QZ7A 1WSHA 2RN2A 3HVWA 4Y1DA 3OYBA 3VQ5A 2VG6B 4CHPA 3WNEA 2WK4A 3TVKA 3TARA 3V9XA 2IA6A 3MXJA 4RNFA 3QEVA 3KLEA 1VSDA 4ZVEA 1NK9A 4DF8A 4XO0A 1FK9B 3HVAA 2F96A 4ECZA 2PZSA 1HYVA 4KPYA 3DOLA 3DLKB 4OKEA 2W8LA 5KFJA 3K5LA 4WYWA 4HUFA 3QYYA 4KV8B 2JEFA 2W9CA 3HXMA 5KT6A 5I42A 3DLGA 1TK0A 3IS9B 4NYZA 2GC8A 4N76A 4R8UA 3AVGA 4YR2A 4GC6A 3M8PA 3OY9A 1NK4A 2BQRA 3MEDB 4I2QB 2F8EX 4F4WA 5K14B 2IC3B 4AHVA 3L2WA 2OPRB 4FBUA 3DMJA 1TK8A 4M3WA 4K4UA 4K8XA 3N6NA 2WCXA 4KB1A 2QV6A 4KHUA 3CFRA 1N5YB 1SV5B 3RR8A 3MR3A 1SH0A 4WFXA 1XC9A 1X9WA 1S1XB 4RW7B 1TV6B 3SUPA 1NK5A 4HCBA 4TQSA 5KFAA 3MF5A 1C0UA 3PR4A 4JV0A 3ZSWA 4Q0BA 1HNVA 3LZIA 3KLIB 1S0NA 5DGBA 4CJRA 4FJIA 4FJXA 2P5OA 4K4WA 3I0SB 4ECXA 4CJQA 5DMRA 2OPSB 1TGOA 2IS3A 3H5SA 3KJVB 3V9SA 1TL1B 1S9FA 4JLHA 3H2LA 1KLMA 1RT3B 4QWBA 3I5CA 3SFGA 3QETA 4ECYA 1J54A 5KGXA 1S9GB 2UVVA 1I6JA 1RTJA 3DLEB 3OJSA 1SUQB 2C22A 1YTAA 1RILA 4LQ9A 3CO9A 3H40A 2DY4A 3QLHB 3AA4A 4PQUB 3LALA 1N56A 1L3SA 1NJZA 3NGDA 1TKZB 3QEXA 4RW8B 5FRMA 1RT5B 4ZPDA 4IR9A 4FYDA 1SL0A 2ZE2B 1RDBA 4BDPA 1RBRA 1U45A 3GQCA 2RPIA 2DFFA 3KLEB 4ZHRA 2F8TA 2FVSA 4KE5A 4ECSA 4AILC 5E41A 2V4QA 2KQ2A 3TAFA 4GMJB 4ZTJA 3QERA 4ICLA 3C95A 5T14A 3KHGA 3L3UA 2X6NA 4Y2AA 1RAJA 4JV1A 2KZZA 5I3UA 1GOBA 4CHQA 3M8PB 5JS2A
chains in the Genus database with same CATH superfamily
4NOHA 4Z0UA 3CCVN 4OX6A 2G8WA 3N6LA 3BQ0A 1L3TA 5K20B 2YH1A 2GQQA 2OKQA 1WC3A 3QFWA 3AO2A 3OYEA 4RW4A 1U6BA 2F9TA 2XS7A 3HLUA 4FLYA 4X62K 1RDWX 2XC9A 4J9MA 4IRCA 4DL0C 3OL9A 4Y1CA 2GVZA 3OL8A 1I94F 1MMDA 4NX9A 4FS2A 4H5TA 2I0XA 2VFUA 2J9DE 2RU3A 3DXKA 4PABA 1N0UA 4HYKA 2NCKL 4AH9A 5K8OA 2NXUA 3KKRA 3HSJA 4B9VA 3QO9A 3CIZA 5F8LA 3WDOA 4ZN3A 5C24A 4CNZA 4B3MK 1DBDA 3KXDA 1CULA 5JMNA 4FWKA 4O4GA 2XHBA 1XMOK 2BUPA 1RTJB 3THYB 3AGRA 3KHRA 1N88A 3VEWA 4BQZA 2EVZA 4UY85 4MMOA 5AT1B 2E6LA 4F26A 4JNEA 1YVUA 5CD4H 3AA8A 2ITGA 1MROB 4X4VA 5BR8J 1X5SA 5KG2A 4ILRA 2FVQA 5E3PA 1D8YA 3BV8A 1Y4ZB 3NY0A 3OBYA 3ZT1A 2HNYB 5KG5A 1RAHB 5AQSA 2XS5A 1RZMA 4B3TK 2DGXA 4OJRA 5AZJB 4F4YA 2BVZA 4OZ2A 4EZ6A 1U1KA 2AKWB 3HMJG 5A76A 1HPZB 4HKQA 2R8IA 2W2OP 4IOCQ 2ZF5O 4NLBA 4QIEA 3QRPA 1RT6B 5GADU 5ETRA 2I9SA 5A8WA 2OA8A 2QL5B 3RB0A 2DPIA 1RCHA 3RAXA 4CGFA 2DGSA 2PMHA 1FKPA 3HVRA 2UU9J 3KMSA 2QA2A 3QRQA 2ACMA 1HNWJ 3SSSA 4QOTA 4RW4B 1RTIA 5DM7L 3K2PA 4H5VA 4I4BA 5KFZA 2FTRA 3U1NA 1GAOA 4DBQA 1HQEB 4JI1J 4ZVUB 4HDHA 2OMOA 1L3UA 3A8IA 1CJUB 2Q6CA 3CTRA 3UDEA 2IJFA 4A8OA 3LPTA 1G1XA 3FCWA 1EKEA 4M1KA 3QO9B 3K57A 1UWBA 2V69A 2J0SD 1QHTA 4F9OA 1W2IA 3D0GE 2MLYA 2XS2A 5C24B 2ZH1A 5KFGA 2OEKA 1X4EA 4W90B 3MM8A 2CVEA 4CT8A 1XIQA 3AT1B 4NEYA 4O4GB 4S0MA 5E7OB 1HYSA 1S1VB 5DS7A 2J7KA 3CD5A 3P5JA 1H72C 2QMUB 1UP1A 2ASYA 2F1FA 3M1VA 4B9MA 4DV1J 4YP3A 5J2PB 1MLAA 3MEEA 3SCJE 3NE6A 4ILHA 1VRUA 3TQ1A 4CZCA 3OQ2A 1E6YA 4BR0A 1Y11A 2CJXB 1U48A 1UTAA 1LW2A 3MPWA 5KG4A 5D0HA 1QAIA 1VQ4S 1UVIA 3VQTA 2RMLA 4IH6A 3O4NA 3S3MA 4LF5K 2BBEA 4IO1A 3AA3A 3B78A 3O4QA 3VGKA 4PYDA 5A8WB 4PHTX 3E9LA 4ZVFA 4C8NA 2FHJD 4JI3K 4OYOA 2KHCA 1GLDG 1EQMA 3HULA 3SLCA 1D3WA 2MEWA 3RBZA 1SJ3P 3UE5A 5LT5A 3MXMA 2PGCA 3EE3A 5IFMA 4KBOA 3HSDA 2CQ2A 3MFIA 4I2QA 4BRFA 1ZBIA 3LGNA 2XM3A 4ECRA 1N5YA 4OZ0A 1I39A 5HVGA 4M45A 3EYZA 3DXBA 3VGVA 5C7PA 2FSJA 4IG3B 1V9OA 4DZ6A 3OYMA 1VQ8S 4Y28C 1UWBB 4GW6A 5B8HA 3CDUA 2HWTA 2HHXA 1QS4A 4B3SK 4WFBL 3MMCB 4YB5A 3CDAA 1ITPA 1XN9A 1ZH5A 1N52B 4JI2F 2X3GA 1HYSB 2Z56B 1ILYA 3S6EA 2WB1D 4CLPA 3H08A 4USWA 2B7BB 2IGIA 3OFFA 1R6VA 1Q82O 3M1VB 3K58A 5CYJA 1Q86T 3MEEB 1KC8T 2F8SA 3NRBA 3A5MC 3DLEA 1H2UX 2DNKA 1VRUB 2B8PA 1VQMS 4IDHA 5HQ8A 2OTJN 2VCPA 1FXRA 2IYGA 4BG8A 1HBNA 2KRBA 5LJVA 1LW2B 1S49A 4DQIA 2U1AA 4DR4J 2HFVA 4DV4J 4HI1A 1EIYB 4V19J 3CM5A 4X4SA 1RT5A 5AXMA 4NXNF 4ER8A 4FXWA 4O3NA 3K5OA 1UA0A 1Q18A 4C0BA 3MCPA 1DRZA 2RQCA 5C15A 2O4GA 4PZVA 3PV8A 2UYTA 2KKHA 2VQEK 3G96A 2XLKA 4MIBA 1XNRK 1UCNA 3US5A 2DR5A 5DLGA 2LECA 1R43A 4OYAA 2ZOMA 3S7RA 3JAMO 2BKNA 3GFXA 4HT7A 3GR1A 1TU0B 1I51B 3DC2A 2W9BB 5ELZA 3MEGB 2HBQB 1RBAA 2J9EA 5HRRA 3QNOA 2YH0A 3H3OB 4O0IA 3A1YG 3FDSA 3UKRA 4L8RB 2MSTA 2IM2A 3EICA 1YVFA 4GC7A 1VK0A 4CO1A 2P9IA 3MPUB 2OHDA 2HZCA 3I55N 1F5BA 3AVNA 4BGBA 1RDDA 1HL6A 1VQ6N 1GX6A 1E6VB 1SPBP 2G2ZA 2QA4G 1YJTA 3OW2R 2ZGZA 4AXJA 3CJKB 5KG7A 3VZHA 1JLCB 2FJXA 3JS6A 3DU5A 2AF6A 5KFKA 3H1VX 5DK5A 2ZQBA 3S01A 3KK7A 4CP5A 1T94A 4LBIA 2XY6A 3M8SA 3HK2A 8ATCB 4I6YA 3PJXA 3UN5A 3D1QA 3R2DJ 3VA3A 3HD1A 1HBNB 3U02A 3MK6A 4J91A 2W7OA 4X4QA 4JYAF 2OZMA 3K8WA 2DY9A 5L1LA 2KO1A 3TZYA 2KH9A 2YTCA 1XQIA 2FBYA 4CIOA 4LF9F 2WW8A 3LF0A 2COLA 4OJ3A 1T6CA 4RX6A 2V94A 2VIHA 4FOIA 4FWNA 3MAAA 4LIWA 1YZ6A 4U7CA 5I3PA 4DV4F 3KNGA 4MK9A 3DRRA 4DV6K 3U3YA 4FK0A 2GVDA 2KT5A 3K5NA 2JFKA 4OX9K 3Q8SB 1S76D 3SQGB 3CD6S 4J9RA 1HJOA 2M3DA 5HMYA 1K73T 1EKRA 2NRVA 2ASLA 5EWEA 5AQIA 4I2PA 3TUJC 1TKDA 4QR0A 3BO2A 5KFMA 3SZ2A 4E1NA 3OXGA 3D7EO 2KM8C 1UPMB 4AFFA 1EB0A 2KB2A 1B7YB 4LF7K 1QE1B 3VZIA 1S5JA 1MWYA 3AARA 3L3VA 3ILIA 3MMAA 2FDNA 4CIFA 2HGMA 2QGFB 3DHWC 2P9IB 1SKRA 1H98A 1CZ9A 1R6YA 4JV5F 1FX2A 2RJZA 2DFHA 5LL6Z 3SBMA 3E66A 1I3OB 3VGUA 4LMZA 4A5AA 4CERA 2MQQA 5HBMB 5HLFB 3BP8A 2YNFA 3FMBA 1JL2A 3FFIA 1FESA 2Z2LA 4OHXA 2P9NA 1W26A 4RTFD 2YNIA 4B1WB 1WAJA 2Q36A 2AWZA 3H5UA 3DHXA 3NVMA 2FHOB 3C8YA 4DTSA 3RB4A 1FTRA 2NRWA 3C6AA 5HMWA 3GU0A 1YKWA 3V5RA 3V6DA 4A2BA 1FRHA 4PL8A 1WLJA 5JUMA 3QPIA 4Y00A 3U1MA 1PJ5A 4NMLA 2FLPA 2HLUA 2PC6A 2HMPA 2XTJP 1VCTA 4BDZA 2WBRA 1QQOA 2EFOA 4ZTFA 1R27B 2GVDB 4DTXA 1HYZA 3IAM9 3CFPA 3T1HJ 4FF1A 2ZD1A 4JD2B 4C97A 4P2XA 1FE4A 4IBNA 1IKYA 2QLFB 2CGKA 1WBDA 1DJ0A 2C1EB 5KFDA 1WSFA 1NGEA 2DNZA 4ZPTR 1HNIA 4OLBA 3AJ1A 3OSNA 4EHTA 2VYPA 3GL1A 4P2SA 1K6YA 4WK1A 2B4JA 3VQ8A 3ELHA 2QSFA 1C4AA 4J2BA 1YG0A 2E9RX 2CQHA 3CCRS 4CZHA 3MCOA 3VCDA 3DLBA 4Z4EA 1G99A 3OR2B 4ZP8A 5KQ8A 3CDWA 1X0FA 1RAIB 2WSCC 1YI2N 4GKKJ 4ES1A 4JI7F 4FJHA 1S1UA 1ASVA 5AQXA 3WEEA 4HUGA 4NCGB 3CJ0A 3F73A 2ZZMA 2JLEA 3FFIB 5KGWA 3RMDA 1KHVA 4DCOB 5CA5A 1FNOA 1WEZA 1X9MA 3RB6A 2CNOB 4ED6A 3CCUS 2LQJA 2D0CA 4U9RA 1U2CA 4OHVA 2CNKB 2M8HA 4M5JA 1PO6A 3AO5A 2QWPA 4FM0A 3J7AN 2CG4A 4AQYK 4Z4FA 2D7SA 5RUBA 2MLZA 1R89A 2GV9A 2HNDA 1Q8KA 3PTWA 3SCKE 3BSCA 4IO8A 1EQYA 4AYBD 2V5HG 3EZ5A 3QIPA 4ZPAA 3O5TB 3IKMA 2YKQA 5GMKa 1R8BA 3GSDA 4ZIWA 3SQ2A 4F4ZA 1IQTA 2YWGA 3QEIA 3AH6A 4ED1A 1U1RA 4J9KA 3HM9A 1HNZJ 1Q16B 2BJ8A 4CM0A 1YJUA 1Q8LA 2FLNA 3TA0A 3FZBA 4H4KA 1KS2A 2WVEA 2DGWA 3C6HA 1RWNB 2IM3A 4IO9L 3J80U 1GLCG 3V6KA 4ANEA 4BY9C 3B6BA 4RO0A 1RYRA 5D4LA 1KVAA 4DV2K 1QJHA 3M2VA 4LIRA 4WCEQ 1X5PA 2LP4A 2DPNA 3M2UA 1RBVA 1CJKA 2OEJA 2YQ1A 1RTHA 3CC4S 2HSTA 4HEA9 1ZPVA 5A8RA 3FQLA 4KHPJ 4M5DB 2XGPA 4DV5K 1FRIA 4HVJA 5CR4A 2W9AA 4O55A 4OYIA 3R1XA 1O6XA 5CYMA 4KYZA 5KFEA 2KHDA 3TSPA 2HBLA 1H2VZ 3ZC4A 2F3JA 1YXQA 1ACMB 4MKVA 2IHR1 2BACA 3EDRB 4LVNP 4PYAA 2PI4A 2AGOA 1UW9A 4AHTA 1JXBA 5L9XA 3PFOA 3TAMA 4P71A 4J9VA 2Z1HA 1X4GA 2IAJA 1GNKA 1VHIA 2P9PB 5L1JA 2A1RA 4HHTA 1TL3B 3I56S 3A2FA 4O44A 4FJ9A 3KG1A 3H5XA 2ZBIA 2IA0A 3CDBA 4Q5VA 4IEEA 1SBRA 1ZBSA 1N32K 3B82A 3UD4P 4QBUA 3NH1A 1JCEA 4H0VB 1WAFA 4TKTA 4J37A 4DR6K 3LH2S 2XWYA 4DL3A 2GHVC 4FVCA 4YFUA 5KFCA 3AB4B 4J9PA 4RW9B 1VS3A 4H03B 3M4XA 3S8SA 5FD1A 2RSQA 3ZT3A 4F3OA 3FBEA 3Q83A 3LWLA 3JSYA 4F04B 3C16B 3KD1E 1EETB 2I5JA 1QZ6A 4KBIA 2B51A 3GZ7A 3FCVA 3G71S 4URSA 3C15A 4KTZA 5DM7Q 1YBAA 3FCHA 3WXKA 2BQ3A 4IDKA 1WDTA 1RT2A 5J2QB 4W5NA 1HWKA 4HI2A 1GLJO 2JRSA 4CE9A 2E5LJ 3M6GA 3B4MA 1IKWA 4PG6A 2Z30B 2F65A 1HR0J 4ISEA 1C4CA 5A8RB 3G6ES 4WZMA 1WTFA 1C1AA 3DU6A 3ZT0A 1FRJA 3JQJA 5CYMB 2E1ZA 2W6KA 2A3JA 3VQ4A 5B09A 3K59A 4CJ7A 4ZOSA 2RKIA 1FNXH 1QQNA 3W66A 2YX6A 3SPYA 1RXOB 3OR1A 3ZO7A 4FBTA 2XLIA 1I94K 5KRTA 2VBYA 1VQNS 2ITMA 4KIAA 3PIOL 3L7OA 2GWKA 3TAMB 4FJLA 4KPCA 2IAJB 4MH8A 3FVYA 3IAS9 3CULA 3MI7X 2OFGX 3CB4A 4BWMA 1IKVA 2BABA 2I6WA 4YEAA 4DTRA 4LSLB 3DGPA 3KK2B 3B6OA 1TKXA 3FGUA 2JH3A 3JQMA 2DTUA 1FTCA 4FJJA 2H3EB 4J90A 4UY8O 1QVFR 4DB3A 1LXJA 1JLGB 2EG2A 4TQRA 1U24A 1V4TA 1Y97A 3LDQA 2FC8A 4USHA 3AA5X 3ZZ0A 4DTMA 2M4MA 4EI2A 1TL7A 1IBLF 4CO2A 2JEJA 4WKRA 3ATUA 4IJNA 4QPXA 3ISNC 2UUBF 2MY7A 2V0NA 4D3GA 2HRUA 2XWXA 1O5JA 3T5JA 4H0OA 3DOLB 1SJFA 1U1QA 2W9CB 4CIGA 4IDKB 2C3UA 2CWXA 5BYRA 4ZLPA 3GB0A 1UZDA 1AFJA 2VWJA 4ED0A 2B5JA 4OKJA 1UL3A 2HW3A 3O9UA 4CJ3A 1VBYA 1NNEA 1VYAA 1JJCB 1UMJA 3CF5L 1VQON 1JLQA 1HKBA 1U1PA 4FWPA 1FRKA 3P6YC 4DUYJ 2XY7A 4C2MA 4ILJA 1C0UB 4NI2A 1UWAA 2PSZA 2VH7A 5EU7A 4Q0BB 1HNVB 4KHNA 4B9NA 4LF6J 4CJPA 3HKZD 3BBCA 1BCOA 1UEVA 4ANDA 3P96A 3OJUA 1J5EJ 3BM7A 4ZS6A 4LREA 4PRFA 1VI7A 2LXIA 1FKOA 1NDCA 3HSGA 2D3ZA 1IKVB 4M8LA 4QU6A 3H6EA 2OO4A 4F2SA 3G8TA 3R3LA 2LA4A 3NGIA 1IWAA 3Q8VA 1TKXB 3CIPA 5G0RA 2QM1A 2LXFA 2R7VA 1WB9A 1MN9A 5ETLA 2HG4A 3HHLB 1WSEA 3DAWA 1XBWA 4PWWA 2E5HA 5HAOA 2ZJRQ 5M1PA 5LSRA 2VFVA 3GV8B 1I1GA 1J2VA 4C8YA 1WC1A 5C42A 1HARA 1IBKJ 5F8JA 1ZBUA 1JKHA 3CC7N 5K8NA 4UUXA 5F0UA 2XG8A 1FDDA 5F3TA 2IRUA 1BWFO 1OWXA 4LFCF 3R5GA 1DTTA 3WNHA 1OYEA 2MHNA 3QBWA 2ILZA 4CEQA 1VSIA 3TU5A 3AAQA 4U8VA 1O8BA 2AJ1A 3BR8A 1B92A 2B5JB 2LFVA 2MZTA 3CUNA 3HOSA 2Q79A 3VAGA 1VJQA 2DCUB 2R7WA 1F3VA 1HI8A 1RBTA 1QSLA 5KPZA 2Y1RI 1RTZA 5AXLA 4H4KC 2DISA 2MTLA 3UN3A 4CJWA 3UPFA 2G8VA 1F9HA 3BBFA 3CETA 3WQPA 1N5TA 1XHXA 2J5AA 2VFRA 5KG0A 2CDRB 2GA7A 3ET6B 4NI2B 2I7PA 3CC2S 4JI8F 2ADCA 3RRKA 3BREA 2V6AA 4DS4A 2ETJA 4X65F 1IM4A 3PYFA 4DUYF 1CLQA 3W7BA 2O8BA 4NLDA 4ZLNA 4C7QA 5CYQB 2FY1A 2K7KA 3G87A 1KVKA 4YB1P 2ZM6F 1WOQA 4CJ5A 4DQSA 5FLXY 2AGQA 2MZJA 4KB0A 4RWWA 3FNNA 1URRA 2OAUA 1VQKS 2HBYB 2O8DB 3PX4A 3Q8RB 4X64F 1V3RA 4YB7A 4ZVPB 2HWIA 4ILMA 3PDNA 4NZ6A 1GK8A 4BACA 4BRIA 2MHEA 2IYIA 5M2PA 2GGPB 4JI2K 2DPJA 2UXCJ 1KOHA 4A8MP 2ASPA 3BF4A 1A0OB 4JEPA 2RAQA 4DV7K 5HK4A 2C3MA 2IBKA 1RT1B 2VPWB 3K5MA 2LQ8A 3FEXB 1XWLA 3KJNB 5DETA 3THXA 5D3GA 1VQMN 1XC3A 3T3FA 3OYLA 3KDNA 3MM6A 1VK8A 5C42B 3ZNUA 4H5NA 4ZITA 2VFSA 2BH1A 5AQGA 1RHJB 3ZZTA 4NXNK 2R42A 4JI0F 3SJHA 1RK8A 1IBKF 4GO5X 4ELTA 1Q5VA 2OTLN 5C0YA 4ZVOB 1FXXA 2ZH7A 1VHXA 1XMQF 1ZC6A 5F3ZA 2DGOA 3AD8C 2P51A 1PSDA 3G4SS 3RAMA 2JZ5A 1TFYA 3DDKA 2QTDA 3HJFA 4KV8A 4F36A 4NLRA 2R3VA 3V1RA 1X4FA 2FHMA 4Z7YA 1M90T 4FPRA 4G1QB 5L39A 1JLAB 4OYBA 5T7BA 1WEYA 3E01A 2G0CA 1R0CB 3H25A 1FD8A 2D3O1 4AT1B 1YX2A 1S12A 3RJMB 3QJLA 3PEJA 3R5CA 3CFOA 1KNZA 3N79A 4I64A 2QMWA 1NBWA 2HBKA 5BR9A 4M3UA 1NOYA 1H1VA 3ZTRA 3N01A 4HT5A 3OSPA 1IKXB 2MKIA 2AEMA 2W2PP 2L9NA 2JVOA 4O8UA 4QW9A 1BG3A 2DH7A 3I0SA 2DGTA 5AQRA 1SJQA 3MOJB 4RCHA 2DRAA 5I3QA 3ZT2A 3ASMA 3FFKB 4CJ4A 1W7AA 1N54B 1M5VC 2HPUA 3GPAA 4LF8F 5D3GB 2R2UA 3ILJA 1S72S 3MM6B 4MAKA 5KFIA 2HB5A 4CWBA 5BREA 1DARA 1RSCA 4BE2A 1BQMA 1VMBA 4JYAK 5DQIA 4LBPA 2RN2A 4PQAA 3M30A 2H5JB 4UOCA 3TUPA 3OYBA 2VG6B 1HD1A 2E7XA 3MXJA 3MMBA 1OSDA 3IM9A 2Y8YA 1SI9A 4LF9K 2ZJPL 4ZVEA 3THPA 1JCGA 1OH5A 1QLNA 5BRFA 2BMBA 4DF8A 1FK9B 3AQOA 4DV4K 2OLWA 4C8ZA 1SQKA 2RILA 5KFJA 3K5LA 4HUFA 3ATVA 3QYYA 4KV8B 3OTOJ 5BN8A 2A40A 5I42A 4CNYA 1U1OA 1CJVA 2GC8A 4R8UA 3TYTA 5E5NA 3CD6N 3C0BA 2BQRA 4H0XB 4BGAA 4M63A 1ELOA 2NRZA 4F7VA 2IC3B 3AD9C 2GMHA 2YQ0A 4AHVA 4K4UA 4K8XA 3N6NA 4KB1A 4KHUA 3IMXA 3CFRA 3N28A 3W0LA 4YOUA 1SV5B 1OKJA 2BXJA 4KR0B 4RW7B 3MD1A 5C2GA 4B1VA 2A0FB 2V7YA 5KFAA 2VONA 1QAYA 3PR4A 3QFPA 1X4HA 4K0KF 1JXVA 2BE7D 1R7IA 2K3KA 2YPYA 4IWVA 4KGKA 3CQYA 2DXFA 2NRTA 2GTDA 4K2JA 2KYXA 3Q2TC 2J4RA 4CJRA 4FJIA 4JV5K 3JSRA 1G3OA 3I0SB 4K4WA 4ECXA 3L4QA 3OFHA 2OPSB 2IS3A 3EX7B 3H5SA 3KWMA 2V2KA 3QB0A 5CE3A 3DDNA 3FMWA 4JLHA 1KLMA 3SFGA 1V5IB 4PKDB 2UVVA 1K9MT 1PGZA 5B0EA 1RILA 5IQ6A 4LQ9A 2EWHA 2Q43A 3FEYB 1Z05A 4M5IA 3W2VA 4RWTA 1M1GA 2PE8A 4WPAA 3PRBA 4OLPA 1NJZA 3QEXA 4CBWA 4RW8B 3M30B 2GZOA 1Y7PA 4UUWA 3JAMU 5J1PA 4BDPA 2ACYA 3IA0A 4Y2KA 2M5YA 2FVSA 2QWOA 2FHKA 2AT1B 4KE5A 1RACB 1Z6RA 2CJBA 5LM7E 3THWB 4GMJB 2QTWA 4IO9Q 4ZTJA 1MWKA 3QERA 4ICLA 3VF0B 1FDBA 3CJCA 4CTAA 4JV1A 3VAKA 2MQNA 5I3UA 5CCLA 3I32A 4X62J 2OUGA 1WC5A 2CH5A 3MUTP 4JS4A 3ENWA 5DDRC 1XR6A 1WNSA 4DG1A 3OUYA 5F9NA 5AZIA 4DUZF 3POTA 2MQOA 1VBZA 2ZZNA 5MLCQ 1S0VA 2G0JA 3PHEA 1TVRA 1T05A 2DHXA 4YOYA 5CZ1A 3PVXA 1MMNA 2B9EA 5F1XA 5THWA 4FNIA 4B3MJ 3N5FA 5KFNA 2VHGA 2HK3A 4IFEA 4OHZA 3MR6A 1SZ2A 2MXYA 1GXLA 1XMOJ 1M1KT 3M1FA 1VSFA 1KQSR 1F2GA 3QFUA 4FLUA 1S97A 4QAGA 4B9UA 5BXIA 3L6QA 4JI7K 1UAXA 4JKGA 4MKAA 2J8SA 3OHRA 2P1JA 4N77A 4HWIA 4M7XA 3CCZA 1YQHA 5EVZA 4KQZA 5D4PA 2EFVA 5DJBA 1VRTB 4H0YB 2V2ZA 5KFHA 4XAKA 4K5SA 4DFPA 2OZSA 1KAYA 2BJ7A 4DR5F 4B3TJ 2AJQA 3S3OA 5M1NA 3LGMA 2YWKA 3VN5A 1RHQB 2VF3A 3W2VB 2XYPB 1S6PB 4NLPA 3KK3A 3CMAN 4NWBA 3TEGA 1U0SA 2C3OA 2P9KB 2O3DA 3MR7A 3MUVP 5A8KA 4Z2XA 3ISZA 4YS2A 3OHAA 4Z7CA 5ETPA 3RRGA 1RJJA 3TX8A 5BPNA 1URNA 4CGHA 3WT0A 5DZ6A 1BMQB 3HBTA 3OS2A 4CEDA 4C11B 4ICLB 3VQSA 4URGA 1NLKL 4USTA 4QWCA 1XNQF 3VQQA 1ZS6A 2ZHAA 4NYFA 3CCVS 2H4YB 2B6AA 3BZQA 3R6LB 4RZRA 4F25A 1R0AA 4ZCLA 1CZBA 1CXUA 4ETXA 3ENHA 3V4MA 1WF0A 1DZ5A 1HBOA 3DYAA 3L4BC 4GVEA 3K89A 5FROA 1TVRB 4P10A 2XULA 3KOAA 4LH5A 4WE1B 1Y5NB 5D4OA 2V68A 3OLAA 5FPDA 3PJ9A 4DCHA 5C25A 2J7UA 3IG1A 4DV0F 3L2QA 4JV2A 4ILGB 4JKAA 2CQGA 2KFYA 3D68A 4TYAA 2AJ0A 3L95X 3SI8A 3GYGA 5C2DA 2R8KA 3J80Y 1RBSA 3DWLA 5D78A 5DG7A 2YKOA 1HKGA 4JKGB 4ZJQA 4PUOA 1APSA 5KOWA 3KVGA 3AVCA 5FLXO 5JS1A 2DB1A 4C0OC 1N6QA 2BZ2A 2D1CA 3BSAA 2VKRA 1XEZA 4A4JA 1OJ4A 4NLQA 3NH0A 4ELUA 2FLOA 3KLHB 3PRDA 5FDLB 2RDIA 5J1EA 5KPTA 3CPWM 3VVUA 4CO4A 2O4IA 1UFWA 3KK3B 1HHTP 3M6WA 4LF5J 2IOCA 3IRWP 5A8KB 1YRXA 1S1WA 2CPYA 3PIPL 1HRHA 3IO1A 4JI3J 5IQQA 5AFUA 1R8HA 1M5PC 4KTQA 4KY3A 5GAGI 4X2BA 1UFLA 4ZMMA 5ETVA 2VD3A 2Q31A 2FIUA 3MXIA 2XSJA 2E1AA 4JI6J 4P73A 3VTIA 2RD5C 5CZ2A 2Q66A 1RT4A 3EO3A 5AXKA 4BC9A 3NMAA 1NGIA 2UV8A 1M5KC 3VQ7A 4YHHF 1R0AB 2E5IA 5GAEP 3IS9A 3DYAB 5D15A 3CCJN 1ZZNA 1RHMB 2XY5A 1IO2A 2WONA 4PWUA 3MEDA 4FJMA 2D9OA 1X31C 4KGXB 2QYGA 5K14A 1DQ9A 3NCRA 4JK9A 5C25B 4B3SJ 3AB2B 1BHLA 5CZVA 3FGVA 2M88A 1QVGR 3DXMB 2FJBB 3RBXA 5F8NA 4CFBA 4LFAF 1RP5A 2AX0A 1GOAA 1A6LA 5L1KA 3E1YA 1XMBA 4HACA 2ZVSA 3HHDA 2R7YA 3OTCA 4M63C 2GAGC 1VISA 4QQBA 4QWAA 4HTJA 3ZZRA 3HCXA 1FRXA 4EWTA 3VAJA 2E9ZA 1N6QB 2SXLA 3CJ3A 2VPYB 2VGNA 1GH8A 4IYQA 2KXFA 2B8QA 4KT0C 5HO4A 4P9SA 3NWGA 3P5TL 4EO6A 2M52A 1FEEA 3IBWA 4FWSA 3WBZA 5LXYA 2AYBA 5J1EB 5A2QU 1O0PA 5DG9A 3G6YA 1KEKA 4CGGA 1XUPO 1A5WA 1SL1A 3AJDA 3PW0A 1RGVA 4PQUA 3O3HA 2R8JA 3EWGA 1NAQA 3O9TA 3AVLA 1KD1T 1WSJA 5ETKA 2VQEJ 1MN7A 1XNRJ 3OYCA 3K5PA 3LPUA 3EPGA 3T41A 2ZE2A 2RE2A 2AEFA 4QS7A 5B0FA 2Y1JA 3ZSZA 4NLSA 3CJRA 1PC5A 1RT4B 4PKIA 1L3VA 1HMVB 1UA1A 1T3VA 4DPTA 4ZVGA 5A0YA 3CD7A 3DFEA 2R7SA 3OYKA 3GCWP 1S1TB 2H54B 4JI6F 1LWEB 1EX4A 3O9RA 1AZSA 2VA3A 1YJWN 3RGIA 1IBLK 4CHOA 1NCLA 2WONB 3HDSA 3DRPB 1UEKA 3P5BP 3UB5A 3NF9A 3SMSA 2UUBK 2VBZA 4QW8A 1KKHA 3CJAA 4GO7X 1U4BA 3BGUA 2FC0A 3DI6A 1JL1A 2YV0X 2LU1A 1J27A 1HI0P 2P2CB 3HFVA 3I9V9 1XK8A 1Q7YT 4HACB 3CGIA 1DY3A 1X3NA 2HMIB 2BV3A 2RU9A 3BO4A 1KTQA 4PPZA 2OCEA 3UVJB 3DM2A 3V1QA 1WHYA 2IMOA 3KLFA 4MKYA 1NKEA 4XH4A 1D0EA 4OPKA 2LU2A 4MIWA 2ZWPA 5CQGA 4OYPA 3NF6A 1TFWA 4BVOA 2KW4A 5TKYA 4DI6A 4IFYA 5AQJA 5AQFA 4H8KA 2DJWA 1ZAXA 4FLZA 5EX3A 1XTZA 5ETNA 1JLEB 1K1SA 4M5HA 4CH7A 3RB3A 3C7NA 4E1JA 1FFSB 1YF5L 5AQQA 3OVNA 3D3CJ 1FERA 1YAGA 1IXKA 3AOCA 5ETQA 1RI7A 3W62A 4DPWA 3R27A 5HQMA 3HHLD 1R3NA 3BGFA 3PX6A 3BEXA 5F0XA 3QSIA 3P83D 4F4XA 1T44A 3IDHA 4BHQA 3EGZA 4ELVA 2U2FA 1D4XA 4WQ4A 1TL4A 4K7QA 4C3MA 2FJAB 4KFBB 3VQBA 5E3CA 4NXMF 2OSRA 4A8YA 1H7WA 2V67A 2EG1A 1ZXOA 2CNNB 4ID5B 1ICEB 4CT9A 4UZBA 2VJVA 4ZKAA 5LSLA 2VOPA 4IQMA 4LFCK 1R8PA 4C0HA 3I0RA 4N5SA 2IDEA 3FSYA 3BKFA 1ZBTA 4KJIA 1N5QA 4DMZA 2P9SA 3A5LC 2XZTB 5LXRA 4TU7A 2JOQA 3WZ0A 3TAQA 1H0HB 2LLZA 3I55S 1ROFA 2OFHX 4E8UA 1RLDA 2FZKB 2XYGB 1Z25A 1VQ6S 1VQSA 3FSXA 4GV3A 2DTJA 1S9EB 3R9LA 3AAPA 3WNFA 4LSNA 4MYUA 4ZVQB 1OO0B 3LP2B 3QGHA 1HQUB 3NOCA 2HHWA 3CC2N 4B3RJ 4JI8K 4FF4A 3LPEA 3Q8PB 1U25A 4QPTA 3NBPA 4B8AB 2KRRA 4X65K 4M5LA 4M5GA 4DUYK 2MMYA 2NUHA 2WOMA 5KFYA 2DFEA 2GIRA 3HI9A 3R7NB 4M95A 3EJMA 2ZM6K 1GTHA 4X64K 4U95A 4FZZA 3M7VA 3HJVA 3N5BA 4K4TA 3ZSRA 1DQAA 4RU9A 3O4WA 5E3QA 2HQFA 3KWGA 5HROB 3NNAA 4JKHA 1RWWB 4DLGA 4P7VA 2KLAA 1HBUB 4JS5A 2HOEA 2JNJA 1FFGB 1EZZB 2JHEA 1JWWA 3RSEB 3BBBA 4FF2A 1P1LA 2KVQE 3SFUA 1BU6O 1UW4A 2QT7A 2ZH2A 2E2NA 4ECVA 1S4FA 4KSEB 3J7YU 2ZJPQ 5AQVA 2JWNA 1BHNA 3WHIA 2BGGA 5HL7Q 2G8FA 4EFAC 2UVUA 3AA9A 1RTDB 3H98A 4P2FA 1RAOA 1YGYA 2VB6A 3HHNB 5IXUA 3GIIA 3KIOA 2IJNA 1JX4A 4FPBA 5IM0A 1H73A 3BSOA 4JI0K 5EWGA 1IBKK 1RB0A 2QX0A 2C2MB 1XMQK 4GVLA 5F9LA 2RQKA 3PUFA 2NREA 5LMUJ 4OFZA 2CPHA 1Y3JA 3A8EA 5D0EA 1QSYA 1LFPA 3PX0A 1RKJA 4LSNB 1N4LA 3LW5C 4FJ8A 4I6WA 3J80O 1ATNA 1R31A 1WSGA 2RT3A 1HLUA 2Y1LB 1RWVB 2F4FA 3UDVA 3JTOA 3JB9k 4AQYJ 4CEAA 3NBPB 3BGRB 1TZ0A 2QLWA 2HHHF 2A5XA 2E9TA 3ZETA 4URQU 4FYWB 4N47A 1JJ2R 2VA2A 1C0GA 4B3RF 1UETA 2WUSA 4PXBA 3E9OA 5JVGL 3NF8A 1NU4A 1YK9A 1SKWA 1TUGB 3KMQA 5IS2A 1NSPA 3P4UB 4FYYB 3BO3A 4EU0A 2B9YA 3L7UA 3MZIA 3V9WA 2VDIA 4DHVA 4I7FA 2M0GB 3AQPA 5ETTA 1REGX 4ZPCA 4BC3A 1T9VA 1C0TA 2ATLA 3WQUA 4DFKA 2RRNA 2JFDA 4NRUA 3OYGA 3HOTA 4LF8K 4CZEA 5F0WA 3Q24A 2CPFA 3TTDA 5L46A 2VJUA 3ZX3A 2DRDA 4AHUA 4C1NI 1XQSC 5IT4A 4DV2J 4ED4A 3QMQA 4DQQA 2R2SA 2OYQA 2KTQA 3IRXA 2JL9A 3ZNJ1 4FM2A 3TTCA 4O5BA 5IM0B 1WUAA 4WQ5A 2NXEA 2XMVA 2YNGA 3V1OA 3J7ZT 2BE2B 5EOYA 3THTA 4DV5J 3ZTQA 5KG3A 1GX5A 1IJJA 2LDIA 4DCPB 4TY8A 5GADI 1S6UA 4DTPA 2GWJA 4KHWA 1YI2S 3AD7C 3KJQB 2LDYA 3HVTA 3D1OA 3GYXB 4EYHB 2QWQA 4WP8A 3FEZA 2CQBA 4LVOP 2GJ2A 4RR5A 2Y9HA 4CFAA 3CQ8A 3F41A 4LRCA 2MSSA 4DPYA 5LMUF 3P31A 4R5PB 3GIMA 4QWDA 1SKSA 4IJAA 4B1UB 4L3QA 3ZLJA 3M8QA 4BQLA 3O6WA 2KXNB 4LH4A 4K25A 1K8AT 1UVJA 3EE9A 4USUA 4E7KA 4RJVA 4JHDB 3ZETB 2RS8A 3Q23A 1HQ2A 3UWTA 4DR1F 3IWXA 4OI1A 3ENQA 3QDKA 1DAXA 4K0KK 4IG0A 1N32J 3C6UA 3NKYA 3O1BA 3QIDA 3OLBA 5L9NA 3NGUA 3OS1A 4CJKA 3N6MA 4DR6J 3W8GA 4I6MA 3I96A 5BPLA 3GFYA 2EK6A 3S3NA 2J6UA 2L3MA 1LWCA 3QMLA 2Y1IA 5M1FA 2AJFE 1KAZA 4DSKA 2UXDJ 5JLHA 2GJFA 3CJQA 3MAQA 3BDEA 4IRKA 1DLOA 2MQ8A 2ZHOA 2MKCA 2M9KA 3HPHA 3OYHA 1T9UA 1EWRA 2NS1B 3GYNA 3CCTA 3NCPA 4KO0A 1QSSA 3OS0A 3GV7B 4PWDA 4EUVA 4K4YA 2PI5A 1LAWA 2YNGB 3OL6A 4DTUA 5AQMA 4Q8EA 4UQTA 2CZVC 2NXNA 4XPEA 2H5IB 4TY8B 1GMUA 5HI7A 2Z58B 2ILYA 4J2EA 3DLHA 3D9BA 3EVOA 1MWMA 1BCMA 4DV5F 2R7XA 4DF4A 5SUHA 1S5ZA 2FUG9 3VENA 2V8GA 1I94J 1D5AA 3KKFA 2C3PA 4DUZK 1BGXT 3DRSA 3E51A 4OZLA 3I4PA 2F9WA 2RS2A 1FWKA 3I5AA 2HAIA 3LP0A 4NZ0A 4E2FB 4M3ZA 1RU1A 1RDAA 3UCGA 2NZ4A 2GJIA 3NEKA 2PEHA 3LZJA 2B9WA 3GLJA 3JXUA 1DHMA 3JTPA 3NFAA 4MDBA 3R1LA 3MN9A 1UVKA 2CJKA 3LTOA 1QUVA 5F8MA 2BDPA 3O08A 2ROGA 4A8SA 2CZ9A 3RMBA 2GO8A 3W61A 1RE1B 2VASA 4AHRA 3CE8A 4O5FA 1NMDA 1LWCB 2V4JA 5KFRA 4CHNA 4J9OA 1WG4A 4U6PA 1REVA 1NPPA 2XMJA 4FZYA 2CJYB 4FW1A 4DR5K 3QINA 4DU3A 4BRKA 2P8IA 2YWHA 1YIJN 3KLGB 2QJ3A 2P6TA 1PYTA 4QWEA 2YNHA 3JQKA 2GUIA 3QAEA 1U1MA 1CS4A 2CPIA 2LEPA 4AUKA 2UXDF 2PMZD 4CO0A 5JMVA 2ZC4A 4CI6A 3K2YA 5GAHU 3OYJA 3A8JA 4Q45A 4X4OA 2G0IA 2H65B 1W0HA 5BYQA 3PR5B 1MWQA 4ZP9A 2D0BA 3BQ1A 2CQDA 2QL9B 3ZSXA 4P7TA 4QS9A 2WZ1A 4LUBA 4B9SA 3DNCA 1B64A 4JB8B 4KH6A 4O0JA 1NWKA 4DSLA 2F9DA 3MUMP 1XNQK 3K9JA 1P8ZA 4A47A 4ZP6A 2D74B 3SYZA 2AIRB 1HKCA 1VLYA 3M32B 2DHGA 2DBBA 3DRSB 1WHVA 3RWUA 4A8QA 1LW0A 3SXLA 3RBEA 2B56A 4BWJA 3J7YP 1BA1A 1HWIA 4DFMA 4DV0K 3PZPA 1FJGK 4KAZA 3OV7A 4WU2A 1FXDA 1VAZA 3ZSYA 1D8ZA 2AX1A 5FPNA 2PBDA 2ALYB 3KUGA 4A2AA 3G8SA 3LDPA 3WXMB 2FSNA 3IN5A 2C2RA 3X1LB 5G4DA 4C23A 3A8YA 1KCFA 1A9NB 3LGHA 2YI1A 2KFNA 2DXEA 2FBVA 4FWOA 3A12A 1NGHA 2GS8A 4W5RA 3KWIA 3H42A 3TQEA 4KH1B 4OI3A 1P9YA 2QLBB 4UW2A 4EO8A 2OPQA 4LC9B 3VEOA 1VQ7N 5BPMA 1RUSA 3PEHA 4UOHA 2Y0SD 4BRMA 3RRHA 1G2EA 1S99A 4LD0A 2GHPA 3N9UC 1NBEB 1YZ7A 3TANA 2IVFB 2A2CA 2W41A 4ZHRB 1RWXB 4MK7A 4P6QA 2WVDA 2QWNA 1X4DA 2B4OA 1AXQA 2A6MA 3CQXA 3VWSA 5FPMA 1N36F 9RUBA 2DT9A 1X5OA 2JLFA 3RMAA 4CH1A 4KREA 4AL5A 1DEJA 2O8CA 5CD4A 3MMVA 4J9SA 3QNWB 1FRLA 1Q81T 3LDLA 1YUWA 1TMMA 4ZLLA 1BQXA 4YHHK 1VQOS 1ATRA 3MECA 3NWRA 1NGJA 4NCBA 3DLJA 4Y6IA 3GFHA 4O0NA 2HLTA 1VSJA 1R59O 3PYDA 1SH2A 2K7JA 3T5KA 3MHYA 3H59A 4WQ5C 3DLLQ 3RR7A 2AZ3A 2GVZB 5AFUH 3QQCD 1IR0A 2JEGA 4QIVA 3VEVA 4FZVA 3DXKB 1ZA1B 4I9QA 2OIHA 4JKEA 1RT7A 2IDOA 4JI2J 1AROP 2QYCA 4LFAK 4J2DA 4YB6A 2HQGA 3C94A 4CGDA 2MDAA 2LXUA 1IBCB 4IFVA 3MDFA 4DV7J 4U7BA 1Q9YA 1CULB 3P1GA 2F5GA 3VALA 4BCAA 1CVJA 5KT4A 3SK3A 1QQCA 3NMRA 4CJFA 3JSMA 1IR1A 2HS4A 4RBVA 1VQLN 2IBOA 1RAGB 1IBMJ 4FO0A 4IOXA 1CSJA 4CDIA 2W8KA 2HK2A 4L76A 1EXQA 1L3KA 3OW2M 2JEIA 2OPQB 1EARA 2HBJA 2BJEA 3C6TA 3MN5A 4PEOA 2GUPA 2XEXA 3IWNC 1EP4A 4MK8A 4O3PA 5GMDA 3SQ0A 4NXNJ 3TSUA 3MTJA 2W4PA 4WYLA 2QL7B 3D6MB 1NKBA 3O80A 3CC7S 1C1BA 4CECA 3CCSN 1Q4RA 3V2UC 2DYAA 2FHJA 3HFZB 4NLCA 2KM8B 2AYGA 1UAWA 2D41A 1ZETA 3W63A 4OIXA 5A2QY 2P9LA 1F60B 2YKNA 3QFHA 1L5UA 5LL6d 2O8EA 2Q0RA 3CMES 2N4DA 5D4NA 2O8CB 1FCAA 3OFGA 1FKPB 4LF1A 5H9EK 4FVMA 1NK8A 4C8MA 2XHCA 4CEFA 4YY3F 2AQ4A 2LQ5A 4B9TA 3AV9A 4ENOA 3M6UA 2J6SA 3NGRA 1TAUA 1RTIB 3MECB 3JXOA 2ZUGA 5HP1A 1M5SA 2V51B 1H74A 4JI6K 3S9HA 3F56A 2A6AA 3OD2A 5FLXU 1HNXF 3V81A 4LR9A 3VGLA 3SCIE 3ZEUA 1FDAA 2ZOFA 2PDAA 3KK1A 4RUHA 2W2QP 4BR2A 3PYEA 2UZAA 3PYGA 2GCFA 4RLEA 2CYYA 5IWAF 4CYUA 1X9SA 4OVLA 1LK5A 3P8BB 4F0HA 3VEYA 1NJXA 3J81Y 4IFVB 1VQ5S 2IRYA 4F3TA 2A42A 3L9ZA 2E1CA 3MM8B 1W9HA 2HHSA 4X4RA 1GLAG 4CK1A 4WU3A 1C1CA 2G8HA 4OLAA 1QUPA 3ITHA 3MM5A 1F0XA 2V8VA 2DKOB 3MM9A 1KONA 3C14A 4DV7F 1U2RA 2EEYA 3KG4A 4JYAJ 4XH5A 3MPYA 1FHTA 3W9IA 3GWCA 1RNHA 4GV6A 2EFPA 4AE5A 1S9GA 2VQFF 1IBMF 1E6YB 5T41A 1LWFA 1N5SA 2MZRA 2WAQD 4LF9J 1S4EA 4NA2A 3NGKA 1U8SA 2E1MC 3TW0A 3OYAA 3T1YF 3QIOA 1WSHA 2FC9A 4Y1DA 1SJ1A 2HS3A 2P9LB 4CHPA 3WNEA 4IOCL 2QO3A 4USJC 3VF6A 1X0PA 2OTLS 1T6DA 4C48A 4Q2LA 1VSDA 2QI2A 1NK9A 1UPPA 4CLKA 4XO0A 4CZIA 2PZSA 4OKEA 1WWHA 2AHOB 2C42A 3SEOA 3HXMA 1KN6A 5KT6A 5AQYA 3DLGA 1TK0A 4FYXB 3FZKA 2Q0UA 1UJ5A 4NXMK 4YR2A 4GC6A 3M8PA 4A61A 3OY9A 4I2QB 3UE2A 4CQ1A 3ZEUB 3L4IA 1TK8A 2VC1A 3DMJA 5HMXA 2WCXA 3M2RA 1N5YB 4P2MA 4LBHA 4JV5J 2WFBA 4CI0B 4ISFA 1SH0A 3ULEA 2VV5A 1NK5A 4TQSA 3R2CJ 3LL3A 4DR7F 3GJQB 3MF5A 2CH6A 1UVMA 4LSZB 1PG5B 4JV0A 4AXIA 6AT1B 1Q86O 1E4FT 2ZC3A 5GAHP 1KC8O 4YDDB 2NXCA 3MN6A 1S0NA 5DGBA 2N3OA 4OI2A 4FJXA 3SAFA 4O8KA 4CJQA 2I7NA 1RAFB 3MM9B 1UFKA 4UTGA 2Z4PA 1F9EB 4EK2A 1EO1A 5JVGQ 3C19A 2RHQB 3TVYA 3I5CA 2VICA 2RRAA 1J54A 1N8RT 3FC9A 1RBLA 5KGXA 1S9GB 1FEHA 2HZAA 1QM9A 4OJGA 1NLVA 1NMEB 3DLEB 4O23A 1SIWB 2C22A 4ANCA 3NVKA 1GLFO 2ZNYA 4AD6A 1W2BM 2HVDA 3AA4A 1CC8A 2B7CB 4CLTA 2Q2RA 4HH0A 2MKJA 3W9HA 2MY8A 1RT5B 4IR9A 4FYDA 2HVZA 3IR5B 3M6XA 3A4TA 4OI4A 4TNOA 1RDBA 5K8PA 3CJTA 3WIVA 3D3BJ 1TL5A 2E5GA 1U45A 3GQCA 2RPIA 3AY9A 4TU9A 1TUVA 2F8TA 2Z8QA 1SQGA 3QBCA 4ECSA 4CM2A 4KH5A 2KQ2A 1G7CB 4DPUA 3C95A 4IEIA 2ZNZA 3L3UA 2X6NA 4Y2AA 3M8PB 5DDOC 3VGSA 3CERA 1HX1A 4J8FA 2XSFA 4H54A 3O3FA 4W5OA 3M2RB 2F9JA 5AJ3J 4WFAL 1SC1B 3HX9A 1KBRA 2EFGA 2BUNA 4PG7A 3RW7A 4C3LA 2ABYA 4BRLA 4KGVB 5KFPA 3SNNA 4JI7J 1ZM2A 3UKRB 4M3RA 2BW7A 3EKUA 2MQPA 2F7VA 2PYJA 3VF2A 1WKKA 1J9AA 4FDFA 2AA4A 4JI4F 2QSWA 2FJEB 1S79A 3PO4A 1OS5A 1F3FA 1T9TA 2D3UA 3FLCO 7FD1A 2BKPA 3D4JA 4LT6A 3VQCA 1A7GE 4X84A 1NGGA 4O3QA 5KFXA 4OZ5A 3HHKA 4DL4A 2DR9A 1U6FA 4WXOA 3MR5A 2IY5B 1RDRA 1CEZA 2Q6BA 1U02A 1NGCA 3TP2A 5AQNA 4H4OA 4WP3A 2QFIA 2HHHK 2WBMA 5JICA 2X3DA 4PPDA 1TUYA 2XMUA 5CAAA 2KDOA 2UUTA 4R79A 2DR7A 2IMWP 2VDHA 3D2EA 4EFHA 1ZAVA 3K8VA 4N8NA 2YHYA 4B3RK 4FZXC 3CJ2A 2WB4A 3HPGA 2DNYA 3DOKA 1LV5A 2X78A 2HGLA 4PG4A 4RW6A 3T7ZA 2OPPA 1K73O 2GO9A 3GFZA 1YBUA 3VOVA 3KZBA 4TYBA 3MAAB 2DNHA 2KT3A 3DRRB 4E1MA 2UUAF 3AJ2A 1ZZFA 1UVLA 2Q97A 3VHQA 3BEGB 2DRBA 4FWMA 3OXLA 3LOUA 3L09A 4F2RA 3SUNA 3QRRA 3FBBA 1XJWB 4DU4A 5CXTA 3IXQA 4ED3A 5FPEA 4I2PB 2MZQA 1X4CA 3IC1A 4NLWA 3D67A 3NAEA 3BKUA 2WVBA 1IG9A 3OTBA 2KJVA 2MYFA 1Z1ZA 4QS8A 3I6PA 4AHCA 1VIOA 2MPUA 3LM9A 3MMAB 4F8RA 2R2TA 2GV1A 3ID6A 3CJ1A 4OPJA 1FO1A 4HDGA 5AJ3F 4MLHA 4CESA 4B9QA 2ZBRA 1NZAA 2DY1A 3TJ9A 3AVAA 1HD0A 4DR3J 3QEPA 2D5RA 4L75A 4C8LA 1LCUA 2FY8A 4ZN1A 5LJ5Y 2FLLA 4OHWA 1FVQA 2YNFB 3T19A 3ILLA 3FZLA 4CZMA 4FJKA 2R4FA 1BWEA 3LDOA 3RMCA 3U7JA 5LMUK 4J7CA 1V5VA 1SVDA 2P9NB 3JYTA 5SZTA 4M7YA 1VSEA 2CVIA 3OYFA 2PY5A 3FR0A 4TY9A 3I8BA 2YNIB 2MKSA 2EC0A 3HSZA 3UKUA 4ES3A 3NG8A 2NPIA 3FSIA 3D28A 4DR1K 2IVNA 4X4NA 2CJAA 4WBFA 3CMAS 3D2EB 2E1RA 1PAUB 3V6DB 3MGJA 5T7LA 5E2QA 1B70B 3EXCX 4X66F 3TAPA 4QIGA 1FKAF 3W1YC 3CWJA 3FBFA 4LRAA 2OPPB 1ATSA 1YWXA 3QZ8A 2AJ4A 4M42A 4WFNQ 2NXJA 2E66A 2RH3A 1X60A 3Q8UA 3VEXA 5C2CA 2ATCB 5A2QO 2ZD1B 3HPOA 1C6VA 4V19S 1U8WA 2VC0A 4DL7A 5M1KA 2P5GA 1IKYB 3ZFVA 1NRKA 1QVFM 3FK4A 1X3MA 4PR6A 1B9FA 1MMLA 4LF4J 1FJCA 3DLKA 1VGYA 1HNIB 4B08A 1N33F 3ZX2A 4ZPWR 2HFSA 4JI5J 1RYSA 5I4MA 2DIVA 2G2OA 3UI3A 4HTUA 4ZVSB 1YLXA 1YJ7A 4K43A 5KFFA 4DV3F 2QA4N 3ONQA 3R6GB 2IM0A 1R0BG 1BC6A 5B0AA 3P39A 4DKWA 5EXWA 3CJ8A 2RQMA 2YY3A 3IWLA 3G6VA 1DFDA 1DTQA 4PKHA 4A8XA 3SAGA 4K8ZA 3O2IA 2ZZTA 4FLTA 1DGKN 4CF1A 4Z94A 1S1XA 1TV6A 1S1UB 3WEEB 3H20A 4PY5A 2RUSA 1VSLA 3N4WA 3J7AP 1YJ9S 1ZM3A 4DR3F 3J81O 3KLIA 4RBTA 3NAHA 2HHVA 2JC0A 2RDJA 4N8OA 3VVTA 3C66A 1DQ8A 2HWHA 3E3XA 2EKNA 2H4WB 2XI2A 3KJVA 4C3KA 2GEMA 4BRQA 2G8KA 4CO3A 2DHHA 4WYBA 4FJ5A 4D3HA 3GSIA 4W4MA 1S59A 1PJ6A 1WUUA 2C2DA 5HMZA 2QLXA 2QE5A 3QLHA 2HNDB 3WUHA 3VQAA 4Y0WA 4MO4A 3GDQA 1CG2A 2QG9B 4FPIA 2YHXA 2IPOB 3QIPB 3DOMA 2JWLA 1IBLJ 4PCQA 2NLWA 4N7TA 2WHOA 4MO5A 3S41A 3SDEA 2UUBJ 5C10A 4FF3A 4WF9L 6FD1A 3AHPA 3UR3C 2JLGA 2OGUA 1S7HA 4A46A 3FKBA 1NPKA 3FRZA 3W9JA 3CCJS 4BRHA 3AA2A 5M2RA 2PT0A 2UXDK 4OGCA 4NLOA 2QA1A 5F41A 2GX9A 4LF4F 3GE9A 1NK7A 3TTFA 3KUHA 1NU0A 3SBTA 1KP6A 4NLVA 2JC1A 3M2VB 4JI5F 4KTWA 4KI6A 1WC6A 3GIKA 3RAQA 4JK8A 1DTQB 2CQ4A 2NRRA 3VGTA 1K47A 1ZTTA 3M2UB 1CJKB 1WF2A 5AQOA 3D2FA 1RBUA 1RTHB 2PN6A 2PEBA 2KFZA 3A5NC 4FPAA 4ALZA 2G4BA 1RCXB 4A57A 4U7UK 1Q8BA 2Y3YA 3MWPA 1V3ZA 2FVPA 3FQKA 1OY6A 3VV2B 3Q7CA 4TN2A 2QW9A 4ZCKA 2CNLB 1SS6A 1OH6A 2HRYA 3Q7BA 3P4IA 1M5HA 2MKHA 2O66A 2JWKA 2BM0A 1HJRA 4DU1A 1LK7A 1SIZA 5C5JA 5D0RA 3THYA 3CCLN 4NASA 4B17A 4B3OA 3G0ZA 3LAKA 5B0DA 3IBFB 4O44B 3LDSA 1MROA 2WVCA 4DR2F 1WSVA 1MSWD 4FXDA 2JVRA 3V9ZA 4AHSA 5KG6A 4DSJA 1PCAA 2HNYA 4X4UA 2L08A 3HI0A 1YJNN 5GAEI 2YPZA 5AZJA 1GLEG 2WSEC 1YSJA 1HPZA 3A13A 2EFNA 4PAAA 4UOGA 4ILLA 2VKZG 3FZHA 4LFCJ 3CVKA 1ZAWA 1VBKA 1RT6A 1RDCA 4MQ3A 1YJWS 1MNEA 4K42A 2IRXA 2LQ9A 2V50A 4ZLJA 2I5JB 5ETMA 3UDLA 1WHXA 3O1LA 3TZZA 4CLYA 3C15B 2Z1JA 1OH8A 3EMTA 3ZYYX 5EDWA 2QWMA 1N36K 3NP5A 1ZPWX 1Y0HA 1RT2B 4ZPVR 4WCEL 2DGVA 2NUUG 2A1SA 1IKWB 4DFJA 3D2FB 1GMWA 1VSMA 1T8EA 1ZBFA 3Q2SC 3Q22A 5SWMA 1HWUA 4J9UE 4AM6A 1O13A 3UR0A 1HQEA 4CZKA 4JI8J 1CJUA 4JKDA 1D9FA 2P9UA 4F0MA 1RBOB 4Q2MA 4X65J 1GMWD 5MAOA 3V6HA 3TJ8A 4OZNA 4LRBA 1U1NA 2RKIB 3IBCB 2R7QA 4WFBQ 2D9PA 3QGGA 1NHUA 2ZM6J 1UOCA 3OR1B 1GMVA 3PJWA 1T3NA 4X64J 3CIMA 4USKA 2HBZB 5HQLA 4OPHA 4WIIA 3MD3A 4GNIA 4FOEA 1S1VA 2ALZA 1R8AA 2J0QD 3GIJA 2M2BA 1NK6A 4B3OB 2D0PA 3DGPB 5J2PA 5TKWA 1BD6A 3GOIA 4B9LA 4E7IA 3TJAA 3NGSA 4FYVB 1IUJA 3CXCR 2E88A 4E7JA 1SJRA 2R8GA 3B8AX 1S10A 4ZCIA 4NB4A 3F0NA 2B4VA 4CZJA 3SSQA 4IQXA 1IJEB 3GR0A 3MPDA 5CH7B 1ZBLA 4CVNE 4CIEA 2ZH4A 2R9LA 2XY8A 4F3QA 5IV4A 2ZH5A 1S0MA 1OVYA 1GFWB 1TL7B 2NUBA 2O5DA 3BH6B 3U9DA 1VOMA 4JI0J 1SQEA 2CPEA 1UEUA 1XMQJ 4L3KA 1OY8A 2N7YA 2FQQB 2ZKUA 4ZK7M 2PMWA 2OEMA 3CEDA 2W4DA 3CMEN 2BM1A 1NM1A 3KNAA 4C98A 4CD1A 1ZA2B 2E1YA 4HR2A 5KT7A 5D0GA 4YY3K 2F63A 4PXEA 1N34J 3I5BA 4L73A 2P9UB 1JLQB 1HBMA 2V52B 2ZOGA 4IG3A 2F4VJ 3I33A 4A8FA 5LSOA 1MA9B 2YBVA 3UCZP 4IOBA 1HNXK 3HKWA 2YJFA 1LEOA 2FGCA 3TAEA 3MMCA 4WJBA 2ZJQL 4CEOA 1F5AA 3HP9A 4BC7A 1TYQA 3H5YA 3HRGA 3CI5A 5IWAK 1Y3KA 3AXKA 4XDCA 1FKOB 3EZUA 3GE1A 4FLWA 3RW6A 1NGFA 1VQ5N 3ULHA 4H4MA 2XLJA 4RNHA 3DN9A 3HFKA 3ZZPA 2ROEA 2RF2A 1VC6A 5G0RB 2QWRA 3T69A 2YWEA 2ZH8A 5HN0A 3UNGC 3G2XA 3PW4A 4LF8J 1P90A 4FS1A 3EZOA 4J9NA 2L41A 2G8IA 2IJRA 3TZXA 5BR8F 2NNWA 2QZ8A 2E2QA 1BWVA 2HRTA 3QESA 2CIMA 1Q82T 2FF6A 3EM1A 1S48A 2KL8A 3VQ6A 3VA0A 3PKYA 4CBUA 4Z4GA 3WQTA 3QWPA 1LQ9A 2VQFK 4Q43A 3IGNA 3LP3A 1IBMK 3Q8QB 5GMEA 4ECWA 2M8DB 1JKHB 2OD6A 3LWMA 2CDQA 7FDRA 2LEBA 5M1QA 3BYPA 1B7FA 2UV8G 4LR7A 1SCJB 3WX4A 3UCUP 5DM6L 2CJ9A 1DTTB 3T1YK 2BQUA 1SC6A 1U04A 3ZZOA 1O51A 1RDUA 2WBNA 5HRSA 3FJ2A 4KHMA 3KUEA 2UU9F 2UVWA 1RWPB 5IT9Y 1HNWF 4QZVB 4ZVHA 2ZDOA 3VQ9A 3BYRA 4WFAQ 4RNMA 3T6BA 1KRPA 2W9BA 3MEGA 3KHYA 2W01A 1HBMB 2EWSA 2HGNA 5J2MA 2C2ZB 5AQWA 5MLCV 3EZWA 4JI1F 2FJVA 2EBEA 4Y2IA 4K0KJ 3D6FB 3WX8A 1N34F 3D45A 2X1GA 1E6VA 2F4VF 4DXLA 3K17A 1TYQB 2O8BB 3TABA 1AB8A 3CJKA 2XHWA 4CZFA 1T11A 2KYZA 3TX0A 1JLCA 4CJUA 1QTMA 4DR7K 1W25A 4KHQA 3HM8A 1CC7A 4CFCA 4O3SA 2C3YA 3UIQA 4NRTA 4H4MB 1NJYA 3H7HB 2F8HA 4NE9C 1M5OC 2RE1A 2RF2B 2ASDA 1A5VA 3NAIA 3QT7A 4F3MA 1RQ0A 3R97A 3N4PA 3BGOP 5GAEU 4DV1F 1KQSM 2WSFC 4K50A 2RHKA 4CF8A 2DO0A 1VDHA 4OL8A 4DX5A 1C0MA 4UOFA 1V3SA 3GILA 3THXB 4CO5A 2AZ1A 2ZJRL 3ALYA 4OV1A 4HHHA 3QT6A 3DKDA 3IR7B 3KDOA 1NB7A 3CHWA 2HVHA 4CHYA 4BRPA 1LOTB 3VQPA 1GT8A 3G25A 1M90O 3SQGA 4E89A 3NS5A 1OY9A 2B43A 3TR5A 1PYSB 3JSBA 2IVPA 2HIQA 2YX1A 2H48B 1JNRB 2V7ZA 3U9ZA 3UQSA 1KHWA 2HHTA 4DUZJ 1MDUB 4USIA 4MT1A 4BR4A 1R8CA 4JN4A 1QE1A 2C2OB 2NRHA