2ZD1A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase/inhibitor
total genus 159
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2zd1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2zd1A05
2D3UA 3ZSRA 4HVJA 1Z26A 1T7PA 2YHAA 4Z0UA 3QEIA 3SUOA 4CF9A 1K1SA 3C6TA 4H4MB 3AO5A 4KHNA 2WCXA 4DSFA 4MKBA 5KG7A 3QINA 3MEEA 3MXIA 3JSMA 1RDCA 4DTJA 3BGRA 1C0TA 3T5HA 4CEZA 1LWCB 4LSLB 3KLEB 3OSPA 2FJWA 4UQGA 4F3TA 1UA0A 3V1QA 1MU2A 1SKWA 1RILA 1S6PA 3KK2B 1LWFA 3AO1A 5KFRA 3LP1A 3DRSB 2ZE2A 1JLBA 4FLYA 1TK0A 3CQ8A 4J9KA 5J2NA 2IM0A 4FLZA 4WE1B 3BR9A 3HVWA 1C6VA 4CF2A 4NLVA 4N5SA 4AILC 4KAZA 4Z4EA 2V0NA 2JGUA 3MEDB 3V9ZA 2QXFA 1VSIA 4B9UA 4OPKA 1W0HA 1IKYA 3VQ7A 1WAJA 4N47A 1RT4A 1RA6A 4FW2A 3I0RB 2R2TA 1T94A 1TP7A 4BWJA 4AHCA 2FBXA 3VQEA 4B8AB 3PR4A 1S1WA 4F8RA 2RPIA 2HNYA 4RW7B 1HQEB 1R0AB 3KJVA 3EZUA 3VQSA 3BDPA 4O4GB 4CHQA 3WNGA 1RNHA 4FLTA 4ED6A 3CO9A 5KT3A 1WSFA 3TAGA 1NKEA 4J2AA 4C8KA 4R5PB 3AA2A 1RDDA 3SQ4A 3AVNA 1TKDA 2BE2B 5KRTA 3SCXA 3OL7A 4GC7A 2W9AA 4RNOA 1NK6A 4ELUA 2HVIA 3PVXA 4X2BA 4QWBA 4H54A 3BJYA 4FZZA 1C0MA 4FYDA 5EUHA 1VSJA 3OYBA 3QO9B 1DLOA 2XY6A 3V1RA 2WK4A 1GX6A 2G8WA 1TK5A 4F3OA 3NAEA 1JLCA 1B9FA 3SQ2A 4NLTA 4Y1DA 2RN2A 1I6JA 1S97A 5CYMB 4QW9A 2W9BB 2HVHA 1RT1A 4I2QB 1JL1A 3V9WA 5HP1A 1RBRA 4AHRA 2R7YA 2E4LA 4IKFA 4KB0A 5FRMA 2ZD1A 3VQCA 3KLGA 1RT7A 2FVQA 1BQMA 2E9RX 3C6TB 1WSEA 3WNEA 3OYDA 4LQ9A 4NLOA 2I5JA 2G8VA 3MEEB 2ATQA 3JSMB 3MEGA 3KTQA 4FJJA 3K2PA 2JEJA 3BGRB 4HYKA 1C0TB 1QTMA 1EP4A 3CDEA 4MK9A 4ELTA 2WHOA 3QIPB 5F9LA 4K8ZA 1VSKA 1MU2B 4JRPA 4OLBA 4KHSA 3PW4A 2IAJA 3OLAA 1S6PB 1LWFB 4CEEA 3ZT0A 4CJ5A 3LP1B 2ZE2B 1JLBB 4JUZA 3I0SA 4K4SA 1BGXT 1RYRA 5J2NB 2ALZA 4K4VA 3GIKA 3TI0A 1WNEA 3RAQA 2FJXA 4M45A 1C1BA 4MIBA 4Z4GA 3CJ2A 2XGQA 2GBZA 1IG9A 3G10A 1IKYB 1RT4B 4J9RA 2IS3A 5CY4A 5KT4A 4BE1A 1C2PA 2W8LA 4FJ5A 2HHWA 4PQUA 3CJ3A 4CIEA 1ITGA 2OZSA 4ZTFA 5J2QA 1S1WB 3RTVA 3V6JA 4E7JA 4DL7A 3ALYA 1KTQA 3HPGA 3KJVB 3T3FA 4FJ9A 1K6YA 4CHZA 2XHBA 4FW1A 3NCIA 3RBEA 3FFIA 2F8EX 4DLGA 4HHTA 4ZP6A 4ZP8A 4DTRA 4B9VA 4NCBA 1WNSA 4RNNA 3V81A 2KTQA 4E19A 1S1UB 5EWEA 3SUQA 1W25A 3LANA 5KFQA 1YVUA 3QESA 3U3YA 3JYTA 1S0MA 3QGHA 2EC0A 2UUWA 5DGBA 4NLRA 1KSPA 5D3GA 4IBNA 4DMNA 3QEPA 4FCYA 1DLOB 4CESA 3OYKA 4CHYA 1HQUA 3NF8A 4FBUA 4TN2A 5KFUA 2OPPA 1J54A 3OYEA 2D7SA 1VRUB 1N6QA 2P1JA 3C95A 1RT1B 2Z1JA 1BI4A 5HP1B 3H5XA 4HUEA 4TQSA 4YNQA 4CF1A 5KG2A 1WN7A 4CJTA 3K5NA 3OYCA 1RT7B 4RW9A 4DFKA 1RT6A 1TAUA 4EP4A 2HMIA 3OHAA 1C1CA 2XGPA 1ZBHA 4M42A 2I5JB 1VSEA 2FJVA 5KFGA 4FJGA 3BQ2A 4HCBA 3MEGB 2JC1A 1ZYQA 4C8LA 4RW4A 3F9KA 2G8IA 4FM2A 1EP4B 1RBTA 4K50A 3VN5A 4B9TA 2ITGA 2CJQA 1Q9YA 2IAJB 3H40A 3UQSA 4TXSA 1RCHA 2GC8A 1U47A 4O3SA 3I0SB 3SI6A 4LD0A 5HRNA 4E7HA 3OL6A 2E6MA 1RDAA 2FVCA 4GVMA 4Y1CA 5F8GA 3S3OA 4URGA 1C1BB 3S3NA 4DTOA 1JLAB 3SNNA 3ICLA 3M8QA 2ILZA 4CJRA 4OVLA 3HPHA 3K5MA 4K4WA 4PQUB 3LAKA 3NF6A 4DU3A 4CFCA 2A1RA 3LP2A 4WXOA 3HM9A 1T8EA 3MAQA 5J2QB 3OYMA 1NK9A 4ECSA 4NRTA 3ISNC 4FJLA 2AWZA 3M9OB 3I5CA 1LAVA 3V9UA 5KG4A 3P5JA 3BQ0A 1T3NA 3V81B 5F8IA 4RNFA 4CERA 5HRSA 2BGGA 2HWHA 1D0EA 4M95A 4KI6A 3NL0A 1ZBFA 4PWDA 1JX4A 4CJQA 1X9MA 4EZ6A 4YQWA 4CFAA 2PY5A 3IGNA 4PUOA 3BSCA 5D3GB 3NF7A 3H08A 4BACA 5K14B 2OPRB 4XPEA 1Z4UA 2VG7A 5DQGA 3CDWA 1HQUB 2ZQBA 1S1VA 2G8UA 3L3VA 4FJXA 4TSXA 2OPPB 1XR7A 4YMEA 3NGDA 4AHTA 1L3TA 4EO8A 4DQSA 1T05A 4IRDA 3KLHA 3T1AA 4FS1A 1G15A 3V4IA 3I8DA 4CEQA 5C42A 4CHNA 1BI4B 3KLVA 3AA5X 1HYVA 2Y1JA 5L1JA 4B9NA 3PX0A 4EBEA 3PO4A 4RW9B 1QHTA 1RT6B 3KMQA 4KO0A 4KHRA 4EYIB 2HMIB 5C24A 3KHRA 1C1CB 3PUFA 4ED3A 3PX4A 3MR6A 3K5OA 4O3RA 2WOMA 4KKOA 4DQPA 4RW4B 4DLEA 2YHBA 4FK4A 2DFEA 4DL6A 3AA3A 3RWUA 5JS1A 4Y2AA 4O4RA 4ZHRA 4M94A 4Y34A 3L3UA 4NYFA 2XY5A 4IR9A 1SH3A 2HW3A 2WONA 3DRPA 2QKKA 4KREA 5HLFA 1XR6A 1RA7A 3T5JA 1CSJA 1RTHA 3UPFA 4CGGA 3U6FA 3HJFA 3N6MA 3Q8SB 4DQQA 3L2WA 4TLRA 3IN5A 3M8QB 3V6KA 4EEYA 2O4IA 2D0CA 4DSLA 3DYAA 4QAGA 3LP2B 1HRHA 4CJKA 3BSNA 5J1EA 4HUFA 2C28A 1D9DA 4ECWA 1QSLA 4EBDA 1LW2A 4OLAA 5KFHA 3DLBA 3LZIA 4CJ4A 3MFIA 1D9FA 1VRTA 2BANA 2EX3A 4RNHA 1KCFA 1CXUA 5KFJA 2F8SA 4FXDA 3KNAA 1N4LA 4O3OA 4TYAA 5KFFA 4TQRA 4ECZA 1WSGA 4FK0A 3SUPA 4J2BA 4CK3A 4PWDB 4PUOB 4ZMMA 1IKVA 4AHVA 4ECRA 1L3VA 3VQPA 2O4GA 1RT2A 5SZTA 2VG7B 2C2DA 1S1VB 5CZ2A 3OYJA 4K8XA 4ED1A 4FJNA 1TVRA 3CJ0A 1T05B 2V4QA 3KLHB 3V4IB 2C2RA 3FSIA 1HPZA 3L2RA 5C42B 1CZBA 1BCOA 2P5GA 4FJ8A 4O44B 3OS1A 4FLUA 3TAQA 4WXWA 1RDRA 1ZBIA 3ZSQA 2B43A 2HHTA 3VQ9A 2JLEA 5KFBA 3AA4A 4CFBA 4EP5A 5DG8A 1TK8A 1XC9A 4KO0B 3QIPA 5C24B 3OJSA 1ZTWA 2XY8A 2IC3A 1D1UA 4CJEA 4IG0B 2WOMB 4KKOB 3AVJA 3EZ5A 4KE5A 1TGOA 3LZJA 1KLMA 4G1QA 4Q43A 4YP3A 1XR5A 1XWLA 4ZHRB 4FZXC 4ECXA 1X1PA 1A5VA 5KGXA 3HVAA 2WONB 3IS9A 1O1WA 4KTWA 3DRPB 4K4ZA 3LP3A 2ATLA 4Z4FA 4W5QA 3FQKA 5E41A 1JL2A 1NNDA 3QYYA 3QERA 2VA3A 5DG9A 5HLFB 4RU9A 3DI6A 2B4JA 1Z25A 1S10A 3LDSA 1RTHB 5KFLA 4DFMA 3PO5A 2FBVA 2VG5A 3TWHA 3MTKA 3EY1A 2XO7A 1OS5A 2X74A 2OYQA 4DL2A 5L9XA 4BDYA 2FBTA 3DYAB 1WSIA 3TAEA 1HNVA 2J6SA 3HP9A 4NLWA 5J1EB 4YFUA 3HHKA 3KK3A 3KHLA 3A2FA 3L2UA 2KW4A 5I3UA 4KB1A 3KOAA 1LW2B 3CM6A 4CJFA 4F2RA 1S1UA 4GW6A 1U48A 1LV5A 1VRTB 2BANB 4DG1A 1N56A 4F4KA 2B6AB 2BDPA 3DOKA 1S5JA 1KFSA 1ZETA 4N76A 3V6HA 4DU4A 3B6OA 3CWJA 3PX6A 1GOAA 4Q44A 2O5DA 4XIUA 4Q8FA 1BL3A 1SH2A 3ZSZA 4M3XA 1IKVB 1NK7A 1VRUA 1K1QA 1RT2B 4DSIA 3P1GA 4IFYA 4Y3CA 5KT6A 4CEOA 4CEBA 4FLVA 4HCCA 3MXMA 1QUVA 1TVRB 4MK8A 1NKBA 3PW7A 2BRLA 1TV6A 3OL9A 3AVAA 3ZSYA 5KT7A 3ULDA 1HPZB 2AQ4A 4F4WA 3CG7A 3CJ5A 3MECA 4I2PA 4RUAA 2IM2A 3NH0A 4CECA 5KTQA 4OGEA 2BQRA 3TQ1A 1NOZA 3MFHA 3PJXA 4J9MA 4C8NA 3OVNA 3LP0A 4HKQA 2D3ZA 4E1NA 4KHUA 5JUMA 4IRCA 1TKTA 1WAFA 1IM4A 2IC3B 1Q9XA 1BIUA 2IGIA 4ED7A 1KLMB 4G1QB 4J2EA 3M8SA 5KG6A 1IKWA 3OYGA 4FK2A 1T03A 4KI4A 1U04A 1WSJA 2IM3A 3ZT3A 1U45A 3MR2A 3O3GA 4FJHA 1S49A 3LWLA 2F96A 3IS9B 2OA8A 4DTNA 3EPGA 3O3HA 1JLAA 2Q3SA 4Z4CA 3MXJA 3HP6A 3SI8A 5FRNA 1HYSA 1VSDA 4WFXA 4HUGA 3DI6B 3QLHA 1NHVA 1QE1A 3H5UA 1IO2A 2P51A 1YTUA 3L2QA 5DG7A 2VG5B 5EDWA 2R8KA 4WZQA 2QE5A 3HT3A 1HNVB 2AGOA 3ZSWA 1GOBA 3M8RA 3KK3B 1N48A 3I5BA 3FQLA 4J9QA 3KD1E 5I3UB 3IRXA 4EBCA 4CF8A 4CK2A 1DTQA 2YNFB 2W7PA 1FXXA 4DSKA 4DG1B 4GMJB 2XC9A 3DOKB 3IG1A 2IMWP 1KFDA 1TKXA 2HAIA 2HHUA 4H8KA 5KT2A 5K14A 4TY8A 5F9NA 2OPRA 4RZRA 5F8MA 1SUQA 2J6UA 5J2MA 1KRPA 4DQIA 3PV8A 3SYZA 3SQ1A 4LQ3A 4FJIA 4QWDA 4ECQA 2W9CA 1VSHA 3MR3A 4ID5A 2RDIA 3QGIA 4U6PA 4IFYB 3VQ8A 2AJQA 3H98A 2IJNA 2OH2A 3UR0A 3S3MA 3E01B 3PW2A 1J9AA 2DFHA 4B3OA 4DS4A 1TV6B 4U7CA 2DY4A 4IOBA 2RF2A 4F4ZA 4R8UA 2KZZA 1VSLA 4C8OA 3MECB 1JLQA 4I2PB 4IQXA 3GYNA 4IH5A 4NCAA 3NAIA 3D5MA 3KHHA 4FBTA 2QK9A 2BRKA 3SUNA 2QKBA 3LP0B 4KV8A 1UAXA 2GIQA 4Q45A 1XHZA 1RBSA 2UVUA 3OYLA 1TKTB 4NYZA 4O55A 1TAQA 1IKWB 3LWMA 1T03B 4E89A 1Y97A 3O4QA 3QEVA 1RTDB 1A5WA 1VSFA 3ITHA 3DMJA 3FRZA 1ASWA 1HNIA 3I5AA 1HYSB 3LAMA 3PW0A 5KRSA 3QLHB 4CGJA 3WNFA 1QE1B 2UVVA 1L5UA 3LALA 4NLUA 5EWFA 5HRPA 4CE9A 3BSAA 3C6UA 2GV9A 4Q0BA 3GIMA 1C1AA 4CGIA 2DFFA 1RT5B 3RR8A 4OL8A 2YNGA 3CDUA 4DF4A 3PR5B 4HTUA 1RT3B 4K4UA 1CLQA 4B9LA 3NF9A 5DLFA 4OKKA 2NUBA 4AHSA 1RTIA 3IRXB 4NLDA 5EU7A 1HYZA 4RW6A 2R2SA 4QWEA 1DTQB 2DPIA 1IKXA 2HHXA 4DEZA 3IG1B 2JC0A 1TKXB 1HMVA 3MF5A 3CYMA 3GV7B 3QETA 5KFAA 4I9LA 3CFRA 4M3ZA 3UIQA 1UA1A 4ZPBA 4TY8B 2I1RA 5F8LA 1YT3A 1S0NA 4GC6A 1SUQB 5J2MB 2UVWA 3RR7A 3HVTA 4NYNA 4CHPA 4RNMA 4F4XA 2W9CB 5KGWA 4DFJA 4FM1A 4ID5B 3ZSVA 4DSEA 5CYQB 4JV0A 3KLIA 3NE6A 4O44A 3S9HA 4CF0A 1JLGA 1BHLA 4M3WA 2KFZA 3KKSA 4B3OB 2HHQA 3CFOA 3PY8A 2GUIA 4BE0A 2RF2B 1ZBUA 3OYAA 3AVCA 2G8HA 4R8UB 1RDBA 1KVCA 1I39A 4JLHA 1JLQB 3VQ4A 3K57A 4M3TA 2XCPA 3RB4A 4IDKA 2IJFA 4E7KA 3M8PA 4IG0A 2IOCA 4IKAA 1HARA 4JS5A 1NJYA 2D0BA 4M41A 4KV8B 5JS2A 4O0JA 3PZPA 3DLHA 4OKJA 2AGPA 5C25A 1U4BA 2W8KA 2R8HA 2E9ZA 3K58A 4ZPDA 4ZP9A 3VQAA 4H4OA 1S1TA 3CJ4A 3E51A 3OYNA 3KHGA 3H59A 4KRFA 1NK0A 3N6LA 1EETA 4CGFA 3NFAA 2FC0A 3ITHB 3DMJB 4ICLA 3RB0A 2YKMA 3SPYA 1IH7A 5HROA 1TL1A 1HNIB 3H4BA 2PYLA 3SV3A 1KHVA 4CGDA 1L3UA 4ECTA 1KHWA 4W5OA 2R8IA 4O0IA 4I7FA 1EX4A 2AX1A 4JV2A 3C6UB 4Q0BB 1QAIA 5FROA 3D0PA 1MMLA 2YKNA 4MFBA 4CK1A 3H4DA 3H5YA 2OPSB 2YNGB 3OLBA 5KG0A 3G6XA 2B6AA 4NLPA 5KG5A 4URQU 4LSNA 2FVSA 3H5SA 1RTIB 4F50A 1TQLA 1TKZA 1NJXA 2IM1A 4CEFA 4FM0A 4RW6B 4E0DA 3OS0A 4DTUA 4YR2A 3T5LA 2QV6A 1LWEA 1LW0A 1IKXB 1S0OA 4WFYA 3VQBA 1BQNA 3AVLA 4J9NA 2IDOA 4Q8EA 4NLYA 2OPQA 4ZVFA 1HMVB 3TAMA 1N5YA 4CJ3A 4FVMA 4NRUA 1F21A 4M3RA 1REVA 2ILYA 4EO6A 1X9SA 3HVTB 1NOYA 3M9NB 3HVRA 4DTSA 3KLFB 3AO2A 4K4XA 4MKAA 4MIAA 2HHSA 3PW5A 5F8HA 3PJWA 4J9LA 4QWCA 4ZTJA 3QEXA 3KLIB 1B92A 2UUTA 5KFOA 3WNHA 1JLGB 4DQRA 2F8TA 1QSYA 4KHMA 1NK4A 2XY7A 3OYFA 3CIZA 3CM5A 4RUCA 5KFZA 4MH8A 4BE2A 1JLEB 2YNIA 3DM2B 4J9SA 4ZVEA 4IDKB 3KK1A 3M8PB 2XI2A 4QPXA 4FZYA 1UWBA 5KFDA 3SQ0A 3OSNA 3VQ5A 1NKCA 1D5AA 4ED0A 2CKWA 4QW8A 2FLPA 2AX0A 5C25B 2EHGA 2WTFA 3AVIA 1QAJA 3ZT4A 4H4OB 3AO3A 1S1TB 2FVRA 3HO1A 4E1MA 4JS4A 4NLQA 3RRHA 1DTTA 4N56A 3RAXA 2BQUA 1EETB 1LAWA 4ICLB 2HNZA 2YKMB 1WLJA 3DLGA 5HROB 1TL1B 4CEAA 3AVBA 4O3PA 3DLEA 1NJZA 3GIJA 2V9WA 3NDKA 1FKPA 4Q5VA 5C5JA 4XPCA 2XI3A 4I7FB 4LH4A 1ASUA 2VG6A 3V9SA 5KFKA 3SJJA 2YKNB 5L1IA 4MFBB 1TL3A 4RW8A 3THVA 4KPYA 2YNFA 3KIOA 3TAPA 2HNDA 3RB3A 4B08A 2D5RA 3HYFA 4LSNB 5CZ1A 4ED2A 4IFVA 2X6SA 1JKHB 1TKZB 3TAFA 1FK9A 1NK5A 3QZ8A 3HKWA 3IAYA 1LWEB 1LW0B 1YTAA 1BQNB 4IRKA 1FKOA 4OJRA 4NLGA 2DTUA 2OPQB 3TAMB 1N5YB 1X9WA 4OGCA 3D45A 1U09A 3QIDA 2UVRA 2PZSA 3QEWA 1J53A 1REVB 3SPZA 1UOCA 5KFSA 4KB7A 3ISND 5FDLA 3AVMA 3ASMA 3E01A 3D28A 2AGQA 3O3FA 2XCAA 4CCHA 3B6PA 1S48A 3RB6A 4LY7A 3KMSA 3GIIA 1ASVA 1XHXA 4DL4A 1GX5A 4XO0A 3K5LA 3SV4A 3TARA 5L1KA 4KHYA 3T19A 1QSSA 1S9FA 1VSMA 4NLXA 4FJ7A 2YNIB 4OPJA 4CJSA 3FDSA 2B5JA 4J9PA 1GOCA 3LPUA 3KK1B 3V6DA 1UWBB 1S1XA 4DF8A 3BSOA 1L3SA 2RKIA 1BIZA 1EXQA 1RTDA 2HWIA 1VK0A 2FLNA 4KBIA 3G0ZA 3DLKA 3QNOA 2WB4A 3L2VA 5I42A 5T7BA 4CGHA 3NGYA 1DTTB 2C2EA 1JXEA 4NCGA 3VA0A 4J2DA 2ETJA 3NH2A 2HNZB 3H2LA 3DLGB 1KLNA 5KT5A 4EYHB 3DLEB 2R8GA 1RT5A 1FKPB 4URSA 3BREA 5KFVA 4ZVGA 3F73A 4FJMA 1KVBA 3HPOA 1RT3A 3Q8PB 2C22A 1C0UA 4E7IA 2VG6B 3Q8RB 4PA1A 5F8JA 5KFTA 2HNYB 3HL8A 1TL3B 4RW8B 2ASJA 4B8CA 4DS5A 5F8NA 3AVFA 5HBMA 3NGZA 2HNDB 1RTJA 3QNNA 1S9GA 1RYSA 1NHUA 5J2PA 4IH7A 4G3IA 4CJVA 4IFVB 4CFDA 1FK9B 4O5BA 3VA3A 4ED8A 4B9MA 2Y1IA 1NJWA 1I3AA 1B9DA 4C8MA 3ZSOA 1FKOB 5EWGA 1S4FA 2VA2A 3L8BA 2ZKUA 2D0AA 2IA6A 2YV0X 4YR0A 2OZMA 1A5XA 1S6QA 3DDKA 4ZPCA 3M9MB 2VWKA 4W5TA 3OS2A 1SV5A 2BR0A 3ZT2A 4BDPA 5KG1A 5CYQA 4DL5A 3KD5E 3AVKA 1BCMA 5FDLB 4YR3A 3AVHA 5KFCA 5T14A 1JLCB 3DRRA 5KFWA 4KTQA 4N41A 3UDLA 4ID1A 2HHVA 3OJUA 1CZ9A 2W7OA 3EYZA 3V1OA 4KHWA 3ZCMA 3EPIA 2R2UA 1JIHA 4W5NA 5DMRA 3T5KA 2ZD1B 1S9EA 3KLGB 4M3YA 1BQMB 2LSNA 4RG8A 3QGGA 2XWYA 4KTZA 4Z4HA 4R0EA 4FS2A 3SZ2A 2B5JB 3NHGA 4OKEA 2A1SA 4NLSA 2Z1IA 4B9SA 3V6DB 1SKSA 1S1XB 5KFIA 2RKIB 4Y2CA 5KFYA 4O3QA 4IG3A 1SH0A 4KFBA 4TYBA 4KAIA 3SFUA 5DGAA 1SL1A 3DLKB 3Q8QB 1D8YA 5I42B 5L1LA 5DK5A 5KFPA 1JLFA 4DL3A 3IGVA 3KKRA 4NCGB 4MQ3A 2Z1GA 5DQHA 4IH6A 4FJKA 4ECVA 2BQ3A 4JRQA 3G6VA 2OPSA 3TVKA 4E7LA 1C0UB 4QWAA 3RMBA 3DOLA 3OY9A 1XI1A 2RDJA 4LH5A 3VQDA 1SKRA 4ECUA 3PHEA 3OYIA 2X6NA 1W9HA 3ZT1A 4ZVHA 5HBMB 2AU0A 1RTJB 4TY9A 1YVFA 1S9GB 4WYLA 5J2PB 3FFIB 3P83D 2XRIA 4F4YA 3AO4A 4ZP7A 3O4NA 3HXMA 4W5RA 1U49A 1SL2A 4CIGA 4Z4IA 3CVKA 4CIFA 3GILA 3JYTB 3CFPA 5KFXA 1S6QB 2D41A 1J5OA 3KLFA 4KSEB 3HSTB 1SV5B 2FVPA 3NBPA 2YNHA 3MR5A 4ELVA 2Z1HA 2IBKA 5KI6A 1ZBLA 4DTXA 1Q8IA 2JEFA 2JEIA 3DRRB 4ECYA 3C94A 1N6QB 4FLWA 2P5OA 2VWJA 2ASLA 4DU1A 2KZMA 3TR8A 1JLEA 4CJPA 3DM2A 4H4MA 4E3SA 1HJRA 4BDZA 5SWMA 4K4YA 2V4RA 2E6LA 2HB5A 1S9EB 4IR1A 3ZSXA 3SFGA 2G8FA 2G8KA 1WSHA 2KQ2A 4I9QA 4DWIA 3GQCA 1KVAA 3QIOA 1LWCA 4LSLA 3KLEA 4CJUA 2R2RA 5DQIA 4FLXA 4CJWA 4CEDA 4MK7A 3RMAA 2GIRA 3KK2A 3NAHA 4EZ9A 3DRSA 3NH1A 1QS4A 5KG3A 3BQ1A 4ZPAA 4WE1A 4IG3B 4F2SA 4KFBB 2R8JA 3GV8B 3VQQA 2J6TA 5HRRA 4AH9A 3MEDA 5JXSA 5DLGA 2FLLA 4DSJA 4QCLA 2PYJA 1JLFB 3K59A 3V9XA 4CJLA 3OHBA 1JXLA 3TABA 3I0RA 5KFNA 4PY5A 3U3GA 3G86A 5KFEA 4BWMA 4NZ0A 4O3NA 3N6NA 4QOZB 4K4TA 4RW7A 1HQEA 1R0AA 4AHUA 3AVGA 1RBUA 4O4GA 4WYWA 1NK8A 3DOLB 3OL8A 4WZMA 1CXQA 1SL0A 2ASDA 3AV9A 2KFNA 3HK2A 1JKHA 5KFMA 4M3UA 4KHQA 4DFPA 2W42A 1BISA 4CHOA 4R5PA 3G6YA 1QQCA 2WRMA 2BE2A 3TANA 3NKYA 3DLRA 3OYHA 3RMCA 1JXBA 3GV5B 4WFZA 3RMDA 3LPTA 3QO9A 3RBDA 4DTMA 4L8RB 3RRGA 3NMAA 3VQ6A 4DTPA 1ZTTA 2FBYA 1J5OB 1EKEA 2E9TA 2X78A 3NGIA 4JV1A 1RBVA 1RAJA 2DPJA 3NBPB 2YNHB 2JEGA 3QZ7A 5CYMA 2W9BA 4I2QA 4J9OA
chains in the Genus database with same CATH superfamily
2HGMA 2ZWOA 1Z26A 1T7PA 2DVIA 4FWQA 2VIHA 4P2XA 1K1SA 2FJDB 4KHNA 4DSFA 5M1NA 1N34F 4MKBA 2QWRA 1R6VA 2OD4A 3MXIA 2VFSA 5F0UA 2E1ZA 4CLSA 3ENBA 2V2VA 4BVPA 4J37A 4DTJA 3IC1A 1LWCB 4C23A 2ZBCA 4MDAA 4UQGA 3FGUA 1Q16B 3V1QA 4LFCF 4YY3J 3M1VA 1LWFA 4CT8A 2ZE2A 2CGJA 2B9EA 1DZ5A 1HNZK 1X5SA 4MJKA 4CYUB 2C3OA 4N5SA 4BQLA 3OTOK 1N54B 1WUUA 1HW8A 4JP8A 3FZ2A 3TEHB 5E3RA 3V9ZA 1VSIA 1LNQA 3AH6A 2Q66A 3C2PA 2R2TA 3HHNB 2AV5A 4BWJA 1HUXA 5ETTA 2KT3A 3VF0B 5CE3A 4CH7A 4F8RA 3OBIA 3MX2A 3AT1B 3FBFA 4KIAA 3P5BP 4LBHA 3VQSA 3BDPA 2W6KA 2HF4A 5HATA 4CBUA 4DV4F 3DAWA 5BREA 3W8PA 3TAGA 4OYMA 1HWUA 1TKDA 4GKJF 3V4MA 3OL7A 1VQYA 1NK6A 1RZMA 3AD7C 3PVXA 3CJSA 2ITMA 3TTCA 3BJYA 4H54A 1C0MA 4FYDA 3PYEA 2B7BB 3AARA 2WK4A 1NM1A 3W5XA 3CMES 2FXUA 2G8WA 1TK5A 2GQQA 4F3OA 3NAEA 2FZGB 1EQMA 3SQ2A 3CC7N 3CE8A 4Y1DA 1V4TA 3BO3A 1OWXA 1CLFA 5CYMB 3U9ZA 2JWLA 3DXKA 4HHHA 3UR3C 1UVJA 2IYIA 1RXOB 2XHCA 1WOOA 4ILHA 2E4LA 4IKFA 1ATNA 1RJJA 1R8CA 2FLOA 4UY8O 3DOMA 3O1BA 2QFJA 2V69A 2H4WB 4DV1J 5F41A 4IJNA 3C15B 2OSRA 1FNOA 1U6BA 1WSEA 2XLJA 4CW7B 3MEEB 1FX4A 3MPVA 1KQFB 3TSPA 3KTQA 3MEGA 2UXBF 3K2PA 2QA4G 2JEJA 3U1LA 2GMJA 2MHNA 4X4UA 4ELTA 2V5HG 4NX9A 5GINA 3IM8A 1NMDA 2WBMA 2L3MA 3T1YJ 4CEEA 3ZT0A 4K2XA 4AD6A 4KYZA 3TUIC 3FBBA 5J2NB 4K4VA 3DRXA 3H6EA 3W64A 1WNEA 2UXDF 1Y7PA 4OI3A 4MIBA 5AQJA 1N5SA 4DV6F 2R42A 5KT4A 2VUGA 1KQGB 1RTZA 3MM9B 1NG9A 4OJHA 1S1WB 3R5AA 1E4GT 5AQHA 1KTQA 3CD6N 2ZHBA 3POTA 4CHZA 2XHBA 4B3MJ 4P6QA 2C2KB 2HLUA 5IC6B 4HHTA 2P9SB 1HW9A 3ENOA 4DTRA 1QVFR 2KTQA 4IUFA 1BY9A 4P72A 1J5EF 4E19A 5EWEA 3LANA 4YY3K 1EKRA 3PTWA 3JYTA 4BRHA 5J1PA 5D0EA 2UUWA 3T69A 1H6KX 3MN6A 1WACA 1DLOB 4CESA 3BGLA 4CHYA 3NF8A 4ZA1A 4PXCA 1VQLS 1W2BR 5AQQA 4CLUA 1ZM4A 3LOUA 1YZ7A 3OYEA 2A3JA 1HWLA 1FRMA 3H5XA 3VEVA 2CWXA 1NAQA 5DETA 1LFWA 1RT7B 2DR5A 1YRUA 1C4CA 3LO3A 4IWVA 1RHQB 4TKTA 3J7ZO 1IWAA 5CZXA 1ZYQA 4WK1A 4G65A 2G8IA 3OQ2A 3QGPA 3H40A 1FTCA 3UQSA 1LXNA 5AXNA 2CQ3A 3BEGB 4HT5A 3I0SB 4KGMA 2VYPA 4DPWA 4LF9F 3O5BA 2P9CA 2ZBIA 2E6MA 2FVCA 1RFQA 4Y1CA 1GEHA 1NEEA 1GNKA 4LF2A 3VWSA 3S3NA 1K9MO 1YHQN 3JSYA 4U95A 5M2PA 1OQ6A 1HBNB 2ILZA 3HPHA 3K5MA 3CCSS 4BC4A 2G13A 3R5CA 3VEZA 4CFCA 1HWIA 4DR2F 2A1RA 4WXOA 3DGVA 3IBCB 4DV1K 3OYMA 3T6JA 3ZEUB 3FEYB 3I6PA 3TZYA 1QZ6A 3OBWA 3VV2B 4ANCA 4FJLA 1LAVA 3RBZA 3V9UA 3TQEA 4NA3A 3Q22A 5KG4A 3BQ0A 3MCSA 4PL7A 1ZAVA 1S3XA 5AQGA 2W2PP 3FMWA 4CERA 3JB9k 3DLLQ 1U6ZA 2MQ8A 4AF1A 1D0EA 3T1YK 4EZ6A 3QBWA 4CJQA 4L72B 2K7JA 4ZVSB 2PY5A 1BG3A 3BSCA 5D3GB 2ZBQA 3NF7A 2QWQA 4RJVA 2OPRB 3RRKA 1Z4UA 4RU2A 3KG1A 3QT7A 1S1VA 3L3VA 1AZSB 3ULEB 4FS1A 2VF3A 4CEQA 4CHNA 3TZZA 2PO4A 3KLVA 3MCNA 3ZETB 4NYPA 2UZAA 1EQ0A 3HI0A 4M5GA 3ID6A 5ITHA 5HMYA 2X51A 3PX0A 2OEMA 1RACB 1IBCB 2OIHA 4AFFA 2R7SA 4BC5A 4B3MK 1EB0A 4OZNA 3K5PA 4KO0A 4EYIB 1VQ6S 2HMIB 4CH0S 5ADZA 2UUCJ 3PX4A 4ZIVA 4KKOA 4RW4B 1N32F 4WQ4A 2ZUGA 1IBMK 3C0BA 3MPUB 4M94A 4Y34A 4CYUA 4A46A 2XY5A 1SH3A 2WONA 2VOOA 3ZLJA 1N36J 1RBLA 1RA7A 3T5JA 6AT1B 3W3SA 3DFEA 3E66A 4PRFA 4HL9A 1WHXA 3S7RA 4W90B 1YX2A 2V34A 4TLRA 3IN5A 3V6KA 2RIJA 4WU2A 3M2UA 2WBNA 1SCJB 2O4IA 4HH0A 4Y6IA 5FLXO 4QAGA 1HRHA 1VBYA 3FGVA 1NBWA 4HUFA 2E1AA 3D0GE 3U1NA 2C28A 1D9DA 4ECWA 2QMUB 4K41A 1FEEA 4CJ4A 3MFIA 4B1YB 2LCWA 1IR0A 3U02A 1VRTA 4LIRA 2GJFA 1NDLA 3WBZA 1CXUA 3N79A 1ZXOA 2DR7A 3O9UA 3M05A 4ZVTB 4O3OA 4TYAA 3UCUP 4EI2A 1T3VA 2A18A 3THXA 4FK0A 2NNWA 2D69A 4CK3A 1SC6A 1SZ2A 1ZC6A 2KG0A 1WWHA 2J9DE 4WKYA 1CG2A 3ETMA 3HSZA 1RHRB 4AHVA 4ECRA 4USMA 4DV3K 5SZTA 2B9YA 4A5AA 3LQVA 2D1CA 1T05B 1UEVA 4CTAB 3CC2N 2AJ4A 3L2RA 3VGTA 1CZBA 4NLBA 1BCOA 3OR2B 4O44B 3OS1A 1JB0C 4WXWA 2E1CA 4KGVB 3ISZA 4EAHD 4I69A 1FWLA 1CS4B 2E1RA 3VQ9A 4DR4F 4DHYA 5KFBA 3TJ9A 3DXMA 1TK8A 2E66A 5CYJA 2F4VJ 1T9TA 2D0PA 1RDUA 4WWSA 2IC3A 1D1UA 4USKA 2N3LA 2WOMB 2NYHA 4KE5A 4QYZJ 1M1KT 1KLMA 4Q43A 4USWA 1SQEA 2AYEA 1SBRA 1Z6RA 2XMKA 2YQ1A 2HAFA 3TYTA 3M6GA 3L4BC 2PFUA 4I6MB 3HSGA 3VAKA 5HLFB 4RU9A 1Z25A 2B4JA 2DXDA 1S10A 4B1XB 2VFUA 3OV7A 1VHFA 1U2VB 2F65A 2UV8A 1DJ0A 1OS5A 2X74A 3N5FA 4DL2A 2GIFA 1IBLJ 5AQOA 4JI0F 3W8GA 1C4AA 2E8AA 1EARA 1RAIB 3HP9A 4U8VA 4NLWA 5J1EB 3DKDA 3HHKA 3KHLA 3A2FA 1RKJA 5I3UA 1CEZA 4KB1A 3NCQA 3CM6A 4K42A 3SMZA 2UUCK 4DR5F 1S5JA 3NP5A 1ZETA 1SJQA 3CCTA 2RU3A 2MHEA 3B6OA 2YXLA 4JEPA 2O5DA 1VQNN 2HZVA 4OPAA 2IDEA 5E0OA 4JD2A 3PIPL 1QVGM 3VTIA 1N36K 1K1QA 1FE0A 3CF5L 3P1GA 1OIAA 2RRAA 3PFOA 1WC0A 5D4PA 5KT6A 1UEKA 4FLVA 3WQTA 4PXEA 2JFDA 1QUVA 2GO9A 1RQ0A 1WUAA 1RU1A 2DEIA 4MK8A 2BRLA 1AT1B 3ZSYA 2PEHA 5KT7A 2P9IB 1HPZB 1DAXA 1RCXB 3VGVA 3CG7A 3VVTA 3CJ5A 1HFEL 4IDHA 1T0TV 4NXMJ 3O1LA 2Q1LA 3TQ1A 2BQRA 3PJXA 3IRWP 2P6TA 4BS2A 4C8NA 2HSTA 4PG8A 2UU9F 3MD3A 4B3RJ 4YOWA 4JKCA 1WAFA 4BRKA 1IM4A 1Q9XA 3MAAB 4LT6A 1BIUA 4X65J 2IGIA 1M5KC 4I67A 3H0PA 4G1QB 1YJ9S 4FK2A 4MTPA 3ZT3A 1U45A 4FF3A 2KN4A 2JRSA 4BGBA 4DTNA 3O3HA 1PYTA 2RUSA 1U6FA 5JVHQ 3SI8A 2ADCA 1HBNA 3SBTA 1VQKN 4OX7A 1VSDA 4WFXA 4HUGA 3UE5A 4B1UB 2QLXA 3BB5A 1TL4A 2DGQA 1S59A 4OO1J 3MM8B 4YEAA 4DR1F 2R7RA 2CAJA 3P8BB 3ZZRA 2R8KA 5AJ3J 2BZ2A 3IBFB 1AUSL 3QRQA 4MO5A 2QE5A 2W40A 1HNVB 4LFAF 1DGKN 3M8RA 3KD1E 2M2BA 2KKHA 2G1DA 3TX0A 4CK2A 2Z2ZA 3ZTSA 4XTTA 3BZQA 2F4VK 2EXUA 4ZVOB 1FXXA 3OVSA 4DG1B 2DNPA 4FNHA 4QYZK 1TKXA 1B70B 2HAIA 4H8KA 3C16B 3KDOA 1QHAA 4TY8A 5F9NA 4ZVUB 2OPRA 2BJ8A 3K8WA 4RZRA 3C14B 1Q86T 2PC6A 1IG8A 1SUQA 1KRPA 4DQIA 5BRDA 3NMRA 1Y5LB 3FCWA 3ULEA 1A6LA 1VSHA 4GKKF 3MR3A 4F3QA 4WQ5A 3BPSP 2IDLA 3VQ8A 2AJQA 2DGOA 3GMGA 2AJFE 5JLHA 2RB7A 1RI7A 3A3OB 4OMFG 1KXPA 1IBLK 5A6PA 2DFHA 1TV6B 2GX8A 1SJ4P 1K8KA 4IOBA 1WHVA 3MURP 3O9QA 1H38A 4R8UA 5GADU 1VSLA 3MECB 4I2PB 4IQXA 1QUPA 3NAIA 2HBZB 3VR1A 4H5TA 4OHZA 4JKGA 4K5SA 4P2MA 3LP0B 4KV8A 1UAXA 2GIQA 4Q45A 1RDWX 2P6SA 5EY4A 2UVUA 2AJ0A 3LPYA 1GXTA 1HKAA 1CULB 2NREA 2CQBA 1TAQA 2DPNA 2RQCA 2BXJA 4OI4A 4PQAA 4E89A 3O4QA 2W4PA 3QMLA 5KOWA 3QEVA 1RTDB 2GMLA 1VSFA 3ITHA 1JJ2R 2LFVA 3I5AA 2F9DA 1HYSB 1SQFA 1T6DA 4BQZA 2CQCA 3ZTOA 3BSAA 3C6UA 1GH8A 3KWGA 4CDIA 1NBEB 3KFWX 2P8IA 3BDEA 1HHSA 4NXMK 4HTUA 1RT3B 2C1EB 4K4UA 1CLQA 2YX7A 2VFVA 3NF9A 3R2DJ 4NLDA 1HYZA 2U1AA 1DTQB 4QWEA 4OZ1A 4B02A 4B3RK 3A5NC 1IKXA 3HI9A 3E9OA 2HHXA 1DARA 4WFAL 2HSEB 4DEZA 3IG1B 4X65K 3P4UB 4CZCA 3QETA 2OFGX 4JI2F 4I9LA 4M3ZA 4IOCQ 2CUYA 1UA1A 1YT3A 2ACYA 1G7CB 5AE1A 1KQSR 4GC6A 1NGBA 3MGJA 3U27A 4DR6F 4ZCIA 3IP0A 3TR5A 4QR2A 5KGWA 2DTJA 4LREA 4FM1A 4ID5B 4DSEA 5H1SV 1U1KA 4QR0A 4JV0A 4O44A 5AE3A 4N8NA 1TUVA 3AJ2A 4K0KJ 1JLGA 4M3WA 5AJ3K 2KFZA 3KKSA 2BJ7A 3IWLA 3R1XA 1HNWF 1ZBUA 2Z56B 4JI1F 1R43A 1ZPVA 3C3LA 1KVCA 2HBKA 4JLHA 4M3TA 4PEOA 2CWKA 2XLIA 1N34J 1MG7A 2XCPA 4IDKA 4E7KA 2VGMA 1WI6A 1VFJA 2ZZTA 2FJEB 3JSRA 1T9YA 3PZPA 4LFCJ 2BW2A 2W8KA 4Y65A 4ZP9A 3SBGA 3WX8A 1S1TA 3VF2A 3QT6A 2MTLA 2E2NA 1WF2A 2GQ2A 3H25A 1K8AT 2YKMA 1IH7A 5F0XA 3H4BA 2BV3A 5DJBA 3SV3A 4CGDA 1G4CA 2E5GA 1L3UA 3QRPA 2OSQA 4W5OA 4C7QA 2NLWA 2OEJA 3OXGA 1V3SA 4L3QA 1VQ7N 1H74A 2QT7A 4K2JA 1QAIA 4S0MA 5FROA 4CK1A 3O80A 4DR7J 2W01A 2LXIA 4UOCA 2N4CA 3I8BA 3OLBA 2FF3B 4DV4J 1GLBG 4URQU 4LSNA 3WEEA 3H5SA 5HJYA 3D67A 3H3OB 3FVYA 2OANA 5AQMA 4FM0A 4DTUA 4YR2A 5K20B 2QV6A 1LWEA 4EK2A 2MKIA 2WTUA 4J9NA 2IDOA 2K3IA 4ZVFA 1HMVB 1N5YA 4FVMA 1IR2A 3GZ7A 4M3RA 1MLAA 3R3TA 4EO6A 4X62J 2Q2RA 1FXDA 2ZBPA 3HVRA 2WW8A 3M3ZA 4B1WB 3KLFB 4K4XA 3MK6A 5LY3A 4NI2B 1NB2A 4BRPA 1KR4A 1XC3A 1U0HB 1HBMA 3NGRA 3NVKA 1TL7B 2BEFA 4A8YA 1NK4A 2XY7A 2PA3A 4UUXA 5IM0A 3H1VX 4UTGA 2VASA 3CJ1A 3VTHA 2YNIA 5HSPA 4YN3B 2QMXA 4BRAA 2O8FA 2XI2A 4QPXA 4I64A 4FZYA 5JICA 4QIWD 3SQ0A 1AFIA 4FF4A 1D5AA 3QBXA 2KVQE 2CKWA 3R7BB 2FLPA 2AX0A 1YQHA 4WTYA 3D1HA 3GIRA 3AVIA 2HFUA 3FLCO 1PILA 3SIPB 1ZS6A 1P8ZA 3HO1A 4E1MA 1S0VA 1DTTA 4N56A 3PDNA 1BE4A 2G1HA 2UXDJ 4TU7A 2XO6A 1LAWA 3SCJE 4ICLB 4YORA 3DLGA 3C6AA 5HROB 4CEAA 3DLEA 2ZDOA 3GBTA 1B7YB 1FKPA 1RAHB 5C5JA 2BH1A 2IJRA 3D54A 4DL0C 3MCAB 4MFBB 3MMAB 5DZ6A 4I4BA 3SCLE 3OTEA 3RB3A 2F8MA 3NGUA 2D5RA 3HYFA 4EUVA 3J7YP 3N0VA 3LH2S 3TAFA 1NK5A 2VBXA 3QZ8A 2J0WA 1J5EJ 3IAYA 4LFCK 4G1IA 1BQNB 2EPIA 2HOEA 1M90T 1Q7YO 4Y0WA 3KG4A 3TAMB 4OGCA 3CJTA 3H45C 4M8LA 3D45A 2PMHA 5FIIA 3SQGB 3PFEA 2BOPA 2UVRA 1REVB 2I9SA 5AR0A 1PGZA 3ISND 1BQXA 1XJWB 2QG9B 3G4SS 3ASMA 5HANA 3D28A 1Y9OA 3W62A 4V19S 4CCHA 4K25A 3SSQA 4F0KA 3B6PA 1B0VA 4LY7A 3GIIA 1ASVA 4DL4A 3DU6A 4A2AA 3BPDA 2RU9A 5FJ4A 1KOOA 3DGPB 2QI2A 1VYAA 3TARA 4DR7K 2XSFA 1S9FA 2CPJA 1JMTA 1KD1O 4DV4K 2HZCA 2PGCA 3JTNA 1F2HA 4OPJA 2UUBJ 4CJSA 2CJKA 5M1FA 1S1XA 1MW7A 1RTDA 3UD3P 4FN5A 1RWVB 2HWIA 3EXYA 1S72N 3UKRB 4HHUA 2JDJA 2FLNA 2XEXA 4BRNA 1M5HA 3DLKA 2CZ9A 3QNOA 4C3MA 5A0YB 5JLFA 5I42A 3NNCA 4X62K 2CH6A 4NCGA 3ILOA 2ETJA 3H2LA 2D4WA 3OFHA 1GMVA 3PEHA 3BREA 2NXJA 4DN0A 4ZVGA 1F9EB 5LL6d 4AL7A 1RT3A 1C0UA 2FPHX 3OPKA 1CJVA 2FJBB 4PHTX 3CC7S 1W2IA 3JQMA 3HL8A 1TL3B 4RW8B 3KWMA 1CC8A 2B3TB 4WP9A 1RTJA 4YB1P 5HQ8A 4BBYA 2F9JA 2DHHA 4IH7A 4RCHA 2XQCA 1NJWA 3BGFA 3KJFB 1FKOB 3L8BA 2ZKUA 2IRUA 4P75A 1RUSA 1VQOS 2D0AA 2IA6A 2YV0X 1FDDA 3DWLA 4YR0A 4V19X 4PKIA 1WTBA 1WBDA 1EWRA 3DDKA 2HS3A 3M9MB 2VBYA 5CD4A 2FHMA 2BR0A 4FNIA 5KG1A 3DXSX 3AVKA 5FDLB 4PPZA 3DC2A 2GO8A 4IO9Q 1JLCB 4DUYJ 1DY3A 5MAOA 1N33F 4ID1A 2HHVA 2O8CB 5KAKA 1X5PA 2HRUA 2W7OA 1S6OA 2V68A 4KHWA 1G3OA 1BC6A 1JIHA 2KHDA 1KQKA 4G1PA 4UY85 3KLGB 1BQMB 8AT1B 4HI1A 4LF7J 2YPZA 2M8DB 4Z4HA 3M30B 1CJUB 1R8AA 2Q79A 2WSCC 1FWPA 5A8RB 2DXEA 3EVMA 2UUAF 4OKEA 4NLSA 1SKSA 1N32J 3QAUA 3VAIA 3W61A 4R79A 5KFYA 3CD0A 1BLUA 4O3QA 2MQPA 4OYWA 4B3TF 5DGAA 2R7VA 3CCQN 1HWKA 3UFCX 3N9UC 4IH6A 2UV8G 2E20A 4JRQA 2FHJA 1YIJN 2A1BA 4QWAA 1NGEA 2YCHA 3F0NA 3EGNA 2RDJA 3PRVA 3NCPA 1VBXA 3VQDA 4ECUA 3PHEA 2CPDA 3WQPA 2X6NA 3B54A 1EX8A 5HBMB 2UUBK 3CCZA 3ZO7A 3IA0A 1S9GB 1W97L 4WYLA 4UUWA 3THYA 3AO4A 1ZM9A 4ZP7A 5SUHA 3X3UA 5IWAJ 5B0AA 2Z57B 2BJ1A 3GSDA 2LECA 4A59A 4U7BA 3HXMA 4DPTA 2ZC3A 5ADXA 3CVKA 3HSCA 2EKYA 3BYPA 5EVZA 8RUCA 1TUUA 2D41A 1J5OA 3KLFA 1NPKA 4NI2A 3W1YC 1UJ4A 2FVPA 1RAFB 2YNHA 3MR5A 4PPDA 2IBKA 5KI6A 2E7WA 1UCNA 1QAXA 1CZAN 3IWXA 3A4TA 4FYXB 4P52A 4DPUA 2DIVA 1RADB 1DBDA 4BRCA 3AD9C 3TTFA 1AYEA 2YWFA 3L09A 1Q18A 5G0RA 3W0LA 2P2CB 2J0XA 1J6ZA 1HJRA 3MEKA 2FSNA 4BDZA 4K4YA 2PN6A 1YHQS 4PG6A 4PXDA 1S9EB 4IR1A 3I56N 2G8KA 1WSHA 1KVAA 3KLEA 4CJUA 2LDIA 2R2RA 4CJWA 3ZZPA 2GIRA 3H46O 2GAGC 2X1GA 3J7Z5 4DCJB 3I87A 2KM8B 1H2TZ 1GXUA 2MLXA 5KG3A 1QS4A 3VZIA 1NCLA 5F1XA 4KFBB 4RBTA 4NYOA 1CJKB 1N8RO 2B8PA 2LYVA 4DJBA 2CNLB 4AH9A 3MEDA 5JXSA 3NGKA 2FLLA 2PYJA 4BRLA 3V9XA 1JXLA 3UDCA 3G86A 2Z8QA 4DUYK 5KFEA 5D4LA 4BWMA 1VK8A 4NXNJ 1C0GA 2CZ4A 2R9LA 1WC1A 4JI0J 4ZDNA 1RBUA 3CD5A 4WYWA 5HK4A 1GMWD 4DV7J 5BR8F 4LFBF 1ZAWA 4YHHF 4R5PA 4LF7K 3H20A 1CBKA 3G6YA 5GAGU 1AUDA 2J0SD 3FC9A 2BE2A 3D7SB 2IY5B 3D0IE 1Y5NB 1URRA 3IR5B 1N32K 2CQDA 3SQGA 2VCPA 3G71N 1B64A 3MMJA 4YDXA 4LF8F 3RMDA 1RHUB 3LPTA 2NXNA 3RBDA 4DTMA 2R7OA 3VQ6A 1U02A 5BN8A 3M6WA 4DV5J 1ZM3A 2N3OA 3U9DA 3CPEA 2KT5A 4K8RA 1GLFO 2K1RA 2W9BA 4I2QA 2QYGA 3LTOA 1GLCG 3NXZA 2D3UA 3VCDA 4BC7A 4BC3A 2YHAA 4Z0UA 1OKJA 1B0PA 1NZ8A 3QEIA 2IVMA 4CF9A 3C6TA 3MWBA 3BF1A 5FPEA 4FWRA 2I6WA 1RDCA 2ZFHA 3BGRA 2E44A 4CEZA 5BR9A 1QQNA 2UU9J 4LSLB 3R9PA 3CCLS 3J81O 3GR1A 2QIFA 5IWAK 1NSPA 1SKWA 3KK2B 4J9UE 5BPLA 5AZIB 5A0YA 3LP1A 3DRSB 2KL8A 4JKBA 3MN7A 4FLYA 1ROFA 3CQ8A 4J9KA 4WE1B 2KB2A 4NLVA 4LRCA 4Z4EA 3BO2A 2Q36A 1JJHA 2V0NA 3W2VB 2V8DA 2U2FA 1H1VA 4H0TB 4OPKA 1IKYA 5KOXA 4DR3J 3I0RB 1T94A 1PCAA 3RSEB 3VQEA 3PR4A 1Y64A 5H9FJ 4DR1J 5IQQA 3GSIA 3CCRN 2GTDA 2RPIA 2QTWA 3BKFA 1X7VA 1UPPA 4RW7B 1HQEB 2XMUA 3D6FB 4LFAJ 2JSXA 2ZH6A 4O4GB 3UWTA 2Q97A 1T9UA 2VB6A 1WSFA 3L6QA 1MMNA 3QNWB 3CIMA 2WAQD 3CPWM 1RDDA 3SQ4A 3AVNA 5KRTA 3SCXA 5D6GA 3KK7A 4HTIA 2GNKA 2XNQA 2QEXN 4CZLA 3K17A 1RU2A 4FZZA 2RILA 3ILJA 4KGXB 2XY6A 3V1RA 1YLXA 3A12A 5THWA 4ITSA 1UAWA 3VAGA 4M5NA 1JLCA 1NGDA 2HS0A 4HEA9 3OFEA 4GKKJ 2O8CA 3VGLA 1S97A 2HVHA 2UP1A 1RT1A 2BM1A 5EX3A 1JL1A 1MDUB 2M3DA 5HP1A 2M70A 3GE1A 1YJNN 4NXNK 3BBBA 2Z2YB 2KU7A 2GVDB 4JI0K 1U8WA 3KLGA 2FVQA 4ZLJA 1BQMA 1P6TA 4DV7K 4M1KA 5LOQA 4LQ9A 4NLOA 5A8RA 1FRKA 3CCEN 1EHWA 3JSMB 4HYKA 1C0TB 1EP4A 3GFXA 4WIQA 2WHOA 4QIFA 2JWNA 4OHVA 3OA9A 4OZ0A 2PAVA 3GL1A 1MU2B 3CQYA 4JRPA 3PW4A 1S6PB 4CJ5A 2VOPA 4Y2MA 1JLBB 2V8HA 1RYRA 1UZDA 3GIKA 4RWWA 4OLOA 1Y4ZB 2YWGA 4DV5K 4BRMA 3ADAC 3RAQA 1XNRJ 1C1BA 3DU5A 2MKJA 3CJ2A 2GBZA 4Z4GA 2H5IB 1RT4B 3L7UA 4J9RA 3R97A 2IS3A 5CY4A 1MROA 1C2PA 1R8BA 1ITGA 5BN9A 4M5KA 2PI5A 2OZSA 3TUPA 4JNEA 5J2QA 3FSXA 3A5OC 4E7JA 1U1MA 3VEOA 2FZCB 4QS7A 4RTFD 3KJVB 3G8TA 3T3FA 3NCIA 1OMSA 3RBEA 4ZP6A 5HAOA 2QA1A 1FJGF 4B9VA 4NCBA 3QB0A 1WNSA 3BS9A 1A7GE 5KFQA 1RISA 2A6AA 3U3YA 3CJ7A 3QGHA 1IUJA 1W7WA 5T7LA 1GMWA 5AFUA 4JV5F 1VK3A 5D8HB 3OYKA 5FPMA 4LBPA 3S1TA 4FBUA 3NRBA 3MUVP 1VS3A 3SEOA 2OPPA 2H3EB 3AD8C 1NU4A 1HBUB 1UETA 2F7VA 3WXMB 4WBFA 3CNQP 4DR3K 3LPEA 1VRUB 5DRKA 4FOEA 1RLDA 3TSQA 2Z1JA 4DR1K 1BI4A 3EL2A 2AP6A 4HUEA 4TQSA 5DM6Q 1HBOB 3W9HA 3OYCA 3BV8A 1HNWJ 4LFAK 3MMBB 4JI1J 1AW0A 1WEXA 4QOTA 4EP4A 4C0OC 2C3PA 2I5JB 4RO0A 3OBYA 2FJVA 2RHKA 5HQLA 2NSBA 5KFGA 2YKPA 1NHKL 3D6HB 4K50A 4OJ3A 2CJQA 2DRBA 2IVPA 1Q9YA 3I9V9 3BGOP 1VQPS 1CJKA 2CJ9A 2IAJB 5HL7L 3IUCA 2EI5A 4EU0A 3AA9A 1U47A 3BF4A 3W65A 2W2QP 2QX0A 4E7HA 1VBKA 2LXUA 3EZOA 3IWNC 3SXLA 1N5TA 2DT9A 2LEBA 5F8GA 2CQIA 4GKKK 1E6YA 3JSBA 3EDRB 1JLAB 3SNNA 1NB7A 3BUZB 3KJQB 4CJRA 4OVLA 4PQUB 3LAKA 3NF6A 4BG8A 2KHCA 3LP2A 4B3SK 3FBCA 3AXKA 2CPEA 1IBKF 1VQ9S 2AJ2A 4ECSA 2AWZA 3M9OB 4OYAA 2CIMA 3I5CA 4OX9F 3I55S 3DDNA 2P9PB 1NO8A 3N28A 4ANDA 3V81B 4GVLA 5F8IA 2O8DB 5HRSA 2BGGA 2HWHA 1FXRA 5AE2A 1TTHB 4YQWA 1LWXA 4M5DA 2MQNA 4PUOA 4BR2A 4QS8A 2E1PA 4W98A 3H08A 1R8PA 1K47A 4BACA 4XPEA 2VG7A 1XNRK 4K7QA 1HQUB 4XAKA 1JCGA 4ALZA 3Q23A 4FJXA 4TSXA 2V4JB 2XMVA 2M5YA 1G99A 4OI2A 1IXKA 3NGDA 3KLHA 2XMJA 2FHOB 2IHR1 1NGCA 5C42A 2VGNA 3VENA 4DCHA 3AA5X 4Q7AA 4CZHA 2Y1JA 1SJRA 4CM2A 1ILYA 4GVBB 3O9SA 4EBEA 4RW9B 1QHTA 1RT6B 5AXLA 3KMQA 2QLWA 5GAHU 1C1CB 2P9LB 3HX9A 3PUFA 5B0DA 2OEKA 1CJTA 4K59A 4DLEA 4FK4A 4IO8A 5JS1A 3CMQA 5F3TA 4ZHRA 2A6MA 4H0OA 2K06A 4LF5J 2QWNA 3TPQA 3O8WA 2E5JA 1P1LA 2DNMA 1VQ5N 2N7YA 4KREA 2CNOB 2ZJRL 3M2RB 1CSJA 3TUZC 3RSEA 2V50A 1RTHA 3V5RA 4AXJA 3UPFA 2DGUA 3TEGA 1I94F 3MM5B 3M8QB 4X4VA 4DSLA 3DYAA 3CCUN 2NRTA 1U1NA 4WIIA 3TSUA 3WUHA 3UKUA 2DGXA 2PFFB 1HNWK 3QICA 5A6WA 4JI1K 4QIVA 1Y0HA 3CIPA 1FVSA 4Z2XA 5FLXY 1D9FA 2BANA 4N7TA 1R89A 2BW7A 4RNHA 4KH5A 3AAWB 2HYIB 4B17A 5HOOA 2X1AA 2ZNZA 1U2CA 3I4PA 3KNAA 1VC5A 2MLZA 5LXRA 4ECZA 1M5PC 3ENHA 4PWDB 3B82A 1T6CA 4ZMMA 1LOUA 3HOSA 2UXCF 4A8OA 4CI6A 1RT2A 3T7ZA 5ETLA 1VQ8N 2VONA 2EW9A 2EFGA 2C2DA 5CZ2A 4K8XA 2V4QA 1PBAA 2J7WA 3V4IB 3RW6A 3FSIA 3CXCR 4YDUA 2BOAA 1GT8A 1C0FA 1FRIA 3EN9A 3TAQA 2KH9A 2B43A 3A1YG 4JI4J 3FNNA 1D9AA 5DG8A 4FDFA 2CH5A 5C24B 1WOSA 1OSCA 2XY8A 3VALA 5EN1A 1WG5A 3AVJA 2RDDA 4YP3A 1IJJA 1H3DA 1WKKA 1TFYA 2DCLA 5KPZA 3ILIA 4ECXA 4Y28C 5KGXA 4FWOA 1SPBP 3DRPB 4KTWA 4Z4FA 4W5QA 4IEEA 2ALYB 5DG9A 3DI6A 3FFKB 3AGRA 1P9YA 3MAHA 4P73A 3F41A 3M8YA 3PO5A 2FBVA 2VG5A 1KBRA 3BZKA 1Q7LB 2XO7A 3THPA 2OYQA 3UDEA 3TZXA 2MQQA 2J6SA 4NMLA 5EGYA 4DUZF 4IOAQ 1RGVA 2KW4A 3A8YA 2MKKA 1LW2B 4DHVA 3HD2A 1YGYA 4ETXA 1QVFM 3JQJA 4RUBA 1SB6A 4LSZB 3DOKA 2CADA 4LF4J 1FFSB 3G25A 1OPZA 3MPDA 1M1GA 1YWXA 2Y8WA 4LF5K 1PC5A 3PX6A 1Q79A 4RX6A 3J80U 1GLAG 4Q44A 3IR6B 4HWIA 2MDAA 1WKLA 1YJTA 3CCMS 1IKVB 1JJCB 3OD2A 1VRUA 2WVEA 4DV0J 2E5IA 3IAM9 3H7HB 3GB0A 3H2VE 2LQ8A 3Q24A 3CJCA 2MZQA 4HCCA 2HBYB 4CZIA 1R8HA 2F7TA 2A6OA 5AQLA 4ID8A 1TVRB 1NKBA 5LXYA 3LGMA 1AROP 3MMCB 2KO1A 1KDNA 4RUAA 1WDTA 3GLJA 2W2NP 2KG1A 1VRQC 4PG5A 3ENAA 5ETVA 4RLEA 2GS8A 3HF5A 3DJCA 1NOZA 4J9MA 3W7BA 2EFQA 1XMQF 4J90A 4ES1A 3G8QA 1YITN 5ETMA 4E1NA 4LMZA 2HK3A 4HT7A 5JUMA 2UUAJ 4IRCA 1TKTA 2QLFB 2AW0A 4FF1A 3M32A 1WC6A 1FESA 3N4QA 2QLBB 4J2EA 1IKWA 3OYGA 5A8WB 3ELHA 4KI4A 2DISA 3THWB 1VOMA 4FJHA 1S49A 3LWLA 2F96A 3IS9B 1YJWN 1KAYA 3EPGA 1JLAA 1YBAA 3MXJA 4PKGA 5AQTA 4H0PA 3OUYB 3QLHA 1QE1A 3G2XA 4RL1A 2P51A 1S5ZA 5E84A 3K89A 2LXFA 1RWPB 3RW7A 2C3UA 3ET6A 1IR1A 2CQ0A 3C19A 3R6LB 4WZQA 3O08A 5AQWA 1Q5VA 4FWKA 5AXMA 2AGOA 3ZSWA 1GOBA 2CXEA 1HNXF 3KK3B 3FQLA 4JI4K 3IRXA 4EBCA 2J8AA 2BJ9A 5BYSA 3A5LC 4JK9A 3AFGA 3BP8A 2XMWA 3B8AX 3TO8A 2BABA 2VPWB 2XC9A 4RPFA 2CPHA 2FTRA 3MD1A 1WBBA 3QWUA 4OZ3A 2HHUA 3GG1A 5KT2A 2ZH9A 4AQYJ 1NXIA 4ISGA 4JKAA 5F8MA 5GAEU 2J6UA 5J2MA 4JI6F 3W2WB 1QVGR 3SYZA 4FJIA 4Y2KA 1E3MA 2W9CA 3UN5A 5LMNJ 1XN9A 4DU8A 4U6PA 4B1ZA 2ZVSA 4C3LA 4IFYB 3ETOA 1Z2LA 2HKEA 3H98A 4BRDA 5TKYA 1S72S 3S3MA 4GVBA 4CJ7A 3MTJA 1T9VA 2AZ3A 2RVJA 4L6V3 9RUBA 2AIRB 2G0IA 2DR6A 4U67Q 1D4XA 4JYAK 2MYFA 2NRWA 2P9LA 3PKYA 4IH5A 3WQUA 1Q81T 3KHHA 4M5MA 3SUNA 3ZX0A 1NZAA 1D09B 2HQDA 3OR1B 3CJKA 4EIAA 2G2OA 2MXYA 4LF4K 1WTFA 1PJ6A 2MGZB 1T03B 2XYPB 1NPRA 1Y97A 4OQJA 1TYQA 1XMOF 1Q7YT 1A5WA 2NRZA 4U8YA 2Y9HA 4DV0K 1HNIA 3FRYA 4DX6A 3PW0A 4ZJOA 2EWSA 2UVVA 3FE1A 3LALA 1T11A 3FJ2A 4D3HA 1VAZA 4Q0BA 2VQFF 3GIMA 1C1AA 3W63A 2RUGA 2ZUAA 3HZ6A 1LCUA 4ZCLA 5AZJA 4ZCKA 5DLFA 4OKKA 3E2EA 1RTIA 1KD1T 4YHHJ 3HFZB 3DCAA 3O1WA 4ZJQA 4QR1A 3MUMP 2HURA 3GV7B 3CW2C 1WORA 3UIQA 4ZPBA 4LF8J 5FPDA 1IJEB 1S0NA 1B99A 4FYWB 4NYNA 4FF2A 4CHPA 2WVCA 2HQ3A 4H0YB 5J1NA 3FZHA 4I0WA 2JX2A 4RBVA 3R7SB 1YRTA 3NE6A 2GGPB 4CF0A 5LMUJ 3DLLL 1LOTB 2GELA 2JLGA 3P96A 4JHDA 3FMBA 4B3OB 3D1OA 3GFYA 1VLYA 3WIVA 2HHQA 3CCQS 2GUIA 3EGZA 2RF2B 1AB8A 2G8HA 1O8BA 4JI7J 1I39A 1JLQB 4DI6A 3QDKA 4OHXA 5LJWA 3V2UC 1LFPA 3PYDA 4EFAC 2N7CA 3RB4A 3PG9A 3M8PA 1ATSA 1E6VA 2CPYA 2E1MC 1MWYA 1YIJS 5JJBA 4A8XA 4O0JA 3DLHA 2ZHOA 1U4BA 2E9ZA 2O8EB 4WTOB 4AQYK 4HVZA 3K58A 4LUBA 3CJ4A 3TWZA 2K8GA 2KRBA 4LF6F 3HJVA 1NK0A 1EETA 4CGFA 3DMJB 5LMNK 1FD2A 2DNOA 2A10A 3VMFB 2VBWA 1I3OB 2C42A 4DQ8A 2PYLA 1ELOA 2CQGA 3LUYA 1SAZA 4ECTA 1KHWA 3WIUA 2HVEA 1IM6A 5EHHA 4I7FA 4ILGB 2AX1A 1GLEG 2Q31A 3D0PA 2YKNA 3H4DA 2DO4A 5ETQA 3H5YA 2XTJP 3HCXA 2DGWA 3ONQA 5IFMA 2YNGB 3G6XA 4FOIA 1KP6A 5KG5A 4MYUA 2FVSA 1YBUA 1TQLA 5CH7B 1NJXA 4RW6B 1BUPA 3OS0A 1LW0A 1V4SA 2X3DA 1S0OA 4WFYA 1J27A 1FRJA 4A8FA 3AVLA 4NLYA 4CLZA 2OPQA 1HNZF 3C7NA 3OTOF 2RD5C 3T41A 4NRUA 3BY5A 3VEXA 1HR0J 3D0HE 1LK7A 3NWRA 4MYTA 1X9SA 4USIA 3HVTB 2VH7A 3X1LB 4MKAA 5IT9O 2HHSA 3G87A 4ISEA 2HFOA 3MMCA 1BO5O 4FPRA 3PJWA 4ZTJA 3QEXA 3KLIB 2Q43A 1B92A 2O01C 2UUTA 2J76E 3R7NB 2VJVA 5LJVA 3MM7B 2KYXA 2VBZA 3TA2A 1DURA 2GAHC 1G6BA 3R3LA 3NS5A 4RUCA 5KFZA 3GPAA 8ATCB 4BE2A 3CMEN 3RVCA 1OY6A 2DH9A 1FD8A 4J9SA 4YHHK 4ZVEA 1NH8A 2RQKA 3K0JA 2XM3A 2FDNA 3VQ5A 5DO2A 1OH7A 2HLTA 2OHDA 5C25B 2WTFA 5DDQC 3R8YA 1XMBA 1FKAF 5JVGL 1QAJA 3PCOB 1Q1KA 4JI8F 4P2SA 3ZT4A 4H4OB 2ZJQQ 4FP9A 4DBQA 2H5JB 4KHPK 1K0VA 3RAXA 2BQUA 2XULA 2ZM6F 1TL1B 3D2EB 2ABYA 3T1HJ 3O9TA 1FNMA 3G71S 1NJZA 3NDKA 2WB1D 4Q5VA 5LMUK 2XI3A 4X64K 1ZZFA 2VG6A 2RS8A 4OYIA 3V9SA 4PYDA 4X4SA 4IXCA 2A3ZA 1X4AA 4JI7K 3THVA 3TAPA 4D3GA 4X4RA 4FXVA 1NLKL 4LR9A 2L41A 5LSOA 4ED2A 3NOCA 4IFVA 2X6SA 1TKZB 4PL8A 1FK9A 2YWHA 3LGNA 3VGSA 4P10A 2G2ZA 4IRKA 1KONA 4NLGA 3PHTA 2JHEA 4C11A 5AQFA 2DNZA 1V6HA 3SK3A 5M1OA 2VV5A 4JV5J 1U09A 3A0IX 5H1SQ 3IKMA 1UL3A 2PT0A 1N8RT 1KNZA 4DUTA 2AGQA 4M7XA 1X5TA 3EM1A 5CQGA 1GX5A 5IQ6A 3G82B 1NNEA 4KHYA 2BTFA 3EWGA 2PMZD 2VPXB 1ZA1B 3OR1A 4FJ7A 4A47A 4ZITA 1V9OA 1R3NA 4R25A 2LKZA 3W5ZA 4YY3F 3LPUA 3KK1B 1SC4B 2O66A 1KC8O 3V6DA 1UWBB 2V94A 2AMCB 2RKIA 1BIZA 1JJ4A 5JMVA 4FYYB 1M5OC 5A8KA 3OTCA 4PZVA 4KBIA 1U24A 5CD4H 1HR0K 5GADI 2CVEA 4CGHA 2DJWA 2MPUA 4CZGA 3VA0A 4J2DA 3O6WA 2DEJA 3P39A 2HNZB 2R3VA 3HSJA 2RHQB 5KT5A 3Q2TC 3FEZA 3SCIE 4URSA 5FPNA 3AQOA 4FJMA 4CBWA 5B09A 3UB5A 2QWOA 2RQMA 5HVGA 4E7IA 1SJFA 4PA1A 5M1KA 1KWMA 4O0NA 5F8JA 5AQUA 5KFTA 3AODA 4B8CA 3EJMA 3MDQA 5F8NA 2XLKA 5JVHL 2HNDB 2AZ1A 7FD1A 4USVA 1MN9A 4W92B 4UF4A 4G3IA 4CJVA 1F5AA 3WXIA 4CFDA 3HFKA 5K8NA 4Y2IA 3WXLA 2QL9B 2NPIA 3PIOQ 4ERDA 1S4FA 2VA2A 2JFKA 5A2QO 1KQSM 3U4LA 4Z94A 5D4OA 4W4MA 2VWKA 4W5TA 4A8QA 1SV5A 2VJUA 5C7PA 3OTBA 5IV4A 3SMPA 1FRHA 4RKUC 4DL5A 5C15A 4YR3A 4KT0C 2B4OA 1ZBTA 4WF9L 3T1HK 5T14A 1U8SA 3DRRA 5LT5A 3CCVS 1WDDA 1J2VA 2M0GB 3OJUA 2VDIA 3V1OA 2ROPA 4C3KA 3EPIA 4DOZA 2FC9A 2J7KA 2IVYA 4W5NA 1Q5YA 4LRDA 2ZD1B 1BUXA 2RMLA 4USUA 5GAEP 4RG8A 3PSFA 3QGGA 4FS2A 2B5JB 2A1SA 4BLGA 5BXIA 1NPPA 4B9SA 2F5GA 2ZOFA 2KYZA 5KFIA 3D1QA 4Y2CA 3VEYA 5ADXH 2YQ0A 5AQVA 3PXGa 1SH0A 2YQ3A 4CLWA 4DCPB 1P9QC 4JV5K 1RWWB 1D8YA 5DK5A 1RCOB 1IV0A 5KFPA 1JLFA 3TTDA 4RBUA 3UW1A 2VZ9A 4MQ3A 1VQ6N 2P9NA 4FJKA 4ECVA 1I94J 2O8BA 2V67A 2BACA 3G6VA 1F9HA 2IYGA 5GMKa 3CCJS 3TVZA 3LDNA 1NUEA 3CSKA 3RMBA 2F9WA 3DOLA 2XSJA 2HBJA 2I0XA 4F02A 1SXLA 5B0BA 2NZCA 4ZVHA 2AU0A 3I82A 1YVFA 2QLJB 1IBMF 5J2PB 1E4FT 4A8KA 3G6ES 3O4NA 3UCGA 3BKTA 3MHYA 1U49A 4CIGA 4YDDB 4CIFA 3GILA 5KFXA 3QSYB 1S6QB 4WQ4C 4Y00A 5MLCQ 3BBCA 1WC5A 2F4FA 4HLBA 1HX1A 4U96A 4Z7YA 3NBPA 4ELVA 2CNNB 1FWKA 4OZJA 2FJAB 4DTXA 1JK9B 4DDFA 3OFFA 1UJ6A 3Q83A 4GNIA 2W2MP 4IOCL 1N6QB 2P5OA 3E8OA 4P9SA 2KZMA 2DNQA 1HI1A 1NDPA 3D6MB 2Y0SD 3ZSXA 3SFGA 2VFTA 4I9QA 3QIOA 1LWCA 3GJTB 5DQIA 1S7HA 2EFNA 4MK7A 4EZ9A 4HTJA 3VEWA 4F04B 3GTYX 4ZPAA 4IG3B 4DV3F 4F2SA 2G0JA 2JNJA 2R8JA 3G9CA 2P9EA 2GHVC 4PABA 5DLGA 1MMDA 1UVMA 5F0WA 5LM7E 4PY5A 1Q53A 4NZ0A 2GA7A 4LC9B 3JAMO 4QOZB 3ZNJ1 4WFBQ 1MA9B 4FWLA 4I68A 5K8MA 4DUZJ 2IVOA 1T3OA 1CXQA 3KJNB 3HK2A 4M3UA 4UQTA 4HACB 5GMDA 3BZCA 1QLNA 3GYGA 1HPMA 2A42A 3MMVA 2GWKA 3HDSA 2H4YB 4XDDA 2QZ8A 3OYHA 2E5HA 3US5A 3GV5B 3GYXB 3NMUA 3NOGA 1NGHA 1VQMS 2OTLS 4NPOA 2YHXA 1WG4A 1EKEA 3VETA 2E9TA 2R7QA 4HI2A 1T02A 1RGIA 5AT1B 3QZ7A 5CYMA 1I94K 3T6BA 5EXWA 2EEYA 1VHXA 3C66A 4AM7A 3ZSRA 4KGZB 5C2DA 3BBFA 1TR0A 3C15A 4A8SA 3SUOA 1GXLA 2V2ZA 5E3AA 4H4MB 2WCXA 3D2WA 5JVGQ 3QINA 3J80O 3MEEA 3MN9A 5FLXU 5GMEA 1S4EA 4IOXA 2G0CA 3T5HA 1RKIA 1HLWA 3OSPA 3CCUS 2FJWA 1UA0A 3BH6B 5ETKA 2E2PA 3MM6B 3CETA 1RILA 2LU2A 3AO1A 3QFWA 5KFRA 1KN6A 2QGFB 3SDEB 2L9WA 1N36F 5J2NA 2IM0A 2CYYA 3HVWA 3BR9A 3J81Y 4CF2A 3L7PA 3RBXA 4FLZA 4AILC 1TUWA 3OTDA 4PWUA 1R0CB 1W0HA 3J7YU 1RABB 2NS1B 3LM9A 3CGIA 4FW2A 4ATNA 4AHCA 3MM9A 2M4MA 2Z2LA 2VODA 1S1WA 4KH1B 1YJ9N 2W6LA 4F0MA 3SCKE 2ZH5A 1R0AB 1VCTA 2DK2A 3WNGA 1RNHA 4ED6A 1NKEA 4J2AA 2P9SA 2FHKA 2E5LJ 4ISFA 2LU1A 4DKWA 1UWAA 4RNOA 2HVIA 4CO0A 3HHLB 4X2BA 5EUHA 1VSJA 3OYBA 3QO9B 1DLOA 1EZZB 1GX6A 4JI6J 2Y3YA 1QD1A 2YHYA 3TJ8A 1B9FA 2NZ4A 4NLTA 2OMOA 3G8SA 3AOBA 1UVIA 2GX9A 3VOVA 4QW9A 3V9WA 3QATA 1T9XA 4NWBA 1RBRA 2CJBA 3TRGA 2R7YA 4WK3A 5FRMA 5D0HA 2ZD1A 3SSRA 3BH7B 1RT7A 5BJRA 1IVZA 3GJQB 4DUZK 3GE9A 2MB0B 1GK8A 5IOLA 3QFUA 1PYOB 4UW2A 3R5GA 3W66A 4FJJA 1U1PA 1QTMA 1EIYB 2DGSA 2GWJA 5CABA 1RP5A 4OLBA 4KHSA 3OLAA 3GJRB 4FSVA 5AFUH 4CLLA 3M1VB 1LWFB 2ZE2B 3IFRA 3I0SA 1A0OB 5TKWA 4C0HA 2FYXA 1BGXT 3P5TL 2ALZA 1AXQA 1XMOJ 1YI2N 1RHMB 1R0BG 3FSYA 4H5WA 5B0FA 1SIZA 2FJXA 1GTHA 1HD1A 1IG9A 5E7OB 3D68A 1WOQA 1IBLF 2YPYA 4BE1A 2HHWA 3CJ3A 3JTPA 4U9RA 4E8UA 4ZTFA 3SQOP 4YOXA 1OPIA 3QWPA 3V6JA 4WQ5C 4QIGA 3ZEUA 4NOHA 3HRGA 3DNCA 4FJ9A 2FUG9 1VQ4S 3CPWR 4DLGA 3H8YA 2DCUB 2FSJA 1S1UB 2DRDA 2DRAA 3SUQA 3K7RA 2HHHJ 3QESA 4WF9Q 3OVAA 3NVMA 1S0MA 2NQPA 1YJ7A 1B0TA 4TU9A 3B78A 5DGBA 1VGYA 2OLWA 5D3GA 1G2EA 2ZGZA 4IBNA 4FWSA 4DMNA 4FCYA 2KT2A 1X4EA 4AL5A 1AZSA 1J54A 1AA1B 1ZOTA 5EX5A 5HI7A 2D7SA 3TUJC 4AL6A 4DMZA 1N6QA 1EWQA 3I33A 2P1JA 1S99A 2ZWPA 3DXKB 3ZETA 1YJWS 4YNQA 5KG2A 4LRFA 4NXMF 5ETNA 4CJTA 3K5NA 3DOMB 3P38A 2BE9B 1TAUA 3LDQA 2EVZA 4CIOA 3L4QA 2HMIA 4CLTA 4B3RF 2POKA 2A2DA 4M42A 5ETPA 4P71A 4C48A 4MLEA 3WT0A 4FJGA 4HCBA 3MEGB 2V2QA 4IO9L 1OQ3A 2JC1A 2ZF5O 2E5LK 4RW4A 3F9KA 2BJDA 4FM2A 1RBTA 2EC2A 2ITGA 1LEOA 2AYMA 1RCHA 2J9EA 4O3SA 4JI6K 4LD0A 4LF6J 3HFVA 1Q82T 2CQ1A 4BRFA 4LJMA 5CHIA 1FO1A 4WJBA 2Z4PA 3F5TA 2MY8A 3R27A 3OL6A 1RDAA 4J5OA 3NWGA 1NWKA 4DTOA 3ATVA 5AJ3F 2MKYA 2XYHB 1NDKA 4K4WA 1H72C 4F0HA 4DU3A 4ETZA 3HM9A 4XDCA 1T8EA 4C98A 1H2UX 4HACA 1NK9A 3JTOA 1GMUA 4P2FA 1MSWD 4NRTA 1YTYA 3POTB 2VKZG 4ZVRB 3MXHP 3CCWA 1IJFB 3MWPA 3P5JA 1T3NA 1DFDA 4FKXA 4RNFA 2Q0UA 1WELA 2QL7B 2CQHA 4M95A 1ZA2B 1ZBFA 3IBWA 4IJAA 4CFAA 1VHIA 2KRRA 2YVSA 1U0SA 3OXLA 4JK7A 5F3ZA 2ZQBA 2G8UA 4OIXA 3RUBL 5GAGI 4YMEA 1OH8A 1L3TA 4EO8A 4DQSA 1T05A 4IRDA 3WHIA 4CTAA 5ETOA 3I8DA 4DV2J 3B4DA 2MSTA 3OR2A 3PM9A 2HVDA 1HYVA 1KS2A 4CZJA 5L1JA 1APSA 2BKOA 1CS4A 3PO4A 1UW9A 3GJSB 2KHOA 4OI1A 4O8UA 5K8OA 3IDHA 4ED3A 4NLCA 1HI0P 3MR6A 2DIUA 1SIWB 2WOMA 2HHHK 1SVDA 4DL6A 3AA3A 4Y2AA 4O4RA 2WVFA 2RH3A 3MI7X 4NYFA 1RBOB 1EQYA 2HW3A 1UMJA 1OYEA 1FJCA 4I6MA 4JI8J 2HPUA 2ZDPA 3FZFA 3VQTA 5IV3A 4ZVQB 3B8HA 3IAS9 4B1VA 5HLFA 1XR6A 1HA1A 3EGWB 2FF6A 4DU7A 2UYTA 2YBVA 3TW0A 2ZM6J 3U6FA 1U2VA 1MWQA 3HJFA 3L2WA 4EEYA 4E1JA 4DX7A 1KAXA 2AP1A 4RWTA 4NASA 2PSZA 1ZPWX 4CQ1A 5J1EA 3KUHA 2A40A 1QSLA 2H54B 2BUPA 1UKUA 4OLAA 5KFHA 3DLBA 2H1YA 3KNGA 3LZIA 5M1QA 2ZKTA 2EX3A 1QJHA 1V5VA 3HHLA 4FXDA 4M7YA 4WCEQ 2XNRA 4PKHA 2E88A 5KFFA 4GKJJ 4ILJA 1PJ7A 1H73A 2YY3A 4LF6K 1CC7A 1L3VA 3VQPA 2O4GA 1WSRA 1WHYA 1S1VB 1TMJA 1MN7A 2ZJPL 2KJWA 4F25A 2FB0A 4UOHA 5I3QA 4R0JA 4NB4A 3BO4A 1JWWA 2MLYA 2C2RA 2P9IA 1HPZA 2R7XA 2P5GA 4FJ8A 2AF6A 1RDRA 3ZSQA 4FKYA 3FCHA 2HHTA 1SQGA 5AXKA 2JLEA 4OZLA 2I7NA 3AA4A 4CFBA 2MZJA 4ZPVR 4KO0B 1XK8A 1XC9A 5ETRA 3OJSA 2ZGYA 3G4SN 1ZTWA 2EFOA 3BF3A 3CERA 1VIXA 3MAAA 2UXBJ 4WFNL 4IG0B 4KKOB 4DX5A 3LZJA 1TGOA 4G1QA 2HWTA 1XWLA 1X3MA 4FZXC 1NGJA 3S41A 1X1PA 4USTA 1A5VA 1RAEB 3KZBA 2H9ZA 2WONB 5LJ5Y 1O1WA 2CRLA 4K4ZA 2D1KA 3LP3A 2ATLA 4LVNP 2FHJD 4PAAA 1D8ZA 1JL2A 3PSIA 1NNDA 3QYYA 3QERA 2VA3A 3Q89A 1UVLA 3CB4A 3UDVA 3LDSA 1KVKA 4DFMA 1JNRB 3MM8A 4IO1A 3MTKA 1KOHA 2ZH7A 4DV2K 4CLFA 2K3KA 4DR7F 4DV6J 3M2UB 2FBTA 2ZZNA 3TAEA 4K0KK 1HNVA 3D7EO 4GV6A 2YI1A 3GWCA 5B0GA 3KOAA 1Q81O 3E1YA 3CMAS 1RE1B 1S1UA 4A5BA 1N34K 1U1OA 1LV5A 1VRTB 4FVCA 4DG1A 1N56A 4F4KA 2ACMA 2B6AB 2BDPA 3OVBA 1KFSA 4N76A 4OYOA 2DH8A 3V6HA 1UJ5A 3C16A 2V51B 2ROEA 2LEAA 3MX5A 3C14A 2RHSB 4NA1A 2O3DA 3CWJA 4JKEA 3THXB 4X62F 4Q8FA 3F56A 2IRXA 4JI8K 4WP3A 4M3XA 3MUTP 1NK7A 2VU5A 2CPIA 2ZM6K 4CEOA 4C4WA 3MXMA 5L8RC 2HHPA 4PG7A 3PW7A 2ZZMA 3M7VA 2E2QA 1TV6A 3AVAA 2F1FA 4C9DA 5U47A 3ULDA 2AQ4A 4F4WA 1VQON 3MECA 4I2PA 2IM2A 3R9LA 5KTQA 1X9JA 2LEPA 1XERA 4OGEA 3IXQA 3UN3A 4ZCMA 3OVNA 3DXMB 2E7VA 2HIYA 2HFNA 3LP0A 2J5AA 4HKQA 2D3ZA 4KC5A 4KHUA 2X7IA 2RE1A 2IC3B 1CULA 3HOTA 4ED7A 1KLMB 4GKJK 2C3MA 2VPYB 1WSJA 3MR2A 3O3GA 2PDAA 5CCMA 4BR9A 2Q3SA 4Z4CA 3HP6A 1YBTA 1U7LA 5FRNA 1HYSA 4EHTA 1NHVA 4LF9J 3H5UA 5IT4A 4K5RA 1YTUA 2GV1A 2DY1A 5EDWA 3VPZA 1F60B 1FHTA 3AOCA 4DR2J 3I5BA 2MZTA 4J9QA 5I3UB 2Y1LB 3Q7CA 4IFEA 2BM0A 2WSFC 3ZZOA 4X66F 1DTQA 1LQ9A 2FD2A 2YNFB 2W7PA 4DSKA 1IBMJ 4GMJB 1Z1ZA 2UXBK 3IG1A 1T95A 1KFDA 3HULA 1BA1A 2HFZA 4IQMA 1EJ7L 2ASOA 1FRLA 3VF6A 4CZMA 2NLXA 4QJVA 3MCOA 1OJ4A 3PV8A 1HHTP 4JD2B 3SQ1A 4LQ3A 4CO4A 2NRRA 4ID5A 2RDIA 3QGIA 2UXDK 3A8JA 1Z05A 2NRVA 2KDOA 3HMJG 4E2FB 5E33A 2J0QD 3UR0A 4DV6K 1J9AA 4CZFA 2DY4A 2VPZB 2I38A 4F4ZA 2JH3A 2XYGB 1O6XA 3GYNA 2KXNB 2FIUA 2UUBF 1UVNA 1OY9A 1BXNA 4FBTA 2QK9A 2MEWA 2QKBA 4A2BA 2DNHA 1DQ8A 1AFJA 3OYLA 4LRAA 2QA2A 4NYZA 4O55A 2FY1A 5DM6L 2G9OA 1J5EK 4C1NK 2QM1A 2FZKB 2ASPA 2WZ1A 4DV3J 3CD6S 3EO3A 1YF5L 3QMQA 3EVOA 1ASWA 3EX7B 4BR7A 2B8QA 5GAHI 4OI6A 4RUHA 5KRSA 2P9GA 3WNFA 5EWFA 5HRPA 2GV9A 2BE7D 4CD3A 5AQSA 2R7TA 2DFFA 1RT5B 3RR8A 2I2YA 3CDUA 4DF4A 4B9LA 1O51A 2IIRA 1T9WA 5EU7A 2QL5B 4X4PA 2R2SA 2DPIA 4CO3A 4M5IA 1S76D 2LQ5A 1TKXB 1HMVA 2XMMA 1KC8T 3PJ9A 5KFAA 3CFRA 2W4DA 4TY8B 1W7AA 5F8LA 2QMWA 3ZZZA 1SUQB 2UVWA 3M1FA 3CJQA 4AM6A 2HGLA 4RNMA 3CULA 5GIPA 4F4XA 4IZ9A 3PEJA 4DUYF 3CC4N 3VGUA 4DFJA 2JWKA 4LF9K 1UPMB 4J91A 1NSQA 3SSSA 3S8SA 5CYQB 3CXCM 3S9HA 1V3ZA 1U0HA 1TL7A 1BHLA 2HIQA 4PWWA 1K8KB 3MCMA 2IBOA 3UD4P 3GFHA 5K9FA 5M1PA 4DR2K 4R8UB 1RDBA 3VQ4A 3K57A 4LF7F 1NDCA 3LDLA 2QN6B 3ZZYA 3VAJA 2DXFA 4IG0A 2IOCA 3C46A 1XEZA 4MKYA