2ZD1A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 159
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2zd1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2zd1A05
2FBVA 4CESA 1NJWA 2GIQA 1F21A 4GC6A 5KFUA 1BQNA 5J1EB 4N41A 2R8KA 4FXDA 4DFMA 4FJLA 4DS5A 2HHUA 4F3TA 5F8MA 4IG3B 1NKBA 4M42A 3OS2A 1BI4A 4E1NA 5L1IA 4J9KA 3LP1B 1RA7A 4I7FB 2JEJA 5KFOA 1CZ9A 2BE2B 3M8QA 1JLEB 1CXQA 1HRHA 1TP7A 1YVFA 1ITGA 3CDWA 3GIMA 1UA0A 3KK1A 3PO5A 3RMAA 4IG0A 1S6QB 3OYNA 1C1CA 1BHLA 2FLNA 1HMVB 1S6PB 4DSEA 3RRGA 1TV6A 1TKXB 3AVFA 4CEFA 5L1KA 2B6AA 3GILA 1TGOA 3L8BA 3M9NB 2WOMB 4FLYA 3O3HA 3OYDA 3K5MA 1G15A 3MFHA 2Z1IA 3HL8A 3IN5A 4F4ZA 1U04A 3VN5A 1L5UA 3MEGA 2IA6A 5I42B 3AVKA 2XCPA 3CM6A 3MXMA 3C94A 5J2MA 2D7SA 4DSKA 4B8AB 4DTJA 3NGYA 1S10A 4CE9A 3I5AA 4HUGA 1RT4B 2AGPA 5HBMA 5FRMA 3SQ0A 4WE1B 1KHVA 3RR8A 1S1VA 1RTHA 3PV8A 3I0RA 3H5UA 2FJWA 2YNGB 3H40A 2YHBA 5HRNA 1B92A 4KFBA 3SI6A 2QXFA 4CGIA 3ASMA 2AWZA 4J2EA 3C6TA 2G8WA 3GQCA 2WRMA 1RTDB 1RDRA 2PYLA 2HHSA 4M3XA 2VG5A 1IKYB 4M3YA 1JLCA 3CVKA 4IRDA 4K8XA 4Q43A 4AHVA 3G10A 4CK3A 4LY7A 2XY6A 4C8OA 4HCCA 4ED7A 1Q9XA 4FJIA 3ZT2A 3EZUA 3KLHA 1BQMB 5F8LA 4CCHA 3QNNA 4DL2A 1TAQA 1HQUB 3DRPB 2PZSA 3QLHB 1S97A 2HB5A 3LP2A 1TK0A 3PX0A 2WTFA 3C95A 1VSMA 3DYAA 2W9BB 3VQ4A 2XO7A 5KFNA 3AO1A 4KI4A 1N4LA 2DTUA 1T94A 1GX5A 4J2BA 2DFHA 4CERA 1QE1B 3HVAA 5J2QB 2LSNA 2ZD1B 4K4UA 3HVTB 2XI3A 2D3ZA 1FKPB 1HNVB 1IO2A 1T03A 4ED2A 1LWEA 3ZT4A 1FKOB 3M8RA 2IAJA 2IOCA 1JIHA 3DOLA 4Y34A 4I9QA 4ECVA 3T1AA 4O3PA 3S9HA 3KLEB 3ZSRA 3H4BA 1LWFB 4DSIA 2QKKA 4NYFA 1NK0A 2CJQA 3OHBA 1U48A 4BACA 1C6VA 2YNIA 4FW1A 2JC1A 4DL3A 3DDKA 5DLGA 3FSIA 1B9DA 3UQSA 2OA8A 1RT3B 2XHBA 2PY5A 3T3FA 2WHOA 2F8EX 4TQRA 4JLHA 4NLRA 1Y97A 3HVWA 4FJ8A 2R7YA 3VQQA 4B08A 4QW8A 4ED0A 1N5YA 3QIPB 1DTTB 3MFIA 1LV5A 2HNZA 2QV6A 1QSYA 3NBPB 4Z4HA 3QGIA 1FK9A 2HW3A 4KB1A 4C8MA 4NZ0A 1XR6A 4DQRA 1KLNA 4B3OA 3ICLA 4EBEA 3PX4A 3LANA 3PUFA 3H59A 3H5XA 1BGXT 3NH0A 1BQNB 3JYTA 2VA3A 4DSJA 4Q0BA 3QO9B 5KFJA 4ECSA 1TK8A 4IRCA 4PY5A 4KHUA 1NHVA 2OZSA 4JV1A 1N6QA 4O4RA 2BDPA 1BIUA 2OPQB 4PQUA 3TAEA 1RTIB 5HRPA 1IH7A 3AV9A 5HRRA 2IM0A 1Q8IA 1O1WA 2ETJA 3CJ3A 1IKWA 1RBVA 3ISND 4B8CA 3LWMA 3KMQA 4EZ9A 3HSTB 4Q8FA 4IG0B 5EDWA 3VQ9A 4ZPBA 5HROB 5KG7A 2FVQA 5KT7A 3P5JA 4MK9A 2B6AB 1U4BA 3RBEA 1JLBA 1SL0A 4CECA 2YKNA 4O3RA 3NCIA 4ZHRA 3MTKA 5DG9A 3V9XA 3SQ4A 2FJXA 1YT3A 1RBUA 3GV5B 5HLFA 4E7IA 5KGXA 3KHLA 1RYRA 3SQ2A 4F3OA 3UPFA 3AA3A 1S48A 2R8GA 4W5RA 2HHWA 4NYZA 4CEOA 5KFMA 4KKOA 4CHZA 3M9MB 4IRKA 5K14A 5J2MB 2B43A 5EWFA 1WSEA 2YV0X 2RDIA 5F8IA 4I9LA 4CK1A 4NLSA 3MR5A 1BCOA 3SV3A 4N47A 5KT5A 4R0EA 2IJNA 4M3RA 2PYJA 1CLQA 3K5OA 3K5LA 3CJ0A 4CF1A 1UWBA 1CZBA 1RNHA 1RTHB 1N48A 4IFVB 3V9WA 4ZVHA 3IRXA 4DL4A 3KLFA 1IKXB 4O3NA 4W5NA 2FBTA 3I5BA 1ZBIA 4RNHA 3SI8A 2O5DA 3OVNA 1MU2A 5CYQA 1C1BB 3DOKA 3KLIA 4IH6A 1RT5B 1SL1A 5T7BA 2UUTA 1A5XA 4N5SA 2FVRA 1S0OA 4R5PB 3AVBA 3SNNA 1VSIA 3MEEA 2WCXA 1WSIA 3CM5A 4ED8A 1HYSA 4F4XA 1LW2A 2J6UA 4CIFA 1EXQA 2V4RA 2G8IA 4Y2AA 1JLQB 3PZPA 1ZTWA 3PW7A 2XRIA 3OSNA 5KFEA 1VSHA 3I8DA 3U6FA 4RUAA 4DTOA 2IGIA 1SL2A 4H4MB 3DYAB 1NOZA 4CFAA 2XGPA 3FFIB 2JC0A 3CO9A 3QESA 1RBRA 3ZSVA 4CHQA 1TL3B 4WFXA 4W5QA 3D28A 2X78A 3LP3A 2FBYA 2R2RA 2FLPA 3OYBA 4M3UA 4IFYB 2BRLA 1VSFA 1QQCA 2QKBA 4G1QB 2BQUA 4NLOA 5DQIA 4DU1A 4RW7A 3EPIA 4CEDA 3NDKA 4DFPA 2XGQA 1I39A 3IG1A 3VQ5A 2ZE2A 4CHPA 3TWHA 4YR3A 3V9ZA 4DTSA 3SQ1A 3S3MA 2WK4A 2XY8A 4O55A 4FZXC 1IKVA 2IMWP 3KK3A 1LWEB 1LAWA 4LD0A 3Q8SB 4LQ9A 3DOLB 3KD1E 4NLUA 1LWCA 4B9MA 4WXOA 5KFTA 3NMAA 4B9TA 2HNYA 4QOZB 3ZT1A 1TVRA 3BQ2A 2BRKA 2RKIB 4FK2A 4B9UA 3NGZA 3ZT0A 3TAMB 4ED3A 4HCBA 3BGRB 3F73A 1JLGB 4NLGA 5C42A 2Y1IA 2KZZA 1REVA 4HHTA 3DLEA 4ID5A 4RZRA 1JLFB 1RT1A 1JX4A 5CZ2A 2AJQA 3S3OA 1N5YB 3ZSZA 1S1XA 5KFCA 4IH5A 1Z26A 4HKQA 4FZZA 2HNZB 1FK9B 4IBNA 4M3ZA 3ZSXA 4JRPA 3VQAA 1UA1A 3CWJA 4RNFA 2G8FA 3PX6A 3KD5E 2OPPB 3FRZA 2JEGA 2ZKUA 3AVLA 4CFDA 2X6SA 3ZSYA 1JXLA 2ILYA 1DLOB 1IG9A 4PWDB 4ZTFA 5CYMB 5KFSA 2AGOA 1HARA 3SV4A 3IS9B 1DTQB 2OPRA 1S1TA 3MECA 1OS5A 4KO0A 1EKEA 2Z1JA 3RB6A 5KTQA 3ISNC 2I5JA 3P83D 5JS2A 4BE1A 1RBSA 3BDPA 1QSSA 5FDLA 1CXUA 3S3NA 2FVPA 4Z4CA 4CGFA 4KV8B 4ELUA 3MXIA 2YKMB 5KFAA 3TAFA 4OKKA 2KW4A 1BCMA 4WYLA 3HYFA 4Z4EA 1RCHA 1KLMB 2F8TA 2YKNB 3NKYA 4ZHRB 4Q5VA 1NNDA 4ZVFA 3HHKA 2GV9A 2E9TA 4CJ4A 3GV8B 3KK2A 4OKJA 3DRSB 4MKAA 4KKOB 5K14B 3NAIA 3MR2A 4O0IA 4NCBA 2V4QA 4W5TA 2ITGA 2C2RA 1RDBA 1KVCA 4WFZA 4HYKA 1KVAA 4LSNA 2ATQA 2BQRA 4EYIB 4E19A 3EY1A 2D3UA 3ZT3A 1RT2B 5KFZA 4C8KA 4JS4A 2DPJA 5EWEA 3ITHA 4DQQA 4FJNA 3IRXB 4OJRA 3DLGA 3QNOA 2HMIB 3EZ5A 5KFIA 4DG1B 5D3GB 3CIZA 4YNQA 4RW6A 1S0NA 1HQEA 4FJKA 1RYSA 3HT3A 1MU2B 3H5YA 2D0CA 3LAKA 1YVUA 3DLBA 2IM2A 3VQ7A 4AHCA 4FJJA 3TQ1A 4HUEA 4TY9A 3VQ8A 2AX1A 5F8NA 3CJ5A 4QAGA 2IC3B 4FYDA 2HWHA 4Q8EA 4NCGB 3LP0A 1KRPA 3ZSWA 4WYWA 3MEEB 1R0AA 4CFBA 4GMJB 4CJEA 5KFRA 4NLVA 4RNMA 3KLGB 5KFHA 1LW2B 1VRTB 2WONB 5KG4A 4Y3CA 4CJUA 3FDSA 2RPIA 4J9NA 1C0UA 4DTXA 2OPSB 3BSCA 3B6PA 2W9CB 3RRHA 1ASVA 4FJGA 4LQ3A 4B9SA 4DSFA 5F8GA 1RT7A 1RT6A 5JUMA 4FLWA 5DLFA 2ILZA 1UAXA 1ASWA 3O4QA 3HM9A 3KHHA 4RW9A 5DQGA 3OY9A 1NJZA 4KRFA 4RW8B 4RW7B 3KNAA 3I0SB 4IKFA 2YNHA 3NAEA 2OZMA 1W0HA 3QEVA 3IG1B 2E9RX 2ZE2B 3O3FA 4DTRA 1NK4A 3JSMA 4ZP6A 3LALA 1SV5A 3KK3B 1K1QA 1VRUB 3D45A 1N56A 2IM3A 4BDYA 4K4WA 3MR6A 1LWCB 1L3UA 1BIZA 3A2FA 4O3QA 4ED1A 1TL1B 5JS1A 1S1UA 4I2PB 4K4ZA 4J9LA 3OS0A 1TKTA 1HNIA 5E41A 2G8HA 5C24B 5I3UB 3U3YA 4KB0A 5KT3A 3E01A 1L3SA 5F8HA 2WB4A 3HPOA 4EBCA 1K6YA 4ID5B 3CFOA 3KJVA 4KHWA 3QIOA 5C25A 3QEWA 1RT1B 4CJRA 1QUVA 4ICLA 1S1XB 4YQWA 1VSLA 1SUQA 3QEIA 4E89A 2HVHA 4OLBA 4DF4A 5DK5A 4KHQA 4IR9A 3HPHA 4ZTJA 4ZPCA 2XC9A 1WSJA 1T8EA 2A1RA 4FM2A 3CDEA 1GX6A 1GOBA 4CJWA 4CIGA 3C6UA 4KAIA 4ECQA 3SCXA 1TK5A 2R8IA 4F4YA 2HVIA 4F8RA 4XPCA 2VG7B 2R2SA 4QCLA 4LH4A 2OPRB 1GOAA 3MECB 3AA2A 4KPYA 1JL2A 4DSLA 4URGA 2HHVA 3CFRA 3G6YA 2C2DA 3KTQA 2D0BA 4IDKA 3SUOA 5FDLB 4FLTA 5J2NA 2IS3A 3BJYA 4AHUA 4BE0A 1A5WA 3OHAA 1JLAB 4MIBA 5KFXA 4JRQA 3DRRA 4ZPDA 4KBIA 3T5HA 2Y1JA 1S9GA 3OYIA 4J2DA 2YNFB 1QSLA 1S1WA 5KFYA 5JXSA 4KHSA 4MK7A 3M9OB 4RW4A 3DLHA 3DMJA 4X2BA 3M8PA 3ZCMA 3NFAA 2EX3A 3T5LA 1QAJA 3QYYA 2ASJA 4IR1A 3CQ8A 1MMLA 2UVRA 1BI4B 3OYMA 3TARA 2VA2A 4ECYA 4BDPA 3NF7A 1D1UA 1HYZA 3SPYA 4LSNB 3M8QB 3V6KA 4O3OA 4OGEA 4E7JA 3ZSOA 4FLZA 3RMCA 3L3UA 2DPIA 4E3SA 3KK1B 1YTUA 4KI6A 4CJ3A 3KKSA 5DGBA 1C1CB 4DMNA 5CY4A 1TV6B 5KFFA 2QK9A 1RAJA 5L1JA 3NF6A 4CEZA 4M3WA 2GUIA 4RW6B 3UDLA 1UOCA 4MQ3A 3OYKA 4KTWA 3RAQA 5KG0A 2DFFA 3MEGB 3WNGA 4H54A 2VWKA 3VQDA 5KFPA 3LP0B 2C28A 1R0AB 3CDUA 4DLEA 1TKDA 1XHZA 5J1EA 4TY8A 2X74A 5HBMB 4Q45A 3CFPA 1VSKA 5KFBA 4NLYA 3K5NA 4FBUA 4IG3A 2B4JA 3RMBA 1S1VB 4NRTA 5SWMA 4IOBA 3I0RB 4Y1CA 3LP1A 4UQGA 4I7FA 2VWJA 1SKRA 4NCAA 2BE2A 1NKCA 1RT6B 1J53A 4KFBB 4NLDA 2I1RA 3C6TB 1I3AA 3QGHA 1U47A 3DI6A 4G3IA 5L9XA 1U09A 5FROA 1HMVA 1S6PA 4CEBA 3L2VA 4IQXA 1YTAA 5KI6A 2VG5B 5KFGA 1X9MA 4DQPA 1JLCB 4TXSA 2WOMA 3JSMB 3PW4A 4M3TA 2HHQA 5EUHA 1CSJA 4WFYA 3PO4A 5DQHA 5KT2A 3TAQA 4I2QA 4PA1A 3KLHB 4J9SA 4TSXA 3LZIA 2FVSA 5I42A 4FJHA 3OJUA 4IH7A 5KFWA 3BREA 3T5KA 3H08A 3LP2B 3AO2A 3F9KA 3LZJA 2C22A 4CEEA 2B5JA 3IGNA 1GOCA 4J9PA 1RT4A 4E0DA 3OS1A 4N76A 4FBTA 4AHSA 3NGIA 3SUPA 4ELTA 3L2RA 3OL7A 4MFBA 4DLGA 4WE1A 4KHMA 2ASDA 4KAZA 4CJFA 3U3GA 3RTVA 3NF8A 4ICLB 3AO5A 3DLRA 2YNGA 3PR5B 1SUQB 3HVRA 1W9HA 3OYLA 1J9AA 4H8KA 1T03B 1NOYA 3DM2A 2IAJB 1X9WA 4KB7A 3AVCA 3LPUA 2OH2A 4HUFA 1LW0A 3PW2A 4DFKA 4B9LA 5KFDA 3TR8A 1IKYA 4EP5A 3VQ6A 2V0NA 1QTMA 3DLKA 4CHOA 4J9OA 4AILC 4FK0A 2E6LA 4CJPA 2YNIB 4KHYA 3KHRA 1X9SA 3NAHA 5L1LA 3GIIA 4B9VA 4FK4A 1BQMA 2F8SA 4CF0A 3OJSA 3Q8RB 1HQUA 3QLHA 3GIKA 2FBXA 2W9BA 5KFLA 3MAQA 2FJVA 4DS4A 4F2RA 3NL0A 5SZTA 2JGUA 1TQLA 4E7KA 4OLAA 4CFCA 2EC0A 4B3OB 1QE1A 3TI0A 4BE2A 4LH5A 3OL8A 1RTJA 5J2QA 2ZD1A 2BR0A 3HVTA 3JYTB 4DU3A 4Q0BB 3V9SA 4RW4B 3HK2A 4CJSA 1HNVA 1N6QB 3CJ2A 1BL3A 4J2AA 2KQ2A 2OYQA 5EU7A 2UVWA 4PQUB 1FKOA 4EYHB 1QAIA 1NJXA 4O3SA 2GC8A 3PR4A 1WAFA 2XCAA 1S4FA 4O44A 1D9DA 3AO3A 4FM1A 1IKWB 3PJXA 4EO6A 4CHYA 4XIUA 1ZYQA 1NKEA 1XWLA 4CF9A 3UR0A 1LWFA 4DEZA 2RF2A 2JEFA 5KFVA 4M45A 1EP4A 2F96A 4ELVA 3AVMA 4ECRA 4CK2A 3QINA 3B6OA 4C8NA 1NHUA 3P1GA 3VQCA 3NE6A 4RNOA 4QW9A 4H4OA 4NLPA 1JLBB 2D0AA 3G6VA 2Z1GA 4OPKA 4W5OA 3RWUA 3QIPA 1DTTA 2R8HA 5HLFB 2ATLA 4ZVEA 4EBDA 1C1AA 4K8ZA 3MF5A 3NBPA 4CJVA 4ZP7A 1HPZA 3OSPA 3PHEA 5KG2A 4YR2A 4ZPAA 3RBDA 3VQSA 1ZBFA 3LPTA 3LWLA 3QETA 2HHXA 1U49A 3QO9A 4TY8B 3L2UA 3OYJA 2J6TA 3OYGA 3K57A 4ZP8A 2R2TA 2OPQA 3THVA 1RTIA 4WZQA 1UWBB 4LSLA 3KLFB 5FRNA 4CF2A 4Y1DA 4ZVGA 4Z4IA 2FC0A 5J2PA 4YP3A 3ZSQA 3K58A 3NF9A 1S9EA 3DI6B 4R8UA 5CYQB 3DOKB 3KLIB 3VQBA 3SUNA 1XR7A 3TVKA 5HROA 4DU4A 4KTZA 3V6DA 2AU0A 4CJLA 1JKHA 2RDJA 3EYZA 2Z1HA 4RNNA 4AHRA 5F9LA 1WNSA 1HYSB 1S0MA 1WN7A 4BWMA 4I2QB 2XY7A 3EPGA 3AVJA 4CGHA 1A5VA 4MK8A 3VQPA 4DF8A 4DTNA 2IBKA 4JV2A 4FW2A 2KTQA 4ZMMA 1HJRA 1L3TA 1S9FA 2GIRA 2BANA 2RN2A 2P5GA 2B5JB 2E4LA 4PUOA 2R8JA 2W8LA 3NH2A 1LAVA 3TANA 3N6MA 4MFBB 4KTQA 1KCFA 2CKWA 4IFVA 3SFGA 2W7PA 4KHRA 1SKWA 2BQ3A 4CJ5A 3HKWA 3KMSA 1IKXA 5KGWA 2VG6A 1ZTTA 3OL9A 4K4YA 1KTQA 1ZBHA 1Q9YA 4JUZA 4J9QA 1IKVB 2Q3SA 3NH1A 4YMEA 1XI1A 4B9NA 3DM2B 1C1BA 3V4IA 1QHTA 3AA4A 3CJ4A 2XI2A 4K4VA 1RT5A 1LW0B 4WZMA 1D9FA 5KG3A 4O0JA 2HNYB 4Z0UA 1K1SA 3WNEA 1TVRB 3I5CA 4R5PA 4L8RB 3DLKB 5KG6A 4TQSA 2W42A 3QGGA 1RA6A 3V9UA 3AA5X 1WSHA 5KG1A 3CYMA 4JV0A 1NK9A 5C42B 1JLQA 1WNEA 1REVB 5DGAA 4E1MA 4FJ7A 3DLEB 3KLVA 2C2EA 3RB0A 1WSFA 4RU9A 2XY5A 1KFDA 3L2QA 3LAMA 4H4MA 4OPJA 3FFIA 4QWBA 3MEDA 3ULDA 1TL3A 1HYVA 3AVAA 4IFYA 2V9WA 4GW6A 3WNHA 4E7HA 3FQKA 4G1QA 4MIAA 4Y2CA 1RTJB 3RR7A 3TABA 5HP1A 1JL1A 1D8YA 1C0TA 1S49A 3IAYA 3QIDA 2BGGA 1S1TB 2ALZA 4CEAA 4KO0B 1IM4A 3O4NA 1EETA 4NLQA 4JS5A 2I5JB 4O44B 1T05A 1D5AA 4DL7A 4O5BA 4F4KA 4K4XA 4EZ6A 3NGDA 4U7CA 2RF2B 2RKIA 1EP4B 3V6HA 3TAMA 2P51A 3GIJA 4DFJA 3V1RA 2HNDA 3BGRA 3OLAA 1Z25A 2XWYA 3HP6A 1JLGA 2IM1A 4N56A 4J9RA 3KHGA 4H4OB 3ALYA 1FXXA 3L3VA 3BSAA 3MR3A 4ID1A 1T3NA 1WLJA 1JLFA 3HJFA 4NLWA 3FQLA 3V1OA 3D5MA 4FVMA 1RILA 3OLBA 1NK5A 5DG7A 3SYZA 1ZBUA 3RAXA 3RB4A 3QERA 4EEYA 1QS4A 3Q8PB 3KK2B 4ED6A 3HPGA 2KFNA 1HPZB 4OVLA 4NLTA 5EWGA 3V1QA 1KFSA 2OPPA 1TKZA 2UVVA 4HTUA 3AVNA 4EO8A 1DLOA 4DTUA 4PWDA 4MKBA 5CYMA 1VSJA 3AO4A 3H4DA 1ASUA 2D41A 4QWAA 2A1SA 3IS9A 1B9FA 1DTQA 2O4GA 4TN2A 3GV7B 3HXMA 2AGQA 3ITHB 3V81A 1SH3A 4CGJA 4LSLB 3DLGB 2HWIA 2W7OA 4DL6A 4DTMA 4CJTA 1J5OA 3SFUA 5J2PB 2E6MA 4CGDA 4ECTA 4OKEA 1HQEB 4K50A 3RMDA 1S9EB 3QEXA 4KV8A 2R2UA 4R8UB 3BQ0A 4ECUA 3KKRA 4CEQA 5F8JA 4YFUA 3OYCA 4MH8A 2YKMA 3NHGA 3KOAA 3V6DB 5DMRA 4O4GA 2J6SA 5F9NA 1JKHB 4ECXA 1VSDA 2G8UA 1KLMA 1T7PA 4J9MA 3PW5A 5C5JA 1C0MA 4KHNA 4FCYA 4DQSA 2FLLA 4F2SA 1JXBA 3IGVA 1RDDA 4WXWA 4IKAA 4FZYA 1WSGA 2W8KA 2UVUA 2EHGA 3VA3A 1C0UB 3DRSA 4NYNA 3RB3A 1L3VA 3PY8A 4KREA 3QEPA 2BANB 1X1PA 3BSOA 4F50A 3G86A 3G6XA 1RT7B 1D0EA 1JLEA 5DG8A 4PUOB 4OGCA 2E9ZA 3BSNA 2G8VA 2DY4A 1I6JA 1RT2A 4FJ5A 4RW9B 3PVXA 1S6QA 3CG7A 3VQEA 4M41A 2YNHB 1TKXA 3MXJA 2HMIA 3K2PA 2VG6B 4DG1A 1KVBA 1NK7A 5D3GA 5KFQA 3QZ7A 4ECZA 3GYNA 3OYFA 1XHXA 4M95A 1Z4UA 4FLXA 5KG5A 2AX0A 1SV5B 2KFZA 4CIEA 2JEIA 3H5SA 2KZMA 3V4IB 1RBTA 1W25A 4FJMA 4NRUA 4QWDA 2P5OA 2IC3A 1KSPA 1JXEA 1S1UB 4QPXA 4NCGA 1NK8A 1TKTB 5KT6A 1HNIB 1RDAA 4DTPA 1TAUA 3V6JA 3E01B 3KLGA 1C2PA 3SJJA 4GVMA 3SPZA 2G8KA 1VRTA 2WONA 3N6LA 3M8SA 1EX4A 3PW0A 2OPSA 1BISA 3KJVB 2ASLA 3K59A 5C25B 2W9CA 4CGGA 4Q44A 1WAJA 5T14A 1VSEA 4F4WA 4U6PA 3MEDB 3T5JA 3E51A 2W9AA 2DFEA 1RTDA 3H2LA 2IJFA 2GBZA 1SH2A 4RW8A 3I0SA 3AVGA 2ZQBA 5KT4A 4FLUA 3LDSA 5HP1B 3H98A 4BDZA 3C6UB 1C0TB 2IDOA 3HO1A 3TAGA 5CZ1A 3TAPA 2X6NA 1NJYA 3BR9A 3L2WA 4GC7A 1ZETA 1XR5A 1VRUA 4C8LA 1U45A 4FS1A 3QZ8A 1EETB 2P1JA 4E7LA 1T05B 3OYAA 4AHTA 4DQIA 4IDKB 5HRSA 3T19A 5J2NB 1TL1A 3DRPA 3SUQA 4DWIA 4I2PA 5KFKA 1XC9A 1NK6A 5C24A 4OL8A 5I3UA 3VA0A 2NUBA 2HNDB 4Z4GA 3DRRB 3Q8QB 4QWCA 4FM0A 3OYHA 3N6NA 4CJQA 3PJWA 1S9GB 4FJXA 1ZBLA 4RUCA 1J54A 3G0ZA 2O4IA 4CJKA 2QE5A 3SZ2A 1S1WB 4K4SA 4URQU 1KHWA 5KRSA 2AQ4A 4YR0A 4TYBA 4KSEB 4URSA 2YHAA 3DMJB 3M8PB 1FKPA 3UIQA 4XPEA 4QWEA 3HP9A 4TYAA 4KE5A 1TKZB 3KLEA 4TLRA 3O3GA 2UUWA 4XO0A 3AVIA 4FLVA 4K4TA 2D5RA 4FS2A 3KIOA 2VG7A 4DL5A 1RDCA 4AH9A 3OL6A 1SH0A 4CHNA 4BWJA 3V81B 4FJ9A 3WNFA 4Z4FA 1RT3A 3D0PA 1J5OB 4EP4A 2JLEA 5KRTA 1SKSA 4NLXA 3AVHA 4HVJA 4ZP9A 4RG8A 1JLAA 1S5JA 1VK0A 4CF8A 2FVCA 3OYEA 4O4GB 2HAIA 3BQ1A 2HHTA 4M94A 2YNFA 4ECWA
chains in the Genus database with same CATH superfamily
1P8GA 4I0WA 2QXLA 3UVJB 1KS2A 3VQTA 3C6AA 2HFOA 3BY5A 4BHQA 4DS5A 2HHUA 5F8MA 5GADI 1HW9A 3CJ8A 1BI4A 3QICA 3OS2A 3LP1B 5FLXO 1U1LA 1S7IA 4C0OC 3R5AA 2JEJA 1MSWD 1CZ9A 1UW4A 2V7YA 3EE3A 2EKNA 2ZGYA 2EC2A 1HNZJ 1YLXA 1DBDA 2O8FA 4JAXA 4IG0A 5LXYA 3P38A 3OYNA 1BHLA 4M63C 4DUZF 4CEFA 5L1KA 2B6AA 4DR2K 2LECA 3M9NB 2NYIA 4FLYA 2DNMA 3K5MA 4ZOSA 4FOIA 1S72N 2BYCA 4F4ZA 1U04A 4YOUA 3MEGA 3OT9A 2JZ5A 4PYDA 4OZ1A 2XMAA 2YKOA 4WK1A 3NGYA 4PKGA 2QIFA 2G2YA 4CZEA 2VQFF 5IT4A 1HBMB 4PABA 4WFNL 1T9YA 1X4EA 4M5DB 1VQSA 3RR8A 3PV8A 3BN7A 3I0RA 3H5UA 1LXJA 4FWKA 2FJWA 1SS6A 4PXCA 3H40A 2YHBA 5HRNA 2UXBK 1KVKA 1B7YB 2AYBA 3SI6A 1LEOA 4LSZB 4BGAA 4YDXA 1H74A 4TLQA 2G8WA 5THWA 3W2WA 4HHJA 2HSEB 1CZAN 1JCFA 3M6UA 5LJ3Y 4DV2F 3FJ2A 4NEZA 4CBUA 3UE2A 4U7UD 5M1KA 4IRDA 1U2CA 4ES2A 4C8OA 3AAQA 2PSZA 4ED7A 5SUHA 3ZT2A 2UUAK 4QU7A 3OVSA 3AXMA 3CJQA 4CH7A 4DL2A 1CS4A 1TAQA 1Q8LA 2PZSA 3QLHB 3VMFB 2LVWA 4OI6A 1BDGA 4BC3A 4KI4A 4JKEA 5AJ3F 3CC7N 1VQNS 1T94A 1PO6A 3ZETA 4J2BA 1QE1B 4YOEA 5AXMA 2GZOA 2LSNA 2ZD1B 4RWXA 4K4UA 2YWEA 4LRFA 2VV5A 3R5BA 3BZCA 3BKUA 2ZDPA 1HNVB 2O1PA 1LWEA 5DDRC 3CD0A 5CD4H 3M8RA 2N3OA 3QAEA 1U1OA 3VV2B 3QRQA 1DEJA 4FWOA 1RWWB 2QL7B 3CERA 3H4BA 2ZWOA 1XEZA 2QKKA 1GQEA 5DM7L 2HRYA 3LGNA 5LL6d 3H8YA 4U96A 1RCOB 2L3MA 4DL3A 3FSIA 1RWXB 4PG8A 3T3FA 2MXYA 4IDHA 1NDLA 1LFWA 3HVWA 1R0CB 4B08A 1PIEA 4QW8A 1N5YA 1F5CA 4HR2A 1TU0B 2P9KA 4ISGA 1K0TA 4DZ6A 4H0YB 3PRBA 1WTBA 4OX6A 4P73A 4KB1A 1KR4A 1XR6A 1FVSA 3PX4A 3LANA 1RGIA 3WZ0A 3JS9A 3PUFA 2PA3A 3H5XA 1BGXT 2BTFA 2W41A 4DSJA 3JYTA 3OBWA 5HJYA 5KFJA 4DR7F 2MLYA 2V2VA 1CJKB 3HD2A 1NHVA 4JV1A 1N6QA 3M32A 2BDPA 1NGEA 3ZX2A 2OPQB 1FFWB 2FSNA 2DT9A 2E29A 1YG0A 3M6WA 1NLKL 2E1YA 2GMJA 1Q8IA 1O1WA 5GAHI 4BR0A 1IKWA 1RBVA 5IT0A 4P52A 2OHDA 3D0HE 3LWMA 2O8FB 1UZHA 3CC2S 1HBNA 4EZ9A 4IG0B 3TA0A 2F9TA 3DRYA 5KT7A 3KXDA 4YN3B 1HWUA 2F4FA 2G0JA 4FN5A 4X62K 4ZVOB 2B6AB 1JLBA 2V6AA 4RX6A 1SL0A 4DQ8A 1GXTA 2YKNA 2V94A 5DG9A 3THXB 4IOAQ 5JICA 4WIIA 1IR1A 3D7SB 3KHLA 3W3DA 2B4UA 2DKOB 4DCJB 3B6BA 4F9OA 3DXKB 2HHWA 1FTCA 1U0HB 4OV1A 1WB9A 4IRKA 1K8AT 2JDJA 4IO9Q 2B43A 5CH7B 2VQEF 5EWFA 4ILHA 1HLWA 2LXIA 3N9UC 1N34K 2BBEA 3OBYA 4R0EA 2MKIA 1TELA 3IBWA 4AXJA 2PYJA 3K5OA 2JFKA 1DURA 4C48A 4IFVB 3V9WA 4ZS6A 1LWXA 4CZCA 3CJ7A 4O3NA 4FPAA 4W5NA 1N34F 4USMA 1NM1A 4RNHA 2RE1A 3IWNC 3OVNA 5AQLA 3W2WB 1MU2A 5CYQA 3KLIA 3MM9A 4LRCA 5AQPA 1HWJA 1SL1A 2BEFA 2AEJA 5T7BA 1A5XA 2FVRA 3W9HA 2Q31A 4LC9B 2P9NA 3C19A 3J8AA 5E26A 4DV7K 3CM5A 1G7CB 4ED8A 1PGZA 1LW2A 3H2VE 3TSUA 2V4RA 1FXRA 5KQDA 2DB1A 3PZPA 5TKWA 3OSNA 1CS4B 3BGLA 2DHSA 3U6FA 3TW0A 4RUAA 2B4VA 2VOOA 4H4MB 2XGPA 4JEPA 4I6WA 3ZSVA 4A2BA 4W5QA 2IHR1 4M3UA 1QQCA 3KKFA 5F0UA 2IFXA 3QT7A 5DQIA 4DU1A 4RW7A 3EPIA 4V19J 1X3MA 2BX6A 2V8DA 1NPPA 1D9AA 3Q0AA 4DFPA 1EQ0A 3IG1A 3VQ5A 2ZE2A 4CHPA 3TWHA 4YR3A 2P9LA 4AF1A 1BA0A 3S3MA 1Z05A 3M2VB 2M4MA 2IMWP 2DNHA 1LWEB 5E5NA 2N82B 2Q36A 4WXOA 5KFTA 2RQKA 3CCVS 2F4VK 3U27A 4B9UA 2H54B 4BRHA 4ED3A 2CPJA 2FZCB 5C42A 4IQMA 1WOOA 1N5VA 1RAIB 1JX4A 2AJQA 3ID8A 3S3OA 4NLCA 1N5YB 2GVZB 4WPAA 5KFCA 4HKQA 2XG8A 4FZZA 1FRJA 2LDYA 3BYPA 1ZH5A 4A61A 1XNRK 3OFGA 2CGJA 1HD0A 4F0MA 4NXMF 3VQAA 4H0XB 6FD1A 1TUUA 1W7AA 4ANCA 3SBMA 1CJUB 2V8GA 3AVLA 3LUYA 3P8BB 1QAYA 1CEZA 4PWDB 3CI5A 5KFSA 2AGOA 4F25A 4H0VB 2IVMA 1RU2A 2QN6B 1QZ6A 3M32B 2OPRA 2WBMA 4NLBA 1T9TA 4CZMA 1RWMB 5KTQA 2NR0A 1AXQA 4CH1A 4FNHA 5FDLA 4WWSA 1CXUA 3FSYA 4CGFA 1HBNB 3R1HA 2LDIA 3MXIA 3CSKA 4A8SA 2WVDA 5E0OA 1BCMA 2LQ9A 4WYLA 1NGAA 4DV5J 2ZH4A 3HYFA 2X1GA 2YKNB 3NKYA 3QB0A 4JI5K 4WP9A 1NNDA 2E9TA 3L4IA 1OPZA 1Q7YT 2J5AA 1N8RO 3IXQA 5E3PA 2GWJA 4P2FA 3B82A 1NBEB 3VF6A 4OKJA 1V5VA 1F2HA 4CI6A 5CR4A 1CG2A 1VBKA 4W5TA 2YI1A 1RDBA 1FD2A 3OUYB 1PYTA 3TNVA 2EK1A 4LSNA 1UETA 2ZHBA 5E7OB 3NNHA 3Q23A 4E19A 4MIWA 4NA2A 3TJ9A 3MMVA 2L08A 5KFZA 3TX8A 3JTPA 2DPJA 4DQQA 3DLGA 3QMLA 2HMIB 2ZVIA 5D3GB 3CIZA 4YNQA 2Z2ZA 5ADXA 4FJKA 1RYSA 4DV7J 4ISFA 1MU2B 3H42A 1OWXA 2D0CA 5ETMA 2CQ3A 2DHGA 1GLBG 4FJJA 3VGVA 4LF6J 5GINA 4Q8EA 2P6SA 3LP0A 1KRPA 1WHVA 2P9NB 1G4CA 1OSCA 5AQRA 2VBZA 3VGLA 2K06A 3ILIA 2DH9A 2FZGB 1LW2B 5HQLA 2WONB 2M8DB 4Y3CA 2G9OA 4JI0J 2DR9A 4OJ1A 2XSFA 3B6PA 1GT8A 2W9CB 3RRHA 3MR7A 1VQYA 1WG4A 1OY9A 5K20B 3JAMO 2H48B 1FNOA 3I6PA 2A5XA 3H46O 1KN6A 2CNNB 2DGUA 2CH5A 2ILZA 4KH5A 1R8BA 4BVPA 3HM9A 2WTUA 2H51B 1Q8BA 3OY9A 3EICA 2UUCF 4RW7B 4X4OA 5EX0A 3A5LC 3W5ZA 2OZMA 3MPWA 1W0HA 3PM9A 3NY0A 3IG1B 2ZE2B 2R9LA 4ZP6A 4X65F 3EX7B 5JVHQ 3UKRA 4DV0K 1VRUB 3VAMA 1N56A 4BDYA 3MR6A 2MKJA 5DZ6A 2KHOA 1BIZA 3ILOA 1UPPA 1Y00A 2ROGA 1DZ5A 4CLUA 4DHVA 5JS1A 4I2PB 1FJGK 2O8DB 5DETA 1L3SA 2W24A 2EFOA 2NSBA 4XEIA 2M9KA 2JLGA 4TU8A 3M4XA 4F4AA 3CFOA 4YOVA 3QAUA 3QIOA 3VCDA 1FJGF 4N8OA 2JVRA 2AP6A 2UV8A 1XUPO 1IM6A 3CQXA 2A41A 2IVNA 2XTJP 4IR9A 3HPHA 3CJRA 4ZTJA 3SBGA 2FLOA 4UOFA 1GX6A 2RS8A 2VPYB 4HH0A 3C6UA 4ILRA 5GAEP 2GGPA 2VG7B 2R2SA 4BG9A 4P72A 2OPRB 4J9VA 3HT0A 4URGA 3EWGA 1KBRA 4CO4A 2HFSA 2HHVA 1J5EK 3CFRA 2C2DA 2D0BA 5FDLB 4FLTA 5J2NA 2K3IA 2IS3A 4WCEL 3MM5B 2Y3YA 2ZWPA 4X4PA 4JI5J 5KFXA 3OTBA 1UP1A 3W2VA 2YQ0A 2YJFA 3U1MA 1S9GA 1HFEL 3Q2SC 3FMWA 4F02A 2M88A 1X3NA 3HDSA 1S1WA 1IR2A 4RW4A 2NXEA 3HI0A 4F3QA 3H6EA 2EX3A 4JI6F 5FPMA 3QYYA 2DEJA 3VAJA 1MMLA 3W0LA 4PXBA 2VA2A 5GMEA 4BDPA 3H45C 3FC9A 3FFKB 4LSNB 2LQ5A 2X1FA 3FK4A 2DPIA 2R7UA 3KK1B 3C14A 4CJ3A 2NRTA 1RQ0A 3M30B 5KFFA 3WQTA 3BKFA 4CZGA 3NF6A 4G65A 4GNIA 2I38A 4YDDB 2CQBA 3UDLA 1TUYA 4MQ3A 4USHA 3KJNB 1WSRA 2HRTA 2DFFA 3M2RB 5A0YB 2DGSA 3HHEA 5I9EB 4ILLA 2NS1B 3LP0B 2C28A 4A8QA 5GIPA 2FGCA 4C6AA 4USJC 2X74A 3O8MA 1I3OB 1EJ7L 3NOGA 1VSKA 4BRFA 5FPNA 1TL5A 2NZTA 3CC4N 2Q1LA 1YIJN 1S1VB 3FEXB 4NRTA 1WKLA 5SWMA 4UQGA 2BOAA 1SKRA 1J53A 4KFBB 1EARA 4CI0B 1FWKA 3RUBL 3C6TB 1I3AA 1SQKA 3DI6A 3ZTPA 5L9XA 2Y9HA 1M5SA 3AY9A 1HMVA 2D3OR 2P9IA 4IQXA 1YTAA 3N4QA 5KI6A 1ZAWA 2VG5B 4DQPA 1JLCB 4M3TA 1FRHA 3CPEA 2KO1A 2XO6A 3PO4A 5DQHA 4B3SF 4DR6K 4I2QA 2AJ4A 3A8KA 2CPXA 3I33A 3VGUA 3LZIA 4GV3A 2HBQB 3CCUS 2J0WA 3T5KA 3WIUA 3LP2B 3AO2A 1U1QA 1BQXA 3NS7B 2C22A 3IGNA 1GOCA 4J9PA 4E0DA 1I94F 4N76A 3NGIA 2VFTA 2Q0UA 1H38A 4OPAA 1GH8A 3L2RA 3GONA 1NU4A 2EFNA 4JI7F 4KAZA 3FBFA 2KLAA 3U3GA 3L0QA 3ADAC 2AMCB 1Q82O 3CXCR 2GV1A 3HVRA 1TUVA 2OP5A 1J9AA 1H2UX 1VQ8S 4HHUA 4DR4K 1T03B 2P6TA 3EN9A 1NOYA 3IBFB 2A2DA 1VRQC 1X9WA 2HS3A 3LQVA 4F0HA 3SAHA 3PYDA 3LPUA 1VCTA 1SCJB 3PW2A 3MCOA 2W2OP 4C9DA 4NZ6A 2MYFA 4A8WA 1OH6A 2E6LA 4CJPA 3VAIA 1X9SA 2PAVA 2GHWA 4FK4A 2O8BA 1YJWS 3CCMS 3KWMA 3GYXB 4FYVB 3AB4B 4B17A 4JI3K 1XMOF 3Q8RB 1UZDA 1RAGB 1HUXA 2ZBIA 2FBXA 1YXQA 1UJ5A 2BW2A 1Q53A 4NXNF 6FDRA 5AFUH 4F2RA 2FHOB 1TQLA 4CFCA 1KC8T 5C10A 4QIEA 5FIIA 2CZVC 2Q3PA 5J2QA 3J7YI 3D2FB 3HVTA 1SJFA 1A6LA 4RW4B 1B70B 1NSKL 5BR9A 3OXGA 2KQ2A 2OYQA 5EU7A 1Q78A 4V1Ak 4U67L 1B4SA 1NJXA 2GC8A 2B7BB 3TZWA 1S4FA 3CUNA 5C7PA 1O5JA 4O44A 1D9DA 2C1EB 4Y00A 3VEYA 4KGMA 1NKEA 4CF9A 3UR0A 4DEZA 1N36J 4OZ3A 3AVMA 4CK2A 2HBRB 2VDIA 2P9PB 1N0UA 4PPZA 3GR1A 5ETSA 1FXLA 3CT9A 4BR9A 4RNOA 4QW9A 4NLPA 5HO4A 3G6VA 3TSQA 4OYAA 4CZLA 3W3SA 3CETA 1UVMA 2BXJA 2LYVA 2HZVA 4NMLA 1FDBA 3FKBA 4ZVEA 2V63A 1C1AA 3R6GB 4ZP7A 3PHEA 5LOQA 1Q1KA 3UW1A 2ZNYA 2LP4A 1FJCA 2HS4A 3QETA 1GMWA 1U49A 1T9UA 2CA9A 4P7VA 3MUMP 2EWHA 3X1LB 2NRZA 3K57A 3OYGA 3DLLQ 3D2WA 4I64A 2R2TA 4K43A 1UWBB 3OBIA 1BWVA 2O66A 2W7AA 3KLFB 5FRNA 1ULRA 1RBOB 5AQTA 5J2PA 4YP3A 3M3ZA 4W4MA 3NF9A 2E66A 4CLYA 1JCEA 3DI6B 4DR6J 2H4WB 5HROA 4KTZA 2O3DA 4ZLJA 3K2YA 2DGWA 3I9ZA 2Z4PA 1F2GA 2HZAA 2XYPB 2GJFA 5GMKa 5F9LA 4P2SA 4YOYA 2H3GX 2ZDOA 1FESA 4AD6A 4I2QB 3UDCA 1A5VA 1FRIA 1NH8A 3OTDA 4JOUA 3JS6A 2IBKA 3C46A 1XMBA 2KVQE 1GLDG 5HANA 4BBYA 5L39A 4DOZA 1TMJA 2QL9B 5BREA 1VFJA 3GYGA 1ZM2A 4B02A 2W8LA 2IRYA 1LAVA 3TJ8A 3KK7A 2AA4A 2YH0A 3BN4A 2MKKA 3EJMA 1MW7A 2YX4A 1VQPS 4KHRA 2QA4N 1H7XA 1TZ0A 4CJ5A 3KMSA 2VG6A 4Y2IA 1KTQA 1ZBHA 4JUZA 3R9PA 2D9OA 2DRAA 5M1NA 2Q3SA 2WBNA 3NH1A 3R8YA 2GMLA 1VBZA 1XI1A 1QHTA 3AA4A 3G25A 3CJ4A 5M1FA 1EB0A 2BE9B 1K1SA 3Q24A 1OVYA 5KG6A 1ILYA 2W42A 3OFEA 2MHEA 3WX8A 4FWPA 3L09A 3SQOP 4DX7A 2VZ9A 1F3FA 3CYMA 2O8BB 5HVHA 4FJ7A 4A4JA 3DLEB 4BR4A 1GTHA 1IBMK 3THTA 3RW7A 3BO4A 3L2QA 3LAMA 4OPJA 3EGVA 1TL3A 1HYVA 2NRXA 1GMVA 2HYIB 5C2CA 4ZKAA 4D3HA 3FQKA 4G1QA 2QJ3A 4Y2CA 2BUNA 1FRLA 5BXIA 1IBMF 2CADA 3TABA 1JL1A 2OIHA 3TQEA 2RD5C 4QIVA 3IAYA 3A8EA 3QIDA 1TMMA 3G4SN 2QMWA 1UVJA 4YY3F 2R7TA 4NLQA 2I5JB 4O44B 1T05A 2GHVC 4O5BA 2PMWA 5LMUK 1DFDA 3NGDA 2YPYA 4QIFA 4U7CA 3R6MA 2RKIA 1B0PA 2ZH1A 3V6HA 1VDHA 3V1RA 2NREA 3BGRA 1Z25A 1JLGA 1OH7A 3S8SA 3G71S 5DDQC 1VQ9S 3ALYA 3Q89A 5GAGP 1NLVA 1IBLJ 3V1OA 1UCNA 2HHHK 4A8XA 2DRBA 3D5MA 1NK5A 3CCWA 2H1YA 1RP5A 2KG1A 4LF5F 3VF2A 1NO8A 3CCJN 3Q8PB 1FDDA 5B0DA 5EWGA 3D6TB 2XSJA 5CD4A 3T9ZA 3L4BC 4HTUA 2MZTA 3AVNA 4X64F 2Y0BB 4Z2XA 2QSWA 5CYMA 2DVIA 2OJ3A 3AO4A 4IOAL 2D41A 4K59A 4QWAA 3HXMA 1B9FA 3GV7B 4QU6A 4ES3A 1FERA 3N28A 4IO1A 5T7LB 3ITHB 2NZ4A 3V81A 1YHQS 3OR2B 2MQ8A 1P1LA 4FYWB 4NASA 1GXLA 4JI1F 4CJTA 1J5OA 4IO9L 3SFUA 3TUZC 2BJ7A 2DNPA 5J2PB 1RAEB 1MA9B 2W4DA 4GKJF 5BYRA 3VHQA 4OKEA 1HQEB 1EAYC 4KV8A 4YFUA 4MLHA 5F8JA 2YKMA 1MNEA 3KOAA 4WP3A 2HSTA 4TU7A 4DCPB 1NSQA 5GAHU 2G8UA 2X7IA 4FO0A 5AQXA 3MM6A 3MOJB 4DV2J 4DQSA 3UN2A 1JXBA 3IGVA 4HT5A 1U24A 5B8HA 3ENAA 2DXEA 1WSGA 3VGMA 2RT3A 3T7ZA 2NQPA 4I56A 2MQNA 3VA3A 3KHYA 1IJFB 1RHRB 2E5JA 3BSOA 3MPDA 4O5FA 2ZH9A 1T6CA 1XNQK 4OHWA 3BSNA 1I6JA 2F1FA 1AYEA 5B0FA 2IRUA 3PVXA 4AE5A 3O3LA 1T02A 3G8QA 3CCLS 4M41A 5AJ3J 1RWUA 3MXJA 2VG6B 3QZ7A 2B56A 3GYNA 4OI1A 1XHXA 4M95A 5LL6Z 1KONA 4ZITA 2LQBA 2AX0A 1XNQF 2KXNB 4CIEA 1KD1O 1CJVA 3A8JA 3VENA 4MO4A 3TTFA 1VC5A 2PT0A 1VK3A 4F3MA 4JKHA 5BR8F 3CCZA 1JXEA 4EAHD 3QBXA 4JV5F 1TAUA 4B3RJ 3CCEN 3K8WA 2UXDF 3TRGA 3N6LA 5KOXA 1SJQA 3CF5Q 1WKJA 1QQMA 1OYDA 2OPSA 3N5FA 1BISA 2M5YA 2ASLA 3HI9A 2MGZB 4C8ZA 5AE2A 1WAJA 4HLBA 2HRUA 3CDBA 4U6PA 4K0KK 5D77A 4A8MP 3NVMA 2W4PA 2W9AA 2RRBA 5K8OA 3OVBA 2DFEA 5AQOA 1RTDA 3D6HB 2PBDA 4UQTA 3PIPQ 2NNWA 3MMCA 4B3TJ 4FLUA 3QWUA 1NGIA 2OSRA 1JXVA 3H98A 5HATA 4BDZA 3FEZA 3HO1A 1PILA 3TAGA 5CZ1A 3NG8A 2X6NA 2V2KA 4GC7A 4DR7J 1IXKA 1H73A 4FS1A 1U2VA 3JSRA 4E7LA 1T05B 3OYAA 4AHTA 1UEKA 4IDKB 3T19A 1Q86O 1TL1A 2QWLA 1XC9A 2H3EB 2HHHJ 4DV6J 5I3UA 4AYBD 1B3TA 3VTHA 4WQ5A 4FM0A 2GWKA 4JYAK 1ZS6A 3PJWA 4EHUA 4ZJQA 1J54A 4EFHA 4CJKA 5CAAA 2YTCA 4QQBA 3G6EN 4RKUC 2J0XA 3ZX0A 4URQU 3W64A 1G99A 3N01A 1Q79A 3TZZA 3MMBA 2ZJPQ 3P4IA 3Q2TC 3K5PA 3RGIA 3OV7A 4QYZJ 2XSJB 2Q66A 3ZNJ1 3KLEA 5FPDA 4TLRA 1IBKK 4XO0A 3BO3A 3A1YG 2O8CB 2CPDA 3BEGB 2VQEJ 4DL5A 1RDCA 1SH0A 4BRIA 4BWJA 4BRKA 1YVNA 3V81B 3TTCA 4WF9Q 1RWNB 3FZKA 2ZWHA 1RT3A 2K1RB 4TNOA 1J5OB 2HBMA 1SKSA 4X66K 4OYIA 2YH1A 1NGGA 1JLAA 1FFGB 4DR3J 4KR0B 4RR5A 2FVCA 2HAIA 3BQ1A 2KU7A 2HHTA 1NDPA 4M94A 3SCLE 5IQ6A 4BVOA 2DITA 3MM6B 2FBVA 3AD9C 4EUVA 2Q6BA 3C15A 4X66F 5KFUA 3DRXA 3NLCA 2R8KA 4FXDA 2N4DA 2RDDA 4OLPA 1T3OA 4IOCQ 1N88A 4JBCA 4IG3B 1NKBA 3G82A 3SMSA 1FW6A 1RA7A 1DGKN 4YDUC 2P5VA 5B09A 3CCQN 3M8QA 4QYRA 3MN7A 4G6VB 3U9ZA 2Q0RA 4BY9C 4ZCLA 2COLA 3M1FA 2ZUAA 1YVFA 1ITGA 1UA0A 2ADBA 4MDBA 4YOTA 2KYZA 2FLNA 4C98A 1TV6A 3GILA 1U0SA 4CIOA 2WOMB 3O3HA 4P74A 5AQMA 3F2KA 4KHPF 2P9UA 4CLFA 1FDNA 3IN5A 1L5UA 2CGKA 3AVKA 4TKTA 4OHYA 5AZIB 3CM6A 1VQ7S 3C94A 5K8NA 4CLZA 1YUWA 1KQKA 1WC1A 4CE9A 3Q83A 3VEZA 1OKJA 1WEZA 3I5AA 1RT4B 5JVHL 5FRMA 2NRHA 1WOSA 2D4WA 2HGLA 4WE1B 1KHVA 8RUCA 1RE1B 1YITN 3WXKA 4YORA 2BJ1A 2BW7A 2BVZA 1LNQA 4CGIA 1F9FA 3CCTA 2DBBA 2G2OA 4J2EA 3Q8VA 2ATCB 1RTDB 4U7BA 1RDRA 3MMCB 4L75A 3C3LA 4HACA 4OZNA 4Q43A 4K8XA 4CK3A 2XY6A 4LY7A 4NO7A 2QWQA 4N8NA 5AQGA 5CHIA 3R5GA 1HI8A 4FJIA 3EZUA 1GLEG 3KLHA 3U7JA 1U2VB 5JLFA 3CMQA 1BQMB 2HK2A 4JYAJ 2VD3A 3SIPB 2F9DA 1NGCA 4NOHA 1FE0A 1HQUB 1TK0A 2WTFA 4MKVA 2XO7A 1ACMB 3AO1A 4P2MA 4JNEA 2FY8A 1GX5A 2DFHA 4CERA 5D0HA 2R7SA 4ID8A 3FVYA 3OTOK 2DCLA 3MMBB 2YWHA 1IBKJ 4CLLA 1OSDA 4UOGA 4H5VA 2IAJA 4ISEA 3UD3P 3NGKA 4ECVA 3I56N 3KLEB 1SC6A 3ET6A 2DYAA 3H1VX 3HHNB 4LIRA 3UO0A 4DSIA 1JK9B 4LRBA 2CJQA 1R8AA 1U48A 3PDNA 1UPMB 3DDKA 2PMZD 1B9DA 3UQSA 3I55N 1RT3B 3C8YA 2WHOA 4F67A 3J7Z5 4FJ8A 3ZZRA 5KQ8A 3QIPB 1DTTB 4LFBK 3O9SA 3UKUB 2QLBB 3NBPB 2W2MP 4CW7B 2MSTA 1G3OA 2OMLA 1FK9A 4LF7J 7FDRA 4C8MA 2HFZA 3I96A 2J9CA 3C15B 2PDAA 3HBTA 3HCXA 1AUDA 3NH0A 2GAHC 3GFHA 4IRCA 4KHUA 2ZH5A 1N52B 8AT1B 4FL9A 2AIRB 4Z7CA 3DCAA 1OH5A 5HRPA 5ITHA 1RHMB 5HRRA 2FGOA 2DJWA 4CO5A 4NZ7A 2VASA 1MG7A 3ISND 4NI2B 3KMQA 5K5MA 1NXIA 4Q8FA 3GMGA 4ZPBA 2OTLN 5CQGA 5KG7A 2FVQA 1SZ2A 1WUUA 3SDEB 3DOMA 1U4BA 2M7SA 1OY8A 4CECA 1VIOA 3OTEA 4ZHRA 2B0GA 1VQOS 3SQ4A 1Y3JA 2FJXA 1YT3A 5HLFA 1RYRA 4NYOA 4X65J 4F3OA 1S48A 4W5RA 3T1YK 3UI3A 3PYEA 5K14A 3RAMA 1VQ6N 3CD7A 1WSEA 4I9LA 2X3DA 2XS5A 4NLSA 4DCOB 3I9V9 5IM0A 2IJNA 2JWLA 3O44A 3PSFA 1HHQA 4M3RA 3JQKA 3K5LA 4UOCA 3MCMA 1GNKA 1CZBA 4ZVHA 4DL4A 1IKXB 4EGLA 2B8PA 1MN9A 3OD2A 2POKA 1VOMA 2AZ1A 3I5BA 4WJBA 4CO1A 2MZJA 3EGZA 5LMNK 3CMAN 3NNAA 4M5IA 1C1BB 4LFCK 1CJTA 3A5NC 2MEWA 2WSEC 3BGOP 1RT5B 5K9FA 2YXLA 3FZHA 3CCRS 3A4TA 4DV1F 1JCGA 1VQMN 1K44A 4PG7A 3ZYYX 4ZPTR 1S0OA 3AVBA 3SNNA 4FF1A 3BV8A 4H03B 1HYSA 5LMNF 4F4XA 1U2FA 5LSOA 4DU8A 1ROFA 5IWAF 1EXQA 4JK7A 1ZTWA 4P7TA 1JJCB 2ASPA 4DTOA 3E9OA 3ENWA 1YJ9N 2BJDA 3CO9A 1OJ4A 4WFXA 4KIAA 3TR5A 2RE2A 2X78A 4I6MA 2ZH8A 2FBYA 2OAUA 4IFYB 1VSFA 2XLKA 1NB2A 3Q8YA 2VOPA 3E8OA 2ZFHA 2VC0A 4CM2A 2BQUA 4IUFA 3NMUA 3R9LA 2UU9F 3DKDA 1WSVA 4EI2A 2M52A 2VWBA 3FSXA 1DJ0A 3PFOA 1IKVA 1WUAA 2V52B 3J7AP 3Q8SB 4PG4A 5MLCV 1X4GA 3KD1E 4NLUA 4JI6J 4B9MA 5F3TA 2CWXA 2DNGA 3NMAA 1X60A 2J7KA 3ZT1A 1TVRA 1RACB 4FK2A 2ACYA 4WKRA 2PC6A 3A8YA 4LFBJ 1Z6RA 2RHSB 1H1VA 1HD1A 4UY85 2Y1IA 5KAKA 4HHTA 4ID5A 4RZRA 3F0NA 3ENBA 1JLFB 4AL7A 3LM9A 1S1XA 4OJHA 4B1UB 1U7LA 1LK7A 1WC0A 4CZIA 4CZFA 1FK9B 3PNIA 2O8EA 2J76E 3ZSXA 4JRPA 4BC9A 3HULA 1RKJA 3CWJA 2G8FA 4BR2A 2OPPB 4CVNE 4U95A 2JEGA 2ZM6F 1FRXA 1DLOB 3JSYA 3CPWR 3VZIA 2QG9B 1HARA 2OEKA 3NS6A 3ZTRA 2WFBA 1NHKL 4GVBA 1S1TA 3MECA 2KN4A 1OS5A 3RB6A 5H1SV 2ZZTA 4OLOA 1ZXOA 1RBSA 1QSSA 3S3NA 2FVPA 2H5JB 2C42A 3M1VA 3CNQP 5C12A 4HTJA 2HBYB 5KFAA 3W9JA 3DLLL 2PA8D 1NMDA 2X51A 3IFRA 4OKKA 3DOMB 5AXNA 2A6MA 5ADXH 4ZHRB 4B1ZA 3POTA 3EE8A 4ZVFA 3HHKA 5A8KA 4CJ4A 2GMHA 3GV8B 3U1LA 2CJ9A 3GTYX 4B3SJ 4MKAA 5K14B 4O0IA 4NCBA 4X4RA 1T9WA 1BUPA 2MDAA 2KI2A 2GW8A 3VGKA 2ATQA 2DTJA 4K2XA 2BQRA 2NRWA 3C66A 4C8KA 1HNXF 3QNWB 4LFCJ 2OUGA 1I94J 3O5BA 4A8KA 4LBPA 4OJRA 5IT9U 2DGVA 3EZ5A 5KFIA 1TFWA 3KUHA 2KFYA 2JJ4D 4JI7J 3LA0A 3R5DA 5FD1A 4HT7A 3I87A 4RW6A 2RS2A 3FBBA 3H0PA 3EGNA 3J7AN 4C97A 3HKZD 4DPWA 3LAKA 1YVUA 1JNZB 3VQ7A 1C0GA 4AHCA 4LF9F 4TY9A 3VQ8A 4Y2MA 2IA0A 3CJ5A 4QAGA 3KG0A 5A8RB 4NCGB 2R7QA 2FY1A 4CFBA 1HNWK 4GMJB 2UV8G 3LM2A 3ZEUA 5D4PA 1E6VB 3JSBA 4AFFA 2NRVA 4USVA 2RPIA 2QEXN 3UN5A 3ZO7A 4DTXA 2EI5A 3BSCA 4DR1J 2FDNA 2XM3A 1ZPVA 2IMOA 2XNQA 2LA6A 4ZIVA 2XLIA 2LCWA 4FZVA 4KH1B 5E84A 1RT7A 5JUMA 2A2CA 4I6MB 4I69A 5DLFA 4FLWA 4EWTA 1FEHA 2ZJQQ 1UAXA 1GAOA 2BJ8A 3GG4A 2BV3A 3BF3A 1K9MO 1FVQA 3RVCA 3KNAA 3I0SB 2YNHA 1H7WA 1X5PA 1LOTB 2E9RX 4XDDA 3CGIA 3FRYA 3JSMA 1I5OB 1GEHA 4QBUA 3LALA 1SV5A 1K1QA 1QVFM 1PSDA 2NUUG 2ZH6A 3DGPA 2HMPA 4JI8K 4Y2KA 3J81Y 4K4WA 2J9DE 4FF2A 4OI0A 3GSIA 5G0RB 1FNXH 4ED1A 2B9XA 3J7ZT 3OS0A 1K73O 1TKTA 4GKKK 2IBOA 3DU6A 4JK8A 5ETOA 3U3YA 4KB0A 3E01A 5BJRA 2WB4A 1HX1A 3HPOA 1ATRA 3GSDA 1ICEB 2QFJA 4ID5B 2HIQA 3KJVA 1RBLA 3JQMA 4ZCMA 3TA1A 4KHWA 5C25A 1OMSA 4RUHA 1NUEA 4PRFA 1S1XB 2CJXB 4LF8K 4KGXB 3KUGA 2J8AA 2FD2A 3QEIA 4A8FA 1EWRA 2P9SA 5M1PA 3MEKA 5D78A 3UCUP 4DF4A 5IFMA 4GMKA 2P2CB 4XTTA 1T8EA 3SK3A 4ILGB 4CJWA 1S4EA 3GR0A 5LY3A 4A8OA 1TK5A 3WBZA 4IJNA 3M5RA 4F8RA 4CZKA 5A6WA 3MECB 3W60A 4DX6A 4DSLA 4N7TA 4DBQA 2WVCA 5GAEI 5IT9O 1WC3A 2JWKA 1HR0F 3O8WA 4JI2K 2V8PA 3BJYA 3IAM9 3VEOA 4HVZA 5J1PA 2Q43A 2D69A 3GFZA 4RL1A 3TJAA 3DRRA 1X7VA 3S01A 4C11B 4KBIA 3T5HA 1AUSL 1YZ6A 2DGQA 3OYIA 4J2DA 2YNFB 2FJAB 2E1RA 4JI2F 1QSLA 5KFYA 5A8KB 1BO5O 3LL3A 2OLWA 3DMJA 2EW9A 3AA9A 3NFAA 4QJVA 2OEJA 3CW2C 5GAHP 2ASJA 4IR1A 3THWB 1VISA 1U8WA 3MMAB 3BYRA 2UVRA 4LRDA 4A5AA 2QWOA 1D1UA 1XIQA 1S5ZA 2C2KB 3SPYA 3ZZYA 4E7JA 1RAAB 3ZSOA 4FLZA 3RMCA 3L3UA 4E3SA 2MZRA 1XQIA 3WEEA 4LR7A 1NJIT 4KI6A 3KKSA 1HHSA 1NRKA 3TZXA 1C1CB 5K8MA 4B3MK 4CTAB 1VQKN 3R7BB 3O80A 1N33J 4RW6B 3NP5A 2XMKA 3RW6A 3GJRB 2GS8A 4ILJA 3NS5A 3DLJA 3WNGA 4H54A 3BGFA 4WFBQ 5AQVA 3VQDA 4UUXA 1C4AA 1SVDA 1VQLS 1S6OA 1BY9A 2X1BA 4DLEA 1MWQA 1YRUA 4RLEA 2W40A 3IAS9 2KJWA 5HBMB 4Q45A 5MLCQ 3BGUA 5KFBA 4AQYK 3K5NA 2RRAA 2GUPA 3RMBA 1QQNA 2MZQA 3FNNA 4WK3A 4JI4K 3Q7CA 4Y1CA 3PG9A 3LP1A 2J9EA 2YQ3A 5IZHA 1RK8A 2I1RA 2KKHA 3QGHA 2BJ3A 1U47A 4OI3A 4Q2LA 4AQYF 3L7UA 3CF5L 2Y1LB 4NMXA 3MAAA 4EIAA 3LDLA 2DGXA 5BRFA 1HNZK 1ZZNA 4EK2A 4TXSA 3PW4A 3JSMB 2HHQA 1KDNA 5EUHA 1CSJA 2RUGA 4HDHA 1NMEB 3UNYA 4PA1A 3EO3A 2XLJA 4UY8T 2FVSA 1FWLA 1WG1A 2X1AA 5KFWA 3BREA 1IBCB 5LM7E 1CULB 1BU6O 1MLAA 4LF8J 4CEEA 2B5JA 2HBLA 2J7UA 1H3DA 2MY7A 3OS1A 4ELTA 4AHSA 2BM0A 4CYUB 1KKHA 1HBMA 2A6OA 5H1SQ 1FO1A 4KHMA 4M5DA 2AJ2A 3D54A 1RTZA 3RTVA 3AO5A 3T1HK 2EFGA 7AT1B 2C2MB 4J91A 4LF4J 3GWCA 3OYLA 3ZX3A 4H8KA 2P9SB 3GG0A 2RHQB 1SC3B 4CWBA 4LF5J 3MMJA 2GO8A 4HUFA 4DFKA 2VIHA 4LMZA 2A40A 3VQ6A 2FC9A 2RU9A 2P9EA 4P10A 4FK0A 1A7GE 4BRPA 4X64J 3D0IE 2YNIB 2ZH7A 1Q7LB 3RBXA 3GIIA 4B9VA 2FSJA 4DR5K 1Q86T 2E5HA 1NBWA 1Q5YA 2F8SA 2F9WA 5I3PA 3VF0B 3HF5A 3OJSA 1NGJA 3QLHA 5IQQA 1SBRA 4WBFA 3P5BP 1OH8A 4JI1J 5D15A 4C1NK 3MAQA 3AAWB 4GKJJ 2CFXA 1X31C 4CNYA 3T6BA 1HHTP 2JGUA 3CD5A 4E7KA 5AXKA 3OFHA 4B3OB 4WF9L 2IRXA 1QE1A 2CG8A 2RH3A 2ZD1A 2G4BA 1E4FT 3FE1A 4Q0BB 3J80U 1QY7A 4CJSA 4GV9A 3BH6B 1HNVA 1BL3A 4G1PA 4J2AA 4PQUB 1Z2ZA 4EYHB 2ZF5O 2UUBF 4P6QA 1BE4A 3F9MA 1KOOA 4OX8A 4EO6A 5C2FA 2RF2A 1XMQJ 3CCRN 2JEFA 2F96A 1N32J 4ECRA 2NZCA 1M5HA 4IOCL 3NVKA 4K8RA 1NHUA 3CE8A 1PJ5A 4PL8A 5EGYA 2D0AA 1T44A 3MXHP 3R3LA 3RWUA 3MN5A 2MJUA 4EBDA 3R2DJ 3E1YA 1M1KO 4RWWA 4CJVA 1MDUB 3BEXA 1URRA 2IJRA 4HI2A 4ZPAA 1YI2S 3JQJA 4JI4J 2MZSA 3VQSA 2FF6A 1QDUB 1ZBFA 5TKYA 3PCOB 3QBCA 5BR8J 4RBTA 3L2UA 4Z37A 4L6V3 1FFSB 2JVOA 1CJKA 2GQ2A 4ZP8A 4JV5J 2OPQA 2U1AA 4GVEA 2UXDJ 4WZQA 1S59A 2L9WA 3DFEA 5CABA 3K9JA 2ERRA 1GMWD 1S12A 4ZVGA 5H9EJ 1DAXA 2BKPA 4P71A 1UW9A 3WDOA 1N54B 3DOKB 1CC7A 4WP8A 5A2QY 2DRDA 3QPIA 4GVLA 4WQ4A 3MAAB 2EPIA 2YY3A 3BBBA 2DH8A 2Z1HA 4RNNA 2VHGA 1WNSA 1GLJO 3THXA 1WN7A 3E9LA 3K0SA 3EPGA 3AAPA 4G9ZA 5DZ7A 3VQPA 4K5SA 3DXKA 2VC1A 1U0HA 4JV2A 2KTQA 4ZMMA 4DR2F 1L3TA 3O2IA 3K89A 2QLWA 2BANA 2P5GA 3FBEA 1X5SA 3T1HJ 2B5JB 2W2PP 3O1LA 4PUOA 2CQDA 3NH2A 3TANA 3N6MA 1WBBA 2F8MA 3UWTA 3IR7B 2CKWA 1RZMA 2ABYA 2HQ3A 4IFVA 2W7PA 2V8HA 3C16A 4ATNA 2ZHAA 5KGWA 2CZ4A 1F9HA 3J80O 4FPBA 5L9NA 5ETNA 2GELA 2BACA 4JKCA 1Q9YA 4QZVB 2AEFA 1PAEX 1KAXA 3GP9A 4MKYA 2VFRA 1VC6A 3MHYA 3V4IA 4ERDA 2MTLA 4JHDB 4QR1A 4DR5J 3ONQA 2HNYB 1UL3A 5J1NA 3WNEA 2H4YB 4CRJA 2UXBF 4TQSA 2IYGA 2YBVA 4FNIA 3V9UA 1HKCA 5KG1A 4OHZA 4DKWA 4KY3A 1WNEA 1RWOB 1REVB 3W8GA 2E2QA 2VPZB 2CUYA 2OGUA 1YF5L 2KDOA 3LH2S 1WSFA 5FLXY 3F5TA 2Z57B 4H4MA 1JJHA 1J2VA 1KOHA 3BUZB 3CPWM 2BM1A 2E5LJ 2UUAF 4A62A 1U6FA 2LMIA 3BBFA 1K47A 4GW6A 3WNHA 3KFWX 4ZVPB 3TZYA 5D4OA 4FKYA 1RKIA 2GJIA 1D8YA 3AH6A 1C0TA 1S49A 3M2VA 5BYSA 3CJAA 4KQZA 1YQHA 2YHYA 4CEAA 4KO0B 2D1KA 2GQCA 1JNRB 2CNLB 1YRXA 1D5AA 1FF2A 4PKHA 4AT1B 1WI6A 4F4KA 3S7RA 2EFPA 1V5IB 2RF2B 1VQ5N 3C7NB 3O1BA 3GIJA 2HNDA 4BC2A 3OLAA 3IBCB 3HP6A 1NDKA 2DNOA 2IM1A 3KHGA 3CCSS 2GNKA 3EZOA 1T3NA 2HGNA 4XH1A 4LFAK 2GVZA 2XMWA 3GFXA 4FVMA 2V7ZA 5HI7A 1EWQA 1ZBUA 3I82A 3M8ZA 3E3XA 4Z7YA 3KK2B 4KHPJ 1SQFA 2E1ZA 1KFSA 3UD4P 2HLTA 4C4WA 4BGBA 1CJUA 5EXWA 3W5XA 5E3AA 4PWDA 3NGSA 4NA3A 1W2BR 1F3VA 2O4GA 4TN2A 4FDFA 4AM7A 4WU2A 4J90A 4CGJA 4NX9A 2R4FA 5GAGU 3ILLA 1R7IA 2HVEA 3QEXA 3THYB 2R2UA 3BQ0A 3OYCA 3QBWA 1KTVA 5DMRA 4ETZA 4O4GA 2DIVA 3N4PA 3AOBA 4J9MA 4KHNA 1UMJA 3ZFVA 1K8AO 2FLLA 1RDDA 4WXWA 4IKAA 4FZYA 2BJ9A 1KAZA 2EHGA 3I31A 1C0UB 4LREA 4DV5K 2Y8YA 4NYNA 4X62F 4XH4A 3PY8A 3IMQJ 3QEPA 2BANB 1X1PA 4GO7X 4M63A 5B0BA 2YKQA 4F50A 1HBUB 3OUYA 3G86A 4ES1A 1D0EA 4PUOB 2G8VA 2DY4A 1KP6A 5ELZA 3WXMB 4RW9B 4DV4J 1TFYA 2H5IB 3C16B 4QPTA 2HMIA 3K2PA 1RDUA 5LT5A 5D3GA 5KFQA 1SAZA 3OYFA 1UWAA 2B8QA 2KFZA 3ZNUA 4EU0A 2JEIA 3B8HA 3V4IB 1EO1A 1W25A 2RILA 4FJMA 1UFKA 5MAOA 2P5OA 1S1UB 2N7YA 1ZM9A 2EBGA 1NK8A 1UVNA 5KT6A 1HNIB 1RDAA 4Y0WA 4DTPA 4V19S 3SPZA 2G8KA 2KJVA 3SAGA 2WONA 3D1OA 4R0JA 1YJNS 1DY3A 4LF6K 1PJ6A 2F65A 4BRQA 3CJCA 3ZC4A 4H4KC 2W9CA 1VC0A 3CMEN 4QIWD 3G8SA 1H2VZ 4CGGA 2LFVA 4Q44A 5T14A 2GCFA 3RG6A 3ZZZA 4DV7F 4F4WA 4C3MA 3T5JA 4JI0K 4DUYK 3L4QA 4MT1A 2VBWA 4LF6F 3QRPA 2ZITA 2OCEA 2I2YA 1QJHA 3KG4A 2JHEA 2HF3A 1BWFO 4HI1A 4F26A 2G0IA 3E2EA 4P9SA 1TL4A 2PI5A 1BUXA 4OHXA 1O6XA 3TEHB 1C0TB 5HMXA 2ROEA 3BR9A 1YSJA 4OZ0A 1ZETA 4ZCIA 4DHYA 1XR5A 1VRUA 4HTIA 1EX8A 4C8LA 3MAHA 2ZBPA 3THPA 4YB5A 1RFQA 2MQQA 1WOQA 1S72S 3ZXWA 3DRPA 4DWIA 4I2PA 2QX0A 4H5WA 3N0VA 3HJVA 1NK6A 3KG1A 5AQNA 2O8DA 4LFAJ 3VA0A 4ZIWA 2HNDB 1R8HA 3Q8QB 4QWCA 4ZK7M 3SMPA 3N6NA 3QJLA 4CJQA 4FJXA 1ZBLA 1M90T 7FD1A 5JVGQ 2O4IA 2QE5A 1TR0A 1HQ2A 2F4VF 1KWMA 2RSQA 1NSPA 5JJBA 3JAMU 1KHWA 5KRSA 2AQ4A 4YR0A 4TYBA 4URSA 1VYAA 3M8PB 1BOTO 1FKPA 2XEXA 3DXSX 3G87A 1G2EA 4QWEA 5EN1A 4I4BA 4KE5A 4EFAC 3ULEB 4PG5A 2A42A 2UUWA 3US5A 4IO8A 1DARA 2R42A 3WQUA 2DEIA 2D5RA 3WIVA 2AJ1A 3M05A 2VG7A 1XNRF 5L38A 3A3PB 4CHNA 3VF4A 2KRBA 3SQGB 3FLCO 3D0PA 3QDKA 3ENHA 4NLXA 2QWPA 2QT7A 3MM5A 5F3ZA 3AOCA 4ZP9A 3VTIA 3Q86A 1VK0A 1ZM3A 2IIHA 3CTRA 3OYEA 4O4GB 3AGRA 4CLTA 4QS7A 1M5PC 2PFFB 3H3OB 4CESA 4LR9A 3OFFA 4DV1J 3ATUA 3EUNA 1F21A 3CC7S 2WVEA 4GC6A 5J1EB 6AT1B 4FJLA 5DRKA 1XERA 2P9GA 4USIA 4M42A 1HWLA 5L1IA 3FBCA 4H5TA 4I7FB 5KFOA 3QFHA 2BE2B 2ZC4A 4J9UE 4JI5F 4CD1A 3MWBA 4RBUA 3TUIC 2E7XA 2LXUA 1CXQA 3RJMB 1FRMA 3CDWA 3KK1A 5HK4A 3ZZOA 3RMAA 3O5TB 3GE9A 4J5OA 4DXLA 3L7PA 3M30A 1S6PB 5JMNA 4DSEA 2MSSA 4HHHA 5AZJB 2KVIA 2YX6A 2DK2A 2E5GA 3OYDA 2OTJN 1G15A 5HVFA 3MFHA 2Z1IA 2HBJA 2RJZA 3HL8A 1FTRA 2ZJQL 3M2RA 3EDQB 5A0YA 5I42B 3CD6N 1ESVA 2LKZA 4PWWA 2XCPA 1RJJA 2D7SA 1T9VA 4B8AB 4DTJA 3MZIA 4OI2A 2EK6A 2AGPA 3HZEA 4DUYJ 2HBKA 3SQ0A 2KXFA 4O8KA 2AF6A 3AD7C 1S1VA 1RTHA 1VQ4N 5GIOA 3J81j 3BF4A 2YNGB 2HIYA 3VPZA 4KFBA 2QXFA 1I51B 3ASMA 2AWZA 3C6TA 3GQCA 4ZVSB 4FXWA 3CIPA 2PYLA 2HHSA 2FHKA 4M3XA 2PIIA 2VG5A 1IKYB 2KHDA 3D6RA 1SXLA 1JLCA 4OO1J 1XBWA 2F63A 4AHVA 4HCCA 2V50A 1Q9XA 2D3O1 4V19X 1Q81O 3FCWA 5K8PA 5F8LA 4CCHA 2E5IA 2ZOMA 4UW2A 3H7HB 2FIUA 3DRPB 1S97A 2R7WA 2HB5A 3LP2A 2KKZA 3MM7B 3Q8UA 3DYAA 2W9BB 3AB2B 3VQ4A 4DV0F 2Q2RA 5GVQA 2AD9A 1N4LA 4XK8C 2DTUA 2ROPA 2RMLA 2NSCA 4N77A 4YOXA 3HVAA 2I6WA 1LKZA 4ZDNA 2D0PA 5A6PA 1FX4A 2YVSA 2XI3A 2D3ZA 1FKPB 1IO2A 1T03A 1QM9A 1FKOB 3AY0A 1JIHA 3DOLA 3O9UA 1NSAA 3HFZB 4Y34A 4BR7A 4IZ9A 3T1AA 4O3PA 2CIMA 4NPOA 2JH3A 1LWFB 4NYFA 1W7WA 1NK0A 2E2PA 4JKGB 3OHBA 1MWYA 4BACA 1C6VA 4FW1A 2E1CA 2M0GB 2XHBA 1SJRA 2RHKA 4JLHA 4NLRA 2HFNA 3S6EA 3ZZUA 3AARA 2R7YA 1RCXB 3VQQA 4ED0A 1Q4RA 3H3NO 1WELA 2QV6A 1QSYA 4Z4HA 2MY8A 2HW3A 1RISA 4RWTA 2EBEA 4NZ0A 4DQRA 1J5EF 3ICLA 4A47A 4EBEA 4LF9J 3D2FA 2VA3A 3U9DA 3QO9B 4ECSA 1TK8A 3MX5A 4BS2A 2CRLA 1BHNA 2HGMA 2Z30B 3BP8A 1BIUA 3TAEA 1RTIB 1NB7A 3D7EO 2L9NA 4I6YA 1IR0A 2DO4A 2LQJA 4WFBL 2IM0A 2PEBA 2A3JA 5CZXA 2NXCA 2VODA 4ILMA 3BS9A 4B8CA 2ZZMA 4CZHA 4BCAA 1Y4ZB 3HSTB 2HG4A 5A2QU 2P9PA 3L3CA 5EDWA 3VQ9A 3BH7B 2V8VA 3P5JA 1B7FA 2CYYA 2DNQA 1R8PA 4MK9A 2CGLA 3RBEA 4OX9J 1N36K 4O3RA 3NCIA 3MTKA 1M0SA 5DS7A 2CPFA 1RBUA 1WTFA 5KGXA 4CQ1A 3UPFA 2J8SA 3B4DA 1SPBP 2GX8A 2CQHA 4NYZA 4CEOA 4ZLPA 5KFMA 4KKOA 3M9MB 2CQGA 3IFEA 2CZ9A 2E8AA 1VQNN 2BH1A 2RDIA 4OYBA 2ZZNA 4CK1A 3FZLA 5CYJA 2BE7D 3MR5A 1YJRA 1BCOA 3SV3A 1LQ9A 4N47A 5KT5A 2XZDB 1G6BA 2DNNA 5H9FJ 3AQPA 5ETLA 4CF1A 1WKKA 1UWBA 1RNHA 3WC2A 1RTHB 1N48A 3R3TA 5FPEA 4KH0B 3BZQA 3KLFA 2CPZA 2YWWA 4KGZB 4OI4A 2FBTA 3NCQA 3IMXA 3QSYB 1ZBIA 4X84A 2GHPA 2H65B 3FZ2A 1Y5IB 4K2JA 3TVZA 1WOPA 5I3QA 4IH6A 3OTCA 1PYSB 4R5PB 1VJWA 3D0GE 1B99A 5ETTA 2WCXA 1WSIA 3SXLA 2J6UA 4CIFA 1WORA 2UZAA 3LDQA 4Y2AA 1JLQB 3ENQA 3HHLD 3PW7A 3TU5A 2QA4G 2XRIA 1YRTA 1NM2A 5KFEA 3AA8A 3HFKA 3QFWA 3I8DA 1RAFB 2IGIA 3ZZPA 3DYAB 1DQ9A 4NE9C 1HR0J 4L74A 4J8FA 3FFIB 2JC0A 1SKUB 4CHQA 1WC4A 3GU0A 4DR6F 2OO4A 3OYBA 4BRCA 1Q8KA 4FF4A 2QKBA 1X4AA 1QVGR 2DNRA 4G1IA 1UAWA 1GXUA 2XGQA 1I39A 1O13A 4DV3K 5AQQA 1E6YB 3V9ZA 4KBOA 4DTSA 3SQ1A 2XY8A 4O55A 4FZXC 2QYCA 2GFFA 3PSIA 3UCGA 2VB6A 4LD0A 4ZCKA 4OIXA 3DOLB 4NYPA 3CC2N 3R7NB 2V2ZA 2B4PA 4B9TA 5E3QA 4QOZB 5G4DA 4AL5A 3BQ2A 4BC7A 2BRKA 1ITPA 3HD1A 3TAMB 3PLAA 3PEHA 4DR4F 5A2QO 1KAYA 1BG3A 4NLGA 2R3VA 3DLEA 4BG8A 3EDRB 3A0IX 4UZCA 5CZ2A 3ZSZA 2ZOGA 3V2UC 4IH5A 2ZVSA 2QL5B 1WEYA 3GB0A 3SAFA 4M3ZA 1W2BM 1UA1A 1VLYA 2HQCA 4RNFA 4JI3F 3EKUA 2KT2A 5IXUA 2X6SA 3ZSYA 2HLUA 2ILYA 4ZTFA 2QI2A 3LDNA 2VFSA 3MCSA 1RAOA 3SV4A 2F5GA 3IS9B 1DTQB 4YHHK 2JLFA 5KOWA 1EKEA 5HJXA 2Z1JA 3ISNC 2I5JA 3GOIA 2UXCJ 3P83D 3HX9A 3NNCA 1Q5VA 3BDPA 1ZBSA 3OQ2A 2FC8A 2NPIA 2XYHB 2QFIA 1R8CA 5FJ4A 4HDGA 4YUDA 4ELUA 1LFPA 1P6TA 3TAFA 1NH7A 2KW4A 4M5JA 3O9TA 3M8WA 1RCHA 1KLMB 3D3CJ 1YJNN 2DNZA 3X3UA 2V5HG 3WUHA 4Q5VA 2G1HA 1M1KT 3QT6A 1S79A 2QGFB 2GV9A 4C3LA 1B0TA 1NGDA 1YK9A 1WJ9A 3DRSB 4MAKA 4KKOB 3NAIA 3HZ6A 3C6HA 1IBLK 2ITGA 4DUZK 1HKAA 2ZJRQ 3FZBA 5AQJA 2P9CA 2FHMA 1Y9OA 3D4JA 3ZT3A 1RT2B 3QRRA 3TUJC 4BR5A 4BROA 4FWQA 5EWEA 5T7LA 3ITHA 4FJNA 3OR2A 4ITSA 2GVDA 1IBLF 3QNOA 1YX2A 4BRMA 4DG1B 1LCUA 2JNJA 2HQDA 3ETOA 3GE1A 1HQEA 3CCVN 1S77D 1APSA 5GADU 2OI2A 4HL9A 2DHAA 3DLBA 2IM2A 3VEXA 3TQ1A 2VQFK 1KVJA 2AX1A 2FYXA 1WDDA 2IC3B 2GEMA 3O6WA 4KH6A 1R0AA 1VLOA 2CQ4A 5E3CA 5KFRA 4CJEA 3KLGB 1KVIA 2D74B 4WTOB 4CLKA 1VRTB 2CQIA 5KG4A 2FJDB 4CJUA 2J7WA 2DNLA 4DU7A 1ASVA 2DPNA 4DV2K 2NPFA 5D0GA 4FJGA 3SSSA 2VKRA 1Y3KA 3VVUA 5A8WA 3VEWA 4DV3J 1X9JA 1PG5B 4YB7A 3T6JA 1IWAA 1ASWA 3KHHA 1WBDA 1NJZA 4KRFA 4RW8B 4C1NI 3FZFA 3EMTA 3D67A 3PHTA 3QEVA 1R27B 3O3FA 4DTRA 3TO8A 1NK4A 3SJHA 3DU5A 3DDNA 1MWZA 1JJ2M 2R7RA 2QTWA 1XN9A 4IFEA 3ENVA 4M5NA 3E9PA 3D45A 5AJ3K 1L3UA 2OD6A 1R6VA 1U6ZA 3A2FA 5AQIA 5DDPC 2UUBJ 1HPMA 3HLUA 5E41A 5C24B 1E4GT 1TL7B 2DHHA 5F8HA 2PGCA 1NWKA 1D09B 4EBCA 3KNGA 1FWPA 4KH4A 3QEWA 2MGZA 4FYXB 2Z2LA 1QUVA 5M1OA 4CO3A 4B3RK 3RYLA 1VSLA 2CAJA 1SUQA 3W1YC 3CC4S 1ZOTA 1YIJS 4E89A 4CT8A 4J7CA 4BC4A 2HVHA 3VETA 4KHQA 1V3SA 3R1LA 4YHHJ 2EEYA 4ED4A 3VGTA 1WSJA 3CJKB 2GTDA 4DJBA 3CDEA 1FJEB 3WX4A 4I68A 4B3RF 4CIGA 1W97L 4ECQA 4FOEA 3IKMA 5L46A 4F4YA 2Q6CA 2XHCA 3FUYA 3D1HA 4XPCA 4QCLA 4LH4A 1GOAA 1WDTA 3DNCA 3AA2A 4KPYA 3W66A 2F7TA 2XULA 1O0PA 1GTEA 2I9SA 4B3TK 5DO2A 2B4OA 3G6YA 3KTQA 4IDKA 5AE3A 4A57A 5C15A 4AHUA 2MQPA 4P75A 4DR7K 4BE0A 2GO9A 3OHAA 3SMZA 4MIBA 2Y1JA 3O4WA 4CP5A 1UFLA 3DDIA 3GLJA 4B3TF 2VGMA 5LMUF 4A2AA 2N7CA 4MMOA 4DUZJ 4DV6K 1URNA 4F36A 1T0TV 1L3KA 4K5RA 4X2BA 3ZCMA 4GY2B 3GFYA 3CQ8A 4B9QA 1BI4B 3NGTA 3OYMA 3TARA 1WHXA 1ATNA 1V3RA 2ZH2A 5DDOC 3NF7A 2HHHF 4MYUA 4DV6F 3V6KA 4O3OA 4DR2J 4ZVQB 1SJ4P 1BXNA 2O8CA 3BO2A 4CLSA 3FR0A 1F6TA 4MO5A 2VUGA 3BPDA 4QYZK 5DGBA 4DCHA 2GJ2A 5CY4A 2GVDB 1F9EB 2VQFJ 1F60B 1TUWA 2QK9A 3PKMA 2K1RA 1JJ4A 2VQEK 4M3WA 2GUIA 4OPHA 1UOCA 3CJ1A 2W25A 1ZPWX 2O01C 1TTHB 1CBKA 5KG0A 3MEGB 1JWWA 1PCAA 3I32A 2VWKA 1X0FA 5KFPA 1R0AB 1TKDA 2OKQA 4DR3K 2UXBJ 1PAUB 4NLYA 4FWRA 4FBUA 4IG3A 2B4JA 3TOQA 2KL8A 4IOBA 3I0RB 1RADB 2NLWA 1MWKA 3KUEA 1U1PA 1NKCA 5A8WB 4PXDA 5B0GA 3CJ9A 4DR3F 4NLDA 4HEA9 1NG9A 2J9DA 2OANA 1N5TA 3P4UB 4G3IA 2UUAJ 1YJTA 5FROA 5HMWA 3L2VA 3LTOA 2FZKB 5GMDA 4MYTA 1ZC6A 4FWMA 2WOMA 1CLFA 4LIWA 1R59O 2C2ZB 4WFYA 5B0EA 2CNKB 5KT2A 2HZCA 4J9SA 3UR3C 3C2PA 4UZBA 3VOVA 4FJHA 3OJUA 5AZIA 1FNMA 4UTGA 3FZMA 3H08A 2OFHX 3F9KA 4CD3A 4UUWA 1R3NA 3HOTA 5BN8A 1RT4A 3AJ2A 1K8KA 4FBTA 3SUPA 3OL7A 4EMDA 4DLGA 4WE1A