2ZD1A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 159
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2zd1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2zd1A05
5KFYA 5E41A 2JC1A 5KG6A 4IRKA 3OSNA 4FLTA 4NLXA 3KHRA 2XI3A 2BRKA 1Z26A 3PO4A 4FLYA 3LZJA 3D5MA 2KZMA 3T5JA 5HLFA 3F9KA 3C6TB 5KT4A 4CJQA 4DSLA 1FK9B 2BRLA 3NH0A 4AHTA 3H4DA 1NK6A 4OGEA 4AHUA 3VQAA 4ZP9A 3H5XA 4Y2CA 2IM0A 4I2PB 1HRHA 5JS2A 3EZ5A 3RWUA 4FJHA 3WNEA 3M8QB 2WB4A 4ECUA 3SPZA 3KK3B 3FRZA 3S3MA 1WSEA 4BE2A 4FJLA 3E01A 5KFRA 3NGZA 4CEDA 4PA1A 1BCMA 4NCBA 2J6TA 1HPZB 2IM3A 1EKEA 4ELUA 4FBTA 1TAQA 4PUOB 4F4YA 1TV6A 3GILA 1GOCA 3IN5A 2F8EX 4CGGA 3NMAA 3O3GA 4URQU 4N56A 3LP1A 2HMIA 4K4ZA 4I9QA 3K57A 3LAMA 2HWIA 5F9LA 5L1JA 3OVNA 4RZRA 4KO0A 1RT2A 2XI2A 2RN2A 4CEAA 5KFDA 2ATQA 2RKIB 4CIFA 2FBYA 1TVRB 3KIOA 5KT6A 2Y1JA 2Z1HA 4OVLA 1KCFA 1WAJA 3CJ4A 4KE5A 4TXSA 3PX0A 4YP3A 2GIRA 4J2DA 3U6FA 3SUQA 3SFGA 4YR0A 2XGQA 4W5QA 4KHUA 5KFUA 1K6YA 3ZSXA 4IFVA 1NJZA 1IKVB 3V81B 3MXJA 3HPOA 1JX4A 2ITGA 3SQ4A 3BJYA 1S0MA 4ZP7A 3I5BA 4O3QA 4DFJA 4DFPA 4DL7A 5KFPA 1BQMB 1QSSA 2VG5B 1IKWB 2CJQA 4MQ3A 4CGJA 1X9MA 4ZHRA 1RDRA 1IKXA 4KFBB 5EWFA 1N6QA 1XR5A 3SJJA 5KI6A 5KG3A 2E6MA 2FVSA 4Y1CA 4N47A 4O44A 3U3YA 3RR8A 4RW4A 4R8UB 3LP2A 3VQ4A 3GIIA 3V9WA 2UUTA 4CEFA 4FJJA 3BSAA 3RB3A 2EC0A 1WSGA 4KHNA 1JLBA 5L9XA 1J9AA 1KVAA 4KHQA 5F8LA 1TKZA 3ZT1A 1C2PA 2RDJA 1S9GA 3T5LA 2IOCA 4CEEA 1ZBHA 3I0RA 2GIQA 4J2AA 1EX4A 5EWEA 4NCAA 3HHKA 1X9WA 4JS4A 2G8HA 4RW8A 1RT5A 3KLFA 3C95A 1RTJB 4GVMA 3V9ZA 1ZTWA 2YNFB 4KHYA 3ISNC 1L3TA 4FLZA 3L2VA 2HHUA 3HKWA 3QNOA 5CYQA 4KKOB 3DLRA 3L2UA 1RILA 3PVXA 4B9MA 3SI8A 4KTZA 2XCPA 1SKWA 4ID5B 4ED6A 2IAJB 4JV1A 1TQLA 2R8GA 3AO1A 1UA0A 5DG7A 4J9SA 3BGRB 3TAQA 4IG3A 2R8IA 3LWLA 1HQUA 4ZVFA 3VQBA 1KVBA 3HM9A 3FFIB 4F3TA 3QGIA 4F3OA 3CIZA 1S1VB 4QWDA 4K4SA 4YR3A 1FKPB 3G0ZA 4ED3A 1RT7A 3RMDA 1C1BA 3OYBA 1JLCB 3IS9B 4Q5VA 3OYNA 5DGAA 4NLTA 4E7JA 3UDLA 1C6VA 2FC0A 4NLUA 2EX3A 4EYIB 2GBZA 4OJRA 3EPIA 4WE1A 1HQEB 3H5YA 4NYNA 4CECA 5KG4A 4ECWA 3CDWA 2JEFA 2WONB 3AO2A 3KKRA 4ECQA 3JSMA 1B9DA 1S1UA 1IKYB 4O5BA 3OLAA 1JXBA 3I5CA 4TYAA 2OPRB 4C8MA 3TAPA 4HUFA 2WOMB 3DYAB 1FKOB 3DLEA 5EU7A 3V1RA 4B8CA 3OY9A 3T5HA 3KLHA 2FBTA 3NHGA 4Q45A 4ZP8A 4NLOA 3CJ0A 2I1RA 3HP6A 4CJWA 4CGFA 3TAGA 2VG7B 3DRSA 3AA3A 2F8TA 4GW6A 2R2UA 3AVBA 1NJWA 3SUPA 1R0AB 1IH7A 1TP7A 3TAMB 2YNIA 4ZPAA 1S6PB 3RB4A 3ITHB 5KFCA 2FJXA 4EZ6A 3RB6A 1NK9A 4KI6A 3VQEA 3BQ0A 3LDSA 1S48A 4NRUA 3ALYA 3OLBA 3PW5A 5KT5A 4WFZA 4RU9A 2OPQB 4BWJA 5DQIA 1S9EB 4E7HA 3BDPA 3TVKA 2IS3A 1YTUA 1N48A 2C22A 3SNNA 4CCHA 5DLFA 4HTUA 1RTHA 3OHBA 1RDAA 3LWMA 1KLMA 5KT2A 4U7CA 2R8KA 3RMCA 3HVTB 1WN7A 1DTTB 4IRCA 4CEQA 3S9HA 5DG8A 3AVGA 3KD5E 2WRMA 1SL2A 3V6HA 4CFAA 1HYSA 1S6PA 3CFOA 4Q8FA 1KHWA 1D9DA 1W0HA 1D1UA 3DLKB 4FZYA 4Q44A 1HNVB 3FQLA 4Z4CA 5L1LA 4B3OB 3H98A 4OGCA 2VG7A 2ZE2B 3ULDA 3OYFA 4FJIA 2O5DA 2ZD1B 1RDDA 1ASUA 5T14A 3KK2A 3OYGA 1NK8A 4H4MB 2XY6A 4YQWA 1HYVA 2WCXA 2KQ2A 2RF2B 4G3IA 1SV5A 3DLEB 3P5JA 1KVCA 2WK4A 4JRPA 1FKOA 3ZSVA 1WNEA 3V9UA 4J9NA 1BI4A 3L2QA 4CEZA 4KAIA 4WFXA 2FVRA 1C0UA 5C24A 2JEJA 2IDOA 4CGDA 1HNIB 4CJTA 3QGHA 4E0DA 2XHBA 4OPJA 4KSEB 5KFWA 4YFUA 1NJXA 3DRPB 3V4IB 3AVCA 4ECTA 3CVKA 3MR3A 3MECA 5EWGA 4W5OA 3AV9A 4KI4A 1C1CB 1C1BB 3NDKA 2HHVA 3C94A 3AVIA 2I5JB 3V1QA 3GV7B 1VSLA 1Z4UA 3VQSA 1TKXA 4K8ZA 4LD0A 4OKEA 3TWHA 1BQNB 4R5PA 4J9LA 4GC6A 1QHTA 2JGUA 1RBUA 3M9NB 4JLHA 1LWFB 1HQUB 4O0IA 3QESA 5J2MB 4BE1A 1U45A 5KFEA 2G8UA 1T03B 1LV5A 4E89A 2IAJA 4IOBA 1SL1A 3CJ5A 3UR0A 3P83D 3ZT3A 2KW4A 3DM2A 1RYSA 3U3GA 4FZZA 4PWDA 4RNNA 4IH6A 4DTNA 2FLPA 2HB5A 2PZSA 4ZPCA 3OJSA 3N6NA 3MEGA 4QW8A 3KK1B 2A1RA 3QIOA 3SYZA 4ED2A 1J5OA 4RW8B 5J2QB 1WSJA 4NLPA 3JYTA 1JKHB 4M3XA 3CO9A 4LY7A 2YNGA 3I0RB 4TY8B 4Y3CA 1S9GB 1VSJA 1JLEB 2VA2A 4GMJB 4CFCA 1ZETA 2QKKA 4CK2A 2D7SA 1UOCA 5KFBA 1JLEA 4TY8A 1RDCA 3GIMA 3QEVA 4QPXA 4DQQA 1QAIA 3GIJA 3ZSWA 1WSFA 4ELVA 1RT1A 3DRRA 4YNQA 3H5SA 4RW6B 4R8UA 4CJ3A 2G8IA 1J5OB 3MR6A 3CFPA 2J6UA 1QS4A 4CJFA 4RG8A 3NGDA 3HVAA 3QZ7A 3CWJA 1LW2B 4I7FB 4ZTJA 1DLOB 1BIUA 1ZBUA 4DTXA 1D9FA 4O3NA 1NKCA 1IKXB 4KFBA 1XHZA 4ZHRB 2VG5A 4DEZA 2ASJA 5K14B 2JLEA 5KFGA 4FVMA 1S97A 1VSHA 1UWBA 5KFMA 5EUHA 4M42A 3PW2A 1T03A 4RNOA 1BHLA 5FDLA 4IH5A 3QIDA 4M41A 4CFDA 1VRUA 2DY4A 1SH0A 4FJXA 4U6PA 3PJWA 1BGXT 3HP9A 4C8NA 5C42A 1BQNA 4R5PB 4WYWA 3QIPA 3HL8A 4HYKA 4KHMA 1C0TB 4IKAA 1G15A 1CXQA 1L3VA 3O4NA 5KFNA 4LQ9A 5F8JA 3DDKA 2E6LA 1NNDA 3V4IA 1Y97A 4CFBA 3SQ2A 3PO5A 3D45A 1RA6A 4IKFA 5D3GB 4KO0B 4CIGA 4NLQA 2IC3A 4ED8A 4DQSA 1XWLA 3GV8B 2HVIA 4W5RA 4F4KA 4DQIA 5DLGA 4ZVHA 1WAFA 4WXWA 1RT3A 1NOZA 1S9FA 3NFAA 4B9TA 4FM1A 3RAQA 1ZYQA 1W25A 5HROB 1S0OA 4F4WA 3KK2B 4GC7A 3OYCA 4DF4A 2ZD1A 1CXUA 4K8XA 5HBMB 3DLBA 4G1QA 1KLNA 3T1AA 4DQRA 4R0EA 2GV9A 4AH9A 5KG1A 2B43A 4CGHA 3HO1A 4TYBA 4YMEA 3WNHA 3KLGB 3RB0A 3BSNA 4K4VA 2FJWA 5F8GA 3QNNA 4B9NA 4Z4GA 3AVMA 3LP3A 3KLIA 4J9OA 4CJ5A 2VWJA 5HLFB 1KLMB 3UIQA 1RTHB 3OYDA 3M8SA 2ASLA 1TAUA 3TI0A 4KV8A 4XIUA 3RRHA 3ASMA 4J9MA 3VN5A 1D8YA 2RPIA 3CG7A 3M8RA 3MEEB 1LAWA 4KHSA 3LPUA 4KTWA 5J2NB 3MEEA 4J9KA 1YVFA 4JS5A 4E1MA 5JXSA 1LAVA 1U4BA 1U49A 4CIEA 2HNYA 2W9BA 1HMVB 3TAMA 4OKJA 2C28A 2OA8A 2KFZA 2IJNA 4KV8B 5I3UA 3ZT0A 1XR6A 1IG9A 3L2WA 4DG1A 3EY1A 3MFIA 3KLGA 4URGA 4O4GB 3IAYA 4FK4A 3NF8A 4ZPDA 3D0PA 1A5XA 2WOMA 3EZUA 5C5JA 4G1QB 4MK7A 2DPJA 3OL6A 1X1PA 3A2FA 1S1UB 2Z1IA 4NLGA 2WONA 4CHYA 4BDZA 4CHOA 2ALZA 5HROA 2YKNB 1RCHA 4CJUA 3NF9A 2YKMB 1RT3B 1TL3B 2XO7A 2VG6B 4DU3A 3RR7A 3QO9A 3OYLA 5J2PB 3TQ1A 3CM6A 4J9PA 1JL2A 3NH1A 4K4WA 1ZBLA 1N4LA 1JLCA 4RW7A 4DL4A 1RT7B 1L3UA 2UVRA 3B6PA 4DQPA 1JIHA 3D28A 1S1VA 4CF0A 1S1XA 5HP1A 5L1IA 4AHCA 1HARA 2R8HA 3KHHA 4DTJA 3MEDA 2XY5A 2O4IA 1JLFA 2GUIA 2UUWA 1NKEA 3T5KA 4FJKA 2V9WA 4WXOA 3AVNA 2V4QA 4IG3B 3ZT4A 4ZVGA 2DFEA 4L8RB 3HPHA 3KJVA 1ZTTA 1CZBA 4CE9A 4Z4FA 3QIPB 3CFRA 4XPCA 4XO0A 2AX1A 4NLVA 3Q8SB 5FRMA 1VRUB 4DTSA 4MK8A 2C2EA 2OPSB 2HHXA 1I6JA 4KKOA 3MTKA 2HHWA 2E9TA 1SH3A 4J9QA 3SV3A 3VQ9A 1UWBB 1RT4A 3MR2A 4XPEA 5K14A 3QERA 2J6SA 4FS1A 1S1WB 3KLFB 2HNDA 4M3UA 5F9NA 1DTQA 1TK0A 5KGWA 1S1TB 1DLOA 4M3TA 4I7FA 4CHZA 1QTMA 3OSPA 3PR4A 1ASVA 3AO5A 4LSLB 4EBCA 4LSNB 2P1JA 5KFVA 5C25A 5KFXA 5KFAA 1FXXA 1XHXA 5SWMA 2YHBA 1RT1B 2X78A 1JLBB 2G8FA 4RNFA 3MR5A 3LZIA 1QSYA 3WNFA 4QW9A 3LP2B 3DOLB 3F73A 3QINA 2DFFA 2DFHA 3PW0A 3KHLA 2WHOA 3HJFA 2W8KA 3SQ0A 3KMQA 4AHVA 3EYZA 4KPYA 1S1TA 1JKHA 1DTQB 2HHQA 3RRGA 2HNDB 4JRQA 3NBPB 1S1WA 2QV6A 4CJLA 3RMBA 4K4UA 1YT3A 1T8EA 4FJNA 5FRNA 1BQMA 1YVUA 5HRRA 3CQ8A 2X6NA 3MEGB 1UAXA 4NYFA 3PV8A 4O4RA 3ZCMA 4KB7A 2UVVA 1IKVA 2OPSA 3M8PB 4PWDB 1U04A 1T94A 3DM2B 2XCAA 3VQDA 3SPYA 2IA6A 1N5YB 3KJVB 3BSOA 2OYQA 3OYHA 4PQUB 3TARA 3HK2A 4MK9A 2R2RA 2CKWA 1LWCA 3CYMA 4IR1A 1NK7A 2D3ZA 2A1SA 2PYJA 5KG0A 3OYAA 2BE2A 1TKXB 3QEPA 3QZ8A 1KRPA 1S1XB 5HP1B 1TVRA 1TGOA 4KB1A 2RKIA 2D3UA 1RYRA 1EXQA 4HUEA 4ECRA 1C1CA 1K1SA 4FLUA 2AGQA 1CZ9A 3NGIA 3L3UA 2OZSA 4TY9A 3SI6A 1TK8A 4CJVA 4F4ZA 1CLQA 3QO9B 3DRPA 1NK5A 3V1OA 1L3SA 1HPZA 1KTQA 2YKNA 4KHRA 3K5NA 1WLJA 3P1GA 1C0UB 5C24B 1RTIB 3SV4A 3KK3A 3M8QA 1BI4B 2G8WA 3PX4A 3PW4A 4K4TA 1XR7A 4CERA 3CJ3A 4N76A 5CYMA 3MXMA 4O4GA 4FK2A 2EHGA 2YV0X 3G6YA 5DK5A 1S5JA 3K59A 4DWIA 3C6TA 3FDSA 4KB0A 3AVKA 4B3OA 3HVRA 4DTMA 4Z0UA 1HNVA 3DLKA 3V9XA 3NGYA 3SUNA 2HNYB 2W9BB 1HYSB 4DLGA 3RAXA 3KNAA 3BSCA 4MKAA 3N6MA 1DTTA 3DLGB 3HVTA 5J2NA 3OJUA 2W9CA 4IH7A 4CK1A 4CJEA 4DL6A 1QE1A 2HHSA 2KFNA 4E1NA 2D0CA 3AVJA 3OYEA 3OL9A 3AA2A 4DU4A 2HW3A 4ED1A 1U48A 2OPQA 4DFMA 2FJVA 4DTRA 1REVB 3KLIB 2B4JA 4O0JA 3TANA 3ITHA 4CJPA 4EP5A 4BE0A 1NOYA 2BR0A 2YNIB 1EP4B 4FJ7A 4LH4A 4FLVA 1TKDA 4H4OA 3OHAA 5F8IA 4M3ZA 4N41A 3DRSB 2HAIA 5HBMA 4E7KA 2AQ4A 3ZSRA 4DS4A 3PY8A 2OPPB 3Q8PB 3ZT2A 1JXLA 3KLHB 1BCOA 3O3FA 4HHTA 1NJYA 4Y34A 5DMRA 4CEOA 2XGPA 1TL1A 2P51A 4TQSA 1JXEA 4DU1A 3DOKA 2OPRA 4KAZA 4NLRA 1CSJA 1RBVA 1LWEA 1IKYA 3JSMB 2IC3B 3RTVA 2XY8A 1QAJA 4DL2A 5D3GA 4NLSA 4WE1B 3LP0A 3VQ6A 1QUVA 5CZ2A 3VQ7A 5KFIA 3H5UA 1JLQB 3IG1A 4C8KA 5DGBA 4EO6A 3DLHA 3NAHA 3HVWA 4ZVEA 3IS9A 2B6AA 1TKTB 5CY4A 4IR9A 1C0TA 1FKPA 1O1WA 4ZTFA 1B92A 3IRXB 4KREA 2AGOA 1NK4A 5C42B 5F8HA 3L3VA 4NCGA 2WTFA 4CF8A 1B9FA 3CDUA 4TSXA 3OYIA 4IDKB 1ZBFA 4TLRA 3KLEB 3BGRA 5FDLB 2ILYA 4OPKA 2DPIA 4ID5A 4MKBA 3SZ2A 5JS1A 4FW1A 3NE6A 1VK0A 1WSHA 2QE5A 3OYJA 3PJXA 3Q8RB 5KFZA 1Q8IA 4JV0A 4Y1DA 1LW2A 3TR8A 5DQHA 2C2RA 2V0NA 5HRPA 1N56A 2QKBA 3HPGA 2DTUA 4AHSA 1RTJA 3DI6B 2QK9A 5L1KA 3NF6A 4CHNA 4RW6A 1T3NA 3DRRB 4M45A 2BANB 2JEGA 3V6JA 4QWAA 3AA5X 3KOAA 4EEYA 2AU0A 1W9HA 1JLGB 2XWYA 1TKZB 3UQSA 1IM4A 2OH2A 2YNGB 1GX6A 5KFTA 5KFLA 5KFJA 2KTQA 3JYTB 3RBEA 3KMSA 5J2QA 1YTAA 3BQ1A 4IFYB 4DTOA 2YNHB 1RBTA 3O3HA 1JLAA 1KFSA 2F96A 4AILC 4FK0A 1SUQB 4RW4B 2AX0A 3KK1A 4Y2AA 4M3YA 2FLLA 1C0MA 4O44B 3H40A 4ZPBA 4QWCA 1QQCA 2D5RA 4KBIA 3MF5A 2GC8A 2OZMA 4RUCA 1N6QB 2ASDA 4FLXA 4J2EA 3IGNA 4K50A 3PR5B 1SUQA 3LPTA 2HVHA 2AGPA 3H4BA 2W7OA 4AHRA 3MXIA 4LH5A 4FYDA 1Q9YA 3NAIA 1X9SA 2YNHA 3UPFA 4I9LA 4TQRA 5J2MA 1WNSA 2IM2A 4FCYA 4W5TA 4I2QA 4IFVB 4HUGA 1LWFA 2F8SA 3GIKA 3VQCA 3AA4A 3KD1E 2BGGA 1S4FA 1UA1A 2FBVA 4M94A 3VQ8A 2LSNA 2I5JA 1VRTB 4FZXC 4F2SA 4RW9B 3E51A 4NZ0A 2YHAA 3O4QA 5KRTA 2BANA 3MECB 3C6UA 4FM0A 3DI6A 2JC0A 3FQKA 4RUAA 1BL3A 1JL1A 1VSMA 3OL8A 5KFOA 1RT2B 3PZPA 1NHVA 4IBNA 4IQXA 1HNIA 1D0EA 4CGIA 2B5JB 3LP1B 2HMIB 3AVFA 4FJ5A 3M9MB 4PUOA 4WFYA 3K5MA 2P5GA 2D0BA 4RNMA 1SV5B 2RF2A 3V9SA 3LALA 4Z4HA 1SKSA 4H4MA 2BQRA 4Q43A 3E01B 3OS0A 4F4XA 2XRIA 3G10A 4IDKA 3MAQA 3TAEA 3GQCA 3NAEA 4TN2A 2ZE2A 5KG5A 3BQ2A 3IRXA 4HCCA 1KSPA 4B9VA 1ITGA 2C2DA 3PW7A 3AVHA 3QLHB 1EETB 3VQ5A 1FK9A 1RT6A 2D41A 3KLVA 4BDYA 4DS5A 3OS2A 3OYKA 5KFHA 4DLEA 2G8VA 3LP0B 4Q8EA 2AWZA 3ZSQA 3G6VA 2ETJA 1S9EA 2UVWA 4CJ4A 3OS1A 1VSDA 4B9UA 2ZQBA 2HWHA 3LAKA 4W5NA 1LW0B 2HNZA 4H54A 4ID1A 5KGXA 2G8KA 2PYLA 5CZ1A 3NKYA 4HVJA 5FROA 4FLWA 3V6DB 4QOZB 2X74A 5F8NA 1R0AA 2OPPA 2FBXA 4KRFA 4M95A 3QGGA 2JEIA 4E7LA 3KTQA 2AJQA 1Z25A 2BQUA 3OYMA 3HSTB 2FLNA 1EP4A 4EBDA 1C1AA 3V6DA 4B8AB 2IGIA 4NRTA 3I0SA 2XY7A 4BWMA 4CESA 4DSEA 1U47A 5DQGA 3DYAA 4DSKA 2HNZB 4K4XA 4JUZA 3K5LA 1REVA 2PY5A 5KFQA 1MU2B 3NF7A 3TAFA 4LQ3A 4YR2A 2O4GA 4EZ9A 4F50A 4CF1A 1WSIA 1HQEA 1QE1B 3VA3A 3L8BA 1NKBA 1I39A 4CEBA 2W9CB 4NYZA 4WZQA 1RT6B 1EETA 3QLHA 3QEIA 3AVLA 4FBUA 1U09A 4IRDA 1HJRA 1S6QB 1J54A 4BACA 3KHGA 3CM5A 5SZTA 4CK3A 3LANA 4M3RA 1A5WA 3FFIA 2Z1JA 3NCIA 2NUBA 4O3RA 2E9ZA 1GOAA 2IJFA 3QETA 3QEWA 4Q0BA 5JUMA 5CYMB 2HHTA 1K1QA 2P5OA 2BQ3A 1RBRA 2FVQA 4FJMA 1RTDA 3CDEA 5I42B 1HYZA 5HRSA 2ATLA 4UQGA 4DSFA 3VA0A 4CHQA 5CYQB 1RTIA 1GX5A 2B5JA 2R2TA 4FXDA 3OL7A 4CF2A 2RDIA 3T3FA 4C8LA 4OLAA 2YNFA 5EDWA 1VSIA 3ZSZA 1BISA 4ED7A 2VA3A 3THVA 3V6KA 4ZP6A 1RT5B 1TK5A 1A5VA 2X6SA 3C6UB 4O3OA 4NLWA 5J1EB 4RW9A 2KZZA 1SKRA 3N6LA 1VRTA 3PUFA 3HT3A 4CHPA 1XC9A 3WNGA 3H2LA 1QSLA 2BE2B 3MFHA 3IGVA 4DSIA 1T7PA 4KTQA 4N5SA 4EP4A 1LWCB 1MMLA 3SQ1A 4I2QB 4HCBA 4PQUA 1J53A 3I8DA 3GYNA 1SL0A 4IG0B 3I5AA 3SCXA 1N5YA 3CJ2A 4ECXA 3TABA 4DL5A 4HKQA 4M3WA 3T19A 4NLDA 5DG9A 1VSEA 4CJSA 3DMJA 4QWBA 3M8PA 1RDBA 3AVAA 4CF9A 4QCLA 4MFBB 5KTQA 4O3SA 1IKWA 2W8LA 1JLAB 4MIBA 1S0NA 3NBPA 4E19A 2W42A 4IFYA 4OKKA 4MH8A 4MFBA 4DTUA 4CJKA 3V81A 2R8JA 3SFUA 3QYYA 4O3PA 3Q8QB 2E4LA 4DMNA 3DMJB 5KT3A 3S3NA 2ZKUA 3HYFA 3RBDA 2R7YA 2IM1A 3DOLA 1IO2A 1JLGA 2FVPA 2Y1IA 2V4RA 4IG0A 1BIZA 3EPGA 3H08A 5T7BA 1RAJA 4F2RA 4EBEA 3KKSA 3SUOA 4CJRA 4ZMMA 2UVUA 3VQQA 4DSJA 5C25B 4FW2A 2D0AA 4LSNA 4DFKA 2Q3SA 4LSLA 3QEXA 4KHWA 1RNHA 4RNHA 5J1EA 4Z4EA 4BDPA 5KG2A 4URSA 1TV6B 4FJ8A 4X2BA 1SH2A 1RA7A 1RT4B 4ELTA 5KG7A 3GV5B 4JV2A 3ICLA 1S10A 3PHEA 3KLEA 4C8OA 4K4YA 2W7PA 5KT7A 5I42A 1RTDB 4NCGB 1KHVA 2IMWP 4ECVA 4ED0A 3NL0A 4I2PA 4OL8A 3H59A 4QWEA 5KFSA 1VSKA 4J9RA 1Q9XA 4Q0BB 5KRSA 1TKTA 4ECYA 2B6AB 4WYLA 5KFFA 1JLFB 2ILZA 4FM2A 1JLQA 3IG1B 3MEDB 4F8RA 3B6OA 1S6QA 3ZSOA 4EO8A 4B08A 4OLBA 3K5OA 3HXMA 4DTPA 4PY5A 4RW7B 5F8MA 1LWEB 5KFKA 5J2PA 3FSIA 1L5UA 1OS5A 4FJ9A 2VG6A 1VSFA 1TL3A 4B9SA 3DOKB 4E3SA 2R2SA 2YKMA 1TL1B 3K58A 3RMAA 4EYHB 4Z4IA 4FS2A 4B9LA 1KFDA 1D5AA 1I3AA 2XC9A 2QXFA 4E7IA 3AO4A 1MU2A 4FJGA 3G6XA 1T05B 3S3OA 4DF8A 2IBKA 4J2BA 4NLYA 2E9RX 4H4OB 3AO3A 3PX6A 2Z1GA 4ICLB 3BREA 3I0SB 3BR9A 4QAGA 2W9AA 3G86A 2FVCA 1RBSA 2VWKA 4ICLA 2BDPA 3ISND 4MIAA 4DG1B 4ECZA 1ASWA 4WZMA 1T05A 4ECSA 4O55A 1S49A 5I3UB 3ZSYA 3M9OB 3VQPA 4H8KA 3NH2A 1NHUA 3K2PA 4DL3A 1NK0A 1HMVA 1ZBIA 1LW0A 1GOBA 1F21A 5HRNA 1XI1A 3DLGA 3L2RA
chains in the Genus database with same CATH superfamily
3A3OB 5M1KA 2JJ4D 5KG6A 3OSNA 4FLTA 3VR1A 4K42A 2CG8A 1BY9A 4TVAB 4FLYA 3BB5A 3VVUA 3THWA 2J76E 4NI2A 4PABA 1FD8A 2B9YA 3GJQB 4AHTA 5E84A 2ZVIA 1LKZA 3S6EA 4DR6J 5H9EK 1KVKA 2OMOA 5IS2A 4ANCA 3TSPA 5M1OA 2HFNA 4I2PB 1DJ0A 3SQOP 1H2TZ 4OPHA 2OKQA 2B7BB 4BE2A 9RUBA 2PI5A 5KFRA 1ATRA 2O1PA 1BCMA 3DFEA 1HPZB 1EKEA 4ZVUB 4BC4A 3SMZA 4PUOB 4F4YA 3GILA 2R7VA 3F0NA 2HYIB 4URQU 2HWIA 5DDQC 4RZRA 4KO0A 4CEAA 2XI2A 4ED5A 4DPUA 5CHCB 5JLFA 3VF0B 1SXLA 3GLJA 5KT6A 4QIGA 2V2QA 3L6QA 2KDOA 1WAJA 3CDAA 2QYGA 1PC4A 1C4AA 4JHDA 2ZFHA 2ZH2A 3CW2C 1HA1A 5ETSA 5GADI 1N88A 5KFUA 1YK9A 1K6YA 3ZSXA 2BOPA 2ZKTA 1IKVB 3V81B 3HKZD 3HPOA 1RDWX 2IRUA 2ITGA 1QUPA 1NMDA 5GAGU 1EKSA 3O2IA 4P2FA 4DL7A 4WJBA 2YPYA 3GE9A 4MQ3A 2P9UA 2RILA 1RDRA 2DT9A 3C15B 1B7FA 1IBLK 2Q6CA 1XR5A 4AQYK 3LA0A 5KI6A 2QWLA 1HWJA 3UDVA 2AKWB 3U3YA 4V19J 3CPWR 2VF3A 1LOTB 2HRTA 3OR2B 5LY3A 2DR8A 4R8UB 4USJC 3LP2A 3VQ4A 1G99A 3V9WA 2UUTA 4I69A 4FPIA 4BR5A 4CEFA 4FJJA 2JFKA 3BSAA 1WSGA 4V1Ak 1JLBA 5L9XA 1KVAA 4LF2A 5F8LA 1TKZA 3ZT1A 1C2PA 2RDJA 3J80Y 1S9GA 2DXDA 4B3MK 3ETMA 2X3DA 4DHVA 5EWEA 4FDFA 1OKJA 1X9WA 2CQHA 1GLJO 2QMUB 2RU9A 1Z2ZA 3KLFA 1RTJB 1WWHA 3S01A 4WU2A 2FLOA 1FXRA 3DDIA 5M2PA 2PMWA 4C1NI 3J81O 1FI4A 4KHYA 4FLZA 3WIUA 2F9WA 3L2VA 4M7YA 2GVDB 4KKOB 3KFWX 4ZJQA 2VASA 3U1NA 1HW8A 1YJVA 3NXZA 4WFBQ 3SI8A 1R3NA 3M2UB 4OX7A 2I6WA 2CPJA 4Q7AA 2O8DA 1RCOB 4B17A 4JV1A 1TQLA 1PAUB 1UA0A 1I94F 4H5RA 3TAQA 4USWA 5DS7A 4XDDA 2R8IA 2RQ4A 3R5AA 4OYAA 3QJPA 4NXNK 3HM9A 2CNNB 3QGIA 4PQAA 1F3VA 3ATUA 4X84A 4ZCLA 3RMDA 1C1BA 5K9FA 2IBOA 4NLTA 5B0CA 4E7JA 4HTJA 4CZJA 4NLUA 3MM8B 1DAXA 4EYIB 5AXNA 1XMOF 3QJLA 3H5YA 5ETNA 1ACMB 4USUA 2PSZA 2E5LF 4KGZB 1L3KA 2YWHA 1VBZA 1JXBA 4C8MA 3DYAB 1M1KT 4W92B 4DDFA 3VMFB 2XMUA 3U7JA 3KLHA 1N34F 4ZP8A 4J7CA 4F3QA 2O66A 2J4RA 3D2EA 4DL0C 2VG7B 3VAGA 4JI7F 3B54A 1RK8A 4OX6A 1IH7A 1G3OA 4ZPAA 3RJMB 2QM1A 3H2UB 1Q5YA 3KYLA 2FJXA 3UFCX 4EZ6A 1NK9A 1R43A 1CQMA 3PW5A 2X1BA 4JI4K 4WFZA 4BWJA 5DQIA 1YITN 5TKWA 5AT1B 1YTUA 1N48A 4BRAA 2V7ZA 2C22A 2DR5A 4KHPJ 1RTHA 3OHBA 4DN0A 5KT2A 3QMLA 2IFXA 1MROB 1U0SA 5E3QA 3AVGA 3KD5E 1SL2A 3BP8A 4CO3A 1S6PA 4ZA1A 1D9DA 4AL6A 4OZ5A 4Q44A 3LW5C 1LCUA 4CH0S 3P31A 5L1LA 4ENOA 4B3OB 5GIPA 4LF6K 3FEYB 1YKWA 3ULDA 3HOTA 2ZJPQ 3HI0A 3FC9A 4DR1K 4M5GA 5T14A 1OY8A 3SCLE 1GXUA 1NK8A 2KRRA 1S22A 2MQPA 4G3IA 3P5JA 4C2MA 1KVCA 4AF1A 2WK4A 4KQZA 2OTLS 3AJ1A 3L2QA 2HSEB 4CIOA 3ZTSA 3CI5A 5C24A 1VQ6S 2IDOA 3I8BA 5JICA 3GR1A 1N52B 3MM6A 2CQBA 1D8ZA 4K0KJ 1KTVA 3QGHA 4DV3J 4KSEB 5KFWA 4GRSA 3V4IB 1F5CA 3AVCA 1ATNA 4DR5J 3PXGa 3MR3A 3U9DA 2ASYA 4A59A 3NDKA 3IBFB 3AVIA 1AZSA 3SSQA 2VUGA 1Z4UA 5E3AA 2FSKA 4H5TA 1QHTA 2JGUA 3W60A 3I4HX 1VQLN 2G8UA 2AV5A 3CJKA 3WX8A 4IOBA 1Z2LA 2QZ8A 3ZX0A 4BRFA 5AZIB 4OYXA 3U3GA 3ZYYX 3MM9B 3BDEA 4IH6A 4DTNA 2V4JB 2UXBK 2HB5A 5IWAF 2KH9A 2PZSA 1WHWA 3FGVA 4PHTX 5K8MA 4CZGA 3OJSA 3KWMA 3D1OA 1FX4A 1QVFM 3D2WA 4ILLA 3GONA 4FYYB 1B4SA 4BR7A 2ZEJA 1M5HA 3I0RB 5L9NA 4F0KA 1OPIA 1VSJA 1JLEB 2VA2A 1ZETA 2UV8A 4DV6F 4CK2A 2QKKA 2U2FA 4FSVA 3PIPL 4J8FA 1UOCA 5AQQA 5BREA 1RLCL 3QEVA 4QPXA 5CXTA 1QAIA 1CJTB 1WG1A 4YN3B 4W90B 3ZSWA 2XZWA 1WSFA 2VWBA 1S59A 2HBYB 1Z1ZA 3DRRA 4YNQA 4RW6B 4A8WA 4CJ3A 3Q2SC 2FPHX 4JYAK 3I6PA 4NZ6A 3CCJS 3OR2A 1ZC6A 4CJFA 1TUWA 3M1VA 3CWJA 4YOWA 4I7FB 4LMZA 3H3OB 3L95X 4DTXA 1OQ6A 2HBRB 3O8WA 1JJ4A 1IKXB 2LECA 4ZHRB 1IN0A 4DEZA 5K14B 2JLEA 5KFGA 4FVMA 1NUEA 4FWKA 5CAAA 3UN5A 5EUHA 3DGPB 4M42A 2JOQA 2NSCA 3UKUB 3QFUA 3QIDA 3H7HB 4U6PA 2PFDA 3RYLA 5C42A 1BQNA 2VKRA 5BJRA 3TSUA 3QIPA 2VYPA 1QZ6A 1UEKA 5LSLA 1BDGA 1KVJA 1C0TB 3CIPA 3DKDA 3EDRB 3WEEA 2J7WA 4DV1K 2ZJRL 2R7TA 4LQ9A 3CCES 2F3JA 3DDKA 3ULEB 1NNDA 4TLQA 3V4IA 3PO5A 3SQ2A 3D45A 4H5NA 4MYUA 2QEXS 4YOUA 3GSIA 4ED8A 4NA3A 4DR7J 1DKGD 2NZTA 1XWLA 4NX9A 1VRQC 4DQIA 2K8GA 1YRTA 3R7BB 1O13A 4H0TB 3WDOA 5LOQA 4WXWA 3Q22A 1U2VB 2E5IA 1RT3A 1S9FA 4B9TA 4FM1A 1ZYQA 1RHMB 1NEEA 3O9QA 4AL5A 1KC8T 4DV6K 2HF3A 4DF4A 1B3TA 4GO7X 1X3MA 1VHFA 1CXUA 1QVGM 1NU0A 4F9OA 1KLNA 3OD2A 2BABA 1LNQA 4CGHA 1RSCA 3G71S 3KLGB 4I68A 3BYRA 3CJ1A 5F41A 4Z4GA 1FA0A 1J27A 3SAHA 4B1YB 3UIQA 1RTHB 3OYDA 2ASLA 2DNNA 3THWB 3TI0A 1SAZA 2IVFB 3CCEN 4YEAA 3ASMA 2XYPB 3U4LA 2NRZA 3QT8A 3MM7B 1H72C 3M8RA 4KH5A 5GAEP 2B0GA 2DNKA 3CJ8A 4KTWA 5J2NB 4JI3J 1R6YA 1U1PA 3HZGA 1F9FA 6FDRA 1WF0A 1FDAA 1YVFA 4OYIA 3OTBA 4E1MA 3W64A 3C7NA 1U4BA 4CIEA 3MPWA 3OTOJ 3TAMA 5AXMA 2C28A 1R89A 2BTFA 1M5OC 1SJQA 3PYEA 4KV8B 5I3UA 3JS9A 5KAKA 3M8WA 3SQGA 1M1GA 3K5PA 4P9SA 5A8WB 5AE1A 1FXDA 2W24A 5H1SQ 4O4GB 1X3NA 2PI4A 1G2EA 1YBAA 2JSXA 2YH1A 3MK6A 2OCEA 2ZNZA 3FSYA 3D0GE 4DV7F 4DBQA 3D0PA 1VBKA 4YY3F 4MK7A 3OL6A 1X1PA 2XEXA 2Q2RA 2Z1IA 4NYOA 1RBAA 4K25A 1SKUB 1T11A 3HULA 4A8QA 4CHOA 4DR6F 4B3TK 3ENVA 3UNGC 1RCHA 3B6BA 4HDHA 1RT3B 1U2VA 2ZM6F 3RR7A 4H03B 4FWMA 2FZKB 4I6YA 3TW0A 3CM6A 2LQ9A 1P8GA 1OJ4A 1F60B 1JLCA 4RW7A 1L3UA 2UVRA 4N7TA 1QTNB 1R6VA 3U1LA 4DQPA 3CD6N 1GH8A 1JIHA 1H2VZ 1S1XA 5L1IA 3NGUA 2HPUA 3MEDA 1S0VA 3LF0A 2O4IA 1T0TV 2GUIA 3T5KA 3OXFA 3AVNA 1UKUA 3Q8VA 3R5BA 4IG3B 3M6WA 3ZT4A 4ZVGA 2DFEA 2EW9A 1U8WA 3CFRA 2FY1A 4XO0A 3Q8SB 5KPRA 4MK8A 3QAUA 2DGUA 2C2EA 2HHXA 1F5BA 1SH3A 4J9QA 1JWWA 5LMUK 2EXUA 1BUXA 2R3VA 2O8EB 2G1DA 1NGCA 4XPEA 1HUXA 1U0HB 5GAHI 2J6SA 1S1WB 4CWBA 1VS3A 1GLFO 4M3UA 1DTQA 3MMBB 1HKCA 1RAOA 3S41A 1UVMA 2ZH4A 4CHZA 4FWRA 4BR9A 2FHKA 1ASVA 3ENAA 3IP0A 4KGMA 4LSNB 2F63A 4JD2B 4GVLA 2YHBA 4M8LA 3BF4A 2X78A 4RJVA 4I1TA 3J81U 2R7QA 3WNFA 1NGEA 2JHEA 3J8AA 3QINA 4C7QA 4JI6F 2QA2A 3MUTP 4QIWD 4AHVA 1WG5A 2ZM6K 3L7UA 1V5IB 2OHDA 2B4PA 1PAEX 1DTQB 4JRQA 4RUHA 2JL9A 3RMBA 4FJNA 5FRNA 1BQMA 3ULHA 5ITHA 3CQ8A 2X6NA 2RHSB 4GO5X 3TA1A 2JH3A 3AGRA 2V2KA 1UP1A 3BKFA 2CNKB 3M8PB 2E7XA 3OTCA 3NWGA 4CT9A 1VDHA 3BGOP 4BRIA 3D7EO 3DM2B 4HTIA 4Y2MA 2UP1A 2VPXB 4EGLA 3SPYA 2VJUA 3FLCO 3BSOA 2YI1A 2OYQA 3K0SA 3OYHA 2WVFA 1BE4A 2RS2A 3G8TA 1S76D 3DXKA 2CKWA 4JYAF 1LWCA 1YZ6A 4IR1A 1YJNS 3MN5A 2PYJA 4DV2J 2BE2A 1TKXB 3G82B 3MTJA 3E2EA 4YDXA 5HP1B 1VAZA 1TVRA 4KB1A 3AB2B 4GV3A 2RKIA 2BZ2A 1RYRA 1AZSB 4LVNP 1C1CA 1K1SA 3TR5A 3L3UA 2OZSA 4TY9A 2KJWA 1PKUA 4F4ZA 3GWCA 1NK5A 3UCGA 3V1OA 2CJ9A 5RUBA 1HPZA 1IBKK 2V50A 2DJWA 4I4BA 4KHRA 2DEIA 1HWLA 1FKAF 2DHSA 1AUDA 3P1GA 3NGTA 1VIXA 1C0UB 3VGKA 2R7OA 5F3ZA 3SMSA 1BHNA 1K73T 1BI4B 4JI1F 1QAXA 4K4TA 4CERA 3J7AP 3DOMB 4DV6J 2GHWA 4FK2A 4EHTA 2HBJA 1PGZA 2NLWA 2KXHA 2PC6A 2E5HA 3OQ2A 1GLAG 4DWIA 3C6TA 3FDSA 1PYSB 1SJRA 4DTMA 3DLKA 5J1PA 5F0UA 3NGYA 2HNYB 5FLXY 2CQ0A 4U7BA 4Z7CA 4MKAA 3N6MA 2GIFA 3P38A 1DTTA 3DLGB 5J2NA 3OJUA 3ENHA 3VESA 4X66K 2KM8C 3NGKA 4Y6IA 2KFNA 4CO2A 4IXCA 3MM7A 1EWQA 5BR8F 1U48A 3ILLA 5G0RB 2FYXA 3MMVA 4A5AA 3KLIB 3CMAN 4O0JA 4NOHA 3IFRA 2UUAJ 4OYOA 5FLXU 3OTOK 2HS0A 4P6QA 1S77D 4LH4A 1TKDA 5AJ3K 2M3DA 3UN2A 4K8RA 5F8IA 1B0VA 2QLBB 5HBMA 2VCPA 2DBBA 2K7KA 2OPPB 2E1YA 2KJVA 3I9ZA 4LFAF 1BCOA 3KNGA 4A8FA 1JJ2M 3DLLL 4CZHA 1RZMA 3VPZA 2OPRA 4LBHA 4KAZA 3Q2TC 1CSJA 3AFGA 1X7VA 2CQ4A 3VAHA 1AB8A 4H0OA 2LA6A 4MTPA 2A3JA 2H5JB 1B0TA 2ZHAA 1NJIT 3LP0A 3VQ6A 5CZ2A 2ZDPA 4D3HA 3C14A 2VIHA 4EO6A 3DLHA 4R25A 4HHHA 4IR9A 3IDHA 3QPIA 4ZTFA 2ERRA 1B92A 1VQKS 4JV5J 1XIQA 4C11A 4KGKA 1KAYA 5F8HA 3E3XA 4NCGA 2WTFA 4Y00A 5DM6L 3QT7A 4CF8A 2X3GA 4TSXA 1P6TA 2DEJA 1ZBFA 4JKAA 1Q1KA 4PXDA 5FDLB 1WJ9A 3UKUA 5C15A 3EKSA 4ZVSB 4YB1P 1URRA 3BY5A 1DQ8A 4JP8A 5AQGA 2HFZA 4FW1A 2Q36A 4NEZA 2RJZA 2P9SB 2W4PA 1C0FA 2QE5A 1I5OB 4GVEA 2JWLA 4ILRA 1Q8IA 3GG0A 4JV0A 1YLXA 3TR8A 3EE9A 2V0NA 5HRPA 3DXBA 3GPAA 4AHSA 1RTJA 2QMWA 4GMKA 3RU0A 5L1KA 3Q0AA 2XSFA 1GLBG 4CHNA 4M45A 3VWSA 3V6JA 2VGNA 2XLKA 3CT9A 1GTHA 2CQ2A 2YTCA 2DY9A 5IT9U 1JLGB 2XWYA 1VQKN 5CZXA 3ZFVA 5C2GA 2OH2A 1GX6A 5KFTA 3AARA 2DRDA 1NGAA 5KFJA 3MAHA 3B82A 1Y0HA 1YTAA 3BQ1A 5I3PA 4CZEA 1NAQA 4DTOA 2YNHB 1RBTA 3O3HA 2CJKA 4DV4K 3GIRA 3D0HE 3M8ZA 3OA9A 4AILC 3HX9A 2DNGA 4M3YA 1C0MA 4O44B 3ZTOA 2VQFJ 5LMNK 1YJ7A 1FO1A 4KBIA 2GC8A 4J91A 1FJEB 2QWOA 2ASDA 4TNOA 4K0KF 3MM9A 1S72S 2WW4A 3LDOA 3EN9A 5LL6d 4Y28C 4K50A 2AGPA 3MURP 3LQVA 4LBIA 4LH5A 2UXDF 3CC7N 1DQAA 3NAIA 1RWXB 4GKKK 3CMEN 4LF5K 5J2MA 1WNSA 3THYB 2QFJA 2OP5A 1GLEG 2W2PP 2ZZNA 4HUGA 1LWFA 2EFNA 2FY8A 3WQTA 2BV3A 3K2YA 3VQ8A 2I5JA 5HMZA 3M1FA 4ISGA 1X5OA 3M6GA 4B3SJ 4RW9B 4NZ0A 2YHAA 5KRTA 2BANA 5BRFA 1AROP 3AD9C 1BL3A 4RUAA 1HW9A 1VSMA 3OL8A 2XBPA 3NS7B 1EB0A 4JI6J 3VAMA 3EE8A 2LEBA 1D0EA 3LP1B 4ZVPB 3VAFA 1WUAA 2W6KA 5BR9A 3LALA 3DN9A 3IC1A 5BRDA 1HPMA 2GUPA 4YHHF 3B78A 3G10A 3MAQA 2WSCC 2AMCB 1FFGB 2MZ1A 3NAEA 7FDRA 3PTWA 2F4VK 1DARA 3CD0A 1VQNS 4CH1A 2ZH6A 4JI2F 4OJGA 4OLPA 1CBKA 1VLOA 1ITGA 1EETB 2DGOA 1RT6A 2RE1A 3V2UC 2QRRA 1WC5A 4LFBF 3O9UA 8RUCA 3OS2A 5LMUF 5KFHA 3OVSA 2G8VA 3LP0B 4NB4A 2AWZA 2RUSA 3NRBA 3ZSQA 4CZFA 2ETJA 4EU0A 3K9JA 4FNHA 2UVWA 4CJ4A 5D4NA 3K8WA 3DRXA 4KHPK 5CHIA 4LF5F 2MTLA 5GADP 1PO6A 1LW0B 1ROFA 2AJ4A 4A48A 2WVBA 3V6DB 4OZ2A 4A8MP 2CH6A 5F8NA 3I33A 1HLUA 2QL9B 2FBXA 3QGGA 3R5CA 4DUYJ 3MZIA 4E7LA 3LTOA 1NLKL 1Z25A 1VQOS 2FLNA 1EP4A 4P71A 3HSGA 3ZNJ1 2NLXA 1VQ8S 2UUBJ 2IGIA 4B8AB 3C19A 3I0SA 5AJ3J 3VAKA 6AT1B 4DSEA 5DQGA 3DYAA 1KP6A 4PG7A 5C12A 4JUZA 1MU2B 1OMSA 1H98A 5G0RA 1YJNN 3DGVA 3HZ6A 3ONQA 4F50A 5A0YB 1T95A 1SQGA 5L38A 1SQKA 1QE1B 1Z05A 4ZLJA 5ADXA 1Q8LA 4NYZA 1RT6B 2P9NB 4JKFA 3QLHA 5HMYA 4IRDA 4CK3A 4M3RA 1A5WA 2Z1JA 3GYXB 2BM1A 1RWUA 1UZHA 4O3RA 1QY7A 3BGLA 1VQLS 1CS4A 1XNQJ 3GTYX 4NMLA 1HNXK 3D66A 1RQ0A 5JUMA 5CYMB 2MKYA 2HHTA 1TL7A 3UCZP 1AW0A 2O8DB 5BN8A 3MCOA 1SZ2A 1RBRA 2XYHB 3M2UA 1KD1T 2ZH7A 1RTDA 3CDEA 1HYZA 5HRSA 5C10A 5CYQB 2ZJQL 4OX9F 2GQ2A 3KWGA 4FWPA 4C8LA 4OLAA 1YWXA 3HBTA 5FLXO 1K0VA 2E5LJ 1RT5B 3CC4N 2NRTA 1WF1A 4X4SA 4NA2A 2UUCF 4NLWA 4RW9A 2Y3YA 4IO9Q 2KZZA 1D09B 4PKGA 1RCXB 1SKRA 3N6LA 1U1QA 3MHYA 3R2CJ 4CHPA 3WNGA 3H2LA 1QSLA 3IGVA 3NG8A 2OTJS 1YIJN 1ULRA 1T7PA 4KTQA 3CQXA 2IA0A 5ADXH 1MMLA 3DXKB 1QJHA 2NRVA 2O01C 4HCBA 1O8BA 2DCUB 1SL0A 3I5AA 3OUYA 4OX9J 4ECXA 4B1ZA 1GT8A 3C6HA 5DG9A 4NYPA 4Y0WA 2OSRA 4UTGA 4QCLA 4MFBB 4MYTA 4DV4J 5CE3A 1IKWA 2P9IA 3GB0A 2OFGX 4OPAA 4WYBA 3HCXA 4EIAA 1GLDG 2FZGB 2R4FA 2DNOA 3Q8QB 2E4LA 3KVGA 4P2XA 4DMNA 4ED4A 3HYFA 2R7YA 3TTDA 3DOLA 5AQSA 2C3YA 3JSYA 4IG0A 4DPXA 2W25A 1XMQF 3N01A 2P9PA 3U8XA 3FGUA 1D4XA 5M2RA 1YUWA 3KKSA 3QGPA 4X4UA 3MPDA 1NMEB 4G1PA 2C3UA 2D0AA 4LSLA 4V19X 2YHXA 1RWWB 2CPHA 2I8EA 4QOTA 5AQJA 4HHJA 5J1EA 1SQFA 4BDPA 5M1FA 1U1NA 3T69A 2P9SA 1IJJA 4HVZA 2YX7A 4OJ1A 1C0GA 4X2BA 3G96A 1TMMA 1OY9A 4LR9A 1RT4B 5KG7A 1XMQK 1KR4A 2JX2A 3CB4A 2E20A 3QSIA 3ZX3A 4LF8K 4C8OA 2VQEF 3AJ2A 1X4BA 2MZQA 1RTDB 1KHVA 3X1LB 2FUG9 4JI8J 4ECVA 2ALYB 4QWEA 1TL7B 4YOEA 3PDNA 2DNQA 1Q9XA 4DR1F 1TKTA 1F2HA 4WYLA 2O8BB 1JLFB 2P9LB 2C3OA 2D74B 3VGUA 4W4MA 5ETVA 2LEAA 4PY5A 4LFAK 2V67A 1WUUA 3QFWA 4RW7B 5B0GA 3EL2A 3CCQS 2MZTA 3R1XA 2A2CA 1W7AA 5KFKA 1HNWK 3DJCA 1HI8A 3EZWA 2ZH3A 3VGLA 5BPMA 4E3SA 2R2SA 3ZZTA 1NSAA 3M30B 1TL1B 3RMAA 1F9EB 1YQHA 1N33K 4FS2A 4BRLA 1I3AA 2XC9A 2M88A 3HHEA 2XMWA 3AO4A 4OI6A 1MU2A 1T05B 1NGFA 1V4SA 4BRPA 2ZBCA 3AO3A 3BR9A 5AQVA 3D1HA 5BR8K 4QAGA 2W9AA 3G86A 1BO5O 4M5KA 1RBSA 4ICLA 2BDPA 1Q79A 5IT9Y 4MIAA 4UY85 4X64K 4KR0B 3GBTA 4CQ1A 3CXCM 1IBMK 1S49A 3N9UC 3ZSYA 2GTDA 2HQCA 3NH2A 4DL3A 1WBDA 4LC9B 5H9EJ 1HMVA 2QC3A 3MCNA 3GFZA 1UVJA 3ZZRA 1PCAA 3FMBA 4FYVB 2DNPA 1ZXOA 1F21A 1SS6A 3A5LC 2XQCA 3L2RA 5MLCQ 4LBPA 1R0CB 4M5LA 5E41A 2JC1A 3BEGB 4NLXA 2XI3A 3NNCA 3POTA 1QVGR 2MZSA 1M5VC 4CBUA 4HL9A 3T5JA 5HLFA 3F9KA 4O0NA 4CJQA 4DSLA 4OZLA 4OI4A 2BRLA 3BPDA 3WUHA 2IVOA 1RBLA 3NH0A 3P4IA 4OGEA 5GVQA 3VQAA 4ZP9A 3H5XA 4Y2CA 2IM0A 3CXCR 2DR6A 3R6GB 1HRHA 2Q66A 3EZ5A 2QJ3A 3WNEA 1BG3A 3M8QB 4A8KA 2OMLA 3KK3B 2P2CB 2UXCF 3RZAA 2CPDA 4PKHA 3NGZA 2GGPA 3DU5A 1ZAVA 3ATVA 4CEDA 3UCUP 2YWFA 4FWLA 5L39A 4NCBA 2J6TA 4ELUA 2IM3A 4FBTA 1GOCA 3IN5A 2F8EX 1HBOB 1FNXH 4KYZA 2CPFA 4M5NA 3CMES 2QL7B 2HMIA 4I9QA 4P2MA 2RHKA 5L1JA 5AQOA 1RT2A 2RN2A 2ATQA 4BREA 4CIFA 2K06A 1D9AA 2B56A 1A0OB 2J7UA 4M5MA 4U96A 4UUWA 1KCFA 2BJDA 3GE1A 3PEJA 1V3RA 3VEZA 4TXSA 3PX0A 2GIRA 2MJUA 2JNJA 2HVEA 2E88A 2CQCA 1FRKA 3M2RB 3SFGA 4YR0A 2QLWA 3IR6B 4IFVA 4A5BA 3SSSA 4KBOA 2HQIA 3DGPA 4C23A 3I5BA 4CYUB 3O6WA 4DFJA 4FYWB 5KFPA 4CZCA 1O0PA 2CJQA 2RDDA 2N4CA 4CGJA 4ZHRA 4L76A 4KFBB 2CZ9A 5EWFA 4OYBA 1HNZF 2QO3A 2KL8A 3DCAA 4Y1CA 3U9ZA 1YXQA 4N47A 4O44A 5A8KA 2KHCA 4OYMA 2Y1LB 4RW4A 3U1MA 1EQ0A 5E3RA 3IXQA 2DHXA 2HAFA 1QHAA 2D69A 2EC0A 4KHNA 1M90O 3U02A 4KHQA 1TELA 3ILOA 2NUHA 4U67Q 1U2CA 2FQQB 3T5LA 2IOCA 1GTEA 4NXMF 4J2AA 3R8YA 2X7IA 3JSBA 2KVQE 2W6LA 2RAQA 4NCAA 1K8AO 1XTZA 4JS4A 2KM8B 4K2XA 2G8HA 1RT5A 3EDQB 3WT0A 4GVMA 1HNWF 1ICEB 3DAWA 3M2VB 2YNFB 2RRNA 1F9HA 5HI7A 3HKWA 3DU6A 3DLRA 3L2UA 1X31C 2XM3A 1H74A 2IAJB 2R8GA 5IV3A 3CJTA 5DG7A 3OBYA 1KAZA 4LF8J 3W2WB 4RKUC 1WI6A 2XNRA 1UVKA 4ZLNA 2DH7A 5ETPA 1FE0A 1HNXF 3THXA 3VQBA 1KVBA 3FFIB 2G2YA 1YITS 4IZ9A 2HEKA 1N0UA 4F3OA 1JCEA 5AQLA 2GX8A 3JXOA 1FKPB 1XMOJ 4DQ8A 3B4DA 5CCMA 3T9ZA 2B4VA 4ZVOB 5DGAA 2EX3A 4LIRA 2E5JA 3BBBA 3O9TA 3N4PA 4A8XA 1N0VC 4NYNA 1XJWB 4CECA 5KG4A 4ECWA 2WONB 1IWGA 3KKRA 1DY3A 3HSZA 3MDFA 1B9DA 3UDCA 5ADZA 2VOOA 1SIZA 1SJFA 1KXPA 2OPRB 1T9XA 1Q7LB 4NXNJ 1FKOB 3NCQA 5GAGI 3VHQA 3V1RA 4C6AA 3T5HA 5EVZA 2I1RA 3HP6A 3SQGB 2ACMA 4ZKAA 3TAGA 1WKLA 3AA3A 2C3MA 1XN9A 3O44A 3FBBA 3TX8A 4X4RA 3SUPA 1R0AB 1JMTA 2HRYA 3PNIA 5KFCA 4DPOA 3R8EA 1X4AA 1F2GA 5KT5A 4CM2A 1S9EB 4E7HA 3BH6B 3ZC4A 3TVKA 2IS3A 4OFZA 3G8SA 3GFYA 4HTUA 4WTYA 3AQPA 3RMCA 4CEQA 4IDHA 4CT8A 5DG8A 4K0KK 2WRMA 3FCHA 4CFAA 1HYSA 3CFOA 4DXLA 2KRBA 1LFWA 2KT2A 4Q8FA 1KHWA 4BQLA 1D1UA 3FQLA 1IR2A 2IVMA 2E2QA 2FC8A 4ID8A 2ZE2B 2F9JA 2ZH9A 2ZD1B 1RDDA 4PG6A 4H4MB 4I6MB 4YQWA 2EFOA 2WCXA 2RF2B 1VMBA 3O8MA 1FKOA 1NHKL 3V9UA 1WEXA 1ZOTA 2MSTA 4KAIA 4WFXA 1C0UA 2JEJA 4ZN1A 2XTJP 1HNIB 4DV5F 2VICA 1E4GT 2NPFA 1KQKA 2XHBA 4TU7A 2RQCA 2ZVSA 3GCXP 3UO0A 3P45B 4CI6A 4DV0K 4W5OA 3AV9A 2XLJA 4KI4A 2P9EA 2WSEC 2Z0GA 2AD9A 4B1VA 2M8HA 1TKXA 3NEKA 4LD0A 3TWHA 1BQNB 4GC6A 3GR0A 1YJRA 3THXB 3CD5A 1PBAA 4BGAA 5DZ7A 1HQUB 3EVMA 3THYA 2NXCA 1U45A 3R7SB 5KFEA 4QYZJ 3T1HK 1YRXA 2JRSA 3WXIA 2BOAA 2MQNA 3R6LB 2UUBF 2IAJA 5JVGL 2XMJA 2MHEA 4O8KA 3ZT3A 3RBXA 2FIUA 5JVGQ 1RYSA 2CGLA 3H0PA 3E8OA 3QRRA 2F4FA 1Q8KA 2MQQA 3MCPA 3MEGA 4OI2A 1T02A 3O80A 4FO0A 2KYZA 2F7VA 3SYZA 2EK1A 1J5OA 4RW8B 1FF2A 3DNCA 1WSJA 3J81j 4NLPA 3JYTA 4UOGA 2UU9F 5AQHA 2YNGA 4A62A 4Y3CA 2QW9A 3FEZA 2LFVA 2P6TA 3UKRA 4DQQA 3AB4B 4B3SK 1RT1A 1IBKF 4K43A 2G8IA 4CO5A 1MNEA 2FSNA 2IJRA 1VIOA 4RG8A 3BBCA 3W66A 3HVAA 3QZ7A 3ZEUA 1UW9A 3KUHA 1FJGK 1BIUA 1UVNA 1D9FA 2QN6B 4CBWA 1NKCA 2VG5A 4OLOA 2ASJA 3EVOA 1XNRJ 3HF5A 4ZJOA 4FL9A 1QQNA 4OZNA 1FNMA 2H51B 2GJFA 5FDLA 4DR7K 3MDQA 3KZBA 4M5HA 2CJBA 3OTOF 4CFDA 3RW6A 1N5SA 4FJXA 3RSEA 4HYKA 2OEJA 3CQYA 2HVDA 5A8RA 3O4NA 3PKMA 2E6LA 4ZLPA 1D3WA 4LF7J 1HBUA 2HKEA 5D3GB 4CIGA 4FWSA 3GV8B 4W5RA 5DLGA 4ZVHA 1WAFA 4PG4A 3PYGA 2NQPA 1B0PA 4LT6A 3NFAA 3RAQA 1H1VA 1S0OA 3CC7S 3KK2B 1BLUA 1DBDA 3F2KA 2ZD1A 2C2KB 4K8XA 2M52A 4BROA 2DITA 4AH9A 2RQMA 2BJ3A 2B43A 5ETTA 4M5JA 5CD4H 3NGRA 1PILA 2GVZA 3MMAB 4MO5A 2JDJA 4PWUA 2OO4A 3QNNA 4B9NA 4GV6A 4ATNA 5B0BA 4OQJA 4J9OA 4CJ5A 1VJQA 2VWJA 5AQYA 4DX7A 3QDKA 3M8SA 1RWVB 2DGSA 1OSDA 3CCTA 4N77A 4J9MA 2A6OA 1HBMA 3CG7A 2G9OA 3TX0A 1HHSA 2I7NA 1VISA 2FHMA 4KHSA 2DGWA 2YKQA 3LPUA 4JI7K 3MEEA 4H5WA 3QT5A 1DHMA 1SPBP 4JS5A 3DLLQ 3MXHP 2EPIA 2X51A 3RG6A 2W9BA 1HMVB 4EK2A 1WELA 2OA8A 3D6RA 2KVIA 4NO7A 1JJCB 4AM6A 1A6LA 2AJFE 2H5IB 4KC5A 2YKAA 1ZBSA 2N3OA 5BPNA 1IG9A 4DG1A 1N5QA 1UAWA 5BYRA 1MWZA 1EHWA 2K1RB 2O67A 5IFMA 2Z4PA 1NGHA 3IAYA 2BH1A 4FK4A 3NF8A 2HF4A 2DR7A 1A5XA 4U7UK 1JNRB 3VVTA 3SDEB 4BQZA 5IC4B 1VQ6N 2PEHA 1ZZNA 5AZJB 4ZJLA 2G0JA 2GO8A 3A5MC 2LDIA 3NOGA 2ALZA 4CJUA 5HMXA 3AAWB 1TL3B 2XO7A 3L3CA 3MN9A 5J2PB 4CLWA 2RRBA 3TQ1A 4JKBA 1RI7A 1JL2A 3NH1A 4K4WA 4WCEQ 3IO1A 2ZDOA 4DL4A 3O9RA 3B6PA 2AJ1A 3D28A 4D3GA 2CVIA 2GCFA 2UU9J 3EXCX 1NDPA 2W4DA 1HARA 2R8HA 3KHHA 3I31A 2XY5A 1FJCA 3N5FA 3CTRA 4FJKA 3E1YA 4ZCKA 3DHXA 3F44A 1HI1A 4A8YA 3KJVA 1QQOA 4L75A 4F26A 2CGJA 4Z4FA 2F1FA 2XB2D 3PKYA 2B9EA 2M9KA 2XHWA 3EGWB 4G65A 3VGSA 1NMNA 3DHWC 4ZOSA 4L3NA 5DDOC 4A61A 4RBVA 2HHWA 1HQ2A 3CUNA 3SV3A 2UXDK 3HSJA 2SXLA 1GQEA 3M2VA 4I64A 3MR2A 3WXMB 2QWMA 1NPKA 3QERA 1Q8BA 1X5PA 5AQMA 3DWLA 1Q78A 5BPLA 1TK0A 1S1TB 1DLOA 4DR7F 5B0EA 1WEYA 1QTMA 2M4MA 4J90A 4B3RK 5KFVA 1N34K 1SI9A 4NZ7A 2ZWHA 3SCIE 1T9VA 4OIXA 3GCWP 5SWMA 2G8FA 4RNFA 2P9PB 3C46A 3LZIA 1RWNB 4ILGB 2V94A 1EWRA 4RUBA 2DFHA 3PW0A 3HJFA 3Q24A 2Y0SD 3KMQA 3CGIA 4RBTA 2HHHF 4KPYA 2DO0A 4E2FB 2VQEJ 5A2QU 1WC4A 2HNDB 3D67A 2QV6A 4DPTA 4F3MA 1KDNA 1YT3A 2B8QA 1VHIA 1A9NB 5D6GA 3M6XA 2UVVA 2OPSA 5DM6Q 2RU3A 4BG8A 1VQPN 2EEYA 4FF2A 1T3VA 5FIIA 5I9EB 1IVZA 5A6WA 3E66A 4PL8A 2KYXA 2IA6A 2XSJB 1N5YB 1PIEA 1NDCA 3KJVB 3MPUB 5CR4A 4PQUB 5HANA 2W2NP 3TARA 3HK2A 4N8NA 2VFSA 1OO0B 3A4TA 2OEMA 5D0GA 2HS4A 3FZBA 1NK7A 2A1SA 2MYFA 4OX9K 1FD2A 2VKZG 5EHHA 5KG0A 3QEPA 3QZ8A 1KRPA 5AQPA 2K2PA 1EXQA 3NS6A 3CCQN 2JFDA 4FWNA 2E1ZA 3HHLD 2QT7A 2AGQA 1ZM2A 1IJFB 4ALZA 3SI6A 1TK8A 4CJVA 1CLQA 3QO9B 4J9UE 2Q3PA 2YPZA 1Y3KA 1RAEB 2EFVA 2YKNA 3G87A 5A6PA 2DXEA 2Q0RA 1WOOA 4MKVA 3KG4A 1RTIB 4UOHA 3HZEA 4UT4A 3M8QA 4B1WB 3MN6A 4FPBA 4CD1A 1RAHB 3PW4A 4XDCA 4IO8A 4YOYA 4NA1A 2ASOA 4N76A 1FRIA 1FDBA 2K1RA 4AXIA 5DK5A 3P6YC 4ZPTR 3G2XA 1NGIA 4O23A 3KDNA 4DR1J 4Z0UA 4CO0A 1HNVA 2ZUGA 3QSYB 4Z7YA 4DLGA 3RAXA 4WP8A 2COLA 3D4JA 1S7HA 4OI0A 1U1LA 3HVTA 2W9CA 1P27B 5GAEI 3TPQA 2OLWA 2VD3A 3O1BA 2ZOGA 1QE1A 2MQOA 3OYEA 3AVJA 4DU4A 3NCPA 2G4BA 2HW3A 4ED1A 3FRYA 7AT1B 3H45C 2QWPA 1GLLO 4DFMA 4DTRA 1FWPA 2AT1B 2UXCJ 3TANA 3QRPA 2GVZB 3F56A 3ITHA 4CJPA 3AOBA 3SMPA 4XEIA 2JLFA 2BR0A 2YNIB 2PMZD 2E2NA 2EG1A 2VFTA 3OHAA 5DO2A 4BGBA 2VBZA 3PIOQ 2A18A 4E7KA 4QYRA 2AQ4A 4EFHA 5AQUA 3D2EB 3GFHA 3Q8PB 1JXLA 4NLBA 4F36A 4HHTA 1NJYA 4Y34A 3TEGA 2P51A 1JXEA 4DU1A 3DOKA 4NLRA 4R79A 1LWEA 2O3DA 1IKYA 2V8VA 4LF8F 3JSMB 3RTVA 1O51A 3K89A 1QAJA 2CZ4A 5D3GA 3OXLA 5C2CA 1GMUA 2CDRB 4RO0A 3J7ZT 3ZNUA 1M5PC 1H6KX 5DGBA 1DEJA 2O8BA 3IS9A 2B6AA 3WEEB 6FD1A 3CD7A 5CY4A 2MB0B 3R5JB 1FKPA 3ELHA 4KREA 2FJBB 2UU9K 5C2DA 4LRFA 4IJNA 1MMDA 3I56N 4BRDA 2OAUA 4IO9L 4RWTA 5LM7E 1QAYA 4DUYF 4X4NA 4TLRA 4RU2A 2DPIA 5EY4A 4ID5A 4A57A 5AQXA 4CZKA 2FF6A 3NE6A 1MN7A 1WSHA 3MM5A 3PJXA 2NRRA 2CA9A 3PFEA 3M05A 5DQHA 3MAAB 2QTWA 4AM7A 1G4CA 1BMQB 2E2PA 2DTUA 4F25A 4K7QA 3PFOA 2VQFK 3DRRB 4V19S 5LT5A 2VPZB 3A0IX 1WTBA 2ROEA 2AU0A 3NOCA 3UKRB 1RAGB 3CERA 2JZ5A 3LDPA 2RMLA 1OH8A 2XMKA 5TKYA 4CZLA 2VDHA 4H4KA 3BGUA 1ZBTA 2KTQA 5KQ8A 3JYTB 5ETRA 3IAS9 2WVEA 4DR5F 2V34A 3SCJE 3KMSA 1UW4A 3W9JA 2XZDB 2N82B 1MA9B 2F8MA 3PACA 2F96A 3QB0A 1SUQB 4IOCQ 3KK1A 4Y2AA 2FLLA 2FJEB 4ZPBA 2BKOA 3N28A 1QQCA 2D5RA 2QX0A 3SJHA 3ENQA 2XMVA 4CLPA 3FZKA 1N6QB 3C15A 1VQNN 4JI6K 3H4BA 1WI8A 4AHRA 1DGKN 3MXIA 3WIVA 1X9SA 3UPFA 3VQTA 1XNQF 1EKRA 1JCFA 4K41A 2XO6A 2RB7A 4JV5F 4USMA 4W5TA 4FCYA 4I2QA 4IFVB 3VTIA 1RGVA 3VQCA 3LL3A 1RAFB 1RWKB 1UA1A 4DUTA 4N8OA 4TU9A 4M94A 2LSNA 1Q18A 4A4JA 1NBWA 1VRTB 1UCNA 2CAJA 3MECB 3M6UA 4BRHA 3Q8YA 3DI6A 3FQKA 2EI5A 3LGHA 2IY5B 3I82A 1P8ZA 1RT2B 3PZPA 3O5BA 2B5JB 4GKKJ 2YQ0A 4LF5J 2XULA 1AFIA 1FRHA 4JI5K 1OY6A 4C48A 2E7WA 1RAAB 3W5ZA 2QWNA 1YJ9N 2RF2A 3V9SA 2HFSA 1JCGA 4Q43A 2H48B 2YHWA 1Y7PA 5EX0A 4F4XA 2PMHA 4IDKA 5HMWA 2GWJA 3FZ2A 3V5RA 3DRYA 1E6VA 3W9HA 4EFAC 3TEHB 2CQIA 4M5IA 4FVCA 1XERA 5BXIA 3PW7A 3VQ5A 4U67L 1NWKA 1FK9A 1CJVB 2D41A 3KLVA 4NI2B 2NR0A 2QG9B 3WC0A 3OYKA 4CO4A 4DLEA 3RRKA 2BMBA 2H9ZA 1O6XA 3TJ8A 4OYPA 3AY9A 3D3BJ 4LREA 1QLNA 3AA8A 1SVDA 4MMOA 5B8HA 2LCWA 5KGXA 2HZCA 1H3DA 2PYLA 5CZ1A 3NKYA 1YJ9S 3RW7A 1BA0A 5EGYA 2D1CA 1SBRA 3PRBA 2JEIA 3EMTA 2DGVA 3LM2A 3EM1A 4DPWA 4LF4F 2HZAA 4GKJF 3H1QA 1X5TA 2CPYA 2DD8S 4P7VA 4CESA 4WCEL 2XZTB 4LRBA 3TAFA 1U2FA 1M1KO 4LRDA 1U2RA 2HFUA 5T7LA 5HQMA 2EKNA 1HQEA 4KH0B 4OZJA 1NKBA 1X4EA 5G4DA 1F6TA 3LDNA 4JI3K 3NNAA 2KT3A 4WIIA 2DHHA 2DNLA 3GDQA 4FXWA 3P5TL 1HJRA 2QI2A 5SZTA 1EZZB 1Q82O 5LMNF 3ID6A 3NLCA 1E6VB 3NCIA 2FTRA 1MWMA 2NUBA 3OFGA 4IOXA 2E9ZA 3WXLA 3QEWA 3PSFA 4Q0BA 1HI0P 3BKTA 3CCLN 1WB9A 1WSRA 4HI2A 2BQ3A 1Q86O 4FJMA 2HQGA 4DU8A 2BACA 4PCQA 4DSFA 4WFNL 2GVDA 3LM9A 2XNQA 2ZZMA 5AR0A 4B3TJ 1B7YB 4WWSA 4ED7A 3THVA 2X1AA 2MGZA 1QVFR 3C6UB 3TYTA 4FWQA 1XNQK 3OBIA 3CJ7A 1MMNA 3I4PA 4JI0J 4HT5A 3MFHA 2MJNA 5HQLA 2UUCJ 3VEWA 3VETA 1LK7A 4I2QB 1X4GA 3LO3A 2CNOB 1RE1B 3O5TB 1IXKA 4B1XB 3CJ2A 3G9CA 4BS2A 3W7BA 4HKQA 4HH0A 4EHUA 3T19A 4NLDA 5JMNA 3M8PA 3AVAA 4KIAA 4CF9A 1WTFA 3VALA 5KTQA 4O3SA 1S72N 3GJSB 4AYBD 2YCHA 1QZ5A 1WKKA 3KKFA 1WDTA 4JKGA 1FXLA 4JKHA 4JKGB 2J0SD 3FCVA 1S0NA 4DR4K 2W42A 4E19A 4IFYA 4MH8A 2BJ8A 4WP9A 4HEA9 1JK9B 3CPWM 4BRKA 3SFUA 2PDAA 2J0QD 4QQBA 5KT3A 2P9GA 3BKUA 3RBDA 1TL5A 1U6ZA 1IO2A 3A13A 4CLUA 2PD1A 2V4RA 2NREA 1BIZA 4PL7A 1YI2S 2AEMA 3EPGA 3H08A 4JHDB 3IKMA 1RAJA 4EBEA 3K0JA 5E2QA 2HRUA 4ILJA 4CJRA 4DX8H 4I0WA 2HGMA 4DFKA 3I56S 1HD1A 5JVHL 4KHWA 3LH2S 1K9MT 4ZN3A 2ZM6J 2UYTA 3BYPA 4I56A 2CNLB 4Z4EA 5CABA 3Q83A 1N8RO 4URSA 2J9EA 2XG8A 1CG2A 3KJFB 4PXBA 2O8CA 1SH2A 4ISFA 4ELTA 4BRQA 3G71N 3GV5B 3J80U 3ICLA 4NLCA 4CVNE 3PHEA 5B7WA 5DDPC 2BUNA 2CJXB 4M5DA 3MMJA 4NCGB 2WAQD 2FZCB 4F7VA 3NL0A 5K5MA 4I2PA 2MQLA 2BA9A 4L72B 5KFSA 3C0BA 2LU2A 1Q7YT 2A10A 5KRSA 2B6AB 1BWVA 4KPCA 3CCUN 5GIOA 1JLQA 3MEDB 3B6OA 5BR8J 7FD1A 1S6QA 4OLBA 2KT5A 3HXMA 5KQDA 4DTPA 1NGJA 4ZCMA 1NZ8A 2CH5A 5F8MA 2PN6A 5J2PA 2OUGA 2NPIA 4LRCA 3CDBA 1L5UA 1OS5A 3EVWA 1TL3A 3DOKB 2GW8A 4Q2MA 4JKCA 3ZETA 4Z4IA 3R5GA 9ATCB 2Z2LA 2A3ZA 5T41A 1D5AA 3VEOA 1B70B 3H90A 3W61A 2FJDB 4QIEA 4DR2F 4FJGA 3SDEA 4I67A 4J2BA 4NLYA 3OVAA 2E9RX 1VQON 4H4OB 4ICLB 3BREA 2BBEA 3I0SB 1WF2A 2VWKA 2ITMA 3WC2A 4DG1B 3HRGA 2Z8QA 4WZMA 5KOXA 4BG9A 1REGX 2H5EA 1T05A 4O55A 2G0IA 2KG1A 5I3UB 3M9OB 3TUJC 3ENWA 4H8KA 3F5TA 1NM1A 2DNMA 2I7PA 3CD6S 2BUPA 3C7NB 1FEEA 1ILYA 2WC9A 1GOBA 2WVDA 4J37A 3MOZA 1XNRF 3DLGA 3BZQA 3PIPQ 2VU5A 5HVGA 2HZVA 2G1HA 1RU1A 2BJ7A 2MLYA 2PA8D 3MD3A 3KHRA 4CDIA 1Z26A 1LOUA 2IHR1 1EJ7L 3PO4A 2HOEA 3A8YA 3LZJA 1BQXA 2F9DA 2OD6A 3D5MA 1I94K 1YG0A 1BWFO 4H5VA 3CCZA 4AUKA 5KT4A 1G6BA 5CA5A 1GK8A 3H4DA 1NK6A 2GS8A 1N32K 4AHUA 3BR8A 1T9UA 2NYIA 1EARA 1M90T 4FJHA 2NYHA 1RWOB 3FRZA 1WSEA 4FJLA 3E01A 2GJ2A 3UE2A 5K20B 4PA1A 2F9TA 5FD1A 1WOSA 4BRNA 4JI3F 5E33A 3NMAA 3O3GA 4N56A 4DR2K 2BX6A 3C3LA 3LAMA 2F7TA 4U95A 4PEOA 2RKIB 5U47A 1TVRB 3KIOA 4JK7A 4RWXA 2Z1HA 2X1FA 1JB0C 1C4CA 4YHHJ 4KT0C 2P6SA 1GAOA 4OV1A 4YP3A 3GFXA 5E5NA 4J2DA 2DK2A 4F67A 1VBXA 3D2FA 2YJFA 4W5QA 3CJRA 3FR0A 4KHUA 3SBTA 3M5RA 4UY8O 2W2QP 1YGYA 1RHJB 1NJZA 4X4QA 3AAPA 2UV8G 2Q1NA 2ZGYA 3SQ4A 3TQEA 3BJYA 4JI0F 2E5GA 1RABB 1IR0A 4O3QA 1WC3A 1QSSA 4CLYA 2IIHA 1IKWB 1X9MA 2LXFA 1IKXA 3TZZA 5HL7Q 3EGZA 4BCAA 2IYIA 2E6MA 3ZEUB 1PSDA 4X66F 3S7RA 1NO8A 4DV5J 3RR8A 3K8VA 3NVMA 3TVZA 1WDDA 1J5EF 3GIIA 1UWAA 2P8IA 1MLAA 3RB3A 3PIOL 5K8PA 1J9AA 3UNYA 2VL1A 4JYAJ 1KWMA 3W3DA 2FHJA 4CEEA 1ZBHA 3TZYA 3I0RA 2GIQA 4QIFA 5B09A 4DMZA 2A41A 2E1RA 2DB1A 3CF5Q 2YKOA 3D6HB 5H9FK 1FRJA 5IT4A 2ADBA 5FPNA 1ZTWA 1VOMA 3IFEA 4QS8A 1XMOK 1L3TA 3QNOA 1NDKA 4UW2A 1RILA 3PVXA 1KONA 2HK3A 4KTZA 3ZZOA 2XCPA 2D3O1 4ID5B 4ED6A 3AO1A 3MUVP 3BGRB 3J7YP 4IG3A 5HSPA 4JI5F 3LWLA 1HQUA 3PHTA 2HVZA 3M7VA 2GO9A 1BU6O 2LDYA 4RLEA 2R9LA 3W3SA 2UUBK 4QWDA 4K4SA 4YR3A 4OMFG 1XQIA 4EAHD 2PFUA 5HATA 4ED3A 2KHOA 3IS9B 2VQEK 1U24A 4Q5VA 1UEUA 2AW0A 2EFQA 2F40A 3C14B 5IWAJ 3A5NC 4CLZA 3CDWA 3AO2A 5HVHA 1BD6A 4ECQA 1WHYA 1S1UA 1IKYB 1FT8A 3I5CA 4X65J 4TYAA 3TAPA 4HUFA 4FZVA 1DT9A 2LQ5A 4UF4A 4B8CA 3OY9A 4FF3A 1FW6A 4HI1A 4Q45A 5H1SV 4P7TA 4O5FA 5A8WA 3CJ0A 2NCKL 4CJWA 4CGFA 2CPEA 2F8TA 4GW6A 1WSVA 2R2UA 5FJ4A 1UVIA 3AVBA 1HNXJ 1YSJA 1S6PB 3AA9A 3RB6A 3QMQA 4KI6A 2WTUA 3VQEA 4RR5A 3EWGA 2DNHA 2GEMA 3H25A 1SB6A 4LF4K 2HQDA 5IT9O 1FJGF 4RU9A 4X62F 2Q97A 4M1KA 4LR7A 2JWKA 2XMTA 3O08A 3OPKA 3VGTA 4OO1J 3SNNA 5DLFA 4JOUA 2EBGA 2R8KA 4U7CA 1VC6A 2ZC4A 4YORA 4IRCA 2VFRA 2OSQA 4OHZA 3R9PA 1W0HA 1BXNA 3R2DJ 4Z4CA 4FXVA 1I94J 2HURA 2VG7A 1UVLA 2W7AA 1U25A 4FJIA 1ZAWA 4PYAA 2WZ1A 2VQFF 3KK2A 1MW7A 4P2SA 1HYVA 1JJ2R 3F9MA 3ZSVA 2Y0BB 1WNEA 2ADCA 1BI4A 2KHDA 2E2OA 1K8KB 5AQIA 1P1LA 4CGDA 2KFYA 4X4OA 1X60A 2ZBPA 4CJTA 4OPJA 3FZLA 3DRPB 1X4FA 5ETQA 4HR2A 2FD2A 1FVQA 1RDUA 3MECA 5EWGA 2H54B 3KUGA 1C1BB 5A2QO 3RVCA 2UXCK 4CLTA 2JVRA 1LK5A 3GV7B 3FKBA 3VQSA 5DZ6A 1Y5IB 2V5HG 3EGVA 1RBUA 3M9NB 4YHHK 4JLHA 1FERA 3HMJG 1U8SA 4PKDB 1UTAA 3QESA 5J2MB 2LEPA 1T03B 5LSOA 1LV5A 2VJVA 1SCJB 3W2VB 3UR0A 3DM2A 4PAAA 5LJVA 4PWDA 4RNNA 2RE2A 3FSXA 4LFCK 2ZBQA 2FLPA 4ZPCA 1S57A 2HK2A 2IRYA 4XH1A 2B7CB 3EKUA 3G6EN 2A1RA 3QIOA 2E5LK 2V6AA 2NNWA 4C3MA 1IBLJ 5J2QB 3W5YA 4BVOA 1OYEA 2EFGA 1JKHB 3WHIA 3W8GA 2CWXA 3C16B 2DVIA 3BH7B 2ASPA 3THPA 4GMJB 1CJKA 4CFCA 2D7SA 1JLEA 2VZ9A 1W2BR 4PPDA 1OSCA 4TY8A 2CDQA 4IOAL 3HHLC 3FUYA 1QQMA 2AYGA 1HLWA 2C3PA 3HDSA 4ETZA 4BBYA 2VOPA 2J8AA 4JB8B 3MR6A 4HACB 1IQZA 1QS4A 3SEOA 2Q0UA 3LPEA 4XH4A 4DCPB 1Y5LB 3SAGA 3US5A 4DB3A 4LFAJ 2MY7A 2VHGA 1ZBUA 4DV7J 1N8RT 2PIIA 1EO1A 4NEYA 4O3NA 2CPZA 1XHZA 5LJ5Y 3QBCA 2HGLA 2E8AA 4WKYA 2ZBRA 1S97A 5EX5A 2ZITA 1UWBA 3W2VA 2Z30B 5KFMA 8ATCB 3PW2A 1T6DA 2HBMA 4IH5A 2KXFA 1VHXA 5AQZA 2EC2A 3G8QA 3P8BB 4ZS6A 3FCWA 1VRUA 1SH0A 2KI2A 3UB5A 2LP4A 1BGXT 3PJWA 2P5VA 2FGOA 3I9V9 1RWPB 2H1YA 4C8NA 4R5PB 3HL8A 2RIJA 2KKHA 4KHMA 3D7SB 1YHQN 4IKAA 1HWIA 1CXQA 4NWBA 4IUFA 2ASMA 3QRQA 1RJJA 4A46A 1VBYA 1Y97A 4OJHA 1RA6A 4Y2IA 4KO0B 2H3EB 3MM6B 2YY3A 4NLQA 3LDLA 3HLUA 1FFWB 2HVIA 3FVYA 4F4KA 4DZ6A 3DC2A 1KBRA 4USIA 1YJWS 2FHJD 1NOZA 3CHWA 3OR1A 5HROB 1QDUB 5A76A 5J1NA 4FOEA 1K8AT 4LFBJ 3DLBA 3JQKA 4FP9A 5HL7L 4G1QA 4DQRA 2YX6A 2RRAA 5LJ3Y 3HO1A 4EWTA 1TTHB 3WNHA 1W97L 1WKJA 2FB0A 2HG4A 4K4VA 1VYAA 5F8GA 1YHQS 1M5SA 3H1VX 2I38A 2O8FB 3MMCB 5HLFB 1X4CA 1TAUA 4KV8A 3QFHA 1TUVA 4AT1B 3HOSA 4DZDA 3A8EA 3ENOA 4Y65A 4JAXA 3F41A 2W4CA 3MEEB 3SK3A 3JTPA 2DRAA 1MSWD 1Q5VA 2HLTA 3AHPA 1HKAA 3TUPA 1LAVA 4FWOA 2LU1A 4ZVRB 5D0HA 1N33J 4PWWA 4OKJA 2KFZA 3UVJA 2IJNA 2ZOMA 3GSDA 2Z56B 4ILMA 3EY1A 4H0VB 1VQ4N 2PE8A 1Q82T 4DPYA 2LA4A 2YXLA 3PYDA 4ZPDA 2IVYA 2WOMA 3HT0A 2XS7A 4JN4A 4G1QB 1M1HA 4X64J 2C2NA 2MSSA 2A2DA 4F02A 3E9PA 2IPOB 2KN4A 4USTA 2WONA 4BDZA 4LR8A 5HROA 2YKNB 3NF9A 2YKMB 2OTJN 4E1JA 4ISEA 4DU3A 3OYLA 5GADU 4L73A 4EI2A 1ZBLA 1N4LA 3UD5A 3VF6A 2BXJA 5AJ3F 3IBCB 4DV3K 1YBUA 5HP1A 4YB7A 2BJEA 4JV5K 2HMPA 1HBUB 3ULEA 4ES2A 4DTJA 2QIFA 1BWEA 1JLFA 4M63C 3MUMP 2V4QA 4FVUA 4C0BA 3HPHA 5D0RA 1AFJA 1X8DA 3DXMA 1ZTTA 4CE9A 2DGTA 3QIPB 2J9CA 4WQ4A 2AX1A 4NLVA 5F2RA 5FRMA 1VRUB 4DX5A 2QTDA 3AGKA 1S3XA 4IYQA 2E9TA 3VQ9A 1UWBB 1RT4A 1FVSA 1N36K 2D0PA 4FS1A 1KOHA 1PBUA 4MLEA 3UD3P 2HNDA 2AP6A 4YUDA 5KGWA 1P9QC 1R27B 2HBQB 4DKWA 3CJQA 4EBCA 3AO5A 1XEZA 4WU3A 2NRXA 3EE3A 5KFXA 2BE7D 1XHXA 4QU6A 1Q7YO 1RT1B 1JLBB 4ZIVA 2D4WA 3W9IA 3MR5A 1QSYA 3J7YU 3L7OA 4QW9A 4QU7A 1WC6A 1N36F 4MLHA 2DFFA 3KHLA 3TO8A 1XMBA 2W8KA 4LFCF 3EYZA 5AQRA 5LMNJ 1ELOA 1JKHA 5D8HB 2HHQA 3RRGA 1S1WA 2CRLA 4K4UA 4B3RJ 2MXYA 3H46O 3MEGB 2P9IB 3CCVS 3W62A 4NYFA 3PV8A 4O4RA 3W5XA 4LF9K 1URNA 4KB7A 5EN1A 4QS7A 1YF5L 2VFUA 3OTDA 2IYGA 4PWDB 4BR2A 1YJUA 3TA2A 1UFLA 3LDQA 4JI1K 2A6MA 3VQDA 3JAMY 3MCMA 2Z2ZA 2UUCK 3DXMB 2CG4A 2R2RA 3CYMA 5AE2A 2D3ZA 2MQ8A 5D4OA 1FFSB 3OYAA 1KQSR 1S1XB 1FEHA 1E3MA 4USHA 2D3UA 4IEEA 4L6V3 4ECRA 4YOVA 1I51B 1KKHA 3CCSS 1HWUA 3CCRS 5KPZA 2L9WA 1L3SA 3W63A 1WLJA 3MWTA 3SV4A 2QMXA 1K8KA 3KK3A 3D6MB 3HD1A 2YHYA 3I87A 1XR7A 2LMIA 4RCHA 2YWKA 3ZO7A 5CYMA 3MXMA 5I4MA 2EHGA 1RHRB 1MWYA 3G6YA 1R8PA 1S5JA 5DM7L 3TU5A 4USVA 2IMOA 5SUHA 4KB0A 3AVKA 3VERA 3OFFA 3SUNA 2B8PA 2W9BB 1HYSB 2CYYA 2CQ3A 3BSCA 3Q23A 2XYGB 4FKXA 1K73O 2MDAA 1N32F 4IH7A 4LF9F 5JVHQ 4CK1A 4CJEA 4DL6A 4LF6F 4LRAA 1TYQB 2HHSA 4WF9L 2D0CA 1RU2A