2ZD1A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase/inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 159
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2zd1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2zd1A05
2E9ZA 1S48A 4CGIA 3JSMB 2QXFA 4CJ4A 1CXQA 2D3UA 3I0RA 3RB6A 4CF9A 1TP7A 4H4MB 3KOAA 4N41A 1D9DA 4CJKA 5HLFB 3F9KA 4E7LA 4GW6A 2WOMB 2J6SA 3DI6A 4DL6A 5HROA 2XI3A 4CEQA 4CF8A 2PY5A 1HNVB 5KTQA 1IKWB 3NF8A 4BDZA 4E89A 1CZBA 4BACA 4RUAA 3LZIA 2B6AA 1WSGA 3L2VA 4OJRA 4NRTA 4K4VA 4NLRA 1RBUA 3KMSA 5DQIA 4E19A 2F8SA 5DQGA 1S9GA 4WFZA 5T7BA 4ED8A 4OGEA 1TKTA 2RN2A 4QAGA 4OPKA 4J9MA 3SUNA 1S5JA 5J2QB 1FKOB 4WXOA 4MIBA 4FK0A 2EHGA 3MXIA 5I3UA 3LWMA 1RTDA 4F4WA 4KHRA 4ZHRA 2FLNA 3NGIA 4ZHRB 2AWZA 4TLRA 3NF9A 3K58A 2HMIA 2AGQA 4O3SA 4FS2A 1ASVA 4KTWA 1U48A 3G6YA 3IS9B 5JS1A 3TAFA 1S6QA 2HHTA 3IS9A 1RDCA 2VG7A 2PYLA 3WNHA 4DQQA 3GQCA 3DYAB 1T3NA 4KKOB 1NOZA 1S1TA 3HVTB 5KFSA 5F8JA 5F8NA 3V81B 4HUFA 3RMBA 1IM4A 3TQ1A 3AO2A 3NGDA 3PV8A 3PHEA 3DLEA 4O0JA 4FJKA 2XY8A 1EP4A 2QK9A 1IKXA 3AA4A 1QE1A 4CGFA 3CDWA 3ZT2A 1QE1B 4EZ9A 3AVGA 1GX6A 1L3SA 1HMVA 3G86A 3RTVA 3SZ2A 5C24B 4ICLA 4W5OA 4RW9A 4AH9A 4KREA 2UVUA 4Z4CA 1TKZB 2D41A 4CEBA 3V9UA 1Y97A 1JLQA 3QNOA 3M8RA 3ZSRA 3O4QA 3QGIA 3MEGB 3MXMA 3T19A 2Y1IA 5L1KA 1A5XA 3FQKA 1LWCA 1KSPA 4DFPA 4FJ5A 2E4LA 1HQEA 3K5LA 4Y1CA 4AHVA 1DTQB 1JLGB 4IH6A 2E9RX 1S1UA 5CZ2A 1HPZA 1ASWA 1S9GB 3I0SB 1GOCA 3HVRA 1LW0A 2C28A 4M95A 5C42A 3KK1B 2F8EX 3MR6A 3WNEA 1K1QA 3M8SA 2I5JA 2O5DA 4CJLA 1S10A 3DLKB 4W5NA 2ASJA 1REVA 1BGXT 1B9DA 4ZVHA 3D45A 5HLFA 3SQ4A 5KG4A 1FXXA 2HNYB 5J2PB 4M3WA 1VRUA 2KTQA 2OH2A 4K4UA 1ASUA 2HNDA 3TAEA 4YR2A 2HB5A 3SUOA 4MK9A 3AVAA 2OPSA 1ZBFA 4KBIA 4JV2A 1C1BB 3VQSA 3SV4A 3KLGB 1VSFA 3VQBA 4YFUA 3DRRA 1UA1A 4MFBB 3V9SA 2R8GA 3NKYA 1NK5A 1S9EA 3V6JA 3DOLB 3ISND 4I2PA 3NF6A 1HYZA 1ZBHA 5DLGA 1NK0A 4N5SA 1A5WA 4LSNA 4RW9B 4BE1A 3IGVA 4NLYA 3DRSB 5KFEA 1IO2A 2AQ4A 3LDSA 1Q9XA 3RAXA 4ECUA 3OYCA 1JKHB 3AVMA 2BANB 1WNSA 4DFKA 1A5VA 4G1QA 4CEAA 4DL2A 2W9AA 3NCIA 1DTQA 3CJ0A 2FLPA 3I5BA 5KFVA 3LP0B 1N5YA 1U04A 2HWHA 5KFWA 4H4OA 3KLHA 4CFDA 4URSA 3BDPA 2VWJA 3AVHA 3BGRA 3Q8PB 4FLZA 4NLVA 3ZT3A 4CIEA 3ZCMA 4F4ZA 4FJ8A 1BISA 3V9ZA 2P51A 4DLEA 1BQMA 4KI4A 3ZSOA 3RRHA 4MQ3A 2V9WA 3JYTB 2FBXA 3SV3A 1JLAA 1REVB 1CZ9A 4LD0A 1HYVA 3TAGA 1NKCA 3MEGA 1NJWA 4HCCA 5F8MA 3HM9A 4DTMA 5DG8A 3OL8A 2FJVA 1I39A 4L8RB 2Z1JA 1LWFA 3OYHA 3T1AA 4PUOA 2GIQA 2OPSB 1EKEA 2FVPA 4EBDA 4KTZA 4CJ3A 5JS2A 2XCAA 4YR3A 3BSAA 1TL1A 1RT1A 2ASLA 3RMDA 4ZP8A 4IFVB 4AHUA 4BWMA 4FBTA 3VQ4A 3V6HA 4TYAA 2W8LA 4M3RA 1RBSA 3V6DA 2F96A 2WONB 3KHHA 1L5UA 2J6UA 1KHWA 2WB4A 2VA2A 1D5AA 4OKEA 3BREA 1VSKA 1YVUA 1N56A 2ILZA 4FW1A 5L9XA 3OYIA 5K14B 2AGPA 3S9HA 2HVIA 2JEIA 3AO1A 2JC1A 3M8QA 1F21A 2D0BA 3RR7A 4Q8EA 4FYDA 2WOMA 4QOZB 4W5QA 3VQCA 3AV9A 1LWEB 4LH5A 4CJEA 4KPYA 4FJHA 4TY9A 2Y1JA 3SQ0A 4IG0A 4RW6B 2XHBA 3C94A 4KO0A 4CJFA 4RW6A 1LW2A 4IR1A 3KK2B 3E51A 3K2PA 1S6PB 1HRHA 4O4GB 3NAIA 5KGXA 1J9AA 2BE2B 3NH2A 1SH2A 4JRPA 1BQMB 2BRLA 3C6UB 3V1RA 1FKOA 1NNDA 4WYLA 3TR8A 3TANA 2X6SA 3PO5A 5KFKA 4ED7A 2HHWA 3KK3A 3H5YA 1DTTA 2JEJA 1EETB 4XIUA 1TAQA 4ZVEA 4RU9A 2ITGA 4O44A 4EZ6A 2XGPA 1HNIA 3AVBA 4ZTJA 4GVMA 4NYZA 3HL8A 5F8GA 3SPZA 2YKMB 1L3VA 3OYNA 3LANA 3CYMA 4YR0A 3DYAA 2BQRA 1TL1B 3LP0A 4OLBA 1YT3A 5KT3A 2PYJA 1TV6B 4I2QA 3I0SA 1N6QB 2OPQA 4FJ7A 3RBEA 4F4KA 3S3MA 4EYHB 3KLIA 3FRZA 1EP4B 4NLUA 2X6NA 3HPHA 4EP5A 4GC7A 3EPGA 2VG5A 3BSOA 3CQ8A 1HJRA 2AU0A 4H8KA 4O0IA 3T5KA 4DLGA 4LQ3A 3CDEA 4PWDA 1SH0A 5HBMB 4DMNA 4CECA 4ZPDA 1WSIA 2DY4A 2XI2A 2EX3A 4XPCA 4B8AB 2ZD1B 3DMJA 3N6NA 2O4IA 1IKWA 3PO4A 1S0OA 3OL9A 3EPIA 4FJJA 3OL6A 1C1AA 2FLLA 1T7PA 3T5HA 4AHSA 2XO7A 5KFZA 3FFIB 4IDKA 1JLEB 1C1BA 2ATQA 3CFRA 3MEEB 2IM1A 4DF8A 2BGGA 5CZ1A 3TAMA 4B9TA 2ASDA 3TAMB 3L2RA 2RKIB 3QIPB 4F4XA 3HJFA 2JC0A 3CJ2A 3NHGA 5I3UB 5KG5A 3L2QA 1RDRA 3O3GA 2WRMA 4I7FA 4ED2A 1S1VB 4QWEA 4CIGA 2AX0A 4CEOA 1FKPB 2JEFA 4H54A 4CEDA 3QESA 2NUBA 1ZBLA 4IKAA 2B4JA 4IOBA 4F4YA 4B9SA 3CG7A 3NBPA 3OHBA 3SCXA 3NBPB 4B08A 2HHXA 5EWFA 4IRKA 4ECRA 1VSJA 1J53A 4ED0A 3CIZA 1IKXB 3Q8QB 2FVSA 3DDKA 3QNNA 4Y2AA 4ZPAA 2G8HA 4M94A 4Y2CA 5D3GA 2IMWP 5KT6A 3ALYA 1TKZA 3OYBA 4HVJA 4XO0A 3SNNA 3OYJA 3ICLA 2B43A 5L1LA 1SH3A 3NH1A 3DRSA 4AILC 2YNIA 2YNFB 3N6MA 3LP1A 3NMAA 4AHTA 4YQWA 4TY8A 3WNGA 1LWFB 4KE5A 2D7SA 2IA6A 1JKHA 4E1NA 4NYNA 4DU1A 4TQSA 4IDKB 4HYKA 5DG7A 3SJJA 3PUFA 5J1EB 1HQEB 1S49A 3K5MA 4K50A 4J9KA 5FROA 4DTSA 2VG6B 3KLFA 1QHTA 1XC9A 4E3SA 4LSLA 3KD5E 3O3HA 4DWIA 1HARA 3CWJA 3AVNA 4FW2A 4O3RA 4X2BA 3AO3A 3B6PA 4J9SA 4C8OA 5F8IA 3HHKA 4WFYA 2V4RA 2BRKA 4IRDA 1VSHA 3BJYA 4EO6A 1JLBB 1BQNA 2ZD1A 2XGQA 4RNMA 1LWEA 1VRTA 3OYLA 1KTQA 4WZQA 4FJLA 4KKOA 1Z26A 1KFDA 4OLAA 5KGWA 4TYBA 4G3IA 2X78A 1S1TB 2IC3A 3TWHA 3SYZA 4C8KA 4DS4A 3DLGA 1S6PA 5HRNA 3DRRB 4FCYA 1RT1B 1ZBUA 5L1JA 3HSTB 4FK2A 1RT7B 4OKJA 4FZYA 2HWIA 3BR9A 1TKTB 4NCGA 5FRMA 1UOCA 4KHNA 4AHRA 1S9EB 2OPPA 3ZSZA 4CERA 4XPEA 4QWBA 1NK6A 4EO8A 3KHLA 3TVKA 4ZP6A 3OSNA 5KFBA 1NHUA 4ED1A 1VSIA 1JLQB 4O3NA 2C2DA 2C22A 2PZSA 3ZSVA 5KFIA 1WAJA 2IJNA 4HKQA 3ZT1A 4MKBA 1UWBB 2G8VA 1RBTA 4G1QB 1S6QB 3UPFA 4ECWA 1UAXA 3OSPA 3RBDA 3TABA 4J9QA 1T05A 3ASMA 5L1IA 5KFYA 1T05B 3EZUA 4FJMA 3QO9B 3NGZA 4CGHA 1KFSA 5KG1A 3T5LA 2FJWA 1DLOB 2KZZA 4JV1A 4NLXA 3OL7A 2KQ2A 5DK5A 2QKKA 2YHBA 3VA0A 1Q9YA 4FZXC 3LAMA 3IAYA 1JLCB 3PZPA 1BL3A 5D3GB 5DMRA 4CK1A 4J2AA 4IFYA 1S1XA 4H4MA 1S1XB 1NJYA 1TK0A 5J2PA 4U7CA 4QPXA 1D9FA 3ZT0A 2YKNA 4M45A 1TGOA 3V9WA 3OYDA 3OS1A 5KRSA 1QTMA 4NRUA 4ED6A 3KNAA 2RDJA 1KRPA 1LWCB 4CHNA 4B9VA 2W9BB 1YVFA 1KVAA 2YNHB 3SFGA 1U45A 3DLGB 4Y1DA 4DTPA 4BWJA 3U6FA 4R0EA 3S3NA 2GBZA 1XWLA 1S1UB 4DF4A 3RR8A 3H5UA 4I9QA 2WK4A 2I5JB 4K8XA 4JLHA 3KIOA 3BQ2A 2RPIA 5HP1B 2R7YA 3V1OA 4CESA 1RTDB 3Q8RB 4J9OA 5E41A 4J9NA 1C0UB 4C8NA 2E6LA 4FM1A 2GUIA 2GV9A 2VA3A 3G6VA 3N6LA 1RNHA 4DTNA 2FVCA 1BQNB 3DRPB 4E7HA 5KFFA 3O3FA 2GIRA 1C1CA 3QIDA 3CM5A 2FJXA 4KTQA 1SL1A 1TKXA 4IG0B 3PX4A 4RNNA 3QO9A 4FJIA 5KFGA 3KLGA 3E01A 1IKVB 2IGIA 1IKVA 4O4GA 3PW4A 1Z25A 2IAJA 4DSJA 1R0AA 1ZTTA 1U49A 5KFQA 3MECB 4URGA 3QEXA 2X74A 1K1SA 2OZSA 3H5XA 4WZMA 4KRFA 2HHUA 2XY5A 2W9CA 1HMVB 3VQEA 4IH7A 4LSNB 2HHQA 4I7FB 4J2EA 4NLSA 4DQIA 3PW5A 2YNFA 2C2EA 4KHYA 4MH8A 2ZE2B 3I5AA 4YNQA 4RW8A 3QEWA 3DLHA 2ZE2A 2W9BA 4ECXA 4RW7B 2W42A 2Z1HA 1TL3A 5F9NA 3KTQA 3GIKA 2AJQA 1TV6A 4I2QB 3V81A 3HP9A 1BI4A 3EYZA 2BQUA 2UVWA 2WONA 4JS4A 4DU4A 4NLWA 3NH0A 4M41A 4DU3A 1ZYQA 3RB0A 4KB0A 1SUQB 1S1WB 1GX5A 4ZMMA 4QWDA 4LH4A 3KHGA 4IRCA 1RT5B 4K4TA 3CO9A 3K5NA 1SV5B 3IN5A 4QW8A 1W25A 2HNYA 1HQUA 3DMJB 4C8LA 1VRTB 4MKAA 1RA6A 1ZBIA 1B9FA 2B6AB 4Z0UA 4NZ0A 4ZTFA 3G0ZA 2Q3SA 4K4SA 2W7OA 3MEDA 2R2UA 1I3AA 4MFBA 4IG3B 4J2DA 2IOCA 4DL3A 3PW7A 4IQXA 2R8IA 4Q45A 4YP3A 4KHQA 3OLAA 2UUWA 3AVIA 2IBKA 1EX4A 1RTHA 4WE1B 4ZP9A 2A1RA 2KW4A 3GIJA 1S1VA 1EXQA 1RDDA 2W7PA 3CFPA 1FK9A 3MFHA 1X9SA 4KHMA 4CK2A 4ELVA 2XC9A 4KHUA 5KT4A 4ECQA 4Y34A 1JXBA 3LP2A 4RW8B 1XR6A 2WHOA 4FJNA 4DL7A 1RTJA 4ELTA 4IBNA 2P1JA 1X9MA 4O3QA 4E0DA 2ILYA 4EYIB 4O3OA 4O55A 4KO0B 4CGJA 1NHVA 3C95A 4MK7A 3RMCA 3AA5X 3BSCA 3IGNA 2KFZA 3PVXA 4FXDA 2KZMA 2YHAA 4M3ZA 3CJ5A 3QEPA 2W8KA 3HP6A 1QSSA 3HO1A 3KJVB 4ZP7A 1TVRA 3JYTA 3CFOA 4N56A 2V0NA 4CHPA 4JV0A 3OJSA 1C0TB 3PJWA 5J2NA 4DFJA 1ITGA 3OYMA 4O44B 1C6VA 1RILA 4NCAA 4DG1A 4RNFA 1WSEA 3V1QA 3CJ3A 4CJPA 2R2SA 2I1RA 4CF1A 3MR2A 4J2BA 4DSLA 4WFXA 4Z4GA 2RF2A 5C5JA 4FLWA 5FDLB 4GC6A 1BI4B 1LAVA 4RUCA 5KFDA 4B8CA 1SKRA 3V6DB 5KFUA 2D0AA 1RYRA 3NF7A 1L3UA 5C25B 5F8LA 1OS5A 2XRIA 1XHZA 2UVRA 1RTHB 4WE1A 3T5JA 3SQ1A 3DLKA 1LV5A 3G6XA 2D5RA 1KVCA 5HBMA 5EU7A 4FJXA 5KFPA 5I42B 3KD1E 1JIHA 4DTUA 1NJZA 5HROB 1G15A 4J9PA 2IJFA 1XI1A 3NAEA 3GV8B 3KLEB 3TAQA 3P5JA 3LALA 2XY6A 5KG6A 1D0EA 1X1PA 2HHVA 1NK7A 5KFHA 3PX0A 1IG9A 3HPOA 1X9WA 1JLEA 3QETA 4NLDA 4GMJB 2OYQA 4J9RA 2XY7A 4MK8A 2IAJB 1RTIA 3ZSWA 4FLYA 5JUMA 4Q44A 3VQQA 3GYNA 2DTUA 4NLTA 3B6OA 2RKIA 1RT6A 3C6TB 2BE2A 4EEYA 3GIIA 1MMLA 4FBUA 5C24A 3KHRA 2QKBA 3AO4A 2AX1A 3AA2A 2FBTA 2Z1IA 2YNGB 3IRXB 4HCBA 3DOKB 4E7JA 3D0PA 2HMIB 1CXUA 1BCMA 1S0NA 3LP2B 4TQRA 1UA0A 5KT5A 3PR5B 4R8UB 4ED3A 4CJUA 1NKBA 2OPRB 1C0MA 3KLVA 3CDUA 1C1CB 3KKRA 1UWBA 3FQLA 2O4GA 4DFMA 3DM2B 3OYGA 1RDBA 4E1MA 4CF2A 4I9LA 4Y3CA 2AGOA 4F2SA 2EC0A 3KK1A 1N48A 2CKWA 4B9MA 2E9TA 1HYSB 3KLIB 2D0CA 4CHOA 2G8FA 3PJXA 4B3OA 4DS5A 1SUQA 2W9CB 2HNZA 1TVRB 3EZ5A 2R2TA 5FRNA 1EETA 1S97A 3QYYA 3L2WA 5J2NB 1BCOA 5EWGA 1HNVA 2R8KA 5J2MB 3P1GA 4F3OA 1MU2A 4CFBA 1D1UA 4RW7A 4TSXA 3FFIA 5KI6A 1XR7A 3CJ4A 1VSEA 3H5SA 3SFUA 2JLEA 3MEEA 1WAFA 3OLBA 5KG2A 3OJUA 1IKYA 5C42B 4R5PB 4ZPCA 4ECZA 1LW0B 4DL4A 4BE2A 5DG9A 1JX4A 2DPIA 5EDWA 1KLNA 3SI6A 4IH5A 1O1WA 5KFJA 3QGHA 3RAQA 1YTAA 3VQ7A 1WSHA 4NCBA 5I42A 1RAJA 1JLBA 1TK8A 2E6MA 1JLFB 1I6JA 4CK3A 2HAIA 3D5MA 3THVA 4Z4HA 2FBVA 4Z4EA 1VRUB 3ITHA 2IDOA 3ITHB 4F8RA 1QSLA 4FVMA 2HW3A 3U3GA 1TKXB 2HNDB 1XR5A 2OA8A 1K6YA 1VSMA 1N5YB 3DLRA 3H40A 4HUGA 1RT7A 1W0HA 3E01B 3VN5A 3QZ7A 4CJQA 4IG3A 4B9UA 4O3PA 3DLEB 2WCXA 1RA7A 2OPPB 3IG1A 5KFRA 3SI8A 3NDKA 1CLQA 4K4YA 3AA3A 3H2LA 3QZ8A 3L3VA 3DOKA 3M8PB 5DLFA 4ZPBA 3TARA 4KI6A 4IR9A 2BR0A 3KMQA 5J2MA 3PW2A 2HVHA 3NFAA 1D8YA 5KT2A 4PQUB 5KT7A 4RG8A 1QUVA 2YKMA 3MFIA 1XHXA 4DQSA 4ZVGA 4QW9A 1NK9A 3SPYA 4OVLA 5CYMB 2UUTA 2VG6A 3KLFB 4H4OB 3KLHB 3SUPA 4CJTA 2IS3A 2RDIA 4EBEA 4KB1A 1BHLA 4C8MA 4DL5A 2QV6A 3HVAA 3BSNA 1JXEA 4ID1A 5DQHA 2D3ZA 1S1WA 3TAPA 5HP1A 2KFNA 4LQ9A 3PX6A 2HNZB 1JLCA 4KAIA 4ICLB 3H4DA 5K14A 4Q5VA 3MR3A 3D28A 3ULDA 1NK4A 3LWLA 4AHCA 1C0TA 5F8HA 4RW4A 3P83D 3RWUA 3DI6B 3VQ9A 1J5OA 4N47A 4TY8B 4F3TA 3LZJA 1RT3B 3GV5B 2G8WA 3RB4A 1RT3A 5SWMA 3AVLA 3FSIA 4CEFA 1NK8A 3U3YA 4IFVA 2FVRA 4OKKA 4FM0A 4KAZA 3H08A 3SUQA 1R0AB 4CFAA 4HHTA 3NE6A 3V6KA 3PW0A 3QIPA 3OYKA 4URQU 3UR0A 1RT2B 4I2PB 2GC8A 5HRPA 3LAKA 5CY4A 1Q8IA 1N4LA 3QEVA 4CJ5A 3VA3A 4QCLA 4DQRA 3GIMA 3M8QB 3UDLA 4TXSA 3VQPA 4FLXA 3MTKA 1BIUA 2FBYA 3KLEA 3OHAA 3HK2A 3SQ2A 2DFFA 3G10A 2OPRA 4B9NA 4YMEA 3Q8SB 3QERA 1TL3B 5KFLA 3PR4A 2DPJA 1JL1A 3K5OA 2P5OA 1LW2B 3FDSA 4M42A 1RCHA 2CJQA 4KB7A 3QEIA 1DLOA 1S4FA 2P5GA 1VK0A 2QE5A 3IG1B 4N76A 3MECA 2A1SA 3K57A 3C6UA 1HYSA 1YTUA 1RT4B 4F2RA 4FJ9A 3L8BA 4IFYB 4Z4FA 3OY9A 3OS0A 2IM3A 5KG3A 4B9LA 2Z1GA 1BIZA 2R8JA 4FJGA 4CGGA 4NLPA 4KV8B 3BQ1A 4OPJA 3GILA 4KFBB 1B92A 4PQUA 5KG0A 3RRGA 4R8UA 1MU2B 1C2PA 3ZSXA 4ELUA 4DSIA 3M9MB 4Q0BA 2YNHA 3DM2A 2RF2B 4BDYA 3ZT4A 1QQCA 3MF5A 4QWCA 4DTJA 2ZKUA 1QSYA 5CYQA 2ATLA 3M9OB 3H59A 3QLHA 4NLOA 3AO5A 1Z4UA 3S3OA 4CEZA 4E7IA 5C25A 2HHSA 1SL2A 4FLVA 4B3OB 4CJWA 2IM2A 4CEEA 4KSEB 5KFTA 1S0MA 4CGDA 3EY1A 1FK9B 1CSJA 1SV5A 4CE9A 4PWDB 1TK5A 2G8KA 1C0UA 4OL8A 3NAHA 3CVKA 1KVBA 4K4ZA 4WYWA 4WXWA 4FK4A 2WTFA 4K8ZA 4RW4B 4DSEA 4NLGA 3AVKA 1HQUB 4DQPA 3DRPA 2IM0A 4PY5A 4U6PA 4JRQA 4Q43A 2DFEA 1QS4A 5KFCA 2IC3B 2ETJA 1WN7A 4M3UA 3NL0A 3HXMA 4BE0A 4KHWA 1KHVA 1RBVA 3PY8A 4FZZA 1RTIB 5KRTA 4W5TA 1NKEA 1J54A 4F50A 4O5BA 3V4IA 4DSFA 1W9HA 2UVVA 5JXSA 1QAJA 1RT2A 1RT6B 3C6TA 4ZVFA 1S9FA 2C2RA 4DEZA 3MAQA 5SZTA 1IH7A 1U09A 3KKSA 1DTTB 4E7KA 3VQ8A 2G8IA 1RDAA 3F73A 1U47A 2YNGA 3IRXA 4OGCA 5HRSA 4MIAA 3VQDA 3GV7B 3L3UA 4M3YA 1JLFA 4FS1A 4ECYA 3H4BA 2V4QA 5EWEA 1TQLA 4ECSA 3MXJA 2BQ3A 4W5RA 3AVFA 4TN2A 5CYMA 1RBRA 4M3XA 4UQGA 1L3TA 2J6TA 4RZRA 5CYQB 1ZETA 3BGRB 3KK2A 5KFMA 4J9LA 3HT3A 4M3TA 5KG7A 4LSLB 4QWAA 4CCHA 4CHZA 5KFAA 1VSDA 1N6QA 3JSMA 3I8DA 1NJXA 3I0RB 3OYFA 3HKWA 3UQSA 4BDPA 4NLQA 1SL0A 4PA1A 2VG5B 3ISNC 3T3FA 3OVNA 3L2UA 2DFHA 4CJRA 1RT5A 4RNOA 3M8PA 3DLBA 1TKDA 1JXLA 4K4WA 2YNIB 2ZQBA 3H98A 1U4BA 4KFBA 1J5OB 4DTOA 3LP3A 1HNIB 1KLMA 2B5JA 4LY7A 1KLMB 2B5JB 1SKWA 3AVJA 3O4NA 4HTUA 1JL2A 5J1EA 3LPUA 3RB3A 5KFNA 1VSLA 4NYFA 3RMAA 1RYSA 3MR5A 1JLGA 3HVWA 4R5PA 3V4IB 1TAUA 3QLHB 5DGBA 5F9LA 3QINA 5T14A 4CF0A 3HPGA 3A2FA 5J2QA 2JEGA 1NOYA 2LSNA 3QGGA 4DSKA 2FVQA 2R8HA 3V9XA 1GOBA 3CM6A 1FKPA 2VWKA 2G8UA 2BANA 4FLUA 2VG7B 4DTRA 1LAWA 2JGUA 1T8EA 5KFOA 4ECTA 4Z4IA 2ALZA 1T03A 3VQ6A 3ZSYA 4Q8FA 1GOAA 4CIFA 5DGAA 4ID5A 4CJVA 3HVTA 1T03B 4K4XA 1WNEA 4ID5B 3MEDB 4CFCA 4CHQA 3AVCA 3QIOA 3OS2A 2BDPA 4NCGB 3I5CA 4O4RA 2XCPA 2OZMA 4EP4A 4EBCA 4DTXA 1KCFA 1QAIA 3DOLA 3KJVA 3VQ5A 1JLAB 1RT4A 3HYFA 3WNFA 4ECVA 5HRRA 2F8TA 3KK3B 4CHYA 4FM2A 4KHSA 1ZTWA 4HUEA 1WSFA 2YKNB 4KV8A 2XWYA 3OYEA 3BQ0A 3LP1B 3ZSQA 4DG1B 2YV0X 1T94A 3VQAA 4FLTA 5KFXA 4PUOB 1RTJB 4CJSA 3UIQA 3LPTA 3OYAA 3K59A 4JS5A 1WSJA 3TI0A 4Q0BB 3M9NB 5FDLA 4RNHA 1IKYB 2R2RA 4IKFA 1SKSA 1HPZB 5EUHA 3NGYA 2OPQB 4JUZA 2FC0A 1WLJA
chains in the Genus database with same CATH superfamily
4DPOA 2CPZA 3JSMB 3D6FB 3RB6A 1LK5A 4CF9A 1BC6A 4N41A 5A8WA 2GJ2A 2NZTA 3AXMA 5LXYA 2WOMB 3DI6A 1RAGB 5HROA 2PY5A 2F3JA 4LBHA 3CCUS 3LZIA 4OZLA 1WSGA 2I8EA 4ZPTR 2CQ4A 4NRTA 2AD9A 4JI1K 2YH1A 5CHCB 3QBWA 2F8SA 5DQGA 1S9GA 4ED8A 4C8YA 5A8KA 1TKTA 2KJVA 2W2QP 1RAIB 2NYHA 4MTPA 3SUNA 4WXOA 1BLUA 5C2FA 1T0TV 3PNIA 5I3UA 2QJ3A 5CCMA 4PABA 5BYSA 2FLNA 3NGIA 3EDQB 3SQGB 1S0VA 4ZHRB 3NF9A 2AGQA 2RS2A 2PMHA 2ZH7A 1U48A 2U2FA 3IS9B 4NPOA 3CXCM 4DV2F 3FZLA 3IS9A 3O5BA 4FPAA 4UOGA 4CO3A 4DQQA 1T3NA 4ILHA 4KKOB 1FD2A 4BRHA 1NOZA 5KPZA 1Z6RA 5F8JA 3O3LA 3B82A 4HUFA 3RMBA 1IM4A 1HI1A 4O8UA 1WC6A 1S6UA 4P71A 4U95A 3J7YP 3PHEA 3O8WA 3CJQA 1QE1A 3ZX3A 2P9IB 1FI4A 4CGFA 2XLJA 1QE1B 4EZ9A 1B3TA 2GW8A 2HBLA 3SZ2A 2CQBA 1NGEA 4B17A 4AH9A 3DAWA 4Z4CA 1TZ0A 4L3QA 2D41A 3MR7A 1FJGJ 3M8RA 2NR0A 4GKJK 3QGIA 3M30A 4PG5A 3MEGB 5AZJB 4OFZA 4LRFA 3CERA 2O8BB 4HTLA 4FWRA 4L76A 4DFPA 2E4LA 1HQEA 4AD6A 4IH6A 4EFHA 3M32B 1WUUA 1ASWA 1RLCL 1JXVA 3B6BA 3TR5A 1W2BM 3CCUN 2F8EX 1K1QA 4USIA 1HIYA 2P9UA 2P9LA 4DR7K 2YTCA 1S10A 5AQFA 1U6FA 3DLKB 4W5NA 1BGXT 1V4SA 3EZWA 4GV3A 2HNYB 3J81Y 2OEKA 4PXBA 2XNQA 2D1KA 3GR1A 5ETRA 5LMNJ 2APOA 2DGXA 3N4WA 3TAEA 4GKKK 4QU7A 2OPSA 4UT4A 4BRIA 1Q7LB 3PRVA 3MPDA 3RUBL 4WQ4C 3VQBA 5LJWA 2O67A 1UA1A 2BJ8A 3V9SA 4JI8F 3KJNB 3NKYA 3BF3A 4Y2KA 5IV4A 2MLXA 4I2PA 4FKXA 3HOSA 4OI0A 1NK0A 5IM0A 2E5HA 2X1AA 3UW1A 1AXQA 3IGVA 3O9TA 4KQZA 3PEJA 2HFVA 4GVBA 1U1LA 2KN4A 3DRSB 4HACA 3KJQB 3LDSA 2QL5B 1ZBTA 1Q9XA 3RAXA 3KDNA 4ECUA 2LDYA 1JKHB 3AVMA 4DQ8A 1Q18A 4CEAA 2NNWA 2CJXB 3BGOP 4DL2A 2W9AA 3C6AA 4LF4F 4MMOA 1N5YA 1N36J 2CAJA 1X4HA 2HWHA 5KFWA 2CQ0A 3ZZYA 2VWJA 3AVHA 4OJ1A 2OEJA 3BGRA 3CNQP 3Q8PB 3AGRA 4H0YB 3ZT3A 3J81O 3QMQA 3V9ZA 2WVFA 4KI4A 3ZSOA 3RRHA 2XLKA 1Q1KA 3JYTB 4DUYJ 2FBXA 3SV3A 3WX8A 4LBPA 3PCOB 3L7UA 2VOPA 4MDBA 5ETNA 4RO0A 1NKCA 3NMUA 4K5SA 5F8MA 2YVSA 3HM9A 3R5CA 3HFKA 1RJJA 2V5HG 2FLOA 4OI1A 2LQ8A 1SIZA 5HL7L 1R6YA 1BD6A 2GIQA 4EBDA 1HBMA 2HHHK 3BSAA 4YDDB 5AQTA 5HATA 3RMDA 4X4PA 2WFBA 1EJ7L 3TJ8A 4K7QA 1FFWB 2CDQA 3GU0A 3WIUA 2WONB 3R6LB 3KHHA 1KHWA 3TTDA 4YY3F 2VA2A 4OKEA 3BREA 2WSCC 1HR0K 1VSKA 2EPIA 1YVUA 1CG2A 2BVZA 3QRPA 2JEIA 1YVNA 2BKOA 4LF9J 2WOMA 5DZ6A 2AZ1A 3GIRA 3N28A 3AV9A 4KPYA 2KO1A 2G0JA 4FJHA 4EUVA 2PN6A 4TY9A 2WUSA 5B0AA 4LFAJ 4CLUA 1M5VC 4PXDA 4CJFA 3KK2B 1C4AA 1Q81T 1OH6A 2YBVA 1KR4A 2BE2B 2ZZNA 6AT1B 4ZIWA 1KNZA 3MXHP 4CBXA 2ASMA 4XTTA 2V7ZA 3O9RA 5A8RB 3V1RA 4ZJQA 1NNDA 5KFKA 3J7YI 4ED7A 2HGNA 2K1RB 5I4MA 3H5YA 1X4CA 1TAQA 2ITGA 2V50A 2XGPA 1HNIA 1BXNA 3H90A 3DRXA 1SBRA 5LMUJ 3CIPA 1XIQA 4BQLA 2NSBA 3DYAA 4IO1A 4EGLA 2BQRA 3GJRB 5E3PA 4OLBA 3ID8A 1HNWK 1KVJA 2UXBF 1TV6B 1XN9A 4FJ7A 3RBEA 1FX2A 2LXIA 3FRZA 2R3VA 3BN7A 2X6NA 3HPHA 4NEYA 2HBYB 4GC7A 4C48A 3MPYA 2LU1A 3DRYA 2E2QA 3JAMO 4O0IA 3RAMA 4KGZB 4DMNA 2BJ7A 3FKBA 2EX3A 4F36A 2XZWA 2KKZA 2CH5A 4JAXA 4JKCA 2JVOA 3NGUA 5A2QU 3OL9A 3OXFA 4FJJA 5J1PA 4X4OA 2FLLA 1WC3A 2G0IA 3T1HF 4AHSA 2WSEC 1JLEB 2ATQA 2HVEA 2DHXA 3G8TA 3MEEB 3ZYYX 4GVLA 3IM9A 2Z4PA 4A5AA 5JLHA 3J81U 3ET6B 4O0NA 2PMWA 5E3RA 1NMDA 4PG7A 3SEOA 4PYDA 4XH5A 1I94F 2DNYA 1FDNA 2RKIB 3DLLL 1NGBA 2ZUGA 3CJ2A 5I3UB 3K0JA 1IBMJ 2WRMA 4I7FA 4ED2A 1S1VB 4BC7A 4M7YA 4B3TJ 4CZHA 2KHDA 4LC9B 4CEOA 4CEDA 2YWEA 2NUBA 3O5TB 4F4YA 4B9SA 1YBTA 1IBKF 3SCXA 1UW4A 3F0NA 1YGYA 4ECRA 1T9UA 1X4BA 1J53A 4ED0A 4RTFD 3C19A 3BB5A 3VAKA 3DDKA 3QNNA 1BUPA 3ENOA 2PI4A 3WUHA 2G8HA 1GLDG 2GVDA 2QFIA 2YWHA 1BWFO 3ALYA 1TKZA 1I51B 3CQYA 3OYBA 4HVJA 3I32A 4GKKJ 4BR5A 5L1LA 2B43A 1RI7A 5LMNK 3DRSA 1RADB 2QWQA 2YNFB 3ZC4A 3NMAA 2DRAA 1TUWA 4KE5A 2FHOB 5E2QA 2CNOB 2MZSA 4NYNA 4GMKA 3QRQA 4DU1A 4P10A 3G82B 4TQSA 1U1MA 3PJ9A 2JZ5A 3C3LA 1T3VA 2WSFC 3K5MA 1N0UA 3CPEA 3BEXA 1WJ9A 3GL1A 4E3SA 4LSLA 3L4BC 3LM2A 2E1PA 4DWIA 1HARA 3CWJA 1BDGA 3AVNA 3CULA 4X2BA 2DH7A 4JN4A 2VU5A 1U6BA 1SIWB 2DYAA 2RB7A 4MYTA 3B6PA 3FSYA 4C8OA 2V4RA 2GGPB 1T9YA 2MPUA 4DU8A 2ZD1A 2LU2A 4X4NA 3AQPA 2J9DA 2RU3A 1MMDA 2RHQB 1LWEA 2XYGB 2R7XA 3NCPA 2KVIA 1VRTA 3OYLA 1KTQA 4OLAA 4V19S 2X78A 3SYZA 4C8KA 3N0VA 3DLGA 4FOIA 1G1XA 3IR7B 3BDEA 1ZS6A 1H6KX 1VGYA 5HQ8A 3NGSA 3Q2TC 2W6KA 1F60B 4KHNA 1MWQA 1S9EB 2XO6A 4XPEA 4NI2B 5EN1A 2O66A 4DMZA 4EO8A 3KHLA 2ZH3A 4ZP6A 4HACB 1N32K 4O3NA 2GVZB 2C22A 1G6BA 5KOXA 1HJOA 2PZSA 1MMNA 4DR3J 4RCHA 1RBAA 3UNGC 4L3KA 1ZA1B 4LVOP 2GA7A 2PMZD 1UWBB 3CJ7A 4FWNA 4G1QB 3CD7A 3K89A 1T6DA 2D9OA 5KFYA 3GFXA 4H0PA 4A8MP 2P9PB 3A5LC 2V69A 1XMOK 4QIGA 2D1CA 2K06A 1KFSA 2F9WA 1Q16B 3T5LA 1DLOB 2V8HA 3RG6A 3VA0A 1OYEA 1Q9YA 2BEFA 2HG4A 4FZXC 2B8QA 1F5BA 3HHLD 5D3GB 2HFUA 2CQIA 3G96A 1RABB 2P9CA 5GADP 3ELHA 1GK8A 3T6BA 4B3RK 2CPDA 2YKNA 4M45A 3OYDA 3OS1A 1RWOB 3CC2S 1KRPA 2RDJA 4WFBL 4B9VA 2W9BB 2GMLA 1HBMB 4OZ1A 3DLGB 1V3SA 4Y1DA 4BWJA 2VOOA 1XWLA 5D0EA 3NVMA 4M5LA 5IWAJ 3OTOK 3MM8A 3W63A 2WK4A 1XMQK 4K8XA 1LQ9A 1UAWA 3KIOA 3WHIA 3BQ2A 3J7ZT 3OFFA 1FNXH 4EK2A 4PG8A 4QYZK 2ERRA 4J9OA 3TEHB 2E6LA 4XH1A 4EMDA 1N8RT 3G6VA 3U8XA 2W2NP 3SCJE 4E7HA 1NU4A 2LECA 3CM5A 2FJXA 4BR9A 3D7SB 3O9UA 3QO9A 3CW2C 3S8SA 1IKVB 1IKVA 1Z25A 1NLVA 1FERA 2E8AA 1R0AA 3HHLC 1K1SA 2ZNYA 4ZVSB 4DL0C 4WZMA 4KRFA 5D0RA 4ED5A 3LGHA 1EQMA 1F6TA 1HMVB 3VQEA 4OZ3A 1CC8A 5IM0B 2A1BA 1TMMA 1EO1A 5AFUH 2FDNA 4ZVRB 2C2EA 1AFJA 4MH8A 2ZE2B 3UE5A 1GAOA 4RW8A 3QEWA 3O6QA 1RBOB 5IT4A 2C2OB 1Z2ZA 4M1KA 5C7PA 2MB0B 4RW7B 2W42A 1N0VC 3M6UA 4A61A 4WP3A 2AJQA 2ZZMA 1TV6A 3HP9A 1T3OA 1BI4A 3PKMA 5D8HB 3H1VX 1HW8A 3ADAC 4AYBD 4E98A 4DU3A 1ZYQA 4OJHA 2I7PA 2H4WB 1SUQB 3J80O 1NG9A 1AA1B 2UZAA 3FRYA 3CO9A 5FPDA 4WJBA 3DMJB 4DZ6A 1QJHA 4C8LA 1B9FA 4X65J 2UXBK 4FWKA 4Z0UA 2IHR1 2Q3SA 1YDLA 1NJIO 2A2CA 3MEDA 3FUYA 4ZVUB 2D9PA 2IOCA 1ZAXA 3MEKA 4NASA 4IQXA 3NG8A 1Q86T 4CO1A 2O1PA 4YP3A 1DEJA 4DXLA 1PAEX 1EX4A 1RTHA 2K8GA 1NO8A 2A1RA 4WU3A 4IFEA 1S1VA 1EXQA 1RDDA 4OX7A 4KHMA 4ELVA 2XS5A 4ECQA 2Q3PA 1JXBA 1NCLA 4OX9J 4RW8B 2DISA 3A12A 4YHHF 1XNRK 4DL7A 2VQEK 5AXMA 1RTJA 1YK9A 1SJ4P 2P1JA 2HHPA 4O3QA 5E5NA 1RZMA 4E0DA 3MWBA 4I4BA 4M7XA 1G2EA 4XAKA 4O55A 1JJHA 3A4TA 2XYHB 3C95A 5FPEA 4MK7A 3RMCA 3AA5X 3BSCA 3IGNA 4KBOA 2RDDA 3ZZZA 3TWZA 3ATVA 2B4OA 4P74A 1R89A 4UZBA 4JI6F 3ENQA 5D0HA 4CLZA 1TVRA 4N56A 2DNPA 2V0NA 3ZZRA 3B78A 3OJSA 4KJIA 5J2NA 1CPZA 3HD1A 1IQZA 5M1FA 4LF7F 1K0TA 4R25A 4RNFA 2YKOA 4FPIA 1X4FA 2QLJB 1OH5A 3MN6A 4C3MA 2E44A 5C0YA 3P4UB 2D0OA 2G4BA 3GLJA 1NDKA 4GC6A 3MHYA 4JV5F 4HL9A 4Y65A 3SBGA 2J7WA 3NF7A 3HTVA 1SC3B 3MM6B 2ZWOA 1XHZA 1RTHB 3C7NA 4C7QA 2D5RA 5HBMA 1SCJB 5EU7A 4FJXA 3KD1E 4KGXB 1VQMN 1U2VA 3ENAA 1JIHA 4MDAA 1AUDA 1YRXA 2DNMA 3AD7C 4I69A 2J5AA 1IJJA 2OAUA 1XI1A 3GWCA 1ICEB 3D0IE 1LK7A 2E5GA 4EI2A 1N34F 2DD8S 3K8WA 1N33K 2E1RA 1X9WA 2C3YA 4GMJB 4J9RA 4HWIA 2EFGA 3MURP 2IVYA 3X3UA 4CZJA 2JLGA 5M2PA 2DTUA 3J7YU 3D2FA 1AFIA 2Q0RA 3GIIA 5CD4H 1XEZA 3QMLA 1EAYC 3KHRA 3AA2A 2YNGB 3IRXB 4HCBA 2HMIB 1BCMA 4I6MA 1S0NA 2YY3A 2QL9B 1FTRA 1F1BB 2M8HA 2UXCJ 2ZITA 3W65A 4E1JA 3OFGA 1NKBA 1C0MA 5LT5A 3CDUA 4ZPWR 4CVNE 4I67A 3DM2B 3OYGA 2MQNA 4I9LA 4GRSA 2KM8C 4KYZA 3OVSA 2EC0A 4I6AA 1N48A 2CKWA 2ZUAA 2E9TA 2D0CA 3KLIB 3JXOA 4CHOA 2BKPA 4IYQA 4WTOB 1U1RA 2CPYA 1BMQB 2XZDB 2QA2A 1ZH5A 4PKGA 1SUQA 3O1BA 2O8CB 2HNZA 4X66K 4V19J 2O8CA 3EZ5A 3HLUA 2UXDJ 2CJAA 5FRNA 3LUYA 2GAGC 3S1TA 2A6OA 1TL7B 2DHGA 5EWGA 1HNVA 4C11A 3P1GA 4OJGA 4CH7A 4WF9L 1Y5NB 4F3OA 2R7UA 4CFBA 2DB1A 2MKIA 4X4TA 2UUBK 5MLCQ 5LM7E 4RW7A 1AUSL 1TFWA 3FEYB 3VAGA 1F3VA 1JJ4A 2K3KA 3H5SA 3SFUA 2HBKA 3T1HJ 1KONA 3Q8VA 1GMWA 4F67A 5B0BA 5KG2A 2KYZA 3OJUA 1WF0A 4CZFA 2GEMA 2RQCA 4BE2A 3N4QA 2ABYA 4B3RF 3PG9A 5EDWA 1IQTA 2DCLA 3SI6A 4IH5A 3HSZA 1ESVA 3EN9A 3VQ7A 4NCBA 1JLBA 4NWBA 1JLFB 2F8MA 2EKYA 4Z4HA 3TZXA 1EQ0A 4LJMA 2NLWA 3TNVA 3VVTA 2R7WA 2WW4A 4F8RA 2ZH6A 1U0HB 1QSLA 2DGVA 1GLCG 1CULB 1VHIA 3K5PA 3U3GA 1K6YA 1VSMA 1NBEB 1SAZA 4QIEA 4PZVA 3MMVA 3GG1A 2ZVIA 4P2FA 1Q7YO 3QFHA 4O3PA 3JTNA 1RA7A 4KHPJ 2OPPB 5KFRA 3NDKA 2L41A 2LQJA 4K4YA 3AA3A 4WFAL 2WB1D 2CQ2A 2ZC4A 4PHTX 2O8FA 2GTDA 1E6VA 4JI3J 1GFWB 2GVZA 2BR0A 5J2MA 4RG8A 4OZ0A 3IC1A 2O8EA 2FSKA 1XERA 3PHTA 1XHXA 2XSJA 4DQSA 1MWMA 4ZVGA 1NK9A 3NWRA 3SPYA 2PA8D 3KLFB 4H4OB 4FYYB 4DV5J 3SUPA 2OANA 4CJTA 3ZZTA 1UJ5A 3CF5Q 2CH6A 5A6WA 4ER8A 1RKIA 3BSNA 1WHYA 4ID1A 5DQHA 2DNZA 1S1WA 5HP1A 4CO4A 3PX6A 2YX4A 4ZLPA 2QEXS 4OJ3A 3HSGA 4BRAA 4OI6A 2PFDA 5DZ7A 3D28A 2PEHA 3ULDA 2GNKA 2ZM6K 2QLBB 5M1NA 1C0TA 2N7CA 4QZVB 3G87A 4CM0A 5BJRA 3P83D 2HFSA 5DS7A 3A8EA 2M7SA 4TY8B 1NJIT 4B3TK 1ZM4A 1MROB 1X4DA 1QAYA 2DIVA 4JNEA 4USTA 1BU6O 2RS8A 2HYIB 4LR7A 1NK8A 3UB5A 2JDJA 3BZQA 1F5CA 1ATNA 3H08A 5ETLA 5A8KB 1YLXA 1VK3A 4CTAA 4HHTA 3PW0A 3QSYB 2CWKA 1YG0A 3DU5A 1BA1A 1ILYA 5HRPA 3LAKA 1M5PC 1N4LA 4B3MJ 4OZJA 4M5NA 5C15A 3MPUB 3Q89A 3CDBA 3D9BA 3QRRA 3VQPA 3ZX0A 1UJ4A 1BIUA 2FBYA 2CG4A 4JI1F 3HK2A 3SQ2A 1OY8A 2VQEJ 3F56A 1TL3B 3MWTA 2YJFA 2ZBPA 4DI6A 4J5OA 2DXEA 1KAXA 3FDSA 3QJPA 1UMJA 3BZCA 4MYUA 2FXUA 1VK0A 3IG1B 3UNYA 2A1SA 2JOQA 2QC3A 5LJVA 1HNWJ 3H8YA 1Q81O 3CD6N 4ZN3A 1RHUB 3OY9A 4K42A 1CJVB 3LDPA 1HNXK 2D4WA 2Z1GA 5AJ3F 2A10A 5CCLA 4CGGA 1LWXA 3BQ1A 4CZGA 4OPJA 3R3TA 1YX2A 2H54B 4P75A 3GILA 2FC8A 2QN6B 3AAQA 4X65K 3VENA 4JYAK 3DXKB 4ELUA 2WBMA 3M9MB 4ZKAA 2KXNB 1HWKA 5M1QA 3HD2A 5B0FA 2DNQA 1RQ0A 2JFKA 2AF6A 3CQXA 1PC5A 1VS3A 4NLOA 2C42A 4DPXA 2VPZB 4CEZA 3WC2A 4IDHA 5C25A 2HHSA 4F0HA 1WB9A 2IM2A 3EWGA 5KFTA 1CSJA 1SV5A 2M70A 4PWDB 1S7IA 1RWXB 3VGVA 3NAHA 4FK4A 2WTFA 4RW4B 3AVKA 1OVQA 4RWTA 2IFXA 4W98A 4DQPA 3DRPA 5G0RA 2BJEA 5E3QA 2ROEA 4U6PA 4JRQA 3OW2M 4H5VA 2V2KA 2BOAA 2IC3B 3CGIA 3EE9A 2EXUA 3VQTA 3AGKA 3WQUA 4BE0A 1KHVA 3PY8A 3FEZA 1RBVA 4W5TA 3KKFA 1NKEA 5K8NA 3RU0A 1HBOA 2FHKA 2UVVA 2ZH9A 1CJUA 5BN9A 4UY8O 1RT2A 2KT2A 1RT6B 3C6TA 2HQIA 2C2RA 4M8LA 4ILGB 1AZSB 4Q7AA 2FB0A 1IJEB 5T41A 3VQ8A 1U47A 2BX6A 4OGCA 3VQDA 1LXJA 1JLFA 2V34A 3FGUA 1FHTA 4YORA 3H4BA 3GCXP 5RUBA 4HVZA 3JQKA 2GHVC 2P6SA 2MLYA 3MXJA 2YX7A 4HI2A 3GOIA 2E5IA 3J7Z5 5DDRC 3WQTA 2IYGA 2M52A 3O44A 1RBRA 2D0PA 3CCEN 4J9LA 2MKSA 4QWAA 4CCHA 1XJWB 3D1HA 2Z8QA 1Q0NA 3J80Y 1V9OA 2AT1B 3VGSA 4DZDA 4FVCA 4NLQA 5B0EA 4PA1A 3ISNC 4OPHA 1LNQA 3IO1A 4KC5A 1JXLA 3ENWA 1FNOA 2ZQBA 4A8WA 1U4BA 5FLXY 1HNIB 2VKRA 3K9KA 2B5JB 3TPQA 1RAOA 3VMFB 3LPUA 3VGMA 3RB3A 1D8ZA 1GXTA 1JCEA 3RMAA 1JLGA 3J7ZO 3B54A 1YI2N 2DR9A 1KBRA 1X5OA 3ET6A 3VR1A 3VF2A 4TVAB 5CZXA 5GAHP 4OLPA 3VOVA 1YIJS 3QINA 3EVWA 3HPGA 2ZDPA 1NOYA 2LSNA 1HL6A 3MM9A 4EHTA 3CJ8A 5DM7Q 2ADBA 5BYQA 1FW6A 5C12A 1VQPN 1XMOJ 2NS1B 4WFBQ 2MKHA 4ZJLA 4HI1A 2BANA 2VYPA 4DUZF 1M1KO 3QBXA 2Y1RI 3VGTA 1T8EA 4RUBA 3R7NB 1NGAA 5KFOA 3D6HB 2R42A 3PYFA 2H3EB 2ALZA 1WACA 2W24A 2ZM6J 4BR2A 3PIPQ 4CHQA 3QIOA 1OPZA 2ZJPQ 2Q97A 2BDPA 3I5CA 1M5KC 2XCPA 4JKHA 4JKAA 1S72S 3DOLA 3TUZC 3HYFA 3WNFA 4ECVA 4DDFA 2LA4A 1NBWA 3IM8A 4KHSA 1ZTWA 2VHGA 2A6MA 2E5LF 1BOTO 4UTGA 2JWNA 4CZMA 3R9PA 4DG1B 3Q8YA 4PUOB 3TEGA 1GLJO 3R2DJ 2NZCA 3EGVA 2KG0A 4QYZJ 3LPTA 3UIQA 4KH5A 1E6YB 1OQ3A 2HIYA 4LRAA 1AROP 2QA4N 2WZ1A 1IKYB 4IKFA 3X1LB 3WXKA 2YKAA 1NPKA 1XMQJ 2BOPA 2LFVA 5HVHA 1U24A 4CJ4A 2D3UA 2K2PA 2Y8YA 1O5JA 4WWSA 3KOAA 3KJFB 4TKTA 3DU6A 2GMHA 4BR0A 4BR4A 4ZDNA 5HLFB 1RACB 2OKQA 4C23A 4F3MA 4DL6A 2XI3A 4DB3A 2V9KA 1HNVB 5KTQA 4LFBF 2YQ3A 3FGVA 3EUNA 3E9PA 1VMBA 3MMBB 3VF0B 4A8SA 1WF1A 1U02A 1RBUA 3VHQA 3HFVA 3KMSA 3C46A 5DQIA 4DR1J 4E19A 2E1YA 3SIPB 4OGEA 2FHJA 1VLOA 1QDUB 3FVYA 4QS8A 2DT9A 1X4EA 1S5JA 1FKOB 4CLPA 4MIBA 3L4QA 4CRJA 1HLUA 1SVDA 3LWMA 2PBDA 5ETVA 3T1HK 3CETA 5AQIA 3IP0A 2RRNA 2FZCB 1MW7A 4ILJA 2HWTA 5AXLA 3THPA 2DJWA 2HHTA 2PYLA 1KC8O 1X3MA 4PRFA 3V5RA 5KFSA 4YDUC 1VIXA 4PCQA 3V81B 3QDKA 3AO2A 3QJLA 3DLEA 4C97A 5IQ6A 4FJKA 2XY8A 1M5HA 2QK9A 4GV6A 2G2YA 4JYAJ 4LF8K 3AA4A 3HI9A 5JVHQ 1OPIA 3CDWA 3ZT2A 3AVGA 3VAJA 5JICA 1HMVA 1CJVA 4RBVA 4ICLA 4KH4A 4RW9A 1DURA 4KREA 4C9DA 4PWWA 1JLQA 3QNOA 3T19A 1WG4A 1ZOTA 3FBEA 2Y1IA 5L1KA 1A5XA 4LF4K 3P96A 2QTDA 3MX5A 5LSLA 1SC6A 2UXCK 4USWA 4AHVA 1DTQB 4ZVPB 2LYVA 1VQ7N 1S1UA 5CZ2A 4Z94A 2KXHA 1AT1B 2P9KA 2O5DA 3OBIA 1I94J 3IBFB 3SQOP 2KB2A 3KG0A 3MN9A 1Q8KA 2QZ8A 2ASJA 1REVA 5A0YA 1KQKA 4WCEL 7FDRA 4BLGA 2D69A 4FKYA 1ASUA 1N33J 4F26A 2IBOA 3C16B 3W5ZA 2VPWB 4WFNQ 2HB5A 4JI5J 4YOVA 1YBAA 3AVAA 5L9NA 5L8RC 5M2RA 5AE2A 4JV2A 5GAHI 1VSFA 4ITSA 2GHPA 4C98A 2XWXA 3M8WA 3J8AA 1F3FA 2R8GA 2BUNA 1S9EA 3V6JA 2Q43A 4B1UB 3ISND 4IWVA 3Q0AA 1PC4A 2VF3A 2PFUA 3NF6A 4NZ7A 3TSUA 3IXQA 1A5WA 4LSNA 1S4EA 2CFXA 4RW9B 3KVGA 1J5EK 3AJDA 4HDHA 4JI6K 5LJ5Y 4M63C 5KFEA 2AQ4A 1J5EJ 1VHFA 2GHWA 2BBEA 2IYIA 1IBKJ 2KLAA 5HVGA 4DFKA 2JX2A 1F2HA 1DTQA 2FLPA 1QQNA 1ZPVA 3DDNA 1V6HA 3I5BA 5KFVA 3WXJA 4DV5K 3KLHA 4CFDA 4URSA 1NSAA 2VB6A 5C10A 2WAQD 5E7OB 1U8WA 2P9IA 4FJ8A 1VC5A 3MN5A 1NDPA 4DV1K 1YBUA 2V2ZA 1F5AA 1PKUA 4HHJA 2D74B 1HNXJ 2QWNA 1REVB 4RUHA 2P9GA 4PL8A 4CD3A 2MKYA 1HYVA 3I6PA 4Y0WA 1QVFR 4K41A 1NJWA 4HCCA 1FKAF 5DG8A 2ZJQQ 1U0SA 2KJWA 3L09A 3CC4N 2HK3A 4PUOA 3MMBA 2MZTA 4ALZA 4CJ3A 3PYDA 1ZM2A 2ASLA 1S22A 2RU9A 4FBTA 1OH7A 4M5DB 2VV5A 1VQLS 3V6HA 2WTUA 3BM7A 2VIHA 4M3RA 3MCSA 2FPHX 2ZDOA 3LQVA 2J6UA 2ROPA 2CYYA 4USMA 4JD2B 5GINA 2GS8A 3LPYA 2HSEB 2OSRA 5AQUA 1N56A 2HVDA 5L9XA 2HVIA 4LFBK 2AJFE 3CCRN 3AO1A 4CH0S 2QEXN 3RR7A 4FYDA 4QOZB 3ZTQA 1LWEB 4LH5A 1VLYA 3MCAB 1J27A 2Y1JA 2QMWA 3N4PA 2XHBA 3C94A 3MAAB 3E51A 3K2PA 1ATSA 1OO0B 3VEVA 4O4GB 3NAIA 5KGXA 4NEZA 2C3UA 1SQGA 2ZJPL 3PDNA 1YUWA 1J9AA 3GONA 3ZZ0A 1SH2A 2ACYA 3AB4B 1HHTP 1FKOA 3D6MB 2UXDF 5AQWA 3TANA 4K2XA 1YF5L 2X6SA 1WEZA 4LFAK 3ENBA 3KK3A 3ETOA 1M90O 1T11A 3A13A 1EETB 2JEJA 1ZC6A 4FF3A 4FVUA 1X0FA 2QWRA 4DR4J 4CDIA 3A1YG 4K0KF 4GVMA 1VQ6S 3HL8A 4YB5A 3SBTA 1L3VA 3WEEB 3KYLA 1E6YA 4B1XB 4YUDA 1YT3A 4N7TA 3UD5A 2OPQA 4F4KA 4EYHB 2VC0A 1FRJA 1EP4B 4NLUA 4NB4A 4JD2A 2E2NA 2XMUA 2FJDB 2VG5A 3JXUA 4BC3A 3CMQA 4K43A 3R5GA 4H8KA 1DRZA 4PWDA 5HBMB 1K73T 4CECA 2R7TA 4ZPDA 2DY4A 2PSZA 4JP8A 2F65A 4B8AB 2ZD1B 3DMJA 4AQYJ 5CAAA 5AQQA 2E1ZA 3EPIA 3GJTB 4RLEA 2QTWA 4BREA 2QXLA 3C16A 4CW7B 5KFZA 3W2WA 4IDKA 3CFRA 3HBTA 5FPNA 1W2BR 1C4CA 4DF8A 1FD8A 5AQZA 3R8YA 5ELZA 1QY7A 2ASDA 3FZKA 3L2RA 4ED4A 1GEHA 4F4XA 3HJFA 2P9KB 2VCPA 2RT3A 3CJKB 3NHGA 4C2MA 5KG5A 5BR9A 1YZ7A 1T02A 2HSTA 2OIHA 4H54A 3QESA 3HZEA 3M1VB 1ZBLA 3M1FA 3MAHA 1X7VA 3NBPB 2HHXA 3FSXA 1RHMB 1GLBG 4J90A 4IRKA 3D68A 3TQEA 4OHZA 2FY1A 3CIZA 3ZZUA 4BRCA 3DXSX 4LIRA 4WBFA 1Y11A 3KG4A 2O8DA 4NA2A 2MDAA 2V2VA 1Y9OA 3G4SS 1Q5VA 1NPRA 2XZTB 2FF6A 2EW9A 4M94A 5IOLA 1YXQA 5D3GA 1DQ8A 5KT6A 3K9JA 3SAFA 3DOMA 3CCWA 3TSPA 1SH3A 1S57A 4YQWA 2D7SA 4WCEQ 2HURA 1Q82T 4I6WA 2IIHA 3TA1A 1HQEB 4LF9F 2I6WA 2J9CA 4K50A 4DTSA 2VG6B 1SJRA 1QHTA 3E1YA 3R9LA 3O3HA 4AQYK 4FW2A 4LFCK 3CJKA 1HI0P 2YQ1A 1YZ6A 2BACA 3ZZPA 3SAGA 2N3LA 2CXEA 4IRDA 3K8VA 4F0MA 3D1OA 1Q5YA 1JLBB 2XGQA 2W2PP 1IR0A 4KKOA 1Z26A 1KFDA 4TYBA 5B7WA 4G3IA 3QQCD 1A7GE 3H7HB 3K17A 1S6PA 2XHWA 3KUGA 1RT1B 2PAVA 4FK2A 4OKJA 4FZYA 2KFYA 2H4YB 1WUAA 2W4DA 2JSXA 1UOCA 4U67Q 4PG6A 2VONA 4QWBA 1NK6A 1KXPA 1VQKN 2YPYA 1RWVB 4ANCA 2C2DA 3WXLA 2ZBQA 3RRKA 5EHHA 1VQ7S 3BGUA 3ZO7A 5KFIA 1O51A 4Q2MA 2IJNA 4HKQA 4MKBA 5LMNF 1RBTA 1MN9A 1EWRA 3RBDA 4J9QA 2VC1A 2LQBA 5L1IA 4OX9F 2QFJA 1T05B 3EZUA 4DCOB 1EARA 5C2GA 3CCQS 1YJNN 3UCUP 4CGHA 2HQCA 3POTB 2FJWA 2KZZA 2KQ2A 2NXEA 1FRLA 4NX9A 3G6ES 2YHBA 4LR8A 1EQYA 2P9UB 4MLEA 2DGTA 2V67A 3G4SN 4GKJF 3PZPA 1FX4A 4IFYA 1S1XA 1KKHA 1DZ5A 4ES2A 1F9EB 5J2PA 4U7CA 4BC5A 1EWQA 4H5TA 1D9FA 2A5XA 5AQKA 2WVEA 1TGOA 5HVFA 4OYXA 2DNGA 4NRUA 4A8KA 3KNAA 3AY0A 1JNRB 5ETKA 4ILRA 4DTPA 2ZZTA 3U6FA 1X8DA 4RU2A 1PYSB 3PLAA 2GBZA 1S1UB 3L6QA 2V94A 1TFYA 4DF4A 5FIIA 3R5DA 2HK2A 3H46O 1H73A 2R7YA 1X9JA 4CESA 1J2VA 1RTDB 3Q8RB 4DUYK 5CXTA 4OI4A 3WDOA 2DY9A 2GV9A 4U8VA 1U1NA 1WOOA 2FVCA 1BQNB 3A8KA 1C1CA 2BE9B 4A47A 2CGLA 1VISA 1CULA 3WQPA 3PX4A 4RNNA 3KLGA 3FE1A 2IGIA 1RHRB 2MSSA 2V52B 4O4GA 3PW4A 5I3PA 4DSJA 2CJKA 2BM1A 1IBKK 5B08A 1V4TA 4CJ7A 2GJFA 4URGA 3LDLA 2C3MA 2X74A 3M7VA 3JQJA 1R7IA 2W9CA 4CI0B 4U9RA 2MY8A 5H9FK 3OTEA 4CO0A 2HHQA 5LSOA 1ULRA 4DQIA 1ACMB 3PW5A 5GAGI 1M1KT 4YNQA 4ZIVA 3WEEA 2IRUA 5E33A 1N34J 2P9PA 1TL3A 5F9NA 3GIKA 1SS6A 1N34K 1ZBSA 1RGVA 5H9EK 1VR6A 2IVOA 2AYEA 1RCXB 3NRBA 1PO6A 2WONA 2UVWA 5BPMA 4NLWA 3CI5A 3NH0A 4FF1A 3A8IA 2OFHX 1FJGF 1X31C 1NXIA 4QWDA 4ISEA 3HRGA 3MMCA 1CVJA 5AQVA 3SCLE 3KHGA 1RT5B 2MXYA 1IUJA 1U2VB 3FCVA 1HQUA 1FE0A 4OQJA 1VRTB 3PFEA 4CP5A 1RA6A 1ZBIA 2YPZA 1X5SA 2YKQA 3DXKA 3IFEA 3OR2A 3QGPA 3OR2B 2R2UA 4NL5A 4UOCA 1WWHA 4MFBA 4IG3B 3PW7A 1WHVA 4XK8C 3SMSA 4BRPA 2UUWA 3ULEB 2IBKA 4QJVA 4MJKA 4WE1B 3NLCA 4ZP9A 2HQGA 2W7PA 1EB0A 3CFPA 2GWJA 4H5WA 1HBNB 4Y00A 2XC9A 5KT4A 4Y34A 3NWGA 2J76E 4CQ1A 3NVKA 3LP2A 2QO3A 2G13A 2Q2RA 3LM9A 2WHOA 4FJNA 2VGMA 4F02A 4KHPK 4BRMA 4CLSA 4J7CA 2CJYB 1X9MA 5AQNA 3BGFA 2JRSA 2NPFA 4CGJA 2FJEB 2W41A 2NXUA 4ZS6A 3PTWA 3R6GB 2KFZA 3PVXA 3P4IA 1HUXA 2HFOA 4JI7K 1QSSA 3HO1A 3JYTA 3CFOA 4NYOA 2XMTA 3M2RA 3R5BA 3PJWA 1FJEB 3M30B 1FDAA 4LT6A 1ITGA 4KT0C 3U4LA 3UDCA 3OYMA 1N36F 1C6VA 2CDRB 4JV5J 4L6V3 3CPWR 3VAFA 1SQKA 2HS0A 4I68A 1WSEA 3V1QA 3EZOA 2I1RA 2PD1A 3MR2A 4I6YA 2V4JA 4Z4GA 3RBZA 2RF2A 4N8OA 4H4KA 5BR8F 4YOWA 4FLWA 1BI4B 3OVBA 1RHJB 5KFDA 1SKRA 3POTA 3V6DB 5KFUA 3BO2A 1FFSB 2P9EA 3UFCX 4F7VA 2RUGA 1XUPO 2D0AA 3AAWB 4DR3K 1Q8BA 5C25B 1B99A 2XRIA 1NGFA 1LV5A 3HMJG 1KVCA 1VCTA 1LOUA 1OSCA 4DTUA 3R8EA 2UXDK 2AYGA 3OUYB 5IV3A 4J9PA 3NAEA 2CJBA 1FRHA 2V63A 3GV8B 3TAQA 2GX9A 3W1YC 1H1VA 5AXKA 1YJNS 1NK7A 4BCAA 1NSQA 2ZJRL 3HPOA 1KS2A 1NH7A 1JLEA 3QETA 1KVKA 2QT7A 3JB9k 2XY7A 2IAJB 1RTIA 4YY3K 5CE3A 4Q44A 4A57A 3VQQA 1VI7A 4ZN1A 4NLTA 4HLBA 4JK7A 2RKIA 2YWGA 4CBWA 2E2OA 3N5BA 2ZH4A 2LMIA 5C24A 2F5GA 1ZZNA 5HAOA 1Q4RA 2L9NA 4CYUB 3BO3A 2C1EB 2XMVA 2FBTA 2Z1IA 1YITS 3JS6A 3DOKB 3CCES 1UFKA 1VQ5S 2VICA 2DCUB 2Q36A 1FWLA 5KT5A 3UI3A 3PR5B 3WT0A 2QSWA 2EFQA 4CZEA 2DPNA 1DQ9A 3KKRA 1C1CB 4GVEA 3FQLA 2M4MA 2B51A 1TYQB 5GAEI 4DFMA 1NRKA 1S77D 1RDBA 4E1MA 3EGNA 3P49B 4Y3CA 2AYBA 5E3CA 3LDNA 4P2MA 3KK1A 5HI7A 1HYSB 1JCFA 1G3OA 2GX8A 4B3OA 1NDLA 1UVJA 2W9CB 1SB6A 3U02A 1N5TA 4LFCF 2DGWA 2IY5B 2DNLA 4UY85 1U7LA 4M5KA 3NGTA 5T7LA 4DR6K 2XS7A 1U6ZA 2WC9A 3QYYA 1ATRA 4FO0A 1K44A 1YI2S 3E66A 1JJ2R 3TTFA 1I5OB 3ZETB 1D1UA 3C14A 3FK4A 1KC8T 5BRFA 4TSXA 3FFIA 5ETPA 2ZWPA 4H0VB 3SK3A 1XR7A 1RB0A 3CJ4A 3W9HA 1VSEA 3RJMB 2JLEA 1WAFA 2KG1A 5K8OA 1IKYA 2ASPA 4RBUA 1P1TA 3T9ZA 3M3ZA 3EEQA 1FFGB 3GSDA 4BRQA 3LGNA 2DPIA 4OYMA 1VJQA 2ZVSA 3QGHA 2E20A 3QATA 3BZKA 3VGUA 4PKDB 4DHYA 4UQTA 4CK3A 4Z4EA 2FBVA 4B9QA 2XYPB 1VRUB 2IDOA 3WXIA 4JKFA 1WEYA 2OP5A 4DBQA 3M2VB 1TKXB 2OA8A 3IRWP 4ZLJA 1W97L 3DLRA 3H40A 4GO7X 1WSVA 3MM5A 3PXGa 3GPAA 3OD2A 3U1NA 1WORA 1IBMF 4IG3A 2BJ3A 1FXDA 2WCXA 2VFRA 3TA0A 3IG1A 3SI8A 1Q79A 3BUZB 3RW7A 4YDUA 1WEXA 2LA6A 1IWAA 2G1DA 4JI8J 3DOMB 5JVGL 1NGJA 3PRDA 5DLFA 1ZAVA 9RUBA 4KI6A 1VFJA 4X66F 3KMQA 9ATCB 4P72A 2R4FA 3NFAA 3VAHA 5KT2A 4DV5F 2LEPA 3QFUA 5EX0A 1HKCA 4DV1J 2YKMA 5HMYA 3V4MA 4S0MA 4ZITA 4DV6J 4OVLA 3SSRA 8RUCA 1H7WA 3D2EB 2MTLA 4GY2B 1YJRA 4B3TF 2DY1A 1JXEA 3M5RA 2HF3A 4IXCA 1P9QC 2GIFA 4LF6J 3AT1B 2Y0SD 3W64A 5FD1A 4ICLB 3CC2N 3H4DA 4XEIA 3GBTA 3MN7A 4DV4K 3MR3A 2OMOA 1UEKA 1NK4A 3TU5A 4AHCA 4RW4A 4B3SF 3RWUA 3DI6B 1TL7A 2FSNA 4N47A 2IJRA 1WC0A 5EVZA 2VDIA 4OV1A 1BO5O 5EXWA 2M0GB 1UVMA 5JVHL 2VBZA 4A59A 4PKHA 3JTOA 4C0HA 3OPKA 4PPZA 5EOYA 4KAZA 1CJTA 2IPOB 1N33F 3AARA 3VPZA 3D2FB 3V6KA 2QMXA 2HBMA 4Y2IA 3OYKA 2ZOMA 1GT8A 3HHEA 4Z2XA 1Q8IA 1QD1A 4OO1J 1NHKL 4QCLA 2AP1A 5JLFA 3AQOA 4FLXA 3MTKA 3MUVP 3KLEA 2PA3A 5HN0A 4B9NA 4OZ5A 3IAS9 3Q8SB 3QERA 5KFLA 4CLKA 2OTLN 2DPJA 5F3TA 1JL1A 2LEBA 1K0VA 2CZ9A 4JB8B 1JCGA 4KB7A 4WU2A 1TUYA 2QE5A 5IS2A 2ZBRA 3W3DA 3C6UA 1HYSA 2E5LK 1JJ2M 1RT4B 4F2RA 4IFYB 4Z4FA 8ATCB 5TKYA 4I64A 1FJGK 2DR8A 1ZXOA 2R8JA 4FJGA 4OYBA 4M5MA 4KV8B 2GJIA 2M3DA 3CXCR 1RHQB 4OYIA 4PQUA 3FR0A 5KG0A 4ZCIA 3GYGA 4USJC 1C2PA 3ZSXA 4DSIA 1H72C 2ZOFA 2CPXA 2W25A 3ZT4A 3MF5A 4QWCA 4JBCA 4IJNA 4TNOA 2ATLA 5EGYA 2WBNA 1H98A 1LKZA 2W6LA 1DKGD 4E7IA 1FXRA 4JI6J 1SL2A 4CJWA 2ACMA 1Y5LB 2ZNZA 3MCPA 4CGDA 4E2FB 1WDDA 2G8KA 4OL8A 4JKGB 3OUYA 3KFWX 2WBRA 2VGNA 1HQUB 4FPBA 2IM0A 4PY5A 1MROA 2P5VA 3EO3A 4Q43A 4C0OC 4WFAQ 1EZZB 1CS4A 2QMUB 3DGPA 2DFEA 5KFCA 1H3DA 2ETJA 3JAMU 3OFEA 2F63A 1WN7A 4JI5K 3NL0A 1RTIB 2OEMA 1J54A 2HRTA 5HL7Q 5E0OA 4O5BA 3V4IA 4OHWA 1W7AA 2YHYA 2M2BA 5JXSA 2EWSA 1H2TZ 4ZVFA 1S9FA 5SZTA 1YIJN 3EGZA 5C2DA 1TMJA 4B1ZA 2MZRA 1U09A 1XNRF 2A42A 1RDAA 1N32J 3R7BB 5GAEP 2L3MA 2RVJA 3L3UA 4M3YA 4FS1A 4DV4F 2VFUA 4LF5J 5L39A 2V4QA 1TQLA 1H2UX 2BQ3A 2MJNA 3HZ6A 2DGQA 4WK3A 1PYOB 3QICA 4A48A 2BJDA 4LF7J 3AVFA 5B0GA 2AJ1A 1L3TA 2J6TA 5CYQB 3AJ1A 5TKWA 3DWLA 2YWFA 4CHZA 2RILA 1VSDA 1N6QA 3THYB 2J0WA 5KAKA 2W4CA 3I8DA 1NJXA 4IOXA 3OYFA 4BDPA 3HSJA 1SL0A 2VG5B 3T3FA 4CJRA 3KNGA 4WPAA 4YDXA 2LQ5A 1M5SA 2HAFA 1RGIA 4KFBA 1J5OB 5D78A 3PYEA 1SKWA 3O4NA 5AE3A 4HTUA 1JL2A 1Z1ZA 3RVCA 4DV0F 2YWWA 5KFNA 4NYFA 4JI0J 3D3BJ 3H42A 3V4IB 4H0TB 2MLZA 4W90B 1OWXA 2H3GX 3QLHB 1HPMA 3BH6B 3UN5A 4C6AA 4CF0A 3ENVA 3A2FA 1VJWA 5J2QA 2JEGA 5M1OA 2B3TB 3LA0A 3PKYA 4LF8F 5AQJA 2FVQA 2QYGA 1S5ZA 3V9XA 2N4DA 2PGCA 1LXNA 5F2RA 2G8UA 2BMBA 4DTRA 1LAWA 4X62J 3OTOF 4PQAA 3K7RA 3G9CA 4Z4IA 3O1LA 1N5SA 2AA4A 2VJVA 3QJJA 2LEAA 3W2WB 3VQ6A 2J8SA 4CJVA 1T03B 4K4XA 1DFDA 1WG5A 3MEDB 3AVCA 4B3SJ 1TR0A 4EP4A 4LRBA 4DTXA 4QIFA 3VAIA 5G4DA 3KJVA 1JLAB 1PJ7A 5A8RA 4CO5A 3KK3B 3CMES 4V1Ak 1L3KA 3CJSA 4YOTA 4CHYA 3Q83A 4AFFA 5JMVA 3ILJA 2DH8A 2J0XA 1UFWA 5LL6Z 2VFSA 4QR1A 2D3O1 4KV8A 3LP1B 2YV0X 2E66A 3G25A 3VQAA 3EDRB 3P5TL 1RTJB 4CJSA 1PIEA 3K59A 3AA9A 5DM7L 4Q0BB 5CQGA 3M9NB 3RGIA 2GQQA 1PAUB 1JMTA 2BM0A 1SKSA 1HPZB 5EUHA 2OPQB 2FC0A 5HJXA 4WK1A 2HMPA 5E84A 3TZWA 1ZA2B 4CGIA 1K8KB 3VEXA 2QXFA 2G0CA 1CXQA 1KAZA 4PWUA 2BJ9A 1XTZA 4H4MB 4X84A 4ZPVR 4PG4A 3BF4A 4IUFA 3F9KA 1YHQS 3ID6A 4GW6A 2J6SA 4CEQA 1HI8A 1IKWB 4BDZA 4E89A 3AH6A 5HO4A 4DUTA 1XQIA 4A46A 2OTJN 4OJRA 1CC7A 4DX5A 3GFZA 1X5PA 3W5YA 1SPBP 4QBUA 4WFZA 4JKBA 2FTRA 3CHWA 2RN2A 3CJTA 4QAGA 4OPKA 4J9MA 3W60A 4CH1A 1AZSA 4BRFA 4FK0A 2VQFF 3ULEA 5L38A 3MXIA 1K47A 2AMCB 1V3RA 1OKJA 1Y0HA 4KHRA 4ZHRA 2HBQB 2HVZA 2AWZA 4TLRA 2D3OR 2HMIA 4FS2A 2DITA 4KTWA 2EK6A 3G6YA 3TAFA 2FHMA 1RDCA 3GB0A 3WNHA 3GQCA 1VC0A 3DYAB 3I4HX 5FJ4A 3CUNA 1MLAA 3NGRA 2QSFA 3NGDA 4O0JA 2DO4A 4OX9K 1IKXA 3NCQA 3RTVA 1TKZB 6FDRA 2ZGYA 1X3NA 4C4WA 5K8PA 3N79A 3DNCA 4MAKA 2M8DB 3O4QA 3QWUA 3TX8A 1HD1A 2UYTA 3CCMS 5IT9U 2XSJB 1KSPA 2FIUA 1BWEA 1O6XA 2V4JB 3PIOQ 4EAHD 1JLGB 4ATNA 2NXNA 4M5HA 1A9NB 4I56A 1S9GB 4BVPA 3I0SB 2C28A 4M95A 1P8ZA 4FWMA 1LFWA 3WNEA 3M8SA 1VQ4S 1B7YB 2UUAK 3S41A 4DV7J 3I33A 8AT1B 3U1LA 1UVKA 1B9DA 4JKGA 1EKRA 5HLFA 3D45A 1FXXA 5J2PB 2GUPA 4M3WA 1VRUA 2OH2A 2HKEA 4K4UA 2JJ4D 4JI2J 4YR2A 4MK9A 4AQYF 1U1OA 4KBIA 1C1BB 2X3GA 3SV4A 3ZXWA 3KLGB 1RAEB 1R59O 5AZIB 3ULHA 2PI5A 4CLFA 3A5MC 1NK5A 3DOLB 5KQ8A 3ENHA 4CLLA 1QTNB 3JTPA 3CCVN 2JWLA 1HYZA 1ZBHA 5C2CA 4NZ6A 1Q8LA 4NLYA 4AUKA 3QT5A 1IO2A 3PSIA 1VYAA 3UN3A 4JI5F 3ILIA 3OYCA 2W40A 4PXCA 2MJUA 1NU0A 4LRDA 1WNSA 1GTHA 3NOGA 3UO0A 1A5VA 4G1QA 3KG1A 4BG9A 2CQDA 2NQPA 3P5BP 3NEKA 3BDPA 1HD0A 2DR7A 3U27A 3VEYA 4DV7F 3GMGA 2ZH8A 4CIEA 4F4ZA 4JI3F 3QWPA 4TU8A 3GG4A 4BGBA 3AA8A 4DR5F 3VZIA 1JLAA 4G9ZA 1WG1A 3M6XA 1IBLJ 4O8KA 1VQ4N 3TAGA 1NSKL 4K2JA 4DTMA 4HTJA 2QG9B 2E7XA 4L8RB 4ZCKA 1LWFA 4B02A 3OYHA 1VK8A 4FSVA 3T1AA 1EKEA 2OPSB 2FZKB 4USUA 2FVPA 2CQ3A 3HJVA 3H2UB 2HS3A 4KTZA 5JS2A 4YR3A 1TL1A 1VQ8N 3CMAS 4AHUA 4BWMA 4ILLA 4QQBA 3S01A 3W9IA 3VQ4A 5M1PA 1D3WA 1K8AO 1GLFO 3NP5A 4ZLLA 3QFPA 3AHPA 4KH0B 3AXKA 2WB4A 5THWA 2DIUA 2W4PA 3I56N 2F40A 1W2IA 5L46A 3M6VA 3OYIA 1FCAA 2AGPA 4OPAA 1PSDA 2H51B 3AOCA 1F21A 2Y1LB 5GAEU 4W5QA 1H74A 3TVZA 4CJEA 4WQ5A 2CA9A 3SMPA 3CEDA 1FDDA 4YN3B 4RW6B 2UUCF 4RW6A 1LW2A 4IR1A 3L7PA 1S6PB 4AT1B 1D9AA 1HRHA 4A2BA 5IQQA 3OT9A 4RR5A 3T9NA 1NMEB 3NH2A 4JRPA 1B70B 2ZH5A 3D6RA 3G71N 3HHDA 2QA4S 3NNHA 4NXMF 2WVCA 3PO5A 2B7CB 2ALYB 2NRVA 1FE4A 1XNQK 4RU9A 4O44A 1FO1A 3AVBA 4UZCA 4I6MB 2YX1A 3UWTA 4AL6A 4ZTJA 4ANDA 3O6WA 4X4VA 3CYMA 1RSCA 3VTIA 4DX8H 1WI6A 2CNNB 2B9WA 1TL1B 1WC5A 3LP0A 4DR5K 5KT3A 2PYJA 4I2QA 2CWXA 3I0SA 2DRDA 2Q0UA 1JB0C 1F9HA 3MM6A 2Y3YA 2E29A 3CQ8A 1HJRA 3THWB 2C2ZB 2AU0A 2E7VA 1XBWA 3T5KA 4YOYA 4MO4A 3GR0A 2V8DA 1WSIA 4DHVA 1QAXA 4XPCA 2C3PA 2RAQA 4KH6A 2G1HA 3N6NA 3TO8A 3PM9A 2O4IA 1IKWA 1N88A 1C1AA 3AAPA 3DGPB 1IBLK 2CRLA 4G6VB 2Z2ZA 3BYRA 3MM5B 3CCMN 3Q22A 3US5A 3CCRS 1AYEA 2IM1A 1F2GA 3PIPL 2QI2A 3HF5A 5AJ3J 3Q2SC 2BGGA 5FLXO 2EEYA 3TAMA 3TAMB 1YJ9N 5MAOA 2XEXA 4BHQA 1VQNS 3QIPB 3A8YA 2NRTA 1VAZA 2QIFA 1PILA 1GNKA 2V8GA 3L2QA 3O3GA 1GMUA 3KWMA 4QWEA 3C66A 4CIGA 2AX0A 5BR8J 1TUGB 2NRRA 2NXJA 1FKPB 2JEFA 1DARA 2B4UA 1HNZF 4U96A 4B08A 3UD3P 3H25A 4DV4J 2HGLA 3HSCA 1VSJA 3I96A 2ZGZA 3MPWA 1UPMB 2XS2A 3N5FA 4ANEA 4NXMK 1VDHA 2HS4A 1IKXB 2IA0A 4OYPA 2GQ2A 1YJ7A 3MMAA 3QB0A 4ZPAA 4IJAA 2A18A 4DV6K 3VERA 4USVA 4Y2CA 3FBBA 2ITMA 3M4XA 4XO0A 7FD1A 4KHPF 3SNNA 3OYJA 2ZBCA 5A76A 4X64F 3ONQA 2YNIA 2MZQA 3N6MA 3QT7A 1T44A 4YOUA 1HHQA 4LF2A 1O0PA 1JKHA 2ZFHA 2KYXA 1D4XA 4HYKA 3SJJA 3PUFA 5J1EB 4DV7K 3L9ZA 4M5DA 4J9KA 4Y28C 3KLFA 3CCVS 1XC9A 1WI8A 1VBZA 4ETZA 3KD5E 1BHNA 1RP5A 2P9LB 2OFGX 3TUJC 2FJBB 2GMJA 3EGWB 2YCHA 2E7WA 1NNEA 4J9SA 1OY9A 5AQPA 3HHKA 1VSHA 4P6QA 4JHDA 4EO6A 3MOZA 1PJ6A 1R6VA 1BQNA 4CZLA 1X4GA 2DXFA 2Q79A 4RNMA 4CNYA 4U7UD 1FRKA 5ADXA 5KPTA 4WZQA 2P6TA 3FZFA 2A6AA 2BV3A 5GAGU 4KR0B 1S1TB 3TWHA 2CGKA 4DS4A 1LCUA 1M90T 4QOTA 4FCYA 1T95A 4UUWA 3HSTB 1RT7B 5LMUK 3A5OC 1OVYA 5D0GA 1CBKA 2MHNA 3RZAA 3MM8B 3BR9A 4RX6A 1TKTB 5FRMA 4DUYF 1TL5A 2J7KA 5HQLA 2MZJA 4CERA 4PR6A 3AOBA 2BTFA 2O8FB 1R31A 3OSNA 5KFBA 3OXGA 1NHUA 1JLQB 4HR2A 4ZOSA 4OIXA 3ZSVA 4A8OA 1WAJA 4DU7A 3ZT1A 3W8GA 3J7AP 3BGLA 3UPFA 4C3LA 1UAXA 3OSPA 3CCTA 1E4FT 2H65B 3GE9A 2AZ3A 2JWKA 3Q8UA 3QO9B 3NGZA 4K8RA 3UDVA 2OMLA 3G71S 4OYZA 4NLXA 1TUUA 4QS7A 5DK5A 2QKKA 4LF9K 2F1FA 1VQ9N 5BREA 1T9VA 2W7AA 2YQ0A 5IT0A 4QR2A 2XMAA 3D66A 3SCIE 2H9ZA 4CK1A 1VC6A 2GGPA 3IWLA 1JNZB 1TK0A 1WSRA 2EG2A 3C65A 2ZBIA 2EWHA 3V9WA 4QIWD 2O8BA 5KRSA 1MNEA 4ED6A 1LWCB 4CHNA 2P9NB 1UFLA 2FSJA 1KVAA 2YNHB 3SFGA 1U45A 4DR3F 1HNZK 2NREA 2DGUA 3TUPA 2F7TA 3M32A 2MQQA 3RR8A 3H5UA 4I9QA 1Y64A 2I5JB 4BG8A 3M2UB 4JLHA 2NSCA 2RPIA 3V1OA 5E41A 4J9NA 1C0UB 1ELOA 4C8NA 2IVNA 3SQGA 2GUIA 4DV6F 2VA3A 5GMDA 3D6TB 5KFFA 3O3FA 5IC4B 2GIRA 1XC3A 1TKXA 2P8IA 1N36K 3NXZA 4BGAA 4ISGA 1UP1A 4EU0A 4FJIA 1LEOA 5KFGA 3O2IA 3E01A 1KN6A 4D3HA 3GYXB 2IAJA 2OO4A 2O8DB 1F9FA 5KFQA 2MKJA 3QEXA 1HBOB 5DDPC 4KY3A 2HHUA 2F9TA 1DHMA 4CZIA 3R7SB 4IH7A 4B3RJ 1QZ6A 4OZ2A 2ZWHA 3WBZA 4I7FB 4IO8A 3GCWP 3P3DA 4X62K 1PYTA 2X1FA 2UP1A 3CJ9A 4KHYA 3TP2A 3I5AA 4ERDA 1IBCB 2ZE2A 5GAHU 2W9BA 1ZM3A 1QVGM 3R5JB 3I4PA 1IR1A 3KTQA 1BUXA 2KM8B 2MYFA 4P73A 1R0CB 4I2QB 3V81A 1PCAA 1B0PA 3EYZA 2E2PA 4JI4K 4JS4A 4DU4A 3M2UA 1WTBA 2KI2A 3RB0A 2EG1A 5K8MA 1DGKN 1FRXA 4HTIA 1S1WB 3I82A 4ZMMA 5KPRA 3DN9A 2POKA 3CJ1A 4LH4A 1N54B 2VWBA 1ROFA 4LIWA 4M5JA 2XMKA 4ID8A 4K4TA 1QQMA 3K5NA 3QPIA 3IN5A 4QW8A 3DHXA 2YHWA 2CZ4A 2B8PA 4FF2A 2CJ9A 3W0LA 2HBJA 1C0FA 2B6AB 3ZETA 3WC0A 4NZ0A 7AT1B 3G0ZA 4G65A 2CADA 2ZHOA 4V19X 3F44A 5AZIA 3TJAA 4DL3A 4AL7A 5A2QY 2B7BB 2BKNA 3RSEB 2CPHA 3CIMA 2DGSA 2KW4A 3GIJA 2RD5C 2ZHBA 4JI3K 4L72B 3MFHA 1X9SA 4CK2A 3C6HA 3MCMA 2DR5A 2JL9A 2SXLA 4P2XA 3W5XA 4BRNA 4ELTA 2YJEA 4IBNA 4ZVTB 1PJ5A 2J0QD 1CS4B 4EYIB 1RU2A 4UF4A 2UU9J 4DV2J 2XLIA 1NHVA 1Y10A 4F04B 2F4VF 1KEKA 1SC1B 2YHAA 1HNWF 3Q24A 1J5EF 3R2CJ 3QEPA 3G2XA 2J4RA 3MTJA 4M63A 2M9KA 5D4LA 2EC2A 4CHPA 2L9DA 3EL2A 1C0TB 2C3OA 4DFJA 2DHHA 3FFKB 4O44B 1YHQN 5D4PA 5ETQA 2UUCK 1WOPA 3CJ3A 4CJPA 2R2SA 1KD1T 1ZAWA 4JI1J 4Z7CA 1MN7A 4J2BA 4DSLA 3GJSB 2MY7A 3MI7X 5H9FJ 5C5JA 1YTYA 2XTJP 3M6WA 3CJRA 1LAVA 4DV1F 4RUCA 2RIJA 2X51A 1JWWA 4B8CA 3CSKA 4WYBA 4TLQA 2LXUA 5FLXU