2ZD1A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with tmc278 (rilpivirine), a non-nucleoside rt inhibitor
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
554
structure length
554
Chain Sequence
MVPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title High-resolution structures of HIV-1 reverse transcriptase/TMC278 complexes: Strategic flexibility explains potency against resistance mutations.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase, hydrolase/inhibitor
total genus 159
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2zd1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2zd1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2zd1A05
4OLAA 1A5VA 1C1CA 3CJ3A 1EX4A 4B9TA 5KGWA 4CGIA 1KVAA 3OSNA 3DLEB 4ED2A 3RMBA 3MXJA 3KHRA 4NCGA 4FK2A 4OPJA 3L3UA 4OGCA 3SQ4A 4DS4A 1WAJA 3NGDA 1WSJA 4LSNA 4KB0A 4EEYA 2ZQBA 3V4IA 3OYDA 3HVTA 3VQCA 2AU0A 1S1VB 1Y97A 1QUVA 1JKHA 3BDPA 1LW0B 4FZZA 1G15A 3SQ2A 2ASJA 1RBRA 3PX0A 4H4OA 5L9XA 3LAKA 3IN5A 3MEGA 2JEFA 3L2QA 2B6AB 3CFOA 3KK1B 1WAFA 4RNNA 3O4NA 3T5JA 1TK5A 5KFNA 3DMJA 3B6PA 4CECA 4OGEA 1DTQB 3HPGA 1NNDA 4FJ7A 4F3TA 1EKEA 2OPSB 3KLGA 4NYZA 4O3OA 2ZE2A 4RG8A 1T03B 2ASDA 1LWCB 1BL3A 2E4LA 1WN7A 4IDKB 1J5OB 4QWDA 1LWEA 4KB1A 2IC3A 2W8KA 4R0EA 2E9RX 4ED1A 4CJKA 4ECXA 3E01B 4YR0A 4F4WA 4NLTA 4M41A 2BANB 4QOZB 5CYMB 1GOCA 4RW8A 3CJ4A 4CIEA 1IKXB 3CIZA 4DTJA 3ZSRA 3SCXA 2B4JA 3MECA 1F21A 2XRIA 2YNHB 1K1QA 1K1SA 2RDIA 4DL2A 3VQDA 4N5SA 4I7FA 3RRHA 2GC8A 4ZTJA 4BE0A 4IG3B 3ZCMA 1N48A 5KFEA 3TAPA 1NOZA 5J2MB 2QV6A 4DL4A 3K5LA 4C8LA 3LZIA 4DTMA 4KV8A 1U45A 4PUOB 4ZMMA 1L3TA 3PW7A 3ZSWA 3CJ0A 2I5JB 3PX4A 4J9KA 4ZPCA 3QIOA 3KLEA 1KLMB 3FFIA 1TGOA 4EBDA 1VRTA 3OYGA 4MKAA 4GVMA 4QWCA 2DY4A 3BGRB 2IDOA 4N41A 3T3FA 3AVLA 4YMEA 3SQ0A 1S1WB 4GW6A 4TQRA 4CJQA 4E89A 3WNHA 3AVFA 4ECVA 1SH0A 4FJMA 4BDZA 2DPIA 4EP5A 1SV5B 4AHTA 3DLEA 1Q9YA 1TV6B 1JL1A 4KHRA 4F4ZA 3M9MB 5DQHA 3O3HA 3KK3B 3MEEA 4KHMA 4ECQA 5CYQB 1YTAA 3LPTA 3V9UA 4JS4A 2YHBA 4KFBB 5F9LA 2IBKA 3QNNA 1S1VA 4Z4GA 3MR2A 2WHOA 1VK0A 3H08A 3MR5A 3GQCA 1I3AA 2OPRB 2GIQA 5KFAA 4OLBA 3NCIA 1ASUA 4M3YA 5KG2A 3NF9A 2HWHA 4Q43A 1X1PA 1KFSA 4FJJA 4ID1A 1BIZA 2G8KA 2B6AA 4IH5A 2AX1A 3NKYA 3G6YA 1WSIA 1MU2B 4DF4A 4CEBA 4ELUA 2OH2A 5KFQA 5SWMA 3V9ZA 5KFSA 4CJTA 4M3TA 1RT5B 1N6QB 1LAVA 3GV8B 4EBEA 1WNSA 3G86A 1QHTA 2FBXA 2HNYB 1X9MA 3L2RA 3QGGA 1CSJA 4EBCA 5CZ2A 1C2PA 5KFDA 4IDKA 3G6XA 4HCBA 2O5DA 3H5UA 1S9GB 2NUBA 1RT3A 4F4XA 5DGBA 3M9OB 1R0AA 3RBDA 5KT7A 4KO0B 2HVHA 1IKYB 3E01A 5DQGA 4BWJA 2BANA 4I2PB 3HSTB 1HQEB 2KTQA 3QO9A 3OLAA 2R7YA 3PR4A 4CK3A 3Q8PB 5HRPA 1B9FA 3RWUA 3FRZA 2IM0A 4Q0BB 2IGIA 4H54A 4TYBA 4LY7A 2R2TA 3D28A 3N6MA 5F8HA 1CXQA 4ZP8A 3HPHA 1IKWB 2D3UA 3DI6A 4HKQA 1S49A 1C6VA 4DU3A 1S1TB 1JLGB 2I5JA 2HW3A 1HARA 3GILA 3QZ8A 1S9EB 1GX5A 3DLHA 1S9FA 2X6NA 4ED0A 3DYAB 3ZT0A 1JXLA 3DM2B 1S1UB 4CEFA 2HB5A 3LWLA 4FW1A 3V1QA 1S1WA 1XR6A 4MKBA 1S0NA 3V9XA 2HNDA 2OYQA 4RU9A 4M45A 3PHEA 3NHGA 4O3SA 4CK1A 1B92A 3LPUA 2F8EX 3TQ1A 4Y3CA 3MR6A 3KIOA 3V6DA 1WSEA 2E9TA 1TV6A 3LWMA 3BJYA 1ZTTA 1C0UB 3Q8RB 5KFUA 2Z1IA 4FJ9A 1FKPB 3QIPA 3DLKB 5F8NA 4H4MB 4YNQA 3LP0A 4KFBA 4TY8B 2XC9A 3TABA 2P51A 1VSMA 3I5AA 3VN5A 2YHAA 1REVA 2W9BB 4DTXA 2OPRA 4N56A 4RW9A 4PWDB 5KRTA 4KHYA 2EX3A 3PW4A 4DTRA 1RAJA 2PY5A 3DRPB 3DRRA 3CG7A 4KI6A 4ELVA 2D3ZA 4F3OA 4FS2A 1MU2A 2VG5A 3QEWA 1HMVB 3NAHA 3B6OA 1TKXB 3Q8QB 4CJEA 4ICLB 4HCCA 4OKKA 1TK8A 1RBUA 2C2DA 1C1CB 4IRDA 5EWGA 4AHRA 1NJYA 4B9MA 1QS4A 1A5WA 4O4RA 3MXMA 2XY6A 2C2EA 4LD0A 2W7OA 4M3WA 3SI8A 4NCGB 3O3FA 4LH4A 4DLEA 4XPCA 4I2PA 1HQEA 3KJVA 3UQSA 2IM3A 4IRKA 4FM0A 4OKEA 3SUNA 1KLNA 1BCMA 4ZVGA 1ZBFA 4FYDA 1JKHB 2ZD1B 5KT2A 3AVCA 2ASLA 3JYTB 4KE5A 2HHWA 3GYNA 1J9AA 3MXIA 4EZ6A 4ZVHA 1LW2A 4MIAA 4B9UA 4CFAA 4J2BA 2G8WA 3HHKA 3GIJA 4NLXA 3V6KA 3VQSA 5DG8A 2C2RA 4NZ0A 3QEPA 3RB0A 5HP1B 1S1TA 1JLGA 3TVKA 1Q9XA 3ASMA 3C95A 1QE1A 3U3YA 3ITHA 4N76A 4U6PA 1S9EA 5K14B 4HTUA 3KD1E 3ZSOA 3SJJA 3KLGB 1RTJA 1HYSA 4Q5VA 3VQBA 2ZE2B 3GV5B 5KFFA 3MFHA 2B5JB 4IR1A 2RKIA 3QLHB 1LWEB 3T5KA 4KHWA 1NOYA 3FQLA 5FRNA 1JLQB 3RMCA 4NLRA 2X74A 2D7SA 4ECWA 4DG1A 4Y1CA 2P1JA 2JEGA 2WB4A 4O4GB 3GIIA 4J9LA 1SKRA 1I39A 3DDKA 4BE2A 2BDPA 4IKFA 3DLKA 3A2FA 1U09A 4KTWA 2DFHA 3KK2B 3WNFA 4TY8A 3OYLA 3VQ4A 1RBTA 4RW6B 2KQ2A 2WOMB 4YR2A 1KHWA 2W9BA 2AGQA 1TKZA 4AH9A 1RBVA 3V9WA 4FBTA 3KLEB 4WZQA 1NKBA 1TL3A 4CFBA 3FFIB 4FK4A 2W7PA 5L1LA 3Q8SB 1RDDA 1HMVA 4KB7A 3LAMA 1TKXA 2OZSA 1IO2A 4ICLA 5KT5A 4IQXA 3NH1A 2HHQA 4DTUA 2UVWA 4JV0A 1S0OA 4WE1B 5KTQA 4B9NA 4DQIA 2ITGA 4HUEA 1ASWA 2HHSA 3ICLA 3S3MA 3CDEA 3PZPA 3EY1A 4XIUA 1HYZA 3H4BA 2FLNA 1IG9A 4NLSA 3PX6A 2XHBA 2Z1HA 3IAYA 1QTMA 3BSOA 3FDSA 1KRPA 5L1KA 4CGDA 1T8EA 1XC9A 1HPZA 1TQLA 3O3GA 3LP3A 4CJVA 4Y2CA 3MEEB 2R2UA 4FJ5A 3AA5X 4URGA 1S10A 4AHUA 2FVQA 4W5QA 5L1IA 1HNIB 4B9LA 3OL9A 2ZD1A 3HVAA 4J9PA 1C1AA 2Z1GA 2QK9A 3JYTA 3AVKA 3PO5A 3SUPA 4LSLA 1LAWA 1YTUA 3BQ1A 4WFYA 2VWJA 4FS1A 4NCBA 5HP1A 2D0AA 1XHXA 1UOCA 4KBIA 5KFMA 3KTQA 5HBMA 3VQ9A 4OL8A 1HYVA 5K14A 1J54A 1B9DA 3DRSA 2AGOA 1KVBA 2B5JA 4IFYB 5FROA 4ID5A 1KHVA 1RDBA 1D5AA 3QLHA 3NMAA 3DOLA 3AO4A 3MF5A 1RT3B 2FBVA 1R0AB 1JLQA 3PR5B 3HL8A 4BACA 4IH6A 2KFZA 4FM2A 5J2PA 4O3RA 3BREA 3S3OA 3ZSVA 1NK0A 3QO9B 4O4GA 2XCPA 2AWZA 3RMDA 5T7BA 1KVCA 2QXFA 1D9FA 5KFLA 4EYIB 3NBPA 2V9WA 4I2QB 2ALZA 4J9OA 3KLIA 5EUHA 3WNGA 1RT6A 2DFFA 4QW8A 3CDWA 1EXQA 3KK2A 5F9NA 3C94A 4KHNA 3DOKA 4RW6A 3ZSZA 2WOMA 3G0ZA 4B9VA 3VA0A 2WCXA 3FSIA 4F4YA 1L3VA 3DI6B 4AILC 3OJSA 3OYJA 3H2LA 1SUQB 3OS0A 3RAXA 4FJGA 1VSIA 2E6LA 4M42A 1KSPA 4TXSA 3KOAA 3L8BA 1N4LA 2O4GA 5CY4A 1SL2A 1BIUA 2IJFA 2GUIA 4WE1A 4BE1A 4ED7A 4DFJA 3TAQA 2HNDB 4ZTFA 4WZMA 1CZBA 4ECSA 4Q8EA 1VSDA 1NK9A 4CGHA 5J2NA 1T05B 2FJWA 4F50A 5F8GA 3I0RB 3K59A 2IMWP 4NLUA 4QWAA 5C24A 3H59A 3V6DB 4BDYA 1SKWA 1GOBA 2G8HA 3RR7A 5KG4A 2E9ZA 1JLCA 1BI4B 4CHNA 3V81A 4RW4B 1D0EA 3QESA 4J9RA 2ILZA 1RT1B 3NAEA 3QIPB 4CGGA 4FK0A 1QSYA 2OPQA 3LP0B 4CGFA 3OYAA 2EHGA 1HNIA 1BHLA 3ZSYA 2HNZB 3CDUA 1REVB 4FCYA 1CLQA 2LSNA 4RW9B 4XPEA 4ZP7A 2D5RA 3QEIA 3SPYA 3AVNA 3DRRB 1T94A 3HKWA 2VG5B 3AA2A 1X9SA 3HJFA 1S1XA 1FKOB 4Z4CA 1SH2A 5HRSA 2OA8A 4JUZA 4R8UA 3KLHA 2YKMA 4IFVB 3WNEA 4IG0B 3SNNA 3AO5A 3IG1A 1RT4A 5D3GA 3M9NB 1NK6A 5KG3A 1JLEA 4IFYA 2BE2A 4YR3A 2KW4A 2Q3SA 5J2QA 2HHXA 4DMNA 5KFOA 4CJUA 3KD5E 5KRSA 2R8JA 3BQ0A 4KHUA 3VQ7A 5I42B 4ED3A 3OYIA 1ZBLA 2R8IA 4HUGA 3OS2A 1S4FA 1IH7A 4Z4FA 3QEXA 4ECYA 3OYCA 1RDAA 3AVJA 2UUWA 3CQ8A 4IOBA 4C8NA 4C8KA 3KJVB 3TAGA 3AA4A 2G8FA 5CZ1A 2RPIA 1U4BA 2C28A 2KFNA 4FW2A 2FJXA 4ELTA 5HRNA 4I2QA 4CF9A 4NRUA 2A1RA 4FJ8A 2JC1A 4Y34A 5DK5A 3ALYA 1ZTWA 4L8RB 4J9NA 3AVAA 3TAFA 4K4VA 4DQPA 1LW2B 4MK8A 4WXOA 4ZHRB 3KKSA 3HVRA 5KG7A 3OSPA 2AQ4A 3OHAA 4UQGA 3OVNA 1SUQA 2B43A 1QE1B 3EZUA 3ITHB 2OZMA 3AO2A 4CF0A 3PY8A 1RTJB 1HYSB 4M3ZA 2FVSA 3LP2B 3QIDA 3LP1A 4CF8A 4NLWA 4G1QB 2RKIB 4KREA 4J9MA 1XI1A 4O3NA 3PJXA 3M8RA 4AHVA 5J1EB 2YNIA 3IS9B 3RAQA 4J9QA 4DG1B 3AO3A 1GOAA 1RA6A 2JLEA 4MK7A 3KMQA 1T05A 4CJ3A 4FM1A 3I0RA 2R2SA 2WK4A 3RRGA 4ECZA 1CZ9A 4E1NA 5KFBA 4GC6A 2IOCA 5KFPA 3UIQA 3QNOA 1JL2A 1BI4A 3ZT3A 5EWEA 4RW4A 1DTTB 4CFCA 3CFRA 1RT1A 1UA1A 2ATQA 1TAQA 1MMLA 2IS3A 4CFDA 4R5PB 4CHQA 2KZMA 5DG7A 2UUTA 3C6TB 2W9CB 4CIGA 4E3SA 4QPXA 4DSFA 1S5JA 4CCHA 2HNZA 2BQ3A 5DGAA 3KNAA 1TKZB 1T7PA 4QWBA 1UA0A 3G10A 3BSNA 2YV0X 2X6SA 2IM2A 1TL3B 1ZETA 3GV7B 3U6FA 3ISND 1ZBUA 1I6JA 2FJVA 2ATLA 3KHGA 3HVWA 4K8ZA 4CGJA 1FKOA 3D0PA 3HXMA 4BWMA 4DSEA 3D45A 2D41A 5KG1A 3CO9A 1EP4B 3NGZA 4KTZA 4IFVA 4ZPDA 4IG0A 2R2RA 4IKAA 4Q44A 2IA6A 3T5LA 5C25A 2XY5A 4J9SA 2HMIB 5F8JA 3M8PA 2FBTA 4CEEA 4OKJA 3LALA 4DQQA 3N6LA 5I42A 5KFJA 5C42B 2P5OA 4WXWA 3EPGA 1HPZB 3NF7A 3V6HA 4QWEA 3NDKA 4DSIA 3AVHA 1RYRA 4DU4A 3K58A 5KI6A 4DFPA 4I9QA 5KFKA 2D0BA 5KGXA 3IGNA 3OL8A 4DL5A 4N47A 5KT6A 2HAIA 4TN2A 3OS1A 4DSJA 1L3SA 1GX6A 4NLYA 4E0DA 1T3NA 4RUCA 4LSLB 4ZVEA 4K4XA 5KG0A 4ZHRA 3L2WA 4TY9A 4FLTA 4FJXA 1NKCA 1Q8IA 1WSFA 5FRMA 3M8QB 2E6MA 2XGQA 3M8SA 3P5JA 5HBMB 4CJ4A 4FJHA 4ZP6A 4YFUA 4KHSA 1BQNB 3P83D 1UWBB 3DRSB 3CJ2A 2A1SA 1ZYQA 3LP2A 2W42A 1LWFB 4ID5B 4G1QA 5E41A 4F2SA 2O4IA 4G3IA 3DOLB 1FXXA 3C6UA 2RN2A 2IJNA 2BRKA 3P1GA 1Z4UA 4EO8A 2AGPA 4B3OA 5J1EA 3IS9A 4CJPA 4F8RA 4MH8A 1XR5A 5KG6A 5J2PB 4W5RA 3H5SA 5I3UA 4DS5A 1OS5A 4ECTA 4EP4A 3LZJA 4DWIA 4HVJA 5KFHA 3OL7A 2HHUA 3NBPB 3SZ2A 2V4RA 5C5JA 3HP6A 3QERA 4C8OA 4MQ3A 4FLUA 3KLIB 4AHCA 1DTTA 1NJXA 3CJ5A 3ZSXA 2XI3A 1RT6B 3E51A 2C22A 4R5PA 3C6TA 3OYBA 2W9CA 5KFTA 3DOKB 4Z4HA 3VQAA 3NF6A 4NRTA 1JLBB 2VWKA 1RBSA 4RW7B 4M94A 3L3VA 2R8KA 3QGIA 3D5MA 4DLGA 4O44A 1D8YA 1W9HA 2W8LA 4DL3A 4AHSA 4O0IA 3PVXA 3BSCA 1NK5A 1RT2A 5T14A 4KRFA 3DLRA 1EP4A 3AV9A 5DLFA 1Z26A 1NK7A 2VA3A 4CJWA 1RTIB 3THVA 1SKSA 3VQ8A 1JIHA 4TSXA 1U48A 4ED6A 5J2NB 4FLWA 3AVIA 4KHQA 2HMIA 4K4YA 1C0TB 2QKBA 5FDLB 5C24B 1JXBA 5C42A 2WONB 1WLJA 3BQ2A 4EYHB 2YKNA 4DSLA 1KTQA 1JLCB 3SYZA 1QQCA 3DLGB 2BQRA 4JV1A 3V81B 3MEDB 3MAQA 4K4TA 5KFYA 3KHHA 4ZPAA 1LV5A 3EPIA 3ISNC 3CVKA 1VSJA 3AVBA 2OPQB 4FJNA 3PJWA 4JV2A 1RDCA 1DLOA 4NLOA 4URSA 1Z25A 2BR0A 2XO7A 3ZT4A 2Y1JA 2XY7A 2CJQA 2UVRA 2WTFA 4LH5A 5HLFB 3SFGA 5KFGA 3T1AA 2OPPB 1S1XB 2J6SA 4F2RA 4IBNA 3M8QA 3F9KA 5DLGA 4R8UB 1WSGA 3KLHB 1TKTB 4O3QA 2YKMB 3PW0A 1XR7A 1YVUA 4NLPA 3IG1B 1TP7A 2YNFB 2UVVA 1RT4B 1BQNA 2I1RA 5D3GB 1UWBA 1RNHA 1JX4A 4ECRA 1JLEB 2BE2B 1LWFA 3RB3A 5J2QB 1N5YA 3VQ5A 4I9LA 3NFAA 1SL0A 1QAIA 3AO1A 3NH0A 4CF2A 4JRQA 1TVRB 5F8MA 3OJUA 5DQIA 3T19A 4DU1A 4KKOA 3KMSA 4M95A 4CJFA 3DLBA 3IRXB 1ZBHA 3VQPA 3HYFA 4CHOA 4E19A 3HM9A 4NYFA 3RB6A 3OL6A 3H5XA 3OHBA 3NF8A 4CEDA 1IKVB 4CHYA 3L2VA 1L3UA 1S48A 4E7LA 3CFPA 3NH2A 3SFUA 1S97A 2XGPA 2PZSA 4FBUA 4MK9A 3VQEA 3TR8A 1JLBA 4RW7A 1TL1A 4B9SA 1ASVA 1YVFA 1RTHB 1KCFA 2KZZA 2VA2A 1JXEA 1BGXT 2F8SA 2BGGA 1VSEA 4E1MA 3QETA 5JUMA 3NGYA 3LP1B 4JS5A 5KFXA 4CHZA 4FZYA 4NLVA 1QAJA 1EETB 4KI4A 4ED8A 4FLZA 2Z1JA 4NLDA 4OVLA 3QZ7A 2RDJA 4FLYA 4KAZA 1FK9A 3VQ6A 1NJWA 1RT7B 4ZP9A 4FLVA 3HK2A 4ZVFA 1RTIA 3U3GA 2YNIB 4MFBA 2WRMA 3AVMA 2GIRA 3TANA 3I0SB 1W0HA 3TWHA 3RB4A 1C0TA 3RTVA 5FDLA 3OYMA 3QEVA 1NK4A 2WONA 2DPJA 4LQ9A 3OY9A 5KG5A 3S3NA 2ETJA 3DLGA 3MEDA 1D1UA 4NLGA 4ZPBA 1RTDB 4DEZA 3H5YA 4RNFA 4YP3A 2HHTA 3NAIA 3GIMA 1L5UA 4DL7A 2FVRA 4K50A 4CEZA 2QE5A 1TAUA 4JLHA 4FJIA 5KFZA 3KLFB 3HT3A 5HROB 4M3RA 1HNVB 1UAXA 1JLAB 5KFCA 4Z4EA 3NL0A 3PW5A 5HLFA 2R8GA 3K2PA 1VRUB 2OPPA 3UR0A 5EU7A 4W5OA 4CF1A 2ZKUA 5DG9A 2QKKA 1LW0A 1U04A 4RNMA 2F8TA 4H8KA 1TKTA 4CE9A 4URQU 1VSLA 4HHTA 1VSKA 3H98A 2XY8A 2YNFA 5C25B 2G8VA 4DFMA 4DQSA 1ITGA 3KK1A 1X9WA 2IM1A 3AA3A 3M8PB 4DTNA 3ZT1A 2FLLA 4IH7A 2HWIA 4J2AA 2CKWA 1DTQA 1ZBIA 4B08A 4CEOA 4FVMA 1TVRA 5DMRA 5KFIA 2OPSA 3OYFA 1BQMB 3SUQA 1T03A 1NHVA 1LWCA 4IR9A 1J5OA 1U47A 4W5NA 4DF8A 4CJRA 3IRXA 4PA1A 3MTKA 1C0MA 4K4WA 3VA3A 3CM6A 4KPYA 3ULDA 2FVCA 1IKVA 3SV4A 4KTQA 2RF2B 5L1JA 5CYMA 3EYZA 4E7JA 3MR3A 4K4UA 4PQUB 1IKXA 4CERA 3HO1A 2YNHA 3L2UA 3CYMA 3NE6A 1O1WA 2DFEA 1BCOA 3SPZA 3K5MA 2FC0A 3MFIA 1RTHA 1BISA 3SI6A 4IG3A 4X2BA 1XWLA 3EZ5A 3AVGA 5J2MA 3OYNA 3HP9A 4DL6A 4WYWA 4DTPA 1EETA 4PUOA 3OYEA 3C6UB 2PYJA 1HQUB 1RT7A 3V6JA 2VG7B 4E7IA 1KLMA 4B3OB 3UPFA 1VSFA 2IAJB 3I0SA 4K4ZA 3PV8A 3OYHA 5I3UB 3BGRA 3ZT2A 4GC7A 2W9AA 2JEIA 3JSMB 4NLQA 2VG6B 2FLPA 4CIFA 1U49A 4O0JA 4CESA 4FJKA 4BDPA 3VQQA 1CXUA 4EZ9A 4Q8FA 2HVIA 1C1BB 1S6QB 1RTDA 4U7CA 1D9DA 3BR9A 1TK0A 1SV5A 4IRCA 3KLFA 4M3UA 5HROA 1KFDA 4W5TA 1HNVA 1JLFB 3KKRA 4B8AB 3KK3A 1JLAA 5F8LA 3K5OA 2P5GA 1WSHA 3N6NA 2R8HA 5CYQA 4DFKA 4O44B 3TAMB 1VRUA 4C8MA 1RT2B 2DTUA 4K4SA 1S0MA 1NHUA 4OPKA 1RILA 4FJLA 2XI2A 3KLVA 3OLBA 4QCLA 4Z0UA 3TAEA 1S6PB 4GMJB 5KFRA 3OYKA 2J6TA 5SZTA 3ZSQA 3K5NA 3T5HA 2YNGB 4RNOA 4B8CA 2G8IA 3SQ1A 4DQRA 3F73A 4DSKA 1RT5A 1HJRA 4J2EA 1N6QA 2YKNB 3PUFA 5KFWA 2X78A 3CM5A 5HRRA 4O5BA 2HNYA 2BRLA 1BQMA 2AX0A 1QSLA 4E7KA 2EC0A 4PY5A 3I5BA 3SV3A 1S9GA 3QINA 4JRPA 4OJRA 4ECUA 1DLOB 4CJ5A 3LDSA 1RA7A 5KT4A 4WFZA 4CEQA 4K8XA 4KO0A 2Y1IA 4TYAA 3I5CA 1IKYA 3QYYA 2JGUA 2RF2A 4Y1DA 1A5XA 3CWJA 3QGHA 2F96A 4DTOA 4FZXC 3RR8A 4LSNB 4PQUA 3V4IB 3HVTB 4O55A 1K6YA 4Q0BA 2D0CA 1QSSA 4HYKA 5JS2A 3SUOA 5KT3A 4CJSA 4EO6A 4H4OB 3NGIA 3TI0A 3O4QA 4WYLA 4RZRA 3MEGB 3GIKA 4KSEB 2FVPA 3KHLA 3IGVA 1RDRA 1N5YB 4M3XA 1IKWA 4Y2AA 5JXSA 4CEAA 4YQWA 3TARA 2V0NA 2HHVA 3DMJB 1WNEA 1TKDA 1HQUA 3H4DA 1XHZA 2VG7A 5EWFA 4NYNA 4DTSA 4QW9A 1NKEA 2IAJA 3DYAA 1VSHA 3DM2A 4HUFA 2ILYA 1S1UA 4KKOB 2UVUA 4CJLA 1RCHA 5JS1A 2JC0A 3K57A 3JSMA 2PYLA 3PO4A 2IC3B 2VG6A 3I8DA 3V1OA 5KFVA 4RNHA 1J53A 2J6UA 4CHPA 1NJZA 4J2DA 3HPOA 1C1BA 2FBYA 4KAIA 1SH3A 4NCAA 2JEJA 1S6QA 3PW2A 4E7HA 4RW8B 5F8IA 3MECB 4O3PA 3S9HA 4CK2A 3FQKA 1C0UA 4Z4IA 1JLFA 3LANA 4I7FB 1TL1B 4F4KA 3G6VA 2AJQA 1N56A 3TAMA 1FKPA 4H4MA 2XCAA 1NK8A 4Q45A 2GV9A 4XO0A 3RBEA 3H40A 1SL1A 2G8UA 4MIBA 1W25A 3BSAA 2XWYA 3V1RA 1RYSA 4KV8B 2GBZA 4QAGA 3UDLA 4TLRA 4PWDA 2BQUA 2V4QA 4FLXA 1FK9B 1S6PA 4RUAA 5EDWA 4FXDA 1VRTB 3DRPA 4MFBB 4WFXA 4LQ3A 3RMAA 1YT3A 1IM4A 4TQSA 1HRHA 2YNGA 3V9SA
chains in the Genus database with same CATH superfamily
4X65K 4QOTA 2UUCJ 2EPIA 1EX4A 4B3TF 4LIWA 8AT1B 3BV8A 2PE8A 1KVAA 3DLEB 1GQEA 1SXLA 4JI3K 3QAEA 3KWGA 3TWZA 2NSCA 3MPYA 3ULEA 3L3UA 4LMZA 1WSJA 4HDGA 4JI0K 2P9LB 2AU0A 1WKJA 3D1QA 1JKHA 4X4PA 3LDOA 3THPA 1G15A 5GMKa 2O8EB 1XNQK 3JS9A 4F0KA 4H4OA 5ETRA 2Q31A 3LAKA 2BEFA 1U2RA 2BH1A 3KK1B 1WAFA 1N32K 3T5JA 3O4WA 5KFNA 3DMJA 2LCWA 3EDQB 4DR2K 1ZAVA 3HPGA 1SKUB 3THTA 3G71N 4F3TA 5AQTA 1EKEA 1RGVA 2L3MA 1T03B 2OTJN 2I9SA 2LQJA 1MNEA 2J9CA 4OHZA 2W8KA 4BRGA 2OKQA 2E9RX 4ED1A 3E01B 4YR0A 4NLTA 2GVZB 1GOCA 3QJLA 4WQ5A 1ZA1B 3QRPA 1RB0A 2A3JA 3ZSRA 1S7IA 2YNHB 1BQXA 2OEKA 1K1QA 1K1SA 4C48A 4N5SA 2XQCA 2HGNA 2GC8A 1RFQA 4JI4K 3C16B 1DQAA 3R1LA 1OMSA 2W2PP 5FIIA 2H1YA 4IO9L 1MSWD 1NOZA 1D9AA 3UKUA 1MN9A 1QAYA 1YIJN 3K5LA 3CJ1A 4C8LA 3LDLA 2P9PB 1FNXH 4DTMA 1FKAF 4PUOB 2UU9J 1L3TA 1KQKA 2FZGB 5AQUA 3NS7B 4A8MP 4J9KA 3D1OA 1HKGA 4ZLLA 4CH0S 1KNZA 3HT0A 3QMLA 3QQCD 4DN0A 5CH7B 2W2OP 4ZPTR 3H8YA 1J5EF 1S1WB 1LNQA 2Q0UA 1UVKA 2M88A 3JAMY 3FKBA 5BRFA 4FJMA 1SV5B 1TV6B 1FTCA 4P72A 4UW2A 4F4ZA 1JL1A 2J8AA 3M9MB 3SQGA 5DQHA 3U4LA 3O3HA 3O9QA 3NEKA 2A0FB 2IVYA 2C42A 3M8YA 1YTAA 1AYEA 4XDDA 3K5PA 4O5FA 3HHLD 3EVMA 4Z4GA 1SC4B 1VK0A 1FJGK 3MR5A 3FR0A 4LREA 2OPRB 1JWWA 4OLBA 5KG2A 3NF9A 2HWHA 3NP5A 1G99A 4Q43A 1X1PA 2O8BB 4FJJA 4OYWA 2WC9A 2B6AA 3NKYA 3LW5C 2HS3A 3G6YA 1PJ7A 4DF4A 4CEBA 4ELUA 3P3DA 1NH7A 5C0YA 1HWJA 1YK9A 4CI0B 3UDCA 1VQKN 4KIAA 1WF0A 1VQON 5T7LB 3R8YA 2OFGX 3L2RA 1GT8A 3QGGA 1YJNN 2A2CA 3MOZA 3H5UA 2VOPA 2CNNB 3JAMU 4F4XA 1HHTP 2ZWHA 5DGBA 1MMDA 1R0AA 3JXOA 3QPIA 4OZ2A 1ROFA 2HF4A 2BANA 3C15A 1M1KO 3CIPA 2KTQA 4FWRA 3QO9A 2GZOA 2R7YA 2NZ4A 2AV5A 2EFPA 4CK3A 2HRTA 2IM0A 4Q0BB 4H54A 4EFHA 4KJIA 1JQGA 5F8HA 4C8ZA 4C3MA 2LQ9A 3HPHA 3CO0P 2DNRA 1S5ZA 2D3UA 1RI7A 3BPDA 3DI6A 4OI6A 5DDQC 3JQJA 2DNZA 1C6VA 1NGJA 4JKGA 2I5JA 4I56A 3MMAB 4F4AA 2ADCA 4WFBL 1S1UB 2KVIA 3LWLA 3R7BB 3CHWA 4ZK7M 3ENOA 2B9WA 1TZ0A 3ZZPA 3ZZTA 2PIIA 4QIVA 3NHGA 4DV6K 4B3SJ 3OTOJ 2VPXB 1TR0A 3KIOA 5M2PA 3LWMA 3MMBA 2QWPA 1M0SA 3NVKA 2F9WA 5CZVA 2ZVSA 2VKZG 3Q8RB 2JOQA 1KEKA 3G82A 5F41A 1KVJA 3J7ZT 3RSEB 1K73T 1VSMA 1YF5L 3TA0A 4DR6F 3CCZA 4EAHD 4DTXA 3NS6A 4JK7A 2DB1A 2GHWA 4M63A 1YJ9N 4KHYA 2XMTA 3P6YC 4DTRA 3DRPB 4KI6A 2VG5A 2UV8G 3MCOA 3Q8QB 1NBEB 5DZ7A 3RRKA 2UXBJ 3G2XA 3LA0A 3RAMA 4HCCA 4OKKA 3HMJG 1I3OB 4DV5J 2C2DA 1K9MT 1ELOA 4W90B 1NJYA 3M30A 2VBYA 3H46O 4LD0A 4M3WA 4A4JA 1SBRA 3O3FA 1F2HA 3BP8A 3CPWM 4NXNK 4CTAB 4I2PA 2HK3A 4YOUA 3UQSA 4IJNA 4IRKA 4FM0A 1WD6A 3J7YP 1JJ2R 4B02A 1H73A 3VAFA 1O8BA 4M5HA 3DOMB 3JYTB 1H38A 3MN6A 3GYNA 1J9AA 5JMNA 4ZVHA 1LW2A 3HBTA 1URNA 4CLFA 2G8WA 3HHKA 3O9SA 5DG8A 2ZH8A 4A62A 4NZ0A 2XM3A 5HP1B 3N5BA 2HZCA 4N76A 2XBPA 5K14B 3WDOA 1U6BA 1C0FA 4IR1A 3LPYA 2LMIA 2P9UA 4CNZA 1N34F 1LWEB 3GYGA 3PJ9A 1NOYA 3B8HA 4BG8A 1Y64A 1KQGB 2DVIA 3CF5L 2D7SA 1RAFB 2DNMA 4IO8A 4IUFA 4ED5A 3L4IA 1O0PA 3M32A 3MM8A 2Z58B 4JI6J 4IO9Q 2XZWA 4EUVA 5LY3A 4DB3A 4TLQA 2IY5B 3O44A 2OD4A 1Q81T 1I39A 3DDKA 5LT5A 2Z30B 1SJ4P 3A2FA 2CQ4A 4YB6A 4LF4F 3OYLA 2YQ0A 5A6PA 4RW6B 2KQ2A 2PMZD 2GAHC 4AH9A 2P5VA 2HBYB 4FBTA 1HL6A 3MAAA 3EGZA 3KLEB 4FK4A 4YY3J 2E1CA 2VQFJ 4FZVA 2W7PA 2P9IB 2DHSA 1TKXA 4ICLA 3NH1A 2JX2A 3R3TA 4PXEA 3T9ZA 3QSYB 4WE1B 4DV7F 4WP3A 4DQIA 1GLBG 3ICLA 3PZPA 1P8GA 2FPHX 5K20B 3W9JA 3BN4A 2ALYB 1BE4A 3I33A 1G6BA 2O01C 1TUWA 1F6TA 1VJQA 3H3NO 4NLSA 3PX6A 1QTMA 1HLWA 2FZKB 2WZ1A 4CGDA 4DUZJ 1WTBA 1BOTO 1TQLA 3O3GA 1VLOA 4DX7A 3D0IE 4TKTA 4CBWA 4I1TA 2R2UA 5AZIB 3AA5X 4URGA 1WG4A 5LJVA 1S10A 2FVQA 3J80O 2ADBA 5E3QA 2FD2A 4B9LA 3HLUA 1UW9A 3FBEA 5G0RB 2VASA 2DNPA 3W2WB 2QK9A 3CETA 2H4YB 3AVKA 1SJQA 3FGVA 3VGKA 3KG4A 1NM2A 1RXOB 2E1YA 2CGKA 1YTUA 5ELZA 1R31A 4WFYA 4AQYJ 3ZZYA 2DY1A 4NI2A 2EEYA 3DXKA 4OL8A 4I64A 3PCOB 3AOBA 5BR9A 4PEOA 3DRSA 4IFYB 3ULHA 5FROA 1RDBA 4NMLA 3H1VX 3NMAA 4FNIA 4LFBF 4WFNL 2WAQD 1WC0A 3AA9A 3MF5A 1WDDA 4X65F 2CPFA 2SXLA 1F5CA 4CDIA 3VEXA 4WKRA 2A42A 3S3OA 3I87A 3ZSVA 1CG2A 4DV2J 5BRDA 3RMDA 2EWHA 1RACB 4GMKA 1DFDA 3C6HA 5KFLA 4LRCA 4C6AA 4KQZA 1OJ4A 4JI3F 2MKSA 4BR9A 1RT6A 1E6YB 4B9QA 1FD2A 2D3OR 4QW8A 1HWLA 2MKYA 2E7VA 2R7UA 4WFAL 2WOMA 1M1HA 4B9VA 3P8BB 3VA0A 2WCXA 4WFBQ 3FSIA 2ASOA 1E6VA 3OYJA 4LRFA 3QGPA 4LF6F 3GJRB 1HR0J 3RAXA 3J8AA 1XNQF 2CG4A 4FKYA 3ZEUB 3OXFA 2B4PA 4JN4A 5GAEI 4M42A 3R97A 1KSPA 3AH6A 2W6LA 4Z94A 4UTGA 3KOAA 3AODA 2VQEK 3ID6A 2QEXS 3D7EO 1ATRA 1JJCB 5A76A 3TAQA 4DR2F 1ZAXA 3O6WA 4Q8EA 4H03B 3HX9A 1IQZA 2K1RA 5F8GA 4IEIA 5D6GA 2HWTA 1TTHB 3J7YI 4Y65A 2HYIB 3LL3A 1JLCA 1BI4B 1FJCA 4CHNA 3OR2A 4F3MA 2VH7A 3U1NA 4KHPJ 3A5MC 4J9RA 2ILZA 1RT1B 2HFZA 2OPQA 3LP0B 4DR1K 4CGFA 3OTCA 1HNIA 1SQFA 1BHLA 1KP6A 1REVB 4BR2A 1CLQA 4TU9A 1X5TA 4XPEA 4U8YA 2QYCA 2IJRA 4JI4F 4ZP7A 4X4VA 1TU0B 3AVNA 2MZSA 2BVZA 3HKWA 4PABA 2ZOMA 5BN9A 3EN9A 1SH2A 1HBOA 2QA2A 2E88A 4QS8A 2OA8A 2KU7A 3KLHA 1AZSB 4CLYA 1VQLN 1G1XA 5D3GA 4OZ0A 4FF2A 1NK6A 5KG3A 1YZ7A 4YR3A 2BE2A 5C2CA 5D77A 2J76E 4DMNA 1GAOA 2R8JA 4KHUA 4YB5A 3POTA 3W5ZA 3OS2A 1S4FA 2J8SA 4KH1B 3UKRA 4JNEA 4ZKAA 2E2NA 2CQCA 1HBMA 2DT9A 2VL1A 3DXSX 5CZ1A 1RHMB 4ZCIA 2BM0A 3VAKA 5BYRA 2VPYB 5CR4A 4I2QA 1FNMA 3UVJA 3SCIE 2MQ8A 4C4WA 2A6OA 2JC1A 2V8DA 4JK8A 3LGMA 3ALYA 4Y2MA 1KD1T 5ADZA 4K4VA 1U1KA 2GHVC 4WXOA 1CULA 3KKSA 3HVRA 1YJTA 5IWAK 3V5RA 2V4JB 2B43A 3AO2A 1ZZNA 3CF5Q 2OTLS 4M3ZA 3HZEA 2ZH2A 3DHWC 4NLWA 2ZZNA 2YTCA 2DHXA 4PG5A 1VQMN 4PXDA 1B0VA 5KPRA 1YI2S 1YAGA 1V4TA 1XI1A 3K9JA 1YRUA 2D74B 2DITA 5J1EB 1U1OA 2YNIA 2E7XA 4DG1B 4BRQA 1RA6A 2MQQA 2B9YA 4CJ3A 2R2SA 1CZ9A 5KFBA 1NDPA 2MZTA 2IVFB 3C65A 2PC6A 3KHYA 2YVSA 3TJ9A 3VAMA 3QNOA 1XBWA 4CZIA 3PRVA 1VC0A 2IFXA 4FOIA 1X4GA 1V5VA 2I38A 3WIUA 3GTYX 3JSBA 2JWKA 1LFWA 3TRGA 5BR8J 2W9CB 3D3BJ 3CD7A 4QPXA 4QIEA 4JI2K 1TKZB 2DIUA 7FDRA 3G10A 5AZJA 2X6SA 2EFOA 3V2UC 2P9EA 1Z2ZA 4JI1K 5H9EJ 2FJVA 5D0EA 1Q7YT 4WK3A 3MZIA 3CXCR 3I55N 4DSEA 2DD8S 3VGSA 4KTZA 2DIVA 4N77A 4IG0A 3PSFA 2NXJA 4Q44A 3T5LA 4JYAK 1XC3A 4JV5K 2DGOA 4J9SA 4HT7A 4WCEL 3M8PA 1GLAG 2XYGB 4OKJA 3VOVA 5C42B 5GAHI 2YKOA 1HPZB 4B1UB 5CD4A 3ILIA 3QRQA 1W2BM 3R7SB 3VWSA 2N4CA 2QWLA 5KI6A 5E3AA 3VHQA 5KGXA 1FI4A 3GSDA 2KKHA 4DV6F 1NZAA 2VDHA 3HTVA 5KT6A 2WVEA 4TN2A 1WC5A 2G1HA 1N36K 1U2VB 3ZZZA 2N7YA 1JCGA 2HGLA 5JVHL 3Q83A 2YJEA 3TVYA 4MYUA 4FLTA 5HQ8A 3W3DA 4H0YB 4WFNQ 1NKCA 1Q8IA 3M8QB 3P5JA 2DO4A 4MJKA 4GKJJ 4H5VA 4OJGA 3QFUA 3P83D 2VBWA 2W01A 2A1SA 3LP2A 5E84A 4G1QA 4DR7J 2QL9B 4F2SA 2E5LJ 1NXIA 3DOLB 1T02A 4JI8J 2H5IB 1GNKA 3CCQN 2JDJA 4DR3K 3IDHA 1BWVA 4F8RA 4CJPA 3F56A 2KB2A 3H5SA 5I3UA 3B54A 1OS5A 3QDKA 3N4WA 4WFAQ 3LZJA 2HFOA 4DWIA 3LM2A 4DZDA 3IRWP 1U8SA 2MJNA 3NBPB 3HP6A 3QERA 3C2PA 1RJJA 4MQ3A 3KLIB 3CJ5A 2XI3A 3E51A 3R1HA 3IA0A 2CXEA 1OO0B 4CYUB 5KFTA 3DOKB 3QJPA 4NRTA 1JLBB 2R7VA 1IR1A 1M5KC 4RW7B 4UY8T 3EXCX 4M94A 3D5MA 4O44A 1W9HA 2W8LA 4DL3A 2FY1A 3EO3A 3O5TB 2NXCA 2RIJA 2AYMA 2K2PA 1SVDA 4HACB 2RJZA 2HQGA 3MTJA 2QX0A 4LRAA 1VBYA 3EEQA 2IVPA 3CJ9A 4FLWA 4LFCJ 1UEUA 1C0TB 2VGNA 3GP9A 2RU3A 2QKBA 5AE1A 1WLJA 4BLGA 1CS4A 2OIHA 3SYZA 2BQRA 4JV1A 2UXCJ 3MAQA 3DGPB 2QWRA 1VSJA 2KJWA 2MTLA 2EBGA 4NLOA 2CNKB 2ZHBA 5MLCQ 1Z25A 2BR0A 2XO7A 3ZT4A 2CVEA 5I4MA 2IYIA 4MDAA 3GSIA 4LH5A 2D3O1 2QGFB 5KFGA 4FSVA 1W2IA 1M5OC 2J6SA 3EVWA 2R7WA 5HL7L 1TYQB 4UUWA 3F9KA 2PA8D 3L3CA 4R8UB 4JOUA 2KT2A 3HSCA 2YKMB 2AKWB 4ISGA 4PKHA 2P6SA 4H4KC 2ZNZA 4NLPA 1R0CB 5EGYA 3PIOL 5BYQA 3D2FB 5CHCB 4PR6A 1LWFA 5J2QB 1MROB 2ZC4A 5FLXO 4OYIA 1QAIA 3HHDA 3NH0A 4CF2A 4JRQA 2Y0BB 2CUYA 2E44A 2F4VJ 3TJAA 3GG4A 3KK7A 3VR1A 3KMSA 3DLBA 3VQPA 3HYFA 4BQZA 4CHOA 2YX1A 4NYFA 1YXQA 2KYZA 1S59A 3MHYA 4CD1A 1WG1A 4DR4J 3WQUA 4OYAA 1L3UA 3AY9A 1YLXA 4PWWA 3CFPA 3VZHA 3WQTA 2XGPA 3CMES 4FBUA 2OSRA 1UKUA 3TR8A 2OSQA 3IR6B 4EMDA 3CPEA 2YWGA 4BC4A 4E1MA 2RILA 4JS5A 1EETB 1JMTA 4FLZA 4USIA 4NLDA 2RDJA 1NJWA 5IT0A 3HK2A 1UVIA 2MQNA 1RTIA 1RBOB 3AVMA 2X1BA 1OPZA 3I0SB 1W0HA 2WONA 2DNNA 4PG7A 2L9DA 1IBLJ 1T9YA 1RTDB 2O1PA 4RNFA 2HHTA 3VGMA 2I2YA 4DX6A 1L5UA 4K50A 5AXMA 3AQOA 1TAUA 1H74A 3HT3A 4A59A 4M3RA 3C3LA 5IZHA 3C14B 5KFCA 2FYXA 3NL0A 4NEYA 5HLFA 4WJBA 3K2PA 3LTOA 3MM7B 1DJ0A 2DEJA 3FFKB 2DNYA 4WCEQ 3PNIA 3UR0A 2DEIA 1RSCA 4CF1A 4CIOA 3CCSN 2QKKA 3WIVA 4RNMA 2F8TA 4DUYJ 1TKTA 4URQU 5A8WA 4HHTA 2AJ2A 2XY8A 2H5EA 3DC2A 5C25B 5LXRA 3AARA 3AA3A 4GY2B 1V6HA 5LMNK 1ZBIA 3TA1A 4B08A 4A8YA 1MDUB 3NGRA 1TVRA 2NCKL 1Y7PA 5BJRA 3ZX3A 5JVHQ 2F8MA 1NHKL 2M5YA 3J7YU 4KH4A 3VGTA 5IC4B 4K4WA 3CM6A 4CH1A 4UZCA 1RWNB 5M2RA 4C3LA 3SV4A 2E2PA 3F44A 1GK8A 2JSXA 3FSYA 2KHOA 4PQUB 3UE2A 2RUGA 5LMUJ 3HO1A 4DR1F 5BXIA 5JICA 2KH9A 3NE6A 3LPEA 2HRUA 5K5MA 1HHQA 4E1JA 1RLCL 1BCOA 2Q36A 1MWZA 2BABA 4LC9B 4IG3A 3D0GE 2HSTA 1VQ9S 5DM7L 2HKEA 1VRQC 1EIYB 5J2MA 3OYNA 3HP9A 1VISA 3EZOA 4LT6A 4ZVSB 2AP6A 1VBXA 3OYEA 1GTEA 3J80Y 2GEMA 3CEDA 1K8KA 1RISA 4K0KJ 3PV8A 2GQCA 4OO1J 4KRWA 1KWMA 3RW7A 2JEIA 3JSMB 2I6WA 3ZZ0A 2GWKA 2VG6B 5K8MA 4MO4A 3DN9A 2CPIA 2FLPA 2BJ3A 1ZPVA 1JJ2M 2ZJRL 2HVIA 2F7TA 2D1CA 1C1BB 2DNOA 4E8UA 1X7VA 4F36A 1TK0A 3E8OA 4DBQA 4FOEA 3K0SA 1RLDA 1Y00A 4DHYA 3KLFA 5HROA 2NRWA 2GWJA 3BGOP 3KK3A 2XSJA 3N6NA 3TAMB 2DR7A 2AT1B 3UNGC 3L95X 1RT2B 4JHDB 1Y0HA 5E26A 2VU5A 5C15A 2XI2A 5IWAF 4FJLA 4Z0UA 2L9WA 1AROP 4GMJB 4OHYA 3AB2B 4BR4A 3HF5A 5SZTA 3QATA 4L3NA 3R6LB 3J80U 1M5SA 3T5HA 2YNGB 3SQ1A 3WX4A 3NWRA 2D0OA 1UPMB 4DSKA 1HJRA 2FSKA 2YKNB 4MYTA 1IQTA 2YCHA 3J7ZO 1FW6A 2VCPA 5HRRA 3KUHA 2YWFA 1DQ9A 2HNYA 2ROGA 1BMQB 1NSAA 4E7KA 4DPWA 3O08A 4ECUA 1OH8A 5GVQA 2MLZA 3R5CA 5HL7Q 4G65A 4B3RK 1IKYA 4MO5A 5AQKA 3QYYA 2HQ3A 2CJYB 3QGHA 3W9HA 4DTOA 3PIOQ 3RR8A 3DGVA 4DI6A 2FC9A 3V4IB 5DO2A 1Z2LA 1K9MO 4OPHA 4O55A 3IKMA 1AB8A 2D0CA 2BE7D 3M5RA 4CJSA 3VZIA 4EO6A 1FDDA 4LR7A 2AW0A 1FRJA 4CZJA 3D2WA 1XK8A 4JI1F 3KHLA 5H9FK 3IGVA 3GBTA 4NEZA 3CJSA 4M3XA 1IKWA 4Y2AA 3RG6A 1XERA 1VQ7N 3MPVA 2AA4A 3TARA 2HHVA 1S6OA 5G4DA 5EWFA 5HOOA 4ZS6A 4NYNA 4DTSA 4QW9A 4ZA1A 1F2GA 4JV5F 1CJTA 4KKOB 1KBRA 2VUGA 4CJLA 3I8DA 3V1OA 3M8ZA 5FPNA 5D4OA 1X5OA 1Q0NA 4L74A 2R9LA 2XTJP 2ZJQL 3I4HX 2N3LA 4NCAA 1S6QA 4RW8B 1H2UX 4L6V3 4P73A 1V4SA 4CK2A 4Z4IA 4WWSA 2QA4N 4NB4A 3LANA 1TL1B 1NM1A 2QT7A 4OX9K 2BBEA 5EX5A 3J7Z5 1FKPA 2XCAA 2CDRB 5D4PA 3TSPA 5BRHA 4XO0A 4MIBA 1G3OA 3V1RA 2QJ3A 2B8QA 1RYSA 3HI9A 3WXLA 4QAGA 4TLRA 4PWDA 4DU8A 1FK9B 3AFGA 1FXLA 1U0HA 5H1SV 4KBOA 1VQPS 4FN5A 5D78A 1IM4A 1WKKA 2FJDB 1AT1B 1EO1A 1VQNN 2XMAA 5ADXA 3NRBA 4AL5A 1J6ZA 5T41A 2JVRA 3ILLA 5IFMA 4OYOA 5EOYA 1VOMA 2MKKA 1WOQA 4B9TA 1Z1ZA 2KT3A 3WC2A 2QTDA 3D2EB 5U47A 3MXJA 3KHRA 4NCGA 2DRAA 1UEKA 4OPJA 3FBBA 4B3MF 3SQ4A 2MDAA 4BRKA 3GMGA 4LSNA 3NGKA 4KB0A 2IBOA 2ZQBA 1A7GE 1NU0A 3HVTA 3VQCA 1YRTA 4BRIA 1S1VB 1Y97A 1LW0B 4FZZA 2ASJA 1YGYA 3LUYA 4C3KA 3EZWA 2JEFA 4CZCA 3THXB 2QN6B 3D7SB 3BY5A 1TK5A 4OFZA 2Q43A 1DY3A 3W60A 3MX2A 3CT9A 4NLBA 4NMXA 4PPZA 3KLGA 4NYZA 4O3OA 2K8GA 2ZE2A 1PSDA 3KNGA 3KZBA 3EE9A 1FE4A 4IDKB 1J5OB 1PYOB 4ZVRB 2IC3A 2L9NA 4X62J 1J5EJ 4R0EA 3VTHA 2KT5A 4CJKA 4LF7K 2M4MA 4QOZB 3R2DJ 5CYMB 5DM7Q 4DR5J 4CM2A 2ZNYA 3CJ4A 1N8RO 1IKXB 3CIZA 4DTJA 3SCXA 3MECA 1F21A 4F25A 4DL2A 2UU9K 2DCLA 3VQDA 4I7FA 1I5OB 1VFJA 1AW0A 4ZTJA 3ZCMA 3VGLA 3TAPA 3W0LA 2CJBA 3IAS9 4DL4A 5CYJA 3BGFA 4FPBA 4FO0A 3PW7A 1NSPA 1UVNA 3QIOA 2ZJRQ 1KLMB 3FFIA 1VRTA 3OYGA 4MKAA 4GVMA 4QWCA 4FPIA 3OVSA 1IBKJ 3FSXA 4FYWB 3BGRB 4ER8A 3AT1B 4LF8F 3T3FA 3FZKA 2YQ3A 3W1YC 3HSGA 4CWBA 4NZ6A 1SC6A 2O8FB 3J7AN 4OQJA 3AXMA 2VJVA 2JH3A 1UWAA 3MGJA 1OY8A 1HBNA 3JTOA 4ECVA 4OYXA 1VCTA 1YHQS 4ANDA 4DV0J 2DPIA 2DXFA 4EP5A 1X5PA 3DLEA 3BBBA 4DPUA 2W2NP 4OHXA 3MEEA 1P6TA 4NXMJ 4Q7AA 3FBCA 3V9UA 4USUA 5AQLA 2P9LA 3SSSA 1S4EA 4QU6A 2RB7A 2PMHA 1UFKA 2O8EA 2RQCA 4M3YA 3QNWB 2EWSA 2EXUA 3R5GA 4ID1A 2G8KA 1VQ6N 2P9CA 5BYSA 4BGAA 1FDNA 3MM9A 5IQ6A 5KFQA 2KFYA 3ZTQA 3TEHB 1M1KT 4M3TA 5LL6Z 5GAGI 3GV8B 2NYHA 3HM8A 2X51A 2IHR1 3G86A 4KGKA 1ICEB 2KL8A 3I32A 4HCBA 2O5DA 3ZNUA 7AT1B 1X60A 3A5NC 1WUAA 1RT3A 1WSVA 1K0TA 3M9OB 3R5JB 4KO0B 2HVHA 3E01A 3R9PA 4BWJA 3ZFVA 2E5JA 3HSTB 2C3MA 1HQEB 3OLAA 4ZVPB 4G9ZA 1H2VZ 1W7WA 2M2BA 4DPTA 6FD1A 3RWUA 5HSPA 4DV4F 3HCXA 2FJBB 3C16A 4CO5A 4CZKA 3CXCM 2FHOB 3WXKA 3MOJB 1WBBA 3UNYA 3UFCX 4A8QA 1NRKA 2VPZB 4YOXA 2PT0A 2RHKA 1JLGB 3VEYA 5IT9O 2HW3A 2VD3A 1HARA 4OZLA 1P8ZA 3JB9k 1YJWS 1S9EB 1GX5A 2ZJQQ 2X6NA 4ED0A 3UDVA 5C10A 3BGLA 3CDBA 4B3SK 1FRHA 3DM2B 4LF5J 2YHYA 1Y10A 2O8DB 3OR1A 4ZCLA 4FW1A 2I8EA 5AQXA 3V1QA 2UXDF 1S1WA 5LMNF 4MKBA 2CJAA 3DWLA 3D4JA 3P4IA 4RU9A 3PHEA 3UO0A 3F9MA 4O3SA 1QVFR 1M5VC 1RWUA 3RU0A 1PGZA 2F8EX 3W8GA 1NU4A 4YDUA 1GLLO 1R7IA 1MG7A 3ZETB 3PEJA 3V6DA 3UCGA 1TV6A 2E9TA 1X4HA 4YOTA 4XDCA 2FC8A 5F2RA 4QU7A 3FMBA 5CA5A 5J1NA 2MKHA 5B08A 5FLXY 3I6PA 2G0CA 5KFUA 2AD9A 1EZZB 4FJ9A 3DLKB 5IXUA 4TY8B 1ZM9A 4NA3A 2XC9A 3G4SS 3TABA 3G96A 2P51A 2P2CB 2UXBK 2W9BB 5AQNA 3U1MA 1S77D 2OPRA 1HBUA 2GX9A 3PW4A 2ZM6K 1R8PA 3QBWA 2HGMA 1RAJA 2PY5A 2PEBA 3CCES 1VQ8N 4AXJA 3B6OA 1HD0A 3BYPA 3SIPB 4DUTA 3L4BC 3P96A 1TK8A 1RBUA 2CQ1A 5T7LA 5EWGA 4J90A 2MQMA 5H1SQ 1QS4A 2V7ZA 3CJKA 3CCVS 1N34J 1G4CA 3WHIA 1Q5YA 1XMQF 1QD1A 2VV5A 4KT0C 2ZKTA 3O8MA 4USWA 3W5YA 4DLEA 1Q95G 2YPZA 3KJVA 4WQ4C 1N52B 4DHVA 1JKHB 2ZD1B 1BUPA 1PBUA 3AVCA 1KTVA 3HRGA 3W7BA 4IOAL 3AXKA 1H2TZ 2PAVA 5J1PA 3FUYA 3MAHA 5I3QA 4QR1A 1UETA 4LF4J 4CFAA 1NLVA 2C2ZB 4CNYA 3R6MA 2VC0A 2OD6A 3VQSA 4AD6A 4F67A 3QEPA 4L75A 5HQLA 2XS7A 3E9PA 3C95A 2CFXA 1QE1A 2GNKA 3GDQA 3U3YA 2QMXA 2Q6BA 4QS9A 3KD1E 4IOXA 3MMAA 3BB5A 1OH6A 3GV5B 4FXWA 2E5IA 2XWXA 4UF4A 4JI6K 2RKIA 3TA2A 2DNLA 4FYVB 3T5KA 3TUJC 2A6AA 3OBIA 2XSFA 1DKGD 3FQLA 2ZZTA 1JLQB 3ENHA 4NLRA 3RMCA 4B3TK 1SQGA 4ECWA 3PEHA 3T1HJ 2P1JA 2JEGA 3W62A 2HZAA 3OTDA 4O4GB 3NS5A 1LCUA 2NRXA 1YUWA 5IV3A 3VEOA 2MXYA 4J9LA 2NYIA 3HJVA 4QBUA 5EVZA 2QMUB 3NOCA 4B3RF 4BE2A 2AJ1A 4YHHJ 4H0OA 3HSJA 2V2ZA 4IKFA 4YY3K 3RSEA 3HSZA 3DDNA 1NPRA 1RWXB 1IN0A 2BJ7A 1SJFA 3V9WA 2M70A 3FZMA 4WZQA 1HWIA 2ZBCA 4DV1F 3Q8SB 5DDPC 1RDDA 1M90O 4KB7A 4DOZA 5CXTA 3GIRA 5KT5A 2HHQA 1SQKA 2BOAA 2E2QA 4DUZK 4B9NA 2CQBA 5A0YA 2A1BA 2ITGA 1ASWA 5DZ6A 3RJMB 2NPIA 3CDEA 3EY1A 2NRRA 4OZNA 1N5VA 2OGUA 2CGJA 2NXEA 3GLJA 1IG9A 4CRJA 1MLAA 2XHBA 3BSOA 3FDSA 5L1KA 4X65J 2JVOA 3TTCA 2GAGC 3EVOA 3LP3A 2LEBA 2A40A 2KXHA 4CTAA 3PYGA 3VV2B 4ZJOA 1BXNA 4W5QA 1YBUA 2F4FA 4PG8A 3OL9A 3OW2R 2W4CA 3HVAA 1C1AA 4JI3J 3DOMA 4YS2A 3JYTA 4IJAA 4JKHA 3SUPA 1OIAA 4OX9F 1U2FA 4V19X 4JI0J 3TTFA 5A2QY 2BKNA 4NCBA 2JWLA 5HP1A 4UOCA 3K89A 4PL7A 1XHXA 4KBIA 2O67A 2QW9A 5HBMA 1HKAA 5E0OA 4AL6A 1HYVA 4MLHA 2UUCF 2WBMA 5K14A 1B9DA 1K8AO 1KVBA 4RTFD 2OLWA 2CQ2A 4DX5A 3LQVA 1N32J 4P71A 1NGGA 3AAQA 1X0FA 3S8SA 1KN6A 2FBVA 3VTIA 1R0AB 1OY6A 4DR2J 5M1KA 1KVKA 4IH6A 2XZDB 2DHAA 2KFZA 4FM2A 5J2PA 2ZH1A 1WF2A 3QO9B 2XCPA 2AWZA 2E5GA 2XMJA 3G71S 4K5RA 3NLCA 2OTJS 2P9NB 4EYIB 3N28A 2ALZA 3HZ6A 2FGCA 5M2UA 4MLEA 4J9OA 3FMWA 1CJVB 3WNGA 1YJ7A 2MZQA 1T0TV 2OO4A 1ATNA 4HTJA 2DTJA 2BUPA 4P2FA 4L3KA 4FL9A 2LVWA 4RW6A 4N8NA 3G0ZA 4UY85 3QFPA 3S41A 4A2BA 4DCPB 3DI6B 3ISZA 1SUQB 4JKGB 1E3MA 5A2QU 4JI4J 4FJGA 2HEKA 1VSIA 3A3PB 3PACA 4J9UE 3MD1A 2DNHA 3L8BA 3S1TA 1ZC6A 1SL2A 4B1YB 4WP8A 3TO8A 3MM5B 4A8KA 4WE1A 4AE5A 4BE1A 1YIJS 1LWXA 3O1BA 4PAAA 4DFJA 3NMRA 2XS2A 1Q53A 2BA9A 3PYEA 1VSDA 4PHTX 5J2NA 3VETA 4GKKK 1T05B 2FJWA 1NSKL 8ATCB 2IMWP 1RDWX 1RUSA 5C24A 2GMHA 4GRSA 4H5RA 5KG4A 3DJCA 2E9ZA 3R7NB 2QWMA 3UE5A 1OKJA 4IEEA 2QSFA 4LF7F 2GUPA 3NAEA 1NMEB 4BC2A 4J7CA 4WF9L 5G0RA 2HNZB 3CDUA 3M2UA 2C2KB 2UU9F 1U1MA 5HMZA 3CQXA 4IYQA 1VYAA 4GO5X 2QWQA 3SPYA 2UYTA 2VG5B 3AA2A 2VIHA 1WOSA 2EFGA 3AJ1A 1FKOB 3MD3A 4LUBA 1FJGJ 3CCTA 3KJFB 2LXFA 1RQ0A 3IG1A 3FZHA 1RT4A 1APSA 2GJFA 2CWXA 2H9ZA 4IFYA 1S0VA 3J81O 5KFOA 4CJUA 5KRSA 3P4UB 3M05A 5I42B 1ZBLA 2DH9A 3RBXA 3QEXA 3D67A 3P39A 2JJ4D 3MMJA 4IOAQ 1RDAA 3AVJA 2UUWA 2F7VA 2RQMA 1VQKS 4C8KA 5HMYA 1VQOS 1F3FA 3VMFB 2G8FA 1ACMB 1S99A 3ID8A 1U4BA 4PG6A 2C28A 5B0EA 2KFNA 2FJXA 2CQ0A 1YJNS 1RWKB 5HRNA 4CF9A 3US5A 2UV8A 4FJ8A 2MLXA 4Y34A 1CVJA 2BW2A 5IOLA 1ZTWA 4J9NA 5JMVA 3TAFA 4DQPA 1S72N 1LW2B 4MK8A 2AJFE 4ZHRB 4H5TA 2AJ4A 3IWXA 2AQ4A 3AB4B 4JAXA 1FWPA 1OQ6A 2GMLA 4B1XB 4N8OA 3EZUA 3CCRN 3PY8A 2LECA 4QR0A 2P9UB 1CZAN 2V34A 5GAGU 3P38A 3PIPL 2GW8A 2A5XA 1T44A 2CADA 1FRXA 2W2MP 3P45B 3RAQA 4CLKA 2ASPA 3DXBA 1EB0A 1VHFA 3R9LA 2QFJA 3FVYA 2WK4A 3MM8B 4X4QA 1MN7A 3RRGA 4J91A 2HBQB 3E9OA 5KFPA 4H0XB 1CEZA 3CGIA 1BI4A 4BRFA 3P49B 3OXGA 5EWEA 3QMQA 2ZC3A 2G2ZA 4CFCA 3CFRA 3FZLA 1R59O 1RT1A 1TAQA 1MMLA 4DPOA 1R89A 5ETOA 4DV6J 3DLLL 2UUTA 3W2VA 1S5JA 3G87A 4O23A 3CCLN 3KNAA 3GFZA 1T7PA 3IAM9 1S22A 2IM2A 2WW4A 3MK6A 5AQGA 1I6JA 1XQIA 2ATLA 3KHGA 2M3DA 4CGJA 3D0PA 3HXMA 1H72C 4BWMA 3EGNA 3CCUN 3CO9A 1EP4B 5CHIA 1AZSA 1X4EA 3ZZOA 2CQPA 5AFUH 2FB0A 2IA6A 4OJ3A 1CJUB 1R6YA 1YJ9S 2XY5A 5F8JA 4B3SF 3OTOF 5KFJA 1ZPWX 2AHOB 1NGFA 3HFVA 4WXWA 1FT8A 3EPGA 4RCHA 2YHWA 2A18A 3V6HA 4DSIA 2V67A 4DFPA 4LFAJ 1FX2A 2BV3A 2ZH5A 3N01A 2C3UA 5KOWA 4N47A 1XQSC 4DSJA 2F65A 1OYEA 5E3PA 4NXNJ 1I94K 4RUCA 4G1IA 5KG0A 1RTZA 2BUNA 3TU5A 4HL9A 2E5LK 1SQEA 1WDTA 2XS5A 1WSFA 2GQ2A 4BRPA 2UXBF 2ZBQA 3JTNA 3M8SA 4OHWA 4J5OA 2VF3A 3DXKB 3TZXA 5GMDA 4FJHA 2ZH7A 4ZP6A 3MDQA 3ONQA 2QIFA 1BQNB 2ZM6F 1UWBB 3DRSB 5BN8A 2L41A 1ZYQA 2GVDB 4FWKA 4G1PA 2O8CA 3QWUA 5E41A 2O4IA 2FJEB 3G9CA 1FXXA 1KOOA 3C6UA 2XMMA 3GR0A 1KONA 2BJEA 2IJNA 2BRKA 3P1GA 2AGPA 4B3OA 5J1EA 1WHYA 4MH8A 3VERA 4W5RA 3GONA 1H6KX 5CZXA 3C19A 3BPSP 3QAUA 4HVJA 2NXUA 3JQKA 3OL7A 2HHUA 4B1ZA 1WI6A 4OYMA 3SZ2A 5C5JA 1SZ2A 2BACA 4CO4A 2NZTA 4IFEA 4AHCA 1RT6B 4X4RA 3E66A 3OYBA 2W9CA 4XH5A 2B56A 3NF6A 2LXIA 3ZLJA 2VWKA 1E6VB 1XNRK 4HDHA 1D8YA 3IR7B 3U9DA 2CJXB 4O0IA 1N5QA 4M5GA 3A8YA 2KRBA 1NK5A 2V8GA 5T14A 2RU9A 3DLRA 3TUIC 3OFFA 3W63A 1U1QA 4DV3K 3GE1A 4YEAA 3QT8A 4DMZA 1U48A 4ED6A 2HURA 3ET6A 1JNRB 4LFBK 2GHPA 3TPQA 4JI6F 4UOFA 5C42A 4WF9Q 2QSWA 3BGUA 2LKZA 3KYLA 1YX2A 1KTQA 4Z2XA 3FZ2A 3E9LA 1JLCB 3EX7B 1PKUA 2G2YA 3DLGB 2W2QP 4PPDA 3MEDB 2L48A 1KAXA 3KHHA 2X3DA 3DXMA 1P1TA 4JBCA 4ZPAA 1BHNA 1WEYA 1LV5A 3ISNC 5JLFA 1F9EB 2OPQB 3IBFB 4FWLA 3PJWA 4JV2A 3NMUA 2BJDA 1QJHA 4ETXA 2GCFA 1YJRA 1U2VA 2F40A 4QYZK 2H65B 2Y1JA 4Y2KA 2UVRA 4QIFA 4YY3F 2VQFF 1F5BA 2WSEC 4CZHA 3M8QA 3ENQA 4LF6K 5DLGA 2V69A 3UN2A 3KLHB 2KO1A 4O3QA 2RSQA 1YVUA 3MN9A 4EIAA 2YNFB 2UVVA 5D3GB 3MDFA 1RCXB 1RNHA 1JX4A 2BE2B 2QL5B 3H25A 3A3NB 5ETMA 4FYXB 3POTB 3NFAA 4DUZF 3AO1A 4C23A 3UKRB 4DR4K 5F8MA 4BGBA 3FZFA 4IQMA 4F7VA 1HBMB 4CJFA 1ZBHA 4CLPA 3HM9A 4GV6A 2HQFA 3H5XA 3UVJB 2DR9A 1U24A 4CEDA 2CZ4A 3FE1A 1D8ZA 1PBAA 2G4BA 2AZ3A 3EUNA 4CYUA 2GMJA 3NH2A 4HR2A 2BYCA 1CULB 4MK9A 1JLBA 1FRIA 3RUBL 2Q2RA 4RW7A 3D6RA 3PIPQ 1RTHB 4CLLA 3VAIA 1JXEA 4CM0A 3EKSA 2F8SA 1WELA 1VMBA 1TUVA 1TL4A 3PYFA 4W92B 3G25A 4HACA 5KFXA 3FEYB 2XULA 4NLVA 1QAJA 3MPDA 4KI4A 2Z1JA 3QZ7A 4LRBA 3T9NA 3KXDA 1SB6A 2YNIB 4MFBA 3M2VB 2GIRA 1SC3B 3TANA 1RADB 3TWHA 3GCWP 3DLLQ 4ZIVA 1C0TA 3CMAN 2NLXA 3D54A 4DV2F 5HMWA 3OYMA 2VQEJ 3N9UC 4PQAA 5KG5A 3S3NA 3M2RB 2AP1A 2ETJA 4F04B 3UD5A 4DCJB 1D1UA 4NLGA 3AY0A 3DGPA 1Q78A 2GO8A 2DGXA 1HX1A 4YP3A 2R7OA 1OWXA 1D09B 4DL7A 4FP9A 4CEZA 1UJ4A 4GVLA 2QE5A 4D3GA 2R3VA 4FJIA 3G8TA 1GXLA 1HNVB 3OFEA 4DUYK 1JLAB 1H0HB 3JXUA 1HR0F 5AZJB 3PW5A 4ZN1A 1IBMJ 1VRUB 4HTIA 3EM1A 4DR1J 1QLNA 3BF3A 3OVAA 3ELHA 4F0HA 4A61A 5DG9A 2VDIA 3TTDA 3IMQJ 3D2FA 3S01A 3C0BA 4DFMA 4Y2IA 1ITGA 2HBMA 1X9WA 3HHEA 3M8PB 4DTNA 2FLLA 2VFTA 3C7NB 5KQ8A 1QVFM 1HUXA 2HWIA 2CKWA 2OFHX 1QQMA 1DTQA 4FVMA 2E20A 2GTDA 5DMRA 5AXKA 3H20A 3PDNA 2OPSA 2OHDA 4KHPF 1IVZA 1BQMB 2LQ5A 1X3NA 1LWCA 2VKRA 1VQLS 2JL9A 4IR9A 4GKKF 4W5NA 4DF8A 3PFEA 4C98A 3TUPA 3VA3A 4M1KA 5I9EB 4PZVA 4GNIA 3BZQA 2G1DA 1YQHA 2RF2B 3I4PA 5L1JA 3TEGA 1B70B 1LK5A 2Q1NA 4RWTA 1RDUA 1XTZA 3UCUP 3ZX0A 2IIHA 1BLUA 1O1WA 2DFEA 3SPZA 3K5MA 3WT0A 4DDFA 1BISA 1NPKA 5M1NA 3SI6A 3CCMN 2LA6A 3CDAA 1X4BA 3EZ5A 4JKAA 1LXJA 4J8FA 3THYA 4LVNP 2QRRA 4WYWA 1GLJO 1EETA 4C2MA 5IWAJ 3IC1A 2KHDA 3GYXB 4RBTA 1HQUB 4A8SA 3V6JA 2VG7B 4FNHA 4E7IA 2H3GX 2C3PA 2E7WA 5AQWA 2IAJB 3I0SA 4K4ZA 3OYHA 5I3UB 4RL1A 4GC7A 2UUBK 4FF4A 2NR0A 3GFYA 3VQTA 1VQMS 1E4GT 2ROPA 2PFUA 2V2QA 1BU6O 2VWBA 2XEXA 4P52A 1E4FT 3B8AX 5F0XA 4U7CA 1RTDA 2KXNB 4OZ1A 5LSRA 4RBVA 4ZCKA 5TKWA 4M5MA 4CVNE 5L8RC 4YB1P 4IRCA 1I51B 4JKCA 2BW7A 3LM9A 4I6YA 1JLFB 3P31A 4B8AB 3K5OA 3MCSA 1WSHA 2R8HA 5CYQA 4ANEA 4R79A 4O44B 4CW7B 4C8MA 4O8UA 2IDEA 4BS2A 1WB9A 2J5AA 5CE3A 1YWXA 4JI2J 4K4SA 1S0MA 2OUGA 3KLVA 3OLBA 1B0PA 3QT5A 4NOHA 1S6PB 1LOUA 3DKDA 3CJ8A 5TKYA 3OYKA 2J6TA 4I6AA 2A6MA 2XB2D 1Q18A 2VBZA 4BHQA 4A46A 4B8CA 3F73A 3C6AA 3RW6A 1RT5A 3VF4A 1N6QA 2MHNA 3PUFA 3I55S 5GAEP 3CM5A 3ILJA 4O5BA 4JYAJ 4U7UD 4ES2A 3QFHA 2IIRA 4RU2A 3WEEA 1QSLA 2EC0A 3A1YG 3SV3A 3RVCA 1S9GA 3SXLA 4CJ5A 3HOTA 4PWUA 4K8XA 2Y1IA 4TYAA 1NG9A 2JGUA 4Y1DA 4ILLA 3CWJA 1RBAA 2F96A 5THWA 4FZXC 1FX4A 4PQUA 3R5BA 3LGHA 3O9TA 3K0JA 1IG8A 2J0WA 3JAMO 1K6YA 2P6TA 1N36J 1QSSA 2G2OA 5JS2A 3A8KA 3SUOA 1SI9A 3C46A 1EHWA 3HDSA 4RZRA 3MEGB 3GIKA 2FVPA 2DPNA 1RKIA 5JXSA 4YQWA 1HHSA 3IP0A 2DH8A 4ZVQB 3H4DA 2RUSA 1T9XA 5IV4A 3A5LC 2HQDA 4FKXA 1NKEA 3DYAA 1R8HA 4LF2A 4HUFA 3JSMA 2VG6A 4JP8A 4Q2MA 2DGTA 2J6UA 1HNXK 4CHPA 1BA0A 4DR3J 3CIMA 2R4FA 1C1BA 2POKA 4RBUA 1SH3A 2V68A 3CCQS 2D0PA 2J9DA 1RKJA 3AAWB 5F8IA 1AFIA 3NWGA 3CPWR 3CULA 3S9HA 3FQKA 1C0UA 4NWBA 2DH7A 4OPAA 3G6VA 3AJDA 1QHAA 2NZCA 2W7AA 1FERA 3A4TA 4P9SA 3TAMA 2MGZB 4H4MA 1I94F 4FXVA 1QAXA 3EDRB 4JHDA 2XWYA 5B0DA 2E5LF 4B17A 2VODA 4KV8B 2B4UA 3N4QA 2B4OA 2BQUA 4JI8F 2F63A 1P90A 5D15A 2GX8A 4RUAA 2QA4G 3CC2N 5EDWA 1UAWA 2HQCA 4P7VA 2EBEA 1HRHA 2YNGA 2VB6A 5L46A 4V19J 4OLAA 4KGMA 1A5VA 1DT9A 2DO0A 1C1CA 3BBCA 4USMA 3HKZD 3FBFA 5KGWA 1DZ5A 1SIWB 1RCOB 4ED2A 3RMBA 1B99A 2JHEA 2E1AA 4DS4A 3NGDA 1FEEA 1QVGR 2V2KA 1VAZA 3V4IA 1WF1A 1FRKA 2W1BA 4KY3A 1QUVA 3EJMA 3N0VA 2BX6A 1XNRF 1XEZA 1RBRA 5A8WB 2EFNA 4ZLJA 4HTLA 3IN5A 4EI2A 3IUCA 3L2QA 5M1OA 2BKOA 2BJ1A 1X4DA 3CSKA 1Q7LB 4H4KA 2PGCA 2Z2MA 1RHKB 3B6PA 4CECA 4OGEA 1N8RT 4DV3F 4FJ7A 1EX8A 3A8IA 2UXCF 2PD1A 4DR5K 1BL3A 2E4LA 1GLEG 2DXDA 1Y9OA 1FTRA 1T95A 4U96A 3ZNJ1 2YX7A 4JI7K 1NDCA 2OELA 4KYZA 2QXLA 4F4WA 4RW8A 2RMLA 4CIEA 2VJUA 1VQYA 4BCAA 5GAHP 2XRIA 4HT5A 3NOGA 3RRHA 4DJBA 5CCLA 2PI4A 4IG3B 5KFEA 3L7PA 1SJ3P 4C1NI 5KPTA 5J2MB 3LZIA 1U45A 4X66K 1OYDA 3ZSWA 3CJ0A 4ZPCA 1V5IB 4Y0FA 1TGOA 3A3OB 4EBDA 2E66A 3F5TA 3FZBA 1UVJA 3VF6A 2DY4A 2O66A 2DNKA 4N41A 3NG8A 2ACMA 4YMEA 2B51A 4TVAB 3PXGa 3K7RA 3VEVA 4DR4F 2K06A 4FF1A 3WNHA 5EY4A 2LFVA 1SH0A 1OVYA 4L72B 3NGSA 3D2EA 1SJ1A 4AHTA 4KHRA 2JFKA 3ZX2A 3KK3B 4OI1A 3DHXA 4USTA 4YOYA 1ZA2B 3R5AA 2XLIA 4BQLA 2YHBA 4KFBB 3QNNA 1S1VA 2MMYA 3MR2A 1TMJA 2N7CA 3GQCA 1I3AA 1ASUA 1XJWB 1BIZA 5L9NA 4IH5A 4FWPA 3K17A 2AX1A 1WSIA 1MU2B 1T9WA 1RHUB 2BMBA 2PEHA 4ZPWR 3VEWA 3M7VA 5CCMA 5HK4A 4EBEA 3CCSS 1WNSA 1IBCB 1IBLF 2FBXA 2HNYB 4NYPA 1VS3A 4EBCA 1C2PA 5KFDA 4IDKA 1VC5A 1PO6A 5LMNJ 1GXUA 3RBDA 5KT7A 1IKYB 5DQGA 4JKEA 4W98A 5DETA 4MKVA 3EGWB 4USHA 5RUBA 4ERDA 5HRPA 3FRZA 4M5LA 4M7YA 2UP1A 2IGIA 1AUSL 4TYBA 4DUYF 3KWIA 3I8BA 4PRFA 3N6MA 1KC8O 1W97L 1IKWB 2Y8YA 3O1LA 2NRHA 2OCEA 4JD2B 2BJ8A 2D69A 4ZVOB 1AFJA 1S1TB 1CPZA 3T1YK 3UW1A 4BRNA 1P9QC 4LF9J 2CQDA 3BH7B 4I6WA 2BM1A 3ZT0A 4WK1A 2IVOA 4P75A 4U67L 3TSQA 3H2UB 4P2SA 2VFVA 2P8IA 2O8FA 3M6UA 3DRYA 2F5GA 4QJVA 1S0NA 3V9XA 2HNDA 2DCUB 4LSZB 1B92A 3LPUA 5LM7E 3AD9C 2PDAA 3CQYA 2XNRA 4H0VB 5CQGA 2Q3PA 3MR6A 1XMOJ 3I31A 1WSEA 3HHNB 3Q8VA 4I6MA 3BJYA 1ZTTA 2CPXA 3R6GB 4F02A 2CGLA 4Y28C 2HIYA 2OEMA 1HKCA 3BKTA 1HNZJ 2YPYA 2Z1IA 1WC4A 1FKPB 5B8HA 3QIPA 4U7BA 5F8NA 3EMTA 4M5DA 1ZM4A 1U6ZA 4F9OA 3BR8A 3I56N 4RW9A 2HFSA 4PWDB 1LFPA 2EFQA 2MKCA 2NUHA 3SJHA 5B0AA 4K0KF 3DRRA 3MURP 3CG7A 1SC1B 2B7BB 4ELVA 1MWQA 2D3ZA 2J0QD 4F3OA 5AQHA 3QEWA 1HMVB 4V19S 2NQPA 4CJEA 1HA1A 2AF6A 1IR0A 1PAUB 2RDDA 1BUXA 1B0TA 2H4WB 3ATUA 2MKIA 4IRDA 4AHRA 3FGUA 1ZH5A 1S57A 4PKDB 1A5WA 2AEFA 2CAJA 5IT4A 3FEZA 3MXMA 2UUBF 1NEEA 2C2EA 2MLYA 1WKLA 2E5HA 3SI8A 4NCGB 4O8KA 5F0WA 4ZITA 1B7FA 3HHLA 3TOQA 1HQEA 1AUDA 3AOAA 1GTHA 3MUMP 4RUBA 3SUNA 1KLNA 4O0NA 4ZVGA 4FYDA 2Z56B 4K2XA 2LU1A 5AQSA 4H5WA 5AQRA 5HVFA 2JZ5A 5KT2A 2OANA 4KE5A 2HG4A 1QDUB 2KYXA 3S6EA 4PYDA 3MXIA 2IVNA 5FPDA 3G6EN 4MIAA 3CC7N 4ZVUB 4NLXA 3V6KA 5EX0A 4KH0B 2C2RA 1ZXOA 3GJTB 4JKDA 2FF3B 1JLGA 3M1VA 4X4OA 3D6MB 3MN5A 2AIRB 3ITHA 4U6PA 2ZGZA 1S9EA 4HTUA 2NPFA 1FHTA 1YKWA 3ZSOA 3KLGB 1RTJA 1HYSA 5IM0B 4Q5VA 4ISEA 2ZE2B 3VQBA 2B5JB 4HLBA 5F0UA 2DR6A 5DDOC 3PLAA 5H9FJ 3QLHB 2EKYA 3ENWA 2OMOA 4KHWA 4P10A 3T6BA 3I9V9 2IRUA 1VQ7S 3OTEA 3LDQA 4YHHK 2X74A 5HJXA 1WOOA 3AJ2A 1FWLA 1DHMA 3GR1A 3GIIA 3VVTA 1UFWA 1OH5A 1SKRA 2CZVC 1M90T 4B3MK 2BDPA 1ZM3A 4C11A 3DLKA 1FJEB 2YKAA 2A41A 2DFHA 3OQ2A 3KK2B 3WNFA 4TY8A 1DURA 4YR2A 3OVBA 2HSEB 4USKA 2IRXA 4OI4A 1NSQA 2ZBRA 2W9BA 1Q8LA 3Q8UA 1R27B 1WHXA 2GGPA 1RBVA 1X8DA 3O9UA 4LIRA 1TL3A 2QA4S 4CFBA 4FWMA 3FFIB 5L1LA 3CC4N 2G0JA 1VQ5N 2DGWA 3G8QA 3LAMA 2DYAA 1IO2A 4IQXA 2RNEA 1VGYA 3JQMA 3P5TL 4JV0A 1S0OA 5KTQA 2ABYA 1VQ4N 2B7CB 3R5DA 2RRBA 3S3MA 4LJMA 1HBNB 1HQ2A 4OX8A 2H51B 2HZVA 2UUAJ 3H4BA 2FLNA 2FF6A 3QJJA 5FPEA 2YKQA 4XEIA 1T8EA 3NNCA 1WUUA 2AYEA 5AQVA 1VQNS 1Q8BA 1KS2A 1HNXF 3B78A 4CJVA 4Y2CA 3WXMB 3MEEB 4FJ5A 4AHUA 2DGUA 3SMZA 2GJ2A 3OHRA 2R7TA 2ZD1A 1K8AT 1PJ6A 5GADI 1NCLA 3M8WA 4OHVA 4LSLA 1TMMA 1LAWA 3GG1A 2IDLA 2VFUA 2VWJA 1NPPA 3MM9B 4K5SA 5A8RB 4FS1A 1RAOA 3W9IA 3W61A 2NLWA 1IR2A 1QZ5A 1RWWB 1UOCA 5KFMA 2XLKA 3VQ9A 2A10A 2GS8A 3ADAC 4N7TA 2AGOA 4ID5A 5B7WA 3KJNB 1CJKA 4LF8K 4WIIA 5HVGA 2U1AA 2KG0A 3AO4A 3PTWA 2CPYA 2Y1RI 2KJVA 1IM6A 5D0HA 1RT3B 2GFFA 1JLQA 3PR5B 3AAPA 3FNNA 2M0GB 4BACA 4QZVB 3KVGA 4OX6A 3UN3A 1NK0A 4O4GA 1TL7B 2M52A 3N5FA 2BTFA 2V9WA 2XHWA 2NS1B 2XMWA 2OMLA 4C0OC 4LF7J 1ZBTA 3CDWA 3LO3A 3SCKE 4Y6IA 2KM8C 3MR7A 3C94A 4DKWA 3ZSZA 4U67Q 5CAAA 4F4YA 4F0MA 3BF1A 4WBFA 3VEZA 4ENOA 2M9KA 2E6LA 3CD6N 1UJ5A 2ERRA 1YITN 4MT1A 1N4LA 2O4GA 4CZMA 3OR1B 2KI2A 1RAHB 2I7NA 2IJFA 4X62F 2GUIA 2ATCB 2WTUA 1NDLA 3RBZA 3W5XA 2CPJA 4ECSA 1NK9A 4CGHA 2HBJA 4DR5F 4F50A 3I0RB 3K59A 4KPCA 4EFAC 4QWAA 3H59A 3V6DB 5HO4A 4BDYA 2V9KA 1GOBA 2G8HA 3RR7A 1FVQA 4ILJA 4I69A 4JI5J 2FJAB 4JI7F 4FF3A 3CERA 3V81A 4RW4B 1D0EA 2HF3A 3QESA 2AMCB 2NRVA 2VFRA 3R27A 3O3LA 2X1FA 1QSYA 2VONA 4KR0B 2N3OA 3SMSA 2EHGA 4PL8A 3ZSYA 4OX7A 3U02A 3UN5A 4DV4K 3CUNA 4FCYA 1Q82O 2LSNA 1HBUB 2D9OA 5JVGL 2D5RA 1DEJA 4LR8A 1N33K 3HZGA 4XH4A 1X31C 1IBKF 3BEXA 3HJFA 1S1XA 4Z4CA 4A48A 5HRSA 1RHJB 2H54B 4JUZA 3W66A 4ILRA 4X66F 2G9OA 4IFVB 3WNEA 2XO6A 3MXHP 2QWNA 3AGRA 5GAEU 1ITPA 4P7TA 1JLEA 3UB5A 2HHXA 3CJKB 4DV0F 1ZS6A 3C66A 1VQ6S 3VQ7A 2HLTA 2UXDK 1HNWJ 4ED3A 3MPWA 2V7YA 1IH7A 1RBLA 3CQ8A 4C8NA 4NXMF 3KJVB 3TAGA 3AA4A 4UUXA 2ZH6A 2EI5A 2ITMA 4FW2A 2P9NA 2P9SA 2LDIA 3GB0A 3BBFA 5C2DA 5HMXA 3K8VA 1CJVA 1T6CA 1N54B 1OSCA 5DK5A 4K59A 4L8RB 3OBYA 4HI1A 3FLCO 2HS4A 5KG7A 3SEOA 3OSPA 2HHPA 3OHAA 3L09A 3TUZC 4UQGA 3OVNA 1SUQA 3ZTOA 4X64K 1QE1B 5AJ3J 2EW9A 1CC8A 3CCJN 3BO2A 2FY8A 3LP1A 4CF8A 3IWLA 4GV3A 2RKIB 3MWTA 2B3TB 4AT1B 3MM5A 2J4RA 4J9MA 2WVDA 3PJXA 3M8RA 1OVQA 2LDYA 3IS9B 3OUYB 2PFFB 3AO3A 1T05A 3Q86A 3VF2A 4FM1A 3GJQB 2BKPA 4ECZA 4JKBA 3KG1A 4A47A 4GC6A 2IOCA 2CJ9A 4BRCA 1XMQK 3UIQA 1GMWD 4XAKA 1EKSA 1NB7A 2CVIA 5A8KA 3ZT3A 1DTTB 2XHCA 2JLFA 3ETOA 3U1LA 2WBNA 4R5PB 4CHQA 3P5BP 2KZMA 2P9KB 4PXBA 3C6TB 4QIWD 3THWA 4PKGA 4E3SA 1WACA 1Q5VA 1HWKA 4X4TA 3GL1A 4CCHA 2HNZA 1J2VA 2BQ3A 2DGSA 5DM6L 1H7WA 4WTYA 4QWBA 3Q2TC 3QICA 3BSNA 2YHXA 4OZ3A 3PKMA 2WBRA 5ETQA 3GV7B 3U6FA 3ISND 1VQSA 1ZBUA 1HIYA 2H5JB 4LF5F 1QTNB 4K8ZA 1FKOA 1M5HA 3VAHA 3D45A 4E2FB 3J7A1 5AQMA 1NUEA 3NGZA 1VDHA 3H0PA 4ZOSA 5A0YB 2R2RA 2H3EB 3T1YF 3O9RA 2ZM6J 2RS8A 4ZN3A 1A9NB 3KFWX 1URRA 2HMIB 2ZH3A 4LFAK 3DCAA 1OQ3A 3H3OB 3LALA 4DQQA 3N6LA 1HPMA 5I42A 1VQ8S 2P5OA 1IJJA 4QWEA 3NDKA 3AVHA 2PMWA 1RYRA 2V5HG 4I9QA 3E2EA 3MMVA 2VBXA