4CFBA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfbA00
2BANA 4H4OA 3KLFA 2BE2A 1SL0A 4J2DA 3VQ8A 3OYMA 3KLHA 3DOLA 2IDOA 3LAKA 1RT3A 3KD5E 3VQDA 3VA3A 2PYLA 2F8TA 3CM6A 3L2VA 4BACA 4GMJB 2Y1IA 1S1XA 3TAMA 4JRPA 1JLGA 1JLCA 4CECA 2I5JA 4KFBA 4LD0A 4Z4FA 2YHBA 1RBVA 2XHBA 4DU4A 4M3ZA 1C0UA 1JLQA 4FLYA 3HSTB 2HB5A 4FLTA 3SQ4A 3MXJA 4AHUA 4YFUA 4CERA 2OA8A 1WSHA 4G1QA 4CJWA 2OYQA 1TK8A 3K2PA 4CEDA 3C6TA 4CJ3A 4BWJA 1BL3A 2OPSA 4DTSA 1NK5A 4C8NA 3TABA 3ZSOA 2PYJA 4ZTJA 4DLEA 4DQRA 4RW7A 3BGRA 3VQ7A 4F2SA 4CCHA 1NOZA 1VSFA 4DTPA 3MAQA 3NE6A 1BCMA 1MU2A 5KTQA 4C8LA 4KHWA 3HPHA 1KVBA 3B6OA 4R5PA 4E19A 1S1UA 1HYVA 3L8BA 3DYAA 3WNGA 3OYGA 3AO2A 3C95A 2ATQA 5DMRA 4CFCA 1KLNA 3IG1A 3LALA 4I7FA 3VA0A 4FLZA 1Y97A 4I9LA 3V81A 2HNDA 3S9HA 2A1RA 1KVAA 1XHZA 1CZBA 3KD1E 4HVJA 1RNHA 3QEVA 3G10A 4B9LA 1LWFA 5D3GA 1S6QA 3LP2A 4KPYA 3OYCA 4B8CA 2KZMA 4W5NA 4CHPA 1HYZA 4BDYA 1VSJA 1TL3A 4FLWA 1WSJA 3LPUA 4AH9A 4O0IA 5I3UA 2JLEA 3DLKA 3QIPA 3DLGA 5J2NA 2P51A 2XO7A 3T19A 2YV0X 1IKYA 3MECA 1X9WA 1U45A 2YNHA 3NF6A 2NUBA 4KHNA 4KO0A 4CJ5A 3SNNA 2O4IA 1WLJA 4N76A 1LW0A 4O4GA 5E41A 2A1SA 3ZSWA 2OZSA 3QERA 1ITGA 4DTMA 3U3YA 1L3SA 4HHTA 2FBYA 1SKRA 4KAZA 3OYLA 1FXXA 4DS4A 2FC0A 1C1BA 3T1AA 3ZT0A 3TAEA 4TSXA 5FROA 3OYJA 4DTUA 3AV9A 4E3SA 1Q9XA 1SUQA 3ZSYA 4OKJA 2XY8A 2GUIA 5T7BA 4W5QA 3UIQA 4JS4A 5SWMA 4CJFA 3MXIA 1IKXA 2EX3A 4BE1A 4NCAA 3NDKA 4DTXA 3JSMA 2Q3SA 1RBUA 4AHRA 3RWUA 4QOZB 2QKBA 4Q5VA 3DOKA 4B9UA 2HHQA 4CFAA 1NK9A 1I39A 4FW2A 1VRTA 1IKWA 4BWMA 1NKCA 3CFRA 4BDPA 4CGIA 3PX4A 3RR7A 3QINA 2RN2A 4IKFA 1VSKA 1KTQA 2ETJA 2D0BA 4CJTA 2DFEA 4DU3A 3DLHA 3HVRA 4FLXA 2W42A 4Q0BA 3KK3A 3CQ8A 3PY8A 4FK2A 1GOCA 1KRPA 3L2UA 3AA4A 2HNYA 1RT6A 3AVHA 4PQUA 4O0JA 4GW6A 1XHXA 3DRSA 2HHVA 5EU7A 3DRPA 4CJPA 3V9WA 4BE2A 4CF1A 2DTUA 3SQ1A 1JLEA 4OKEA 3TWHA 2G8HA 1T7PA 3NH2A 1T8EA 1B9DA 3HJFA 3KKSA 1G15A 4IFVA 4HUEA 1Q8IA 4IG0A 3TAPA 2XY5A 1DTQA 3WNEA 3K5MA 4KHQA 3HK2A 1WAJA 2VG5A 3ZT1A 3HPOA 4Z4GA 3D0PA 2DFFA 3K59A 4M42A 4DTJA 4KI6A 4HCCA 4M3WA 2OPPA 3VQ4A 4ID1A 4KHUA 2HHSA 4HCBA 2R7YA 4B9VA 1ASVA 4DSIA 1GOBA 4F3TA 1SL1A 1LW2A 1HQEA 1RTIA 2B6AA 5C24A 3L2WA 4ELTA 1NJYA 3PX6A 1CXQA 5CZ2A 5HRPA 3EY1A 4B08A 3HP9A 4E7JA 2YHAA 3CG7A 4CJRA 3OYEA 3AO3A 2BGGA 4RW6A 3K58A 2D0AA 1VRUA 4FW1A 4KHYA 5KRSA 2KQ2A 4FLUA 1ZBLA 1UA1A 3K5NA 5HRRA 4DLGA 2BDPA 4ELUA 2XY6A 1J54A 3KTQA 4CJ4A 1JLAA 3QLHA 5J2MA 1BQNA 2KZZA 4B9TA 4OGCA 1KVCA 1S5JA 4CGFA 1TKTA 1NK8A 4DSLA 1NOYA 1NK6A 1D9FA 4Z0UA 4KTWA 1U47A 4E1MA 1HYSA 1EP4A 1QSLA 1DLOA 4CHQA 3OYNA 4DS5A 3AO1A 4CHNA 3V1QA 4DSFA 4E7LA 1NJWA 5K14A 4J2BA 3U3GA 3PO5A 4KB0A 3PX0A 1TV6A 4F4KA 2KFNA 1REVA 2E6LA 2PY5A 3VQQA 1C1AA 1RT4A 3NF7A 3SI6A 1KFSA 4E7KA 4CEZA 5KGWA 3OVNA 3DLBA 4CEQA 5CYQA 3DRRA 4OPKA 3CFPA 3TAQA 1TAUA 3IRXA 5DK5A 3O4NA 4FJ9A 2ZQBA 4KI4A 1RDAA 4N5SA 3LPTA 4DSEA 2P5GA 1A5XA 4KTZA 4CEFA 3LZIA 3HXMA 2VWJA 1BGXT 4NYNA 5J2QA 3RMAA 1U49A 1X9MA 2GBZA 1C0MA 1RTDA 1IG9A 1RDBA 1L3TA 1D5AA 2YKNA 3L3VA 4HTUA 2HVIA 1VSLA 4W5TA 4CJEA 1HNVA 2ZE2A 4CJLA 1NJZA 3LZJA 4JS5A 2OPRA 3DMJA 1RT1A 1VSDA 3VQAA 4AHSA 4H8KA 4DQQA 4K8XA 1NK7A 5HP1A 5FDLA 5HRSA 3OJSA 1QSYA 4CESA 1HMVA 4FJMA 5JS2A 4EP5A 4ZHRA 3OJUA 1CXUA 3SQ0A 1QQCA 1WSGA 1BCOA 3ULDA 4M3TA 4OLAA 1JLBA 2IC3A 4MFBA 4CF0A 5SZTA 3KLIA 3AA3A 4M3RA 4FJ7A 4QCLA 3V9UA 2X78A 5CZ1A 3L2QA 4DF4A 4CEEA 1RT7A 3O4QA 3K5OA 4Z4CA 3LP3A 3NH1A 3AVBA 3KIOA 3OYHA 1VSIA 4RW4A 1TK0A 2P5OA 3ZT3A 4Z4EA 1BIUA 1O1WA 3V9SA 4FM2A 3M8SA 4W5RA 1VSHA 3QEPA 2FBTA 3DM2A 3KK1A 4FLVA 4J2EA 3AVKA 4CK3A 3ITHA 1LAVA 3PUFA 3VQ6A 1RDDA 1BI4A 3LP1A 5CYMA 3MEDA 4CIGA 1KFDA 3OYBA 3MEEA 3VQCA 1IH7A 3P1GA 3AVMA 3SUNA 3M8PA 5HBMA 1HRHA 3EYZA 4B3OA 4CIFA 1B9FA 5J1EA 3RMCA 1QSSA 1TVRA 4C8MA 1WSEA 4AHCA 4M41A 4MQ3A 1NK0A 3OYFA 4DTOA 1VSMA 3SUQA 4CE9A 1BQMA 1YTAA 4RW8A 1Z25A 1LWCA 2ITGA 1A5WA 2IAJA 2GV9A 2OPQA 4BE0A 3O3GA 2KW4A 4B9MA 4FJHA 2YKMA 1CZ9A 4DQSA 3I0SA 4O5BA 1SKSA 4F8RA 1EXQA 4FJNA 4DFJA 1QTMA 1QS4A 4IDKA 4FM1A 4CGGA 4NCBA 4DFPA 4C8KA 1N6QA 3ALYA 4PWDA 3RRHA 3AVLA 1TK5A 4CJQA 4DSJA 3OYDA 1EKEA 4FJ5A 4KB1A 5J2PA 2B5JA 3QIOA 4CHZA 5CY4A 3AVNA 1LWEA 1S1VA 3DLRA 2IS3A 4CK2A 3SPZA 4DWIA 3LP0A 5KRTA 3S3MA 4IFYA 5FRMA 1SL2A 1QHTA 4ZTFA 3NGYA 1NKEA 4OLBA 3LWMA 4N47A 3RR8A 4FJGA 2G8IA 3NAEA 3AO5A 1BHLA 1RCHA 4CGHA 3RRGA 2YNFA 2HVHA 3NHGA 1RILA 3QESA 5KI6A 3CFOA 3ZSVA 2X6NA 4C8OA 3VN5A 4CGDA 4KKOA 2G8VA 3KJVA 1ASWA 1I3AA 2QXFA 1VK0A 1L5UA 2F96A 2X74A 3FFIA 4OJRA 1RTJA 4CEBA 4OPJA 4CFDA 3WNFA 4DQPA 4FK0A 4CEOA 3NF9A 1FKOA 1Z26A 1YTUA 3I0RA 3LAMA 2F8SA 3KLGA 1J5OA 3V1OA 1WSFA 4O55A 1B92A 3AVFA 2FBXA 4KTQA 3ZSQA 1JL1A 3HYFA 3TR8A 2IOCA 3HVTA 2YNIA 3KK2A 1GOAA 4DF8A 1L3UA 1C6VA 2IGIA 2AJQA 1JXEA 3LANA 4EP4A 3V9ZA 4N41A 3DLEA 4EZ9A 3HL8A 3OYIA 4RG8A 3WNHA 1TL1A 1ZBUA 3ASMA 1R0AA 3QO9A 1ZBHA 4FZYA 2QKKA 4OKKA 4I9QA 1TGOA 4CJKA 3ZCMA 3SUPA 1FKPA 3OS1A 1KLMA 1TKZA 2HHWA 2B4JA 3AO4A 2G8FA 3VQ5A 3SV4A 3TAFA 4BDZA 3NF8A 3A2FA 1HJRA 3V9XA 3L2RA 4FJJA 4KREA 1SV5A 4DMNA 4FJLA 1EX4A 5JS1A 4FCYA 3C94A 3MXMA 4CJVA 3AVAA 4M45A 1YVUA 1QE1A 3OYKA 3OYAA 4OVLA 3HT3A 1EETA 1IKVA 1BI4B 1UOCA 3SYZA 4AILC 4KHSA 1N5YA 1S1WA 1RBTA 5HROA 4HUGA 4DQIA 1Q9YA 4FXDA 2P1JA 3QNNA 3HO1A 4O44A 3V6DA 3S3OA 4FZZA 1JKHA 4QAGA 1C0TA 4GVMA 4AHVA 4B9NA 3M8QA 4J2AA 3SV3A 3QNOA 4FJKA 1ASUA 3CYMA 3NBPA 3OS2A 2LSNA 2XRIA 3B6PA 4AHTA 4CJUA 3SZ2A 4F3OA 4CIEA 3ZSRA 1C1CA 4N56A 4CGJA 3VQPA 4M3XA 3D45A 1TKDA 1W9HA 1HNIA 3LWLA 2O4GA 3ZSZA 1VSEA 4NYFA 3ZT4A 4CJSA 2QK9A 3ZT2A 4I2QA 2WOMA 4ELVA 1IO2A 4IBNA 4W5OA 4B9SA 4DSKA 2VG7A 3NGIA 3RTVA 4JRQA 3AA2A 3P83D 2PZSA 3SJJA 4HUFA 4JLHA 5I42A 3M8RA 2OZMA 4FVMA 3S3NA 1FK9A 1ZBIA 4UQGA 3CM5A 3F9KA 3DI6A 5KGXA 3O3HA 4OGEA 4CHOA 1T03A 1WN7A 2DFHA 4F2RA 1WSIA 1WNSA 3V4IA 2G8UA 4LSLA 4M3YA 2RPIA 3LDSA 4CK1A 1XWLA 3NGZA 3RMDA 1X9SA 2KTQA 3NFAA 4DTNA 2Z1JA 1RTHA 4DG1A 5C25A 2HW3A 3QEWA 3RMBA 2E4LA 4E0DA 1T05A 1RT2A 2HHXA 4IG3A 1LAWA 1NJXA 3T3FA 1XI1A 2RKIA 1UAXA 1J53A 1J9AA 1S6PA 2X6SA 3P5JA 3U6FA 4DTRA 4LH4A 1S9EA 3QETA 4E1NA 2JGUA 4M3UA 3HM9A 1SKWA 4LY7A 2HNZA 1JXBA 3VQEA 3I8DA 1F21A 3F73A 2VWKA 3SCXA 4RW9A 4WE1A 1S9GA 1CLQA 3BDPA 3HPGA 4Z4IA 3SUOA 4LH5A 2ZD1A 4PY5A 1DTTA 4DFMA 4E7HA 4E89A 5C42A 4H4MA 2HHUA 2Z1IA 2Z1GA 1WAFA 3TANA 1BIZA 4FJ8A 4YNQA 3K57A 3TARA 1RBSA 4CF8A 1W0HA 2Z1HA 3L3UA 3TI0A 3AVGA 1UA0A 1U4BA 4FYDA 3QEXA 2FBVA 1RT5A 4ICLA 3IAYA 4CFBA 1KSPA 4CEAA 4FZXC 4B8AB 1D8YA 2Y1JA 1XC9A 2WONA 4Z4HA 4ID5A 4I2PA 1HPZA 1TAQA 1UWBA 1NK4A 2G8KA 4CF2A 3AVJA 1RBRA 2RF2A 2KFZA 3H08A 3EZ5A 3SQ2A 2HMIA 4PUOA 4CF9A 1D9DA 4NCGA 4Y1DA 4XIUA 4LSNA 4L8RB 2G8WA 4DU1A 3O3FA 3PV8A 2HHTA 4K8ZA 3AA5X 1U48A 4FJXA 3AVCA 1JLFA 1TKXA 1K6YA 4Y1CA 3TAGA 1NKBA 3MEGA 4PA1A 2DY4A 4FM0A 1JL2A 1X1PA 2VG6A 3K5LA 3KLEA 1KCFA 3PO4A 2XY7A 3V1RA 5FRNA 4EZ6A 3VQ9A 5HRNA 1ZBFA 2E6MA 1L3VA 3IS9A 3OY9A 4KV8A 2YNGA 1A5VA 1RDCA 1U04A 1YT3A 3E01A 4E7IA 1HQUA 3ISNC 1LV5A 1S1TA 4KRFA 5HLFA 3OS0A 2EHGA 3JYTA 3C6UA 4FJIA 2D0CA 2D5RA 3AVIA 4FK4A 3G0ZA 3THVA 1ZYQA 3VQBA 3SPYA 3NCIA 3ZSXA 4DFKA 3NH0A 4CHYA 3QEIA 1BISA 3HP6A 3KKRA
chains in the Genus database with same CATH superfamily
3IDHA 5BRDA 3Q7CA 4ISEA 3ZX0A 2V51B 3LAKA 3KD5E 1RT3A 3R1XA 2Y1IA 4JRPA 3MMVA 2YHBA 2JWLA 4YFUA 1NGEA 1WSHA 4HWIA 2HF4A 4G1QA 1QVGM 1Z6RA 1NK5A 4DTSA 2OPSA 4JAXA 5ADXA 4F2SA 1HX1A 1NOZA 3NE6A 2FSKA 3ATUA 3LALA 4DV2K 3VA0A 3V81A 2HNDA 1CZBA 4DV0K 3K9KA 4BC5A 3SAFA 3G10A 5D3GA 1S6QA 2ZGYA 1WSJA 4AH9A 5I3UA 5J2NA 4WQ4A 1N34K 2P51A 4CD1A 3ZX2A 2XO7A 1YITN 3FZMA 1IKYA 5AZIA 2YNHA 3NF6A 4BR2A 4KHNA 1X3NA 4KO0A 4CJ5A 4N76A 1LW0A 4O4GA 3J7AP 3OHRA 1FXXA 4DS4A 5I42A 2A40A 3OYJA 1OVYA 2XY8A 2GUIA 1VHXA 5T7BA 4W5QA 3UIQA 4JS4A 5SWMA 3UKRA 3RWUA 1DEJA 3DXKA 4Q5VA 2HHQA 4CFAA 3CCEN 3WUHA 5E84A 3LDPA 5HOOA 3PX4A 3RR7A 2CH5A 2ZJPL 1KTQA 4CZHA 2DFEA 2D0PA 2HBKA 2O8BA 3AA4A 4GVEA 4PQUA 2YX6A 4CJPA 4BE2A 2P9LA 4MLEA 3SQ1A 4OKEA 3TWHA 1T7PA 3HJFA 2QWMA 5FPEA 2CGJA 4HUEA 1WOQA 4KHQA 4IDHA 3HK2A 2VG5A 4GY2B 4FWNA 4CZGA 3K59A 2E20A 4KI6A 4M3WA 3M6GA 3VQ4A 4ID1A 3CPWM 1NJIO 4F3TA 1T6DA 2BUPA 4JKGA 3P38A 1YJWN 1S22A 3EY1A 4B08A 3HP9A 1VRUA 3FGUA 4BR5A 4IJNA 4BRGA 4FWPA 2Q97A 4DR3K 3K5NA 4DLGA 1MDUB 1LCUA 1BQNA 5AZIB 1K73O 4B9TA 3VETA 1S5JA 4CGFA 1D9FA 3CJCA 2OCEA 1DLOA 4DS5A 1HPMA 3AO1A 4CI6A 3T69A 4J2BA 3U3GA 3P31A 1TV6A 1BWFO 1KQSM 3VQQA 3NF7A 3SI6A 1EWRA 4E7KA 4WCEL 4DR1K 3DLBA 4CEQA 5CYQA 4BR4A 1TAUA 3O4NA 3UKRB 1RDAA 4DSEA 1A5XA 4KTZA 2YHYA 3DXKB 2ZE2A 4M7XA 5GAHP 1NJZA 4OPHA 3U4LA 3LZJA 3A0IX 1VSDA 4AHSA 1VQPN 1SS6A 2P9NA 4DQQA 4Y0WA 4DUZK 4DB3A 1QSYA 2O8BB 2HHHK 3ID6A 3ENBA 3SQ0A 4M3TA 5SZTA 3AA3A 2P9LB 4ILJA 2X78A 4FWRA 4QS8A 4EFHA 4X66K 4Z4CA 1Y64A 1YJ9N 3AVBA 3KIOA 1JCFA 3CJ1A 1NU0A 2O8EA 1O1WA 3V9SA 4C1NI 1P8ZA 3MN5A 4H0VB 3VEZA 4W5RA 5AQOA 3QEPA 2FBTA 3DM2A 3KK1A 4FLVA 3QBXA 3AVKA 1BUPA 4U67L 3ITHA 5B8HA 2EWSA 3VQ6A 1LAVA 3GDQA 1RDDA 5CYMA 4H5WA 4CIGA 2OTLN 1J6ZA 1IH7A 3P1GA 4JKGB 5HBMA 1TVRA 4C8MA 3C6AA 4AHCA 3MX2A 4M41A 3HBTA 5JLHA 2E88A 1BQMA 1Z25A 5AQIA 1LWCA 1A5WA 2IAJA 4FJHA 1SKSA 4O5BA 4FJNA 1D4XA 4DFJA 1QTMA 1VQNN 4NCBA 1DT9A 3KWIA 3VGMA 4PWDA 1GLBG 1OVQA 3WXIA 3DXMA 2B5JA 4LF6K 2ASPA 4ISFA 4DWIA 4MLHA 4YOYA 2RE2A 3LP0A 5KRTA 1NGGA 3NGYA 4YORA 2G8IA 4GV3A 1QQOA 3AO5A 2HVHA 1GLLO 5KI6A 2X6NA 5BN8A 4CGDA 5CE3A 5FLXO 4DHYA 1VK0A 2F96A 2Q0RA 4DQPA 4FK0A 2F8SA 1Z26A 1EQYA 2Q2RA 1KAYA 1ATRA 3E9LA 1RFQA 4KTQA 1B92A 2WBNA 4JKCA 3HYFA 4ILHA 2P9NB 3HVTA 4R79A 1GOAA 1C6VA 2IGIA 4H0YB 4CJ7A 3DLEA 2H3GX 4RG8A 1TL1A 3ASMA 1KXPA 3QO9A 1Q82O 2V7YA 3SUPA 2HHWA 4FOEA 3AO4A 5AJ3K 3VQ5A 1OH8A 3SV4A 2O8EB 4FJJA 4KREA 3AGRA 3O6WA 3IUCA 2P9UA 3HI0A 4M45A 2OTJN 1YVUA 4YY3K 3HT3A 4OVLA 1EETA 1IKVA 3THWA 5HROA 1Q9YA 3S3OA 3C0BA 4B1UB 4B9NA 5LL6Z 3SV3A 4JKFA 3UB5A 3CYMA 3OS2A 1X3MA 3B6PA 2P9IA 4CIEA 5F0XA 3VQPA 4BGAA 3LWLA 3ZLJA 3ZT4A 3ZT2A 1LOTB 1IO2A 4WQ4C 4JRQA 3DXMB 3M8RA 4WQ5A 2O8CA 3S3NA 4UQGA 3CM5A 3VPZA 3DI6A 1WN7A 4M7YA 3V4IA 4M3YA 3LDSA 2F4VK 1XWLA 3RMDA 3A5LC 2Z1JA 3GG4A 2NRHA 3S41A 5C25A 4G9ZA 2ZM6K 3H3NO 4JI7K 1NJXA 4CZKA 3T3FA 1UAXA 3U6FA 1S6PA 3K9JA 4LH4A 2E5LK 3QETA 2JGUA 5JVHL 1JJ2M 1JXBA 3VQEA 5IT9O 4RW9A 4WE1A 1S9GA 3BDPA 1C0GA 2NNWA 4PY5A 2O8DA 1DTTA 4DFMA 2Z1GA 4GKJK 3LM2A 2YJEA 3TSUA 3CCMN 4CF8A 5BR9A 2GTDA 2FBVA 2KHOA 1RT5A 1KSPA 1XMOK 1D8YA 2Y1JA 1XC9A 3CCUN 4NB4A 4O8KA 4ID5A 1HPZA 3LM9A 4BY9C 1RBRA 2KFZA 1MWKA 1D9DA 4XIUA 2GX9A 2WFBA 4DU1A 4K8ZA 3AA5X 4DV7K 2QWNA 3AVCA 4F9OA 3HOTA 1JLFA 1TKXA 5AQNA 1X1PA 4M63C 1KCFA 2XY7A 2P9UB 3VQ9A 5HRNA 1ZBFA 1MWMA 2NRTA 2E6MA 3THWB 4LF5K 3WXKA 3E01A 5BRHA 4E7IA 2O8FA 1S1TA 4KRFA 5HLFA 4BRQA 2ZWHA 4O8UA 1U2VA 3THVA 2QWPA 3VQBA 3HSCA 5AQPA 5BR8K 3NH0A 3DAWA 4BREA 2P9IB 5GINA 1BISA 4Z94A 3KLHA 3DOLA 3VQDA 2PYLA 1ATNA 4PKHA 4BACA 1S1XA 1VQ7N 5BPLA 1JLGA 4CZIA 4LD0A 3C65A 2XHBA 3G4SN 4FLYA 2O8CB 1Q86O 4FLTA 3SQ4A 2OA8A 2QWQA 2YHXA 3C6TA 4BWJA 3OBWA 2PYJA 3HM8A 4DLEA 4ZTJA 3LDLA 1VSFA 1W97L 5AQFA 3VTHA 5KTQA 4OX9K 4C8LA 3HPHA 3U9DA 3DYAA 2PZSA 5DMRA 4NXMK 2OZMA 4I7FA 5AZJA 3QEVA 2IVNA 2QTDA 2O8DB 1LWFA 5LMUK 3LP2A 4LF8K 4W5NA 2ZGZA 2E1ZA 4B8CA 4AQYK 2FSJA 1QZ5A 2Q0UA 2QWLA 2YV0X 4WFAL 3MECA 1U45A 4X65K 1GLEG 2O4IA 2A1SA 3FZKA 3EE8A 2OZSA 2FBYA 1C1BA 1NMNA 2FF6A 3T1AA 1Q9XA 3AV9A 1SUQA 3HTVA 3ZSYA 4LFBK 2DPNA 3MXIA 2A41A 1IKXA 2F7TA 4NCAA 3GL1A 2Q3SA 3G71N 3DOKA 2O8FB 1NK9A 1VQON 1VRTA 3O80A 1IKWA 2E2OA 3MWPA 4JHDA 4CGIA 2RN2A 1T3VA 4JKBA 4DU3A 3DLHA 1TYQA 3SAGA 3HVRA 3EKSA 3D2FA 5KPRA 2W42A 4Q0BA 3CQ8A 3PY8A 4FK2A 2ASMA 4JK9A 4B3MK 4O0JA 5LY3A 4GW6A 3TTDA 1BOTO 5EU7A 3EL2A 3DRPA 4GNIA 3WEEA 4A61A 3I8BA 3BUZB 5M1PA 2G8HA 1VAZA 1T8EA 1HNZK 3KKSA 1GLJO 3TAPA 3EN9A 3WNEA 1WAJA 5JICA 1ESVA 3D0PA 1OH7A 3T7ZA 4XH1A 5F2RA 4J8FA 3CC7N 4UY8O 3VGLA 4KBOA 4HCBA 2NZTA 2ZJRL 4H5NA 1VQ8N 1ASVA 5C2DA 3ENOA 5C24A 1RTIA 2B6AA 2AP1A 3L2WA 4A57A 5AZJB 4JKAA 1CXQA 5CZ2A 3HRGA 4DR5K 4CJRA 3O9QA 1K9MO 3K58A 2QEXN 4FW1A 4EHTA 1YI2N 4KHYA 2KQ2A 4FLUA 1ZBLA 2J4RA 3CJAA 2BDPA 1HNXK 4ELUA 3KTQA 4CJ4A 3BZCA 1NK8A 5AQWA 4Z0UA 1U47A 1HYSA 1EP4A 3GOIA 3V1QA 1NJWA 3CJBA 2Q31A 4JEPA 2PY5A 1C1AA 4IO9L 3BF1A 5A2QO 4CEZA 5KGWA 3OVNA 3CFPA 2P5GA 3OBYA 3RMAA 4FWQA 1X9MA 1RTDA 1D5AA 3L3VA 4HTUA 4K42A 1NNEA 4CJEA 1HNVA 5C15A 2PAVA 1S72N 3BF3A 4JS5A 4JHDB 3DMJA 3VQAA 5JMVA 4H8KA 1TYQB 3F9MA 3D2FB 3FLCO 5FDLA 3OJSA 3KVGA 4CESA 1HMVA 4FJMA 1IJJA 4EP5A 4ZHRA 3SK3A 1JLBA 3WEEB 4FJ7A 4H0OA 4M3RA 4QCLA 2E8AA 5CZ1A 4DF4A 4CEEA 3O4QA 3K5OA 5F1XA 4B9QA 1TK0A 1VSIA 2FF3B 4WQ5C 2VGNA 1XNQK 1QQMA 3M8SA 1HUXA 3WQTA 2NRVA 3LP1A 4LC9B 3VQCA 3H3OB 3SBTA 3SUNA 3CJ9A 2HMPA 3EYZA 4CIFA 1Q7YO 3RMCA 4EHUA 1NK0A 1BU6O 3OYFA 1VSMA 3BP8A 2CH6A 3IMXA 3VEYA 2KW4A 3I0SA 4JKHA 4IEEA 4EAHD 1NGAA 4IDKA 5AQGA 4DFPA 4C8KA 1N6QA 4DSJA 3AVLA 4CJQA 5J2PA 4X64K 4CZJA 1LWEA 5H1SQ 4BR9A 4CK2A 3S3MA 4IFYA 3LWMA 3RR8A 4FJGA 2V7ZA 1HKCA 1RDWX 4BRIA 3PIOL 3CFOA 2UUAK 4KKOA 1WUAA 2G8VA 3KJVA 1I3AA 4DUYK 2X74A 4OPJA 4NXNK 1KAZA 4CEOA 1FKOA 3LAMA 4GV6A 1CZAN 2I7NA 3JS6A 3V1OA 1G99A 3AVFA 4BRPA 3DWLA 2YNIA 2P9SA 3C6HA 4L3QA 3LANA 4MDBA 4EP4A 3FFKB 4A5BA 5CHIA 4N41A 4DR6K 3WNHA 1R0AA 3JAMO 1ZBHA 3ZETA 3VGKA 1ZBSA 1FKPA 4RWTA 3OS1A 1KLMA 1TKZA 3H6EA 2B4JA 2E2QA 4PL7A 2G8FA 2F9WA 3TAFA 3N4QA 3FR0A 3DLLL 1NM1A 4U7BA 1M1KO 4IOXA 4FCYA 3MXMA 4CBXA 4LFCK 1QE1A 3OYKA 4AILC 3J80O 1RBTA 2VCPA 3E1YA 4YOTA 3PLAA 1C0TA 3M8QA 4B1VA 3ZYYX 3QFUA 2A42A 2LSNA 2XRIA 4AHTA 1C1CA 3SMSA 5AQMA 3ZSZA 1VSEA 2QK9A 4I2QA 2WOMA 3D6RA 4W5OA 3VF4A 3RTVA 2UUBK 2Q1NA 3SJJA 2D1KA 3GE1A 3CHWA 2P9KA 5GAEP 4FVMA 1FK9A 5KPTA 4CHOA 1WSIA 4LF7K 4LSLA 3NGZA 3NFAA 4DTNA 5TKYA 2E4LA 2W6KA 4E0DA 1RT2A 4QS9A 1C0FA 1J53A 4DTRA 1NMDA 4BVOA 1SKWA 3RSEA 1Z05A 3I8DA 1Q81O 4Z4IA 4LH5A 4O5FA 2PBDA 2ZD1A 5BREA 2CGLA 2QA4N 1WAFA 2P9SB 3NMUA 4FJ8A 4YNQA 3TARA 3AVGA 4JI6K 4DV5K 3M3ZA 4JI4K 3IAYA 4FWLA 4CFBA 2QWOA 4FZXC 4B8AB 1P90A 4EIAA 1QQNA 1TAQA 3ZETB 4CF2A 5LJWA 3EZ5A 4WFNL 3THYA 4CF9A 2HMIA 4NCGA 4Y1DA 5HL7L 5C12A 1U48A 1BA0A 5DM7L 4FWMA 4Y1CA 5IWAK 3CCSN 4FSVA 2E1YA 3CCVN 3V1RA 5FRNA 4JI1K 3EZWA 4AM6A 4DQ8A 1RDCA 1TUYA 3OS0A 1TUUA 1VQKN 3C6UA 4FJIA 4FK4A 3CETA 3LDQA 1IV0A 3G0ZA 2NRWA 4XH4A 3SPYA 4BRAA 4H4OA 4MDAA 2BE2A 1SL0A 4J2DA 3BEXA 3VQ8A 5M1NA 1VQ9N 3VA3A 3CM6A 3L2VA 4GMJB 5AQXA 3TAMA 5AQRA 4YOVA 1JLCA 2I5JA 4KFBA 4Z4FA 4M3ZA 4DU4A 4LF9K 2UYTA 2P9KB 1VQ6N 2HB5A 4CERA 3RVCA 3CF5L 2OYQA 1BL3A 2GEMA 4C8NA 3TABA 4K43A 5M1FA 3BGRA 3VQ7A 2QI2A 4CCHA 4FWKA 4DTPA 3MAQA 1BCMA 1KVBA 3FE1A 4R5PA 4E19A 3R9PA 1S1UA 2Q36A 4IZ9A 3C95A 2ATQA 4CFCA 3IG1A 3RSEB 3S9HA 3CMEN 1XHZA 1Y97A 1RNHA 3KZBA 3BZKA 4KPYA 3E66A 1TL3A 3WXMB 3LPUA 2JLEA 4CD3A 2BTFA 3DLKA 3DLGA 1YJNN 3A5MC 3T19A 4JKDA 1N33K 4XEIA 1WLJA 5E41A 3C7NA 3THYB 3ZSWA 5AQVA 3J8AA 3QERA 1ITGA 2E2PA 4IXCA 3U3YA 1L3SA 4HHTA 1SKRA 2D4WA 3TAEA 2FC0A 3ZT0A 4KB0A 4J2AA 3QDKA 5FROA 1NGJA 4OKJA 3WT0A 2EX3A 4BE1A 3NDKA 4DTXA 5I9EB 2HF3A 4AHRA 4H5TA 2A5XA 1EWQA 1WBBA 4JNEA 4FW2A 3F2KA 4H0TB 3AARA 4BWMA 1YHQN 1NKCA 3MN6A 3QINA 2D0BA 3PIPL 3M1FA 5KPZA 2OANA 1KRPA 3KHYA 2HNYA 4NLCA 2ITMA 1RT6A 3AVHA 2GELA 4CZFA 1ZXOA 4CF1A 1BG3A 1JLEA 3WXJA 3NH2A 1G15A 1BO5O 4IFVA 1Q8IA 3HPOA 2P9PA 2DFFA 4JN4A 4FL9A 4M42A 3GBTA 2UU9K 1VQLN 3OTOK 3ATVA 4KHUA 2W41A 3O4WA 4B9VA 4FOIA 3FZHA 4CVNE 1LW2A 2YI1A 4LF4K 4ELTA 4PL8A 3PX6A 3SLCA 5HRPA 4K25A 4BRMA 3MX5A 2YHAA 1FJGK 3AO3A 1NG9A 2HOEA 5KRSA 1UA1A 4X62K 5HRRA 1E4FT 3D7EO 1JLAA 3QLHA 3EO3A 3QB0A 4MO4A 1XC3A 4DSLA 2NRRA 3VEXA 4KTWA 1QSLA 4CHQA 3OYNA 3C7NB 4E7LA 1N36K 3QBWA 4F4KA 1REVA 2E6LA 1KFSA 5AR0A 3DRRA 3H1VX 3TAQA 5DK5A 4WYBA 2ZQBA 3L4QA 4FJ9A 4N5SA 3LPTA 5CR4A 4CEFA 2VWJA 1BGXT 5J2QA 1C0MA 2JWKA 3M5RA 1RDBA 3O9TA 1IG9A 2HVIA 1VSLA 5BRFA 2OPRA 3O1BA 3KK7A 5LMNK 4QS7A 4K8XA 1YIJN 1NK7A 5HP1A 3OA9A 4DV4K 3NVKA 1CXUA 1YUWA 3D2EA 1WSGA 3G25A 4OLAA 1K8AO 4MFBA 4YOWA 1K8KA 4DCHA 3KLIA 2NLXA 3B8AX 4H0XB 3V9UA 1ATSA 3UKUA 4BQZA 2FXUA 3NH1A 4E1JA 4RW4A 4Z4EA 2P5OA 3ZT3A 2IIRA 2P9PB 4CZEA 1VSHA 1VQ5N 5AFUH 3ZX3A 2QW9A 4CK3A 5GIPA 4JI8K 2QWRA 5M1KA 1BI4A 3OYBA 2VGMA 3MEDA 1KFDA 5LJVA 4CW7B 5ELZA 3AVMA 3M8PA 3O9RA 3HZ6A 5C2FA 1B9FA 1QSSA 4MQ3A 4GKKK 4DTOA 3SUQA 1YTAA 4BE0A 4PKIA 3O3GA 2YKMA 5EOYA 4F8RA 2WC9A 3A5NC 4FM1A 4CGGA 3MK6A 3J7YP 1QHAA 3TSQA 1KAXA 4FJ5A 3OYDA 3VERA 1VQ4N 4KB1A 3QIOA 4CHZA 5CY4A 5EY4A 3AVNA 1S1VA 2IS3A 4FPAA 5FRMA 1SL2A 1QHTA 2HBLA 4ZTFA 1NKEA 5EX5A 3CCRN 3NAEA 3VF2A 3NHGA 5GADP 3QESA 3ZSVA 3VESA 2QXFA 1L5UA 1YVNA 4OJRA 2IVOA 3FFIA 4CFDA 3WNFA 1NGFA 3NF9A 4IWVA 1YTUA 3I0RA 3KLGA 1J5OA 4BROA 1WSFA 4KH4A 2FBXA 3ZSQA 4NLBA 2IOCA 3L0QA 3KK2A 1HLUA 2AJQA 4BRKA 2FLOA 4EZ9A 2UUCK 4JK8A 3OYIA 3D2EB 3WQUA 4IEIA 1ZBUA 4DKWA 1K8KB 4JI5K 4YHHK 4FZYA 2QKKA 4I9QA 1TGOA 3UKUB 1HJOA 4BDZA 4GV9A 3A2FA 3V9XA 3L2RA 1SV5A 4DMNA 2W40A 4B3TK 3C94A 3VF6A 3CIPA 4CJVA 3LDNA 3OYAA 1BI4B 1OH5A 1N5YA 4HUGA 4DQIA 4FXDA 2P1JA 4BG9A 1JKHA 4QAGA 4GVMA 2E2NA 1NLVA 1ASUA 1NGBA 2GWKA 4CJUA 4F3OA 3SZ2A 1MA9B 1KD1O 4N56A 1HNIA 4LFAK 4NYFA 4ELVA 1J5EK 3VEWA 4IBNA 4DSKA 3AA2A 3O5BA 4A2AA 4HUFA 4JLHA 3F9KA 3O3HA 2AA4A 4OGEA 1T03A 3ZEUA 1WNSA 2RPIA 1HKBA 2KTQA 1X9SA 2YCHA 1RTHA 3RMBA 1QVFM 4IG3A 2X6SA 1J9AA 1OH6A 2ASOA 4LY7A 2HNZA 4IJAA 2VWKA 4BGBA 3SCXA 1CLQA 1GLCG 5FPMA 3SUOA 4CBWA 2CGKA 4BVPA 4E89A 5C42A 5KQ8A 2Z1IA 1NGCA 1E4GT 3K57A 3K0SA 1YAGA 3U8XA 1W0HA 3L3UA 4FYDA 3QEXA 4ICLA 1XUPO 4CEAA 4DR4K 4ISGA 4Z4HA 1UWBA 1DGKN 4FVUA 3AVJA 2W6LA 3H08A 4XH5A 4B3RK 3L6QA 3A5OC 3MCAB 2D0OA 3O3FA 4OPAA 3LL3A 3TAGA 1K6YA 4H5RA 2DY4A 1NKBA 5FPNA 1RDUA 2HBMA 2WUSA 4EZ6A 3VMFB 1A5VA 1U04A 3ISNC 1RGIA 2D0CA 5AQZA 5BN9A 4BRDA 4C23A 3CCLN 1IG8A 5M1QA 3NCIA 3MDQA 2ZJQL 3HP6A 3KKRA 2BANA 3KLFA 5AQKA 3TSPA 4B1XB 3DJCA 3OYMA 3Q7BA 4A62A 2IDOA 3EE9A 2KLAA 2F8TA 4BC3A 4FO0A 4CECA 3SMPA 3SAHA 1RBVA 1C0UA 2V52B 5MLCQ 1JLQA 3HSTB 4FWSA 3MXJA 4AHUA 4JK7A 3VEOA 3T1HK 4CJWA 3ZEUB 1TK8A 3K2PA 4CEDA 3TPQA 4CJ3A 3QMLA 4K41A 1HNWK 3ZSOA 3G6EN 4DQRA 4RW7A 3LDOA 4IOAL 1MU2A 4KHWA 3B6OA 3MN7A 1HYVA 3O9UA 5KQDA 3L8BA 3WNGA 3OYGA 3AO2A 1I94K 1KLNA 4FLZA 4I9LA 2A1RA 1KVAA 3KD1E 1HR0K 4HVJA 4B3SK 4BRLA 4B9LA 3SJHA 4V19S 3R8EA 1E3MA 3OYCA 2KZMA 4H03B 5AFUA 1YF5L 1HYZA 4CHPA 3EEQA 4BDYA 1VSJA 1H1VA 3T1YK 4FLWA 4O0IA 3QIPA 3E9OA 1T44A 1X9WA 3CERA 3SBGA 2NUBA 5AQHA 3AAQA 3SNNA 4JKEA 2PFUA 3CJ7A 3J81O 4HTLA 4DTMA 3CCJN 4DV6K 3VENA 4KAZA 3OYLA 2GUPA 3VEVA 4TSXA 4E3SA 4DTUA 4JV5K 1Q18A 4JYAK 3AAPA 3AY9A 4B1ZA 4DV1K 3H1QA 4CJFA 3CCQN 3JSMA 3P39A 1RBUA 4QOZB 4BR7A 2QKBA 4A5AA 4B9UA 1I39A 4JD2A 1WB9A 3CFRA 4BDPA 4CBUA 4IKFA 1VSKA 2ETJA 4CJTA 4FLXA 4BC4A 3KK3A 2A6AA 1GOCA 3TU5A 3L2UA 3VTIA 5AQSA 1DKGD 1XHXA 3DRSA 3KWGA 2HHVA 4FWOA 3V9WA 2DTUA 3TTCA 2IVPA 1B9DA 1QZ6A 5AQTA 4IG0A 2XY5A 1DTQA 1R59O 3QICA 3K5MA 4NO7A 3ZT1A 4Z4GA 4RCHA 1NGHA 1NGDA 4DTJA 3ULEA 4HCCA 2OPPA 5EXWA 2HHSA 2R7YA 4DSIA 1GOBA 4YDUA 1SL1A 1HQEA 1X9JA 1NJYA 4AF1A 2BH1A 3CPEA 4E7JA 3CG7A 3OYEA 2BGGA 4RW6A 2D0AA 1ZC6A 4IOCL 3O9SA 1SZ2A 4CZLA 2XY6A 1J54A 2WTUA 5J2MA 2KZZA 4OGCA 1KVCA 3VOVA 1TKTA 3R3LA 1NOYA 1NK6A 1IBLK 4E1MA 1V4SA 4A2BA 4CHNA 5M1OA 1W2BM 4DSFA 5K14A 1IBMK 3PO5A 3PX0A 3A8YA 2KFNA 1RT4A 4JI2K 4OPKA 2QM1A 3IRXA 2NRXA 4KI4A 4PKGA 3LZIA 3HXMA 4NYNA 1U49A 2GBZA 3CC2N 1L3TA 2YKNA 4RTFD 5EVZA 4W5TA 4JD2B 4CJLA 3MWTA 1S3XA 4H0PA 4I6MA 1RT1A 4WF9L 3THXA 4BRNA 5HRSA 5ADXH 3IFRA 4DV3K 1GLAG 4YOUA 1IBKK 5JS2A 3OJUA 1QQCA 1BCOA 3ULDA 2IC3A 4CF0A 3QFPA 3N4PA 2VWBA 3L2QA 2GWJA 1WBDA 2RHKA 1RT7A 3LP3A 3OYHA 3CQXA 1BIUA 5E26A 5DM6L 4FM2A 2UXDK 3J7ZO 4J2EA 4C1NK 3ULEB 1N32K 3PUFA 4B9MA 3MEEA 4ILGB 3W3DA 1HRHA 4B3OA 2I7PA 4BQLA 5J1EA 1VQMN 1WSEA 4CZMA 3AGKA 4CE9A 4RW8A 3FZFA 2ITGA 3BY5A 2KKZA 2GV9A 2OPQA 2F9TA 5AQQA 1CZ9A 4YOXA 4DQSA 3MN9A 1SAZA 3CXCM 1EXQA 3I33A 3NVMA 1QS4A 2UXCK 5BPMA 3ALYA 3RRHA 1TK5A 1GLFO 1HKGA 1EKEA 2VQEK 3DLRA 3EKUA 3SPZA 4AM7A 3CD6N 5BPNA 2NRZA 5AQJA 1V4TA 4OLBA 4N47A 4KHPK 1BHLA 1RCHA 4CGHA 3RRGA 2YNFA 1RILA 4C8OA 5FPDA 3VN5A 5AQUA 4BRFA 1ASWA 4CEBA 1RTJA 3HOSA 1BDGA 2QXLA 4IO8A 4O55A 1YXQA 4I6MB 1JL1A 2VQFK 3TR8A 3THXB 1N8RO 5AQLA 4DF8A 5TKWA 1U6ZA 1JXEA 3H46O 3MCPA 5JLFA 3V9ZA 3HL8A 4BRCA 1EO1A 4OKKA 4CJKA 3ZCMA 4JI3K 5GAGP 1NWKA 3W0LA 3PSIA 4BG8A 1BA1A 2VYPA 4IFEA 3WXLA 3CC4N 3H45C 3NF8A 1HJRA 4FJLA 1EX4A 1XNRK 5JS1A 5GIOA 3AVAA 1L3UA 1UOCA 3SYZA 4KHSA 1S1WA 4A59A 3QNNA 3HO1A 2HBJA 4O44A 3V6DA 4FZZA 1JCGA 4AHVA 3ID8A 3QNOA 4FJKA 3UE5A 3NBPA 3O08A 3IKMA 3ZSRA 4CGJA 1FW6A 4M3XA 3D45A 1TKDA 1W9HA 4OO1J 3I56N 2O4GA 4CJSA 3ENHA 5AQYA 2YJFA 4B9SA 4BC2A 2VG7A 3NGIA 3TTFA 3P83D 4DR2K 4KH6A 4JI0K 1ZBIA 4DR7K 3F5TA 4B1WB 5KGXA 2UXBK 4BRHA 1T6CA 2DFHA 4F2RA 2G8UA 1ILYA 4K0KK 4CK1A 3CI5A 3L4IA 2HW3A 1SQKA 4DG1A 4MO5A 3QEWA 1T05A 2HHXA 1LAWA 3CQYA 4H5VA 1XI1A 2RKIA 3P5JA 1S9EA 5C10A 4E1NA 4M3UA 3HM9A 1F21A 3F73A 3HPGA 1JCEA 4KH5A 4FPBA 4E7HA 3FZLA 4H4MA 2HHUA 3TANA 1BIZA 3PSFA 1U2VB 1RBSA 2FSNA 2Z1HA 1UA0A 3TI0A 1U4BA 1GLDG 1OKJA 3JXUA 3O1WA 3OW2M 2A3ZA 2WONA 4I2PA 3I55N 2G8KA 1NK4A 2RF2A 3SQ2A 4PUOA 4LSNA 4L8RB 1XQSC 2G8WA 3PV8A 2HHTA 4FJXA 4B1YB 3MEGA 4PA1A 5C0YA 4FM0A 1JL2A 2VG6A 4WFBL 3KLEA 3K5LA 3PO4A 1KC8O 3CMAN 5JVGL 1W7AA 3U9ZA 2HSTA 1L3VA 3IS9A 3OY9A 4KV8A 2YNGA 1YT3A 1O13A 1HQUA 1LV5A 2ZF5O 3O8MA 2EHGA 3JYTA 2YHWA 4PHTX 1NBWA 2D5RA 3AVIA 1NGIA 3P4IA 4YDUC 1ZYQA 3E9PA 1XMQK 4BR0A 3R6MA 4DFKA 1M90O 4CHYA 3QEIA 3ZSXA
chains in the Genus database with same CATH topology
2BANA 4H4OA 3KLFA 2BE2A 1SL0A 4J2DA 3VQ8A 3OYMA 3KLHA 3DOLA 2IDOA 3LAKA 1RT3A 3KD5E 3VQDA 3VA3A 2PYLA 2F8TA 3CM6A 3L2VA 4BACA 4GMJB 2Y1IA 1S1XA 3TAMA 4JRPA 1JLGA 1JLCA 4CECA 2I5JA 4KFBA 4LD0A 4Z4FA 2YHBA 1RBVA 2XHBA 4DU4A 4M3ZA 1C0UA 1JLQA 4FLYA 3HSTB 2HB5A 4FLTA 3SQ4A 3MXJA 4AHUA 4YFUA 4CERA 2OA8A 1WSHA 4G1QA 4CJWA 2OYQA 1TK8A 3K2PA 4CEDA 3C6TA 4CJ3A 4BWJA 1BL3A 2OPSA 4DTSA 1NK5A 4C8NA 3TABA 3ZSOA 2PYJA 4ZTJA 4DLEA 4DQRA 4RW7A 3BGRA 3VQ7A 4F2SA 4CCHA 1NOZA 1VSFA 4DTPA 3MAQA 3NE6A 1BCMA 1MU2A 5KTQA 4C8LA 4KHWA 3HPHA 1KVBA 3B6OA 4R5PA 4E19A 1S1UA 1HYVA 3L8BA 3DYAA 3WNGA 3OYGA 3AO2A 3C95A 2ATQA 5DMRA 4CFCA 1KLNA 3IG1A 3LALA 4I7FA 3VA0A 4FLZA 1Y97A 4I9LA 3V81A 2HNDA 3S9HA 2A1RA 1KVAA 1XHZA 1CZBA 3KD1E 4HVJA 1RNHA 3QEVA 3G10A 4B9LA 1LWFA 5D3GA 1S6QA 3LP2A 4KPYA 3OYCA 4B8CA 2KZMA 4W5NA 4CHPA 1HYZA 4BDYA 1VSJA 1TL3A 4FLWA 1WSJA 3LPUA 4AH9A 4O0IA 5I3UA 2JLEA 3DLKA 3QIPA 3DLGA 5J2NA 2P51A 2XO7A 3T19A 2YV0X 1IKYA 3MECA 1X9WA 1U45A 2YNHA 3NF6A 2NUBA 4KHNA 4KO0A 4CJ5A 3SNNA 2O4IA 1WLJA 4N76A 1LW0A 4O4GA 5E41A 2A1SA 3ZSWA 2OZSA 3QERA 1ITGA 4DTMA 3U3YA 1L3SA 4HHTA 2FBYA 1SKRA 4KAZA 3OYLA 1FXXA 4DS4A 2FC0A 1C1BA 3T1AA 3ZT0A 3TAEA 4TSXA 5FROA 3OYJA 4DTUA 3AV9A 4E3SA 1Q9XA 1SUQA 3ZSYA 4OKJA 2XY8A 2GUIA 5T7BA 4W5QA 3UIQA 4JS4A 5SWMA 4CJFA 3MXIA 1IKXA 2EX3A 4BE1A 4NCAA 3NDKA 4DTXA 3JSMA 2Q3SA 1RBUA 4AHRA 3RWUA 4QOZB 2QKBA 4Q5VA 3DOKA 4B9UA 2HHQA 4CFAA 1NK9A 1I39A 4FW2A 1VRTA 1IKWA 4BWMA 1NKCA 3CFRA 4BDPA 4CGIA 3PX4A 3RR7A 3QINA 2RN2A 4IKFA 1VSKA 1KTQA 2ETJA 2D0BA 4CJTA 2DFEA 4DU3A 3DLHA 3HVRA 4FLXA 2W42A 4Q0BA 3KK3A 3CQ8A 3PY8A 4FK2A 1GOCA 1KRPA 3L2UA 3AA4A 2HNYA 1RT6A 3AVHA 4PQUA 4O0JA 4GW6A 1XHXA 3DRSA 2HHVA 5EU7A 3DRPA 4CJPA 3V9WA 4BE2A 4CF1A 2DTUA 3SQ1A 1JLEA 4OKEA 3TWHA 2G8HA 1T7PA 3NH2A 1T8EA 1B9DA 3HJFA 3KKSA 1G15A 4IFVA 4HUEA 1Q8IA 4IG0A 3TAPA 2XY5A 1DTQA 3WNEA 3K5MA 4KHQA 3HK2A 1WAJA 2VG5A 3ZT1A 3HPOA 4Z4GA 3D0PA 2DFFA 3K59A 4M42A 4DTJA 4KI6A 4HCCA 4M3WA 2OPPA 3VQ4A 4ID1A 4KHUA 2HHSA 4HCBA 2R7YA 4B9VA 1ASVA 4DSIA 1GOBA 4F3TA 1SL1A 1LW2A 1HQEA 1RTIA 2B6AA 5C24A 3L2WA 4ELTA 1NJYA 3PX6A 1CXQA 5CZ2A 5HRPA 3EY1A 4B08A 3HP9A 4E7JA 2YHAA 3CG7A 4CJRA 3OYEA 3AO3A 2BGGA 4RW6A 3K58A 2D0AA 1VRUA 4FW1A 4KHYA 5KRSA 2KQ2A 4FLUA 1ZBLA 1UA1A 3K5NA 5HRRA 4DLGA 2BDPA 4ELUA 2XY6A 1J54A 3KTQA 4CJ4A 1JLAA 3QLHA 5J2MA 1BQNA 2KZZA 4B9TA 4OGCA 1KVCA 1S5JA 4CGFA 1TKTA 1NK8A 4DSLA 1NOYA 1NK6A 1D9FA 4Z0UA 4KTWA 1U47A 4E1MA 1HYSA 1EP4A 1QSLA 1DLOA 4CHQA 3OYNA 4DS5A 3AO1A 4CHNA 3V1QA 4DSFA 4E7LA 1NJWA 5K14A 4J2BA 3U3GA 3PO5A 4KB0A 3PX0A 1TV6A 4F4KA 2KFNA 1REVA 2E6LA 2PY5A 3VQQA 1C1AA 1RT4A 3NF7A 3SI6A 1KFSA 4E7KA 4CEZA 5KGWA 3OVNA 3DLBA 4CEQA 5CYQA 3DRRA 4OPKA 3CFPA 3TAQA 1TAUA 3IRXA 5DK5A 3O4NA 4FJ9A 2ZQBA 4KI4A 1RDAA 4N5SA 3LPTA 4DSEA 2P5GA 1A5XA 4KTZA 4CEFA 3LZIA 3HXMA 2VWJA 1BGXT 4NYNA 5J2QA 3RMAA 1U49A 1X9MA 2GBZA 1C0MA 1RTDA 1IG9A 1RDBA 1L3TA 1D5AA 2YKNA 3L3VA 4HTUA 2HVIA 1VSLA 4W5TA 4CJEA 1HNVA 2ZE2A 4CJLA 1NJZA 3LZJA 4JS5A 2OPRA 3DMJA 1RT1A 1VSDA 3VQAA 4AHSA 4H8KA 4DQQA 4K8XA 1NK7A 5HP1A 5FDLA 5HRSA 3OJSA 1QSYA 4CESA 1HMVA 4FJMA 5JS2A 4EP5A 4ZHRA 3OJUA 1CXUA 3SQ0A 1QQCA 1WSGA 1BCOA 3ULDA 4M3TA 4OLAA 1JLBA 2IC3A 4MFBA 4CF0A 5SZTA 3KLIA 3AA3A 4M3RA 4FJ7A 4QCLA 3V9UA 2X78A 5CZ1A 3L2QA 4DF4A 4CEEA 1RT7A 3O4QA 3K5OA 4Z4CA 3LP3A 3NH1A 3AVBA 3KIOA 3OYHA 1VSIA 4RW4A 1TK0A 2P5OA 3ZT3A 4Z4EA 1BIUA 1O1WA 3V9SA 4FM2A 3M8SA 4W5RA 1VSHA 3QEPA 2FBTA 3DM2A 3KK1A 4FLVA 4J2EA 3AVKA 4CK3A 3ITHA 1LAVA 3PUFA 3VQ6A 1RDDA 1BI4A 3LP1A 5CYMA 3MEDA 4CIGA 1KFDA 3OYBA 3MEEA 3VQCA 1IH7A 3P1GA 3AVMA 3SUNA 3M8PA 5HBMA 1HRHA 3EYZA 4B3OA 4CIFA 1B9FA 5J1EA 3RMCA 1QSSA 1TVRA 4C8MA 1WSEA 4AHCA 4M41A 4MQ3A 1NK0A 3OYFA 4DTOA 1VSMA 3SUQA 4CE9A 1BQMA 1YTAA 4RW8A 1Z25A 1LWCA 2ITGA 1A5WA 2IAJA 2GV9A 2OPQA 4BE0A 3O3GA 2KW4A 4B9MA 4FJHA 2YKMA 1CZ9A 4DQSA 3I0SA 4O5BA 1SKSA 4F8RA 1EXQA 4FJNA 4DFJA 1QTMA 1QS4A 4IDKA 4FM1A 4CGGA 4NCBA 4DFPA 4C8KA 1N6QA 3ALYA 4PWDA 3RRHA 3AVLA 1TK5A 4CJQA 4DSJA 3OYDA 1EKEA 4FJ5A 4KB1A 5J2PA 2B5JA 3QIOA 4CHZA 5CY4A 3AVNA 1LWEA 1S1VA 3DLRA 2IS3A 4CK2A 3SPZA 4DWIA 3LP0A 5KRTA 3S3MA 4IFYA 5FRMA 1SL2A 1QHTA 4ZTFA 3NGYA 1NKEA 4OLBA 3LWMA 4N47A 3RR8A 4FJGA 2G8IA 3NAEA 3AO5A 1BHLA 1RCHA 4CGHA 3RRGA 2YNFA 2HVHA 3NHGA 1RILA 3QESA 5KI6A 3CFOA 3ZSVA 2X6NA 4C8OA 3VN5A 4CGDA 4KKOA 2G8VA 3KJVA 1ASWA 1I3AA 2QXFA 1VK0A 1L5UA 2F96A 2X74A 3FFIA 4OJRA 1RTJA 4CEBA 4OPJA 4CFDA 3WNFA 4DQPA 4FK0A 4CEOA 3NF9A 1FKOA 1Z26A 1YTUA 3I0RA 3LAMA 2F8SA 3KLGA 1J5OA 3V1OA 1WSFA 4O55A 1B92A 3AVFA 2FBXA 4KTQA 3ZSQA 1JL1A 3HYFA 3TR8A 2IOCA 3HVTA 2YNIA 3KK2A 1GOAA 4DF8A 1L3UA 1C6VA 2IGIA 2AJQA 1JXEA 3LANA 4EP4A 3V9ZA 4N41A 3DLEA 4EZ9A 3HL8A 3OYIA 4RG8A 3WNHA 1TL1A 1ZBUA 3ASMA 1R0AA 3QO9A 1ZBHA 4FZYA 2QKKA 4OKKA 4I9QA 1TGOA 4CJKA 3ZCMA 3SUPA 1FKPA 3OS1A 1KLMA 1TKZA 2HHWA 2B4JA 3AO4A 2G8FA 3VQ5A 3SV4A 3TAFA 4BDZA 3NF8A 3A2FA 1HJRA 3V9XA 3L2RA 4FJJA 4KREA 1SV5A 4DMNA 4FJLA 1EX4A 5JS1A 4FCYA 3C94A 3MXMA 4CJVA 3AVAA 4M45A 1YVUA 1QE1A 3OYKA 3OYAA 4OVLA 3HT3A 1EETA 1IKVA 1BI4B 1UOCA 3SYZA 4AILC 4KHSA 1N5YA 1S1WA 1RBTA 5HROA 4HUGA 4DQIA 1Q9YA 4FXDA 2P1JA 3QNNA 3HO1A 4O44A 3V6DA 3S3OA 4FZZA 1JKHA 4QAGA 1C0TA 4GVMA 4AHVA 4B9NA 3M8QA 4J2AA 3SV3A 3QNOA 4FJKA 1ASUA 3CYMA 3NBPA 3OS2A 2LSNA 2XRIA 3B6PA 4AHTA 4CJUA 3SZ2A 4F3OA 4CIEA 3ZSRA 1C1CA 4N56A 4CGJA 3VQPA 4M3XA 3D45A 1TKDA 1W9HA 1HNIA 3LWLA 2O4GA 3ZSZA 1VSEA 4NYFA 3ZT4A 4CJSA 2QK9A 3ZT2A 4I2QA 2WOMA 4ELVA 1IO2A 4IBNA 4W5OA 4B9SA 4DSKA 2VG7A 3NGIA 3RTVA 4JRQA 3AA2A 3P83D 2PZSA 3SJJA 4HUFA 4JLHA 5I42A 3M8RA 2OZMA 4FVMA 3S3NA 1FK9A 1ZBIA 4UQGA 3CM5A 3F9KA 3DI6A 5KGXA 3O3HA 4OGEA 4CHOA 1T03A 1WN7A 2DFHA 4F2RA 1WSIA 1WNSA 3V4IA 2G8UA 4LSLA 4M3YA 2RPIA 3LDSA 4CK1A 1XWLA 3NGZA 3RMDA 1X9SA 2KTQA 3NFAA 4DTNA 2Z1JA 1RTHA 4DG1A 5C25A 2HW3A 3QEWA 3RMBA 2E4LA 4E0DA 1T05A 1RT2A 2HHXA 4IG3A 1LAWA 1NJXA 3T3FA 1XI1A 2RKIA 1UAXA 1J53A 1J9AA 1S6PA 2X6SA 3P5JA 3U6FA 4DTRA 4LH4A 1S9EA 3QETA 4E1NA 2JGUA 4M3UA 3HM9A 1SKWA 4LY7A 2HNZA 1JXBA 3VQEA 3I8DA 1F21A 3F73A 2VWKA 3SCXA 4RW9A 4WE1A 1S9GA 1CLQA 3BDPA 3HPGA 4Z4IA 3SUOA 4LH5A 2ZD1A 4PY5A 1DTTA 4DFMA 4E7HA 4E89A 5C42A 4H4MA 2HHUA 2Z1IA 2Z1GA 1WAFA 3TANA 1BIZA 4FJ8A 4YNQA 3K57A 3TARA 1RBSA 4CF8A 1W0HA 2Z1HA 3L3UA 3TI0A 3AVGA 1UA0A 1U4BA 4FYDA 3QEXA 2FBVA 1RT5A 4ICLA 3IAYA 4CFBA 1KSPA 4CEAA 4FZXC 4B8AB 1D8YA 2Y1JA 1XC9A 2WONA 4Z4HA 4ID5A 4I2PA 1HPZA 1TAQA 1UWBA 1NK4A 2G8KA 4CF2A 3AVJA 1RBRA 2RF2A 2KFZA 3H08A 3EZ5A 3SQ2A 2HMIA 4PUOA 4CF9A 1D9DA 4NCGA 4Y1DA 4XIUA 4LSNA 4L8RB 2G8WA 4DU1A 3O3FA 3PV8A 2HHTA 4K8ZA 3AA5X 1U48A 4FJXA 3AVCA 1JLFA 1TKXA 1K6YA 4Y1CA 3TAGA 1NKBA 3MEGA 4PA1A 2DY4A 4FM0A 1JL2A 1X1PA 2VG6A 3K5LA 3KLEA 1KCFA 3PO4A 2XY7A 3V1RA 5FRNA 4EZ6A 3VQ9A 5HRNA 1ZBFA 2E6MA 1L3VA 3IS9A 3OY9A 4KV8A 2YNGA 1A5VA 1RDCA 1U04A 1YT3A 3E01A 4E7IA 1HQUA 3ISNC 1LV5A 1S1TA 4KRFA 5HLFA 3OS0A 2EHGA 3JYTA 3C6UA 4FJIA 2D0CA 2D5RA 3AVIA 4FK4A 3G0ZA 3THVA 1ZYQA 3VQBA 3SPYA 3NCIA 3ZSXA 4DFKA 3NH0A 4CHYA 3QEIA 1BISA 3HP6A 3KKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAN A;  4H4O A;  3KLF A;  2BE2 A;  1SL0 A;  4J2D A;  3VQ8 A;  3OYM A;  3KLH A;  3DOL A;  2IDO A;  3LAK A;  1RT3 A;  3KD5 E;  3VQD A;  3VA3 A;  2PYL A;  2F8T A;  3CM6 A;  3L2V A;  4BAC A;  4GMJ B;  2Y1I A;  1S1X A;  3TAM A;  4JRP A;  1JLG A;  1JLC A;  4CEC A;  2I5J A;  4KFB A;  4LD0 A;  4Z4F A;  2YHB A;  1RBV A;  2XHB A;  4DU4 A;  4M3Z A;  1C0U A;  1JLQ A;  4FLY A;  3HST B;  2HB5 A;  4FLT A;  3SQ4 A;  3MXJ A;  4AHU A;  4YFU A;  4CER A;  2OA8 A;  1WSH A;  4G1Q A;  4CJW A;  2OYQ A;  1TK8 A;  3K2P A;  4CED A;  3C6T A;  4CJ3 A;  4BWJ A;  1BL3 A;  2OPS A;  4DTS A;  1NK5 A;  4C8N A;  3TAB A;  3ZSO A;  2PYJ A;  4ZTJ A;  4DLE A;  4DQR A;  4RW7 A;  3BGR A;  3VQ7 A;  4F2S A;  4CCH A;  1NOZ A;  1VSF A;  4DTP A;  3MAQ A;  3NE6 A;  1BCM A;  1MU2 A;  5KTQ A;  4C8L A;  4KHW A;  3HPH A;  1KVB A;  3B6O A;  4R5P A;  4E19 A;  1S1U A;  1HYV A;  3L8B A;  3DYA A;  3WNG A;  3OYG A;  3AO2 A;  3C95 A;  2ATQ A;  5DMR A;  4CFC A;  1KLN A;  3IG1 A;  3LAL A;  4I7F A;  3VA0 A;  4FLZ A;  1Y97 A;  4I9L A;  3V81 A;  2HND A;  3S9H A;  2A1R A;  1KVA A;  1XHZ A;  1CZB A;  3KD1 E;  4HVJ A;  1RNH A;  3QEV A;  3G10 A;  4B9L A;  1LWF A;  5D3G A;  1S6Q A;  3LP2 A;  4KPY A;  3OYC A;  4B8C A;  2KZM A;  4W5N A;  4CHP A;  1HYZ A;  4BDY A;  1VSJ A;  1TL3 A;  4FLW A;  1WSJ A;  3LPU A;  4AH9 A;  4O0I A;  5I3U A;  2JLE A;  3DLK A;  3QIP A;  3DLG A;  5J2N A;  2P51 A;  2XO7 A;  3T19 A;  2YV0 X;  1IKY A;  3MEC A;  1X9W A;  1U45 A;  2YNH A;  3NF6 A;  2NUB A;  4KHN A;  4KO0 A;  4CJ5 A;  3SNN A;  2O4I A;  1WLJ A;  4N76 A;  1LW0 A;  4O4G A;  5E41 A;  2A1S A;  3ZSW A;  2OZS A;  3QER A;  1ITG A;  4DTM A;  3U3Y A;  1L3S A;  4HHT A;  2FBY A;  1SKR A;  4KAZ A;  3OYL A;  1FXX A;  4DS4 A;  2FC0 A;  1C1B A;  3T1A A;  3ZT0 A;  3TAE A;  4TSX A;  5FRO A;  3OYJ A;  4DTU A;  3AV9 A;  4E3S A;  1Q9X A;  1SUQ A;  3ZSY A;  4OKJ A;  2XY8 A;  2GUI A;  5T7B A;  4W5Q A;  3UIQ A;  4JS4 A;  5SWM A;  4CJF A;  3MXI A;  1IKX A;  2EX3 A;  4BE1 A;  4NCA A;  3NDK A;  4DTX A;  3JSM A;  2Q3S A;  1RBU A;  4AHR A;  3RWU A;  4QOZ B;  2QKB A;  4Q5V A;  3DOK A;  4B9U A;  2HHQ A;  4CFA A;  1NK9 A;  1I39 A;  4FW2 A;  1VRT A;  1IKW A;  4BWM A;  1NKC A;  3CFR A;  4BDP A;  4CGI A;  3PX4 A;  3RR7 A;  3QIN A;  2RN2 A;  4IKF A;  1VSK A;  1KTQ A;  2ETJ A;  2D0B A;  4CJT A;  2DFE A;  4DU3 A;  3DLH A;  3HVR A;  4FLX A;  2W42 A;  4Q0B A;  3KK3 A;  3CQ8 A;  3PY8 A;  4FK2 A;  1GOC A;  1KRP A;  3L2U A;  3AA4 A;  2HNY A;  1RT6 A;  3AVH A;  4PQU A;  4O0J A;  4GW6 A;  1XHX A;  3DRS A;  2HHV A;  5EU7 A;  3DRP A;  4CJP A;  3V9W A;  4BE2 A;  4CF1 A;  2DTU A;  3SQ1 A;  1JLE A;  4OKE A;  3TWH A;  2G8H A;  1T7P A;  3NH2 A;  1T8E A;  1B9D A;  3HJF A;  3KKS A;  1G15 A;  4IFV A;  4HUE A;  1Q8I A;  4IG0 A;  3TAP A;  2XY5 A;  1DTQ A;  3WNE A;  3K5M A;  4KHQ A;  3HK2 A;  1WAJ A;  2VG5 A;  3ZT1 A;  3HPO A;  4Z4G A;  3D0P A;  2DFF A;  3K59 A;  4M42 A;  4DTJ A;  4KI6 A;  4HCC A;  4M3W A;  2OPP A;  3VQ4 A;  4ID1 A;  4KHU A;  2HHS A;  4HCB A;  2R7Y A;  4B9V A;  1ASV A;  4DSI A;  1GOB A;  4F3T A;  1SL1 A;  1LW2 A;  1HQE A;  1RTI A;  2B6A A;  5C24 A;  3L2W A;  4ELT A;  1NJY A;  3PX6 A;  1CXQ A;  5CZ2 A;  5HRP A;  3EY1 A;  4B08 A;  3HP9 A;  4E7J A;  2YHA A;  3CG7 A;  4CJR A;  3OYE A;  3AO3 A;  2BGG A;  4RW6 A;  3K58 A;  2D0A A;  1VRU A;  4FW1 A;  4KHY A;  5KRS A;  2KQ2 A;  4FLU A;  1ZBL A;  1UA1 A;  3K5N A;  5HRR A;  4DLG A;  2BDP A;  4ELU A;  2XY6 A;  1J54 A;  3KTQ A;  4CJ4 A;  1JLA A;  3QLH A;  5J2M A;  1BQN A;  2KZZ A;  4B9T A;  4OGC A;  1KVC A;  1S5J A;  4CGF A;  1TKT A;  1NK8 A;  4DSL A;  1NOY A;  1NK6 A;  1D9F A;  4Z0U A;  4KTW A;  1U47 A;  4E1M A;  1HYS A;  1EP4 A;  1QSL A;  1DLO A;  4CHQ A;  3OYN A;  4DS5 A;  3AO1 A;  4CHN A;  3V1Q A;  4DSF A;  4E7L A;  1NJW A;  5K14 A;  4J2B A;  3U3G A;  3PO5 A;  4KB0 A;  3PX0 A;  1TV6 A;  4F4K A;  2KFN A;  1REV A;  2E6L A;  2PY5 A;  3VQQ A;  1C1A A;  1RT4 A;  3NF7 A;  3SI6 A;  1KFS A;  4E7K A;  4CEZ A;  5KGW A;  3OVN A;  3DLB A;  4CEQ A;  5CYQ A;  3DRR A;  4OPK A;  3CFP A;  3TAQ A;  1TAU A;  3IRX A;  5DK5 A;  3O4N A;  4FJ9 A;  2ZQB A;  4KI4 A;  1RDA A;  4N5S A;  3LPT A;  4DSE A;  2P5G A;  1A5X A;  4KTZ A;  4CEF A;  3LZI A;  3HXM A;  2VWJ A;  1BGX T;  4NYN A;  5J2Q A;  3RMA A;  1U49 A;  1X9M A;  2GBZ A;  1C0M A;  1RTD A;  1IG9 A;  1RDB A;  1L3T A;  1D5A A;  2YKN A;  3L3V A;  4HTU A;  2HVI A;  1VSL A;  4W5T A;  4CJE A;  1HNV A;  2ZE2 A;  4CJL A;  1NJZ A;  3LZJ A;  4JS5 A;  2OPR A;  3DMJ A;  1RT1 A;  1VSD A;  3VQA A;  4AHS A;  4H8K A;  4DQQ A;  4K8X A;  1NK7 A;  5HP1 A;  5FDL A;  5HRS A;  3OJS A;  1QSY A;  4CES A;  1HMV A;  4FJM A;  5JS2 A;  4EP5 A;  4ZHR A;  3OJU A;  1CXU A;  3SQ0 A;  1QQC A;  1WSG A;  1BCO A;  3ULD A;  4M3T A;  4OLA A;  1JLB A;  2IC3 A;  4MFB A;  4CF0 A;  5SZT A;  3KLI A;  3AA3 A;  4M3R A;  4FJ7 A;  4QCL A;  3V9U A;  2X78 A;  5CZ1 A;  3L2Q A;  4DF4 A;  4CEE A;  1RT7 A;  3O4Q A;  3K5O A;  4Z4C A;  3LP3 A;  3NH1 A;  3AVB A;  3KIO A;  3OYH A;  1VSI A;  4RW4 A;  1TK0 A;  2P5O A;  3ZT3 A;  4Z4E A;  1BIU A;  1O1W A;  3V9S A;  4FM2 A;  3M8S A;  4W5R A;  1VSH A;  3QEP A;  2FBT A;  3DM2 A;  3KK1 A;  4FLV A;  4J2E A;  3AVK A;  4CK3 A;  3ITH A;  1LAV A;  3PUF A;  3VQ6 A;  1RDD A;  1BI4 A;  3LP1 A;  5CYM A;  3MED A;  4CIG A;  1KFD A;  3OYB A;  3MEE A;  3VQC A;  1IH7 A;  3P1G A;  3AVM A;  3SUN A;  3M8P A;  5HBM A;  1HRH A;  3EYZ A;  4B3O A;  4CIF A;  1B9F A;  5J1E A;  3RMC A;  1QSS A;  1TVR A;  4C8M A;  1WSE A;  4AHC A;  4M41 A;  4MQ3 A;  1NK0 A;  3OYF A;  4DTO A;  1VSM A;  3SUQ A;  4CE9 A;  1BQM A;  1YTA A;  4RW8 A;  1Z25 A;  1LWC A;  2ITG A;  1A5W A;  2IAJ A;  2GV9 A;  2OPQ A;  4BE0 A;  3O3G A;  2KW4 A;  4B9M A;  4FJH A;  2YKM A;  1CZ9 A;  4DQS A;  3I0S A;  4O5B A;  1SKS A;  4F8R A;  1EXQ A;  4FJN A;  4DFJ A;  1QTM A;  1QS4 A;  4IDK A;  4FM1 A;  4CGG A;  4NCB A;  4DFP A;  4C8K A;  1N6Q A;  3ALY A;  4PWD A;  3RRH A;  3AVL A;  1TK5 A;  4CJQ A;  4DSJ A;  3OYD A;  1EKE A;  4FJ5 A;  4KB1 A;  5J2P A;  2B5J A;  3QIO A;  4CHZ A;  5CY4 A;  3AVN A;  1LWE A;  1S1V A;  3DLR A;  2IS3 A;  4CK2 A;  3SPZ A;  4DWI A;  3LP0 A;  5KRT A;  3S3M A;  4IFY A;  5FRM A;  1SL2 A;  1QHT A;  4ZTF A;  3NGY A;  1NKE A;  4OLB A;  3LWM A;  4N47 A;  3RR8 A;  4FJG A;  2G8I A;  3NAE A;  3AO5 A;  1BHL A;  1RCH A;  4CGH A;  3RRG A;  2YNF A;  2HVH A;  3NHG A;  1RIL A;  3QES A;  5KI6 A;  3CFO A;  3ZSV A;  2X6N A;  4C8O A;  3VN5 A;  4CGD A;  4KKO A;  2G8V A;  3KJV A;  1ASW A;  1I3A A;  2QXF A;  1VK0 A;  1L5U A;  2F96 A;  2X74 A;  3FFI A;  4OJR A;  1RTJ A;  4CEB A;  4OPJ A;  4CFD A;  3WNF A;  4DQP A;  4FK0 A;  4CEO A;  3NF9 A;  1FKO A;  1Z26 A;  1YTU A;  3I0R A;  3LAM A;  2F8S A;  3KLG A;  1J5O A;  3V1O A;  1WSF A;  4O55 A;  1B92 A;  3AVF A;  2FBX A;  4KTQ A;  3ZSQ A;  1JL1 A;  3HYF A;  3TR8 A;  2IOC A;  3HVT A;  2YNI A;  3KK2 A;  1GOA A;  4DF8 A;  1L3U A;  1C6V A;  2IGI A;  2AJQ A;  1JXE A;  3LAN A;  4EP4 A;  3V9Z A;  4N41 A;  3DLE A;  4EZ9 A;  3HL8 A;  3OYI A;  4RG8 A;  3WNH A;  1TL1 A;  1ZBU A;  3ASM A;  1R0A A;  3QO9 A;  1ZBH A;  4FZY A;  2QKK A;  4OKK A;  4I9Q A;  1TGO A;  4CJK A;  3ZCM A;  3SUP A;  1FKP A;  3OS1 A;  1KLM A;  1TKZ A;  2HHW A;  2B4J A;  3AO4 A;  2G8F A;  3VQ5 A;  3SV4 A;  3TAF A;  4BDZ A;  3NF8 A;  3A2F A;  1HJR A;  3V9X A;  3L2R A;  4FJJ A;  4KRE A;  1SV5 A;  4DMN A;  4FJL A;  1EX4 A;  5JS1 A;  4FCY A;  3C94 A;  3MXM A;  4CJV A;  3AVA A;  4M45 A;  1YVU A;  1QE1 A;  3OYK A;  3OYA A;  4OVL A;  3HT3 A;  1EET A;  1IKV A;  1BI4 B;  1UOC A;  3SYZ A;  4AIL C;  4KHS A;  1N5Y A;  1S1W A;  1RBT A;  5HRO A;  4HUG A;  4DQI A;  1Q9Y A;  4FXD A;  2P1J A;  3QNN A;  3HO1 A;  4O44 A;  3V6D A;  3S3O A;  4FZZ A;  1JKH A;  4QAG A;  1C0T A;  4GVM A;  4AHV A;  4B9N A;  3M8Q A;  4J2A A;  3SV3 A;  3QNO A;  4FJK A;  1ASU A;  3CYM A;  3NBP A;  3OS2 A;  2LSN A;  2XRI A;  3B6P A;  4AHT A;  4CJU A;  3SZ2 A;  4F3O A;  4CIE A;  3ZSR A;  1C1C A;  4N56 A;  4CGJ A;  3VQP A;  4M3X A;  3D45 A;  1TKD A;  1W9H A;  1HNI A;  3LWL A;  2O4G A;  3ZSZ A;  1VSE A;  4NYF A;  3ZT4 A;  4CJS A;  2QK9 A;  3ZT2 A;  4I2Q A;  2WOM A;  4ELV A;  1IO2 A;  4IBN A;  4W5O A;  4B9S A;  4DSK A;  2VG7 A;  3NGI A;  3RTV A;  4JRQ A;  3AA2 A;  3P83 D;  2PZS A;  3SJJ A;  4HUF A;  4JLH A;  5I42 A;  3M8R A;  2OZM A;  4FVM A;  3S3N A;  1FK9 A;  1ZBI A;  4UQG A;  3CM5 A;  3F9K A;  3DI6 A;  5KGX A;  3O3H A;  4OGE A;  4CHO A;  1T03 A;  1WN7 A;  2DFH A;  4F2R A;  1WSI A;  1WNS A;  3V4I A;  2G8U A;  4LSL A;  4M3Y A;  2RPI A;  3LDS A;  4CK1 A;  1XWL A;  3NGZ A;  3RMD A;  1X9S A;  2KTQ A;  3NFA A;  4DTN A;  2Z1J A;  1RTH A;  4DG1 A;  5C25 A;  2HW3 A;  3QEW A;  3RMB A;  2E4L A;  4E0D A;  1T05 A;  1RT2 A;  2HHX A;  4IG3 A;  1LAW A;  1NJX A;  3T3F A;  1XI1 A;  2RKI A;  1UAX A;  1J53 A;  1J9A A;  1S6P A;  2X6S A;  3P5J A;  3U6F A;  4DTR A;  4LH4 A;  1S9E A;  3QET A;  4E1N A;  2JGU A;  4M3U A;  3HM9 A;  1SKW A;  4LY7 A;  2HNZ A;  1JXB A;  3VQE A;  3I8D A;  1F21 A;  3F73 A;  2VWK A;  3SCX A;  4RW9 A;  4WE1 A;  1S9G A;  1CLQ A;  3BDP A;  3HPG A;  4Z4I A;  3SUO A;  4LH5 A;  2ZD1 A;  4PY5 A;  1DTT A;  4DFM A;  4E7H A;  4E89 A;  5C42 A;  4H4M A;  2HHU A;  2Z1I A;  2Z1G A;  1WAF A;  3TAN A;  1BIZ A;  4FJ8 A;  4YNQ A;  3K57 A;  3TAR A;  1RBS A;  4CF8 A;  1W0H A;  2Z1H A;  3L3U A;  3TI0 A;  3AVG A;  1UA0 A;  1U4B A;  4FYD A;  3QEX A;  2FBV A;  1RT5 A;  4ICL A;  3IAY A;  4CFB A;  1KSP A;  4CEA A;  4FZX C;  4B8A B;  1D8Y A;  2Y1J A;  1XC9 A;  2WON A;  4Z4H A;  4ID5 A;  4I2P A;  1HPZ A;  1TAQ A;  1UWB A;  1NK4 A;  2G8K A;  4CF2 A;  3AVJ A;  1RBR A;  2RF2 A;  2KFZ A;  3H08 A;  3EZ5 A;  3SQ2 A;  2HMI A;  4PUO A;  4CF9 A;  1D9D A;  4NCG A;  4Y1D A;  4XIU A;  4LSN A;  4L8R B;  2G8W A;  4DU1 A;  3O3F A;  3PV8 A;  2HHT A;  4K8Z A;  3AA5 X;  1U48 A;  4FJX A;  3AVC A;  1JLF A;  1TKX A;  1K6Y A;  4Y1C A;  3TAG A;  1NKB A;  3MEG A;  4PA1 A;  2DY4 A;  4FM0 A;  1JL2 A;  1X1P A;  2VG6 A;  3K5L A;  3KLE A;  1KCF A;  3PO4 A;  2XY7 A;  3V1R A;  5FRN A;  4EZ6 A;  3VQ9 A;  5HRN A;  1ZBF A;  2E6M A;  1L3V A;  3IS9 A;  3OY9 A;  4KV8 A;  2YNG A;  1A5V A;  1RDC A;  1U04 A;  1YT3 A;  3E01 A;  4E7I A;  1HQU A;  3ISN C;  1LV5 A;  1S1T A;  4KRF A;  5HLF A;  3OS0 A;  2EHG A;  3JYT A;  3C6U A;  4FJI A;  2D0C A;  2D5R A;  3AVI A;  4FK4 A;  3G0Z A;  3THV A;  1ZYQ A;  3VQB A;  3SPY A;  3NCI A;  3ZSX A;  4DFK A;  3NH0 A;  4CHY A;  3QEI A;  1BIS A;  3HP6 A;  3KKR A; 
#chains in the Genus database with same CATH topology
 3IDH A;  5BRD A;  3Q7C A;  4ISE A;  3ZX0 A;  2V51 B;  3LAK A;  3KD5 E;  1RT3 A;  3R1X A;  2Y1I A;  4JRP A;  3MMV A;  2YHB A;  2JWL A;  4YFU A;  1NGE A;  1WSH A;  4HWI A;  2HF4 A;  4G1Q A;  1QVG M;  1Z6R A;  1NK5 A;  4DTS A;  2OPS A;  4JAX A;  5ADX A;  4F2S A;  1HX1 A;  1NOZ A;  3NE6 A;  2FSK A;  3ATU A;  3LAL A;  4DV2 K;  3VA0 A;  3V81 A;  2HND A;  1CZB A;  4DV0 K;  3K9K A;  4BC5 A;  3SAF A;  3G10 A;  5D3G A;  1S6Q A;  2ZGY A;  1WSJ A;  4AH9 A;  5I3U A;  5J2N A;  4WQ4 A;  1N34 K;  2P51 A;  4CD1 A;  3ZX2 A;  2XO7 A;  1YIT N;  3FZM A;  1IKY A;  5AZI A;  2YNH A;  3NF6 A;  4BR2 A;  4KHN A;  1X3N A;  4KO0 A;  4CJ5 A;  4N76 A;  1LW0 A;  4O4G A;  3J7A P;  3OHR A;  1FXX A;  4DS4 A;  5I42 A;  2A40 A;  3OYJ A;  1OVY A;  2XY8 A;  2GUI A;  1VHX A;  5T7B A;  4W5Q A;  3UIQ A;  4JS4 A;  5SWM A;  3UKR A;  3RWU A;  1DEJ A;  3DXK A;  4Q5V A;  2HHQ A;  4CFA A;  3CCE N;  3WUH A;  5E84 A;  3LDP A;  5HOO A;  3PX4 A;  3RR7 A;  2CH5 A;  2ZJP L;  1KTQ A;  4CZH A;  2DFE A;  2D0P A;  2HBK A;  2O8B A;  3AA4 A;  4GVE A;  4PQU A;  2YX6 A;  4CJP A;  4BE2 A;  2P9L A;  4MLE A;  3SQ1 A;  4OKE A;  3TWH A;  1T7P A;  3HJF A;  2QWM A;  5FPE A;  2CGJ A;  4HUE A;  1WOQ A;  4KHQ A;  4IDH A;  3HK2 A;  2VG5 A;  4GY2 B;  4FWN A;  4CZG A;  3K59 A;  2E20 A;  4KI6 A;  4M3W A;  3M6G A;  3VQ4 A;  4ID1 A;  3CPW M;  1NJI O;  4F3T A;  1T6D A;  2BUP A;  4JKG A;  3P38 A;  1YJW N;  1S22 A;  3EY1 A;  4B08 A;  3HP9 A;  1VRU A;  3FGU A;  4BR5 A;  4IJN A;  4BRG A;  4FWP A;  2Q97 A;  4DR3 K;  3K5N A;  4DLG A;  1MDU B;  1LCU A;  1BQN A;  5AZI B;  1K73 O;  4B9T A;  3VET A;  1S5J A;  4CGF A;  1D9F A;  3CJC A;  2OCE A;  1DLO A;  4DS5 A;  1HPM A;  3AO1 A;  4CI6 A;  3T69 A;  4J2B A;  3U3G A;  3P31 A;  1TV6 A;  1BWF O;  1KQS M;  3VQQ A;  3NF7 A;  3SI6 A;  1EWR A;  4E7K A;  4WCE L;  4DR1 K;  3DLB A;  4CEQ A;  5CYQ A;  4BR4 A;  1TAU A;  3O4N A;  3UKR B;  1RDA A;  4DSE A;  1A5X A;  4KTZ A;  2YHY A;  3DXK B;  2ZE2 A;  4M7X A;  5GAH P;  1NJZ A;  4OPH A;  3U4L A;  3LZJ A;  3A0I X;  1VSD A;  4AHS A;  1VQP N;  1SS6 A;  2P9N A;  4DQQ A;  4Y0W A;  4DUZ K;  4DB3 A;  1QSY A;  2O8B B;  2HHH K;  3ID6 A;  3ENB A;  3SQ0 A;  4M3T A;  5SZT A;  3AA3 A;  2P9L B;  4ILJ A;  2X78 A;  4FWR A;  4QS8 A;  4EFH A;  4X66 K;  4Z4C A;  1Y64 A;  1YJ9 N;  3AVB A;  3KIO A;  1JCF A;  3CJ1 A;  1NU0 A;  2O8E A;  1O1W A;  3V9S A;  4C1N I;  1P8Z A;  3MN5 A;  4H0V B;  3VEZ A;  4W5R A;  5AQO A;  3QEP A;  2FBT A;  3DM2 A;  3KK1 A;  4FLV A;  3QBX A;  3AVK A;  1BUP A;  4U67 L;  3ITH A;  5B8H A;  2EWS A;  3VQ6 A;  1LAV A;  3GDQ A;  1RDD A;  5CYM A;  4H5W A;  4CIG A;  2OTL N;  1J6Z A;  1IH7 A;  3P1G A;  4JKG B;  5HBM A;  1TVR A;  4C8M A;  3C6A A;  4AHC A;  3MX2 A;  4M41 A;  3HBT A;  5JLH A;  2E88 A;  1BQM A;  1Z25 A;  5AQI A;  1LWC A;  1A5W A;  2IAJ A;  4FJH A;  1SKS A;  4O5B A;  4FJN A;  1D4X A;  4DFJ A;  1QTM A;  1VQN N;  4NCB A;  1DT9 A;  3KWI A;  3VGM A;  4PWD A;  1GLB G;  1OVQ A;  3WXI A;  3DXM A;  2B5J A;  4LF6 K;  2ASP A;  4ISF A;  4DWI A;  4MLH A;  4YOY A;  2RE2 A;  3LP0 A;  5KRT A;  1NGG A;  3NGY A;  4YOR A;  2G8I A;  4GV3 A;  1QQO A;  3AO5 A;  2HVH A;  1GLL O;  5KI6 A;  2X6N A;  5BN8 A;  4CGD A;  5CE3 A;  5FLX O;  4DHY A;  1VK0 A;  2F96 A;  2Q0R A;  4DQP A;  4FK0 A;  2F8S A;  1Z26 A;  1EQY A;  2Q2R A;  1KAY A;  1ATR A;  3E9L A;  1RFQ A;  4KTQ A;  1B92 A;  2WBN A;  4JKC A;  3HYF A;  4ILH A;  2P9N B;  3HVT A;  4R79 A;  1GOA A;  1C6V A;  2IGI A;  4H0Y B;  4CJ7 A;  3DLE A;  2H3G X;  4RG8 A;  1TL1 A;  3ASM A;  1KXP A;  3QO9 A;  1Q82 O;  2V7Y A;  3SUP A;  2HHW A;  4FOE A;  3AO4 A;  5AJ3 K;  3VQ5 A;  1OH8 A;  3SV4 A;  2O8E B;  4FJJ A;  4KRE A;  3AGR A;  3O6W A;  3IUC A;  2P9U A;  3HI0 A;  4M45 A;  2OTJ N;  1YVU A;  4YY3 K;  3HT3 A;  4OVL A;  1EET A;  1IKV A;  3THW A;  5HRO A;  1Q9Y A;  3S3O A;  3C0B A;  4B1U B;  4B9N A;  5LL6 Z;  3SV3 A;  4JKF A;  3UB5 A;  3CYM A;  3OS2 A;  1X3M A;  3B6P A;  2P9I A;  4CIE A;  5F0X A;  3VQP A;  4BGA A;  3LWL A;  3ZLJ A;  3ZT4 A;  3ZT2 A;  1LOT B;  1IO2 A;  4WQ4 C;  4JRQ A;  3DXM B;  3M8R A;  4WQ5 A;  2O8C A;  3S3N A;  4UQG A;  3CM5 A;  3VPZ A;  3DI6 A;  1WN7 A;  4M7Y A;  3V4I A;  4M3Y A;  3LDS A;  2F4V K;  1XWL A;  3RMD A;  3A5L C;  2Z1J A;  3GG4 A;  2NRH A;  3S41 A;  5C25 A;  4G9Z A;  2ZM6 K;  3H3N O;  4JI7 K;  1NJX A;  4CZK A;  3T3F A;  1UAX A;  3U6F A;  1S6P A;  3K9J A;  4LH4 A;  2E5L K;  3QET A;  2JGU A;  5JVH L;  1JJ2 M;  1JXB A;  3VQE A;  5IT9 O;  4RW9 A;  4WE1 A;  1S9G A;  3BDP A;  1C0G A;  2NNW A;  4PY5 A;  2O8D A;  1DTT A;  4DFM A;  2Z1G A;  4GKJ K;  3LM2 A;  2YJE A;  3TSU A;  3CCM N;  4CF8 A;  5BR9 A;  2GTD A;  2FBV A;  2KHO A;  1RT5 A;  1KSP A;  1XMO K;  1D8Y A;  2Y1J A;  1XC9 A;  3CCU N;  4NB4 A;  4O8K A;  4ID5 A;  1HPZ A;  3LM9 A;  4BY9 C;  1RBR A;  2KFZ A;  1MWK A;  1D9D A;  4XIU A;  2GX9 A;  2WFB A;  4DU1 A;  4K8Z A;  3AA5 X;  4DV7 K;  2QWN A;  3AVC A;  4F9O A;  3HOT A;  1JLF A;  1TKX A;  5AQN A;  1X1P A;  4M63 C;  1KCF A;  2XY7 A;  2P9U B;  3VQ9 A;  5HRN A;  1ZBF A;  1MWM A;  2NRT A;  2E6M A;  3THW B;  4LF5 K;  3WXK A;  3E01 A;  5BRH A;  4E7I A;  2O8F A;  1S1T A;  4KRF A;  5HLF A;  4BRQ A;  2ZWH A;  4O8U A;  1U2V A;  3THV A;  2QWP A;  3VQB A;  3HSC A;  5AQP A;  5BR8 K;  3NH0 A;  3DAW A;  4BRE A;  2P9I B;  5GIN A;  1BIS A;  4Z94 A;  3KLH A;  3DOL A;  3VQD A;  2PYL A;  1ATN A;  4PKH A;  4BAC A;  1S1X A;  1VQ7 N;  5BPL A;  1JLG A;  4CZI A;  4LD0 A;  3C65 A;  2XHB A;  3G4S N;  4FLY A;  2O8C B;  1Q86 O;  4FLT A;  3SQ4 A;  2OA8 A;  2QWQ A;  2YHX A;  3C6T A;  4BWJ A;  3OBW A;  2PYJ A;  3HM8 A;  4DLE A;  4ZTJ A;  3LDL A;  1VSF A;  1W97 L;  5AQF A;  3VTH A;  5KTQ A;  4OX9 K;  4C8L A;  3HPH A;  3U9D A;  3DYA A;  2PZS A;  5DMR A;  4NXM K;  2OZM A;  4I7F A;  5AZJ A;  3QEV A;  2IVN A;  2QTD A;  2O8D B;  1LWF A;  5LMU K;  3LP2 A;  4LF8 K;  4W5N A;  2ZGZ A;  2E1Z A;  4B8C A;  4AQY K;  2FSJ A;  1QZ5 A;  2Q0U A;  2QWL A;  2YV0 X;  4WFA L;  3MEC A;  1U45 A;  4X65 K;  1GLE G;  2O4I A;  2A1S A;  3FZK A;  3EE8 A;  2OZS A;  2FBY A;  1C1B A;  1NMN A;  2FF6 A;  3T1A A;  1Q9X A;  3AV9 A;  1SUQ A;  3HTV A;  3ZSY A;  4LFB K;  2DPN A;  3MXI A;  2A41 A;  1IKX A;  2F7T A;  4NCA A;  3GL1 A;  2Q3S A;  3G71 N;  3DOK A;  2O8F B;  1NK9 A;  1VQO N;  1VRT A;  3O80 A;  1IKW A;  2E2O A;  3MWP A;  4JHD A;  4CGI A;  2RN2 A;  1T3V A;  4JKB A;  4DU3 A;  3DLH A;  1TYQ A;  3SAG A;  3HVR A;  3EKS A;  3D2F A;  5KPR A;  2W42 A;  4Q0B A;  3CQ8 A;  3PY8 A;  4FK2 A;  2ASM A;  4JK9 A;  4B3M K;  4O0J A;  5LY3 A;  4GW6 A;  3TTD A;  1BOT O;  5EU7 A;  3EL2 A;  3DRP A;  4GNI A;  3WEE A;  4A61 A;  3I8B A;  3BUZ B;  5M1P A;  2G8H A;  1VAZ A;  1T8E A;  1HNZ K;  3KKS A;  1GLJ O;  3TAP A;  3EN9 A;  3WNE A;  1WAJ A;  5JIC A;  1ESV A;  3D0P A;  1OH7 A;  3T7Z A;  4XH1 A;  5F2R A;  4J8F A;  3CC7 N;  4UY8 O;  3VGL A;  4KBO A;  4HCB A;  2NZT A;  2ZJR L;  4H5N A;  1VQ8 N;  1ASV A;  5C2D A;  3ENO A;  5C24 A;  1RTI A;  2B6A A;  2AP1 A;  3L2W A;  4A57 A;  5AZJ B;  4JKA A;  1CXQ A;  5CZ2 A;  3HRG A;  4DR5 K;  4CJR A;  3O9Q A;  1K9M O;  3K58 A;  2QEX N;  4FW1 A;  4EHT A;  1YI2 N;  4KHY A;  2KQ2 A;  4FLU A;  1ZBL A;  2J4R A;  3CJA A;  2BDP A;  1HNX K;  4ELU A;  3KTQ A;  4CJ4 A;  3BZC A;  1NK8 A;  5AQW A;  4Z0U A;  1U47 A;  1HYS A;  1EP4 A;  3GOI A;  3V1Q A;  1NJW A;  3CJB A;  2Q31 A;  4JEP A;  2PY5 A;  1C1A A;  4IO9 L;  3BF1 A;  5A2Q O;  4CEZ A;  5KGW A;  3OVN A;  3CFP A;  2P5G A;  3OBY A;  3RMA A;  4FWQ A;  1X9M A;  1RTD A;  1D5A A;  3L3V A;  4HTU A;  4K42 A;  1NNE A;  4CJE A;  1HNV A;  5C15 A;  2PAV A;  1S72 N;  3BF3 A;  4JS5 A;  4JHD B;  3DMJ A;  3VQA A;  5JMV A;  4H8K A;  1TYQ B;  3F9M A;  3D2F B;  3FLC O;  5FDL A;  3OJS A;  3KVG A;  4CES A;  1HMV A;  4FJM A;  1IJJ A;  4EP5 A;  4ZHR A;  3SK3 A;  1JLB A;  3WEE B;  4FJ7 A;  4H0O A;  4M3R A;  4QCL A;  2E8A A;  5CZ1 A;  4DF4 A;  4CEE A;  3O4Q A;  3K5O A;  5F1X A;  4B9Q A;  1TK0 A;  1VSI A;  2FF3 B;  4WQ5 C;  2VGN A;  1XNQ K;  1QQM A;  3M8S A;  1HUX A;  3WQT A;  2NRV A;  3LP1 A;  4LC9 B;  3VQC A;  3H3O B;  3SBT A;  3SUN A;  3CJ9 A;  2HMP A;  3EYZ A;  4CIF A;  1Q7Y O;  3RMC A;  4EHU A;  1NK0 A;  1BU6 O;  3OYF A;  1VSM A;  3BP8 A;  2CH6 A;  3IMX A;  3VEY A;  2KW4 A;  3I0S A;  4JKH A;  4IEE A;  4EAH D;  1NGA A;  4IDK A;  5AQG A;  4DFP A;  4C8K A;  1N6Q A;  4DSJ A;  3AVL A;  4CJQ A;  5J2P A;  4X64 K;  4CZJ A;  1LWE A;  5H1S Q;  4BR9 A;  4CK2 A;  3S3M A;  4IFY A;  3LWM A;  3RR8 A;  4FJG A;  2V7Z A;  1HKC A;  1RDW X;  4BRI A;  3PIO L;  3CFO A;  2UUA K;  4KKO A;  1WUA A;  2G8V A;  3KJV A;  1I3A A;  4DUY K;  2X74 A;  4OPJ A;  4NXN K;  1KAZ A;  4CEO A;  1FKO A;  3LAM A;  4GV6 A;  1CZA N;  2I7N A;  3JS6 A;  3V1O A;  1G99 A;  3AVF A;  4BRP A;  3DWL A;  2YNI A;  2P9S A;  3C6H A;  4L3Q A;  3LAN A;  4MDB A;  4EP4 A;  3FFK B;  4A5B A;  5CHI A;  4N41 A;  4DR6 K;  3WNH A;  1R0A A;  3JAM O;  1ZBH A;  3ZET A;  3VGK A;  1ZBS A;  1FKP A;  4RWT A;  3OS1 A;  1KLM A;  1TKZ A;  3H6E A;  2B4J A;  2E2Q A;  4PL7 A;  2G8F A;  2F9W A;  3TAF A;  3N4Q A;  3FR0 A;  3DLL L;  1NM1 A;  4U7B A;  1M1K O;  4IOX A;  4FCY A;  3MXM A;  4CBX A;  4LFC K;  1QE1 A;  3OYK A;  4AIL C;  3J80 O;  1RBT A;  2VCP A;  3E1Y A;  4YOT A;  3PLA A;  1C0T A;  3M8Q A;  4B1V A;  3ZYY X;  3QFU A;  2A42 A;  2LSN A;  2XRI A;  4AHT A;  1C1C A;  3SMS A;  5AQM A;  3ZSZ A;  1VSE A;  2QK9 A;  4I2Q A;  2WOM A;  3D6R A;  4W5O A;  3VF4 A;  3RTV A;  2UUB K;  2Q1N A;  3SJJ A;  2D1K A;  3GE1 A;  3CHW A;  2P9K A;  5GAE P;  4FVM A;  1FK9 A;  5KPT A;  4CHO A;  1WSI A;  4LF7 K;  4LSL A;  3NGZ A;  3NFA A;  4DTN A;  5TKY A;  2E4L A;  2W6K A;  4E0D A;  1RT2 A;  4QS9 A;  1C0F A;  1J53 A;  4DTR A;  1NMD A;  4BVO A;  1SKW A;  3RSE A;  1Z05 A;  3I8D A;  1Q81 O;  4Z4I A;  4LH5 A;  4O5F A;  2PBD A;  2ZD1 A;  5BRE A;  2CGL A;  2QA4 N;  1WAF A;  2P9S B;  3NMU A;  4FJ8 A;  4YNQ A;  3TAR A;  3AVG A;  4JI6 K;  4DV5 K;  3M3Z A;  4JI4 K;  3IAY A;  4FWL A;  4CFB A;  2QWO A;  4FZX C;  4B8A B;  1P90 A;  4EIA A;  1QQN A;  1TAQ A;  3ZET B;  4CF2 A;  5LJW A;  3EZ5 A;  4WFN L;  3THY A;  4CF9 A;  2HMI A;  4NCG A;  4Y1D A;  5HL7 L;  5C12 A;  1U48 A;  1BA0 A;  5DM7 L;  4FWM A;  4Y1C A;  5IWA K;  3CCS N;  4FSV A;  2E1Y A;  3CCV N;  3V1R A;  5FRN A;  4JI1 K;  3EZW A;  4AM6 A;  4DQ8 A;  1RDC A;  1TUY A;  3OS0 A;  1TUU A;  1VQK N;  3C6U A;  4FJI A;  4FK4 A;  3CET A;  3LDQ A;  1IV0 A;  3G0Z A;  2NRW A;  4XH4 A;  3SPY A;  4BRA A;  4H4O A;  4MDA A;  2BE2 A;  1SL0 A;  4J2D A;  3BEX A;  3VQ8 A;  5M1N A;  1VQ9 N;  3VA3 A;  3CM6 A;  3L2V A;  4GMJ B;  5AQX A;  3TAM A;  5AQR A;  4YOV A;  1JLC A;  2I5J A;  4KFB A;  4Z4F A;  4M3Z A;  4DU4 A;  4LF9 K;  2UYT A;  2P9K B;  1VQ6 N;  2HB5 A;  4CER A;  3RVC A;  3CF5 L;  2OYQ A;  1BL3 A;  2GEM A;  4C8N A;  3TAB A;  4K43 A;  5M1F A;  3BGR A;  3VQ7 A;  2QI2 A;  4CCH A;  4FWK A;  4DTP A;  3MAQ A;  1BCM A;  1KVB A;  3FE1 A;  4R5P A;  4E19 A;  3R9P A;  1S1U A;  2Q36 A;  4IZ9 A;  3C95 A;  2ATQ A;  4CFC A;  3IG1 A;  3RSE B;  3S9H A;  3CME N;  1XHZ A;  1Y97 A;  1RNH A;  3KZB A;  3BZK A;  4KPY A;  3E66 A;  1TL3 A;  3WXM B;  3LPU A;  2JLE A;  4CD3 A;  2BTF A;  3DLK A;  3DLG A;  1YJN N;  3A5M C;  3T19 A;  4JKD A;  1N33 K;  4XEI A;  1WLJ A;  5E41 A;  3C7N A;  3THY B;  3ZSW A;  5AQV A;  3J8A A;  3QER A;  1ITG A;  2E2P A;  4IXC A;  3U3Y A;  1L3S A;  4HHT A;  1SKR A;  2D4W A;  3TAE A;  2FC0 A;  3ZT0 A;  4KB0 A;  4J2A A;  3QDK A;  5FRO A;  1NGJ A;  4OKJ A;  3WT0 A;  2EX3 A;  4BE1 A;  3NDK A;  4DTX A;  5I9E B;  2HF3 A;  4AHR A;  4H5T A;  2A5X A;  1EWQ A;  1WBB A;  4JNE A;  4FW2 A;  3F2K A;  4H0T B;  3AAR A;  4BWM A;  1YHQ N;  1NKC A;  3MN6 A;  3QIN A;  2D0B A;  3PIP L;  3M1F A;  5KPZ A;  2OAN A;  1KRP A;  3KHY A;  2HNY A;  4NLC A;  2ITM A;  1RT6 A;  3AVH A;  2GEL A;  4CZF A;  1ZXO A;  4CF1 A;  1BG3 A;  1JLE A;  3WXJ A;  3NH2 A;  1G15 A;  1BO5 O;  4IFV A;  1Q8I A;  3HPO A;  2P9P A;  2DFF A;  4JN4 A;  4FL9 A;  4M42 A;  3GBT A;  2UU9 K;  1VQL N;  3OTO K;  3ATV A;  4KHU A;  2W41 A;  3O4W A;  4B9V A;  4FOI A;  3FZH A;  4CVN E;  1LW2 A;  2YI1 A;  4LF4 K;  4ELT A;  4PL8 A;  3PX6 A;  3SLC A;  5HRP A;  4K25 A;  4BRM A;  3MX5 A;  2YHA A;  1FJG K;  3AO3 A;  1NG9 A;  2HOE A;  5KRS A;  1UA1 A;  4X62 K;  5HRR A;  1E4F T;  3D7E O;  1JLA A;  3QLH A;  3EO3 A;  3QB0 A;  4MO4 A;  1XC3 A;  4DSL A;  2NRR A;  3VEX A;  4KTW A;  1QSL A;  4CHQ A;  3OYN A;  3C7N B;  4E7L A;  1N36 K;  3QBW A;  4F4K A;  1REV A;  2E6L A;  1KFS A;  5AR0 A;  3DRR A;  3H1V X;  3TAQ A;  5DK5 A;  4WYB A;  2ZQB A;  3L4Q A;  4FJ9 A;  4N5S A;  3LPT A;  5CR4 A;  4CEF A;  2VWJ A;  1BGX T;  5J2Q A;  1C0M A;  2JWK A;  3M5R A;  1RDB A;  3O9T A;  1IG9 A;  2HVI A;  1VSL A;  5BRF A;  2OPR A;  3O1B A;  3KK7 A;  5LMN K;  4QS7 A;  4K8X A;  1YIJ N;  1NK7 A;  5HP1 A;  3OA9 A;  4DV4 K;  3NVK A;  1CXU A;  1YUW A;  3D2E A;  1WSG A;  3G25 A;  4OLA A;  1K8A O;  4MFB A;  4YOW A;  1K8K A;  4DCH A;  3KLI A;  2NLX A;  3B8A X;  4H0X B;  3V9U A;  1ATS A;  3UKU A;  4BQZ A;  2FXU A;  3NH1 A;  4E1J A;  4RW4 A;  4Z4E A;  2P5O A;  3ZT3 A;  2IIR A;  2P9P B;  4CZE A;  1VSH A;  1VQ5 N;  5AFU H;  3ZX3 A;  2QW9 A;  4CK3 A;  5GIP A;  4JI8 K;  2QWR A;  5M1K A;  1BI4 A;  3OYB A;  2VGM A;  3MED A;  1KFD A;  5LJV A;  4CW7 B;  5ELZ A;  3AVM A;  3M8P A;  3O9R A;  3HZ6 A;  5C2F A;  1B9F A;  1QSS A;  4MQ3 A;  4GKK K;  4DTO A;  3SUQ A;  1YTA A;  4BE0 A;  4PKI A;  3O3G A;  2YKM A;  5EOY A;  4F8R A;  2WC9 A;  3A5N C;  4FM1 A;  4CGG A;  3MK6 A;  3J7Y P;  1QHA A;  3TSQ A;  1KAX A;  4FJ5 A;  3OYD A;  3VER A;  1VQ4 N;  4KB1 A;  3QIO A;  4CHZ A;  5CY4 A;  5EY4 A;  3AVN A;  1S1V A;  2IS3 A;  4FPA A;  5FRM A;  1SL2 A;  1QHT A;  2HBL A;  4ZTF A;  1NKE A;  5EX5 A;  3CCR N;  3NAE A;  3VF2 A;  3NHG A;  5GAD P;  3QES A;  3ZSV A;  3VES A;  2QXF A;  1L5U A;  1YVN A;  4OJR A;  2IVO A;  3FFI A;  4CFD A;  3WNF A;  1NGF A;  3NF9 A;  4IWV A;  1YTU A;  3I0R A;  3KLG A;  1J5O A;  4BRO A;  1WSF A;  4KH4 A;  2FBX A;  3ZSQ A;  4NLB A;  2IOC A;  3L0Q A;  3KK2 A;  1HLU A;  2AJQ A;  4BRK A;  2FLO A;  4EZ9 A;  2UUC K;  4JK8 A;  3OYI A;  3D2E B;  3WQU A;  4IEI A;  1ZBU A;  4DKW A;  1K8K B;  4JI5 K;  4YHH K;  4FZY A;  2QKK A;  4I9Q A;  1TGO A;  3UKU B;  1HJO A;  4BDZ A;  4GV9 A;  3A2F A;  3V9X A;  3L2R A;  1SV5 A;  4DMN A;  2W40 A;  4B3T K;  3C94 A;  3VF6 A;  3CIP A;  4CJV A;  3LDN A;  3OYA A;  1BI4 B;  1OH5 A;  1N5Y A;  4HUG A;  4DQI A;  4FXD A;  2P1J A;  4BG9 A;  1JKH A;  4QAG A;  4GVM A;  2E2N A;  1NLV A;  1ASU A;  1NGB A;  2GWK A;  4CJU A;  4F3O A;  3SZ2 A;  1MA9 B;  1KD1 O;  4N56 A;  1HNI A;  4LFA K;  4NYF A;  4ELV A;  1J5E K;  3VEW A;  4IBN A;  4DSK A;  3AA2 A;  3O5B A;  4A2A A;  4HUF A;  4JLH A;  3F9K A;  3O3H A;  2AA4 A;  4OGE A;  1T03 A;  3ZEU A;  1WNS A;  2RPI A;  1HKB A;  2KTQ A;  1X9S A;  2YCH A;  1RTH A;  3RMB A;  1QVF M;  4IG3 A;  2X6S A;  1J9A A;  1OH6 A;  2ASO A;  4LY7 A;  2HNZ A;  4IJA A;  2VWK A;  4BGB A;  3SCX A;  1CLQ A;  1GLC G;  5FPM A;  3SUO A;  4CBW A;  2CGK A;  4BVP A;  4E89 A;  5C42 A;  5KQ8 A;  2Z1I A;  1NGC A;  1E4G T;  3K57 A;  3K0S A;  1YAG A;  3U8X A;  1W0H A;  3L3U A;  4FYD A;  3QEX A;  4ICL A;  1XUP O;  4CEA A;  4DR4 K;  4ISG A;  4Z4H A;  1UWB A;  1DGK N;  4FVU A;  3AVJ A;  2W6L A;  3H08 A;  4XH5 A;  4B3R K;  3L6Q A;  3A5O C;  3MCA B;  2D0O A;  3O3F A;  4OPA A;  3LL3 A;  3TAG A;  1K6Y A;  4H5R A;  2DY4 A;  1NKB A;  5FPN A;  1RDU A;  2HBM A;  2WUS A;  4EZ6 A;  3VMF B;  1A5V A;  1U04 A;  3ISN C;  1RGI A;  2D0C A;  5AQZ A;  5BN9 A;  4BRD A;  4C23 A;  3CCL N;  1IG8 A;  5M1Q A;  3NCI A;  3MDQ A;  2ZJQ L;  3HP6 A;  3KKR A;  2BAN A;  3KLF A;  5AQK A;  3TSP A;  4B1X B;  3DJC A;  3OYM A;  3Q7B A;  4A62 A;  2IDO A;  3EE9 A;  2KLA A;  2F8T A;  4BC3 A;  4FO0 A;  4CEC A;  3SMP A;  3SAH A;  1RBV A;  1C0U A;  2V52 B;  5MLC Q;  1JLQ A;  3HST B;  4FWS A;  3MXJ A;  4AHU A;  4JK7 A;  3VEO A;  3T1H K;  4CJW A;  3ZEU B;  1TK8 A;  3K2P A;  4CED A;  3TPQ A;  4CJ3 A;  3QML A;  4K41 A;  1HNW K;  3ZSO A;  3G6E N;  4DQR A;  4RW7 A;  3LDO A;  4IOA L;  1MU2 A;  4KHW A;  3B6O A;  3MN7 A;  1HYV A;  3O9U A;  5KQD A;  3L8B A;  3WNG A;  3OYG A;  3AO2 A;  1I94 K;  1KLN A;  4FLZ A;  4I9L A;  2A1R A;  1KVA A;  3KD1 E;  1HR0 K;  4HVJ A;  4B3S K;  4BRL A;  4B9L A;  3SJH A;  4V19 S;  3R8E A;  1E3M A;  3OYC A;  2KZM A;  4H03 B;  5AFU A;  1YF5 L;  1HYZ A;  4CHP A;  3EEQ A;  4BDY A;  1VSJ A;  1H1V A;  3T1Y K;  4FLW A;  4O0I A;  3QIP A;  3E9O A;  1T44 A;  1X9W A;  3CER A;  3SBG A;  2NUB A;  5AQH A;  3AAQ A;  3SNN A;  4JKE A;  2PFU A;  3CJ7 A;  3J81 O;  4HTL A;  4DTM A;  3CCJ N;  4DV6 K;  3VEN A;  4KAZ A;  3OYL A;  2GUP A;  3VEV A;  4TSX A;  4E3S A;  4DTU A;  4JV5 K;  1Q18 A;  4JYA K;  3AAP A;  3AY9 A;  4B1Z A;  4DV1 K;  3H1Q A;  4CJF A;  3CCQ N;  3JSM A;  3P39 A;  1RBU A;  4QOZ B;  4BR7 A;  2QKB A;  4A5A A;  4B9U A;  1I39 A;  4JD2 A;  1WB9 A;  3CFR A;  4BDP A;  4CBU A;  4IKF A;  1VSK A;  2ETJ A;  4CJT A;  4FLX A;  4BC4 A;  3KK3 A;  2A6A A;  1GOC A;  3TU5 A;  3L2U A;  3VTI A;  5AQS A;  1DKG D;  1XHX A;  3DRS A;  3KWG A;  2HHV A;  4FWO A;  3V9W A;  2DTU A;  3TTC A;  2IVP A;  1B9D A;  1QZ6 A;  5AQT A;  4IG0 A;  2XY5 A;  1DTQ A;  1R59 O;  3QIC A;  3K5M A;  4NO7 A;  3ZT1 A;  4Z4G A;  4RCH A;  1NGH A;  1NGD A;  4DTJ A;  3ULE A;  4HCC A;  2OPP A;  5EXW A;  2HHS A;  2R7Y A;  4DSI A;  1GOB A;  4YDU A;  1SL1 A;  1HQE A;  1X9J A;  1NJY A;  4AF1 A;  2BH1 A;  3CPE A;  4E7J A;  3CG7 A;  3OYE A;  2BGG A;  4RW6 A;  2D0A A;  1ZC6 A;  4IOC L;  3O9S A;  1SZ2 A;  4CZL A;  2XY6 A;  1J54 A;  2WTU A;  5J2M A;  2KZZ A;  4OGC A;  1KVC A;  3VOV A;  1TKT A;  3R3L A;  1NOY A;  1NK6 A;  1IBL K;  4E1M A;  1V4S A;  4A2B A;  4CHN A;  5M1O A;  1W2B M;  4DSF A;  5K14 A;  1IBM K;  3PO5 A;  3PX0 A;  3A8Y A;  2KFN A;  1RT4 A;  4JI2 K;  4OPK A;  2QM1 A;  3IRX A;  2NRX A;  4KI4 A;  4PKG A;  3LZI A;  3HXM A;  4NYN A;  1U49 A;  2GBZ A;  3CC2 N;  1L3T A;  2YKN A;  4RTF D;  5EVZ A;  4W5T A;  4JD2 B;  4CJL A;  3MWT A;  1S3X A;  4H0P A;  4I6M A;  1RT1 A;  4WF9 L;  3THX A;  4BRN A;  5HRS A;  5ADX H;  3IFR A;  4DV3 K;  1GLA G;  4YOU A;  1IBK K;  5JS2 A;  3OJU A;  1QQC A;  1BCO A;  3ULD A;  2IC3 A;  4CF0 A;  3QFP A;  3N4P A;  2VWB A;  3L2Q A;  2GWJ A;  1WBD A;  2RHK A;  1RT7 A;  3LP3 A;  3OYH A;  3CQX A;  1BIU A;  5E26 A;  5DM6 L;  4FM2 A;  2UXD K;  3J7Z O;  4J2E A;  4C1N K;  3ULE B;  1N32 K;  3PUF A;  4B9M A;  3MEE A;  4ILG B;  3W3D A;  1HRH A;  4B3O A;  2I7P A;  4BQL A;  5J1E A;  1VQM N;  1WSE A;  4CZM A;  3AGK A;  4CE9 A;  4RW8 A;  3FZF A;  2ITG A;  3BY5 A;  2KKZ A;  2GV9 A;  2OPQ A;  2F9T A;  5AQQ A;  1CZ9 A;  4YOX A;  4DQS A;  3MN9 A;  1SAZ A;  3CXC M;  1EXQ A;  3I33 A;  3NVM A;  1QS4 A;  2UXC K;  5BPM A;  3ALY A;  3RRH A;  1TK5 A;  1GLF O;  1HKG A;  1EKE A;  2VQE K;  3DLR A;  3EKU A;  3SPZ A;  4AM7 A;  3CD6 N;  5BPN A;  2NRZ A;  5AQJ A;  1V4T A;  4OLB A;  4N47 A;  4KHP K;  1BHL A;  1RCH A;  4CGH A;  3RRG A;  2YNF A;  1RIL A;  4C8O A;  5FPD A;  3VN5 A;  5AQU A;  4BRF A;  1ASW A;  4CEB A;  1RTJ A;  3HOS A;  1BDG A;  2QXL A;  4IO8 A;  4O55 A;  1YXQ A;  4I6M B;  1JL1 A;  2VQF K;  3TR8 A;  3THX B;  1N8R O;  5AQL A;  4DF8 A;  5TKW A;  1U6Z A;  1JXE A;  3H46 O;  3MCP A;  5JLF A;  3V9Z A;  3HL8 A;  4BRC A;  1EO1 A;  4OKK A;  4CJK A;  3ZCM A;  4JI3 K;  5GAG P;  1NWK A;  3W0L A;  3PSI A;  4BG8 A;  1BA1 A;  2VYP A;  4IFE A;  3WXL A;  3CC4 N;  3H45 C;  3NF8 A;  1HJR A;  4FJL A;  1EX4 A;  1XNR K;  5JS1 A;  5GIO A;  3AVA A;  1L3U A;  1UOC A;  3SYZ A;  4KHS A;  1S1W A;  4A59 A;  3QNN A;  3HO1 A;  2HBJ A;  4O44 A;  3V6D A;  4FZZ A;  1JCG A;  4AHV A;  3ID8 A;  3QNO A;  4FJK A;  3UE5 A;  3NBP A;  3O08 A;  3IKM A;  3ZSR A;  4CGJ A;  1FW6 A;  4M3X A;  3D45 A;  1TKD A;  1W9H A;  4OO1 J;  3I56 N;  2O4G A;  4CJS A;  3ENH A;  5AQY A;  2YJF A;  4B9S A;  4BC2 A;  2VG7 A;  3NGI A;  3TTF A;  3P83 D;  4DR2 K;  4KH6 A;  4JI0 K;  1ZBI A;  4DR7 K;  3F5T A;  4B1W B;  5KGX A;  2UXB K;  4BRH A;  1T6C A;  2DFH A;  4F2R A;  2G8U A;  1ILY A;  4K0K K;  4CK1 A;  3CI5 A;  3L4I A;  2HW3 A;  1SQK A;  4DG1 A;  4MO5 A;  3QEW A;  1T05 A;  2HHX A;  1LAW A;  3CQY A;  4H5V A;  1XI1 A;  2RKI A;  3P5J A;  1S9E A;  5C10 A;  4E1N A;  4M3U A;  3HM9 A;  1F21 A;  3F73 A;  3HPG A;  1JCE A;  4KH5 A;  4FPB A;  4E7H A;  3FZL A;  4H4M A;  2HHU A;  3TAN A;  1BIZ A;  3PSF A;  1U2V B;  1RBS A;  2FSN A;  2Z1H A;  1UA0 A;  3TI0 A;  1U4B A;  1GLD G;  1OKJ A;  3JXU A;  3O1W A;  3OW2 M;  2A3Z A;  2WON A;  4I2P A;  3I55 N;  2G8K A;  1NK4 A;  2RF2 A;  3SQ2 A;  4PUO A;  4LSN A;  4L8R B;  1XQS C;  2G8W A;  3PV8 A;  2HHT A;  4FJX A;  4B1Y B;  3MEG A;  4PA1 A;  5C0Y A;  4FM0 A;  1JL2 A;  2VG6 A;  4WFB L;  3KLE A;  3K5L A;  3PO4 A;  1KC8 O;  3CMA N;  5JVG L;  1W7A A;  3U9Z A;  2HST A;  1L3V A;  3IS9 A;  3OY9 A;  4KV8 A;  2YNG A;  1YT3 A;  1O13 A;  1HQU A;  1LV5 A;  2ZF5 O;  3O8M A;  2EHG A;  3JYT A;  2YHW A;  4PHT X;  1NBW A;  2D5R A;  3AVI A;  1NGI A;  3P4I A;  4YDU C;  1ZYQ A;  3E9P A;  1XMQ K;  4BR0 A;  3R6M A;  4DFK A;  1M90 O;  4CHY A;  3QEI A;  3ZSX A; 
#chains in the Genus database with same CATH homology
 2BAN A;  4H4O A;  3KLF A;  2BE2 A;  1SL0 A;  4J2D A;  3VQ8 A;  3OYM A;  3KLH A;  3DOL A;  2IDO A;  3LAK A;  1RT3 A;  3KD5 E;  3VQD A;  3VA3 A;  2PYL A;  2F8T A;  3CM6 A;  3L2V A;  4BAC A;  4GMJ B;  2Y1I A;  1S1X A;  3TAM A;  4JRP A;  1JLG A;  1JLC A;  4CEC A;  2I5J A;  4KFB A;  4LD0 A;  4Z4F A;  2YHB A;  1RBV A;  2XHB A;  4DU4 A;  4M3Z A;  1C0U A;  1JLQ A;  4FLY A;  3HST B;  2HB5 A;  4FLT A;  3SQ4 A;  3MXJ A;  4AHU A;  4YFU A;  4CER A;  2OA8 A;  1WSH A;  4G1Q A;  4CJW A;  2OYQ A;  1TK8 A;  3K2P A;  4CED A;  3C6T A;  4CJ3 A;  4BWJ A;  1BL3 A;  2OPS A;  4DTS A;  1NK5 A;  4C8N A;  3TAB A;  3ZSO A;  2PYJ A;  4ZTJ A;  4DLE A;  4DQR A;  4RW7 A;  3BGR A;  3VQ7 A;  4F2S A;  4CCH A;  1NOZ A;  1VSF A;  4DTP A;  3MAQ A;  3NE6 A;  1BCM A;  1MU2 A;  5KTQ A;  4C8L A;  4KHW A;  3HPH A;  1KVB A;  3B6O A;  4R5P A;  4E19 A;  1S1U A;  1HYV A;  3L8B A;  3DYA A;  3WNG A;  3OYG A;  3AO2 A;  3C95 A;  2ATQ A;  5DMR A;  4CFC A;  1KLN A;  3IG1 A;  3LAL A;  4I7F A;  3VA0 A;  4FLZ A;  1Y97 A;  4I9L A;  3V81 A;  2HND A;  3S9H A;  2A1R A;  1KVA A;  1XHZ A;  1CZB A;  3KD1 E;  4HVJ A;  1RNH A;  3QEV A;  3G10 A;  4B9L A;  1LWF A;  5D3G A;  1S6Q A;  3LP2 A;  4KPY A;  3OYC A;  4B8C A;  2KZM A;  4W5N A;  4CHP A;  1HYZ A;  4BDY A;  1VSJ A;  1TL3 A;  4FLW A;  1WSJ A;  3LPU A;  4AH9 A;  4O0I A;  5I3U A;  2JLE A;  3DLK A;  3QIP A;  3DLG A;  5J2N A;  2P51 A;  2XO7 A;  3T19 A;  2YV0 X;  1IKY A;  3MEC A;  1X9W A;  1U45 A;  2YNH A;  3NF6 A;  2NUB A;  4KHN A;  4KO0 A;  4CJ5 A;  3SNN A;  2O4I A;  1WLJ A;  4N76 A;  1LW0 A;  4O4G A;  5E41 A;  2A1S A;  3ZSW A;  2OZS A;  3QER A;  1ITG A;  4DTM A;  3U3Y A;  1L3S A;  4HHT A;  2FBY A;  1SKR A;  4KAZ A;  3OYL A;  1FXX A;  4DS4 A;  2FC0 A;  1C1B A;  3T1A A;  3ZT0 A;  3TAE A;  4TSX A;  5FRO A;  3OYJ A;  4DTU A;  3AV9 A;  4E3S A;  1Q9X A;  1SUQ A;  3ZSY A;  4OKJ A;  2XY8 A;  2GUI A;  5T7B A;  4W5Q A;  3UIQ A;  4JS4 A;  5SWM A;  4CJF A;  3MXI A;  1IKX A;  2EX3 A;  4BE1 A;  4NCA A;  3NDK A;  4DTX A;  3JSM A;  2Q3S A;  1RBU A;  4AHR A;  3RWU A;  4QOZ B;  2QKB A;  4Q5V A;  3DOK A;  4B9U A;  2HHQ A;  4CFA A;  1NK9 A;  1I39 A;  4FW2 A;  1VRT A;  1IKW A;  4BWM A;  1NKC A;  3CFR A;  4BDP A;  4CGI A;  3PX4 A;  3RR7 A;  3QIN A;  2RN2 A;  4IKF A;  1VSK A;  1KTQ A;  2ETJ A;  2D0B A;  4CJT A;  2DFE A;  4DU3 A;  3DLH A;  3HVR A;  4FLX A;  2W42 A;  4Q0B A;  3KK3 A;  3CQ8 A;  3PY8 A;  4FK2 A;  1GOC A;  1KRP A;  3L2U A;  3AA4 A;  2HNY A;  1RT6 A;  3AVH A;  4PQU A;  4O0J A;  4GW6 A;  1XHX A;  3DRS A;  2HHV A;  5EU7 A;  3DRP A;  4CJP A;  3V9W A;  4BE2 A;  4CF1 A;  2DTU A;  3SQ1 A;  1JLE A;  4OKE A;  3TWH A;  2G8H A;  1T7P A;  3NH2 A;  1T8E A;  1B9D A;  3HJF A;  3KKS A;  1G15 A;  4IFV A;  4HUE A;  1Q8I A;  4IG0 A;  3TAP A;  2XY5 A;  1DTQ A;  3WNE A;  3K5M A;  4KHQ A;  3HK2 A;  1WAJ A;  2VG5 A;  3ZT1 A;  3HPO A;  4Z4G A;  3D0P A;  2DFF A;  3K59 A;  4M42 A;  4DTJ A;  4KI6 A;  4HCC A;  4M3W A;  2OPP A;  3VQ4 A;  4ID1 A;  4KHU A;  2HHS A;  4HCB A;  2R7Y A;  4B9V A;  1ASV A;  4DSI A;  1GOB A;  4F3T A;  1SL1 A;  1LW2 A;  1HQE A;  1RTI A;  2B6A A;  5C24 A;  3L2W A;  4ELT A;  1NJY A;  3PX6 A;  1CXQ A;  5CZ2 A;  5HRP A;  3EY1 A;  4B08 A;  3HP9 A;  4E7J A;  2YHA A;  3CG7 A;  4CJR A;  3OYE A;  3AO3 A;  2BGG A;  4RW6 A;  3K58 A;  2D0A A;  1VRU A;  4FW1 A;  4KHY A;  5KRS A;  2KQ2 A;  4FLU A;  1ZBL A;  1UA1 A;  3K5N A;  5HRR A;  4DLG A;  2BDP A;  4ELU A;  2XY6 A;  1J54 A;  3KTQ A;  4CJ4 A;  1JLA A;  3QLH A;  5J2M A;  1BQN A;  2KZZ A;  4B9T A;  4OGC A;  1KVC A;  1S5J A;  4CGF A;  1TKT A;  1NK8 A;  4DSL A;  1NOY A;  1NK6 A;  1D9F A;  4Z0U A;  4KTW A;  1U47 A;  4E1M A;  1HYS A;  1EP4 A;  1QSL A;  1DLO A;  4CHQ A;  3OYN A;  4DS5 A;  3AO1 A;  4CHN A;  3V1Q A;  4DSF A;  4E7L A;  1NJW A;  5K14 A;  4J2B A;  3U3G A;  3PO5 A;  4KB0 A;  3PX0 A;  1TV6 A;  4F4K A;  2KFN A;  1REV A;  2E6L A;  2PY5 A;  3VQQ A;  1C1A A;  1RT4 A;  3NF7 A;  3SI6 A;  1KFS A;  4E7K A;  4CEZ A;  5KGW A;  3OVN A;  3DLB A;  4CEQ A;  5CYQ A;  3DRR A;  4OPK A;  3CFP A;  3TAQ A;  1TAU A;  3IRX A;  5DK5 A;  3O4N A;  4FJ9 A;  2ZQB A;  4KI4 A;  1RDA A;  4N5S A;  3LPT A;  4DSE A;  2P5G A;  1A5X A;  4KTZ A;  4CEF A;  3LZI A;  3HXM A;  2VWJ A;  1BGX T;  4NYN A;  5J2Q A;  3RMA A;  1U49 A;  1X9M A;  2GBZ A;  1C0M A;  1RTD A;  1IG9 A;  1RDB A;  1L3T A;  1D5A A;  2YKN A;  3L3V A;  4HTU A;  2HVI A;  1VSL A;  4W5T A;  4CJE A;  1HNV A;  2ZE2 A;  4CJL A;  1NJZ A;  3LZJ A;  4JS5 A;  2OPR A;  3DMJ A;  1RT1 A;  1VSD A;  3VQA A;  4AHS A;  4H8K A;  4DQQ A;  4K8X A;  1NK7 A;  5HP1 A;  5FDL A;  5HRS A;  3OJS A;  1QSY A;  4CES A;  1HMV A;  4FJM A;  5JS2 A;  4EP5 A;  4ZHR A;  3OJU A;  1CXU A;  3SQ0 A;  1QQC A;  1WSG A;  1BCO A;  3ULD A;  4M3T A;  4OLA A;  1JLB A;  2IC3 A;  4MFB A;  4CF0 A;  5SZT A;  3KLI A;  3AA3 A;  4M3R A;  4FJ7 A;  4QCL A;  3V9U A;  2X78 A;  5CZ1 A;  3L2Q A;  4DF4 A;  4CEE A;  1RT7 A;  3O4Q A;  3K5O A;  4Z4C A;  3LP3 A;  3NH1 A;  3AVB A;  3KIO A;  3OYH A;  1VSI A;  4RW4 A;  1TK0 A;  2P5O A;  3ZT3 A;  4Z4E A;  1BIU A;  1O1W A;  3V9S A;  4FM2 A;  3M8S A;  4W5R A;  1VSH A;  3QEP A;  2FBT A;  3DM2 A;  3KK1 A;  4FLV A;  4J2E A;  3AVK A;  4CK3 A;  3ITH A;  1LAV A;  3PUF A;  3VQ6 A;  1RDD A;  1BI4 A;  3LP1 A;  5CYM A;  3MED A;  4CIG A;  1KFD A;  3OYB A;  3MEE A;  3VQC A;  1IH7 A;  3P1G A;  3AVM A;  3SUN A;  3M8P A;  5HBM A;  1HRH A;  3EYZ A;  4B3O A;  4CIF A;  1B9F A;  5J1E A;  3RMC A;  1QSS A;  1TVR A;  4C8M A;  1WSE A;  4AHC A;  4M41 A;  4MQ3 A;  1NK0 A;  3OYF A;  4DTO A;  1VSM A;  3SUQ A;  4CE9 A;  1BQM A;  1YTA A;  4RW8 A;  1Z25 A;  1LWC A;  2ITG A;  1A5W A;  2IAJ A;  2GV9 A;  2OPQ A;  4BE0 A;  3O3G A;  2KW4 A;  4B9M A;  4FJH A;  2YKM A;  1CZ9 A;  4DQS A;  3I0S A;  4O5B A;  1SKS A;  4F8R A;  1EXQ A;  4FJN A;  4DFJ A;  1QTM A;  1QS4 A;  4IDK A;  4FM1 A;  4CGG A;  4NCB A;  4DFP A;  4C8K A;  1N6Q A;  3ALY A;  4PWD A;  3RRH A;  3AVL A;  1TK5 A;  4CJQ A;  4DSJ A;  3OYD A;  1EKE A;  4FJ5 A;  4KB1 A;  5J2P A;  2B5J A;  3QIO A;  4CHZ A;  5CY4 A;  3AVN A;  1LWE A;  1S1V A;  3DLR A;  2IS3 A;  4CK2 A;  3SPZ A;  4DWI A;  3LP0 A;  5KRT A;  3S3M A;  4IFY A;  5FRM A;  1SL2 A;  1QHT A;  4ZTF A;  3NGY A;  1NKE A;  4OLB A;  3LWM A;  4N47 A;  3RR8 A;  4FJG A;  2G8I A;  3NAE A;  3AO5 A;  1BHL A;  1RCH A;  4CGH A;  3RRG A;  2YNF A;  2HVH A;  3NHG A;  1RIL A;  3QES A;  5KI6 A;  3CFO A;  3ZSV A;  2X6N A;  4C8O A;  3VN5 A;  4CGD A;  4KKO A;  2G8V A;  3KJV A;  1ASW A;  1I3A A;  2QXF A;  1VK0 A;  1L5U A;  2F96 A;  2X74 A;  3FFI A;  4OJR A;  1RTJ A;  4CEB A;  4OPJ A;  4CFD A;  3WNF A;  4DQP A;  4FK0 A;  4CEO A;  3NF9 A;  1FKO A;  1Z26 A;  1YTU A;  3I0R A;  3LAM A;  2F8S A;  3KLG A;  1J5O A;  3V1O A;  1WSF A;  4O55 A;  1B92 A;  3AVF A;  2FBX A;  4KTQ A;  3ZSQ A;  1JL1 A;  3HYF A;  3TR8 A;  2IOC A;  3HVT A;  2YNI A;  3KK2 A;  1GOA A;  4DF8 A;  1L3U A;  1C6V A;  2IGI A;  2AJQ A;  1JXE A;  3LAN A;  4EP4 A;  3V9Z A;  4N41 A;  3DLE A;  4EZ9 A;  3HL8 A;  3OYI A;  4RG8 A;  3WNH A;  1TL1 A;  1ZBU A;  3ASM A;  1R0A A;  3QO9 A;  1ZBH A;  4FZY A;  2QKK A;  4OKK A;  4I9Q A;  1TGO A;  4CJK A;  3ZCM A;  3SUP A;  1FKP A;  3OS1 A;  1KLM A;  1TKZ A;  2HHW A;  2B4J A;  3AO4 A;  2G8F A;  3VQ5 A;  3SV4 A;  3TAF A;  4BDZ A;  3NF8 A;  3A2F A;  1HJR A;  3V9X A;  3L2R A;  4FJJ A;  4KRE A;  1SV5 A;  4DMN A;  4FJL A;  1EX4 A;  5JS1 A;  4FCY A;  3C94 A;  3MXM A;  4CJV A;  3AVA A;  4M45 A;  1YVU A;  1QE1 A;  3OYK A;  3OYA A;  4OVL A;  3HT3 A;  1EET A;  1IKV A;  1BI4 B;  1UOC A;  3SYZ A;  4AIL C;  4KHS A;  1N5Y A;  1S1W A;  1RBT A;  5HRO A;  4HUG A;  4DQI A;  1Q9Y A;  4FXD A;  2P1J A;  3QNN A;  3HO1 A;  4O44 A;  3V6D A;  3S3O A;  4FZZ A;  1JKH A;  4QAG A;  1C0T A;  4GVM A;  4AHV A;  4B9N A;  3M8Q A;  4J2A A;  3SV3 A;  3QNO A;  4FJK A;  1ASU A;  3CYM A;  3NBP A;  3OS2 A;  2LSN A;  2XRI A;  3B6P A;  4AHT A;  4CJU A;  3SZ2 A;  4F3O A;  4CIE A;  3ZSR A;  1C1C A;  4N56 A;  4CGJ A;  3VQP A;  4M3X A;  3D45 A;  1TKD A;  1W9H A;  1HNI A;  3LWL A;  2O4G A;  3ZSZ A;  1VSE A;  4NYF A;  3ZT4 A;  4CJS A;  2QK9 A;  3ZT2 A;  4I2Q A;  2WOM A;  4ELV A;  1IO2 A;  4IBN A;  4W5O A;  4B9S A;  4DSK A;  2VG7 A;  3NGI A;  3RTV A;  4JRQ A;  3AA2 A;  3P83 D;  2PZS A;  3SJJ A;  4HUF A;  4JLH A;  5I42 A;  3M8R A;  2OZM A;  4FVM A;  3S3N A;  1FK9 A;  1ZBI A;  4UQG A;  3CM5 A;  3F9K A;  3DI6 A;  5KGX A;  3O3H A;  4OGE A;  4CHO A;  1T03 A;  1WN7 A;  2DFH A;  4F2R A;  1WSI A;  1WNS A;  3V4I A;  2G8U A;  4LSL A;  4M3Y A;  2RPI A;  3LDS A;  4CK1 A;  1XWL A;  3NGZ A;  3RMD A;  1X9S A;  2KTQ A;  3NFA A;  4DTN A;  2Z1J A;  1RTH A;  4DG1 A;  5C25 A;  2HW3 A;  3QEW A;  3RMB A;  2E4L A;  4E0D A;  1T05 A;  1RT2 A;  2HHX A;  4IG3 A;  1LAW A;  1NJX A;  3T3F A;  1XI1 A;  2RKI A;  1UAX A;  1J53 A;  1J9A A;  1S6P A;  2X6S A;  3P5J A;  3U6F A;  4DTR A;  4LH4 A;  1S9E A;  3QET A;  4E1N A;  2JGU A;  4M3U A;  3HM9 A;  1SKW A;  4LY7 A;  2HNZ A;  1JXB A;  3VQE A;  3I8D A;  1F21 A;  3F73 A;  2VWK A;  3SCX A;  4RW9 A;  4WE1 A;  1S9G A;  1CLQ A;  3BDP A;  3HPG A;  4Z4I A;  3SUO A;  4LH5 A;  2ZD1 A;  4PY5 A;  1DTT A;  4DFM A;  4E7H A;  4E89 A;  5C42 A;  4H4M A;  2HHU A;  2Z1I A;  2Z1G A;  1WAF A;  3TAN A;  1BIZ A;  4FJ8 A;  4YNQ A;  3K57 A;  3TAR A;  1RBS A;  4CF8 A;  1W0H A;  2Z1H A;  3L3U A;  3TI0 A;  3AVG A;  1UA0 A;  1U4B A;  4FYD A;  3QEX A;  2FBV A;  1RT5 A;  4ICL A;  3IAY A;  4CFB A;  1KSP A;  4CEA A;  4FZX C;  4B8A B;  1D8Y A;  2Y1J A;  1XC9 A;  2WON A;  4Z4H A;  4ID5 A;  4I2P A;  1HPZ A;  1TAQ A;  1UWB A;  1NK4 A;  2G8K A;  4CF2 A;  3AVJ A;  1RBR A;  2RF2 A;  2KFZ A;  3H08 A;  3EZ5 A;  3SQ2 A;  2HMI A;  4PUO A;  4CF9 A;  1D9D A;  4NCG A;  4Y1D A;  4XIU A;  4LSN A;  4L8R B;  2G8W A;  4DU1 A;  3O3F A;  3PV8 A;  2HHT A;  4K8Z A;  3AA5 X;  1U48 A;  4FJX A;  3AVC A;  1JLF A;  1TKX A;  1K6Y A;  4Y1C A;  3TAG A;  1NKB A;  3MEG A;  4PA1 A;  2DY4 A;  4FM0 A;  1JL2 A;  1X1P A;  2VG6 A;  3K5L A;  3KLE A;  1KCF A;  3PO4 A;  2XY7 A;  3V1R A;  5FRN A;  4EZ6 A;  3VQ9 A;  5HRN A;  1ZBF A;  2E6M A;  1L3V A;  3IS9 A;  3OY9 A;  4KV8 A;  2YNG A;  1A5V A;  1RDC A;  1U04 A;  1YT3 A;  3E01 A;  4E7I A;  1HQU A;  3ISN C;  1LV5 A;  1S1T A;  4KRF A;  5HLF A;  3OS0 A;  2EHG A;  3JYT A;  3C6U A;  4FJI A;  2D0C A;  2D5R A;  3AVI A;  4FK4 A;  3G0Z A;  3THV A;  1ZYQ A;  3VQB A;  3SPY A;  3NCI A;  3ZSX A;  4DFK A;  3NH0 A;  4CHY A;  3QEI A;  1BIS A;  3HP6 A;  3KKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...