4CFBA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfbA00
3OYJA 3L3VA 4FVMA 4KAZA 1VSEA 4FJ9A 5FDLA 4ICLA 4L8RB 1RT6A 2ZE2A 3NF6A 1RBTA 4M3RA 3OYFA 4FLZA 1HNVA 1TKZA 4BDYA 4DTRA 3KLFA 4BDPA 3AVJA 1FXXA 3K57A 2KZZA 3HP9A 4DSJA 4IFVA 1N5YA 2BGGA 1TKDA 3LALA 4DG1A 3LWLA 5KGWA 1VSKA 3LP3A 4CJWA 3QEXA 4DSKA 1BIZA 4DU3A 1NK4A 4CCHA 4E7JA 2G8VA 4DU4A 3NHGA 1XI1A 3MEGA 1U4BA 4Z4FA 1Z25A 3VQ4A 4CJTA 4CEZA 1RT4A 3O3GA 3HPOA 5EU7A 4O0IA 3E01A 3O4NA 3ZT1A 4EP5A 3ASMA 3SYZA 4PUOA 4LD0A 4MFBA 3AO1A 4JRPA 4KHQA 3AVLA 4PA1A 4EZ6A 5KRSA 4O4GA 3KK1A 4ZHRA 4B8AB 1IKXA 3VQ9A 4F8RA 1A5WA 4CGHA 3DLRA 5K14A 4FLVA 4NYNA 2DFFA 3LZJA 1VSFA 3HJFA 2R7YA 2ATQA 4CJKA 4Z4CA 4Y1DA 1N6QA 3DOKA 4J2DA 3V4IA 4FJLA 4W5NA 4DQIA 1BHLA 4E19A 4Z0UA 4FJGA 3B6PA 1BGXT 3QO9A 5DK5A 2KFNA 4BE2A 1HMVA 4KTWA 3TARA 4PQUA 3VQPA 3VQ7A 4FLWA 3TR8A 3U3GA 3V1QA 1CXUA 3VQAA 3NH0A 3OY9A 3K5LA 1RT1A 3KLIA 4OLAA 2HVHA 3MXMA 4B9SA 4FJHA 2ZD1A 1JLGA 4MQ3A 4Z4IA 4DTSA 3BDPA 1REVA 4QOZB 1EKEA 4BWJA 3NGZA 1LW0A 1RDAA 2OPPA 4GMJB 4HUEA 4FCYA 3MXIA 3ZSRA 4HUFA 4FZZA 3U3YA 3T1AA 4CGJA 1A5VA 2PZSA 2XY8A 1YTAA 3L2RA 3DLBA 5CYQA 4CJ3A 4N76A 4NCBA 4AILC 1I39A 2IOCA 4FXDA 1S1WA 4CJEA 2G8KA 3EZ5A 4CHQA 4LH4A 3M8QA 3MEEA 4DSFA 3LANA 1SL2A 3DM2A 3NFAA 4I7FA 4QAGA 4J2AA 1WSFA 1TL1A 1RBVA 1VRTA 2E4LA 5J1EA 2XO7A 5HRRA 3CG7A 3G10A 4RW7A 1QS4A 2WOMA 4DLGA 3KKSA 2D5RA 4ELTA 3ZSZA 1ASVA 4KRFA 2B6AA 1U45A 1SL1A 2FBYA 2FBVA 1RBSA 3AVBA 4KB1A 3CFPA 5KGXA 3O3HA 5C24A 4FJJA 1EETA 1S1UA 4DQRA 4CJRA 2OA8A 1S5JA 1WAFA 3ISNC 1MU2A 4DU1A 4CGGA 1KFSA 1YT3A 4DTOA 3QETA 4KTQA 3VQ8A 4FJIA 1J5OA 1TAQA 1ZBFA 5SZTA 3AA5X 4CERA 1X9SA 1X1PA 2VG5A 3AVFA 3KK3A 1VRUA 3OYHA 2HHTA 1K6YA 4HCCA 2EX3A 4IFYA 3ZCMA 4B9TA 1XHXA 2LSNA 3SUOA 1HQEA 1O1WA 3ULDA 4CF9A 1D8YA 1KVBA 1VSDA 5KTQA 3OYBA 4XIUA 1RBUA 3AV9A 4FLTA 3TAFA 1WLJA 3AA3A 2HNYA 4E89A 4F3TA 4KO0A 4OPJA 3FFIA 5JS2A 1Q9YA 4PY5A 3AA2A 3KKRA 4W5QA 1QE1A 3SUQA 5HRSA 4O55A 1RTIA 3HYFA 4CEBA 4F4KA 4H8KA 4B9LA 2F8TA 3O4QA 4NCAA 3DOLA 1SV5A 4JRQA 2YV0X 5DMRA 1VK0A 4KKOA 1SKRA 4BE1A 4E1MA 2YNFA 3M8PA 4M3ZA 3SUNA 1TVRA 4B9UA 1RT2A 4CECA 1SUQA 4FLUA 5JS1A 4LH5A 1BQNA 3ALYA 3ITHA 3V9SA 4CGIA 4HVJA 4KI6A 4KHYA 3F73A 1DLOA 3F9KA 3LPTA 4OKKA 3NBPA 4R5PA 1LV5A 3BGRA 2B5JA 5FRNA 2WONA 3OJSA 1HNIA 1KLNA 4CJSA 1BCMA 4LSLA 1D9DA 4O5BA 3C95A 3HVTA 3PY8A 1RDBA 2D0AA 4IKFA 4BWMA 3AVIA 1UAXA 4I2PA 2HVIA 3IRXA 3ZSYA 3ZT3A 3V1RA 4CEDA 4DSEA 1Y97A 3CM5A 1W9HA 3QERA 5HRPA 1WSJA 4M42A 3AVNA 1NJYA 1J53A 2HHUA 1ASWA 2EHGA 5I42A 4FZXC 3TAPA 1I3AA 1TK0A 4M3TA 3T3FA 1LAWA 4M3WA 1KRPA 3NCIA 2KQ2A 4EZ9A 4Z4HA 4DTUA 3RRGA 1RTJA 5J2NA 2XRIA 3AVCA 3TABA 4M45A 4IDKA 1J9AA 4W5RA 4DTJA 1Q9XA 3IG1A 4ID5A 3TAQA 2X6NA 3PUFA 1C1BA 3VA0A 3DLGA 4G1QA 4CEEA 3HXMA 1C1AA 2IGIA 2OPSA 1FKOA 1JLFA 2X6SA 3A2FA 4IBNA 3LP2A 4CF8A 3TWHA 2A1RA 2QKKA 3K2PA 3PO5A 1GOBA 2X74A 4C8KA 3SV4A 1RCHA 3RMBA 2W42A 1KVCA 4E0DA 3OYEA 2XY5A 1TV6A 2HNZA 1A5XA 4B9NA 3V6DA 3QEPA 2Y1JA 2OPQA 2YNGA 1IG9A 3HSTB 2VWJA 1ZBUA 3PX0A 4AHUA 3K5MA 5HBMA 3HM9A 4ZTFA 4FK4A 3VN5A 1JLEA 4JLHA 1IH7A 1KFDA 5HP1A 1EXQA 3ZT2A 3OS1A 4OLBA 4FW2A 4DTPA 2XY7A 3SQ4A 1BI4B 2OYQA 4HCBA 3NDKA 3OJUA 4B08A 3T19A 5J2QA 2OZMA 4FK2A 1HYSA 2VWKA 3SNNA 3OYIA 2HHQA 3JSMA 1ZBIA 3DRSA 4LSNA 2QKBA 3ZSXA 3NF7A 4CHYA 5I3UA 3WNHA 1VSLA 3KLGA 5CY4A 1NK6A 1L3VA 4CESA 1JLQA 1JLAA 1WSEA 1Q8IA 1TK8A 3NF9A 4IG3A 3V81A 3V9UA 3SUPA 5HLFA 3OYGA 2IS3A 2B4JA 1L5UA 4CEQA 1B92A 1C6VA 1GOCA 2VG6A 3ZSQA 3VQCA 2I5JA 3SV3A 1UA0A 3OVNA 1T8EA 3M8RA 1NJZA 1HYZA 4CGDA 1BCOA 4OKEA 4BDZA 2Z1GA 2AJQA 4B8CA 3OYKA 4RG8A 1NOZA 3P83D 4CJ5A 3SI6A 3QINA 1S9GA 4E1NA 4CIEA 4KHUA 3MEDA 3NAEA 1U48A 1KCFA 4LY7A 4CK3A 1X9WA 4FJ8A 3DMJA 2JLEA 4CFAA 2DY4A 3OS0A 1Z26A 1S1XA 4C8NA 3DLKA 3UIQA 1JLCA 4Y1CA 3AO3A 2Z1IA 3WNEA 3KIOA 2IDOA 4E7HA 1WN7A 1G15A 1B9DA 1D5AA 3HVRA 3CYMA 4FK0A 1HRHA 1C1CA 1BIUA 5KI6A 2HB5A 2G8HA 4DF4A 3OYDA 1NJWA 1UA1A 1QSYA 1QSSA 1WSIA 1VSHA 4RW9A 4M41A 3LWMA 3LP0A 3KTQA 4FJMA 3H08A 4M3YA 2QK9A 4FJXA 4BACA 2BDPA 1B9FA 3SQ2A 3S3MA 3NGIA 1QSLA 3S3OA 4E7LA 3HK2A 3QIOA 2G8WA 1WSGA 1DTQA 3DI6A 2FBXA 3P1GA 3NF8A 1KSPA 3HO1A 3SQ1A 2YHAA 3KLHA 1ZBHA 4QCLA 2E6MA 4Z4EA 4DSLA 3WNFA 4CF1A 3SCXA 1RDDA 3SPYA 4DQSA 1NJXA 4FJ7A 3I8DA 2OPRA 1QHTA 4OGCA 2P1JA 4M3UA 4I2QA 4OKJA 3HPHA 4OVLA 3RMCA 4CJQA 4O44A 3C94A 1JKHA 1KTQA 4FJ5A 3LAMA 3LP1A 4E7KA 3ZSWA 3B6OA 3PX4A 1S6QA 3L8BA 3DLEA 4FW1A 1ZBLA 4KB0A 3DRRA 4Z4GA 4HTUA 3SJJA 4CK1A 1JXBA 3LPUA 1NOYA 5C42A 3V9XA 1JXEA 1RT3A 4AHVA 3KLEA 3TAEA 2P5GA 3NGYA 3VQ5A 4CHPA 4FYDA 4DF8A 3I0RA 2BANA 3DYAA 3VQBA 4DS4A 3VA3A 4GVMA 3KJVA 3QIPA 3U6FA 1C0MA 1NK9A 4B3OA 3RR7A 2JGUA 1S6PA 3TANA 1NKBA 3QNOA 4F3OA 5E41A 3K5OA 4FZYA 4KHWA 1NK8A 1JL1A 3QEVA 3RMAA 1D9FA 1TKXA 4B9VA 4CHNA 4YNQA 4Q0BA 3HL8A 2KW4A 1TGOA 3OYLA 1RBRA 4N5SA 3RTVA 1IKYA 3QLHA 1SKSA 3TAMA 4CEFA 4N56A 1TK5A 1NKEA 1YVUA 3RRHA 4J2BA 3EY1A 4ID1A 4KFBA 4HHTA 4BE0A 3LAKA 4KV8A 4KREA 2P51A 3CFRA 5FROA 4AHCA 4I9QA 5D3GA 4H4MA 4AH9A 2RF2A 3TI0A 4FJKA 2YNIA 4CHOA 4M3XA 4J2EA 2O4IA 1W0HA 1TAUA 3AO4A 4DMNA 2YNHA 3L2UA 3MAQA 2XY6A 5J2PA 1VSJA 3LZIA 4DQQA 3VQDA 4E7IA 4EP4A 2E6LA 1R0AA 2RN2A 4FM0A 2XHBA 2YHBA 4DFJA 4NCGA 3ZSVA 4DFMA 1NK7A 1HQUA 2HHSA 2IAJA 5C25A 2GUIA 1BQMA 2D0BA 4DFPA 4KHNA 2VG7A 4N41A 4CF0A 1SKWA 3G0ZA 1C0TA 3NE6A 1TL3A 4FM1A 1BL3A 2HNDA 4DS5A 3V9WA 5HRNA 2GBZA 2Y1IA 4RW8A 1U49A 2X78A 4CF2A 4C8OA 1ITGA 3CM6A 5CYMA 4CEAA 2Q3SA 4N47A 4CJVA 2KTQA 2Z1HA 1UWBA 2FBTA 3PX6A 3C6TA 1UOCA 1CZBA 4GW6A 4FJNA 3DRPA 4NYFA 2ITGA 4KTZA 4CFDA 4CE9A 3D0PA 3IS9A 2YKNA 5T7BA 1KLMA 1S1TA 2Z1JA 3AVKA 3NH1A 4JS5A 2GV9A 3QESA 3IAYA 4KI4A 4HUGA 4CIFA 2D0CA 2DFHA 1CLQA 1JL2A 4JS4A 3SPZA 3SZ2A 4KPYA 2O4GA 1DTTA 1WSHA 3HPGA 3OYAA 3V9ZA 4DLEA 4O0JA 3VQQA 3SQ0A 3RWUA 4C8LA 2PY5A 4K8XA 4OPKA 5HROA 2HHWA 4DQPA 1CXQA 2G8UA 1WNSA 4CGFA 3OS2A 3HP6A 3RR8A 4CIGA 2ETJA 3AA4A 2BE2A 3S3NA 4F2RA 1FK9A 2ZQBA 3KD5E 1LW2A 1QQCA 3L3UA 1ZYQA 1NK5A 1T05A 2KFZA 3QEIA 1LWCA 5CZ2A 1L3SA 3CFOA 1C0UA 1S1VA 3AVGA 4CJPA 3L2WA 4RW4A 4CJFA 5FRMA 4CK2A 3PO4A 4AHTA 3L2VA 1EP4A 3NH2A 4ZTJA 3JYTA 3OYNA 3M8SA 4TSXA 4I9LA 3THVA 1IO2A 1HYVA 2DFEA 4AHSA 4YFUA 1U47A 1L3UA 1RTDA 3KK2A 3V1OA 4E3SA 4DFKA 3L2QA 1J54A 1ASUA 3D45A 4IG0A 2IC3A 3ZT4A 3AO2A 1NK0A 3VQEA 4CFCA 4CJUA 3OYMA 1HJRA 2F96A 3CQ8A 4CHZA 1F21A 2RKIA 1NKCA 5SWMA 1RT5A 1XWLA 3S9HA 3AVAA 4FM2A 4PWDA 3OYCA 3DLHA 4CEOA 3P5JA 3O3FA 1RILA 1FKPA 4DWIA 4ELUA 1U04A 3ZSOA 1RTHA 4FLXA 1X9MA 3MECA 2P5OA 1JLBA 1IKVA 3K58A 1L3TA 4B9MA 5CZ1A 2OZSA 2G8IA 2HHXA 2RPIA 5J2MA 2HHVA 4OJRA 3C6UA 4CJLA 4DTXA 1YTUA 2QXFA 3I0SA 5KRTA 2HW3A 4UQGA 3EYZA 1LWEA 3MXJA 4H4OA 1BI4A 1BISA 1KVAA 3K59A 3LDSA 3QEWA 4C8MA 1EX4A 1LAVA 1VSIA 3ZT0A 4CFBA 4W5OA 3K5NA 4Q5VA 1CZ9A 3KD1E 1T03A 1XHZA 4RW6A 3TAGA 1T7PA 4K8ZA 4DSIA 4KHSA 3RMDA 1WAJA 3AVMA 4WE1A 4ELVA 4OGEA 1RT7A 3AO5A 3VQ6A 4W5TA 2F8SA 2YKMA 2A1SA 1RDCA 3WNGA 4DTMA 1XC9A 1RNHA 1IKWA 3AVHA 3PV8A 2PYJA 4CJ4A 4DTNA 4FLYA 1S9EA 1VSMA 1TKTA 4F2SA 2HMIA 1QTMA 2PYLA 1GOAA 2KZMA 3HT3A 1SL0A 1HPZA 1LWFA 2NUBA 2DTUA 2G8FA 3QNNA 2FC0A 4AHRA
chains in the Genus database with same CATH superfamily
3NF6A 4BDPA 2KZZA 4A5AA 4DG1A 1VSKA 3LP3A 1G99A 4JKGA 1XI1A 4FOEA 3EN9A 4CZGA 4EP5A 3O4NA 3ZT1A 3ASMA 1KXPA 3WXJA 2Q1NA 5AQYA 3T1HK 4KHQA 4PA1A 4EZ6A 5KRSA 1HKGA 2E2PA 4ZHRA 3VQ9A 4JKCA 3AARA 3R1XA 3ZEUB 4NYNA 3MX5A 4X62K 1NGEA 2NRXA 2ATQA 1R59O 4J2DA 1BHLA 4E19A 3O8MA 1BGXT 2A40A 4BE2A 1HMVA 4PQUA 5M1NA 1NGGA 3D7EO 5M1QA 3TR8A 2QWQA 1XNQK 5BPNA 1RT1A 3KLIA 5BR9A 3H3OB 4B9SA 3PSFA 1JCGA 4CZJA 2FSNA 3BDPA 2O8FA 4MLHA 1RDAA 2OPPA 4GMJB 4IFEA 2E20A 2W41A 4N76A 2GWKA 1I39A 2IOCA 2Q0RA 5EXWA 1OH6A 4LH4A 1TUYA 2P9KB 4HTLA 4YHHK 4BC5A 1JCFA 4I7FA 5M1PA 2QXLA 4H5VA 4QAGA 4J2AA 3CXCM 2XO7A 1EO1A 3P31A 5HRRA 3CG7A 4DLGA 2D5RA 1ASVA 2B6AA 1SL1A 2FBVA 5KGXA 3JAMO 4JKDA 3T7ZA 1WAFA 1NM1A 4A61A 1YT3A 2GTDA 4DTOA 1U2VB 1ZBFA 3MWPA 3AVFA 3EE9A 3KK3A 5AQOA 1K6YA 3HOSA 4H0TB 2BH1A 1HQEA 3VF2A 2VWBA 3ZETA 5FPNA 4FLTA 4IZ9A 1WBDA 4E89A 4KO0A 5JS2A 1Q9YA 4BC4A 4PY5A 3AA2A 1RTIA 4CEBA 1QHAA 3ENOA 4CZEA 4JRQA 3UE5A 5DMRA 4X66K 1SKRA 4BE1A 2YNFA 3SUNA 4BVOA 5I9EB 4FLUA 1SUQA 1NNEA 5JS1A 3ALYA 3V9SA 4KI6A 4HVJA 4KHYA 1DLOA 1LV5A 3BGRA 2B5JA 5AQLA 3OJSA 4GV9A 4CJSA 2CH6A 1D9DA 4K41A 4O5BA 3C95A 3EL2A 4BRAA 4FWRA 3AVIA 2Q97A 1UAXA 4DSEA 1Y97A 1MA9B 2HHUA 4FZXC 1I3AA 4K0KK 5JMVA 3N4PA 3NCIA 3RRGA 4JI6K 2XRIA 2A3ZA 3TABA 1J9AA 4W5RA 4JI0K 3LM2A 4BQZA 4DR3K 1S22A 3VA0A 4G1QA 3HXMA 2PFUA 2OPSA 2X6SA 3LP2A 5AQSA 2X74A 4CW7B 2NZTA 2W42A 2FSJA 4UY8O 4FO0A 4DR2K 4AM7A 3PLAA 2OPQA 1IG9A 1VHXA 4H5TA 3PX0A 4MO4A 4IO8A 4PKGA 2ASMA 2OCEA 5HP1A 2OYQA 4DTPA 2XY7A 5AFUH 4B08A 3I8BA 3OYIA 1ZBIA 3DRSA 3ZSXA 5JVHL 3WNHA 3KLGA 4GKKK 4DR1K 1L3VA 4NO7A 1JLAA 1Q8IA 1QQMA 3TTFA 3OYGA 2VG6A 1O13A 4DV1K 3OVNA 3M8RA 3EZWA 4OO1J 2J4RA 4A62A 3THWB 3OYKA 1NOZA 3QINA 5FPDA 5IWAK 3MEDA 5KQ8A 4CK3A 1VAZA 4RTFD 2KHOA 3UIQA 3HRGA 3AGKA 3WNEA 2IDOA 4E7HA 5LMUK 1G15A 1GLLO 1BIUA 4DF4A 3VERA 1QSSA 1WSIA 2GEMA 4FOIA 5M1KA 3H08A 3HM8A 2BDPA 1VQ6N 3S3OA 2E1YA 4B3MK 3QIOA 2G8WA 3ZEUA 4B1UB 1DTQA 4CZIA 4YOWA 1NGHA 3CCVN 3SQ1A 1LOTB 1NGIA 3KLHA 2OPRA 1KAYA 3I56N 4OGCA 2O8DB 4M3UA 4I2QA 3C94A 3HZ6A 1JKHA 4E7KA 3PX4A 1ZBLA 1BDGA 3DRRA 4YOTA 2QW9A 4M7YA 4XH5A 2ZF5O 3DXMA 1NOYA 1JXEA 3VQ5A 3UB5A 2BANA 4GVMA 2E2NA 1C0MA 1NK9A 2JGUA 2P9KA 3QNOA 2HMPA 3K5OA 3VTIA 1JL1A 3RMAA 1D9FA 2QM1A 4CBUA 4CHNA 4YNQA 4Q0BA 3OYLA 4N5SA 3RTVA 1ATSA 1SKSA 1XQSC 1N34K 4CEFA 4J2BA 4HHTA 4A59A 4KREA 4B1WB 1U2VA 2Q2RA 1GLEG 2P9PB 1W0HA 4KH5A 4DCHA 1OH5A 2UUAK 2YNHA 2XY6A 4FPAA 3MX2A 2RN2A 4DFMA 1BQMA 1QVGM 4WFBL 4H0YB 3KK7A 3NE6A 3QICA 1BL3A 4DS5A 5HRNA 4RW8A 2YI1A 3BZKA 1ITGA 4PL7A 3LDQA 1UWBA 3PX6A 3C6TA 1UOCA 4CZKA 5EY4A 4FPBA 4GW6A 1HNXK 2ITGA 4JS5A 3OBWA 3QESA 2DFHA 1CLQA 4BRLA 3SPZA 3FZFA 3E1YA 1DTTA 1WSHA 4BRQA 4DLEA 3SQ0A 3J7YP 4C8LA 2PY5A 1NWKA 2G8UA 3RR8A 1OH7A 4CIGA 3VEWA 3S3NA 1QQCA 3L3UA 1NK5A 2W6KA 2KFZA 3QEIA 5LY3A 1L3SA 3CFOA 1TYQA 4WCEL 2ZJPL 3L2WA 5FRMA 2HBJA 4CJFA 4CK2A 5CHIA 3PO4A 4K25A 3NH2A 3OBYA 1IO2A 1HYVA 3KVGA 1GLDG 3KK2A 3V1OA 1RGIA 4E3SA 4DFKA 2V7ZA 5FLXO 1IV0A 1E4GT 2QWOA 3CQ8A 3CMEN 2RKIA 1NKCA 5SWMA 1MDUB 2PBDA 4PWDA 3OYCA 3DLHA 3SLCA 1Q7YO 3BZCA 4CEOA 3P5JA 5AFUA 3BF3A 3L6QA 2P5OA 5M1FA 4B9MA 3SBTA 1L3TA 5C2DA 4OJRA 1YTUA 4CJLA 2QXFA 5KRTA 3QMLA 4JK9A 3NVKA 1CZ9A 2JWKA 4JI3K 4EHTA 4KHSA 4BR2A 4JEPA 3TSUA 4WE1A 1YITN 4OGEA 2YKMA 4LF4K 4WFAL 1VQ9N 3PV8A 1DT9A 1S9EA 5EOYA 4OX9K 2FC0A 4IWVA 4BC3A 3L3VA 3M1FA 4FVMA 4BR9A 4FJ9A 5FDLA 1RT6A 2ZE2A 4FLZA 3MMVA 1HNVA 1TKZA 3K57A 2QWPA 4BGAA 1N5YA 1V4TA 2BGGA 1TKDA 3LWLA 3QEXA 4FWKA 1NK4A 4CCHA 4E7JA 1U4BA 1Z25A 1RT4A 3CPWM 4O0IA 4DV2K 3E01A 3SYZA 4BRPA 4LD0A 3AO1A 3ATVA 3ZX3A 5B8HA 3F2KA 4O4GA 4JKBA 3O6WA 3KK1A 3R9PA 4B8AB 3K0SA 5K14A 2DFFA 1GLJO 1VSFA 2R7YA 4CJKA 4BR7A 1FW6A 4Y1DA 3ID6A 1T6DA 4Z0UA 2UXBK 3M5RA 2GUPA 3VQPA 1BOTO 3GOIA 3AY9A 3V1QA 3HI0A 2CH5A 3VQAA 3NH0A 3OY9A 3K5LA 2UXCK 2O8DA 5EVZA 4OLAA 4BRNA 2HVHA 3VGLA 1SQKA 3LDNA 4MQ3A 1NGAA 2CGKA 3MN7A 3NGZA 4HUEA 1LW0A 3MXIA 4NLCA 2WUSA 1A5VA 1YTAA 3L2RA 4FWLA 4YOUA 4CJ3A 3UKRB 3FR0A 4BR0A 4E1JA 2G8KA 3P39A 4CHQA 3MEEA 4DSFA 1SL2A 5HL7L 3DLLL 3NFAA 3R6MA 3BUZB 1V4SA 1YUWA 1WSFA 5M1OA 1RBVA 3G10A 4ELTA 1QS4A 2WOMA 2W6LA 3KKSA 4GKJK 4KRFA 1NGDA 3ZSZA 1VQLN 1U45A 2RE2A 1I94K 1RBSA 4KB1A 2I7PA 3CFPA 2Q36A 3PSIA 4FWMA 3O3HA 1EETA 3NVMA 3E9LA 4CGGA 1ATNA 1KFSA 3VQ8A 4FJIA 4ILHA 5KPRA 1Z6RA 1TAQA 5AQPA 2VG5A 4XH4A 4IO9L 4RCHA 2QWRA 4B9TA 4IFYA 3ZCMA 5AQKA 2LSNA 3J81O 4DR4K 3ULDA 1D8YA 1BWFO 1KVBA 1X3MA 1ZBSA 3CJBA 1RBUA 3AV9A 2AA4A 4CZMA 4B3RK 2P9LB 3CF5L 3FFIA 2F4VK 2O8BB 4O55A 4JV5K 4DV5K 4NCAA 4LFAK 1HX1A 5AZIA 1TVRA 3THYB 5AQMA 3CC7N 3ITHA 4CGIA 4BRIA 4R5PA 4FWPA 2ZJQL 3F5TA 2D0OA 1CZAN 3HVTA 3HSCA 4IKFA 4BWMA 3ENBA 3O4WA 4WQ4A 4B1XB 4LC9B 3A5LC 3IRXA 4CEDA 3CM5A 3QERA 4M42A 1NJYA 1J53A 5E84A 5I42A 3TAPA 2F9WA 1TK0A 3T3FA 4M3TA 4LFCK 1KRPA 3VOVA 1NBWA 4Z4HA 1RDUA 4DTUA 2FF6A 4IDKA 5GIPA 3TAQA 3PUFA 3DLGA 4K43A 1X9JA 4LF6K 4CD3A 3A2FA 2A1RA 1JJ2M 4BRMA 1HUXA 3PO5A 3TPQA 3RMBA 3D2EB 3CPEA 3H46O 4E0DA 2XY5A 1TV6A 2HNZA 1A5XA 3O5BA 1J5EK 2IVPA 5C12A 3HSTB 2O8EB 5HBMA 3HM9A 3VESA 1YJNN 4AM6A 1EXQA 3OS1A 3U9ZA 5F1XA 1BI4B 1QZ5A 3SQ4A 3NDKA 3KZBA 1HYSA 3JSMA 4ILJA 3J7AP 2Q31A 4LSNA 3NF7A 3SMSA 4CHYA 5I3UA 1NK6A 3TTDA 3CCQN 5KPTA 1TK8A 2NRTA 4IG3A 3IUCA 3L0QA 4JHDB 3H1VX 1IBLK 3MN6A 3FE1A 1B92A 4YOYA 4JNEA 3ZSQA 4CGDA 1T44A 5BRFA 2OTJN 4CJ5A 1YJ9N 3SI6A 1S9GA 1WUAA 4FJ8A 1X9WA 4LF7K 2JLEA 1KQSM 1FJGK 1JLCA 1SZ2A 3C6AA 3FZMA 1WN7A 1D5AA 3WXMB 4FK0A 4A2AA 1HRHA 2O8CB 4OPHA 3GG4A 4AF1A 2G8HA 1NJWA 1UA1A 3KTQA 4M41A 2QK9A 4JK7A 1B9FA 4IOXA 4H5NA 1OKJA 3H1QA 2FBXA 3NF8A 1KSPA 3FZKA 2P9IB 4LFBK 2QI2A 4QCLA 3LL3A 4CF1A 3ZLJA 1NJXA 1IBKK 4FJ7A 3I8DA 2P1JA 2OANA 4OKJA 1WB9A 3O80A 1NGJA 3ZSWA 3B6OA 2P9SB 3DLEA 1MWKA 1DGKN 4HTUA 4JD2A 2A6AA 3SJJA 1HNZK 3VTHA 4LF8K 3LPUA 1Q82O 2P5GA 3CHWA 4CHPA 3SJHA 4FYDA 3CERA 1OVYA 2W40A 5IT9O 3VQBA 3UKRA 3KJVA 4X65K 1XMQK 4B3OA 5BN9A 1NKBA 3QEVA 3BY5A 2KW4A 2BTFA 1TGOA 1HJOA 2ZWHA 3RSEB 3QLHA 1IJJA 3ATUA 1NGFA 3TAMA 2F9TA 4N56A 1NMNA 4BE0A 1S72N 4KV8A 4BROA 4I9QA 1ILYA 4H4MA 4AH9A 4FJKA 4CHOA 3T1YK 5ELZA 1YXQA 3HTVA 4DMNA 3WUHA 1VSJA 4ISGA 2E6LA 1R0AA 4KBOA 4DFJA 2YHBA 2JWLA 3EKSA 5LL6Z 5C25A 2GUIA 2NRHA 2P9LA 4DFPA 4KHNA 2VG7A 4N41A 3G0ZA 3FGUA 1C0TA 4FM1A 4DR5K 4CF2A 4C8OA 2KTQA 2Z1HA 4FL9A 4B9QA 4BRKA 4MDAA 3THYA 3WEEB 4FJNA 3WXIA 4KTZA 1K73O 5BN8A 5GAHP 1S1TA 2Z1JA 3AVKA 3WXKA 3NH1A 3IAYA 4JS4A 4H0VB 4KPYA 3HPGA 3OYAA 3V9ZA 4O0JA 3VEZA 3DAWA 2EWSA 4OPKA 5HROA 4DQPA 1CXQA 4YDUA 3CJ7A 4WFNL 3OS2A 3HP6A 4R79A 2BE2A 1Y64A 5BPMA 3ZX0A 3IFRA 1W7AA 4RW4A 3ZX2A 5E26A 1EP4A 3M8SA 4TSXA 5DM7L 2DFEA 3EEQA 3THXB 2VGNA 1GLAG 4O8UA 3TSQA 4IG0A 4JI8K 3AO2A 1NK0A 4CJUA 3CC4N 3S41A 2F96A 3D2EA 1F21A 3ULEB 4FM2A 2CGJA 2HOEA 3J8AA 3K9KA 3O3FA 1FKPA 3CD6N 2O8EA 3QBWA 1RTHA 3MCAB 3SMPA 3MECA 4FLXA 1X9MA 1IKVA 2G8IA 2HHXA 3R3LA 2HHVA 3BP8A 3Q7BA 3I0SA 3W3DA 3GL1A 1BI4A 1BISA 4U67L 3LDSA 4G9ZA 3FZHA 3ZT0A 3C7NB 3KWIA 1T03A 1EWQA 1XHZA 4RW6A 3IMXA 1OVQA 5KPZA 3VETA 2GELA 3BEXA 3AVMA 4F9OA 2F8SA 1RDCA 1XC9A 3C0BA 1IKWA 3AVHA 5MLCQ 1VQNN 4WQ5C 4JHDA 1VSMA 1TKTA 4F2SA 2KZMA 1QTMA 4BQLA 1IG8A 1H1VA 1HPZA 1LWFA 1YAGA 3B8AX 2G8FA 3QNNA 4PL8A 3CCSN 4L8RB 4ICLA 1RBTA 4BDYA 1FXXA 3HP9A 4DSJA 3LALA 3QFPA 5KGWA 4CJWA 1BIZA 4DU4A 3NHGA 4OPAA 3VQ4A 2QWNA 4CJTA 4CEZA 2O8CA 3O3GA 3HPOA 3VEVA 2QWMA 2HBLA 4JRPA 2WBNA 4CGHA 4F8RA 4FLVA 3LZJA 3LDLA 3EKUA 1S3XA 3K9JA 3QO9A 3D2FB 2P9IA 3LDOA 4AQYK 3U3GA 1CXUA 3WQUA 2I7NA 3MXMA 4EIAA 4FJHA 3U9DA 4DV0K 4DTSA 4Z4IA 1EKEA 4FCYA 4FZZA 2PZSA 3T1AA 4JI2K 3QFUA 2XY8A 3DLBA 3QBXA 5CYQA 2IVNA 5H1SQ 4FXDA 1S1WA 4DB3A 4CJEA 5CR4A 3M8QA 3H6EA 3LANA 1JCEA 4WF9L 3DXKB 2E4LA 1P90A 4RW7A 2FBYA 3AVBA 1NGBA 1K8AO 1S1UA 3RSEA 1S5JA 3ISNC 1MU2A 4DU1A 3QETA 4KTQA 4LF5K 3SBGA 2ZJRL 1J5OA 1X9SA 1X1PA 2A5XA 2HHTA 4HCCA 1ATRA 1HNWK 4H5WA 1XHXA 3UKUB 3SUOA 1O1WA 4PKHA 1K9MO 4IDHA 4CF9A 5F0XA 5AQTA 3TAFA 2HNYA 5C2FA 4OPJA 4BY9C 4W5QA 3SUQA 3HYFA 5AJ3K 4H8KA 3DOLA 2YV0X 4WQ4C 4DKWA 2ZM6K 5AQFA 1YIJN 4B9UA 1RT2A 4CECA 3P4IA 3OHRA 3F9KA 1KD1O 3WEEA 1IBMK 5GAGP 4ISEA 1HNIA 2P9NB 1KLNA 4NLBA 2A42A 1BCMA 4LSLA 4BRHA 3THWA 5AQVA 1RDBA 2D0AA 5GAEP 2YHXA 2WC9A 4I2PA 2HVIA 3ZSYA 3V1RA 2E8AA 1WSJA 2RHKA 3AVNA 1LCUA 2HBMA 3C6HA 2EHGA 5AQQA 4WQ5A 1LAWA 2DPNA 4EZ9A 2KQ2A 3AVCA 4M45A 3IG1A 4ID5A 2X6NA 1C1BA 4CEEA 2IGIA 1FKOA 1JLFA 3TWHA 2QKKA 4EFHA 3K2PA 4DV7K 4I6MB 3E66A 1HR0K 4C8KA 1BU6O 1RCHA 4IOCL 1KVCA 1RDWX 3FLCO 1P8ZA 4JKHA 4B9NA 1KAZA 3V6DA 4B1YB 2Y1JA 3ZETB 1ZBUA 4AHUA 3G71N 4ZTFA 4FK4A 3AAQA 3VN5A 3G25A 1NMDA 4OLBA 4FW2A 4HCBA 3VF6A 3OJUA 3O9UA 4FK2A 3SNNA 3MDQA 3C7NA 1VSLA 3A5OC 3BF1A 5CY4A 1ZXOA 1WSEA 3V81A 4FSVA 4JKEA 3SUPA 3R8EA 1VQPN 2D4WA 3O9SA 1C6VA 1GOCA 3PIOL 3VQCA 1T8EA 3P38A 2OTLN 2ITMA 1HYZA 1ESVA 1BCOA 4BDZA 1YHQN 2HF3A 2Z1GA 4IXCA 4RG8A 5BPLA 1VQ5N 4KHUA 3NAEA 1KCFA 4LY7A 3DMJA 3OS0A 1Z26A 4O8KA 2QEXN 2Z1IA 3KIOA 5JLHA 3VEOA 5GINA 3HVRA 3CYMA 3G4SN 2P9PA 2HB5A 4C23A 3CQXA 1EQYA 1QSYA 1GLFO 1VQ8N 1VSHA 4H0PA 4RW9A 3LP0A 4FJMA 4DV3K 4BACA 3WXLA 3SQ2A 3S3MA 1QSLA 3O9TA 4E7LA 4Z94A 3DI6A 3CMAN 1QZ6A 1NU0A 5AQXA 2YHAA 1ZBHA 2E6MA 4U7BA 1VQ4N 3LM9A 3D2FA 3ID8A 5AQZA 1QHTA 2HBKA 3NMUA 3RMCA 1Q86O 1J6ZA 3LAMA 3LP1A 4FJ5A 4GV6A 4Z4GA 4BRGA 3AGRA 4CK1A 1DKGD 4YOVA 4AHVA 4CBWA 3I0RA 4DUZK 4DS4A 3VA3A 2BUPA 3QIPA 3U6FA 3RR7A 3CCJN 3HOTA 3TANA 2IVOA 4FZYA 4KHWA 1NK8A 5AQWA 1TKXA 4B9VA 3HL8A 1IKYA 2ASOA 1SS6A 1TK5A 4BR4A 3EY1A 4KFBA 4IEEA 3CFRA 5FROA 2YNIA 4M3XA 1BG3A 3AO4A 3WQTA 3UKUA 4XH1A 4JI5K 2NRZA 2XHBA 3A5MC 4NCGA 3ZSVA 1NK7A 1HQUA 2HHSA 2IAJA 4GV3A 2D0BA 2V52B 4CF0A 1SKWA 4XEIA 3L4QA 1HKCA 2HNDA 2GBZA 2Y1IA 4DHYA 4YDUC 3CM6A 4N47A 4CJVA 3O9RA 5KQDA 3DRPA 2E2OA 4CE9A 3D0PA 1YF5L 2YKNA 1VQON 2GV9A 4CZLA 4HUGA 3DXMB 2D0CA 2E1ZA 2P9NA 4ILGB 3SZ2A 4DR7K 1W2BM 1T6CA 3VQQA 3SK3A 3EO3A 1WNSA 4CGFA 2ETJA 5DM6L 3AA4A 4C1NI 4F2RA 5C10A 1ZYQA 1T05A 1LWCA 5CZ2A 1C0UA 1S1VA 3VF4A 3AVGA 4B3SK 4AHTA 1W97L 4ZTJA 4EAHD 4NXNK 3VGMA 4AHSA 1RTDA 3M3ZA 3L2QA 1J54A 1ASUA 4B3TK 2IC3A 3OYMA 4I6MA 5AR0A 5BREA 1HJRA 4H0OA 3CI5A 4CHZA 1RT5A 4QS7A 4A2BA 3S9HA 3AVAA 3I33A 4DWIA 1RILA 2WFBA 1U04A 4BREA 1XNRK 3ZSOA 1JLBA 5J2MA 4DTXA 3O08A 3ZYYX 2HW3A 4UQGA 3K59A 4BC2A 1SAZA 5C15A 3QEWA 4C8MA 3EE8A 1EX4A 1VSIA 4L3QA 3K5NA 4HWIA 4Q5VA 1RFQA 3TAGA 1T7PA 4K8ZA 4DSIA 3RMDA 4LF9K 1WAJA 5GADP 5BRDA 4ELVA 3DJCA 4W5TA 2AP1A 3FZLA 4CJ4A 2QA4N 2V7YA 3FFKB 1GOAA 3GE1A 3U8XA 1SL0A 2DTUA 3CCLN 1QVFM 4AHRA 4CVNE 3OYJA 4KAZA 1VSEA 4M3RA 3OYFA 2FLOA 4DTRA 2UYTA 3KLFA 3AVJA 3T69A 4IFVA 2NLXA 1T3VA 3QDKA 4DV6K 4DSKA 4DU3A 1TYQB 3SAFA 2F7TA 2G8VA 4Z4FA 3MEGA 5EX5A 5EU7A 5JLFA 4PUOA 4MFBA 5AQUA 4CZFA 3AVLA 4BR5A 3O1BA 3VEXA 2CGLA 3C65A 1IKXA 1A5WA 3DLRA 4B1ZA 3HJFA 1N33K 4Z4CA 4X64K 1N6QA 3DOKA 1XC3A 3V4IA 4FJLA 4W5NA 4DQIA 3IKMA 2O8BA 4FJGA 3B6PA 4FWOA 2KFNA 5DK5A 4KTWA 3TARA 1QQNA 3E9OA 3VQ7A 4FLWA 1BUPA 4WYBA 3VMFB 2ZD1A 1JLGA 4DUYK 1REVA 3MK6A 2YHWA 4QOZB 5TKWA 4BWJA 4JI1K 3ZSRA 1GLCG 3CCMN 4HUFA 5AQJA 4CGJA 3U3YA 3W0LA 4NCBA 4AILC 3Q7CA 1Z05A 3EZ5A 1YJWN 1BA0A 1TUUA 3DM2A 1TL1A 1VRTA 3CQYA 5J1EA 4JKFA 1N8RO 3MWTA 1WBBA 1YI2N 2E88A 1E4FT 3CC2N 3OTOK 4JI7K 3CCRN 5C24A 4FJJA 4DQRA 2OA8A 4CJRA 2KKZA 3J7ZO 5SZTA 3AA5X 1EWRA 4CERA 1Q18A 1VRUA 4GNIA 3OYHA 1KC8O 2EX3A 2UXDK 5LMNK 4A5BA 5GIOA 2UUCK 4BVPA 1YVNA 3OW2M 2UUBK 1M90O 1VSDA 4YY3K 5KTQA 3OYBA 2V51B 4XIUA 1WLJA 1HKBA 1GLBG 4JI4K 3AA3A 4F3TA 2A41A 3KKRA 1QE1A 4QS8A 1K8KB 5HRSA 1N32K 4JYAK 2IIRA 3IDHA 3JS6A 4F4KA 4B9LA 2F8TA 3O4QA 2YHYA 2HHHK 2FSKA 1SV5A 2ASPA 1VK0A 4KKOA 5AZJB 4E1MA 4M3ZA 3M8PA 5AQRA 3VEYA 1KAXA 4LH5A 1BQNA 3F9MA 3MN5A 4PKIA 3F73A 3LPTA 4OKKA 3NBPA 2NRWA 5FRNA 2WONA 1NGCA 4BG8A 2VQEK 1ZC6A 2D1KA 4QS9A 3PY8A 3G6EN 1OH8A 3ENHA 3ZT3A 1W9HA 5HRPA 1ASWA 4BG9A 4M3WA 2VCPA 1RTJA 5AQIA 3L4IA 5J2NA 1Q9XA 4DTJA 4MDBA 4H03B 4H0XB 1C1AA 4CF8A 4IBNA 2YJFA 3U4LA 1GOBA 3SV4A 3A8YA 3E9PA 2FF3B 3OYEA 5C0YA 4IEIA 5ADXH 3M6GA 3QEPA 2YNGA 2VWJA 2VQFK 4FWSA 3H45C 2ZGYA 3K5MA 1JLEA 4JLHA 1IH7A 1KFDA 3ZT2A 3TU5A 4EHUA 4K42A 4FWNA 5J2QA 4ISFA 2P9SA 3N4QA 3T19A 2OZMA 2VWKA 5LJVA 1X3NA 2HHQA 2QKBA 4CI6A 2GWJA 5AZIB 2P9UB 3QB0A 4CESA 1JLQA 3NF9A 5AQHA 3V9UA 5HLFA 2IS3A 2B4JA 3GBTA 1L5UA 4CEQA 3SV3A 2I5JA 1UA0A 1NJZA 4OKEA 1NG9A 2AJQA 4B8CA 3P83D 3CCUN 4FWQA 4CIEA 4E1NA 1U48A 3GDQA 1M1KO 4DQ8A 3CJ9A 5AQNA 2UU9K 1E3MA 4CFAA 2DY4A 4NB4A 1S1XA 2KLAA 4C8NA 5BR8K 3DLKA 3D6RA 4Y1CA 3AO3A 4JKGB 3CETA 1B9DA 4IJAA 4NXMK 1C1CA 5KI6A 3TTCA 2WTUA 2QTDA 1C0GA 2YJEA 3OYDA 4KHPK 4M3YA 3LWMA 4FVUA 5TKYA 4FJXA 5F2RA 4IOAL 3NGIA 3HK2A 1VQKN 1WSGA 4BGBA 3KWGA 3P1GA 3HO1A 2QWLA 1NLVA 4Z4EA 4DSLA 3WNFA 3SCXA 1RDDA 3SPYA 4DQSA 4V19S 3A5NC 4OVLA 3HPHA 4CJQA 4O44A 2O8FB 1KTQA 1U6ZA 2E5LK 4GVEA 1S6QA 3L8BA 4M63C 4YOXA 4FW1A 4JKAA 4KB0A 5A2QO 2YX6A 1JXBA 3CJCA 4KH6A 5C42A 3V9XA 1RT3A 3KLEA 3TAEA 2NRRA 3NGYA 4H5RA 4DF8A 4J8FA 4DR6K 3DYAA 1QQOA 1BO5O 1S6PA 4F3OA 5E41A 3TSPA 3PIPL 1C0FA 4RWTA 5JICA 1HPMA 1RBRA 3VENA 4O5FA 1WOQA 1NKEA 1YVUA 3RRHA 3THXA 1NJIO 4ID1A 4BRFA 4CD1A 4Y0WA 3LAKA 3A0IX 2P51A 4AHCA 5D3GA 3CCEN 3VGKA 2O4IA 2RF2A 3TI0A 2E2QA 4J2EA 4PHTX 1TAUA 3L2UA 3MAQA 5J2PA 3ULEA 3LZIA 4DQQA 3VQDA 4E7IA 4EP4A 2YCHA 4B1VA 4FM0A 2VYPA 4YORA 4GY2B 3CIPA 2PAVA 5AQGA 3KHYA 5CE3A 1TL3A 1N36K 1K8KA 2D0PA 2NNWA 3V9WA 1U49A 2X78A 1BA1A 3O1WA 5CYMA 4CEAA 2Q3SA 1XMOK 5AZJA 2FBTA 4C1NK 1CZBA 1Q81O 3JXUA 4NYFA 4CFDA 3IS9A 2VGMA 5T7BA 5BRHA 1KLMA 4A57A 4JD2B 4KI4A 2GX9A 4CIFA 1D4XA 3I55N 1JL2A 3MCPA 2O4GA 4BRCA 2NRVA 3OA9A 3RWUA 4K8XA 3J80O 2HHWA 5LJWA 3HBTA 1FK9A 2ZQBA 3RVCA 4CJ7A 3KD5E 1LW2A 3H3NO 2Q0UA 4CJPA 4DV4K 4JK8A 3L2VA 3WT0A 3JYTA 3OYNA 4I9LA 5JVGL 3THVA 1U47A 4YFUA 1L3UA 5ADXA 4KH4A 3D45A 4IJNA 3ZT4A 5HOOA 3VQEA 4CFCA 2ZGZA 3CJ1A 3O9QA 3VPZA 4JAXA 1XUPO 1XWLA 4JN4A 3LDPA 2FXUA 4ELUA 3AAPA 1HLUA 3K58A 2OZSA 5CZ1A 2RPIA 3CJAA 3SAHA 3C6UA 2HF4A 4MLEA 3EYZA 1LWEA 3DWLA 3MXJA 4H4OA 1KVAA 1VQ7N 1LAVA 4CFBA 2H3GX 4W5OA 3KD1E 1DEJA 4CBXA 2P9UA 5FPMA 1RT7A 1VQMN 3AO5A 3VQ6A 4DTMA 2A1SA 3WNGA 4CZHA 1RNHA 2PYJA 5FPEA 3MN9A 4DTNA 4MO5A 2HSTA 4FLYA 2HMIA 2PYLA 4M7XA 3SAGA 1MWMA 3HT3A 3DXKA 2NUBA 4BRDA
chains in the Genus database with same CATH topology
3OYJA 3L3VA 4FVMA 4KAZA 1VSEA 4FJ9A 5FDLA 4ICLA 4L8RB 1RT6A 2ZE2A 3NF6A 1RBTA 4M3RA 3OYFA 4FLZA 1HNVA 1TKZA 4BDYA 4DTRA 3KLFA 4BDPA 3AVJA 1FXXA 3K57A 2KZZA 3HP9A 4DSJA 4IFVA 1N5YA 2BGGA 1TKDA 3LALA 4DG1A 3LWLA 5KGWA 1VSKA 3LP3A 4CJWA 3QEXA 4DSKA 1BIZA 4DU3A 1NK4A 4CCHA 4E7JA 2G8VA 4DU4A 3NHGA 1XI1A 3MEGA 1U4BA 4Z4FA 1Z25A 3VQ4A 4CJTA 4CEZA 1RT4A 3O3GA 3HPOA 5EU7A 4O0IA 3E01A 3O4NA 3ZT1A 4EP5A 3ASMA 3SYZA 4PUOA 4LD0A 4MFBA 3AO1A 4JRPA 4KHQA 3AVLA 4PA1A 4EZ6A 5KRSA 4O4GA 3KK1A 4ZHRA 4B8AB 1IKXA 3VQ9A 4F8RA 1A5WA 4CGHA 3DLRA 5K14A 4FLVA 4NYNA 2DFFA 3LZJA 1VSFA 3HJFA 2R7YA 2ATQA 4CJKA 4Z4CA 4Y1DA 1N6QA 3DOKA 4J2DA 3V4IA 4FJLA 4W5NA 4DQIA 1BHLA 4E19A 4Z0UA 4FJGA 3B6PA 1BGXT 3QO9A 5DK5A 2KFNA 4BE2A 1HMVA 4KTWA 3TARA 4PQUA 3VQPA 3VQ7A 4FLWA 3TR8A 3U3GA 3V1QA 1CXUA 3VQAA 3NH0A 3OY9A 3K5LA 1RT1A 3KLIA 4OLAA 2HVHA 3MXMA 4B9SA 4FJHA 2ZD1A 1JLGA 4MQ3A 4Z4IA 4DTSA 3BDPA 1REVA 4QOZB 1EKEA 4BWJA 3NGZA 1LW0A 1RDAA 2OPPA 4GMJB 4HUEA 4FCYA 3MXIA 3ZSRA 4HUFA 4FZZA 3U3YA 3T1AA 4CGJA 1A5VA 2PZSA 2XY8A 1YTAA 3L2RA 3DLBA 5CYQA 4CJ3A 4N76A 4NCBA 4AILC 1I39A 2IOCA 4FXDA 1S1WA 4CJEA 2G8KA 3EZ5A 4CHQA 4LH4A 3M8QA 3MEEA 4DSFA 3LANA 1SL2A 3DM2A 3NFAA 4I7FA 4QAGA 4J2AA 1WSFA 1TL1A 1RBVA 1VRTA 2E4LA 5J1EA 2XO7A 5HRRA 3CG7A 3G10A 4RW7A 1QS4A 2WOMA 4DLGA 3KKSA 2D5RA 4ELTA 3ZSZA 1ASVA 4KRFA 2B6AA 1U45A 1SL1A 2FBYA 2FBVA 1RBSA 3AVBA 4KB1A 3CFPA 5KGXA 3O3HA 5C24A 4FJJA 1EETA 1S1UA 4DQRA 4CJRA 2OA8A 1S5JA 1WAFA 3ISNC 1MU2A 4DU1A 4CGGA 1KFSA 1YT3A 4DTOA 3QETA 4KTQA 3VQ8A 4FJIA 1J5OA 1TAQA 1ZBFA 5SZTA 3AA5X 4CERA 1X9SA 1X1PA 2VG5A 3AVFA 3KK3A 1VRUA 3OYHA 2HHTA 1K6YA 4HCCA 2EX3A 4IFYA 3ZCMA 4B9TA 1XHXA 2LSNA 3SUOA 1HQEA 1O1WA 3ULDA 4CF9A 1D8YA 1KVBA 1VSDA 5KTQA 3OYBA 4XIUA 1RBUA 3AV9A 4FLTA 3TAFA 1WLJA 3AA3A 2HNYA 4E89A 4F3TA 4KO0A 4OPJA 3FFIA 5JS2A 1Q9YA 4PY5A 3AA2A 3KKRA 4W5QA 1QE1A 3SUQA 5HRSA 4O55A 1RTIA 3HYFA 4CEBA 4F4KA 4H8KA 4B9LA 2F8TA 3O4QA 4NCAA 3DOLA 1SV5A 4JRQA 2YV0X 5DMRA 1VK0A 4KKOA 1SKRA 4BE1A 4E1MA 2YNFA 3M8PA 4M3ZA 3SUNA 1TVRA 4B9UA 1RT2A 4CECA 1SUQA 4FLUA 5JS1A 4LH5A 1BQNA 3ALYA 3ITHA 3V9SA 4CGIA 4HVJA 4KI6A 4KHYA 3F73A 1DLOA 3F9KA 3LPTA 4OKKA 3NBPA 4R5PA 1LV5A 3BGRA 2B5JA 5FRNA 2WONA 3OJSA 1HNIA 1KLNA 4CJSA 1BCMA 4LSLA 1D9DA 4O5BA 3C95A 3HVTA 3PY8A 1RDBA 2D0AA 4IKFA 4BWMA 3AVIA 1UAXA 4I2PA 2HVIA 3IRXA 3ZSYA 3ZT3A 3V1RA 4CEDA 4DSEA 1Y97A 3CM5A 1W9HA 3QERA 5HRPA 1WSJA 4M42A 3AVNA 1NJYA 1J53A 2HHUA 1ASWA 2EHGA 5I42A 4FZXC 3TAPA 1I3AA 1TK0A 4M3TA 3T3FA 1LAWA 4M3WA 1KRPA 3NCIA 2KQ2A 4EZ9A 4Z4HA 4DTUA 3RRGA 1RTJA 5J2NA 2XRIA 3AVCA 3TABA 4M45A 4IDKA 1J9AA 4W5RA 4DTJA 1Q9XA 3IG1A 4ID5A 3TAQA 2X6NA 3PUFA 1C1BA 3VA0A 3DLGA 4G1QA 4CEEA 3HXMA 1C1AA 2IGIA 2OPSA 1FKOA 1JLFA 2X6SA 3A2FA 4IBNA 3LP2A 4CF8A 3TWHA 2A1RA 2QKKA 3K2PA 3PO5A 1GOBA 2X74A 4C8KA 3SV4A 1RCHA 3RMBA 2W42A 1KVCA 4E0DA 3OYEA 2XY5A 1TV6A 2HNZA 1A5XA 4B9NA 3V6DA 3QEPA 2Y1JA 2OPQA 2YNGA 1IG9A 3HSTB 2VWJA 1ZBUA 3PX0A 4AHUA 3K5MA 5HBMA 3HM9A 4ZTFA 4FK4A 3VN5A 1JLEA 4JLHA 1IH7A 1KFDA 5HP1A 1EXQA 3ZT2A 3OS1A 4OLBA 4FW2A 4DTPA 2XY7A 3SQ4A 1BI4B 2OYQA 4HCBA 3NDKA 3OJUA 4B08A 3T19A 5J2QA 2OZMA 4FK2A 1HYSA 2VWKA 3SNNA 3OYIA 2HHQA 3JSMA 1ZBIA 3DRSA 4LSNA 2QKBA 3ZSXA 3NF7A 4CHYA 5I3UA 3WNHA 1VSLA 3KLGA 5CY4A 1NK6A 1L3VA 4CESA 1JLQA 1JLAA 1WSEA 1Q8IA 1TK8A 3NF9A 4IG3A 3V81A 3V9UA 3SUPA 5HLFA 3OYGA 2IS3A 2B4JA 1L5UA 4CEQA 1B92A 1C6VA 1GOCA 2VG6A 3ZSQA 3VQCA 2I5JA 3SV3A 1UA0A 3OVNA 1T8EA 3M8RA 1NJZA 1HYZA 4CGDA 1BCOA 4OKEA 4BDZA 2Z1GA 2AJQA 4B8CA 3OYKA 4RG8A 1NOZA 3P83D 4CJ5A 3SI6A 3QINA 1S9GA 4E1NA 4CIEA 4KHUA 3MEDA 3NAEA 1U48A 1KCFA 4LY7A 4CK3A 1X9WA 4FJ8A 3DMJA 2JLEA 4CFAA 2DY4A 3OS0A 1Z26A 1S1XA 4C8NA 3DLKA 3UIQA 1JLCA 4Y1CA 3AO3A 2Z1IA 3WNEA 3KIOA 2IDOA 4E7HA 1WN7A 1G15A 1B9DA 1D5AA 3HVRA 3CYMA 4FK0A 1HRHA 1C1CA 1BIUA 5KI6A 2HB5A 2G8HA 4DF4A 3OYDA 1NJWA 1UA1A 1QSYA 1QSSA 1WSIA 1VSHA 4RW9A 4M41A 3LWMA 3LP0A 3KTQA 4FJMA 3H08A 4M3YA 2QK9A 4FJXA 4BACA 2BDPA 1B9FA 3SQ2A 3S3MA 3NGIA 1QSLA 3S3OA 4E7LA 3HK2A 3QIOA 2G8WA 1WSGA 1DTQA 3DI6A 2FBXA 3P1GA 3NF8A 1KSPA 3HO1A 3SQ1A 2YHAA 3KLHA 1ZBHA 4QCLA 2E6MA 4Z4EA 4DSLA 3WNFA 4CF1A 3SCXA 1RDDA 3SPYA 4DQSA 1NJXA 4FJ7A 3I8DA 2OPRA 1QHTA 4OGCA 2P1JA 4M3UA 4I2QA 4OKJA 3HPHA 4OVLA 3RMCA 4CJQA 4O44A 3C94A 1JKHA 1KTQA 4FJ5A 3LAMA 3LP1A 4E7KA 3ZSWA 3B6OA 3PX4A 1S6QA 3L8BA 3DLEA 4FW1A 1ZBLA 4KB0A 3DRRA 4Z4GA 4HTUA 3SJJA 4CK1A 1JXBA 3LPUA 1NOYA 5C42A 3V9XA 1JXEA 1RT3A 4AHVA 3KLEA 3TAEA 2P5GA 3NGYA 3VQ5A 4CHPA 4FYDA 4DF8A 3I0RA 2BANA 3DYAA 3VQBA 4DS4A 3VA3A 4GVMA 3KJVA 3QIPA 3U6FA 1C0MA 1NK9A 4B3OA 3RR7A 2JGUA 1S6PA 3TANA 1NKBA 3QNOA 4F3OA 5E41A 3K5OA 4FZYA 4KHWA 1NK8A 1JL1A 3QEVA 3RMAA 1D9FA 1TKXA 4B9VA 4CHNA 4YNQA 4Q0BA 3HL8A 2KW4A 1TGOA 3OYLA 1RBRA 4N5SA 3RTVA 1IKYA 3QLHA 1SKSA 3TAMA 4CEFA 4N56A 1TK5A 1NKEA 1YVUA 3RRHA 4J2BA 3EY1A 4ID1A 4KFBA 4HHTA 4BE0A 3LAKA 4KV8A 4KREA 2P51A 3CFRA 5FROA 4AHCA 4I9QA 5D3GA 4H4MA 4AH9A 2RF2A 3TI0A 4FJKA 2YNIA 4CHOA 4M3XA 4J2EA 2O4IA 1W0HA 1TAUA 3AO4A 4DMNA 2YNHA 3L2UA 3MAQA 2XY6A 5J2PA 1VSJA 3LZIA 4DQQA 3VQDA 4E7IA 4EP4A 2E6LA 1R0AA 2RN2A 4FM0A 2XHBA 2YHBA 4DFJA 4NCGA 3ZSVA 4DFMA 1NK7A 1HQUA 2HHSA 2IAJA 5C25A 2GUIA 1BQMA 2D0BA 4DFPA 4KHNA 2VG7A 4N41A 4CF0A 1SKWA 3G0ZA 1C0TA 3NE6A 1TL3A 4FM1A 1BL3A 2HNDA 4DS5A 3V9WA 5HRNA 2GBZA 2Y1IA 4RW8A 1U49A 2X78A 4CF2A 4C8OA 1ITGA 3CM6A 5CYMA 4CEAA 2Q3SA 4N47A 4CJVA 2KTQA 2Z1HA 1UWBA 2FBTA 3PX6A 3C6TA 1UOCA 1CZBA 4GW6A 4FJNA 3DRPA 4NYFA 2ITGA 4KTZA 4CFDA 4CE9A 3D0PA 3IS9A 2YKNA 5T7BA 1KLMA 1S1TA 2Z1JA 3AVKA 3NH1A 4JS5A 2GV9A 3QESA 3IAYA 4KI4A 4HUGA 4CIFA 2D0CA 2DFHA 1CLQA 1JL2A 4JS4A 3SPZA 3SZ2A 4KPYA 2O4GA 1DTTA 1WSHA 3HPGA 3OYAA 3V9ZA 4DLEA 4O0JA 3VQQA 3SQ0A 3RWUA 4C8LA 2PY5A 4K8XA 4OPKA 5HROA 2HHWA 4DQPA 1CXQA 2G8UA 1WNSA 4CGFA 3OS2A 3HP6A 3RR8A 4CIGA 2ETJA 3AA4A 2BE2A 3S3NA 4F2RA 1FK9A 2ZQBA 3KD5E 1LW2A 1QQCA 3L3UA 1ZYQA 1NK5A 1T05A 2KFZA 3QEIA 1LWCA 5CZ2A 1L3SA 3CFOA 1C0UA 1S1VA 3AVGA 4CJPA 3L2WA 4RW4A 4CJFA 5FRMA 4CK2A 3PO4A 4AHTA 3L2VA 1EP4A 3NH2A 4ZTJA 3JYTA 3OYNA 3M8SA 4TSXA 4I9LA 3THVA 1IO2A 1HYVA 2DFEA 4AHSA 4YFUA 1U47A 1L3UA 1RTDA 3KK2A 3V1OA 4E3SA 4DFKA 3L2QA 1J54A 1ASUA 3D45A 4IG0A 2IC3A 3ZT4A 3AO2A 1NK0A 3VQEA 4CFCA 4CJUA 3OYMA 1HJRA 2F96A 3CQ8A 4CHZA 1F21A 2RKIA 1NKCA 5SWMA 1RT5A 1XWLA 3S9HA 3AVAA 4FM2A 4PWDA 3OYCA 3DLHA 4CEOA 3P5JA 3O3FA 1RILA 1FKPA 4DWIA 4ELUA 1U04A 3ZSOA 1RTHA 4FLXA 1X9MA 3MECA 2P5OA 1JLBA 1IKVA 3K58A 1L3TA 4B9MA 5CZ1A 2OZSA 2G8IA 2HHXA 2RPIA 5J2MA 2HHVA 4OJRA 3C6UA 4CJLA 4DTXA 1YTUA 2QXFA 3I0SA 5KRTA 2HW3A 4UQGA 3EYZA 1LWEA 3MXJA 4H4OA 1BI4A 1BISA 1KVAA 3K59A 3LDSA 3QEWA 4C8MA 1EX4A 1LAVA 1VSIA 3ZT0A 4CFBA 4W5OA 3K5NA 4Q5VA 1CZ9A 3KD1E 1T03A 1XHZA 4RW6A 3TAGA 1T7PA 4K8ZA 4DSIA 4KHSA 3RMDA 1WAJA 3AVMA 4WE1A 4ELVA 4OGEA 1RT7A 3AO5A 3VQ6A 4W5TA 2F8SA 2YKMA 2A1SA 1RDCA 3WNGA 4DTMA 1XC9A 1RNHA 1IKWA 3AVHA 3PV8A 2PYJA 4CJ4A 4DTNA 4FLYA 1S9EA 1VSMA 1TKTA 4F2SA 2HMIA 1QTMA 2PYLA 1GOAA 2KZMA 3HT3A 1SL0A 1HPZA 1LWFA 2NUBA 2DTUA 2G8FA 3QNNA 2FC0A 4AHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYJ A;  3L3V A;  4FVM A;  4KAZ A;  1VSE A;  4FJ9 A;  5FDL A;  4ICL A;  4L8R B;  1RT6 A;  2ZE2 A;  3NF6 A;  1RBT A;  4M3R A;  3OYF A;  4FLZ A;  1HNV A;  1TKZ A;  4BDY A;  4DTR A;  3KLF A;  4BDP A;  3AVJ A;  1FXX A;  3K57 A;  2KZZ A;  3HP9 A;  4DSJ A;  4IFV A;  1N5Y A;  2BGG A;  1TKD A;  3LAL A;  4DG1 A;  3LWL A;  5KGW A;  1VSK A;  3LP3 A;  4CJW A;  3QEX A;  4DSK A;  1BIZ A;  4DU3 A;  1NK4 A;  4CCH A;  4E7J A;  2G8V A;  4DU4 A;  3NHG A;  1XI1 A;  3MEG A;  1U4B A;  4Z4F A;  1Z25 A;  3VQ4 A;  4CJT A;  4CEZ A;  1RT4 A;  3O3G A;  3HPO A;  5EU7 A;  4O0I A;  3E01 A;  3O4N A;  3ZT1 A;  4EP5 A;  3ASM A;  3SYZ A;  4PUO A;  4LD0 A;  4MFB A;  3AO1 A;  4JRP A;  4KHQ A;  3AVL A;  4PA1 A;  4EZ6 A;  5KRS A;  4O4G A;  3KK1 A;  4ZHR A;  4B8A B;  1IKX A;  3VQ9 A;  4F8R A;  1A5W A;  4CGH A;  3DLR A;  5K14 A;  4FLV A;  4NYN A;  2DFF A;  3LZJ A;  1VSF A;  3HJF A;  2R7Y A;  2ATQ A;  4CJK A;  4Z4C A;  4Y1D A;  1N6Q A;  3DOK A;  4J2D A;  3V4I A;  4FJL A;  4W5N A;  4DQI A;  1BHL A;  4E19 A;  4Z0U A;  4FJG A;  3B6P A;  1BGX T;  3QO9 A;  5DK5 A;  2KFN A;  4BE2 A;  1HMV A;  4KTW A;  3TAR A;  4PQU A;  3VQP A;  3VQ7 A;  4FLW A;  3TR8 A;  3U3G A;  3V1Q A;  1CXU A;  3VQA A;  3NH0 A;  3OY9 A;  3K5L A;  1RT1 A;  3KLI A;  4OLA A;  2HVH A;  3MXM A;  4B9S A;  4FJH A;  2ZD1 A;  1JLG A;  4MQ3 A;  4Z4I A;  4DTS A;  3BDP A;  1REV A;  4QOZ B;  1EKE A;  4BWJ A;  3NGZ A;  1LW0 A;  1RDA A;  2OPP A;  4GMJ B;  4HUE A;  4FCY A;  3MXI A;  3ZSR A;  4HUF A;  4FZZ A;  3U3Y A;  3T1A A;  4CGJ A;  1A5V A;  2PZS A;  2XY8 A;  1YTA A;  3L2R A;  3DLB A;  5CYQ A;  4CJ3 A;  4N76 A;  4NCB A;  4AIL C;  1I39 A;  2IOC A;  4FXD A;  1S1W A;  4CJE A;  2G8K A;  3EZ5 A;  4CHQ A;  4LH4 A;  3M8Q A;  3MEE A;  4DSF A;  3LAN A;  1SL2 A;  3DM2 A;  3NFA A;  4I7F A;  4QAG A;  4J2A A;  1WSF A;  1TL1 A;  1RBV A;  1VRT A;  2E4L A;  5J1E A;  2XO7 A;  5HRR A;  3CG7 A;  3G10 A;  4RW7 A;  1QS4 A;  2WOM A;  4DLG A;  3KKS A;  2D5R A;  4ELT A;  3ZSZ A;  1ASV A;  4KRF A;  2B6A A;  1U45 A;  1SL1 A;  2FBY A;  2FBV A;  1RBS A;  3AVB A;  4KB1 A;  3CFP A;  5KGX A;  3O3H A;  5C24 A;  4FJJ A;  1EET A;  1S1U A;  4DQR A;  4CJR A;  2OA8 A;  1S5J A;  1WAF A;  3ISN C;  1MU2 A;  4DU1 A;  4CGG A;  1KFS A;  1YT3 A;  4DTO A;  3QET A;  4KTQ A;  3VQ8 A;  4FJI A;  1J5O A;  1TAQ A;  1ZBF A;  5SZT A;  3AA5 X;  4CER A;  1X9S A;  1X1P A;  2VG5 A;  3AVF A;  3KK3 A;  1VRU A;  3OYH A;  2HHT A;  1K6Y A;  4HCC A;  2EX3 A;  4IFY A;  3ZCM A;  4B9T A;  1XHX A;  2LSN A;  3SUO A;  1HQE A;  1O1W A;  3ULD A;  4CF9 A;  1D8Y A;  1KVB A;  1VSD A;  5KTQ A;  3OYB A;  4XIU A;  1RBU A;  3AV9 A;  4FLT A;  3TAF A;  1WLJ A;  3AA3 A;  2HNY A;  4E89 A;  4F3T A;  4KO0 A;  4OPJ A;  3FFI A;  5JS2 A;  1Q9Y A;  4PY5 A;  3AA2 A;  3KKR A;  4W5Q A;  1QE1 A;  3SUQ A;  5HRS A;  4O55 A;  1RTI A;  3HYF A;  4CEB A;  4F4K A;  4H8K A;  4B9L A;  2F8T A;  3O4Q A;  4NCA A;  3DOL A;  1SV5 A;  4JRQ A;  2YV0 X;  5DMR A;  1VK0 A;  4KKO A;  1SKR A;  4BE1 A;  4E1M A;  2YNF A;  3M8P A;  4M3Z A;  3SUN A;  1TVR A;  4B9U A;  1RT2 A;  4CEC A;  1SUQ A;  4FLU A;  5JS1 A;  4LH5 A;  1BQN A;  3ALY A;  3ITH A;  3V9S A;  4CGI A;  4HVJ A;  4KI6 A;  4KHY A;  3F73 A;  1DLO A;  3F9K A;  3LPT A;  4OKK A;  3NBP A;  4R5P A;  1LV5 A;  3BGR A;  2B5J A;  5FRN A;  2WON A;  3OJS A;  1HNI A;  1KLN A;  4CJS A;  1BCM A;  4LSL A;  1D9D A;  4O5B A;  3C95 A;  3HVT A;  3PY8 A;  1RDB A;  2D0A A;  4IKF A;  4BWM A;  3AVI A;  1UAX A;  4I2P A;  2HVI A;  3IRX A;  3ZSY A;  3ZT3 A;  3V1R A;  4CED A;  4DSE A;  1Y97 A;  3CM5 A;  1W9H A;  3QER A;  5HRP A;  1WSJ A;  4M42 A;  3AVN A;  1NJY A;  1J53 A;  2HHU A;  1ASW A;  2EHG A;  5I42 A;  4FZX C;  3TAP A;  1I3A A;  1TK0 A;  4M3T A;  3T3F A;  1LAW A;  4M3W A;  1KRP A;  3NCI A;  2KQ2 A;  4EZ9 A;  4Z4H A;  4DTU A;  3RRG A;  1RTJ A;  5J2N A;  2XRI A;  3AVC A;  3TAB A;  4M45 A;  4IDK A;  1J9A A;  4W5R A;  4DTJ A;  1Q9X A;  3IG1 A;  4ID5 A;  3TAQ A;  2X6N A;  3PUF A;  1C1B A;  3VA0 A;  3DLG A;  4G1Q A;  4CEE A;  3HXM A;  1C1A A;  2IGI A;  2OPS A;  1FKO A;  1JLF A;  2X6S A;  3A2F A;  4IBN A;  3LP2 A;  4CF8 A;  3TWH A;  2A1R A;  2QKK A;  3K2P A;  3PO5 A;  1GOB A;  2X74 A;  4C8K A;  3SV4 A;  1RCH A;  3RMB A;  2W42 A;  1KVC A;  4E0D A;  3OYE A;  2XY5 A;  1TV6 A;  2HNZ A;  1A5X A;  4B9N A;  3V6D A;  3QEP A;  2Y1J A;  2OPQ A;  2YNG A;  1IG9 A;  3HST B;  2VWJ A;  1ZBU A;  3PX0 A;  4AHU A;  3K5M A;  5HBM A;  3HM9 A;  4ZTF A;  4FK4 A;  3VN5 A;  1JLE A;  4JLH A;  1IH7 A;  1KFD A;  5HP1 A;  1EXQ A;  3ZT2 A;  3OS1 A;  4OLB A;  4FW2 A;  4DTP A;  2XY7 A;  3SQ4 A;  1BI4 B;  2OYQ A;  4HCB A;  3NDK A;  3OJU A;  4B08 A;  3T19 A;  5J2Q A;  2OZM A;  4FK2 A;  1HYS A;  2VWK A;  3SNN A;  3OYI A;  2HHQ A;  3JSM A;  1ZBI A;  3DRS A;  4LSN A;  2QKB A;  3ZSX A;  3NF7 A;  4CHY A;  5I3U A;  3WNH A;  1VSL A;  3KLG A;  5CY4 A;  1NK6 A;  1L3V A;  4CES A;  1JLQ A;  1JLA A;  1WSE A;  1Q8I A;  1TK8 A;  3NF9 A;  4IG3 A;  3V81 A;  3V9U A;  3SUP A;  5HLF A;  3OYG A;  2IS3 A;  2B4J A;  1L5U A;  4CEQ A;  1B92 A;  1C6V A;  1GOC A;  2VG6 A;  3ZSQ A;  3VQC A;  2I5J A;  3SV3 A;  1UA0 A;  3OVN A;  1T8E A;  3M8R A;  1NJZ A;  1HYZ A;  4CGD A;  1BCO A;  4OKE A;  4BDZ A;  2Z1G A;  2AJQ A;  4B8C A;  3OYK A;  4RG8 A;  1NOZ A;  3P83 D;  4CJ5 A;  3SI6 A;  3QIN A;  1S9G A;  4E1N A;  4CIE A;  4KHU A;  3MED A;  3NAE A;  1U48 A;  1KCF A;  4LY7 A;  4CK3 A;  1X9W A;  4FJ8 A;  3DMJ A;  2JLE A;  4CFA A;  2DY4 A;  3OS0 A;  1Z26 A;  1S1X A;  4C8N A;  3DLK A;  3UIQ A;  1JLC A;  4Y1C A;  3AO3 A;  2Z1I A;  3WNE A;  3KIO A;  2IDO A;  4E7H A;  1WN7 A;  1G15 A;  1B9D A;  1D5A A;  3HVR A;  3CYM A;  4FK0 A;  1HRH A;  1C1C A;  1BIU A;  5KI6 A;  2HB5 A;  2G8H A;  4DF4 A;  3OYD A;  1NJW A;  1UA1 A;  1QSY A;  1QSS A;  1WSI A;  1VSH A;  4RW9 A;  4M41 A;  3LWM A;  3LP0 A;  3KTQ A;  4FJM A;  3H08 A;  4M3Y A;  2QK9 A;  4FJX A;  4BAC A;  2BDP A;  1B9F A;  3SQ2 A;  3S3M A;  3NGI A;  1QSL A;  3S3O A;  4E7L A;  3HK2 A;  3QIO A;  2G8W A;  1WSG A;  1DTQ A;  3DI6 A;  2FBX A;  3P1G A;  3NF8 A;  1KSP A;  3HO1 A;  3SQ1 A;  2YHA A;  3KLH A;  1ZBH A;  4QCL A;  2E6M A;  4Z4E A;  4DSL A;  3WNF A;  4CF1 A;  3SCX A;  1RDD A;  3SPY A;  4DQS A;  1NJX A;  4FJ7 A;  3I8D A;  2OPR A;  1QHT A;  4OGC A;  2P1J A;  4M3U A;  4I2Q A;  4OKJ A;  3HPH A;  4OVL A;  3RMC A;  4CJQ A;  4O44 A;  3C94 A;  1JKH A;  1KTQ A;  4FJ5 A;  3LAM A;  3LP1 A;  4E7K A;  3ZSW A;  3B6O A;  3PX4 A;  1S6Q A;  3L8B A;  3DLE A;  4FW1 A;  1ZBL A;  4KB0 A;  3DRR A;  4Z4G A;  4HTU A;  3SJJ A;  4CK1 A;  1JXB A;  3LPU A;  1NOY A;  5C42 A;  3V9X A;  1JXE A;  1RT3 A;  4AHV A;  3KLE A;  3TAE A;  2P5G A;  3NGY A;  3VQ5 A;  4CHP A;  4FYD A;  4DF8 A;  3I0R A;  2BAN A;  3DYA A;  3VQB A;  4DS4 A;  3VA3 A;  4GVM A;  3KJV A;  3QIP A;  3U6F A;  1C0M A;  1NK9 A;  4B3O A;  3RR7 A;  2JGU A;  1S6P A;  3TAN A;  1NKB A;  3QNO A;  4F3O A;  5E41 A;  3K5O A;  4FZY A;  4KHW A;  1NK8 A;  1JL1 A;  3QEV A;  3RMA A;  1D9F A;  1TKX A;  4B9V A;  4CHN A;  4YNQ A;  4Q0B A;  3HL8 A;  2KW4 A;  1TGO A;  3OYL A;  1RBR A;  4N5S A;  3RTV A;  1IKY A;  3QLH A;  1SKS A;  3TAM A;  4CEF A;  4N56 A;  1TK5 A;  1NKE A;  1YVU A;  3RRH A;  4J2B A;  3EY1 A;  4ID1 A;  4KFB A;  4HHT A;  4BE0 A;  3LAK A;  4KV8 A;  4KRE A;  2P51 A;  3CFR A;  5FRO A;  4AHC A;  4I9Q A;  5D3G A;  4H4M A;  4AH9 A;  2RF2 A;  3TI0 A;  4FJK A;  2YNI A;  4CHO A;  4M3X A;  4J2E A;  2O4I A;  1W0H A;  1TAU A;  3AO4 A;  4DMN A;  2YNH A;  3L2U A;  3MAQ A;  2XY6 A;  5J2P A;  1VSJ A;  3LZI A;  4DQQ A;  3VQD A;  4E7I A;  4EP4 A;  2E6L A;  1R0A A;  2RN2 A;  4FM0 A;  2XHB A;  2YHB A;  4DFJ A;  4NCG A;  3ZSV A;  4DFM A;  1NK7 A;  1HQU A;  2HHS A;  2IAJ A;  5C25 A;  2GUI A;  1BQM A;  2D0B A;  4DFP A;  4KHN A;  2VG7 A;  4N41 A;  4CF0 A;  1SKW A;  3G0Z A;  1C0T A;  3NE6 A;  1TL3 A;  4FM1 A;  1BL3 A;  2HND A;  4DS5 A;  3V9W A;  5HRN A;  2GBZ A;  2Y1I A;  4RW8 A;  1U49 A;  2X78 A;  4CF2 A;  4C8O A;  1ITG A;  3CM6 A;  5CYM A;  4CEA A;  2Q3S A;  4N47 A;  4CJV A;  2KTQ A;  2Z1H A;  1UWB A;  2FBT A;  3PX6 A;  3C6T A;  1UOC A;  1CZB A;  4GW6 A;  4FJN A;  3DRP A;  4NYF A;  2ITG A;  4KTZ A;  4CFD A;  4CE9 A;  3D0P A;  3IS9 A;  2YKN A;  5T7B A;  1KLM A;  1S1T A;  2Z1J A;  3AVK A;  3NH1 A;  4JS5 A;  2GV9 A;  3QES A;  3IAY A;  4KI4 A;  4HUG A;  4CIF A;  2D0C A;  2DFH A;  1CLQ A;  1JL2 A;  4JS4 A;  3SPZ A;  3SZ2 A;  4KPY A;  2O4G A;  1DTT A;  1WSH A;  3HPG A;  3OYA A;  3V9Z A;  4DLE A;  4O0J A;  3VQQ A;  3SQ0 A;  3RWU A;  4C8L A;  2PY5 A;  4K8X A;  4OPK A;  5HRO A;  2HHW A;  4DQP A;  1CXQ A;  2G8U A;  1WNS A;  4CGF A;  3OS2 A;  3HP6 A;  3RR8 A;  4CIG A;  2ETJ A;  3AA4 A;  2BE2 A;  3S3N A;  4F2R A;  1FK9 A;  2ZQB A;  3KD5 E;  1LW2 A;  1QQC A;  3L3U A;  1ZYQ A;  1NK5 A;  1T05 A;  2KFZ A;  3QEI A;  1LWC A;  5CZ2 A;  1L3S A;  3CFO A;  1C0U A;  1S1V A;  3AVG A;  4CJP A;  3L2W A;  4RW4 A;  4CJF A;  5FRM A;  4CK2 A;  3PO4 A;  4AHT A;  3L2V A;  1EP4 A;  3NH2 A;  4ZTJ A;  3JYT A;  3OYN A;  3M8S A;  4TSX A;  4I9L A;  3THV A;  1IO2 A;  1HYV A;  2DFE A;  4AHS A;  4YFU A;  1U47 A;  1L3U A;  1RTD A;  3KK2 A;  3V1O A;  4E3S A;  4DFK A;  3L2Q A;  1J54 A;  1ASU A;  3D45 A;  4IG0 A;  2IC3 A;  3ZT4 A;  3AO2 A;  1NK0 A;  3VQE A;  4CFC A;  4CJU A;  3OYM A;  1HJR A;  2F96 A;  3CQ8 A;  4CHZ A;  1F21 A;  2RKI A;  1NKC A;  5SWM A;  1RT5 A;  1XWL A;  3S9H A;  3AVA A;  4FM2 A;  4PWD A;  3OYC A;  3DLH A;  4CEO A;  3P5J A;  3O3F A;  1RIL A;  1FKP A;  4DWI A;  4ELU A;  1U04 A;  3ZSO A;  1RTH A;  4FLX A;  1X9M A;  3MEC A;  2P5O A;  1JLB A;  1IKV A;  3K58 A;  1L3T A;  4B9M A;  5CZ1 A;  2OZS A;  2G8I A;  2HHX A;  2RPI A;  5J2M A;  2HHV A;  4OJR A;  3C6U A;  4CJL A;  4DTX A;  1YTU A;  2QXF A;  3I0S A;  5KRT A;  2HW3 A;  4UQG A;  3EYZ A;  1LWE A;  3MXJ A;  4H4O A;  1BI4 A;  1BIS A;  1KVA A;  3K59 A;  3LDS A;  3QEW A;  4C8M A;  1EX4 A;  1LAV A;  1VSI A;  3ZT0 A;  4CFB A;  4W5O A;  3K5N A;  4Q5V A;  1CZ9 A;  3KD1 E;  1T03 A;  1XHZ A;  4RW6 A;  3TAG A;  1T7P A;  4K8Z A;  4DSI A;  4KHS A;  3RMD A;  1WAJ A;  3AVM A;  4WE1 A;  4ELV A;  4OGE A;  1RT7 A;  3AO5 A;  3VQ6 A;  4W5T A;  2F8S A;  2YKM A;  2A1S A;  1RDC A;  3WNG A;  4DTM A;  1XC9 A;  1RNH A;  1IKW A;  3AVH A;  3PV8 A;  2PYJ A;  4CJ4 A;  4DTN A;  4FLY A;  1S9E A;  1VSM A;  1TKT A;  4F2S A;  2HMI A;  1QTM A;  2PYL A;  1GOA A;  2KZM A;  3HT3 A;  1SL0 A;  1HPZ A;  1LWF A;  2NUB A;  2DTU A;  2G8F A;  3QNN A;  2FC0 A;  4AHR A; 
#chains in the Genus database with same CATH topology
 3NF6 A;  4BDP A;  2KZZ A;  4A5A A;  4DG1 A;  1VSK A;  3LP3 A;  1G99 A;  4JKG A;  1XI1 A;  4FOE A;  3EN9 A;  4CZG A;  4EP5 A;  3O4N A;  3ZT1 A;  3ASM A;  1KXP A;  3WXJ A;  2Q1N A;  5AQY A;  3T1H K;  4KHQ A;  4PA1 A;  4EZ6 A;  5KRS A;  1HKG A;  2E2P A;  4ZHR A;  3VQ9 A;  4JKC A;  3AAR A;  3R1X A;  3ZEU B;  4NYN A;  3MX5 A;  4X62 K;  1NGE A;  2NRX A;  2ATQ A;  1R59 O;  4J2D A;  1BHL A;  4E19 A;  3O8M A;  1BGX T;  2A40 A;  4BE2 A;  1HMV A;  4PQU A;  5M1N A;  1NGG A;  3D7E O;  5M1Q A;  3TR8 A;  2QWQ A;  1XNQ K;  5BPN A;  1RT1 A;  3KLI A;  5BR9 A;  3H3O B;  4B9S A;  3PSF A;  1JCG A;  4CZJ A;  2FSN A;  3BDP A;  2O8F A;  4MLH A;  1RDA A;  2OPP A;  4GMJ B;  4IFE A;  2E20 A;  2W41 A;  4N76 A;  2GWK A;  1I39 A;  2IOC A;  2Q0R A;  5EXW A;  1OH6 A;  4LH4 A;  1TUY A;  2P9K B;  4HTL A;  4YHH K;  4BC5 A;  1JCF A;  4I7F A;  5M1P A;  2QXL A;  4H5V A;  4QAG A;  4J2A A;  3CXC M;  2XO7 A;  1EO1 A;  3P31 A;  5HRR A;  3CG7 A;  4DLG A;  2D5R A;  1ASV A;  2B6A A;  1SL1 A;  2FBV A;  5KGX A;  3JAM O;  4JKD A;  3T7Z A;  1WAF A;  1NM1 A;  4A61 A;  1YT3 A;  2GTD A;  4DTO A;  1U2V B;  1ZBF A;  3MWP A;  3AVF A;  3EE9 A;  3KK3 A;  5AQO A;  1K6Y A;  3HOS A;  4H0T B;  2BH1 A;  1HQE A;  3VF2 A;  2VWB A;  3ZET A;  5FPN A;  4FLT A;  4IZ9 A;  1WBD A;  4E89 A;  4KO0 A;  5JS2 A;  1Q9Y A;  4BC4 A;  4PY5 A;  3AA2 A;  1RTI A;  4CEB A;  1QHA A;  3ENO A;  4CZE A;  4JRQ A;  3UE5 A;  5DMR A;  4X66 K;  1SKR A;  4BE1 A;  2YNF A;  3SUN A;  4BVO A;  5I9E B;  4FLU A;  1SUQ A;  1NNE A;  5JS1 A;  3ALY A;  3V9S A;  4KI6 A;  4HVJ A;  4KHY A;  1DLO A;  1LV5 A;  3BGR A;  2B5J A;  5AQL A;  3OJS A;  4GV9 A;  4CJS A;  2CH6 A;  1D9D A;  4K41 A;  4O5B A;  3C95 A;  3EL2 A;  4BRA A;  4FWR A;  3AVI A;  2Q97 A;  1UAX A;  4DSE A;  1Y97 A;  1MA9 B;  2HHU A;  4FZX C;  1I3A A;  4K0K K;  5JMV A;  3N4P A;  3NCI A;  3RRG A;  4JI6 K;  2XRI A;  2A3Z A;  3TAB A;  1J9A A;  4W5R A;  4JI0 K;  3LM2 A;  4BQZ A;  4DR3 K;  1S22 A;  3VA0 A;  4G1Q A;  3HXM A;  2PFU A;  2OPS A;  2X6S A;  3LP2 A;  5AQS A;  2X74 A;  4CW7 B;  2NZT A;  2W42 A;  2FSJ A;  4UY8 O;  4FO0 A;  4DR2 K;  4AM7 A;  3PLA A;  2OPQ A;  1IG9 A;  1VHX A;  4H5T A;  3PX0 A;  4MO4 A;  4IO8 A;  4PKG A;  2ASM A;  2OCE A;  5HP1 A;  2OYQ A;  4DTP A;  2XY7 A;  5AFU H;  4B08 A;  3I8B A;  3OYI A;  1ZBI A;  3DRS A;  3ZSX A;  5JVH L;  3WNH A;  3KLG A;  4GKK K;  4DR1 K;  1L3V A;  4NO7 A;  1JLA A;  1Q8I A;  1QQM A;  3TTF A;  3OYG A;  2VG6 A;  1O13 A;  4DV1 K;  3OVN A;  3M8R A;  3EZW A;  4OO1 J;  2J4R A;  4A62 A;  3THW B;  3OYK A;  1NOZ A;  3QIN A;  5FPD A;  5IWA K;  3MED A;  5KQ8 A;  4CK3 A;  1VAZ A;  4RTF D;  2KHO A;  3UIQ A;  3HRG A;  3AGK A;  3WNE A;  2IDO A;  4E7H A;  5LMU K;  1G15 A;  1GLL O;  1BIU A;  4DF4 A;  3VER A;  1QSS A;  1WSI A;  2GEM A;  4FOI A;  5M1K A;  3H08 A;  3HM8 A;  2BDP A;  1VQ6 N;  3S3O A;  2E1Y A;  4B3M K;  3QIO A;  2G8W A;  3ZEU A;  4B1U B;  1DTQ A;  4CZI A;  4YOW A;  1NGH A;  3CCV N;  3SQ1 A;  1LOT B;  1NGI A;  3KLH A;  2OPR A;  1KAY A;  3I56 N;  4OGC A;  2O8D B;  4M3U A;  4I2Q A;  3C94 A;  3HZ6 A;  1JKH A;  4E7K A;  3PX4 A;  1ZBL A;  1BDG A;  3DRR A;  4YOT A;  2QW9 A;  4M7Y A;  4XH5 A;  2ZF5 O;  3DXM A;  1NOY A;  1JXE A;  3VQ5 A;  3UB5 A;  2BAN A;  4GVM A;  2E2N A;  1C0M A;  1NK9 A;  2JGU A;  2P9K A;  3QNO A;  2HMP A;  3K5O A;  3VTI A;  1JL1 A;  3RMA A;  1D9F A;  2QM1 A;  4CBU A;  4CHN A;  4YNQ A;  4Q0B A;  3OYL A;  4N5S A;  3RTV A;  1ATS A;  1SKS A;  1XQS C;  1N34 K;  4CEF A;  4J2B A;  4HHT A;  4A59 A;  4KRE A;  4B1W B;  1U2V A;  2Q2R A;  1GLE G;  2P9P B;  1W0H A;  4KH5 A;  4DCH A;  1OH5 A;  2UUA K;  2YNH A;  2XY6 A;  4FPA A;  3MX2 A;  2RN2 A;  4DFM A;  1BQM A;  1QVG M;  4WFB L;  4H0Y B;  3KK7 A;  3NE6 A;  3QIC A;  1BL3 A;  4DS5 A;  5HRN A;  4RW8 A;  2YI1 A;  3BZK A;  1ITG A;  4PL7 A;  3LDQ A;  1UWB A;  3PX6 A;  3C6T A;  1UOC A;  4CZK A;  5EY4 A;  4FPB A;  4GW6 A;  1HNX K;  2ITG A;  4JS5 A;  3OBW A;  3QES A;  2DFH A;  1CLQ A;  4BRL A;  3SPZ A;  3FZF A;  3E1Y A;  1DTT A;  1WSH A;  4BRQ A;  4DLE A;  3SQ0 A;  3J7Y P;  4C8L A;  2PY5 A;  1NWK A;  2G8U A;  3RR8 A;  1OH7 A;  4CIG A;  3VEW A;  3S3N A;  1QQC A;  3L3U A;  1NK5 A;  2W6K A;  2KFZ A;  3QEI A;  5LY3 A;  1L3S A;  3CFO A;  1TYQ A;  4WCE L;  2ZJP L;  3L2W A;  5FRM A;  2HBJ A;  4CJF A;  4CK2 A;  5CHI A;  3PO4 A;  4K25 A;  3NH2 A;  3OBY A;  1IO2 A;  1HYV A;  3KVG A;  1GLD G;  3KK2 A;  3V1O A;  1RGI A;  4E3S A;  4DFK A;  2V7Z A;  5FLX O;  1IV0 A;  1E4G T;  2QWO A;  3CQ8 A;  3CME N;  2RKI A;  1NKC A;  5SWM A;  1MDU B;  2PBD A;  4PWD A;  3OYC A;  3DLH A;  3SLC A;  1Q7Y O;  3BZC A;  4CEO A;  3P5J A;  5AFU A;  3BF3 A;  3L6Q A;  2P5O A;  5M1F A;  4B9M A;  3SBT A;  1L3T A;  5C2D A;  4OJR A;  1YTU A;  4CJL A;  2QXF A;  5KRT A;  3QML A;  4JK9 A;  3NVK A;  1CZ9 A;  2JWK A;  4JI3 K;  4EHT A;  4KHS A;  4BR2 A;  4JEP A;  3TSU A;  4WE1 A;  1YIT N;  4OGE A;  2YKM A;  4LF4 K;  4WFA L;  1VQ9 N;  3PV8 A;  1DT9 A;  1S9E A;  5EOY A;  4OX9 K;  2FC0 A;  4IWV A;  4BC3 A;  3L3V A;  3M1F A;  4FVM A;  4BR9 A;  4FJ9 A;  5FDL A;  1RT6 A;  2ZE2 A;  4FLZ A;  3MMV A;  1HNV A;  1TKZ A;  3K57 A;  2QWP A;  4BGA A;  1N5Y A;  1V4T A;  2BGG A;  1TKD A;  3LWL A;  3QEX A;  4FWK A;  1NK4 A;  4CCH A;  4E7J A;  1U4B A;  1Z25 A;  1RT4 A;  3CPW M;  4O0I A;  4DV2 K;  3E01 A;  3SYZ A;  4BRP A;  4LD0 A;  3AO1 A;  3ATV A;  3ZX3 A;  5B8H A;  3F2K A;  4O4G A;  4JKB A;  3O6W A;  3KK1 A;  3R9P A;  4B8A B;  3K0S A;  5K14 A;  2DFF A;  1GLJ O;  1VSF A;  2R7Y A;  4CJK A;  4BR7 A;  1FW6 A;  4Y1D A;  3ID6 A;  1T6D A;  4Z0U A;  2UXB K;  3M5R A;  2GUP A;  3VQP A;  1BOT O;  3GOI A;  3AY9 A;  3V1Q A;  3HI0 A;  2CH5 A;  3VQA A;  3NH0 A;  3OY9 A;  3K5L A;  2UXC K;  2O8D A;  5EVZ A;  4OLA A;  4BRN A;  2HVH A;  3VGL A;  1SQK A;  3LDN A;  4MQ3 A;  1NGA A;  2CGK A;  3MN7 A;  3NGZ A;  4HUE A;  1LW0 A;  3MXI A;  4NLC A;  2WUS A;  1A5V A;  1YTA A;  3L2R A;  4FWL A;  4YOU A;  4CJ3 A;  3UKR B;  3FR0 A;  4BR0 A;  4E1J A;  2G8K A;  3P39 A;  4CHQ A;  3MEE A;  4DSF A;  1SL2 A;  5HL7 L;  3DLL L;  3NFA A;  3R6M A;  3BUZ B;  1V4S A;  1YUW A;  1WSF A;  5M1O A;  1RBV A;  3G10 A;  4ELT A;  1QS4 A;  2WOM A;  2W6L A;  3KKS A;  4GKJ K;  4KRF A;  1NGD A;  3ZSZ A;  1VQL N;  1U45 A;  2RE2 A;  1I94 K;  1RBS A;  4KB1 A;  2I7P A;  3CFP A;  2Q36 A;  3PSI A;  4FWM A;  3O3H A;  1EET A;  3NVM A;  3E9L A;  4CGG A;  1ATN A;  1KFS A;  3VQ8 A;  4FJI A;  4ILH A;  5KPR A;  1Z6R A;  1TAQ A;  5AQP A;  2VG5 A;  4XH4 A;  4IO9 L;  4RCH A;  2QWR A;  4B9T A;  4IFY A;  3ZCM A;  5AQK A;  2LSN A;  3J81 O;  4DR4 K;  3ULD A;  1D8Y A;  1BWF O;  1KVB A;  1X3M A;  1ZBS A;  3CJB A;  1RBU A;  3AV9 A;  2AA4 A;  4CZM A;  4B3R K;  2P9L B;  3CF5 L;  3FFI A;  2F4V K;  2O8B B;  4O55 A;  4JV5 K;  4DV5 K;  4NCA A;  4LFA K;  1HX1 A;  5AZI A;  1TVR A;  3THY B;  5AQM A;  3CC7 N;  3ITH A;  4CGI A;  4BRI A;  4R5P A;  4FWP A;  2ZJQ L;  3F5T A;  2D0O A;  1CZA N;  3HVT A;  3HSC A;  4IKF A;  4BWM A;  3ENB A;  3O4W A;  4WQ4 A;  4B1X B;  4LC9 B;  3A5L C;  3IRX A;  4CED A;  3CM5 A;  3QER A;  4M42 A;  1NJY A;  1J53 A;  5E84 A;  5I42 A;  3TAP A;  2F9W A;  1TK0 A;  3T3F A;  4M3T A;  4LFC K;  1KRP A;  3VOV A;  1NBW A;  4Z4H A;  1RDU A;  4DTU A;  2FF6 A;  4IDK A;  5GIP A;  3TAQ A;  3PUF A;  3DLG A;  4K43 A;  1X9J A;  4LF6 K;  4CD3 A;  3A2F A;  2A1R A;  1JJ2 M;  4BRM A;  1HUX A;  3PO5 A;  3TPQ A;  3RMB A;  3D2E B;  3CPE A;  3H46 O;  4E0D A;  2XY5 A;  1TV6 A;  2HNZ A;  1A5X A;  3O5B A;  1J5E K;  2IVP A;  5C12 A;  3HST B;  2O8E B;  5HBM A;  3HM9 A;  3VES A;  1YJN N;  4AM6 A;  1EXQ A;  3OS1 A;  3U9Z A;  5F1X A;  1BI4 B;  1QZ5 A;  3SQ4 A;  3NDK A;  3KZB A;  1HYS A;  3JSM A;  4ILJ A;  3J7A P;  2Q31 A;  4LSN A;  3NF7 A;  3SMS A;  4CHY A;  5I3U A;  1NK6 A;  3TTD A;  3CCQ N;  5KPT A;  1TK8 A;  2NRT A;  4IG3 A;  3IUC A;  3L0Q A;  4JHD B;  3H1V X;  1IBL K;  3MN6 A;  3FE1 A;  1B92 A;  4YOY A;  4JNE A;  3ZSQ A;  4CGD A;  1T44 A;  5BRF A;  2OTJ N;  4CJ5 A;  1YJ9 N;  3SI6 A;  1S9G A;  1WUA A;  4FJ8 A;  1X9W A;  4LF7 K;  2JLE A;  1KQS M;  1FJG K;  1JLC A;  1SZ2 A;  3C6A A;  3FZM A;  1WN7 A;  1D5A A;  3WXM B;  4FK0 A;  4A2A A;  1HRH A;  2O8C B;  4OPH A;  3GG4 A;  4AF1 A;  2G8H A;  1NJW A;  1UA1 A;  3KTQ A;  4M41 A;  2QK9 A;  4JK7 A;  1B9F A;  4IOX A;  4H5N A;  1OKJ A;  3H1Q A;  2FBX A;  3NF8 A;  1KSP A;  3FZK A;  2P9I B;  4LFB K;  2QI2 A;  4QCL A;  3LL3 A;  4CF1 A;  3ZLJ A;  1NJX A;  1IBK K;  4FJ7 A;  3I8D A;  2P1J A;  2OAN A;  4OKJ A;  1WB9 A;  3O80 A;  1NGJ A;  3ZSW A;  3B6O A;  2P9S B;  3DLE A;  1MWK A;  1DGK N;  4HTU A;  4JD2 A;  2A6A A;  3SJJ A;  1HNZ K;  3VTH A;  4LF8 K;  3LPU A;  1Q82 O;  2P5G A;  3CHW A;  4CHP A;  3SJH A;  4FYD A;  3CER A;  1OVY A;  2W40 A;  5IT9 O;  3VQB A;  3UKR A;  3KJV A;  4X65 K;  1XMQ K;  4B3O A;  5BN9 A;  1NKB A;  3QEV A;  3BY5 A;  2KW4 A;  2BTF A;  1TGO A;  1HJO A;  2ZWH A;  3RSE B;  3QLH A;  1IJJ A;  3ATU A;  1NGF A;  3TAM A;  2F9T A;  4N56 A;  1NMN A;  4BE0 A;  1S72 N;  4KV8 A;  4BRO A;  4I9Q A;  1ILY A;  4H4M A;  4AH9 A;  4FJK A;  4CHO A;  3T1Y K;  5ELZ A;  1YXQ A;  3HTV A;  4DMN A;  3WUH A;  1VSJ A;  4ISG A;  2E6L A;  1R0A A;  4KBO A;  4DFJ A;  2YHB A;  2JWL A;  3EKS A;  5LL6 Z;  5C25 A;  2GUI A;  2NRH A;  2P9L A;  4DFP A;  4KHN A;  2VG7 A;  4N41 A;  3G0Z A;  3FGU A;  1C0T A;  4FM1 A;  4DR5 K;  4CF2 A;  4C8O A;  2KTQ A;  2Z1H A;  4FL9 A;  4B9Q A;  4BRK A;  4MDA A;  3THY A;  3WEE B;  4FJN A;  3WXI A;  4KTZ A;  1K73 O;  5BN8 A;  5GAH P;  1S1T A;  2Z1J A;  3AVK A;  3WXK A;  3NH1 A;  3IAY A;  4JS4 A;  4H0V B;  4KPY A;  3HPG A;  3OYA A;  3V9Z A;  4O0J A;  3VEZ A;  3DAW A;  2EWS A;  4OPK A;  5HRO A;  4DQP A;  1CXQ A;  4YDU A;  3CJ7 A;  4WFN L;  3OS2 A;  3HP6 A;  4R79 A;  2BE2 A;  1Y64 A;  5BPM A;  3ZX0 A;  3IFR A;  1W7A A;  4RW4 A;  3ZX2 A;  5E26 A;  1EP4 A;  3M8S A;  4TSX A;  5DM7 L;  2DFE A;  3EEQ A;  3THX B;  2VGN A;  1GLA G;  4O8U A;  3TSQ A;  4IG0 A;  4JI8 K;  3AO2 A;  1NK0 A;  4CJU A;  3CC4 N;  3S41 A;  2F96 A;  3D2E A;  1F21 A;  3ULE B;  4FM2 A;  2CGJ A;  2HOE A;  3J8A A;  3K9K A;  3O3F A;  1FKP A;  3CD6 N;  2O8E A;  3QBW A;  1RTH A;  3MCA B;  3SMP A;  3MEC A;  4FLX A;  1X9M A;  1IKV A;  2G8I A;  2HHX A;  3R3L A;  2HHV A;  3BP8 A;  3Q7B A;  3I0S A;  3W3D A;  3GL1 A;  1BI4 A;  1BIS A;  4U67 L;  3LDS A;  4G9Z A;  3FZH A;  3ZT0 A;  3C7N B;  3KWI A;  1T03 A;  1EWQ A;  1XHZ A;  4RW6 A;  3IMX A;  1OVQ A;  5KPZ A;  3VET A;  2GEL A;  3BEX A;  3AVM A;  4F9O A;  2F8S A;  1RDC A;  1XC9 A;  3C0B A;  1IKW A;  3AVH A;  5MLC Q;  1VQN N;  4WQ5 C;  4JHD A;  1VSM A;  1TKT A;  4F2S A;  2KZM A;  1QTM A;  4BQL A;  1IG8 A;  1H1V A;  1HPZ A;  1LWF A;  1YAG A;  3B8A X;  2G8F A;  3QNN A;  4PL8 A;  3CCS N;  4L8R B;  4ICL A;  1RBT A;  4BDY A;  1FXX A;  3HP9 A;  4DSJ A;  3LAL A;  3QFP A;  5KGW A;  4CJW A;  1BIZ A;  4DU4 A;  3NHG A;  4OPA A;  3VQ4 A;  2QWN A;  4CJT A;  4CEZ A;  2O8C A;  3O3G A;  3HPO A;  3VEV A;  2QWM A;  2HBL A;  4JRP A;  2WBN A;  4CGH A;  4F8R A;  4FLV A;  3LZJ A;  3LDL A;  3EKU A;  1S3X A;  3K9J A;  3QO9 A;  3D2F B;  2P9I A;  3LDO A;  4AQY K;  3U3G A;  1CXU A;  3WQU A;  2I7N A;  3MXM A;  4EIA A;  4FJH A;  3U9D A;  4DV0 K;  4DTS A;  4Z4I A;  1EKE A;  4FCY A;  4FZZ A;  2PZS A;  3T1A A;  4JI2 K;  3QFU A;  2XY8 A;  3DLB A;  3QBX A;  5CYQ A;  2IVN A;  5H1S Q;  4FXD A;  1S1W A;  4DB3 A;  4CJE A;  5CR4 A;  3M8Q A;  3H6E A;  3LAN A;  1JCE A;  4WF9 L;  3DXK B;  2E4L A;  1P90 A;  4RW7 A;  2FBY A;  3AVB A;  1NGB A;  1K8A O;  1S1U A;  3RSE A;  1S5J A;  3ISN C;  1MU2 A;  4DU1 A;  3QET A;  4KTQ A;  4LF5 K;  3SBG A;  2ZJR L;  1J5O A;  1X9S A;  1X1P A;  2A5X A;  2HHT A;  4HCC A;  1ATR A;  1HNW K;  4H5W A;  1XHX A;  3UKU B;  3SUO A;  1O1W A;  4PKH A;  1K9M O;  4IDH A;  4CF9 A;  5F0X A;  5AQT A;  3TAF A;  2HNY A;  5C2F A;  4OPJ A;  4BY9 C;  4W5Q A;  3SUQ A;  3HYF A;  5AJ3 K;  4H8K A;  3DOL A;  2YV0 X;  4WQ4 C;  4DKW A;  2ZM6 K;  5AQF A;  1YIJ N;  4B9U A;  1RT2 A;  4CEC A;  3P4I A;  3OHR A;  3F9K A;  1KD1 O;  3WEE A;  1IBM K;  5GAG P;  4ISE A;  1HNI A;  2P9N B;  1KLN A;  4NLB A;  2A42 A;  1BCM A;  4LSL A;  4BRH A;  3THW A;  5AQV A;  1RDB A;  2D0A A;  5GAE P;  2YHX A;  2WC9 A;  4I2P A;  2HVI A;  3ZSY A;  3V1R A;  2E8A A;  1WSJ A;  2RHK A;  3AVN A;  1LCU A;  2HBM A;  3C6H A;  2EHG A;  5AQQ A;  4WQ5 A;  1LAW A;  2DPN A;  4EZ9 A;  2KQ2 A;  3AVC A;  4M45 A;  3IG1 A;  4ID5 A;  2X6N A;  1C1B A;  4CEE A;  2IGI A;  1FKO A;  1JLF A;  3TWH A;  2QKK A;  4EFH A;  3K2P A;  4DV7 K;  4I6M B;  3E66 A;  1HR0 K;  4C8K A;  1BU6 O;  1RCH A;  4IOC L;  1KVC A;  1RDW X;  3FLC O;  1P8Z A;  4JKH A;  4B9N A;  1KAZ A;  3V6D A;  4B1Y B;  2Y1J A;  3ZET B;  1ZBU A;  4AHU A;  3G71 N;  4ZTF A;  4FK4 A;  3AAQ A;  3VN5 A;  3G25 A;  1NMD A;  4OLB A;  4FW2 A;  4HCB A;  3VF6 A;  3OJU A;  3O9U A;  4FK2 A;  3SNN A;  3MDQ A;  3C7N A;  1VSL A;  3A5O C;  3BF1 A;  5CY4 A;  1ZXO A;  1WSE A;  3V81 A;  4FSV A;  4JKE A;  3SUP A;  3R8E A;  1VQP N;  2D4W A;  3O9S A;  1C6V A;  1GOC A;  3PIO L;  3VQC A;  1T8E A;  3P38 A;  2OTL N;  2ITM A;  1HYZ A;  1ESV A;  1BCO A;  4BDZ A;  1YHQ N;  2HF3 A;  2Z1G A;  4IXC A;  4RG8 A;  5BPL A;  1VQ5 N;  4KHU A;  3NAE A;  1KCF A;  4LY7 A;  3DMJ A;  3OS0 A;  1Z26 A;  4O8K A;  2QEX N;  2Z1I A;  3KIO A;  5JLH A;  3VEO A;  5GIN A;  3HVR A;  3CYM A;  3G4S N;  2P9P A;  2HB5 A;  4C23 A;  3CQX A;  1EQY A;  1QSY A;  1GLF O;  1VQ8 N;  1VSH A;  4H0P A;  4RW9 A;  3LP0 A;  4FJM A;  4DV3 K;  4BAC A;  3WXL A;  3SQ2 A;  3S3M A;  1QSL A;  3O9T A;  4E7L A;  4Z94 A;  3DI6 A;  3CMA N;  1QZ6 A;  1NU0 A;  5AQX A;  2YHA A;  1ZBH A;  2E6M A;  4U7B A;  1VQ4 N;  3LM9 A;  3D2F A;  3ID8 A;  5AQZ A;  1QHT A;  2HBK A;  3NMU A;  3RMC A;  1Q86 O;  1J6Z A;  3LAM A;  3LP1 A;  4FJ5 A;  4GV6 A;  4Z4G A;  4BRG A;  3AGR A;  4CK1 A;  1DKG D;  4YOV A;  4AHV A;  4CBW A;  3I0R A;  4DUZ K;  4DS4 A;  3VA3 A;  2BUP A;  3QIP A;  3U6F A;  3RR7 A;  3CCJ N;  3HOT A;  3TAN A;  2IVO A;  4FZY A;  4KHW A;  1NK8 A;  5AQW A;  1TKX A;  4B9V A;  3HL8 A;  1IKY A;  2ASO A;  1SS6 A;  1TK5 A;  4BR4 A;  3EY1 A;  4KFB A;  4IEE A;  3CFR A;  5FRO A;  2YNI A;  4M3X A;  1BG3 A;  3AO4 A;  3WQT A;  3UKU A;  4XH1 A;  4JI5 K;  2NRZ A;  2XHB A;  3A5M C;  4NCG A;  3ZSV A;  1NK7 A;  1HQU A;  2HHS A;  2IAJ A;  4GV3 A;  2D0B A;  2V52 B;  4CF0 A;  1SKW A;  4XEI A;  3L4Q A;  1HKC A;  2HND A;  2GBZ A;  2Y1I A;  4DHY A;  4YDU C;  3CM6 A;  4N47 A;  4CJV A;  3O9R A;  5KQD A;  3DRP A;  2E2O A;  4CE9 A;  3D0P A;  1YF5 L;  2YKN A;  1VQO N;  2GV9 A;  4CZL A;  4HUG A;  3DXM B;  2D0C A;  2E1Z A;  2P9N A;  4ILG B;  3SZ2 A;  4DR7 K;  1W2B M;  1T6C A;  3VQQ A;  3SK3 A;  3EO3 A;  1WNS A;  4CGF A;  2ETJ A;  5DM6 L;  3AA4 A;  4C1N I;  4F2R A;  5C10 A;  1ZYQ A;  1T05 A;  1LWC A;  5CZ2 A;  1C0U A;  1S1V A;  3VF4 A;  3AVG A;  4B3S K;  4AHT A;  1W97 L;  4ZTJ A;  4EAH D;  4NXN K;  3VGM A;  4AHS A;  1RTD A;  3M3Z A;  3L2Q A;  1J54 A;  1ASU A;  4B3T K;  2IC3 A;  3OYM A;  4I6M A;  5AR0 A;  5BRE A;  1HJR A;  4H0O A;  3CI5 A;  4CHZ A;  1RT5 A;  4QS7 A;  4A2B A;  3S9H A;  3AVA A;  3I33 A;  4DWI A;  1RIL A;  2WFB A;  1U04 A;  4BRE A;  1XNR K;  3ZSO A;  1JLB A;  5J2M A;  4DTX A;  3O08 A;  3ZYY X;  2HW3 A;  4UQG A;  3K59 A;  4BC2 A;  1SAZ A;  5C15 A;  3QEW A;  4C8M A;  3EE8 A;  1EX4 A;  1VSI A;  4L3Q A;  3K5N A;  4HWI A;  4Q5V A;  1RFQ A;  3TAG A;  1T7P A;  4K8Z A;  4DSI A;  3RMD A;  4LF9 K;  1WAJ A;  5GAD P;  5BRD A;  4ELV A;  3DJC A;  4W5T A;  2AP1 A;  3FZL A;  4CJ4 A;  2QA4 N;  2V7Y A;  3FFK B;  1GOA A;  3GE1 A;  3U8X A;  1SL0 A;  2DTU A;  3CCL N;  1QVF M;  4AHR A;  4CVN E;  3OYJ A;  4KAZ A;  1VSE A;  4M3R A;  3OYF A;  2FLO A;  4DTR A;  2UYT A;  3KLF A;  3AVJ A;  3T69 A;  4IFV A;  2NLX A;  1T3V A;  3QDK A;  4DV6 K;  4DSK A;  4DU3 A;  1TYQ B;  3SAF A;  2F7T A;  2G8V A;  4Z4F A;  3MEG A;  5EX5 A;  5EU7 A;  5JLF A;  4PUO A;  4MFB A;  5AQU A;  4CZF A;  3AVL A;  4BR5 A;  3O1B A;  3VEX A;  2CGL A;  3C65 A;  1IKX A;  1A5W A;  3DLR A;  4B1Z A;  3HJF A;  1N33 K;  4Z4C A;  4X64 K;  1N6Q A;  3DOK A;  1XC3 A;  3V4I A;  4FJL A;  4W5N A;  4DQI A;  3IKM A;  2O8B A;  4FJG A;  3B6P A;  4FWO A;  2KFN A;  5DK5 A;  4KTW A;  3TAR A;  1QQN A;  3E9O A;  3VQ7 A;  4FLW A;  1BUP A;  4WYB A;  3VMF B;  2ZD1 A;  1JLG A;  4DUY K;  1REV A;  3MK6 A;  2YHW A;  4QOZ B;  5TKW A;  4BWJ A;  4JI1 K;  3ZSR A;  1GLC G;  3CCM N;  4HUF A;  5AQJ A;  4CGJ A;  3U3Y A;  3W0L A;  4NCB A;  4AIL C;  3Q7C A;  1Z05 A;  3EZ5 A;  1YJW N;  1BA0 A;  1TUU A;  3DM2 A;  1TL1 A;  1VRT A;  3CQY A;  5J1E A;  4JKF A;  1N8R O;  3MWT A;  1WBB A;  1YI2 N;  2E88 A;  1E4F T;  3CC2 N;  3OTO K;  4JI7 K;  3CCR N;  5C24 A;  4FJJ A;  4DQR A;  2OA8 A;  4CJR A;  2KKZ A;  3J7Z O;  5SZT A;  3AA5 X;  1EWR A;  4CER A;  1Q18 A;  1VRU A;  4GNI A;  3OYH A;  1KC8 O;  2EX3 A;  2UXD K;  5LMN K;  4A5B A;  5GIO A;  2UUC K;  4BVP A;  1YVN A;  3OW2 M;  2UUB K;  1M90 O;  1VSD A;  4YY3 K;  5KTQ A;  3OYB A;  2V51 B;  4XIU A;  1WLJ A;  1HKB A;  1GLB G;  4JI4 K;  3AA3 A;  4F3T A;  2A41 A;  3KKR A;  1QE1 A;  4QS8 A;  1K8K B;  5HRS A;  1N32 K;  4JYA K;  2IIR A;  3IDH A;  3JS6 A;  4F4K A;  4B9L A;  2F8T A;  3O4Q A;  2YHY A;  2HHH K;  2FSK A;  1SV5 A;  2ASP A;  1VK0 A;  4KKO A;  5AZJ B;  4E1M A;  4M3Z A;  3M8P A;  5AQR A;  3VEY A;  1KAX A;  4LH5 A;  1BQN A;  3F9M A;  3MN5 A;  4PKI A;  3F73 A;  3LPT A;  4OKK A;  3NBP A;  2NRW A;  5FRN A;  2WON A;  1NGC A;  4BG8 A;  2VQE K;  1ZC6 A;  2D1K A;  4QS9 A;  3PY8 A;  3G6E N;  1OH8 A;  3ENH A;  3ZT3 A;  1W9H A;  5HRP A;  1ASW A;  4BG9 A;  4M3W A;  2VCP A;  1RTJ A;  5AQI A;  3L4I A;  5J2N A;  1Q9X A;  4DTJ A;  4MDB A;  4H03 B;  4H0X B;  1C1A A;  4CF8 A;  4IBN A;  2YJF A;  3U4L A;  1GOB A;  3SV4 A;  3A8Y A;  3E9P A;  2FF3 B;  3OYE A;  5C0Y A;  4IEI A;  5ADX H;  3M6G A;  3QEP A;  2YNG A;  2VWJ A;  2VQF K;  4FWS A;  3H45 C;  2ZGY A;  3K5M A;  1JLE A;  4JLH A;  1IH7 A;  1KFD A;  3ZT2 A;  3TU5 A;  4EHU A;  4K42 A;  4FWN A;  5J2Q A;  4ISF A;  2P9S A;  3N4Q A;  3T19 A;  2OZM A;  2VWK A;  5LJV A;  1X3N A;  2HHQ A;  2QKB A;  4CI6 A;  2GWJ A;  5AZI B;  2P9U B;  3QB0 A;  4CES A;  1JLQ A;  3NF9 A;  5AQH A;  3V9U A;  5HLF A;  2IS3 A;  2B4J A;  3GBT A;  1L5U A;  4CEQ A;  3SV3 A;  2I5J A;  1UA0 A;  1NJZ A;  4OKE A;  1NG9 A;  2AJQ A;  4B8C A;  3P83 D;  3CCU N;  4FWQ A;  4CIE A;  4E1N A;  1U48 A;  3GDQ A;  1M1K O;  4DQ8 A;  3CJ9 A;  5AQN A;  2UU9 K;  1E3M A;  4CFA A;  2DY4 A;  4NB4 A;  1S1X A;  2KLA A;  4C8N A;  5BR8 K;  3DLK A;  3D6R A;  4Y1C A;  3AO3 A;  4JKG B;  3CET A;  1B9D A;  4IJA A;  4NXM K;  1C1C A;  5KI6 A;  3TTC A;  2WTU A;  2QTD A;  1C0G A;  2YJE A;  3OYD A;  4KHP K;  4M3Y A;  3LWM A;  4FVU A;  5TKY A;  4FJX A;  5F2R A;  4IOA L;  3NGI A;  3HK2 A;  1VQK N;  1WSG A;  4BGB A;  3KWG A;  3P1G A;  3HO1 A;  2QWL A;  1NLV A;  4Z4E A;  4DSL A;  3WNF A;  3SCX A;  1RDD A;  3SPY A;  4DQS A;  4V19 S;  3A5N C;  4OVL A;  3HPH A;  4CJQ A;  4O44 A;  2O8F B;  1KTQ A;  1U6Z A;  2E5L K;  4GVE A;  1S6Q A;  3L8B A;  4M63 C;  4YOX A;  4FW1 A;  4JKA A;  4KB0 A;  5A2Q O;  2YX6 A;  1JXB A;  3CJC A;  4KH6 A;  5C42 A;  3V9X A;  1RT3 A;  3KLE A;  3TAE A;  2NRR A;  3NGY A;  4H5R A;  4DF8 A;  4J8F A;  4DR6 K;  3DYA A;  1QQO A;  1BO5 O;  1S6P A;  4F3O A;  5E41 A;  3TSP A;  3PIP L;  1C0F A;  4RWT A;  5JIC A;  1HPM A;  1RBR A;  3VEN A;  4O5F A;  1WOQ A;  1NKE A;  1YVU A;  3RRH A;  3THX A;  1NJI O;  4ID1 A;  4BRF A;  4CD1 A;  4Y0W A;  3LAK A;  3A0I X;  2P51 A;  4AHC A;  5D3G A;  3CCE N;  3VGK A;  2O4I A;  2RF2 A;  3TI0 A;  2E2Q A;  4J2E A;  4PHT X;  1TAU A;  3L2U A;  3MAQ A;  5J2P A;  3ULE A;  3LZI A;  4DQQ A;  3VQD A;  4E7I A;  4EP4 A;  2YCH A;  4B1V A;  4FM0 A;  2VYP A;  4YOR A;  4GY2 B;  3CIP A;  2PAV A;  5AQG A;  3KHY A;  5CE3 A;  1TL3 A;  1N36 K;  1K8K A;  2D0P A;  2NNW A;  3V9W A;  1U49 A;  2X78 A;  1BA1 A;  3O1W A;  5CYM A;  4CEA A;  2Q3S A;  1XMO K;  5AZJ A;  2FBT A;  4C1N K;  1CZB A;  1Q81 O;  3JXU A;  4NYF A;  4CFD A;  3IS9 A;  2VGM A;  5T7B A;  5BRH A;  1KLM A;  4A57 A;  4JD2 B;  4KI4 A;  2GX9 A;  4CIF A;  1D4X A;  3I55 N;  1JL2 A;  3MCP A;  2O4G A;  4BRC A;  2NRV A;  3OA9 A;  3RWU A;  4K8X A;  3J80 O;  2HHW A;  5LJW A;  3HBT A;  1FK9 A;  2ZQB A;  3RVC A;  4CJ7 A;  3KD5 E;  1LW2 A;  3H3N O;  2Q0U A;  4CJP A;  4DV4 K;  4JK8 A;  3L2V A;  3WT0 A;  3JYT A;  3OYN A;  4I9L A;  5JVG L;  3THV A;  1U47 A;  4YFU A;  1L3U A;  5ADX A;  4KH4 A;  3D45 A;  4IJN A;  3ZT4 A;  5HOO A;  3VQE A;  4CFC A;  2ZGZ A;  3CJ1 A;  3O9Q A;  3VPZ A;  4JAX A;  1XUP O;  1XWL A;  4JN4 A;  3LDP A;  2FXU A;  4ELU A;  3AAP A;  1HLU A;  3K58 A;  2OZS A;  5CZ1 A;  2RPI A;  3CJA A;  3SAH A;  3C6U A;  2HF4 A;  4MLE A;  3EYZ A;  1LWE A;  3DWL A;  3MXJ A;  4H4O A;  1KVA A;  1VQ7 N;  1LAV A;  4CFB A;  2H3G X;  4W5O A;  3KD1 E;  1DEJ A;  4CBX A;  2P9U A;  5FPM A;  1RT7 A;  1VQM N;  3AO5 A;  3VQ6 A;  4DTM A;  2A1S A;  3WNG A;  4CZH A;  1RNH A;  2PYJ A;  5FPE A;  3MN9 A;  4DTN A;  4MO5 A;  2HST A;  4FLY A;  2HMI A;  2PYL A;  4M7X A;  3SAG A;  1MWM A;  3HT3 A;  3DXK A;  2NUB A;  4BRD A; 
#chains in the Genus database with same CATH homology
 3OYJ A;  3L3V A;  4FVM A;  4KAZ A;  1VSE A;  4FJ9 A;  5FDL A;  4ICL A;  4L8R B;  1RT6 A;  2ZE2 A;  3NF6 A;  1RBT A;  4M3R A;  3OYF A;  4FLZ A;  1HNV A;  1TKZ A;  4BDY A;  4DTR A;  3KLF A;  4BDP A;  3AVJ A;  1FXX A;  3K57 A;  2KZZ A;  3HP9 A;  4DSJ A;  4IFV A;  1N5Y A;  2BGG A;  1TKD A;  3LAL A;  4DG1 A;  3LWL A;  5KGW A;  1VSK A;  3LP3 A;  4CJW A;  3QEX A;  4DSK A;  1BIZ A;  4DU3 A;  1NK4 A;  4CCH A;  4E7J A;  2G8V A;  4DU4 A;  3NHG A;  1XI1 A;  3MEG A;  1U4B A;  4Z4F A;  1Z25 A;  3VQ4 A;  4CJT A;  4CEZ A;  1RT4 A;  3O3G A;  3HPO A;  5EU7 A;  4O0I A;  3E01 A;  3O4N A;  3ZT1 A;  4EP5 A;  3ASM A;  3SYZ A;  4PUO A;  4LD0 A;  4MFB A;  3AO1 A;  4JRP A;  4KHQ A;  3AVL A;  4PA1 A;  4EZ6 A;  5KRS A;  4O4G A;  3KK1 A;  4ZHR A;  4B8A B;  1IKX A;  3VQ9 A;  4F8R A;  1A5W A;  4CGH A;  3DLR A;  5K14 A;  4FLV A;  4NYN A;  2DFF A;  3LZJ A;  1VSF A;  3HJF A;  2R7Y A;  2ATQ A;  4CJK A;  4Z4C A;  4Y1D A;  1N6Q A;  3DOK A;  4J2D A;  3V4I A;  4FJL A;  4W5N A;  4DQI A;  1BHL A;  4E19 A;  4Z0U A;  4FJG A;  3B6P A;  1BGX T;  3QO9 A;  5DK5 A;  2KFN A;  4BE2 A;  1HMV A;  4KTW A;  3TAR A;  4PQU A;  3VQP A;  3VQ7 A;  4FLW A;  3TR8 A;  3U3G A;  3V1Q A;  1CXU A;  3VQA A;  3NH0 A;  3OY9 A;  3K5L A;  1RT1 A;  3KLI A;  4OLA A;  2HVH A;  3MXM A;  4B9S A;  4FJH A;  2ZD1 A;  1JLG A;  4MQ3 A;  4Z4I A;  4DTS A;  3BDP A;  1REV A;  4QOZ B;  1EKE A;  4BWJ A;  3NGZ A;  1LW0 A;  1RDA A;  2OPP A;  4GMJ B;  4HUE A;  4FCY A;  3MXI A;  3ZSR A;  4HUF A;  4FZZ A;  3U3Y A;  3T1A A;  4CGJ A;  1A5V A;  2PZS A;  2XY8 A;  1YTA A;  3L2R A;  3DLB A;  5CYQ A;  4CJ3 A;  4N76 A;  4NCB A;  4AIL C;  1I39 A;  2IOC A;  4FXD A;  1S1W A;  4CJE A;  2G8K A;  3EZ5 A;  4CHQ A;  4LH4 A;  3M8Q A;  3MEE A;  4DSF A;  3LAN A;  1SL2 A;  3DM2 A;  3NFA A;  4I7F A;  4QAG A;  4J2A A;  1WSF A;  1TL1 A;  1RBV A;  1VRT A;  2E4L A;  5J1E A;  2XO7 A;  5HRR A;  3CG7 A;  3G10 A;  4RW7 A;  1QS4 A;  2WOM A;  4DLG A;  3KKS A;  2D5R A;  4ELT A;  3ZSZ A;  1ASV A;  4KRF A;  2B6A A;  1U45 A;  1SL1 A;  2FBY A;  2FBV A;  1RBS A;  3AVB A;  4KB1 A;  3CFP A;  5KGX A;  3O3H A;  5C24 A;  4FJJ A;  1EET A;  1S1U A;  4DQR A;  4CJR A;  2OA8 A;  1S5J A;  1WAF A;  3ISN C;  1MU2 A;  4DU1 A;  4CGG A;  1KFS A;  1YT3 A;  4DTO A;  3QET A;  4KTQ A;  3VQ8 A;  4FJI A;  1J5O A;  1TAQ A;  1ZBF A;  5SZT A;  3AA5 X;  4CER A;  1X9S A;  1X1P A;  2VG5 A;  3AVF A;  3KK3 A;  1VRU A;  3OYH A;  2HHT A;  1K6Y A;  4HCC A;  2EX3 A;  4IFY A;  3ZCM A;  4B9T A;  1XHX A;  2LSN A;  3SUO A;  1HQE A;  1O1W A;  3ULD A;  4CF9 A;  1D8Y A;  1KVB A;  1VSD A;  5KTQ A;  3OYB A;  4XIU A;  1RBU A;  3AV9 A;  4FLT A;  3TAF A;  1WLJ A;  3AA3 A;  2HNY A;  4E89 A;  4F3T A;  4KO0 A;  4OPJ A;  3FFI A;  5JS2 A;  1Q9Y A;  4PY5 A;  3AA2 A;  3KKR A;  4W5Q A;  1QE1 A;  3SUQ A;  5HRS A;  4O55 A;  1RTI A;  3HYF A;  4CEB A;  4F4K A;  4H8K A;  4B9L A;  2F8T A;  3O4Q A;  4NCA A;  3DOL A;  1SV5 A;  4JRQ A;  2YV0 X;  5DMR A;  1VK0 A;  4KKO A;  1SKR A;  4BE1 A;  4E1M A;  2YNF A;  3M8P A;  4M3Z A;  3SUN A;  1TVR A;  4B9U A;  1RT2 A;  4CEC A;  1SUQ A;  4FLU A;  5JS1 A;  4LH5 A;  1BQN A;  3ALY A;  3ITH A;  3V9S A;  4CGI A;  4HVJ A;  4KI6 A;  4KHY A;  3F73 A;  1DLO A;  3F9K A;  3LPT A;  4OKK A;  3NBP A;  4R5P A;  1LV5 A;  3BGR A;  2B5J A;  5FRN A;  2WON A;  3OJS A;  1HNI A;  1KLN A;  4CJS A;  1BCM A;  4LSL A;  1D9D A;  4O5B A;  3C95 A;  3HVT A;  3PY8 A;  1RDB A;  2D0A A;  4IKF A;  4BWM A;  3AVI A;  1UAX A;  4I2P A;  2HVI A;  3IRX A;  3ZSY A;  3ZT3 A;  3V1R A;  4CED A;  4DSE A;  1Y97 A;  3CM5 A;  1W9H A;  3QER A;  5HRP A;  1WSJ A;  4M42 A;  3AVN A;  1NJY A;  1J53 A;  2HHU A;  1ASW A;  2EHG A;  5I42 A;  4FZX C;  3TAP A;  1I3A A;  1TK0 A;  4M3T A;  3T3F A;  1LAW A;  4M3W A;  1KRP A;  3NCI A;  2KQ2 A;  4EZ9 A;  4Z4H A;  4DTU A;  3RRG A;  1RTJ A;  5J2N A;  2XRI A;  3AVC A;  3TAB A;  4M45 A;  4IDK A;  1J9A A;  4W5R A;  4DTJ A;  1Q9X A;  3IG1 A;  4ID5 A;  3TAQ A;  2X6N A;  3PUF A;  1C1B A;  3VA0 A;  3DLG A;  4G1Q A;  4CEE A;  3HXM A;  1C1A A;  2IGI A;  2OPS A;  1FKO A;  1JLF A;  2X6S A;  3A2F A;  4IBN A;  3LP2 A;  4CF8 A;  3TWH A;  2A1R A;  2QKK A;  3K2P A;  3PO5 A;  1GOB A;  2X74 A;  4C8K A;  3SV4 A;  1RCH A;  3RMB A;  2W42 A;  1KVC A;  4E0D A;  3OYE A;  2XY5 A;  1TV6 A;  2HNZ A;  1A5X A;  4B9N A;  3V6D A;  3QEP A;  2Y1J A;  2OPQ A;  2YNG A;  1IG9 A;  3HST B;  2VWJ A;  1ZBU A;  3PX0 A;  4AHU A;  3K5M A;  5HBM A;  3HM9 A;  4ZTF A;  4FK4 A;  3VN5 A;  1JLE A;  4JLH A;  1IH7 A;  1KFD A;  5HP1 A;  1EXQ A;  3ZT2 A;  3OS1 A;  4OLB A;  4FW2 A;  4DTP A;  2XY7 A;  3SQ4 A;  1BI4 B;  2OYQ A;  4HCB A;  3NDK A;  3OJU A;  4B08 A;  3T19 A;  5J2Q A;  2OZM A;  4FK2 A;  1HYS A;  2VWK A;  3SNN A;  3OYI A;  2HHQ A;  3JSM A;  1ZBI A;  3DRS A;  4LSN A;  2QKB A;  3ZSX A;  3NF7 A;  4CHY A;  5I3U A;  3WNH A;  1VSL A;  3KLG A;  5CY4 A;  1NK6 A;  1L3V A;  4CES A;  1JLQ A;  1JLA A;  1WSE A;  1Q8I A;  1TK8 A;  3NF9 A;  4IG3 A;  3V81 A;  3V9U A;  3SUP A;  5HLF A;  3OYG A;  2IS3 A;  2B4J A;  1L5U A;  4CEQ A;  1B92 A;  1C6V A;  1GOC A;  2VG6 A;  3ZSQ A;  3VQC A;  2I5J A;  3SV3 A;  1UA0 A;  3OVN A;  1T8E A;  3M8R A;  1NJZ A;  1HYZ A;  4CGD A;  1BCO A;  4OKE A;  4BDZ A;  2Z1G A;  2AJQ A;  4B8C A;  3OYK A;  4RG8 A;  1NOZ A;  3P83 D;  4CJ5 A;  3SI6 A;  3QIN A;  1S9G A;  4E1N A;  4CIE A;  4KHU A;  3MED A;  3NAE A;  1U48 A;  1KCF A;  4LY7 A;  4CK3 A;  1X9W A;  4FJ8 A;  3DMJ A;  2JLE A;  4CFA A;  2DY4 A;  3OS0 A;  1Z26 A;  1S1X A;  4C8N A;  3DLK A;  3UIQ A;  1JLC A;  4Y1C A;  3AO3 A;  2Z1I A;  3WNE A;  3KIO A;  2IDO A;  4E7H A;  1WN7 A;  1G15 A;  1B9D A;  1D5A A;  3HVR A;  3CYM A;  4FK0 A;  1HRH A;  1C1C A;  1BIU A;  5KI6 A;  2HB5 A;  2G8H A;  4DF4 A;  3OYD A;  1NJW A;  1UA1 A;  1QSY A;  1QSS A;  1WSI A;  1VSH A;  4RW9 A;  4M41 A;  3LWM A;  3LP0 A;  3KTQ A;  4FJM A;  3H08 A;  4M3Y A;  2QK9 A;  4FJX A;  4BAC A;  2BDP A;  1B9F A;  3SQ2 A;  3S3M A;  3NGI A;  1QSL A;  3S3O A;  4E7L A;  3HK2 A;  3QIO A;  2G8W A;  1WSG A;  1DTQ A;  3DI6 A;  2FBX A;  3P1G A;  3NF8 A;  1KSP A;  3HO1 A;  3SQ1 A;  2YHA A;  3KLH A;  1ZBH A;  4QCL A;  2E6M A;  4Z4E A;  4DSL A;  3WNF A;  4CF1 A;  3SCX A;  1RDD A;  3SPY A;  4DQS A;  1NJX A;  4FJ7 A;  3I8D A;  2OPR A;  1QHT A;  4OGC A;  2P1J A;  4M3U A;  4I2Q A;  4OKJ A;  3HPH A;  4OVL A;  3RMC A;  4CJQ A;  4O44 A;  3C94 A;  1JKH A;  1KTQ A;  4FJ5 A;  3LAM A;  3LP1 A;  4E7K A;  3ZSW A;  3B6O A;  3PX4 A;  1S6Q A;  3L8B A;  3DLE A;  4FW1 A;  1ZBL A;  4KB0 A;  3DRR A;  4Z4G A;  4HTU A;  3SJJ A;  4CK1 A;  1JXB A;  3LPU A;  1NOY A;  5C42 A;  3V9X A;  1JXE A;  1RT3 A;  4AHV A;  3KLE A;  3TAE A;  2P5G A;  3NGY A;  3VQ5 A;  4CHP A;  4FYD A;  4DF8 A;  3I0R A;  2BAN A;  3DYA A;  3VQB A;  4DS4 A;  3VA3 A;  4GVM A;  3KJV A;  3QIP A;  3U6F A;  1C0M A;  1NK9 A;  4B3O A;  3RR7 A;  2JGU A;  1S6P A;  3TAN A;  1NKB A;  3QNO A;  4F3O A;  5E41 A;  3K5O A;  4FZY A;  4KHW A;  1NK8 A;  1JL1 A;  3QEV A;  3RMA A;  1D9F A;  1TKX A;  4B9V A;  4CHN A;  4YNQ A;  4Q0B A;  3HL8 A;  2KW4 A;  1TGO A;  3OYL A;  1RBR A;  4N5S A;  3RTV A;  1IKY A;  3QLH A;  1SKS A;  3TAM A;  4CEF A;  4N56 A;  1TK5 A;  1NKE A;  1YVU A;  3RRH A;  4J2B A;  3EY1 A;  4ID1 A;  4KFB A;  4HHT A;  4BE0 A;  3LAK A;  4KV8 A;  4KRE A;  2P51 A;  3CFR A;  5FRO A;  4AHC A;  4I9Q A;  5D3G A;  4H4M A;  4AH9 A;  2RF2 A;  3TI0 A;  4FJK A;  2YNI A;  4CHO A;  4M3X A;  4J2E A;  2O4I A;  1W0H A;  1TAU A;  3AO4 A;  4DMN A;  2YNH A;  3L2U A;  3MAQ A;  2XY6 A;  5J2P A;  1VSJ A;  3LZI A;  4DQQ A;  3VQD A;  4E7I A;  4EP4 A;  2E6L A;  1R0A A;  2RN2 A;  4FM0 A;  2XHB A;  2YHB A;  4DFJ A;  4NCG A;  3ZSV A;  4DFM A;  1NK7 A;  1HQU A;  2HHS A;  2IAJ A;  5C25 A;  2GUI A;  1BQM A;  2D0B A;  4DFP A;  4KHN A;  2VG7 A;  4N41 A;  4CF0 A;  1SKW A;  3G0Z A;  1C0T A;  3NE6 A;  1TL3 A;  4FM1 A;  1BL3 A;  2HND A;  4DS5 A;  3V9W A;  5HRN A;  2GBZ A;  2Y1I A;  4RW8 A;  1U49 A;  2X78 A;  4CF2 A;  4C8O A;  1ITG A;  3CM6 A;  5CYM A;  4CEA A;  2Q3S A;  4N47 A;  4CJV A;  2KTQ A;  2Z1H A;  1UWB A;  2FBT A;  3PX6 A;  3C6T A;  1UOC A;  1CZB A;  4GW6 A;  4FJN A;  3DRP A;  4NYF A;  2ITG A;  4KTZ A;  4CFD A;  4CE9 A;  3D0P A;  3IS9 A;  2YKN A;  5T7B A;  1KLM A;  1S1T A;  2Z1J A;  3AVK A;  3NH1 A;  4JS5 A;  2GV9 A;  3QES A;  3IAY A;  4KI4 A;  4HUG A;  4CIF A;  2D0C A;  2DFH A;  1CLQ A;  1JL2 A;  4JS4 A;  3SPZ A;  3SZ2 A;  4KPY A;  2O4G A;  1DTT A;  1WSH A;  3HPG A;  3OYA A;  3V9Z A;  4DLE A;  4O0J A;  3VQQ A;  3SQ0 A;  3RWU A;  4C8L A;  2PY5 A;  4K8X A;  4OPK A;  5HRO A;  2HHW A;  4DQP A;  1CXQ A;  2G8U A;  1WNS A;  4CGF A;  3OS2 A;  3HP6 A;  3RR8 A;  4CIG A;  2ETJ A;  3AA4 A;  2BE2 A;  3S3N A;  4F2R A;  1FK9 A;  2ZQB A;  3KD5 E;  1LW2 A;  1QQC A;  3L3U A;  1ZYQ A;  1NK5 A;  1T05 A;  2KFZ A;  3QEI A;  1LWC A;  5CZ2 A;  1L3S A;  3CFO A;  1C0U A;  1S1V A;  3AVG A;  4CJP A;  3L2W A;  4RW4 A;  4CJF A;  5FRM A;  4CK2 A;  3PO4 A;  4AHT A;  3L2V A;  1EP4 A;  3NH2 A;  4ZTJ A;  3JYT A;  3OYN A;  3M8S A;  4TSX A;  4I9L A;  3THV A;  1IO2 A;  1HYV A;  2DFE A;  4AHS A;  4YFU A;  1U47 A;  1L3U A;  1RTD A;  3KK2 A;  3V1O A;  4E3S A;  4DFK A;  3L2Q A;  1J54 A;  1ASU A;  3D45 A;  4IG0 A;  2IC3 A;  3ZT4 A;  3AO2 A;  1NK0 A;  3VQE A;  4CFC A;  4CJU A;  3OYM A;  1HJR A;  2F96 A;  3CQ8 A;  4CHZ A;  1F21 A;  2RKI A;  1NKC A;  5SWM A;  1RT5 A;  1XWL A;  3S9H A;  3AVA A;  4FM2 A;  4PWD A;  3OYC A;  3DLH A;  4CEO A;  3P5J A;  3O3F A;  1RIL A;  1FKP A;  4DWI A;  4ELU A;  1U04 A;  3ZSO A;  1RTH A;  4FLX A;  1X9M A;  3MEC A;  2P5O A;  1JLB A;  1IKV A;  3K58 A;  1L3T A;  4B9M A;  5CZ1 A;  2OZS A;  2G8I A;  2HHX A;  2RPI A;  5J2M A;  2HHV A;  4OJR A;  3C6U A;  4CJL A;  4DTX A;  1YTU A;  2QXF A;  3I0S A;  5KRT A;  2HW3 A;  4UQG A;  3EYZ A;  1LWE A;  3MXJ A;  4H4O A;  1BI4 A;  1BIS A;  1KVA A;  3K59 A;  3LDS A;  3QEW A;  4C8M A;  1EX4 A;  1LAV A;  1VSI A;  3ZT0 A;  4CFB A;  4W5O A;  3K5N A;  4Q5V A;  1CZ9 A;  3KD1 E;  1T03 A;  1XHZ A;  4RW6 A;  3TAG A;  1T7P A;  4K8Z A;  4DSI A;  4KHS A;  3RMD A;  1WAJ A;  3AVM A;  4WE1 A;  4ELV A;  4OGE A;  1RT7 A;  3AO5 A;  3VQ6 A;  4W5T A;  2F8S A;  2YKM A;  2A1S A;  1RDC A;  3WNG A;  4DTM A;  1XC9 A;  1RNH A;  1IKW A;  3AVH A;  3PV8 A;  2PYJ A;  4CJ4 A;  4DTN A;  4FLY A;  1S9E A;  1VSM A;  1TKT A;  4F2S A;  2HMI A;  1QTM A;  2PYL A;  1GOA A;  2KZM A;  3HT3 A;  1SL0 A;  1HPZ A;  1LWF A;  2NUB A;  2DTU A;  2G8F A;  3QNN A;  2FC0 A;  4AHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...