4CFBA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfbA00
4W5QA 3TR8A 3L2UA 3K5LA 4CIGA 4W5RA 4Z4FA 2BGGA 4CF8A 4DU1A 2NUBA 4OKEA 1S1XA 5FRNA 3CM5A 4OLAA 1RBUA 3OS0A 1L3SA 4CHNA 1JKHA 3HO1A 3S3MA 4M3TA 3KLEA 1REVA 3EY1A 1UA0A 2GUIA 2XY8A 4M3RA 4CFBA 3SI6A 4ELVA 2P5GA 4KI4A 2HHUA 1A5XA 3VQ4A 4DG1A 1VRUA 2BANA 4B8AB 3OYKA 5I3UA 3MEDA 4CF2A 5J2NA 2D0BA 3AVJA 1NJYA 1TKXA 2IGIA 3AVNA 3P5JA 2IOCA 4KTWA 5HRSA 1C0UA 5D3GA 3E01A 3QINA 1KFSA 2HHXA 3ISNC 3KLHA 4FLZA 3VQDA 5I42A 4C8LA 5E41A 1RT7A 3LP3A 4DSFA 2ZD1A 3O4NA 4DFPA 1D8YA 4HUEA 4FK0A 1WSEA 4JS4A 1VSEA 1TL1A 2F96A 4B9VA 1VK0A 3AVMA 1LV5A 3ALYA 2P1JA 4CIEA 1SV5A 5KRTA 2OYQA 1TV6A 1HYSA 1HPZA 3RMCA 4B9MA 4DTNA 1X9SA 2G8HA 4PWDA 1S1VA 4OKKA 4OGCA 4B8CA 3KIOA 4CGFA 3MEGA 4C8NA 4KTZA 4J2DA 3AVLA 4ZHRA 3AVHA 4CESA 3SCXA 4Z4IA 1G15A 3IRXA 4CEEA 4M3ZA 1W9HA 4JLHA 2KQ2A 1YT3A 1RT2A 3HSTB 3L3UA 4K8XA 4FW2A 1CXUA 4FW1A 4FZZA 1U04A 2HHVA 4KO0A 1MU2A 3CG7A 4I2QA 4PUOA 4NCBA 1NJZA 4DTOA 1WAFA 4Z4HA 3DLKA 4KHYA 3KD1E 3G10A 5HRNA 4RW9A 4FJ7A 4J2AA 4G1QA 3S3NA 2XHBA 4AHUA 3V9SA 4H4MA 4EP5A 4YNQA 4DS5A 3PY8A 3CM6A 2KFZA 1XHXA 4BDYA 1NOYA 1RDDA 1KCFA 3SPZA 1S6QA 1HNVA 1WN7A 4CJLA 4F4KA 3TWHA 4XIUA 3KTQA 4KKOA 1HYZA 3NGYA 2VWKA 3HJFA 2KZMA 4GVMA 4E7HA 1U47A 4OLBA 4DTSA 1L3UA 4CHZA 4FLUA 1X9MA 1RBRA 3OVNA 3QEXA 1TKZA 1SKSA 2G8WA 1TKDA 1WSFA 1HQEA 1NKEA 1KFDA 4N76A 3DMJA 4N5SA 2OPPA 3LAMA 4KHWA 4O55A 1JXBA 4C8MA 4B9UA 3QEIA 2OPSA 1C1AA 3L3VA 3A2FA 4I9LA 4CECA 3NH2A 3HM9A 2W42A 1EETA 3AVKA 3F73A 5CYMA 3CYMA 3LDSA 4CEFA 4CJTA 2WONA 3VQ8A 4KHNA 4CJFA 2HVIA 5KI6A 3T3FA 1C1CA 1Z25A 2E4LA 4AHRA 4RG8A 3L8BA 2DY4A 1QS4A 4HVJA 2YNGA 3LWMA 1SL0A 4FJHA 1BL3A 2BDPA 4DSKA 4ZTFA 2D0CA 1ASUA 3V9UA 1JLGA 2QXFA 3NF6A 2HHSA 1ZYQA 3OYIA 4DLGA 3CFPA 3M8RA 3VQBA 1IO2A 3NDKA 1JXEA 3VQQA 4AHSA 4C8OA 1WAJA 4IKFA 4DTMA 3LZJA 3I0SA 1BI4A 1RBSA 2JLEA 4CE9A 1GOCA 3WNGA 3DLRA 1WSHA 4LH5A 1VSHA 1I39A 5CZ1A 4FJMA 4DTRA 3PO5A 1RT3A 1A5WA 2EHGA 2XY6A 3TARA 1VSMA 5FROA 3HYFA 1VRTA 3G0ZA 3HPOA 3HP9A 2XY7A 3KKRA 3SJJA 2PY5A 4CHYA 1YTAA 2Z1JA 4Q5VA 4HTUA 1B9FA 3EZ5A 3NGZA 4FLWA 1VSFA 4FJ8A 1ITGA 4E7KA 4F2SA 3QEPA 3AO2A 2PYJA 4IG3A 4H8KA 1KRPA 4W5NA 3D45A 3QESA 4IG0A 2PYLA 3NAEA 1NK5A 4QCLA 4KV8A 4DF8A 1XC9A 3DLGA 3QO9A 4Q0BA 3MEEA 4KHUA 1QSLA 3HVTA 4CJEA 3D0PA 2R7YA 2QK9A 1RTJA 1YTUA 3OYBA 3OYCA 3PX6A 4CHQA 3RR8A 2P5OA 3NHGA 2BE2A 1VSIA 1KVBA 1QHTA 1VSJA 3LP0A 2G8FA 2Z1GA 4DLEA 3VQPA 3O3GA 1L3TA 2GBZA 2X74A 4QOZB 3OJSA 1TK8A 4LD0A 3IAYA 1RTHA 1SUQA 4TSXA 4CJUA 3V9ZA 4KTQA 1CZ9A 1HJRA 4B08A 1LAWA 4Y1DA 5EU7A 3RWUA 3DLHA 4DTJA 4LSLA 4B9NA 4W5OA 4I2PA 3PO4A 4E7JA 2O4IA 5CYQA 4E1MA 3ZT0A 3NH0A 1HMVA 5J2QA 4EP4A 3HPGA 4FLYA 1R0AA 1JLAA 1RNHA 3C95A 3KD5E 1Q8IA 3K59A 4LY7A 1NK0A 3DI6A 2OZSA 2FBXA 5HROA 4N41A 3OYJA 3I8DA 1JLFA 4B9LA 4FLTA 2HNYA 1RBTA 4F8RA 1S1UA 3KLFA 2G8VA 3NH1A 4CFAA 1I3AA 4KPYA 3BDPA 3TAQA 3OYAA 2HHQA 4RW4A 4DQRA 3WNEA 5J2PA 4DQIA 5T7BA 1BCOA 3AA5X 5DMRA 2QKBA 5K14A 1FKOA 4AHCA 3OYFA 4FK2A 4FM2A 3SV4A 4LSNA 3MXMA 4CJRA 2YKNA 4FXDA 3ITHA 4M3UA 1LAVA 2XRIA 4QAGA 1ZBUA 4M42A 3C6UA 3LANA 1TK0A 1GOBA 3VQ9A 3LAKA 4PY5A 1EP4A 4O0JA 3AO3A 4DQPA 4HHTA 4Z0UA 4AHVA 3AV9A 1JL2A 4J2BA 4OGEA 1BQNA 1SL1A 3ZT3A 4ID5A 3B6OA 4DTUA 4CF0A 4BWMA 1LWCA 4CF9A 2Z1HA 3ULDA 2YNFA 3OYHA 3ZCMA 1DLOA 2YNIA 3AA3A 3OYDA 3KK1A 3U3GA 5FDLA 3TAFA 1BGXT 1CXQA 1RT5A 4DWIA 4HUGA 4BE1A 4FCYA 1GOAA 3T19A 4ID1A 3NBPA 4N56A 2DFHA 4CGHA 4DQSA 2HHWA 4EZ6A 3MXJA 3KKSA 4GW6A 1F21A 3VA0A 4Z4GA 4DSEA 1C6VA 4CGIA 2ZE2A 4UQGA 3ZSVA 3DOKA 5FRMA 1BCMA 4RW6A 1BQMA 5C25A 3S3OA 3AVIA 4DSIA 4L8RB 3SQ1A 1TGOA 4K8ZA 3LP2A 3P1GA 4CJWA 3ZT1A 3L2QA 3THVA 1LWFA 1Z26A 4DSJA 5CZ2A 4FK4A 1VSLA 1WNSA 4O5BA 1U49A 2PZSA 3DYAA 1Q9XA 3SUOA 4DU3A 1JLQA 4KREA 3LALA 4FYDA 3NCIA 2YV0X 3KK2A 3OYNA 4FM1A 3SV3A 1KLNA 4Z4EA 2KZZA 1O1WA 4CFCA 5HBMA 2X6NA 4JRQA 1C0TA 1UAXA 2VG6A 1K6YA 3PX4A 1BI4B 2RN2A 3TAGA 1TK5A 1HQUA 4H4OA 4FZYA 3K5MA 3RMAA 2HHTA 1EKEA 3QNNA 1L3VA 2IAJA 3TABA 4Y1CA 3KLIA 1TAUA 3HL8A 4FJJA 3UIQA 1S1TA 2GV9A 3C94A 3DRPA 4DTXA 3S9HA 3K58A 1RCHA 3TAPA 3RR7A 1C0MA 3ZSRA 4B9SA 1B9DA 4BWJA 2KTQA 3JYTA 4M41A 3AVFA 1NK8A 2G8IA 2LSNA 3V81A 3SQ0A 2VG7A 5KRSA 4R5PA 4CHOA 1VSDA 3QNOA 1UWBA 3ZT4A 4O4GA 3AO5A 4O0IA 4W5TA 1S6PA 2P51A 4YFUA 4DFMA 3LWLA 1ZBHA 4DF4A 1S1WA 4JS5A 3QEWA 3IS9A 4IFVA 4BDZA 1NKBA 3T1AA 1FKPA 3AVCA 3O3FA 3NGIA 4FZXC 3QEVA 1NJXA 1U48A 3ZSWA 3MAQA 2XY5A 1L5UA 4CEOA 3TAEA 4M45A 1XI1A 5SZTA 3PX0A 1NK7A 5C24A 4MQ3A 3KJVA 1QSYA 4FJXA 3OY9A 4DFJA 1BHLA 5C42A 3QETA 3AVBA 2OPRA 1WSIA 4LH4A 2X78A 2JGUA 4NYNA 3VN5A 3TI0A 2DFEA 4CJQA 3ZSQA 3ZT2A 1KVAA 2FC0A 3NFAA 4FJGA 2HNDA 3SZ2A 3F9KA 3RMDA 2E6LA 2ITGA 3AA2A 1ZBLA 3DLEA 3RMBA 3QERA 3ZSXA 1EX4A 1VSKA 3DOLA 1IKXA 1DTTA 1DTQA 4F3TA 3AVAA 3NE6A 3V4IA 1UA1A 5KGWA 1J54A 1NJWA 4FJ5A 1FXXA 1QE1A 3SUQA 2A1SA 3NF9A 4OPKA 4B3OA 1D5AA 4AH9A 4HCBA 1D9DA 1T8EA 4M3XA 4KFBA 1QTMA 1RDBA 5CY4A 1ZBIA 3TAMA 4NCGA 4DU4A 4FVMA 3SNNA 1Y97A 4CEZA 2ETJA 3LPUA 1FK9A 4CK1A 1LWEA 4CJSA 1U45A 4Z4CA 2VG5A 3AVGA 4CJKA 1N6QA 2VWJA 1KTQA 3FFIA 5HLFA 1YVUA 1SKWA 1N5YA 4E0DA 3LPTA 4BACA 4CJ5A 1HNIA 4DMNA 1KVCA 4CK3A 4FM0A 1TL3A 4FJIA 1IKWA 1RDCA 4NYFA 4F3OA 1ASVA 4CEBA 2HMIA 4CHPA 1LW2A 1SKRA 2OA8A 4C8KA 3RTVA 4PA1A 4E19A 4E7LA 4KB1A 5HP1A 3IG1A 1KLMA 3NF7A 5KTQA 4WE1A 4OJRA 1J5OA 3L2VA 3QLHA 2IDOA 1J53A 4DFKA 4E89A 3OS2A 4ELUA 2YNHA 5DK5A 4PQUA 4CGDA 4CGJA 4AILC 1D9FA 3KLGA 2WOMA 3HXMA 3SUNA 3PV8A 4BE2A 3WNFA 2FBYA 4FLVA 3C6TA 4N47A 1T05A 2G8UA 4CEAA 1RTIA 2HNZA 3V9XA 2E6MA 4CJ3A 4NCAA 4CEQA 1T03A 2XO7A 1TVRA 1BIZA 3WNHA 4J2EA 3AA4A 3VQCA 2I5JA 2X6SA 2FBVA 3VQAA 2DTUA 4M3WA 5JS1A 3L2RA 3CQ8A 2Z1IA 3VQEA 4EZ9A 4CCHA 3U3YA 4OPJA 3HT3A 1IKVA 3M8SA 4OKJA 4FJLA 2RF2A 5SWMA 2F8TA 1XHZA 2FBTA 5HRRA 2ZQBA 4BE0A 1QQCA 4I7FA 4CK2A 3QIPA 3M8PA 1ASWA 3P83D 4E7IA 1IG9A 4M3YA 3ASMA 3AO4A 3CFOA 2QKKA 3BGRA 4BDPA 2D0AA 3OJUA 3DRRA 3ZSYA 3K5NA 2OZMA 4ICLA 1T7PA 1Q9YA 1TAQA 4GMJB 4CJ4A 3KK3A 4JRPA 5J2MA 2RKIA 4B9TA 4CJPA 2B4JA 4DQQA 3SQ2A 1HYVA 5JS2A 2KFNA 3B6PA 2HVHA 2Q3SA 2B6AA 3VA3A 3L2WA 3V6DA 1RT1A 4KRFA 4AHTA 4CERA 4IFYA 2KW4A 3AO1A 1KSPA 1BISA 5HRPA 3V1QA 1C1BA 1X1PA 1RT4A 1TKTA 3V1RA 1JLEA 3U6FA 3TANA 3K2PA 4CGGA 2Y1JA 1WLJA 3OYMA 2D5RA 3PUFA 3DLBA 1HRHA 1RDAA 4MFBA 4CJVA 4FJNA 3OYLA 2G8KA 1JLBA 4ELTA 4IBNA 4FJ9A 1IH7A 3DRSA 4KHQA 1XWLA 1ZBFA 4RW8A 2YHBA 3O4QA 3HP6A 3HVRA 1RILA 3M8QA 3OYGA 2YHAA 3DM2A 4CIFA 1U4BA 3RRGA 1CZBA 4HUFA 3SPYA 3LP1A 2IC3A 4O44A 4CFDA 5J1EA 4DS4A 3VQ5A 2F8SA 1SL2A 1WSJA 1S9GA 2EX3A 4IDKA 3CFRA 1WSGA 1JL1A 1LW0A 1NK6A 3QIOA 1NOZA 1JLCA 2ATQA 1QSSA 1RBVA 1UOCA 2B5JA 3LZIA 4KI6A 2AJQA 3HK2A 4ZTJA 3ZSZA 4E3SA 2O4GA 1X9WA 2HB5A 3RRHA 2DFFA 4KHSA 4E1NA 3V9WA 3OS1A 1W0HA 3H08A 3HPHA 1NK4A 4KB0A 3O3HA 4FLXA 4DTPA 1CLQA 3MECA 3MXIA 4F2RA 4KAZA 2YKMA 4I9QA 1RT6A 5KGXA 2OPQA 1S9EA 1EXQA 4CF1A 2Y1IA 3I0RA 4HCCA 3VQ6A 1IKYA 3NF8A 1BIUA 1B92A 2IS3A 3V1OA 4DSLA 4FJKA 1NK9A 3OYEA 3JSMA 2HW3A 3ZSOA 3SUPA 4RW7A 1A5VA 1J9AA 4OVLA 3K5OA 1S5JA 3K57A 2A1RA 3VQ7A 3SYZA 3SQ4A 4CEDA 1RTDA 2RPIA 1NKCA 3EYZA
chains in the Genus database with same CATH superfamily
4W5QA 3L2UA 4CF8A 4OLAA 3DJCA 1CZAN 3CCJN 3LDLA 3EE8A 4M3TA 3QB0A 4M3RA 4ELVA 3AAPA 3J80O 2P5GA 2NRRA 3HOTA 3OYKA 5J2NA 2RHKA 4CF2A 1JCEA 1YXQA 1QZ5A 3UKUB 3R8EA 3P5JA 3AVNA 5HRSA 3E01A 3ID8A 3E9OA 3ISNC 3KLHA 4FLZA 3ZX0A 3LP3A 4DFPA 4HUEA 4FK0A 4JS4A 1TL1A 3WUHA 3MN6A 3ALYA 2P1JA 4CIEA 1SV5A 3VENA 1HYSA 4B9MA 4A62A 1IBLK 2VCPA 5AJ3K 3AVLA 3UKRA 3AVHA 4Z4IA 3WXLA 1G15A 4IEIA 3DXMB 3L3UA 4LF7K 4K8XA 3F2KA 4FW2A 4X66K 4FZZA 1EO1A 4KO0A 3FFKB 1NJZA 3P38A 2IVPA 3D2FB 1SAZA 4FJ7A 3C7NA 4J2AA 4IJAA 4M42A 2XHBA 4R79A 3V9SA 1SZ2A 3CM6A 4H5WA 5AQTA 2P9KA 4BDYA 3T1YK 1KCFA 4CZLA 1HNVA 4JKGB 3M1FA 4C23A 3NGYA 2GUPA 4DTSA 4EHUA 2F4VK 5GIPA 4EFHA 3I56N 2GWJA 1WSFA 4GKJK 1KFDA 3DMJA 3LAMA 4O55A 2EWSA 4F3TA 1KD1O 3L3VA 3A2FA 1XC9A 5AQJA 1EETA 3LDSA 1GLDG 4JI6K 5KI6A 1C1CA 4LF5K 1Z25A 2E4LA 4RG8A 4ILHA 3RVCA 4PL7A 4XH1A 4HVJA 4DSKA 2D0CA 3V9UA 4DLGA 3CFPA 4PKHA 3ZETA 4AHSA 4IKFA 2ZJRL 1NGCA 4H5RA 5AQWA 1QQOA 2NRWA 1GOCA 5CZ1A 5KPZA 3JS6A 4H5TA 3SK3A 1VSMA 3HYFA 4FWSA 2HSTA 3VF6A 2VGMA 3J81O 5JVHL 4E7KA 1Q7YO 4W5NA 3VF2A 2V7YA 1NK5A 4CJ7A 3DLGA 4Q0BA 1XMOK 1KAXA 2OCEA 1HLUA 4KHUA 3D0PA 4BRDA 1ATRA 1Y64A 3OYBA 3OYCA 4CHQA 4A61A 3NHGA 2Q36A 4MLEA 3LP0A 3LDNA 3H1VX 3VQPA 1L3TA 1OH6A 4JI5K 2FXUA 1RTHA 1SUQA 4TSXA 3SMPA 5FPMA 3V9ZA 1CZ9A 4KTQA 1HJRA 3MN7A 4B08A 1LAWA 4Y1DA 3RWUA 3DLHA 5AQRA 3HZ6A 3O08A 4W5OA 4I2PA 3PO4A 4FLYA 1R0AA 1Q8IA 1NK0A 4B3SK 3VEXA 4GV3A 4N41A 4B1ZA 3U9DA 2P9SB 1S1UA 3BEXA 2G8VA 2VQEK 1I3AA 3BDPA 3TAQA 3OYAA 1WBBA 1YJ9N 4PL8A 5DMRA 4FM2A 4CJRA 1LAVA 4QAGA 1ZBUA 3LANA 3ENBA 3AARA 3LAKA 3THWB 1EP4A 2W6KA 4JKCA 4O0JA 4AHVA 3QDKA 1JL2A 4J2BA 4YOVA 4ID5A 3B6OA 4BR7A 1NG9A 2KKZA 4CF9A 3ULDA 2YNFA 4CBXA 3ZCMA 5JICA 1VQ9N 3T19A 3MXJA 1ZXOA 3KKSA 1P90A 3OTOK 3DXMA 4DSEA 2ZE2A 3NVMA 5FRMA 1BCMA 4DSIA 5C25A 3K0SA 3LP2A 3P1GA 3LDPA 1LWFA 3D2FA 3CCVN 5C15A 3U4LA 4MDAA 1WOQA 3M6GA 1Q9XA 1V4SA 3D2EB 4KREA 3NCIA 4FM1A 1KLNA 1O1WA 2WFBA 5HBMA 2X6NA 1BI4B 2RN2A 5M1NA 3VTIA 4B1XB 2ZF5O 3R9PA 2P9IB 3K9KA 1S1TA 3DRPA 3QMLA 3RR7A 1B9DA 2O8FB 2LSNA 1OH7A 1VSDA 4O0IA 4MO4A 1H1VA 1S6PA 2P51A 4YFUA 1ZBHA 1S1WA 2KHOA 4IFVA 2FF3B 3AVCA 4A5AA 3NGIA 4FZXC 3CMEN 1X3NA 2E88A 1U48A 2QWMA 2F9WA 1L5UA 1KQSM 3TAEA 4FJXA 3CPEA 3CQYA 1BHLA 3QETA 4JI1K 2OPRA 3MWPA 5F2RA 2JGUA 4NYNA 1OH5A 4WF9L 3ZSQA 5LMNK 4FJGA 2Q97A 4FPBA 3SZ2A 4PKGA 2ITGA 3AA2A 2A41A 2VQFK 3ZSXA 1DTTA 3V4IA 2UYTA 1NJWA 1FXXA 4HCBA 1T8EA 2V7ZA 1IV0A 5EX5A 5CY4A 3TAMA 1T6CA 4FVMA 3SNNA 4CEZA 3LPUA 1FK9A 4BG9A 4CK1A 1YI2N 4Z4CA 2VG5A 3AVGA 4YOTA 3FFIA 2YJFA 5HLFA 1YVUA 1SKWA 2E1ZA 2UXCK 5F0XA 4DMNA 4FJIA 2QA4N 2WTUA 4CHPA 1GLCG 1MWMA 3RTVA 4JKFA 4KB1A 5KQ8A 3IG1A 3PIOL 5KTQA 4OJRA 4NB4A 3QLHA 2AA4A 4E89A 1GLBG 4CGDA 4CGJA 1D9FA 2WOMA 3HXMA 4CZFA 4LFBK 3NMUA 4JKDA 2I7PA 1T05A 2P9SA 4N47A 3DLLL 3H3OB 2HF4A 3HBTA 2E6MA 4CJ3A 4B3RK 3ZYYX 1BIZA 4J2EA 2VWBA 3CQ8A 1ZBSA 2P9NB 2QM1A 1IKVA 3GE1A 3OW2M 3ZX2A 3THWA 2V52B 5M1PA 1ASWA 1IG9A 3BY5A 3MN5A 4I6MB 2D0AA 3OJUA 3P39A 2UXDK 2OZMA 1T7PA 4ISFA 3DWLA 3KK3A 4JRPA 4AM6A 5J2MA 2IIRA 3SQ2A 2HVHA 2Q3SA 3EEQA 4QS8A 2B6AA 3VA3A 1VHXA 4QS9A 5H1SQ 1X1PA 4IWVA 4CGGA 3PSIA 1HRHA 3JAMO 2HOEA 1D4XA 3OYLA 1JLBA 3B8AX 4IBNA 1IH7A 1BOTO 3CPWM 2BTFA 3HVRA 1O13A 4CIFA 3FZFA 4BY9C 5J1EA 3VQ5A 1SL2A 3D2EA 1WSJA 1S9GA 2EX3A 3CJCA 4JK7A 4FO0A 4DKWA 1U2VB 2WBNA 5AQGA 3ZSZA 1ESVA 2DFFA 5AQNA 2P9IA 1GLEG 1NMDA 3THXB 4BGBA 2Q0RA 5KQDA 4E1JA 3O3HA 4DTPA 4I9QA 4F2RA 3ATVA 5BRDA 1RT6A 4HCCA 3VQ6A 3SAGA 3MCPA 1T6DA 4FJKA 3OYEA 2HW3A 5LL6Z 3GL1A 1VQ6N 4RW7A 1J9AA 1C0FA 4BRFA 2NRXA 1VQ4N 3K5OA 5AQVA 2ZJQL 5TKWA 3EYZA 4KH6A 4M7XA 1GLAG 4CIGA 4W5RA 4OKEA 5FRNA 3CM5A 3OS0A 4CHNA 3S3MA 3KLEA 3SI6A 3Q7CA 4A2BA 2HHUA 1A5XA 2QWQA 3VQ4A 1VAZA 3CJBA 5I3UA 2D0BA 2HBJA 3QINA 4BR9A 5C10A 3P4IA 3VERA 5E41A 1RT7A 2ZD1A 5CR4A 3O9TA 3TSPA 4JD2B 2JWLA 1HNWK 2O8BB 1VQNN 1VK0A 1LV5A 2O8DB 3EE9A 5AZIB 1S1VA 2QWRA 4BVPA 4CGFA 3MEGA 1YF5L 3N4QA 4CESA 4DUZK 3IRXA 4M3ZA 1N34K 4K41A 4JN4A 2KQ2A 1I94K 3SBGA 1CXUA 4FW1A 1WAFA 1XMQK 4FWQA 4G1QA 4DS5A 2KFZA 3TSQA 3PY8A 1XHXA 3SPZA 1WN7A 4CJLA 1SS6A 2WC9A 4DV3K 3KTQA 1HYZA 1C0GA 3BP8A 4GVMA 3AGKA 5E26A 2QWPA 2YCHA 4BC3A 3OVNA 4MDBA 1TKZA 1SKSA 1HNZK 1HQEA 4FVUA 4RCHA 2P9NA 4LF6K 4H5VA 2OPSA 4CECA 3HM9A 3F73A 2W42A 1Z6RA 4JNEA 2A6AA 4CJFA 3T3FA 2A5XA 3L8BA 4I6MA 1QS4A 2YNGA 3KK7A 3WXMB 3LWMA 1SL0A 4YY3K 2F7TA 3LDOA 1DKGD 1ASUA 2QXFA 3NF6A 4WFNL 1ZYQA 3EL2A 3VQBA 3NDKA 1JXEA 4DTMA 3DAWA 3Q7BA 2JLEA 1HKCA 2E8AA 3DLRA 4LH5A 2PBDA 4AM7A 1BUPA 3A5MC 2XY6A 3TARA 5C0YA 1NU0A 3HP9A 2PY5A 4Q5VA 1B9FA 3EZ5A 1ITGA 5CE3A 2PYJA 3FE1A 5BRFA 2PYLA 1XUPO 4QCLA 4CW7B 4JI3K 3MEEA 5BPNA 1BA0A 5E84A 4LF8K 1HKGA 5BN9A 1RTJA 1U2VA 1T3VA 3TTDA 3RR8A 3OHRA 4C1NI 1VSIA 1KVBA 1VSJA 3AAQA 1RFQA 3VGKA 3CC4N 3O3GA 3GBTA 2GBZA 2X74A 1HR0K 1LOTB 5DM7L 5LY3A 5EU7A 3CD6N 3VEVA 4B9NA 1HMVA 4CZEA 2UXBK 3KD5E 3K59A 4LY7A 3DI6A 3ULEB 2OZSA 5HROA 3I8DA 3C6HA 4FLTA 1RBTA 3JXUA 4F8RA 2HBMA 3UB5A 3W3DA 2HHQA 4RW4A 4RWTA 4B1UB 3H46O 5K14A 1FKOA 3SLCA 4AHCA 4FK2A 3SV4A 4GKKK 5CHIA 4DR4K 4M3UA 3N4PA 3C6UA 1TK0A 1GOBA 3KHYA 4DQPA 1BO5O 4OGEA 1VQKN 2Q31A 3CJ1A 4WQ5A 3ZT3A 5GINA 4ISEA 4J8FA 4CF0A 2Z1HA 2P9PB 2NRVA 2P9LB 2O8BA 3EO3A 3AA3A 3KK1A 3U3GA 1IBMK 2GTDA 5FDLA 4CZKA 4DWIA 4DQSA 3NBPA 4OX9K 4EZ6A 4BC5A 1F21A 4UQGA 5BR9A 4H0TB 4RW6A 1NGHA 3AVIA 3F9MA 3SQ1A 3TPQA 2QK9A 1K73O 4DSJA 3BUZB 4FK4A 1VSLA 4O5BA 4G9ZA 4XH4A 1JLQA 4FYDA 2QXLA 3OYNA 4CFCA 1C0TA 2VG6A 4FZYA 1K6YA 1TK5A 1TUUA 5KPRA 3RMAA 1EKEA 3QNNA 3KLIA 3ZX3A 4IOAL 3C94A 3S9HA 3D7EO 3K58A 3TAPA 3CJAA 4M41A 2KZMA 3SQ0A 2VG7A 5KRSA 1UWBA 4DR2K 3AO5A 4PHTX 1WBDA 4DV2K 4DF4A 4BRMA 4JS5A 3KVGA 3SJHA 1FKPA 3G71N 3O3FA 4FWRA 5F1XA 5MLCQ 3VEOA 4M45A 1K8KB 4WFAL 1NK7A 1N33K 4DFJA 4JI4K 4CBWA 5C42A 1WSIA 2FLOA 4DHYA 3NFAA 1FW6A 3H6EA 3O1WA 4FWKA 4IXCA 1ZBLA 3DLEA 1EX4A 1VSKA 3DOLA 1IKXA 3AVAA 3QFUA 1UA1A 3FZMA 4CZMA 1QE1A 2A1SA 4OPKA 1D5AA 1R59O 1WUAA 2E2OA 2ETJA 3C6AA 1LWEA 1U45A 1N6QA 1KTQA 4CD3A 4E0DA 4BR4A 4BACA 4KH5A 1TL3A 4WQ4A 1J5EK 4F3OA 1ASVA 2HMIA 1RDUA 1LW2A 4B1WB 4C8KA 4YORA 1NGIA 1WB9A 1KLMA 1J5OA 3UKUA 4BREA 4CVNE 1N36K 2YNHA 5DK5A 1IJJA 3ULEA 1S3XA 3SUNA 1OVYA 4FL9A 1T44A 1DEJA 5BR8K 4CZGA 3V9XA 4NCAA 2XO7A 2NZTA 1TVRA 3BF3A 3WNHA 3AA4A 3GDQA 2X6SA 2FBVA 3VQAA 2DTUA 3UE5A 1MWKA 2Z1IA 3VQEA 1KAZA 4CCHA 4BRNA 3IKMA 2ZJPL 4YDUA 4FJLA 2F8TA 2FBTA 4IOCL 4L3QA 2ZQBA 5HRRA 1BWFO 3J7YP 4BVOA 3O9QA 4I7FA 3QIPA 3M8PA 4BR2A 2NNWA 4BDPA 3NVKA 3U9ZA 4GMJB 5GAEP 2D0OA 2P9PA 4B9TA 2P9LA 3A5LC 5JS2A 4JKGA 3CF5L 3V6DA 1RT1A 4AHTA 3MX2A 3T7ZA 4CERA 2QWLA 2KW4A 4H0VB 5HRPA 3V1QA 1NWKA 1RT4A 1HNXK 3U6FA 5AQQA 2FSKA 1YIJN 1RDAA 4MFBA 3GG4A 4CJVA 2FSJA 4FJ9A 3VOVA 2ASOA 3DRSA 3O8MA 1VQPN 4KHQA 2YHBA 4B3TK 2QI2A 3HP6A 4IEEA 3FZLA 3M8QA 1X3MA 4BR0A 3SPYA 3LP1A 4CFDA 5LMUK 3IDHA 4DV5K 5FPEA 4FOIA 1WSGA 1JL1A 1NK6A 3IMXA 1JLCA 1U6ZA 1HJOA 1RBVA 4JHDB 3CCQN 2B5JA 2WUSA 4E3SA 3RRHA 3EKUA 3M5RA 3V9WA 4WQ5C 1IG8A 3TTCA 1CLQA 4KAZA 2FSNA 5KGXA 2OPQA 1K8AO 4ILJA 4NLCA 3I0RA 3QBXA 3CETA 3O5BA 5M1FA 1IKYA 3NF8A 1B92A 4DSLA 5HL7L 3K57A 1S5JA 2A1RA 3CJ7A 1K8KA 3QFPA 2Q1NA 4IJNA 3TR8A 3K5LA 4Z4FA 2BGGA 5AR0A 4DU1A 1QHAA 3EKSA 1L3SA 2ZWHA 1JKHA 3HO1A 3U8XA 1REVA 3EY1A 4DR6K 4BC2A 4JKAA 1S72N 1VRUA 2BANA 4B8AB 4LF9K 5D3GA 2IOCA 4K42A 4KTWA 1HX1A 3WQUA 3THYB 4DQ8A 4JAXA 5BPMA 4C8LA 2E2NA 1D8YA 1WSEA 4DB3A 1VSEA 3C0BA 4B9VA 2PFUA 4UY8O 3VPZA 4F9OA 2D4WA 5KRTA 2GWKA 4IO9L 3RMCA 4DTNA 4OKKA 3KIOA 1W7AA 3K9JA 4KTZA 1VQ8N 4J2DA 3SCXA 4CEEA 4U67L 4WFBL 3HSTB 2E2PA 1U04A 2HHVA 1MU2A 4I2QA 4PUOA 4DTOA 4Z4HA 3DLKA 4A2AA 3R1XA 3KD1E 3G10A 5HRNA 1DT9A 4RW9A 2W6LA 2RE2A 5A2QO 4AHUA 4EP5A 4YNQA 4JK8A 1RDDA 4O8KA 4DR7K 4BRLA 3RSEB 3TWHA 4XIUA 4KKOA 4FWNA 2VWKA 4IOXA 4OLBA 2UUAK 1X9MA 5I9EB 4DV0K 1W2BM 5EVZA 4KHWA 4DR1K 2UUCK 2NRHA 3QEIA 1C1AA 4I9LA 1GLJO 3E9LA 3CYMA 5CYMA 4CEFA 1Q86O 2HVIA 3TU5A 1RGIA 4FWPA 3G4SN 4FJHA 1BL3A 1P8ZA 2BDPA 4ZTFA 2CH5A 3CC7N 2HHSA 4WQ4C 5FPNA 4MLHA 3OYIA 1IO2A 1HUXA 4IZ9A 5LJWA 1WAJA 1BI4A 1RBSA 1VSHA 4FJMA 3PO5A 1RT3A 1A5WA 3SBTA 4B1YB 1VRTA 3G0ZA 3HSCA 3HPOA 2XY7A 3KKRA 4YOXA 4CHYA 1YTAA 2O8FA 1OKJA 5AQZA 1NJIO 3QEPA 4H8KA 3QESA 4C1NK 4IG0A 3IUCA 3NAEA 4KV8A 3H1QA 4GY2B 1EWRA 5C2FA 3HVTA 2R7YA 4JHDA 4YDUC 1YTUA 2P5OA 2BE2A 1QHTA 4K43A 4EHTA 2Z1GA 4LF4K 4DLEA 4GV9A 1KC8O 4H0XB 1TK8A 4LD0A 3IAYA 4CJUA 4KHPK 1QZ6A 3O1BA 5C12A 4DTJA 4LSLA 4XH5A 4XEIA 5J2QA 2ZM6K 1RNHA 4JI8K 2F9TA 2O8CB 2QTDA 3VGLA 3OYJA 1JLFA 4GV6A 3KLFA 3NH1A 4CFAA 4FWMA 5T7BA 5GAHP 4DQIA 3AA5X 2QKBA 3OYFA 4LSNA 1XNQK 2CGKA 2VGNA 1VQ5N 4HHTA 4DV6K 3THYA 2OTJN 1BQNA 4DTUA 1EQYA 5C2DA 3OYHA 2A42A 1DLOA 2YNIA 3OYDA 3I55N 2OANA 1BGXT 1CXQA 3OA9A 3O80A 4HUGA 1W97L 4N56A 2DFHA 3VF4A 5BN8A 1C6VA 3ZSVA 3DOKA 1YHQN 1BQMA 1TGOA 4K8ZA 4CJWA 3THVA 4K0KK 2YHWA 1Z26A 5CZ2A 1M90O 1NGGA 2PZSA 3SUOA 2BUPA 3SAHA 3ZETB 4Y0WA 3KK2A 3FZKA 3EN9A 4JRQA 3PX4A 1HKBA 3MX5A 1VQLN 1HQUA 3K5MA 2HHTA 2IAJA 4Y1CA 3VTHA 3D6RA 1TAUA 3HL8A 4BRHA 3UIQA 3CQXA 2GV9A 4DTXA 3KWIA 1C0MA 4BWJA 2KTQA 2GEMA 1NK8A 3AVFA 4BRIA 4W5TA 1EWQA 3LWLA 3PIPL 3QEWA 4BDZA 2E2QA 5AQXA 2V51B 3LL3A 3QEVA 3A0IX 1GLFO 4NLBA 1XI1A 5SZTA 3PX0A 5C24A 1QSYA 3KJVA 3H45C 3OY9A 3TSUA 3OBWA 5M1OA 2X78A 3VN5A 2DFEA 2IVOA 4FWLA 4A59A 3ZT2A 4CJQA 2HHHK 3I33A 3THXA 2HNDA 4NXMK 1KAYA 4DV4K 3F9KA 2UU9K 1JCGA 3WEEB 2E6LA 4CZJA 4KH4A 3RMBA 1YUWA 3QERA 3T1HK 1DTQA 1E4GT 1J54A 4FJ5A 4V19S 3SUQA 2QEXN 3NF9A 4B3OA 2AP1A 4AH9A 5JLFA 1D9DA 4KFBA 4BROA 1RDBA 1HPMA 1QTMA 1ZBIA 5AZJB 3A5OC 4JYAK 4CJ5A 4H5NA 1HNIA 3DXKB 4CK3A 3VESA 4YHHK 4NYFA 3IFRA 4PA1A 1V4TA 4M63C 4E19A 4E7LA 1BG3A 2CH6A 4WE1A 3WXKA 3L2VA 2IDOA 1J53A 3J7ZO 4DFKA 3PLAA 5GAGP 4YOWA 4PQUA 5FPDA 2O8CA 4AILC 4O5FA 4JD2A 4BE2A 2FBYA 2G8UA 3BZKA 2O8DA 4CD1A 2I5JA 5AZIA 3I8BA 4LFAK 1GLLO 5ELZA 3L2RA 5JS1A 4FSVA 4DR5K 3U3YA 5BRHA 3HT3A 4AQYK 3M8SA 4CZHA 1JJ2M 1OH8A 1XHZA 2E20A 4BE0A 4DV7K 2HBLA 4CK2A 3P83D 4X62K 2NRZA 4M3YA 2QKKA 3CFOA 3BGRA 3ZLJA 2RKIA 4CJPA 3CCSN 3CCEN 2B4JA 1HYVA 3B6PA 1NMNA 4K25A 4KRFA 4BC4A 1QQNA 1KSPA 2I7NA 1BISA 1TKTA 3WXJA 4B1VA 4IDHA 1WLJA 3OYMA 2D5RA 1YJNN 2G8KA 5BREA 3HOSA 4ELTA 4GVEA 1XWLA 4RW8A 1RILA 2YHAA 1TUYA 3DM2A 1CZBA 3CHWA 4BGAA 4DS4A 2QWNA 2F8SA 1ATNA 3CFRA 4BG8A 1LW0A 3QIOA 5EY4A 3FZHA 3QICA 1QSSA 3LZIA 4KI6A 3HK2A 1SQKA 1X9WA 2HB5A 4KBOA 3L4QA 4E1NA 4JV5K 3ENHA 2E1YA 5GADP 3VEZA 3L6QA 4FLXA 3MXIA 1Q82O 3J7AP 1S9EA 1EXQA 4JI7K 5JLHA 1NBWA 1BIUA 3S41A 1LCUA 3V1OA 5AFUA 2YHYA 3J8AA 3ZSOA 3SUPA 1A5VA 3VEWA 1NGBA 4CEDA 3E9PA 1RTDA 3MDQA 2DPNA 3R3LA 2NUBA 1BA1A 1S1XA 1RBUA 1YAGA 1UA0A 2GUIA 2XY8A 4CFBA 4KI4A 3WEEA 4DG1A 3SAFA 3MEDA 5IT9O 3AVJA 5AQMA 1NJYA 1TKXA 2IGIA 1C0UA 3MK6A 3MMVA 1KFSA 2ZGYA 4YOYA 2HHXA 4GNIA 3HTVA 3VGMA 3VQDA 5I42A 4DSFA 3O4NA 5AZJA 5B8HA 3QBWA 2F96A 4OPAA 5LJVA 3AVMA 1N8RO 2OYQA 1TV6A 2NLXA 1HPZA 1N32K 1X9SA 2G8HA 4PWDA 4OGCA 4B8CA 3DXKA 4C8NA 2J4RA 2CGJA 4ZHRA 3VETA 1W9HA 4JLHA 1KXPA 1YT3A 1RT2A 3CG7A 2A3ZA 1BDGA 4NCBA 1YITN 2GELA 4KHYA 1VQON 5AQOA 3S3NA 4H4MA 4EAHD 1NOYA 2Q2RA 1S6QA 4F4KA 4BRAA 3G25A 1Q81O 1BU6O 3HJFA 4X65K 4E7HA 1U47A 1L3UA 4CHZA 4FLUA 4BQZA 1RBRA 4WYBA 3QEXA 2G8WA 1TKDA 1NKEA 5AQPA 2KLAA 4FWOA 1G99A 3TTFA 2OPPA 4N5SA 4N76A 3HM8A 1JXBA 4C8MA 4B9UA 3NH2A 3CCMN 5AFUH 3AVKA 4LC9B 4CJTA 1NGEA 2WONA 3VQ8A 4KHNA 4AHRA 2DY4A 4OPHA 3O9RA 4NO7A 1S22A 5M1KA 2A40A 1JLGA 3M8RA 4JK9A 4C8OA 3VQQA 4LFCK 3LZJA 3I0SA 1ILYA 4ISGA 4BRGA 4CE9A 1NGFA 3FR0A 4QS7A 3M3ZA 3CXCM 3WNGA 2OTLN 1WSHA 1I39A 4DTRA 2EHGA 3MCAB 3MN9A 5FLXO 5FROA 3SJJA 2Z1JA 3AY9A 4HTUA 3ZEUB 4FLWA 3NGZA 4FJ8A 1VSFA 4F2SA 3AO2A 4JEPA 4IG3A 1KRPA 3D45A 2BH1A 4AF1A 4DF8A 1VQ7N 3QO9A 2W40A 4DR3K 1QSLA 2O8EB 3HRGA 3OBYA 4CJEA 4DV1K 3PX6A 3E66A 2G8FA 1MA9B 2HMPA 3HI0A 4QOZB 3OJSA 4JI0K 1QVGM 1YJWN 4BQLA 3O4WA 4E7JA 2O4IA 5CYQA 4E1MA 4H03B 3ZT0A 3NH0A 4OO1J 4EP4A 3HPGA 1JLAA 3ENOA 2HBKA 3C95A 5AQFA 2FBXA 5ADXA 5AQSA 4B9LA 2HNYA 4H0PA 4KPYA 4DQRA 3WNEA 5J2PA 5HOOA 1BCOA 2ITMA 4U7BA 3MXMA 2YKNA 4FXDA 3ITHA 2XRIA 3VQ9A 4PY5A 3AO3A 4H0YB 4Z0UA 3PSFA 3AV9A 1SL1A 5IWAK 2YHXA 4BWMA 1LWCA 4ILGB 1JCFA 3L4IA 3CJ9A 5AQKA 3TAFA 1OVQA 1RT5A 2P9UB 3ATUA 2YJEA 4BE1A 4FCYA 1GOAA 3A5NC 4ID1A 2HHWA 4CGHA 2ASMA 4X64K 4MO5A 4GW6A 3WXIA 3VA0A 4Z4GA 3C65A 3CC2N 4CGIA 3GOIA 4PKIA 3S3OA 4L8RB 3FLCO 3KWGA 3L2QA 1IBKK 3ZT1A 1XNRK 1QVFM 2HF3A 3O6WA 3BF1A 1WNSA 2CGLA 1E4FT 1NGDA 3CI5A 1U49A 1XC3A 3DYAA 5AQLA 4DU3A 4BR5A 3LALA 2YV0X 4Z4EA 3SV3A 2KZZA 4H0OA 3BZCA 1UAXA 1XQSC 3TAGA 4H4OA 1L3VA 4BRQA 3TABA 4FJJA 3F5TA 4B9QA 4O8UA 1RCHA 3ZSRA 4B9SA 3A8YA 3JYTA 2G8IA 3V81A 4R5PA 4CHOA 3QNOA 5ADXH 3ZT4A 5JVGL 4O4GA 1Z05A 4DFMA 3WQTA 1NKBA 3IS9A 4NXNK 3T1AA 4DUYK 1J6ZA 1NLVA 1NJXA 1TYQB 3ZSWA 3MAQA 3VMFB 2XY5A 4CEOA 4MQ3A 3CCUN 3AVBA 3FGUA 4LH4A 4JKBA 1FJGK 3TI0A 1Q18A 1KVAA 2FC0A 4A57A 1K9MO 1NM1A 3RMDA 3CIPA 3ZEUA 4WCEL 3NE6A 4RTFD 5KGWA 3H3NO 3MWTA 2GX9A 4M3XA 4NCGA 4DU4A 4BRPA 1Y97A 2QW9A 3L0QA 2O8EA 3T69A 4CJSA 5AQYA 1NGAA 4CJKA 2VWJA 2D1KA 1N5YA 3LPTA 4YOUA 3KZBA 1KVCA 5KPTA 4FM0A 1IKWA 1RDCA 3UKRB 4CEBA 4JKHA 1SKRA 2OA8A 2QWOA 5HP1A 2FF6A 5EOYA 3NF7A 4JKEA 4B3MK 4HTLA 3OS2A 4ELUA 4Z94A 3C7NB 2PAVA 2NRTA 2JWKA 2P9KB 5BPLA 3KLGA 3PV8A 3O9SA 4FLVA 3WNFA 3C6TA 3SMSA 4CEAA 1RTIA 2HNZA 4CEQA 1ZC6A 1T03A 3VQCA 3EZWA 4M3WA 3LM9A 2ASPA 4EZ9A 5AQUA 4OPJA 3AGRA 2YI1A 4CZIA 3ID6A 5JMVA 4OKJA 2RF2A 5SWMA 3CCLN 2VYPA 3CERA 2H3GX 5AQHA 4M7YA 1QQCA 4IFEA 4E7IA 3ASMA 3AO4A 2W41A 2IVNA 3DRRA 5TKYA 3ZSYA 3K5NA 4ICLA 1M1KO 1Q9YA 1TAQA 4CJ4A 2KFNA 4DQQA 3G6EN 2D0PA 5GIOA 1RDWX 3RSEA 3L2WA 5AQIA 2P9UA 4DCHA 4IFYA 3AO1A 1X9JA 2YX6A 2ZGZA 1C1BA 3V1RA 1JLEA 5M1QA 3TANA 4CBUA 3K2PA 3DLBA 2Y1JA 3O9UA 3PUFA 1MDUB 3R6MA 2Q0UA 3CMAN 4FJNA 2UUBK 1ZBFA 3VEYA 4FPAA 3LM2A 3O4QA 5DM6L 3W0LA 4FOEA 3CCRN 3OYGA 1U4BA 3RRGA 4HUFA 1NGJA 2IC3A 4O44A 4IDKA 1QQMA 1NOZA 4HWIA 4CI6A 2ATQA 1ATSA 1UOCA 4BRKA 4IO8A 2AJQA 4ZTJA 5EXWA 2O4GA 4A5BA 4KHSA 3OS1A 1VQMN 1W0HA 1E3MA 2E5LK 3H08A 3HPHA 1NK4A 4KB0A 4BRCA 1YVNA 3MECA 2YKMA 3E1YA 3WT0A 1DGKN 4EIAA 4CF1A 3LDQA 2Y1IA 2IS3A 4JI2K 3P31A 1NK9A 3JSMA 4OVLA 1TYQA 1NNEA 3VQ7A 3SYZA 3SQ4A 2RPIA 1NKCA
chains in the Genus database with same CATH topology
4W5QA 3TR8A 3L2UA 3K5LA 4CIGA 4W5RA 4Z4FA 2BGGA 4CF8A 4DU1A 2NUBA 4OKEA 1S1XA 5FRNA 3CM5A 4OLAA 1RBUA 3OS0A 1L3SA 4CHNA 1JKHA 3HO1A 3S3MA 4M3TA 3KLEA 1REVA 3EY1A 1UA0A 2GUIA 2XY8A 4M3RA 4CFBA 3SI6A 4ELVA 2P5GA 4KI4A 2HHUA 1A5XA 3VQ4A 4DG1A 1VRUA 2BANA 4B8AB 3OYKA 5I3UA 3MEDA 4CF2A 5J2NA 2D0BA 3AVJA 1NJYA 1TKXA 2IGIA 3AVNA 3P5JA 2IOCA 4KTWA 5HRSA 1C0UA 5D3GA 3E01A 3QINA 1KFSA 2HHXA 3ISNC 3KLHA 4FLZA 3VQDA 5I42A 4C8LA 5E41A 1RT7A 3LP3A 4DSFA 2ZD1A 3O4NA 4DFPA 1D8YA 4HUEA 4FK0A 1WSEA 4JS4A 1VSEA 1TL1A 2F96A 4B9VA 1VK0A 3AVMA 1LV5A 3ALYA 2P1JA 4CIEA 1SV5A 5KRTA 2OYQA 1TV6A 1HYSA 1HPZA 3RMCA 4B9MA 4DTNA 1X9SA 2G8HA 4PWDA 1S1VA 4OKKA 4OGCA 4B8CA 3KIOA 4CGFA 3MEGA 4C8NA 4KTZA 4J2DA 3AVLA 4ZHRA 3AVHA 4CESA 3SCXA 4Z4IA 1G15A 3IRXA 4CEEA 4M3ZA 1W9HA 4JLHA 2KQ2A 1YT3A 1RT2A 3HSTB 3L3UA 4K8XA 4FW2A 1CXUA 4FW1A 4FZZA 1U04A 2HHVA 4KO0A 1MU2A 3CG7A 4I2QA 4PUOA 4NCBA 1NJZA 4DTOA 1WAFA 4Z4HA 3DLKA 4KHYA 3KD1E 3G10A 5HRNA 4RW9A 4FJ7A 4J2AA 4G1QA 3S3NA 2XHBA 4AHUA 3V9SA 4H4MA 4EP5A 4YNQA 4DS5A 3PY8A 3CM6A 2KFZA 1XHXA 4BDYA 1NOYA 1RDDA 1KCFA 3SPZA 1S6QA 1HNVA 1WN7A 4CJLA 4F4KA 3TWHA 4XIUA 3KTQA 4KKOA 1HYZA 3NGYA 2VWKA 3HJFA 2KZMA 4GVMA 4E7HA 1U47A 4OLBA 4DTSA 1L3UA 4CHZA 4FLUA 1X9MA 1RBRA 3OVNA 3QEXA 1TKZA 1SKSA 2G8WA 1TKDA 1WSFA 1HQEA 1NKEA 1KFDA 4N76A 3DMJA 4N5SA 2OPPA 3LAMA 4KHWA 4O55A 1JXBA 4C8MA 4B9UA 3QEIA 2OPSA 1C1AA 3L3VA 3A2FA 4I9LA 4CECA 3NH2A 3HM9A 2W42A 1EETA 3AVKA 3F73A 5CYMA 3CYMA 3LDSA 4CEFA 4CJTA 2WONA 3VQ8A 4KHNA 4CJFA 2HVIA 5KI6A 3T3FA 1C1CA 1Z25A 2E4LA 4AHRA 4RG8A 3L8BA 2DY4A 1QS4A 4HVJA 2YNGA 3LWMA 1SL0A 4FJHA 1BL3A 2BDPA 4DSKA 4ZTFA 2D0CA 1ASUA 3V9UA 1JLGA 2QXFA 3NF6A 2HHSA 1ZYQA 3OYIA 4DLGA 3CFPA 3M8RA 3VQBA 1IO2A 3NDKA 1JXEA 3VQQA 4AHSA 4C8OA 1WAJA 4IKFA 4DTMA 3LZJA 3I0SA 1BI4A 1RBSA 2JLEA 4CE9A 1GOCA 3WNGA 3DLRA 1WSHA 4LH5A 1VSHA 1I39A 5CZ1A 4FJMA 4DTRA 3PO5A 1RT3A 1A5WA 2EHGA 2XY6A 3TARA 1VSMA 5FROA 3HYFA 1VRTA 3G0ZA 3HPOA 3HP9A 2XY7A 3KKRA 3SJJA 2PY5A 4CHYA 1YTAA 2Z1JA 4Q5VA 4HTUA 1B9FA 3EZ5A 3NGZA 4FLWA 1VSFA 4FJ8A 1ITGA 4E7KA 4F2SA 3QEPA 3AO2A 2PYJA 4IG3A 4H8KA 1KRPA 4W5NA 3D45A 3QESA 4IG0A 2PYLA 3NAEA 1NK5A 4QCLA 4KV8A 4DF8A 1XC9A 3DLGA 3QO9A 4Q0BA 3MEEA 4KHUA 1QSLA 3HVTA 4CJEA 3D0PA 2R7YA 2QK9A 1RTJA 1YTUA 3OYBA 3OYCA 3PX6A 4CHQA 3RR8A 2P5OA 3NHGA 2BE2A 1VSIA 1KVBA 1QHTA 1VSJA 3LP0A 2G8FA 2Z1GA 4DLEA 3VQPA 3O3GA 1L3TA 2GBZA 2X74A 4QOZB 3OJSA 1TK8A 4LD0A 3IAYA 1RTHA 1SUQA 4TSXA 4CJUA 3V9ZA 4KTQA 1CZ9A 1HJRA 4B08A 1LAWA 4Y1DA 5EU7A 3RWUA 3DLHA 4DTJA 4LSLA 4B9NA 4W5OA 4I2PA 3PO4A 4E7JA 2O4IA 5CYQA 4E1MA 3ZT0A 3NH0A 1HMVA 5J2QA 4EP4A 3HPGA 4FLYA 1R0AA 1JLAA 1RNHA 3C95A 3KD5E 1Q8IA 3K59A 4LY7A 1NK0A 3DI6A 2OZSA 2FBXA 5HROA 4N41A 3OYJA 3I8DA 1JLFA 4B9LA 4FLTA 2HNYA 1RBTA 4F8RA 1S1UA 3KLFA 2G8VA 3NH1A 4CFAA 1I3AA 4KPYA 3BDPA 3TAQA 3OYAA 2HHQA 4RW4A 4DQRA 3WNEA 5J2PA 4DQIA 5T7BA 1BCOA 3AA5X 5DMRA 2QKBA 5K14A 1FKOA 4AHCA 3OYFA 4FK2A 4FM2A 3SV4A 4LSNA 3MXMA 4CJRA 2YKNA 4FXDA 3ITHA 4M3UA 1LAVA 2XRIA 4QAGA 1ZBUA 4M42A 3C6UA 3LANA 1TK0A 1GOBA 3VQ9A 3LAKA 4PY5A 1EP4A 4O0JA 3AO3A 4DQPA 4HHTA 4Z0UA 4AHVA 3AV9A 1JL2A 4J2BA 4OGEA 1BQNA 1SL1A 3ZT3A 4ID5A 3B6OA 4DTUA 4CF0A 4BWMA 1LWCA 4CF9A 2Z1HA 3ULDA 2YNFA 3OYHA 3ZCMA 1DLOA 2YNIA 3AA3A 3OYDA 3KK1A 3U3GA 5FDLA 3TAFA 1BGXT 1CXQA 1RT5A 4DWIA 4HUGA 4BE1A 4FCYA 1GOAA 3T19A 4ID1A 3NBPA 4N56A 2DFHA 4CGHA 4DQSA 2HHWA 4EZ6A 3MXJA 3KKSA 4GW6A 1F21A 3VA0A 4Z4GA 4DSEA 1C6VA 4CGIA 2ZE2A 4UQGA 3ZSVA 3DOKA 5FRMA 1BCMA 4RW6A 1BQMA 5C25A 3S3OA 3AVIA 4DSIA 4L8RB 3SQ1A 1TGOA 4K8ZA 3LP2A 3P1GA 4CJWA 3ZT1A 3L2QA 3THVA 1LWFA 1Z26A 4DSJA 5CZ2A 4FK4A 1VSLA 1WNSA 4O5BA 1U49A 2PZSA 3DYAA 1Q9XA 3SUOA 4DU3A 1JLQA 4KREA 3LALA 4FYDA 3NCIA 2YV0X 3KK2A 3OYNA 4FM1A 3SV3A 1KLNA 4Z4EA 2KZZA 1O1WA 4CFCA 5HBMA 2X6NA 4JRQA 1C0TA 1UAXA 2VG6A 1K6YA 3PX4A 1BI4B 2RN2A 3TAGA 1TK5A 1HQUA 4H4OA 4FZYA 3K5MA 3RMAA 2HHTA 1EKEA 3QNNA 1L3VA 2IAJA 3TABA 4Y1CA 3KLIA 1TAUA 3HL8A 4FJJA 3UIQA 1S1TA 2GV9A 3C94A 3DRPA 4DTXA 3S9HA 3K58A 1RCHA 3TAPA 3RR7A 1C0MA 3ZSRA 4B9SA 1B9DA 4BWJA 2KTQA 3JYTA 4M41A 3AVFA 1NK8A 2G8IA 2LSNA 3V81A 3SQ0A 2VG7A 5KRSA 4R5PA 4CHOA 1VSDA 3QNOA 1UWBA 3ZT4A 4O4GA 3AO5A 4O0IA 4W5TA 1S6PA 2P51A 4YFUA 4DFMA 3LWLA 1ZBHA 4DF4A 1S1WA 4JS5A 3QEWA 3IS9A 4IFVA 4BDZA 1NKBA 3T1AA 1FKPA 3AVCA 3O3FA 3NGIA 4FZXC 3QEVA 1NJXA 1U48A 3ZSWA 3MAQA 2XY5A 1L5UA 4CEOA 3TAEA 4M45A 1XI1A 5SZTA 3PX0A 1NK7A 5C24A 4MQ3A 3KJVA 1QSYA 4FJXA 3OY9A 4DFJA 1BHLA 5C42A 3QETA 3AVBA 2OPRA 1WSIA 4LH4A 2X78A 2JGUA 4NYNA 3VN5A 3TI0A 2DFEA 4CJQA 3ZSQA 3ZT2A 1KVAA 2FC0A 3NFAA 4FJGA 2HNDA 3SZ2A 3F9KA 3RMDA 2E6LA 2ITGA 3AA2A 1ZBLA 3DLEA 3RMBA 3QERA 3ZSXA 1EX4A 1VSKA 3DOLA 1IKXA 1DTTA 1DTQA 4F3TA 3AVAA 3NE6A 3V4IA 1UA1A 5KGWA 1J54A 1NJWA 4FJ5A 1FXXA 1QE1A 3SUQA 2A1SA 3NF9A 4OPKA 4B3OA 1D5AA 4AH9A 4HCBA 1D9DA 1T8EA 4M3XA 4KFBA 1QTMA 1RDBA 5CY4A 1ZBIA 3TAMA 4NCGA 4DU4A 4FVMA 3SNNA 1Y97A 4CEZA 2ETJA 3LPUA 1FK9A 4CK1A 1LWEA 4CJSA 1U45A 4Z4CA 2VG5A 3AVGA 4CJKA 1N6QA 2VWJA 1KTQA 3FFIA 5HLFA 1YVUA 1SKWA 1N5YA 4E0DA 3LPTA 4BACA 4CJ5A 1HNIA 4DMNA 1KVCA 4CK3A 4FM0A 1TL3A 4FJIA 1IKWA 1RDCA 4NYFA 4F3OA 1ASVA 4CEBA 2HMIA 4CHPA 1LW2A 1SKRA 2OA8A 4C8KA 3RTVA 4PA1A 4E19A 4E7LA 4KB1A 5HP1A 3IG1A 1KLMA 3NF7A 5KTQA 4WE1A 4OJRA 1J5OA 3L2VA 3QLHA 2IDOA 1J53A 4DFKA 4E89A 3OS2A 4ELUA 2YNHA 5DK5A 4PQUA 4CGDA 4CGJA 4AILC 1D9FA 3KLGA 2WOMA 3HXMA 3SUNA 3PV8A 4BE2A 3WNFA 2FBYA 4FLVA 3C6TA 4N47A 1T05A 2G8UA 4CEAA 1RTIA 2HNZA 3V9XA 2E6MA 4CJ3A 4NCAA 4CEQA 1T03A 2XO7A 1TVRA 1BIZA 3WNHA 4J2EA 3AA4A 3VQCA 2I5JA 2X6SA 2FBVA 3VQAA 2DTUA 4M3WA 5JS1A 3L2RA 3CQ8A 2Z1IA 3VQEA 4EZ9A 4CCHA 3U3YA 4OPJA 3HT3A 1IKVA 3M8SA 4OKJA 4FJLA 2RF2A 5SWMA 2F8TA 1XHZA 2FBTA 5HRRA 2ZQBA 4BE0A 1QQCA 4I7FA 4CK2A 3QIPA 3M8PA 1ASWA 3P83D 4E7IA 1IG9A 4M3YA 3ASMA 3AO4A 3CFOA 2QKKA 3BGRA 4BDPA 2D0AA 3OJUA 3DRRA 3ZSYA 3K5NA 2OZMA 4ICLA 1T7PA 1Q9YA 1TAQA 4GMJB 4CJ4A 3KK3A 4JRPA 5J2MA 2RKIA 4B9TA 4CJPA 2B4JA 4DQQA 3SQ2A 1HYVA 5JS2A 2KFNA 3B6PA 2HVHA 2Q3SA 2B6AA 3VA3A 3L2WA 3V6DA 1RT1A 4KRFA 4AHTA 4CERA 4IFYA 2KW4A 3AO1A 1KSPA 1BISA 5HRPA 3V1QA 1C1BA 1X1PA 1RT4A 1TKTA 3V1RA 1JLEA 3U6FA 3TANA 3K2PA 4CGGA 2Y1JA 1WLJA 3OYMA 2D5RA 3PUFA 3DLBA 1HRHA 1RDAA 4MFBA 4CJVA 4FJNA 3OYLA 2G8KA 1JLBA 4ELTA 4IBNA 4FJ9A 1IH7A 3DRSA 4KHQA 1XWLA 1ZBFA 4RW8A 2YHBA 3O4QA 3HP6A 3HVRA 1RILA 3M8QA 3OYGA 2YHAA 3DM2A 4CIFA 1U4BA 3RRGA 1CZBA 4HUFA 3SPYA 3LP1A 2IC3A 4O44A 4CFDA 5J1EA 4DS4A 3VQ5A 2F8SA 1SL2A 1WSJA 1S9GA 2EX3A 4IDKA 3CFRA 1WSGA 1JL1A 1LW0A 1NK6A 3QIOA 1NOZA 1JLCA 2ATQA 1QSSA 1RBVA 1UOCA 2B5JA 3LZIA 4KI6A 2AJQA 3HK2A 4ZTJA 3ZSZA 4E3SA 2O4GA 1X9WA 2HB5A 3RRHA 2DFFA 4KHSA 4E1NA 3V9WA 3OS1A 1W0HA 3H08A 3HPHA 1NK4A 4KB0A 3O3HA 4FLXA 4DTPA 1CLQA 3MECA 3MXIA 4F2RA 4KAZA 2YKMA 4I9QA 1RT6A 5KGXA 2OPQA 1S9EA 1EXQA 4CF1A 2Y1IA 3I0RA 4HCCA 3VQ6A 1IKYA 3NF8A 1BIUA 1B92A 2IS3A 3V1OA 4DSLA 4FJKA 1NK9A 3OYEA 3JSMA 2HW3A 3ZSOA 3SUPA 4RW7A 1A5VA 1J9AA 4OVLA 3K5OA 1S5JA 3K57A 2A1RA 3VQ7A 3SYZA 3SQ4A 4CEDA 1RTDA 2RPIA 1NKCA 3EYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5Q A;  3TR8 A;  3L2U A;  3K5L A;  4CIG A;  4W5R A;  4Z4F A;  2BGG A;  4CF8 A;  4DU1 A;  2NUB A;  4OKE A;  1S1X A;  5FRN A;  3CM5 A;  4OLA A;  1RBU A;  3OS0 A;  1L3S A;  4CHN A;  1JKH A;  3HO1 A;  3S3M A;  4M3T A;  3KLE A;  1REV A;  3EY1 A;  1UA0 A;  2GUI A;  2XY8 A;  4M3R A;  4CFB A;  3SI6 A;  4ELV A;  2P5G A;  4KI4 A;  2HHU A;  1A5X A;  3VQ4 A;  4DG1 A;  1VRU A;  2BAN A;  4B8A B;  3OYK A;  5I3U A;  3MED A;  4CF2 A;  5J2N A;  2D0B A;  3AVJ A;  1NJY A;  1TKX A;  2IGI A;  3AVN A;  3P5J A;  2IOC A;  4KTW A;  5HRS A;  1C0U A;  5D3G A;  3E01 A;  3QIN A;  1KFS A;  2HHX A;  3ISN C;  3KLH A;  4FLZ A;  3VQD A;  5I42 A;  4C8L A;  5E41 A;  1RT7 A;  3LP3 A;  4DSF A;  2ZD1 A;  3O4N A;  4DFP A;  1D8Y A;  4HUE A;  4FK0 A;  1WSE A;  4JS4 A;  1VSE A;  1TL1 A;  2F96 A;  4B9V A;  1VK0 A;  3AVM A;  1LV5 A;  3ALY A;  2P1J A;  4CIE A;  1SV5 A;  5KRT A;  2OYQ A;  1TV6 A;  1HYS A;  1HPZ A;  3RMC A;  4B9M A;  4DTN A;  1X9S A;  2G8H A;  4PWD A;  1S1V A;  4OKK A;  4OGC A;  4B8C A;  3KIO A;  4CGF A;  3MEG A;  4C8N A;  4KTZ A;  4J2D A;  3AVL A;  4ZHR A;  3AVH A;  4CES A;  3SCX A;  4Z4I A;  1G15 A;  3IRX A;  4CEE A;  4M3Z A;  1W9H A;  4JLH A;  2KQ2 A;  1YT3 A;  1RT2 A;  3HST B;  3L3U A;  4K8X A;  4FW2 A;  1CXU A;  4FW1 A;  4FZZ A;  1U04 A;  2HHV A;  4KO0 A;  1MU2 A;  3CG7 A;  4I2Q A;  4PUO A;  4NCB A;  1NJZ A;  4DTO A;  1WAF A;  4Z4H A;  3DLK A;  4KHY A;  3KD1 E;  3G10 A;  5HRN A;  4RW9 A;  4FJ7 A;  4J2A A;  4G1Q A;  3S3N A;  2XHB A;  4AHU A;  3V9S A;  4H4M A;  4EP5 A;  4YNQ A;  4DS5 A;  3PY8 A;  3CM6 A;  2KFZ A;  1XHX A;  4BDY A;  1NOY A;  1RDD A;  1KCF A;  3SPZ A;  1S6Q A;  1HNV A;  1WN7 A;  4CJL A;  4F4K A;  3TWH A;  4XIU A;  3KTQ A;  4KKO A;  1HYZ A;  3NGY A;  2VWK A;  3HJF A;  2KZM A;  4GVM A;  4E7H A;  1U47 A;  4OLB A;  4DTS A;  1L3U A;  4CHZ A;  4FLU A;  1X9M A;  1RBR A;  3OVN A;  3QEX A;  1TKZ A;  1SKS A;  2G8W A;  1TKD A;  1WSF A;  1HQE A;  1NKE A;  1KFD A;  4N76 A;  3DMJ A;  4N5S A;  2OPP A;  3LAM A;  4KHW A;  4O55 A;  1JXB A;  4C8M A;  4B9U A;  3QEI A;  2OPS A;  1C1A A;  3L3V A;  3A2F A;  4I9L A;  4CEC A;  3NH2 A;  3HM9 A;  2W42 A;  1EET A;  3AVK A;  3F73 A;  5CYM A;  3CYM A;  3LDS A;  4CEF A;  4CJT A;  2WON A;  3VQ8 A;  4KHN A;  4CJF A;  2HVI A;  5KI6 A;  3T3F A;  1C1C A;  1Z25 A;  2E4L A;  4AHR A;  4RG8 A;  3L8B A;  2DY4 A;  1QS4 A;  4HVJ A;  2YNG A;  3LWM A;  1SL0 A;  4FJH A;  1BL3 A;  2BDP A;  4DSK A;  4ZTF A;  2D0C A;  1ASU A;  3V9U A;  1JLG A;  2QXF A;  3NF6 A;  2HHS A;  1ZYQ A;  3OYI A;  4DLG A;  3CFP A;  3M8R A;  3VQB A;  1IO2 A;  3NDK A;  1JXE A;  3VQQ A;  4AHS A;  4C8O A;  1WAJ A;  4IKF A;  4DTM A;  3LZJ A;  3I0S A;  1BI4 A;  1RBS A;  2JLE A;  4CE9 A;  1GOC A;  3WNG A;  3DLR A;  1WSH A;  4LH5 A;  1VSH A;  1I39 A;  5CZ1 A;  4FJM A;  4DTR A;  3PO5 A;  1RT3 A;  1A5W A;  2EHG A;  2XY6 A;  3TAR A;  1VSM A;  5FRO A;  3HYF A;  1VRT A;  3G0Z A;  3HPO A;  3HP9 A;  2XY7 A;  3KKR A;  3SJJ A;  2PY5 A;  4CHY A;  1YTA A;  2Z1J A;  4Q5V A;  4HTU A;  1B9F A;  3EZ5 A;  3NGZ A;  4FLW A;  1VSF A;  4FJ8 A;  1ITG A;  4E7K A;  4F2S A;  3QEP A;  3AO2 A;  2PYJ A;  4IG3 A;  4H8K A;  1KRP A;  4W5N A;  3D45 A;  3QES A;  4IG0 A;  2PYL A;  3NAE A;  1NK5 A;  4QCL A;  4KV8 A;  4DF8 A;  1XC9 A;  3DLG A;  3QO9 A;  4Q0B A;  3MEE A;  4KHU A;  1QSL A;  3HVT A;  4CJE A;  3D0P A;  2R7Y A;  2QK9 A;  1RTJ A;  1YTU A;  3OYB A;  3OYC A;  3PX6 A;  4CHQ A;  3RR8 A;  2P5O A;  3NHG A;  2BE2 A;  1VSI A;  1KVB A;  1QHT A;  1VSJ A;  3LP0 A;  2G8F A;  2Z1G A;  4DLE A;  3VQP A;  3O3G A;  1L3T A;  2GBZ A;  2X74 A;  4QOZ B;  3OJS A;  1TK8 A;  4LD0 A;  3IAY A;  1RTH A;  1SUQ A;  4TSX A;  4CJU A;  3V9Z A;  4KTQ A;  1CZ9 A;  1HJR A;  4B08 A;  1LAW A;  4Y1D A;  5EU7 A;  3RWU A;  3DLH A;  4DTJ A;  4LSL A;  4B9N A;  4W5O A;  4I2P A;  3PO4 A;  4E7J A;  2O4I A;  5CYQ A;  4E1M A;  3ZT0 A;  3NH0 A;  1HMV A;  5J2Q A;  4EP4 A;  3HPG A;  4FLY A;  1R0A A;  1JLA A;  1RNH A;  3C95 A;  3KD5 E;  1Q8I A;  3K59 A;  4LY7 A;  1NK0 A;  3DI6 A;  2OZS A;  2FBX A;  5HRO A;  4N41 A;  3OYJ A;  3I8D A;  1JLF A;  4B9L A;  4FLT A;  2HNY A;  1RBT A;  4F8R A;  1S1U A;  3KLF A;  2G8V A;  3NH1 A;  4CFA A;  1I3A A;  4KPY A;  3BDP A;  3TAQ A;  3OYA A;  2HHQ A;  4RW4 A;  4DQR A;  3WNE A;  5J2P A;  4DQI A;  5T7B A;  1BCO A;  3AA5 X;  5DMR A;  2QKB A;  5K14 A;  1FKO A;  4AHC A;  3OYF A;  4FK2 A;  4FM2 A;  3SV4 A;  4LSN A;  3MXM A;  4CJR A;  2YKN A;  4FXD A;  3ITH A;  4M3U A;  1LAV A;  2XRI A;  4QAG A;  1ZBU A;  4M42 A;  3C6U A;  3LAN A;  1TK0 A;  1GOB A;  3VQ9 A;  3LAK A;  4PY5 A;  1EP4 A;  4O0J A;  3AO3 A;  4DQP A;  4HHT A;  4Z0U A;  4AHV A;  3AV9 A;  1JL2 A;  4J2B A;  4OGE A;  1BQN A;  1SL1 A;  3ZT3 A;  4ID5 A;  3B6O A;  4DTU A;  4CF0 A;  4BWM A;  1LWC A;  4CF9 A;  2Z1H A;  3ULD A;  2YNF A;  3OYH A;  3ZCM A;  1DLO A;  2YNI A;  3AA3 A;  3OYD A;  3KK1 A;  3U3G A;  5FDL A;  3TAF A;  1BGX T;  1CXQ A;  1RT5 A;  4DWI A;  4HUG A;  4BE1 A;  4FCY A;  1GOA A;  3T19 A;  4ID1 A;  3NBP A;  4N56 A;  2DFH A;  4CGH A;  4DQS A;  2HHW A;  4EZ6 A;  3MXJ A;  3KKS A;  4GW6 A;  1F21 A;  3VA0 A;  4Z4G A;  4DSE A;  1C6V A;  4CGI A;  2ZE2 A;  4UQG A;  3ZSV A;  3DOK A;  5FRM A;  1BCM A;  4RW6 A;  1BQM A;  5C25 A;  3S3O A;  3AVI A;  4DSI A;  4L8R B;  3SQ1 A;  1TGO A;  4K8Z A;  3LP2 A;  3P1G A;  4CJW A;  3ZT1 A;  3L2Q A;  3THV A;  1LWF A;  1Z26 A;  4DSJ A;  5CZ2 A;  4FK4 A;  1VSL A;  1WNS A;  4O5B A;  1U49 A;  2PZS A;  3DYA A;  1Q9X A;  3SUO A;  4DU3 A;  1JLQ A;  4KRE A;  3LAL A;  4FYD A;  3NCI A;  2YV0 X;  3KK2 A;  3OYN A;  4FM1 A;  3SV3 A;  1KLN A;  4Z4E A;  2KZZ A;  1O1W A;  4CFC A;  5HBM A;  2X6N A;  4JRQ A;  1C0T A;  1UAX A;  2VG6 A;  1K6Y A;  3PX4 A;  1BI4 B;  2RN2 A;  3TAG A;  1TK5 A;  1HQU A;  4H4O A;  4FZY A;  3K5M A;  3RMA A;  2HHT A;  1EKE A;  3QNN A;  1L3V A;  2IAJ A;  3TAB A;  4Y1C A;  3KLI A;  1TAU A;  3HL8 A;  4FJJ A;  3UIQ A;  1S1T A;  2GV9 A;  3C94 A;  3DRP A;  4DTX A;  3S9H A;  3K58 A;  1RCH A;  3TAP A;  3RR7 A;  1C0M A;  3ZSR A;  4B9S A;  1B9D A;  4BWJ A;  2KTQ A;  3JYT A;  4M41 A;  3AVF A;  1NK8 A;  2G8I A;  2LSN A;  3V81 A;  3SQ0 A;  2VG7 A;  5KRS A;  4R5P A;  4CHO A;  1VSD A;  3QNO A;  1UWB A;  3ZT4 A;  4O4G A;  3AO5 A;  4O0I A;  4W5T A;  1S6P A;  2P51 A;  4YFU A;  4DFM A;  3LWL A;  1ZBH A;  4DF4 A;  1S1W A;  4JS5 A;  3QEW A;  3IS9 A;  4IFV A;  4BDZ A;  1NKB A;  3T1A A;  1FKP A;  3AVC A;  3O3F A;  3NGI A;  4FZX C;  3QEV A;  1NJX A;  1U48 A;  3ZSW A;  3MAQ A;  2XY5 A;  1L5U A;  4CEO A;  3TAE A;  4M45 A;  1XI1 A;  5SZT A;  3PX0 A;  1NK7 A;  5C24 A;  4MQ3 A;  3KJV A;  1QSY A;  4FJX A;  3OY9 A;  4DFJ A;  1BHL A;  5C42 A;  3QET A;  3AVB A;  2OPR A;  1WSI A;  4LH4 A;  2X78 A;  2JGU A;  4NYN A;  3VN5 A;  3TI0 A;  2DFE A;  4CJQ A;  3ZSQ A;  3ZT2 A;  1KVA A;  2FC0 A;  3NFA A;  4FJG A;  2HND A;  3SZ2 A;  3F9K A;  3RMD A;  2E6L A;  2ITG A;  3AA2 A;  1ZBL A;  3DLE A;  3RMB A;  3QER A;  3ZSX A;  1EX4 A;  1VSK A;  3DOL A;  1IKX A;  1DTT A;  1DTQ A;  4F3T A;  3AVA A;  3NE6 A;  3V4I A;  1UA1 A;  5KGW A;  1J54 A;  1NJW A;  4FJ5 A;  1FXX A;  1QE1 A;  3SUQ A;  2A1S A;  3NF9 A;  4OPK A;  4B3O A;  1D5A A;  4AH9 A;  4HCB A;  1D9D A;  1T8E A;  4M3X A;  4KFB A;  1QTM A;  1RDB A;  5CY4 A;  1ZBI A;  3TAM A;  4NCG A;  4DU4 A;  4FVM A;  3SNN A;  1Y97 A;  4CEZ A;  2ETJ A;  3LPU A;  1FK9 A;  4CK1 A;  1LWE A;  4CJS A;  1U45 A;  4Z4C A;  2VG5 A;  3AVG A;  4CJK A;  1N6Q A;  2VWJ A;  1KTQ A;  3FFI A;  5HLF A;  1YVU A;  1SKW A;  1N5Y A;  4E0D A;  3LPT A;  4BAC A;  4CJ5 A;  1HNI A;  4DMN A;  1KVC A;  4CK3 A;  4FM0 A;  1TL3 A;  4FJI A;  1IKW A;  1RDC A;  4NYF A;  4F3O A;  1ASV A;  4CEB A;  2HMI A;  4CHP A;  1LW2 A;  1SKR A;  2OA8 A;  4C8K A;  3RTV A;  4PA1 A;  4E19 A;  4E7L A;  4KB1 A;  5HP1 A;  3IG1 A;  1KLM A;  3NF7 A;  5KTQ A;  4WE1 A;  4OJR A;  1J5O A;  3L2V A;  3QLH A;  2IDO A;  1J53 A;  4DFK A;  4E89 A;  3OS2 A;  4ELU A;  2YNH A;  5DK5 A;  4PQU A;  4CGD A;  4CGJ A;  4AIL C;  1D9F A;  3KLG A;  2WOM A;  3HXM A;  3SUN A;  3PV8 A;  4BE2 A;  3WNF A;  2FBY A;  4FLV A;  3C6T A;  4N47 A;  1T05 A;  2G8U A;  4CEA A;  1RTI A;  2HNZ A;  3V9X A;  2E6M A;  4CJ3 A;  4NCA A;  4CEQ A;  1T03 A;  2XO7 A;  1TVR A;  1BIZ A;  3WNH A;  4J2E A;  3AA4 A;  3VQC A;  2I5J A;  2X6S A;  2FBV A;  3VQA A;  2DTU A;  4M3W A;  5JS1 A;  3L2R A;  3CQ8 A;  2Z1I A;  3VQE A;  4EZ9 A;  4CCH A;  3U3Y A;  4OPJ A;  3HT3 A;  1IKV A;  3M8S A;  4OKJ A;  4FJL A;  2RF2 A;  5SWM A;  2F8T A;  1XHZ A;  2FBT A;  5HRR A;  2ZQB A;  4BE0 A;  1QQC A;  4I7F A;  4CK2 A;  3QIP A;  3M8P A;  1ASW A;  3P83 D;  4E7I A;  1IG9 A;  4M3Y A;  3ASM A;  3AO4 A;  3CFO A;  2QKK A;  3BGR A;  4BDP A;  2D0A A;  3OJU A;  3DRR A;  3ZSY A;  3K5N A;  2OZM A;  4ICL A;  1T7P A;  1Q9Y A;  1TAQ A;  4GMJ B;  4CJ4 A;  3KK3 A;  4JRP A;  5J2M A;  2RKI A;  4B9T A;  4CJP A;  2B4J A;  4DQQ A;  3SQ2 A;  1HYV A;  5JS2 A;  2KFN A;  3B6P A;  2HVH A;  2Q3S A;  2B6A A;  3VA3 A;  3L2W A;  3V6D A;  1RT1 A;  4KRF A;  4AHT A;  4CER A;  4IFY A;  2KW4 A;  3AO1 A;  1KSP A;  1BIS A;  5HRP A;  3V1Q A;  1C1B A;  1X1P A;  1RT4 A;  1TKT A;  3V1R A;  1JLE A;  3U6F A;  3TAN A;  3K2P A;  4CGG A;  2Y1J A;  1WLJ A;  3OYM A;  2D5R A;  3PUF A;  3DLB A;  1HRH A;  1RDA A;  4MFB A;  4CJV A;  4FJN A;  3OYL A;  2G8K A;  1JLB A;  4ELT A;  4IBN A;  4FJ9 A;  1IH7 A;  3DRS A;  4KHQ A;  1XWL A;  1ZBF A;  4RW8 A;  2YHB A;  3O4Q A;  3HP6 A;  3HVR A;  1RIL A;  3M8Q A;  3OYG A;  2YHA A;  3DM2 A;  4CIF A;  1U4B A;  3RRG A;  1CZB A;  4HUF A;  3SPY A;  3LP1 A;  2IC3 A;  4O44 A;  4CFD A;  5J1E A;  4DS4 A;  3VQ5 A;  2F8S A;  1SL2 A;  1WSJ A;  1S9G A;  2EX3 A;  4IDK A;  3CFR A;  1WSG A;  1JL1 A;  1LW0 A;  1NK6 A;  3QIO A;  1NOZ A;  1JLC A;  2ATQ A;  1QSS A;  1RBV A;  1UOC A;  2B5J A;  3LZI A;  4KI6 A;  2AJQ A;  3HK2 A;  4ZTJ A;  3ZSZ A;  4E3S A;  2O4G A;  1X9W A;  2HB5 A;  3RRH A;  2DFF A;  4KHS A;  4E1N A;  3V9W A;  3OS1 A;  1W0H A;  3H08 A;  3HPH A;  1NK4 A;  4KB0 A;  3O3H A;  4FLX A;  4DTP A;  1CLQ A;  3MEC A;  3MXI A;  4F2R A;  4KAZ A;  2YKM A;  4I9Q A;  1RT6 A;  5KGX A;  2OPQ A;  1S9E A;  1EXQ A;  4CF1 A;  2Y1I A;  3I0R A;  4HCC A;  3VQ6 A;  1IKY A;  3NF8 A;  1BIU A;  1B92 A;  2IS3 A;  3V1O A;  4DSL A;  4FJK A;  1NK9 A;  3OYE A;  3JSM A;  2HW3 A;  3ZSO A;  3SUP A;  4RW7 A;  1A5V A;  1J9A A;  4OVL A;  3K5O A;  1S5J A;  3K57 A;  2A1R A;  3VQ7 A;  3SYZ A;  3SQ4 A;  4CED A;  1RTD A;  2RPI A;  1NKC A;  3EYZ A; 
#chains in the Genus database with same CATH topology
 4W5Q A;  3L2U A;  4CF8 A;  4OLA A;  3DJC A;  1CZA N;  3CCJ N;  3LDL A;  3EE8 A;  4M3T A;  3QB0 A;  4M3R A;  4ELV A;  3AAP A;  3J80 O;  2P5G A;  2NRR A;  3HOT A;  3OYK A;  5J2N A;  2RHK A;  4CF2 A;  1JCE A;  1YXQ A;  1QZ5 A;  3UKU B;  3R8E A;  3P5J A;  3AVN A;  5HRS A;  3E01 A;  3ID8 A;  3E9O A;  3ISN C;  3KLH A;  4FLZ A;  3ZX0 A;  3LP3 A;  4DFP A;  4HUE A;  4FK0 A;  4JS4 A;  1TL1 A;  3WUH A;  3MN6 A;  3ALY A;  2P1J A;  4CIE A;  1SV5 A;  3VEN A;  1HYS A;  4B9M A;  4A62 A;  1IBL K;  2VCP A;  5AJ3 K;  3AVL A;  3UKR A;  3AVH A;  4Z4I A;  3WXL A;  1G15 A;  4IEI A;  3DXM B;  3L3U A;  4LF7 K;  4K8X A;  3F2K A;  4FW2 A;  4X66 K;  4FZZ A;  1EO1 A;  4KO0 A;  3FFK B;  1NJZ A;  3P38 A;  2IVP A;  3D2F B;  1SAZ A;  4FJ7 A;  3C7N A;  4J2A A;  4IJA A;  4M42 A;  2XHB A;  4R79 A;  3V9S A;  1SZ2 A;  3CM6 A;  4H5W A;  5AQT A;  2P9K A;  4BDY A;  3T1Y K;  1KCF A;  4CZL A;  1HNV A;  4JKG B;  3M1F A;  4C23 A;  3NGY A;  2GUP A;  4DTS A;  4EHU A;  2F4V K;  5GIP A;  4EFH A;  3I56 N;  2GWJ A;  1WSF A;  4GKJ K;  1KFD A;  3DMJ A;  3LAM A;  4O55 A;  2EWS A;  4F3T A;  1KD1 O;  3L3V A;  3A2F A;  1XC9 A;  5AQJ A;  1EET A;  3LDS A;  1GLD G;  4JI6 K;  5KI6 A;  1C1C A;  4LF5 K;  1Z25 A;  2E4L A;  4RG8 A;  4ILH A;  3RVC A;  4PL7 A;  4XH1 A;  4HVJ A;  4DSK A;  2D0C A;  3V9U A;  4DLG A;  3CFP A;  4PKH A;  3ZET A;  4AHS A;  4IKF A;  2ZJR L;  1NGC A;  4H5R A;  5AQW A;  1QQO A;  2NRW A;  1GOC A;  5CZ1 A;  5KPZ A;  3JS6 A;  4H5T A;  3SK3 A;  1VSM A;  3HYF A;  4FWS A;  2HST A;  3VF6 A;  2VGM A;  3J81 O;  5JVH L;  4E7K A;  1Q7Y O;  4W5N A;  3VF2 A;  2V7Y A;  1NK5 A;  4CJ7 A;  3DLG A;  4Q0B A;  1XMO K;  1KAX A;  2OCE A;  1HLU A;  4KHU A;  3D0P A;  4BRD A;  1ATR A;  1Y64 A;  3OYB A;  3OYC A;  4CHQ A;  4A61 A;  3NHG A;  2Q36 A;  4MLE A;  3LP0 A;  3LDN A;  3H1V X;  3VQP A;  1L3T A;  1OH6 A;  4JI5 K;  2FXU A;  1RTH A;  1SUQ A;  4TSX A;  3SMP A;  5FPM A;  3V9Z A;  1CZ9 A;  4KTQ A;  1HJR A;  3MN7 A;  4B08 A;  1LAW A;  4Y1D A;  3RWU A;  3DLH A;  5AQR A;  3HZ6 A;  3O08 A;  4W5O A;  4I2P A;  3PO4 A;  4FLY A;  1R0A A;  1Q8I A;  1NK0 A;  4B3S K;  3VEX A;  4GV3 A;  4N41 A;  4B1Z A;  3U9D A;  2P9S B;  1S1U A;  3BEX A;  2G8V A;  2VQE K;  1I3A A;  3BDP A;  3TAQ A;  3OYA A;  1WBB A;  1YJ9 N;  4PL8 A;  5DMR A;  4FM2 A;  4CJR A;  1LAV A;  4QAG A;  1ZBU A;  3LAN A;  3ENB A;  3AAR A;  3LAK A;  3THW B;  1EP4 A;  2W6K A;  4JKC A;  4O0J A;  4AHV A;  3QDK A;  1JL2 A;  4J2B A;  4YOV A;  4ID5 A;  3B6O A;  4BR7 A;  1NG9 A;  2KKZ A;  4CF9 A;  3ULD A;  2YNF A;  4CBX A;  3ZCM A;  5JIC A;  1VQ9 N;  3T19 A;  3MXJ A;  1ZXO A;  3KKS A;  1P90 A;  3OTO K;  3DXM A;  4DSE A;  2ZE2 A;  3NVM A;  5FRM A;  1BCM A;  4DSI A;  5C25 A;  3K0S A;  3LP2 A;  3P1G A;  3LDP A;  1LWF A;  3D2F A;  3CCV N;  5C15 A;  3U4L A;  4MDA A;  1WOQ A;  3M6G A;  1Q9X A;  1V4S A;  3D2E B;  4KRE A;  3NCI A;  4FM1 A;  1KLN A;  1O1W A;  2WFB A;  5HBM A;  2X6N A;  1BI4 B;  2RN2 A;  5M1N A;  3VTI A;  4B1X B;  2ZF5 O;  3R9P A;  2P9I B;  3K9K A;  1S1T A;  3DRP A;  3QML A;  3RR7 A;  1B9D A;  2O8F B;  2LSN A;  1OH7 A;  1VSD A;  4O0I A;  4MO4 A;  1H1V A;  1S6P A;  2P51 A;  4YFU A;  1ZBH A;  1S1W A;  2KHO A;  4IFV A;  2FF3 B;  3AVC A;  4A5A A;  3NGI A;  4FZX C;  3CME N;  1X3N A;  2E88 A;  1U48 A;  2QWM A;  2F9W A;  1L5U A;  1KQS M;  3TAE A;  4FJX A;  3CPE A;  3CQY A;  1BHL A;  3QET A;  4JI1 K;  2OPR A;  3MWP A;  5F2R A;  2JGU A;  4NYN A;  1OH5 A;  4WF9 L;  3ZSQ A;  5LMN K;  4FJG A;  2Q97 A;  4FPB A;  3SZ2 A;  4PKG A;  2ITG A;  3AA2 A;  2A41 A;  2VQF K;  3ZSX A;  1DTT A;  3V4I A;  2UYT A;  1NJW A;  1FXX A;  4HCB A;  1T8E A;  2V7Z A;  1IV0 A;  5EX5 A;  5CY4 A;  3TAM A;  1T6C A;  4FVM A;  3SNN A;  4CEZ A;  3LPU A;  1FK9 A;  4BG9 A;  4CK1 A;  1YI2 N;  4Z4C A;  2VG5 A;  3AVG A;  4YOT A;  3FFI A;  2YJF A;  5HLF A;  1YVU A;  1SKW A;  2E1Z A;  2UXC K;  5F0X A;  4DMN A;  4FJI A;  2QA4 N;  2WTU A;  4CHP A;  1GLC G;  1MWM A;  3RTV A;  4JKF A;  4KB1 A;  5KQ8 A;  3IG1 A;  3PIO L;  5KTQ A;  4OJR A;  4NB4 A;  3QLH A;  2AA4 A;  4E89 A;  1GLB G;  4CGD A;  4CGJ A;  1D9F A;  2WOM A;  3HXM A;  4CZF A;  4LFB K;  3NMU A;  4JKD A;  2I7P A;  1T05 A;  2P9S A;  4N47 A;  3DLL L;  3H3O B;  2HF4 A;  3HBT A;  2E6M A;  4CJ3 A;  4B3R K;  3ZYY X;  1BIZ A;  4J2E A;  2VWB A;  3CQ8 A;  1ZBS A;  2P9N B;  2QM1 A;  1IKV A;  3GE1 A;  3OW2 M;  3ZX2 A;  3THW A;  2V52 B;  5M1P A;  1ASW A;  1IG9 A;  3BY5 A;  3MN5 A;  4I6M B;  2D0A A;  3OJU A;  3P39 A;  2UXD K;  2OZM A;  1T7P A;  4ISF A;  3DWL A;  3KK3 A;  4JRP A;  4AM6 A;  5J2M A;  2IIR A;  3SQ2 A;  2HVH A;  2Q3S A;  3EEQ A;  4QS8 A;  2B6A A;  3VA3 A;  1VHX A;  4QS9 A;  5H1S Q;  1X1P A;  4IWV A;  4CGG A;  3PSI A;  1HRH A;  3JAM O;  2HOE A;  1D4X A;  3OYL A;  1JLB A;  3B8A X;  4IBN A;  1IH7 A;  1BOT O;  3CPW M;  2BTF A;  3HVR A;  1O13 A;  4CIF A;  3FZF A;  4BY9 C;  5J1E A;  3VQ5 A;  1SL2 A;  3D2E A;  1WSJ A;  1S9G A;  2EX3 A;  3CJC A;  4JK7 A;  4FO0 A;  4DKW A;  1U2V B;  2WBN A;  5AQG A;  3ZSZ A;  1ESV A;  2DFF A;  5AQN A;  2P9I A;  1GLE G;  1NMD A;  3THX B;  4BGB A;  2Q0R A;  5KQD A;  4E1J A;  3O3H A;  4DTP A;  4I9Q A;  4F2R A;  3ATV A;  5BRD A;  1RT6 A;  4HCC A;  3VQ6 A;  3SAG A;  3MCP A;  1T6D A;  4FJK A;  3OYE A;  2HW3 A;  5LL6 Z;  3GL1 A;  1VQ6 N;  4RW7 A;  1J9A A;  1C0F A;  4BRF A;  2NRX A;  1VQ4 N;  3K5O A;  5AQV A;  2ZJQ L;  5TKW A;  3EYZ A;  4KH6 A;  4M7X A;  1GLA G;  4CIG A;  4W5R A;  4OKE A;  5FRN A;  3CM5 A;  3OS0 A;  4CHN A;  3S3M A;  3KLE A;  3SI6 A;  3Q7C A;  4A2B A;  2HHU A;  1A5X A;  2QWQ A;  3VQ4 A;  1VAZ A;  3CJB A;  5I3U A;  2D0B A;  2HBJ A;  3QIN A;  4BR9 A;  5C10 A;  3P4I A;  3VER A;  5E41 A;  1RT7 A;  2ZD1 A;  5CR4 A;  3O9T A;  3TSP A;  4JD2 B;  2JWL A;  1HNW K;  2O8B B;  1VQN N;  1VK0 A;  1LV5 A;  2O8D B;  3EE9 A;  5AZI B;  1S1V A;  2QWR A;  4BVP A;  4CGF A;  3MEG A;  1YF5 L;  3N4Q A;  4CES A;  4DUZ K;  3IRX A;  4M3Z A;  1N34 K;  4K41 A;  4JN4 A;  2KQ2 A;  1I94 K;  3SBG A;  1CXU A;  4FW1 A;  1WAF A;  1XMQ K;  4FWQ A;  4G1Q A;  4DS5 A;  2KFZ A;  3TSQ A;  3PY8 A;  1XHX A;  3SPZ A;  1WN7 A;  4CJL A;  1SS6 A;  2WC9 A;  4DV3 K;  3KTQ A;  1HYZ A;  1C0G A;  3BP8 A;  4GVM A;  3AGK A;  5E26 A;  2QWP A;  2YCH A;  4BC3 A;  3OVN A;  4MDB A;  1TKZ A;  1SKS A;  1HNZ K;  1HQE A;  4FVU A;  4RCH A;  2P9N A;  4LF6 K;  4H5V A;  2OPS A;  4CEC A;  3HM9 A;  3F73 A;  2W42 A;  1Z6R A;  4JNE A;  2A6A A;  4CJF A;  3T3F A;  2A5X A;  3L8B A;  4I6M A;  1QS4 A;  2YNG A;  3KK7 A;  3WXM B;  3LWM A;  1SL0 A;  4YY3 K;  2F7T A;  3LDO A;  1DKG D;  1ASU A;  2QXF A;  3NF6 A;  4WFN L;  1ZYQ A;  3EL2 A;  3VQB A;  3NDK A;  1JXE A;  4DTM A;  3DAW A;  3Q7B A;  2JLE A;  1HKC A;  2E8A A;  3DLR A;  4LH5 A;  2PBD A;  4AM7 A;  1BUP A;  3A5M C;  2XY6 A;  3TAR A;  5C0Y A;  1NU0 A;  3HP9 A;  2PY5 A;  4Q5V A;  1B9F A;  3EZ5 A;  1ITG A;  5CE3 A;  2PYJ A;  3FE1 A;  5BRF A;  2PYL A;  1XUP O;  4QCL A;  4CW7 B;  4JI3 K;  3MEE A;  5BPN A;  1BA0 A;  5E84 A;  4LF8 K;  1HKG A;  5BN9 A;  1RTJ A;  1U2V A;  1T3V A;  3TTD A;  3RR8 A;  3OHR A;  4C1N I;  1VSI A;  1KVB A;  1VSJ A;  3AAQ A;  1RFQ A;  3VGK A;  3CC4 N;  3O3G A;  3GBT A;  2GBZ A;  2X74 A;  1HR0 K;  1LOT B;  5DM7 L;  5LY3 A;  5EU7 A;  3CD6 N;  3VEV A;  4B9N A;  1HMV A;  4CZE A;  2UXB K;  3KD5 E;  3K59 A;  4LY7 A;  3DI6 A;  3ULE B;  2OZS A;  5HRO A;  3I8D A;  3C6H A;  4FLT A;  1RBT A;  3JXU A;  4F8R A;  2HBM A;  3UB5 A;  3W3D A;  2HHQ A;  4RW4 A;  4RWT A;  4B1U B;  3H46 O;  5K14 A;  1FKO A;  3SLC A;  4AHC A;  4FK2 A;  3SV4 A;  4GKK K;  5CHI A;  4DR4 K;  4M3U A;  3N4P A;  3C6U A;  1TK0 A;  1GOB A;  3KHY A;  4DQP A;  1BO5 O;  4OGE A;  1VQK N;  2Q31 A;  3CJ1 A;  4WQ5 A;  3ZT3 A;  5GIN A;  4ISE A;  4J8F A;  4CF0 A;  2Z1H A;  2P9P B;  2NRV A;  2P9L B;  2O8B A;  3EO3 A;  3AA3 A;  3KK1 A;  3U3G A;  1IBM K;  2GTD A;  5FDL A;  4CZK A;  4DWI A;  4DQS A;  3NBP A;  4OX9 K;  4EZ6 A;  4BC5 A;  1F21 A;  4UQG A;  5BR9 A;  4H0T B;  4RW6 A;  1NGH A;  3AVI A;  3F9M A;  3SQ1 A;  3TPQ A;  2QK9 A;  1K73 O;  4DSJ A;  3BUZ B;  4FK4 A;  1VSL A;  4O5B A;  4G9Z A;  4XH4 A;  1JLQ A;  4FYD A;  2QXL A;  3OYN A;  4CFC A;  1C0T A;  2VG6 A;  4FZY A;  1K6Y A;  1TK5 A;  1TUU A;  5KPR A;  3RMA A;  1EKE A;  3QNN A;  3KLI A;  3ZX3 A;  4IOA L;  3C94 A;  3S9H A;  3D7E O;  3K58 A;  3TAP A;  3CJA A;  4M41 A;  2KZM A;  3SQ0 A;  2VG7 A;  5KRS A;  1UWB A;  4DR2 K;  3AO5 A;  4PHT X;  1WBD A;  4DV2 K;  4DF4 A;  4BRM A;  4JS5 A;  3KVG A;  3SJH A;  1FKP A;  3G71 N;  3O3F A;  4FWR A;  5F1X A;  5MLC Q;  3VEO A;  4M45 A;  1K8K B;  4WFA L;  1NK7 A;  1N33 K;  4DFJ A;  4JI4 K;  4CBW A;  5C42 A;  1WSI A;  2FLO A;  4DHY A;  3NFA A;  1FW6 A;  3H6E A;  3O1W A;  4FWK A;  4IXC A;  1ZBL A;  3DLE A;  1EX4 A;  1VSK A;  3DOL A;  1IKX A;  3AVA A;  3QFU A;  1UA1 A;  3FZM A;  4CZM A;  1QE1 A;  2A1S A;  4OPK A;  1D5A A;  1R59 O;  1WUA A;  2E2O A;  2ETJ A;  3C6A A;  1LWE A;  1U45 A;  1N6Q A;  1KTQ A;  4CD3 A;  4E0D A;  4BR4 A;  4BAC A;  4KH5 A;  1TL3 A;  4WQ4 A;  1J5E K;  4F3O A;  1ASV A;  2HMI A;  1RDU A;  1LW2 A;  4B1W B;  4C8K A;  4YOR A;  1NGI A;  1WB9 A;  1KLM A;  1J5O A;  3UKU A;  4BRE A;  4CVN E;  1N36 K;  2YNH A;  5DK5 A;  1IJJ A;  3ULE A;  1S3X A;  3SUN A;  1OVY A;  4FL9 A;  1T44 A;  1DEJ A;  5BR8 K;  4CZG A;  3V9X A;  4NCA A;  2XO7 A;  2NZT A;  1TVR A;  3BF3 A;  3WNH A;  3AA4 A;  3GDQ A;  2X6S A;  2FBV A;  3VQA A;  2DTU A;  3UE5 A;  1MWK A;  2Z1I A;  3VQE A;  1KAZ A;  4CCH A;  4BRN A;  3IKM A;  2ZJP L;  4YDU A;  4FJL A;  2F8T A;  2FBT A;  4IOC L;  4L3Q A;  2ZQB A;  5HRR A;  1BWF O;  3J7Y P;  4BVO A;  3O9Q A;  4I7F A;  3QIP A;  3M8P A;  4BR2 A;  2NNW A;  4BDP A;  3NVK A;  3U9Z A;  4GMJ B;  5GAE P;  2D0O A;  2P9P A;  4B9T A;  2P9L A;  3A5L C;  5JS2 A;  4JKG A;  3CF5 L;  3V6D A;  1RT1 A;  4AHT A;  3MX2 A;  3T7Z A;  4CER A;  2QWL A;  2KW4 A;  4H0V B;  5HRP A;  3V1Q A;  1NWK A;  1RT4 A;  1HNX K;  3U6F A;  5AQQ A;  2FSK A;  1YIJ N;  1RDA A;  4MFB A;  3GG4 A;  4CJV A;  2FSJ A;  4FJ9 A;  3VOV A;  2ASO A;  3DRS A;  3O8M A;  1VQP N;  4KHQ A;  2YHB A;  4B3T K;  2QI2 A;  3HP6 A;  4IEE A;  3FZL A;  3M8Q A;  1X3M A;  4BR0 A;  3SPY A;  3LP1 A;  4CFD A;  5LMU K;  3IDH A;  4DV5 K;  5FPE A;  4FOI A;  1WSG A;  1JL1 A;  1NK6 A;  3IMX A;  1JLC A;  1U6Z A;  1HJO A;  1RBV A;  4JHD B;  3CCQ N;  2B5J A;  2WUS A;  4E3S A;  3RRH A;  3EKU A;  3M5R A;  3V9W A;  4WQ5 C;  1IG8 A;  3TTC A;  1CLQ A;  4KAZ A;  2FSN A;  5KGX A;  2OPQ A;  1K8A O;  4ILJ A;  4NLC A;  3I0R A;  3QBX A;  3CET A;  3O5B A;  5M1F A;  1IKY A;  3NF8 A;  1B92 A;  4DSL A;  5HL7 L;  3K57 A;  1S5J A;  2A1R A;  3CJ7 A;  1K8K A;  3QFP A;  2Q1N A;  4IJN A;  3TR8 A;  3K5L A;  4Z4F A;  2BGG A;  5AR0 A;  4DU1 A;  1QHA A;  3EKS A;  1L3S A;  2ZWH A;  1JKH A;  3HO1 A;  3U8X A;  1REV A;  3EY1 A;  4DR6 K;  4BC2 A;  4JKA A;  1S72 N;  1VRU A;  2BAN A;  4B8A B;  4LF9 K;  5D3G A;  2IOC A;  4K42 A;  4KTW A;  1HX1 A;  3WQU A;  3THY B;  4DQ8 A;  4JAX A;  5BPM A;  4C8L A;  2E2N A;  1D8Y A;  1WSE A;  4DB3 A;  1VSE A;  3C0B A;  4B9V A;  2PFU A;  4UY8 O;  3VPZ A;  4F9O A;  2D4W A;  5KRT A;  2GWK A;  4IO9 L;  3RMC A;  4DTN A;  4OKK A;  3KIO A;  1W7A A;  3K9J A;  4KTZ A;  1VQ8 N;  4J2D A;  3SCX A;  4CEE A;  4U67 L;  4WFB L;  3HST B;  2E2P A;  1U04 A;  2HHV A;  1MU2 A;  4I2Q A;  4PUO A;  4DTO A;  4Z4H A;  3DLK A;  4A2A A;  3R1X A;  3KD1 E;  3G10 A;  5HRN A;  1DT9 A;  4RW9 A;  2W6L A;  2RE2 A;  5A2Q O;  4AHU A;  4EP5 A;  4YNQ A;  4JK8 A;  1RDD A;  4O8K A;  4DR7 K;  4BRL A;  3RSE B;  3TWH A;  4XIU A;  4KKO A;  4FWN A;  2VWK A;  4IOX A;  4OLB A;  2UUA K;  1X9M A;  5I9E B;  4DV0 K;  1W2B M;  5EVZ A;  4KHW A;  4DR1 K;  2UUC K;  2NRH A;  3QEI A;  1C1A A;  4I9L A;  1GLJ O;  3E9L A;  3CYM A;  5CYM A;  4CEF A;  1Q86 O;  2HVI A;  3TU5 A;  1RGI A;  4FWP A;  3G4S N;  4FJH A;  1BL3 A;  1P8Z A;  2BDP A;  4ZTF A;  2CH5 A;  3CC7 N;  2HHS A;  4WQ4 C;  5FPN A;  4MLH A;  3OYI A;  1IO2 A;  1HUX A;  4IZ9 A;  5LJW A;  1WAJ A;  1BI4 A;  1RBS A;  1VSH A;  4FJM A;  3PO5 A;  1RT3 A;  1A5W A;  3SBT A;  4B1Y B;  1VRT A;  3G0Z A;  3HSC A;  3HPO A;  2XY7 A;  3KKR A;  4YOX A;  4CHY A;  1YTA A;  2O8F A;  1OKJ A;  5AQZ A;  1NJI O;  3QEP A;  4H8K A;  3QES A;  4C1N K;  4IG0 A;  3IUC A;  3NAE A;  4KV8 A;  3H1Q A;  4GY2 B;  1EWR A;  5C2F A;  3HVT A;  2R7Y A;  4JHD A;  4YDU C;  1YTU A;  2P5O A;  2BE2 A;  1QHT A;  4K43 A;  4EHT A;  2Z1G A;  4LF4 K;  4DLE A;  4GV9 A;  1KC8 O;  4H0X B;  1TK8 A;  4LD0 A;  3IAY A;  4CJU A;  4KHP K;  1QZ6 A;  3O1B A;  5C12 A;  4DTJ A;  4LSL A;  4XH5 A;  4XEI A;  5J2Q A;  2ZM6 K;  1RNH A;  4JI8 K;  2F9T A;  2O8C B;  2QTD A;  3VGL A;  3OYJ A;  1JLF A;  4GV6 A;  3KLF A;  3NH1 A;  4CFA A;  4FWM A;  5T7B A;  5GAH P;  4DQI A;  3AA5 X;  2QKB A;  3OYF A;  4LSN A;  1XNQ K;  2CGK A;  2VGN A;  1VQ5 N;  4HHT A;  4DV6 K;  3THY A;  2OTJ N;  1BQN A;  4DTU A;  1EQY A;  5C2D A;  3OYH A;  2A42 A;  1DLO A;  2YNI A;  3OYD A;  3I55 N;  2OAN A;  1BGX T;  1CXQ A;  3OA9 A;  3O80 A;  4HUG A;  1W97 L;  4N56 A;  2DFH A;  3VF4 A;  5BN8 A;  1C6V A;  3ZSV A;  3DOK A;  1YHQ N;  1BQM A;  1TGO A;  4K8Z A;  4CJW A;  3THV A;  4K0K K;  2YHW A;  1Z26 A;  5CZ2 A;  1M90 O;  1NGG A;  2PZS A;  3SUO A;  2BUP A;  3SAH A;  3ZET B;  4Y0W A;  3KK2 A;  3FZK A;  3EN9 A;  4JRQ A;  3PX4 A;  1HKB A;  3MX5 A;  1VQL N;  1HQU A;  3K5M A;  2HHT A;  2IAJ A;  4Y1C A;  3VTH A;  3D6R A;  1TAU A;  3HL8 A;  4BRH A;  3UIQ A;  3CQX A;  2GV9 A;  4DTX A;  3KWI A;  1C0M A;  4BWJ A;  2KTQ A;  2GEM A;  1NK8 A;  3AVF A;  4BRI A;  4W5T A;  1EWQ A;  3LWL A;  3PIP L;  3QEW A;  4BDZ A;  2E2Q A;  5AQX A;  2V51 B;  3LL3 A;  3QEV A;  3A0I X;  1GLF O;  4NLB A;  1XI1 A;  5SZT A;  3PX0 A;  5C24 A;  1QSY A;  3KJV A;  3H45 C;  3OY9 A;  3TSU A;  3OBW A;  5M1O A;  2X78 A;  3VN5 A;  2DFE A;  2IVO A;  4FWL A;  4A59 A;  3ZT2 A;  4CJQ A;  2HHH K;  3I33 A;  3THX A;  2HND A;  4NXM K;  1KAY A;  4DV4 K;  3F9K A;  2UU9 K;  1JCG A;  3WEE B;  2E6L A;  4CZJ A;  4KH4 A;  3RMB A;  1YUW A;  3QER A;  3T1H K;  1DTQ A;  1E4G T;  1J54 A;  4FJ5 A;  4V19 S;  3SUQ A;  2QEX N;  3NF9 A;  4B3O A;  2AP1 A;  4AH9 A;  5JLF A;  1D9D A;  4KFB A;  4BRO A;  1RDB A;  1HPM A;  1QTM A;  1ZBI A;  5AZJ B;  3A5O C;  4JYA K;  4CJ5 A;  4H5N A;  1HNI A;  3DXK B;  4CK3 A;  3VES A;  4YHH K;  4NYF A;  3IFR A;  4PA1 A;  1V4T A;  4M63 C;  4E19 A;  4E7L A;  1BG3 A;  2CH6 A;  4WE1 A;  3WXK A;  3L2V A;  2IDO A;  1J53 A;  3J7Z O;  4DFK A;  3PLA A;  5GAG P;  4YOW A;  4PQU A;  5FPD A;  2O8C A;  4AIL C;  4O5F A;  4JD2 A;  4BE2 A;  2FBY A;  2G8U A;  3BZK A;  2O8D A;  4CD1 A;  2I5J A;  5AZI A;  3I8B A;  4LFA K;  1GLL O;  5ELZ A;  3L2R A;  5JS1 A;  4FSV A;  4DR5 K;  3U3Y A;  5BRH A;  3HT3 A;  4AQY K;  3M8S A;  4CZH A;  1JJ2 M;  1OH8 A;  1XHZ A;  2E20 A;  4BE0 A;  4DV7 K;  2HBL A;  4CK2 A;  3P83 D;  4X62 K;  2NRZ A;  4M3Y A;  2QKK A;  3CFO A;  3BGR A;  3ZLJ A;  2RKI A;  4CJP A;  3CCS N;  3CCE N;  2B4J A;  1HYV A;  3B6P A;  1NMN A;  4K25 A;  4KRF A;  4BC4 A;  1QQN A;  1KSP A;  2I7N A;  1BIS A;  1TKT A;  3WXJ A;  4B1V A;  4IDH A;  1WLJ A;  3OYM A;  2D5R A;  1YJN N;  2G8K A;  5BRE A;  3HOS A;  4ELT A;  4GVE A;  1XWL A;  4RW8 A;  1RIL A;  2YHA A;  1TUY A;  3DM2 A;  1CZB A;  3CHW A;  4BGA A;  4DS4 A;  2QWN A;  2F8S A;  1ATN A;  3CFR A;  4BG8 A;  1LW0 A;  3QIO A;  5EY4 A;  3FZH A;  3QIC A;  1QSS A;  3LZI A;  4KI6 A;  3HK2 A;  1SQK A;  1X9W A;  2HB5 A;  4KBO A;  3L4Q A;  4E1N A;  4JV5 K;  3ENH A;  2E1Y A;  5GAD P;  3VEZ A;  3L6Q A;  4FLX A;  3MXI A;  1Q82 O;  3J7A P;  1S9E A;  1EXQ A;  4JI7 K;  5JLH A;  1NBW A;  1BIU A;  3S41 A;  1LCU A;  3V1O A;  5AFU A;  2YHY A;  3J8A A;  3ZSO A;  3SUP A;  1A5V A;  3VEW A;  1NGB A;  4CED A;  3E9P A;  1RTD A;  3MDQ A;  2DPN A;  3R3L A;  2NUB A;  1BA1 A;  1S1X A;  1RBU A;  1YAG A;  1UA0 A;  2GUI A;  2XY8 A;  4CFB A;  4KI4 A;  3WEE A;  4DG1 A;  3SAF A;  3MED A;  5IT9 O;  3AVJ A;  5AQM A;  1NJY A;  1TKX A;  2IGI A;  1C0U A;  3MK6 A;  3MMV A;  1KFS A;  2ZGY A;  4YOY A;  2HHX A;  4GNI A;  3HTV A;  3VGM A;  3VQD A;  5I42 A;  4DSF A;  3O4N A;  5AZJ A;  5B8H A;  3QBW A;  2F96 A;  4OPA A;  5LJV A;  3AVM A;  1N8R O;  2OYQ A;  1TV6 A;  2NLX A;  1HPZ A;  1N32 K;  1X9S A;  2G8H A;  4PWD A;  4OGC A;  4B8C A;  3DXK A;  4C8N A;  2J4R A;  2CGJ A;  4ZHR A;  3VET A;  1W9H A;  4JLH A;  1KXP A;  1YT3 A;  1RT2 A;  3CG7 A;  2A3Z A;  1BDG A;  4NCB A;  1YIT N;  2GEL A;  4KHY A;  1VQO N;  5AQO A;  3S3N A;  4H4M A;  4EAH D;  1NOY A;  2Q2R A;  1S6Q A;  4F4K A;  4BRA A;  3G25 A;  1Q81 O;  1BU6 O;  3HJF A;  4X65 K;  4E7H A;  1U47 A;  1L3U A;  4CHZ A;  4FLU A;  4BQZ A;  1RBR A;  4WYB A;  3QEX A;  2G8W A;  1TKD A;  1NKE A;  5AQP A;  2KLA A;  4FWO A;  1G99 A;  3TTF A;  2OPP A;  4N5S A;  4N76 A;  3HM8 A;  1JXB A;  4C8M A;  4B9U A;  3NH2 A;  3CCM N;  5AFU H;  3AVK A;  4LC9 B;  4CJT A;  1NGE A;  2WON A;  3VQ8 A;  4KHN A;  4AHR A;  2DY4 A;  4OPH A;  3O9R A;  4NO7 A;  1S22 A;  5M1K A;  2A40 A;  1JLG A;  3M8R A;  4JK9 A;  4C8O A;  3VQQ A;  4LFC K;  3LZJ A;  3I0S A;  1ILY A;  4ISG A;  4BRG A;  4CE9 A;  1NGF A;  3FR0 A;  4QS7 A;  3M3Z A;  3CXC M;  3WNG A;  2OTL N;  1WSH A;  1I39 A;  4DTR A;  2EHG A;  3MCA B;  3MN9 A;  5FLX O;  5FRO A;  3SJJ A;  2Z1J A;  3AY9 A;  4HTU A;  3ZEU B;  4FLW A;  3NGZ A;  4FJ8 A;  1VSF A;  4F2S A;  3AO2 A;  4JEP A;  4IG3 A;  1KRP A;  3D45 A;  2BH1 A;  4AF1 A;  4DF8 A;  1VQ7 N;  3QO9 A;  2W40 A;  4DR3 K;  1QSL A;  2O8E B;  3HRG A;  3OBY A;  4CJE A;  4DV1 K;  3PX6 A;  3E66 A;  2G8F A;  1MA9 B;  2HMP A;  3HI0 A;  4QOZ B;  3OJS A;  4JI0 K;  1QVG M;  1YJW N;  4BQL A;  3O4W A;  4E7J A;  2O4I A;  5CYQ A;  4E1M A;  4H03 B;  3ZT0 A;  3NH0 A;  4OO1 J;  4EP4 A;  3HPG A;  1JLA A;  3ENO A;  2HBK A;  3C95 A;  5AQF A;  2FBX A;  5ADX A;  5AQS A;  4B9L A;  2HNY A;  4H0P A;  4KPY A;  4DQR A;  3WNE A;  5J2P A;  5HOO A;  1BCO A;  2ITM A;  4U7B A;  3MXM A;  2YKN A;  4FXD A;  3ITH A;  2XRI A;  3VQ9 A;  4PY5 A;  3AO3 A;  4H0Y B;  4Z0U A;  3PSF A;  3AV9 A;  1SL1 A;  5IWA K;  2YHX A;  4BWM A;  1LWC A;  4ILG B;  1JCF A;  3L4I A;  3CJ9 A;  5AQK A;  3TAF A;  1OVQ A;  1RT5 A;  2P9U B;  3ATU A;  2YJE A;  4BE1 A;  4FCY A;  1GOA A;  3A5N C;  4ID1 A;  2HHW A;  4CGH A;  2ASM A;  4X64 K;  4MO5 A;  4GW6 A;  3WXI A;  3VA0 A;  4Z4G A;  3C65 A;  3CC2 N;  4CGI A;  3GOI A;  4PKI A;  3S3O A;  4L8R B;  3FLC O;  3KWG A;  3L2Q A;  1IBK K;  3ZT1 A;  1XNR K;  1QVF M;  2HF3 A;  3O6W A;  3BF1 A;  1WNS A;  2CGL A;  1E4F T;  1NGD A;  3CI5 A;  1U49 A;  1XC3 A;  3DYA A;  5AQL A;  4DU3 A;  4BR5 A;  3LAL A;  2YV0 X;  4Z4E A;  3SV3 A;  2KZZ A;  4H0O A;  3BZC A;  1UAX A;  1XQS C;  3TAG A;  4H4O A;  1L3V A;  4BRQ A;  3TAB A;  4FJJ A;  3F5T A;  4B9Q A;  4O8U A;  1RCH A;  3ZSR A;  4B9S A;  3A8Y A;  3JYT A;  2G8I A;  3V81 A;  4R5P A;  4CHO A;  3QNO A;  5ADX H;  3ZT4 A;  5JVG L;  4O4G A;  1Z05 A;  4DFM A;  3WQT A;  1NKB A;  3IS9 A;  4NXN K;  3T1A A;  4DUY K;  1J6Z A;  1NLV A;  1NJX A;  1TYQ B;  3ZSW A;  3MAQ A;  3VMF B;  2XY5 A;  4CEO A;  4MQ3 A;  3CCU N;  3AVB A;  3FGU A;  4LH4 A;  4JKB A;  1FJG K;  3TI0 A;  1Q18 A;  1KVA A;  2FC0 A;  4A57 A;  1K9M O;  1NM1 A;  3RMD A;  3CIP A;  3ZEU A;  4WCE L;  3NE6 A;  4RTF D;  5KGW A;  3H3N O;  3MWT A;  2GX9 A;  4M3X A;  4NCG A;  4DU4 A;  4BRP A;  1Y97 A;  2QW9 A;  3L0Q A;  2O8E A;  3T69 A;  4CJS A;  5AQY A;  1NGA A;  4CJK A;  2VWJ A;  2D1K A;  1N5Y A;  3LPT A;  4YOU A;  3KZB A;  1KVC A;  5KPT A;  4FM0 A;  1IKW A;  1RDC A;  3UKR B;  4CEB A;  4JKH A;  1SKR A;  2OA8 A;  2QWO A;  5HP1 A;  2FF6 A;  5EOY A;  3NF7 A;  4JKE A;  4B3M K;  4HTL A;  3OS2 A;  4ELU A;  4Z94 A;  3C7N B;  2PAV A;  2NRT A;  2JWK A;  2P9K B;  5BPL A;  3KLG A;  3PV8 A;  3O9S A;  4FLV A;  3WNF A;  3C6T A;  3SMS A;  4CEA A;  1RTI A;  2HNZ A;  4CEQ A;  1ZC6 A;  1T03 A;  3VQC A;  3EZW A;  4M3W A;  3LM9 A;  2ASP A;  4EZ9 A;  5AQU A;  4OPJ A;  3AGR A;  2YI1 A;  4CZI A;  3ID6 A;  5JMV A;  4OKJ A;  2RF2 A;  5SWM A;  3CCL N;  2VYP A;  3CER A;  2H3G X;  5AQH A;  4M7Y A;  1QQC A;  4IFE A;  4E7I A;  3ASM A;  3AO4 A;  2W41 A;  2IVN A;  3DRR A;  5TKY A;  3ZSY A;  3K5N A;  4ICL A;  1M1K O;  1Q9Y A;  1TAQ A;  4CJ4 A;  2KFN A;  4DQQ A;  3G6E N;  2D0P A;  5GIO A;  1RDW X;  3RSE A;  3L2W A;  5AQI A;  2P9U A;  4DCH A;  4IFY A;  3AO1 A;  1X9J A;  2YX6 A;  2ZGZ A;  1C1B A;  3V1R A;  1JLE A;  5M1Q A;  3TAN A;  4CBU A;  3K2P A;  3DLB A;  2Y1J A;  3O9U A;  3PUF A;  1MDU B;  3R6M A;  2Q0U A;  3CMA N;  4FJN A;  2UUB K;  1ZBF A;  3VEY A;  4FPA A;  3LM2 A;  3O4Q A;  5DM6 L;  3W0L A;  4FOE A;  3CCR N;  3OYG A;  1U4B A;  3RRG A;  4HUF A;  1NGJ A;  2IC3 A;  4O44 A;  4IDK A;  1QQM A;  1NOZ A;  4HWI A;  4CI6 A;  2ATQ A;  1ATS A;  1UOC A;  4BRK A;  4IO8 A;  2AJQ A;  4ZTJ A;  5EXW A;  2O4G A;  4A5B A;  4KHS A;  3OS1 A;  1VQM N;  1W0H A;  1E3M A;  2E5L K;  3H08 A;  3HPH A;  1NK4 A;  4KB0 A;  4BRC A;  1YVN A;  3MEC A;  2YKM A;  3E1Y A;  3WT0 A;  1DGK N;  4EIA A;  4CF1 A;  3LDQ A;  2Y1I A;  2IS3 A;  4JI2 K;  3P31 A;  1NK9 A;  3JSM A;  4OVL A;  1TYQ A;  1NNE A;  3VQ7 A;  3SYZ A;  3SQ4 A;  2RPI A;  1NKC A; 
#chains in the Genus database with same CATH homology
 4W5Q A;  3TR8 A;  3L2U A;  3K5L A;  4CIG A;  4W5R A;  4Z4F A;  2BGG A;  4CF8 A;  4DU1 A;  2NUB A;  4OKE A;  1S1X A;  5FRN A;  3CM5 A;  4OLA A;  1RBU A;  3OS0 A;  1L3S A;  4CHN A;  1JKH A;  3HO1 A;  3S3M A;  4M3T A;  3KLE A;  1REV A;  3EY1 A;  1UA0 A;  2GUI A;  2XY8 A;  4M3R A;  4CFB A;  3SI6 A;  4ELV A;  2P5G A;  4KI4 A;  2HHU A;  1A5X A;  3VQ4 A;  4DG1 A;  1VRU A;  2BAN A;  4B8A B;  3OYK A;  5I3U A;  3MED A;  4CF2 A;  5J2N A;  2D0B A;  3AVJ A;  1NJY A;  1TKX A;  2IGI A;  3AVN A;  3P5J A;  2IOC A;  4KTW A;  5HRS A;  1C0U A;  5D3G A;  3E01 A;  3QIN A;  1KFS A;  2HHX A;  3ISN C;  3KLH A;  4FLZ A;  3VQD A;  5I42 A;  4C8L A;  5E41 A;  1RT7 A;  3LP3 A;  4DSF A;  2ZD1 A;  3O4N A;  4DFP A;  1D8Y A;  4HUE A;  4FK0 A;  1WSE A;  4JS4 A;  1VSE A;  1TL1 A;  2F96 A;  4B9V A;  1VK0 A;  3AVM A;  1LV5 A;  3ALY A;  2P1J A;  4CIE A;  1SV5 A;  5KRT A;  2OYQ A;  1TV6 A;  1HYS A;  1HPZ A;  3RMC A;  4B9M A;  4DTN A;  1X9S A;  2G8H A;  4PWD A;  1S1V A;  4OKK A;  4OGC A;  4B8C A;  3KIO A;  4CGF A;  3MEG A;  4C8N A;  4KTZ A;  4J2D A;  3AVL A;  4ZHR A;  3AVH A;  4CES A;  3SCX A;  4Z4I A;  1G15 A;  3IRX A;  4CEE A;  4M3Z A;  1W9H A;  4JLH A;  2KQ2 A;  1YT3 A;  1RT2 A;  3HST B;  3L3U A;  4K8X A;  4FW2 A;  1CXU A;  4FW1 A;  4FZZ A;  1U04 A;  2HHV A;  4KO0 A;  1MU2 A;  3CG7 A;  4I2Q A;  4PUO A;  4NCB A;  1NJZ A;  4DTO A;  1WAF A;  4Z4H A;  3DLK A;  4KHY A;  3KD1 E;  3G10 A;  5HRN A;  4RW9 A;  4FJ7 A;  4J2A A;  4G1Q A;  3S3N A;  2XHB A;  4AHU A;  3V9S A;  4H4M A;  4EP5 A;  4YNQ A;  4DS5 A;  3PY8 A;  3CM6 A;  2KFZ A;  1XHX A;  4BDY A;  1NOY A;  1RDD A;  1KCF A;  3SPZ A;  1S6Q A;  1HNV A;  1WN7 A;  4CJL A;  4F4K A;  3TWH A;  4XIU A;  3KTQ A;  4KKO A;  1HYZ A;  3NGY A;  2VWK A;  3HJF A;  2KZM A;  4GVM A;  4E7H A;  1U47 A;  4OLB A;  4DTS A;  1L3U A;  4CHZ A;  4FLU A;  1X9M A;  1RBR A;  3OVN A;  3QEX A;  1TKZ A;  1SKS A;  2G8W A;  1TKD A;  1WSF A;  1HQE A;  1NKE A;  1KFD A;  4N76 A;  3DMJ A;  4N5S A;  2OPP A;  3LAM A;  4KHW A;  4O55 A;  1JXB A;  4C8M A;  4B9U A;  3QEI A;  2OPS A;  1C1A A;  3L3V A;  3A2F A;  4I9L A;  4CEC A;  3NH2 A;  3HM9 A;  2W42 A;  1EET A;  3AVK A;  3F73 A;  5CYM A;  3CYM A;  3LDS A;  4CEF A;  4CJT A;  2WON A;  3VQ8 A;  4KHN A;  4CJF A;  2HVI A;  5KI6 A;  3T3F A;  1C1C A;  1Z25 A;  2E4L A;  4AHR A;  4RG8 A;  3L8B A;  2DY4 A;  1QS4 A;  4HVJ A;  2YNG A;  3LWM A;  1SL0 A;  4FJH A;  1BL3 A;  2BDP A;  4DSK A;  4ZTF A;  2D0C A;  1ASU A;  3V9U A;  1JLG A;  2QXF A;  3NF6 A;  2HHS A;  1ZYQ A;  3OYI A;  4DLG A;  3CFP A;  3M8R A;  3VQB A;  1IO2 A;  3NDK A;  1JXE A;  3VQQ A;  4AHS A;  4C8O A;  1WAJ A;  4IKF A;  4DTM A;  3LZJ A;  3I0S A;  1BI4 A;  1RBS A;  2JLE A;  4CE9 A;  1GOC A;  3WNG A;  3DLR A;  1WSH A;  4LH5 A;  1VSH A;  1I39 A;  5CZ1 A;  4FJM A;  4DTR A;  3PO5 A;  1RT3 A;  1A5W A;  2EHG A;  2XY6 A;  3TAR A;  1VSM A;  5FRO A;  3HYF A;  1VRT A;  3G0Z A;  3HPO A;  3HP9 A;  2XY7 A;  3KKR A;  3SJJ A;  2PY5 A;  4CHY A;  1YTA A;  2Z1J A;  4Q5V A;  4HTU A;  1B9F A;  3EZ5 A;  3NGZ A;  4FLW A;  1VSF A;  4FJ8 A;  1ITG A;  4E7K A;  4F2S A;  3QEP A;  3AO2 A;  2PYJ A;  4IG3 A;  4H8K A;  1KRP A;  4W5N A;  3D45 A;  3QES A;  4IG0 A;  2PYL A;  3NAE A;  1NK5 A;  4QCL A;  4KV8 A;  4DF8 A;  1XC9 A;  3DLG A;  3QO9 A;  4Q0B A;  3MEE A;  4KHU A;  1QSL A;  3HVT A;  4CJE A;  3D0P A;  2R7Y A;  2QK9 A;  1RTJ A;  1YTU A;  3OYB A;  3OYC A;  3PX6 A;  4CHQ A;  3RR8 A;  2P5O A;  3NHG A;  2BE2 A;  1VSI A;  1KVB A;  1QHT A;  1VSJ A;  3LP0 A;  2G8F A;  2Z1G A;  4DLE A;  3VQP A;  3O3G A;  1L3T A;  2GBZ A;  2X74 A;  4QOZ B;  3OJS A;  1TK8 A;  4LD0 A;  3IAY A;  1RTH A;  1SUQ A;  4TSX A;  4CJU A;  3V9Z A;  4KTQ A;  1CZ9 A;  1HJR A;  4B08 A;  1LAW A;  4Y1D A;  5EU7 A;  3RWU A;  3DLH A;  4DTJ A;  4LSL A;  4B9N A;  4W5O A;  4I2P A;  3PO4 A;  4E7J A;  2O4I A;  5CYQ A;  4E1M A;  3ZT0 A;  3NH0 A;  1HMV A;  5J2Q A;  4EP4 A;  3HPG A;  4FLY A;  1R0A A;  1JLA A;  1RNH A;  3C95 A;  3KD5 E;  1Q8I A;  3K59 A;  4LY7 A;  1NK0 A;  3DI6 A;  2OZS A;  2FBX A;  5HRO A;  4N41 A;  3OYJ A;  3I8D A;  1JLF A;  4B9L A;  4FLT A;  2HNY A;  1RBT A;  4F8R A;  1S1U A;  3KLF A;  2G8V A;  3NH1 A;  4CFA A;  1I3A A;  4KPY A;  3BDP A;  3TAQ A;  3OYA A;  2HHQ A;  4RW4 A;  4DQR A;  3WNE A;  5J2P A;  4DQI A;  5T7B A;  1BCO A;  3AA5 X;  5DMR A;  2QKB A;  5K14 A;  1FKO A;  4AHC A;  3OYF A;  4FK2 A;  4FM2 A;  3SV4 A;  4LSN A;  3MXM A;  4CJR A;  2YKN A;  4FXD A;  3ITH A;  4M3U A;  1LAV A;  2XRI A;  4QAG A;  1ZBU A;  4M42 A;  3C6U A;  3LAN A;  1TK0 A;  1GOB A;  3VQ9 A;  3LAK A;  4PY5 A;  1EP4 A;  4O0J A;  3AO3 A;  4DQP A;  4HHT A;  4Z0U A;  4AHV A;  3AV9 A;  1JL2 A;  4J2B A;  4OGE A;  1BQN A;  1SL1 A;  3ZT3 A;  4ID5 A;  3B6O A;  4DTU A;  4CF0 A;  4BWM A;  1LWC A;  4CF9 A;  2Z1H A;  3ULD A;  2YNF A;  3OYH A;  3ZCM A;  1DLO A;  2YNI A;  3AA3 A;  3OYD A;  3KK1 A;  3U3G A;  5FDL A;  3TAF A;  1BGX T;  1CXQ A;  1RT5 A;  4DWI A;  4HUG A;  4BE1 A;  4FCY A;  1GOA A;  3T19 A;  4ID1 A;  3NBP A;  4N56 A;  2DFH A;  4CGH A;  4DQS A;  2HHW A;  4EZ6 A;  3MXJ A;  3KKS A;  4GW6 A;  1F21 A;  3VA0 A;  4Z4G A;  4DSE A;  1C6V A;  4CGI A;  2ZE2 A;  4UQG A;  3ZSV A;  3DOK A;  5FRM A;  1BCM A;  4RW6 A;  1BQM A;  5C25 A;  3S3O A;  3AVI A;  4DSI A;  4L8R B;  3SQ1 A;  1TGO A;  4K8Z A;  3LP2 A;  3P1G A;  4CJW A;  3ZT1 A;  3L2Q A;  3THV A;  1LWF A;  1Z26 A;  4DSJ A;  5CZ2 A;  4FK4 A;  1VSL A;  1WNS A;  4O5B A;  1U49 A;  2PZS A;  3DYA A;  1Q9X A;  3SUO A;  4DU3 A;  1JLQ A;  4KRE A;  3LAL A;  4FYD A;  3NCI A;  2YV0 X;  3KK2 A;  3OYN A;  4FM1 A;  3SV3 A;  1KLN A;  4Z4E A;  2KZZ A;  1O1W A;  4CFC A;  5HBM A;  2X6N A;  4JRQ A;  1C0T A;  1UAX A;  2VG6 A;  1K6Y A;  3PX4 A;  1BI4 B;  2RN2 A;  3TAG A;  1TK5 A;  1HQU A;  4H4O A;  4FZY A;  3K5M A;  3RMA A;  2HHT A;  1EKE A;  3QNN A;  1L3V A;  2IAJ A;  3TAB A;  4Y1C A;  3KLI A;  1TAU A;  3HL8 A;  4FJJ A;  3UIQ A;  1S1T A;  2GV9 A;  3C94 A;  3DRP A;  4DTX A;  3S9H A;  3K58 A;  1RCH A;  3TAP A;  3RR7 A;  1C0M A;  3ZSR A;  4B9S A;  1B9D A;  4BWJ A;  2KTQ A;  3JYT A;  4M41 A;  3AVF A;  1NK8 A;  2G8I A;  2LSN A;  3V81 A;  3SQ0 A;  2VG7 A;  5KRS A;  4R5P A;  4CHO A;  1VSD A;  3QNO A;  1UWB A;  3ZT4 A;  4O4G A;  3AO5 A;  4O0I A;  4W5T A;  1S6P A;  2P51 A;  4YFU A;  4DFM A;  3LWL A;  1ZBH A;  4DF4 A;  1S1W A;  4JS5 A;  3QEW A;  3IS9 A;  4IFV A;  4BDZ A;  1NKB A;  3T1A A;  1FKP A;  3AVC A;  3O3F A;  3NGI A;  4FZX C;  3QEV A;  1NJX A;  1U48 A;  3ZSW A;  3MAQ A;  2XY5 A;  1L5U A;  4CEO A;  3TAE A;  4M45 A;  1XI1 A;  5SZT A;  3PX0 A;  1NK7 A;  5C24 A;  4MQ3 A;  3KJV A;  1QSY A;  4FJX A;  3OY9 A;  4DFJ A;  1BHL A;  5C42 A;  3QET A;  3AVB A;  2OPR A;  1WSI A;  4LH4 A;  2X78 A;  2JGU A;  4NYN A;  3VN5 A;  3TI0 A;  2DFE A;  4CJQ A;  3ZSQ A;  3ZT2 A;  1KVA A;  2FC0 A;  3NFA A;  4FJG A;  2HND A;  3SZ2 A;  3F9K A;  3RMD A;  2E6L A;  2ITG A;  3AA2 A;  1ZBL A;  3DLE A;  3RMB A;  3QER A;  3ZSX A;  1EX4 A;  1VSK A;  3DOL A;  1IKX A;  1DTT A;  1DTQ A;  4F3T A;  3AVA A;  3NE6 A;  3V4I A;  1UA1 A;  5KGW A;  1J54 A;  1NJW A;  4FJ5 A;  1FXX A;  1QE1 A;  3SUQ A;  2A1S A;  3NF9 A;  4OPK A;  4B3O A;  1D5A A;  4AH9 A;  4HCB A;  1D9D A;  1T8E A;  4M3X A;  4KFB A;  1QTM A;  1RDB A;  5CY4 A;  1ZBI A;  3TAM A;  4NCG A;  4DU4 A;  4FVM A;  3SNN A;  1Y97 A;  4CEZ A;  2ETJ A;  3LPU A;  1FK9 A;  4CK1 A;  1LWE A;  4CJS A;  1U45 A;  4Z4C A;  2VG5 A;  3AVG A;  4CJK A;  1N6Q A;  2VWJ A;  1KTQ A;  3FFI A;  5HLF A;  1YVU A;  1SKW A;  1N5Y A;  4E0D A;  3LPT A;  4BAC A;  4CJ5 A;  1HNI A;  4DMN A;  1KVC A;  4CK3 A;  4FM0 A;  1TL3 A;  4FJI A;  1IKW A;  1RDC A;  4NYF A;  4F3O A;  1ASV A;  4CEB A;  2HMI A;  4CHP A;  1LW2 A;  1SKR A;  2OA8 A;  4C8K A;  3RTV A;  4PA1 A;  4E19 A;  4E7L A;  4KB1 A;  5HP1 A;  3IG1 A;  1KLM A;  3NF7 A;  5KTQ A;  4WE1 A;  4OJR A;  1J5O A;  3L2V A;  3QLH A;  2IDO A;  1J53 A;  4DFK A;  4E89 A;  3OS2 A;  4ELU A;  2YNH A;  5DK5 A;  4PQU A;  4CGD A;  4CGJ A;  4AIL C;  1D9F A;  3KLG A;  2WOM A;  3HXM A;  3SUN A;  3PV8 A;  4BE2 A;  3WNF A;  2FBY A;  4FLV A;  3C6T A;  4N47 A;  1T05 A;  2G8U A;  4CEA A;  1RTI A;  2HNZ A;  3V9X A;  2E6M A;  4CJ3 A;  4NCA A;  4CEQ A;  1T03 A;  2XO7 A;  1TVR A;  1BIZ A;  3WNH A;  4J2E A;  3AA4 A;  3VQC A;  2I5J A;  2X6S A;  2FBV A;  3VQA A;  2DTU A;  4M3W A;  5JS1 A;  3L2R A;  3CQ8 A;  2Z1I A;  3VQE A;  4EZ9 A;  4CCH A;  3U3Y A;  4OPJ A;  3HT3 A;  1IKV A;  3M8S A;  4OKJ A;  4FJL A;  2RF2 A;  5SWM A;  2F8T A;  1XHZ A;  2FBT A;  5HRR A;  2ZQB A;  4BE0 A;  1QQC A;  4I7F A;  4CK2 A;  3QIP A;  3M8P A;  1ASW A;  3P83 D;  4E7I A;  1IG9 A;  4M3Y A;  3ASM A;  3AO4 A;  3CFO A;  2QKK A;  3BGR A;  4BDP A;  2D0A A;  3OJU A;  3DRR A;  3ZSY A;  3K5N A;  2OZM A;  4ICL A;  1T7P A;  1Q9Y A;  1TAQ A;  4GMJ B;  4CJ4 A;  3KK3 A;  4JRP A;  5J2M A;  2RKI A;  4B9T A;  4CJP A;  2B4J A;  4DQQ A;  3SQ2 A;  1HYV A;  5JS2 A;  2KFN A;  3B6P A;  2HVH A;  2Q3S A;  2B6A A;  3VA3 A;  3L2W A;  3V6D A;  1RT1 A;  4KRF A;  4AHT A;  4CER A;  4IFY A;  2KW4 A;  3AO1 A;  1KSP A;  1BIS A;  5HRP A;  3V1Q A;  1C1B A;  1X1P A;  1RT4 A;  1TKT A;  3V1R A;  1JLE A;  3U6F A;  3TAN A;  3K2P A;  4CGG A;  2Y1J A;  1WLJ A;  3OYM A;  2D5R A;  3PUF A;  3DLB A;  1HRH A;  1RDA A;  4MFB A;  4CJV A;  4FJN A;  3OYL A;  2G8K A;  1JLB A;  4ELT A;  4IBN A;  4FJ9 A;  1IH7 A;  3DRS A;  4KHQ A;  1XWL A;  1ZBF A;  4RW8 A;  2YHB A;  3O4Q A;  3HP6 A;  3HVR A;  1RIL A;  3M8Q A;  3OYG A;  2YHA A;  3DM2 A;  4CIF A;  1U4B A;  3RRG A;  1CZB A;  4HUF A;  3SPY A;  3LP1 A;  2IC3 A;  4O44 A;  4CFD A;  5J1E A;  4DS4 A;  3VQ5 A;  2F8S A;  1SL2 A;  1WSJ A;  1S9G A;  2EX3 A;  4IDK A;  3CFR A;  1WSG A;  1JL1 A;  1LW0 A;  1NK6 A;  3QIO A;  1NOZ A;  1JLC A;  2ATQ A;  1QSS A;  1RBV A;  1UOC A;  2B5J A;  3LZI A;  4KI6 A;  2AJQ A;  3HK2 A;  4ZTJ A;  3ZSZ A;  4E3S A;  2O4G A;  1X9W A;  2HB5 A;  3RRH A;  2DFF A;  4KHS A;  4E1N A;  3V9W A;  3OS1 A;  1W0H A;  3H08 A;  3HPH A;  1NK4 A;  4KB0 A;  3O3H A;  4FLX A;  4DTP A;  1CLQ A;  3MEC A;  3MXI A;  4F2R A;  4KAZ A;  2YKM A;  4I9Q A;  1RT6 A;  5KGX A;  2OPQ A;  1S9E A;  1EXQ A;  4CF1 A;  2Y1I A;  3I0R A;  4HCC A;  3VQ6 A;  1IKY A;  3NF8 A;  1BIU A;  1B92 A;  2IS3 A;  3V1O A;  4DSL A;  4FJK A;  1NK9 A;  3OYE A;  3JSM A;  2HW3 A;  3ZSO A;  3SUP A;  4RW7 A;  1A5V A;  1J9A A;  4OVL A;  3K5O A;  1S5J A;  3K57 A;  2A1R A;  3VQ7 A;  3SYZ A;  3SQ4 A;  4CED A;  1RTD A;  2RPI A;  1NKC A;  3EYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...