4CFBA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfbA00
1YTAA 2O4GA 1RT6A 4CJWA 3I8DA 3DMJA 1BHLA 4I2QA 4NCBA 4DLEA 2XHBA 4DLGA 3WNEA 1ZBFA 4E1MA 4DTJA 3V9XA 1S6PA 2G8VA 1TAUA 4KAZA 1EETA 1R0AA 4CEAA 2P51A 2YNHA 3PX0A 3U3GA 1NJYA 4I7FA 3C6UA 5CYQA 4CF9A 3D0PA 3AVLA 4QCLA 3KLIA 4CJPA 4CJFA 4Z4HA 2YNFA 4OVLA 1XI1A 2HNDA 4FJ5A 4GMJB 1LAVA 3OYJA 4IG3A 3AO5A 1U49A 4DSJA 4W5OA 4E3SA 2ZQBA 2HHTA 1HMVA 1NKCA 1C1AA 3KKSA 4FW1A 5HP1A 5SZTA 4DFKA 3LWLA 2IDOA 1J9AA 1B9DA 4Y1CA 1G15A 4FZZA 1RTJA 1F21A 4CJSA 3DYAA 3SI6A 4J2EA 3OYIA 1IG9A 4YFUA 1BL3A 2X6SA 3NFAA 4FLXA 1L5UA 3AVMA 2WONA 2OPPA 4CGFA 3L8BA 1S9GA 3M8RA 4B9LA 3QINA 4ID5A 2P5GA 4E7HA 4DS5A 3ZT4A 4M3YA 1C1BA 4AHRA 5KTQA 4HCCA 4DTNA 4CF0A 4OPJA 2OZMA 4Z4FA 3HXMA 4GW6A 4M3WA 4FZXC 4IKFA 1KCFA 2QK9A 3QERA 2EX3A 3ITHA 3KK1A 2XY6A 4QOZB 3VQQA 4BE2A 1ZYQA 2HHWA 1A5VA 4RW8A 1U47A 4FZYA 2O4IA 4I9LA 1U45A 1YT3A 3L3UA 3SUQA 1VSMA 1D9FA 1HYSA 1U4BA 1ITGA 1RDBA 3VQAA 4DFPA 3C6TA 3B6OA 3DM2A 1TK0A 4LH4A 4N76A 1KSPA 2BGGA 2P1JA 4FM1A 4CJVA 4FJ7A 1RBUA 2VG7A 3VQ4A 2FBXA 3ZSOA 3QEPA 2D0BA 3KD1E 1RT7A 1TL3A 1ZBUA 4KRFA 3V9ZA 3OYFA 2BDPA 4Q5VA 1Q9XA 2D0AA 3V9SA 2G8UA 1VSEA 3AVBA 4FJKA 1VRUA 4M3XA 4KHWA 1JLGA 4FJHA 1IKXA 3VQ9A 3KJVA 1ASUA 1NK9A 1CXQA 4CJ4A 2DTUA 4Z4IA 4PWDA 2XY8A 2YKNA 3S3NA 4B9MA 4FJMA 3TANA 1QSSA 4JRQA 3HPHA 3DI6A 3OS1A 3SCXA 2YNIA 4CJTA 3T3FA 2Y1IA 3TABA 2OA8A 4EZ6A 3TI0A 2F8TA 2HHUA 1REVA 5HRPA 3OVNA 4FJLA 1XWLA 5KRSA 4CHZA 1IKYA 1J5OA 4RW9A 1JLEA 1ZBLA 1I3AA 2F96A 1NK7A 3H08A 3AA2A 1JL1A 3HPGA 3NF7A 3VQDA 4C8OA 4OGCA 5C24A 3LAKA 3RRGA 5JS1A 4KHUA 4DU1A 4B08A 4I9QA 1DTTA 1C6VA 4CGGA 4XIUA 4IFYA 1XHXA 5KGWA 2FBVA 1EX4A 4E1NA 3OY9A 1JLBA 4DTRA 4F3TA 4CJUA 5FDLA 4HVJA 4CFCA 3SJJA 4FLVA 4FJJA 3VN5A 1RTHA 2JGUA 1SL0A 1RILA 2R7YA 2DFHA 5J1EA 2GV9A 3AV9A 4FJGA 3SV4A 1MU2A 1S6QA 2KFZA 3K5MA 4OGEA 4M41A 4CHPA 2Z1HA 4CEZA 4N56A 1VSDA 1BQNA 3QNNA 1D8YA 1ZBHA 5HRNA 5KGXA 3HJFA 4MQ3A 1Y97A 4E7JA 1S9EA 4M3RA 4CFDA 2RF2A 2YV0X 4CGHA 5I42A 2VWJA 4AHVA 1WSHA 4IFVA 2KQ2A 4B9UA 2HHXA 2X74A 4OLBA 1Z26A 3O3HA 4CF8A 2G8HA 2LSNA 1JXBA 3ZT3A 3TARA 2E6MA 3AO1A 4ICLA 4BWMA 3L2UA 4FJIA 4AH9A 3O3FA 4M3ZA 3NF9A 5K14A 4DU3A 3OS2A 5FRMA 4CECA 3VQEA 2HW3A 4Y1DA 1SKWA 1L3TA 4CEBA 4FK4A 1CXUA 1QQCA 2A1SA 5HBMA 3NH2A 4JRPA 3ASMA 3HM9A 3ISNC 1U04A 3RR8A 3VA3A 1BISA 1S1XA 3CG7A 3K57A 1A5WA 2A1RA 3AO4A 3IS9A 2HVHA 2IGIA 1XHZA 2OPQA 3TAPA 3QNOA 1RDCA 2IS3A 3RRHA 4OJRA 1WN7A 1TK5A 4DTPA 3EYZA 1UA1A 4Z4EA 4FLUA 1RT1A 3PY8A 1BCOA 2DY4A 4EP4A 3D45A 2B5JA 4CEEA 2D5RA 4KO0A 5HRSA 1L3VA 1J54A 4IDKA 2IC3A 1NJWA 4CF1A 4FXDA 2ZD1A 2Z1JA 4KB1A 1HQUA 1SUQA 1W0HA 4B8AB 4LSNA 3K5OA 4DF8A 3QETA 5I3UA 4CJ5A 1WSGA 1JKHA 4W5NA 1LWFA 4FM2A 3VQBA 1GOAA 4O0JA 2ZE2A 4LH5A 2OYQA 2KZZA 4CK2A 3S3MA 1GOBA 3RTVA 1CLQA 1RT3A 4CHQA 1RT4A 4E7KA 1NKEA 4F2RA 4CJKA 2KW4A 3HSTB 5SWMA 4W5QA 1NOYA 2WOMA 4LSLA 4G1QA 4DFJA 3RMDA 1KFDA 1Q9YA 3KD5E 4YNQA 3RWUA 5D3GA 3MAQA 2NUBA 4CESA 4DFMA 1S1VA 3G10A 3KTQA 4DSIA 1T03A 3AVJA 1X9SA 2OPSA 1TKDA 4OKEA 2HHVA 1C0TA 1VSJA 4CHNA 1UAXA 3HVTA 3LWMA 3TAFA 4FLZA 3SYZA 1QSYA 3KLFA 5JS2A 3NE6A 1NK5A 4R5PA 3SQ0A 3PUFA 1TVRA 3KK2A 2X6NA 4CJQA 3SQ2A 3ZSVA 1NK6A 3L3VA 3VA0A 4FJXA 1DTQA 2YHBA 4CJ3A 4OPKA 4CHYA 4EP5A 1LW2A 2JLEA 3CFRA 5J2NA 1SL1A 3RR7A 4J2DA 1WLJA 3HVRA 1KRPA 3VQCA 4CCHA 3AVNA 4B3OA 2DFEA 4DWIA 1KLMA 4HTUA 2FBTA 2HHQA 4LD0A 3AVCA 3ZT1A 4NCGA 4O5BA 3OYAA 1ZBIA 3B6PA 1TL1A 3IRXA 3SV3A 3L2QA 3S9HA 1WSEA 4OKJA 4FYDA 4AHTA 4J2AA 4W5RA 3PX6A 1RBSA 1BI4A 2PYJA 3FFIA 1VSLA 1BCMA 4CFAA 1CZBA 3G0ZA 3V6DA 3AA3A 3ZSWA 4KHSA 1S5JA 3ZCMA 2G8KA 2OZSA 3DRRA 3EY1A 1FK9A 3IG1A 3LZIA 4HUGA 4HUFA 3VQPA 3PV8A 4CE9A 4ZTFA 3V9WA 1D9DA 4B9TA 1RDAA 4BACA 5J2QA 3THVA 4AHUA 4BE0A 1N5YA 4C8MA 1WSFA 1SKSA 1YTUA 1WSJA 1T8EA 1JXEA 3AA4A 4O4GA 3KLGA 1JLCA 3HP6A 4RW7A 3A2FA 3U3YA 5HROA 4FCYA 4DG1A 3NDKA 4OLAA 3CM6A 1FKOA 5DK5A 3DLBA 1C0MA 4JS5A 1I39A 3VQ5A 3WNGA 1RTIA 4DF4A 1NK8A 2VG6A 1B92A 1VSFA 3QEVA 3NAEA 3QEWA 1TK8A 3QIPA 3LP3A 3HYFA 3TAEA 3V4IA 1KFSA 3DLGA 2YNGA 2AJQA 4ELVA 2YHAA 3DLRA 5EU7A 4CJLA 2E4LA 5J2PA 4E89A 3SZ2A 3SQ1A 3TAQA 4RW4A 2KFNA 3NF8A 3C95A 1RCHA 5HRRA 3M8PA 1JL2A 4CJEA 3LALA 4CEDA 4UQGA 4FLWA 3QESA 4KFBA 2RKIA 3DLKA 4HUEA 4FJ8A 1BI4B 3K5LA 3VQ8A 1NKBA 3S3OA 1UWBA 3QO9A 4CEQA 3OYEA 1T7PA 2PYLA 4ZHRA 1RBTA 4PUOA 1VRTA 3HK2A 1W9HA 1HYZA 1KTQA 1JLQA 1RBRA 3BDPA 3P1GA 1RBVA 4N47A 4KV8A 1VK0A 1KVAA 5CZ1A 4AHSA 3VQ6A 4ZTJA 2QKKA 4KHQA 2P5OA 3DLEA 4DQQA 3DLHA 4IG0A 3MECA 4DTOA 5FRNA 3M8SA 3OYGA 3DRSA 4C8NA 3EZ5A 3I0RA 3JYTA 5KRTA 3F73A 5HLFA 3HO1A 4CERA 1UOCA 2EHGA 3E01A 4O0IA 3QEIA 3OJUA 4DQIA 4HHTA 4DTXA 3RMBA 1TGOA 3OYHA 1XC9A 1BQMA 2XO7A 3CQ8A 1S1UA 3AA5X 4LY7A 3V1QA 5FROA 3HL8A 4O44A 4CGJA 5CYMA 4KI6A 3LP0A 4FJ9A 1Q8IA 2KTQA 4DSKA 3CYMA 3KLHA 1WAJA 1YVUA 3DRPA 3CFPA 3MEDA 4O55A 3T19A 1KVBA 4CEFA 2RPIA 1UA0A 4AILC 5C42A 3LANA 1WNSA 1LWCA 4E0DA 4RG8A 4NYNA 4B9VA 4DMNA 4ELTA 2W42A 4H4OA 3PO4A 1EP4A 4F4KA 4KB0A 1RTDA 3HPOA 3SUNA 4J2BA 2ITGA 2Z1IA 2DFFA 3LDSA 3OYLA 1NJXA 3KLEA 1JLFA 1HNIA 1JLAA 3CM5A 2Y1JA 4NCAA 4ID1A 4EZ9A 3U6FA 1QTMA 4FK0A 1QHTA 1HNVA 4DU4A 4Z0UA 3RMAA 2D0CA 3NGYA 4E7LA 3IAYA 3KIOA 3JSMA 4RW6A 4CGIA 1BGXT 1WAFA 3T1AA 3HT3A 4FM0A 4H4MA 4DTUA 4DTMA 1VSIA 1C1CA 3SUPA 2G8WA 2PZSA 4KTQA 4Z4GA 1VSKA 3KKRA 1HPZA 4HCBA 1NJZA 2IOCA 2HNZA 3F9KA 1B9FA 4N41A 2HNYA 3AVKA 3UIQA 4KHNA 4PQUA 1DLOA 3LPUA 4WE1A 2ATQA 4BE1A 1C0UA 2VWKA 4CF2A 4N5SA 1HJRA 3QEXA 4H8KA 3WNHA 4E7IA 1QE1A 1LWEA 4CK3A 3O4NA 3TWHA 4W5TA 4M45A 4K8XA 4KI4A 2HMIA 3VQ7A 3V1RA 1TKZA 2Q3SA 4FVMA 3NGZA 3MXIA 3AO3A 1S1WA 4K8ZA 4KTWA 1IKVA 2OPRA 1LV5A 4JS4A 4M42A 4DTSA 4CK1A 1U48A 4BDPA 2GUIA 1RT5A 1ASVA 4F3OA 2PY5A 2HB5A 2IAJA 3L2RA 3LAMA 4FJNA 2VG5A 3OYNA 3RMCA 4M3TA 2KZMA 3NCIA 1QS4A 3CFOA 4F8RA 1LW0A 3OYCA 3MXJA 3NGIA 1FKPA 3SPYA 4DQPA 2QKBA 4DQSA 3C94A 4FLYA 3OJSA 4DS4A 3LZJA 1LAWA 1RT2A 2HVIA 2HHSA 3ZSYA 3TAGA 1IKWA 3AVGA 4FW2A 1S1TA 3I0SA 1NK4A 4KKOA 3O4QA 3ZSRA 2I5JA 1SV5A 3K2PA 3P5JA 1EXQA 3NH0A 4E19A 4M3UA 3ZSZA 1TV6A 2E6LA 3AO2A 1EKEA 2YKMA 4KTZA 1SL2A 1WSIA 3BGRA 4CEOA 2Z1GA 3OYDA 4DSFA 3L2VA 1HQEA 2BE2A 2G8FA 4C8KA 3ALYA 4CJRA 3V81A 1SKRA 4FLTA 5KI6A 4F2SA 4GVMA 3O3GA 4KREA 3ZT2A 4B9NA 2G8IA 3V9UA 1IO2A 3MEGA 1TAQA 3MXMA 5T7BA 1ASWA 4CIGA 4CIEA 2F8SA 2B6AA 3AVAA 4IBNA 2XY7A 2B4JA 1O1WA 1NOZA 1D5AA 4MFBA 3K58A 3TAMA 3PO5A 1RDDA 4TSXA 2BANA 2FC0A 4FK2A 3AVHA 4OKKA 4CHOA 4BDZA 1IH7A 1VSHA 3OYMA 1X9MA 4PY5A 4JLHA 3ZSQA 3ZSXA 3NBPA 2X78A 1TKTA 4CIFA 1FXXA 1QSLA 1RNHA 3SNNA 1HRHA 5DMRA 3MEEA 4ELUA 1Z25A 4PA1A 3M8QA 5CZ2A 4I2PA 4QAGA 1HYVA 4L8RB 3AVIA 1BIUA 3AVFA 1KLNA 2FBYA 1J53A 2RN2A 3QIOA 3SPZA 3K5NA 4BDYA 3LPTA 1L3UA 1NK0A 3KK3A 3NF6A 3HP9A 3NHGA 1BIZA 4DSLA 1KVCA 4Q0BA 4DSEA 3LP1A 3P83D 4CFBA 3L2WA 4Z4CA 3OYBA 4KPYA 2XY5A 4KHYA 3SUOA 2GBZA 1L3SA 5E41A 3WNFA 3V1OA 2QXFA 1X1PA 4NYFA 3LP2A 4C8LA 3NH1A 4DQRA 5C25A 3PX4A 2XRIA 2ETJA 1T05A 3DOLA 3SQ4A 1X9WA 1GOCA 1TKXA 3TR8A 4CGDA 1CZ9A 3K59A 3ULDA 4B8CA 3OS0A 4AHCA 1K6YA 3DOKA 5J2MA 5CY4A 4BWJA 3OYKA 3ZT0A 1A5XA 4B9SA 1N6QA 3QLHA
chains in the Genus database with same CATH superfamily
2NRRA 3DMJA 1BHLA 4I2QA 2W6LA 1XMOK 4H5RA 3VTIA 3THYB 1NGEA 2GWKA 2HOEA 1NGHA 1NJYA 4I7FA 5CYQA 1S72N 5AQJA 3KLIA 2YNFA 4OVLA 1ATNA 4FJ5A 5C2FA 3CC4N 3NVKA 4DSJA 4W5OA 2ZQBA 1HMVA 1NKCA 5HP1A 4DFKA 3LWLA 1YJWN 1YIJN 4YFUA 2X6SA 2FXUA 4NB4A 3G6EN 2OPPA 4A5BA 3M8RA 4DS5A 3CJ9A 1HJOA 3I33A 1NGAA 2O8CA 3FE1A 4OPJA 3EN9A 3MWTA 4FZXC 4LF5K 3QERA 4EHUA 4FSVA 3VQQA 1A5VA 2ZJPL 4FZYA 3J8AA 2O8EB 1KXPA 1D9FA 2A40A 1HNWK 3VQAA 3B6OA 4LH4A 4WQ5C 3THXB 4N76A 1KSPA 4FJ7A 2VG7A 3VQ4A 4MO5A 2D0BA 3C7NB 3VMFB 1TL3A 2E2PA 3NVMA 4KRFA 4DR5K 2BDPA 2G8UA 3HRGA 3QICA 4M3XA 1VRUA 2UYTA 5AQTA 4BRNA 4FJHA 4FWMA 1IKXA 4KH5A 2DTUA 1HKGA 2XY8A 4G9ZA 4B9MA 3ENOA 1K9MO 4BQZA 4CZMA 4FJMA 4DR7K 2P9PA 2YNIA 2H3GX 1HX1A 4EZ6A 4XH1A 1OVYA 2F8TA 5HRPA 3OVNA 1QQNA 3I55N 1J5OA 4RW9A 4DV4K 3AA2A 3HPGA 3RRGA 4A2AA 5KGWA 2FBVA 1Q7YO 4CFCA 3VN5A 1RTHA 2JGUA 2HHHK 4ILJA 2HSTA 3SV4A 1MU2A 3AGRA 3K5MA 2Z1HA 4N56A 1BQNA 3QNNA 1D8YA 5KGXA 3HJFA 4MQ3A 4E7JA 3D2EA 1S9EA 2RF2A 5GIPA 5LL6Z 4CGHA 2VWJA 1HKCA 1Z26A 3AAPA 3N4PA 4JKFA 4CF8A 2A5XA 1MWMA 2FSJA 4BWMA 3L2UA 4FJIA 3O3FA 5K14A 4JKHA 5FRMA 3KVGA 1L3TA 1C0GA 4DUYK 3ASMA 5AQMA 5LJVA 3RR8A 2Q97A 4H0YB 3W0LA 1N36K 3L0QA 5GIOA 1XHZA 4YY3K 3TAPA 2ZWHA 1RDCA 2IS3A 4OJRA 3LM2A 3ID8A 2DY4A 4EP4A 2GEMA 2V7ZA 2J4RA 1HQUA 1ESVA 4CZFA 1JCGA 1WSGA 3CMAN 4FM2A 4R79A 2ZE2A 4LH5A 4UY8O 2VGNA 2Q0UA 3P39A 3S3MA 1GOBA 1CLQA 1NKEA 2YHXA 3DXMB 5F1XA 3HSTB 5IWAK 1NOYA 4DR1K 4LSLA 3CC2N 1YF5L 3RMDA 1Q9YA 1WB9A 2P9IB 3MAQA 2NUBA 4CESA 2QEXN 3DXKB 4BR9A 3D2FA 3SBTA 1TKDA 3FFKB 4FLZA 2D1KA 3J7YP 3KLFA 3NE6A 1NK5A 3PUFA 2DPNA 1NK6A 3H45C 4FJXA 5AFUA 3CFRA 3RR7A 1SL1A 2JLEA 1NLVA 1WLJA 1KRPA 1FW6A 2DFEA 1Z05A 4CBXA 1KLMA 4KBOA 1J5EK 1TL1A 3L2QA 1WSEA 5HL7L 2YHYA 4W5RA 4WYBA 1NJIO 3ZSWA 5BPLA 1FJGK 2G8KA 4KB1A 4AM6A 5C15A 3T1YK 4IOXA 2YI1A 5AQLA 4BE0A 4LFCK 1SKSA 4PKGA 1YTUA 1WSJA 2BUPA 2P9UB 3GBTA 1VQ5N 4FCYA 1MA9B 4OLAA 2E8AA 3CM6A 1FKOA 5DK5A 3BP8A 3WNGA 1W7AA 4H03B 2NLXA 3BF1A 4K43A 5AQYA 2VG6A 5EOYA 1VSFA 3QEVA 1TK8A 3QIPA 1M1KO 3LP3A 3HYFA 5AQPA 4JI5K 2ZJRL 2E4LA 4E89A 3SQ1A 2Q36A 4RW4A 4OX9K 2KFNA 1RCHA 5AR0A 4B3SK 3M8PA 3LALA 3O1WA 3R3LA 4JKGB 3K5LA 2A41A 1NKBA 4PUOA 3U4LA 4ZHRA 1VRTA 1W97L 1W9HA 1RBRA 3MCPA 4N47A 3ZETB 4KV8A 1VK0A 1KVAA 4DHYA 4ZTJA 3CHWA 3O1BA 4DQQA 3DLHA 4IG0A 4KHPK 2V7YA 5HLFA 3EZ5A 3JYTA 5KRTA 4IOCL 1UOCA 4GNIA 2ASMA 3ZEUA 1WOQA 5FROA 2P9SB 4CGJA 4IJNA 4KI6A 4FJ9A 3T69A 4L3QA 3CYMA 1VQON 3CFPA 5E84A 4O55A 3ZEUB 1SAZA 2NZTA 4B9VA 4QS9A 4DMNA 2W42A 3O4WA 4H4OA 4A2BA 5F0XA 3PO4A 4J2BA 3OYLA 3SK3A 2OTJN 4ID1A 4EZ9A 4DR3K 1HNVA 4Z0UA 4E7LA 5TKWA 4DV3K 1WAFA 3HT3A 4H4MA 2PZSA 5AQGA 3Q7CA 4KH6A 2UUCK 4KTQA 4Z4GA 1NJZA 2HNYA 1YXQA 4JV5K 2PFUA 3UIQA 2QWOA 4KHNA 2VQEK 2ATQA 4BE1A 1C0UA 1IBKK 4N5SA 1HJRA 4H8KA 5GAGP 4CK3A 1ATRA 3H1VX 4M45A 4K8XA 4KI4A 2ASPA 5BREA 3MXIA 3NGZA 3AO3A 5TKYA 4KTWA 1IKVA 4JS4A 1WUAA 4JI7K 2PY5A 3D2EB 4YOWA 3OYNA 3G71N 4F8RA 1GLEG 1V4SA 3VOVA 3OYCA 3SPYA 3CPWM 3C94A 3OJSA 4DS4A 3LZJA 1RT2A 2HVIA 1IKWA 1E4FT 2IVPA 3AVGA 1S1TA 3I0SA 4KKOA 1SV5A 1EXQA 4FWPA 2QWRA 1TV6A 5FPEA 3JAMO 1EKEA 2YKMA 4BRDA 1SL2A 1WSIA 2CGKA 1K8KA 4BC2A 1TYQB 3OYDA 3WXIA 4LF7K 3L2VA 2G8FA 4CJRA 5KI6A 2WC9A 3VERA 2G8IA 4BR0A 1IO2A 1T6DA 3MEGA 2P9KA 4FO0A 2JWLA 3MXMA 2F8SA 4IBNA 1O1WA 1D5AA 4MFBA 3UKUA 3TAMA 3K58A 4O5FA 4X65K 4FPAA 4CHOA 4H0XB 4BDZA 5M1NA 3QB0A 4JLHA 1BOTO 3OW2M 3CCVN 2X78A 2W40A 1FXXA 2GTDA 4ELUA 1S3XA 3M8QA 4PA1A 4BRFA 4I2PA 3K5NA 3EZWA 2NRXA 2P9KB 3NHGA 1BIZA 4NO7A 3A5NC 3P83D 4KHYA 1VQ7N 3OYBA 3O9TA 3SUOA 5CR4A 4C8LA 4PL7A 5GAHP 1T05A 1TKXA 4CGDA 1QZ6A 4NXMK 2AP1A 5J2MA 4J8FA 1HLUA 5LY3A 5JLFA 1YTAA 3WQTA 1VQPN 2O4GA 1J6ZA 4NCBA 3U8XA 4K42A 4FPBA 1VQMN 3CCRN 1EETA 1R0AA 4CEAA 2YNHA 3PX0A 4Z4HA 4CJPA 4CJFA 2HNDA 3MWPA 1LAVA 5EX5A 4QS7A 3OYJA 4IG3A 3AO5A 4JYAK 2YCHA 2HHTA 1C1AA 3KKSA 3M6GA 2IDOA 3UB5A 4Y1CA 1G15A 3O9UA 4JNEA 3CD6N 3CCSN 3U9ZA 4IEEA 3RVCA 3OYIA 3OBYA 1IG9A 3EEQA 4K0KK 3NFAA 3R8EA 1NGDA 4CGFA 1S9GA 4BRMA 2P5GA 4EIAA 1C1BA 4FOEA 5KTQA 1KC8O 2OZMA 4CF0A 4BGBA 4GW6A 2HBMA 1XQSC 3P31A 5BPMA 2EX3A 5AQSA 3ZYYX 3W3DA 1ZYQA 4RW8A 3CCMN 4BC4A 1YT3A 1HYSA 2PAVA 1ITGA 5BRDA 4DFPA 2F9WA 2V52B 4CJVA 1Q81O 3ZSOA 3KD1E 2E88A 3OYFA 2D0AA 5AQZA 3SBGA 1NK9A 1G99A 5AQHA 3S3NA 2CGJA 3TANA 3HPHA 3O9QA 3DI6A 3OS1A 4OO1J 3CCLN 3TI0A 4FJLA 4F9OA 1XWLA 4CHZA 1IKYA 3FGUA 2YJEA 4YOYA 5C24A 4WFBL 4BRPA 3CCQN 4KHUA 4I9QA 4B08A 1IBLK 1DTTA 1NGCA 4EAHD 5C2DA 4XIUA 1XHXA 3CJBA 4E1NA 4DTRA 1JLBA 4CJUA 4MO4A 3SAGA 2E20A 3CPEA 4EHTA 1RILA 2DFHA 5J1EA 3K0SA 2KFZA 2RHKA 4JD2A 4OGEA 2W6KA 4BR5A 5KPTA 1ZBHA 1X3MA 4RTFD 5HRNA 4M3RA 3DAWA 4AHVA 1QQOA 3J81O 2P9PB 4WQ4A 4IFVA 2HHXA 3R6MA 2G8HA 3F5TA 1LOTB 4BG8A 1NGIA 3NF9A 2FSNA 4JN4A 3VQEA 4Y1DA 4CEBA 4FK4A 2A1SA 3NH2A 3HM9A 2FSKA 3VA3A 3FZFA 1S1XA 2UU9K 4WF9L 3CMEN 2A1RA 4B1UB 2HVHA 5BPNA 1NWKA 3RRHA 4DV7K 3CJ1A 1HKBA 1UA1A 3THYA 4H0OA 1RT1A 1BCOA 3CJCA 3D45A 4CEEA 2D5RA 5JVGL 4IDKA 2ZD1A 2P9NA 4B8AB 1OVQA 4LSNA 3K5OA 4E1JA 4DF8A 5I3UA 1IG8A 3SAFA 5EVZA 4YOTA 4JKCA 3RTVA 1RT3A 1RT4A 4F2RA 4CZGA 2KW4A 3FR0A 4CD3A 4W5QA 1QVGM 3QFPA 3KD5E 3PIPL 3PSIA 4DKWA 4IZ9A 3R1XA 3BF3A 4DFMA 5B8HA 1NGGA 1S1VA 3G10A 4DSIA 3H3NO 1T03A 1VSJA 1YVNA 4FL9A 3TTCA 3TAFA 2GX9A 3QMLA 1QSYA 5JS2A 3IDHA 4R5PA 3OA9A 2X6NA 2E2OA 3SQ2A 5AQOA 2YHBA 4BC3A 4OPKA 4J2DA 5KPRA 3FLCO 3HVRA 1DEJA 3AVNA 4O8UA 3O6WA 4B3OA 2NRZA 1KAZA 2FBTA 4NLCA 3WXMB 4LD0A 1BWFO 4NCGA 4O5BA 1W2BM 3IRXA 1ZBIA 3SV3A 1HR0K 4FYDA 3PX6A 5FPDA 1RBSA 1VSLA 3EKSA 3V6DA 4JHDA 5BN8A 4B3MK 3AA3A 1S5JA 3THWB 2OZSA 4HUGA 3IG1A 3LZIA 3VQPA 4CE9A 3AY9A 1RDAA 5J2QA 3THVA 4AHUA 1MDUB 3AA4A 4O4GA 3KLGA 3HP6A 1JLCA 3A2FA 3E9PA 4IFEA 3SJHA 2QTDA 3VQ5A 1I94K 1RTIA 4CZIA 1NK8A 5LMNK 5FLXO 3NAEA 3TAEA 3V4IA 1XNQK 2AJQA 4CJLA 5AQKA 4JI4K 3CCJN 3MX5A 1H1VA 5HRRA 4BRCA 4CJEA 1JL2A 4CEDA 4UQGA 4XH4A 4BRLA 4HUEA 3L4QA 5KPZA 3VQ8A 3S3OA 1UWBA 3QO9A 4CEQA 2IIRA 3OYEA 1T7PA 2PYLA 2NRHA 3HK2A 4JI8K 5CE3A 1HYZA 5AQQA 3PSFA 4JKAA 2QKKA 4KHQA 3MECA 3HM8A 1BG3A 3F73A 4BQLA 3WEEB 3E01A 3OJUA 4M7YA 2E5LK 1DKGD 1X3NA 3CCUN 1Z6RA 1S1UA 3V1QA 5AQIA 5CYMA 2E2NA 3LP0A 5M1KA 3P38A 2KTQA 1RGIA 4BVPA 1YVUA 3UKUB 4Y0WA 3LDLA 1VQ4N 5JLHA 3FZLA 4NXNK 4RG8A 4NYNA 3KWIA 3WXLA 3M1FA 4ELTA 3SUNA 4MDBA 1VHXA 1HNIA 3BZKA 3TTFA 4NCAA 4FWLA 1N33K 4X66K 3NGYA 4O8KA 3C0BA 3JSMA 4RW6A 4CGIA 1BGXT 3T1AA 4DTUA 1C1CA 1LCUA 3A5MC 3KKRA 1HPZA 2IOCA 3AVKA 1NGJA 1DLOA 3CETA 4WE1A 2VWKA 4JI0K 3O4NA 3TWHA 4YHHK 2HMIA 3V1RA 2Q3SA 3WXJA 4BVOA 3GG4A 4DTSA 2WTUA 2GUIA 3VEWA 1RT5A 4F3OA 4DR2K 4YORA 3H1QA 3LAMA 4FJNA 3U9DA 4FWOA 3PIOL 2RE2A 4C1NK 2KZMA 3VESA 1QS4A 1LW0A 3VGMA 4DQSA 2V51B 1VQLN 4FLYA 2P9LB 2HHSA 3MK6A 2D0OA 1IV0A 2JWKA 5AQRA 3WXKA 2KHOA 3TAGA 3O4QA 4JD2B 2QWLA 4M3UA 4C23A 3KWGA 4CEOA 2UXCK 3IKMA 3ALYA 4FLTA 4F2SA 4GVMA 4H0VB 2FF6A 2O8FB 4JI3K 3TSPA 1TAQA 1XC3A 1WBBA 5T7BA 4CIGA 2XY7A 5AQFA 3PO5A 1RDDA 3DJCA 4FK2A 1VSHA 2ZF5O 4A59A 1P8ZA 4B1VA 3NBPA 1TKTA 3JS6A 3VGLA 3SNNA 5DMRA 4QAGA 4L8RB 1BIUA 3AVFA 3ENBA 1KLNA 1BA1A 2RN2A 3HTVA 3SPZA 3LPTA 3CJAA 3LDOA 1KVCA 4Q0BA 3LP1A 3L2WA 1L3SA 3K9JA 4NYFA 1YITN 3SQ4A 5GADP 4B8CA 1K6YA 2E1ZA 3DOKA 4BWJA 3ZT0A 1A5XA 1N6QA 1Q82O 2ZGZA 4CJWA 5C12A 2XHBA 1QQMA 3WNEA 3CERA 4DTJA 1S6PA 1U2VA 1TAUA 4KAZA 3U3GA 3C6UA 4CF9A 3ULEA 1XMQK 4MLHA 3D0PA 4QCLA 4B1ZA 1XI1A 5I9EB 4GMJB 3QBXA 1BU6O 2E2QA 3I56N 2I7NA 3QDKA 3EKUA 1J9AA 4WQ5A 4FZZA 1RTJA 3VPZA 1RFQA 1BL3A 3AAQA 3AVMA 2WONA 1P90A 4B9LA 4M3YA 2OANA 2O8EA 5AQUA 3HXMA 4M3WA 4IKFA 4RCHA 3A0IX 4QOZB 3ZETA 2ZGYA 1U47A 1GLBG 5M1OA 2O4IA 4I9LA 2I7PA 3SUQA 1RDBA 3NMUA 3ATVA 1TUYA 3DM2A 3J80O 3P4IA 4FM1A 5C0YA 1ZBUA 3CIPA 1Q9XA 3MN9A 1VSEA 4KHWA 1JLGA 3UE5A 4IO9L 4CD1A 1CXQA 1NG9A 4PWDA 1HUXA 2IVNA 2YKNA 4BR2A 5BR8K 2HF4A 1QSSA 3GOIA 4CZLA 3H46O 3BEXA 1QHAA 3T3FA 3TABA 2ITMA 4FWRA 2HHUA 2HMPA 5KRSA 1ZBLA 1JLEA 1I3AA 4YOXA 3VEVA 3VQDA 4CI6A 1EWRA 3VF2A 1YJ9N 3PLAA 5JS1A 4DU1A 3CCEN 1C6VA 3OY9A 3EO3A 4FJJA 4BR7A 2R7YA 3BUZB 4FJGA 3AV9A 4JKBA 1S6QA 4CHPA 4GV9A 1VSDA 4AM7A 2O8DB 1DT9A 1Y97A 5DM7L 4CFDA 5I42A 4H0PA 3IUCA 3R9PA 1QVFM 3O08A 3RSEB 1WSHA 2X74A 4IXCA 4OLBA 4JI6K 3C65A 3TARA 3ZT3A 2E6MA 4ICLA 2UXDK 4DU3A 2HW3A 3VF6A 4JRPA 1QQCA 5HBMA 3ZX3A 3CJ7A 1BISA 4X64K 1U2VB 3K57A 1A5WA 1KAXA 3AO4A 3IS9A 3LDNA 2OPQA 3QNOA 3GL1A 3VEOA 4A5AA 1WN7A 2KLAA 2CH6A 4DTPA 3EYZA 4Z4EA 1RDUA 1NNEA 3PY8A 4BRKA 2B5JA 5HRSA 1L3VA 1J54A 4CZJA 3E9LA 2E1YA 4ISEA 4FXDA 1W0HA 5C10A 2D0PA 3GE1A 4CJ5A 5A2QO 2OYQA 4CK2A 5LJWA 4RWTA 4CHQA 4E7KA 4CJKA 5SWMA 5DM6L 3VTHA 2YX6A 4B1XB 1KFDA 2Q0RA 4AF1A 5AZIA 5D3GA 2OPSA 3C7NA 2HHVA 1C0TA 4CHNA 3HVTA 4DUZK 1Q86O 3SYZA 3VENA 1YAGA 3IFRA 3SQ0A 1TVRA 2QI2A 3E66A 3TSQA 3L3VA 3VA0A 4CJ3A 4DV1K 1LW2A 1GLDG 3J7AP 4CCHA 4HTUA 3F9MA 4YDUC 3AVCA 3ZT1A 4AHTA 4J2AA 2PYJA 3FFIA 1BCMA 5M1PA 1CZBA 3G0ZA 4B3RK 4YOUA 4KHSA 1NMDA 3ZCMA 3MN5A 3SLCA 3EY1A 1FK9A 4HUFA 2NRVA 4ZTFA 5AQNA 1NGFA 5LMUK 4C8MA 1WSFA 5BRFA 1JXEA 4RW7A 5HROA 3U3YA 4DG1A 3CQYA 4JS5A 3T7ZA 1B92A 3N4QA 4IJAA 1KFSA 1O13A 4ELVA 1BA0A 3TAQA 3NF8A 3WEEA 4U67L 1Y64A 4JK7A 3L4IA 1VQ9N 3MN6A 5GINA 1WBDA 2RKIA 3DLKA 3EE8A 2HBJA 4WQ4C 3BY5A 2UUBK 4BRHA 1KTQA 1JLQA 4LF9K 3M3ZA 4AHSA 3VQ6A 2P5OA 4DB3A 5FRNA 1ZC6A 3M8SA 3DRSA 1K8AO 4O0IA 3QEIA 4DQIA 4Z94A 3RMBA 1TGOA 3OYHA 5AZIB 1OH6A 3E1YA 4CZHA 3CQ8A 3AA5X 4O44A 3TTDA 3DXKA 2VYPA 1NMNA 1WAJA 3ZX0A 3GDQA 4FWNA 1MWKA 1KVBA 4CEFA 2RPIA 4AILC 3F2KA 5C42A 4ISGA 3LANA 1LWCA 5M1QA 1NBWA 4BG9A 4KB0A 1T44A 1EP4A 4F4KA 4BRQA 1RTDA 3HPOA 2ITGA 2Z1IA 1NJXA 3KLEA 1GLLO 1JLFA 1VQ6N 3Q7BA 2Y1JA 4H0TB 3U6FA 1QTMA 5FPMA 4FK0A 1QHTA 4FVUA 2D0CA 3SUPA 4FM0A 1VSIA 2G8WA 1YHQN 4HCBA 2HNZA 4LF8K 4FWKA 3MDQA 3MX2A 4WFNL 1NM1A 1EWQA 5KQ8A 2NRTA 5BR9A 3H3OB 3VQ7A 4K25A 4FVMA 3T1HK 5BRHA 1S1WA 1LV5A 1XUPO 4DV5K 2BTFA 1EQYA 4CBUA 1ASVA 5EXWA 3L2RA 1RDWX 2P9SA 3DLLL 3FZMA 3KK7A 3RMCA 4M3TA 1ILYA 2O8FA 1HNXK 3CFOA 3HBTA 1FKPA 1OH5A 4LFAK 2QKBA 4PKHA 1LAWA 5AZJB 3ZSYA 1GLFO 3OBWA 5KQDA 1NK4A 3ZSRA 2I5JA 3K2PA 3NH0A 3ZSZA 3AO2A 4KTZA 3ZX2A 2Z1GA 2P9LA 1QZ5A 2BE2A 1N8RO 3C6AA 4IO8A 4B9NA 3V9UA 2GWJA 2UXBK 3QBWA 1NOZA 3KHYA 4FWSA 1IH7A 4H5WA 3OYMA 3JXUA 5MLCQ 1X9MA 5AFUH 1GLJO 2WFBA 1HRHA 1Z25A 3AVIA 2FBYA 3QIOA 1GLCG 4YDUA 1L3UA 1EO1A 2FF3B 4DSEA 4CFBA 4Z4CA 2IVOA 5ELZA 5E41A 3V1OA 2QXFA 1X1PA 2P9NB 1NU0A 4DV6K 2XRIA 3O9RA 1GOCA 4X62K 4CZKA 1JJ2M 4IEIA 4AHCA 3UKRB 1K8KB 5AZJA 5H1SQ 3OTOK 1RT6A 3I8DA 1ZBSA 3O5BA 4DLEA 4DLGA 2QWQA 4OPAA 1ZBFA 4E1MA 3V9XA 2G8VA 4AQYK 2P51A 2F4VK 4JI1K 4CVNE 2ZJQL 3O9SA 2QM1A 3AVLA 5IT9O 2VWBA 4JKDA 1U49A 4E3SA 4FW1A 3CQXA 5SZTA 3SMSA 3HZ6A 1B9DA 3ULEB 4LFBK 1F21A 4CJSA 2P9IA 3DYAA 3ENHA 3SI6A 4J2EA 3D7EO 4FLXA 1L5UA 3VGKA 3DXMA 1SZ2A 3VEZA 1KQSM 3L8BA 5ADXA 1S22A 3QINA 4ID5A 4E7HA 3ZT4A 4HCCA 4AHRA 2KKZA 4DTNA 4Z4FA 2A42A 4CW7B 1KCFA 4H5VA 3S41A 2QK9A 1Q18A 3ITHA 3KK1A 2XY6A 4BE2A 1JCFA 2HHWA 4BREA 1OH8A 4LC9B 4EFHA 1U45A 3L3UA 1VSMA 2A6AA 1U4BA 3C6TA 1DGKN 1TK0A 3LDPA 2BGGA 2P1JA 1RBUA 2FBXA 3QEPA 4ILGB 3ZLJA 1RT7A 3V9ZA 4Q5VA 3V9SA 3AVBA 4FJKA 2HBKA 4I6MA 1ATSA 1D4XA 3BZCA 3VQ9A 3KJVA 1ASUA 4CJ4A 4Z4IA 3J7ZO 4JRQA 2QA4N 3RSEA 4M63C 3CI5A 4CJTA 3SCXA 2OA8A 2Y1IA 2UUAK 4CJ7A 2QWNA 1REVA 4U7BA 2FLOA 1IBMK 4JHDB 4BRGA 2D4WA 2F96A 1NK7A 3H08A 5HOOA 1JL1A 3NF7A 4C8OA 2ASOA 4OGCA 3LAKA 4DCHA 4V19S 3UKRA 4CGGA 4IWVA 4IFYA 2CGLA 2QXLA 1EX4A 4NLBA 4F3TA 5FDLA 4HVJA 3SJJA 4IOAL 1BUPA 3TSUA 4FLVA 1SL0A 3CXCM 3VF4A 2GV9A 2YHWA 2O8BA 4LF4K 4M41A 4CEZA 3MCAB 3ID6A 3CF5L 4PL8A 2YV0X 4MLEA 4XEIA 3VEXA 2HF3A 2KQ2A 4B9UA 3MMVA 3O3HA 2OCEA 3H6EA 3LM9A 2LSNA 1JXBA 3EL2A 3AO1A 2VQFK 3QFUA 4AH9A 1U6ZA 4M3ZA 4B9QA 3OS2A 2HBLA 4CECA 1SKWA 1CXUA 1M90O 3A5LC 3ISNC 1U04A 3TU5A 3CG7A 2P9UA 1R59O 4JKEA 4XH5A 2IGIA 2Q1NA 3ATUA 2O8BB 1TK5A 4FLUA 5F2RA 4JKGA 4KO0A 4B3TK 4WCEL 4GV6A 2IC3A 1NJWA 4CF1A 2Z1JA 5FPNA 1SUQA 3KZBA 4JEPA 3LDQA 3O8MA 3QETA 1BDGA 2WUSA 1JKHA 4WFAL 4W5NA 1LWFA 4MDAA 3IMXA 3VQBA 1GOAA 4O0JA 2PBDA 1VQ8N 1YUWA 2KZZA 3MN7A 2O8CB 2WOMA 4G1QA 4DFJA 4A61A 4YNQA 1CZAN 2NNWA 3RWUA 2W41A 5GAEP 3HI0A 5JMVA 4BY9C 3KTQA 3AVJA 4DR4K 1X9SA 4OKEA 1UAXA 3LWMA 1N34K 1K73O 3VEYA 3CC7N 3KK2A 4CJQA 4JK9A 3ZSVA 5AQVA 1TYQA 1DTQA 4PHTX 3O80A 4CHYA 4EP5A 5J2NA 3VQCA 4GKJK 4DWIA 4OPHA 1VAZA 2HHQA 4BR4A 3OYAA 3B6PA 1NGBA 3S9HA 4OKJA 5JICA 1BI4A 4CFAA 2F9TA 3DRRA 3PV8A 4B1YB 1D9DA 4B9TA 3V9WA 4GV3A 2CH5A 4BACA 3D2FB 4CBWA 1N5YA 4ILHA 5ADXH 1T8EA 4FWQA 1C0FA 2F7TA 3G25A 3NDKA 2OTLN 3DLBA 1C0MA 3OHRA 1I39A 4DF4A 4JAXA 4BC5A 3QEWA 3L6QA 3DLGA 2YNGA 1SQKA 3THWA 2YHAA 3DLRA 5EU7A 5J2PA 3SZ2A 4BRIA 3C95A 2WBNA 4BRAA 4FLWA 3QESA 4KFBA 2QWPA 4K41A 4FJ8A 1BI4B 4BGAA 1N32K 1RBTA 3M5RA 3WUHA 3BDPA 3P1GA 1RBVA 5CZ1A 5JVHL 4BROA 3DLEA 4DTOA 3I8BA 3K9KA 5BN9A 3SMPA 4DQ8A 3OYGA 4C8NA 3I0RA 1X9JA 4DV0K 3HO1A 4CERA 2EHGA 3HOTA 2QWMA 4HHTA 4DTXA 1XC9A 4A57A 1BQMA 2XO7A 2EWSA 4LY7A 3HL8A 1E3MA 1Q8IA 4DSKA 3KLHA 3DRPA 3MEDA 3C6HA 3T19A 4LF6K 1UA0A 1XNRK 2VCPA 3HOSA 1V4TA 1WNSA 4E0DA 5AQXA 2NRWA 2A3ZA 3G4SN 1KD1O 2DFFA 3LDSA 1YJNN 3DWLA 1JLAA 3CM5A 2Q2RA 4DU4A 3RMAA 3IAYA 3KIOA 1T3VA 4DTMA 1OKJA 1VSKA 3F9KA 5CHIA 1B9FA 4DR6K 3LL3A 4N41A 3TPQA 4M7XA 3EE9A 4A62A 4C1NI 1SS6A 4PQUA 3AGKA 3LPUA 4JI2K 1E4GT 4CF2A 3QEXA 3WNHA 4E7IA 1QE1A 1LWEA 2BH1A 3VETA 1T6CA 4W5TA 4JK8A 4PKIA 4KH4A 1OH7A 1TKZA 4K8ZA 3AARA 4FOIA 2GUPA 2OPRA 3FZHA 4GVEA 4M42A 3WQUA 2AA4A 4CK1A 4ISFA 1U48A 3HSCA 4BDPA 4GY2B 1JCEA 2HB5A 2IAJA 3FZKA 2VG5A 3WT0A 3A8YA 3NCIA 1HPMA 3THXA 1IJJA 3MXJA 3NGIA 4DQPA 4H5NA 5AJ3K 1ZXOA 4FW2A 1TUUA 3P5JA 4HTLA 4E19A 2E6LA 3BGRA 2VGMA 4DSFA 1HQEA 1YI2N 1BO5O 4C8KA 4CZEA 2QW9A 3V81A 1SKRA 3D6RA 3O3GA 4KREA 3ZT2A 2Q31A 1KAYA 1ASWA 1GLAG 4CIEA 4H5TA 2B6AA 3AVAA 2B4JA 2ZM6K 4TSXA 2BANA 2FC0A 2GELA 3AVHA 4OKKA 4PY5A 3ZSQA 3ZSXA 4YOVA 4CIFA 5EY4A 1QSLA 1RNHA 4IDHA 1HNZK 3MEEA 5CZ2A 1VQKN 2YJFA 3E9OA 1HYVA 5AQWA 4B1WB 4HWIA 1J53A 5E26A 4BDYA 1NK0A 3KK3A 4I6MB 3NF6A 3HP9A 4DSLA 2O8DA 3A5OC 1VQNN 4KPYA 2XY5A 4GKKK 2GBZA 4QS8A 3WNFA 3LP2A 3NH1A 5M1FA 4DQRA 5C25A 3PX4A 2ETJA 3DOLA 4DV2K 1X9WA 3TR8A 1CZ9A 3SAHA 3K59A 3ULDA 3OS0A 5CY4A 3OYKA 4B9SA 3QLHA 3B8AX
chains in the Genus database with same CATH topology
1YTAA 2O4GA 1RT6A 4CJWA 3I8DA 3DMJA 1BHLA 4I2QA 4NCBA 4DLEA 2XHBA 4DLGA 3WNEA 1ZBFA 4E1MA 4DTJA 3V9XA 1S6PA 2G8VA 1TAUA 4KAZA 1EETA 1R0AA 4CEAA 2P51A 2YNHA 3PX0A 3U3GA 1NJYA 4I7FA 3C6UA 5CYQA 4CF9A 3D0PA 3AVLA 4QCLA 3KLIA 4CJPA 4CJFA 4Z4HA 2YNFA 4OVLA 1XI1A 2HNDA 4FJ5A 4GMJB 1LAVA 3OYJA 4IG3A 3AO5A 1U49A 4DSJA 4W5OA 4E3SA 2ZQBA 2HHTA 1HMVA 1NKCA 1C1AA 3KKSA 4FW1A 5HP1A 5SZTA 4DFKA 3LWLA 2IDOA 1J9AA 1B9DA 4Y1CA 1G15A 4FZZA 1RTJA 1F21A 4CJSA 3DYAA 3SI6A 4J2EA 3OYIA 1IG9A 4YFUA 1BL3A 2X6SA 3NFAA 4FLXA 1L5UA 3AVMA 2WONA 2OPPA 4CGFA 3L8BA 1S9GA 3M8RA 4B9LA 3QINA 4ID5A 2P5GA 4E7HA 4DS5A 3ZT4A 4M3YA 1C1BA 4AHRA 5KTQA 4HCCA 4DTNA 4CF0A 4OPJA 2OZMA 4Z4FA 3HXMA 4GW6A 4M3WA 4FZXC 4IKFA 1KCFA 2QK9A 3QERA 2EX3A 3ITHA 3KK1A 2XY6A 4QOZB 3VQQA 4BE2A 1ZYQA 2HHWA 1A5VA 4RW8A 1U47A 4FZYA 2O4IA 4I9LA 1U45A 1YT3A 3L3UA 3SUQA 1VSMA 1D9FA 1HYSA 1U4BA 1ITGA 1RDBA 3VQAA 4DFPA 3C6TA 3B6OA 3DM2A 1TK0A 4LH4A 4N76A 1KSPA 2BGGA 2P1JA 4FM1A 4CJVA 4FJ7A 1RBUA 2VG7A 3VQ4A 2FBXA 3ZSOA 3QEPA 2D0BA 3KD1E 1RT7A 1TL3A 1ZBUA 4KRFA 3V9ZA 3OYFA 2BDPA 4Q5VA 1Q9XA 2D0AA 3V9SA 2G8UA 1VSEA 3AVBA 4FJKA 1VRUA 4M3XA 4KHWA 1JLGA 4FJHA 1IKXA 3VQ9A 3KJVA 1ASUA 1NK9A 1CXQA 4CJ4A 2DTUA 4Z4IA 4PWDA 2XY8A 2YKNA 3S3NA 4B9MA 4FJMA 3TANA 1QSSA 4JRQA 3HPHA 3DI6A 3OS1A 3SCXA 2YNIA 4CJTA 3T3FA 2Y1IA 3TABA 2OA8A 4EZ6A 3TI0A 2F8TA 2HHUA 1REVA 5HRPA 3OVNA 4FJLA 1XWLA 5KRSA 4CHZA 1IKYA 1J5OA 4RW9A 1JLEA 1ZBLA 1I3AA 2F96A 1NK7A 3H08A 3AA2A 1JL1A 3HPGA 3NF7A 3VQDA 4C8OA 4OGCA 5C24A 3LAKA 3RRGA 5JS1A 4KHUA 4DU1A 4B08A 4I9QA 1DTTA 1C6VA 4CGGA 4XIUA 4IFYA 1XHXA 5KGWA 2FBVA 1EX4A 4E1NA 3OY9A 1JLBA 4DTRA 4F3TA 4CJUA 5FDLA 4HVJA 4CFCA 3SJJA 4FLVA 4FJJA 3VN5A 1RTHA 2JGUA 1SL0A 1RILA 2R7YA 2DFHA 5J1EA 2GV9A 3AV9A 4FJGA 3SV4A 1MU2A 1S6QA 2KFZA 3K5MA 4OGEA 4M41A 4CHPA 2Z1HA 4CEZA 4N56A 1VSDA 1BQNA 3QNNA 1D8YA 1ZBHA 5HRNA 5KGXA 3HJFA 4MQ3A 1Y97A 4E7JA 1S9EA 4M3RA 4CFDA 2RF2A 2YV0X 4CGHA 5I42A 2VWJA 4AHVA 1WSHA 4IFVA 2KQ2A 4B9UA 2HHXA 2X74A 4OLBA 1Z26A 3O3HA 4CF8A 2G8HA 2LSNA 1JXBA 3ZT3A 3TARA 2E6MA 3AO1A 4ICLA 4BWMA 3L2UA 4FJIA 4AH9A 3O3FA 4M3ZA 3NF9A 5K14A 4DU3A 3OS2A 5FRMA 4CECA 3VQEA 2HW3A 4Y1DA 1SKWA 1L3TA 4CEBA 4FK4A 1CXUA 1QQCA 2A1SA 5HBMA 3NH2A 4JRPA 3ASMA 3HM9A 3ISNC 1U04A 3RR8A 3VA3A 1BISA 1S1XA 3CG7A 3K57A 1A5WA 2A1RA 3AO4A 3IS9A 2HVHA 2IGIA 1XHZA 2OPQA 3TAPA 3QNOA 1RDCA 2IS3A 3RRHA 4OJRA 1WN7A 1TK5A 4DTPA 3EYZA 1UA1A 4Z4EA 4FLUA 1RT1A 3PY8A 1BCOA 2DY4A 4EP4A 3D45A 2B5JA 4CEEA 2D5RA 4KO0A 5HRSA 1L3VA 1J54A 4IDKA 2IC3A 1NJWA 4CF1A 4FXDA 2ZD1A 2Z1JA 4KB1A 1HQUA 1SUQA 1W0HA 4B8AB 4LSNA 3K5OA 4DF8A 3QETA 5I3UA 4CJ5A 1WSGA 1JKHA 4W5NA 1LWFA 4FM2A 3VQBA 1GOAA 4O0JA 2ZE2A 4LH5A 2OYQA 2KZZA 4CK2A 3S3MA 1GOBA 3RTVA 1CLQA 1RT3A 4CHQA 1RT4A 4E7KA 1NKEA 4F2RA 4CJKA 2KW4A 3HSTB 5SWMA 4W5QA 1NOYA 2WOMA 4LSLA 4G1QA 4DFJA 3RMDA 1KFDA 1Q9YA 3KD5E 4YNQA 3RWUA 5D3GA 3MAQA 2NUBA 4CESA 4DFMA 1S1VA 3G10A 3KTQA 4DSIA 1T03A 3AVJA 1X9SA 2OPSA 1TKDA 4OKEA 2HHVA 1C0TA 1VSJA 4CHNA 1UAXA 3HVTA 3LWMA 3TAFA 4FLZA 3SYZA 1QSYA 3KLFA 5JS2A 3NE6A 1NK5A 4R5PA 3SQ0A 3PUFA 1TVRA 3KK2A 2X6NA 4CJQA 3SQ2A 3ZSVA 1NK6A 3L3VA 3VA0A 4FJXA 1DTQA 2YHBA 4CJ3A 4OPKA 4CHYA 4EP5A 1LW2A 2JLEA 3CFRA 5J2NA 1SL1A 3RR7A 4J2DA 1WLJA 3HVRA 1KRPA 3VQCA 4CCHA 3AVNA 4B3OA 2DFEA 4DWIA 1KLMA 4HTUA 2FBTA 2HHQA 4LD0A 3AVCA 3ZT1A 4NCGA 4O5BA 3OYAA 1ZBIA 3B6PA 1TL1A 3IRXA 3SV3A 3L2QA 3S9HA 1WSEA 4OKJA 4FYDA 4AHTA 4J2AA 4W5RA 3PX6A 1RBSA 1BI4A 2PYJA 3FFIA 1VSLA 1BCMA 4CFAA 1CZBA 3G0ZA 3V6DA 3AA3A 3ZSWA 4KHSA 1S5JA 3ZCMA 2G8KA 2OZSA 3DRRA 3EY1A 1FK9A 3IG1A 3LZIA 4HUGA 4HUFA 3VQPA 3PV8A 4CE9A 4ZTFA 3V9WA 1D9DA 4B9TA 1RDAA 4BACA 5J2QA 3THVA 4AHUA 4BE0A 1N5YA 4C8MA 1WSFA 1SKSA 1YTUA 1WSJA 1T8EA 1JXEA 3AA4A 4O4GA 3KLGA 1JLCA 3HP6A 4RW7A 3A2FA 3U3YA 5HROA 4FCYA 4DG1A 3NDKA 4OLAA 3CM6A 1FKOA 5DK5A 3DLBA 1C0MA 4JS5A 1I39A 3VQ5A 3WNGA 1RTIA 4DF4A 1NK8A 2VG6A 1B92A 1VSFA 3QEVA 3NAEA 3QEWA 1TK8A 3QIPA 3LP3A 3HYFA 3TAEA 3V4IA 1KFSA 3DLGA 2YNGA 2AJQA 4ELVA 2YHAA 3DLRA 5EU7A 4CJLA 2E4LA 5J2PA 4E89A 3SZ2A 3SQ1A 3TAQA 4RW4A 2KFNA 3NF8A 3C95A 1RCHA 5HRRA 3M8PA 1JL2A 4CJEA 3LALA 4CEDA 4UQGA 4FLWA 3QESA 4KFBA 2RKIA 3DLKA 4HUEA 4FJ8A 1BI4B 3K5LA 3VQ8A 1NKBA 3S3OA 1UWBA 3QO9A 4CEQA 3OYEA 1T7PA 2PYLA 4ZHRA 1RBTA 4PUOA 1VRTA 3HK2A 1W9HA 1HYZA 1KTQA 1JLQA 1RBRA 3BDPA 3P1GA 1RBVA 4N47A 4KV8A 1VK0A 1KVAA 5CZ1A 4AHSA 3VQ6A 4ZTJA 2QKKA 4KHQA 2P5OA 3DLEA 4DQQA 3DLHA 4IG0A 3MECA 4DTOA 5FRNA 3M8SA 3OYGA 3DRSA 4C8NA 3EZ5A 3I0RA 3JYTA 5KRTA 3F73A 5HLFA 3HO1A 4CERA 1UOCA 2EHGA 3E01A 4O0IA 3QEIA 3OJUA 4DQIA 4HHTA 4DTXA 3RMBA 1TGOA 3OYHA 1XC9A 1BQMA 2XO7A 3CQ8A 1S1UA 3AA5X 4LY7A 3V1QA 5FROA 3HL8A 4O44A 4CGJA 5CYMA 4KI6A 3LP0A 4FJ9A 1Q8IA 2KTQA 4DSKA 3CYMA 3KLHA 1WAJA 1YVUA 3DRPA 3CFPA 3MEDA 4O55A 3T19A 1KVBA 4CEFA 2RPIA 1UA0A 4AILC 5C42A 3LANA 1WNSA 1LWCA 4E0DA 4RG8A 4NYNA 4B9VA 4DMNA 4ELTA 2W42A 4H4OA 3PO4A 1EP4A 4F4KA 4KB0A 1RTDA 3HPOA 3SUNA 4J2BA 2ITGA 2Z1IA 2DFFA 3LDSA 3OYLA 1NJXA 3KLEA 1JLFA 1HNIA 1JLAA 3CM5A 2Y1JA 4NCAA 4ID1A 4EZ9A 3U6FA 1QTMA 4FK0A 1QHTA 1HNVA 4DU4A 4Z0UA 3RMAA 2D0CA 3NGYA 4E7LA 3IAYA 3KIOA 3JSMA 4RW6A 4CGIA 1BGXT 1WAFA 3T1AA 3HT3A 4FM0A 4H4MA 4DTUA 4DTMA 1VSIA 1C1CA 3SUPA 2G8WA 2PZSA 4KTQA 4Z4GA 1VSKA 3KKRA 1HPZA 4HCBA 1NJZA 2IOCA 2HNZA 3F9KA 1B9FA 4N41A 2HNYA 3AVKA 3UIQA 4KHNA 4PQUA 1DLOA 3LPUA 4WE1A 2ATQA 4BE1A 1C0UA 2VWKA 4CF2A 4N5SA 1HJRA 3QEXA 4H8KA 3WNHA 4E7IA 1QE1A 1LWEA 4CK3A 3O4NA 3TWHA 4W5TA 4M45A 4K8XA 4KI4A 2HMIA 3VQ7A 3V1RA 1TKZA 2Q3SA 4FVMA 3NGZA 3MXIA 3AO3A 1S1WA 4K8ZA 4KTWA 1IKVA 2OPRA 1LV5A 4JS4A 4M42A 4DTSA 4CK1A 1U48A 4BDPA 2GUIA 1RT5A 1ASVA 4F3OA 2PY5A 2HB5A 2IAJA 3L2RA 3LAMA 4FJNA 2VG5A 3OYNA 3RMCA 4M3TA 2KZMA 3NCIA 1QS4A 3CFOA 4F8RA 1LW0A 3OYCA 3MXJA 3NGIA 1FKPA 3SPYA 4DQPA 2QKBA 4DQSA 3C94A 4FLYA 3OJSA 4DS4A 3LZJA 1LAWA 1RT2A 2HVIA 2HHSA 3ZSYA 3TAGA 1IKWA 3AVGA 4FW2A 1S1TA 3I0SA 1NK4A 4KKOA 3O4QA 3ZSRA 2I5JA 1SV5A 3K2PA 3P5JA 1EXQA 3NH0A 4E19A 4M3UA 3ZSZA 1TV6A 2E6LA 3AO2A 1EKEA 2YKMA 4KTZA 1SL2A 1WSIA 3BGRA 4CEOA 2Z1GA 3OYDA 4DSFA 3L2VA 1HQEA 2BE2A 2G8FA 4C8KA 3ALYA 4CJRA 3V81A 1SKRA 4FLTA 5KI6A 4F2SA 4GVMA 3O3GA 4KREA 3ZT2A 4B9NA 2G8IA 3V9UA 1IO2A 3MEGA 1TAQA 3MXMA 5T7BA 1ASWA 4CIGA 4CIEA 2F8SA 2B6AA 3AVAA 4IBNA 2XY7A 2B4JA 1O1WA 1NOZA 1D5AA 4MFBA 3K58A 3TAMA 3PO5A 1RDDA 4TSXA 2BANA 2FC0A 4FK2A 3AVHA 4OKKA 4CHOA 4BDZA 1IH7A 1VSHA 3OYMA 1X9MA 4PY5A 4JLHA 3ZSQA 3ZSXA 3NBPA 2X78A 1TKTA 4CIFA 1FXXA 1QSLA 1RNHA 3SNNA 1HRHA 5DMRA 3MEEA 4ELUA 1Z25A 4PA1A 3M8QA 5CZ2A 4I2PA 4QAGA 1HYVA 4L8RB 3AVIA 1BIUA 3AVFA 1KLNA 2FBYA 1J53A 2RN2A 3QIOA 3SPZA 3K5NA 4BDYA 3LPTA 1L3UA 1NK0A 3KK3A 3NF6A 3HP9A 3NHGA 1BIZA 4DSLA 1KVCA 4Q0BA 4DSEA 3LP1A 3P83D 4CFBA 3L2WA 4Z4CA 3OYBA 4KPYA 2XY5A 4KHYA 3SUOA 2GBZA 1L3SA 5E41A 3WNFA 3V1OA 2QXFA 1X1PA 4NYFA 3LP2A 4C8LA 3NH1A 4DQRA 5C25A 3PX4A 2XRIA 2ETJA 1T05A 3DOLA 3SQ4A 1X9WA 1GOCA 1TKXA 3TR8A 4CGDA 1CZ9A 3K59A 3ULDA 4B8CA 3OS0A 4AHCA 1K6YA 3DOKA 5J2MA 5CY4A 4BWJA 3OYKA 3ZT0A 1A5XA 4B9SA 1N6QA 3QLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YTA A;  2O4G A;  1RT6 A;  4CJW A;  3I8D A;  3DMJ A;  1BHL A;  4I2Q A;  4NCB A;  4DLE A;  2XHB A;  4DLG A;  3WNE A;  1ZBF A;  4E1M A;  4DTJ A;  3V9X A;  1S6P A;  2G8V A;  1TAU A;  4KAZ A;  1EET A;  1R0A A;  4CEA A;  2P51 A;  2YNH A;  3PX0 A;  3U3G A;  1NJY A;  4I7F A;  3C6U A;  5CYQ A;  4CF9 A;  3D0P A;  3AVL A;  4QCL A;  3KLI A;  4CJP A;  4CJF A;  4Z4H A;  2YNF A;  4OVL A;  1XI1 A;  2HND A;  4FJ5 A;  4GMJ B;  1LAV A;  3OYJ A;  4IG3 A;  3AO5 A;  1U49 A;  4DSJ A;  4W5O A;  4E3S A;  2ZQB A;  2HHT A;  1HMV A;  1NKC A;  1C1A A;  3KKS A;  4FW1 A;  5HP1 A;  5SZT A;  4DFK A;  3LWL A;  2IDO A;  1J9A A;  1B9D A;  4Y1C A;  1G15 A;  4FZZ A;  1RTJ A;  1F21 A;  4CJS A;  3DYA A;  3SI6 A;  4J2E A;  3OYI A;  1IG9 A;  4YFU A;  1BL3 A;  2X6S A;  3NFA A;  4FLX A;  1L5U A;  3AVM A;  2WON A;  2OPP A;  4CGF A;  3L8B A;  1S9G A;  3M8R A;  4B9L A;  3QIN A;  4ID5 A;  2P5G A;  4E7H A;  4DS5 A;  3ZT4 A;  4M3Y A;  1C1B A;  4AHR A;  5KTQ A;  4HCC A;  4DTN A;  4CF0 A;  4OPJ A;  2OZM A;  4Z4F A;  3HXM A;  4GW6 A;  4M3W A;  4FZX C;  4IKF A;  1KCF A;  2QK9 A;  3QER A;  2EX3 A;  3ITH A;  3KK1 A;  2XY6 A;  4QOZ B;  3VQQ A;  4BE2 A;  1ZYQ A;  2HHW A;  1A5V A;  4RW8 A;  1U47 A;  4FZY A;  2O4I A;  4I9L A;  1U45 A;  1YT3 A;  3L3U A;  3SUQ A;  1VSM A;  1D9F A;  1HYS A;  1U4B A;  1ITG A;  1RDB A;  3VQA A;  4DFP A;  3C6T A;  3B6O A;  3DM2 A;  1TK0 A;  4LH4 A;  4N76 A;  1KSP A;  2BGG A;  2P1J A;  4FM1 A;  4CJV A;  4FJ7 A;  1RBU A;  2VG7 A;  3VQ4 A;  2FBX A;  3ZSO A;  3QEP A;  2D0B A;  3KD1 E;  1RT7 A;  1TL3 A;  1ZBU A;  4KRF A;  3V9Z A;  3OYF A;  2BDP A;  4Q5V A;  1Q9X A;  2D0A A;  3V9S A;  2G8U A;  1VSE A;  3AVB A;  4FJK A;  1VRU A;  4M3X A;  4KHW A;  1JLG A;  4FJH A;  1IKX A;  3VQ9 A;  3KJV A;  1ASU A;  1NK9 A;  1CXQ A;  4CJ4 A;  2DTU A;  4Z4I A;  4PWD A;  2XY8 A;  2YKN A;  3S3N A;  4B9M A;  4FJM A;  3TAN A;  1QSS A;  4JRQ A;  3HPH A;  3DI6 A;  3OS1 A;  3SCX A;  2YNI A;  4CJT A;  3T3F A;  2Y1I A;  3TAB A;  2OA8 A;  4EZ6 A;  3TI0 A;  2F8T A;  2HHU A;  1REV A;  5HRP A;  3OVN A;  4FJL A;  1XWL A;  5KRS A;  4CHZ A;  1IKY A;  1J5O A;  4RW9 A;  1JLE A;  1ZBL A;  1I3A A;  2F96 A;  1NK7 A;  3H08 A;  3AA2 A;  1JL1 A;  3HPG A;  3NF7 A;  3VQD A;  4C8O A;  4OGC A;  5C24 A;  3LAK A;  3RRG A;  5JS1 A;  4KHU A;  4DU1 A;  4B08 A;  4I9Q A;  1DTT A;  1C6V A;  4CGG A;  4XIU A;  4IFY A;  1XHX A;  5KGW A;  2FBV A;  1EX4 A;  4E1N A;  3OY9 A;  1JLB A;  4DTR A;  4F3T A;  4CJU A;  5FDL A;  4HVJ A;  4CFC A;  3SJJ A;  4FLV A;  4FJJ A;  3VN5 A;  1RTH A;  2JGU A;  1SL0 A;  1RIL A;  2R7Y A;  2DFH A;  5J1E A;  2GV9 A;  3AV9 A;  4FJG A;  3SV4 A;  1MU2 A;  1S6Q A;  2KFZ A;  3K5M A;  4OGE A;  4M41 A;  4CHP A;  2Z1H A;  4CEZ A;  4N56 A;  1VSD A;  1BQN A;  3QNN A;  1D8Y A;  1ZBH A;  5HRN A;  5KGX A;  3HJF A;  4MQ3 A;  1Y97 A;  4E7J A;  1S9E A;  4M3R A;  4CFD A;  2RF2 A;  2YV0 X;  4CGH A;  5I42 A;  2VWJ A;  4AHV A;  1WSH A;  4IFV A;  2KQ2 A;  4B9U A;  2HHX A;  2X74 A;  4OLB A;  1Z26 A;  3O3H A;  4CF8 A;  2G8H A;  2LSN A;  1JXB A;  3ZT3 A;  3TAR A;  2E6M A;  3AO1 A;  4ICL A;  4BWM A;  3L2U A;  4FJI A;  4AH9 A;  3O3F A;  4M3Z A;  3NF9 A;  5K14 A;  4DU3 A;  3OS2 A;  5FRM A;  4CEC A;  3VQE A;  2HW3 A;  4Y1D A;  1SKW A;  1L3T A;  4CEB A;  4FK4 A;  1CXU A;  1QQC A;  2A1S A;  5HBM A;  3NH2 A;  4JRP A;  3ASM A;  3HM9 A;  3ISN C;  1U04 A;  3RR8 A;  3VA3 A;  1BIS A;  1S1X A;  3CG7 A;  3K57 A;  1A5W A;  2A1R A;  3AO4 A;  3IS9 A;  2HVH A;  2IGI A;  1XHZ A;  2OPQ A;  3TAP A;  3QNO A;  1RDC A;  2IS3 A;  3RRH A;  4OJR A;  1WN7 A;  1TK5 A;  4DTP A;  3EYZ A;  1UA1 A;  4Z4E A;  4FLU A;  1RT1 A;  3PY8 A;  1BCO A;  2DY4 A;  4EP4 A;  3D45 A;  2B5J A;  4CEE A;  2D5R A;  4KO0 A;  5HRS A;  1L3V A;  1J54 A;  4IDK A;  2IC3 A;  1NJW A;  4CF1 A;  4FXD A;  2ZD1 A;  2Z1J A;  4KB1 A;  1HQU A;  1SUQ A;  1W0H A;  4B8A B;  4LSN A;  3K5O A;  4DF8 A;  3QET A;  5I3U A;  4CJ5 A;  1WSG A;  1JKH A;  4W5N A;  1LWF A;  4FM2 A;  3VQB A;  1GOA A;  4O0J A;  2ZE2 A;  4LH5 A;  2OYQ A;  2KZZ A;  4CK2 A;  3S3M A;  1GOB A;  3RTV A;  1CLQ A;  1RT3 A;  4CHQ A;  1RT4 A;  4E7K A;  1NKE A;  4F2R A;  4CJK A;  2KW4 A;  3HST B;  5SWM A;  4W5Q A;  1NOY A;  2WOM A;  4LSL A;  4G1Q A;  4DFJ A;  3RMD A;  1KFD A;  1Q9Y A;  3KD5 E;  4YNQ A;  3RWU A;  5D3G A;  3MAQ A;  2NUB A;  4CES A;  4DFM A;  1S1V A;  3G10 A;  3KTQ A;  4DSI A;  1T03 A;  3AVJ A;  1X9S A;  2OPS A;  1TKD A;  4OKE A;  2HHV A;  1C0T A;  1VSJ A;  4CHN A;  1UAX A;  3HVT A;  3LWM A;  3TAF A;  4FLZ A;  3SYZ A;  1QSY A;  3KLF A;  5JS2 A;  3NE6 A;  1NK5 A;  4R5P A;  3SQ0 A;  3PUF A;  1TVR A;  3KK2 A;  2X6N A;  4CJQ A;  3SQ2 A;  3ZSV A;  1NK6 A;  3L3V A;  3VA0 A;  4FJX A;  1DTQ A;  2YHB A;  4CJ3 A;  4OPK A;  4CHY A;  4EP5 A;  1LW2 A;  2JLE A;  3CFR A;  5J2N A;  1SL1 A;  3RR7 A;  4J2D A;  1WLJ A;  3HVR A;  1KRP A;  3VQC A;  4CCH A;  3AVN A;  4B3O A;  2DFE A;  4DWI A;  1KLM A;  4HTU A;  2FBT A;  2HHQ A;  4LD0 A;  3AVC A;  3ZT1 A;  4NCG A;  4O5B A;  3OYA A;  1ZBI A;  3B6P A;  1TL1 A;  3IRX A;  3SV3 A;  3L2Q A;  3S9H A;  1WSE A;  4OKJ A;  4FYD A;  4AHT A;  4J2A A;  4W5R A;  3PX6 A;  1RBS A;  1BI4 A;  2PYJ A;  3FFI A;  1VSL A;  1BCM A;  4CFA A;  1CZB A;  3G0Z A;  3V6D A;  3AA3 A;  3ZSW A;  4KHS A;  1S5J A;  3ZCM A;  2G8K A;  2OZS A;  3DRR A;  3EY1 A;  1FK9 A;  3IG1 A;  3LZI A;  4HUG A;  4HUF A;  3VQP A;  3PV8 A;  4CE9 A;  4ZTF A;  3V9W A;  1D9D A;  4B9T A;  1RDA A;  4BAC A;  5J2Q A;  3THV A;  4AHU A;  4BE0 A;  1N5Y A;  4C8M A;  1WSF A;  1SKS A;  1YTU A;  1WSJ A;  1T8E A;  1JXE A;  3AA4 A;  4O4G A;  3KLG A;  1JLC A;  3HP6 A;  4RW7 A;  3A2F A;  3U3Y A;  5HRO A;  4FCY A;  4DG1 A;  3NDK A;  4OLA A;  3CM6 A;  1FKO A;  5DK5 A;  3DLB A;  1C0M A;  4JS5 A;  1I39 A;  3VQ5 A;  3WNG A;  1RTI A;  4DF4 A;  1NK8 A;  2VG6 A;  1B92 A;  1VSF A;  3QEV A;  3NAE A;  3QEW A;  1TK8 A;  3QIP A;  3LP3 A;  3HYF A;  3TAE A;  3V4I A;  1KFS A;  3DLG A;  2YNG A;  2AJQ A;  4ELV A;  2YHA A;  3DLR A;  5EU7 A;  4CJL A;  2E4L A;  5J2P A;  4E89 A;  3SZ2 A;  3SQ1 A;  3TAQ A;  4RW4 A;  2KFN A;  3NF8 A;  3C95 A;  1RCH A;  5HRR A;  3M8P A;  1JL2 A;  4CJE A;  3LAL A;  4CED A;  4UQG A;  4FLW A;  3QES A;  4KFB A;  2RKI A;  3DLK A;  4HUE A;  4FJ8 A;  1BI4 B;  3K5L A;  3VQ8 A;  1NKB A;  3S3O A;  1UWB A;  3QO9 A;  4CEQ A;  3OYE A;  1T7P A;  2PYL A;  4ZHR A;  1RBT A;  4PUO A;  1VRT A;  3HK2 A;  1W9H A;  1HYZ A;  1KTQ A;  1JLQ A;  1RBR A;  3BDP A;  3P1G A;  1RBV A;  4N47 A;  4KV8 A;  1VK0 A;  1KVA A;  5CZ1 A;  4AHS A;  3VQ6 A;  4ZTJ A;  2QKK A;  4KHQ A;  2P5O A;  3DLE A;  4DQQ A;  3DLH A;  4IG0 A;  3MEC A;  4DTO A;  5FRN A;  3M8S A;  3OYG A;  3DRS A;  4C8N A;  3EZ5 A;  3I0R A;  3JYT A;  5KRT A;  3F73 A;  5HLF A;  3HO1 A;  4CER A;  1UOC A;  2EHG A;  3E01 A;  4O0I A;  3QEI A;  3OJU A;  4DQI A;  4HHT A;  4DTX A;  3RMB A;  1TGO A;  3OYH A;  1XC9 A;  1BQM A;  2XO7 A;  3CQ8 A;  1S1U A;  3AA5 X;  4LY7 A;  3V1Q A;  5FRO A;  3HL8 A;  4O44 A;  4CGJ A;  5CYM A;  4KI6 A;  3LP0 A;  4FJ9 A;  1Q8I A;  2KTQ A;  4DSK A;  3CYM A;  3KLH A;  1WAJ A;  1YVU A;  3DRP A;  3CFP A;  3MED A;  4O55 A;  3T19 A;  1KVB A;  4CEF A;  2RPI A;  1UA0 A;  4AIL C;  5C42 A;  3LAN A;  1WNS A;  1LWC A;  4E0D A;  4RG8 A;  4NYN A;  4B9V A;  4DMN A;  4ELT A;  2W42 A;  4H4O A;  3PO4 A;  1EP4 A;  4F4K A;  4KB0 A;  1RTD A;  3HPO A;  3SUN A;  4J2B A;  2ITG A;  2Z1I A;  2DFF A;  3LDS A;  3OYL A;  1NJX A;  3KLE A;  1JLF A;  1HNI A;  1JLA A;  3CM5 A;  2Y1J A;  4NCA A;  4ID1 A;  4EZ9 A;  3U6F A;  1QTM A;  4FK0 A;  1QHT A;  1HNV A;  4DU4 A;  4Z0U A;  3RMA A;  2D0C A;  3NGY A;  4E7L A;  3IAY A;  3KIO A;  3JSM A;  4RW6 A;  4CGI A;  1BGX T;  1WAF A;  3T1A A;  3HT3 A;  4FM0 A;  4H4M A;  4DTU A;  4DTM A;  1VSI A;  1C1C A;  3SUP A;  2G8W A;  2PZS A;  4KTQ A;  4Z4G A;  1VSK A;  3KKR A;  1HPZ A;  4HCB A;  1NJZ A;  2IOC A;  2HNZ A;  3F9K A;  1B9F A;  4N41 A;  2HNY A;  3AVK A;  3UIQ A;  4KHN A;  4PQU A;  1DLO A;  3LPU A;  4WE1 A;  2ATQ A;  4BE1 A;  1C0U A;  2VWK A;  4CF2 A;  4N5S A;  1HJR A;  3QEX A;  4H8K A;  3WNH A;  4E7I A;  1QE1 A;  1LWE A;  4CK3 A;  3O4N A;  3TWH A;  4W5T A;  4M45 A;  4K8X A;  4KI4 A;  2HMI A;  3VQ7 A;  3V1R A;  1TKZ A;  2Q3S A;  4FVM A;  3NGZ A;  3MXI A;  3AO3 A;  1S1W A;  4K8Z A;  4KTW A;  1IKV A;  2OPR A;  1LV5 A;  4JS4 A;  4M42 A;  4DTS A;  4CK1 A;  1U48 A;  4BDP A;  2GUI A;  1RT5 A;  1ASV A;  4F3O A;  2PY5 A;  2HB5 A;  2IAJ A;  3L2R A;  3LAM A;  4FJN A;  2VG5 A;  3OYN A;  3RMC A;  4M3T A;  2KZM A;  3NCI A;  1QS4 A;  3CFO A;  4F8R A;  1LW0 A;  3OYC A;  3MXJ A;  3NGI A;  1FKP A;  3SPY A;  4DQP A;  2QKB A;  4DQS A;  3C94 A;  4FLY A;  3OJS A;  4DS4 A;  3LZJ A;  1LAW A;  1RT2 A;  2HVI A;  2HHS A;  3ZSY A;  3TAG A;  1IKW A;  3AVG A;  4FW2 A;  1S1T A;  3I0S A;  1NK4 A;  4KKO A;  3O4Q A;  3ZSR A;  2I5J A;  1SV5 A;  3K2P A;  3P5J A;  1EXQ A;  3NH0 A;  4E19 A;  4M3U A;  3ZSZ A;  1TV6 A;  2E6L A;  3AO2 A;  1EKE A;  2YKM A;  4KTZ A;  1SL2 A;  1WSI A;  3BGR A;  4CEO A;  2Z1G A;  3OYD A;  4DSF A;  3L2V A;  1HQE A;  2BE2 A;  2G8F A;  4C8K A;  3ALY A;  4CJR A;  3V81 A;  1SKR A;  4FLT A;  5KI6 A;  4F2S A;  4GVM A;  3O3G A;  4KRE A;  3ZT2 A;  4B9N A;  2G8I A;  3V9U A;  1IO2 A;  3MEG A;  1TAQ A;  3MXM A;  5T7B A;  1ASW A;  4CIG A;  4CIE A;  2F8S A;  2B6A A;  3AVA A;  4IBN A;  2XY7 A;  2B4J A;  1O1W A;  1NOZ A;  1D5A A;  4MFB A;  3K58 A;  3TAM A;  3PO5 A;  1RDD A;  4TSX A;  2BAN A;  2FC0 A;  4FK2 A;  3AVH A;  4OKK A;  4CHO A;  4BDZ A;  1IH7 A;  1VSH A;  3OYM A;  1X9M A;  4PY5 A;  4JLH A;  3ZSQ A;  3ZSX A;  3NBP A;  2X78 A;  1TKT A;  4CIF A;  1FXX A;  1QSL A;  1RNH A;  3SNN A;  1HRH A;  5DMR A;  3MEE A;  4ELU A;  1Z25 A;  4PA1 A;  3M8Q A;  5CZ2 A;  4I2P A;  4QAG A;  1HYV A;  4L8R B;  3AVI A;  1BIU A;  3AVF A;  1KLN A;  2FBY A;  1J53 A;  2RN2 A;  3QIO A;  3SPZ A;  3K5N A;  4BDY A;  3LPT A;  1L3U A;  1NK0 A;  3KK3 A;  3NF6 A;  3HP9 A;  3NHG A;  1BIZ A;  4DSL A;  1KVC A;  4Q0B A;  4DSE A;  3LP1 A;  3P83 D;  4CFB A;  3L2W A;  4Z4C A;  3OYB A;  4KPY A;  2XY5 A;  4KHY A;  3SUO A;  2GBZ A;  1L3S A;  5E41 A;  3WNF A;  3V1O A;  2QXF A;  1X1P A;  4NYF A;  3LP2 A;  4C8L A;  3NH1 A;  4DQR A;  5C25 A;  3PX4 A;  2XRI A;  2ETJ A;  1T05 A;  3DOL A;  3SQ4 A;  1X9W A;  1GOC A;  1TKX A;  3TR8 A;  4CGD A;  1CZ9 A;  3K59 A;  3ULD A;  4B8C A;  3OS0 A;  4AHC A;  1K6Y A;  3DOK A;  5J2M A;  5CY4 A;  4BWJ A;  3OYK A;  3ZT0 A;  1A5X A;  4B9S A;  1N6Q A;  3QLH A; 
#chains in the Genus database with same CATH topology
 2NRR A;  3DMJ A;  1BHL A;  4I2Q A;  2W6L A;  1XMO K;  4H5R A;  3VTI A;  3THY B;  1NGE A;  2GWK A;  2HOE A;  1NGH A;  1NJY A;  4I7F A;  5CYQ A;  1S72 N;  5AQJ A;  3KLI A;  2YNF A;  4OVL A;  1ATN A;  4FJ5 A;  5C2F A;  3CC4 N;  3NVK A;  4DSJ A;  4W5O A;  2ZQB A;  1HMV A;  1NKC A;  5HP1 A;  4DFK A;  3LWL A;  1YJW N;  1YIJ N;  4YFU A;  2X6S A;  2FXU A;  4NB4 A;  3G6E N;  2OPP A;  4A5B A;  3M8R A;  4DS5 A;  3CJ9 A;  1HJO A;  3I33 A;  1NGA A;  2O8C A;  3FE1 A;  4OPJ A;  3EN9 A;  3MWT A;  4FZX C;  4LF5 K;  3QER A;  4EHU A;  4FSV A;  3VQQ A;  1A5V A;  2ZJP L;  4FZY A;  3J8A A;  2O8E B;  1KXP A;  1D9F A;  2A40 A;  1HNW K;  3VQA A;  3B6O A;  4LH4 A;  4WQ5 C;  3THX B;  4N76 A;  1KSP A;  4FJ7 A;  2VG7 A;  3VQ4 A;  4MO5 A;  2D0B A;  3C7N B;  3VMF B;  1TL3 A;  2E2P A;  3NVM A;  4KRF A;  4DR5 K;  2BDP A;  2G8U A;  3HRG A;  3QIC A;  4M3X A;  1VRU A;  2UYT A;  5AQT A;  4BRN A;  4FJH A;  4FWM A;  1IKX A;  4KH5 A;  2DTU A;  1HKG A;  2XY8 A;  4G9Z A;  4B9M A;  3ENO A;  1K9M O;  4BQZ A;  4CZM A;  4FJM A;  4DR7 K;  2P9P A;  2YNI A;  2H3G X;  1HX1 A;  4EZ6 A;  4XH1 A;  1OVY A;  2F8T A;  5HRP A;  3OVN A;  1QQN A;  3I55 N;  1J5O A;  4RW9 A;  4DV4 K;  3AA2 A;  3HPG A;  3RRG A;  4A2A A;  5KGW A;  2FBV A;  1Q7Y O;  4CFC A;  3VN5 A;  1RTH A;  2JGU A;  2HHH K;  4ILJ A;  2HST A;  3SV4 A;  1MU2 A;  3AGR A;  3K5M A;  2Z1H A;  4N56 A;  1BQN A;  3QNN A;  1D8Y A;  5KGX A;  3HJF A;  4MQ3 A;  4E7J A;  3D2E A;  1S9E A;  2RF2 A;  5GIP A;  5LL6 Z;  4CGH A;  2VWJ A;  1HKC A;  1Z26 A;  3AAP A;  3N4P A;  4JKF A;  4CF8 A;  2A5X A;  1MWM A;  2FSJ A;  4BWM A;  3L2U A;  4FJI A;  3O3F A;  5K14 A;  4JKH A;  5FRM A;  3KVG A;  1L3T A;  1C0G A;  4DUY K;  3ASM A;  5AQM A;  5LJV A;  3RR8 A;  2Q97 A;  4H0Y B;  3W0L A;  1N36 K;  3L0Q A;  5GIO A;  1XHZ A;  4YY3 K;  3TAP A;  2ZWH A;  1RDC A;  2IS3 A;  4OJR A;  3LM2 A;  3ID8 A;  2DY4 A;  4EP4 A;  2GEM A;  2V7Z A;  2J4R A;  1HQU A;  1ESV A;  4CZF A;  1JCG A;  1WSG A;  3CMA N;  4FM2 A;  4R79 A;  2ZE2 A;  4LH5 A;  4UY8 O;  2VGN A;  2Q0U A;  3P39 A;  3S3M A;  1GOB A;  1CLQ A;  1NKE A;  2YHX A;  3DXM B;  5F1X A;  3HST B;  5IWA K;  1NOY A;  4DR1 K;  4LSL A;  3CC2 N;  1YF5 L;  3RMD A;  1Q9Y A;  1WB9 A;  2P9I B;  3MAQ A;  2NUB A;  4CES A;  2QEX N;  3DXK B;  4BR9 A;  3D2F A;  3SBT A;  1TKD A;  3FFK B;  4FLZ A;  2D1K A;  3J7Y P;  3KLF A;  3NE6 A;  1NK5 A;  3PUF A;  2DPN A;  1NK6 A;  3H45 C;  4FJX A;  5AFU A;  3CFR A;  3RR7 A;  1SL1 A;  2JLE A;  1NLV A;  1WLJ A;  1KRP A;  1FW6 A;  2DFE A;  1Z05 A;  4CBX A;  1KLM A;  4KBO A;  1J5E K;  1TL1 A;  3L2Q A;  1WSE A;  5HL7 L;  2YHY A;  4W5R A;  4WYB A;  1NJI O;  3ZSW A;  5BPL A;  1FJG K;  2G8K A;  4KB1 A;  4AM6 A;  5C15 A;  3T1Y K;  4IOX A;  2YI1 A;  5AQL A;  4BE0 A;  4LFC K;  1SKS A;  4PKG A;  1YTU A;  1WSJ A;  2BUP A;  2P9U B;  3GBT A;  1VQ5 N;  4FCY A;  1MA9 B;  4OLA A;  2E8A A;  3CM6 A;  1FKO A;  5DK5 A;  3BP8 A;  3WNG A;  1W7A A;  4H03 B;  2NLX A;  3BF1 A;  4K43 A;  5AQY A;  2VG6 A;  5EOY A;  1VSF A;  3QEV A;  1TK8 A;  3QIP A;  1M1K O;  3LP3 A;  3HYF A;  5AQP A;  4JI5 K;  2ZJR L;  2E4L A;  4E89 A;  3SQ1 A;  2Q36 A;  4RW4 A;  4OX9 K;  2KFN A;  1RCH A;  5AR0 A;  4B3S K;  3M8P A;  3LAL A;  3O1W A;  3R3L A;  4JKG B;  3K5L A;  2A41 A;  1NKB A;  4PUO A;  3U4L A;  4ZHR A;  1VRT A;  1W97 L;  1W9H A;  1RBR A;  3MCP A;  4N47 A;  3ZET B;  4KV8 A;  1VK0 A;  1KVA A;  4DHY A;  4ZTJ A;  3CHW A;  3O1B A;  4DQQ A;  3DLH A;  4IG0 A;  4KHP K;  2V7Y A;  5HLF A;  3EZ5 A;  3JYT A;  5KRT A;  4IOC L;  1UOC A;  4GNI A;  2ASM A;  3ZEU A;  1WOQ A;  5FRO A;  2P9S B;  4CGJ A;  4IJN A;  4KI6 A;  4FJ9 A;  3T69 A;  4L3Q A;  3CYM A;  1VQO N;  3CFP A;  5E84 A;  4O55 A;  3ZEU B;  1SAZ A;  2NZT A;  4B9V A;  4QS9 A;  4DMN A;  2W42 A;  3O4W A;  4H4O A;  4A2B A;  5F0X A;  3PO4 A;  4J2B A;  3OYL A;  3SK3 A;  2OTJ N;  4ID1 A;  4EZ9 A;  4DR3 K;  1HNV A;  4Z0U A;  4E7L A;  5TKW A;  4DV3 K;  1WAF A;  3HT3 A;  4H4M A;  2PZS A;  5AQG A;  3Q7C A;  4KH6 A;  2UUC K;  4KTQ A;  4Z4G A;  1NJZ A;  2HNY A;  1YXQ A;  4JV5 K;  2PFU A;  3UIQ A;  2QWO A;  4KHN A;  2VQE K;  2ATQ A;  4BE1 A;  1C0U A;  1IBK K;  4N5S A;  1HJR A;  4H8K A;  5GAG P;  4CK3 A;  1ATR A;  3H1V X;  4M45 A;  4K8X A;  4KI4 A;  2ASP A;  5BRE A;  3MXI A;  3NGZ A;  3AO3 A;  5TKY A;  4KTW A;  1IKV A;  4JS4 A;  1WUA A;  4JI7 K;  2PY5 A;  3D2E B;  4YOW A;  3OYN A;  3G71 N;  4F8R A;  1GLE G;  1V4S A;  3VOV A;  3OYC A;  3SPY A;  3CPW M;  3C94 A;  3OJS A;  4DS4 A;  3LZJ A;  1RT2 A;  2HVI A;  1IKW A;  1E4F T;  2IVP A;  3AVG A;  1S1T A;  3I0S A;  4KKO A;  1SV5 A;  1EXQ A;  4FWP A;  2QWR A;  1TV6 A;  5FPE A;  3JAM O;  1EKE A;  2YKM A;  4BRD A;  1SL2 A;  1WSI A;  2CGK A;  1K8K A;  4BC2 A;  1TYQ B;  3OYD A;  3WXI A;  4LF7 K;  3L2V A;  2G8F A;  4CJR A;  5KI6 A;  2WC9 A;  3VER A;  2G8I A;  4BR0 A;  1IO2 A;  1T6D A;  3MEG A;  2P9K A;  4FO0 A;  2JWL A;  3MXM A;  2F8S A;  4IBN A;  1O1W A;  1D5A A;  4MFB A;  3UKU A;  3TAM A;  3K58 A;  4O5F A;  4X65 K;  4FPA A;  4CHO A;  4H0X B;  4BDZ A;  5M1N A;  3QB0 A;  4JLH A;  1BOT O;  3OW2 M;  3CCV N;  2X78 A;  2W40 A;  1FXX A;  2GTD A;  4ELU A;  1S3X A;  3M8Q A;  4PA1 A;  4BRF A;  4I2P A;  3K5N A;  3EZW A;  2NRX A;  2P9K B;  3NHG A;  1BIZ A;  4NO7 A;  3A5N C;  3P83 D;  4KHY A;  1VQ7 N;  3OYB A;  3O9T A;  3SUO A;  5CR4 A;  4C8L A;  4PL7 A;  5GAH P;  1T05 A;  1TKX A;  4CGD A;  1QZ6 A;  4NXM K;  2AP1 A;  5J2M A;  4J8F A;  1HLU A;  5LY3 A;  5JLF A;  1YTA A;  3WQT A;  1VQP N;  2O4G A;  1J6Z A;  4NCB A;  3U8X A;  4K42 A;  4FPB A;  1VQM N;  3CCR N;  1EET A;  1R0A A;  4CEA A;  2YNH A;  3PX0 A;  4Z4H A;  4CJP A;  4CJF A;  2HND A;  3MWP A;  1LAV A;  5EX5 A;  4QS7 A;  3OYJ A;  4IG3 A;  3AO5 A;  4JYA K;  2YCH A;  2HHT A;  1C1A A;  3KKS A;  3M6G A;  2IDO A;  3UB5 A;  4Y1C A;  1G15 A;  3O9U A;  4JNE A;  3CD6 N;  3CCS N;  3U9Z A;  4IEE A;  3RVC A;  3OYI A;  3OBY A;  1IG9 A;  3EEQ A;  4K0K K;  3NFA A;  3R8E A;  1NGD A;  4CGF A;  1S9G A;  4BRM A;  2P5G A;  4EIA A;  1C1B A;  4FOE A;  5KTQ A;  1KC8 O;  2OZM A;  4CF0 A;  4BGB A;  4GW6 A;  2HBM A;  1XQS C;  3P31 A;  5BPM A;  2EX3 A;  5AQS A;  3ZYY X;  3W3D A;  1ZYQ A;  4RW8 A;  3CCM N;  4BC4 A;  1YT3 A;  1HYS A;  2PAV A;  1ITG A;  5BRD A;  4DFP A;  2F9W A;  2V52 B;  4CJV A;  1Q81 O;  3ZSO A;  3KD1 E;  2E88 A;  3OYF A;  2D0A A;  5AQZ A;  3SBG A;  1NK9 A;  1G99 A;  5AQH A;  3S3N A;  2CGJ A;  3TAN A;  3HPH A;  3O9Q A;  3DI6 A;  3OS1 A;  4OO1 J;  3CCL N;  3TI0 A;  4FJL A;  4F9O A;  1XWL A;  4CHZ A;  1IKY A;  3FGU A;  2YJE A;  4YOY A;  5C24 A;  4WFB L;  4BRP A;  3CCQ N;  4KHU A;  4I9Q A;  4B08 A;  1IBL K;  1DTT A;  1NGC A;  4EAH D;  5C2D A;  4XIU A;  1XHX A;  3CJB A;  4E1N A;  4DTR A;  1JLB A;  4CJU A;  4MO4 A;  3SAG A;  2E20 A;  3CPE A;  4EHT A;  1RIL A;  2DFH A;  5J1E A;  3K0S A;  2KFZ A;  2RHK A;  4JD2 A;  4OGE A;  2W6K A;  4BR5 A;  5KPT A;  1ZBH A;  1X3M A;  4RTF D;  5HRN A;  4M3R A;  3DAW A;  4AHV A;  1QQO A;  3J81 O;  2P9P B;  4WQ4 A;  4IFV A;  2HHX A;  3R6M A;  2G8H A;  3F5T A;  1LOT B;  4BG8 A;  1NGI A;  3NF9 A;  2FSN A;  4JN4 A;  3VQE A;  4Y1D A;  4CEB A;  4FK4 A;  2A1S A;  3NH2 A;  3HM9 A;  2FSK A;  3VA3 A;  3FZF A;  1S1X A;  2UU9 K;  4WF9 L;  3CME N;  2A1R A;  4B1U B;  2HVH A;  5BPN A;  1NWK A;  3RRH A;  4DV7 K;  3CJ1 A;  1HKB A;  1UA1 A;  3THY A;  4H0O A;  1RT1 A;  1BCO A;  3CJC A;  3D45 A;  4CEE A;  2D5R A;  5JVG L;  4IDK A;  2ZD1 A;  2P9N A;  4B8A B;  1OVQ A;  4LSN A;  3K5O A;  4E1J A;  4DF8 A;  5I3U A;  1IG8 A;  3SAF A;  5EVZ A;  4YOT A;  4JKC A;  3RTV A;  1RT3 A;  1RT4 A;  4F2R A;  4CZG A;  2KW4 A;  3FR0 A;  4CD3 A;  4W5Q A;  1QVG M;  3QFP A;  3KD5 E;  3PIP L;  3PSI A;  4DKW A;  4IZ9 A;  3R1X A;  3BF3 A;  4DFM A;  5B8H A;  1NGG A;  1S1V A;  3G10 A;  4DSI A;  3H3N O;  1T03 A;  1VSJ A;  1YVN A;  4FL9 A;  3TTC A;  3TAF A;  2GX9 A;  3QML A;  1QSY A;  5JS2 A;  3IDH A;  4R5P A;  3OA9 A;  2X6N A;  2E2O A;  3SQ2 A;  5AQO A;  2YHB A;  4BC3 A;  4OPK A;  4J2D A;  5KPR A;  3FLC O;  3HVR A;  1DEJ A;  3AVN A;  4O8U A;  3O6W A;  4B3O A;  2NRZ A;  1KAZ A;  2FBT A;  4NLC A;  3WXM B;  4LD0 A;  1BWF O;  4NCG A;  4O5B A;  1W2B M;  3IRX A;  1ZBI A;  3SV3 A;  1HR0 K;  4FYD A;  3PX6 A;  5FPD A;  1RBS A;  1VSL A;  3EKS A;  3V6D A;  4JHD A;  5BN8 A;  4B3M K;  3AA3 A;  1S5J A;  3THW B;  2OZS A;  4HUG A;  3IG1 A;  3LZI A;  3VQP A;  4CE9 A;  3AY9 A;  1RDA A;  5J2Q A;  3THV A;  4AHU A;  1MDU B;  3AA4 A;  4O4G A;  3KLG A;  3HP6 A;  1JLC A;  3A2F A;  3E9P A;  4IFE A;  3SJH A;  2QTD A;  3VQ5 A;  1I94 K;  1RTI A;  4CZI A;  1NK8 A;  5LMN K;  5FLX O;  3NAE A;  3TAE A;  3V4I A;  1XNQ K;  2AJQ A;  4CJL A;  5AQK A;  4JI4 K;  3CCJ N;  3MX5 A;  1H1V A;  5HRR A;  4BRC A;  4CJE A;  1JL2 A;  4CED A;  4UQG A;  4XH4 A;  4BRL A;  4HUE A;  3L4Q A;  5KPZ A;  3VQ8 A;  3S3O A;  1UWB A;  3QO9 A;  4CEQ A;  2IIR A;  3OYE A;  1T7P A;  2PYL A;  2NRH A;  3HK2 A;  4JI8 K;  5CE3 A;  1HYZ A;  5AQQ A;  3PSF A;  4JKA A;  2QKK A;  4KHQ A;  3MEC A;  3HM8 A;  1BG3 A;  3F73 A;  4BQL A;  3WEE B;  3E01 A;  3OJU A;  4M7Y A;  2E5L K;  1DKG D;  1X3N A;  3CCU N;  1Z6R A;  1S1U A;  3V1Q A;  5AQI A;  5CYM A;  2E2N A;  3LP0 A;  5M1K A;  3P38 A;  2KTQ A;  1RGI A;  4BVP A;  1YVU A;  3UKU B;  4Y0W A;  3LDL A;  1VQ4 N;  5JLH A;  3FZL A;  4NXN K;  4RG8 A;  4NYN A;  3KWI A;  3WXL A;  3M1F A;  4ELT A;  3SUN A;  4MDB A;  1VHX A;  1HNI A;  3BZK A;  3TTF A;  4NCA A;  4FWL A;  1N33 K;  4X66 K;  3NGY A;  4O8K A;  3C0B A;  3JSM A;  4RW6 A;  4CGI A;  1BGX T;  3T1A A;  4DTU A;  1C1C A;  1LCU A;  3A5M C;  3KKR A;  1HPZ A;  2IOC A;  3AVK A;  1NGJ A;  1DLO A;  3CET A;  4WE1 A;  2VWK A;  4JI0 K;  3O4N A;  3TWH A;  4YHH K;  2HMI A;  3V1R A;  2Q3S A;  3WXJ A;  4BVO A;  3GG4 A;  4DTS A;  2WTU A;  2GUI A;  3VEW A;  1RT5 A;  4F3O A;  4DR2 K;  4YOR A;  3H1Q A;  3LAM A;  4FJN A;  3U9D A;  4FWO A;  3PIO L;  2RE2 A;  4C1N K;  2KZM A;  3VES A;  1QS4 A;  1LW0 A;  3VGM A;  4DQS A;  2V51 B;  1VQL N;  4FLY A;  2P9L B;  2HHS A;  3MK6 A;  2D0O A;  1IV0 A;  2JWK A;  5AQR A;  3WXK A;  2KHO A;  3TAG A;  3O4Q A;  4JD2 B;  2QWL A;  4M3U A;  4C23 A;  3KWG A;  4CEO A;  2UXC K;  3IKM A;  3ALY A;  4FLT A;  4F2S A;  4GVM A;  4H0V B;  2FF6 A;  2O8F B;  4JI3 K;  3TSP A;  1TAQ A;  1XC3 A;  1WBB A;  5T7B A;  4CIG A;  2XY7 A;  5AQF A;  3PO5 A;  1RDD A;  3DJC A;  4FK2 A;  1VSH A;  2ZF5 O;  4A59 A;  1P8Z A;  4B1V A;  3NBP A;  1TKT A;  3JS6 A;  3VGL A;  3SNN A;  5DMR A;  4QAG A;  4L8R B;  1BIU A;  3AVF A;  3ENB A;  1KLN A;  1BA1 A;  2RN2 A;  3HTV A;  3SPZ A;  3LPT A;  3CJA A;  3LDO A;  1KVC A;  4Q0B A;  3LP1 A;  3L2W A;  1L3S A;  3K9J A;  4NYF A;  1YIT N;  3SQ4 A;  5GAD P;  4B8C A;  1K6Y A;  2E1Z A;  3DOK A;  4BWJ A;  3ZT0 A;  1A5X A;  1N6Q A;  1Q82 O;  2ZGZ A;  4CJW A;  5C12 A;  2XHB A;  1QQM A;  3WNE A;  3CER A;  4DTJ A;  1S6P A;  1U2V A;  1TAU A;  4KAZ A;  3U3G A;  3C6U A;  4CF9 A;  3ULE A;  1XMQ K;  4MLH A;  3D0P A;  4QCL A;  4B1Z A;  1XI1 A;  5I9E B;  4GMJ B;  3QBX A;  1BU6 O;  2E2Q A;  3I56 N;  2I7N A;  3QDK A;  3EKU A;  1J9A A;  4WQ5 A;  4FZZ A;  1RTJ A;  3VPZ A;  1RFQ A;  1BL3 A;  3AAQ A;  3AVM A;  2WON A;  1P90 A;  4B9L A;  4M3Y A;  2OAN A;  2O8E A;  5AQU A;  3HXM A;  4M3W A;  4IKF A;  4RCH A;  3A0I X;  4QOZ B;  3ZET A;  2ZGY A;  1U47 A;  1GLB G;  5M1O A;  2O4I A;  4I9L A;  2I7P A;  3SUQ A;  1RDB A;  3NMU A;  3ATV A;  1TUY A;  3DM2 A;  3J80 O;  3P4I A;  4FM1 A;  5C0Y A;  1ZBU A;  3CIP A;  1Q9X A;  3MN9 A;  1VSE A;  4KHW A;  1JLG A;  3UE5 A;  4IO9 L;  4CD1 A;  1CXQ A;  1NG9 A;  4PWD A;  1HUX A;  2IVN A;  2YKN A;  4BR2 A;  5BR8 K;  2HF4 A;  1QSS A;  3GOI A;  4CZL A;  3H46 O;  3BEX A;  1QHA A;  3T3F A;  3TAB A;  2ITM A;  4FWR A;  2HHU A;  2HMP A;  5KRS A;  1ZBL A;  1JLE A;  1I3A A;  4YOX A;  3VEV A;  3VQD A;  4CI6 A;  1EWR A;  3VF2 A;  1YJ9 N;  3PLA A;  5JS1 A;  4DU1 A;  3CCE N;  1C6V A;  3OY9 A;  3EO3 A;  4FJJ A;  4BR7 A;  2R7Y A;  3BUZ B;  4FJG A;  3AV9 A;  4JKB A;  1S6Q A;  4CHP A;  4GV9 A;  1VSD A;  4AM7 A;  2O8D B;  1DT9 A;  1Y97 A;  5DM7 L;  4CFD A;  5I42 A;  4H0P A;  3IUC A;  3R9P A;  1QVF M;  3O08 A;  3RSE B;  1WSH A;  2X74 A;  4IXC A;  4OLB A;  4JI6 K;  3C65 A;  3TAR A;  3ZT3 A;  2E6M A;  4ICL A;  2UXD K;  4DU3 A;  2HW3 A;  3VF6 A;  4JRP A;  1QQC A;  5HBM A;  3ZX3 A;  3CJ7 A;  1BIS A;  4X64 K;  1U2V B;  3K57 A;  1A5W A;  1KAX A;  3AO4 A;  3IS9 A;  3LDN A;  2OPQ A;  3QNO A;  3GL1 A;  3VEO A;  4A5A A;  1WN7 A;  2KLA A;  2CH6 A;  4DTP A;  3EYZ A;  4Z4E A;  1RDU A;  1NNE A;  3PY8 A;  4BRK A;  2B5J A;  5HRS A;  1L3V A;  1J54 A;  4CZJ A;  3E9L A;  2E1Y A;  4ISE A;  4FXD A;  1W0H A;  5C10 A;  2D0P A;  3GE1 A;  4CJ5 A;  5A2Q O;  2OYQ A;  4CK2 A;  5LJW A;  4RWT A;  4CHQ A;  4E7K A;  4CJK A;  5SWM A;  5DM6 L;  3VTH A;  2YX6 A;  4B1X B;  1KFD A;  2Q0R A;  4AF1 A;  5AZI A;  5D3G A;  2OPS A;  3C7N A;  2HHV A;  1C0T A;  4CHN A;  3HVT A;  4DUZ K;  1Q86 O;  3SYZ A;  3VEN A;  1YAG A;  3IFR A;  3SQ0 A;  1TVR A;  2QI2 A;  3E66 A;  3TSQ A;  3L3V A;  3VA0 A;  4CJ3 A;  4DV1 K;  1LW2 A;  1GLD G;  3J7A P;  4CCH A;  4HTU A;  3F9M A;  4YDU C;  3AVC A;  3ZT1 A;  4AHT A;  4J2A A;  2PYJ A;  3FFI A;  1BCM A;  5M1P A;  1CZB A;  3G0Z A;  4B3R K;  4YOU A;  4KHS A;  1NMD A;  3ZCM A;  3MN5 A;  3SLC A;  3EY1 A;  1FK9 A;  4HUF A;  2NRV A;  4ZTF A;  5AQN A;  1NGF A;  5LMU K;  4C8M A;  1WSF A;  5BRF A;  1JXE A;  4RW7 A;  5HRO A;  3U3Y A;  4DG1 A;  3CQY A;  4JS5 A;  3T7Z A;  1B92 A;  3N4Q A;  4IJA A;  1KFS A;  1O13 A;  4ELV A;  1BA0 A;  3TAQ A;  3NF8 A;  3WEE A;  4U67 L;  1Y64 A;  4JK7 A;  3L4I A;  1VQ9 N;  3MN6 A;  5GIN A;  1WBD A;  2RKI A;  3DLK A;  3EE8 A;  2HBJ A;  4WQ4 C;  3BY5 A;  2UUB K;  4BRH A;  1KTQ A;  1JLQ A;  4LF9 K;  3M3Z A;  4AHS A;  3VQ6 A;  2P5O A;  4DB3 A;  5FRN A;  1ZC6 A;  3M8S A;  3DRS A;  1K8A O;  4O0I A;  3QEI A;  4DQI A;  4Z94 A;  3RMB A;  1TGO A;  3OYH A;  5AZI B;  1OH6 A;  3E1Y A;  4CZH A;  3CQ8 A;  3AA5 X;  4O44 A;  3TTD A;  3DXK A;  2VYP A;  1NMN A;  1WAJ A;  3ZX0 A;  3GDQ A;  4FWN A;  1MWK A;  1KVB A;  4CEF A;  2RPI A;  4AIL C;  3F2K A;  5C42 A;  4ISG A;  3LAN A;  1LWC A;  5M1Q A;  1NBW A;  4BG9 A;  4KB0 A;  1T44 A;  1EP4 A;  4F4K A;  4BRQ A;  1RTD A;  3HPO A;  2ITG A;  2Z1I A;  1NJX A;  3KLE A;  1GLL O;  1JLF A;  1VQ6 N;  3Q7B A;  2Y1J A;  4H0T B;  3U6F A;  1QTM A;  5FPM A;  4FK0 A;  1QHT A;  4FVU A;  2D0C A;  3SUP A;  4FM0 A;  1VSI A;  2G8W A;  1YHQ N;  4HCB A;  2HNZ A;  4LF8 K;  4FWK A;  3MDQ A;  3MX2 A;  4WFN L;  1NM1 A;  1EWQ A;  5KQ8 A;  2NRT A;  5BR9 A;  3H3O B;  3VQ7 A;  4K25 A;  4FVM A;  3T1H K;  5BRH A;  1S1W A;  1LV5 A;  1XUP O;  4DV5 K;  2BTF A;  1EQY A;  4CBU A;  1ASV A;  5EXW A;  3L2R A;  1RDW X;  2P9S A;  3DLL L;  3FZM A;  3KK7 A;  3RMC A;  4M3T A;  1ILY A;  2O8F A;  1HNX K;  3CFO A;  3HBT A;  1FKP A;  1OH5 A;  4LFA K;  2QKB A;  4PKH A;  1LAW A;  5AZJ B;  3ZSY A;  1GLF O;  3OBW A;  5KQD A;  1NK4 A;  3ZSR A;  2I5J A;  3K2P A;  3NH0 A;  3ZSZ A;  3AO2 A;  4KTZ A;  3ZX2 A;  2Z1G A;  2P9L A;  1QZ5 A;  2BE2 A;  1N8R O;  3C6A A;  4IO8 A;  4B9N A;  3V9U A;  2GWJ A;  2UXB K;  3QBW A;  1NOZ A;  3KHY A;  4FWS A;  1IH7 A;  4H5W A;  3OYM A;  3JXU A;  5MLC Q;  1X9M A;  5AFU H;  1GLJ O;  2WFB A;  1HRH A;  1Z25 A;  3AVI A;  2FBY A;  3QIO A;  1GLC G;  4YDU A;  1L3U A;  1EO1 A;  2FF3 B;  4DSE A;  4CFB A;  4Z4C A;  2IVO A;  5ELZ A;  5E41 A;  3V1O A;  2QXF A;  1X1P A;  2P9N B;  1NU0 A;  4DV6 K;  2XRI A;  3O9R A;  1GOC A;  4X62 K;  4CZK A;  1JJ2 M;  4IEI A;  4AHC A;  3UKR B;  1K8K B;  5AZJ A;  5H1S Q;  3OTO K;  1RT6 A;  3I8D A;  1ZBS A;  3O5B A;  4DLE A;  4DLG A;  2QWQ A;  4OPA A;  1ZBF A;  4E1M A;  3V9X A;  2G8V A;  4AQY K;  2P51 A;  2F4V K;  4JI1 K;  4CVN E;  2ZJQ L;  3O9S A;  2QM1 A;  3AVL A;  5IT9 O;  2VWB A;  4JKD A;  1U49 A;  4E3S A;  4FW1 A;  3CQX A;  5SZT A;  3SMS A;  3HZ6 A;  1B9D A;  3ULE B;  4LFB K;  1F21 A;  4CJS A;  2P9I A;  3DYA A;  3ENH A;  3SI6 A;  4J2E A;  3D7E O;  4FLX A;  1L5U A;  3VGK A;  3DXM A;  1SZ2 A;  3VEZ A;  1KQS M;  3L8B A;  5ADX A;  1S22 A;  3QIN A;  4ID5 A;  4E7H A;  3ZT4 A;  4HCC A;  4AHR A;  2KKZ A;  4DTN A;  4Z4F A;  2A42 A;  4CW7 B;  1KCF A;  4H5V A;  3S41 A;  2QK9 A;  1Q18 A;  3ITH A;  3KK1 A;  2XY6 A;  4BE2 A;  1JCF A;  2HHW A;  4BRE A;  1OH8 A;  4LC9 B;  4EFH A;  1U45 A;  3L3U A;  1VSM A;  2A6A A;  1U4B A;  3C6T A;  1DGK N;  1TK0 A;  3LDP A;  2BGG A;  2P1J A;  1RBU A;  2FBX A;  3QEP A;  4ILG B;  3ZLJ A;  1RT7 A;  3V9Z A;  4Q5V A;  3V9S A;  3AVB A;  4FJK A;  2HBK A;  4I6M A;  1ATS A;  1D4X A;  3BZC A;  3VQ9 A;  3KJV A;  1ASU A;  4CJ4 A;  4Z4I A;  3J7Z O;  4JRQ A;  2QA4 N;  3RSE A;  4M63 C;  3CI5 A;  4CJT A;  3SCX A;  2OA8 A;  2Y1I A;  2UUA K;  4CJ7 A;  2QWN A;  1REV A;  4U7B A;  2FLO A;  1IBM K;  4JHD B;  4BRG A;  2D4W A;  2F96 A;  1NK7 A;  3H08 A;  5HOO A;  1JL1 A;  3NF7 A;  4C8O A;  2ASO A;  4OGC A;  3LAK A;  4DCH A;  4V19 S;  3UKR A;  4CGG A;  4IWV A;  4IFY A;  2CGL A;  2QXL A;  1EX4 A;  4NLB A;  4F3T A;  5FDL A;  4HVJ A;  3SJJ A;  4IOA L;  1BUP A;  3TSU A;  4FLV A;  1SL0 A;  3CXC M;  3VF4 A;  2GV9 A;  2YHW A;  2O8B A;  4LF4 K;  4M41 A;  4CEZ A;  3MCA B;  3ID6 A;  3CF5 L;  4PL8 A;  2YV0 X;  4MLE A;  4XEI A;  3VEX A;  2HF3 A;  2KQ2 A;  4B9U A;  3MMV A;  3O3H A;  2OCE A;  3H6E A;  3LM9 A;  2LSN A;  1JXB A;  3EL2 A;  3AO1 A;  2VQF K;  3QFU A;  4AH9 A;  1U6Z A;  4M3Z A;  4B9Q A;  3OS2 A;  2HBL A;  4CEC A;  1SKW A;  1CXU A;  1M90 O;  3A5L C;  3ISN C;  1U04 A;  3TU5 A;  3CG7 A;  2P9U A;  1R59 O;  4JKE A;  4XH5 A;  2IGI A;  2Q1N A;  3ATU A;  2O8B B;  1TK5 A;  4FLU A;  5F2R A;  4JKG A;  4KO0 A;  4B3T K;  4WCE L;  4GV6 A;  2IC3 A;  1NJW A;  4CF1 A;  2Z1J A;  5FPN A;  1SUQ A;  3KZB A;  4JEP A;  3LDQ A;  3O8M A;  3QET A;  1BDG A;  2WUS A;  1JKH A;  4WFA L;  4W5N A;  1LWF A;  4MDA A;  3IMX A;  3VQB A;  1GOA A;  4O0J A;  2PBD A;  1VQ8 N;  1YUW A;  2KZZ A;  3MN7 A;  2O8C B;  2WOM A;  4G1Q A;  4DFJ A;  4A61 A;  4YNQ A;  1CZA N;  2NNW A;  3RWU A;  2W41 A;  5GAE P;  3HI0 A;  5JMV A;  4BY9 C;  3KTQ A;  3AVJ A;  4DR4 K;  1X9S A;  4OKE A;  1UAX A;  3LWM A;  1N34 K;  1K73 O;  3VEY A;  3CC7 N;  3KK2 A;  4CJQ A;  4JK9 A;  3ZSV A;  5AQV A;  1TYQ A;  1DTQ A;  4PHT X;  3O80 A;  4CHY A;  4EP5 A;  5J2N A;  3VQC A;  4GKJ K;  4DWI A;  4OPH A;  1VAZ A;  2HHQ A;  4BR4 A;  3OYA A;  3B6P A;  1NGB A;  3S9H A;  4OKJ A;  5JIC A;  1BI4 A;  4CFA A;  2F9T A;  3DRR A;  3PV8 A;  4B1Y B;  1D9D A;  4B9T A;  3V9W A;  4GV3 A;  2CH5 A;  4BAC A;  3D2F B;  4CBW A;  1N5Y A;  4ILH A;  5ADX H;  1T8E A;  4FWQ A;  1C0F A;  2F7T A;  3G25 A;  3NDK A;  2OTL N;  3DLB A;  1C0M A;  3OHR A;  1I39 A;  4DF4 A;  4JAX A;  4BC5 A;  3QEW A;  3L6Q A;  3DLG A;  2YNG A;  1SQK A;  3THW A;  2YHA A;  3DLR A;  5EU7 A;  5J2P A;  3SZ2 A;  4BRI A;  3C95 A;  2WBN A;  4BRA A;  4FLW A;  3QES A;  4KFB A;  2QWP A;  4K41 A;  4FJ8 A;  1BI4 B;  4BGA A;  1N32 K;  1RBT A;  3M5R A;  3WUH A;  3BDP A;  3P1G A;  1RBV A;  5CZ1 A;  5JVH L;  4BRO A;  3DLE A;  4DTO A;  3I8B A;  3K9K A;  5BN9 A;  3SMP A;  4DQ8 A;  3OYG A;  4C8N A;  3I0R A;  1X9J A;  4DV0 K;  3HO1 A;  4CER A;  2EHG A;  3HOT A;  2QWM A;  4HHT A;  4DTX A;  1XC9 A;  4A57 A;  1BQM A;  2XO7 A;  2EWS A;  4LY7 A;  3HL8 A;  1E3M A;  1Q8I A;  4DSK A;  3KLH A;  3DRP A;  3MED A;  3C6H A;  3T19 A;  4LF6 K;  1UA0 A;  1XNR K;  2VCP A;  3HOS A;  1V4T A;  1WNS A;  4E0D A;  5AQX A;  2NRW A;  2A3Z A;  3G4S N;  1KD1 O;  2DFF A;  3LDS A;  1YJN N;  3DWL A;  1JLA A;  3CM5 A;  2Q2R A;  4DU4 A;  3RMA A;  3IAY A;  3KIO A;  1T3V A;  4DTM A;  1OKJ A;  1VSK A;  3F9K A;  5CHI A;  1B9F A;  4DR6 K;  3LL3 A;  4N41 A;  3TPQ A;  4M7X A;  3EE9 A;  4A62 A;  4C1N I;  1SS6 A;  4PQU A;  3AGK A;  3LPU A;  4JI2 K;  1E4G T;  4CF2 A;  3QEX A;  3WNH A;  4E7I A;  1QE1 A;  1LWE A;  2BH1 A;  3VET A;  1T6C A;  4W5T A;  4JK8 A;  4PKI A;  4KH4 A;  1OH7 A;  1TKZ A;  4K8Z A;  3AAR A;  4FOI A;  2GUP A;  2OPR A;  3FZH A;  4GVE A;  4M42 A;  3WQU A;  2AA4 A;  4CK1 A;  4ISF A;  1U48 A;  3HSC A;  4BDP A;  4GY2 B;  1JCE A;  2HB5 A;  2IAJ A;  3FZK A;  2VG5 A;  3WT0 A;  3A8Y A;  3NCI A;  1HPM A;  3THX A;  1IJJ A;  3MXJ A;  3NGI A;  4DQP A;  4H5N A;  5AJ3 K;  1ZXO A;  4FW2 A;  1TUU A;  3P5J A;  4HTL A;  4E19 A;  2E6L A;  3BGR A;  2VGM A;  4DSF A;  1HQE A;  1YI2 N;  1BO5 O;  4C8K A;  4CZE A;  2QW9 A;  3V81 A;  1SKR A;  3D6R A;  3O3G A;  4KRE A;  3ZT2 A;  2Q31 A;  1KAY A;  1ASW A;  1GLA G;  4CIE A;  4H5T A;  2B6A A;  3AVA A;  2B4J A;  2ZM6 K;  4TSX A;  2BAN A;  2FC0 A;  2GEL A;  3AVH A;  4OKK A;  4PY5 A;  3ZSQ A;  3ZSX A;  4YOV A;  4CIF A;  5EY4 A;  1QSL A;  1RNH A;  4IDH A;  1HNZ K;  3MEE A;  5CZ2 A;  1VQK N;  2YJF A;  3E9O A;  1HYV A;  5AQW A;  4B1W B;  4HWI A;  1J53 A;  5E26 A;  4BDY A;  1NK0 A;  3KK3 A;  4I6M B;  3NF6 A;  3HP9 A;  4DSL A;  2O8D A;  3A5O C;  1VQN N;  4KPY A;  2XY5 A;  4GKK K;  2GBZ A;  4QS8 A;  3WNF A;  3LP2 A;  3NH1 A;  5M1F A;  4DQR A;  5C25 A;  3PX4 A;  2ETJ A;  3DOL A;  4DV2 K;  1X9W A;  3TR8 A;  1CZ9 A;  3SAH A;  3K59 A;  3ULD A;  3OS0 A;  5CY4 A;  3OYK A;  4B9S A;  3QLH A;  3B8A X; 
#chains in the Genus database with same CATH homology
 1YTA A;  2O4G A;  1RT6 A;  4CJW A;  3I8D A;  3DMJ A;  1BHL A;  4I2Q A;  4NCB A;  4DLE A;  2XHB A;  4DLG A;  3WNE A;  1ZBF A;  4E1M A;  4DTJ A;  3V9X A;  1S6P A;  2G8V A;  1TAU A;  4KAZ A;  1EET A;  1R0A A;  4CEA A;  2P51 A;  2YNH A;  3PX0 A;  3U3G A;  1NJY A;  4I7F A;  3C6U A;  5CYQ A;  4CF9 A;  3D0P A;  3AVL A;  4QCL A;  3KLI A;  4CJP A;  4CJF A;  4Z4H A;  2YNF A;  4OVL A;  1XI1 A;  2HND A;  4FJ5 A;  4GMJ B;  1LAV A;  3OYJ A;  4IG3 A;  3AO5 A;  1U49 A;  4DSJ A;  4W5O A;  4E3S A;  2ZQB A;  2HHT A;  1HMV A;  1NKC A;  1C1A A;  3KKS A;  4FW1 A;  5HP1 A;  5SZT A;  4DFK A;  3LWL A;  2IDO A;  1J9A A;  1B9D A;  4Y1C A;  1G15 A;  4FZZ A;  1RTJ A;  1F21 A;  4CJS A;  3DYA A;  3SI6 A;  4J2E A;  3OYI A;  1IG9 A;  4YFU A;  1BL3 A;  2X6S A;  3NFA A;  4FLX A;  1L5U A;  3AVM A;  2WON A;  2OPP A;  4CGF A;  3L8B A;  1S9G A;  3M8R A;  4B9L A;  3QIN A;  4ID5 A;  2P5G A;  4E7H A;  4DS5 A;  3ZT4 A;  4M3Y A;  1C1B A;  4AHR A;  5KTQ A;  4HCC A;  4DTN A;  4CF0 A;  4OPJ A;  2OZM A;  4Z4F A;  3HXM A;  4GW6 A;  4M3W A;  4FZX C;  4IKF A;  1KCF A;  2QK9 A;  3QER A;  2EX3 A;  3ITH A;  3KK1 A;  2XY6 A;  4QOZ B;  3VQQ A;  4BE2 A;  1ZYQ A;  2HHW A;  1A5V A;  4RW8 A;  1U47 A;  4FZY A;  2O4I A;  4I9L A;  1U45 A;  1YT3 A;  3L3U A;  3SUQ A;  1VSM A;  1D9F A;  1HYS A;  1U4B A;  1ITG A;  1RDB A;  3VQA A;  4DFP A;  3C6T A;  3B6O A;  3DM2 A;  1TK0 A;  4LH4 A;  4N76 A;  1KSP A;  2BGG A;  2P1J A;  4FM1 A;  4CJV A;  4FJ7 A;  1RBU A;  2VG7 A;  3VQ4 A;  2FBX A;  3ZSO A;  3QEP A;  2D0B A;  3KD1 E;  1RT7 A;  1TL3 A;  1ZBU A;  4KRF A;  3V9Z A;  3OYF A;  2BDP A;  4Q5V A;  1Q9X A;  2D0A A;  3V9S A;  2G8U A;  1VSE A;  3AVB A;  4FJK A;  1VRU A;  4M3X A;  4KHW A;  1JLG A;  4FJH A;  1IKX A;  3VQ9 A;  3KJV A;  1ASU A;  1NK9 A;  1CXQ A;  4CJ4 A;  2DTU A;  4Z4I A;  4PWD A;  2XY8 A;  2YKN A;  3S3N A;  4B9M A;  4FJM A;  3TAN A;  1QSS A;  4JRQ A;  3HPH A;  3DI6 A;  3OS1 A;  3SCX A;  2YNI A;  4CJT A;  3T3F A;  2Y1I A;  3TAB A;  2OA8 A;  4EZ6 A;  3TI0 A;  2F8T A;  2HHU A;  1REV A;  5HRP A;  3OVN A;  4FJL A;  1XWL A;  5KRS A;  4CHZ A;  1IKY A;  1J5O A;  4RW9 A;  1JLE A;  1ZBL A;  1I3A A;  2F96 A;  1NK7 A;  3H08 A;  3AA2 A;  1JL1 A;  3HPG A;  3NF7 A;  3VQD A;  4C8O A;  4OGC A;  5C24 A;  3LAK A;  3RRG A;  5JS1 A;  4KHU A;  4DU1 A;  4B08 A;  4I9Q A;  1DTT A;  1C6V A;  4CGG A;  4XIU A;  4IFY A;  1XHX A;  5KGW A;  2FBV A;  1EX4 A;  4E1N A;  3OY9 A;  1JLB A;  4DTR A;  4F3T A;  4CJU A;  5FDL A;  4HVJ A;  4CFC A;  3SJJ A;  4FLV A;  4FJJ A;  3VN5 A;  1RTH A;  2JGU A;  1SL0 A;  1RIL A;  2R7Y A;  2DFH A;  5J1E A;  2GV9 A;  3AV9 A;  4FJG A;  3SV4 A;  1MU2 A;  1S6Q A;  2KFZ A;  3K5M A;  4OGE A;  4M41 A;  4CHP A;  2Z1H A;  4CEZ A;  4N56 A;  1VSD A;  1BQN A;  3QNN A;  1D8Y A;  1ZBH A;  5HRN A;  5KGX A;  3HJF A;  4MQ3 A;  1Y97 A;  4E7J A;  1S9E A;  4M3R A;  4CFD A;  2RF2 A;  2YV0 X;  4CGH A;  5I42 A;  2VWJ A;  4AHV A;  1WSH A;  4IFV A;  2KQ2 A;  4B9U A;  2HHX A;  2X74 A;  4OLB A;  1Z26 A;  3O3H A;  4CF8 A;  2G8H A;  2LSN A;  1JXB A;  3ZT3 A;  3TAR A;  2E6M A;  3AO1 A;  4ICL A;  4BWM A;  3L2U A;  4FJI A;  4AH9 A;  3O3F A;  4M3Z A;  3NF9 A;  5K14 A;  4DU3 A;  3OS2 A;  5FRM A;  4CEC A;  3VQE A;  2HW3 A;  4Y1D A;  1SKW A;  1L3T A;  4CEB A;  4FK4 A;  1CXU A;  1QQC A;  2A1S A;  5HBM A;  3NH2 A;  4JRP A;  3ASM A;  3HM9 A;  3ISN C;  1U04 A;  3RR8 A;  3VA3 A;  1BIS A;  1S1X A;  3CG7 A;  3K57 A;  1A5W A;  2A1R A;  3AO4 A;  3IS9 A;  2HVH A;  2IGI A;  1XHZ A;  2OPQ A;  3TAP A;  3QNO A;  1RDC A;  2IS3 A;  3RRH A;  4OJR A;  1WN7 A;  1TK5 A;  4DTP A;  3EYZ A;  1UA1 A;  4Z4E A;  4FLU A;  1RT1 A;  3PY8 A;  1BCO A;  2DY4 A;  4EP4 A;  3D45 A;  2B5J A;  4CEE A;  2D5R A;  4KO0 A;  5HRS A;  1L3V A;  1J54 A;  4IDK A;  2IC3 A;  1NJW A;  4CF1 A;  4FXD A;  2ZD1 A;  2Z1J A;  4KB1 A;  1HQU A;  1SUQ A;  1W0H A;  4B8A B;  4LSN A;  3K5O A;  4DF8 A;  3QET A;  5I3U A;  4CJ5 A;  1WSG A;  1JKH A;  4W5N A;  1LWF A;  4FM2 A;  3VQB A;  1GOA A;  4O0J A;  2ZE2 A;  4LH5 A;  2OYQ A;  2KZZ A;  4CK2 A;  3S3M A;  1GOB A;  3RTV A;  1CLQ A;  1RT3 A;  4CHQ A;  1RT4 A;  4E7K A;  1NKE A;  4F2R A;  4CJK A;  2KW4 A;  3HST B;  5SWM A;  4W5Q A;  1NOY A;  2WOM A;  4LSL A;  4G1Q A;  4DFJ A;  3RMD A;  1KFD A;  1Q9Y A;  3KD5 E;  4YNQ A;  3RWU A;  5D3G A;  3MAQ A;  2NUB A;  4CES A;  4DFM A;  1S1V A;  3G10 A;  3KTQ A;  4DSI A;  1T03 A;  3AVJ A;  1X9S A;  2OPS A;  1TKD A;  4OKE A;  2HHV A;  1C0T A;  1VSJ A;  4CHN A;  1UAX A;  3HVT A;  3LWM A;  3TAF A;  4FLZ A;  3SYZ A;  1QSY A;  3KLF A;  5JS2 A;  3NE6 A;  1NK5 A;  4R5P A;  3SQ0 A;  3PUF A;  1TVR A;  3KK2 A;  2X6N A;  4CJQ A;  3SQ2 A;  3ZSV A;  1NK6 A;  3L3V A;  3VA0 A;  4FJX A;  1DTQ A;  2YHB A;  4CJ3 A;  4OPK A;  4CHY A;  4EP5 A;  1LW2 A;  2JLE A;  3CFR A;  5J2N A;  1SL1 A;  3RR7 A;  4J2D A;  1WLJ A;  3HVR A;  1KRP A;  3VQC A;  4CCH A;  3AVN A;  4B3O A;  2DFE A;  4DWI A;  1KLM A;  4HTU A;  2FBT A;  2HHQ A;  4LD0 A;  3AVC A;  3ZT1 A;  4NCG A;  4O5B A;  3OYA A;  1ZBI A;  3B6P A;  1TL1 A;  3IRX A;  3SV3 A;  3L2Q A;  3S9H A;  1WSE A;  4OKJ A;  4FYD A;  4AHT A;  4J2A A;  4W5R A;  3PX6 A;  1RBS A;  1BI4 A;  2PYJ A;  3FFI A;  1VSL A;  1BCM A;  4CFA A;  1CZB A;  3G0Z A;  3V6D A;  3AA3 A;  3ZSW A;  4KHS A;  1S5J A;  3ZCM A;  2G8K A;  2OZS A;  3DRR A;  3EY1 A;  1FK9 A;  3IG1 A;  3LZI A;  4HUG A;  4HUF A;  3VQP A;  3PV8 A;  4CE9 A;  4ZTF A;  3V9W A;  1D9D A;  4B9T A;  1RDA A;  4BAC A;  5J2Q A;  3THV A;  4AHU A;  4BE0 A;  1N5Y A;  4C8M A;  1WSF A;  1SKS A;  1YTU A;  1WSJ A;  1T8E A;  1JXE A;  3AA4 A;  4O4G A;  3KLG A;  1JLC A;  3HP6 A;  4RW7 A;  3A2F A;  3U3Y A;  5HRO A;  4FCY A;  4DG1 A;  3NDK A;  4OLA A;  3CM6 A;  1FKO A;  5DK5 A;  3DLB A;  1C0M A;  4JS5 A;  1I39 A;  3VQ5 A;  3WNG A;  1RTI A;  4DF4 A;  1NK8 A;  2VG6 A;  1B92 A;  1VSF A;  3QEV A;  3NAE A;  3QEW A;  1TK8 A;  3QIP A;  3LP3 A;  3HYF A;  3TAE A;  3V4I A;  1KFS A;  3DLG A;  2YNG A;  2AJQ A;  4ELV A;  2YHA A;  3DLR A;  5EU7 A;  4CJL A;  2E4L A;  5J2P A;  4E89 A;  3SZ2 A;  3SQ1 A;  3TAQ A;  4RW4 A;  2KFN A;  3NF8 A;  3C95 A;  1RCH A;  5HRR A;  3M8P A;  1JL2 A;  4CJE A;  3LAL A;  4CED A;  4UQG A;  4FLW A;  3QES A;  4KFB A;  2RKI A;  3DLK A;  4HUE A;  4FJ8 A;  1BI4 B;  3K5L A;  3VQ8 A;  1NKB A;  3S3O A;  1UWB A;  3QO9 A;  4CEQ A;  3OYE A;  1T7P A;  2PYL A;  4ZHR A;  1RBT A;  4PUO A;  1VRT A;  3HK2 A;  1W9H A;  1HYZ A;  1KTQ A;  1JLQ A;  1RBR A;  3BDP A;  3P1G A;  1RBV A;  4N47 A;  4KV8 A;  1VK0 A;  1KVA A;  5CZ1 A;  4AHS A;  3VQ6 A;  4ZTJ A;  2QKK A;  4KHQ A;  2P5O A;  3DLE A;  4DQQ A;  3DLH A;  4IG0 A;  3MEC A;  4DTO A;  5FRN A;  3M8S A;  3OYG A;  3DRS A;  4C8N A;  3EZ5 A;  3I0R A;  3JYT A;  5KRT A;  3F73 A;  5HLF A;  3HO1 A;  4CER A;  1UOC A;  2EHG A;  3E01 A;  4O0I A;  3QEI A;  3OJU A;  4DQI A;  4HHT A;  4DTX A;  3RMB A;  1TGO A;  3OYH A;  1XC9 A;  1BQM A;  2XO7 A;  3CQ8 A;  1S1U A;  3AA5 X;  4LY7 A;  3V1Q A;  5FRO A;  3HL8 A;  4O44 A;  4CGJ A;  5CYM A;  4KI6 A;  3LP0 A;  4FJ9 A;  1Q8I A;  2KTQ A;  4DSK A;  3CYM A;  3KLH A;  1WAJ A;  1YVU A;  3DRP A;  3CFP A;  3MED A;  4O55 A;  3T19 A;  1KVB A;  4CEF A;  2RPI A;  1UA0 A;  4AIL C;  5C42 A;  3LAN A;  1WNS A;  1LWC A;  4E0D A;  4RG8 A;  4NYN A;  4B9V A;  4DMN A;  4ELT A;  2W42 A;  4H4O A;  3PO4 A;  1EP4 A;  4F4K A;  4KB0 A;  1RTD A;  3HPO A;  3SUN A;  4J2B A;  2ITG A;  2Z1I A;  2DFF A;  3LDS A;  3OYL A;  1NJX A;  3KLE A;  1JLF A;  1HNI A;  1JLA A;  3CM5 A;  2Y1J A;  4NCA A;  4ID1 A;  4EZ9 A;  3U6F A;  1QTM A;  4FK0 A;  1QHT A;  1HNV A;  4DU4 A;  4Z0U A;  3RMA A;  2D0C A;  3NGY A;  4E7L A;  3IAY A;  3KIO A;  3JSM A;  4RW6 A;  4CGI A;  1BGX T;  1WAF A;  3T1A A;  3HT3 A;  4FM0 A;  4H4M A;  4DTU A;  4DTM A;  1VSI A;  1C1C A;  3SUP A;  2G8W A;  2PZS A;  4KTQ A;  4Z4G A;  1VSK A;  3KKR A;  1HPZ A;  4HCB A;  1NJZ A;  2IOC A;  2HNZ A;  3F9K A;  1B9F A;  4N41 A;  2HNY A;  3AVK A;  3UIQ A;  4KHN A;  4PQU A;  1DLO A;  3LPU A;  4WE1 A;  2ATQ A;  4BE1 A;  1C0U A;  2VWK A;  4CF2 A;  4N5S A;  1HJR A;  3QEX A;  4H8K A;  3WNH A;  4E7I A;  1QE1 A;  1LWE A;  4CK3 A;  3O4N A;  3TWH A;  4W5T A;  4M45 A;  4K8X A;  4KI4 A;  2HMI A;  3VQ7 A;  3V1R A;  1TKZ A;  2Q3S A;  4FVM A;  3NGZ A;  3MXI A;  3AO3 A;  1S1W A;  4K8Z A;  4KTW A;  1IKV A;  2OPR A;  1LV5 A;  4JS4 A;  4M42 A;  4DTS A;  4CK1 A;  1U48 A;  4BDP A;  2GUI A;  1RT5 A;  1ASV A;  4F3O A;  2PY5 A;  2HB5 A;  2IAJ A;  3L2R A;  3LAM A;  4FJN A;  2VG5 A;  3OYN A;  3RMC A;  4M3T A;  2KZM A;  3NCI A;  1QS4 A;  3CFO A;  4F8R A;  1LW0 A;  3OYC A;  3MXJ A;  3NGI A;  1FKP A;  3SPY A;  4DQP A;  2QKB A;  4DQS A;  3C94 A;  4FLY A;  3OJS A;  4DS4 A;  3LZJ A;  1LAW A;  1RT2 A;  2HVI A;  2HHS A;  3ZSY A;  3TAG A;  1IKW A;  3AVG A;  4FW2 A;  1S1T A;  3I0S A;  1NK4 A;  4KKO A;  3O4Q A;  3ZSR A;  2I5J A;  1SV5 A;  3K2P A;  3P5J A;  1EXQ A;  3NH0 A;  4E19 A;  4M3U A;  3ZSZ A;  1TV6 A;  2E6L A;  3AO2 A;  1EKE A;  2YKM A;  4KTZ A;  1SL2 A;  1WSI A;  3BGR A;  4CEO A;  2Z1G A;  3OYD A;  4DSF A;  3L2V A;  1HQE A;  2BE2 A;  2G8F A;  4C8K A;  3ALY A;  4CJR A;  3V81 A;  1SKR A;  4FLT A;  5KI6 A;  4F2S A;  4GVM A;  3O3G A;  4KRE A;  3ZT2 A;  4B9N A;  2G8I A;  3V9U A;  1IO2 A;  3MEG A;  1TAQ A;  3MXM A;  5T7B A;  1ASW A;  4CIG A;  4CIE A;  2F8S A;  2B6A A;  3AVA A;  4IBN A;  2XY7 A;  2B4J A;  1O1W A;  1NOZ A;  1D5A A;  4MFB A;  3K58 A;  3TAM A;  3PO5 A;  1RDD A;  4TSX A;  2BAN A;  2FC0 A;  4FK2 A;  3AVH A;  4OKK A;  4CHO A;  4BDZ A;  1IH7 A;  1VSH A;  3OYM A;  1X9M A;  4PY5 A;  4JLH A;  3ZSQ A;  3ZSX A;  3NBP A;  2X78 A;  1TKT A;  4CIF A;  1FXX A;  1QSL A;  1RNH A;  3SNN A;  1HRH A;  5DMR A;  3MEE A;  4ELU A;  1Z25 A;  4PA1 A;  3M8Q A;  5CZ2 A;  4I2P A;  4QAG A;  1HYV A;  4L8R B;  3AVI A;  1BIU A;  3AVF A;  1KLN A;  2FBY A;  1J53 A;  2RN2 A;  3QIO A;  3SPZ A;  3K5N A;  4BDY A;  3LPT A;  1L3U A;  1NK0 A;  3KK3 A;  3NF6 A;  3HP9 A;  3NHG A;  1BIZ A;  4DSL A;  1KVC A;  4Q0B A;  4DSE A;  3LP1 A;  3P83 D;  4CFB A;  3L2W A;  4Z4C A;  3OYB A;  4KPY A;  2XY5 A;  4KHY A;  3SUO A;  2GBZ A;  1L3S A;  5E41 A;  3WNF A;  3V1O A;  2QXF A;  1X1P A;  4NYF A;  3LP2 A;  4C8L A;  3NH1 A;  4DQR A;  5C25 A;  3PX4 A;  2XRI A;  2ETJ A;  1T05 A;  3DOL A;  3SQ4 A;  1X9W A;  1GOC A;  1TKX A;  3TR8 A;  4CGD A;  1CZ9 A;  3K59 A;  3ULD A;  4B8C A;  3OS0 A;  4AHC A;  1K6Y A;  3DOK A;  5J2M A;  5CY4 A;  4BWJ A;  3OYK A;  3ZT0 A;  1A5X A;  4B9S A;  1N6Q A;  3QLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...