4CFBA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cfbA00
3ZT4A 3NGZA 4KHYA 1NK9A 1SKRA 4L8RB 1B9FA 4Q0BA 4JLHA 3SJJA 4BE1A 1U4BA 2YKMA 2XO7A 2P1JA 2G8UA 3DLKA 4BDPA 2AJQA 1ASUA 1NOYA 4CJRA 3CFRA 4C8MA 4O44A 3I0SA 1DTQA 4RW9A 2LSNA 2X74A 4CF8A 3NDKA 3BDPA 1RDDA 4M41A 1RTDA 1SUQA 3SQ0A 4KPYA 1EETA 4DQRA 3RMAA 1UWBA 3I0RA 3KLEA 3KK2A 4CJSA 2VG6A 3DLBA 4KAZA 4FJGA 1VSEA 3DMJA 2G8FA 3HK2A 4DQIA 5CYMA 3JYTA 3ALYA 3G0ZA 4CJWA 2ZE2A 4E1NA 4FJKA 3DLHA 2QK9A 4FZYA 2IC3A 2X78A 4GVMA 3V81A 2XY5A 3KK3A 5J2PA 3MXIA 1LAVA 3AO4A 2KZMA 4ICLA 1YVUA 3MXJA 3VQBA 4B8AB 3OS0A 3RMBA 4FW1A 4ELTA 3OYJA 3VQ9A 3SUNA 3TAFA 3AVKA 1X9MA 4QCLA 4ZTJA 3AV9A 2G8KA 2I5JA 4O0IA 2X6NA 1SKWA 2HHQA 2D0CA 2ATQA 5HBMA 1TK5A 2F8TA 1NJXA 3OYHA 2BE2A 4FK0A 1IKXA 4ELVA 5DK5A 2OZSA 2HVHA 2KZZA 1SL1A 4BWMA 3VQ4A 2YNGA 3HJFA 3OYKA 1HPZA 2Z1GA 3TARA 3LAMA 4CHQA 4H4MA 1WSJA 3K5MA 1J54A 4OPJA 1RDBA 4HHTA 4B9SA 3S3OA 1BIUA 3DLEA 4IKFA 1LWFA 1RILA 3VQ5A 2OZMA 2HB5A 3NF6A 3SQ4A 1IH7A 3ZT0A 3RTVA 3IS9A 1SL0A 4FJHA 4C8OA 3PUFA 2HW3A 2XY6A 1XHXA 4FJ5A 4DLEA 2KFZA 1ASWA 2YKNA 3U6FA 1IG9A 2PY5A 4BACA 1WSFA 1A5VA 3KTQA 4CEBA 4Z4IA 1BIZA 1WLJA 4O0JA 4M3ZA 4AHSA 4FYDA 1HYVA 3RRGA 3AVNA 4OJRA 3LP1A 1KFSA 2OPRA 3U3GA 3AVFA 5D3GA 3TAMA 2O4IA 4FJLA 1NK7A 1U49A 4N76A 3DRSA 1LWCA 4OKEA 1WNSA 4N5SA 4KI4A 1TGOA 4Z4CA 1UA0A 1RTIA 2BGGA 1XWLA 1CXQA 4CJKA 1WSIA 1YT3A 4E7JA 3L3VA 3V9SA 3HVTA 4HVJA 4E7IA 4Z4FA 2IS3A 1HNVA 3ITHA 3LPTA 5FDLA 4CEOA 4KREA 4B9VA 2QKKA 4ZHRA 3SUOA 3TANA 5K14A 4E3SA 3KIOA 2FC0A 3SCXA 4CJ4A 3PX6A 1Q9YA 3AVCA 3LP3A 4B9UA 3SQ2A 4AH9A 3CM5A 2P5OA 4F3TA 3AA2A 3PO4A 1NK8A 3ZSZA 1EKEA 3ZT3A 4CGIA 4DFMA 2R7YA 3RMCA 3VQPA 4KB1A 4FJ9A 4HUFA 2BANA 3LP2A 3NF8A 1D8YA 4W5TA 2IAJA 3QEIA 4J2EA 2DFHA 1VSMA 4G1QA 3SZ2A 1RTJA 1JLCA 4F4KA 4KTZA 3RR8A 2IOCA 3ZSRA 3HPOA 2JLEA 2G8VA 4RG8A 5I3UA 1NK5A 1EP4A 4M3WA 1C0TA 4E19A 3OYAA 2PZSA 4MFBA 3VN5A 4CJUA 3L2QA 4EP4A 1VSDA 1D9FA 3PO5A 5C42A 3SYZA 3LP0A 1JL2A 4ID5A 2ZQBA 4K8XA 2XRIA 4DTSA 1TKXA 4OKJA 4DQQA 1EX4A 2Y1IA 4CIFA 3OYNA 3F9KA 4EZ9A 4CFCA 3AO3A 3LALA 4Z4GA 4LH5A 1FXXA 1TL1A 3MEEA 3T19A 4AHCA 4FK4A 3JSMA 3AVJA 3VQ6A 4CERA 3KD1E 3SV3A 3HVRA 1U47A 4E1MA 3S3MA 1C1BA 2GBZA 5FROA 5FRNA 2XY8A 3KKRA 3TWHA 1J9AA 1UA1A 1DLOA 3HP6A 4FJJA 4OGCA 5E41A 1SV5A 3B6OA 3QEVA 2FBXA 1NK0A 3AVIA 4DLGA 4DSEA 4FLVA 3OYMA 3OYIA 3PX4A 2HNYA 3OS1A 3QETA 4CJTA 4I9LA 3HPGA 1U45A 1DTTA 2G8IA 2PYJA 4YNQA 4CK2A 3DRRA 1NKBA 2HNZA 1MU2A 2KW4A 1T8EA 4N47A 3CM6A 2HMIA 4FJ8A 1RT7A 3NH0A 3OVNA 3ZSXA 1N6QA 4Y1DA 2OPSA 1I3AA 1L3VA 5KGXA 4DWIA 4IG0A 1R0AA 1RT1A 4CIEA 1J5OA 2OA8A 2RN2A 3LANA 3O3GA 3OY9A 1QS4A 4M42A 4FZZA 4CJQA 3HT3A 1RDCA 2WONA 1C0MA 3SPZA 3KKSA 4W5QA 1ZBIA 1VSIA 3AA4A 1FK9A 1NJZA 5FRMA 1FKOA 4OLBA 1S1TA 4FLYA 4M3YA 1JL1A 4M45A 3K57A 4OGEA 3LZIA 1BGXT 3KLGA 4HUEA 4FLZA 2Z1JA 1ITGA 4CEAA 1WSEA 4FK2A 3L2WA 3K5LA 2E6LA 3CYMA 1RT4A 3OJUA 2EHGA 1L5UA 3NAEA 3ZSQA 1WSGA 4NYFA 1VSJA 1ZBUA 2E6MA 1JLQA 4CJVA 4KB0A 4GMJB 3ZCMA 4H8KA 1T7PA 1QQCA 1HQUA 1BCMA 1U04A 4FW2A 3HO1A 1BL3A 3AA5X 4CK3A 4PWDA 4I7FA 1RBSA 4DSLA 4DFPA 1TAUA 4IG3A 4B9MA 3H08A 3HYFA 4B9LA 4CEQA 3M8PA 4F3OA 2ETJA 3L2UA 4UQGA 4CEZA 2YNFA 3IRXA 4RW8A 5DMRA 1X9WA 3KD5E 2HVIA 3V9ZA 5HRNA 3LAKA 3QEWA 1IKWA 4Y1CA 1XC9A 1S9GA 1VSLA 3VQ7A 4LSNA 4Z4EA 2EX3A 2VWJA 4O55A 1RCHA 3L3UA 1QE1A 3MAQA 1JLGA 4FM2A 3K5NA 1BHLA 1WAJA 4GW6A 1A5WA 4H4OA 1S6QA 4N56A 4EZ6A 3NF9A 2D5RA 4JS5A 3VA3A 4DTRA 2Q3SA 3TABA 4DF8A 4LD0A 3NH2A 1QSLA 2YNHA 3NCIA 1I39A 3WNFA 2RPIA 4DSJA 4M3TA 2HHSA 4PA1A 3KJVA 1QHTA 2B5JA 3M8RA 2ITGA 2JGUA 3AA3A 3L2RA 3K2PA 3NGYA 5KI6A 2D0AA 4JS4A 1GOBA 1VSKA 1C1AA 3O3HA 4QOZB 4DU3A 3OYBA 4FXDA 3V1QA 5JS2A 1S9EA 3OJSA 3WNHA 3OYGA 4QAGA 4RW4A 3OYDA 3WNEA 1G15A 3PY8A 1S1VA 1W0HA 3P1GA 4DSIA 4RW7A 4DU4A 4FVMA 3ZSVA 2ZD1A 1IKVA 5KRSA 3QEXA 3V6DA 3QEPA 4KHWA 4ZTFA 2FBYA 2QXFA 4AHRA 4CCHA 1KVAA 1RTHA 1JKHA 1U48A 4B8CA 1HYSA 3O4QA 4CEEA 3ZSWA 2KFNA 4DG1A 2GV9A 3SV4A 2GUIA 1TVRA 1S1WA 2HHVA 1B92A 4CF2A 1Z25A 4OLAA 1RNHA 3QNNA 3NHGA 4J2DA 4KFBA 4KHNA 4DTPA 5CYQA 4C8NA 1RBVA 1KLNA 1O1WA 3RWUA 3HP9A 4ELUA 3KLHA 2FBVA 2OPPA 1TKTA 4XIUA 4FJIA 3DRPA 1WSHA 3B6PA 3HXMA 1RT2A 3EZ5A 2YV0X 4M3RA 1LAWA 5J2QA 3TAQA 1NK4A 3PV8A 1KRPA 1HMVA 1L3UA 1S1UA 3QINA 4CFAA 4WE1A 4KV8A 2YNIA 4IFYA 4NCGA 5CZ2A 3V1OA 5HROA 4KRFA 3WNGA 1NKCA 4KHSA 3DM2A 2DFFA 2HHWA 2Z1HA 4KHUA 2XY7A 3D45A 2VWKA 5SWMA 2KQ2A 4DFKA 4Q5VA 2RF2A 1HNIA 4CGGA 1T05A 3ZT1A 4O5BA 4CF9A 4DSFA 1TK8A 3V1RA 1GOAA 4J2BA 2BDPA 1XHZA 5SZTA 2KTQA 1VSHA 2QKBA 4CJEA 1RBTA 1NK6A 1BCOA 1JXEA 2F96A 3HL8A 4B9TA 3QLHA 4CHZA 3C95A 1S5JA 1VSFA 1CXUA 4CF0A 1X1PA 4PUOA 2IDOA 4AHTA 4BWJA 3VQ8A 4W5OA 3S9HA 4KO0A 5KRTA 4JRQA 3QO9A 2NUBA 4I9QA 3V9UA 3TAEA 4CGDA 2B6AA 4O4GA 3C6TA 2DY4A 4E0DA 1HYZA 2G8HA 1KLMA 4DQSA 4TSXA 1VRTA 5HRPA 1KSPA 1BI4A 3P83D 3DOKA 4BDZA 4LY7A 3MEDA 1RT5A 3AVGA 4CGFA 3LWLA 4CHPA 2P51A 4DF4A 3SUQA 4HCCA 4YFUA 1KTQA 3NBPA 1CZBA 3TAGA 1SL2A 1S1XA 3AO2A 4BE0A 1HJRA 3CG7A 4CJLA 4OKKA 4CEFA 4DFJA 4AILC 2PYLA 5J1EA 4PQUA 4CGHA 4FM1A 1HQEA 1KCFA 4CK1A 3LPUA 2Y1JA 3A2FA 4AHVA 1T03A 1B9DA 1CLQA 3AVLA 4E7LA 4R5PA 2Z1IA 3K59A 4FJMA 1ASVA 3OYLA 1GOCA 3KK1A 4DTNA 4LH4A 2E4LA 5KTQA 3U3YA 3S3NA 1RT3A 1LW2A 1NJWA 2W42A 4MQ3A 4ID1A 2F8SA 3VQDA 3OYEA 4LSLA 3BGRA 4DTMA 2YHAA 1JLBA 1VK0A 1A5XA 1JXBA 1Z26A 1KVCA 2D0BA 5CZ1A 4BE2A 1NJYA 1K6YA 2O4GA 4DU1A 3C94A 4HCBA 4Z0UA 3AO5A 3L8BA 2A1SA 3AO1A 3E01A 1QSSA 1VRUA 4DQPA 4B3OA 2FBTA 3NE6A 3DOLA 2XHBA 1LW0A 1D9DA 3SPYA 5J2NA 2YHBA 4CJ3A 3OS2A 3DI6A 1RDAA 3G10A 3K5OA 3QESA 4KI6A 4KTQA 3V4IA 3TAPA 1QTMA 4CJ5A 1JLEA 3QIPA 3THVA 3CQ8A 2OPQA 3FFIA 1ZBHA 3DLGA 2X6SA 5JS1A 1WAFA 4OVLA 4CESA 4DTJA 1WN7A 4CJPA 3LZJA 1X9SA 3HPHA 3LDSA 3V9XA 1IO2A 4FM0A 1KVBA 4FLTA 4KTWA 4Z4HA 1BISA 3T3FA 3VQEA 3MEGA 1LWEA 2HHXA 3OYFA 4CHYA 2RKIA 1Q9XA 5HLFA 5CY4A 1TK0A 1F21A 3IG1A 4RW6A 1ZYQA 4FJ7A 4DTUA 1C1CA 5KGWA 1TV6A 1SKSA 1JLFA 3C6UA 1IKYA 3M8SA 1NOZA 5HP1A 3AVMA 3O4NA 1BQMA 3HSTB 3VQAA 3HM9A 3D0PA 1UOCA 4IBNA 4DTOA 3SQ1A 1S6PA 4HUGA 3V9WA 4CEDA 2G8WA 4C8LA 4PY5A 4I2PA 1Y97A 4KHQA 2IGIA 3ASMA 3NGIA 1Q8IA 1C0UA 4DS4A 3T1AA 4CHOA 3EY1A 4DMNA 3ULDA 2DTUA 4K8ZA 5HRRA 4EP5A 3OYCA 3DLRA 4FZXC 2VG7A 3AVHA 3QERA 1RT6A 4BDYA 3MXMA 1HRHA 1C6VA 4FLWA 4W5NA 3K58A 4N41A 3TR8A 3RMDA 3CFOA 4E89A 3F73A 1UAXA 2A1RA 3SUPA 1XI1A 2HHTA 3ZT2A 4JRPA 4I2QA 1TAQA 4CECA 4IDKA 4DTXA 3KLIA 4FCYA 4B08A 3EYZA 3SNNA 1YTUA 1TKDA 3L2VA 4CGJA 5J2MA 3TI0A 5I42A 3NF7A 3VQQA 4FJNA 4NCBA 3VQCA 4E7KA 4FJXA 2OYQA 3QIOA 4FLXA 2P5GA 1JLAA 2DFEA 3NFAA 3ZSOA 4OPKA 4CHNA 1BQNA 4CFDA 4E7HA 4CF1A 5C25A 4DS5A 3IAYA 4F8RA 1RBUA 3PX0A 1EXQA 1BI4B 2HNDA 1D5AA 4NYNA 1REVA 3M8QA 4HTUA 3AVAA 5EU7A 1RBRA 2WOMA 3MECA 3LWMA 3QNOA 1LV5A 1TL3A 1CZ9A 3VA0A 1ZBLA 1QSYA 4J2AA 1FKPA 1J53A 4F2SA 3ISNC 4M3UA 4NCAA 3NH1A 2B4JA 3O3FA 3I8DA 1NKEA 2VG5A 4B9NA 4M3XA 2HHUA 4CJFA 5C24A 3UIQA 4C8KA 5HRSA 3CFPA 1L3SA 3P5JA 4F2RA 5T7BA 4FLUA 3SI6A 4CE9A 3RRHA 4W5RA 4IFVA 1W9HA 4AHUA 1L3TA 4CFBA 1KFDA 3RR7A 1ZBFA 1YTAA 3ZSYA 4DSKA 4KKOA 4CIGA 3AVBA 1TKZA 3DYAA 1N5YA 3KLFA
chains in the Genus database with same CATH superfamily
3ZT4A 4RCHA 4L8RB 4Q0BA 3SJJA 4H5NA 4BRQA 4NB4A 2XO7A 2P1JA 2G8UA 3DLKA 1U6ZA 4CZGA 4CJRA 3CFRA 4C8MA 4O44A 3ZX3A 4DUYK 4KPYA 2VYPA 2VG6A 4FJGA 4K41A 2G8FA 1E4GT 1G99A 3T69A 3ALYA 3G0ZA 4CJWA 5M1KA 4JI6K 2QK9A 4FZYA 4GNIA 4QS7A 4YY3K 3CPWM 2KZMA 1LAVA 4ICLA 3SUNA 4WQ5A 3ZETB 3O8MA 2G8KA 5AQIA 2ATQA 2BE2A 2P9SB 4FK0A 4ELVA 5DK5A 2QXLA 3MWPA 2KZZA 2YNGA 3OYKA 1VQON 1HNZK 2Z1GA 3LAMA 5KPZA 3JS6A 1RDBA 4B9SA 3VQ5A 1NJIO 1TUUA 3RTVA 4C8OA 3M3ZA 2P9KA 3OHRA 4MLEA 4PKHA 2XY6A 4FJ5A 1ASWA 3TPQA 4LF5K 1ATSA 1NGDA 3U6FA 1WSFA 1A5VA 2P9UA 3F9MA 2ZWHA 4DV7K 4Z4IA 3FR0A 4M3ZA 2FLOA 3B8AX 4B3MK 1NGBA 1YXQA 2ASMA 1KFSA 1GLJO 4XEIA 3TAMA 5LJVA 3VGLA 1NK7A 2O8BA 2H3GX 4N76A 1JCEA 4Z4CA 1IJJA 2BGGA 1WSIA 4HVJA 5FDLA 2QWOA 4UY8O 1Q18A 2E2NA 4QS9A 3SCXA 4CJ4A 1Q9YA 4B9UA 3LP3A 3SQ2A 3MMVA 2OTJN 1YHQN 1WUAA 1TYQB 3L6QA 3J81O 1NK8A 2VQFK 3RMCA 1IV0A 4HUFA 1VQ6N 3NF8A 5KPTA 3QEIA 1VSMA 1E3MA 1QVGM 1YITN 1QZ6A 2CGKA 3ZSRA 5FLXO 4AF1A 2G8VA 5I3UA 1NK5A 2V7YA 5ADXH 3FE1A 1D9FA 1VSDA 3PO5A 4ID5A 4DTSA 2O8DB 2Y1IA 5EY4A 3F9KA 3FZMA 4IEEA 1T6DA 4AHCA 3JSMA 3THWB 4CERA 1Q81O 5FRNA 2XY8A 1J9AA 3B6OA 4O8KA 3QEVA 1NK0A 3C7NA 5KQDA 2QWLA 3QETA 4I9LA 3HPGA 3ULEB 3VEXA 1ATNA 1NKBA 3Q7BA 3O6WA 3CM6A 3ULEA 4GKKK 1RT7A 3NVMA 3ZSXA 1I3AA 1L3VA 3RSEA 4DWIA 4JKCA 1JCGA 4CIEA 4JKGB 2NLXA 5BR9A 3MN9A 1YJWN 4M42A 3CIPA 1IG8A 5ADXA 1N36K 4IJNA 1K8AO 4H5RA 1VSIA 1EWRA 1FK9A 5FRMA 1FKOA 2IVNA 4OLBA 5EOYA 1GLLO 4FLYA 4M45A 1BA1A 3NVKA 1OVQA 5AQFA 1RT4A 3CQYA 3D2EA 1WSGA 3CCSN 2YJEA 1T7PA 3U9DA 3VEWA 4FW2A 3CC4N 1BL3A 3AA5X 4DSLA 1GLCG 5AQUA 1GLFO 4DFPA 4FOIA 3H1VX 4IG3A 3CCEN 4B9LA 3HYFA 4X65K 4CEQA 3QBXA 3CHWA 3M8PA 4AM7A 3L2UA 4A61A 3AAPA 4RW8A 2Q36A 3I8BA 3KD5E 1KXPA 3LAKA 3QEWA 3D6RA 2UUCK 4Z4EA 4JI8K 1RGIA 4FM2A 2FSKA 4H4OA 1S6QA 3VA3A 4LD0A 3EKSA 5LJWA 1H1VA 1QSLA 1I39A 4FWOA 4B1VA 3KJVA 3N4QA 4BRIA 2HMPA 3NGYA 2D0AA 4JS4A 4QOZB 4DQ8A 2D4WA 5AZJA 3I55N 5LMUK 5JS2A 1S9EA 3OYGA 1VQ5N 1OKJA 4CZIA 3P1GA 4DSIA 1IKVA 3V6DA 4JKHA 3QEPA 2QXFA 1QQMA 4B3SK 3CJ1A 3O4QA 3ZSWA 2E2OA 3CXCM 2VQEK 4C8NA 4BRCA 1KLNA 5AZIB 4JKBA 3B6PA 4FWPA 1S72N 1RT2A 1VQMN 3TAQA 5AQRA 3O80A 4CZJA 1L3UA 3QINA 4B1WB 4IFYA 4C23A 2HHWA 2Q97A 4BC5A 2XY7A 1FW6A 4BRNA 3D45A 5SWMA 4DFKA 4Q5VA 4JNEA 2BDPA 2A41A 5SZTA 2KTQA 5FPNA 1LOTB 2E88A 3J8AA 5C10A 1BCOA 2YHWA 4B9TA 3M6GA 4PUOA 1CXUA 4CF0A 3VQ8A 3S9HA 2P9LB 1V4SA 5TKWA 4CGDA 2A6AA 3THYB 3CPEA 1VRTA 1NLVA 1OVYA 3R1XA 5M1PA 4LC9B 5AJ3K 4CHPA 2P51A 3SUQA 4CJ7A 1CZBA 3DWLA 4KBOA 3TAGA 1S1XA 1HJRA 4OKKA 4CEFA 4DFJA 4PQUA 3A5LC 4BVOA 3LPUA 3A2FA 4AHVA 3K59A 3T1HK 5KPRA 3U3YA 1NJWA 1K8KA 4C1NK 3TTCA 3D2FB 3OYEA 2ZJQL 4JI1K 1NU0A 1A5XA 4BE2A 2V51B 1K6YA 1ZBSA 2O4GA 2UXBK 3AO5A 3L8BA 3AO1A 3E01A 3O1BA 1LW0A 3OS2A 3DI6A 4KI6A 3K5OA 1V4TA 1QTMA 1JLEA 4MDAA 2F4VK 3E9OA 3THVA 5TKYA 3DLGA 1WAFA 1X9SA 3HPHA 3LDSA 3V9XA 4FSVA 3T3FA 1LWEA 4CHYA 2RKIA 3CF5L 1Q9XA 1F21A 1TUYA 4RW6A 2BUPA 5KGWA 5GINA 3CCMN 1TV6A 1SKSA 1SAZA 1XUPO 3G71N 3AVMA 3HM9A 3SQ1A 3V9WA 5BRFA 4CEDA 4I2PA 5GADP 3T1AA 4DMNA 4FPBA 4K8ZA 3W0LA 4DR6K 2ZGYA 3KWIA 3QERA 4BDYA 2VGNA 4MO4A 2O8EA 3WEEB 3K58A 4ILJA 3TR8A 2QWQA 3F73A 1UAXA 3C0BA 1HLUA 1TAQA 4DTXA 3KLIA 1VQ8N 1TKDA 4YORA 1YTUA 3CJ7A 4H5TA 2YCHA 3VQCA 4E7KA 3QIOA 2PBDA 4A59A 5EXWA 4WYBA 3FZFA 1VQ9N 1REVA 5EU7A 3MECA 3LWMA 5AQVA 3AGKA 2Q31A 3VA0A 1J6ZA 1J53A 4BR7A 2ASOA 4NCAA 3VF6A 4M3XA 2VG5A 3T7ZA 4CJFA 5C24A 5HRSA 3P5JA 4OO1J 4IJAA 3SBGA 4F2RA 5T7BA 5M1NA 2NNWA 4W5RA 1MA9B 3FZKA 4IFVA 1L3TA 1KFDA 3CJCA 3EE9A 4XH1A 1NK9A 4JLHA 3G6EN 4BE1A 4BRLA 2AJQA 3SBTA 2A40A 1DTQA 1NWKA 2LSNA 1RDDA 4M41A 1EETA 3I0RA 3KLEA 4CJSA 3HK2A 4KAZA 3DMJA 4DQIA 5CYMA 3JYTA 4E1NA 3DLHA 5FPEA 2IC3A 2X78A 3V81A 2XY5A 3CETA 3AO4A 3OS0A 1YVUA 4B8AB 3SMPA 2NRXA 1ILYA 3VQ9A 1X9MA 1BDGA 1QVFM 2I5JA 2WTUA 5HL7L 3WXIA 2NZTA 2X6NA 4V19S 1TK5A 2F8TA 3K9JA 4RTFD 1IKXA 2HVHA 3HJFA 1DT9A 2KLAA 4BC3A 1SQKA 3QBWA 4H4MA 1Q86O 3S3OA 2FSNA 3F5TA 1BIUA 2P9SA 4JKGA 3NF6A 4YHHK 3SQ4A 3EE8A 2QM1A 1YI2N 1XHXA 4DLEA 2KFZA 2YKNA 1IG9A 4BACA 1WLJA 5AQMA 3BP8A 3LDNA 2E5LK 3LP1A 1QZ5A 3CCUN 3U3GA 5D3GA 3MN5A 4FJLA 1IBLK 3DRSA 5M1QA 4HTLA 5EX5A 4CJKA 1YT3A 4E7JA 4Z4FA 3V9SA 3HVTA 4E7IA 4CEOA 1N33K 4KREA 4ZHRA 3TANA 1VQPN 3NMUA 2GUPA 4DFMA 3ZT3A 1J5EK 2R7YA 4KB1A 2BANA 3LP2A 1D8YA 3GBTA 4J2EA 1RTJA 4F4KA 4KTZA 5LMNK 4GY2B 2ASPA 4BRAA 3R3LA 4BR9A 3W3DA 4E19A 3FZHA 5JVGL 4CJUA 3SYZA 3LP0A 2GX9A 4H0YB 4H0TB 4CIFA 1VQ7N 4EZ9A 2UXDK 2GEMA 4Z4GA 3DXMB 1FXXA 3MEEA 3T19A 4JAXA 3VQ6A 3HVRA 4E1MA 4H5VA 1C0FA 3KKRA 1KQSM 4FWRA 4FJJA 4OGCA 1SV5A 2O8EB 3AVIA 4DLGA 3OYMA 2HNYA 1CZAN 4CJTA 3U4LA 4JD2A 2KW4A 1T3VA 4N47A 2A42A 3O5BA 3GE1A 1K73O 3EKUA 3NH0A 2JWKA 2OPSA 5KGXA 4WFNL 4LFBK 3CCRN 5AQJA 4IEIA 5DM7L 3O3GA 3OY9A 2YI1A 3RSEB 4FZZA 4IXCA 4CJQA 3KKSA 4W5QA 1ZBIA 5BRDA 3OBYA 2GELA 4M3YA 1JL1A 4CVNE 3WQTA 1BGXT 3O9SA 4EAHD 3C7NB 2FF6A 2EHGA 3AAQA 4NYFA 1JLQA 4YDUA 1HQUA 1VQ4N 1U04A 1P8ZA 3THWA 5CE3A 4CK3A 3HRGA 4JI5K 1TAUA 4B9MA 1NGHA 2ETJA 1NGCA 4CI6A 4CEZA 2HVIA 1X9WA 4GV6A 3WEEA 4CD3A 1IKWA 4Y1CA 4YDUC 1XC9A 4EFHA 4RWTA 3VQ7A 1X3MA 3L3UA 4LF6K 3A8YA 3BF3A 2UYTA 5BPLA 3EZWA 3BZCA 1BHLA 1WAJA 2I7PA 3KZBA 1YIJN 5JMVA 3OA9A 2PAVA 1NBWA 3U9ZA 4ILGB 2Q3SA 3TABA 5E84A 3KWGA 2YNHA 3NCIA 2HHSA 2RPIA 4PA1A 5GAGP 1WBDA 2B5JA 2ITGA 1YF5L 3AA3A 3BUZB 1M1KO 5KI6A 1GOBA 1VSKA 2UUBK 3OYBA 4FXDA 1E4FT 3V1QA 1I94K 1EWQA 1KD1O 3OJSA 4QAGA 1G15A 1VQKN 3LM2A 3PY8A 4IFEA 5CHIA 2NRTA 4KH4A 4DU4A 3ZSVA 4FL9A 4ZTFA 3BF1A 1KVAA 1JKHA 4B8CA 2QWPA 4CW7B 4DV4K 2E8AA 4AM6A 4JI2K 4FOEA 1DGKN 1Q7YO 1RDUA 4KHNA 2QTDA 5CYQA 5AQWA 3KLHA 2FBVA 2OPPA 4BR4A 4XIUA 1K8KB 5BPNA 3QDKA 4B1YB 3HXMA 3MX5A 4M3RA 5J2QA 2V7ZA 1NK4A 4FPAA 4IOXA 4WE1A 4KV8A 4NCGA 3ATUA 3V1OA 3QMLA 3DM2A 2DFFA 4KHUA 2KQ2A 2P9IB 2OTLN 2RF2A 2E2PA 4KHPK 4O5BA 4CF9A 4A5BA 4DSFA 2QWNA 3AY9A 2W40A 1XHZA 5AQQA 3PSIA 3ENBA 3T1YK 2QKBA 1RBTA 1HUXA 1JJ2M 1O13A 5BREA 3CD6N 1X1PA 2IDOA 4BWJA 3A0IX 3MWTA 2NUBA 3TAEA 2B6AA 2DY4A 4I6MA 5BR8K 5HRPA 5LY3A 1BI4A 4BDZA 3A5MC 4LY7A 5EVZA 1RT5A 3AVGA 4CGFA 4DF4A 4YFUA 1KTQA 2ZF5O 2FSJA 1NGIA 1SL2A 5AQSA 2PYLA 3VESA 1Z05A 3VTIA 1CLQA 2UUAK 4E7LA 4R5PA 2Z1IA 4ISFA 2NRZA 3E9PA 1GOCA 3KK1A 3R8EA 4DTNA 4DHYA 1BWFO 3TU5A 4M7YA 5AZIA 4BQLA 2D0OA 3VQDA 1VK0A 1Y64A 1Z26A 2D0BA 3GDQA 4R79A 5I9EB 4E1JA 4HCBA 4KH5A 4B3OA 1VRUA 4X66K 3DOLA 1HKBA 1D9DA 3QESA 3V4IA 4DR1K 4YOYA 2OPQA 1ZBHA 4OVLA 4CESA 4CJPA 3AARA 4H0OA 4FLTA 4KTWA 2W6LA 4Z4HA 1BISA 1X9JA 5MLCQ 4IO9L 3WT0A 3OYFA 3P31A 3ZX2A 2HBMA 3ID6A 3G25A 4DTUA 3P4IA 2BH1A 2WFBA 2O8FB 4BG8A 4PKGA 3M8SA 1BQMA 3VQAA 5AR0A 3LDLA 4C1NI 4AQYK 1ZC6A 4HUGA 4U7BA 4C8LA 3OTOK 4KHQA 3ASMA 3NGIA 3WXJA 4DS4A 4CHOA 2DTUA 3ULDA 2CH6A 3A5NC 4GVEA 1C6VA 5LL6Z 1NGAA 2A1RA 1YUWA 1XI1A 3ZT2A 3F2KA 4CECA 4IDKA 4ISGA 3WUHA 4F9OA 2I7NA 3EYZA 3SNNA 3H3OB 3L2VA 3TI0A 5I42A 3NF7A 4A2BA 2OYQA 4FLXA 4MDBA 3IAYA 1BQNA 1KAYA 4CFDA 2GTDA 2ZGZA 4CF1A 5C25A 1RBUA 3J7ZO 1BI4B 1D5AA 4DV0K 3AVAA 2WOMA 1LV5A 1QSYA 4CZMA 3HOTA 4M3UA 3NH1A 4B9NA 3O3FA 2HHUA 3UKUA 4C8KA 3QB0A 1SZ2A 4YOUA 4JYAK 3P38A 3EO3A 3SI6A 3ZLJA 4AHUA 4DSKA 1YTAA 3V9UA 3AVBA 3DYAA 4NLBA 1KAXA 1B9FA 1D4XA 1U4BA 5B8HA 1NOYA 3QICA 2D1KA 4CF8A 3NDKA 2O8BB 4BR0A 2QWMA 2KKZA 4LF9K 4DQRA 3DLBA 1VSEA 3ATVA 1HKGA 3O9UA 1Z6RA 1JCFA 3L4IA 3I33A 4NLCA 3KK3A 3D2EB 5J2PA 3MXIA 3PIPL 3RMBA 2YHYA 4FW1A 3IDHA 4QCLA 3TAFA 3AVKA 4ZTJA 3UB5A 3CCJN 2CGLA 2HHQA 2D0CA 4NO7A 4DV5K 2OZSA 4BR2A 1MWMA 1SL1A 3VQ4A 4DR4K 4CBWA 2Q0RA 4GV9A 3TARA 5C0YA 4J8FA 2F7TA 1WSJA 3K5MA 1J54A 4OPJA 3SMSA 1LWFA 1RILA 2HB5A 3ZT0A 3IS9A 4FJHA 4NXNK 3PUFA 1RFQA 5AFUH 4OPHA 2PY5A 1LCUA 4BRKA 4O0JA 2D0PA 4OJRA 1XNQK 1KAZA 4BR5A 3HTVA 2O4IA 3EL2A 3CC7N 1U49A 1LWCA 4OKEA 4N5SA 2OCEA 3DXKA 1XMOK 1UA0A 1RTIA 1XWLA 4B1UB 4WCEL 3J7YP 2IS3A 1HNVA 1U2VA 3SAHA 4IWVA 5K14A 2FC0A 3PX6A 4K42A 4DV3K 3JXUA 2P5OA 4B3RK 3H6EA 3ZSZA 4KHWA 3GOIA 3VF4A 4LFAK 4G1QA 3SZ2A 3L4QA 1SS6A 3WXLA 3HPOA 2JLEA 3E66A 4RG8A 1EP4A 4BG9A 4XH4A 3OYAA 3VN5A 3L2QA 5A2QO 3HZ6A 4K8XA 5C42A 2XRIA 1TKXA 3LDOA 4K43A 4DQQA 1MDUB 5AQYA 3OYNA 1FJGK 2JWLA 4CFCA 3AO3A 3LALA 1HJOA 4FK4A 1QHAA 2A3ZA 3MDQA 2ZJRL 3KD1E 3SV3A 1U47A 3S3MA 5FROA 3TWHA 1VHXA 4JI0K 1UA1A 3HP6A 4EIAA 4FLVA 3OYIA 3PX4A 1IBMK 2G8IA 3E9LA 4CK2A 5IWAK 2HNZA 1MU2A 4I6MB 5F0XA 1T8EA 2HMIA 4FJ8A 2YHXA 5FPDA 2P9NB 5AQXA 1NGFA 1R0AA 3TTFA 2OA8A 3LANA 2QWRA 4H5WA 3UKRA 1QS4A 2WONA 4JV5K 1C0MA 4JI4K 3AA4A 3ENHA 3H45C 1NJZA 4PL7A 5C2FA 3LZIA 3O4WA 2P9IA 3KLGA 1OH8A 4HUEA 4FLZA 2Z1JA 1WSEA 3SAGA 4DR5K 1NM1A 3D2FA 3OJUA 3ZSQA 4CJVA 2E6MA 4H0PA 4GMJB 3ZCMA 4H8KA 3K0SA 1QQCA 2AP1A 3I56N 1BCMA 3HO1A 2VGMA 4JHDA 4I7FA 1K9MO 2HF4A 4IOAL 4DV1K 3E1YA 2EWSA 1QQOA 2E20A 3IRXA 1HKCA 2CH5A 3V9ZA 1BO5O 2HOEA 4PHTX 4FWMA 1VSLA 5GAEP 3VF2A 4O55A 1QE1A 3MAQA 1JLGA 4PL8A 2GWJA 3K5NA 4WF9L 4GW6A 1A5WA 3DJCA 4N56A 4EZ6A 3NF9A 4CZFA 4DTRA 4DV6K 3WNFA 4BC2A 4DSJA 4M3TA 4BRFA 2HBLA 5FPMA 3H1QA 3M8RA 2JGUA 4HWIA 3K2PA 4DU3A 4B1XB 3BEXA 4BQZA 3WNHA 4RW4A 3WNEA 3TSQA 3WQUA 1S1VA 1W0HA 3VTHA 3UE5A 3R6MA 3QEXA 5BRHA 2FBYA 4AHRA 4CCHA 1HNWK 1RTHA 4JKFA 1U48A 4LFCK 4FWLA 1P90A 4CEEA 1WOQA 4GKJK 4DG1A 5C12A 1XNRK 3SV4A 1S1WA 2HHVA 4LF7K 4FWQA 1Z25A 4CBUA 4OLAA 4CD1A 3QNNA 4FO0A 4KFBA 5JLFA 4DTPA 3CCLN 3TSPA 1RBVA 3CCVN 3RWUA 3HP9A 1TKTA 3OW2M 4BRPA 3DRPA 2VWBA 1W2BM 3ZYYX 1LAWA 3PV8A 1HMVA 3SK3A 4IDHA 4CFAA 3SJHA 2YNIA 4DR3K 5CZ2A 3MK6A 4KRFA 1NKCA 1OH5A 2Z1HA 2VWKA 1HNIA 3M5RA 4DR2K 3O08A 3V1RA 4J2BA 1VSHA 4MO5A 3FZLA 4CJEA 1BU6O 5AQKA 1DKGD 2E1YA 2F96A 3FLCO 3QLHA 4CHZA 3C95A 3LM9A 4AHTA 2NRVA 4KO0A 3R9PA 5KRTA 3QO9A 4JRQA 4I9QA 3CQXA 4O4GA 4DUZK 2HBKA 4E0DA 2RHKA 3M1FA 2Q0UA 4TSXA 4FVUA 2F9WA 3P83D 3MEDA 3LWLA 4HCCA 2W41A 4FWKA 3O1WA 5F1XA 1YAGA 4KB0A 3CG7A 4CJLA 4A57A 3Q7CA 5J1EA 4CGHA 4FM1A 1KCFA 2Y1JA 1B9DA 3DXMA 3AVLA 3VGMA 1ASVA 3OYLA 3P39A 4LH4A 3S3NA 3MX2A 3JAMO 3MN7A 4MQ3A 1YJNN 2F8SA 3BGRA 4M63C 2YHAA 2AA4A 1JLBA 3PIOL 5CZ1A 4DU1A 4DQPA 2A1SA 3N4PA 4BGBA 3NE6A 4QS8A 2XHBA 4CZHA 3AGRA 5J2NA 2YHBA 4CJ3A 3G10A 4OPAA 3TAPA 4YOWA 4WQ5C 5AQHA 3QIPA 4H03B 3WXMB 4XH5A 3CQ8A 3FFIA 3VMFB 2X6SA 2YJFA 5BPMA 3CC2N 1WN7A 2NRHA 4Z94A 2O8FA 1KVBA 3VQEA 3MEGA 5GIPA 2HHXA 4FWNA 5HLFA 5CY4A 3IG1A 4FJ7A 5E26A 1BG3A 3A5OC 3C6HA 3C6UA 3SAFA 3O4NA 3HSTB 5AQNA 3L0QA 2G8WA 3BZKA 4PY5A 1Y97A 1Q8IA 1C0UA 3EY1A 4WQ4C 5AFUA 3VENA 4EP5A 3QFPA 3DLRA 4H0XB 2VG7A 3AVHA 3CERA 1RT6A 2O8DA 1WBBA 3HSCA 3RMDA 3CFOA 4U67L 2HHTA 4JRPA 5CR4A 2GWKA 2QEXN 4I2QA 4FCYA 1VAZA 2QI2A 5J2MA 4NCBA 3VQQA 3ZETA 1JLAA 2DFEA 1TYQA 3DLLL 3NFAA 1NGJA 4OPKA 4CHNA 4E7HA 4DS5A 3VEZA 1N34K 3PX0A 2HNDA 3VEOA 3M8QA 4JKDA 4BRGA 4HTUA 1RBRA 4J2AA 1FKPA 4BRHA 4BROA 3ISNC 2B4JA 3I8DA 1NKEA 3CFPA 1T44A 3UKRB 3PSFA 4JI7K 4CE9A 4A5AA 4K0KK 1GLEG 3RR7A 1ZBFA 3ZSYA 2CGJA 4CIGA 3NBPA 1TKZA 1N5YA 4B1ZA 3NGZA 4KHYA 1BOTO 1SKRA 1EQYA 3O9QA 2YKMA 4K25A 4BDPA 3DXKB 1ASUA 4RW9A 3I0SA 3BDPA 3IKMA 2X74A 4B9QA 1RTDA 1SUQA 3SQ0A 3RMAA 1UWBA 3KK2A 3ZEUA 2ZE2A 4FJKA 2FXUA 1GLDG 4GVMA 4ELTA 2VCPA 3MXJA 3VQBA 1XMQK 3OYJA 2UU9K 1ZXOA 3C65A 4CZKA 4DCHA 3AV9A 4O0IA 1SKWA 5HBMA 4Y0WA 3OYHA 1NJXA 3VPZA 4BWMA 1HPZA 2F9TA 3KHYA 4DKWA 4CHQA 1Q82O 4HHTA 5H1SQ 3DLEA 1S22A 3VGKA 4IKFA 2O8CA 2OZMA 3H3NO 3ID8A 1IH7A 1SL0A 1NMDA 5AQOA 1HR0K 2P9NA 4IO8A 2HW3A 2J4RA 4BY9C 5AZJB 3KTQA 4CEBA 1BIZA 1W97L 4AHSA 4FYDA 1HYVA 3RRGA 3AVNA 1U2VB 2ITMA 2OPRA 3AVFA 1NG9A 4CZEA 3LDQA 2V52B 5IT9O 4KI4A 1WNSA 1TGOA 3IUCA 1IBKK 1CXQA 3L3VA 1ATRA 3ITHA 3LPTA 4B9VA 3TTDA 2QKKA 4X62K 3SUOA 3VETA 4E3SA 3KIOA 3AVCA 4NXMK 4EHTA 4AH9A 3THYA 1NNEA 3CM5A 4BGAA 4F3TA 3AA2A 3PO4A 2QA4N 1EKEA 4CGIA 5C2DA 4FJ9A 3VQPA 5JS1A 4W5TA 2IAJA 2DFHA 4YOTA 4JN4A 2O8CB 1JLCA 5AQLA 3RR8A 2IOCA 1DEJA 5M1OA 4M3WA 1KC8O 1R59O 1C0TA 2PZSA 4MFBA 1C0GA 4EP4A 4JK8A 1JL2A 2ZQBA 4OKJA 1EX4A 3CMAN 2QW9A 3S41A 4LH5A 1TL1A 3VOVA 1W7AA 3AVJA 4BREA 1NGGA 1C1BA 2GBZA 1DLOA 5E41A 3ZEUB 2FBXA 1HX1A 4DSEA 3CMEN 4EHUA 3OS1A 1U45A 1DTTA 5DM6L 2PYJA 4X64K 4YNQA 3DRRA 5AQGA 3J80O 1XC3A 4A2AA 4JD2B 3OVNA 1N6QA 4Y1DA 1MWKA 4O8UA 4IG0A 1RT1A 1NGEA 1J5OA 3CCQN 2RN2A 5AQZA 3HT3A 1RDCA 3SPZA 1S1TA 3HOSA 3K57A 4OGEA 3LDPA 1ITGA 4CEAA 4FK2A 3L2WA 4BC4A 3K5LA 2E6LA 3J7AP 3CYMA 1L5UA 3NAEA 2WUSA 1VSJA 1ZBUA 3U8XA 4PWDA 1RBSA 4DB3A 3H08A 5KQ8A 4F3OA 4UQGA 2YNFA 5DMRA 5HRNA 5BN9A 1S9GA 4BRDA 4LSNA 2EX3A 2VWJA 1RCHA 3ENOA 3MCAB 2A5XA 3IFRA 1BUPA 2ZJPL 1VQLN 5GIOA 4JS5A 2D5RA 3UKUB 3VERA 4BVPA 4DF8A 3NH2A 2HBJA 1HPMA 4B3TK 4JEPA 1QHTA 5JICA 2NRWA 3L2RA 5M1FA 3O3HA 1C1AA 3FFKB 1ESVA 3D7EO 3OYDA 4A62A 2WC9A 4MLHA 3VEYA 3PLAA 4PKIA 3K9KA 4RW7A 4FVMA 3LL3A 2ZD1A 5AQPA 1VQNN 5KRSA 5F2RA 3H46O 4G9ZA 3G4SN 1HYSA 1YJ9N 3MCPA 2KFNA 2GV9A 3SLCA 4JI3K 2GUIA 1TVRA 1B92A 4CF2A 4CBXA 1RNHA 1X3NA 3NHGA 4J2DA 3WXKA 1YVNA 2Q2RA 1O1WA 4H0VB 4ELUA 4FJIA 3EZ5A 1WSHA 1OH6A 1RDWX 2YV0X 4BRMA 1KRPA 4YOXA 4LF4K 1WB9A 1S1UA 4WQ4A 5HROA 3WNGA 4KHSA 3QFUA 4CGGA 1T05A 3ZT1A 3OBWA 1TK8A 3HM8A 3O9TA 1GOAA 2Q1NA 3TSUA 5ELZA 5JVHL 3O9RA 4O5FA 5BN8A 1NK6A 1HNXK 1JXEA 3HL8A 2ZM6K 1S5JA 1VSFA 3DAWA 4W5OA 3EN9A 1EO1A 3C6TA 1N32K 1HYZA 2G8HA 3GL1A 2E2QA 1KLMA 4DQSA 4L3QA 3CJBA 1KSPA 3DOKA 2UXCK 2OANA 2YX6A 5HOOA 1BA0A 1NMNA 3AO2A 1T6CA 4BE0A 4ISEA 4AILC 1HQEA 2BTFA 4CK1A 1T03A 2NRRA 4FJMA 4JKEA 3THXB 2KHOA 4FWSA 2E4LA 5KTQA 1RT3A 1LW2A 5AQTA 4WFAL 2W42A 1QQNA 4ID1A 2P9PA 2E1ZA 3HBTA 4LSLA 2DPNA 4DTMA 2P9KB 5GAHP 1JXBA 4LF8K 1KVCA 1NJYA 4OX9K 3C94A 4Z0UA 3BY5A 1QSSA 2FBTA 2IVPA 4IOCL 3SPYA 2IIRA 5C15A 1RDAA 3IMXA 4KTQA 1XQSC 4CJ5A 4GV3A 4DV2K 2IVOA 4DTJA 4ILHA 3LZJA 1N8RO 1IO2A 4FM0A 4M7XA 2PFUA 3RVCA 3VEVA 1TK0A 1ZYQA 1C1CA 1OH7A 4YOVA 1JLFA 1IKYA 1NOZA 5HP1A 3D0PA 1UOCA 4IBNA 4DTOA 1GLBG 4IZ9A 2W6KA 1S6PA 2FF3B 2IGIA 2P9UB 3CI5A 3HI0A 5HRRA 3OYCA 2HHHK 4FZXC 2HF3A 1GLAG 2P9PB 3MXMA 1HRHA 4FLWA 4W5NA 4N41A 3FGUA 4E89A 3SUPA 3THXA 4KH6A 4DR7K 4B08A 4JHDB 3KVGA 2RE2A 4CGJA 1S3XA 4WFBL 4FJNA 4FJXA 2P5GA 3ZSOA 4JK9A 4F8RA 1EXQA 4NYNA 4CZLA 3C6AA 5JLHA 3QNOA 3CJAA 1TL3A 1CZ9A 1ZBLA 4F2SA 3MN6A 3EEQA 2P9LA 2WBNA 3KK7A 3UIQA 1L3SA 1M90O 4JKAA 4FLUA 4JK7A 3GG4A 3RRHA 2HSTA 1W9HA 4CFBA 3CJ9A 4KKOA 3ZX0A 3KLFA
chains in the Genus database with same CATH topology
3ZT4A 3NGZA 4KHYA 1NK9A 1SKRA 4L8RB 1B9FA 4Q0BA 4JLHA 3SJJA 4BE1A 1U4BA 2YKMA 2XO7A 2P1JA 2G8UA 3DLKA 4BDPA 2AJQA 1ASUA 1NOYA 4CJRA 3CFRA 4C8MA 4O44A 3I0SA 1DTQA 4RW9A 2LSNA 2X74A 4CF8A 3NDKA 3BDPA 1RDDA 4M41A 1RTDA 1SUQA 3SQ0A 4KPYA 1EETA 4DQRA 3RMAA 1UWBA 3I0RA 3KLEA 3KK2A 4CJSA 2VG6A 3DLBA 4KAZA 4FJGA 1VSEA 3DMJA 2G8FA 3HK2A 4DQIA 5CYMA 3JYTA 3ALYA 3G0ZA 4CJWA 2ZE2A 4E1NA 4FJKA 3DLHA 2QK9A 4FZYA 2IC3A 2X78A 4GVMA 3V81A 2XY5A 3KK3A 5J2PA 3MXIA 1LAVA 3AO4A 2KZMA 4ICLA 1YVUA 3MXJA 3VQBA 4B8AB 3OS0A 3RMBA 4FW1A 4ELTA 3OYJA 3VQ9A 3SUNA 3TAFA 3AVKA 1X9MA 4QCLA 4ZTJA 3AV9A 2G8KA 2I5JA 4O0IA 2X6NA 1SKWA 2HHQA 2D0CA 2ATQA 5HBMA 1TK5A 2F8TA 1NJXA 3OYHA 2BE2A 4FK0A 1IKXA 4ELVA 5DK5A 2OZSA 2HVHA 2KZZA 1SL1A 4BWMA 3VQ4A 2YNGA 3HJFA 3OYKA 1HPZA 2Z1GA 3TARA 3LAMA 4CHQA 4H4MA 1WSJA 3K5MA 1J54A 4OPJA 1RDBA 4HHTA 4B9SA 3S3OA 1BIUA 3DLEA 4IKFA 1LWFA 1RILA 3VQ5A 2OZMA 2HB5A 3NF6A 3SQ4A 1IH7A 3ZT0A 3RTVA 3IS9A 1SL0A 4FJHA 4C8OA 3PUFA 2HW3A 2XY6A 1XHXA 4FJ5A 4DLEA 2KFZA 1ASWA 2YKNA 3U6FA 1IG9A 2PY5A 4BACA 1WSFA 1A5VA 3KTQA 4CEBA 4Z4IA 1BIZA 1WLJA 4O0JA 4M3ZA 4AHSA 4FYDA 1HYVA 3RRGA 3AVNA 4OJRA 3LP1A 1KFSA 2OPRA 3U3GA 3AVFA 5D3GA 3TAMA 2O4IA 4FJLA 1NK7A 1U49A 4N76A 3DRSA 1LWCA 4OKEA 1WNSA 4N5SA 4KI4A 1TGOA 4Z4CA 1UA0A 1RTIA 2BGGA 1XWLA 1CXQA 4CJKA 1WSIA 1YT3A 4E7JA 3L3VA 3V9SA 3HVTA 4HVJA 4E7IA 4Z4FA 2IS3A 1HNVA 3ITHA 3LPTA 5FDLA 4CEOA 4KREA 4B9VA 2QKKA 4ZHRA 3SUOA 3TANA 5K14A 4E3SA 3KIOA 2FC0A 3SCXA 4CJ4A 3PX6A 1Q9YA 3AVCA 3LP3A 4B9UA 3SQ2A 4AH9A 3CM5A 2P5OA 4F3TA 3AA2A 3PO4A 1NK8A 3ZSZA 1EKEA 3ZT3A 4CGIA 4DFMA 2R7YA 3RMCA 3VQPA 4KB1A 4FJ9A 4HUFA 2BANA 3LP2A 3NF8A 1D8YA 4W5TA 2IAJA 3QEIA 4J2EA 2DFHA 1VSMA 4G1QA 3SZ2A 1RTJA 1JLCA 4F4KA 4KTZA 3RR8A 2IOCA 3ZSRA 3HPOA 2JLEA 2G8VA 4RG8A 5I3UA 1NK5A 1EP4A 4M3WA 1C0TA 4E19A 3OYAA 2PZSA 4MFBA 3VN5A 4CJUA 3L2QA 4EP4A 1VSDA 1D9FA 3PO5A 5C42A 3SYZA 3LP0A 1JL2A 4ID5A 2ZQBA 4K8XA 2XRIA 4DTSA 1TKXA 4OKJA 4DQQA 1EX4A 2Y1IA 4CIFA 3OYNA 3F9KA 4EZ9A 4CFCA 3AO3A 3LALA 4Z4GA 4LH5A 1FXXA 1TL1A 3MEEA 3T19A 4AHCA 4FK4A 3JSMA 3AVJA 3VQ6A 4CERA 3KD1E 3SV3A 3HVRA 1U47A 4E1MA 3S3MA 1C1BA 2GBZA 5FROA 5FRNA 2XY8A 3KKRA 3TWHA 1J9AA 1UA1A 1DLOA 3HP6A 4FJJA 4OGCA 5E41A 1SV5A 3B6OA 3QEVA 2FBXA 1NK0A 3AVIA 4DLGA 4DSEA 4FLVA 3OYMA 3OYIA 3PX4A 2HNYA 3OS1A 3QETA 4CJTA 4I9LA 3HPGA 1U45A 1DTTA 2G8IA 2PYJA 4YNQA 4CK2A 3DRRA 1NKBA 2HNZA 1MU2A 2KW4A 1T8EA 4N47A 3CM6A 2HMIA 4FJ8A 1RT7A 3NH0A 3OVNA 3ZSXA 1N6QA 4Y1DA 2OPSA 1I3AA 1L3VA 5KGXA 4DWIA 4IG0A 1R0AA 1RT1A 4CIEA 1J5OA 2OA8A 2RN2A 3LANA 3O3GA 3OY9A 1QS4A 4M42A 4FZZA 4CJQA 3HT3A 1RDCA 2WONA 1C0MA 3SPZA 3KKSA 4W5QA 1ZBIA 1VSIA 3AA4A 1FK9A 1NJZA 5FRMA 1FKOA 4OLBA 1S1TA 4FLYA 4M3YA 1JL1A 4M45A 3K57A 4OGEA 3LZIA 1BGXT 3KLGA 4HUEA 4FLZA 2Z1JA 1ITGA 4CEAA 1WSEA 4FK2A 3L2WA 3K5LA 2E6LA 3CYMA 1RT4A 3OJUA 2EHGA 1L5UA 3NAEA 3ZSQA 1WSGA 4NYFA 1VSJA 1ZBUA 2E6MA 1JLQA 4CJVA 4KB0A 4GMJB 3ZCMA 4H8KA 1T7PA 1QQCA 1HQUA 1BCMA 1U04A 4FW2A 3HO1A 1BL3A 3AA5X 4CK3A 4PWDA 4I7FA 1RBSA 4DSLA 4DFPA 1TAUA 4IG3A 4B9MA 3H08A 3HYFA 4B9LA 4CEQA 3M8PA 4F3OA 2ETJA 3L2UA 4UQGA 4CEZA 2YNFA 3IRXA 4RW8A 5DMRA 1X9WA 3KD5E 2HVIA 3V9ZA 5HRNA 3LAKA 3QEWA 1IKWA 4Y1CA 1XC9A 1S9GA 1VSLA 3VQ7A 4LSNA 4Z4EA 2EX3A 2VWJA 4O55A 1RCHA 3L3UA 1QE1A 3MAQA 1JLGA 4FM2A 3K5NA 1BHLA 1WAJA 4GW6A 1A5WA 4H4OA 1S6QA 4N56A 4EZ6A 3NF9A 2D5RA 4JS5A 3VA3A 4DTRA 2Q3SA 3TABA 4DF8A 4LD0A 3NH2A 1QSLA 2YNHA 3NCIA 1I39A 3WNFA 2RPIA 4DSJA 4M3TA 2HHSA 4PA1A 3KJVA 1QHTA 2B5JA 3M8RA 2ITGA 2JGUA 3AA3A 3L2RA 3K2PA 3NGYA 5KI6A 2D0AA 4JS4A 1GOBA 1VSKA 1C1AA 3O3HA 4QOZB 4DU3A 3OYBA 4FXDA 3V1QA 5JS2A 1S9EA 3OJSA 3WNHA 3OYGA 4QAGA 4RW4A 3OYDA 3WNEA 1G15A 3PY8A 1S1VA 1W0HA 3P1GA 4DSIA 4RW7A 4DU4A 4FVMA 3ZSVA 2ZD1A 1IKVA 5KRSA 3QEXA 3V6DA 3QEPA 4KHWA 4ZTFA 2FBYA 2QXFA 4AHRA 4CCHA 1KVAA 1RTHA 1JKHA 1U48A 4B8CA 1HYSA 3O4QA 4CEEA 3ZSWA 2KFNA 4DG1A 2GV9A 3SV4A 2GUIA 1TVRA 1S1WA 2HHVA 1B92A 4CF2A 1Z25A 4OLAA 1RNHA 3QNNA 3NHGA 4J2DA 4KFBA 4KHNA 4DTPA 5CYQA 4C8NA 1RBVA 1KLNA 1O1WA 3RWUA 3HP9A 4ELUA 3KLHA 2FBVA 2OPPA 1TKTA 4XIUA 4FJIA 3DRPA 1WSHA 3B6PA 3HXMA 1RT2A 3EZ5A 2YV0X 4M3RA 1LAWA 5J2QA 3TAQA 1NK4A 3PV8A 1KRPA 1HMVA 1L3UA 1S1UA 3QINA 4CFAA 4WE1A 4KV8A 2YNIA 4IFYA 4NCGA 5CZ2A 3V1OA 5HROA 4KRFA 3WNGA 1NKCA 4KHSA 3DM2A 2DFFA 2HHWA 2Z1HA 4KHUA 2XY7A 3D45A 2VWKA 5SWMA 2KQ2A 4DFKA 4Q5VA 2RF2A 1HNIA 4CGGA 1T05A 3ZT1A 4O5BA 4CF9A 4DSFA 1TK8A 3V1RA 1GOAA 4J2BA 2BDPA 1XHZA 5SZTA 2KTQA 1VSHA 2QKBA 4CJEA 1RBTA 1NK6A 1BCOA 1JXEA 2F96A 3HL8A 4B9TA 3QLHA 4CHZA 3C95A 1S5JA 1VSFA 1CXUA 4CF0A 1X1PA 4PUOA 2IDOA 4AHTA 4BWJA 3VQ8A 4W5OA 3S9HA 4KO0A 5KRTA 4JRQA 3QO9A 2NUBA 4I9QA 3V9UA 3TAEA 4CGDA 2B6AA 4O4GA 3C6TA 2DY4A 4E0DA 1HYZA 2G8HA 1KLMA 4DQSA 4TSXA 1VRTA 5HRPA 1KSPA 1BI4A 3P83D 3DOKA 4BDZA 4LY7A 3MEDA 1RT5A 3AVGA 4CGFA 3LWLA 4CHPA 2P51A 4DF4A 3SUQA 4HCCA 4YFUA 1KTQA 3NBPA 1CZBA 3TAGA 1SL2A 1S1XA 3AO2A 4BE0A 1HJRA 3CG7A 4CJLA 4OKKA 4CEFA 4DFJA 4AILC 2PYLA 5J1EA 4PQUA 4CGHA 4FM1A 1HQEA 1KCFA 4CK1A 3LPUA 2Y1JA 3A2FA 4AHVA 1T03A 1B9DA 1CLQA 3AVLA 4E7LA 4R5PA 2Z1IA 3K59A 4FJMA 1ASVA 3OYLA 1GOCA 3KK1A 4DTNA 4LH4A 2E4LA 5KTQA 3U3YA 3S3NA 1RT3A 1LW2A 1NJWA 2W42A 4MQ3A 4ID1A 2F8SA 3VQDA 3OYEA 4LSLA 3BGRA 4DTMA 2YHAA 1JLBA 1VK0A 1A5XA 1JXBA 1Z26A 1KVCA 2D0BA 5CZ1A 4BE2A 1NJYA 1K6YA 2O4GA 4DU1A 3C94A 4HCBA 4Z0UA 3AO5A 3L8BA 2A1SA 3AO1A 3E01A 1QSSA 1VRUA 4DQPA 4B3OA 2FBTA 3NE6A 3DOLA 2XHBA 1LW0A 1D9DA 3SPYA 5J2NA 2YHBA 4CJ3A 3OS2A 3DI6A 1RDAA 3G10A 3K5OA 3QESA 4KI6A 4KTQA 3V4IA 3TAPA 1QTMA 4CJ5A 1JLEA 3QIPA 3THVA 3CQ8A 2OPQA 3FFIA 1ZBHA 3DLGA 2X6SA 5JS1A 1WAFA 4OVLA 4CESA 4DTJA 1WN7A 4CJPA 3LZJA 1X9SA 3HPHA 3LDSA 3V9XA 1IO2A 4FM0A 1KVBA 4FLTA 4KTWA 4Z4HA 1BISA 3T3FA 3VQEA 3MEGA 1LWEA 2HHXA 3OYFA 4CHYA 2RKIA 1Q9XA 5HLFA 5CY4A 1TK0A 1F21A 3IG1A 4RW6A 1ZYQA 4FJ7A 4DTUA 1C1CA 5KGWA 1TV6A 1SKSA 1JLFA 3C6UA 1IKYA 3M8SA 1NOZA 5HP1A 3AVMA 3O4NA 1BQMA 3HSTB 3VQAA 3HM9A 3D0PA 1UOCA 4IBNA 4DTOA 3SQ1A 1S6PA 4HUGA 3V9WA 4CEDA 2G8WA 4C8LA 4PY5A 4I2PA 1Y97A 4KHQA 2IGIA 3ASMA 3NGIA 1Q8IA 1C0UA 4DS4A 3T1AA 4CHOA 3EY1A 4DMNA 3ULDA 2DTUA 4K8ZA 5HRRA 4EP5A 3OYCA 3DLRA 4FZXC 2VG7A 3AVHA 3QERA 1RT6A 4BDYA 3MXMA 1HRHA 1C6VA 4FLWA 4W5NA 3K58A 4N41A 3TR8A 3RMDA 3CFOA 4E89A 3F73A 1UAXA 2A1RA 3SUPA 1XI1A 2HHTA 3ZT2A 4JRPA 4I2QA 1TAQA 4CECA 4IDKA 4DTXA 3KLIA 4FCYA 4B08A 3EYZA 3SNNA 1YTUA 1TKDA 3L2VA 4CGJA 5J2MA 3TI0A 5I42A 3NF7A 3VQQA 4FJNA 4NCBA 3VQCA 4E7KA 4FJXA 2OYQA 3QIOA 4FLXA 2P5GA 1JLAA 2DFEA 3NFAA 3ZSOA 4OPKA 4CHNA 1BQNA 4CFDA 4E7HA 4CF1A 5C25A 4DS5A 3IAYA 4F8RA 1RBUA 3PX0A 1EXQA 1BI4B 2HNDA 1D5AA 4NYNA 1REVA 3M8QA 4HTUA 3AVAA 5EU7A 1RBRA 2WOMA 3MECA 3LWMA 3QNOA 1LV5A 1TL3A 1CZ9A 3VA0A 1ZBLA 1QSYA 4J2AA 1FKPA 1J53A 4F2SA 3ISNC 4M3UA 4NCAA 3NH1A 2B4JA 3O3FA 3I8DA 1NKEA 2VG5A 4B9NA 4M3XA 2HHUA 4CJFA 5C24A 3UIQA 4C8KA 5HRSA 3CFPA 1L3SA 3P5JA 4F2RA 5T7BA 4FLUA 3SI6A 4CE9A 3RRHA 4W5RA 4IFVA 1W9HA 4AHUA 1L3TA 4CFBA 1KFDA 3RR7A 1ZBFA 1YTAA 3ZSYA 4DSKA 4KKOA 4CIGA 3AVBA 1TKZA 3DYAA 1N5YA 3KLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT4 A;  3NGZ A;  4KHY A;  1NK9 A;  1SKR A;  4L8R B;  1B9F A;  4Q0B A;  4JLH A;  3SJJ A;  4BE1 A;  1U4B A;  2YKM A;  2XO7 A;  2P1J A;  2G8U A;  3DLK A;  4BDP A;  2AJQ A;  1ASU A;  1NOY A;  4CJR A;  3CFR A;  4C8M A;  4O44 A;  3I0S A;  1DTQ A;  4RW9 A;  2LSN A;  2X74 A;  4CF8 A;  3NDK A;  3BDP A;  1RDD A;  4M41 A;  1RTD A;  1SUQ A;  3SQ0 A;  4KPY A;  1EET A;  4DQR A;  3RMA A;  1UWB A;  3I0R A;  3KLE A;  3KK2 A;  4CJS A;  2VG6 A;  3DLB A;  4KAZ A;  4FJG A;  1VSE A;  3DMJ A;  2G8F A;  3HK2 A;  4DQI A;  5CYM A;  3JYT A;  3ALY A;  3G0Z A;  4CJW A;  2ZE2 A;  4E1N A;  4FJK A;  3DLH A;  2QK9 A;  4FZY A;  2IC3 A;  2X78 A;  4GVM A;  3V81 A;  2XY5 A;  3KK3 A;  5J2P A;  3MXI A;  1LAV A;  3AO4 A;  2KZM A;  4ICL A;  1YVU A;  3MXJ A;  3VQB A;  4B8A B;  3OS0 A;  3RMB A;  4FW1 A;  4ELT A;  3OYJ A;  3VQ9 A;  3SUN A;  3TAF A;  3AVK A;  1X9M A;  4QCL A;  4ZTJ A;  3AV9 A;  2G8K A;  2I5J A;  4O0I A;  2X6N A;  1SKW A;  2HHQ A;  2D0C A;  2ATQ A;  5HBM A;  1TK5 A;  2F8T A;  1NJX A;  3OYH A;  2BE2 A;  4FK0 A;  1IKX A;  4ELV A;  5DK5 A;  2OZS A;  2HVH A;  2KZZ A;  1SL1 A;  4BWM A;  3VQ4 A;  2YNG A;  3HJF A;  3OYK A;  1HPZ A;  2Z1G A;  3TAR A;  3LAM A;  4CHQ A;  4H4M A;  1WSJ A;  3K5M A;  1J54 A;  4OPJ A;  1RDB A;  4HHT A;  4B9S A;  3S3O A;  1BIU A;  3DLE A;  4IKF A;  1LWF A;  1RIL A;  3VQ5 A;  2OZM A;  2HB5 A;  3NF6 A;  3SQ4 A;  1IH7 A;  3ZT0 A;  3RTV A;  3IS9 A;  1SL0 A;  4FJH A;  4C8O A;  3PUF A;  2HW3 A;  2XY6 A;  1XHX A;  4FJ5 A;  4DLE A;  2KFZ A;  1ASW A;  2YKN A;  3U6F A;  1IG9 A;  2PY5 A;  4BAC A;  1WSF A;  1A5V A;  3KTQ A;  4CEB A;  4Z4I A;  1BIZ A;  1WLJ A;  4O0J A;  4M3Z A;  4AHS A;  4FYD A;  1HYV A;  3RRG A;  3AVN A;  4OJR A;  3LP1 A;  1KFS A;  2OPR A;  3U3G A;  3AVF A;  5D3G A;  3TAM A;  2O4I A;  4FJL A;  1NK7 A;  1U49 A;  4N76 A;  3DRS A;  1LWC A;  4OKE A;  1WNS A;  4N5S A;  4KI4 A;  1TGO A;  4Z4C A;  1UA0 A;  1RTI A;  2BGG A;  1XWL A;  1CXQ A;  4CJK A;  1WSI A;  1YT3 A;  4E7J A;  3L3V A;  3V9S A;  3HVT A;  4HVJ A;  4E7I A;  4Z4F A;  2IS3 A;  1HNV A;  3ITH A;  3LPT A;  5FDL A;  4CEO A;  4KRE A;  4B9V A;  2QKK A;  4ZHR A;  3SUO A;  3TAN A;  5K14 A;  4E3S A;  3KIO A;  2FC0 A;  3SCX A;  4CJ4 A;  3PX6 A;  1Q9Y A;  3AVC A;  3LP3 A;  4B9U A;  3SQ2 A;  4AH9 A;  3CM5 A;  2P5O A;  4F3T A;  3AA2 A;  3PO4 A;  1NK8 A;  3ZSZ A;  1EKE A;  3ZT3 A;  4CGI A;  4DFM A;  2R7Y A;  3RMC A;  3VQP A;  4KB1 A;  4FJ9 A;  4HUF A;  2BAN A;  3LP2 A;  3NF8 A;  1D8Y A;  4W5T A;  2IAJ A;  3QEI A;  4J2E A;  2DFH A;  1VSM A;  4G1Q A;  3SZ2 A;  1RTJ A;  1JLC A;  4F4K A;  4KTZ A;  3RR8 A;  2IOC A;  3ZSR A;  3HPO A;  2JLE A;  2G8V A;  4RG8 A;  5I3U A;  1NK5 A;  1EP4 A;  4M3W A;  1C0T A;  4E19 A;  3OYA A;  2PZS A;  4MFB A;  3VN5 A;  4CJU A;  3L2Q A;  4EP4 A;  1VSD A;  1D9F A;  3PO5 A;  5C42 A;  3SYZ A;  3LP0 A;  1JL2 A;  4ID5 A;  2ZQB A;  4K8X A;  2XRI A;  4DTS A;  1TKX A;  4OKJ A;  4DQQ A;  1EX4 A;  2Y1I A;  4CIF A;  3OYN A;  3F9K A;  4EZ9 A;  4CFC A;  3AO3 A;  3LAL A;  4Z4G A;  4LH5 A;  1FXX A;  1TL1 A;  3MEE A;  3T19 A;  4AHC A;  4FK4 A;  3JSM A;  3AVJ A;  3VQ6 A;  4CER A;  3KD1 E;  3SV3 A;  3HVR A;  1U47 A;  4E1M A;  3S3M A;  1C1B A;  2GBZ A;  5FRO A;  5FRN A;  2XY8 A;  3KKR A;  3TWH A;  1J9A A;  1UA1 A;  1DLO A;  3HP6 A;  4FJJ A;  4OGC A;  5E41 A;  1SV5 A;  3B6O A;  3QEV A;  2FBX A;  1NK0 A;  3AVI A;  4DLG A;  4DSE A;  4FLV A;  3OYM A;  3OYI A;  3PX4 A;  2HNY A;  3OS1 A;  3QET A;  4CJT A;  4I9L A;  3HPG A;  1U45 A;  1DTT A;  2G8I A;  2PYJ A;  4YNQ A;  4CK2 A;  3DRR A;  1NKB A;  2HNZ A;  1MU2 A;  2KW4 A;  1T8E A;  4N47 A;  3CM6 A;  2HMI A;  4FJ8 A;  1RT7 A;  3NH0 A;  3OVN A;  3ZSX A;  1N6Q A;  4Y1D A;  2OPS A;  1I3A A;  1L3V A;  5KGX A;  4DWI A;  4IG0 A;  1R0A A;  1RT1 A;  4CIE A;  1J5O A;  2OA8 A;  2RN2 A;  3LAN A;  3O3G A;  3OY9 A;  1QS4 A;  4M42 A;  4FZZ A;  4CJQ A;  3HT3 A;  1RDC A;  2WON A;  1C0M A;  3SPZ A;  3KKS A;  4W5Q A;  1ZBI A;  1VSI A;  3AA4 A;  1FK9 A;  1NJZ A;  5FRM A;  1FKO A;  4OLB A;  1S1T A;  4FLY A;  4M3Y A;  1JL1 A;  4M45 A;  3K57 A;  4OGE A;  3LZI A;  1BGX T;  3KLG A;  4HUE A;  4FLZ A;  2Z1J A;  1ITG A;  4CEA A;  1WSE A;  4FK2 A;  3L2W A;  3K5L A;  2E6L A;  3CYM A;  1RT4 A;  3OJU A;  2EHG A;  1L5U A;  3NAE A;  3ZSQ A;  1WSG A;  4NYF A;  1VSJ A;  1ZBU A;  2E6M A;  1JLQ A;  4CJV A;  4KB0 A;  4GMJ B;  3ZCM A;  4H8K A;  1T7P A;  1QQC A;  1HQU A;  1BCM A;  1U04 A;  4FW2 A;  3HO1 A;  1BL3 A;  3AA5 X;  4CK3 A;  4PWD A;  4I7F A;  1RBS A;  4DSL A;  4DFP A;  1TAU A;  4IG3 A;  4B9M A;  3H08 A;  3HYF A;  4B9L A;  4CEQ A;  3M8P A;  4F3O A;  2ETJ A;  3L2U A;  4UQG A;  4CEZ A;  2YNF A;  3IRX A;  4RW8 A;  5DMR A;  1X9W A;  3KD5 E;  2HVI A;  3V9Z A;  5HRN A;  3LAK A;  3QEW A;  1IKW A;  4Y1C A;  1XC9 A;  1S9G A;  1VSL A;  3VQ7 A;  4LSN A;  4Z4E A;  2EX3 A;  2VWJ A;  4O55 A;  1RCH A;  3L3U A;  1QE1 A;  3MAQ A;  1JLG A;  4FM2 A;  3K5N A;  1BHL A;  1WAJ A;  4GW6 A;  1A5W A;  4H4O A;  1S6Q A;  4N56 A;  4EZ6 A;  3NF9 A;  2D5R A;  4JS5 A;  3VA3 A;  4DTR A;  2Q3S A;  3TAB A;  4DF8 A;  4LD0 A;  3NH2 A;  1QSL A;  2YNH A;  3NCI A;  1I39 A;  3WNF A;  2RPI A;  4DSJ A;  4M3T A;  2HHS A;  4PA1 A;  3KJV A;  1QHT A;  2B5J A;  3M8R A;  2ITG A;  2JGU A;  3AA3 A;  3L2R A;  3K2P A;  3NGY A;  5KI6 A;  2D0A A;  4JS4 A;  1GOB A;  1VSK A;  1C1A A;  3O3H A;  4QOZ B;  4DU3 A;  3OYB A;  4FXD A;  3V1Q A;  5JS2 A;  1S9E A;  3OJS A;  3WNH A;  3OYG A;  4QAG A;  4RW4 A;  3OYD A;  3WNE A;  1G15 A;  3PY8 A;  1S1V A;  1W0H A;  3P1G A;  4DSI A;  4RW7 A;  4DU4 A;  4FVM A;  3ZSV A;  2ZD1 A;  1IKV A;  5KRS A;  3QEX A;  3V6D A;  3QEP A;  4KHW A;  4ZTF A;  2FBY A;  2QXF A;  4AHR A;  4CCH A;  1KVA A;  1RTH A;  1JKH A;  1U48 A;  4B8C A;  1HYS A;  3O4Q A;  4CEE A;  3ZSW A;  2KFN A;  4DG1 A;  2GV9 A;  3SV4 A;  2GUI A;  1TVR A;  1S1W A;  2HHV A;  1B92 A;  4CF2 A;  1Z25 A;  4OLA A;  1RNH A;  3QNN A;  3NHG A;  4J2D A;  4KFB A;  4KHN A;  4DTP A;  5CYQ A;  4C8N A;  1RBV A;  1KLN A;  1O1W A;  3RWU A;  3HP9 A;  4ELU A;  3KLH A;  2FBV A;  2OPP A;  1TKT A;  4XIU A;  4FJI A;  3DRP A;  1WSH A;  3B6P A;  3HXM A;  1RT2 A;  3EZ5 A;  2YV0 X;  4M3R A;  1LAW A;  5J2Q A;  3TAQ A;  1NK4 A;  3PV8 A;  1KRP A;  1HMV A;  1L3U A;  1S1U A;  3QIN A;  4CFA A;  4WE1 A;  4KV8 A;  2YNI A;  4IFY A;  4NCG A;  5CZ2 A;  3V1O A;  5HRO A;  4KRF A;  3WNG A;  1NKC A;  4KHS A;  3DM2 A;  2DFF A;  2HHW A;  2Z1H A;  4KHU A;  2XY7 A;  3D45 A;  2VWK A;  5SWM A;  2KQ2 A;  4DFK A;  4Q5V A;  2RF2 A;  1HNI A;  4CGG A;  1T05 A;  3ZT1 A;  4O5B A;  4CF9 A;  4DSF A;  1TK8 A;  3V1R A;  1GOA A;  4J2B A;  2BDP A;  1XHZ A;  5SZT A;  2KTQ A;  1VSH A;  2QKB A;  4CJE A;  1RBT A;  1NK6 A;  1BCO A;  1JXE A;  2F96 A;  3HL8 A;  4B9T A;  3QLH A;  4CHZ A;  3C95 A;  1S5J A;  1VSF A;  1CXU A;  4CF0 A;  1X1P A;  4PUO A;  2IDO A;  4AHT A;  4BWJ A;  3VQ8 A;  4W5O A;  3S9H A;  4KO0 A;  5KRT A;  4JRQ A;  3QO9 A;  2NUB A;  4I9Q A;  3V9U A;  3TAE A;  4CGD A;  2B6A A;  4O4G A;  3C6T A;  2DY4 A;  4E0D A;  1HYZ A;  2G8H A;  1KLM A;  4DQS A;  4TSX A;  1VRT A;  5HRP A;  1KSP A;  1BI4 A;  3P83 D;  3DOK A;  4BDZ A;  4LY7 A;  3MED A;  1RT5 A;  3AVG A;  4CGF A;  3LWL A;  4CHP A;  2P51 A;  4DF4 A;  3SUQ A;  4HCC A;  4YFU A;  1KTQ A;  3NBP A;  1CZB A;  3TAG A;  1SL2 A;  1S1X A;  3AO2 A;  4BE0 A;  1HJR A;  3CG7 A;  4CJL A;  4OKK A;  4CEF A;  4DFJ A;  4AIL C;  2PYL A;  5J1E A;  4PQU A;  4CGH A;  4FM1 A;  1HQE A;  1KCF A;  4CK1 A;  3LPU A;  2Y1J A;  3A2F A;  4AHV A;  1T03 A;  1B9D A;  1CLQ A;  3AVL A;  4E7L A;  4R5P A;  2Z1I A;  3K59 A;  4FJM A;  1ASV A;  3OYL A;  1GOC A;  3KK1 A;  4DTN A;  4LH4 A;  2E4L A;  5KTQ A;  3U3Y A;  3S3N A;  1RT3 A;  1LW2 A;  1NJW A;  2W42 A;  4MQ3 A;  4ID1 A;  2F8S A;  3VQD A;  3OYE A;  4LSL A;  3BGR A;  4DTM A;  2YHA A;  1JLB A;  1VK0 A;  1A5X A;  1JXB A;  1Z26 A;  1KVC A;  2D0B A;  5CZ1 A;  4BE2 A;  1NJY A;  1K6Y A;  2O4G A;  4DU1 A;  3C94 A;  4HCB A;  4Z0U A;  3AO5 A;  3L8B A;  2A1S A;  3AO1 A;  3E01 A;  1QSS A;  1VRU A;  4DQP A;  4B3O A;  2FBT A;  3NE6 A;  3DOL A;  2XHB A;  1LW0 A;  1D9D A;  3SPY A;  5J2N A;  2YHB A;  4CJ3 A;  3OS2 A;  3DI6 A;  1RDA A;  3G10 A;  3K5O A;  3QES A;  4KI6 A;  4KTQ A;  3V4I A;  3TAP A;  1QTM A;  4CJ5 A;  1JLE A;  3QIP A;  3THV A;  3CQ8 A;  2OPQ A;  3FFI A;  1ZBH A;  3DLG A;  2X6S A;  5JS1 A;  1WAF A;  4OVL A;  4CES A;  4DTJ A;  1WN7 A;  4CJP A;  3LZJ A;  1X9S A;  3HPH A;  3LDS A;  3V9X A;  1IO2 A;  4FM0 A;  1KVB A;  4FLT A;  4KTW A;  4Z4H A;  1BIS A;  3T3F A;  3VQE A;  3MEG A;  1LWE A;  2HHX A;  3OYF A;  4CHY A;  2RKI A;  1Q9X A;  5HLF A;  5CY4 A;  1TK0 A;  1F21 A;  3IG1 A;  4RW6 A;  1ZYQ A;  4FJ7 A;  4DTU A;  1C1C A;  5KGW A;  1TV6 A;  1SKS A;  1JLF A;  3C6U A;  1IKY A;  3M8S A;  1NOZ A;  5HP1 A;  3AVM A;  3O4N A;  1BQM A;  3HST B;  3VQA A;  3HM9 A;  3D0P A;  1UOC A;  4IBN A;  4DTO A;  3SQ1 A;  1S6P A;  4HUG A;  3V9W A;  4CED A;  2G8W A;  4C8L A;  4PY5 A;  4I2P A;  1Y97 A;  4KHQ A;  2IGI A;  3ASM A;  3NGI A;  1Q8I A;  1C0U A;  4DS4 A;  3T1A A;  4CHO A;  3EY1 A;  4DMN A;  3ULD A;  2DTU A;  4K8Z A;  5HRR A;  4EP5 A;  3OYC A;  3DLR A;  4FZX C;  2VG7 A;  3AVH A;  3QER A;  1RT6 A;  4BDY A;  3MXM A;  1HRH A;  1C6V A;  4FLW A;  4W5N A;  3K58 A;  4N41 A;  3TR8 A;  3RMD A;  3CFO A;  4E89 A;  3F73 A;  1UAX A;  2A1R A;  3SUP A;  1XI1 A;  2HHT A;  3ZT2 A;  4JRP A;  4I2Q A;  1TAQ A;  4CEC A;  4IDK A;  4DTX A;  3KLI A;  4FCY A;  4B08 A;  3EYZ A;  3SNN A;  1YTU A;  1TKD A;  3L2V A;  4CGJ A;  5J2M A;  3TI0 A;  5I42 A;  3NF7 A;  3VQQ A;  4FJN A;  4NCB A;  3VQC A;  4E7K A;  4FJX A;  2OYQ A;  3QIO A;  4FLX A;  2P5G A;  1JLA A;  2DFE A;  3NFA A;  3ZSO A;  4OPK A;  4CHN A;  1BQN A;  4CFD A;  4E7H A;  4CF1 A;  5C25 A;  4DS5 A;  3IAY A;  4F8R A;  1RBU A;  3PX0 A;  1EXQ A;  1BI4 B;  2HND A;  1D5A A;  4NYN A;  1REV A;  3M8Q A;  4HTU A;  3AVA A;  5EU7 A;  1RBR A;  2WOM A;  3MEC A;  3LWM A;  3QNO A;  1LV5 A;  1TL3 A;  1CZ9 A;  3VA0 A;  1ZBL A;  1QSY A;  4J2A A;  1FKP A;  1J53 A;  4F2S A;  3ISN C;  4M3U A;  4NCA A;  3NH1 A;  2B4J A;  3O3F A;  3I8D A;  1NKE A;  2VG5 A;  4B9N A;  4M3X A;  2HHU A;  4CJF A;  5C24 A;  3UIQ A;  4C8K A;  5HRS A;  3CFP A;  1L3S A;  3P5J A;  4F2R A;  5T7B A;  4FLU A;  3SI6 A;  4CE9 A;  3RRH A;  4W5R A;  4IFV A;  1W9H A;  4AHU A;  1L3T A;  4CFB A;  1KFD A;  3RR7 A;  1ZBF A;  1YTA A;  3ZSY A;  4DSK A;  4KKO A;  4CIG A;  3AVB A;  1TKZ A;  3DYA A;  1N5Y A;  3KLF A; 
#chains in the Genus database with same CATH topology
 3ZT4 A;  4RCH A;  4L8R B;  4Q0B A;  3SJJ A;  4H5N A;  4BRQ A;  4NB4 A;  2XO7 A;  2P1J A;  2G8U A;  3DLK A;  1U6Z A;  4CZG A;  4CJR A;  3CFR A;  4C8M A;  4O44 A;  3ZX3 A;  4DUY K;  4KPY A;  2VYP A;  2VG6 A;  4FJG A;  4K41 A;  2G8F A;  1E4G T;  1G99 A;  3T69 A;  3ALY A;  3G0Z A;  4CJW A;  5M1K A;  4JI6 K;  2QK9 A;  4FZY A;  4GNI A;  4QS7 A;  4YY3 K;  3CPW M;  2KZM A;  1LAV A;  4ICL A;  3SUN A;  4WQ5 A;  3ZET B;  3O8M A;  2G8K A;  5AQI A;  2ATQ A;  2BE2 A;  2P9S B;  4FK0 A;  4ELV A;  5DK5 A;  2QXL A;  3MWP A;  2KZZ A;  2YNG A;  3OYK A;  1VQO N;  1HNZ K;  2Z1G A;  3LAM A;  5KPZ A;  3JS6 A;  1RDB A;  4B9S A;  3VQ5 A;  1NJI O;  1TUU A;  3RTV A;  4C8O A;  3M3Z A;  2P9K A;  3OHR A;  4MLE A;  4PKH A;  2XY6 A;  4FJ5 A;  1ASW A;  3TPQ A;  4LF5 K;  1ATS A;  1NGD A;  3U6F A;  1WSF A;  1A5V A;  2P9U A;  3F9M A;  2ZWH A;  4DV7 K;  4Z4I A;  3FR0 A;  4M3Z A;  2FLO A;  3B8A X;  4B3M K;  1NGB A;  1YXQ A;  2ASM A;  1KFS A;  1GLJ O;  4XEI A;  3TAM A;  5LJV A;  3VGL A;  1NK7 A;  2O8B A;  2H3G X;  4N76 A;  1JCE A;  4Z4C A;  1IJJ A;  2BGG A;  1WSI A;  4HVJ A;  5FDL A;  2QWO A;  4UY8 O;  1Q18 A;  2E2N A;  4QS9 A;  3SCX A;  4CJ4 A;  1Q9Y A;  4B9U A;  3LP3 A;  3SQ2 A;  3MMV A;  2OTJ N;  1YHQ N;  1WUA A;  1TYQ B;  3L6Q A;  3J81 O;  1NK8 A;  2VQF K;  3RMC A;  1IV0 A;  4HUF A;  1VQ6 N;  3NF8 A;  5KPT A;  3QEI A;  1VSM A;  1E3M A;  1QVG M;  1YIT N;  1QZ6 A;  2CGK A;  3ZSR A;  5FLX O;  4AF1 A;  2G8V A;  5I3U A;  1NK5 A;  2V7Y A;  5ADX H;  3FE1 A;  1D9F A;  1VSD A;  3PO5 A;  4ID5 A;  4DTS A;  2O8D B;  2Y1I A;  5EY4 A;  3F9K A;  3FZM A;  4IEE A;  1T6D A;  4AHC A;  3JSM A;  3THW B;  4CER A;  1Q81 O;  5FRN A;  2XY8 A;  1J9A A;  3B6O A;  4O8K A;  3QEV A;  1NK0 A;  3C7N A;  5KQD A;  2QWL A;  3QET A;  4I9L A;  3HPG A;  3ULE B;  3VEX A;  1ATN A;  1NKB A;  3Q7B A;  3O6W A;  3CM6 A;  3ULE A;  4GKK K;  1RT7 A;  3NVM A;  3ZSX A;  1I3A A;  1L3V A;  3RSE A;  4DWI A;  4JKC A;  1JCG A;  4CIE A;  4JKG B;  2NLX A;  5BR9 A;  3MN9 A;  1YJW N;  4M42 A;  3CIP A;  1IG8 A;  5ADX A;  1N36 K;  4IJN A;  1K8A O;  4H5R A;  1VSI A;  1EWR A;  1FK9 A;  5FRM A;  1FKO A;  2IVN A;  4OLB A;  5EOY A;  1GLL O;  4FLY A;  4M45 A;  1BA1 A;  3NVK A;  1OVQ A;  5AQF A;  1RT4 A;  3CQY A;  3D2E A;  1WSG A;  3CCS N;  2YJE A;  1T7P A;  3U9D A;  3VEW A;  4FW2 A;  3CC4 N;  1BL3 A;  3AA5 X;  4DSL A;  1GLC G;  5AQU A;  1GLF O;  4DFP A;  4FOI A;  3H1V X;  4IG3 A;  3CCE N;  4B9L A;  3HYF A;  4X65 K;  4CEQ A;  3QBX A;  3CHW A;  3M8P A;  4AM7 A;  3L2U A;  4A61 A;  3AAP A;  4RW8 A;  2Q36 A;  3I8B A;  3KD5 E;  1KXP A;  3LAK A;  3QEW A;  3D6R A;  2UUC K;  4Z4E A;  4JI8 K;  1RGI A;  4FM2 A;  2FSK A;  4H4O A;  1S6Q A;  3VA3 A;  4LD0 A;  3EKS A;  5LJW A;  1H1V A;  1QSL A;  1I39 A;  4FWO A;  4B1V A;  3KJV A;  3N4Q A;  4BRI A;  2HMP A;  3NGY A;  2D0A A;  4JS4 A;  4QOZ B;  4DQ8 A;  2D4W A;  5AZJ A;  3I55 N;  5LMU K;  5JS2 A;  1S9E A;  3OYG A;  1VQ5 N;  1OKJ A;  4CZI A;  3P1G A;  4DSI A;  1IKV A;  3V6D A;  4JKH A;  3QEP A;  2QXF A;  1QQM A;  4B3S K;  3CJ1 A;  3O4Q A;  3ZSW A;  2E2O A;  3CXC M;  2VQE K;  4C8N A;  4BRC A;  1KLN A;  5AZI B;  4JKB A;  3B6P A;  4FWP A;  1S72 N;  1RT2 A;  1VQM N;  3TAQ A;  5AQR A;  3O80 A;  4CZJ A;  1L3U A;  3QIN A;  4B1W B;  4IFY A;  4C23 A;  2HHW A;  2Q97 A;  4BC5 A;  2XY7 A;  1FW6 A;  4BRN A;  3D45 A;  5SWM A;  4DFK A;  4Q5V A;  4JNE A;  2BDP A;  2A41 A;  5SZT A;  2KTQ A;  5FPN A;  1LOT B;  2E88 A;  3J8A A;  5C10 A;  1BCO A;  2YHW A;  4B9T A;  3M6G A;  4PUO A;  1CXU A;  4CF0 A;  3VQ8 A;  3S9H A;  2P9L B;  1V4S A;  5TKW A;  4CGD A;  2A6A A;  3THY B;  3CPE A;  1VRT A;  1NLV A;  1OVY A;  3R1X A;  5M1P A;  4LC9 B;  5AJ3 K;  4CHP A;  2P51 A;  3SUQ A;  4CJ7 A;  1CZB A;  3DWL A;  4KBO A;  3TAG A;  1S1X A;  1HJR A;  4OKK A;  4CEF A;  4DFJ A;  4PQU A;  3A5L C;  4BVO A;  3LPU A;  3A2F A;  4AHV A;  3K59 A;  3T1H K;  5KPR A;  3U3Y A;  1NJW A;  1K8K A;  4C1N K;  3TTC A;  3D2F B;  3OYE A;  2ZJQ L;  4JI1 K;  1NU0 A;  1A5X A;  4BE2 A;  2V51 B;  1K6Y A;  1ZBS A;  2O4G A;  2UXB K;  3AO5 A;  3L8B A;  3AO1 A;  3E01 A;  3O1B A;  1LW0 A;  3OS2 A;  3DI6 A;  4KI6 A;  3K5O A;  1V4T A;  1QTM A;  1JLE A;  4MDA A;  2F4V K;  3E9O A;  3THV A;  5TKY A;  3DLG A;  1WAF A;  1X9S A;  3HPH A;  3LDS A;  3V9X A;  4FSV A;  3T3F A;  1LWE A;  4CHY A;  2RKI A;  3CF5 L;  1Q9X A;  1F21 A;  1TUY A;  4RW6 A;  2BUP A;  5KGW A;  5GIN A;  3CCM N;  1TV6 A;  1SKS A;  1SAZ A;  1XUP O;  3G71 N;  3AVM A;  3HM9 A;  3SQ1 A;  3V9W A;  5BRF A;  4CED A;  4I2P A;  5GAD P;  3T1A A;  4DMN A;  4FPB A;  4K8Z A;  3W0L A;  4DR6 K;  2ZGY A;  3KWI A;  3QER A;  4BDY A;  2VGN A;  4MO4 A;  2O8E A;  3WEE B;  3K58 A;  4ILJ A;  3TR8 A;  2QWQ A;  3F73 A;  1UAX A;  3C0B A;  1HLU A;  1TAQ A;  4DTX A;  3KLI A;  1VQ8 N;  1TKD A;  4YOR A;  1YTU A;  3CJ7 A;  4H5T A;  2YCH A;  3VQC A;  4E7K A;  3QIO A;  2PBD A;  4A59 A;  5EXW A;  4WYB A;  3FZF A;  1VQ9 N;  1REV A;  5EU7 A;  3MEC A;  3LWM A;  5AQV A;  3AGK A;  2Q31 A;  3VA0 A;  1J6Z A;  1J53 A;  4BR7 A;  2ASO A;  4NCA A;  3VF6 A;  4M3X A;  2VG5 A;  3T7Z A;  4CJF A;  5C24 A;  5HRS A;  3P5J A;  4OO1 J;  4IJA A;  3SBG A;  4F2R A;  5T7B A;  5M1N A;  2NNW A;  4W5R A;  1MA9 B;  3FZK A;  4IFV A;  1L3T A;  1KFD A;  3CJC A;  3EE9 A;  4XH1 A;  1NK9 A;  4JLH A;  3G6E N;  4BE1 A;  4BRL A;  2AJQ A;  3SBT A;  2A40 A;  1DTQ A;  1NWK A;  2LSN A;  1RDD A;  4M41 A;  1EET A;  3I0R A;  3KLE A;  4CJS A;  3HK2 A;  4KAZ A;  3DMJ A;  4DQI A;  5CYM A;  3JYT A;  4E1N A;  3DLH A;  5FPE A;  2IC3 A;  2X78 A;  3V81 A;  2XY5 A;  3CET A;  3AO4 A;  3OS0 A;  1YVU A;  4B8A B;  3SMP A;  2NRX A;  1ILY A;  3VQ9 A;  1X9M A;  1BDG A;  1QVF M;  2I5J A;  2WTU A;  5HL7 L;  3WXI A;  2NZT A;  2X6N A;  4V19 S;  1TK5 A;  2F8T A;  3K9J A;  4RTF D;  1IKX A;  2HVH A;  3HJF A;  1DT9 A;  2KLA A;  4BC3 A;  1SQK A;  3QBW A;  4H4M A;  1Q86 O;  3S3O A;  2FSN A;  3F5T A;  1BIU A;  2P9S A;  4JKG A;  3NF6 A;  4YHH K;  3SQ4 A;  3EE8 A;  2QM1 A;  1YI2 N;  1XHX A;  4DLE A;  2KFZ A;  2YKN A;  1IG9 A;  4BAC A;  1WLJ A;  5AQM A;  3BP8 A;  3LDN A;  2E5L K;  3LP1 A;  1QZ5 A;  3CCU N;  3U3G A;  5D3G A;  3MN5 A;  4FJL A;  1IBL K;  3DRS A;  5M1Q A;  4HTL A;  5EX5 A;  4CJK A;  1YT3 A;  4E7J A;  4Z4F A;  3V9S A;  3HVT A;  4E7I A;  4CEO A;  1N33 K;  4KRE A;  4ZHR A;  3TAN A;  1VQP N;  3NMU A;  2GUP A;  4DFM A;  3ZT3 A;  1J5E K;  2R7Y A;  4KB1 A;  2BAN A;  3LP2 A;  1D8Y A;  3GBT A;  4J2E A;  1RTJ A;  4F4K A;  4KTZ A;  5LMN K;  4GY2 B;  2ASP A;  4BRA A;  3R3L A;  4BR9 A;  3W3D A;  4E19 A;  3FZH A;  5JVG L;  4CJU A;  3SYZ A;  3LP0 A;  2GX9 A;  4H0Y B;  4H0T B;  4CIF A;  1VQ7 N;  4EZ9 A;  2UXD K;  2GEM A;  4Z4G A;  3DXM B;  1FXX A;  3MEE A;  3T19 A;  4JAX A;  3VQ6 A;  3HVR A;  4E1M A;  4H5V A;  1C0F A;  3KKR A;  1KQS M;  4FWR A;  4FJJ A;  4OGC A;  1SV5 A;  2O8E B;  3AVI A;  4DLG A;  3OYM A;  2HNY A;  1CZA N;  4CJT A;  3U4L A;  4JD2 A;  2KW4 A;  1T3V A;  4N47 A;  2A42 A;  3O5B A;  3GE1 A;  1K73 O;  3EKU A;  3NH0 A;  2JWK A;  2OPS A;  5KGX A;  4WFN L;  4LFB K;  3CCR N;  5AQJ A;  4IEI A;  5DM7 L;  3O3G A;  3OY9 A;  2YI1 A;  3RSE B;  4FZZ A;  4IXC A;  4CJQ A;  3KKS A;  4W5Q A;  1ZBI A;  5BRD A;  3OBY A;  2GEL A;  4M3Y A;  1JL1 A;  4CVN E;  3WQT A;  1BGX T;  3O9S A;  4EAH D;  3C7N B;  2FF6 A;  2EHG A;  3AAQ A;  4NYF A;  1JLQ A;  4YDU A;  1HQU A;  1VQ4 N;  1U04 A;  1P8Z A;  3THW A;  5CE3 A;  4CK3 A;  3HRG A;  4JI5 K;  1TAU A;  4B9M A;  1NGH A;  2ETJ A;  1NGC A;  4CI6 A;  4CEZ A;  2HVI A;  1X9W A;  4GV6 A;  3WEE A;  4CD3 A;  1IKW A;  4Y1C A;  4YDU C;  1XC9 A;  4EFH A;  4RWT A;  3VQ7 A;  1X3M A;  3L3U A;  4LF6 K;  3A8Y A;  3BF3 A;  2UYT A;  5BPL A;  3EZW A;  3BZC A;  1BHL A;  1WAJ A;  2I7P A;  3KZB A;  1YIJ N;  5JMV A;  3OA9 A;  2PAV A;  1NBW A;  3U9Z A;  4ILG B;  2Q3S A;  3TAB A;  5E84 A;  3KWG A;  2YNH A;  3NCI A;  2HHS A;  2RPI A;  4PA1 A;  5GAG P;  1WBD A;  2B5J A;  2ITG A;  1YF5 L;  3AA3 A;  3BUZ B;  1M1K O;  5KI6 A;  1GOB A;  1VSK A;  2UUB K;  3OYB A;  4FXD A;  1E4F T;  3V1Q A;  1I94 K;  1EWQ A;  1KD1 O;  3OJS A;  4QAG A;  1G15 A;  1VQK N;  3LM2 A;  3PY8 A;  4IFE A;  5CHI A;  2NRT A;  4KH4 A;  4DU4 A;  3ZSV A;  4FL9 A;  4ZTF A;  3BF1 A;  1KVA A;  1JKH A;  4B8C A;  2QWP A;  4CW7 B;  4DV4 K;  2E8A A;  4AM6 A;  4JI2 K;  4FOE A;  1DGK N;  1Q7Y O;  1RDU A;  4KHN A;  2QTD A;  5CYQ A;  5AQW A;  3KLH A;  2FBV A;  2OPP A;  4BR4 A;  4XIU A;  1K8K B;  5BPN A;  3QDK A;  4B1Y B;  3HXM A;  3MX5 A;  4M3R A;  5J2Q A;  2V7Z A;  1NK4 A;  4FPA A;  4IOX A;  4WE1 A;  4KV8 A;  4NCG A;  3ATU A;  3V1O A;  3QML A;  3DM2 A;  2DFF A;  4KHU A;  2KQ2 A;  2P9I B;  2OTL N;  2RF2 A;  2E2P A;  4KHP K;  4O5B A;  4CF9 A;  4A5B A;  4DSF A;  2QWN A;  3AY9 A;  2W40 A;  1XHZ A;  5AQQ A;  3PSI A;  3ENB A;  3T1Y K;  2QKB A;  1RBT A;  1HUX A;  1JJ2 M;  1O13 A;  5BRE A;  3CD6 N;  1X1P A;  2IDO A;  4BWJ A;  3A0I X;  3MWT A;  2NUB A;  3TAE A;  2B6A A;  2DY4 A;  4I6M A;  5BR8 K;  5HRP A;  5LY3 A;  1BI4 A;  4BDZ A;  3A5M C;  4LY7 A;  5EVZ A;  1RT5 A;  3AVG A;  4CGF A;  4DF4 A;  4YFU A;  1KTQ A;  2ZF5 O;  2FSJ A;  1NGI A;  1SL2 A;  5AQS A;  2PYL A;  3VES A;  1Z05 A;  3VTI A;  1CLQ A;  2UUA K;  4E7L A;  4R5P A;  2Z1I A;  4ISF A;  2NRZ A;  3E9P A;  1GOC A;  3KK1 A;  3R8E A;  4DTN A;  4DHY A;  1BWF O;  3TU5 A;  4M7Y A;  5AZI A;  4BQL A;  2D0O A;  3VQD A;  1VK0 A;  1Y64 A;  1Z26 A;  2D0B A;  3GDQ A;  4R79 A;  5I9E B;  4E1J A;  4HCB A;  4KH5 A;  4B3O A;  1VRU A;  4X66 K;  3DOL A;  1HKB A;  1D9D A;  3QES A;  3V4I A;  4DR1 K;  4YOY A;  2OPQ A;  1ZBH A;  4OVL A;  4CES A;  4CJP A;  3AAR A;  4H0O A;  4FLT A;  4KTW A;  2W6L A;  4Z4H A;  1BIS A;  1X9J A;  5MLC Q;  4IO9 L;  3WT0 A;  3OYF A;  3P31 A;  3ZX2 A;  2HBM A;  3ID6 A;  3G25 A;  4DTU A;  3P4I A;  2BH1 A;  2WFB A;  2O8F B;  4BG8 A;  4PKG A;  3M8S A;  1BQM A;  3VQA A;  5AR0 A;  3LDL A;  4C1N I;  4AQY K;  1ZC6 A;  4HUG A;  4U7B A;  4C8L A;  3OTO K;  4KHQ A;  3ASM A;  3NGI A;  3WXJ A;  4DS4 A;  4CHO A;  2DTU A;  3ULD A;  2CH6 A;  3A5N C;  4GVE A;  1C6V A;  5LL6 Z;  1NGA A;  2A1R A;  1YUW A;  1XI1 A;  3ZT2 A;  3F2K A;  4CEC A;  4IDK A;  4ISG A;  3WUH A;  4F9O A;  2I7N A;  3EYZ A;  3SNN A;  3H3O B;  3L2V A;  3TI0 A;  5I42 A;  3NF7 A;  4A2B A;  2OYQ A;  4FLX A;  4MDB A;  3IAY A;  1BQN A;  1KAY A;  4CFD A;  2GTD A;  2ZGZ A;  4CF1 A;  5C25 A;  1RBU A;  3J7Z O;  1BI4 B;  1D5A A;  4DV0 K;  3AVA A;  2WOM A;  1LV5 A;  1QSY A;  4CZM A;  3HOT A;  4M3U A;  3NH1 A;  4B9N A;  3O3F A;  2HHU A;  3UKU A;  4C8K A;  3QB0 A;  1SZ2 A;  4YOU A;  4JYA K;  3P38 A;  3EO3 A;  3SI6 A;  3ZLJ A;  4AHU A;  4DSK A;  1YTA A;  3V9U A;  3AVB A;  3DYA A;  4NLB A;  1KAX A;  1B9F A;  1D4X A;  1U4B A;  5B8H A;  1NOY A;  3QIC A;  2D1K A;  4CF8 A;  3NDK A;  2O8B B;  4BR0 A;  2QWM A;  2KKZ A;  4LF9 K;  4DQR A;  3DLB A;  1VSE A;  3ATV A;  1HKG A;  3O9U A;  1Z6R A;  1JCF A;  3L4I A;  3I33 A;  4NLC A;  3KK3 A;  3D2E B;  5J2P A;  3MXI A;  3PIP L;  3RMB A;  2YHY A;  4FW1 A;  3IDH A;  4QCL A;  3TAF A;  3AVK A;  4ZTJ A;  3UB5 A;  3CCJ N;  2CGL A;  2HHQ A;  2D0C A;  4NO7 A;  4DV5 K;  2OZS A;  4BR2 A;  1MWM A;  1SL1 A;  3VQ4 A;  4DR4 K;  4CBW A;  2Q0R A;  4GV9 A;  3TAR A;  5C0Y A;  4J8F A;  2F7T A;  1WSJ A;  3K5M A;  1J54 A;  4OPJ A;  3SMS A;  1LWF A;  1RIL A;  2HB5 A;  3ZT0 A;  3IS9 A;  4FJH A;  4NXN K;  3PUF A;  1RFQ A;  5AFU H;  4OPH A;  2PY5 A;  1LCU A;  4BRK A;  4O0J A;  2D0P A;  4OJR A;  1XNQ K;  1KAZ A;  4BR5 A;  3HTV A;  2O4I A;  3EL2 A;  3CC7 N;  1U49 A;  1LWC A;  4OKE A;  4N5S A;  2OCE A;  3DXK A;  1XMO K;  1UA0 A;  1RTI A;  1XWL A;  4B1U B;  4WCE L;  3J7Y P;  2IS3 A;  1HNV A;  1U2V A;  3SAH A;  4IWV A;  5K14 A;  2FC0 A;  3PX6 A;  4K42 A;  4DV3 K;  3JXU A;  2P5O A;  4B3R K;  3H6E A;  3ZSZ A;  4KHW A;  3GOI A;  3VF4 A;  4LFA K;  4G1Q A;  3SZ2 A;  3L4Q A;  1SS6 A;  3WXL A;  3HPO A;  2JLE A;  3E66 A;  4RG8 A;  1EP4 A;  4BG9 A;  4XH4 A;  3OYA A;  3VN5 A;  3L2Q A;  5A2Q O;  3HZ6 A;  4K8X A;  5C42 A;  2XRI A;  1TKX A;  3LDO A;  4K43 A;  4DQQ A;  1MDU B;  5AQY A;  3OYN A;  1FJG K;  2JWL A;  4CFC A;  3AO3 A;  3LAL A;  1HJO A;  4FK4 A;  1QHA A;  2A3Z A;  3MDQ A;  2ZJR L;  3KD1 E;  3SV3 A;  1U47 A;  3S3M A;  5FRO A;  3TWH A;  1VHX A;  4JI0 K;  1UA1 A;  3HP6 A;  4EIA A;  4FLV A;  3OYI A;  3PX4 A;  1IBM K;  2G8I A;  3E9L A;  4CK2 A;  5IWA K;  2HNZ A;  1MU2 A;  4I6M B;  5F0X A;  1T8E A;  2HMI A;  4FJ8 A;  2YHX A;  5FPD A;  2P9N B;  5AQX A;  1NGF A;  1R0A A;  3TTF A;  2OA8 A;  3LAN A;  2QWR A;  4H5W A;  3UKR A;  1QS4 A;  2WON A;  4JV5 K;  1C0M A;  4JI4 K;  3AA4 A;  3ENH A;  3H45 C;  1NJZ A;  4PL7 A;  5C2F A;  3LZI A;  3O4W A;  2P9I A;  3KLG A;  1OH8 A;  4HUE A;  4FLZ A;  2Z1J A;  1WSE A;  3SAG A;  4DR5 K;  1NM1 A;  3D2F A;  3OJU A;  3ZSQ A;  4CJV A;  2E6M A;  4H0P A;  4GMJ B;  3ZCM A;  4H8K A;  3K0S A;  1QQC A;  2AP1 A;  3I56 N;  1BCM A;  3HO1 A;  2VGM A;  4JHD A;  4I7F A;  1K9M O;  2HF4 A;  4IOA L;  4DV1 K;  3E1Y A;  2EWS A;  1QQO A;  2E20 A;  3IRX A;  1HKC A;  2CH5 A;  3V9Z A;  1BO5 O;  2HOE A;  4PHT X;  4FWM A;  1VSL A;  5GAE P;  3VF2 A;  4O55 A;  1QE1 A;  3MAQ A;  1JLG A;  4PL8 A;  2GWJ A;  3K5N A;  4WF9 L;  4GW6 A;  1A5W A;  3DJC A;  4N56 A;  4EZ6 A;  3NF9 A;  4CZF A;  4DTR A;  4DV6 K;  3WNF A;  4BC2 A;  4DSJ A;  4M3T A;  4BRF A;  2HBL A;  5FPM A;  3H1Q A;  3M8R A;  2JGU A;  4HWI A;  3K2P A;  4DU3 A;  4B1X B;  3BEX A;  4BQZ A;  3WNH A;  4RW4 A;  3WNE A;  3TSQ A;  3WQU A;  1S1V A;  1W0H A;  3VTH A;  3UE5 A;  3R6M A;  3QEX A;  5BRH A;  2FBY A;  4AHR A;  4CCH A;  1HNW K;  1RTH A;  4JKF A;  1U48 A;  4LFC K;  4FWL A;  1P90 A;  4CEE A;  1WOQ A;  4GKJ K;  4DG1 A;  5C12 A;  1XNR K;  3SV4 A;  1S1W A;  2HHV A;  4LF7 K;  4FWQ A;  1Z25 A;  4CBU A;  4OLA A;  4CD1 A;  3QNN A;  4FO0 A;  4KFB A;  5JLF A;  4DTP A;  3CCL N;  3TSP A;  1RBV A;  3CCV N;  3RWU A;  3HP9 A;  1TKT A;  3OW2 M;  4BRP A;  3DRP A;  2VWB A;  1W2B M;  3ZYY X;  1LAW A;  3PV8 A;  1HMV A;  3SK3 A;  4IDH A;  4CFA A;  3SJH A;  2YNI A;  4DR3 K;  5CZ2 A;  3MK6 A;  4KRF A;  1NKC A;  1OH5 A;  2Z1H A;  2VWK A;  1HNI A;  3M5R A;  4DR2 K;  3O08 A;  3V1R A;  4J2B A;  1VSH A;  4MO5 A;  3FZL A;  4CJE A;  1BU6 O;  5AQK A;  1DKG D;  2E1Y A;  2F96 A;  3FLC O;  3QLH A;  4CHZ A;  3C95 A;  3LM9 A;  4AHT A;  2NRV A;  4KO0 A;  3R9P A;  5KRT A;  3QO9 A;  4JRQ A;  4I9Q A;  3CQX A;  4O4G A;  4DUZ K;  2HBK A;  4E0D A;  2RHK A;  3M1F A;  2Q0U A;  4TSX A;  4FVU A;  2F9W A;  3P83 D;  3MED A;  3LWL A;  4HCC A;  2W41 A;  4FWK A;  3O1W A;  5F1X A;  1YAG A;  4KB0 A;  3CG7 A;  4CJL A;  4A57 A;  3Q7C A;  5J1E A;  4CGH A;  4FM1 A;  1KCF A;  2Y1J A;  1B9D A;  3DXM A;  3AVL A;  3VGM A;  1ASV A;  3OYL A;  3P39 A;  4LH4 A;  3S3N A;  3MX2 A;  3JAM O;  3MN7 A;  4MQ3 A;  1YJN N;  2F8S A;  3BGR A;  4M63 C;  2YHA A;  2AA4 A;  1JLB A;  3PIO L;  5CZ1 A;  4DU1 A;  4DQP A;  2A1S A;  3N4P A;  4BGB A;  3NE6 A;  4QS8 A;  2XHB A;  4CZH A;  3AGR A;  5J2N A;  2YHB A;  4CJ3 A;  3G10 A;  4OPA A;  3TAP A;  4YOW A;  4WQ5 C;  5AQH A;  3QIP A;  4H03 B;  3WXM B;  4XH5 A;  3CQ8 A;  3FFI A;  3VMF B;  2X6S A;  2YJF A;  5BPM A;  3CC2 N;  1WN7 A;  2NRH A;  4Z94 A;  2O8F A;  1KVB A;  3VQE A;  3MEG A;  5GIP A;  2HHX A;  4FWN A;  5HLF A;  5CY4 A;  3IG1 A;  4FJ7 A;  5E26 A;  1BG3 A;  3A5O C;  3C6H A;  3C6U A;  3SAF A;  3O4N A;  3HST B;  5AQN A;  3L0Q A;  2G8W A;  3BZK A;  4PY5 A;  1Y97 A;  1Q8I A;  1C0U A;  3EY1 A;  4WQ4 C;  5AFU A;  3VEN A;  4EP5 A;  3QFP A;  3DLR A;  4H0X B;  2VG7 A;  3AVH A;  3CER A;  1RT6 A;  2O8D A;  1WBB A;  3HSC A;  3RMD A;  3CFO A;  4U67 L;  2HHT A;  4JRP A;  5CR4 A;  2GWK A;  2QEX N;  4I2Q A;  4FCY A;  1VAZ A;  2QI2 A;  5J2M A;  4NCB A;  3VQQ A;  3ZET A;  1JLA A;  2DFE A;  1TYQ A;  3DLL L;  3NFA A;  1NGJ A;  4OPK A;  4CHN A;  4E7H A;  4DS5 A;  3VEZ A;  1N34 K;  3PX0 A;  2HND A;  3VEO A;  3M8Q A;  4JKD A;  4BRG A;  4HTU A;  1RBR A;  4J2A A;  1FKP A;  4BRH A;  4BRO A;  3ISN C;  2B4J A;  3I8D A;  1NKE A;  3CFP A;  1T44 A;  3UKR B;  3PSF A;  4JI7 K;  4CE9 A;  4A5A A;  4K0K K;  1GLE G;  3RR7 A;  1ZBF A;  3ZSY A;  2CGJ A;  4CIG A;  3NBP A;  1TKZ A;  1N5Y A;  4B1Z A;  3NGZ A;  4KHY A;  1BOT O;  1SKR A;  1EQY A;  3O9Q A;  2YKM A;  4K25 A;  4BDP A;  3DXK B;  1ASU A;  4RW9 A;  3I0S A;  3BDP A;  3IKM A;  2X74 A;  4B9Q A;  1RTD A;  1SUQ A;  3SQ0 A;  3RMA A;  1UWB A;  3KK2 A;  3ZEU A;  2ZE2 A;  4FJK A;  2FXU A;  1GLD G;  4GVM A;  4ELT A;  2VCP A;  3MXJ A;  3VQB A;  1XMQ K;  3OYJ A;  2UU9 K;  1ZXO A;  3C65 A;  4CZK A;  4DCH A;  3AV9 A;  4O0I A;  1SKW A;  5HBM A;  4Y0W A;  3OYH A;  1NJX A;  3VPZ A;  4BWM A;  1HPZ A;  2F9T A;  3KHY A;  4DKW A;  4CHQ A;  1Q82 O;  4HHT A;  5H1S Q;  3DLE A;  1S22 A;  3VGK A;  4IKF A;  2O8C A;  2OZM A;  3H3N O;  3ID8 A;  1IH7 A;  1SL0 A;  1NMD A;  5AQO A;  1HR0 K;  2P9N A;  4IO8 A;  2HW3 A;  2J4R A;  4BY9 C;  5AZJ B;  3KTQ A;  4CEB A;  1BIZ A;  1W97 L;  4AHS A;  4FYD A;  1HYV A;  3RRG A;  3AVN A;  1U2V B;  2ITM A;  2OPR A;  3AVF A;  1NG9 A;  4CZE A;  3LDQ A;  2V52 B;  5IT9 O;  4KI4 A;  1WNS A;  1TGO A;  3IUC A;  1IBK K;  1CXQ A;  3L3V A;  1ATR A;  3ITH A;  3LPT A;  4B9V A;  3TTD A;  2QKK A;  4X62 K;  3SUO A;  3VET A;  4E3S A;  3KIO A;  3AVC A;  4NXM K;  4EHT A;  4AH9 A;  3THY A;  1NNE A;  3CM5 A;  4BGA A;  4F3T A;  3AA2 A;  3PO4 A;  2QA4 N;  1EKE A;  4CGI A;  5C2D A;  4FJ9 A;  3VQP A;  5JS1 A;  4W5T A;  2IAJ A;  2DFH A;  4YOT A;  4JN4 A;  2O8C B;  1JLC A;  5AQL A;  3RR8 A;  2IOC A;  1DEJ A;  5M1O A;  4M3W A;  1KC8 O;  1R59 O;  1C0T A;  2PZS A;  4MFB A;  1C0G A;  4EP4 A;  4JK8 A;  1JL2 A;  2ZQB A;  4OKJ A;  1EX4 A;  3CMA N;  2QW9 A;  3S41 A;  4LH5 A;  1TL1 A;  3VOV A;  1W7A A;  3AVJ A;  4BRE A;  1NGG A;  1C1B A;  2GBZ A;  1DLO A;  5E41 A;  3ZEU B;  2FBX A;  1HX1 A;  4DSE A;  3CME N;  4EHU A;  3OS1 A;  1U45 A;  1DTT A;  5DM6 L;  2PYJ A;  4X64 K;  4YNQ A;  3DRR A;  5AQG A;  3J80 O;  1XC3 A;  4A2A A;  4JD2 B;  3OVN A;  1N6Q A;  4Y1D A;  1MWK A;  4O8U A;  4IG0 A;  1RT1 A;  1NGE A;  1J5O A;  3CCQ N;  2RN2 A;  5AQZ A;  3HT3 A;  1RDC A;  3SPZ A;  1S1T A;  3HOS A;  3K57 A;  4OGE A;  3LDP A;  1ITG A;  4CEA A;  4FK2 A;  3L2W A;  4BC4 A;  3K5L A;  2E6L A;  3J7A P;  3CYM A;  1L5U A;  3NAE A;  2WUS A;  1VSJ A;  1ZBU A;  3U8X A;  4PWD A;  1RBS A;  4DB3 A;  3H08 A;  5KQ8 A;  4F3O A;  4UQG A;  2YNF A;  5DMR A;  5HRN A;  5BN9 A;  1S9G A;  4BRD A;  4LSN A;  2EX3 A;  2VWJ A;  1RCH A;  3ENO A;  3MCA B;  2A5X A;  3IFR A;  1BUP A;  2ZJP L;  1VQL N;  5GIO A;  4JS5 A;  2D5R A;  3UKU B;  3VER A;  4BVP A;  4DF8 A;  3NH2 A;  2HBJ A;  1HPM A;  4B3T K;  4JEP A;  1QHT A;  5JIC A;  2NRW A;  3L2R A;  5M1F A;  3O3H A;  1C1A A;  3FFK B;  1ESV A;  3D7E O;  3OYD A;  4A62 A;  2WC9 A;  4MLH A;  3VEY A;  3PLA A;  4PKI A;  3K9K A;  4RW7 A;  4FVM A;  3LL3 A;  2ZD1 A;  5AQP A;  1VQN N;  5KRS A;  5F2R A;  3H46 O;  4G9Z A;  3G4S N;  1HYS A;  1YJ9 N;  3MCP A;  2KFN A;  2GV9 A;  3SLC A;  4JI3 K;  2GUI A;  1TVR A;  1B92 A;  4CF2 A;  4CBX A;  1RNH A;  1X3N A;  3NHG A;  4J2D A;  3WXK A;  1YVN A;  2Q2R A;  1O1W A;  4H0V B;  4ELU A;  4FJI A;  3EZ5 A;  1WSH A;  1OH6 A;  1RDW X;  2YV0 X;  4BRM A;  1KRP A;  4YOX A;  4LF4 K;  1WB9 A;  1S1U A;  4WQ4 A;  5HRO A;  3WNG A;  4KHS A;  3QFU A;  4CGG A;  1T05 A;  3ZT1 A;  3OBW A;  1TK8 A;  3HM8 A;  3O9T A;  1GOA A;  2Q1N A;  3TSU A;  5ELZ A;  5JVH L;  3O9R A;  4O5F A;  5BN8 A;  1NK6 A;  1HNX K;  1JXE A;  3HL8 A;  2ZM6 K;  1S5J A;  1VSF A;  3DAW A;  4W5O A;  3EN9 A;  1EO1 A;  3C6T A;  1N32 K;  1HYZ A;  2G8H A;  3GL1 A;  2E2Q A;  1KLM A;  4DQS A;  4L3Q A;  3CJB A;  1KSP A;  3DOK A;  2UXC K;  2OAN A;  2YX6 A;  5HOO A;  1BA0 A;  1NMN A;  3AO2 A;  1T6C A;  4BE0 A;  4ISE A;  4AIL C;  1HQE A;  2BTF A;  4CK1 A;  1T03 A;  2NRR A;  4FJM A;  4JKE A;  3THX B;  2KHO A;  4FWS A;  2E4L A;  5KTQ A;  1RT3 A;  1LW2 A;  5AQT A;  4WFA L;  2W42 A;  1QQN A;  4ID1 A;  2P9P A;  2E1Z A;  3HBT A;  4LSL A;  2DPN A;  4DTM A;  2P9K B;  5GAH P;  1JXB A;  4LF8 K;  1KVC A;  1NJY A;  4OX9 K;  3C94 A;  4Z0U A;  3BY5 A;  1QSS A;  2FBT A;  2IVP A;  4IOC L;  3SPY A;  2IIR A;  5C15 A;  1RDA A;  3IMX A;  4KTQ A;  1XQS C;  4CJ5 A;  4GV3 A;  4DV2 K;  2IVO A;  4DTJ A;  4ILH A;  3LZJ A;  1N8R O;  1IO2 A;  4FM0 A;  4M7X A;  2PFU A;  3RVC A;  3VEV A;  1TK0 A;  1ZYQ A;  1C1C A;  1OH7 A;  4YOV A;  1JLF A;  1IKY A;  1NOZ A;  5HP1 A;  3D0P A;  1UOC A;  4IBN A;  4DTO A;  1GLB G;  4IZ9 A;  2W6K A;  1S6P A;  2FF3 B;  2IGI A;  2P9U B;  3CI5 A;  3HI0 A;  5HRR A;  3OYC A;  2HHH K;  4FZX C;  2HF3 A;  1GLA G;  2P9P B;  3MXM A;  1HRH A;  4FLW A;  4W5N A;  4N41 A;  3FGU A;  4E89 A;  3SUP A;  3THX A;  4KH6 A;  4DR7 K;  4B08 A;  4JHD B;  3KVG A;  2RE2 A;  4CGJ A;  1S3X A;  4WFB L;  4FJN A;  4FJX A;  2P5G A;  3ZSO A;  4JK9 A;  4F8R A;  1EXQ A;  4NYN A;  4CZL A;  3C6A A;  5JLH A;  3QNO A;  3CJA A;  1TL3 A;  1CZ9 A;  1ZBL A;  4F2S A;  3MN6 A;  3EEQ A;  2P9L A;  2WBN A;  3KK7 A;  3UIQ A;  1L3S A;  1M90 O;  4JKA A;  4FLU A;  4JK7 A;  3GG4 A;  3RRH A;  2HST A;  1W9H A;  4CFB A;  3CJ9 A;  4KKO A;  3ZX0 A;  3KLF A; 
#chains in the Genus database with same CATH homology
 3ZT4 A;  3NGZ A;  4KHY A;  1NK9 A;  1SKR A;  4L8R B;  1B9F A;  4Q0B A;  4JLH A;  3SJJ A;  4BE1 A;  1U4B A;  2YKM A;  2XO7 A;  2P1J A;  2G8U A;  3DLK A;  4BDP A;  2AJQ A;  1ASU A;  1NOY A;  4CJR A;  3CFR A;  4C8M A;  4O44 A;  3I0S A;  1DTQ A;  4RW9 A;  2LSN A;  2X74 A;  4CF8 A;  3NDK A;  3BDP A;  1RDD A;  4M41 A;  1RTD A;  1SUQ A;  3SQ0 A;  4KPY A;  1EET A;  4DQR A;  3RMA A;  1UWB A;  3I0R A;  3KLE A;  3KK2 A;  4CJS A;  2VG6 A;  3DLB A;  4KAZ A;  4FJG A;  1VSE A;  3DMJ A;  2G8F A;  3HK2 A;  4DQI A;  5CYM A;  3JYT A;  3ALY A;  3G0Z A;  4CJW A;  2ZE2 A;  4E1N A;  4FJK A;  3DLH A;  2QK9 A;  4FZY A;  2IC3 A;  2X78 A;  4GVM A;  3V81 A;  2XY5 A;  3KK3 A;  5J2P A;  3MXI A;  1LAV A;  3AO4 A;  2KZM A;  4ICL A;  1YVU A;  3MXJ A;  3VQB A;  4B8A B;  3OS0 A;  3RMB A;  4FW1 A;  4ELT A;  3OYJ A;  3VQ9 A;  3SUN A;  3TAF A;  3AVK A;  1X9M A;  4QCL A;  4ZTJ A;  3AV9 A;  2G8K A;  2I5J A;  4O0I A;  2X6N A;  1SKW A;  2HHQ A;  2D0C A;  2ATQ A;  5HBM A;  1TK5 A;  2F8T A;  1NJX A;  3OYH A;  2BE2 A;  4FK0 A;  1IKX A;  4ELV A;  5DK5 A;  2OZS A;  2HVH A;  2KZZ A;  1SL1 A;  4BWM A;  3VQ4 A;  2YNG A;  3HJF A;  3OYK A;  1HPZ A;  2Z1G A;  3TAR A;  3LAM A;  4CHQ A;  4H4M A;  1WSJ A;  3K5M A;  1J54 A;  4OPJ A;  1RDB A;  4HHT A;  4B9S A;  3S3O A;  1BIU A;  3DLE A;  4IKF A;  1LWF A;  1RIL A;  3VQ5 A;  2OZM A;  2HB5 A;  3NF6 A;  3SQ4 A;  1IH7 A;  3ZT0 A;  3RTV A;  3IS9 A;  1SL0 A;  4FJH A;  4C8O A;  3PUF A;  2HW3 A;  2XY6 A;  1XHX A;  4FJ5 A;  4DLE A;  2KFZ A;  1ASW A;  2YKN A;  3U6F A;  1IG9 A;  2PY5 A;  4BAC A;  1WSF A;  1A5V A;  3KTQ A;  4CEB A;  4Z4I A;  1BIZ A;  1WLJ A;  4O0J A;  4M3Z A;  4AHS A;  4FYD A;  1HYV A;  3RRG A;  3AVN A;  4OJR A;  3LP1 A;  1KFS A;  2OPR A;  3U3G A;  3AVF A;  5D3G A;  3TAM A;  2O4I A;  4FJL A;  1NK7 A;  1U49 A;  4N76 A;  3DRS A;  1LWC A;  4OKE A;  1WNS A;  4N5S A;  4KI4 A;  1TGO A;  4Z4C A;  1UA0 A;  1RTI A;  2BGG A;  1XWL A;  1CXQ A;  4CJK A;  1WSI A;  1YT3 A;  4E7J A;  3L3V A;  3V9S A;  3HVT A;  4HVJ A;  4E7I A;  4Z4F A;  2IS3 A;  1HNV A;  3ITH A;  3LPT A;  5FDL A;  4CEO A;  4KRE A;  4B9V A;  2QKK A;  4ZHR A;  3SUO A;  3TAN A;  5K14 A;  4E3S A;  3KIO A;  2FC0 A;  3SCX A;  4CJ4 A;  3PX6 A;  1Q9Y A;  3AVC A;  3LP3 A;  4B9U A;  3SQ2 A;  4AH9 A;  3CM5 A;  2P5O A;  4F3T A;  3AA2 A;  3PO4 A;  1NK8 A;  3ZSZ A;  1EKE A;  3ZT3 A;  4CGI A;  4DFM A;  2R7Y A;  3RMC A;  3VQP A;  4KB1 A;  4FJ9 A;  4HUF A;  2BAN A;  3LP2 A;  3NF8 A;  1D8Y A;  4W5T A;  2IAJ A;  3QEI A;  4J2E A;  2DFH A;  1VSM A;  4G1Q A;  3SZ2 A;  1RTJ A;  1JLC A;  4F4K A;  4KTZ A;  3RR8 A;  2IOC A;  3ZSR A;  3HPO A;  2JLE A;  2G8V A;  4RG8 A;  5I3U A;  1NK5 A;  1EP4 A;  4M3W A;  1C0T A;  4E19 A;  3OYA A;  2PZS A;  4MFB A;  3VN5 A;  4CJU A;  3L2Q A;  4EP4 A;  1VSD A;  1D9F A;  3PO5 A;  5C42 A;  3SYZ A;  3LP0 A;  1JL2 A;  4ID5 A;  2ZQB A;  4K8X A;  2XRI A;  4DTS A;  1TKX A;  4OKJ A;  4DQQ A;  1EX4 A;  2Y1I A;  4CIF A;  3OYN A;  3F9K A;  4EZ9 A;  4CFC A;  3AO3 A;  3LAL A;  4Z4G A;  4LH5 A;  1FXX A;  1TL1 A;  3MEE A;  3T19 A;  4AHC A;  4FK4 A;  3JSM A;  3AVJ A;  3VQ6 A;  4CER A;  3KD1 E;  3SV3 A;  3HVR A;  1U47 A;  4E1M A;  3S3M A;  1C1B A;  2GBZ A;  5FRO A;  5FRN A;  2XY8 A;  3KKR A;  3TWH A;  1J9A A;  1UA1 A;  1DLO A;  3HP6 A;  4FJJ A;  4OGC A;  5E41 A;  1SV5 A;  3B6O A;  3QEV A;  2FBX A;  1NK0 A;  3AVI A;  4DLG A;  4DSE A;  4FLV A;  3OYM A;  3OYI A;  3PX4 A;  2HNY A;  3OS1 A;  3QET A;  4CJT A;  4I9L A;  3HPG A;  1U45 A;  1DTT A;  2G8I A;  2PYJ A;  4YNQ A;  4CK2 A;  3DRR A;  1NKB A;  2HNZ A;  1MU2 A;  2KW4 A;  1T8E A;  4N47 A;  3CM6 A;  2HMI A;  4FJ8 A;  1RT7 A;  3NH0 A;  3OVN A;  3ZSX A;  1N6Q A;  4Y1D A;  2OPS A;  1I3A A;  1L3V A;  5KGX A;  4DWI A;  4IG0 A;  1R0A A;  1RT1 A;  4CIE A;  1J5O A;  2OA8 A;  2RN2 A;  3LAN A;  3O3G A;  3OY9 A;  1QS4 A;  4M42 A;  4FZZ A;  4CJQ A;  3HT3 A;  1RDC A;  2WON A;  1C0M A;  3SPZ A;  3KKS A;  4W5Q A;  1ZBI A;  1VSI A;  3AA4 A;  1FK9 A;  1NJZ A;  5FRM A;  1FKO A;  4OLB A;  1S1T A;  4FLY A;  4M3Y A;  1JL1 A;  4M45 A;  3K57 A;  4OGE A;  3LZI A;  1BGX T;  3KLG A;  4HUE A;  4FLZ A;  2Z1J A;  1ITG A;  4CEA A;  1WSE A;  4FK2 A;  3L2W A;  3K5L A;  2E6L A;  3CYM A;  1RT4 A;  3OJU A;  2EHG A;  1L5U A;  3NAE A;  3ZSQ A;  1WSG A;  4NYF A;  1VSJ A;  1ZBU A;  2E6M A;  1JLQ A;  4CJV A;  4KB0 A;  4GMJ B;  3ZCM A;  4H8K A;  1T7P A;  1QQC A;  1HQU A;  1BCM A;  1U04 A;  4FW2 A;  3HO1 A;  1BL3 A;  3AA5 X;  4CK3 A;  4PWD A;  4I7F A;  1RBS A;  4DSL A;  4DFP A;  1TAU A;  4IG3 A;  4B9M A;  3H08 A;  3HYF A;  4B9L A;  4CEQ A;  3M8P A;  4F3O A;  2ETJ A;  3L2U A;  4UQG A;  4CEZ A;  2YNF A;  3IRX A;  4RW8 A;  5DMR A;  1X9W A;  3KD5 E;  2HVI A;  3V9Z A;  5HRN A;  3LAK A;  3QEW A;  1IKW A;  4Y1C A;  1XC9 A;  1S9G A;  1VSL A;  3VQ7 A;  4LSN A;  4Z4E A;  2EX3 A;  2VWJ A;  4O55 A;  1RCH A;  3L3U A;  1QE1 A;  3MAQ A;  1JLG A;  4FM2 A;  3K5N A;  1BHL A;  1WAJ A;  4GW6 A;  1A5W A;  4H4O A;  1S6Q A;  4N56 A;  4EZ6 A;  3NF9 A;  2D5R A;  4JS5 A;  3VA3 A;  4DTR A;  2Q3S A;  3TAB A;  4DF8 A;  4LD0 A;  3NH2 A;  1QSL A;  2YNH A;  3NCI A;  1I39 A;  3WNF A;  2RPI A;  4DSJ A;  4M3T A;  2HHS A;  4PA1 A;  3KJV A;  1QHT A;  2B5J A;  3M8R A;  2ITG A;  2JGU A;  3AA3 A;  3L2R A;  3K2P A;  3NGY A;  5KI6 A;  2D0A A;  4JS4 A;  1GOB A;  1VSK A;  1C1A A;  3O3H A;  4QOZ B;  4DU3 A;  3OYB A;  4FXD A;  3V1Q A;  5JS2 A;  1S9E A;  3OJS A;  3WNH A;  3OYG A;  4QAG A;  4RW4 A;  3OYD A;  3WNE A;  1G15 A;  3PY8 A;  1S1V A;  1W0H A;  3P1G A;  4DSI A;  4RW7 A;  4DU4 A;  4FVM A;  3ZSV A;  2ZD1 A;  1IKV A;  5KRS A;  3QEX A;  3V6D A;  3QEP A;  4KHW A;  4ZTF A;  2FBY A;  2QXF A;  4AHR A;  4CCH A;  1KVA A;  1RTH A;  1JKH A;  1U48 A;  4B8C A;  1HYS A;  3O4Q A;  4CEE A;  3ZSW A;  2KFN A;  4DG1 A;  2GV9 A;  3SV4 A;  2GUI A;  1TVR A;  1S1W A;  2HHV A;  1B92 A;  4CF2 A;  1Z25 A;  4OLA A;  1RNH A;  3QNN A;  3NHG A;  4J2D A;  4KFB A;  4KHN A;  4DTP A;  5CYQ A;  4C8N A;  1RBV A;  1KLN A;  1O1W A;  3RWU A;  3HP9 A;  4ELU A;  3KLH A;  2FBV A;  2OPP A;  1TKT A;  4XIU A;  4FJI A;  3DRP A;  1WSH A;  3B6P A;  3HXM A;  1RT2 A;  3EZ5 A;  2YV0 X;  4M3R A;  1LAW A;  5J2Q A;  3TAQ A;  1NK4 A;  3PV8 A;  1KRP A;  1HMV A;  1L3U A;  1S1U A;  3QIN A;  4CFA A;  4WE1 A;  4KV8 A;  2YNI A;  4IFY A;  4NCG A;  5CZ2 A;  3V1O A;  5HRO A;  4KRF A;  3WNG A;  1NKC A;  4KHS A;  3DM2 A;  2DFF A;  2HHW A;  2Z1H A;  4KHU A;  2XY7 A;  3D45 A;  2VWK A;  5SWM A;  2KQ2 A;  4DFK A;  4Q5V A;  2RF2 A;  1HNI A;  4CGG A;  1T05 A;  3ZT1 A;  4O5B A;  4CF9 A;  4DSF A;  1TK8 A;  3V1R A;  1GOA A;  4J2B A;  2BDP A;  1XHZ A;  5SZT A;  2KTQ A;  1VSH A;  2QKB A;  4CJE A;  1RBT A;  1NK6 A;  1BCO A;  1JXE A;  2F96 A;  3HL8 A;  4B9T A;  3QLH A;  4CHZ A;  3C95 A;  1S5J A;  1VSF A;  1CXU A;  4CF0 A;  1X1P A;  4PUO A;  2IDO A;  4AHT A;  4BWJ A;  3VQ8 A;  4W5O A;  3S9H A;  4KO0 A;  5KRT A;  4JRQ A;  3QO9 A;  2NUB A;  4I9Q A;  3V9U A;  3TAE A;  4CGD A;  2B6A A;  4O4G A;  3C6T A;  2DY4 A;  4E0D A;  1HYZ A;  2G8H A;  1KLM A;  4DQS A;  4TSX A;  1VRT A;  5HRP A;  1KSP A;  1BI4 A;  3P83 D;  3DOK A;  4BDZ A;  4LY7 A;  3MED A;  1RT5 A;  3AVG A;  4CGF A;  3LWL A;  4CHP A;  2P51 A;  4DF4 A;  3SUQ A;  4HCC A;  4YFU A;  1KTQ A;  3NBP A;  1CZB A;  3TAG A;  1SL2 A;  1S1X A;  3AO2 A;  4BE0 A;  1HJR A;  3CG7 A;  4CJL A;  4OKK A;  4CEF A;  4DFJ A;  4AIL C;  2PYL A;  5J1E A;  4PQU A;  4CGH A;  4FM1 A;  1HQE A;  1KCF A;  4CK1 A;  3LPU A;  2Y1J A;  3A2F A;  4AHV A;  1T03 A;  1B9D A;  1CLQ A;  3AVL A;  4E7L A;  4R5P A;  2Z1I A;  3K59 A;  4FJM A;  1ASV A;  3OYL A;  1GOC A;  3KK1 A;  4DTN A;  4LH4 A;  2E4L A;  5KTQ A;  3U3Y A;  3S3N A;  1RT3 A;  1LW2 A;  1NJW A;  2W42 A;  4MQ3 A;  4ID1 A;  2F8S A;  3VQD A;  3OYE A;  4LSL A;  3BGR A;  4DTM A;  2YHA A;  1JLB A;  1VK0 A;  1A5X A;  1JXB A;  1Z26 A;  1KVC A;  2D0B A;  5CZ1 A;  4BE2 A;  1NJY A;  1K6Y A;  2O4G A;  4DU1 A;  3C94 A;  4HCB A;  4Z0U A;  3AO5 A;  3L8B A;  2A1S A;  3AO1 A;  3E01 A;  1QSS A;  1VRU A;  4DQP A;  4B3O A;  2FBT A;  3NE6 A;  3DOL A;  2XHB A;  1LW0 A;  1D9D A;  3SPY A;  5J2N A;  2YHB A;  4CJ3 A;  3OS2 A;  3DI6 A;  1RDA A;  3G10 A;  3K5O A;  3QES A;  4KI6 A;  4KTQ A;  3V4I A;  3TAP A;  1QTM A;  4CJ5 A;  1JLE A;  3QIP A;  3THV A;  3CQ8 A;  2OPQ A;  3FFI A;  1ZBH A;  3DLG A;  2X6S A;  5JS1 A;  1WAF A;  4OVL A;  4CES A;  4DTJ A;  1WN7 A;  4CJP A;  3LZJ A;  1X9S A;  3HPH A;  3LDS A;  3V9X A;  1IO2 A;  4FM0 A;  1KVB A;  4FLT A;  4KTW A;  4Z4H A;  1BIS A;  3T3F A;  3VQE A;  3MEG A;  1LWE A;  2HHX A;  3OYF A;  4CHY A;  2RKI A;  1Q9X A;  5HLF A;  5CY4 A;  1TK0 A;  1F21 A;  3IG1 A;  4RW6 A;  1ZYQ A;  4FJ7 A;  4DTU A;  1C1C A;  5KGW A;  1TV6 A;  1SKS A;  1JLF A;  3C6U A;  1IKY A;  3M8S A;  1NOZ A;  5HP1 A;  3AVM A;  3O4N A;  1BQM A;  3HST B;  3VQA A;  3HM9 A;  3D0P A;  1UOC A;  4IBN A;  4DTO A;  3SQ1 A;  1S6P A;  4HUG A;  3V9W A;  4CED A;  2G8W A;  4C8L A;  4PY5 A;  4I2P A;  1Y97 A;  4KHQ A;  2IGI A;  3ASM A;  3NGI A;  1Q8I A;  1C0U A;  4DS4 A;  3T1A A;  4CHO A;  3EY1 A;  4DMN A;  3ULD A;  2DTU A;  4K8Z A;  5HRR A;  4EP5 A;  3OYC A;  3DLR A;  4FZX C;  2VG7 A;  3AVH A;  3QER A;  1RT6 A;  4BDY A;  3MXM A;  1HRH A;  1C6V A;  4FLW A;  4W5N A;  3K58 A;  4N41 A;  3TR8 A;  3RMD A;  3CFO A;  4E89 A;  3F73 A;  1UAX A;  2A1R A;  3SUP A;  1XI1 A;  2HHT A;  3ZT2 A;  4JRP A;  4I2Q A;  1TAQ A;  4CEC A;  4IDK A;  4DTX A;  3KLI A;  4FCY A;  4B08 A;  3EYZ A;  3SNN A;  1YTU A;  1TKD A;  3L2V A;  4CGJ A;  5J2M A;  3TI0 A;  5I42 A;  3NF7 A;  3VQQ A;  4FJN A;  4NCB A;  3VQC A;  4E7K A;  4FJX A;  2OYQ A;  3QIO A;  4FLX A;  2P5G A;  1JLA A;  2DFE A;  3NFA A;  3ZSO A;  4OPK A;  4CHN A;  1BQN A;  4CFD A;  4E7H A;  4CF1 A;  5C25 A;  4DS5 A;  3IAY A;  4F8R A;  1RBU A;  3PX0 A;  1EXQ A;  1BI4 B;  2HND A;  1D5A A;  4NYN A;  1REV A;  3M8Q A;  4HTU A;  3AVA A;  5EU7 A;  1RBR A;  2WOM A;  3MEC A;  3LWM A;  3QNO A;  1LV5 A;  1TL3 A;  1CZ9 A;  3VA0 A;  1ZBL A;  1QSY A;  4J2A A;  1FKP A;  1J53 A;  4F2S A;  3ISN C;  4M3U A;  4NCA A;  3NH1 A;  2B4J A;  3O3F A;  3I8D A;  1NKE A;  2VG5 A;  4B9N A;  4M3X A;  2HHU A;  4CJF A;  5C24 A;  3UIQ A;  4C8K A;  5HRS A;  3CFP A;  1L3S A;  3P5J A;  4F2R A;  5T7B A;  4FLU A;  3SI6 A;  4CE9 A;  3RRH A;  4W5R A;  4IFV A;  1W9H A;  4AHU A;  1L3T A;  4CFB A;  1KFD A;  3RR7 A;  1ZBF A;  1YTA A;  3ZSY A;  4DSK A;  4KKO A;  4CIG A;  3AVB A;  1TKZ A;  3DYA A;  1N5Y A;  3KLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...