2RHKA

Crystal structure of influenza a ns1a protein in complex with f2f3 fragment of human cellular factor cpsf30, northeast structural genomics targets or8c and hr6309a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
PASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for suppression of a host antiviral response by influenza A virus.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/nuclear protein
molecule keywords Non-structural protein 1
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2rhkA00
3OA9A 3P39A 3O9TA 2RHKA 3P38A 3KWIA 3L4QA 3O9QA 3EE8A 3M5RA 3P31A 3O9SA 3RVCA 3D6RA 2GX9A 2KKZA 3O9UA 3F5TA 3O9RA 3EE9A 3KWGA 4OPAA 4OPHA
chains in the Genus database with same CATH superfamily
3HT3A 4FWSA 1MWMA 4HCCA 1J53A 4IOCL 2ZE2A 3M6GA 1NK7A 2BE2A 3DM2A 1J54A 5DMRA 4JKCA 3AA5X 2ZGYA 1UAXA 4H0TB 3A0IX 3OYGA 4DB3A 1ZBHA 4KTQA 4ISGA 5JLFA 2NUBA 2KW4A 5BPMA 1QSLA 4V19S 1KAZA 2PYJA 4IKFA 2VG7A 3OYNA 4M41A 1ZYQA 3MEEA 4LFCK 3HRGA 5EY4A 5B8HA 4KRFA 1BO5O 3H6EA 4I6MB 4MO4A 4BDPA 3B8AX 2G8KA 1T7PA 2QW9A 3QINA 2E2OA 4BR2A 1R59O 3TSQA 1LOTB 3U9DA 4E1MA 4LF6K 4OO1J 3SLCA 1TKDA 1LAWA 1C0MA 1XMOK 1HPZA 4KHWA 3QMLA 1X9JA 2Z1HA 4BC2A 4CIFA 3AY9A 4CFCA 1SL1A 3P38A 3AVIA 4DV6K 2KLAA 4E0DA 4CHOA 2WFBA 1ZBUA 4B9LA 2E1ZA 3DRPA 4M3ZA 5JVHL 3V6DA 1JL2A 3NVMA 1S1UA 1GLDG 4CHPA 1JCFA 4DSKA 2IOCA 3VPZA 3C6HA 3QEVA 4LFAK 4EP5A 1VSKA 4FW1A 3MAQA 1VQ7N 4ID1A 4B1YB 2G8WA 3H3OB 5C15A 4CZFA 4KFBA 1Z26A 2EX3A 3I33A 3ZT1A 1CLQA 2OTJN 4IEEA 5AZIB 4CI6A 4IG0A 4CF1A 2W40A 4R79A 5IT9O 2QWLA 1S22A 4KHYA 4FJ5A 1HKGA 1RDDA 4FJJA 3DXKA 3GOIA 1NK5A 4LC9B 3O4NA 4XEIA 4CJQA 3DI6A 1VSFA 4RW6A 3IDHA 4M3UA 4DKWA 4BY9C 4Z4CA 5HOOA 1A5WA 3MN7A 3TAGA 3RWUA 3VF6A 2Q0UA 4DQPA 4FYDA 1VQLN 1NGBA 1EX4A 1ZBFA 3N4QA 4FWOA 4DR3K 1ZC6A 3MWTA 2P9IB 5BRHA 3CQ8A 3MDQA 1RDUA 1LAVA 4BC3A 4DTXA 2HHWA 3EL2A 3CCSN 3QLHA 3VQDA 5KRSA 1NKBA 2KFNA 3SJHA 3FZHA 1NOZA 3LALA 3MCAB 2OZMA 4B9TA 2FLOA 2XY7A 1S9EA 3DXMA 2XY8A 2A40A 3AVCA 3HSTB 2KZZA 3DLLL 1CXQA 1N5YA 1J5EK 4BC4A 3NMUA 4CECA 4GV3A 4B1ZA 2WUSA 3T3FA 3L2QA 1IO2A 3CJBA 3BUZB 3D2EA 2OPQA 4A5AA 1OVQA 3NH0A 5FPNA 1SL2A 3AVBA 3J7ZO 4MLEA 5AQFA 4A61A 3EE9A 3ZT0A 3EYZA 3LZJA 2IDOA 3V81A 4FJKA 4B9QA 1HYSA 4A62A 2F96A 1Z25A 4DSLA 3R8EA 3PX6A 1TL1A 2Q0RA 3HPHA 4JS5A 3PIOL 4AHRA 4MFBA 4QS8A 4LSNA 1W2BM 1L3SA 3C0BA 3N4PA 3CC2N 4B3MK 3ZEUA 1XNQK 4X64K 2NRZA 3AGRA 3RVCA 3LPTA 4WCEL 3K5MA 3ENBA 3DAWA 2OCEA 2Q3SA 4A2BA 4FJLA 1B9FA 3CC4N 3VA0A 3G10A 4A5BA 2O8CA 4BR5A 1HKBA 2QA4N 1WAFA 2XHBA 2EWSA 3ZSZA 4DTNA 3MN6A 1YVNA 1QSYA 3VQ6A 1MU2A 2P9IA 3TU5A 4FW2A 4CJRA 3VEYA 3AVAA 3DJCA 4IZ9A 5TKWA 2FSKA 5KGXA 4FZZA 3EZ5A 3E9LA 3P1GA 1OVYA 4JI2K 3QDKA 1YITN 1YTAA 4NCBA 3O3GA 1B92A 3OYAA 1IH7A 3VQBA 4AH9A 1HUXA 1RGIA 3CJ1A 3E66A 1SAZA 3WXIA 4O0JA 1OH7A 4JS4A 4FK0A 1BA0A 4BRMA 4FLWA 4RW8A 3DOLA 1M90O 1NJWA 4FWKA 3A5LC 4K8XA 3ZSWA 3KD5E 2G8VA 4OKJA 4FJIA 5HBMA 1NK8A 3MX2A 1QVGM 1NGHA 2H3GX 3I0SA 3NCIA 1XC9A 2BTFA 4PKHA 3D2FB 2DPNA 1TGOA 4OKEA 1HQUA 3VEOA 3FLCO 3I56N 1X9MA 2E5LK 1TK5A 4M63C 1WLJA 1HR0K 2GELA 5C42A 2DY4A 3KIOA 1JLFA 1IKWA 4BRHA 3UIQA 1SV5A 3NH1A 2HHXA 1KSPA 2CH6A 1TAQA 2CGJA 3K58A 2HNYA 4DR1K 1Q86O 1HX1A 4FPAA 4U7BA 3D2EB 3HVTA 3U4LA 3QEWA 3V9XA 2D0PA 1A5VA 1ATSA 3GE1A 4OLBA 3SK3A 3RSEB 4CJWA 5M1FA 4FL9A 4CEOA 1K9MO 1U04A 1U6ZA 2O4GA 2KQ2A 1NGEA 3HBTA 1TKXA 1EETA 4ILJA 3M8PA 4XIUA 3T1HK 4K41A 4WQ4C 4XH4A 3OA9A 4IWVA 2FSJA 3DLGA 5AQJA 1F21A 1Y64A 2O8BB 4FWRA 2PZSA 3NF7A 1U47A 4CEAA 4BROA 4DU1A 3TAQA 2ASOA 3THVA 5GIOA 4CF9A 1NGFA 4QCLA 3M1FA 2BH1A 1I39A 3UKRB 3AVKA 5MLCQ 4BR7A 3GG4A 3O9UA 5BPNA 3MK6A 2HHVA 4DFPA 3MN9A 3VESA 3C6AA 5CZ1A 3SUPA 3B6OA 3V9SA 3ULEA 2Y1JA 3L2UA 3VF2A 1DTQA 3LM9A 3LDOA 4A2AA 4CJ4A 4KB0A 4NYNA 3CCRN 1J9AA 3OYBA 4Z4FA 3AA4A 5F2RA 3LDQA 1S9GA 4Y0WA 5CYMA 2FXUA 5AQXA 3SV4A 3HZ6A 3KWGA 1HNVA 5E84A 1G15A 2HBLA 1HKCA 3SPZA 1T05A 3TAPA 4BG9A 3KK3A 2E2NA 4JI4K 2HHSA 3L2RA 4CEBA 5JMVA 2OYQA 4OGCA 4CZMA 2B4JA 1JXBA 3OYFA 3K9KA 4DSIA 3AGKA 4BRIA 3OY9A 2HVHA 4F8RA 3THWA 1CZ9A 4BWMA 5AQNA 3RRHA 1W97L 1VQ5N 3JYTA 3FGUA 4H5VA 4NCGA 2HNDA 2NNWA 4BG8A 4JKAA 3KK7A 3LAKA 2GV9A 4ELTA 4M3WA 2QI2A 3O5BA 3O1BA 3WUHA 1BGXT 2QM1A 1KFDA 3ZYYX 5M1OA 3V1QA 1TYQA 4JKBA 3G71N 5T7BA 4BRDA 3EY1A 4IEIA 3TTFA 4DCHA 3CJAA 4H0XB 3ZSOA 2ZJPL 5HP1A 5I9EB 4F9OA 4Z4IA 4GV9A 4KH5A 1N32K 5KRTA 3JSMA 4FWLA 4Z0UA 1KFSA 5LJVA 5BPLA 1VHXA 4FK4A 1EO1A 3EZWA 2VGMA 3O08A 2E6MA 2KFZA 2VG5A 3HOTA 4CZIA 1ZBIA 1C1CA 4JV5K 4CZHA 3H46O 1L5UA 4RW7A 4KTZA 5FPDA 4CZGA 2WOMA 4OVLA 1RT5A 4H5WA 2D5RA 3VQ5A 3CCUN 3D0PA 3M3ZA 5EX5A 3CFPA 3OYKA 3CPWM 4LF7K 4ICLA 2RHKA 3RMAA 4NXMK 4FWPA 5KGWA 2VG6A 3DXKB 1WBBA 3OJUA 4YNQA 2QEXN 3VGLA 1A5XA 1M1KO 2HF3A 2HNZA 1C0GA 1S5JA 4LSLA 4DTRA 3H1VX 3TTCA 4CJEA 1TYQB 1JLCA 4BRPA 3OYIA 4YOYA 3LL3A 3OTOK 1NGCA 1YF5L 4DR5K 4PKGA 2P9LA 5A2QO 4CJKA 4HVJA 4CJUA 1RT6A 2P9UB 3BY5A 4DR2K 3CF5L 3LDNA 4H0PA 1HYZA 3KVGA 5BR8K 2HMIA 1C1BA 2Z1IA 4WFAL 2GX9A 4OX9K 4H5RA 4YFUA 2O8EA 3THYB 3C7NB 3VTIA 1KLNA 3OYMA 2VWBA 4DQIA 2D1KA 4C1NK 1P90A 3NGYA 4BQZA 5GINA 4JKEA 4KHSA 4C8MA 4CJTA 1WSIA 1U4BA 3IUCA 4CJ3A 1KD1O 5EOYA 4NO7A 4BE1A 2YV0X 4M3YA 2HB5A 2QWMA 2ZGZA 3HP9A 2VQFK 1T6DA 3A8YA 3CCJN 3J81O 1TUUA 4B9MA 3SQ0A 3O1WA 3VERA 3TARA 3FFIA 1C1AA 3RSEA 4BGAA 3NGZA 1XHZA 4DSJA 4BRNA 3MCPA 1LCUA 1RTHA 4IG3A 3OYLA 3PSIA 1CZAN 1T8EA 4DHYA 4CFDA 3PX4A 2NZTA 4CJLA 2YNIA 4I2PA 4CHQA 1HYVA 3RMDA 2P1JA 4HUEA 3DLKA 3SUQA 3ZETB 3CCQN 3C65A 3L4IA 2A5XA 4JI5K 1K6YA 2OPRA 2E4LA 4LH4A 2QXFA 4H0OA 4KH4A 4BDYA 3K2PA 1UOCA 3CD6N 4E7IA 2O8DA 4YORA 1QTMA 5C10A 4LF9K 1RBVA 1W9HA 5CHIA 4Z4GA 2OTLN 1RTJA 1SZ2A 4CZKA 4DS4A 1YAGA 3R3LA 3J7AP 2E2PA 3E1YA 4CEFA 1SL0A 1IBLK 2P9SB 4F4KA 1MDUB 5FROA 3DLRA 3NE6A 4IJAA 1S72N 4I2QA 4J2AA 2NRVA 3DWLA 3ATVA 1S6PA 2P9NB 2YCHA 5EXWA 3IAYA 1JCEA 1MWKA 1WUAA 3AVGA 3AVJA 3J80O 3NF9A 5TKYA 4Y1DA 1BU6O 2HF4A 3PY8A 3ZT3A 2NRRA 1LWEA 5F1XA 2WC9A 1SKSA 2CH5A 4CFAA 3M8QA 4Z4EA 2E8AA 1U48A 3NGIA 3TWHA 4ELVA 2QXLA 1BIUA 2ETJA 2A41A 3AO1A 3CJ7A 4KKOA 5LY3A 4FM0A 5AQKA 1BQNA 4PL7A 1V4SA 2IAJA 3AO2A 2O8EB 5CR4A 5AR0A 4BE2A 4I6MA 4GVEA 4J2BA 2GUIA 5BN9A 4FJHA 4L8RB 2O8DB 4FPBA 3ZSRA 4I9QA 3OHRA 4FJXA 4DR7K 4CK3A 4NCAA 3TSPA 3E01A 4FJ8A 3HVRA 1Q9XA 3CMAN 5EVZA 3FZFA 3UKUA 4LF8K 2V51B 1TVRA 4FJGA 4KHNA 3O3HA 3O4WA 5AQTA 1JLEA 4J8FA 2XY6A 4DTMA 2FBTA 2YHYA 4CIEA 1ZBLA 3OYEA 4AF1A 4OGEA 3WQTA 2ZQBA 1DEJA 1QHTA 1GOBA 3O8MA 3OYCA 4FCYA 4E89A 2X6NA 5KTQA 5AQQA 3W0LA 4PWDA 4DSFA 2W6LA 5CY4A 3QBWA 2VWKA 4W5QA 4FLTA 3VF4A 3E9PA 3S9HA 1NGIA 2AA4A 2FBYA 1BQMA 4RW4A 4DTOA 3TI0A 2W42A 1VQON 3SAFA 4JYAK 2ZD1A 3I55N 1YJWN 4B9NA 3RMCA 4IFVA 1QSSA 3OS0A 3OYDA 1HMVA 4AHTA 1LW2A 4AM6A 3ALYA 1RT4A 4KB1A 3VQEA 2ZJRL 4CZLA 4X65K 2ZF5O 4CF0A 1RT7A 2F8SA 1BA1A 3ISNC 3K0SA 1JLAA 4YOTA 1VQ6N 4NLCA 1N34K 3H1QA 1FJGK 1UWBA 1WNSA 5AQWA 2YX6A 4JI8K 2OANA 1BOTO 4DV7K 4CGFA 1FK9A 3C7NA 4DQQA 4FWMA 1D8YA 2Q31A 4ID5A 4DV0K 2GEMA 5M1KA 4IOXA 1XNRK 2ZWHA 2KZMA 2QKBA 3DXMB 1TK0A 4KI6A 4HTUA 2WBNA 4JLHA 4UQGA 1K73O 1QQNA 3EKUA 3KD1E 3C95A 4FM2A 4NYFA 4CJ7A 4AILC 4AM7A 3SAHA 4EHTA 3H08A 4B3RK 4FJNA 2HHQA 3CETA 3WXLA 5EU7A 3PLAA 4DMNA 4MDBA 5FPMA 4FO0A 1RT3A 3P4IA 4M7XA 3O9SA 4KI4A 1IJJA 1OKJA 1JXEA 3CG7A 2QWOA 2ZM6K 1VQPN 1TK8A 4DU3A 3CCVN 2FBVA 4DV5K 3C6UA 3QFPA 2P9LB 2A6AA 3RMBA 3SYZA 4C8KA 4GW6A 3O9TA 3HTVA 3SMPA 1ESVA 3WEEB 4JK7A 3CMEN 1YXQA 2OPSA 3K9JA 1WBDA 3VEXA 3ATUA 1P8ZA 5FRNA 4BR9A 1VRTA 2RN2A 3NH2A 1GOCA 1BCMA 1N8RO 1X3MA 2HHTA 1TKZA 4B9VA 4DF4A 4B9SA 4PHTX 1HJRA 3R9PA 4JK8A 4FWNA 4WYBA 2XY5A 5FPEA 4BRKA 2E6LA 1QQCA 3KLGA 1E4GT 2X74A 1ILYA 3CC7N 2NRXA 4MQ3A 1L3TA 1N6QA 3KTQA 2A1SA 1NK9A 1KTQA 4GMJB 2O8FB 4JI7K 1BISA 3ZCMA 3U8XA 3AAPA 3HYFA 2I5JA 4AHVA 5AQVA 3KLIA 3WNFA 3VEWA 3ZX3A 4FLYA 3ZT4A 4DTSA 4CEEA 1RT1A 3HSCA 4O5FA 3PV8A 4M3TA 2UXCK 2QWPA 3R1XA 3WNEA 4CD1A 3QEPA 1IBKK 1KVCA 4FVUA 1C0FA 2RE2A 4B08A 3ULDA 1RDAA 5AFUH 4H0VB 3WEEA 3DLHA 3PIPL 3BF1A 4DUYK 4LF4K 3AO3A 2Q2RA 4W5TA 4JNEA 1Q9YA 2HOEA 3K5NA 3IMXA 4JAXA 1NOYA 2P51A 1YT3A 2QKKA 1ASWA 4N47A 4DTUA 4B1UB 4CJ5A 3G4SN 5HLFA 1VSIA 3GBTA 1G99A 1O13A 3LDSA 1ZBSA 2LSNA 4CCHA 3OW2M 2Q36A 1OH8A 3CFRA 2IC3A 3AVMA 4DLEA 5AQRA 3DRRA 2A42A 1RFQA 5I42A 1NGDA 3G25A 3QFUA 2F8TA 3HP6A 3F5TA 3ID6A 3A5OC 3IRXA 4YDUA 4JD2A 4BE0A 3RR7A 2YNHA 3IFRA 3P39A 1DLOA 1NMNA 4PUOA 1SQKA 3SQ4A 3OYHA 2J4RA 3FE1A 4W5OA 2PY5A 4JKDA 2P5GA 5BR9A 5HRRA 1NNEA 3SI6A 3F73A 3P83D 3THXB 3UKUB 2GWKA 2VYPA 5KQ8A 1KQSM 1RDBA 1RBTA 3ZSYA 5J2NA 1Q18A 4M3RA 1NJYA 2ATQA 2R7YA 1EWQA 4JEPA 1BUPA 3HO1A 4PKIA 2ITMA 1WN7A 4YDUC 4M45A 2DFFA 3AVHA 3FR0A 4DV2K 1BWFO 4AHCA 3D7EO 4RCHA 3EKSA 1EQYA 3C6TA 3U3YA 4BRLA 3V9WA 4DF8A 4C8LA 4GKJK 1TAUA 3CXCM 4FLVA 3S3OA 4C8NA 3CCMN 1WSGA 1IG8A 4IXCA 4JI3K 5D3GA 1ASVA 2UUBK 5KI6A 4A57A 2G8FA 4I9LA 2QWNA 1NKCA 5HRNA 3TAMA 4BR0A 4JD2B 2AJQA 5M1NA 1WOQA 3R6MA 3AA2A 4HTLA 3QESA 5GAEP 5DM6L 4H5NA 5JS1A 4DG1A 4FZYA 3SBGA 1BG3A 1YI2N 4DTPA 4CF2A 1NK0A 4PQUA 1BI4A 4HHTA 3ZLJA 5LL6Z 3J7YP 3EEQA 1W0HA 3CHWA 5AQZA 4IO8A 1JL1A 1ITGA 4JHDA 3DOKA 3MN5A 5HRSA 1BHLA 2FF3B 3L3VA 3L8BA 4RW9A 3LZIA 4M42A 2FF6A 1VQ9N 3F9MA 2PAVA 1REVA 3L0QA 3SZ2A 1IG9A 4X62K 1K8AO 4DTJA 1S6QA 2RF2A 1SKRA 4NXNK 4CGDA 5FRMA 1K8KB 4CEDA 4CBWA 1IKXA 2DTUA 2FBXA 3S3MA 1H1VA 2AP1A 5C12A 2YKNA 3SNNA 4LH5A 2XO7A 2V7ZA 1IKVA 5ELZA 4CFBA 4DV3K 5AQUA 1NMDA 1VSMA 1FKOA 5LMNK 3B6PA 1RT2A 4DU4A 3TABA 2VQEK 1RCHA 4A59A 2DFHA 4DR6K 3SV3A 3AO4A 2IS3A 2OZSA 1RDCA 5AQLA 3HXMA 2QK9A 2UXDK 1E4FT 4WFBL 3LPUA 1VQMN 3MECA 4XH1A 4CBXA 4BACA 3AA3A 5C0YA 3D2FA 2CGKA 4FJ7A 3WXMB 1QVFM 4JRPA 3WXJA 2JLEA 1J6ZA 4BVOA 2QWRA 2Q1NA 3SMSA 4J2EA 4ZTJA 2HMPA 1D9DA 4WQ4A 4CESA 3NDKA 1J5OA 1VQKN 5AQGA 2HBJA 2NRTA 4BRQA 2F9WA 2JWKA 4WQ5C 3MX5A 2YNGA 1RNHA 5K14A 5GAHP 1WAJA 4JI1K 5HRPA 1X9SA 5I3UA 4HCBA 3EE8A 4CEZA 2CGLA 1S1WA 3OS2A 4B1WB 2B6AA 4EHUA 3A5MC 3CCEN 4CK2A 5BRFA 4IJNA 3W3DA 4BRGA 1W7AA 4BRAA 3LWLA 2V7YA 4CBUA 3KK1A 4RTFD 3JXUA 5HL7L 4YY3K 4ISEA 2P9PA 5C24A 3LANA 3QEIA 1NK4A 1O1WA 1DTTA 3ZSXA 4OLAA 4GV6A 4DQ8A 4B3OA 3AVLA 4M3XA 4E1JA 3DLEA 1CXUA 1TKTA 3VQQA 1VSEA 4W5RA 3I0RA 5SZTA 3O80A 1WSFA 3SUOA 1N33K 4CGHA 3M8RA 4F3TA 1HNIA 3WNGA 1S1TA 3O9QA 1U49A 1LW0A 3M5RA 1D9FA 5AQSA 4KHPK 3GL1A 1NGAA 4FWQA 4CK1A 2NLXA 5AQMA 1TUYA 3MXMA 3SJJA 4LD0A 1QZ5A 3QICA 5GAGP 3K5LA 4YOUA 2ZJQL 1NK6A 4B3TK 1U2VB 3NVKA 1V4TA 1KCFA 3MMVA 1EP4A 2YHWA 1YIJN 2E88A 3F9KA 4FSVA 2D0AA 4EZ6A 4KREA 1HNZK 3KLEA 2ASMA 2IVOA 4ILHA 1DGKN 2DFEA 3NHGA 4DR4K 1Q8IA 1S1VA 4H4OA 1R0AA 3BZKA 2YHXA 3Q7BA 1L3UA 4KTWA 4CIGA 3FFKB 1JJ2M 4JI6K 4BQLA 5J2MA 2BANA 1JLBA 3SAGA 3NAEA 1S3XA 5CYQA 2HW3A 1YHQN 1ATNA 3PX0A 2P9NA 5AQHA 5AJ3K 3O9RA 1NWKA 4ELUA 3F2KA 2GUPA 1YJ9N 2YHBA 2D0BA 2G8HA 4OKKA 2I7NA 5HROA 4BR4A 1X3NA 4CJFA 5BRDA 4DV4K 4JKGB 3QIPA 5KPTA 3K57A 1T6CA 5GADP 2Z1GA 3D45A 4L3QA 4B8AB 3QETA 2G8IA 3CQYA 2IGIA 4B1VA 2GWJA 1JLQA 3K5OA 1KRPA 4WE1A 3ZSVA 3ZX2A 3KKRA 3KJVA 1JCGA 1HNXK 4CZJA 5J2PA 3HI0A 4O55A 1YJNN 4E7JA 2OPPA 4KO0A 3JAMO 1Y97A 1VQNN 1YTUA 4CHZA 4GVMA 3BDPA 3RRGA 5CZ2A 4DV1K 3TAFA 1DT9A 1QZ6A 3UE5A 3LP0A 4B9UA 4FOEA 4BRCA 3CJCA 4K8ZA 3L3UA 1KAYA 2Q97A 3O6WA 1ATRA 3IG1A 3QBXA 3S41A 3T19A 4YOXA 1RILA 2V52B 4O8KA 3VQ4A 1JLGA 1WSEA 3ZT2A 2P5OA 3H3NO 1HPMA 1XUPO 3KWIA 3P5JA 3HL8A 3VTHA 2XRIA 4GY2B 4BC5A 4TSXA 1UA0A 3CCLN 3QNNA 4H4MA 1VAZA 4BVPA 4DFKA 2A3ZA 2QTDA 2W41A 2A1RA 3FZMA 3ASMA 3A2FA 1EXQA 4MO5A 5M1QA 4BRFA 3H45C 3I8BA 1N36K 3V9UA 3QERA 4WF9L 5DK5A 3TR8A 3HOSA 3DYAA 3CJ9A 1X9WA 3NBPA 2YNFA 4G9ZA 3CPEA 4C1NI 5E26A 2WONA 4NLBA 3HM8A 4CJSA 1NKEA 4UY8O 1IKYA 1C6VA 4X66K 1B9DA 3DRSA 1XC3A 2Z1JA 4FK2A 4O0IA 4IOAL 3BZCA 4FLXA 4CD3A 4CW7B 3THYA 5C25A 4NB4A 3AAQA 4JK9A 1QE1A 1XWLA 4K25A 2VGNA 3T1AA 1LV5A 3KLFA 3E9OA 3P31A 3BEXA 3VQ9A 3VEVA 2P9KB 3O3FA 3CM5A 3WQUA 3J8AA 1HNWK 4B8CA 2O4IA 1KLMA 3T69A 1QQOA 4QS9A 3DMJA 4CGGA 3LM2A 5ADXA 2JWLA 1X1PA 4EAHD 3K59A 3KZBA 3TTDA 1BI4B 5C2DA 3PO4A 4HWIA 1Q82O 1GLEG 4MDAA 3AO5A 3KKSA 5C2FA 4CVNE 3I8DA 3VA3A 2VCPA 4C23A 4BREA 4QAGA 1XI1A 1L3VA 4N41A 2D4WA 4YHHK 2PFUA 4CJPA 3BGRA 1RBSA 3U6FA 1NGGA 4PY5A 4FM1A 3TPQA 1XMQK 3HK2A 3GDQA 5AQYA 1JKHA 1HJOA 1Z05A 4O5BA 3KLHA 2HSTA 3U3GA 4DFMA 1BCOA 5E41A 4RWTA 5KPZA 3MXIA 3VETA 3EO3A 3LWMA 2W6KA 3VMFB 4N5SA 4LY7A 4GKKK 5KQDA 1U2VA 4E3SA 4JI0K 3SPYA 3QB0A 3AVFA 5BREA 4Z94A 4K0KK 2F4VK 4E1NA 2WTUA 3G6EN 1GOAA 2PBDA 4K43A 1KXPA 4JRQA 1I3AA 4BWJA 4BGBA 1LWCA 5LMUK 3NF8A 2YKMA 3ZSQA 3ZX0A 2PYLA 2YI1A 1HLUA 2P9UA 1VSHA 4Q0BA 5AQIA 1RBRA 1NJZA 3KHYA 4AHUA 1K8KA 2O8FA 4W5NA 1GLJO 3V1RA 1XQSC 3KK2A 1BIZA 2HHUA 3LDPA 4CHYA 1YVUA 2YHAA 4KBOA 1BDGA 4WQ5A 4O8UA 1D5AA 2F7TA 2D0CA 1NGJA 4DSEA 2BUPA 3ID8A 2RPIA 2GTDA 4OPAA 5AQOA 1NU0A 3T1YK 1FW6A 5J2QA 5JLHA 1NJXA 4LFBK 4IDHA 4O44A 1WB9A 3MWPA 3NF6A 4DLGA 5SWMA 1D4XA 1EKEA 3SQ2A 2BDPA 2QWQA 1QS4A 2X78A 4BDZA 4YOVA 3AV9A 3VQAA 1GLBG 1T3VA 3SUNA 4J2DA 3CIPA 1KVAA 1IBMK 3RR8A 1E3MA 3QIOA 4DFJA 2I7PA 1NJIO 3CYMA 4CF8A 2YJFA 3DLBA 4F2SA 1RBUA 1KAXA 4EIAA 1Q7YO 2HBMA 1VQ4N 2P9SA 4EZ9A 1DKGD 1RTDA 3LAMA 5KPRA 2OA8A 2NRHA 5GIPA 4CERA 5JS2A 3OS1A 3UKRA 3CI5A 4FJMA 2EHGA 1VSDA 1TL3A 1FKPA 1GLFO 3VENA 4H8KA 4FJ9A 1HRHA 5BN8A 1I94K 1NM1A 5H1SQ 4HUGA 4QOZB 2FC0A 4N76A 3CERA 1LWFA 2O8CB 3LDLA 4CGJA 5FDLA 1NBWA 3HJFA 1U45A 3UB5A 3HM9A 2D0OA 4EP4A 3JS6A 4E7KA 3ZEUB 4ZTFA 1VQ8N 3ZETA 3THXA 4C8OA 1IV0A 3VGKA 1VK0A 3U9ZA 4H03B 4WFNL 1KC8O 2VWJA 3PO5A 3PUFA 3V9ZA 4JKHA 3LP3A 3BF3A 4U67L 3SQ1A 1T44A 3AARA 4Y1CA 4O4GA 4IO9L 1YUWA 4CEQA 3C94A 4FLZA 3M8SA 1WSJA 3FZKA 1ZXOA 3THWB 3WXKA 1UA1A 4Q5VA 4HUFA 4CZEA 4ZHRA 4IBNA 1OH5A 4FOIA 3IS9A 1EWRA 3CFOA 3TANA 5AZJA 1Z6RA 3MEGA 4H0YB 3TSUA 5ADXH 5IWAK 4R5PA 2UXBK 4KHUA 1WSHA 4KH6A 4FZXC 1S1XA 3LP2A 4LF5K 4F3OA 4XH5A 2KTQA 2RKIA 3WT0A 2HVIA 3VQPA 1C0TA 2UYTA 2GBZA 1SKWA 3VN5A 5FLXO 2P9PB 3PSFA 4YOWA 3EN9A 3A5NC 4G1QA 1ASUA 4IDKA 4DWIA 3CM6A 4OPHA 4PL8A 2UUCK 5JVGL 2IIRA 1C0UA 3Q7CA 3HPOA 3VEZA 1RDWX 1GLLO 3QEXA 5LJWA 1KVBA 2IVNA 1RTIA 1Q81O 3OYJA 4OJRA 4CE9A 4E19A 4JN4A 3MXJA 3CQXA 3L6QA 2P9KA 3OBYA 5AQPA 2F9TA 3L2WA 3LP1A 3QO9A 3VQCA 3VQ7A 5J1EA 4AHSA 4KAZA 5JICA 4KV8A 3O4QA 4FLUA 2G8UA 1NG9A 2NRWA 4JHDB 2E1YA 5M1PA 4DQSA 3V1OA 5AZJB 4GNIA 2IVPA 4H5TA 5DM7L 3L2VA 3ENOA 1SS6A 4IFYA 4M7YA 2KKZA 2FSNA 1QQMA 2JGUA 3RTVA 4RG8A 1FXXA 2X6SA 1VRUA 2ASPA 3VOVA 3WNHA 4N56A 2O8BA 4JKGA 1GLAG 3ULEB 5CE3A 2Y1IA 4PA1A 1T03A 4AQYK 4CJVA 3MEDA 3AVNA 2KHOA 3HPGA 3L4QA 2HHHK 4FXDA 4OPKA 1CZBA 3ITHA 5F0XA 3NFAA 1QHAA 3OVNA 3VQ8A 4KHQA 3T7ZA 1XHXA 3G0ZA 3SCXA 2UUAK 4JKFA 4QS7A 2E2QA 2B5JA 3VGMA 2E20A 4FVMA 4DS5A 2BGGA 4DUZK 4KPYA 1TV6A 4K42A 4IFEA 4E7LA 3D6RA 1OH6A 4B3SK 2UU9K 3IKMA 4B1XB 4CHNA 4F2RA 1NLVA 4Z4HA 1HQEA 3V4IA 1GLCG 3SBTA 1SUQA 3FZLA 1VSJA 5AFUA 3TAEA 3S3NA 1BL3A 2YJEA 4I7FA 4E7HA 3ENHA 3QNOA 1MA9B 5AZIA 4DQRA 2HBKA 1VSLA 4CGIA 4OPJA 3OBWA 3BP8A 4EFHA 4MLHA 4ISFA 2ITGA 3OJSA 4ILGB
chains in the Genus database with same CATH topology
3BF1A 4BRFA 4FWLA 3H45C 3I8BA 4FWSA 1MWMA 5LJVA 4WF9L 5BPLA 3HOSA 2Q2RA 4IOCL 1EO1A 3M6GA 3CJ9A 3EZWA 2VGMA 3O08A 4JNEA 4JKCA 3HOTA 2HOEA 4CZIA 2ZGYA 3IMXA 4JAXA 4G9ZA 3CPEA 4H0TB 4C1NI 3A0IX 5E26A 4NLBA 4DB3A 4CZHA 3H46O 3HM8A 4B1UB 4UY8O 4ISGA 3G4SN 5JLFA 5FPDA 4CZGA 3GBTA 5BPMA 1G99A 1O13A 1KAZA 1ZBSA 1XC3A 4H5WA 3OW2M 2Q36A 3CCUN 4IOAL 3M3ZA 5EX5A 3CPWM 4CD3A 2RHKA 3HRGA 5EY4A 4NB4A 5AQRA 5B8HA 3AAQA 4FWPA 4JK9A 1BO5O 2A42A 3DXKB 1RFQA 4K25A 2VGNA 3H6EA 1NGDA 4I6MB 4MO4A 2QEXN 3B8AX 3E9OA 3G25A 3P31A 3BEXA 3VGLA 3QFUA 3VEVA 2P9KB 2QW9A 1M1KO 2HF3A 3F5TA 1C0GA 3ID6A 2E2OA 3A5OC 4BR2A 1R59O 3WQUA 3TSQA 3H1VX 3J8AA 3TTCA 1LOTB 1TYQB 4JD2A 4YDUA 3U9DA 3SLCA 4BRPA 4OO1J 4YOYA 3LL3A 1NGCA 1QQOA 4QS9A 1YF5L 3T69A 3IFRA 1X9JA 3LM2A 3P39A 3QMLA 4BC2A 4PKGA 5ADXA 2JWLA 2P9LA 1SQKA 2J4RA 3FE1A 3AY9A 4EAHD 4JKDA 3P38A 5BR9A 3KZBA 2P9UB 3TTDA 5C2DA 2KLAA 2WFBA 4HWIA 2E1ZA 3CF5L 3UKUB 1VQ8N 3LDNA 4H0PA 1Q82O 3KVGA 1GLEG 2GWKA 4MDAA 2VYPA 5C2FA 4WFAL 2GX9A 3NVMA 2VCPA 1GLDG 4H5RA 1JCFA 4C23A 5KQ8A 4BREA 1KQSM 3VPZA 3C6HA 2D4WA 3C7NB 2PFUA 3VTIA 1VQ7N 2VWBA 2D1KA 4B1YB 4C1NK 1P90A 4BQZA 1Q18A 5GINA 4JKEA 1NGGA 3TPQA 3H3OB 4JEPA 5C15A 1BUPA 3GDQA 3IUCA 4CZFA 5AQYA 4PKIA 3I33A 2ITMA 5EOYA 1KD1O 1HJOA 1Z05A 4NO7A 2OTJN 2HSTA 4IEEA 4YDUC 5AZIB 2ZGZA 2QWMA 4CI6A 3FR0A 1T6DA 2W40A 3A8YA 3CCJN 4RWTA 1BWFO 4R79A 5KPZA 3D7EO 4RCHA 1TUUA 3EKSA 1EQYA 3VETA 2QWLA 3EO3A 4BRLA 1S22A 3O1WA 3VERA 3VMFB 3CXCM 4BGAA 3RSEA 1HKGA 3CCMN 3DXKA 3GOIA 1IG8A 4IXCA 4LC9B 5KQDA 4BRNA 1U2VA 3MCPA 4XEIA 1LCUA 3IDHA 3QB0A 4DKWA 5BREA 4Z94A 1CZAN 4A57A 4DHYA 4BY9C 3G6EN 2PBDA 2QWNA 3MN7A 5HOOA 2NZTA 4K43A 1KXPA 4BR0A 4JD2B 5M1NA 4BGBA 1WOQA 3R6MA 4HTLA 3VF6A 5GAEP 2Q0UA 5DM6L 4H5NA 1VQLN 3SBGA 1BG3A 1NGBA 1YI2N 3ZX0A 3ZETB 2YI1A 4FWOA 3N4QA 1HLUA 2P9UA 1ZC6A 3MWTA 2P9IB 5BRHA 3C65A 3L4IA 3MDQA 3CCQN 2A5XA 3CHWA 5AQZA 1RDUA 4IO8A 5AQIA 4JHDA 3KHYA 4BC3A 3MN5A 3EL2A 1K8KA 4H0OA 3CCSN 4KH4A 5JVHL 1GLJO 3CD6N 3SJHA 1XQSC 2FF3B 3FZHA 2FF6A 4YORA 3MCAB 3LDPA 5C10A 1VQ9N 2FLOA 3F9MA 5CHIA 3DXMA 2PAVA 2OTLN 2A40A 4KBOA 1BDGA 3L0QA 4WQ5A 4O8UA 1SZ2A 4CZKA 2F7TA 3DLLL 4BC4A 1K8AO 1NGJA 2BUPA 3NMUA 1YAGA 3ID8A 2GTDA 3R3LA 4OPAA 2WUSA 5AQOA 2E2PA 4B1ZA 4GV3A 3E1YA 5JLHA 1K8KB 2P9SB 1MDUB 3CJBA 4IJAA 3BUZB 4IDHA 4CBWA 1S72N 3MWPA 3D2EA 1H1VA 2AP1A 2NRVA 3DWLA 1D4XA 4A5AA 5C12A 3ATVA 2P9NB 2YCHA 5EXWA 2QWQA 1JCEA 1MWKA 2V7ZA 5ELZA 5FPNA 1WUAA 5AQUA 4YOVA 1NMDA 5TKYA 1BU6O 2HF4A 1GLBG 1T3VA 2NRRA 3CIPA 5F1XA 4MLEA 3J7ZO 2WC9A 5AQFA 4A61A 3EE9A 4A59A 2CH5A 2I7PA 1NJIO 4B9QA 3PIPL 2YJFA 2E8AA 5AQLA 1KAXA 2QXLA 4A62A 4EIAA 1Q7YO 3R8EA 1E4FT 2A41A 4WFBL 1VQMN 4XH1A 3CJ7A 4CBXA 5LY3A 2HBMA 1VQ4N 2P9SA 5C0YA 2Q0RA 3D2FA 1DKGD 2CGKA 5AQKA 3PIOL 3WXMB 4PL7A 1V4SA 2NRHA 4QS8A 5KPRA 3WXJA 5GIPA 1W2BM 1QVFM 1J6ZA 4BVOA 3UKRA 2QWRA 3CI5A 3C0BA 3N4PA 3CC2N 2Q1NA 3ZEUA 1GLFO 2NRZA 3AGRA 3RVCA 3VENA 5CR4A 4WCEL 5AR0A 3SMSA 3ENBA 3DAWA 4I6MA 5BN8A 2HMPA 1NM1A 5H1SQ 4A2BA 4GVEA 5BN9A 4WQ4A 3CERA 3CC4N 4FPBA 5AQGA 2HBJA 4A5BA 1VQKN 4BR5A 1HKBA 2QA4N 3LDLA 2NRTA 4BRQA 2F9WA 3OHRA 2JWKA 4WQ5C 2EWSA 3MX5A 1NBWA 3MN6A 3UB5A 5GAHP 1YVNA 3TSPA 2D0OA 3JS6A 2P9IA 3TU5A 3ZEUB 3CMAN 3EE8A 5EVZA 3FZFA 4IZ9A 3DJCA 5TKWA 2V51B 3UKUA 3VEYA 3ZETA 2CGLA 2FSKA 3VGKA 4B1WB 3O4WA 3E9LA 3U9ZA 4EHUA 4H03B 1OVYA 4WFNL 1KC8O 3A5MC 3QDKA 1YITN 5AQTA 3CCEN 5BRFA 4J8FA 4IJNA 4JKHA 3W3DA 4BRGA 3BF3A 2YHYA 4U67L 4BRAA 1T44A 2V7YA 1HUXA 1RGIA 3AARA 3CJ1A 3E66A 1SAZA 3WXIA 4AF1A 3WQTA 4CBUA 1DEJA 4IO9L 3O8MA 1YUWA 4RTFD 3JXUA 5HL7L 4ISEA 3FZKA 5AQQA 4MO5A 5M1QA 1BA0A 2P9PA 1ZXOA 4BRMA 3W0LA 3WXKA 4CZEA 1M90O 4FWKA 3A5LC 4GV6A 4DQ8A 4FOIA 4E1JA 5AZJA 3QBWA 1Z6RA 4H0YB 3MX2A 3TSUA 1QVGM 1NGHA 2H3GX 5ADXH 3VF4A 2BTFA 3E9PA 3D2FB 4PKHA 1NGIA 4KH6A 2DPNA 2AA4A 3VEOA 3FLCO 3I56N 3O80A 4XH5A 4M63C 1VQON 3SAFA 2GELA 3I55N 3WT0A 1YJWN 2UYTA 4BRHA 3O9QA 4AM6A 3M5RA 2CH6A 2P9PB 2CGJA 5AQSA 4YOWA 3EN9A 3GL1A 1NGAA 3A5NC 4FWQA 2ZJRL 4CZLA 2NLXA 5AQMA 2ZF5O 1TUYA 4OPHA 4PL8A 1BA1A 5JVGL 1Q86O 2IIRA 3Q7CA 1QZ5A 1HX1A 4FPAA 3QICA 5GAGP 4U7BA 3D2EB 4YOUA 4YOTA 2ZJQL 3VEZA 4NLCA 1RDWX 3H1QA 3U4LA 1VQ6N 1GLLO 1U2VB 5LJWA 2D0PA 3NVKA 1V4TA 3GE1A 1ATSA 3SK3A 5AQWA 2YX6A 3RSEB 2IVNA 1BOTO 2OANA 3MMVA 1Q81O 3C7NA 4FWMA 5M1FA 2Q31A 2YHWA 4FL9A 1YIJN 2E88A 2GEMA 4FSVA 4JN4A 1K9MO 5M1KA 3CQXA 1U6ZA 3L6QA 4IOXA 2P9KA 1NGEA 2ZWHA 3HBTA 3OBYA 5AQPA 2F9TA 4ILJA 2ASMA 3DXMB 2IVOA 4ILHA 1DGKN 2WBNA 4K41A 4WQ4C 4XH4A 5JICA 3OA9A 1QQNA 3EKUA 2FSJA 4IWVA 1K73O 4CJ7A 5AQJA 1Y64A 2YHXA 4AM7A 3Q7BA 4FWRA 3SAHA 2NRWA 4EHTA 4JHDB 3FFKB 4BROA 2E1YA 3CETA 1JJ2M 3WXLA 5M1PA 2ASOA 3PLAA 5GIOA 4BQLA 3SAGA 5AZJB 4MDBA 5FPMA 4GNIA 2IVPA 1NGFA 4H5TA 4FO0A 1S3XA 3ENOA 1SS6A 3M1FA 3P4IA 5DM7L 4M7XA 2BH1A 4M7YA 3UKRB 1ATNA 1YHQN 3O9SA 5MLCQ 1IJJA 2KKZA 2P9NA 3GG4A 5AQHA 3O9UA 1OKJA 4BR7A 2FSNA 3O9RA 1NWKA 5BPNA 3MK6A 1QQMA 2QWOA 2GUPA 3F2KA 1VQPN 1YJ9N 3MN9A 3VESA 3C6AA 3CCVN 3QFPA 2ASPA 2P9LB 3VOVA 2A6AA 2I7NA 4BR4A 1X3NA 4JKGA 3ULEA 1GLAG 5BRDA 3O9TA 4JKGB 3ULEB 5CE3A 5KPTA 3HTVA 1T6CA 3VF2A 5GADP 3LM9A 4L3QA 3SMPA 1ESVA 3WEEB 4JK7A 3CQYA 3CMEN 3LDOA 4A2AA 1YXQA 2KHOA 3L4QA 4B1VA 3K9JA 2GWJA 3VEXA 3ATUA 3CCRN 1P8ZA 5F0XA 5F2RA 3LDQA 4BR9A 1QHAA 4Y0WA 3ZX2A 2FXUA 5AQXA 3T7ZA 1JCGA 3HZ6A 3KWGA 4CZJA 3HI0A 5E84A 2HBLA 1YJNN 1N8RO 1HKCA 1X3MA 4JKFA 1VQNN 4QS7A 2E2QA 4BG9A 3VGMA 4PHTX 2E2NA 3R9PA 2E20A 4JK8A 5JMVA 4FWNA 4WYBA 1DT9A 4CZMA 3K9KA 5FPEA 3AGKA 4K42A 4BRKA 1QZ6A 4BRIA 3UE5A 1E4GT 4IFEA 4FOEA 1ILYA 4BRCA 5AQNA 3D6RA 3CC7N 3CJCA 2NRXA 1KAYA 1W97L 2Q97A 1VQ5N 3O6WA 3IKMA 1ATRA 4B1XB 3FGUA 4H5VA 3QBXA 3S41A 1NLVA 4YOXA 2NNWA 2V52B 4BG8A 4JKAA 4O8KA 3KK7A 2QI2A 3O5BA 1GLCG 3SBTA 3O1BA 3U8XA 3AAPA 3WUHA 5AQVA 2QM1A 3FZLA 3H3NO 1HPMA 3VEWA 3ZX3A 5M1OA 3ZYYX 5AFUA 1XUPO 3HSCA 3KWIA 4O5FA 2QWPA 3R1XA 3VTHA 1TYQA 4JKBA 4GY2B 4BC5A 4CD1A 3G71N 4BRDA 4IEIA 2YJEA 3TTFA 3CCLN 4DCHA 3ENHA 4FVUA 3CJAA 4H0XB 1C0FA 2RE2A 1MA9B 2ZJPL 1VAZA 5AZIA 4BVPA 5I9EB 4F9OA 2HBKA 2A3ZA 4GV9A 3OBWA 3BP8A 4EFHA 2QTDA 2W41A 4MLHA 3FZMA 5AFUH 4ISFA 4KH5A 4H0VB 3WEEA 4ILGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA9 A;  3P39 A;  3O9T A;  2RHK A;  3P38 A;  3KWI A;  3L4Q A;  3O9Q A;  3EE8 A;  3M5R A;  3P31 A;  3O9S A;  3RVC A;  3D6R A;  2GX9 A;  2KKZ A;  3O9U A;  3F5T A;  3O9R A;  3EE9 A;  3KWG A;  4OPA A;  4OPH A; 
#chains in the Genus database with same CATH topology
 3HT3 A;  4FWS A;  1MWM A;  4HCC A;  1J53 A;  4IOC L;  2ZE2 A;  3M6G A;  1NK7 A;  2BE2 A;  3DM2 A;  1J54 A;  5DMR A;  4JKC A;  3AA5 X;  2ZGY A;  1UAX A;  4H0T B;  3A0I X;  3OYG A;  4DB3 A;  1ZBH A;  4KTQ A;  4ISG A;  5JLF A;  2NUB A;  2KW4 A;  5BPM A;  1QSL A;  4V19 S;  1KAZ A;  2PYJ A;  4IKF A;  2VG7 A;  3OYN A;  4M41 A;  1ZYQ A;  3MEE A;  4LFC K;  3HRG A;  5EY4 A;  5B8H A;  4KRF A;  1BO5 O;  3H6E A;  4I6M B;  4MO4 A;  4BDP A;  3B8A X;  2G8K A;  1T7P A;  2QW9 A;  3QIN A;  2E2O A;  4BR2 A;  1R59 O;  3TSQ A;  1LOT B;  3U9D A;  4E1M A;  4LF6 K;  4OO1 J;  3SLC A;  1TKD A;  1LAW A;  1C0M A;  1XMO K;  1HPZ A;  4KHW A;  3QML A;  1X9J A;  2Z1H A;  4BC2 A;  4CIF A;  3AY9 A;  4CFC A;  1SL1 A;  3P38 A;  3AVI A;  4DV6 K;  2KLA A;  4E0D A;  4CHO A;  2WFB A;  1ZBU A;  4B9L A;  2E1Z A;  3DRP A;  4M3Z A;  5JVH L;  3V6D A;  1JL2 A;  3NVM A;  1S1U A;  1GLD G;  4CHP A;  1JCF A;  4DSK A;  2IOC A;  3VPZ A;  3C6H A;  3QEV A;  4LFA K;  4EP5 A;  1VSK A;  4FW1 A;  3MAQ A;  1VQ7 N;  4ID1 A;  4B1Y B;  2G8W A;  3H3O B;  5C15 A;  4CZF A;  4KFB A;  1Z26 A;  2EX3 A;  3I33 A;  3ZT1 A;  1CLQ A;  2OTJ N;  4IEE A;  5AZI B;  4CI6 A;  4IG0 A;  4CF1 A;  2W40 A;  4R79 A;  5IT9 O;  2QWL A;  1S22 A;  4KHY A;  4FJ5 A;  1HKG A;  1RDD A;  4FJJ A;  3DXK A;  3GOI A;  1NK5 A;  4LC9 B;  3O4N A;  4XEI A;  4CJQ A;  3DI6 A;  1VSF A;  4RW6 A;  3IDH A;  4M3U A;  4DKW A;  4BY9 C;  4Z4C A;  5HOO A;  1A5W A;  3MN7 A;  3TAG A;  3RWU A;  3VF6 A;  2Q0U A;  4DQP A;  4FYD A;  1VQL N;  1NGB A;  1EX4 A;  1ZBF A;  3N4Q A;  4FWO A;  4DR3 K;  1ZC6 A;  3MWT A;  2P9I B;  5BRH A;  3CQ8 A;  3MDQ A;  1RDU A;  1LAV A;  4BC3 A;  4DTX A;  2HHW A;  3EL2 A;  3CCS N;  3QLH A;  3VQD A;  5KRS A;  1NKB A;  2KFN A;  3SJH A;  3FZH A;  1NOZ A;  3LAL A;  3MCA B;  2OZM A;  4B9T A;  2FLO A;  2XY7 A;  1S9E A;  3DXM A;  2XY8 A;  2A40 A;  3AVC A;  3HST B;  2KZZ A;  3DLL L;  1CXQ A;  1N5Y A;  1J5E K;  4BC4 A;  3NMU A;  4CEC A;  4GV3 A;  4B1Z A;  2WUS A;  3T3F A;  3L2Q A;  1IO2 A;  3CJB A;  3BUZ B;  3D2E A;  2OPQ A;  4A5A A;  1OVQ A;  3NH0 A;  5FPN A;  1SL2 A;  3AVB A;  3J7Z O;  4MLE A;  5AQF A;  4A61 A;  3EE9 A;  3ZT0 A;  3EYZ A;  3LZJ A;  2IDO A;  3V81 A;  4FJK A;  4B9Q A;  1HYS A;  4A62 A;  2F96 A;  1Z25 A;  4DSL A;  3R8E A;  3PX6 A;  1TL1 A;  2Q0R A;  3HPH A;  4JS5 A;  3PIO L;  4AHR A;  4MFB A;  4QS8 A;  4LSN A;  1W2B M;  1L3S A;  3C0B A;  3N4P A;  3CC2 N;  4B3M K;  3ZEU A;  1XNQ K;  4X64 K;  2NRZ A;  3AGR A;  3RVC A;  3LPT A;  4WCE L;  3K5M A;  3ENB A;  3DAW A;  2OCE A;  2Q3S A;  4A2B A;  4FJL A;  1B9F A;  3CC4 N;  3VA0 A;  3G10 A;  4A5B A;  2O8C A;  4BR5 A;  1HKB A;  2QA4 N;  1WAF A;  2XHB A;  2EWS A;  3ZSZ A;  4DTN A;  3MN6 A;  1YVN A;  1QSY A;  3VQ6 A;  1MU2 A;  2P9I A;  3TU5 A;  4FW2 A;  4CJR A;  3VEY A;  3AVA A;  3DJC A;  4IZ9 A;  5TKW A;  2FSK A;  5KGX A;  4FZZ A;  3EZ5 A;  3E9L A;  3P1G A;  1OVY A;  4JI2 K;  3QDK A;  1YIT N;  1YTA A;  4NCB A;  3O3G A;  1B92 A;  3OYA A;  1IH7 A;  3VQB A;  4AH9 A;  1HUX A;  1RGI A;  3CJ1 A;  3E66 A;  1SAZ A;  3WXI A;  4O0J A;  1OH7 A;  4JS4 A;  4FK0 A;  1BA0 A;  4BRM A;  4FLW A;  4RW8 A;  3DOL A;  1M90 O;  1NJW A;  4FWK A;  3A5L C;  4K8X A;  3ZSW A;  3KD5 E;  2G8V A;  4OKJ A;  4FJI A;  5HBM A;  1NK8 A;  3MX2 A;  1QVG M;  1NGH A;  2H3G X;  3I0S A;  3NCI A;  1XC9 A;  2BTF A;  4PKH A;  3D2F B;  2DPN A;  1TGO A;  4OKE A;  1HQU A;  3VEO A;  3FLC O;  3I56 N;  1X9M A;  2E5L K;  1TK5 A;  4M63 C;  1WLJ A;  1HR0 K;  2GEL A;  5C42 A;  2DY4 A;  3KIO A;  1JLF A;  1IKW A;  4BRH A;  3UIQ A;  1SV5 A;  3NH1 A;  2HHX A;  1KSP A;  2CH6 A;  1TAQ A;  2CGJ A;  3K58 A;  2HNY A;  4DR1 K;  1Q86 O;  1HX1 A;  4FPA A;  4U7B A;  3D2E B;  3HVT A;  3U4L A;  3QEW A;  3V9X A;  2D0P A;  1A5V A;  1ATS A;  3GE1 A;  4OLB A;  3SK3 A;  3RSE B;  4CJW A;  5M1F A;  4FL9 A;  4CEO A;  1K9M O;  1U04 A;  1U6Z A;  2O4G A;  2KQ2 A;  1NGE A;  3HBT A;  1TKX A;  1EET A;  4ILJ A;  3M8P A;  4XIU A;  3T1H K;  4K41 A;  4WQ4 C;  4XH4 A;  3OA9 A;  4IWV A;  2FSJ A;  3DLG A;  5AQJ A;  1F21 A;  1Y64 A;  2O8B B;  4FWR A;  2PZS A;  3NF7 A;  1U47 A;  4CEA A;  4BRO A;  4DU1 A;  3TAQ A;  2ASO A;  3THV A;  5GIO A;  4CF9 A;  1NGF A;  4QCL A;  3M1F A;  2BH1 A;  1I39 A;  3UKR B;  3AVK A;  5MLC Q;  4BR7 A;  3GG4 A;  3O9U A;  5BPN A;  3MK6 A;  2HHV A;  4DFP A;  3MN9 A;  3VES A;  3C6A A;  5CZ1 A;  3SUP A;  3B6O A;  3V9S A;  3ULE A;  2Y1J A;  3L2U A;  3VF2 A;  1DTQ A;  3LM9 A;  3LDO A;  4A2A A;  4CJ4 A;  4KB0 A;  4NYN A;  3CCR N;  1J9A A;  3OYB A;  4Z4F A;  3AA4 A;  5F2R A;  3LDQ A;  1S9G A;  4Y0W A;  5CYM A;  2FXU A;  5AQX A;  3SV4 A;  3HZ6 A;  3KWG A;  1HNV A;  5E84 A;  1G15 A;  2HBL A;  1HKC A;  3SPZ A;  1T05 A;  3TAP A;  4BG9 A;  3KK3 A;  2E2N A;  4JI4 K;  2HHS A;  3L2R A;  4CEB A;  5JMV A;  2OYQ A;  4OGC A;  4CZM A;  2B4J A;  1JXB A;  3OYF A;  3K9K A;  4DSI A;  3AGK A;  4BRI A;  3OY9 A;  2HVH A;  4F8R A;  3THW A;  1CZ9 A;  4BWM A;  5AQN A;  3RRH A;  1W97 L;  1VQ5 N;  3JYT A;  3FGU A;  4H5V A;  4NCG A;  2HND A;  2NNW A;  4BG8 A;  4JKA A;  3KK7 A;  3LAK A;  2GV9 A;  4ELT A;  4M3W A;  2QI2 A;  3O5B A;  3O1B A;  3WUH A;  1BGX T;  2QM1 A;  1KFD A;  3ZYY X;  5M1O A;  3V1Q A;  1TYQ A;  4JKB A;  3G71 N;  5T7B A;  4BRD A;  3EY1 A;  4IEI A;  3TTF A;  4DCH A;  3CJA A;  4H0X B;  3ZSO A;  2ZJP L;  5HP1 A;  5I9E B;  4F9O A;  4Z4I A;  4GV9 A;  4KH5 A;  1N32 K;  5KRT A;  3JSM A;  4FWL A;  4Z0U A;  1KFS A;  5LJV A;  5BPL A;  1VHX A;  4FK4 A;  1EO1 A;  3EZW A;  2VGM A;  3O08 A;  2E6M A;  2KFZ A;  2VG5 A;  3HOT A;  4CZI A;  1ZBI A;  1C1C A;  4JV5 K;  4CZH A;  3H46 O;  1L5U A;  4RW7 A;  4KTZ A;  5FPD A;  4CZG A;  2WOM A;  4OVL A;  1RT5 A;  4H5W A;  2D5R A;  3VQ5 A;  3CCU N;  3D0P A;  3M3Z A;  5EX5 A;  3CFP A;  3OYK A;  3CPW M;  4LF7 K;  4ICL A;  2RHK A;  3RMA A;  4NXM K;  4FWP A;  5KGW A;  2VG6 A;  3DXK B;  1WBB A;  3OJU A;  4YNQ A;  2QEX N;  3VGL A;  1A5X A;  1M1K O;  2HF3 A;  2HNZ A;  1C0G A;  1S5J A;  4LSL A;  4DTR A;  3H1V X;  3TTC A;  4CJE A;  1TYQ B;  1JLC A;  4BRP A;  3OYI A;  4YOY A;  3LL3 A;  3OTO K;  1NGC A;  1YF5 L;  4DR5 K;  4PKG A;  2P9L A;  5A2Q O;  4CJK A;  4HVJ A;  4CJU A;  1RT6 A;  2P9U B;  3BY5 A;  4DR2 K;  3CF5 L;  3LDN A;  4H0P A;  1HYZ A;  3KVG A;  5BR8 K;  2HMI A;  1C1B A;  2Z1I A;  4WFA L;  2GX9 A;  4OX9 K;  4H5R A;  4YFU A;  2O8E A;  3THY B;  3C7N B;  3VTI A;  1KLN A;  3OYM A;  2VWB A;  4DQI A;  2D1K A;  4C1N K;  1P90 A;  3NGY A;  4BQZ A;  5GIN A;  4JKE A;  4KHS A;  4C8M A;  4CJT A;  1WSI A;  1U4B A;  3IUC A;  4CJ3 A;  1KD1 O;  5EOY A;  4NO7 A;  4BE1 A;  2YV0 X;  4M3Y A;  2HB5 A;  2QWM A;  2ZGZ A;  3HP9 A;  2VQF K;  1T6D A;  3A8Y A;  3CCJ N;  3J81 O;  1TUU A;  4B9M A;  3SQ0 A;  3O1W A;  3VER A;  3TAR A;  3FFI A;  1C1A A;  3RSE A;  4BGA A;  3NGZ A;  1XHZ A;  4DSJ A;  4BRN A;  3MCP A;  1LCU A;  1RTH A;  4IG3 A;  3OYL A;  3PSI A;  1CZA N;  1T8E A;  4DHY A;  4CFD A;  3PX4 A;  2NZT A;  4CJL A;  2YNI A;  4I2P A;  4CHQ A;  1HYV A;  3RMD A;  2P1J A;  4HUE A;  3DLK A;  3SUQ A;  3ZET B;  3CCQ N;  3C65 A;  3L4I A;  2A5X A;  4JI5 K;  1K6Y A;  2OPR A;  2E4L A;  4LH4 A;  2QXF A;  4H0O A;  4KH4 A;  4BDY A;  3K2P A;  1UOC A;  3CD6 N;  4E7I A;  2O8D A;  4YOR A;  1QTM A;  5C10 A;  4LF9 K;  1RBV A;  1W9H A;  5CHI A;  4Z4G A;  2OTL N;  1RTJ A;  1SZ2 A;  4CZK A;  4DS4 A;  1YAG A;  3R3L A;  3J7A P;  2E2P A;  3E1Y A;  4CEF A;  1SL0 A;  1IBL K;  2P9S B;  4F4K A;  1MDU B;  5FRO A;  3DLR A;  3NE6 A;  4IJA A;  1S72 N;  4I2Q A;  4J2A A;  2NRV A;  3DWL A;  3ATV A;  1S6P A;  2P9N B;  2YCH A;  5EXW A;  3IAY A;  1JCE A;  1MWK A;  1WUA A;  3AVG A;  3AVJ A;  3J80 O;  3NF9 A;  5TKY A;  4Y1D A;  1BU6 O;  2HF4 A;  3PY8 A;  3ZT3 A;  2NRR A;  1LWE A;  5F1X A;  2WC9 A;  1SKS A;  2CH5 A;  4CFA A;  3M8Q A;  4Z4E A;  2E8A A;  1U48 A;  3NGI A;  3TWH A;  4ELV A;  2QXL A;  1BIU A;  2ETJ A;  2A41 A;  3AO1 A;  3CJ7 A;  4KKO A;  5LY3 A;  4FM0 A;  5AQK A;  1BQN A;  4PL7 A;  1V4S A;  2IAJ A;  3AO2 A;  2O8E B;  5CR4 A;  5AR0 A;  4BE2 A;  4I6M A;  4GVE A;  4J2B A;  2GUI A;  5BN9 A;  4FJH A;  4L8R B;  2O8D B;  4FPB A;  3ZSR A;  4I9Q A;  3OHR A;  4FJX A;  4DR7 K;  4CK3 A;  4NCA A;  3TSP A;  3E01 A;  4FJ8 A;  3HVR A;  1Q9X A;  3CMA N;  5EVZ A;  3FZF A;  3UKU A;  4LF8 K;  2V51 B;  1TVR A;  4FJG A;  4KHN A;  3O3H A;  3O4W A;  5AQT A;  1JLE A;  4J8F A;  2XY6 A;  4DTM A;  2FBT A;  2YHY A;  4CIE A;  1ZBL A;  3OYE A;  4AF1 A;  4OGE A;  3WQT A;  2ZQB A;  1DEJ A;  1QHT A;  1GOB A;  3O8M A;  3OYC A;  4FCY A;  4E89 A;  2X6N A;  5KTQ A;  5AQQ A;  3W0L A;  4PWD A;  4DSF A;  2W6L A;  5CY4 A;  3QBW A;  2VWK A;  4W5Q A;  4FLT A;  3VF4 A;  3E9P A;  3S9H A;  1NGI A;  2AA4 A;  2FBY A;  1BQM A;  4RW4 A;  4DTO A;  3TI0 A;  2W42 A;  1VQO N;  3SAF A;  4JYA K;  2ZD1 A;  3I55 N;  1YJW N;  4B9N A;  3RMC A;  4IFV A;  1QSS A;  3OS0 A;  3OYD A;  1HMV A;  4AHT A;  1LW2 A;  4AM6 A;  3ALY A;  1RT4 A;  4KB1 A;  3VQE A;  2ZJR L;  4CZL A;  4X65 K;  2ZF5 O;  4CF0 A;  1RT7 A;  2F8S A;  1BA1 A;  3ISN C;  3K0S A;  1JLA A;  4YOT A;  1VQ6 N;  4NLC A;  1N34 K;  3H1Q A;  1FJG K;  1UWB A;  1WNS A;  5AQW A;  2YX6 A;  4JI8 K;  2OAN A;  1BOT O;  4DV7 K;  4CGF A;  1FK9 A;  3C7N A;  4DQQ A;  4FWM A;  1D8Y A;  2Q31 A;  4ID5 A;  4DV0 K;  2GEM A;  5M1K A;  4IOX A;  1XNR K;  2ZWH A;  2KZM A;  2QKB A;  3DXM B;  1TK0 A;  4KI6 A;  4HTU A;  2WBN A;  4JLH A;  4UQG A;  1K73 O;  1QQN A;  3EKU A;  3KD1 E;  3C95 A;  4FM2 A;  4NYF A;  4CJ7 A;  4AIL C;  4AM7 A;  3SAH A;  4EHT A;  3H08 A;  4B3R K;  4FJN A;  2HHQ A;  3CET A;  3WXL A;  5EU7 A;  3PLA A;  4DMN A;  4MDB A;  5FPM A;  4FO0 A;  1RT3 A;  3P4I A;  4M7X A;  3O9S A;  4KI4 A;  1IJJ A;  1OKJ A;  1JXE A;  3CG7 A;  2QWO A;  2ZM6 K;  1VQP N;  1TK8 A;  4DU3 A;  3CCV N;  2FBV A;  4DV5 K;  3C6U A;  3QFP A;  2P9L B;  2A6A A;  3RMB A;  3SYZ A;  4C8K A;  4GW6 A;  3O9T A;  3HTV A;  3SMP A;  1ESV A;  3WEE B;  4JK7 A;  3CME N;  1YXQ A;  2OPS A;  3K9J A;  1WBD A;  3VEX A;  3ATU A;  1P8Z A;  5FRN A;  4BR9 A;  1VRT A;  2RN2 A;  3NH2 A;  1GOC A;  1BCM A;  1N8R O;  1X3M A;  2HHT A;  1TKZ A;  4B9V A;  4DF4 A;  4B9S A;  4PHT X;  1HJR A;  3R9P A;  4JK8 A;  4FWN A;  4WYB A;  2XY5 A;  5FPE A;  4BRK A;  2E6L A;  1QQC A;  3KLG A;  1E4G T;  2X74 A;  1ILY A;  3CC7 N;  2NRX A;  4MQ3 A;  1L3T A;  1N6Q A;  3KTQ A;  2A1S A;  1NK9 A;  1KTQ A;  4GMJ B;  2O8F B;  4JI7 K;  1BIS A;  3ZCM A;  3U8X A;  3AAP A;  3HYF A;  2I5J A;  4AHV A;  5AQV A;  3KLI A;  3WNF A;  3VEW A;  3ZX3 A;  4FLY A;  3ZT4 A;  4DTS A;  4CEE A;  1RT1 A;  3HSC A;  4O5F A;  3PV8 A;  4M3T A;  2UXC K;  2QWP A;  3R1X A;  3WNE A;  4CD1 A;  3QEP A;  1IBK K;  1KVC A;  4FVU A;  1C0F A;  2RE2 A;  4B08 A;  3ULD A;  1RDA A;  5AFU H;  4H0V B;  3WEE A;  3DLH A;  3PIP L;  3BF1 A;  4DUY K;  4LF4 K;  3AO3 A;  2Q2R A;  4W5T A;  4JNE A;  1Q9Y A;  2HOE A;  3K5N A;  3IMX A;  4JAX A;  1NOY A;  2P51 A;  1YT3 A;  2QKK A;  1ASW A;  4N47 A;  4DTU A;  4B1U B;  4CJ5 A;  3G4S N;  5HLF A;  1VSI A;  3GBT A;  1G99 A;  1O13 A;  3LDS A;  1ZBS A;  2LSN A;  4CCH A;  3OW2 M;  2Q36 A;  1OH8 A;  3CFR A;  2IC3 A;  3AVM A;  4DLE A;  5AQR A;  3DRR A;  2A42 A;  1RFQ A;  5I42 A;  1NGD A;  3G25 A;  3QFU A;  2F8T A;  3HP6 A;  3F5T A;  3ID6 A;  3A5O C;  3IRX A;  4YDU A;  4JD2 A;  4BE0 A;  3RR7 A;  2YNH A;  3IFR A;  3P39 A;  1DLO A;  1NMN A;  4PUO A;  1SQK A;  3SQ4 A;  3OYH A;  2J4R A;  3FE1 A;  4W5O A;  2PY5 A;  4JKD A;  2P5G A;  5BR9 A;  5HRR A;  1NNE A;  3SI6 A;  3F73 A;  3P83 D;  3THX B;  3UKU B;  2GWK A;  2VYP A;  5KQ8 A;  1KQS M;  1RDB A;  1RBT A;  3ZSY A;  5J2N A;  1Q18 A;  4M3R A;  1NJY A;  2ATQ A;  2R7Y A;  1EWQ A;  4JEP A;  1BUP A;  3HO1 A;  4PKI A;  2ITM A;  1WN7 A;  4YDU C;  4M45 A;  2DFF A;  3AVH A;  3FR0 A;  4DV2 K;  1BWF O;  4AHC A;  3D7E O;  4RCH A;  3EKS A;  1EQY A;  3C6T A;  3U3Y A;  4BRL A;  3V9W A;  4DF8 A;  4C8L A;  4GKJ K;  1TAU A;  3CXC M;  4FLV A;  3S3O A;  4C8N A;  3CCM N;  1WSG A;  1IG8 A;  4IXC A;  4JI3 K;  5D3G A;  1ASV A;  2UUB K;  5KI6 A;  4A57 A;  2G8F A;  4I9L A;  2QWN A;  1NKC A;  5HRN A;  3TAM A;  4BR0 A;  4JD2 B;  2AJQ A;  5M1N A;  1WOQ A;  3R6M A;  3AA2 A;  4HTL A;  3QES A;  5GAE P;  5DM6 L;  4H5N A;  5JS1 A;  4DG1 A;  4FZY A;  3SBG A;  1BG3 A;  1YI2 N;  4DTP A;  4CF2 A;  1NK0 A;  4PQU A;  1BI4 A;  4HHT A;  3ZLJ A;  5LL6 Z;  3J7Y P;  3EEQ A;  1W0H A;  3CHW A;  5AQZ A;  4IO8 A;  1JL1 A;  1ITG A;  4JHD A;  3DOK A;  3MN5 A;  5HRS A;  1BHL A;  2FF3 B;  3L3V A;  3L8B A;  4RW9 A;  3LZI A;  4M42 A;  2FF6 A;  1VQ9 N;  3F9M A;  2PAV A;  1REV A;  3L0Q A;  3SZ2 A;  1IG9 A;  4X62 K;  1K8A O;  4DTJ A;  1S6Q A;  2RF2 A;  1SKR A;  4NXN K;  4CGD A;  5FRM A;  1K8K B;  4CED A;  4CBW A;  1IKX A;  2DTU A;  2FBX A;  3S3M A;  1H1V A;  2AP1 A;  5C12 A;  2YKN A;  3SNN A;  4LH5 A;  2XO7 A;  2V7Z A;  1IKV A;  5ELZ A;  4CFB A;  4DV3 K;  5AQU A;  1NMD A;  1VSM A;  1FKO A;  5LMN K;  3B6P A;  1RT2 A;  4DU4 A;  3TAB A;  2VQE K;  1RCH A;  4A59 A;  2DFH A;  4DR6 K;  3SV3 A;  3AO4 A;  2IS3 A;  2OZS A;  1RDC A;  5AQL A;  3HXM A;  2QK9 A;  2UXD K;  1E4F T;  4WFB L;  3LPU A;  1VQM N;  3MEC A;  4XH1 A;  4CBX A;  4BAC A;  3AA3 A;  5C0Y A;  3D2F A;  2CGK A;  4FJ7 A;  3WXM B;  1QVF M;  4JRP A;  3WXJ A;  2JLE A;  1J6Z A;  4BVO A;  2QWR A;  2Q1N A;  3SMS A;  4J2E A;  4ZTJ A;  2HMP A;  1D9D A;  4WQ4 A;  4CES A;  3NDK A;  1J5O A;  1VQK N;  5AQG A;  2HBJ A;  2NRT A;  4BRQ A;  2F9W A;  2JWK A;  4WQ5 C;  3MX5 A;  2YNG A;  1RNH A;  5K14 A;  5GAH P;  1WAJ A;  4JI1 K;  5HRP A;  1X9S A;  5I3U A;  4HCB A;  3EE8 A;  4CEZ A;  2CGL A;  1S1W A;  3OS2 A;  4B1W B;  2B6A A;  4EHU A;  3A5M C;  3CCE N;  4CK2 A;  5BRF A;  4IJN A;  3W3D A;  4BRG A;  1W7A A;  4BRA A;  3LWL A;  2V7Y A;  4CBU A;  3KK1 A;  4RTF D;  3JXU A;  5HL7 L;  4YY3 K;  4ISE A;  2P9P A;  5C24 A;  3LAN A;  3QEI A;  1NK4 A;  1O1W A;  1DTT A;  3ZSX A;  4OLA A;  4GV6 A;  4DQ8 A;  4B3O A;  3AVL A;  4M3X A;  4E1J A;  3DLE A;  1CXU A;  1TKT A;  3VQQ A;  1VSE A;  4W5R A;  3I0R A;  5SZT A;  3O80 A;  1WSF A;  3SUO A;  1N33 K;  4CGH A;  3M8R A;  4F3T A;  1HNI A;  3WNG A;  1S1T A;  3O9Q A;  1U49 A;  1LW0 A;  3M5R A;  1D9F A;  5AQS A;  4KHP K;  3GL1 A;  1NGA A;  4FWQ A;  4CK1 A;  2NLX A;  5AQM A;  1TUY A;  3MXM A;  3SJJ A;  4LD0 A;  1QZ5 A;  3QIC A;  5GAG P;  3K5L A;  4YOU A;  2ZJQ L;  1NK6 A;  4B3T K;  1U2V B;  3NVK A;  1V4T A;  1KCF A;  3MMV A;  1EP4 A;  2YHW A;  1YIJ N;  2E88 A;  3F9K A;  4FSV A;  2D0A A;  4EZ6 A;  4KRE A;  1HNZ K;  3KLE A;  2ASM A;  2IVO A;  4ILH A;  1DGK N;  2DFE A;  3NHG A;  4DR4 K;  1Q8I A;  1S1V A;  4H4O A;  1R0A A;  3BZK A;  2YHX A;  3Q7B A;  1L3U A;  4KTW A;  4CIG A;  3FFK B;  1JJ2 M;  4JI6 K;  4BQL A;  5J2M A;  2BAN A;  1JLB A;  3SAG A;  3NAE A;  1S3X A;  5CYQ A;  2HW3 A;  1YHQ N;  1ATN A;  3PX0 A;  2P9N A;  5AQH A;  5AJ3 K;  3O9R A;  1NWK A;  4ELU A;  3F2K A;  2GUP A;  1YJ9 N;  2YHB A;  2D0B A;  2G8H A;  4OKK A;  2I7N A;  5HRO A;  4BR4 A;  1X3N A;  4CJF A;  5BRD A;  4DV4 K;  4JKG B;  3QIP A;  5KPT A;  3K57 A;  1T6C A;  5GAD P;  2Z1G A;  3D45 A;  4L3Q A;  4B8A B;  3QET A;  2G8I A;  3CQY A;  2IGI A;  4B1V A;  2GWJ A;  1JLQ A;  3K5O A;  1KRP A;  4WE1 A;  3ZSV A;  3ZX2 A;  3KKR A;  3KJV A;  1JCG A;  1HNX K;  4CZJ A;  5J2P A;  3HI0 A;  4O55 A;  1YJN N;  4E7J A;  2OPP A;  4KO0 A;  3JAM O;  1Y97 A;  1VQN N;  1YTU A;  4CHZ A;  4GVM A;  3BDP A;  3RRG A;  5CZ2 A;  4DV1 K;  3TAF A;  1DT9 A;  1QZ6 A;  3UE5 A;  3LP0 A;  4B9U A;  4FOE A;  4BRC A;  3CJC A;  4K8Z A;  3L3U A;  1KAY A;  2Q97 A;  3O6W A;  1ATR A;  3IG1 A;  3QBX A;  3S41 A;  3T19 A;  4YOX A;  1RIL A;  2V52 B;  4O8K A;  3VQ4 A;  1JLG A;  1WSE A;  3ZT2 A;  2P5O A;  3H3N O;  1HPM A;  1XUP O;  3KWI A;  3P5J A;  3HL8 A;  3VTH A;  2XRI A;  4GY2 B;  4BC5 A;  4TSX A;  1UA0 A;  3CCL N;  3QNN A;  4H4M A;  1VAZ A;  4BVP A;  4DFK A;  2A3Z A;  2QTD A;  2W41 A;  2A1R A;  3FZM A;  3ASM A;  3A2F A;  1EXQ A;  4MO5 A;  5M1Q A;  4BRF A;  3H45 C;  3I8B A;  1N36 K;  3V9U A;  3QER A;  4WF9 L;  5DK5 A;  3TR8 A;  3HOS A;  3DYA A;  3CJ9 A;  1X9W A;  3NBP A;  2YNF A;  4G9Z A;  3CPE A;  4C1N I;  5E26 A;  2WON A;  4NLB A;  3HM8 A;  4CJS A;  1NKE A;  4UY8 O;  1IKY A;  1C6V A;  4X66 K;  1B9D A;  3DRS A;  1XC3 A;  2Z1J A;  4FK2 A;  4O0I A;  4IOA L;  3BZC A;  4FLX A;  4CD3 A;  4CW7 B;  3THY A;  5C25 A;  4NB4 A;  3AAQ A;  4JK9 A;  1QE1 A;  1XWL A;  4K25 A;  2VGN A;  3T1A A;  1LV5 A;  3KLF A;  3E9O A;  3P31 A;  3BEX A;  3VQ9 A;  3VEV A;  2P9K B;  3O3F A;  3CM5 A;  3WQU A;  3J8A A;  1HNW K;  4B8C A;  2O4I A;  1KLM A;  3T69 A;  1QQO A;  4QS9 A;  3DMJ A;  4CGG A;  3LM2 A;  5ADX A;  2JWL A;  1X1P A;  4EAH D;  3K59 A;  3KZB A;  3TTD A;  1BI4 B;  5C2D A;  3PO4 A;  4HWI A;  1Q82 O;  1GLE G;  4MDA A;  3AO5 A;  3KKS A;  5C2F A;  4CVN E;  3I8D A;  3VA3 A;  2VCP A;  4C23 A;  4BRE A;  4QAG A;  1XI1 A;  1L3V A;  4N41 A;  2D4W A;  4YHH K;  2PFU A;  4CJP A;  3BGR A;  1RBS A;  3U6F A;  1NGG A;  4PY5 A;  4FM1 A;  3TPQ A;  1XMQ K;  3HK2 A;  3GDQ A;  5AQY A;  1JKH A;  1HJO A;  1Z05 A;  4O5B A;  3KLH A;  2HST A;  3U3G A;  4DFM A;  1BCO A;  5E41 A;  4RWT A;  5KPZ A;  3MXI A;  3VET A;  3EO3 A;  3LWM A;  2W6K A;  3VMF B;  4N5S A;  4LY7 A;  4GKK K;  5KQD A;  1U2V A;  4E3S A;  4JI0 K;  3SPY A;  3QB0 A;  3AVF A;  5BRE A;  4Z94 A;  4K0K K;  2F4V K;  4E1N A;  2WTU A;  3G6E N;  1GOA A;  2PBD A;  4K43 A;  1KXP A;  4JRQ A;  1I3A A;  4BWJ A;  4BGB A;  1LWC A;  5LMU K;  3NF8 A;  2YKM A;  3ZSQ A;  3ZX0 A;  2PYL A;  2YI1 A;  1HLU A;  2P9U A;  1VSH A;  4Q0B A;  5AQI A;  1RBR A;  1NJZ A;  3KHY A;  4AHU A;  1K8K A;  2O8F A;  4W5N A;  1GLJ O;  3V1R A;  1XQS C;  3KK2 A;  1BIZ A;  2HHU A;  3LDP A;  4CHY A;  1YVU A;  2YHA A;  4KBO A;  1BDG A;  4WQ5 A;  4O8U A;  1D5A A;  2F7T A;  2D0C A;  1NGJ A;  4DSE A;  2BUP A;  3ID8 A;  2RPI A;  2GTD A;  4OPA A;  5AQO A;  1NU0 A;  3T1Y K;  1FW6 A;  5J2Q A;  5JLH A;  1NJX A;  4LFB K;  4IDH A;  4O44 A;  1WB9 A;  3MWP A;  3NF6 A;  4DLG A;  5SWM A;  1D4X A;  1EKE A;  3SQ2 A;  2BDP A;  2QWQ A;  1QS4 A;  2X78 A;  4BDZ A;  4YOV A;  3AV9 A;  3VQA A;  1GLB G;  1T3V A;  3SUN A;  4J2D A;  3CIP A;  1KVA A;  1IBM K;  3RR8 A;  1E3M A;  3QIO A;  4DFJ A;  2I7P A;  1NJI O;  3CYM A;  4CF8 A;  2YJF A;  3DLB A;  4F2S A;  1RBU A;  1KAX A;  4EIA A;  1Q7Y O;  2HBM A;  1VQ4 N;  2P9S A;  4EZ9 A;  1DKG D;  1RTD A;  3LAM A;  5KPR A;  2OA8 A;  2NRH A;  5GIP A;  4CER A;  5JS2 A;  3OS1 A;  3UKR A;  3CI5 A;  4FJM A;  2EHG A;  1VSD A;  1TL3 A;  1FKP A;  1GLF O;  3VEN A;  4H8K A;  4FJ9 A;  1HRH A;  5BN8 A;  1I94 K;  1NM1 A;  5H1S Q;  4HUG A;  4QOZ B;  2FC0 A;  4N76 A;  3CER A;  1LWF A;  2O8C B;  3LDL A;  4CGJ A;  5FDL A;  1NBW A;  3HJF A;  1U45 A;  3UB5 A;  3HM9 A;  2D0O A;  4EP4 A;  3JS6 A;  4E7K A;  3ZEU B;  4ZTF A;  1VQ8 N;  3ZET A;  3THX A;  4C8O A;  1IV0 A;  3VGK A;  1VK0 A;  3U9Z A;  4H03 B;  4WFN L;  1KC8 O;  2VWJ A;  3PO5 A;  3PUF A;  3V9Z A;  4JKH A;  3LP3 A;  3BF3 A;  4U67 L;  3SQ1 A;  1T44 A;  3AAR A;  4Y1C A;  4O4G A;  4IO9 L;  1YUW A;  4CEQ A;  3C94 A;  4FLZ A;  3M8S A;  1WSJ A;  3FZK A;  1ZXO A;  3THW B;  3WXK A;  1UA1 A;  4Q5V A;  4HUF A;  4CZE A;  4ZHR A;  4IBN A;  1OH5 A;  4FOI A;  3IS9 A;  1EWR A;  3CFO A;  3TAN A;  5AZJ A;  1Z6R A;  3MEG A;  4H0Y B;  3TSU A;  5ADX H;  5IWA K;  4R5P A;  2UXB K;  4KHU A;  1WSH A;  4KH6 A;  4FZX C;  1S1X A;  3LP2 A;  4LF5 K;  4F3O A;  4XH5 A;  2KTQ A;  2RKI A;  3WT0 A;  2HVI A;  3VQP A;  1C0T A;  2UYT A;  2GBZ A;  1SKW A;  3VN5 A;  5FLX O;  2P9P B;  3PSF A;  4YOW A;  3EN9 A;  3A5N C;  4G1Q A;  1ASU A;  4IDK A;  4DWI A;  3CM6 A;  4OPH A;  4PL8 A;  2UUC K;  5JVG L;  2IIR A;  1C0U A;  3Q7C A;  3HPO A;  3VEZ A;  1RDW X;  1GLL O;  3QEX A;  5LJW A;  1KVB A;  2IVN A;  1RTI A;  1Q81 O;  3OYJ A;  4OJR A;  4CE9 A;  4E19 A;  4JN4 A;  3MXJ A;  3CQX A;  3L6Q A;  2P9K A;  3OBY A;  5AQP A;  2F9T A;  3L2W A;  3LP1 A;  3QO9 A;  3VQC A;  3VQ7 A;  5J1E A;  4AHS A;  4KAZ A;  5JIC A;  4KV8 A;  3O4Q A;  4FLU A;  2G8U A;  1NG9 A;  2NRW A;  4JHD B;  2E1Y A;  5M1P A;  4DQS A;  3V1O A;  5AZJ B;  4GNI A;  2IVP A;  4H5T A;  5DM7 L;  3L2V A;  3ENO A;  1SS6 A;  4IFY A;  4M7Y A;  2KKZ A;  2FSN A;  1QQM A;  2JGU A;  3RTV A;  4RG8 A;  1FXX A;  2X6S A;  1VRU A;  2ASP A;  3VOV A;  3WNH A;  4N56 A;  2O8B A;  4JKG A;  1GLA G;  3ULE B;  5CE3 A;  2Y1I A;  4PA1 A;  1T03 A;  4AQY K;  4CJV A;  3MED A;  3AVN A;  2KHO A;  3HPG A;  3L4Q A;  2HHH K;  4FXD A;  4OPK A;  1CZB A;  3ITH A;  5F0X A;  3NFA A;  1QHA A;  3OVN A;  3VQ8 A;  4KHQ A;  3T7Z A;  1XHX A;  3G0Z A;  3SCX A;  2UUA K;  4JKF A;  4QS7 A;  2E2Q A;  2B5J A;  3VGM A;  2E20 A;  4FVM A;  4DS5 A;  2BGG A;  4DUZ K;  4KPY A;  1TV6 A;  4K42 A;  4IFE A;  4E7L A;  3D6R A;  1OH6 A;  4B3S K;  2UU9 K;  3IKM A;  4B1X B;  4CHN A;  4F2R A;  1NLV A;  4Z4H A;  1HQE A;  3V4I A;  1GLC G;  3SBT A;  1SUQ A;  3FZL A;  1VSJ A;  5AFU A;  3TAE A;  3S3N A;  1BL3 A;  2YJE A;  4I7F A;  4E7H A;  3ENH A;  3QNO A;  1MA9 B;  5AZI A;  4DQR A;  2HBK A;  1VSL A;  4CGI A;  4OPJ A;  3OBW A;  3BP8 A;  4EFH A;  4MLH A;  4ISF A;  2ITG A;  3OJS A;  4ILG B; 
#chains in the Genus database with same CATH homology
 3BF1 A;  4BRF A;  4FWL A;  3H45 C;  3I8B A;  4FWS A;  1MWM A;  5LJV A;  4WF9 L;  5BPL A;  3HOS A;  2Q2R A;  4IOC L;  1EO1 A;  3M6G A;  3CJ9 A;  3EZW A;  2VGM A;  3O08 A;  4JNE A;  4JKC A;  3HOT A;  2HOE A;  4CZI A;  2ZGY A;  3IMX A;  4JAX A;  4G9Z A;  3CPE A;  4H0T B;  4C1N I;  3A0I X;  5E26 A;  4NLB A;  4DB3 A;  4CZH A;  3H46 O;  3HM8 A;  4B1U B;  4UY8 O;  4ISG A;  3G4S N;  5JLF A;  5FPD A;  4CZG A;  3GBT A;  5BPM A;  1G99 A;  1O13 A;  1KAZ A;  1ZBS A;  1XC3 A;  4H5W A;  3OW2 M;  2Q36 A;  3CCU N;  4IOA L;  3M3Z A;  5EX5 A;  3CPW M;  4CD3 A;  2RHK A;  3HRG A;  5EY4 A;  4NB4 A;  5AQR A;  5B8H A;  3AAQ A;  4FWP A;  4JK9 A;  1BO5 O;  2A42 A;  3DXK B;  1RFQ A;  4K25 A;  2VGN A;  3H6E A;  1NGD A;  4I6M B;  4MO4 A;  2QEX N;  3B8A X;  3E9O A;  3G25 A;  3P31 A;  3BEX A;  3VGL A;  3QFU A;  3VEV A;  2P9K B;  2QW9 A;  1M1K O;  2HF3 A;  3F5T A;  1C0G A;  3ID6 A;  2E2O A;  3A5O C;  4BR2 A;  1R59 O;  3WQU A;  3TSQ A;  3H1V X;  3J8A A;  3TTC A;  1LOT B;  1TYQ B;  4JD2 A;  4YDU A;  3U9D A;  3SLC A;  4BRP A;  4OO1 J;  4YOY A;  3LL3 A;  1NGC A;  1QQO A;  4QS9 A;  1YF5 L;  3T69 A;  3IFR A;  1X9J A;  3LM2 A;  3P39 A;  3QML A;  4BC2 A;  4PKG A;  5ADX A;  2JWL A;  2P9L A;  1SQK A;  2J4R A;  3FE1 A;  3AY9 A;  4EAH D;  4JKD A;  3P38 A;  5BR9 A;  3KZB A;  2P9U B;  3TTD A;  5C2D A;  2KLA A;  2WFB A;  4HWI A;  2E1Z A;  3CF5 L;  3UKU B;  1VQ8 N;  3LDN A;  4H0P A;  1Q82 O;  3KVG A;  1GLE G;  2GWK A;  4MDA A;  2VYP A;  5C2F A;  4WFA L;  2GX9 A;  3NVM A;  2VCP A;  1GLD G;  4H5R A;  1JCF A;  4C23 A;  5KQ8 A;  4BRE A;  1KQS M;  3VPZ A;  3C6H A;  2D4W A;  3C7N B;  2PFU A;  3VTI A;  1VQ7 N;  2VWB A;  2D1K A;  4B1Y B;  4C1N K;  1P90 A;  4BQZ A;  1Q18 A;  5GIN A;  4JKE A;  1NGG A;  3TPQ A;  3H3O B;  4JEP A;  5C15 A;  1BUP A;  3GDQ A;  3IUC A;  4CZF A;  5AQY A;  4PKI A;  3I33 A;  2ITM A;  5EOY A;  1KD1 O;  1HJO A;  1Z05 A;  4NO7 A;  2OTJ N;  2HST A;  4IEE A;  4YDU C;  5AZI B;  2ZGZ A;  2QWM A;  4CI6 A;  3FR0 A;  1T6D A;  2W40 A;  3A8Y A;  3CCJ N;  4RWT A;  1BWF O;  4R79 A;  5KPZ A;  3D7E O;  4RCH A;  1TUU A;  3EKS A;  1EQY A;  3VET A;  2QWL A;  3EO3 A;  4BRL A;  1S22 A;  3O1W A;  3VER A;  3VMF B;  3CXC M;  4BGA A;  3RSE A;  1HKG A;  3CCM N;  3DXK A;  3GOI A;  1IG8 A;  4IXC A;  4LC9 B;  5KQD A;  4BRN A;  1U2V A;  3MCP A;  4XEI A;  1LCU A;  3IDH A;  3QB0 A;  4DKW A;  5BRE A;  4Z94 A;  1CZA N;  4A57 A;  4DHY A;  4BY9 C;  3G6E N;  2PBD A;  2QWN A;  3MN7 A;  5HOO A;  2NZT A;  4K43 A;  1KXP A;  4BR0 A;  4JD2 B;  5M1N A;  4BGB A;  1WOQ A;  3R6M A;  4HTL A;  3VF6 A;  5GAE P;  2Q0U A;  5DM6 L;  4H5N A;  1VQL N;  3SBG A;  1BG3 A;  1NGB A;  1YI2 N;  3ZX0 A;  3ZET B;  2YI1 A;  4FWO A;  3N4Q A;  1HLU A;  2P9U A;  1ZC6 A;  3MWT A;  2P9I B;  5BRH A;  3C65 A;  3L4I A;  3MDQ A;  3CCQ N;  2A5X A;  3CHW A;  5AQZ A;  1RDU A;  4IO8 A;  5AQI A;  4JHD A;  3KHY A;  4BC3 A;  3MN5 A;  3EL2 A;  1K8K A;  4H0O A;  3CCS N;  4KH4 A;  5JVH L;  1GLJ O;  3CD6 N;  3SJH A;  1XQS C;  2FF3 B;  3FZH A;  2FF6 A;  4YOR A;  3MCA B;  3LDP A;  5C10 A;  1VQ9 N;  2FLO A;  3F9M A;  5CHI A;  3DXM A;  2PAV A;  2OTL N;  2A40 A;  4KBO A;  1BDG A;  3L0Q A;  4WQ5 A;  4O8U A;  1SZ2 A;  4CZK A;  2F7T A;  3DLL L;  4BC4 A;  1K8A O;  1NGJ A;  2BUP A;  3NMU A;  1YAG A;  3ID8 A;  2GTD A;  3R3L A;  4OPA A;  2WUS A;  5AQO A;  2E2P A;  4B1Z A;  4GV3 A;  3E1Y A;  5JLH A;  1K8K B;  2P9S B;  1MDU B;  3CJB A;  4IJA A;  3BUZ B;  4IDH A;  4CBW A;  1S72 N;  3MWP A;  3D2E A;  1H1V A;  2AP1 A;  2NRV A;  3DWL A;  1D4X A;  4A5A A;  5C12 A;  3ATV A;  2P9N B;  2YCH A;  5EXW A;  2QWQ A;  1JCE A;  1MWK A;  2V7Z A;  5ELZ A;  5FPN A;  1WUA A;  5AQU A;  4YOV A;  1NMD A;  5TKY A;  1BU6 O;  2HF4 A;  1GLB G;  1T3V A;  2NRR A;  3CIP A;  5F1X A;  4MLE A;  3J7Z O;  2WC9 A;  5AQF A;  4A61 A;  3EE9 A;  4A59 A;  2CH5 A;  2I7P A;  1NJI O;  4B9Q A;  3PIP L;  2YJF A;  2E8A A;  5AQL A;  1KAX A;  2QXL A;  4A62 A;  4EIA A;  1Q7Y O;  3R8E A;  1E4F T;  2A41 A;  4WFB L;  1VQM N;  4XH1 A;  3CJ7 A;  4CBX A;  5LY3 A;  2HBM A;  1VQ4 N;  2P9S A;  5C0Y A;  2Q0R A;  3D2F A;  1DKG D;  2CGK A;  5AQK A;  3PIO L;  3WXM B;  4PL7 A;  1V4S A;  2NRH A;  4QS8 A;  5KPR A;  3WXJ A;  5GIP A;  1W2B M;  1QVF M;  1J6Z A;  4BVO A;  3UKR A;  2QWR A;  3CI5 A;  3C0B A;  3N4P A;  3CC2 N;  2Q1N A;  3ZEU A;  1GLF O;  2NRZ A;  3AGR A;  3RVC A;  3VEN A;  5CR4 A;  4WCE L;  5AR0 A;  3SMS A;  3ENB A;  3DAW A;  4I6M A;  5BN8 A;  2HMP A;  1NM1 A;  5H1S Q;  4A2B A;  4GVE A;  5BN9 A;  4WQ4 A;  3CER A;  3CC4 N;  4FPB A;  5AQG A;  2HBJ A;  4A5B A;  1VQK N;  4BR5 A;  1HKB A;  2QA4 N;  3LDL A;  2NRT A;  4BRQ A;  2F9W A;  3OHR A;  2JWK A;  4WQ5 C;  2EWS A;  3MX5 A;  1NBW A;  3MN6 A;  3UB5 A;  5GAH P;  1YVN A;  3TSP A;  2D0O A;  3JS6 A;  2P9I A;  3TU5 A;  3ZEU B;  3CMA N;  3EE8 A;  5EVZ A;  3FZF A;  4IZ9 A;  3DJC A;  5TKW A;  2V51 B;  3UKU A;  3VEY A;  3ZET A;  2CGL A;  2FSK A;  3VGK A;  4B1W B;  3O4W A;  3E9L A;  3U9Z A;  4EHU A;  4H03 B;  1OVY A;  4WFN L;  1KC8 O;  3A5M C;  3QDK A;  1YIT N;  5AQT A;  3CCE N;  5BRF A;  4J8F A;  4IJN A;  4JKH A;  3W3D A;  4BRG A;  3BF3 A;  2YHY A;  4U67 L;  4BRA A;  1T44 A;  2V7Y A;  1HUX A;  1RGI A;  3AAR A;  3CJ1 A;  3E66 A;  1SAZ A;  3WXI A;  4AF1 A;  3WQT A;  4CBU A;  1DEJ A;  4IO9 L;  3O8M A;  1YUW A;  4RTF D;  3JXU A;  5HL7 L;  4ISE A;  3FZK A;  5AQQ A;  4MO5 A;  5M1Q A;  1BA0 A;  2P9P A;  1ZXO A;  4BRM A;  3W0L A;  3WXK A;  4CZE A;  1M90 O;  4FWK A;  3A5L C;  4GV6 A;  4DQ8 A;  4FOI A;  4E1J A;  5AZJ A;  3QBW A;  1Z6R A;  4H0Y B;  3MX2 A;  3TSU A;  1QVG M;  1NGH A;  2H3G X;  5ADX H;  3VF4 A;  2BTF A;  3E9P A;  3D2F B;  4PKH A;  1NGI A;  4KH6 A;  2DPN A;  2AA4 A;  3VEO A;  3FLC O;  3I56 N;  3O80 A;  4XH5 A;  4M63 C;  1VQO N;  3SAF A;  2GEL A;  3I55 N;  3WT0 A;  1YJW N;  2UYT A;  4BRH A;  3O9Q A;  4AM6 A;  3M5R A;  2CH6 A;  2P9P B;  2CGJ A;  5AQS A;  4YOW A;  3EN9 A;  3GL1 A;  1NGA A;  3A5N C;  4FWQ A;  2ZJR L;  4CZL A;  2NLX A;  5AQM A;  2ZF5 O;  1TUY A;  4OPH A;  4PL8 A;  1BA1 A;  5JVG L;  1Q86 O;  2IIR A;  3Q7C A;  1QZ5 A;  1HX1 A;  4FPA A;  3QIC A;  5GAG P;  4U7B A;  3D2E B;  4YOU A;  4YOT A;  2ZJQ L;  3VEZ A;  4NLC A;  1RDW X;  3H1Q A;  3U4L A;  1VQ6 N;  1GLL O;  1U2V B;  5LJW A;  2D0P A;  3NVK A;  1V4T A;  3GE1 A;  1ATS A;  3SK3 A;  5AQW A;  2YX6 A;  3RSE B;  2IVN A;  1BOT O;  2OAN A;  3MMV A;  1Q81 O;  3C7N A;  4FWM A;  5M1F A;  2Q31 A;  2YHW A;  4FL9 A;  1YIJ N;  2E88 A;  2GEM A;  4FSV A;  4JN4 A;  1K9M O;  5M1K A;  3CQX A;  1U6Z A;  3L6Q A;  4IOX A;  2P9K A;  1NGE A;  2ZWH A;  3HBT A;  3OBY A;  5AQP A;  2F9T A;  4ILJ A;  2ASM A;  3DXM B;  2IVO A;  4ILH A;  1DGK N;  2WBN A;  4K41 A;  4WQ4 C;  4XH4 A;  5JIC A;  3OA9 A;  1QQN A;  3EKU A;  2FSJ A;  4IWV A;  1K73 O;  4CJ7 A;  5AQJ A;  1Y64 A;  2YHX A;  4AM7 A;  3Q7B A;  4FWR A;  3SAH A;  2NRW A;  4EHT A;  4JHD B;  3FFK B;  4BRO A;  2E1Y A;  3CET A;  1JJ2 M;  3WXL A;  5M1P A;  2ASO A;  3PLA A;  5GIO A;  4BQL A;  3SAG A;  5AZJ B;  4MDB A;  5FPM A;  4GNI A;  2IVP A;  1NGF A;  4H5T A;  4FO0 A;  1S3X A;  3ENO A;  1SS6 A;  3M1F A;  3P4I A;  5DM7 L;  4M7X A;  2BH1 A;  4M7Y A;  3UKR B;  1ATN A;  1YHQ N;  3O9S A;  5MLC Q;  1IJJ A;  2KKZ A;  2P9N A;  3GG4 A;  5AQH A;  3O9U A;  1OKJ A;  4BR7 A;  2FSN A;  3O9R A;  1NWK A;  5BPN A;  3MK6 A;  1QQM A;  2QWO A;  2GUP A;  3F2K A;  1VQP N;  1YJ9 N;  3MN9 A;  3VES A;  3C6A A;  3CCV N;  3QFP A;  2ASP A;  2P9L B;  3VOV A;  2A6A A;  2I7N A;  4BR4 A;  1X3N A;  4JKG A;  3ULE A;  1GLA G;  5BRD A;  3O9T A;  4JKG B;  3ULE B;  5CE3 A;  5KPT A;  3HTV A;  1T6C A;  3VF2 A;  5GAD P;  3LM9 A;  4L3Q A;  3SMP A;  1ESV A;  3WEE B;  4JK7 A;  3CQY A;  3CME N;  3LDO A;  4A2A A;  1YXQ A;  2KHO A;  3L4Q A;  4B1V A;  3K9J A;  2GWJ A;  3VEX A;  3ATU A;  3CCR N;  1P8Z A;  5F0X A;  5F2R A;  3LDQ A;  4BR9 A;  1QHA A;  4Y0W A;  3ZX2 A;  2FXU A;  5AQX A;  3T7Z A;  1JCG A;  3HZ6 A;  3KWG A;  4CZJ A;  3HI0 A;  5E84 A;  2HBL A;  1YJN N;  1N8R O;  1HKC A;  1X3M A;  4JKF A;  1VQN N;  4QS7 A;  2E2Q A;  4BG9 A;  3VGM A;  4PHT X;  2E2N A;  3R9P A;  2E20 A;  4JK8 A;  5JMV A;  4FWN A;  4WYB A;  1DT9 A;  4CZM A;  3K9K A;  5FPE A;  3AGK A;  4K42 A;  4BRK A;  1QZ6 A;  4BRI A;  3UE5 A;  1E4G T;  4IFE A;  4FOE A;  1ILY A;  4BRC A;  5AQN A;  3D6R A;  3CC7 N;  3CJC A;  2NRX A;  1KAY A;  1W97 L;  2Q97 A;  1VQ5 N;  3O6W A;  3IKM A;  1ATR A;  4B1X B;  3FGU A;  4H5V A;  3QBX A;  3S41 A;  1NLV A;  4YOX A;  2NNW A;  2V52 B;  4BG8 A;  4JKA A;  4O8K A;  3KK7 A;  2QI2 A;  3O5B A;  1GLC G;  3SBT A;  3O1B A;  3U8X A;  3AAP A;  3WUH A;  5AQV A;  2QM1 A;  3FZL A;  3H3N O;  1HPM A;  3VEW A;  3ZX3 A;  5M1O A;  3ZYY X;  5AFU A;  1XUP O;  3HSC A;  3KWI A;  4O5F A;  2QWP A;  3R1X A;  3VTH A;  1TYQ A;  4JKB A;  4GY2 B;  4BC5 A;  4CD1 A;  3G71 N;  4BRD A;  4IEI A;  2YJE A;  3TTF A;  3CCL N;  4DCH A;  3ENH A;  4FVU A;  3CJA A;  4H0X B;  1C0F A;  2RE2 A;  1MA9 B;  2ZJP L;  1VAZ A;  5AZI A;  4BVP A;  5I9E B;  4F9O A;  2HBK A;  2A3Z A;  4GV9 A;  3OBW A;  3BP8 A;  4EFH A;  2QTD A;  2W41 A;  4MLH A;  3FZM A;  5AFU H;  4ISF A;  4KH5 A;  4H0V B;  3WEE A;  4ILG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...