2RHKA

Crystal structure of influenza a ns1a protein in complex with f2f3 fragment of human cellular factor cpsf30, northeast structural genomics targets or8c and hr6309a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
PASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural basis for suppression of a host antiviral response by influenza A virus.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/nuclear protein
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2rhkA00
3P39A 3O9QA 3D6RA 4OPAA 3F5TA 3O9SA 4OPHA 2KKZA 2RHKA 2GX9A 3O9RA 3O9TA 3P38A 3RVCA 3KWIA 3L4QA 3P31A 3KWGA 3M5RA 3O9UA 3EE9A 3EE8A 3OA9A
chains in the Genus database with same CATH superfamily
5EXWA 4CJ7A 3PV8A 4FLVA 3JYTA 4Y1DA 4BR7A 4QS8A 5FRNA 1LAVA 5AQHA 2CH5A 2QXLA 4FW1A 2UXCK 1DTTA 1JLBA 5BR9A 3O6WA 2RPIA 5KPRA 1NJWA 1VQ4N 3O1BA 3TAGA 1YUWA 2IVPA 3NF9A 4CFCA 5J2QA 3D7EO 1N8RO 1ZBSA 2VYPA 4MO4A 4DFMA 5BREA 3KHYA 5AQMA 5C2FA 4IEEA 2OA8A 2EX3A 1IBKK 4CBUA 4KHNA 3D2EB 3QLHA 2BANA 2PY5A 3M5RA 3K9KA 3ULDA 3O3HA 2HF4A 1NGFA 1QQOA 3VF4A 5CYMA 4KHPK 1WUAA 3NH2A 1BCOA 5KRTA 1SZ2A 4KBOA 2QKBA 4R79A 1NOZA 1C1AA 2IS3A 2QM1A 3U6FA 1TKZA 2ZWHA 3DM2A 1YVUA 4DUYK 3JSMA 1QQCA 3DLKA 1S1WA 4IJNA 1LW2A 5LJWA 3MEGA 2NNWA 3VERA 4C8LA 2OANA 1DLOA 3SAHA 3KIOA 4H5TA 2QWRA 4B3TK 1ASUA 5LJVA 5CY4A 2XO7A 3V9WA 4LD0A 4BREA 4HTLA 1FXXA 2PYLA 4DV0K 3M1FA 5E41A 1KFDA 3AVGA 4Z0UA 4FWOA 3HSCA 4GY2B 2HBMA 3I33A 2HBLA 3KLEA 1KXPA 4MO5A 5AQRA 5EVZA 3K58A 2ITMA 4PUOA 3WT0A 5LY3A 2O8EA 4DV4K 4BRFA 4EHUA 2GX9A 4J2BA 3THXB 2W42A 3VA0A 2Y1IA 3CCJN 3OJUA 1VQ9N 3F2KA 3VQPA 4W5OA 1U6ZA 2WC9A 3O4NA 4CGHA 2JWKA 4MQ3A 4CEDA 3WXKA 3J7ZO 1VSEA 4M3ZA 3HXMA 4F3OA 3HTVA 1FK9A 2HVIA 4F4KA 3AAPA 1JLFA 2VG6A 1T44A 3GE1A 3CERA 1BIZA 1HKGA 1D9DA 1Z25A 5BN8A 3P31A 1HPZA 3KLIA 3P83D 4DSJA 1BCMA 5GINA 4BDYA 4AILC 3CETA 4CIFA 3ZETB 4H03B 4AH9A 1KVCA 4NB4A 4DR6K 5HRPA 4AM6A 1WSGA 3VQBA 2UYTA 1IH7A 4O8UA 1NGDA 3PUFA 4FK4A 4IFVA 3I55N 3V9XA 3SK3A 3SQ2A 2O8FA 4DR5K 1T6DA 1X9JA 3A5MC 3DXKA 3QMLA 4B9UA 3V9SA 4FJLA 1U47A 1XMQK 4CHYA 4LSLA 1ASWA 3G4SN 4B1UB 4JRPA 3GOIA 3IMXA 3CC7N 4YY3K 3CJCA 3ZT4A 3HOSA 1NGIA 1S9GA 1QZ6A 3FE1A 5GIPA 1WNSA 4F2SA 3AVJA 1IKYA 3VQ6A 2I5JA 1LWCA 3SBGA 3MMVA 3DMJA 3M8PA 1WN7A 4B9SA 1WSIA 4FLWA 3AVLA 4O5BA 5C2DA 5FDLA 3DXMB 2EWSA 1UWBA 3FLCO 3ZSYA 3J8AA 3V81A 3T1HK 4DV6K 2I7PA 1JCEA 2AJQA 4ISEA 4E19A 1VQ5N 4DU1A 3D2FB 2NRRA 4H4OA 5FLXO 3E9OA 5BRFA 4O55A 4JK7A 1I39A 5T7BA 3I0RA 5CYQA 3QFUA 2WUSA 3VQ7A 2H3GX 4CZFA 4JI7K 4JV5K 4CJTA 3MXIA 3E66A 1QVGM 1HR0K 4YDUC 5ELZA 2P5GA 4AHTA 3RSEB 2XY8A 3F73A 3CHWA 3C95A 1VRTA 1H1VA 1RT6A 4HUEA 4DQQA 1BQMA 2QTDA 5J2NA 2FBYA 5M1QA 4BRKA 1RT5A 2OPRA 2OTLN 4DV5K 1TK5A 3O4QA 3EO3A 4CW7B 4F3TA 1XNQK 3DRSA 1TYQB 1HYVA 2WONA 3DLHA 3DAWA 4PWDA 4IZ9A 1Q81O 1SV5A 1NJYA 3KJVA 4CESA 3NAEA 2HMPA 4BR9A 3UKUA 3BUZB 2UUBK 3AY9A 3VF2A 1VQON 4GV9A 3VEZA 1RTJA 4WFBL 2DFEA 3DLRA 5C12A 4C8NA 4N5SA 3SMPA 1A5WA 3AVMA 3MCAB 5E26A 4JNEA 1VQKN 2CGKA 1YI2N 4RW6A 4CGGA 1NGJA 4LFBK 4R5PA 3HSTB 1ZBLA 5AQFA 5C24A 3AVIA 5E84A 1HNZK 1WBDA 4BRQA 1X9SA 2HF3A 1U45A 5HL7L 1VRUA 1HYZA 4FJ8A 1QTMA 2E88A 4KHSA 1TAUA 3KVGA 2P9LA 1YF5L 3CM5A 3AO3A 3E9PA 1JLGA 1NGHA 4LF6K 5IT9O 4J8FA 2F8TA 3NVMA 4L8RB 4KTZA 1C6VA 3L0QA 1IBLK 2F4VK 1ATSA 4CJFA 1ITGA 3VPZA 2KZZA 5A2QO 2GUIA 4HTUA 2P9PA 3LDQA 3D45A 4DS4A 4KPYA 3WNFA 4O44A 4DLGA 1REVA 4FJNA 2FSJA 1QHAA 1RBTA 4LF8K 3H6EA 4FZZA 4KH6A 1VSFA 3JS6A 3SI6A 1SKSA 2VWJA 1S1TA 3C7NB 1RDWX 4RG8A 1BWFO 4IO8A 2FF3B 4H5WA 4H0OA 3M3ZA 1TKDA 3PY8A 4JK8A 4GNIA 3EN9A 3SUNA 4JKCA 3CJ1A 1LWEA 2E2NA 3DI6A 1NNEA 1SL2A 2NRXA 1WAJA 4FJMA 3AVFA 2FSKA 4AHVA 4IDHA 4EHTA 2HHTA 4M3YA 4EFHA 4CGJA 3OYLA 1HLUA 1TKTA 2QWOA 4BRHA 4DTRA 3LANA 1KD1O 1JL1A 3EE9A 4JD2A 3RMDA 2P9KA 1A5XA 1WSHA 3P39A 2ZJRL 2YKMA 4WQ4A 3IG1A 3HZ6A 3TAPA 1WSEA 3B8AX 1N6QA 5JS1A 3S9HA 4E1MA 1ZBIA 4ICLA 4FWSA 2GBZA 4FWQA 1NOYA 5AQJA 3ID8A 1BDGA 1BGXT 4BR5A 5AQNA 4B1YB 3VOVA 4HVJA 3EEQA 4CBWA 3HPHA 4CZLA 3N4PA 1U4BA 1HRHA 1WB9A 4RW9A 5LMUK 2VCPA 3W0LA 3ALYA 1QE1A 3NGZA 4CZIA 3VA3A 4FJHA 1S1UA 3QINA 2OPPA 4NYNA 4DQPA 1W2BM 5AFUH 2O8EB 2GV9A 3AGKA 1MA9B 3HVTA 5J2PA 1NBWA 3ZX2A 3ZCMA 2XY7A 4DQIA 3LP3A 4DKWA 4PKIA 1XHXA 4FLUA 4M3WA 1C1BA 5JVGL 3VEYA 3CPEA 3Q7CA 3LZIA 3G71N 3OS1A 1K9MO 3BY5A 3WQTA 2HBJA 3V1QA 5AQYA 1GLEG 2V7ZA 4B08A 3QEVA 1OKJA 2F7TA 1W0HA 3GL1A 3NH1A 2VG7A 4BVOA 3ATUA 4WQ5A 3FR0A 1KAYA 2ETJA 3PX0A 1NK7A 3ULEA 1GLCG 1O13A 4B9NA 4O4GA 5DM6L 3BGRA 1QSYA 2O8BB 1HQEA 4CVNE 3MK6A 1DT9A 3CD6N 2UXBK 2OPQA 1JXBA 2KTQA 4YOTA 3VQEA 3MXMA 5AQKA 4CHQA 2G8KA 3L2RA 4DU4A 2HHSA 3V9ZA 2X78A 3AA3A 1C0FA 4RTFD 5FPNA 4GMJB 2P9NA 3DWLA 4PHTX 4FZYA 3KZBA 3WUHA 1T03A 1RBUA 4BRMA 3V9UA 1N36K 1RNHA 4CJ3A 4DTJA 1R59O 2FLOA 2O8FB 2IVNA 4CHOA 1X3NA 3J80O 4MDAA 4XH1A 1EWQA 4JEPA 2D0OA 4O0JA 4ILGB 4H0TB 1MWKA 3OTOK 4B1ZA 1J5OA 4JAXA 3VEOA 1NU0A 4IFEA 3OYDA 3L2QA 4KFBA 2PAVA 5FPEA 3V1RA 3HPOA 4DG1A 2F8SA 2WBNA 3LALA 4I2PA 1ZBFA 4IG0A 4A62A 2YJEA 3DJCA 1MDUB 3AVCA 4GW6A 4DTXA 2A5XA 4DTNA 3B6PA 3FFIA 4JKFA 3RR7A 3QERA 3THYA 3NF8A 4W5RA 4BWJA 1SS6A 2G8UA 3HOTA 2BGGA 1RT3A 3HT3A 3OS0A 4MDBA 4PKHA 3AO4A 4CJ4A 1SL0A 4CE9A 3CXCM 4Y0WA 2JGUA 3UKRA 4H5RA 1U2VA 1D5AA 1FKOA 4BR4A 1NGEA 3IRXA 4BWMA 1RTDA 3C0BA 1RBVA 1TGOA 4CJSA 2WTUA 1QQMA 4CJVA 3LZJA 3MWTA 1HYSA 4OGCA 3HPGA 2YX6A 1OVYA 2D0CA 1IJJA 3H1QA 3JXUA 2P9UA 4B8CA 1TVRA 3MN7A 4ID1A 3IS9A 1S1VA 1VQLN 5F1XA 4E1JA 3MECA 5AQXA 4E7HA 3LWMA 3W3DA 3A2FA 3IFRA 1KVAA 2V7YA 3NGIA 3QEPA 3LP0A 3OJSA 3NF6A 4PKGA 3WEEA 4CJLA 4RWTA 4FOIA 2B4JA 4CJ5A 2KZMA 4FOEA 4X65K 1OH5A 5KGXA 4YDUA 4LY7A 4A2AA 1O1WA 4KB1A 3BZCA 4C1NK 3KK3A 1TK0A 1OH8A 5HRRA 3A5LC 1QHTA 2D5RA 2BH1A 2JLEA 3UKUB 2W40A 1SUQA 1G15A 2F9TA 4H8KA 4CEBA 1VQ8N 4CEQA 1WOQA 3V4IA 1M90O 1IKXA 4M3TA 1NGCA 3SQ4A 2KKZA 3HM8A 4WFAL 3NDKA 3K0SA 1CZAN 2A41A 3HM9A 3R1XA 5CZ1A 2XRIA 1N34K 4J2EA 2P9SA 1RILA 2Q0UA 5CZ2A 4YFUA 1EQYA 4KB0A 2UU9K 4NYFA 3MXJA 4FM2A 2X6SA 3AO1A 1TV6A 1J6ZA 2G8HA 2P9LB 3A5NC 1S5JA 4ILHA 1FW6A 3QBXA 3QFPA 3ZT2A 1Q82O 1KFSA 2YJFA 4B9MA 4LFAK 4KH4A 4JI2K 3KK2A 3VQCA 2IOCA 1N5YA 4K8ZA 2D1KA 1NKBA 3C65A 1LW0A 4B9VA 3CJBA 4B9QA 1X1PA 4FJIA 4FJJA 4DCHA 1Y64A 3MN5A 2PFUA 4DHYA 2OYQA 3I0SA 2P9PB 1LOTB 2E5LK 4M42A 3HP6A 4IXCA 4PL7A 3GDQA 4LH4A 3VESA 3T69A 4DU3A 1EWRA 4GVEA 4BG9A 1VSIA 1DGKN 3TWHA 1JLQA 4BC5A 3WXLA 3TAMA 2Z1GA 3ENHA 4V19S 3E1YA 2B5JA 2FF6A 3AO5A 3LL3A 3OBWA 4G1QA 3M6GA 1I94K 3Q7BA 1RT2A 1UA1A 5M1PA 4H5VA 4KV8A 3EY1A 1NKEA 1K8AO 3ITHA 2NRTA 5KPZA 3S3NA 2Q2RA 4CHPA 3LDOA 2BTFA 4XH5A 5AQTA 4K43A 5GAHP 3QEWA 1NK9A 2V52B 4I9LA 3FZFA 4JD2B 4H0VB 3G6EN 3ZYYX 2P9KB 4LF5K 2YHBA 3T7ZA 5GAGP 1GLDG 2DY4A 4DF4A 4I6MA 1BQNA 3QNNA 3P4IA 3HVRA 5CHIA 4CHZA 4F9OA 4I9QA 1XI1A 4LH5A 4FWKA 2G8VA 1ATNA 5KI6A 4DFKA 4IEIA 4JKBA 2X6NA 1DKGD 4B1WB 5M1NA 5EY4A 5MLCQ 1JLAA 1KQSM 4KKOA 2ZJQL 2W6KA 1MU2A 2IIRA 4X62K 3RTVA 1GLBG 3O4WA 3TU5A 1YTUA 4FL9A 1R0AA 4DS5A 3AO2A 3ID6A 2HVHA 3VQDA 1BOTO 3BZKA 4J2AA 3NFAA 4HWIA 2O8DA 4BRNA 3CCSN 3MEDA 4CF2A 5AZIA 2ZE2A 4OLAA 3OA9A 4CEZA 3IDHA 4KI4A 5BPMA 3TR8A 5SWMA 3VQAA 1BG3A 3OYCA 2FSNA 2ASMA 1RBRA 2VG5A 3F9MA 1EO1A 3QIPA 1TK8A 4QOZB 3KK7A 2VGMA 4OPKA 2RE2A 5CR4A 1RDDA 1D4XA 4F2RA 4DTOA 5ADXA 5HP1A 4JYAK 3ULEB 1GLLO 2D0BA 5BRDA 4NCAA 3TSUA 3VMFB 4KHYA 1P8ZA 1S9EA 3RMCA 4N47A 4JI4K 1WBBA 4NO7A 2D0PA 3SV4A 2QA4N 5DK5A 4GKJK 3OY9A 3ZSWA 3T3FA 5K14A 3TAEA 1TL1A 2YHAA 4Y1CA 3MEEA 1B9DA 1YXQA 5TKWA 3BF3A 3EL2A 4QAGA 4CD3A 5EU7A 3VN5A 4OO1J 2Q97A 5AQOA 4XIUA 3M8RA 5AQWA 4C8MA 3KLGA 4ID5A 1I3AA 3C6TA 3O9QA 2GUPA 4BGBA 3CFPA 1SAZA 3R6MA 4M63C 3AA4A 2LSNA 3CFRA 4ELTA 3GBTA 3VGLA 4YOYA 2QK9A 1YJ9N 3ATVA 4NXNK 1NLVA 2YCHA 1MWMA 1BISA 4QCLA 4H5NA 1RFQA 3DYAA 1RT1A 1HNIA 4BRAA 1VQNN 1CXUA 3ZT0A 4Q5VA 1L5UA 1HQUA 1EKEA 3V6DA 3SCXA 3THYB 1RTIA 2G8WA 1TKXA 1A5VA 1BA1A 3KLFA 2NZTA 3K57A 1EETA 4YOUA 4Z4HA 1IG9A 3IUCA 2ZQBA 4CD1A 2A6AA 3ZSOA 3S3OA 3UKRB 5AR0A 1U2VB 3TI0A 2ATQA 4C8KA 3EZ5A 4CJRA 1P90A 1ZC6A 1HUXA 2I7NA 4B1VA 1NJXA 4DSEA 3TABA 3NCIA 3A0IX 3CFOA 4FJ9A 1YAGA 1E3MA 4RW7A 1KAXA 5I3UA 1VSKA 1KC8O 1C1CA 2HHVA 4BRLA 4BVPA 1ZYQA 4A5AA 4BGAA 2P9UB 1XQSC 2YHXA 4JLHA 2OZSA 5AZJA 4FLXA 4FWRA 4FK2A 2F9WA 1YIJN 3DRRA 3MN6A 4CIGA 2HHQA 3TSPA 3WEEB 3NH0A 1J9AA 3QO9A 4JI8K 1RDBA 3LDSA 1GLFO 1K6YA 1XNRK 3ZX0A 2A1RA 4Q0BA 4DTUA 5AJ3K 3KTQA 3H08A 3VQ8A 1EXQA 3QETA 4FJ5A 1X9WA 4DMNA 2XY5A 4LF7K 4CJKA 4KTWA 3OYFA 4FM1A 4FLTA 4Z4IA 5M1KA 3WNEA 5J1EA 3KLHA 3M8SA 5F0XA 4HCBA 4NCBA 3PLAA 3PSIA 4BR2A 4FWMA 4E7KA 2P9SB 3LAKA 4KHUA 1OH6A 2JWLA 5AQZA 2Q31A 1E4GT 2E6LA 4CFBA 4OPAA 3DLBA 1Q8IA 3CF5L 5GAEP 4CIEA 1NGAA 4QS7A 5KRSA 3QNOA 1VQPN 2QKKA 3ZX3A 2CGLA 2E8AA 4CGIA 4JRQA 1BL3A 1Q7YO 3CC2N 1QSLA 3R3LA 4Z4GA 4TSXA 2GWKA 4DLEA 3ZETA 4DR1K 4WCEL 4B8AB 4M45A 2GELA 2ASOA 4BC4A 3ENBA 3TTCA 4FPAA 1LAWA 3ZEUA 1N33K 4MLHA 4FK0A 3S3MA 5AQVA 4E7IA 1YVNA 3HL8A 4CZEA 1U04A 3SAGA 1T05A 3LM9A 3OYEA 3T1YK 1S1XA 1CLQA 4JI5K 4CEOA 5JLFA 2DPNA 4BDPA 4A59A 3JAMO 4J2DA 4JHDA 4DV2K 5HOOA 2ZD1A 1C0GA 2WFBA 4H0YB 2IC3A 1GLJO 4IG3A 3MX2A 3DXMA 4O5FA 3WNHA 3LWLA 4DUZK 4CZMA 2PYJA 5FROA 4GV6A 1CZBA 3SNNA 2DFHA 1BO5O 1HX1A 4JKGA 1JXEA 1HMVA 2HMIA 4AF1A 1CZ9A 3D2FA 3SYZA 3QESA 4CK3A 4YOWA 3RVCA 5GIOA 4B3MK 3OYMA 4E1NA 3ZSZA 4BR0A 1BIUA 3DXKB 2G8FA 3TTFA 1BU6O 4ELVA 4EP5A 1TAQA 3K5LA 3CCLN 1WSJA 3LPUA 2GWJA 4HUGA 5JS2A 1NK5A 4I7FA 5JVHL 3LDPA 1GOCA 1WSFA 4BRGA 2HNZA 3C6AA 2Z1HA 2O8DB 1QS4A 4JKDA 2HHWA 2DTUA 2HNDA 2Q0RA 2FBVA 3CCEN 4CCHA 4ZHRA 5AZIB 4CJPA 4FLYA 4DTSA 3KKRA 4CF8A 1TYQA 2HW3A 3FZHA 3F9KA 3RMBA 4U67L 4MFBA 3OBYA 2RHKA 4ELUA 2QWLA 3SV3A 4GVMA 3O1WA 2YKNA 3CI5A 3MN9A 3MWPA 3HRGA 1KLNA 3OHRA 3DOKA 5AQSA 3GG4A 3SQ0A 4CHNA 3OYHA 4FSVA 3VTHA 4O8KA 4YORA 3L8BA 4KTQA 1RGIA 4M41A 1VQMN 2NRZA 3SBTA 3P38A 3H45C 3SZ2A 4DR3K 1NG9A 3VQ5A 3O3FA 1FKPA 1J53A 3SUQA 1QSSA 2OTJN 1Z05A 4IJAA 2FC0A 3ISNC 1YHQN 4KI6A 4G9ZA 1E4FT 2OZMA 4CF1A 1S72N 3K59A 4GKKK 3QICA 3BDPA 3VEVA 1VK0A 3MDQA 3AA2A 2J4RA 4EIAA 3CJAA 3OYIA 2Q3SA 4LC9B 4YOXA 4BACA 1S6QA 3S41A 4HCCA 4B9TA 5DM7L 3THWA 3O9UA 4O0IA 3L2UA 2Q1NA 4JKHA 1VHXA 3FZMA 1SKRA 5HBMA 3NMUA 3ZSQA 1XMOK 4IFYA 4EAHD 3CIPA 3LDNA 3RRGA 3O9SA 2HNYA 3OW2M 1ATRA 4AHUA 2KW4A 1UOCA 3CYMA 1T3VA 4CJWA 1WAFA 3C7NA 1NK6A 3EKUA 5F2RA 3AVBA 5B8HA 3PSFA 4E7LA 4Z4EA 4AHSA 2GEMA 2UUAK 4WQ4C 4DSLA 4DSFA 1KAZA 2A1SA 3A8YA 4X64K 5JLHA 1BI4A 2P9IA 3WNGA 3NVKA 3MAQA 1QZ5A 4FW2A 1RDCA 3R8EA 1IG8A 2P5OA 1VSDA 1NWKA 3WXMB 3FGUA 2PZSA 4LFCK 1FJGK 2QWQA 2QI2A 4CZHA 2FBXA 1DEJA 4JS4A 1VQ7N 1YTAA 4GV3A 5HRNA 4C23A 3RWUA 1LV5A 4CZKA 3MCPA 3VETA 3HYFA 1Q9XA 4FVUA 5AZJB 2O4IA 3PX6A 3CJ9A 4B1XB 4DFPA 4FO0A 1B92A 1L3VA 1HNXK 1KLMA 3VEXA 2OCEA 3TAFA 1ZXOA 2VQFK 4DSIA 4F8RA 1GLAG 4OPJA 1BA0A 1CXQA 4DQSA 2RN2A 4B3OA 4HHTA 4C1NI 2OPSA 1W9HA 1K8KA 4RW4A 4Z4FA 4X66K 4B3RK 4IBNA 3VEWA 1Y97A 4I2QA 3TANA 4JI0K 2ZJPL 4BDZA 1XC3A 1QQNA 3CMAN 4FVMA 5KQ8A 4JI1K 3OYKA 4W5QA 4EP4A 3K5OA 4H0XB 4WQ5C 2YNHA 3SPYA 1ILYA 1D8YA 4DV7K 3TARA 5HLFA 2X74A 4KAZA 4FJGA 3CM6A 3AVAA 4UQGA 2GTDA 1VSLA 1XWLA 4WF9L 3QEIA 1C0MA 4E7JA 1X9MA 1TUUA 1KTQA 5KPTA 2E20A 3LP1A 4YHHK 1S3XA 4EZ6A 3PO5A 4FXDA 3AVHA 5HROA 1OH7A 3SPZA 3VQQA 1NMNA 1C0UA 4DTPA 1HNWK 3U4LA 3L4IA 4OGEA 4BC2A 4BQZA 4OLBA 1VSJA 2EHGA 3G0ZA 2WOMA 2O8CA 4CEFA 3TSQA 3CPWM 2E2QA 5C25A 5KTQA 1RDAA 4E0DA 2ZGYA 2YNGA 4AQYK 1NK0A 2CH6A 2HSTA 1K73O 1JLEA 2A42A 4KREA 4OX9K 3K2PA 2O8BA 1NGBA 1YITN 3J81O 4KHWA 1RT4A 5IWAK 3SJJA 1KVBA 3CG7A 4FWLA 2VQEK 1XHZA 1KRPA 4ZTFA 1RBSA 3K9JA 2E1ZA 1BUPA 4A61A 1QVFM 4DWIA 4FJ7A 4FCYA 3L3UA 4FYDA 3HI0A 2KFNA 3NE6A 3G25A 5D3GA 2QWPA 3ZLJA 3C6HA 3ZEUB 5C15A 1Q9YA 2NRWA 3O9RA 4K8XA 1EP4A 2E4LA 3A5OC 3LAMA 1LCUA 1RDUA 3VTIA 1EX4A 4XEIA 3BP8A 4M3UA 1YJNN 3CCMN 1TL3A 5CE3A 1JCFA 1Z26A 3U9ZA 4AHRA 1Q86O 2VWKA 3FFKB 3ZSXA 4BRPA 4UY8O 4OVLA 1NJZA 4N76A 4K25A 4FWPA 2CGJA 3L2VA 3AA5X 1JL2A 1ASVA 4JHDB 3CQ8A 1RTHA 1RCHA 3TTDA 2FXUA 3CC4N 4BRCA 4DTMA 3VF6A 1C0TA 1HKBA 4BE2A 3OS2A 3HBTA 3ENOA 4CK2A 3OYAA 2HB5A 5I42A 3O08A 4A2BA 2IAJA 3SAFA 4CF9A 2R7YA 4M3XA 3HJFA 3WXJA 2Y1JA 4IDKA 4WYBA 3L2WA 3VQ9A 2BUPA 1NJIO 4JKGB 4LF4K 2QWMA 4DV3K 3U3YA 1IV0A 2HHUA 1L3TA 4RCHA 1HKCA 1HPMA 4IOCL 5AQGA 3SQ1A 5AQQA 2P9NB 3LPTA 4FPBA 4CEAA 4BRIA 2UUCK 4PQUA 3AGRA 5JICA 2RKIA 4K42A 2RF2A 1VAZA 3C6UA 5AQLA 3F5TA 2YHWA 4BQLA 4OPHA 5BPLA 3OYNA 5AFUA 1T6CA 4ZTJA 4QS9A 3I56N 3WXIA 5BR8K 2VGNA 3KD1E 2Q36A 3K5NA 1L3SA 3KK1A 4Z4CA 1XUPO 4M7YA 4MLEA 4CEEA 4DFJA 5KQDA 3TAQA 3IKMA 2E6MA 1SL1A 4OKEA 4CZJA 4YNQA 5EOYA 4DR7K 4OKJA 3ZT1A 3CMEN 4E89A 2ASPA 4A57A 3AAQA 2QEXN 5DMRA 3NHGA 4C8OA 4DR2K 2KQ2A 4ISGA 3D2EA 2ITGA 3VGKA 2XY6A 3KWIA 4LSNA 2KHOA 2E2OA 3HK2A 2BDPA 4KH5A 1B9FA 3LDLA 3D0PA 3BEXA 4NCGA 4ISFA 4BG8A 5C0YA 1OVQA 3OYBA 4BY9C 5KGWA 2HBKA 1W7AA 3PO4A 5H1SQ 4AM7A 4H0PA 2DFFA 3E9LA 3L3VA 4DF8A 5JMVA 1YJWN 3J7AP 4FM0A 2UXDK 4U7BA 1V4SA 3H3OB 4XH4A 5I9EB 1S6PA 3EZWA 3DLEA 2KLAA 2YNFA 4W5NA 4DQRA 3QDKA 4FWNA 4HUFA 4DSKA 4M7XA 4M3RA 2QWNA 2E1YA 2G8IA 2IDOA 3O9TA 1UA0A 4PL8A 4KHQA 1NK4A 4CERA 2P51A 4OKKA 2AA4A 3O8MA 4JKAA 3THWB 3M8QA 5SZTA 4W5TA 2Z1IA 1S22A 2FBTA 1HJOA 4DB3A 4IOAL 3KD5E 1JLCA 2YNIA 5GADP 1IO2A 1Q18A 4A5BA 4L3QA 3DOLA 3T1AA 4YOVA 3ZT3A 3ZSRA 3E01A 4IKFA 3U8XA 3THXA 3MX5A 1NGGA 4EZ9A 3FZKA 4BE0A 1JCGA 3CJ7A 1T7PA 5AQUA 3N4QA 3BF1A 4PY5A 1BI4B 3RRHA 3SMSA 4N41A 2P9IB 1HJRA 3D6RA 5C42A 4JI6K 3QB0A 4FJXA 2D0AA 2W6LA 1Z6RA 3L6QA 4CGDA 4CFDA 3CCQN 3NF7A 1J54A 5BPNA 3O80A 3R9PA 1SQKA 1JJ2M 2F96A 3O5BA 5ADXH 4DR4K 5HRSA 5M1FA 3QEXA 5M1OA 1GOAA 1M1KO 1IBMK 3HO1A 4BROA 4BC3A 1ZBUA 3NBPA 3B6OA 5LMNK 2D4WA 3CCRN 2KFZA 4NLCA 1UAXA 3QIOA 1G99A 2ZM6K 5LL6Z 4JN4A 3THVA 2BE2A 5AQPA 3DLLL 2HOEA 1DTQA 1K8KB 4PA1A 3AV9A 5FPMA 4CJEA 1J5EK 4FJKA 3EE8A 3H46O 1KSPA 1LWFA 4K41A 3DLGA 2VWBA 4WFNL 3LM2A 2V51B 2HHHK 2O4GA 5EX5A 1D9FA 1BHLA 3V1OA 3C94A 3TPQA 2W41A 4B3SK 1VSHA 1IKWA 4BRDA 4NXMK 2NRVA 3WQUA 4RW8A 1W97L 2PBDA 3KKSA 3L4QA 4JI3K 4CK1A 2HHXA 4JKEA 1NK8A 3H3NO 3H1VX 3AARA 3CQYA 1U49A 1VQ6N 3OYGA 1N32K 4NLBA 3CQXA 4CZGA 1TUYA 3FZLA 3NGYA 4H4MA 1U48A 1NKCA 1ZBHA 3UB5A 4CBXA 2O8CB 3EYZA 2E2PA 4I6MB 1HNVA 2IGIA 2YV0X 4ILJA 3I8DA 1T8EA 3VQ4A 2Z1JA 3IAYA 4KRFA 3RR8A 5AQIA 3P5JA 2NLXA 4IO9L 3HP9A 4CGFA 1YT3A 3SUPA 3VGMA 2A3ZA 3T19A 3UIQA 2XHBA 3ASMA 3RSEA 4Z94A 2P1JA 4CJQA 3U3GA 4IOXA 1GOBA 4KO0A 3AVKA 3UE5A 2NUBA 5J2MA 1XC9A 5C10A 2QXFA 3SJHA 2ZF5O 4JS5A 4E3SA 3LP2A 1ESVA 3OVNA 3KWGA 2YHYA 3I8BA 3O3GA 5BRHA 3G10A 4CECA 4K0KK 4CFAA 3RMAA 4JK9A 3AVNA 4LF9K 1NM1A 1V4TA 4IWVA 4FLZA 2IVOA 4BE1A 1NMDA 1X3MA 4WE1A 3CCVN 4B9LA 4CI6A 2B6AA 1F21A 5BN9A 3U9DA 1KCFA 3ZSVA 1VSMA 3PIPL 5FPDA 1WLJA 2A40A 3SLCA 3SUOA 4OJRA 2ZGZA 4N56A 3CCUN 4AHCA 1JKHA 2YI1A 5FRMA 3P1GA 5TKYA 4DQ8A 3PIOL 2QW9A 3VENA 3K5MA 4CF0A 1RT7A 4FZXC 3PX4A 3J7YP 4DV1K 1IKVA 3OYJA 2AP1A 3EKSA 3DRPA 4CJUA 2NRHA 1SKWA 3QBWA 1L3UA
chains in the Genus database with same CATH topology
5EXWA 3U4LA 3L4IA 4CJ7A 4BQZA 4BC2A 4CZLA 3N4PA 2VCPA 3W0LA 1BA1A 3TSQA 4BR7A 4CZIA 2NZTA 2E2QA 4QS8A 3CPWM 4YOUA 2ZGYA 1W2BM 5AFUH 3AGKA 2CH6A 2HSTA 1MA9B 3IUCA 5AQHA 1NBWA 3ZX2A 4CD1A 1K73O 2A6AA 2A42A 2CH5A 2QXLA 4DKWA 4PKIA 3UKRB 5AR0A 5JVGL 1U2VB 1NGBA 3VEYA 3CPEA 5BR9A 3Q7CA 3O6WA 1YITN 3G71N 4FWLA 5KPRA 1K9MO 1VQ4N 1P90A 1ZC6A 1HUXA 2I7NA 3O1BA 2HBJA 1YUWA 3WQTA 2IVPA 4B1VA 5AQYA 3K9JA 2E1ZA 1BUPA 3D7EO 1GLEG 4A61A 1ZBSA 1N8RO 1QVFM 2V7ZA 2VYPA 3A0IX 4MO4A 5BREA 3HI0A 3KHYA 5AQMA 5C2FA 1OKJA 1YAGA 2F7TA 4IEEA 3GL1A 3G25A 2QWPA 1KAXA 3C6HA 3ZEUB 5C15A 1KC8O 2NRWA 3O9RA 4BVOA 3ATUA 3A5OC 4WQ5A 4BRLA 1LCUA 4BVPA 3FR0A 1KAYA 4A5AA 2P9UB 4BGAA 1XQSC 4CBUA 1GLCG 1RDUA 1O13A 2YHXA 3D2EB 3ULEA 3VTIA 5AZJA 5DM6L 3M5RA 4XEIA 3K9KA 3BP8A 1DT9A 3MK6A 4FWRA 2HF4A 1NGFA 1YJNN 3CCMN 5CE3A 3CD6N 2F9WA 1JCFA 3U9ZA 1QQOA 4YOTA 1YIJN 1Q86O 3FFKB 4BRPA 3VF4A 4UY8O 3MN6A 4K25A 5AQKA 1WUAA 4FWPA 2CGJA 1SZ2A 4KBOA 4JHDB 3TSPA 3WEEB 1C0FA 4R79A 4RTFD 5FPNA 2QM1A 3TTDA 1GLFO 2FXUA 2P9NA 3DWLA 4BRCA 4PHTX 3KZBA 3ZX0A 3CC4N 2ZWHA 3WUHA 4BRMA 3VF6A 1HKBA 1R59O 2FLOA 2IVNA 1X3NA 3HBTA 4MDAA 3ENOA 4XH1A 4JEPA 2D0OA 4ILGB 4H0TB 1MWKA 3O08A 4A2BA 3SAFA 4B1ZA 4IJNA 4JAXA 3WXJA 3VEOA 4WYBA 1NJIO 5LJWA 2BUPA 4IFEA 4JKGB 2NNWA 2QWMA 2PAVA 3VERA 5M1KA 2OANA 3SAHA 5FPEA 4H5TA 1HKCA 1HPMA 2QWRA 4RCHA 5LJVA 4IOCL 5AQGA 5F0XA 3PLAA 5AQQA 4BREA 2WBNA 2P9NB 4HTLA 4FPBA 4A62A 4BR2A 2YJEA 4FWMA 3M1FA 3DJCA 1MDUB 4BRIA 2A5XA 2P9SB 4FWOA 3AGRA 4JKFA 5C10A 3HSCA 4GY2B 2HBMA 2JWLA 5JICA 5AQZA 3I33A 4K42A 2HBLA 1SS6A 1E4GT 2Q31A 1KXPA 3HOTA 1VAZA 4MO5A 4OPAA 5AQRA 4MDBA 3F5TA 5AQLA 5EVZA 2YHWA 4PKHA 4BQLA 4OPHA 3CF5L 5BPLA 2ITMA 5GAEP 1NGAA 4QS7A 3WT0A 5AFUA 1T6CA 5LY3A 4QS9A 1VQPN 3ZX3A 3I56N 3WXIA 4BRFA 4EHUA 2GX9A 2VGNA 3CXCM 4Y0WA 2CGLA 3UKRA 2E8AA 2Q36A 4H5RA 3CC2N 1U2VA 1Q7YO 3CCJN 1VQ9N 3F2KA 1XUPO 3R3LA 1U6ZA 2WC9A 4M7YA 4MLEA 2GWKA 4BR4A 5KQDA 1NGEA 2JWKA 3ZETA 3IKMA 3C0BA 4WCEL 3WXKA 4CZJA 2GELA 5EOYA 2ASOA 3J7ZO 4BC4A 3CMEN 1QQMA 2ASPA 3ENBA 3TTCA 4A57A 3MWTA 3AAQA 2QEXN 3HTVA 4FPAA 2YX6A 3ZEUA 1OVYA 4MLHA 1IJJA 3AAPA 5AQVA 1T44A 3H1QA 4ISGA 3GE1A 1YVNA 4CZEA 3JXUA 2P9UA 3CERA 3D2EA 3SAGA 3VGKA 1HKGA 3KWIA 3LM9A 3MN7A 2KHOA 2E2OA 5BN8A 3P31A 1VQLN 5F1XA 4E1JA 5AQXA 5GINA 3W3DA 3CETA 3ZETB 4KH5A 3IFRA 4H03B 5JLFA 2V7YA 2DPNA 3LDLA 4NB4A 3BEXA 4AM6A 4ISFA 4A59A 4PKGA 3WEEA 4JHDA 4BG8A 5C0YA 2UYTA 4RWTA 4FOIA 5HOOA 4BY9C 4FOEA 4O8UA 1NGDA 2HBKA 1C0GA 2WFBA 4YDUA 3I55N 3SK3A 4AM7A 5H1SQ 4H0YB 4H0PA 3E9LA 1GLJO 4A2AA 5JMVA 1YJWN 1T6DA 1X9JA 3A5MC 4C1NK 1V4SA 4U7BA 3DXKA 3QMLA 3A5LC 3H3OB 3MX2A 4XH4A 5I9EB 2BH1A 3UKUB 3DXMA 3EZWA 2W40A 4O5FA 4CZMA 2F9TA 3G4SN 4B1UB 4GV6A 2KLAA 3GOIA 3IMXA 3CC7N 1VQ8N 1BO5O 3CJCA 3HOSA 1HX1A 4JKGA 1NGIA 1WOQA 3QDKA 4FWNA 1QZ6A 1M90O 4AF1A 1NGCA 3FE1A 5GIPA 4M7XA 2KKZA 3HM8A 4WFAL 2QWNA 2E1YA 1CZAN 2A41A 3D2FA 3O9TA 4PL8A 3SBGA 3R1XA 3MMVA 4YOWA 3RVCA 5GIOA 2P9SA 2Q0UA 4BR0A 2AA4A 3O8MA 4JKAA 3DXKB 5C2DA 1EQYA 1S22A 3TTFA 1BU6O 1HJOA 4DB3A 3DXMB 3CCLN 4IOAL 2EWSA 3FLCO 3J8AA 5GADP 1J6ZA 1Q18A 4A5BA 4L3QA 2GWJA 4YOVA 2P9LB 3A5NC 3U8XA 2I7PA 4ILHA 1JCEA 3QBXA 3MX5A 3QFPA 4ISEA 5JVHL 2YJFA 3LDPA 1Q82O 1VQ5N 4KH4A 1NGGA 3D2FB 3FZKA 4BRGA 1JCGA 2NRRA 3C6AA 3CJ7A 2D1KA 3E9OA 5BRFA 5AQUA 4JK7A 3C65A 3CJBA 4JKDA 4B9QA 3QFUA 2Q0RA 2WUSA 2H3GX 3N4QA 4CZFA 3BF1A 3CCEN 4DCHA 1Y64A 5AZIB 3MN5A 2PFUA 3E66A 1QVGM 4DHYA 3SMSA 2P9IB 1TYQA 3FZHA 2P9PB 1LOTB 3D6RA 4YDUC 5ELZA 3QB0A 4IXCA 3RSEB 4U67L 4PL7A 3OBYA 1Z6RA 3CHWA 3GDQA 2RHKA 3VESA 3L6QA 1H1VA 3CCQN 3T69A 5BPNA 3O80A 2QWLA 3R9PA 4GVEA 1SQKA 4BG9A 1JJ2M 2QTDA 3O5BA 3O1WA 5ADXH 5M1QA 1DGKN 4BRKA 4BC5A 3CI5A 3WXLA 2OTLN 3MN9A 3MWPA 5M1FA 3ENHA 3HRGA 3OHRA 5AQSA 5M1OA 3EO3A 3E1YA 3GG4A 1M1KO 4BROA 4BC3A 2FF6A 3LL3A 3OBWA 2D4WA 4FSVA 1TYQB 3M6GA 3CCRN 3VTHA 4NLCA 4O8KA 3Q7BA 1G99A 3DAWA 4YORA 1RGIA 4JN4A 5M1PA 4H5VA 5AQPA 1VQMN 4IZ9A 2NRZA 3SBTA 1Q81O 3DLLL 1K8AO 2HOEA 5KPZA 2NRTA 3P38A 2Q2RA 3H45C 1K8KB 3LDOA 5FPMA 2BTFA 4XH5A 5AQTA 2HMPA 4BR9A 3EE8A 4K43A 3UKUA 5GAHP 3BUZB 3AY9A 2V52B 3VF2A 3H46O 3FZFA 4JD2B 1VQON 4GV9A 3VEZA 2OTJN 4H0VB 3G6EN 3ZYYX 2P9KB 4K41A 4WFBL 1Z05A 5C12A 2VWBA 4IJAA 1YHQN 4WFNL 3T7ZA 5GAGP 1GLDG 3LM2A 4G9ZA 1E4FT 2V51B 4I6MA 3SMPA 3P4IA 1S72N 3MCAB 5E26A 1VQKN 4JNEA 3QICA 5EX5A 5CHIA 2CGKA 4F9OA 1YI2N 3VEVA 1NGJA 3MDQA 4FWKA 2J4RA 4EIAA 1ATNA 2W41A 3CJAA 3TPQA 4IEIA 4JKBA 4LC9B 5AQFA 4YOXA 1DKGD 4BRDA 3S41A 4B1WB 2NRVA 5EY4A 5M1NA 3WQUA 5E84A 5MLCQ 1W97L 2PBDA 3L4QA 5DM7L 3O9UA 4BRQA 1KQSM 2HF3A 2Q1NA 4JKEA 4JKHA 2ZJQL 3FZMA 3H3NO 3H1VX 5HL7L 2IIRA 3AARA 3NMUA 3CQYA 1VQ6N 4NLBA 3CQXA 4EAHD 2E88A 4CZGA 1TUYA 3CIPA 3FZLA 1GLBG 3LDNA 3UB5A 3KVGA 2P9LA 3O4WA 3O9SA 3TU5A 3OW2M 1YF5L 1ATRA 4FL9A 3E9PA 4CBXA 1NGHA 1T3VA 4J8FA 2E2PA 3ID6A 4I6MB 3C7NA 3NVMA 4ILJA 3EKUA 5F2RA 5B8HA 1BOTO 3L0QA 2GEMA 4HWIA 4WQ4C 5AQIA 1ATSA 4BRNA 2NLXA 4IO9L 3CCSN 1KAZA 3VPZA 3A8YA 5AZIA 5JLHA 3OA9A 2P9IA 3IDHA 3VGMA 3NVKA 2A3ZA 2P9PA 5BPMA 3LDQA 1QZ5A 3R8EA 1BG3A 1IG8A 3RSEA 4Z94A 2FSJA 2FSNA 1QHAA 2ASMA 4IOXA 1NWKA 3F9MA 3WXMB 1EO1A 3FGUA 3UE5A 3H6EA 4KH6A 3KK7A 3JS6A 2VGMA 2QWQA 2QI2A 2RE2A 4CZHA 3C7NB 4IO8A 1RDWX 5CR4A 1BWFO 1DEJA 2FF3B 2ZF5O 3SJHA 4H5WA 1VQ7N 4GV3A 1D4XA 4H0OA 4C23A 3M3ZA 4CZKA 1ESVA 5ADXA 3MCPA 3ULEB 3KWGA 1GLLO 4JK8A 3VETA 4FVUA 5AZJB 2YHYA 3I8BA 3EN9A 4GNIA 5BRDA 5BRHA 3TSUA 3VMFB 1P8ZA 4JKCA 3CJ1A 2E2NA 4JK9A 3CJ9A 4B1XB 1NM1A 1V4TA 4FO0A 4NO7A 4IWVA 2NRXA 3VEXA 2D0PA 1ZXOA 2FSKA 2IVOA 2QA4N 1GLAG 1BA0A 4IDHA 4EHTA 1NMDA 1X3MA 3CCVN 4CI6A 4EFHA 5BN9A 4C1NI 3U9DA 1K8KA 1YXQA 5TKWA 3BF3A 3EL2A 1HLUA 2QWOA 4BRHA 4CD3A 3PIPL 4OO1J 3VEWA 1KD1O 3EE9A 5FPDA 4JD2A 2Q97A 2ZJPL 2A40A 1XC3A 5AQOA 3SLCA 5AQWA 1QQNA 3CMAN 5KQ8A 2P9KA 3P39A 3O9QA 4H0XB 4WQ5C 2GUPA 4BGBA 2ZJRL 1SAZA 4WQ4A 2ZGZA 3R6MA 1ILYA 4M63C 3HZ6A 3CCUN 3GBTA 3VGLA 4YOYA 3B8AX 1YJ9N 3ATVA 2YI1A 2GTDA 1NLVA 5TKYA 2QW9A 4DQ8A 3VENA 3PIOL 4WF9L 2YCHA 1MWMA 4FWSA 4FWQA 1TUUA 5KPTA 4H5NA 2E20A 5AQJA 3ID8A 1RFQA 1BDGA 4BR5A 4BRAA 1S3XA 5AQNA 2AP1A 3EKSA 1VQNN 4B1YB 3VOVA 2NRHA 3QBWA 4CBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P39 A;  3O9Q A;  3D6R A;  4OPA A;  3F5T A;  3O9S A;  4OPH A;  2KKZ A;  2RHK A;  2GX9 A;  3O9R A;  3O9T A;  3P38 A;  3RVC A;  3KWI A;  3L4Q A;  3P31 A;  3KWG A;  3M5R A;  3O9U A;  3EE9 A;  3EE8 A;  3OA9 A; 
#chains in the Genus database with same CATH topology
 5EXW A;  4CJ7 A;  3PV8 A;  4FLV A;  3JYT A;  4Y1D A;  4BR7 A;  4QS8 A;  5FRN A;  1LAV A;  5AQH A;  2CH5 A;  2QXL A;  4FW1 A;  2UXC K;  1DTT A;  1JLB A;  5BR9 A;  3O6W A;  2RPI A;  5KPR A;  1NJW A;  1VQ4 N;  3O1B A;  3TAG A;  1YUW A;  2IVP A;  3NF9 A;  4CFC A;  5J2Q A;  3D7E O;  1N8R O;  1ZBS A;  2VYP A;  4MO4 A;  4DFM A;  5BRE A;  3KHY A;  5AQM A;  5C2F A;  4IEE A;  2OA8 A;  2EX3 A;  1IBK K;  4CBU A;  4KHN A;  3D2E B;  3QLH A;  2BAN A;  2PY5 A;  3M5R A;  3K9K A;  3ULD A;  3O3H A;  2HF4 A;  1NGF A;  1QQO A;  3VF4 A;  5CYM A;  4KHP K;  1WUA A;  3NH2 A;  1BCO A;  5KRT A;  1SZ2 A;  4KBO A;  2QKB A;  4R79 A;  1NOZ A;  1C1A A;  2IS3 A;  2QM1 A;  3U6F A;  1TKZ A;  2ZWH A;  3DM2 A;  1YVU A;  4DUY K;  3JSM A;  1QQC A;  3DLK A;  1S1W A;  4IJN A;  1LW2 A;  5LJW A;  3MEG A;  2NNW A;  3VER A;  4C8L A;  2OAN A;  1DLO A;  3SAH A;  3KIO A;  4H5T A;  2QWR A;  4B3T K;  1ASU A;  5LJV A;  5CY4 A;  2XO7 A;  3V9W A;  4LD0 A;  4BRE A;  4HTL A;  1FXX A;  2PYL A;  4DV0 K;  3M1F A;  5E41 A;  1KFD A;  3AVG A;  4Z0U A;  4FWO A;  3HSC A;  4GY2 B;  2HBM A;  3I33 A;  2HBL A;  3KLE A;  1KXP A;  4MO5 A;  5AQR A;  5EVZ A;  3K58 A;  2ITM A;  4PUO A;  3WT0 A;  5LY3 A;  2O8E A;  4DV4 K;  4BRF A;  4EHU A;  2GX9 A;  4J2B A;  3THX B;  2W42 A;  3VA0 A;  2Y1I A;  3CCJ N;  3OJU A;  1VQ9 N;  3F2K A;  3VQP A;  4W5O A;  1U6Z A;  2WC9 A;  3O4N A;  4CGH A;  2JWK A;  4MQ3 A;  4CED A;  3WXK A;  3J7Z O;  1VSE A;  4M3Z A;  3HXM A;  4F3O A;  3HTV A;  1FK9 A;  2HVI A;  4F4K A;  3AAP A;  1JLF A;  2VG6 A;  1T44 A;  3GE1 A;  3CER A;  1BIZ A;  1HKG A;  1D9D A;  1Z25 A;  5BN8 A;  3P31 A;  1HPZ A;  3KLI A;  3P83 D;  4DSJ A;  1BCM A;  5GIN A;  4BDY A;  4AIL C;  3CET A;  4CIF A;  3ZET B;  4H03 B;  4AH9 A;  1KVC A;  4NB4 A;  4DR6 K;  5HRP A;  4AM6 A;  1WSG A;  3VQB A;  2UYT A;  1IH7 A;  4O8U A;  1NGD A;  3PUF A;  4FK4 A;  4IFV A;  3I55 N;  3V9X A;  3SK3 A;  3SQ2 A;  2O8F A;  4DR5 K;  1T6D A;  1X9J A;  3A5M C;  3DXK A;  3QML A;  4B9U A;  3V9S A;  4FJL A;  1U47 A;  1XMQ K;  4CHY A;  4LSL A;  1ASW A;  3G4S N;  4B1U B;  4JRP A;  3GOI A;  3IMX A;  3CC7 N;  4YY3 K;  3CJC A;  3ZT4 A;  3HOS A;  1NGI A;  1S9G A;  1QZ6 A;  3FE1 A;  5GIP A;  1WNS A;  4F2S A;  3AVJ A;  1IKY A;  3VQ6 A;  2I5J A;  1LWC A;  3SBG A;  3MMV A;  3DMJ A;  3M8P A;  1WN7 A;  4B9S A;  1WSI A;  4FLW A;  3AVL A;  4O5B A;  5C2D A;  5FDL A;  3DXM B;  2EWS A;  1UWB A;  3FLC O;  3ZSY A;  3J8A A;  3V81 A;  3T1H K;  4DV6 K;  2I7P A;  1JCE A;  2AJQ A;  4ISE A;  4E19 A;  1VQ5 N;  4DU1 A;  3D2F B;  2NRR A;  4H4O A;  5FLX O;  3E9O A;  5BRF A;  4O55 A;  4JK7 A;  1I39 A;  5T7B A;  3I0R A;  5CYQ A;  3QFU A;  2WUS A;  3VQ7 A;  2H3G X;  4CZF A;  4JI7 K;  4JV5 K;  4CJT A;  3MXI A;  3E66 A;  1QVG M;  1HR0 K;  4YDU C;  5ELZ A;  2P5G A;  4AHT A;  3RSE B;  2XY8 A;  3F73 A;  3CHW A;  3C95 A;  1VRT A;  1H1V A;  1RT6 A;  4HUE A;  4DQQ A;  1BQM A;  2QTD A;  5J2N A;  2FBY A;  5M1Q A;  4BRK A;  1RT5 A;  2OPR A;  2OTL N;  4DV5 K;  1TK5 A;  3O4Q A;  3EO3 A;  4CW7 B;  4F3T A;  1XNQ K;  3DRS A;  1TYQ B;  1HYV A;  2WON A;  3DLH A;  3DAW A;  4PWD A;  4IZ9 A;  1Q81 O;  1SV5 A;  1NJY A;  3KJV A;  4CES A;  3NAE A;  2HMP A;  4BR9 A;  3UKU A;  3BUZ B;  2UUB K;  3AY9 A;  3VF2 A;  1VQO N;  4GV9 A;  3VEZ A;  1RTJ A;  4WFB L;  2DFE A;  3DLR A;  5C12 A;  4C8N A;  4N5S A;  3SMP A;  1A5W A;  3AVM A;  3MCA B;  5E26 A;  4JNE A;  1VQK N;  2CGK A;  1YI2 N;  4RW6 A;  4CGG A;  1NGJ A;  4LFB K;  4R5P A;  3HST B;  1ZBL A;  5AQF A;  5C24 A;  3AVI A;  5E84 A;  1HNZ K;  1WBD A;  4BRQ A;  1X9S A;  2HF3 A;  1U45 A;  5HL7 L;  1VRU A;  1HYZ A;  4FJ8 A;  1QTM A;  2E88 A;  4KHS A;  1TAU A;  3KVG A;  2P9L A;  1YF5 L;  3CM5 A;  3AO3 A;  3E9P A;  1JLG A;  1NGH A;  4LF6 K;  5IT9 O;  4J8F A;  2F8T A;  3NVM A;  4L8R B;  4KTZ A;  1C6V A;  3L0Q A;  1IBL K;  2F4V K;  1ATS A;  4CJF A;  1ITG A;  3VPZ A;  2KZZ A;  5A2Q O;  2GUI A;  4HTU A;  2P9P A;  3LDQ A;  3D45 A;  4DS4 A;  4KPY A;  3WNF A;  4O44 A;  4DLG A;  1REV A;  4FJN A;  2FSJ A;  1QHA A;  1RBT A;  4LF8 K;  3H6E A;  4FZZ A;  4KH6 A;  1VSF A;  3JS6 A;  3SI6 A;  1SKS A;  2VWJ A;  1S1T A;  3C7N B;  1RDW X;  4RG8 A;  1BWF O;  4IO8 A;  2FF3 B;  4H5W A;  4H0O A;  3M3Z A;  1TKD A;  3PY8 A;  4JK8 A;  4GNI A;  3EN9 A;  3SUN A;  4JKC A;  3CJ1 A;  1LWE A;  2E2N A;  3DI6 A;  1NNE A;  1SL2 A;  2NRX A;  1WAJ A;  4FJM A;  3AVF A;  2FSK A;  4AHV A;  4IDH A;  4EHT A;  2HHT A;  4M3Y A;  4EFH A;  4CGJ A;  3OYL A;  1HLU A;  1TKT A;  2QWO A;  4BRH A;  4DTR A;  3LAN A;  1KD1 O;  1JL1 A;  3EE9 A;  4JD2 A;  3RMD A;  2P9K A;  1A5X A;  1WSH A;  3P39 A;  2ZJR L;  2YKM A;  4WQ4 A;  3IG1 A;  3HZ6 A;  3TAP A;  1WSE A;  3B8A X;  1N6Q A;  5JS1 A;  3S9H A;  4E1M A;  1ZBI A;  4ICL A;  4FWS A;  2GBZ A;  4FWQ A;  1NOY A;  5AQJ A;  3ID8 A;  1BDG A;  1BGX T;  4BR5 A;  5AQN A;  4B1Y B;  3VOV A;  4HVJ A;  3EEQ A;  4CBW A;  3HPH A;  4CZL A;  3N4P A;  1U4B A;  1HRH A;  1WB9 A;  4RW9 A;  5LMU K;  2VCP A;  3W0L A;  3ALY A;  1QE1 A;  3NGZ A;  4CZI A;  3VA3 A;  4FJH A;  1S1U A;  3QIN A;  2OPP A;  4NYN A;  4DQP A;  1W2B M;  5AFU H;  2O8E B;  2GV9 A;  3AGK A;  1MA9 B;  3HVT A;  5J2P A;  1NBW A;  3ZX2 A;  3ZCM A;  2XY7 A;  4DQI A;  3LP3 A;  4DKW A;  4PKI A;  1XHX A;  4FLU A;  4M3W A;  1C1B A;  5JVG L;  3VEY A;  3CPE A;  3Q7C A;  3LZI A;  3G71 N;  3OS1 A;  1K9M O;  3BY5 A;  3WQT A;  2HBJ A;  3V1Q A;  5AQY A;  1GLE G;  2V7Z A;  4B08 A;  3QEV A;  1OKJ A;  2F7T A;  1W0H A;  3GL1 A;  3NH1 A;  2VG7 A;  4BVO A;  3ATU A;  4WQ5 A;  3FR0 A;  1KAY A;  2ETJ A;  3PX0 A;  1NK7 A;  3ULE A;  1GLC G;  1O13 A;  4B9N A;  4O4G A;  5DM6 L;  3BGR A;  1QSY A;  2O8B B;  1HQE A;  4CVN E;  3MK6 A;  1DT9 A;  3CD6 N;  2UXB K;  2OPQ A;  1JXB A;  2KTQ A;  4YOT A;  3VQE A;  3MXM A;  5AQK A;  4CHQ A;  2G8K A;  3L2R A;  4DU4 A;  2HHS A;  3V9Z A;  2X78 A;  3AA3 A;  1C0F A;  4RTF D;  5FPN A;  4GMJ B;  2P9N A;  3DWL A;  4PHT X;  4FZY A;  3KZB A;  3WUH A;  1T03 A;  1RBU A;  4BRM A;  3V9U A;  1N36 K;  1RNH A;  4CJ3 A;  4DTJ A;  1R59 O;  2FLO A;  2O8F B;  2IVN A;  4CHO A;  1X3N A;  3J80 O;  4MDA A;  4XH1 A;  1EWQ A;  4JEP A;  2D0O A;  4O0J A;  4ILG B;  4H0T B;  1MWK A;  3OTO K;  4B1Z A;  1J5O A;  4JAX A;  3VEO A;  1NU0 A;  4IFE A;  3OYD A;  3L2Q A;  4KFB A;  2PAV A;  5FPE A;  3V1R A;  3HPO A;  4DG1 A;  2F8S A;  2WBN A;  3LAL A;  4I2P A;  1ZBF A;  4IG0 A;  4A62 A;  2YJE A;  3DJC A;  1MDU B;  3AVC A;  4GW6 A;  4DTX A;  2A5X A;  4DTN A;  3B6P A;  3FFI A;  4JKF A;  3RR7 A;  3QER A;  3THY A;  3NF8 A;  4W5R A;  4BWJ A;  1SS6 A;  2G8U A;  3HOT A;  2BGG A;  1RT3 A;  3HT3 A;  3OS0 A;  4MDB A;  4PKH A;  3AO4 A;  4CJ4 A;  1SL0 A;  4CE9 A;  3CXC M;  4Y0W A;  2JGU A;  3UKR A;  4H5R A;  1U2V A;  1D5A A;  1FKO A;  4BR4 A;  1NGE A;  3IRX A;  4BWM A;  1RTD A;  3C0B A;  1RBV A;  1TGO A;  4CJS A;  2WTU A;  1QQM A;  4CJV A;  3LZJ A;  3MWT A;  1HYS A;  4OGC A;  3HPG A;  2YX6 A;  1OVY A;  2D0C A;  1IJJ A;  3H1Q A;  3JXU A;  2P9U A;  4B8C A;  1TVR A;  3MN7 A;  4ID1 A;  3IS9 A;  1S1V A;  1VQL N;  5F1X A;  4E1J A;  3MEC A;  5AQX A;  4E7H A;  3LWM A;  3W3D A;  3A2F A;  3IFR A;  1KVA A;  2V7Y A;  3NGI A;  3QEP A;  3LP0 A;  3OJS A;  3NF6 A;  4PKG A;  3WEE A;  4CJL A;  4RWT A;  4FOI A;  2B4J A;  4CJ5 A;  2KZM A;  4FOE A;  4X65 K;  1OH5 A;  5KGX A;  4YDU A;  4LY7 A;  4A2A A;  1O1W A;  4KB1 A;  3BZC A;  4C1N K;  3KK3 A;  1TK0 A;  1OH8 A;  5HRR A;  3A5L C;  1QHT A;  2D5R A;  2BH1 A;  2JLE A;  3UKU B;  2W40 A;  1SUQ A;  1G15 A;  2F9T A;  4H8K A;  4CEB A;  1VQ8 N;  4CEQ A;  1WOQ A;  3V4I A;  1M90 O;  1IKX A;  4M3T A;  1NGC A;  3SQ4 A;  2KKZ A;  3HM8 A;  4WFA L;  3NDK A;  3K0S A;  1CZA N;  2A41 A;  3HM9 A;  3R1X A;  5CZ1 A;  2XRI A;  1N34 K;  4J2E A;  2P9S A;  1RIL A;  2Q0U A;  5CZ2 A;  4YFU A;  1EQY A;  4KB0 A;  2UU9 K;  4NYF A;  3MXJ A;  4FM2 A;  2X6S A;  3AO1 A;  1TV6 A;  1J6Z A;  2G8H A;  2P9L B;  3A5N C;  1S5J A;  4ILH A;  1FW6 A;  3QBX A;  3QFP A;  3ZT2 A;  1Q82 O;  1KFS A;  2YJF A;  4B9M A;  4LFA K;  4KH4 A;  4JI2 K;  3KK2 A;  3VQC A;  2IOC A;  1N5Y A;  4K8Z A;  2D1K A;  1NKB A;  3C65 A;  1LW0 A;  4B9V A;  3CJB A;  4B9Q A;  1X1P A;  4FJI A;  4FJJ A;  4DCH A;  1Y64 A;  3MN5 A;  2PFU A;  4DHY A;  2OYQ A;  3I0S A;  2P9P B;  1LOT B;  2E5L K;  4M42 A;  3HP6 A;  4IXC A;  4PL7 A;  3GDQ A;  4LH4 A;  3VES A;  3T69 A;  4DU3 A;  1EWR A;  4GVE A;  4BG9 A;  1VSI A;  1DGK N;  3TWH A;  1JLQ A;  4BC5 A;  3WXL A;  3TAM A;  2Z1G A;  3ENH A;  4V19 S;  3E1Y A;  2B5J A;  2FF6 A;  3AO5 A;  3LL3 A;  3OBW A;  4G1Q A;  3M6G A;  1I94 K;  3Q7B A;  1RT2 A;  1UA1 A;  5M1P A;  4H5V A;  4KV8 A;  3EY1 A;  1NKE A;  1K8A O;  3ITH A;  2NRT A;  5KPZ A;  3S3N A;  2Q2R A;  4CHP A;  3LDO A;  2BTF A;  4XH5 A;  5AQT A;  4K43 A;  5GAH P;  3QEW A;  1NK9 A;  2V52 B;  4I9L A;  3FZF A;  4JD2 B;  4H0V B;  3G6E N;  3ZYY X;  2P9K B;  4LF5 K;  2YHB A;  3T7Z A;  5GAG P;  1GLD G;  2DY4 A;  4DF4 A;  4I6M A;  1BQN A;  3QNN A;  3P4I A;  3HVR A;  5CHI A;  4CHZ A;  4F9O A;  4I9Q A;  1XI1 A;  4LH5 A;  4FWK A;  2G8V A;  1ATN A;  5KI6 A;  4DFK A;  4IEI A;  4JKB A;  2X6N A;  1DKG D;  4B1W B;  5M1N A;  5EY4 A;  5MLC Q;  1JLA A;  1KQS M;  4KKO A;  2ZJQ L;  2W6K A;  1MU2 A;  2IIR A;  4X62 K;  3RTV A;  1GLB G;  3O4W A;  3TU5 A;  1YTU A;  4FL9 A;  1R0A A;  4DS5 A;  3AO2 A;  3ID6 A;  2HVH A;  3VQD A;  1BOT O;  3BZK A;  4J2A A;  3NFA A;  4HWI A;  2O8D A;  4BRN A;  3CCS N;  3MED A;  4CF2 A;  5AZI A;  2ZE2 A;  4OLA A;  3OA9 A;  4CEZ A;  3IDH A;  4KI4 A;  5BPM A;  3TR8 A;  5SWM A;  3VQA A;  1BG3 A;  3OYC A;  2FSN A;  2ASM A;  1RBR A;  2VG5 A;  3F9M A;  1EO1 A;  3QIP A;  1TK8 A;  4QOZ B;  3KK7 A;  2VGM A;  4OPK A;  2RE2 A;  5CR4 A;  1RDD A;  1D4X A;  4F2R A;  4DTO A;  5ADX A;  5HP1 A;  4JYA K;  3ULE B;  1GLL O;  2D0B A;  5BRD A;  4NCA A;  3TSU A;  3VMF B;  4KHY A;  1P8Z A;  1S9E A;  3RMC A;  4N47 A;  4JI4 K;  1WBB A;  4NO7 A;  2D0P A;  3SV4 A;  2QA4 N;  5DK5 A;  4GKJ K;  3OY9 A;  3ZSW A;  3T3F A;  5K14 A;  3TAE A;  1TL1 A;  2YHA A;  4Y1C A;  3MEE A;  1B9D A;  1YXQ A;  5TKW A;  3BF3 A;  3EL2 A;  4QAG A;  4CD3 A;  5EU7 A;  3VN5 A;  4OO1 J;  2Q97 A;  5AQO A;  4XIU A;  3M8R A;  5AQW A;  4C8M A;  3KLG A;  4ID5 A;  1I3A A;  3C6T A;  3O9Q A;  2GUP A;  4BGB A;  3CFP A;  1SAZ A;  3R6M A;  4M63 C;  3AA4 A;  2LSN A;  3CFR A;  4ELT A;  3GBT A;  3VGL A;  4YOY A;  2QK9 A;  1YJ9 N;  3ATV A;  4NXN K;  1NLV A;  2YCH A;  1MWM A;  1BIS A;  4QCL A;  4H5N A;  1RFQ A;  3DYA A;  1RT1 A;  1HNI A;  4BRA A;  1VQN N;  1CXU A;  3ZT0 A;  4Q5V A;  1L5U A;  1HQU A;  1EKE A;  3V6D A;  3SCX A;  3THY B;  1RTI A;  2G8W A;  1TKX A;  1A5V A;  1BA1 A;  3KLF A;  2NZT A;  3K57 A;  1EET A;  4YOU A;  4Z4H A;  1IG9 A;  3IUC A;  2ZQB A;  4CD1 A;  2A6A A;  3ZSO A;  3S3O A;  3UKR B;  5AR0 A;  1U2V B;  3TI0 A;  2ATQ A;  4C8K A;  3EZ5 A;  4CJR A;  1P90 A;  1ZC6 A;  1HUX A;  2I7N A;  4B1V A;  1NJX A;  4DSE A;  3TAB A;  3NCI A;  3A0I X;  3CFO A;  4FJ9 A;  1YAG A;  1E3M A;  4RW7 A;  1KAX A;  5I3U A;  1VSK A;  1KC8 O;  1C1C A;  2HHV A;  4BRL A;  4BVP A;  1ZYQ A;  4A5A A;  4BGA A;  2P9U B;  1XQS C;  2YHX A;  4JLH A;  2OZS A;  5AZJ A;  4FLX A;  4FWR A;  4FK2 A;  2F9W A;  1YIJ N;  3DRR A;  3MN6 A;  4CIG A;  2HHQ A;  3TSP A;  3WEE B;  3NH0 A;  1J9A A;  3QO9 A;  4JI8 K;  1RDB A;  3LDS A;  1GLF O;  1K6Y A;  1XNR K;  3ZX0 A;  2A1R A;  4Q0B A;  4DTU A;  5AJ3 K;  3KTQ A;  3H08 A;  3VQ8 A;  1EXQ A;  3QET A;  4FJ5 A;  1X9W A;  4DMN A;  2XY5 A;  4LF7 K;  4CJK A;  4KTW A;  3OYF A;  4FM1 A;  4FLT A;  4Z4I A;  5M1K A;  3WNE A;  5J1E A;  3KLH A;  3M8S A;  5F0X A;  4HCB A;  4NCB A;  3PLA A;  3PSI A;  4BR2 A;  4FWM A;  4E7K A;  2P9S B;  3LAK A;  4KHU A;  1OH6 A;  2JWL A;  5AQZ A;  2Q31 A;  1E4G T;  2E6L A;  4CFB A;  4OPA A;  3DLB A;  1Q8I A;  3CF5 L;  5GAE P;  4CIE A;  1NGA A;  4QS7 A;  5KRS A;  3QNO A;  1VQP N;  2QKK A;  3ZX3 A;  2CGL A;  2E8A A;  4CGI A;  4JRQ A;  1BL3 A;  1Q7Y O;  3CC2 N;  1QSL A;  3R3L A;  4Z4G A;  4TSX A;  2GWK A;  4DLE A;  3ZET A;  4DR1 K;  4WCE L;  4B8A B;  4M45 A;  2GEL A;  2ASO A;  4BC4 A;  3ENB A;  3TTC A;  4FPA A;  1LAW A;  3ZEU A;  1N33 K;  4MLH A;  4FK0 A;  3S3M A;  5AQV A;  4E7I A;  1YVN A;  3HL8 A;  4CZE A;  1U04 A;  3SAG A;  1T05 A;  3LM9 A;  3OYE A;  3T1Y K;  1S1X A;  1CLQ A;  4JI5 K;  4CEO A;  5JLF A;  2DPN A;  4BDP A;  4A59 A;  3JAM O;  4J2D A;  4JHD A;  4DV2 K;  5HOO A;  2ZD1 A;  1C0G A;  2WFB A;  4H0Y B;  2IC3 A;  1GLJ O;  4IG3 A;  3MX2 A;  3DXM A;  4O5F A;  3WNH A;  3LWL A;  4DUZ K;  4CZM A;  2PYJ A;  5FRO A;  4GV6 A;  1CZB A;  3SNN A;  2DFH A;  1BO5 O;  1HX1 A;  4JKG A;  1JXE A;  1HMV A;  2HMI A;  4AF1 A;  1CZ9 A;  3D2F A;  3SYZ A;  3QES A;  4CK3 A;  4YOW A;  3RVC A;  5GIO A;  4B3M K;  3OYM A;  4E1N A;  3ZSZ A;  4BR0 A;  1BIU A;  3DXK B;  2G8F A;  3TTF A;  1BU6 O;  4ELV A;  4EP5 A;  1TAQ A;  3K5L A;  3CCL N;  1WSJ A;  3LPU A;  2GWJ A;  4HUG A;  5JS2 A;  1NK5 A;  4I7F A;  5JVH L;  3LDP A;  1GOC A;  1WSF A;  4BRG A;  2HNZ A;  3C6A A;  2Z1H A;  2O8D B;  1QS4 A;  4JKD A;  2HHW A;  2DTU A;  2HND A;  2Q0R A;  2FBV A;  3CCE N;  4CCH A;  4ZHR A;  5AZI B;  4CJP A;  4FLY A;  4DTS A;  3KKR A;  4CF8 A;  1TYQ A;  2HW3 A;  3FZH A;  3F9K A;  3RMB A;  4U67 L;  4MFB A;  3OBY A;  2RHK A;  4ELU A;  2QWL A;  3SV3 A;  4GVM A;  3O1W A;  2YKN A;  3CI5 A;  3MN9 A;  3MWP A;  3HRG A;  1KLN A;  3OHR A;  3DOK A;  5AQS A;  3GG4 A;  3SQ0 A;  4CHN A;  3OYH A;  4FSV A;  3VTH A;  4O8K A;  4YOR A;  3L8B A;  4KTQ A;  1RGI A;  4M41 A;  1VQM N;  2NRZ A;  3SBT A;  3P38 A;  3H45 C;  3SZ2 A;  4DR3 K;  1NG9 A;  3VQ5 A;  3O3F A;  1FKP A;  1J53 A;  3SUQ A;  1QSS A;  2OTJ N;  1Z05 A;  4IJA A;  2FC0 A;  3ISN C;  1YHQ N;  4KI6 A;  4G9Z A;  1E4F T;  2OZM A;  4CF1 A;  1S72 N;  3K59 A;  4GKK K;  3QIC A;  3BDP A;  3VEV A;  1VK0 A;  3MDQ A;  3AA2 A;  2J4R A;  4EIA A;  3CJA A;  3OYI A;  2Q3S A;  4LC9 B;  4YOX A;  4BAC A;  1S6Q A;  3S41 A;  4HCC A;  4B9T A;  5DM7 L;  3THW A;  3O9U A;  4O0I A;  3L2U A;  2Q1N A;  4JKH A;  1VHX A;  3FZM A;  1SKR A;  5HBM A;  3NMU A;  3ZSQ A;  1XMO K;  4IFY A;  4EAH D;  3CIP A;  3LDN A;  3RRG A;  3O9S A;  2HNY A;  3OW2 M;  1ATR A;  4AHU A;  2KW4 A;  1UOC A;  3CYM A;  1T3V A;  4CJW A;  1WAF A;  3C7N A;  1NK6 A;  3EKU A;  5F2R A;  3AVB A;  5B8H A;  3PSF A;  4E7L A;  4Z4E A;  4AHS A;  2GEM A;  2UUA K;  4WQ4 C;  4DSL A;  4DSF A;  1KAZ A;  2A1S A;  3A8Y A;  4X64 K;  5JLH A;  1BI4 A;  2P9I A;  3WNG A;  3NVK A;  3MAQ A;  1QZ5 A;  4FW2 A;  1RDC A;  3R8E A;  1IG8 A;  2P5O A;  1VSD A;  1NWK A;  3WXM B;  3FGU A;  2PZS A;  4LFC K;  1FJG K;  2QWQ A;  2QI2 A;  4CZH A;  2FBX A;  1DEJ A;  4JS4 A;  1VQ7 N;  1YTA A;  4GV3 A;  5HRN A;  4C23 A;  3RWU A;  1LV5 A;  4CZK A;  3MCP A;  3VET A;  3HYF A;  1Q9X A;  4FVU A;  5AZJ B;  2O4I A;  3PX6 A;  3CJ9 A;  4B1X B;  4DFP A;  4FO0 A;  1B92 A;  1L3V A;  1HNX K;  1KLM A;  3VEX A;  2OCE A;  3TAF A;  1ZXO A;  2VQF K;  4DSI A;  4F8R A;  1GLA G;  4OPJ A;  1BA0 A;  1CXQ A;  4DQS A;  2RN2 A;  4B3O A;  4HHT A;  4C1N I;  2OPS A;  1W9H A;  1K8K A;  4RW4 A;  4Z4F A;  4X66 K;  4B3R K;  4IBN A;  3VEW A;  1Y97 A;  4I2Q A;  3TAN A;  4JI0 K;  2ZJP L;  4BDZ A;  1XC3 A;  1QQN A;  3CMA N;  4FVM A;  5KQ8 A;  4JI1 K;  3OYK A;  4W5Q A;  4EP4 A;  3K5O A;  4H0X B;  4WQ5 C;  2YNH A;  3SPY A;  1ILY A;  1D8Y A;  4DV7 K;  3TAR A;  5HLF A;  2X74 A;  4KAZ A;  4FJG A;  3CM6 A;  3AVA A;  4UQG A;  2GTD A;  1VSL A;  1XWL A;  4WF9 L;  3QEI A;  1C0M A;  4E7J A;  1X9M A;  1TUU A;  1KTQ A;  5KPT A;  2E20 A;  3LP1 A;  4YHH K;  1S3X A;  4EZ6 A;  3PO5 A;  4FXD A;  3AVH A;  5HRO A;  1OH7 A;  3SPZ A;  3VQQ A;  1NMN A;  1C0U A;  4DTP A;  1HNW K;  3U4L A;  3L4I A;  4OGE A;  4BC2 A;  4BQZ A;  4OLB A;  1VSJ A;  2EHG A;  3G0Z A;  2WOM A;  2O8C A;  4CEF A;  3TSQ A;  3CPW M;  2E2Q A;  5C25 A;  5KTQ A;  1RDA A;  4E0D A;  2ZGY A;  2YNG A;  4AQY K;  1NK0 A;  2CH6 A;  2HST A;  1K73 O;  1JLE A;  2A42 A;  4KRE A;  4OX9 K;  3K2P A;  2O8B A;  1NGB A;  1YIT N;  3J81 O;  4KHW A;  1RT4 A;  5IWA K;  3SJJ A;  1KVB A;  3CG7 A;  4FWL A;  2VQE K;  1XHZ A;  1KRP A;  4ZTF A;  1RBS A;  3K9J A;  2E1Z A;  1BUP A;  4A61 A;  1QVF M;  4DWI A;  4FJ7 A;  4FCY A;  3L3U A;  4FYD A;  3HI0 A;  2KFN A;  3NE6 A;  3G25 A;  5D3G A;  2QWP A;  3ZLJ A;  3C6H A;  3ZEU B;  5C15 A;  1Q9Y A;  2NRW A;  3O9R A;  4K8X A;  1EP4 A;  2E4L A;  3A5O C;  3LAM A;  1LCU A;  1RDU A;  3VTI A;  1EX4 A;  4XEI A;  3BP8 A;  4M3U A;  1YJN N;  3CCM N;  1TL3 A;  5CE3 A;  1JCF A;  1Z26 A;  3U9Z A;  4AHR A;  1Q86 O;  2VWK A;  3FFK B;  3ZSX A;  4BRP A;  4UY8 O;  4OVL A;  1NJZ A;  4N76 A;  4K25 A;  4FWP A;  2CGJ A;  3L2V A;  3AA5 X;  1JL2 A;  1ASV A;  4JHD B;  3CQ8 A;  1RTH A;  1RCH A;  3TTD A;  2FXU A;  3CC4 N;  4BRC A;  4DTM A;  3VF6 A;  1C0T A;  1HKB A;  4BE2 A;  3OS2 A;  3HBT A;  3ENO A;  4CK2 A;  3OYA A;  2HB5 A;  5I42 A;  3O08 A;  4A2B A;  2IAJ A;  3SAF A;  4CF9 A;  2R7Y A;  4M3X A;  3HJF A;  3WXJ A;  2Y1J A;  4IDK A;  4WYB A;  3L2W A;  3VQ9 A;  2BUP A;  1NJI O;  4JKG B;  4LF4 K;  2QWM A;  4DV3 K;  3U3Y A;  1IV0 A;  2HHU A;  1L3T A;  4RCH A;  1HKC A;  1HPM A;  4IOC L;  5AQG A;  3SQ1 A;  5AQQ A;  2P9N B;  3LPT A;  4FPB A;  4CEA A;  4BRI A;  2UUC K;  4PQU A;  3AGR A;  5JIC A;  2RKI A;  4K42 A;  2RF2 A;  1VAZ A;  3C6U A;  5AQL A;  3F5T A;  2YHW A;  4BQL A;  4OPH A;  5BPL A;  3OYN A;  5AFU A;  1T6C A;  4ZTJ A;  4QS9 A;  3I56 N;  3WXI A;  5BR8 K;  2VGN A;  3KD1 E;  2Q36 A;  3K5N A;  1L3S A;  3KK1 A;  4Z4C A;  1XUP O;  4M7Y A;  4MLE A;  4CEE A;  4DFJ A;  5KQD A;  3TAQ A;  3IKM A;  2E6M A;  1SL1 A;  4OKE A;  4CZJ A;  4YNQ A;  5EOY A;  4DR7 K;  4OKJ A;  3ZT1 A;  3CME N;  4E89 A;  2ASP A;  4A57 A;  3AAQ A;  2QEX N;  5DMR A;  3NHG A;  4C8O A;  4DR2 K;  2KQ2 A;  4ISG A;  3D2E A;  2ITG A;  3VGK A;  2XY6 A;  3KWI A;  4LSN A;  2KHO A;  2E2O A;  3HK2 A;  2BDP A;  4KH5 A;  1B9F A;  3LDL A;  3D0P A;  3BEX A;  4NCG A;  4ISF A;  4BG8 A;  5C0Y A;  1OVQ A;  3OYB A;  4BY9 C;  5KGW A;  2HBK A;  1W7A A;  3PO4 A;  5H1S Q;  4AM7 A;  4H0P A;  2DFF A;  3E9L A;  3L3V A;  4DF8 A;  5JMV A;  1YJW N;  3J7A P;  4FM0 A;  2UXD K;  4U7B A;  1V4S A;  3H3O B;  4XH4 A;  5I9E B;  1S6P A;  3EZW A;  3DLE A;  2KLA A;  2YNF A;  4W5N A;  4DQR A;  3QDK A;  4FWN A;  4HUF A;  4DSK A;  4M7X A;  4M3R A;  2QWN A;  2E1Y A;  2G8I A;  2IDO A;  3O9T A;  1UA0 A;  4PL8 A;  4KHQ A;  1NK4 A;  4CER A;  2P51 A;  4OKK A;  2AA4 A;  3O8M A;  4JKA A;  3THW B;  3M8Q A;  5SZT A;  4W5T A;  2Z1I A;  1S22 A;  2FBT A;  1HJO A;  4DB3 A;  4IOA L;  3KD5 E;  1JLC A;  2YNI A;  5GAD P;  1IO2 A;  1Q18 A;  4A5B A;  4L3Q A;  3DOL A;  3T1A A;  4YOV A;  3ZT3 A;  3ZSR A;  3E01 A;  4IKF A;  3U8X A;  3THX A;  3MX5 A;  1NGG A;  4EZ9 A;  3FZK A;  4BE0 A;  1JCG A;  3CJ7 A;  1T7P A;  5AQU A;  3N4Q A;  3BF1 A;  4PY5 A;  1BI4 B;  3RRH A;  3SMS A;  4N41 A;  2P9I B;  1HJR A;  3D6R A;  5C42 A;  4JI6 K;  3QB0 A;  4FJX A;  2D0A A;  2W6L A;  1Z6R A;  3L6Q A;  4CGD A;  4CFD A;  3CCQ N;  3NF7 A;  1J54 A;  5BPN A;  3O80 A;  3R9P A;  1SQK A;  1JJ2 M;  2F96 A;  3O5B A;  5ADX H;  4DR4 K;  5HRS A;  5M1F A;  3QEX A;  5M1O A;  1GOA A;  1M1K O;  1IBM K;  3HO1 A;  4BRO A;  4BC3 A;  1ZBU A;  3NBP A;  3B6O A;  5LMN K;  2D4W A;  3CCR N;  2KFZ A;  4NLC A;  1UAX A;  3QIO A;  1G99 A;  2ZM6 K;  5LL6 Z;  4JN4 A;  3THV A;  2BE2 A;  5AQP A;  3DLL L;  2HOE A;  1DTQ A;  1K8K B;  4PA1 A;  3AV9 A;  5FPM A;  4CJE A;  1J5E K;  4FJK A;  3EE8 A;  3H46 O;  1KSP A;  1LWF A;  4K41 A;  3DLG A;  2VWB A;  4WFN L;  3LM2 A;  2V51 B;  2HHH K;  2O4G A;  5EX5 A;  1D9F A;  1BHL A;  3V1O A;  3C94 A;  3TPQ A;  2W41 A;  4B3S K;  1VSH A;  1IKW A;  4BRD A;  4NXM K;  2NRV A;  3WQU A;  4RW8 A;  1W97 L;  2PBD A;  3KKS A;  3L4Q A;  4JI3 K;  4CK1 A;  2HHX A;  4JKE A;  1NK8 A;  3H3N O;  3H1V X;  3AAR A;  3CQY A;  1U49 A;  1VQ6 N;  3OYG A;  1N32 K;  4NLB A;  3CQX A;  4CZG A;  1TUY A;  3FZL A;  3NGY A;  4H4M A;  1U48 A;  1NKC A;  1ZBH A;  3UB5 A;  4CBX A;  2O8C B;  3EYZ A;  2E2P A;  4I6M B;  1HNV A;  2IGI A;  2YV0 X;  4ILJ A;  3I8D A;  1T8E A;  3VQ4 A;  2Z1J A;  3IAY A;  4KRF A;  3RR8 A;  5AQI A;  3P5J A;  2NLX A;  4IO9 L;  3HP9 A;  4CGF A;  1YT3 A;  3SUP A;  3VGM A;  2A3Z A;  3T19 A;  3UIQ A;  2XHB A;  3ASM A;  3RSE A;  4Z94 A;  2P1J A;  4CJQ A;  3U3G A;  4IOX A;  1GOB A;  4KO0 A;  3AVK A;  3UE5 A;  2NUB A;  5J2M A;  1XC9 A;  5C10 A;  2QXF A;  3SJH A;  2ZF5 O;  4JS5 A;  4E3S A;  3LP2 A;  1ESV A;  3OVN A;  3KWG A;  2YHY A;  3I8B A;  3O3G A;  5BRH A;  3G10 A;  4CEC A;  4K0K K;  4CFA A;  3RMA A;  4JK9 A;  3AVN A;  4LF9 K;  1NM1 A;  1V4T A;  4IWV A;  4FLZ A;  2IVO A;  4BE1 A;  1NMD A;  1X3M A;  4WE1 A;  3CCV N;  4B9L A;  4CI6 A;  2B6A A;  1F21 A;  5BN9 A;  3U9D A;  1KCF A;  3ZSV A;  1VSM A;  3PIP L;  5FPD A;  1WLJ A;  2A40 A;  3SLC A;  3SUO A;  4OJR A;  2ZGZ A;  4N56 A;  3CCU N;  4AHC A;  1JKH A;  2YI1 A;  5FRM A;  3P1G A;  5TKY A;  4DQ8 A;  3PIO L;  2QW9 A;  3VEN A;  3K5M A;  4CF0 A;  1RT7 A;  4FZX C;  3PX4 A;  3J7Y P;  4DV1 K;  1IKV A;  3OYJ A;  2AP1 A;  3EKS A;  3DRP A;  4CJU A;  2NRH A;  1SKW A;  3QBW A;  1L3U A; 
#chains in the Genus database with same CATH homology
 5EXW A;  3U4L A;  3L4I A;  4CJ7 A;  4BQZ A;  4BC2 A;  4CZL A;  3N4P A;  2VCP A;  3W0L A;  1BA1 A;  3TSQ A;  4BR7 A;  4CZI A;  2NZT A;  2E2Q A;  4QS8 A;  3CPW M;  4YOU A;  2ZGY A;  1W2B M;  5AFU H;  3AGK A;  2CH6 A;  2HST A;  1MA9 B;  3IUC A;  5AQH A;  1NBW A;  3ZX2 A;  4CD1 A;  1K73 O;  2A6A A;  2A42 A;  2CH5 A;  2QXL A;  4DKW A;  4PKI A;  3UKR B;  5AR0 A;  5JVG L;  1U2V B;  1NGB A;  3VEY A;  3CPE A;  5BR9 A;  3Q7C A;  3O6W A;  1YIT N;  3G71 N;  4FWL A;  5KPR A;  1K9M O;  1VQ4 N;  1P90 A;  1ZC6 A;  1HUX A;  2I7N A;  3O1B A;  2HBJ A;  1YUW A;  3WQT A;  2IVP A;  4B1V A;  5AQY A;  3K9J A;  2E1Z A;  1BUP A;  3D7E O;  1GLE G;  4A61 A;  1ZBS A;  1N8R O;  1QVF M;  2V7Z A;  2VYP A;  3A0I X;  4MO4 A;  5BRE A;  3HI0 A;  3KHY A;  5AQM A;  5C2F A;  1OKJ A;  1YAG A;  2F7T A;  4IEE A;  3GL1 A;  3G25 A;  2QWP A;  1KAX A;  3C6H A;  3ZEU B;  5C15 A;  1KC8 O;  2NRW A;  3O9R A;  4BVO A;  3ATU A;  3A5O C;  4WQ5 A;  4BRL A;  1LCU A;  4BVP A;  3FR0 A;  1KAY A;  4A5A A;  2P9U B;  4BGA A;  1XQS C;  4CBU A;  1GLC G;  1RDU A;  1O13 A;  2YHX A;  3D2E B;  3ULE A;  3VTI A;  5AZJ A;  5DM6 L;  3M5R A;  4XEI A;  3K9K A;  3BP8 A;  1DT9 A;  3MK6 A;  4FWR A;  2HF4 A;  1NGF A;  1YJN N;  3CCM N;  5CE3 A;  3CD6 N;  2F9W A;  1JCF A;  3U9Z A;  1QQO A;  4YOT A;  1YIJ N;  1Q86 O;  3FFK B;  4BRP A;  3VF4 A;  4UY8 O;  3MN6 A;  4K25 A;  5AQK A;  1WUA A;  4FWP A;  2CGJ A;  1SZ2 A;  4KBO A;  4JHD B;  3TSP A;  3WEE B;  1C0F A;  4R79 A;  4RTF D;  5FPN A;  2QM1 A;  3TTD A;  1GLF O;  2FXU A;  2P9N A;  3DWL A;  4BRC A;  4PHT X;  3KZB A;  3ZX0 A;  3CC4 N;  2ZWH A;  3WUH A;  4BRM A;  3VF6 A;  1HKB A;  1R59 O;  2FLO A;  2IVN A;  1X3N A;  3HBT A;  4MDA A;  3ENO A;  4XH1 A;  4JEP A;  2D0O A;  4ILG B;  4H0T B;  1MWK A;  3O08 A;  4A2B A;  3SAF A;  4B1Z A;  4IJN A;  4JAX A;  3WXJ A;  3VEO A;  4WYB A;  1NJI O;  5LJW A;  2BUP A;  4IFE A;  4JKG B;  2NNW A;  2QWM A;  2PAV A;  3VER A;  5M1K A;  2OAN A;  3SAH A;  5FPE A;  4H5T A;  1HKC A;  1HPM A;  2QWR A;  4RCH A;  5LJV A;  4IOC L;  5AQG A;  5F0X A;  3PLA A;  5AQQ A;  4BRE A;  2WBN A;  2P9N B;  4HTL A;  4FPB A;  4A62 A;  4BR2 A;  2YJE A;  4FWM A;  3M1F A;  3DJC A;  1MDU B;  4BRI A;  2A5X A;  2P9S B;  4FWO A;  3AGR A;  4JKF A;  5C10 A;  3HSC A;  4GY2 B;  2HBM A;  2JWL A;  5JIC A;  5AQZ A;  3I33 A;  4K42 A;  2HBL A;  1SS6 A;  1E4G T;  2Q31 A;  1KXP A;  3HOT A;  1VAZ A;  4MO5 A;  4OPA A;  5AQR A;  4MDB A;  3F5T A;  5AQL A;  5EVZ A;  2YHW A;  4PKH A;  4BQL A;  4OPH A;  3CF5 L;  5BPL A;  2ITM A;  5GAE P;  1NGA A;  4QS7 A;  3WT0 A;  5AFU A;  1T6C A;  5LY3 A;  4QS9 A;  1VQP N;  3ZX3 A;  3I56 N;  3WXI A;  4BRF A;  4EHU A;  2GX9 A;  2VGN A;  3CXC M;  4Y0W A;  2CGL A;  3UKR A;  2E8A A;  2Q36 A;  4H5R A;  3CC2 N;  1U2V A;  1Q7Y O;  3CCJ N;  1VQ9 N;  3F2K A;  1XUP O;  3R3L A;  1U6Z A;  2WC9 A;  4M7Y A;  4MLE A;  2GWK A;  4BR4 A;  5KQD A;  1NGE A;  2JWK A;  3ZET A;  3IKM A;  3C0B A;  4WCE L;  3WXK A;  4CZJ A;  2GEL A;  5EOY A;  2ASO A;  3J7Z O;  4BC4 A;  3CME N;  1QQM A;  2ASP A;  3ENB A;  3TTC A;  4A57 A;  3MWT A;  3AAQ A;  2QEX N;  3HTV A;  4FPA A;  2YX6 A;  3ZEU A;  1OVY A;  4MLH A;  1IJJ A;  3AAP A;  5AQV A;  1T44 A;  3H1Q A;  4ISG A;  3GE1 A;  1YVN A;  4CZE A;  3JXU A;  2P9U A;  3CER A;  3D2E A;  3SAG A;  3VGK A;  1HKG A;  3KWI A;  3LM9 A;  3MN7 A;  2KHO A;  2E2O A;  5BN8 A;  3P31 A;  1VQL N;  5F1X A;  4E1J A;  5AQX A;  5GIN A;  3W3D A;  3CET A;  3ZET B;  4KH5 A;  3IFR A;  4H03 B;  5JLF A;  2V7Y A;  2DPN A;  3LDL A;  4NB4 A;  3BEX A;  4AM6 A;  4ISF A;  4A59 A;  4PKG A;  3WEE A;  4JHD A;  4BG8 A;  5C0Y A;  2UYT A;  4RWT A;  4FOI A;  5HOO A;  4BY9 C;  4FOE A;  4O8U A;  1NGD A;  2HBK A;  1C0G A;  2WFB A;  4YDU A;  3I55 N;  3SK3 A;  4AM7 A;  5H1S Q;  4H0Y B;  4H0P A;  3E9L A;  1GLJ O;  4A2A A;  5JMV A;  1YJW N;  1T6D A;  1X9J A;  3A5M C;  4C1N K;  1V4S A;  4U7B A;  3DXK A;  3QML A;  3A5L C;  3H3O B;  3MX2 A;  4XH4 A;  5I9E B;  2BH1 A;  3UKU B;  3DXM A;  3EZW A;  2W40 A;  4O5F A;  4CZM A;  2F9T A;  3G4S N;  4B1U B;  4GV6 A;  2KLA A;  3GOI A;  3IMX A;  3CC7 N;  1VQ8 N;  1BO5 O;  3CJC A;  3HOS A;  1HX1 A;  4JKG A;  1NGI A;  1WOQ A;  3QDK A;  4FWN A;  1QZ6 A;  1M90 O;  4AF1 A;  1NGC A;  3FE1 A;  5GIP A;  4M7X A;  2KKZ A;  3HM8 A;  4WFA L;  2QWN A;  2E1Y A;  1CZA N;  2A41 A;  3D2F A;  3O9T A;  4PL8 A;  3SBG A;  3R1X A;  3MMV A;  4YOW A;  3RVC A;  5GIO A;  2P9S A;  2Q0U A;  4BR0 A;  2AA4 A;  3O8M A;  4JKA A;  3DXK B;  5C2D A;  1EQY A;  1S22 A;  3TTF A;  1BU6 O;  1HJO A;  4DB3 A;  3DXM B;  3CCL N;  4IOA L;  2EWS A;  3FLC O;  3J8A A;  5GAD P;  1J6Z A;  1Q18 A;  4A5B A;  4L3Q A;  2GWJ A;  4YOV A;  2P9L B;  3A5N C;  3U8X A;  2I7P A;  4ILH A;  1JCE A;  3QBX A;  3MX5 A;  3QFP A;  4ISE A;  5JVH L;  2YJF A;  3LDP A;  1Q82 O;  1VQ5 N;  4KH4 A;  1NGG A;  3D2F B;  3FZK A;  4BRG A;  1JCG A;  2NRR A;  3C6A A;  3CJ7 A;  2D1K A;  3E9O A;  5BRF A;  5AQU A;  4JK7 A;  3C65 A;  3CJB A;  4JKD A;  4B9Q A;  3QFU A;  2Q0R A;  2WUS A;  2H3G X;  3N4Q A;  4CZF A;  3BF1 A;  3CCE N;  4DCH A;  1Y64 A;  5AZI B;  3MN5 A;  2PFU A;  3E66 A;  1QVG M;  4DHY A;  3SMS A;  2P9I B;  1TYQ A;  3FZH A;  2P9P B;  1LOT B;  3D6R A;  4YDU C;  5ELZ A;  3QB0 A;  4IXC A;  3RSE B;  4U67 L;  4PL7 A;  3OBY A;  1Z6R A;  3CHW A;  3GDQ A;  2RHK A;  3VES A;  3L6Q A;  1H1V A;  3CCQ N;  3T69 A;  5BPN A;  3O80 A;  2QWL A;  3R9P A;  4GVE A;  1SQK A;  4BG9 A;  1JJ2 M;  2QTD A;  3O5B A;  3O1W A;  5ADX H;  5M1Q A;  1DGK N;  4BRK A;  4BC5 A;  3CI5 A;  3WXL A;  2OTL N;  3MN9 A;  3MWP A;  5M1F A;  3ENH A;  3HRG A;  3OHR A;  5AQS A;  5M1O A;  3EO3 A;  3E1Y A;  3GG4 A;  1M1K O;  4BRO A;  4BC3 A;  2FF6 A;  3LL3 A;  3OBW A;  2D4W A;  4FSV A;  1TYQ B;  3M6G A;  3CCR N;  3VTH A;  4NLC A;  4O8K A;  3Q7B A;  1G99 A;  3DAW A;  4YOR A;  1RGI A;  4JN4 A;  5M1P A;  4H5V A;  5AQP A;  1VQM N;  4IZ9 A;  2NRZ A;  3SBT A;  1Q81 O;  3DLL L;  1K8A O;  2HOE A;  5KPZ A;  2NRT A;  3P38 A;  2Q2R A;  3H45 C;  1K8K B;  3LDO A;  5FPM A;  2BTF A;  4XH5 A;  5AQT A;  2HMP A;  4BR9 A;  3EE8 A;  4K43 A;  3UKU A;  5GAH P;  3BUZ B;  3AY9 A;  2V52 B;  3VF2 A;  3H46 O;  3FZF A;  4JD2 B;  1VQO N;  4GV9 A;  3VEZ A;  2OTJ N;  4H0V B;  3G6E N;  3ZYY X;  2P9K B;  4K41 A;  4WFB L;  1Z05 A;  5C12 A;  2VWB A;  4IJA A;  1YHQ N;  4WFN L;  3T7Z A;  5GAG P;  1GLD G;  3LM2 A;  4G9Z A;  1E4F T;  2V51 B;  4I6M A;  3SMP A;  3P4I A;  1S72 N;  3MCA B;  5E26 A;  1VQK N;  4JNE A;  3QIC A;  5EX5 A;  5CHI A;  2CGK A;  4F9O A;  1YI2 N;  3VEV A;  1NGJ A;  3MDQ A;  4FWK A;  2J4R A;  4EIA A;  1ATN A;  2W41 A;  3CJA A;  3TPQ A;  4IEI A;  4JKB A;  4LC9 B;  5AQF A;  4YOX A;  1DKG D;  4BRD A;  3S41 A;  4B1W B;  2NRV A;  5EY4 A;  5M1N A;  3WQU A;  5E84 A;  5MLC Q;  1W97 L;  2PBD A;  3L4Q A;  5DM7 L;  3O9U A;  4BRQ A;  1KQS M;  2HF3 A;  2Q1N A;  4JKE A;  4JKH A;  2ZJQ L;  3FZM A;  3H3N O;  3H1V X;  5HL7 L;  2IIR A;  3AAR A;  3NMU A;  3CQY A;  1VQ6 N;  4NLB A;  3CQX A;  4EAH D;  2E88 A;  4CZG A;  1TUY A;  3CIP A;  3FZL A;  1GLB G;  3LDN A;  3UB5 A;  3KVG A;  2P9L A;  3O4W A;  3O9S A;  3TU5 A;  3OW2 M;  1YF5 L;  1ATR A;  4FL9 A;  3E9P A;  4CBX A;  1NGH A;  1T3V A;  4J8F A;  2E2P A;  3ID6 A;  4I6M B;  3C7N A;  3NVM A;  4ILJ A;  3EKU A;  5F2R A;  5B8H A;  1BOT O;  3L0Q A;  2GEM A;  4HWI A;  4WQ4 C;  5AQI A;  1ATS A;  4BRN A;  2NLX A;  4IO9 L;  3CCS N;  1KAZ A;  3VPZ A;  3A8Y A;  5AZI A;  5JLH A;  3OA9 A;  2P9I A;  3IDH A;  3VGM A;  3NVK A;  2A3Z A;  2P9P A;  5BPM A;  3LDQ A;  1QZ5 A;  3R8E A;  1BG3 A;  1IG8 A;  3RSE A;  4Z94 A;  2FSJ A;  2FSN A;  1QHA A;  2ASM A;  4IOX A;  1NWK A;  3F9M A;  3WXM B;  1EO1 A;  3FGU A;  3UE5 A;  3H6E A;  4KH6 A;  3KK7 A;  3JS6 A;  2VGM A;  2QWQ A;  2QI2 A;  2RE2 A;  4CZH A;  3C7N B;  4IO8 A;  1RDW X;  5CR4 A;  1BWF O;  1DEJ A;  2FF3 B;  2ZF5 O;  3SJH A;  4H5W A;  1VQ7 N;  4GV3 A;  1D4X A;  4H0O A;  4C23 A;  3M3Z A;  4CZK A;  1ESV A;  5ADX A;  3MCP A;  3ULE B;  3KWG A;  1GLL O;  4JK8 A;  3VET A;  4FVU A;  5AZJ B;  2YHY A;  3I8B A;  3EN9 A;  4GNI A;  5BRD A;  5BRH A;  3TSU A;  3VMF B;  1P8Z A;  4JKC A;  3CJ1 A;  2E2N A;  4JK9 A;  3CJ9 A;  4B1X B;  1NM1 A;  1V4T A;  4FO0 A;  4NO7 A;  4IWV A;  2NRX A;  3VEX A;  2D0P A;  1ZXO A;  2FSK A;  2IVO A;  2QA4 N;  1GLA G;  1BA0 A;  4IDH A;  4EHT A;  1NMD A;  1X3M A;  3CCV N;  4CI6 A;  4EFH A;  5BN9 A;  4C1N I;  3U9D A;  1K8K A;  1YXQ A;  5TKW A;  3BF3 A;  3EL2 A;  1HLU A;  2QWO A;  4BRH A;  4CD3 A;  3PIP L;  4OO1 J;  3VEW A;  1KD1 O;  3EE9 A;  5FPD A;  4JD2 A;  2Q97 A;  2ZJP L;  2A40 A;  1XC3 A;  5AQO A;  3SLC A;  5AQW A;  1QQN A;  3CMA N;  5KQ8 A;  2P9K A;  3P39 A;  3O9Q A;  4H0X B;  4WQ5 C;  2GUP A;  4BGB A;  2ZJR L;  1SAZ A;  4WQ4 A;  2ZGZ A;  3R6M A;  1ILY A;  4M63 C;  3HZ6 A;  3CCU N;  3GBT A;  3VGL A;  4YOY A;  3B8A X;  1YJ9 N;  3ATV A;  2YI1 A;  2GTD A;  1NLV A;  5TKY A;  2QW9 A;  4DQ8 A;  3VEN A;  3PIO L;  4WF9 L;  2YCH A;  1MWM A;  4FWS A;  4FWQ A;  1TUU A;  5KPT A;  4H5N A;  2E20 A;  5AQJ A;  3ID8 A;  1RFQ A;  1BDG A;  4BR5 A;  4BRA A;  1S3X A;  5AQN A;  2AP1 A;  3EKS A;  1VQN N;  4B1Y B;  3VOV A;  2NRH A;  3QBW A;  4CBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...