2RHKA

Crystal structure of influenza a ns1a protein in complex with f2f3 fragment of human cellular factor cpsf30, northeast structural genomics targets or8c and hr6309a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
PASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for suppression of a host antiviral response by influenza A virus.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/nuclear protein
molecule keywords Non-structural protein 1
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2rhkA00
3EE8A 3P38A 2GX9A 3KWGA 3P31A 3KWIA 3O9QA 3O9TA 3M5RA 3O9UA 3EE9A 3O9RA 3F5TA 3D6RA 4OPAA 3O9SA 2RHKA 3RVCA 3P39A 3OA9A 3L4QA 2KKZA 4OPHA
chains in the Genus database with same CATH superfamily
1HJRA 1ITGA 4YNQA 2HVHA 4DV1K 2RKIA 4DFPA 4Q0BA 1XQSC 1HYVA 3L3UA 3HSCA 4IFYA 3OYEA 3V9SA 2ZE2A 2YKNA 1UOCA 3AO2A 3T3FA 3NCIA 5DK5A 4U7BA 1KRPA 2OTLN 4EIAA 4C1NI 5JS1A 2D5RA 1NOZA 3MXIA 3EL2A 2HB5A 4JYAK 1NM1A 1VQMN 1KVBA 4CBXA 1XWLA 4O44A 5CZ1A 5AQLA 3NGZA 3L6QA 3QFUA 1JXEA 3MCAB 1SUQA 3DLBA 3S3OA 4DR1K 1C1AA 3SQ2A 3MN6A 4NCAA 2E2PA 4YY3K 2YCHA 3NAEA 2ZGZA 1VSJA 3HT3A 2FC0A 3OYBA 3RTVA 2NUBA 4DU3A 3PSIA 1F21A 4IFEA 2O8FB 3BF1A 1RT4A 5BRFA 1J6ZA 4CBWA 4YHHK 3QDKA 4BR9A 3S3NA 4IO9L 1W9HA 4IO8A 2GELA 1BGXT 1TKTA 2NRRA 4BRKA 5DM6L 4OLAA 3M8QA 5M1PA 4KAZA 1C1CA 1WNSA 2Y1IA 1CXUA 2CH6A 1QQNA 4C8NA 1K8KB 4ELUA 4DV5K 4DV7K 5B8HA 4M3TA 1MDUB 1ZBUA 5BPMA 3J81O 5AQJA 1DTTA 1RT5A 3ZYYX 3JAMO 3CCUN 3C7NB 3T1HK 3KK3A 1ZBLA 3W3DA 2F96A 3SUPA 2HHXA 3LAKA 2P9SA 1OVQA 4EAHD 1C6VA 4DR5K 5C10A 3P31A 1NBWA 1QSYA 2QWOA 4WF9L 3O9QA 4OJRA 3F73A 3VF6A 1N32K 4H4OA 3EYZA 1NWKA 1ATNA 4A61A 4WQ4C 3HVTA 3KLIA 3DLKA 4HHTA 1IV0A 4CJPA 2ASMA 4WYBA 5AZJA 3WXMB 4BC4A 2E20A 3EO3A 3QB0A 3HK2A 2E6MA 5J2MA 4Z0UA 3CQ8A 4H5WA 1T6CA 1HKCA 4JEPA 3E01A 4M3YA 1TV6A 3OYLA 1K8KA 3THYA 4FJLA 1BWFO 4CECA 4BE2A 3L8BA 2OPQA 1RDCA 1RBUA 2OANA 4H4MA 4CJKA 3EZ5A 3ZEUB 2W41A 1X9SA 1S6QA 4BC2A 5FROA 2YHXA 1NU0A 3HTVA 5F0XA 3O9TA 2O8CA 4CJSA 4H0OA 2AA4A 3HPGA 3KK1A 1FXXA 3TR8A 2KKZA 3C7NA 1NGGA 4WQ5A 2Q31A 2VGNA 3EKUA 2EX3A 4KHSA 1FJGK 5LJVA 3ZX0A 2PFUA 4ILHA 1SS6A 3TAPA 4CJQA 2VG7A 3QEWA 3QBWA 3ENHA 1S22A 4IEIA 1TAUA 3AV9A 2O8CB 3OYJA 3G4SN 1IKVA 3LZJA 5KTQA 2KTQA 2FBTA 2KQ2A 2CGJA 5FRNA 2JGUA 2HNYA 3KJVA 4FWLA 3VERA 1N33K 1NGFA 2HHQA 5CZ2A 1VSMA 4GV9A 2ETJA 3H3OB 4FO0A 5BN8A 3MWPA 3HPOA 3K5OA 1ZBSA 3R6MA 5J1EA 1TVRA 3AA5X 3LM9A 1YF5L 1HYZA 4FL9A 3HP6A 1GLJO 3TWHA 3SCXA 2QEXN 4YDUA 2CH5A 4BVOA 4FWKA 4HTUA 5AQUA 3ZSZA 3CCLN 1VQ8N 3MWTA 4B9UA 3BZKA 5KGWA 4JI0K 4HVJA 4GV3A 4AH9A 1JJ2M 1E3MA 3JSMA 4XH1A 1C0FA 3O9RA 4CW7B 4J2EA 3N4PA 3V1RA 1MU2A 3OA9A 3CC2N 2ZJRL 5GIOA 3EZWA 1VSLA 4CJWA 5EY4A 4W5RA 4DSFA 3U3YA 4GMJB 4BR5A 4KV8A 4FPBA 3MK6A 3VQPA 3KKRA 1NGIA 4KO0A 1ASVA 1NJWA 3AVNA 2PY5A 2P9PA 1X9WA 4H0YB 1Y97A 3MMVA 4WE1A 4A2BA 2QKBA 3SNNA 4I2QA 3O1WA 1Q7YO 2DFHA 3F5TA 5K14A 3T69A 4RW4A 3I8BA 1X9JA 1P90A 2J4RA 3FR0A 3OYIA 2Z1GA 3TAQA 4G9ZA 3VQ7A 3LPTA 4E7KA 4FJKA 4KI4A 3J7AP 4M3XA 3T1AA 2E6LA 1KQSM 3KK7A 1OH5A 5AJ3K 3R8EA 1T44A 2Q36A 4CJRA 1IH7A 1RDDA 2BUPA 5JS2A 3KTQA 1S1VA 3GL1A 4FLYA 2VWKA 5BN9A 1U6ZA 5AQVA 3V9WA 2OYQA 4C8LA 3SAFA 5HRNA 4M7YA 4B9NA 2O8DA 3O3GA 3PO5A 2HVIA 4CGJA 1BQNA 2WBNA 5T7BA 1Q82O 4YOXA 3NF6A 3QEIA 2QK9A 4DTMA 4IDHA 4IG3A 3C95A 5LMNK 5BPLA 1S9GA 1YVUA 3CPWM 1KSPA 4W5TA 1Q9XA 1D9FA 4CEAA 4WFNL 4QS7A 3E9LA 2HBMA 1WB9A 2FBXA 2D1KA 1KAZA 3IKMA 2F8SA 3TTDA 4FXDA 2DY4A 4JKEA 2A1RA 1TUYA 3UKUB 3BZCA 1QVGM 2UUCK 2B5JA 3E1YA 3K5MA 5HLFA 1NJIO 4CJ4A 1YJWN 1C0UA 3DI6A 2E88A 3QINA 1RTDA 4KRFA 3DLEA 2JLEA 4N41A 1KTQA 3AO1A 1BA0A 4IOXA 5HBMA 4BY9C 2UYTA 3AVIA 3DAWA 4CJLA 3RR7A 3RWUA 4B3MK 2P9KA 3U8XA 4CIFA 4LF5K 4BG8A 1BO5O 1J5OA 4OKKA 4CJ5A 5DMRA 3KLHA 4C8OA 1NMDA 1X3NA 5LY3A 5HL7L 4NXMK 1IKXA 3PV8A 4FM1A 1RTHA 1CLQA 3QICA 2VWJA 4IZ9A 4H0VB 4O8UA 4E7LA 1M90O 3AY9A 3TU5A 4LF9K 3C94A 4DTRA 4BDZA 2KLAA 4DWIA 2PYJA 5KQDA 5KPZA 1DT9A 2E2NA 3VGKA 1BI4B 2P5GA 4CF0A 2R7YA 3EE9A 3NF7A 4CD3A 3GBTA 1BOTO 3UB5A 3DRPA 2QXLA 3IUCA 1GLAG 2BDPA 3ZSRA 4EHTA 1NGBA 2HF3A 3DRRA 4JHDA 4F2RA 4CF1A 2PAVA 1WSIA 3KWGA 2XRIA 1DGKN 3AAQA 3VQQA 4WFAL 5AQHA 4IKFA 3RMBA 3RMCA 4LF8K 4LFAK 4A62A 1LW2A 1JCFA 1BI4A 3WQUA 3HPHA 3ZX2A 1Z26A 4PL7A 4Z4EA 2YHBA 4JS5A 4FWMA 2GWKA 3IS9A 4IEEA 2P9UA 3R1XA 1N36K 4B3TK 3ID8A 2G8KA 3ZETA 4FZXC 5JLFA 4FOIA 3THXB 1SAZA 3BP8A 1HKGA 4EP4A 1Q81O 1MWMA 1WUAA 4ZTJA 4JKCA 4Z4IA 3SQ4A 3J7YP 4FW2A 1HRHA 2XY7A 1RTIA 5AQQA 2Z1JA 1BISA 2WONA 2A3ZA 4GW6A 1RT3A 2NRXA 4OVLA 1QHTA 1TAQA 1VQ9N 3NMUA 1QSLA 4FSVA 3ITHA 4JI6K 1EX4A 3PY8A 3MAQA 4DR4K 4DHYA 3L3VA 2PYLA 2YJEA 3SQ1A 4DQIA 2E8AA 1D5AA 2NLXA 3D6RA 3ZLJA 3GE1A 1RTJA 3ZSVA 2HHWA 2HW3A 4CHPA 4CGFA 1ASWA 3K5NA 3WNEA 4CFCA 2HHSA 4BGAA 3B6OA 1UWBA 4CK2A 4FWNA 4H5NA 5TKWA 1ZBHA 2NZTA 2FF3B 2XO7A 2HNZA 3WXJA 3KLEA 1SL1A 1FKOA 1QQOA 4DR2K 3H3NO 1WOQA 1YI2N 4CEOA 3A2FA 3FGUA 4FJJA 1K73O 1YVNA 3QNNA 2YNGA 3A5MC 2Q3SA 2WOMA 3ZT0A 1RT6A 1LV5A 4NYFA 4DR7K 1B9FA 4B1ZA 1KFSA 1J54A 1HQEA 1T3VA 4M7XA 3NHGA 2CGLA 4HCBA 4CE9A 5AQNA 3ATVA 1XMQK 4OPKA 1Q8IA 4CF9A 4M3RA 1ZXOA 3NF9A 2O8DB 2ZF5O 3SAGA 4NO7A 3A5OC 4DCHA 2KZMA 3L2UA 4E7JA 2IVOA 4GVMA 3J80O 2VG5A 3NBPA 4Q5VA 2P5OA 1RDWX 5IT9O 3VQ9A 4B1XB 1L3UA 4IBNA 2FSNA 3OS0A 2BE2A 1KAXA 3AVCA 1HUXA 4M3WA 3TSPA 3K2PA 2XY6A 3TAMA 3QNOA 2ZD1A 3DM2A 3MN7A 3MX5A 4CCHA 5HOOA 3WXIA 2F4VK 4BR4A 4DTNA 3DMJA 3TABA 4FZZA 3KZBA 4DTOA 1NK8A 4CEQA 3VEOA 4JKAA 1L3SA 3LP1A 3CCJN 4JLHA 4FWRA 3OVNA 4LH4A 3LL3A 2FSJA 4X62K 5HRPA 5ADXH 4M3ZA 3KLFA 5H1SQ 5EXWA 4W5NA 3ZT4A 4A5AA 4FLZA 2YNHA 5C0YA 3S9HA 4EHUA 2HSTA 2A5XA 4BRHA 5CR4A 3EY1A 3NE6A 4O5BA 2YI1A 4BRIA 4EP5A 3J7ZO 3QIPA 3ATUA 3M5RA 4JI5K 1VRUA 3TI0A 2A41A 4I9LA 4DR3K 1OKJA 4OKEA 3I0RA 2HHUA 4CF8A 1ZC6A 4GNIA 2HHVA 3Q7BA 2Q1NA 1UA0A 4B8AB 3CC4N 1QS4A 1HR0K 2E1YA 1ZBFA 2RF2A 4ISGA 5EVZA 4Z4GA 1GLLO 3L2RA 1XHZA 1NJYA 2V7YA 4YOWA 5CYQA 5ELZA 3VQ5A 2RE2A 2Q0UA 3CCSN 1QQMA 2VG6A 2ASPA 4KHQA 2QWRA 1U48A 3C65A 4IOAL 4BRLA 4JHDB 3HM9A 4FJNA 3KLGA 2X74A 4CJTA 3P83D 3SV3A 1HKBA 2QWNA 4DFJA 1EETA 3TAGA 2KFNA 2UXDK 1VSEA 4CZHA 1S1WA 4CGGA 4BQZA 3TSQA 2ZM6K 2E1ZA 1WAFA 3OYFA 1C0MA 4QS8A 2O4IA 1JLBA 3U9ZA 3DLHA 2P9IB 2ZGYA 1RBSA 3LPUA 5SZTA 2P9NB 3H08A 4OPHA 4KTQA 4RW7A 3OS2A 3SMPA 4CZJA 3PIPL 1KLMA 3CIPA 3ZETB 2Q2RA 2AJQA 1YAGA 4ID5A 3V4IA 4LFBK 1SKWA 1WLJA 3ZSWA 2XY8A 1KFDA 5C42A 4PKGA 4BACA 1M1KO 3CYMA 4ISFA 2W40A 2YKMA 1T7PA 1NLVA 1VQ7N 3V6DA 4PUOA 1JXBA 3THVA 3OBYA 3QLHA 3AA4A 1X9MA 4DG1A 4FZYA 4BE1A 2DFFA 4A59A 5C12A 3VQBA 2I7PA 5E84A 3CCVN 1MWKA 1LWCA 1X1PA 4CEEA 3VEXA 4HUEA 4N47A 3MX2A 3H45C 1K8AO 5C15A 3OYHA 3H6EA 5AQMA 5IWAK 3SPZA 2NRHA 3WXKA 4V19S 4FJHA 3G25A 3P1GA 3BUZB 1U4BA 4GKKK 4PL8A 5JICA 3OJSA 2O8BA 2HOEA 5GADP 4DTJA 3SI6A 1ZBIA 4JKGA 3RRHA 3EEQA 3K9JA 1YJNN 1WN7A 4WQ4A 3T7ZA 2YHAA 3L4IA 4FLXA 4OLBA 2W6LA 2PZSA 5FPMA 3SJHA 3QEPA 1U04A 2KZZA 4CJ3A 3A5NC 1D9DA 4B3OA 1QZ6A 3CM6A 4E1JA 4CIEA 2NRWA 3SUNA 3CQYA 4I6MB 1W97L 3QEXA 3H46O 3OS1A 3VOVA 2ATQA 3ULEA 1S9EA 3CQXA 3GOIA 3WXLA 3AVGA 4Z94A 4DV4K 1WSEA 3EN9A 4IG0A 2D0AA 2FSKA 4CJVA 3AGRA 2D4WA 3CXCM 3C0BA 3UKRA 1K6YA 3HYFA 1RNHA 2O8FA 4FK2A 3AA2A 1WSFA 2H3GX 3VTHA 5HRSA 3OW2M 1J5EK 3DOLA 4BRPA 3V81A 3LAMA 1N5YA 1GLDG 4NB4A 4B3RK 3HOSA 3LDPA 4K41A 3FZLA 5M1FA 1CZ9A 4CHYA 5BR9A 3VGLA 3WNFA 4FLVA 1TYQA 4CJEA 3WEEB 5C25A 4AM6A 1NK0A 4M3UA 2PBDA 2O8EA 2OCEA 4DB3A 1NKBA 3KK2A 3C6UA 1SKSA 1VQ5N 4DU1A 4H0XB 3OYGA 1BG3A 1JLGA 3B6PA 4E89A 1EKEA 3QMLA 3O4WA 1LWFA 4JK9A 2FBYA 4JKBA 4DUZK 1IBLK 4BRQA 4ICLA 1XHXA 1X3MA 1S6PA 4JS4A 4H5TA 1TKZA 4FLWA 4BC5A 5KRTA 1WBDA 3LDLA 4N56A 3CM5A 3P39A 3MECA 4FOEA 5M1NA 4ZHRA 4FPAA 5F2RA 4K42A 2D0OA 4HUGA 1KVAA 2P9SB 2ASOA 5AQIA 2ITMA 3U6FA 1QSSA 1VQ6N 3K0SA 3THXA 5GAGP 1DLOA 1I94K 3G0ZA 4N76A 5KGXA 3CCRN 2GUIA 3O9SA 1B92A 2P9UB 3SV4A 2Q97A 4PKIA 1V4SA 3I56N 1VQPN 4Z4CA 4WCEL 4RWTA 4EZ9A 4AILC 1YTAA 5AFUA 4ELVA 2XHBA 3MEEA 3MEDA 3D2FA 4RG8A 3KD5E 5E41A 3O08A 1WAJA 1JKHA 3O3HA 3HOTA 1VAZA 3HXMA 3NDKA 4UY8O 4H03B 5I42A 5AR0A 4H0TB 1GOAA 4Z4HA 5GAEP 1N6QA 4JI1K 3VA0A 1TL3A 1S1UA 3CFPA 1EQYA 4FWSA 4HWIA 1N8RO 2DTUA 2Y1JA 3FZHA 3ZSXA 3HBTA 4L3QA 1BIZA 3VQ8A 1NGJA 4KI6A 3AGKA 4UQGA 4WFBL 2I7NA 4AQYK 4DFKA 3LANA 4YOYA 1NG9A 3AVAA 5AQOA 5D3GA 1EO1A 1DEJA 1NKCA 3CETA 2P9NA 4CF2A 4DV0K 5BR8K 3B8AX 4DV6K 5M1QA 1ASUA 4DFMA 4BWMA 1IKWA 1SKRA 2D0BA 4DV3K 1IBKK 4YFUA 3LM2A 2IS3A 3ZT3A 2QTDA 4DSKA 2IC3A 3OYCA 3AVMA 4H0PA 5AQRA 3U9DA 2YHWA 4KH5A 3K58A 5AZIB 2QWLA 1RDUA 4DSJA 1IG9A 4FJ9A 3VQEA 4FWOA 3SK3A 3ZSQA 3SBTA 3D45A 4O8KA 2ZJPL 1TK8A 4PA1A 5AQFA 3VF2A 4KHWA 4JKGB 3FFIA 4J2DA 4LY7A 3TAFA 1OH8A 1NK6A 1V4TA 4KHNA 5DM7L 1SL2A 5J2QA 3I8DA 4JI8K 1BCOA 3ZX3A 3CERA 3LDNA 2G8WA 5M1KA 1E4FT 3OTOK 3RMAA 1JLFA 3LWMA 3V9XA 4DTUA 3I33A 3A0IX 3SMSA 1S5JA 5I9EB 2KW4A 3DLGA 4K43A 1W7AA 1R0AA 1EXQA 1HMVA 5EX5A 3FE1A 1XI1A 1QE1A 4B9QA 1HNIA 2HHTA 4FVMA 3DRSA 4CESA 3SPYA 4CEFA 4B1YB 3WNGA 3AO4A 1O1WA 4LF4K 5C24A 3CC7N 1KXPA 3L0QA 1BCMA 1I39A 3F9KA 1KC8O 2G8HA 3EKSA 2V52B 3PSFA 4FJ8A 2KHOA 3AVKA 1RT1A 4MFBA 1D4XA 2A1SA 5AFUH 3AO3A 4CHZA 2YJFA 3HI0A 2FXUA 1HNXK 4MO5A 4J8FA 1T6DA 1BHLA 5FRMA 2RHKA 4H5RA 4LC9B 4DS4A 3V9ZA 4OPJA 2P51A 4CIGA 5BREA 4B1UB 3ENBA 3QFPA 4AHTA 3O4NA 5LL6Z 4OKJA 1XMOK 3ZCMA 2KFZA 3O3FA 4ID1A 3TAEA 3LDSA 3UKRB 4BC3A 2VCPA 1TL1A 1WSGA 1KCFA 2P9LB 3L4QA 3CF5L 2OZMA 1Z25A 4JKHA 3H1QA 1J53A 3L2WA 1HNZK 5AZJB 3VMFB 2WTUA 3CFOA 4BRFA 2GWJA 4X66K 3HM8A 1IO2A 4DLEA 3ASMA 5HROA 3ISNC 1EWQA 3J8AA 2X78A 4IJAA 4CVNE 4JRPA 3IMXA 2YHYA 4R5PA 3A5LC 4BE0A 2NRZA 2QWPA 4FK0A 1JLCA 1GOCA 5AQWA 4C8MA 4BQLA 2HMIA 2JWKA 1OH7A 3KHYA 3AVLA 4MLHA 4M41A 1XUPO 3LP2A 1GOBA 1IG8A 4DQ8A 1WBBA 4JI2K 3HO1A 1Z05A 1YT3A 4MQ3A 4JKFA 1A5XA 3VESA 3VQCA 4CZFA 1YITN 4DQQA 3IDHA 1S1TA 4NXNK 2CGKA 3VQ6A 5KPTA 4PQUA 1SQKA 2UUAK 3RRGA 4OX9K 2P9LA 1LAVA 3QETA 2IVNA 5SWMA 2D0CA 4Y0WA 4NYNA 2HMPA 3CJ1A 4CFAA 4RW6A 1NK4A 3E66A 3VN5A 4DTXA 3BY5A 2B6AA 2FLOA 3K5LA 3ULDA 1EP4A 4HUFA 3I0SA 1C1BA 2OPPA 3LP3A 4LSLA 5KRSA 4M42A 4LFCK 4B3SK 4RTFD 4DTSA 4CERA 1HNVA 4AHUA 3S3MA 3M1FA 1FK9A 3PUFA 4DF4A 4F8RA 3OYMA 4I7FA 4FK4A 3DLRA 4BRAA 4A57A 1REVA 3KD1E 1RT2A 1S3XA 4PHTX 3DOKA 5AQGA 1HQUA 1ATSA 3EE8A 1NK7A 4KH6A 2A40A 4K0KK 1LCUA 1CXQA 2HF4A 4CZKA 1RCHA 4DMNA 4KB0A 3IG1A 4KH4A 1YTUA 5EU7A 4CEBA 4W5OA 4KFBA 3P5JA 1TYQB 4CJUA 3Q7CA 1EWRA 1NK9A 1VQKN 3SUQA 3OJUA 3QO9A 3K9KA 4CZIA 4GKJK 4YORA 1A5VA 1GLCG 4E3SA 3OYKA 4B9LA 3QESA 3VQAA 3LDOA 4MDBA 3VQDA 3IFRA 4ELTA 3TSUA 2YNFA 1Y64A 1YJ9N 1SL0A 4QAGA 1OH6A 3MN9A 4K8XA 2Z1HA 1YIJN 5ADXA 3FZKA 1BL3A 4CD1A 3CJ9A 1CZAN 4KHUA 1TUUA 2QWMA 4E0DA 3VENA 1HX1A 2WUSA 1ILYA 4KBOA 4BG9A 2A42A 5AQPA 1VQON 4CZEA 2ZQBA 4A2AA 3R3LA 3SBGA 4MLEA 2YNIA 4KHPK 1RILA 2QW9A 3UIQA 4GVEA 4FM2A 3M8SA 2P1JA 3CHWA 4O4GA 4E7IA 3F2KA 2QXFA 3SLCA 4JI7K 4NCGA 3ZT2A 3V9UA 2B4JA 2XY5A 4KB1A 2X6SA 1FW6A 4BRCA 1HYSA 3DXMB 5M1OA 3LALA 5HRRA 4F2SA 1TK0A 2GEMA 2WC9A 2NNWA 3IRXA 1WSHA 2OPRA 4O5FA 4CI6A 4BRGA 2F9TA 3ZSOA 5FPDA 1P8ZA 3U3GA 3DLLL 3TANA 4FJ7A 4QS9A 3MN5A 4K25A 4YOVA 3NH0A 5KI6A 1Q18A 2GX9A 4JD2B 1U2VA 5I3UA 4JI4K 3D2EB 4BREA 3SQ0A 2OTJN 1OVYA 3OBWA 2LSNA 2ITGA 4JNEA 2G8VA 2RN2A 1L3VA 3PIOL 3PO4A 4FJIA 4BVPA 1VSIA 2BANA 2IAJA 4X65K 5LJWA 1NNEA 4B9TA 3RSEB 4I6MA 3AO5A 4DSIA 2QWQA 4E19A 4B08A 5KPRA 4CGIA 3D2FB 2QA4N 1QTMA 3K59A 4LF6K 3O5BA 4BR7A 3VETA 4CBUA 3NH1A 4C1NK 2W42A 3O9UA 5LMUK 3CJCA 3CCEN 1RBVA 3RVCA 4B1VA 2QM1A 5CYMA 1HLUA 2IVPA 4JAXA 1L5UA 3VEZA 2G8FA 1HPMA 2EWSA 4WQ5C 5E26A 4JV5K 3O6WA 3GG4A 4DQRA 1C0GA 2HNDA 1HNWK 2NRTA 3O80A 4AHRA 4B8CA 5BPNA 1VQ4N 3KVGA 2FF6A 3DXKA 4KTWA 1A5WA 1G99A 2G8UA 4ZTFA 2UUBK 4W5QA 3CFRA 2E2QA 4C23A 1BIUA 2VGMA 1SZ2A 4JRQA 3SJJA 3PX6A 3I55N 3CJ7A 1NKEA 4F3OA 4KPYA 4BGBA 3ID6A 2BTFA 4IWVA 4CZLA 4F4KA 2UXCK 2HBKA 4Y1CA 1ATRA 3DXKB 4MO4A 3UKUA 3JS6A 3E9PA 3LZIA 4FWPA 3HP9A 3HSTB 4BDPA 1CZBA 1U2VB 1VHXA 1YHQN 1BUPA 3HJFA 4ILJA 4JKDA 5C2FA 2FBVA 3NH2A 3LWLA 5FPNA 1RBRA 3KWIA 4JN4A 4LF7K 4MDAA 1D8YA 4L8RB 4O55A 4DV2K 1VQLN 2AP1A 2OA8A 5AQYA 2X6NA 1U47A 4CHOA 4DQPA 4FCYA 1NGCA 3VGMA 4FYDA 3BF3A 2V51B 3DYAA 3R9PA 3D2EA 2VYPA 4TSXA 4YDUC 5A2QO 1UA1A 3RR8A 2O4GA 2F8TA 1Q86O 1NGDA 3BEXA 5FLXO 1NGAA 2P9IA 3FZFA 4DLGA 1NMNA 2E4LA 4FJMA 4G1QA 3O1BA 4PKHA 3KIOA 3VA3A 3VPZA 3THWA 1HJOA 4FLTA 1RFQA 2HBJA 3NVKA 4FWQA 1QQCA 4CK3A 3CI5A 1VSFA 2OZSA 3U4LA 4DF8A 3HZ6A 4O0IA 4DTPA 3JXUA 4DQSA 4FVUA 3H1VX 1BU6O 4OGEA 2ZJQL 1S1XA 4EZ6A 1VQNN 1BQMA 3MXJA 4E7HA 3CG7A 4CFDA 3O8MA 3DJCA 4FLUA 3D0PA 3W0LA 1JCEA 2QKKA 3WT0A 4FJXA 2G8IA 4RCHA 3O4QA 4J2BA 3A8YA 4H5VA 3ENOA 4JI3K 4FJGA 5JVGL 2HBLA 1TGOA 2Z1IA 3P4IA 4EFHA 3TTCA 1Z6RA 1GLEG 3VEVA 4B9VA 4BR0A 2GV9A 4XIUA 3THWB 4C8KA 2UU9K 2GBZA 3KKSA 1XC3A 3CMAN 1T05A 4LSNA 2YV0X 4GY2B 5JVHL 4CEDA 5C2DA 1J9AA 4DKWA 3WNHA 1QZ5A 4NCBA 4O0JA 1NJXA 4OPAA 1HPZA 1JL2A 4IXCA 4E1MA 2O8EB 2VQFK 3NGYA 4XH4A 4U67L 3SZ2A 1KVCA 2Q0RA 5MLCQ 3SYZA 1YXQA 3K57A 4AM7A 4YOUA 1IJJA 1E4GT 3VQ4A 2I5JA 1RBTA 5AQZA 3VEWA 1VK0A 1U45A 3V1QA 3THYB 1NGEA 3ZT1A 1RDAA 1TKDA 1VRTA 3CD6N 5GIPA 1W2BM 3L2QA 5FDLA 4JD2A 3NF8A 4CJFA 3AVHA 2VQEK 1VSKA 4YOTA 3HVRA 4CZMA 3OYAA 1FKPA 3PX4A 4B1WB 4BRNA 2QI2A 1XC9A 3SUOA 1JLEA 2DFEA 4CGHA 4XH5A 3NVMA 2P9KB 4F9OA 4E1NA 3WQTA 1S72N 3AVFA 1O13A 2V7ZA 3VF4A 1NOYA 3MXMA 4FJ5A 1U49A 4X64K 1TK5A 4FW1A 3P38A 1I3AA 3MDQA 1SV5A 5J2PA 2E5LK 5CE3A 4DS5A 3QEVA 3WUHA 1TKXA 4A5BA 1VSHA 4JK7A 1LWEA 4B9MA 4CHNA 2F9WA 3TARA 1XNQK 3QERA 4HTLA 1GLBG 1L3TA 1Q9YA 5TKYA 3JYTA 1XNRK 2OPSA 4NLBA 2BH1A 3M3ZA 4GV6A 4NLCA 2A6AA 3AVJA 4CK1A 4I2PA 3DXMA 3T19A 1T8EA 1NGHA 4BRMA 3M8RA 1IBMK 1GLFO 3CPEA 2HHHK 1NK5A 1KD1O 3OHRA 3CJBA 5GINA 1N34K 4DU4A 4OO1J 4RW9A 1C0TA 2D0PA 4LD0A 3ALYA 5AQTA 1IKYA 3QBXA 4BWJA 1VSDA 4DR6K 3UE5A 5AQXA 4F3TA 5CY4A 2RPIA 3PX0A 1NJZA 3HL8A 3NGIA 3CMEN 4CHQA 2WFBA 4BRDA 4IFVA 4M63C 1JLQA 3C6HA 4KREA 3WEEA 5BRHA 4Y1DA 5AZIA 4IOCL 1YUWA 2DPNA 3MEGA 3G71N 3GDQA 1RT7A 4BR2A 5KQ8A 4AHVA 2ZWHA 3CCMN 4B9SA 4XEIA 3ULEB 5AQSA 2NRVA 3S41A 3ZEUA 1RDBA 4AHCA 4CZGA 2F7TA 2IGIA 4K8ZA 1H1VA 3HRGA 3NFAA 3CJAA 3QIOA 4DSEA 3TTFA 1ESVA 1RGIA 3LDQA 1MA9B 2IOCA 3FLCO 1K9MO 5CHIA 3G6EN 1JLAA 1KAYA 4I9QA 3C6AA 2GTDA 3AVBA 5EOYA 4R79A 3N4QA 2BGGA 3AARA 1DKGD 1B9DA 3MCPA 5BRDA 1W0HA 4FM0A 4J2AA 3BGRA 2IIRA 4CEZA 4CFBA 1KLNA 3FZMA 1LW0A 3BDPA 4AHSA 2UXBK 1R59O 3RMDA 5J2NA 3V1OA 4JK8A 4ISEA 3DWLA 2W6KA 4Z4FA 3ZSYA 4QOZB 2JWLA 1QHAA 2GUPA 4IJNA 3AAPA 1JL1A 2YX6A 3PLAA 1UAXA 1T03A 1WSJA 1BDGA 4LH5A 3D7EO 3FFKB 4H8KA 4HCCA 3IAYA 3CCQN 4DUYK 3G10A 3VEYA 4BROA 4CJ7A 4PY5A 1DTQA 1JCGA 3TPQA 5HP1A 5AQKA 3VTIA 3M6GA 3E9OA 1LOTB 3RSEA 4BDYA 3LP0A 4ILGB 3OY9A 3F9MA 1LAWA 4IDKA 4KKOA 3M8PA 3L2VA 4RW8A 4PWDA 5GAHP 4M45A 3SAHA 1BA1A 2VWBA 4QCLA 4DSLA 2E2OA 2EHGA 2IDOA 5JMVA 3C6TA 3AA3A 5F1XA 1QVFM 4AF1A 5JLHA 1ZYQA 4N5SA 4OGCA 2P9PB 1G15A 4KTZA 3OYNA 5FPEA 4CGDA 4KHYA 3OYDA 2O8BB 3T1YK
chains in the Genus database with same CATH topology
2IVPA 4JAXA 5GAEP 2A3ZA 2NRXA 1EQYA 4FWSA 1XQSC 4HWIA 3VEZA 1N8RO 1VQ9N 3FZHA 3NMUA 1HPMA 3HSCA 4FSVA 3HBTA 4L3QA 2EWSA 4WQ5C 5E26A 1NGJA 3GG4A 3O6WA 1C0GA 4DHYA 3AGKA 4WFBL 2I7NA 4U7BA 4YOYA 2NRTA 2YJEA 3O80A 4EIAA 5BPNA 2OTLN 4C1NI 1VQ4N 2E8AA 3KVGA 2FF6A 5AQOA 3DXKA 2NLXA 3D6RA 3EL2A 3GE1A 1NM1A 1EO1A 1G99A 1VQMN 1DEJA 4CBXA 5AQLA 3CETA 2E2QA 2P9NA 4C23A 3L6QA 3QFUA 3MCAB 2VGMA 1SZ2A 3B8AX 3I55N 5M1QA 4BGAA 3CJ7A 3MN6A 2E2PA 4FWNA 4BGBA 4H5NA 5TKWA 2NZTA 2FF3B 2YCHA 2ZGZA 3ID6A 2BTFA 3WXJA 3LM2A 4IWVA 4CZLA 2QTDA 1QQOA 3H3NO 1WOQA 1YI2N 4H0PA 2HBKA 5AQRA 3FGUA 1ATRA 3DXKB 2YHWA 4IFEA 4KH5A 5AZIB 3U9DA 2QWLA 3BF1A 1RDUA 3JS6A 4MO4A 3E9PA 3UKUA 5BRFA 1K73O 4FWPA 1J6ZA 4CBWA 1YVNA 3QDKA 4FWOA 4BR9A 3A5MC 3SK3A 3SBTA 4IO9L 4O8KA 2ZJPL 1U2VB 5AQFA 4IO8A 1YHQN 1BUPA 2GELA 3VF2A 2NRRA 4ILJA 4BRKA 4JKGB 4B1ZA 5DM6L 4JKDA 5C2FA 1T3VA 4M7XA 2CGLA 5FPNA 3KWIA 4JN4A 5M1PA 1V4TA 4MDAA 5DM7L 2CH6A 1QQNA 5AQNA 1K8KB 1VQLN 3ATVA 2AP1A 5AQYA 3ZX3A 5B8HA 1MDUB 3CERA 3LDNA 5BPMA 1ZXOA 5AQJA 5M1KA 1E4FT 3ZYYX 2ZF5O 1NGCA 3SAGA 3CCUN 4NO7A 3A5OC 3C7NB 3VGMA 3BF3A 2V51B 4DCHA 3R9PA 3I33A 3D2EA 2VYPA 3A0IX 4YDUC 3W3DA 2IVOA 3SMSA 2P9SA 4EAHD 5I9EB 1RDWX 5C10A 3P31A 4K43A 1NBWA 2QWOA 1NGDA 3BEXA 3O9QA 5EX5A 4B1XB 4WF9L 1Q86O 1NGAA 3FE1A 2P9IA 3FZFA 3VF6A 4B9QA 2FSNA 1KAXA 3O1BA 4PKHA 1HUXA 1NWKA 3TSPA 4B1YB 1ATNA 3VPZA 4WQ4C 4A61A 1HJOA 3MN7A 1RFQA 2HBJA 3MX5A 1KXPA 3L0QA 3CC7N 3NVKA 5HOOA 2ASMA 4WYBA 4FWQA 1KC8O 5AZJA 3WXIA 3WXMB 3EKSA 2V52B 4BC4A 2E20A 3EO3A 4BR4A 2KHOA 3CI5A 3QB0A 5AQQA 3KZBA 3U4LA 3VEOA 1D4XA 3HZ6A 4JKAA 4H5WA 5AFUH 3CCJN 1T6CA 1HKCA 4JEPA 4FWRA 3JXUA 2YJFA 4FVUA 3HI0A 2FXUA 3LL3A 1K8KA 2FSJA 1BU6O 3H1VX 1T6DA 4J8FA 4MO5A 2ZJQL 5ADXH 1VQNN 5H1SQ 2RHKA 4H5RA 4LC9B 5EXWA 3O8MA 1BWFO 3DJCA 4A5AA 3W0LA 1JCEA 2OANA 5BREA 5C0YA 4B1UB 3ENBA 3ZEUB 2W41A 3WT0A 3QFPA 4EHUA 2HSTA 2A5XA 4BRHA 5CR4A 4RCHA 4BC2A 3A8YA 2YHXA 2YI1A 3HTVA 4H5VA 3ENOA 4BRIA 5F0XA 3O9TA 3J7ZO 3ATUA 3M5RA 4H0OA 5JVGL 2HBLA 3UKRB 3P4IA 4EFHA 4BC3A 2AA4A 2VCPA 1Z6RA 3TTCA 1GLEG 2A41A 3VEVA 2P9LB 1OKJA 2KKZA 3L4QA 4BR0A 3CF5L 3C7NA 1NGGA 4JKHA 3H1QA 1ZC6A 4GNIA 4WQ5A 2Q31A 2VGNA 3Q7BA 5AZJB 2Q1NA 3VMFB 3EKUA 3CC4N 4BRFA 1XC3A 2E1YA 3CMAN 2GWJA 5LJVA 4GY2B 3HM8A 2PFUA 3ZX0A 4ILHA 5JVHL 1SS6A 5C2DA 4ISGA 3J8AA 5EVZA 4IJAA 1GLLO 4DKWA 3QBWA 3ENHA 1S22A 3IMXA 4IEIA 2V7YA 2YHYA 4YOWA 3A5LC 1QZ5A 5ELZA 2NRZA 2RE2A 2Q0UA 2QWPA 4OPAA 3G4SN 3CCSN 5AQWA 1QQMA 4IXCA 4BQLA 2ASPA 2QWRA 2JWKA 3C65A 3KHYA 4MLHA 4XH4A 2CGJA 4U67L 4IOAL 4BRLA 4JHDB 2Q0RA 5MLCQ 1XUPO 1YXQA 1IG8A 4AM7A 4FWLA 3VERA 4YOUA 1IJJA 1HKBA 1NGFA 2QWNA 1E4GT 4CZHA 4DQ8A 4BQZA 5AQZA 1Z05A 3VEWA 3TSQA 4GV9A 3H3OB 4JKFA 2E1ZA 4FO0A 5BN8A 3MWPA 3VESA 4QS8A 1NGEA 3U9ZA 4CZFA 1ZBSA 1YITN 2P9IB 2ZGYA 3IDHA 3R6MA 3CD6N 5GIPA 1W2BM 3LM9A 2CGKA 1YF5L 2P9NB 4FL9A 5KPTA 1GLJO 1SQKA 4OPHA 2QEXN 2P9LA 4YDUA 4JD2A 2CH5A 4BVOA 3SMPA 4FWKA 4CZJA 5AQUA 3CIPA 3ZETB 3PIPL 2IVNA 4Y0WA 2Q2RA 4YOTA 2HMPA 1YAGA 4CZMA 3CJ1A 1VQ8N 3CCLN 3MWTA 4B1WB 4BRNA 2QI2A 3E66A 4PKGA 4GV3A 1M1KO 4ISFA 2W40A 1JJ2M 4XH5A 3NVMA 1NLVA 1VQ7N 2FLOA 4XH1A 1C0FA 2P9KB 3O9RA 4F9OA 3N4PA 3OBYA 3WQTA 1S72N 3OA9A 3CC2N 2ZJRL 1O13A 5GIOA 2V7ZA 3VF4A 3EZWA 5EY4A 4A59A 5C12A 4BR5A 4FPBA 2I7PA 3P38A 4RTFD 3MDQA 3MK6A 5E84A 3CCVN 1MWKA 3M1FA 5CE3A 3VEXA 1NGIA 3WUHA 4A5BA 3MX2A 2P9PA 4H0YB 3H45C 4JK7A 1K8AO 5C15A 3MMVA 4BRAA 4A2BA 3H6EA 5AQMA 2NRHA 2F9WA 3WXKA 3O1WA 1Q7YO 4A57A 3T69A 3F5TA 3G25A 3I8BA 3BUZB 4HTLA 1GLBG 1X9JA 1P90A 1S3XA 2J4RA 4PHTX 4PL8A 5TKYA 5JICA 3FR0A 5AQGA 4G9ZA 4NLBA 2BH1A 1ATSA 2HOEA 3EE8A 5GADP 3M3ZA 4KH6A 4GV6A 2A40A 4NLCA 2A6AA 4JKGA 1LCUA 2HF4A 3K9JA 4CZKA 1KQSM 3DXMA 1YJNN 3KK7A 4WQ4A 3T7ZA 3L4IA 4KH4A 3R8EA 1T44A 1NGHA 2Q36A 4BRMA 2BUPA 1GLFO 3CPEA 3GL1A 1TYQB 5FPMA 1U6ZA 5AQVA 5BN9A 3SAFA 3SJHA 1KD1O 3Q7CA 3OHRA 4M7YA 3CJBA 1VQKN 3A5NC 5GINA 4OO1J 1QZ6A 2WBNA 1Q82O 4E1JA 4YOXA 3K9KA 2NRWA 4CZIA 3CQYA 4I6MB 1W97L 3H46O 2D0PA 3VOVA 4IDHA 4YORA 5AQTA 1GLCG 3ULEA 5BPLA 3QBXA 3CPWM 3CQXA 3LDOA 4MDBA 3GOIA 4WFNL 3WXLA 3IFRA 4QS7A 3UE5A 4Z94A 3E9LA 5AQXA 1Y64A 2HBMA 3TSUA 1YJ9N 3EN9A 2D1KA 2FSKA 1KAZA 3IKMA 3TTDA 4JKEA 3MN9A 3AGRA 1TUYA 3CMEN 2WFBA 3UKUB 4BRDA 4M63C 2D4WA 5ADXA 1YIJN 3CXCM 3C0BA 3C6HA 3FZKA 3UKRA 1QVGM 3E1YA 4CD1A 3WEEA 3CJ9A 5BRHA 1CZAN 1NJIO 2QWMA 1TUUA 5AZIA 4IOCL 1YUWA 2DPNA 1YJWN 2E88A 3G71N 3GDQA 2H3GX 3VTHA 3OW2M 4BR2A 5KQ8A 3VENA 1HX1A 2WUSA 2ZWHA 3CCMN 1ILYA 4XEIA 1BA0A 4IOXA 4KBOA 2A42A 5AQSA 5AQPA 3ULEB 4BG9A 4BRPA 4CZEA 1VQON 4BY9C 4A2AA 2UYTA 2NRVA 3DAWA 3S41A 3R3LA 1GLDG 3SBGA 3ZEUA 4MLEA 4NB4A 4CZGA 2F7TA 3LDPA 2QW9A 3HOSA 1H1VA 3HRGA 3FZLA 4GVEA 4K41A 5M1FA 3CJAA 5BR9A 2P9KA 3U8XA 3CHWA 4BG8A 3TTFA 3VGLA 1BO5O 1ESVA 1TYQA 1RGIA 3F2KA 3LDQA 3SLCA 3WEEB 4AM6A 2PBDA 4DB3A 1MA9B 1NMDA 3FLCO 1K9MO 1X3NA 5LY3A 5HL7L 5CHIA 3G6EN 1KAYA 1VQ5N 3C6AA 2GTDA 4H0XB 4BRCA 3QICA 1BG3A 3DXMB 4IZ9A 4H0VB 3QMLA 3O4WA 4O8UA 5M1OA 1M90O 3AY9A 5EOYA 3TU5A 3N4QA 4R79A 4JK9A 4JKBA 2GEMA 2KLAA 1DKGD 2WC9A 3AARA 3MCPA 2NNWA 1X3MA 4BRQA 5BRDA 5KQDA 5KPZA 2IIRA 4H5TA 1DT9A 3FZMA 2E2NA 4O5FA 4BC5A 4CI6A 3VGKA 4BRGA 1R59O 2F9TA 3EE9A 3LDLA 5FPDA 1P8ZA 4CD3A 3GBTA 1BOTO 3P39A 4JK8A 4ISEA 3UB5A 3DWLA 3DLLL 4FOEA 2QXLA 4QS9A 5M1NA 3IUCA 1GLAG 2JWLA 1QHAA 3MN5A 4K25A 4YOVA 2GUPA 4EHTA 4FPAA 4IJNA 1NGBA 3AAPA 1Q18A 4K42A 2YX6A 5F2RA 3PLAA 2D0OA 2GX9A 2HF3A 4JD2B 2P9SB 4JHDA 1U2VA 2ASOA 5AQIA 2ITMA 1BDGA 3D2EB 2PAVA 3KWGA 3D7EO 3FFKB 4BREA 2OTJN 1DGKN 1OVYA 3AAQA 1VQ6N 3OBWA 5AQHA 4WFAL 4JNEA 3CCQN 5GAGP 3VEYA 4BROA 4CJ7A 1JCGA 3TPQA 4A62A 1JCFA 5AQKA 3CCRN 3VTIA 3PIOL 3WQUA 3M6GA 3O9SA 3ZX2A 4PL7A 3E9OA 1LOTB 4BVPA 2P9UB 4FWMA 3RSEA 2GWKA 4ILGB 5LJWA 4IEEA 3F9MA 2P9UA 3R1XA 4I6MA 3RSEB 5GAHP 2Q97A 4PKIA 1V4SA 3SAHA 3I56N 3ID8A 1VQPN 4WCEL 4RWTA 1BA1A 2VWBA 2QWQA 3ZETA 2E2OA 5JMVA 5AFUA 5KPRA 5JLFA 3D2FB 2QA4N 4FOIA 5F1XA 1SAZA 3BP8A 1HKGA 3D2FA 4AF1A 1Q81O 1QVFM 5JLHA 1MWMA 3O5BA 3VETA 2P9PB 4BR7A 4C1NK 4CBUA 3O9UA 5FPEA 1WUAA 4JKCA 3O08A 3CJCA 3CCEN 3RVCA 3HOTA 1VAZA 4UY8O 4H03B 4B1VA 2QM1A 5AR0A 4H0TB 1HLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE8 A;  3P38 A;  2GX9 A;  3KWG A;  3P31 A;  3KWI A;  3O9Q A;  3O9T A;  3M5R A;  3O9U A;  3EE9 A;  3O9R A;  3F5T A;  3D6R A;  4OPA A;  3O9S A;  2RHK A;  3RVC A;  3P39 A;  3OA9 A;  3L4Q A;  2KKZ A;  4OPH A; 
#chains in the Genus database with same CATH topology
 1HJR A;  1ITG A;  4YNQ A;  2HVH A;  4DV1 K;  2RKI A;  4DFP A;  4Q0B A;  1XQS C;  1HYV A;  3L3U A;  3HSC A;  4IFY A;  3OYE A;  3V9S A;  2ZE2 A;  2YKN A;  1UOC A;  3AO2 A;  3T3F A;  3NCI A;  5DK5 A;  4U7B A;  1KRP A;  2OTL N;  4EIA A;  4C1N I;  5JS1 A;  2D5R A;  1NOZ A;  3MXI A;  3EL2 A;  2HB5 A;  4JYA K;  1NM1 A;  1VQM N;  1KVB A;  4CBX A;  1XWL A;  4O44 A;  5CZ1 A;  5AQL A;  3NGZ A;  3L6Q A;  3QFU A;  1JXE A;  3MCA B;  1SUQ A;  3DLB A;  3S3O A;  4DR1 K;  1C1A A;  3SQ2 A;  3MN6 A;  4NCA A;  2E2P A;  4YY3 K;  2YCH A;  3NAE A;  2ZGZ A;  1VSJ A;  3HT3 A;  2FC0 A;  3OYB A;  3RTV A;  2NUB A;  4DU3 A;  3PSI A;  1F21 A;  4IFE A;  2O8F B;  3BF1 A;  1RT4 A;  5BRF A;  1J6Z A;  4CBW A;  4YHH K;  3QDK A;  4BR9 A;  3S3N A;  4IO9 L;  1W9H A;  4IO8 A;  2GEL A;  1BGX T;  1TKT A;  2NRR A;  4BRK A;  5DM6 L;  4OLA A;  3M8Q A;  5M1P A;  4KAZ A;  1C1C A;  1WNS A;  2Y1I A;  1CXU A;  2CH6 A;  1QQN A;  4C8N A;  1K8K B;  4ELU A;  4DV5 K;  4DV7 K;  5B8H A;  4M3T A;  1MDU B;  1ZBU A;  5BPM A;  3J81 O;  5AQJ A;  1DTT A;  1RT5 A;  3ZYY X;  3JAM O;  3CCU N;  3C7N B;  3T1H K;  3KK3 A;  1ZBL A;  3W3D A;  2F96 A;  3SUP A;  2HHX A;  3LAK A;  2P9S A;  1OVQ A;  4EAH D;  1C6V A;  4DR5 K;  5C10 A;  3P31 A;  1NBW A;  1QSY A;  2QWO A;  4WF9 L;  3O9Q A;  4OJR A;  3F73 A;  3VF6 A;  1N32 K;  4H4O A;  3EYZ A;  1NWK A;  1ATN A;  4A61 A;  4WQ4 C;  3HVT A;  3KLI A;  3DLK A;  4HHT A;  1IV0 A;  4CJP A;  2ASM A;  4WYB A;  5AZJ A;  3WXM B;  4BC4 A;  2E20 A;  3EO3 A;  3QB0 A;  3HK2 A;  2E6M A;  5J2M A;  4Z0U A;  3CQ8 A;  4H5W A;  1T6C A;  1HKC A;  4JEP A;  3E01 A;  4M3Y A;  1TV6 A;  3OYL A;  1K8K A;  3THY A;  4FJL A;  1BWF O;  4CEC A;  4BE2 A;  3L8B A;  2OPQ A;  1RDC A;  1RBU A;  2OAN A;  4H4M A;  4CJK A;  3EZ5 A;  3ZEU B;  2W41 A;  1X9S A;  1S6Q A;  4BC2 A;  5FRO A;  2YHX A;  1NU0 A;  3HTV A;  5F0X A;  3O9T A;  2O8C A;  4CJS A;  4H0O A;  2AA4 A;  3HPG A;  3KK1 A;  1FXX A;  3TR8 A;  2KKZ A;  3C7N A;  1NGG A;  4WQ5 A;  2Q31 A;  2VGN A;  3EKU A;  2EX3 A;  4KHS A;  1FJG K;  5LJV A;  3ZX0 A;  2PFU A;  4ILH A;  1SS6 A;  3TAP A;  4CJQ A;  2VG7 A;  3QEW A;  3QBW A;  3ENH A;  1S22 A;  4IEI A;  1TAU A;  3AV9 A;  2O8C B;  3OYJ A;  3G4S N;  1IKV A;  3LZJ A;  5KTQ A;  2KTQ A;  2FBT A;  2KQ2 A;  2CGJ A;  5FRN A;  2JGU A;  2HNY A;  3KJV A;  4FWL A;  3VER A;  1N33 K;  1NGF A;  2HHQ A;  5CZ2 A;  1VSM A;  4GV9 A;  2ETJ A;  3H3O B;  4FO0 A;  5BN8 A;  3MWP A;  3HPO A;  3K5O A;  1ZBS A;  3R6M A;  5J1E A;  1TVR A;  3AA5 X;  3LM9 A;  1YF5 L;  1HYZ A;  4FL9 A;  3HP6 A;  1GLJ O;  3TWH A;  3SCX A;  2QEX N;  4YDU A;  2CH5 A;  4BVO A;  4FWK A;  4HTU A;  5AQU A;  3ZSZ A;  3CCL N;  1VQ8 N;  3MWT A;  4B9U A;  3BZK A;  5KGW A;  4JI0 K;  4HVJ A;  4GV3 A;  4AH9 A;  1JJ2 M;  1E3M A;  3JSM A;  4XH1 A;  1C0F A;  3O9R A;  4CW7 B;  4J2E A;  3N4P A;  3V1R A;  1MU2 A;  3OA9 A;  3CC2 N;  2ZJR L;  5GIO A;  3EZW A;  1VSL A;  4CJW A;  5EY4 A;  4W5R A;  4DSF A;  3U3Y A;  4GMJ B;  4BR5 A;  4KV8 A;  4FPB A;  3MK6 A;  3VQP A;  3KKR A;  1NGI A;  4KO0 A;  1ASV A;  1NJW A;  3AVN A;  2PY5 A;  2P9P A;  1X9W A;  4H0Y B;  1Y97 A;  3MMV A;  4WE1 A;  4A2B A;  2QKB A;  3SNN A;  4I2Q A;  3O1W A;  1Q7Y O;  2DFH A;  3F5T A;  5K14 A;  3T69 A;  4RW4 A;  3I8B A;  1X9J A;  1P90 A;  2J4R A;  3FR0 A;  3OYI A;  2Z1G A;  3TAQ A;  4G9Z A;  3VQ7 A;  3LPT A;  4E7K A;  4FJK A;  4KI4 A;  3J7A P;  4M3X A;  3T1A A;  2E6L A;  1KQS M;  3KK7 A;  1OH5 A;  5AJ3 K;  3R8E A;  1T44 A;  2Q36 A;  4CJR A;  1IH7 A;  1RDD A;  2BUP A;  5JS2 A;  3KTQ A;  1S1V A;  3GL1 A;  4FLY A;  2VWK A;  5BN9 A;  1U6Z A;  5AQV A;  3V9W A;  2OYQ A;  4C8L A;  3SAF A;  5HRN A;  4M7Y A;  4B9N A;  2O8D A;  3O3G A;  3PO5 A;  2HVI A;  4CGJ A;  1BQN A;  2WBN A;  5T7B A;  1Q82 O;  4YOX A;  3NF6 A;  3QEI A;  2QK9 A;  4DTM A;  4IDH A;  4IG3 A;  3C95 A;  5LMN K;  5BPL A;  1S9G A;  1YVU A;  3CPW M;  1KSP A;  4W5T A;  1Q9X A;  1D9F A;  4CEA A;  4WFN L;  4QS7 A;  3E9L A;  2HBM A;  1WB9 A;  2FBX A;  2D1K A;  1KAZ A;  3IKM A;  2F8S A;  3TTD A;  4FXD A;  2DY4 A;  4JKE A;  2A1R A;  1TUY A;  3UKU B;  3BZC A;  1QVG M;  2UUC K;  2B5J A;  3E1Y A;  3K5M A;  5HLF A;  1NJI O;  4CJ4 A;  1YJW N;  1C0U A;  3DI6 A;  2E88 A;  3QIN A;  1RTD A;  4KRF A;  3DLE A;  2JLE A;  4N41 A;  1KTQ A;  3AO1 A;  1BA0 A;  4IOX A;  5HBM A;  4BY9 C;  2UYT A;  3AVI A;  3DAW A;  4CJL A;  3RR7 A;  3RWU A;  4B3M K;  2P9K A;  3U8X A;  4CIF A;  4LF5 K;  4BG8 A;  1BO5 O;  1J5O A;  4OKK A;  4CJ5 A;  5DMR A;  3KLH A;  4C8O A;  1NMD A;  1X3N A;  5LY3 A;  5HL7 L;  4NXM K;  1IKX A;  3PV8 A;  4FM1 A;  1RTH A;  1CLQ A;  3QIC A;  2VWJ A;  4IZ9 A;  4H0V B;  4O8U A;  4E7L A;  1M90 O;  3AY9 A;  3TU5 A;  4LF9 K;  3C94 A;  4DTR A;  4BDZ A;  2KLA A;  4DWI A;  2PYJ A;  5KQD A;  5KPZ A;  1DT9 A;  2E2N A;  3VGK A;  1BI4 B;  2P5G A;  4CF0 A;  2R7Y A;  3EE9 A;  3NF7 A;  4CD3 A;  3GBT A;  1BOT O;  3UB5 A;  3DRP A;  2QXL A;  3IUC A;  1GLA G;  2BDP A;  3ZSR A;  4EHT A;  1NGB A;  2HF3 A;  3DRR A;  4JHD A;  4F2R A;  4CF1 A;  2PAV A;  1WSI A;  3KWG A;  2XRI A;  1DGK N;  3AAQ A;  3VQQ A;  4WFA L;  5AQH A;  4IKF A;  3RMB A;  3RMC A;  4LF8 K;  4LFA K;  4A62 A;  1LW2 A;  1JCF A;  1BI4 A;  3WQU A;  3HPH A;  3ZX2 A;  1Z26 A;  4PL7 A;  4Z4E A;  2YHB A;  4JS5 A;  4FWM A;  2GWK A;  3IS9 A;  4IEE A;  2P9U A;  3R1X A;  1N36 K;  4B3T K;  3ID8 A;  2G8K A;  3ZET A;  4FZX C;  5JLF A;  4FOI A;  3THX B;  1SAZ A;  3BP8 A;  1HKG A;  4EP4 A;  1Q81 O;  1MWM A;  1WUA A;  4ZTJ A;  4JKC A;  4Z4I A;  3SQ4 A;  3J7Y P;  4FW2 A;  1HRH A;  2XY7 A;  1RTI A;  5AQQ A;  2Z1J A;  1BIS A;  2WON A;  2A3Z A;  4GW6 A;  1RT3 A;  2NRX A;  4OVL A;  1QHT A;  1TAQ A;  1VQ9 N;  3NMU A;  1QSL A;  4FSV A;  3ITH A;  4JI6 K;  1EX4 A;  3PY8 A;  3MAQ A;  4DR4 K;  4DHY A;  3L3V A;  2PYL A;  2YJE A;  3SQ1 A;  4DQI A;  2E8A A;  1D5A A;  2NLX A;  3D6R A;  3ZLJ A;  3GE1 A;  1RTJ A;  3ZSV A;  2HHW A;  2HW3 A;  4CHP A;  4CGF A;  1ASW A;  3K5N A;  3WNE A;  4CFC A;  2HHS A;  4BGA A;  3B6O A;  1UWB A;  4CK2 A;  4FWN A;  4H5N A;  5TKW A;  1ZBH A;  2NZT A;  2FF3 B;  2XO7 A;  2HNZ A;  3WXJ A;  3KLE A;  1SL1 A;  1FKO A;  1QQO A;  4DR2 K;  3H3N O;  1WOQ A;  1YI2 N;  4CEO A;  3A2F A;  3FGU A;  4FJJ A;  1K73 O;  1YVN A;  3QNN A;  2YNG A;  3A5M C;  2Q3S A;  2WOM A;  3ZT0 A;  1RT6 A;  1LV5 A;  4NYF A;  4DR7 K;  1B9F A;  4B1Z A;  1KFS A;  1J54 A;  1HQE A;  1T3V A;  4M7X A;  3NHG A;  2CGL A;  4HCB A;  4CE9 A;  5AQN A;  3ATV A;  1XMQ K;  4OPK A;  1Q8I A;  4CF9 A;  4M3R A;  1ZXO A;  3NF9 A;  2O8D B;  2ZF5 O;  3SAG A;  4NO7 A;  3A5O C;  4DCH A;  2KZM A;  3L2U A;  4E7J A;  2IVO A;  4GVM A;  3J80 O;  2VG5 A;  3NBP A;  4Q5V A;  2P5O A;  1RDW X;  5IT9 O;  3VQ9 A;  4B1X B;  1L3U A;  4IBN A;  2FSN A;  3OS0 A;  2BE2 A;  1KAX A;  3AVC A;  1HUX A;  4M3W A;  3TSP A;  3K2P A;  2XY6 A;  3TAM A;  3QNO A;  2ZD1 A;  3DM2 A;  3MN7 A;  3MX5 A;  4CCH A;  5HOO A;  3WXI A;  2F4V K;  4BR4 A;  4DTN A;  3DMJ A;  3TAB A;  4FZZ A;  3KZB A;  4DTO A;  1NK8 A;  4CEQ A;  3VEO A;  4JKA A;  1L3S A;  3LP1 A;  3CCJ N;  4JLH A;  4FWR A;  3OVN A;  4LH4 A;  3LL3 A;  2FSJ A;  4X62 K;  5HRP A;  5ADX H;  4M3Z A;  3KLF A;  5H1S Q;  5EXW A;  4W5N A;  3ZT4 A;  4A5A A;  4FLZ A;  2YNH A;  5C0Y A;  3S9H A;  4EHU A;  2HST A;  2A5X A;  4BRH A;  5CR4 A;  3EY1 A;  3NE6 A;  4O5B A;  2YI1 A;  4BRI A;  4EP5 A;  3J7Z O;  3QIP A;  3ATU A;  3M5R A;  4JI5 K;  1VRU A;  3TI0 A;  2A41 A;  4I9L A;  4DR3 K;  1OKJ A;  4OKE A;  3I0R A;  2HHU A;  4CF8 A;  1ZC6 A;  4GNI A;  2HHV A;  3Q7B A;  2Q1N A;  1UA0 A;  4B8A B;  3CC4 N;  1QS4 A;  1HR0 K;  2E1Y A;  1ZBF A;  2RF2 A;  4ISG A;  5EVZ A;  4Z4G A;  1GLL O;  3L2R A;  1XHZ A;  1NJY A;  2V7Y A;  4YOW A;  5CYQ A;  5ELZ A;  3VQ5 A;  2RE2 A;  2Q0U A;  3CCS N;  1QQM A;  2VG6 A;  2ASP A;  4KHQ A;  2QWR A;  1U48 A;  3C65 A;  4IOA L;  4BRL A;  4JHD B;  3HM9 A;  4FJN A;  3KLG A;  2X74 A;  4CJT A;  3P83 D;  3SV3 A;  1HKB A;  2QWN A;  4DFJ A;  1EET A;  3TAG A;  2KFN A;  2UXD K;  1VSE A;  4CZH A;  1S1W A;  4CGG A;  4BQZ A;  3TSQ A;  2ZM6 K;  2E1Z A;  1WAF A;  3OYF A;  1C0M A;  4QS8 A;  2O4I A;  1JLB A;  3U9Z A;  3DLH A;  2P9I B;  2ZGY A;  1RBS A;  3LPU A;  5SZT A;  2P9N B;  3H08 A;  4OPH A;  4KTQ A;  4RW7 A;  3OS2 A;  3SMP A;  4CZJ A;  3PIP L;  1KLM A;  3CIP A;  3ZET B;  2Q2R A;  2AJQ A;  1YAG A;  4ID5 A;  3V4I A;  4LFB K;  1SKW A;  1WLJ A;  3ZSW A;  2XY8 A;  1KFD A;  5C42 A;  4PKG A;  4BAC A;  1M1K O;  3CYM A;  4ISF A;  2W40 A;  2YKM A;  1T7P A;  1NLV A;  1VQ7 N;  3V6D A;  4PUO A;  1JXB A;  3THV A;  3OBY A;  3QLH A;  3AA4 A;  1X9M A;  4DG1 A;  4FZY A;  4BE1 A;  2DFF A;  4A59 A;  5C12 A;  3VQB A;  2I7P A;  5E84 A;  3CCV N;  1MWK A;  1LWC A;  1X1P A;  4CEE A;  3VEX A;  4HUE A;  4N47 A;  3MX2 A;  3H45 C;  1K8A O;  5C15 A;  3OYH A;  3H6E A;  5AQM A;  5IWA K;  3SPZ A;  2NRH A;  3WXK A;  4V19 S;  4FJH A;  3G25 A;  3P1G A;  3BUZ B;  1U4B A;  4GKK K;  4PL8 A;  5JIC A;  3OJS A;  2O8B A;  2HOE A;  5GAD P;  4DTJ A;  3SI6 A;  1ZBI A;  4JKG A;  3RRH A;  3EEQ A;  3K9J A;  1YJN N;  1WN7 A;  4WQ4 A;  3T7Z A;  2YHA A;  3L4I A;  4FLX A;  4OLB A;  2W6L A;  2PZS A;  5FPM A;  3SJH A;  3QEP A;  1U04 A;  2KZZ A;  4CJ3 A;  3A5N C;  1D9D A;  4B3O A;  1QZ6 A;  3CM6 A;  4E1J A;  4CIE A;  2NRW A;  3SUN A;  3CQY A;  4I6M B;  1W97 L;  3QEX A;  3H46 O;  3OS1 A;  3VOV A;  2ATQ A;  3ULE A;  1S9E A;  3CQX A;  3GOI A;  3WXL A;  3AVG A;  4Z94 A;  4DV4 K;  1WSE A;  3EN9 A;  4IG0 A;  2D0A A;  2FSK A;  4CJV A;  3AGR A;  2D4W A;  3CXC M;  3C0B A;  3UKR A;  1K6Y A;  3HYF A;  1RNH A;  2O8F A;  4FK2 A;  3AA2 A;  1WSF A;  2H3G X;  3VTH A;  5HRS A;  3OW2 M;  1J5E K;  3DOL A;  4BRP A;  3V81 A;  3LAM A;  1N5Y A;  1GLD G;  4NB4 A;  4B3R K;  3HOS A;  3LDP A;  4K41 A;  3FZL A;  5M1F A;  1CZ9 A;  4CHY A;  5BR9 A;  3VGL A;  3WNF A;  4FLV A;  1TYQ A;  4CJE A;  3WEE B;  5C25 A;  4AM6 A;  1NK0 A;  4M3U A;  2PBD A;  2O8E A;  2OCE A;  4DB3 A;  1NKB A;  3KK2 A;  3C6U A;  1SKS A;  1VQ5 N;  4DU1 A;  4H0X B;  3OYG A;  1BG3 A;  1JLG A;  3B6P A;  4E89 A;  1EKE A;  3QML A;  3O4W A;  1LWF A;  4JK9 A;  2FBY A;  4JKB A;  4DUZ K;  1IBL K;  4BRQ A;  4ICL A;  1XHX A;  1X3M A;  1S6P A;  4JS4 A;  4H5T A;  1TKZ A;  4FLW A;  4BC5 A;  5KRT A;  1WBD A;  3LDL A;  4N56 A;  3CM5 A;  3P39 A;  3MEC A;  4FOE A;  5M1N A;  4ZHR A;  4FPA A;  5F2R A;  4K42 A;  2D0O A;  4HUG A;  1KVA A;  2P9S B;  2ASO A;  5AQI A;  2ITM A;  3U6F A;  1QSS A;  1VQ6 N;  3K0S A;  3THX A;  5GAG P;  1DLO A;  1I94 K;  3G0Z A;  4N76 A;  5KGX A;  3CCR N;  2GUI A;  3O9S A;  1B92 A;  2P9U B;  3SV4 A;  2Q97 A;  4PKI A;  1V4S A;  3I56 N;  1VQP N;  4Z4C A;  4WCE L;  4RWT A;  4EZ9 A;  4AIL C;  1YTA A;  5AFU A;  4ELV A;  2XHB A;  3MEE A;  3MED A;  3D2F A;  4RG8 A;  3KD5 E;  5E41 A;  3O08 A;  1WAJ A;  1JKH A;  3O3H A;  3HOT A;  1VAZ A;  3HXM A;  3NDK A;  4UY8 O;  4H03 B;  5I42 A;  5AR0 A;  4H0T B;  1GOA A;  4Z4H A;  5GAE P;  1N6Q A;  4JI1 K;  3VA0 A;  1TL3 A;  1S1U A;  3CFP A;  1EQY A;  4FWS A;  4HWI A;  1N8R O;  2DTU A;  2Y1J A;  3FZH A;  3ZSX A;  3HBT A;  4L3Q A;  1BIZ A;  3VQ8 A;  1NGJ A;  4KI6 A;  3AGK A;  4UQG A;  4WFB L;  2I7N A;  4AQY K;  4DFK A;  3LAN A;  4YOY A;  1NG9 A;  3AVA A;  5AQO A;  5D3G A;  1EO1 A;  1DEJ A;  1NKC A;  3CET A;  2P9N A;  4CF2 A;  4DV0 K;  5BR8 K;  3B8A X;  4DV6 K;  5M1Q A;  1ASU A;  4DFM A;  4BWM A;  1IKW A;  1SKR A;  2D0B A;  4DV3 K;  1IBK K;  4YFU A;  3LM2 A;  2IS3 A;  3ZT3 A;  2QTD A;  4DSK A;  2IC3 A;  3OYC A;  3AVM A;  4H0P A;  5AQR A;  3U9D A;  2YHW A;  4KH5 A;  3K58 A;  5AZI B;  2QWL A;  1RDU A;  4DSJ A;  1IG9 A;  4FJ9 A;  3VQE A;  4FWO A;  3SK3 A;  3ZSQ A;  3SBT A;  3D45 A;  4O8K A;  2ZJP L;  1TK8 A;  4PA1 A;  5AQF A;  3VF2 A;  4KHW A;  4JKG B;  3FFI A;  4J2D A;  4LY7 A;  3TAF A;  1OH8 A;  1NK6 A;  1V4T A;  4KHN A;  5DM7 L;  1SL2 A;  5J2Q A;  3I8D A;  4JI8 K;  1BCO A;  3ZX3 A;  3CER A;  3LDN A;  2G8W A;  5M1K A;  1E4F T;  3OTO K;  3RMA A;  1JLF A;  3LWM A;  3V9X A;  4DTU A;  3I33 A;  3A0I X;  3SMS A;  1S5J A;  5I9E B;  2KW4 A;  3DLG A;  4K43 A;  1W7A A;  1R0A A;  1EXQ A;  1HMV A;  5EX5 A;  3FE1 A;  1XI1 A;  1QE1 A;  4B9Q A;  1HNI A;  2HHT A;  4FVM A;  3DRS A;  4CES A;  3SPY A;  4CEF A;  4B1Y B;  3WNG A;  3AO4 A;  1O1W A;  4LF4 K;  5C24 A;  3CC7 N;  1KXP A;  3L0Q A;  1BCM A;  1I39 A;  3F9K A;  1KC8 O;  2G8H A;  3EKS A;  2V52 B;  3PSF A;  4FJ8 A;  2KHO A;  3AVK A;  1RT1 A;  4MFB A;  1D4X A;  2A1S A;  5AFU H;  3AO3 A;  4CHZ A;  2YJF A;  3HI0 A;  2FXU A;  1HNX K;  4MO5 A;  4J8F A;  1T6D A;  1BHL A;  5FRM A;  2RHK A;  4H5R A;  4LC9 B;  4DS4 A;  3V9Z A;  4OPJ A;  2P51 A;  4CIG A;  5BRE A;  4B1U B;  3ENB A;  3QFP A;  4AHT A;  3O4N A;  5LL6 Z;  4OKJ A;  1XMO K;  3ZCM A;  2KFZ A;  3O3F A;  4ID1 A;  3TAE A;  3LDS A;  3UKR B;  4BC3 A;  2VCP A;  1TL1 A;  1WSG A;  1KCF A;  2P9L B;  3L4Q A;  3CF5 L;  2OZM A;  1Z25 A;  4JKH A;  3H1Q A;  1J53 A;  3L2W A;  1HNZ K;  5AZJ B;  3VMF B;  2WTU A;  3CFO A;  4BRF A;  2GWJ A;  4X66 K;  3HM8 A;  1IO2 A;  4DLE A;  3ASM A;  5HRO A;  3ISN C;  1EWQ A;  3J8A A;  2X78 A;  4IJA A;  4CVN E;  4JRP A;  3IMX A;  2YHY A;  4R5P A;  3A5L C;  4BE0 A;  2NRZ A;  2QWP A;  4FK0 A;  1JLC A;  1GOC A;  5AQW A;  4C8M A;  4BQL A;  2HMI A;  2JWK A;  1OH7 A;  3KHY A;  3AVL A;  4MLH A;  4M41 A;  1XUP O;  3LP2 A;  1GOB A;  1IG8 A;  4DQ8 A;  1WBB A;  4JI2 K;  3HO1 A;  1Z05 A;  1YT3 A;  4MQ3 A;  4JKF A;  1A5X A;  3VES A;  3VQC A;  4CZF A;  1YIT N;  4DQQ A;  3IDH A;  1S1T A;  4NXN K;  2CGK A;  3VQ6 A;  5KPT A;  4PQU A;  1SQK A;  2UUA K;  3RRG A;  4OX9 K;  2P9L A;  1LAV A;  3QET A;  2IVN A;  5SWM A;  2D0C A;  4Y0W A;  4NYN A;  2HMP A;  3CJ1 A;  4CFA A;  4RW6 A;  1NK4 A;  3E66 A;  3VN5 A;  4DTX A;  3BY5 A;  2B6A A;  2FLO A;  3K5L A;  3ULD A;  1EP4 A;  4HUF A;  3I0S A;  1C1B A;  2OPP A;  3LP3 A;  4LSL A;  5KRS A;  4M42 A;  4LFC K;  4B3S K;  4RTF D;  4DTS A;  4CER A;  1HNV A;  4AHU A;  3S3M A;  3M1F A;  1FK9 A;  3PUF A;  4DF4 A;  4F8R A;  3OYM A;  4I7F A;  4FK4 A;  3DLR A;  4BRA A;  4A57 A;  1REV A;  3KD1 E;  1RT2 A;  1S3X A;  4PHT X;  3DOK A;  5AQG A;  1HQU A;  1ATS A;  3EE8 A;  1NK7 A;  4KH6 A;  2A40 A;  4K0K K;  1LCU A;  1CXQ A;  2HF4 A;  4CZK A;  1RCH A;  4DMN A;  4KB0 A;  3IG1 A;  4KH4 A;  1YTU A;  5EU7 A;  4CEB A;  4W5O A;  4KFB A;  3P5J A;  1TYQ B;  4CJU A;  3Q7C A;  1EWR A;  1NK9 A;  1VQK N;  3SUQ A;  3OJU A;  3QO9 A;  3K9K A;  4CZI A;  4GKJ K;  4YOR A;  1A5V A;  1GLC G;  4E3S A;  3OYK A;  4B9L A;  3QES A;  3VQA A;  3LDO A;  4MDB A;  3VQD A;  3IFR A;  4ELT A;  3TSU A;  2YNF A;  1Y64 A;  1YJ9 N;  1SL0 A;  4QAG A;  1OH6 A;  3MN9 A;  4K8X A;  2Z1H A;  1YIJ N;  5ADX A;  3FZK A;  1BL3 A;  4CD1 A;  3CJ9 A;  1CZA N;  4KHU A;  1TUU A;  2QWM A;  4E0D A;  3VEN A;  1HX1 A;  2WUS A;  1ILY A;  4KBO A;  4BG9 A;  2A42 A;  5AQP A;  1VQO N;  4CZE A;  2ZQB A;  4A2A A;  3R3L A;  3SBG A;  4MLE A;  2YNI A;  4KHP K;  1RIL A;  2QW9 A;  3UIQ A;  4GVE A;  4FM2 A;  3M8S A;  2P1J A;  3CHW A;  4O4G A;  4E7I A;  3F2K A;  2QXF A;  3SLC A;  4JI7 K;  4NCG A;  3ZT2 A;  3V9U A;  2B4J A;  2XY5 A;  4KB1 A;  2X6S A;  1FW6 A;  4BRC A;  1HYS A;  3DXM B;  5M1O A;  3LAL A;  5HRR A;  4F2S A;  1TK0 A;  2GEM A;  2WC9 A;  2NNW A;  3IRX A;  1WSH A;  2OPR A;  4O5F A;  4CI6 A;  4BRG A;  2F9T A;  3ZSO A;  5FPD A;  1P8Z A;  3U3G A;  3DLL L;  3TAN A;  4FJ7 A;  4QS9 A;  3MN5 A;  4K25 A;  4YOV A;  3NH0 A;  5KI6 A;  1Q18 A;  2GX9 A;  4JD2 B;  1U2V A;  5I3U A;  4JI4 K;  3D2E B;  4BRE A;  3SQ0 A;  2OTJ N;  1OVY A;  3OBW A;  2LSN A;  2ITG A;  4JNE A;  2G8V A;  2RN2 A;  1L3V A;  3PIO L;  3PO4 A;  4FJI A;  4BVP A;  1VSI A;  2BAN A;  2IAJ A;  4X65 K;  5LJW A;  1NNE A;  4B9T A;  3RSE B;  4I6M A;  3AO5 A;  4DSI A;  2QWQ A;  4E19 A;  4B08 A;  5KPR A;  4CGI A;  3D2F B;  2QA4 N;  1QTM A;  3K59 A;  4LF6 K;  3O5B A;  4BR7 A;  3VET A;  4CBU A;  3NH1 A;  4C1N K;  2W42 A;  3O9U A;  5LMU K;  3CJC A;  3CCE N;  1RBV A;  3RVC A;  4B1V A;  2QM1 A;  5CYM A;  1HLU A;  2IVP A;  4JAX A;  1L5U A;  3VEZ A;  2G8F A;  1HPM A;  2EWS A;  4WQ5 C;  5E26 A;  4JV5 K;  3O6W A;  3GG4 A;  4DQR A;  1C0G A;  2HND A;  1HNW K;  2NRT A;  3O80 A;  4AHR A;  4B8C A;  5BPN A;  1VQ4 N;  3KVG A;  2FF6 A;  3DXK A;  4KTW A;  1A5W A;  1G99 A;  2G8U A;  4ZTF A;  2UUB K;  4W5Q A;  3CFR A;  2E2Q A;  4C23 A;  1BIU A;  2VGM A;  1SZ2 A;  4JRQ A;  3SJJ A;  3PX6 A;  3I55 N;  3CJ7 A;  1NKE A;  4F3O A;  4KPY A;  4BGB A;  3ID6 A;  2BTF A;  4IWV A;  4CZL A;  4F4K A;  2UXC K;  2HBK A;  4Y1C A;  1ATR A;  3DXK B;  4MO4 A;  3UKU A;  3JS6 A;  3E9P A;  3LZI A;  4FWP A;  3HP9 A;  3HST B;  4BDP A;  1CZB A;  1U2V B;  1VHX A;  1YHQ N;  1BUP A;  3HJF A;  4ILJ A;  4JKD A;  5C2F A;  2FBV A;  3NH2 A;  3LWL A;  5FPN A;  1RBR A;  3KWI A;  4JN4 A;  4LF7 K;  4MDA A;  1D8Y A;  4L8R B;  4O55 A;  4DV2 K;  1VQL N;  2AP1 A;  2OA8 A;  5AQY A;  2X6N A;  1U47 A;  4CHO A;  4DQP A;  4FCY A;  1NGC A;  3VGM A;  4FYD A;  3BF3 A;  2V51 B;  3DYA A;  3R9P A;  3D2E A;  2VYP A;  4TSX A;  4YDU C;  5A2Q O;  1UA1 A;  3RR8 A;  2O4G A;  2F8T A;  1Q86 O;  1NGD A;  3BEX A;  5FLX O;  1NGA A;  2P9I A;  3FZF A;  4DLG A;  1NMN A;  2E4L A;  4FJM A;  4G1Q A;  3O1B A;  4PKH A;  3KIO A;  3VA3 A;  3VPZ A;  3THW A;  1HJO A;  4FLT A;  1RFQ A;  2HBJ A;  3NVK A;  4FWQ A;  1QQC A;  4CK3 A;  3CI5 A;  1VSF A;  2OZS A;  3U4L A;  4DF8 A;  3HZ6 A;  4O0I A;  4DTP A;  3JXU A;  4DQS A;  4FVU A;  3H1V X;  1BU6 O;  4OGE A;  2ZJQ L;  1S1X A;  4EZ6 A;  1VQN N;  1BQM A;  3MXJ A;  4E7H A;  3CG7 A;  4CFD A;  3O8M A;  3DJC A;  4FLU A;  3D0P A;  3W0L A;  1JCE A;  2QKK A;  3WT0 A;  4FJX A;  2G8I A;  4RCH A;  3O4Q A;  4J2B A;  3A8Y A;  4H5V A;  3ENO A;  4JI3 K;  4FJG A;  5JVG L;  2HBL A;  1TGO A;  2Z1I A;  3P4I A;  4EFH A;  3TTC A;  1Z6R A;  1GLE G;  3VEV A;  4B9V A;  4BR0 A;  2GV9 A;  4XIU A;  3THW B;  4C8K A;  2UU9 K;  2GBZ A;  3KKS A;  1XC3 A;  3CMA N;  1T05 A;  4LSN A;  2YV0 X;  4GY2 B;  5JVH L;  4CED A;  5C2D A;  1J9A A;  4DKW A;  3WNH A;  1QZ5 A;  4NCB A;  4O0J A;  1NJX A;  4OPA A;  1HPZ A;  1JL2 A;  4IXC A;  4E1M A;  2O8E B;  2VQF K;  3NGY A;  4XH4 A;  4U67 L;  3SZ2 A;  1KVC A;  2Q0R A;  5MLC Q;  3SYZ A;  1YXQ A;  3K57 A;  4AM7 A;  4YOU A;  1IJJ A;  1E4G T;  3VQ4 A;  2I5J A;  1RBT A;  5AQZ A;  3VEW A;  1VK0 A;  1U45 A;  3V1Q A;  3THY B;  1NGE A;  3ZT1 A;  1RDA A;  1TKD A;  1VRT A;  3CD6 N;  5GIP A;  1W2B M;  3L2Q A;  5FDL A;  4JD2 A;  3NF8 A;  4CJF A;  3AVH A;  2VQE K;  1VSK A;  4YOT A;  3HVR A;  4CZM A;  3OYA A;  1FKP A;  3PX4 A;  4B1W B;  4BRN A;  2QI2 A;  1XC9 A;  3SUO A;  1JLE A;  2DFE A;  4CGH A;  4XH5 A;  3NVM A;  2P9K B;  4F9O A;  4E1N A;  3WQT A;  1S72 N;  3AVF A;  1O13 A;  2V7Z A;  3VF4 A;  1NOY A;  3MXM A;  4FJ5 A;  1U49 A;  4X64 K;  1TK5 A;  4FW1 A;  3P38 A;  1I3A A;  3MDQ A;  1SV5 A;  5J2P A;  2E5L K;  5CE3 A;  4DS5 A;  3QEV A;  3WUH A;  1TKX A;  4A5B A;  1VSH A;  4JK7 A;  1LWE A;  4B9M A;  4CHN A;  2F9W A;  3TAR A;  1XNQ K;  3QER A;  4HTL A;  1GLB G;  1L3T A;  1Q9Y A;  5TKY A;  3JYT A;  1XNR K;  2OPS A;  4NLB A;  2BH1 A;  3M3Z A;  4GV6 A;  4NLC A;  2A6A A;  3AVJ A;  4CK1 A;  4I2P A;  3DXM A;  3T19 A;  1T8E A;  1NGH A;  4BRM A;  3M8R A;  1IBM K;  1GLF O;  3CPE A;  2HHH K;  1NK5 A;  1KD1 O;  3OHR A;  3CJB A;  5GIN A;  1N34 K;  4DU4 A;  4OO1 J;  4RW9 A;  1C0T A;  2D0P A;  4LD0 A;  3ALY A;  5AQT A;  1IKY A;  3QBX A;  4BWJ A;  1VSD A;  4DR6 K;  3UE5 A;  5AQX A;  4F3T A;  5CY4 A;  2RPI A;  3PX0 A;  1NJZ A;  3HL8 A;  3NGI A;  3CME N;  4CHQ A;  2WFB A;  4BRD A;  4IFV A;  4M63 C;  1JLQ A;  3C6H A;  4KRE A;  3WEE A;  5BRH A;  4Y1D A;  5AZI A;  4IOC L;  1YUW A;  2DPN A;  3MEG A;  3G71 N;  3GDQ A;  1RT7 A;  4BR2 A;  5KQ8 A;  4AHV A;  2ZWH A;  3CCM N;  4B9S A;  4XEI A;  3ULE B;  5AQS A;  2NRV A;  3S41 A;  3ZEU A;  1RDB A;  4AHC A;  4CZG A;  2F7T A;  2IGI A;  4K8Z A;  1H1V A;  3HRG A;  3NFA A;  3CJA A;  3QIO A;  4DSE A;  3TTF A;  1ESV A;  1RGI A;  3LDQ A;  1MA9 B;  2IOC A;  3FLC O;  1K9M O;  5CHI A;  3G6E N;  1JLA A;  1KAY A;  4I9Q A;  3C6A A;  2GTD A;  3AVB A;  5EOY A;  4R79 A;  3N4Q A;  2BGG A;  3AAR A;  1DKG D;  1B9D A;  3MCP A;  5BRD A;  1W0H A;  4FM0 A;  4J2A A;  3BGR A;  2IIR A;  4CEZ A;  4CFB A;  1KLN A;  3FZM A;  1LW0 A;  3BDP A;  4AHS A;  2UXB K;  1R59 O;  3RMD A;  5J2N A;  3V1O A;  4JK8 A;  4ISE A;  3DWL A;  2W6K A;  4Z4F A;  3ZSY A;  4QOZ B;  2JWL A;  1QHA A;  2GUP A;  4IJN A;  3AAP A;  1JL1 A;  2YX6 A;  3PLA A;  1UAX A;  1T03 A;  1WSJ A;  1BDG A;  4LH5 A;  3D7E O;  3FFK B;  4H8K A;  4HCC A;  3IAY A;  3CCQ N;  4DUY K;  3G10 A;  3VEY A;  4BRO A;  4CJ7 A;  4PY5 A;  1DTQ A;  1JCG A;  3TPQ A;  5HP1 A;  5AQK A;  3VTI A;  3M6G A;  3E9O A;  1LOT B;  3RSE A;  4BDY A;  3LP0 A;  4ILG B;  3OY9 A;  3F9M A;  1LAW A;  4IDK A;  4KKO A;  3M8P A;  3L2V A;  4RW8 A;  4PWD A;  5GAH P;  4M45 A;  3SAH A;  1BA1 A;  2VWB A;  4QCL A;  4DSL A;  2E2O A;  2EHG A;  2IDO A;  5JMV A;  3C6T A;  3AA3 A;  5F1X A;  1QVF M;  4AF1 A;  5JLH A;  1ZYQ A;  4N5S A;  4OGC A;  2P9P B;  1G15 A;  4KTZ A;  3OYN A;  5FPE A;  4CGD A;  4KHY A;  3OYD A;  2O8B B;  3T1Y K; 
#chains in the Genus database with same CATH homology
 2IVP A;  4JAX A;  5GAE P;  2A3Z A;  2NRX A;  1EQY A;  4FWS A;  1XQS C;  4HWI A;  3VEZ A;  1N8R O;  1VQ9 N;  3FZH A;  3NMU A;  1HPM A;  3HSC A;  4FSV A;  3HBT A;  4L3Q A;  2EWS A;  4WQ5 C;  5E26 A;  1NGJ A;  3GG4 A;  3O6W A;  1C0G A;  4DHY A;  3AGK A;  4WFB L;  2I7N A;  4U7B A;  4YOY A;  2NRT A;  2YJE A;  3O80 A;  4EIA A;  5BPN A;  2OTL N;  4C1N I;  1VQ4 N;  2E8A A;  3KVG A;  2FF6 A;  5AQO A;  3DXK A;  2NLX A;  3D6R A;  3EL2 A;  3GE1 A;  1NM1 A;  1EO1 A;  1G99 A;  1VQM N;  1DEJ A;  4CBX A;  5AQL A;  3CET A;  2E2Q A;  2P9N A;  4C23 A;  3L6Q A;  3QFU A;  3MCA B;  2VGM A;  1SZ2 A;  3B8A X;  3I55 N;  5M1Q A;  4BGA A;  3CJ7 A;  3MN6 A;  2E2P A;  4FWN A;  4BGB A;  4H5N A;  5TKW A;  2NZT A;  2FF3 B;  2YCH A;  2ZGZ A;  3ID6 A;  2BTF A;  3WXJ A;  3LM2 A;  4IWV A;  4CZL A;  2QTD A;  1QQO A;  3H3N O;  1WOQ A;  1YI2 N;  4H0P A;  2HBK A;  5AQR A;  3FGU A;  1ATR A;  3DXK B;  2YHW A;  4IFE A;  4KH5 A;  5AZI B;  3U9D A;  2QWL A;  3BF1 A;  1RDU A;  3JS6 A;  4MO4 A;  3E9P A;  3UKU A;  5BRF A;  1K73 O;  4FWP A;  1J6Z A;  4CBW A;  1YVN A;  3QDK A;  4FWO A;  4BR9 A;  3A5M C;  3SK3 A;  3SBT A;  4IO9 L;  4O8K A;  2ZJP L;  1U2V B;  5AQF A;  4IO8 A;  1YHQ N;  1BUP A;  2GEL A;  3VF2 A;  2NRR A;  4ILJ A;  4BRK A;  4JKG B;  4B1Z A;  5DM6 L;  4JKD A;  5C2F A;  1T3V A;  4M7X A;  2CGL A;  5FPN A;  3KWI A;  4JN4 A;  5M1P A;  1V4T A;  4MDA A;  5DM7 L;  2CH6 A;  1QQN A;  5AQN A;  1K8K B;  1VQL N;  3ATV A;  2AP1 A;  5AQY A;  3ZX3 A;  5B8H A;  1MDU B;  3CER A;  3LDN A;  5BPM A;  1ZXO A;  5AQJ A;  5M1K A;  1E4F T;  3ZYY X;  2ZF5 O;  1NGC A;  3SAG A;  3CCU N;  4NO7 A;  3A5O C;  3C7N B;  3VGM A;  3BF3 A;  2V51 B;  4DCH A;  3R9P A;  3I33 A;  3D2E A;  2VYP A;  3A0I X;  4YDU C;  3W3D A;  2IVO A;  3SMS A;  2P9S A;  4EAH D;  5I9E B;  1RDW X;  5C10 A;  3P31 A;  4K43 A;  1NBW A;  2QWO A;  1NGD A;  3BEX A;  3O9Q A;  5EX5 A;  4B1X B;  4WF9 L;  1Q86 O;  1NGA A;  3FE1 A;  2P9I A;  3FZF A;  3VF6 A;  4B9Q A;  2FSN A;  1KAX A;  3O1B A;  4PKH A;  1HUX A;  1NWK A;  3TSP A;  4B1Y B;  1ATN A;  3VPZ A;  4WQ4 C;  4A61 A;  1HJO A;  3MN7 A;  1RFQ A;  2HBJ A;  3MX5 A;  1KXP A;  3L0Q A;  3CC7 N;  3NVK A;  5HOO A;  2ASM A;  4WYB A;  4FWQ A;  1KC8 O;  5AZJ A;  3WXI A;  3WXM B;  3EKS A;  2V52 B;  4BC4 A;  2E20 A;  3EO3 A;  4BR4 A;  2KHO A;  3CI5 A;  3QB0 A;  5AQQ A;  3KZB A;  3U4L A;  3VEO A;  1D4X A;  3HZ6 A;  4JKA A;  4H5W A;  5AFU H;  3CCJ N;  1T6C A;  1HKC A;  4JEP A;  4FWR A;  3JXU A;  2YJF A;  4FVU A;  3HI0 A;  2FXU A;  3LL3 A;  1K8K A;  2FSJ A;  1BU6 O;  3H1V X;  1T6D A;  4J8F A;  4MO5 A;  2ZJQ L;  5ADX H;  1VQN N;  5H1S Q;  2RHK A;  4H5R A;  4LC9 B;  5EXW A;  3O8M A;  1BWF O;  3DJC A;  4A5A A;  3W0L A;  1JCE A;  2OAN A;  5BRE A;  5C0Y A;  4B1U B;  3ENB A;  3ZEU B;  2W41 A;  3WT0 A;  3QFP A;  4EHU A;  2HST A;  2A5X A;  4BRH A;  5CR4 A;  4RCH A;  4BC2 A;  3A8Y A;  2YHX A;  2YI1 A;  3HTV A;  4H5V A;  3ENO A;  4BRI A;  5F0X A;  3O9T A;  3J7Z O;  3ATU A;  3M5R A;  4H0O A;  5JVG L;  2HBL A;  3UKR B;  3P4I A;  4EFH A;  4BC3 A;  2AA4 A;  2VCP A;  1Z6R A;  3TTC A;  1GLE G;  2A41 A;  3VEV A;  2P9L B;  1OKJ A;  2KKZ A;  3L4Q A;  4BR0 A;  3CF5 L;  3C7N A;  1NGG A;  4JKH A;  3H1Q A;  1ZC6 A;  4GNI A;  4WQ5 A;  2Q31 A;  2VGN A;  3Q7B A;  5AZJ B;  2Q1N A;  3VMF B;  3EKU A;  3CC4 N;  4BRF A;  1XC3 A;  2E1Y A;  3CMA N;  2GWJ A;  5LJV A;  4GY2 B;  3HM8 A;  2PFU A;  3ZX0 A;  4ILH A;  5JVH L;  1SS6 A;  5C2D A;  4ISG A;  3J8A A;  5EVZ A;  4IJA A;  1GLL O;  4DKW A;  3QBW A;  3ENH A;  1S22 A;  3IMX A;  4IEI A;  2V7Y A;  2YHY A;  4YOW A;  3A5L C;  1QZ5 A;  5ELZ A;  2NRZ A;  2RE2 A;  2Q0U A;  2QWP A;  4OPA A;  3G4S N;  3CCS N;  5AQW A;  1QQM A;  4IXC A;  4BQL A;  2ASP A;  2QWR A;  2JWK A;  3C65 A;  3KHY A;  4MLH A;  4XH4 A;  2CGJ A;  4U67 L;  4IOA L;  4BRL A;  4JHD B;  2Q0R A;  5MLC Q;  1XUP O;  1YXQ A;  1IG8 A;  4AM7 A;  4FWL A;  3VER A;  4YOU A;  1IJJ A;  1HKB A;  1NGF A;  2QWN A;  1E4G T;  4CZH A;  4DQ8 A;  4BQZ A;  5AQZ A;  1Z05 A;  3VEW A;  3TSQ A;  4GV9 A;  3H3O B;  4JKF A;  2E1Z A;  4FO0 A;  5BN8 A;  3MWP A;  3VES A;  4QS8 A;  1NGE A;  3U9Z A;  4CZF A;  1ZBS A;  1YIT N;  2P9I B;  2ZGY A;  3IDH A;  3R6M A;  3CD6 N;  5GIP A;  1W2B M;  3LM9 A;  2CGK A;  1YF5 L;  2P9N B;  4FL9 A;  5KPT A;  1GLJ O;  1SQK A;  4OPH A;  2QEX N;  2P9L A;  4YDU A;  4JD2 A;  2CH5 A;  4BVO A;  3SMP A;  4FWK A;  4CZJ A;  5AQU A;  3CIP A;  3ZET B;  3PIP L;  2IVN A;  4Y0W A;  2Q2R A;  4YOT A;  2HMP A;  1YAG A;  4CZM A;  3CJ1 A;  1VQ8 N;  3CCL N;  3MWT A;  4B1W B;  4BRN A;  2QI2 A;  3E66 A;  4PKG A;  4GV3 A;  1M1K O;  4ISF A;  2W40 A;  1JJ2 M;  4XH5 A;  3NVM A;  1NLV A;  1VQ7 N;  2FLO A;  4XH1 A;  1C0F A;  2P9K B;  3O9R A;  4F9O A;  3N4P A;  3OBY A;  3WQT A;  1S72 N;  3OA9 A;  3CC2 N;  2ZJR L;  1O13 A;  5GIO A;  2V7Z A;  3VF4 A;  3EZW A;  5EY4 A;  4A59 A;  5C12 A;  4BR5 A;  4FPB A;  2I7P A;  3P38 A;  4RTF D;  3MDQ A;  3MK6 A;  5E84 A;  3CCV N;  1MWK A;  3M1F A;  5CE3 A;  3VEX A;  1NGI A;  3WUH A;  4A5B A;  3MX2 A;  2P9P A;  4H0Y B;  3H45 C;  4JK7 A;  1K8A O;  5C15 A;  3MMV A;  4BRA A;  4A2B A;  3H6E A;  5AQM A;  2NRH A;  2F9W A;  3WXK A;  3O1W A;  1Q7Y O;  4A57 A;  3T69 A;  3F5T A;  3G25 A;  3I8B A;  3BUZ B;  4HTL A;  1GLB G;  1X9J A;  1P90 A;  1S3X A;  2J4R A;  4PHT X;  4PL8 A;  5TKY A;  5JIC A;  3FR0 A;  5AQG A;  4G9Z A;  4NLB A;  2BH1 A;  1ATS A;  2HOE A;  3EE8 A;  5GAD P;  3M3Z A;  4KH6 A;  4GV6 A;  2A40 A;  4NLC A;  2A6A A;  4JKG A;  1LCU A;  2HF4 A;  3K9J A;  4CZK A;  1KQS M;  3DXM A;  1YJN N;  3KK7 A;  4WQ4 A;  3T7Z A;  3L4I A;  4KH4 A;  3R8E A;  1T44 A;  1NGH A;  2Q36 A;  4BRM A;  2BUP A;  1GLF O;  3CPE A;  3GL1 A;  1TYQ B;  5FPM A;  1U6Z A;  5AQV A;  5BN9 A;  3SAF A;  3SJH A;  1KD1 O;  3Q7C A;  3OHR A;  4M7Y A;  3CJB A;  1VQK N;  3A5N C;  5GIN A;  4OO1 J;  1QZ6 A;  2WBN A;  1Q82 O;  4E1J A;  4YOX A;  3K9K A;  2NRW A;  4CZI A;  3CQY A;  4I6M B;  1W97 L;  3H46 O;  2D0P A;  3VOV A;  4IDH A;  4YOR A;  5AQT A;  1GLC G;  3ULE A;  5BPL A;  3QBX A;  3CPW M;  3CQX A;  3LDO A;  4MDB A;  3GOI A;  4WFN L;  3WXL A;  3IFR A;  4QS7 A;  3UE5 A;  4Z94 A;  3E9L A;  5AQX A;  1Y64 A;  2HBM A;  3TSU A;  1YJ9 N;  3EN9 A;  2D1K A;  2FSK A;  1KAZ A;  3IKM A;  3TTD A;  4JKE A;  3MN9 A;  3AGR A;  1TUY A;  3CME N;  2WFB A;  3UKU B;  4BRD A;  4M63 C;  2D4W A;  5ADX A;  1YIJ N;  3CXC M;  3C0B A;  3C6H A;  3FZK A;  3UKR A;  1QVG M;  3E1Y A;  4CD1 A;  3WEE A;  3CJ9 A;  5BRH A;  1CZA N;  1NJI O;  2QWM A;  1TUU A;  5AZI A;  4IOC L;  1YUW A;  2DPN A;  1YJW N;  2E88 A;  3G71 N;  3GDQ A;  2H3G X;  3VTH A;  3OW2 M;  4BR2 A;  5KQ8 A;  3VEN A;  1HX1 A;  2WUS A;  2ZWH A;  3CCM N;  1ILY A;  4XEI A;  1BA0 A;  4IOX A;  4KBO A;  2A42 A;  5AQS A;  5AQP A;  3ULE B;  4BG9 A;  4BRP A;  4CZE A;  1VQO N;  4BY9 C;  4A2A A;  2UYT A;  2NRV A;  3DAW A;  3S41 A;  3R3L A;  1GLD G;  3SBG A;  3ZEU A;  4MLE A;  4NB4 A;  4CZG A;  2F7T A;  3LDP A;  2QW9 A;  3HOS A;  1H1V A;  3HRG A;  3FZL A;  4GVE A;  4K41 A;  5M1F A;  3CJA A;  5BR9 A;  2P9K A;  3U8X A;  3CHW A;  4BG8 A;  3TTF A;  3VGL A;  1BO5 O;  1ESV A;  1TYQ A;  1RGI A;  3F2K A;  3LDQ A;  3SLC A;  3WEE B;  4AM6 A;  2PBD A;  4DB3 A;  1MA9 B;  1NMD A;  3FLC O;  1K9M O;  1X3N A;  5LY3 A;  5HL7 L;  5CHI A;  3G6E N;  1KAY A;  1VQ5 N;  3C6A A;  2GTD A;  4H0X B;  4BRC A;  3QIC A;  1BG3 A;  3DXM B;  4IZ9 A;  4H0V B;  3QML A;  3O4W A;  4O8U A;  5M1O A;  1M90 O;  3AY9 A;  5EOY A;  3TU5 A;  3N4Q A;  4R79 A;  4JK9 A;  4JKB A;  2GEM A;  2KLA A;  1DKG D;  2WC9 A;  3AAR A;  3MCP A;  2NNW A;  1X3M A;  4BRQ A;  5BRD A;  5KQD A;  5KPZ A;  2IIR A;  4H5T A;  1DT9 A;  3FZM A;  2E2N A;  4O5F A;  4BC5 A;  4CI6 A;  3VGK A;  4BRG A;  1R59 O;  2F9T A;  3EE9 A;  3LDL A;  5FPD A;  1P8Z A;  4CD3 A;  3GBT A;  1BOT O;  3P39 A;  4JK8 A;  4ISE A;  3UB5 A;  3DWL A;  3DLL L;  4FOE A;  2QXL A;  4QS9 A;  5M1N A;  3IUC A;  1GLA G;  2JWL A;  1QHA A;  3MN5 A;  4K25 A;  4YOV A;  2GUP A;  4EHT A;  4FPA A;  4IJN A;  1NGB A;  3AAP A;  1Q18 A;  4K42 A;  2YX6 A;  5F2R A;  3PLA A;  2D0O A;  2GX9 A;  2HF3 A;  4JD2 B;  2P9S B;  4JHD A;  1U2V A;  2ASO A;  5AQI A;  2ITM A;  1BDG A;  3D2E B;  2PAV A;  3KWG A;  3D7E O;  3FFK B;  4BRE A;  2OTJ N;  1DGK N;  1OVY A;  3AAQ A;  1VQ6 N;  3OBW A;  5AQH A;  4WFA L;  4JNE A;  3CCQ N;  5GAG P;  3VEY A;  4BRO A;  4CJ7 A;  1JCG A;  3TPQ A;  4A62 A;  1JCF A;  5AQK A;  3CCR N;  3VTI A;  3PIO L;  3WQU A;  3M6G A;  3O9S A;  3ZX2 A;  4PL7 A;  3E9O A;  1LOT B;  4BVP A;  2P9U B;  4FWM A;  3RSE A;  2GWK A;  4ILG B;  5LJW A;  4IEE A;  3F9M A;  2P9U A;  3R1X A;  4I6M A;  3RSE B;  5GAH P;  2Q97 A;  4PKI A;  1V4S A;  3SAH A;  3I56 N;  3ID8 A;  1VQP N;  4WCE L;  4RWT A;  1BA1 A;  2VWB A;  2QWQ A;  3ZET A;  2E2O A;  5JMV A;  5AFU A;  5KPR A;  5JLF A;  3D2F B;  2QA4 N;  4FOI A;  5F1X A;  1SAZ A;  3BP8 A;  1HKG A;  3D2F A;  4AF1 A;  1Q81 O;  1QVF M;  5JLH A;  1MWM A;  3O5B A;  3VET A;  2P9P B;  4BR7 A;  4C1N K;  4CBU A;  3O9U A;  5FPE A;  1WUA A;  4JKC A;  3O08 A;  3CJC A;  3CCE N;  3RVC A;  3HOT A;  1VAZ A;  4UY8 O;  4H03 B;  4B1V A;  2QM1 A;  5AR0 A;  4H0T B;  1HLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...