2RHKA

Crystal structure of influenza a ns1a protein in complex with f2f3 fragment of human cellular factor cpsf30, northeast structural genomics targets or8c and hr6309a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
PASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/nuclear protein
molecule keywords Non-structural protein 1
publication title Structural basis for suppression of a host antiviral response by influenza A virus.
pubmed doi rcsb
source organism Influenza a virus
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2rhkA00
2RHKA 3O9TA 3RVCA 3EE8A 3KWIA 3M5RA 3OA9A 3P31A 3O9UA 3D6RA 3O9QA 3O9RA 3P39A 4OPHA 3F5TA 2KKZA 3P38A 3EE9A 3KWGA 3O9SA 2GX9A 3L4QA 4OPAA
chains in the Genus database with same CATH superfamily
1RT7A 5GIOA 1D4XA 4CJ4A 1JCFA 2NRVA 1GLLO 4FJ5A 1YXQA 4BQLA 3PX6A 3QEIA 3O4NA 1IJJA 5KGWA 3D45A 3ITHA 3CQXA 3HVTA 3RSEA 3JSMA 3RMCA 2I5JA 3OS0A 3WNEA 1VK0A 2Q1NA 4B8AB 3HZ6A 2F7TA 2OZMA 4EHTA 4LC9B 5KGXA 4A62A 3HK2A 2AJQA 2Q3SA 3NVMA 3GL1A 3OVNA 4E7LA 3V1OA 3L2UA 1KVCA 4LF8K 2HF3A 3WNGA 3C95A 3IS9A 1Q81O 3EZWA 3D2EA 4K42A 2LSNA 3V81A 2GELA 4BC3A 3VQDA 3V4IA 1ZBIA 2EHGA 1BA1A 3O9SA 3FZLA 1K73O 2BH1A 2H3GX 3DXKA 5SWMA 4I9LA 1EKEA 1RT6A 2P9SB 3FE1A 1J53A 4H0OA 1S9EA 5LMNK 1EWRA 3M8SA 2HF4A 3PO5A 1TUUA 4M3YA 4DQIA 1IKYA 3QINA 3CQ8A 3RMBA 3CPEA 2XHBA 2G8VA 2PYLA 1Q8IA 3OS2A 1WOQA 1GLAG 5EOYA 3AO2A 3ZYYX 1KLMA 4H5WA 5HROA 3UKUA 1G15A 1BCMA 1VSLA 1WSJA 2YJFA 3MXMA 1BI4A 4DF4A 5BPLA 1VQMN 1VQON 4NXNK 3I55N 3O9UA 1RDDA 2IGIA 4ELTA 4AM6A 4I7FA 1K8KA 5AQIA 2ZJRL 3ASMA 3QO9A 4IFEA 2HMIA 3TAGA 3G10A 4OO1J 3CD6N 2EWSA 4KBOA 4JK8A 4FZXC 1Q18A 3LPTA 4FWPA 1YJ9N 1XWLA 3AA4A 4OLBA 4BGAA 3VGKA 5BR9A 3C6TA 4BR9A 1KRPA 3KZBA 3B6PA 1SZ2A 4BRGA 5E26A 4WFNL 2PZSA 1NWKA 2OPSA 2Z1IA 1VSJA 1JXEA 3EE8A 5C2DA 1C0UA 1ZXOA 1TK8A 2E5LK 4KH6A 5AZIB 4FOEA 3GDQA 5GIPA 4AHCA 4A2BA 5M1NA 2EX3A 5M1FA 1RT2A 4HUGA 3LDOA 3S41A 2A1RA 4XH1A 4JKCA 2D0BA 3BY5A 3VETA 4PHTX 4FJNA 2O8CA 3BF3A 3IUCA 5GAHP 4DUZK 3RR7A 3O4QA 3HRGA 3HJFA 4IDKA 4JKGB 1NLVA 5LMUK 3PY8A 1J54A 4JS5A 3CJCA 3ID6A 4BE2A 5IT9O 3C7NA 3WNHA 4C8LA 3NAEA 1IH7A 5FPEA 4CD3A 1VQ7N 4JYAK 3WEEA 1YTAA 1XMOK 3CCSN 3THVA 3RRHA 3P5JA 3ATVA 4JV5K 3ZSQA 2FBVA 4FW2A 3AO1A 4BRHA 4DQPA 1D8YA 1VSMA 3T3FA 4JKBA 3OYAA 3ZT1A 4AHRA 3AVBA 2O8EA 3VQ5A 4G1QA 2X6SA 4FLVA 3SK3A 2YNIA 4BDPA 2OCEA 3QIPA 5FRMA 1CZBA 2DFFA 4NCBA 2Z1GA 1IBKK 3AAPA 2E8AA 2NRHA 4B3OA 3J8AA 1SL2A 3TI0A 1NMNA 1LAWA 4CJTA 4B8CA 1SKRA 3QNNA 1HNXK 3S3OA 4KKOA 4GVMA 1GLCG 1QHAA 1Q9XA 1CXQA 3GE1A 4CHQA 1LOTB 1TAUA 5HRSA 1CZ9A 4HUEA 3AVNA 4FK2A 4FO0A 2RF2A 4YOVA 3OW2M 4WQ4A 3HYFA 1UA0A 1VQ6N 2IVNA 1CXUA 3EYZA 1U6ZA 1S5JA 4AF1A 2GWKA 5BREA 4B1YB 3SJJA 1N6QA 1UAXA 4CD1A 4GNIA 4B9TA 4BWMA 1O1WA 4BRAA 2JGUA 2YCHA 5BRDA 1T6CA 3MN7A 3ENHA 1ZBUA 3CM5A 3HM8A 3I33A 3K9JA 3PIOL 3H46O 2D0OA 4M45A 4JHDB 1U49A 1R59O 1BOTO 2P9SA 2D5RA 3EL2A 4DV7K 4UY8O 1WSEA 4Z4IA 2UXDK 5HL7L 2FF6A 4QOZB 1LWFA 1ESVA 3IRXA 1EQYA 3L3UA 5C25A 3D2FB 2HVIA 3A5OC 4PUOA 3CCMN 4ILJA 1DKGD 1HQUA 3OHRA 4IOXA 2WONA 4NLCA 1C0TA 3U6FA 4DV6K 4DLGA 5IWAK 3G71N 3QIOA 4BC4A 4YHHK 2P9UB 5AQHA 4FJHA 2OTLN 3M8QA 3HI0A 1Z6RA 4H5VA 1ZBLA 1L3VA 4DFKA 4O0JA 2UU9K 5EY4A 1J5OA 1G99A 4KH4A 4BREA 4IO9L 1WAFA 5A2QO 5SZTA 3RMAA 1UA1A 4KAZA 1ZBHA 4RW6A 4W5RA 2HHQA 4C1NK 4CJLA 2KZMA 1NK8A 4BVPA 3MEEA 3ZSYA 5FLXO 1YJWN 4CI6A 4FJMA 3ZETB 2HNDA 3TAPA 1NG9A 4BG9A 4B1WB 4YORA 4U7BA 3MX2A 3F2KA 1EX4A 5KTQA 3BDPA 4XH5A 5B8HA 1RTIA 2XY8A 2JWLA 2E6MA 4CJSA 4CIGA 1HJRA 1RDCA 1ZBSA 3GBTA 5KPZA 4E7HA 1GLDG 4OJRA 3VQCA 1VQPN 2CGJA 5KRTA 1XNRK 3HOSA 4WYBA 3V9WA 4YOWA 2P5OA 1T3VA 3KLGA 3V1QA 4M3XA 5FDLA 2QK9A 3AO5A 4DTSA 1EXQA 1LWEA 4K0KK 2QTDA 4JKGA 4FYDA 2QW9A 5J1EA 2RHKA 3PSFA 1YUWA 4YDUC 2QM1A 4JK7A 3OYNA 4JS4A 4KRFA 3R9PA 3UKUB 1IBLK 3GOIA 5EX5A 1FKOA 4KFBA 1GOCA 4OGEA 1BI4B 1JLEA 4BE1A 1QHTA 1HNVA 3AA5X 1ATSA 5EU7A 1S22A 1KLNA 2OZSA 2GBZA 1QSYA 3NF6A 4CHPA 3P1GA 3SQ4A 3TABA 3O9TA 3VQEA 4B3TK 1GLFO 1S6QA 2BUPA 1WLJA 1JLAA 3O3FA 3DLBA 4N76A 4J2EA 1D9DA 4AH9A 3HVRA 2F8TA 1CLQA 3NF9A 1TYQA 4CGGA 1V4SA 3THWA 1NGJA 1BU6O 3TTCA 1QQMA 3BP8A 4B9VA 3G25A 2OPQA 3CCLN 3QETA 1XI1A 5M1PA 4DSKA 1LAVA 1QE1A 2W6LA 4XH4A 3W3DA 4OPJA 2YV0X 1C6VA 4BWJA 3ZLJA 4KB0A 1ZYQA 1M90O 3M8PA 1RDUA 3VQPA 2HHUA 3S9HA 1HPZA 4JI2K 3T19A 3TTDA 2IVPA 4KB1A 1GOBA 3CCJN 1LV5A 4G9ZA 4PKGA 2UXBK 3KKSA 4C8KA 1QVGM 5JLFA 3H3NO 3OYJA 4GVEA 3VF6A 4DV4K 3TWHA 3TAEA 1MA9B 2NLXA 2ITGA 2DTUA 1NJZA 3FZKA 2O8CB 4HWIA 4M41A 2HBJA 3E9OA 1VQ8N 2FBXA 2HHSA 1NK4A 3Q7BA 3PUFA 3KWGA 5T7BA 1KAYA 3ZEUB 5HRRA 4F2SA 1S9GA 1U45A 5KQ8A 2A6AA 1FW6A 1HKCA 1JLQA 4CJFA 4JHDA 3MN5A 3C6AA 4DTXA 4H0VB 5F0XA 1OH6A 4RW4A 4H5RA 3F73A 3K58A 1W97L 4J2AA 2GUIA 3H1QA 4KHSA 2QKKA 1Z25A 2ZQBA 4DR6K 4FWNA 4YOYA 1TVRA 3D2FA 3NGYA 4FOIA 1RT5A 3CCUN 4PL7A 4CHYA 5HP1A 2I7NA 4ID5A 1MU2A 4EIAA 4CBWA 4A5BA 5AQYA 3VQ9A 3ZSWA 2DY4A 1WBBA 5D3GA 3NF8A 1TAQA 3K2PA 1KSPA 4N41A 3RR8A 1VSKA 3SAHA 4FLTA 1IG9A 1DLOA 4XEIA 3LL3A 4BVOA 3MCAB 3ENOA 1W9HA 1VSFA 1FK9A 3H6EA 3V9SA 4WQ5C 1NOYA 4CK3A 3CMAN 4LSNA 1JLFA 3EEQA 1NGGA 4LSLA 4IJAA 1RBUA 2KTQA 1S1XA 3LDNA 1OH7A 4BE0A 1BCOA 1C1AA 3WXMB 3VA3A 4LH5A 4E7JA 3AVMA 3NE6A 3DXMA 2DFHA 4K8XA 4CZEA 1SUQA 3NH0A 3NDKA 3QDKA 2FLOA 3L2QA 4LFCK 3AY9A 4JLHA 3PSIA 2GEMA 4DQSA 3O5BA 3L6QA 4UQGA 4KHPK 4X62K 4BG8A 3ZETA 2UXCK 4H4MA 5LL6Z 4N47A 3WT0A 4CK2A 5LY3A 4J2DA 1YJNN 4HHTA 4PA1A 4JEPA 3SAFA 3D6RA 2P9NB 4Y1CA 3HP6A 3BZKA 2JWKA 3ZSRA 1KAZA 2UYTA 3KIOA 5BRHA 1TKZA 1DGKN 3IFRA 1TV6A 1HNIA 1BO5O 4M7XA 3K9KA 2IVOA 4E1MA 4M3UA 2HBMA 2P9LA 4FWLA 3FR0A 4A61A 3TAMA 1SL0A 2E88A 4A57A 4KO0A 1T6DA 1EWQA 4ID1A 4C8NA 3Q7CA 3OBWA 4NO7A 2IOCA 1QQNA 1BQNA 4LH4A 4DQ8A 1T8EA 4DSEA 3LP3A 5JS1A 5ELZA 4O0IA 3SUPA 5BN9A 3J81O 3JXUA 3OYCA 4CEAA 3OYGA 3C0BA 2IC3A 1HQEA 4KTWA 3SPYA 4CEEA 2B4JA 2NZTA 1P90A 1QS4A 4O44A 4CBXA 3VQ6A 5BRFA 5JICA 2KFNA 2NUBA 3R8EA 1OVYA 2Q97A 4FLYA 1WUAA 2HSTA 3QEVA 2Q0UA 4WE1A 3AVKA 4B9NA 4FWMA 1VHXA 2QWRA 3TPQA 5I42A 4F3OA 3MAQA 3K57A 3TAQA 1XC3A 2E2NA 1KVAA 4MO4A 1RGIA 3MWTA 4X65K 5AJ3K 4I6MB 3KK3A 3OJSA 3EKSA 3HPOA 5FPMA 4A59A 3VGLA 3FGUA 1XC9A 2QXLA 3K5MA 4DU3A 1S1TA 3AGKA 4CFDA 1I3AA 2JLEA 3R1XA 1KFDA 1JLBA 2ETJA 2A40A 3O3GA 4RW9A 4EP5A 4Z4EA 4JI1K 5GAGP 3QICA 2WOMA 2UUAK 2D0PA 4KTQA 4CGHA 4LY7A 3CJ9A 3ZSVA 2YHBA 3E66A 3ZX3A 3SUNA 3U9ZA 3LDLA 3EO3A 3U8XA 3VEWA 5E41A 3SUQA 4E89A 3OYBA 3O3HA 4B1UB 4OLAA 2G8KA 2KQ2A 1HRHA 2OPRA 4BRQA 1NGDA 2FSJA 4DR2K 4X66K 3ID8A 5LJVA 3A2FA 4DMNA 2P1JA 3C65A 1QQCA 4MDAA 1NOZA 2Q0RA 1RTJA 4FCYA 1D5AA 4BGBA 5BN8A 5FRNA 3VGMA 3ALYA 2UUCK 4CESA 5TKYA 2FXUA 3ZEUA 4JK9A 4CZMA 4IZ9A 5KPTA 2HHTA 2IS3A 4MQ3A 3ZT2A 3HPGA 3KLIA 1U48A 1WSGA 4DR7K 2Q2RA 4IXCA 1C0MA 4BRNA 3VQAA 2X74A 3O8MA 3DRPA 5AQKA 3ZX2A 2ASOA 3VF2A 3CJ1A 2Z1JA 1HR0K 3NH1A 1KFSA 3ATUA 4CHZA 1TL3A 4J2BA 4FJIA 3AO3A 4Z0UA 3UB5A 2RN2A 5CHIA 2YHAA 4M7YA 4DF8A 4F8RA 4FM1A 3P4IA 2G8IA 1OH8A 3SYZA 3CG7A 4IOAL 4Q5VA 1NGIA 1P8ZA 3DJCA 1NKCA 3IKMA 2J4RA 4ISEA 3AA3A 1IV0A 4YFUA 1NJYA 1TYQB 5CE3A 4DR3K 1XNQK 1Q86O 3VF4A 3THWB 3LP1A 1NK0A 3CERA 4OX9K 1C0FA 5JLHA 3FZMA 1S1VA 1YT3A 1QSLA 3MXIA 4YOXA 3HO1A 1VSIA 3BGRA 2HHVA 2WTUA 2HNZA 5AQVA 3F5TA 4EHUA 3T1HK 1Q7YO 4YY3K 4RW7A 3KD1E 1JXBA 4B3SK 3SI6A 4WFBL 3VQ8A 4DWIA 3QB0A 1NGBA 2O8DB 4JD2A 2XY7A 3G0ZA 3ZT4A 3SBGA 1TKDA 2ZGYA 1YI2N 4KI6A 4M3ZA 3H3OB 1N33K 1NM1A 3QESA 3UKRB 5C24A 3LWMA 3QLHA 2X6NA 4FJ8A 3CYMA 2YHYA 1BDGA 1HX1A 3TR8A 1RCHA 2ZE2A 2ZD1A 1K6YA 3BF1A 3ULDA 2P9NA 5M1OA 1YITN 4AHSA 4E3SA 4BY9C 1ILYA 4KHWA 3C6HA 3L3VA 3CPWM 2BANA 2QWLA 3VEVA 3HP9A 4CGJA 3LWLA 1LW0A 3O08A 2F4VK 2E6LA 1VQKN 2NRZA 2E2OA 4AQYK 4OPHA 4W5TA 1NKBA 3IAYA 5CYMA 2I7PA 2QWMA 2PFUA 3KLFA 1IKVA 4DFMA 4FJGA 3DOKA 4DFPA 3PX0A 3PIPL 1RT1A 3CJAA 4WFAL 2DFEA 2QEXN 2HBLA 2HHXA 4NXMK 1SV5A 4M63C 3SAGA 4DG1A 2P9PB 4HCBA 3J7AP 1W7AA 4GV3A 1VQNN 1KXPA 1DEJA 2P5GA 4ZTFA 3WXJA 1BA0A 4FJLA 3TSUA 4H4OA 3HBTA 2BDPA 4KHNA 3IDHA 2Q36A 2YX6A 4KREA 2XRIA 3M3ZA 3SQ0A 3WNFA 2YI1A 4ILGB 3HXMA 1IKWA 1K9MO 1X9SA 3CF5L 4GV9A 2ZJPL 3N4PA 1BGXT 3K0SA 3EN9A 1NGCA 4YNQA 1HKBA 1JL1A 4JRQA 1KTQA 3A5NC 2IDOA 4GKKK 3KHYA 3MECA 4IEIA 3DXMB 1KD1O 3AVJA 4CF0A 2A3ZA 1J9AA 1JCEA 2B6AA 5KI6A 2BTFA 3CETA 3F9KA 5HOOA 3QBXA 2V7ZA 2QWPA 4CFCA 5TKWA 4I6MA 1QQOA 3ZCMA 5AQSA 3SV3A 3DMJA 3LM9A 5AZJB 4HUFA 3WXKA 1RDAA 5FPDA 1I39A 1NGAA 1DTTA 5LJWA 1RBTA 4KTZA 3TAFA 1NJIO 1WN7A 4IFYA 4WQ4C 2CGLA 5JMVA 3L4IA 2X78A 3J7YP 4IO8A 1VAZA 3JYTA 1A5VA 3DLKA 2YNGA 1S1UA 4BR2A 2QWQA 3K5NA 3K5OA 4Z4GA 2O4IA 3CC2N 4XIUA 3VN5A 1SKWA 3CJBA 4DTOA 2KKZA 3P38A 3NBPA 1N36K 2P9LB 3TSPA 1VQLN 4W5OA 4CF1A 4Z4CA 1S1WA 1BG3A 1IBMK 5CYQA 4E19A 2NRTA 1O13A 2VGNA 4F3TA 2YHXA 3LP0A 4NYFA 3K59A 4JNEA 1HMVA 3MXJA 4H5TA 1L5UA 1X9WA 5ADXH 1MWKA 4B3RK 2KW4A 3MK6A 4CHOA 1LWCA 4M42A 2QKBA 3CXCM 4FWQA 4MLHA 4GMJB 2WC9A 2F96A 4CCHA 3THYB 4DB3A 1KAXA 1RT4A 2W40A 4PKIA 4M3RA 5BR8K 1N8RO 2VGMA 1T03A 3SPZA 1BIUA 4H0TB 1A5XA 4IBNA 4DQQA 4JKEA 4BC5A 1ASUA 1QZ6A 3A5MC 4IJNA 3U4LA 4A5AA 3QEPA 3H08A 3CCEN 5AQPA 4O5BA 3D0PA 3LP2A 3CIPA 1U04A 4DQRA 5JS2A 5AQJA 5CZ2A 1NBWA 4DLEA 1NJXA 4NYNA 4TSXA 1BQMA 5M1QA 4N5SA 4ELUA 1NK5A 1NGEA 2XY6A 3OYIA 1NJWA 4O8UA 1X3NA 1SQKA 3HT3A 4LD0A 3KLHA 5AQFA 4HCCA 2FC0A 3LZJA 3SLCA 4KHYA 3OYKA 4HTUA 3L2RA 3DM2A 5AQRA 1TGOA 4DCHA 4B9MA 1YVNA 4E7IA 3TARA 1XQSC 2OANA 2Y1IA 4CEZA 4M3WA 2GWJA 2F9WA 3AV9A 2HMPA 4ILHA 5GADP 1GLBG 2D0AA 1HYVA 3LAMA 2KZZA 2O8DA 1WSFA 3TU5A 3VQ4A 2CGKA 4OKEA 4FLUA 4L8RB 3NF7A 3ZSZA 1C1BA 3M1FA 4FJXA 1WAJA 5AQXA 3UKRA 3L0QA 1ZBFA 3KK2A 1OVQA 3WQUA 2VWBA 3RMDA 4RCHA 2VWJA 3MWPA 2BGGA 4CZLA 2A42A 5C12A 1NK9A 1NK6A 2YJEA 4FJ7A 3CMEN 1BL3A 1X1PA 5HLFA 3DYAA 1NKEA 4CJKA 4DUYK 2A5XA 2RE2A 2XO7A 1YTUA 1MWMA 4BRPA 5ADXA 3DI6A 3AGRA 3NHGA 3VQQA 3QMLA 2QA4N 2GV9A 3GG4A 3PLAA 1RTDA 2Z1HA 5J2NA 3O9RA 1NU0A 4H0PA 3E01A 1YIJN 3NVKA 4DTMA 4JI6K 4C1NI 4WF9L 3FZFA 4CJ5A 4BRKA 2E2QA 2QXFA 1OH5A 4FJKA 4FPAA 3K5LA 2O8FB 4Z4FA 1TKTA 3V9UA 5J2QA 4KPYA 3ENBA 2P9PA 1UOCA 4FJJA 1RNHA 4JI8K 5M1KA 3I0RA 3BUZB 3OA9A 3MX5A 3T7ZA 3SV4A 4QS8A 3HL8A 1RFQA 4K41A 4FWKA 3G4SN 2ZF5O 3UIQA 4CGDA 1MDUB 1RDWX 1U2VA 1VSEA 4CECA 4F9OA 3DAWA 4Z4HA 4NB4A 3QEWA 3SQ1A 4PL8A 4GV6A 3FFKB 4FK0A 4KV8A 4MLEA 2ASMA 5BPNA 4FW1A 4CEFA 1QTMA 1S3XA 4JI4K 2FSKA 4CE9A 1BISA 4CF8A 3WUHA 4JD2B 3V6DA 3AVHA 3CQYA 5AZJA 3O1BA 4PQUA 1NNEA 4CEBA 1KQSM 3SMSA 1A5WA 2HBKA 3EZ5A 3WXLA 3FZHA 2WBNA 3KTQA 1L3TA 4LFAK 2ITMA 4FWSA 2HB5A 4BR5A 4CZJA 4CJPA 4U67L 4DTUA 4K25A 4O5FA 4CZFA 4JRPA 1SAZA 4HTLA 4H0YB 4B08A 3O80A 3WQTA 4CZHA 2P51A 3OYEA 1FJGK 1UWBA 3L2WA 4DS4A 4PWDA 2VQEK 2A1SA 1TL1A 4JI0K 5HRNA 1YAGA 3OYMA 1JJ2M 3TSQA 4RG8A 4IKFA 4EZ6A 1WNSA 3E1YA 4E1JA 2VG5A 2ASPA 1Y64A 4F4KA 1JLCA 5C15A 3KLEA 1ITGA 3UE5A 4CJVA 4CFBA 3L4QA 1WB9A 4RW8A 4CERA 1IKXA 2VCPA 4K8ZA 1S6PA 3NH2A 4CJWA 1K8AO 3RVCA 1B92A 4DTPA 3ISNC 2A41A 1Q9YA 5AFUA 2B5JA 3THYA 5DK5A 3SQ2A 1DTQA 3P31A 1ATRA 1HKGA 4CZIA 1JCGA 2V51B 3LDQA 2VWKA 2HVHA 3VERA 4MFBA 1B9FA 4CJEA 2PYJA 5AQQA 3QNOA 3NCIA 4FPBA 5CR4A 2WFBA 2P9KA 3A5LC 2Y1JA 3OYDA 4F2RA 4K43A 4E0DA 4CK1A 1LW2A 3T1AA 3U3GA 4CJUA 1R0AA 2HHHK 2DPNA 2IIRA 5AR0A 4JKAA 4DV5K 4CEDA 1BWFO 3HOTA 4DKWA 3M5RA 1RDBA 3VPZA 1E3MA 4CJ3A 1REVA 4CJ7A 3JS6A 3TANA 5EXWA 4V19S 4CBUA 2ATQA 4KHUA 3VA0A 2QWOA 4BQZA 1RBSA 4PKHA 4CFAA 2KHOA 1Z26A 3OBYA 4JKDA 3DLGA 3V9ZA 2D4WA 4YOTA 1HYZA 1TKXA 3DWLA 1S72N 2OTJN 5EVZA 1N5YA 3SZ2A 3H1VX 3I8BA 4AILC 3O1WA 1ASVA 4ZHRA 3MCPA 3VEOA 4CEQA 4N56A 5DMRA 3DLLL 5AQWA 3DLEA 5F2RA 4CHNA 3VTIA 3G6EN 4CZGA 2ZWHA 3LANA 1JLGA 1NGFA 4QS7A 5E84A 3MN6A 4BRFA 3PO4A 3E9LA 4DR1K 3CFOA 4O55A 1FXXA 5KRSA 3ZSOA 4NCAA 4CF2A 4LF9K 4OKKA 1YF5L 3CJ7A 5AQNA 2KFZA 3TTFA 3NGIA 3I8DA 2CH5A 3KJVA 1VQ9N 3B8AX 1GOAA 4IEEA 5BPMA 3BEXA 3CC7N 4DR5K 4E1NA 2O8FA 2WUSA 3PX4A 2F9TA 2IAJA 4I9QA 1B9DA 4GW6A 2R7YA 2GUPA 4Y1DA 1V4TA 3MDQA 4LFBK 3CC4N 4W5QA 1RBVA 4DTRA 1D9FA 3U9DA 4MO5A 3ULEB 3OYHA 1TK0A 4B9QA 1H1VA 5CZ1A 3IG1A 4HVJA 3U3YA 1TK5A 2AP1A 1VQ4N 4BDYA 4FK4A 1X3MA 2F8SA 4EZ9A 4QCLA 3JAMO 3CCRN 3LAKA 3RTVA 4FLWA 3AVFA 3KK1A 4ELVA 1ATNA 2W42A 1X9JA 4CEOA 3LDSA 3AVLA 3VMFB 4LF6K 4ZTJA 4CIFA 5JVHL 4H8KA 1Z05A 2HW3A 4CGFA 5KQDA 1GLEG 1L3SA 4RTFD 5C10A 5MLCQ 4GKJK 4JI7K 4C8MA 4CIEA 2D1KA 1VQ5N 3T69A 2O8BB 3CCVN 3AVIA 4AHTA 2RKIA 2D0CA 2P9IB 3ZT3A 4EFHA 4RWTA 3CFPA 3C94A 5HRPA 1NGHA 3SJHA 3CI5A 5K14A 5C2FA 4J8FA 4JN4A 4FLZA 3HPHA 4O4GA 4NLBA 2W41A 4X64K 3THXB 1J5EK 3HTVA 5CY4A 3ZX0A 1M1KO 4ISGA 1W2BM 2Q31A 3AVAA 3N4QA 1HJOA 2QWNA 3P39A 3KVGA 1T05A 4CZKA 4BC2A 2NRRA 1HUXA 4O8KA 3VESA 5JVGL 4DR4K 1Q82O 5AQLA 5AQZA 2PY5A 1N32K 4B9SA 4C8OA 1JKHA 4BACA 3O6WA 3MEGA 5I3UA 3C6UA 2VQFK 3T1YK 3LALA 4DV2K 1ASWA 3QEXA 4JI5K 3A0IX 4BR4A 3KK7A 1VSHA 3V9XA 1KVBA 4M3TA 3MMVA 4YDUA 4DSLA 2XY5A 4FWRA 1T7PA 4YOUA 4B9UA 4KI4A 1C0GA 4DFJA 2G8HA 4NCGA 1U2VB 3OJUA 2VG6A 2QI2A 2OPPA 4L3QA 4DS5A 3LM2A 4QAGA 4B9LA 3O9QA 3I56N 3B6OA 3VQ7A 3EE9A 2YKNA 1WBDA 2BE2A 2GX9A 3ZT0A 1YHQN 2YKMA 1WSHA 2OYQA 3DRSA 1XMQK 4FL9A 2E1YA 1KCFA 2FBYA 4Q0BA 4DV0K 2HNYA 3VEYA 3SMPA 1TUYA 4B1ZA 2AA4A 4AHUA 1NK7A 4AHVA 3MN9A 1JL2A 4JI3K 1X9MA 1HNWK 3AARA 4C23A 1WSIA 2NRXA 1L3UA 3CCQN 3LPUA 3QBWA 4JKFA 3L8BA 4KH5A 2VYPA 3I0SA 3RSEB 1YVUA 4QS9A 4CJRA 3KWIA 1HLUA 4BR7A 4DSFA 4MDBA 2E20A 4FVMA 4B1VA 4FVUA 3VEXA 4DTNA 4I2PA 1BIZA 4FZYA 4Y0WA 4IDHA 3OYLA 5AZIA 1EO1A 1BUPA 1J6ZA 3D2EB 3VQBA 4LF5K 1DT9A 5AQTA 2YHWA 4CW7B 5AQGA 1XHXA 2RPIA 2E1ZA 1OKJA 1Y97A 2V7YA 3DXKB 4OPKA 4BDZA 4DU4A 3HSCA 4DSIA 2CH6A 3ZSXA 1E4GT 1E4FT 3IMXA 2VG7A 3E9PA 5I9EB 1VRUA 4BRCA 5GAEP 3OY9A 4CVNE 3A8YA 3AVGA 1EETA 4R79A 3OYFA 3QERA 4IOCL 2YNHA 2FSNA 4B1XB 3NFAA 1GLJO 3AO4A 2NRWA 2OA8A 3DOLA 3O4WA 3HSTB 4JAXA 4WCEL 4OVLA 5AQUA 4A2AA 2KLAA 3EY1A 3SCXA 1XUPO 3HM9A 1RTHA 4FJ9A 3ULEA 1HPMA 2P9KB 3M8RA 3CHWA 3J7ZO 2ZJQL 4FWOA 3H45C 1K8KB 4DSJA 4WQ5A 1QZ5A 2ZM6K 3SBTA 1N34K 3SUOA 3J80O 3M6GA 4B3MK 2O4GA 3VENA 3LZIA 1HNZK 4BROA 3BZCA 4FM0A 4H03B 4W5NA 4DTJA 4FSVA 4PY5A 3NMUA 4CJQA 4IG3A 3FFIA 2YNFA 1I94K 3D7EO 3PV8A 4DHYA 4R5PA 4DV3K 3OS1A 3S3NA 3W0LA 3EKUA 2HHWA 1U47A 2O8BA 3OTOK 3AA2A 4BRLA 1NMDA 4BRDA 3L2VA 4OGCA 5KPRA 3KD5E 2P9IA 4GY2B 2GTDA 1RILA 3WXIA 1VSDA 3CFRA 2V52B 3NGZA 2HOEA 1C1CA 4AM7A 3THXA 3S3MA 3P83D 3VOVA 4BR0A 1EP4A 5C42A 1BHLA 2PAVA 4DV1K 5J2PA 3FLCO 1U4BA 4FM2A 2G8WA 1F21A 4BRMA 3AAQA 1T44A 2UUBK 4IWVA 5H1SQ 5DM7L 3KKRA 1IO2A 2E4LA 3C7NB 5FROA 4CGIA 4IG0A 3F9MA 3SNNA 5AQMA 1W0HA 3WEEB 3RWUA 1IG8A 3VEZA 5HBMA 5AQOA 4EAHD 4IFVA 4I2QA 1ZC6A 5GINA 3RRGA 4E7KA 2W6KA 3MEDA 3DRRA 5AFUH 3VTHA 3DLHA 5C0YA 1FKPA 5FPNA 5DM6L 3R3LA 1KC8O 5F1XA 2PBDA 4FLXA 2ZGZA 4CF9A 1CZAN 4DU1A 1SL1A 4KHQA 1HYSA 2E2PA 2G8FA 1VRTA 1XHZA 2O8EB 3V1RA 4LF7K 1LCUA 2NNWA 4ISFA 4Z94A 3DLRA 4BRIA 4LF4K 3QFPA 3QFUA 4FXDA 4FZZA 1SS6A 1QSSA 3R6MA 5J2MA 4H0XB 1SKSA 1RBRA 1QVFM 3LDPA 3AVCA 3CM6A 4H5NA 2G8UA 4JKHA 4EP4A 4OKJA 1RT3A 2P9UA 2FF3B 4ICLA 2FBTA 4OPAA
chains in the Genus database with same CATH topology
3DWLA 1S72N 5GIOA 1D4XA 3PIPL 1JCFA 3CJAA 3O9TA 4WFAL 1GLFO 5EVZA 2OTJN 2QEXN 2BUPA 2HBLA 2NRVA 1GLLO 3H1VX 3I8BA 3O1WA 4M63C 3SAGA 3MCPA 1YXQA 3VEOA 4BQLA 3DLLL 2P9PB 5AQWA 5F2RA 4GV3A 1VQNN 1IJJA 1TYQA 3VTIA 3G6EN 1KXPA 1V4SA 1DEJA 1NGJA 2ZWHA 4CZGA 1BU6O 3WXJA 3CQXA 1BA0A 3TTCA 1QQMA 3BP8A 3RSEA 3TSUA 1NGFA 3G25A 4QS7A 3HBTA 5E84A 3IDHA 3MN6A 2Q36A 2YX6A 2Q1NA 4BRFA 3E9LA 3CCLN 3HZ6A 5M1PA 2F7TA 3M3ZA 4EHTA 4LC9B 2YI1A 4ILGB 4A62A 4XH4A 1YF5L 3CJ7A 3W3DA 5AQNA 3NVMA 1K9MO 3TTFA 3GL1A 3CF5L 4GV9A 2ZJPL 3N4PA 2CH5A 1VQ9N 3B8AX 3EN9A 1NGCA 1M90O 4IEEA 1RDUA 1HKBA 5BPMA 3BEXA 2HF3A 3CC7N 1Q81O 3A5NC 3EZWA 3TTDA 2IVPA 2WUSA 2F9TA 3D2EA 3KHYA 3CCJN 4K42A 4G9ZA 2GELA 4BC3A 4IEIA 3DXMB 2GUPA 1V4TA 4PKGA 1KD1O 3MDQA 1BA1A 3O9SA 2A3ZA 3CC4N 3FZLA 1K73O 1JCEA 2BTFA 3CETA 5HOOA 2BH1A 5JLFA 3H3NO 3U9DA 2H3GX 1QVGM 3DXKA 4GVEA 3QBXA 2V7ZA 3VF6A 2QWPA 4MO5A 5TKWA 2P9SB 4I6MA 1MA9B 3FE1A 3ULEB 4H0OA 1QQOA 4B9QA 1H1VA 2NLXA 5AQSA 3FZKA 2AP1A 3LM9A 4HWIA 5AZJB 3WXKA 2HF4A 1VQ4N 1TUUA 5FPDA 2HBJA 3E9OA 1X3MA 1VQ8N 3CCRN 1NGAA 3CPEA 3Q7BA 1WOQA 5LJWA 3KWGA 1NJIO 1ATNA 1GLAG 4WQ4C 1X9JA 5EOYA 1KAYA 3ZEUB 2CGLA 5JMVA 3ZYYX 3L4IA 4H5WA 3UKUA 3VMFB 4IO8A 1VAZA 5KQ8A 2A6AA 4BR2A 5JVHL 1Z05A 2YJFA 5KQDA 1GLEG 1HKCA 5BPLA 4RTFD 1VQMN 2QWQA 1VQON 4JHDA 3MN5A 5C10A 5MLCQ 3I55N 3C6AA 4H0VB 5F0XA 3O9UA 3CC2N 2D1KA 4H5RA 3CJBA 1W97L 1VQ5N 3T69A 2KKZA 3P38A 4AM6A 3CCVN 2P9LB 3TSPA 1VQLN 3H1QA 1K8KA 5AQIA 1BG3A 4FWNA 4YOYA 2ZJRL 2P9IB 3D2FA 4FOIA 4EFHA 4RWTA 3CCUN 4PL7A 4IFEA 2I7NA 2NRTA 1O13A 2VGNA 2YHXA 1NGHA 3SJHA 3CI5A 4CBWA 4EIAA 5C2FA 4A5BA 4JNEA 5AQYA 4OO1J 4J8FA 4H5TA 3CD6N 2EWSA 4JN4A 5ADXH 1MWKA 4KBOA 4JK8A 3MK6A 2W41A 4NLBA 3HTVA 3CXCM 3ZX0A 1Q18A 1M1KO 4FWQA 4ISGA 2Q31A 4MLHA 1W2BM 4FWPA 3SAHA 3N4QA 1YJ9N 2WC9A 1HJOA 2QWNA 3P39A 3KVGA 4BGAA 4XEIA 3LL3A 3VGKA 3MCAB 4BC2A 3ENOA 4BVOA 4CZKA 4DB3A 1KAXA 2W40A 4BR9A 5BR9A 2NRRA 4PKIA 3KZBA 1HUXA 3H6EA 4O8KA 1N8RO 1SZ2A 2VGMA 4WQ5C 3VESA 4BRGA 5JVGL 1Q82O 5E26A 5AQLA 5AQZA 4WFNL 3CMAN 4H0TB 1NWKA 1NGGA 4IJAA 4JKEA 4BC5A 3LDNA 3O6WA 3WXMB 1QZ6A 3A5MC 3U4LA 4IJNA 4A5AA 3EE8A 5C2DA 1ZXOA 3CCEN 5AQPA 4KH6A 5AZIB 4FOEA 3CIPA 3DXMA 3GDQA 3A0IX 4BR4A 5GIPA 3KK7A 4A2BA 4CZEA 5AQJA 5M1NA 3QDKA 1NBWA 3MMVA 5M1FA 4YDUA 3LDOA 3S41A 2FLOA 4XH1A 4JKCA 5M1QA 4FWRA 4YOUA 3VETA 1C0GA 3AY9A 2GEMA 4PHTX 3O5BA 3L6QA 1NGEA 4BG8A 3BF3A 3IUCA 4O8UA 1X3NA 3ZETA 1SQKA 1U2VB 5GAHP 3WT0A 2QI2A 3HRGA 5LY3A 4JKGB 4L3QA 5AQFA 1NLVA 1YJNN 3SLCA 3LM2A 4JEPA 3SAFA 3CJCA 3D6RA 2P9NB 5AQRA 3O9QA 4DCHA 1YVNA 3ID6A 3I56N 1XQSC 3C7NA 2OANA 2JWKA 3EE9A 2GWJA 2F9WA 5FPEA 4CD3A 2HMPA 2GX9A 4ILHA 1GLBG 3WEEA 1KAZA 5GADP 1VQ7N 2UYTA 1YHQN 3CCSN 5BRHA 3TU5A 1DGKN 3IFRA 3ATVA 2CGKA 1BO5O 4M7XA 3K9KA 3M1FA 4FL9A 2E1YA 2IVOA 5AQXA 3UKRA 2HBMA 2P9LA 3L0QA 3WQUA 2VWBA 4FWLA 4BRHA 4RCHA 3FR0A 4A61A 4JKBA 2E88A 3MWPA 4A57A 4CZLA 3VEYA 2A42A 1T6DA 3SMPA 5C12A 1TUYA 3Q7CA 4B1ZA 2AA4A 2YJEA 3OBWA 4NO7A 1QQNA 3MN9A 4DQ8A 3CMEN 5ELZA 3SK3A 5BN9A 3AARA 2A5XA 4C23A 2NRXA 3JXUA 3CCQN 2RE2A 3QBWA 4JKFA 3C0BA 1MWMA 4BRPA 4KH5A 2VYPA 5ADXA 3RSEB 3AGRA 4QS9A 3KWIA 3AAPA 1HLUA 4BR7A 2E8AA 2NRHA 3QMLA 2NZTA 1P90A 3J8AA 2QA4N 3GG4A 4CBXA 4MDBA 5BRFA 3PLAA 5JICA 2E20A 4B1VA 3O9RA 4FVUA 3R8EA 1OVYA 4H0PA 3VEXA 2Q97A 1YIJN 3NVKA 1WUAA 2HSTA 4C1NI 4WF9L 3FZFA 4Y0WA 2Q0UA 4BRKA 2E2QA 4IDHA 1GLCG 4FPAA 1QHAA 5AZIA 3GE1A 1EO1A 1BUPA 1LOTB 1J6ZA 3D2EB 3ENBA 4FWMA 1DT9A 2P9PA 2QWRA 2YHWA 5AQTA 4FO0A 3TPQA 5AQGA 4YOVA 3OW2M 2E1ZA 1OKJA 5M1KA 4WQ4A 3BUZB 3OA9A 2V7YA 3MX5A 3DXKB 3T7ZA 1XC3A 2E2NA 4MO4A 4QS8A 1RGIA 3MWTA 4I6MB 3HSCA 1RFQA 2CH6A 4K41A 4FWKA 2IVNA 1VQ6N 3EKSA 3G4SN 2ZF5O 5FPMA 1U6ZA 4A59A 3VGLA 1MDUB 1E4GT 1E4FT 3FGUA 3IMXA 2QXLA 1RDWX 1U2VA 4AF1A 3AGKA 2GWKA 5BREA 3R1XA 4B1YB 2A40A 3E9PA 5I9EB 4BRCA 5GAEP 5GAGP 4F9OA 3DAWA 3QICA 4GNIA 4CD1A 2D0PA 3A8YA 4NB4A 4R79A 4BRAA 3CJ9A 4IOCL 4PL8A 4GV6A 2FSNA 3E66A 3FFKB 2YCHA 4B1XB 4MLEA 3ZX3A 5BRDA 3LDLA 1GLJO 2ASMA 3U9ZA 2NRWA 5BPNA 1T6CA 3O4WA 1S3XA 3EO3A 3MN7A 3U8XA 3VEWA 4JAXA 4WCEL 3ENHA 3HM8A 2FSKA 5AQUA 3I33A 2KLAA 3K9JA 4A2AA 3PIOL 3H46O 1XUPO 3WUHA 2D0OA 4JD2B 4JHDB 4B1UB 1R59O 1BOTO 2P9SA 3ULEA 1HPMA 2P9KB 3EL2A 3CHWA 4BRQA 4UY8O 3CQYA 3J7ZO 2ZJQL 4FWOA 1NGDA 3O1BA 5AZJA 2FSJA 5HL7L 2FF6A 1ESVA 1K8KB 3H45C 3ID8A 3SMSA 5LJVA 1KQSM 3C65A 2HBKA 1EQYA 4WQ5A 1QZ5A 4MDAA 3D2FB 2Q0RA 3A5OC 3SBTA 4BGBA 3CCMN 5BN8A 3VGMA 4ILJA 1DKGD 3FZHA 3WXLA 3M6GA 2WBNA 5TKYA 2FXUA 3VENA 3ZEUA 3OHRA 4IOXA 4JK9A 2ITMA 4NLCA 4BROA 4CZMA 4FWSA 4IZ9A 5KPTA 4H03B 4BR5A 4CZJA 4U67L 4FSVA 4K25A 4O5FA 4CZFA 3NMUA 1SAZA 3G71N 4HTLA 2Q2RA 4IXCA 4H0YB 4BRNA 3O80A 3D7EO 3WQTA 4CZHA 4BC4A 2P9UB 3O8MA 5AQHA 5AQKA 4DHYA 3ZX2A 2OTLN 2ASOA 3VF2A 3CJ1A 3HI0A 3W0LA 1Z6RA 3EKUA 1YAGA 4H5VA 1JJ2M 3ATUA 3TSQA 4BRLA 1NMDA 4BRDA 5KPRA 3UB5A 5CHIA 3E1YA 4M7YA 5EY4A 4E1JA 2P9IA 1G99A 1Y64A 2ASPA 3P4IA 4GY2B 4KH4A 4IOAL 4BREA 5C15A 4IO9L 2GTDA 3UE5A 1NGIA 3WXIA 1P8ZA 3DJCA 3IKMA 2V52B 2J4RA 3L4QA 2HOEA 4ISEA 1TYQB 4AM7A 2VCPA 4C1NK 5CE3A 1YITN 1Q86O 3VF4A 3CERA 1K8AO 1C0FA 3RVCA 3VOVA 4BR0A 4BVPA 2A41A 5JLHA 1YJWN 2PAVA 3FZMA 5AFUA 4CI6A 3FLCO 3ZETB 4YOXA 3P31A 4BRMA 3AAQA 1T44A 4BG9A 1ATRA 1HKGA 4CZIA 5AQVA 3F5TA 4B1WB 4IWVA 4YORA 1JCGA 4EHUA 3MX2A 3F2KA 5DM7L 5H1SQ 4U7BA 2V51B 1Q7YO 3LDQA 4XH5A 5B8HA 2JWLA 3VERA 3C7NB 4WFBL 3F9MA 3QB0A 1ZBSA 5AQMA 3GBTA 5AQQA 3WEEB 1NGBA 5KPZA 4JD2A 1IG8A 3VEZA 4FPBA 5AQOA 3SBGA 1GLDG 4EAHD 5CR4A 1ZC6A 2P9KA 2WFBA 3A5LC 1VQPN 5GINA 2ZGYA 2CGJA 1YI2N 3H3OB 1NM1A 3VTHA 5AFUH 5C0YA 5FPNA 5DM6L 3R3LA 3UKRB 4WYBA 3HOSA 1KC8O 5F1XA 4YOWA 2PBDA 1T3VA 2ZGZA 2YHYA 1CZAN 1BDGA 1HX1A 4K43A 2QTDA 4JKGA 2E2PA 2QW9A 3BF1A 2RHKA 1LCUA 2DPNA 2IIRA 2NNWA 4ISFA 5AR0A 4JKAA 4BRIA 2P9NA 4Z94A 1BWFO 3QFPA 1YUWA 3QFUA 4YDUC 1SS6A 2QM1A 5M1OA 3R6MA 3M5RA 4DKWA 3HOTA 4JK7A 4H0XB 3VPZA 4BY9C 1ILYA 3C6HA 3CPWM 4CJ7A 3JS6A 3R9PA 5EXWA 3UKUB 2QWLA 1QVFM 3GOIA 3VEVA 4CBUA 5EX5A 3LDPA 3O08A 4H5NA 1VQKN 2NRZA 4JKHA 2E2OA 2QWOA 4OPHA 4BQZA 4PKHA 2P9UA 2FF3B 2KHOA 2I7PA 1ATSA 2QWMA 1S22A 3OBYA 4JKDA 2PFUA 2D4WA 4YOTA 4OPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHK A;  3O9T A;  3RVC A;  3EE8 A;  3KWI A;  3M5R A;  3OA9 A;  3P31 A;  3O9U A;  3D6R A;  3O9Q A;  3O9R A;  3P39 A;  4OPH A;  3F5T A;  2KKZ A;  3P38 A;  3EE9 A;  3KWG A;  3O9S A;  2GX9 A;  3L4Q A;  4OPA A; 
#chains in the Genus database with same CATH topology
 1RT7 A;  5GIO A;  1D4X A;  4CJ4 A;  1JCF A;  2NRV A;  1GLL O;  4FJ5 A;  1YXQ A;  4BQL A;  3PX6 A;  3QEI A;  3O4N A;  1IJJ A;  5KGW A;  3D45 A;  3ITH A;  3CQX A;  3HVT A;  3RSE A;  3JSM A;  3RMC A;  2I5J A;  3OS0 A;  3WNE A;  1VK0 A;  2Q1N A;  4B8A B;  3HZ6 A;  2F7T A;  2OZM A;  4EHT A;  4LC9 B;  5KGX A;  4A62 A;  3HK2 A;  2AJQ A;  2Q3S A;  3NVM A;  3GL1 A;  3OVN A;  4E7L A;  3V1O A;  3L2U A;  1KVC A;  4LF8 K;  2HF3 A;  3WNG A;  3C95 A;  3IS9 A;  1Q81 O;  3EZW A;  3D2E A;  4K42 A;  2LSN A;  3V81 A;  2GEL A;  4BC3 A;  3VQD A;  3V4I A;  1ZBI A;  2EHG A;  1BA1 A;  3O9S A;  3FZL A;  1K73 O;  2BH1 A;  2H3G X;  3DXK A;  5SWM A;  4I9L A;  1EKE A;  1RT6 A;  2P9S B;  3FE1 A;  1J53 A;  4H0O A;  1S9E A;  5LMN K;  1EWR A;  3M8S A;  2HF4 A;  3PO5 A;  1TUU A;  4M3Y A;  4DQI A;  1IKY A;  3QIN A;  3CQ8 A;  3RMB A;  3CPE A;  2XHB A;  2G8V A;  2PYL A;  1Q8I A;  3OS2 A;  1WOQ A;  1GLA G;  5EOY A;  3AO2 A;  3ZYY X;  1KLM A;  4H5W A;  5HRO A;  3UKU A;  1G15 A;  1BCM A;  1VSL A;  1WSJ A;  2YJF A;  3MXM A;  1BI4 A;  4DF4 A;  5BPL A;  1VQM N;  1VQO N;  4NXN K;  3I55 N;  3O9U A;  1RDD A;  2IGI A;  4ELT A;  4AM6 A;  4I7F A;  1K8K A;  5AQI A;  2ZJR L;  3ASM A;  3QO9 A;  4IFE A;  2HMI A;  3TAG A;  3G10 A;  4OO1 J;  3CD6 N;  2EWS A;  4KBO A;  4JK8 A;  4FZX C;  1Q18 A;  3LPT A;  4FWP A;  1YJ9 N;  1XWL A;  3AA4 A;  4OLB A;  4BGA A;  3VGK A;  5BR9 A;  3C6T A;  4BR9 A;  1KRP A;  3KZB A;  3B6P A;  1SZ2 A;  4BRG A;  5E26 A;  4WFN L;  2PZS A;  1NWK A;  2OPS A;  2Z1I A;  1VSJ A;  1JXE A;  3EE8 A;  5C2D A;  1C0U A;  1ZXO A;  1TK8 A;  2E5L K;  4KH6 A;  5AZI B;  4FOE A;  3GDQ A;  5GIP A;  4AHC A;  4A2B A;  5M1N A;  2EX3 A;  5M1F A;  1RT2 A;  4HUG A;  3LDO A;  3S41 A;  2A1R A;  4XH1 A;  4JKC A;  2D0B A;  3BY5 A;  3VET A;  4PHT X;  4FJN A;  2O8C A;  3BF3 A;  3IUC A;  5GAH P;  4DUZ K;  3RR7 A;  3O4Q A;  3HRG A;  3HJF A;  4IDK A;  4JKG B;  1NLV A;  5LMU K;  3PY8 A;  1J54 A;  4JS5 A;  3CJC A;  3ID6 A;  4BE2 A;  5IT9 O;  3C7N A;  3WNH A;  4C8L A;  3NAE A;  1IH7 A;  5FPE A;  4CD3 A;  1VQ7 N;  4JYA K;  3WEE A;  1YTA A;  1XMO K;  3CCS N;  3THV A;  3RRH A;  3P5J A;  3ATV A;  4JV5 K;  3ZSQ A;  2FBV A;  4FW2 A;  3AO1 A;  4BRH A;  4DQP A;  1D8Y A;  1VSM A;  3T3F A;  4JKB A;  3OYA A;  3ZT1 A;  4AHR A;  3AVB A;  2O8E A;  3VQ5 A;  4G1Q A;  2X6S A;  4FLV A;  3SK3 A;  2YNI A;  4BDP A;  2OCE A;  3QIP A;  5FRM A;  1CZB A;  2DFF A;  4NCB A;  2Z1G A;  1IBK K;  3AAP A;  2E8A A;  2NRH A;  4B3O A;  3J8A A;  1SL2 A;  3TI0 A;  1NMN A;  1LAW A;  4CJT A;  4B8C A;  1SKR A;  3QNN A;  1HNX K;  3S3O A;  4KKO A;  4GVM A;  1GLC G;  1QHA A;  1Q9X A;  1CXQ A;  3GE1 A;  4CHQ A;  1LOT B;  1TAU A;  5HRS A;  1CZ9 A;  4HUE A;  3AVN A;  4FK2 A;  4FO0 A;  2RF2 A;  4YOV A;  3OW2 M;  4WQ4 A;  3HYF A;  1UA0 A;  1VQ6 N;  2IVN A;  1CXU A;  3EYZ A;  1U6Z A;  1S5J A;  4AF1 A;  2GWK A;  5BRE A;  4B1Y B;  3SJJ A;  1N6Q A;  1UAX A;  4CD1 A;  4GNI A;  4B9T A;  4BWM A;  1O1W A;  4BRA A;  2JGU A;  2YCH A;  5BRD A;  1T6C A;  3MN7 A;  3ENH A;  1ZBU A;  3CM5 A;  3HM8 A;  3I33 A;  3K9J A;  3PIO L;  3H46 O;  2D0O A;  4M45 A;  4JHD B;  1U49 A;  1R59 O;  1BOT O;  2P9S A;  2D5R A;  3EL2 A;  4DV7 K;  4UY8 O;  1WSE A;  4Z4I A;  2UXD K;  5HL7 L;  2FF6 A;  4QOZ B;  1LWF A;  1ESV A;  3IRX A;  1EQY A;  3L3U A;  5C25 A;  3D2F B;  2HVI A;  3A5O C;  4PUO A;  3CCM N;  4ILJ A;  1DKG D;  1HQU A;  3OHR A;  4IOX A;  2WON A;  4NLC A;  1C0T A;  3U6F A;  4DV6 K;  4DLG A;  5IWA K;  3G71 N;  3QIO A;  4BC4 A;  4YHH K;  2P9U B;  5AQH A;  4FJH A;  2OTL N;  3M8Q A;  3HI0 A;  1Z6R A;  4H5V A;  1ZBL A;  1L3V A;  4DFK A;  4O0J A;  2UU9 K;  5EY4 A;  1J5O A;  1G99 A;  4KH4 A;  4BRE A;  4IO9 L;  1WAF A;  5A2Q O;  5SZT A;  3RMA A;  1UA1 A;  4KAZ A;  1ZBH A;  4RW6 A;  4W5R A;  2HHQ A;  4C1N K;  4CJL A;  2KZM A;  1NK8 A;  4BVP A;  3MEE A;  3ZSY A;  5FLX O;  1YJW N;  4CI6 A;  4FJM A;  3ZET B;  2HND A;  3TAP A;  1NG9 A;  4BG9 A;  4B1W B;  4YOR A;  4U7B A;  3MX2 A;  3F2K A;  1EX4 A;  5KTQ A;  3BDP A;  4XH5 A;  5B8H A;  1RTI A;  2XY8 A;  2JWL A;  2E6M A;  4CJS A;  4CIG A;  1HJR A;  1RDC A;  1ZBS A;  3GBT A;  5KPZ A;  4E7H A;  1GLD G;  4OJR A;  3VQC A;  1VQP N;  2CGJ A;  5KRT A;  1XNR K;  3HOS A;  4WYB A;  3V9W A;  4YOW A;  2P5O A;  1T3V A;  3KLG A;  3V1Q A;  4M3X A;  5FDL A;  2QK9 A;  3AO5 A;  4DTS A;  1EXQ A;  1LWE A;  4K0K K;  2QTD A;  4JKG A;  4FYD A;  2QW9 A;  5J1E A;  2RHK A;  3PSF A;  1YUW A;  4YDU C;  2QM1 A;  4JK7 A;  3OYN A;  4JS4 A;  4KRF A;  3R9P A;  3UKU B;  1IBL K;  3GOI A;  5EX5 A;  1FKO A;  4KFB A;  1GOC A;  4OGE A;  1BI4 B;  1JLE A;  4BE1 A;  1QHT A;  1HNV A;  3AA5 X;  1ATS A;  5EU7 A;  1S22 A;  1KLN A;  2OZS A;  2GBZ A;  1QSY A;  3NF6 A;  4CHP A;  3P1G A;  3SQ4 A;  3TAB A;  3O9T A;  3VQE A;  4B3T K;  1GLF O;  1S6Q A;  2BUP A;  1WLJ A;  1JLA A;  3O3F A;  3DLB A;  4N76 A;  4J2E A;  1D9D A;  4AH9 A;  3HVR A;  2F8T A;  1CLQ A;  3NF9 A;  1TYQ A;  4CGG A;  1V4S A;  3THW A;  1NGJ A;  1BU6 O;  3TTC A;  1QQM A;  3BP8 A;  4B9V A;  3G25 A;  2OPQ A;  3CCL N;  3QET A;  1XI1 A;  5M1P A;  4DSK A;  1LAV A;  1QE1 A;  2W6L A;  4XH4 A;  3W3D A;  4OPJ A;  2YV0 X;  1C6V A;  4BWJ A;  3ZLJ A;  4KB0 A;  1ZYQ A;  1M90 O;  3M8P A;  1RDU A;  3VQP A;  2HHU A;  3S9H A;  1HPZ A;  4JI2 K;  3T19 A;  3TTD A;  2IVP A;  4KB1 A;  1GOB A;  3CCJ N;  1LV5 A;  4G9Z A;  4PKG A;  2UXB K;  3KKS A;  4C8K A;  1QVG M;  5JLF A;  3H3N O;  3OYJ A;  4GVE A;  3VF6 A;  4DV4 K;  3TWH A;  3TAE A;  1MA9 B;  2NLX A;  2ITG A;  2DTU A;  1NJZ A;  3FZK A;  2O8C B;  4HWI A;  4M41 A;  2HBJ A;  3E9O A;  1VQ8 N;  2FBX A;  2HHS A;  1NK4 A;  3Q7B A;  3PUF A;  3KWG A;  5T7B A;  1KAY A;  3ZEU B;  5HRR A;  4F2S A;  1S9G A;  1U45 A;  5KQ8 A;  2A6A A;  1FW6 A;  1HKC A;  1JLQ A;  4CJF A;  4JHD A;  3MN5 A;  3C6A A;  4DTX A;  4H0V B;  5F0X A;  1OH6 A;  4RW4 A;  4H5R A;  3F73 A;  3K58 A;  1W97 L;  4J2A A;  2GUI A;  3H1Q A;  4KHS A;  2QKK A;  1Z25 A;  2ZQB A;  4DR6 K;  4FWN A;  4YOY A;  1TVR A;  3D2F A;  3NGY A;  4FOI A;  1RT5 A;  3CCU N;  4PL7 A;  4CHY A;  5HP1 A;  2I7N A;  4ID5 A;  1MU2 A;  4EIA A;  4CBW A;  4A5B A;  5AQY A;  3VQ9 A;  3ZSW A;  2DY4 A;  1WBB A;  5D3G A;  3NF8 A;  1TAQ A;  3K2P A;  1KSP A;  4N41 A;  3RR8 A;  1VSK A;  3SAH A;  4FLT A;  1IG9 A;  1DLO A;  4XEI A;  3LL3 A;  4BVO A;  3MCA B;  3ENO A;  1W9H A;  1VSF A;  1FK9 A;  3H6E A;  3V9S A;  4WQ5 C;  1NOY A;  4CK3 A;  3CMA N;  4LSN A;  1JLF A;  3EEQ A;  1NGG A;  4LSL A;  4IJA A;  1RBU A;  2KTQ A;  1S1X A;  3LDN A;  1OH7 A;  4BE0 A;  1BCO A;  1C1A A;  3WXM B;  3VA3 A;  4LH5 A;  4E7J A;  3AVM A;  3NE6 A;  3DXM A;  2DFH A;  4K8X A;  4CZE A;  1SUQ A;  3NH0 A;  3NDK A;  3QDK A;  2FLO A;  3L2Q A;  4LFC K;  3AY9 A;  4JLH A;  3PSI A;  2GEM A;  4DQS A;  3O5B A;  3L6Q A;  4UQG A;  4KHP K;  4X62 K;  4BG8 A;  3ZET A;  2UXC K;  4H4M A;  5LL6 Z;  4N47 A;  3WT0 A;  4CK2 A;  5LY3 A;  4J2D A;  1YJN N;  4HHT A;  4PA1 A;  4JEP A;  3SAF A;  3D6R A;  2P9N B;  4Y1C A;  3HP6 A;  3BZK A;  2JWK A;  3ZSR A;  1KAZ A;  2UYT A;  3KIO A;  5BRH A;  1TKZ A;  1DGK N;  3IFR A;  1TV6 A;  1HNI A;  1BO5 O;  4M7X A;  3K9K A;  2IVO A;  4E1M A;  4M3U A;  2HBM A;  2P9L A;  4FWL A;  3FR0 A;  4A61 A;  3TAM A;  1SL0 A;  2E88 A;  4A57 A;  4KO0 A;  1T6D A;  1EWQ A;  4ID1 A;  4C8N A;  3Q7C A;  3OBW A;  4NO7 A;  2IOC A;  1QQN A;  1BQN A;  4LH4 A;  4DQ8 A;  1T8E A;  4DSE A;  3LP3 A;  5JS1 A;  5ELZ A;  4O0I A;  3SUP A;  5BN9 A;  3J81 O;  3JXU A;  3OYC A;  4CEA A;  3OYG A;  3C0B A;  2IC3 A;  1HQE A;  4KTW A;  3SPY A;  4CEE A;  2B4J A;  2NZT A;  1P90 A;  1QS4 A;  4O44 A;  4CBX A;  3VQ6 A;  5BRF A;  5JIC A;  2KFN A;  2NUB A;  3R8E A;  1OVY A;  2Q97 A;  4FLY A;  1WUA A;  2HST A;  3QEV A;  2Q0U A;  4WE1 A;  3AVK A;  4B9N A;  4FWM A;  1VHX A;  2QWR A;  3TPQ A;  5I42 A;  4F3O A;  3MAQ A;  3K57 A;  3TAQ A;  1XC3 A;  2E2N A;  1KVA A;  4MO4 A;  1RGI A;  3MWT A;  4X65 K;  5AJ3 K;  4I6M B;  3KK3 A;  3OJS A;  3EKS A;  3HPO A;  5FPM A;  4A59 A;  3VGL A;  3FGU A;  1XC9 A;  2QXL A;  3K5M A;  4DU3 A;  1S1T A;  3AGK A;  4CFD A;  1I3A A;  2JLE A;  3R1X A;  1KFD A;  1JLB A;  2ETJ A;  2A40 A;  3O3G A;  4RW9 A;  4EP5 A;  4Z4E A;  4JI1 K;  5GAG P;  3QIC A;  2WOM A;  2UUA K;  2D0P A;  4KTQ A;  4CGH A;  4LY7 A;  3CJ9 A;  3ZSV A;  2YHB A;  3E66 A;  3ZX3 A;  3SUN A;  3U9Z A;  3LDL A;  3EO3 A;  3U8X A;  3VEW A;  5E41 A;  3SUQ A;  4E89 A;  3OYB A;  3O3H A;  4B1U B;  4OLA A;  2G8K A;  2KQ2 A;  1HRH A;  2OPR A;  4BRQ A;  1NGD A;  2FSJ A;  4DR2 K;  4X66 K;  3ID8 A;  5LJV A;  3A2F A;  4DMN A;  2P1J A;  3C65 A;  1QQC A;  4MDA A;  1NOZ A;  2Q0R A;  1RTJ A;  4FCY A;  1D5A A;  4BGB A;  5BN8 A;  5FRN A;  3VGM A;  3ALY A;  2UUC K;  4CES A;  5TKY A;  2FXU A;  3ZEU A;  4JK9 A;  4CZM A;  4IZ9 A;  5KPT A;  2HHT A;  2IS3 A;  4MQ3 A;  3ZT2 A;  3HPG A;  3KLI A;  1U48 A;  1WSG A;  4DR7 K;  2Q2R A;  4IXC A;  1C0M A;  4BRN A;  3VQA A;  2X74 A;  3O8M A;  3DRP A;  5AQK A;  3ZX2 A;  2ASO A;  3VF2 A;  3CJ1 A;  2Z1J A;  1HR0 K;  3NH1 A;  1KFS A;  3ATU A;  4CHZ A;  1TL3 A;  4J2B A;  4FJI A;  3AO3 A;  4Z0U A;  3UB5 A;  2RN2 A;  5CHI A;  2YHA A;  4M7Y A;  4DF8 A;  4F8R A;  4FM1 A;  3P4I A;  2G8I A;  1OH8 A;  3SYZ A;  3CG7 A;  4IOA L;  4Q5V A;  1NGI A;  1P8Z A;  3DJC A;  1NKC A;  3IKM A;  2J4R A;  4ISE A;  3AA3 A;  1IV0 A;  4YFU A;  1NJY A;  1TYQ B;  5CE3 A;  4DR3 K;  1XNQ K;  1Q86 O;  3VF4 A;  3THW B;  3LP1 A;  1NK0 A;  3CER A;  4OX9 K;  1C0F A;  5JLH A;  3FZM A;  1S1V A;  1YT3 A;  1QSL A;  3MXI A;  4YOX A;  3HO1 A;  1VSI A;  3BGR A;  2HHV A;  2WTU A;  2HNZ A;  5AQV A;  3F5T A;  4EHU A;  3T1H K;  1Q7Y O;  4YY3 K;  4RW7 A;  3KD1 E;  1JXB A;  4B3S K;  3SI6 A;  4WFB L;  3VQ8 A;  4DWI A;  3QB0 A;  1NGB A;  2O8D B;  4JD2 A;  2XY7 A;  3G0Z A;  3ZT4 A;  3SBG A;  1TKD A;  2ZGY A;  1YI2 N;  4KI6 A;  4M3Z A;  3H3O B;  1N33 K;  1NM1 A;  3QES A;  3UKR B;  5C24 A;  3LWM A;  3QLH A;  2X6N A;  4FJ8 A;  3CYM A;  2YHY A;  1BDG A;  1HX1 A;  3TR8 A;  1RCH A;  2ZE2 A;  2ZD1 A;  1K6Y A;  3BF1 A;  3ULD A;  2P9N A;  5M1O A;  1YIT N;  4AHS A;  4E3S A;  4BY9 C;  1ILY A;  4KHW A;  3C6H A;  3L3V A;  3CPW M;  2BAN A;  2QWL A;  3VEV A;  3HP9 A;  4CGJ A;  3LWL A;  1LW0 A;  3O08 A;  2F4V K;  2E6L A;  1VQK N;  2NRZ A;  2E2O A;  4AQY K;  4OPH A;  4W5T A;  1NKB A;  3IAY A;  5CYM A;  2I7P A;  2QWM A;  2PFU A;  3KLF A;  1IKV A;  4DFM A;  4FJG A;  3DOK A;  4DFP A;  3PX0 A;  3PIP L;  1RT1 A;  3CJA A;  4WFA L;  2DFE A;  2QEX N;  2HBL A;  2HHX A;  4NXM K;  1SV5 A;  4M63 C;  3SAG A;  4DG1 A;  2P9P B;  4HCB A;  3J7A P;  1W7A A;  4GV3 A;  1VQN N;  1KXP A;  1DEJ A;  2P5G A;  4ZTF A;  3WXJ A;  1BA0 A;  4FJL A;  3TSU A;  4H4O A;  3HBT A;  2BDP A;  4KHN A;  3IDH A;  2Q36 A;  2YX6 A;  4KRE A;  2XRI A;  3M3Z A;  3SQ0 A;  3WNF A;  2YI1 A;  4ILG B;  3HXM A;  1IKW A;  1K9M O;  1X9S A;  3CF5 L;  4GV9 A;  2ZJP L;  3N4P A;  1BGX T;  3K0S A;  3EN9 A;  1NGC A;  4YNQ A;  1HKB A;  1JL1 A;  4JRQ A;  1KTQ A;  3A5N C;  2IDO A;  4GKK K;  3KHY A;  3MEC A;  4IEI A;  3DXM B;  1KD1 O;  3AVJ A;  4CF0 A;  2A3Z A;  1J9A A;  1JCE A;  2B6A A;  5KI6 A;  2BTF A;  3CET A;  3F9K A;  5HOO A;  3QBX A;  2V7Z A;  2QWP A;  4CFC A;  5TKW A;  4I6M A;  1QQO A;  3ZCM A;  5AQS A;  3SV3 A;  3DMJ A;  3LM9 A;  5AZJ B;  4HUF A;  3WXK A;  1RDA A;  5FPD A;  1I39 A;  1NGA A;  1DTT A;  5LJW A;  1RBT A;  4KTZ A;  3TAF A;  1NJI O;  1WN7 A;  4IFY A;  4WQ4 C;  2CGL A;  5JMV A;  3L4I A;  2X78 A;  3J7Y P;  4IO8 A;  1VAZ A;  3JYT A;  1A5V A;  3DLK A;  2YNG A;  1S1U A;  4BR2 A;  2QWQ A;  3K5N A;  3K5O A;  4Z4G A;  2O4I A;  3CC2 N;  4XIU A;  3VN5 A;  1SKW A;  3CJB A;  4DTO A;  2KKZ A;  3P38 A;  3NBP A;  1N36 K;  2P9L B;  3TSP A;  1VQL N;  4W5O A;  4CF1 A;  4Z4C A;  1S1W A;  1BG3 A;  1IBM K;  5CYQ A;  4E19 A;  2NRT A;  1O13 A;  2VGN A;  4F3T A;  2YHX A;  3LP0 A;  4NYF A;  3K59 A;  4JNE A;  1HMV A;  3MXJ A;  4H5T A;  1L5U A;  1X9W A;  5ADX H;  1MWK A;  4B3R K;  2KW4 A;  3MK6 A;  4CHO A;  1LWC A;  4M42 A;  2QKB A;  3CXC M;  4FWQ A;  4MLH A;  4GMJ B;  2WC9 A;  2F96 A;  4CCH A;  3THY B;  4DB3 A;  1KAX A;  1RT4 A;  2W40 A;  4PKI A;  4M3R A;  5BR8 K;  1N8R O;  2VGM A;  1T03 A;  3SPZ A;  1BIU A;  4H0T B;  1A5X A;  4IBN A;  4DQQ A;  4JKE A;  4BC5 A;  1ASU A;  1QZ6 A;  3A5M C;  4IJN A;  3U4L A;  4A5A A;  3QEP A;  3H08 A;  3CCE N;  5AQP A;  4O5B A;  3D0P A;  3LP2 A;  3CIP A;  1U04 A;  4DQR A;  5JS2 A;  5AQJ A;  5CZ2 A;  1NBW A;  4DLE A;  1NJX A;  4NYN A;  4TSX A;  1BQM A;  5M1Q A;  4N5S A;  4ELU A;  1NK5 A;  1NGE A;  2XY6 A;  3OYI A;  1NJW A;  4O8U A;  1X3N A;  1SQK A;  3HT3 A;  4LD0 A;  3KLH A;  5AQF A;  4HCC A;  2FC0 A;  3LZJ A;  3SLC A;  4KHY A;  3OYK A;  4HTU A;  3L2R A;  3DM2 A;  5AQR A;  1TGO A;  4DCH A;  4B9M A;  1YVN A;  4E7I A;  3TAR A;  1XQS C;  2OAN A;  2Y1I A;  4CEZ A;  4M3W A;  2GWJ A;  2F9W A;  3AV9 A;  2HMP A;  4ILH A;  5GAD P;  1GLB G;  2D0A A;  1HYV A;  3LAM A;  2KZZ A;  2O8D A;  1WSF A;  3TU5 A;  3VQ4 A;  2CGK A;  4OKE A;  4FLU A;  4L8R B;  3NF7 A;  3ZSZ A;  1C1B A;  3M1F A;  4FJX A;  1WAJ A;  5AQX A;  3UKR A;  3L0Q A;  1ZBF A;  3KK2 A;  1OVQ A;  3WQU A;  2VWB A;  3RMD A;  4RCH A;  2VWJ A;  3MWP A;  2BGG A;  4CZL A;  2A42 A;  5C12 A;  1NK9 A;  1NK6 A;  2YJE A;  4FJ7 A;  3CME N;  1BL3 A;  1X1P A;  5HLF A;  3DYA A;  1NKE A;  4CJK A;  4DUY K;  2A5X A;  2RE2 A;  2XO7 A;  1YTU A;  1MWM A;  4BRP A;  5ADX A;  3DI6 A;  3AGR A;  3NHG A;  3VQQ A;  3QML A;  2QA4 N;  2GV9 A;  3GG4 A;  3PLA A;  1RTD A;  2Z1H A;  5J2N A;  3O9R A;  1NU0 A;  4H0P A;  3E01 A;  1YIJ N;  3NVK A;  4DTM A;  4JI6 K;  4C1N I;  4WF9 L;  3FZF A;  4CJ5 A;  4BRK A;  2E2Q A;  2QXF A;  1OH5 A;  4FJK A;  4FPA A;  3K5L A;  2O8F B;  4Z4F A;  1TKT A;  3V9U A;  5J2Q A;  4KPY A;  3ENB A;  2P9P A;  1UOC A;  4FJJ A;  1RNH A;  4JI8 K;  5M1K A;  3I0R A;  3BUZ B;  3OA9 A;  3MX5 A;  3T7Z A;  3SV4 A;  4QS8 A;  3HL8 A;  1RFQ A;  4K41 A;  4FWK A;  3G4S N;  2ZF5 O;  3UIQ A;  4CGD A;  1MDU B;  1RDW X;  1U2V A;  1VSE A;  4CEC A;  4F9O A;  3DAW A;  4Z4H A;  4NB4 A;  3QEW A;  3SQ1 A;  4PL8 A;  4GV6 A;  3FFK B;  4FK0 A;  4KV8 A;  4MLE A;  2ASM A;  5BPN A;  4FW1 A;  4CEF A;  1QTM A;  1S3X A;  4JI4 K;  2FSK A;  4CE9 A;  1BIS A;  4CF8 A;  3WUH A;  4JD2 B;  3V6D A;  3AVH A;  3CQY A;  5AZJ A;  3O1B A;  4PQU A;  1NNE A;  4CEB A;  1KQS M;  3SMS A;  1A5W A;  2HBK A;  3EZ5 A;  3WXL A;  3FZH A;  2WBN A;  3KTQ A;  1L3T A;  4LFA K;  2ITM A;  4FWS A;  2HB5 A;  4BR5 A;  4CZJ A;  4CJP A;  4U67 L;  4DTU A;  4K25 A;  4O5F A;  4CZF A;  4JRP A;  1SAZ A;  4HTL A;  4H0Y B;  4B08 A;  3O80 A;  3WQT A;  4CZH A;  2P51 A;  3OYE A;  1FJG K;  1UWB A;  3L2W A;  4DS4 A;  4PWD A;  2VQE K;  2A1S A;  1TL1 A;  4JI0 K;  5HRN A;  1YAG A;  3OYM A;  1JJ2 M;  3TSQ A;  4RG8 A;  4IKF A;  4EZ6 A;  1WNS A;  3E1Y A;  4E1J A;  2VG5 A;  2ASP A;  1Y64 A;  4F4K A;  1JLC A;  5C15 A;  3KLE A;  1ITG A;  3UE5 A;  4CJV A;  4CFB A;  3L4Q A;  1WB9 A;  4RW8 A;  4CER A;  1IKX A;  2VCP A;  4K8Z A;  1S6P A;  3NH2 A;  4CJW A;  1K8A O;  3RVC A;  1B92 A;  4DTP A;  3ISN C;  2A41 A;  1Q9Y A;  5AFU A;  2B5J A;  3THY A;  5DK5 A;  3SQ2 A;  1DTQ A;  3P31 A;  1ATR A;  1HKG A;  4CZI A;  1JCG A;  2V51 B;  3LDQ A;  2VWK A;  2HVH A;  3VER A;  4MFB A;  1B9F A;  4CJE A;  2PYJ A;  5AQQ A;  3QNO A;  3NCI A;  4FPB A;  5CR4 A;  2WFB A;  2P9K A;  3A5L C;  2Y1J A;  3OYD A;  4F2R A;  4K43 A;  4E0D A;  4CK1 A;  1LW2 A;  3T1A A;  3U3G A;  4CJU A;  1R0A A;  2HHH K;  2DPN A;  2IIR A;  5AR0 A;  4JKA A;  4DV5 K;  4CED A;  1BWF O;  3HOT A;  4DKW A;  3M5R A;  1RDB A;  3VPZ A;  1E3M A;  4CJ3 A;  1REV A;  4CJ7 A;  3JS6 A;  3TAN A;  5EXW A;  4V19 S;  4CBU A;  2ATQ A;  4KHU A;  3VA0 A;  2QWO A;  4BQZ A;  1RBS A;  4PKH A;  4CFA A;  2KHO A;  1Z26 A;  3OBY A;  4JKD A;  3DLG A;  3V9Z A;  2D4W A;  4YOT A;  1HYZ A;  1TKX A;  3DWL A;  1S72 N;  2OTJ N;  5EVZ A;  1N5Y A;  3SZ2 A;  3H1V X;  3I8B A;  4AIL C;  3O1W A;  1ASV A;  4ZHR A;  3MCP A;  3VEO A;  4CEQ A;  4N56 A;  5DMR A;  3DLL L;  5AQW A;  3DLE A;  5F2R A;  4CHN A;  3VTI A;  3G6E N;  4CZG A;  2ZWH A;  3LAN A;  1JLG A;  1NGF A;  4QS7 A;  5E84 A;  3MN6 A;  4BRF A;  3PO4 A;  3E9L A;  4DR1 K;  3CFO A;  4O55 A;  1FXX A;  5KRS A;  3ZSO A;  4NCA A;  4CF2 A;  4LF9 K;  4OKK A;  1YF5 L;  3CJ7 A;  5AQN A;  2KFZ A;  3TTF A;  3NGI A;  3I8D A;  2CH5 A;  3KJV A;  1VQ9 N;  3B8A X;  1GOA A;  4IEE A;  5BPM A;  3BEX A;  3CC7 N;  4DR5 K;  4E1N A;  2O8F A;  2WUS A;  3PX4 A;  2F9T A;  2IAJ A;  4I9Q A;  1B9D A;  4GW6 A;  2R7Y A;  2GUP A;  4Y1D A;  1V4T A;  3MDQ A;  4LFB K;  3CC4 N;  4W5Q A;  1RBV A;  4DTR A;  1D9F A;  3U9D A;  4MO5 A;  3ULE B;  3OYH A;  1TK0 A;  4B9Q A;  1H1V A;  5CZ1 A;  3IG1 A;  4HVJ A;  3U3Y A;  1TK5 A;  2AP1 A;  1VQ4 N;  4BDY A;  4FK4 A;  1X3M A;  2F8S A;  4EZ9 A;  4QCL A;  3JAM O;  3CCR N;  3LAK A;  3RTV A;  4FLW A;  3AVF A;  3KK1 A;  4ELV A;  1ATN A;  2W42 A;  1X9J A;  4CEO A;  3LDS A;  3AVL A;  3VMF B;  4LF6 K;  4ZTJ A;  4CIF A;  5JVH L;  4H8K A;  1Z05 A;  2HW3 A;  4CGF A;  5KQD A;  1GLE G;  1L3S A;  4RTF D;  5C10 A;  5MLC Q;  4GKJ K;  4JI7 K;  4C8M A;  4CIE A;  2D1K A;  1VQ5 N;  3T69 A;  2O8B B;  3CCV N;  3AVI A;  4AHT A;  2RKI A;  2D0C A;  2P9I B;  3ZT3 A;  4EFH A;  4RWT A;  3CFP A;  3C94 A;  5HRP A;  1NGH A;  3SJH A;  3CI5 A;  5K14 A;  5C2F A;  4J8F A;  4JN4 A;  4FLZ A;  3HPH A;  4O4G A;  4NLB A;  2W41 A;  4X64 K;  3THX B;  1J5E K;  3HTV A;  5CY4 A;  3ZX0 A;  1M1K O;  4ISG A;  1W2B M;  2Q31 A;  3AVA A;  3N4Q A;  1HJO A;  2QWN A;  3P39 A;  3KVG A;  1T05 A;  4CZK A;  4BC2 A;  2NRR A;  1HUX A;  4O8K A;  3VES A;  5JVG L;  4DR4 K;  1Q82 O;  5AQL A;  5AQZ A;  2PY5 A;  1N32 K;  4B9S A;  4C8O A;  1JKH A;  4BAC A;  3O6W A;  3MEG A;  5I3U A;  3C6U A;  2VQF K;  3T1Y K;  3LAL A;  4DV2 K;  1ASW A;  3QEX A;  4JI5 K;  3A0I X;  4BR4 A;  3KK7 A;  1VSH A;  3V9X A;  1KVB A;  4M3T A;  3MMV A;  4YDU A;  4DSL A;  2XY5 A;  4FWR A;  1T7P A;  4YOU A;  4B9U A;  4KI4 A;  1C0G A;  4DFJ A;  2G8H A;  4NCG A;  1U2V B;  3OJU A;  2VG6 A;  2QI2 A;  2OPP A;  4L3Q A;  4DS5 A;  3LM2 A;  4QAG A;  4B9L A;  3O9Q A;  3I56 N;  3B6O A;  3VQ7 A;  3EE9 A;  2YKN A;  1WBD A;  2BE2 A;  2GX9 A;  3ZT0 A;  1YHQ N;  2YKM A;  1WSH A;  2OYQ A;  3DRS A;  1XMQ K;  4FL9 A;  2E1Y A;  1KCF A;  2FBY A;  4Q0B A;  4DV0 K;  2HNY A;  3VEY A;  3SMP A;  1TUY A;  4B1Z A;  2AA4 A;  4AHU A;  1NK7 A;  4AHV A;  3MN9 A;  1JL2 A;  4JI3 K;  1X9M A;  1HNW K;  3AAR A;  4C23 A;  1WSI A;  2NRX A;  1L3U A;  3CCQ N;  3LPU A;  3QBW A;  4JKF A;  3L8B A;  4KH5 A;  2VYP A;  3I0S A;  3RSE B;  1YVU A;  4QS9 A;  4CJR A;  3KWI A;  1HLU A;  4BR7 A;  4DSF A;  4MDB A;  2E20 A;  4FVM A;  4B1V A;  4FVU A;  3VEX A;  4DTN A;  4I2P A;  1BIZ A;  4FZY A;  4Y0W A;  4IDH A;  3OYL A;  5AZI A;  1EO1 A;  1BUP A;  1J6Z A;  3D2E B;  3VQB A;  4LF5 K;  1DT9 A;  5AQT A;  2YHW A;  4CW7 B;  5AQG A;  1XHX A;  2RPI A;  2E1Z A;  1OKJ A;  1Y97 A;  2V7Y A;  3DXK B;  4OPK A;  4BDZ A;  4DU4 A;  3HSC A;  4DSI A;  2CH6 A;  3ZSX A;  1E4G T;  1E4F T;  3IMX A;  2VG7 A;  3E9P A;  5I9E B;  1VRU A;  4BRC A;  5GAE P;  3OY9 A;  4CVN E;  3A8Y A;  3AVG A;  1EET A;  4R79 A;  3OYF A;  3QER A;  4IOC L;  2YNH A;  2FSN A;  4B1X B;  3NFA A;  1GLJ O;  3AO4 A;  2NRW A;  2OA8 A;  3DOL A;  3O4W A;  3HST B;  4JAX A;  4WCE L;  4OVL A;  5AQU A;  4A2A A;  2KLA A;  3EY1 A;  3SCX A;  1XUP O;  3HM9 A;  1RTH A;  4FJ9 A;  3ULE A;  1HPM A;  2P9K B;  3M8R A;  3CHW A;  3J7Z O;  2ZJQ L;  4FWO A;  3H45 C;  1K8K B;  4DSJ A;  4WQ5 A;  1QZ5 A;  2ZM6 K;  3SBT A;  1N34 K;  3SUO A;  3J80 O;  3M6G A;  4B3M K;  2O4G A;  3VEN A;  3LZI A;  1HNZ K;  4BRO A;  3BZC A;  4FM0 A;  4H03 B;  4W5N A;  4DTJ A;  4FSV A;  4PY5 A;  3NMU A;  4CJQ A;  4IG3 A;  3FFI A;  2YNF A;  1I94 K;  3D7E O;  3PV8 A;  4DHY A;  4R5P A;  4DV3 K;  3OS1 A;  3S3N A;  3W0L A;  3EKU A;  2HHW A;  1U47 A;  2O8B A;  3OTO K;  3AA2 A;  4BRL A;  1NMD A;  4BRD A;  3L2V A;  4OGC A;  5KPR A;  3KD5 E;  2P9I A;  4GY2 B;  2GTD A;  1RIL A;  3WXI A;  1VSD A;  3CFR A;  2V52 B;  3NGZ A;  2HOE A;  1C1C A;  4AM7 A;  3THX A;  3S3M A;  3P83 D;  3VOV A;  4BR0 A;  1EP4 A;  5C42 A;  1BHL A;  2PAV A;  4DV1 K;  5J2P A;  3FLC O;  1U4B A;  4FM2 A;  2G8W A;  1F21 A;  4BRM A;  3AAQ A;  1T44 A;  2UUB K;  4IWV A;  5H1S Q;  5DM7 L;  3KKR A;  1IO2 A;  2E4L A;  3C7N B;  5FRO A;  4CGI A;  4IG0 A;  3F9M A;  3SNN A;  5AQM A;  1W0H A;  3WEE B;  3RWU A;  1IG8 A;  3VEZ A;  5HBM A;  5AQO A;  4EAH D;  4IFV A;  4I2Q A;  1ZC6 A;  5GIN A;  3RRG A;  4E7K A;  2W6K A;  3MED A;  3DRR A;  5AFU H;  3VTH A;  3DLH A;  5C0Y A;  1FKP A;  5FPN A;  5DM6 L;  3R3L A;  1KC8 O;  5F1X A;  2PBD A;  4FLX A;  2ZGZ A;  4CF9 A;  1CZA N;  4DU1 A;  1SL1 A;  4KHQ A;  1HYS A;  2E2P A;  2G8F A;  1VRT A;  1XHZ A;  2O8E B;  3V1R A;  4LF7 K;  1LCU A;  2NNW A;  4ISF A;  4Z94 A;  3DLR A;  4BRI A;  4LF4 K;  3QFP A;  3QFU A;  4FXD A;  4FZZ A;  1SS6 A;  1QSS A;  3R6M A;  5J2M A;  4H0X B;  1SKS A;  1RBR A;  1QVF M;  3LDP A;  3AVC A;  3CM6 A;  4H5N A;  2G8U A;  4JKH A;  4EP4 A;  4OKJ A;  1RT3 A;  2P9U A;  2FF3 B;  4ICL A;  2FBT A;  4OPA A; 
#chains in the Genus database with same CATH homology
 3DWL A;  1S72 N;  5GIO A;  1D4X A;  3PIP L;  1JCF A;  3CJA A;  3O9T A;  4WFA L;  1GLF O;  5EVZ A;  2OTJ N;  2QEX N;  2BUP A;  2HBL A;  2NRV A;  1GLL O;  3H1V X;  3I8B A;  3O1W A;  4M63 C;  3SAG A;  3MCP A;  1YXQ A;  3VEO A;  4BQL A;  3DLL L;  2P9P B;  5AQW A;  5F2R A;  4GV3 A;  1VQN N;  1IJJ A;  1TYQ A;  3VTI A;  3G6E N;  1KXP A;  1V4S A;  1DEJ A;  1NGJ A;  2ZWH A;  4CZG A;  1BU6 O;  3WXJ A;  3CQX A;  1BA0 A;  3TTC A;  1QQM A;  3BP8 A;  3RSE A;  3TSU A;  1NGF A;  3G25 A;  4QS7 A;  3HBT A;  5E84 A;  3IDH A;  3MN6 A;  2Q36 A;  2YX6 A;  2Q1N A;  4BRF A;  3E9L A;  3CCL N;  3HZ6 A;  5M1P A;  2F7T A;  3M3Z A;  4EHT A;  4LC9 B;  2YI1 A;  4ILG B;  4A62 A;  4XH4 A;  1YF5 L;  3CJ7 A;  3W3D A;  5AQN A;  3NVM A;  1K9M O;  3TTF A;  3GL1 A;  3CF5 L;  4GV9 A;  2ZJP L;  3N4P A;  2CH5 A;  1VQ9 N;  3B8A X;  3EN9 A;  1NGC A;  1M90 O;  4IEE A;  1RDU A;  1HKB A;  5BPM A;  3BEX A;  2HF3 A;  3CC7 N;  1Q81 O;  3A5N C;  3EZW A;  3TTD A;  2IVP A;  2WUS A;  2F9T A;  3D2E A;  3KHY A;  3CCJ N;  4K42 A;  4G9Z A;  2GEL A;  4BC3 A;  4IEI A;  3DXM B;  2GUP A;  1V4T A;  4PKG A;  1KD1 O;  3MDQ A;  1BA1 A;  3O9S A;  2A3Z A;  3CC4 N;  3FZL A;  1K73 O;  1JCE A;  2BTF A;  3CET A;  5HOO A;  2BH1 A;  5JLF A;  3H3N O;  3U9D A;  2H3G X;  1QVG M;  3DXK A;  4GVE A;  3QBX A;  2V7Z A;  3VF6 A;  2QWP A;  4MO5 A;  5TKW A;  2P9S B;  4I6M A;  1MA9 B;  3FE1 A;  3ULE B;  4H0O A;  1QQO A;  4B9Q A;  1H1V A;  2NLX A;  5AQS A;  3FZK A;  2AP1 A;  3LM9 A;  4HWI A;  5AZJ B;  3WXK A;  2HF4 A;  1VQ4 N;  1TUU A;  5FPD A;  2HBJ A;  3E9O A;  1X3M A;  1VQ8 N;  3CCR N;  1NGA A;  3CPE A;  3Q7B A;  1WOQ A;  5LJW A;  3KWG A;  1NJI O;  1ATN A;  1GLA G;  4WQ4 C;  1X9J A;  5EOY A;  1KAY A;  3ZEU B;  2CGL A;  5JMV A;  3ZYY X;  3L4I A;  4H5W A;  3UKU A;  3VMF B;  4IO8 A;  1VAZ A;  5KQ8 A;  2A6A A;  4BR2 A;  5JVH L;  1Z05 A;  2YJF A;  5KQD A;  1GLE G;  1HKC A;  5BPL A;  4RTF D;  1VQM N;  2QWQ A;  1VQO N;  4JHD A;  3MN5 A;  5C10 A;  5MLC Q;  3I55 N;  3C6A A;  4H0V B;  5F0X A;  3O9U A;  3CC2 N;  2D1K A;  4H5R A;  3CJB A;  1W97 L;  1VQ5 N;  3T69 A;  2KKZ A;  3P38 A;  4AM6 A;  3CCV N;  2P9L B;  3TSP A;  1VQL N;  3H1Q A;  1K8K A;  5AQI A;  1BG3 A;  4FWN A;  4YOY A;  2ZJR L;  2P9I B;  3D2F A;  4FOI A;  4EFH A;  4RWT A;  3CCU N;  4PL7 A;  4IFE A;  2I7N A;  2NRT A;  1O13 A;  2VGN A;  2YHX A;  1NGH A;  3SJH A;  3CI5 A;  4CBW A;  4EIA A;  5C2F A;  4A5B A;  4JNE A;  5AQY A;  4OO1 J;  4J8F A;  4H5T A;  3CD6 N;  2EWS A;  4JN4 A;  5ADX H;  1MWK A;  4KBO A;  4JK8 A;  3MK6 A;  2W41 A;  4NLB A;  3HTV A;  3CXC M;  3ZX0 A;  1Q18 A;  1M1K O;  4FWQ A;  4ISG A;  2Q31 A;  4MLH A;  1W2B M;  4FWP A;  3SAH A;  3N4Q A;  1YJ9 N;  2WC9 A;  1HJO A;  2QWN A;  3P39 A;  3KVG A;  4BGA A;  4XEI A;  3LL3 A;  3VGK A;  3MCA B;  4BC2 A;  3ENO A;  4BVO A;  4CZK A;  4DB3 A;  1KAX A;  2W40 A;  4BR9 A;  5BR9 A;  2NRR A;  4PKI A;  3KZB A;  1HUX A;  3H6E A;  4O8K A;  1N8R O;  1SZ2 A;  2VGM A;  4WQ5 C;  3VES A;  4BRG A;  5JVG L;  1Q82 O;  5E26 A;  5AQL A;  5AQZ A;  4WFN L;  3CMA N;  4H0T B;  1NWK A;  1NGG A;  4IJA A;  4JKE A;  4BC5 A;  3LDN A;  3O6W A;  3WXM B;  1QZ6 A;  3A5M C;  3U4L A;  4IJN A;  4A5A A;  3EE8 A;  5C2D A;  1ZXO A;  3CCE N;  5AQP A;  4KH6 A;  5AZI B;  4FOE A;  3CIP A;  3DXM A;  3GDQ A;  3A0I X;  4BR4 A;  5GIP A;  3KK7 A;  4A2B A;  4CZE A;  5AQJ A;  5M1N A;  3QDK A;  1NBW A;  3MMV A;  5M1F A;  4YDU A;  3LDO A;  3S41 A;  2FLO A;  4XH1 A;  4JKC A;  5M1Q A;  4FWR A;  4YOU A;  3VET A;  1C0G A;  3AY9 A;  2GEM A;  4PHT X;  3O5B A;  3L6Q A;  1NGE A;  4BG8 A;  3BF3 A;  3IUC A;  4O8U A;  1X3N A;  3ZET A;  1SQK A;  1U2V B;  5GAH P;  3WT0 A;  2QI2 A;  3HRG A;  5LY3 A;  4JKG B;  4L3Q A;  5AQF A;  1NLV A;  1YJN N;  3SLC A;  3LM2 A;  4JEP A;  3SAF A;  3CJC A;  3D6R A;  2P9N B;  5AQR A;  3O9Q A;  4DCH A;  1YVN A;  3ID6 A;  3I56 N;  1XQS C;  3C7N A;  2OAN A;  2JWK A;  3EE9 A;  2GWJ A;  2F9W A;  5FPE A;  4CD3 A;  2HMP A;  2GX9 A;  4ILH A;  1GLB G;  3WEE A;  1KAZ A;  5GAD P;  1VQ7 N;  2UYT A;  1YHQ N;  3CCS N;  5BRH A;  3TU5 A;  1DGK N;  3IFR A;  3ATV A;  2CGK A;  1BO5 O;  4M7X A;  3K9K A;  3M1F A;  4FL9 A;  2E1Y A;  2IVO A;  5AQX A;  3UKR A;  2HBM A;  2P9L A;  3L0Q A;  3WQU A;  2VWB A;  4FWL A;  4BRH A;  4RCH A;  3FR0 A;  4A61 A;  4JKB A;  2E88 A;  3MWP A;  4A57 A;  4CZL A;  3VEY A;  2A42 A;  1T6D A;  3SMP A;  5C12 A;  1TUY A;  3Q7C A;  4B1Z A;  2AA4 A;  2YJE A;  3OBW A;  4NO7 A;  1QQN A;  3MN9 A;  4DQ8 A;  3CME N;  5ELZ A;  3SK3 A;  5BN9 A;  3AAR A;  2A5X A;  4C23 A;  2NRX A;  3JXU A;  3CCQ N;  2RE2 A;  3QBW A;  4JKF A;  3C0B A;  1MWM A;  4BRP A;  4KH5 A;  2VYP A;  5ADX A;  3RSE B;  3AGR A;  4QS9 A;  3KWI A;  3AAP A;  1HLU A;  4BR7 A;  2E8A A;  2NRH A;  3QML A;  2NZT A;  1P90 A;  3J8A A;  2QA4 N;  3GG4 A;  4CBX A;  4MDB A;  5BRF A;  3PLA A;  5JIC A;  2E20 A;  4B1V A;  3O9R A;  4FVU A;  3R8E A;  1OVY A;  4H0P A;  3VEX A;  2Q97 A;  1YIJ N;  3NVK A;  1WUA A;  2HST A;  4C1N I;  4WF9 L;  3FZF A;  4Y0W A;  2Q0U A;  4BRK A;  2E2Q A;  4IDH A;  1GLC G;  4FPA A;  1QHA A;  5AZI A;  3GE1 A;  1EO1 A;  1BUP A;  1LOT B;  1J6Z A;  3D2E B;  3ENB A;  4FWM A;  1DT9 A;  2P9P A;  2QWR A;  2YHW A;  5AQT A;  4FO0 A;  3TPQ A;  5AQG A;  4YOV A;  3OW2 M;  2E1Z A;  1OKJ A;  5M1K A;  4WQ4 A;  3BUZ B;  3OA9 A;  2V7Y A;  3MX5 A;  3DXK B;  3T7Z A;  1XC3 A;  2E2N A;  4MO4 A;  4QS8 A;  1RGI A;  3MWT A;  4I6M B;  3HSC A;  1RFQ A;  2CH6 A;  4K41 A;  4FWK A;  2IVN A;  1VQ6 N;  3EKS A;  3G4S N;  2ZF5 O;  5FPM A;  1U6Z A;  4A59 A;  3VGL A;  1MDU B;  1E4G T;  1E4F T;  3FGU A;  3IMX A;  2QXL A;  1RDW X;  1U2V A;  4AF1 A;  3AGK A;  2GWK A;  5BRE A;  3R1X A;  4B1Y B;  2A40 A;  3E9P A;  5I9E B;  4BRC A;  5GAE P;  5GAG P;  4F9O A;  3DAW A;  3QIC A;  4GNI A;  4CD1 A;  2D0P A;  3A8Y A;  4NB4 A;  4R79 A;  4BRA A;  3CJ9 A;  4IOC L;  4PL8 A;  4GV6 A;  2FSN A;  3E66 A;  3FFK B;  2YCH A;  4B1X B;  4MLE A;  3ZX3 A;  5BRD A;  3LDL A;  1GLJ O;  2ASM A;  3U9Z A;  2NRW A;  5BPN A;  1T6C A;  3O4W A;  1S3X A;  3EO3 A;  3MN7 A;  3U8X A;  3VEW A;  4JAX A;  4WCE L;  3ENH A;  3HM8 A;  2FSK A;  5AQU A;  3I33 A;  2KLA A;  3K9J A;  4A2A A;  3PIO L;  3H46 O;  1XUP O;  3WUH A;  2D0O A;  4JD2 B;  4JHD B;  4B1U B;  1R59 O;  1BOT O;  2P9S A;  3ULE A;  1HPM A;  2P9K B;  3EL2 A;  3CHW A;  4BRQ A;  4UY8 O;  3CQY A;  3J7Z O;  2ZJQ L;  4FWO A;  1NGD A;  3O1B A;  5AZJ A;  2FSJ A;  5HL7 L;  2FF6 A;  1ESV A;  1K8K B;  3H45 C;  3ID8 A;  3SMS A;  5LJV A;  1KQS M;  3C65 A;  2HBK A;  1EQY A;  4WQ5 A;  1QZ5 A;  4MDA A;  3D2F B;  2Q0R A;  3A5O C;  3SBT A;  4BGB A;  3CCM N;  5BN8 A;  3VGM A;  4ILJ A;  1DKG D;  3FZH A;  3WXL A;  3M6G A;  2WBN A;  5TKY A;  2FXU A;  3VEN A;  3ZEU A;  3OHR A;  4IOX A;  4JK9 A;  2ITM A;  4NLC A;  4BRO A;  4CZM A;  4FWS A;  4IZ9 A;  5KPT A;  4H03 B;  4BR5 A;  4CZJ A;  4U67 L;  4FSV A;  4K25 A;  4O5F A;  4CZF A;  3NMU A;  1SAZ A;  3G71 N;  4HTL A;  2Q2R A;  4IXC A;  4H0Y B;  4BRN A;  3O80 A;  3D7E O;  3WQT A;  4CZH A;  4BC4 A;  2P9U B;  3O8M A;  5AQH A;  5AQK A;  4DHY A;  3ZX2 A;  2OTL N;  2ASO A;  3VF2 A;  3CJ1 A;  3HI0 A;  3W0L A;  1Z6R A;  3EKU A;  1YAG A;  4H5V A;  1JJ2 M;  3ATU A;  3TSQ A;  4BRL A;  1NMD A;  4BRD A;  5KPR A;  3UB5 A;  5CHI A;  3E1Y A;  4M7Y A;  5EY4 A;  4E1J A;  2P9I A;  1G99 A;  1Y64 A;  2ASP A;  3P4I A;  4GY2 B;  4KH4 A;  4IOA L;  4BRE A;  5C15 A;  4IO9 L;  2GTD A;  3UE5 A;  1NGI A;  3WXI A;  1P8Z A;  3DJC A;  3IKM A;  2V52 B;  2J4R A;  3L4Q A;  2HOE A;  4ISE A;  1TYQ B;  4AM7 A;  2VCP A;  4C1N K;  5CE3 A;  1YIT N;  1Q86 O;  3VF4 A;  3CER A;  1K8A O;  1C0F A;  3RVC A;  3VOV A;  4BR0 A;  4BVP A;  2A41 A;  5JLH A;  1YJW N;  2PAV A;  3FZM A;  5AFU A;  4CI6 A;  3FLC O;  3ZET B;  4YOX A;  3P31 A;  4BRM A;  3AAQ A;  1T44 A;  4BG9 A;  1ATR A;  1HKG A;  4CZI A;  5AQV A;  3F5T A;  4B1W B;  4IWV A;  4YOR A;  1JCG A;  4EHU A;  3MX2 A;  3F2K A;  5DM7 L;  5H1S Q;  4U7B A;  2V51 B;  1Q7Y O;  3LDQ A;  4XH5 A;  5B8H A;  2JWL A;  3VER A;  3C7N B;  4WFB L;  3F9M A;  3QB0 A;  1ZBS A;  5AQM A;  3GBT A;  5AQQ A;  3WEE B;  1NGB A;  5KPZ A;  4JD2 A;  1IG8 A;  3VEZ A;  4FPB A;  5AQO A;  3SBG A;  1GLD G;  4EAH D;  5CR4 A;  1ZC6 A;  2P9K A;  2WFB A;  3A5L C;  1VQP N;  5GIN A;  2ZGY A;  2CGJ A;  1YI2 N;  3H3O B;  1NM1 A;  3VTH A;  5AFU H;  5C0Y A;  5FPN A;  5DM6 L;  3R3L A;  3UKR B;  4WYB A;  3HOS A;  1KC8 O;  5F1X A;  4YOW A;  2PBD A;  1T3V A;  2ZGZ A;  2YHY A;  1CZA N;  1BDG A;  1HX1 A;  4K43 A;  2QTD A;  4JKG A;  2E2P A;  2QW9 A;  3BF1 A;  2RHK A;  1LCU A;  2DPN A;  2IIR A;  2NNW A;  4ISF A;  5AR0 A;  4JKA A;  4BRI A;  2P9N A;  4Z94 A;  1BWF O;  3QFP A;  1YUW A;  3QFU A;  4YDU C;  1SS6 A;  2QM1 A;  5M1O A;  3R6M A;  3M5R A;  4DKW A;  3HOT A;  4JK7 A;  4H0X B;  3VPZ A;  4BY9 C;  1ILY A;  3C6H A;  3CPW M;  4CJ7 A;  3JS6 A;  3R9P A;  5EXW A;  3UKU B;  2QWL A;  1QVF M;  3GOI A;  3VEV A;  4CBU A;  5EX5 A;  3LDP A;  3O08 A;  4H5N A;  1VQK N;  2NRZ A;  4JKH A;  2E2O A;  2QWO A;  4OPH A;  4BQZ A;  4PKH A;  2P9U A;  2FF3 B;  2KHO A;  2I7P A;  1ATS A;  2QWM A;  1S22 A;  3OBY A;  4JKD A;  2PFU A;  2D4W A;  4YOT A;  4OPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...