2RHKA

Crystal structure of influenza a ns1a protein in complex with f2f3 fragment of human cellular factor cpsf30, northeast structural genomics targets or8c and hr6309a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
119
structure length
119
Chain Sequence
PASRYITDMTIEELSRDWFMLMPKQKVEGPLCIRIDQAIMDKNIMLKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSFPGHTIEDVKNAIGVLIGGLEWNDNTVRVSKTLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 1
publication title Structural basis for suppression of a host antiviral response by influenza A virus.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/nuclear protein
total genus 38
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2rhkA00
2GX9A 3O9TA 3P38A 3KWGA 3EE8A 2RHKA 3M5RA 3O9UA 4OPAA 3O9SA 3EE9A 3RVCA 3O9QA 3KWIA 3O9RA 4OPHA 3OA9A 3P31A 3D6RA 3L4QA 3P39A 2KKZA 3F5TA
chains in the Genus database with same CATH superfamily
3THWB 4NCAA 3C65A 2VWBA 4N47A 3THYA 4BR2A 1X3NA 3P38A 4DFKA 4CEOA 1RT7A 4BQLA 4I2QA 3PO4A 5B8HA 4FLXA 1H1VA 4PA1A 3H1QA 4MLHA 3CCJN 3D2FB 3VQ7A 1Q81O 4ZTJA 3IFRA 3QEIA 1ZYQA 4YY3K 2F7TA 3QEPA 2O8EB 2UUAK 4MDBA 3K5LA 3EEQA 3PIPL 5KQ8A 4YORA 1VSKA 3ENHA 1C1AA 4YFUA 4O44A 3T3FA 4FJ7A 3C6AA 1RT4A 3ZYYX 1YF5L 3OY9A 1ASWA 3VA0A 5JS1A 1NKBA 1ILYA 3QIPA 2NRRA 3ZT3A 1KQSM 4DV1K 5EXWA 2YNIA 3L2RA 3LL3A 2QK9A 2RE2A 3IDHA 5AQOA 3SUNA 4FWKA 4YOWA 4AHTA 2FF6A 2FXUA 3VQ5A 3ZT0A 2WC9A 3JXUA 4FWQA 4KHQA 1N5YA 1TKDA 1P8ZA 4WE1A 2PBDA 2NZTA 1V4TA 2ETJA 1QTMA 4H4MA 2A42A 1QVFM 4FOIA 1DEJA 3PSIA 4KBOA 3E1YA 1KVCA 1IJJA 1CZBA 4IWVA 3ZETB 4NLBA 4DSJA 3AO3A 3CJBA 1WBBA 1XNRK 4H5TA 4OLBA 4B3RK 4L3QA 3AGRA 2P9NA 1NGJA 3HYFA 3AVKA 4KTQA 1VRUA 4ZTFA 2F4VK 3HO1A 4CJKA 3TU5A 4LFBK 2HHXA 3BF3A 4IG0A 4FWNA 3V9ZA 2NRTA 3LM9A 1GLLO 3TSUA 1C6VA 1BWFO 3I56N 2EWSA 3OYEA 4E7JA 3KLGA 3F5TA 4CZKA 3WEEB 3HPOA 2VYPA 5LL6Z 3KJVA 3MXJA 1C0FA 3NAEA 2UXCK 3DXMB 1VQ7N 3CM6A 3A5NC 4RW7A 3SUQA 4BG9A 3F9MA 4ELTA 4DTXA 1NGHA 3T7ZA 4E0DA 3KWIA 2XY8A 3J8AA 3HL8A 3A8YA 1VQNN 4B9MA 1JCEA 4A57A 3OJUA 3OYMA 3RMCA 4DTMA 1WB9A 3DI6A 4AILC 3TARA 3WNFA 3CMAN 4KH6A 4FJNA 1UWBA 1B92A 3GBTA 3H3NO 5DM6L 2ZGYA 4B1WB 3CHWA 5FRNA 1NGDA 4B9TA 3ZSXA 4LF9K 3EE9A 3MWPA 1U4BA 2CGLA 2NNWA 3VF2A 3CJ7A 1ASUA 4OKJA 1RCHA 3L4IA 3OA9A 4BE0A 5JLHA 3V9UA 3D0PA 2D4WA 1DKGD 4CEEA 1S72N 3PIOL 4LF6K 1J53A 3RWUA 2EX3A 1NK0A 1EP4A 3MECA 1JCGA 3UKUB 3ZEUA 3VA3A 1S1TA 1LW2A 4B08A 1RDDA 4JI3K 3VQAA 5ADXA 5AQSA 4CEQA 1TGOA 3VQ4A 3TI0A 4CJ4A 4CGFA 2E20A 3EYZA 5LJWA 3FLCO 3OYLA 3ZT2A 4BRPA 1C0MA 5HL7L 3LP2A 4X64K 1HMVA 1OVYA 4FL9A 3KKSA 3TAFA 4NO7A 1NJXA 3MAQA 3CG7A 1TK5A 1GLJO 3PX6A 2QWLA 2IS3A 1GOBA 1ATSA 5CR4A 2FBVA 1BCOA 1TKXA 3AVIA 1O13A 1B9DA 4QAGA 2BANA 3CPEA 1KVAA 4RW6A 1SUQA 1QHAA 3OW2M 2P9PB 1HKCA 4EZ9A 1GLEG 1MWKA 2UYTA 3H3OB 5AQFA 4K41A 4FJJA 2IIRA 1XC3A 4FM0A 1Z6RA 1SKRA 1HPMA 1VQ5N 1BIUA 3QEWA 4W5TA 1VQON 4C8KA 4PUOA 1OH6A 3V9SA 3M6GA 3HSCA 4B9QA 1G99A 4GKJK 1M1KO 3PUFA 1LWEA 1NGAA 1LAVA 2YCHA 4M63C 1K8AO 3JS6A 4CHYA 3SMPA 4RW8A 1NK9A 4BROA 4RG8A 1ATNA 3VQ8A 3ZX3A 1XMOK 4IJNA 2OCEA 2VQEK 4I6MB 3SYZA 1CZAN 1F21A 4N41A 4WFAL 1WAJA 3NCIA 1N32K 5K14A 3P83D 5AQYA 3QETA 2O8BA 4BGBA 1D4XA 4EP4A 3U3GA 3CF5L 1KVBA 2IDOA 4F2SA 1QSLA 1BL3A 1T8EA 1IV0A 3W3DA 1NMNA 3FFKB 1L3TA 1OH8A 5FPMA 5FROA 4PKGA 2Z1GA 4N5SA 3RSEB 1LOTB 4CJ3A 4WFNL 4AM6A 3CQYA 3EY1A 1NLVA 1RDAA 4DFMA 1QQCA 1KC8O 1XC9A 3CI5A 3MCAB 3ENBA 3RMDA 4E89A 3T69A 4PHTX 4DF4A 2XY6A 3RMAA 4CEBA 4MO4A 1VSDA 3OYDA 2YHXA 3G4SN 5KTQA 4CGDA 1Z05A 4KHPK 1C0TA 2ASOA 4BWJA 3E9LA 3MN9A 5FDLA 4EAHD 5I42A 2E88A 4IDKA 4CK3A 1U2VB 2OANA 4FVMA 4F8RA 1BQMA 5J2QA 4E7HA 1I39A 3J81O 3SAFA 3VN5A 4OPJA 4DS5A 1JXEA 1RT6A 1Q7YO 2E1YA 3CCMN 1FKOA 2D0OA 4BDZA 4KHWA 3M1FA 2QWOA 3S3MA 3OYGA 3QNNA 2Z1IA 5C10A 1EX4A 5M1NA 4DS4A 4JYAK 3U9ZA 4BR9A 3QINA 4CZEA 4FJKA 1QS4A 4GV3A 4L8RB 1JL2A 2YHBA 4LF4K 4FK2A 4H4OA 2Q0UA 4JKCA 4JAXA 3TTFA 3ULDA 4J2AA 4H5RA 2FBYA 1X9SA 1E4FT 4MQ3A 1SS6A 3EKUA 3VGLA 5DMRA 2HBLA 2ITGA 1WOQA 2X78A 3AO1A 1RBVA 4JEPA 4FJXA 2VG6A 2XHBA 1U49A 1Y97A 5C12A 2P9LB 4JI5K 4NCGA 5BRFA 1NJIO 2HMPA 4YOUA 1DGKN 1IBLK 3O9QA 1XHXA 1HNVA 4K42A 3TAMA 5LMUK 1TKZA 3NHGA 3R1XA 1D8YA 5LMNK 2OYQA 2HF3A 3VTHA 1BA0A 4MDAA 3WQUA 4IOAL 5EU7A 5GAHP 4BRDA 3U3YA 2OZMA 4KHSA 1A5VA 3LP3A 3LP0A 3TAQA 3FZLA 3PO5A 5ADXH 2YV0X 3O4QA 4JD2A 5JVHL 3TTCA 3WUHA 5GIOA 5GINA 3OYBA 2F9WA 1VQLN 1D9FA 3CCVN 4FLYA 1EWQA 3NF7A 1A5WA 3C6HA 1NJYA 2F8SA 4FXDA 2QKKA 4CBXA 3I0RA 2OTLN 5AQIA 1RT3A 1S1XA 3CETA 4O0JA 1NGEA 1WSIA 2QTDA 3MDQA 3VQ6A 5H1SQ 2P9UA 1HYZA 3FE1A 3FZMA 4ILHA 4XEIA 3NH2A 4CJUA 1NJWA 4XH5A 4FSVA 4FW2A 3ULEB 4BE2A 3IS9A 1Z25A 4DHYA 3QICA 2G8FA 3G10A 3GE1A 3KLFA 3SUOA 3VQBA 3DLBA 4V19S 4JN4A 3SNNA 4F3TA 4DWIA 3QMLA 4KI4A 3WXMB 1HKBA 1GLBG 3SUPA 2YKNA 4AHUA 3U4LA 1RGIA 3O5BA 2HHTA 4H5NA 5KRSA 3RR8A 3DXKA 4FJMA 1HNWK 4YOVA 3M3ZA 1K9MO 3C7NA 1LCUA 3TSPA 3HM9A 2UUCK 3CCEN 2UU9K 3BZKA 5AZJA 4ZHRA 4OGEA 2FF3B 2P9KA 2P5GA 3FZHA 3AA2A 1JLQA 5EY4A 4DU4A 4M3RA 4K8XA 2YJEA 3SK3A 4JNEA 2ZJQL 3C6TA 4BVOA 2XY5A 2BDPA 1NMDA 3M8RA 3DYAA 4M3XA 3O6WA 1YJNN 4KI6A 4CZLA 4HTLA 4QOZB 3VEYA 2NRWA 4FZYA 1E4GT 4JI2K 1LWFA 4C1NK 4I9LA 4DKWA 4I2PA 1M90O 3ISNC 1BU6O 3SZ2A 4BREA 1EQYA 3HOSA 4JV5K 3K58A 1G15A 4IZ9A 2IVOA 3TAPA 2ITMA 4H5VA 4CGHA 5AJ3K 4CF9A 3UB5A 2PAVA 3VQPA 4DR4K 3BY5A 3SAGA 4JI7K 4BWMA 3MN6A 2Q31A 4DQRA 4H0PA 2ZWHA 5AR0A 1QQOA 1EXQA 4CGIA 5F1XA 5CY4A 5GAEP 3SPYA 3HK2A 2ZQBA 1K73O 1JL1A 3K59A 3T1HK 1TYQB 4JK9A 5JS2A 3D45A 1UOCA 4DV0K 3CCRN 4DR5K 4CI6A 3UKRB 4B9UA 1BHLA 3A5MC 3DLEA 3RMBA 1HPZA 2O8CA 2D1KA 4FM2A 2ZE2A 3KHYA 4GVMA 4JI0K 3VEWA 4B3SK 2E5LK 5GADP 4H03B 4CHQA 4PQUA 1Q8IA 4DV3K 1IKVA 4CFBA 4JHDA 4C8NA 3C94A 3D6RA 3L2VA 2E6LA 3QBXA 4R79A 3J80O 4UY8O 4F4KA 4GVEA 4JS4A 2LSNA 3T1YK 4J2EA 3S41A 3GOIA 4DV5K 4DLEA 2HF4A 2O4IA 4FJ5A 1NK7A 1LV5A 4FJ8A 2KFZA 5JLFA 3AY9A 3LPUA 3VERA 3CCLN 5FLXO 1BDGA 2A5XA 1VSJA 1FKPA 3HZ6A 4JLHA 2P9IB 4LF5K 1SQKA 1IO2A 2BH1A 4NXMK 2XRIA 2E4LA 2HHQA 4GY2B 2GV9A 1EETA 3O1WA 4CFAA 4CJFA 4K8ZA 4B9SA 4ELUA 4CJTA 4JRPA 1TV6A 5C42A 4G1QA 3SCXA 1KXPA 3ENOA 4DSFA 1SKWA 2ZJRL 1ZBLA 1BISA 4DR1K 5HRSA 1JLBA 2EHGA 4KTWA 5CZ2A 4IXCA 3HP9A 4IG3A 1X9JA 1WSFA 1EWRA 4AH9A 2VGNA 3MX5A 4EIAA 1GLDG 4QS9A 1NG9A 1JJ2M 3O8MA 4CHPA 4Q5VA 1NOZA 1ZBHA 2D0AA 3B8AX 3QIOA 2HB5A 2B6AA 1CZ9A 4NYNA 1KFDA 4FWMA 1K8KB 2OPSA 3AVMA 1T03A 1NKCA 4CJ7A 3HOTA 4E1NA 1YVUA 1DTTA 4GNIA 3J7YP 4EHUA 1T7PA 3VQQA 3NF8A 4BRKA 4BRLA 3CXCM 3HRGA 3ITHA 4GV9A 4FJIA 4CJPA 2HBKA 3KLIA 3DLGA 4DMNA 1RTDA 3OYCA 4IOCL 2GWJA 3MXMA 3I55N 2NRZA 1RT1A 3KK7A 4JI6K 4CJLA 4DV6K 1QSYA 1CXUA 2JWLA 3E01A 4LH5A 2FBTA 3PY8A 4H8KA 3UIQA 1YT3A 3KWGA 1TK0A 3MCPA 1OKJA 3NFAA 1YVNA 1J5EK 4J2BA 3CJCA 5E84A 2W41A 3BDPA 3DLHA 4DV2K 3SJHA 1S22A 4CBWA 4CF2A 4C23A 3NVMA 1YTAA 1DTQA 2I7PA 3GL1A 2GUPA 3QB0A 5AFUA 2Q0RA 3I33A 3AVAA 2O8FA 5EVZA 3WXLA 2O8DB 5AQHA 4BRGA 4IFYA 4BRMA 5AQZA 3O08A 5AQTA 3LAKA 3V9XA 2JWKA 5KI6A 3THYB 4DV7K 4I9QA 3SQ0A 4FJGA 1KTQA 3SQ2A 1V4SA 4BR4A 2UXDK 2GEMA 4KB1A 2GELA 2E8AA 1IH7A 3HTVA 3AO4A 3THXA 3LDQA 4X65K 4BE1A 3ZSVA 2VGMA 3R9PA 4HCBA 2CH5A 5BPMA 1JLAA 3V1QA 1NK4A 1KAYA 5ELZA 1ASVA 4AHVA 1J5OA 4CEDA 4DTNA 4U7BA 3LANA 5EX5A 1ZBFA 1BI4A 1J54A 1X3MA 4CJEA 1XHZA 1YHQN 4BRHA 5BN8A 1Y64A 4BACA 4W5RA 3CJ1A 2GBZA 1XQSC 1IG9A 3DOLA 1NU0A 4RW4A 4CIEA 1X1PA 3AVFA 3VTIA 1SV5A 4DQPA 3LWLA 1LAWA 2E6MA 2PFUA 2P1JA 2NUBA 5IWAK 2QWRA 4JKFA 4LFAK 1IG8A 2RPIA 3NGYA 1IBMK 2P9NB 3F2KA 3CERA 4K0KK 2PY5A 3O9SA 5BN9A 4CCHA 1YUWA 5IT9O 4LF8K 5FPNA 5M1PA 1RDUA 3AVBA 1KCFA 4DV4K 3VGMA 2HOEA 4CF0A 2P51A 4B1VA 3ALYA 5BPLA 3CCQN 3DRPA 4FK0A 3ZT1A 2F8TA 1OVQA 4DQQA 2W40A 4B9VA 1MWMA 3TSQA 1NWKA 5AQQA 1NM1A 4E7IA 2G8VA 3CFPA 4LC9B 3O1BA 4DU3A 2BGGA 1JLGA 2Q97A 3AVCA 3VQCA 4FPAA 4JK8A 3RRHA 1YIJN 3AVLA 5KPRA 1NK8A 4BRFA 4CIGA 1QSSA 5AQXA 3D2EB 4J2DA 3FGUA 1HNXK 3V1RA 2Y1JA 3TPQA 3CD6N 4C8OA 3I8DA 5J2PA 4ILJA 3N4PA 4DR6K 3KK3A 2NLXA 5HRPA 1TL1A 1Q9XA 5D3GA 3KLEA 4CE9A 4M7XA 3ASMA 1JKHA 3R6MA 3V9WA 2Q36A 2PYJA 3OYJA 4Z4GA 4DQSA 2HVIA 4YOXA 2AA4A 4B1XB 3MX2A 3LWMA 2FSKA 2Q2RA 4CJWA 2QW9A 4H0YB 4A5AA 2P9SA 3O4WA 1RBTA 4YHHK 4FM1A 5BREA 1ZXOA 1NJZA 5J2MA 1VSMA 1HNIA 3AO2A 2R7YA 3CJ9A 4GW6A 4KFBA 3ZSOA 1BGXT 1KFSA 2YHWA 4CGJA 4TSXA 1TK8A 1TUUA 1NGCA 4XH1A 3OTOK 3ZEUB 2KZMA 5JMVA 3CM5A 3VEXA 3O4NA 1Z26A 1C0GA 1VQPN 1FJGK 2KLAA 1Q18A 2AJQA 2O4GA 3AA3A 4O0IA 4M3ZA 2J4RA 3LAMA 4RWTA 1QZ6A 1XWLA 5M1QA 1S1UA 1RBUA 2WOMA 1W97L 2DFHA 4O5FA 1WSGA 4FJHA 3ZT4A 4BRNA 4DR2K 4CVNE 1KAXA 1CXQA 4Y0WA 1TAUA 3UE5A 5AZIA 4HHTA 4FWLA 1W9HA 4E1MA 3K5NA 2OTJN 1RTJA 4W5QA 4J8FA 4CZMA 3U8XA 3O80A 2Z1JA 4LH4A 3Q7BA 3NMUA 1NBWA 1SAZA 3MEEA 3ZX0A 4W5NA 5AFUH 1L5UA 4OKKA 2XY7A 4IFEA 4JKGA 4BDPA 5AQMA 4WCEL 2CGJA 3HVRA 1QQMA 1YAGA 2X6NA 5AQGA 4U67L 2PZSA 2CH6A 4Z0UA 3NH1A 2KZZA 2FLOA 4CF8A 4EZ6A 4ICLA 4FK4A 3CQXA 5KQDA 2NRXA 3J7AP 2W6KA 1HYVA 3THWA 3K5OA 4LFCK 4KKOA 1UA0A 1BO5O 5KGXA 1DLOA 4FLZA 2FSNA 3U6FA 3SQ1A 1ZBSA 4OX9K 2HSTA 1OH5A 3D2FA 3A5LC 4HCCA 4CD3A 2O8BB 4RCHA 4A2BA 5DM7L 1CLQA 3VOVA 2O8EA 2F96A 4ID1A 5TKYA 1HYSA 4FW1A 3E66A 3VETA 4IO9L 5M1OA 3DRRA 1HQUA 3GDQA 1SL2A 3DLRA 3HM8A 3KZBA 4WFBL 1RBSA 5CE3A 4IFVA 5AQWA 3OBWA 3H1VX 1NGFA 3M8SA 1I94K 1VSEA 4DTOA 4BC2A 4CHZA 3QEXA 4DTRA 4O8KA 1ZBIA 1HX1A 4FLWA 5FRMA 2D0CA 3H46O 3RRGA 3WNGA 1W0HA 3DLKA 3AO5A 4CBUA 4PKHA 4BG8A 5C25A 3ZETA 4CJSA 3OYAA 1N36K 2G8WA 2E2PA 1OH7A 5C24A 4PY5A 3RVCA 3DLLL 2ZM6K 3IMXA 3VQDA 3V1OA 4N76A 3LZJA 3C0BA 4HWIA 1RBRA 3AA4A 1QE1A 3BUZB 3SBTA 4FWPA 1GLCG 4A5BA 3A0IX 2BTFA 2B5JA 2JGUA 3WXJA 4JK7A 1MDUB 1SZ2A 1ESVA 3Q7CA 3KIOA 2HBMA 4PKIA 4K25A 3P5JA 3CQ8A 3CCUN 2QWPA 1K8KA 4DU1A 3B6OA 4C1NI 4ID5A 3CYMA 3PX0A 1WSHA 2QWMA 4B3MK 5LY3A 2VG7A 3WEEA 5CYQA 1X9WA 1VRTA 4H0XB 4O4GA 4DFPA 3MN5A 3VPZA 4CJQA 3IUCA 2Z1HA 3DXMA 1ATRA 3TANA 2KFNA 1T6CA 2RF2A 4JKHA 2QXLA 2HMIA 1BG3A 2FBXA 3EO3A 2D0PA 5AQNA 3I8BA 4OLAA 4EHTA 2GTDA 1S1WA 3SBGA 3I0SA 1HRHA 4BDYA 4CFDA 1X9MA 3OYNA 4M45A 5HP1A 3K9KA 5AQPA 4DLGA 1SKSA 2HBJA 1KLMA 2WBNA 3BGRA 3ID8A 3PX4A 3FZFA 2G8HA 2QI2A 1HQEA 4WQ5C 5AQRA 2G8KA 3CPWM 4PL8A 4M3UA 3S9HA 5JICA 3FZKA 2OPQA 3G6EN 4DSEA 4Z4FA 3S3OA 4WQ5A 1ZC6A 1N33K 2KTQA 3SQ4A 4F2RA 3AVJA 2ASPA 2FSJA 4IJAA 2OZSA 3EKSA 1RTIA 4JD2B 1VQ4N 1SL0A 4A62A 4H5WA 4FZZA 3QDKA 5AQLA 3SI6A 4BR5A 4AF1A 3HT3A 1YJ9N 3L0QA 2HHSA 3UKUA 3KD1E 3HI0A 3ZSYA 3NVKA 3L6QA 4BQZA 3E9OA 1TVRA 1YXQA 4CJVA 5FPEA 3A5OC 3EZWA 3K5MA 5I9EB 2VQFK 4BR0A 2IVNA 4BC3A 2P9UB 4AQYK 5KRTA 4FCYA 3KTQA 1T3VA 2Q1NA 4FOEA 4FLVA 2YNFA 4DSIA 3L3UA 5SWMA 3DJCA 4OJRA 3WQTA 2BUPA 4OPKA 1QHTA 3JAMO 2F9TA 3QNOA 1QQNA 5SZTA 3QO9A 3AVHA 1O1WA 3OYFA 4OO1J 4BVPA 3OVNA 3HPHA 4Q0BA 4CD1A 3FR0A 4ELVA 1YTUA 2A3ZA 2P9PA 3KK1A 3LP1A 1YITN 3DXKB 3S3NA 4R5PA 1NK5A 3PSFA 3VESA 3L2QA 1J9AA 2YKMA 2HHHK 3C7NB 1JLCA 1IKWA 1S6PA 3NGZA 4B1ZA 4HUFA 4JKDA 5KPTA 3M5RA 2DFFA 4YDUC 5AZJB 2P9KB 4HVJA 4Z4EA 2E2NA 3H45C 2HW3A 5HRNA 2DPNA 5E26A 3QFUA 4YDUA 4B8CA 4DSLA 4E19A 4FYDA 3EL2A 4FLTA 2E2QA 1E3MA 4X62K 2HVHA 3IG1A 5TKWA 1P90A 1U47A 3VEOA 4CZGA 4KPYA 1L3UA 4DF8A 3ZLJA 4Z4CA 3ZSZA 3L2WA 1U6ZA 4CK1A 3VENA 4ILGB 5MLCQ 4BRQA 3AV9A 3LDSA 4I6MA 1L3VA 2YJFA 3O3GA 3O3HA 1VSLA 5BR8K 5BRHA 1WSEA 1NGBA 4GKKK 3VEZA 5AQKA 4KAZA 4JRQA 1JCFA 1YI2N 3VQ9A 3W0LA 3LPTA 3SMSA 1T6DA 4FLUA 4ISGA 3AVNA 2A41A 3RSEA 3HBTA 2QXFA 3DAWA 1K6YA 1RTHA 3D2EA 1MA9B 4EFHA 4XIUA 4B1UB 5CZ1A 3OS0A 2QWQA 1WSJA 4H0VB 3QERA 3AA5X 4NCBA 4CJ5A 3P39A 2YNGA 2P5OA 3N4QA 1RNHA 3CMEN 4CZIA 3CJAA 3CCSN 3PV8A 4AHCA 3AAQA 3CC4N 5M1FA 2KW4A 5CYMA 5GAGP 1U2VA 1VHXA 4DB3A 1BUPA 1S6QA 2O8CB 4JI1K 3ATUA 4IKFA 3NF6A 1VSFA 4CZJA 4HTUA 4B3OA 1N34K 4H0TB 2RKIA 4JHDB 4PWDA 4DQIA 1D5AA 3BF1A 2A40A 3D7EO 4KHNA 3O9TA 3QFPA 2Y1IA 5F0XA 2VWKA 1U48A 2HHVA 3O9UA 1BQNA 3GG4A 3MN7A 5HLFA 1D9DA 3BZCA 4KH5A 4E7KA 5T7BA 1KLNA 3HP6A 3OJSA 3EZ5A 2B4JA 4AHSA 4FWSA 4IO8A 1LW0A 1DT9A 5HOOA 3OS1A 2G8IA 1XNQK 1YJWN 3FFIA 2IAJA 2V52B 3V6DA 1GOAA 4I7FA 4X66K 2DY4A 4NYFA 4DCHA 1VAZA 4G9ZA 1VSHA 4KHYA 2W6LA 2QWNA 4LD0A 1HLUA 1RT2A 4M3WA 2HHUA 1T44A 1TKTA 1WNSA 2P9LA 2YX6A 4DTPA 4JKAA 1VQ9N 2V7YA 4M7YA 2RHKA 1QZ5A 2ATQA 4OPAA 1S9GA 1GLFO 5EOYA 4KO0A 2JLEA 1A5XA 1IKXA 4KB0A 2HHWA 4FPBA 4CEZA 3DWLA 2HNZA 4DFJA 3AGKA 2QEXN 1ITGA 4IOXA 3R8EA 1TUYA 3KKRA 4A59A 4BR7A 1T05A 3AARA 3CFOA 3A2FA 3SPZA 5AQVA 1GLAG 4WYBA 2GX9A 4C8MA 1R0AA 1HKGA 1U04A 4HUEA 4B9NA 3ID6A 1KAZA 4DTSA 4NLCA 5BPNA 1C0UA 3OYHA 2IC3A 3KVGA 3DRSA 4DUYK 4O55A 1KD1O 4K43A 4E1JA 4OGCA 2NRVA 2D5RA 1KRPA 2DTUA 1VQ6N 3JSMA 4Z94A 4JI4K 5CHIA 3M8QA 2OPRA 5HBMA 2H3GX 3VF6A 2WUSA 3LDPA 1GOCA 2I5JA 3CC2N 5KGWA 1WLJA 3VQEA 4B8AB 3VMFB 1VQKN 1B9FA 3BEXA 1BIZA 3ULEA 3J7ZO 2NRHA 3HVTA 3KK2A 4DQ8A 3NBPA 1NK6A 2G8UA 3IRXA 3JYTA 2UUBK 4M3YA 4DTUA 1RDBA 2QKBA 3LZIA 1XI1A 2GUIA 4O5BA 4BRCA 4QS7A 3HPGA 5LJVA 3E9PA 1ZBUA 4E7LA 3WXIA 4Z4HA 3RR7A 1HJOA 3OHRA 2IOCA 2I7NA 4QS8A 4YNQA 1UAXA 2O8FB 3WNHA 3ZX2A 4ISEA 4CHNA 2KQ2A 1EO1A 4FJ9A 4IEEA 1NNEA 4KTZA 2W42A 3U9DA 2WTUA 3L2UA 2X6SA 1S3XA 3P4IA 3F9KA 3DOKA 3PLAA 3ZCMA 3DM2A 1N6QA 4CECA 4JS5A 4CK2A 5BRDA 3HJFA 3TABA 4Y1CA 3QEVA 1L3SA 5I3UA 5J1EA 5F2RA 4M41A 4DSKA 2A1SA 3THXB 4GV6A 3O3FA 3MK6A 3WNEA 3OBYA 4MLEA 1XMQK 2VCPA 3LALA 1Q9YA 3R3LA 2RN2A 1NGIA 2V7ZA 1N8RO 3CFRA 4AHRA 3G71N 1BI4B 2DFEA 1JLFA 1HJRA 1W2BM 4LSLA 4FZXC 4BC5A 3G25A 4F3OA 1Q82O 3K57A 1TL3A 2YI1A 1HUXA 4M3TA 4DG1A 1HR0K 2ASMA 3VGKA 4W5OA 1XUPO 5HRRA 2KKZA 1TAQA 4O8UA 1RDCA 1KSPA 4WF9L 1VQMN 2VG5A 1QVGM 1VK0A 4GMJB 3BP8A 3OYIA 1W7AA 4Z4IA 1TYQA 4DTJA 5J2NA 2OA8A 3MEDA 1C1BA 2YHYA 1WAFA 2PYLA 4AM7A 3AVGA 4PL7A 4FJLA 3UKRA 3TTDA 1RILA 4Y1DA 1EKEA 3KLHA 3OYKA 3TWHA 5KPZA 3OS2A 4ISFA 1R59O 4LSNA 1NKEA 4KV8A 3QESA 3TAEA 5HROA 3EN9A 3VF4A 4CZHA 3NDKA 1S1VA 4M42A 1UA1A 3TR8A 5AQJA 2V51B 4BC4A 4CHOA 4CW7B 4B1YB 3SAHA 1WN7A 1Q86O 4FWOA 3KD5E 3T19A 2UXBK 4BGAA 4HUGA 1WBDA 4A61A 4CF1A 3K0SA 4RTFD 3LDNA 1VQ8N 4KHUA 1FW6A 4NB4A 3K9JA 2HNDA 1IBKK 4JKBA 2X74A 3THVA 4FVUA 1JLEA 4CGGA 4E3SA 3EE8A 3CIPA 2BE2A 1FK9A 4BRAA 4QCLA 3V4IA 2P9IA 4A2AA 1SL1A 4CESA 1BOTO 2ZGZA 2A6AA 4JKEA 1WUAA 4CZFA 4B3TK 5JVGL 3MEGA 2IVPA 3LM2A 3L4QA 1IKYA 3QBWA 4IBNA 4B9LA 4N56A 2QM1A 1LWCA 3IAYA 1REVA 2HNYA 2OPPA 5BR9A 3CC7N 4DR7K 5C2DA 1RDWX 2P9SB 2AP1A 4MO5A 4IDHA 5AQUA 4WQ4C 1RFQA 3ATVA 4NXNK 4XH4A 4IEIA 1HNZK 3MXIA 4H0OA 3T1AA 4OKEA 4DUZK 3RTVA 4KREA 4EP5A 3O9RA 4OPHA 3NE6A 4FWRA 3V81A 4WQ4A 3H08A 4BRIA 2Q3SA 3QLHA 5DK5A 3B6PA 1I3AA 5GIPA 3LDOA 3MMVA 1J6ZA 2D0BA 2WFBA 4CIFA 3NF9A 4OVLA 4JI8K 1BCMA 4YOTA 3L3VA 4LY7A 3DMJA 4CJRA 3P31A 3SLCA 3IKMA 5A2QO 3VEVA 4DR3K 3WT0A 5C15A 1VSIA 2ZD1A 3C95A 3C6UA 2KHOA 3F73A 3L8BA 3ZSRA 2IGIA 2ZF5O 3P1GA 1U45A 4LF7K 1S5JA 5C2FA 3HXMA 4CFCA 5AZIB 3ZSQA 2E2OA 1S9EA 3G0ZA 4F9OA 1NOYA 3NH0A 2FC0A 3H6EA 2QA4N 1JXBA 4FO0A 3SV3A 2YNHA 4KRFA 5M1KA 3HSTB 3LDLA 2E1ZA 3MWTA 4BY9C 1MU2A 4UQGA 5C0YA 3K2PA 1BA1A 1C1CA 4JKGB 1FXXA 4MFBA 1RT5A 4C8LA 3AAPA 4KH4A 3M8PA 3ZSWA 2VWJA 4RW9A 2XO7A 4CEFA 2WONA 2CGKA 4CEAA 4CERA 1NGGA 4YOYA 3SV4A 3TAGA 3NGIA 2A1RA 2ZJPL 2GWKA 3WXKA 2O8DA 3SJJA 2YHAA 5FPDA 5E41A
chains in the Genus database with same CATH topology
5AQIA 3C65A 4ILJA 3CCSN 2VWBA 3N4PA 3CETA 1NGEA 3AAQA 2QTDA 1X3NA 3MDQA 3P38A 4BR2A 3CC4N 2NLXA 5M1FA 4BQLA 5H1SQ 5B8HA 1H1VA 3H1QA 4M7XA 4MLHA 3CCJN 3D2FB 2P9UA 5GAGP 1Q81O 1U2VA 4DB3A 3FE1A 3R6MA 1BUPA 3FZMA 2Q36A 3IFRA 2F7TA 4ILHA 4XEIA 3ATUA 4MDBA 4XH5A 4FSVA 3ULEB 4CZJA 3PIPL 5KQ8A 4YOXA 2AA4A 4YORA 4B1XB 3MX2A 4DHYA 2FSKA 3QICA 2Q2RA 3ENHA 2QW9A 4H0TB 4H0YB 4A5AA 2P9SA 3GE1A 3O4WA 4JHDB 3BF1A 5BREA 2A40A 3D7EO 1ZXOA 3C6AA 3O9TA 3QFPA 4JN4A 3ZYYX 5F0XA 3QMLA 1YF5L 3WXMB 1HKBA 3MN7A 1GLBG 3GG4A 3O9UA 3CJ9A 1ILYA 4KH5A 3U4LA 2NRRA 1RGIA 2YHWA 3O5BA 1KQSM 5EXWA 4H5NA 1TUUA 3DXKA 3LL3A 1NGCA 4FWSA 2RE2A 3IDHA 4IO8A 4XH1A 5AQOA 4YOVA 3M3ZA 1K9MO 3ZEUB 1DT9A 4FWKA 5JMVA 3VEXA 3C7NA 5HOOA 4YOWA 2FF6A 2FXUA 1LCUA 2WC9A 1C0GA 3JXUA 4FWQA 3TSPA 3CCEN 1VQPN 5AZJA 1YJWN 2KLAA 2FF3B 2P9KA 1Q18A 3FZHA 1P8ZA 5EY4A 2PBDA 2NZTA 1V4TA 2V52B 2J4RA 2A42A 1QVFM 4FOIA 1DEJA 4KBOA 1QZ6A 4RWTA 3E1YA 1IJJA 2YJEA 4IWVA 4JNEA 3SK3A 3ZETB 2ZJQL 4NLBA 5M1QA 4DCHA 4BVOA 1VAZA 3CJBA 4G9ZA 1W97L 1NMDA 2QWNA 4H5TA 1HLUA 4L3QA 3AGRA 4O5FA 3O6WA 1YJNN 1T44A 4BRNA 2P9NA 1NGJA 2P9LA 2YX6A 1KAXA 4Y0WA 4CZLA 3UE5A 5AZIA 4HTLA 4FWLA 3VEYA 2NRWA 4JKAA 1VQ9N 2OTJN 2V7YA 1E4GT 4M7YA 2RHKA 1QZ5A 4J8FA 4OPAA 4CZMA 3U8XA 1GLFO 3O80A 5EOYA 3TU5A 4C1NK 4DKWA 3BF3A 3NMUA 3Q7BA 1NBWA 1SAZA 4FWNA 2NRTA 1M90O 3ZX0A 1BU6O 5AFUH 3LM9A 4FPBA 1GLLO 3DWLA 1EQYA 4BREA 3TSUA 4IFEA 3HOSA 4IZ9A 2IVOA 2ITMA 1BWFO 3AGKA 2EWSA 4JKGA 5AQMA 3I56N 2QEXN 4IOXA 4WCEL 4H5VA 1TUYA 2CGJA 3R8EA 3F5TA 4A59A 1QQMA 3AARA 1YAGA 3WEEB 3UB5A 2PAVA 5AQGA 2VYPA 4CZKA 4U67L 5AQVA 1GLAG 4WYBA 2GX9A 3SAGA 2CH6A 1C0FA 3MN6A 2Q31A 2FLOA 4H0PA 3DXMB 2ZWHA 5AR0A 1HKGA 3A5NC 1QQOA 1VQ7N 3ID6A 1KAZA 5F1XA 4NLCA 3CQXA 5GAEP 5BPNA 4BG9A 5KQDA 3F9MA 1K73O 2NRXA 1NGHA 1TYQB 3KVGA 3T7ZA 3KWIA 3J8AA 1KD1O 4JK9A 4K43A 4E1JA 3A8YA 2NRVA 1VQNN 1BO5O 1JCEA 3CCRN 1VQ6N 2FSNA 4A57A 4Z94A 1ZBSA 5CHIA 2HSTA 3UKRB 3VF6A 2H3GX 4CI6A 3A5MC 2WUSA 3A5LC 3D2FA 3LDPA 3CMAN 4KH6A 3CC2N 3GBTA 4CD3A 4RCHA 4A2BA 3H3NO 5DM7L 3VOVA 2D1KA 2ZGYA 3VMFB 4B1WB 3CHWA 3KHYA 5DM6L 1NGDA 3VEWA 1VQKN 3EE9A 3BEXA 3MWPA 5GADP 4H03B 5TKYA 3ULEA 3J7ZO 2NRHA 2CGLA 2NNWA 3E66A 3VF2A 4DQ8A 3VETA 3CJ7A 4IO9L 5M1OA 3L4IA 3OA9A 4JHDA 3D6RA 5JLHA 3GDQA 3HM8A 2D4WA 3QBXA 1DKGD 4R79A 4UY8O 3KZBA 4WFBL 4GVEA 5CE3A 1S72N 3PIOL 4BRCA 4QS7A 5AQWA 5LJVA 3OBWA 3H1VX 3E9PA 3S41A 3GOIA 3WXIA 1NGFA 1HJOA 2HF4A 3OHRA 2I7NA 4QS8A 4BC2A 1JCGA 3ZX2A 4ISEA 3UKUB 4O8KA 3ZEUA 1EO1A 1HX1A 3AY9A 4IEEA 5JLFA 3VERA 3U9DA 3CCLN 1BDGA 2A5XA 5ADXA 5AQSA 3H46O 3HZ6A 1S3XA 2P9IB 3P4IA 3PLAA 1SQKA 2E20A 2BH1A 4CBUA 4PKHA 5LJWA 3FLCO 4GY2B 4BG8A 4BRPA 5BRDA 5HL7L 3ZETA 1OVYA 4FL9A 2E2PA 3O1WA 5F2RA 4NO7A 3RVCA 3DLLL 4GV6A 1GLJO 3IMXA 3MK6A 2QWLA 3C0BA 4HWIA 3BUZB 3SBTA 1KXPA 3ENOA 3OBYA 4MLEA 4FWPA 1ATSA 2VCPA 5CR4A 2ZJRL 1GLCG 4A5BA 3R3LA 1O13A 1NGIA 2V7ZA 1N8RO 3A0IX 2BTFA 4IXCA 3WXJA 1MDUB 4JK7A 1SZ2A 3G71N 1ESVA 3CPEA 3Q7CA 1QHAA 1X9JA 2HBMA 2P9PB 4PKIA 3OW2M 1W2BM 2VGNA 3MX5A 1HKCA 4K25A 1GLEG 1MWKA 3CCUN 2QWPA 1K8KA 4C1NI 4EIAA 2UYTA 1GLDG 4QS9A 3H3OB 5AQFA 4K41A 3O8MA 3G25A 4BC5A 1JJ2M 2IIRA 1XC3A 3B8AX 1Z6RA 2QWMA 5LY3A 1Q82O 1HPMA 1VQ5N 4FWMA 1K8KB 2YI1A 1HUXA 1VQON 2ASMA 3VGKA 3WEEA 3M6GA 3HSCA 4B9QA 1XUPO 1G99A 4CJ7A 3HOTA 4H0XB 2KKZA 1NGAA 3MN5A 1M1KO 3VPZA 4O8UA 3IUCA 4WF9L 3DXMA 1ATRA 1T6CA 2YCHA 1VQMN 4JKHA 2QXLA 1QVGM 1BG3A 3BP8A 4GNIA 4M63C 4EHUA 1K8AO 3JS6A 4BRKA 3EO3A 3SMPA 2D0PA 1TYQA 4BRLA 5AQNA 3CXCM 4BROA 3HRGA 3I8BA 4GV9A 4EHTA 2GTDA 1ATNA 3SBGA 3ZX3A 4IJNA 2YHYA 2HBKA 4I6MB 4AM7A 1CZAN 3K9KA 5AQPA 4PL7A 3UKRA 3TTDA 4IOCL 2GWJA 4WFAL 2HBJA 3I55N 5KPZA 2NRZA 3KK7A 5AQYA 2WBNA 4ISFA 1R59O 4BGBA 3ID8A 3FZFA 2JWLA 1D4XA 3EN9A 2QI2A 3VF4A 4CZHA 3CF5L 3KWGA 5AQJA 2V51B 4WQ5C 5AQRA 3MCPA 4BC4A 1OKJA 3CPWM 1YVNA 4B1YB 3SAHA 1Q86O 3CJCA 5E84A 2W41A 4FWOA 3W3DA 4PL8A 3FFKB 1S22A 3SJHA 4CBWA 5FPMA 3FZKA 5JICA 3G6EN 4PKGA 4WQ5A 4C23A 1ZC6A 1LOTB 3NVMA 3RSEB 4BGAA 4WFNL 2ASPA 2FSJA 3CQYA 4IJAA 4A61A 2I7PA 4AM6A 3EKSA 1NLVA 3GL1A 2GUPA 3LDNA 4JD2B 4RTFD 4A62A 1VQ8N 1VQ4N 4NB4A 3QB0A 4H5WA 1KC8O 3K9JA 3QDKA 5AQLA 4BR5A 5AFUA 4AF1A 4JKBA 3CI5A 2Q0RA 3MCAB 3I33A 3L0QA 1YJ9N 3ENBA 4FVUA 3UKUA 4PHTX 3T69A 3HI0A 5EVZA 3WXLA 5AQHA 3NVKA 4BRGA 3EE8A 3CIPA 3L6QA 3E9OA 4MO4A 4BQZA 4BRMA 1YXQA 4BRAA 5AQZA 3O08A 5AQTA 2YHXA 5FPEA 3A5OC 3G4SN 1Z05A 2JWKA 3EZWA 2P9IA 4A2AA 5I9EB 1BOTO 4BR7A 4BR0A 2ASOA 2IVNA 1V4SA 2ZGZA 3E9LA 3MN9A 2A6AA 4BR4A 4JKEA 4EAHD 1WUAA 2E88A 4CZFA 4BC3A 2P9UB 5JVGL 2IVPA 1U2VB 2OANA 3LM2A 3L4QA 2GEMA 3QBWA 1T3VA 2GELA 2QM1A 2Q1NA 3SAFA 5BR9A 3CC7N 4FOEA 2E8AA 1Q7YO 3DJCA 3HTVA 3WQTA 2BUPA 3LDQA 5C2DA 2E1YA 1RDWX 3CCMN 2F9TA 2P9SB 2AP1A 4MO5A 2D0OA 1QQNA 2VGMA 4IDHA 5AQUA 4WQ4C 3R9PA 1RFQA 3ATVA 2CH5A 3M1FA 2QWOA 4XH4A 4IEIA 5BPMA 1KAYA 5C10A 4H0OA 5ELZA 4OO1J 4BVPA 3O9RA 4OPHA 5M1NA 4FWRA 5EX5A 4WQ4A 4U7BA 1X3MA 4BRIA 4CD1A 3FR0A 1YHQN 2A3ZA 2P9PA 4BRHA 5BN8A 1YITN 3DXKB 3U9ZA 4BR9A 1Y64A 3VESA 3CJ1A 4CZEA 5GIPA 3LDOA 3MMVA 3C7NB 1J6ZA 2WFBA 1XQSC 4B1ZA 4GV3A 4JKDA 5KPTA 3M5RA 4YDUC 5AZJB 2Q0UA 2P9KB 4JKCA 2E2NA 3VTIA 3H45C 4YOTA 4JAXA 2DPNA 5E26A 3TTFA 3QFUA 4YDUA 2PFUA 4H5RA 3P31A 3EL2A 2E2QA 1E4FT 3SLCA 3IKMA 1SS6A 5TKWA 3VEVA 3EKUA 1P90A 3WT0A 2QWRA 4JKFA 3VGLA 1IG8A 5C15A 3VEOA 4CZGA 2HBLA 2KHOA 1WOQA 4JEPA 2ZF5O 1U6ZA 2P9NB 3CERA 3F2KA 4ILGB 3VENA 4BRQA 2P9LB 5C12A 4I6MA 5MLCQ 5C2FA 3O9SA 5BN9A 5BRFA 1NJIO 2HMPA 4YOUA 1DGKN 1YUWA 3O9QA 5AZIB 2E2OA 2YJFA 4K42A 5FPNA 5M1PA 1RDUA 4F9OA 3VGMA 2HOEA 3H6EA 5BRHA 4FO0A 2QA4N 4B1VA 5BPLA 1NGBA 3VEZA 3CCQN 5M1KA 3R1XA 3LDLA 5AQKA 2E1ZA 1JCFA 1YI2N 3W0LA 3MWTA 4BY9C 2HF3A 2W40A 3VTHA 3SMSA 5C0YA 1BA0A 4MDAA 1MWMA 3WQUA 4IOAL 1BA1A 1T6DA 3TSQA 4ISGA 4JKGB 5GAHP 4BRDA 1NWKA 5AQQA 1NM1A 2A41A 3RSEA 3HBTA 3FZLA 3AAPA 3DAWA 3O1BA 4KH4A 4LC9B 5ADXH 3D2EA 4EFHA 1MA9B 2Q97A 4JD2A 5JVHL 4B1UB 4FPAA 4JK8A 3TTCA 3WUHA 1YIJN 2QWQA 5GIOA 5GINA 2CGKA 5KPRA 4BRFA 1NGGA 2F9WA 4H0VB 4YOYA 1VQLN 2ZJPL 3CCVN 5AQXA 3D2EB 2GWKA 3C6HA 3P39A 3FGUA 3WXKA 3N4QA 3TPQA 4CBXA 3CD6N 5FPDA 3CMEN 4CZIA 2OTLN 3CJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GX9 A;  3O9T A;  3P38 A;  3KWG A;  3EE8 A;  2RHK A;  3M5R A;  3O9U A;  4OPA A;  3O9S A;  3EE9 A;  3RVC A;  3O9Q A;  3KWI A;  3O9R A;  4OPH A;  3OA9 A;  3P31 A;  3D6R A;  3L4Q A;  3P39 A;  2KKZ A;  3F5T A; 
#chains in the Genus database with same CATH topology
 3THW B;  4NCA A;  3C65 A;  2VWB A;  4N47 A;  3THY A;  4BR2 A;  1X3N A;  3P38 A;  4DFK A;  4CEO A;  1RT7 A;  4BQL A;  4I2Q A;  3PO4 A;  5B8H A;  4FLX A;  1H1V A;  4PA1 A;  3H1Q A;  4MLH A;  3CCJ N;  3D2F B;  3VQ7 A;  1Q81 O;  4ZTJ A;  3IFR A;  3QEI A;  1ZYQ A;  4YY3 K;  2F7T A;  3QEP A;  2O8E B;  2UUA K;  4MDB A;  3K5L A;  3EEQ A;  3PIP L;  5KQ8 A;  4YOR A;  1VSK A;  3ENH A;  1C1A A;  4YFU A;  4O44 A;  3T3F A;  4FJ7 A;  3C6A A;  1RT4 A;  3ZYY X;  1YF5 L;  3OY9 A;  1ASW A;  3VA0 A;  5JS1 A;  1NKB A;  1ILY A;  3QIP A;  2NRR A;  3ZT3 A;  1KQS M;  4DV1 K;  5EXW A;  2YNI A;  3L2R A;  3LL3 A;  2QK9 A;  2RE2 A;  3IDH A;  5AQO A;  3SUN A;  4FWK A;  4YOW A;  4AHT A;  2FF6 A;  2FXU A;  3VQ5 A;  3ZT0 A;  2WC9 A;  3JXU A;  4FWQ A;  4KHQ A;  1N5Y A;  1TKD A;  1P8Z A;  4WE1 A;  2PBD A;  2NZT A;  1V4T A;  2ETJ A;  1QTM A;  4H4M A;  2A42 A;  1QVF M;  4FOI A;  1DEJ A;  3PSI A;  4KBO A;  3E1Y A;  1KVC A;  1IJJ A;  1CZB A;  4IWV A;  3ZET B;  4NLB A;  4DSJ A;  3AO3 A;  3CJB A;  1WBB A;  1XNR K;  4H5T A;  4OLB A;  4B3R K;  4L3Q A;  3AGR A;  2P9N A;  1NGJ A;  3HYF A;  3AVK A;  4KTQ A;  1VRU A;  4ZTF A;  2F4V K;  3HO1 A;  4CJK A;  3TU5 A;  4LFB K;  2HHX A;  3BF3 A;  4IG0 A;  4FWN A;  3V9Z A;  2NRT A;  3LM9 A;  1GLL O;  3TSU A;  1C6V A;  1BWF O;  3I56 N;  2EWS A;  3OYE A;  4E7J A;  3KLG A;  3F5T A;  4CZK A;  3WEE B;  3HPO A;  2VYP A;  5LL6 Z;  3KJV A;  3MXJ A;  1C0F A;  3NAE A;  2UXC K;  3DXM B;  1VQ7 N;  3CM6 A;  3A5N C;  4RW7 A;  3SUQ A;  4BG9 A;  3F9M A;  4ELT A;  4DTX A;  1NGH A;  3T7Z A;  4E0D A;  3KWI A;  2XY8 A;  3J8A A;  3HL8 A;  3A8Y A;  1VQN N;  4B9M A;  1JCE A;  4A57 A;  3OJU A;  3OYM A;  3RMC A;  4DTM A;  1WB9 A;  3DI6 A;  4AIL C;  3TAR A;  3WNF A;  3CMA N;  4KH6 A;  4FJN A;  1UWB A;  1B92 A;  3GBT A;  3H3N O;  5DM6 L;  2ZGY A;  4B1W B;  3CHW A;  5FRN A;  1NGD A;  4B9T A;  3ZSX A;  4LF9 K;  3EE9 A;  3MWP A;  1U4B A;  2CGL A;  2NNW A;  3VF2 A;  3CJ7 A;  1ASU A;  4OKJ A;  1RCH A;  3L4I A;  3OA9 A;  4BE0 A;  5JLH A;  3V9U A;  3D0P A;  2D4W A;  1DKG D;  4CEE A;  1S72 N;  3PIO L;  4LF6 K;  1J53 A;  3RWU A;  2EX3 A;  1NK0 A;  1EP4 A;  3MEC A;  1JCG A;  3UKU B;  3ZEU A;  3VA3 A;  1S1T A;  1LW2 A;  4B08 A;  1RDD A;  4JI3 K;  3VQA A;  5ADX A;  5AQS A;  4CEQ A;  1TGO A;  3VQ4 A;  3TI0 A;  4CJ4 A;  4CGF A;  2E20 A;  3EYZ A;  5LJW A;  3FLC O;  3OYL A;  3ZT2 A;  4BRP A;  1C0M A;  5HL7 L;  3LP2 A;  4X64 K;  1HMV A;  1OVY A;  4FL9 A;  3KKS A;  3TAF A;  4NO7 A;  1NJX A;  3MAQ A;  3CG7 A;  1TK5 A;  1GLJ O;  3PX6 A;  2QWL A;  2IS3 A;  1GOB A;  1ATS A;  5CR4 A;  2FBV A;  1BCO A;  1TKX A;  3AVI A;  1O13 A;  1B9D A;  4QAG A;  2BAN A;  3CPE A;  1KVA A;  4RW6 A;  1SUQ A;  1QHA A;  3OW2 M;  2P9P B;  1HKC A;  4EZ9 A;  1GLE G;  1MWK A;  2UYT A;  3H3O B;  5AQF A;  4K41 A;  4FJJ A;  2IIR A;  1XC3 A;  4FM0 A;  1Z6R A;  1SKR A;  1HPM A;  1VQ5 N;  1BIU A;  3QEW A;  4W5T A;  1VQO N;  4C8K A;  4PUO A;  1OH6 A;  3V9S A;  3M6G A;  3HSC A;  4B9Q A;  1G99 A;  4GKJ K;  1M1K O;  3PUF A;  1LWE A;  1NGA A;  1LAV A;  2YCH A;  4M63 C;  1K8A O;  3JS6 A;  4CHY A;  3SMP A;  4RW8 A;  1NK9 A;  4BRO A;  4RG8 A;  1ATN A;  3VQ8 A;  3ZX3 A;  1XMO K;  4IJN A;  2OCE A;  2VQE K;  4I6M B;  3SYZ A;  1CZA N;  1F21 A;  4N41 A;  4WFA L;  1WAJ A;  3NCI A;  1N32 K;  5K14 A;  3P83 D;  5AQY A;  3QET A;  2O8B A;  4BGB A;  1D4X A;  4EP4 A;  3U3G A;  3CF5 L;  1KVB A;  2IDO A;  4F2S A;  1QSL A;  1BL3 A;  1T8E A;  1IV0 A;  3W3D A;  1NMN A;  3FFK B;  1L3T A;  1OH8 A;  5FPM A;  5FRO A;  4PKG A;  2Z1G A;  4N5S A;  3RSE B;  1LOT B;  4CJ3 A;  4WFN L;  4AM6 A;  3CQY A;  3EY1 A;  1NLV A;  1RDA A;  4DFM A;  1QQC A;  1KC8 O;  1XC9 A;  3CI5 A;  3MCA B;  3ENB A;  3RMD A;  4E89 A;  3T69 A;  4PHT X;  4DF4 A;  2XY6 A;  3RMA A;  4CEB A;  4MO4 A;  1VSD A;  3OYD A;  2YHX A;  3G4S N;  5KTQ A;  4CGD A;  1Z05 A;  4KHP K;  1C0T A;  2ASO A;  4BWJ A;  3E9L A;  3MN9 A;  5FDL A;  4EAH D;  5I42 A;  2E88 A;  4IDK A;  4CK3 A;  1U2V B;  2OAN A;  4FVM A;  4F8R A;  1BQM A;  5J2Q A;  4E7H A;  1I39 A;  3J81 O;  3SAF A;  3VN5 A;  4OPJ A;  4DS5 A;  1JXE A;  1RT6 A;  1Q7Y O;  2E1Y A;  3CCM N;  1FKO A;  2D0O A;  4BDZ A;  4KHW A;  3M1F A;  2QWO A;  3S3M A;  3OYG A;  3QNN A;  2Z1I A;  5C10 A;  1EX4 A;  5M1N A;  4DS4 A;  4JYA K;  3U9Z A;  4BR9 A;  3QIN A;  4CZE A;  4FJK A;  1QS4 A;  4GV3 A;  4L8R B;  1JL2 A;  2YHB A;  4LF4 K;  4FK2 A;  4H4O A;  2Q0U A;  4JKC A;  4JAX A;  3TTF A;  3ULD A;  4J2A A;  4H5R A;  2FBY A;  1X9S A;  1E4F T;  4MQ3 A;  1SS6 A;  3EKU A;  3VGL A;  5DMR A;  2HBL A;  2ITG A;  1WOQ A;  2X78 A;  3AO1 A;  1RBV A;  4JEP A;  4FJX A;  2VG6 A;  2XHB A;  1U49 A;  1Y97 A;  5C12 A;  2P9L B;  4JI5 K;  4NCG A;  5BRF A;  1NJI O;  2HMP A;  4YOU A;  1DGK N;  1IBL K;  3O9Q A;  1XHX A;  1HNV A;  4K42 A;  3TAM A;  5LMU K;  1TKZ A;  3NHG A;  3R1X A;  1D8Y A;  5LMN K;  2OYQ A;  2HF3 A;  3VTH A;  1BA0 A;  4MDA A;  3WQU A;  4IOA L;  5EU7 A;  5GAH P;  4BRD A;  3U3Y A;  2OZM A;  4KHS A;  1A5V A;  3LP3 A;  3LP0 A;  3TAQ A;  3FZL A;  3PO5 A;  5ADX H;  2YV0 X;  3O4Q A;  4JD2 A;  5JVH L;  3TTC A;  3WUH A;  5GIO A;  5GIN A;  3OYB A;  2F9W A;  1VQL N;  1D9F A;  3CCV N;  4FLY A;  1EWQ A;  3NF7 A;  1A5W A;  3C6H A;  1NJY A;  2F8S A;  4FXD A;  2QKK A;  4CBX A;  3I0R A;  2OTL N;  5AQI A;  1RT3 A;  1S1X A;  3CET A;  4O0J A;  1NGE A;  1WSI A;  2QTD A;  3MDQ A;  3VQ6 A;  5H1S Q;  2P9U A;  1HYZ A;  3FE1 A;  3FZM A;  4ILH A;  4XEI A;  3NH2 A;  4CJU A;  1NJW A;  4XH5 A;  4FSV A;  4FW2 A;  3ULE B;  4BE2 A;  3IS9 A;  1Z25 A;  4DHY A;  3QIC A;  2G8F A;  3G10 A;  3GE1 A;  3KLF A;  3SUO A;  3VQB A;  3DLB A;  4V19 S;  4JN4 A;  3SNN A;  4F3T A;  4DWI A;  3QML A;  4KI4 A;  3WXM B;  1HKB A;  1GLB G;  3SUP A;  2YKN A;  4AHU A;  3U4L A;  1RGI A;  3O5B A;  2HHT A;  4H5N A;  5KRS A;  3RR8 A;  3DXK A;  4FJM A;  1HNW K;  4YOV A;  3M3Z A;  1K9M O;  3C7N A;  1LCU A;  3TSP A;  3HM9 A;  2UUC K;  3CCE N;  2UU9 K;  3BZK A;  5AZJ A;  4ZHR A;  4OGE A;  2FF3 B;  2P9K A;  2P5G A;  3FZH A;  3AA2 A;  1JLQ A;  5EY4 A;  4DU4 A;  4M3R A;  4K8X A;  2YJE A;  3SK3 A;  4JNE A;  2ZJQ L;  3C6T A;  4BVO A;  2XY5 A;  2BDP A;  1NMD A;  3M8R A;  3DYA A;  4M3X A;  3O6W A;  1YJN N;  4KI6 A;  4CZL A;  4HTL A;  4QOZ B;  3VEY A;  2NRW A;  4FZY A;  1E4G T;  4JI2 K;  1LWF A;  4C1N K;  4I9L A;  4DKW A;  4I2P A;  1M90 O;  3ISN C;  1BU6 O;  3SZ2 A;  4BRE A;  1EQY A;  3HOS A;  4JV5 K;  3K58 A;  1G15 A;  4IZ9 A;  2IVO A;  3TAP A;  2ITM A;  4H5V A;  4CGH A;  5AJ3 K;  4CF9 A;  3UB5 A;  2PAV A;  3VQP A;  4DR4 K;  3BY5 A;  3SAG A;  4JI7 K;  4BWM A;  3MN6 A;  2Q31 A;  4DQR A;  4H0P A;  2ZWH A;  5AR0 A;  1QQO A;  1EXQ A;  4CGI A;  5F1X A;  5CY4 A;  5GAE P;  3SPY A;  3HK2 A;  2ZQB A;  1K73 O;  1JL1 A;  3K59 A;  3T1H K;  1TYQ B;  4JK9 A;  5JS2 A;  3D45 A;  1UOC A;  4DV0 K;  3CCR N;  4DR5 K;  4CI6 A;  3UKR B;  4B9U A;  1BHL A;  3A5M C;  3DLE A;  3RMB A;  1HPZ A;  2O8C A;  2D1K A;  4FM2 A;  2ZE2 A;  3KHY A;  4GVM A;  4JI0 K;  3VEW A;  4B3S K;  2E5L K;  5GAD P;  4H03 B;  4CHQ A;  4PQU A;  1Q8I A;  4DV3 K;  1IKV A;  4CFB A;  4JHD A;  4C8N A;  3C94 A;  3D6R A;  3L2V A;  2E6L A;  3QBX A;  4R79 A;  3J80 O;  4UY8 O;  4F4K A;  4GVE A;  4JS4 A;  2LSN A;  3T1Y K;  4J2E A;  3S41 A;  3GOI A;  4DV5 K;  4DLE A;  2HF4 A;  2O4I A;  4FJ5 A;  1NK7 A;  1LV5 A;  4FJ8 A;  2KFZ A;  5JLF A;  3AY9 A;  3LPU A;  3VER A;  3CCL N;  5FLX O;  1BDG A;  2A5X A;  1VSJ A;  1FKP A;  3HZ6 A;  4JLH A;  2P9I B;  4LF5 K;  1SQK A;  1IO2 A;  2BH1 A;  4NXM K;  2XRI A;  2E4L A;  2HHQ A;  4GY2 B;  2GV9 A;  1EET A;  3O1W A;  4CFA A;  4CJF A;  4K8Z A;  4B9S A;  4ELU A;  4CJT A;  4JRP A;  1TV6 A;  5C42 A;  4G1Q A;  3SCX A;  1KXP A;  3ENO A;  4DSF A;  1SKW A;  2ZJR L;  1ZBL A;  1BIS A;  4DR1 K;  5HRS A;  1JLB A;  2EHG A;  4KTW A;  5CZ2 A;  4IXC A;  3HP9 A;  4IG3 A;  1X9J A;  1WSF A;  1EWR A;  4AH9 A;  2VGN A;  3MX5 A;  4EIA A;  1GLD G;  4QS9 A;  1NG9 A;  1JJ2 M;  3O8M A;  4CHP A;  4Q5V A;  1NOZ A;  1ZBH A;  2D0A A;  3B8A X;  3QIO A;  2HB5 A;  2B6A A;  1CZ9 A;  4NYN A;  1KFD A;  4FWM A;  1K8K B;  2OPS A;  3AVM A;  1T03 A;  1NKC A;  4CJ7 A;  3HOT A;  4E1N A;  1YVU A;  1DTT A;  4GNI A;  3J7Y P;  4EHU A;  1T7P A;  3VQQ A;  3NF8 A;  4BRK A;  4BRL A;  3CXC M;  3HRG A;  3ITH A;  4GV9 A;  4FJI A;  4CJP A;  2HBK A;  3KLI A;  3DLG A;  4DMN A;  1RTD A;  3OYC A;  4IOC L;  2GWJ A;  3MXM A;  3I55 N;  2NRZ A;  1RT1 A;  3KK7 A;  4JI6 K;  4CJL A;  4DV6 K;  1QSY A;  1CXU A;  2JWL A;  3E01 A;  4LH5 A;  2FBT A;  3PY8 A;  4H8K A;  3UIQ A;  1YT3 A;  3KWG A;  1TK0 A;  3MCP A;  1OKJ A;  3NFA A;  1YVN A;  1J5E K;  4J2B A;  3CJC A;  5E84 A;  2W41 A;  3BDP A;  3DLH A;  4DV2 K;  3SJH A;  1S22 A;  4CBW A;  4CF2 A;  4C23 A;  3NVM A;  1YTA A;  1DTQ A;  2I7P A;  3GL1 A;  2GUP A;  3QB0 A;  5AFU A;  2Q0R A;  3I33 A;  3AVA A;  2O8F A;  5EVZ A;  3WXL A;  2O8D B;  5AQH A;  4BRG A;  4IFY A;  4BRM A;  5AQZ A;  3O08 A;  5AQT A;  3LAK A;  3V9X A;  2JWK A;  5KI6 A;  3THY B;  4DV7 K;  4I9Q A;  3SQ0 A;  4FJG A;  1KTQ A;  3SQ2 A;  1V4S A;  4BR4 A;  2UXD K;  2GEM A;  4KB1 A;  2GEL A;  2E8A A;  1IH7 A;  3HTV A;  3AO4 A;  3THX A;  3LDQ A;  4X65 K;  4BE1 A;  3ZSV A;  2VGM A;  3R9P A;  4HCB A;  2CH5 A;  5BPM A;  1JLA A;  3V1Q A;  1NK4 A;  1KAY A;  5ELZ A;  1ASV A;  4AHV A;  1J5O A;  4CED A;  4DTN A;  4U7B A;  3LAN A;  5EX5 A;  1ZBF A;  1BI4 A;  1J54 A;  1X3M A;  4CJE A;  1XHZ A;  1YHQ N;  4BRH A;  5BN8 A;  1Y64 A;  4BAC A;  4W5R A;  3CJ1 A;  2GBZ A;  1XQS C;  1IG9 A;  3DOL A;  1NU0 A;  4RW4 A;  4CIE A;  1X1P A;  3AVF A;  3VTI A;  1SV5 A;  4DQP A;  3LWL A;  1LAW A;  2E6M A;  2PFU A;  2P1J A;  2NUB A;  5IWA K;  2QWR A;  4JKF A;  4LFA K;  1IG8 A;  2RPI A;  3NGY A;  1IBM K;  2P9N B;  3F2K A;  3CER A;  4K0K K;  2PY5 A;  3O9S A;  5BN9 A;  4CCH A;  1YUW A;  5IT9 O;  4LF8 K;  5FPN A;  5M1P A;  1RDU A;  3AVB A;  1KCF A;  4DV4 K;  3VGM A;  2HOE A;  4CF0 A;  2P51 A;  4B1V A;  3ALY A;  5BPL A;  3CCQ N;  3DRP A;  4FK0 A;  3ZT1 A;  2F8T A;  1OVQ A;  4DQQ A;  2W40 A;  4B9V A;  1MWM A;  3TSQ A;  1NWK A;  5AQQ A;  1NM1 A;  4E7I A;  2G8V A;  3CFP A;  4LC9 B;  3O1B A;  4DU3 A;  2BGG A;  1JLG A;  2Q97 A;  3AVC A;  3VQC A;  4FPA A;  4JK8 A;  3RRH A;  1YIJ N;  3AVL A;  5KPR A;  1NK8 A;  4BRF A;  4CIG A;  1QSS A;  5AQX A;  3D2E B;  4J2D A;  3FGU A;  1HNX K;  3V1R A;  2Y1J A;  3TPQ A;  3CD6 N;  4C8O A;  3I8D A;  5J2P A;  4ILJ A;  3N4P A;  4DR6 K;  3KK3 A;  2NLX A;  5HRP A;  1TL1 A;  1Q9X A;  5D3G A;  3KLE A;  4CE9 A;  4M7X A;  3ASM A;  1JKH A;  3R6M A;  3V9W A;  2Q36 A;  2PYJ A;  3OYJ A;  4Z4G A;  4DQS A;  2HVI A;  4YOX A;  2AA4 A;  4B1X B;  3MX2 A;  3LWM A;  2FSK A;  2Q2R A;  4CJW A;  2QW9 A;  4H0Y B;  4A5A A;  2P9S A;  3O4W A;  1RBT A;  4YHH K;  4FM1 A;  5BRE A;  1ZXO A;  1NJZ A;  5J2M A;  1VSM A;  1HNI A;  3AO2 A;  2R7Y A;  3CJ9 A;  4GW6 A;  4KFB A;  3ZSO A;  1BGX T;  1KFS A;  2YHW A;  4CGJ A;  4TSX A;  1TK8 A;  1TUU A;  1NGC A;  4XH1 A;  3OTO K;  3ZEU B;  2KZM A;  5JMV A;  3CM5 A;  3VEX A;  3O4N A;  1Z26 A;  1C0G A;  1VQP N;  1FJG K;  2KLA A;  1Q18 A;  2AJQ A;  2O4G A;  3AA3 A;  4O0I A;  4M3Z A;  2J4R A;  3LAM A;  4RWT A;  1QZ6 A;  1XWL A;  5M1Q A;  1S1U A;  1RBU A;  2WOM A;  1W97 L;  2DFH A;  4O5F A;  1WSG A;  4FJH A;  3ZT4 A;  4BRN A;  4DR2 K;  4CVN E;  1KAX A;  1CXQ A;  4Y0W A;  1TAU A;  3UE5 A;  5AZI A;  4HHT A;  4FWL A;  1W9H A;  4E1M A;  3K5N A;  2OTJ N;  1RTJ A;  4W5Q A;  4J8F A;  4CZM A;  3U8X A;  3O80 A;  2Z1J A;  4LH4 A;  3Q7B A;  3NMU A;  1NBW A;  1SAZ A;  3MEE A;  3ZX0 A;  4W5N A;  5AFU H;  1L5U A;  4OKK A;  2XY7 A;  4IFE A;  4JKG A;  4BDP A;  5AQM A;  4WCE L;  2CGJ A;  3HVR A;  1QQM A;  1YAG A;  2X6N A;  5AQG A;  4U67 L;  2PZS A;  2CH6 A;  4Z0U A;  3NH1 A;  2KZZ A;  2FLO A;  4CF8 A;  4EZ6 A;  4ICL A;  4FK4 A;  3CQX A;  5KQD A;  2NRX A;  3J7A P;  2W6K A;  1HYV A;  3THW A;  3K5O A;  4LFC K;  4KKO A;  1UA0 A;  1BO5 O;  5KGX A;  1DLO A;  4FLZ A;  2FSN A;  3U6F A;  3SQ1 A;  1ZBS A;  4OX9 K;  2HST A;  1OH5 A;  3D2F A;  3A5L C;  4HCC A;  4CD3 A;  2O8B B;  4RCH A;  4A2B A;  5DM7 L;  1CLQ A;  3VOV A;  2O8E A;  2F96 A;  4ID1 A;  5TKY A;  1HYS A;  4FW1 A;  3E66 A;  3VET A;  4IO9 L;  5M1O A;  3DRR A;  1HQU A;  3GDQ A;  1SL2 A;  3DLR A;  3HM8 A;  3KZB A;  4WFB L;  1RBS A;  5CE3 A;  4IFV A;  5AQW A;  3OBW A;  3H1V X;  1NGF A;  3M8S A;  1I94 K;  1VSE A;  4DTO A;  4BC2 A;  4CHZ A;  3QEX A;  4DTR A;  4O8K A;  1ZBI A;  1HX1 A;  4FLW A;  5FRM A;  2D0C A;  3H46 O;  3RRG A;  3WNG A;  1W0H A;  3DLK A;  3AO5 A;  4CBU A;  4PKH A;  4BG8 A;  5C25 A;  3ZET A;  4CJS A;  3OYA A;  1N36 K;  2G8W A;  2E2P A;  1OH7 A;  5C24 A;  4PY5 A;  3RVC A;  3DLL L;  2ZM6 K;  3IMX A;  3VQD A;  3V1O A;  4N76 A;  3LZJ A;  3C0B A;  4HWI A;  1RBR A;  3AA4 A;  1QE1 A;  3BUZ B;  3SBT A;  4FWP A;  1GLC G;  4A5B A;  3A0I X;  2BTF A;  2B5J A;  2JGU A;  3WXJ A;  4JK7 A;  1MDU B;  1SZ2 A;  1ESV A;  3Q7C A;  3KIO A;  2HBM A;  4PKI A;  4K25 A;  3P5J A;  3CQ8 A;  3CCU N;  2QWP A;  1K8K A;  4DU1 A;  3B6O A;  4C1N I;  4ID5 A;  3CYM A;  3PX0 A;  1WSH A;  2QWM A;  4B3M K;  5LY3 A;  2VG7 A;  3WEE A;  5CYQ A;  1X9W A;  1VRT A;  4H0X B;  4O4G A;  4DFP A;  3MN5 A;  3VPZ A;  4CJQ A;  3IUC A;  2Z1H A;  3DXM A;  1ATR A;  3TAN A;  2KFN A;  1T6C A;  2RF2 A;  4JKH A;  2QXL A;  2HMI A;  1BG3 A;  2FBX A;  3EO3 A;  2D0P A;  5AQN A;  3I8B A;  4OLA A;  4EHT A;  2GTD A;  1S1W A;  3SBG A;  3I0S A;  1HRH A;  4BDY A;  4CFD A;  1X9M A;  3OYN A;  4M45 A;  5HP1 A;  3K9K A;  5AQP A;  4DLG A;  1SKS A;  2HBJ A;  1KLM A;  2WBN A;  3BGR A;  3ID8 A;  3PX4 A;  3FZF A;  2G8H A;  2QI2 A;  1HQE A;  4WQ5 C;  5AQR A;  2G8K A;  3CPW M;  4PL8 A;  4M3U A;  3S9H A;  5JIC A;  3FZK A;  2OPQ A;  3G6E N;  4DSE A;  4Z4F A;  3S3O A;  4WQ5 A;  1ZC6 A;  1N33 K;  2KTQ A;  3SQ4 A;  4F2R A;  3AVJ A;  2ASP A;  2FSJ A;  4IJA A;  2OZS A;  3EKS A;  1RTI A;  4JD2 B;  1VQ4 N;  1SL0 A;  4A62 A;  4H5W A;  4FZZ A;  3QDK A;  5AQL A;  3SI6 A;  4BR5 A;  4AF1 A;  3HT3 A;  1YJ9 N;  3L0Q A;  2HHS A;  3UKU A;  3KD1 E;  3HI0 A;  3ZSY A;  3NVK A;  3L6Q A;  4BQZ A;  3E9O A;  1TVR A;  1YXQ A;  4CJV A;  5FPE A;  3A5O C;  3EZW A;  3K5M A;  5I9E B;  2VQF K;  4BR0 A;  2IVN A;  4BC3 A;  2P9U B;  4AQY K;  5KRT A;  4FCY A;  3KTQ A;  1T3V A;  2Q1N A;  4FOE A;  4FLV A;  2YNF A;  4DSI A;  3L3U A;  5SWM A;  3DJC A;  4OJR A;  3WQT A;  2BUP A;  4OPK A;  1QHT A;  3JAM O;  2F9T A;  3QNO A;  1QQN A;  5SZT A;  3QO9 A;  3AVH A;  1O1W A;  3OYF A;  4OO1 J;  4BVP A;  3OVN A;  3HPH A;  4Q0B A;  4CD1 A;  3FR0 A;  4ELV A;  1YTU A;  2A3Z A;  2P9P A;  3KK1 A;  3LP1 A;  1YIT N;  3DXK B;  3S3N A;  4R5P A;  1NK5 A;  3PSF A;  3VES A;  3L2Q A;  1J9A A;  2YKM A;  2HHH K;  3C7N B;  1JLC A;  1IKW A;  1S6P A;  3NGZ A;  4B1Z A;  4HUF A;  4JKD A;  5KPT A;  3M5R A;  2DFF A;  4YDU C;  5AZJ B;  2P9K B;  4HVJ A;  4Z4E A;  2E2N A;  3H45 C;  2HW3 A;  5HRN A;  2DPN A;  5E26 A;  3QFU A;  4YDU A;  4B8C A;  4DSL A;  4E19 A;  4FYD A;  3EL2 A;  4FLT A;  2E2Q A;  1E3M A;  4X62 K;  2HVH A;  3IG1 A;  5TKW A;  1P90 A;  1U47 A;  3VEO A;  4CZG A;  4KPY A;  1L3U A;  4DF8 A;  3ZLJ A;  4Z4C A;  3ZSZ A;  3L2W A;  1U6Z A;  4CK1 A;  3VEN A;  4ILG B;  5MLC Q;  4BRQ A;  3AV9 A;  3LDS A;  4I6M A;  1L3V A;  2YJF A;  3O3G A;  3O3H A;  1VSL A;  5BR8 K;  5BRH A;  1WSE A;  1NGB A;  4GKK K;  3VEZ A;  5AQK A;  4KAZ A;  4JRQ A;  1JCF A;  1YI2 N;  3VQ9 A;  3W0L A;  3LPT A;  3SMS A;  1T6D A;  4FLU A;  4ISG A;  3AVN A;  2A41 A;  3RSE A;  3HBT A;  2QXF A;  3DAW A;  1K6Y A;  1RTH A;  3D2E A;  1MA9 B;  4EFH A;  4XIU A;  4B1U B;  5CZ1 A;  3OS0 A;  2QWQ A;  1WSJ A;  4H0V B;  3QER A;  3AA5 X;  4NCB A;  4CJ5 A;  3P39 A;  2YNG A;  2P5O A;  3N4Q A;  1RNH A;  3CME N;  4CZI A;  3CJA A;  3CCS N;  3PV8 A;  4AHC A;  3AAQ A;  3CC4 N;  5M1F A;  2KW4 A;  5CYM A;  5GAG P;  1U2V A;  1VHX A;  4DB3 A;  1BUP A;  1S6Q A;  2O8C B;  4JI1 K;  3ATU A;  4IKF A;  3NF6 A;  1VSF A;  4CZJ A;  4HTU A;  4B3O A;  1N34 K;  4H0T B;  2RKI A;  4JHD B;  4PWD A;  4DQI A;  1D5A A;  3BF1 A;  2A40 A;  3D7E O;  4KHN A;  3O9T A;  3QFP A;  2Y1I A;  5F0X A;  2VWK A;  1U48 A;  2HHV A;  3O9U A;  1BQN A;  3GG4 A;  3MN7 A;  5HLF A;  1D9D A;  3BZC A;  4KH5 A;  4E7K A;  5T7B A;  1KLN A;  3HP6 A;  3OJS A;  3EZ5 A;  2B4J A;  4AHS A;  4FWS A;  4IO8 A;  1LW0 A;  1DT9 A;  5HOO A;  3OS1 A;  2G8I A;  1XNQ K;  1YJW N;  3FFI A;  2IAJ A;  2V52 B;  3V6D A;  1GOA A;  4I7F A;  4X66 K;  2DY4 A;  4NYF A;  4DCH A;  1VAZ A;  4G9Z A;  1VSH A;  4KHY A;  2W6L A;  2QWN A;  4LD0 A;  1HLU A;  1RT2 A;  4M3W A;  2HHU A;  1T44 A;  1TKT A;  1WNS A;  2P9L A;  2YX6 A;  4DTP A;  4JKA A;  1VQ9 N;  2V7Y A;  4M7Y A;  2RHK A;  1QZ5 A;  2ATQ A;  4OPA A;  1S9G A;  1GLF O;  5EOY A;  4KO0 A;  2JLE A;  1A5X A;  1IKX A;  4KB0 A;  2HHW A;  4FPB A;  4CEZ A;  3DWL A;  2HNZ A;  4DFJ A;  3AGK A;  2QEX N;  1ITG A;  4IOX A;  3R8E A;  1TUY A;  3KKR A;  4A59 A;  4BR7 A;  1T05 A;  3AAR A;  3CFO A;  3A2F A;  3SPZ A;  5AQV A;  1GLA G;  4WYB A;  2GX9 A;  4C8M A;  1R0A A;  1HKG A;  1U04 A;  4HUE A;  4B9N A;  3ID6 A;  1KAZ A;  4DTS A;  4NLC A;  5BPN A;  1C0U A;  3OYH A;  2IC3 A;  3KVG A;  3DRS A;  4DUY K;  4O55 A;  1KD1 O;  4K43 A;  4E1J A;  4OGC A;  2NRV A;  2D5R A;  1KRP A;  2DTU A;  1VQ6 N;  3JSM A;  4Z94 A;  4JI4 K;  5CHI A;  3M8Q A;  2OPR A;  5HBM A;  2H3G X;  3VF6 A;  2WUS A;  3LDP A;  1GOC A;  2I5J A;  3CC2 N;  5KGW A;  1WLJ A;  3VQE A;  4B8A B;  3VMF B;  1VQK N;  1B9F A;  3BEX A;  1BIZ A;  3ULE A;  3J7Z O;  2NRH A;  3HVT A;  3KK2 A;  4DQ8 A;  3NBP A;  1NK6 A;  2G8U A;  3IRX A;  3JYT A;  2UUB K;  4M3Y A;  4DTU A;  1RDB A;  2QKB A;  3LZI A;  1XI1 A;  2GUI A;  4O5B A;  4BRC A;  4QS7 A;  3HPG A;  5LJV A;  3E9P A;  1ZBU A;  4E7L A;  3WXI A;  4Z4H A;  3RR7 A;  1HJO A;  3OHR A;  2IOC A;  2I7N A;  4QS8 A;  4YNQ A;  1UAX A;  2O8F B;  3WNH A;  3ZX2 A;  4ISE A;  4CHN A;  2KQ2 A;  1EO1 A;  4FJ9 A;  4IEE A;  1NNE A;  4KTZ A;  2W42 A;  3U9D A;  2WTU A;  3L2U A;  2X6S A;  1S3X A;  3P4I A;  3F9K A;  3DOK A;  3PLA A;  3ZCM A;  3DM2 A;  1N6Q A;  4CEC A;  4JS5 A;  4CK2 A;  5BRD A;  3HJF A;  3TAB A;  4Y1C A;  3QEV A;  1L3S A;  5I3U A;  5J1E A;  5F2R A;  4M41 A;  4DSK A;  2A1S A;  3THX B;  4GV6 A;  3O3F A;  3MK6 A;  3WNE A;  3OBY A;  4MLE A;  1XMQ K;  2VCP A;  3LAL A;  1Q9Y A;  3R3L A;  2RN2 A;  1NGI A;  2V7Z A;  1N8R O;  3CFR A;  4AHR A;  3G71 N;  1BI4 B;  2DFE A;  1JLF A;  1HJR A;  1W2B M;  4LSL A;  4FZX C;  4BC5 A;  3G25 A;  4F3O A;  1Q82 O;  3K57 A;  1TL3 A;  2YI1 A;  1HUX A;  4M3T A;  4DG1 A;  1HR0 K;  2ASM A;  3VGK A;  4W5O A;  1XUP O;  5HRR A;  2KKZ A;  1TAQ A;  4O8U A;  1RDC A;  1KSP A;  4WF9 L;  1VQM N;  2VG5 A;  1QVG M;  1VK0 A;  4GMJ B;  3BP8 A;  3OYI A;  1W7A A;  4Z4I A;  1TYQ A;  4DTJ A;  5J2N A;  2OA8 A;  3MED A;  1C1B A;  2YHY A;  1WAF A;  2PYL A;  4AM7 A;  3AVG A;  4PL7 A;  4FJL A;  3UKR A;  3TTD A;  1RIL A;  4Y1D A;  1EKE A;  3KLH A;  3OYK A;  3TWH A;  5KPZ A;  3OS2 A;  4ISF A;  1R59 O;  4LSN A;  1NKE A;  4KV8 A;  3QES A;  3TAE A;  5HRO A;  3EN9 A;  3VF4 A;  4CZH A;  3NDK A;  1S1V A;  4M42 A;  1UA1 A;  3TR8 A;  5AQJ A;  2V51 B;  4BC4 A;  4CHO A;  4CW7 B;  4B1Y B;  3SAH A;  1WN7 A;  1Q86 O;  4FWO A;  3KD5 E;  3T19 A;  2UXB K;  4BGA A;  4HUG A;  1WBD A;  4A61 A;  4CF1 A;  3K0S A;  4RTF D;  3LDN A;  1VQ8 N;  4KHU A;  1FW6 A;  4NB4 A;  3K9J A;  2HND A;  1IBK K;  4JKB A;  2X74 A;  3THV A;  4FVU A;  1JLE A;  4CGG A;  4E3S A;  3EE8 A;  3CIP A;  2BE2 A;  1FK9 A;  4BRA A;  4QCL A;  3V4I A;  2P9I A;  4A2A A;  1SL1 A;  4CES A;  1BOT O;  2ZGZ A;  2A6A A;  4JKE A;  1WUA A;  4CZF A;  4B3T K;  5JVG L;  3MEG A;  2IVP A;  3LM2 A;  3L4Q A;  1IKY A;  3QBW A;  4IBN A;  4B9L A;  4N56 A;  2QM1 A;  1LWC A;  3IAY A;  1REV A;  2HNY A;  2OPP A;  5BR9 A;  3CC7 N;  4DR7 K;  5C2D A;  1RDW X;  2P9S B;  2AP1 A;  4MO5 A;  4IDH A;  5AQU A;  4WQ4 C;  1RFQ A;  3ATV A;  4NXN K;  4XH4 A;  4IEI A;  1HNZ K;  3MXI A;  4H0O A;  3T1A A;  4OKE A;  4DUZ K;  3RTV A;  4KRE A;  4EP5 A;  3O9R A;  4OPH A;  3NE6 A;  4FWR A;  3V81 A;  4WQ4 A;  3H08 A;  4BRI A;  2Q3S A;  3QLH A;  5DK5 A;  3B6P A;  1I3A A;  5GIP A;  3LDO A;  3MMV A;  1J6Z A;  2D0B A;  2WFB A;  4CIF A;  3NF9 A;  4OVL A;  4JI8 K;  1BCM A;  4YOT A;  3L3V A;  4LY7 A;  3DMJ A;  4CJR A;  3P31 A;  3SLC A;  3IKM A;  5A2Q O;  3VEV A;  4DR3 K;  3WT0 A;  5C15 A;  1VSI A;  2ZD1 A;  3C95 A;  3C6U A;  2KHO A;  3F73 A;  3L8B A;  3ZSR A;  2IGI A;  2ZF5 O;  3P1G A;  1U45 A;  4LF7 K;  1S5J A;  5C2F A;  3HXM A;  4CFC A;  5AZI B;  3ZSQ A;  2E2O A;  1S9E A;  3G0Z A;  4F9O A;  1NOY A;  3NH0 A;  2FC0 A;  3H6E A;  2QA4 N;  1JXB A;  4FO0 A;  3SV3 A;  2YNH A;  4KRF A;  5M1K A;  3HST B;  3LDL A;  2E1Z A;  3MWT A;  4BY9 C;  1MU2 A;  4UQG A;  5C0Y A;  3K2P A;  1BA1 A;  1C1C A;  4JKG B;  1FXX A;  4MFB A;  1RT5 A;  4C8L A;  3AAP A;  4KH4 A;  3M8P A;  3ZSW A;  2VWJ A;  4RW9 A;  2XO7 A;  4CEF A;  2WON A;  2CGK A;  4CEA A;  4CER A;  1NGG A;  4YOY A;  3SV4 A;  3TAG A;  3NGI A;  2A1R A;  2ZJP L;  2GWK A;  3WXK A;  2O8D A;  3SJJ A;  2YHA A;  5FPD A;  5E41 A; 
#chains in the Genus database with same CATH homology
 5AQI A;  3C65 A;  4ILJ A;  3CCS N;  2VWB A;  3N4P A;  3CET A;  1NGE A;  3AAQ A;  2QTD A;  1X3N A;  3MDQ A;  3P38 A;  4BR2 A;  3CC4 N;  2NLX A;  5M1F A;  4BQL A;  5H1S Q;  5B8H A;  1H1V A;  3H1Q A;  4M7X A;  4MLH A;  3CCJ N;  3D2F B;  2P9U A;  5GAG P;  1Q81 O;  1U2V A;  4DB3 A;  3FE1 A;  3R6M A;  1BUP A;  3FZM A;  2Q36 A;  3IFR A;  2F7T A;  4ILH A;  4XEI A;  3ATU A;  4MDB A;  4XH5 A;  4FSV A;  3ULE B;  4CZJ A;  3PIP L;  5KQ8 A;  4YOX A;  2AA4 A;  4YOR A;  4B1X B;  3MX2 A;  4DHY A;  2FSK A;  3QIC A;  2Q2R A;  3ENH A;  2QW9 A;  4H0T B;  4H0Y B;  4A5A A;  2P9S A;  3GE1 A;  3O4W A;  4JHD B;  3BF1 A;  5BRE A;  2A40 A;  3D7E O;  1ZXO A;  3C6A A;  3O9T A;  3QFP A;  4JN4 A;  3ZYY X;  5F0X A;  3QML A;  1YF5 L;  3WXM B;  1HKB A;  3MN7 A;  1GLB G;  3GG4 A;  3O9U A;  3CJ9 A;  1ILY A;  4KH5 A;  3U4L A;  2NRR A;  1RGI A;  2YHW A;  3O5B A;  1KQS M;  5EXW A;  4H5N A;  1TUU A;  3DXK A;  3LL3 A;  1NGC A;  4FWS A;  2RE2 A;  3IDH A;  4IO8 A;  4XH1 A;  5AQO A;  4YOV A;  3M3Z A;  1K9M O;  3ZEU B;  1DT9 A;  4FWK A;  5JMV A;  3VEX A;  3C7N A;  5HOO A;  4YOW A;  2FF6 A;  2FXU A;  1LCU A;  2WC9 A;  1C0G A;  3JXU A;  4FWQ A;  3TSP A;  3CCE N;  1VQP N;  5AZJ A;  1YJW N;  2KLA A;  2FF3 B;  2P9K A;  1Q18 A;  3FZH A;  1P8Z A;  5EY4 A;  2PBD A;  2NZT A;  1V4T A;  2V52 B;  2J4R A;  2A42 A;  1QVF M;  4FOI A;  1DEJ A;  4KBO A;  1QZ6 A;  4RWT A;  3E1Y A;  1IJJ A;  2YJE A;  4IWV A;  4JNE A;  3SK3 A;  3ZET B;  2ZJQ L;  4NLB A;  5M1Q A;  4DCH A;  4BVO A;  1VAZ A;  3CJB A;  4G9Z A;  1W97 L;  1NMD A;  2QWN A;  4H5T A;  1HLU A;  4L3Q A;  3AGR A;  4O5F A;  3O6W A;  1YJN N;  1T44 A;  4BRN A;  2P9N A;  1NGJ A;  2P9L A;  2YX6 A;  1KAX A;  4Y0W A;  4CZL A;  3UE5 A;  5AZI A;  4HTL A;  4FWL A;  3VEY A;  2NRW A;  4JKA A;  1VQ9 N;  2OTJ N;  2V7Y A;  1E4G T;  4M7Y A;  2RHK A;  1QZ5 A;  4J8F A;  4OPA A;  4CZM A;  3U8X A;  1GLF O;  3O80 A;  5EOY A;  3TU5 A;  4C1N K;  4DKW A;  3BF3 A;  3NMU A;  3Q7B A;  1NBW A;  1SAZ A;  4FWN A;  2NRT A;  1M90 O;  3ZX0 A;  1BU6 O;  5AFU H;  3LM9 A;  4FPB A;  1GLL O;  3DWL A;  1EQY A;  4BRE A;  3TSU A;  4IFE A;  3HOS A;  4IZ9 A;  2IVO A;  2ITM A;  1BWF O;  3AGK A;  2EWS A;  4JKG A;  5AQM A;  3I56 N;  2QEX N;  4IOX A;  4WCE L;  4H5V A;  1TUY A;  2CGJ A;  3R8E A;  3F5T A;  4A59 A;  1QQM A;  3AAR A;  1YAG A;  3WEE B;  3UB5 A;  2PAV A;  5AQG A;  2VYP A;  4CZK A;  4U67 L;  5AQV A;  1GLA G;  4WYB A;  2GX9 A;  3SAG A;  2CH6 A;  1C0F A;  3MN6 A;  2Q31 A;  2FLO A;  4H0P A;  3DXM B;  2ZWH A;  5AR0 A;  1HKG A;  3A5N C;  1QQO A;  1VQ7 N;  3ID6 A;  1KAZ A;  5F1X A;  4NLC A;  3CQX A;  5GAE P;  5BPN A;  4BG9 A;  5KQD A;  3F9M A;  1K73 O;  2NRX A;  1NGH A;  1TYQ B;  3KVG A;  3T7Z A;  3KWI A;  3J8A A;  1KD1 O;  4JK9 A;  4K43 A;  4E1J A;  3A8Y A;  2NRV A;  1VQN N;  1BO5 O;  1JCE A;  3CCR N;  1VQ6 N;  2FSN A;  4A57 A;  4Z94 A;  1ZBS A;  5CHI A;  2HST A;  3UKR B;  3VF6 A;  2H3G X;  4CI6 A;  3A5M C;  2WUS A;  3A5L C;  3D2F A;  3LDP A;  3CMA N;  4KH6 A;  3CC2 N;  3GBT A;  4CD3 A;  4RCH A;  4A2B A;  3H3N O;  5DM7 L;  3VOV A;  2D1K A;  2ZGY A;  3VMF B;  4B1W B;  3CHW A;  3KHY A;  5DM6 L;  1NGD A;  3VEW A;  1VQK N;  3EE9 A;  3BEX A;  3MWP A;  5GAD P;  4H03 B;  5TKY A;  3ULE A;  3J7Z O;  2NRH A;  2CGL A;  2NNW A;  3E66 A;  3VF2 A;  4DQ8 A;  3VET A;  3CJ7 A;  4IO9 L;  5M1O A;  3L4I A;  3OA9 A;  4JHD A;  3D6R A;  5JLH A;  3GDQ A;  3HM8 A;  2D4W A;  3QBX A;  1DKG D;  4R79 A;  4UY8 O;  3KZB A;  4WFB L;  4GVE A;  5CE3 A;  1S72 N;  3PIO L;  4BRC A;  4QS7 A;  5AQW A;  5LJV A;  3OBW A;  3H1V X;  3E9P A;  3S41 A;  3GOI A;  3WXI A;  1NGF A;  1HJO A;  2HF4 A;  3OHR A;  2I7N A;  4QS8 A;  4BC2 A;  1JCG A;  3ZX2 A;  4ISE A;  3UKU B;  4O8K A;  3ZEU A;  1EO1 A;  1HX1 A;  3AY9 A;  4IEE A;  5JLF A;  3VER A;  3U9D A;  3CCL N;  1BDG A;  2A5X A;  5ADX A;  5AQS A;  3H46 O;  3HZ6 A;  1S3X A;  2P9I B;  3P4I A;  3PLA A;  1SQK A;  2E20 A;  2BH1 A;  4CBU A;  4PKH A;  5LJW A;  3FLC O;  4GY2 B;  4BG8 A;  4BRP A;  5BRD A;  5HL7 L;  3ZET A;  1OVY A;  4FL9 A;  2E2P A;  3O1W A;  5F2R A;  4NO7 A;  3RVC A;  3DLL L;  4GV6 A;  1GLJ O;  3IMX A;  3MK6 A;  2QWL A;  3C0B A;  4HWI A;  3BUZ B;  3SBT A;  1KXP A;  3ENO A;  3OBY A;  4MLE A;  4FWP A;  1ATS A;  2VCP A;  5CR4 A;  2ZJR L;  1GLC G;  4A5B A;  3R3L A;  1O13 A;  1NGI A;  2V7Z A;  1N8R O;  3A0I X;  2BTF A;  4IXC A;  3WXJ A;  1MDU B;  4JK7 A;  1SZ2 A;  3G71 N;  1ESV A;  3CPE A;  3Q7C A;  1QHA A;  1X9J A;  2HBM A;  2P9P B;  4PKI A;  3OW2 M;  1W2B M;  2VGN A;  3MX5 A;  1HKC A;  4K25 A;  1GLE G;  1MWK A;  3CCU N;  2QWP A;  1K8K A;  4C1N I;  4EIA A;  2UYT A;  1GLD G;  4QS9 A;  3H3O B;  5AQF A;  4K41 A;  3O8M A;  3G25 A;  4BC5 A;  1JJ2 M;  2IIR A;  1XC3 A;  3B8A X;  1Z6R A;  2QWM A;  5LY3 A;  1Q82 O;  1HPM A;  1VQ5 N;  4FWM A;  1K8K B;  2YI1 A;  1HUX A;  1VQO N;  2ASM A;  3VGK A;  3WEE A;  3M6G A;  3HSC A;  4B9Q A;  1XUP O;  1G99 A;  4CJ7 A;  3HOT A;  4H0X B;  2KKZ A;  1NGA A;  3MN5 A;  1M1K O;  3VPZ A;  4O8U A;  3IUC A;  4WF9 L;  3DXM A;  1ATR A;  1T6C A;  2YCH A;  1VQM N;  4JKH A;  2QXL A;  1QVG M;  1BG3 A;  3BP8 A;  4GNI A;  4M63 C;  4EHU A;  1K8A O;  3JS6 A;  4BRK A;  3EO3 A;  3SMP A;  2D0P A;  1TYQ A;  4BRL A;  5AQN A;  3CXC M;  4BRO A;  3HRG A;  3I8B A;  4GV9 A;  4EHT A;  2GTD A;  1ATN A;  3SBG A;  3ZX3 A;  4IJN A;  2YHY A;  2HBK A;  4I6M B;  4AM7 A;  1CZA N;  3K9K A;  5AQP A;  4PL7 A;  3UKR A;  3TTD A;  4IOC L;  2GWJ A;  4WFA L;  2HBJ A;  3I55 N;  5KPZ A;  2NRZ A;  3KK7 A;  5AQY A;  2WBN A;  4ISF A;  1R59 O;  4BGB A;  3ID8 A;  3FZF A;  2JWL A;  1D4X A;  3EN9 A;  2QI2 A;  3VF4 A;  4CZH A;  3CF5 L;  3KWG A;  5AQJ A;  2V51 B;  4WQ5 C;  5AQR A;  3MCP A;  4BC4 A;  1OKJ A;  3CPW M;  1YVN A;  4B1Y B;  3SAH A;  1Q86 O;  3CJC A;  5E84 A;  2W41 A;  4FWO A;  3W3D A;  4PL8 A;  3FFK B;  1S22 A;  3SJH A;  4CBW A;  5FPM A;  3FZK A;  5JIC A;  3G6E N;  4PKG A;  4WQ5 A;  4C23 A;  1ZC6 A;  1LOT B;  3NVM A;  3RSE B;  4BGA A;  4WFN L;  2ASP A;  2FSJ A;  3CQY A;  4IJA A;  4A61 A;  2I7P A;  4AM6 A;  3EKS A;  1NLV A;  3GL1 A;  2GUP A;  3LDN A;  4JD2 B;  4RTF D;  4A62 A;  1VQ8 N;  1VQ4 N;  4NB4 A;  3QB0 A;  4H5W A;  1KC8 O;  3K9J A;  3QDK A;  5AQL A;  4BR5 A;  5AFU A;  4AF1 A;  4JKB A;  3CI5 A;  2Q0R A;  3MCA B;  3I33 A;  3L0Q A;  1YJ9 N;  3ENB A;  4FVU A;  3UKU A;  4PHT X;  3T69 A;  3HI0 A;  5EVZ A;  3WXL A;  5AQH A;  3NVK A;  4BRG A;  3EE8 A;  3CIP A;  3L6Q A;  3E9O A;  4MO4 A;  4BQZ A;  4BRM A;  1YXQ A;  4BRA A;  5AQZ A;  3O08 A;  5AQT A;  2YHX A;  5FPE A;  3A5O C;  3G4S N;  1Z05 A;  2JWK A;  3EZW A;  2P9I A;  4A2A A;  5I9E B;  1BOT O;  4BR7 A;  4BR0 A;  2ASO A;  2IVN A;  1V4S A;  2ZGZ A;  3E9L A;  3MN9 A;  2A6A A;  4BR4 A;  4JKE A;  4EAH D;  1WUA A;  2E88 A;  4CZF A;  4BC3 A;  2P9U B;  5JVG L;  2IVP A;  1U2V B;  2OAN A;  3LM2 A;  3L4Q A;  2GEM A;  3QBW A;  1T3V A;  2GEL A;  2QM1 A;  2Q1N A;  3SAF A;  5BR9 A;  3CC7 N;  4FOE A;  2E8A A;  1Q7Y O;  3DJC A;  3HTV A;  3WQT A;  2BUP A;  3LDQ A;  5C2D A;  2E1Y A;  1RDW X;  3CCM N;  2F9T A;  2P9S B;  2AP1 A;  4MO5 A;  2D0O A;  1QQN A;  2VGM A;  4IDH A;  5AQU A;  4WQ4 C;  3R9P A;  1RFQ A;  3ATV A;  2CH5 A;  3M1F A;  2QWO A;  4XH4 A;  4IEI A;  5BPM A;  1KAY A;  5C10 A;  4H0O A;  5ELZ A;  4OO1 J;  4BVP A;  3O9R A;  4OPH A;  5M1N A;  4FWR A;  5EX5 A;  4WQ4 A;  4U7B A;  1X3M A;  4BRI A;  4CD1 A;  3FR0 A;  1YHQ N;  2A3Z A;  2P9P A;  4BRH A;  5BN8 A;  1YIT N;  3DXK B;  3U9Z A;  4BR9 A;  1Y64 A;  3VES A;  3CJ1 A;  4CZE A;  5GIP A;  3LDO A;  3MMV A;  3C7N B;  1J6Z A;  2WFB A;  1XQS C;  4B1Z A;  4GV3 A;  4JKD A;  5KPT A;  3M5R A;  4YDU C;  5AZJ B;  2Q0U A;  2P9K B;  4JKC A;  2E2N A;  3VTI A;  3H45 C;  4YOT A;  4JAX A;  2DPN A;  5E26 A;  3TTF A;  3QFU A;  4YDU A;  2PFU A;  4H5R A;  3P31 A;  3EL2 A;  2E2Q A;  1E4F T;  3SLC A;  3IKM A;  1SS6 A;  5TKW A;  3VEV A;  3EKU A;  1P90 A;  3WT0 A;  2QWR A;  4JKF A;  3VGL A;  1IG8 A;  5C15 A;  3VEO A;  4CZG A;  2HBL A;  2KHO A;  1WOQ A;  4JEP A;  2ZF5 O;  1U6Z A;  2P9N B;  3CER A;  3F2K A;  4ILG B;  3VEN A;  4BRQ A;  2P9L B;  5C12 A;  4I6M A;  5MLC Q;  5C2F A;  3O9S A;  5BN9 A;  5BRF A;  1NJI O;  2HMP A;  4YOU A;  1DGK N;  1YUW A;  3O9Q A;  5AZI B;  2E2O A;  2YJF A;  4K42 A;  5FPN A;  5M1P A;  1RDU A;  4F9O A;  3VGM A;  2HOE A;  3H6E A;  5BRH A;  4FO0 A;  2QA4 N;  4B1V A;  5BPL A;  1NGB A;  3VEZ A;  3CCQ N;  5M1K A;  3R1X A;  3LDL A;  5AQK A;  2E1Z A;  1JCF A;  1YI2 N;  3W0L A;  3MWT A;  4BY9 C;  2HF3 A;  2W40 A;  3VTH A;  3SMS A;  5C0Y A;  1BA0 A;  4MDA A;  1MWM A;  3WQU A;  4IOA L;  1BA1 A;  1T6D A;  3TSQ A;  4ISG A;  4JKG B;  5GAH P;  4BRD A;  1NWK A;  5AQQ A;  1NM1 A;  2A41 A;  3RSE A;  3HBT A;  3FZL A;  3AAP A;  3DAW A;  3O1B A;  4KH4 A;  4LC9 B;  5ADX H;  3D2E A;  4EFH A;  1MA9 B;  2Q97 A;  4JD2 A;  5JVH L;  4B1U B;  4FPA A;  4JK8 A;  3TTC A;  3WUH A;  1YIJ N;  2QWQ A;  5GIO A;  5GIN A;  2CGK A;  5KPR A;  4BRF A;  1NGG A;  2F9W A;  4H0V B;  4YOY A;  1VQL N;  2ZJP L;  3CCV N;  5AQX A;  3D2E B;  2GWK A;  3C6H A;  3P39 A;  3FGU A;  3WXK A;  3N4Q A;  3TPQ A;  4CBX A;  3CD6 N;  5FPD A;  3CME N;  4CZI A;  2OTL N;  3CJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...