1HNWK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnwK00
1IBLK 4JI1K 2VQEK 4LF7K 4DV1K 4LFCK 2HHHK 4CVNE 4DV4K 2F4VK 4DR1K 4JYAK 1I94K 4JI2K 4LF9K 4LF5K 2UXCK 1HNZK 4B3SK 2UUAK 4YHHK 2ZM6K 1XMOK 1N32K 4AQYK 4JI4K 4JV5K 4CW7B 3OTOK 1IBKK 4DR6K 4X64K 5AJ3K 5FLXO 4X66K 4DR3K 4DV7K 1HNWK 1XNQK 2UXDK 4DV3K 3T1YK 4LF4K 3J7YP 1XNRK 4JI8K 5LL6Z 4DUYK 1N33K 4DR2K 4LF8K 4JI7K 4DV2K 1J5EK 2UU9K 4JI5K 4X65K 1N36K 4GKJK 4KHPK 4JI0K 4OX9K 4X62K 1HNXK 4NXNK 3T1HK 5BR8K 2UXBK 4JI6K 4YY3K 2UUCK 2UUBK 3J81O 4JI3K 4LFAK 5LMUK 4DUZK 4DV6K 1IBMK 3J7AP 5IT9O 5LMNK 2E5LK 3JAMO 4DR4K 4DV0K 4NXMK 4DR5K 4B3TK 4B3RK 4GKKK 1N34K 4DR7K 4LF6K 4LFBK 1XMQK 5IWAK 4B3MK 4K0KK 2VQFK 3J80O 4DV5K 1FJGK 4V19S 5A2QO 1HR0K
chains in the Genus database with same CATH superfamily
5F2RA 3NDKA 3E66A 5BN8A 3SMPA 4FJ8A 3DMJA 2BGGA 1VSLA 4QAGA 1WSHA 1WSFA 5KGWA 1Z26A 4JYAK 4DQ8A 3VF6A 3CC2N 4I6MB 3I8BA 4CGFA 5CY4A 4JN4A 3CIPA 4FJ5A 3LDSA 5AQUA 2PYLA 1S9GA 5FRMA 4BQLA 4DLEA 4FJLA 1VAZA 4JKDA 2BDPA 4A57A 1NM1A 1NK9A 1RDAA 4CJEA 1FKOA 4IXCA 3TAPA 2O8EA 3OBYA 1W97L 4X64K 4C8LA 3P4IA 1Z25A 3DXKB 3KHYA 1XNQK 1XI1A 3OYBA 3OYHA 1X9WA 4WF9L 2FF6A 4I7FA 4AH9A 3MCAB 1NKEA 3MX2A 5C25A 3NF7A 4LF8K 2QWRA 4J2EA 2UU9K 2ZGZA 5AR0A 4GV9A 4DB3A 3CETA 4LC9B 1V4SA 4JKGB 4OLAA 2IOCA 2KFZA 1VQKN 3VQ8A 2CGKA 1L5UA 2E2QA 2XHBA 4R79A 3OS1A 5AFUA 2QEXN 4FJNA 4LFAK 2O8BB 4H5TA 3ZX3A 5AQIA 1TKDA 1W0HA 2OPSA 3B8AX 3D45A 2JWLA 1BOTO 3IUCA 4BY9C 1SL0A 2F9TA 4CIGA 1B9FA 2PBDA 4DR5K 3VN5A 3Q7BA 3V1QA 5AQYA 3CCSN 4LSNA 5JVHL 1TK5A 2PYJA 1QQOA 1WOQA 4NLCA 3JSMA 1BO5O 4E89A 2VQFK 5AQSA 1EKEA 1SKSA 3DXKA 4AM6A 1RGIA 2IVNA 3MN9A 4CE9A 3TAGA 5A2QO 3LP0A 2VQEK 2WONA 2A1RA 1UA1A 3B6OA 2ZD1A 3DAWA 1EWRA 3G10A 2ITMA 2OPPA 2HBKA 3BF3A 4NO7A 1C1CA 2XY7A 1B92A 4DTUA 5C12A 4FJ7A 2A40A 2NLXA 5EXWA 3GBTA 1GLDG 1NLVA 3CCJN 1RDUA 4DTXA 3AAQA 1N32K 1VQNN 3SJHA 1XUPO 3A2FA 1LAVA 1IG9A 2O8CA 3FZMA 4U7BA 2VWJA 3GOIA 3MX5A 3WXMB 4JD2A 5HBMA 3EN9A 1JKHA 1YHQN 2QK9A 1SAZA 2AJQA 3AO2A 5LJWA 4ISEA 1EO1A 3SV4A 4FM1A 3O4WA 2O4GA 4LF4K 4B9VA 4DSLA 4BRLA 1XNRK 4JLHA 4BE1A 3QERA 1RFQA 2VG6A 4J2DA 2ZWHA 3KLFA 4W5QA 2D1KA 3ZT1A 1TL1A 4X65K 2NRVA 4FYDA 5JVGL 4UQGA 3CJ1A 3MAQA 4F2RA 1JLCA 1C0FA 3SQ1A 3EZWA 4OX9K 2P9PB 3AO5A 3S3MA 4KHWA 3WEEA 1M90O 3WNHA 1TL3A 4LD0A 2RN2A 1LWFA 3KZBA 3D0PA 4O44A 5BR9A 4RW4A 4FLZA 4B9TA 4DUZK 4CEFA 1NOYA 4DFJA 4DTPA 2E5LK 4CJ3A 4DF8A 3C7NA 2NNWA 1RT7A 4F4KA 3CXCM 4MLHA 3GDQA 4IWVA 3RRGA 3DLEA 2UYTA 3ULDA 1Z6RA 5DM6L 3ZX2A 2GELA 2BE2A 1XMQK 5HLFA 1HJRA 1QS4A 1ZBLA 1QE1A 3OYGA 2LSNA 2XY5A 1QQNA 3ZEUB 1DLOA 3SUQA 4YORA 1S9EA 1IBLK 1LCUA 3EZ5A 3FLCO 3K5OA 1WSEA 4WE1A 4CJWA 1VSDA 3A5OC 3HRGA 2GUPA 2HMIA 5E26A 4CGIA 4MO4A 2OPRA 2FSNA 4BRDA 2ZGYA 4JI2K 1NKCA 3BGRA 4N76A 1NGGA 1T8EA 4O0JA 1LW2A 1XC3A 4IFYA 1T7PA 1HNZK 1EQYA 5FPMA 5AQZA 5T7BA 1EX4A 1S3XA 1L3TA 4BC3A 4A5AA 3HPGA 1KLMA 1F21A 4EIAA 2E2OA 3S3OA 2D0BA 1HLUA 4BRNA 4FWOA 4KHNA 1ASVA 1TYQB 2D0CA 4AF1A 4B9MA 4CHOA 4EP4A 4M3XA 4JRQA 2E8AA 1D8YA 3C6TA 3WXIA 2YNFA 3MWPA 5C42A 1HX1A 5GAHP 2Z1IA 4CIEA 3VA0A 3T19A 3VQ9A 3SUNA 3CG7A 4CJFA 1Q86O 2QTDA 4JKHA 3CHWA 4CEDA 4CF9A 3A0IX 4IKFA 2P9KA 2YI1A 4FOIA 3LDOA 3H1VX 4C8NA 1U48A 1LOTB 4FSVA 1OH6A 4AHSA 2A5XA 1IKYA 1N6QA 3SJJA 3TABA 3SBTA 3QEPA 2ASMA 4BC2A 3AVBA 1DKGD 5ADXH 4FJKA 1FW6A 1C1BA 1SUQA 2B5JA 2WUSA 4ICLA 3ZT0A 1OH7A 1J5OA 1XWLA 2P9IA 3RSEA 1WAJA 4IEIA 2A42A 3RMAA 3HZ6A 2HSTA 3HYFA 2YHYA 1JCFA 4DKWA 4DS5A 1FJGK 4Q5VA 1E4FT 2Q36A 3GL1A 4LH4A 1Q9XA 3KLGA 1KAZA 4M3ZA 4BWJA 3CQXA 3HI0A 3U4LA 3ENBA 2KQ2A 1K8AO 3QETA 3HPOA 1K6YA 1BI4A 3EL2A 3R1XA 5KRSA 5C0YA 3OYAA 3HP6A 3AA2A 5AZJB 5M1FA 3DLHA 2GX9A 4CF8A 5F1XA 5M1QA 2OTJN 3ZLJA 3KTQA 2GBZA 1P8ZA 1MWKA 3L2WA 4FJHA 1X9JA 4XEIA 5BRHA 3VQCA 2ZM6K 1K73O 4AQYK 1KFDA 4GMJB 4JI4K 3WQTA 2I5JA 1TYQA 3L8BA 3LDNA 1IBKK 4JS4A 4DR6K 3L4QA 1CZBA 4C8MA 3H08A 4JHDB 2A6AA 5JLFA 5CZ2A 1K8KB 3NH2A 2EWSA 3SYZA 1S6QA 4B8CA 1NMNA 4BDYA 1C6VA 2DPNA 2QWPA 3ZT4A 4M63C 1KSPA 4NCAA 5LY3A 4CCHA 3KD5E 4Y1DA 1S6PA 1T3VA 1BU6O 1W7AA 4OKKA 4Z0UA 4BC4A 1S1XA 4B9NA 3CFPA 1RT1A 3RWUA 4RCHA 4IJNA 2E6LA 4H4MA 1GOCA 4OPKA 2KFNA 5AQMA 2FLOA 5CR4A 2YHBA 2FBTA 3SK3A 5AQGA 1ATRA 3ID8A 3TSQA 3MDQA 1EXQA 5EVZA 3D7EO 5EY4A 2PFUA 1G99A 4BVOA 3L6QA 1LWEA 3V9WA 2X78A 4ELUA 4B3TK 1WSGA 1WN7A 4KFBA 3AY9A 4CD1A 5B8HA 1WAFA 3BUZB 4I2PA 1L3SA 1XC9A 1QHAA 5AQOA 2PZSA 4IOCL 4CJQA 3JS6A 1HQUA 1X9SA 2V7YA 2H3GX 4I2QA 2XY6A 3AVIA 3QDKA 4AHRA 1EWQA 4DSKA 1XQSC 4LFCK 4DTSA 2JWKA 3D2FB 2HVHA 1NOZA 1VSFA 4FM0A 1BA0A 4B1VA 3TAQA 2ITGA 4FWRA 5H1SQ 2D5RA 2UXCK 3CPEA 5D3GA 2UUAK 3ID6A 1TUUA 1ILYA 2KTQA 4WCEL 3K2PA 3KKRA 1QHTA 5AQNA 1HYZA 4ZHRA 2OZSA 3ZSRA 5AJ3K 1NK4A 2Q31A 1MA9B 4C8KA 3CI5A 3CFOA 3DXMB 2ZJRL 2ZE2A 2OANA 3C65A 4CF0A 4PL8A 3EYZA 3ISNC 1BI4B 4IDHA 1N33K 1EETA 4FO0A 5AQLA 2QI2A 4I6MA 4CEQA 1W9HA 2OPQA 3O9TA 3LM9A 3CQYA 2IDOA 4CHPA 3C6HA 5J2PA 4M7YA 4FLYA 2VYPA 2F8TA 2A1SA 4CF1A 3VQ4A 3ZSQA 4CHQA 4RW6A 3BDPA 4KB1A 1FXXA 1NG9A 2E2PA 3OYLA 1OH8A 4WQ4A 4YY3K 2GUIA 4OKEA 3NH1A 5LMUK 4A61A 1ASWA 3TSUA 3AVGA 3N4QA 1NGAA 4DV0K 4JKCA 4YFUA 4JS5A 4ILGB 4NXMK 3K9KA 4AHTA 3BZKA 4H4OA 3A5NC 1VSKA 1YTUA 1QSLA 2P9NB 3ENHA 1OKJA 4Q0BA 1JL2A 4FWQA 2HW3A 2IC3A 4YOTA 4A59A 3T3FA 5CE3A 3OYNA 3THXA 3FZKA 4CZJA 4IEEA 4A5BA 2HVIA 3MEDA 2R7YA 4CVNE 2F4VK 4KI6A 1R59O 3QLHA 4YDUC 3U6FA 2FSKA 3PLAA 3WXKA 4O5BA 3QNNA 2HOEA 4GV3A 4H5RA 4IO9L 3M3ZA 4RG8A 2HF3A 5JS1A 2X74A 1NJWA 4CHNA 3B6PA 3V6DA 3RMDA 1YIJN 3QBWA 2EX3A 2VGMA 5C2DA 1YVUA 2ASPA 5AQQA 1JXEA 4N56A 4B3SK 3E01A 1VQLN 1XMOK 1V4TA 5FROA 3NVKA 4B9SA 1YVNA 4H0TB 1LWCA 2CGLA 4CJKA 1BL3A 4C8OA 5I42A 1WSIA 3OW2M 2YNGA 1QZ5A 4CBWA 4BR4A 3QIOA 1A5WA 1NK5A 3O1BA 3CMEN 1KLNA 4PA1A 4BR7A 4CJ7A 5GIPA 3SAHA 3AO3A 1RBRA 1H1VA 4HHTA 3VQDA 2QM1A 3EE8A 3SLCA 3MXJA 3KLIA 3AO1A 5TKWA 5M1NA 2E4LA 3VQAA 4X62K 3DLLL 2RPIA 4H03B 4KI4A 4FJ9A 2O8EB 5BPLA 3AGRA 3J81O 3CCRN 1HNIA 3WUHA 4CGGA 1W2BM 3HPHA 3NHGA 4CBXA 4QCLA 3OYDA 1BCOA 1S1UA 4B3RK 3DRPA 1D5AA 4JK9A 5GINA 3THXB 1TK0A 1RBUA 3ENOA 3VEXA 1N8RO 4BGAA 4ELTA 5HRSA 4CEEA 3QEIA 1ZBHA 4ISGA 4G1QA 3T1AA 4DQPA 3UKUA 2HHSA 4ZTFA 3VESA 2BH1A 3VF4A 3NF9A 3E9LA 4JI1K 1QVGM 1C1AA 3VQBA 4BR9A 4H8KA 4CFDA 1ATSA 1GOBA 3OYJA 4N47A 4DLGA 3OYCA 3CCUN 4BRQA 4KAZA 1NK8A 4YDUA 2A3ZA 4FWLA 1RTIA 3DOLA 1Y97A 3ATUA 3F9MA 4BG9A 1HPMA 2VCPA 3EKUA 2ZJPL 1FK9A 4FJJA 1RBVA 3WNFA 4J8FA 2HNDA 4CW7B 5BPMA 3OTOK 4L8RB 1JLEA 3QMLA 5DMRA 4E1JA 4K8XA 4K41A 4DSFA 3O4QA 4YOXA 2F9WA 1LW0A 4KTWA 3QIPA 1U6ZA 3O4NA 4E7JA 3VQQA 3PSIA 4FCYA 4BRFA 4L3QA 5JMVA 3F5TA 1Q82O 2P9KB 3WNEA 3ZX0A 1YJ9N 3DJCA 4FL9A 3VOVA 1RILA 4H0PA 3K59A 1CZ9A 4IO8A 1NGIA 4DV2K 4MQ3A 3CCQN 2O4IA 2O8FA 4OPHA 1BG3A 3HTVA 3CMAN 4HTLA 1RT5A 4QS9A 3SPYA 5CZ1A 4TSXA 2P51A 4CJPA 3WXLA 1HKGA 1U2VB 4JI6K 4DU3A 3BZCA 4DQIA 4PQUA 2HHUA 2BANA 1BISA 1NGEA 1N5YA 1E3MA 2IVOA 2HF4A 2NZTA 5KQDA 3DXMA 5HRNA 3ITHA 3CFRA 5AQFA 1P90A 3ATVA 5CYQA 1BCMA 4IOAL 3AVNA 5AQRA 3G0ZA 4GKKK 2IAJA 3KKSA 2F7TA 4HUGA 1IO2A 4CJSA 4M3YA 4B3MK 3N4PA 1XHXA 3P1GA 1MDUB 1NJYA 5EOYA 3P39A 2PY5A 3O3FA 3FFIA 1BGXT 1RTDA 1HRHA 2Z1GA 1NKBA 3TU5A 3F9KA 4OJRA 3FR0A 1KVAA 2QKBA 4IFVA 4BRCA 1VHXA 2OZMA 1VQMN 3P5JA 3HVTA 3K5NA 2BUPA 4H5VA 4KRFA 3MK6A 4KHSA 4F8RA 4OPJA 3H3NO 4JHDA 5HP1A 4AHUA 2P9NA 4CZGA 3LL3A 1DT9A 3DI6A 1KQSM 5EU7A 4F9OA 4DTOA 5FRNA 1DEJA 4H0OA 3OA9A 4BR2A 3ZCMA 3KJVA 1SKRA 4FZXC 3NF6A 1RTHA 3P83D 4CJLA 1NGHA 4NYNA 1TV6A 4CGJA 2UXDK 2GWKA 2RF2A 4DV3K 3CM6A 4CJ5A 4OPAA 1ZYQA 4FJGA 5AZJA 3PIPL 1G15A 4M3WA 3FE1A 1J5EK 1R0AA 3U3GA 3EY1A 3ZYYX 3PO4A 2Q3SA 4EP5A 4JI0K 2VGNA 3CF5L 1HNXK 4FLWA 3WNGA 3I0RA 3SAFA 2O8FB 4BDZA 4DTNA 1TAUA 4FPBA 3H6EA 2G8FA 2P9PA 2NRZA 1QQMA 3VA3A 3VGLA 4DV6K 3A8YA 4PHTX 5DM7L 3RSEB 4Z4CA 1HQEA 3HM9A 2Q2RA 3V9ZA 1RTJA 2NRRA 1IJJA 2IS3A 3C6AA 3L4IA 1NGJA 3V9XA 1SL2A 5AQJA 2Q1NA 3TWHA 4FWSA 3WXJA 3THWA 4YNQA 1BIZA 3QO9A 2YV0X 2OA8A 4KBOA 4FZZA 3S3NA 3UB5A 4JEPA 3R9PA 4R5PA 2O8CB 2WBNA 4M3UA 4NLBA 4AILC 3SI6A 3QB0A 2FBXA 3THVA 1CXUA 3PX0A 3DLRA 1HYVA 2RKIA 1NMDA 2B6AA 4K25A 2DFEA 4DQSA 4DFPA 2ZQBA 4CFCA 4FW1A 3AVFA 1VQ4N 1HKBA 3RR8A 3LDPA 3Q7CA 3SUPA 3H1QA 3LP1A 5AQHA 2F96A 2G8VA 4CF2A 1BA1A 1RDCA 5KTQA 3LWMA 4BGBA 3MMVA 1WUAA 3KLEA 5J2NA 3SCXA 2Q97A 2QWMA 1BDGA 3PX6A 4IBNA 3RRHA 2ETJA 1BQMA 1T44A 4O8KA 1QZ6A 4KTZA 1DTQA 2E20A 2VWBA 2QXFA 1VSMA 4DFMA 4CEAA 1ZXOA 4WQ5A 4DG1A 4M45A 3KWGA 3I33A 4FWMA 4AHCA 3T1YK 1BWFO 1S22A 1U49A 1RBSA 4DR2K 3U3YA 1KVBA 4ID1A 5JICA 3DRRA 1ZBUA 1JJ2M 2W6KA 5E84A 4KV8A 2QWLA 5K14A 1HUXA 3I0SA 1YITN 2WTUA 3AAPA 4NXNK 1TKTA 1RT6A 2Z1JA 1VQON 3HK2A 3EKSA 4HWIA 4BC5A 4CK2A 5EX5A 4H0YB 1A5XA 1NNEA 4JI3K 3HL8A 2XY8A 1NBWA 1BUPA 3ZSWA 3K57A 2BTFA 3JAMO 1K8KA 1GLBG 4CHYA 2CGJA 3FFKB 4E7KA 3LDLA 2ASOA 4Z4GA 3K9JA 3NVMA 2O8BA 3H3OB 4DR7K 4IFEA 4FLTA 2P1JA 4OO1J 3VEOA 2YX6A 1WBDA 3ULEA 4CECA 4IJAA 3A5MC 3VPZA 4DR4K 4DFKA 3C95A 3DLGA 2YKNA 3ALYA 1GLEG 3DM2A 4IZ9A 3ZETA 3U9DA 2IIRA 4DV4K 2CH6A 2P9LB 3DLKA 4O55A 3OYFA 1NK0A 5BREA 1O1WA 5HL7L 1KAXA 2V7ZA 3LPTA 4DU1A 1SQKA 2QWQA 1IV0A 3BY5A 1TKZA 1YAGA 5C2FA 2W42A 2QWOA 2G8IA 4Z4FA 4B9UA 3JXUA 2D0PA 1TGOA 5CYMA 4K8ZA 4E19A 1QVFM 4BQZA 5ELZA 2Q0RA 3EEQA 3LALA 4FJIA 3O9RA 3AA4A 4RW9A 5KPRA 4M3TA 4FWKA 2QWNA 2YNIA 2FC0A 1ZBFA 2P5GA 4B9LA 1OVQA 4WFAL 4JI8K 1FKPA 2NRXA 3KK7A 3QNOA 4OLBA 3E9PA 4XH1A 3MEGA 3LANA 4YOVA 2KKZA 4JI7K 4CZLA 1S72N 1VSEA 1RT3A 3OBWA 1NWKA 3ZSOA 4Z4HA 3CCVN 2V51B 3G25A 3IRXA 4PWDA 3ZSZA 3KWIA 3V1OA 4DSEA 4JK8A 4OKJA 4BRPA 2ZF5O 1IBMK 1S1VA 3VTHA 4ILJA 5SZTA 3RVCA 3IG1A 4EFHA 2HB5A 1K9MO 3AA3A 4E7LA 3ASMA 4O0IA 4I9LA 2HHQA 1YF5L 3NF8A 3CYMA 1GLLO 2NRTA 4OVLA 5I3UA 3CJBA 1GLFO 5KPZA 4CBUA 2IVPA 4E1NA 1QSSA 4DV5K 3TR8A 4CFBA 2D0OA 4E7HA 3R6MA 4JKBA 1ZC6A 4KH6A 2YCHA 3F2KA 4RTFD 3RR7A 1YJWN 3LP3A 1U2VA 1L3VA 3L2RA 2E1YA 2NUBA 3SQ4A 1JXBA 4CZMA 3TTCA 1U04A 3V4IA 2P5OA 3ZEUA 3PSFA 5AQXA 4A2BA 3T69A 5AQPA 3TAFA 3JYTA 1YJNN 3WEEB 4KTQA 4FK2A 2X6NA 4M3RA 4JKGA 4B3OA 3HO1A 2W41A 1HMVA 2ATQA 3BP8A 2OCEA 3HSCA 2HBJA 4K43A 3C6UA 4DHYA 3FZLA 5KI6A 3VGKA 4KHUA 3ZSVA 4E7IA 3LDQA 3NCIA 2AA4A 4PKGA 2G8KA 2GEMA 4JNEA 4NYFA 4CJUA 1IKWA 3THYB 1J6ZA 4I9QA 4CEBA 1U45A 5JS2A 2P9UA 4JD2B 4XH4A 2YHAA 2WOMA 4NB4A 5BRFA 3OYMA 3O9QA 3MN5A 1BQNA 4JKFA 1C0TA 5GAEP 4NCGA 1JL1A 2FXUA 4BVPA 2KHOA 2UXBK 5FDLA 4A62A 4CGDA 2UUCK 2UUBK 4DS4A 1MWMA 2HNYA 5AZIA 4Y0WA 3THWB 3MEEA 2QA4N 1D9FA 2DY4A 4U67L 2HMPA 3L2UA 1VQ5N 1Q8IA 2V52B 4WQ5C 1IKVA 3SV3A 2WFBA 4DQQA 2FF3B 4FVMA 3VGMA 3QBXA 3M8RA 4ZTJA 4AHVA 1C0MA 1ZBIA 1NJIO 3E9OA 3SQ0A 3KK1A 3G71N 4PY5A 1TAQA 4GVMA 1TVRA 4GW6A 1VK0A 4FPAA 3J8AA 3CJ7A 1SV5A 3C94A 4JAXA 4XH5A 3OS2A 4EZ9A 3OVNA 5KQ8A 4EZ6A 3U9ZA 1U47A 3AGKA 3W3DA 2HHHK 1UAXA 3MN7A 1Q18A 3ULEB 1I94K 1I39A 4A2AA 3NE6A 3CC7N 1Z05A 1CZAN 4MDAA 3VETA 2Y1JA 2GTDA 1J54A 3U8XA 3QFUA 3VQ7A 2NRHA 5C24A 4BE2A 4CFAA 2P9LA 4JV5K 3CJ9A 3VMFB 3MN6A 5TKYA 4M42A 2KLAA 4CI6A 3QEWA 1KC8O 4GV6A 2QW9A 2ZJQL 2D0AA 2CH5A 1VRUA 4JK7A 3IS9A 4DU4A 5MLCQ 3V9SA 4DCHA 5LL6Z 5KGXA 2HHXA 4C1NI 1NU0A 2I7PA 1N36K 1GLJO 3O8MA 2HBMA 4CESA 1Q9YA 4BROA 2J4RA 5C10A 2XRIA 3E1YA 5M1OA 3OYKA 1S5JA 5J2QA 4ISFA 4H0XB 3C0BA 4OGCA 4EHUA 3SQ2A 3IAYA 3H45C 3I56N 3CD6N 1XHZA 5M1KA 3PY8A 3HXMA 3QESA 3GE1A 3OYIA 3J7AP 3FZHA 4GY2B 4GVEA 5IT9O 3OS0A 1KCFA 4M7XA 3VQ5A 4LSLA 4DTMA 1T05A 5J1EA 1UWBA 2HHTA 2G8UA 4FK4A 1YXQA 4PL7A 4O5FA 4CZFA 3O9UA 4RW7A 4JRPA 3CCEN 4KHYA 4WYBA 3V81A 3VERA 3KVGA 3H46O 3MXIA 4KREA 5GIOA 4Z4EA 2W40A 1GOAA 5SWMA 1C0UA 4FXDA 3UKRA 4W5RA 3O3HA 5LJVA 4IOXA 4MFBA 3SNNA 5M1PA 4DQRA 1JCGA 3BEXA 1M1KO 1ASUA 1NGBA 2PAVA 3V1RA 3VEWA 3S41A 3NFAA 3QEXA 5HRRA 3AVLA 5I9EB 1HYSA 3OHRA 4CERA 3A5LC 4QS7A 3IKMA 3LPUA 2WC9A 4LF5K 1ATNA 3MECA 1YI2N 3TI0A 4CJRA 4RW8A 1S1TA 5HRPA 2Q0UA 3TTFA 4B1XB 5E41A 1S1WA 1VSHA 4KH4A 1D4XA 3VEYA 1Q7YO 3LM2A 4MO5A 3AVAA 4FOEA 2KZZA 4DMNA 3J7YP 1JLBA 3KK3A 3L2VA 4DUYK 4J2BA 3VTIA 1HNVA 5JLHA 4WFNL 1U4BA 4PKHA 4IG3A 3HVRA 1NGCA 3CPWM 3O1WA 1HPZA 2E6MA 4CEZA 4BREA 5HROA 3UKUB 5BR8K 3EE9A 4W5TA 4CD3A 1VQ8N 5HOOA 2YJEA 3UE5A 3QFPA 3ZT2A 3BF1A 3M8SA 4BWMA 4OGEA 1KFSA 3TAMA 3TANA 2P9SA 5KRTA 4KHQA 3D2EA 1KAYA 3CCLN 1DGKN 3M1FA 4C23A 4QS8A 2OYQA 1KRPA 5BRDA 2W6LA 4CZEA 3NAEA 1N34K 4O4GA 3HP9A 3NGZA 1MU2A 1WSJA 3HSTB 3I55N 4M41A 1I3AA 4EAHD 4ID5A 1NK7A 1T03A 1WNSA 4B1UB 4FWNA 3AV9A 3DRSA 3SAGA 3NH0A 4FLVA 3RTVA 1TK8A 3SMSA 1DTTA 4K42A 4HUEA 1JCEA 4BRHA 3VQ6A 1WB9A 4HVJA 4DV1K 1ZBSA 4LF7K 3AARA 4IG0A 3THYA 1RBTA 5BN9A 4YOUA 4J2AA 4HCCA 4BRAA 4Y1CA 3UIQA 5AQVA 4W5OA 4CZHA 4JKAA 3SBGA 4HTUA 3FZFA 1IH7A 4CGHA 2Z1HA 1RT2A 4JKEA 4C1NK 3HOSA 4LY7A 3DLBA 2VG7A 3CM5A 2O8DB 3MXMA 1QQCA 3OJUA 2QKKA 1TUYA 1Q81O 3WT0A 4CJVA 3EO3A 3O08A 1UOCA 4YOYA 4X66K 3PIOL 4DR3K 4CJ4A 1EP4A 3I8DA 3AO4A 3C7NB 3TARA 1NJZA 4KH5A 1QSYA 1TKXA 4FW2A 1BIUA 3HJFA 4B1YB 4CK3A 1J9AA 1GLAG 3G6EN 4MDBA 1IKXA 4GKJK 4KHPK 4WQ4C 4DWIA 1SZ2A 2O8DA 1GLCG 3UKRB 3ZSYA 1ESVA 3LWLA 2F8SA 3O9SA 3SUOA 1SS6A 1L3UA 4UY8O 2DTUA 2KW4A 5C15A 5CHIA 4RWTA 3KK2A 1JLAA 4BRMA 4E3SA 4AM7A 3O3GA 2B4JA 3M5RA 5LMNK 5AFUH 5KPTA 4DTJA 3DYAA 2I7NA 1RDDA 5FPEA 1WLJA 3V9UA 1X9MA 3VQPA 4CZKA 2VWKA 4FJXA 1D9DA 1LV5A 1UA0A 4F3TA 3NGIA 3W0LA 3PO5A 5DK5A 4K0KK 3O80A 3R3LA 3AVCA 4V19S 3LZIA 3ZSXA 4LH5A 3VENA 2DFFA 4N5SA 4QOZB 2DFHA 1X3NA 3L3UA 4KO0A 4F3OA 1SL1A 4B1WB 4BACA 5F0XA 4MLEA 4O8UA 4DR1K 1B9DA 1YT3A 5GADP 4H0VB 3PUFA 3LZJA 3L3VA 3TPQA 4BRIA 5AQWA 3AVMA 4FZYA 2P9IB 1HJOA 1VSJA 3R8EA 2YNHA 3FGUA 4ELVA 3NBPA 3D6RA 1VRTA 1RCHA 1E4GT 4BRKA 3M8PA 3SPZA 4BR5A 4KKOA 3MCPA 2D4WA 3LAKA 5FLXO 3VEZA 1KVCA 3D2EB 2KZMA 2NRWA 3K5LA 4DV7K 1HNWK 3LAMA 1ITGA 4DF4A 2JLEA 4PUOA 2G8HA 4DTRA 3HBTA 4WFBL 4H5NA 3SZ2A 4BR0A 3RMBA 4NCBA 5ADXA 2G8WA 3OY9A 4HUFA 2YHWA 1VSIA 2E88A 4CIFA 3M8QA 1NGFA 4CZIA 3PV8A 2VG5A 1J53A 3F73A 3CERA 4E1MA 4BDPA 4CHZA 4FLXA 4FWPA 5BPNA 1CLQA 2JGUA 3J7ZO 3AA5X 1JLFA 3IFRA 4CK1A 4E0DA 1JLQA 2FBYA 1VQ7N 4F2SA 3IMXA 3QINA 3T1HK 4DSIA 2GWJA 3KIOA 4BRGA 2HHVA 3O5BA 3L0QA 2HHWA 4FLUA 5FPDA 2A41A 3G4SN 3RMCA 2Y1IA 3AVKA 4EHTA 5GAGP 3CQ8A 1NGDA 1RDWX 3GG4A 2GV9A 3T7ZA 4B1ZA 3TTDA 1YUWA 4G9ZA 5AZIB 3VQEA 1C0GA 1RT4A 4LF6K 3CJAA 1VQPN 1NJXA 3QEVA 1JLGA 4CJTA 4IDKA 5J2MA 4N41A 1IG8A 3CCMN 3KD1E 1RDBA 3VEVA 1HR0K 3M6GA 3DOKA 2RHKA 1NK6A 1KXPA 4BG8A 3P38A 2FBVA 2P9UB 4GNIA 1LAWA 2QXLA 4FVUA 5AQKA 4LF9K 1CXQA 3HM8A 1X3MA 1YTAA 3IDHA 3K58A 4B9QA 4FJMA 1Y64A 4YHHK 3HOTA 3TAEA 3S9HA 3PX4A 3ZT3A 3OJSA 2YKMA 3OYEA 1A5VA 2AP1A 2YHXA 1QTMA 1KTQA 5AQTA 1RNHA 3L2QA 4YOWA 3HT3A 3NGYA 4B08A 4ILHA 3CC4N 3AVHA 4DSJA 3VF2A 4W5NA 3TSPA 4FK0A 2XO7A 3K5MA 4H5WA 4HCBA 3MWTA 1OVYA 1X1PA 1HKCA 4JI5K 3CJCA 1BHLA 4Z94A 2RE2A 4XIUA 2HBLA 1REVA 2IGIA 3DWLA 4FM2A 1WBBA 2E2NA 2P9SB 2EHGA 3WQUA 2OTLN 4Z4IA 1T6CA 1VQ6N 3LP2A 1VQ9N 3O6WA 2X6SA 5FPNA 1OH5A 1O13A 4B8AB 4KB0A 1SKWA 3KLHA 4BE0A 3AVJA 3NMUA 2E1ZA 4PKIA 4LFBK 1T6DA 3K0SA 3ZETB 4KPYA 3QICA 5IWAK 4CEOA 2FSJA 1KD1O 3J80O 2HNZA 3D2FA 2YJFA 3P31A
chains in the Genus database with same CATH topology
1IBLK 4JI1K 2VQEK 4LF7K 4DV1K 4LFCK 2HHHK 4CVNE 4DV4K 2F4VK 4DR1K 4JYAK 1I94K 4JI2K 4LF9K 4LF5K 2UXCK 1HNZK 4B3SK 2UUAK 4YHHK 2ZM6K 1XMOK 1N32K 4AQYK 4JI4K 4JV5K 4CW7B 3OTOK 1IBKK 4DR6K 4X64K 5AJ3K 5FLXO 4X66K 4DR3K 4DV7K 1HNWK 1XNQK 2UXDK 4DV3K 3T1YK 4LF4K 3J7YP 1XNRK 4JI8K 5LL6Z 4DUYK 1N33K 4DR2K 4LF8K 4JI7K 4DV2K 1J5EK 2UU9K 4JI5K 4X65K 1N36K 4GKJK 4KHPK 4JI0K 4OX9K 4X62K 1HNXK 4NXNK 3T1HK 5BR8K 2UXBK 4JI6K 4YY3K 2UUCK 2UUBK 3J81O 4JI3K 4LFAK 5LMUK 4DUZK 4DV6K 1IBMK 3J7AP 5IT9O 5LMNK 2E5LK 3JAMO 4DR4K 4DV0K 4NXMK 4DR5K 4B3TK 4B3RK 4GKKK 1N34K 4DR7K 4LF6K 4LFBK 1XMQK 5IWAK 4B3MK 4K0KK 2VQFK 3J80O 4DV5K 1FJGK 4V19S 5A2QO 1HR0K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL K;  4JI1 K;  2VQE K;  4LF7 K;  4DV1 K;  4LFC K;  2HHH K;  4CVN E;  4DV4 K;  2F4V K;  4DR1 K;  4JYA K;  1I94 K;  4JI2 K;  4LF9 K;  4LF5 K;  2UXC K;  1HNZ K;  4B3S K;  2UUA K;  4YHH K;  2ZM6 K;  1XMO K;  1N32 K;  4AQY K;  4JI4 K;  4JV5 K;  4CW7 B;  3OTO K;  1IBK K;  4DR6 K;  4X64 K;  5AJ3 K;  5FLX O;  4X66 K;  4DR3 K;  4DV7 K;  1HNW K;  1XNQ K;  2UXD K;  4DV3 K;  3T1Y K;  4LF4 K;  3J7Y P;  1XNR K;  4JI8 K;  5LL6 Z;  4DUY K;  1N33 K;  4DR2 K;  4LF8 K;  4JI7 K;  4DV2 K;  1J5E K;  2UU9 K;  4JI5 K;  4X65 K;  1N36 K;  4GKJ K;  4KHP K;  4JI0 K;  4OX9 K;  4X62 K;  1HNX K;  4NXN K;  3T1H K;  5BR8 K;  2UXB K;  4JI6 K;  4YY3 K;  2UUC K;  2UUB K;  3J81 O;  4JI3 K;  4LFA K;  5LMU K;  4DUZ K;  4DV6 K;  1IBM K;  3J7A P;  5IT9 O;  5LMN K;  2E5L K;  3JAM O;  4DR4 K;  4DV0 K;  4NXM K;  4DR5 K;  4B3T K;  4B3R K;  4GKK K;  1N34 K;  4DR7 K;  4LF6 K;  4LFB K;  1XMQ K;  5IWA K;  4B3M K;  4K0K K;  2VQF K;  3J80 O;  4DV5 K;  1FJG K;  4V19 S;  5A2Q O;  1HR0 K; 
#chains in the Genus database with same CATH topology
 5F2R A;  3NDK A;  3E66 A;  5BN8 A;  3SMP A;  4FJ8 A;  3DMJ A;  2BGG A;  1VSL A;  4QAG A;  1WSH A;  1WSF A;  5KGW A;  1Z26 A;  4JYA K;  4DQ8 A;  3VF6 A;  3CC2 N;  4I6M B;  3I8B A;  4CGF A;  5CY4 A;  4JN4 A;  3CIP A;  4FJ5 A;  3LDS A;  5AQU A;  2PYL A;  1S9G A;  5FRM A;  4BQL A;  4DLE A;  4FJL A;  1VAZ A;  4JKD A;  2BDP A;  4A57 A;  1NM1 A;  1NK9 A;  1RDA A;  4CJE A;  1FKO A;  4IXC A;  3TAP A;  2O8E A;  3OBY A;  1W97 L;  4X64 K;  4C8L A;  3P4I A;  1Z25 A;  3DXK B;  3KHY A;  1XNQ K;  1XI1 A;  3OYB A;  3OYH A;  1X9W A;  4WF9 L;  2FF6 A;  4I7F A;  4AH9 A;  3MCA B;  1NKE A;  3MX2 A;  5C25 A;  3NF7 A;  4LF8 K;  2QWR A;  4J2E A;  2UU9 K;  2ZGZ A;  5AR0 A;  4GV9 A;  4DB3 A;  3CET A;  4LC9 B;  1V4S A;  4JKG B;  4OLA A;  2IOC A;  2KFZ A;  1VQK N;  3VQ8 A;  2CGK A;  1L5U A;  2E2Q A;  2XHB A;  4R79 A;  3OS1 A;  5AFU A;  2QEX N;  4FJN A;  4LFA K;  2O8B B;  4H5T A;  3ZX3 A;  5AQI A;  1TKD A;  1W0H A;  2OPS A;  3B8A X;  3D45 A;  2JWL A;  1BOT O;  3IUC A;  4BY9 C;  1SL0 A;  2F9T A;  4CIG A;  1B9F A;  2PBD A;  4DR5 K;  3VN5 A;  3Q7B A;  3V1Q A;  5AQY A;  3CCS N;  4LSN A;  5JVH L;  1TK5 A;  2PYJ A;  1QQO A;  1WOQ A;  4NLC A;  3JSM A;  1BO5 O;  4E89 A;  2VQF K;  5AQS A;  1EKE A;  1SKS A;  3DXK A;  4AM6 A;  1RGI A;  2IVN A;  3MN9 A;  4CE9 A;  3TAG A;  5A2Q O;  3LP0 A;  2VQE K;  2WON A;  2A1R A;  1UA1 A;  3B6O A;  2ZD1 A;  3DAW A;  1EWR A;  3G10 A;  2ITM A;  2OPP A;  2HBK A;  3BF3 A;  4NO7 A;  1C1C A;  2XY7 A;  1B92 A;  4DTU A;  5C12 A;  4FJ7 A;  2A40 A;  2NLX A;  5EXW A;  3GBT A;  1GLD G;  1NLV A;  3CCJ N;  1RDU A;  4DTX A;  3AAQ A;  1N32 K;  1VQN N;  3SJH A;  1XUP O;  3A2F A;  1LAV A;  1IG9 A;  2O8C A;  3FZM A;  4U7B A;  2VWJ A;  3GOI A;  3MX5 A;  3WXM B;  4JD2 A;  5HBM A;  3EN9 A;  1JKH A;  1YHQ N;  2QK9 A;  1SAZ A;  2AJQ A;  3AO2 A;  5LJW A;  4ISE A;  1EO1 A;  3SV4 A;  4FM1 A;  3O4W A;  2O4G A;  4LF4 K;  4B9V A;  4DSL A;  4BRL A;  1XNR K;  4JLH A;  4BE1 A;  3QER A;  1RFQ A;  2VG6 A;  4J2D A;  2ZWH A;  3KLF A;  4W5Q A;  2D1K A;  3ZT1 A;  1TL1 A;  4X65 K;  2NRV A;  4FYD A;  5JVG L;  4UQG A;  3CJ1 A;  3MAQ A;  4F2R A;  1JLC A;  1C0F A;  3SQ1 A;  3EZW A;  4OX9 K;  2P9P B;  3AO5 A;  3S3M A;  4KHW A;  3WEE A;  1M90 O;  3WNH A;  1TL3 A;  4LD0 A;  2RN2 A;  1LWF A;  3KZB A;  3D0P A;  4O44 A;  5BR9 A;  4RW4 A;  4FLZ A;  4B9T A;  4DUZ K;  4CEF A;  1NOY A;  4DFJ A;  4DTP A;  2E5L K;  4CJ3 A;  4DF8 A;  3C7N A;  2NNW A;  1RT7 A;  4F4K A;  3CXC M;  4MLH A;  3GDQ A;  4IWV A;  3RRG A;  3DLE A;  2UYT A;  3ULD A;  1Z6R A;  5DM6 L;  3ZX2 A;  2GEL A;  2BE2 A;  1XMQ K;  5HLF A;  1HJR A;  1QS4 A;  1ZBL A;  1QE1 A;  3OYG A;  2LSN A;  2XY5 A;  1QQN A;  3ZEU B;  1DLO A;  3SUQ A;  4YOR A;  1S9E A;  1IBL K;  1LCU A;  3EZ5 A;  3FLC O;  3K5O A;  1WSE A;  4WE1 A;  4CJW A;  1VSD A;  3A5O C;  3HRG A;  2GUP A;  2HMI A;  5E26 A;  4CGI A;  4MO4 A;  2OPR A;  2FSN A;  4BRD A;  2ZGY A;  4JI2 K;  1NKC A;  3BGR A;  4N76 A;  1NGG A;  1T8E A;  4O0J A;  1LW2 A;  1XC3 A;  4IFY A;  1T7P A;  1HNZ K;  1EQY A;  5FPM A;  5AQZ A;  5T7B A;  1EX4 A;  1S3X A;  1L3T A;  4BC3 A;  4A5A A;  3HPG A;  1KLM A;  1F21 A;  4EIA A;  2E2O A;  3S3O A;  2D0B A;  1HLU A;  4BRN A;  4FWO A;  4KHN A;  1ASV A;  1TYQ B;  2D0C A;  4AF1 A;  4B9M A;  4CHO A;  4EP4 A;  4M3X A;  4JRQ A;  2E8A A;  1D8Y A;  3C6T A;  3WXI A;  2YNF A;  3MWP A;  5C42 A;  1HX1 A;  5GAH P;  2Z1I A;  4CIE A;  3VA0 A;  3T19 A;  3VQ9 A;  3SUN A;  3CG7 A;  4CJF A;  1Q86 O;  2QTD A;  4JKH A;  3CHW A;  4CED A;  4CF9 A;  3A0I X;  4IKF A;  2P9K A;  2YI1 A;  4FOI A;  3LDO A;  3H1V X;  4C8N A;  1U48 A;  1LOT B;  4FSV A;  1OH6 A;  4AHS A;  2A5X A;  1IKY A;  1N6Q A;  3SJJ A;  3TAB A;  3SBT A;  3QEP A;  2ASM A;  4BC2 A;  3AVB A;  1DKG D;  5ADX H;  4FJK A;  1FW6 A;  1C1B A;  1SUQ A;  2B5J A;  2WUS A;  4ICL A;  3ZT0 A;  1OH7 A;  1J5O A;  1XWL A;  2P9I A;  3RSE A;  1WAJ A;  4IEI A;  2A42 A;  3RMA A;  3HZ6 A;  2HST A;  3HYF A;  2YHY A;  1JCF A;  4DKW A;  4DS5 A;  1FJG K;  4Q5V A;  1E4F T;  2Q36 A;  3GL1 A;  4LH4 A;  1Q9X A;  3KLG A;  1KAZ A;  4M3Z A;  4BWJ A;  3CQX A;  3HI0 A;  3U4L A;  3ENB A;  2KQ2 A;  1K8A O;  3QET A;  3HPO A;  1K6Y A;  1BI4 A;  3EL2 A;  3R1X A;  5KRS A;  5C0Y A;  3OYA A;  3HP6 A;  3AA2 A;  5AZJ B;  5M1F A;  3DLH A;  2GX9 A;  4CF8 A;  5F1X A;  5M1Q A;  2OTJ N;  3ZLJ A;  3KTQ A;  2GBZ A;  1P8Z A;  1MWK A;  3L2W A;  4FJH A;  1X9J A;  4XEI A;  5BRH A;  3VQC A;  2ZM6 K;  1K73 O;  4AQY K;  1KFD A;  4GMJ B;  4JI4 K;  3WQT A;  2I5J A;  1TYQ A;  3L8B A;  3LDN A;  1IBK K;  4JS4 A;  4DR6 K;  3L4Q A;  1CZB A;  4C8M A;  3H08 A;  4JHD B;  2A6A A;  5JLF A;  5CZ2 A;  1K8K B;  3NH2 A;  2EWS A;  3SYZ A;  1S6Q A;  4B8C A;  1NMN A;  4BDY A;  1C6V A;  2DPN A;  2QWP A;  3ZT4 A;  4M63 C;  1KSP A;  4NCA A;  5LY3 A;  4CCH A;  3KD5 E;  4Y1D A;  1S6P A;  1T3V A;  1BU6 O;  1W7A A;  4OKK A;  4Z0U A;  4BC4 A;  1S1X A;  4B9N A;  3CFP A;  1RT1 A;  3RWU A;  4RCH A;  4IJN A;  2E6L A;  4H4M A;  1GOC A;  4OPK A;  2KFN A;  5AQM A;  2FLO A;  5CR4 A;  2YHB A;  2FBT A;  3SK3 A;  5AQG A;  1ATR A;  3ID8 A;  3TSQ A;  3MDQ A;  1EXQ A;  5EVZ A;  3D7E O;  5EY4 A;  2PFU A;  1G99 A;  4BVO A;  3L6Q A;  1LWE A;  3V9W A;  2X78 A;  4ELU A;  4B3T K;  1WSG A;  1WN7 A;  4KFB A;  3AY9 A;  4CD1 A;  5B8H A;  1WAF A;  3BUZ B;  4I2P A;  1L3S A;  1XC9 A;  1QHA A;  5AQO A;  2PZS A;  4IOC L;  4CJQ A;  3JS6 A;  1HQU A;  1X9S A;  2V7Y A;  2H3G X;  4I2Q A;  2XY6 A;  3AVI A;  3QDK A;  4AHR A;  1EWQ A;  4DSK A;  1XQS C;  4LFC K;  4DTS A;  2JWK A;  3D2F B;  2HVH A;  1NOZ A;  1VSF A;  4FM0 A;  1BA0 A;  4B1V A;  3TAQ A;  2ITG A;  4FWR A;  5H1S Q;  2D5R A;  2UXC K;  3CPE A;  5D3G A;  2UUA K;  3ID6 A;  1TUU A;  1ILY A;  2KTQ A;  4WCE L;  3K2P A;  3KKR A;  1QHT A;  5AQN A;  1HYZ A;  4ZHR A;  2OZS A;  3ZSR A;  5AJ3 K;  1NK4 A;  2Q31 A;  1MA9 B;  4C8K A;  3CI5 A;  3CFO A;  3DXM B;  2ZJR L;  2ZE2 A;  2OAN A;  3C65 A;  4CF0 A;  4PL8 A;  3EYZ A;  3ISN C;  1BI4 B;  4IDH A;  1N33 K;  1EET A;  4FO0 A;  5AQL A;  2QI2 A;  4I6M A;  4CEQ A;  1W9H A;  2OPQ A;  3O9T A;  3LM9 A;  3CQY A;  2IDO A;  4CHP A;  3C6H A;  5J2P A;  4M7Y A;  4FLY A;  2VYP A;  2F8T A;  2A1S A;  4CF1 A;  3VQ4 A;  3ZSQ A;  4CHQ A;  4RW6 A;  3BDP A;  4KB1 A;  1FXX A;  1NG9 A;  2E2P A;  3OYL A;  1OH8 A;  4WQ4 A;  4YY3 K;  2GUI A;  4OKE A;  3NH1 A;  5LMU K;  4A61 A;  1ASW A;  3TSU A;  3AVG A;  3N4Q A;  1NGA A;  4DV0 K;  4JKC A;  4YFU A;  4JS5 A;  4ILG B;  4NXM K;  3K9K A;  4AHT A;  3BZK A;  4H4O A;  3A5N C;  1VSK A;  1YTU A;  1QSL A;  2P9N B;  3ENH A;  1OKJ A;  4Q0B A;  1JL2 A;  4FWQ A;  2HW3 A;  2IC3 A;  4YOT A;  4A59 A;  3T3F A;  5CE3 A;  3OYN A;  3THX A;  3FZK A;  4CZJ A;  4IEE A;  4A5B A;  2HVI A;  3MED A;  2R7Y A;  4CVN E;  2F4V K;  4KI6 A;  1R59 O;  3QLH A;  4YDU C;  3U6F A;  2FSK A;  3PLA A;  3WXK A;  4O5B A;  3QNN A;  2HOE A;  4GV3 A;  4H5R A;  4IO9 L;  3M3Z A;  4RG8 A;  2HF3 A;  5JS1 A;  2X74 A;  1NJW A;  4CHN A;  3B6P A;  3V6D A;  3RMD A;  1YIJ N;  3QBW A;  2EX3 A;  2VGM A;  5C2D A;  1YVU A;  2ASP A;  5AQQ A;  1JXE A;  4N56 A;  4B3S K;  3E01 A;  1VQL N;  1XMO K;  1V4T A;  5FRO A;  3NVK A;  4B9S A;  1YVN A;  4H0T B;  1LWC A;  2CGL A;  4CJK A;  1BL3 A;  4C8O A;  5I42 A;  1WSI A;  3OW2 M;  2YNG A;  1QZ5 A;  4CBW A;  4BR4 A;  3QIO A;  1A5W A;  1NK5 A;  3O1B A;  3CME N;  1KLN A;  4PA1 A;  4BR7 A;  4CJ7 A;  5GIP A;  3SAH A;  3AO3 A;  1RBR A;  1H1V A;  4HHT A;  3VQD A;  2QM1 A;  3EE8 A;  3SLC A;  3MXJ A;  3KLI A;  3AO1 A;  5TKW A;  5M1N A;  2E4L A;  3VQA A;  4X62 K;  3DLL L;  2RPI A;  4H03 B;  4KI4 A;  4FJ9 A;  2O8E B;  5BPL A;  3AGR A;  3J81 O;  3CCR N;  1HNI A;  3WUH A;  4CGG A;  1W2B M;  3HPH A;  3NHG A;  4CBX A;  4QCL A;  3OYD A;  1BCO A;  1S1U A;  4B3R K;  3DRP A;  1D5A A;  4JK9 A;  5GIN A;  3THX B;  1TK0 A;  1RBU A;  3ENO A;  3VEX A;  1N8R O;  4BGA A;  4ELT A;  5HRS A;  4CEE A;  3QEI A;  1ZBH A;  4ISG A;  4G1Q A;  3T1A A;  4DQP A;  3UKU A;  2HHS A;  4ZTF A;  3VES A;  2BH1 A;  3VF4 A;  3NF9 A;  3E9L A;  4JI1 K;  1QVG M;  1C1A A;  3VQB A;  4BR9 A;  4H8K A;  4CFD A;  1ATS A;  1GOB A;  3OYJ A;  4N47 A;  4DLG A;  3OYC A;  3CCU N;  4BRQ A;  4KAZ A;  1NK8 A;  4YDU A;  2A3Z A;  4FWL A;  1RTI A;  3DOL A;  1Y97 A;  3ATU A;  3F9M A;  4BG9 A;  1HPM A;  2VCP A;  3EKU A;  2ZJP L;  1FK9 A;  4FJJ A;  1RBV A;  3WNF A;  4J8F A;  2HND A;  4CW7 B;  5BPM A;  3OTO K;  4L8R B;  1JLE A;  3QML A;  5DMR A;  4E1J A;  4K8X A;  4K41 A;  4DSF A;  3O4Q A;  4YOX A;  2F9W A;  1LW0 A;  4KTW A;  3QIP A;  1U6Z A;  3O4N A;  4E7J A;  3VQQ A;  3PSI A;  4FCY A;  4BRF A;  4L3Q A;  5JMV A;  3F5T A;  1Q82 O;  2P9K B;  3WNE A;  3ZX0 A;  1YJ9 N;  3DJC A;  4FL9 A;  3VOV A;  1RIL A;  4H0P A;  3K59 A;  1CZ9 A;  4IO8 A;  1NGI A;  4DV2 K;  4MQ3 A;  3CCQ N;  2O4I A;  2O8F A;  4OPH A;  1BG3 A;  3HTV A;  3CMA N;  4HTL A;  1RT5 A;  4QS9 A;  3SPY A;  5CZ1 A;  4TSX A;  2P51 A;  4CJP A;  3WXL A;  1HKG A;  1U2V B;  4JI6 K;  4DU3 A;  3BZC A;  4DQI A;  4PQU A;  2HHU A;  2BAN A;  1BIS A;  1NGE A;  1N5Y A;  1E3M A;  2IVO A;  2HF4 A;  2NZT A;  5KQD A;  3DXM A;  5HRN A;  3ITH A;  3CFR A;  5AQF A;  1P90 A;  3ATV A;  5CYQ A;  1BCM A;  4IOA L;  3AVN A;  5AQR A;  3G0Z A;  4GKK K;  2IAJ A;  3KKS A;  2F7T A;  4HUG A;  1IO2 A;  4CJS A;  4M3Y A;  4B3M K;  3N4P A;  1XHX A;  3P1G A;  1MDU B;  1NJY A;  5EOY A;  3P39 A;  2PY5 A;  3O3F A;  3FFI A;  1BGX T;  1RTD A;  1HRH A;  2Z1G A;  1NKB A;  3TU5 A;  3F9K A;  4OJR A;  3FR0 A;  1KVA A;  2QKB A;  4IFV A;  4BRC A;  1VHX A;  2OZM A;  1VQM N;  3P5J A;  3HVT A;  3K5N A;  2BUP A;  4H5V A;  4KRF A;  3MK6 A;  4KHS A;  4F8R A;  4OPJ A;  3H3N O;  4JHD A;  5HP1 A;  4AHU A;  2P9N A;  4CZG A;  3LL3 A;  1DT9 A;  3DI6 A;  1KQS M;  5EU7 A;  4F9O A;  4DTO A;  5FRN A;  1DEJ A;  4H0O A;  3OA9 A;  4BR2 A;  3ZCM A;  3KJV A;  1SKR A;  4FZX C;  3NF6 A;  1RTH A;  3P83 D;  4CJL A;  1NGH A;  4NYN A;  1TV6 A;  4CGJ A;  2UXD K;  2GWK A;  2RF2 A;  4DV3 K;  3CM6 A;  4CJ5 A;  4OPA A;  1ZYQ A;  4FJG A;  5AZJ A;  3PIP L;  1G15 A;  4M3W A;  3FE1 A;  1J5E K;  1R0A A;  3U3G A;  3EY1 A;  3ZYY X;  3PO4 A;  2Q3S A;  4EP5 A;  4JI0 K;  2VGN A;  3CF5 L;  1HNX K;  4FLW A;  3WNG A;  3I0R A;  3SAF A;  2O8F B;  4BDZ A;  4DTN A;  1TAU A;  4FPB A;  3H6E A;  2G8F A;  2P9P A;  2NRZ A;  1QQM A;  3VA3 A;  3VGL A;  4DV6 K;  3A8Y A;  4PHT X;  5DM7 L;  3RSE B;  4Z4C A;  1HQE A;  3HM9 A;  2Q2R A;  3V9Z A;  1RTJ A;  2NRR A;  1IJJ A;  2IS3 A;  3C6A A;  3L4I A;  1NGJ A;  3V9X A;  1SL2 A;  5AQJ A;  2Q1N A;  3TWH A;  4FWS A;  3WXJ A;  3THW A;  4YNQ A;  1BIZ A;  3QO9 A;  2YV0 X;  2OA8 A;  4KBO A;  4FZZ A;  3S3N A;  3UB5 A;  4JEP A;  3R9P A;  4R5P A;  2O8C B;  2WBN A;  4M3U A;  4NLB A;  4AIL C;  3SI6 A;  3QB0 A;  2FBX A;  3THV A;  1CXU A;  3PX0 A;  3DLR A;  1HYV A;  2RKI A;  1NMD A;  2B6A A;  4K25 A;  2DFE A;  4DQS A;  4DFP A;  2ZQB A;  4CFC A;  4FW1 A;  3AVF A;  1VQ4 N;  1HKB A;  3RR8 A;  3LDP A;  3Q7C A;  3SUP A;  3H1Q A;  3LP1 A;  5AQH A;  2F96 A;  2G8V A;  4CF2 A;  1BA1 A;  1RDC A;  5KTQ A;  3LWM A;  4BGB A;  3MMV A;  1WUA A;  3KLE A;  5J2N A;  3SCX A;  2Q97 A;  2QWM A;  1BDG A;  3PX6 A;  4IBN A;  3RRH A;  2ETJ A;  1BQM A;  1T44 A;  4O8K A;  1QZ6 A;  4KTZ A;  1DTQ A;  2E20 A;  2VWB A;  2QXF A;  1VSM A;  4DFM A;  4CEA A;  1ZXO A;  4WQ5 A;  4DG1 A;  4M45 A;  3KWG A;  3I33 A;  4FWM A;  4AHC A;  3T1Y K;  1BWF O;  1S22 A;  1U49 A;  1RBS A;  4DR2 K;  3U3Y A;  1KVB A;  4ID1 A;  5JIC A;  3DRR A;  1ZBU A;  1JJ2 M;  2W6K A;  5E84 A;  4KV8 A;  2QWL A;  5K14 A;  1HUX A;  3I0S A;  1YIT N;  2WTU A;  3AAP A;  4NXN K;  1TKT A;  1RT6 A;  2Z1J A;  1VQO N;  3HK2 A;  3EKS A;  4HWI A;  4BC5 A;  4CK2 A;  5EX5 A;  4H0Y B;  1A5X A;  1NNE A;  4JI3 K;  3HL8 A;  2XY8 A;  1NBW A;  1BUP A;  3ZSW A;  3K57 A;  2BTF A;  3JAM O;  1K8K A;  1GLB G;  4CHY A;  2CGJ A;  3FFK B;  4E7K A;  3LDL A;  2ASO A;  4Z4G A;  3K9J A;  3NVM A;  2O8B A;  3H3O B;  4DR7 K;  4IFE A;  4FLT A;  2P1J A;  4OO1 J;  3VEO A;  2YX6 A;  1WBD A;  3ULE A;  4CEC A;  4IJA A;  3A5M C;  3VPZ A;  4DR4 K;  4DFK A;  3C95 A;  3DLG A;  2YKN A;  3ALY A;  1GLE G;  3DM2 A;  4IZ9 A;  3ZET A;  3U9D A;  2IIR A;  4DV4 K;  2CH6 A;  2P9L B;  3DLK A;  4O55 A;  3OYF A;  1NK0 A;  5BRE A;  1O1W A;  5HL7 L;  1KAX A;  2V7Z A;  3LPT A;  4DU1 A;  1SQK A;  2QWQ A;  1IV0 A;  3BY5 A;  1TKZ A;  1YAG A;  5C2F A;  2W42 A;  2QWO A;  2G8I A;  4Z4F A;  4B9U A;  3JXU A;  2D0P A;  1TGO A;  5CYM A;  4K8Z A;  4E19 A;  1QVF M;  4BQZ A;  5ELZ A;  2Q0R A;  3EEQ A;  3LAL A;  4FJI A;  3O9R A;  3AA4 A;  4RW9 A;  5KPR A;  4M3T A;  4FWK A;  2QWN A;  2YNI A;  2FC0 A;  1ZBF A;  2P5G A;  4B9L A;  1OVQ A;  4WFA L;  4JI8 K;  1FKP A;  2NRX A;  3KK7 A;  3QNO A;  4OLB A;  3E9P A;  4XH1 A;  3MEG A;  3LAN A;  4YOV A;  2KKZ A;  4JI7 K;  4CZL A;  1S72 N;  1VSE A;  1RT3 A;  3OBW A;  1NWK A;  3ZSO A;  4Z4H A;  3CCV N;  2V51 B;  3G25 A;  3IRX A;  4PWD A;  3ZSZ A;  3KWI A;  3V1O A;  4DSE A;  4JK8 A;  4OKJ A;  4BRP A;  2ZF5 O;  1IBM K;  1S1V A;  3VTH A;  4ILJ A;  5SZT A;  3RVC A;  3IG1 A;  4EFH A;  2HB5 A;  1K9M O;  3AA3 A;  4E7L A;  3ASM A;  4O0I A;  4I9L A;  2HHQ A;  1YF5 L;  3NF8 A;  3CYM A;  1GLL O;  2NRT A;  4OVL A;  5I3U A;  3CJB A;  1GLF O;  5KPZ A;  4CBU A;  2IVP A;  4E1N A;  1QSS A;  4DV5 K;  3TR8 A;  4CFB A;  2D0O A;  4E7H A;  3R6M A;  4JKB A;  1ZC6 A;  4KH6 A;  2YCH A;  3F2K A;  4RTF D;  3RR7 A;  1YJW N;  3LP3 A;  1U2V A;  1L3V A;  3L2R A;  2E1Y A;  2NUB A;  3SQ4 A;  1JXB A;  4CZM A;  3TTC A;  1U04 A;  3V4I A;  2P5O A;  3ZEU A;  3PSF A;  5AQX A;  4A2B A;  3T69 A;  5AQP A;  3TAF A;  3JYT A;  1YJN N;  3WEE B;  4KTQ A;  4FK2 A;  2X6N A;  4M3R A;  4JKG A;  4B3O A;  3HO1 A;  2W41 A;  1HMV A;  2ATQ A;  3BP8 A;  2OCE A;  3HSC A;  2HBJ A;  4K43 A;  3C6U A;  4DHY A;  3FZL A;  5KI6 A;  3VGK A;  4KHU A;  3ZSV A;  4E7I A;  3LDQ A;  3NCI A;  2AA4 A;  4PKG A;  2G8K A;  2GEM A;  4JNE A;  4NYF A;  4CJU A;  1IKW A;  3THY B;  1J6Z A;  4I9Q A;  4CEB A;  1U45 A;  5JS2 A;  2P9U A;  4JD2 B;  4XH4 A;  2YHA A;  2WOM A;  4NB4 A;  5BRF A;  3OYM A;  3O9Q A;  3MN5 A;  1BQN A;  4JKF A;  1C0T A;  5GAE P;  4NCG A;  1JL1 A;  2FXU A;  4BVP A;  2KHO A;  2UXB K;  5FDL A;  4A62 A;  4CGD A;  2UUC K;  2UUB K;  4DS4 A;  1MWM A;  2HNY A;  5AZI A;  4Y0W A;  3THW B;  3MEE A;  2QA4 N;  1D9F A;  2DY4 A;  4U67 L;  2HMP A;  3L2U A;  1VQ5 N;  1Q8I A;  2V52 B;  4WQ5 C;  1IKV A;  3SV3 A;  2WFB A;  4DQQ A;  2FF3 B;  4FVM A;  3VGM A;  3QBX A;  3M8R A;  4ZTJ A;  4AHV A;  1C0M A;  1ZBI A;  1NJI O;  3E9O A;  3SQ0 A;  3KK1 A;  3G71 N;  4PY5 A;  1TAQ A;  4GVM A;  1TVR A;  4GW6 A;  1VK0 A;  4FPA A;  3J8A A;  3CJ7 A;  1SV5 A;  3C94 A;  4JAX A;  4XH5 A;  3OS2 A;  4EZ9 A;  3OVN A;  5KQ8 A;  4EZ6 A;  3U9Z A;  1U47 A;  3AGK A;  3W3D A;  2HHH K;  1UAX A;  3MN7 A;  1Q18 A;  3ULE B;  1I94 K;  1I39 A;  4A2A A;  3NE6 A;  3CC7 N;  1Z05 A;  1CZA N;  4MDA A;  3VET A;  2Y1J A;  2GTD A;  1J54 A;  3U8X A;  3QFU A;  3VQ7 A;  2NRH A;  5C24 A;  4BE2 A;  4CFA A;  2P9L A;  4JV5 K;  3CJ9 A;  3VMF B;  3MN6 A;  5TKY A;  4M42 A;  2KLA A;  4CI6 A;  3QEW A;  1KC8 O;  4GV6 A;  2QW9 A;  2ZJQ L;  2D0A A;  2CH5 A;  1VRU A;  4JK7 A;  3IS9 A;  4DU4 A;  5MLC Q;  3V9S A;  4DCH A;  5LL6 Z;  5KGX A;  2HHX A;  4C1N I;  1NU0 A;  2I7P A;  1N36 K;  1GLJ O;  3O8M A;  2HBM A;  4CES A;  1Q9Y A;  4BRO A;  2J4R A;  5C10 A;  2XRI A;  3E1Y A;  5M1O A;  3OYK A;  1S5J A;  5J2Q A;  4ISF A;  4H0X B;  3C0B A;  4OGC A;  4EHU A;  3SQ2 A;  3IAY A;  3H45 C;  3I56 N;  3CD6 N;  1XHZ A;  5M1K A;  3PY8 A;  3HXM A;  3QES A;  3GE1 A;  3OYI A;  3J7A P;  3FZH A;  4GY2 B;  4GVE A;  5IT9 O;  3OS0 A;  1KCF A;  4M7X A;  3VQ5 A;  4LSL A;  4DTM A;  1T05 A;  5J1E A;  1UWB A;  2HHT A;  2G8U A;  4FK4 A;  1YXQ A;  4PL7 A;  4O5F A;  4CZF A;  3O9U A;  4RW7 A;  4JRP A;  3CCE N;  4KHY A;  4WYB A;  3V81 A;  3VER A;  3KVG A;  3H46 O;  3MXI A;  4KRE A;  5GIO A;  4Z4E A;  2W40 A;  1GOA A;  5SWM A;  1C0U A;  4FXD A;  3UKR A;  4W5R A;  3O3H A;  5LJV A;  4IOX A;  4MFB A;  3SNN A;  5M1P A;  4DQR A;  1JCG A;  3BEX A;  1M1K O;  1ASU A;  1NGB A;  2PAV A;  3V1R A;  3VEW A;  3S41 A;  3NFA A;  3QEX A;  5HRR A;  3AVL A;  5I9E B;  1HYS A;  3OHR A;  4CER A;  3A5L C;  4QS7 A;  3IKM A;  3LPU A;  2WC9 A;  4LF5 K;  1ATN A;  3MEC A;  1YI2 N;  3TI0 A;  4CJR A;  4RW8 A;  1S1T A;  5HRP A;  2Q0U A;  3TTF A;  4B1X B;  5E41 A;  1S1W A;  1VSH A;  4KH4 A;  1D4X A;  3VEY A;  1Q7Y O;  3LM2 A;  4MO5 A;  3AVA A;  4FOE A;  2KZZ A;  4DMN A;  3J7Y P;  1JLB A;  3KK3 A;  3L2V A;  4DUY K;  4J2B A;  3VTI A;  1HNV A;  5JLH A;  4WFN L;  1U4B A;  4PKH A;  4IG3 A;  3HVR A;  1NGC A;  3CPW M;  3O1W A;  1HPZ A;  2E6M A;  4CEZ A;  4BRE A;  5HRO A;  3UKU B;  5BR8 K;  3EE9 A;  4W5T A;  4CD3 A;  1VQ8 N;  5HOO A;  2YJE A;  3UE5 A;  3QFP A;  3ZT2 A;  3BF1 A;  3M8S A;  4BWM A;  4OGE A;  1KFS A;  3TAM A;  3TAN A;  2P9S A;  5KRT A;  4KHQ A;  3D2E A;  1KAY A;  3CCL N;  1DGK N;  3M1F A;  4C23 A;  4QS8 A;  2OYQ A;  1KRP A;  5BRD A;  2W6L A;  4CZE A;  3NAE A;  1N34 K;  4O4G A;  3HP9 A;  3NGZ A;  1MU2 A;  1WSJ A;  3HST B;  3I55 N;  4M41 A;  1I3A A;  4EAH D;  4ID5 A;  1NK7 A;  1T03 A;  1WNS A;  4B1U B;  4FWN A;  3AV9 A;  3DRS A;  3SAG A;  3NH0 A;  4FLV A;  3RTV A;  1TK8 A;  3SMS A;  1DTT A;  4K42 A;  4HUE A;  1JCE A;  4BRH A;  3VQ6 A;  1WB9 A;  4HVJ A;  4DV1 K;  1ZBS A;  4LF7 K;  3AAR A;  4IG0 A;  3THY A;  1RBT A;  5BN9 A;  4YOU A;  4J2A A;  4HCC A;  4BRA A;  4Y1C A;  3UIQ A;  5AQV A;  4W5O A;  4CZH A;  4JKA A;  3SBG A;  4HTU A;  3FZF A;  1IH7 A;  4CGH A;  2Z1H A;  1RT2 A;  4JKE A;  4C1N K;  3HOS A;  4LY7 A;  3DLB A;  2VG7 A;  3CM5 A;  2O8D B;  3MXM A;  1QQC A;  3OJU A;  2QKK A;  1TUY A;  1Q81 O;  3WT0 A;  4CJV A;  3EO3 A;  3O08 A;  1UOC A;  4YOY A;  4X66 K;  3PIO L;  4DR3 K;  4CJ4 A;  1EP4 A;  3I8D A;  3AO4 A;  3C7N B;  3TAR A;  1NJZ A;  4KH5 A;  1QSY A;  1TKX A;  4FW2 A;  1BIU A;  3HJF A;  4B1Y B;  4CK3 A;  1J9A A;  1GLA G;  3G6E N;  4MDB A;  1IKX A;  4GKJ K;  4KHP K;  4WQ4 C;  4DWI A;  1SZ2 A;  2O8D A;  1GLC G;  3UKR B;  3ZSY A;  1ESV A;  3LWL A;  2F8S A;  3O9S A;  3SUO A;  1SS6 A;  1L3U A;  4UY8 O;  2DTU A;  2KW4 A;  5C15 A;  5CHI A;  4RWT A;  3KK2 A;  1JLA A;  4BRM A;  4E3S A;  4AM7 A;  3O3G A;  2B4J A;  3M5R A;  5LMN K;  5AFU H;  5KPT A;  4DTJ A;  3DYA A;  2I7N A;  1RDD A;  5FPE A;  1WLJ A;  3V9U A;  1X9M A;  3VQP A;  4CZK A;  2VWK A;  4FJX A;  1D9D A;  1LV5 A;  1UA0 A;  4F3T A;  3NGI A;  3W0L A;  3PO5 A;  5DK5 A;  4K0K K;  3O80 A;  3R3L A;  3AVC A;  4V19 S;  3LZI A;  3ZSX A;  4LH5 A;  3VEN A;  2DFF A;  4N5S A;  4QOZ B;  2DFH A;  1X3N A;  3L3U A;  4KO0 A;  4F3O A;  1SL1 A;  4B1W B;  4BAC A;  5F0X A;  4MLE A;  4O8U A;  4DR1 K;  1B9D A;  1YT3 A;  5GAD P;  4H0V B;  3PUF A;  3LZJ A;  3L3V A;  3TPQ A;  4BRI A;  5AQW A;  3AVM A;  4FZY A;  2P9I B;  1HJO A;  1VSJ A;  3R8E A;  2YNH A;  3FGU A;  4ELV A;  3NBP A;  3D6R A;  1VRT A;  1RCH A;  1E4G T;  4BRK A;  3M8P A;  3SPZ A;  4BR5 A;  4KKO A;  3MCP A;  2D4W A;  3LAK A;  5FLX O;  3VEZ A;  1KVC A;  3D2E B;  2KZM A;  2NRW A;  3K5L A;  4DV7 K;  1HNW K;  3LAM A;  1ITG A;  4DF4 A;  2JLE A;  4PUO A;  2G8H A;  4DTR A;  3HBT A;  4WFB L;  4H5N A;  3SZ2 A;  4BR0 A;  3RMB A;  4NCB A;  5ADX A;  2G8W A;  3OY9 A;  4HUF A;  2YHW A;  1VSI A;  2E88 A;  4CIF A;  3M8Q A;  1NGF A;  4CZI A;  3PV8 A;  2VG5 A;  1J53 A;  3F73 A;  3CER A;  4E1M A;  4BDP A;  4CHZ A;  4FLX A;  4FWP A;  5BPN A;  1CLQ A;  2JGU A;  3J7Z O;  3AA5 X;  1JLF A;  3IFR A;  4CK1 A;  4E0D A;  1JLQ A;  2FBY A;  1VQ7 N;  4F2S A;  3IMX A;  3QIN A;  3T1H K;  4DSI A;  2GWJ A;  3KIO A;  4BRG A;  2HHV A;  3O5B A;  3L0Q A;  2HHW A;  4FLU A;  5FPD A;  2A41 A;  3G4S N;  3RMC A;  2Y1I A;  3AVK A;  4EHT A;  5GAG P;  3CQ8 A;  1NGD A;  1RDW X;  3GG4 A;  2GV9 A;  3T7Z A;  4B1Z A;  3TTD A;  1YUW A;  4G9Z A;  5AZI B;  3VQE A;  1C0G A;  1RT4 A;  4LF6 K;  3CJA A;  1VQP N;  1NJX A;  3QEV A;  1JLG A;  4CJT A;  4IDK A;  5J2M A;  4N41 A;  1IG8 A;  3CCM N;  3KD1 E;  1RDB A;  3VEV A;  1HR0 K;  3M6G A;  3DOK A;  2RHK A;  1NK6 A;  1KXP A;  4BG8 A;  3P38 A;  2FBV A;  2P9U B;  4GNI A;  1LAW A;  2QXL A;  4FVU A;  5AQK A;  4LF9 K;  1CXQ A;  3HM8 A;  1X3M A;  1YTA A;  3IDH A;  3K58 A;  4B9Q A;  4FJM A;  1Y64 A;  4YHH K;  3HOT A;  3TAE A;  3S9H A;  3PX4 A;  3ZT3 A;  3OJS A;  2YKM A;  3OYE A;  1A5V A;  2AP1 A;  2YHX A;  1QTM A;  1KTQ A;  5AQT A;  1RNH A;  3L2Q A;  4YOW A;  3HT3 A;  3NGY A;  4B08 A;  4ILH A;  3CC4 N;  3AVH A;  4DSJ A;  3VF2 A;  4W5N A;  3TSP A;  4FK0 A;  2XO7 A;  3K5M A;  4H5W A;  4HCB A;  3MWT A;  1OVY A;  1X1P A;  1HKC A;  4JI5 K;  3CJC A;  1BHL A;  4Z94 A;  2RE2 A;  4XIU A;  2HBL A;  1REV A;  2IGI A;  3DWL A;  4FM2 A;  1WBB A;  2E2N A;  2P9S B;  2EHG A;  3WQU A;  2OTL N;  4Z4I A;  1T6C A;  1VQ6 N;  3LP2 A;  1VQ9 N;  3O6W A;  2X6S A;  5FPN A;  1OH5 A;  1O13 A;  4B8A B;  4KB0 A;  1SKW A;  3KLH A;  4BE0 A;  3AVJ A;  3NMU A;  2E1Z A;  4PKI A;  4LFB K;  1T6D A;  3K0S A;  3ZET B;  4KPY A;  3QIC A;  5IWA K;  4CEO A;  2FSJ A;  1KD1 O;  3J80 O;  2HNZ A;  3D2F A;  2YJF A;  3P31 A; 
#chains in the Genus database with same CATH homology
 1IBL K;  4JI1 K;  2VQE K;  4LF7 K;  4DV1 K;  4LFC K;  2HHH K;  4CVN E;  4DV4 K;  2F4V K;  4DR1 K;  4JYA K;  1I94 K;  4JI2 K;  4LF9 K;  4LF5 K;  2UXC K;  1HNZ K;  4B3S K;  2UUA K;  4YHH K;  2ZM6 K;  1XMO K;  1N32 K;  4AQY K;  4JI4 K;  4JV5 K;  4CW7 B;  3OTO K;  1IBK K;  4DR6 K;  4X64 K;  5AJ3 K;  5FLX O;  4X66 K;  4DR3 K;  4DV7 K;  1HNW K;  1XNQ K;  2UXD K;  4DV3 K;  3T1Y K;  4LF4 K;  3J7Y P;  1XNR K;  4JI8 K;  5LL6 Z;  4DUY K;  1N33 K;  4DR2 K;  4LF8 K;  4JI7 K;  4DV2 K;  1J5E K;  2UU9 K;  4JI5 K;  4X65 K;  1N36 K;  4GKJ K;  4KHP K;  4JI0 K;  4OX9 K;  4X62 K;  1HNX K;  4NXN K;  3T1H K;  5BR8 K;  2UXB K;  4JI6 K;  4YY3 K;  2UUC K;  2UUB K;  3J81 O;  4JI3 K;  4LFA K;  5LMU K;  4DUZ K;  4DV6 K;  1IBM K;  3J7A P;  5IT9 O;  5LMN K;  2E5L K;  3JAM O;  4DR4 K;  4DV0 K;  4NXM K;  4DR5 K;  4B3T K;  4B3R K;  4GKK K;  1N34 K;  4DR7 K;  4LF6 K;  4LFB K;  1XMQ K;  5IWA K;  4B3M K;  4K0K K;  2VQF K;  3J80 O;  4DV5 K;  1FJG K;  4V19 S;  5A2Q O;  1HR0 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...