1HNWK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnwK00
3JAMO 5IWAK 5LMUK 3OTOK 4X64K 1J5EK 4LF8K 2UU9K 4OX9K 4LF5K 4DR4K 3J7AP 5BR8K 4LFAK 4JV5K 4LF4K 4DV6K 4CVNE 4DV1K 4NXNK 4JYAK 4JI4K 4JI1K 4DR5K 3J7YP 3J81O 4DR6K 4AQYK 4JI3K 4GKJK 4V19S 4LFBK 3J80O 4X66K 4LF7K 5LL6Z 4LF9K 4DV7K 4B3TK 4DR1K 2VQEK 4LFCK 4B3SK 4DV4K 5LMNK 2F4VK 4JI5K 5A2QO 4DR3K 4JI7K 1IBLK 2HHHK 4CW7B 4DUZK 1FJGK 1N32K 4B3MK 4YHHK 4DV2K 1HNWK 5IT9O 4JI0K 1N33K 1I94K 2UUBK 2UXBK 1N34K 3T1YK 4DV3K 2ZM6K 1HNZK 4B3RK 5AJ3K 4DV5K 2E5LK 1HR0K 4DR2K 4K0KK 4JI8K 4X62K 1IBMK 2UUCK 2VQFK 2UUAK 4DR7K 4NXMK 1XMQK 1HNXK 4DV0K 4JI6K 1IBKK 1N36K 4LF6K 4JI2K 3T1HK 4KHPK 2UXCK 4X65K 1XMOK 5FLXO 1XNQK 4GKKK 4YY3K 4DUYK 2UXDK 1XNRK
chains in the Genus database with same CATH superfamily
4FJLA 5IWAK 3L2QA 3ZLJA 4K8XA 3TWHA 1QQNA 2UU9K 4AHVA 4AM7A 4CBXA 4KH5A 2A6AA 1LCUA 3DXKA 2LSNA 3EO3A 3FE1A 4IFEA 3VF6A 4DTMA 3VGLA 5GADP 3CQXA 5BN8A 4FWKA 4DV1K 2HF4A 5AQMA 4C1NK 4W5NA 4DR5K 1D8YA 4FJHA 3VQBA 2D0BA 2HB5A 4CEZA 4DU3A 4Z4GA 2WTUA 4DTOA 2GEMA 1Z26A 4CF9A 2HMPA 2VWKA 3ZSQA 3SYZA 2QWRA 3LWLA 4GVMA 1NOYA 5AR0A 4BRAA 1LW0A 3K5OA 4DTXA 4B3SK 4CJVA 4FK4A 4DTJA 3CJ9A 3O9UA 4B1UB 5KQDA 3I8DA 4BY9C 1JLEA 1N32K 5AQXA 4AM6A 1TVRA 3V81A 1BQMA 3PY8A 4OLAA 4H0VB 1HRHA 1KVCA 2OPRA 5BPMA 3ATUA 1NK9A 2ATQA 3M8QA 2EHGA 3ULEA 4LY7A 2KHOA 1TV6A 4KTQA 1S5JA 5GINA 1L3VA 5C24A 3ZSXA 3OYNA 1GOAA 3QLHA 4B9VA 2B6AA 4OLBA 1QVFM 4U7BA 1C1BA 4BR7A 2OPPA 3MCAB 2YKNA 4CZJA 4ZTJA 1HPMA 4CBWA 2QWNA 4BDZA 1ZYQA 1OH6A 1KTQA 4N41A 1XI1A 4BR9A 1WBBA 3AO3A 4M3YA 2J4RA 4KHQA 3AGRA 4CZLA 3SV3A 3C94A 1Q82O 1HX1A 5JVHL 3U4LA 4OKJA 3K5NA 3VA3A 4JRQA 1RT3A 2A1SA 2CGKA 4DUYK 1S1XA 4IBNA 4CGGA 3HOTA 4DFJA 3DLKA 1KAZA 3L2UA 4CERA 4DQ8A 4OX9K 4YORA 3VERA 2I7NA 4LFAK 4FL9A 3LWMA 2V7ZA 4KH4A 4EFHA 4E89A 4HUEA 3ID6A 5TKYA 2ZWHA 2ZGYA 1NK4A 2P9PA 4GNIA 1B9FA 1B92A 4H4MA 1BG3A 2NRHA 4O8KA 1QHAA 5KTQA 3G25A 2P9IB 4AILC 4FJJA 4FJ8A 4X66K 3HOSA 3C7NB 3FZLA 4HTUA 4DTPA 4H5NA 4FWRA 1T3VA 4H5RA 4CJFA 4DLGA 3F9KA 3ZT2A 2VGNA 5A2QO 2Z1GA 1HKBA 3DLGA 4FM0A 3SMSA 4BGBA 2BE2A 2YKMA 2EX3A 1L3SA 3ISNC 1EETA 4CECA 1KLNA 1ZBFA 4FLTA 1JCGA 1J6ZA 3U3YA 3ZSZA 1Y64A 2A42A 1NKEA 2F9TA 2YCHA 4HHTA 1FXXA 5J1EA 3M1FA 3DRRA 5JS2A 4PKHA 4KB0A 5I42A 3D2EB 1CZBA 4BR4A 4OKEA 2GELA 2P9NB 3ULDA 1NM1A 4ELTA 3ZSOA 3MXIA 3KD5E 1NGDA 3JSMA 1S72N 3RSEA 3FZKA 3CPWM 1EQYA 1YXQA 1VHXA 1NK5A 2Q36A 3SMPA 3VESA 3G4SN 4PL7A 5FDLA 1YVUA 3QNNA 3DOKA 4CF2A 4BACA 3OYMA 4JI2K 1FKOA 3DI6A 3V9UA 2E6LA 2VYPA 5AQSA 3NGZA 1JLCA 1RT5A 1WLJA 4YFUA 2O4GA 3D2FA 4CFDA 2XY7A 1NGIA 1P8ZA 1XNRK 4XH1A 4FJNA 5C42A 2HBJA 2RF2A 2WFBA 3D7EO 4CF0A 1Z6RA 4FZXC 1JLQA 4FK2A 3A2FA 3TANA 3CD6N 3HO1A 4JKGA 4LF4K 4B9QA 2W42A 3OJUA 4CVNE 2VWJA 2Y1JA 5M1NA 4Z4EA 4E7JA 3RVCA 2NLXA 1JLAA 3O9RA 4AQYK 4H0OA 1ESVA 3NDKA 3ENHA 1TK0A 4WQ4C 1K8KB 4JKHA 4BC4A 1S9GA 3J80O 4N5SA 3T3FA 1U45A 4LSLA 1HKCA 2GBZA 4KO0A 4EHTA 3KKRA 3RMDA 3OYFA 3GG4A 2ETJA 1TKXA 3CIPA 3PO4A 1QHTA 3EKSA 3NFAA 5AQHA 4O44A 3KWIA 1TGOA 2HF3A 1E4FT 3ZCMA 4UY8O 3A0IX 1HNIA 4RG8A 1N5YA 4F4KA 3CG7A 2HVHA 2BUPA 4B9SA 4O55A 3LZJA 4CZKA 2QWLA 4WYBA 4FJIA 4CEDA 3OYIA 3B8AX 3LP2A 2UXBK 1IG9A 4FO0A 3CHWA 4N56A 2IIRA 3CC4N 5SZTA 1HNZK 4Z4IA 5I9EB 1KVAA 4Z4CA 4IXCA 4JLHA 5M1OA 2F96A 4DR2K 1E3MA 5CHIA 4M3TA 4GY2B 4GMJB 4CZEA 2NZTA 4CFCA 3O1BA 4FPBA 1WNSA 1VRTA 4FWLA 3EY1A 3VQCA 4CJ7A 3BF1A 3AVKA 3KLEA 3HK2A 3OHRA 1KFSA 2XHBA 2O8BB 3UB5A 4KB1A 1HYVA 1WSEA 1KAXA 1RTIA 3TARA 2RN2A 4BRKA 3OS1A 4XIUA 3TAGA 3CC7N 2HOEA 4GKKK 1A5VA 1UWBA 3CF5L 4MO4A 3FZHA 4B9TA 3LAKA 3KLIA 4C23A 1YJNN 1T7PA 1ZBLA 3THYA 1RDWX 5EY4A 5CYQA 3AVCA 4NB4A 3H3NO 4LD0A 4CESA 4BR5A 3SAGA 4WQ5A 3CCVN 5AQKA 3NF7A 4IO8A 1NK0A 4NXNK 2H3GX 3OYBA 2HNZA 3MEGA 3KVGA 2FBYA 2O8FB 4QOZB 4E7HA 1BA0A 2V7YA 4EHUA 2FSNA 4KBOA 3HRGA 4N47A 1S1WA 1U04A 3ZETB 3ZX2A 3OBWA 3WEEB 2D0OA 5F1XA 4BQZA 2OYQA 2VWBA 5C2FA 1WSHA 4NCAA 1YI2N 4M7XA 5J2MA 3OVNA 1X9JA 1W97L 2O8DA 4KI4A 2YJEA 4B3MK 1BIZA 3DRSA 2E2OA 4B8AB 1KFDA 4WF9L 3HP6A 1I94K 4DV3K 1W2BM 3V9SA 1BU6O 3HBTA 4I6MA 4JHDA 5M1QA 5HRNA 2HNDA 2AA4A 1Q9YA 4TSXA 3M8RA 3B6OA 2UUCK 1QQOA 4HUGA 2Q31A 3UE5A 1RCHA 1WSFA 4DR7K 4CJUA 4RW7A 3AARA 1YVNA 3QEWA 4GV6A 5F0XA 1QVGM 4KRFA 2E1YA 1IKXA 3HL8A 1NGCA 3EKUA 4NYNA 1SL1A 5FPDA 2Q1NA 1ZC6A 1YT3A 1XC9A 5CR4A 2YHXA 3SJHA 4RTFD 1BWFO 3HT3A 3MX2A 1IKWA 3RMAA 4CE9A 4FJ7A 3L2VA 3DLEA 2YNFA 3I8BA 2QWPA 3J7ZO 1IG8A 4B3OA 3O5BA 2D1KA 3QMLA 4M41A 1VQ9N 3OBYA 3GDQA 3LDLA 4XEIA 1UAXA 2FBTA 4RW8A 5FROA 3D45A 4ILHA 3L3VA 1BI4A 2X6SA 4E7KA 1BUPA 5E41A 3LAMA 4JYAK 2WOMA 4AHCA 4GV3A 4Y1CA 5J2QA 4JS4A 4DR6K 5HL7L 4M63C 2A1RA 5JLHA 1QZ5A 4B1VA 5HRRA 1O1WA 1X3NA 4BRHA 4M3WA 3LALA 3CYMA 1WB9A 4JEPA 3ZSVA 2CH5A 4FM2A 3RTVA 4JI5K 5M1KA 1K73O 3VQ7A 1T6CA 1GLDG 3P5JA 3O8MA 3K58A 2PZSA 3DRPA 3C6TA 4K42A 2YHBA 3NF8A 1S1VA 3TTFA 3E9LA 3T1YK 3FZFA 2ZQBA 2RHKA 5AQRA 3Q7CA 2ZM6K 2O8EB 3THXB 3SV4A 4CJEA 3KLFA 1M1KO 3WT0A 3E01A 4LC9B 1GLEG 3KWGA 3THWB 3PUFA 1WSIA 3ZT3A 5FPEA 4HVJA 1BL3A 2QKKA 4FWNA 3F9MA 1SKRA 3IMXA 1Z05A 3DOLA 3M3ZA 2XY8A 3AO1A 4JI6K 4NCBA 2DFHA 4DQPA 3NMUA 3H1VX 3O1WA 5C2DA 1A5XA 4IG0A 3C95A 1TKDA 4PWDA 5GAEP 3DLRA 3SI6A 3QFPA 4WQ5C 4L3QA 3V1RA 4DS5A 3AVFA 1RDAA 4QAGA 1Q18A 1NBWA 2DTUA 3CQ8A 4LH4A 2F7TA 4DR4K 4CJPA 5BR9A 2GV9A 1JLGA 3VGKA 4OPKA 3JYTA 4BG9A 4CJLA 1WSJA 3NF9A 1WAFA 1GOBA 4JI4K 4HCBA 4ILGB 4CZMA 1JCEA 3BZCA 3VENA 1RILA 1K6YA 5JLFA 5T7BA 3VQPA 3HVTA 4KTZA 4H03B 3S3OA 3SPYA 5GIOA 4BC2A 3TSUA 2P9SA 3KK7A 3TTDA 5AFUA 5BPLA 2P5GA 1NJIO 4HCCA 1BISA 2P5OA 3O3HA 3DYAA 3BP8A 1KXPA 4O4GA 1FJGK 2GUPA 4YHHK 1HJOA 2P9IA 3CJ1A 3SPZA 3BZKA 4DWIA 1U2VA 5FPMA 4A2BA 3ZT1A 4BRPA 2UUBK 1XHZA 4IOCL 1EXQA 4B9NA 4G1QA 3LM9A 3MAQA 2W6LA 1Z25A 4I2PA 3I56N 1RBTA 3DM2A 4JD2A 5AJ3K 3EZ5A 3O4NA 3L8BA 3CJ7A 3R1XA 2WC9A 1RBUA 5LJVA 2KTQA 1JL1A 4BWMA 1RT7A 2F9WA 3M8PA 3TAMA 4BRNA 3AVGA 3EE9A 1NGGA 1TUUA 4FLUA 2E6MA 2E88A 4OO1J 4G9ZA 3GBTA 4JK9A 3CXCM 2GWJA 3CFPA 3KJVA 4FK0A 5BRFA 4C1NI 3NCIA 2UXDK 1JKHA 3JAMO 4F2RA 2O4IA 4CJ5A 3LP0A 4CD1A 4M3XA 5AQUA 3ITHA 1Q7YO 4BR2A 4ZTFA 4DFKA 3CCRN 1GLAG 3CM6A 3QDKA 1X9MA 2HHSA 2P9UA 2X78A 4HUFA 4Y0WA 2NRZA 2E2QA 3VOVA 3AA3A 1MWKA 3J7YP 3OYDA 3IAYA 1LV5A 3NVKA 2NRXA 3S9HA 3LDQA 1EKEA 2P9KA 2PFUA 3LDPA 4JK7A 3U9DA 3OYLA 5D3GA 2A5XA 3O08A 1BDGA 2UYTA 3TSPA 4FLXA 1Q86O 1RBSA 2F4VK 4RW4A 5I3UA 1BOTO 2ASPA 4DR3K 4H4OA 4E19A 3U6FA 3P4IA 2KFZA 4I9LA 4KHUA 5HROA 3HM8A 3UKRB 3RR7A 4R5PA 3ZEUB 2V51B 5IT9O 4OPJA 2YI1A 3KK3A 1KD1O 1W9HA 4EAHD 4CZGA 3DXKB 4Q5VA 2DY4A 2RKIA 4Z4FA 5AZIA 3THVA 3AVLA 1IBMK 1XWLA 5C12A 2IGIA 1CLQA 2FSJA 1I39A 1TUYA 4IJNA 3SBTA 5FPNA 1TK8A 1BCOA 2P1JA 3TAPA 1BA1A 1XHXA 3PX4A 3F73A 3TR8A 1N36K 1TYQB 2NUBA 1HKGA 1NKBA 4KHPK 1J54A 1TL3A 3QNOA 4DCHA 2W6KA 4ISGA 5FLXO 3LM2A 1QSLA 2XRIA 3PX6A 3MN7A 3VEYA 1T05A 1TKTA 3RWUA 1EX4A 1YF5L 4B1ZA 4FJ5A 2ITGA 5KPRA 4B8CA 3ULEB 2ZJPL 1QQCA 3J7AP 1C0MA 3ATVA 3WNGA 1CXQA 3O4QA 1TK5A 4N76A 4CHOA 2ZE2A 3OJSA 4PA1A 4FM1A 1Q81O 1NG9A 3CFOA 4DS4A 3I0SA 4YDUA 4JI3K 4V19S 3ZSRA 1F21A 1HQUA 4OPAA 5AQIA 4WFNL 1O13A 1B9DA 3RRHA 3EYZA 3UIQA 1E4GT 4CF1A 1DKGD 3CETA 3QEVA 2GTDA 3CPEA 3C6HA 4ISEA 4A61A 3PV8A 5KQ8A 4YOYA 1IBLK 4DQQA 4CJSA 2NNWA 2QKBA 3UKUA 3VQDA 4CW7B 2RE2A 3VEZA 3ZT4A 4DUZK 2PBDA 1REVA 3EZWA 3VQ5A 5C0YA 2DPNA 3P1GA 2O8FA 5KGXA 1ASVA 1CZAN 2GX9A 1DTQA 3HYFA 4ID1A 4RW9A 3H46O 4BE0A 2HSTA 3DLLL 3RMCA 3O9SA 3HPHA 4IJAA 1WUAA 4H5TA 4PKIA 4B1WB 3WEEA 1YAGA 3IFRA 1X9SA 3WNHA 4WE1A 4CGHA 4DTSA 4B3RK 1D4XA 5AQWA 4KHWA 2P9PB 4H0TB 4X62K 3VQ8A 3SBGA 3MWPA 1ILYA 4E1MA 2UUAK 1SS6A 3CCMN 4EZ6A 3OYCA 1RBRA 1NK7A 3ZSWA 5H1SQ 2HMIA 4A5AA 3QESA 1Y97A 2A41A 4E1JA 5BRDA 2OA8A 4DV0K 4M3UA 5E84A 4YOVA 5CE3A 3LL3A 4H0YB 3VTIA 4CJQA 5GAGP 3AVHA 3M5RA 1U49A 1T44A 4FW1A 4JNEA 2NRWA 2BTFA 4KFBA 3AA4A 3HSTB 4BVPA 3LANA 3OYGA 1G15A 4FVMA 5JS1A 2ZF5O 3E66A 4AF1A 5HLFA 2FBVA 2WONA 3AGKA 4A5BA 2Y1IA 1SL2A 1J5EK 4F8RA 1S9EA 1VSIA 3A5LC 3OW2M 2HHXA 1L3TA 3CFRA 1TAQA 1QZ6A 1RNHA 4FOEA 1TKZA 5DMRA 2E8AA 2QK9A 3SQ2A 1JLBA 3OYJA 1NGAA 4CJ4A 3V9WA 1S1UA 3H1QA 3CCEN 1NGHA 3T69A 1JXEA 4JKEA 1NJWA 5JMVA 3R8EA 3K5MA 1VSKA 3ENBA 4LFCK 5BN9A 4B1XB 4DV4K 1OVQA 4AH9A 2IS3A 2Z1IA 1ZBSA 1IO2A 3HJFA 4JKCA 2P51A 4M3ZA 1LW2A 5BRHA 4BRCA 1C0UA 3D2FB 4MDBA 3C6AA 2VG7A 1IH7A 4FW2A 5ADXH 3R9PA 4J2DA 4H5WA 1VQLN 4BQLA 3KIOA 4IOAL 2QTDA 4JI8K 4WFAL 3M6GA 5CY4A 1DT9A 1D9DA 2XY6A 4FZZA 1ASWA 3ZX0A 3CC2N 3PSIA 4JAXA 3QETA 3HP9A 3I33A 2O8CA 1WOQA 4BROA 3THXA 3K9KA 4CHZA 4L8RB 3G71N 2QXFA 4GW6A 4BE2A 1LOTB 2FXUA 4EP4A 4QS7A 2EWSA 1OKJA 3WUHA 2DFFA 4C8KA 1VQPN 4PQUA 4I2QA 2QM1A 4JKFA 5J2PA 4H5VA 2CGJA 3U9ZA 3GE1A 5ELZA 1KVBA 2IC3A 1RT6A 4MO5A 4DTUA 3TTCA 1YJWN 4UQGA 5BREA 4Y1DA 1CZ9A 2QI2A 4CGIA 3CCQN 2KQ2A 2WUSA 5TKWA 5GIPA 4B9MA 2ZJQL 5AQYA 2PY5A 4YDUC 4F3OA 4BRDA 3EN9A 1T03A 4LF5K 4H0XB 4JV5K 1VQ6N 3RR8A 4HTLA 3AVMA 2HBKA 2P9LA 4AHUA 1UOCA 1U4BA 3OS2A 4KI6A 4JK8A 4MQ3A 1EWRA 2GWKA 2FF3B 3AAPA 2D0PA 4CHPA 3S41A 3K0SA 1VSHA 4ILJA 2KZZA 1S3XA 2VQEK 4PUOA 1SKWA 4B1YB 5LMNK 1EWQA 1VSDA 2IAJA 2KKZA 4IEIA 2R7YA 4CJRA 3PIOL 5HP1A 4CIGA 2OZMA 3O3GA 1QE1A 5KPTA 4DTNA 1GOCA 1T6DA 1C6VA 4IFYA 5AQGA 3VA0A 5FRMA 4QCLA 3NH1A 5AQFA 4FLWA 1M90O 3L6QA 1IV0A 4FWMA 1HNWK 1NNEA 3O80A 3G10A 1N33K 2HNYA 4CD3A 3H45C 4KTWA 3BGRA 2Z1HA 3VQAA 1NU0A 1C0GA 2JWKA 1W7AA 4R79A 1L5UA 1L3UA 3THYB 2QWOA 2G8KA 1OH5A 3LDOA 1NWKA 3DWLA 3MMVA 1ITGA 3L2RA 1NMNA 2HHUA 1HPZA 4FJ9A 1N8RO 3CJBA 3MN5A 2OZSA 3E1YA 3K5LA 4F9OA 5HRSA 3SZ2A 4CK3A 4FJGA 4PL8A 1YIJN 1VSJA 2HBMA 3MX5A 1IKVA 3K59A 3QEIA 4ELUA 3MXJA 3O6WA 1YTUA 2HHVA 1VSMA 4WCEL 1XQSC 1U48A 4CJWA 4DSLA 3SNNA 4F2SA 4NO7A 2O8DB 1WN7A 4EZ9A 4CGDA 2YNGA 5EVZA 3FGUA 4DG1A 2Q0RA 3ID8A 4W5QA 4KHSA 3MXMA 3AVAA 3HVRA 4B9LA 2Q2RA 1VSLA 4O0IA 2Q3SA 5EU7A 1J5OA 3P39A 4RW6A 3MEEA 4HWIA 3NAEA 3I55N 2JLEA 1RBVA 1ATRA 3C65A 3H6EA 1NGEA 4CBUA 4FCYA 1RTHA 5EOYA 5AQQA 5AQVA 5DK5A 3VQ9A 1VSEA 3SAHA 1SZ2A 3QB0A 3IDHA 1S6PA 3MCPA 2FC0A 1YHQN 3SAFA 1JJ2M 3AAQA 3F2KA 4FYDA 4DR1K 3E9OA 4EP5A 4RCHA 1I3AA 2W40A 3SK3A 3OYHA 4FWSA 3K57A 1NKCA 2HHHK 3HPGA 1C0FA 5FRNA 4A57A 4MFBA 4CFAA 3OYAA 1KSPA 4J2BA 5DM6L 4ICLA 3WNEA 3QINA 3QBXA 2X6NA 4FLVA 4JI0K 3NE6A 2HBLA 2YX6A 3PIPL 1Q9XA 4OKKA 4DFPA 4E0DA 2VGMA 3DLHA 1C0TA 4KHNA 3EE8A 2E5LK 1SAZA 1BI4B 4YNQA 4MLHA 3QIPA 4YOWA 3C6UA 2PAVA 1KCFA 1VK0A 5EX5A 1IKYA 1VRUA 3NF6A 4C8NA 3TU5A 3VF4A 3MEDA 2IVOA 5HOOA 1OVYA 1RTJA 1VQKN 3C7NA 4JS5A 3L4IA 3VETA 4JKBA 3IG1A 3KZBA 5M1FA 2RPIA 2AJQA 2YJFA 2X74A 1QS4A 4Z94A 4E3SA 1BIUA 4FJKA 3AO2A 4KV8A 5AZJB 2QWMA 4JKDA 5LY3A 4MDAA 2ZD1A 4YOTA 2G8IA 3CERA 3LP3A 4LH5A 4CFBA 1K8AO 3MN6A 3BDPA 3AV9A 2HHWA 3V1OA 3P83D 2D0AA 1U47A 2YHAA 1HMVA 5BR8K 1EO1A 1TYQA 4CI6A 3L2WA 1D5AA 3D2EA 4W5TA 4AHTA 3PLAA 3ENOA 2P9NA 4WQ4A 4F3TA 3KHYA 4E7IA 4IG3A 4ID5A 5DM7L 4GKJK 3DLBA 3TI0A 5AQLA 4ZHRA 3S3MA 3PSFA 1GLJO 2BH1A 4CEAA 4IOXA 1RDBA 3K2PA 1RT2A 4E7LA 3BUZB 2A40A 4CEFA 3V9ZA 4DU1A 1RDUA 4OPHA 1CXUA 3DMJA 4O0JA 4DMNA 4PKGA 3CM5A 3ZT0A 3VQ4A 3MN9A 3P38A 3MDQA 4ISFA 4OJRA 3QBWA 4CK1A 2BDPA 3CCUN 3WXMB 3VGMA 2HVIA 3V6DA 3CCLN 1N34K 4DKWA 4BG8A 3ASMA 4EIAA 1JLFA 4DSIA 4DV5K 3J8AA 3WXKA 4FWOA 2D4WA 2IVPA 1V4TA 3DXMB 5KPZA 3S3NA 1HYSA 4DF8A 1K8KA 3N4QA 4NXMK 5AQPA 5J2NA 4AHRA 1MA9B 1HNVA 3AA2A 3LP1A 4KHYA 4BR0A 3VQ6A 2P9SB 2JWLA 3FFKB 4M7YA 3T7ZA 2UXCK 1R0AA 1GLFO 2YHYA 3VN5A 4Z4HA 4Z0UA 4FOIA 2OANA 3QICA 1U2VB 2IOCA 1X3MA 4J2EA 3CI5A 3IS9A 3C0BA 2Z1JA 1VQMN 4FSVA 2NRVA 1SQKA 3IKMA 3A5MC 4CEQA 4JD2B 1NJZA 1BCMA 1NGFA 4CIEA 1ASUA 4FJMA 1HUXA 3CQYA 4JKAA 5KI6A 4FZYA 4CGJA 3NGYA 2QEXN 4BRLA 4DLEA 4KKOA 5LL6Z 2E4LA 3VQQA 1BO5O 4CEBA 3AVIA 4JRPA 4BRQA 3AO4A 5AQNA 3ZX3A 4DU4A 2O8BA 4CZFA 3AY9A 5HRPA 1SL0A 2YNHA 4DF4A 4DTRA 1VQON 4CIFA 1BQNA 5KRSA 2XY5A 1Q8IA 4ELVA 1ATSA 4BRIA 3CMAN 2OCEA 4BE1A 2HHQA 4J2AA 4AHSA 2HW3A 1S1TA 2Q0UA 3KTQA 1A5WA 1EP4A 1C1AA 1RT4A 1J9AA 4BDPA 4IEEA 2DFEA 4K43A 3H08A 1NLVA 1C1CA 2E2PA 3JXUA 4M45A 3RMBA 1JL2A 2P9UB 4M3RA 4DSKA 3SUPA 2D5RA 1LWFA 1S6QA 4FXDA 3O9TA 2VG5A 4B08A 1W0HA 2CH6A 1OH7A 2P9KB 3VEVA 1ZBUA 3SJJA 3ZETA 3VF2A 3D6RA 4IO9L 4NCGA 3VEXA 1BHLA 3T1HK 1KRPA 4X65K 1ZBIA 5M1PA 4BREA 3BF3A 1OH8A 4YOUA 4FLYA 3AVBA 2F8SA 1XNQK 4YY3K 1MWMA 4K8ZA 4H8KA 4OVLA 3CJCA 3LDSA 3HI0A 4GV9A 5JICA 4O8UA 4X64K 3A5NC 4LF8K 1GLCG 3TAEA 3SUNA 4BGAA 3WXJA 4BRMA 4XH4A 3T1AA 3FZMA 4DV6K 3NH0A 4I7FA 2VCPA 3SUOA 5AZIB 2E2NA 3V1QA 1UA1A 4BC5A 1QTMA 1KLMA 2BGGA 3FFIA 3J81O 3R3LA 3FR0A 1UA0A 1TL1A 1HYZA 1G99A 1LAWA 3O4WA 4LFBK 1RGIA 2JGUA 1DLOA 4CZHA 4C8MA 4LF7K 4E1NA 4CJKA 2I5JA 1K9MO 3F5TA 4LF9K 1RFQA 5KRTA 3HXMA 2D0CA 4BVOA 1R59O 3LPTA 4BC3A 4H0PA 2NRTA 1S22A 3L3UA 4JI7K 3QEXA 1KC8O 4BRGA 4CHYA 3OA9A 1DEJA 3VTHA 1GLLO 3NVMA 4DSJA 3G6EN 4K25A 1N6QA 1LWCA 3MWTA 5LJWA 3U8XA 3NH2A 3RSEB 2ASMA 1P90A 1DGKN 2OPQA 4Q0BA 2V52B 1NGBA 3SLCA 4DSEA 4IKFA 4CEEA 3WXLA 2QXLA 5CYMA 1HR0K 4DQSA 4BDYA 1YJ9N 2VQFK 4W5RA 3IUCA 2NRRA 4PY5A 2ASOA 3LDNA 4CK2A 1FKPA 5MLCQ 3PO5A 3P31A 1MDUB 4FWQA 4DFMA 2VG6A 1IJJA 1MU2A 5GAHP 1WAJA 1HLUA 3QEPA 3U3GA 3QFUA 3KD1E 3MK6A 1SV5A 1VSFA 1WSGA 1XUPO 2AP1A 4JKGB 4WFBL 3SQ4A 2ZGZA 2ITMA 1TAUA 5AQJA 2KW4A 4CF8A 3ALYA 3UKUB 4C8LA 3VMFB 4KPYA 2OTJN 4M42A 3L0QA 1T8EA 3HSCA 1X9WA 4FVUA 1QQMA 3OS0A 1VQNN 4K41A 3OTOK 1YUWA 2G8WA 2O8EA 4O5BA 2G8HA 4DQIA 5ADXA 3V4IA 3SQ1A 5EXWA 3VEWA 1VQ4N 3NHGA 1VQ8N 2XO7A 3SUQA 3AVJA 5BPNA 3MECA 1X1PA 1NK6A 3THWA 2A3ZA 2PYLA 4IFVA 4NYFA 4JI1K 5K14A 3O9QA 1NJYA 2QA4N 3TPQA 3M8SA 3GOIA 3SCXA 2YHWA 1KAYA 4CZIA 1H1VA 1XC3A 4FJXA 5SWMA 3H3OB 1NOZA 4FWPA 2ZJRL 5AQZA 3WNFA 4QS8A 2FLOA 4GVEA 4IDKA 2WBNA 5C25A 1KQSM 1JCFA 3W0LA 2G8FA 2G8VA 2W41A 1NMDA 2PYJA 3IRXA 5E26A 3A5OC 1VAZA 3BY5A 3TABA 3EEQA 3Q7BA 2YV0X 2KZMA 4IDHA 5AQOA 4FLZA 5HBMA 1SUQA 3G0ZA 1J53A 4BWJA 4DSFA 3LPUA 3KKSA 1RDDA 1FK9A 4KREA 2KFNA 1NK8A 3OYEA 1RTDA 3VQEA 3NBPA 5C10A 3AO5A 4QS9A 1LAVA 1ZXOA 1VQ5N 1XMQK 4IZ9A 1HNXK 1V4SA 2IDOA 2KLAA 4IWVA 4XH5A 3HM9A 4NLCA 1RT1A 1IBKK 3OY9A 3HTVA 2G8UA 3T19A 3TAQA 1DTTA 4OGEA 1FW6A 3OYKA 2B4JA 2QWQA 1U6ZA 4MLEA 4FPAA 3TSQA 3V9XA 1VQ7N 1ATNA 2YNIA 2FSKA 3LZIA 5LMUK 1JXBA 4KH6A 4DQRA 4RWTA 1D9FA 3NGIA 3PX0A 3SQ0A 2E1ZA 4CGFA 5AZJA 3KLGA 4OGCA 5JVGL 1WBDA 2GUIA 4LSNA 1NJXA 3AVNA 4BRFA 2OPSA 3FLCO 4I9QA 5CZ2A 4U67L 3CMEN 4W5OA 1SKSA 4DB3A 3WQTA 3I0RA 3W3DA 3WXIA 5CZ1A 2O8CB 3BEXA 2Q97A 2FF6A 4DV7K 4B3TK 4C8OA 3TAFA 2QW9A 5F2RA 1ZBHA 1YITN 4CCHA 4J8FA 1RDCA 3K9JA 2I7PA 3QO9A 4I6MB 4JHDB 4DHYA 3DAWA 4A2AA 1HQEA 3O3FA 2B5JA 3KLHA 2HHTA 5AQTA 4A59A 3HPOA 3ZSYA 3B6PA 3AA5X 3CCJN 5KGWA 2BANA 4DV2K 3L4QA 1QSSA 4B9UA 4CJ3A 4CHQA 3ZYYX 3R6MA 4YOXA 3JS6A 1YTAA 3VEOA 1QSYA 4A62A 1GLBG 4JN4A 4NLBA 3EL2A 3N4PA 4K0KK 2P9LB 3QERA 4O5FA 3WQUA 2F8TA 3GL1A 1NGJA 3VPZA 1BGXT 1LWEA 3D0PA 3HZ6A 3KK1A 3DJCA 5AFUH 2IVNA 2OTLN 4CHNA 5B8HA 1HJRA 4LF6K 3QIOA 3DXMA 4CEOA 3RRGA 3CJAA 2CGLA 2E20A 3CCSN 2FBXA 1XMOK 5C15A 3KK2A 4KAZA 4CJTA 3A8YA 3UKRA 3E9PA 4PHTX 3ZEUA
chains in the Genus database with same CATH topology
3JAMO 5IWAK 5LMUK 3OTOK 4X64K 1J5EK 4LF8K 2UU9K 4OX9K 4LF5K 4DR4K 3J7AP 5BR8K 4LFAK 4JV5K 4LF4K 4DV6K 4CVNE 4DV1K 4NXNK 4JYAK 4JI4K 4JI1K 4DR5K 3J7YP 3J81O 4DR6K 4AQYK 4JI3K 4GKJK 4V19S 4LFBK 3J80O 4X66K 4LF7K 5LL6Z 4LF9K 4DV7K 4B3TK 4DR1K 2VQEK 4LFCK 4B3SK 4DV4K 5LMNK 2F4VK 4JI5K 5A2QO 4DR3K 4JI7K 1IBLK 2HHHK 4CW7B 4DUZK 1FJGK 1N32K 4B3MK 4YHHK 4DV2K 1HNWK 5IT9O 4JI0K 1N33K 1I94K 2UUBK 2UXBK 1N34K 3T1YK 4DV3K 2ZM6K 1HNZK 4B3RK 5AJ3K 4DV5K 2E5LK 1HR0K 4DR2K 4K0KK 4JI8K 4X62K 1IBMK 2UUCK 2VQFK 2UUAK 4DR7K 4NXMK 1XMQK 1HNXK 4DV0K 4JI6K 1IBKK 1N36K 4LF6K 4JI2K 3T1HK 4KHPK 2UXCK 4X65K 1XMOK 5FLXO 1XNQK 4GKKK 4YY3K 4DUYK 2UXDK 1XNRK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM O;  5IWA K;  5LMU K;  3OTO K;  4X64 K;  1J5E K;  4LF8 K;  2UU9 K;  4OX9 K;  4LF5 K;  4DR4 K;  3J7A P;  5BR8 K;  4LFA K;  4JV5 K;  4LF4 K;  4DV6 K;  4CVN E;  4DV1 K;  4NXN K;  4JYA K;  4JI4 K;  4JI1 K;  4DR5 K;  3J7Y P;  3J81 O;  4DR6 K;  4AQY K;  4JI3 K;  4GKJ K;  4V19 S;  4LFB K;  3J80 O;  4X66 K;  4LF7 K;  5LL6 Z;  4LF9 K;  4DV7 K;  4B3T K;  4DR1 K;  2VQE K;  4LFC K;  4B3S K;  4DV4 K;  5LMN K;  2F4V K;  4JI5 K;  5A2Q O;  4DR3 K;  4JI7 K;  1IBL K;  2HHH K;  4CW7 B;  4DUZ K;  1FJG K;  1N32 K;  4B3M K;  4YHH K;  4DV2 K;  1HNW K;  5IT9 O;  4JI0 K;  1N33 K;  1I94 K;  2UUB K;  2UXB K;  1N34 K;  3T1Y K;  4DV3 K;  2ZM6 K;  1HNZ K;  4B3R K;  5AJ3 K;  4DV5 K;  2E5L K;  1HR0 K;  4DR2 K;  4K0K K;  4JI8 K;  4X62 K;  1IBM K;  2UUC K;  2VQF K;  2UUA K;  4DR7 K;  4NXM K;  1XMQ K;  1HNX K;  4DV0 K;  4JI6 K;  1IBK K;  1N36 K;  4LF6 K;  4JI2 K;  3T1H K;  4KHP K;  2UXC K;  4X65 K;  1XMO K;  5FLX O;  1XNQ K;  4GKK K;  4YY3 K;  4DUY K;  2UXD K;  1XNR K; 
#chains in the Genus database with same CATH topology
 4FJL A;  5IWA K;  3L2Q A;  3ZLJ A;  4K8X A;  3TWH A;  1QQN A;  2UU9 K;  4AHV A;  4AM7 A;  4CBX A;  4KH5 A;  2A6A A;  1LCU A;  3DXK A;  2LSN A;  3EO3 A;  3FE1 A;  4IFE A;  3VF6 A;  4DTM A;  3VGL A;  5GAD P;  3CQX A;  5BN8 A;  4FWK A;  4DV1 K;  2HF4 A;  5AQM A;  4C1N K;  4W5N A;  4DR5 K;  1D8Y A;  4FJH A;  3VQB A;  2D0B A;  2HB5 A;  4CEZ A;  4DU3 A;  4Z4G A;  2WTU A;  4DTO A;  2GEM A;  1Z26 A;  4CF9 A;  2HMP A;  2VWK A;  3ZSQ A;  3SYZ A;  2QWR A;  3LWL A;  4GVM A;  1NOY A;  5AR0 A;  4BRA A;  1LW0 A;  3K5O A;  4DTX A;  4B3S K;  4CJV A;  4FK4 A;  4DTJ A;  3CJ9 A;  3O9U A;  4B1U B;  5KQD A;  3I8D A;  4BY9 C;  1JLE A;  1N32 K;  5AQX A;  4AM6 A;  1TVR A;  3V81 A;  1BQM A;  3PY8 A;  4OLA A;  4H0V B;  1HRH A;  1KVC A;  2OPR A;  5BPM A;  3ATU A;  1NK9 A;  2ATQ A;  3M8Q A;  2EHG A;  3ULE A;  4LY7 A;  2KHO A;  1TV6 A;  4KTQ A;  1S5J A;  5GIN A;  1L3V A;  5C24 A;  3ZSX A;  3OYN A;  1GOA A;  3QLH A;  4B9V A;  2B6A A;  4OLB A;  1QVF M;  4U7B A;  1C1B A;  4BR7 A;  2OPP A;  3MCA B;  2YKN A;  4CZJ A;  4ZTJ A;  1HPM A;  4CBW A;  2QWN A;  4BDZ A;  1ZYQ A;  1OH6 A;  1KTQ A;  4N41 A;  1XI1 A;  4BR9 A;  1WBB A;  3AO3 A;  4M3Y A;  2J4R A;  4KHQ A;  3AGR A;  4CZL A;  3SV3 A;  3C94 A;  1Q82 O;  1HX1 A;  5JVH L;  3U4L A;  4OKJ A;  3K5N A;  3VA3 A;  4JRQ A;  1RT3 A;  2A1S A;  2CGK A;  4DUY K;  1S1X A;  4IBN A;  4CGG A;  3HOT A;  4DFJ A;  3DLK A;  1KAZ A;  3L2U A;  4CER A;  4DQ8 A;  4OX9 K;  4YOR A;  3VER A;  2I7N A;  4LFA K;  4FL9 A;  3LWM A;  2V7Z A;  4KH4 A;  4EFH A;  4E89 A;  4HUE A;  3ID6 A;  5TKY A;  2ZWH A;  2ZGY A;  1NK4 A;  2P9P A;  4GNI A;  1B9F A;  1B92 A;  4H4M A;  1BG3 A;  2NRH A;  4O8K A;  1QHA A;  5KTQ A;  3G25 A;  2P9I B;  4AIL C;  4FJJ A;  4FJ8 A;  4X66 K;  3HOS A;  3C7N B;  3FZL A;  4HTU A;  4DTP A;  4H5N A;  4FWR A;  1T3V A;  4H5R A;  4CJF A;  4DLG A;  3F9K A;  3ZT2 A;  2VGN A;  5A2Q O;  2Z1G A;  1HKB A;  3DLG A;  4FM0 A;  3SMS A;  4BGB A;  2BE2 A;  2YKM A;  2EX3 A;  1L3S A;  3ISN C;  1EET A;  4CEC A;  1KLN A;  1ZBF A;  4FLT A;  1JCG A;  1J6Z A;  3U3Y A;  3ZSZ A;  1Y64 A;  2A42 A;  1NKE A;  2F9T A;  2YCH A;  4HHT A;  1FXX A;  5J1E A;  3M1F A;  3DRR A;  5JS2 A;  4PKH A;  4KB0 A;  5I42 A;  3D2E B;  1CZB A;  4BR4 A;  4OKE A;  2GEL A;  2P9N B;  3ULD A;  1NM1 A;  4ELT A;  3ZSO A;  3MXI A;  3KD5 E;  1NGD A;  3JSM A;  1S72 N;  3RSE A;  3FZK A;  3CPW M;  1EQY A;  1YXQ A;  1VHX A;  1NK5 A;  2Q36 A;  3SMP A;  3VES A;  3G4S N;  4PL7 A;  5FDL A;  1YVU A;  3QNN A;  3DOK A;  4CF2 A;  4BAC A;  3OYM A;  4JI2 K;  1FKO A;  3DI6 A;  3V9U A;  2E6L A;  2VYP A;  5AQS A;  3NGZ A;  1JLC A;  1RT5 A;  1WLJ A;  4YFU A;  2O4G A;  3D2F A;  4CFD A;  2XY7 A;  1NGI A;  1P8Z A;  1XNR K;  4XH1 A;  4FJN A;  5C42 A;  2HBJ A;  2RF2 A;  2WFB A;  3D7E O;  4CF0 A;  1Z6R A;  4FZX C;  1JLQ A;  4FK2 A;  3A2F A;  3TAN A;  3CD6 N;  3HO1 A;  4JKG A;  4LF4 K;  4B9Q A;  2W42 A;  3OJU A;  4CVN E;  2VWJ A;  2Y1J A;  5M1N A;  4Z4E A;  4E7J A;  3RVC A;  2NLX A;  1JLA A;  3O9R A;  4AQY K;  4H0O A;  1ESV A;  3NDK A;  3ENH A;  1TK0 A;  4WQ4 C;  1K8K B;  4JKH A;  4BC4 A;  1S9G A;  3J80 O;  4N5S A;  3T3F A;  1U45 A;  4LSL A;  1HKC A;  2GBZ A;  4KO0 A;  4EHT A;  3KKR A;  3RMD A;  3OYF A;  3GG4 A;  2ETJ A;  1TKX A;  3CIP A;  3PO4 A;  1QHT A;  3EKS A;  3NFA A;  5AQH A;  4O44 A;  3KWI A;  1TGO A;  2HF3 A;  1E4F T;  3ZCM A;  4UY8 O;  3A0I X;  1HNI A;  4RG8 A;  1N5Y A;  4F4K A;  3CG7 A;  2HVH A;  2BUP A;  4B9S A;  4O55 A;  3LZJ A;  4CZK A;  2QWL A;  4WYB A;  4FJI A;  4CED A;  3OYI A;  3B8A X;  3LP2 A;  2UXB K;  1IG9 A;  4FO0 A;  3CHW A;  4N56 A;  2IIR A;  3CC4 N;  5SZT A;  1HNZ K;  4Z4I A;  5I9E B;  1KVA A;  4Z4C A;  4IXC A;  4JLH A;  5M1O A;  2F96 A;  4DR2 K;  1E3M A;  5CHI A;  4M3T A;  4GY2 B;  4GMJ B;  4CZE A;  2NZT A;  4CFC A;  3O1B A;  4FPB A;  1WNS A;  1VRT A;  4FWL A;  3EY1 A;  3VQC A;  4CJ7 A;  3BF1 A;  3AVK A;  3KLE A;  3HK2 A;  3OHR A;  1KFS A;  2XHB A;  2O8B B;  3UB5 A;  4KB1 A;  1HYV A;  1WSE A;  1KAX A;  1RTI A;  3TAR A;  2RN2 A;  4BRK A;  3OS1 A;  4XIU A;  3TAG A;  3CC7 N;  2HOE A;  4GKK K;  1A5V A;  1UWB A;  3CF5 L;  4MO4 A;  3FZH A;  4B9T A;  3LAK A;  3KLI A;  4C23 A;  1YJN N;  1T7P A;  1ZBL A;  3THY A;  1RDW X;  5EY4 A;  5CYQ A;  3AVC A;  4NB4 A;  3H3N O;  4LD0 A;  4CES A;  4BR5 A;  3SAG A;  4WQ5 A;  3CCV N;  5AQK A;  3NF7 A;  4IO8 A;  1NK0 A;  4NXN K;  2H3G X;  3OYB A;  2HNZ A;  3MEG A;  3KVG A;  2FBY A;  2O8F B;  4QOZ B;  4E7H A;  1BA0 A;  2V7Y A;  4EHU A;  2FSN A;  4KBO A;  3HRG A;  4N47 A;  1S1W A;  1U04 A;  3ZET B;  3ZX2 A;  3OBW A;  3WEE B;  2D0O A;  5F1X A;  4BQZ A;  2OYQ A;  2VWB A;  5C2F A;  1WSH A;  4NCA A;  1YI2 N;  4M7X A;  5J2M A;  3OVN A;  1X9J A;  1W97 L;  2O8D A;  4KI4 A;  2YJE A;  4B3M K;  1BIZ A;  3DRS A;  2E2O A;  4B8A B;  1KFD A;  4WF9 L;  3HP6 A;  1I94 K;  4DV3 K;  1W2B M;  3V9S A;  1BU6 O;  3HBT A;  4I6M A;  4JHD A;  5M1Q A;  5HRN A;  2HND A;  2AA4 A;  1Q9Y A;  4TSX A;  3M8R A;  3B6O A;  2UUC K;  1QQO A;  4HUG A;  2Q31 A;  3UE5 A;  1RCH A;  1WSF A;  4DR7 K;  4CJU A;  4RW7 A;  3AAR A;  1YVN A;  3QEW A;  4GV6 A;  5F0X A;  1QVG M;  4KRF A;  2E1Y A;  1IKX A;  3HL8 A;  1NGC A;  3EKU A;  4NYN A;  1SL1 A;  5FPD A;  2Q1N A;  1ZC6 A;  1YT3 A;  1XC9 A;  5CR4 A;  2YHX A;  3SJH A;  4RTF D;  1BWF O;  3HT3 A;  3MX2 A;  1IKW A;  3RMA A;  4CE9 A;  4FJ7 A;  3L2V A;  3DLE A;  2YNF A;  3I8B A;  2QWP A;  3J7Z O;  1IG8 A;  4B3O A;  3O5B A;  2D1K A;  3QML A;  4M41 A;  1VQ9 N;  3OBY A;  3GDQ A;  3LDL A;  4XEI A;  1UAX A;  2FBT A;  4RW8 A;  5FRO A;  3D45 A;  4ILH A;  3L3V A;  1BI4 A;  2X6S A;  4E7K A;  1BUP A;  5E41 A;  3LAM A;  4JYA K;  2WOM A;  4AHC A;  4GV3 A;  4Y1C A;  5J2Q A;  4JS4 A;  4DR6 K;  5HL7 L;  4M63 C;  2A1R A;  5JLH A;  1QZ5 A;  4B1V A;  5HRR A;  1O1W A;  1X3N A;  4BRH A;  4M3W A;  3LAL A;  3CYM A;  1WB9 A;  4JEP A;  3ZSV A;  2CH5 A;  4FM2 A;  3RTV A;  4JI5 K;  5M1K A;  1K73 O;  3VQ7 A;  1T6C A;  1GLD G;  3P5J A;  3O8M A;  3K58 A;  2PZS A;  3DRP A;  3C6T A;  4K42 A;  2YHB A;  3NF8 A;  1S1V A;  3TTF A;  3E9L A;  3T1Y K;  3FZF A;  2ZQB A;  2RHK A;  5AQR A;  3Q7C A;  2ZM6 K;  2O8E B;  3THX B;  3SV4 A;  4CJE A;  3KLF A;  1M1K O;  3WT0 A;  3E01 A;  4LC9 B;  1GLE G;  3KWG A;  3THW B;  3PUF A;  1WSI A;  3ZT3 A;  5FPE A;  4HVJ A;  1BL3 A;  2QKK A;  4FWN A;  3F9M A;  1SKR A;  3IMX A;  1Z05 A;  3DOL A;  3M3Z A;  2XY8 A;  3AO1 A;  4JI6 K;  4NCB A;  2DFH A;  4DQP A;  3NMU A;  3H1V X;  3O1W A;  5C2D A;  1A5X A;  4IG0 A;  3C95 A;  1TKD A;  4PWD A;  5GAE P;  3DLR A;  3SI6 A;  3QFP A;  4WQ5 C;  4L3Q A;  3V1R A;  4DS5 A;  3AVF A;  1RDA A;  4QAG A;  1Q18 A;  1NBW A;  2DTU A;  3CQ8 A;  4LH4 A;  2F7T A;  4DR4 K;  4CJP A;  5BR9 A;  2GV9 A;  1JLG A;  3VGK A;  4OPK A;  3JYT A;  4BG9 A;  4CJL A;  1WSJ A;  3NF9 A;  1WAF A;  1GOB A;  4JI4 K;  4HCB A;  4ILG B;  4CZM A;  1JCE A;  3BZC A;  3VEN A;  1RIL A;  1K6Y A;  5JLF A;  5T7B A;  3VQP A;  3HVT A;  4KTZ A;  4H03 B;  3S3O A;  3SPY A;  5GIO A;  4BC2 A;  3TSU A;  2P9S A;  3KK7 A;  3TTD A;  5AFU A;  5BPL A;  2P5G A;  1NJI O;  4HCC A;  1BIS A;  2P5O A;  3O3H A;  3DYA A;  3BP8 A;  1KXP A;  4O4G A;  1FJG K;  2GUP A;  4YHH K;  1HJO A;  2P9I A;  3CJ1 A;  3SPZ A;  3BZK A;  4DWI A;  1U2V A;  5FPM A;  4A2B A;  3ZT1 A;  4BRP A;  2UUB K;  1XHZ A;  4IOC L;  1EXQ A;  4B9N A;  4G1Q A;  3LM9 A;  3MAQ A;  2W6L A;  1Z25 A;  4I2P A;  3I56 N;  1RBT A;  3DM2 A;  4JD2 A;  5AJ3 K;  3EZ5 A;  3O4N A;  3L8B A;  3CJ7 A;  3R1X A;  2WC9 A;  1RBU A;  5LJV A;  2KTQ A;  1JL1 A;  4BWM A;  1RT7 A;  2F9W A;  3M8P A;  3TAM A;  4BRN A;  3AVG A;  3EE9 A;  1NGG A;  1TUU A;  4FLU A;  2E6M A;  2E88 A;  4OO1 J;  4G9Z A;  3GBT A;  4JK9 A;  3CXC M;  2GWJ A;  3CFP A;  3KJV A;  4FK0 A;  5BRF A;  4C1N I;  3NCI A;  2UXD K;  1JKH A;  3JAM O;  4F2R A;  2O4I A;  4CJ5 A;  3LP0 A;  4CD1 A;  4M3X A;  5AQU A;  3ITH A;  1Q7Y O;  4BR2 A;  4ZTF A;  4DFK A;  3CCR N;  1GLA G;  3CM6 A;  3QDK A;  1X9M A;  2HHS A;  2P9U A;  2X78 A;  4HUF A;  4Y0W A;  2NRZ A;  2E2Q A;  3VOV A;  3AA3 A;  1MWK A;  3J7Y P;  3OYD A;  3IAY A;  1LV5 A;  3NVK A;  2NRX A;  3S9H A;  3LDQ A;  1EKE A;  2P9K A;  2PFU A;  3LDP A;  4JK7 A;  3U9D A;  3OYL A;  5D3G A;  2A5X A;  3O08 A;  1BDG A;  2UYT A;  3TSP A;  4FLX A;  1Q86 O;  1RBS A;  2F4V K;  4RW4 A;  5I3U A;  1BOT O;  2ASP A;  4DR3 K;  4H4O A;  4E19 A;  3U6F A;  3P4I A;  2KFZ A;  4I9L A;  4KHU A;  5HRO A;  3HM8 A;  3UKR B;  3RR7 A;  4R5P A;  3ZEU B;  2V51 B;  5IT9 O;  4OPJ A;  2YI1 A;  3KK3 A;  1KD1 O;  1W9H A;  4EAH D;  4CZG A;  3DXK B;  4Q5V A;  2DY4 A;  2RKI A;  4Z4F A;  5AZI A;  3THV A;  3AVL A;  1IBM K;  1XWL A;  5C12 A;  2IGI A;  1CLQ A;  2FSJ A;  1I39 A;  1TUY A;  4IJN A;  3SBT A;  5FPN A;  1TK8 A;  1BCO A;  2P1J A;  3TAP A;  1BA1 A;  1XHX A;  3PX4 A;  3F73 A;  3TR8 A;  1N36 K;  1TYQ B;  2NUB A;  1HKG A;  1NKB A;  4KHP K;  1J54 A;  1TL3 A;  3QNO A;  4DCH A;  2W6K A;  4ISG A;  5FLX O;  3LM2 A;  1QSL A;  2XRI A;  3PX6 A;  3MN7 A;  3VEY A;  1T05 A;  1TKT A;  3RWU A;  1EX4 A;  1YF5 L;  4B1Z A;  4FJ5 A;  2ITG A;  5KPR A;  4B8C A;  3ULE B;  2ZJP L;  1QQC A;  3J7A P;  1C0M A;  3ATV A;  3WNG A;  1CXQ A;  3O4Q A;  1TK5 A;  4N76 A;  4CHO A;  2ZE2 A;  3OJS A;  4PA1 A;  4FM1 A;  1Q81 O;  1NG9 A;  3CFO A;  4DS4 A;  3I0S A;  4YDU A;  4JI3 K;  4V19 S;  3ZSR A;  1F21 A;  1HQU A;  4OPA A;  5AQI A;  4WFN L;  1O13 A;  1B9D A;  3RRH A;  3EYZ A;  3UIQ A;  1E4G T;  4CF1 A;  1DKG D;  3CET A;  3QEV A;  2GTD A;  3CPE A;  3C6H A;  4ISE A;  4A61 A;  3PV8 A;  5KQ8 A;  4YOY A;  1IBL K;  4DQQ A;  4CJS A;  2NNW A;  2QKB A;  3UKU A;  3VQD A;  4CW7 B;  2RE2 A;  3VEZ A;  3ZT4 A;  4DUZ K;  2PBD A;  1REV A;  3EZW A;  3VQ5 A;  5C0Y A;  2DPN A;  3P1G A;  2O8F A;  5KGX A;  1ASV A;  1CZA N;  2GX9 A;  1DTQ A;  3HYF A;  4ID1 A;  4RW9 A;  3H46 O;  4BE0 A;  2HST A;  3DLL L;  3RMC A;  3O9S A;  3HPH A;  4IJA A;  1WUA A;  4H5T A;  4PKI A;  4B1W B;  3WEE A;  1YAG A;  3IFR A;  1X9S A;  3WNH A;  4WE1 A;  4CGH A;  4DTS A;  4B3R K;  1D4X A;  5AQW A;  4KHW A;  2P9P B;  4H0T B;  4X62 K;  3VQ8 A;  3SBG A;  3MWP A;  1ILY A;  4E1M A;  2UUA K;  1SS6 A;  3CCM N;  4EZ6 A;  3OYC A;  1RBR A;  1NK7 A;  3ZSW A;  5H1S Q;  2HMI A;  4A5A A;  3QES A;  1Y97 A;  2A41 A;  4E1J A;  5BRD A;  2OA8 A;  4DV0 K;  4M3U A;  5E84 A;  4YOV A;  5CE3 A;  3LL3 A;  4H0Y B;  3VTI A;  4CJQ A;  5GAG P;  3AVH A;  3M5R A;  1U49 A;  1T44 A;  4FW1 A;  4JNE A;  2NRW A;  2BTF A;  4KFB A;  3AA4 A;  3HST B;  4BVP A;  3LAN A;  3OYG A;  1G15 A;  4FVM A;  5JS1 A;  2ZF5 O;  3E66 A;  4AF1 A;  5HLF A;  2FBV A;  2WON A;  3AGK A;  4A5B A;  2Y1I A;  1SL2 A;  1J5E K;  4F8R A;  1S9E A;  1VSI A;  3A5L C;  3OW2 M;  2HHX A;  1L3T A;  3CFR A;  1TAQ A;  1QZ6 A;  1RNH A;  4FOE A;  1TKZ A;  5DMR A;  2E8A A;  2QK9 A;  3SQ2 A;  1JLB A;  3OYJ A;  1NGA A;  4CJ4 A;  3V9W A;  1S1U A;  3H1Q A;  3CCE N;  1NGH A;  3T69 A;  1JXE A;  4JKE A;  1NJW A;  5JMV A;  3R8E A;  3K5M A;  1VSK A;  3ENB A;  4LFC K;  5BN9 A;  4B1X B;  4DV4 K;  1OVQ A;  4AH9 A;  2IS3 A;  2Z1I A;  1ZBS A;  1IO2 A;  3HJF A;  4JKC A;  2P51 A;  4M3Z A;  1LW2 A;  5BRH A;  4BRC A;  1C0U A;  3D2F B;  4MDB A;  3C6A A;  2VG7 A;  1IH7 A;  4FW2 A;  5ADX H;  3R9P A;  4J2D A;  4H5W A;  1VQL N;  4BQL A;  3KIO A;  4IOA L;  2QTD A;  4JI8 K;  4WFA L;  3M6G A;  5CY4 A;  1DT9 A;  1D9D A;  2XY6 A;  4FZZ A;  1ASW A;  3ZX0 A;  3CC2 N;  3PSI A;  4JAX A;  3QET A;  3HP9 A;  3I33 A;  2O8C A;  1WOQ A;  4BRO A;  3THX A;  3K9K A;  4CHZ A;  4L8R B;  3G71 N;  2QXF A;  4GW6 A;  4BE2 A;  1LOT B;  2FXU A;  4EP4 A;  4QS7 A;  2EWS A;  1OKJ A;  3WUH A;  2DFF A;  4C8K A;  1VQP N;  4PQU A;  4I2Q A;  2QM1 A;  4JKF A;  5J2P A;  4H5V A;  2CGJ A;  3U9Z A;  3GE1 A;  5ELZ A;  1KVB A;  2IC3 A;  1RT6 A;  4MO5 A;  4DTU A;  3TTC A;  1YJW N;  4UQG A;  5BRE A;  4Y1D A;  1CZ9 A;  2QI2 A;  4CGI A;  3CCQ N;  2KQ2 A;  2WUS A;  5TKW A;  5GIP A;  4B9M A;  2ZJQ L;  5AQY A;  2PY5 A;  4YDU C;  4F3O A;  4BRD A;  3EN9 A;  1T03 A;  4LF5 K;  4H0X B;  4JV5 K;  1VQ6 N;  3RR8 A;  4HTL A;  3AVM A;  2HBK A;  2P9L A;  4AHU A;  1UOC A;  1U4B A;  3OS2 A;  4KI6 A;  4JK8 A;  4MQ3 A;  1EWR A;  2GWK A;  2FF3 B;  3AAP A;  2D0P A;  4CHP A;  3S41 A;  3K0S A;  1VSH A;  4ILJ A;  2KZZ A;  1S3X A;  2VQE K;  4PUO A;  1SKW A;  4B1Y B;  5LMN K;  1EWQ A;  1VSD A;  2IAJ A;  2KKZ A;  4IEI A;  2R7Y A;  4CJR A;  3PIO L;  5HP1 A;  4CIG A;  2OZM A;  3O3G A;  1QE1 A;  5KPT A;  4DTN A;  1GOC A;  1T6D A;  1C6V A;  4IFY A;  5AQG A;  3VA0 A;  5FRM A;  4QCL A;  3NH1 A;  5AQF A;  4FLW A;  1M90 O;  3L6Q A;  1IV0 A;  4FWM A;  1HNW K;  1NNE A;  3O80 A;  3G10 A;  1N33 K;  2HNY A;  4CD3 A;  3H45 C;  4KTW A;  3BGR A;  2Z1H A;  3VQA A;  1NU0 A;  1C0G A;  2JWK A;  1W7A A;  4R79 A;  1L5U A;  1L3U A;  3THY B;  2QWO A;  2G8K A;  1OH5 A;  3LDO A;  1NWK A;  3DWL A;  3MMV A;  1ITG A;  3L2R A;  1NMN A;  2HHU A;  1HPZ A;  4FJ9 A;  1N8R O;  3CJB A;  3MN5 A;  2OZS A;  3E1Y A;  3K5L A;  4F9O A;  5HRS A;  3SZ2 A;  4CK3 A;  4FJG A;  4PL8 A;  1YIJ N;  1VSJ A;  2HBM A;  3MX5 A;  1IKV A;  3K59 A;  3QEI A;  4ELU A;  3MXJ A;  3O6W A;  1YTU A;  2HHV A;  1VSM A;  4WCE L;  1XQS C;  1U48 A;  4CJW A;  4DSL A;  3SNN A;  4F2S A;  4NO7 A;  2O8D B;  1WN7 A;  4EZ9 A;  4CGD A;  2YNG A;  5EVZ A;  3FGU A;  4DG1 A;  2Q0R A;  3ID8 A;  4W5Q A;  4KHS A;  3MXM A;  3AVA A;  3HVR A;  4B9L A;  2Q2R A;  1VSL A;  4O0I A;  2Q3S A;  5EU7 A;  1J5O A;  3P39 A;  4RW6 A;  3MEE A;  4HWI A;  3NAE A;  3I55 N;  2JLE A;  1RBV A;  1ATR A;  3C65 A;  3H6E A;  1NGE A;  4CBU A;  4FCY A;  1RTH A;  5EOY A;  5AQQ A;  5AQV A;  5DK5 A;  3VQ9 A;  1VSE A;  3SAH A;  1SZ2 A;  3QB0 A;  3IDH A;  1S6P A;  3MCP A;  2FC0 A;  1YHQ N;  3SAF A;  1JJ2 M;  3AAQ A;  3F2K A;  4FYD A;  4DR1 K;  3E9O A;  4EP5 A;  4RCH A;  1I3A A;  2W40 A;  3SK3 A;  3OYH A;  4FWS A;  3K57 A;  1NKC A;  2HHH K;  3HPG A;  1C0F A;  5FRN A;  4A57 A;  4MFB A;  4CFA A;  3OYA A;  1KSP A;  4J2B A;  5DM6 L;  4ICL A;  3WNE A;  3QIN A;  3QBX A;  2X6N A;  4FLV A;  4JI0 K;  3NE6 A;  2HBL A;  2YX6 A;  3PIP L;  1Q9X A;  4OKK A;  4DFP A;  4E0D A;  2VGM A;  3DLH A;  1C0T A;  4KHN A;  3EE8 A;  2E5L K;  1SAZ A;  1BI4 B;  4YNQ A;  4MLH A;  3QIP A;  4YOW A;  3C6U A;  2PAV A;  1KCF A;  1VK0 A;  5EX5 A;  1IKY A;  1VRU A;  3NF6 A;  4C8N A;  3TU5 A;  3VF4 A;  3MED A;  2IVO A;  5HOO A;  1OVY A;  1RTJ A;  1VQK N;  3C7N A;  4JS5 A;  3L4I A;  3VET A;  4JKB A;  3IG1 A;  3KZB A;  5M1F A;  2RPI A;  2AJQ A;  2YJF A;  2X74 A;  1QS4 A;  4Z94 A;  4E3S A;  1BIU A;  4FJK A;  3AO2 A;  4KV8 A;  5AZJ B;  2QWM A;  4JKD A;  5LY3 A;  4MDA A;  2ZD1 A;  4YOT A;  2G8I A;  3CER A;  3LP3 A;  4LH5 A;  4CFB A;  1K8A O;  3MN6 A;  3BDP A;  3AV9 A;  2HHW A;  3V1O A;  3P83 D;  2D0A A;  1U47 A;  2YHA A;  1HMV A;  5BR8 K;  1EO1 A;  1TYQ A;  4CI6 A;  3L2W A;  1D5A A;  3D2E A;  4W5T A;  4AHT A;  3PLA A;  3ENO A;  2P9N A;  4WQ4 A;  4F3T A;  3KHY A;  4E7I A;  4IG3 A;  4ID5 A;  5DM7 L;  4GKJ K;  3DLB A;  3TI0 A;  5AQL A;  4ZHR A;  3S3M A;  3PSF A;  1GLJ O;  2BH1 A;  4CEA A;  4IOX A;  1RDB A;  3K2P A;  1RT2 A;  4E7L A;  3BUZ B;  2A40 A;  4CEF A;  3V9Z A;  4DU1 A;  1RDU A;  4OPH A;  1CXU A;  3DMJ A;  4O0J A;  4DMN A;  4PKG A;  3CM5 A;  3ZT0 A;  3VQ4 A;  3MN9 A;  3P38 A;  3MDQ A;  4ISF A;  4OJR A;  3QBW A;  4CK1 A;  2BDP A;  3CCU N;  3WXM B;  3VGM A;  2HVI A;  3V6D A;  3CCL N;  1N34 K;  4DKW A;  4BG8 A;  3ASM A;  4EIA A;  1JLF A;  4DSI A;  4DV5 K;  3J8A A;  3WXK A;  4FWO A;  2D4W A;  2IVP A;  1V4T A;  3DXM B;  5KPZ A;  3S3N A;  1HYS A;  4DF8 A;  1K8K A;  3N4Q A;  4NXM K;  5AQP A;  5J2N A;  4AHR A;  1MA9 B;  1HNV A;  3AA2 A;  3LP1 A;  4KHY A;  4BR0 A;  3VQ6 A;  2P9S B;  2JWL A;  3FFK B;  4M7Y A;  3T7Z A;  2UXC K;  1R0A A;  1GLF O;  2YHY A;  3VN5 A;  4Z4H A;  4Z0U A;  4FOI A;  2OAN A;  3QIC A;  1U2V B;  2IOC A;  1X3M A;  4J2E A;  3CI5 A;  3IS9 A;  3C0B A;  2Z1J A;  1VQM N;  4FSV A;  2NRV A;  1SQK A;  3IKM A;  3A5M C;  4CEQ A;  4JD2 B;  1NJZ A;  1BCM A;  1NGF A;  4CIE A;  1ASU A;  4FJM A;  1HUX A;  3CQY A;  4JKA A;  5KI6 A;  4FZY A;  4CGJ A;  3NGY A;  2QEX N;  4BRL A;  4DLE A;  4KKO A;  5LL6 Z;  2E4L A;  3VQQ A;  1BO5 O;  4CEB A;  3AVI A;  4JRP A;  4BRQ A;  3AO4 A;  5AQN A;  3ZX3 A;  4DU4 A;  2O8B A;  4CZF A;  3AY9 A;  5HRP A;  1SL0 A;  2YNH A;  4DF4 A;  4DTR A;  1VQO N;  4CIF A;  1BQN A;  5KRS A;  2XY5 A;  1Q8I A;  4ELV A;  1ATS A;  4BRI A;  3CMA N;  2OCE A;  4BE1 A;  2HHQ A;  4J2A A;  4AHS A;  2HW3 A;  1S1T A;  2Q0U A;  3KTQ A;  1A5W A;  1EP4 A;  1C1A A;  1RT4 A;  1J9A A;  4BDP A;  4IEE A;  2DFE A;  4K43 A;  3H08 A;  1NLV A;  1C1C A;  2E2P A;  3JXU A;  4M45 A;  3RMB A;  1JL2 A;  2P9U B;  4M3R A;  4DSK A;  3SUP A;  2D5R A;  1LWF A;  1S6Q A;  4FXD A;  3O9T A;  2VG5 A;  4B08 A;  1W0H A;  2CH6 A;  1OH7 A;  2P9K B;  3VEV A;  1ZBU A;  3SJJ A;  3ZET A;  3VF2 A;  3D6R A;  4IO9 L;  4NCG A;  3VEX A;  1BHL A;  3T1H K;  1KRP A;  4X65 K;  1ZBI A;  5M1P A;  4BRE A;  3BF3 A;  1OH8 A;  4YOU A;  4FLY A;  3AVB A;  2F8S A;  1XNQ K;  4YY3 K;  1MWM A;  4K8Z A;  4H8K A;  4OVL A;  3CJC A;  3LDS A;  3HI0 A;  4GV9 A;  5JIC A;  4O8U A;  4X64 K;  3A5N C;  4LF8 K;  1GLC G;  3TAE A;  3SUN A;  4BGA A;  3WXJ A;  4BRM A;  4XH4 A;  3T1A A;  3FZM A;  4DV6 K;  3NH0 A;  4I7F A;  2VCP A;  3SUO A;  5AZI B;  2E2N A;  3V1Q A;  1UA1 A;  4BC5 A;  1QTM A;  1KLM A;  2BGG A;  3FFI A;  3J81 O;  3R3L A;  3FR0 A;  1UA0 A;  1TL1 A;  1HYZ A;  1G99 A;  1LAW A;  3O4W A;  4LFB K;  1RGI A;  2JGU A;  1DLO A;  4CZH A;  4C8M A;  4LF7 K;  4E1N A;  4CJK A;  2I5J A;  1K9M O;  3F5T A;  4LF9 K;  1RFQ A;  5KRT A;  3HXM A;  2D0C A;  4BVO A;  1R59 O;  3LPT A;  4BC3 A;  4H0P A;  2NRT A;  1S22 A;  3L3U A;  4JI7 K;  3QEX A;  1KC8 O;  4BRG A;  4CHY A;  3OA9 A;  1DEJ A;  3VTH A;  1GLL O;  3NVM A;  4DSJ A;  3G6E N;  4K25 A;  1N6Q A;  1LWC A;  3MWT A;  5LJW A;  3U8X A;  3NH2 A;  3RSE B;  2ASM A;  1P90 A;  1DGK N;  2OPQ A;  4Q0B A;  2V52 B;  1NGB A;  3SLC A;  4DSE A;  4IKF A;  4CEE A;  3WXL A;  2QXL A;  5CYM A;  1HR0 K;  4DQS A;  4BDY A;  1YJ9 N;  2VQF K;  4W5R A;  3IUC A;  2NRR A;  4PY5 A;  2ASO A;  3LDN A;  4CK2 A;  1FKP A;  5MLC Q;  3PO5 A;  3P31 A;  1MDU B;  4FWQ A;  4DFM A;  2VG6 A;  1IJJ A;  1MU2 A;  5GAH P;  1WAJ A;  1HLU A;  3QEP A;  3U3G A;  3QFU A;  3KD1 E;  3MK6 A;  1SV5 A;  1VSF A;  1WSG A;  1XUP O;  2AP1 A;  4JKG B;  4WFB L;  3SQ4 A;  2ZGZ A;  2ITM A;  1TAU A;  5AQJ A;  2KW4 A;  4CF8 A;  3ALY A;  3UKU B;  4C8L A;  3VMF B;  4KPY A;  2OTJ N;  4M42 A;  3L0Q A;  1T8E A;  3HSC A;  1X9W A;  4FVU A;  1QQM A;  3OS0 A;  1VQN N;  4K41 A;  3OTO K;  1YUW A;  2G8W A;  2O8E A;  4O5B A;  2G8H A;  4DQI A;  5ADX A;  3V4I A;  3SQ1 A;  5EXW A;  3VEW A;  1VQ4 N;  3NHG A;  1VQ8 N;  2XO7 A;  3SUQ A;  3AVJ A;  5BPN A;  3MEC A;  1X1P A;  1NK6 A;  3THW A;  2A3Z A;  2PYL A;  4IFV A;  4NYF A;  4JI1 K;  5K14 A;  3O9Q A;  1NJY A;  2QA4 N;  3TPQ A;  3M8S A;  3GOI A;  3SCX A;  2YHW A;  1KAY A;  4CZI A;  1H1V A;  1XC3 A;  4FJX A;  5SWM A;  3H3O B;  1NOZ A;  4FWP A;  2ZJR L;  5AQZ A;  3WNF A;  4QS8 A;  2FLO A;  4GVE A;  4IDK A;  2WBN A;  5C25 A;  1KQS M;  1JCF A;  3W0L A;  2G8F A;  2G8V A;  2W41 A;  1NMD A;  2PYJ A;  3IRX A;  5E26 A;  3A5O C;  1VAZ A;  3BY5 A;  3TAB A;  3EEQ A;  3Q7B A;  2YV0 X;  2KZM A;  4IDH A;  5AQO A;  4FLZ A;  5HBM A;  1SUQ A;  3G0Z A;  1J53 A;  4BWJ A;  4DSF A;  3LPU A;  3KKS A;  1RDD A;  1FK9 A;  4KRE A;  2KFN A;  1NK8 A;  3OYE A;  1RTD A;  3VQE A;  3NBP A;  5C10 A;  3AO5 A;  4QS9 A;  1LAV A;  1ZXO A;  1VQ5 N;  1XMQ K;  4IZ9 A;  1HNX K;  1V4S A;  2IDO A;  2KLA A;  4IWV A;  4XH5 A;  3HM9 A;  4NLC A;  1RT1 A;  1IBK K;  3OY9 A;  3HTV A;  2G8U A;  3T19 A;  3TAQ A;  1DTT A;  4OGE A;  1FW6 A;  3OYK A;  2B4J A;  2QWQ A;  1U6Z A;  4MLE A;  4FPA A;  3TSQ A;  3V9X A;  1VQ7 N;  1ATN A;  2YNI A;  2FSK A;  3LZI A;  5LMU K;  1JXB A;  4KH6 A;  4DQR A;  4RWT A;  1D9F A;  3NGI A;  3PX0 A;  3SQ0 A;  2E1Z A;  4CGF A;  5AZJ A;  3KLG A;  4OGC A;  5JVG L;  1WBD A;  2GUI A;  4LSN A;  1NJX A;  3AVN A;  4BRF A;  2OPS A;  3FLC O;  4I9Q A;  5CZ2 A;  4U67 L;  3CME N;  4W5O A;  1SKS A;  4DB3 A;  3WQT A;  3I0R A;  3W3D A;  3WXI A;  5CZ1 A;  2O8C B;  3BEX A;  2Q97 A;  2FF6 A;  4DV7 K;  4B3T K;  4C8O A;  3TAF A;  2QW9 A;  5F2R A;  1ZBH A;  1YIT N;  4CCH A;  4J8F A;  1RDC A;  3K9J A;  2I7P A;  3QO9 A;  4I6M B;  4JHD B;  4DHY A;  3DAW A;  4A2A A;  1HQE A;  3O3F A;  2B5J A;  3KLH A;  2HHT A;  5AQT A;  4A59 A;  3HPO A;  3ZSY A;  3B6P A;  3AA5 X;  3CCJ N;  5KGW A;  2BAN A;  4DV2 K;  3L4Q A;  1QSS A;  4B9U A;  4CJ3 A;  4CHQ A;  3ZYY X;  3R6M A;  4YOX A;  3JS6 A;  1YTA A;  3VEO A;  1QSY A;  4A62 A;  1GLB G;  4JN4 A;  4NLB A;  3EL2 A;  3N4P A;  4K0K K;  2P9L B;  3QER A;  4O5F A;  3WQU A;  2F8T A;  3GL1 A;  1NGJ A;  3VPZ A;  1BGX T;  1LWE A;  3D0P A;  3HZ6 A;  3KK1 A;  3DJC A;  5AFU H;  2IVN A;  2OTL N;  4CHN A;  5B8H A;  1HJR A;  4LF6 K;  3QIO A;  3DXM A;  4CEO A;  3RRG A;  3CJA A;  2CGL A;  2E20 A;  3CCS N;  2FBX A;  1XMO K;  5C15 A;  3KK2 A;  4KAZ A;  4CJT A;  3A8Y A;  3UKR A;  3E9P A;  4PHT X;  3ZEU A; 
#chains in the Genus database with same CATH homology
 3JAM O;  5IWA K;  5LMU K;  3OTO K;  4X64 K;  1J5E K;  4LF8 K;  2UU9 K;  4OX9 K;  4LF5 K;  4DR4 K;  3J7A P;  5BR8 K;  4LFA K;  4JV5 K;  4LF4 K;  4DV6 K;  4CVN E;  4DV1 K;  4NXN K;  4JYA K;  4JI4 K;  4JI1 K;  4DR5 K;  3J7Y P;  3J81 O;  4DR6 K;  4AQY K;  4JI3 K;  4GKJ K;  4V19 S;  4LFB K;  3J80 O;  4X66 K;  4LF7 K;  5LL6 Z;  4LF9 K;  4DV7 K;  4B3T K;  4DR1 K;  2VQE K;  4LFC K;  4B3S K;  4DV4 K;  5LMN K;  2F4V K;  4JI5 K;  5A2Q O;  4DR3 K;  4JI7 K;  1IBL K;  2HHH K;  4CW7 B;  4DUZ K;  1FJG K;  1N32 K;  4B3M K;  4YHH K;  4DV2 K;  1HNW K;  5IT9 O;  4JI0 K;  1N33 K;  1I94 K;  2UUB K;  2UXB K;  1N34 K;  3T1Y K;  4DV3 K;  2ZM6 K;  1HNZ K;  4B3R K;  5AJ3 K;  4DV5 K;  2E5L K;  1HR0 K;  4DR2 K;  4K0K K;  4JI8 K;  4X62 K;  1IBM K;  2UUC K;  2VQF K;  2UUA K;  4DR7 K;  4NXM K;  1XMQ K;  1HNX K;  4DV0 K;  4JI6 K;  1IBK K;  1N36 K;  4LF6 K;  4JI2 K;  3T1H K;  4KHP K;  2UXC K;  4X65 K;  1XMO K;  5FLX O;  1XNQ K;  4GKK K;  4YY3 K;  4DUY K;  2UXD K;  1XNR K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...