1HNWK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnwK00
4DV1K 4DR7K 4DV4K 3J7YP 3JAMO 4GKKK 4JI8K 4DR2K 5A2QO 1HNWK 4JI3K 1J5EK 4B3SK 4DV7K 4LF4K 5IT9O 4JV5K 4LFCK 1HR0K 5LMUK 4JI1K 2UXDK 5LL6Z 5LMNK 4DUZK 1IBKK 4DV0K 4DV2K 2VQEK 4YHHK 4JI5K 1IBLK 1IBMK 2HHHK 4JI0K 3J80O 4B3RK 4B3TK 2UUBK 1N33K 2UU9K 2VQFK 4JYAK 5FLXO 2UUAK 1I94K 3J81O 1FJGK 1HNZK 4DR3K 4LF7K 1XNQK 2UXCK 4LFBK 4DR1K 1XMQK 4B3MK 4X64K 2E5LK 4CVNE 1N32K 4KHPK 1N36K 4LF5K 4YY3K 3OTOK 2ZM6K 3J7AP 1XMOK 4DV3K 5BR8K 2UUCK 4JI7K 5IWAK 4DV6K 4LF6K 1N34K 4DV5K 5AJ3K 4CW7B 1XNRK 4LFAK 1HNXK 4AQYK 4K0KK 2UXBK 4DR4K 4X62K 2F4VK 4OX9K 4JI2K 4LF8K 4NXMK 3T1YK 4DUYK 3T1HK 4V19S 4NXNK 4DR5K 4JI6K 4X66K 4DR6K 4JI4K 4GKJK 4X65K 4LF9K
chains in the Genus database with same CATH superfamily
4NYNA 1OVYA 2WUSA 3VEOA 1E3MA 2E4LA 4I9LA 3P4IA 4W5RA 1JLGA 3ZSXA 3J7YP 3L2WA 3RWUA 5DM6L 4JRQA 4GKKK 5AQWA 3OYKA 3SLCA 3DOLA 4B9LA 1NMDA 3HP6A 4B8CA 3BP8A 3CC4N 4W5NA 1U2VB 4KV8A 1ZC6A 2VG5A 1C1CA 1VQPN 3I55N 3FFKB 3HSTB 2BANA 1JJ2M 3JSMA 1J53A 3V1QA 2P9NA 3D2FB 1ESVA 1VSDA 4H8KA 1QQOA 3JYTA 3CQ8A 3L3VA 5TKWA 4N5SA 2P9IB 2E8AA 4M3XA 4IFYA 4CEEA 3DLEA 3NBPA 1L3UA 3WEEB 5FLXO 1WSFA 3FFIA 3WNEA 1RBUA 1X9JA 3HOSA 1FJGK 2O8CB 3OYIA 1BWFO 3VQ9A 5HRPA 1V4SA 3VQCA 3QBWA 3OS0A 1LV5A 3EZWA 4BC2A 5ADXA 2FSJA 1C1BA 2P9SA 2YHYA 3NFAA 1RDAA 3D6RA 4DG1A 3LAKA 3QEIA 3CFRA 1QQNA 2RN2A 4M3TA 4E1JA 5BR8K 1JLFA 2AJQA 4JD2A 5BPLA 3AA2A 1XWLA 1NGEA 3E01A 1RT4A 4CIEA 4QS8A 3AVNA 1RT5A 3OW2M 4FSVA 3QEXA 2D1KA 2ZJQL 4WQ4C 1DT9A 3UKRA 1YJWN 1XNRK 4ILJA 5AFUA 2AA4A 1RBSA 3M1FA 4B1XB 3QB0A 4QS9A 1BQNA 2NRRA 4OPJA 3AGRA 1RT1A 3O3FA 2YCHA 3ZT0A 3THXB 4M3ZA 5SZTA 5F0XA 3NF6A 2P1JA 3VENA 3BZKA 4BREA 1KD1O 3AO1A 3SZ2A 4DWIA 3HT3A 2F9TA 3C7NB 1JCEA 1Y64A 4OGCA 1MWKA 4CF2A 4KHWA 2G8UA 3NH1A 3WT0A 4CZKA 3G71N 2FBVA 3ATVA 1HLUA 3VF4A 2HBJA 1KTQA 2WONA 5GAHP 3TAMA 1QQCA 3F9KA 2NRZA 4MDBA 3QDKA 4K8ZA 3L4QA 1VQMN 4YHHK 5JLHA 4JI5K 3DLRA 2YX6A 4BR7A 1N33K 1XQSC 4K8XA 5E84A 1W7AA 1YUWA 3PIOL 5AQHA 3F5TA 3HVTA 4BRCA 1TUUA 4BC3A 3ISNC 2XY5A 1EXQA 4FWNA 2QKBA 3SMSA 1JLAA 3CI5A 2D0PA 2F8TA 1JKHA 3O3GA 5AQIA 5BRDA 4LFBK 1WB9A 3KK1A 3ULEA 4M45A 3THYA 1ZBHA 3AA4A 1VAZA 1KLMA 1E4FT 3SUNA 1HPMA 4YDUA 5C12A 3THWB 3I0SA 3ZT1A 3ZSZA 3KIOA 3OYNA 3VA0A 4JEPA 2O8DA 1RT6A 3WXKA 4CZMA 1L3TA 1U48A 1YI2N 3M6GA 3QERA 3BF3A 3CCUN 3DLKA 1FXXA 3B8AX 1YVNA 2YKMA 3CF5L 1NG9A 3CMAN 3AV9A 4IBNA 1HYVA 3NHGA 4CZJA 5J2NA 1K6YA 3QO9A 2NRTA 4IOCL 1NGBA 4JI2K 2O8BA 2E1ZA 1S1UA 2ZWHA 3HOTA 4AM6A 1EWRA 4K41A 4F3OA 5I9EB 4DR6K 3IMXA 4XEIA 4W5QA 3HYFA 1IG9A 3PSIA 3V9WA 1RDBA 4A59A 3JAMO 3VN5A 3TI0A 5J2MA 2W6KA 4CZHA 3MECA 2A1SA 3DMJA 1SL2A 4JI3K 4FJ8A 4BDPA 3O3HA 5IT9O 4YOTA 1HX1A 1HMVA 1VQKN 5AQLA 3OYHA 3TABA 1ILYA 1HR0K 2BE2A 2HOEA 4J2BA 1QHAA 2VWJA 3QICA 2CGLA 4H5NA 3CPWM 3CCJN 1RTDA 5GADP 1UWBA 2O8EA 2BTFA 4CJTA 3I0RA 1BA0A 4E1MA 3OBYA 3ZT2A 2GV9A 3LAMA 3A5NC 4B1YB 3MN6A 3PX0A 3HPGA 2FBYA 4H0TB 2QA4N 4DB3A 4EHUA 3AVCA 3QFPA 1XNQK 1JL1A 3RR7A 4DSJA 1TGOA 3H3NO 3SJJA 2E2OA 2IAJA 2E5LK 1DKGD 1TV6A 4DF4A 3UIQA 1RTJA 1TK5A 4CGHA 2QWLA 3DXKA 5FPNA 1LW2A 2A5XA 3G4SN 4KI6A 4PL8A 3ITHA 3ASMA 4Y1DA 4J2AA 2Q2RA 3H1QA 3K9KA 3MEEA 3RSEB 1N34K 4XH4A 4A61A 3G25A 3ENOA 4OKJA 1S1VA 3K9JA 3QIOA 4DHYA 3CQYA 1UA1A 3QBXA 3OJSA 2H3GX 4HHTA 4FLTA 3DLBA 4H5WA 4FYDA 4LF8K 4FZYA 2P9KA 3MCAB 4IKFA 5HLFA 4FJMA 3IRXA 4H0XB 4CEAA 3CM6A 2HBKA 4F3TA 1I39A 1BISA 4M7YA 2PYLA 3QEWA 2IVNA 1VSJA 2PBDA 2QTDA 1IKXA 1LAVA 2QW9A 4IXCA 1Q8IA 4AHCA 3MMVA 3FZLA 4UY8O 1L3VA 1ZBFA 3OYCA 3VQEA 1NGIA 1RDDA 4CJQA 3KKSA 3H08A 3CJCA 4KKOA 1SAZA 3PSFA 1KVAA 4RW4A 5BRHA 5HOOA 4FJJA 4OLAA 4DSLA 2Z1IA 5DMRA 1X9MA 1TKDA 3F2KA 3LL3A 5CZ2A 2B6AA 5AQXA 5J1EA 1WSGA 4B9MA 1IV0A 1DTQA 2HW3A 2E20A 4I6MB 2I7NA 4FJ9A 3THVA 1LAWA 4AHUA 4B3MK 3K59A 1RFQA 3WXMB 4IO8A 3WNGA 4EIAA 4A5BA 4JN4A 2FF3B 3ZETB 1J54A 2ZM6K 4CJ7A 2CGJA 3AVGA 4OLBA 1VSMA 2FBXA 4CERA 3QLHA 4CK2A 3WXIA 3L4IA 3P39A 4H0PA 3O9QA 1JXBA 4DSKA 3I33A 2NRXA 3O9UA 5LJWA 2HBMA 4FWQA 4CBUA 4FWSA 1BG3A 3NCIA 1J9AA 4JHDB 3CFPA 1QQMA 1W97L 2NNWA 4WF9L 3NDKA 2P9PB 3MDQA 4OX9K 3TSPA 1CZAN 4AHVA 1S1XA 4BVOA 4DUYK 4ILGB 1BIUA 1JCFA 1BIZA 3LZIA 4FM2A 3VEZA 4Y1CA 4Z4EA 4NB4A 4FXDA 2QWNA 5J2PA 4JK7A 4X65K 5BR9A 4QS7A 2QK9A 3L6QA 4EZ6A 3V9ZA 5JMVA 2FSNA 1LWCA 2JGUA 1T3VA 2ZF5O 3U8XA 4DR2K 4AM7A 3M8QA 2VYPA 4KFBA 2HB5A 4H0OA 2GWJA 1XI1A 3V9SA 1GLJO 4LFCK 5JS1A 2UXDK 5FPDA 4MQ3A 3WUHA 1DLOA 4F2RA 5EVZA 3CQXA 4XH5A 3QEVA 1SQKA 3EE8A 4CZLA 2D4WA 3KKRA 3F73A 3SAGA 2VQFK 2UUAK 2GBZA 1KC8O 4KPYA 1MU2A 4CFCA 5SWMA 3V9UA 1HNZK 5I42A 1TYQA 2UXCK 2PZSA 1NKEA 3O9SA 1TVRA 4DKWA 1D9DA 1RDWX 3LM9A 3TANA 1HPZA 5AQTA 4MLEA 4PQUA 4XIUA 5AQZA 3OTOK 1TKXA 2D0BA 3OYFA 5GAGP 4LC9B 4FWLA 4MO4A 5EY4A 4DTSA 1WBBA 1HNIA 4A5AA 3N4PA 2HMPA 3VF6A 4KRFA 1JLBA 2UYTA 3FE1A 1T6DA 2F96A 4FWKA 1UA0A 1P90A 5AJ3K 3O5BA 2YHXA 4CJ4A 1VRUA 1A5WA 4U7BA 3NE6A 3UKUB 4BROA 4B1WB 4CEQA 2HNYA 1HNXK 2E1YA 4HTLA 1B9DA 3PO5A 2RPIA 2GELA 1ATNA 1EWQA 3R8EA 2RF2A 3RVCA 1RILA 2ZQBA 2A40A 2IVOA 1Y97A 2X6NA 3UE5A 4ZHRA 5KRSA 4FJ7A 4LF9K 2WFBA 3AVHA 3QIPA 4NLCA 3AVLA 2PAVA 3LANA 3ZSOA 4DLGA 1YT3A 4ZTFA 1ITGA 4BRQA 5AQRA 4JI8K 3CPEA 3HTVA 4BC5A 4RCHA 3AARA 2QEXN 4JKGA 1RT7A 1TKTA 4E7HA 1CLQA 4B3SK 5AZJB 1WSEA 2YJEA 5EU7A 2E6LA 1XHXA 3VQQA 5AQFA 4FLUA 4FWRA 3I56N 1RDUA 4CJ5A 4FVMA 4OPKA 4JKEA 3OYMA 3A5LC 4DQSA 3ZX3A 5HRRA 2P9LB 4A62A 3J7ZO 2NZTA 3AVIA 1NOZA 4CCHA 3U9DA 5LJVA 1YHQN 1SKRA 4KHUA 2XY7A 3T69A 4JYAK 2RKIA 3EE9A 4CEDA 4EP5A 1R0AA 3DXKB 3EKSA 4CHNA 4CHPA 4LF7K 2Q0RA 1EP4A 3ZT3A 1XMQK 3T7ZA 4DQIA 3RMCA 3WNHA 5CR4A 1WSJA 3DI6A 3AA3A 3SCXA 4KTWA 1HYSA 1KVCA 4CEFA 4B08A 4JAXA 3OS2A 2A6AA 1OH8A 1GLLO 3EYZA 4H4MA 4RTFD 1K8KA 4BE2A 1Q18A 4Y0WA 3O6WA 4B9UA 5BN9A 2JWKA 4IDHA 1LW0A 1ATSA 4O0IA 4DFPA 1QSLA 4IOXA 4B1UB 1E4GT 5C24A 1WLJA 1HYZA 5CYMA 4CJSA 3VA3A 1D5AA 4DR5K 2BH1A 4E7JA 3ZX2A 3C95A 3ZX0A 3R1XA 4GY2B 4FWPA 1GOBA 4B9SA 5C2DA 2IIRA 2V7YA 4MDAA 2I7PA 1C1AA 3DM2A 4BRIA 3ALYA 3N4QA 4M42A 4LD0A 5GIPA 2EWSA 1BCMA 1JLCA 4CFDA 3VQDA 4CJPA 1BU6O 1A5VA 3L0QA 3GDQA 5BREA 3KK7A 1J5EK 4BRPA 4BGBA 2G8VA 5AQVA 4CZFA 5AQUA 3SUPA 4C1NK 2LSNA 5AQSA 4FJLA 3MAQA 1HJRA 3GE1A 4KREA 3C6AA 4EHTA 2G8WA 2OANA 4FM0A 3TAQA 3P38A 1YTUA 1BCOA 2W6LA 1KVBA 2P9UA 4PKHA 2GUIA 3OJUA 1ZBSA 4N41A 4GV3A 3IUCA 3AA5X 4B3TK 1VQ6N 2IGIA 3AO3A 3ZSWA 4K43A 4CGJA 5F1XA 1O13A 3VTHA 4BACA 1CZBA 5M1OA 4DCHA 4U67L 3BY5A 4K42A 4IWVA 3KLHA 5AQNA 3MX2A 4C23A 4BWJA 1T7PA 3CJ9A 3DLGA 3DXMA 3M5RA 3AAPA 1MWMA 2FC0A 3H46O 2XO7A 4I2PA 1IJJA 4KHPK 4LF5K 2HBLA 1YJNN 1BI4A 2NRHA 4CJ3A 4CIFA 1U04A 1X9SA 4YNQA 4DTOA 4B3OA 4DSFA 1VQON 2BUPA 1S1WA 2UUCK 4JI7K 4O8KA 5KI6A 4JKFA 3HM8A 4A2AA 4CIGA 2FBTA 4BG9A 2XY6A 2X78A 3QNNA 2RE2A 4N56A 4DV5K 3NGYA 4EZ9A 3RTVA 2Z1GA 3O1WA 1V4TA 3IS9A 3JS6A 5AQMA 3G0ZA 4YOUA 2FF6A 4EP4A 4L8RB 3ID8A 4DR4K 1HQEA 3W3DA 4PA1A 3A2FA 3FLCO 3TAPA 1NJXA 2F8SA 3C6TA 1X3MA 3VGLA 1ZBLA 2E88A 3QMLA 1N5YA 1RBRA 3ZSQA 3AY9A 4PKIA 3VQPA 4FLYA 1U49A 4HCBA 4BG8A 3L2UA 1OH5A 1VQNN 4DV1K 4FW2A 2ATQA 1OH7A 2E6MA 2YHAA 3ZSVA 4C8NA 5DM7L 5FROA 4CJLA 1OKJA 3NF7A 2IC3A 2DPNA 3O4NA 4IO9L 3S9HA 3FR0A 1HNWK 4CESA 2FSKA 4CGFA 3DYAA 4BGAA 2HHWA 4BRAA 4JV5K 5EOYA 1X3NA 4JKCA 3K5OA 1SZ2A 3QETA 2QWQA 3HM9A 1MDUB 3CM5A 2G8IA 3LZJA 3VETA 4FVUA 5C15A 5HRNA 4WFNL 3O9TA 3MXMA 4B3RK 1Q9XA 3OS1A 5AZIA 4RWTA 1N6QA 5AQJA 2O8FB 3CJ1A 2FXUA 1QZ6A 3AVMA 2YV0X 4KHSA 4FLWA 2AP1A 3VQAA 3BDPA 2Q0UA 2YJFA 5CYQA 1MA9B 2VCPA 1W9HA 1RGIA 4X64K 1ZBIA 4E7LA 2P51A 4I9QA 4YOXA 3MWPA 2D0OA 4JK9A 1VK0A 3VEWA 2BGGA 3J7AP 3L2RA 2KFNA 3PO4A 2YKNA 5HBMA 5JLFA 1ZXOA 5T7BA 2A1RA 2HNDA 2G8FA 3O9RA 2QWOA 3D2EA 2YNHA 2QWPA 3KD5E 4O4GA 1RNHA 4CZIA 1IO2A 4EAHD 4LFAK 3SPZA 4AH9A 5M1QA 3P1GA 4DQ8A 3KK3A 3HPOA 2CH6A 5KPTA 4BRHA 3OHRA 3OYBA 3KHYA 3T1YK 3U3GA 1GLCG 5KQDA 3P83D 3C6UA 4WQ5C 1M90O 5AR0A 4E19A 1S1TA 2Q36A 1U2VA 4JKGB 3RR8A 1JXEA 3AO4A 3M8RA 3HL8A 2WTUA 5AQKA 3TAFA 1W2BM 1NGAA 3RMBA 2I5JA 5JVHL 4Q0BA 1HQUA 3AO2A 4BRFA 4CECA 1BOTO 2VWKA 4FOEA 4HCCA 4J2DA 3QEPA 3D2FA 2HHTA 4DV7K 2E2PA 4Z4HA 4OKKA 4M3RA 1Q81O 2Z1JA 4Q5VA 3KLIA 1C0UA 4CK1A 2P9IA 3KWIA 3A5MC 1YTAA 4DS5A 3CIPA 5I3UA 3WEEA 1IBKK 4M7XA 4CD1A 4DV0K 3S3MA 1TKZA 4CBXA 3WXJA 1G99A 2O8CA 3LP2A 1RTIA 3A8YA 2HSTA 1S22A 4BDYA 2IS3A 2HNZA 4BR4A 4DTUA 1LCUA 4BR0A 3H6EA 4ILHA 5C10A 2P9NB 4FJIA 1FKPA 5KRTA 1QE1A 3J81O 4CFAA 3NH2A 1NKCA 3MN7A 3MEDA 4DR1K 4JKHA 3R9PA 4ID5A 3VEXA 3OY9A 3SNNA 3O8MA 4CVNE 2RHKA 4NCBA 2OTLN 3A5OC 2V7ZA 3PLAA 1EX4A 3HI0A 1WN7A 4G9ZA 3LM2A 4DSIA 4RG8A 4FLZA 1XMOK 2GX9A 2WOMA 3U9ZA 3VQ6A 1GLDG 4DSEA 3KLGA 1B92A 1T6CA 3PY8A 1ZYQA 2P9SB 3LPTA 4F2SA 3NMUA 1XUPO 2QXFA 1Q86O 5DK5A 2OCEA 4Z4IA 4JD2B 3OA9A 1WOQA 3D0PA 1VRTA 4CBWA 2VG7A 4X62K 3E1YA 3BZCA 3NF9A 3AGKA 4NXMK 1UAXA 3THXA 1NOYA 1RBVA 4JNEA 3UKRB 4IDKA 4IG0A 4BRDA 4NCGA 4KHQA 1C0TA 3C7NA 1RBTA 2GUPA 3EZ5A 4FM1A 1KQSM 3ZEUA 1K73O 2KQ2A 1WSIA 4LSLA 2HHUA 4ISGA 3TAGA 4BVPA 1TK8A 5AQQA 3KVGA 3P5JA 4FWMA 1VQ8N 3VPZA 4DQPA 3GG4A 4OGEA 3TTDA 3BGRA 3MWTA 5EX5A 2OYQA 5FRNA 1LOTB 2GEMA 3E9LA 4DUZK 4E7KA 4PL7A 4IG3A 2D0CA 4CEZA 1NJZA 4L3QA 1JCGA 3K5LA 4CGDA 1S72N 1U47A 3TSUA 1NU0A 3U4LA 5MLCQ 3DOKA 4MFBA 2P5GA 4KTQA 1HJOA 2A3ZA 4JKBA 1KSPA 4MLHA 2YHWA 1C0FA 3AVBA 3THWA 5M1PA 4FJXA 1BI4B 1XC9A 4RW7A 3SAHA 3SBTA 2B4JA 3KZBA 2EX3A 4IJNA 4CF1A 4IFVA 1QTMA 1TAQA 2NRVA 2JLEA 2HHVA 1GLFO 2E2NA 4CF8A 3VGKA 1SV5A 3H3OB 3R6MA 4Z4GA 4WFAL 4H5RA 3ULEB 2E2QA 4DFJA 3THYB 3ZLJA 3T3FA 3ZSYA 4FK4A 2NLXA 1KAYA 2YI1A 3AO5A 3P31A 2O8DB 4H0VB 4OVLA 3WNFA 2G8KA 1S6QA 3KJVA 1KAZA 4I7FA 2IDOA 3PV8A 2ZE2A 1ASUA 1QVFM 3ENHA 2ITGA 3BEXA 4NXNK 2FLOA 1TUYA 5ELZA 3TU5A 4DTRA 3IKMA 3RMAA 3CD6N 1EO1A 2W40A 4DLEA 2KZZA 3F9MA 3SUQA 2O8BB 3MN5A 4DS4A 3DWLA 4DV4K 2HHXA 1BA1A 2KW4A 4GW6A 2D0AA 2Q31A 1BQMA 3NVMA 1KFSA 4LH5A 4B1VA 4PHTX 1HNVA 3OBWA 3CG7A 3J8AA 1DGKN 4YDUC 5B8HA 5A2QO 4W5TA 3HP9A 1VQLN 1KAXA 1TL3A 1LWEA 2KLAA 3VQ4A 3V81A 1Q7YO 3C65A 4BRLA 3HO1A 3CCQN 4FJGA 3PX6A 3CFOA 3VTIA 1XHZA 1VSKA 2VQEK 4HWIA 2OPRA 3VF2A 3LALA 1FKOA 3LDPA 4FLXA 1NGCA 5JICA 2UUBK 1NJWA 1QHTA 5J2QA 3EL2A 1KFDA 4FJNA 4CJFA 2Y1JA 2V52B 3H1VX 5BRFA 5D3GA 4CFBA 3MXIA 1NNEA 2O8EB 3FGUA 3NGIA 2QKKA 2X74A 3DRRA 3S41A 1A5XA 3CYMA 1T8EA 3WQUA 5CY4A 3RSEA 4YY3K 2ZD1A 3U6FA 4CJVA 1L3SA 1BUPA 4HUGA 3M8PA 4F4KA 1U45A 3WXLA 3K58A 4CI6A 1VQ5N 1C6VA 3CERA 4O5BA 4FL9A 2F9WA 5JVGL 3TPQA 1FW6A 2DFHA 2X6SA 4PY5A 1IH7A 1SUQA 3OYGA 1SL1A 3LDOA 3TTFA 2OPPA 4R79A 3SPYA 4K0KK 2UXBK 1Z05A 3KLFA 4DU1A 4BDZA 1BHLA 1N8RO 5FRMA 2YNGA 4F9OA 5KGXA 3HSCA 2ASPA 3LDLA 1Q82O 1RT3A 2YNIA 4JI4K 4IJAA 3DRPA 3O4WA 4GMJB 2HVHA 1NGJA 3E66A 4DR7K 4RW9A 5EXWA 3VQ7A 4BR2A 2HHQA 2XHBA 2P9KB 4GVMA 3KK2A 3SK3A 3T1AA 1GLAG 4BRMA 1WAFA 4CGGA 3IDHA 4C8KA 4O55A 2P5OA 1B9FA 5BPNA 3AVAA 2ZGYA 4CD3A 4KTZA 1VHXA 3SAFA 1NK8A 2OZMA 3SV3A 2NUBA 1REVA 3WQTA 5M1KA 4QCLA 1CXQA 1D8YA 1WSHA 4DV2K 1UOCA 4FPAA 3CMEN 1NGHA 4NYFA 5C42A 3J80O 4BQLA 4FJ5A 1TK0A 4I6MA 4JS5A 1QSYA 2HVIA 1NJIO 2UU9K 3L3UA 1HRHA 3GBTA 3LPUA 3ZETA 4KH5A 1HUXA 4DR3K 1GLBG 3CCRN 1SKSA 2KHOA 5KTQA 4YOWA 1S9EA 4ID1A 3TARA 4FOIA 1NGGA 1NWKA 2V51B 3TR8A 4GVEA 1R59O 4NCAA 1D9FA 4JHDA 4CHYA 2W42A 4LH4A 4BRGA 3NF8A 4CJRA 3ENBA 3K0SA 2P9PA 3I8BA 2HF3A 3UB5A 2PYJA 3SQ4A 4AF1A 4AHRA 4CW7B 1C0GA 3VQ8A 4AHSA 1GOAA 4B1ZA 1JLEA 1ASWA 2W41A 4CJKA 4YFUA 4KB0A 3ZEUB 2Q1NA 5CE3A 2KKZA 1YAGA 2HMIA 4KHYA 4PKGA 4JI6K 4C8LA 5ADXH 3H45C 3V6DA 3SV4A 1D4XA 4CJUA 3V1RA 4RW6A 2ZGZA 1NK9A 3IAYA 4DTJA 1NBWA 4H5VA 1JL2A 3VGMA 3KLEA 3OYDA 3DJCA 3QINA 3EO3A 3ATUA 4GNIA 2OZSA 4DU3A 3U3YA 3CCMN 5BN8A 5AFUH 1P8ZA 4O8UA 3GL1A 3ZSRA 1C0MA 3OYJA 3SYZA 2VGMA 4JI1K 3FZMA 5LMNK 3T19A 3SMPA 5CHIA 1NLVA 4DTPA 2HF4A 1OH6A 3K5MA 1EETA 4OO1J 3HBTA 2HHHK 4WFBL 1H1VA 2ITMA 1VQ7N 3C94A 3ZCMA 3LP3A 1KLNA 4ELVA 3AVJA 2Z1HA 1U6ZA 3HRGA 3QNOA 4JLHA 4I2QA 4EFHA 4HUEA 1X9WA 3ID6A 4DTNA 3FZFA 3GOIA 1NK7A 3VMFB 4TSXA 4KAZA 4E0DA 4CEBA 3TSQA 2ASMA 3DAWA 1RT2A 1DEJA 3D7EO 4KH4A 5TKYA 3SJHA 2XY8A 3M3ZA 3VEVA 1TYQB 2ZJRL 4O44A 1WBDA 4H03B 3NVKA 4CEOA 4DV3K 3UKUA 4E3SA 4IFEA 4BR5A 3K57A 4BY9C 1BGXT 3Q7CA 4ISEA 4J2EA 1KXPA 3OYAA 2BDPA 3RMDA 3LWLA 3E9PA 1VSHA 4QOZB 3MK6A 3O4QA 1VSEA 2YHBA 4OPHA 1IKYA 3IG1A 4FO0A 1NM1A 4M3YA 2VG6A 5AQOA 4M41A 1WAJA 2CH5A 1WUAA 4CK3A 1NK0A 4B9QA 3DRSA 3MX5A 3RRGA 3R3LA 3DLLL 5HROA 5AZJA 3CCEN 2VGNA 2KZMA 3KD1E 3HXMA 3B6PA 3TWHA 1Q9YA 2O4GA 4ISFA 1RDCA 3JXUA 4KB1A 1O1WA 4DQQA 4JK8A 1T03A 2P9LA 1TAUA 1JLQA 5JS2A 5AQYA 3L2VA 3CJAA 3TTCA 1BDGA 4BE1A 4MO5A 5LMUK 5LL6Z 1X1PA 2Y1IA 2NRWA 4B9VA 4IEIA 4DU4A 1K8AO 1J6ZA 1NGFA 3L8BA 1CXUA 3LDSA 3MCPA 1IBLK 2JWLA 3CC7N 3NH0A 4N76A 4H4OA 4B8AB 5HL7L 3HJFA 4YORA 3NAEA 2Q97A 4CJEA 1M1KO 4FW1A 4HVJA 4FZZA 4YOVA 3M8SA 1IG8A 2DTUA 1VQ9N 1S5JA 2YNFA 2XRIA 4OPAA 2A41A 4CHQA 3PX4A 5GAEP 3LP1A 4DFMA 4WQ4A 5GINA 2OPSA 4B9TA 4YOYA 1Z26A 3KWGA 3TAEA 4IOAL 2ETJA 1NJYA 2DFFA 4HUFA 3MXJA 1IKWA 1N36K 4JRPA 3OYLA 4DMNA 4F8RA 4FLVA 1EKEA 4CF0A 4A2BA 2VWBA 3V1OA 3C6HA 3V9XA 4LSNA 5IWAK 1NMNA 4JKAA 3Q7BA 4LY7A 5FPEA 1T05A 5GIOA 2B5JA 5E41A 3IFRA 1YIJN 5M1NA 3L2QA 2WC9A 1IKVA 2F7TA 5H1SQ 1S6PA 3S3NA 1K8KB 3SBGA 2IVPA 1NK6A 1Z6RA 4FK0A 3CC2N 4H5TA 5FDLA 1TL1A 4FCYA 1BO5O 4CZGA 1S3XA 1G15A 3W0LA 2DFEA 1BL3A 2QI2A 4KBOA 3CHWA 1Z25A 1KCFA 1SS6A 4KH6A 1K9MO 2D5RA 3B6OA 1GOCA 3E9OA 5BPMA 2OA8A 1OVQA 5KPRA 1XC3A 1J5OA 1YITN 3OYEA 3EEQA 1VSFA 3FZKA 4LF4K 3K2PA 4XH1A 3BUZB 1RTHA 5LY3A 4O0JA 1U4BA 4H0YB 5FPMA 3VQBA 5K14A 3HPHA 3O08A 5F2RA 1YXQA 4CJWA 3D45A 1IBMK 4JKDA 4RW8A 1NK5A 4JS4A 1QVGM 3ULDA 5HP1A 4KI4A 3HK2A 2IOCA 3RRHA 1I94K 2P9UB 2G8HA 3MEGA 2EHGA 4OJRA 4E89A 3VQ5A 1FK9A 4IEEA 5C0YA 4W5OA 4FK2A 1ATRA 5KPZA 3QFUA 4WCEL 4CGIA 4N47A 4CF9A 4KHNA 1VSLA 4HTUA 4WE1A 4FPBA 3DXMB 1QS4A 3EN9A 5E26A 1T44A 3CCSN 3SI6A 3AAQA 3I8DA 3A0IX 3CXCM 4LF6K 3AVKA 4CHZA 1SKWA 3AVFA 1SL0A 2WBNA 2GTDA 1DTTA 4NO7A 2KTQA 4G1QA 3DLHA 3LWMA 4BC4A 3BF1A 4PWDA 5KGWA 5M1FA 1KRPA 4BRNA 4CE9A 4B9NA 4ICLA 1YVUA 3LP0A 1ZBUA 4DFKA 1QZ5A 4M63C 2ZJPL 4Z4CA 4V19S 3SUOA 2CGKA 4M3WA 4DTXA 3EY1A 4GV6A 1WNSA 4KO0A 3PIPL 2DY4A 4FJKA 3SQ1A 1I3AA 3MN9A 4AHTA 3NGZA 3ZT4A 1S9GA 1RCHA 4Z94A 1LWFA 2KFZA 5KQ8A 3LDQA 4M3UA 2OTJN 3VERA 2QWRA 4BQZA 4A57A 4BR9A 3SQ2A 4FZXC 4BRKA 1ASVA 1YJ9N 4CZEA 1NGDA 5CZ1A 4DTMA 3G6EN 2R7YA 1F21A 2O8FA 4FJHA 3VEYA 4NLBA 1YF5L 2OPQA 1NKBA 4ELUA 2QXLA 4PUOA 3PUFA 2J4RA 4FWOA 4UQGA 4JI0K 3CETA 1L5UA 1VQ4N 2QWMA 4BWMA 4GV9A 3SQ0A 3CCLN 3HZ6A 4WQ5A 3V4IA 4E7IA 4E1NA 3O80A 5C25A 1HKCA 2PY5A 4Z4FA 5AZIB 4ELTA 3VESA 1EQYA 3CCVN 4O5FA 1HKBA 3QESA 1N32K 1W0HA 3LDNA 2QM1A 2ASOA 3G10A 1QSSA 3VOVA 3HVRA 5HRSA 3O1BA 4C1NI 3ZYYX 4DF8A 4CHOA 2GWKA 3CJBA 3CJ7A 1HKGA 4AILC 4C8MA 4DV6K 2Q3SA 2PFUA 4J8FA 1CZ9A 3C0BA 4WYBA 4IZ9A 3K5NA 4BE0A 5C2FA 4C8OA 5AQGA 4DQRA 1NK4A 4AQYK 2O4IA 3EKUA 2F4VK 5AQPA 4QAGA 3D2EB 3S3OA 4OKEA 4R5PA 3T1HK 2A42A 1VSIA 4ZTJA 3FZHA 4K25A 3OVNA 4X66K 3KTQA 1GLEG 4GKJK 2HHSA 4Z0UA
chains in the Genus database with same CATH topology
4DV1K 4DR7K 4DV4K 3J7YP 3JAMO 4GKKK 4JI8K 4DR2K 5A2QO 1HNWK 4JI3K 1J5EK 4B3SK 4DV7K 4LF4K 5IT9O 4JV5K 4LFCK 1HR0K 5LMUK 4JI1K 2UXDK 5LL6Z 5LMNK 4DUZK 1IBKK 4DV0K 4DV2K 2VQEK 4YHHK 4JI5K 1IBLK 1IBMK 2HHHK 4JI0K 3J80O 4B3RK 4B3TK 2UUBK 1N33K 2UU9K 2VQFK 4JYAK 5FLXO 2UUAK 1I94K 3J81O 1FJGK 1HNZK 4DR3K 4LF7K 1XNQK 2UXCK 4LFBK 4DR1K 1XMQK 4B3MK 4X64K 2E5LK 4CVNE 1N32K 4KHPK 1N36K 4LF5K 4YY3K 3OTOK 2ZM6K 3J7AP 1XMOK 4DV3K 5BR8K 2UUCK 4JI7K 5IWAK 4DV6K 4LF6K 1N34K 4DV5K 5AJ3K 4CW7B 1XNRK 4LFAK 1HNXK 4AQYK 4K0KK 2UXBK 4DR4K 4X62K 2F4VK 4OX9K 4JI2K 4LF8K 4NXMK 3T1YK 4DUYK 3T1HK 4V19S 4NXNK 4DR5K 4JI6K 4X66K 4DR6K 4JI4K 4GKJK 4X65K 4LF9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 K;  4DR7 K;  4DV4 K;  3J7Y P;  3JAM O;  4GKK K;  4JI8 K;  4DR2 K;  5A2Q O;  1HNW K;  4JI3 K;  1J5E K;  4B3S K;  4DV7 K;  4LF4 K;  5IT9 O;  4JV5 K;  4LFC K;  1HR0 K;  5LMU K;  4JI1 K;  2UXD K;  5LL6 Z;  5LMN K;  4DUZ K;  1IBK K;  4DV0 K;  4DV2 K;  2VQE K;  4YHH K;  4JI5 K;  1IBL K;  1IBM K;  2HHH K;  4JI0 K;  3J80 O;  4B3R K;  4B3T K;  2UUB K;  1N33 K;  2UU9 K;  2VQF K;  4JYA K;  5FLX O;  2UUA K;  1I94 K;  3J81 O;  1FJG K;  1HNZ K;  4DR3 K;  4LF7 K;  1XNQ K;  2UXC K;  4LFB K;  4DR1 K;  1XMQ K;  4B3M K;  4X64 K;  2E5L K;  4CVN E;  1N32 K;  4KHP K;  1N36 K;  4LF5 K;  4YY3 K;  3OTO K;  2ZM6 K;  3J7A P;  1XMO K;  4DV3 K;  5BR8 K;  2UUC K;  4JI7 K;  5IWA K;  4DV6 K;  4LF6 K;  1N34 K;  4DV5 K;  5AJ3 K;  4CW7 B;  1XNR K;  4LFA K;  1HNX K;  4AQY K;  4K0K K;  2UXB K;  4DR4 K;  4X62 K;  2F4V K;  4OX9 K;  4JI2 K;  4LF8 K;  4NXM K;  3T1Y K;  4DUY K;  3T1H K;  4V19 S;  4NXN K;  4DR5 K;  4JI6 K;  4X66 K;  4DR6 K;  4JI4 K;  4GKJ K;  4X65 K;  4LF9 K; 
#chains in the Genus database with same CATH topology
 4NYN A;  1OVY A;  2WUS A;  3VEO A;  1E3M A;  2E4L A;  4I9L A;  3P4I A;  4W5R A;  1JLG A;  3ZSX A;  3J7Y P;  3L2W A;  3RWU A;  5DM6 L;  4JRQ A;  4GKK K;  5AQW A;  3OYK A;  3SLC A;  3DOL A;  4B9L A;  1NMD A;  3HP6 A;  4B8C A;  3BP8 A;  3CC4 N;  4W5N A;  1U2V B;  4KV8 A;  1ZC6 A;  2VG5 A;  1C1C A;  1VQP N;  3I55 N;  3FFK B;  3HST B;  2BAN A;  1JJ2 M;  3JSM A;  1J53 A;  3V1Q A;  2P9N A;  3D2F B;  1ESV A;  1VSD A;  4H8K A;  1QQO A;  3JYT A;  3CQ8 A;  3L3V A;  5TKW A;  4N5S A;  2P9I B;  2E8A A;  4M3X A;  4IFY A;  4CEE A;  3DLE A;  3NBP A;  1L3U A;  3WEE B;  5FLX O;  1WSF A;  3FFI A;  3WNE A;  1RBU A;  1X9J A;  3HOS A;  1FJG K;  2O8C B;  3OYI A;  1BWF O;  3VQ9 A;  5HRP A;  1V4S A;  3VQC A;  3QBW A;  3OS0 A;  1LV5 A;  3EZW A;  4BC2 A;  5ADX A;  2FSJ A;  1C1B A;  2P9S A;  2YHY A;  3NFA A;  1RDA A;  3D6R A;  4DG1 A;  3LAK A;  3QEI A;  3CFR A;  1QQN A;  2RN2 A;  4M3T A;  4E1J A;  5BR8 K;  1JLF A;  2AJQ A;  4JD2 A;  5BPL A;  3AA2 A;  1XWL A;  1NGE A;  3E01 A;  1RT4 A;  4CIE A;  4QS8 A;  3AVN A;  1RT5 A;  3OW2 M;  4FSV A;  3QEX A;  2D1K A;  2ZJQ L;  4WQ4 C;  1DT9 A;  3UKR A;  1YJW N;  1XNR K;  4ILJ A;  5AFU A;  2AA4 A;  1RBS A;  3M1F A;  4B1X B;  3QB0 A;  4QS9 A;  1BQN A;  2NRR A;  4OPJ A;  3AGR A;  1RT1 A;  3O3F A;  2YCH A;  3ZT0 A;  3THX B;  4M3Z A;  5SZT A;  5F0X A;  3NF6 A;  2P1J A;  3VEN A;  3BZK A;  4BRE A;  1KD1 O;  3AO1 A;  3SZ2 A;  4DWI A;  3HT3 A;  2F9T A;  3C7N B;  1JCE A;  1Y64 A;  4OGC A;  1MWK A;  4CF2 A;  4KHW A;  2G8U A;  3NH1 A;  3WT0 A;  4CZK A;  3G71 N;  2FBV A;  3ATV A;  1HLU A;  3VF4 A;  2HBJ A;  1KTQ A;  2WON A;  5GAH P;  3TAM A;  1QQC A;  3F9K A;  2NRZ A;  4MDB A;  3QDK A;  4K8Z A;  3L4Q A;  1VQM N;  4YHH K;  5JLH A;  4JI5 K;  3DLR A;  2YX6 A;  4BR7 A;  1N33 K;  1XQS C;  4K8X A;  5E84 A;  1W7A A;  1YUW A;  3PIO L;  5AQH A;  3F5T A;  3HVT A;  4BRC A;  1TUU A;  4BC3 A;  3ISN C;  2XY5 A;  1EXQ A;  4FWN A;  2QKB A;  3SMS A;  1JLA A;  3CI5 A;  2D0P A;  2F8T A;  1JKH A;  3O3G A;  5AQI A;  5BRD A;  4LFB K;  1WB9 A;  3KK1 A;  3ULE A;  4M45 A;  3THY A;  1ZBH A;  3AA4 A;  1VAZ A;  1KLM A;  1E4F T;  3SUN A;  1HPM A;  4YDU A;  5C12 A;  3THW B;  3I0S A;  3ZT1 A;  3ZSZ A;  3KIO A;  3OYN A;  3VA0 A;  4JEP A;  2O8D A;  1RT6 A;  3WXK A;  4CZM A;  1L3T A;  1U48 A;  1YI2 N;  3M6G A;  3QER A;  3BF3 A;  3CCU N;  3DLK A;  1FXX A;  3B8A X;  1YVN A;  2YKM A;  3CF5 L;  1NG9 A;  3CMA N;  3AV9 A;  4IBN A;  1HYV A;  3NHG A;  4CZJ A;  5J2N A;  1K6Y A;  3QO9 A;  2NRT A;  4IOC L;  1NGB A;  4JI2 K;  2O8B A;  2E1Z A;  1S1U A;  2ZWH A;  3HOT A;  4AM6 A;  1EWR A;  4K41 A;  4F3O A;  5I9E B;  4DR6 K;  3IMX A;  4XEI A;  4W5Q A;  3HYF A;  1IG9 A;  3PSI A;  3V9W A;  1RDB A;  4A59 A;  3JAM O;  3VN5 A;  3TI0 A;  5J2M A;  2W6K A;  4CZH A;  3MEC A;  2A1S A;  3DMJ A;  1SL2 A;  4JI3 K;  4FJ8 A;  4BDP A;  3O3H A;  5IT9 O;  4YOT A;  1HX1 A;  1HMV A;  1VQK N;  5AQL A;  3OYH A;  3TAB A;  1ILY A;  1HR0 K;  2BE2 A;  2HOE A;  4J2B A;  1QHA A;  2VWJ A;  3QIC A;  2CGL A;  4H5N A;  3CPW M;  3CCJ N;  1RTD A;  5GAD P;  1UWB A;  2O8E A;  2BTF A;  4CJT A;  3I0R A;  1BA0 A;  4E1M A;  3OBY A;  3ZT2 A;  2GV9 A;  3LAM A;  3A5N C;  4B1Y B;  3MN6 A;  3PX0 A;  3HPG A;  2FBY A;  4H0T B;  2QA4 N;  4DB3 A;  4EHU A;  3AVC A;  3QFP A;  1XNQ K;  1JL1 A;  3RR7 A;  4DSJ A;  1TGO A;  3H3N O;  3SJJ A;  2E2O A;  2IAJ A;  2E5L K;  1DKG D;  1TV6 A;  4DF4 A;  3UIQ A;  1RTJ A;  1TK5 A;  4CGH A;  2QWL A;  3DXK A;  5FPN A;  1LW2 A;  2A5X A;  3G4S N;  4KI6 A;  4PL8 A;  3ITH A;  3ASM A;  4Y1D A;  4J2A A;  2Q2R A;  3H1Q A;  3K9K A;  3MEE A;  3RSE B;  1N34 K;  4XH4 A;  4A61 A;  3G25 A;  3ENO A;  4OKJ A;  1S1V A;  3K9J A;  3QIO A;  4DHY A;  3CQY A;  1UA1 A;  3QBX A;  3OJS A;  2H3G X;  4HHT A;  4FLT A;  3DLB A;  4H5W A;  4FYD A;  4LF8 K;  4FZY A;  2P9K A;  3MCA B;  4IKF A;  5HLF A;  4FJM A;  3IRX A;  4H0X B;  4CEA A;  3CM6 A;  2HBK A;  4F3T A;  1I39 A;  1BIS A;  4M7Y A;  2PYL A;  3QEW A;  2IVN A;  1VSJ A;  2PBD A;  2QTD A;  1IKX A;  1LAV A;  2QW9 A;  4IXC A;  1Q8I A;  4AHC A;  3MMV A;  3FZL A;  4UY8 O;  1L3V A;  1ZBF A;  3OYC A;  3VQE A;  1NGI A;  1RDD A;  4CJQ A;  3KKS A;  3H08 A;  3CJC A;  4KKO A;  1SAZ A;  3PSF A;  1KVA A;  4RW4 A;  5BRH A;  5HOO A;  4FJJ A;  4OLA A;  4DSL A;  2Z1I A;  5DMR A;  1X9M A;  1TKD A;  3F2K A;  3LL3 A;  5CZ2 A;  2B6A A;  5AQX A;  5J1E A;  1WSG A;  4B9M A;  1IV0 A;  1DTQ A;  2HW3 A;  2E20 A;  4I6M B;  2I7N A;  4FJ9 A;  3THV A;  1LAW A;  4AHU A;  4B3M K;  3K59 A;  1RFQ A;  3WXM B;  4IO8 A;  3WNG A;  4EIA A;  4A5B A;  4JN4 A;  2FF3 B;  3ZET B;  1J54 A;  2ZM6 K;  4CJ7 A;  2CGJ A;  3AVG A;  4OLB A;  1VSM A;  2FBX A;  4CER A;  3QLH A;  4CK2 A;  3WXI A;  3L4I A;  3P39 A;  4H0P A;  3O9Q A;  1JXB A;  4DSK A;  3I33 A;  2NRX A;  3O9U A;  5LJW A;  2HBM A;  4FWQ A;  4CBU A;  4FWS A;  1BG3 A;  3NCI A;  1J9A A;  4JHD B;  3CFP A;  1QQM A;  1W97 L;  2NNW A;  4WF9 L;  3NDK A;  2P9P B;  3MDQ A;  4OX9 K;  3TSP A;  1CZA N;  4AHV A;  1S1X A;  4BVO A;  4DUY K;  4ILG B;  1BIU A;  1JCF A;  1BIZ A;  3LZI A;  4FM2 A;  3VEZ A;  4Y1C A;  4Z4E A;  4NB4 A;  4FXD A;  2QWN A;  5J2P A;  4JK7 A;  4X65 K;  5BR9 A;  4QS7 A;  2QK9 A;  3L6Q A;  4EZ6 A;  3V9Z A;  5JMV A;  2FSN A;  1LWC A;  2JGU A;  1T3V A;  2ZF5 O;  3U8X A;  4DR2 K;  4AM7 A;  3M8Q A;  2VYP A;  4KFB A;  2HB5 A;  4H0O A;  2GWJ A;  1XI1 A;  3V9S A;  1GLJ O;  4LFC K;  5JS1 A;  2UXD K;  5FPD A;  4MQ3 A;  3WUH A;  1DLO A;  4F2R A;  5EVZ A;  3CQX A;  4XH5 A;  3QEV A;  1SQK A;  3EE8 A;  4CZL A;  2D4W A;  3KKR A;  3F73 A;  3SAG A;  2VQF K;  2UUA K;  2GBZ A;  1KC8 O;  4KPY A;  1MU2 A;  4CFC A;  5SWM A;  3V9U A;  1HNZ K;  5I42 A;  1TYQ A;  2UXC K;  2PZS A;  1NKE A;  3O9S A;  1TVR A;  4DKW A;  1D9D A;  1RDW X;  3LM9 A;  3TAN A;  1HPZ A;  5AQT A;  4MLE A;  4PQU A;  4XIU A;  5AQZ A;  3OTO K;  1TKX A;  2D0B A;  3OYF A;  5GAG P;  4LC9 B;  4FWL A;  4MO4 A;  5EY4 A;  4DTS A;  1WBB A;  1HNI A;  4A5A A;  3N4P A;  2HMP A;  3VF6 A;  4KRF A;  1JLB A;  2UYT A;  3FE1 A;  1T6D A;  2F96 A;  4FWK A;  1UA0 A;  1P90 A;  5AJ3 K;  3O5B A;  2YHX A;  4CJ4 A;  1VRU A;  1A5W A;  4U7B A;  3NE6 A;  3UKU B;  4BRO A;  4B1W B;  4CEQ A;  2HNY A;  1HNX K;  2E1Y A;  4HTL A;  1B9D A;  3PO5 A;  2RPI A;  2GEL A;  1ATN A;  1EWQ A;  3R8E A;  2RF2 A;  3RVC A;  1RIL A;  2ZQB A;  2A40 A;  2IVO A;  1Y97 A;  2X6N A;  3UE5 A;  4ZHR A;  5KRS A;  4FJ7 A;  4LF9 K;  2WFB A;  3AVH A;  3QIP A;  4NLC A;  3AVL A;  2PAV A;  3LAN A;  3ZSO A;  4DLG A;  1YT3 A;  4ZTF A;  1ITG A;  4BRQ A;  5AQR A;  4JI8 K;  3CPE A;  3HTV A;  4BC5 A;  4RCH A;  3AAR A;  2QEX N;  4JKG A;  1RT7 A;  1TKT A;  4E7H A;  1CLQ A;  4B3S K;  5AZJ B;  1WSE A;  2YJE A;  5EU7 A;  2E6L A;  1XHX A;  3VQQ A;  5AQF A;  4FLU A;  4FWR A;  3I56 N;  1RDU A;  4CJ5 A;  4FVM A;  4OPK A;  4JKE A;  3OYM A;  3A5L C;  4DQS A;  3ZX3 A;  5HRR A;  2P9L B;  4A62 A;  3J7Z O;  2NZT A;  3AVI A;  1NOZ A;  4CCH A;  3U9D A;  5LJV A;  1YHQ N;  1SKR A;  4KHU A;  2XY7 A;  3T69 A;  4JYA K;  2RKI A;  3EE9 A;  4CED A;  4EP5 A;  1R0A A;  3DXK B;  3EKS A;  4CHN A;  4CHP A;  4LF7 K;  2Q0R A;  1EP4 A;  3ZT3 A;  1XMQ K;  3T7Z A;  4DQI A;  3RMC A;  3WNH A;  5CR4 A;  1WSJ A;  3DI6 A;  3AA3 A;  3SCX A;  4KTW A;  1HYS A;  1KVC A;  4CEF A;  4B08 A;  4JAX A;  3OS2 A;  2A6A A;  1OH8 A;  1GLL O;  3EYZ A;  4H4M A;  4RTF D;  1K8K A;  4BE2 A;  1Q18 A;  4Y0W A;  3O6W A;  4B9U A;  5BN9 A;  2JWK A;  4IDH A;  1LW0 A;  1ATS A;  4O0I A;  4DFP A;  1QSL A;  4IOX A;  4B1U B;  1E4G T;  5C24 A;  1WLJ A;  1HYZ A;  5CYM A;  4CJS A;  3VA3 A;  1D5A A;  4DR5 K;  2BH1 A;  4E7J A;  3ZX2 A;  3C95 A;  3ZX0 A;  3R1X A;  4GY2 B;  4FWP A;  1GOB A;  4B9S A;  5C2D A;  2IIR A;  2V7Y A;  4MDA A;  2I7P A;  1C1A A;  3DM2 A;  4BRI A;  3ALY A;  3N4Q A;  4M42 A;  4LD0 A;  5GIP A;  2EWS A;  1BCM A;  1JLC A;  4CFD A;  3VQD A;  4CJP A;  1BU6 O;  1A5V A;  3L0Q A;  3GDQ A;  5BRE A;  3KK7 A;  1J5E K;  4BRP A;  4BGB A;  2G8V A;  5AQV A;  4CZF A;  5AQU A;  3SUP A;  4C1N K;  2LSN A;  5AQS A;  4FJL A;  3MAQ A;  1HJR A;  3GE1 A;  4KRE A;  3C6A A;  4EHT A;  2G8W A;  2OAN A;  4FM0 A;  3TAQ A;  3P38 A;  1YTU A;  1BCO A;  2W6L A;  1KVB A;  2P9U A;  4PKH A;  2GUI A;  3OJU A;  1ZBS A;  4N41 A;  4GV3 A;  3IUC A;  3AA5 X;  4B3T K;  1VQ6 N;  2IGI A;  3AO3 A;  3ZSW A;  4K43 A;  4CGJ A;  5F1X A;  1O13 A;  3VTH A;  4BAC A;  1CZB A;  5M1O A;  4DCH A;  4U67 L;  3BY5 A;  4K42 A;  4IWV A;  3KLH A;  5AQN A;  3MX2 A;  4C23 A;  4BWJ A;  1T7P A;  3CJ9 A;  3DLG A;  3DXM A;  3M5R A;  3AAP A;  1MWM A;  2FC0 A;  3H46 O;  2XO7 A;  4I2P A;  1IJJ A;  4KHP K;  4LF5 K;  2HBL A;  1YJN N;  1BI4 A;  2NRH A;  4CJ3 A;  4CIF A;  1U04 A;  1X9S A;  4YNQ A;  4DTO A;  4B3O A;  4DSF A;  1VQO N;  2BUP A;  1S1W A;  2UUC K;  4JI7 K;  4O8K A;  5KI6 A;  4JKF A;  3HM8 A;  4A2A A;  4CIG A;  2FBT A;  4BG9 A;  2XY6 A;  2X78 A;  3QNN A;  2RE2 A;  4N56 A;  4DV5 K;  3NGY A;  4EZ9 A;  3RTV A;  2Z1G A;  3O1W A;  1V4T A;  3IS9 A;  3JS6 A;  5AQM A;  3G0Z A;  4YOU A;  2FF6 A;  4EP4 A;  4L8R B;  3ID8 A;  4DR4 K;  1HQE A;  3W3D A;  4PA1 A;  3A2F A;  3FLC O;  3TAP A;  1NJX A;  2F8S A;  3C6T A;  1X3M A;  3VGL A;  1ZBL A;  2E88 A;  3QML A;  1N5Y A;  1RBR A;  3ZSQ A;  3AY9 A;  4PKI A;  3VQP A;  4FLY A;  1U49 A;  4HCB A;  4BG8 A;  3L2U A;  1OH5 A;  1VQN N;  4DV1 K;  4FW2 A;  2ATQ A;  1OH7 A;  2E6M A;  2YHA A;  3ZSV A;  4C8N A;  5DM7 L;  5FRO A;  4CJL A;  1OKJ A;  3NF7 A;  2IC3 A;  2DPN A;  3O4N A;  4IO9 L;  3S9H A;  3FR0 A;  1HNW K;  4CES A;  2FSK A;  4CGF A;  3DYA A;  4BGA A;  2HHW A;  4BRA A;  4JV5 K;  5EOY A;  1X3N A;  4JKC A;  3K5O A;  1SZ2 A;  3QET A;  2QWQ A;  3HM9 A;  1MDU B;  3CM5 A;  2G8I A;  3LZJ A;  3VET A;  4FVU A;  5C15 A;  5HRN A;  4WFN L;  3O9T A;  3MXM A;  4B3R K;  1Q9X A;  3OS1 A;  5AZI A;  4RWT A;  1N6Q A;  5AQJ A;  2O8F B;  3CJ1 A;  2FXU A;  1QZ6 A;  3AVM A;  2YV0 X;  4KHS A;  4FLW A;  2AP1 A;  3VQA A;  3BDP A;  2Q0U A;  2YJF A;  5CYQ A;  1MA9 B;  2VCP A;  1W9H A;  1RGI A;  4X64 K;  1ZBI A;  4E7L A;  2P51 A;  4I9Q A;  4YOX A;  3MWP A;  2D0O A;  4JK9 A;  1VK0 A;  3VEW A;  2BGG A;  3J7A P;  3L2R A;  2KFN A;  3PO4 A;  2YKN A;  5HBM A;  5JLF A;  1ZXO A;  5T7B A;  2A1R A;  2HND A;  2G8F A;  3O9R A;  2QWO A;  3D2E A;  2YNH A;  2QWP A;  3KD5 E;  4O4G A;  1RNH A;  4CZI A;  1IO2 A;  4EAH D;  4LFA K;  3SPZ A;  4AH9 A;  5M1Q A;  3P1G A;  4DQ8 A;  3KK3 A;  3HPO A;  2CH6 A;  5KPT A;  4BRH A;  3OHR A;  3OYB A;  3KHY A;  3T1Y K;  3U3G A;  1GLC G;  5KQD A;  3P83 D;  3C6U A;  4WQ5 C;  1M90 O;  5AR0 A;  4E19 A;  1S1T A;  2Q36 A;  1U2V A;  4JKG B;  3RR8 A;  1JXE A;  3AO4 A;  3M8R A;  3HL8 A;  2WTU A;  5AQK A;  3TAF A;  1W2B M;  1NGA A;  3RMB A;  2I5J A;  5JVH L;  4Q0B A;  1HQU A;  3AO2 A;  4BRF A;  4CEC A;  1BOT O;  2VWK A;  4FOE A;  4HCC A;  4J2D A;  3QEP A;  3D2F A;  2HHT A;  4DV7 K;  2E2P A;  4Z4H A;  4OKK A;  4M3R A;  1Q81 O;  2Z1J A;  4Q5V A;  3KLI A;  1C0U A;  4CK1 A;  2P9I A;  3KWI A;  3A5M C;  1YTA A;  4DS5 A;  3CIP A;  5I3U A;  3WEE A;  1IBK K;  4M7X A;  4CD1 A;  4DV0 K;  3S3M A;  1TKZ A;  4CBX A;  3WXJ A;  1G99 A;  2O8C A;  3LP2 A;  1RTI A;  3A8Y A;  2HST A;  1S22 A;  4BDY A;  2IS3 A;  2HNZ A;  4BR4 A;  4DTU A;  1LCU A;  4BR0 A;  3H6E A;  4ILH A;  5C10 A;  2P9N B;  4FJI A;  1FKP A;  5KRT A;  1QE1 A;  3J81 O;  4CFA A;  3NH2 A;  1NKC A;  3MN7 A;  3MED A;  4DR1 K;  4JKH A;  3R9P A;  4ID5 A;  3VEX A;  3OY9 A;  3SNN A;  3O8M A;  4CVN E;  2RHK A;  4NCB A;  2OTL N;  3A5O C;  2V7Z A;  3PLA A;  1EX4 A;  3HI0 A;  1WN7 A;  4G9Z A;  3LM2 A;  4DSI A;  4RG8 A;  4FLZ A;  1XMO K;  2GX9 A;  2WOM A;  3U9Z A;  3VQ6 A;  1GLD G;  4DSE A;  3KLG A;  1B92 A;  1T6C A;  3PY8 A;  1ZYQ A;  2P9S B;  3LPT A;  4F2S A;  3NMU A;  1XUP O;  2QXF A;  1Q86 O;  5DK5 A;  2OCE A;  4Z4I A;  4JD2 B;  3OA9 A;  1WOQ A;  3D0P A;  1VRT A;  4CBW A;  2VG7 A;  4X62 K;  3E1Y A;  3BZC A;  3NF9 A;  3AGK A;  4NXM K;  1UAX A;  3THX A;  1NOY A;  1RBV A;  4JNE A;  3UKR B;  4IDK A;  4IG0 A;  4BRD A;  4NCG A;  4KHQ A;  1C0T A;  3C7N A;  1RBT A;  2GUP A;  3EZ5 A;  4FM1 A;  1KQS M;  3ZEU A;  1K73 O;  2KQ2 A;  1WSI A;  4LSL A;  2HHU A;  4ISG A;  3TAG A;  4BVP A;  1TK8 A;  5AQQ A;  3KVG A;  3P5J A;  4FWM A;  1VQ8 N;  3VPZ A;  4DQP A;  3GG4 A;  4OGE A;  3TTD A;  3BGR A;  3MWT A;  5EX5 A;  2OYQ A;  5FRN A;  1LOT B;  2GEM A;  3E9L A;  4DUZ K;  4E7K A;  4PL7 A;  4IG3 A;  2D0C A;  4CEZ A;  1NJZ A;  4L3Q A;  1JCG A;  3K5L A;  4CGD A;  1S72 N;  1U47 A;  3TSU A;  1NU0 A;  3U4L A;  5MLC Q;  3DOK A;  4MFB A;  2P5G A;  4KTQ A;  1HJO A;  2A3Z A;  4JKB A;  1KSP A;  4MLH A;  2YHW A;  1C0F A;  3AVB A;  3THW A;  5M1P A;  4FJX A;  1BI4 B;  1XC9 A;  4RW7 A;  3SAH A;  3SBT A;  2B4J A;  3KZB A;  2EX3 A;  4IJN A;  4CF1 A;  4IFV A;  1QTM A;  1TAQ A;  2NRV A;  2JLE A;  2HHV A;  1GLF O;  2E2N A;  4CF8 A;  3VGK A;  1SV5 A;  3H3O B;  3R6M A;  4Z4G A;  4WFA L;  4H5R A;  3ULE B;  2E2Q A;  4DFJ A;  3THY B;  3ZLJ A;  3T3F A;  3ZSY A;  4FK4 A;  2NLX A;  1KAY A;  2YI1 A;  3AO5 A;  3P31 A;  2O8D B;  4H0V B;  4OVL A;  3WNF A;  2G8K A;  1S6Q A;  3KJV A;  1KAZ A;  4I7F A;  2IDO A;  3PV8 A;  2ZE2 A;  1ASU A;  1QVF M;  3ENH A;  2ITG A;  3BEX A;  4NXN K;  2FLO A;  1TUY A;  5ELZ A;  3TU5 A;  4DTR A;  3IKM A;  3RMA A;  3CD6 N;  1EO1 A;  2W40 A;  4DLE A;  2KZZ A;  3F9M A;  3SUQ A;  2O8B B;  3MN5 A;  4DS4 A;  3DWL A;  4DV4 K;  2HHX A;  1BA1 A;  2KW4 A;  4GW6 A;  2D0A A;  2Q31 A;  1BQM A;  3NVM A;  1KFS A;  4LH5 A;  4B1V A;  4PHT X;  1HNV A;  3OBW A;  3CG7 A;  3J8A A;  1DGK N;  4YDU C;  5B8H A;  5A2Q O;  4W5T A;  3HP9 A;  1VQL N;  1KAX A;  1TL3 A;  1LWE A;  2KLA A;  3VQ4 A;  3V81 A;  1Q7Y O;  3C65 A;  4BRL A;  3HO1 A;  3CCQ N;  4FJG A;  3PX6 A;  3CFO A;  3VTI A;  1XHZ A;  1VSK A;  2VQE K;  4HWI A;  2OPR A;  3VF2 A;  3LAL A;  1FKO A;  3LDP A;  4FLX A;  1NGC A;  5JIC A;  2UUB K;  1NJW A;  1QHT A;  5J2Q A;  3EL2 A;  1KFD A;  4FJN A;  4CJF A;  2Y1J A;  2V52 B;  3H1V X;  5BRF A;  5D3G A;  4CFB A;  3MXI A;  1NNE A;  2O8E B;  3FGU A;  3NGI A;  2QKK A;  2X74 A;  3DRR A;  3S41 A;  1A5X A;  3CYM A;  1T8E A;  3WQU A;  5CY4 A;  3RSE A;  4YY3 K;  2ZD1 A;  3U6F A;  4CJV A;  1L3S A;  1BUP A;  4HUG A;  3M8P A;  4F4K A;  1U45 A;  3WXL A;  3K58 A;  4CI6 A;  1VQ5 N;  1C6V A;  3CER A;  4O5B A;  4FL9 A;  2F9W A;  5JVG L;  3TPQ A;  1FW6 A;  2DFH A;  2X6S A;  4PY5 A;  1IH7 A;  1SUQ A;  3OYG A;  1SL1 A;  3LDO A;  3TTF A;  2OPP A;  4R79 A;  3SPY A;  4K0K K;  2UXB K;  1Z05 A;  3KLF A;  4DU1 A;  4BDZ A;  1BHL A;  1N8R O;  5FRM A;  2YNG A;  4F9O A;  5KGX A;  3HSC A;  2ASP A;  3LDL A;  1Q82 O;  1RT3 A;  2YNI A;  4JI4 K;  4IJA A;  3DRP A;  3O4W A;  4GMJ B;  2HVH A;  1NGJ A;  3E66 A;  4DR7 K;  4RW9 A;  5EXW A;  3VQ7 A;  4BR2 A;  2HHQ A;  2XHB A;  2P9K B;  4GVM A;  3KK2 A;  3SK3 A;  3T1A A;  1GLA G;  4BRM A;  1WAF A;  4CGG A;  3IDH A;  4C8K A;  4O55 A;  2P5O A;  1B9F A;  5BPN A;  3AVA A;  2ZGY A;  4CD3 A;  4KTZ A;  1VHX A;  3SAF A;  1NK8 A;  2OZM A;  3SV3 A;  2NUB A;  1REV A;  3WQT A;  5M1K A;  4QCL A;  1CXQ A;  1D8Y A;  1WSH A;  4DV2 K;  1UOC A;  4FPA A;  3CME N;  1NGH A;  4NYF A;  5C42 A;  3J80 O;  4BQL A;  4FJ5 A;  1TK0 A;  4I6M A;  4JS5 A;  1QSY A;  2HVI A;  1NJI O;  2UU9 K;  3L3U A;  1HRH A;  3GBT A;  3LPU A;  3ZET A;  4KH5 A;  1HUX A;  4DR3 K;  1GLB G;  3CCR N;  1SKS A;  2KHO A;  5KTQ A;  4YOW A;  1S9E A;  4ID1 A;  3TAR A;  4FOI A;  1NGG A;  1NWK A;  2V51 B;  3TR8 A;  4GVE A;  1R59 O;  4NCA A;  1D9F A;  4JHD A;  4CHY A;  2W42 A;  4LH4 A;  4BRG A;  3NF8 A;  4CJR A;  3ENB A;  3K0S A;  2P9P A;  3I8B A;  2HF3 A;  3UB5 A;  2PYJ A;  3SQ4 A;  4AF1 A;  4AHR A;  4CW7 B;  1C0G A;  3VQ8 A;  4AHS A;  1GOA A;  4B1Z A;  1JLE A;  1ASW A;  2W41 A;  4CJK A;  4YFU A;  4KB0 A;  3ZEU B;  2Q1N A;  5CE3 A;  2KKZ A;  1YAG A;  2HMI A;  4KHY A;  4PKG A;  4JI6 K;  4C8L A;  5ADX H;  3H45 C;  3V6D A;  3SV4 A;  1D4X A;  4CJU A;  3V1R A;  4RW6 A;  2ZGZ A;  1NK9 A;  3IAY A;  4DTJ A;  1NBW A;  4H5V A;  1JL2 A;  3VGM A;  3KLE A;  3OYD A;  3DJC A;  3QIN A;  3EO3 A;  3ATU A;  4GNI A;  2OZS A;  4DU3 A;  3U3Y A;  3CCM N;  5BN8 A;  5AFU H;  1P8Z A;  4O8U A;  3GL1 A;  3ZSR A;  1C0M A;  3OYJ A;  3SYZ A;  2VGM A;  4JI1 K;  3FZM A;  5LMN K;  3T19 A;  3SMP A;  5CHI A;  1NLV A;  4DTP A;  2HF4 A;  1OH6 A;  3K5M A;  1EET A;  4OO1 J;  3HBT A;  2HHH K;  4WFB L;  1H1V A;  2ITM A;  1VQ7 N;  3C94 A;  3ZCM A;  3LP3 A;  1KLN A;  4ELV A;  3AVJ A;  2Z1H A;  1U6Z A;  3HRG A;  3QNO A;  4JLH A;  4I2Q A;  4EFH A;  4HUE A;  1X9W A;  3ID6 A;  4DTN A;  3FZF A;  3GOI A;  1NK7 A;  3VMF B;  4TSX A;  4KAZ A;  4E0D A;  4CEB A;  3TSQ A;  2ASM A;  3DAW A;  1RT2 A;  1DEJ A;  3D7E O;  4KH4 A;  5TKY A;  3SJH A;  2XY8 A;  3M3Z A;  3VEV A;  1TYQ B;  2ZJR L;  4O44 A;  1WBD A;  4H03 B;  3NVK A;  4CEO A;  4DV3 K;  3UKU A;  4E3S A;  4IFE A;  4BR5 A;  3K57 A;  4BY9 C;  1BGX T;  3Q7C A;  4ISE A;  4J2E A;  1KXP A;  3OYA A;  2BDP A;  3RMD A;  3LWL A;  3E9P A;  1VSH A;  4QOZ B;  3MK6 A;  3O4Q A;  1VSE A;  2YHB A;  4OPH A;  1IKY A;  3IG1 A;  4FO0 A;  1NM1 A;  4M3Y A;  2VG6 A;  5AQO A;  4M41 A;  1WAJ A;  2CH5 A;  1WUA A;  4CK3 A;  1NK0 A;  4B9Q A;  3DRS A;  3MX5 A;  3RRG A;  3R3L A;  3DLL L;  5HRO A;  5AZJ A;  3CCE N;  2VGN A;  2KZM A;  3KD1 E;  3HXM A;  3B6P A;  3TWH A;  1Q9Y A;  2O4G A;  4ISF A;  1RDC A;  3JXU A;  4KB1 A;  1O1W A;  4DQQ A;  4JK8 A;  1T03 A;  2P9L A;  1TAU A;  1JLQ A;  5JS2 A;  5AQY A;  3L2V A;  3CJA A;  3TTC A;  1BDG A;  4BE1 A;  4MO5 A;  5LMU K;  5LL6 Z;  1X1P A;  2Y1I A;  2NRW A;  4B9V A;  4IEI A;  4DU4 A;  1K8A O;  1J6Z A;  1NGF A;  3L8B A;  1CXU A;  3LDS A;  3MCP A;  1IBL K;  2JWL A;  3CC7 N;  3NH0 A;  4N76 A;  4H4O A;  4B8A B;  5HL7 L;  3HJF A;  4YOR A;  3NAE A;  2Q97 A;  4CJE A;  1M1K O;  4FW1 A;  4HVJ A;  4FZZ A;  4YOV A;  3M8S A;  1IG8 A;  2DTU A;  1VQ9 N;  1S5J A;  2YNF A;  2XRI A;  4OPA A;  2A41 A;  4CHQ A;  3PX4 A;  5GAE P;  3LP1 A;  4DFM A;  4WQ4 A;  5GIN A;  2OPS A;  4B9T A;  4YOY A;  1Z26 A;  3KWG A;  3TAE A;  4IOA L;  2ETJ A;  1NJY A;  2DFF A;  4HUF A;  3MXJ A;  1IKW A;  1N36 K;  4JRP A;  3OYL A;  4DMN A;  4F8R A;  4FLV A;  1EKE A;  4CF0 A;  4A2B A;  2VWB A;  3V1O A;  3C6H A;  3V9X A;  4LSN A;  5IWA K;  1NMN A;  4JKA A;  3Q7B A;  4LY7 A;  5FPE A;  1T05 A;  5GIO A;  2B5J A;  5E41 A;  3IFR A;  1YIJ N;  5M1N A;  3L2Q A;  2WC9 A;  1IKV A;  2F7T A;  5H1S Q;  1S6P A;  3S3N A;  1K8K B;  3SBG A;  2IVP A;  1NK6 A;  1Z6R A;  4FK0 A;  3CC2 N;  4H5T A;  5FDL A;  1TL1 A;  4FCY A;  1BO5 O;  4CZG A;  1S3X A;  1G15 A;  3W0L A;  2DFE A;  1BL3 A;  2QI2 A;  4KBO A;  3CHW A;  1Z25 A;  1KCF A;  1SS6 A;  4KH6 A;  1K9M O;  2D5R A;  3B6O A;  1GOC A;  3E9O A;  5BPM A;  2OA8 A;  1OVQ A;  5KPR A;  1XC3 A;  1J5O A;  1YIT N;  3OYE A;  3EEQ A;  1VSF A;  3FZK A;  4LF4 K;  3K2P A;  4XH1 A;  3BUZ B;  1RTH A;  5LY3 A;  4O0J A;  1U4B A;  4H0Y B;  5FPM A;  3VQB A;  5K14 A;  3HPH A;  3O08 A;  5F2R A;  1YXQ A;  4CJW A;  3D45 A;  1IBM K;  4JKD A;  4RW8 A;  1NK5 A;  4JS4 A;  1QVG M;  3ULD A;  5HP1 A;  4KI4 A;  3HK2 A;  2IOC A;  3RRH A;  1I94 K;  2P9U B;  2G8H A;  3MEG A;  2EHG A;  4OJR A;  4E89 A;  3VQ5 A;  1FK9 A;  4IEE A;  5C0Y A;  4W5O A;  4FK2 A;  1ATR A;  5KPZ A;  3QFU A;  4WCE L;  4CGI A;  4N47 A;  4CF9 A;  4KHN A;  1VSL A;  4HTU A;  4WE1 A;  4FPB A;  3DXM B;  1QS4 A;  3EN9 A;  5E26 A;  1T44 A;  3CCS N;  3SI6 A;  3AAQ A;  3I8D A;  3A0I X;  3CXC M;  4LF6 K;  3AVK A;  4CHZ A;  1SKW A;  3AVF A;  1SL0 A;  2WBN A;  2GTD A;  1DTT A;  4NO7 A;  2KTQ A;  4G1Q A;  3DLH A;  3LWM A;  4BC4 A;  3BF1 A;  4PWD A;  5KGW A;  5M1F A;  1KRP A;  4BRN A;  4CE9 A;  4B9N A;  4ICL A;  1YVU A;  3LP0 A;  1ZBU A;  4DFK A;  1QZ5 A;  4M63 C;  2ZJP L;  4Z4C A;  4V19 S;  3SUO A;  2CGK A;  4M3W A;  4DTX A;  3EY1 A;  4GV6 A;  1WNS A;  4KO0 A;  3PIP L;  2DY4 A;  4FJK A;  3SQ1 A;  1I3A A;  3MN9 A;  4AHT A;  3NGZ A;  3ZT4 A;  1S9G A;  1RCH A;  4Z94 A;  1LWF A;  2KFZ A;  5KQ8 A;  3LDQ A;  4M3U A;  2OTJ N;  3VER A;  2QWR A;  4BQZ A;  4A57 A;  4BR9 A;  3SQ2 A;  4FZX C;  4BRK A;  1ASV A;  1YJ9 N;  4CZE A;  1NGD A;  5CZ1 A;  4DTM A;  3G6E N;  2R7Y A;  1F21 A;  2O8F A;  4FJH A;  3VEY A;  4NLB A;  1YF5 L;  2OPQ A;  1NKB A;  4ELU A;  2QXL A;  4PUO A;  3PUF A;  2J4R A;  4FWO A;  4UQG A;  4JI0 K;  3CET A;  1L5U A;  1VQ4 N;  2QWM A;  4BWM A;  4GV9 A;  3SQ0 A;  3CCL N;  3HZ6 A;  4WQ5 A;  3V4I A;  4E7I A;  4E1N A;  3O80 A;  5C25 A;  1HKC A;  2PY5 A;  4Z4F A;  5AZI B;  4ELT A;  3VES A;  1EQY A;  3CCV N;  4O5F A;  1HKB A;  3QES A;  1N32 K;  1W0H A;  3LDN A;  2QM1 A;  2ASO A;  3G10 A;  1QSS A;  3VOV A;  3HVR A;  5HRS A;  3O1B A;  4C1N I;  3ZYY X;  4DF8 A;  4CHO A;  2GWK A;  3CJB A;  3CJ7 A;  1HKG A;  4AIL C;  4C8M A;  4DV6 K;  2Q3S A;  2PFU A;  4J8F A;  1CZ9 A;  3C0B A;  4WYB A;  4IZ9 A;  3K5N A;  4BE0 A;  5C2F A;  4C8O A;  5AQG A;  4DQR A;  1NK4 A;  4AQY K;  2O4I A;  3EKU A;  2F4V K;  5AQP A;  4QAG A;  3D2E B;  3S3O A;  4OKE A;  4R5P A;  3T1H K;  2A42 A;  1VSI A;  4ZTJ A;  3FZH A;  4K25 A;  3OVN A;  4X66 K;  3KTQ A;  1GLE G;  4GKJ K;  2HHS A;  4Z0U A; 
#chains in the Genus database with same CATH homology
 4DV1 K;  4DR7 K;  4DV4 K;  3J7Y P;  3JAM O;  4GKK K;  4JI8 K;  4DR2 K;  5A2Q O;  1HNW K;  4JI3 K;  1J5E K;  4B3S K;  4DV7 K;  4LF4 K;  5IT9 O;  4JV5 K;  4LFC K;  1HR0 K;  5LMU K;  4JI1 K;  2UXD K;  5LL6 Z;  5LMN K;  4DUZ K;  1IBK K;  4DV0 K;  4DV2 K;  2VQE K;  4YHH K;  4JI5 K;  1IBL K;  1IBM K;  2HHH K;  4JI0 K;  3J80 O;  4B3R K;  4B3T K;  2UUB K;  1N33 K;  2UU9 K;  2VQF K;  4JYA K;  5FLX O;  2UUA K;  1I94 K;  3J81 O;  1FJG K;  1HNZ K;  4DR3 K;  4LF7 K;  1XNQ K;  2UXC K;  4LFB K;  4DR1 K;  1XMQ K;  4B3M K;  4X64 K;  2E5L K;  4CVN E;  1N32 K;  4KHP K;  1N36 K;  4LF5 K;  4YY3 K;  3OTO K;  2ZM6 K;  3J7A P;  1XMO K;  4DV3 K;  5BR8 K;  2UUC K;  4JI7 K;  5IWA K;  4DV6 K;  4LF6 K;  1N34 K;  4DV5 K;  5AJ3 K;  4CW7 B;  1XNR K;  4LFA K;  1HNX K;  4AQY K;  4K0K K;  2UXB K;  4DR4 K;  4X62 K;  2F4V K;  4OX9 K;  4JI2 K;  4LF8 K;  4NXM K;  3T1Y K;  4DUY K;  3T1H K;  4V19 S;  4NXN K;  4DR5 K;  4JI6 K;  4X66 K;  4DR6 K;  4JI4 K;  4GKJ K;  4X65 K;  4LF9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...