1HNWK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnwK00
4DUZK 3OTOK 4DV0K 3T1HK 4B3TK 4LF9K 3J80O 4DR7K 4DR3K 1XNQK 4KHPK 4DR2K 2UXCK 1HNXK 4LF7K 5BR8K 4YY3K 1N32K 4B3MK 1I94K 1N34K 4DV7K 4CVNE 3T1YK 1J5EK 4LF6K 4JI4K 4NXNK 1IBMK 4JI7K 1IBLK 4DR1K 2UUBK 4OX9K 4JYAK 4JI8K 4JV5K 2ZM6K 4JI1K 4CW7B 4JI0K 5A2QO 5LMUK 2F4VK 4X64K 1XMOK 4B3RK 4DV6K 4DV2K 5LL6Z 5FLXO 2UUCK 4DR5K 4DR4K 5LMNK 4LFAK 1HNZK 2UU9K 2UXBK 4V19S 1XNRK 2VQFK 4DV1K 4DV5K 4JI3K 4YHHK 4JI2K 4AQYK 4GKKK 4X66K 4DR6K 4DUYK 4LFCK 1FJGK 4B3SK 2HHHK 1N33K 4DV4K 3J7YP 3J81O 4JI6K 1XMQK 2UXDK 4X65K 4LF4K 5IT9O 1HR0K 1IBKK 5AJ3K 4NXMK 1N36K 2VQEK 2E5LK 5IWAK 1HNWK 4LFBK 4DV3K 4LF5K 4K0KK 4GKJK 2UUAK 4LF8K 4JI5K 3J7AP 4X62K 3JAMO
chains in the Genus database with same CATH superfamily
3DXMB 3MAQA 5GAGP 4DR7K 2NRHA 4PKIA 4DR3K 1ZBLA 4FLXA 4CZKA 3AO2A 3O1BA 3S9HA 5AZIB 4IFVA 4DR2K 4I7FA 5AQJA 5FPNA 4KKOA 5FRNA 3TANA 5FPDA 1Z05A 4DV7K 4KI4A 2YJFA 3C7NB 3HP6A 3CCSN 5BPLA 1IO2A 3AVGA 1MU2A 3HZ6A 4CHOA 2OZMA 3QFPA 2YHAA 3MN9A 2VWJA 2D1KA 1TL3A 1IH7A 4AILC 3EZ5A 5I3UA 2ATQA 3L6QA 1N5YA 3C6TA 1N8RO 1A5XA 1TKZA 4U67L 2F4VK 4HUEA 4KHQA 1UOCA 5AQRA 1X9MA 1GLCG 4B1UB 3KK2A 3QINA 5AQUA 3VEWA 3D7EO 3O9QA 2YNGA 4DTMA 2YHWA 1BL3A 4BE1A 3EKSA 2BGGA 4YOWA 3ZX0A 1SQKA 3MXIA 1W2BM 1BA1A 2UXBK 2P9LB 4EHTA 4CJUA 3CFPA 1G99A 4WFAL 2E6LA 2Z1JA 3M8RA 3PO5A 3LP2A 4JKHA 1U2VB 3T19A 1RFQA 1N6QA 4M7YA 1LCUA 1CZ9A 2IIRA 3N4QA 1FJGK 4TSXA 4AH9A 4EHUA 2CH5A 1BI4B 4K41A 1VQ7N 3EEQA 3ULEB 2WONA 4FJIA 3M8QA 4NB4A 1QHAA 2QWPA 2G8VA 1KFSA 1TV6A 5AQGA 3TR8A 3THXA 4B9LA 3SAFA 4GVEA 1MWKA 4CD3A 4JK8A 4M42A 4QOZB 3MEDA 4M3XA 4PL8A 3OBYA 4IG3A 3CJ1A 3VQ5A 1RT1A 3CHWA 4FYDA 4J2EA 4WCEL 3GOIA 3F9KA 1ATRA 5M1QA 5J2NA 3Q7CA 2HBLA 3O9TA 3IS9A 3OYKA 4FWNA 3PSFA 4IXCA 2YNFA 3W0LA 3K9JA 3J7ZO 2HF4A 1P8ZA 4Z4GA 2G8IA 5M1NA 3AGRA 3IKMA 3H3OB 1NGFA 4KV8A 4YDUC 2ASMA 3V1OA 4BRQA 3KD1E 2P9IA 4PHTX 1ATSA 1JL2A 4FJLA 3SLCA 4CEQA 3BF1A 1ZYQA 1KAZA 3SPZA 5LMUK 4KHYA 5AQYA 1ZC6A 3VN5A 2UUCK 3HVRA 4IEEA 4B08A 1MA9B 4Z94A 3QETA 1X1PA 2O8FA 3DLBA 1JKHA 3K57A 1HNVA 3AAPA 3KK7A 1GOAA 2YV0X 4BQLA 5KRTA 4CBWA 1Z6RA 1FW6A 4CHQA 3D2EB 3LPTA 1X9WA 1RTJA 2O4IA 5CY4A 4BQZA 3HO1A 2QWOA 4N5SA 1NNEA 3TAMA 4H03B 4DQRA 4E3SA 4CJTA 4X65K 2I7PA 3NF7A 2FBTA 1RDWX 3AO3A 5AJ3K 1N36K 4WYBA 3VGLA 3WXLA 2HBKA 1B92A 3ID8A 3OYBA 3QLHA 3PUFA 2OZSA 1HQEA 4HHTA 1RDAA 5AQQA 3UKRA 2V52B 2ZGYA 5E26A 4X62K 3SK3A 3MCAB 2CGKA 2ZGZA 4FPAA 3OTOK 3HYFA 5KQ8A 4FJ5A 1BISA 1Y64A 1CXUA 4CCHA 3P1GA 3VENA 1JCGA 3KWGA 3ZYYX 3IRXA 4CZHA 3VQ6A 3A8YA 4C8MA 4CEFA 4WQ4C 1NK6A 4RW4A 3VOVA 3V9ZA 1JLGA 4AHRA 1U49A 4A57A 4M3TA 3KHYA 4IO9L 3PO4A 2KFNA 4B8AB 4GV3A 4BR9A 4JI8K 1RILA 5AR0A 4AHCA 5A2QO 3RSEB 1RDDA 4JKAA 3OYDA 3AVHA 3SV3A 4DF8A 3F2KA 3OYMA 4NLBA 4E0DA 1C0UA 4EAHD 3SJJA 3AA5X 3T3FA 3QFUA 4ELVA 1T7PA 4FWPA 5D3GA 3AVLA 5AQWA 1O13A 1IKYA 3H08A 2Q0UA 4CBUA 2UU9K 3N4PA 2HOEA 1JCFA 5TKYA 3CF5L 1GLAG 1WSIA 4BG8A 4QCLA 3MN7A 1KVCA 3BY5A 2HW3A 1ILYA 3D2FB 4MFBA 1BQNA 2HSTA 4DTRA 4BDPA 3P5JA 4IOXA 4JI2K 3VERA 4ICLA 3VEYA 4K42A 3L4QA 3NH0A 2VWBA 3CPWM 4C1NK 4JKGA 4HTUA 3SUQA 3VQPA 3QBWA 4GNIA 1YVNA 4BR4A 4OLAA 3PSIA 5AQFA 4FJMA 4C8LA 4DHYA 4DFJA 5AZIA 2W6KA 5KPTA 3MK6A 4BROA 4H5TA 4JK9A 5HRNA 2QKKA 1NK0A 4BE2A 5F0XA 2O8CB 3DXKB 3C7NA 3ZSZA 2YHYA 1K73O 4IOCL 2W41A 1VQ8N 3QESA 5SWMA 3ZSQA 3JAMO 5EVZA 2KFZA 3KK3A 1VQ9N 1SKSA 5GAHP 3RWUA 4OLBA 3M3ZA 3KK1A 5K14A 1U6ZA 4ZTFA 1JXEA 2Q2RA 4R79A 4KHPK 2UXCK 1HNXK 3QB0A 3DOKA 4M7XA 4ELUA 1NK9A 1NJWA 4B3MK 1K8KB 4O0IA 2QK9A 3WEEB 2A1SA 4FJXA 1WSGA 4IOAL 5F2RA 3KIOA 3JYTA 2KZZA 1C0TA 1HPMA 3DLEA 1C0GA 2IC3A 4F8RA 1U4BA 3CMEN 1JXBA 2P9LA 1RDCA 2PZSA 1SAZA 4CFBA 4CJWA 4IFEA 1VSEA 4MQ3A 4CW7B 4A59A 4JI0K 2E1YA 5MLCQ 1C6VA 4FJNA 3OYJA 3I8BA 1ZBUA 3CQ8A 1NOZA 1U2VA 5KI6A 2F96A 1KD1O 4KI6A 4PUOA 3M1FA 2IDOA 1BUPA 1BI4A 2YCHA 1Q9YA 4FK4A 5LL6Z 2VG6A 1QQNA 4H4OA 3ULEA 3ZT0A 3P4IA 1NOYA 2P9SB 2A5XA 1VSLA 4L3QA 1YI2N 2O8EB 4IJNA 1J6ZA 3HL8A 1HNIA 2HB5A 3IAYA 3DLKA 4F4KA 4YHHK 5KPZA 3KLIA 3ZETB 3T7ZA 4W5NA 3SV4A 5DK5A 3ZSOA 2X6SA 3G10A 2OPRA 3VA0A 4DSIA 2YX6A 3DLHA 1YT3A 1KAXA 5HRSA 1LWCA 3DRRA 5AQPA 4IEIA 5JLFA 3NH2A 4CEOA 3MXMA 2DTUA 1WAJA 1TAQA 4LY7A 5AQKA 3OS0A 3VTHA 4LF8K 5ADXH 3CIPA 4DKWA 5M1KA 3C6HA 3OS1A 3AVAA 1EX4A 1VSHA 4CE9A 2DY4A 1RT7A 3ITHA 4B9TA 3L3UA 5FROA 5AQZA 4UQGA 1K6YA 1XNQK 5CE3A 4W5OA 1RNHA 4H0OA 4LF7K 2P9PA 3OYLA 4KH6A 4LSNA 1SL1A 1T03A 2NRZA 4DCHA 4CJ5A 3B6OA 1N34K 3NHGA 4U7BA 3J8AA 1S1TA 3NVKA 2D0AA 4LD0A 2HBMA 4OPJA 3CC4N 3SQ1A 3WNFA 1JLFA 4G1QA 2YNHA 2HF3A 5CYQA 1MDUB 4CI6A 4JYAK 3D2EA 1Z25A 2E2NA 1GOCA 4BE0A 1R0AA 3AO5A 3VQBA 1JCEA 4BGAA 5ADXA 1R59O 3P38A 4FWOA 3QEIA 2KQ2A 1L3SA 5CR4A 2JGUA 5KGXA 1ZBHA 3A5LC 1RT5A 4YOUA 1QSYA 4CK3A 4PQUA 3F5TA 3KLFA 4BC3A 1LWEA 4HTLA 4FJ8A 3AAQA 2I7NA 2F9TA 4AHUA 1DT9A 3OYNA 2XY6A 3KZBA 4DUYK 1TUUA 1X3NA 3NH1A 4KREA 3AVIA 3L2UA 4FJ7A 3DLLL 3O3GA 1VSKA 3O1WA 1OH6A 1NG9A 1WSFA 3MWPA 4FWLA 3LM2A 2ZJPL 4HUFA 3TI0A 5IT9O 3TSPA 4B1WB 2QA4N 3AO1A 3AV9A 3CCRN 3NDKA 3A5NC 4GKJK 3VEOA 2UUAK 1Q7YO 2ITMA 1QQCA 2E2QA 5AQIA 3E9OA 1QQOA 4DQQA 4CJ3A 3T1HK 4NO7A 5LY3A 2P9UA 2D0CA 1SS6A 3CI5A 4DU1A 3VGMA 4KTQA 2OTJN 1D4XA 5BN9A 3MX2A 3UKUA 4JKDA 3AVMA 3VTIA 4N47A 1KLNA 3Q7BA 4FWMA 4KFBA 3IFRA 2GUPA 4CFDA 3AARA 4DTSA 3OYAA 3OVNA 3A5OC 3VF6A 1IBLK 3MEGA 1H1VA 1XC9A 4WQ4A 4M3WA 4B1VA 4ILGB 1QZ5A 4H4MA 3OYGA 3D2FA 3PIOL 1SUQA 2HMIA 2QWQA 4K8ZA 3R6MA 4XH4A 3U6FA 3UIQA 4B3RK 1IKXA 4IG0A 3V9UA 1RGIA 1T8EA 4BR5A 4Y0WA 1KLMA 4CZMA 1EKEA 2GWJA 4M3YA 4JHDB 1RTDA 2KZMA 3KLGA 4IJAA 4JKEA 4BRDA 5BRDA 2BTFA 1KCFA 3VF4A 4KH5A 4PWDA 3LDPA 3WXMB 4CBXA 1XWLA 5HOOA 2VQFK 1HJRA 4DV5K 3RR8A 1T44A 1B9FA 2O8CA 4PKGA 3RVCA 1BCOA 3V1QA 5HL7L 3OYCA 3FGUA 3VGKA 4DQSA 2GUIA 4DQIA 4X66K 3FZLA 2OPQA 1WBBA 2NZTA 3CERA 2KHOA 3TAEA 3ID6A 3PX4A 1VQ6N 1VAZA 4BRHA 2P5GA 1XMQK 2UXDK 5J2PA 1BHLA 2Z1GA 3M6GA 2W6LA 3C6UA 4KHSA 4XIUA 1MWMA 4BRMA 3WQUA 1S1UA 3SMPA 3MDQA 1YVUA 2E2OA 3WEEA 2E1ZA 3QIOA 3DM2A 3TPQA 3HM9A 4MLHA 4MLEA 1D9FA 1KQSM 4NCBA 1LV5A 2O8DB 1M1KO 4FLWA 3FFKB 1TAUA 1RBSA 4A62A 4BC2A 2Q97A 3ULDA 4H8KA 4CF0A 3ZSWA 1NM1A 3WT0A 3PY8A 3R3LA 3OS2A 2Y1IA 3LP3A 1NGEA 4EFHA 3ENBA 3MEEA 3TTCA 1E4FT 1BU6O 3P39A 2P9SA 3GL1A 2QTDA 2HNYA 4FWRA 3SUOA 4BWJA 2HVIA 2OA8A 3HTVA 2PFUA 4CGGA 1EWQA 1HLUA 4C8NA 4CZEA 5FRMA 3LDSA 3ZETA 1X3MA 4I6MA 4FWSA 4DFMA 1U45A 1RT4A 1L3TA 2IOCA 3VQ4A 4JS4A 3E66A 2IGIA 4DV2K 4DV6K 3CCMN 4H0TB 3R1XA 4YFUA 1S9GA 2D4WA 3O5BA 4OKKA 4ZHRA 4Z4FA 2X6NA 2WOMA 2AP1A 2E2PA 3MWTA 4O5BA 3K0SA 1NGJA 5FPEA 3CXCM 5DM7L 1SKRA 5FPMA 1ZBFA 1DTTA 2IVOA 1VQMN 1W7AA 5HP1A 2HMPA 3U4LA 3I33A 4QS8A 4MO4A 4H0XB 3NMUA 3KTQA 1YTAA 1HKBA 4B9UA 3J7YP 4DFKA 4JI6K 2XY7A 4UY8O 4ID5A 4FK2A 1CLQA 4LH5A 3ZT1A 4IDHA 5JVGL 1S3XA 3LWLA 4WF9L 1IBKK 1GLDG 4NXMK 1JLQA 3H46O 1HPZA 4LH4A 5BREA 1S22A 4LFBK 4LC9B 3W3DA 4DWIA 2P5OA 3NFAA 3K5LA 1WBDA 3LAKA 4JI5K 4FJGA 3J7AP 3ASMA 4O5FA 3THWB 3ZSYA 1NK4A 1X9SA 3U3YA 5BR9A 1XHXA 3DMJA 1YHQN 2FF3B 2QWMA 2Z1HA 3NE6A 3I55N 5BR8K 2R7YA 1D8YA 3SNNA 4PY5A 2BANA 4DF4A 1Q18A 1VSFA 1VQPN 1NGHA 5JS1A 1JL1A 3O08A 2YKNA 2GTDA 2P9NB 2OPSA 1TL1A 2DFFA 5E84A 3TTFA 2HNZA 3HPOA 5M1PA 4CIFA 4CZFA 2X78A 5AFUH 3ZT3A 3V81A 3CC2N 3VQ7A 4EP5A 1VQLN 4FOEA 4BVPA 2UYTA 3G0ZA 3A0IX 5FLXO 1RBVA 3ZEUB 4DR5K 4C23A 1KFDA 3AVKA 3RMCA 1D9DA 4CF2A 4KHNA 1KXPA 4Z0UA 3M8SA 1OH8A 3S3MA 1D5AA 3DAWA 1C0FA 1OH5A 3CG7A 1LOTB 2A40A 4FK0A 4AQYK 4XH5A 5CZ2A 1QHTA 3VQAA 1ASUA 2NUBA 4CEZA 4DTUA 1VQON 3QERA 4BC5A 1C1AA 2VCPA 1N33K 3WXKA 4CGHA 3T1AA 5F1XA 4CESA 4DG1A 2G8FA 2XHBA 3CMAN 4CF8A 4CF9A 1RCHA 3V9SA 2WFBA 1ZBIA 4RW9A 5AFUA 4C8KA 4Z4CA 4JN4A 4MDAA 2HHTA 2V7YA 2DFHA 2LSNA 4BRKA 3RRGA 3VQCA 3SQ4A 2B6AA 2QWLA 3QEXA 1HNWK 4WFBL 2QXLA 4IFYA 2PYLA 1NKEA 3G4SN 3D0PA 4JEPA 1KVBA 4C1NI 3R8EA 4CJQA 5CZ1A 3DXMA 1CZAN 3VQ8A 1HQUA 1TGOA 3J80O 4LF9K 5LJWA 2D0BA 1KC8O 4B9SA 2ASPA 4O8UA 3LANA 3IMXA 3LALA 1RBTA 3VEZA 4KPYA 3C94A 4K25A 5EOYA 4JAXA 3CCUN 3P83D 3U9ZA 2PY5A 1HYSA 4FO0A 2FBXA 1IBMK 3UE5A 1YAGA 3QO9A 4H5RA 4J2BA 1NGDA 4CIGA 2YNIA 3FZHA 1FKPA 4F2SA 4F9OA 4JV5K 3FLCO 4W5RA 4FLYA 5AQOA 2Q36A 3OJSA 1YXQA 2A42A 4CIEA 2W42A 4WE1A 3L2QA 4BRIA 2G8UA 1Q86O 1SZ2A 3E9PA 4FZZA 3I0SA 3BEXA 2ZQBA 3NAEA 3OYEA 4OO1J 2IAJA 5AQXA 1TUYA 4BRPA 2F8TA 2FF6A 4LFAK 4HVJA 3CD6N 2YKMA 2GBZA 1XNRK 2JWKA 3CCLN 1WLJA 2YI1A 2EX3A 3KKSA 4CEAA 3O3FA 5J2MA 4Z4EA 4FLTA 2Q1NA 3WNGA 1JLBA 3FR0A 3TARA 1YJWN 1V4SA 2HHHK 5H1SQ 1W9HA 4I2QA 4HWIA 1SL2A 1T6DA 3WQTA 3BUZB 1WN7A 2IVPA 2E6MA 4A5BA 2O8DA 3RR7A 4B1XB 4KTZA 2HHUA 1QE1A 1BOTO 4DU4A 3DRSA 2GWKA 2DPNA 4GY2B 5AQHA 3E1YA 2GEMA 1WNSA 5IWAK 3QBXA 5C2FA 4HCBA 3ZCMA 5HBMA 1RBUA 1NKBA 5CHIA 4FW1A 2NRRA 2GX9A 3HRGA 3LDNA 3BGRA 1Q81O 3CQXA 1ZBSA 4DV0K 1SV5A 1F21A 3TWHA 2A6AA 3OY9A 2WC9A 1TK5A 4B3TK 1QQMA 1JLAA 1L5UA 1FKOA 1IG8A 3C0BA 3VQQA 3QEPA 3TAPA 2FC0A 2CGLA 5E41A 4DQPA 3AVNA 3DYAA 4RW8A 4ISFA 4CVNE 3DJCA 4LF6K 1OH7A 5KPRA 1KSPA 4FJKA 4WFNL 4FXDA 1I3AA 4CZGA 3HJFA 1HYVA 1NK5A 2UUBK 4KH4A 3THVA 3UB5A 5I9EB 3JXUA 1JJ2M 3C6AA 1NJYA 1J5OA 1TKXA 1X9JA 3AVBA 3K58A 4EZ6A 1NGGA 4X64K 4FZXC 2F9WA 3QMLA 3L3VA 3TSQA 5KTQA 4JKFA 3SQ0A 2PAVA 1NGAA 3G6EN 1HX1A 4O44A 4KHWA 1WB9A 2XY8A 1L3VA 2WBNA 3CETA 1P90A 4DSFA 1EXQA 2G8HA 2QEXN 1NGIA 3HOSA 1NK7A 4BDYA 4YORA 4DTOA 2P9KB 4Z4HA 4FWKA 3CCQN 4DR6K 3SAGA 2E88A 3THWA 3F73A 1BDGA 4LFCK 3NGIA 5HRRA 2OANA 3J81O 4H5WA 1J53A 4EP4A 5GADP 3O9RA 2ZJRL 4OPHA 1KRPA 4E7JA 3GG4A 2E5LK 1E4GT 4A5AA 4J8FA 1B9DA 1BO5O 1GLBG 2YHBA 1QVGM 1RT2A 3AVCA 5TKWA 4AHSA 2ZD1A 3KLHA 3K59A 4DSKA 4OPAA 3H1QA 4M41A 4YNQA 1EO1A 2FSKA 2P9NA 1NWKA 2VGNA 1O1WA 4JS5A 1M90O 1BG3A 3SBTA 4H0VB 2KTQA 2WUSA 4GV6A 1TKTA 1V4TA 4EZ9A 3TU5A 3OBWA 4BACA 3D6RA 3HXMA 2I5JA 4BR2A 2VGMA 3P31A 3C95A 1J5EK 2E4LA 3TAGA 1ATNA 3BDPA 3H45C 3ZLJA 2QXFA 4W5TA 2QI2A 1YIJN 4CHYA 1S72N 3LM9A 4AM7A 3ATVA 1TYQB 3IG1A 3RTVA 1QS4A 1BIZA 1S9EA 4O0JA 2E20A 3TAFA 5AQTA 3RSEA 1S1XA 2X74A 3ZX2A 4CZJA 1ASWA 3AVJA 1YJ9N 3NBPA 3VEXA 1U04A 3NCIA 3CFRA 2W40A 3SZ2A 3RRHA 5LJVA 4OKJA 4BC4A 5LMNK 2O4GA 1VSDA 5C15A 4V19S 5C25A 4N41A 2H3GX 3EYZA 3F9MA 4B3OA 4OJRA 2HHSA 1RT6A 3E01A 4YOTA 1CZBA 4FZYA 4O55A 3M5RA 2HHQA 3LDOA 2QM1A 3MECA 4PKHA 5HLFA 3CC7N 1RT3A 1QSSA 3CM5A 3HSTB 4E1JA 3V4IA 2D5RA 2DFEA 3A5MC 3I0RA 2VWKA 4DTNA 4DSLA 2P1JA 3DRPA 4BR0A 4Y1DA 3CJ9A 2VQEK 3C65A 3O9UA 3THYB 3WXJA 3DXKA 3IDHA 2WTUA 4JLHA 3V1RA 3FE1A 1NJIO 3O4NA 1BQMA 3RMBA 4FJ9A 3OYHA 2JLEA 3CM6A 3TSUA 2BDPA 3DWLA 3CCVN 4FM1A 1HKCA 3LP0A 4CJPA 3U9DA 2FBVA 3O4QA 5B8HA 3AA2A 1K8KA 5GAEP 1WSJA 4N56A 3ZSRA 2HHXA 3ENHA 1DTQA 3WNEA 4GW6A 5BRHA 4B9NA 3LZIA 5EY4A 4DQ8A 1XQSC 4OX9K 4QAGA 2Q31A 5DMRA 3WUHA 3QDKA 3H3NO 3CJ7A 1ASVA 1HUXA 4W5QA 4JD2B 5C42A 2B5JA 4KRFA 2EWSA 4JRPA 1S5JA 4CHZA 1REVA 1GOBA 5JLHA 2RPIA 3VF2A 2QKBA 3SUNA 4DR4K 3K2PA 3WNHA 4RW6A 4E7KA 3PV8A 3CPEA 1IKWA 5DM6L 4DS5A 1YTUA 4B9QA 2O8EA 3VMFB 1BWFO 1XC3A 4PA1A 2KKZA 3EE8A 3HI0A 1TVRA 5JVHL 4CGJA 4B9MA 3GE1A 4H0PA 1VRTA 4IZ9A 1KAYA 4RG8A 5KRSA 4YOYA 4WQ5A 5FDLA 1WOQA 3MMVA 3KD5E 1S6QA 3JS6A 4A61A 3O3HA 5GIOA 1Z26A 4OVLA 2XY5A 3FZFA 4CJKA 1BCMA 2VYPA 3QEVA 3GBTA 4DV3K 3OW2M 2V7ZA 4HCCA 3V6DA 1GLEG 4M3ZA 1UAXA 5M1OA 1TK0A 3SCXA 3CYMA 1TKDA 2KW4A 3HM8A 4H5VA 1S6PA 1GLJO 4OKEA 1UA1A 4GV9A 4DU3A 2OTLN 3O80A 4NYFA 4BREA 1OVYA 2P9PB 4FWQA 4E7IA 4YY3K 2GV9A 4CJEA 5I42A 1E3MA 2F7TA 4MDBA 3T1YK 4I9QA 4CK2A 4JI4K 4NXNK 1NU0A 3MCPA 4ILJA 4CJFA 5EU7A 4E19A 3PLAA 5J2QA 5BPNA 3JSMA 4Q0BA 1JLEA 5CYMA 3O6WA 3BF3A 4CHPA 4BRFA 3DOLA 4M63C 3ZSVA 3AO4A 4CERA 4FPBA 1QTMA 4CEDA 4JI1K 3QNOA 3EN9A 3S41A 3LP1A 4KTWA 2HBJA 1IG9A 2P9KA 1YJNN 4ZTJA 3E9LA 4FCYA 2NRTA 3L2VA 3RMAA 1IKVA 3V9XA 3QEWA 3ISNC 1OVQA 1K9MO 1Y97A 2ITGA 3SI6A 4I9LA 1GLLO 3FZKA 5C12A 3LL3A 2XO7A 3G71N 1NGBA 1T3VA 1DEJA 3CJCA 3NF9A 4KBOA 2B4JA 3FZMA 4BRNA 4Y1CA 5AQNA 4CGFA 4DV1K 3MN5A 1NJZA 3HPHA 2ZF5O 5AZJB 1NMDA 2IS3A 1T6CA 1VSJA 3K5OA 4CFCA 4JKBA 1VRUA 4GMJB 4E1MA 1RDBA 3U8XA 2NRVA 4O4GA 1QSLA 1DLOA 3PIPL 4M3UA 4KAZA 1IV0A 3EY1A 1RTHA 3ENOA 4DLGA 4ELTA 1WUAA 4IWVA 2V51B 4GVMA 3SPYA 4RTFD 4FLVA 4CJSA 4NCAA 5C0YA 3VQDA 3L8BA 4CHNA 1J54A 4IKFA 4FJJA 3NF8A 4OGCA 3SJHA 5JICA 1NKCA 3SYZA 3ATUA 3K5NA 1TYQA 2O8BB 4B9VA 1HYZA 3HT3A 4F3TA 4JK7A 2AA4A 2P9UB 1UA0A 1NLVA 4H0YB 3KKRA 1N32K 4E7LA 1HRHA 5T7BA 1I94K 4KHUA 3UKUB 4DFPA 2RE2A 1RTIA 4DLEA 2FXUA 3EO3A 3HSCA 4Z4IA 2HHWA 1XHZA 4NCGA 2QW9A 3B6PA 3OA9A 3S3NA 3QIPA 3NGYA 2ZM6K 3HVTA 4FOIA 4BR7A 4XH1A 1VQ5N 2VG5A 3MXJA 4IDKA 1XMOK 5C10A 4CF1A 2ZJQL 4E7HA 2YHXA 2RKIA 4C8OA 3HBTA 5KQDA 3RMDA 2FLOA 3TABA 2AJQA 1Q82O 3LZJA 4JHDA 2EHGA 2OYQA 4JKCA 5BPMA 1HMVA 4AHTA 4JNEA 1Q8IA 3D45A 3EE9A 1HNZK 4F3OA 4FJHA 2RF2A 2J4RA 1RDUA 3ZT2A 4Q5VA 3OYFA 1ESVA 3A2FA 3THYA 1I39A 4JI3K 3L2WA 4FM2A 4BVOA 3HK2A 4JRQA 1EQYA 5SZTA 4ISGA 4M45A 4MO5A 4R5PA 1QZ6A 2NRWA 4E1NA 4BRAA 4PL7A 3AA4A 1ZXOA 3GDQA 1OKJA 1YF5L 3AA3A 3AY9A 4WQ5C 4FVUA 3WXIA 1VSMA 4BGBA 4K8XA 3EL2A 3BZCA 4NLCA 3TTDA 2RHKA 4XEIA 2ZWHA 3VPZA 3O9SA 4YOXA 1GLFO 4CEEA 1WSHA 4YOVA 3QNNA 1TK8A 1NK8A 4EIAA 4ILHA 4CJ7A 2FSNA 3CJBA 3MN6A 1G15A 5EXWA 3V9WA 3K5MA 4I2PA 2PYJA 1IJJA 4FVMA 4JD2A 3SMSA 5AQMA 4BRGA 2Q0RA 4QS7A 3OJUA 1U48A 3THXB 3AVFA 3B8AX 3K9KA 4BRCA 3H6EA 5GINA 4KO0A 2E8AA 4CFAA 3KJVA 1ITGA 5AQSA 4K43A 3S3OA 3HP9A 1Q9XA 4AM6A 1EETA 3BP8A 2ETJA 2PBDA 1LWFA 4JI7K 1XUPO 4FSVA 4B1YB 4DSEA 3NGZA 3KVGA 2GELA 4BRLA 3OHRA 4FLZA 3O4WA 3L0QA 3ALYA 3H1VX 1NJXA 1KVAA 4O8KA 3R9PA 5J1EA 4KB0A 4CECA 2NRXA 1DGKN 4I6MB 4CZIA 4B1ZA 3O8MA 4RCHA 1KTQA 1L3UA 2OPPA 2VG7A 1BA0A 3SUPA 1EP4A 1J9AA 4OGEA 3KWIA 1FXXA 4DTJA 1FK9A 2A3ZA 4DMNA 5JS2A 1CXQA 4IO8A 5JMVA 4AF1A 1HKGA 2P9IB 1C1BA 5EX5A 1XI1A 3MX5A 5ELZA 4OPKA 4CJLA 1LAVA 3M8PA 4FL9A 1S1WA 1YUWA 5C24A 5BRFA 4RWTA 2BH1A 2OCEA 3VETA 3OYIA 1BIUA 3NVMA 4KB1A 1C0MA 1BGXT 4CGDA 1EWRA 2FBYA 3ZT4A 1T05A 1LW2A 3T69A 3SQ2A 2O8FB 1W97L 2D0PA 2P51A 2XRIA 1YITN 4DB3A 4FM0A 1DKGD 5AQVA 2FSJA 4J2DA 4FLUA 3HOTA 1JLCA 2KLAA 5HROA 3SBGA 3SAHA 4DTPA 4A2BA 4NYNA 4CJRA 2RN2A 3LWMA 4K0KK 4LSLA 3VA3A 1UWBA 3CFOA 1VK0A 4DUZK 1LW0A 3LAMA 3CQYA 5HRPA 4J2AA 3PX0A 3VQ9A 3TAQA 4QS9A 3IUCA 2NLXA 4RW7A 2QWNA 2Q3SA 3VQEA 2D0OA 1LAWA 4YDUA 3L2RA 1RBRA 2QWRA 3EKUA 3G25A 3I56N 1HJOA 3DI6A 4IBNA 2A1RA 4G9ZA 3UKRB 5KGWA 4CZLA 2Z1IA 4DR1K 1VHXA 2Y1JA 4A2AA 4H5NA 3L4IA 2F8SA 3AGKA 2A41A 4E89A 4DS4A 2G8WA 1NBWA 3KLEA 4M3RA 1SL0A 5AZJA 1VQ4N 4CEBA 5GIPA 3ZSXA 5C2DA 2CH6A 2NNWA 4L8RB 4CJVA 3CJAA 4FW2A 3ZEUA 1VSIA 2BUPA 2CGJA 5AQLA 1VQNN 4CD1A 3LDLA 2ASOA 1WAFA 3BZKA 1A5VA 1K8AO 4CK1A 1W0HA 1C1CA 3VESA 2ZE2A 4DTXA 2YJEA 3VEVA 2HNDA 3ZX3A 1NGCA 1A5WA 4GKKK 4ID1A 4F2RA 3DLRA 2JWLA 3U3GA 4B3SK 3I8DA 3QICA 2HVHA 4DSJA 4DV4K 1U47A 2O8BA 1QVFM 2G8KA 3CCJN 1WSEA 3EZWA 3DLGA 4ISEA 4LF4K 4B8CA 3HPGA 1NMNA 4AHVA 1HR0K 1S1VA 4BG9A 4CJ4A 3NF6A 2BE2A 4N76A 5M1FA 1SKWA 3CCEN 3LPUA 4LF5K 2HHVA 3LDQA 4BDZA 4HUGA 4CGIA 3FFIA 4BWMA 4BY9C 2IVNA 1VQKN 5BN8A 4JKGB 3PX6A
chains in the Genus database with same CATH topology
4DUZK 3OTOK 4DV0K 3T1HK 4B3TK 4LF9K 3J80O 4DR7K 4DR3K 1XNQK 4KHPK 4DR2K 2UXCK 1HNXK 4LF7K 5BR8K 4YY3K 1N32K 4B3MK 1I94K 1N34K 4DV7K 4CVNE 3T1YK 1J5EK 4LF6K 4JI4K 4NXNK 1IBMK 4JI7K 1IBLK 4DR1K 2UUBK 4OX9K 4JYAK 4JI8K 4JV5K 2ZM6K 4JI1K 4CW7B 4JI0K 5A2QO 5LMUK 2F4VK 4X64K 1XMOK 4B3RK 4DV6K 4DV2K 5LL6Z 5FLXO 2UUCK 4DR5K 4DR4K 5LMNK 4LFAK 1HNZK 2UU9K 2UXBK 4V19S 1XNRK 2VQFK 4DV1K 4DV5K 4JI3K 4YHHK 4JI2K 4AQYK 4GKKK 4X66K 4DR6K 4DUYK 4LFCK 1FJGK 4B3SK 2HHHK 1N33K 4DV4K 3J7YP 3J81O 4JI6K 1XMQK 2UXDK 4X65K 4LF4K 5IT9O 1HR0K 1IBKK 5AJ3K 4NXMK 1N36K 2VQEK 2E5LK 5IWAK 1HNWK 4LFBK 4DV3K 4LF5K 4K0KK 4GKJK 2UUAK 4LF8K 4JI5K 3J7AP 4X62K 3JAMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ K;  3OTO K;  4DV0 K;  3T1H K;  4B3T K;  4LF9 K;  3J80 O;  4DR7 K;  4DR3 K;  1XNQ K;  4KHP K;  4DR2 K;  2UXC K;  1HNX K;  4LF7 K;  5BR8 K;  4YY3 K;  1N32 K;  4B3M K;  1I94 K;  1N34 K;  4DV7 K;  4CVN E;  3T1Y K;  1J5E K;  4LF6 K;  4JI4 K;  4NXN K;  1IBM K;  4JI7 K;  1IBL K;  4DR1 K;  2UUB K;  4OX9 K;  4JYA K;  4JI8 K;  4JV5 K;  2ZM6 K;  4JI1 K;  4CW7 B;  4JI0 K;  5A2Q O;  5LMU K;  2F4V K;  4X64 K;  1XMO K;  4B3R K;  4DV6 K;  4DV2 K;  5LL6 Z;  5FLX O;  2UUC K;  4DR5 K;  4DR4 K;  5LMN K;  4LFA K;  1HNZ K;  2UU9 K;  2UXB K;  4V19 S;  1XNR K;  2VQF K;  4DV1 K;  4DV5 K;  4JI3 K;  4YHH K;  4JI2 K;  4AQY K;  4GKK K;  4X66 K;  4DR6 K;  4DUY K;  4LFC K;  1FJG K;  4B3S K;  2HHH K;  1N33 K;  4DV4 K;  3J7Y P;  3J81 O;  4JI6 K;  1XMQ K;  2UXD K;  4X65 K;  4LF4 K;  5IT9 O;  1HR0 K;  1IBK K;  5AJ3 K;  4NXM K;  1N36 K;  2VQE K;  2E5L K;  5IWA K;  1HNW K;  4LFB K;  4DV3 K;  4LF5 K;  4K0K K;  4GKJ K;  2UUA K;  4LF8 K;  4JI5 K;  3J7A P;  4X62 K;  3JAM O; 
#chains in the Genus database with same CATH topology
 3DXM B;  3MAQ A;  5GAG P;  4DR7 K;  2NRH A;  4PKI A;  4DR3 K;  1ZBL A;  4FLX A;  4CZK A;  3AO2 A;  3O1B A;  3S9H A;  5AZI B;  4IFV A;  4DR2 K;  4I7F A;  5AQJ A;  5FPN A;  4KKO A;  5FRN A;  3TAN A;  5FPD A;  1Z05 A;  4DV7 K;  4KI4 A;  2YJF A;  3C7N B;  3HP6 A;  3CCS N;  5BPL A;  1IO2 A;  3AVG A;  1MU2 A;  3HZ6 A;  4CHO A;  2OZM A;  3QFP A;  2YHA A;  3MN9 A;  2VWJ A;  2D1K A;  1TL3 A;  1IH7 A;  4AIL C;  3EZ5 A;  5I3U A;  2ATQ A;  3L6Q A;  1N5Y A;  3C6T A;  1N8R O;  1A5X A;  1TKZ A;  4U67 L;  2F4V K;  4HUE A;  4KHQ A;  1UOC A;  5AQR A;  1X9M A;  1GLC G;  4B1U B;  3KK2 A;  3QIN A;  5AQU A;  3VEW A;  3D7E O;  3O9Q A;  2YNG A;  4DTM A;  2YHW A;  1BL3 A;  4BE1 A;  3EKS A;  2BGG A;  4YOW A;  3ZX0 A;  1SQK A;  3MXI A;  1W2B M;  1BA1 A;  2UXB K;  2P9L B;  4EHT A;  4CJU A;  3CFP A;  1G99 A;  4WFA L;  2E6L A;  2Z1J A;  3M8R A;  3PO5 A;  3LP2 A;  4JKH A;  1U2V B;  3T19 A;  1RFQ A;  1N6Q A;  4M7Y A;  1LCU A;  1CZ9 A;  2IIR A;  3N4Q A;  1FJG K;  4TSX A;  4AH9 A;  4EHU A;  2CH5 A;  1BI4 B;  4K41 A;  1VQ7 N;  3EEQ A;  3ULE B;  2WON A;  4FJI A;  3M8Q A;  4NB4 A;  1QHA A;  2QWP A;  2G8V A;  1KFS A;  1TV6 A;  5AQG A;  3TR8 A;  3THX A;  4B9L A;  3SAF A;  4GVE A;  1MWK A;  4CD3 A;  4JK8 A;  4M42 A;  4QOZ B;  3MED A;  4M3X A;  4PL8 A;  3OBY A;  4IG3 A;  3CJ1 A;  3VQ5 A;  1RT1 A;  3CHW A;  4FYD A;  4J2E A;  4WCE L;  3GOI A;  3F9K A;  1ATR A;  5M1Q A;  5J2N A;  3Q7C A;  2HBL A;  3O9T A;  3IS9 A;  3OYK A;  4FWN A;  3PSF A;  4IXC A;  2YNF A;  3W0L A;  3K9J A;  3J7Z O;  2HF4 A;  1P8Z A;  4Z4G A;  2G8I A;  5M1N A;  3AGR A;  3IKM A;  3H3O B;  1NGF A;  4KV8 A;  4YDU C;  2ASM A;  3V1O A;  4BRQ A;  3KD1 E;  2P9I A;  4PHT X;  1ATS A;  1JL2 A;  4FJL A;  3SLC A;  4CEQ A;  3BF1 A;  1ZYQ A;  1KAZ A;  3SPZ A;  5LMU K;  4KHY A;  5AQY A;  1ZC6 A;  3VN5 A;  2UUC K;  3HVR A;  4IEE A;  4B08 A;  1MA9 B;  4Z94 A;  3QET A;  1X1P A;  2O8F A;  3DLB A;  1JKH A;  3K57 A;  1HNV A;  3AAP A;  3KK7 A;  1GOA A;  2YV0 X;  4BQL A;  5KRT A;  4CBW A;  1Z6R A;  1FW6 A;  4CHQ A;  3D2E B;  3LPT A;  1X9W A;  1RTJ A;  2O4I A;  5CY4 A;  4BQZ A;  3HO1 A;  2QWO A;  4N5S A;  1NNE A;  3TAM A;  4H03 B;  4DQR A;  4E3S A;  4CJT A;  4X65 K;  2I7P A;  3NF7 A;  2FBT A;  1RDW X;  3AO3 A;  5AJ3 K;  1N36 K;  4WYB A;  3VGL A;  3WXL A;  2HBK A;  1B92 A;  3ID8 A;  3OYB A;  3QLH A;  3PUF A;  2OZS A;  1HQE A;  4HHT A;  1RDA A;  5AQQ A;  3UKR A;  2V52 B;  2ZGY A;  5E26 A;  4X62 K;  3SK3 A;  3MCA B;  2CGK A;  2ZGZ A;  4FPA A;  3OTO K;  3HYF A;  5KQ8 A;  4FJ5 A;  1BIS A;  1Y64 A;  1CXU A;  4CCH A;  3P1G A;  3VEN A;  1JCG A;  3KWG A;  3ZYY X;  3IRX A;  4CZH A;  3VQ6 A;  3A8Y A;  4C8M A;  4CEF A;  4WQ4 C;  1NK6 A;  4RW4 A;  3VOV A;  3V9Z A;  1JLG A;  4AHR A;  1U49 A;  4A57 A;  4M3T A;  3KHY A;  4IO9 L;  3PO4 A;  2KFN A;  4B8A B;  4GV3 A;  4BR9 A;  4JI8 K;  1RIL A;  5AR0 A;  4AHC A;  5A2Q O;  3RSE B;  1RDD A;  4JKA A;  3OYD A;  3AVH A;  3SV3 A;  4DF8 A;  3F2K A;  3OYM A;  4NLB A;  4E0D A;  1C0U A;  4EAH D;  3SJJ A;  3AA5 X;  3T3F A;  3QFU A;  4ELV A;  1T7P A;  4FWP A;  5D3G A;  3AVL A;  5AQW A;  1O13 A;  1IKY A;  3H08 A;  2Q0U A;  4CBU A;  2UU9 K;  3N4P A;  2HOE A;  1JCF A;  5TKY A;  3CF5 L;  1GLA G;  1WSI A;  4BG8 A;  4QCL A;  3MN7 A;  1KVC A;  3BY5 A;  2HW3 A;  1ILY A;  3D2F B;  4MFB A;  1BQN A;  2HST A;  4DTR A;  4BDP A;  3P5J A;  4IOX A;  4JI2 K;  3VER A;  4ICL A;  3VEY A;  4K42 A;  3L4Q A;  3NH0 A;  2VWB A;  3CPW M;  4C1N K;  4JKG A;  4HTU A;  3SUQ A;  3VQP A;  3QBW A;  4GNI A;  1YVN A;  4BR4 A;  4OLA A;  3PSI A;  5AQF A;  4FJM A;  4C8L A;  4DHY A;  4DFJ A;  5AZI A;  2W6K A;  5KPT A;  3MK6 A;  4BRO A;  4H5T A;  4JK9 A;  5HRN A;  2QKK A;  1NK0 A;  4BE2 A;  5F0X A;  2O8C B;  3DXK B;  3C7N A;  3ZSZ A;  2YHY A;  1K73 O;  4IOC L;  2W41 A;  1VQ8 N;  3QES A;  5SWM A;  3ZSQ A;  3JAM O;  5EVZ A;  2KFZ A;  3KK3 A;  1VQ9 N;  1SKS A;  5GAH P;  3RWU A;  4OLB A;  3M3Z A;  3KK1 A;  5K14 A;  1U6Z A;  4ZTF A;  1JXE A;  2Q2R A;  4R79 A;  4KHP K;  2UXC K;  1HNX K;  3QB0 A;  3DOK A;  4M7X A;  4ELU A;  1NK9 A;  1NJW A;  4B3M K;  1K8K B;  4O0I A;  2QK9 A;  3WEE B;  2A1S A;  4FJX A;  1WSG A;  4IOA L;  5F2R A;  3KIO A;  3JYT A;  2KZZ A;  1C0T A;  1HPM A;  3DLE A;  1C0G A;  2IC3 A;  4F8R A;  1U4B A;  3CME N;  1JXB A;  2P9L A;  1RDC A;  2PZS A;  1SAZ A;  4CFB A;  4CJW A;  4IFE A;  1VSE A;  4MQ3 A;  4CW7 B;  4A59 A;  4JI0 K;  2E1Y A;  5MLC Q;  1C6V A;  4FJN A;  3OYJ A;  3I8B A;  1ZBU A;  3CQ8 A;  1NOZ A;  1U2V A;  5KI6 A;  2F96 A;  1KD1 O;  4KI6 A;  4PUO A;  3M1F A;  2IDO A;  1BUP A;  1BI4 A;  2YCH A;  1Q9Y A;  4FK4 A;  5LL6 Z;  2VG6 A;  1QQN A;  4H4O A;  3ULE A;  3ZT0 A;  3P4I A;  1NOY A;  2P9S B;  2A5X A;  1VSL A;  4L3Q A;  1YI2 N;  2O8E B;  4IJN A;  1J6Z A;  3HL8 A;  1HNI A;  2HB5 A;  3IAY A;  3DLK A;  4F4K A;  4YHH K;  5KPZ A;  3KLI A;  3ZET B;  3T7Z A;  4W5N A;  3SV4 A;  5DK5 A;  3ZSO A;  2X6S A;  3G10 A;  2OPR A;  3VA0 A;  4DSI A;  2YX6 A;  3DLH A;  1YT3 A;  1KAX A;  5HRS A;  1LWC A;  3DRR A;  5AQP A;  4IEI A;  5JLF A;  3NH2 A;  4CEO A;  3MXM A;  2DTU A;  1WAJ A;  1TAQ A;  4LY7 A;  5AQK A;  3OS0 A;  3VTH A;  4LF8 K;  5ADX H;  3CIP A;  4DKW A;  5M1K A;  3C6H A;  3OS1 A;  3AVA A;  1EX4 A;  1VSH A;  4CE9 A;  2DY4 A;  1RT7 A;  3ITH A;  4B9T A;  3L3U A;  5FRO A;  5AQZ A;  4UQG A;  1K6Y A;  1XNQ K;  5CE3 A;  4W5O A;  1RNH A;  4H0O A;  4LF7 K;  2P9P A;  3OYL A;  4KH6 A;  4LSN A;  1SL1 A;  1T03 A;  2NRZ A;  4DCH A;  4CJ5 A;  3B6O A;  1N34 K;  3NHG A;  4U7B A;  3J8A A;  1S1T A;  3NVK A;  2D0A A;  4LD0 A;  2HBM A;  4OPJ A;  3CC4 N;  3SQ1 A;  3WNF A;  1JLF A;  4G1Q A;  2YNH A;  2HF3 A;  5CYQ A;  1MDU B;  4CI6 A;  4JYA K;  3D2E A;  1Z25 A;  2E2N A;  1GOC A;  4BE0 A;  1R0A A;  3AO5 A;  3VQB A;  1JCE A;  4BGA A;  5ADX A;  1R59 O;  3P38 A;  4FWO A;  3QEI A;  2KQ2 A;  1L3S A;  5CR4 A;  2JGU A;  5KGX A;  1ZBH A;  3A5L C;  1RT5 A;  4YOU A;  1QSY A;  4CK3 A;  4PQU A;  3F5T A;  3KLF A;  4BC3 A;  1LWE A;  4HTL A;  4FJ8 A;  3AAQ A;  2I7N A;  2F9T A;  4AHU A;  1DT9 A;  3OYN A;  2XY6 A;  3KZB A;  4DUY K;  1TUU A;  1X3N A;  3NH1 A;  4KRE A;  3AVI A;  3L2U A;  4FJ7 A;  3DLL L;  3O3G A;  1VSK A;  3O1W A;  1OH6 A;  1NG9 A;  1WSF A;  3MWP A;  4FWL A;  3LM2 A;  2ZJP L;  4HUF A;  3TI0 A;  5IT9 O;  3TSP A;  4B1W B;  2QA4 N;  3AO1 A;  3AV9 A;  3CCR N;  3NDK A;  3A5N C;  4GKJ K;  3VEO A;  2UUA K;  1Q7Y O;  2ITM A;  1QQC A;  2E2Q A;  5AQI A;  3E9O A;  1QQO A;  4DQQ A;  4CJ3 A;  3T1H K;  4NO7 A;  5LY3 A;  2P9U A;  2D0C A;  1SS6 A;  3CI5 A;  4DU1 A;  3VGM A;  4KTQ A;  2OTJ N;  1D4X A;  5BN9 A;  3MX2 A;  3UKU A;  4JKD A;  3AVM A;  3VTI A;  4N47 A;  1KLN A;  3Q7B A;  4FWM A;  4KFB A;  3IFR A;  2GUP A;  4CFD A;  3AAR A;  4DTS A;  3OYA A;  3OVN A;  3A5O C;  3VF6 A;  1IBL K;  3MEG A;  1H1V A;  1XC9 A;  4WQ4 A;  4M3W A;  4B1V A;  4ILG B;  1QZ5 A;  4H4M A;  3OYG A;  3D2F A;  3PIO L;  1SUQ A;  2HMI A;  2QWQ A;  4K8Z A;  3R6M A;  4XH4 A;  3U6F A;  3UIQ A;  4B3R K;  1IKX A;  4IG0 A;  3V9U A;  1RGI A;  1T8E A;  4BR5 A;  4Y0W A;  1KLM A;  4CZM A;  1EKE A;  2GWJ A;  4M3Y A;  4JHD B;  1RTD A;  2KZM A;  3KLG A;  4IJA A;  4JKE A;  4BRD A;  5BRD A;  2BTF A;  1KCF A;  3VF4 A;  4KH5 A;  4PWD A;  3LDP A;  3WXM B;  4CBX A;  1XWL A;  5HOO A;  2VQF K;  1HJR A;  4DV5 K;  3RR8 A;  1T44 A;  1B9F A;  2O8C A;  4PKG A;  3RVC A;  1BCO A;  3V1Q A;  5HL7 L;  3OYC A;  3FGU A;  3VGK A;  4DQS A;  2GUI A;  4DQI A;  4X66 K;  3FZL A;  2OPQ A;  1WBB A;  2NZT A;  3CER A;  2KHO A;  3TAE A;  3ID6 A;  3PX4 A;  1VQ6 N;  1VAZ A;  4BRH A;  2P5G A;  1XMQ K;  2UXD K;  5J2P A;  1BHL A;  2Z1G A;  3M6G A;  2W6L A;  3C6U A;  4KHS A;  4XIU A;  1MWM A;  4BRM A;  3WQU A;  1S1U A;  3SMP A;  3MDQ A;  1YVU A;  2E2O A;  3WEE A;  2E1Z A;  3QIO A;  3DM2 A;  3TPQ A;  3HM9 A;  4MLH A;  4MLE A;  1D9F A;  1KQS M;  4NCB A;  1LV5 A;  2O8D B;  1M1K O;  4FLW A;  3FFK B;  1TAU A;  1RBS A;  4A62 A;  4BC2 A;  2Q97 A;  3ULD A;  4H8K A;  4CF0 A;  3ZSW A;  1NM1 A;  3WT0 A;  3PY8 A;  3R3L A;  3OS2 A;  2Y1I A;  3LP3 A;  1NGE A;  4EFH A;  3ENB A;  3MEE A;  3TTC A;  1E4F T;  1BU6 O;  3P39 A;  2P9S A;  3GL1 A;  2QTD A;  2HNY A;  4FWR A;  3SUO A;  4BWJ A;  2HVI A;  2OA8 A;  3HTV A;  2PFU A;  4CGG A;  1EWQ A;  1HLU A;  4C8N A;  4CZE A;  5FRM A;  3LDS A;  3ZET A;  1X3M A;  4I6M A;  4FWS A;  4DFM A;  1U45 A;  1RT4 A;  1L3T A;  2IOC A;  3VQ4 A;  4JS4 A;  3E66 A;  2IGI A;  4DV2 K;  4DV6 K;  3CCM N;  4H0T B;  3R1X A;  4YFU A;  1S9G A;  2D4W A;  3O5B A;  4OKK A;  4ZHR A;  4Z4F A;  2X6N A;  2WOM A;  2AP1 A;  2E2P A;  3MWT A;  4O5B A;  3K0S A;  1NGJ A;  5FPE A;  3CXC M;  5DM7 L;  1SKR A;  5FPM A;  1ZBF A;  1DTT A;  2IVO A;  1VQM N;  1W7A A;  5HP1 A;  2HMP A;  3U4L A;  3I33 A;  4QS8 A;  4MO4 A;  4H0X B;  3NMU A;  3KTQ A;  1YTA A;  1HKB A;  4B9U A;  3J7Y P;  4DFK A;  4JI6 K;  2XY7 A;  4UY8 O;  4ID5 A;  4FK2 A;  1CLQ A;  4LH5 A;  3ZT1 A;  4IDH A;  5JVG L;  1S3X A;  3LWL A;  4WF9 L;  1IBK K;  1GLD G;  4NXM K;  1JLQ A;  3H46 O;  1HPZ A;  4LH4 A;  5BRE A;  1S22 A;  4LFB K;  4LC9 B;  3W3D A;  4DWI A;  2P5O A;  3NFA A;  3K5L A;  1WBD A;  3LAK A;  4JI5 K;  4FJG A;  3J7A P;  3ASM A;  4O5F A;  3THW B;  3ZSY A;  1NK4 A;  1X9S A;  3U3Y A;  5BR9 A;  1XHX A;  3DMJ A;  1YHQ N;  2FF3 B;  2QWM A;  2Z1H A;  3NE6 A;  3I55 N;  5BR8 K;  2R7Y A;  1D8Y A;  3SNN A;  4PY5 A;  2BAN A;  4DF4 A;  1Q18 A;  1VSF A;  1VQP N;  1NGH A;  5JS1 A;  1JL1 A;  3O08 A;  2YKN A;  2GTD A;  2P9N B;  2OPS A;  1TL1 A;  2DFF A;  5E84 A;  3TTF A;  2HNZ A;  3HPO A;  5M1P A;  4CIF A;  4CZF A;  2X78 A;  5AFU H;  3ZT3 A;  3V81 A;  3CC2 N;  3VQ7 A;  4EP5 A;  1VQL N;  4FOE A;  4BVP A;  2UYT A;  3G0Z A;  3A0I X;  5FLX O;  1RBV A;  3ZEU B;  4DR5 K;  4C23 A;  1KFD A;  3AVK A;  3RMC A;  1D9D A;  4CF2 A;  4KHN A;  1KXP A;  4Z0U A;  3M8S A;  1OH8 A;  3S3M A;  1D5A A;  3DAW A;  1C0F A;  1OH5 A;  3CG7 A;  1LOT B;  2A40 A;  4FK0 A;  4AQY K;  4XH5 A;  5CZ2 A;  1QHT A;  3VQA A;  1ASU A;  2NUB A;  4CEZ A;  4DTU A;  1VQO N;  3QER A;  4BC5 A;  1C1A A;  2VCP A;  1N33 K;  3WXK A;  4CGH A;  3T1A A;  5F1X A;  4CES A;  4DG1 A;  2G8F A;  2XHB A;  3CMA N;  4CF8 A;  4CF9 A;  1RCH A;  3V9S A;  2WFB A;  1ZBI A;  4RW9 A;  5AFU A;  4C8K A;  4Z4C A;  4JN4 A;  4MDA A;  2HHT A;  2V7Y A;  2DFH A;  2LSN A;  4BRK A;  3RRG A;  3VQC A;  3SQ4 A;  2B6A A;  2QWL A;  3QEX A;  1HNW K;  4WFB L;  2QXL A;  4IFY A;  2PYL A;  1NKE A;  3G4S N;  3D0P A;  4JEP A;  1KVB A;  4C1N I;  3R8E A;  4CJQ A;  5CZ1 A;  3DXM A;  1CZA N;  3VQ8 A;  1HQU A;  1TGO A;  3J80 O;  4LF9 K;  5LJW A;  2D0B A;  1KC8 O;  4B9S A;  2ASP A;  4O8U A;  3LAN A;  3IMX A;  3LAL A;  1RBT A;  3VEZ A;  4KPY A;  3C94 A;  4K25 A;  5EOY A;  4JAX A;  3CCU N;  3P83 D;  3U9Z A;  2PY5 A;  1HYS A;  4FO0 A;  2FBX A;  1IBM K;  3UE5 A;  1YAG A;  3QO9 A;  4H5R A;  4J2B A;  1NGD A;  4CIG A;  2YNI A;  3FZH A;  1FKP A;  4F2S A;  4F9O A;  4JV5 K;  3FLC O;  4W5R A;  4FLY A;  5AQO A;  2Q36 A;  3OJS A;  1YXQ A;  2A42 A;  4CIE A;  2W42 A;  4WE1 A;  3L2Q A;  4BRI A;  2G8U A;  1Q86 O;  1SZ2 A;  3E9P A;  4FZZ A;  3I0S A;  3BEX A;  2ZQB A;  3NAE A;  3OYE A;  4OO1 J;  2IAJ A;  5AQX A;  1TUY A;  4BRP A;  2F8T A;  2FF6 A;  4LFA K;  4HVJ A;  3CD6 N;  2YKM A;  2GBZ A;  1XNR K;  2JWK A;  3CCL N;  1WLJ A;  2YI1 A;  2EX3 A;  3KKS A;  4CEA A;  3O3F A;  5J2M A;  4Z4E A;  4FLT A;  2Q1N A;  3WNG A;  1JLB A;  3FR0 A;  3TAR A;  1YJW N;  1V4S A;  2HHH K;  5H1S Q;  1W9H A;  4I2Q A;  4HWI A;  1SL2 A;  1T6D A;  3WQT A;  3BUZ B;  1WN7 A;  2IVP A;  2E6M A;  4A5B A;  2O8D A;  3RR7 A;  4B1X B;  4KTZ A;  2HHU A;  1QE1 A;  1BOT O;  4DU4 A;  3DRS A;  2GWK A;  2DPN A;  4GY2 B;  5AQH A;  3E1Y A;  2GEM A;  1WNS A;  5IWA K;  3QBX A;  5C2F A;  4HCB A;  3ZCM A;  5HBM A;  1RBU A;  1NKB A;  5CHI A;  4FW1 A;  2NRR A;  2GX9 A;  3HRG A;  3LDN A;  3BGR A;  1Q81 O;  3CQX A;  1ZBS A;  4DV0 K;  1SV5 A;  1F21 A;  3TWH A;  2A6A A;  3OY9 A;  2WC9 A;  1TK5 A;  4B3T K;  1QQM A;  1JLA A;  1L5U A;  1FKO A;  1IG8 A;  3C0B A;  3VQQ A;  3QEP A;  3TAP A;  2FC0 A;  2CGL A;  5E41 A;  4DQP A;  3AVN A;  3DYA A;  4RW8 A;  4ISF A;  4CVN E;  3DJC A;  4LF6 K;  1OH7 A;  5KPR A;  1KSP A;  4FJK A;  4WFN L;  4FXD A;  1I3A A;  4CZG A;  3HJF A;  1HYV A;  1NK5 A;  2UUB K;  4KH4 A;  3THV A;  3UB5 A;  5I9E B;  3JXU A;  1JJ2 M;  3C6A A;  1NJY A;  1J5O A;  1TKX A;  1X9J A;  3AVB A;  3K58 A;  4EZ6 A;  1NGG A;  4X64 K;  4FZX C;  2F9W A;  3QML A;  3L3V A;  3TSQ A;  5KTQ A;  4JKF A;  3SQ0 A;  2PAV A;  1NGA A;  3G6E N;  1HX1 A;  4O44 A;  4KHW A;  1WB9 A;  2XY8 A;  1L3V A;  2WBN A;  3CET A;  1P90 A;  4DSF A;  1EXQ A;  2G8H A;  2QEX N;  1NGI A;  3HOS A;  1NK7 A;  4BDY A;  4YOR A;  4DTO A;  2P9K B;  4Z4H A;  4FWK A;  3CCQ N;  4DR6 K;  3SAG A;  2E88 A;  3THW A;  3F73 A;  1BDG A;  4LFC K;  3NGI A;  5HRR A;  2OAN A;  3J81 O;  4H5W A;  1J53 A;  4EP4 A;  5GAD P;  3O9R A;  2ZJR L;  4OPH A;  1KRP A;  4E7J A;  3GG4 A;  2E5L K;  1E4G T;  4A5A A;  4J8F A;  1B9D A;  1BO5 O;  1GLB G;  2YHB A;  1QVG M;  1RT2 A;  3AVC A;  5TKW A;  4AHS A;  2ZD1 A;  3KLH A;  3K59 A;  4DSK A;  4OPA A;  3H1Q A;  4M41 A;  4YNQ A;  1EO1 A;  2FSK A;  2P9N A;  1NWK A;  2VGN A;  1O1W A;  4JS5 A;  1M90 O;  1BG3 A;  3SBT A;  4H0V B;  2KTQ A;  2WUS A;  4GV6 A;  1TKT A;  1V4T A;  4EZ9 A;  3TU5 A;  3OBW A;  4BAC A;  3D6R A;  3HXM A;  2I5J A;  4BR2 A;  2VGM A;  3P31 A;  3C95 A;  1J5E K;  2E4L A;  3TAG A;  1ATN A;  3BDP A;  3H45 C;  3ZLJ A;  2QXF A;  4W5T A;  2QI2 A;  1YIJ N;  4CHY A;  1S72 N;  3LM9 A;  4AM7 A;  3ATV A;  1TYQ B;  3IG1 A;  3RTV A;  1QS4 A;  1BIZ A;  1S9E A;  4O0J A;  2E20 A;  3TAF A;  5AQT A;  3RSE A;  1S1X A;  2X74 A;  3ZX2 A;  4CZJ A;  1ASW A;  3AVJ A;  1YJ9 N;  3NBP A;  3VEX A;  1U04 A;  3NCI A;  3CFR A;  2W40 A;  3SZ2 A;  3RRH A;  5LJV A;  4OKJ A;  4BC4 A;  5LMN K;  2O4G A;  1VSD A;  5C15 A;  4V19 S;  5C25 A;  4N41 A;  2H3G X;  3EYZ A;  3F9M A;  4B3O A;  4OJR A;  2HHS A;  1RT6 A;  3E01 A;  4YOT A;  1CZB A;  4FZY A;  4O55 A;  3M5R A;  2HHQ A;  3LDO A;  2QM1 A;  3MEC A;  4PKH A;  5HLF A;  3CC7 N;  1RT3 A;  1QSS A;  3CM5 A;  3HST B;  4E1J A;  3V4I A;  2D5R A;  2DFE A;  3A5M C;  3I0R A;  2VWK A;  4DTN A;  4DSL A;  2P1J A;  3DRP A;  4BR0 A;  4Y1D A;  3CJ9 A;  2VQE K;  3C65 A;  3O9U A;  3THY B;  3WXJ A;  3DXK A;  3IDH A;  2WTU A;  4JLH A;  3V1R A;  3FE1 A;  1NJI O;  3O4N A;  1BQM A;  3RMB A;  4FJ9 A;  3OYH A;  2JLE A;  3CM6 A;  3TSU A;  2BDP A;  3DWL A;  3CCV N;  4FM1 A;  1HKC A;  3LP0 A;  4CJP A;  3U9D A;  2FBV A;  3O4Q A;  5B8H A;  3AA2 A;  1K8K A;  5GAE P;  1WSJ A;  4N56 A;  3ZSR A;  2HHX A;  3ENH A;  1DTQ A;  3WNE A;  4GW6 A;  5BRH A;  4B9N A;  3LZI A;  5EY4 A;  4DQ8 A;  1XQS C;  4OX9 K;  4QAG A;  2Q31 A;  5DMR A;  3WUH A;  3QDK A;  3H3N O;  3CJ7 A;  1ASV A;  1HUX A;  4W5Q A;  4JD2 B;  5C42 A;  2B5J A;  4KRF A;  2EWS A;  4JRP A;  1S5J A;  4CHZ A;  1REV A;  1GOB A;  5JLH A;  2RPI A;  3VF2 A;  2QKB A;  3SUN A;  4DR4 K;  3K2P A;  3WNH A;  4RW6 A;  4E7K A;  3PV8 A;  3CPE A;  1IKW A;  5DM6 L;  4DS5 A;  1YTU A;  4B9Q A;  2O8E A;  3VMF B;  1BWF O;  1XC3 A;  4PA1 A;  2KKZ A;  3EE8 A;  3HI0 A;  1TVR A;  5JVH L;  4CGJ A;  4B9M A;  3GE1 A;  4H0P A;  1VRT A;  4IZ9 A;  1KAY A;  4RG8 A;  5KRS A;  4YOY A;  4WQ5 A;  5FDL A;  1WOQ A;  3MMV A;  3KD5 E;  1S6Q A;  3JS6 A;  4A61 A;  3O3H A;  5GIO A;  1Z26 A;  4OVL A;  2XY5 A;  3FZF A;  4CJK A;  1BCM A;  2VYP A;  3QEV A;  3GBT A;  4DV3 K;  3OW2 M;  2V7Z A;  4HCC A;  3V6D A;  1GLE G;  4M3Z A;  1UAX A;  5M1O A;  1TK0 A;  3SCX A;  3CYM A;  1TKD A;  2KW4 A;  3HM8 A;  4H5V A;  1S6P A;  1GLJ O;  4OKE A;  1UA1 A;  4GV9 A;  4DU3 A;  2OTL N;  3O80 A;  4NYF A;  4BRE A;  1OVY A;  2P9P B;  4FWQ A;  4E7I A;  4YY3 K;  2GV9 A;  4CJE A;  5I42 A;  1E3M A;  2F7T A;  4MDB A;  3T1Y K;  4I9Q A;  4CK2 A;  4JI4 K;  4NXN K;  1NU0 A;  3MCP A;  4ILJ A;  4CJF A;  5EU7 A;  4E19 A;  3PLA A;  5J2Q A;  5BPN A;  3JSM A;  4Q0B A;  1JLE A;  5CYM A;  3O6W A;  3BF3 A;  4CHP A;  4BRF A;  3DOL A;  4M63 C;  3ZSV A;  3AO4 A;  4CER A;  4FPB A;  1QTM A;  4CED A;  4JI1 K;  3QNO A;  3EN9 A;  3S41 A;  3LP1 A;  4KTW A;  2HBJ A;  1IG9 A;  2P9K A;  1YJN N;  4ZTJ A;  3E9L A;  4FCY A;  2NRT A;  3L2V A;  3RMA A;  1IKV A;  3V9X A;  3QEW A;  3ISN C;  1OVQ A;  1K9M O;  1Y97 A;  2ITG A;  3SI6 A;  4I9L A;  1GLL O;  3FZK A;  5C12 A;  3LL3 A;  2XO7 A;  3G71 N;  1NGB A;  1T3V A;  1DEJ A;  3CJC A;  3NF9 A;  4KBO A;  2B4J A;  3FZM A;  4BRN A;  4Y1C A;  5AQN A;  4CGF A;  4DV1 K;  3MN5 A;  1NJZ A;  3HPH A;  2ZF5 O;  5AZJ B;  1NMD A;  2IS3 A;  1T6C A;  1VSJ A;  3K5O A;  4CFC A;  4JKB A;  1VRU A;  4GMJ B;  4E1M A;  1RDB A;  3U8X A;  2NRV A;  4O4G A;  1QSL A;  1DLO A;  3PIP L;  4M3U A;  4KAZ A;  1IV0 A;  3EY1 A;  1RTH A;  3ENO A;  4DLG A;  4ELT A;  1WUA A;  4IWV A;  2V51 B;  4GVM A;  3SPY A;  4RTF D;  4FLV A;  4CJS A;  4NCA A;  5C0Y A;  3VQD A;  3L8B A;  4CHN A;  1J54 A;  4IKF A;  4FJJ A;  3NF8 A;  4OGC A;  3SJH A;  5JIC A;  1NKC A;  3SYZ A;  3ATU A;  3K5N A;  1TYQ A;  2O8B B;  4B9V A;  1HYZ A;  3HT3 A;  4F3T A;  4JK7 A;  2AA4 A;  2P9U B;  1UA0 A;  1NLV A;  4H0Y B;  3KKR A;  1N32 K;  4E7L A;  1HRH A;  5T7B A;  1I94 K;  4KHU A;  3UKU B;  4DFP A;  2RE2 A;  1RTI A;  4DLE A;  2FXU A;  3EO3 A;  3HSC A;  4Z4I A;  2HHW A;  1XHZ A;  4NCG A;  2QW9 A;  3B6P A;  3OA9 A;  3S3N A;  3QIP A;  3NGY A;  2ZM6 K;  3HVT A;  4FOI A;  4BR7 A;  4XH1 A;  1VQ5 N;  2VG5 A;  3MXJ A;  4IDK A;  1XMO K;  5C10 A;  4CF1 A;  2ZJQ L;  4E7H A;  2YHX A;  2RKI A;  4C8O A;  3HBT A;  5KQD A;  3RMD A;  2FLO A;  3TAB A;  2AJQ A;  1Q82 O;  3LZJ A;  4JHD A;  2EHG A;  2OYQ A;  4JKC A;  5BPM A;  1HMV A;  4AHT A;  4JNE A;  1Q8I A;  3D45 A;  3EE9 A;  1HNZ K;  4F3O A;  4FJH A;  2RF2 A;  2J4R A;  1RDU A;  3ZT2 A;  4Q5V A;  3OYF A;  1ESV A;  3A2F A;  3THY A;  1I39 A;  4JI3 K;  3L2W A;  4FM2 A;  4BVO A;  3HK2 A;  4JRQ A;  1EQY A;  5SZT A;  4ISG A;  4M45 A;  4MO5 A;  4R5P A;  1QZ6 A;  2NRW A;  4E1N A;  4BRA A;  4PL7 A;  3AA4 A;  1ZXO A;  3GDQ A;  1OKJ A;  1YF5 L;  3AA3 A;  3AY9 A;  4WQ5 C;  4FVU A;  3WXI A;  1VSM A;  4BGB A;  4K8X A;  3EL2 A;  3BZC A;  4NLC A;  3TTD A;  2RHK A;  4XEI A;  2ZWH A;  3VPZ A;  3O9S A;  4YOX A;  1GLF O;  4CEE A;  1WSH A;  4YOV A;  3QNN A;  1TK8 A;  1NK8 A;  4EIA A;  4ILH A;  4CJ7 A;  2FSN A;  3CJB A;  3MN6 A;  1G15 A;  5EXW A;  3V9W A;  3K5M A;  4I2P A;  2PYJ A;  1IJJ A;  4FVM A;  4JD2 A;  3SMS A;  5AQM A;  4BRG A;  2Q0R A;  4QS7 A;  3OJU A;  1U48 A;  3THX B;  3AVF A;  3B8A X;  3K9K A;  4BRC A;  3H6E A;  5GIN A;  4KO0 A;  2E8A A;  4CFA A;  3KJV A;  1ITG A;  5AQS A;  4K43 A;  3S3O A;  3HP9 A;  1Q9X A;  4AM6 A;  1EET A;  3BP8 A;  2ETJ A;  2PBD A;  1LWF A;  4JI7 K;  1XUP O;  4FSV A;  4B1Y B;  4DSE A;  3NGZ A;  3KVG A;  2GEL A;  4BRL A;  3OHR A;  4FLZ A;  3O4W A;  3L0Q A;  3ALY A;  3H1V X;  1NJX A;  1KVA A;  4O8K A;  3R9P A;  5J1E A;  4KB0 A;  4CEC A;  2NRX A;  1DGK N;  4I6M B;  4CZI A;  4B1Z A;  3O8M A;  4RCH A;  1KTQ A;  1L3U A;  2OPP A;  2VG7 A;  1BA0 A;  3SUP A;  1EP4 A;  1J9A A;  4OGE A;  3KWI A;  1FXX A;  4DTJ A;  1FK9 A;  2A3Z A;  4DMN A;  5JS2 A;  1CXQ A;  4IO8 A;  5JMV A;  4AF1 A;  1HKG A;  2P9I B;  1C1B A;  5EX5 A;  1XI1 A;  3MX5 A;  5ELZ A;  4OPK A;  4CJL A;  1LAV A;  3M8P A;  4FL9 A;  1S1W A;  1YUW A;  5C24 A;  5BRF A;  4RWT A;  2BH1 A;  2OCE A;  3VET A;  3OYI A;  1BIU A;  3NVM A;  4KB1 A;  1C0M A;  1BGX T;  4CGD A;  1EWR A;  2FBY A;  3ZT4 A;  1T05 A;  1LW2 A;  3T69 A;  3SQ2 A;  2O8F B;  1W97 L;  2D0P A;  2P51 A;  2XRI A;  1YIT N;  4DB3 A;  4FM0 A;  1DKG D;  5AQV A;  2FSJ A;  4J2D A;  4FLU A;  3HOT A;  1JLC A;  2KLA A;  5HRO A;  3SBG A;  3SAH A;  4DTP A;  4A2B A;  4NYN A;  4CJR A;  2RN2 A;  3LWM A;  4K0K K;  4LSL A;  3VA3 A;  1UWB A;  3CFO A;  1VK0 A;  4DUZ K;  1LW0 A;  3LAM A;  3CQY A;  5HRP A;  4J2A A;  3PX0 A;  3VQ9 A;  3TAQ A;  4QS9 A;  3IUC A;  2NLX A;  4RW7 A;  2QWN A;  2Q3S A;  3VQE A;  2D0O A;  1LAW A;  4YDU A;  3L2R A;  1RBR A;  2QWR A;  3EKU A;  3G25 A;  3I56 N;  1HJO A;  3DI6 A;  4IBN A;  2A1R A;  4G9Z A;  3UKR B;  5KGW A;  4CZL A;  2Z1I A;  4DR1 K;  1VHX A;  2Y1J A;  4A2A A;  4H5N A;  3L4I A;  2F8S A;  3AGK A;  2A41 A;  4E89 A;  4DS4 A;  2G8W A;  1NBW A;  3KLE A;  4M3R A;  1SL0 A;  5AZJ A;  1VQ4 N;  4CEB A;  5GIP A;  3ZSX A;  5C2D A;  2CH6 A;  2NNW A;  4L8R B;  4CJV A;  3CJA A;  4FW2 A;  3ZEU A;  1VSI A;  2BUP A;  2CGJ A;  5AQL A;  1VQN N;  4CD1 A;  3LDL A;  2ASO A;  1WAF A;  3BZK A;  1A5V A;  1K8A O;  4CK1 A;  1W0H A;  1C1C A;  3VES A;  2ZE2 A;  4DTX A;  2YJE A;  3VEV A;  2HND A;  3ZX3 A;  1NGC A;  1A5W A;  4GKK K;  4ID1 A;  4F2R A;  3DLR A;  2JWL A;  3U3G A;  4B3S K;  3I8D A;  3QIC A;  2HVH A;  4DSJ A;  4DV4 K;  1U47 A;  2O8B A;  1QVF M;  2G8K A;  3CCJ N;  1WSE A;  3EZW A;  3DLG A;  4ISE A;  4LF4 K;  4B8C A;  3HPG A;  1NMN A;  4AHV A;  1HR0 K;  1S1V A;  4BG9 A;  4CJ4 A;  3NF6 A;  2BE2 A;  4N76 A;  5M1F A;  1SKW A;  3CCE N;  3LPU A;  4LF5 K;  2HHV A;  3LDQ A;  4BDZ A;  4HUG A;  4CGI A;  3FFI A;  4BWM A;  4BY9 C;  2IVN A;  1VQK N;  5BN8 A;  4JKG B;  3PX6 A; 
#chains in the Genus database with same CATH homology
 4DUZ K;  3OTO K;  4DV0 K;  3T1H K;  4B3T K;  4LF9 K;  3J80 O;  4DR7 K;  4DR3 K;  1XNQ K;  4KHP K;  4DR2 K;  2UXC K;  1HNX K;  4LF7 K;  5BR8 K;  4YY3 K;  1N32 K;  4B3M K;  1I94 K;  1N34 K;  4DV7 K;  4CVN E;  3T1Y K;  1J5E K;  4LF6 K;  4JI4 K;  4NXN K;  1IBM K;  4JI7 K;  1IBL K;  4DR1 K;  2UUB K;  4OX9 K;  4JYA K;  4JI8 K;  4JV5 K;  2ZM6 K;  4JI1 K;  4CW7 B;  4JI0 K;  5A2Q O;  5LMU K;  2F4V K;  4X64 K;  1XMO K;  4B3R K;  4DV6 K;  4DV2 K;  5LL6 Z;  5FLX O;  2UUC K;  4DR5 K;  4DR4 K;  5LMN K;  4LFA K;  1HNZ K;  2UU9 K;  2UXB K;  4V19 S;  1XNR K;  2VQF K;  4DV1 K;  4DV5 K;  4JI3 K;  4YHH K;  4JI2 K;  4AQY K;  4GKK K;  4X66 K;  4DR6 K;  4DUY K;  4LFC K;  1FJG K;  4B3S K;  2HHH K;  1N33 K;  4DV4 K;  3J7Y P;  3J81 O;  4JI6 K;  1XMQ K;  2UXD K;  4X65 K;  4LF4 K;  5IT9 O;  1HR0 K;  1IBK K;  5AJ3 K;  4NXM K;  1N36 K;  2VQE K;  2E5L K;  5IWA K;  1HNW K;  4LFB K;  4DV3 K;  4LF5 K;  4K0K K;  4GKJ K;  2UUA K;  4LF8 K;  4JI5 K;  3J7A P;  4X62 K;  3JAM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...