1HNWK

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 1hnwK00
4DR6K 4DV3K 1HR0K 2VQFK 1N33K 4DR2K 4LF5K 5FLXO 4DUYK 4DV7K 4DR3K 4CVNE 4B3TK 4LF4K 1XMOK 2VQEK 4X64K 2F4VK 4JYAK 5LMUK 4CW7B 1IBMK 4JI1K 5LL6Z 4LF6K 2UUCK 4DR1K 4DR5K 1N32K 5IWAK 4LFAK 3OTOK 4DV4K 1FJGK 3T1YK 4NXMK 2UU9K 2ZM6K 2UUAK 1HNXK 1HNZK 4GKKK 4K0KK 1HNWK 4LF8K 1XNQK 5LMNK 1XMQK 4X66K 4V19S 4DV2K 4YY3K 4NXNK 1XNRK 4B3RK 1IBKK 4JV5K 4YHHK 1J5EK 4DV1K 4LFBK 4JI0K 4DR4K 2UXDK 4X62K 4B3SK 2UXBK 3J80O 1N36K 5IT9O 4LF7K 5A2QO 4X65K 1IBLK 4DV5K 4AQYK 4JI8K 4DV0K 4JI6K 4DUZK 4LF9K 4DR7K 4JI4K 1N34K 2E5LK 3J7YP 4B3MK 3J81O 4JI7K 2HHHK 4JI5K 3T1HK 1I94K 4JI3K 4KHPK 2UXCK 4OX9K 5AJ3K 4GKJK 4JI2K 5BR8K 3J7AP 4LFCK 3JAMO 2UUBK 4DV6K
chains in the Genus database with same CATH superfamily
4WQ5A 4B08A 2GBZA 4DV3K 1Q81O 1CZBA 4M3WA 4H8KA 2A5XA 1DEJA 3H3OB 1ASUA 1BQMA 3VQ7A 2YHWA 1TV6A 3AVLA 5CYMA 2G8KA 1T44A 3TTDA 3AVAA 3CQXA 4MO5A 1VHXA 3AVBA 4LF6K 2JWKA 2V7ZA 4JK8A 3ZSQA 4BR9A 1WLJA 3E01A 2G8WA 2RKIA 3C94A 2UUAK 3IFRA 1JLAA 1S6QA 4O5BA 2WFBA 1CZAN 1OH7A 3O4QA 4B1WB 4MDBA 4C8OA 4BRQA 3L2WA 2E6LA 3FFKB 3NGYA 2NRZA 5KTQA 4V19S 2W41A 3BZCA 4KRFA 2W42A 5E26A 5FRMA 1XNRK 2FXUA 3AVGA 1C1BA 1NG9A 1NGEA 3HVTA 5JVHL 4DV1K 4PHTX 2AA4A 4CHOA 4B9LA 2YJFA 4OKKA 3AARA 5CZ2A 3CC2N 5IT9O 1B92A 4CFAA 1L3SA 3PSIA 3NH1A 4DQIA 4OGCA 1M1KO 3PO5A 1Y97A 4EZ6A 1HQEA 1T7PA 3GBTA 4N76A 2RN2A 1VAZA 4CHPA 1NLVA 4FJGA 3L4IA 3IG1A 1KRPA 2GEMA 1JL2A 3KK7A 3SPZA 2B5JA 3THYB 2E8AA 3QNOA 5AQNA 4R5PA 3ATVA 3PIPL 1S9GA 4UQGA 3U9ZA 3P31A 1EX4A 2KZMA 2O8EA 4DSFA 1E4GT 4ICLA 5CE3A 4KHPK 5FROA 4E7JA 4EZ9A 1YIJN 4IO9L 4OLAA 3OYCA 2ZJRL 4CD1A 2WTUA 4CJ5A 4XH1A 2UUBK 3KK1A 1KSPA 4EFHA 4NYFA 4O55A 3NVMA 3WUHA 2GWJA 1RNHA 4BR0A 3QEWA 4CK2A 2F96A 1NGAA 3C0BA 3HL8A 1ZYQA 3NGIA 3O4NA 1KLNA 3HPOA 1YJ9N 3I56N 4U67L 2AP1A 1IBMK 4FK2A 4C1NI 1BI4A 1FKOA 5BRFA 5AQTA 4FLZA 1NGFA 4YOUA 3CJ1A 2FF3B 1R0AA 1JLBA 2WUSA 3OYHA 1JJ2M 4AHVA 5KQ8A 3CFPA 2PY5A 1YJWN 1HNWK 1GOBA 2BE2A 3O08A 4RW9A 1NGGA 4H0XB 1A5XA 4WCEL 2Q36A 3R6MA 1NGIA 1DLOA 1JLQA 2O8DB 1K8AO 2CGLA 1JL1A 1VQMN 2RF2A 3TSUA 3TR8A 1S1WA 3D45A 5EX5A 4QS7A 2WOMA 4EIAA 3O80A 3H46O 2O8CB 1BWFO 3THXB 3LPUA 4KREA 2Q0UA 4AQYK 1ASVA 4RTFD 3TPQA 3TAEA 4DSEA 3M8PA 1YITN 3AVIA 3JYTA 4XH4A 1YF5L 3DLGA 1DGKN 3LAMA 1BCMA 3DXMB 1OH5A 1LOTB 4LH4A 4A59A 1S72N 4H03B 4F4KA 4RW6A 1YT3A 2O8FA 3ENBA 4CZGA 3SBGA 1V4TA 4N47A 3CCSN 3QLHA 3G71N 1QTMA 5BN8A 3SLCA 3WQUA 4AF1A 3L4QA 2YHAA 3ZT2A 2Q31A 3NH2A 2P9IB 5HRSA 3M8SA 2QKBA 1TAQA 5AQFA 3ULEA 1VQLN 3DI6A 4M45A 4DSJA 2V52B 5F1XA 2E88A 3OYLA 2A1SA 4X64K 4DFJA 3E66A 3QERA 5D3GA 3KLHA 5KPZA 3MAQA 1JLEA 2OZSA 5AQQA 5KI6A 4B9SA 4FWPA 4CF8A 1RT1A 1Z26A 3QMLA 1RBRA 1BO5O 4W5OA 4Z4IA 4MDAA 3FGUA 2X6SA 4WQ5C 3THWA 4B9VA 5TKYA 3O3FA 1S1TA 2E4LA 3DLLL 5AQXA 4BC3A 1VK0A 3VEWA 1S6PA 5BPNA 1Q8IA 3CCVN 4CEFA 2VWBA 1SV5A 2HHUA 2KHOA 3C7NA 4CJ4A 2F7TA 3VA3A 4KH6A 3I8DA 3ALYA 3IKMA 3KIOA 4FZYA 3EKSA 4CJ3A 1D8YA 4O0JA 1GLCG 3DRPA 3BF1A 2AJQA 3S3NA 4FZXC 4BRHA 4ZTFA 5KGXA 2GELA 1QQNA 3LM2A 2KLAA 4J8FA 3IS9A 2NRVA 4ILHA 4B3MK 4CBXA 3KVGA 2OA8A 5JMVA 4B1XB 4FJMA 3CC7N 1S3XA 2HHWA 3H1VX 4DU4A 4XEIA 4OLBA 3R1XA 2PFUA 4CJEA 3TANA 3C6UA 4CZKA 4H0OA 3SMPA 4MO4A 1LV5A 4A2AA 3VGMA 3ZT4A 4CZHA 3VQ5A 1HKGA 1SL2A 4AHTA 4RG8A 5DMRA 4IFYA 4YOXA 4KTZA 1BCOA 1JLCA 3TAFA 1YI2N 3P1GA 4CJVA 3C6AA 1RCHA 4M42A 1C0GA 3KZBA 3LDPA 2VCPA 3F9MA 2OTLN 4JRPA 3CF5L 2HBLA 4H0PA 5CY4A 2VG5A 2DTUA 3LDNA 4QCLA 4DV4K 2PYJA 4BRFA 1BISA 3G4SN 4HUFA 2OPSA 1QSLA 3L8BA 4CEBA 5E84A 1C0MA 3THYA 3CI5A 3HT3A 4E0DA 1HJRA 3KD1E 3WXMB 3U9DA 1CLQA 5B8HA 1N6QA 1HMVA 3OA9A 1SKSA 1C0UA 3CCMN 5C0YA 5C2FA 4YHHK 3G0ZA 2FF6A 3VF6A 1J5EK 4KTWA 4YDUC 2Q97A 3HZ6A 2G8HA 4X62K 3V9UA 4CD3A 2YNHA 3DM2A 3HXMA 5BRDA 3O9QA 1LW2A 5A2QO 3O4WA 3AA2A 1U04A 1XUPO 4DV5K 2XY6A 3VEYA 5AQRA 3H45C 4M3RA 5AZJB 1JLFA 1E4FT 3WT0A 1U4BA 3FE1A 4JS5A 4BE2A 2VWKA 1ILYA 1X3MA 3VERA 2Z1JA 1B9DA 1N8RO 3CERA 3J81O 1EWQA 3LPTA 3S41A 2OCEA 3FZHA 4J2AA 4NB4A 4CJTA 1C6VA 3L2RA 4GKJK 1WAJA 4K8ZA 2QWQA 1TL1A 3PIOL 4BC2A 3PV8A 5F2RA 4OPJA 4HUGA 4FJHA 3TTFA 3SUOA 3S3OA 2JWLA 3F9KA 1RBSA 4LF5K 2IVPA 5GAGP 3SV4A 1TK8A 2O8DA 1O1WA 1HX1A 2HVHA 5BREA 3EO3A 1SQKA 1OKJA 3UIQA 3IAYA 4CFBA 2O8CA 1DT9A 3THXA 3OYBA 4Z4GA 3TU5A 4DR1K 1SKRA 1ITGA 3OYGA 4FYDA 3RR8A 2KFNA 2CH6A 1NGCA 2HBJA 4Q0BA 2VYPA 3KLEA 3ZYYX 4RW8A 4CGGA 4CEZA 4N5SA 3G10A 3DXMA 5AQGA 4JK9A 2ZJQL 1L3VA 1XI1A 4WF9L 3OJSA 1S1UA 4CJFA 1WAFA 3WNEA 3SUPA 2FBXA 4BRGA 4JV5K 2P9PB 4Z4EA 1VQNN 3FZMA 3D2FB 5LJWA 4DSKA 2IVOA 1FXXA 1ESVA 4B1VA 4GV3A 2P9IA 2BTFA 1HLUA 2VG6A 4C23A 5C15A 1KAZA 3U4LA 4FW1A 4I2QA 3R3LA 1X9JA 2O4IA 4NLCA 4AM6A 3ZEUB 1ASWA 2P5OA 5HRNA 3O9SA 4Z4FA 3VPZA 4HCBA 3OBWA 2O8BB 1WOQA 3QBWA 3CMEN 1NOZA 4TSXA 3QIPA 1VSJA 4KO0A 4CF9A 1UA1A 3SNNA 2XY5A 1QQCA 4E1MA 3QNNA 2Z1IA 3NMUA 4DS4A 5C42A 4MLHA 4FM0A 2YNFA 4CZJA 5M1FA 4JKGB 5DM6L 1VQ4N 2D1KA 1N33K 3PUFA 4YOYA 3FZKA 4W5QA 3QETA 1GLLO 2NRXA 1YVNA 4M7YA 1TKTA 3M3ZA 3L2VA 2VQEK 2P9UB 2HNDA 1LAWA 1TKDA 2PBDA 2DFEA 1XWLA 5J2NA 2I7NA 3IRXA 5HP1A 2HF4A 4JHDB 1NKBA 2HNYA 1T6CA 3ZSVA 3GOIA 4CF0A 2XY8A 3WEEB 2ZGYA 5M1NA 3ZT0A 2EWSA 1QSYA 1K9MO 1HNZK 3H1QA 5KQDA 1WSGA 1QQOA 3CJ9A 1TYQB 1XNQK 4CESA 1RDBA 3UKUB 4EP5A 4FJLA 3J8AA 1X9WA 1VQ8N 2ASOA 2ZD1A 1LWEA 2F9TA 1SZ2A 2YNIA 3B6PA 4C8NA 4BRDA 3E1YA 1Q82O 1HKBA 1KAYA 1LCUA 4G1QA 4CZLA 3DLBA 4FWSA 4BG9A 3DAWA 3CJBA 1WSJA 2HF3A 4X65K 4KKOA 1IKXA 5FPEA 1L5UA 1IG8A 5DM7L 3HBTA 2Q3SA 1VSMA 3C65A 3AVJA 4LY7A 3VQ9A 3V4IA 4M3YA 2D5RA 1VQPN 1MDUB 2E5LK 2Z1HA 1HNIA 1JXEA 4HHTA 2QWMA 5AQYA 4CEAA 2YJEA 4CGFA 2QM1A 3VQEA 3CHWA 3SZ2A 1D5AA 4CJUA 1CXQA 1HUXA 2QXLA 4AH9A 3SPYA 4NCAA 3CIPA 3O8MA 1SL1A 4BRMA 2IS3A 1NMNA 4HWIA 4LFCK 4KI4A 1VSDA 1GLEG 4FWLA 5AFUH 4DFKA 2CGJA 1W0HA 3P5JA 1QVFM 1TL3A 1VSEA 1RBVA 3VA0A 3EL2A 4BRKA 3ZX2A 2NRTA 4BG8A 3CCUN 4HVJA 4CVNE 1XC3A 1HKCA 1XMOK 1D9FA 4B9UA 4PY5A 3UB5A 3LWLA 3KD5E 4JYAK 5KPTA 4Y1DA 1RILA 2BUPA 3BUZB 3OHRA 4CERA 4IG3A 4ISFA 2UUCK 3NF9A 3SQ2A 4KPYA 1VSHA 4DTUA 5AZJA 3OYJA 2G8FA 3QDKA 1TUUA 3EZWA 5H1SQ 5I42A 4A57A 5I9EB 4FPAA 4CJ7A 1BU6O 1NKCA 4K42A 4K8XA 1QQMA 1RDDA 3ZX0A 3MECA 4CHYA 2ASPA 3QBXA 4DU1A 4L8RB 3VQPA 4CEEA 5J2MA 3AO3A 4FJIA 4OKJA 2GV9A 1IJJA 5JLHA 1XQSC 3J80O 1GLBG 1LAVA 1QZ6A 4BR4A 4CF1A 4BACA 1WBDA 4B8CA 4FOIA 2XY7A 3EYZA 3G25A 1ZBFA 2FLOA 1Z6RA 3VN5A 3PX4A 4BDPA 1RTHA 3WXKA 1WBBA 2GTDA 1W9HA 4BVOA 2PYLA 3QB0A 4CZFA 3J7YP 5K14A 3ZLJA 2W6LA 4FM1A 3PSFA 4F8RA 2QW9A 4BGBA 4DTXA 4BQZA 2FBVA 4YOTA 2Q0RA 4JD2B 3NCIA 4QAGA 4BC4A 4CE9A 5AJ3K 3CJ7A 3DRSA 2D0OA 3DWLA 4Z0UA 4J2EA 3ZETB 3ZSRA 1NBWA 4PL7A 3MX2A 3VEVA 4JKFA 1KCFA 1U45A 3E9LA 4CI6A 5AQHA 1NNEA 3NAEA 2VQFK 3OYEA 1BOTO 4DR2K 1Q9XA 5CR4A 1NK4A 1GOCA 1Q86O 4ISEA 4B9MA 4E7IA 1V4SA 3CM5A 4IOXA 2E2QA 2P9PA 4KAZA 3WNFA 2VWJA 2D0CA 4JRQA 4BE0A 4BWJA 4FM2A 3D2FA 3KWIA 4F9OA 3ENOA 4WFAL 3HSCA 3CCLN 4CJKA 4FWOA 3H6EA 4N56A 3DMJA 4CECA 1HPZA 3ZT1A 5AQPA 3HM8A 3MWPA 3D7EO 3ID6A 2ZWHA 2F8TA 3NF7A 3EN9A 3IUCA 1HRHA 3ZEUA 2QWNA 5FPMA 3P83D 2YHXA 2Y1JA 3QEPA 3TI0A 3P4IA 2ETJA 4K0KK 5HROA 3THVA 3OYIA 3K5OA 3CCQN 3WXIA 4AHRA 3QIOA 5LMNK 3TARA 1OH6A 1FKPA 3QINA 2YX6A 4BR7A 4X66K 2O8BA 2B4JA 3K58A 4DF4A 4ELTA 1SS6A 1NK7A 1WSFA 4C1NK 3M6GA 2KZZA 3HI0A 2V51B 1C0FA 4CK3A 4BR2A 2UXDK 3O5BA 4WFNL 4IFVA 2HVIA 1OVQA 1NK9A 4JKGA 2ZF5O 4JK7A 1NK8A 1IBLK 4FJ5A 2FC0A 3LP2A 2NZTA 1KVBA 1BIZA 4HTLA 1BA1A 4DQRA 2P9UA 1ZBIA 2FSJA 4FK4A 1BA0A 4DLEA 3KTQA 2X6NA 4WE1A 4CGHA 3DLKA 1WUAA 3BY5A 3FZFA 1Q18A 3VQ8A 2OTJN 5J1EA 4FXDA 1MWMA 3MX5A 4M63C 1RT4A 4B1ZA 4JKEA 1A5VA 3OS0A 4F3TA 4JHDA 3K0SA 1IH7A 4E89A 2WC9A 3Q7CA 3WXLA 1VRUA 3WEEA 5BR8K 1NGHA 4PKGA 5F0XA 2HBKA 1J5OA 4B3OA 1TYQA 3ATUA 4BREA 3TSQA 1KC8O 3CJCA 3OW2M 2NLXA 3UKUA 3ZT3A 1C0TA 4FLUA 4JN4A 4CFCA 5JLFA 5HOOA 1OH8A 2HB5A 4A2BA 2A40A 2YHBA 2GUPA 3OJUA 4CIGA 3QEVA 5J2PA 5ADXH 1DKGD 3AO1A 2E2OA 5MLCQ 3AA3A 4H5TA 3HM9A 5LL6Z 2A6AA 1NM1A 1HJOA 2P9LB 3HPHA 1N32K 1NJIO 5KRSA 4JKBA 3SQ0A 2YCHA 3WQTA 4JKDA 4NXMK 4CJWA 3QFPA 4FO0A 3AA4A 3O1BA 4BDZA 1GLDG 3BP8A 3H08A 3TSPA 3ZSXA 2Y1IA 2D4WA 2IIRA 4Z94A 1WSIA 2BGGA 1YUWA 3A5OC 1XMQK 3C6TA 4DV2K 5I3UA 4IOCL 4DB3A 4H5VA 1WSEA 3NH0A 4AM7A 4BROA 4JAXA 4A62A 4KV8A 3VQDA 4FVUA 1KFSA 1VQ6N 1BDGA 1FK9A 4B3SK 1TK5A 1N36K 1JKHA 4F3OA 3RMCA 1S22A 4LF7K 3L2UA 1BL3A 5LJVA 2F9WA 3I0RA 4LD0A 1BQNA 4O8KA 1HYZA 5M1PA 5C12A 2CGKA 4BGAA 3I55N 1RDUA 4LF9K 1UAXA 1EETA 4JNEA 2IDOA 4G9ZA 3U8XA 2B6AA 5SWMA 1JXBA 4DTSA 4CZMA 2NRWA 1L3UA 1RBTA 4I2PA 4FZZA 4CIEA 4JKAA 1SUQA 3VTIA 4GNIA 4FOEA 1W2BM 5FPDA 1IG9A 4CJPA 5E41A 3ZCMA 3N4QA 1BGXT 3B6OA 2UYTA 3T19A 1CXUA 1CZ9A 3NHGA 3I0SA 5AQWA 3T7ZA 4AILC 4PKIA 1TKXA 3OYDA 1G99A 5EY4A 3RMDA 5HLFA 4CHNA 2ZGZA 1JCGA 4H0YB 3KLIA 3KLFA 4Z4CA 1NJWA 3NFAA 1NKEA 4EHUA 3F5TA 1K8KB 4LSNA 4DF8A 4RW4A 1TK0A 3VEZA 3WNGA 4CZIA 1XHZA 3CD6N 2P9KB 4CGIA 4DTNA 3ZSWA 3RWUA 5IWAK 2HBMA 2IAJA 2ZQBA 1FJGK 3T1YK 5M1KA 4XH5A 2HMPA 4DTRA 1EO1A 3SBTA 4C8MA 4W5TA 1I39A 1J53A 3UKRB 4OO1J 1P8ZA 3M8RA 4AHUA 5SZTA 2J4RA 4JD2A 4B1UB 3QFUA 4NLBA 3VEXA 1G15A 5EXWA 4GMJB 3ZETA 3IDHA 3V9XA 2YKNA 3OYAA 1ZXOA 3DOLA 4B8AB 4CCHA 1VSLA 3OS1A 3ISNC 4W5NA 4GVEA 3Q7BA 5HRRA 3MXIA 2P9SB 3MN7A 3CJAA 3ID8A 4BC5A 4DQ8A 3OYNA 2P9NB 3D0PA 4DV0K 5GAHP 4FLVA 4CHQA 4KHNA 3TABA 3MCAB 1IKYA 4FWKA 4H5NA 5T7BA 3K9JA 4JI4K 3VTHA 1N34K 3LDQA 4IDHA 4M7XA 2ZE2A 3RTVA 4L3QA 4I6MB 4CIFA 4OPKA 4CJLA 1HQUA 3HOTA 3K5NA 3RRHA 4O0IA 4B9TA 3VF2A 5HRPA 3L3VA 4DLGA 2XO7A 4A5AA 1VRTA 3CM6A 2FSNA 1RFQA 4PL8A 5AQOA 4IKFA 1LWFA 2D0AA 4M3TA 4AHCA 3SJHA 1P90A 3JSMA 1NU0A 4DQSA 1RTIA 1LW0A 4DR3K 3DRRA 2OPPA 3K5LA 2QKKA 3DLEA 1UA0A 1T6DA 4DFPA 2E2PA 4BQLA 1BHLA 3OYFA 2DFFA 2NUBA 5AR0A 4CW7B 1O13A 2D0PA 3V1OA 4DWIA 4CEDA 2QA4N 4FPBA 3KWGA 3LWMA 1NGDA 4PKHA 1M90O 3L0QA 5KGWA 3OBYA 2OYQA 3QICA 3DXKB 3SMSA 3BDPA 3MDQA 4AHSA 4JS4A 5AQJA 1XC9A 1FW6A 1QHTA 4NXNK 3K59A 1YJNN 2Q1NA 2HSTA 1IBKK 4KHYA 1HYVA 5HBMA 3A2FA 3EZ5A 2W6KA 4A5BA 4DR4K 1BUPA 1NK6A 1L3TA 4JLHA 3O9TA 2QWPA 2E20A 3LANA 3U3YA 4FSVA 4GW6A 4BR5A 4RW7A 3TTCA 3SQ4A 3KJVA 3WNHA 4BE1A 2P1JA 3BZKA 3T69A 3CETA 4JI6K 1EXQA 4FL9A 3I8BA 4ZTJA 5LY3A 3SUNA 4I7FA 3CMAN 2Z1GA 4QOZB 4PWDA 1KFDA 4C8LA 3QEXA 4FJNA 1OVYA 1SAZA 2FSKA 3OVNA 5CHIA 3L3UA 2FBYA 1J6ZA 4CEQA 3CCEN 1S5JA 1NMDA 4IBNA 2HHSA 2P9LA 1I94K 2E6MA 4FLTA 1KAXA 3JXUA 3VQCA 4FVMA 1H1VA 1VSKA 1T03A 4JI2K 3NDKA 5FPNA 3JAMO 3AVNA 3HVRA 4DV6K 2O4GA 3K9KA 4ILJA 4I9LA 3AGKA 1HR0K 5DK5A 4C8KA 3ITHA 5FRNA 5BPMA 3O9UA 2KW4A 3CQ8A 3HK2A 4E3SA 4B3TK 4LF4K 3OY9A 5ELZA 3VF4A 2HNZA 1EQYA 4RCHA 2QWLA 1RTDA 4CBWA 3RMAA 3HYFA 5M1OA 4H0TB 4DS5A 4E19A 4IEEA 5BPLA 5AQSA 1NJZA 4FWMA 3MEEA 2X78A 3SAHA 3O3HA 3AA5X 2EX3A 3BGRA 5C24A 3NF8A 4DTPA 4LFAK 1WSHA 3O9RA 3SUQA 4KHQA 2ZM6K 1U48A 3AAPA 3CXCM 1QSSA 3M1FA 4YFUA 1HNXK 3HRGA 3EKUA 1VQ9N 3LP3A 2ITMA 1YVUA 4NYNA 1D9DA 1NK5A 5C25A 1DTQA 4LF8K 4DG1A 5AQVA 4M41A 4FLYA 3VQQA 5JS2A 2HHTA 1T8EA 2G8VA 2QWOA 3K2PA 4O4GA 3W3DA 4KH4A 3R8EA 3V81A 5JVGL 1MWKA 5CZ1A 4BDYA 1RBUA 2HHQA 3HJFA 1T05A 4LFBK 3A5MC 4O44A 3RSEB 4F2RA 4FJKA 4M3XA 2UXBK 2OPRA 1KQSM 4CGDA 4FJJA 4IFEA 3VMFB 2QK9A 3GE1A 4PA1A 5M1QA 4KFBA 4CEOA 3TAQA 3AVHA 3SV3A 4JI8K 1QVGM 1KLMA 1SKWA 2NNWA 4WFBL 1K8KA 3AVFA 2ATQA 3AV9A 4DR7K 4ID5A 4OJRA 4WQ4A 2A41A 4ELUA 3E9OA 1SL0A 4F2SA 2P9KA 4JI7K 1WNSA 1U2VB 4DQPA 4JI5K 2YHYA 2OANA 2QI2A 4OKEA 4J2BA 3D6RA 4JI3K 4FWNA 5KRTA 1NGJA 3LP1A 2WBNA 3G6EN 2RE2A 1N5YA 1QE1A 4YDUA 3TAPA 5BRHA 3AY9A 1REVA 3UKRA 3LALA 2BH1A 5FLXO 2HOEA 3OYMA 3DJCA 4FW2A 2A1RA 4DMNA 1HNVA 3AO2A 3KKRA 4YOWA 1F21A 2JGUA 4FLXA 3LDOA 2F4VK 3C6HA 4CGJA 3JS6A 4N41A 2QWRA 3MN9A 3R9PA 4K41A 3PY8A 3L2QA 5C2DA 1Y64A 2P9SA 5JS1A 2P9NA 5KPRA 1RDWX 3J7ZO 4IDKA 3LP0A 3HP6A 4ELVA 4M3ZA 2JLEA 3O3GA 3TAMA 3AVKA 4I6MA 5EVZA 1NWKA 1X3NA 4M3UA 3CPEA 3MCPA 2G8IA 3E9PA 4DQQA 1Z25A 4H0VB 3K5MA 1U47A 3RRGA 1NK0A 3A8YA 2NRRA 5HL7L 4JI0K 1VSFA 2HMIA 4ZHRA 2D0BA 1VQON 1EP4A 1TUYA 3KHYA 4E7KA 4EHTA 4GVMA 4K25A 1J9AA 1RT7A 2IC3A 2VGNA 3VETA 5CYQA 4UY8O 3KLGA 3AVCA 5AFUA 3D2EB 4DUZK 1B9FA 2V7YA 4QS9A 1S9EA 3T3FA 1D4XA 4R79A 5AQLA 2KFZA 3QESA 3CFRA 2XHBA 3SCXA 2XRIA 3FFIA 5JICA 4GV9A 1YAGA 4FJ7A 2QTDA 1R59O 3SI6A 2Q2RA 4GV6A 2HHVA 4NCBA 4IG0A 4O5FA 5GAEP 3AO4A 3LM9A 2KTQA 5AQKA 2ITGA 4FLWA 3DXKA 1VQKN 2A3ZA 4BRLA 1RGIA 2YI1A 4KHSA 4BRCA 4BVPA 4OPHA 2FBTA 3F2KA 4B9NA 2DPNA 4A61A 1ZBSA 5AZIB 5C10A 4U7BA 3RMBA 4Q5VA 1HYSA 3ULDA 3QO9A 4FJXA 4IO8A 3EE9A 2A42A 3PX6A 4YNQA 5LMUK 3NBPA 3VQBA 2EHGA 4OPAA 5AQIA 4PQUA 1IV0A 3MK6A 4KB0A 3ZX3A 3AGRA 1ATNA 3C95A 4QS8A 3TAGA 2QXFA 1KXPA 3T1AA 4IJNA 2VGMA 2UU9K 2F8SA 5BN9A 4K43A 3CCJN 4DSIA 4GKKK 3SK3A 2IVNA 1LWCA 4H5WA 3NVKA 4GY2B 1S1VA 1U6ZA 4BY9C 3NF6A 3S3MA 2E1ZA 1TVRA 1RDCA 3A0IX 4B1YB 4FWRA 3FZLA 2GUIA 5J2QA 2E1YA 1WB9A 1IKWA 2RPIA 4E7LA 1Q7YO 1U49A 2NRHA 4E1NA 3KK3A 3M5RA 3UE5A 2I5JA 1VQ7N 5GIPA 4DTOA 3ZSOA 1QS4A 4B9QA 3AAQA 1EKEA 4HCCA 2I7PA 4PUOA 1KVAA 2BANA 2IOCA 3MMVA 2E2NA 1TGOA 4H4OA 4JEPA 4NCGA 4FCYA 3SYZA 3H3NO 1NGBA 3EE8A 2HHXA 4JKHA 3AVMA 5TKWA 4DKWA 3U6FA 1Q9YA 3RVCA 2LSNA 4HTUA 4LH5A 2W40A 2R7YA 3PO4A 3LDSA 4KTQA 3MXJA 4E1JA 2UXCK 1BG3A 1JCFA 2IGIA 2YKMA 1ZBUA 3QEIA 3SQ1A 4WYBA 1TAUA 3KKSA 4DR6K 3NGZA 1X9MA 4WQ4C 1RT5A 3MEGA 3U3GA 3VESA 3TWHA 4DU3A 1YTUA 3GG4A 3ZSZA 3MXMA 3GL1A 4OGEA 1X1PA 4MFBA 3MN5A 3RSEA 5AQUA 2P51A 4LSLA 1GOAA 2H3GX 3HO1A 3V6DA 5FDLA 3PLAA 2RHKA 1KD1O 1K6YA 4KH5A 1RT6A 2HW3A 2CH5A 5EOYA 2X74A 4ISGA 3IMXA 2ASMA 2O8EB 4DR5K 3VQAA 5GADP 4IJAA 3OTOK 2KKZA 1JLGA 1K73O 3MEDA 3M8QA 4DFMA 3PX0A 1ZBHA 3BF3A 1U2VA 2DY4A 3L6QA 4YY3K 1C1CA 1T3VA 1VSIA 4XIUA 2BDPA 4H5RA 1NJYA 2WONA 2VG7A 1W7AA 4I9QA 1HPMA 3EY1A 4Z4HA 4FJ8A 4CF2A 4KHUA 3P39A 3B8AX 2QEXN 3BEXA 1BIUA 1BI4B 4MLEA 1EWRA 2YV0X 1X9SA 4IZ9A 3LZJA 3VEOA 4DTJA 3HSTB 3KK2A 1MU2A 1UWBA 4Y0WA 2GWKA 4HUEA 4FJ9A 3SAFA 1GLAG 4FWQA 3LAKA 3VENA 3CG7A 2GX9A 4MQ3A 4DSLA 1QZ5A 5AQZA 1S1XA 2HHHK 1ATRA 3VQ4A 3T1HK 5ADXA 3N4PA 4DHYA 5GIOA 3CPWM 4OVLA 5BR9A 4CJRA 4BRAA 3S9HA 3SJJA 3P38A 4IWVA 3NE6A 3V9ZA 4CJQA 1RT2A 3RR7A 3J7AP 1KVCA 3CC4N 1ZC6A 1ZBLA 3DLRA 4FK0A 3MWTA 1NOYA 1DTTA 1ATSA 4Y1CA 4DUYK 2ZJPL 4DV7K 3AO5A 3FLCO 1QHAA 4CJSA 3O6WA 4JKCA 1XHXA 1NJXA 2KQ2A 3VQ6A 3W0LA 4BRPA 4ID1A 4O8UA 4CBUA 4EAHD 1TKZA 5AQMA 3DOKA 4YOVA 3LDLA 1C1AA 3GDQA 5GINA 4JI1K 3I33A 1WN7A 3V9SA 3CCRN 4KB1A 4BRNA 2O8FB 3V1QA 4LC9B 1YTAA 1JCEA 3VGKA 3VOVA 5EU7A 3D2EA 3K57A 4YORA 4KHWA 2DFHA 4DTMA 2PAVA 3DYAA 4IXCA 3A5NC 3HTVA 4IEIA 1YHQN 3O1WA 4NO7A 1UOCA 3F73A 3DLHA 3CFOA 1RDAA 1W97L 1IKVA 3CYMA 4B3RK 4CK1A 3ULEB 2OPQA 3HP9A 3CQYA 4CFDA 3A5LC 4ILGB 1GLFO 4CZEA 4EP4A 1KTQA 4BRIA 2YNGA 3HPGA 1RTJA 4KI6A 4BWMA 3ZSYA 3WXJA 4KBOA 1J54A 4IOAL 3VGLA 3FR0A 5AZIA 4E7HA 3LL3A 2P5GA 1A5WA 3THWB 1GLJO 3SAGA 1VQ5N 3OYKA 3HOSA 4J2DA 3V9WA 3ASMA 1RT3A 1I3AA 1E3MA 3V1RA 2OZMA 1IO2A 3OS2A 4DCHA 4CHZA 3MN6A 3C7NB 4OX9K 4H4MA 2G8UA 4RWTA 2PZSA 1Z05A 1YXQA 3ENHA 3LZIA 4W5RA 3EEQA 1MA9B
chains in the Genus database with same CATH topology
4DR6K 4DV3K 1HR0K 2VQFK 1N33K 4DR2K 4LF5K 5FLXO 4DUYK 4DV7K 4DR3K 4CVNE 4B3TK 4LF4K 1XMOK 2VQEK 4X64K 2F4VK 4JYAK 5LMUK 4CW7B 1IBMK 4JI1K 5LL6Z 4LF6K 2UUCK 4DR1K 4DR5K 1N32K 5IWAK 4LFAK 3OTOK 4DV4K 1FJGK 3T1YK 4NXMK 2UU9K 2ZM6K 2UUAK 1HNXK 1HNZK 4GKKK 4K0KK 1HNWK 4LF8K 1XNQK 5LMNK 1XMQK 4X66K 4V19S 4DV2K 4YY3K 4NXNK 1XNRK 4B3RK 1IBKK 4JV5K 4YHHK 1J5EK 4DV1K 4LFBK 4JI0K 4DR4K 2UXDK 4X62K 4B3SK 2UXBK 3J80O 1N36K 5IT9O 4LF7K 5A2QO 4X65K 1IBLK 4DV5K 4AQYK 4JI8K 4DV0K 4JI6K 4DUZK 4LF9K 4DR7K 4JI4K 1N34K 2E5LK 3J7YP 4B3MK 3J81O 4JI7K 2HHHK 4JI5K 3T1HK 1I94K 4JI3K 4KHPK 2UXCK 4OX9K 5AJ3K 4GKJK 4JI2K 5BR8K 3J7AP 4LFCK 3JAMO 2UUBK 4DV6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 K;  4DV3 K;  1HR0 K;  2VQF K;  1N33 K;  4DR2 K;  4LF5 K;  5FLX O;  4DUY K;  4DV7 K;  4DR3 K;  4CVN E;  4B3T K;  4LF4 K;  1XMO K;  2VQE K;  4X64 K;  2F4V K;  4JYA K;  5LMU K;  4CW7 B;  1IBM K;  4JI1 K;  5LL6 Z;  4LF6 K;  2UUC K;  4DR1 K;  4DR5 K;  1N32 K;  5IWA K;  4LFA K;  3OTO K;  4DV4 K;  1FJG K;  3T1Y K;  4NXM K;  2UU9 K;  2ZM6 K;  2UUA K;  1HNX K;  1HNZ K;  4GKK K;  4K0K K;  1HNW K;  4LF8 K;  1XNQ K;  5LMN K;  1XMQ K;  4X66 K;  4V19 S;  4DV2 K;  4YY3 K;  4NXN K;  1XNR K;  4B3R K;  1IBK K;  4JV5 K;  4YHH K;  1J5E K;  4DV1 K;  4LFB K;  4JI0 K;  4DR4 K;  2UXD K;  4X62 K;  4B3S K;  2UXB K;  3J80 O;  1N36 K;  5IT9 O;  4LF7 K;  5A2Q O;  4X65 K;  1IBL K;  4DV5 K;  4AQY K;  4JI8 K;  4DV0 K;  4JI6 K;  4DUZ K;  4LF9 K;  4DR7 K;  4JI4 K;  1N34 K;  2E5L K;  3J7Y P;  4B3M K;  3J81 O;  4JI7 K;  2HHH K;  4JI5 K;  3T1H K;  1I94 K;  4JI3 K;  4KHP K;  2UXC K;  4OX9 K;  5AJ3 K;  4GKJ K;  4JI2 K;  5BR8 K;  3J7A P;  4LFC K;  3JAM O;  2UUB K;  4DV6 K; 
#chains in the Genus database with same CATH topology
 4WQ5 A;  4B08 A;  2GBZ A;  4DV3 K;  1Q81 O;  1CZB A;  4M3W A;  4H8K A;  2A5X A;  1DEJ A;  3H3O B;  1ASU A;  1BQM A;  3VQ7 A;  2YHW A;  1TV6 A;  3AVL A;  5CYM A;  2G8K A;  1T44 A;  3TTD A;  3AVA A;  3CQX A;  4MO5 A;  1VHX A;  3AVB A;  4LF6 K;  2JWK A;  2V7Z A;  4JK8 A;  3ZSQ A;  4BR9 A;  1WLJ A;  3E01 A;  2G8W A;  2RKI A;  3C94 A;  2UUA K;  3IFR A;  1JLA A;  1S6Q A;  4O5B A;  2WFB A;  1CZA N;  1OH7 A;  3O4Q A;  4B1W B;  4MDB A;  4C8O A;  4BRQ A;  3L2W A;  2E6L A;  3FFK B;  3NGY A;  2NRZ A;  5KTQ A;  4V19 S;  2W41 A;  3BZC A;  4KRF A;  2W42 A;  5E26 A;  5FRM A;  1XNR K;  2FXU A;  3AVG A;  1C1B A;  1NG9 A;  1NGE A;  3HVT A;  5JVH L;  4DV1 K;  4PHT X;  2AA4 A;  4CHO A;  4B9L A;  2YJF A;  4OKK A;  3AAR A;  5CZ2 A;  3CC2 N;  5IT9 O;  1B92 A;  4CFA A;  1L3S A;  3PSI A;  3NH1 A;  4DQI A;  4OGC A;  1M1K O;  3PO5 A;  1Y97 A;  4EZ6 A;  1HQE A;  1T7P A;  3GBT A;  4N76 A;  2RN2 A;  1VAZ A;  4CHP A;  1NLV A;  4FJG A;  3L4I A;  3IG1 A;  1KRP A;  2GEM A;  1JL2 A;  3KK7 A;  3SPZ A;  2B5J A;  3THY B;  2E8A A;  3QNO A;  5AQN A;  4R5P A;  3ATV A;  3PIP L;  1S9G A;  4UQG A;  3U9Z A;  3P31 A;  1EX4 A;  2KZM A;  2O8E A;  4DSF A;  1E4G T;  4ICL A;  5CE3 A;  4KHP K;  5FRO A;  4E7J A;  4EZ9 A;  1YIJ N;  4IO9 L;  4OLA A;  3OYC A;  2ZJR L;  4CD1 A;  2WTU A;  4CJ5 A;  4XH1 A;  2UUB K;  3KK1 A;  1KSP A;  4EFH A;  4NYF A;  4O55 A;  3NVM A;  3WUH A;  2GWJ A;  1RNH A;  4BR0 A;  3QEW A;  4CK2 A;  2F96 A;  1NGA A;  3C0B A;  3HL8 A;  1ZYQ A;  3NGI A;  3O4N A;  1KLN A;  3HPO A;  1YJ9 N;  3I56 N;  4U67 L;  2AP1 A;  1IBM K;  4FK2 A;  4C1N I;  1BI4 A;  1FKO A;  5BRF A;  5AQT A;  4FLZ A;  1NGF A;  4YOU A;  3CJ1 A;  2FF3 B;  1R0A A;  1JLB A;  2WUS A;  3OYH A;  1JJ2 M;  4AHV A;  5KQ8 A;  3CFP A;  2PY5 A;  1YJW N;  1HNW K;  1GOB A;  2BE2 A;  3O08 A;  4RW9 A;  1NGG A;  4H0X B;  1A5X A;  4WCE L;  2Q36 A;  3R6M A;  1NGI A;  1DLO A;  1JLQ A;  2O8D B;  1K8A O;  2CGL A;  1JL1 A;  1VQM N;  2RF2 A;  3TSU A;  3TR8 A;  1S1W A;  3D45 A;  5EX5 A;  4QS7 A;  2WOM A;  4EIA A;  3O80 A;  3H46 O;  2O8C B;  1BWF O;  3THX B;  3LPU A;  4KRE A;  2Q0U A;  4AQY K;  1ASV A;  4RTF D;  3TPQ A;  3TAE A;  4DSE A;  3M8P A;  1YIT N;  3AVI A;  3JYT A;  4XH4 A;  1YF5 L;  3DLG A;  1DGK N;  3LAM A;  1BCM A;  3DXM B;  1OH5 A;  1LOT B;  4LH4 A;  4A59 A;  1S72 N;  4H03 B;  4F4K A;  4RW6 A;  1YT3 A;  2O8F A;  3ENB A;  4CZG A;  3SBG A;  1V4T A;  4N47 A;  3CCS N;  3QLH A;  3G71 N;  1QTM A;  5BN8 A;  3SLC A;  3WQU A;  4AF1 A;  3L4Q A;  2YHA A;  3ZT2 A;  2Q31 A;  3NH2 A;  2P9I B;  5HRS A;  3M8S A;  2QKB A;  1TAQ A;  5AQF A;  3ULE A;  1VQL N;  3DI6 A;  4M45 A;  4DSJ A;  2V52 B;  5F1X A;  2E88 A;  3OYL A;  2A1S A;  4X64 K;  4DFJ A;  3E66 A;  3QER A;  5D3G A;  3KLH A;  5KPZ A;  3MAQ A;  1JLE A;  2OZS A;  5AQQ A;  5KI6 A;  4B9S A;  4FWP A;  4CF8 A;  1RT1 A;  1Z26 A;  3QML A;  1RBR A;  1BO5 O;  4W5O A;  4Z4I A;  4MDA A;  3FGU A;  2X6S A;  4WQ5 C;  3THW A;  4B9V A;  5TKY A;  3O3F A;  1S1T A;  2E4L A;  3DLL L;  5AQX A;  4BC3 A;  1VK0 A;  3VEW A;  1S6P A;  5BPN A;  1Q8I A;  3CCV N;  4CEF A;  2VWB A;  1SV5 A;  2HHU A;  2KHO A;  3C7N A;  4CJ4 A;  2F7T A;  3VA3 A;  4KH6 A;  3I8D A;  3ALY A;  3IKM A;  3KIO A;  4FZY A;  3EKS A;  4CJ3 A;  1D8Y A;  4O0J A;  1GLC G;  3DRP A;  3BF1 A;  2AJQ A;  3S3N A;  4FZX C;  4BRH A;  4ZTF A;  5KGX A;  2GEL A;  1QQN A;  3LM2 A;  2KLA A;  4J8F A;  3IS9 A;  2NRV A;  4ILH A;  4B3M K;  4CBX A;  3KVG A;  2OA8 A;  5JMV A;  4B1X B;  4FJM A;  3CC7 N;  1S3X A;  2HHW A;  3H1V X;  4DU4 A;  4XEI A;  4OLB A;  3R1X A;  2PFU A;  4CJE A;  3TAN A;  3C6U A;  4CZK A;  4H0O A;  3SMP A;  4MO4 A;  1LV5 A;  4A2A A;  3VGM A;  3ZT4 A;  4CZH A;  3VQ5 A;  1HKG A;  1SL2 A;  4AHT A;  4RG8 A;  5DMR A;  4IFY A;  4YOX A;  4KTZ A;  1BCO A;  1JLC A;  3TAF A;  1YI2 N;  3P1G A;  4CJV A;  3C6A A;  1RCH A;  4M42 A;  1C0G A;  3KZB A;  3LDP A;  2VCP A;  3F9M A;  2OTL N;  4JRP A;  3CF5 L;  2HBL A;  4H0P A;  5CY4 A;  2VG5 A;  2DTU A;  3LDN A;  4QCL A;  4DV4 K;  2PYJ A;  4BRF A;  1BIS A;  3G4S N;  4HUF A;  2OPS A;  1QSL A;  3L8B A;  4CEB A;  5E84 A;  1C0M A;  3THY A;  3CI5 A;  3HT3 A;  4E0D A;  1HJR A;  3KD1 E;  3WXM B;  3U9D A;  1CLQ A;  5B8H A;  1N6Q A;  1HMV A;  3OA9 A;  1SKS A;  1C0U A;  3CCM N;  5C0Y A;  5C2F A;  4YHH K;  3G0Z A;  2FF6 A;  3VF6 A;  1J5E K;  4KTW A;  4YDU C;  2Q97 A;  3HZ6 A;  2G8H A;  4X62 K;  3V9U A;  4CD3 A;  2YNH A;  3DM2 A;  3HXM A;  5BRD A;  3O9Q A;  1LW2 A;  5A2Q O;  3O4W A;  3AA2 A;  1U04 A;  1XUP O;  4DV5 K;  2XY6 A;  3VEY A;  5AQR A;  3H45 C;  4M3R A;  5AZJ B;  1JLF A;  1E4F T;  3WT0 A;  1U4B A;  3FE1 A;  4JS5 A;  4BE2 A;  2VWK A;  1ILY A;  1X3M A;  3VER A;  2Z1J A;  1B9D A;  1N8R O;  3CER A;  3J81 O;  1EWQ A;  3LPT A;  3S41 A;  2OCE A;  3FZH A;  4J2A A;  4NB4 A;  4CJT A;  1C6V A;  3L2R A;  4GKJ K;  1WAJ A;  4K8Z A;  2QWQ A;  1TL1 A;  3PIO L;  4BC2 A;  3PV8 A;  5F2R A;  4OPJ A;  4HUG A;  4FJH A;  3TTF A;  3SUO A;  3S3O A;  2JWL A;  3F9K A;  1RBS A;  4LF5 K;  2IVP A;  5GAG P;  3SV4 A;  1TK8 A;  2O8D A;  1O1W A;  1HX1 A;  2HVH A;  5BRE A;  3EO3 A;  1SQK A;  1OKJ A;  3UIQ A;  3IAY A;  4CFB A;  2O8C A;  1DT9 A;  3THX A;  3OYB A;  4Z4G A;  3TU5 A;  4DR1 K;  1SKR A;  1ITG A;  3OYG A;  4FYD A;  3RR8 A;  2KFN A;  2CH6 A;  1NGC A;  2HBJ A;  4Q0B A;  2VYP A;  3KLE A;  3ZYY X;  4RW8 A;  4CGG A;  4CEZ A;  4N5S A;  3G10 A;  3DXM A;  5AQG A;  4JK9 A;  2ZJQ L;  1L3V A;  1XI1 A;  4WF9 L;  3OJS A;  1S1U A;  4CJF A;  1WAF A;  3WNE A;  3SUP A;  2FBX A;  4BRG A;  4JV5 K;  2P9P B;  4Z4E A;  1VQN N;  3FZM A;  3D2F B;  5LJW A;  4DSK A;  2IVO A;  1FXX A;  1ESV A;  4B1V A;  4GV3 A;  2P9I A;  2BTF A;  1HLU A;  2VG6 A;  4C23 A;  5C15 A;  1KAZ A;  3U4L A;  4FW1 A;  4I2Q A;  3R3L A;  1X9J A;  2O4I A;  4NLC A;  4AM6 A;  3ZEU B;  1ASW A;  2P5O A;  5HRN A;  3O9S A;  4Z4F A;  3VPZ A;  4HCB A;  3OBW A;  2O8B B;  1WOQ A;  3QBW A;  3CME N;  1NOZ A;  4TSX A;  3QIP A;  1VSJ A;  4KO0 A;  4CF9 A;  1UA1 A;  3SNN A;  2XY5 A;  1QQC A;  4E1M A;  3QNN A;  2Z1I A;  3NMU A;  4DS4 A;  5C42 A;  4MLH A;  4FM0 A;  2YNF A;  4CZJ A;  5M1F A;  4JKG B;  5DM6 L;  1VQ4 N;  2D1K A;  1N33 K;  3PUF A;  4YOY A;  3FZK A;  4W5Q A;  3QET A;  1GLL O;  2NRX A;  1YVN A;  4M7Y A;  1TKT A;  3M3Z A;  3L2V A;  2VQE K;  2P9U B;  2HND A;  1LAW A;  1TKD A;  2PBD A;  2DFE A;  1XWL A;  5J2N A;  2I7N A;  3IRX A;  5HP1 A;  2HF4 A;  4JHD B;  1NKB A;  2HNY A;  1T6C A;  3ZSV A;  3GOI A;  4CF0 A;  2XY8 A;  3WEE B;  2ZGY A;  5M1N A;  3ZT0 A;  2EWS A;  1QSY A;  1K9M O;  1HNZ K;  3H1Q A;  5KQD A;  1WSG A;  1QQO A;  3CJ9 A;  1TYQ B;  1XNQ K;  4CES A;  1RDB A;  3UKU B;  4EP5 A;  4FJL A;  3J8A A;  1X9W A;  1VQ8 N;  2ASO A;  2ZD1 A;  1LWE A;  2F9T A;  1SZ2 A;  2YNI A;  3B6P A;  4C8N A;  4BRD A;  3E1Y A;  1Q82 O;  1HKB A;  1KAY A;  1LCU A;  4G1Q A;  4CZL A;  3DLB A;  4FWS A;  4BG9 A;  3DAW A;  3CJB A;  1WSJ A;  2HF3 A;  4X65 K;  4KKO A;  1IKX A;  5FPE A;  1L5U A;  1IG8 A;  5DM7 L;  3HBT A;  2Q3S A;  1VSM A;  3C65 A;  3AVJ A;  4LY7 A;  3VQ9 A;  3V4I A;  4M3Y A;  2D5R A;  1VQP N;  1MDU B;  2E5L K;  2Z1H A;  1HNI A;  1JXE A;  4HHT A;  2QWM A;  5AQY A;  4CEA A;  2YJE A;  4CGF A;  2QM1 A;  3VQE A;  3CHW A;  3SZ2 A;  1D5A A;  4CJU A;  1CXQ A;  1HUX A;  2QXL A;  4AH9 A;  3SPY A;  4NCA A;  3CIP A;  3O8M A;  1SL1 A;  4BRM A;  2IS3 A;  1NMN A;  4HWI A;  4LFC K;  4KI4 A;  1VSD A;  1GLE G;  4FWL A;  5AFU H;  4DFK A;  2CGJ A;  1W0H A;  3P5J A;  1QVF M;  1TL3 A;  1VSE A;  1RBV A;  3VA0 A;  3EL2 A;  4BRK A;  3ZX2 A;  2NRT A;  4BG8 A;  3CCU N;  4HVJ A;  4CVN E;  1XC3 A;  1HKC A;  1XMO K;  1D9F A;  4B9U A;  4PY5 A;  3UB5 A;  3LWL A;  3KD5 E;  4JYA K;  5KPT A;  4Y1D A;  1RIL A;  2BUP A;  3BUZ B;  3OHR A;  4CER A;  4IG3 A;  4ISF A;  2UUC K;  3NF9 A;  3SQ2 A;  4KPY A;  1VSH A;  4DTU A;  5AZJ A;  3OYJ A;  2G8F A;  3QDK A;  1TUU A;  3EZW A;  5H1S Q;  5I42 A;  4A57 A;  5I9E B;  4FPA A;  4CJ7 A;  1BU6 O;  1NKC A;  4K42 A;  4K8X A;  1QQM A;  1RDD A;  3ZX0 A;  3MEC A;  4CHY A;  2ASP A;  3QBX A;  4DU1 A;  4L8R B;  3VQP A;  4CEE A;  5J2M A;  3AO3 A;  4FJI A;  4OKJ A;  2GV9 A;  1IJJ A;  5JLH A;  1XQS C;  3J80 O;  1GLB G;  1LAV A;  1QZ6 A;  4BR4 A;  4CF1 A;  4BAC A;  1WBD A;  4B8C A;  4FOI A;  2XY7 A;  3EYZ A;  3G25 A;  1ZBF A;  2FLO A;  1Z6R A;  3VN5 A;  3PX4 A;  4BDP A;  1RTH A;  3WXK A;  1WBB A;  2GTD A;  1W9H A;  4BVO A;  2PYL A;  3QB0 A;  4CZF A;  3J7Y P;  5K14 A;  3ZLJ A;  2W6L A;  4FM1 A;  3PSF A;  4F8R A;  2QW9 A;  4BGB A;  4DTX A;  4BQZ A;  2FBV A;  4YOT A;  2Q0R A;  4JD2 B;  3NCI A;  4QAG A;  4BC4 A;  4CE9 A;  5AJ3 K;  3CJ7 A;  3DRS A;  2D0O A;  3DWL A;  4Z0U A;  4J2E A;  3ZET B;  3ZSR A;  1NBW A;  4PL7 A;  3MX2 A;  3VEV A;  4JKF A;  1KCF A;  1U45 A;  3E9L A;  4CI6 A;  5AQH A;  1NNE A;  3NAE A;  2VQF K;  3OYE A;  1BOT O;  4DR2 K;  1Q9X A;  5CR4 A;  1NK4 A;  1GOC A;  1Q86 O;  4ISE A;  4B9M A;  4E7I A;  1V4S A;  3CM5 A;  4IOX A;  2E2Q A;  2P9P A;  4KAZ A;  3WNF A;  2VWJ A;  2D0C A;  4JRQ A;  4BE0 A;  4BWJ A;  4FM2 A;  3D2F A;  3KWI A;  4F9O A;  3ENO A;  4WFA L;  3HSC A;  3CCL N;  4CJK A;  4FWO A;  3H6E A;  4N56 A;  3DMJ A;  4CEC A;  1HPZ A;  3ZT1 A;  5AQP A;  3HM8 A;  3MWP A;  3D7E O;  3ID6 A;  2ZWH A;  2F8T A;  3NF7 A;  3EN9 A;  3IUC A;  1HRH A;  3ZEU A;  2QWN A;  5FPM A;  3P83 D;  2YHX A;  2Y1J A;  3QEP A;  3TI0 A;  3P4I A;  2ETJ A;  4K0K K;  5HRO A;  3THV A;  3OYI A;  3K5O A;  3CCQ N;  3WXI A;  4AHR A;  3QIO A;  5LMN K;  3TAR A;  1OH6 A;  1FKP A;  3QIN A;  2YX6 A;  4BR7 A;  4X66 K;  2O8B A;  2B4J A;  3K58 A;  4DF4 A;  4ELT A;  1SS6 A;  1NK7 A;  1WSF A;  4C1N K;  3M6G A;  2KZZ A;  3HI0 A;  2V51 B;  1C0F A;  4CK3 A;  4BR2 A;  2UXD K;  3O5B A;  4WFN L;  4IFV A;  2HVI A;  1OVQ A;  1NK9 A;  4JKG A;  2ZF5 O;  4JK7 A;  1NK8 A;  1IBL K;  4FJ5 A;  2FC0 A;  3LP2 A;  2NZT A;  1KVB A;  1BIZ A;  4HTL A;  1BA1 A;  4DQR A;  2P9U A;  1ZBI A;  2FSJ A;  4FK4 A;  1BA0 A;  4DLE A;  3KTQ A;  2X6N A;  4WE1 A;  4CGH A;  3DLK A;  1WUA A;  3BY5 A;  3FZF A;  1Q18 A;  3VQ8 A;  2OTJ N;  5J1E A;  4FXD A;  1MWM A;  3MX5 A;  4M63 C;  1RT4 A;  4B1Z A;  4JKE A;  1A5V A;  3OS0 A;  4F3T A;  4JHD A;  3K0S A;  1IH7 A;  4E89 A;  2WC9 A;  3Q7C A;  3WXL A;  1VRU A;  3WEE A;  5BR8 K;  1NGH A;  4PKG A;  5F0X A;  2HBK A;  1J5O A;  4B3O A;  1TYQ A;  3ATU A;  4BRE A;  3TSQ A;  1KC8 O;  3CJC A;  3OW2 M;  2NLX A;  3UKU A;  3ZT3 A;  1C0T A;  4FLU A;  4JN4 A;  4CFC A;  5JLF A;  5HOO A;  1OH8 A;  2HB5 A;  4A2B A;  2A40 A;  2YHB A;  2GUP A;  3OJU A;  4CIG A;  3QEV A;  5J2P A;  5ADX H;  1DKG D;  3AO1 A;  2E2O A;  5MLC Q;  3AA3 A;  4H5T A;  3HM9 A;  5LL6 Z;  2A6A A;  1NM1 A;  1HJO A;  2P9L B;  3HPH A;  1N32 K;  1NJI O;  5KRS A;  4JKB A;  3SQ0 A;  2YCH A;  3WQT A;  4JKD A;  4NXM K;  4CJW A;  3QFP A;  4FO0 A;  3AA4 A;  3O1B A;  4BDZ A;  1GLD G;  3BP8 A;  3H08 A;  3TSP A;  3ZSX A;  2Y1I A;  2D4W A;  2IIR A;  4Z94 A;  1WSI A;  2BGG A;  1YUW A;  3A5O C;  1XMQ K;  3C6T A;  4DV2 K;  5I3U A;  4IOC L;  4DB3 A;  4H5V A;  1WSE A;  3NH0 A;  4AM7 A;  4BRO A;  4JAX A;  4A62 A;  4KV8 A;  3VQD A;  4FVU A;  1KFS A;  1VQ6 N;  1BDG A;  1FK9 A;  4B3S K;  1TK5 A;  1N36 K;  1JKH A;  4F3O A;  3RMC A;  1S22 A;  4LF7 K;  3L2U A;  1BL3 A;  5LJV A;  2F9W A;  3I0R A;  4LD0 A;  1BQN A;  4O8K A;  1HYZ A;  5M1P A;  5C12 A;  2CGK A;  4BGA A;  3I55 N;  1RDU A;  4LF9 K;  1UAX A;  1EET A;  4JNE A;  2IDO A;  4G9Z A;  3U8X A;  2B6A A;  5SWM A;  1JXB A;  4DTS A;  4CZM A;  2NRW A;  1L3U A;  1RBT A;  4I2P A;  4FZZ A;  4CIE A;  4JKA A;  1SUQ A;  3VTI A;  4GNI A;  4FOE A;  1W2B M;  5FPD A;  1IG9 A;  4CJP A;  5E41 A;  3ZCM A;  3N4Q A;  1BGX T;  3B6O A;  2UYT A;  3T19 A;  1CXU A;  1CZ9 A;  3NHG A;  3I0S A;  5AQW A;  3T7Z A;  4AIL C;  4PKI A;  1TKX A;  3OYD A;  1G99 A;  5EY4 A;  3RMD A;  5HLF A;  4CHN A;  2ZGZ A;  1JCG A;  4H0Y B;  3KLI A;  3KLF A;  4Z4C A;  1NJW A;  3NFA A;  1NKE A;  4EHU A;  3F5T A;  1K8K B;  4LSN A;  4DF8 A;  4RW4 A;  1TK0 A;  3VEZ A;  3WNG A;  4CZI A;  1XHZ A;  3CD6 N;  2P9K B;  4CGI A;  4DTN A;  3ZSW A;  3RWU A;  5IWA K;  2HBM A;  2IAJ A;  2ZQB A;  1FJG K;  3T1Y K;  5M1K A;  4XH5 A;  2HMP A;  4DTR A;  1EO1 A;  3SBT A;  4C8M A;  4W5T A;  1I39 A;  1J53 A;  3UKR B;  4OO1 J;  1P8Z A;  3M8R A;  4AHU A;  5SZT A;  2J4R A;  4JD2 A;  4B1U B;  3QFU A;  4NLB A;  3VEX A;  1G15 A;  5EXW A;  4GMJ B;  3ZET A;  3IDH A;  3V9X A;  2YKN A;  3OYA A;  1ZXO A;  3DOL A;  4B8A B;  4CCH A;  1VSL A;  3OS1 A;  3ISN C;  4W5N A;  4GVE A;  3Q7B A;  5HRR A;  3MXI A;  2P9S B;  3MN7 A;  3CJA A;  3ID8 A;  4BC5 A;  4DQ8 A;  3OYN A;  2P9N B;  3D0P A;  4DV0 K;  5GAH P;  4FLV A;  4CHQ A;  4KHN A;  3TAB A;  3MCA B;  1IKY A;  4FWK A;  4H5N A;  5T7B A;  3K9J A;  4JI4 K;  3VTH A;  1N34 K;  3LDQ A;  4IDH A;  4M7X A;  2ZE2 A;  3RTV A;  4L3Q A;  4I6M B;  4CIF A;  4OPK A;  4CJL A;  1HQU A;  3HOT A;  3K5N A;  3RRH A;  4O0I A;  4B9T A;  3VF2 A;  5HRP A;  3L3V A;  4DLG A;  2XO7 A;  4A5A A;  1VRT A;  3CM6 A;  2FSN A;  1RFQ A;  4PL8 A;  5AQO A;  4IKF A;  1LWF A;  2D0A A;  4M3T A;  4AHC A;  3SJH A;  1P90 A;  3JSM A;  1NU0 A;  4DQS A;  1RTI A;  1LW0 A;  4DR3 K;  3DRR A;  2OPP A;  3K5L A;  2QKK A;  3DLE A;  1UA0 A;  1T6D A;  4DFP A;  2E2P A;  4BQL A;  1BHL A;  3OYF A;  2DFF A;  2NUB A;  5AR0 A;  4CW7 B;  1O13 A;  2D0P A;  3V1O A;  4DWI A;  4CED A;  2QA4 N;  4FPB A;  3KWG A;  3LWM A;  1NGD A;  4PKH A;  1M90 O;  3L0Q A;  5KGW A;  3OBY A;  2OYQ A;  3QIC A;  3DXK B;  3SMS A;  3BDP A;  3MDQ A;  4AHS A;  4JS4 A;  5AQJ A;  1XC9 A;  1FW6 A;  1QHT A;  4NXN K;  3K59 A;  1YJN N;  2Q1N A;  2HST A;  1IBK K;  4KHY A;  1HYV A;  5HBM A;  3A2F A;  3EZ5 A;  2W6K A;  4A5B A;  4DR4 K;  1BUP A;  1NK6 A;  1L3T A;  4JLH A;  3O9T A;  2QWP A;  2E20 A;  3LAN A;  3U3Y A;  4FSV A;  4GW6 A;  4BR5 A;  4RW7 A;  3TTC A;  3SQ4 A;  3KJV A;  3WNH A;  4BE1 A;  2P1J A;  3BZK A;  3T69 A;  3CET A;  4JI6 K;  1EXQ A;  4FL9 A;  3I8B A;  4ZTJ A;  5LY3 A;  3SUN A;  4I7F A;  3CMA N;  2Z1G A;  4QOZ B;  4PWD A;  1KFD A;  4C8L A;  3QEX A;  4FJN A;  1OVY A;  1SAZ A;  2FSK A;  3OVN A;  5CHI A;  3L3U A;  2FBY A;  1J6Z A;  4CEQ A;  3CCE N;  1S5J A;  1NMD A;  4IBN A;  2HHS A;  2P9L A;  1I94 K;  2E6M A;  4FLT A;  1KAX A;  3JXU A;  3VQC A;  4FVM A;  1H1V A;  1VSK A;  1T03 A;  4JI2 K;  3NDK A;  5FPN A;  3JAM O;  3AVN A;  3HVR A;  4DV6 K;  2O4G A;  3K9K A;  4ILJ A;  4I9L A;  3AGK A;  1HR0 K;  5DK5 A;  4C8K A;  3ITH A;  5FRN A;  5BPM A;  3O9U A;  2KW4 A;  3CQ8 A;  3HK2 A;  4E3S A;  4B3T K;  4LF4 K;  3OY9 A;  5ELZ A;  3VF4 A;  2HNZ A;  1EQY A;  4RCH A;  2QWL A;  1RTD A;  4CBW A;  3RMA A;  3HYF A;  5M1O A;  4H0T B;  4DS5 A;  4E19 A;  4IEE A;  5BPL A;  5AQS A;  1NJZ A;  4FWM A;  3MEE A;  2X78 A;  3SAH A;  3O3H A;  3AA5 X;  2EX3 A;  3BGR A;  5C24 A;  3NF8 A;  4DTP A;  4LFA K;  1WSH A;  3O9R A;  3SUQ A;  4KHQ A;  2ZM6 K;  1U48 A;  3AAP A;  3CXC M;  1QSS A;  3M1F A;  4YFU A;  1HNX K;  3HRG A;  3EKU A;  1VQ9 N;  3LP3 A;  2ITM A;  1YVU A;  4NYN A;  1D9D A;  1NK5 A;  5C25 A;  1DTQ A;  4LF8 K;  4DG1 A;  5AQV A;  4M41 A;  4FLY A;  3VQQ A;  5JS2 A;  2HHT A;  1T8E A;  2G8V A;  2QWO A;  3K2P A;  4O4G A;  3W3D A;  4KH4 A;  3R8E A;  3V81 A;  5JVG L;  1MWK A;  5CZ1 A;  4BDY A;  1RBU A;  2HHQ A;  3HJF A;  1T05 A;  4LFB K;  3A5M C;  4O44 A;  3RSE B;  4F2R A;  4FJK A;  4M3X A;  2UXB K;  2OPR A;  1KQS M;  4CGD A;  4FJJ A;  4IFE A;  3VMF B;  2QK9 A;  3GE1 A;  4PA1 A;  5M1Q A;  4KFB A;  4CEO A;  3TAQ A;  3AVH A;  3SV3 A;  4JI8 K;  1QVG M;  1KLM A;  1SKW A;  2NNW A;  4WFB L;  1K8K A;  3AVF A;  2ATQ A;  3AV9 A;  4DR7 K;  4ID5 A;  4OJR A;  4WQ4 A;  2A41 A;  4ELU A;  3E9O A;  1SL0 A;  4F2S A;  2P9K A;  4JI7 K;  1WNS A;  1U2V B;  4DQP A;  4JI5 K;  2YHY A;  2OAN A;  2QI2 A;  4OKE A;  4J2B A;  3D6R A;  4JI3 K;  4FWN A;  5KRT A;  1NGJ A;  3LP1 A;  2WBN A;  3G6E N;  2RE2 A;  1N5Y A;  1QE1 A;  4YDU A;  3TAP A;  5BRH A;  3AY9 A;  1REV A;  3UKR A;  3LAL A;  2BH1 A;  5FLX O;  2HOE A;  3OYM A;  3DJC A;  4FW2 A;  2A1R A;  4DMN A;  1HNV A;  3AO2 A;  3KKR A;  4YOW A;  1F21 A;  2JGU A;  4FLX A;  3LDO A;  2F4V K;  3C6H A;  4CGJ A;  3JS6 A;  4N41 A;  2QWR A;  3MN9 A;  3R9P A;  4K41 A;  3PY8 A;  3L2Q A;  5C2D A;  1Y64 A;  2P9S A;  5JS1 A;  2P9N A;  5KPR A;  1RDW X;  3J7Z O;  4IDK A;  3LP0 A;  3HP6 A;  4ELV A;  4M3Z A;  2JLE A;  3O3G A;  3TAM A;  3AVK A;  4I6M A;  5EVZ A;  1NWK A;  1X3N A;  4M3U A;  3CPE A;  3MCP A;  2G8I A;  3E9P A;  4DQQ A;  1Z25 A;  4H0V B;  3K5M A;  1U47 A;  3RRG A;  1NK0 A;  3A8Y A;  2NRR A;  5HL7 L;  4JI0 K;  1VSF A;  2HMI A;  4ZHR A;  2D0B A;  1VQO N;  1EP4 A;  1TUY A;  3KHY A;  4E7K A;  4EHT A;  4GVM A;  4K25 A;  1J9A A;  1RT7 A;  2IC3 A;  2VGN A;  3VET A;  5CYQ A;  4UY8 O;  3KLG A;  3AVC A;  5AFU A;  3D2E B;  4DUZ K;  1B9F A;  2V7Y A;  4QS9 A;  1S9E A;  3T3F A;  1D4X A;  4R79 A;  5AQL A;  2KFZ A;  3QES A;  3CFR A;  2XHB A;  3SCX A;  2XRI A;  3FFI A;  5JIC A;  4GV9 A;  1YAG A;  4FJ7 A;  2QTD A;  1R59 O;  3SI6 A;  2Q2R A;  4GV6 A;  2HHV A;  4NCB A;  4IG0 A;  4O5F A;  5GAE P;  3AO4 A;  3LM9 A;  2KTQ A;  5AQK A;  2ITG A;  4FLW A;  3DXK A;  1VQK N;  2A3Z A;  4BRL A;  1RGI A;  2YI1 A;  4KHS A;  4BRC A;  4BVP A;  4OPH A;  2FBT A;  3F2K A;  4B9N A;  2DPN A;  4A61 A;  1ZBS A;  5AZI B;  5C10 A;  4U7B A;  3RMB A;  4Q5V A;  1HYS A;  3ULD A;  3QO9 A;  4FJX A;  4IO8 A;  3EE9 A;  2A42 A;  3PX6 A;  4YNQ A;  5LMU K;  3NBP A;  3VQB A;  2EHG A;  4OPA A;  5AQI A;  4PQU A;  1IV0 A;  3MK6 A;  4KB0 A;  3ZX3 A;  3AGR A;  1ATN A;  3C95 A;  4QS8 A;  3TAG A;  2QXF A;  1KXP A;  3T1A A;  4IJN A;  2VGM A;  2UU9 K;  2F8S A;  5BN9 A;  4K43 A;  3CCJ N;  4DSI A;  4GKK K;  3SK3 A;  2IVN A;  1LWC A;  4H5W A;  3NVK A;  4GY2 B;  1S1V A;  1U6Z A;  4BY9 C;  3NF6 A;  3S3M A;  2E1Z A;  1TVR A;  1RDC A;  3A0I X;  4B1Y B;  4FWR A;  3FZL A;  2GUI A;  5J2Q A;  2E1Y A;  1WB9 A;  1IKW A;  2RPI A;  4E7L A;  1Q7Y O;  1U49 A;  2NRH A;  4E1N A;  3KK3 A;  3M5R A;  3UE5 A;  2I5J A;  1VQ7 N;  5GIP A;  4DTO A;  3ZSO A;  1QS4 A;  4B9Q A;  3AAQ A;  1EKE A;  4HCC A;  2I7P A;  4PUO A;  1KVA A;  2BAN A;  2IOC A;  3MMV A;  2E2N A;  1TGO A;  4H4O A;  4JEP A;  4NCG A;  4FCY A;  3SYZ A;  3H3N O;  1NGB A;  3EE8 A;  2HHX A;  4JKH A;  3AVM A;  5TKW A;  4DKW A;  3U6F A;  1Q9Y A;  3RVC A;  2LSN A;  4HTU A;  4LH5 A;  2W40 A;  2R7Y A;  3PO4 A;  3LDS A;  4KTQ A;  3MXJ A;  4E1J A;  2UXC K;  1BG3 A;  1JCF A;  2IGI A;  2YKM A;  1ZBU A;  3QEI A;  3SQ1 A;  4WYB A;  1TAU A;  3KKS A;  4DR6 K;  3NGZ A;  1X9M A;  4WQ4 C;  1RT5 A;  3MEG A;  3U3G A;  3VES A;  3TWH A;  4DU3 A;  1YTU A;  3GG4 A;  3ZSZ A;  3MXM A;  3GL1 A;  4OGE A;  1X1P A;  4MFB A;  3MN5 A;  3RSE A;  5AQU A;  2P51 A;  4LSL A;  1GOA A;  2H3G X;  3HO1 A;  3V6D A;  5FDL A;  3PLA A;  2RHK A;  1KD1 O;  1K6Y A;  4KH5 A;  1RT6 A;  2HW3 A;  2CH5 A;  5EOY A;  2X74 A;  4ISG A;  3IMX A;  2ASM A;  2O8E B;  4DR5 K;  3VQA A;  5GAD P;  4IJA A;  3OTO K;  2KKZ A;  1JLG A;  1K73 O;  3MED A;  3M8Q A;  4DFM A;  3PX0 A;  1ZBH A;  3BF3 A;  1U2V A;  2DY4 A;  3L6Q A;  4YY3 K;  1C1C A;  1T3V A;  1VSI A;  4XIU A;  2BDP A;  4H5R A;  1NJY A;  2WON A;  2VG7 A;  1W7A A;  4I9Q A;  1HPM A;  3EY1 A;  4Z4H A;  4FJ8 A;  4CF2 A;  4KHU A;  3P39 A;  3B8A X;  2QEX N;  3BEX A;  1BIU A;  1BI4 B;  4MLE A;  1EWR A;  2YV0 X;  1X9S A;  4IZ9 A;  3LZJ A;  3VEO A;  4DTJ A;  3HST B;  3KK2 A;  1MU2 A;  1UWB A;  4Y0W A;  2GWK A;  4HUE A;  4FJ9 A;  3SAF A;  1GLA G;  4FWQ A;  3LAK A;  3VEN A;  3CG7 A;  2GX9 A;  4MQ3 A;  4DSL A;  1QZ5 A;  5AQZ A;  1S1X A;  2HHH K;  1ATR A;  3VQ4 A;  3T1H K;  5ADX A;  3N4P A;  4DHY A;  5GIO A;  3CPW M;  4OVL A;  5BR9 A;  4CJR A;  4BRA A;  3S9H A;  3SJJ A;  3P38 A;  4IWV A;  3NE6 A;  3V9Z A;  4CJQ A;  1RT2 A;  3RR7 A;  3J7A P;  1KVC A;  3CC4 N;  1ZC6 A;  1ZBL A;  3DLR A;  4FK0 A;  3MWT A;  1NOY A;  1DTT A;  1ATS A;  4Y1C A;  4DUY K;  2ZJP L;  4DV7 K;  3AO5 A;  3FLC O;  1QHA A;  4CJS A;  3O6W A;  4JKC A;  1XHX A;  1NJX A;  2KQ2 A;  3VQ6 A;  3W0L A;  4BRP A;  4ID1 A;  4O8U A;  4CBU A;  4EAH D;  1TKZ A;  5AQM A;  3DOK A;  4YOV A;  3LDL A;  1C1A A;  3GDQ A;  5GIN A;  4JI1 K;  3I33 A;  1WN7 A;  3V9S A;  3CCR N;  4KB1 A;  4BRN A;  2O8F B;  3V1Q A;  4LC9 B;  1YTA A;  1JCE A;  3VGK A;  3VOV A;  5EU7 A;  3D2E A;  3K57 A;  4YOR A;  4KHW A;  2DFH A;  4DTM A;  2PAV A;  3DYA A;  4IXC A;  3A5N C;  3HTV A;  4IEI A;  1YHQ N;  3O1W A;  4NO7 A;  1UOC A;  3F73 A;  3DLH A;  3CFO A;  1RDA A;  1W97 L;  1IKV A;  3CYM A;  4B3R K;  4CK1 A;  3ULE B;  2OPQ A;  3HP9 A;  3CQY A;  4CFD A;  3A5L C;  4ILG B;  1GLF O;  4CZE A;  4EP4 A;  1KTQ A;  4BRI A;  2YNG A;  3HPG A;  1RTJ A;  4KI6 A;  4BWM A;  3ZSY A;  3WXJ A;  4KBO A;  1J54 A;  4IOA L;  3VGL A;  3FR0 A;  5AZI A;  4E7H A;  3LL3 A;  2P5G A;  1A5W A;  3THW B;  1GLJ O;  3SAG A;  1VQ5 N;  3OYK A;  3HOS A;  4J2D A;  3V9W A;  3ASM A;  1RT3 A;  1I3A A;  1E3M A;  3V1R A;  2OZM A;  1IO2 A;  3OS2 A;  4DCH A;  4CHZ A;  3MN6 A;  3C7N B;  4OX9 K;  4H4M A;  2G8U A;  4RWT A;  2PZS A;  1Z05 A;  1YXQ A;  3ENH A;  3LZI A;  4W5R A;  3EEQ A;  1MA9 B; 
#chains in the Genus database with same CATH homology
 4DR6 K;  4DV3 K;  1HR0 K;  2VQF K;  1N33 K;  4DR2 K;  4LF5 K;  5FLX O;  4DUY K;  4DV7 K;  4DR3 K;  4CVN E;  4B3T K;  4LF4 K;  1XMO K;  2VQE K;  4X64 K;  2F4V K;  4JYA K;  5LMU K;  4CW7 B;  1IBM K;  4JI1 K;  5LL6 Z;  4LF6 K;  2UUC K;  4DR1 K;  4DR5 K;  1N32 K;  5IWA K;  4LFA K;  3OTO K;  4DV4 K;  1FJG K;  3T1Y K;  4NXM K;  2UU9 K;  2ZM6 K;  2UUA K;  1HNX K;  1HNZ K;  4GKK K;  4K0K K;  1HNW K;  4LF8 K;  1XNQ K;  5LMN K;  1XMQ K;  4X66 K;  4V19 S;  4DV2 K;  4YY3 K;  4NXN K;  1XNR K;  4B3R K;  1IBK K;  4JV5 K;  4YHH K;  1J5E K;  4DV1 K;  4LFB K;  4JI0 K;  4DR4 K;  2UXD K;  4X62 K;  4B3S K;  2UXB K;  3J80 O;  1N36 K;  5IT9 O;  4LF7 K;  5A2Q O;  4X65 K;  1IBL K;  4DV5 K;  4AQY K;  4JI8 K;  4DV0 K;  4JI6 K;  4DUZ K;  4LF9 K;  4DR7 K;  4JI4 K;  1N34 K;  2E5L K;  3J7Y P;  4B3M K;  3J81 O;  4JI7 K;  2HHH K;  4JI5 K;  3T1H K;  1I94 K;  4JI3 K;  4KHP K;  2UXC K;  4OX9 K;  5AJ3 K;  4GKJ K;  4JI2 K;  5BR8 K;  3J7A P;  4LFC K;  3JAM O;  2UUB K;  4DV6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...