4AHTA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
151
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
molecule keywords INTEGRASE
total genus 55
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahtA00
3ZT4A 1KVBA 4N56A 3HVRA 4F3OA 3OYMA 4E7LA 4KTQA 4DTSA 3C95A 3K5MA 3TAPA 4OLAA 4FJ7A 3V9WA 4CF2A 2JGUA 1IO2A 3RTVA 2HHSA 2EX3A 4CHPA 2P1JA 3AVBA 3TAEA 4Z4IA 4N47A 4IFYA 4E7KA 3TWHA 4GW6A 3OYHA 1D8YA 4LSLA 1KLNA 2G8WA 4B9VA 3AO5A 4PUOA 3SQ4A 1X1PA 2OPRA 3QETA 3TAQA 1LWFA 4CGJA 3NE6A 2OZMA 1K6YA 4K8ZA 3QIOA 1NOZA 1S1UA 4JLHA 4F4KA 1J9AA 2RF2A 1KSPA 1MU2A 3OJSA 3NHGA 4HTUA 4DQIA 1YT3A 3LP0A 4DG1A 3HT3A 1IG9A 1NK4A 3KD5E 4F8RA 3DLEA 4ICLA 3ZSZA 3HXMA 4H8KA 3TAMA 3KK2A 4WE1A 4I9QA 3I8DA 3AVIA 4DTNA 4DSFA 3PY8A 3DM2A 1XWLA 4KTZA 4DQRA 3L3VA 1KFDA 3LZIA 1VSKA 3LPUA 3KLGA 4EP4A 4FM2A 3CYMA 5J2MA 1J5OA 2PY5A 3KLFA 2LSNA 4CFDA 3NGIA 1NK6A 4I2PA 5J2NA 2KZZA 4B9NA 2XRIA 1EXQA 1FXXA 3SV3A 1S5JA 4KI4A 1WAFA 4KRFA 3MXJA 3KKRA 3CG7A 1JKHA 2F8TA 2IDOA 4CEAA 4OKJA 2G8FA 1Q8IA 1UAXA 4NCGA 3VQ9A 3KLHA 2Y1JA 1IKVA 4DFKA 3M8QA 4M3TA 1A5XA 1VSDA 1EETA 2EHGA 4G1QA 5KGWA 2OYQA 3CM6A 4FJKA 4KHSA 1YTUA 4B8CA 2HHQA 2YKNA 1HNIA 3C6TA 4CFBA 4FJIA 4FJGA 3T19A 2QK9A 1BGXT 4O0JA 3O3HA 3NDKA 1S6QA 2GBZA 3U6FA 3ASMA 1QSSA 1U45A 4LD0A 4CJEA 3O3GA 4CFCA 3AO3A 3LAKA 4CJVA 3IRXA 4FM0A 3O4QA 1VSHA 4PY5A 1D9DA 3OYAA 5CYMA 4KFBA 5KGXA 1RTIA 1RILA 1IKWA 1TKZA 3OYGA 3V9XA 1L3VA 2QXFA 4DSIA 2HNYA 3L2WA 4YNQA 3SI6A 2FBXA 4BE0A 4IDKA 3QERA 1C1BA 4C8MA 1VSIA 3C6UA 4J2BA 4C8NA 2X6NA 3L2VA 3VA3A 3BGRA 4CGFA 1Y97A 3MXIA 3ZSWA 3DI6A 5JS2A 3HSTB 3G0ZA 2VG6A 3JYTA 1TK8A 1CZ9A 1SKSA 3NF6A 3UIQA 1CLQA 3LDSA 2IS3A 2B4JA 1BHLA 1C0MA 4CJ3A 3OYNA 3ZT0A 2HHVA 3THVA 3AA4A 4M3XA 1VRTA 1TL1A 3HPHA 4FJHA 3QEIA 4N5SA 2GV9A 4CJ5A 1BIZA 1HQUA 4FM1A 4DFPA 1F21A 2HMIA 3RWUA 3S3NA 1ZYQA 4E19A 4DTPA 1CXQA 1KTQA 1UOCA 4E7IA 2HVHA 3OYFA 4M42A 4OGEA 2Z1HA 3HPOA 1WSGA 4Z4FA 2G8KA 1IKXA 2YNIA 3LP1A 1HYVA 1D9FA 5HRPA 4AILC 3CFOA 1WNSA 1GOCA 4ELVA 5HRRA 4DS4A 1C0TA 1GOBA 4KO0A 3HP6A 4Z4EA 4W5NA 1BI4B 3DYAA 4CF1A 4GMJB 4AHCA 4BWJA 4LY7A 5I42A 4B9LA 3O3FA 1L3UA 4BE2A 4OJRA 3VQQA 3ITHA 2FC0A 4KTWA 3LPTA 3QO9A 4DSJA 4FJ5A 3RRGA 3I0SA 2VWKA 1SL2A 3OS0A 3OJUA 3B6OA 3V1QA 4LSNA 3KLEA 4NCBA 4J2DA 3MECA 1RBVA 1D5AA 1SUQA 3MEEA 2XHBA 4DTJA 3NF9A 3SYZA 3HP9A 4MFBA 2O4GA 1BQNA 1WSEA 2HNZA 3V1RA 1RT4A 3NCIA 2HNDA 1SKWA 2HHWA 1TKTA 4BACA 1T8EA 4DWIA 4FVMA 2VG5A 3AVMA 1LV5A 1HNVA 4HCBA 4CJFA 2HW3A 3OYEA 2X74A 4CJRA 4CJWA 3WNEA 3SNNA 2DTUA 1VRUA 4DLEA 1U49A 5HP1A 1RT6A 3SPZA 2IAJA 2GUIA 3EY1A 1DTQA 3SUQA 2Y1IA 4J2AA 3ZSQA 4Q0BA 3OS1A 2YHBA 3HYFA 2ZE2A 2XO7A 4FJNA 3TAGA 3EZ5A 3ZT3A 3RMDA 1VSJA 1X9WA 3AVAA 3QEPA 2PZSA 2B5JA 3NH2A 2D0CA 3LZJA 4FJJA 2YV0X 4RW6A 4O0IA 4DTRA 2BGGA 2D5RA 4I2QA 1TKXA 1KVCA 1RTDA 4B9TA 3K5OA 1KFSA 4KV8A 2YKMA 3ZSVA 3SUPA 3S3OA 3F9KA 1DLOA 4O4GA 4W5RA 3SPYA 1SL1A 1QS4A 1X9MA 3PUFA 3VQEA 1QTMA 5J2PA 1Z26A 4M45A 3L3UA 1CXUA 4RW7A 4KPYA 4H4OA 3A2FA 2A1SA 4O5BA 3U3GA 1HYSA 2JLEA 3L2UA 1JLEA 2HHUA 1CZBA 1RDAA 3OYJA 4DQSA 3V9ZA 2XY6A 4B3OA 4NYFA 4M3RA 4M3UA 2VG7A 2RKIA 3ZT2A 1WSFA 3LP2A 1RDDA 2Z1JA 1KLMA 4FJ8A 2RN2A 1UWBA 4F2RA 4FLTA 3KK1A 3OVNA 3ISNC 3M8PA 3ZSOA 4ZHRA 4E89A 1B92A 1RCHA 1LW2A 3B6PA 3ZCMA 2HVIA 3V9SA 1L3SA 3JSMA 4FK4A 1LAVA 5KRSA 2X6SA 3AO2A 4AHRA 3V6DA 4BWMA 1TAUA 1TAQA 3VA0A 3ZSRA 4CGGA 4FLYA 4KHWA 2F96A 4DU4A 2KFZA 2DFFA 4DMNA 4IKFA 2DY4A 1ZBIA 3KKSA 1S9GA 4CFAA 3OS2A 4J2EA 1KCFA 2FBYA 1TV6A 1WSHA 3DLRA 1XC9A 4FJXA 1A5VA 3AA5X 4CEQA 4CK3A 1EX4A 3AA3A 3CM5A 4RG8A 4Y1DA 1Q9YA 3MAQA 2BDPA 4PQUA 1C1CA 5SWMA 2A1RA 1RTJA 1NK0A 1T7PA 4NYNA 4K8XA 4JS5A 3ZT1A 3HM9A 3AVJA 1BCMA 4N41A 4Z4HA 3OY9A 4C8OA 3LWMA 3K5LA 4N76A 1QSLA 3KIOA 3SQ0A 4EZ6A 1S1XA 3U3YA 3DLKA 4FW1A 4KKOA 1LWEA 2YNFA 4CESA 4CEBA 4W5TA 3AO4A 2B6AA 2OZSA 4FZXC 4CF0A 4CJLA 4CJTA 3V81A 2FBVA 1SL0A 1W0HA 4DU1A 3IG1A 2Z1GA 1RTHA 1VK0A 4O44A 4AHVA 4B08A 4CEOA 5E41A 4DF8A 5DK5A 1JLFA 5FDLA 3VQ4A 1R0AA 4E0DA 4OLBA 4ID5A 1REVA 4CGIA 1ZBUA 2HB5A 4EZ9A 1G15A 3H08A 2ZQBA 2YNGA 3T1AA 5T7BA 1BL3A 4CEEA 2OPQA 4HHTA 5JS1A 4E7JA 5C24A 4F2SA 1NKCA 4CK2A 3LWLA 1RT5A 1LAWA 2X78A 3VQ7A 1GOAA 4KREA 1BI4A 4EP5A 3C94A 4W5OA 4HCCA 3NFAA 4Z4CA 4C8LA 3HVTA 2KFNA 1BIUA 1EP4A 4AH9A 4DQQA 4FZYA 3AVKA 3K59A 5K14A 5D3GA 4H4MA 3SQ1A 2XY5A 4KB1A 1JLGA 1TK5A 1T05A 4ELTA 5SZTA 2KZMA 5HLFA 3SUOA 2WOMA 1BISA 5CY4A 3NGZA 1U47A 4E3SA 1UA1A 3QEWA 5CZ2A 1L5UA 4CE9A 1U4BA 3HK2A 3QLHA 2R7YA 2OPSA 3CFPA 3OYCA 4B9MA 2E6LA 4O55A 1RDBA 3AVCA 3V4IA 1TVRA 4OPKA 1ZBLA 3OYLA 2ETJA 4CJQA 4DLGA 4FK0A 1TL3A 4FW2A 1WN7A 4CHZA 1W9HA 3D0PA 4FK2A 2KW4A 3K57A 1KVAA 4R5PA 1VSLA 2G8IA 1QSYA 4M3WA 1TGOA 1IH7A 4DTXA 1WSJA 4BE1A 1RDCA 4CEDA 4CEFA 3NH1A 1WLJA 4AHUA 3P5JA 4DFJA 4IFVA 3VQ6A 5HRNA 4XIUA 3DRPA 3ZSYA 4LH5A 3AVLA 2BANA 3V9UA 3DRRA 4FXDA 4FYDA 2O4IA 1NJYA 2ATQA 1FKPA 2BE2A 1S6PA 3VQ8A 1N5YA 1RT2A 4E1NA 3G10A 3M8SA 3TABA 3VQCA 5KI6A 3PO5A 2ITGA 3WNHA 1JXBA 3KK3A 3RMCA 1NJWA 5CZ1A 4JS4A 1U48A 3VN5A 3AVFA 1VSFA 3EYZA 4OKEA 4CGDA 2PYJA 4L8RB 4W5QA 3RRHA 1L3TA 4TSXA 3HO1A 4QOZB 4HUEA 1JLAA 3KTQA 3QNNA 3TANA 3AO1A 3DLHA 3PX0A 4ZTJA 1RBSA 1YVUA 3HPGA 3QIPA 3OYDA 3CQ8A 3NGYA 3WNFA 1YTAA 4CHNA 4CJKA 3RR8A 1J53A 3MEDA 3NAEA 4JRQA 2WONA 2ZD1A 4QAGA 4DU3A 4DTOA 3QEVA 1RT1A 1B9FA 3QEXA 5I3UA 1TK0A 1N6QA 2OA8A 2KTQA 2FBTA 4BDPA 4FLWA 4CIGA 3L8BA 4DFMA 1NOYA 4B9UA 4DSLA 2G8UA 1EKEA 2Q3SA 1JXEA 3SV4A 1S1WA 4OPJA 2Z1IA 3AVGA 3F73A 2VWJA 3ALYA 2OPPA 4CJPA 1XHZA 2P5GA 4M3YA 1I3AA 3L2QA 4RW9A 1NKEA 2PYLA 4FJ9A 3HJFA 2AJQA 3IS9A 2E4LA 3VQDA 4HUGA 3ULDA 4F3TA 1JLCA 4M3ZA 2G8HA 2QKKA 3RMAA 4GVMA 1C0UA 1RBTA 3DOLA 1HPZA 1QHTA 1QE1A 4C8KA 2XY7A 5FRMA 1KRPA 2E6MA 3OYIA 5KRTA 4KB0A 3QNOA 1S1TA 3BDPA 2HHXA 3DMJA 1SKRA 4KHYA 3V1OA 2IGIA 5HBMA 2YHAA 4YFUA 4ZTFA 2DFHA 4KHQA 4AHSA 3LAMA 3K2PA 4FLZA 1XHXA 3KLIA 3TR8A 3WNGA 3VQBA 4CJUA 1NK7A 1HYZA 3TARA 3MEGA 5HRSA 3RMBA 4CF8A 3NH0A 1RT3A 3AVNA 3P1GA 3K58A 3E01A 4FLVA 3PX4A 1RBUA 1NK5A 4CECA 3TI0A 4CHQA 1S1VA 1JL1A 1NK9A 1IKYA 1A5WA 3K5NA 5J2QA 4KAZA 4B9SA 3NF8A 1X9SA 1NJZA 3AV9A 3NF7A 4CEZA 4UQGA 2NUBA 4IG3A 1B9DA 4KI6A 4Q5VA 4I9LA 5C42A 1Z25A 3CFRA 4JRPA 3S9HA 4KHUA 1ZBHA 4CK1A 1RT7A 2G8VA 1LW0A 2HHTA 1ASUA 5DMRA 3LALA 3ZSXA 5J1EA 3NBPA 4CIFA 3LANA 4AHTA 2W42A 1DTTA 4OVLA 4BDZA 3I0RA 1J54A 4LH4A 3FFIA 3DOKA 3OYKA 3VQ5A 1SV5A 1JLQA 5CYQA 4E7HA 2IC3A 2XY8A 4Z0UA 4DQPA 1C6VA 4QCLA 4NCAA 1HJRA 1T03A 4PA1A 3M8RA 4MQ3A 1VSMA 1HRHA 1LWCA 1QQCA 2P51A 2RPIA 4KHNA 2P5OA 1TKDA 4Z4GA 5KTQA 4DS5A 3LP3A 4ID1A 5FROA 2YNHA 1FKOA 1UA0A 1I39A 4OGCA 4RW4A 3SCXA 4M41A 1C1AA 1ZBFA 4DSEA 3TAFA 3VQAA 1BCOA 1WSIA 4B8AB 2F8SA 4DTMA 2QKBA 1Q9XA 3RR7A 1RNHA 4FLXA 3SZ2A 4ELUA 3AA2A 4FLUA 5HROA 4E1MA 3PX6A 4HVJA 3KJVA 1HMVA 4CJSA 4CHYA 4CIEA 3OYBA 3DLGA 4IBNA 4OKKA 1ASWA 3AVHA 3S3MA 1S9EA 2IOCA 3QINA 4CGHA 3L2RA 3PV8A 1NK8A 4I7FA 5C25A 1BQMA 1U04A 2I5JA 3SUNA 5EU7A 1XI1A 1ASVA 4FJMA 1NJXA 3SJJA 3KD1E 2KQ2A 4CJ4A 3SQ2A 3DLBA 2D0BA 4CHOA 3P83D 1JL2A 1WAJA 4DSKA 3O4NA 1NKBA 4FCYA 4FJLA 1FK9A 1RBRA 3DRSA 3HL8A 3MXMA 4IG0A 3D45A 4DTUA 4HUFA 4RW8A 3IAYA 4CF9A 4PWDA 4FZZA 4CCHA 3T3FA 3VQPA 2D0AA 5FRNA 1ITGA 4BDYA 4DF4A 3QESA 1VSEA 4CERA 3PO4A 1HQEA 2DFEA 1JLBA 4Y1CA 1O1WA
chains in the Genus database with same CATH superfamily
4N56A 1KVBA 3W3DA 2E2PA 5FPNA 3O9RA 3GOIA 2P9SB 3F9MA 4KTQA 4DTSA 4JKGA 4DR2K 3V9WA 1ILYA 3RTVA 2HHSA 4YY3K 1XUPO 3NVKA 2P9IA 1W7AA 3AVBA 4Z4IA 1KLNA 4B9VA 3C65A 4PUOA 1YITN 5BRDA 4NXMK 4JLHA 1J9AA 2RF2A 1KSPA 3OJSA 2KHOA 3GBTA 4HTUA 3H1QA 1GLAG 2I7PA 1IG9A 1BO5O 3DLEA 3KK2A 2QA4N 3E9LA 3CC2N 1QHAA 4BR0A 4DSFA 3ZX3A 4KTZA 5E84A 4DQRA 1KFDA 3WXMB 2ITMA 2W40A 4FM2A 5J2MA 2PY5A 1QVFM 4K43A 2P9LB 2H3GX 4H5RA 1WUAA 5ADXH 5J2NA 1FXXA 3AGRA 3SV3A 1BA1A 4PHTX 1WAFA 5BPMA 2IDOA 2G8FA 1Q8IA 3VQ9A 4DR6K 3PSFA 4DV1K 5C2FA 2VQEK 3M8QA 3FZLA 4G1QA 4B8CA 3C6TA 3C6AA 3T19A 4EAHD 2QK9A 4A62A 1QSSA 3AO3A 4FM0A 3IRXA 1NGAA 4KH6A 4CBWA 1VQNN 2E88A 3M6GA 1SAZA 1IKWA 1X3NA 1TKZA 5AQPA 3OYGA 4YNQA 1BWFO 4BC2A 2F4VK 2FBXA 4CZIA 5BREA 4IDKA 4C8MA 1VSIA 4C8NA 3DJCA 2UUAK 3F2KA 3MXIA 4GY2B 3G0ZA 3LM9A 3UIQA 2QEXN 3LDSA 2IS3A 1BHLA 1C0MA 2Q1NA 3AA4A 2UUBK 1TL1A 3D2FB 3HPHA 3D2FA 4FJHA 2GV9A 4CJ5A 1ESVA 4FOIA 1BIZA 1HQUA 4NO7A 4FM1A 1YAGA 5CR4A 1KTQA 2HVHA 3OYFA 1EO1A 1WSGA 1QQMA 3M5RA 2G8KA 4Z4FA 1IKXA 3CIPA 1HYVA 1WNSA 1BI4B 4CF1A 1U2VB 4GMJB 4BWJA 4LY7A 2VCPA 3VQQA 4KTWA 3MN9A 3RRGA 4JAXA 4WF9L 5ELZA 3OJUA 3B6OA 2KLAA 3LDQA 3KLEA 4A5BA 1VQ8N 1VQON 3SMPA 2XHBA 3NF9A 2Q31A 3O5BA 3QFUA 5KPZA 1RT4A 1H1VA 2VYPA 3NCIA 2HSTA 1SKWA 4DWIA 2DPNA 4FVMA 4BGAA 2VG5A 1LV5A 4FPAA 3FFKB 4HCBA 2HW3A 2DTUA 4CJWA 2V52B 3EY1A 1DTQA 1XNQK 5F2RA 3AVAA 3UB5A 3QEPA 2B5JA 1K8KA 3NH2A 3CXCM 4O0IA 1Q81O 1RTDA 4B9TA 3K5OA 3S3OA 3EE8A 4O4GA 3SPYA 1X9MA 1SL1A 3PUFA 1Z26A 3U3GA 1DGKN 2HHUA 3OYJA 4M3UA 2NRHA 5AQQA 2VG7A 3LP2A 2Z1JA 2JWLA 2RN2A 4BRCA 3QBXA 2WBNA 3V9SA 3QMLA 3BZCA 1NMDA 5AQIA 3UKUB 5JMVA 4JKGB 1BDGA 3V6DA 5AJ3K 4IFEA 4B1VA 1V4TA 1ZBIA 1QZ6A 1S9GA 4CFAA 3CHWA 4CZEA 5AQTA 1WSHA 2QWOA 3DLRA 3ENHA 1XC9A 3AA5X 3CM5A 4RG8A 4AF1A 4QS7A 2EWSA 5FPMA 1HJOA 2A1RA 4JS5A 2NLXA 3OY9A 4C8OA 3SQ0A 4FSVA 4EZ6A 1LWEA 2YNFA 4CEBA 3CCUN 4FZXC 4CJLA 4CJTA 5BPLA 1SL0A 2E20A 1W0HA 1VK0A 2F9WA 4B08A 5E41A 1JLFA 4OLBA 4CGIA 1REVA 5AQYA 3TU5A 3H08A 2YNGA 2YX6A 2PFUA 4CEEA 4MDAA 4E7JA 4F2SA 2D0PA 5MLCQ 4B3TK 2E2NA 2X78A 3CETA 4EP5A 3C94A 4JI7K 4OO1J 4FZYA 4DQQA 5D3GA 3O4WA 4O8KA 3SQ1A 1JLGA 2NRZA 3A5LC 3AAQA 3SUOA 1U47A 5CZ2A 1U4BA 1HNWK 1C0FA 2R7YA 2E8AA 1X3MA 4LC9B 4BRLA 3V4IA 4B3MK 4OPKA 4DLGA 4YORA 2Q2RA 5DM7L 2G8IA 1TGOA 1IH7A 4CEDA 3MN5A 4AHUA 4LH5A 4B9QA 5EY4A 1BOTO 1FKPA 3VF6A 3VQ8A 3SLCA 3G10A 4JI5K 1DEJA 2ITGA 2YJEA 3KK3A 4CGDA 1Q86O 1M90O 3RRHA 4QOZB 4HUEA 1JLAA 3FZMA 2FLOA 4GNIA 2WTUA 3L4QA 3MN7A 1J53A 3MEDA 4JK8A 3NAEA 4DTOA 3HM8A 1T44A 3KHYA 1VQKN 2YCHA 2PAVA 1E4GT 4B9UA 1VQLN 3CCSN 1S1WA 4OPJA 2Z1IA 2VWJA 2OPPA 3VGKA 4CJPA 3ULEA 2P5GA 1I3AA 3WUHA 1NKEA 2PYLA 3T7ZA 2FSNA 4HUGA 3B8AX 5KQDA 4IEIA 1C0UA 3DOLA 3MCAB 3CJBA 4JK7A 2GELA 3THWB 5KRTA 3QNOA 1YVNA 2HHXA 1HPMA 3QBWA 2VGNA 3CCVN 3V1OA 2IGIA 1SKRA 3IMXA 1T6DA 3LAMA 3PLAA 3TR8A 3WNGA 3VQBA 5HRSA 3RMBA 4CF8A 3P1GA 1GLCG 1NK9A 3TI0A 4CHQA 2FF6A 4RCHA 1IKYA 1J6ZA 1X9SA 3MWPA 3AV9A 3NF7A 3CJ1A 4I9LA 1Z25A 3CFRA 1RT7A 1LW0A 1ASUA 4C23A 1NGFA 3LALA 3PIOL 3ZSXA 3LANA 2W42A 1BA0A 1DTTA 3I0RA 1J54A 3FFIA 3DOKA 3OYKA 2E1YA 1SV5A 2CH6A 1NWKA 2IVNA 4DQPA 1C6VA 2HHHK 1WOQA 4QCLA 1HJRA 5JVHL 3M8RA 1YJNN 1VSMA 4V19S 3SBGA 1TKDA 5KTQA 5FROA 2YNHA 1FKOA 3ULEB 4X65K 4OGCA 3SCXA 5AQFA 1ZXOA 3VQAA 3JAMO 4CZGA 2YHXA 4M63C 1NJIO 5HROA 4CIEA 3S3MA 3PV8A 3VEVA 2NRXA 1VQ6N 4I7FA 3SUNA 1U04A 2I5JA 4YOVA 1XI1A 1ASVA 3ID8A 4FJMA 3EE9A 2D0BA 4CHOA 1WAJA 3O4NA 4FJLA 1RBRA 1OKJA 1NMNA 5BN9A 3IAYA 3THXB 3T3FA 3VQPA 5JLFA 4BDYA 4DF4A 4B1ZA 3PO4A 3O9UA 3VPZA 3SJHA 3U3YA 4Y1CA 3HVRA 3UE5A 4E7LA 5AQNA 3TAPA 4OLAA 4CF2A 1IO2A 2EX3A 3G4SN 5BR8K 2QWRA 3TAEA 2UXCK 3ZX0A 2ZJRL 1D8YA 4LSLA 3AO5A 2GWJA 3SQ4A 3TAQA 3OA9A 4CGJA 2KKZA 3DAWA 4JKAA 1DKGD 3CJ9A 4F4KA 4C1NI 4CI6A 4DQIA 3HT3A 4DG1A 4F8RA 5AQOA 3TAMA 4H0XB 3I8DA 3AVIA 4DTNA 3DM2A 1XWLA 4ISEA 3WEEB 4FOEA 3EO3A 1J5OA 4PL7A 5GAHP 3LDPA 4CFDA 4FWQA 1NK6A 2KZZA 4NLBA 2E2OA 2XRIA 4JD2B 3MXJA 2OTJN 3CG7A 4NCGA 3KLHA 2E2QA 4DFKA 1A5XA 2EHGA 1OH7A 5C0YA 5AZIA 2YKNA 1HNIA 4CFBA 4DR4K 4CD1A 4LD0A 3WXJA 3O3GA 2A6AA 1D9DA 2BTFA 4JD2A 1TYQB 2O8CB 3V9XA 3D7EO 2QI2A 3SI6A 4IO9L 1QVGM 1VHXA 3BF1A 3C7NB 1EWQA 4BE0A 2IIRA 4IDHA 2F7TA 3QERA 3GG4A 3OTOK 2X6NA 5M1KA 2A3ZA 2YJFA 1HKCA 3UKUA 4CGFA 3ZSWA 3JYTA 2VG6A 1CZ9A 3P38A 5AZIB 2P9NA 2OCEA 2B4JA 4PKGA 1VRTA 1QQNA 3A0IX 3QEIA 4N5SA 4DFPA 4DTPA 1CXQA 3GL1A 4M42A 4OGEA 3HPOA 4ILGB 4CZLA 3CC4N 1D9FA 2HF4A 1C0TA 3BP8A 4KO0A 3HP6A 4DS4A 4Z4EA 1L3UA 2UUCK 4OJRA 5C12A 4FJ5A 3QO9A 4A2BA 5BN8A 1IBMK 3U4LA 3THXA 1LCUA 3OS0A 1IBKK 1SZ2A 4LSNA 4KH4A 1D5AA 4B1UB 1N8RO 4DTJA 1W97L 3SYZA 3HP9A 1NGIA 1N33K 2O4GA 2QWQA 4JI0K 4Y0WA 1BQNA 3H45C 3V1RA 3ATVA 2OANA 1NGDA 2HNDA 1TKTA 3CCEN 3OYEA 3EKSA 2GWKA 3SAHA 3CI5A 5GIOA 4FWOA 1RT6A 3SUQA 3ZSQA 5LMNK 4CZMA 2ZE2A 4LFCK 5TKYA 3QICA 4BVPA 3TAGA 4BROA 1VSJA 1XNRK 2P9LA 2QWNA 2YV0X 4RW6A 4BG9A 4DTRA 2BGGA 2D5RA 4I2QA 1BU6O 1KVCA 3ZSVA 3SUPA 3G25A 1DLOA 4E1JA 4XH1A 3WT0A 1QTMA 3L3UA 4H5NA 4RW7A 4KPYA 4H4OA 3A2FA 2A1SA 4O5BA 2O8BB 1HYSA 4X66K 3L2UA 4NYFA 4M3RA 3TSPA 2RKIA 4IJAA 1GLBG 1RDDA 4O5FA 3CPWM 4F2RA 3M8PA 4E89A 1B92A 2HVIA 3B6PA 3ZCMA 5KRSA 4AHRA 1HKGA 4BWMA 3WQTA 1K8AO 3A8YA 4UY8O 4DV6K 4CGGA 4FLYA 3O9TA 5CE3A 2DFFA 3W0LA 1ATSA 2I7NA 4J2EA 1KCFA 2FBYA 1TV6A 3FZFA 4Y1DA 4L3QA 1NGCA 1NK0A 1T7PA 4DUYK 5LMUK 4K8XA 3LDOA 3ZT1A 3Q7BA 4DHYA 4Z4HA 3BY5A 3HTVA 3THYA 3LWMA 3KIOA 4WCEL 5JICA 4FW1A 4FWKA 4QS9A 5JVGL 3K9JA 1VQPN 2B6AA 2OZSA 4CF0A 5AQLA 3V81A 3G6EN 1S72N 2Z1GA 4O44A 4DF8A 5FDLA 3VQ4A 2HB5A 1G15A 5FLXO 5T7BA 2OPQA 4A2AA 3CJ7A 1NKCA 4CK2A 1RT5A 3IKMA 2HMPA 2KFNA 3HVTA 1BIUA 5GAEP 2NRTA 4AH9A 1IG8A 3AVKA 3H46O 3P4IA 3TPQA 1TK5A 4IJNA 1T05A 3VENA 2VQFK 2HF3A 1L5UA 3HK2A 3QB0A 3OYCA 1HLUA 3UKRA 2E6LA 3CQXA 4O55A 1RDBA 3AVCA 1TVRA 3OYLA 2ETJA 4FK2A 3J7AP 1VSLA 1U6ZA 5AQXA 1Q18A 4FWLA 4DR1K 4M3WA 1HX1A 2A42A 1KAYA 2RHKA 1RDCA 4DFJA 2A40A 3C7NA 3DRPA 4BVOA 4XEIA 2BANA 3V9UA 3CCMN 3FR0A 4FXDA 3I56N 2O4IA 4B1WB 1N5YA 1Q7YO 3PO5A 3WNHA 3RMCA 1NJWA 5CZ1A 4JI2K 4JS4A 3O8MA 1U48A 3VN5A 3P31A 2PYJA 4W5QA 1L3TA 3HO1A 5AZJA 2FSJA 3MK6A 3VF2A 3O9QA 1BG3A 3HPGA 3OYDA 3RR8A 4CHNA 3O08A 4JKBA 4DU3A 3QEXA 2WONA 2ZD1A 1TK0A 1RT1A 1B9FA 2FBTA 3L4IA 4FLWA 4CIGA 3L8BA 4DSLA 1JXEA 2P9NB 3SV4A 2P9PB 3AVGA 3ALYA 3CCRN 1XHZA 1XQSC 3L2QA 4M3YA 5AZJB 2W6KA 2E5LK 2AJQA 3IS9A 3VQDA 3ULDA 2G8HA 2QKKA 4GVMA 1RBTA 1C0GA 1HPZA 3PIPL 2XY7A 2UU9K 4KB0A 1S1TA 1TUUA 3DMJA 3HZ6A 2V51B 4JI6K 3N4PA 4YHHK 3J80O 4KHQA 3K2PA 4WFNL 1NK7A 1HYZA 3NH0A 3PX4A 4FLVA 3VOVA 1S1VA 5M1OA 3O80A 3NF8A 4X62K 2ZWHA 2D0OA 3WXLA 4KI6A 4JRPA 3MWTA 4CK1A 2HHTA 1Y64A 4FWSA 3MX2A 4CIFA 4AHTA 1MWKA 1XMQK 4BDZA 3E66A 3VQ5A 1YJ9N 1JLQA 4DB3A 1HR0K 2ZJPL 5CYQA 4HWIA 4PA1A 1K8KB 4Z4GA 1UA0A 4CZFA 1I39A 2YI1A 4DTMA 3ZYYX 3HBTA 3KJVA 2V7ZA 1HMVA 4CJSA 1ASWA 3T69A 3QINA 3L2RA 5E26A 1VQ9N 4BC4A 4XH4A 4H03B 2D4WA 3THYB 1JL2A 4A57A 5AQGA 4FCYA 1FK9A 3MXMA 3IDHA 4DTUA 3BUZB 4HUFA 4RW8A 3C6HA 2P9UA 3QDKA 1ITGA 1VQ4N 4JKDA 1JLBA 1E4FT 3ZT4A 4F3OA 2AA4A 2YHWA 2ZGZA 4LF6K 1I94K 3K5MA 3GE1A 4FJ7A 3A5OC 4BREA 2JGUA 4CHPA 5BRHA 4BRAA 2P1JA 4YOYA 4N47A 4IFYA 2OA8A 3TWHA 3OYHA 3O6WA 2G8WA 3QETA 1LWFA 2OZMA 1K6YA 4PKIA 1S1UA 4JHDB 1HUXA 5FPDA 1YT3A 3KD5E 3K0SA 2ZM6K 1CZAN 4ICLA 3ZSZA 2NNWA 5LJWA 1WB9A 4I9QA 4JYAK 3PY8A 4LFBK 3L3VA 1VSKA 2GEMA 3KLGA 4EP4A 5B8HA 1KD1O 4YOWA 4I2PA 4JV5K 4B9NA 1S5JA 3DXMB 4K0KK 5AQRA 4KRFA 3KKRA 3ATUA 3NVMA 1JKHA 4BC3A 4OKJA 1V4SA 1UAXA 4M7XA 5AQMA 2Y1JA 1IKVA 1T6CA 1VSDA 4FJKA 4KHSA 3EEQA 2HHQA 3BF3A 3JXUA 1BGXT 4O0JA 3O3HA 3NDKA 1S6QA 4JKHA 4DR3K 3ASMA 2BH1A 1U45A 3E9OA 4CJEA 3CJAA 4PY5A 3O4QA 3OYAA 1JCEA 3VEWA 5KGXA 1RTIA 4RWTA 1FJGK 2HBKA 1OVYA 3KZBA 1OH8A 4IZ9A 1C1BA 4J2BA 3L2VA 1Y97A 1HKBA 3DI6A 5JS2A 2O8DA 1SKSA 3P39A 1JCFA 4CJ3A 3OYNA 1N36K 1KQSM 1ATRA 3THVA 3FZHA 1YF5L 1S3XA 2P9KB 4HTLA 4JKFA 4AM6A 5C2DA 1F21A 3S3NA 1ZYQA 1O13A 2O8FB 4E19A 4E7IA 4ISFA 2Z1HA 5GIPA 5AQWA 2YNIA 4BG8A 5HRPA 4ELVA 5HRRA 4W5NA 1GOBA 5AR0A 3DYAA 5AFUA 3AY9A 4AHCA 2A5XA 3O3FA 1ZBSA 3TTFA 1OVQA 4H0OA 3E1YA 5EVZA 2VWKA 1OH5A 2HOEA 3V1QA 4NCBA 3MECA 1SUQA 3MEEA 3FE1A 2BUPA 1DT9A 3ENBA 3H3NO 4R79A 1EWRA 3CQYA 3AVMA 5DM6L 4B1YB 4CD3A 2X74A 4CJRA 3G71N 3WNEA 3SNNA 2FXUA 1VRUA 4LF9K 1U49A 4LF7K 3VEYA 2IAJA 4Q0BA 3VTHA 2YHBA 2W6LA 3EZ5A 4MDBA 1N34K 4BQZA 2PZSA 2D0CA 1EQYA 4GKJK 5I9EB 1TKXA 1VAZA 1KFSA 4KV8A 3F9KA 3VQEA 4M45A 3RVCA 3QFPA 5HL7L 1JLEA 4B3OA 3V9ZA 2AP1A 2PBDA 4DV7K 1QZ5A 1WSFA 3GDQA 1KLMA 5BR9A 4FJ8A 2NRVA 1UWBA 2QWLA 4U67L 4ZHRA 1LW2A 1NGGA 5BRFA 2D1KA 3CMAN 4H5WA 2X6SA 3AO2A 5AQHA 1TAUA 3O1BA 1TAQA 3VA0A 1RDUA 4DU4A 2UXBK 3R8EA 4DMNA 3EL2A 3SBTA 4IKFA 2DY4A 5LY3A 3KKSA 4H0YB 2ZF5O 4BRGA 1EX4A 3AA3A 2A41A 1Q9YA 2BDPA 4PQUA 1C1CA 4YOTA 5SWMA 1XMOK 1RTJA 4QS8A 1NGHA 1BCMA 2O8EB 3K5LA 1RGIA 1S1XA 1TUYA 1NGJA 3WXKA 1SQKA 4CESA 1WBDA 4W5TA 3AO4A 5LL6Z 2FBVA 4GVEA 1NM1A 3ZETB 1RTHA 4BR7A 3DXMA 4AHVA 3J81O 3J8AA 4E0DA 5DK5A 4IXCA 1R0AA 1OH6A 5FPEA 3T1AA 5F0XA 2O8BA 1BL3A 1X9JA 3LL3A 5JS1A 3LWLA 3Q7CA 2V7YA 1U2VA 4W5OA 1P8ZA 4Z4CA 4HCCA 3RSEB 3VGMA 3FGUA 5CHIA 3H3OB 2XY5A 3DXKB 2E1ZA 5SZTA 2KZMA 5HLFA 2WOMA 3NGZA 3QEWA 2NRWA 2OPSA 4B9MA 4FK0A 1ZBLA 4ILJA 1TL3A 1WN7A 4CHZA 2KW4A 1KVAA 4DQ8A 5HOOA 3VERA 4BE1A 4CEFA 3NH1A 3P5JA 3JS6A 4H0VB 4IFVA 4MO5A 5HRNA 5AQJA 1IV0A 4JKCA 2UYTA 1G99A 2QWPA 1NJYA 3D2EA 2ATQA 1RT2A 4E1NA 4IOAL 3M8SA 1MA9B 1JXBA 3CF5L 3TSQA 3HSCA 4JNEA 4EIAA 3EYZA 4TSXA 2IVPA 4H5TA 2FSKA 3OW2M 4FWRA 4MO4A 2CH5A 3TANA 1MDUB 3I33A 3PX0A 4ZTJA 1RBSA 4IOCL 3CQ8A 3NGYA 4CJKA 1GLJO 4JRQA 4KI4A 1N6QA 4YDUA 4NXNK 2NRRA 4FL9A 5C10A 2OTLN 1P90A 1NOYA 2Q3SA 3I55N 3L0QA 1M1KO 3BZKA 4RW9A 4GV3A 3HJFA 4BR4A 4F3TA 1JLCA 4M3ZA 4MLHA 3CERA 3VEZA 1QHTA 1QE1A 1KRPA 3CMEN 2E6MA 3OYIA 5JLHA 4YOUA 4YFUA 2YHAA 4ZTFA 2NZTA 4JHDA 4FLZA 1XHXA 3KLIA 3H1VX 3TARA 3ID6A 4NB4A 1RT3A 3K58A 4B9SA 3E01A 1NK5A 1RBUA 1JL1A 5J2QA 1A5WA 4JKEA 1NJZA 4CEZA 4Q5VA 2IVOA 5C42A 3S9HA 4KHUA 3SAFA 1ZBHA 2G8VA 5DMRA 3NBPA 2WC9A 3WQUA 3IFRA 4EHUA 4PKHA 4Z0UA 3IUCA 4NCAA 3DLLL 4IWVA 4YDUC 4BGBA 1HRHA 1LWCA 1QQCA 2P51A 2RPIA 1YJWN 3CCLN 4DS5A 4ID1A 4RW4A 4H0TB 4DSEA 3TAFA 4DKWA 1BCOA 1ATNA 1VQ5N 2F8SA 1Q9XA 3UKRB 5M1NA 3SZ2A 4FLUA 3KVGA 4E1MA 1GLEG 4WFAL 4IBNA 4OKKA 1S9EA 2IOCA 4CGHA 4OPAA 3TSUA 4JI8K 5EU7A 1NJXA 3SJJA 2KQ2A 4A61A 3SQ2A 1NG9A 3DLBA 3MN6A 3R9PA 1GLFO 3DWLA 3R3LA 1NKBA 3HL8A 4NLCA 3D45A 4RTFD 4FZZA 2D0AA 4AQYK 4BR9A 5FRNA 5AQSA 3QESA 1VSEA 4CERA 1R59O 1K9MO 1ZC6A 1HQEA 3U9ZA 1NU0A 1O1WA 1IBLK 4XH5A 3OYMA 2VGMA 1D4XA 4FWPA 4H5VA 4FO0A 3C95A 1LOTB 2P9PA 3VETA 1J5EK 4E7KA 3ZLJA 4GW6A 1X1PA 2OPRA 1YHQN 1S22A 3NE6A 4K8ZA 3QIOA 4FWMA 1NOZA 4DUZK 1MU2A 3NHGA 3LP0A 2O8DB 1NK4A 3HXMA 2GX9A 4H8KA 4WE1A 3NMUA 1NGEA 2Q0UA 3LZIA 5EX5A 3LPUA 3CYMA 3KLFA 3FLCO 3VTIA 3LDLA 2LSNA 1Z05A 1KAZA 5EXWA 3NGIA 1EXQA 4BRKA 5M1PA 2F8TA 2QXLA 4CEAA 4LFAK 4B3RK 3M3ZA 3CCJN 4M3TA 1EETA 5KGWA 1YTUA 2OYQA 3CM6A 3CPEA 4KH5A 3M1FA 4FJIA 4OPHA 4FJGA 5A2QO 2GBZA 3U6FA 4CFCA 4JN4A 3LAKA 4CJVA 4AM7A 1VSHA 4BRHA 4WFBL 2ASMA 3E9PA 5ADXA 5CYMA 5H1SQ 4KFBA 4OX9K 1RILA 2CGKA 1L3VA 3MCPA 2QXFA 4DSIA 2HNYA 3L2WA 1Q82O 2HBJA 1HNXK 3MX5A 4WQ4A 3C6UA 4B3SK 3VA3A 3BGRA 4WYBA 3HSTB 4M7YA 1TK8A 1CLQA 3NF6A 4BR5A 4JI4K 4DCHA 5F1XA 4GKKK 4B1XB 3ZT0A 2HHVA 4M3XA 4CZHA 4BRPA 5LJVA 2HMIA 2WUSA 4JEPA 3RWUA 4U7BA 1UOCA 2J4RA 3F5TA 3THWA 3LP1A 5C15A 4AILC 3CFOA 1NGBA 1GOCA 5I42A 4B9LA 3TTCA 3HOTA 1XC3A 4BE2A 1W2BM 4JI1K 5GAGP 3ITHA 2FC0A 4DSJA 3LPTA 3BEXA 3CJCA 3I0SA 1SL2A 4K25A 3ZX2A 5M1FA 1YXQA 4J2DA 3ZEUA 1NNEA 2P9KA 1KXPA 1RBVA 5AQZA 1VQMN 3R1XA 5M1QA 4WQ5C 4MFBA 3ZETA 1WSEA 2HNZA 3U8XA 2HHWA 4Z94A 3S41A 4BACA 2P9IB 1T8EA 1HNVA 4CJFA 3K9KA 3EZWA 4WQ4C 4DLEA 5HP1A 3SPZA 2GUIA 3VMFB 4J2AA 2Y1IA 4H0PA 3MMVA 3OS1A 3HYFA 4K41A 2XO7A 4FJNA 4X64K 3O9SA 3ZT3A 3RMDA 1X9WA 4CVNE 3L6QA 1RFQA 3LZJA 3WEEA 4MLEA 2YKMA 2FF3B 5IWAK 4JI3K 4CW7B 4W5RA 1QS4A 4DV5K 5J2PA 1CXUA 4CZKA 5BPNA 2W41A 2JLEA 1KAXA 2O8FA 1CZBA 1RDAA 4DQSA 2XY6A 4IEEA 3ZT2A 3AGKA 4FLTA 3TTDA 3KK1A 3OVNA 4A5AA 3ISNC 3ZSOA 1RCHA 1SS6A 4O8UA 4C1NK 4CJ7A 1L3SA 3JSMA 4FK4A 1LAVA 4FWNA 3VF4A 1MWMA 3O1WA 4CBXA 3ZSRA 1HNZK 4KHWA 2F96A 4ILHA 3PSIA 2KFZA 3OS2A 1NBWA 4FJXA 4I6MB 4G9ZA 4CEQA 1A5VA 4CK3A 3VEOA 4BRMA 3MAQA 1JJ2M 1TYQA 2O8CA 2UXDK 1QQOA 4NYNA 3HM9A 3AVJA 3OBYA 4N41A 4N76A 1QSLA 5EOYA 3DLKA 5AQVA 4KKOA 4BRNA 4WQ5A 3OBWA 4DU1A 3CCQN 3IG1A 4BRIA 4F9OA 4LF5K 3KK7A 4CEOA 4GV6A 4ID5A 1ZBUA 1KC8O 4EZ9A 2ZQBA 4GV9A 1GLDG 4I6MA 4HHTA 5GINA 5C24A 1LAWA 4KREA 3VQ7A 1GOAA 1BI4A 1YI2N 3NFAA 4C8LA 1EP4A 5KPTA 3K59A 5K14A 4H4MA 3R6MA 3VEXA 3EN9A 3CD6N 4KB1A 1GLLO 3D2EB 4ELTA 4LF4K 5CY4A 1BISA 1JCGA 4E3SA 1UA1A 4K42A 4CE9A 3T1HK 3QLHA 3T1YK 3CFPA 5AQKA 2YHYA 3SAGA 2HBLA 4CJQA 4FW2A 4BR2A 1W9HA 3D0PA 3D6RA 3K57A 4R5PA 1QSYA 3SK3A 4DR5K 4DTXA 2O8EA 1WSJA 4EFHA 1WLJA 1WBBA 3VESA 4XIUA 3VQ6A 3A5MC 2ZGYA 3ZSYA 3AVLA 1FW6A 5TKWA 2HBMA 4YOXA 3DRRA 4FYDA 4ISGA 3DXKA 4KBOA 4DR7K 2BE2A 3HI0A 1S6PA 3ENOA 3CC7N 3TABA 3VQCA 5KI6A 1YIJN 3AVFA 1VSFA 4OKEA 1YUWA 4L8RB 4BRDA 4EHTA 2ASOA 2JWKA 3KTQA 3QNNA 3VGLA 3AO1A 3DLHA 1T3VA 1YVUA 3QIPA 4BRQA 3WNFA 1YTAA 1Z6RA 3A5NC 4QAGA 3QEVA 5I3UA 4DV2K 2KTQA 3U9DA 3ZEUB 4BDPA 4IO8A 2QWMA 4DFMA 3C0BA 4LF8K 2G8UA 2ASPA 1EKEA 5GADP 3F73A 1NLVA 4FJ9A 4IOXA 1N32K 2E4LA 2CGJA 4KHPK 3KWGA 3RMAA 3FZKA 2QW9A 5AFUH 3I8BA 5FRMA 4C8KA 1IJJA 5KPRA 3BDPA 4KHYA 5HBMA 4DV0K 2Q36A 2DFHA 3H6EA 4AHSA 4CZJA 4CJUA 5IT9O 2VWBA 3MEGA 2WFBA 4J8FA 3AVNA 4FJJA 4CECA 4KAZA 3K5NA 4UQGA 2NUBA 3WXIA 4IG3A 1B9DA 4FVUA 2P9SA 2Q97A 4PL8A 5J1EA 3HOSA 4FPBA 4OVLA 4LH4A 4BC5A 3MDQA 2ZJQL 4E7HA 2IC3A 2XY8A 3LDNA 3RSEA 2QTDA 1T03A 4MQ3A 2F9TA 4BQLA 2GTDA 4BY9C 4KHNA 2GUPA 1BUPA 3J7YP 2P5OA 3LM2A 3LP3A 4BRFA 2CGLA 3EKUA 4M41A 1C1AA 1ZBFA 1WSIA 4B8AB 2QKBA 3RR7A 1RNHA 1RDWX 5KQ8A 4FLXA 5AQUA 3AA2A 4ELUA 1E3MA 3PX6A 4CBUA 4HVJA 3J7ZO 4CHYA 3OYBA 4A59A 3DLGA 3AVHA 3HRGA 1NK8A 3SMSA 5C25A 1BQMA 3OHRA 4DV4K 3KD1E 4CJ4A 3P83D 4DSKA 3AAPA 4DV3K 3DRSA 4IG0A 3N4QA 2Q0RA 4JK9A 1K73O 4CF9A 4PWDA 2QM1A 4CCHA 1VQ7N 2P9UB 3KWIA 2RE2A 3AARA 2DFEA
chains in the Genus database with same CATH topology
3ZT4A 1KVBA 4N56A 3HVRA 4F3OA 3OYMA 4E7LA 4KTQA 4DTSA 3C95A 3K5MA 3TAPA 4OLAA 4FJ7A 3V9WA 4CF2A 2JGUA 1IO2A 3RTVA 2HHSA 2EX3A 4CHPA 2P1JA 3AVBA 3TAEA 4Z4IA 4N47A 4IFYA 4E7KA 3TWHA 4GW6A 3OYHA 1D8YA 4LSLA 1KLNA 2G8WA 4B9VA 3AO5A 4PUOA 3SQ4A 1X1PA 2OPRA 3QETA 3TAQA 1LWFA 4CGJA 3NE6A 2OZMA 1K6YA 4K8ZA 3QIOA 1NOZA 1S1UA 4JLHA 4F4KA 1J9AA 2RF2A 1KSPA 1MU2A 3OJSA 3NHGA 4HTUA 4DQIA 1YT3A 3LP0A 4DG1A 3HT3A 1IG9A 1NK4A 3KD5E 4F8RA 3DLEA 4ICLA 3ZSZA 3HXMA 4H8KA 3TAMA 3KK2A 4WE1A 4I9QA 3I8DA 3AVIA 4DTNA 4DSFA 3PY8A 3DM2A 1XWLA 4KTZA 4DQRA 3L3VA 1KFDA 3LZIA 1VSKA 3LPUA 3KLGA 4EP4A 4FM2A 3CYMA 5J2MA 1J5OA 2PY5A 3KLFA 2LSNA 4CFDA 3NGIA 1NK6A 4I2PA 5J2NA 2KZZA 4B9NA 2XRIA 1EXQA 1FXXA 3SV3A 1S5JA 4KI4A 1WAFA 4KRFA 3MXJA 3KKRA 3CG7A 1JKHA 2F8TA 2IDOA 4CEAA 4OKJA 2G8FA 1Q8IA 1UAXA 4NCGA 3VQ9A 3KLHA 2Y1JA 1IKVA 4DFKA 3M8QA 4M3TA 1A5XA 1VSDA 1EETA 2EHGA 4G1QA 5KGWA 2OYQA 3CM6A 4FJKA 4KHSA 1YTUA 4B8CA 2HHQA 2YKNA 1HNIA 3C6TA 4CFBA 4FJIA 4FJGA 3T19A 2QK9A 1BGXT 4O0JA 3O3HA 3NDKA 1S6QA 2GBZA 3U6FA 3ASMA 1QSSA 1U45A 4LD0A 4CJEA 3O3GA 4CFCA 3AO3A 3LAKA 4CJVA 3IRXA 4FM0A 3O4QA 1VSHA 4PY5A 1D9DA 3OYAA 5CYMA 4KFBA 5KGXA 1RTIA 1RILA 1IKWA 1TKZA 3OYGA 3V9XA 1L3VA 2QXFA 4DSIA 2HNYA 3L2WA 4YNQA 3SI6A 2FBXA 4BE0A 4IDKA 3QERA 1C1BA 4C8MA 1VSIA 3C6UA 4J2BA 4C8NA 2X6NA 3L2VA 3VA3A 3BGRA 4CGFA 1Y97A 3MXIA 3ZSWA 3DI6A 5JS2A 3HSTB 3G0ZA 2VG6A 3JYTA 1TK8A 1CZ9A 1SKSA 3NF6A 3UIQA 1CLQA 3LDSA 2IS3A 2B4JA 1BHLA 1C0MA 4CJ3A 3OYNA 3ZT0A 2HHVA 3THVA 3AA4A 4M3XA 1VRTA 1TL1A 3HPHA 4FJHA 3QEIA 4N5SA 2GV9A 4CJ5A 1BIZA 1HQUA 4FM1A 4DFPA 1F21A 2HMIA 3RWUA 3S3NA 1ZYQA 4E19A 4DTPA 1CXQA 1KTQA 1UOCA 4E7IA 2HVHA 3OYFA 4M42A 4OGEA 2Z1HA 3HPOA 1WSGA 4Z4FA 2G8KA 1IKXA 2YNIA 3LP1A 1HYVA 1D9FA 5HRPA 4AILC 3CFOA 1WNSA 1GOCA 4ELVA 5HRRA 4DS4A 1C0TA 1GOBA 4KO0A 3HP6A 4Z4EA 4W5NA 1BI4B 3DYAA 4CF1A 4GMJB 4AHCA 4BWJA 4LY7A 5I42A 4B9LA 3O3FA 1L3UA 4BE2A 4OJRA 3VQQA 3ITHA 2FC0A 4KTWA 3LPTA 3QO9A 4DSJA 4FJ5A 3RRGA 3I0SA 2VWKA 1SL2A 3OS0A 3OJUA 3B6OA 3V1QA 4LSNA 3KLEA 4NCBA 4J2DA 3MECA 1RBVA 1D5AA 1SUQA 3MEEA 2XHBA 4DTJA 3NF9A 3SYZA 3HP9A 4MFBA 2O4GA 1BQNA 1WSEA 2HNZA 3V1RA 1RT4A 3NCIA 2HNDA 1SKWA 2HHWA 1TKTA 4BACA 1T8EA 4DWIA 4FVMA 2VG5A 3AVMA 1LV5A 1HNVA 4HCBA 4CJFA 2HW3A 3OYEA 2X74A 4CJRA 4CJWA 3WNEA 3SNNA 2DTUA 1VRUA 4DLEA 1U49A 5HP1A 1RT6A 3SPZA 2IAJA 2GUIA 3EY1A 1DTQA 3SUQA 2Y1IA 4J2AA 3ZSQA 4Q0BA 3OS1A 2YHBA 3HYFA 2ZE2A 2XO7A 4FJNA 3TAGA 3EZ5A 3ZT3A 3RMDA 1VSJA 1X9WA 3AVAA 3QEPA 2PZSA 2B5JA 3NH2A 2D0CA 3LZJA 4FJJA 2YV0X 4RW6A 4O0IA 4DTRA 2BGGA 2D5RA 4I2QA 1TKXA 1KVCA 1RTDA 4B9TA 3K5OA 1KFSA 4KV8A 2YKMA 3ZSVA 3SUPA 3S3OA 3F9KA 1DLOA 4O4GA 4W5RA 3SPYA 1SL1A 1QS4A 1X9MA 3PUFA 3VQEA 1QTMA 5J2PA 1Z26A 4M45A 3L3UA 1CXUA 4RW7A 4KPYA 4H4OA 3A2FA 2A1SA 4O5BA 3U3GA 1HYSA 2JLEA 3L2UA 1JLEA 2HHUA 1CZBA 1RDAA 3OYJA 4DQSA 3V9ZA 2XY6A 4B3OA 4NYFA 4M3RA 4M3UA 2VG7A 2RKIA 3ZT2A 1WSFA 3LP2A 1RDDA 2Z1JA 1KLMA 4FJ8A 2RN2A 1UWBA 4F2RA 4FLTA 3KK1A 3OVNA 3ISNC 3M8PA 3ZSOA 4ZHRA 4E89A 1B92A 1RCHA 1LW2A 3B6PA 3ZCMA 2HVIA 3V9SA 1L3SA 3JSMA 4FK4A 1LAVA 5KRSA 2X6SA 3AO2A 4AHRA 3V6DA 4BWMA 1TAUA 1TAQA 3VA0A 3ZSRA 4CGGA 4FLYA 4KHWA 2F96A 4DU4A 2KFZA 2DFFA 4DMNA 4IKFA 2DY4A 1ZBIA 3KKSA 1S9GA 4CFAA 3OS2A 4J2EA 1KCFA 2FBYA 1TV6A 1WSHA 3DLRA 1XC9A 4FJXA 1A5VA 3AA5X 4CEQA 4CK3A 1EX4A 3AA3A 3CM5A 4RG8A 4Y1DA 1Q9YA 3MAQA 2BDPA 4PQUA 1C1CA 5SWMA 2A1RA 1RTJA 1NK0A 1T7PA 4NYNA 4K8XA 4JS5A 3ZT1A 3HM9A 3AVJA 1BCMA 4N41A 4Z4HA 3OY9A 4C8OA 3LWMA 3K5LA 4N76A 1QSLA 3KIOA 3SQ0A 4EZ6A 1S1XA 3U3YA 3DLKA 4FW1A 4KKOA 1LWEA 2YNFA 4CESA 4CEBA 4W5TA 3AO4A 2B6AA 2OZSA 4FZXC 4CF0A 4CJLA 4CJTA 3V81A 2FBVA 1SL0A 1W0HA 4DU1A 3IG1A 2Z1GA 1RTHA 1VK0A 4O44A 4AHVA 4B08A 4CEOA 5E41A 4DF8A 5DK5A 1JLFA 5FDLA 3VQ4A 1R0AA 4E0DA 4OLBA 4ID5A 1REVA 4CGIA 1ZBUA 2HB5A 4EZ9A 1G15A 3H08A 2ZQBA 2YNGA 3T1AA 5T7BA 1BL3A 4CEEA 2OPQA 4HHTA 5JS1A 4E7JA 5C24A 4F2SA 1NKCA 4CK2A 3LWLA 1RT5A 1LAWA 2X78A 3VQ7A 1GOAA 4KREA 1BI4A 4EP5A 3C94A 4W5OA 4HCCA 3NFAA 4Z4CA 4C8LA 3HVTA 2KFNA 1BIUA 1EP4A 4AH9A 4DQQA 4FZYA 3AVKA 3K59A 5K14A 5D3GA 4H4MA 3SQ1A 2XY5A 4KB1A 1JLGA 1TK5A 1T05A 4ELTA 5SZTA 2KZMA 5HLFA 3SUOA 2WOMA 1BISA 5CY4A 3NGZA 1U47A 4E3SA 1UA1A 3QEWA 5CZ2A 1L5UA 4CE9A 1U4BA 3HK2A 3QLHA 2R7YA 2OPSA 3CFPA 3OYCA 4B9MA 2E6LA 4O55A 1RDBA 3AVCA 3V4IA 1TVRA 4OPKA 1ZBLA 3OYLA 2ETJA 4CJQA 4DLGA 4FK0A 1TL3A 4FW2A 1WN7A 4CHZA 1W9HA 3D0PA 4FK2A 2KW4A 3K57A 1KVAA 4R5PA 1VSLA 2G8IA 1QSYA 4M3WA 1TGOA 1IH7A 4DTXA 1WSJA 4BE1A 1RDCA 4CEDA 4CEFA 3NH1A 1WLJA 4AHUA 3P5JA 4DFJA 4IFVA 3VQ6A 5HRNA 4XIUA 3DRPA 3ZSYA 4LH5A 3AVLA 2BANA 3V9UA 3DRRA 4FXDA 4FYDA 2O4IA 1NJYA 2ATQA 1FKPA 2BE2A 1S6PA 3VQ8A 1N5YA 1RT2A 4E1NA 3G10A 3M8SA 3TABA 3VQCA 5KI6A 3PO5A 2ITGA 3WNHA 1JXBA 3KK3A 3RMCA 1NJWA 5CZ1A 4JS4A 1U48A 3VN5A 3AVFA 1VSFA 3EYZA 4OKEA 4CGDA 2PYJA 4L8RB 4W5QA 3RRHA 1L3TA 4TSXA 3HO1A 4QOZB 4HUEA 1JLAA 3KTQA 3QNNA 3TANA 3AO1A 3DLHA 3PX0A 4ZTJA 1RBSA 1YVUA 3HPGA 3QIPA 3OYDA 3CQ8A 3NGYA 3WNFA 1YTAA 4CHNA 4CJKA 3RR8A 1J53A 3MEDA 3NAEA 4JRQA 2WONA 2ZD1A 4QAGA 4DU3A 4DTOA 3QEVA 1RT1A 1B9FA 3QEXA 5I3UA 1TK0A 1N6QA 2OA8A 2KTQA 2FBTA 4BDPA 4FLWA 4CIGA 3L8BA 4DFMA 1NOYA 4B9UA 4DSLA 2G8UA 1EKEA 2Q3SA 1JXEA 3SV4A 1S1WA 4OPJA 2Z1IA 3AVGA 3F73A 2VWJA 3ALYA 2OPPA 4CJPA 1XHZA 2P5GA 4M3YA 1I3AA 3L2QA 4RW9A 1NKEA 2PYLA 4FJ9A 3HJFA 2AJQA 3IS9A 2E4LA 3VQDA 4HUGA 3ULDA 4F3TA 1JLCA 4M3ZA 2G8HA 2QKKA 3RMAA 4GVMA 1C0UA 1RBTA 3DOLA 1HPZA 1QHTA 1QE1A 4C8KA 2XY7A 5FRMA 1KRPA 2E6MA 3OYIA 5KRTA 4KB0A 3QNOA 1S1TA 3BDPA 2HHXA 3DMJA 1SKRA 4KHYA 3V1OA 2IGIA 5HBMA 2YHAA 4YFUA 4ZTFA 2DFHA 4KHQA 4AHSA 3LAMA 3K2PA 4FLZA 1XHXA 3KLIA 3TR8A 3WNGA 3VQBA 4CJUA 1NK7A 1HYZA 3TARA 3MEGA 5HRSA 3RMBA 4CF8A 3NH0A 1RT3A 3AVNA 3P1GA 3K58A 3E01A 4FLVA 3PX4A 1RBUA 1NK5A 4CECA 3TI0A 4CHQA 1S1VA 1JL1A 1NK9A 1IKYA 1A5WA 3K5NA 5J2QA 4KAZA 4B9SA 3NF8A 1X9SA 1NJZA 3AV9A 3NF7A 4CEZA 4UQGA 2NUBA 4IG3A 1B9DA 4KI6A 4Q5VA 4I9LA 5C42A 1Z25A 3CFRA 4JRPA 3S9HA 4KHUA 1ZBHA 4CK1A 1RT7A 2G8VA 1LW0A 2HHTA 1ASUA 5DMRA 3LALA 3ZSXA 5J1EA 3NBPA 4CIFA 3LANA 4AHTA 2W42A 1DTTA 4OVLA 4BDZA 3I0RA 1J54A 4LH4A 3FFIA 3DOKA 3OYKA 3VQ5A 1SV5A 1JLQA 5CYQA 4E7HA 2IC3A 2XY8A 4Z0UA 4DQPA 1C6VA 4QCLA 4NCAA 1HJRA 1T03A 4PA1A 3M8RA 4MQ3A 1VSMA 1HRHA 1LWCA 1QQCA 2P51A 2RPIA 4KHNA 2P5OA 1TKDA 4Z4GA 5KTQA 4DS5A 3LP3A 4ID1A 5FROA 2YNHA 1FKOA 1UA0A 1I39A 4OGCA 4RW4A 3SCXA 4M41A 1C1AA 1ZBFA 4DSEA 3TAFA 3VQAA 1BCOA 1WSIA 4B8AB 2F8SA 4DTMA 2QKBA 1Q9XA 3RR7A 1RNHA 4FLXA 3SZ2A 4ELUA 3AA2A 4FLUA 5HROA 4E1MA 3PX6A 4HVJA 3KJVA 1HMVA 4CJSA 4CHYA 4CIEA 3OYBA 3DLGA 4IBNA 4OKKA 1ASWA 3AVHA 3S3MA 1S9EA 2IOCA 3QINA 4CGHA 3L2RA 3PV8A 1NK8A 4I7FA 5C25A 1BQMA 1U04A 2I5JA 3SUNA 5EU7A 1XI1A 1ASVA 4FJMA 1NJXA 3SJJA 3KD1E 2KQ2A 4CJ4A 3SQ2A 3DLBA 2D0BA 4CHOA 3P83D 1JL2A 1WAJA 4DSKA 3O4NA 1NKBA 4FCYA 4FJLA 1FK9A 1RBRA 3DRSA 3HL8A 3MXMA 4IG0A 3D45A 4DTUA 4HUFA 4RW8A 3IAYA 4CF9A 4PWDA 4FZZA 4CCHA 3T3FA 3VQPA 2D0AA 5FRNA 1ITGA 4BDYA 4DF4A 3QESA 1VSEA 4CERA 3PO4A 1HQEA 2DFEA 1JLBA 4Y1CA 1O1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZT4 A;  1KVB A;  4N56 A;  3HVR A;  4F3O A;  3OYM A;  4E7L A;  4KTQ A;  4DTS A;  3C95 A;  3K5M A;  3TAP A;  4OLA A;  4FJ7 A;  3V9W A;  4CF2 A;  2JGU A;  1IO2 A;  3RTV A;  2HHS A;  2EX3 A;  4CHP A;  2P1J A;  3AVB A;  3TAE A;  4Z4I A;  4N47 A;  4IFY A;  4E7K A;  3TWH A;  4GW6 A;  3OYH A;  1D8Y A;  4LSL A;  1KLN A;  2G8W A;  4B9V A;  3AO5 A;  4PUO A;  3SQ4 A;  1X1P A;  2OPR A;  3QET A;  3TAQ A;  1LWF A;  4CGJ A;  3NE6 A;  2OZM A;  1K6Y A;  4K8Z A;  3QIO A;  1NOZ A;  1S1U A;  4JLH A;  4F4K A;  1J9A A;  2RF2 A;  1KSP A;  1MU2 A;  3OJS A;  3NHG A;  4HTU A;  4DQI A;  1YT3 A;  3LP0 A;  4DG1 A;  3HT3 A;  1IG9 A;  1NK4 A;  3KD5 E;  4F8R A;  3DLE A;  4ICL A;  3ZSZ A;  3HXM A;  4H8K A;  3TAM A;  3KK2 A;  4WE1 A;  4I9Q A;  3I8D A;  3AVI A;  4DTN A;  4DSF A;  3PY8 A;  3DM2 A;  1XWL A;  4KTZ A;  4DQR A;  3L3V A;  1KFD A;  3LZI A;  1VSK A;  3LPU A;  3KLG A;  4EP4 A;  4FM2 A;  3CYM A;  5J2M A;  1J5O A;  2PY5 A;  3KLF A;  2LSN A;  4CFD A;  3NGI A;  1NK6 A;  4I2P A;  5J2N A;  2KZZ A;  4B9N A;  2XRI A;  1EXQ A;  1FXX A;  3SV3 A;  1S5J A;  4KI4 A;  1WAF A;  4KRF A;  3MXJ A;  3KKR A;  3CG7 A;  1JKH A;  2F8T A;  2IDO A;  4CEA A;  4OKJ A;  2G8F A;  1Q8I A;  1UAX A;  4NCG A;  3VQ9 A;  3KLH A;  2Y1J A;  1IKV A;  4DFK A;  3M8Q A;  4M3T A;  1A5X A;  1VSD A;  1EET A;  2EHG A;  4G1Q A;  5KGW A;  2OYQ A;  3CM6 A;  4FJK A;  4KHS A;  1YTU A;  4B8C A;  2HHQ A;  2YKN A;  1HNI A;  3C6T A;  4CFB A;  4FJI A;  4FJG A;  3T19 A;  2QK9 A;  1BGX T;  4O0J A;  3O3H A;  3NDK A;  1S6Q A;  2GBZ A;  3U6F A;  3ASM A;  1QSS A;  1U45 A;  4LD0 A;  4CJE A;  3O3G A;  4CFC A;  3AO3 A;  3LAK A;  4CJV A;  3IRX A;  4FM0 A;  3O4Q A;  1VSH A;  4PY5 A;  1D9D A;  3OYA A;  5CYM A;  4KFB A;  5KGX A;  1RTI A;  1RIL A;  1IKW A;  1TKZ A;  3OYG A;  3V9X A;  1L3V A;  2QXF A;  4DSI A;  2HNY A;  3L2W A;  4YNQ A;  3SI6 A;  2FBX A;  4BE0 A;  4IDK A;  3QER A;  1C1B A;  4C8M A;  1VSI A;  3C6U A;  4J2B A;  4C8N A;  2X6N A;  3L2V A;  3VA3 A;  3BGR A;  4CGF A;  1Y97 A;  3MXI A;  3ZSW A;  3DI6 A;  5JS2 A;  3HST B;  3G0Z A;  2VG6 A;  3JYT A;  1TK8 A;  1CZ9 A;  1SKS A;  3NF6 A;  3UIQ A;  1CLQ A;  3LDS A;  2IS3 A;  2B4J A;  1BHL A;  1C0M A;  4CJ3 A;  3OYN A;  3ZT0 A;  2HHV A;  3THV A;  3AA4 A;  4M3X A;  1VRT A;  1TL1 A;  3HPH A;  4FJH A;  3QEI A;  4N5S A;  2GV9 A;  4CJ5 A;  1BIZ A;  1HQU A;  4FM1 A;  4DFP A;  1F21 A;  2HMI A;  3RWU A;  3S3N A;  1ZYQ A;  4E19 A;  4DTP A;  1CXQ A;  1KTQ A;  1UOC A;  4E7I A;  2HVH A;  3OYF A;  4M42 A;  4OGE A;  2Z1H A;  3HPO A;  1WSG A;  4Z4F A;  2G8K A;  1IKX A;  2YNI A;  3LP1 A;  1HYV A;  1D9F A;  5HRP A;  4AIL C;  3CFO A;  1WNS A;  1GOC A;  4ELV A;  5HRR A;  4DS4 A;  1C0T A;  1GOB A;  4KO0 A;  3HP6 A;  4Z4E A;  4W5N A;  1BI4 B;  3DYA A;  4CF1 A;  4GMJ B;  4AHC A;  4BWJ A;  4LY7 A;  5I42 A;  4B9L A;  3O3F A;  1L3U A;  4BE2 A;  4OJR A;  3VQQ A;  3ITH A;  2FC0 A;  4KTW A;  3LPT A;  3QO9 A;  4DSJ A;  4FJ5 A;  3RRG A;  3I0S A;  2VWK A;  1SL2 A;  3OS0 A;  3OJU A;  3B6O A;  3V1Q A;  4LSN A;  3KLE A;  4NCB A;  4J2D A;  3MEC A;  1RBV A;  1D5A A;  1SUQ A;  3MEE A;  2XHB A;  4DTJ A;  3NF9 A;  3SYZ A;  3HP9 A;  4MFB A;  2O4G A;  1BQN A;  1WSE A;  2HNZ A;  3V1R A;  1RT4 A;  3NCI A;  2HND A;  1SKW A;  2HHW A;  1TKT A;  4BAC A;  1T8E A;  4DWI A;  4FVM A;  2VG5 A;  3AVM A;  1LV5 A;  1HNV A;  4HCB A;  4CJF A;  2HW3 A;  3OYE A;  2X74 A;  4CJR A;  4CJW A;  3WNE A;  3SNN A;  2DTU A;  1VRU A;  4DLE A;  1U49 A;  5HP1 A;  1RT6 A;  3SPZ A;  2IAJ A;  2GUI A;  3EY1 A;  1DTQ A;  3SUQ A;  2Y1I A;  4J2A A;  3ZSQ A;  4Q0B A;  3OS1 A;  2YHB A;  3HYF A;  2ZE2 A;  2XO7 A;  4FJN A;  3TAG A;  3EZ5 A;  3ZT3 A;  3RMD A;  1VSJ A;  1X9W A;  3AVA A;  3QEP A;  2PZS A;  2B5J A;  3NH2 A;  2D0C A;  3LZJ A;  4FJJ A;  2YV0 X;  4RW6 A;  4O0I A;  4DTR A;  2BGG A;  2D5R A;  4I2Q A;  1TKX A;  1KVC A;  1RTD A;  4B9T A;  3K5O A;  1KFS A;  4KV8 A;  2YKM A;  3ZSV A;  3SUP A;  3S3O A;  3F9K A;  1DLO A;  4O4G A;  4W5R A;  3SPY A;  1SL1 A;  1QS4 A;  1X9M A;  3PUF A;  3VQE A;  1QTM A;  5J2P A;  1Z26 A;  4M45 A;  3L3U A;  1CXU A;  4RW7 A;  4KPY A;  4H4O A;  3A2F A;  2A1S A;  4O5B A;  3U3G A;  1HYS A;  2JLE A;  3L2U A;  1JLE A;  2HHU A;  1CZB A;  1RDA A;  3OYJ A;  4DQS A;  3V9Z A;  2XY6 A;  4B3O A;  4NYF A;  4M3R A;  4M3U A;  2VG7 A;  2RKI A;  3ZT2 A;  1WSF A;  3LP2 A;  1RDD A;  2Z1J A;  1KLM A;  4FJ8 A;  2RN2 A;  1UWB A;  4F2R A;  4FLT A;  3KK1 A;  3OVN A;  3ISN C;  3M8P A;  3ZSO A;  4ZHR A;  4E89 A;  1B92 A;  1RCH A;  1LW2 A;  3B6P A;  3ZCM A;  2HVI A;  3V9S A;  1L3S A;  3JSM A;  4FK4 A;  1LAV A;  5KRS A;  2X6S A;  3AO2 A;  4AHR A;  3V6D A;  4BWM A;  1TAU A;  1TAQ A;  3VA0 A;  3ZSR A;  4CGG A;  4FLY A;  4KHW A;  2F96 A;  4DU4 A;  2KFZ A;  2DFF A;  4DMN A;  4IKF A;  2DY4 A;  1ZBI A;  3KKS A;  1S9G A;  4CFA A;  3OS2 A;  4J2E A;  1KCF A;  2FBY A;  1TV6 A;  1WSH A;  3DLR A;  1XC9 A;  4FJX A;  1A5V A;  3AA5 X;  4CEQ A;  4CK3 A;  1EX4 A;  3AA3 A;  3CM5 A;  4RG8 A;  4Y1D A;  1Q9Y A;  3MAQ A;  2BDP A;  4PQU A;  1C1C A;  5SWM A;  2A1R A;  1RTJ A;  1NK0 A;  1T7P A;  4NYN A;  4K8X A;  4JS5 A;  3ZT1 A;  3HM9 A;  3AVJ A;  1BCM A;  4N41 A;  4Z4H A;  3OY9 A;  4C8O A;  3LWM A;  3K5L A;  4N76 A;  1QSL A;  3KIO A;  3SQ0 A;  4EZ6 A;  1S1X A;  3U3Y A;  3DLK A;  4FW1 A;  4KKO A;  1LWE A;  2YNF A;  4CES A;  4CEB A;  4W5T A;  3AO4 A;  2B6A A;  2OZS A;  4FZX C;  4CF0 A;  4CJL A;  4CJT A;  3V81 A;  2FBV A;  1SL0 A;  1W0H A;  4DU1 A;  3IG1 A;  2Z1G A;  1RTH A;  1VK0 A;  4O44 A;  4AHV A;  4B08 A;  4CEO A;  5E41 A;  4DF8 A;  5DK5 A;  1JLF A;  5FDL A;  3VQ4 A;  1R0A A;  4E0D A;  4OLB A;  4ID5 A;  1REV A;  4CGI A;  1ZBU A;  2HB5 A;  4EZ9 A;  1G15 A;  3H08 A;  2ZQB A;  2YNG A;  3T1A A;  5T7B A;  1BL3 A;  4CEE A;  2OPQ A;  4HHT A;  5JS1 A;  4E7J A;  5C24 A;  4F2S A;  1NKC A;  4CK2 A;  3LWL A;  1RT5 A;  1LAW A;  2X78 A;  3VQ7 A;  1GOA A;  4KRE A;  1BI4 A;  4EP5 A;  3C94 A;  4W5O A;  4HCC A;  3NFA A;  4Z4C A;  4C8L A;  3HVT A;  2KFN A;  1BIU A;  1EP4 A;  4AH9 A;  4DQQ A;  4FZY A;  3AVK A;  3K59 A;  5K14 A;  5D3G A;  4H4M A;  3SQ1 A;  2XY5 A;  4KB1 A;  1JLG A;  1TK5 A;  1T05 A;  4ELT A;  5SZT A;  2KZM A;  5HLF A;  3SUO A;  2WOM A;  1BIS A;  5CY4 A;  3NGZ A;  1U47 A;  4E3S A;  1UA1 A;  3QEW A;  5CZ2 A;  1L5U A;  4CE9 A;  1U4B A;  3HK2 A;  3QLH A;  2R7Y A;  2OPS A;  3CFP A;  3OYC A;  4B9M A;  2E6L A;  4O55 A;  1RDB A;  3AVC A;  3V4I A;  1TVR A;  4OPK A;  1ZBL A;  3OYL A;  2ETJ A;  4CJQ A;  4DLG A;  4FK0 A;  1TL3 A;  4FW2 A;  1WN7 A;  4CHZ A;  1W9H A;  3D0P A;  4FK2 A;  2KW4 A;  3K57 A;  1KVA A;  4R5P A;  1VSL A;  2G8I A;  1QSY A;  4M3W A;  1TGO A;  1IH7 A;  4DTX A;  1WSJ A;  4BE1 A;  1RDC A;  4CED A;  4CEF A;  3NH1 A;  1WLJ A;  4AHU A;  3P5J A;  4DFJ A;  4IFV A;  3VQ6 A;  5HRN A;  4XIU A;  3DRP A;  3ZSY A;  4LH5 A;  3AVL A;  2BAN A;  3V9U A;  3DRR A;  4FXD A;  4FYD A;  2O4I A;  1NJY A;  2ATQ A;  1FKP A;  2BE2 A;  1S6P A;  3VQ8 A;  1N5Y A;  1RT2 A;  4E1N A;  3G10 A;  3M8S A;  3TAB A;  3VQC A;  5KI6 A;  3PO5 A;  2ITG A;  3WNH A;  1JXB A;  3KK3 A;  3RMC A;  1NJW A;  5CZ1 A;  4JS4 A;  1U48 A;  3VN5 A;  3AVF A;  1VSF A;  3EYZ A;  4OKE A;  4CGD A;  2PYJ A;  4L8R B;  4W5Q A;  3RRH A;  1L3T A;  4TSX A;  3HO1 A;  4QOZ B;  4HUE A;  1JLA A;  3KTQ A;  3QNN A;  3TAN A;  3AO1 A;  3DLH A;  3PX0 A;  4ZTJ A;  1RBS A;  1YVU A;  3HPG A;  3QIP A;  3OYD A;  3CQ8 A;  3NGY A;  3WNF A;  1YTA A;  4CHN A;  4CJK A;  3RR8 A;  1J53 A;  3MED A;  3NAE A;  4JRQ A;  2WON A;  2ZD1 A;  4QAG A;  4DU3 A;  4DTO A;  3QEV A;  1RT1 A;  1B9F A;  3QEX A;  5I3U A;  1TK0 A;  1N6Q A;  2OA8 A;  2KTQ A;  2FBT A;  4BDP A;  4FLW A;  4CIG A;  3L8B A;  4DFM A;  1NOY A;  4B9U A;  4DSL A;  2G8U A;  1EKE A;  2Q3S A;  1JXE A;  3SV4 A;  1S1W A;  4OPJ A;  2Z1I A;  3AVG A;  3F73 A;  2VWJ A;  3ALY A;  2OPP A;  4CJP A;  1XHZ A;  2P5G A;  4M3Y A;  1I3A A;  3L2Q A;  4RW9 A;  1NKE A;  2PYL A;  4FJ9 A;  3HJF A;  2AJQ A;  3IS9 A;  2E4L A;  3VQD A;  4HUG A;  3ULD A;  4F3T A;  1JLC A;  4M3Z A;  2G8H A;  2QKK A;  3RMA A;  4GVM A;  1C0U A;  1RBT A;  3DOL A;  1HPZ A;  1QHT A;  1QE1 A;  4C8K A;  2XY7 A;  5FRM A;  1KRP A;  2E6M A;  3OYI A;  5KRT A;  4KB0 A;  3QNO A;  1S1T A;  3BDP A;  2HHX A;  3DMJ A;  1SKR A;  4KHY A;  3V1O A;  2IGI A;  5HBM A;  2YHA A;  4YFU A;  4ZTF A;  2DFH A;  4KHQ A;  4AHS A;  3LAM A;  3K2P A;  4FLZ A;  1XHX A;  3KLI A;  3TR8 A;  3WNG A;  3VQB A;  4CJU A;  1NK7 A;  1HYZ A;  3TAR A;  3MEG A;  5HRS A;  3RMB A;  4CF8 A;  3NH0 A;  1RT3 A;  3AVN A;  3P1G A;  3K58 A;  3E01 A;  4FLV A;  3PX4 A;  1RBU A;  1NK5 A;  4CEC A;  3TI0 A;  4CHQ A;  1S1V A;  1JL1 A;  1NK9 A;  1IKY A;  1A5W A;  3K5N A;  5J2Q A;  4KAZ A;  4B9S A;  3NF8 A;  1X9S A;  1NJZ A;  3AV9 A;  3NF7 A;  4CEZ A;  4UQG A;  2NUB A;  4IG3 A;  1B9D A;  4KI6 A;  4Q5V A;  4I9L A;  5C42 A;  1Z25 A;  3CFR A;  4JRP A;  3S9H A;  4KHU A;  1ZBH A;  4CK1 A;  1RT7 A;  2G8V A;  1LW0 A;  2HHT A;  1ASU A;  5DMR A;  3LAL A;  3ZSX A;  5J1E A;  3NBP A;  4CIF A;  3LAN A;  4AHT A;  2W42 A;  1DTT A;  4OVL A;  4BDZ A;  3I0R A;  1J54 A;  4LH4 A;  3FFI A;  3DOK A;  3OYK A;  3VQ5 A;  1SV5 A;  1JLQ A;  5CYQ A;  4E7H A;  2IC3 A;  2XY8 A;  4Z0U A;  4DQP A;  1C6V A;  4QCL A;  4NCA A;  1HJR A;  1T03 A;  4PA1 A;  3M8R A;  4MQ3 A;  1VSM A;  1HRH A;  1LWC A;  1QQC A;  2P51 A;  2RPI A;  4KHN A;  2P5O A;  1TKD A;  4Z4G A;  5KTQ A;  4DS5 A;  3LP3 A;  4ID1 A;  5FRO A;  2YNH A;  1FKO A;  1UA0 A;  1I39 A;  4OGC A;  4RW4 A;  3SCX A;  4M41 A;  1C1A A;  1ZBF A;  4DSE A;  3TAF A;  3VQA A;  1BCO A;  1WSI A;  4B8A B;  2F8S A;  4DTM A;  2QKB A;  1Q9X A;  3RR7 A;  1RNH A;  4FLX A;  3SZ2 A;  4ELU A;  3AA2 A;  4FLU A;  5HRO A;  4E1M A;  3PX6 A;  4HVJ A;  3KJV A;  1HMV A;  4CJS A;  4CHY A;  4CIE A;  3OYB A;  3DLG A;  4IBN A;  4OKK A;  1ASW A;  3AVH A;  3S3M A;  1S9E A;  2IOC A;  3QIN A;  4CGH A;  3L2R A;  3PV8 A;  1NK8 A;  4I7F A;  5C25 A;  1BQM A;  1U04 A;  2I5J A;  3SUN A;  5EU7 A;  1XI1 A;  1ASV A;  4FJM A;  1NJX A;  3SJJ A;  3KD1 E;  2KQ2 A;  4CJ4 A;  3SQ2 A;  3DLB A;  2D0B A;  4CHO A;  3P83 D;  1JL2 A;  1WAJ A;  4DSK A;  3O4N A;  1NKB A;  4FCY A;  4FJL A;  1FK9 A;  1RBR A;  3DRS A;  3HL8 A;  3MXM A;  4IG0 A;  3D45 A;  4DTU A;  4HUF A;  4RW8 A;  3IAY A;  4CF9 A;  4PWD A;  4FZZ A;  4CCH A;  3T3F A;  3VQP A;  2D0A A;  5FRN A;  1ITG A;  4BDY A;  4DF4 A;  3QES A;  1VSE A;  4CER A;  3PO4 A;  1HQE A;  2DFE A;  1JLB A;  4Y1C A;  1O1W A; 
#chains in the Genus database with same CATH topology
 4N56 A;  1KVB A;  3W3D A;  2E2P A;  5FPN A;  3O9R A;  3GOI A;  2P9S B;  3F9M A;  4KTQ A;  4DTS A;  4JKG A;  4DR2 K;  3V9W A;  1ILY A;  3RTV A;  2HHS A;  4YY3 K;  1XUP O;  3NVK A;  2P9I A;  1W7A A;  3AVB A;  4Z4I A;  1KLN A;  4B9V A;  3C65 A;  4PUO A;  1YIT N;  5BRD A;  4NXM K;  4JLH A;  1J9A A;  2RF2 A;  1KSP A;  3OJS A;  2KHO A;  3GBT A;  4HTU A;  3H1Q A;  1GLA G;  2I7P A;  1IG9 A;  1BO5 O;  3DLE A;  3KK2 A;  2QA4 N;  3E9L A;  3CC2 N;  1QHA A;  4BR0 A;  4DSF A;  3ZX3 A;  4KTZ A;  5E84 A;  4DQR A;  1KFD A;  3WXM B;  2ITM A;  2W40 A;  4FM2 A;  5J2M A;  2PY5 A;  1QVF M;  4K43 A;  2P9L B;  2H3G X;  4H5R A;  1WUA A;  5ADX H;  5J2N A;  1FXX A;  3AGR A;  3SV3 A;  1BA1 A;  4PHT X;  1WAF A;  5BPM A;  2IDO A;  2G8F A;  1Q8I A;  3VQ9 A;  4DR6 K;  3PSF A;  4DV1 K;  5C2F A;  2VQE K;  3M8Q A;  3FZL A;  4G1Q A;  4B8C A;  3C6T A;  3C6A A;  3T19 A;  4EAH D;  2QK9 A;  4A62 A;  1QSS A;  3AO3 A;  4FM0 A;  3IRX A;  1NGA A;  4KH6 A;  4CBW A;  1VQN N;  2E88 A;  3M6G A;  1SAZ A;  1IKW A;  1X3N A;  1TKZ A;  5AQP A;  3OYG A;  4YNQ A;  1BWF O;  4BC2 A;  2F4V K;  2FBX A;  4CZI A;  5BRE A;  4IDK A;  4C8M A;  1VSI A;  4C8N A;  3DJC A;  2UUA K;  3F2K A;  3MXI A;  4GY2 B;  3G0Z A;  3LM9 A;  3UIQ A;  2QEX N;  3LDS A;  2IS3 A;  1BHL A;  1C0M A;  2Q1N A;  3AA4 A;  2UUB K;  1TL1 A;  3D2F B;  3HPH A;  3D2F A;  4FJH A;  2GV9 A;  4CJ5 A;  1ESV A;  4FOI A;  1BIZ A;  1HQU A;  4NO7 A;  4FM1 A;  1YAG A;  5CR4 A;  1KTQ A;  2HVH A;  3OYF A;  1EO1 A;  1WSG A;  1QQM A;  3M5R A;  2G8K A;  4Z4F A;  1IKX A;  3CIP A;  1HYV A;  1WNS A;  1BI4 B;  4CF1 A;  1U2V B;  4GMJ B;  4BWJ A;  4LY7 A;  2VCP A;  3VQQ A;  4KTW A;  3MN9 A;  3RRG A;  4JAX A;  4WF9 L;  5ELZ A;  3OJU A;  3B6O A;  2KLA A;  3LDQ A;  3KLE A;  4A5B A;  1VQ8 N;  1VQO N;  3SMP A;  2XHB A;  3NF9 A;  2Q31 A;  3O5B A;  3QFU A;  5KPZ A;  1RT4 A;  1H1V A;  2VYP A;  3NCI A;  2HST A;  1SKW A;  4DWI A;  2DPN A;  4FVM A;  4BGA A;  2VG5 A;  1LV5 A;  4FPA A;  3FFK B;  4HCB A;  2HW3 A;  2DTU A;  4CJW A;  2V52 B;  3EY1 A;  1DTQ A;  1XNQ K;  5F2R A;  3AVA A;  3UB5 A;  3QEP A;  2B5J A;  1K8K A;  3NH2 A;  3CXC M;  4O0I A;  1Q81 O;  1RTD A;  4B9T A;  3K5O A;  3S3O A;  3EE8 A;  4O4G A;  3SPY A;  1X9M A;  1SL1 A;  3PUF A;  1Z26 A;  3U3G A;  1DGK N;  2HHU A;  3OYJ A;  4M3U A;  2NRH A;  5AQQ A;  2VG7 A;  3LP2 A;  2Z1J A;  2JWL A;  2RN2 A;  4BRC A;  3QBX A;  2WBN A;  3V9S A;  3QML A;  3BZC A;  1NMD A;  5AQI A;  3UKU B;  5JMV A;  4JKG B;  1BDG A;  3V6D A;  5AJ3 K;  4IFE A;  4B1V A;  1V4T A;  1ZBI A;  1QZ6 A;  1S9G A;  4CFA A;  3CHW A;  4CZE A;  5AQT A;  1WSH A;  2QWO A;  3DLR A;  3ENH A;  1XC9 A;  3AA5 X;  3CM5 A;  4RG8 A;  4AF1 A;  4QS7 A;  2EWS A;  5FPM A;  1HJO A;  2A1R A;  4JS5 A;  2NLX A;  3OY9 A;  4C8O A;  3SQ0 A;  4FSV A;  4EZ6 A;  1LWE A;  2YNF A;  4CEB A;  3CCU N;  4FZX C;  4CJL A;  4CJT A;  5BPL A;  1SL0 A;  2E20 A;  1W0H A;  1VK0 A;  2F9W A;  4B08 A;  5E41 A;  1JLF A;  4OLB A;  4CGI A;  1REV A;  5AQY A;  3TU5 A;  3H08 A;  2YNG A;  2YX6 A;  2PFU A;  4CEE A;  4MDA A;  4E7J A;  4F2S A;  2D0P A;  5MLC Q;  4B3T K;  2E2N A;  2X78 A;  3CET A;  4EP5 A;  3C94 A;  4JI7 K;  4OO1 J;  4FZY A;  4DQQ A;  5D3G A;  3O4W A;  4O8K A;  3SQ1 A;  1JLG A;  2NRZ A;  3A5L C;  3AAQ A;  3SUO A;  1U47 A;  5CZ2 A;  1U4B A;  1HNW K;  1C0F A;  2R7Y A;  2E8A A;  1X3M A;  4LC9 B;  4BRL A;  3V4I A;  4B3M K;  4OPK A;  4DLG A;  4YOR A;  2Q2R A;  5DM7 L;  2G8I A;  1TGO A;  1IH7 A;  4CED A;  3MN5 A;  4AHU A;  4LH5 A;  4B9Q A;  5EY4 A;  1BOT O;  1FKP A;  3VF6 A;  3VQ8 A;  3SLC A;  3G10 A;  4JI5 K;  1DEJ A;  2ITG A;  2YJE A;  3KK3 A;  4CGD A;  1Q86 O;  1M90 O;  3RRH A;  4QOZ B;  4HUE A;  1JLA A;  3FZM A;  2FLO A;  4GNI A;  2WTU A;  3L4Q A;  3MN7 A;  1J53 A;  3MED A;  4JK8 A;  3NAE A;  4DTO A;  3HM8 A;  1T44 A;  3KHY A;  1VQK N;  2YCH A;  2PAV A;  1E4G T;  4B9U A;  1VQL N;  3CCS N;  1S1W A;  4OPJ A;  2Z1I A;  2VWJ A;  2OPP A;  3VGK A;  4CJP A;  3ULE A;  2P5G A;  1I3A A;  3WUH A;  1NKE A;  2PYL A;  3T7Z A;  2FSN A;  4HUG A;  3B8A X;  5KQD A;  4IEI A;  1C0U A;  3DOL A;  3MCA B;  3CJB A;  4JK7 A;  2GEL A;  3THW B;  5KRT A;  3QNO A;  1YVN A;  2HHX A;  1HPM A;  3QBW A;  2VGN A;  3CCV N;  3V1O A;  2IGI A;  1SKR A;  3IMX A;  1T6D A;  3LAM A;  3PLA A;  3TR8 A;  3WNG A;  3VQB A;  5HRS A;  3RMB A;  4CF8 A;  3P1G A;  1GLC G;  1NK9 A;  3TI0 A;  4CHQ A;  2FF6 A;  4RCH A;  1IKY A;  1J6Z A;  1X9S A;  3MWP A;  3AV9 A;  3NF7 A;  3CJ1 A;  4I9L A;  1Z25 A;  3CFR A;  1RT7 A;  1LW0 A;  1ASU A;  4C23 A;  1NGF A;  3LAL A;  3PIO L;  3ZSX A;  3LAN A;  2W42 A;  1BA0 A;  1DTT A;  3I0R A;  1J54 A;  3FFI A;  3DOK A;  3OYK A;  2E1Y A;  1SV5 A;  2CH6 A;  1NWK A;  2IVN A;  4DQP A;  1C6V A;  2HHH K;  1WOQ A;  4QCL A;  1HJR A;  5JVH L;  3M8R A;  1YJN N;  1VSM A;  4V19 S;  3SBG A;  1TKD A;  5KTQ A;  5FRO A;  2YNH A;  1FKO A;  3ULE B;  4X65 K;  4OGC A;  3SCX A;  5AQF A;  1ZXO A;  3VQA A;  3JAM O;  4CZG A;  2YHX A;  4M63 C;  1NJI O;  5HRO A;  4CIE A;  3S3M A;  3PV8 A;  3VEV A;  2NRX A;  1VQ6 N;  4I7F A;  3SUN A;  1U04 A;  2I5J A;  4YOV A;  1XI1 A;  1ASV A;  3ID8 A;  4FJM A;  3EE9 A;  2D0B A;  4CHO A;  1WAJ A;  3O4N A;  4FJL A;  1RBR A;  1OKJ A;  1NMN A;  5BN9 A;  3IAY A;  3THX B;  3T3F A;  3VQP A;  5JLF A;  4BDY A;  4DF4 A;  4B1Z A;  3PO4 A;  3O9U A;  3VPZ A;  3SJH A;  3U3Y A;  4Y1C A;  3HVR A;  3UE5 A;  4E7L A;  5AQN A;  3TAP A;  4OLA A;  4CF2 A;  1IO2 A;  2EX3 A;  3G4S N;  5BR8 K;  2QWR A;  3TAE A;  2UXC K;  3ZX0 A;  2ZJR L;  1D8Y A;  4LSL A;  3AO5 A;  2GWJ A;  3SQ4 A;  3TAQ A;  3OA9 A;  4CGJ A;  2KKZ A;  3DAW A;  4JKA A;  1DKG D;  3CJ9 A;  4F4K A;  4C1N I;  4CI6 A;  4DQI A;  3HT3 A;  4DG1 A;  4F8R A;  5AQO A;  3TAM A;  4H0X B;  3I8D A;  3AVI A;  4DTN A;  3DM2 A;  1XWL A;  4ISE A;  3WEE B;  4FOE A;  3EO3 A;  1J5O A;  4PL7 A;  5GAH P;  3LDP A;  4CFD A;  4FWQ A;  1NK6 A;  2KZZ A;  4NLB A;  2E2O A;  2XRI A;  4JD2 B;  3MXJ A;  2OTJ N;  3CG7 A;  4NCG A;  3KLH A;  2E2Q A;  4DFK A;  1A5X A;  2EHG A;  1OH7 A;  5C0Y A;  5AZI A;  2YKN A;  1HNI A;  4CFB A;  4DR4 K;  4CD1 A;  4LD0 A;  3WXJ A;  3O3G A;  2A6A A;  1D9D A;  2BTF A;  4JD2 A;  1TYQ B;  2O8C B;  3V9X A;  3D7E O;  2QI2 A;  3SI6 A;  4IO9 L;  1QVG M;  1VHX A;  3BF1 A;  3C7N B;  1EWQ A;  4BE0 A;  2IIR A;  4IDH A;  2F7T A;  3QER A;  3GG4 A;  3OTO K;  2X6N A;  5M1K A;  2A3Z A;  2YJF A;  1HKC A;  3UKU A;  4CGF A;  3ZSW A;  3JYT A;  2VG6 A;  1CZ9 A;  3P38 A;  5AZI B;  2P9N A;  2OCE A;  2B4J A;  4PKG A;  1VRT A;  1QQN A;  3A0I X;  3QEI A;  4N5S A;  4DFP A;  4DTP A;  1CXQ A;  3GL1 A;  4M42 A;  4OGE A;  3HPO A;  4ILG B;  4CZL A;  3CC4 N;  1D9F A;  2HF4 A;  1C0T A;  3BP8 A;  4KO0 A;  3HP6 A;  4DS4 A;  4Z4E A;  1L3U A;  2UUC K;  4OJR A;  5C12 A;  4FJ5 A;  3QO9 A;  4A2B A;  5BN8 A;  1IBM K;  3U4L A;  3THX A;  1LCU A;  3OS0 A;  1IBK K;  1SZ2 A;  4LSN A;  4KH4 A;  1D5A A;  4B1U B;  1N8R O;  4DTJ A;  1W97 L;  3SYZ A;  3HP9 A;  1NGI A;  1N33 K;  2O4G A;  2QWQ A;  4JI0 K;  4Y0W A;  1BQN A;  3H45 C;  3V1R A;  3ATV A;  2OAN A;  1NGD A;  2HND A;  1TKT A;  3CCE N;  3OYE A;  3EKS A;  2GWK A;  3SAH A;  3CI5 A;  5GIO A;  4FWO A;  1RT6 A;  3SUQ A;  3ZSQ A;  5LMN K;  4CZM A;  2ZE2 A;  4LFC K;  5TKY A;  3QIC A;  4BVP A;  3TAG A;  4BRO A;  1VSJ A;  1XNR K;  2P9L A;  2QWN A;  2YV0 X;  4RW6 A;  4BG9 A;  4DTR A;  2BGG A;  2D5R A;  4I2Q A;  1BU6 O;  1KVC A;  3ZSV A;  3SUP A;  3G25 A;  1DLO A;  4E1J A;  4XH1 A;  3WT0 A;  1QTM A;  3L3U A;  4H5N A;  4RW7 A;  4KPY A;  4H4O A;  3A2F A;  2A1S A;  4O5B A;  2O8B B;  1HYS A;  4X66 K;  3L2U A;  4NYF A;  4M3R A;  3TSP A;  2RKI A;  4IJA A;  1GLB G;  1RDD A;  4O5F A;  3CPW M;  4F2R A;  3M8P A;  4E89 A;  1B92 A;  2HVI A;  3B6P A;  3ZCM A;  5KRS A;  4AHR A;  1HKG A;  4BWM A;  3WQT A;  1K8A O;  3A8Y A;  4UY8 O;  4DV6 K;  4CGG A;  4FLY A;  3O9T A;  5CE3 A;  2DFF A;  3W0L A;  1ATS A;  2I7N A;  4J2E A;  1KCF A;  2FBY A;  1TV6 A;  3FZF A;  4Y1D A;  4L3Q A;  1NGC A;  1NK0 A;  1T7P A;  4DUY K;  5LMU K;  4K8X A;  3LDO A;  3ZT1 A;  3Q7B A;  4DHY A;  4Z4H A;  3BY5 A;  3HTV A;  3THY A;  3LWM A;  3KIO A;  4WCE L;  5JIC A;  4FW1 A;  4FWK A;  4QS9 A;  5JVG L;  3K9J A;  1VQP N;  2B6A A;  2OZS A;  4CF0 A;  5AQL A;  3V81 A;  3G6E N;  1S72 N;  2Z1G A;  4O44 A;  4DF8 A;  5FDL A;  3VQ4 A;  2HB5 A;  1G15 A;  5FLX O;  5T7B A;  2OPQ A;  4A2A A;  3CJ7 A;  1NKC A;  4CK2 A;  1RT5 A;  3IKM A;  2HMP A;  2KFN A;  3HVT A;  1BIU A;  5GAE P;  2NRT A;  4AH9 A;  1IG8 A;  3AVK A;  3H46 O;  3P4I A;  3TPQ A;  1TK5 A;  4IJN A;  1T05 A;  3VEN A;  2VQF K;  2HF3 A;  1L5U A;  3HK2 A;  3QB0 A;  3OYC A;  1HLU A;  3UKR A;  2E6L A;  3CQX A;  4O55 A;  1RDB A;  3AVC A;  1TVR A;  3OYL A;  2ETJ A;  4FK2 A;  3J7A P;  1VSL A;  1U6Z A;  5AQX A;  1Q18 A;  4FWL A;  4DR1 K;  4M3W A;  1HX1 A;  2A42 A;  1KAY A;  2RHK A;  1RDC A;  4DFJ A;  2A40 A;  3C7N A;  3DRP A;  4BVO A;  4XEI A;  2BAN A;  3V9U A;  3CCM N;  3FR0 A;  4FXD A;  3I56 N;  2O4I A;  4B1W B;  1N5Y A;  1Q7Y O;  3PO5 A;  3WNH A;  3RMC A;  1NJW A;  5CZ1 A;  4JI2 K;  4JS4 A;  3O8M A;  1U48 A;  3VN5 A;  3P31 A;  2PYJ A;  4W5Q A;  1L3T A;  3HO1 A;  5AZJ A;  2FSJ A;  3MK6 A;  3VF2 A;  3O9Q A;  1BG3 A;  3HPG A;  3OYD A;  3RR8 A;  4CHN A;  3O08 A;  4JKB A;  4DU3 A;  3QEX A;  2WON A;  2ZD1 A;  1TK0 A;  1RT1 A;  1B9F A;  2FBT A;  3L4I A;  4FLW A;  4CIG A;  3L8B A;  4DSL A;  1JXE A;  2P9N B;  3SV4 A;  2P9P B;  3AVG A;  3ALY A;  3CCR N;  1XHZ A;  1XQS C;  3L2Q A;  4M3Y A;  5AZJ B;  2W6K A;  2E5L K;  2AJQ A;  3IS9 A;  3VQD A;  3ULD A;  2G8H A;  2QKK A;  4GVM A;  1RBT A;  1C0G A;  1HPZ A;  3PIP L;  2XY7 A;  2UU9 K;  4KB0 A;  1S1T A;  1TUU A;  3DMJ A;  3HZ6 A;  2V51 B;  4JI6 K;  3N4P A;  4YHH K;  3J80 O;  4KHQ A;  3K2P A;  4WFN L;  1NK7 A;  1HYZ A;  3NH0 A;  3PX4 A;  4FLV A;  3VOV A;  1S1V A;  5M1O A;  3O80 A;  3NF8 A;  4X62 K;  2ZWH A;  2D0O A;  3WXL A;  4KI6 A;  4JRP A;  3MWT A;  4CK1 A;  2HHT A;  1Y64 A;  4FWS A;  3MX2 A;  4CIF A;  4AHT A;  1MWK A;  1XMQ K;  4BDZ A;  3E66 A;  3VQ5 A;  1YJ9 N;  1JLQ A;  4DB3 A;  1HR0 K;  2ZJP L;  5CYQ A;  4HWI A;  4PA1 A;  1K8K B;  4Z4G A;  1UA0 A;  4CZF A;  1I39 A;  2YI1 A;  4DTM A;  3ZYY X;  3HBT A;  3KJV A;  2V7Z A;  1HMV A;  4CJS A;  1ASW A;  3T69 A;  3QIN A;  3L2R A;  5E26 A;  1VQ9 N;  4BC4 A;  4XH4 A;  4H03 B;  2D4W A;  3THY B;  1JL2 A;  4A57 A;  5AQG A;  4FCY A;  1FK9 A;  3MXM A;  3IDH A;  4DTU A;  3BUZ B;  4HUF A;  4RW8 A;  3C6H A;  2P9U A;  3QDK A;  1ITG A;  1VQ4 N;  4JKD A;  1JLB A;  1E4F T;  3ZT4 A;  4F3O A;  2AA4 A;  2YHW A;  2ZGZ A;  4LF6 K;  1I94 K;  3K5M A;  3GE1 A;  4FJ7 A;  3A5O C;  4BRE A;  2JGU A;  4CHP A;  5BRH A;  4BRA A;  2P1J A;  4YOY A;  4N47 A;  4IFY A;  2OA8 A;  3TWH A;  3OYH A;  3O6W A;  2G8W A;  3QET A;  1LWF A;  2OZM A;  1K6Y A;  4PKI A;  1S1U A;  4JHD B;  1HUX A;  5FPD A;  1YT3 A;  3KD5 E;  3K0S A;  2ZM6 K;  1CZA N;  4ICL A;  3ZSZ A;  2NNW A;  5LJW A;  1WB9 A;  4I9Q A;  4JYA K;  3PY8 A;  4LFB K;  3L3V A;  1VSK A;  2GEM A;  3KLG A;  4EP4 A;  5B8H A;  1KD1 O;  4YOW A;  4I2P A;  4JV5 K;  4B9N A;  1S5J A;  3DXM B;  4K0K K;  5AQR A;  4KRF A;  3KKR A;  3ATU A;  3NVM A;  1JKH A;  4BC3 A;  4OKJ A;  1V4S A;  1UAX A;  4M7X A;  5AQM A;  2Y1J A;  1IKV A;  1T6C A;  1VSD A;  4FJK A;  4KHS A;  3EEQ A;  2HHQ A;  3BF3 A;  3JXU A;  1BGX T;  4O0J A;  3O3H A;  3NDK A;  1S6Q A;  4JKH A;  4DR3 K;  3ASM A;  2BH1 A;  1U45 A;  3E9O A;  4CJE A;  3CJA A;  4PY5 A;  3O4Q A;  3OYA A;  1JCE A;  3VEW A;  5KGX A;  1RTI A;  4RWT A;  1FJG K;  2HBK A;  1OVY A;  3KZB A;  1OH8 A;  4IZ9 A;  1C1B A;  4J2B A;  3L2V A;  1Y97 A;  1HKB A;  3DI6 A;  5JS2 A;  2O8D A;  1SKS A;  3P39 A;  1JCF A;  4CJ3 A;  3OYN A;  1N36 K;  1KQS M;  1ATR A;  3THV A;  3FZH A;  1YF5 L;  1S3X A;  2P9K B;  4HTL A;  4JKF A;  4AM6 A;  5C2D A;  1F21 A;  3S3N A;  1ZYQ A;  1O13 A;  2O8F B;  4E19 A;  4E7I A;  4ISF A;  2Z1H A;  5GIP A;  5AQW A;  2YNI A;  4BG8 A;  5HRP A;  4ELV A;  5HRR A;  4W5N A;  1GOB A;  5AR0 A;  3DYA A;  5AFU A;  3AY9 A;  4AHC A;  2A5X A;  3O3F A;  1ZBS A;  3TTF A;  1OVQ A;  4H0O A;  3E1Y A;  5EVZ A;  2VWK A;  1OH5 A;  2HOE A;  3V1Q A;  4NCB A;  3MEC A;  1SUQ A;  3MEE A;  3FE1 A;  2BUP A;  1DT9 A;  3ENB A;  3H3N O;  4R79 A;  1EWR A;  3CQY A;  3AVM A;  5DM6 L;  4B1Y B;  4CD3 A;  2X74 A;  4CJR A;  3G71 N;  3WNE A;  3SNN A;  2FXU A;  1VRU A;  4LF9 K;  1U49 A;  4LF7 K;  3VEY A;  2IAJ A;  4Q0B A;  3VTH A;  2YHB A;  2W6L A;  3EZ5 A;  4MDB A;  1N34 K;  4BQZ A;  2PZS A;  2D0C A;  1EQY A;  4GKJ K;  5I9E B;  1TKX A;  1VAZ A;  1KFS A;  4KV8 A;  3F9K A;  3VQE A;  4M45 A;  3RVC A;  3QFP A;  5HL7 L;  1JLE A;  4B3O A;  3V9Z A;  2AP1 A;  2PBD A;  4DV7 K;  1QZ5 A;  1WSF A;  3GDQ A;  1KLM A;  5BR9 A;  4FJ8 A;  2NRV A;  1UWB A;  2QWL A;  4U67 L;  4ZHR A;  1LW2 A;  1NGG A;  5BRF A;  2D1K A;  3CMA N;  4H5W A;  2X6S A;  3AO2 A;  5AQH A;  1TAU A;  3O1B A;  1TAQ A;  3VA0 A;  1RDU A;  4DU4 A;  2UXB K;  3R8E A;  4DMN A;  3EL2 A;  3SBT A;  4IKF A;  2DY4 A;  5LY3 A;  3KKS A;  4H0Y B;  2ZF5 O;  4BRG A;  1EX4 A;  3AA3 A;  2A41 A;  1Q9Y A;  2BDP A;  4PQU A;  1C1C A;  4YOT A;  5SWM A;  1XMO K;  1RTJ A;  4QS8 A;  1NGH A;  1BCM A;  2O8E B;  3K5L A;  1RGI A;  1S1X A;  1TUY A;  1NGJ A;  3WXK A;  1SQK A;  4CES A;  1WBD A;  4W5T A;  3AO4 A;  5LL6 Z;  2FBV A;  4GVE A;  1NM1 A;  3ZET B;  1RTH A;  4BR7 A;  3DXM A;  4AHV A;  3J81 O;  3J8A A;  4E0D A;  5DK5 A;  4IXC A;  1R0A A;  1OH6 A;  5FPE A;  3T1A A;  5F0X A;  2O8B A;  1BL3 A;  1X9J A;  3LL3 A;  5JS1 A;  3LWL A;  3Q7C A;  2V7Y A;  1U2V A;  4W5O A;  1P8Z A;  4Z4C A;  4HCC A;  3RSE B;  3VGM A;  3FGU A;  5CHI A;  3H3O B;  2XY5 A;  3DXK B;  2E1Z A;  5SZT A;  2KZM A;  5HLF A;  2WOM A;  3NGZ A;  3QEW A;  2NRW A;  2OPS A;  4B9M A;  4FK0 A;  1ZBL A;  4ILJ A;  1TL3 A;  1WN7 A;  4CHZ A;  2KW4 A;  1KVA A;  4DQ8 A;  5HOO A;  3VER A;  4BE1 A;  4CEF A;  3NH1 A;  3P5J A;  3JS6 A;  4H0V B;  4IFV A;  4MO5 A;  5HRN A;  5AQJ A;  1IV0 A;  4JKC A;  2UYT A;  1G99 A;  2QWP A;  1NJY A;  3D2E A;  2ATQ A;  1RT2 A;  4E1N A;  4IOA L;  3M8S A;  1MA9 B;  1JXB A;  3CF5 L;  3TSQ A;  3HSC A;  4JNE A;  4EIA A;  3EYZ A;  4TSX A;  2IVP A;  4H5T A;  2FSK A;  3OW2 M;  4FWR A;  4MO4 A;  2CH5 A;  3TAN A;  1MDU B;  3I33 A;  3PX0 A;  4ZTJ A;  1RBS A;  4IOC L;  3CQ8 A;  3NGY A;  4CJK A;  1GLJ O;  4JRQ A;  4KI4 A;  1N6Q A;  4YDU A;  4NXN K;  2NRR A;  4FL9 A;  5C10 A;  2OTL N;  1P90 A;  1NOY A;  2Q3S A;  3I55 N;  3L0Q A;  1M1K O;  3BZK A;  4RW9 A;  4GV3 A;  3HJF A;  4BR4 A;  4F3T A;  1JLC A;  4M3Z A;  4MLH A;  3CER A;  3VEZ A;  1QHT A;  1QE1 A;  1KRP A;  3CME N;  2E6M A;  3OYI A;  5JLH A;  4YOU A;  4YFU A;  2YHA A;  4ZTF A;  2NZT A;  4JHD A;  4FLZ A;  1XHX A;  3KLI A;  3H1V X;  3TAR A;  3ID6 A;  4NB4 A;  1RT3 A;  3K58 A;  4B9S A;  3E01 A;  1NK5 A;  1RBU A;  1JL1 A;  5J2Q A;  1A5W A;  4JKE A;  1NJZ A;  4CEZ A;  4Q5V A;  2IVO A;  5C42 A;  3S9H A;  4KHU A;  3SAF A;  1ZBH A;  2G8V A;  5DMR A;  3NBP A;  2WC9 A;  3WQU A;  3IFR A;  4EHU A;  4PKH A;  4Z0U A;  3IUC A;  4NCA A;  3DLL L;  4IWV A;  4YDU C;  4BGB A;  1HRH A;  1LWC A;  1QQC A;  2P51 A;  2RPI A;  1YJW N;  3CCL N;  4DS5 A;  4ID1 A;  4RW4 A;  4H0T B;  4DSE A;  3TAF A;  4DKW A;  1BCO A;  1ATN A;  1VQ5 N;  2F8S A;  1Q9X A;  3UKR B;  5M1N A;  3SZ2 A;  4FLU A;  3KVG A;  4E1M A;  1GLE G;  4WFA L;  4IBN A;  4OKK A;  1S9E A;  2IOC A;  4CGH A;  4OPA A;  3TSU A;  4JI8 K;  5EU7 A;  1NJX A;  3SJJ A;  2KQ2 A;  4A61 A;  3SQ2 A;  1NG9 A;  3DLB A;  3MN6 A;  3R9P A;  1GLF O;  3DWL A;  3R3L A;  1NKB A;  3HL8 A;  4NLC A;  3D45 A;  4RTF D;  4FZZ A;  2D0A A;  4AQY K;  4BR9 A;  5FRN A;  5AQS A;  3QES A;  1VSE A;  4CER A;  1R59 O;  1K9M O;  1ZC6 A;  1HQE A;  3U9Z A;  1NU0 A;  1O1W A;  1IBL K;  4XH5 A;  3OYM A;  2VGM A;  1D4X A;  4FWP A;  4H5V A;  4FO0 A;  3C95 A;  1LOT B;  2P9P A;  3VET A;  1J5E K;  4E7K A;  3ZLJ A;  4GW6 A;  1X1P A;  2OPR A;  1YHQ N;  1S22 A;  3NE6 A;  4K8Z A;  3QIO A;  4FWM A;  1NOZ A;  4DUZ K;  1MU2 A;  3NHG A;  3LP0 A;  2O8D B;  1NK4 A;  3HXM A;  2GX9 A;  4H8K A;  4WE1 A;  3NMU A;  1NGE A;  2Q0U A;  3LZI A;  5EX5 A;  3LPU A;  3CYM A;  3KLF A;  3FLC O;  3VTI A;  3LDL A;  2LSN A;  1Z05 A;  1KAZ A;  5EXW A;  3NGI A;  1EXQ A;  4BRK A;  5M1P A;  2F8T A;  2QXL A;  4CEA A;  4LFA K;  4B3R K;  3M3Z A;  3CCJ N;  4M3T A;  1EET A;  5KGW A;  1YTU A;  2OYQ A;  3CM6 A;  3CPE A;  4KH5 A;  3M1F A;  4FJI A;  4OPH A;  4FJG A;  5A2Q O;  2GBZ A;  3U6F A;  4CFC A;  4JN4 A;  3LAK A;  4CJV A;  4AM7 A;  1VSH A;  4BRH A;  4WFB L;  2ASM A;  3E9P A;  5ADX A;  5CYM A;  5H1S Q;  4KFB A;  4OX9 K;  1RIL A;  2CGK A;  1L3V A;  3MCP A;  2QXF A;  4DSI A;  2HNY A;  3L2W A;  1Q82 O;  2HBJ A;  1HNX K;  3MX5 A;  4WQ4 A;  3C6U A;  4B3S K;  3VA3 A;  3BGR A;  4WYB A;  3HST B;  4M7Y A;  1TK8 A;  1CLQ A;  3NF6 A;  4BR5 A;  4JI4 K;  4DCH A;  5F1X A;  4GKK K;  4B1X B;  3ZT0 A;  2HHV A;  4M3X A;  4CZH A;  4BRP A;  5LJV A;  2HMI A;  2WUS A;  4JEP A;  3RWU A;  4U7B A;  1UOC A;  2J4R A;  3F5T A;  3THW A;  3LP1 A;  5C15 A;  4AIL C;  3CFO A;  1NGB A;  1GOC A;  5I42 A;  4B9L A;  3TTC A;  3HOT A;  1XC3 A;  4BE2 A;  1W2B M;  4JI1 K;  5GAG P;  3ITH A;  2FC0 A;  4DSJ A;  3LPT A;  3BEX A;  3CJC A;  3I0S A;  1SL2 A;  4K25 A;  3ZX2 A;  5M1F A;  1YXQ A;  4J2D A;  3ZEU A;  1NNE A;  2P9K A;  1KXP A;  1RBV A;  5AQZ A;  1VQM N;  3R1X A;  5M1Q A;  4WQ5 C;  4MFB A;  3ZET A;  1WSE A;  2HNZ A;  3U8X A;  2HHW A;  4Z94 A;  3S41 A;  4BAC A;  2P9I B;  1T8E A;  1HNV A;  4CJF A;  3K9K A;  3EZW A;  4WQ4 C;  4DLE A;  5HP1 A;  3SPZ A;  2GUI A;  3VMF B;  4J2A A;  2Y1I A;  4H0P A;  3MMV A;  3OS1 A;  3HYF A;  4K41 A;  2XO7 A;  4FJN A;  4X64 K;  3O9S A;  3ZT3 A;  3RMD A;  1X9W A;  4CVN E;  3L6Q A;  1RFQ A;  3LZJ A;  3WEE A;  4MLE A;  2YKM A;  2FF3 B;  5IWA K;  4JI3 K;  4CW7 B;  4W5R A;  1QS4 A;  4DV5 K;  5J2P A;  1CXU A;  4CZK A;  5BPN A;  2W41 A;  2JLE A;  1KAX A;  2O8F A;  1CZB A;  1RDA A;  4DQS A;  2XY6 A;  4IEE A;  3ZT2 A;  3AGK A;  4FLT A;  3TTD A;  3KK1 A;  3OVN A;  4A5A A;  3ISN C;  3ZSO A;  1RCH A;  1SS6 A;  4O8U A;  4C1N K;  4CJ7 A;  1L3S A;  3JSM A;  4FK4 A;  1LAV A;  4FWN A;  3VF4 A;  1MWM A;  3O1W A;  4CBX A;  3ZSR A;  1HNZ K;  4KHW A;  2F96 A;  4ILH A;  3PSI A;  2KFZ A;  3OS2 A;  1NBW A;  4FJX A;  4I6M B;  4G9Z A;  4CEQ A;  1A5V A;  4CK3 A;  3VEO A;  4BRM A;  3MAQ A;  1JJ2 M;  1TYQ A;  2O8C A;  2UXD K;  1QQO A;  4NYN A;  3HM9 A;  3AVJ A;  3OBY A;  4N41 A;  4N76 A;  1QSL A;  5EOY A;  3DLK A;  5AQV A;  4KKO A;  4BRN A;  4WQ5 A;  3OBW A;  4DU1 A;  3CCQ N;  3IG1 A;  4BRI A;  4F9O A;  4LF5 K;  3KK7 A;  4CEO A;  4GV6 A;  4ID5 A;  1ZBU A;  1KC8 O;  4EZ9 A;  2ZQB A;  4GV9 A;  1GLD G;  4I6M A;  4HHT A;  5GIN A;  5C24 A;  1LAW A;  4KRE A;  3VQ7 A;  1GOA A;  1BI4 A;  1YI2 N;  3NFA A;  4C8L A;  1EP4 A;  5KPT A;  3K59 A;  5K14 A;  4H4M A;  3R6M A;  3VEX A;  3EN9 A;  3CD6 N;  4KB1 A;  1GLL O;  3D2E B;  4ELT A;  4LF4 K;  5CY4 A;  1BIS A;  1JCG A;  4E3S A;  1UA1 A;  4K42 A;  4CE9 A;  3T1H K;  3QLH A;  3T1Y K;  3CFP A;  5AQK A;  2YHY A;  3SAG A;  2HBL A;  4CJQ A;  4FW2 A;  4BR2 A;  1W9H A;  3D0P A;  3D6R A;  3K57 A;  4R5P A;  1QSY A;  3SK3 A;  4DR5 K;  4DTX A;  2O8E A;  1WSJ A;  4EFH A;  1WLJ A;  1WBB A;  3VES A;  4XIU A;  3VQ6 A;  3A5M C;  2ZGY A;  3ZSY A;  3AVL A;  1FW6 A;  5TKW A;  2HBM A;  4YOX A;  3DRR A;  4FYD A;  4ISG A;  3DXK A;  4KBO A;  4DR7 K;  2BE2 A;  3HI0 A;  1S6P A;  3ENO A;  3CC7 N;  3TAB A;  3VQC A;  5KI6 A;  1YIJ N;  3AVF A;  1VSF A;  4OKE A;  1YUW A;  4L8R B;  4BRD A;  4EHT A;  2ASO A;  2JWK A;  3KTQ A;  3QNN A;  3VGL A;  3AO1 A;  3DLH A;  1T3V A;  1YVU A;  3QIP A;  4BRQ A;  3WNF A;  1YTA A;  1Z6R A;  3A5N C;  4QAG A;  3QEV A;  5I3U A;  4DV2 K;  2KTQ A;  3U9D A;  3ZEU B;  4BDP A;  4IO8 A;  2QWM A;  4DFM A;  3C0B A;  4LF8 K;  2G8U A;  2ASP A;  1EKE A;  5GAD P;  3F73 A;  1NLV A;  4FJ9 A;  4IOX A;  1N32 K;  2E4L A;  2CGJ A;  4KHP K;  3KWG A;  3RMA A;  3FZK A;  2QW9 A;  5AFU H;  3I8B A;  5FRM A;  4C8K A;  1IJJ A;  5KPR A;  3BDP A;  4KHY A;  5HBM A;  4DV0 K;  2Q36 A;  2DFH A;  3H6E A;  4AHS A;  4CZJ A;  4CJU A;  5IT9 O;  2VWB A;  3MEG A;  2WFB A;  4J8F A;  3AVN A;  4FJJ A;  4CEC A;  4KAZ A;  3K5N A;  4UQG A;  2NUB A;  3WXI A;  4IG3 A;  1B9D A;  4FVU A;  2P9S A;  2Q97 A;  4PL8 A;  5J1E A;  3HOS A;  4FPB A;  4OVL A;  4LH4 A;  4BC5 A;  3MDQ A;  2ZJQ L;  4E7H A;  2IC3 A;  2XY8 A;  3LDN A;  3RSE A;  2QTD A;  1T03 A;  4MQ3 A;  2F9T A;  4BQL A;  2GTD A;  4BY9 C;  4KHN A;  2GUP A;  1BUP A;  3J7Y P;  2P5O A;  3LM2 A;  3LP3 A;  4BRF A;  2CGL A;  3EKU A;  4M41 A;  1C1A A;  1ZBF A;  1WSI A;  4B8A B;  2QKB A;  3RR7 A;  1RNH A;  1RDW X;  5KQ8 A;  4FLX A;  5AQU A;  3AA2 A;  4ELU A;  1E3M A;  3PX6 A;  4CBU A;  4HVJ A;  3J7Z O;  4CHY A;  3OYB A;  4A59 A;  3DLG A;  3AVH A;  3HRG A;  1NK8 A;  3SMS A;  5C25 A;  1BQM A;  3OHR A;  4DV4 K;  3KD1 E;  4CJ4 A;  3P83 D;  4DSK A;  3AAP A;  4DV3 K;  3DRS A;  4IG0 A;  3N4Q A;  2Q0R A;  4JK9 A;  1K73 O;  4CF9 A;  4PWD A;  2QM1 A;  4CCH A;  1VQ7 N;  2P9U B;  3KWI A;  2RE2 A;  3AAR A;  2DFE A; 
#chains in the Genus database with same CATH homology
 3ZT4 A;  1KVB A;  4N56 A;  3HVR A;  4F3O A;  3OYM A;  4E7L A;  4KTQ A;  4DTS A;  3C95 A;  3K5M A;  3TAP A;  4OLA A;  4FJ7 A;  3V9W A;  4CF2 A;  2JGU A;  1IO2 A;  3RTV A;  2HHS A;  2EX3 A;  4CHP A;  2P1J A;  3AVB A;  3TAE A;  4Z4I A;  4N47 A;  4IFY A;  4E7K A;  3TWH A;  4GW6 A;  3OYH A;  1D8Y A;  4LSL A;  1KLN A;  2G8W A;  4B9V A;  3AO5 A;  4PUO A;  3SQ4 A;  1X1P A;  2OPR A;  3QET A;  3TAQ A;  1LWF A;  4CGJ A;  3NE6 A;  2OZM A;  1K6Y A;  4K8Z A;  3QIO A;  1NOZ A;  1S1U A;  4JLH A;  4F4K A;  1J9A A;  2RF2 A;  1KSP A;  1MU2 A;  3OJS A;  3NHG A;  4HTU A;  4DQI A;  1YT3 A;  3LP0 A;  4DG1 A;  3HT3 A;  1IG9 A;  1NK4 A;  3KD5 E;  4F8R A;  3DLE A;  4ICL A;  3ZSZ A;  3HXM A;  4H8K A;  3TAM A;  3KK2 A;  4WE1 A;  4I9Q A;  3I8D A;  3AVI A;  4DTN A;  4DSF A;  3PY8 A;  3DM2 A;  1XWL A;  4KTZ A;  4DQR A;  3L3V A;  1KFD A;  3LZI A;  1VSK A;  3LPU A;  3KLG A;  4EP4 A;  4FM2 A;  3CYM A;  5J2M A;  1J5O A;  2PY5 A;  3KLF A;  2LSN A;  4CFD A;  3NGI A;  1NK6 A;  4I2P A;  5J2N A;  2KZZ A;  4B9N A;  2XRI A;  1EXQ A;  1FXX A;  3SV3 A;  1S5J A;  4KI4 A;  1WAF A;  4KRF A;  3MXJ A;  3KKR A;  3CG7 A;  1JKH A;  2F8T A;  2IDO A;  4CEA A;  4OKJ A;  2G8F A;  1Q8I A;  1UAX A;  4NCG A;  3VQ9 A;  3KLH A;  2Y1J A;  1IKV A;  4DFK A;  3M8Q A;  4M3T A;  1A5X A;  1VSD A;  1EET A;  2EHG A;  4G1Q A;  5KGW A;  2OYQ A;  3CM6 A;  4FJK A;  4KHS A;  1YTU A;  4B8C A;  2HHQ A;  2YKN A;  1HNI A;  3C6T A;  4CFB A;  4FJI A;  4FJG A;  3T19 A;  2QK9 A;  1BGX T;  4O0J A;  3O3H A;  3NDK A;  1S6Q A;  2GBZ A;  3U6F A;  3ASM A;  1QSS A;  1U45 A;  4LD0 A;  4CJE A;  3O3G A;  4CFC A;  3AO3 A;  3LAK A;  4CJV A;  3IRX A;  4FM0 A;  3O4Q A;  1VSH A;  4PY5 A;  1D9D A;  3OYA A;  5CYM A;  4KFB A;  5KGX A;  1RTI A;  1RIL A;  1IKW A;  1TKZ A;  3OYG A;  3V9X A;  1L3V A;  2QXF A;  4DSI A;  2HNY A;  3L2W A;  4YNQ A;  3SI6 A;  2FBX A;  4BE0 A;  4IDK A;  3QER A;  1C1B A;  4C8M A;  1VSI A;  3C6U A;  4J2B A;  4C8N A;  2X6N A;  3L2V A;  3VA3 A;  3BGR A;  4CGF A;  1Y97 A;  3MXI A;  3ZSW A;  3DI6 A;  5JS2 A;  3HST B;  3G0Z A;  2VG6 A;  3JYT A;  1TK8 A;  1CZ9 A;  1SKS A;  3NF6 A;  3UIQ A;  1CLQ A;  3LDS A;  2IS3 A;  2B4J A;  1BHL A;  1C0M A;  4CJ3 A;  3OYN A;  3ZT0 A;  2HHV A;  3THV A;  3AA4 A;  4M3X A;  1VRT A;  1TL1 A;  3HPH A;  4FJH A;  3QEI A;  4N5S A;  2GV9 A;  4CJ5 A;  1BIZ A;  1HQU A;  4FM1 A;  4DFP A;  1F21 A;  2HMI A;  3RWU A;  3S3N A;  1ZYQ A;  4E19 A;  4DTP A;  1CXQ A;  1KTQ A;  1UOC A;  4E7I A;  2HVH A;  3OYF A;  4M42 A;  4OGE A;  2Z1H A;  3HPO A;  1WSG A;  4Z4F A;  2G8K A;  1IKX A;  2YNI A;  3LP1 A;  1HYV A;  1D9F A;  5HRP A;  4AIL C;  3CFO A;  1WNS A;  1GOC A;  4ELV A;  5HRR A;  4DS4 A;  1C0T A;  1GOB A;  4KO0 A;  3HP6 A;  4Z4E A;  4W5N A;  1BI4 B;  3DYA A;  4CF1 A;  4GMJ B;  4AHC A;  4BWJ A;  4LY7 A;  5I42 A;  4B9L A;  3O3F A;  1L3U A;  4BE2 A;  4OJR A;  3VQQ A;  3ITH A;  2FC0 A;  4KTW A;  3LPT A;  3QO9 A;  4DSJ A;  4FJ5 A;  3RRG A;  3I0S A;  2VWK A;  1SL2 A;  3OS0 A;  3OJU A;  3B6O A;  3V1Q A;  4LSN A;  3KLE A;  4NCB A;  4J2D A;  3MEC A;  1RBV A;  1D5A A;  1SUQ A;  3MEE A;  2XHB A;  4DTJ A;  3NF9 A;  3SYZ A;  3HP9 A;  4MFB A;  2O4G A;  1BQN A;  1WSE A;  2HNZ A;  3V1R A;  1RT4 A;  3NCI A;  2HND A;  1SKW A;  2HHW A;  1TKT A;  4BAC A;  1T8E A;  4DWI A;  4FVM A;  2VG5 A;  3AVM A;  1LV5 A;  1HNV A;  4HCB A;  4CJF A;  2HW3 A;  3OYE A;  2X74 A;  4CJR A;  4CJW A;  3WNE A;  3SNN A;  2DTU A;  1VRU A;  4DLE A;  1U49 A;  5HP1 A;  1RT6 A;  3SPZ A;  2IAJ A;  2GUI A;  3EY1 A;  1DTQ A;  3SUQ A;  2Y1I A;  4J2A A;  3ZSQ A;  4Q0B A;  3OS1 A;  2YHB A;  3HYF A;  2ZE2 A;  2XO7 A;  4FJN A;  3TAG A;  3EZ5 A;  3ZT3 A;  3RMD A;  1VSJ A;  1X9W A;  3AVA A;  3QEP A;  2PZS A;  2B5J A;  3NH2 A;  2D0C A;  3LZJ A;  4FJJ A;  2YV0 X;  4RW6 A;  4O0I A;  4DTR A;  2BGG A;  2D5R A;  4I2Q A;  1TKX A;  1KVC A;  1RTD A;  4B9T A;  3K5O A;  1KFS A;  4KV8 A;  2YKM A;  3ZSV A;  3SUP A;  3S3O A;  3F9K A;  1DLO A;  4O4G A;  4W5R A;  3SPY A;  1SL1 A;  1QS4 A;  1X9M A;  3PUF A;  3VQE A;  1QTM A;  5J2P A;  1Z26 A;  4M45 A;  3L3U A;  1CXU A;  4RW7 A;  4KPY A;  4H4O A;  3A2F A;  2A1S A;  4O5B A;  3U3G A;  1HYS A;  2JLE A;  3L2U A;  1JLE A;  2HHU A;  1CZB A;  1RDA A;  3OYJ A;  4DQS A;  3V9Z A;  2XY6 A;  4B3O A;  4NYF A;  4M3R A;  4M3U A;  2VG7 A;  2RKI A;  3ZT2 A;  1WSF A;  3LP2 A;  1RDD A;  2Z1J A;  1KLM A;  4FJ8 A;  2RN2 A;  1UWB A;  4F2R A;  4FLT A;  3KK1 A;  3OVN A;  3ISN C;  3M8P A;  3ZSO A;  4ZHR A;  4E89 A;  1B92 A;  1RCH A;  1LW2 A;  3B6P A;  3ZCM A;  2HVI A;  3V9S A;  1L3S A;  3JSM A;  4FK4 A;  1LAV A;  5KRS A;  2X6S A;  3AO2 A;  4AHR A;  3V6D A;  4BWM A;  1TAU A;  1TAQ A;  3VA0 A;  3ZSR A;  4CGG A;  4FLY A;  4KHW A;  2F96 A;  4DU4 A;  2KFZ A;  2DFF A;  4DMN A;  4IKF A;  2DY4 A;  1ZBI A;  3KKS A;  1S9G A;  4CFA A;  3OS2 A;  4J2E A;  1KCF A;  2FBY A;  1TV6 A;  1WSH A;  3DLR A;  1XC9 A;  4FJX A;  1A5V A;  3AA5 X;  4CEQ A;  4CK3 A;  1EX4 A;  3AA3 A;  3CM5 A;  4RG8 A;  4Y1D A;  1Q9Y A;  3MAQ A;  2BDP A;  4PQU A;  1C1C A;  5SWM A;  2A1R A;  1RTJ A;  1NK0 A;  1T7P A;  4NYN A;  4K8X A;  4JS5 A;  3ZT1 A;  3HM9 A;  3AVJ A;  1BCM A;  4N41 A;  4Z4H A;  3OY9 A;  4C8O A;  3LWM A;  3K5L A;  4N76 A;  1QSL A;  3KIO A;  3SQ0 A;  4EZ6 A;  1S1X A;  3U3Y A;  3DLK A;  4FW1 A;  4KKO A;  1LWE A;  2YNF A;  4CES A;  4CEB A;  4W5T A;  3AO4 A;  2B6A A;  2OZS A;  4FZX C;  4CF0 A;  4CJL A;  4CJT A;  3V81 A;  2FBV A;  1SL0 A;  1W0H A;  4DU1 A;  3IG1 A;  2Z1G A;  1RTH A;  1VK0 A;  4O44 A;  4AHV A;  4B08 A;  4CEO A;  5E41 A;  4DF8 A;  5DK5 A;  1JLF A;  5FDL A;  3VQ4 A;  1R0A A;  4E0D A;  4OLB A;  4ID5 A;  1REV A;  4CGI A;  1ZBU A;  2HB5 A;  4EZ9 A;  1G15 A;  3H08 A;  2ZQB A;  2YNG A;  3T1A A;  5T7B A;  1BL3 A;  4CEE A;  2OPQ A;  4HHT A;  5JS1 A;  4E7J A;  5C24 A;  4F2S A;  1NKC A;  4CK2 A;  3LWL A;  1RT5 A;  1LAW A;  2X78 A;  3VQ7 A;  1GOA A;  4KRE A;  1BI4 A;  4EP5 A;  3C94 A;  4W5O A;  4HCC A;  3NFA A;  4Z4C A;  4C8L A;  3HVT A;  2KFN A;  1BIU A;  1EP4 A;  4AH9 A;  4DQQ A;  4FZY A;  3AVK A;  3K59 A;  5K14 A;  5D3G A;  4H4M A;  3SQ1 A;  2XY5 A;  4KB1 A;  1JLG A;  1TK5 A;  1T05 A;  4ELT A;  5SZT A;  2KZM A;  5HLF A;  3SUO A;  2WOM A;  1BIS A;  5CY4 A;  3NGZ A;  1U47 A;  4E3S A;  1UA1 A;  3QEW A;  5CZ2 A;  1L5U A;  4CE9 A;  1U4B A;  3HK2 A;  3QLH A;  2R7Y A;  2OPS A;  3CFP A;  3OYC A;  4B9M A;  2E6L A;  4O55 A;  1RDB A;  3AVC A;  3V4I A;  1TVR A;  4OPK A;  1ZBL A;  3OYL A;  2ETJ A;  4CJQ A;  4DLG A;  4FK0 A;  1TL3 A;  4FW2 A;  1WN7 A;  4CHZ A;  1W9H A;  3D0P A;  4FK2 A;  2KW4 A;  3K57 A;  1KVA A;  4R5P A;  1VSL A;  2G8I A;  1QSY A;  4M3W A;  1TGO A;  1IH7 A;  4DTX A;  1WSJ A;  4BE1 A;  1RDC A;  4CED A;  4CEF A;  3NH1 A;  1WLJ A;  4AHU A;  3P5J A;  4DFJ A;  4IFV A;  3VQ6 A;  5HRN A;  4XIU A;  3DRP A;  3ZSY A;  4LH5 A;  3AVL A;  2BAN A;  3V9U A;  3DRR A;  4FXD A;  4FYD A;  2O4I A;  1NJY A;  2ATQ A;  1FKP A;  2BE2 A;  1S6P A;  3VQ8 A;  1N5Y A;  1RT2 A;  4E1N A;  3G10 A;  3M8S A;  3TAB A;  3VQC A;  5KI6 A;  3PO5 A;  2ITG A;  3WNH A;  1JXB A;  3KK3 A;  3RMC A;  1NJW A;  5CZ1 A;  4JS4 A;  1U48 A;  3VN5 A;  3AVF A;  1VSF A;  3EYZ A;  4OKE A;  4CGD A;  2PYJ A;  4L8R B;  4W5Q A;  3RRH A;  1L3T A;  4TSX A;  3HO1 A;  4QOZ B;  4HUE A;  1JLA A;  3KTQ A;  3QNN A;  3TAN A;  3AO1 A;  3DLH A;  3PX0 A;  4ZTJ A;  1RBS A;  1YVU A;  3HPG A;  3QIP A;  3OYD A;  3CQ8 A;  3NGY A;  3WNF A;  1YTA A;  4CHN A;  4CJK A;  3RR8 A;  1J53 A;  3MED A;  3NAE A;  4JRQ A;  2WON A;  2ZD1 A;  4QAG A;  4DU3 A;  4DTO A;  3QEV A;  1RT1 A;  1B9F A;  3QEX A;  5I3U A;  1TK0 A;  1N6Q A;  2OA8 A;  2KTQ A;  2FBT A;  4BDP A;  4FLW A;  4CIG A;  3L8B A;  4DFM A;  1NOY A;  4B9U A;  4DSL A;  2G8U A;  1EKE A;  2Q3S A;  1JXE A;  3SV4 A;  1S1W A;  4OPJ A;  2Z1I A;  3AVG A;  3F73 A;  2VWJ A;  3ALY A;  2OPP A;  4CJP A;  1XHZ A;  2P5G A;  4M3Y A;  1I3A A;  3L2Q A;  4RW9 A;  1NKE A;  2PYL A;  4FJ9 A;  3HJF A;  2AJQ A;  3IS9 A;  2E4L A;  3VQD A;  4HUG A;  3ULD A;  4F3T A;  1JLC A;  4M3Z A;  2G8H A;  2QKK A;  3RMA A;  4GVM A;  1C0U A;  1RBT A;  3DOL A;  1HPZ A;  1QHT A;  1QE1 A;  4C8K A;  2XY7 A;  5FRM A;  1KRP A;  2E6M A;  3OYI A;  5KRT A;  4KB0 A;  3QNO A;  1S1T A;  3BDP A;  2HHX A;  3DMJ A;  1SKR A;  4KHY A;  3V1O A;  2IGI A;  5HBM A;  2YHA A;  4YFU A;  4ZTF A;  2DFH A;  4KHQ A;  4AHS A;  3LAM A;  3K2P A;  4FLZ A;  1XHX A;  3KLI A;  3TR8 A;  3WNG A;  3VQB A;  4CJU A;  1NK7 A;  1HYZ A;  3TAR A;  3MEG A;  5HRS A;  3RMB A;  4CF8 A;  3NH0 A;  1RT3 A;  3AVN A;  3P1G A;  3K58 A;  3E01 A;  4FLV A;  3PX4 A;  1RBU A;  1NK5 A;  4CEC A;  3TI0 A;  4CHQ A;  1S1V A;  1JL1 A;  1NK9 A;  1IKY A;  1A5W A;  3K5N A;  5J2Q A;  4KAZ A;  4B9S A;  3NF8 A;  1X9S A;  1NJZ A;  3AV9 A;  3NF7 A;  4CEZ A;  4UQG A;  2NUB A;  4IG3 A;  1B9D A;  4KI6 A;  4Q5V A;  4I9L A;  5C42 A;  1Z25 A;  3CFR A;  4JRP A;  3S9H A;  4KHU A;  1ZBH A;  4CK1 A;  1RT7 A;  2G8V A;  1LW0 A;  2HHT A;  1ASU A;  5DMR A;  3LAL A;  3ZSX A;  5J1E A;  3NBP A;  4CIF A;  3LAN A;  4AHT A;  2W42 A;  1DTT A;  4OVL A;  4BDZ A;  3I0R A;  1J54 A;  4LH4 A;  3FFI A;  3DOK A;  3OYK A;  3VQ5 A;  1SV5 A;  1JLQ A;  5CYQ A;  4E7H A;  2IC3 A;  2XY8 A;  4Z0U A;  4DQP A;  1C6V A;  4QCL A;  4NCA A;  1HJR A;  1T03 A;  4PA1 A;  3M8R A;  4MQ3 A;  1VSM A;  1HRH A;  1LWC A;  1QQC A;  2P51 A;  2RPI A;  4KHN A;  2P5O A;  1TKD A;  4Z4G A;  5KTQ A;  4DS5 A;  3LP3 A;  4ID1 A;  5FRO A;  2YNH A;  1FKO A;  1UA0 A;  1I39 A;  4OGC A;  4RW4 A;  3SCX A;  4M41 A;  1C1A A;  1ZBF A;  4DSE A;  3TAF A;  3VQA A;  1BCO A;  1WSI A;  4B8A B;  2F8S A;  4DTM A;  2QKB A;  1Q9X A;  3RR7 A;  1RNH A;  4FLX A;  3SZ2 A;  4ELU A;  3AA2 A;  4FLU A;  5HRO A;  4E1M A;  3PX6 A;  4HVJ A;  3KJV A;  1HMV A;  4CJS A;  4CHY A;  4CIE A;  3OYB A;  3DLG A;  4IBN A;  4OKK A;  1ASW A;  3AVH A;  3S3M A;  1S9E A;  2IOC A;  3QIN A;  4CGH A;  3L2R A;  3PV8 A;  1NK8 A;  4I7F A;  5C25 A;  1BQM A;  1U04 A;  2I5J A;  3SUN A;  5EU7 A;  1XI1 A;  1ASV A;  4FJM A;  1NJX A;  3SJJ A;  3KD1 E;  2KQ2 A;  4CJ4 A;  3SQ2 A;  3DLB A;  2D0B A;  4CHO A;  3P83 D;  1JL2 A;  1WAJ A;  4DSK A;  3O4N A;  1NKB A;  4FCY A;  4FJL A;  1FK9 A;  1RBR A;  3DRS A;  3HL8 A;  3MXM A;  4IG0 A;  3D45 A;  4DTU A;  4HUF A;  4RW8 A;  3IAY A;  4CF9 A;  4PWD A;  4FZZ A;  4CCH A;  3T3F A;  3VQP A;  2D0A A;  5FRN A;  1ITG A;  4BDY A;  4DF4 A;  3QES A;  1VSE A;  4CER A;  3PO4 A;  1HQE A;  2DFE A;  1JLB A;  4Y1C A;  1O1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...