4AHTA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
151
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 55
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahtA00
4Z4GA 4BDPA 1CLQA 3HJFA 3HYFA 2W42A 3AO2A 1WN7A 4B9MA 3PX6A 1B9FA 3LP0A 3U3YA 3DYAA 4DTOA 2OPQA 1VSLA 4E3SA 3KKRA 3T19A 2YNGA 3RMBA 3HT3A 1CXUA 4CHQA 4FJLA 2KTQA 2ZQBA 4OLBA 2E4LA 5C25A 4ELUA 3LP1A 1SUQA 1U4BA 4C8MA 1Z25A 4DFMA 3O3HA 3DI6A 3LZIA 1CZ9A 3QESA 1GOAA 4FJJA 3V6DA 2FBVA 2WONA 3AVBA 4KAZA 2Y1JA 3CG7A 3K5NA 3T3FA 3V4IA 4J2DA 3HP6A 5J2QA 3D45A 4C8LA 4B9LA 4FJKA 4OKKA 1UA1A 3OJUA 3SQ4A 4JRPA 4RW4A 1IKYA 4CEBA 4CGIA 4B3OA 5FRNA 4FCYA 4BDYA 1RBRA 3WNEA 1VSJA 3NH1A 2VWJA 1NKBA 1MU2A 3ZSQA 3OYGA 3S3MA 3OYJA 4FLYA 4DQQA 4PY5A 1S1TA 2RF2A 1IKXA 1CXQA 1RDBA 4HUGA 2P5GA 1RNHA 2RN2A 3KK1A 4E89A 3L8BA 3VQ8A 3RTVA 1L3VA 3DMJA 2VG6A 2G8IA 3TAFA 1N6QA 1RBTA 3AVJA 5I3UA 3C6UA 1XHZA 4CEOA 3NE6A 4Q0BA 1JL2A 3DLGA 1JLEA 4CJVA 4B08A 4AHVA 4CECA 2HHVA 3RMDA 4CEAA 3JSMA 3VQAA 3ZT0A 4B8AB 4KPYA 4CHNA 4HCBA 4FJIA 3DLKA 4CFCA 2HVHA 1FKOA 2LSNA 3SQ2A 4F3OA 4QOZB 4CIEA 2RPIA 4DS4A 4CF2A 1S1VA 1TKDA 3ZSRA 1RCHA 1KLNA 1YT3A 3G0ZA 4DTSA 4PWDA 2D0BA 5K14A 3O3GA 3OYMA 1UWBA 1TV6A 4RW7A 1S1WA 1IG9A 4CJKA 4M3WA 1HRHA 4FW2A 3L2WA 3QIOA 3ULDA 4FK4A 1VSHA 2VG7A 1TAQA 3L2QA 1JLBA 3QNOA 1S9EA 4IFVA 1F21A 5HRRA 4CF0A 4CK2A 4DU4A 3P1GA 1YTAA 3KLFA 2B6AA 4BWJA 3MAQA 2ATQA 1CZBA 4B8CA 4FJNA 4CFAA 3IRXA 4NCAA 3MEEA 1FK9A 4CGDA 4OPKA 3HL8A 3NGZA 3VQDA 4CF9A 2HNDA 3SZ2A 2PYJA 4FM1A 1IO2A 3NF6A 1DTTA 3LAMA 4O0JA 3AVGA 4O4GA 4OGEA 4DTXA 3RR8A 4OKJA 4F2RA 3PO4A 1TKXA 2XY7A 3V9SA 3OYNA 3O3FA 1UOCA 3L3VA 4IBNA 5KRTA 1RTDA 3OJSA 3VQ4A 3ZSZA 4DFPA 4DSLA 1RBSA 1XHXA 3AVMA 1C1CA 2DFEA 4B9VA 4FW1A 1BIZA 3AA4A 4M3RA 3ZSOA 3KD1E 3C94A 3DLEA 1JLQA 1JXEA 1NK9A 2QXFA 1VSIA 4KI4A 2Q3SA 2HNYA 3DRRA 5JS1A 3HXMA 1S6PA 1KCFA 1SV5A 3QLHA 3KTQA 4FJGA 4KHUA 4W5OA 4J2BA 2HHXA 1SL1A 2Z1JA 3AA3A 3B6OA 4J2EA 3LPUA 4M42A 3AO4A 4DQIA 5J2NA 1NK4A 4KHNA 1HNIA 1RDCA 4I9LA 3B6PA 4AH9A 4O5BA 3V81A 4N56A 2OZSA 3HVRA 3K2PA 4CEDA 4C8KA 1WAFA 1RT1A 4RW8A 3VN5A 3VQQA 3AVAA 4N47A 4DTMA 3AVFA 4DMNA 4CHYA 4O0IA 4DU1A 2O4IA 5CZ2A 5SWMA 3V9XA 2EX3A 4DQSA 1NOYA 1ZBIA 2JGUA 4DLGA 4AILC 3IAYA 4KHWA 4DTUA 1B92A 3H08A 3MEGA 1WSJA 1NK8A 5J1EA 1Q9XA 3MECA 5KTQA 1VRUA 3LP2A 4R5PA 3RRHA 1JXBA 2IDOA 5J2PA 3WNGA 3NCIA 1NK6A 3LWLA 2G8WA 3C95A 4KFBA 4CGGA 4CIFA 3I8DA 4IFYA 3VA0A 3SJJA 1L3TA 1RDDA 3QNNA 1RT7A 4KHYA 3OS2A 2G8KA 4FJ9A 1GOCA 1HMVA 3IG1A 5C24A 1J54A 3OY9A 1ASUA 4E7JA 1UA0A 3KD5E 3HSTB 1WSIA 1NKEA 2O4GA 1QSSA 4EZ6A 2KZMA 3LP3A 4FLTA 1NJWA 4CJ4A 3K5MA 4OVLA 3SQ1A 5SZTA 4CE9A 1RT5A 2YV0X 5KGXA 4W5QA 4BACA 1LWCA 5CY4A 2PYLA 4Y1CA 4B9TA 2HB5A 1YTUA 1L5UA 1KFDA 4Z4IA 1EP4A 3JYTA 3P5JA 3FFIA 2KW4A 1NJZA 2G8FA 4QAGA 3AO1A 4KHQA 1RBVA 4CGHA 1WSHA 4CJPA 3M8SA 5J2MA 1I39A 4MQ3A 4H4MA 4K8XA 3AVIA 3AA5X 3LDSA 1HNVA 3KLHA 4FK2A 3SUQA 1REVA 1RT6A 1UAXA 2OPPA 2VWKA 2XY8A 5KGWA 3LWMA 1SL2A 2OPRA 3DM2A 4CFDA 1T7PA 2Z1HA 4AHSA 5DMRA 3VQ5A 2X78A 2YHAA 2IGIA 4PA1A 3OYHA 3QERA 4F4KA 2A1SA 4ELVA 1TK0A 1L3SA 4KB1A 2P51A 2IOCA 2YNIA 2E6MA 3OVNA 4DF8A 2PY5A 3O4QA 3VQEA 3IS9A 4C8OA 2FBXA 4FLVA 4F2SA 1IH7A 1RTIA 5CYMA 5JS2A 1KLMA 4DG1A 3MXMA 1LW0A 4HUEA 3CYMA 1WAJA 1D9DA 4DSKA 1SKRA 3L2UA 4W5RA 5DK5A 1L3UA 1HQUA 1X9SA 2F8TA 2HHQA 3TAEA 3VQCA 2EHGA 1S6QA 1XWLA 4GMJB 1K6YA 1TAUA 1U45A 3RWUA 2RKIA 4DS5A 5CZ1A 4GVMA 1TL1A 4LSLA 2XY5A 3L2VA 1RDAA 1WSEA 3LAKA 4AHRA 4NCBA 1KSPA 4M3YA 1VK0A 4IKFA 1U47A 3UIQA 2F96A 3M8PA 2HHSA 4AHCA 4HHTA 2HHWA 3SNNA 4CEFA 3ZSWA 1FXXA 1U48A 4Y1DA 4CJ5A 1IKVA 4M3XA 3VQ7A 1QE1A 2OA8A 4XIUA 3RR7A 3VQ6A 1RT4A 3ISNC 1HYZA 3ZT3A 3KIOA 3OS1A 4Z4CA 3CFRA 4JS5A 2BANA 3V9WA 4GW6A 4DTRA 1LWFA 4CERA 4CF1A 2KFNA 1J53A 4RW6A 4FZXC 1KVAA 4ICLA 4KI6A 2ZE2A 4DFJA 4IG3A 3HK2A 4DTPA 1DLOA 1KFSA 1C6VA 4KKOA 2IC3A 4CJLA 4RW9A 1YVUA 4FM0A 5C42A 1QS4A 3WNHA 4DSJA 1NOZA 2DFFA 4CJWA 3TAPA 2X74A 1EETA 2XRIA 1ZBLA 4PUOA 4Z4FA 3SUNA 4EZ9A 3L2RA 3WNFA 5D3GA 3CM6A 4I2QA 3OYIA 1N5YA 4E19A 5EU7A 1X1PA 1LWEA 3OYKA 4FM2A 3SV3A 4HUFA 2Y1IA 4KB0A 1BCOA 1JKHA 1S1UA 2G8UA 5FROA 3G10A 3S3NA 3OYEA 3SUPA 4E7LA 4DF4A 4CGJA 2DY4A 4N5SA 1IKWA 4K8ZA 4CHOA 1RBUA 3K5LA 4CK3A 3L3UA 3VQ9A 3K59A 4DTJA 4DSIA 1J9AA 1BL3A 2ETJA 4YFUA 4CHZA 1HYVA 1KTQA 1BGXT 3ASMA 3LPTA 3NF7A 1SL0A 3KK3A 4E0DA 4QCLA 1DTQA 2GV9A 5HRSA 4FYDA 3BGRA 4KHSA 1LAWA 4F3TA 1QSYA 3NAEA 3U6FA 4B9NA 4CCHA 1EX4A 1LW2A 2WOMA 1QTMA 4FK0A 5I42A 4E7HA 3QEPA 2GBZA 3QEVA 1KRPA 4CGFA 5KRSA 4CFBA 4M3UA 5FRMA 2IS3A 1ASWA 4Z0UA 3D0PA 3QEXA 2F8SA 2KQ2A 1G15A 3AVLA 1O1WA 2BGGA 3EZ5A 2G8VA 4FJ7A 3U3GA 3T1AA 3NFAA 2D0CA 2HNZA 2I5JA 1BHLA 3NF8A 4BE2A 2KZZA 1BIUA 3PV8A 1VSDA 1W0HA 1ITGA 3BDPA 4CESA 3AVHA 4BWMA 4IG0A 3KLGA 3SCXA 4PQUA 3NF9A 4FJXA 1NJXA 4OGCA 3DLHA 3TR8A 3LZJA 4FJMA 1RT2A 4AHTA 2A1RA 1ZBUA 4FZYA 3NGYA 3DRPA 1BCMA 1C0UA 2NUBA 1S5JA 1FKPA 3NHGA 3SPYA 1R0AA 1A5WA 1C0MA 3NBPA 1SKWA 3NGIA 4WE1A 4H8KA 3V1QA 3M8RA 3QEWA 1XI1A 1VSEA 3DRSA 4KREA 4EP5A 2D5RA 1QHTA 2YKNA 4OKEA 3HM9A 3DLRA 4DQRA 3AVNA 2FBTA 2GUIA 3TARA 4E1NA 3AO5A 2YNFA 3ZSVA 1C0TA 4EP4A 4CJQA 1SKSA 2HHTA 4BDZA 1TVRA 1Q8IA 3OYLA 4B9UA 3AVCA 1D5AA 2R7YA 4NYFA 4CJUA 1HJRA 1BQMA 2AJQA 1NKCA 4FVMA 3E01A 1RTHA 4L8RB 4CJEA 4W5TA 1NK5A 4ID1A 3AVKA 2OYQA 2E6LA 2XHBA 1WSFA 3MEDA 3S3OA 4J2AA 2DTUA 1VSMA 5HLFA 3VQPA 1ZBHA 2PZSA 1BI4B 4Z4EA 3HPHA 5CYQA 4DWIA 3CM5A 4HTUA 3NDKA 1VRTA 4AHUA 4B9SA 2BE2A 4FLUA 4JLHA 4CEEA 3TAQA 4BE0A 1Z26A 5HP1A 3TWHA 4LY7A 4CEQA 2ZD1A 3SQ0A 4OJRA 4CJSA 4CK1A 4E1MA 1NK0A 1S9GA 1Y97A 4I9QA 4ELTA 4FJ5A 5T7BA 4HVJA 5HROA 1S1XA 2DFHA 2IAJA 4UQGA 1T8EA 2XY6A 3NH2A 1KVCA 3KJVA 3ZT1A 1X9MA 3DOKA 1RT3A 3CQ8A 3HPOA 1HYSA 3I0SA 3M8QA 3AV9A 2BDPA 1LAVA 3A2FA 4E7KA 4E7IA 4O44A 2D0AA 3OYBA 1BISA 3PUFA 3KLEA 4JRQA 3I0RA 3QO9A 1BI4A 3ZT2A 1A5XA 1Q9YA 3ALYA 4DFKA 3HPGA 2YHBA 1XC9A 3V9ZA 4FJ8A 1I3AA 3F73A 3PO5A 4DLEA 3K58A 1GOBA 2KFZA 1T05A 4C8NA 4LD0A 4M41A 1WLJA 3SPZA 3OYDA 3K5OA 2HHUA 2P1JA 3V1OA 3RMCA 3NH0A 1J5OA 3O4NA 3P83D 2X6NA 3HO1A 4IDKA 4NCGA 3ZSXA 4KTQA 2X6SA 5FDLA 3QINA 4DTNA 4JS4A 4H4OA 2VG5A 4RG8A 1JLCA 3DOLA 3ZSYA 3V9UA 1TK5A 3SI6A 1TK8A 2QKKA 3V1RA 4ZHRA 4N76A 1LV5A 4N41A 4CJ3A 3QEIA 1TKZA 4Q5VA 1T03A 2YKMA 4I7FA 4FLZA 4CHPA 3RRGA 1NJYA 2HMIA 1X9WA 2FBYA 3ZCMA 3ITHA 4CJTA 4LH4A 1WSGA 3PX4A 1JLAA 1QSLA 4YNQA 4FJHA 3MXJA 4ID5A 1U49A 1KVBA 1D8YA 1ZBFA 3QETA 5HRNA 4OPJA 1HPZA 2YNHA 3F9KA 3KK2A 1RTJA 4HCCA 3HVTA 2B5JA 3SYZA 1A5VA 3TAGA 4FXDA 3EY1A 4M3TA 1W9HA 3C6TA 3RMAA 1EKEA 1B9DA 2Z1GA 2QKBA 4CJFA 3TI0A 1NK7A 3KKSA 4TSXA 1HQEA 4M45A 4FLWA 3K57A 3SUOA 3THVA 4LSNA 1JL1A 4DU3A 1WNSA 2G8HA 3VQBA 4FZZA 2OPSA 4W5NA 3PY8A 3OYFA 2OZMA 2XO7A 3OYAA 4Z4HA 4KTZA 2HVIA 4DQPA 3LANA 2B4JA 4KRFA 3VA3A 3TABA 4CJRA 1U04A 4CEZA 1VSFA 1ASVA 4LH5A 4MFBA 1JLFA 3AA2A 4KV8A 4CF8A 3OYCA 4F8RA 3PX0A 1VSKA 4G1QA 3TAMA 2HW3A 4NYNA 2ITGA 3QIPA 3S9HA 3ZT4A 3CFPA 1ZYQA 1RILA 1EXQA 1BQNA 3OS0A 3CFOA 4OLAA 3KLIA 3EYZA 5HRPA 2QK9A 1TKTA 2JLEA 4O55A 5KI6A 4FLXA 3AO3A 3SV4A 3TANA 4ZTFA 3DLBA 2P5OA 4KO0A 3HP9A 1QQCA 2Z1IA 1C1BA 4M3ZA 4I2PA 4ZTJA 1TGOA 5E41A 3MXIA 1C1AA 2FC0A 4CIGA 3LALA 1JLGA 4DSFA 1TL3A 4KTWA 5HBMA 4DSEA 1D9FA 4BE1A
chains in the Genus database with same CATH superfamily
2ZF5O 1CLQA 3EL2A 3HJFA 2BH1A 3HYFA 3U3YA 2O8EA 1EO1A 4E3SA 4LF4K 4OLBA 1U4BA 3TTDA 4AQYK 1GOAA 2P9IB 4J2DA 3HP6A 5J2QA 4OKKA 4CZMA 3MN9A 4RW4A 4B3OA 4CEBA 4NB4A 3MWTA 4DUYK 3NH1A 2VWJA 1NKBA 1MU2A 3CERA 3OYGA 4XH5A 4FLYA 4PY5A 1IKXA 1RDBA 3LM9A 2P5GA 3IUCA 4LC9B 3KK1A 3VQ8A 1L3VA 3DMJA 1XHZA 4CEOA 3CJBA 3NE6A 4IZ9A 2HHVA 4AHVA 4OO1J 2P9IA 2LSNA 5KQ8A 4F3OA 1YT3A 3G0ZA 2D0BA 4A2AA 5M1NA 5FLXO 3O3GA 1UWBA 1TV6A 3O9UA 1IV0A 1IG9A 3UB5A 3L2WA 3ULDA 1VQ7N 1HNWK 2VG7A 4H5RA 3IKMA 4EFHA 3BUZB 5HRRA 3VGMA 3MAQA 2Q0RA 4ISGA 4B1WB 4CFAA 1V4TA 1J5EK 4NCAA 4H0VB 2QXLA 3NGZA 3VQDA 5AQHA 2HNDA 1OH8A 2PYJA 1IO2A 4O0JA 4BVOA 2IVPA 3FGUA 3CCJN 3MK6A 4IBNA 5KRTA 5E84A 3OJSA 1IBMK 1MDUB 4YORA 1GLAG 1C1CA 4DV3K 3TSQA 1BIZA 1E4GT 3OTOK 1NMNA 3ZLJA 4BRCA 3WXJA 1JXEA 2VCPA 4KI4A 4H5VA 3DRRA 4DR2K 4X62K 1S6PA 4FWMA 4JKHA 1YVNA 3AA3A 1YJ9N 1QZ6A 5BREA 4O5BA 1J6ZA 4IEIA 3V81A 3FFKB 3J80O 2OZSA 4C8KA 1M90O 3BP8A 2O4IA 1ZBIA 4DV0K 2QWPA 2O8CB 2QM1A 5J2PA 4LF9K 2IDOA 1BDGA 4WQ4C 3SLCA 3WNGA 3I8DA 4CIFA 2OTJN 3VGKA 4IFYA 3VA0A 3O6WA 3QNNA 4KHYA 2ZJQL 2G8KA 1GOCA 3IG1A 2YHYA 5C24A 3OY9A 4E7JA 3BZKA 2CGLA 1W7AA 3HSTB 4DR3K 5AFUH 4JKFA 4FLTA 1WBDA 1NJWA 3SQ1A 2KHOA 5JLFA 4BACA 2VYPA 1N34K 1L5UA 4Z4IA 3SMSA 2J4RA 2KW4A 2O8CA 4YDUA 4CJPA 5J2MA 3AVIA 1S72N 3SJHA 4JI5K 1MA9B 3MMVA 4AM6A 3LWMA 2G8IA 2OPPA 5C0YA 3PSFA 2OPRA 4CFDA 5ADXA 5DMRA 2X78A 4PA1A 1YAGA 3I33A 2A1SA 1ESVA 4BR0A 2P51A 4C8OA 3O4QA 3VQEA 3IS9A 3MXMA 1KLMA 4HUEA 1RGIA 1TYQB 2HHHK 4DSKA 1SKRA 3L2UA 4F9OA 5HL7L 3ZYYX 5AR0A 5AZIB 2EHGA 3M5RA 4GMJB 1ATNA 3HI0A 3RWUA 3G6EN 3CCEN 5CZ1A 4GVMA 2XY5A 4KH6A 3L2VA 2CH6A 3ID8A 3JAMO 1KSPA 4M3YA 3KHYA 3MX2A 1DEJA 3C65A 4Y1DA 1IKVA 2GWKA 1TYQA 1G99A 1MWKA 1HKCA 3VPZA 4CZEA 3OS1A 3ZT3A 4DKWA 3CFRA 2G8HA 2BANA 5BRFA 4GW6A 5AZIA 3V9WA 1J53A 4GV9A 2GUPA 4ICLA 4DFJA 3M3ZA 1VQKN 3AAQA 3EO3A 4CJLA 1C0FA 4EZ9A 3L2RA 3OYIA 1NG9A 1N5YA 3OYKA 4JEPA 3SV3A 4DR1K 2GTDA 1BCOA 1JKHA 1S1UA 3S3NA 3CF5L 3OYEA 2DY4A 3ENBA 1ATSA 4N5SA 1RBUA 3K5LA 3L3UA 4FWRA 2ETJA 5AQIA 3G4SN 1K73O 1HYVA 1KTQA 3NF7A 3ASMA 5JVGL 4IOAL 4BQLA 4YY3K 1DTQA 5HRSA 3BGRA 3CJ7A 4F3TA 1QSYA 3U6FA 1GLFO 3CC2N 2WOMA 2CGJA 3E1YA 4Z0UA 2HSTA 4U67L 1G15A 1Q86O 3EZ5A 4FJ7A 1LCUA 3U3GA 3T1AA 3T1YK 1HLUA 3NVKA 2I5JA 1VSDA 1W0HA 5DM7L 3KLGA 3SCXA 3NF9A 1NJXA 5E26A 2VGNA 1RT2A 4AHTA 2A1RA 2FLOA 3THYB 4FZYA 1R59O 1BU6O 1S5JA 3NHGA 4ISEA 3WEEB 3CPEA 1YI2N 3QEWA 3VEOA 4B1ZA 2FSNA 1EWQA 4MDBA 4FOEA 3HM9A 3DLRA 3VF2A 4E1NA 1C0TA 4BDZA 3OYLA 4B9UA 3AVCA 3CMEN 3TSPA 3DAWA 1BQMA 3EE8A 2AJQA 3E01A 3WQTA 2OCEA 1KAZA 4W5TA 1NGIA 3THYA 3S3OA 5LJWA 5HLFA 3WEEA 5CYQA 3NDKA 1VRTA 4AHUA 4B9SA 2HOEA 2RE2A 1NM1A 5HP1A 1VQ8N 2Q0UA 3EKSA 4IOXA 1S9GA 2IVNA 4BC5A 1YJNN 2JWLA 1NGFA 3ZT1A 2F9WA 3DOKA 4JNEA 1RT3A 3CQ8A 4JV5K 1HYSA 4DR7K 4IOCL 3AV9A 1NBWA 4B1UB 4O44A 2D0AA 1BISA 3KLEA 4BGBA 4MDAA 5ADXH 3ZT2A 3BF3A 3VF6A 4DFKA 1RDUA 3F73A 4DLEA 3K58A 1T05A 3SPZA 3OYDA 3CQXA 3NH0A 2P9UB 3O4NA 3P83D 3AGRA 2UXDK 4YOUA 3QINA 1XMQK 4DTNA 5EY4A 4RG8A 2W41A 4CZIA 1LV5A 4N41A 4CJ3A 4CHPA 4A5AA 3ITHA 4LH4A 5BN9A 3MXJA 4ID5A 1U49A 5KPTA 4OPJA 5GAEP 3F9KA 1TUUA 1A5VA 3TAGA 3EY1A 1W9HA 3RMAA 1EKEA 1B9DA 3BF1A 2QKBA 3TI0A 3THVA 1QVFM 4JI3K 4X65K 1DT9A 3OYFA 4KTZA 3DJCA 2B4JA 3TABA 3CCLN 1GLDG 4MFBA 3AA2A 4KV8A 4F8RA 1OKJA 3TTFA 3C7NB 4H0PA 1LOTB 3HZ6A 5HRPA 4ZTFA 4K25A 3TANA 3DLBA 4FO0A 1QQCA 2Z1IA 4YOYA 1XQSC 1GLBG 5E41A 3C6AA 4V19S 3LALA 3CCVN 1JLGA 4KTWA 5HBMA 3F2KA 1D9FA 3H46O 1NGEA 4Z4GA 4WQ5A 4FPBA 2F4VK 2GEMA 1N36K 1VQMN 2A40A 3GOIA 5BRHA 3PX6A 1B9FA 3LP0A 2OPQA 2HF4A 5LY3A 3EE9A 2E4LA 3LP1A 2ZGZA 3DI6A 3QESA 1CZ9A 3V6DA 2Q2RA 2WONA 4BRHA 3CG7A 3D45A 4C8LA 5AQRA 3T1HK 5FPNA 4CGIA 1IG8A 2V51B 4FCYA 3ZSQA 4EIAA 1JCFA 3OYJA 4DQQA 2E88A 1S1TA 1MWMA 4JI8K 4O5FA 3RTVA 4A62A 1EWRA 3TU5A 3TAFA 3QICA 1JL2A 3DLGA 3RMDA 3JSMA 1VHXA 3ZT0A 4O8KA 4CHNA 4FJIA 4HCBA 4CF2A 1S1VA 2P9KA 3ZSRA 1RCHA 1QQNA 3D2EB 4PWDA 4H5WA 3OYMA 4RW7A 3LDLA 4CJKA 4FW2A 3QIOA 5C10A 1TAQA 3VESA 3L2QA 3QNOA 4IFVA 3H3OB 1F21A 5AJ3K 1KQSM 5KQDA 1GLCG 4CK2A 2YHWA 3KLFA 2B6AA 1N32K 1CZBA 5JMVA 3IRXA 1VQON 1FK9A 4CGDA 4OPKA 2NRRA 3CI5A 4CCHA 4RCHA 5HOOA 3AVGA 4DTXA 4OKJA 4F2RA 1HKBA 2XY7A 2O8DA 3D2EA 3OYNA 4M63C 3O3FA 1HX1A 4CZGA 4DFPA 2PAVA 3EEQA 1RBSA 4BC2A 2GELA 3KWGA 4M3RA 3KD1E 3CCQN 3SAFA 5GAHP 1X9JA 3C94A 3DLEA 3CMAN 1NK9A 1NGBA 4DR5K 5AQZA 3EZWA 2Q31A 3HXMA 3IDHA 1KCFA 3QLHA 5AQMA 4KHUA 4GV3A 4W5OA 4J8FA 2QWOA 1XNRK 3AO4A 3O9RA 1NK4A 1VAZA 4DQIA 1HNIA 1RDCA 4I9LA 2QTDA 1IBKK 4PKIA 3K2PA 3VN5A 1NGGA 1RT1A 3OBWA 4N47A 3ZETB 1ILYA 4CHYA 5CZ2A 1U2VB 1YHQN 3RSEB 4WQ5C 1Q9XA 3MCPA 5KTQA 1NK6A 2I7PA 2G8WA 3LWLA 3LDNA 4KFBA 4CGGA 3A0IX 3SJJA 1RT7A 3OS2A 1HMVA 1QSSA 3LP3A 1HNZK 5SZTA 4W5QA 1RT5A 4H0YB 2FF3B 3FZHA 1LWCA 4JK9A 4Y1CA 3ZETA 4B9TA 1KFDA 3CJ1A 1U2VA 3FE1A 3P5JA 3FFIA 3RSEA 5ELZA 4QAGA 4CZFA 1XC3A 1QZ5A 4KHQA 3C0BA 1WSHA 1ZC6A 1I39A 2D4WA 4K8XA 1HNVA 4FK2A 3B8AX 5BR9A 1REVA 2XY8A 5KGWA 3SUQA 4CD1A 1IBLK 2Z1HA 3VQ5A 2YHAA 3FZFA 2A42A 4ELVA 2FSKA 5AQYA 3TSUA 4WFAL 1L3SA 4KB1A 2E6MA 2PY5A 2FBXA 1RTIA 3MCAB 5CYMA 1LW0A 1KXPA 2UU9K 4W5RA 5DK5A 1X9SA 3L4IA 2HHQA 5AQLA 1XWLA 4LSLA 1RDAA 3LAKA 4AHRA 1X3NA 4AM7A 4OPHA 5TKYA 2F96A 1NNEA 4HHTA 3SNNA 4FWPA 3GG4A 3ZSWA 1FXXA 3HOTA 1U48A 4CJ5A 3M1FA 1QE1A 3VQ6A 1HYZA 4JS5A 4DTRA 1LWFA 4CF1A 4FZXC 2KKZA 3VEWA 1KFSA 1C6VA 2ASOA 4KKOA 1HKGA 4X66K 1QS4A 3WNHA 1NOZA 2DFFA 3TAPA 4Z4FA 2XRIA 4PUOA 1CZAN 4LF8K 3WNFA 3CM6A 3LL3A 3J81O 2AA4A 5F0XA 4E19A 1X1PA 2F7TA 2G8UA 5FROA 3G10A 3A5NC 4E7LA 4CHOA 5EXWA 4CK3A 3O4WA 3K59A 3MN6A 5FPDA 1BL3A 2ZJRL 2FXUA 3LPTA 3KK3A 4QCLA 3QB0A 4FYDA 4KHSA 5C15A 4JKDA 4LFCK 4FK0A 5I42A 4E7HA 1KRPA 4M3UA 5TKWA 2F8SA 2KQ2A 2BGGA 1O1WA 2E2QA 2D0CA 2UUCK 2YI1A 2KZZA 4DUZK 3QFUA 1ITGA 4CESA 1Z05A 3P38A 3L6QA 4IG0A 4YHHK 3O1BA 4BRNA 2Q1NA 4OGCA 4FJMA 3ENHA 1V4SA 3DRPA 1BCMA 1C0MA 3NBPA 3THWB 1SKWA 2UUAK 4DV5K 4KREA 1JJ2M 4EP5A 3SMPA 2YKNA 1JCGA 3AVNA 2GUIA 2QW9A 4ILJA 5AQVA 4EP4A 1Q8IA 4CJUA 4B1YB 5BR8K 3JXUA 1DKGD 1NKCA 4BRAA 4JAXA 3QDKA 2NRTA 4CZLA 1NK5A 2DTUA 3LDPA 5CHIA 3VQPA 1BI4B 3U8XA 3THWA 3CM5A 2BE2A 4FLUA 4CEEA 3TAQA 4LY7A 4NXNK 3SQ0A 3MX5A 4BC4A 3VMFB 4I9QA 3VTHA 4FJ5A 5T7BA 4HVJA 1WBBA 1S1XA 2IAJA 1NMDA 4UQGA 3U9ZA 4DHYA 4ISFA 1KVCA 2A41A 3KJVA 3CCMN 3PSIA 3K9JA 3HPOA 4CW7B 3A2FA 4HWIA 4JN4A 3HOSA 4E7KA 4GVEA 4JKEA 1BI4A 2VWBA 3ALYA 3HPGA 2YHBA 1XC9A 3AAPA 3V9ZA 4FWNA 3PO5A 2UUBK 4M41A 2IIRA 5M1OA 4DQ8A 4NCGA 3ZSXA 2X6SA 5FDLA 4JS4A 1TK8A 3SI6A 3VENA 3VEXA 3CCSN 1BO5O 4FWQA 4ZHRA 3QEIA 4A2BA 1T03A 2YKMA 4I7FA 1N8RO 4MO5A 3RRGA 2HMIA 1X9WA 3OBYA 5AQXA 4EHTA 3PX4A 5H1SQ 5HRNA 2NLXA 2B5JA 4BC3A 3PIOL 2Z1GA 5AQOA 3AY9A 1NK7A 3H1VX 5IWAK 1K8AO 1WNSA 1NGCA 4FWLA 4B1XB 3WT0A 2HVIA 4JK7A 4DQPA 3R6MA 5AQGA 4GKKK 4CEZA 1HNXK 4LH5A 1VSFA 1ASVA 3J8AA 3Q7CA 4H5NA 1I94K 1VSKA 4DV7K 4FSVA 4NYNA 2ITGA 3ZT4A 3CFPA 1ZYQA 1T44A 3KLIA 5LMNK 2W40A 4FLXA 3ENOA 1C1BA 1SQKA 2WBNA 3VEYA 4M3ZA 4ZTJA 1TGOA 3MXIA 4CZKA 2FC0A 4YDUC 3GL1A 4DSEA 3U9DA 3F5TA 4BE1A 4JKAA 3SK3A 3VTIA 3CC4N 2W42A 1JCEA 5AQTA 2UXCK 1WN7A 4LFBK 1VSLA 3T19A 2YNGA 5KPZA 3RMBA 1VQ4N 3HT3A 4CHQA 4PKGA 2ZQBA 5C25A 4IO9L 4ELUA 3WXIA 1SUQA 1KAYA 4C8MA 1Z25A 3LZIA 1KC8O 1D4XA 4IWVA 2FBVA 4KAZA 3V4IA 1QQOA 3I55N 4FJKA 3N4QA 4BGAA 4E1JA 3OJUA 2ZJPL 3SQ4A 4JRPA 1IKYA 5CE3A 5FRNA 3WNEA 1VSJA 3H45C 3S3MA 1Q81O 1CXQA 3CD6N 3CXCM 2BUPA 1RNHA 2RN2A 4E89A 3IFRA 2VG6A 3R1XA 1N6QA 1RBTA 3K0SA 3IMXA 1JLEA 4B08A 4CECA 4KPYA 4CEAA 3VQAA 4B8AB 3DLKA 4CFCA 4PHTX 2HVHA 1FKOA 3SQ2A 4CIEA 4JKGB 1TKDA 3CQYA 5K14A 2I7NA 1ATRA 1S1WA 5MLCQ 4M3WA 1S9EA 3A5LC 2A5XA 4DU4A 1BG3A 1YTAA 4JI1K 2ATQA 3P31A 4B8CA 3S41A 4FJNA 1W97L 3FR0A 4CF9A 3SZ2A 1IJJA 1VQLN 4FM1A 5FPMA 3HRGA 4GNIA 3KWIA 5BPMA 4JKGA 3PO4A 2QWNA 3A5OC 3O1WA 3EN9A 4BR7A 2ZM6K 1XMOK 3OW2M 2AP1A 3SAHA 1UOCA 3L3VA 3VQ4A 3ZSZA 4DSLA 2P9UA 3O9QA 3E9LA 4B9VA 4FW1A 3AA4A 4YOTA 3ZSOA 1FW6A 2V7ZA 4BRQA 4BRLA 1JLQA 3DXMB 2QXFA 1VSIA 5M1PA 1EQYA 5JS1A 4BRDA 5IT9O 2QWLA 4J2BA 1SL1A 4CBWA 4K0KK 3LPUA 5AQWA 5J2NA 4B3MK 3BZCA 3JS6A 4KHNA 3B6PA 4CVNE 2NZTA 3NMUA 1WAFA 4A61A 4RW8A 1YIJN 3VQQA 3AVAA 4DTMA 4DMNA 4DU1A 5SWMA 4B9QA 2EX3A 4JI0K 1NOYA 2JGUA 2YJEA 3IAYA 3H08A 3GBTA 3MEGA 3WXMB 1WSJA 3THXB 1NK8A 3HBTA 4B3SK 3DXMA 1RFQA 3LP2A 4FJGA 1U6ZA 5AQNA 3RRHA 1H1VA 3C95A 3L4QA 4IJAA 4KHPK 1NWKA 4JI2K 1T3VA 4FJ9A 3KD5E 1J54A 1ASUA 1UA0A 1NU0A 1WSIA 4O8UA 4EZ6A 2KZMA 3C7NA 3K5MA 1VQNN 4H0XB 1P90A 2ITMA 5CY4A 2PYLA 2P9NB 4FL9A 1NGJA 2WFBA 3JYTA 2G8FA 1NJZA 3THXA 3AO1A 4CGHA 2VQEK 2NRZA 4L3QA 3M8SA 4MQ3A 4H4MA 3WXLA 3AA5X 3MN5A 4WFNL 3KLHA 1KD1O 1RT6A 2VWKA 4H5TA 3U4LA 4BRIA 3OYHA 2IGIA 5KPRA 2BTFA 2CH5A 2IOCA 2YNIA 4DF8A 1S22A 1IH7A 5JS2A 4DG1A 2KLAA 1WAJA 1D9DA 3CHWA 1L3UA 1GLLO 4M7XA 3TAEA 4KBOA 3KK7A 3VEVA 3EKUA 4DV1K 1M1KO 2RKIA 3I56N 1TL1A 5EVZA 3UKUB 1WSEA 2ZGYA 1KAXA 4LF5K 2QWRA 1VK0A 4IKFA 4IXCA 4AHCA 4BRFA 4CEFA 4CJ7A 1ZBSA 5LJVA 4M3XA 2OA8A 3RR7A 1RT4A 3KIOA 3O9TA 3Q7BA 2KFNA 3A8YA 1BUPA 1KVAA 4BQZA 4KI6A 1BOTO 3HK2A 4H03B 4DTPA 2IC3A 4C23A 3DWLA 3UKUA 1E4FT 4CJWA 2F9TA 2X74A 1EETA 1ZBLA 2ASPA 3SUNA 4QS8A 5D3GA 2QWMA 1YF5L 2PBDA 4FM2A 3CETA 4HUFA 4KB0A 4PKHA 3LDQA 4CD3A 4K8ZA 1YUWA 4JD2B 2V7YA 5F2RA 4CHZA 1BGXT 2GV9A 3LM2A 3LDOA 1LAWA 3VGLA 4B9NA 1LW2A 3E66A 3QEPA 2GBZA 3R3LA 3QEVA 5KRSA 2IS3A 3MDQA 3D0PA 3AVLA 2G8VA 1BA1A 3FZMA 1BHLA 4BE2A 1RDWX 1T6DA 3PV8A 4QS9A 3AVHA 4BG8A 4BWMA 4JD2A 2QWQA 3CJ9A 2E20A 3P39A 3DLHA 5AQQA 2NRWA 4ILGB 1ZBUA 4NLBA 3VOVA 2E1YA 1FKPA 1A5WA 2D1KA 4WE1A 1QHAA 4H8KA 3M8RA 1XI1A 1VSEA 1GLJO 2D5RA 5M1FA 4KH5A 3AO5A 2YNFA 1SKSA 5BPNA 4WQ4A 1D5AA 2R7YA 4NYFA 4K42A 5GAGP 1OH7A 1RTHA 4YOVA 4L8RB 3PIPL 4MLEA 3F9MA 2OYQA 2XHBA 4J2AA 3VETA 3FZKA 4WFBL 1VSMA 5GIOA 4I6MB 4HTUA 4JLHA 4CEQA 2ZD1A 4OJRA 4CJSA 3L0QA 1Y97A 5HROA 1Q7YO 1T8EA 4JYAK 2XY6A 3NH2A 4FWOA 3BEXA 3H3NO 1X9MA 1OH6A 2PFUA 3I0SA 3M8QA 3N4PA 1LAVA 1X3MA 3OYBA 4JRQA 3HM8A 3PUFA 4BR4A 3I0RA 3QO9A 1Q9YA 4I6MA 3O5BA 5BPLA 4FJ8A 5BN8A 2KFZA 1GOBA 3WXKA 4C8NA 4LD0A 3K5OA 5C12A 2P1JA 3V1OA 3RMCA 4OX9K 1NGHA 2X6NA 3PLAA 2UXBK 3A5MC 4IDKA 5GIPA 4KTQA 1VQ9N 1HPMA 4H4OA 1JLCA 3DOLA 3ZSYA 3V9UA 1YJWN 1TK5A 2QKKA 3H6EA 3V1RA 2YX6A 5GINA 1TKZA 4FLZA 3ZX0A 4WF9L 1BWFO 4NXMK 2FBYA 3ZCMA 4DV2K 4CJTA 4FJHA 4YNQA 1KVBA 3G71N 1ZBFA 3DLLL 3CCUN 3H1QA 3QETA 5C2DA 2YCHA 3FLCO 3KK2A 1RTJA 4KH4A 4AF1A 2P9PB 2WUSA 3KKSA 2W6KA 1HQEA 4TSXA 3K57A 4LSNA 1JL1A 4RTFD 3VQBA 2OPSA 2E5LK 2O8FB 3PY8A 4IEEA 5JVHL 2OZMA 4YOXA 2XO7A 4QS7A 5F1XA 4IDHA 1JLFA 4Y0WA 3PX0A 3TAMA 3QIPA 5DM6L 3S9HA 1YITN 1EXQA 3CFOA 2QK9A 4MLHA 1TKTA 4O55A 5KI6A 3SV4A 3AO3A 2P5OA 3HP9A 4DR4K 2P9PA 2V52B 3D2FB 5JLHA 1C1AA 4CIGA 3AGKA 4JKCA 4DSFA 1TL3A 2O8FA 2CGKA 4JI7K 4DV6K 3R9PA 3OA9A 1T6CA 4BDPA 4DR6K 1XNQK 3AO2A 4B9MA 1SS6A 4HTLA 3DYAA 4DTOA 5M1QA 3KKRA 2HBJA 1ZXOA 1CXUA 4FJLA 4GKJK 1P8ZA 2KTQA 2NNWA 1BA0A 4DFMA 4CZHA 3J7YP 3O3HA 4FJJA 1NJIO 1SZ2A 3ZX2A 3AVBA 2Y1JA 3K5NA 3D2FA 3T3FA 3UKRB 4B9LA 1Q18A 2HBMA 1HUXA 1NLVA 1UA1A 5EX5A 5GADP 4BDYA 1RBRA 3O9SA 4PL8A 2RF2A 4HUGA 4JI4K 4DCHA 3KZBA 3L8BA 2ZWHA 2VQFK 3AVJA 4MO4A 3C6UA 5I3UA 4Q0BA 5EOYA 4CJVA 2HMPA 4QOZB 2RPIA 4DS4A 1OH5A 1KLNA 3UKRA 4CBXA 4DTSA 3CIPA 3DXKB 3HSCA 3C6HA 3E9OA 1HRHA 3R8EA 5AQKA 4FK4A 1VSHA 1JLBA 4FOIA 4K43A 1SAZA 4CF0A 3P1GA 4BWJA 4B3RK 3MEEA 2NRHA 3HL8A 3NF6A 1DTTA 3ATVA 3LAMA 4O4GA 4OGEA 4BVPA 3J7ZO 3RR8A 4CBUA 1TKXA 4NO7A 3V9SA 2DPNA 3DXKA 5LMUK 1RTDA 1XHXA 3AVMA 2DFEA 3ZX3A 4LFAK 3T69A 2QI2A 2NRXA 2Q3SA 2HNYA 3ATUA 3KTQA 1SV5A 2UYTA 2HHXA 4BR5A 2Z1JA 3B6OA 4J2EA 1NGAA 4M42A 3TPQA 4AH9A 3MWPA 1WUAA 4A59A 1VQ6N 2HBKA 4N56A 3HVRA 4CEDA 2OANA 3QFPA 3AVFA 2HF3A 4O0IA 1OVQA 3V9XA 5AQJA 4EAHD 4DQSA 4DLGA 4AILC 4KHWA 4DTUA 1B92A 5J1EA 3MECA 2FSJA 1VRUA 4R5PA 1JXBA 4BR9A 3NCIA 4B1VA 2E2OA 2YJFA 3CPWM 1L3TA 1K9MO 2O8BB 2QEXN 1RDDA 3SBTA 4IJNA 4R79A 1NKEA 2O4GA 5AZJB 2HBLA 4DV4K 4CJ4A 4OVLA 4CE9A 2YV0X 5KGXA 2HB5A 1YTUA 1EP4A 2OTLN 2W6LA 1RBVA 1S3XA 3LDSA 3K9KA 1UAXA 2RHKA 4BRMA 1SL2A 1T7PA 3DM2A 2O8BA 4RWTA 4AHSA 3QERA 4C1NI 4F4KA 1TK0A 2E2PA 5B8HA 5AZJA 3OVNA 1TUYA 4BY9C 4F2SA 4FLVA 1FJGK 3ID6A 3CYMA 2IVOA 1WB9A 1HQUA 3VF4A 2F8TA 3VERA 3WQUA 3VQCA 3T7ZA 1S6QA 3TTCA 2D0PA 1K6YA 1TAUA 1U45A 2E8AA 4DS5A 4BROA 2VGMA 4FWKA 3G25A 4NCBA 4A57A 1C0GA 1XUPO 4K41A 1U47A 3M8PA 3UIQA 2HHSA 4BR2A 2HHWA 3VQ7A 4XIUA 3ISNC 3MN7A 4IO8A 4Z4CA 4CERA 4RW6A 2P9LB 2ZE2A 3HTVA 4IG3A 1DLOA 3O8MA 4RW9A 1YVUA 4BRPA 4FM0A 5C42A 4DSJA 3CCRN 1E3MA 1WOQA 4PL7A 4I2QA 2JWKA 5EU7A 4FPAA 1LWEA 2Y1IA 3CC7N 4GV6A 3SUPA 4U7BA 4DF4A 4CGJA 1Y64A 1IKWA 3FZLA 1N33K 4DTJA 3VQ9A 4DSIA 1J9AA 4YFUA 3OHRA 2Q36A 1SL0A 4E0DA 2P9LA 3NAEA 2D0OA 4A5BA 1EX4A 4IFEA 1QTMA 1QQMA 4XH1A 4B3TK 1Q82O 5CR4A 4BG9A 4CGFA 3D7EO 4CFBA 5FRMA 3WUHA 3QEXA 1ASWA 3J7AP 3ULEB 2H3GX 3NFAA 2HNZA 1HJOA 3NF8A 4BRKA 1BIUA 3AARA 3BDPA 2NRVA 2Q97A 4PQUA 4FJXA 1NGDA 1HR0K 4JHDB 3TR8A 3LZJA 4G9ZA 4YOWA 3NGYA 1C0UA 2NUBA 1R0AA 3SPYA 3NGIA 3V1QA 4XEIA 3DRSA 4BRGA 4NLCA 1QHTA 4OKEA 2FF6A 4DQRA 3ULEA 2FBTA 3TARA 5M1KA 3VEZA 3ZSVA 4CJQA 2HHTA 1TVRA 2E1ZA 3M6GA 4XH4A 3SBGA 3W0LA 1HJRA 4FWSA 4OPAA 3GE1A 4Z94A 4FVMA 1DGKN 4JHDA 4CJEA 5AQPA 4ID1A 3AVKA 2E6LA 4H0TB 4JI6K 1WSFA 3MEDA 4CI6A 1ZBHA 2PZSA 4Z4EA 3HPHA 2P9KB 4DWIA 4BREA 2P9NA 3I8BA 3QBXA 4BE0A 1Z26A 3TWHA 4CK1A 3O80A 3UE5A 4E1MA 5AQFA 1NK0A 4ELTA 2DFHA 4LF6K 3P4IA 4EHUA 1O13A 1YXQA 1QVGM 4JK8A 2QA4N 2BDPA 4E7IA 4GY2B 3D6RA 4WCEL 4CZJA 4FVUA 2A3ZA 1A5XA 2YHXA 2O8DB 5AQUA 3W3DA 1I3AA 1Z6RA 2GX9A 1WLJA 3GDQA 2HHUA 1J5OA 3HO1A 5A2QO 2VG5A 3KVGA 5AQSA 1OVYA 2E2NA 5JICA 5I9EB 2GWJA 4N76A 4WYBA 4LF7K 4Q5VA 3QBWA 2P9SB 2A6AA 1NJYA 4JKBA 1WSGA 2WC9A 1K8KB 1GLEG 1JLAA 1QSLA 1D8YA 1W2BM 1HPZA 2YNHA 1VQ5N 4HCCA 5C2FA 3HVTA 3SYZA 4ILHA 3ZEUB 4FXDA 4M3TA 3C6TA 4DB3A 3O08A 3E9PA 3CJAA 4CJFA 3NVMA 4FLWA 4M45A 3SUOA 4DU3A 4FZZA 4W5NA 3QMLA 3SAGA 5AFUA 3OYAA 4Z4HA 3LANA 5BRDA 2P9SA 3VA3A 4KRFA 4CJRA 1U04A 4X64K 1VQPN 2O8EB 4CF8A 3CJCA 3OYCA 4H0OA 4G1QA 1K8KA 3RVCA 2HW3A 5FPEA 1RILA 1BQNA 3OS0A 4OLAA 3EYZA 4C1NK 2JLEA 2WTUA 3ZEUA 4KO0A 4M7YA 5LL6Z 2ASMA 2EWSA 3BY5A 4I2PA 4UY8O
chains in the Genus database with same CATH topology
4Z4GA 4BDPA 1CLQA 3HJFA 3HYFA 2W42A 3AO2A 1WN7A 4B9MA 3PX6A 1B9FA 3LP0A 3U3YA 3DYAA 4DTOA 2OPQA 1VSLA 4E3SA 3KKRA 3T19A 2YNGA 3RMBA 3HT3A 1CXUA 4CHQA 4FJLA 2KTQA 2ZQBA 4OLBA 2E4LA 5C25A 4ELUA 3LP1A 1SUQA 1U4BA 4C8MA 1Z25A 4DFMA 3O3HA 3DI6A 3LZIA 1CZ9A 3QESA 1GOAA 4FJJA 3V6DA 2FBVA 2WONA 3AVBA 4KAZA 2Y1JA 3CG7A 3K5NA 3T3FA 3V4IA 4J2DA 3HP6A 5J2QA 3D45A 4C8LA 4B9LA 4FJKA 4OKKA 1UA1A 3OJUA 3SQ4A 4JRPA 4RW4A 1IKYA 4CEBA 4CGIA 4B3OA 5FRNA 4FCYA 4BDYA 1RBRA 3WNEA 1VSJA 3NH1A 2VWJA 1NKBA 1MU2A 3ZSQA 3OYGA 3S3MA 3OYJA 4FLYA 4DQQA 4PY5A 1S1TA 2RF2A 1IKXA 1CXQA 1RDBA 4HUGA 2P5GA 1RNHA 2RN2A 3KK1A 4E89A 3L8BA 3VQ8A 3RTVA 1L3VA 3DMJA 2VG6A 2G8IA 3TAFA 1N6QA 1RBTA 3AVJA 5I3UA 3C6UA 1XHZA 4CEOA 3NE6A 4Q0BA 1JL2A 3DLGA 1JLEA 4CJVA 4B08A 4AHVA 4CECA 2HHVA 3RMDA 4CEAA 3JSMA 3VQAA 3ZT0A 4B8AB 4KPYA 4CHNA 4HCBA 4FJIA 3DLKA 4CFCA 2HVHA 1FKOA 2LSNA 3SQ2A 4F3OA 4QOZB 4CIEA 2RPIA 4DS4A 4CF2A 1S1VA 1TKDA 3ZSRA 1RCHA 1KLNA 1YT3A 3G0ZA 4DTSA 4PWDA 2D0BA 5K14A 3O3GA 3OYMA 1UWBA 1TV6A 4RW7A 1S1WA 1IG9A 4CJKA 4M3WA 1HRHA 4FW2A 3L2WA 3QIOA 3ULDA 4FK4A 1VSHA 2VG7A 1TAQA 3L2QA 1JLBA 3QNOA 1S9EA 4IFVA 1F21A 5HRRA 4CF0A 4CK2A 4DU4A 3P1GA 1YTAA 3KLFA 2B6AA 4BWJA 3MAQA 2ATQA 1CZBA 4B8CA 4FJNA 4CFAA 3IRXA 4NCAA 3MEEA 1FK9A 4CGDA 4OPKA 3HL8A 3NGZA 3VQDA 4CF9A 2HNDA 3SZ2A 2PYJA 4FM1A 1IO2A 3NF6A 1DTTA 3LAMA 4O0JA 3AVGA 4O4GA 4OGEA 4DTXA 3RR8A 4OKJA 4F2RA 3PO4A 1TKXA 2XY7A 3V9SA 3OYNA 3O3FA 1UOCA 3L3VA 4IBNA 5KRTA 1RTDA 3OJSA 3VQ4A 3ZSZA 4DFPA 4DSLA 1RBSA 1XHXA 3AVMA 1C1CA 2DFEA 4B9VA 4FW1A 1BIZA 3AA4A 4M3RA 3ZSOA 3KD1E 3C94A 3DLEA 1JLQA 1JXEA 1NK9A 2QXFA 1VSIA 4KI4A 2Q3SA 2HNYA 3DRRA 5JS1A 3HXMA 1S6PA 1KCFA 1SV5A 3QLHA 3KTQA 4FJGA 4KHUA 4W5OA 4J2BA 2HHXA 1SL1A 2Z1JA 3AA3A 3B6OA 4J2EA 3LPUA 4M42A 3AO4A 4DQIA 5J2NA 1NK4A 4KHNA 1HNIA 1RDCA 4I9LA 3B6PA 4AH9A 4O5BA 3V81A 4N56A 2OZSA 3HVRA 3K2PA 4CEDA 4C8KA 1WAFA 1RT1A 4RW8A 3VN5A 3VQQA 3AVAA 4N47A 4DTMA 3AVFA 4DMNA 4CHYA 4O0IA 4DU1A 2O4IA 5CZ2A 5SWMA 3V9XA 2EX3A 4DQSA 1NOYA 1ZBIA 2JGUA 4DLGA 4AILC 3IAYA 4KHWA 4DTUA 1B92A 3H08A 3MEGA 1WSJA 1NK8A 5J1EA 1Q9XA 3MECA 5KTQA 1VRUA 3LP2A 4R5PA 3RRHA 1JXBA 2IDOA 5J2PA 3WNGA 3NCIA 1NK6A 3LWLA 2G8WA 3C95A 4KFBA 4CGGA 4CIFA 3I8DA 4IFYA 3VA0A 3SJJA 1L3TA 1RDDA 3QNNA 1RT7A 4KHYA 3OS2A 2G8KA 4FJ9A 1GOCA 1HMVA 3IG1A 5C24A 1J54A 3OY9A 1ASUA 4E7JA 1UA0A 3KD5E 3HSTB 1WSIA 1NKEA 2O4GA 1QSSA 4EZ6A 2KZMA 3LP3A 4FLTA 1NJWA 4CJ4A 3K5MA 4OVLA 3SQ1A 5SZTA 4CE9A 1RT5A 2YV0X 5KGXA 4W5QA 4BACA 1LWCA 5CY4A 2PYLA 4Y1CA 4B9TA 2HB5A 1YTUA 1L5UA 1KFDA 4Z4IA 1EP4A 3JYTA 3P5JA 3FFIA 2KW4A 1NJZA 2G8FA 4QAGA 3AO1A 4KHQA 1RBVA 4CGHA 1WSHA 4CJPA 3M8SA 5J2MA 1I39A 4MQ3A 4H4MA 4K8XA 3AVIA 3AA5X 3LDSA 1HNVA 3KLHA 4FK2A 3SUQA 1REVA 1RT6A 1UAXA 2OPPA 2VWKA 2XY8A 5KGWA 3LWMA 1SL2A 2OPRA 3DM2A 4CFDA 1T7PA 2Z1HA 4AHSA 5DMRA 3VQ5A 2X78A 2YHAA 2IGIA 4PA1A 3OYHA 3QERA 4F4KA 2A1SA 4ELVA 1TK0A 1L3SA 4KB1A 2P51A 2IOCA 2YNIA 2E6MA 3OVNA 4DF8A 2PY5A 3O4QA 3VQEA 3IS9A 4C8OA 2FBXA 4FLVA 4F2SA 1IH7A 1RTIA 5CYMA 5JS2A 1KLMA 4DG1A 3MXMA 1LW0A 4HUEA 3CYMA 1WAJA 1D9DA 4DSKA 1SKRA 3L2UA 4W5RA 5DK5A 1L3UA 1HQUA 1X9SA 2F8TA 2HHQA 3TAEA 3VQCA 2EHGA 1S6QA 1XWLA 4GMJB 1K6YA 1TAUA 1U45A 3RWUA 2RKIA 4DS5A 5CZ1A 4GVMA 1TL1A 4LSLA 2XY5A 3L2VA 1RDAA 1WSEA 3LAKA 4AHRA 4NCBA 1KSPA 4M3YA 1VK0A 4IKFA 1U47A 3UIQA 2F96A 3M8PA 2HHSA 4AHCA 4HHTA 2HHWA 3SNNA 4CEFA 3ZSWA 1FXXA 1U48A 4Y1DA 4CJ5A 1IKVA 4M3XA 3VQ7A 1QE1A 2OA8A 4XIUA 3RR7A 3VQ6A 1RT4A 3ISNC 1HYZA 3ZT3A 3KIOA 3OS1A 4Z4CA 3CFRA 4JS5A 2BANA 3V9WA 4GW6A 4DTRA 1LWFA 4CERA 4CF1A 2KFNA 1J53A 4RW6A 4FZXC 1KVAA 4ICLA 4KI6A 2ZE2A 4DFJA 4IG3A 3HK2A 4DTPA 1DLOA 1KFSA 1C6VA 4KKOA 2IC3A 4CJLA 4RW9A 1YVUA 4FM0A 5C42A 1QS4A 3WNHA 4DSJA 1NOZA 2DFFA 4CJWA 3TAPA 2X74A 1EETA 2XRIA 1ZBLA 4PUOA 4Z4FA 3SUNA 4EZ9A 3L2RA 3WNFA 5D3GA 3CM6A 4I2QA 3OYIA 1N5YA 4E19A 5EU7A 1X1PA 1LWEA 3OYKA 4FM2A 3SV3A 4HUFA 2Y1IA 4KB0A 1BCOA 1JKHA 1S1UA 2G8UA 5FROA 3G10A 3S3NA 3OYEA 3SUPA 4E7LA 4DF4A 4CGJA 2DY4A 4N5SA 1IKWA 4K8ZA 4CHOA 1RBUA 3K5LA 4CK3A 3L3UA 3VQ9A 3K59A 4DTJA 4DSIA 1J9AA 1BL3A 2ETJA 4YFUA 4CHZA 1HYVA 1KTQA 1BGXT 3ASMA 3LPTA 3NF7A 1SL0A 3KK3A 4E0DA 4QCLA 1DTQA 2GV9A 5HRSA 4FYDA 3BGRA 4KHSA 1LAWA 4F3TA 1QSYA 3NAEA 3U6FA 4B9NA 4CCHA 1EX4A 1LW2A 2WOMA 1QTMA 4FK0A 5I42A 4E7HA 3QEPA 2GBZA 3QEVA 1KRPA 4CGFA 5KRSA 4CFBA 4M3UA 5FRMA 2IS3A 1ASWA 4Z0UA 3D0PA 3QEXA 2F8SA 2KQ2A 1G15A 3AVLA 1O1WA 2BGGA 3EZ5A 2G8VA 4FJ7A 3U3GA 3T1AA 3NFAA 2D0CA 2HNZA 2I5JA 1BHLA 3NF8A 4BE2A 2KZZA 1BIUA 3PV8A 1VSDA 1W0HA 1ITGA 3BDPA 4CESA 3AVHA 4BWMA 4IG0A 3KLGA 3SCXA 4PQUA 3NF9A 4FJXA 1NJXA 4OGCA 3DLHA 3TR8A 3LZJA 4FJMA 1RT2A 4AHTA 2A1RA 1ZBUA 4FZYA 3NGYA 3DRPA 1BCMA 1C0UA 2NUBA 1S5JA 1FKPA 3NHGA 3SPYA 1R0AA 1A5WA 1C0MA 3NBPA 1SKWA 3NGIA 4WE1A 4H8KA 3V1QA 3M8RA 3QEWA 1XI1A 1VSEA 3DRSA 4KREA 4EP5A 2D5RA 1QHTA 2YKNA 4OKEA 3HM9A 3DLRA 4DQRA 3AVNA 2FBTA 2GUIA 3TARA 4E1NA 3AO5A 2YNFA 3ZSVA 1C0TA 4EP4A 4CJQA 1SKSA 2HHTA 4BDZA 1TVRA 1Q8IA 3OYLA 4B9UA 3AVCA 1D5AA 2R7YA 4NYFA 4CJUA 1HJRA 1BQMA 2AJQA 1NKCA 4FVMA 3E01A 1RTHA 4L8RB 4CJEA 4W5TA 1NK5A 4ID1A 3AVKA 2OYQA 2E6LA 2XHBA 1WSFA 3MEDA 3S3OA 4J2AA 2DTUA 1VSMA 5HLFA 3VQPA 1ZBHA 2PZSA 1BI4B 4Z4EA 3HPHA 5CYQA 4DWIA 3CM5A 4HTUA 3NDKA 1VRTA 4AHUA 4B9SA 2BE2A 4FLUA 4JLHA 4CEEA 3TAQA 4BE0A 1Z26A 5HP1A 3TWHA 4LY7A 4CEQA 2ZD1A 3SQ0A 4OJRA 4CJSA 4CK1A 4E1MA 1NK0A 1S9GA 1Y97A 4I9QA 4ELTA 4FJ5A 5T7BA 4HVJA 5HROA 1S1XA 2DFHA 2IAJA 4UQGA 1T8EA 2XY6A 3NH2A 1KVCA 3KJVA 3ZT1A 1X9MA 3DOKA 1RT3A 3CQ8A 3HPOA 1HYSA 3I0SA 3M8QA 3AV9A 2BDPA 1LAVA 3A2FA 4E7KA 4E7IA 4O44A 2D0AA 3OYBA 1BISA 3PUFA 3KLEA 4JRQA 3I0RA 3QO9A 1BI4A 3ZT2A 1A5XA 1Q9YA 3ALYA 4DFKA 3HPGA 2YHBA 1XC9A 3V9ZA 4FJ8A 1I3AA 3F73A 3PO5A 4DLEA 3K58A 1GOBA 2KFZA 1T05A 4C8NA 4LD0A 4M41A 1WLJA 3SPZA 3OYDA 3K5OA 2HHUA 2P1JA 3V1OA 3RMCA 3NH0A 1J5OA 3O4NA 3P83D 2X6NA 3HO1A 4IDKA 4NCGA 3ZSXA 4KTQA 2X6SA 5FDLA 3QINA 4DTNA 4JS4A 4H4OA 2VG5A 4RG8A 1JLCA 3DOLA 3ZSYA 3V9UA 1TK5A 3SI6A 1TK8A 2QKKA 3V1RA 4ZHRA 4N76A 1LV5A 4N41A 4CJ3A 3QEIA 1TKZA 4Q5VA 1T03A 2YKMA 4I7FA 4FLZA 4CHPA 3RRGA 1NJYA 2HMIA 1X9WA 2FBYA 3ZCMA 3ITHA 4CJTA 4LH4A 1WSGA 3PX4A 1JLAA 1QSLA 4YNQA 4FJHA 3MXJA 4ID5A 1U49A 1KVBA 1D8YA 1ZBFA 3QETA 5HRNA 4OPJA 1HPZA 2YNHA 3F9KA 3KK2A 1RTJA 4HCCA 3HVTA 2B5JA 3SYZA 1A5VA 3TAGA 4FXDA 3EY1A 4M3TA 1W9HA 3C6TA 3RMAA 1EKEA 1B9DA 2Z1GA 2QKBA 4CJFA 3TI0A 1NK7A 3KKSA 4TSXA 1HQEA 4M45A 4FLWA 3K57A 3SUOA 3THVA 4LSNA 1JL1A 4DU3A 1WNSA 2G8HA 3VQBA 4FZZA 2OPSA 4W5NA 3PY8A 3OYFA 2OZMA 2XO7A 3OYAA 4Z4HA 4KTZA 2HVIA 4DQPA 3LANA 2B4JA 4KRFA 3VA3A 3TABA 4CJRA 1U04A 4CEZA 1VSFA 1ASVA 4LH5A 4MFBA 1JLFA 3AA2A 4KV8A 4CF8A 3OYCA 4F8RA 3PX0A 1VSKA 4G1QA 3TAMA 2HW3A 4NYNA 2ITGA 3QIPA 3S9HA 3ZT4A 3CFPA 1ZYQA 1RILA 1EXQA 1BQNA 3OS0A 3CFOA 4OLAA 3KLIA 3EYZA 5HRPA 2QK9A 1TKTA 2JLEA 4O55A 5KI6A 4FLXA 3AO3A 3SV4A 3TANA 4ZTFA 3DLBA 2P5OA 4KO0A 3HP9A 1QQCA 2Z1IA 1C1BA 4M3ZA 4I2PA 4ZTJA 1TGOA 5E41A 3MXIA 1C1AA 2FC0A 4CIGA 3LALA 1JLGA 4DSFA 1TL3A 4KTWA 5HBMA 4DSEA 1D9FA 4BE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z4G A;  4BDP A;  1CLQ A;  3HJF A;  3HYF A;  2W42 A;  3AO2 A;  1WN7 A;  4B9M A;  3PX6 A;  1B9F A;  3LP0 A;  3U3Y A;  3DYA A;  4DTO A;  2OPQ A;  1VSL A;  4E3S A;  3KKR A;  3T19 A;  2YNG A;  3RMB A;  3HT3 A;  1CXU A;  4CHQ A;  4FJL A;  2KTQ A;  2ZQB A;  4OLB A;  2E4L A;  5C25 A;  4ELU A;  3LP1 A;  1SUQ A;  1U4B A;  4C8M A;  1Z25 A;  4DFM A;  3O3H A;  3DI6 A;  3LZI A;  1CZ9 A;  3QES A;  1GOA A;  4FJJ A;  3V6D A;  2FBV A;  2WON A;  3AVB A;  4KAZ A;  2Y1J A;  3CG7 A;  3K5N A;  3T3F A;  3V4I A;  4J2D A;  3HP6 A;  5J2Q A;  3D45 A;  4C8L A;  4B9L A;  4FJK A;  4OKK A;  1UA1 A;  3OJU A;  3SQ4 A;  4JRP A;  4RW4 A;  1IKY A;  4CEB A;  4CGI A;  4B3O A;  5FRN A;  4FCY A;  4BDY A;  1RBR A;  3WNE A;  1VSJ A;  3NH1 A;  2VWJ A;  1NKB A;  1MU2 A;  3ZSQ A;  3OYG A;  3S3M A;  3OYJ A;  4FLY A;  4DQQ A;  4PY5 A;  1S1T A;  2RF2 A;  1IKX A;  1CXQ A;  1RDB A;  4HUG A;  2P5G A;  1RNH A;  2RN2 A;  3KK1 A;  4E89 A;  3L8B A;  3VQ8 A;  3RTV A;  1L3V A;  3DMJ A;  2VG6 A;  2G8I A;  3TAF A;  1N6Q A;  1RBT A;  3AVJ A;  5I3U A;  3C6U A;  1XHZ A;  4CEO A;  3NE6 A;  4Q0B A;  1JL2 A;  3DLG A;  1JLE A;  4CJV A;  4B08 A;  4AHV A;  4CEC A;  2HHV A;  3RMD A;  4CEA A;  3JSM A;  3VQA A;  3ZT0 A;  4B8A B;  4KPY A;  4CHN A;  4HCB A;  4FJI A;  3DLK A;  4CFC A;  2HVH A;  1FKO A;  2LSN A;  3SQ2 A;  4F3O A;  4QOZ B;  4CIE A;  2RPI A;  4DS4 A;  4CF2 A;  1S1V A;  1TKD A;  3ZSR A;  1RCH A;  1KLN A;  1YT3 A;  3G0Z A;  4DTS A;  4PWD A;  2D0B A;  5K14 A;  3O3G A;  3OYM A;  1UWB A;  1TV6 A;  4RW7 A;  1S1W A;  1IG9 A;  4CJK A;  4M3W A;  1HRH A;  4FW2 A;  3L2W A;  3QIO A;  3ULD A;  4FK4 A;  1VSH A;  2VG7 A;  1TAQ A;  3L2Q A;  1JLB A;  3QNO A;  1S9E A;  4IFV A;  1F21 A;  5HRR A;  4CF0 A;  4CK2 A;  4DU4 A;  3P1G A;  1YTA A;  3KLF A;  2B6A A;  4BWJ A;  3MAQ A;  2ATQ A;  1CZB A;  4B8C A;  4FJN A;  4CFA A;  3IRX A;  4NCA A;  3MEE A;  1FK9 A;  4CGD A;  4OPK A;  3HL8 A;  3NGZ A;  3VQD A;  4CF9 A;  2HND A;  3SZ2 A;  2PYJ A;  4FM1 A;  1IO2 A;  3NF6 A;  1DTT A;  3LAM A;  4O0J A;  3AVG A;  4O4G A;  4OGE A;  4DTX A;  3RR8 A;  4OKJ A;  4F2R A;  3PO4 A;  1TKX A;  2XY7 A;  3V9S A;  3OYN A;  3O3F A;  1UOC A;  3L3V A;  4IBN A;  5KRT A;  1RTD A;  3OJS A;  3VQ4 A;  3ZSZ A;  4DFP A;  4DSL A;  1RBS A;  1XHX A;  3AVM A;  1C1C A;  2DFE A;  4B9V A;  4FW1 A;  1BIZ A;  3AA4 A;  4M3R A;  3ZSO A;  3KD1 E;  3C94 A;  3DLE A;  1JLQ A;  1JXE A;  1NK9 A;  2QXF A;  1VSI A;  4KI4 A;  2Q3S A;  2HNY A;  3DRR A;  5JS1 A;  3HXM A;  1S6P A;  1KCF A;  1SV5 A;  3QLH A;  3KTQ A;  4FJG A;  4KHU A;  4W5O A;  4J2B A;  2HHX A;  1SL1 A;  2Z1J A;  3AA3 A;  3B6O A;  4J2E A;  3LPU A;  4M42 A;  3AO4 A;  4DQI A;  5J2N A;  1NK4 A;  4KHN A;  1HNI A;  1RDC A;  4I9L A;  3B6P A;  4AH9 A;  4O5B A;  3V81 A;  4N56 A;  2OZS A;  3HVR A;  3K2P A;  4CED A;  4C8K A;  1WAF A;  1RT1 A;  4RW8 A;  3VN5 A;  3VQQ A;  3AVA A;  4N47 A;  4DTM A;  3AVF A;  4DMN A;  4CHY A;  4O0I A;  4DU1 A;  2O4I A;  5CZ2 A;  5SWM A;  3V9X A;  2EX3 A;  4DQS A;  1NOY A;  1ZBI A;  2JGU A;  4DLG A;  4AIL C;  3IAY A;  4KHW A;  4DTU A;  1B92 A;  3H08 A;  3MEG A;  1WSJ A;  1NK8 A;  5J1E A;  1Q9X A;  3MEC A;  5KTQ A;  1VRU A;  3LP2 A;  4R5P A;  3RRH A;  1JXB A;  2IDO A;  5J2P A;  3WNG A;  3NCI A;  1NK6 A;  3LWL A;  2G8W A;  3C95 A;  4KFB A;  4CGG A;  4CIF A;  3I8D A;  4IFY A;  3VA0 A;  3SJJ A;  1L3T A;  1RDD A;  3QNN A;  1RT7 A;  4KHY A;  3OS2 A;  2G8K A;  4FJ9 A;  1GOC A;  1HMV A;  3IG1 A;  5C24 A;  1J54 A;  3OY9 A;  1ASU A;  4E7J A;  1UA0 A;  3KD5 E;  3HST B;  1WSI A;  1NKE A;  2O4G A;  1QSS A;  4EZ6 A;  2KZM A;  3LP3 A;  4FLT A;  1NJW A;  4CJ4 A;  3K5M A;  4OVL A;  3SQ1 A;  5SZT A;  4CE9 A;  1RT5 A;  2YV0 X;  5KGX A;  4W5Q A;  4BAC A;  1LWC A;  5CY4 A;  2PYL A;  4Y1C A;  4B9T A;  2HB5 A;  1YTU A;  1L5U A;  1KFD A;  4Z4I A;  1EP4 A;  3JYT A;  3P5J A;  3FFI A;  2KW4 A;  1NJZ A;  2G8F A;  4QAG A;  3AO1 A;  4KHQ A;  1RBV A;  4CGH A;  1WSH A;  4CJP A;  3M8S A;  5J2M A;  1I39 A;  4MQ3 A;  4H4M A;  4K8X A;  3AVI A;  3AA5 X;  3LDS A;  1HNV A;  3KLH A;  4FK2 A;  3SUQ A;  1REV A;  1RT6 A;  1UAX A;  2OPP A;  2VWK A;  2XY8 A;  5KGW A;  3LWM A;  1SL2 A;  2OPR A;  3DM2 A;  4CFD A;  1T7P A;  2Z1H A;  4AHS A;  5DMR A;  3VQ5 A;  2X78 A;  2YHA A;  2IGI A;  4PA1 A;  3OYH A;  3QER A;  4F4K A;  2A1S A;  4ELV A;  1TK0 A;  1L3S A;  4KB1 A;  2P51 A;  2IOC A;  2YNI A;  2E6M A;  3OVN A;  4DF8 A;  2PY5 A;  3O4Q A;  3VQE A;  3IS9 A;  4C8O A;  2FBX A;  4FLV A;  4F2S A;  1IH7 A;  1RTI A;  5CYM A;  5JS2 A;  1KLM A;  4DG1 A;  3MXM A;  1LW0 A;  4HUE A;  3CYM A;  1WAJ A;  1D9D A;  4DSK A;  1SKR A;  3L2U A;  4W5R A;  5DK5 A;  1L3U A;  1HQU A;  1X9S A;  2F8T A;  2HHQ A;  3TAE A;  3VQC A;  2EHG A;  1S6Q A;  1XWL A;  4GMJ B;  1K6Y A;  1TAU A;  1U45 A;  3RWU A;  2RKI A;  4DS5 A;  5CZ1 A;  4GVM A;  1TL1 A;  4LSL A;  2XY5 A;  3L2V A;  1RDA A;  1WSE A;  3LAK A;  4AHR A;  4NCB A;  1KSP A;  4M3Y A;  1VK0 A;  4IKF A;  1U47 A;  3UIQ A;  2F96 A;  3M8P A;  2HHS A;  4AHC A;  4HHT A;  2HHW A;  3SNN A;  4CEF A;  3ZSW A;  1FXX A;  1U48 A;  4Y1D A;  4CJ5 A;  1IKV A;  4M3X A;  3VQ7 A;  1QE1 A;  2OA8 A;  4XIU A;  3RR7 A;  3VQ6 A;  1RT4 A;  3ISN C;  1HYZ A;  3ZT3 A;  3KIO A;  3OS1 A;  4Z4C A;  3CFR A;  4JS5 A;  2BAN A;  3V9W A;  4GW6 A;  4DTR A;  1LWF A;  4CER A;  4CF1 A;  2KFN A;  1J53 A;  4RW6 A;  4FZX C;  1KVA A;  4ICL A;  4KI6 A;  2ZE2 A;  4DFJ A;  4IG3 A;  3HK2 A;  4DTP A;  1DLO A;  1KFS A;  1C6V A;  4KKO A;  2IC3 A;  4CJL A;  4RW9 A;  1YVU A;  4FM0 A;  5C42 A;  1QS4 A;  3WNH A;  4DSJ A;  1NOZ A;  2DFF A;  4CJW A;  3TAP A;  2X74 A;  1EET A;  2XRI A;  1ZBL A;  4PUO A;  4Z4F A;  3SUN A;  4EZ9 A;  3L2R A;  3WNF A;  5D3G A;  3CM6 A;  4I2Q A;  3OYI A;  1N5Y A;  4E19 A;  5EU7 A;  1X1P A;  1LWE A;  3OYK A;  4FM2 A;  3SV3 A;  4HUF A;  2Y1I A;  4KB0 A;  1BCO A;  1JKH A;  1S1U A;  2G8U A;  5FRO A;  3G10 A;  3S3N A;  3OYE A;  3SUP A;  4E7L A;  4DF4 A;  4CGJ A;  2DY4 A;  4N5S A;  1IKW A;  4K8Z A;  4CHO A;  1RBU A;  3K5L A;  4CK3 A;  3L3U A;  3VQ9 A;  3K59 A;  4DTJ A;  4DSI A;  1J9A A;  1BL3 A;  2ETJ A;  4YFU A;  4CHZ A;  1HYV A;  1KTQ A;  1BGX T;  3ASM A;  3LPT A;  3NF7 A;  1SL0 A;  3KK3 A;  4E0D A;  4QCL A;  1DTQ A;  2GV9 A;  5HRS A;  4FYD A;  3BGR A;  4KHS A;  1LAW A;  4F3T A;  1QSY A;  3NAE A;  3U6F A;  4B9N A;  4CCH A;  1EX4 A;  1LW2 A;  2WOM A;  1QTM A;  4FK0 A;  5I42 A;  4E7H A;  3QEP A;  2GBZ A;  3QEV A;  1KRP A;  4CGF A;  5KRS A;  4CFB A;  4M3U A;  5FRM A;  2IS3 A;  1ASW A;  4Z0U A;  3D0P A;  3QEX A;  2F8S A;  2KQ2 A;  1G15 A;  3AVL A;  1O1W A;  2BGG A;  3EZ5 A;  2G8V A;  4FJ7 A;  3U3G A;  3T1A A;  3NFA A;  2D0C A;  2HNZ A;  2I5J A;  1BHL A;  3NF8 A;  4BE2 A;  2KZZ A;  1BIU A;  3PV8 A;  1VSD A;  1W0H A;  1ITG A;  3BDP A;  4CES A;  3AVH A;  4BWM A;  4IG0 A;  3KLG A;  3SCX A;  4PQU A;  3NF9 A;  4FJX A;  1NJX A;  4OGC A;  3DLH A;  3TR8 A;  3LZJ A;  4FJM A;  1RT2 A;  4AHT A;  2A1R A;  1ZBU A;  4FZY A;  3NGY A;  3DRP A;  1BCM A;  1C0U A;  2NUB A;  1S5J A;  1FKP A;  3NHG A;  3SPY A;  1R0A A;  1A5W A;  1C0M A;  3NBP A;  1SKW A;  3NGI A;  4WE1 A;  4H8K A;  3V1Q A;  3M8R A;  3QEW A;  1XI1 A;  1VSE A;  3DRS A;  4KRE A;  4EP5 A;  2D5R A;  1QHT A;  2YKN A;  4OKE A;  3HM9 A;  3DLR A;  4DQR A;  3AVN A;  2FBT A;  2GUI A;  3TAR A;  4E1N A;  3AO5 A;  2YNF A;  3ZSV A;  1C0T A;  4EP4 A;  4CJQ A;  1SKS A;  2HHT A;  4BDZ A;  1TVR A;  1Q8I A;  3OYL A;  4B9U A;  3AVC A;  1D5A A;  2R7Y A;  4NYF A;  4CJU A;  1HJR A;  1BQM A;  2AJQ A;  1NKC A;  4FVM A;  3E01 A;  1RTH A;  4L8R B;  4CJE A;  4W5T A;  1NK5 A;  4ID1 A;  3AVK A;  2OYQ A;  2E6L A;  2XHB A;  1WSF A;  3MED A;  3S3O A;  4J2A A;  2DTU A;  1VSM A;  5HLF A;  3VQP A;  1ZBH A;  2PZS A;  1BI4 B;  4Z4E A;  3HPH A;  5CYQ A;  4DWI A;  3CM5 A;  4HTU A;  3NDK A;  1VRT A;  4AHU A;  4B9S A;  2BE2 A;  4FLU A;  4JLH A;  4CEE A;  3TAQ A;  4BE0 A;  1Z26 A;  5HP1 A;  3TWH A;  4LY7 A;  4CEQ A;  2ZD1 A;  3SQ0 A;  4OJR A;  4CJS A;  4CK1 A;  4E1M A;  1NK0 A;  1S9G A;  1Y97 A;  4I9Q A;  4ELT A;  4FJ5 A;  5T7B A;  4HVJ A;  5HRO A;  1S1X A;  2DFH A;  2IAJ A;  4UQG A;  1T8E A;  2XY6 A;  3NH2 A;  1KVC A;  3KJV A;  3ZT1 A;  1X9M A;  3DOK A;  1RT3 A;  3CQ8 A;  3HPO A;  1HYS A;  3I0S A;  3M8Q A;  3AV9 A;  2BDP A;  1LAV A;  3A2F A;  4E7K A;  4E7I A;  4O44 A;  2D0A A;  3OYB A;  1BIS A;  3PUF A;  3KLE A;  4JRQ A;  3I0R A;  3QO9 A;  1BI4 A;  3ZT2 A;  1A5X A;  1Q9Y A;  3ALY A;  4DFK A;  3HPG A;  2YHB A;  1XC9 A;  3V9Z A;  4FJ8 A;  1I3A A;  3F73 A;  3PO5 A;  4DLE A;  3K58 A;  1GOB A;  2KFZ A;  1T05 A;  4C8N A;  4LD0 A;  4M41 A;  1WLJ A;  3SPZ A;  3OYD A;  3K5O A;  2HHU A;  2P1J A;  3V1O A;  3RMC A;  3NH0 A;  1J5O A;  3O4N A;  3P83 D;  2X6N A;  3HO1 A;  4IDK A;  4NCG A;  3ZSX A;  4KTQ A;  2X6S A;  5FDL A;  3QIN A;  4DTN A;  4JS4 A;  4H4O A;  2VG5 A;  4RG8 A;  1JLC A;  3DOL A;  3ZSY A;  3V9U A;  1TK5 A;  3SI6 A;  1TK8 A;  2QKK A;  3V1R A;  4ZHR A;  4N76 A;  1LV5 A;  4N41 A;  4CJ3 A;  3QEI A;  1TKZ A;  4Q5V A;  1T03 A;  2YKM A;  4I7F A;  4FLZ A;  4CHP A;  3RRG A;  1NJY A;  2HMI A;  1X9W A;  2FBY A;  3ZCM A;  3ITH A;  4CJT A;  4LH4 A;  1WSG A;  3PX4 A;  1JLA A;  1QSL A;  4YNQ A;  4FJH A;  3MXJ A;  4ID5 A;  1U49 A;  1KVB A;  1D8Y A;  1ZBF A;  3QET A;  5HRN A;  4OPJ A;  1HPZ A;  2YNH A;  3F9K A;  3KK2 A;  1RTJ A;  4HCC A;  3HVT A;  2B5J A;  3SYZ A;  1A5V A;  3TAG A;  4FXD A;  3EY1 A;  4M3T A;  1W9H A;  3C6T A;  3RMA A;  1EKE A;  1B9D A;  2Z1G A;  2QKB A;  4CJF A;  3TI0 A;  1NK7 A;  3KKS A;  4TSX A;  1HQE A;  4M45 A;  4FLW A;  3K57 A;  3SUO A;  3THV A;  4LSN A;  1JL1 A;  4DU3 A;  1WNS A;  2G8H A;  3VQB A;  4FZZ A;  2OPS A;  4W5N A;  3PY8 A;  3OYF A;  2OZM A;  2XO7 A;  3OYA A;  4Z4H A;  4KTZ A;  2HVI A;  4DQP A;  3LAN A;  2B4J A;  4KRF A;  3VA3 A;  3TAB A;  4CJR A;  1U04 A;  4CEZ A;  1VSF A;  1ASV A;  4LH5 A;  4MFB A;  1JLF A;  3AA2 A;  4KV8 A;  4CF8 A;  3OYC A;  4F8R A;  3PX0 A;  1VSK A;  4G1Q A;  3TAM A;  2HW3 A;  4NYN A;  2ITG A;  3QIP A;  3S9H A;  3ZT4 A;  3CFP A;  1ZYQ A;  1RIL A;  1EXQ A;  1BQN A;  3OS0 A;  3CFO A;  4OLA A;  3KLI A;  3EYZ A;  5HRP A;  2QK9 A;  1TKT A;  2JLE A;  4O55 A;  5KI6 A;  4FLX A;  3AO3 A;  3SV4 A;  3TAN A;  4ZTF A;  3DLB A;  2P5O A;  4KO0 A;  3HP9 A;  1QQC A;  2Z1I A;  1C1B A;  4M3Z A;  4I2P A;  4ZTJ A;  1TGO A;  5E41 A;  3MXI A;  1C1A A;  2FC0 A;  4CIG A;  3LAL A;  1JLG A;  4DSF A;  1TL3 A;  4KTW A;  5HBM A;  4DSE A;  1D9F A;  4BE1 A; 
#chains in the Genus database with same CATH topology
 2ZF5 O;  1CLQ A;  3EL2 A;  3HJF A;  2BH1 A;  3HYF A;  3U3Y A;  2O8E A;  1EO1 A;  4E3S A;  4LF4 K;  4OLB A;  1U4B A;  3TTD A;  4AQY K;  1GOA A;  2P9I B;  4J2D A;  3HP6 A;  5J2Q A;  4OKK A;  4CZM A;  3MN9 A;  4RW4 A;  4B3O A;  4CEB A;  4NB4 A;  3MWT A;  4DUY K;  3NH1 A;  2VWJ A;  1NKB A;  1MU2 A;  3CER A;  3OYG A;  4XH5 A;  4FLY A;  4PY5 A;  1IKX A;  1RDB A;  3LM9 A;  2P5G A;  3IUC A;  4LC9 B;  3KK1 A;  3VQ8 A;  1L3V A;  3DMJ A;  1XHZ A;  4CEO A;  3CJB A;  3NE6 A;  4IZ9 A;  2HHV A;  4AHV A;  4OO1 J;  2P9I A;  2LSN A;  5KQ8 A;  4F3O A;  1YT3 A;  3G0Z A;  2D0B A;  4A2A A;  5M1N A;  5FLX O;  3O3G A;  1UWB A;  1TV6 A;  3O9U A;  1IV0 A;  1IG9 A;  3UB5 A;  3L2W A;  3ULD A;  1VQ7 N;  1HNW K;  2VG7 A;  4H5R A;  3IKM A;  4EFH A;  3BUZ B;  5HRR A;  3VGM A;  3MAQ A;  2Q0R A;  4ISG A;  4B1W B;  4CFA A;  1V4T A;  1J5E K;  4NCA A;  4H0V B;  2QXL A;  3NGZ A;  3VQD A;  5AQH A;  2HND A;  1OH8 A;  2PYJ A;  1IO2 A;  4O0J A;  4BVO A;  2IVP A;  3FGU A;  3CCJ N;  3MK6 A;  4IBN A;  5KRT A;  5E84 A;  3OJS A;  1IBM K;  1MDU B;  4YOR A;  1GLA G;  1C1C A;  4DV3 K;  3TSQ A;  1BIZ A;  1E4G T;  3OTO K;  1NMN A;  3ZLJ A;  4BRC A;  3WXJ A;  1JXE A;  2VCP A;  4KI4 A;  4H5V A;  3DRR A;  4DR2 K;  4X62 K;  1S6P A;  4FWM A;  4JKH A;  1YVN A;  3AA3 A;  1YJ9 N;  1QZ6 A;  5BRE A;  4O5B A;  1J6Z A;  4IEI A;  3V81 A;  3FFK B;  3J80 O;  2OZS A;  4C8K A;  1M90 O;  3BP8 A;  2O4I A;  1ZBI A;  4DV0 K;  2QWP A;  2O8C B;  2QM1 A;  5J2P A;  4LF9 K;  2IDO A;  1BDG A;  4WQ4 C;  3SLC A;  3WNG A;  3I8D A;  4CIF A;  2OTJ N;  3VGK A;  4IFY A;  3VA0 A;  3O6W A;  3QNN A;  4KHY A;  2ZJQ L;  2G8K A;  1GOC A;  3IG1 A;  2YHY A;  5C24 A;  3OY9 A;  4E7J A;  3BZK A;  2CGL A;  1W7A A;  3HST B;  4DR3 K;  5AFU H;  4JKF A;  4FLT A;  1WBD A;  1NJW A;  3SQ1 A;  2KHO A;  5JLF A;  4BAC A;  2VYP A;  1N34 K;  1L5U A;  4Z4I A;  3SMS A;  2J4R A;  2KW4 A;  2O8C A;  4YDU A;  4CJP A;  5J2M A;  3AVI A;  1S72 N;  3SJH A;  4JI5 K;  1MA9 B;  3MMV A;  4AM6 A;  3LWM A;  2G8I A;  2OPP A;  5C0Y A;  3PSF A;  2OPR A;  4CFD A;  5ADX A;  5DMR A;  2X78 A;  4PA1 A;  1YAG A;  3I33 A;  2A1S A;  1ESV A;  4BR0 A;  2P51 A;  4C8O A;  3O4Q A;  3VQE A;  3IS9 A;  3MXM A;  1KLM A;  4HUE A;  1RGI A;  1TYQ B;  2HHH K;  4DSK A;  1SKR A;  3L2U A;  4F9O A;  5HL7 L;  3ZYY X;  5AR0 A;  5AZI B;  2EHG A;  3M5R A;  4GMJ B;  1ATN A;  3HI0 A;  3RWU A;  3G6E N;  3CCE N;  5CZ1 A;  4GVM A;  2XY5 A;  4KH6 A;  3L2V A;  2CH6 A;  3ID8 A;  3JAM O;  1KSP A;  4M3Y A;  3KHY A;  3MX2 A;  1DEJ A;  3C65 A;  4Y1D A;  1IKV A;  2GWK A;  1TYQ A;  1G99 A;  1MWK A;  1HKC A;  3VPZ A;  4CZE A;  3OS1 A;  3ZT3 A;  4DKW A;  3CFR A;  2G8H A;  2BAN A;  5BRF A;  4GW6 A;  5AZI A;  3V9W A;  1J53 A;  4GV9 A;  2GUP A;  4ICL A;  4DFJ A;  3M3Z A;  1VQK N;  3AAQ A;  3EO3 A;  4CJL A;  1C0F A;  4EZ9 A;  3L2R A;  3OYI A;  1NG9 A;  1N5Y A;  3OYK A;  4JEP A;  3SV3 A;  4DR1 K;  2GTD A;  1BCO A;  1JKH A;  1S1U A;  3S3N A;  3CF5 L;  3OYE A;  2DY4 A;  3ENB A;  1ATS A;  4N5S A;  1RBU A;  3K5L A;  3L3U A;  4FWR A;  2ETJ A;  5AQI A;  3G4S N;  1K73 O;  1HYV A;  1KTQ A;  3NF7 A;  3ASM A;  5JVG L;  4IOA L;  4BQL A;  4YY3 K;  1DTQ A;  5HRS A;  3BGR A;  3CJ7 A;  4F3T A;  1QSY A;  3U6F A;  1GLF O;  3CC2 N;  2WOM A;  2CGJ A;  3E1Y A;  4Z0U A;  2HST A;  4U67 L;  1G15 A;  1Q86 O;  3EZ5 A;  4FJ7 A;  1LCU A;  3U3G A;  3T1A A;  3T1Y K;  1HLU A;  3NVK A;  2I5J A;  1VSD A;  1W0H A;  5DM7 L;  3KLG A;  3SCX A;  3NF9 A;  1NJX A;  5E26 A;  2VGN A;  1RT2 A;  4AHT A;  2A1R A;  2FLO A;  3THY B;  4FZY A;  1R59 O;  1BU6 O;  1S5J A;  3NHG A;  4ISE A;  3WEE B;  3CPE A;  1YI2 N;  3QEW A;  3VEO A;  4B1Z A;  2FSN A;  1EWQ A;  4MDB A;  4FOE A;  3HM9 A;  3DLR A;  3VF2 A;  4E1N A;  1C0T A;  4BDZ A;  3OYL A;  4B9U A;  3AVC A;  3CME N;  3TSP A;  3DAW A;  1BQM A;  3EE8 A;  2AJQ A;  3E01 A;  3WQT A;  2OCE A;  1KAZ A;  4W5T A;  1NGI A;  3THY A;  3S3O A;  5LJW A;  5HLF A;  3WEE A;  5CYQ A;  3NDK A;  1VRT A;  4AHU A;  4B9S A;  2HOE A;  2RE2 A;  1NM1 A;  5HP1 A;  1VQ8 N;  2Q0U A;  3EKS A;  4IOX A;  1S9G A;  2IVN A;  4BC5 A;  1YJN N;  2JWL A;  1NGF A;  3ZT1 A;  2F9W A;  3DOK A;  4JNE A;  1RT3 A;  3CQ8 A;  4JV5 K;  1HYS A;  4DR7 K;  4IOC L;  3AV9 A;  1NBW A;  4B1U B;  4O44 A;  2D0A A;  1BIS A;  3KLE A;  4BGB A;  4MDA A;  5ADX H;  3ZT2 A;  3BF3 A;  3VF6 A;  4DFK A;  1RDU A;  3F73 A;  4DLE A;  3K58 A;  1T05 A;  3SPZ A;  3OYD A;  3CQX A;  3NH0 A;  2P9U B;  3O4N A;  3P83 D;  3AGR A;  2UXD K;  4YOU A;  3QIN A;  1XMQ K;  4DTN A;  5EY4 A;  4RG8 A;  2W41 A;  4CZI A;  1LV5 A;  4N41 A;  4CJ3 A;  4CHP A;  4A5A A;  3ITH A;  4LH4 A;  5BN9 A;  3MXJ A;  4ID5 A;  1U49 A;  5KPT A;  4OPJ A;  5GAE P;  3F9K A;  1TUU A;  1A5V A;  3TAG A;  3EY1 A;  1W9H A;  3RMA A;  1EKE A;  1B9D A;  3BF1 A;  2QKB A;  3TI0 A;  3THV A;  1QVF M;  4JI3 K;  4X65 K;  1DT9 A;  3OYF A;  4KTZ A;  3DJC A;  2B4J A;  3TAB A;  3CCL N;  1GLD G;  4MFB A;  3AA2 A;  4KV8 A;  4F8R A;  1OKJ A;  3TTF A;  3C7N B;  4H0P A;  1LOT B;  3HZ6 A;  5HRP A;  4ZTF A;  4K25 A;  3TAN A;  3DLB A;  4FO0 A;  1QQC A;  2Z1I A;  4YOY A;  1XQS C;  1GLB G;  5E41 A;  3C6A A;  4V19 S;  3LAL A;  3CCV N;  1JLG A;  4KTW A;  5HBM A;  3F2K A;  1D9F A;  3H46 O;  1NGE A;  4Z4G A;  4WQ5 A;  4FPB A;  2F4V K;  2GEM A;  1N36 K;  1VQM N;  2A40 A;  3GOI A;  5BRH A;  3PX6 A;  1B9F A;  3LP0 A;  2OPQ A;  2HF4 A;  5LY3 A;  3EE9 A;  2E4L A;  3LP1 A;  2ZGZ A;  3DI6 A;  3QES A;  1CZ9 A;  3V6D A;  2Q2R A;  2WON A;  4BRH A;  3CG7 A;  3D45 A;  4C8L A;  5AQR A;  3T1H K;  5FPN A;  4CGI A;  1IG8 A;  2V51 B;  4FCY A;  3ZSQ A;  4EIA A;  1JCF A;  3OYJ A;  4DQQ A;  2E88 A;  1S1T A;  1MWM A;  4JI8 K;  4O5F A;  3RTV A;  4A62 A;  1EWR A;  3TU5 A;  3TAF A;  3QIC A;  1JL2 A;  3DLG A;  3RMD A;  3JSM A;  1VHX A;  3ZT0 A;  4O8K A;  4CHN A;  4FJI A;  4HCB A;  4CF2 A;  1S1V A;  2P9K A;  3ZSR A;  1RCH A;  1QQN A;  3D2E B;  4PWD A;  4H5W A;  3OYM A;  4RW7 A;  3LDL A;  4CJK A;  4FW2 A;  3QIO A;  5C10 A;  1TAQ A;  3VES A;  3L2Q A;  3QNO A;  4IFV A;  3H3O B;  1F21 A;  5AJ3 K;  1KQS M;  5KQD A;  1GLC G;  4CK2 A;  2YHW A;  3KLF A;  2B6A A;  1N32 K;  1CZB A;  5JMV A;  3IRX A;  1VQO N;  1FK9 A;  4CGD A;  4OPK A;  2NRR A;  3CI5 A;  4CCH A;  4RCH A;  5HOO A;  3AVG A;  4DTX A;  4OKJ A;  4F2R A;  1HKB A;  2XY7 A;  2O8D A;  3D2E A;  3OYN A;  4M63 C;  3O3F A;  1HX1 A;  4CZG A;  4DFP A;  2PAV A;  3EEQ A;  1RBS A;  4BC2 A;  2GEL A;  3KWG A;  4M3R A;  3KD1 E;  3CCQ N;  3SAF A;  5GAH P;  1X9J A;  3C94 A;  3DLE A;  3CMA N;  1NK9 A;  1NGB A;  4DR5 K;  5AQZ A;  3EZW A;  2Q31 A;  3HXM A;  3IDH A;  1KCF A;  3QLH A;  5AQM A;  4KHU A;  4GV3 A;  4W5O A;  4J8F A;  2QWO A;  1XNR K;  3AO4 A;  3O9R A;  1NK4 A;  1VAZ A;  4DQI A;  1HNI A;  1RDC A;  4I9L A;  2QTD A;  1IBK K;  4PKI A;  3K2P A;  3VN5 A;  1NGG A;  1RT1 A;  3OBW A;  4N47 A;  3ZET B;  1ILY A;  4CHY A;  5CZ2 A;  1U2V B;  1YHQ N;  3RSE B;  4WQ5 C;  1Q9X A;  3MCP A;  5KTQ A;  1NK6 A;  2I7P A;  2G8W A;  3LWL A;  3LDN A;  4KFB A;  4CGG A;  3A0I X;  3SJJ A;  1RT7 A;  3OS2 A;  1HMV A;  1QSS A;  3LP3 A;  1HNZ K;  5SZT A;  4W5Q A;  1RT5 A;  4H0Y B;  2FF3 B;  3FZH A;  1LWC A;  4JK9 A;  4Y1C A;  3ZET A;  4B9T A;  1KFD A;  3CJ1 A;  1U2V A;  3FE1 A;  3P5J A;  3FFI A;  3RSE A;  5ELZ A;  4QAG A;  4CZF A;  1XC3 A;  1QZ5 A;  4KHQ A;  3C0B A;  1WSH A;  1ZC6 A;  1I39 A;  2D4W A;  4K8X A;  1HNV A;  4FK2 A;  3B8A X;  5BR9 A;  1REV A;  2XY8 A;  5KGW A;  3SUQ A;  4CD1 A;  1IBL K;  2Z1H A;  3VQ5 A;  2YHA A;  3FZF A;  2A42 A;  4ELV A;  2FSK A;  5AQY A;  3TSU A;  4WFA L;  1L3S A;  4KB1 A;  2E6M A;  2PY5 A;  2FBX A;  1RTI A;  3MCA B;  5CYM A;  1LW0 A;  1KXP A;  2UU9 K;  4W5R A;  5DK5 A;  1X9S A;  3L4I A;  2HHQ A;  5AQL A;  1XWL A;  4LSL A;  1RDA A;  3LAK A;  4AHR A;  1X3N A;  4AM7 A;  4OPH A;  5TKY A;  2F96 A;  1NNE A;  4HHT A;  3SNN A;  4FWP A;  3GG4 A;  3ZSW A;  1FXX A;  3HOT A;  1U48 A;  4CJ5 A;  3M1F A;  1QE1 A;  3VQ6 A;  1HYZ A;  4JS5 A;  4DTR A;  1LWF A;  4CF1 A;  4FZX C;  2KKZ A;  3VEW A;  1KFS A;  1C6V A;  2ASO A;  4KKO A;  1HKG A;  4X66 K;  1QS4 A;  3WNH A;  1NOZ A;  2DFF A;  3TAP A;  4Z4F A;  2XRI A;  4PUO A;  1CZA N;  4LF8 K;  3WNF A;  3CM6 A;  3LL3 A;  3J81 O;  2AA4 A;  5F0X A;  4E19 A;  1X1P A;  2F7T A;  2G8U A;  5FRO A;  3G10 A;  3A5N C;  4E7L A;  4CHO A;  5EXW A;  4CK3 A;  3O4W A;  3K59 A;  3MN6 A;  5FPD A;  1BL3 A;  2ZJR L;  2FXU A;  3LPT A;  3KK3 A;  4QCL A;  3QB0 A;  4FYD A;  4KHS A;  5C15 A;  4JKD A;  4LFC K;  4FK0 A;  5I42 A;  4E7H A;  1KRP A;  4M3U A;  5TKW A;  2F8S A;  2KQ2 A;  2BGG A;  1O1W A;  2E2Q A;  2D0C A;  2UUC K;  2YI1 A;  2KZZ A;  4DUZ K;  3QFU A;  1ITG A;  4CES A;  1Z05 A;  3P38 A;  3L6Q A;  4IG0 A;  4YHH K;  3O1B A;  4BRN A;  2Q1N A;  4OGC A;  4FJM A;  3ENH A;  1V4S A;  3DRP A;  1BCM A;  1C0M A;  3NBP A;  3THW B;  1SKW A;  2UUA K;  4DV5 K;  4KRE A;  1JJ2 M;  4EP5 A;  3SMP A;  2YKN A;  1JCG A;  3AVN A;  2GUI A;  2QW9 A;  4ILJ A;  5AQV A;  4EP4 A;  1Q8I A;  4CJU A;  4B1Y B;  5BR8 K;  3JXU A;  1DKG D;  1NKC A;  4BRA A;  4JAX A;  3QDK A;  2NRT A;  4CZL A;  1NK5 A;  2DTU A;  3LDP A;  5CHI A;  3VQP A;  1BI4 B;  3U8X A;  3THW A;  3CM5 A;  2BE2 A;  4FLU A;  4CEE A;  3TAQ A;  4LY7 A;  4NXN K;  3SQ0 A;  3MX5 A;  4BC4 A;  3VMF B;  4I9Q A;  3VTH A;  4FJ5 A;  5T7B A;  4HVJ A;  1WBB A;  1S1X A;  2IAJ A;  1NMD A;  4UQG A;  3U9Z A;  4DHY A;  4ISF A;  1KVC A;  2A41 A;  3KJV A;  3CCM N;  3PSI A;  3K9J A;  3HPO A;  4CW7 B;  3A2F A;  4HWI A;  4JN4 A;  3HOS A;  4E7K A;  4GVE A;  4JKE A;  1BI4 A;  2VWB A;  3ALY A;  3HPG A;  2YHB A;  1XC9 A;  3AAP A;  3V9Z A;  4FWN A;  3PO5 A;  2UUB K;  4M41 A;  2IIR A;  5M1O A;  4DQ8 A;  4NCG A;  3ZSX A;  2X6S A;  5FDL A;  4JS4 A;  1TK8 A;  3SI6 A;  3VEN A;  3VEX A;  3CCS N;  1BO5 O;  4FWQ A;  4ZHR A;  3QEI A;  4A2B A;  1T03 A;  2YKM A;  4I7F A;  1N8R O;  4MO5 A;  3RRG A;  2HMI A;  1X9W A;  3OBY A;  5AQX A;  4EHT A;  3PX4 A;  5H1S Q;  5HRN A;  2NLX A;  2B5J A;  4BC3 A;  3PIO L;  2Z1G A;  5AQO A;  3AY9 A;  1NK7 A;  3H1V X;  5IWA K;  1K8A O;  1WNS A;  1NGC A;  4FWL A;  4B1X B;  3WT0 A;  2HVI A;  4JK7 A;  4DQP A;  3R6M A;  5AQG A;  4GKK K;  4CEZ A;  1HNX K;  4LH5 A;  1VSF A;  1ASV A;  3J8A A;  3Q7C A;  4H5N A;  1I94 K;  1VSK A;  4DV7 K;  4FSV A;  4NYN A;  2ITG A;  3ZT4 A;  3CFP A;  1ZYQ A;  1T44 A;  3KLI A;  5LMN K;  2W40 A;  4FLX A;  3ENO A;  1C1B A;  1SQK A;  2WBN A;  3VEY A;  4M3Z A;  4ZTJ A;  1TGO A;  3MXI A;  4CZK A;  2FC0 A;  4YDU C;  3GL1 A;  4DSE A;  3U9D A;  3F5T A;  4BE1 A;  4JKA A;  3SK3 A;  3VTI A;  3CC4 N;  2W42 A;  1JCE A;  5AQT A;  2UXC K;  1WN7 A;  4LFB K;  1VSL A;  3T19 A;  2YNG A;  5KPZ A;  3RMB A;  1VQ4 N;  3HT3 A;  4CHQ A;  4PKG A;  2ZQB A;  5C25 A;  4IO9 L;  4ELU A;  3WXI A;  1SUQ A;  1KAY A;  4C8M A;  1Z25 A;  3LZI A;  1KC8 O;  1D4X A;  4IWV A;  2FBV A;  4KAZ A;  3V4I A;  1QQO A;  3I55 N;  4FJK A;  3N4Q A;  4BGA A;  4E1J A;  3OJU A;  2ZJP L;  3SQ4 A;  4JRP A;  1IKY A;  5CE3 A;  5FRN A;  3WNE A;  1VSJ A;  3H45 C;  3S3M A;  1Q81 O;  1CXQ A;  3CD6 N;  3CXC M;  2BUP A;  1RNH A;  2RN2 A;  4E89 A;  3IFR A;  2VG6 A;  3R1X A;  1N6Q A;  1RBT A;  3K0S A;  3IMX A;  1JLE A;  4B08 A;  4CEC A;  4KPY A;  4CEA A;  3VQA A;  4B8A B;  3DLK A;  4CFC A;  4PHT X;  2HVH A;  1FKO A;  3SQ2 A;  4CIE A;  4JKG B;  1TKD A;  3CQY A;  5K14 A;  2I7N A;  1ATR A;  1S1W A;  5MLC Q;  4M3W A;  1S9E A;  3A5L C;  2A5X A;  4DU4 A;  1BG3 A;  1YTA A;  4JI1 K;  2ATQ A;  3P31 A;  4B8C A;  3S41 A;  4FJN A;  1W97 L;  3FR0 A;  4CF9 A;  3SZ2 A;  1IJJ A;  1VQL N;  4FM1 A;  5FPM A;  3HRG A;  4GNI A;  3KWI A;  5BPM A;  4JKG A;  3PO4 A;  2QWN A;  3A5O C;  3O1W A;  3EN9 A;  4BR7 A;  2ZM6 K;  1XMO K;  3OW2 M;  2AP1 A;  3SAH A;  1UOC A;  3L3V A;  3VQ4 A;  3ZSZ A;  4DSL A;  2P9U A;  3O9Q A;  3E9L A;  4B9V A;  4FW1 A;  3AA4 A;  4YOT A;  3ZSO A;  1FW6 A;  2V7Z A;  4BRQ A;  4BRL A;  1JLQ A;  3DXM B;  2QXF A;  1VSI A;  5M1P A;  1EQY A;  5JS1 A;  4BRD A;  5IT9 O;  2QWL A;  4J2B A;  1SL1 A;  4CBW A;  4K0K K;  3LPU A;  5AQW A;  5J2N A;  4B3M K;  3BZC A;  3JS6 A;  4KHN A;  3B6P A;  4CVN E;  2NZT A;  3NMU A;  1WAF A;  4A61 A;  4RW8 A;  1YIJ N;  3VQQ A;  3AVA A;  4DTM A;  4DMN A;  4DU1 A;  5SWM A;  4B9Q A;  2EX3 A;  4JI0 K;  1NOY A;  2JGU A;  2YJE A;  3IAY A;  3H08 A;  3GBT A;  3MEG A;  3WXM B;  1WSJ A;  3THX B;  1NK8 A;  3HBT A;  4B3S K;  3DXM A;  1RFQ A;  3LP2 A;  4FJG A;  1U6Z A;  5AQN A;  3RRH A;  1H1V A;  3C95 A;  3L4Q A;  4IJA A;  4KHP K;  1NWK A;  4JI2 K;  1T3V A;  4FJ9 A;  3KD5 E;  1J54 A;  1ASU A;  1UA0 A;  1NU0 A;  1WSI A;  4O8U A;  4EZ6 A;  2KZM A;  3C7N A;  3K5M A;  1VQN N;  4H0X B;  1P90 A;  2ITM A;  5CY4 A;  2PYL A;  2P9N B;  4FL9 A;  1NGJ A;  2WFB A;  3JYT A;  2G8F A;  1NJZ A;  3THX A;  3AO1 A;  4CGH A;  2VQE K;  2NRZ A;  4L3Q A;  3M8S A;  4MQ3 A;  4H4M A;  3WXL A;  3AA5 X;  3MN5 A;  4WFN L;  3KLH A;  1KD1 O;  1RT6 A;  2VWK A;  4H5T A;  3U4L A;  4BRI A;  3OYH A;  2IGI A;  5KPR A;  2BTF A;  2CH5 A;  2IOC A;  2YNI A;  4DF8 A;  1S22 A;  1IH7 A;  5JS2 A;  4DG1 A;  2KLA A;  1WAJ A;  1D9D A;  3CHW A;  1L3U A;  1GLL O;  4M7X A;  3TAE A;  4KBO A;  3KK7 A;  3VEV A;  3EKU A;  4DV1 K;  1M1K O;  2RKI A;  3I56 N;  1TL1 A;  5EVZ A;  3UKU B;  1WSE A;  2ZGY A;  1KAX A;  4LF5 K;  2QWR A;  1VK0 A;  4IKF A;  4IXC A;  4AHC A;  4BRF A;  4CEF A;  4CJ7 A;  1ZBS A;  5LJV A;  4M3X A;  2OA8 A;  3RR7 A;  1RT4 A;  3KIO A;  3O9T A;  3Q7B A;  2KFN A;  3A8Y A;  1BUP A;  1KVA A;  4BQZ A;  4KI6 A;  1BOT O;  3HK2 A;  4H03 B;  4DTP A;  2IC3 A;  4C23 A;  3DWL A;  3UKU A;  1E4F T;  4CJW A;  2F9T A;  2X74 A;  1EET A;  1ZBL A;  2ASP A;  3SUN A;  4QS8 A;  5D3G A;  2QWM A;  1YF5 L;  2PBD A;  4FM2 A;  3CET A;  4HUF A;  4KB0 A;  4PKH A;  3LDQ A;  4CD3 A;  4K8Z A;  1YUW A;  4JD2 B;  2V7Y A;  5F2R A;  4CHZ A;  1BGX T;  2GV9 A;  3LM2 A;  3LDO A;  1LAW A;  3VGL A;  4B9N A;  1LW2 A;  3E66 A;  3QEP A;  2GBZ A;  3R3L A;  3QEV A;  5KRS A;  2IS3 A;  3MDQ A;  3D0P A;  3AVL A;  2G8V A;  1BA1 A;  3FZM A;  1BHL A;  4BE2 A;  1RDW X;  1T6D A;  3PV8 A;  4QS9 A;  3AVH A;  4BG8 A;  4BWM A;  4JD2 A;  2QWQ A;  3CJ9 A;  2E20 A;  3P39 A;  3DLH A;  5AQQ A;  2NRW A;  4ILG B;  1ZBU A;  4NLB A;  3VOV A;  2E1Y A;  1FKP A;  1A5W A;  2D1K A;  4WE1 A;  1QHA A;  4H8K A;  3M8R A;  1XI1 A;  1VSE A;  1GLJ O;  2D5R A;  5M1F A;  4KH5 A;  3AO5 A;  2YNF A;  1SKS A;  5BPN A;  4WQ4 A;  1D5A A;  2R7Y A;  4NYF A;  4K42 A;  5GAG P;  1OH7 A;  1RTH A;  4YOV A;  4L8R B;  3PIP L;  4MLE A;  3F9M A;  2OYQ A;  2XHB A;  4J2A A;  3VET A;  3FZK A;  4WFB L;  1VSM A;  5GIO A;  4I6M B;  4HTU A;  4JLH A;  4CEQ A;  2ZD1 A;  4OJR A;  4CJS A;  3L0Q A;  1Y97 A;  5HRO A;  1Q7Y O;  1T8E A;  4JYA K;  2XY6 A;  3NH2 A;  4FWO A;  3BEX A;  3H3N O;  1X9M A;  1OH6 A;  2PFU A;  3I0S A;  3M8Q A;  3N4P A;  1LAV A;  1X3M A;  3OYB A;  4JRQ A;  3HM8 A;  3PUF A;  4BR4 A;  3I0R A;  3QO9 A;  1Q9Y A;  4I6M A;  3O5B A;  5BPL A;  4FJ8 A;  5BN8 A;  2KFZ A;  1GOB A;  3WXK A;  4C8N A;  4LD0 A;  3K5O A;  5C12 A;  2P1J A;  3V1O A;  3RMC A;  4OX9 K;  1NGH A;  2X6N A;  3PLA A;  2UXB K;  3A5M C;  4IDK A;  5GIP A;  4KTQ A;  1VQ9 N;  1HPM A;  4H4O A;  1JLC A;  3DOL A;  3ZSY A;  3V9U A;  1YJW N;  1TK5 A;  2QKK A;  3H6E A;  3V1R A;  2YX6 A;  5GIN A;  1TKZ A;  4FLZ A;  3ZX0 A;  4WF9 L;  1BWF O;  4NXM K;  2FBY A;  3ZCM A;  4DV2 K;  4CJT A;  4FJH A;  4YNQ A;  1KVB A;  3G71 N;  1ZBF A;  3DLL L;  3CCU N;  3H1Q A;  3QET A;  5C2D A;  2YCH A;  3FLC O;  3KK2 A;  1RTJ A;  4KH4 A;  4AF1 A;  2P9P B;  2WUS A;  3KKS A;  2W6K A;  1HQE A;  4TSX A;  3K57 A;  4LSN A;  1JL1 A;  4RTF D;  3VQB A;  2OPS A;  2E5L K;  2O8F B;  3PY8 A;  4IEE A;  5JVH L;  2OZM A;  4YOX A;  2XO7 A;  4QS7 A;  5F1X A;  4IDH A;  1JLF A;  4Y0W A;  3PX0 A;  3TAM A;  3QIP A;  5DM6 L;  3S9H A;  1YIT N;  1EXQ A;  3CFO A;  2QK9 A;  4MLH A;  1TKT A;  4O55 A;  5KI6 A;  3SV4 A;  3AO3 A;  2P5O A;  3HP9 A;  4DR4 K;  2P9P A;  2V52 B;  3D2F B;  5JLH A;  1C1A A;  4CIG A;  3AGK A;  4JKC A;  4DSF A;  1TL3 A;  2O8F A;  2CGK A;  4JI7 K;  4DV6 K;  3R9P A;  3OA9 A;  1T6C A;  4BDP A;  4DR6 K;  1XNQ K;  3AO2 A;  4B9M A;  1SS6 A;  4HTL A;  3DYA A;  4DTO A;  5M1Q A;  3KKR A;  2HBJ A;  1ZXO A;  1CXU A;  4FJL A;  4GKJ K;  1P8Z A;  2KTQ A;  2NNW A;  1BA0 A;  4DFM A;  4CZH A;  3J7Y P;  3O3H A;  4FJJ A;  1NJI O;  1SZ2 A;  3ZX2 A;  3AVB A;  2Y1J A;  3K5N A;  3D2F A;  3T3F A;  3UKR B;  4B9L A;  1Q18 A;  2HBM A;  1HUX A;  1NLV A;  1UA1 A;  5EX5 A;  5GAD P;  4BDY A;  1RBR A;  3O9S A;  4PL8 A;  2RF2 A;  4HUG A;  4JI4 K;  4DCH A;  3KZB A;  3L8B A;  2ZWH A;  2VQF K;  3AVJ A;  4MO4 A;  3C6U A;  5I3U A;  4Q0B A;  5EOY A;  4CJV A;  2HMP A;  4QOZ B;  2RPI A;  4DS4 A;  1OH5 A;  1KLN A;  3UKR A;  4CBX A;  4DTS A;  3CIP A;  3DXK B;  3HSC A;  3C6H A;  3E9O A;  1HRH A;  3R8E A;  5AQK A;  4FK4 A;  1VSH A;  1JLB A;  4FOI A;  4K43 A;  1SAZ A;  4CF0 A;  3P1G A;  4BWJ A;  4B3R K;  3MEE A;  2NRH A;  3HL8 A;  3NF6 A;  1DTT A;  3ATV A;  3LAM A;  4O4G A;  4OGE A;  4BVP A;  3J7Z O;  3RR8 A;  4CBU A;  1TKX A;  4NO7 A;  3V9S A;  2DPN A;  3DXK A;  5LMU K;  1RTD A;  1XHX A;  3AVM A;  2DFE A;  3ZX3 A;  4LFA K;  3T69 A;  2QI2 A;  2NRX A;  2Q3S A;  2HNY A;  3ATU A;  3KTQ A;  1SV5 A;  2UYT A;  2HHX A;  4BR5 A;  2Z1J A;  3B6O A;  4J2E A;  1NGA A;  4M42 A;  3TPQ A;  4AH9 A;  3MWP A;  1WUA A;  4A59 A;  1VQ6 N;  2HBK A;  4N56 A;  3HVR A;  4CED A;  2OAN A;  3QFP A;  3AVF A;  2HF3 A;  4O0I A;  1OVQ A;  3V9X A;  5AQJ A;  4EAH D;  4DQS A;  4DLG A;  4AIL C;  4KHW A;  4DTU A;  1B92 A;  5J1E A;  3MEC A;  2FSJ A;  1VRU A;  4R5P A;  1JXB A;  4BR9 A;  3NCI A;  4B1V A;  2E2O A;  2YJF A;  3CPW M;  1L3T A;  1K9M O;  2O8B B;  2QEX N;  1RDD A;  3SBT A;  4IJN A;  4R79 A;  1NKE A;  2O4G A;  5AZJ B;  2HBL A;  4DV4 K;  4CJ4 A;  4OVL A;  4CE9 A;  2YV0 X;  5KGX A;  2HB5 A;  1YTU A;  1EP4 A;  2OTL N;  2W6L A;  1RBV A;  1S3X A;  3LDS A;  3K9K A;  1UAX A;  2RHK A;  4BRM A;  1SL2 A;  1T7P A;  3DM2 A;  2O8B A;  4RWT A;  4AHS A;  3QER A;  4C1N I;  4F4K A;  1TK0 A;  2E2P A;  5B8H A;  5AZJ A;  3OVN A;  1TUY A;  4BY9 C;  4F2S A;  4FLV A;  1FJG K;  3ID6 A;  3CYM A;  2IVO A;  1WB9 A;  1HQU A;  3VF4 A;  2F8T A;  3VER A;  3WQU A;  3VQC A;  3T7Z A;  1S6Q A;  3TTC A;  2D0P A;  1K6Y A;  1TAU A;  1U45 A;  2E8A A;  4DS5 A;  4BRO A;  2VGM A;  4FWK A;  3G25 A;  4NCB A;  4A57 A;  1C0G A;  1XUP O;  4K41 A;  1U47 A;  3M8P A;  3UIQ A;  2HHS A;  4BR2 A;  2HHW A;  3VQ7 A;  4XIU A;  3ISN C;  3MN7 A;  4IO8 A;  4Z4C A;  4CER A;  4RW6 A;  2P9L B;  2ZE2 A;  3HTV A;  4IG3 A;  1DLO A;  3O8M A;  4RW9 A;  1YVU A;  4BRP A;  4FM0 A;  5C42 A;  4DSJ A;  3CCR N;  1E3M A;  1WOQ A;  4PL7 A;  4I2Q A;  2JWK A;  5EU7 A;  4FPA A;  1LWE A;  2Y1I A;  3CC7 N;  4GV6 A;  3SUP A;  4U7B A;  4DF4 A;  4CGJ A;  1Y64 A;  1IKW A;  3FZL A;  1N33 K;  4DTJ A;  3VQ9 A;  4DSI A;  1J9A A;  4YFU A;  3OHR A;  2Q36 A;  1SL0 A;  4E0D A;  2P9L A;  3NAE A;  2D0O A;  4A5B A;  1EX4 A;  4IFE A;  1QTM A;  1QQM A;  4XH1 A;  4B3T K;  1Q82 O;  5CR4 A;  4BG9 A;  4CGF A;  3D7E O;  4CFB A;  5FRM A;  3WUH A;  3QEX A;  1ASW A;  3J7A P;  3ULE B;  2H3G X;  3NFA A;  2HNZ A;  1HJO A;  3NF8 A;  4BRK A;  1BIU A;  3AAR A;  3BDP A;  2NRV A;  2Q97 A;  4PQU A;  4FJX A;  1NGD A;  1HR0 K;  4JHD B;  3TR8 A;  3LZJ A;  4G9Z A;  4YOW A;  3NGY A;  1C0U A;  2NUB A;  1R0A A;  3SPY A;  3NGI A;  3V1Q A;  4XEI A;  3DRS A;  4BRG A;  4NLC A;  1QHT A;  4OKE A;  2FF6 A;  4DQR A;  3ULE A;  2FBT A;  3TAR A;  5M1K A;  3VEZ A;  3ZSV A;  4CJQ A;  2HHT A;  1TVR A;  2E1Z A;  3M6G A;  4XH4 A;  3SBG A;  3W0L A;  1HJR A;  4FWS A;  4OPA A;  3GE1 A;  4Z94 A;  4FVM A;  1DGK N;  4JHD A;  4CJE A;  5AQP A;  4ID1 A;  3AVK A;  2E6L A;  4H0T B;  4JI6 K;  1WSF A;  3MED A;  4CI6 A;  1ZBH A;  2PZS A;  4Z4E A;  3HPH A;  2P9K B;  4DWI A;  4BRE A;  2P9N A;  3I8B A;  3QBX A;  4BE0 A;  1Z26 A;  3TWH A;  4CK1 A;  3O80 A;  3UE5 A;  4E1M A;  5AQF A;  1NK0 A;  4ELT A;  2DFH A;  4LF6 K;  3P4I A;  4EHU A;  1O13 A;  1YXQ A;  1QVG M;  4JK8 A;  2QA4 N;  2BDP A;  4E7I A;  4GY2 B;  3D6R A;  4WCE L;  4CZJ A;  4FVU A;  2A3Z A;  1A5X A;  2YHX A;  2O8D B;  5AQU A;  3W3D A;  1I3A A;  1Z6R A;  2GX9 A;  1WLJ A;  3GDQ A;  2HHU A;  1J5O A;  3HO1 A;  5A2Q O;  2VG5 A;  3KVG A;  5AQS A;  1OVY A;  2E2N A;  5JIC A;  5I9E B;  2GWJ A;  4N76 A;  4WYB A;  4LF7 K;  4Q5V A;  3QBW A;  2P9S B;  2A6A A;  1NJY A;  4JKB A;  1WSG A;  2WC9 A;  1K8K B;  1GLE G;  1JLA A;  1QSL A;  1D8Y A;  1W2B M;  1HPZ A;  2YNH A;  1VQ5 N;  4HCC A;  5C2F A;  3HVT A;  3SYZ A;  4ILH A;  3ZEU B;  4FXD A;  4M3T A;  3C6T A;  4DB3 A;  3O08 A;  3E9P A;  3CJA A;  4CJF A;  3NVM A;  4FLW A;  4M45 A;  3SUO A;  4DU3 A;  4FZZ A;  4W5N A;  3QML A;  3SAG A;  5AFU A;  3OYA A;  4Z4H A;  3LAN A;  5BRD A;  2P9S A;  3VA3 A;  4KRF A;  4CJR A;  1U04 A;  4X64 K;  1VQP N;  2O8E B;  4CF8 A;  3CJC A;  3OYC A;  4H0O A;  4G1Q A;  1K8K A;  3RVC A;  2HW3 A;  5FPE A;  1RIL A;  1BQN A;  3OS0 A;  4OLA A;  3EYZ A;  4C1N K;  2JLE A;  2WTU A;  3ZEU A;  4KO0 A;  4M7Y A;  5LL6 Z;  2ASM A;  2EWS A;  3BY5 A;  4I2P A;  4UY8 O; 
#chains in the Genus database with same CATH homology
 4Z4G A;  4BDP A;  1CLQ A;  3HJF A;  3HYF A;  2W42 A;  3AO2 A;  1WN7 A;  4B9M A;  3PX6 A;  1B9F A;  3LP0 A;  3U3Y A;  3DYA A;  4DTO A;  2OPQ A;  1VSL A;  4E3S A;  3KKR A;  3T19 A;  2YNG A;  3RMB A;  3HT3 A;  1CXU A;  4CHQ A;  4FJL A;  2KTQ A;  2ZQB A;  4OLB A;  2E4L A;  5C25 A;  4ELU A;  3LP1 A;  1SUQ A;  1U4B A;  4C8M A;  1Z25 A;  4DFM A;  3O3H A;  3DI6 A;  3LZI A;  1CZ9 A;  3QES A;  1GOA A;  4FJJ A;  3V6D A;  2FBV A;  2WON A;  3AVB A;  4KAZ A;  2Y1J A;  3CG7 A;  3K5N A;  3T3F A;  3V4I A;  4J2D A;  3HP6 A;  5J2Q A;  3D45 A;  4C8L A;  4B9L A;  4FJK A;  4OKK A;  1UA1 A;  3OJU A;  3SQ4 A;  4JRP A;  4RW4 A;  1IKY A;  4CEB A;  4CGI A;  4B3O A;  5FRN A;  4FCY A;  4BDY A;  1RBR A;  3WNE A;  1VSJ A;  3NH1 A;  2VWJ A;  1NKB A;  1MU2 A;  3ZSQ A;  3OYG A;  3S3M A;  3OYJ A;  4FLY A;  4DQQ A;  4PY5 A;  1S1T A;  2RF2 A;  1IKX A;  1CXQ A;  1RDB A;  4HUG A;  2P5G A;  1RNH A;  2RN2 A;  3KK1 A;  4E89 A;  3L8B A;  3VQ8 A;  3RTV A;  1L3V A;  3DMJ A;  2VG6 A;  2G8I A;  3TAF A;  1N6Q A;  1RBT A;  3AVJ A;  5I3U A;  3C6U A;  1XHZ A;  4CEO A;  3NE6 A;  4Q0B A;  1JL2 A;  3DLG A;  1JLE A;  4CJV A;  4B08 A;  4AHV A;  4CEC A;  2HHV A;  3RMD A;  4CEA A;  3JSM A;  3VQA A;  3ZT0 A;  4B8A B;  4KPY A;  4CHN A;  4HCB A;  4FJI A;  3DLK A;  4CFC A;  2HVH A;  1FKO A;  2LSN A;  3SQ2 A;  4F3O A;  4QOZ B;  4CIE A;  2RPI A;  4DS4 A;  4CF2 A;  1S1V A;  1TKD A;  3ZSR A;  1RCH A;  1KLN A;  1YT3 A;  3G0Z A;  4DTS A;  4PWD A;  2D0B A;  5K14 A;  3O3G A;  3OYM A;  1UWB A;  1TV6 A;  4RW7 A;  1S1W A;  1IG9 A;  4CJK A;  4M3W A;  1HRH A;  4FW2 A;  3L2W A;  3QIO A;  3ULD A;  4FK4 A;  1VSH A;  2VG7 A;  1TAQ A;  3L2Q A;  1JLB A;  3QNO A;  1S9E A;  4IFV A;  1F21 A;  5HRR A;  4CF0 A;  4CK2 A;  4DU4 A;  3P1G A;  1YTA A;  3KLF A;  2B6A A;  4BWJ A;  3MAQ A;  2ATQ A;  1CZB A;  4B8C A;  4FJN A;  4CFA A;  3IRX A;  4NCA A;  3MEE A;  1FK9 A;  4CGD A;  4OPK A;  3HL8 A;  3NGZ A;  3VQD A;  4CF9 A;  2HND A;  3SZ2 A;  2PYJ A;  4FM1 A;  1IO2 A;  3NF6 A;  1DTT A;  3LAM A;  4O0J A;  3AVG A;  4O4G A;  4OGE A;  4DTX A;  3RR8 A;  4OKJ A;  4F2R A;  3PO4 A;  1TKX A;  2XY7 A;  3V9S A;  3OYN A;  3O3F A;  1UOC A;  3L3V A;  4IBN A;  5KRT A;  1RTD A;  3OJS A;  3VQ4 A;  3ZSZ A;  4DFP A;  4DSL A;  1RBS A;  1XHX A;  3AVM A;  1C1C A;  2DFE A;  4B9V A;  4FW1 A;  1BIZ A;  3AA4 A;  4M3R A;  3ZSO A;  3KD1 E;  3C94 A;  3DLE A;  1JLQ A;  1JXE A;  1NK9 A;  2QXF A;  1VSI A;  4KI4 A;  2Q3S A;  2HNY A;  3DRR A;  5JS1 A;  3HXM A;  1S6P A;  1KCF A;  1SV5 A;  3QLH A;  3KTQ A;  4FJG A;  4KHU A;  4W5O A;  4J2B A;  2HHX A;  1SL1 A;  2Z1J A;  3AA3 A;  3B6O A;  4J2E A;  3LPU A;  4M42 A;  3AO4 A;  4DQI A;  5J2N A;  1NK4 A;  4KHN A;  1HNI A;  1RDC A;  4I9L A;  3B6P A;  4AH9 A;  4O5B A;  3V81 A;  4N56 A;  2OZS A;  3HVR A;  3K2P A;  4CED A;  4C8K A;  1WAF A;  1RT1 A;  4RW8 A;  3VN5 A;  3VQQ A;  3AVA A;  4N47 A;  4DTM A;  3AVF A;  4DMN A;  4CHY A;  4O0I A;  4DU1 A;  2O4I A;  5CZ2 A;  5SWM A;  3V9X A;  2EX3 A;  4DQS A;  1NOY A;  1ZBI A;  2JGU A;  4DLG A;  4AIL C;  3IAY A;  4KHW A;  4DTU A;  1B92 A;  3H08 A;  3MEG A;  1WSJ A;  1NK8 A;  5J1E A;  1Q9X A;  3MEC A;  5KTQ A;  1VRU A;  3LP2 A;  4R5P A;  3RRH A;  1JXB A;  2IDO A;  5J2P A;  3WNG A;  3NCI A;  1NK6 A;  3LWL A;  2G8W A;  3C95 A;  4KFB A;  4CGG A;  4CIF A;  3I8D A;  4IFY A;  3VA0 A;  3SJJ A;  1L3T A;  1RDD A;  3QNN A;  1RT7 A;  4KHY A;  3OS2 A;  2G8K A;  4FJ9 A;  1GOC A;  1HMV A;  3IG1 A;  5C24 A;  1J54 A;  3OY9 A;  1ASU A;  4E7J A;  1UA0 A;  3KD5 E;  3HST B;  1WSI A;  1NKE A;  2O4G A;  1QSS A;  4EZ6 A;  2KZM A;  3LP3 A;  4FLT A;  1NJW A;  4CJ4 A;  3K5M A;  4OVL A;  3SQ1 A;  5SZT A;  4CE9 A;  1RT5 A;  2YV0 X;  5KGX A;  4W5Q A;  4BAC A;  1LWC A;  5CY4 A;  2PYL A;  4Y1C A;  4B9T A;  2HB5 A;  1YTU A;  1L5U A;  1KFD A;  4Z4I A;  1EP4 A;  3JYT A;  3P5J A;  3FFI A;  2KW4 A;  1NJZ A;  2G8F A;  4QAG A;  3AO1 A;  4KHQ A;  1RBV A;  4CGH A;  1WSH A;  4CJP A;  3M8S A;  5J2M A;  1I39 A;  4MQ3 A;  4H4M A;  4K8X A;  3AVI A;  3AA5 X;  3LDS A;  1HNV A;  3KLH A;  4FK2 A;  3SUQ A;  1REV A;  1RT6 A;  1UAX A;  2OPP A;  2VWK A;  2XY8 A;  5KGW A;  3LWM A;  1SL2 A;  2OPR A;  3DM2 A;  4CFD A;  1T7P A;  2Z1H A;  4AHS A;  5DMR A;  3VQ5 A;  2X78 A;  2YHA A;  2IGI A;  4PA1 A;  3OYH A;  3QER A;  4F4K A;  2A1S A;  4ELV A;  1TK0 A;  1L3S A;  4KB1 A;  2P51 A;  2IOC A;  2YNI A;  2E6M A;  3OVN A;  4DF8 A;  2PY5 A;  3O4Q A;  3VQE A;  3IS9 A;  4C8O A;  2FBX A;  4FLV A;  4F2S A;  1IH7 A;  1RTI A;  5CYM A;  5JS2 A;  1KLM A;  4DG1 A;  3MXM A;  1LW0 A;  4HUE A;  3CYM A;  1WAJ A;  1D9D A;  4DSK A;  1SKR A;  3L2U A;  4W5R A;  5DK5 A;  1L3U A;  1HQU A;  1X9S A;  2F8T A;  2HHQ A;  3TAE A;  3VQC A;  2EHG A;  1S6Q A;  1XWL A;  4GMJ B;  1K6Y A;  1TAU A;  1U45 A;  3RWU A;  2RKI A;  4DS5 A;  5CZ1 A;  4GVM A;  1TL1 A;  4LSL A;  2XY5 A;  3L2V A;  1RDA A;  1WSE A;  3LAK A;  4AHR A;  4NCB A;  1KSP A;  4M3Y A;  1VK0 A;  4IKF A;  1U47 A;  3UIQ A;  2F96 A;  3M8P A;  2HHS A;  4AHC A;  4HHT A;  2HHW A;  3SNN A;  4CEF A;  3ZSW A;  1FXX A;  1U48 A;  4Y1D A;  4CJ5 A;  1IKV A;  4M3X A;  3VQ7 A;  1QE1 A;  2OA8 A;  4XIU A;  3RR7 A;  3VQ6 A;  1RT4 A;  3ISN C;  1HYZ A;  3ZT3 A;  3KIO A;  3OS1 A;  4Z4C A;  3CFR A;  4JS5 A;  2BAN A;  3V9W A;  4GW6 A;  4DTR A;  1LWF A;  4CER A;  4CF1 A;  2KFN A;  1J53 A;  4RW6 A;  4FZX C;  1KVA A;  4ICL A;  4KI6 A;  2ZE2 A;  4DFJ A;  4IG3 A;  3HK2 A;  4DTP A;  1DLO A;  1KFS A;  1C6V A;  4KKO A;  2IC3 A;  4CJL A;  4RW9 A;  1YVU A;  4FM0 A;  5C42 A;  1QS4 A;  3WNH A;  4DSJ A;  1NOZ A;  2DFF A;  4CJW A;  3TAP A;  2X74 A;  1EET A;  2XRI A;  1ZBL A;  4PUO A;  4Z4F A;  3SUN A;  4EZ9 A;  3L2R A;  3WNF A;  5D3G A;  3CM6 A;  4I2Q A;  3OYI A;  1N5Y A;  4E19 A;  5EU7 A;  1X1P A;  1LWE A;  3OYK A;  4FM2 A;  3SV3 A;  4HUF A;  2Y1I A;  4KB0 A;  1BCO A;  1JKH A;  1S1U A;  2G8U A;  5FRO A;  3G10 A;  3S3N A;  3OYE A;  3SUP A;  4E7L A;  4DF4 A;  4CGJ A;  2DY4 A;  4N5S A;  1IKW A;  4K8Z A;  4CHO A;  1RBU A;  3K5L A;  4CK3 A;  3L3U A;  3VQ9 A;  3K59 A;  4DTJ A;  4DSI A;  1J9A A;  1BL3 A;  2ETJ A;  4YFU A;  4CHZ A;  1HYV A;  1KTQ A;  1BGX T;  3ASM A;  3LPT A;  3NF7 A;  1SL0 A;  3KK3 A;  4E0D A;  4QCL A;  1DTQ A;  2GV9 A;  5HRS A;  4FYD A;  3BGR A;  4KHS A;  1LAW A;  4F3T A;  1QSY A;  3NAE A;  3U6F A;  4B9N A;  4CCH A;  1EX4 A;  1LW2 A;  2WOM A;  1QTM A;  4FK0 A;  5I42 A;  4E7H A;  3QEP A;  2GBZ A;  3QEV A;  1KRP A;  4CGF A;  5KRS A;  4CFB A;  4M3U A;  5FRM A;  2IS3 A;  1ASW A;  4Z0U A;  3D0P A;  3QEX A;  2F8S A;  2KQ2 A;  1G15 A;  3AVL A;  1O1W A;  2BGG A;  3EZ5 A;  2G8V A;  4FJ7 A;  3U3G A;  3T1A A;  3NFA A;  2D0C A;  2HNZ A;  2I5J A;  1BHL A;  3NF8 A;  4BE2 A;  2KZZ A;  1BIU A;  3PV8 A;  1VSD A;  1W0H A;  1ITG A;  3BDP A;  4CES A;  3AVH A;  4BWM A;  4IG0 A;  3KLG A;  3SCX A;  4PQU A;  3NF9 A;  4FJX A;  1NJX A;  4OGC A;  3DLH A;  3TR8 A;  3LZJ A;  4FJM A;  1RT2 A;  4AHT A;  2A1R A;  1ZBU A;  4FZY A;  3NGY A;  3DRP A;  1BCM A;  1C0U A;  2NUB A;  1S5J A;  1FKP A;  3NHG A;  3SPY A;  1R0A A;  1A5W A;  1C0M A;  3NBP A;  1SKW A;  3NGI A;  4WE1 A;  4H8K A;  3V1Q A;  3M8R A;  3QEW A;  1XI1 A;  1VSE A;  3DRS A;  4KRE A;  4EP5 A;  2D5R A;  1QHT A;  2YKN A;  4OKE A;  3HM9 A;  3DLR A;  4DQR A;  3AVN A;  2FBT A;  2GUI A;  3TAR A;  4E1N A;  3AO5 A;  2YNF A;  3ZSV A;  1C0T A;  4EP4 A;  4CJQ A;  1SKS A;  2HHT A;  4BDZ A;  1TVR A;  1Q8I A;  3OYL A;  4B9U A;  3AVC A;  1D5A A;  2R7Y A;  4NYF A;  4CJU A;  1HJR A;  1BQM A;  2AJQ A;  1NKC A;  4FVM A;  3E01 A;  1RTH A;  4L8R B;  4CJE A;  4W5T A;  1NK5 A;  4ID1 A;  3AVK A;  2OYQ A;  2E6L A;  2XHB A;  1WSF A;  3MED A;  3S3O A;  4J2A A;  2DTU A;  1VSM A;  5HLF A;  3VQP A;  1ZBH A;  2PZS A;  1BI4 B;  4Z4E A;  3HPH A;  5CYQ A;  4DWI A;  3CM5 A;  4HTU A;  3NDK A;  1VRT A;  4AHU A;  4B9S A;  2BE2 A;  4FLU A;  4JLH A;  4CEE A;  3TAQ A;  4BE0 A;  1Z26 A;  5HP1 A;  3TWH A;  4LY7 A;  4CEQ A;  2ZD1 A;  3SQ0 A;  4OJR A;  4CJS A;  4CK1 A;  4E1M A;  1NK0 A;  1S9G A;  1Y97 A;  4I9Q A;  4ELT A;  4FJ5 A;  5T7B A;  4HVJ A;  5HRO A;  1S1X A;  2DFH A;  2IAJ A;  4UQG A;  1T8E A;  2XY6 A;  3NH2 A;  1KVC A;  3KJV A;  3ZT1 A;  1X9M A;  3DOK A;  1RT3 A;  3CQ8 A;  3HPO A;  1HYS A;  3I0S A;  3M8Q A;  3AV9 A;  2BDP A;  1LAV A;  3A2F A;  4E7K A;  4E7I A;  4O44 A;  2D0A A;  3OYB A;  1BIS A;  3PUF A;  3KLE A;  4JRQ A;  3I0R A;  3QO9 A;  1BI4 A;  3ZT2 A;  1A5X A;  1Q9Y A;  3ALY A;  4DFK A;  3HPG A;  2YHB A;  1XC9 A;  3V9Z A;  4FJ8 A;  1I3A A;  3F73 A;  3PO5 A;  4DLE A;  3K58 A;  1GOB A;  2KFZ A;  1T05 A;  4C8N A;  4LD0 A;  4M41 A;  1WLJ A;  3SPZ A;  3OYD A;  3K5O A;  2HHU A;  2P1J A;  3V1O A;  3RMC A;  3NH0 A;  1J5O A;  3O4N A;  3P83 D;  2X6N A;  3HO1 A;  4IDK A;  4NCG A;  3ZSX A;  4KTQ A;  2X6S A;  5FDL A;  3QIN A;  4DTN A;  4JS4 A;  4H4O A;  2VG5 A;  4RG8 A;  1JLC A;  3DOL A;  3ZSY A;  3V9U A;  1TK5 A;  3SI6 A;  1TK8 A;  2QKK A;  3V1R A;  4ZHR A;  4N76 A;  1LV5 A;  4N41 A;  4CJ3 A;  3QEI A;  1TKZ A;  4Q5V A;  1T03 A;  2YKM A;  4I7F A;  4FLZ A;  4CHP A;  3RRG A;  1NJY A;  2HMI A;  1X9W A;  2FBY A;  3ZCM A;  3ITH A;  4CJT A;  4LH4 A;  1WSG A;  3PX4 A;  1JLA A;  1QSL A;  4YNQ A;  4FJH A;  3MXJ A;  4ID5 A;  1U49 A;  1KVB A;  1D8Y A;  1ZBF A;  3QET A;  5HRN A;  4OPJ A;  1HPZ A;  2YNH A;  3F9K A;  3KK2 A;  1RTJ A;  4HCC A;  3HVT A;  2B5J A;  3SYZ A;  1A5V A;  3TAG A;  4FXD A;  3EY1 A;  4M3T A;  1W9H A;  3C6T A;  3RMA A;  1EKE A;  1B9D A;  2Z1G A;  2QKB A;  4CJF A;  3TI0 A;  1NK7 A;  3KKS A;  4TSX A;  1HQE A;  4M45 A;  4FLW A;  3K57 A;  3SUO A;  3THV A;  4LSN A;  1JL1 A;  4DU3 A;  1WNS A;  2G8H A;  3VQB A;  4FZZ A;  2OPS A;  4W5N A;  3PY8 A;  3OYF A;  2OZM A;  2XO7 A;  3OYA A;  4Z4H A;  4KTZ A;  2HVI A;  4DQP A;  3LAN A;  2B4J A;  4KRF A;  3VA3 A;  3TAB A;  4CJR A;  1U04 A;  4CEZ A;  1VSF A;  1ASV A;  4LH5 A;  4MFB A;  1JLF A;  3AA2 A;  4KV8 A;  4CF8 A;  3OYC A;  4F8R A;  3PX0 A;  1VSK A;  4G1Q A;  3TAM A;  2HW3 A;  4NYN A;  2ITG A;  3QIP A;  3S9H A;  3ZT4 A;  3CFP A;  1ZYQ A;  1RIL A;  1EXQ A;  1BQN A;  3OS0 A;  3CFO A;  4OLA A;  3KLI A;  3EYZ A;  5HRP A;  2QK9 A;  1TKT A;  2JLE A;  4O55 A;  5KI6 A;  4FLX A;  3AO3 A;  3SV4 A;  3TAN A;  4ZTF A;  3DLB A;  2P5O A;  4KO0 A;  3HP9 A;  1QQC A;  2Z1I A;  1C1B A;  4M3Z A;  4I2P A;  4ZTJ A;  1TGO A;  5E41 A;  3MXI A;  1C1A A;  2FC0 A;  4CIG A;  3LAL A;  1JLG A;  4DSF A;  1TL3 A;  4KTW A;  5HBM A;  4DSE A;  1D9F A;  4BE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...