4AHTA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
151
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 55
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahtA00
3AVAA 4KKOA 4FM0A 3OS0A 1W9HA 4LSLA 3VQQA 4E1NA 3PX0A 1ZBLA 1WLJA 4CJ3A 1NK8A 1BL3A 3RR8A 4J2BA 1T8EA 2D5RA 1EXQA 3DYAA 3IS9A 4AHCA 4DFJA 2O4IA 1JLCA 4Z0UA 1WAJA 1GOBA 4C8MA 2XY8A 2IDOA 4CHYA 2FBVA 2Z1JA 4BWJA 3TAMA 3KK3A 3K5NA 4DG1A 3NHGA 4BDZA 3SV3A 1LAVA 2XY6A 1JKHA 1KVBA 2G8HA 1L3TA 4H8KA 1QSSA 3ZSOA 1O1WA 1QHTA 1HYSA 4R5PA 3TABA 2XHBA 4DF8A 1XHXA 2JLEA 1B92A 3VQ8A 3TANA 2DFHA 3TAGA 4PWDA 2YKNA 4Z4GA 4CIEA 3G10A 4DMNA 2KFNA 3L3UA 3AVLA 4M45A 5I3UA 2KFZA 4LY7A 3AA4A 3QO9A 5HBMA 4CJPA 1L3SA 3KJVA 3SUOA 2IS3A 5CZ1A 1IKYA 3OJSA 4W5NA 5HRPA 3PO5A 3KKRA 4CEZA 3KLFA 4E7JA 3DMJA 2ZE2A 1KSPA 4DQIA 2Y1IA 3PUFA 4OPKA 3NH1A 2BDPA 3NF6A 4DSFA 1T05A 3L2UA 2OZMA 1RTJA 2F8SA 1FKOA 1VSFA 4ZTJA 4W5OA 1UAXA 1C1BA 1WSIA 1RDDA 2YNIA 4O4GA 3U3GA 4C8NA 2F96A 3HVRA 3TI0A 1TGOA 4KHNA 2BGGA 1IKWA 1HMVA 4RG8A 3K5LA 4PY5A 1JLAA 3S3NA 4RW6A 4Y1DA 4GW6A 2HNDA 4CGGA 3JSMA 1X9WA 2PY5A 3VQAA 4KB1A 3CFRA 4QCLA 1WSEA 3KD1E 4FZZA 2PZSA 3AO2A 5FDLA 1ZYQA 4JRQA 2KZMA 3SYZA 3S3MA 4AHRA 1FXXA 1RBSA 1SV5A 1JXBA 2X6SA 1NK0A 4CFBA 3RMCA 4CEEA 1U4BA 2OPPA 3D0PA 4BDPA 1ASWA 3I0SA 4M3TA 1CXUA 4NYFA 3RWUA 4CJWA 1D8YA 1ITGA 2Y1JA 1IG9A 3HPGA 1QSLA 5SZTA 1LW2A 5HLFA 4RW4A 2HHUA 3AVCA 1VSIA 5HRSA 4FJNA 3O3FA 5HRRA 4F2SA 4KPYA 3AVBA 1N5YA 4EZ9A 3O4NA 3KLHA 4C8LA 3K59A 1VSEA 4BDYA 4AILC 5CYQA 4DQPA 1JLBA 4KFBA 1RDAA 4HUFA 4Z4EA 2HHSA 4FLTA 4FJMA 3V81A 2OA8A 5KRSA 1JLGA 3T19A 1NJXA 3T3FA 4E7HA 1FK9A 2YHAA 2E4LA 1UOCA 3QESA 4EZ6A 3OYMA 4FJLA 1BIZA 4KHYA 4M42A 4FLVA 3P1GA 3L8BA 1NK7A 4BE0A 3U6FA 2QKKA 3SQ2A 3K5OA 1EX4A 4M41A 4OJRA 4CGFA 1RDBA 3KLGA 1SL0A 4KI6A 1QS4A 1C0MA 2HB5A 3LP3A 4I2PA 3CYMA 2B4JA 1A5XA 2BE2A 4CFAA 3L2RA 4CEBA 4DLEA 5J2MA 4B3OA 1S6PA 4CF1A 3A2FA 1RBRA 4CESA 3T1AA 3ZSRA 2G8UA 4DSKA 3DRSA 2JGUA 2FC0A 2YNFA 5C42A 4B9VA 1BHLA 1BISA 2KZZA 3AVHA 2IC3A 5CYMA 4DFKA 3LP1A 4AHVA 1NK5A 3VA0A 3O4QA 1RTIA 3HPOA 1S6QA 3KLIA 2HNYA 1QQCA 2R7YA 1R0AA 4W5QA 2G8VA 3QIPA 3QIOA 1TL1A 4QOZB 1DTTA 2D0AA 4AHSA 2QKBA 3EY1A 3QETA 3TAEA 3QNNA 1J53A 3ZSZA 4FLWA 4CJEA 4OKEA 3SUQA 3ZSWA 4ID1A 3OJUA 3V9XA 2FBXA 4DTSA 1SKWA 1D9DA 4CF8A 3O3GA 4DSJA 4JS4A 3TAFA 1RBVA 3NGYA 3ZT0A 3MXMA 4FLZA 5D3GA 4H4MA 1LW0A 4BE2A 2PYJA 3HO1A 1CXQA 4L8RB 3LAMA 1VSKA 3AA3A 2G8KA 3I8DA 1ASVA 4FM1A 1T7PA 1VSDA 3VQDA 5C25A 4B9SA 5FROA 4DTNA 4KTWA 4FZYA 1S1XA 1BIUA 2Z1HA 4KO0A 1S1VA 1LWEA 2A1RA 2ZD1A 3DRRA 4CHQA 4B8AB 1KTQA 1UA1A 2DTUA 3AA5X 5KGWA 1B9DA 1HQUA 3SJJA 1KRPA 4CJ4A 1QSYA 2VWJA 1FKPA 1TKDA 3ZT4A 4M3UA 3MAQA 3NH0A 3PO4A 3NF9A 4PA1A 1WSHA 4DSLA 1GOAA 1TKXA 4NCAA 3VQ9A 1HPZA 4ICLA 3QEPA 2P51A 3LANA 5CY4A 4CJRA 3CM5A 1EKEA 4CF2A 4J2DA 3QEIA 2E6LA 1BCMA 1YT3A 1Z25A 4OPJA 1VSLA 4KHQA 4JS5A 4Z4HA 4W5RA 2WOMA 4CJLA 3AVIA 3AVKA 1U45A 4FJGA 1W0HA 3MEEA 2E6MA 4O55A 4OVLA 3RRGA 1SL2A 3KK1A 3VA3A 4DS4A 5I42A 4B9UA 3NE6A 5CZ2A 1YVUA 1S1WA 4DTMA 4AHUA 4HUGA 1TKTA 3AO4A 2KQ2A 3MXJA 1Q8IA 4CJVA 3SNNA 4CIFA 4FK4A 1C6VA 3C94A 5J1EA 1BGXT 4CGJA 3QNOA 3KD5E 1X1PA 4ID5A 3V1RA 3HXMA 3K2PA 4IFYA 2QK9A 4W5TA 2HW3A 4Y1CA 4E0DA 4CHOA 4FVMA 3KLEA 1BCOA 1WAFA 4HUEA 3EZ5A 3M8PA 4E3SA 3JYTA 3M8QA 1SKSA 4O0JA 4I2QA 1S5JA 1TL3A 5DK5A 3V9WA 1VSHA 4CIGA 4DSIA 1RNHA 1NKBA 1ZBHA 4HHTA 3K57A 3AA2A 4GVMA 3C95A 4DTRA 3DLBA 4M3XA 2HHQA 1EETA 2IAJA 3ISNC 3WNFA 2P1JA 4CJUA 1U47A 1NK9A 1L3VA 3L2QA 4DU3A 3AVGA 3BGRA 2XY5A 1LV5A 3SI6A 4KAZA 3SUPA 3THVA 4FJXA 3AVFA 1KVAA 3ITHA 1XI1A 4OLAA 4CJKA 4CERA 4Q0BA 3MECA 1BQMA 4M3RA 4CJ5A 1RBTA 4LH5A 4FLXA 3QERA 1X9SA 1BI4A 3SZ2A 3SUNA 4KHWA 3LALA 2X78A 4DTUA 2HVHA 1WSJA 1RTDA 4RW8A 1RCHA 4CK2A 4O5BA 3ZT3A 2Z1IA 3HL8A 4N5SA 4FK2A 4M3WA 4DFMA 4XIUA 3LAKA 3TR8A 4FLYA 3QINA 3V4IA 3B6OA 2I5JA 2XY7A 1RBUA 4IDKA 2FBYA 4KTZA 3IRXA 5K14A 5KRTA 2RN2A 1J5OA 3RR7A 3QLHA 4WE1A 4FJIA 4CK3A 3CM6A 4Z4FA 3AVMA 4B9NA 3VQ7A 1NK4A 2X74A 1UWBA 3VQBA 3OYFA 4CEAA 3G0ZA 3DRPA 4M3YA 4PQUA 1B9FA 3OYEA 3HT3A 2WONA 3OYNA 1JLEA 4JRPA 3RMDA 5EU7A 1IKXA 4CJTA 1YTUA 4EP4A 2G8FA 1HYVA 3DLEA 4IG0A 3L2VA 4E89A 1IO2A 4J2AA 2G8WA 2B5JA 4FJKA 3F73A 1L3UA 1CZBA 1QTMA 3HJFA 3LP2A 2HHTA 2HHWA 1RT1A 4TSXA 4F3OA 2RKIA 1U49A 4CHNA 2Q3SA 3L2WA 1S9GA 3C6UA 2ETJA 1U48A 1TKZA 2OPSA 3NGIA 4DU1A 4RW7A 2KTQA 1IKVA 2Z1GA 4FJ9A 4CGDA 3AVNA 3HVTA 4OGCA 4CK1A 4DF4A 4YFUA 2PYLA 3OY9A 3SV4A 4ELVA 2DFFA 3NFAA 3M8RA 4BWMA 3EYZA 3NBPA 3SPYA 1S9EA 3OYLA 3SCXA 4FLUA 3V9SA 1JXEA 1NKCA 3WNGA 3SQ0A 4PUOA 1ASUA 1S1TA 4CEFA 4CGHA 2G8IA 1C0TA 1TAQA 4DQSA 4IKFA 3V9ZA 2HMIA 1Y97A 4BACA 1K6YA 1N6QA 1VRUA 2BANA 3V6DA 3ALYA 3VQEA 3VN5A 4BE1A 4F8RA 1LWFA 4OLBA 4YNQA 4ELUA 3LP0A 4NCBA 1Z26A 1XC9A 1HRHA 1YTAA 5FRNA 2IGIA 3RMAA 3S9HA 1NKEA 2GBZA 3OS1A 5JS1A 1HJRA 3NDKA 1UA0A 3VQ5A 4AH9A 5KGXA 4CEOA 1DLOA 1KFDA 1VSMA 3TAPA 1I3AA 1RT5A 5E41A 5HRNA 1MU2A 2HNZA 3HSTB 2P5OA 4NYNA 3O3HA 3TWHA 2NUBA 3MXIA 3VQCA 3WNHA 4CJSA 3NAEA 2DY4A 3ZCMA 3E01A 4O44A 2W42A 1HNVA 4M3ZA 1WSFA 4UQGA 4KHSA 1WSGA 3OYIA 3CG7A 1TVRA 2GUIA 3NF8A 3BDPA 3B6PA 5HP1A 4CHZA 1VRTA 4FJ8A 4N56A 4FZXC 4E1MA 4IBNA 1HYZA 3OYAA 3L3VA 1T03A 3OYJA 1KFSA 4CE9A 2OZSA 4FW1A 4B9LA 1TK8A 3V1OA 3OS2A 2A1SA 2OPQA 1JL2A 3QEWA 4N41A 1IH7A 3NF7A 4B08A 3PX6A 3HP9A 4K8ZA 1WN7A 2YNHA 1RT2A 1KVCA 4E7IA 1KLNA 4KTQA 3OYCA 1BQNA 3AO1A 4E19A 5J2NA 4LH4A 2ITGA 4KB0A 3P83D 1TK0A 2OPRA 3H08A 1LWCA 5DMRA 3OYHA 3PX4A 3NH2A 3NCIA 1D5AA 3QEXA 3AO3A 3V1QA 3AV9A 2LSNA 3DLGA 5C24A 4CJFA 3LZJA 1G15A 2YNGA 1SUQA 4CEQA 4Q5VA 2VG7A 3KKSA 4FW2A 4MQ3A 5SWMA 4DQQA 3SQ4A 2ATQA 5J2QA 1JL1A 3CFOA 4CFCA 4N76A 1TV6A 3MEGA 3ZSYA 2ZQBA 3DI6A 4KRFA 4IFVA 3ZT2A 4C8KA 4LSNA 2KW4A 3VQPA 1Q9XA 1DTQA 2VG6A 1VK0A 4IG3A 4B9MA 2IOCA 2OYQA 3OVNA 3VQ4A 5J2PA 3SPZA 4FJHA 4OKKA 4LD0A 1Q9YA 3DLRA 3KIOA 1GOCA 1C1CA 4CF9A 1X9MA 1L5UA 5T7BA 3V9UA 4ZHRA 3S3OA 1NOYA 4H4OA 4J2EA 4G1QA 5KTQA 3QEVA 2EX3A 3PV8A 1CLQA 4FCYA 1REVA 2O4GA 3LWMA 3ULDA 3HYFA 1BI4B 1D9FA 4I9LA 3AVJA 1VSJA 3CFPA 4B8CA 4FM2A 4DU4A 4F3TA 1CZ9A 1HNIA 4CF0A 4DS5A 2YHBA 4CFDA 3DLKA 4FJJA 4DQRA 1NJZA 4JLHA 5JS2A 1NJYA 4FXDA 4C8OA 2EHGA 4F2RA 1XWLA 2B6AA 1RTHA 2HHVA 1ZBUA 1NOZA 3ZT1A 2P5GA 4FYDA 4AHTA 3RTVA 4B9TA 1NJWA 3C6TA 1C0UA 3ASMA 5FRMA 2GV9A 3DOKA 3CQ8A 4FK0A 2RF2A 1TAUA 3RRHA 3LDSA 4KHUA 3K5MA 3MEDA 2AJQA 2YV0X 2YKMA 2HHXA 1QE1A 3LZIA 4F4KA 4I7FA 1KLMA 1RT3A 1J9AA 3ZSQA 4DWIA 3KTQA 2VWKA 4OKJA 4HCCA 5KI6A 4KREA 1RT7A 4KV8A 3OYKA 4K8XA 4CEDA 1JLFA 2HVIA 1XHZA 4HCBA 3IG1A 3D45A 4NCGA 1JLQA 2XRIA 4CHPA 5HROA 1NK6A 3SQ1A 4I9QA 4HTUA 3TAQA 1U04A 3LPUA 4DTJA 3WNEA 3AO5A 1SL1A 1ZBFA 3NGZA 4DTXA 3OYBA 1F21A 2VG5A 3VQ6A 4N47A 4DSEA 1SKRA 3PY8A 1RT6A 4CCHA 4FJ5A 4FJ7A 3TARA 4EP5A 2X6NA 4CECA 1RT4A 3ZSXA 1C1AA 3LWLA 4KI4A 4DTOA 3DLHA 1KCFA 4E7LA 1HQEA 1A5WA 3LPTA 3ZSVA 4RW9A 3IAYA 1RILA 3M8SA 1S1UA 3UIQA 1EP4A 1WNSA 2QXFA 3HPHA 3P5JA 1LAWA 4MFBA 3U3YA 3FFIA 4E7KA 3F9KA 4DTPA 2RPIA 4QAGA 1I39A 4CGIA 4ELTA 4ZTFA 3KK2A 2F8TA 3I0RA 4OGEA 3K58A 1TK5A 4Z4IA 2FBTA 4DLGA 2DFEA 4Z4CA 1J54A 1A5VA 2D0BA 4GMJB 4O0IA 3OYGA 4HVJA 3HP6A 1RDCA 2D0CA 3HM9A 4DFPA 4CJQA 2XO7A 3HK2A 3OYDA 3DOLA 3RMBA 1ZBIA 3DM2A
chains in the Genus database with same CATH superfamily
4KKOA 4LSLA 3PX0A 2D5RA 3IS9A 4JKAA 1GOBA 1XC3A 2FBVA 3TAMA 2QWNA 1JKHA 2QI2A 3ZYYX 1L3TA 1ATSA 1O1WA 3ZSOA 3VF4A 1VQLN 2XHBA 4YOUA 1B92A 3FZHA 4DB3A 2DFHA 1VQON 3G10A 3WXMB 2KFNA 4M45A 3AVLA 5BN8A 2VWBA 5BN9A 3PO5A 4DQIA 3KLFA 4E7JA 2IVOA 3KVGA 5GIPA 2BDPA 2OZMA 4ZTJA 1UAXA 1C1BA 1WSIA 2BGGA 1TGOA 1IKWA 1JLAA 5LMNK 3F9MA 1X9WA 4CGGA 2PY5A 3JSMA 4KB1A 3ZETB 5FDLA 4JRQA 1GLDG 4MO4A 1HKCA 1FXXA 1RBSA 2X6SA 4G9ZA 1NK0A 4CEEA 1U4BA 4LC9B 2OPPA 5LY3A 4IXCA 3I0SA 1Q7YO 2GWJA 4NYFA 4A61A 1IV0A 5A2QO 2Y1JA 3HTVA 1IG9A 3EE9A 4H03B 5HLFA 3L6QA 5HRSA 4XH1A 3PSFA 4KPYA 5MLCQ 3AVBA 4DQPA 1VSEA 4B3RK 4AILC 5CYQA 1JLBA 2HHSA 2OA8A 3CETA 5KRSA 3T19A 1NJXA 3T3FA 4E7HA 1DT9A 2OTLN 4DUZK 4EZ6A 1TYQA 2HF4A 4GNIA 4AF1A 1NK7A 3U6FA 4JAXA 5AQTA 4DKWA 4CFAA 2B4JA 1A5XA 4BC2A 2JGUA 3QDKA 3AVHA 3E9LA 1NK5A 3O4QA 4H0TB 1QQCA 4W5QA 5M1QA 1KAZA 1OH6A 4BRFA 1N8RO 4QS7A 2D0AA 4QOZB 4GV6A 3QETA 3FFKB 5KQ8A 3WQTA 3SUQA 4ID1A 2FBXA 1D9DA 4DSJA 3O4WA 1RBVA 3ZT0A 1NGAA 2P9LB 1CXQA 2FSKA 3B8AX 1FW6A 3I8DA 1ASVA 5AQIA 2YHWA 4FWOA 4KO0A 1SQKA 3J7AP 1LWEA 2I7PA 3DRRA 4CHQA 4B8AB 2GEMA 5TKWA 3CCVN 1KTQA 5FPMA 3AA5X 3SJJA 4B1ZA 1TKDA 5JLFA 2ASMA 3NVMA 3PLAA 1WSHA 3VQ9A 2IVPA 4ICLA 2P51A 3LANA 5AQJA 4CF2A 2QWRA 1YT3A 1Z25A 4OPJA 1ESVA 4KHQA 3SAHA 2NRHA 4Z4HA 4CBWA 2OANA 2WOMA 3AVIA 1NNEA 4OVLA 3RRGA 1MWKA 1QQOA 3LDQA 1RDUA 5CZ2A 4PL7A 3AGKA 4AHUA 4HUGA 4BRAA 3AO4A 3MXJA 4CIFA 2QWPA 3KD5E 5AQNA 5AQMA 2HW3A 3I56N 3O80A 4Y1CA 2P9NA 3QFPA 3MCPA 1WAFA 1OH7A 1IBKK 2E2QA 4DSIA 1NKBA 4JKGA 3K57A 2AP1A 3WNFA 4CJUA 1VQ8N 4YORA 3L2QA 2ZGYA 3BGRA 1N33K 3NVKA 3IMXA 3AVFA 4FJXA 4CERA 3EL2A 3VOVA 1X3NA 3SZ2A 3TTCA 2X78A 4JKBA 1WSJA 2BTFA 1EQYA 1CZAN 2Z1IA 3HL8A 3AAQA 4WFNL 1KD1O 3QINA 2H3GX 1RBUA 4KTZA 3IRXA 4JI4K 2RE2A 3QLHA 4KH5A 2CH6A 3VQ7A 1NK4A 1TYQB 4CEAA 2CGLA 1ZXOA 3DRPA 4PQUA 1B9FA 2P9IB 2YJFA 4JI7K 3O08A 1HYVA 4K41A 3HRGA 4IG0A 4X62K 3CJ1A 4E89A 4WQ5C 3GOIA 3J7YP 3A5NC 3LP2A 1U48A 4CHNA 3C6UA 1TKZA 4RW7A 5KPZA 4DR7K 3G25A 3D2FA 3ATVA 1BG3A 1JXEA 3SQ0A 1HKBA 4CZGA 3ZEUA 4DV2K 3VETA 4DQSA 4IKFA 4DHYA 1P8ZA 4FPAA 1K6YA 3I55N 3ALYA 2CGKA 2D0PA 3KHYA 4BQLA 2OTJN 1YTAA 4K0KK 4FWPA 5JS1A 1HJOA 3NDKA 2UYTA 3MX5A 2YHYA 2D0OA 3F2KA 5BRDA 4CJ7A 4FL9A 4NYNA 3O3HA 3TWHA 2NUBA 4FPBA 3VQCA 3G4SN 3CI5A 2DY4A 3VESA 3LDNA 3E01A 4M3ZA 1WSFA 3SBGA 4Y0WA 3OYIA 1NM1A 3CG7A 3NF8A 3CERA 5HP1A 4CHZA 4FJ8A 2QA4N 1KFSA 2OZSA 1HYZA 3L3VA 1VQMN 1VAZA 1RGIA 1HNWK 4EIAA 5DM6L 2O8CA 4B9LA 1TK8A 4FWKA 5AQGA 4N41A 1HUXA 4B1UB 2YNHA 2YX6A 4E7IA 1BQNA 3P83D 3OYHA 3H08A 3NH2A 3O9TA 3MDQA 3V1QA 2LSNA 5C24A 1SUQA 4CEQA 4BGBA 4Q5VA 3KKSA 4MQ3A 4JKGB 2FLOA 5SWMA 3SQ4A 1J5EK 2ATQA 5J2QA 4N76A 3QMLA 3DI6A 2FSJA 4C8KA 4B9MA 1VK0A 3OVNA 4FJHA 5J2PA 1Q9YA 3DLRA 1GOCA 1X9MA 3QBWA 3QEVA 1NLVA 2EX3A 3PV8A 4FCYA 4IO8A 4BGAA 4BR0A 3AVJA 4B8CA 1CZ9A 4CF0A 2YHBA 3VMFB 1Z6RA 4DQRA 1NJZA 1JCEA 4FXDA 3HOTA 2VGNA 2EWSA 3W0LA 1T44A 3ZT1A 2V7YA 2P5GA 1IG8A 2QWQA 3DWLA 3DOKA 4H5NA 1TAUA 3TSQA 2YV0X 5GAHP 2YKMA 2UUCK 3K9JA 5I9EB 4BRGA 3LZIA 1X3MA 4A57A 1J9AA 1U2VA 3ZSQA 3KTQA 4HCCA 4I6MA 5KI6A 2E1YA 4K8XA 3LL3A 4IO9L 2HVIA 3G71N 3TTFA 4I9QA 3TAQA 1IJJA 4DTJA 3GBTA 2YCHA 4M7YA 4BRCA 1SKRA 2VG5A 1LOTB 3PY8A 4FJ7A 3THYA 1RT6A 3J8AA 4IJAA 2X6NA 1C1AA 3A5OC 5KQDA 1KCFA 1GLLO 2ZJQL 3IAYA 3E9PA 2QXFA 3HPHA 5AFUH 3AGRA 1IBMK 3DXKA 4JNEA 4E7KA 4DTPA 2RPIA 1ATRA 5C2DA 2UXCK 4ISGA 1VQNN 3KK2A 2F8TA 1TK5A 2D4WA 2DFEA 1NWKA 4Z4CA 2D0BA 4O0IA 4CVNE 3OYGA 2A3ZA 1NGCA 2D0CA 4DFPA 1KAXA 3HM9A 2V52B 2FF3B 3OYDA 4BC3A 2O8DA 2UXDK 3CPEA 2ASOA 3AVAA 3L4IA 3OS0A 1NK8A 1BL3A 5AQHA 1VQ7N 4DFJA 1I94K 2O8CB 2HF3A 4Z0UA 1NGJA 3GL1A 1WB9A 2IDOA 2Z1JA 4DG1A 2G8HA 1QSSA 4CBUA 2JLEA 2W41A 2YKNA 4K25A 3L3UA 5I3UA 4ISEA 2P9UB 3AA4A 1BO5O 3HBTA 1IKYA 2A42A 3KKRA 3DMJA 1KSPA 2Y1IA 3PUFA 4BR5A 1QHAA 3NF6A 3R8EA 4DSFA 3L2UA 2F8SA 2RHKA 4W5OA 2YNIA 4O4GA 3TI0A 4KHNA 2E8AA 3K5LA 4PY5A 1KXPA 3HSCA 4RW6A 1BOTO 3CFRA 5AQYA 4FZZA 4FWSA 3WEEB 3O9SA 4IEIA 4AHRA 1NBWA 1SV5A 4YY3K 4BRMA 3D0PA 4BDPA 1ASWA 4M3TA 1CXUA 2A41A 1GLEG 5BPNA 2NLXA 4BR4A 2UUAK 4C1NI 1LW2A 4RW4A 1VSIA 3H1VX 1N5YA 4JI6K 1YI2N 3JXUA 1U2VB 5C10A 2VGMA 4BVPA 1RDAA 4Z4EA 4EAHD 3LM9A 5AQWA 4B1YB 1JJ2M 2YHAA 2ITMA 1UOCA 3QESA 4GKJK 3P1GA 3L8BA 5EXWA 2O8EA 3M3ZA 4CGFA 4M41A 4OJRA 3KLGA 1RDBA 1QS4A 1C0MA 2WFBA 4I2PA 2FF6A 4CEBA 3A2FA 4MDAA 1MDUB 5AZIA 4CESA 3T1AA 3CC7N 1WBDA 3O1BA 2YNFA 4B9VA 1BISA 3ZLJA 2KZZA 2IC3A 4O8KA 3LP1A 4AHVA 3HPOA 2HNYA 2R7YA 2G8VA 3QIOA 1VHXA 1TL1A 4IOAL 3TAEA 1E4GT 3OHRA 1J53A 3ZSZA 4FLWA 4CJEA 2F4VK 5AQLA 3ID6A 4DTSA 4NB4A 1SKWA 3MXMA 3OTOK 5D3GA 1NGDA 4H4MA 4BE2A 3HO1A 4L8RB 3LAMA 4FM1A 3O6WA 5C25A 2QWLA 4DTNA 4FZYA 1S1XA 1MWMA 2O8DB 4MLHA 1UA1A 1KRPA 1YIJN 4CJ4A 1QSYA 3PO4A 4DCHA 2Q0UA 3CM5A 4WQ5A 4LF9K 4QS8A 1VSLA 4FJGA 4O55A 3O1WA 4H5WA 3KK1A 3VA3A 5I42A 2PFUA 3NE6A 3THXA 2WC9A 1W97L 2YHXA 4CJVA 3IFRA 1Q8IA 1C6VA 5J1EA 1X1PA 4ID5A 3SBTA 3V1RA 3VEWA 3K2PA 4EHUA 3CPWM 4W5TA 1ILYA 2Q0RA 4FVMA 3CCJN 1BCOA 1GLCG 3EZ5A 4HUEA 4CIGA 2I7NA 2HHQA 4M3XA 2IAJA 2CH5A 4C1NK 2OCEA 5EOYA 3WXLA 3P38A 3CD6N 2XY5A 3SI6A 4B3MK 3ITHA 1XI1A 3MECA 4JI5K 2ZF5O 4FOIA 1RBTA 4LFAK 4FLXA 4MO5A 1DKGD 4KHWA 4JI2K 2P9KB 1RTDA 1NGBA 4RW8A 1RCHA 1VQPN 3ZT3A 3BF3A 4M3WA 4XIUA 3LAKA 3TR8A 3B6OA 2XY7A 1GLFO 2PBDA 2FBYA 4M7XA 4FJIA 3CM6A 4Z4FA 3OYFA 3G0ZA 4M3YA 3OYEA 3HT3A 3VEZA 2HHHK 4EP4A 2G8FA 3MCAB 3MK6A 3L2VA 1IO2A 4J2AA 3CXCM 5AZIB 4JKCA 2BUPA 4JKEA 3S41A 3F73A 4TSXA 4EHTA 2KTQA 2ETJA 1IKVA 4OGCA 4DF4A 2PAVA 2PYLA 3VEXA 4ELVA 3EYZA 4LF7K 5C0YA 1NKCA 5KPTA 4JK8A 4PUOA 4JKDA 1S1TA 4CEFA 4CGHA 4CZJA 1NGGA 3KK7A 4F9OA 1TAQA 3J81O 5JVHL 3I33A 2P9PA 4BC4A 1NGHA 4DV3K 1N6QA 4F8RA 4YNQA 3LP0A 4DV4K 1Z26A 1HRHA 5M1KA 2GBZA 4BROA 4DR3K 4BRLA 4NO7A 3VQ5A 4CEOA 1DLOA 1KFDA 1Q82O 1QQMA 4CD3A 5E41A 4OPAA 4A62A 3PSIA 5C2FA 3L0QA 3O8MA 3D7EO 3MXIA 4PHTX 4CJSA 3HM8A 2W42A 1HNVA 5F1XA 1WSGA 3GG4A 4A5AA 5LL6Z 2F9WA 4IWVA 4B1VA 3B6PA 1VRTA 4N56A 4FZXC 4E1MA 3VERA 2Q2RA 3OYJA 1QVGM 2OPQA 1JL2A 3QEWA 3NF7A 4B08A 1KAYA 3QBXA 4YOYA 1HNXK 3AY9A 3E66A 4PKGA 2OPRA 5DMRA 3NCIA 3CJ7A 3AV9A 1G15A 1YF5L 4WFAL 2VG7A 4FW2A 4DQQA 1E4FT 2YI1A 1BA1A 3TSPA 4BC5A 3M1FA 4CFCA 5IT9O 3T1HK 2ZQBA 1Q81O 1K8KA 1Q9XA 2VG6A 4IG3A 3E9OA 3ULEA 3SPZA 3CQXA 3DXMA 4OKKA 4LD0A 1L5UA 2WTUA 5T7BA 3V9UA 4ZHRA 3S3OA 1NOYA 4H4OA 4J2EA 3U9DA 4CZFA 1REVA 2O4GA 2NRVA 4IDHA 3U4LA 4RCHA 3N4PA 1P90A 1YAGA 3U8XA 4DU4A 3VENA 4C23A 2FSNA 4CFDA 4FJJA 4JLHA 5JS2A 1NJYA 4IEEA 4C8OA 5H1SQ 2B6AA 1NOZA 3RSEA 2GUPA 3RTVA 2ZWHA 1C0UA 3SMSA 3ASMA 4BREA 5FRMA 3MWPA 2RF2A 4BVOA 3LDSA 1XMOK 3UB5A 2AJQA 2HHXA 5LMUK 4K43A 3QFUA 4F4KA 4CZMA 1G99A 1RT3A 3SJHA 4CI6A 1R59O 2VWKA 4OKJA 1K8AO 4KREA 3OYKA 4JI8K 1RDWX 4FSVA 5CR4A 3FZKA 1JLFA 1XHZA 3CHWA 3T69A 5FLXO 4PKIA 4U7BA 2A5XA 4B3SK 5BRFA 3WNEA 3AO5A 4H5TA 1SL1A 1ZBFA 3F5TA 5AQFA 4DTXA 3OYBA 1F21A 3A0IX 3VQ6A 4N47A 4OX9K 1RT4A 2Q36A 3J7ZO 2P9PB 4KI4A 3LPTA 5ELZA 5KPRA 4IOXA 3M8SA 1S1UA 3P4IA 1EP4A 3P5JA 4RWTA 1LAWA 4MFBA 2FXUA 3FFIA 2UUBK 3CF5L 4CGIA 4DV0K 4OGEA 3K58A 4WF9L 2FBTA 5BR8K 3H46O 1J54A 3ZX0A 4QS9A 2DPNA 4CJQA 1VQ6N 5HOOA 3DOLA 3DM2A 3VQQA 4E1NA 1ZBLA 5GAGP 3RR8A 2JWLA 2QW9A 4AHCA 3FR0A 1WAJA 4CHYA 4BWJA 3KK3A 3NHGA 1LAVA 2QWMA 5ADXH 2E88A 1QHTA 3TABA 4V19S 4YHHK 2P9NB 3CCSN 1WUAA 3TANA 3TAGA 3CJ9A 4DMNA 2HBMA 3QO9A 4CBXA 1L3SA 3DJCA 4DR1K 3KJVA 2IS3A 3CCEN 1BU6O 5CZ1A 3OJSA 5BPLA 4W5NA 5HRPA 4CEZA 3G6EN 3C65A 1GLBG 2ASPA 1NGFA 3ULEB 4OPKA 3DXMB 1T05A 5AJ3K 1FKOA 1VSFA 3U3GA 3HVRA 2F96A 5JVGL 4RG8A 1HMVA 4Y1DA 2F7TA 2HNDA 1WSEA 3KD1E 3DAWA 2PZSA 3GE1A 1ZYQA 2KZMA 3SYZA 3S3MA 1BWFO 1K9MO 2O8FA 3RMCA 4FO0A 5FPDA 4A2AA 4CJWA 1D8YA 3ID8A 5C12A 3HPGA 1QSLA 3CCLN 5E84A 3O3FA 5HRRA 4EZ9A 3O4NA 3KLHA 4C8LA 4FLTA 4FJMA 4H0PA 3V81A 1JLGA 4JK9A 1FK9A 4DV6K 4FJLA 3OYMA 1BIZA 4KHYA 1E3MA 4FLVA 4BE0A 3D2FB 4KI6A 3LP3A 3CYMA 2BE2A 5JMVA 5J2MA 4B3OA 3KZBA 1S6PA 1RBRA 5M1PA 3ZEUB 4BR9A 1TUUA 3DRSA 5C42A 2FC0A 1BHLA 2QEXN 4DFKA 4MLEA 1T6DA 1S6QA 3KLIA 1XUPO 3QIPA 4CZKA 1DTTA 4AHSA 2HOEA 2KHOA 2QKBA 3QNNA 1NU0A 3ZSWA 3OJUA 4XEIA 4J8FA 2NRRA 1NGEA 1EWRA 4DV1K 4JS4A 2NNWA 3NGYA 3VTHA 1ATNA 1LW0A 1QQNA 5AQPA 1VSKA 1T7PA 4B9SA 5FROA 4KTWA 1X9JA 4M63C 3O9QA 4JD2A 2DTUA 5KGWA 1B9DA 4DR5K 5C15A 4BQZA 3BY5A 3VEVA 5GINA 3CMAN 3ZT4A 3MAQA 2J4RA 3MMVA 4DSLA 1GOAA 1HPZA 3QEPA 4CJRA 4J2DA 1EKEA 3JAMO 5CE3A 3QEIA 4KBOA 2HBKA 3SLCA 4CJLA 3AVKA 2E2OA 4JI0K 3MEEA 2KLAA 1JCGA 1SL2A 4DS4A 4B9UA 1YVUA 4DTMA 2ZJPL 1TKTA 4CGJA 3QNOA 4BRIA 1S3XA 4BRDA 1Z05A 4JN4A 5AQVA 5B8HA 2QWOA 1HLUA 4CHOA 2BH1A 5GADP 4E3SA 1U6ZA 4O0JA 1S5JA 5DK5A 3V9WA 1ZBHA 3UKRA 2GWKA 4BR7A 4HHTA 2NRXA 3AA2A 4DTRA 3C95A 3DLBA 1EETA 5AZJA 3ISNC 5E26A 2P1JA 5M1NA 1NK9A 1YJNN 4MDBA 1L3VA 4LF5K 4IZ9A 4GVEA 3AVGA 3D2EA 1OH8A 4KAZA 3SUPA 4XH4A 1KVAA 2VQFK 1VQKN 3R9PA 1BQMA 5F0XA 4DTUA 5AQUA 4CZLA 4CK2A 4O5BA 4JKFA 4FLYA 3HI0A 2VCPA 4KH4A 5LJVA 2ZJRL 4I6MB 4A5BA 1DGKN 5K14A 2RN2A 4H0VB 3RR7A 4WE1A 3AVMA 4B9NA 2X74A 2NRTA 4NLCA 4JRPA 3RMDA 1BDGA 4CJTA 2QM1A 4BRNA 3THYB 1N36K 5BRHA 1XNQK 1L3UA 1QTMA 3FZMA 2HHTA 2HHWA 1RT1A 3HOSA 4F3OA 2RKIA 1U49A 2Q3SA 3OBWA 2W6LA 3NGIA 4DU1A 5DM7L 1HKGA 2Z1GA 4JHDA 4CGDA 3AVNA 4CK1A 4YFUA 4GV3A 1N32K 3M8RA 4BWMA 3NBPA 3SPYA 1S9EA 3OYLA 3SCXA 3DXKB 3VPZA 4CD1A 4CZIA 3WNGA 4R79A 2G8IA 3V9ZA 4H0YB 4YOXA 1Y97A 4BACA 3V6DA 3N4QA 3VN5A 4OLBA 4WYBA 3RVCA 4YOVA 4ELUA 2IGIA 3RMAA 3S9HA 1NKEA 3GDQA 5FPNA 5M1OA 5FPEA 3BP8A 5AQQA 5KGXA 3WXKA 2NRWA 1VSMA 3EKSA 1I3AA 3TAPA 1RT5A 5HRNA 4U67L 3HSTB 2P5OA 3O9RA 3H1QA 1HNZK 2W6KA 3SK3A 2P9SA 3ZCMA 3U9ZA 3A5MC 3K0SA 4WQ4C 3R6MA 1TVRA 2GUIA 3BDPA 3ZX2A 4PKHA 3OYAA 1GLJO 3MWTA 4CE9A 4JV5K 4FW1A 4CZHA 3V1OA 3OS2A 2A1SA 3MN5A 3R3LA 5AQSA 3PX6A 3HP9A 1WN7A 5EX5A 1KLNA 4KTQA 3OYCA 4LH4A 3A5LC 4KB0A 1LWCA 4YDUC 4DR2K 3AO3A 5AFUA 4CJFA 5JICA 3LZJA 4E1JA 2YNGA 3IKMA 3UKRB 3C7NA 3CFOA 1TUYA 5AZJB 4DUYK 1TV6A 4IFVA 3ZT2A 2KW4A 3VQPA 3D2EB 2OYQA 2V51B 3KIOA 1C1CA 4CF9A 1SS6A 5KTQA 1CLQA 1D9FA 3HYFA 1VSJA 3CFPA 3EEQA 4DS5A 3LDOA 4LF6K 1BA0A 5LJWA 3A8YA 4LFCK 4DR6K 1XWLA 4JYAK 1ZBUA 4FYDA 1S22A 1ZBSA 4AHTA 4B9TA 4KH6A 3C6TA 3VF2A 2O8EB 3RRHA 4KHUA 3K5MA 3MEDA 4K42A 1QE1A 1KLMA 3CCQN 4DWIA 1YUWA 3CQYA 3TU5A 3EO3A 3LM2A 1Y64A 2Q97A 3IG1A 3D45A 4HCBA 2YJEA 4JHDB 1JLQA 2XRIA 4CHPA 5HROA 1NK6A 2P9IA 3SAGA 1U04A 3HZ6A 3VF6A 3NGZA 5AQZA 2AA4A 4ILGB 4CCHA 5AQOA 3TARA 4EP5A 1HPMA 3ZSXA 3LWLA 4DTOA 4E7LA 1HQEA 1A5WA 2CGJA 1YVNA 3UIQA 1WNSA 4OPHA 3C6HA 4FWRA 2F9TA 4GKKK 4JKHA 3BUZB 3UKUA 4QAGA 1I39A 3BEXA 1QZ5A 4ZTFA 4H0XB 3I0RA 2HBLA 1A5VA 4GMJB 4HVJA 3HP6A 2P9SB 3HK2A 4EFHA 4JI1K 3THWA 1Q86O 4L3QA 3VGMA 3RMBA 1ZBIA 4FM0A 1W9HA 1WLJA 4CJ3A 4B1WB 4J2BA 3THXB 1T8EA 1EXQA 3DYAA 3BZCA 3Q7BA 4FWQA 2O4IA 1JLCA 4A2BA 1H1VA 3MN9A 4C8MA 1MA9B 2XY8A 4XH5A 3K5NA 4BDZA 5EVZA 3SV3A 2XY6A 3OA9A 1KVBA 4H8KA 1HYSA 4R5PA 4IJNA 4DF8A 1XHXA 3C0BA 3VQ8A 4H5RA 3AAPA 4PWDA 4Z4GA 4JI3K 2A6AA 4CIEA 1YJ9N 2KFZA 4LY7A 1S72N 5HBMA 3TPQA 4CJPA 1T3VA 3C7NB 3SUOA 5EY4A 1NGIA 2V7ZA 2ZE2A 3LDLA 3NH1A 3CC4N 4UY8O 1RTJA 3PIOL 2A40A 3J80O 1RDDA 4C8NA 3S3NA 4NXMK 4GW6A 4QCLA 3VQAA 3VTIA 3C6AA 1HR0K 3Q7CA 3SMPA 3AO2A 5AQRA 1JXBA 2D1KA 4CFBA 1KQSM 4A59A 3RWUA 4BG8A 1ITGA 5TKYA 5SZTA 4FOEA 2HHUA 3AVCA 4FJNA 4F2SA 3IUCA 3E1YA 3K59A 4BDYA 4B1XB 4KFBA 4JEPA 1RFQA 4HUFA 3VEOA 1YJWN 2O8BA 2E4LA 1VQ9N 2HMPA 4M42A 2QKKA 3SQ2A 3K5OA 1EX4A 1SL0A 2HB5A 1SZ2A 3ENBA 3L2RA 4GY2B 5AQKA 4DQ8A 4DLEA 4KHPK 1BUPA 4CF1A 1EWQA 3ZSRA 3CCMN 2G8UA 4DSKA 4PL8A 1VQ4N 3CJCA 2UXBK 4ILJA 5CYMA 3VA0A 1RTIA 1YITN 1R0AA 1YHQN 3TTDA 4BRHA 3EY1A 1Q18A 4ILHA 4OKEA 1XQSC 3UKUB 3V9XA 1LCUA 4CF8A 3O3GA 1HX1A 3R1XA 3TAFA 4FLZA 2PYJA 3FZLA 2KKZA 3AA3A 2G8KA 3THWB 1VSDA 3VQDA 1BIUA 2Z1HA 3ENOA 1S1VA 3EN9A 2W40A 2A1RA 1NG9A 2ZD1A 1OKJA 1HQUA 4DV7K 2VWJA 1FKPA 4M3UA 3NH0A 3NF9A 4PA1A 1TKXA 4H0OA 4NCAA 1W7AA 5CY4A 4DV5K 2E6LA 1NMDA 1BCMA 4CZEA 4JS5A 4W5RA 1U45A 1W0HA 2E6MA 3QICA 1VQ5N 2NZTA 1S1WA 2ZGZA 1SAZA 3SNNA 2IIRA 2KQ2A 3H3NO 4YOTA 4FK4A 3C94A 3KWIA 1BGXT 1K8KB 3LDPA 4AM7A 1J6ZA 3HXMA 4IFYA 3BF1A 2QK9A 3T7ZA 1XMQK 5GAEP 4E0DA 3KLEA 3M5RA 1SKSA 3M8PA 3JYTA 3M8QA 2IVNA 4I2QA 1TL3A 1VSHA 4IFEA 1RNHA 2P9UA 3CJAA 2JWKA 1ZC6A 4GVMA 3EE8A 3VGKA 3P39A 1U47A 4HWIA 3WUHA 4DU3A 4CW7B 3EZWA 1LV5A 2E5LK 3THVA 3ATUA 4OLAA 3RSEB 4CJKA 4Q0BA 1YXQA 4M3RA 3VEYA 4CJ5A 4FVUA 4LH5A 3QERA 1X9SA 3NMUA 1BI4A 3OBYA 3SUNA 3LALA 3ZX3A 2HVHA 3OW2M 3WEEA 1NMNA 4N5SA 4DFMA 4HTLA 3H3OB 4WQ4A 3V4IA 4NLBA 2I5JA 3CJBA 4IDKA 4BR2A 2GTDA 1QVFM 5KRTA 1J5OA 2O8BB 4CK3A 4OO1J 1UWBA 3VQBA 2NRZA 2WONA 4IOCL 2GX9A 3OYNA 1JLEA 3WQUA 2UU9K 5EU7A 1IKXA 1YTUA 2E1ZA 1T6CA 3DLEA 1V4TA 2ZM6K 3CCUN 2G8WA 2B5JA 4FJKA 1CZBA 3HJFA 4YDUA 3L2WA 1S9GA 2OPSA 4O5FA 3WT0A 4FJ9A 5AQXA 3HVTA 3WXIA 1V4SA 3OY9A 3SV4A 2DFFA 3NFAA 2QXLA 1OVYA 4FLUA 2GELA 3V9SA 1ASUA 3CIPA 3IDHA 1C0TA 3FLCO 3D6RA 1M1KO 2HMIA 4X64K 1VRUA 2BANA 3WXJA 5GIOA 3O9UA 3VQEA 4BE1A 5JLHA 1LWFA 3P31A 4X65K 4BRQA 4NCBA 1XC9A 3I8BA 5FRNA 3OS1A 1HJRA 3CMEN 3L4QA 3TSUA 1UA0A 4AH9A 4LF8K 3SAFA 3M6GA 1GLAG 1MU2A 2HNZA 4X66K 4Z94A 2E20A 4LFBK 3WNHA 4FWNA 1NJIO 3NAEA 3MN6A 4O44A 5AR0A 4B3TK 1IBLK 4UQGA 5CHIA 2HSTA 4IBNA 1T03A 3O5BA 4JK7A 1IH7A 4K8ZA 1WBBA 1JCFA 1RT2A 1KVCA 2E2NA 5J2NA 3AO1A 2E2PA 4E19A 2ITGA 1TK0A 1FJGK 5BPMA 3PX4A 1D5AA 3QEXA 3T1YK 3CC2N 3DLGA 4BRPA 1M90O 4BY9C 4NXNK 1C0GA 2QTDA 1JL1A 3ZSYA 3MEGA 4KRFA 2O8FB 4KHSA 4LSNA 1DTQA 2WUSA 1C0FA 4DR4K 2IOCA 5HL7L 3VQ4A 3W3DA 4FK2A 2VYPA 4G1QA 4YOWA 3LWMA 3ULDA 1BI4B 4O8UA 4I9LA 4RTFD 4FM2A 4F3TA 3H6EA 1DEJA 1HNIA 3ZETA 1OH5A 4FWMA 4AM6A 2Q1NA 3H45C 3DLKA 3JS6A 3VGLA 4FWLA 2EHGA 3MN7A 4F2RA 2VQEK 2HHVA 1RTHA 3AARA 3DLLL 1QZ6A 1NJWA 5IWAK 5ADXA 1EO1A 2GV9A 3CQ8A 4FK0A 4H5VA 3FGUA 2P9KA 1O13A 4I7FA 4WCEL 1K73O 3MX2A 1KC8O 1WOQA 1D4XA 3CCRN 1RT7A 4KV8A 5BR9A 4CEDA 5M1FA 4B9QA 3PIPL 4NCGA 4ISFA 3SQ1A 3QB0A 4HTUA 3LPUA 3EKUA 5BREA 4DSEA 4FJ5A 4LF4K 3FE1A 4CECA 3DLHA 3KWGA 1OVQA 3ZSVA 4RW9A 1RILA 2Q31A 3U3YA 3FZFA 4AQYK 3F9KA 4JD2B 1W2BM 3UE5A 4ELTA 1XNRK 3ENHA 4Z4IA 3K9KA 4DLGA 2P9LA 4GV9A 1RDCA 4BG9A 4BRKA 2XO7A 2HBJA 2WBNA 5F2RA 4WFBL 3BZKA 1N34K
chains in the Genus database with same CATH topology
3AVAA 4KKOA 4FM0A 3OS0A 1W9HA 4LSLA 3VQQA 4E1NA 3PX0A 1ZBLA 1WLJA 4CJ3A 1NK8A 1BL3A 3RR8A 4J2BA 1T8EA 2D5RA 1EXQA 3DYAA 3IS9A 4AHCA 4DFJA 2O4IA 1JLCA 4Z0UA 1WAJA 1GOBA 4C8MA 2XY8A 2IDOA 4CHYA 2FBVA 2Z1JA 4BWJA 3TAMA 3KK3A 3K5NA 4DG1A 3NHGA 4BDZA 3SV3A 1LAVA 2XY6A 1JKHA 1KVBA 2G8HA 1L3TA 4H8KA 1QSSA 3ZSOA 1O1WA 1QHTA 1HYSA 4R5PA 3TABA 2XHBA 4DF8A 1XHXA 2JLEA 1B92A 3VQ8A 3TANA 2DFHA 3TAGA 4PWDA 2YKNA 4Z4GA 4CIEA 3G10A 4DMNA 2KFNA 3L3UA 3AVLA 4M45A 5I3UA 2KFZA 4LY7A 3AA4A 3QO9A 5HBMA 4CJPA 1L3SA 3KJVA 3SUOA 2IS3A 5CZ1A 1IKYA 3OJSA 4W5NA 5HRPA 3PO5A 3KKRA 4CEZA 3KLFA 4E7JA 3DMJA 2ZE2A 1KSPA 4DQIA 2Y1IA 3PUFA 4OPKA 3NH1A 2BDPA 3NF6A 4DSFA 1T05A 3L2UA 2OZMA 1RTJA 2F8SA 1FKOA 1VSFA 4ZTJA 4W5OA 1UAXA 1C1BA 1WSIA 1RDDA 2YNIA 4O4GA 3U3GA 4C8NA 2F96A 3HVRA 3TI0A 1TGOA 4KHNA 2BGGA 1IKWA 1HMVA 4RG8A 3K5LA 4PY5A 1JLAA 3S3NA 4RW6A 4Y1DA 4GW6A 2HNDA 4CGGA 3JSMA 1X9WA 2PY5A 3VQAA 4KB1A 3CFRA 4QCLA 1WSEA 3KD1E 4FZZA 2PZSA 3AO2A 5FDLA 1ZYQA 4JRQA 2KZMA 3SYZA 3S3MA 4AHRA 1FXXA 1RBSA 1SV5A 1JXBA 2X6SA 1NK0A 4CFBA 3RMCA 4CEEA 1U4BA 2OPPA 3D0PA 4BDPA 1ASWA 3I0SA 4M3TA 1CXUA 4NYFA 3RWUA 4CJWA 1D8YA 1ITGA 2Y1JA 1IG9A 3HPGA 1QSLA 5SZTA 1LW2A 5HLFA 4RW4A 2HHUA 3AVCA 1VSIA 5HRSA 4FJNA 3O3FA 5HRRA 4F2SA 4KPYA 3AVBA 1N5YA 4EZ9A 3O4NA 3KLHA 4C8LA 3K59A 1VSEA 4BDYA 4AILC 5CYQA 4DQPA 1JLBA 4KFBA 1RDAA 4HUFA 4Z4EA 2HHSA 4FLTA 4FJMA 3V81A 2OA8A 5KRSA 1JLGA 3T19A 1NJXA 3T3FA 4E7HA 1FK9A 2YHAA 2E4LA 1UOCA 3QESA 4EZ6A 3OYMA 4FJLA 1BIZA 4KHYA 4M42A 4FLVA 3P1GA 3L8BA 1NK7A 4BE0A 3U6FA 2QKKA 3SQ2A 3K5OA 1EX4A 4M41A 4OJRA 4CGFA 1RDBA 3KLGA 1SL0A 4KI6A 1QS4A 1C0MA 2HB5A 3LP3A 4I2PA 3CYMA 2B4JA 1A5XA 2BE2A 4CFAA 3L2RA 4CEBA 4DLEA 5J2MA 4B3OA 1S6PA 4CF1A 3A2FA 1RBRA 4CESA 3T1AA 3ZSRA 2G8UA 4DSKA 3DRSA 2JGUA 2FC0A 2YNFA 5C42A 4B9VA 1BHLA 1BISA 2KZZA 3AVHA 2IC3A 5CYMA 4DFKA 3LP1A 4AHVA 1NK5A 3VA0A 3O4QA 1RTIA 3HPOA 1S6QA 3KLIA 2HNYA 1QQCA 2R7YA 1R0AA 4W5QA 2G8VA 3QIPA 3QIOA 1TL1A 4QOZB 1DTTA 2D0AA 4AHSA 2QKBA 3EY1A 3QETA 3TAEA 3QNNA 1J53A 3ZSZA 4FLWA 4CJEA 4OKEA 3SUQA 3ZSWA 4ID1A 3OJUA 3V9XA 2FBXA 4DTSA 1SKWA 1D9DA 4CF8A 3O3GA 4DSJA 4JS4A 3TAFA 1RBVA 3NGYA 3ZT0A 3MXMA 4FLZA 5D3GA 4H4MA 1LW0A 4BE2A 2PYJA 3HO1A 1CXQA 4L8RB 3LAMA 1VSKA 3AA3A 2G8KA 3I8DA 1ASVA 4FM1A 1T7PA 1VSDA 3VQDA 5C25A 4B9SA 5FROA 4DTNA 4KTWA 4FZYA 1S1XA 1BIUA 2Z1HA 4KO0A 1S1VA 1LWEA 2A1RA 2ZD1A 3DRRA 4CHQA 4B8AB 1KTQA 1UA1A 2DTUA 3AA5X 5KGWA 1B9DA 1HQUA 3SJJA 1KRPA 4CJ4A 1QSYA 2VWJA 1FKPA 1TKDA 3ZT4A 4M3UA 3MAQA 3NH0A 3PO4A 3NF9A 4PA1A 1WSHA 4DSLA 1GOAA 1TKXA 4NCAA 3VQ9A 1HPZA 4ICLA 3QEPA 2P51A 3LANA 5CY4A 4CJRA 3CM5A 1EKEA 4CF2A 4J2DA 3QEIA 2E6LA 1BCMA 1YT3A 1Z25A 4OPJA 1VSLA 4KHQA 4JS5A 4Z4HA 4W5RA 2WOMA 4CJLA 3AVIA 3AVKA 1U45A 4FJGA 1W0HA 3MEEA 2E6MA 4O55A 4OVLA 3RRGA 1SL2A 3KK1A 3VA3A 4DS4A 5I42A 4B9UA 3NE6A 5CZ2A 1YVUA 1S1WA 4DTMA 4AHUA 4HUGA 1TKTA 3AO4A 2KQ2A 3MXJA 1Q8IA 4CJVA 3SNNA 4CIFA 4FK4A 1C6VA 3C94A 5J1EA 1BGXT 4CGJA 3QNOA 3KD5E 1X1PA 4ID5A 3V1RA 3HXMA 3K2PA 4IFYA 2QK9A 4W5TA 2HW3A 4Y1CA 4E0DA 4CHOA 4FVMA 3KLEA 1BCOA 1WAFA 4HUEA 3EZ5A 3M8PA 4E3SA 3JYTA 3M8QA 1SKSA 4O0JA 4I2QA 1S5JA 1TL3A 5DK5A 3V9WA 1VSHA 4CIGA 4DSIA 1RNHA 1NKBA 1ZBHA 4HHTA 3K57A 3AA2A 4GVMA 3C95A 4DTRA 3DLBA 4M3XA 2HHQA 1EETA 2IAJA 3ISNC 3WNFA 2P1JA 4CJUA 1U47A 1NK9A 1L3VA 3L2QA 4DU3A 3AVGA 3BGRA 2XY5A 1LV5A 3SI6A 4KAZA 3SUPA 3THVA 4FJXA 3AVFA 1KVAA 3ITHA 1XI1A 4OLAA 4CJKA 4CERA 4Q0BA 3MECA 1BQMA 4M3RA 4CJ5A 1RBTA 4LH5A 4FLXA 3QERA 1X9SA 1BI4A 3SZ2A 3SUNA 4KHWA 3LALA 2X78A 4DTUA 2HVHA 1WSJA 1RTDA 4RW8A 1RCHA 4CK2A 4O5BA 3ZT3A 2Z1IA 3HL8A 4N5SA 4FK2A 4M3WA 4DFMA 4XIUA 3LAKA 3TR8A 4FLYA 3QINA 3V4IA 3B6OA 2I5JA 2XY7A 1RBUA 4IDKA 2FBYA 4KTZA 3IRXA 5K14A 5KRTA 2RN2A 1J5OA 3RR7A 3QLHA 4WE1A 4FJIA 4CK3A 3CM6A 4Z4FA 3AVMA 4B9NA 3VQ7A 1NK4A 2X74A 1UWBA 3VQBA 3OYFA 4CEAA 3G0ZA 3DRPA 4M3YA 4PQUA 1B9FA 3OYEA 3HT3A 2WONA 3OYNA 1JLEA 4JRPA 3RMDA 5EU7A 1IKXA 4CJTA 1YTUA 4EP4A 2G8FA 1HYVA 3DLEA 4IG0A 3L2VA 4E89A 1IO2A 4J2AA 2G8WA 2B5JA 4FJKA 3F73A 1L3UA 1CZBA 1QTMA 3HJFA 3LP2A 2HHTA 2HHWA 1RT1A 4TSXA 4F3OA 2RKIA 1U49A 4CHNA 2Q3SA 3L2WA 1S9GA 3C6UA 2ETJA 1U48A 1TKZA 2OPSA 3NGIA 4DU1A 4RW7A 2KTQA 1IKVA 2Z1GA 4FJ9A 4CGDA 3AVNA 3HVTA 4OGCA 4CK1A 4DF4A 4YFUA 2PYLA 3OY9A 3SV4A 4ELVA 2DFFA 3NFAA 3M8RA 4BWMA 3EYZA 3NBPA 3SPYA 1S9EA 3OYLA 3SCXA 4FLUA 3V9SA 1JXEA 1NKCA 3WNGA 3SQ0A 4PUOA 1ASUA 1S1TA 4CEFA 4CGHA 2G8IA 1C0TA 1TAQA 4DQSA 4IKFA 3V9ZA 2HMIA 1Y97A 4BACA 1K6YA 1N6QA 1VRUA 2BANA 3V6DA 3ALYA 3VQEA 3VN5A 4BE1A 4F8RA 1LWFA 4OLBA 4YNQA 4ELUA 3LP0A 4NCBA 1Z26A 1XC9A 1HRHA 1YTAA 5FRNA 2IGIA 3RMAA 3S9HA 1NKEA 2GBZA 3OS1A 5JS1A 1HJRA 3NDKA 1UA0A 3VQ5A 4AH9A 5KGXA 4CEOA 1DLOA 1KFDA 1VSMA 3TAPA 1I3AA 1RT5A 5E41A 5HRNA 1MU2A 2HNZA 3HSTB 2P5OA 4NYNA 3O3HA 3TWHA 2NUBA 3MXIA 3VQCA 3WNHA 4CJSA 3NAEA 2DY4A 3ZCMA 3E01A 4O44A 2W42A 1HNVA 4M3ZA 1WSFA 4UQGA 4KHSA 1WSGA 3OYIA 3CG7A 1TVRA 2GUIA 3NF8A 3BDPA 3B6PA 5HP1A 4CHZA 1VRTA 4FJ8A 4N56A 4FZXC 4E1MA 4IBNA 1HYZA 3OYAA 3L3VA 1T03A 3OYJA 1KFSA 4CE9A 2OZSA 4FW1A 4B9LA 1TK8A 3V1OA 3OS2A 2A1SA 2OPQA 1JL2A 3QEWA 4N41A 1IH7A 3NF7A 4B08A 3PX6A 3HP9A 4K8ZA 1WN7A 2YNHA 1RT2A 1KVCA 4E7IA 1KLNA 4KTQA 3OYCA 1BQNA 3AO1A 4E19A 5J2NA 4LH4A 2ITGA 4KB0A 3P83D 1TK0A 2OPRA 3H08A 1LWCA 5DMRA 3OYHA 3PX4A 3NH2A 3NCIA 1D5AA 3QEXA 3AO3A 3V1QA 3AV9A 2LSNA 3DLGA 5C24A 4CJFA 3LZJA 1G15A 2YNGA 1SUQA 4CEQA 4Q5VA 2VG7A 3KKSA 4FW2A 4MQ3A 5SWMA 4DQQA 3SQ4A 2ATQA 5J2QA 1JL1A 3CFOA 4CFCA 4N76A 1TV6A 3MEGA 3ZSYA 2ZQBA 3DI6A 4KRFA 4IFVA 3ZT2A 4C8KA 4LSNA 2KW4A 3VQPA 1Q9XA 1DTQA 2VG6A 1VK0A 4IG3A 4B9MA 2IOCA 2OYQA 3OVNA 3VQ4A 5J2PA 3SPZA 4FJHA 4OKKA 4LD0A 1Q9YA 3DLRA 3KIOA 1GOCA 1C1CA 4CF9A 1X9MA 1L5UA 5T7BA 3V9UA 4ZHRA 3S3OA 1NOYA 4H4OA 4J2EA 4G1QA 5KTQA 3QEVA 2EX3A 3PV8A 1CLQA 4FCYA 1REVA 2O4GA 3LWMA 3ULDA 3HYFA 1BI4B 1D9FA 4I9LA 3AVJA 1VSJA 3CFPA 4B8CA 4FM2A 4DU4A 4F3TA 1CZ9A 1HNIA 4CF0A 4DS5A 2YHBA 4CFDA 3DLKA 4FJJA 4DQRA 1NJZA 4JLHA 5JS2A 1NJYA 4FXDA 4C8OA 2EHGA 4F2RA 1XWLA 2B6AA 1RTHA 2HHVA 1ZBUA 1NOZA 3ZT1A 2P5GA 4FYDA 4AHTA 3RTVA 4B9TA 1NJWA 3C6TA 1C0UA 3ASMA 5FRMA 2GV9A 3DOKA 3CQ8A 4FK0A 2RF2A 1TAUA 3RRHA 3LDSA 4KHUA 3K5MA 3MEDA 2AJQA 2YV0X 2YKMA 2HHXA 1QE1A 3LZIA 4F4KA 4I7FA 1KLMA 1RT3A 1J9AA 3ZSQA 4DWIA 3KTQA 2VWKA 4OKJA 4HCCA 5KI6A 4KREA 1RT7A 4KV8A 3OYKA 4K8XA 4CEDA 1JLFA 2HVIA 1XHZA 4HCBA 3IG1A 3D45A 4NCGA 1JLQA 2XRIA 4CHPA 5HROA 1NK6A 3SQ1A 4I9QA 4HTUA 3TAQA 1U04A 3LPUA 4DTJA 3WNEA 3AO5A 1SL1A 1ZBFA 3NGZA 4DTXA 3OYBA 1F21A 2VG5A 3VQ6A 4N47A 4DSEA 1SKRA 3PY8A 1RT6A 4CCHA 4FJ5A 4FJ7A 3TARA 4EP5A 2X6NA 4CECA 1RT4A 3ZSXA 1C1AA 3LWLA 4KI4A 4DTOA 3DLHA 1KCFA 4E7LA 1HQEA 1A5WA 3LPTA 3ZSVA 4RW9A 3IAYA 1RILA 3M8SA 1S1UA 3UIQA 1EP4A 1WNSA 2QXFA 3HPHA 3P5JA 1LAWA 4MFBA 3U3YA 3FFIA 4E7KA 3F9KA 4DTPA 2RPIA 4QAGA 1I39A 4CGIA 4ELTA 4ZTFA 3KK2A 2F8TA 3I0RA 4OGEA 3K58A 1TK5A 4Z4IA 2FBTA 4DLGA 2DFEA 4Z4CA 1J54A 1A5VA 2D0BA 4GMJB 4O0IA 3OYGA 4HVJA 3HP6A 1RDCA 2D0CA 3HM9A 4DFPA 4CJQA 2XO7A 3HK2A 3OYDA 3DOLA 3RMBA 1ZBIA 3DM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVA A;  4KKO A;  4FM0 A;  3OS0 A;  1W9H A;  4LSL A;  3VQQ A;  4E1N A;  3PX0 A;  1ZBL A;  1WLJ A;  4CJ3 A;  1NK8 A;  1BL3 A;  3RR8 A;  4J2B A;  1T8E A;  2D5R A;  1EXQ A;  3DYA A;  3IS9 A;  4AHC A;  4DFJ A;  2O4I A;  1JLC A;  4Z0U A;  1WAJ A;  1GOB A;  4C8M A;  2XY8 A;  2IDO A;  4CHY A;  2FBV A;  2Z1J A;  4BWJ A;  3TAM A;  3KK3 A;  3K5N A;  4DG1 A;  3NHG A;  4BDZ A;  3SV3 A;  1LAV A;  2XY6 A;  1JKH A;  1KVB A;  2G8H A;  1L3T A;  4H8K A;  1QSS A;  3ZSO A;  1O1W A;  1QHT A;  1HYS A;  4R5P A;  3TAB A;  2XHB A;  4DF8 A;  1XHX A;  2JLE A;  1B92 A;  3VQ8 A;  3TAN A;  2DFH A;  3TAG A;  4PWD A;  2YKN A;  4Z4G A;  4CIE A;  3G10 A;  4DMN A;  2KFN A;  3L3U A;  3AVL A;  4M45 A;  5I3U A;  2KFZ A;  4LY7 A;  3AA4 A;  3QO9 A;  5HBM A;  4CJP A;  1L3S A;  3KJV A;  3SUO A;  2IS3 A;  5CZ1 A;  1IKY A;  3OJS A;  4W5N A;  5HRP A;  3PO5 A;  3KKR A;  4CEZ A;  3KLF A;  4E7J A;  3DMJ A;  2ZE2 A;  1KSP A;  4DQI A;  2Y1I A;  3PUF A;  4OPK A;  3NH1 A;  2BDP A;  3NF6 A;  4DSF A;  1T05 A;  3L2U A;  2OZM A;  1RTJ A;  2F8S A;  1FKO A;  1VSF A;  4ZTJ A;  4W5O A;  1UAX A;  1C1B A;  1WSI A;  1RDD A;  2YNI A;  4O4G A;  3U3G A;  4C8N A;  2F96 A;  3HVR A;  3TI0 A;  1TGO A;  4KHN A;  2BGG A;  1IKW A;  1HMV A;  4RG8 A;  3K5L A;  4PY5 A;  1JLA A;  3S3N A;  4RW6 A;  4Y1D A;  4GW6 A;  2HND A;  4CGG A;  3JSM A;  1X9W A;  2PY5 A;  3VQA A;  4KB1 A;  3CFR A;  4QCL A;  1WSE A;  3KD1 E;  4FZZ A;  2PZS A;  3AO2 A;  5FDL A;  1ZYQ A;  4JRQ A;  2KZM A;  3SYZ A;  3S3M A;  4AHR A;  1FXX A;  1RBS A;  1SV5 A;  1JXB A;  2X6S A;  1NK0 A;  4CFB A;  3RMC A;  4CEE A;  1U4B A;  2OPP A;  3D0P A;  4BDP A;  1ASW A;  3I0S A;  4M3T A;  1CXU A;  4NYF A;  3RWU A;  4CJW A;  1D8Y A;  1ITG A;  2Y1J A;  1IG9 A;  3HPG A;  1QSL A;  5SZT A;  1LW2 A;  5HLF A;  4RW4 A;  2HHU A;  3AVC A;  1VSI A;  5HRS A;  4FJN A;  3O3F A;  5HRR A;  4F2S A;  4KPY A;  3AVB A;  1N5Y A;  4EZ9 A;  3O4N A;  3KLH A;  4C8L A;  3K59 A;  1VSE A;  4BDY A;  4AIL C;  5CYQ A;  4DQP A;  1JLB A;  4KFB A;  1RDA A;  4HUF A;  4Z4E A;  2HHS A;  4FLT A;  4FJM A;  3V81 A;  2OA8 A;  5KRS A;  1JLG A;  3T19 A;  1NJX A;  3T3F A;  4E7H A;  1FK9 A;  2YHA A;  2E4L A;  1UOC A;  3QES A;  4EZ6 A;  3OYM A;  4FJL A;  1BIZ A;  4KHY A;  4M42 A;  4FLV A;  3P1G A;  3L8B A;  1NK7 A;  4BE0 A;  3U6F A;  2QKK A;  3SQ2 A;  3K5O A;  1EX4 A;  4M41 A;  4OJR A;  4CGF A;  1RDB A;  3KLG A;  1SL0 A;  4KI6 A;  1QS4 A;  1C0M A;  2HB5 A;  3LP3 A;  4I2P A;  3CYM A;  2B4J A;  1A5X A;  2BE2 A;  4CFA A;  3L2R A;  4CEB A;  4DLE A;  5J2M A;  4B3O A;  1S6P A;  4CF1 A;  3A2F A;  1RBR A;  4CES A;  3T1A A;  3ZSR A;  2G8U A;  4DSK A;  3DRS A;  2JGU A;  2FC0 A;  2YNF A;  5C42 A;  4B9V A;  1BHL A;  1BIS A;  2KZZ A;  3AVH A;  2IC3 A;  5CYM A;  4DFK A;  3LP1 A;  4AHV A;  1NK5 A;  3VA0 A;  3O4Q A;  1RTI A;  3HPO A;  1S6Q A;  3KLI A;  2HNY A;  1QQC A;  2R7Y A;  1R0A A;  4W5Q A;  2G8V A;  3QIP A;  3QIO A;  1TL1 A;  4QOZ B;  1DTT A;  2D0A A;  4AHS A;  2QKB A;  3EY1 A;  3QET A;  3TAE A;  3QNN A;  1J53 A;  3ZSZ A;  4FLW A;  4CJE A;  4OKE A;  3SUQ A;  3ZSW A;  4ID1 A;  3OJU A;  3V9X A;  2FBX A;  4DTS A;  1SKW A;  1D9D A;  4CF8 A;  3O3G A;  4DSJ A;  4JS4 A;  3TAF A;  1RBV A;  3NGY A;  3ZT0 A;  3MXM A;  4FLZ A;  5D3G A;  4H4M A;  1LW0 A;  4BE2 A;  2PYJ A;  3HO1 A;  1CXQ A;  4L8R B;  3LAM A;  1VSK A;  3AA3 A;  2G8K A;  3I8D A;  1ASV A;  4FM1 A;  1T7P A;  1VSD A;  3VQD A;  5C25 A;  4B9S A;  5FRO A;  4DTN A;  4KTW A;  4FZY A;  1S1X A;  1BIU A;  2Z1H A;  4KO0 A;  1S1V A;  1LWE A;  2A1R A;  2ZD1 A;  3DRR A;  4CHQ A;  4B8A B;  1KTQ A;  1UA1 A;  2DTU A;  3AA5 X;  5KGW A;  1B9D A;  1HQU A;  3SJJ A;  1KRP A;  4CJ4 A;  1QSY A;  2VWJ A;  1FKP A;  1TKD A;  3ZT4 A;  4M3U A;  3MAQ A;  3NH0 A;  3PO4 A;  3NF9 A;  4PA1 A;  1WSH A;  4DSL A;  1GOA A;  1TKX A;  4NCA A;  3VQ9 A;  1HPZ A;  4ICL A;  3QEP A;  2P51 A;  3LAN A;  5CY4 A;  4CJR A;  3CM5 A;  1EKE A;  4CF2 A;  4J2D A;  3QEI A;  2E6L A;  1BCM A;  1YT3 A;  1Z25 A;  4OPJ A;  1VSL A;  4KHQ A;  4JS5 A;  4Z4H A;  4W5R A;  2WOM A;  4CJL A;  3AVI A;  3AVK A;  1U45 A;  4FJG A;  1W0H A;  3MEE A;  2E6M A;  4O55 A;  4OVL A;  3RRG A;  1SL2 A;  3KK1 A;  3VA3 A;  4DS4 A;  5I42 A;  4B9U A;  3NE6 A;  5CZ2 A;  1YVU A;  1S1W A;  4DTM A;  4AHU A;  4HUG A;  1TKT A;  3AO4 A;  2KQ2 A;  3MXJ A;  1Q8I A;  4CJV A;  3SNN A;  4CIF A;  4FK4 A;  1C6V A;  3C94 A;  5J1E A;  1BGX T;  4CGJ A;  3QNO A;  3KD5 E;  1X1P A;  4ID5 A;  3V1R A;  3HXM A;  3K2P A;  4IFY A;  2QK9 A;  4W5T A;  2HW3 A;  4Y1C A;  4E0D A;  4CHO A;  4FVM A;  3KLE A;  1BCO A;  1WAF A;  4HUE A;  3EZ5 A;  3M8P A;  4E3S A;  3JYT A;  3M8Q A;  1SKS A;  4O0J A;  4I2Q A;  1S5J A;  1TL3 A;  5DK5 A;  3V9W A;  1VSH A;  4CIG A;  4DSI A;  1RNH A;  1NKB A;  1ZBH A;  4HHT A;  3K57 A;  3AA2 A;  4GVM A;  3C95 A;  4DTR A;  3DLB A;  4M3X A;  2HHQ A;  1EET A;  2IAJ A;  3ISN C;  3WNF A;  2P1J A;  4CJU A;  1U47 A;  1NK9 A;  1L3V A;  3L2Q A;  4DU3 A;  3AVG A;  3BGR A;  2XY5 A;  1LV5 A;  3SI6 A;  4KAZ A;  3SUP A;  3THV A;  4FJX A;  3AVF A;  1KVA A;  3ITH A;  1XI1 A;  4OLA A;  4CJK A;  4CER A;  4Q0B A;  3MEC A;  1BQM A;  4M3R A;  4CJ5 A;  1RBT A;  4LH5 A;  4FLX A;  3QER A;  1X9S A;  1BI4 A;  3SZ2 A;  3SUN A;  4KHW A;  3LAL A;  2X78 A;  4DTU A;  2HVH A;  1WSJ A;  1RTD A;  4RW8 A;  1RCH A;  4CK2 A;  4O5B A;  3ZT3 A;  2Z1I A;  3HL8 A;  4N5S A;  4FK2 A;  4M3W A;  4DFM A;  4XIU A;  3LAK A;  3TR8 A;  4FLY A;  3QIN A;  3V4I A;  3B6O A;  2I5J A;  2XY7 A;  1RBU A;  4IDK A;  2FBY A;  4KTZ A;  3IRX A;  5K14 A;  5KRT A;  2RN2 A;  1J5O A;  3RR7 A;  3QLH A;  4WE1 A;  4FJI A;  4CK3 A;  3CM6 A;  4Z4F A;  3AVM A;  4B9N A;  3VQ7 A;  1NK4 A;  2X74 A;  1UWB A;  3VQB A;  3OYF A;  4CEA A;  3G0Z A;  3DRP A;  4M3Y A;  4PQU A;  1B9F A;  3OYE A;  3HT3 A;  2WON A;  3OYN A;  1JLE A;  4JRP A;  3RMD A;  5EU7 A;  1IKX A;  4CJT A;  1YTU A;  4EP4 A;  2G8F A;  1HYV A;  3DLE A;  4IG0 A;  3L2V A;  4E89 A;  1IO2 A;  4J2A A;  2G8W A;  2B5J A;  4FJK A;  3F73 A;  1L3U A;  1CZB A;  1QTM A;  3HJF A;  3LP2 A;  2HHT A;  2HHW A;  1RT1 A;  4TSX A;  4F3O A;  2RKI A;  1U49 A;  4CHN A;  2Q3S A;  3L2W A;  1S9G A;  3C6U A;  2ETJ A;  1U48 A;  1TKZ A;  2OPS A;  3NGI A;  4DU1 A;  4RW7 A;  2KTQ A;  1IKV A;  2Z1G A;  4FJ9 A;  4CGD A;  3AVN A;  3HVT A;  4OGC A;  4CK1 A;  4DF4 A;  4YFU A;  2PYL A;  3OY9 A;  3SV4 A;  4ELV A;  2DFF A;  3NFA A;  3M8R A;  4BWM A;  3EYZ A;  3NBP A;  3SPY A;  1S9E A;  3OYL A;  3SCX A;  4FLU A;  3V9S A;  1JXE A;  1NKC A;  3WNG A;  3SQ0 A;  4PUO A;  1ASU A;  1S1T A;  4CEF A;  4CGH A;  2G8I A;  1C0T A;  1TAQ A;  4DQS A;  4IKF A;  3V9Z A;  2HMI A;  1Y97 A;  4BAC A;  1K6Y A;  1N6Q A;  1VRU A;  2BAN A;  3V6D A;  3ALY A;  3VQE A;  3VN5 A;  4BE1 A;  4F8R A;  1LWF A;  4OLB A;  4YNQ A;  4ELU A;  3LP0 A;  4NCB A;  1Z26 A;  1XC9 A;  1HRH A;  1YTA A;  5FRN A;  2IGI A;  3RMA A;  3S9H A;  1NKE A;  2GBZ A;  3OS1 A;  5JS1 A;  1HJR A;  3NDK A;  1UA0 A;  3VQ5 A;  4AH9 A;  5KGX A;  4CEO A;  1DLO A;  1KFD A;  1VSM A;  3TAP A;  1I3A A;  1RT5 A;  5E41 A;  5HRN A;  1MU2 A;  2HNZ A;  3HST B;  2P5O A;  4NYN A;  3O3H A;  3TWH A;  2NUB A;  3MXI A;  3VQC A;  3WNH A;  4CJS A;  3NAE A;  2DY4 A;  3ZCM A;  3E01 A;  4O44 A;  2W42 A;  1HNV A;  4M3Z A;  1WSF A;  4UQG A;  4KHS A;  1WSG A;  3OYI A;  3CG7 A;  1TVR A;  2GUI A;  3NF8 A;  3BDP A;  3B6P A;  5HP1 A;  4CHZ A;  1VRT A;  4FJ8 A;  4N56 A;  4FZX C;  4E1M A;  4IBN A;  1HYZ A;  3OYA A;  3L3V A;  1T03 A;  3OYJ A;  1KFS A;  4CE9 A;  2OZS A;  4FW1 A;  4B9L A;  1TK8 A;  3V1O A;  3OS2 A;  2A1S A;  2OPQ A;  1JL2 A;  3QEW A;  4N41 A;  1IH7 A;  3NF7 A;  4B08 A;  3PX6 A;  3HP9 A;  4K8Z A;  1WN7 A;  2YNH A;  1RT2 A;  1KVC A;  4E7I A;  1KLN A;  4KTQ A;  3OYC A;  1BQN A;  3AO1 A;  4E19 A;  5J2N A;  4LH4 A;  2ITG A;  4KB0 A;  3P83 D;  1TK0 A;  2OPR A;  3H08 A;  1LWC A;  5DMR A;  3OYH A;  3PX4 A;  3NH2 A;  3NCI A;  1D5A A;  3QEX A;  3AO3 A;  3V1Q A;  3AV9 A;  2LSN A;  3DLG A;  5C24 A;  4CJF A;  3LZJ A;  1G15 A;  2YNG A;  1SUQ A;  4CEQ A;  4Q5V A;  2VG7 A;  3KKS A;  4FW2 A;  4MQ3 A;  5SWM A;  4DQQ A;  3SQ4 A;  2ATQ A;  5J2Q A;  1JL1 A;  3CFO A;  4CFC A;  4N76 A;  1TV6 A;  3MEG A;  3ZSY A;  2ZQB A;  3DI6 A;  4KRF A;  4IFV A;  3ZT2 A;  4C8K A;  4LSN A;  2KW4 A;  3VQP A;  1Q9X A;  1DTQ A;  2VG6 A;  1VK0 A;  4IG3 A;  4B9M A;  2IOC A;  2OYQ A;  3OVN A;  3VQ4 A;  5J2P A;  3SPZ A;  4FJH A;  4OKK A;  4LD0 A;  1Q9Y A;  3DLR A;  3KIO A;  1GOC A;  1C1C A;  4CF9 A;  1X9M A;  1L5U A;  5T7B A;  3V9U A;  4ZHR A;  3S3O A;  1NOY A;  4H4O A;  4J2E A;  4G1Q A;  5KTQ A;  3QEV A;  2EX3 A;  3PV8 A;  1CLQ A;  4FCY A;  1REV A;  2O4G A;  3LWM A;  3ULD A;  3HYF A;  1BI4 B;  1D9F A;  4I9L A;  3AVJ A;  1VSJ A;  3CFP A;  4B8C A;  4FM2 A;  4DU4 A;  4F3T A;  1CZ9 A;  1HNI A;  4CF0 A;  4DS5 A;  2YHB A;  4CFD A;  3DLK A;  4FJJ A;  4DQR A;  1NJZ A;  4JLH A;  5JS2 A;  1NJY A;  4FXD A;  4C8O A;  2EHG A;  4F2R A;  1XWL A;  2B6A A;  1RTH A;  2HHV A;  1ZBU A;  1NOZ A;  3ZT1 A;  2P5G A;  4FYD A;  4AHT A;  3RTV A;  4B9T A;  1NJW A;  3C6T A;  1C0U A;  3ASM A;  5FRM A;  2GV9 A;  3DOK A;  3CQ8 A;  4FK0 A;  2RF2 A;  1TAU A;  3RRH A;  3LDS A;  4KHU A;  3K5M A;  3MED A;  2AJQ A;  2YV0 X;  2YKM A;  2HHX A;  1QE1 A;  3LZI A;  4F4K A;  4I7F A;  1KLM A;  1RT3 A;  1J9A A;  3ZSQ A;  4DWI A;  3KTQ A;  2VWK A;  4OKJ A;  4HCC A;  5KI6 A;  4KRE A;  1RT7 A;  4KV8 A;  3OYK A;  4K8X A;  4CED A;  1JLF A;  2HVI A;  1XHZ A;  4HCB A;  3IG1 A;  3D45 A;  4NCG A;  1JLQ A;  2XRI A;  4CHP A;  5HRO A;  1NK6 A;  3SQ1 A;  4I9Q A;  4HTU A;  3TAQ A;  1U04 A;  3LPU A;  4DTJ A;  3WNE A;  3AO5 A;  1SL1 A;  1ZBF A;  3NGZ A;  4DTX A;  3OYB A;  1F21 A;  2VG5 A;  3VQ6 A;  4N47 A;  4DSE A;  1SKR A;  3PY8 A;  1RT6 A;  4CCH A;  4FJ5 A;  4FJ7 A;  3TAR A;  4EP5 A;  2X6N A;  4CEC A;  1RT4 A;  3ZSX A;  1C1A A;  3LWL A;  4KI4 A;  4DTO A;  3DLH A;  1KCF A;  4E7L A;  1HQE A;  1A5W A;  3LPT A;  3ZSV A;  4RW9 A;  3IAY A;  1RIL A;  3M8S A;  1S1U A;  3UIQ A;  1EP4 A;  1WNS A;  2QXF A;  3HPH A;  3P5J A;  1LAW A;  4MFB A;  3U3Y A;  3FFI A;  4E7K A;  3F9K A;  4DTP A;  2RPI A;  4QAG A;  1I39 A;  4CGI A;  4ELT A;  4ZTF A;  3KK2 A;  2F8T A;  3I0R A;  4OGE A;  3K58 A;  1TK5 A;  4Z4I A;  2FBT A;  4DLG A;  2DFE A;  4Z4C A;  1J54 A;  1A5V A;  2D0B A;  4GMJ B;  4O0I A;  3OYG A;  4HVJ A;  3HP6 A;  1RDC A;  2D0C A;  3HM9 A;  4DFP A;  4CJQ A;  2XO7 A;  3HK2 A;  3OYD A;  3DOL A;  3RMB A;  1ZBI A;  3DM2 A; 
#chains in the Genus database with same CATH topology
 4KKO A;  4LSL A;  3PX0 A;  2D5R A;  3IS9 A;  4JKA A;  1GOB A;  1XC3 A;  2FBV A;  3TAM A;  2QWN A;  1JKH A;  2QI2 A;  3ZYY X;  1L3T A;  1ATS A;  1O1W A;  3ZSO A;  3VF4 A;  1VQL N;  2XHB A;  4YOU A;  1B92 A;  3FZH A;  4DB3 A;  2DFH A;  1VQO N;  3G10 A;  3WXM B;  2KFN A;  4M45 A;  3AVL A;  5BN8 A;  2VWB A;  5BN9 A;  3PO5 A;  4DQI A;  3KLF A;  4E7J A;  2IVO A;  3KVG A;  5GIP A;  2BDP A;  2OZM A;  4ZTJ A;  1UAX A;  1C1B A;  1WSI A;  2BGG A;  1TGO A;  1IKW A;  1JLA A;  5LMN K;  3F9M A;  1X9W A;  4CGG A;  2PY5 A;  3JSM A;  4KB1 A;  3ZET B;  5FDL A;  4JRQ A;  1GLD G;  4MO4 A;  1HKC A;  1FXX A;  1RBS A;  2X6S A;  4G9Z A;  1NK0 A;  4CEE A;  1U4B A;  4LC9 B;  2OPP A;  5LY3 A;  4IXC A;  3I0S A;  1Q7Y O;  2GWJ A;  4NYF A;  4A61 A;  1IV0 A;  5A2Q O;  2Y1J A;  3HTV A;  1IG9 A;  3EE9 A;  4H03 B;  5HLF A;  3L6Q A;  5HRS A;  4XH1 A;  3PSF A;  4KPY A;  5MLC Q;  3AVB A;  4DQP A;  1VSE A;  4B3R K;  4AIL C;  5CYQ A;  1JLB A;  2HHS A;  2OA8 A;  3CET A;  5KRS A;  3T19 A;  1NJX A;  3T3F A;  4E7H A;  1DT9 A;  2OTL N;  4DUZ K;  4EZ6 A;  1TYQ A;  2HF4 A;  4GNI A;  4AF1 A;  1NK7 A;  3U6F A;  4JAX A;  5AQT A;  4DKW A;  4CFA A;  2B4J A;  1A5X A;  4BC2 A;  2JGU A;  3QDK A;  3AVH A;  3E9L A;  1NK5 A;  3O4Q A;  4H0T B;  1QQC A;  4W5Q A;  5M1Q A;  1KAZ A;  1OH6 A;  4BRF A;  1N8R O;  4QS7 A;  2D0A A;  4QOZ B;  4GV6 A;  3QET A;  3FFK B;  5KQ8 A;  3WQT A;  3SUQ A;  4ID1 A;  2FBX A;  1D9D A;  4DSJ A;  3O4W A;  1RBV A;  3ZT0 A;  1NGA A;  2P9L B;  1CXQ A;  2FSK A;  3B8A X;  1FW6 A;  3I8D A;  1ASV A;  5AQI A;  2YHW A;  4FWO A;  4KO0 A;  1SQK A;  3J7A P;  1LWE A;  2I7P A;  3DRR A;  4CHQ A;  4B8A B;  2GEM A;  5TKW A;  3CCV N;  1KTQ A;  5FPM A;  3AA5 X;  3SJJ A;  4B1Z A;  1TKD A;  5JLF A;  2ASM A;  3NVM A;  3PLA A;  1WSH A;  3VQ9 A;  2IVP A;  4ICL A;  2P51 A;  3LAN A;  5AQJ A;  4CF2 A;  2QWR A;  1YT3 A;  1Z25 A;  4OPJ A;  1ESV A;  4KHQ A;  3SAH A;  2NRH A;  4Z4H A;  4CBW A;  2OAN A;  2WOM A;  3AVI A;  1NNE A;  4OVL A;  3RRG A;  1MWK A;  1QQO A;  3LDQ A;  1RDU A;  5CZ2 A;  4PL7 A;  3AGK A;  4AHU A;  4HUG A;  4BRA A;  3AO4 A;  3MXJ A;  4CIF A;  2QWP A;  3KD5 E;  5AQN A;  5AQM A;  2HW3 A;  3I56 N;  3O80 A;  4Y1C A;  2P9N A;  3QFP A;  3MCP A;  1WAF A;  1OH7 A;  1IBK K;  2E2Q A;  4DSI A;  1NKB A;  4JKG A;  3K57 A;  2AP1 A;  3WNF A;  4CJU A;  1VQ8 N;  4YOR A;  3L2Q A;  2ZGY A;  3BGR A;  1N33 K;  3NVK A;  3IMX A;  3AVF A;  4FJX A;  4CER A;  3EL2 A;  3VOV A;  1X3N A;  3SZ2 A;  3TTC A;  2X78 A;  4JKB A;  1WSJ A;  2BTF A;  1EQY A;  1CZA N;  2Z1I A;  3HL8 A;  3AAQ A;  4WFN L;  1KD1 O;  3QIN A;  2H3G X;  1RBU A;  4KTZ A;  3IRX A;  4JI4 K;  2RE2 A;  3QLH A;  4KH5 A;  2CH6 A;  3VQ7 A;  1NK4 A;  1TYQ B;  4CEA A;  2CGL A;  1ZXO A;  3DRP A;  4PQU A;  1B9F A;  2P9I B;  2YJF A;  4JI7 K;  3O08 A;  1HYV A;  4K41 A;  3HRG A;  4IG0 A;  4X62 K;  3CJ1 A;  4E89 A;  4WQ5 C;  3GOI A;  3J7Y P;  3A5N C;  3LP2 A;  1U48 A;  4CHN A;  3C6U A;  1TKZ A;  4RW7 A;  5KPZ A;  4DR7 K;  3G25 A;  3D2F A;  3ATV A;  1BG3 A;  1JXE A;  3SQ0 A;  1HKB A;  4CZG A;  3ZEU A;  4DV2 K;  3VET A;  4DQS A;  4IKF A;  4DHY A;  1P8Z A;  4FPA A;  1K6Y A;  3I55 N;  3ALY A;  2CGK A;  2D0P A;  3KHY A;  4BQL A;  2OTJ N;  1YTA A;  4K0K K;  4FWP A;  5JS1 A;  1HJO A;  3NDK A;  2UYT A;  3MX5 A;  2YHY A;  2D0O A;  3F2K A;  5BRD A;  4CJ7 A;  4FL9 A;  4NYN A;  3O3H A;  3TWH A;  2NUB A;  4FPB A;  3VQC A;  3G4S N;  3CI5 A;  2DY4 A;  3VES A;  3LDN A;  3E01 A;  4M3Z A;  1WSF A;  3SBG A;  4Y0W A;  3OYI A;  1NM1 A;  3CG7 A;  3NF8 A;  3CER A;  5HP1 A;  4CHZ A;  4FJ8 A;  2QA4 N;  1KFS A;  2OZS A;  1HYZ A;  3L3V A;  1VQM N;  1VAZ A;  1RGI A;  1HNW K;  4EIA A;  5DM6 L;  2O8C A;  4B9L A;  1TK8 A;  4FWK A;  5AQG A;  4N41 A;  1HUX A;  4B1U B;  2YNH A;  2YX6 A;  4E7I A;  1BQN A;  3P83 D;  3OYH A;  3H08 A;  3NH2 A;  3O9T A;  3MDQ A;  3V1Q A;  2LSN A;  5C24 A;  1SUQ A;  4CEQ A;  4BGB A;  4Q5V A;  3KKS A;  4MQ3 A;  4JKG B;  2FLO A;  5SWM A;  3SQ4 A;  1J5E K;  2ATQ A;  5J2Q A;  4N76 A;  3QML A;  3DI6 A;  2FSJ A;  4C8K A;  4B9M A;  1VK0 A;  3OVN A;  4FJH A;  5J2P A;  1Q9Y A;  3DLR A;  1GOC A;  1X9M A;  3QBW A;  3QEV A;  1NLV A;  2EX3 A;  3PV8 A;  4FCY A;  4IO8 A;  4BGA A;  4BR0 A;  3AVJ A;  4B8C A;  1CZ9 A;  4CF0 A;  2YHB A;  3VMF B;  1Z6R A;  4DQR A;  1NJZ A;  1JCE A;  4FXD A;  3HOT A;  2VGN A;  2EWS A;  3W0L A;  1T44 A;  3ZT1 A;  2V7Y A;  2P5G A;  1IG8 A;  2QWQ A;  3DWL A;  3DOK A;  4H5N A;  1TAU A;  3TSQ A;  2YV0 X;  5GAH P;  2YKM A;  2UUC K;  3K9J A;  5I9E B;  4BRG A;  3LZI A;  1X3M A;  4A57 A;  1J9A A;  1U2V A;  3ZSQ A;  3KTQ A;  4HCC A;  4I6M A;  5KI6 A;  2E1Y A;  4K8X A;  3LL3 A;  4IO9 L;  2HVI A;  3G71 N;  3TTF A;  4I9Q A;  3TAQ A;  1IJJ A;  4DTJ A;  3GBT A;  2YCH A;  4M7Y A;  4BRC A;  1SKR A;  2VG5 A;  1LOT B;  3PY8 A;  4FJ7 A;  3THY A;  1RT6 A;  3J8A A;  4IJA A;  2X6N A;  1C1A A;  3A5O C;  5KQD A;  1KCF A;  1GLL O;  2ZJQ L;  3IAY A;  3E9P A;  2QXF A;  3HPH A;  5AFU H;  3AGR A;  1IBM K;  3DXK A;  4JNE A;  4E7K A;  4DTP A;  2RPI A;  1ATR A;  5C2D A;  2UXC K;  4ISG A;  1VQN N;  3KK2 A;  2F8T A;  1TK5 A;  2D4W A;  2DFE A;  1NWK A;  4Z4C A;  2D0B A;  4O0I A;  4CVN E;  3OYG A;  2A3Z A;  1NGC A;  2D0C A;  4DFP A;  1KAX A;  3HM9 A;  2V52 B;  2FF3 B;  3OYD A;  4BC3 A;  2O8D A;  2UXD K;  3CPE A;  2ASO A;  3AVA A;  3L4I A;  3OS0 A;  1NK8 A;  1BL3 A;  5AQH A;  1VQ7 N;  4DFJ A;  1I94 K;  2O8C B;  2HF3 A;  4Z0U A;  1NGJ A;  3GL1 A;  1WB9 A;  2IDO A;  2Z1J A;  4DG1 A;  2G8H A;  1QSS A;  4CBU A;  2JLE A;  2W41 A;  2YKN A;  4K25 A;  3L3U A;  5I3U A;  4ISE A;  2P9U B;  3AA4 A;  1BO5 O;  3HBT A;  1IKY A;  2A42 A;  3KKR A;  3DMJ A;  1KSP A;  2Y1I A;  3PUF A;  4BR5 A;  1QHA A;  3NF6 A;  3R8E A;  4DSF A;  3L2U A;  2F8S A;  2RHK A;  4W5O A;  2YNI A;  4O4G A;  3TI0 A;  4KHN A;  2E8A A;  3K5L A;  4PY5 A;  1KXP A;  3HSC A;  4RW6 A;  1BOT O;  3CFR A;  5AQY A;  4FZZ A;  4FWS A;  3WEE B;  3O9S A;  4IEI A;  4AHR A;  1NBW A;  1SV5 A;  4YY3 K;  4BRM A;  3D0P A;  4BDP A;  1ASW A;  4M3T A;  1CXU A;  2A41 A;  1GLE G;  5BPN A;  2NLX A;  4BR4 A;  2UUA K;  4C1N I;  1LW2 A;  4RW4 A;  1VSI A;  3H1V X;  1N5Y A;  4JI6 K;  1YI2 N;  3JXU A;  1U2V B;  5C10 A;  2VGM A;  4BVP A;  1RDA A;  4Z4E A;  4EAH D;  3LM9 A;  5AQW A;  4B1Y B;  1JJ2 M;  2YHA A;  2ITM A;  1UOC A;  3QES A;  4GKJ K;  3P1G A;  3L8B A;  5EXW A;  2O8E A;  3M3Z A;  4CGF A;  4M41 A;  4OJR A;  3KLG A;  1RDB A;  1QS4 A;  1C0M A;  2WFB A;  4I2P A;  2FF6 A;  4CEB A;  3A2F A;  4MDA A;  1MDU B;  5AZI A;  4CES A;  3T1A A;  3CC7 N;  1WBD A;  3O1B A;  2YNF A;  4B9V A;  1BIS A;  3ZLJ A;  2KZZ A;  2IC3 A;  4O8K A;  3LP1 A;  4AHV A;  3HPO A;  2HNY A;  2R7Y A;  2G8V A;  3QIO A;  1VHX A;  1TL1 A;  4IOA L;  3TAE A;  1E4G T;  3OHR A;  1J53 A;  3ZSZ A;  4FLW A;  4CJE A;  2F4V K;  5AQL A;  3ID6 A;  4DTS A;  4NB4 A;  1SKW A;  3MXM A;  3OTO K;  5D3G A;  1NGD A;  4H4M A;  4BE2 A;  3HO1 A;  4L8R B;  3LAM A;  4FM1 A;  3O6W A;  5C25 A;  2QWL A;  4DTN A;  4FZY A;  1S1X A;  1MWM A;  2O8D B;  4MLH A;  1UA1 A;  1KRP A;  1YIJ N;  4CJ4 A;  1QSY A;  3PO4 A;  4DCH A;  2Q0U A;  3CM5 A;  4WQ5 A;  4LF9 K;  4QS8 A;  1VSL A;  4FJG A;  4O55 A;  3O1W A;  4H5W A;  3KK1 A;  3VA3 A;  5I42 A;  2PFU A;  3NE6 A;  3THX A;  2WC9 A;  1W97 L;  2YHX A;  4CJV A;  3IFR A;  1Q8I A;  1C6V A;  5J1E A;  1X1P A;  4ID5 A;  3SBT A;  3V1R A;  3VEW A;  3K2P A;  4EHU A;  3CPW M;  4W5T A;  1ILY A;  2Q0R A;  4FVM A;  3CCJ N;  1BCO A;  1GLC G;  3EZ5 A;  4HUE A;  4CIG A;  2I7N A;  2HHQ A;  4M3X A;  2IAJ A;  2CH5 A;  4C1N K;  2OCE A;  5EOY A;  3WXL A;  3P38 A;  3CD6 N;  2XY5 A;  3SI6 A;  4B3M K;  3ITH A;  1XI1 A;  3MEC A;  4JI5 K;  2ZF5 O;  4FOI A;  1RBT A;  4LFA K;  4FLX A;  4MO5 A;  1DKG D;  4KHW A;  4JI2 K;  2P9K B;  1RTD A;  1NGB A;  4RW8 A;  1RCH A;  1VQP N;  3ZT3 A;  3BF3 A;  4M3W A;  4XIU A;  3LAK A;  3TR8 A;  3B6O A;  2XY7 A;  1GLF O;  2PBD A;  2FBY A;  4M7X A;  4FJI A;  3CM6 A;  4Z4F A;  3OYF A;  3G0Z A;  4M3Y A;  3OYE A;  3HT3 A;  3VEZ A;  2HHH K;  4EP4 A;  2G8F A;  3MCA B;  3MK6 A;  3L2V A;  1IO2 A;  4J2A A;  3CXC M;  5AZI B;  4JKC A;  2BUP A;  4JKE A;  3S41 A;  3F73 A;  4TSX A;  4EHT A;  2KTQ A;  2ETJ A;  1IKV A;  4OGC A;  4DF4 A;  2PAV A;  2PYL A;  3VEX A;  4ELV A;  3EYZ A;  4LF7 K;  5C0Y A;  1NKC A;  5KPT A;  4JK8 A;  4PUO A;  4JKD A;  1S1T A;  4CEF A;  4CGH A;  4CZJ A;  1NGG A;  3KK7 A;  4F9O A;  1TAQ A;  3J81 O;  5JVH L;  3I33 A;  2P9P A;  4BC4 A;  1NGH A;  4DV3 K;  1N6Q A;  4F8R A;  4YNQ A;  3LP0 A;  4DV4 K;  1Z26 A;  1HRH A;  5M1K A;  2GBZ A;  4BRO A;  4DR3 K;  4BRL A;  4NO7 A;  3VQ5 A;  4CEO A;  1DLO A;  1KFD A;  1Q82 O;  1QQM A;  4CD3 A;  5E41 A;  4OPA A;  4A62 A;  3PSI A;  5C2F A;  3L0Q A;  3O8M A;  3D7E O;  3MXI A;  4PHT X;  4CJS A;  3HM8 A;  2W42 A;  1HNV A;  5F1X A;  1WSG A;  3GG4 A;  4A5A A;  5LL6 Z;  2F9W A;  4IWV A;  4B1V A;  3B6P A;  1VRT A;  4N56 A;  4FZX C;  4E1M A;  3VER A;  2Q2R A;  3OYJ A;  1QVG M;  2OPQ A;  1JL2 A;  3QEW A;  3NF7 A;  4B08 A;  1KAY A;  3QBX A;  4YOY A;  1HNX K;  3AY9 A;  3E66 A;  4PKG A;  2OPR A;  5DMR A;  3NCI A;  3CJ7 A;  3AV9 A;  1G15 A;  1YF5 L;  4WFA L;  2VG7 A;  4FW2 A;  4DQQ A;  1E4F T;  2YI1 A;  1BA1 A;  3TSP A;  4BC5 A;  3M1F A;  4CFC A;  5IT9 O;  3T1H K;  2ZQB A;  1Q81 O;  1K8K A;  1Q9X A;  2VG6 A;  4IG3 A;  3E9O A;  3ULE A;  3SPZ A;  3CQX A;  3DXM A;  4OKK A;  4LD0 A;  1L5U A;  2WTU A;  5T7B A;  3V9U A;  4ZHR A;  3S3O A;  1NOY A;  4H4O A;  4J2E A;  3U9D A;  4CZF A;  1REV A;  2O4G A;  2NRV A;  4IDH A;  3U4L A;  4RCH A;  3N4P A;  1P90 A;  1YAG A;  3U8X A;  4DU4 A;  3VEN A;  4C23 A;  2FSN A;  4CFD A;  4FJJ A;  4JLH A;  5JS2 A;  1NJY A;  4IEE A;  4C8O A;  5H1S Q;  2B6A A;  1NOZ A;  3RSE A;  2GUP A;  3RTV A;  2ZWH A;  1C0U A;  3SMS A;  3ASM A;  4BRE A;  5FRM A;  3MWP A;  2RF2 A;  4BVO A;  3LDS A;  1XMO K;  3UB5 A;  2AJQ A;  2HHX A;  5LMU K;  4K43 A;  3QFU A;  4F4K A;  4CZM A;  1G99 A;  1RT3 A;  3SJH A;  4CI6 A;  1R59 O;  2VWK A;  4OKJ A;  1K8A O;  4KRE A;  3OYK A;  4JI8 K;  1RDW X;  4FSV A;  5CR4 A;  3FZK A;  1JLF A;  1XHZ A;  3CHW A;  3T69 A;  5FLX O;  4PKI A;  4U7B A;  2A5X A;  4B3S K;  5BRF A;  3WNE A;  3AO5 A;  4H5T A;  1SL1 A;  1ZBF A;  3F5T A;  5AQF A;  4DTX A;  3OYB A;  1F21 A;  3A0I X;  3VQ6 A;  4N47 A;  4OX9 K;  1RT4 A;  2Q36 A;  3J7Z O;  2P9P B;  4KI4 A;  3LPT A;  5ELZ A;  5KPR A;  4IOX A;  3M8S A;  1S1U A;  3P4I A;  1EP4 A;  3P5J A;  4RWT A;  1LAW A;  4MFB A;  2FXU A;  3FFI A;  2UUB K;  3CF5 L;  4CGI A;  4DV0 K;  4OGE A;  3K58 A;  4WF9 L;  2FBT A;  5BR8 K;  3H46 O;  1J54 A;  3ZX0 A;  4QS9 A;  2DPN A;  4CJQ A;  1VQ6 N;  5HOO A;  3DOL A;  3DM2 A;  3VQQ A;  4E1N A;  1ZBL A;  5GAG P;  3RR8 A;  2JWL A;  2QW9 A;  4AHC A;  3FR0 A;  1WAJ A;  4CHY A;  4BWJ A;  3KK3 A;  3NHG A;  1LAV A;  2QWM A;  5ADX H;  2E88 A;  1QHT A;  3TAB A;  4V19 S;  4YHH K;  2P9N B;  3CCS N;  1WUA A;  3TAN A;  3TAG A;  3CJ9 A;  4DMN A;  2HBM A;  3QO9 A;  4CBX A;  1L3S A;  3DJC A;  4DR1 K;  3KJV A;  2IS3 A;  3CCE N;  1BU6 O;  5CZ1 A;  3OJS A;  5BPL A;  4W5N A;  5HRP A;  4CEZ A;  3G6E N;  3C65 A;  1GLB G;  2ASP A;  1NGF A;  3ULE B;  4OPK A;  3DXM B;  1T05 A;  5AJ3 K;  1FKO A;  1VSF A;  3U3G A;  3HVR A;  2F96 A;  5JVG L;  4RG8 A;  1HMV A;  4Y1D A;  2F7T A;  2HND A;  1WSE A;  3KD1 E;  3DAW A;  2PZS A;  3GE1 A;  1ZYQ A;  2KZM A;  3SYZ A;  3S3M A;  1BWF O;  1K9M O;  2O8F A;  3RMC A;  4FO0 A;  5FPD A;  4A2A A;  4CJW A;  1D8Y A;  3ID8 A;  5C12 A;  3HPG A;  1QSL A;  3CCL N;  5E84 A;  3O3F A;  5HRR A;  4EZ9 A;  3O4N A;  3KLH A;  4C8L A;  4FLT A;  4FJM A;  4H0P A;  3V81 A;  1JLG A;  4JK9 A;  1FK9 A;  4DV6 K;  4FJL A;  3OYM A;  1BIZ A;  4KHY A;  1E3M A;  4FLV A;  4BE0 A;  3D2F B;  4KI6 A;  3LP3 A;  3CYM A;  2BE2 A;  5JMV A;  5J2M A;  4B3O A;  3KZB A;  1S6P A;  1RBR A;  5M1P A;  3ZEU B;  4BR9 A;  1TUU A;  3DRS A;  5C42 A;  2FC0 A;  1BHL A;  2QEX N;  4DFK A;  4MLE A;  1T6D A;  1S6Q A;  3KLI A;  1XUP O;  3QIP A;  4CZK A;  1DTT A;  4AHS A;  2HOE A;  2KHO A;  2QKB A;  3QNN A;  1NU0 A;  3ZSW A;  3OJU A;  4XEI A;  4J8F A;  2NRR A;  1NGE A;  1EWR A;  4DV1 K;  4JS4 A;  2NNW A;  3NGY A;  3VTH A;  1ATN A;  1LW0 A;  1QQN A;  5AQP A;  1VSK A;  1T7P A;  4B9S A;  5FRO A;  4KTW A;  1X9J A;  4M63 C;  3O9Q A;  4JD2 A;  2DTU A;  5KGW A;  1B9D A;  4DR5 K;  5C15 A;  4BQZ A;  3BY5 A;  3VEV A;  5GIN A;  3CMA N;  3ZT4 A;  3MAQ A;  2J4R A;  3MMV A;  4DSL A;  1GOA A;  1HPZ A;  3QEP A;  4CJR A;  4J2D A;  1EKE A;  3JAM O;  5CE3 A;  3QEI A;  4KBO A;  2HBK A;  3SLC A;  4CJL A;  3AVK A;  2E2O A;  4JI0 K;  3MEE A;  2KLA A;  1JCG A;  1SL2 A;  4DS4 A;  4B9U A;  1YVU A;  4DTM A;  2ZJP L;  1TKT A;  4CGJ A;  3QNO A;  4BRI A;  1S3X A;  4BRD A;  1Z05 A;  4JN4 A;  5AQV A;  5B8H A;  2QWO A;  1HLU A;  4CHO A;  2BH1 A;  5GAD P;  4E3S A;  1U6Z A;  4O0J A;  1S5J A;  5DK5 A;  3V9W A;  1ZBH A;  3UKR A;  2GWK A;  4BR7 A;  4HHT A;  2NRX A;  3AA2 A;  4DTR A;  3C95 A;  3DLB A;  1EET A;  5AZJ A;  3ISN C;  5E26 A;  2P1J A;  5M1N A;  1NK9 A;  1YJN N;  4MDB A;  1L3V A;  4LF5 K;  4IZ9 A;  4GVE A;  3AVG A;  3D2E A;  1OH8 A;  4KAZ A;  3SUP A;  4XH4 A;  1KVA A;  2VQF K;  1VQK N;  3R9P A;  1BQM A;  5F0X A;  4DTU A;  5AQU A;  4CZL A;  4CK2 A;  4O5B A;  4JKF A;  4FLY A;  3HI0 A;  2VCP A;  4KH4 A;  5LJV A;  2ZJR L;  4I6M B;  4A5B A;  1DGK N;  5K14 A;  2RN2 A;  4H0V B;  3RR7 A;  4WE1 A;  3AVM A;  4B9N A;  2X74 A;  2NRT A;  4NLC A;  4JRP A;  3RMD A;  1BDG A;  4CJT A;  2QM1 A;  4BRN A;  3THY B;  1N36 K;  5BRH A;  1XNQ K;  1L3U A;  1QTM A;  3FZM A;  2HHT A;  2HHW A;  1RT1 A;  3HOS A;  4F3O A;  2RKI A;  1U49 A;  2Q3S A;  3OBW A;  2W6L A;  3NGI A;  4DU1 A;  5DM7 L;  1HKG A;  2Z1G A;  4JHD A;  4CGD A;  3AVN A;  4CK1 A;  4YFU A;  4GV3 A;  1N32 K;  3M8R A;  4BWM A;  3NBP A;  3SPY A;  1S9E A;  3OYL A;  3SCX A;  3DXK B;  3VPZ A;  4CD1 A;  4CZI A;  3WNG A;  4R79 A;  2G8I A;  3V9Z A;  4H0Y B;  4YOX A;  1Y97 A;  4BAC A;  3V6D A;  3N4Q A;  3VN5 A;  4OLB A;  4WYB A;  3RVC A;  4YOV A;  4ELU A;  2IGI A;  3RMA A;  3S9H A;  1NKE A;  3GDQ A;  5FPN A;  5M1O A;  5FPE A;  3BP8 A;  5AQQ A;  5KGX A;  3WXK A;  2NRW A;  1VSM A;  3EKS A;  1I3A A;  3TAP A;  1RT5 A;  5HRN A;  4U67 L;  3HST B;  2P5O A;  3O9R A;  3H1Q A;  1HNZ K;  2W6K A;  3SK3 A;  2P9S A;  3ZCM A;  3U9Z A;  3A5M C;  3K0S A;  4WQ4 C;  3R6M A;  1TVR A;  2GUI A;  3BDP A;  3ZX2 A;  4PKH A;  3OYA A;  1GLJ O;  3MWT A;  4CE9 A;  4JV5 K;  4FW1 A;  4CZH A;  3V1O A;  3OS2 A;  2A1S A;  3MN5 A;  3R3L A;  5AQS A;  3PX6 A;  3HP9 A;  1WN7 A;  5EX5 A;  1KLN A;  4KTQ A;  3OYC A;  4LH4 A;  3A5L C;  4KB0 A;  1LWC A;  4YDU C;  4DR2 K;  3AO3 A;  5AFU A;  4CJF A;  5JIC A;  3LZJ A;  4E1J A;  2YNG A;  3IKM A;  3UKR B;  3C7N A;  3CFO A;  1TUY A;  5AZJ B;  4DUY K;  1TV6 A;  4IFV A;  3ZT2 A;  2KW4 A;  3VQP A;  3D2E B;  2OYQ A;  2V51 B;  3KIO A;  1C1C A;  4CF9 A;  1SS6 A;  5KTQ A;  1CLQ A;  1D9F A;  3HYF A;  1VSJ A;  3CFP A;  3EEQ A;  4DS5 A;  3LDO A;  4LF6 K;  1BA0 A;  5LJW A;  3A8Y A;  4LFC K;  4DR6 K;  1XWL A;  4JYA K;  1ZBU A;  4FYD A;  1S22 A;  1ZBS A;  4AHT A;  4B9T A;  4KH6 A;  3C6T A;  3VF2 A;  2O8E B;  3RRH A;  4KHU A;  3K5M A;  3MED A;  4K42 A;  1QE1 A;  1KLM A;  3CCQ N;  4DWI A;  1YUW A;  3CQY A;  3TU5 A;  3EO3 A;  3LM2 A;  1Y64 A;  2Q97 A;  3IG1 A;  3D45 A;  4HCB A;  2YJE A;  4JHD B;  1JLQ A;  2XRI A;  4CHP A;  5HRO A;  1NK6 A;  2P9I A;  3SAG A;  1U04 A;  3HZ6 A;  3VF6 A;  3NGZ A;  5AQZ A;  2AA4 A;  4ILG B;  4CCH A;  5AQO A;  3TAR A;  4EP5 A;  1HPM A;  3ZSX A;  3LWL A;  4DTO A;  4E7L A;  1HQE A;  1A5W A;  2CGJ A;  1YVN A;  3UIQ A;  1WNS A;  4OPH A;  3C6H A;  4FWR A;  2F9T A;  4GKK K;  4JKH A;  3BUZ B;  3UKU A;  4QAG A;  1I39 A;  3BEX A;  1QZ5 A;  4ZTF A;  4H0X B;  3I0R A;  2HBL A;  1A5V A;  4GMJ B;  4HVJ A;  3HP6 A;  2P9S B;  3HK2 A;  4EFH A;  4JI1 K;  3THW A;  1Q86 O;  4L3Q A;  3VGM A;  3RMB A;  1ZBI A;  4FM0 A;  1W9H A;  1WLJ A;  4CJ3 A;  4B1W B;  4J2B A;  3THX B;  1T8E A;  1EXQ A;  3DYA A;  3BZC A;  3Q7B A;  4FWQ A;  2O4I A;  1JLC A;  4A2B A;  1H1V A;  3MN9 A;  4C8M A;  1MA9 B;  2XY8 A;  4XH5 A;  3K5N A;  4BDZ A;  5EVZ A;  3SV3 A;  2XY6 A;  3OA9 A;  1KVB A;  4H8K A;  1HYS A;  4R5P A;  4IJN A;  4DF8 A;  1XHX A;  3C0B A;  3VQ8 A;  4H5R A;  3AAP A;  4PWD A;  4Z4G A;  4JI3 K;  2A6A A;  4CIE A;  1YJ9 N;  2KFZ A;  4LY7 A;  1S72 N;  5HBM A;  3TPQ A;  4CJP A;  1T3V A;  3C7N B;  3SUO A;  5EY4 A;  1NGI A;  2V7Z A;  2ZE2 A;  3LDL A;  3NH1 A;  3CC4 N;  4UY8 O;  1RTJ A;  3PIO L;  2A40 A;  3J80 O;  1RDD A;  4C8N A;  3S3N A;  4NXM K;  4GW6 A;  4QCL A;  3VQA A;  3VTI A;  3C6A A;  1HR0 K;  3Q7C A;  3SMP A;  3AO2 A;  5AQR A;  1JXB A;  2D1K A;  4CFB A;  1KQS M;  4A59 A;  3RWU A;  4BG8 A;  1ITG A;  5TKY A;  5SZT A;  4FOE A;  2HHU A;  3AVC A;  4FJN A;  4F2S A;  3IUC A;  3E1Y A;  3K59 A;  4BDY A;  4B1X B;  4KFB A;  4JEP A;  1RFQ A;  4HUF A;  3VEO A;  1YJW N;  2O8B A;  2E4L A;  1VQ9 N;  2HMP A;  4M42 A;  2QKK A;  3SQ2 A;  3K5O A;  1EX4 A;  1SL0 A;  2HB5 A;  1SZ2 A;  3ENB A;  3L2R A;  4GY2 B;  5AQK A;  4DQ8 A;  4DLE A;  4KHP K;  1BUP A;  4CF1 A;  1EWQ A;  3ZSR A;  3CCM N;  2G8U A;  4DSK A;  4PL8 A;  1VQ4 N;  3CJC A;  2UXB K;  4ILJ A;  5CYM A;  3VA0 A;  1RTI A;  1YIT N;  1R0A A;  1YHQ N;  3TTD A;  4BRH A;  3EY1 A;  1Q18 A;  4ILH A;  4OKE A;  1XQS C;  3UKU B;  3V9X A;  1LCU A;  4CF8 A;  3O3G A;  1HX1 A;  3R1X A;  3TAF A;  4FLZ A;  2PYJ A;  3FZL A;  2KKZ A;  3AA3 A;  2G8K A;  3THW B;  1VSD A;  3VQD A;  1BIU A;  2Z1H A;  3ENO A;  1S1V A;  3EN9 A;  2W40 A;  2A1R A;  1NG9 A;  2ZD1 A;  1OKJ A;  1HQU A;  4DV7 K;  2VWJ A;  1FKP A;  4M3U A;  3NH0 A;  3NF9 A;  4PA1 A;  1TKX A;  4H0O A;  4NCA A;  1W7A A;  5CY4 A;  4DV5 K;  2E6L A;  1NMD A;  1BCM A;  4CZE A;  4JS5 A;  4W5R A;  1U45 A;  1W0H A;  2E6M A;  3QIC A;  1VQ5 N;  2NZT A;  1S1W A;  2ZGZ A;  1SAZ A;  3SNN A;  2IIR A;  2KQ2 A;  3H3N O;  4YOT A;  4FK4 A;  3C94 A;  3KWI A;  1BGX T;  1K8K B;  3LDP A;  4AM7 A;  1J6Z A;  3HXM A;  4IFY A;  3BF1 A;  2QK9 A;  3T7Z A;  1XMQ K;  5GAE P;  4E0D A;  3KLE A;  3M5R A;  1SKS A;  3M8P A;  3JYT A;  3M8Q A;  2IVN A;  4I2Q A;  1TL3 A;  1VSH A;  4IFE A;  1RNH A;  2P9U A;  3CJA A;  2JWK A;  1ZC6 A;  4GVM A;  3EE8 A;  3VGK A;  3P39 A;  1U47 A;  4HWI A;  3WUH A;  4DU3 A;  4CW7 B;  3EZW A;  1LV5 A;  2E5L K;  3THV A;  3ATU A;  4OLA A;  3RSE B;  4CJK A;  4Q0B A;  1YXQ A;  4M3R A;  3VEY A;  4CJ5 A;  4FVU A;  4LH5 A;  3QER A;  1X9S A;  3NMU A;  1BI4 A;  3OBY A;  3SUN A;  3LAL A;  3ZX3 A;  2HVH A;  3OW2 M;  3WEE A;  1NMN A;  4N5S A;  4DFM A;  4HTL A;  3H3O B;  4WQ4 A;  3V4I A;  4NLB A;  2I5J A;  3CJB A;  4IDK A;  4BR2 A;  2GTD A;  1QVF M;  5KRT A;  1J5O A;  2O8B B;  4CK3 A;  4OO1 J;  1UWB A;  3VQB A;  2NRZ A;  2WON A;  4IOC L;  2GX9 A;  3OYN A;  1JLE A;  3WQU A;  2UU9 K;  5EU7 A;  1IKX A;  1YTU A;  2E1Z A;  1T6C A;  3DLE A;  1V4T A;  2ZM6 K;  3CCU N;  2G8W A;  2B5J A;  4FJK A;  1CZB A;  3HJF A;  4YDU A;  3L2W A;  1S9G A;  2OPS A;  4O5F A;  3WT0 A;  4FJ9 A;  5AQX A;  3HVT A;  3WXI A;  1V4S A;  3OY9 A;  3SV4 A;  2DFF A;  3NFA A;  2QXL A;  1OVY A;  4FLU A;  2GEL A;  3V9S A;  1ASU A;  3CIP A;  3IDH A;  1C0T A;  3FLC O;  3D6R A;  1M1K O;  2HMI A;  4X64 K;  1VRU A;  2BAN A;  3WXJ A;  5GIO A;  3O9U A;  3VQE A;  4BE1 A;  5JLH A;  1LWF A;  3P31 A;  4X65 K;  4BRQ A;  4NCB A;  1XC9 A;  3I8B A;  5FRN A;  3OS1 A;  1HJR A;  3CME N;  3L4Q A;  3TSU A;  1UA0 A;  4AH9 A;  4LF8 K;  3SAF A;  3M6G A;  1GLA G;  1MU2 A;  2HNZ A;  4X66 K;  4Z94 A;  2E20 A;  4LFB K;  3WNH A;  4FWN A;  1NJI O;  3NAE A;  3MN6 A;  4O44 A;  5AR0 A;  4B3T K;  1IBL K;  4UQG A;  5CHI A;  2HST A;  4IBN A;  1T03 A;  3O5B A;  4JK7 A;  1IH7 A;  4K8Z A;  1WBB A;  1JCF A;  1RT2 A;  1KVC A;  2E2N A;  5J2N A;  3AO1 A;  2E2P A;  4E19 A;  2ITG A;  1TK0 A;  1FJG K;  5BPM A;  3PX4 A;  1D5A A;  3QEX A;  3T1Y K;  3CC2 N;  3DLG A;  4BRP A;  1M90 O;  4BY9 C;  4NXN K;  1C0G A;  2QTD A;  1JL1 A;  3ZSY A;  3MEG A;  4KRF A;  2O8F B;  4KHS A;  4LSN A;  1DTQ A;  2WUS A;  1C0F A;  4DR4 K;  2IOC A;  5HL7 L;  3VQ4 A;  3W3D A;  4FK2 A;  2VYP A;  4G1Q A;  4YOW A;  3LWM A;  3ULD A;  1BI4 B;  4O8U A;  4I9L A;  4RTF D;  4FM2 A;  4F3T A;  3H6E A;  1DEJ A;  1HNI A;  3ZET A;  1OH5 A;  4FWM A;  4AM6 A;  2Q1N A;  3H45 C;  3DLK A;  3JS6 A;  3VGL A;  4FWL A;  2EHG A;  3MN7 A;  4F2R A;  2VQE K;  2HHV A;  1RTH A;  3AAR A;  3DLL L;  1QZ6 A;  1NJW A;  5IWA K;  5ADX A;  1EO1 A;  2GV9 A;  3CQ8 A;  4FK0 A;  4H5V A;  3FGU A;  2P9K A;  1O13 A;  4I7F A;  4WCE L;  1K73 O;  3MX2 A;  1KC8 O;  1WOQ A;  1D4X A;  3CCR N;  1RT7 A;  4KV8 A;  5BR9 A;  4CED A;  5M1F A;  4B9Q A;  3PIP L;  4NCG A;  4ISF A;  3SQ1 A;  3QB0 A;  4HTU A;  3LPU A;  3EKU A;  5BRE A;  4DSE A;  4FJ5 A;  4LF4 K;  3FE1 A;  4CEC A;  3DLH A;  3KWG A;  1OVQ A;  3ZSV A;  4RW9 A;  1RIL A;  2Q31 A;  3U3Y A;  3FZF A;  4AQY K;  3F9K A;  4JD2 B;  1W2B M;  3UE5 A;  4ELT A;  1XNR K;  3ENH A;  4Z4I A;  3K9K A;  4DLG A;  2P9L A;  4GV9 A;  1RDC A;  4BG9 A;  4BRK A;  2XO7 A;  2HBJ A;  2WBN A;  5F2R A;  4WFB L;  3BZK A;  1N34 K; 
#chains in the Genus database with same CATH homology
 3AVA A;  4KKO A;  4FM0 A;  3OS0 A;  1W9H A;  4LSL A;  3VQQ A;  4E1N A;  3PX0 A;  1ZBL A;  1WLJ A;  4CJ3 A;  1NK8 A;  1BL3 A;  3RR8 A;  4J2B A;  1T8E A;  2D5R A;  1EXQ A;  3DYA A;  3IS9 A;  4AHC A;  4DFJ A;  2O4I A;  1JLC A;  4Z0U A;  1WAJ A;  1GOB A;  4C8M A;  2XY8 A;  2IDO A;  4CHY A;  2FBV A;  2Z1J A;  4BWJ A;  3TAM A;  3KK3 A;  3K5N A;  4DG1 A;  3NHG A;  4BDZ A;  3SV3 A;  1LAV A;  2XY6 A;  1JKH A;  1KVB A;  2G8H A;  1L3T A;  4H8K A;  1QSS A;  3ZSO A;  1O1W A;  1QHT A;  1HYS A;  4R5P A;  3TAB A;  2XHB A;  4DF8 A;  1XHX A;  2JLE A;  1B92 A;  3VQ8 A;  3TAN A;  2DFH A;  3TAG A;  4PWD A;  2YKN A;  4Z4G A;  4CIE A;  3G10 A;  4DMN A;  2KFN A;  3L3U A;  3AVL A;  4M45 A;  5I3U A;  2KFZ A;  4LY7 A;  3AA4 A;  3QO9 A;  5HBM A;  4CJP A;  1L3S A;  3KJV A;  3SUO A;  2IS3 A;  5CZ1 A;  1IKY A;  3OJS A;  4W5N A;  5HRP A;  3PO5 A;  3KKR A;  4CEZ A;  3KLF A;  4E7J A;  3DMJ A;  2ZE2 A;  1KSP A;  4DQI A;  2Y1I A;  3PUF A;  4OPK A;  3NH1 A;  2BDP A;  3NF6 A;  4DSF A;  1T05 A;  3L2U A;  2OZM A;  1RTJ A;  2F8S A;  1FKO A;  1VSF A;  4ZTJ A;  4W5O A;  1UAX A;  1C1B A;  1WSI A;  1RDD A;  2YNI A;  4O4G A;  3U3G A;  4C8N A;  2F96 A;  3HVR A;  3TI0 A;  1TGO A;  4KHN A;  2BGG A;  1IKW A;  1HMV A;  4RG8 A;  3K5L A;  4PY5 A;  1JLA A;  3S3N A;  4RW6 A;  4Y1D A;  4GW6 A;  2HND A;  4CGG A;  3JSM A;  1X9W A;  2PY5 A;  3VQA A;  4KB1 A;  3CFR A;  4QCL A;  1WSE A;  3KD1 E;  4FZZ A;  2PZS A;  3AO2 A;  5FDL A;  1ZYQ A;  4JRQ A;  2KZM A;  3SYZ A;  3S3M A;  4AHR A;  1FXX A;  1RBS A;  1SV5 A;  1JXB A;  2X6S A;  1NK0 A;  4CFB A;  3RMC A;  4CEE A;  1U4B A;  2OPP A;  3D0P A;  4BDP A;  1ASW A;  3I0S A;  4M3T A;  1CXU A;  4NYF A;  3RWU A;  4CJW A;  1D8Y A;  1ITG A;  2Y1J A;  1IG9 A;  3HPG A;  1QSL A;  5SZT A;  1LW2 A;  5HLF A;  4RW4 A;  2HHU A;  3AVC A;  1VSI A;  5HRS A;  4FJN A;  3O3F A;  5HRR A;  4F2S A;  4KPY A;  3AVB A;  1N5Y A;  4EZ9 A;  3O4N A;  3KLH A;  4C8L A;  3K59 A;  1VSE A;  4BDY A;  4AIL C;  5CYQ A;  4DQP A;  1JLB A;  4KFB A;  1RDA A;  4HUF A;  4Z4E A;  2HHS A;  4FLT A;  4FJM A;  3V81 A;  2OA8 A;  5KRS A;  1JLG A;  3T19 A;  1NJX A;  3T3F A;  4E7H A;  1FK9 A;  2YHA A;  2E4L A;  1UOC A;  3QES A;  4EZ6 A;  3OYM A;  4FJL A;  1BIZ A;  4KHY A;  4M42 A;  4FLV A;  3P1G A;  3L8B A;  1NK7 A;  4BE0 A;  3U6F A;  2QKK A;  3SQ2 A;  3K5O A;  1EX4 A;  4M41 A;  4OJR A;  4CGF A;  1RDB A;  3KLG A;  1SL0 A;  4KI6 A;  1QS4 A;  1C0M A;  2HB5 A;  3LP3 A;  4I2P A;  3CYM A;  2B4J A;  1A5X A;  2BE2 A;  4CFA A;  3L2R A;  4CEB A;  4DLE A;  5J2M A;  4B3O A;  1S6P A;  4CF1 A;  3A2F A;  1RBR A;  4CES A;  3T1A A;  3ZSR A;  2G8U A;  4DSK A;  3DRS A;  2JGU A;  2FC0 A;  2YNF A;  5C42 A;  4B9V A;  1BHL A;  1BIS A;  2KZZ A;  3AVH A;  2IC3 A;  5CYM A;  4DFK A;  3LP1 A;  4AHV A;  1NK5 A;  3VA0 A;  3O4Q A;  1RTI A;  3HPO A;  1S6Q A;  3KLI A;  2HNY A;  1QQC A;  2R7Y A;  1R0A A;  4W5Q A;  2G8V A;  3QIP A;  3QIO A;  1TL1 A;  4QOZ B;  1DTT A;  2D0A A;  4AHS A;  2QKB A;  3EY1 A;  3QET A;  3TAE A;  3QNN A;  1J53 A;  3ZSZ A;  4FLW A;  4CJE A;  4OKE A;  3SUQ A;  3ZSW A;  4ID1 A;  3OJU A;  3V9X A;  2FBX A;  4DTS A;  1SKW A;  1D9D A;  4CF8 A;  3O3G A;  4DSJ A;  4JS4 A;  3TAF A;  1RBV A;  3NGY A;  3ZT0 A;  3MXM A;  4FLZ A;  5D3G A;  4H4M A;  1LW0 A;  4BE2 A;  2PYJ A;  3HO1 A;  1CXQ A;  4L8R B;  3LAM A;  1VSK A;  3AA3 A;  2G8K A;  3I8D A;  1ASV A;  4FM1 A;  1T7P A;  1VSD A;  3VQD A;  5C25 A;  4B9S A;  5FRO A;  4DTN A;  4KTW A;  4FZY A;  1S1X A;  1BIU A;  2Z1H A;  4KO0 A;  1S1V A;  1LWE A;  2A1R A;  2ZD1 A;  3DRR A;  4CHQ A;  4B8A B;  1KTQ A;  1UA1 A;  2DTU A;  3AA5 X;  5KGW A;  1B9D A;  1HQU A;  3SJJ A;  1KRP A;  4CJ4 A;  1QSY A;  2VWJ A;  1FKP A;  1TKD A;  3ZT4 A;  4M3U A;  3MAQ A;  3NH0 A;  3PO4 A;  3NF9 A;  4PA1 A;  1WSH A;  4DSL A;  1GOA A;  1TKX A;  4NCA A;  3VQ9 A;  1HPZ A;  4ICL A;  3QEP A;  2P51 A;  3LAN A;  5CY4 A;  4CJR A;  3CM5 A;  1EKE A;  4CF2 A;  4J2D A;  3QEI A;  2E6L A;  1BCM A;  1YT3 A;  1Z25 A;  4OPJ A;  1VSL A;  4KHQ A;  4JS5 A;  4Z4H A;  4W5R A;  2WOM A;  4CJL A;  3AVI A;  3AVK A;  1U45 A;  4FJG A;  1W0H A;  3MEE A;  2E6M A;  4O55 A;  4OVL A;  3RRG A;  1SL2 A;  3KK1 A;  3VA3 A;  4DS4 A;  5I42 A;  4B9U A;  3NE6 A;  5CZ2 A;  1YVU A;  1S1W A;  4DTM A;  4AHU A;  4HUG A;  1TKT A;  3AO4 A;  2KQ2 A;  3MXJ A;  1Q8I A;  4CJV A;  3SNN A;  4CIF A;  4FK4 A;  1C6V A;  3C94 A;  5J1E A;  1BGX T;  4CGJ A;  3QNO A;  3KD5 E;  1X1P A;  4ID5 A;  3V1R A;  3HXM A;  3K2P A;  4IFY A;  2QK9 A;  4W5T A;  2HW3 A;  4Y1C A;  4E0D A;  4CHO A;  4FVM A;  3KLE A;  1BCO A;  1WAF A;  4HUE A;  3EZ5 A;  3M8P A;  4E3S A;  3JYT A;  3M8Q A;  1SKS A;  4O0J A;  4I2Q A;  1S5J A;  1TL3 A;  5DK5 A;  3V9W A;  1VSH A;  4CIG A;  4DSI A;  1RNH A;  1NKB A;  1ZBH A;  4HHT A;  3K57 A;  3AA2 A;  4GVM A;  3C95 A;  4DTR A;  3DLB A;  4M3X A;  2HHQ A;  1EET A;  2IAJ A;  3ISN C;  3WNF A;  2P1J A;  4CJU A;  1U47 A;  1NK9 A;  1L3V A;  3L2Q A;  4DU3 A;  3AVG A;  3BGR A;  2XY5 A;  1LV5 A;  3SI6 A;  4KAZ A;  3SUP A;  3THV A;  4FJX A;  3AVF A;  1KVA A;  3ITH A;  1XI1 A;  4OLA A;  4CJK A;  4CER A;  4Q0B A;  3MEC A;  1BQM A;  4M3R A;  4CJ5 A;  1RBT A;  4LH5 A;  4FLX A;  3QER A;  1X9S A;  1BI4 A;  3SZ2 A;  3SUN A;  4KHW A;  3LAL A;  2X78 A;  4DTU A;  2HVH A;  1WSJ A;  1RTD A;  4RW8 A;  1RCH A;  4CK2 A;  4O5B A;  3ZT3 A;  2Z1I A;  3HL8 A;  4N5S A;  4FK2 A;  4M3W A;  4DFM A;  4XIU A;  3LAK A;  3TR8 A;  4FLY A;  3QIN A;  3V4I A;  3B6O A;  2I5J A;  2XY7 A;  1RBU A;  4IDK A;  2FBY A;  4KTZ A;  3IRX A;  5K14 A;  5KRT A;  2RN2 A;  1J5O A;  3RR7 A;  3QLH A;  4WE1 A;  4FJI A;  4CK3 A;  3CM6 A;  4Z4F A;  3AVM A;  4B9N A;  3VQ7 A;  1NK4 A;  2X74 A;  1UWB A;  3VQB A;  3OYF A;  4CEA A;  3G0Z A;  3DRP A;  4M3Y A;  4PQU A;  1B9F A;  3OYE A;  3HT3 A;  2WON A;  3OYN A;  1JLE A;  4JRP A;  3RMD A;  5EU7 A;  1IKX A;  4CJT A;  1YTU A;  4EP4 A;  2G8F A;  1HYV A;  3DLE A;  4IG0 A;  3L2V A;  4E89 A;  1IO2 A;  4J2A A;  2G8W A;  2B5J A;  4FJK A;  3F73 A;  1L3U A;  1CZB A;  1QTM A;  3HJF A;  3LP2 A;  2HHT A;  2HHW A;  1RT1 A;  4TSX A;  4F3O A;  2RKI A;  1U49 A;  4CHN A;  2Q3S A;  3L2W A;  1S9G A;  3C6U A;  2ETJ A;  1U48 A;  1TKZ A;  2OPS A;  3NGI A;  4DU1 A;  4RW7 A;  2KTQ A;  1IKV A;  2Z1G A;  4FJ9 A;  4CGD A;  3AVN A;  3HVT A;  4OGC A;  4CK1 A;  4DF4 A;  4YFU A;  2PYL A;  3OY9 A;  3SV4 A;  4ELV A;  2DFF A;  3NFA A;  3M8R A;  4BWM A;  3EYZ A;  3NBP A;  3SPY A;  1S9E A;  3OYL A;  3SCX A;  4FLU A;  3V9S A;  1JXE A;  1NKC A;  3WNG A;  3SQ0 A;  4PUO A;  1ASU A;  1S1T A;  4CEF A;  4CGH A;  2G8I A;  1C0T A;  1TAQ A;  4DQS A;  4IKF A;  3V9Z A;  2HMI A;  1Y97 A;  4BAC A;  1K6Y A;  1N6Q A;  1VRU A;  2BAN A;  3V6D A;  3ALY A;  3VQE A;  3VN5 A;  4BE1 A;  4F8R A;  1LWF A;  4OLB A;  4YNQ A;  4ELU A;  3LP0 A;  4NCB A;  1Z26 A;  1XC9 A;  1HRH A;  1YTA A;  5FRN A;  2IGI A;  3RMA A;  3S9H A;  1NKE A;  2GBZ A;  3OS1 A;  5JS1 A;  1HJR A;  3NDK A;  1UA0 A;  3VQ5 A;  4AH9 A;  5KGX A;  4CEO A;  1DLO A;  1KFD A;  1VSM A;  3TAP A;  1I3A A;  1RT5 A;  5E41 A;  5HRN A;  1MU2 A;  2HNZ A;  3HST B;  2P5O A;  4NYN A;  3O3H A;  3TWH A;  2NUB A;  3MXI A;  3VQC A;  3WNH A;  4CJS A;  3NAE A;  2DY4 A;  3ZCM A;  3E01 A;  4O44 A;  2W42 A;  1HNV A;  4M3Z A;  1WSF A;  4UQG A;  4KHS A;  1WSG A;  3OYI A;  3CG7 A;  1TVR A;  2GUI A;  3NF8 A;  3BDP A;  3B6P A;  5HP1 A;  4CHZ A;  1VRT A;  4FJ8 A;  4N56 A;  4FZX C;  4E1M A;  4IBN A;  1HYZ A;  3OYA A;  3L3V A;  1T03 A;  3OYJ A;  1KFS A;  4CE9 A;  2OZS A;  4FW1 A;  4B9L A;  1TK8 A;  3V1O A;  3OS2 A;  2A1S A;  2OPQ A;  1JL2 A;  3QEW A;  4N41 A;  1IH7 A;  3NF7 A;  4B08 A;  3PX6 A;  3HP9 A;  4K8Z A;  1WN7 A;  2YNH A;  1RT2 A;  1KVC A;  4E7I A;  1KLN A;  4KTQ A;  3OYC A;  1BQN A;  3AO1 A;  4E19 A;  5J2N A;  4LH4 A;  2ITG A;  4KB0 A;  3P83 D;  1TK0 A;  2OPR A;  3H08 A;  1LWC A;  5DMR A;  3OYH A;  3PX4 A;  3NH2 A;  3NCI A;  1D5A A;  3QEX A;  3AO3 A;  3V1Q A;  3AV9 A;  2LSN A;  3DLG A;  5C24 A;  4CJF A;  3LZJ A;  1G15 A;  2YNG A;  1SUQ A;  4CEQ A;  4Q5V A;  2VG7 A;  3KKS A;  4FW2 A;  4MQ3 A;  5SWM A;  4DQQ A;  3SQ4 A;  2ATQ A;  5J2Q A;  1JL1 A;  3CFO A;  4CFC A;  4N76 A;  1TV6 A;  3MEG A;  3ZSY A;  2ZQB A;  3DI6 A;  4KRF A;  4IFV A;  3ZT2 A;  4C8K A;  4LSN A;  2KW4 A;  3VQP A;  1Q9X A;  1DTQ A;  2VG6 A;  1VK0 A;  4IG3 A;  4B9M A;  2IOC A;  2OYQ A;  3OVN A;  3VQ4 A;  5J2P A;  3SPZ A;  4FJH A;  4OKK A;  4LD0 A;  1Q9Y A;  3DLR A;  3KIO A;  1GOC A;  1C1C A;  4CF9 A;  1X9M A;  1L5U A;  5T7B A;  3V9U A;  4ZHR A;  3S3O A;  1NOY A;  4H4O A;  4J2E A;  4G1Q A;  5KTQ A;  3QEV A;  2EX3 A;  3PV8 A;  1CLQ A;  4FCY A;  1REV A;  2O4G A;  3LWM A;  3ULD A;  3HYF A;  1BI4 B;  1D9F A;  4I9L A;  3AVJ A;  1VSJ A;  3CFP A;  4B8C A;  4FM2 A;  4DU4 A;  4F3T A;  1CZ9 A;  1HNI A;  4CF0 A;  4DS5 A;  2YHB A;  4CFD A;  3DLK A;  4FJJ A;  4DQR A;  1NJZ A;  4JLH A;  5JS2 A;  1NJY A;  4FXD A;  4C8O A;  2EHG A;  4F2R A;  1XWL A;  2B6A A;  1RTH A;  2HHV A;  1ZBU A;  1NOZ A;  3ZT1 A;  2P5G A;  4FYD A;  4AHT A;  3RTV A;  4B9T A;  1NJW A;  3C6T A;  1C0U A;  3ASM A;  5FRM A;  2GV9 A;  3DOK A;  3CQ8 A;  4FK0 A;  2RF2 A;  1TAU A;  3RRH A;  3LDS A;  4KHU A;  3K5M A;  3MED A;  2AJQ A;  2YV0 X;  2YKM A;  2HHX A;  1QE1 A;  3LZI A;  4F4K A;  4I7F A;  1KLM A;  1RT3 A;  1J9A A;  3ZSQ A;  4DWI A;  3KTQ A;  2VWK A;  4OKJ A;  4HCC A;  5KI6 A;  4KRE A;  1RT7 A;  4KV8 A;  3OYK A;  4K8X A;  4CED A;  1JLF A;  2HVI A;  1XHZ A;  4HCB A;  3IG1 A;  3D45 A;  4NCG A;  1JLQ A;  2XRI A;  4CHP A;  5HRO A;  1NK6 A;  3SQ1 A;  4I9Q A;  4HTU A;  3TAQ A;  1U04 A;  3LPU A;  4DTJ A;  3WNE A;  3AO5 A;  1SL1 A;  1ZBF A;  3NGZ A;  4DTX A;  3OYB A;  1F21 A;  2VG5 A;  3VQ6 A;  4N47 A;  4DSE A;  1SKR A;  3PY8 A;  1RT6 A;  4CCH A;  4FJ5 A;  4FJ7 A;  3TAR A;  4EP5 A;  2X6N A;  4CEC A;  1RT4 A;  3ZSX A;  1C1A A;  3LWL A;  4KI4 A;  4DTO A;  3DLH A;  1KCF A;  4E7L A;  1HQE A;  1A5W A;  3LPT A;  3ZSV A;  4RW9 A;  3IAY A;  1RIL A;  3M8S A;  1S1U A;  3UIQ A;  1EP4 A;  1WNS A;  2QXF A;  3HPH A;  3P5J A;  1LAW A;  4MFB A;  3U3Y A;  3FFI A;  4E7K A;  3F9K A;  4DTP A;  2RPI A;  4QAG A;  1I39 A;  4CGI A;  4ELT A;  4ZTF A;  3KK2 A;  2F8T A;  3I0R A;  4OGE A;  3K58 A;  1TK5 A;  4Z4I A;  2FBT A;  4DLG A;  2DFE A;  4Z4C A;  1J54 A;  1A5V A;  2D0B A;  4GMJ B;  4O0I A;  3OYG A;  4HVJ A;  3HP6 A;  1RDC A;  2D0C A;  3HM9 A;  4DFP A;  4CJQ A;  2XO7 A;  3HK2 A;  3OYD A;  3DOL A;  3RMB A;  1ZBI A;  3DM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...