4AHTA

Parallel screening of a low molecular weight compound library: do differences in methodology affect hit identification
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
151
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Parallel Screening of Low Molecular Weight Fragment Libraries: Do Differences in Methodology Affect Hit Identification?
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 55
structure length 151
sequence length 154
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4ahtA00
4CJLA 1UWBA 4KV8A 3QIPA 3DLEA 1KLMA 2PYJA 3LAMA 1CXUA 1IKXA 4GVMA 1VRUA 5KRSA 3ISNC 3OS1A 1IKWA 1TAUA 3LZJA 3TAPA 1FKPA 3HM9A 4NYFA 4JRPA 5C42A 5HP1A 2OYQA 3ZSWA 1XI1A 3AA2A 4ELUA 3AVLA 3ASMA 4WE1A 3BGRA 1FKOA 1VSLA 3KLFA 2XHBA 2XY5A 4DTUA 3SJJA 1HJRA 1C0UA 3OYKA 2HHUA 2GUIA 4LD0A 4W5QA 1U4BA 4N5SA 3V6DA 3SUPA 3O4NA 5CYQA 3DRSA 4N47A 3VQCA 3AVIA 2Y1IA 3AO4A 4E1MA 1RT3A 2BE2A 4CHZA 4DMNA 2G8HA 4AHRA 3M8QA 4KHQA 3V1QA 3T3FA 4CJTA 3SUQA 4CK2A 1ZBLA 3T1AA 1T03A 2B6AA 3ZT2A 1DTTA 3SZ2A 2XY6A 3NAEA 2FBVA 4BDZA 3DLGA 4FJKA 3L2QA 3QESA 2EHGA 3ZT0A 3RMBA 2IOCA 4DWIA 3DLKA 3DRRA 4E7KA 3EY1A 4KRFA 5J2NA 4HUEA 4E7HA 3S3NA 5CZ1A 3AO5A 3RMAA 3B6PA 4BE1A 2B5JA 4DQRA 3AV9A 1VSDA 3VQ8A 4CEOA 1C0TA 2IC3A 3IS9A 3VQ6A 3NGYA 4B9SA 1D5AA 4FLVA 4PWDA 3WNGA 4O4GA 1BIUA 5FROA 4JRQA 2A1SA 3OYMA 3S3MA 4FJNA 3DLHA 4O5BA 4B9MA 1WAFA 4I2QA 1K6YA 2F8TA 1L3TA 3LPTA 3A2FA 3KTQA 3NGZA 4FM1A 2GV9A 2D0BA 2VWKA 3NFAA 3SI6A 3OYJA 5CZ2A 5CY4A 4CEEA 4DTOA 3VQPA 4ELVA 3DI6A 1ASWA 4K8ZA 1JXBA 4LY7A 3TABA 3ZSZA 4CE9A 4E1NA 3I0RA 1RDDA 3RTVA 4M41A 4AHUA 4DU3A 2QXFA 3C94A 1EXQA 3WNHA 4CGHA 4B9TA 5T7BA 3CM5A 4OGCA 4CJQA 4AHSA 2NUBA 1NK4A 3VQDA 1CXQA 4DSKA 4M3ZA 4OLBA 4RW9A 1A5VA 1BISA 1VSHA 3DLBA 1X9MA 3HPHA 3E01A 3ZT1A 4HUFA 1TK5A 1KFDA 3VQ4A 4EZ6A 4FK2A 5D3GA 1BCOA 3ZT4A 2KFZA 4YNQA 3HP6A 3WNFA 1TAQA 3V1RA 4CERA 1NOYA 3V4IA 4ICLA 3QERA 5HROA 1RDCA 2OPSA 1BL3A 3KK3A 4DSIA 4KB1A 3NF9A 3V1OA 4DG1A 3QLHA 3M8SA 3I0SA 3ULDA 4FZZA 3THVA 1C1BA 2A1RA 1HYZA 4H4MA 3DYAA 3V9WA 4M3YA 2HNDA 4YFUA 1BIZA 4RW6A 4DLEA 1LW2A 1C1AA 3M8RA 4CIEA 2KZMA 1WAJA 2DFEA 4E0DA 4RW8A 2X74A 3VA0A 5FRMA 1UA1A 2G8IA 5C25A 5HBMA 1JLFA 3QO9A 3OYIA 1SKWA 2RN2A 4B9NA 3OYEA 4DFPA 4M3XA 4Y1DA 3MEEA 2D5RA 5HRSA 4LH4A 3ZSYA 4DF4A 1NJWA 3KJVA 1ZBUA 1RTJA 1Z25A 3OS2A 3OJSA 1UOCA 2O4GA 4DLGA 4DTPA 2EX3A 1ASVA 4O0IA 3F9KA 4HVJA 3OYLA 3TANA 4OPKA 1TK8A 4B9UA 1RCHA 3P5JA 3AVBA 1U49A 3KIOA 1RTHA 1RNHA 2JGUA 4CK1A 3PV8A 2PY5A 4CECA 3SV4A 4DSJA 3RRGA 1NJZA 3CFPA 2QK9A 3NF7A 3O3FA 4C8OA 1I3AA 3CFRA 4KHSA 1JL2A 1QHTA 2G8UA 3PUFA 3L3VA 3KD5E 4JS4A 4KAZA 4N76A 4W5NA 3AVGA 4M3TA 4KHUA 1BI4A 4W5OA 4DS4A 4E19A 1WSEA 1DLOA 2B4JA 2E4LA 4OKEA 3DM2A 4DU1A 4DTRA 1WLJA 3VN5A 4Z4HA 3TAQA 4CJEA 2HHVA 1B9FA 1TV6A 1NKCA 3RMCA 1S6QA 4K8XA 4E7LA 3DLRA 3TWHA 1IG9A 3NDKA 1WSFA 2KQ2A 1BCMA 4IG3A 4EP5A 3U3YA 3HO1A 4FYDA 3S9HA 4N41A 4PQUA 1TKTA 1TL1A 2DFHA 4NCGA 1C1CA 1KTQA 1S1XA 1U04A 1HYSA 3OYHA 3DOKA 4HCCA 3H08A 3PX6A 4KREA 4E3SA 4FJGA 1CZBA 2IDOA 2WONA 5I42A 4O0JA 4B9LA 2Q3SA 4CJUA 3L2VA 1SKRA 2BDPA 4KTQA 3ZSVA 1S1VA 4FJJA 3KLHA 3NH1A 3LWMA 4KHNA 3D0PA 1O1WA 4ZTFA 4B3OA 5JS1A 1EKEA 4CCHA 2YHBA 1HQUA 1IH7A 1IKYA 4QCLA 3TI0A 1JL1A 3K5OA 3HT3A 2HHXA 3OYFA 4CEAA 5SZTA 4I7FA 4HTUA 2HW3A 3MEDA 3ZSXA 3MXIA 2HB5A 2OPRA 1YTUA 1REVA 4H4OA 3CFOA 3DOLA 2O4IA 4CF8A 4OJRA 4KTWA 1C6VA 3AVNA 2OA8A 4CHNA 4FLXA 1NJXA 3L2UA 4E7IA 3SPYA 4CEBA 2KW4A 4CGGA 1SL2A 2PZSA 2X6SA 3AVCA 1TVRA 4BDPA 3L2WA 3ZT3A 1LW0A 1UA0A 4BE0A 4EZ9A 4ZTJA 1RTDA 2P1JA 3OYDA 3D45A 4O55A 4DS5A 4FCYA 3HL8A 4IG0A 3PO5A 4B8CA 1XWLA 4ID1A 1JKHA 4Z0UA 3DMJA 2DFFA 5FRNA 2KTQA 5JS2A 3EYZA 1X9SA 1QS4A 4CJ5A 4PUOA 2OPPA 3SQ1A 1A5WA 2YHAA 2G8FA 3NF8A 1L3SA 1W9HA 3LAKA 3LWLA 3AVMA 3QIOA 4OLAA 3L3UA 2R7YA 1NJYA 1ASUA 1B92A 2HHSA 1FK9A 4PY5A 3VQ5A 4HCBA 4RG8A 4B08A 3SQ4A 1TK0A 4C8KA 4Z4FA 3MAQA 1HNVA 1KCFA 3VQQA 3OYBA 1YT3A 3CYMA 2D0CA 4OPJA 4DSEA 4I2PA 3OYGA 1W0HA 3AA3A 3NF6A 4FLZA 4CEDA 4FLYA 3MXMA 5HLFA 3V9XA 1J9AA 2ZQBA 1VSMA 1QE1A 3T19A 4C8NA 4KKOA 1VSEA 3CM6A 4Q0BA 4RW7A 3QEPA 1TL3A 1SL0A 3HSTB 1BQNA 4EP4A 3G10A 3PX4A 2FBTA 4DTXA 4JS5A 3SV3A 3OYCA 4FK0A 2RF2A 5CYMA 5KGXA 4DTSA 1QSYA 1VSKA 3TARA 3KKRA 3OYAA 3NHGA 3RWUA 4CF1A 4J2BA 4FJXA 1FXXA 1N6QA 1NK7A 4FLWA 5KGWA 4Z4GA 1S6PA 4BACA 2HVHA 2DTUA 4AHTA 4N56A 4CGIA 3KK2A 3AVKA 4MQ3A 1LAWA 4JLHA 4J2DA 5DK5A 1RBVA 2YNHA 4DTNA 1JLBA 4ID5A 1X1PA 1Z26A 4C8MA 2HHTA 1U45A 4FJHA 3VA3A 3IRXA 1HMVA 4CIFA 1RT4A 1GOBA 3AVFA 4CGJA 1TKXA 4CFCA 4CJWA 3QNOA 3LP1A 3SNNA 3HVTA 1BHLA 4LH5A 4DFKA 5J1EA 4KI4A 2ZD1A 4F8RA 3TAGA 3M8PA 1NKBA 3V81A 2E6LA 2P5GA 3K57A 4FJMA 3LP0A 3L8BA 2HHWA 2E6MA 3B6OA 2KZZA 1WSHA 4MFBA 1NOZA 3L2RA 3CG7A 4GW6A 5E41A 4ELTA 4M3WA 2HVIA 4FJ7A 1D8YA 3TAMA 1RBRA 4CGFA 4J2AA 4BDYA 4DU4A 3DRPA 1ZBIA 3FFIA 2I5JA 1LV5A 4Z4IA 4CJ3A 5KRTA 1WN7A 3NCIA 3AA5X 3HYFA 4CK3A 4IBNA 4CEFA 5I3UA 3G0ZA 3MECA 2VG6A 4H8KA 3TAEA 2BANA 2VWJA 2VG7A 1U47A 3HK2A 3S3OA 1SV5A 4CHPA 4CF0A 4UQGA 1RT1A 4FLUA 4M3UA 2WOMA 3VQBA 3V9SA 2YKMA 4AILC 3LP2A 4F2RA 1WSJA 5K14A 3AA4A 1IO2A 3NH0A 1HQEA 3JYTA 1ZBFA 3AVHA 3AO1A 3CQ8A 3QEXA 1TKDA 4KFBA 4C8LA 1BI4B 4CGDA 4CJFA 4FJ9A 4M3RA 1GOCA 3IG1A 1RT7A 1RT5A 1WSIA 1RDAA 2YNGA 1IKVA 1TKZA 2Z1GA 3O3GA 4F2SA 1NK0A 4FJ8A 2QKBA 4OKKA 2W42A 4KI6A 3C6TA 1JLEA 3SUOA 3KLIA 3OS0A 4Z4EA 1XHXA 2G8VA 1DTQA 1VK0A 1XC9A 1D9FA 3AVAA 4CJRA 4OGEA 1VSIA 4OKJA 4Y1CA 1ITGA 5C24A 4B9VA 3ZSQA 3HPOA 2VG5A 2Z1JA 3ZSOA 5DMRA 1L3UA 2DY4A 2X6NA 4FW1A 1SL1A 2XY8A 1XHZA 3QEWA 2FC0A 3C95A 3QETA 4L8RB 1CLQA 3SQ0A 1EX4A 4RW4A 4W5TA 5HRPA 1NK5A 3ALYA 5J2PA 1F21A 2X78A 4KB0A 2YV0X 3V9UA 1NK8A 2QKKA 4DQPA 4DQSA 1NK9A 4CHYA 1TGOA 3P83D 1BQMA 5KTQA 3IAYA 4KPYA 1RBTA 1VSJA 1VRTA 1WSGA 3LANA 4CFBA 3AVJA 3TR8A 4KHYA 4R5PA 3KD1E 3SUNA 4FJLA 1C0MA 4LSNA 3HP9A 2FBYA 2YKNA 4NYNA 4PA1A 1YVUA 1Q9XA 4NCBA 1QSSA 3WNEA 3ZSRA 3U6FA 2D0AA 2ETJA 4CEQA 3BDPA 3RR7A 4DSLA 1L3VA 4I9LA 2F96A 4I9QA 1T8EA 1EP4A 3KLEA 1Q9YA 1LWFA 4DTJA 1RT2A 3PX0A 4FZXC 3LP3A 3P1GA 3KKSA 4CJ4A 1J54A 1RILA 5HRRA 5J2QA 3ZCMA 2XRIA 3SYZA 2AJQA 1JXEA 4KO0A 4ZHRA 4XIUA 3SCXA 1HNIA 2ITGA 2P5OA 1D9DA 3VQAA 4KTZA 4CF9A 4NCAA 2HHQA 2ATQA 3AO3A 2BGGA 3K5MA 2FBXA 4F3OA 3NE6A 2GBZA 1T05A 1RT6A 4BWJA 4FXDA 4OVLA 4CJSA 3LZIA 1HRHA 1RBSA 4LSLA 4CHOA 3TAFA 2HMIA 1JLCA 2IGIA 2HNYA 3RRHA 4BWMA 1T7PA 4IDKA 4GMJB 1KLNA 3LALA 4FVMA 1RBUA 4CJKA 3HXMA 4CF2A 3K5NA 3UIQA 2PYLA 4CEZA 1J53A 3AO2A 2Y1JA 4O44A 5EU7A 3PO4A 3NH2A 1HYVA 4F3TA 1RTIA 4DF8A 3I8DA 4TSXA 1JLGA 4M45A 3OY9A 1WNSA 2IS3A 4CESA 1NKEA 4FLTA 3PY8A 4E89A 3VQ7A 3RMDA 3K58A 5FDLA 1QQCA 4CHQA 3K2PA 3V9ZA 2IAJA 4DSFA 4DFMA 4DQQA 1KRPA 2G8KA 2RKIA 1R0AA 1QTMA 4AH9A 4FK4A 1KVBA 3VQEA 4E7JA 1BGXT 1B9DA 4IFVA 1KSPA 5SWMA 2KFNA 1KVAA 2OZSA 1I39A 2YNFA 3NBPA 2XY7A 1J5OA 1S1UA 1S9EA 4B8AB 1S9GA 2G8WA 4AHVA 3KK1A 3C6UA 3HPGA 3EZ5A 3QNNA 4J2EA 4CJPA 3KLGA 4Z4CA 3O3HA 1ZBHA 3HJFA 2P51A 3QINA 4DQIA 1JLAA 2HNZA 1L5UA 1QSLA 1SUQA 4IKFA 1S1WA 4CIGA 1RDBA 3LPUA 4F4KA 3SPZA 3VQ9A 4CFAA 4FM2A 1MU2A 1EETA 3OYNA 1Y97A 4CJVA 4FZYA 4M42A 3OVNA 1LWCA 3OJUA 3SQ2A 4HUGA 1NK6A 3F73A 1UAXA 1KVCA 2ZE2A 1LWEA 2F8SA 4W5RA 3HVRA 3RR8A 2RPIA 4CFDA 4BE2A 4DTMA 3ITHA 4IFYA 3K5LA 3QEIA 2OZMA 3MEGA 1JLQA 1HPZA 5J2MA 2JLEA 3K59A 1CZ9A 1U48A 2XO7A 1X9WA 4HHTA 3NGIA 1ZYQA 3JSMA 2LSNA 4QAGA 4G1QA 4FW2A 2Z1HA 1YTAA 2OPQA 1S1TA 4KHWA 1VSFA 4FJ5A 4FJIA 1SKSA 3U3GA 3MXJA 4FM0A 3QEVA 2YNIA 1S5JA 4AHCA 1Q8IA 1G15A 4DFJA 1KFSA 4Q5VA 1GOAA 1N5YA 1A5XA 5HRNA 4QOZB 1LAVA 2Z1IA 3O4QA 5KI6A 3LDSA
chains in the Genus database with same CATH superfamily
3BF3A 4KH6A 3QIPA 1KLMA 1K73O 3LAMA 1CXUA 1IKXA 5KRSA 2P9LA 3LZJA 4KH5A 1FKPA 2UU9K 3MX2A 5MLCQ 3ZSWA 3AA2A 1P8ZA 2XHBA 2XY5A 3KHYA 5KQDA 2HHUA 3SK3A 1U4BA 1NM1A 5E26A 5CYQA 3ZX0A 2GWJA 2G8HA 1N34K 1RT3A 1IJJA 3V1QA 3Q7BA 4CJTA 3SUQA 4CK2A 1ZBLA 1T03A 3ZT2A 4BDZA 4K41A 1BOTO 2KKZA 3O9QA 3OBWA 4E7KA 2V7YA 1YJWN 2P9IA 1V4TA 2YX6A 4L3QA 1LCUA 5C12A 2IC3A 3VQ6A 3O8MA 1SZ2A 3OYMA 5KPRA 1BA1A 1WAFA 1K6YA 5A2QO 1L3TA 3AY9A 3MN7A 4FWSA 4ISFA 4MLEA 3VTIA 3OYJA 4A2AA 4CEEA 4DTOA 4LY7A 4E1NA 1HKCA 2VWBA 2UUAK 4M3ZA 4RW9A 3CCQN 3E01A 3KK7A 2I7NA 1TK5A 3VQ4A 4FK2A 2KFZA 3HP6A 4WQ5A 1RDCA 4DSIA 1BL3A 3QLHA 4FZZA 3H46O 1HYZA 3UKRB 3THWA 1C1AA 3M8RA 4CIEA 2KZMA 3T69A 1WAJA 2DFEA 3CI5A 4NLBA 1UA1A 3G4SN 5HBMA 1JLFA 1SKWA 3C0BA 3DXKB 2D5RA 3ULEB 4CZEA 4BREA 1Z25A 1UOCA 4B9UA 3OYLA 3P5JA 1RTHA 4CK1A 3AAPA 3T1HK 5AZIA 3NF7A 4C8OA 1I3AA 1MDUB 4KHSA 1JL2A 4EFHA 3PUFA 3C6AA 1QZ5A 3CJ1A 1BI4A 4W5OA 4DS4A 1WSEA 4OKEA 2QWNA 4MDAA 1WLJA 4GNIA 2F9TA 1VQ4N 4Z4HA 4CJEA 1TV6A 4E7LA 4QS8A 1HX1A 3TWHA 1ZBSA 1IG9A 4C23A 3NDKA 4EP5A 4BRQA 3U3YA 3HO1A 3VESA 2P9NA 5GAEP 2DPNA 4N41A 2DFHA 3OBYA 1HYSA 4IFEA 3A5MC 4A5BA 5FLXO 4EHUA 2Q36A 3OYHA 3I33A 4LFAK 3PX6A 3N4PA 4LC9B 4FPAA 4CJUA 3L2VA 2BDPA 4KBOA 1EKEA 2BH1A 2YHBA 1HQUA 2P9LB 1BG3A 2HHXA 3K5OA 4YOYA 4LF8K 5SZTA 2HW3A 4HTUA 3MEDA 4IEEA 2QWLA 4EHTA 3CFOA 1R59O 4CF8A 4KTWA 1K8KA 4FLXA 1NJXA 1LOTB 2KW4A 2BUPA 2X6SA 3H45C 1VQPN 3ZT3A 4M63C 2ASMA 1UA0A 3P38A 4ZTJA 4JV5K 2Q2RA 2E2QA 4IG0A 3PO5A 2E88A 1JKHA 4ID1A 4Z0UA 1GLLO 3WEEA 5JS2A 3EYZA 1VAZA 2GELA 3PLAA 3E9PA 1A5WA 2YHAA 1W9HA 2P9IB 4J8FA 3L3UA 2R7YA 5AQNA 3SQ4A 3H3OB 4WQ5C 1OVQA 2JWLA 4HWIA 4Y0WA 3VQQA 2WBNA 2D4WA 4DSEA 4OPJA 4LF9K 4JKDA 3ZETA 3AA3A 5EVZA 3CMAN 3OTOK 3SBGA 4CEDA 5HLFA 1GLFO 5GIOA 1J9AA 4C8NA 2PFUA 3VEYA 4C1NI 3O9RA 1TL3A 3P39A 1DT9A 4CBUA 4DB3A 2FBTA 3NVMA 4FK0A 2O8CA 5KGXA 1QSYA 3RWUA 1VQ7N 4FJXA 4CF1A 1N6QA 4FLWA 2HBJA 1S6PA 4N56A 2CGKA 3LDNA 4JLHA 4J2DA 1RBVA 5M1NA 3JAMO 5LJVA 3CXCM 3JS6A 3O4WA 4ID5A 4ISGA 2ASOA 2HHTA 1U45A 1XQSC 4CGJA 4BROA 3JXUA 3SNNA 3KWGA 3THWB 4LH5A 1BHLA 1T3VA 5J1EA 4KI4A 1SQKA 3TAGA 3M8PA 3HZ6A 1NKBA 2O8BA 5AR0A 3K57A 3LP0A 4ISEA 2HHWA 1IBMK 3B6OA 3L2RA 4M3WA 1NG9A 3TSQA 3TAMA 4CGFA 4H5TA 3FFIA 1KD1O 3CCMN 3AA5X 1OVYA 3HYFA 5AQXA 4IBNA 5I3UA 3MECA 3HK2A 3S3OA 1SV5A 5AQZA 4CF0A 2ZJRL 1RT1A 1NGIA 2HBLA 2WOMA 1EO1A 4F2RA 2YKMA 3AA4A 2W6LA 3AVHA 4C8LA 4BG9A 1BI4B 4JKEA 4FJ9A 3CERA 4QS9A 4IJNA 2Z1GA 2QKBA 3PIPL 2W42A 3SUOA 4IOAL 4Z4EA 1XHXA 2FSNA 1VK0A 5DM6L 1VSIA 4Y1CA 1ITGA 1YITN 2Z1JA 2P9NB 3ZSOA 2DY4A 3D7EO 2XY8A 1XHZA 4JAXA 4L8RB 1EX4A 4JI5K 4CHYA 1TGOA 1BQMA 3IAYA 3LANA 4KHPK 1BUPA 3AVJA 2GX9A 3FR0A 3VGKA 1NWKA 4EIAA 4CI6A 4LSNA 4MDBA 4NYNA 2FF6A 4IJAA 5AQQA 3U6FA 2RE2A 4XEIA 3RR7A 4I9LA 2F96A 1K8KB 1J6ZA 1YF5L 1Q9YA 3PX0A 3UB5A 5KPZA 5H1SQ 4FZXC 3DJCA 3KKSA 4CJ4A 1YJNN 1RDUA 3ZCMA 2AJQA 4B3RK 3SCXA 1Z6RA 4BRFA 4BRDA 3G71N 3WEEB 4NCAA 3VPZA 1E4FT 4PKIA 4JI6K 4FPBA 4JK7A 4CJSA 1HRHA 3EEQA 2HNYA 1S72N 4BWMA 3S41A 1T7PA 3LALA 1RBUA 5AQYA 2Y1JA 1YIJN 3ZETB 3I8DA 5F1XA 4CESA 1OH7A 2Q1NA 3K58A 5FDLA 4DFMA 3V9ZA 4DQQA 2G8KA 2RKIA 4FK4A 1BGXT 4JKCA 1B9DA 1ILYA 4B1WB 3OA9A 5SWMA 1KVAA 4NO7A 2OZSA 2O8CB 2OTLN 1C0GA 1S9EA 2V52B 3C6UA 4BRIA 3QINA 4JI8K 1QSLA 4BC3A 3O08A 4M42A 4FM2A 1MU2A 2Q97A 4CJVA 3SQ2A 2QWMA 4DV4K 3F73A 2NRTA 1UAXA 3U8XA 2F8SA 4H0VB 3LM2A 4W5RA 3HVRA 1KQSM 4BE2A 4DTMA 1U2VA 1HPZA 1E3MA 2YHYA 2JLEA 2O8BB 2XO7A 1ZYQA 1VHXA 2LSNA 4H03B 1S1TA 4JKFA 1VSFA 1ZC6A 4WQ4A 3HOSA 4FM0A 1S5JA 1G15A 1NGEA 2NZTA 2AA4A 1HLUA 1KFSA 1OH6A 4AQYK 1A5XA 1LAVA 2Z1IA 3O4QA 2QK9A 2E5LK 3LDSA 4CJLA 1UWBA 2E8AA 3WT0A 5E84A 3OS1A 3TAPA 1ESVA 3HM9A 4NYFA 3QBWA 1XI1A 3ASMA 3FZMA 5FPDA 4YORA 4DTUA 1HJRA 3VEZA 3OYKA 4LD0A 4W5QA 4N5SA 3HTVA 4N47A 3L4IA 4DR6K 3AVIA 2Y1IA 4DMNA 2P9UA 4EAHD 5JVHL 3T1AA 2HF4A 1ATSA 2FBVA 4FJKA 3L2QA 1QQOA 5ADXA 5J2NA 4HUEA 1N8RO 2V7ZA 3AO5A 3RMAA 3B6PA 4DQRA 4CEOA 1IBKK 4A62A 4B9SA 3NMUA 3T1YK 3WNGA 3M6GA 1BIUA 2HOEA 4BGAA 5KPTA 4JRQA 3P4IA 4FJNA 5I9EB 4YOVA 3S3MA 4I2QA 4FL9A 3KTQA 4IOCL 1KAYA 4FM1A 2GV9A 2NRZA 3LDLA 4FWKA 3NFAA 4BRLA 3SI6A 3FZHA 5C2DA 4CZFA 1JXBA 3TABA 5AQTA 3RTVA 5LY3A 3C7NA 4DU3A 3SBTA 3VEVA 3WNHA 1EXQA 4CGHA 5JLFA 4B9TA 5T7BA 4OGCA 1NK4A 4DSKA 1SS6A 4OPHA 1A5VA 1BISA 1VSHA 3HPHA 1C0FA 4BRAA 1T44A 4HUFA 4EZ6A 4B1VA 2P9SA 4ILJA 4JK9A 3CC2N 2UXCK 4JKHA 3CCJN 3I0SA 1DEJA 3THVA 1C1BA 3DYAA 3V9WA 4M3YA 5AQOA 3I55N 4YFUA 1LW2A 2IIRA 4IO9L 4RW8A 3EE8A 4JI4K 5C25A 1HNXK 2QEXN 1FW6A 3OYIA 1GLJO 3GE1A 2FF3B 5HRSA 3MWTA 4DF4A 4DR1K 3KJVA 1RTJA 2O4GA 3M1FA 4DTPA 2EX3A 4QS7A 4NXNK 5AJ3K 1QQNA 4JEPA 4CZLA 1IG8A 3CFRA 3KD5E 2G8UA 4N76A 5BR8K 3L3VA 4JS4A 4W5NA 1NGCA 4H5WA 3AVGA 3THXA 4M3TA 1JCFA 2FXUA 3O9UA 4CW7B 1S22A 1XUPO 2E4LA 4DU1A 4DTRA 1U2VB 3DAWA 3TAQA 4BRHA 2QM1A 1JCEA 5AQWA 4BC2A 2J4RA 1WSFA 2KQ2A 4FYDA 1NGJA 4PQUA 1TL1A 4JYAK 4K42A 1U04A 5AQVA 1D4XA 4FWRA 3H08A 3VETA 3OHRA 4O0JA 4BR5A 3OW2M 5BRDA 4O8UA 1O13A 1SKRA 4ILHA 3BEXA 3ZSVA 1S1VA 3NH1A 4B1ZA 3CPWM 4CCHA 5JS1A 1IKYA 1GLDG 1NGBA 3A8YA 1YTUA 2OPRA 4H4OA 5GAGP 4HTLA 4OJRA 4LFBK 4IWVA 4GKJK 3AVNA 3R1XA 4CHNA 1QHAA 3H3NO 3L2UA 3SPYA 1SL2A 2PZSA 4H0OA 4BDPA 2P9UB 3L2WA 1LW0A 1RTDA 4GKKK 4O55A 1U6ZA 3R3LA 3HL8A 4B8CA 1XWLA 4OPAA 2HMPA 4Z94A 2KTQA 4CJ5A 2OPPA 2HF3A 3SQ1A 3NF8A 3AVMA 4OLAA 2CH5A 1B92A 1FK9A 4PY5A 3CMEN 4AM6A 1TUYA 4HCBA 4B08A 2E2OA 3HSCA 3O5BA 3SJHA 1YT3A 3CYMA 4I6MA 2UUBK 3K9KA 2ZQBA 4NXMK 1QE1A 4CZIA 1VSEA 4Q0BA 4X65K 3CC4N 3C7NB 3QEPA 3GG4A 3E9LA 4EP4A 3G10A 3KZBA 4DTXA 3OYCA 3HM8A 4J2BA 3KKRA 4BACA 4DV1K 3I56N 2A40A 2P9SB 2ZWHA 5DK5A 4DTNA 3A5OC 3MMVA 3VMFB 4CFCA 5AQMA 3QNOA 3SMSA 4DV3K 5BRFA 3N4QA 4F8RA 1SAZA 2E6LA 3MCPA 2KLAA 5AQJA 2E6MA 1NOZA 4GW6A 4CD1A 5E41A 3CD6N 5AZJA 1D8YA 1RBRA 4J2AA 3L0QA 3DRPA 1ZBIA 2OANA 1NU0A 3LL3A 1WN7A 2VQFK 4H8KA 3CCLN 3MN9A 1NBWA 1U47A 1NGDA 1Z05A 5BPLA 4FLUA 3VQBA 2IVNA 5BPMA 5K14A 3NH0A 3THXB 1HQEA 1ZBFA 4IDHA 3AO1A 4KFBA 2QW9A 1GOCA 1WSIA 1RDAA 5IWAK 1IKVA 1TKZA 3O3GA 3GBTA 3W0LA 1NK0A 3J7ZO 3C6TA 3O1WA 4YY3K 2G8VA 1DTQA 3CJBA 4BRNA 1D9FA 1YUWA 1VQ6N 2X6NA 4FW1A 2ASPA 4UY8O 3QEWA 2FC0A 3C95A 1CLQA 3K0SA 5HRPA 2GEMA 3HI0A 2NRVA 3PIOL 1NK8A 4DQPA 4CZGA 5KTQA 4KPYA 1VRTA 5BN8A 2VGNA 3TR8A 3WXLA 4KHYA 3HP9A 2FBYA 4PA1A 4CZJA 3MX5A 4NCBA 4XH5A 4PKGA 5JLHA 5JICA 2W40A 4JKBA 5AQPA 1EP4A 3CQYA 2D0OA 4B1XB 4BQZA 1NGHA 1J54A 2XRIA 1JXEA 1TYQA 5TKYA 4JI0K 4KTZA 3ENHA 4IXCA 1P90A 2ATQA 4RTFD 4F3OA 1T05A 4BWJA 4OVLA 4FSVA 3QICA 2HMIA 2V51B 1ZXOA 1X9JA 1Y64A 3EL2A 4CJKA 3HXMA 4CF2A 5EU7A 4I6MB 1HYVA 2D0PA 2ZGYA 3CCEN 1ATRA 4M45A 3OY9A 1NKEA 3CJAA 3VQ7A 1VQ8N 4X66K 1R0AA 3CCRN 1KSPA 4JD2A 4DV2K 4DV5K 5AQFA 3CIPA 4GV3A 2G8WA 3WUHA 3EZ5A 3QNNA 4PL7A 3O3HA 2P51A 4GVEA 1JLAA 2HNZA 1SUQA 4IKFA 3VTHA 3SPZA 2NRHA 4DR3K 1EETA 4CZHA 4FZYA 5B8HA 3E1YA 3OVNA 1LWCA 2KHOA 4YDUA 4HUGA 1NK6A 4WFNL 4DR5K 1KVCA 3CHWA 4PHTX 3RR8A 4M7YA 3QEIA 2OZMA 3MEGA 1JLQA 5J2MA 3ZX2A 5AZIB 1NJIO 4CD3A 4JI1K 4G1QA 1NNEA 2OPQA 5DM7L 4BC4A 5AZJB 2A41A 3CJ9A 1SKSA 3U3GA 3FE1A 1NMNA 3QEVA 3BZCA 3BUZB 4Q5VA 4QOZB 2UYTA 4DUYK 1XC9A 5GADP 2PYJA 4DKWA 4GVMA 1VRUA 1TAUA 1IKWA 1XNRK 4WFAL 4JRPA 3B8AX 4JHDA 4B1YB 4JI2K 5LL6Z 1N33K 3HRGA 3DRSA 3J81O 4KH4A 2BE2A 3LDPA 5F2RA 4CHZA 1FJGK 4JN4A 3M8QA 3CJ7A 4LF5K 5HOOA 2B6AA 5AQIA 1VQLN 4JKGA 1GLBG 2EHGA 3ZT0A 4DWIA 3DRRA 3EY1A 4E7HA 3S3NA 5AQLA 5CZ1A 2NLXA 4AF1A 3FLCO 3VQ8A 3NGYA 4ILGB 1D5AA 4BR9A 4FLVA 4PWDA 1QVFM 5BN9A 2QXLA 5FROA 3L4QA 4B9MA 2F8TA 3LPTA 3NGZA 5CE3A 5CY4A 2I7PA 4ELVA 1ASWA 2Q31A 4CE9A 1BDGA 3I0RA 3ZEUA 4AHUA 1MWMA 1TYQB 4CJQA 2ITMA 1CXQA 2WC9A 4DR7K 5D3GA 1BCOA 3ZT4A 3WNFA 2O8DA 4CERA 3V4IA 3VF4A 5HROA 1BA0A 2OPSA 4A2BA 1HJOA 4DG1A 3M8SA 3A5NC 1S3XA 2UUCK 1NMDA 4H4MA 3C65A 4RW6A 4DLEA 4E0DA 2X74A 3VA0A 3FZFA 4B9NA 3OYEA 4DFPA 4M3XA 4WYBA 4JD2B 4Y1DA 5ADXH 1HNWK 3ZSYA 1NJWA 1ZBUA 3OS2A 1ASVA 4O0IA 3TANA 4HVJA 4OPKA 1RCHA 3AVBA 3KIOA 5ELZA 1RNHA 4DSJA 1NJZA 3PSFA 4H0YB 4H0PA 4KAZA 2GTDA 3KVGA 3QDKA 4H0XB 2BTFA 5C0YA 4E19A 1DLOA 2B4JA 3GDQA 2HHVA 1B9FA 1S6QA 3J7YP 4K8XA 1EWRA 2E1ZA 3DLRA 3VGLA 1BCMA 4IG3A 1M1KO 1TKTA 4E1JA 4NCGA 4LFCK 1C1CA 4B9QA 1KAXA 2WONA 3WXJA 4DR2K 2UXBK 2Q3SA 4IOXA 3KLHA 1TUUA 3EKUA 1JL1A 5CR4A 3OYFA 1VQ9N 4I7FA 3RVCA 3ZSXA 3MXIA 2HB5A 4JHDB 1T6CA 2PBDA 4FWMA 2YJFA 4O8KA 4CEBA 4CGGA 2D1KA 3AVCA 3TTFA 3AGRA 1HUXA 4BE0A 3DWLA 2P1JA 3OYDA 5JVGL 4DCHA 4JKGB 3DMJA 2DFFA 5FRNA 4A59A 3J7AP 3TSPA 3LAKA 1DKGD 3LWLA 3QIOA 3U9ZA 1NJYA 1ASUA 5EOYA 3VQ5A 3M5RA 4RG8A 2O8FA 4Z4FA 2F7TA 3MAQA 1HNVA 1XMOK 3MCAB 5BPNA 4JNEA 1Q7YO 4I2PA 1CZAN 3NF6A 4YHHK 1J5EK 3V9XA 3R9PA 3SLCA 3D6RA 3CM6A 4OX9K 4RW7A 3ZEUB 3HSTB 1BQNA 5M1FA 4FVUA 3O80A 5EX5A 4JS5A 3SV3A 4XH4A 2RF2A 5CYMA 4DTSA 5M1KA 4DV6K 3NHGA 3H1QA 3OYAA 4Z4GA 1FXXA 1Q81O 2HVHA 2DTUA 4AHTA 4CGIA 3KK2A 3AVKA 4R79A 2YNHA 1JLBA 1X1PA 1Z26A 1YVNA 1HMVA 4F9OA 1RT4A 1WUAA 3AVFA 2HHHK 1WOQA 3M3ZA 4DFKA 1X3NA 3L6QA 4WQ4C 3V81A 2P5GA 3EO3A 4CZKA 1YJ9N 1WSHA 4MFBA 2HVIA 4FJ7A 3EZWA 4BDYA 2OCEA 4CJ3A 1JJ2M 5KRTA 3ID8A 4CK3A 1BU6O 2VG6A 2CH6A 2VWJA 2GUPA 2VG7A 3CC7N 1Q86O 4CHPA 4M3UA 1OH5A 4AILC 1WSJA 1IO2A 3JYTA 3QEXA 3CQ8A 1NGAA 1TKDA 4CJFA 4M3RA 3IG1A 1RT7A 3FFKB 2YNGA 4FJ8A 4F2SA 2QWOA 3IUCA 4OKKA 2F9WA 4CJRA 4OGEA 4OKJA 5C24A 3F2KA 3ZSQA 2VG5A 3J8AA 3MDQA 1XNQK 4XH1A 3QETA 3SQ0A 4RW4A 5CHIA 3SAGA 1NK5A 3ALYA 4O5FA 5J2PA 1F21A 2X78A 3THYA 4KB0A 2YV0X 3H6EA 3V9UA 2UXDK 5HL7L 2HBKA 1VSJA 5BREA 1WSGA 3F5TA 4PL8A 3SAFA 3SUNA 3TU5A 5IT9O 4FJLA 3FGUA 1YVUA 1Q9XA 1QSSA 3ZSRA 2D0AA 2YHWA 4CEQA 1L3VA 1T8EA 3MN5A 5AQGA 3LP3A 3G25A 4H5RA 5J2QA 3SYZA 5FPNA 4KO0A 4ZHRA 4XIUA 4DHYA 3VQAA 1D9DA 2YHXA 4MO4A 5C2FA 4B1UB 3AO3A 4V19S 5GIPA 3K5MA 2FBXA 3D2EA 3NE6A 2GBZA 4FXDA 4FOEA 2QI2A 3LZIA 4BGBA 4CHOA 1Q82O 3TAFA 2IGIA 2O8FB 4IDKA 2VGMA 4GMJB 1KLNA 2PYLA 3LDQA 3AO2A 4O44A 5M1OA 4YOXA 4DF8A 4TSXA 3QFUA 4FLTA 4E89A 4B3SK 5EXWA 3RMDA 1EQYA 1QQCA 4BRPA 3K2PA 4DSFA 2IAJA 4H0TB 2O8EA 1QTMA 4AH9A 5M1QA 1I39A 5LJWA 2ZGZA 1J5OA 3RSEA 4B8AB 4CBWA 1S9GA 3HPGA 4DV0K 4X64K 4CJPA 5M1PA 3MWPA 3HJFA 4DQIA 3FZLA 1L5UA 2CGJA 1S1WA 4CIGA 3LPUA 5AFUH 3VQ9A 4CFAA 3BP8A 1Y97A 4JI3K 1W97L 1DGKN 3SAHA 2RPIA 2Q0RA 4CFDA 4IFYA 2ZM6K 5LMNK 1CZ9A 1U48A 4K0KK 4HHTA 4H5VA 4M7XA 4QAGA 4YOUA 2Z1HA 1YTAA 4BRMA 1K8AO 4KHWA 3VEWA 1OKJA 3K9JA 1GOAA 3VERA 5HRNA 3UKUA 1KC8O 5LMUK 1VQ5N 3ENOA 4KV8A 5KQ8A 3DLEA 3ISNC 4MO5A 1VQMN 3PSIA 4FWPA 5C42A 5HP1A 2OYQA 4ELUA 3AVLA 4WE1A 3BGRA 1FKOA 1VSLA 4WCEL 3KLFA 3SJJA 1C0UA 2GUIA 3V6DA 3SUPA 3O4NA 2GWKA 3VQCA 4DR4K 3LM9A 3AO4A 4E1MA 4BQLA 4AHRA 4KHQA 3O9TA 3T3FA 4CZMA 1XMQK 1DTTA 3A5LC 3SZ2A 3NAEA 2XY6A 5AFUA 3DLGA 1H1VA 1BO5O 3QESA 3RMBA 2IOCA 3DLKA 4KRFA 4BR7A 4IEIA 3THYB 3R6MA 4BE1A 2B5JA 3AV9A 1VSDA 1C0TA 3IS9A 5AQUA 4O4GA 3VF6A 4MLHA 2A1SA 3DLHA 4O5BA 1RGIA 3A2FA 3A0IX 4FWLA 2D0BA 2VWKA 4DQ8A 4U7BA 5CZ2A 4NB4A 4DV7K 3VQPA 1N32K 3DI6A 4BG8A 4K8ZA 3ZSZA 1RDDA 2E2NA 4M41A 2QXFA 3Q7CA 3C94A 3TTCA 1QQMA 3CM5A 3TPQA 4AHSA 1HKGA 2NUBA 3VQDA 4OLBA 3AAQA 3BZKA 3G6EN 3DLBA 1X9MA 3ZT1A 1KFDA 3D2EB 4YNQA 3IKMA 1TAQA 3V1RA 1NOYA 4ICLA 3QERA 5AQHA 4KB1A 3KK3A 3NF9A 3V1OA 3IFRA 5BRHA 2RHKA 3ID6A 3ULDA 2QTDA 2ZJPL 3QBXA 2A1RA 1BWFO 1W7AA 2HNDA 5F0XA 4JK8A 1BIZA 1JCGA 3QMLA 4BY9C 1E4GT 3GOIA 3VENA 3WXIA 5GAHP 2G8IA 2O8EB 2P9KA 3IMXA 2W41A 1NLVA 3QO9A 2RN2A 3MN6A 4YOTA 1GLAG 3MEEA 3BF1A 4LH4A 2OTJN 4H5NA 3RSEB 3OJSA 4DLGA 1I94K 2WTUA 3F9KA 2Q0UA 1VQNN 1YHQN 1TK8A 1U49A 1X3MA 2YI1A 2JGUA 3CJCA 3PV8A 2PY5A 4CECA 3AGKA 3SV4A 3RRGA 3CFPA 3F9MA 3O3FA 3P31A 1N36K 1QHTA 4CVNE 3KWIA 3VGMA 2W6KA 3NVKA 4KHUA 2QA4N 3DM2A 4GV6A 3I8BA 3VN5A 3DLLL 4A5AA 1NKCA 3RMCA 3ZYYX 2E20A 3S9HA 1S1XA 1KTQA 3CPEA 3DOKA 4HCCA 1KXPA 4KREA 5AQKA 3EKSA 4E3SA 1CZBA 2IDOA 3WQUA 5I42A 4FJGA 4B9LA 4LF7K 2A5XA 2ZJQL 3UKUB 4KTQA 4FJJA 3LWMA 4KHNA 3D0PA 1O1WA 4ZTFA 4B3OA 3WQTA 1IH7A 4QCLA 1IBLK 2JWKA 3HT3A 3TI0A 3CCVN 4CEAA 1T6DA 1YXQA 1REVA 3U4LA 3DOLA 2O4IA 4LF6K 4GY2B 1C6VA 2OA8A 4CJ7A 4BVOA 5GINA 3R8EA 4E7IA 3C6HA 4FO0A 1TVRA 4A61A 3MK6A 5JMVA 4EZ9A 3D45A 2IVPA 4DS5A 4FCYA 1X9SA 1HNZK 1QS4A 1EWQA 4PUOA 3ZX3A 2G8FA 3EN9A 1L3SA 2QWPA 4K25A 2HHSA 3CQXA 4A57A 1TK0A 4C8KA 1KCFA 2FSJA 5FPMA 4YOWA 3OYBA 3VEXA 3CCUN 3D2FA 3E66A 2F4VK 2D0CA 3OYGA 1W0HA 2AP1A 1YI2N 4IO8A 1GLEG 1QVGM 1XC3A 4FLZA 3MXMA 4FLYA 4B3MK 1VSMA 3T19A 4KKOA 1OH8A 1SL0A 3VOVA 4K43A 3PX4A 5FRMA 1VSKA 4YDUC 3TARA 1NK7A 5KGWA 4B3TK 2WFBA 3LDOA 4MQ3A 1LAWA 4C8MA 4FJHA 3VA3A 4BR0A 3IRXA 4CIFA 1GOBA 2P9PA 1TKXA 3SMPA 4BRCA 4CJWA 2EWSA 3LP1A 2HBMA 4FWQA 3HVTA 3FZKA 2ZD1A 3O1BA 1M90O 3VF2A 4U67L 2CGLA 5C15A 4FJMA 3L8BA 2P9KB 2KZZA 1QZ6A 3DXMA 3CG7A 4RWTA 4ELTA 3QB0A 1KAZA 3J80O 4NLCA 4DU4A 4Z4IA 2I5JA 1LV5A 3VEOA 2H3GX 3NCIA 3QFPA 1V4SA 4CEFA 3ZLJA 3G0ZA 3TAEA 4C1NK 3ATUA 2BANA 1WBBA 5AQSA 4WFBL 4UQGA 1GLCG 3V9SA 3E9OA 3LP2A 3HBTA 4GV9A 2A3ZA 4CGDA 2VYPA 1RT5A 3WXMB 4X62K 3UE5A 1HKBA 4KI6A 3AARA 1JLEA 4BRKA 3KLIA 3OS0A 4JKAA 3AVAA 2VCPA 3CF5L 1Q18A 4B9VA 3HPOA 2VQEK 5DMRA 1L3UA 4BR2A 3WXKA 1SL1A 2HSTA 3EE9A 4FWNA 1RDWX 2YJEA 4W5TA 3T7ZA 1WB9A 5BR9A 2NRRA 2QKKA 4DQSA 1NK9A 3TSUA 3P83D 4FWOA 2QWQA 4DUZK 1RBTA 4BR4A 2NRWA 4CFBA 4R5PA 3KD1E 1C0MA 2YKNA 4G9ZA 5EY4A 3WNEA 2ETJA 3BDPA 1MWKA 2PAVA 4DSLA 1ATNA 3CETA 4I9QA 4AM7A 3KLEA 2FSKA 1LWFA 3H1VX 4DTJA 1RT2A 3IDHA 3P1GA 2A6AA 1RILA 3BY5A 5HRRA 2NNWA 4BVPA 1HNIA 2ITGA 2P5OA 4CF9A 2HHQA 2BGGA 1WBDA 1RT6A 1NGFA 1IV0A 1RBSA 4LF4K 4PKHA 4LSLA 1JLCA 2YCHA 3RRHA 1HPMA 3ATVA 2FLOA 1HR0K 4IZ9A 4FVMA 3K5NA 3UIQA 3ENBA 4CEZA 2ZF5O 1J53A 3D2FB 3PO4A 3NH2A 3UKRA 4F3TA 1RTIA 1JLGA 1WNSA 2IS3A 4RCHA 3O6WA 3PY8A 2O8DB 4CHQA 1KRPA 2NRXA 1KVBA 3VQEA 4E7JA 1G99A 4IFVA 1VQKN 4BC5A 3DXKA 2KFNA 3ULEA 1NGGA 3GL1A 2YNFA 3NBPA 2XY7A 5C10A 4JI7K 1S1UA 4WF9L 4AHVA 3KK1A 4J2EA 4CBXA 3KLGA 4Z4CA 1ZBHA 3CCSN 5TKWA 2WUSA 1VQON 5FPEA 1RDBA 4F4KA 4FOIA 3OYNA 3OJUA 2P9PB 2E1YA 3W3DA 2ZE2A 4BRGA 1LWEA 3ITHA 3K5LA 3TTDA 1X9WA 3K59A 3O9SA 4OO1J 3NGIA 3JSMA 2A42A 1W2BM 1RFQA 1YAGA 3DXMB 4FW2A 1K9MO 5AQRA 4FJ5A 4FJIA 2E2PA 3U9DA 1MA9B 3HOTA 3MXJA 2YNIA 4AHCA 1Q8IA 4DFJA 2IVOA 1N5YA 2QWRA 5KI6A
chains in the Genus database with same CATH topology
4CJLA 1UWBA 4KV8A 3QIPA 3DLEA 1KLMA 2PYJA 3LAMA 1CXUA 1IKXA 4GVMA 1VRUA 5KRSA 3ISNC 3OS1A 1IKWA 1TAUA 3LZJA 3TAPA 1FKPA 3HM9A 4NYFA 4JRPA 5C42A 5HP1A 2OYQA 3ZSWA 1XI1A 3AA2A 4ELUA 3AVLA 3ASMA 4WE1A 3BGRA 1FKOA 1VSLA 3KLFA 2XHBA 2XY5A 4DTUA 3SJJA 1HJRA 1C0UA 3OYKA 2HHUA 2GUIA 4LD0A 4W5QA 1U4BA 4N5SA 3V6DA 3SUPA 3O4NA 5CYQA 3DRSA 4N47A 3VQCA 3AVIA 2Y1IA 3AO4A 4E1MA 1RT3A 2BE2A 4CHZA 4DMNA 2G8HA 4AHRA 3M8QA 4KHQA 3V1QA 3T3FA 4CJTA 3SUQA 4CK2A 1ZBLA 3T1AA 1T03A 2B6AA 3ZT2A 1DTTA 3SZ2A 2XY6A 3NAEA 2FBVA 4BDZA 3DLGA 4FJKA 3L2QA 3QESA 2EHGA 3ZT0A 3RMBA 2IOCA 4DWIA 3DLKA 3DRRA 4E7KA 3EY1A 4KRFA 5J2NA 4HUEA 4E7HA 3S3NA 5CZ1A 3AO5A 3RMAA 3B6PA 4BE1A 2B5JA 4DQRA 3AV9A 1VSDA 3VQ8A 4CEOA 1C0TA 2IC3A 3IS9A 3VQ6A 3NGYA 4B9SA 1D5AA 4FLVA 4PWDA 3WNGA 4O4GA 1BIUA 5FROA 4JRQA 2A1SA 3OYMA 3S3MA 4FJNA 3DLHA 4O5BA 4B9MA 1WAFA 4I2QA 1K6YA 2F8TA 1L3TA 3LPTA 3A2FA 3KTQA 3NGZA 4FM1A 2GV9A 2D0BA 2VWKA 3NFAA 3SI6A 3OYJA 5CZ2A 5CY4A 4CEEA 4DTOA 3VQPA 4ELVA 3DI6A 1ASWA 4K8ZA 1JXBA 4LY7A 3TABA 3ZSZA 4CE9A 4E1NA 3I0RA 1RDDA 3RTVA 4M41A 4AHUA 4DU3A 2QXFA 3C94A 1EXQA 3WNHA 4CGHA 4B9TA 5T7BA 3CM5A 4OGCA 4CJQA 4AHSA 2NUBA 1NK4A 3VQDA 1CXQA 4DSKA 4M3ZA 4OLBA 4RW9A 1A5VA 1BISA 1VSHA 3DLBA 1X9MA 3HPHA 3E01A 3ZT1A 4HUFA 1TK5A 1KFDA 3VQ4A 4EZ6A 4FK2A 5D3GA 1BCOA 3ZT4A 2KFZA 4YNQA 3HP6A 3WNFA 1TAQA 3V1RA 4CERA 1NOYA 3V4IA 4ICLA 3QERA 5HROA 1RDCA 2OPSA 1BL3A 3KK3A 4DSIA 4KB1A 3NF9A 3V1OA 4DG1A 3QLHA 3M8SA 3I0SA 3ULDA 4FZZA 3THVA 1C1BA 2A1RA 1HYZA 4H4MA 3DYAA 3V9WA 4M3YA 2HNDA 4YFUA 1BIZA 4RW6A 4DLEA 1LW2A 1C1AA 3M8RA 4CIEA 2KZMA 1WAJA 2DFEA 4E0DA 4RW8A 2X74A 3VA0A 5FRMA 1UA1A 2G8IA 5C25A 5HBMA 1JLFA 3QO9A 3OYIA 1SKWA 2RN2A 4B9NA 3OYEA 4DFPA 4M3XA 4Y1DA 3MEEA 2D5RA 5HRSA 4LH4A 3ZSYA 4DF4A 1NJWA 3KJVA 1ZBUA 1RTJA 1Z25A 3OS2A 3OJSA 1UOCA 2O4GA 4DLGA 4DTPA 2EX3A 1ASVA 4O0IA 3F9KA 4HVJA 3OYLA 3TANA 4OPKA 1TK8A 4B9UA 1RCHA 3P5JA 3AVBA 1U49A 3KIOA 1RTHA 1RNHA 2JGUA 4CK1A 3PV8A 2PY5A 4CECA 3SV4A 4DSJA 3RRGA 1NJZA 3CFPA 2QK9A 3NF7A 3O3FA 4C8OA 1I3AA 3CFRA 4KHSA 1JL2A 1QHTA 2G8UA 3PUFA 3L3VA 3KD5E 4JS4A 4KAZA 4N76A 4W5NA 3AVGA 4M3TA 4KHUA 1BI4A 4W5OA 4DS4A 4E19A 1WSEA 1DLOA 2B4JA 2E4LA 4OKEA 3DM2A 4DU1A 4DTRA 1WLJA 3VN5A 4Z4HA 3TAQA 4CJEA 2HHVA 1B9FA 1TV6A 1NKCA 3RMCA 1S6QA 4K8XA 4E7LA 3DLRA 3TWHA 1IG9A 3NDKA 1WSFA 2KQ2A 1BCMA 4IG3A 4EP5A 3U3YA 3HO1A 4FYDA 3S9HA 4N41A 4PQUA 1TKTA 1TL1A 2DFHA 4NCGA 1C1CA 1KTQA 1S1XA 1U04A 1HYSA 3OYHA 3DOKA 4HCCA 3H08A 3PX6A 4KREA 4E3SA 4FJGA 1CZBA 2IDOA 2WONA 5I42A 4O0JA 4B9LA 2Q3SA 4CJUA 3L2VA 1SKRA 2BDPA 4KTQA 3ZSVA 1S1VA 4FJJA 3KLHA 3NH1A 3LWMA 4KHNA 3D0PA 1O1WA 4ZTFA 4B3OA 5JS1A 1EKEA 4CCHA 2YHBA 1HQUA 1IH7A 1IKYA 4QCLA 3TI0A 1JL1A 3K5OA 3HT3A 2HHXA 3OYFA 4CEAA 5SZTA 4I7FA 4HTUA 2HW3A 3MEDA 3ZSXA 3MXIA 2HB5A 2OPRA 1YTUA 1REVA 4H4OA 3CFOA 3DOLA 2O4IA 4CF8A 4OJRA 4KTWA 1C6VA 3AVNA 2OA8A 4CHNA 4FLXA 1NJXA 3L2UA 4E7IA 3SPYA 4CEBA 2KW4A 4CGGA 1SL2A 2PZSA 2X6SA 3AVCA 1TVRA 4BDPA 3L2WA 3ZT3A 1LW0A 1UA0A 4BE0A 4EZ9A 4ZTJA 1RTDA 2P1JA 3OYDA 3D45A 4O55A 4DS5A 4FCYA 3HL8A 4IG0A 3PO5A 4B8CA 1XWLA 4ID1A 1JKHA 4Z0UA 3DMJA 2DFFA 5FRNA 2KTQA 5JS2A 3EYZA 1X9SA 1QS4A 4CJ5A 4PUOA 2OPPA 3SQ1A 1A5WA 2YHAA 2G8FA 3NF8A 1L3SA 1W9HA 3LAKA 3LWLA 3AVMA 3QIOA 4OLAA 3L3UA 2R7YA 1NJYA 1ASUA 1B92A 2HHSA 1FK9A 4PY5A 3VQ5A 4HCBA 4RG8A 4B08A 3SQ4A 1TK0A 4C8KA 4Z4FA 3MAQA 1HNVA 1KCFA 3VQQA 3OYBA 1YT3A 3CYMA 2D0CA 4OPJA 4DSEA 4I2PA 3OYGA 1W0HA 3AA3A 3NF6A 4FLZA 4CEDA 4FLYA 3MXMA 5HLFA 3V9XA 1J9AA 2ZQBA 1VSMA 1QE1A 3T19A 4C8NA 4KKOA 1VSEA 3CM6A 4Q0BA 4RW7A 3QEPA 1TL3A 1SL0A 3HSTB 1BQNA 4EP4A 3G10A 3PX4A 2FBTA 4DTXA 4JS5A 3SV3A 3OYCA 4FK0A 2RF2A 5CYMA 5KGXA 4DTSA 1QSYA 1VSKA 3TARA 3KKRA 3OYAA 3NHGA 3RWUA 4CF1A 4J2BA 4FJXA 1FXXA 1N6QA 1NK7A 4FLWA 5KGWA 4Z4GA 1S6PA 4BACA 2HVHA 2DTUA 4AHTA 4N56A 4CGIA 3KK2A 3AVKA 4MQ3A 1LAWA 4JLHA 4J2DA 5DK5A 1RBVA 2YNHA 4DTNA 1JLBA 4ID5A 1X1PA 1Z26A 4C8MA 2HHTA 1U45A 4FJHA 3VA3A 3IRXA 1HMVA 4CIFA 1RT4A 1GOBA 3AVFA 4CGJA 1TKXA 4CFCA 4CJWA 3QNOA 3LP1A 3SNNA 3HVTA 1BHLA 4LH5A 4DFKA 5J1EA 4KI4A 2ZD1A 4F8RA 3TAGA 3M8PA 1NKBA 3V81A 2E6LA 2P5GA 3K57A 4FJMA 3LP0A 3L8BA 2HHWA 2E6MA 3B6OA 2KZZA 1WSHA 4MFBA 1NOZA 3L2RA 3CG7A 4GW6A 5E41A 4ELTA 4M3WA 2HVIA 4FJ7A 1D8YA 3TAMA 1RBRA 4CGFA 4J2AA 4BDYA 4DU4A 3DRPA 1ZBIA 3FFIA 2I5JA 1LV5A 4Z4IA 4CJ3A 5KRTA 1WN7A 3NCIA 3AA5X 3HYFA 4CK3A 4IBNA 4CEFA 5I3UA 3G0ZA 3MECA 2VG6A 4H8KA 3TAEA 2BANA 2VWJA 2VG7A 1U47A 3HK2A 3S3OA 1SV5A 4CHPA 4CF0A 4UQGA 1RT1A 4FLUA 4M3UA 2WOMA 3VQBA 3V9SA 2YKMA 4AILC 3LP2A 4F2RA 1WSJA 5K14A 3AA4A 1IO2A 3NH0A 1HQEA 3JYTA 1ZBFA 3AVHA 3AO1A 3CQ8A 3QEXA 1TKDA 4KFBA 4C8LA 1BI4B 4CGDA 4CJFA 4FJ9A 4M3RA 1GOCA 3IG1A 1RT7A 1RT5A 1WSIA 1RDAA 2YNGA 1IKVA 1TKZA 2Z1GA 3O3GA 4F2SA 1NK0A 4FJ8A 2QKBA 4OKKA 2W42A 4KI6A 3C6TA 1JLEA 3SUOA 3KLIA 3OS0A 4Z4EA 1XHXA 2G8VA 1DTQA 1VK0A 1XC9A 1D9FA 3AVAA 4CJRA 4OGEA 1VSIA 4OKJA 4Y1CA 1ITGA 5C24A 4B9VA 3ZSQA 3HPOA 2VG5A 2Z1JA 3ZSOA 5DMRA 1L3UA 2DY4A 2X6NA 4FW1A 1SL1A 2XY8A 1XHZA 3QEWA 2FC0A 3C95A 3QETA 4L8RB 1CLQA 3SQ0A 1EX4A 4RW4A 4W5TA 5HRPA 1NK5A 3ALYA 5J2PA 1F21A 2X78A 4KB0A 2YV0X 3V9UA 1NK8A 2QKKA 4DQPA 4DQSA 1NK9A 4CHYA 1TGOA 3P83D 1BQMA 5KTQA 3IAYA 4KPYA 1RBTA 1VSJA 1VRTA 1WSGA 3LANA 4CFBA 3AVJA 3TR8A 4KHYA 4R5PA 3KD1E 3SUNA 4FJLA 1C0MA 4LSNA 3HP9A 2FBYA 2YKNA 4NYNA 4PA1A 1YVUA 1Q9XA 4NCBA 1QSSA 3WNEA 3ZSRA 3U6FA 2D0AA 2ETJA 4CEQA 3BDPA 3RR7A 4DSLA 1L3VA 4I9LA 2F96A 4I9QA 1T8EA 1EP4A 3KLEA 1Q9YA 1LWFA 4DTJA 1RT2A 3PX0A 4FZXC 3LP3A 3P1GA 3KKSA 4CJ4A 1J54A 1RILA 5HRRA 5J2QA 3ZCMA 2XRIA 3SYZA 2AJQA 1JXEA 4KO0A 4ZHRA 4XIUA 3SCXA 1HNIA 2ITGA 2P5OA 1D9DA 3VQAA 4KTZA 4CF9A 4NCAA 2HHQA 2ATQA 3AO3A 2BGGA 3K5MA 2FBXA 4F3OA 3NE6A 2GBZA 1T05A 1RT6A 4BWJA 4FXDA 4OVLA 4CJSA 3LZIA 1HRHA 1RBSA 4LSLA 4CHOA 3TAFA 2HMIA 1JLCA 2IGIA 2HNYA 3RRHA 4BWMA 1T7PA 4IDKA 4GMJB 1KLNA 3LALA 4FVMA 1RBUA 4CJKA 3HXMA 4CF2A 3K5NA 3UIQA 2PYLA 4CEZA 1J53A 3AO2A 2Y1JA 4O44A 5EU7A 3PO4A 3NH2A 1HYVA 4F3TA 1RTIA 4DF8A 3I8DA 4TSXA 1JLGA 4M45A 3OY9A 1WNSA 2IS3A 4CESA 1NKEA 4FLTA 3PY8A 4E89A 3VQ7A 3RMDA 3K58A 5FDLA 1QQCA 4CHQA 3K2PA 3V9ZA 2IAJA 4DSFA 4DFMA 4DQQA 1KRPA 2G8KA 2RKIA 1R0AA 1QTMA 4AH9A 4FK4A 1KVBA 3VQEA 4E7JA 1BGXT 1B9DA 4IFVA 1KSPA 5SWMA 2KFNA 1KVAA 2OZSA 1I39A 2YNFA 3NBPA 2XY7A 1J5OA 1S1UA 1S9EA 4B8AB 1S9GA 2G8WA 4AHVA 3KK1A 3C6UA 3HPGA 3EZ5A 3QNNA 4J2EA 4CJPA 3KLGA 4Z4CA 3O3HA 1ZBHA 3HJFA 2P51A 3QINA 4DQIA 1JLAA 2HNZA 1L5UA 1QSLA 1SUQA 4IKFA 1S1WA 4CIGA 1RDBA 3LPUA 4F4KA 3SPZA 3VQ9A 4CFAA 4FM2A 1MU2A 1EETA 3OYNA 1Y97A 4CJVA 4FZYA 4M42A 3OVNA 1LWCA 3OJUA 3SQ2A 4HUGA 1NK6A 3F73A 1UAXA 1KVCA 2ZE2A 1LWEA 2F8SA 4W5RA 3HVRA 3RR8A 2RPIA 4CFDA 4BE2A 4DTMA 3ITHA 4IFYA 3K5LA 3QEIA 2OZMA 3MEGA 1JLQA 1HPZA 5J2MA 2JLEA 3K59A 1CZ9A 1U48A 2XO7A 1X9WA 4HHTA 3NGIA 1ZYQA 3JSMA 2LSNA 4QAGA 4G1QA 4FW2A 2Z1HA 1YTAA 2OPQA 1S1TA 4KHWA 1VSFA 4FJ5A 4FJIA 1SKSA 3U3GA 3MXJA 4FM0A 3QEVA 2YNIA 1S5JA 4AHCA 1Q8IA 1G15A 4DFJA 1KFSA 4Q5VA 1GOAA 1N5YA 1A5XA 5HRNA 4QOZB 1LAVA 2Z1IA 3O4QA 5KI6A 3LDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJL A;  1UWB A;  4KV8 A;  3QIP A;  3DLE A;  1KLM A;  2PYJ A;  3LAM A;  1CXU A;  1IKX A;  4GVM A;  1VRU A;  5KRS A;  3ISN C;  3OS1 A;  1IKW A;  1TAU A;  3LZJ A;  3TAP A;  1FKP A;  3HM9 A;  4NYF A;  4JRP A;  5C42 A;  5HP1 A;  2OYQ A;  3ZSW A;  1XI1 A;  3AA2 A;  4ELU A;  3AVL A;  3ASM A;  4WE1 A;  3BGR A;  1FKO A;  1VSL A;  3KLF A;  2XHB A;  2XY5 A;  4DTU A;  3SJJ A;  1HJR A;  1C0U A;  3OYK A;  2HHU A;  2GUI A;  4LD0 A;  4W5Q A;  1U4B A;  4N5S A;  3V6D A;  3SUP A;  3O4N A;  5CYQ A;  3DRS A;  4N47 A;  3VQC A;  3AVI A;  2Y1I A;  3AO4 A;  4E1M A;  1RT3 A;  2BE2 A;  4CHZ A;  4DMN A;  2G8H A;  4AHR A;  3M8Q A;  4KHQ A;  3V1Q A;  3T3F A;  4CJT A;  3SUQ A;  4CK2 A;  1ZBL A;  3T1A A;  1T03 A;  2B6A A;  3ZT2 A;  1DTT A;  3SZ2 A;  2XY6 A;  3NAE A;  2FBV A;  4BDZ A;  3DLG A;  4FJK A;  3L2Q A;  3QES A;  2EHG A;  3ZT0 A;  3RMB A;  2IOC A;  4DWI A;  3DLK A;  3DRR A;  4E7K A;  3EY1 A;  4KRF A;  5J2N A;  4HUE A;  4E7H A;  3S3N A;  5CZ1 A;  3AO5 A;  3RMA A;  3B6P A;  4BE1 A;  2B5J A;  4DQR A;  3AV9 A;  1VSD A;  3VQ8 A;  4CEO A;  1C0T A;  2IC3 A;  3IS9 A;  3VQ6 A;  3NGY A;  4B9S A;  1D5A A;  4FLV A;  4PWD A;  3WNG A;  4O4G A;  1BIU A;  5FRO A;  4JRQ A;  2A1S A;  3OYM A;  3S3M A;  4FJN A;  3DLH A;  4O5B A;  4B9M A;  1WAF A;  4I2Q A;  1K6Y A;  2F8T A;  1L3T A;  3LPT A;  3A2F A;  3KTQ A;  3NGZ A;  4FM1 A;  2GV9 A;  2D0B A;  2VWK A;  3NFA A;  3SI6 A;  3OYJ A;  5CZ2 A;  5CY4 A;  4CEE A;  4DTO A;  3VQP A;  4ELV A;  3DI6 A;  1ASW A;  4K8Z A;  1JXB A;  4LY7 A;  3TAB A;  3ZSZ A;  4CE9 A;  4E1N A;  3I0R A;  1RDD A;  3RTV A;  4M41 A;  4AHU A;  4DU3 A;  2QXF A;  3C94 A;  1EXQ A;  3WNH A;  4CGH A;  4B9T A;  5T7B A;  3CM5 A;  4OGC A;  4CJQ A;  4AHS A;  2NUB A;  1NK4 A;  3VQD A;  1CXQ A;  4DSK A;  4M3Z A;  4OLB A;  4RW9 A;  1A5V A;  1BIS A;  1VSH A;  3DLB A;  1X9M A;  3HPH A;  3E01 A;  3ZT1 A;  4HUF A;  1TK5 A;  1KFD A;  3VQ4 A;  4EZ6 A;  4FK2 A;  5D3G A;  1BCO A;  3ZT4 A;  2KFZ A;  4YNQ A;  3HP6 A;  3WNF A;  1TAQ A;  3V1R A;  4CER A;  1NOY A;  3V4I A;  4ICL A;  3QER A;  5HRO A;  1RDC A;  2OPS A;  1BL3 A;  3KK3 A;  4DSI A;  4KB1 A;  3NF9 A;  3V1O A;  4DG1 A;  3QLH A;  3M8S A;  3I0S A;  3ULD A;  4FZZ A;  3THV A;  1C1B A;  2A1R A;  1HYZ A;  4H4M A;  3DYA A;  3V9W A;  4M3Y A;  2HND A;  4YFU A;  1BIZ A;  4RW6 A;  4DLE A;  1LW2 A;  1C1A A;  3M8R A;  4CIE A;  2KZM A;  1WAJ A;  2DFE A;  4E0D A;  4RW8 A;  2X74 A;  3VA0 A;  5FRM A;  1UA1 A;  2G8I A;  5C25 A;  5HBM A;  1JLF A;  3QO9 A;  3OYI A;  1SKW A;  2RN2 A;  4B9N A;  3OYE A;  4DFP A;  4M3X A;  4Y1D A;  3MEE A;  2D5R A;  5HRS A;  4LH4 A;  3ZSY A;  4DF4 A;  1NJW A;  3KJV A;  1ZBU A;  1RTJ A;  1Z25 A;  3OS2 A;  3OJS A;  1UOC A;  2O4G A;  4DLG A;  4DTP A;  2EX3 A;  1ASV A;  4O0I A;  3F9K A;  4HVJ A;  3OYL A;  3TAN A;  4OPK A;  1TK8 A;  4B9U A;  1RCH A;  3P5J A;  3AVB A;  1U49 A;  3KIO A;  1RTH A;  1RNH A;  2JGU A;  4CK1 A;  3PV8 A;  2PY5 A;  4CEC A;  3SV4 A;  4DSJ A;  3RRG A;  1NJZ A;  3CFP A;  2QK9 A;  3NF7 A;  3O3F A;  4C8O A;  1I3A A;  3CFR A;  4KHS A;  1JL2 A;  1QHT A;  2G8U A;  3PUF A;  3L3V A;  3KD5 E;  4JS4 A;  4KAZ A;  4N76 A;  4W5N A;  3AVG A;  4M3T A;  4KHU A;  1BI4 A;  4W5O A;  4DS4 A;  4E19 A;  1WSE A;  1DLO A;  2B4J A;  2E4L A;  4OKE A;  3DM2 A;  4DU1 A;  4DTR A;  1WLJ A;  3VN5 A;  4Z4H A;  3TAQ A;  4CJE A;  2HHV A;  1B9F A;  1TV6 A;  1NKC A;  3RMC A;  1S6Q A;  4K8X A;  4E7L A;  3DLR A;  3TWH A;  1IG9 A;  3NDK A;  1WSF A;  2KQ2 A;  1BCM A;  4IG3 A;  4EP5 A;  3U3Y A;  3HO1 A;  4FYD A;  3S9H A;  4N41 A;  4PQU A;  1TKT A;  1TL1 A;  2DFH A;  4NCG A;  1C1C A;  1KTQ A;  1S1X A;  1U04 A;  1HYS A;  3OYH A;  3DOK A;  4HCC A;  3H08 A;  3PX6 A;  4KRE A;  4E3S A;  4FJG A;  1CZB A;  2IDO A;  2WON A;  5I42 A;  4O0J A;  4B9L A;  2Q3S A;  4CJU A;  3L2V A;  1SKR A;  2BDP A;  4KTQ A;  3ZSV A;  1S1V A;  4FJJ A;  3KLH A;  3NH1 A;  3LWM A;  4KHN A;  3D0P A;  1O1W A;  4ZTF A;  4B3O A;  5JS1 A;  1EKE A;  4CCH A;  2YHB A;  1HQU A;  1IH7 A;  1IKY A;  4QCL A;  3TI0 A;  1JL1 A;  3K5O A;  3HT3 A;  2HHX A;  3OYF A;  4CEA A;  5SZT A;  4I7F A;  4HTU A;  2HW3 A;  3MED A;  3ZSX A;  3MXI A;  2HB5 A;  2OPR A;  1YTU A;  1REV A;  4H4O A;  3CFO A;  3DOL A;  2O4I A;  4CF8 A;  4OJR A;  4KTW A;  1C6V A;  3AVN A;  2OA8 A;  4CHN A;  4FLX A;  1NJX A;  3L2U A;  4E7I A;  3SPY A;  4CEB A;  2KW4 A;  4CGG A;  1SL2 A;  2PZS A;  2X6S A;  3AVC A;  1TVR A;  4BDP A;  3L2W A;  3ZT3 A;  1LW0 A;  1UA0 A;  4BE0 A;  4EZ9 A;  4ZTJ A;  1RTD A;  2P1J A;  3OYD A;  3D45 A;  4O55 A;  4DS5 A;  4FCY A;  3HL8 A;  4IG0 A;  3PO5 A;  4B8C A;  1XWL A;  4ID1 A;  1JKH A;  4Z0U A;  3DMJ A;  2DFF A;  5FRN A;  2KTQ A;  5JS2 A;  3EYZ A;  1X9S A;  1QS4 A;  4CJ5 A;  4PUO A;  2OPP A;  3SQ1 A;  1A5W A;  2YHA A;  2G8F A;  3NF8 A;  1L3S A;  1W9H A;  3LAK A;  3LWL A;  3AVM A;  3QIO A;  4OLA A;  3L3U A;  2R7Y A;  1NJY A;  1ASU A;  1B92 A;  2HHS A;  1FK9 A;  4PY5 A;  3VQ5 A;  4HCB A;  4RG8 A;  4B08 A;  3SQ4 A;  1TK0 A;  4C8K A;  4Z4F A;  3MAQ A;  1HNV A;  1KCF A;  3VQQ A;  3OYB A;  1YT3 A;  3CYM A;  2D0C A;  4OPJ A;  4DSE A;  4I2P A;  3OYG A;  1W0H A;  3AA3 A;  3NF6 A;  4FLZ A;  4CED A;  4FLY A;  3MXM A;  5HLF A;  3V9X A;  1J9A A;  2ZQB A;  1VSM A;  1QE1 A;  3T19 A;  4C8N A;  4KKO A;  1VSE A;  3CM6 A;  4Q0B A;  4RW7 A;  3QEP A;  1TL3 A;  1SL0 A;  3HST B;  1BQN A;  4EP4 A;  3G10 A;  3PX4 A;  2FBT A;  4DTX A;  4JS5 A;  3SV3 A;  3OYC A;  4FK0 A;  2RF2 A;  5CYM A;  5KGX A;  4DTS A;  1QSY A;  1VSK A;  3TAR A;  3KKR A;  3OYA A;  3NHG A;  3RWU A;  4CF1 A;  4J2B A;  4FJX A;  1FXX A;  1N6Q A;  1NK7 A;  4FLW A;  5KGW A;  4Z4G A;  1S6P A;  4BAC A;  2HVH A;  2DTU A;  4AHT A;  4N56 A;  4CGI A;  3KK2 A;  3AVK A;  4MQ3 A;  1LAW A;  4JLH A;  4J2D A;  5DK5 A;  1RBV A;  2YNH A;  4DTN A;  1JLB A;  4ID5 A;  1X1P A;  1Z26 A;  4C8M A;  2HHT A;  1U45 A;  4FJH A;  3VA3 A;  3IRX A;  1HMV A;  4CIF A;  1RT4 A;  1GOB A;  3AVF A;  4CGJ A;  1TKX A;  4CFC A;  4CJW A;  3QNO A;  3LP1 A;  3SNN A;  3HVT A;  1BHL A;  4LH5 A;  4DFK A;  5J1E A;  4KI4 A;  2ZD1 A;  4F8R A;  3TAG A;  3M8P A;  1NKB A;  3V81 A;  2E6L A;  2P5G A;  3K57 A;  4FJM A;  3LP0 A;  3L8B A;  2HHW A;  2E6M A;  3B6O A;  2KZZ A;  1WSH A;  4MFB A;  1NOZ A;  3L2R A;  3CG7 A;  4GW6 A;  5E41 A;  4ELT A;  4M3W A;  2HVI A;  4FJ7 A;  1D8Y A;  3TAM A;  1RBR A;  4CGF A;  4J2A A;  4BDY A;  4DU4 A;  3DRP A;  1ZBI A;  3FFI A;  2I5J A;  1LV5 A;  4Z4I A;  4CJ3 A;  5KRT A;  1WN7 A;  3NCI A;  3AA5 X;  3HYF A;  4CK3 A;  4IBN A;  4CEF A;  5I3U A;  3G0Z A;  3MEC A;  2VG6 A;  4H8K A;  3TAE A;  2BAN A;  2VWJ A;  2VG7 A;  1U47 A;  3HK2 A;  3S3O A;  1SV5 A;  4CHP A;  4CF0 A;  4UQG A;  1RT1 A;  4FLU A;  4M3U A;  2WOM A;  3VQB A;  3V9S A;  2YKM A;  4AIL C;  3LP2 A;  4F2R A;  1WSJ A;  5K14 A;  3AA4 A;  1IO2 A;  3NH0 A;  1HQE A;  3JYT A;  1ZBF A;  3AVH A;  3AO1 A;  3CQ8 A;  3QEX A;  1TKD A;  4KFB A;  4C8L A;  1BI4 B;  4CGD A;  4CJF A;  4FJ9 A;  4M3R A;  1GOC A;  3IG1 A;  1RT7 A;  1RT5 A;  1WSI A;  1RDA A;  2YNG A;  1IKV A;  1TKZ A;  2Z1G A;  3O3G A;  4F2S A;  1NK0 A;  4FJ8 A;  2QKB A;  4OKK A;  2W42 A;  4KI6 A;  3C6T A;  1JLE A;  3SUO A;  3KLI A;  3OS0 A;  4Z4E A;  1XHX A;  2G8V A;  1DTQ A;  1VK0 A;  1XC9 A;  1D9F A;  3AVA A;  4CJR A;  4OGE A;  1VSI A;  4OKJ A;  4Y1C A;  1ITG A;  5C24 A;  4B9V A;  3ZSQ A;  3HPO A;  2VG5 A;  2Z1J A;  3ZSO A;  5DMR A;  1L3U A;  2DY4 A;  2X6N A;  4FW1 A;  1SL1 A;  2XY8 A;  1XHZ A;  3QEW A;  2FC0 A;  3C95 A;  3QET A;  4L8R B;  1CLQ A;  3SQ0 A;  1EX4 A;  4RW4 A;  4W5T A;  5HRP A;  1NK5 A;  3ALY A;  5J2P A;  1F21 A;  2X78 A;  4KB0 A;  2YV0 X;  3V9U A;  1NK8 A;  2QKK A;  4DQP A;  4DQS A;  1NK9 A;  4CHY A;  1TGO A;  3P83 D;  1BQM A;  5KTQ A;  3IAY A;  4KPY A;  1RBT A;  1VSJ A;  1VRT A;  1WSG A;  3LAN A;  4CFB A;  3AVJ A;  3TR8 A;  4KHY A;  4R5P A;  3KD1 E;  3SUN A;  4FJL A;  1C0M A;  4LSN A;  3HP9 A;  2FBY A;  2YKN A;  4NYN A;  4PA1 A;  1YVU A;  1Q9X A;  4NCB A;  1QSS A;  3WNE A;  3ZSR A;  3U6F A;  2D0A A;  2ETJ A;  4CEQ A;  3BDP A;  3RR7 A;  4DSL A;  1L3V A;  4I9L A;  2F96 A;  4I9Q A;  1T8E A;  1EP4 A;  3KLE A;  1Q9Y A;  1LWF A;  4DTJ A;  1RT2 A;  3PX0 A;  4FZX C;  3LP3 A;  3P1G A;  3KKS A;  4CJ4 A;  1J54 A;  1RIL A;  5HRR A;  5J2Q A;  3ZCM A;  2XRI A;  3SYZ A;  2AJQ A;  1JXE A;  4KO0 A;  4ZHR A;  4XIU A;  3SCX A;  1HNI A;  2ITG A;  2P5O A;  1D9D A;  3VQA A;  4KTZ A;  4CF9 A;  4NCA A;  2HHQ A;  2ATQ A;  3AO3 A;  2BGG A;  3K5M A;  2FBX A;  4F3O A;  3NE6 A;  2GBZ A;  1T05 A;  1RT6 A;  4BWJ A;  4FXD A;  4OVL A;  4CJS A;  3LZI A;  1HRH A;  1RBS A;  4LSL A;  4CHO A;  3TAF A;  2HMI A;  1JLC A;  2IGI A;  2HNY A;  3RRH A;  4BWM A;  1T7P A;  4IDK A;  4GMJ B;  1KLN A;  3LAL A;  4FVM A;  1RBU A;  4CJK A;  3HXM A;  4CF2 A;  3K5N A;  3UIQ A;  2PYL A;  4CEZ A;  1J53 A;  3AO2 A;  2Y1J A;  4O44 A;  5EU7 A;  3PO4 A;  3NH2 A;  1HYV A;  4F3T A;  1RTI A;  4DF8 A;  3I8D A;  4TSX A;  1JLG A;  4M45 A;  3OY9 A;  1WNS A;  2IS3 A;  4CES A;  1NKE A;  4FLT A;  3PY8 A;  4E89 A;  3VQ7 A;  3RMD A;  3K58 A;  5FDL A;  1QQC A;  4CHQ A;  3K2P A;  3V9Z A;  2IAJ A;  4DSF A;  4DFM A;  4DQQ A;  1KRP A;  2G8K A;  2RKI A;  1R0A A;  1QTM A;  4AH9 A;  4FK4 A;  1KVB A;  3VQE A;  4E7J A;  1BGX T;  1B9D A;  4IFV A;  1KSP A;  5SWM A;  2KFN A;  1KVA A;  2OZS A;  1I39 A;  2YNF A;  3NBP A;  2XY7 A;  1J5O A;  1S1U A;  1S9E A;  4B8A B;  1S9G A;  2G8W A;  4AHV A;  3KK1 A;  3C6U A;  3HPG A;  3EZ5 A;  3QNN A;  4J2E A;  4CJP A;  3KLG A;  4Z4C A;  3O3H A;  1ZBH A;  3HJF A;  2P51 A;  3QIN A;  4DQI A;  1JLA A;  2HNZ A;  1L5U A;  1QSL A;  1SUQ A;  4IKF A;  1S1W A;  4CIG A;  1RDB A;  3LPU A;  4F4K A;  3SPZ A;  3VQ9 A;  4CFA A;  4FM2 A;  1MU2 A;  1EET A;  3OYN A;  1Y97 A;  4CJV A;  4FZY A;  4M42 A;  3OVN A;  1LWC A;  3OJU A;  3SQ2 A;  4HUG A;  1NK6 A;  3F73 A;  1UAX A;  1KVC A;  2ZE2 A;  1LWE A;  2F8S A;  4W5R A;  3HVR A;  3RR8 A;  2RPI A;  4CFD A;  4BE2 A;  4DTM A;  3ITH A;  4IFY A;  3K5L A;  3QEI A;  2OZM A;  3MEG A;  1JLQ A;  1HPZ A;  5J2M A;  2JLE A;  3K59 A;  1CZ9 A;  1U48 A;  2XO7 A;  1X9W A;  4HHT A;  3NGI A;  1ZYQ A;  3JSM A;  2LSN A;  4QAG A;  4G1Q A;  4FW2 A;  2Z1H A;  1YTA A;  2OPQ A;  1S1T A;  4KHW A;  1VSF A;  4FJ5 A;  4FJI A;  1SKS A;  3U3G A;  3MXJ A;  4FM0 A;  3QEV A;  2YNI A;  1S5J A;  4AHC A;  1Q8I A;  1G15 A;  4DFJ A;  1KFS A;  4Q5V A;  1GOA A;  1N5Y A;  1A5X A;  5HRN A;  4QOZ B;  1LAV A;  2Z1I A;  3O4Q A;  5KI6 A;  3LDS A; 
#chains in the Genus database with same CATH topology
 3BF3 A;  4KH6 A;  3QIP A;  1KLM A;  1K73 O;  3LAM A;  1CXU A;  1IKX A;  5KRS A;  2P9L A;  3LZJ A;  4KH5 A;  1FKP A;  2UU9 K;  3MX2 A;  5MLC Q;  3ZSW A;  3AA2 A;  1P8Z A;  2XHB A;  2XY5 A;  3KHY A;  5KQD A;  2HHU A;  3SK3 A;  1U4B A;  1NM1 A;  5E26 A;  5CYQ A;  3ZX0 A;  2GWJ A;  2G8H A;  1N34 K;  1RT3 A;  1IJJ A;  3V1Q A;  3Q7B A;  4CJT A;  3SUQ A;  4CK2 A;  1ZBL A;  1T03 A;  3ZT2 A;  4BDZ A;  4K41 A;  1BOT O;  2KKZ A;  3O9Q A;  3OBW A;  4E7K A;  2V7Y A;  1YJW N;  2P9I A;  1V4T A;  2YX6 A;  4L3Q A;  1LCU A;  5C12 A;  2IC3 A;  3VQ6 A;  3O8M A;  1SZ2 A;  3OYM A;  5KPR A;  1BA1 A;  1WAF A;  1K6Y A;  5A2Q O;  1L3T A;  3AY9 A;  3MN7 A;  4FWS A;  4ISF A;  4MLE A;  3VTI A;  3OYJ A;  4A2A A;  4CEE A;  4DTO A;  4LY7 A;  4E1N A;  1HKC A;  2VWB A;  2UUA K;  4M3Z A;  4RW9 A;  3CCQ N;  3E01 A;  3KK7 A;  2I7N A;  1TK5 A;  3VQ4 A;  4FK2 A;  2KFZ A;  3HP6 A;  4WQ5 A;  1RDC A;  4DSI A;  1BL3 A;  3QLH A;  4FZZ A;  3H46 O;  1HYZ A;  3UKR B;  3THW A;  1C1A A;  3M8R A;  4CIE A;  2KZM A;  3T69 A;  1WAJ A;  2DFE A;  3CI5 A;  4NLB A;  1UA1 A;  3G4S N;  5HBM A;  1JLF A;  1SKW A;  3C0B A;  3DXK B;  2D5R A;  3ULE B;  4CZE A;  4BRE A;  1Z25 A;  1UOC A;  4B9U A;  3OYL A;  3P5J A;  1RTH A;  4CK1 A;  3AAP A;  3T1H K;  5AZI A;  3NF7 A;  4C8O A;  1I3A A;  1MDU B;  4KHS A;  1JL2 A;  4EFH A;  3PUF A;  3C6A A;  1QZ5 A;  3CJ1 A;  1BI4 A;  4W5O A;  4DS4 A;  1WSE A;  4OKE A;  2QWN A;  4MDA A;  1WLJ A;  4GNI A;  2F9T A;  1VQ4 N;  4Z4H A;  4CJE A;  1TV6 A;  4E7L A;  4QS8 A;  1HX1 A;  3TWH A;  1ZBS A;  1IG9 A;  4C23 A;  3NDK A;  4EP5 A;  4BRQ A;  3U3Y A;  3HO1 A;  3VES A;  2P9N A;  5GAE P;  2DPN A;  4N41 A;  2DFH A;  3OBY A;  1HYS A;  4IFE A;  3A5M C;  4A5B A;  5FLX O;  4EHU A;  2Q36 A;  3OYH A;  3I33 A;  4LFA K;  3PX6 A;  3N4P A;  4LC9 B;  4FPA A;  4CJU A;  3L2V A;  2BDP A;  4KBO A;  1EKE A;  2BH1 A;  2YHB A;  1HQU A;  2P9L B;  1BG3 A;  2HHX A;  3K5O A;  4YOY A;  4LF8 K;  5SZT A;  2HW3 A;  4HTU A;  3MED A;  4IEE A;  2QWL A;  4EHT A;  3CFO A;  1R59 O;  4CF8 A;  4KTW A;  1K8K A;  4FLX A;  1NJX A;  1LOT B;  2KW4 A;  2BUP A;  2X6S A;  3H45 C;  1VQP N;  3ZT3 A;  4M63 C;  2ASM A;  1UA0 A;  3P38 A;  4ZTJ A;  4JV5 K;  2Q2R A;  2E2Q A;  4IG0 A;  3PO5 A;  2E88 A;  1JKH A;  4ID1 A;  4Z0U A;  1GLL O;  3WEE A;  5JS2 A;  3EYZ A;  1VAZ A;  2GEL A;  3PLA A;  3E9P A;  1A5W A;  2YHA A;  1W9H A;  2P9I B;  4J8F A;  3L3U A;  2R7Y A;  5AQN A;  3SQ4 A;  3H3O B;  4WQ5 C;  1OVQ A;  2JWL A;  4HWI A;  4Y0W A;  3VQQ A;  2WBN A;  2D4W A;  4DSE A;  4OPJ A;  4LF9 K;  4JKD A;  3ZET A;  3AA3 A;  5EVZ A;  3CMA N;  3OTO K;  3SBG A;  4CED A;  5HLF A;  1GLF O;  5GIO A;  1J9A A;  4C8N A;  2PFU A;  3VEY A;  4C1N I;  3O9R A;  1TL3 A;  3P39 A;  1DT9 A;  4CBU A;  4DB3 A;  2FBT A;  3NVM A;  4FK0 A;  2O8C A;  5KGX A;  1QSY A;  3RWU A;  1VQ7 N;  4FJX A;  4CF1 A;  1N6Q A;  4FLW A;  2HBJ A;  1S6P A;  4N56 A;  2CGK A;  3LDN A;  4JLH A;  4J2D A;  1RBV A;  5M1N A;  3JAM O;  5LJV A;  3CXC M;  3JS6 A;  3O4W A;  4ID5 A;  4ISG A;  2ASO A;  2HHT A;  1U45 A;  1XQS C;  4CGJ A;  4BRO A;  3JXU A;  3SNN A;  3KWG A;  3THW B;  4LH5 A;  1BHL A;  1T3V A;  5J1E A;  4KI4 A;  1SQK A;  3TAG A;  3M8P A;  3HZ6 A;  1NKB A;  2O8B A;  5AR0 A;  3K57 A;  3LP0 A;  4ISE A;  2HHW A;  1IBM K;  3B6O A;  3L2R A;  4M3W A;  1NG9 A;  3TSQ A;  3TAM A;  4CGF A;  4H5T A;  3FFI A;  1KD1 O;  3CCM N;  3AA5 X;  1OVY A;  3HYF A;  5AQX A;  4IBN A;  5I3U A;  3MEC A;  3HK2 A;  3S3O A;  1SV5 A;  5AQZ A;  4CF0 A;  2ZJR L;  1RT1 A;  1NGI A;  2HBL A;  2WOM A;  1EO1 A;  4F2R A;  2YKM A;  3AA4 A;  2W6L A;  3AVH A;  4C8L A;  4BG9 A;  1BI4 B;  4JKE A;  4FJ9 A;  3CER A;  4QS9 A;  4IJN A;  2Z1G A;  2QKB A;  3PIP L;  2W42 A;  3SUO A;  4IOA L;  4Z4E A;  1XHX A;  2FSN A;  1VK0 A;  5DM6 L;  1VSI A;  4Y1C A;  1ITG A;  1YIT N;  2Z1J A;  2P9N B;  3ZSO A;  2DY4 A;  3D7E O;  2XY8 A;  1XHZ A;  4JAX A;  4L8R B;  1EX4 A;  4JI5 K;  4CHY A;  1TGO A;  1BQM A;  3IAY A;  3LAN A;  4KHP K;  1BUP A;  3AVJ A;  2GX9 A;  3FR0 A;  3VGK A;  1NWK A;  4EIA A;  4CI6 A;  4LSN A;  4MDB A;  4NYN A;  2FF6 A;  4IJA A;  5AQQ A;  3U6F A;  2RE2 A;  4XEI A;  3RR7 A;  4I9L A;  2F96 A;  1K8K B;  1J6Z A;  1YF5 L;  1Q9Y A;  3PX0 A;  3UB5 A;  5KPZ A;  5H1S Q;  4FZX C;  3DJC A;  3KKS A;  4CJ4 A;  1YJN N;  1RDU A;  3ZCM A;  2AJQ A;  4B3R K;  3SCX A;  1Z6R A;  4BRF A;  4BRD A;  3G71 N;  3WEE B;  4NCA A;  3VPZ A;  1E4F T;  4PKI A;  4JI6 K;  4FPB A;  4JK7 A;  4CJS A;  1HRH A;  3EEQ A;  2HNY A;  1S72 N;  4BWM A;  3S41 A;  1T7P A;  3LAL A;  1RBU A;  5AQY A;  2Y1J A;  1YIJ N;  3ZET B;  3I8D A;  5F1X A;  4CES A;  1OH7 A;  2Q1N A;  3K58 A;  5FDL A;  4DFM A;  3V9Z A;  4DQQ A;  2G8K A;  2RKI A;  4FK4 A;  1BGX T;  4JKC A;  1B9D A;  1ILY A;  4B1W B;  3OA9 A;  5SWM A;  1KVA A;  4NO7 A;  2OZS A;  2O8C B;  2OTL N;  1C0G A;  1S9E A;  2V52 B;  3C6U A;  4BRI A;  3QIN A;  4JI8 K;  1QSL A;  4BC3 A;  3O08 A;  4M42 A;  4FM2 A;  1MU2 A;  2Q97 A;  4CJV A;  3SQ2 A;  2QWM A;  4DV4 K;  3F73 A;  2NRT A;  1UAX A;  3U8X A;  2F8S A;  4H0V B;  3LM2 A;  4W5R A;  3HVR A;  1KQS M;  4BE2 A;  4DTM A;  1U2V A;  1HPZ A;  1E3M A;  2YHY A;  2JLE A;  2O8B B;  2XO7 A;  1ZYQ A;  1VHX A;  2LSN A;  4H03 B;  1S1T A;  4JKF A;  1VSF A;  1ZC6 A;  4WQ4 A;  3HOS A;  4FM0 A;  1S5J A;  1G15 A;  1NGE A;  2NZT A;  2AA4 A;  1HLU A;  1KFS A;  1OH6 A;  4AQY K;  1A5X A;  1LAV A;  2Z1I A;  3O4Q A;  2QK9 A;  2E5L K;  3LDS A;  4CJL A;  1UWB A;  2E8A A;  3WT0 A;  5E84 A;  3OS1 A;  3TAP A;  1ESV A;  3HM9 A;  4NYF A;  3QBW A;  1XI1 A;  3ASM A;  3FZM A;  5FPD A;  4YOR A;  4DTU A;  1HJR A;  3VEZ A;  3OYK A;  4LD0 A;  4W5Q A;  4N5S A;  3HTV A;  4N47 A;  3L4I A;  4DR6 K;  3AVI A;  2Y1I A;  4DMN A;  2P9U A;  4EAH D;  5JVH L;  3T1A A;  2HF4 A;  1ATS A;  2FBV A;  4FJK A;  3L2Q A;  1QQO A;  5ADX A;  5J2N A;  4HUE A;  1N8R O;  2V7Z A;  3AO5 A;  3RMA A;  3B6P A;  4DQR A;  4CEO A;  1IBK K;  4A62 A;  4B9S A;  3NMU A;  3T1Y K;  3WNG A;  3M6G A;  1BIU A;  2HOE A;  4BGA A;  5KPT A;  4JRQ A;  3P4I A;  4FJN A;  5I9E B;  4YOV A;  3S3M A;  4I2Q A;  4FL9 A;  3KTQ A;  4IOC L;  1KAY A;  4FM1 A;  2GV9 A;  2NRZ A;  3LDL A;  4FWK A;  3NFA A;  4BRL A;  3SI6 A;  3FZH A;  5C2D A;  4CZF A;  1JXB A;  3TAB A;  5AQT A;  3RTV A;  5LY3 A;  3C7N A;  4DU3 A;  3SBT A;  3VEV A;  3WNH A;  1EXQ A;  4CGH A;  5JLF A;  4B9T A;  5T7B A;  4OGC A;  1NK4 A;  4DSK A;  1SS6 A;  4OPH A;  1A5V A;  1BIS A;  1VSH A;  3HPH A;  1C0F A;  4BRA A;  1T44 A;  4HUF A;  4EZ6 A;  4B1V A;  2P9S A;  4ILJ A;  4JK9 A;  3CC2 N;  2UXC K;  4JKH A;  3CCJ N;  3I0S A;  1DEJ A;  3THV A;  1C1B A;  3DYA A;  3V9W A;  4M3Y A;  5AQO A;  3I55 N;  4YFU A;  1LW2 A;  2IIR A;  4IO9 L;  4RW8 A;  3EE8 A;  4JI4 K;  5C25 A;  1HNX K;  2QEX N;  1FW6 A;  3OYI A;  1GLJ O;  3GE1 A;  2FF3 B;  5HRS A;  3MWT A;  4DF4 A;  4DR1 K;  3KJV A;  1RTJ A;  2O4G A;  3M1F A;  4DTP A;  2EX3 A;  4QS7 A;  4NXN K;  5AJ3 K;  1QQN A;  4JEP A;  4CZL A;  1IG8 A;  3CFR A;  3KD5 E;  2G8U A;  4N76 A;  5BR8 K;  3L3V A;  4JS4 A;  4W5N A;  1NGC A;  4H5W A;  3AVG A;  3THX A;  4M3T A;  1JCF A;  2FXU A;  3O9U A;  4CW7 B;  1S22 A;  1XUP O;  2E4L A;  4DU1 A;  4DTR A;  1U2V B;  3DAW A;  3TAQ A;  4BRH A;  2QM1 A;  1JCE A;  5AQW A;  4BC2 A;  2J4R A;  1WSF A;  2KQ2 A;  4FYD A;  1NGJ A;  4PQU A;  1TL1 A;  4JYA K;  4K42 A;  1U04 A;  5AQV A;  1D4X A;  4FWR A;  3H08 A;  3VET A;  3OHR A;  4O0J A;  4BR5 A;  3OW2 M;  5BRD A;  4O8U A;  1O13 A;  1SKR A;  4ILH A;  3BEX A;  3ZSV A;  1S1V A;  3NH1 A;  4B1Z A;  3CPW M;  4CCH A;  5JS1 A;  1IKY A;  1GLD G;  1NGB A;  3A8Y A;  1YTU A;  2OPR A;  4H4O A;  5GAG P;  4HTL A;  4OJR A;  4LFB K;  4IWV A;  4GKJ K;  3AVN A;  3R1X A;  4CHN A;  1QHA A;  3H3N O;  3L2U A;  3SPY A;  1SL2 A;  2PZS A;  4H0O A;  4BDP A;  2P9U B;  3L2W A;  1LW0 A;  1RTD A;  4GKK K;  4O55 A;  1U6Z A;  3R3L A;  3HL8 A;  4B8C A;  1XWL A;  4OPA A;  2HMP A;  4Z94 A;  2KTQ A;  4CJ5 A;  2OPP A;  2HF3 A;  3SQ1 A;  3NF8 A;  3AVM A;  4OLA A;  2CH5 A;  1B92 A;  1FK9 A;  4PY5 A;  3CME N;  4AM6 A;  1TUY A;  4HCB A;  4B08 A;  2E2O A;  3HSC A;  3O5B A;  3SJH A;  1YT3 A;  3CYM A;  4I6M A;  2UUB K;  3K9K A;  2ZQB A;  4NXM K;  1QE1 A;  4CZI A;  1VSE A;  4Q0B A;  4X65 K;  3CC4 N;  3C7N B;  3QEP A;  3GG4 A;  3E9L A;  4EP4 A;  3G10 A;  3KZB A;  4DTX A;  3OYC A;  3HM8 A;  4J2B A;  3KKR A;  4BAC A;  4DV1 K;  3I56 N;  2A40 A;  2P9S B;  2ZWH A;  5DK5 A;  4DTN A;  3A5O C;  3MMV A;  3VMF B;  4CFC A;  5AQM A;  3QNO A;  3SMS A;  4DV3 K;  5BRF A;  3N4Q A;  4F8R A;  1SAZ A;  2E6L A;  3MCP A;  2KLA A;  5AQJ A;  2E6M A;  1NOZ A;  4GW6 A;  4CD1 A;  5E41 A;  3CD6 N;  5AZJ A;  1D8Y A;  1RBR A;  4J2A A;  3L0Q A;  3DRP A;  1ZBI A;  2OAN A;  1NU0 A;  3LL3 A;  1WN7 A;  2VQF K;  4H8K A;  3CCL N;  3MN9 A;  1NBW A;  1U47 A;  1NGD A;  1Z05 A;  5BPL A;  4FLU A;  3VQB A;  2IVN A;  5BPM A;  5K14 A;  3NH0 A;  3THX B;  1HQE A;  1ZBF A;  4IDH A;  3AO1 A;  4KFB A;  2QW9 A;  1GOC A;  1WSI A;  1RDA A;  5IWA K;  1IKV A;  1TKZ A;  3O3G A;  3GBT A;  3W0L A;  1NK0 A;  3J7Z O;  3C6T A;  3O1W A;  4YY3 K;  2G8V A;  1DTQ A;  3CJB A;  4BRN A;  1D9F A;  1YUW A;  1VQ6 N;  2X6N A;  4FW1 A;  2ASP A;  4UY8 O;  3QEW A;  2FC0 A;  3C95 A;  1CLQ A;  3K0S A;  5HRP A;  2GEM A;  3HI0 A;  2NRV A;  3PIO L;  1NK8 A;  4DQP A;  4CZG A;  5KTQ A;  4KPY A;  1VRT A;  5BN8 A;  2VGN A;  3TR8 A;  3WXL A;  4KHY A;  3HP9 A;  2FBY A;  4PA1 A;  4CZJ A;  3MX5 A;  4NCB A;  4XH5 A;  4PKG A;  5JLH A;  5JIC A;  2W40 A;  4JKB A;  5AQP A;  1EP4 A;  3CQY A;  2D0O A;  4B1X B;  4BQZ A;  1NGH A;  1J54 A;  2XRI A;  1JXE A;  1TYQ A;  5TKY A;  4JI0 K;  4KTZ A;  3ENH A;  4IXC A;  1P90 A;  2ATQ A;  4RTF D;  4F3O A;  1T05 A;  4BWJ A;  4OVL A;  4FSV A;  3QIC A;  2HMI A;  2V51 B;  1ZXO A;  1X9J A;  1Y64 A;  3EL2 A;  4CJK A;  3HXM A;  4CF2 A;  5EU7 A;  4I6M B;  1HYV A;  2D0P A;  2ZGY A;  3CCE N;  1ATR A;  4M45 A;  3OY9 A;  1NKE A;  3CJA A;  3VQ7 A;  1VQ8 N;  4X66 K;  1R0A A;  3CCR N;  1KSP A;  4JD2 A;  4DV2 K;  4DV5 K;  5AQF A;  3CIP A;  4GV3 A;  2G8W A;  3WUH A;  3EZ5 A;  3QNN A;  4PL7 A;  3O3H A;  2P51 A;  4GVE A;  1JLA A;  2HNZ A;  1SUQ A;  4IKF A;  3VTH A;  3SPZ A;  2NRH A;  4DR3 K;  1EET A;  4CZH A;  4FZY A;  5B8H A;  3E1Y A;  3OVN A;  1LWC A;  2KHO A;  4YDU A;  4HUG A;  1NK6 A;  4WFN L;  4DR5 K;  1KVC A;  3CHW A;  4PHT X;  3RR8 A;  4M7Y A;  3QEI A;  2OZM A;  3MEG A;  1JLQ A;  5J2M A;  3ZX2 A;  5AZI B;  1NJI O;  4CD3 A;  4JI1 K;  4G1Q A;  1NNE A;  2OPQ A;  5DM7 L;  4BC4 A;  5AZJ B;  2A41 A;  3CJ9 A;  1SKS A;  3U3G A;  3FE1 A;  1NMN A;  3QEV A;  3BZC A;  3BUZ B;  4Q5V A;  4QOZ B;  2UYT A;  4DUY K;  1XC9 A;  5GAD P;  2PYJ A;  4DKW A;  4GVM A;  1VRU A;  1TAU A;  1IKW A;  1XNR K;  4WFA L;  4JRP A;  3B8A X;  4JHD A;  4B1Y B;  4JI2 K;  5LL6 Z;  1N33 K;  3HRG A;  3DRS A;  3J81 O;  4KH4 A;  2BE2 A;  3LDP A;  5F2R A;  4CHZ A;  1FJG K;  4JN4 A;  3M8Q A;  3CJ7 A;  4LF5 K;  5HOO A;  2B6A A;  5AQI A;  1VQL N;  4JKG A;  1GLB G;  2EHG A;  3ZT0 A;  4DWI A;  3DRR A;  3EY1 A;  4E7H A;  3S3N A;  5AQL A;  5CZ1 A;  2NLX A;  4AF1 A;  3FLC O;  3VQ8 A;  3NGY A;  4ILG B;  1D5A A;  4BR9 A;  4FLV A;  4PWD A;  1QVF M;  5BN9 A;  2QXL A;  5FRO A;  3L4Q A;  4B9M A;  2F8T A;  3LPT A;  3NGZ A;  5CE3 A;  5CY4 A;  2I7P A;  4ELV A;  1ASW A;  2Q31 A;  4CE9 A;  1BDG A;  3I0R A;  3ZEU A;  4AHU A;  1MWM A;  1TYQ B;  4CJQ A;  2ITM A;  1CXQ A;  2WC9 A;  4DR7 K;  5D3G A;  1BCO A;  3ZT4 A;  3WNF A;  2O8D A;  4CER A;  3V4I A;  3VF4 A;  5HRO A;  1BA0 A;  2OPS A;  4A2B A;  1HJO A;  4DG1 A;  3M8S A;  3A5N C;  1S3X A;  2UUC K;  1NMD A;  4H4M A;  3C65 A;  4RW6 A;  4DLE A;  4E0D A;  2X74 A;  3VA0 A;  3FZF A;  4B9N A;  3OYE A;  4DFP A;  4M3X A;  4WYB A;  4JD2 B;  4Y1D A;  5ADX H;  1HNW K;  3ZSY A;  1NJW A;  1ZBU A;  3OS2 A;  1ASV A;  4O0I A;  3TAN A;  4HVJ A;  4OPK A;  1RCH A;  3AVB A;  3KIO A;  5ELZ A;  1RNH A;  4DSJ A;  1NJZ A;  3PSF A;  4H0Y B;  4H0P A;  4KAZ A;  2GTD A;  3KVG A;  3QDK A;  4H0X B;  2BTF A;  5C0Y A;  4E19 A;  1DLO A;  2B4J A;  3GDQ A;  2HHV A;  1B9F A;  1S6Q A;  3J7Y P;  4K8X A;  1EWR A;  2E1Z A;  3DLR A;  3VGL A;  1BCM A;  4IG3 A;  1M1K O;  1TKT A;  4E1J A;  4NCG A;  4LFC K;  1C1C A;  4B9Q A;  1KAX A;  2WON A;  3WXJ A;  4DR2 K;  2UXB K;  2Q3S A;  4IOX A;  3KLH A;  1TUU A;  3EKU A;  1JL1 A;  5CR4 A;  3OYF A;  1VQ9 N;  4I7F A;  3RVC A;  3ZSX A;  3MXI A;  2HB5 A;  4JHD B;  1T6C A;  2PBD A;  4FWM A;  2YJF A;  4O8K A;  4CEB A;  4CGG A;  2D1K A;  3AVC A;  3TTF A;  3AGR A;  1HUX A;  4BE0 A;  3DWL A;  2P1J A;  3OYD A;  5JVG L;  4DCH A;  4JKG B;  3DMJ A;  2DFF A;  5FRN A;  4A59 A;  3J7A P;  3TSP A;  3LAK A;  1DKG D;  3LWL A;  3QIO A;  3U9Z A;  1NJY A;  1ASU A;  5EOY A;  3VQ5 A;  3M5R A;  4RG8 A;  2O8F A;  4Z4F A;  2F7T A;  3MAQ A;  1HNV A;  1XMO K;  3MCA B;  5BPN A;  4JNE A;  1Q7Y O;  4I2P A;  1CZA N;  3NF6 A;  4YHH K;  1J5E K;  3V9X A;  3R9P A;  3SLC A;  3D6R A;  3CM6 A;  4OX9 K;  4RW7 A;  3ZEU B;  3HST B;  1BQN A;  5M1F A;  4FVU A;  3O80 A;  5EX5 A;  4JS5 A;  3SV3 A;  4XH4 A;  2RF2 A;  5CYM A;  4DTS A;  5M1K A;  4DV6 K;  3NHG A;  3H1Q A;  3OYA A;  4Z4G A;  1FXX A;  1Q81 O;  2HVH A;  2DTU A;  4AHT A;  4CGI A;  3KK2 A;  3AVK A;  4R79 A;  2YNH A;  1JLB A;  1X1P A;  1Z26 A;  1YVN A;  1HMV A;  4F9O A;  1RT4 A;  1WUA A;  3AVF A;  2HHH K;  1WOQ A;  3M3Z A;  4DFK A;  1X3N A;  3L6Q A;  4WQ4 C;  3V81 A;  2P5G A;  3EO3 A;  4CZK A;  1YJ9 N;  1WSH A;  4MFB A;  2HVI A;  4FJ7 A;  3EZW A;  4BDY A;  2OCE A;  4CJ3 A;  1JJ2 M;  5KRT A;  3ID8 A;  4CK3 A;  1BU6 O;  2VG6 A;  2CH6 A;  2VWJ A;  2GUP A;  2VG7 A;  3CC7 N;  1Q86 O;  4CHP A;  4M3U A;  1OH5 A;  4AIL C;  1WSJ A;  1IO2 A;  3JYT A;  3QEX A;  3CQ8 A;  1NGA A;  1TKD A;  4CJF A;  4M3R A;  3IG1 A;  1RT7 A;  3FFK B;  2YNG A;  4FJ8 A;  4F2S A;  2QWO A;  3IUC A;  4OKK A;  2F9W A;  4CJR A;  4OGE A;  4OKJ A;  5C24 A;  3F2K A;  3ZSQ A;  2VG5 A;  3J8A A;  3MDQ A;  1XNQ K;  4XH1 A;  3QET A;  3SQ0 A;  4RW4 A;  5CHI A;  3SAG A;  1NK5 A;  3ALY A;  4O5F A;  5J2P A;  1F21 A;  2X78 A;  3THY A;  4KB0 A;  2YV0 X;  3H6E A;  3V9U A;  2UXD K;  5HL7 L;  2HBK A;  1VSJ A;  5BRE A;  1WSG A;  3F5T A;  4PL8 A;  3SAF A;  3SUN A;  3TU5 A;  5IT9 O;  4FJL A;  3FGU A;  1YVU A;  1Q9X A;  1QSS A;  3ZSR A;  2D0A A;  2YHW A;  4CEQ A;  1L3V A;  1T8E A;  3MN5 A;  5AQG A;  3LP3 A;  3G25 A;  4H5R A;  5J2Q A;  3SYZ A;  5FPN A;  4KO0 A;  4ZHR A;  4XIU A;  4DHY A;  3VQA A;  1D9D A;  2YHX A;  4MO4 A;  5C2F A;  4B1U B;  3AO3 A;  4V19 S;  5GIP A;  3K5M A;  2FBX A;  3D2E A;  3NE6 A;  2GBZ A;  4FXD A;  4FOE A;  2QI2 A;  3LZI A;  4BGB A;  4CHO A;  1Q82 O;  3TAF A;  2IGI A;  2O8F B;  4IDK A;  2VGM A;  4GMJ B;  1KLN A;  2PYL A;  3LDQ A;  3AO2 A;  4O44 A;  5M1O A;  4YOX A;  4DF8 A;  4TSX A;  3QFU A;  4FLT A;  4E89 A;  4B3S K;  5EXW A;  3RMD A;  1EQY A;  1QQC A;  4BRP A;  3K2P A;  4DSF A;  2IAJ A;  4H0T B;  2O8E A;  1QTM A;  4AH9 A;  5M1Q A;  1I39 A;  5LJW A;  2ZGZ A;  1J5O A;  3RSE A;  4B8A B;  4CBW A;  1S9G A;  3HPG A;  4DV0 K;  4X64 K;  4CJP A;  5M1P A;  3MWP A;  3HJF A;  4DQI A;  3FZL A;  1L5U A;  2CGJ A;  1S1W A;  4CIG A;  3LPU A;  5AFU H;  3VQ9 A;  4CFA A;  3BP8 A;  1Y97 A;  4JI3 K;  1W97 L;  1DGK N;  3SAH A;  2RPI A;  2Q0R A;  4CFD A;  4IFY A;  2ZM6 K;  5LMN K;  1CZ9 A;  1U48 A;  4K0K K;  4HHT A;  4H5V A;  4M7X A;  4QAG A;  4YOU A;  2Z1H A;  1YTA A;  4BRM A;  1K8A O;  4KHW A;  3VEW A;  1OKJ A;  3K9J A;  1GOA A;  3VER A;  5HRN A;  3UKU A;  1KC8 O;  5LMU K;  1VQ5 N;  3ENO A;  4KV8 A;  5KQ8 A;  3DLE A;  3ISN C;  4MO5 A;  1VQM N;  3PSI A;  4FWP A;  5C42 A;  5HP1 A;  2OYQ A;  4ELU A;  3AVL A;  4WE1 A;  3BGR A;  1FKO A;  1VSL A;  4WCE L;  3KLF A;  3SJJ A;  1C0U A;  2GUI A;  3V6D A;  3SUP A;  3O4N A;  2GWK A;  3VQC A;  4DR4 K;  3LM9 A;  3AO4 A;  4E1M A;  4BQL A;  4AHR A;  4KHQ A;  3O9T A;  3T3F A;  4CZM A;  1XMQ K;  1DTT A;  3A5L C;  3SZ2 A;  3NAE A;  2XY6 A;  5AFU A;  3DLG A;  1H1V A;  1BO5 O;  3QES A;  3RMB A;  2IOC A;  3DLK A;  4KRF A;  4BR7 A;  4IEI A;  3THY B;  3R6M A;  4BE1 A;  2B5J A;  3AV9 A;  1VSD A;  1C0T A;  3IS9 A;  5AQU A;  4O4G A;  3VF6 A;  4MLH A;  2A1S A;  3DLH A;  4O5B A;  1RGI A;  3A2F A;  3A0I X;  4FWL A;  2D0B A;  2VWK A;  4DQ8 A;  4U7B A;  5CZ2 A;  4NB4 A;  4DV7 K;  3VQP A;  1N32 K;  3DI6 A;  4BG8 A;  4K8Z A;  3ZSZ A;  1RDD A;  2E2N A;  4M41 A;  2QXF A;  3Q7C A;  3C94 A;  3TTC A;  1QQM A;  3CM5 A;  3TPQ A;  4AHS A;  1HKG A;  2NUB A;  3VQD A;  4OLB A;  3AAQ A;  3BZK A;  3G6E N;  3DLB A;  1X9M A;  3ZT1 A;  1KFD A;  3D2E B;  4YNQ A;  3IKM A;  1TAQ A;  3V1R A;  1NOY A;  4ICL A;  3QER A;  5AQH A;  4KB1 A;  3KK3 A;  3NF9 A;  3V1O A;  3IFR A;  5BRH A;  2RHK A;  3ID6 A;  3ULD A;  2QTD A;  2ZJP L;  3QBX A;  2A1R A;  1BWF O;  1W7A A;  2HND A;  5F0X A;  4JK8 A;  1BIZ A;  1JCG A;  3QML A;  4BY9 C;  1E4G T;  3GOI A;  3VEN A;  3WXI A;  5GAH P;  2G8I A;  2O8E B;  2P9K A;  3IMX A;  2W41 A;  1NLV A;  3QO9 A;  2RN2 A;  3MN6 A;  4YOT A;  1GLA G;  3MEE A;  3BF1 A;  4LH4 A;  2OTJ N;  4H5N A;  3RSE B;  3OJS A;  4DLG A;  1I94 K;  2WTU A;  3F9K A;  2Q0U A;  1VQN N;  1YHQ N;  1TK8 A;  1U49 A;  1X3M A;  2YI1 A;  2JGU A;  3CJC A;  3PV8 A;  2PY5 A;  4CEC A;  3AGK A;  3SV4 A;  3RRG A;  3CFP A;  3F9M A;  3O3F A;  3P31 A;  1N36 K;  1QHT A;  4CVN E;  3KWI A;  3VGM A;  2W6K A;  3NVK A;  4KHU A;  2QA4 N;  3DM2 A;  4GV6 A;  3I8B A;  3VN5 A;  3DLL L;  4A5A A;  1NKC A;  3RMC A;  3ZYY X;  2E20 A;  3S9H A;  1S1X A;  1KTQ A;  3CPE A;  3DOK A;  4HCC A;  1KXP A;  4KRE A;  5AQK A;  3EKS A;  4E3S A;  1CZB A;  2IDO A;  3WQU A;  5I42 A;  4FJG A;  4B9L A;  4LF7 K;  2A5X A;  2ZJQ L;  3UKU B;  4KTQ A;  4FJJ A;  3LWM A;  4KHN A;  3D0P A;  1O1W A;  4ZTF A;  4B3O A;  3WQT A;  1IH7 A;  4QCL A;  1IBL K;  2JWK A;  3HT3 A;  3TI0 A;  3CCV N;  4CEA A;  1T6D A;  1YXQ A;  1REV A;  3U4L A;  3DOL A;  2O4I A;  4LF6 K;  4GY2 B;  1C6V A;  2OA8 A;  4CJ7 A;  4BVO A;  5GIN A;  3R8E A;  4E7I A;  3C6H A;  4FO0 A;  1TVR A;  4A61 A;  3MK6 A;  5JMV A;  4EZ9 A;  3D45 A;  2IVP A;  4DS5 A;  4FCY A;  1X9S A;  1HNZ K;  1QS4 A;  1EWQ A;  4PUO A;  3ZX3 A;  2G8F A;  3EN9 A;  1L3S A;  2QWP A;  4K25 A;  2HHS A;  3CQX A;  4A57 A;  1TK0 A;  4C8K A;  1KCF A;  2FSJ A;  5FPM A;  4YOW A;  3OYB A;  3VEX A;  3CCU N;  3D2F A;  3E66 A;  2F4V K;  2D0C A;  3OYG A;  1W0H A;  2AP1 A;  1YI2 N;  4IO8 A;  1GLE G;  1QVG M;  1XC3 A;  4FLZ A;  3MXM A;  4FLY A;  4B3M K;  1VSM A;  3T19 A;  4KKO A;  1OH8 A;  1SL0 A;  3VOV A;  4K43 A;  3PX4 A;  5FRM A;  1VSK A;  4YDU C;  3TAR A;  1NK7 A;  5KGW A;  4B3T K;  2WFB A;  3LDO A;  4MQ3 A;  1LAW A;  4C8M A;  4FJH A;  3VA3 A;  4BR0 A;  3IRX A;  4CIF A;  1GOB A;  2P9P A;  1TKX A;  3SMP A;  4BRC A;  4CJW A;  2EWS A;  3LP1 A;  2HBM A;  4FWQ A;  3HVT A;  3FZK A;  2ZD1 A;  3O1B A;  1M90 O;  3VF2 A;  4U67 L;  2CGL A;  5C15 A;  4FJM A;  3L8B A;  2P9K B;  2KZZ A;  1QZ6 A;  3DXM A;  3CG7 A;  4RWT A;  4ELT A;  3QB0 A;  1KAZ A;  3J80 O;  4NLC A;  4DU4 A;  4Z4I A;  2I5J A;  1LV5 A;  3VEO A;  2H3G X;  3NCI A;  3QFP A;  1V4S A;  4CEF A;  3ZLJ A;  3G0Z A;  3TAE A;  4C1N K;  3ATU A;  2BAN A;  1WBB A;  5AQS A;  4WFB L;  4UQG A;  1GLC G;  3V9S A;  3E9O A;  3LP2 A;  3HBT A;  4GV9 A;  2A3Z A;  4CGD A;  2VYP A;  1RT5 A;  3WXM B;  4X62 K;  3UE5 A;  1HKB A;  4KI6 A;  3AAR A;  1JLE A;  4BRK A;  3KLI A;  3OS0 A;  4JKA A;  3AVA A;  2VCP A;  3CF5 L;  1Q18 A;  4B9V A;  3HPO A;  2VQE K;  5DMR A;  1L3U A;  4BR2 A;  3WXK A;  1SL1 A;  2HST A;  3EE9 A;  4FWN A;  1RDW X;  2YJE A;  4W5T A;  3T7Z A;  1WB9 A;  5BR9 A;  2NRR A;  2QKK A;  4DQS A;  1NK9 A;  3TSU A;  3P83 D;  4FWO A;  2QWQ A;  4DUZ K;  1RBT A;  4BR4 A;  2NRW A;  4CFB A;  4R5P A;  3KD1 E;  1C0M A;  2YKN A;  4G9Z A;  5EY4 A;  3WNE A;  2ETJ A;  3BDP A;  1MWK A;  2PAV A;  4DSL A;  1ATN A;  3CET A;  4I9Q A;  4AM7 A;  3KLE A;  2FSK A;  1LWF A;  3H1V X;  4DTJ A;  1RT2 A;  3IDH A;  3P1G A;  2A6A A;  1RIL A;  3BY5 A;  5HRR A;  2NNW A;  4BVP A;  1HNI A;  2ITG A;  2P5O A;  4CF9 A;  2HHQ A;  2BGG A;  1WBD A;  1RT6 A;  1NGF A;  1IV0 A;  1RBS A;  4LF4 K;  4PKH A;  4LSL A;  1JLC A;  2YCH A;  3RRH A;  1HPM A;  3ATV A;  2FLO A;  1HR0 K;  4IZ9 A;  4FVM A;  3K5N A;  3UIQ A;  3ENB A;  4CEZ A;  2ZF5 O;  1J53 A;  3D2F B;  3PO4 A;  3NH2 A;  3UKR A;  4F3T A;  1RTI A;  1JLG A;  1WNS A;  2IS3 A;  4RCH A;  3O6W A;  3PY8 A;  2O8D B;  4CHQ A;  1KRP A;  2NRX A;  1KVB A;  3VQE A;  4E7J A;  1G99 A;  4IFV A;  1VQK N;  4BC5 A;  3DXK A;  2KFN A;  3ULE A;  1NGG A;  3GL1 A;  2YNF A;  3NBP A;  2XY7 A;  5C10 A;  4JI7 K;  1S1U A;  4WF9 L;  4AHV A;  3KK1 A;  4J2E A;  4CBX A;  3KLG A;  4Z4C A;  1ZBH A;  3CCS N;  5TKW A;  2WUS A;  1VQO N;  5FPE A;  1RDB A;  4F4K A;  4FOI A;  3OYN A;  3OJU A;  2P9P B;  2E1Y A;  3W3D A;  2ZE2 A;  4BRG A;  1LWE A;  3ITH A;  3K5L A;  3TTD A;  1X9W A;  3K59 A;  3O9S A;  4OO1 J;  3NGI A;  3JSM A;  2A42 A;  1W2B M;  1RFQ A;  1YAG A;  3DXM B;  4FW2 A;  1K9M O;  5AQR A;  4FJ5 A;  4FJI A;  2E2P A;  3U9D A;  1MA9 B;  3HOT A;  3MXJ A;  2YNI A;  4AHC A;  1Q8I A;  4DFJ A;  2IVO A;  1N5Y A;  2QWR A;  5KI6 A; 
#chains in the Genus database with same CATH homology
 4CJL A;  1UWB A;  4KV8 A;  3QIP A;  3DLE A;  1KLM A;  2PYJ A;  3LAM A;  1CXU A;  1IKX A;  4GVM A;  1VRU A;  5KRS A;  3ISN C;  3OS1 A;  1IKW A;  1TAU A;  3LZJ A;  3TAP A;  1FKP A;  3HM9 A;  4NYF A;  4JRP A;  5C42 A;  5HP1 A;  2OYQ A;  3ZSW A;  1XI1 A;  3AA2 A;  4ELU A;  3AVL A;  3ASM A;  4WE1 A;  3BGR A;  1FKO A;  1VSL A;  3KLF A;  2XHB A;  2XY5 A;  4DTU A;  3SJJ A;  1HJR A;  1C0U A;  3OYK A;  2HHU A;  2GUI A;  4LD0 A;  4W5Q A;  1U4B A;  4N5S A;  3V6D A;  3SUP A;  3O4N A;  5CYQ A;  3DRS A;  4N47 A;  3VQC A;  3AVI A;  2Y1I A;  3AO4 A;  4E1M A;  1RT3 A;  2BE2 A;  4CHZ A;  4DMN A;  2G8H A;  4AHR A;  3M8Q A;  4KHQ A;  3V1Q A;  3T3F A;  4CJT A;  3SUQ A;  4CK2 A;  1ZBL A;  3T1A A;  1T03 A;  2B6A A;  3ZT2 A;  1DTT A;  3SZ2 A;  2XY6 A;  3NAE A;  2FBV A;  4BDZ A;  3DLG A;  4FJK A;  3L2Q A;  3QES A;  2EHG A;  3ZT0 A;  3RMB A;  2IOC A;  4DWI A;  3DLK A;  3DRR A;  4E7K A;  3EY1 A;  4KRF A;  5J2N A;  4HUE A;  4E7H A;  3S3N A;  5CZ1 A;  3AO5 A;  3RMA A;  3B6P A;  4BE1 A;  2B5J A;  4DQR A;  3AV9 A;  1VSD A;  3VQ8 A;  4CEO A;  1C0T A;  2IC3 A;  3IS9 A;  3VQ6 A;  3NGY A;  4B9S A;  1D5A A;  4FLV A;  4PWD A;  3WNG A;  4O4G A;  1BIU A;  5FRO A;  4JRQ A;  2A1S A;  3OYM A;  3S3M A;  4FJN A;  3DLH A;  4O5B A;  4B9M A;  1WAF A;  4I2Q A;  1K6Y A;  2F8T A;  1L3T A;  3LPT A;  3A2F A;  3KTQ A;  3NGZ A;  4FM1 A;  2GV9 A;  2D0B A;  2VWK A;  3NFA A;  3SI6 A;  3OYJ A;  5CZ2 A;  5CY4 A;  4CEE A;  4DTO A;  3VQP A;  4ELV A;  3DI6 A;  1ASW A;  4K8Z A;  1JXB A;  4LY7 A;  3TAB A;  3ZSZ A;  4CE9 A;  4E1N A;  3I0R A;  1RDD A;  3RTV A;  4M41 A;  4AHU A;  4DU3 A;  2QXF A;  3C94 A;  1EXQ A;  3WNH A;  4CGH A;  4B9T A;  5T7B A;  3CM5 A;  4OGC A;  4CJQ A;  4AHS A;  2NUB A;  1NK4 A;  3VQD A;  1CXQ A;  4DSK A;  4M3Z A;  4OLB A;  4RW9 A;  1A5V A;  1BIS A;  1VSH A;  3DLB A;  1X9M A;  3HPH A;  3E01 A;  3ZT1 A;  4HUF A;  1TK5 A;  1KFD A;  3VQ4 A;  4EZ6 A;  4FK2 A;  5D3G A;  1BCO A;  3ZT4 A;  2KFZ A;  4YNQ A;  3HP6 A;  3WNF A;  1TAQ A;  3V1R A;  4CER A;  1NOY A;  3V4I A;  4ICL A;  3QER A;  5HRO A;  1RDC A;  2OPS A;  1BL3 A;  3KK3 A;  4DSI A;  4KB1 A;  3NF9 A;  3V1O A;  4DG1 A;  3QLH A;  3M8S A;  3I0S A;  3ULD A;  4FZZ A;  3THV A;  1C1B A;  2A1R A;  1HYZ A;  4H4M A;  3DYA A;  3V9W A;  4M3Y A;  2HND A;  4YFU A;  1BIZ A;  4RW6 A;  4DLE A;  1LW2 A;  1C1A A;  3M8R A;  4CIE A;  2KZM A;  1WAJ A;  2DFE A;  4E0D A;  4RW8 A;  2X74 A;  3VA0 A;  5FRM A;  1UA1 A;  2G8I A;  5C25 A;  5HBM A;  1JLF A;  3QO9 A;  3OYI A;  1SKW A;  2RN2 A;  4B9N A;  3OYE A;  4DFP A;  4M3X A;  4Y1D A;  3MEE A;  2D5R A;  5HRS A;  4LH4 A;  3ZSY A;  4DF4 A;  1NJW A;  3KJV A;  1ZBU A;  1RTJ A;  1Z25 A;  3OS2 A;  3OJS A;  1UOC A;  2O4G A;  4DLG A;  4DTP A;  2EX3 A;  1ASV A;  4O0I A;  3F9K A;  4HVJ A;  3OYL A;  3TAN A;  4OPK A;  1TK8 A;  4B9U A;  1RCH A;  3P5J A;  3AVB A;  1U49 A;  3KIO A;  1RTH A;  1RNH A;  2JGU A;  4CK1 A;  3PV8 A;  2PY5 A;  4CEC A;  3SV4 A;  4DSJ A;  3RRG A;  1NJZ A;  3CFP A;  2QK9 A;  3NF7 A;  3O3F A;  4C8O A;  1I3A A;  3CFR A;  4KHS A;  1JL2 A;  1QHT A;  2G8U A;  3PUF A;  3L3V A;  3KD5 E;  4JS4 A;  4KAZ A;  4N76 A;  4W5N A;  3AVG A;  4M3T A;  4KHU A;  1BI4 A;  4W5O A;  4DS4 A;  4E19 A;  1WSE A;  1DLO A;  2B4J A;  2E4L A;  4OKE A;  3DM2 A;  4DU1 A;  4DTR A;  1WLJ A;  3VN5 A;  4Z4H A;  3TAQ A;  4CJE A;  2HHV A;  1B9F A;  1TV6 A;  1NKC A;  3RMC A;  1S6Q A;  4K8X A;  4E7L A;  3DLR A;  3TWH A;  1IG9 A;  3NDK A;  1WSF A;  2KQ2 A;  1BCM A;  4IG3 A;  4EP5 A;  3U3Y A;  3HO1 A;  4FYD A;  3S9H A;  4N41 A;  4PQU A;  1TKT A;  1TL1 A;  2DFH A;  4NCG A;  1C1C A;  1KTQ A;  1S1X A;  1U04 A;  1HYS A;  3OYH A;  3DOK A;  4HCC A;  3H08 A;  3PX6 A;  4KRE A;  4E3S A;  4FJG A;  1CZB A;  2IDO A;  2WON A;  5I42 A;  4O0J A;  4B9L A;  2Q3S A;  4CJU A;  3L2V A;  1SKR A;  2BDP A;  4KTQ A;  3ZSV A;  1S1V A;  4FJJ A;  3KLH A;  3NH1 A;  3LWM A;  4KHN A;  3D0P A;  1O1W A;  4ZTF A;  4B3O A;  5JS1 A;  1EKE A;  4CCH A;  2YHB A;  1HQU A;  1IH7 A;  1IKY A;  4QCL A;  3TI0 A;  1JL1 A;  3K5O A;  3HT3 A;  2HHX A;  3OYF A;  4CEA A;  5SZT A;  4I7F A;  4HTU A;  2HW3 A;  3MED A;  3ZSX A;  3MXI A;  2HB5 A;  2OPR A;  1YTU A;  1REV A;  4H4O A;  3CFO A;  3DOL A;  2O4I A;  4CF8 A;  4OJR A;  4KTW A;  1C6V A;  3AVN A;  2OA8 A;  4CHN A;  4FLX A;  1NJX A;  3L2U A;  4E7I A;  3SPY A;  4CEB A;  2KW4 A;  4CGG A;  1SL2 A;  2PZS A;  2X6S A;  3AVC A;  1TVR A;  4BDP A;  3L2W A;  3ZT3 A;  1LW0 A;  1UA0 A;  4BE0 A;  4EZ9 A;  4ZTJ A;  1RTD A;  2P1J A;  3OYD A;  3D45 A;  4O55 A;  4DS5 A;  4FCY A;  3HL8 A;  4IG0 A;  3PO5 A;  4B8C A;  1XWL A;  4ID1 A;  1JKH A;  4Z0U A;  3DMJ A;  2DFF A;  5FRN A;  2KTQ A;  5JS2 A;  3EYZ A;  1X9S A;  1QS4 A;  4CJ5 A;  4PUO A;  2OPP A;  3SQ1 A;  1A5W A;  2YHA A;  2G8F A;  3NF8 A;  1L3S A;  1W9H A;  3LAK A;  3LWL A;  3AVM A;  3QIO A;  4OLA A;  3L3U A;  2R7Y A;  1NJY A;  1ASU A;  1B92 A;  2HHS A;  1FK9 A;  4PY5 A;  3VQ5 A;  4HCB A;  4RG8 A;  4B08 A;  3SQ4 A;  1TK0 A;  4C8K A;  4Z4F A;  3MAQ A;  1HNV A;  1KCF A;  3VQQ A;  3OYB A;  1YT3 A;  3CYM A;  2D0C A;  4OPJ A;  4DSE A;  4I2P A;  3OYG A;  1W0H A;  3AA3 A;  3NF6 A;  4FLZ A;  4CED A;  4FLY A;  3MXM A;  5HLF A;  3V9X A;  1J9A A;  2ZQB A;  1VSM A;  1QE1 A;  3T19 A;  4C8N A;  4KKO A;  1VSE A;  3CM6 A;  4Q0B A;  4RW7 A;  3QEP A;  1TL3 A;  1SL0 A;  3HST B;  1BQN A;  4EP4 A;  3G10 A;  3PX4 A;  2FBT A;  4DTX A;  4JS5 A;  3SV3 A;  3OYC A;  4FK0 A;  2RF2 A;  5CYM A;  5KGX A;  4DTS A;  1QSY A;  1VSK A;  3TAR A;  3KKR A;  3OYA A;  3NHG A;  3RWU A;  4CF1 A;  4J2B A;  4FJX A;  1FXX A;  1N6Q A;  1NK7 A;  4FLW A;  5KGW A;  4Z4G A;  1S6P A;  4BAC A;  2HVH A;  2DTU A;  4AHT A;  4N56 A;  4CGI A;  3KK2 A;  3AVK A;  4MQ3 A;  1LAW A;  4JLH A;  4J2D A;  5DK5 A;  1RBV A;  2YNH A;  4DTN A;  1JLB A;  4ID5 A;  1X1P A;  1Z26 A;  4C8M A;  2HHT A;  1U45 A;  4FJH A;  3VA3 A;  3IRX A;  1HMV A;  4CIF A;  1RT4 A;  1GOB A;  3AVF A;  4CGJ A;  1TKX A;  4CFC A;  4CJW A;  3QNO A;  3LP1 A;  3SNN A;  3HVT A;  1BHL A;  4LH5 A;  4DFK A;  5J1E A;  4KI4 A;  2ZD1 A;  4F8R A;  3TAG A;  3M8P A;  1NKB A;  3V81 A;  2E6L A;  2P5G A;  3K57 A;  4FJM A;  3LP0 A;  3L8B A;  2HHW A;  2E6M A;  3B6O A;  2KZZ A;  1WSH A;  4MFB A;  1NOZ A;  3L2R A;  3CG7 A;  4GW6 A;  5E41 A;  4ELT A;  4M3W A;  2HVI A;  4FJ7 A;  1D8Y A;  3TAM A;  1RBR A;  4CGF A;  4J2A A;  4BDY A;  4DU4 A;  3DRP A;  1ZBI A;  3FFI A;  2I5J A;  1LV5 A;  4Z4I A;  4CJ3 A;  5KRT A;  1WN7 A;  3NCI A;  3AA5 X;  3HYF A;  4CK3 A;  4IBN A;  4CEF A;  5I3U A;  3G0Z A;  3MEC A;  2VG6 A;  4H8K A;  3TAE A;  2BAN A;  2VWJ A;  2VG7 A;  1U47 A;  3HK2 A;  3S3O A;  1SV5 A;  4CHP A;  4CF0 A;  4UQG A;  1RT1 A;  4FLU A;  4M3U A;  2WOM A;  3VQB A;  3V9S A;  2YKM A;  4AIL C;  3LP2 A;  4F2R A;  1WSJ A;  5K14 A;  3AA4 A;  1IO2 A;  3NH0 A;  1HQE A;  3JYT A;  1ZBF A;  3AVH A;  3AO1 A;  3CQ8 A;  3QEX A;  1TKD A;  4KFB A;  4C8L A;  1BI4 B;  4CGD A;  4CJF A;  4FJ9 A;  4M3R A;  1GOC A;  3IG1 A;  1RT7 A;  1RT5 A;  1WSI A;  1RDA A;  2YNG A;  1IKV A;  1TKZ A;  2Z1G A;  3O3G A;  4F2S A;  1NK0 A;  4FJ8 A;  2QKB A;  4OKK A;  2W42 A;  4KI6 A;  3C6T A;  1JLE A;  3SUO A;  3KLI A;  3OS0 A;  4Z4E A;  1XHX A;  2G8V A;  1DTQ A;  1VK0 A;  1XC9 A;  1D9F A;  3AVA A;  4CJR A;  4OGE A;  1VSI A;  4OKJ A;  4Y1C A;  1ITG A;  5C24 A;  4B9V A;  3ZSQ A;  3HPO A;  2VG5 A;  2Z1J A;  3ZSO A;  5DMR A;  1L3U A;  2DY4 A;  2X6N A;  4FW1 A;  1SL1 A;  2XY8 A;  1XHZ A;  3QEW A;  2FC0 A;  3C95 A;  3QET A;  4L8R B;  1CLQ A;  3SQ0 A;  1EX4 A;  4RW4 A;  4W5T A;  5HRP A;  1NK5 A;  3ALY A;  5J2P A;  1F21 A;  2X78 A;  4KB0 A;  2YV0 X;  3V9U A;  1NK8 A;  2QKK A;  4DQP A;  4DQS A;  1NK9 A;  4CHY A;  1TGO A;  3P83 D;  1BQM A;  5KTQ A;  3IAY A;  4KPY A;  1RBT A;  1VSJ A;  1VRT A;  1WSG A;  3LAN A;  4CFB A;  3AVJ A;  3TR8 A;  4KHY A;  4R5P A;  3KD1 E;  3SUN A;  4FJL A;  1C0M A;  4LSN A;  3HP9 A;  2FBY A;  2YKN A;  4NYN A;  4PA1 A;  1YVU A;  1Q9X A;  4NCB A;  1QSS A;  3WNE A;  3ZSR A;  3U6F A;  2D0A A;  2ETJ A;  4CEQ A;  3BDP A;  3RR7 A;  4DSL A;  1L3V A;  4I9L A;  2F96 A;  4I9Q A;  1T8E A;  1EP4 A;  3KLE A;  1Q9Y A;  1LWF A;  4DTJ A;  1RT2 A;  3PX0 A;  4FZX C;  3LP3 A;  3P1G A;  3KKS A;  4CJ4 A;  1J54 A;  1RIL A;  5HRR A;  5J2Q A;  3ZCM A;  2XRI A;  3SYZ A;  2AJQ A;  1JXE A;  4KO0 A;  4ZHR A;  4XIU A;  3SCX A;  1HNI A;  2ITG A;  2P5O A;  1D9D A;  3VQA A;  4KTZ A;  4CF9 A;  4NCA A;  2HHQ A;  2ATQ A;  3AO3 A;  2BGG A;  3K5M A;  2FBX A;  4F3O A;  3NE6 A;  2GBZ A;  1T05 A;  1RT6 A;  4BWJ A;  4FXD A;  4OVL A;  4CJS A;  3LZI A;  1HRH A;  1RBS A;  4LSL A;  4CHO A;  3TAF A;  2HMI A;  1JLC A;  2IGI A;  2HNY A;  3RRH A;  4BWM A;  1T7P A;  4IDK A;  4GMJ B;  1KLN A;  3LAL A;  4FVM A;  1RBU A;  4CJK A;  3HXM A;  4CF2 A;  3K5N A;  3UIQ A;  2PYL A;  4CEZ A;  1J53 A;  3AO2 A;  2Y1J A;  4O44 A;  5EU7 A;  3PO4 A;  3NH2 A;  1HYV A;  4F3T A;  1RTI A;  4DF8 A;  3I8D A;  4TSX A;  1JLG A;  4M45 A;  3OY9 A;  1WNS A;  2IS3 A;  4CES A;  1NKE A;  4FLT A;  3PY8 A;  4E89 A;  3VQ7 A;  3RMD A;  3K58 A;  5FDL A;  1QQC A;  4CHQ A;  3K2P A;  3V9Z A;  2IAJ A;  4DSF A;  4DFM A;  4DQQ A;  1KRP A;  2G8K A;  2RKI A;  1R0A A;  1QTM A;  4AH9 A;  4FK4 A;  1KVB A;  3VQE A;  4E7J A;  1BGX T;  1B9D A;  4IFV A;  1KSP A;  5SWM A;  2KFN A;  1KVA A;  2OZS A;  1I39 A;  2YNF A;  3NBP A;  2XY7 A;  1J5O A;  1S1U A;  1S9E A;  4B8A B;  1S9G A;  2G8W A;  4AHV A;  3KK1 A;  3C6U A;  3HPG A;  3EZ5 A;  3QNN A;  4J2E A;  4CJP A;  3KLG A;  4Z4C A;  3O3H A;  1ZBH A;  3HJF A;  2P51 A;  3QIN A;  4DQI A;  1JLA A;  2HNZ A;  1L5U A;  1QSL A;  1SUQ A;  4IKF A;  1S1W A;  4CIG A;  1RDB A;  3LPU A;  4F4K A;  3SPZ A;  3VQ9 A;  4CFA A;  4FM2 A;  1MU2 A;  1EET A;  3OYN A;  1Y97 A;  4CJV A;  4FZY A;  4M42 A;  3OVN A;  1LWC A;  3OJU A;  3SQ2 A;  4HUG A;  1NK6 A;  3F73 A;  1UAX A;  1KVC A;  2ZE2 A;  1LWE A;  2F8S A;  4W5R A;  3HVR A;  3RR8 A;  2RPI A;  4CFD A;  4BE2 A;  4DTM A;  3ITH A;  4IFY A;  3K5L A;  3QEI A;  2OZM A;  3MEG A;  1JLQ A;  1HPZ A;  5J2M A;  2JLE A;  3K59 A;  1CZ9 A;  1U48 A;  2XO7 A;  1X9W A;  4HHT A;  3NGI A;  1ZYQ A;  3JSM A;  2LSN A;  4QAG A;  4G1Q A;  4FW2 A;  2Z1H A;  1YTA A;  2OPQ A;  1S1T A;  4KHW A;  1VSF A;  4FJ5 A;  4FJI A;  1SKS A;  3U3G A;  3MXJ A;  4FM0 A;  3QEV A;  2YNI A;  1S5J A;  4AHC A;  1Q8I A;  1G15 A;  4DFJ A;  1KFS A;  4Q5V A;  1GOA A;  1N5Y A;  1A5X A;  5HRN A;  4QOZ B;  1LAV A;  2Z1I A;  3O4Q A;  5KI6 A;  3LDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...