3DRRA

Hiv reverse transcriptase y181c mutant in complex with inhibitor r8e
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 148
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drrA05
3E51A 3DLEB 3NGIA 4QWCA 1KVAA 3TABA 4WE1A 5KI6A 4O3OA 2QE5A 5JUMA 1MMLA 4RG8A 4KHRA 3QO9B 1NK6A 5I42B 3OYCA 4CF2A 1UA1A 4FLVA 2HWIA 4KTWA 1QE1B 3Q8SB 3RBEA 3TAFA 1NNDA 2QKKA 2F8EX 1WNSA 3CYMA 5KFRA 3HKWA 4J9RA 5KFPA 4CHQA 3AO2A 3PHEA 2OA8A 4IFYA 5F9LA 5KG7A 3ZT2A 4CJFA 3KKRA 4OKEA 3HO1A 2JEIA 3B6OA 1Z26A 3V4IB 2W42A 2ZE2A 3L2UA 3QEIA 4ZTJA 5HLFB 3EZUA 3NH1A 4HVJA 3KK1B 5KT2A 3OYLA 4FJLA 2W8LA 1RILA 1RAJA 5C25A 4UQGA 3NH0A 3MEEB 5KFUA 3HSTB 2DPJA 4Z4IA 4J2DA 1NHUA 4XIUA 1TP7A 3DLKA 5CZ2A 2G8UA 2RF2B 3WNHA 4J9MA 1S1VA 5L9XA 3ICLA 4ZP8A 3P1GA 3MXIA 5HBMA 4J9SA 4O44B 3KLHA 3HHKA 3MECA 3QNNA 5J2PA 2HHVA 4M95A 5KG6A 2PYLA 2FVRA 3S3MA 3I5CA 1EETB 4H4MB 2FLLA 4NLGA 3DRSA 1S48A 2WRMA 3NHGA 4NCAA 4Q45A 4HUGA 3K5MA 3OYDA 2OPQB 4ZPDA 3SJJA 4R8UB 4WYLA 3VQ8A 5KG1A 3BSAA 1C0TA 4CF1A 5J2MB 4NYFA 1QHTA 3QETA 1K6YA 4M3ZA 1LWCA 2R8HA 3KLIB 1GX6A 2XO7A 4RW4A 3LP1B 3DRSB 5KFKA 3CQ8A 1REVB 4C8NA 1T05A 3CDEA 4AHCA 5I42A 2V4QA 1N5YA 1JLGB 4H4OA 1X9SA 3TANA 4ZVFA 3LPUA 3JYTA 1RBUA 5J1EB 2QKBA 5F9NA 1Y97A 2P5GA 4B3OB 2P1JA 2HVHA 3CO9A 1J9AA 3S9HA 3I5AA 2ATQA 4OKKA 1S0OA 1WAJA 3OL9A 4E7JA 1KHVA 1S1UA 3G0ZA 3CFPA 3NMAA 1ASUA 4CECA 4Z4GA 3JYTB 1IH7A 1VSIA 4H4OB 4IKFA 4CGDA 1IKVA 3AVGA 1HJRA 3VQPA 1VRUB 3NF8A 1NJWA 1LWCB 5L1LA 2C2DA 5SWMA 3PW0A 3KHGA 3T5JA 2YNGA 3E01B 4NCGB 3ZSYA 2BQ3A 3T19A 3OL7A 3DDKA 4HUEA 3KJVA 3GYNA 4H8KA 4IQXA 3OJUA 4QW9A 4R0EA 4H4MA 3VQQA 1IKVB 3QNOA 3AVMA 4DL6A 4FXDA 5KFEA 1GX5A 3C94A 1S1TA 3NAEA 1UA0A 1KCFA 4KBIA 4DL5A 1HNIB 4DTJA 1SV5B 3G6YA 2R8KA 4K4SA 1SL1A 4Z4EA 3TAGA 3EZ5A 1FKOA 5J2PB 5HROB 1SKWA 4ECUA 3MECB 3KHHA 3TVKA 4O3RA 3AVJA 3SUQA 4TQSA 1I3AA 4WE1B 3PO5A 4Q0BB 1BIZA 4ELTA 3AO5A 3MFHA 5I3UA 2GUIA 4J9PA 5KG3A 2RF2A 1KVBA 1LAWA 3AA5X 5KFDA 1O1WA 4B3OA 5DLGA 4DTPA 1IKXA 3NCIA 4WFYA 4DFPA 1XR6A 2D5RA 3ISND 4RW6B 2IBKA 1RT1B 3MEEA 1EP4B 2BRKA 2HHWA 2IDOA 4C8OA 3T1AA 1SUQA 3MR6A 2DFHA 4AHTA 2I5JA 4TY8B 3NAHA 4DLEA 2D3UA 2LSNA 4RW4B 4KB7A 2BR0A 3U6FA 3V4IA 3U3YA 4O55A 2BANA 3G6VA 4HCBA 2ILYA 1BI4B 1FXXA 2W9BA 4K8XA 4DU3A 3NBPB 4ED8A 4F4WA 2DY4A 4J9OA 1NKCA 4EZ9A 5DG8A 3RRHA 1YTUA 4ED1A 3EYZA 5KRSA 3K5OA 5D3GA 3D28A 4RW8B 3TWHA 4M3WA 3HJFA 4ZPCA 1L5UA 2YNHA 4PQUA 2FC0A 4OVLA 3G6XA 4OJRA 2XI3A 3V81B 2CKWA 3CIZA 5T14A 4N76A 2DPIA 3FFIB 3IN5A 3IS9B 3CJ0A 4TN2A 2C28A 4DWIA 3OL8A 3KLGA 5C25B 4CHZA 2IAJA 1BISA 4E89A 5KFAA 4RNOA 4FZXC 5KFCA 1WAFA 1UWBA 4J2EA 1IKWA 3ZSZA 1JLCB 5C5JA 3BQ2A 4FJ5A 3RAXA 4F4ZA 4TY9A 1RDCA 4DFMA 4KAZA 2HNZA 4YR0A 4URGA 3L2WA 4FJGA 1S6QA 4B9NA 3AA3A 1DLOA 2YNIB 4QPXA 4CK1A 2C2EA 3L8BA 2XGPA 4IH6A 4I2PB 2RPIA 3LWLA 1RT7B 2G8FA 3DLRA 3L2VA 4O4GA 3NE6A 3PR4A 1LWFA 1TK0A 4ELUA 5CYQA 4QWDA 4CGFA 4KHWA 2JEFA 1EXQA 3QGIA 3DYAA 3QEXA 4CEQA 1QSYA 1S5JA 3DLEA 4G1QA 3VA3A 4Y2AA 2HHUA 4CESA 4CJRA 3MEGA 3GIKA 4CJLA 4CIEA 1N6QB 5DGAA 3G10A 3LAMA 2I1RA 1HPZA 2HW3A 3HT3A 3HVAA 2UUWA 3OYBA 4DU4A 3KOAA 3VQAA 1JKHA 1WSIA 5KFNA 2G8VA 1UAXA 3UPFA 4DG1B 3I0SB 4KTQA 2HHXA 1TVRB 4IG0B 1QUVA 3VQ7A 3DM2A 3CDWA 3WNFA 1S9FA 4CHOA 1X9WA 4W5NA 2RKIA 5KT4A 5FDLA 1C0UA 3V6DA 1HYSA 2IJNA 4O3PA 4KV8B 2OZMA 4NCBA 3BR9A 3KIOA 3CG7A 3M8SA 3KLFB 2X78A 4Y3CA 4DFKA 1ZBIA 5EDWA 4FCYA 3UR0A 4MK7A 5KT7A 1L3SA 1BCOA 4DL7A 3RTVA 4OKJA 2AX0A 4URQU 2E9TA 3NGDA 3I0RB 4WXOA 1XI1A 3HM9A 5JXSA 4GW6A 2AGPA 1NK4A 4OPJA 1DTQA 4MKAA 5KG0A 4CF9A 3QIPA 3FDSA 1JXBA 2XY7A 4EBCA 2OPPA 3CJ5A 4QW8A 1QTMA 2EHGA 4OGEA 4QWEA 4NLUA 4FM1A 3KK3A 3IAYA 4ID5B 1T03A 2HB5A 3HVWA 1ASVA 2ZD1A 2P5OA 3DOKB 4CHYA 4DF4A 2Y1JA 3LP0A 5KGWA 4ECXA 5J2QA 5KG2A 4RUCA 2VA3A 5KFMA 1TQLA 1CXUA 4TYAA 3NF7A 4IFVB 3A2FA 3KLEB 3HVRA 5CZ1A 3OSNA 1J5OB 3BSNA 1TAQA 3OYIA 3SQ1A 2AQ4A 4CJQA 2IOCA 2IGIA 4Q43A 3T5HA 4Q44A 4FBTA 3KD5E 4TLRA 4BDYA 2ASLA 4R5PB 3DLHA 3TR8A 2J6SA 3Q8QB 1VSJA 4IFVA 4O4RA 1RBTA 4XO0A 4WZQA 4AH9A 5DG7A 4NLWA 1HQUA 1RT5B 3QLHA 2IM2A 1VSLA 4IRDA 4NYNA 1S1WA 3KHRA 3CM6A 4LQ3A 4FZYA 2BQUA 3M8QA 4ID5A 3TAMB 3KK3B 5KFOA 5L1IA 1S49A 1B9FA 4F3OA 3RWUA 2JEGA 4M3TA 4WZMA 3HXMA 1C1BA 1ZYQA 1VRTB 1KSPA 3SUOA 2GC8A 4J9NA 1NHVA 4ECTA 4ID1A 2WOMA 2Y1IA 4BWMA 3M8QB 5C24B 3ZCMA 3MFIA 4FLTA 1DTTB 2OYQA 1JLFB 2C22A 2JC1A 1HQUB 2R2UA 1I6JA 2HWHA 1N48A 1WLJA 2R8GA 1TKXB 4GC7A 4JV0A 3S3OA 3PUFA 4I7FA 4F4KA 5FDLB 4PWDA 2RKIB 4Y1DA 4ED3A 3OYMA 3CVKA 4YR2A 3PW7A 4W5QA 4CGIA 2IM0A 1JLBA 4CFBA 4K50A 2E6LA 3ITHB 4NZ0A 4TSXA 1LW2B 4CF8A 2ASJA 3OYAA 4O3SA 1TKZB 3IG1A 2ALZA 3LAKA 4NLPA 1RTJB 2X6SA 2Z1GA 3PY8A 1JLQB 5J2QB 5KGXA 2OZSA 1W25A 2YNFA 4ECVA 1TK5A 1N6QA 5F8LA 4CGGA 4G1QB 1NJYA 1SH2A 2WOMB 4CE9A 3MEDA 3SQ0A 4O0IA 3D0PA 4FW2A 2IM3A 1CZ9A 2OPPB 4ZPBA 4EYIB 4AILC 5CYMB 3QIPB 4DTMA 3HK2A 1T7PA 3H08A 4J9KA 1UOCA 4W5RA 3OYHA 3KD1E 3ZSVA 4MH8A 1S1WB 3QZ7A 1VSFA 1VSEA 4YQWA 2O4IA 1SKRA 2YNIA 3EPIA 1JLQA 1RT5A 2FVSA 1RTJA 4FS1A 1RNHA 2Z1JA 2OPRB 1JL2A 1TKZA 4DF8A 3JSMB 4J9LA 2KZZA 3RB3A 4KV8A 4MFBA 2IC3B 1RT6A 4KKOB 2G8WA 1ITGA 2HMIA 3N6LA 1C1CB 1S0NA 4JV1A 3FSIA 4NLDA 3GIIA 3PW4A 2AWZA 1TL1A 2AGOA 2E6MA 3THVA 4ZVEA 4IRCA 3CJ2A 3I8DA 3SI8A 1A5VA 4KHQA 1J5OA 3ASMA 1JKHB 2V0NA 1KTQA 1F21A 4AHSA 2PZSA 4DL3A 1CZBA 1JLFA 3VA0A 3L3VA 3OJSA 1B9DA 1C6VA 2R2RA 3UDLA 1ZTWA 3V81A 3B6PA 3RR8A 4FM2A 2KZMA 4J2AA 4B9VA 5KT6A 4IDKA 1RT2A 2ATLA 3TARA 5DGBA 1S6PA 5EUHA 1C1BB 4TYBA 4RW8A 5F8MA 1FKPB 2AGQA 1RDRA 1RDAA 1K1SA 1T8EA 1RT7A 4DSFA 4CJVA 3MTKA 2HHSA 4F3TA 4K4ZA 4ECYA 4IR1A 1TGOA 3AA4A 3QLHB 5EWEA 4W5TA 4FJ7A 4DL4A 4FVMA 5L1JA 3BQ1A 2ZQBA 5KFQA 4DEZA 2BANB 3O3FA 4NLTA 4BACA 4DMNA 1BQNB 3M9NB 1LW0B 4CEOA 4RW9B 3H5UA 2B43A 2IS3A 3P83D 1TVRA 3V6HA 3H98A 3NKYA 4E0DA 4IH5A 3NL0A 4LD0A 1WSEA 4O5BA 4DTNA 3PJXA 3IS9A 3AV9A 1HPZB 2YHBA 3CFOA 3QEWA 2FBVA 1Z4UA 5F8GA 4Z0UA 4FW1A 1JXEA 3MEGB 4ZVGA 3PX4A 4KREA 4FBUA 4M3RA 4DTUA 2HNYA 4DQIA 5DQIA 2O5DA 2D41A 4CHNA 1VSDA 4YFUA 1FKOB 2KFZA 5EU7A 4CEFA 1NJZA 4KHUA 1QS4A 2YKMA 5KFZA 1J53A 1IKYA 3QERA 4RNFA 1S1TB 3MF5A 3QIDA 1BCMA 1TL3A 3VQ9A 4FM0A 1Z25A 3DMJA 4DFJA 3SI6A 2B6AB 4W5OA 3KHLA 2XC9A 2RDJA 4ICLA 4CJ5A 3V9UA 4FLXA 4DSJA 4CFDA 5HP1B 1HQEA 2XY6A 1TKDA 3LZIA 1IKWB 1VRUA 2D0AA 4XPCA 1D5AA 3DM2B 1C0MA 4IKAA 4FK2A 1UWBB 4J9QA 3BGRB 1SUQB 1G15A 3K57A 4ECWA 1JLEA 2YV0X 4ECQA 1U47A 3FFIA 3ISNC 1RA6A 2P51A 2BQRA 4N47A 3TAQA 4B8CA 4FLWA 2B4JA 4BE1A 4BE0A 2B5JA 2YNHB 4PQUB 3V1OA 3LDSA 2VA2A 4HUFA 5HROA 1KHWA 2VG6A 5J1EA 1WSHA 2HAIA 3GV8B 3H59A 5CYQB 4Z4FA 1NJXA 4NLYA 4F2RA 1S0MA 4Q8EA 2D7SA 2JC0A 4JS5A 2J6UA 1L3VA 4JLHA 1J54A 4FJNA 3MXJA 3LP1A 1QAJA 1NOYA 2FJVA 2WHOA 5F8HA 2AU0A 4QWBA 4GC6A 5J2MA 5DQHA 2JLEA 1C0TB 1IM4A 4ED2A 2FJXA 4NCGA 1XR7A 4OPKA 2YNGB 3E01A 4EBEA 4PUOB 4R8UA 2OPQA 1U04A 2FBXA 1RYRA 4MKBA 5J2NA 4C8KA 1EETA 5KFSA 4M3UA 4KE5A 3T5KA 3FQKA 4BWJA 3LALA 4B9TA 4RW6A 3SFUA 4H54A 4O0JA 2O4GA 2V4RA 3C6TA 4O44A 4ZHRA 2GBZA 3OS2A 4E3SA 3BJYA 3ZSXA 4DTXA 3L2RA 1WNEA 2FLPA 5CY4A 3HL8A 4QCLA 5DG9A 3QEVA 2XI2A 3AVNA 3DLKB 1U4BA 4JV2A 4Y2CA 1HNIA 1D1UA 5KRTA 1JLGA 4J2BA 1VK0A 4K4XA 4FJ9A 1RBSA 4NRTA 4AHRA 2KQ2A 3VQ6A 2HHQA 3KJVB 1MU2B 4AHUA 1OS5A 2BE2A 4U7CA 4KAIA 5KFHA 3H4DA 3OYNA 3VQSA 3OYEA 4URSA 1BIUA 4CK2A 2DTUA 4EO6A 2VG7A 2FLNA 5F8NA 4IRKA 1U49A 4DTOA 1NKBA 4RUAA 3H5YA 4OGCA 2I5JB 4BDPA 3VQDA 5T7BA 1KVCA 1U09A 3M9OB 3VQBA 3OYGA 3RB4A 1RT1A 2E9ZA 4CGHA 5KFYA 3AVFA 1S1UB 2EX3A 3RAQA 1CXQA 3HYFA 4EO8A 3KLHB 1SL2A 3PW2A 3DRRB 3DRPA 3LPTA 3K59A 1SKSA 1D0EA 1GOBA 2UVRA 3KNAA 4ZHRB 3OHBA 3SYZA 4IBNA 1YVFA 4RNHA 3NH2A 1RT4A 4KFBA 4ED6A 3UQSA 3HP9A 4EP4A 1SV5A 4ZVHA 2E9RX 1JLEB 4FYDA 3KLVA 1N5YB 4JS4A 1XWLA 4CFAA 3BGRA 1C2PA 1T05B 5HLFA 2UVWA 1W9HA 3OY9A 3KTQA 2D0BA 4Z4HA 1SH3A 4YNQA 1NK5A 3NF9A 5HP1A 3ZSQA 2R8JA 4CIFA 2DFEA 4IFYB 3IGVA 4DQRA 1C1AA 4BE2A 2BE2B 2W9AA 2F8TA 1MU2A 4ELVA 1IO2A 1WSGA 1X1PA 4CGJA 4B9SA 4FJJA 4RNMA 1QE1A 2OH2A 3V9XA 4NLQA 1TL3B 4M42A 3FRZA 1IG9A 2R7YA 3OS0A 3OVNA 3ZSWA 4K8ZA 2F8SA 3OL6A 3VQ5A 2CJQA 2YKMB 4NLOA 4RNNA 4DSLA 2VWJA 2W7PA 2KW4A 1KFDA 4EYHB 1WSJA 4X2BA 5EWGA 1QSSA 2XY5A 3I5BA 3SQ2A 3M9MB 2B5JB 3SPYA 4B9LA 4PY5A 1S1VB 3U3GA 3DRPB 3DRRA 1TKTB 3C6TB 1NK0A 3SNNA 3M8RA 1S97A 3VQ4A 3OHAA 4LH4A 4U6PA 1ZBLA 3V1QA 4DU1A 3K2PA 3QYYA 5KG4A 3DLBA 4ED0A 4ZMMA 3K5NA 1REVA 4MK9A 3QESA 1NKEA 4O3QA 4OL8A 4DS4A 3KLIA 2VG7B 5F8JA 4EZ6A 4CJWA 1HQEB 3S3NA 5DMRA 4E7KA 1KRPA 4G3IA 3PR5B 1A5WA 4NLRA 3T3FA 4FJHA 3MAQA 5KFBA 4CJKA 2Q3SA 2D3ZA 2VWKA 3CJ4A 3DMJB 2JGUA 3HVTB 2ILZA 2A1SA 4NRUA 4I9QA 3H4BA 3Q8RB 4CK3A 1YTAA 4KI4A 5KFLA 3LANA 2BGGA 3PO4A 3SV4A 1XHXA 4IDKB 2XHBA 4MIBA 4KRFA 3FQLA 4ECRA 5KFFA 4CF0A 1LWEA 2R8IA 3GV5B 5HBMB 3BQ0A 1B92A 3D5MA 4EP5A 4I2QB 2GV9A 4M3YA 2YKNB 4CJ4A 4KTZA 1BL3A 3ZT4A 3VQCA 3V1RA 2A1RA 1TAUA 1N4LA 3P5JA 4B8AB 4I9LA 2QXFA 4MIAA 2PY5A 2W7OA 4GMJB 3BDPA 4F8RA 1NOZA 3KK1A 1L3UA 4KHYA 3QGHA 4QAGA 2HNDA 5J2NB 3H2LA 1L3TA 2ZE2B 2WTFA 2QV6A 3CM5A 4NLXA 4IOBA 1LW0A 1BQNA 4PUOA 2HMIB 4CEBA 1D8YA 1RTDA 2IC3A 1HYVA 4FJKA 4IR9A 4ICLB 4FJ8A 2KTQA 5KFGA 1JLAA 5DQGA 2B6AA 2ITGA 1NK7A 3SQ4A 4RW7A 4OLAA 4KSEB 1S1XA 2FJWA 2FBTA 4FJXA 3K5LA 4E19A 4LSNB 3SCXA 3Q8PB 1S9EA 1JIHA 3RMDA 1GOAA 3QO9A 3MR2A 2IMWP 4CJPA 2VG6B 4RU9A 1BQMB 1NK8A 2IM1A 1RT2B 1JL1A 4YR3A 4DTRA 4CHPA 4FK0A 1XHZA 3PZPA 4ZP6A 2HNYB 3DOLB 2E4LA 5C42B 3O4QA 4Y1CA 3SUPA 4OLBA 3OS1A 4XPEA 3VQEA 1NK9A 1FK9A 1XR5A 1VSHA 4GVMA 4YMEA 4KI6A 5KFWA 1HYZA 4NLVA 3O3HA 3V6JA 3T5LA 4HKQA 3KMSA 4DSEA 2WB4A 3ALYA 4B9MA 1RDDA 3LP2A 4M45A 1KLMB 3SUNA 1XC9A 1S9GB 3KK2A 4CJUA 4KHNA 4I7FB 3DI6B 5JS2A 4CJSA 4KKOA 4FK4A 4FJMA 1HRHA 3KMQA 1RTHB 1BHLA 1HMVB 5KT3A 2F96A 4DQPA 4CJEA 3V9WA 3V9ZA 2R2SA 2W9CB 2V9WA 3SZ2A 4Y34A 2VG5A 5C24A 4FLZA 3DLGB 2BRLA 4KB0A 1RTIB 4MK8A 3K58A 3RR7A 4M3XA 1FKPA 1IKYB 5DLFA 3AVAA 3C6UB 4F50A 4Q5VA 2WONA 1HNVB 3UIQA 3CWJA 3HPGA 3GQCA 3L3UA 4K4VA 1RA7A 5K14A 1RDBA 1KFSA 1KLNA 3N6MA 1N56A 4LSLB 4K4WA 1LV5A 2UUTA 4IG3A 3IGNA 4DSIA 2GIQA 2OPSB 3RMBA 4WFXA 5HRRA 3H5SA 3CJ3A 4KPYA 4TQRA 3MR5A 1TV6A 3WNEA 4PWDB 4RW9A 2WCXA 1RT3B 1C1CA 4KB1A 2J6TA 2XY8A 4DL2A 3D45A 1RT6B 3GILA 4CERA 3KLEA 5HRNA 1X9MA 4K4TA 3L2QA 3ZT1A 2FVQA 3PV8A 4CIGA 4FLYA 5KT5A 3V6KA 4LY7A 3NGZA 3LZJA 1ASWA 4B9UA 4EBDA 3IRXB 5CYMA 4QWAA 3AVCA 3OYFA 1S6PB 3C6UA 1QAIA 3NAIA 3AVLA 1WSFA 3RB0A 2PYJA 3AO4A 2IJFA 2UVVA 4CEEA 1JXLA 2XRIA 3TAMA 1R0AA 1QQCA 3MR3A 2QK9A 4BDZA 4F4XA 4QOZB 3VN5A 3O3GA 1U48A 2BDPA 2W9CA 3RRGA 2YNFB 4KO0A 3M8PB 1CSJA 1D9DA 5KG5A 3OSPA 1S10A 1HYSB 2ASDA 3ITHA 4ZP7A 3TAPA 4IH7A 3ZT3A 3DI6A 4FLUA 1JLBB 4DLGA 5FRNA 1A5XA 4R5PA 1TV6B 1KLMA 4IG0A 2XWYA 4CCHA 1TL1B 1Q9XA 4ZPAA 4DG1A 1EX4A 2IA6A 4ZP9A 4CJ3A 4CJTA 4DQSA 3RB6A 3V9SA 4FS2A 3AVKA 1RBRA 4MFBB 5KFTA 3JSMA 2G8HA 2OPRA 3SFGA 4NLSA 4F2SA 2D0CA 5JS1A 3M8PA 2FVCA 1DTTA 3QEPA 3LP0B 4LQ9A 3LP3A 2FBYA 4E1NA 2YHAA 1R0AB 3O4NA 3DYAB 5HRPA 4Z4CA 1ZBFA 4WFZA 3ZSRA 2GIRA 4JRQA 1VRTA 1VSKA 3QZ8A 4DQQA 3RMAA 3MEDB 3IRXA 4N5SA 3DLGA 3F9KA 2X6NA 3QINA 1D9FA 2VG5B 4DTSA 4KHMA 3PW5A 3H40A 1JLAB 3IG1B 1HMVA 1GOCA 1HARA 1EKEA 1LW2A 5F8IA 3EPGA 3NDKA 3TQ1A 3N6NA 3HP6A 5FRMA 3KK2B 1RT3A 3OLBA 3BSOA 2JEJA 4C8MA 4Q8FA 4RZRA 3ULDA 3BREA 2W8KA 2FVPA 3PX0A 4M94A 4TXSA 3AO3A 4CEAA 3MXMA 4JRPA 2R2TA 1K1QA 4YP3A 2C2RA 1T3NA 4HTUA 1TKXA 1JX4A 4IG3B 3NF6A 5L1KA 4LSLA 2HHTA 4KO0B 4K4YA 4FZZA 3NGYA 3GIMA 3DOKA 2YKNA 2ZD1B 3DOLA 4I2QA 1T03B 4PA1A 2EC0A 1LWEB 4E1MA 3OYJA 4N56A 3WNGA 3LWMA 1HNVA 1YT3A 4F4YA 4HCCA 3RBDA 1LWFB 5D3GB 1DTQB 5EWFA 4O4GB 4CEDA 1RTIA 3NFAA 1S9EB 4I2PA 5FROA 2RDIA 4E7IA 2XCAA 3HVTA 3AO1A 4DS5A 4C8LA 2KFNA 4RW7B 2W9BB 1DLOB 1SL0A 3PX6A 1YVUA 4ZTFA 1S6QB 3AA2A 3EY1A 2HNZB 2X74A 5HRSA 1RTDB 1ZBHA 3V6DB 4E7HA 4FJIA 1S4FA 3GV7B 1S9GA 3PJWA 2NUBA 3LP2B 3AVBA 1RYSA 1BGXT 3TAEA 3GIJA 4ECSA 4DSKA 3KLGB 5DK5A 4O3NA 2DFFA 2OPSA 5SZTA 2Z1HA 3HPHA 1ZTTA 3BSCA 1IKXB 4K4UA 4CFCA 4L8RB 1TKTA 3CDUA 4WYWA 3OYKA 5K14B 5I3UB 4Q0BA 4MQ3A 5KFIA 4LH5A 2UVUA 3HPOA 4B08A 3SV3A 3KKSA 1I39A 3AVHA 2WONB 3QGGA 1BQMA 4ECZA 2XGQA 2XCPA 2AX1A 2AJQA 4NYZA 3CFRA 2G8KA 1RCHA 2ETJA 2RN2A 3H5XA 1WN7A 3I0RA 2G8IA 4LSNA 4E7LA 4JUZA 1S1XB 2Z1IA 3ZT0A 3NBPA 4M41A 3G86A 3OLAA 5KFVA 3KLFA 2WK4A 1BI4A 1RTHA 1ZBUA 3TI0A 1ZETA 4AHVA 1U45A 5KFJA 1T94A 1RBVA 1CLQA 1SH0A 1C0UB 5KFXA 3RMCA 1JLCA 3QIOA 2HVIA 4HYKA 3AVIA 2HNDB 1VSMA 4WXWA 4TY8A 1LAVA 3I0SA 3ZSOA 1Q9YA 1W0HA 2IAJB 5KTQA 1EP4A 4KHSA 3F73A 1RT4B 4KFBB 4ED7A 3PVXA 1TK8A 1FK9B 3C95A 4HHTA 4EEYA 2ZKUA 4N41A 5E41A 1Q8IA 4CEZA 5C42A 3SPZA 1QSLA
chains in the Genus database with same CATH superfamily
2WVCA 5F3ZA 1GLAG 2EVZA 3E51A 4CRJA 5KI6A 4DL0C 2GQ2A 3CGIA 3ILOA 4O3OA 2VBWA 4KH0B 2A1BA 4FP9A 4IFEA 5GADU 1H6KX 4KHRA 3QO9B 4H5RA 3CMQA 5I42B 4PXEA 3ZZOA 1HR0F 4CF2A 2WZ1A 3E8OA 2HWIA 2CZ9A 1NGAA 1N32F 5B0FA 3FFKB 4PXCA 5KFRA 2IVNA 5KFPA 4IFYA 2G4BA 4DU7A 4CJFA 3KKRA 1TFYA 3EKSA 5MAOA 5IWAJ 3B6OA 1RWUA 1AZSA 2E2OA 2WBRA 3EZUA 4DN9A 4GKJF 3OYLA 1WDDA 4FJLA 2W8LA 3SSQA 3MEEB 5DDQC 5CQGA 3LGMA 5CZ2A 4HEA9 4HDGA 7FDRA 3BBCA 1F1BB 2IVPA 3CERA 3AQOA 3MXIA 4HTLA 4QPTA 1U8WA 5AQHA 3HHKA 3MECA 3QNNA 2F65A 5J2PA 3W60A 4ED5A 3EE9A 4GMKA 4LR7A 3SLCA 3TUIC 3S8SA 3S3MA 2OO4A 2O8DB 5CR4A 2ADCA 1FJ7A 4R25A 2L3MA 3Q83A 1S48A 4X84A 1E6YA 4Q45A 3UVJA 2CPEA 4ZPDA 4WYLA 1JJ2R 2A5XA 1SJ4P 4UOGA 4MLHA 4NYFA 1RBLA 4M3ZA 3G4SS 2R8HA 2P9EA 3KLIB 3CUNA 1XQSC 2ZUGA 2HBRB 2RAQA 3CQ8A 1REVB 3UKUA 4C8NA 4AHCA 3IXQA 1FX4A 3NMRA 3BYPA 1UVJA 1PYTA 2P5GA 2P1JA 2KRBA 5AJ3F 5AQMA 5DRKA 3M05A 1SC3B 3E3XA 1S0OA 1WB9A 5B0DA 4U7BA 1CJTA 3PRDA 5AXKA 5AQJA 2AYGA 4OZ1A 1U26A 5A2QO 4IKFA 1YUWA 3IDHA 3AVGA 2HWTA 3PJ9A 5D0EA 3NF8A 1NJWA 2R9LA 3ZTSA 3CMES 1UEKA 3CQYA 4PHTX 3ZSYA 2DGVA 3TPQA 2ZVIA 3DDKA 3TUZC 3MWTA 2JWKA 5C15A 4UZCA 4H8KA 1X4EA 4DV0K 3KXDA 1MG7A 4EFHA 1IKVB 2XLIA 3AVMA 3QNOA 4DL6A 5KFEA 2DEJA 3K0JA 4DX5A 3HSZA 3B78A 3R7SB 3OUYA 3TAGA 3EZ5A 1FKOA 4GNIA 4DR4J 1YJUA 3B8AX 1SKWA 4ECUA 1WACA 4I0WA 3AVJA 3SUQA 4EFAC 4WE1B 3PO5A 3AO5A 5KQ8A 4OZ3A 5HQLA 4JI2K 3AA5X 1VBYA 4DV4K 1O1WA 3KJNB 3ZX2A 2HGLA 2Z8QA 4WFYA 2GQCA 1XR6A 4DFPA 3M30A 3A5NC 3ISND 1LEOA 4LF2A 1X3MA 2H65B 2BRKA 2HHWA 1NDKA 1SUQA 2I5JA 3FBBA 3NAHA 1XMOK 1I94F 4W90B 4KB7A 5LJ3Y 2BR0A 2QA4N 1MW7A 4LC9B 3F44A 3SQGB 3SAGA 1HBOB 4O55A 2BANA 3N4QA 3VF2A 2MLYA 2MPUA 4ISFA 2M3DA 2N3LA 1AYEA 2W9BA 1PCAA 1TR0A 4DU3A 3NBPB 4CO2A 2HHHF 1N36K 3RRHA 5KRSA 3A8JA 5D3GA 2GFFA 3D28A 4DUZJ 1YF5L 3H45C 4RW8B 1J5EF 1F2GA 4DV2J 1NPKA 3M8YA 5C0YA 2AF6A 3L4IA 1L5UA 4PQUA 3MAAA 2MMYA 1OYEA 3V81B 2CKWA 1NCLA 2GS8A 2Z57B 4LSZB 5T14A 2DYAA 3IN5A 3IS9B 5TKYA 1CQMA 1ZA1B 1LNQA 1HBNB 3CJ0A 3UW1A 2GVZB 1VCTA 4TN2A 5BPNA 4DWIA 1BISA 3IC1A 4O5FA 4ILGB 3VAGA 4RNOA 3TA2A 4J2EA 4WK1A 1IKWA 1JLCB 3NRBA 3MPVA 2DNPA 3UNGC 5AXLA 3RAXA 4DFMA 4KAZA 1JNRB 2DNYA 2F7TA 2CWXA 2HBQB 3AAQA 2OMOA 2FF6A 1DLOA 4ANEA 3VEXA 2YNIB 2BJ1A 4CK1A 1DQ8A 2XWXA 1RU1A 4IH6A 3LWLA 1RT7B 2XULA 3T41A 3PR4A 1LWFA 4OHWA 1TK0A 5CYQA 4UOCA 1VGYA 3PKMA 3OTCA 4CLFA 2GJIA 3O6WA 5AQOA 3DLEA 4Y2AA 4NXMF 3MEGA 1GMWA 5BYRA 4DV1F 3QDKA 1KVJA 2L48A 1R0BG 2RUSA 1HPZA 4PG8A 4K0KJ 2HW3A 3HVAA 3THWA 1A6LA 3KOAA 4QS8A 2HK3A 1JKHA 3GCWP 4CO0A 5KFNA 4WF9Q 4MJKA 4DG1B 1TVRB 1N88A 3VQ7A 5GAEP 1X9WA 2RKIA 4LF8K 1V9OA 3AA9A 4O3PA 4KV8B 2OZMA 4DUTA 3KIOA 3BPSP 1A9NB 2X78A 4Y3CA 4DFKA 2PC6A 3ET6B 1WKLA 4MK7A 5KT7A 4K41A 5IXUA 3J80O 1NU0A 2NZCA 4B3SJ 1DAXA 1NK4A 3O8WA 4MKAA 4Q2LA 2XY7A 2O01C 2W2PP 1F2HA 2HAFA 3CJ5A 1BA1A 2BEFA 3PIPL 4OGEA 1ICEB 1R8BA 1RHJB 3IAYA 2P5VA 3BZQA 2APOA 3SMZA 2V50A 4DF4A 1SB6A 5G4DA 4N8NA 5ETPA 1OQ6A 5J2QA 4RUCA 5KFMA 3NGRA 4ILLA 3BGFA 4DV6F 3BSNA 1CJVA 3OYIA 3KG1A 5MLCQ 4OHXA 4CJQA 4FWPA 2IGIA 4Q44A 3U1MA 2IVYA 3J7YI 3IM8A 3UN2A 1YX2A 4IFVA 4O4RA 4XO0A 4WZQA 4AH9A 4NLWA 2MLZA 2IM2A 4IRDA 4YOYA 1TYQB 4LQ3A 3KK3B 1S49A 4UQTA 4F3OA 1C1BA 3T1YF 2NXJA 3GTYX 3SUOA 1X4FA 2GC8A 3MHYA 1NHVA 2Y1IA 5KOWA 5FLXO 1LFWA 4ZVUB 3CB4A 3TR5A 4GKJK 4FLTA 1CS4A 3TJAA 2C22A 2YXLA 2R2UA 1WEZA 3G82B 1WLJA 3TSPA 5RUBA 3S3OA 1ZAVA 2P9UB 1X3NA 1KP6A 4OYPA 4GV9A 4ES1A 3Q22A 3D2EA 3OYMA 4LT6A 4W5QA 3GG4A 4CGIA 1RHKB 1BWEA 3ITHB 4NZ0A 2CYYA 4TSXA 3FZHA 3OYAA 3LAKA 1RTJB 2Z1GA 3SCLE 5KGXA 3V4MA 5FPDA 1N6QA 2B4PA 5F8LA 4DR3J 4B1YB 4DV5F 1RKIA 1HI0P 4DQ8A 1T02A 1UPPA 1U1MA 2MZSA 1NNEA 2WOMB 1GLEG 4CE9A 1SIZA 3D0PA 2D74B 2OPPB 4ZPBA 2MZRA 3HK2A 4RKUC 3SAHA 1QTNB 1FA0A 3FSYA 3OYHA 1YLXA 4E1JA 2CQCA 1M90T 3R8EA 1VSFA 4YQWA 5AQKA 2O4IA 3EPIA 3G6ES 3JAMO 1RTJA 5D4OA 2Z1JA 8AT1B 4C11A 3D6MB 4OI2A 4ISEA 5IV4A 3J7ZO 3EE3A 2IC3B 1RT6A 3GZ7A 2RDDA 1C1CB 3R27A 2D0PA 4B3SK 1S0NA 1N8RO 1NO8A 4LVNP 3PW4A 3U9ZA 3CXCR 1NUEA 1VHIA 4USWA 2MQPA 4ATNA 3SDEB 2AGOA 1FEHA 1PC5A 3CJ2A 1WBBA 3JSRA 2FLOA 3KFWX 5F0UA 1EQYA 3RBZA 5GMKa 2MSTA 3M6XA 1F21A 4BRQA 4AHSA 3LA0A 3I9V9 3VA0A 2IVMA 3OJSA 3TU5A 4JI0J 2DITA 1VQ8S 3V81A 2QWOA 2KZMA 3TARA 5DGBA 2MZ1A 1QVFR 2LA6A 4OZ0A 5F8MA 5LSOA 4C6AA 5GAEI 4PYAA 2ZM6K 1JCFA 1S57A 1Q18A 2XYGB 2DNKA 4WPAA 5A6PA 3AA4A 1TGOA 5DM7Q 2KT5A 4FJ7A 5L1JA 4LRFA 1YJNN 2PA8D 3BQ1A 3N4PA 2J8SA 3O3FA 4A8KA 2KKZA 2MKYA 4CM0A 2UV8A 4CEOA 1HD0A 2YWEA 4WU2A 3H5UA 1V3RA 4MO4A 3P83D 2W41A 1TVRA 2HQFA 5EX3A 1JJCB 3PRBA 1XBWA 2NXUA 4LD0A 3PFOA 1DGKN 4FWQA 3W8PA 3HDSA 2CGJA 5F8GA 1JJ4A 1HPMA 4FW1A 1NGHA 4P7TA 4FBUA 4M3RA 3H20A 4DR1J 4LF7K 5DQIA 2O5DA 5GIPA 3OFHA 1Z2ZA 4Z37A 2D41A 4MAKA 4X4TA 1NJZA 1WC5A 2QIFA 4B3MJ 3QERA 1S1TB 4JV5J 2OD4A 1ACMB 3A5MC 3NCPA 2QLFB 2CNLB 4ZVOB 4HL9A 4DFJA 3FSXA 2RMLA 4LRDA 3QMLA 2DJWA 2ZWHA 4W5OA 4DV2K 3KHLA 4JI3F 2I6WA 4ICLA 2CQ2A 2ZBRA 2FHJA 2MYFA 5HP1B 1P9YA 1HQEA 1XNRJ 4EMDA 1Y4ZB 2XY6A 3LZIA 2BW7A 1S79A 4JI8J 5HSPA 4BR2A 1AROP 1U02A 4IKAA 4FK2A 2DPNA 2O1PA 4M5GA 3NVKA 1FD2A 4RBUA 1GXLA 4DR1K 1JLEA 4CH1A 5LMUJ 1NMEB 3D1HA 1NSKL 1RA6A 4A61A 1TMMA 4CLLA 4WFBL 1WF2A 4M7YA 3ULEA 4BROA 2N4CA 1G2EA 2UU9F 2B4JA 4E98A 2IMOA 4BE0A 2F9WA 4PQUB 2W2NP 3LDSA 2CPXA 3PACA 5J1EA 3H59A 4C1NK 4K7QA 4F2RA 1Y5LB 4Q8EA 3TZWA 4BQZA 4JS5A 2DXEA 1OYDA 2FJVA 3HMJG 2VKZG 2HMPA 5J2MA 4BRLA 3LPYA 1C0TB 2YKQA 1D8ZA 1DY3A 3H46O 2YNGB 3E01A 4EBEA 4LMZA 5J2NA 2GJ2A 5CYJA 3MM6A 5E3RA 4BGBA 5KFSA 4AF1A 2GHVC 4FDFA 4HI2A 2PSZA 3FQKA 3VAJA 3CCTA 3FUYA 1UFKA 4QS9A 3CC7S 3VGLA 1KOHA 4O0JA 2O4GA 2ZJQL 2ZNZA 2G0IA 2Q1LA 3HHLD 2GX8A 4WF9L 3L2RA 4BC5A 4C4WA 2FLPA 5CY4A 3R3LA 3FZKA 3AVNA 3DLKB 1SJ3P 2FSNA 2GGPB 3RZAA 3Q8VA 1WC1A 1P27B 5E3QA 3GE1A 2CDQA 5M1OA 5ETRA 4PKDB 4C0BA 2CQ3A 4WQ4C 4CLZA 3VQ6A 3DN9A 1F60B 1OJ4A 2KG0A 1BA0A 3D2FA 1Q5YA 4KAIA 1OY8A 1QLNA 4I6YA 3C7NA 4NX9A 3M2RA 2QWNA 4CK2A 4OIXA 2A41A 5F8NA 4IRKA 3H5YA 4QS7A 5T7BA 1KVCA 3RB4A 2E9ZA 1U2RA 3M30B 3AVFA 3UWTA 4DV3J 4DV6K 2JJ4D 1CXQA 2Z2ZA 3UD5A 3AAWB 1UPMB 4JKEA 3QATA 2YPZA 3QWUA 3QWPA 4JI7F 1D0EA 2DO0A 3PYEA 3CPWR 3VGVA 2MTLA 5AQZA 4FYVB 1YBAA 2XMUA 2BYCA 2GIFA 4ED6A 1RT4A 3CEDA 3HP9A 3UCUP 3H3NO 4RBTA 4ZVHA 4WFAQ 2E5HA 3CJ9A 3T69A 4USIA 4JS4A 1T05B 3G71N 5M1QA 4CNZA 3O3LA 3T1HJ 3C15B 1WC6A 3KTQA 1XTZA 4V19X 1S6UA 2EFQA 5JVGQ 3C16A 3DGPB 3ZSQA 4A8WA 4IFYB 3IGVA 2FHOB 4BE2A 3T1YK 4CTAB 1FKAF 1AT1B 2BE2B 4Z2XA 3BYRA 1U6ZA 3UVJB 2UYTA 3FZLA 4CLKA 4FJJA 2YHWA 2OH2A 4A46A 4M42A 2P9PA 4IWVA 3N4WA 1M90O 5IWAK 2RQ4A 3OVNA 1FWPA 3ENOA 2YKMB 4Q2MA 3DXKA 4DSLA 3ONQA 2VGNA 2DNOA 4ITSA 1URRA 4KGVB 2XY5A 3CJSA 2J0QD 2NLWA 4B9LA 3U3GA 3ULEB 2Y3YA 2YKAA 1NK0A 1RDUA 2B4UA 4RX6A 3EVOA 4KH5A 3U8XA 3VQ4A 3DDNA 3AQPA 4U6PA 4C3KA 4DZ6A 5KG4A 5AQSA 3ID6A 4QYZK 4ED0A 3K5NA 1NKEA 5I4MA 4OL8A 1WKJA 1SCJB 2V7YA 3ZETB 4EZ6A 1KRPA 4G3IA 2MHEA 2LVWA 2DNQA 1SJFA 4M63A 3WEEB 2ZVSA 4KT0C 2KT3A 4CD1A 4J37A 1WC3A 2ILZA 3DNCA 1VIXA 2BM1A 5HO4A 3Q8RB 1HNZF 1IBMK 2OFHX 4KI4A 3AXMA 3CCRS 2BGGA 1VBKA 1XNQJ 1GMWD 2CJYB 3LF0A 4IDKB 2E5IA 2K3IA 3FQLA 4ECRA 4F3QA 5HVHA 2KLAA 1EIYB 1LWEA 3BQ0A 3EZOA 1B92A 3D5MA 2HVDA 2WC9A 3R9LA 4M3YA 5AZIA 1Q95G 1FDNA 2Y0SD 3VQCA 2PD1A 1N32K 1Y10A 4GKKJ 3LDQA 1N4LA 4ZVRB 3OTDA 3HZEA 1HBMB 3OR2A 2A0FB 2C1EB 2UXCF 1HD1A 4GMJB 1L3UA 1WHXA 3MCMA 3QGHA 2HNDA 4JD2B 5A8KB 1WEXA 2AJ2A 2E7VA 2I9SA 4NLXA 2W4DA 1BQNA 1BWVA 1D8YA 4NMXA 4FJKA 4FJ8A 3I4HX 1BQXA 2E8AA 2D69A 1P1TA 2HQIA 3QQCD 4P2MA 2ZHOA 4JKDA 5C2DA 2GAGC 4FJXA 4ZIWA 2DCLA 3Q8PB 1JIHA 3RMDA 1HKBA 2YI1A 4BC9A 4ID8A 4CVNE 1LK5A 2VG6B 2BA9A 3HI0A 2B4OA 1BQMB 1RT2B 3CD5A 4YR3A 1VQOS 4CHPA 4WP3A 3THXA 5C42B 4K8RA 4DCPB 1P8GA 3ILLA 4H5VA 1N5SA 3R1LA 3V6JA 4P75A 3DRXA 4DSEA 2WB4A 4B9MA 5B7WA 2DHAA 1RDDA 1HI1A 4FNIA 1KLMB 4M5DA 3KK2A 2VHGA 3B82A 2D9OA 4JHDB 3DI6B 5JLHA 1YHQN 4BREA 1BHLA 5KT3A 1RWMB 4DQPA 4BRHA 5AJ3K 4P10A 1MWQA 2V9WA 2PI4A 4I6WA 1LXJA 5C24A 3K58A 4M3XA 1AFIA 3QICA 4Q5VA 2WONA 4KIAA 4KJIA 1HNVB 3CWJA 2EBEA 3W64A 3L3UA 2FJAB 4JK7A 1FRKA 4K43A 5K14A 3EGVA 2QC3A 1ZZNA 4NE9C 1WF1A 1N56A 4LSLB 5ETTA 2UUTA 1D09B 2NRTA 4O23A 1RBOB 4DXLA 1FJGJ 1MA9B 3D1OA 4H4KA 4IOAL 3OW2M 4PWDB 4RW9A 1RT3B 1AXQA 3U9DA 1NU4A 2OAUA 2JHEA 2J6TA 4DL2A 3PDNA 3TP2A 3MXHP 2M7SA 4G1PA 4FWSA 2RQMA 2L9NA 4CBXA 1RADB 1TTHB 3ULHA 3L2QA 1Q4RA 2PIIA 2RHSB 3JQMA 4CIGA 5KT5A 4LY7A 3R6GB 1FRIA 3M1VA 3OFFA 2V5HG 1FFGB 5A2QU 3NXZA 4EBDA 4LF4K 2J0XA 4QWAA 3AVCA 4LRBA 3C6UA 1QAIA 1RAAB 3BS9A 3RB0A 2PYJA 2J9DA 3LTOA 1JXLA 1NGEA 5C2CA 1XIQA 4LBHA 5A0YA 3J81U 4F4XA 4HACA 2FIUA 3O3GA 1X0FA 2LU1A 2BUNA 2LA4A 3M8PB 1D9DA 3OSPA 2DCUB 4NEZA 4ZA1A 1S3XA 1RAHB 5LMUF 1HYSB 2ASDA 5GADP 4FLUA 1JLBB 4DLGA 1RCXB 3CCLN 2LP4A 1TUWA 4CCHA 1FX2A 4DG1A 2MJUA 4ZVQB 3KWIA 2KM8C 4CJTA 1M5HA 1AUSL 1YZ6A 2G8HA 2M8DB 2PT0A 1I51B 1GQEA 2D0CA 2FVCA 3FBCA 3RW7A 2F4VF 1WSVA 5D4PA 3EICA 2RRAA 3LP3A 3NMUA 1I1GA 5A0YB 4ZKAA 1GLBG 1R0AB 2HBKA 4JV5F 1CJKB 1SKUB 5HRPA 4WFZA 1Z6RA 2GIRA 3EXCX 4JRQA 3BZKA 4KHPK 4K5RA 3QZ8A 2SXLA 4V1Ak 3CDBA 2R7RA 2X6NA 1D9FA 4YB6A 2VG5B 5ADXA 4DTSA 2HFOA 4X64K 4KHMA 2KJWA 1EKEA 1LW2A 4YB1P 2D4WA 5F8IA 4DX8H 3D54A 1FNMA 4FWLA 3KK2B 1EZZB 3HHEA 3OLBA 4ZDNA 1WOOA 4C8MA 5A8KA 4RZRA 3O1WA 2W8KA 2FVPA 3MXMA 2KXFA 2KHCA 4OX6A 2MZQA 3OR2B 5AQWA 4A57A 2LEPA 4OMFG 3BF4A 4E8UA 1TUUA 3BP8A 3GIMA 2ACMA 2CAJA 4I2QA 1T03B 2HQDA 3IMXA 4E1MA 3OYJA 1KQKA 2WSFC 1GXUA 5HMYA 1HNVA 2GO9A 1MWZA 1NGFA 1BHNA 4F4YA 1RHRB 2FZCB 5DS7A 2DR5A 2WVFA 2QO3A 4XTTA 3Q0AA 3JS9A 1M5VC 1DTQB 4ETXA 4NXNF 4O4GB 1IVZA 5AQRA 2RRNA 2PFUA 5FROA 3J7AP 4E7IA 1B0PA 4JI0F 1H38A 2Q3PA 4DS5A 3AO1A 2KFNA 4RW7B 2EFPA 5CH7B 2W9BB 3OA9A 3MUVP 1QAYA 5AQVA 1HKCA 1X9JA 1S12A 4ILMA 3V6DB 1FW6A 3AB4B 2M88A 3PJWA 3W5XA 2OKQA 1J6ZA 5JLFA 1NMNA 1IR2A 3AVBA 1RYSA 1HR0J 3LM9A 2MQ8A 1BGXT 3JB9k 2UUCF 1LCUA 1WC0A 2HVZA 2PN6A 2OPSA 1TELA 2PA3A 1B0TA 1F6TA 1VJWA 1J27A 3HPHA 1IKXB 3QNWB 4HHUA 4RUBA 3CDUA 4LIWA 5K8NA 5EN1A 3OYKA 5K14B 1Q8LA 1RGVA 4MQ3A 1NRKA 1WEYA 2DHXA 3KKSA 3U7JA 4ER8A 3WDOA 3QGGA 1BQMA 4ECZA 3HOTA 3JSBA 2AJQA 1G6BA 3BKUA 2Y8YA 2P9LA 1DARA 2R3VA 2QN6B 3IBWA 3PFEA 3OXLA 5BJRA 4WK3A 3QJJA 1DURA 4LSNA 3AD9C 3HBTA 1S1XB 4FWKA 2Z1IA 2ZOFA 1X5PA 3TA1A 3GR0A 2YQ1A 3CPEA 2B51A 3MM9B 4DR7K 2G13A 3U27A 5K8OA 1ZETA 1MROB 1T94A 1CLQA 5KFXA 1JLCA 2HK2A 3MUTP 4F4AA 3BN7A 4HYKA 3W8GA 1VSMA 2ASOA 3QRRA 2Q36A 3I0SA 1Q9YA 5JVHL 2FZGB 1HNXJ 1EP4A 3MM7A 5DJBA 4LFAJ 4QR1A 5IS2A 4ED7A 1B3TA 4NEYA 1NSQA 4HHTA 4KBOA 5A2QY 2UXCK 3BBBA 3RSEA 1X31C 4OYIA 2G0JA 3DLEB 4QWCA 3TABA 4WE1A 1KAXA 2CZ4A 3T1HF 4RR5A 3DFEA 2I8EA 1NK6A 3G25A 3OYCA 2O8FA 3KYLA 2P9PB 3RGIA 3IBFB 2DNMA 3GIRA 4OZ2A 1FDBA 1NNDA 2WVEA 3CYMA 1CZAN 2RH3A 4CHQA 3GL1A 4KH4A 4A62A 5KG7A 3CMAS 4L73A 1R0CB 1Z26A 3V4IB 2W42A 2ZE2A 2NREA 1KBRA 3QEIA 3GMGA 1QD1A 4ZTJA 3NH1A 4HVJA 3KK1B 3MD3A 1C0FA 1RAJA 4UQGA 2W40A 1S4EA 2DPJA 4CWBA 4Z4IA 3DLKA 4USJC 5BRFA 2RF2B 2UUBK 4J9MA 1VQON 2HQGA 2DHGA 4YY3F 4FPRA 1M1GA 4ZP8A 5HBMA 4TNOA 2J9CA 4J9SA 2CJKA 3KLHA 4ZCKA 2DEIA 2DGWA 5KG6A 2FVRA 2RU3A 4B3SF 1OSDA 1NSAA 2BJ7A 3VERA 3TX0A 2ACYA 3E1YA 4NLGA 1J5EJ 3DRSA 2DRBA 2WRMA 3GFYA 3MPWA 3NHGA 1AFJA 1AZSB 5B0EA 2OPQB 3OYDA 3SJJA 4OZ5A 4B3RK 2GVDA 4OLPA 2GWJA 3ZZYA 5GAGP 5J2MB 3NWRA 1QHTA 4USMA 3TVYA 2NRWA 3CMAN 3MUMP 1GX6A 4I4BA 2XO7A 3LP1B 3DRSB 2O8FB 1T05A 3CDEA 1N5YA 4A8XA 4DPOA 2VONA 2OFGX 2VASA 4USHA 2BKNA 2QKBA 2ZDOA 1Y97A 3CCSS 4H0OA 3I5AA 2QWQA 1OMSA 2ATQA 2QLXA 2W2QP 3GP9A 1GNKA 4QIGA 4BR9A 4DMZA 2YCHA 4JI5J 3OL9A 3P4IA 4E7JA 4DI6A 3NMAA 1SIWB 3QT8A 1SQKA 2A42A 1HHQA 4CGDA 5BXIA 4LFBJ 1IKVA 1V3SA 3R3TA 1YVNA 1I3OB 1GEHA 3VQPA 3MD1A 5SWMA 4ZJQA 2HIYA 3GFZA 1U6FA 3PW0A 4CYUB 3T5JA 3UCZP 2R7XA 3C7NB 3RVCA 1F0XA 1DZ5A 3F5TA 3OL7A 4OYWA 3AH6A 4HT5A 2QI2A 3JTOA 3OJUA 1FWKA 4QW9A 1FWLA 4H4KC 4C97A 4R0EA 4H4MA 4ALZA 3VQQA 2VOPA 3F9MA 2K3KA 1RAIB 1CULA 2YWHA 2NZTA 1U2VB 3NAEA 2XBPA 2ZH3A 2OI2A 2R8KA 4KY3A 2EG2A 4K4SA 3C46A 3N01A 2D3O1 4IZ9A 5AQGA 3MPUB 4TQSA 3R1XA 3NG8A 1I3AA 2VD3A 1BIZA 5I3UA 2GUIA 3HSCA 5KAKA 3A5LC 2QG9B 4OYMA 2UXDJ 2VWBA 2HFVA 4USVA 1YI2S 2F4VJ 5CZXA 5DLGA 2PAVA 3FKBA 2RILA 2IBKA 1YDLA 1MMNA 3T1AA 2DFHA 4PPZA 1PJ7A 2FD2A 4TY8B 2D3UA 4BC2A 3FJ2A 2LSNA 4RW4B 4WYBA 3U6FA 2FC8A 4MIWA 4YOUA 4H03B 4B3TJ 2RB7A 1FXXA 3D7EO 4YOWA 2QFIA 3D2FB 2AKWB 4ED8A 4F4WA 2P9NB 1NAQA 2OTJS 3I55N 4TU8A 3QPIA 2UU9K 5DG8A 1S72S 4ED1A 4PKGA 1GK8A 4ZN3A 1VBZA 2IYGA 3D2WA 4ZPCA 2XSJA 1OIAA 2H3GX 1S59A 2YNHA 2FC0A 4L3KA 1UKUA 2N4DA 4IO1A 4CZGA 3CIZA 2VB6A 1VQ6N 1OVQA 2KM8B 2DPIA 3VALA 4LFCJ 3R7BB 1MN9A 2C28A 3OL8A 5C25B 4CHZA 2IAJA 3E2EA 4E89A 5GAHP 2MB0B 2HS3A 2DNNA 5D4NA 5HANA 3ZSZA 3BQ2A 4FJ5A 4F4ZA 1RDCA 2XZWA 4CZMA 4YR0A 4URGA 2QMXA 3GG1A 5B09A 1EAYC 4PG4A 4B9NA 2GJFA 2QLWA 3AA3A 4NXNK 2NRHA 5LM7E 2NQPA 3BB5A 3L8BA 4B3TK 2G8FA 3UN5A 1ZM9A 4K5SA 1LK7A 2R4FA 4A4JA 4ELUA 4QWDA 3R7NB 2JEFA 2EK6A 5KOXA 3QGIA 1FRLA 3R9PA 3QEXA 4JKBA 2X51A 3HLUA 4G1QA 4CJLA 4B1XB 4CIEA 3Q8UA 3G10A 2E7XA 2I1RA 2IIRA 2JRSA 3H1QA 4P52A 4QR0A 3HT3A 3OW2R 1WI6A 1WSIA 3M6GA 4I68A 2DVIA 1D3WA 2HHXA 1RWPB 3I0SB 1VK8A 4H5WA 2M4MA 2VBXA 4W5NA 1S9FA 5FDLA 3PKYA 1IBKF 1C0UA 3QMQA 4NZ6A 1XN9A 3V6DA 3R2CJ 2VPZB 4QZVB 3CG7A 2NSBA 3B4DA 1ZBIA 5EDWA 1L3SA 4PWWA 4RBVA 4OKJA 2AX0A 3CHWA 2KB2A 4URQU 2FJBB 1WD6A 4Q7AA 4WXOA 3R5AA 1N5QA 5JXSA 4GW6A 2AGPA 3FE1A 4OPJA 1OQ3A 4U67Q 5KG0A 4CF9A 4OI3A 1GLCG 1GTEA 2ZBQA 1HW8A 3CMEN 3IWNC 4C0OC 4DR7F 2JSXA 3ILIA 4QWEA 3QFHA 4L76A 4IEIA 4X4VA 2XNQA 4H0XB 1T9YA 4JK8A 3HVWA 1ILYA 3DOKB 4EU0A 2CUYA 2VA3A 1N54B 4FYXB 3NF7A 1R43A 3KLEB 3W2VA 5AQFA 5AQQA 1QM9A 5CZ1A 3OSNA 3QT5A 3CCJN 2AQ4A 3VESA 1VQ9N 1ZBSA 1SC4B 2VPYB 4NI2B 3KD5E 7FD1A 4TLRA 4BDYA 5LL6d 1B7FA 4R5PB 3DLHA 3TR8A 5SUHA 3PM9A 3ZNUA 4LUBA 3BH7B 4OI1A 4X65K 1HWKA 4FXWA 1RBTA 4QIFA 5DG7A 4LF6J 2BUPA 2GX9A 2QWPA 3JAMY 1RT5B 3QLHA 3NNHA 4GVLA 2GMJA 1K8KB 3CM6A 3M8QA 2AYMA 4B3RJ 3RWUA 1QVGR 1B9FA 2GA7A 4M3TA 4P74A 2HFZA 4BG9A 4P2SA 2R7TA 4V19S 4YDXA 3BM7A 4J9NA 3TRGA 3EVWA 4ID1A 1Q79A 3CJCA 5C24B 2D1KA 3ZCMA 4L75A 2JVRA 4S0MA 2VDHA 1Q5VA 3BDEA 2OYQA 4AM7A 2CA9A 3L6QA 3T6BA 2HWHA 1I6JA 2JDJA 2HGMA 2L9WA 2R8GA 4IUFA 4LBIA 4JV0A 4F4KA 3EMTA 3FCWA 2WVBA 2UUBF 4PWDA 3K2YA 5K5MA 2RKIB 3MX2A 4YY3K 1F9EB 5I9EB 4B02A 4ED3A 4X66K 5JVGL 2RE1A 3CVKA 1HNZK 3C66A 1CJVB 5EX0A 4CFBA 4KR0B 3Q23A 2E6LA 4JI3K 4CT9A 1VQLS 3IG1A 5C12A 3EX7B 1W25A 2YNFA 3BEGB 4NPOA 5ETOA 1SH2A 2AV5A 4RUHA 3MEDA 3MMAA 3SQ0A 4O0IA 1CZ9A 4X65J 1T7PA 1EWRA 3H08A 3K9JA 1UOCA 4W5RA 4CO1A 2V52B 3CCQN 3QZ7A 4FYWB 2RQCA 4MKYA 1VSEA 1SKRA 5AXNA 4OJGA 1FDDA 1RT5A 1B70B 2FVSA 1SI9A 1RNHA 5DDPC 2OPRB 3CJ8A 3RB3A 4MFBA 3A0IX 3JQKA 4KKOB 5A8WB 2DTJA 4AXJA 1HHTP 2ZH8A 1HKGA 2ZOGA 1X4CA 2J0SD 1RZMA 3FSIA 4NLDA 4PL8A 2E6MA 2VV5A 1RK8A 4IRCA 3SI8A 4DV4F 3THPA 4JKCA 4W92B 4CLWA 1V5VA 2V0NA 3G82A 2H1YA 1MNEA 1PKUA 5TKWA 3MWBA 4AL5A 4FOIA 3L3VA 2IY5B 3L0QA 1ZTWA 4CW7B 1KD1O 5CE3A 2OSRA 4V19J 1WUUA 1VFJA 2AP1A 1CPZA 1U1PA 2O8EB 4B9VA 5FLXU 1SC6A 1RT2A 2ATLA 4OJHA 1C1BB 4ZLNA 2QX0A 2AGQA 4CDIA 3LDOA 1K1SA 5K9FA 1W2BM 4DSFA 4CJVA 3MTKA 2HHSA 5C10A 1NJIT 1N36F 2HHHK 2DH8A 4RJVA 3AT1B 4X62K 2XS5A 3CCWA 4FVMA 2B3TB 4NLCA 2CQPA 4X4NA 2NS1B 2BANB 4NLTA 4DMNA 1BQNB 2NXCA 1VQ4S 1LW0B 4ANCA 3UFCX 2B43A 2IS3A 1VLOA 4ZJLA 3EVMA 3BO2A 1KEKA 2KL8A 3LL3A 2CJBA 1PSDA 2E2PA 1YXQA 4E0DA 1NXIA 1WSEA 4O5BA 2OP5A 4DTNA 2VQFK 1Z4UA 1KQSR 4Z0UA 1WOPA 3UE2A 4KREA 4P2XA 1VQYA 2ZH9A 4A8SA 3NVMA 3ELHA 1VQKN 4CHNA 4NXNJ 1VSDA 4YFUA 1FKOB 2KFZA 3TZYA 4QU7A 4KHUA 2ZBCA 2HBMA 4RNFA 3W3SA 3MF5A 2FSKA 3R2DJ 1BCMA 2UUAK 1TL3A 4JI7K 1QVFM 3SI6A 2QL5B 2VFSA 3R6LB 3H2UB 4ZPVR 1JMTA 2RDJA 4CFDA 4JHDA 1EQMA 2G1DA 3IWLA 2IFXA 5G0RA 1RAEB 2B9YA 1VRUA 2D0AA 1D5AA 1SS6A 2LEAA 1UWBB 4NZ7A 5ETMA 4DV1K 1DHMA 1QQOA 1SUQB 2QSFA 5IQQA 4ECWA 4OLOA 4A47A 1FTCA 3H8YA 2G9OA 3ZX0A 4FPIA 1EWQA 2VZ9A 2AZ1A 3AOBA 3CCVS 2HZCA 1JCEA 4RLEA 2P51A 4EUVA 3M3ZA 4JI1K 4XEIA 5AZIB 4FLWA 2UU9J 4LF8F 2CWKA 2YNHB 1OKJA 4A48A 4C3LA 1YJ9N 3HF5A 4FF4A 2JNJA 5GMDA 2Z4PA 4ZJOA 3GYXB 3FCHA 5A8RA 2VICA 4DR6J 2Z2LA 4OX9K 3BKFA 2JC0A 2J6UA 3IMQJ 2V68A 2VQFJ 2EXUA 2E1AA 4UOFA 4DPUA 1DKGD 4CZHA 3FEZA 4FJNA 3LP1A 1QAJA 3FR0A 2WHOA 2NRVA 2AU0A 2I7NA 4GC6A 4J5OA 3A8EA 3B4MA 5DQHA 3HHDA 1IM4A 4ED2A 2FJXA 1XR7A 3KG4A 4OPKA 1N34K 4PUOB 4R8UA 2F4VK 3W66A 2FBXA 1VRQC 1RYRA 2J7KA 2QXLA 4C8KA 2CPYA 3IAS9 4HR2A 4PL7A 4M3UA 1S22A 4B9TA 2R7UA 1TL5A 1HBNA 2YWFA 2IDLA 4H54A 2HHHJ 4MYTA 5IT9U 3C2PA 4AFFA 3O5BA 3GJRB 3A5OC 1YBTA 2LMIA 3HX9A 4O44A 4ZHRA 1VC6A 2HLUA 3VHQA 3BJYA 3ZSXA 5H1SQ 1WNEA 2VF3A 1R8HA 1FD8A 4X64F 9RUBA 1KWMA 1ZS6A 3P6YC 3HL8A 2HFNA 3QEVA 1Q78A 3W2WA 1U4BA 3NOCA 1P8ZA 2XNRA 1QDUB 3Q8YA 4AYBD 2QYCA 1JLGA 1U0HA 2Q6BA 4IXCA 1GH8A 1M5PC 4DX6A 2PGCA 4PG6A 3UE5A 1OSCA 3KJVB 1YIJN 1OS5A 4F0HA 4U7CA 2AW0A 1K0VA 2FB0A 1BIUA 3I87A 2DTUA 3A3PB 3OV7A 4EO6A 3ZETA 3M6WA 1EO1A 2YH0A 1NKBA 4DR4F 1NGIA 3K5PA 4EWTA 4OGCA 1NEEA 1U09A 3M9OB 4U96A 4LF1A 1VMBA 2FYXA 1K0TA 1YJTA 5KFYA 1T6CA 5IT0A 3W62A 3KDOA 2B4VA 2EX3A 2L08A 2DT9A 1KC8O 3TUJC 1SBRA 4WWSA 2W25A 3W61A 2A6AA 3PW2A 1YJVA 4P9SA 2HLTA 1A7GE 3I31A 4WBFA 4U8YA 4ZHRB 2Q6CA 4USUA 3VWSA 2ERRA 8RUCA 3UQSA 3G8SA 5BREA 4FYDA 1N5YB 1XWLA 2DGOA 3CC4N 3MMVA 3TZXA 2H5JB 3VVTA 3EDQB 2AHOB 3PIOQ 2UVWA 4LF5J 3OY9A 1WTFA 2ZUAA 3WIVA 4Z4HA 1SH3A 1GLLO 4CP5A 3CCLS 2NR0A 4BVOA 1CJUB 3WC2A 1T3OA 2IDEA 4AL7A 3FZFA 4GVBA 3CCMS 1YAGA 3CF5Q 4ELVA 4YEAA 3A8KA 1BXNA 1UFWA 4N77A 1APSA 1T44A 2P6SA 3CDAA 1HLUA 5HAOA 3QSYB 1G4CA 2KH9A 2F8SA 2P9IB 3OL6A 1XMQK 4RNNA 4FWMA 4RU2A 1E4FT 2ZH5A 3RW6A 1Y11A 2Q2RA 2XMAA 5EWGA 3FRYA 4DV7J 3SQ2A 3CW2C 3M9MB 4LF5K 1IG8A 3DRPB 3DRRA 4X4RA 3M8RA 3GJSB 2QA2A 3QJPA 4LH4A 3QFWA 2YHXA 3KHYA 3DLBA 2W24A 3KLIA 1UWAA 1Y5NB 4NO7A 2MKJA 4FWRA 1HQEB 2PFFB 2XM3A 2OSQA 3T9NA 1MROA 2DK2A 2LKZA 3DLLL 3HJVA 4YOTA 4FJHA 2X7IA 4HHHA 4AE5A 2OTLS 4CJKA 3VOVA 2NYHA 3CJ4A 3HVTB 3MN5A 4ETZA 1YBUA 3TX8A 4NRUA 1FJCA 1EHWA 3CCVN 1DQAA 2RNEA 1TZ0A 3LANA 2YX7A 4KRFA 2XHBA 3GE9A 1XK8A 1H1VA 3BGOP 3C65A 1OWXA 1JCGA 4H0PA 1DEJA 1G7CB 4N7TA 4KTZA 4YOXA 4LF4F 3OT9A 5GAEU 3V1RA 2A1RA 3P5JA 3CC2N 3O1BA 2E2NA 4I9LA 4CZFA 4FVUA 6AT1B 1RE1B 3BDPA 3HSDA 2F4FA 4QAGA 5J2NB 2QLJB 1L3TA 2WTFA 2ZJQQ 2ZE2B 2Z58B 3CT9A 3KUHA 2WBNA 4PUOA 4JNEA 3W9JA 3J7AN 4CEBA 1RTDA 2IC3A 1VQKS 3PLAA 1IBMJ 4IR9A 1S7IA 1PG5B 5KFGA 2B6AA 1NK7A 3UCGA 1ULRA 4BRCA 5ETSA 3L4QA 2FJWA 3D6HB 3H2VE 3K5LA 2L41A 3CC4S 4BR4A 4A5AA 1S9EA 1FEEA 3MN6A 5KPRA 2VFRA 3QO9A 4X62F 3MR2A 4IYQA 3ZZTA 2IMWP 4CJPA 4RU9A 1VISA 1NK8A 4DPTA 1JL1A 4FK0A 3VEYA 1K8AT 3PZPA 2PMZD 1RISA 2QYGA 3DOLB 2B8QA 2E4LA 1VOMA 2B9XA 4Y1CA 1IJFB 3SUPA 3J7A1 3OS1A 3CJRA 4XPEA 3A13A 4ZVSB 1JJHA 1FK9A 1XR5A 1VSHA 4GVMA 3N79A 2X1BA 1Y5IB 4PKHA 2VQFF 3D6TB 3TWZA 4A8MP 3T5LA 4HKQA 5M1NA 5L9NA 1RWNB 5ADXH 3D2EB 4M45A 1S9GB 5G0RB 4MT1A 4I7FB 5JS2A 3HM8A 4CIOA 2YWGA 3KMQA 3J81Y 1RTHB 1HMVB 1FF2A 2F96A 3WQUA 4CLSA 1O5JA 4CJEA 3V9WA 4DV1J 1WF0A 2W9CB 2UUAF 3SZ2A 2VG5A 1WBDA 2RRBA 3T1YJ 2MQOA 5AT1B 2BE7D 2JZ5A 1FKPA 1U1NA 1IKYB 3LDLA 5DLFA 2C3PA 4CBWA 2A2CA 4ILHA 1PBUA 3UIQA 3HPGA 1UW9A 4X4OA 4CH7A 1LQ9A 1Q16B 1RA7A 3Q2SC 2XG8A 4JI7J 2UUAJ 3K8VA 4YOVA 2VH7A 5C7PA 4M5JA 4C2MA 3GJQB 2OEJA 3IGNA 3MI7X 3W9HA 2GIQA 1R7IA 2CPFA 5BR8J 3CC2S 1YITN 4M5IA 4DBQA 4A59A 2DGUA 2NCKL 3N0VA 2WCXA 2HF3A 2XY8A 4F26A 3KLEA 4MLEA 1O0PA 1X9MA 2KT2A 3PV8A 3DGVA 4FLYA 1NH8A 1RLCL 4JI6J 3HHLC 5GINA 3MTJA 2UUCK 3L7OA 5CYMA 2IJRA 1GLFO 2NPIA 1S6PB 2F8HA 2R42A 4DUYF 2IJFA 2EPIA 4CEEA 1UETA 2F63A 1R0AA 2QWRA 4YB5A 1QQCA 2QK9A 3VTIA 4QOZB 1K8KA 3VN5A 1VQ7N 3OTBA 2W9CA 2V2ZA 2PDAA 2XMMA 2YNFB 2WW4A 2LQ9A 1T9TA 3THYB 1N33J 1S10A 4YHHF 2HEKA 3O6QA 5EVZA 5FRNA 3G8TA 3UDEA 2DR9A 1TV6B 1KLMA 3P5TL 4ERDA 1TL1B 4ZPAA 4U9RA 2EK1A 1ITPA 5IT4A 3TTFA 4CJ3A 1NGCA 4BLGA 1MWYA 4FS2A 4QJVA 1RBRA 3SFGA 3MR7A 3P49B 1DTTA 3CSKA 4YHHJ 3I56S 3QEPA 3LP0B 4LQ9A 2HYIB 1ZXOA 5C2GA 2IRXA 3AD8C 2NUUG 1W2BR 1NDPA 3IR7B 4PR6A 4Z4CA 3HFVA 1ZBFA 3JQJA 2AA4A 1KKHA 1YGYA 2HQCA 5H9FK 5H9EJ 3DLLQ 2DR7A 3DLGA 3QBXA 2M0GB 1UCNA 4KH6A 4MTPA 2O3DA 2H5EA 2LQ8A 4I64A 1YRXA 3IA0A 1JLAB 4JB8B 5CABA 3EPGA 3CF5L 4JP8A 5T7LA 3HP6A 3F2KA 5FRMA 2VU5A 1OVYA 3HZ6A 4A2AA 2V8GA 3O9TA 3PX0A 3WBZA 2HVEA 4DR6F 4JRPA 2UV8G 5AQLA 1X5OA 1TKXA 1ELOA 4J9UE 3NF6A 1H2TZ 1V5IB 3R6MA 4KO0B 3O80A 3THXB 2YKNA 2ZD1B 3K17A 3DOLA 5HL7L 1LWEB 1X7VA 2GHPA 5FPNA 5AJ3J 2NLXA 1UVNA 1YT3A 3UB5A 4HCCA 1YRTA 5ETQA 2P8IA 2XMKA 3D67A 4IJNA 3CC7N 1WHWA 2XZDB 3MCSA 1S9EB 4KGMA 2XCAA 1IBMF 4C8LA 3U02A 3WEEA 1XMQF 4DDFA 5AQUA 1RTDB 1HI8A 1ZBHA 3HSJA 3E9OA 1RXOB 1FJEB 1GT8A 2QL7B 2DH7A 1KS2A 3MZIA 4LF5F 5IC6B 3BBFA 1R3NA 2HS4A 3GIJA 2FUG9 2QMWA 1UVLA 3KLGB 5GAHI 4OX7A 4O3NA 3F56A 4DHVA 2DFFA 2N7YA 2V6AA 5AZJA 1RSCA 2BACA 1B99A 5F2RA 4L8RB 3H90A 4H0VB 1HA1A 3OXFA 2XYHB 4Q0BA 4XH4A 3VMFB 3HPOA 4B08A 4OFZA 1I39A 3AVHA 2WONB 4DUYJ 1F5CA 3MOJB 3AFGA 1GXTA 4ES2A 2X3DA 2G8KA 3W3DA 1U2VA 2KVIA 4WQ5A 1SJ1A 2WSEC 3H5XA 2RN2A 1WN7A 2OGUA 3I0RA 5DDOC 2R7VA 4E7LA 4JUZA 1OH7A 2VC1A 5KFVA 2QM1A 1U1LA 4DPYA 2WK4A 5LL6Z 3PTWA 3TI0A 5FJ4A 2FXUA 2ZEJA 3QIOA 5U47A 3MMCB 3A8IA 3QFPA 1ZA2B 5LOQA 3DXMA 5AXMA 2A40A 2MKHA 5AQPA 3CD6S 2JLFA 1EB0A 3F73A 4KFBB 2QRRA 3THWB 4DCOB 3PVXA 2Y9HA 1FK9B 4N41A 3O08A 1Q8BA 2VJUA 5C42A 3PSFA 4YDUA 4OV6A 2NRZA 3DJCA 2QE5A 5JUMA 1VLYA 4W4MA 4DCJB 4TKTA 4NWBA 1M0SA 1KDNA 4M1KA 1UA1A 4FLVA 4KTWA 2CQIA 3Q8SB 3RBEA 2FZKB 4X66F 3TAFA 2YJEA 1GTHA 3R5JB 3HKWA 4GVBB 5F0XA 2OA8A 2KDOA 5AE2A 3ZT2A 4OKEA 5HMZA 3FZ2A 2MGZA 2CQ1A 1IWGA 1RBAA 5HQMA 4XAKA 3JSYA 2CFXA 2IVOA 3L2UA 3C15A 4LREA 3D3BJ 1R8CA 3AY0A 1RILA 4B9QA 3S1TA 1YZ7A 4OYBA 3S7RA 4PRFA 3HSTB 4NYOA 4J2DA 2GUPA 1NHUA 2MZTA 1TP7A 3SSRA 2G8UA 3WNHA 1NB7A 3UKRA 3M2VB 1RACB 1NZ8A 3HULA 5B0CA 3DHWC 5L9XA 3ICLA 3BGLA 3M4XA 2BKOA 4O44B 3GYGA 4MDBA 3FEXB 5LJ5Y 2DO4A 3I55S 2K8GA 4M95A 2X1GA 3DXKB 4NB4A 2PYLA 1FVQA 5HI7A 2AD9A 2P9IA 3I5CA 3AJDA 3CXCM 5M1KA 5DZ6A 5MLCV 1EETB 4H4MB 2FLLA 2ZJPQ 4FNHA 1FI4A 4HUGA 3K5MA 5GVQA 2HURA 2GZOA 3ID8A 3VQ8A 1UJ5A 1WUAA 1C0TA 4CF1A 3VEZA 2O8CB 3QETA 2AJ1A 5DDRC 4FKXA 1Q86O 5KFKA 2C3YA 3RJMB 1G3OA 2P9KB 2DIUA 3KDNA 1JLGB 1NPRA 4H4OA 1X9SA 4X64J 3TANA 3JYTA 3DOMB 4B3OB 1K8AO 2E66A 4NASA 5AFUA 3MDFA 3N28A 1JXVA 2Y1RI 2BJDA 4B3TF 3EO3A 1KD1T 2QWMA 1N5VA 2B0GA 3M2VA 2LCWA 1VR6A 4LF6F 2NNWA 3CFPA 2AYBA 1ASUA 4Z4GA 3JYTB 5D15A 1IH7A 1VSIA 1U1OA 2BJEA 4DKWA 4H4OB 2P9KA 1OY6A 3H1VX 4NL5A 3PYFA 3ILJA 2F3JA 2F1FA 1NJIO 1LWCB 5L1LA 3WQPA 4USTA 1QHAA 3KHGA 1SAZA 3MMJA 2YNGA 3E01B 1U25A 2PFDA 5JJBA 1PILA 4KHPF 3Q7BA 3J81O 2DGQA 4DUYK 4HUEA 3SCIE 3WUHA 4ZCMA 5M1FA 3C16B 3GYNA 2V9KA 1T0TV 2YPYA 4OI0A 5M2UA 1VQ5S 1GMVA 1UA0A 4KBIA 1HNIB 1SV5B 1WG1A 5D0RA 3G6YA 3QRPA 4WKRA 5HMWA 2NSCA 5CD4A 1SL1A 3OPKA 4LF8J 2J9DE 2N7CA 4Y2KA 3MECB 4P71A 4BCAA 2VL1A 4RL1A 3TVKA 4O3RA 3EL2A 2DRAA 2W2MP 3QT7A 4Q0BB 4ELTA 5BN9A 4J9PA 2VFVA 3P38A 2RF2A 3HD1A 2IVFB 5KFDA 4B3OA 3ZX3A 3EUNA 2CQBA 4MMOA 2YJFA 4QBUA 2FGOA 3TUPA 3ZXWA 2D5RA 4RW6B 2CQDA 2CNNB 2IDOA 4C8OA 4WFNQ 3O1LA 3VEOA 2BOPA 4HDHA 3MR6A 3EM1A 4AHTA 4I67A 1HBUA 5E3CA 3KZBA 5IM0A 1M1KT 2Z30B 1BUXA 3MMCA 1QAXA 4A8OA 3U3YA 1FRJA 2AEJA 3C0BA 1RWOB 2ILYA 2RS2A 1BI4B 3CCRN 1R6VA 2H3EB 2VJVA 2WUSA 5AQXA 4K8XA 4JI1F 1FJGK 4CLUA 1XERA 2RJZA 2DY4A 1NKCA 4EZ9A 5HL7Q 3BR8A 3C19A 3EYZA 1R8AA 2CNKB 5IV3A 4E2FB 3WXMB 4X65F 3VZHA 2GGPA 3P8BB 4M3WA 3HJFA 2BE9B 2EFNA 4OX9F 3PIOL 2O8EA 2YBVA 4OVLA 3G6XA 4OJRA 2CQ4A 2XI3A 3QAUA 3FLCO 4N76A 2DNZA 1XNRK 3FFIB 1S77D 2P6TA 4KYZA 4AQYJ 3GBTA 4BR5A 2XO6A 2P9CA 1VS3A 1Y64A 2R7QA 3E66A 5KFAA 4IOXA 4FZXC 2KXHA 1UWBA 4R79A 1C4AA 3PEHA 1FVSA 1U6BA 4H0TB 5H9EK 5T7LB 3VGSA 4TY9A 2M2BA 2HNZA 4ZLLA 2HF4A 3L2WA 2WTUA 1N36J 4LFCF 4FJGA 1S6QA 4CZKA 4BRMA 4QPXA 5C2FA 2BJ3A 2C2EA 2XGPA 4I2PB 2GHWA 1BE4A 3R5BA 1Q8KA 2CDRB 4OPAA 3GSIA 1FE0A 4K25A 1HWUA 4KHWA 1EXQA 2VCPA 3U4LA 1H73A 3D0IE 3DYAA 4FO0A 1GFWB 1KONA 4CEQA 1QSYA 1S5JA 3VA3A 2HHUA 1U2CA 4CESA 4UW2A 1N6QB 2N3OA 1KOOA 3LAMA 1BWFO 1U8SA 4JI2J 2UUWA 1N33K 3VQAA 2LQ5A 3EGNA 3CI5A 2G8VA 1PYOB 3VCDA 3VVUA 3F0NA 1QUVA 4M5HA 4CJ7A 3CDWA 3WNFA 2QT7A 2Z2MA 1RWVB 3NNCA 1IM6A 2FHKA 3EGZA 3PYDA 2IJNA 2ZNYA 1NM1A 4NCBA 1BLUA 3BR9A 3M8SA 4F25A 3W63A 2D1CA 3KLFB 5JVHQ 4LFAK 4FCYA 3UR0A 1HNXK 1PYSB 2COLA 4DL7A 1BCOA 2ASMA 1Q86T 3NGDA 1EARA 1XI1A 5GIOA 1DTQA 2BJ8A 3QIPA 1JXBA 4ZLJA 1QTMA 4DR7J 3L3CA 3RUBL 2MY8A 2HIQA 3I9ZA 4FM1A 1IBLK 3P96A 4F0MA 3SIPB 2XS7A 2P5OA 2Y1JA 4BC4A 4ECXA 5HJYA 2AZ3A 1KC8T 5F3TA 1CXUA 2WFBA 2W1BA 4IFVB 3A2FA 4BRDA 5AZJB 3HVRA 1NZAA 4GRSA 3RU0A 1J5OB 4BRFA 1TAQA 3SQ1A 2L9DA 2IOCA 4Q43A 4FBTA 4LFBF 4IEEA 3THTA 2ASLA 3NY0A 3CJBA 2G1HA 4M5MA 2P9UA 5A8WA 2EI5A 3AAPA 1HQUA 2FHJD 1M1HA 1VSLA 4X4PA 2YH1A 5THWA 1S1WA 3KHRA 3P4UB 1W97L 1OPZA 4FZYA 4ID5A 4ZVPB 5L39A 1Y3KA 1RAFB 5M2RA 4B3RF 5LJVA 1KSPA 3D0GE 1LWXA 1Y3JA 2WW8A 3EJMA 3HCXA 2WOMA 4WFBQ 1P6TA 5M2PA 1TYQA 4WIIA 4XK8C 3MFIA 1JLFB 1HQUB 1N48A 2C2MB 2H4WB 1VQ7S 1T6DA 3OVSA 4PG5A 1VHFA 4UUXA 2CPDA 4BR7A 1QJHA 4ZITA 3OXGA 4GKJJ 3TSQA 3PW7A 1FFSB 1JLBA 3QGPA 3LH2S 4K50A 1LW2B 4CF8A 2Q79A 4O3SA 1TKZB 4DPWA 3FMWA 3ENAA 3PY8A 1Q82O 3THYA 1IR0A 5J2QB 5AQYA 2OZSA 4ECVA 3E9LA 1H0HB 3H42A 3S01A 4CGGA 2VC0A 1WG4A 3I33A 4U7UK 1IJEB 2HZAA 2PMWA 3QSIA 4CO5A 2RT3A 4DPXA 4EYIB 2K2PA 5CYMB 3QIPB 1LFPA 4DTMA 4JKFA 1BD6A 4J9KA 2KFYA 3GU0A 3OVAA 2PO4A 1S1WB 4GY2B 5M1PA 3CJKA 1IBLJ 2YNIA 4YUDA 1JLQA 2YTCA 2BABA 4FS1A 4U8VA 5IOLA 2ROPA 1N0VC 3CD7A 1TKZA 2W4CA 4J9LA 4YORA 1O51A 2EFOA 4KV8A 1ITGA 4CBUA 5KPTA 3GIIA 2ALYB 2Q31A 3THVA 1UP1A 4ZVEA 1S5ZA 1A5VA 4KHQA 1J5OA 3IR6B 1TUYA 1JJ2M 1N34F 1UJ4A 2XMVA 3AB2B 4J9VA 1CZBA 1JLFA 1CS4B 4NLBA 3ZZUA 1B9DA 1C6VA 2G0CA 2R2RA 3D1QA 4OPHA 1UL3A 4MO5A 1R27B 3B6PA 3CCES 3RR8A 2QWLA 4FM2A 1VAZA 3CIPA 1SJRA 3DU5A 2DIVA 3O9UA 4TYBA 1KXPA 2J5AA 3FVYA 3GSDA 3KKFA 1FKPB 3J81j 1T8EA 1RT7A 4FXVA 4F3TA 2P9NA 3UN3A 4ECYA 4H5TA 2ZOMA 1F5BA 2BOAA 4BS2A 4DL4A 2JLGA 2YQ0A 2ZQBA 3ENHA 5EY4A 4BACA 5LMNF 3AGKA 3IP0A 3QAEA 2NZ4A 2DY9A 1ZPWX 4RW9B 4TVAB 1FXRA 3OBIA 1ATRA 1N8RT 2P9SB 3H98A 1IBKJ 3ZZ0A 3NKYA 1UTAA 2EWHA 1FNXH 4IH5A 1RHUB 4Y0FA 3LW5C 3NL0A 4F04B 3KJQB 2XMJA 1S6OA 3PJXA 3IS9A 1HPZB 3FGUA 2LDIA 2YHBA 3CFOA 3QEWA 2FBVA 4GVEA 3LM2A 3LDPA 1JXEA 3MEGB 4ZVGA 2ZJRL 3PX4A 1BOTO 5GMEA 2X3GA 5K20B 2XLKA 3KG0A 4DQIA 3NS7B 1FT8A 1BO5O 4MYUA 2X1AA 2QEXS 3TYTA 5EU7A 4CEFA 2YKMA 5KFZA 1IKYA 4IJAA 4PKIA 2IBOA 2Q0UA 2ZC3A 1CULB 3W7BA 1FJGF 2CH6A 3VQ9A 3OTOK 1C0GA 1IXKA 2QLBB 1Z25A 3DMJA 2KJVA 2EKYA 1E4GT 3LDNA 3A4TA 2VDIA 4AUKA 1T3VA 4JI8K 1S0VA 2MDAA 3CJAA 1Y7PA 3HHLA 3DM2B 3ETOA 1CC7A 1C0MA 4J9QA 4B17A 2GTDA 3BGRB 3K57A 5AR0A 2H51B 1FO1A 3M6UA 2PBDA 2YV0X 2VFTA 1U47A 3ISNC 4ZS6A 1EJ7L 1N5TA 3CCQS 2C3OA 4B8CA 3POTA 2DXFA 2CVIA 2GW8A 2UXBK 1IBKK 3V1OA 2QSWA 2VA2A 4HUFA 5HROA 1KHWA 5B0GA 3OUYB 2BJ9A 3O9RA 2HAIA 3ETMA 3GV8B 4USKA 4Z4FA 3PYGA 1FNOA 4UT4A 1YJNS 2D7SA 3TZZA 3PSIA 3PEJA 3IAM9 4JLHA 3MXJA 1NOYA 1FCAA 4H5NA 1WSRA 5F8HA 1B64A 3R5DA 3V2UC 4PXBA 3VF4A 3LGHA 1NH7A 3HOSA 1UFLA 1WOQA 4HH1A 4UY85 3J8AA 5IT9O 4NCGA 2DH9A 2JWLA 5BRHA 3DGPA 4CYUA 2XHCA 3N5FA 3GCXP 2OPQA 2ZH7A 1U04A 1NDLA 2BBEA 4MKBA 1YIJS 4KE5A 2HRUA 4BWJA 3LALA 2H5IB 2CPZA 1HIYA 2V4RA 1M5SA 2GBZA 5IZHA 3OS2A 4E3SA 4DTXA 2ZH4A 1ZM3A 4AXIA 3UKRB 2UXDF 2VUGA 3DHXA 5DG9A 8ATCB 2XSJB 1N34J 2XI2A 3HZGA 5DO2A 3G71S 4ES3A 4JI6K 4FN5A 2RS8A 4Y2CA 1F3FA 1HNXF 4J2BA 3GLJA 4ILRA 3AJ2A 1VK0A 4K4XA 5LXRA 4FJ9A 5HK4A 4Y6IA 1RBSA 1UVIA 4NRTA 5FPMA 2GMHA 4AHRA 2K7JA 2CQGA 3OBYA 4KPCA 3Q2TC 1AW0A 3MMBA 1MU2B 2X1FA 4AHUA 3KJFB 2EKNA 3M2RB 4F9OA 4ANDA 3VQSA 3OYEA 4URSA 1XNQK 1X4HA 3PRVA 1JK9B 5BR8K 2VG7A 2FLNA 1IBLF 3JXUA 4GV6A 4RUAA 5L8RC 1HBUB 1K9MT 4F36A 2HS0A 3IFEA 2NYIA 3MOZA 3I32A 2OMLA 3VQBA 1W7AA 4CGHA 2D3OR 1CC8A <