3DRRA

Hiv reverse transcriptase y181c mutant in complex with inhibitor r8e
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 148
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drrA05
4HCCA 3QERA 1RA6A 2W9BB 1B9DA 3T19A 3LP2A 4YFUA 2E6MA 1QE1A 3OHBA 3UR0A 2I5JA 1WLJA 4ECSA 3SI8A 2FVSA 5FDLA 4J9LA 1IKVA 1JLFB 4IG0B 1HPZB 2IJNA 4BWMA 3KLGB 4FK0A 1N6QA 4CGGA 4DQRA 3SI6A 2IS3A 1LW2B 4IR1A 1D9DA 3SUNA 5JS1A 2X6SA 1FKPA 2UUTA 4F8RA 4FW1A 2VG6B 4Z0UA 3ITHA 4AH9A 1TKTA 1D9FA 4TY8A 3G0ZA 1REVB 2YNGB 4E1MA 1RYSA 3DMJA 2P5OA 1J53A 3CM6A 4LQ9A 3ASMA 3QGIA 1EX4A 4CJSA 4CJVA 2G8FA 1HMVA 3HVAA 4O44A 3PJXA 3Q8PB 4RUCA 2XY5A 4FJ5A 4CIEA 3L2WA 3SQ1A 3KLIA 5J1EB 2UVRA 4ZPBA 2DPJA 3BSOA 4FYDA 3HPHA 3PZPA 4K4SA 3K5NA 4MK8A 1J54A 1D0EA 4EZ6A 1RDBA 4J2AA 3B6PA 1LAVA 2FLPA 3HKWA 3KK3B 4CK3A 1IKYA 4K4VA 2R8JA 1C0MA 4DLGA 5KFNA 5J2PB 2F8EX 3OYGA 3PX6A 4KHUA 3KNAA 4DL6A 1DLOA 4FM1A 3KD5E 1RBVA 1HYSB 4MK7A 1RTIA 3IG1B 3CO9A 3ZSYA 2NUBA 4PQUA 1RCHA 4Z4CA 1TK8A 3AVIA 3DRRB 1QAJA 3KKSA 2PY5A 2WONA 4RNHA 3AO5A 3RTVA 4RNOA 1N4LA 4EEYA 4ZTFA 4ZP7A 1S10A 3LP3A 2BGGA 4NLSA 1GX5A 4KHQA 3KJVB 5KFPA 1U4BA 3OYDA 4FM0A 3QNNA 4FLZA 1VSMA 3MFHA 3PV8A 2YKMB 5KT4A 1WSHA 3K5LA 4RG8A 3RMCA 4NRUA 1VSHA 1QSSA 2FLLA 3HVWA 3AA3A 4RW7A 4B3OA 3QYYA 4W5NA 3RAXA 4Y3CA 2J6TA 3PW5A 4IFYB 3DYAB 4O4GB 4NLUA 4KBIA 1QAIA 3PHEA 4XPCA 2C2DA 3PX4A 4NCBA 1IH7A 1RT5A 1WN7A 1S6QB 5T14A 4M3TA 4G1QA 4ECUA 4Z4FA 2G8UA 3ZT1A 2RPIA 1NOZA 4FJHA 2GBZA 4CHNA 4EYIB 2AU0A 3OVNA 1CLQA 1B92A 4ELTA 4WXWA 1B9FA 4B9VA 4N76A 2WONB 4RW6B 1JLEB 1S1TA 4KB7A 3AV9A 2BQRA 3DOLA 1ASUA 5CY4A 1ZBUA 5J2QA 1X9SA 4EZ9A 4DTSA 4NLDA 4K4XA 4M3WA 4NCGB 3SQ2A 4Z4GA 3U3GA 5L1IA 5EWEA 2R2TA 2AGPA 1D1UA 3T5LA 3N6MA 1C1BB 2IM2A 3OYHA 4JS5A 4TN2A 4OL8A 2Z1JA 3LWLA 3NGIA 2F8SA 3BDPA 4F4XA 3V6JA 2HHSA 3TAPA 3SQ4A 5K14B 3L2VA 1Q9XA 1TKZB 3T5JA 3SCXA 5FROA 2W9CB 3RMAA 4PUOB 4J9KA 3CJ3A 4Y2CA 1ZETA 2J6UA 4CIGA 2DY4A 4DTNA 2EC0A 1JLQA 5F8NA 3PW4A 2PYLA 2ETJA 4DFPA 3AVHA 3JSMA 3OJSA 4ED0A 4GC7A 3EZ5A 2E4LA 3IGVA 4YNQA 4ZMMA 2IBKA 3G6YA 1YTAA 4LSNA 1XHZA 4FVMA 1ZYQA 3TR8A 3SYZA 4O0IA 4KTQA 5DG8A 3DLBA 1HNIA 5KI6A 4U7CA 2VA2A 2RF2A 3SJJA 3BSNA 1JLGB 4DU1A 1HYVA 3NKYA 3VQ8A 4NLXA 4EYHB 1UOCA 5KFXA 1NK4A 4ZP6A 2C28A 4ZPCA 3AA4A 4EP4A 5HLFB 3E01B 4OKKA 4KSEB 4IBNA 4EP5A 3L2RA 3LAKA 4E19A 3H5YA 5DGAA 3M8PA 1IKWA 4FJKA 3PO4A 5KFVA 3IAYA 4CF2A 2HMIB 4EBEA 3V81A 4F2SA 3KIOA 3AO1A 3EPIA 4DTUA 4M42A 4Q45A 5KT3A 3CIZA 5CZ1A 4C8KA 3S9HA 3V6HA 1VSJA 2VG5B 4FBTA 3V9SA 3MEEA 3VQ6A 2OPSA 3RAQA 3WNHA 3CVKA 4Z4IA 4IG3A 1UA0A 3DLRA 4FLUA 3GIIA 3FQLA 4FLWA 3KLVA 4CGFA 3Q8QB 5KFRA 1RDCA 4QAGA 5KFYA 4M3XA 4B9MA 3BSCA 3C6TB 3M8PB 2ILZA 4ZP9A 1ITGA 4LH4A 3V9UA 3TAEA 4Z4EA 1FKOB 1RT2A 4ZPAA 3EY1A 1U49A 3UPFA 3BSAA 1BCMA 2WRMA 5DG9A 3CYMA 4DTMA 3CFPA 3OLBA 1HRHA 4E0DA 1RTDA 3QETA 2KZZA 2Z1HA 1RTHA 1T03A 3DLEA 5C25A 1JXBA 5HBMB 4Q0BA 3MR2A 3ZSRA 5KFJA 3TARA 1SH3A 2QXFA 4DSEA 3KLHB 1WSEA 2VWJA 1VSIA 4PWDA 4IFVB 1C1AA 4QWDA 3DLKA 1IM4A 4O3NA 3V9XA 1BQMB 5KFTA 4WYWA 1N5YB 1EETB 3ISNC 3LP0A 1QHTA 3V9ZA 1TVRB 3TAQA 4CHPA 1C1CB 3VQEA 3HVTA 2ZD1B 3LP1A 4Q5VA 1X1PA 2X74A 2AX1A 1RBSA 1ZBLA 4FK2A 4I7FA 3KHLA 1T3NA 4JV1A 1HNVB 2YKNA 4FJGA 5DG7A 1Q9YA 5J2NB 1GOAA 4ZVHA 2JEIA 3AO2A 3IRXA 4R5PA 1T03B 4DQQA 1KVBA 4OKJA 4ECZA 2B6AB 3HT3A 1S9GA 3CFRA 1XC9A 5KT5A 2CKWA 3OYAA 1SH2A 3VQ4A 4KO0B 4DSFA 2XY7A 1BIZA 2HNYA 2QV6A 3BR9A 4NYFA 4RUAA 1GOCA 1Z25A 5DLFA 1DTTB 4KB1A 5KG2A 2WTFA 4JV2A 1ZBFA 1HQEA 2IC3B 3KLEA 5DGBA 3RB3A 4DG1B 4I2PA 2R2RA 5EWFA 1T8EA 5KG3A 4ZTJA 2JGUA 4ZP8A 1RT1A 3V6DA 4EO8A 2G8IA 3AO4A 4CFAA 4WZQA 1S9EA 3PO5A 3VQPA 5F8GA 2HHTA 4E7LA 2FC0A 4CHYA 3MAQA 4F4KA 2YHBA 1SKRA 2W8LA 3V6KA 4CF8A 4ED6A 4NYNA 4CJ3A 4M95A 4E7JA 4LD0A 3AVNA 2YV0X 1TAQA 4J2BA 4ID5A 2W8KA 1J5OB 1TL1B 3KLFA 4CJ4A 3RR8A 2OH2A 2YNHB 3O4NA 3GIJA 2Z1IA 3QZ8A 1TL3B 5KFOA 4CFCA 1HQEB 1C0TA 1NJWA 1WSJA 1XWLA 1TAUA 2HAIA 1A5XA 4I2PB 3QIPA 1S1UA 1NHVA 3ZT0A 4KI4A 2JC0A 4JUZA 4Y2AA 2XY8A 5EU7A 3M8QB 2QK9A 2PYJA 3DI6B 3S3MA 4NLTA 3K5OA 1S9EB 2BE2B 3SQ0A 3GQCA 2HHXA 1ASWA 1RT4A 4DL7A 4GC6A 1RBTA 3MECB 3CDEA 2XCAA 2FVQA 1XHXA 3QIOA 1VRTA 3TAMB 2ZE2A 3F73A 4FJ8A 3MXJA 1YVFA 3DOKA 4IKAA 1EKEA 3OY9A 1NNDA 4ED1A 4CJEA 3K58A 1EP4B 2ILYA 2VG7A 1XI1A 5CYMB 4K50A 1RT7A 4J9OA 3TANA 2CJQA 4DSKA 2IJFA 1S1VA 2G8VA 2DFFA 3C6UB 3AVKA 4K8XA 3TI0A 4CEDA 4MKBA 3VQ7A 1LWFB 5I42A 4RZRA 4ED2A 4KHSA 1UWBA 2AQ4A 3QIPB 4YR2A 4W5OA 3NE6A 5F8HA 1O1WA 3IN5A 3OS0A 1RT6A 4CJFA 2B5JB 2A1SA 3JYTB 3ZSVA 3QLHB 5KGXA 1LWCB 5J2MA 4DTXA 4URGA 4TSXA 4QWAA 4ECTA 1CZ9A 4KAZA 4KKOA 4AHTA 2OZMA 2D3UA 4QWEA 1BQNA 4RW8A 1EXQA 1NK8A 4OPKA 3QO9B 3B6OA 4IDKB 2IDOA 4KB0A 1WSFA 3I0SB 3H59A 1OS5A 3FFIA 2WK4A 5HRPA 3ALYA 5KG6A 5HROA 1RTJA 4DF4A 3EYZA 5C42B 1RT7B 3CJ0A 3NCIA 1R0AB 1KHWA 4E7HA 4NLRA 2FBYA 3K2PA 2JLEA 4MQ3A 4Y1CA 2OPPB 1NK5A 1JL2A 3RBDA 4CCHA 4FLXA 3M9OB 4FJ7A 3GIKA 1TKXA 4F50A 1RDAA 1C6VA 2HHUA 4FLTA 4BWJA 3G86A 4CESA 1T05B 4KFBB 3GV5B 4CE9A 2GIQA 4R8UA 3CWJA 2B43A 3LP2B 3VQ5A 1QSLA 3ZSWA 3OL9A 3K5MA 1QE1B 1UAXA 1HYZA 2I5JB 5KFUA 5FDLB 1IKVB 2HB5A 1BCOA 1VSEA 1N6QB 3VQ9A 4N56A 4IRDA 4CEEA 3UDLA 2JEGA 3VQSA 1FKPB 1VRUA 3C94A 1JLBA 4FBUA 1VSLA 4HUEA 3MEDA 3ITHB 5DMRA 2W9AA 1TKTB 2D41A 2R7YA 4DL2A 4TY8B 2HNZA 3SUOA 3N6LA 2FBVA 4CEBA 4KV8A 3DLGA 3DMJB 3FSIA 4HTUA 4LSLA 3MXIA 2B4JA 3HK2A 1HMVB 4ZHRA 3IGNA 2XI2A 4O44B 1QQCA 3HP9A 3DLHA 1JKHA 4IH7A 3KLIB 2AJQA 3OL8A 1NK9A 4DTOA 3CJ5A 4IQXA 2BRLA 4C8NA 3TVKA 2C2RA 4L8RB 4MKAA 3H4DA 4NLGA 2OA8A 1IKYB 4FCYA 1L3VA 2E9ZA 3EZUA 3FQKA 4FZXC 5KRTA 1DLOB 3SV3A 4H8KA 1NJXA 1RTIB 4H4MA 3PVXA 4F3OA 2AGQA 1W0HA 4JRPA 1LWEA 4PQUB 1XR5A 2LSNA 4WYLA 1A5VA 3VA0A 4M3ZA 3DDKA 1TQLA 3Q8RB 5CZ2A 4W5TA 4ZHRB 3H5SA 4DWIA 1SUQA 2HW3A 4IH5A 4TQRA 5KT7A 4NYZA 4CGIA 4KRFA 3I0RA 4C8LA 3HJFA 5T7BA 3O3GA 1XR7A 3HSTB 5KFKA 3ZT3A 4MIAA 2ZKUA 1WNEA 2DPIA 4O3OA 5HRNA 2IOCA 4RW7B 4B3OB 1NKEA 4BACA 4RW9A 3HP6A 3K57A 4LH5A 3LPTA 2BR0A 3L2QA 3CDWA 1RT5B 4YR0A 1S0OA 1SV5A 4G1QB 3ULDA 1NKCA 1U48A 3U3YA 3G6XA 4I9QA 1HQUA 4ELVA 4AHCA 1RYRA 1S1TB 5DLGA 4QPXA 1Q8IA 2XI3A 4K4YA 3DOLB 5L1JA 4ICLA 4DFJA 5J2QB 2Z1GA 1S4FA 4CFDA 4NLPA 5DQIA 1LV5A 4HCBA 2KZMA 2HVIA 4ECXA 3MEGA 4DLEA 1LW0A 4WFXA 4DTJA 5KFDA 4IRKA 5HP1A 3O3HA 3KOAA 4RW9B 2G8WA 4FJ9A 4Y34A 4GMJB 1FK9A 3NF6A 4ECRA 3HPOA 1TV6A 3ZT4A 3MF5A 4W5RA 3BGRA 1JL1A 3ZSOA 3P5JA 2HNDA 2D0CA 1MU2A 4IKFA 4KI6A 2UUWA 4CERA 3ISND 3OS1A 2D5RA 3IS9A 5HRSA 3S3NA 4FK4A 2OPQA 2FJXA 1MMLA 3BJYA 3AVAA 3BQ1A 1JLQB 4RW4A 4YP3A 3HO1A 4DL5A 1D8YA 5F8JA 1S6PA 3NF8A 4J9NA 3JSMB 3OS2A 2FBXA 1C0UA 4DFMA 4WE1A 4LSNB 4DS5A 1QSYA 3NL0A 3AVBA 1HNIB 1Z26A 1CSJA 4ED3A 3SUQA 3NFAA 4CHQA 3CJ4A 1JLCA 2Y1JA 3V1RA 2RF2B 5F8LA 3Q8SB 4QWCA 1ASVA 3V1QA 4G3IA 3NGYA 3I5AA 4XO0A 3E51A 3MR3A 2DFEA 3I8DA 1I3AA 1WSIA 2RN2A 5D3GA 2W7OA 1ZTWA 4DU3A 2IM0A 1BI4A 1YVUA 3IS9B 3VQBA 5DQGA 5EWGA 4URSA 1C2PA 3TAGA 1IKWB 3RR7A 3SPZA 4F4YA 3LANA 2RKIA 2KFNA 2ZQBA 2WCXA 3V81B 2X78A 3MR5A 5JUMA 4Q43A 1L3SA 2Y1IA 2V4QA 4I2QA 4QWBA 4PA1A 5KGWA 1XR6A 3H5XA 4YMEA 3V4IA 4KPYA 4O3SA 3KK1A 3KHRA 3O3FA 2KQ2A 3PY8A 3MEEB 3SNNA 2OPSB 4CF9A 2FVRA 4CGJA 2VWKA 4H4OA 3DM2A 4IG3B 4NLOA 4BE0A 3VQDA 4OJRA 1TK5A 4BE1A 1NK6A 5KFEA 4CHZA 3QNOA 4Z4HA 3SUPA 4NLQA 1KFDA 4C8MA 1S1XA 4E89A 1N56A 1RBUA 3S3OA 1RT2B 2WOMA 1KLNA 5JS2A 1TGOA 1T7PA 1NHUA 5KFQA 4O0JA 3OYCA 3QEPA 4J2EA 2FVPA 4O3PA 1SKSA 1RTDB 4IOBA 2BANA 5C24A 1RTHB 1S1WA 3HM9A 3DLEB 5C25B 3G6VA 4Q0BB 3L2UA 1VSDA 4MFBA 4E7KA 1GOBA 4B9TA 3I5BA 3CJ2A 4PWDB 1DTQA 3DLKB 3RBEA 3WNEA 1SL1A 3LWMA 3LP0B 4AHSA 4K4ZA 4CJLA 4J9PA 3ZSQA 5KT6A 4KREA 2R8GA 4ZVEA 1RAJA 4BE2A 3PUFA 3HVTB 3LP1B 4J2DA 1JLAA 3AVCA 1Y97A 4QOZB 2HWHA 4LQ3A 2OZSA 3T3FA 4JV0A 3GIMA 5KG0A 5SWMA 4I7FB 4Q8EA 3ZCMA 4DSIA 4F3TA 2YHAA 1KVCA 4QW8A 3OJUA 2YKNB 2YNFA 3IRXB 2XC9A 1U45A 4R5PB 3H40A 3RB6A 3RRGA 1K1QA 1S9GB 1HJRA 3GV8B 3HYFA 2QE5A 4BDZA 3DRSA 2D7SA 4ELUA 4TLRA 3WNGA 4RNNA 3I5CA 4DU4A 2HNYB 5KRSA 3RMDA 2XRIA 2YNIA 4CJRA 1W25A 2V9WA 4X2BA 4F4ZA 4AHUA 1WNSA 4JRQA 3KK2A 3KLEB 4EO6A 3AVJA 3OL7A 4CECA 3KMSA 4FS1A 2XGPA 3OHAA 4UQGA 4IH6A 2HHWA 1RT1B 3V6DB 4ECQA 4OVLA 1RDDA 5HRRA 5KFIA 4CJQA 4OPJA 3CQ8A 1BHLA 4KHNA 4FLVA 5CYQA 1J9AA 3NF9A 1RA7A 5I3UA 3LZJA 1SKWA 2BQUA 5KFWA 4ED8A 4E1NA 5KG5A 4N41A 4ID5B 2W9BA 2YNIB 4I9LA 3KLFB 1S48A 2V0NA 2HHVA 4E7IA 1JLFA 4IG0A 1C0TB 3KHGA 2F96A 1HPZA 2XY6A 3KLGA 3BQ0A 3OYNA 4NLYA 2HWIA 1S1UB 1JIHA 1LW2A 4MH8A 4MK9A 5L1LA 3SFUA 1BL3A 2VG6A 2XWYA 4B9SA 4OGCA 1WSGA 1REVA 2YNGA 5KG1A 3M8SA 2E6LA 5KT2A 1SL0A 3AVGA 4Q8FA 4ZPDA 1RT4B 4CK2A 3SV4A 4DL4A 4CGHA 1NK0A 3THVA 3KD1E 1VRTB 4YR3A 2ZE2B 4FZYA 3D28A 1RNHA 3PR4A 3VA3A 4DSLA 5KFCA 1IG9A 1CZBA 5JXSA 3DOKB 5J1EA 4OGEA 4JS4A 3G10A 2VG7B 2GV9A 3OL6A 4NLWA 2AX0A 2ASDA 5F8IA 2VA3A 1S1VB 4M94A 3SZ2A 2ALZA 3OYLA 5KFGA 3KK3A 4IRCA 5I42B 1UWBB 4HVJA 5J2PA 3QGGA 2UVWA 3QEIA 1RT6B 1QS4A 1TKDA 1BISA 5J2MB 1HYSA 3IG1A 2XO7A 4KKOB 4OLAA 3OYIA 1A5WA 3V1OA 4CJTA 1BQNB 4RW8B 4EBCA 4E3SA 4R0EA 3L8BA 2JEFA 3DRRA 3TAFA 4ECVA 1VK0A 3FFIB 1JXLA 2V4RA 5HROB 1RTJB 2D0AA 2Q3SA 3KKRA 4KHWA 3KJVA 3N6NA 4O3RA 4B8CA 3H5UA 4YQWA 4DQIA 3CDUA 4M3RA 2YKMA 4CJUA 2E9TA 3AVLA 1KSPA 2OYQA 4NRTA 4ZVFA 2R8HA 4M3UA 4KE5A 3NAIA 1TKXB 4DMNA 2G8KA 3ZSZA 2KFZA 1L3TA 4M45A 4QW9A 2IMWP 1D5AA 4IFYA 3DYAA 4O4GA 3QEXA 4J9SA 4U6PA 2P51A 4R8UB 5DK5A 5KG4A 1U04A 3KTQA 2IM1A 4CJPA 1S6QA 2W42A 3KMQA 2RDJA 3AVFA 2IGIA 5FRMA 3T1AA 3OYMA 2WB4A 1U47A 4RW6A 1JLEA 1L5UA 1VRUB 2ATLA 1CXUA 3RMBA 1JLBB 4DFKA 4KAIA 2FVCA 5KFHA 3MEDB 3LALA 1WAJA 2HNZB 3AA5X 4NCGA 3TWHA 2O4IA 4DTPA 3NBPA 3FDSA 4KV8B 3DLGB 4CF0A 3O4QA 1KCFA 4LSLB 1S5JA 3SPYA 3UIQA 1C1BA 2J6SA 4ZVGA 1KTQA 3T5HA 1JKHB 4M41A 4OKEA 4RNMA 5KFAA 5K14A 3TABA 2ASLA 3PX0A 2GC8A 4J9RA 1S0MA 1TKZA 4W5QA 4N47A 4M3YA 2P5GA 2W9CA 4PUOA 4FLYA 1SH0A 3HPGA 1SL2A 4CEFA 1NJZA 3C95A 3RB4A 1UA1A 1NKBA 3HXMA 2KW4A 4CK1A 3PW0A 4FS2A 1YTUA 3T5KA 3LZIA 4FW2A 4H4MB 3OYJA 3NBPB 5KFLA 3OSNA 3D5MA 2R2UA 1LWEB 4QCLA 3BQ2A 2FJWA 1TK0A 4PY5A 2HVHA 3NAEA 1JLGA 3NGDA 4CGDA 1SUQB 4J9QA 3QINA 2FJVA 3I0RB 4HKQA 2IM3A 5F9NA 3VN5A 2G8HA 2E9RX 2EX3A 1F21A 5HLFA 3E01A 2ATQA 2DFHA 1I6JA 4HHTA 4O55A 5FRNA 2IA6A 1VSFA 3FRZA 1IO2A 4RU9A 5EUHA 4LY7A 3AVMA 2HMIA 2EHGA 5C5JA 1T94A 3ZSXA 4FJMA 4FZZA 4WXOA 2W7PA 4CEQA 2DTUA 1SV5B 4BDYA 3LPUA 3D45A 4HUFA 3RRHA 3M9NB 3BREA 2HHQA 3KHHA 1LAWA 3QEWA 2VG5A 1G15A 5SZTA 4K8ZA 1HQUB 3P1GA 2O5DA 4DF8A 1S0NA 4FJNA 4FJJA 4H54A 4F2RA 4ICLB 5L1KA 2R2SA 1K6YA 3ZT2A 1S9FA 2UVVA 1NOYA 5KFZA 4XIUA 1X9MA 3SFGA 4B9NA 4TQSA 4B9LA 3C6TA 3H2LA 4CHOA 3MEGB 3OYKA 4KHYA 1L3UA 4CEZA 1LW0B 3HHKA 4WFZA 4B9UA 4GVMA 1FKOA 5HP1B 1JX4A 1FK9B 2C22A 1TV6B 3NH2A 3HL8A 3BGRB 3VQQA 2HNDB 4HUGA 1I39A 4FM2A 1MU2B 4AHRA 1X9WA 3H98A 4DS4A 4N5SA 5KFMA 3ICLA 5HBMA 5EDWA 3NF7A 2OPQB 4FJLA 5KTQA 3U6FA 3KLHA 4GW6A 2BQ3A 4RW4B 4DQSA 1S49A 4IFVA 4XPEA 4HYKA 1S6PB 4WZMA 1RBRA 4CF1A 1BQMA 5F8MA 1N5YA 1EETA 2R8IA 3LAMA 4KTWA 4AHVA 2F8TA 1TVRA 4B08A 4FXDA 4ID1A 1C1CA 4K4UA 1C0UB 4WE1B 2ZD1A 5KFSA 3QESA 2JC1A 4CJ5A 1TP7A 1CXQA 4DTRA 1JLCB 3QZ7A 3PW2A 4DEZA 2GUIA 1HNVA 1N48A 3F9KA 5J2NA 2RDIA 3NGZA 1RT3A 5D3GB 2X6NA 4CEOA 4J9MA 2OPRA 1BI4B 2D0BA 2O4GA 3L3UA 3UQSA 1IKXA 2QKBA 2ITGA 2B6AA 2XCPA 3OYFA 4K4WA 3GYNA 4F4WA 3QEVA 4EBDA 2ASJA 4KO0A 1RDRA 1BIUA 1Z4UA 3AA2A 2RKIB 2C2EA 4JLHA 1ZBIA 5L9XA 4Y1DA 1DTTA 1U09A 4I2QB 3VQAA 4CJWA 2QKKA 2IC3A 3HVRA 3AO3A 3V4IB 4DG1A 4DL3A 3KK1B 5KFBA 2GIRA 4H4OB 1KRPA 2I1RA 5DQHA 3DM2B 1ZTTA 4DSJA 3QGHA 1JXEA 1RT3B 3NH0A 2OPRB 4KHRA 4FJXA 4TY9A 2KTQA 5E41A 1IKXB 3D0PA 1S1XB 3NHGA 3V9WA 1RILA 2WOMB 4RNFA 1J5OA 3PR5B 1TL1A 3GILA 2D3ZA 1QTMA 4OLBA 3CFOA 2BRKA 3H4BA 2YNHA 3GV7B 1K1SA 4WFYA 4KTZA 4AILC 3RB0A 2BANB 1TL3A 5C24B 1S1WB 3WNFA 1NJYA 3NDKA 3A2FA 3TQ1A 4TXSA 4MFBB 4FJIA 4CFBA 2IAJA 4NZ0A 3M8QA 1DTQB 3DI6A 2BE2A 1KVAA 4NLVA 2JEJA 3MECA 1W9HA 4DQPA 1JLAB 1KFSA 3DRPA 4MIBA 3OYEA 4CJKA 3TAMA 3OLAA 3PJWA 1NK7A 5KG7A 3NAHA 4CEAA 3K59A 3EPGA 2PZSA 5F9LA 3H08A 2AWZA 2BDPA 1EP4A 3MXMA 5CYMA 2YNFB 3MTKA 4TYBA 1KLMA 2XHBA 3C6UA 3P83D 3RWUA 1LWFA 4O3QA 3NMAA 4TYAA 1VSKA 3CM5A 2IAJB 1ZBHA 3OYBA 3DRSB 1S97A 2WHOA 2B5JA 3JYTA 3QLHA 2XGQA 1LWCA 4ECYA 1YT3A 4BDPA 1WAFA 3MFIA 3OSPA 3L3VA 2AGOA 1KHVA 4O4RA 3VQCA 1BGXT 3KK2B 3QO9A 3DRPB 4IDKA 1QUVA 3I0SA 4O5BA 4B8AB 3PW7A 4C8OA 3MR6A 5KFFA 1GX6A 5C42A 2A1RA 4IR9A 3QIDA 2UVUA 4ECWA 4K4TA 2FLNA 1R0AA 3LDSA 4CIFA 1KLMB 3M9MB 4NCAA 3NH1A 1FXXA 3CG7A 1HARA 2OPPA 2FBTA 5CYQB 2R8KA 4Q44A 5I3UB 4KHMA 3M8RA 4ED7A 1T05A 4KFBA 4URQU 2P1JA
chains in the Genus database with same CATH superfamily
4HCCA 3QERA 1RA6A 3T19A 5AQIA 4J37A 2I9SA 1DURA 1F9HA 1QE1A 3WX8A 1OH5A 1NGAA 2I5JA 1EQYA 3SI8A 1IKVA 2BBEA 1KVJA 1E3MA 2BTFA 4BWMA 4DU8A 4CGGA 2R3VA 3SI6A 2IS3A 1G1XA 3TTDA 3WIUA 5JS1A 2HHHJ 4A8WA 4LF6J 1FKPA 4FKXA 4BR7A 1TKTA 3MN7A 4X4SA 4PCQA 4WTOB 2ZOMA 2FUG9 1P1LA 3ASMA 4CJVA 4FYVB 2HS3A 1ZM2A 2G8FA 5DO2A 2FHOB 2O8EA 3Q8PB 1CJKB 5K8PA 2XY5A 1ZBTA 4QR2A 2DGTA 4ES1A 3NRBA 5J1EB 2YVSA 2RB7A 4Y00A 3HPHA 1SC1B 1XMQK 2YI1A 3CJAA 1D0EA 1YF5L 2YQ1A 1SIZA 2Q97A 5KFNA 2BH1A 1N32F 2H3GX 4QYZJ 1DLOA 1U25A 4BC9A 1RBVA 1HYSB 4MK7A 4DR4K 1FJCA 2NUBA 1UVJA 1KQGB 1TK8A 3ZX2A 1HPMA 1HWUA 4DPYA 3T69A 4ZPTR 3KKSA 2GGPA 4M5KA 2PY5A 2MJNA 4EEYA 1C4AA 4NLSA 1GXLA 2DTJA 2A5XA 1U4BA 3LDLA 4OI1A 2R7RA 1VSMA 4X65K 2Y8YA 1N34K 2BOPA 4PXDA 1WSHA 3K5LA 2DBBA 4ISGA 2PO4A 4NRUA 1QSSA 3GG0A 2NRRA 5EXWA 1SZ2A 4W5NA 3PW5A 3DYAB 3R5DA 1QAIA 4XPCA 2C2DA 2QA4N 4NCBA 4F0KA 1KC8T 1RT5A 5DM6Q 1AYEA 3VAKA 3S41A 3ZT1A 3UO0A 1SB6A 1CS4A 1YJUA 1FEHA 3MM6A 3BYPA 2Z58B 4X4OA 4WXWA 4C97A 4LF7F 4NE9C 2BQRA 1SC4B 3DOLA 2MMYA 2M7SA 4DTSA 1TU0B 3EEQA 2XSFA 3CCSN 1ZM3A 5THWA 4M3WA 4ZJQA 3EGZA 1YDLA 3N5BA 2ERRA 2R2TA 1BUXA 4CI0B 4TU7A 2DKOB 2I2YA 4DPTA 4M5JA 2Z1JA 4RUBA 4DR5F 1BC6A 2F8SA 2ABYA 2J0WA 3GFHA 3TAPA 2DGVA 2ZDPA 4JOUA 1Q78A 3SCXA 1HFEL 2X51A 3OUYB 2J6UA 4AL5A 3RSEB 2B7BB 3AVHA 3PSIA 3OJSA 3DFEA 2GEMA 1LXNA 3N79A 4YDXA 3L3CA 1YTAA 4OHWA 3SYZA 2MQLA 4ISEA 5HQ8A 1G2EA 2NRXA 1UW4A 3L4QA 3ZO7A 2CQCA 3MHYA 5KI6A 4BR9A 4DN0A 5ETPA 2YX1A 3THXA 1GLAG 2L08A 2ZBCA 7FD1A 2CG4A 1HNXF 4ZP6A 1WC6A 1JXVA 4NA1A 4C1NK 1T44A 3NXZA 1NGBA 4H0PA 4HWIA 3H5YA 2KJVA 1IKWA 1F60B 4QR0A 3G71S 3CHWA 2XULA 3PO4A 3QRRA 2ZDOA 5KFVA 4HI1A 3LM2A 2HMIB 1Z1ZA 3Q24A 1NU4A 2DNNA 3V81A 3RUBL 2EEYA 2HLTA 3AO1A 3C46A 1HKCA 4GKKJ 1VSJA 1PO6A 3W64A 3T1HK 2VG5B 4LJMA 4FBTA 3V9SA 2E5LJ 2QSWA 2OPSA 1O6XA 2ZH9A 1CJVA 4PR6A 3WXJA 5KPRA 2A42A 4UOHA 1HBOA 3KG1A 4FLWA 3KLVA 1HHQA 5KFRA 2E2OA 5KFYA 3A8EA 2E5GA 4M3XA 4OPAA 2UXBF 1YTYA 4ZP9A 5JVGL 4Z4EA 1FKOB 4ZPAA 3CJRA 3EY1A 2ZVIA 3UPFA 1HQ2A 4IEIA 5KOXA 2XZWA 1YX2A 5I9EB 1FX4A 2KZZA 4PZVA 2Z1HA 1RTHA 2XTJP 2GO8A 2HFOA 4JI2K 1UCNA 5F0WA 1XNRJ 2LQ8A 4FWSA 3DLEA 2C3OA 5T7LA 1SH3A 4DSEA 2ZM6K 2QTWA 3Q2SC 1WSEA 1HBNB 2VWJA 4PWDA 3W9IA 3DGPB 5KOWA 3V9XA 1N5YB 3LP0A 3A3PB 4KT0C 3TAQA 5C15A 4CHPA 2Q6BA 4I68A 4FXVA 2IHR1 3CGIA 3VQEA 1QY7A 4DR2F 2MQ8A 4B1WB 5ETNA 5A8RA 1Y10A 2KG1A 2QSFA 1WF0A 2C2OB 3J81Y 2AX1A 1RBSA 3LM9A 1VK3A 3QT8A 3BGOP 4J9VA 2ZZNA 2KDOA 2OMOA 4FJGA 3I33A 5J2NB 1RP5A 5AQMA 4JB8B 2JEIA 1NDPA 3WIVA 2X7IA 4CZLA 7AT1B 3HHEA 1KVBA 2B6AB 2HHHF 3U1NA 4LF6F 2BX6A 2WFBA 3BR9A 3BZQA 3JSRA 4K0KJ 1DTTB 2JRSA 2FLOA 5KG2A 3P5TL 3T7ZA 2O8BB 1HQEA 5DGBA 3HM8A 3RB3A 3WT0A 3P8BB 1OIAA 3NWRA 5AE2A 2XNQA 3LL3A 2K3IA 3D54A 3QFWA 1T9WA 3JSYA 4ILRA 4EO8A 2IIHA 2GQQA 2CH5A 3BM7A 1S76D 3VQPA 4E7LA 4F4KA 1B0TA 3V6KA 1VQ4N 5AQJA 4LD0A 1JCGA 3IRWP 3M8ZA 4J2BA 4ID5A 2W8KA 1J5OB 3OW2R 1TL1B 5B0CA 3OD2A 4WP8A 2YNHB 4DR7K 3O4NA 1CBKA 1FDBA 2Q6CA 4CZCA 4BRQA 1C0TA 2Z0GA 4QIEA 1XWLA 1TAUA 2HAIA 3B4DA 3MPDA 2OIHA 3R6MA 4JUZA 2A6MA 4LFBJ 4ZLNA 2QK9A 4UOCA 3CIMA 4OHZA 4NLTA 3M2VB 4CBXA 1I94K 3U7JA 1RT4A 4Z2XA 3MECB 2BV3A 3CDEA 2XCAA 3UCGA 2E1MC 2C3YA 3TAMB 5J1PA 3KJFB 5LSRA 2HFUA 2Q1NA 5IT9O 1EKEA 2AYMA 1NNDA 1NDLA 2IDLA 4CJEA 2COLA 2OHDA 2G9OA 3K58A 3TANA 4DSKA 2HSEB 2IJFA 3TUZC 1M90O 1AW0A 3OVSA 3TI0A 1LWFB 4U96A 5IT0A 3D2EA 3QIPB 2QEXS 5DM6L 1O1WA 3QBWA 4Q7AA 3ZSVA 5B8HA 4CD3A 1SI9A 4A2AA 1WHYA 4CTAA 3ZEUA 4QWAA 1JCEA 1CZ9A 5M1OA 4GV6A 1LWXA 4USTA 4BQLA 3Q7BA 5JJBA 3QO9B 4DV7J 4IO8A 4IDKB 1ZXOA 4USWA 4BG8A 1WSFA 1U2VA 2WK4A 5B0DA 3I96A 4DF4A 2M8DB 4DUZJ 2YWGA 5C42B 2LYVA 4PL7A 1V3ZA 3NCIA 5DDQC 2P9PB 3BO4A 1R0AB 1KHWA 3K2PA 4JI5J 3NGUA 3RBDA 4FLXA 2DGWA 4FLTA 3JAMU 1BOTO 3T41A 3WBZA 4ILLA 3OTEA 1K47A 2DXDA 3R9LA 5CAAA 2CYYA 2W1BA 4QU6A 3LP2B 5AXNA 1QSLA 2OMLA 1HYZA 5HVHA 3J80O 1BCOA 1N6QB 3GCWP 4N56A 1ZZFA 5LMNJ 2H3EB 3NG8A 4I69A 3SCKE 2H65B 4HUEA 4A48A 1Q7YO 1Y3JA 3W62A 2R7YA 2MZJA 4YB5A 1YUWA 3UKUB 5AQRA 3DMJB 2HYIB 2XWXA 1VQ8S 3VTIA 4O44B 4B1XB 2YWHA 2I8EA 4EWTA 2PMZD 2CH6A 4AQYK 3PKMA 1QVGR 2UUBK 2W4PA 2UUAJ 5DETA 3TWZA 4GKKF 4NLGA 1TUWA 1Y00A 3W3SA 3AARA 1L3VA 4FCYA 2NYIA 3T1YJ 2E5LF 4XTTA 1H2UX 3FQKA 3TO8A 4FZXC 5KRTA 1OVYA 5A6WA 2NREA 4H8KA 1RTIB 3RJMB 2AGQA 1W0HA 4JRPA 4NASA 1A5VA 1FCAA 2BUPA 4M3ZA 3DDKA 1EQ0A 5A8KA 4ZHRB 3RZAA 3TUIC 4DWIA 4LBIA 4J90A 4YOUA 4B1YB 5LJ5Y 4DMZA 5D6GA 4CGIA 4KRFA 4OZJA 1XR7A 3HSTB 3ZT3A 1XNRF 2YX6A 3BO2A 5HRNA 5HL7Q 1F5BA 5HQMA 1V3RA 4B3OB 3M1VA 3CDAA 4RW9A 4K7QA 2EKYA 4ZCKA 1KAXA 4LH5A 3CDWA 3S01A 3GB0A 1U1PA 1AFJA 3EO3A 2YPYA 1S0OA 4ILMA 3PEJA 2EFNA 2FJAB 1U48A 1HJOA 1X4GA 3G6XA 2N3LA 1HQUA 1HR0J 3CD0A 4ELVA 4AHCA 5L9NA 5DLGA 1XQIA 4DFJA 2MLXA 1P8GA 2Z1GA 2JSXA 1DHMA 5IWAJ 2LLZA 1GLFO 3W9JA 1LK7A 2OFHX 4EHUA 2IA0A 1SC3B 1SQFA 3MEGA 3J8AA 2DR5A 4Y6IA 5BR9A 2DHXA 3O8MA 4M5LA 4JI4K 5HP1A 2QEXN 3KOAA 4Y34A 1G7CB 3BGRA 2HNDA 4IKFA 4GRSA 4K0KF 1Z6RA 4ZDNA 2PFFB 3IS9A 3VGLA 4M5HA 1Q86O 4B3TJ 2C42A 3AVAA 3BQ1A 2DGOA 4YDDB 3SQGB 4DL5A 2ADBA 5F8JA 1NLKL 4J9NA 2FBXA 4LRDA 3DNCA 4GO5X 2CJBA 1IBKK 3WXLA 4V1Ak 4FOEA 1ZPWX 2MZ1A 3KDNA 3NL0A 3AVBA 1T9UA 5EN1A 3DLLQ 1HNIB 1ROFA 1Z26A 2PFUA 3NFAA 3V1RA 3CCRS 5F8LA 3V1QA 4QWCA 4KGXB 3WX4A 2FD2A 3NGYA 2YHXA 4BC5A 4ER8A 1WSIA 5D3GA 1IV0A 4DU3A 1K9MO 1R0CB 4USKA 4RBVA 3VQBA 3Q8YA 4TLQA 4URSA 3RR7A 1U1OA 3SPZA 1S7HA 1V3SA 4F4YA 4KBOA 2CIMA 4ZS6A 4JKEA 4JD2B 4LFBF 3M4XA 4DV6J 2RKIA 2KFNA 3IR5B 2AEJA 1NPRA 3GWCA 2R7UA 3NY0A 3MR5A 2X78A 5JUMA 4Q43A 3F5TA 3BBBA 1YITS 1XR6A 3KNGA 3KK1A 3AXMA 3HLUA 2AHOB 3O3FA 4UY85 1T02A 3MEEB 3SNNA 2VOPA 2DY9A 4OJ1A 4JI0J 4CZMA 4M63C 4LF2A 2BVZA 1FD8A 4I1TA 4BE1A 4AM7A 1Q82O 2KU7A 2J0QD 1X3NA 1KFDA 2E1YA 4OZ3A 3UDVA 1S1XA 4E89A 1N56A 1X7VA 1RBUA 1V4TA 1P27B 3MMAB 1YI2S 3IR6B 4H5TA 1NDCA 4DR6J 4BR2A 4F0HA 4O0JA 3OYCA 2FVPA 3M6XA 4CO3A 1SKSA 4N8OA 2OEJA 1N0UA 3OTBA 5C24A 2RILA 1IBLK 3VEVA 1WHXA 4NEZA 4DV7F 4IO1A 3G6VA 4Q0BB 5E3RA 4MFBA 3ILIA 2DIVA 3IC1A 4DPUA 2F63A 5GADU 1WOOA 1IUJA 1UFWA 3DLKB 5FIIA 3HFVA 4DUZF 4OYBA 4CZGA 2FF3B 4K4ZA 4CJLA 4NLBA 3I87A 4BC4A 4JI5F 4KREA 1RAJA 3PUFA 4J2DA 2NPFA 2JNJA 4KR0B 2AYBA 2OZSA 4JV0A 1S6UA 2ATCB 4F3TA 5DDOC 3L7UA 3SMSA 3VETA 4AYBD 4R5PB 3H40A 5DJBA 4FL9A 2F4VK 3FGVA 3W61A 3KDOA 2QE5A 5LMNF 4JI1K 2D7SA 4DU4A 3GYXB 2HNYB 3P4UB 2GMHA 5KRSA 4UZBA 4AFFA 2XRIA 4C11B 4FPIA 4C0HA 2YWWA 1TUGB 2X1FA 3QNWB 3GDQA 4BCAA 3KK2A 3KLEB 2HBMA 5CR4A 3OL7A 1HBUA 4CECA 1VK8A 3IXQA 4C48A 3S6EA 4OYPA 3BUZB 3W2WA 2XGPA 3WEEB 3V6DB 5E0OA 1YJWS 4OVLA 2KVIA 5GAGP 3G96A 4Q2LA 2U1AA 1OPIA 5KFIA 2HHPA 4OPJA 3CQ8A 2UUAF 2GVDA 4LRCA 1J9AA 4C7QA 2VBZA 3T1YF 1SKWA 4MLHA 2QWMA 5KFWA 5KG5A 5CHIA 2CDRB 2YNIB 3J7YI 2CGLA 1FJ7A 2F96A 3OYNA 4OYXA 4WP3A 3CC4S 1EKSA 1RZMA 2NXJA 1T0TV 3M05A 4LREA 3CCRN 1GXTA 1WSGA 3WUHA 2VDHA 3M8SA 2KHCA 2P9IB 1X60A 2MTLA 5EGYA 4BQZA 4DL4A 1NK0A 1NXIA 3PDNA 2LQ9A 4BG9A 4A8SA 1VRTB 4ZLLA 1CJKA 1EZZB 3A8KA 3GSDA 1Q18A 3VA3A 4F26A 2HZVA 4DSLA 2I6WA 3DOKB 2HGLA 5J1EA 4JS4A 3G10A 3AGRA 4USVA 2VG7B 5HL7L 4IQMA 2KT3A 3JB9k 2ROEA 2CNOB 5EX3A 1YITN 1IQTA 5KFGA 3PTWA 2H5JB 4IJNA 5I42B 2UXDK 3GOIA 1UWBB 2CJXB 4HVJA 4BRCA 1DJ0A 3R5CA 4JV5J 2HOEA 1HYSA 4PKHA 5IWAF 1MNEA 5HJYA 4KKOB 2QLFB 4K5RA 5CHCB 4EBCA 4MT1A 4R0EA 4ZN1A 3TAFA 2P8IA 1Q5VA 4C23A 1N8RO 1YI2N 3AA9A 5GIOA 2Q3SA 3L4IA 2Q0RA 3MM5B 3N6NA 3H5UA 1NEEA 1F2GA 1VQMS 4NZ7A 2E9TA 3C0BA 2MKYA 3FE1A 4ZVFA 1T6DA 4M3UA 1IBMK 4O8KA 4AE5A 2DH8A 1S7IA 4DMNA 2M9KA 1WC1A 4B3TF 3ZSZA 3H42A 2IMWP 1HIYA 4FPBA 1D5AA 3DYAA 4KH0B 1VBYA 1QTNB 4R8UB 5DK5A 4F3MA 1RWNB 3NCPA 4F02A 1BG3A 1ZZNA 5E5NA 1M5PC 3LPYA 1CJTB 1WUAA 4LT6A 2V2ZA 1U47A 5ETVA 4KH1B 1UZHA 1WJ9A 5DM7Q 3JAMO 1FE4A 5BN9A 2LFVA 2MGZB 1CXUA 1JLBB 3DLLL 2FVCA 3AAQA 1WAJA 1KWMA 3D7SB 2RHKA 1YSJA 4KV8B 3BDEA 3DLGB 2O01C 4CF0A 1GTHA 3EMTA 3KJQB 3EL2A 3R1HA 3FEZA 3Q83A 4GO7X 1JKHB 4UOGA 2F3JA 2G4BA 4DV6F 2BYCA 4DPXA 3FZLA 4OKEA 2GC8A 1WI8A 4N47A 4DUTA 1MWKA 2P5GA 4FWMA 4L76A 2XMKA 5HVFA 3OUYA 1F9FA 2RUGA 3OTCA 3HPGA 2QYGA 3RSEA 4DV4J 4CEFA 4FYXB 2YWEA 3MDQA 2R7QA 1NKBA 2NYHA 3HXMA 4JI0F 3PW0A 1YJWN 5IFMA 4FS2A 3GBTA 2G0JA 4FW2A 3NBPB 3C16B 3L09A 1TK0A 4PY5A 4XH5A 2HVHA 3FZFA 3NAEA 3CEDA 1Y5LB 4DQ8A 2CVEA 2LDYA 3KWMA 4BROA 2Y9HA 1SUQB 2VQFJ 2EG1A 4HDHA 4HKQA 1C4CA 3VN5A 2P9UB 2RSQA 2CZ4A 1VQYA 2DFHA 5ETRA 4HHTA 3HSGA 4WBFA 3TP2A 1U6FA 3CC4N 1NBWA 4FF1A 4LY7A 2FHMA 2HMIA 4XK8C 2EHGA 5C5JA 4D3GA 2GVZB 2BZ2A 5AQFA 4WXOA 1Q86T 3ZZOA 1XMBA 1MWMA 4BDYA 5CXTA 5EOYA 4X4UA 2IVMA 5BRFA 3NMUA 1B7FA 2NS1B 2VG5A 1G15A 1EO1A 3BB5A 5A0YB 1N32K 1FE0A 1RB0A 5D0GA 3QBCA 4FJNA 1BMQB 4FJJA 4ICLB 3FZBA 1OSCA 2MQQA 1NOYA 1PJ5A 4B9NA 3FEXB 5CD4A 3D2FB 3EZWA 2JHEA 3OYKA 4ZVUB 4KHYA 2CJAA 3HHKA 5LJ3Y 4GVMA 1FKOA 4U9RA 4CNZA 3HRGA 2M88A 2C22A 3DU5A 3HL8A 4AHRA 1X9WA 4DS4A 4JEPA 3RBXA 4N5SA 3ICLA 4LF1A 1C0GA 2VBXA 3ILOA 4FJLA 2FPHX 1HBNA 4GW6A 3GJQB 4RW4B 4DQSA 3SAFA 2KT5A 2ZOFA 1NPPA 2G0CA 3DGPA 3CNQP 4CF1A 1N5YA 4OV1A 5FLXU 4O23A 4FXDA 1C0UB 1VQMN 3P4IA 2N82B 1XERA 3N28A 1IJEB 5AJ3J 3CC7S 2GIFA 2JC1A 3AOCA 4P10A 3LTOA 4C0BA 4LF7K 3BBCA 2CVIA 3FSYA 5D0HA 5BREA 1Q82T 3EWGA 1FF2A 4JYAJ 1HA1A 4DCPB 5J2NA 1Z05A 3OBYA 1VBKA 4CEOA 4J9MA 4JI2J 4HL9A 5ETMA 2O4GA 3UQSA 1IKXA 2ITGA 2A41A 2EWSA 2B6AA 3OYFA 2FZCB 3GYNA 2OSRA 4F4WA 3QEVA 2UZAA 4DR5K 2CPEA 4P73A 3AA2A 2J7KA 1ZBIA 5L9XA 4CJ7A 2ZJPQ 1DTTA 2KXNB 2O8BA 1R27B 2F40A 3RYLA 5IC4B 3VQAA 4CJWA 1NHKL 3PYEA 3B54A 2NRTA 1WC5A 4WU2A 3D1HA 5CZXA 1ZTTA 4DSJA 1Q8BA 1RHKB 4LF9J 1R8HA 2QWPA 3UKRB 3PIOL 1RT3B 3D7EO 1ZAWA 3AAPA 2OSQA 3DHXA 4YY3F 4CZFA 4UT4A 3E2EA 1J5OA 4JV5F 1DARA 3U4LA 1TL1A 2D3ZA 1QTMA 1HNXK 4GVBB 2YNHA 3A3NB 3H4BA 3RB0A 2LP4A 3ENHA 3M1FA 1NJYA 4KGKA 5EX0A 3TQ1A 1ACMB 4CO1A 2IAJA 3EX7B 3G6ES 2MXYA 2M5YA 3HHLB 5AXKA 3W0LA 1MG7A 3SJHA 3HHLC 3M2VA 1NGHA 4NLVA 3W3DA 3MECA 1OMSA 4ZCLA 2YKPA 3TAMA 1PAEX 5AE1A 4QU7A 3PJWA 5I3QA 3NAHA 4OJGA 3K59A 2NXNA 2PZSA 1PC4A 2XNRA 1KLMA 5IXUA 2ZWHA 1BO5O 1LWFA 2XLIA 2VH7A 2AJ0A 2UXBK 3NMAA 1WBBA 1VS3A 3H45C 3CM5A 1ZBHA 3OYBA 2P9KB 2IPOB 2XGQA 4RKUC 4ECYA 1YT3A 1YAGA 1ZS6A 1WC0A 4GKJJ 2AGOA 4AUKA 1KHVA 4KH5A 4IXCA 5B7WA 5K8MA 1X4CA 5JLHA 4DBQA 3QO9A 4IDKA 2GWKA 3BPDA 3A5MC 2CJ9A 2AMCB 4LF5K 3AB2B 5KFFA 3TVZA 5IQQA 1EX8A 2LMIA 1NG9A 5C42A 2A1RA 4IR9A 4L3KA 2XMVA 1R0AA 1KQSM 3MPUB 4NCAA 2FY1A 2NXUA 1HARA 1MSWD 4DR2K 2FBTA 5CYQB 1FFWB 2FB0A 2R8KA 3W8GA 3M8RA 4ED7A 2HK3A 4DV4F 2E20A 2XS2A 3MAAB 3LP2A 4YFUA 2BOAA 2E6MA 5GAEP 4ECSA 2FVSA 1JLFB 4IG0B 3CC7N 1Y4ZB 1SVDA 2NUUG 1N6QA 4QPTA 3THPA 5F2RA 2HHHK 4LF6K 2UUTA 2GAHC 2KVQE 2VQFF 4JKHA 5ETLA 1FXDA 4DX5A 1Q95G 2YNGB 3UKUA 4E1MA 4CRJA 4YS2A 2C3UA 2R7OA 4IO9L 3DMJA 1J53A 3KWIA 3CD6S 4PWWA 1NB2A 2NUHA 4O44A 2A6AA 3PJXA 4RUCA 2YX4A 4EU0A 4FJ5A 2Q1LA 3L2WA 2G1DA 1DKGD 2UVRA 1FXRA 1BU6O 2DPJA 1XUPO 1RAOA 3LQVA 4YB6A 4K4SA 1T9XA 2BJ1A 1VHIA 4MK8A 1MLAA 1XC3A 4J2AA 4CBWA 2FSKA 3HKWA 4CK3A 4JKBA 2A18A 1RAGB 3GFXA 5F0UA 1X4EA 4HT7A 1WI6A 2R7TA 2HBJA 4KHUA 2Q79A 4O5FA 4QYZK 4DL6A 5D4PA 3AFGA 4P2MA 1RTIA 3IG1B 3CO9A 1H1VA 3UI3A 5K5MA 2VV5A 5AZJB 2QGFB 3W65A 1QAJA 3MX5A 2O8EB 1E4GT 4OHVA 3MM9A 3S1TA 4RNHA 3AO5A 1VI7A 2V4JB 2DGUA 3J7A1 3LP3A 2BGGA 1R6YA 1GX5A 3LO3A 3KJVB 1NM2A 3I55S 2V68A 4FLZA 4GMKA 2VICA 3MFHA 3O44A 5E3CA 4RG8A 3RMCA 4H4KC 2FLLA 3KWGA 3MN6A 4B3OA 4JK8A 3RAXA 2J6TA 3G6EN 3DJCA 2MZTA 2O3DA 4IDHA 2Z2ZA 2RQMA 1PILA 1WN7A 4A8KA 4ECUA 4FO0A 2QO3A 1CG2A 5AJ3F 2PDAA 4FJHA 2PI4A 5CE3A 2XMJA 3R5GA 2AU0A 1CLQA 1SKUB 4MMOA 1ATNA 1B92A 4B9VA 2IVFB 1WKJA 1JLEB 1VISA 4KB7A 4DX7A 1ASUA 2DNZA 4JYAF 2ZEJA 1ZBUA 1FDAA 2KB2A 2KM8B 2IVNA 2KM8C 4NCGB 2AZ3A 4M5NA 5B08A 5L1IA 1EAYC 2AGPA 2XLKA 3SSSA 4KRWA 2Y8WA 4JS5A 2OAUA 4OL8A 3C15B 3ENVA 2QLWA 4OX6A 3ATVA 4P74A 4F4XA 1GMWA 2HHSA 3SQ4A 4YDUC 3G8SA 3VAIA 3D6RA 1CS4B 5FROA 3NNHA 3C6HA 3CJ3A 4C98A 4Y2CA 2LA4A 4CM2A 4BHQA 3M8YA 2E8AA 3QSYB 1B99A 4AM6A 5F8NA 5KPZA 3PW4A 2ZJPL 3SQGA 1G3OA 2ETJA 4OZLA 4GC7A 5E26A 3JXOA 4LF9F 1ZOTA 3G82B 1ATRA 1UMJA 1RHQB 2RU9A 4FVMA 1ZYQA 4O0IA 2QW9A 2UYTA 5DG8A 4PRFA 1HNIA 2MZSA 4MKYA 2GAGC 3QMLA 3KK7A 2QA2A 4JI4J 4U7CA 2VA2A 3BSNA 2ZHOA 1KQKA 5G4DA 1HYVA 3M2RB 3NKYA 3LDQA 4EYHB 2ZF5O 3JS9A 3V2UC 2JVRA 1Q8LA 1NK4A 4DOZA 2GQ2A 3WZ0A 3GTYX 3GFZA 4OKKA 1FA0A 4FWRA 1A6LA 4X4PA 3L2RA 3LAKA 4JI3J 4E19A 5DGAA 3M8PA 3QJPA 4FJKA 1VQ6S 3C66A 4JD2A 3TUJC 4EBEA 3RW6A 3T9NA 1IBKJ 2PGCA 3MCOA 4DTUA 4Q45A 5KT3A 3CIZA 3BH7B 3H2VE 4NLCA 1URRA 4GKKK 3S9HA 3CD6N 2HQGA 3PYGA 1Y9OA 3CXCM 4CO4A 2E5LK 3MEEA 2DY1A 3VQ6A 5AQYA 1QQNA 2Y1LB 4FLUA 4M63A 4L75A 4CGFA 1RDCA 3N4PA 2MQMA 5IV3A 4ZVOB 2DD8S 1V6HA 3MMAA 3F56A 1BWFO 1ITGA 4LH4A 3CTRA 2KRBA 1RK8A 3BSAA 1VQ7S 1BCMA 5ELZA 3FFKB 3J81U 2WRMA 3BO3A 3CYMA 1TUYA 1R8PA 4DTMA 2WTUA 3SSRA 2OEMA 3ATUA 2IIRA 4GKJF 3WDOA 3QETA 4HI2A 1MN7A 1XNRK 2JFDA 4P52A 1BLUA 1SJ1A 5HBMB 4Q0BA 1NSKL 3MR2A 3TARA 3HHNB 3JQJA 1RWXB 4XEIA 4OQJA 4LRBA 1YJVA 2RS8A 1C1AA 3MTJA 4QWDA 3DLKA 3HSZA 5ADZA 1EETB 3I55N 3Q0AA 3FRYA 2CJYB 4OHXA 1SJ3P 2W4DA 1X1PA 2IVOA 1XIQA 2EFGA 2OCEA 1ZBLA 4FK2A 1NSAA 2RMLA 3P6YC 3THYB 4JV1A 1HNVB 3CSKA 5DG7A 5AQPA 1GOAA 5FLXO 4WCEQ 2J7UA 1WG5A 3AO2A 4R5PA 4JI7J 2V8HA 1SQKA 4DQQA 1S57A 1UPMB 3BS9A 4OKJA 2B4OA 1UEUA 3QAEA 1KQSR 3OYAA 2XY7A 1BIZA 2HNYA 5AQKA 4CH0S 4C11A 4RUAA 1B0PA 3KHYA 1GOCA 1Z25A 5DLFA 4K0KK 1VR6A 2V2VA 4A59A 2IC3B 3KLEA 1LKZA 2EW9A 3IO1A 1HLUA 4B3MJ 3KG0A 5MLCV 3R2DJ 3WEEA 3V6DA 2G8IA 2GQCA 2EC2A 3QRPA 3PO5A 4USUA 5F8GA 2FSJA 2HHTA 3MAQA 2FC0A 5A8WB 4ED6A 4NYNA 2D3OR 3UCUP 4CJ3A 4M95A 3W2VB 2VQEJ 1HWKA 2MKKA 3AVNA 3A12A 1X5OA 1VHFA 3GCXP 5BYQA 2P9LA 5TKWA 4CJ4A 1VLOA 2OH2A 5ETTA 3QZ8A 1UVNA 5KFOA 5LM7E 1HQEB 3SCJE 1WSJA 3JXUA 3I6PA 3R5JB 3K7RA 3HD2A 4JNEA 1XJWB 2VB6A 2JLGA 1NHVA 3HZEA 5IT9Y 3ZT0A 3C3LA 8RUCA 5MLCQ 2JC0A 1RWOB 3K2YA 5EU7A 4LFBK 2JWKA 2NSBA 1VIOA 3QT6A 3K5OA 4B1VA 2MZRA 3CERA 3SQ0A 4ED5A 2P9IA 2HHXA 4HVZA 4DL7A 2MLYA 1RBTA 3MWPA 4K2XA 1XHXA 2DHHA 1Y0HA 3R8EA 3TPQA 1VRTA 3R3LA 1WACA 1XNQJ 2K2PA 1YVFA 1VQ6N 3DOKA 3OY9A 3R1XA 2VHGA 2FC8A 1EP4B 2VG7A 5CYMB 4K50A 2CPZA 2CJQA 4BRDA 2DFFA 4K8XA 4CEDA 2XHWA 5I42A 1UWBA 1YJRA 2AQ4A 3NE6A 4CWBA 3VEYA 3IN5A 2EG2A 3OS0A 3UB5A 3BKTA 3A5OC 3L9ZA 4DTXA 3KUGA 1I1GA 1M0SA 2VFRA 4KAZA 4KKOA 3IMXA 3GJRB 4QWEA 1X4HA 1U1QA 3EKSA 3UW1A 4X4RA 4OPKA 4DV7K 1M5SA 3PG9A 1UWAA 3IWLA 2XYPB 3HF5A 2VF3A 2HVDA 2BE7D 2JFKA 4PPDA 2O8CB 1UVLA 2RUSA 3DOMB 3MM5A 3UD5A 2C2MB 1VQ7N 3EYZA 1VQNS 4DUZK 2FY8A 4NO7A 3BGLA 2CQDA 3J80Y 1N5TA 3OT9A 3EJMA 2G2ZA 1NJIO 4NLRA 2FBYA 2JLEA 4JI8F 3MUVP 4JI5K 4Y1CA 2OPPB 1A0OB 5A6PA 1NK5A 3M32B 2UXDJ 3AOAA 3GIKA 4F50A 2HHUA 1RDAA 2I38A 4RUHA 4CESA 4KFBB 5RUBA 5BN8A 4R8UA 1WD6A 5LOQA 2B43A 2RVJA 3PSFA 3ZEUB 3QRQA 3K5MA 3ZSWA 1UAXA 1TMJA 5KFUA 3CDBA 4P72A 1CJTA 1VSEA 2QFIA 4RBTA 1D8ZA 2W40A 5LMNK 1ULRA 4DL0C 2MGZA 3OVBA 1JLBA 4FBUA 3HFZB 3ITHB 3QJJA 3UCZP 8ATCB 1ZC6A 3SUOA 1WHWA 2GELA 4CEBA 1YJ9N 4KV8A 3DLGA 3FSIA 1IBMJ 4JI3F 1VBXA 1HMVB 1YLXA 4L3NA 4QBUA 3HP9A 1BWEA 3DLHA 2WBNA 1JKHA 4F36A 1QZ5A 1PC5A 4IH7A 2AJQA 1FW6A 4DTOA 1XBWA 4ZVRB 2V52B 4ED4A 5CZVA 2UUAK 2C2RA 3H4DA 1HBMA 1YZ7A 5F41A 2Q3PA 1SXLA 1NDKA 4C8ZA 1H74A 3UD4P 3T1YK 4MO4A 3U8XA 3GE9A 4TKTA 3F2KA 2NZTA 4CT9A 1GK8A 3I31A 4F3OA 4FKYA 4H0XB 3C16A 4PQUB 1XR5A 2V67A 3VA0A 2FZKB 1SJRA 2FC9A 2V94A 1U1RA 3H5SA 1GXUA 3D0HE 5KAKA 1R7IA 3WXMB 1SUQA 2HW3A 4IH5A 4BC3A 3PRDA 1WKKA 3CXCR 2P9UA 4C8LA 4FWQA 4FPAA 3MCNA 3ZX3A 2B3TB 5KFKA 2KJWA 3GR0A 5D8HB 1WNEA 2DPIA 4A2BA 4O3OA 4A8YA 1FT8A 3BF1A 5B0EA 2DXFA 5AQUA 4BACA 3K57A 1LFWA 3LPTA 2GVZA 4BY9C 2BKPA 3R6GB 4YR0A 3AQOA 5IS2A 4G1QB 3O80A 3U3YA 2LXIA 5A0YA 2L9DA 1NSQA 1Q8IA 2XI3A 3VVUA 4ICLA 1K8KB 4CFDA 1S4FA 5IWAK 2ZC4A 4JI7F 2AJFE 3D2FA 2RQ4A 1IWAA 4USHA 2HVIA 2CGKA 2JWLA 4ECXA 2QG9B 1KQFB 4DLEA 2G8WA 4RW9B 4FJ9A 2VC0A 3NF6A 1FFGB 2AYEA 2W25A 1JL1A 2LXUA 2H51B 2VJVA 4CERA 3ISND 2KO1A 2D5RA 5HRSA 4UQTA 3S3NA 1O8BA 4NYOA 3CJ1A 2H48B 2FJXA 3A0IX 4B3MF 4NXNJ 4FWOA 4RW4A 3I9ZA 3O9SA 3NF8A 3OS2A 2V50A 1VQNN 1RUSA 2CG8A 4H0VB 2AD9A 1C0UA 3IUCA 4LSNB 1VGYA 4IOAQ 5AZIB 4ED3A 3SUQA 2HS4A 2E1RA 2RJZA 2AP1A 2VQEF 2RF2B 1M1KT 3VTHA 5H1SQ 4XO0A 3E51A 2DFEA 3I8DA 2QMXA 3K9KA 1I3AA 3B4MA 2RN2A 1SQGA 1WEXA 2EFVA 5AT1B 1YVUA 2FIUA 3IS9B 3NEKA 3CMAN 4CQ1A 1CEZA 3VEXA 5L39A 3TAGA 5GAGU 1KOOA 2ZBIA 1SCJB 4DV6K 5M1QA 3MUTP 1L3SA 2DNMA 4UY8T 4QWBA 4PA1A 5KGWA 1FRLA 3E3XA 4BC7A 4ENOA 1XNQF 1RU2A 4CGJA 2VWKA 1QAXA 4JI0K 2WW8A 3H0PA 4BE0A 3A8IA 3O08A 2JL9A 3UKRA 5ETSA 2IY5B 1TK5A 4CHZA 3CQYA 3QNOA 4NLQA 3SLCA 4C8MA 1NPKA 4DHVA 4CBUA 1BQXA 1S77D 3P96A 2BACA 4DR5J 3NNCA 3BH6B 3THTA 1U1LA 1T7PA 4FOIA 3ZETB 4CDIA 1T6CA 2R9LA 1FWLA 4GVBA 4M5IA 1O13A 4QZVB 1WOQA 4L6V3 3HM9A 5C25B 2IRYA 2NRHA 4H5VA 3R8YA 2V5HG 4B9TA 1DGKN 3I5BA 2FJEB 3JQKA 2CQHA 3WNEA 3HHLA 2L9NA 1SL1A 3LWMA 2J9DE 3UE2A 4AHSA 2ADCA 4J9PA 3AT1B 1WTBA 3ZSQA 1GNKA 5KT6A 4BE2A 1BD6A 3HVTB 3LP1B 2HQCA 3AVCA 4QOZB 3DC2A 1GQEA 3T3FA 2MSTA 2HKEA 3HCXA 2YJFA 3R7SB 3H90A 3OJUA 2YKNB 4HHJA 1HNXJ 2E5JA 2O8DB 3IRXB 2XC9A 5AXLA 5LT5A 3RB6A 1N36J 3RRGA 2YQ0A 1RHMB 2AV5A 1HJRA 4BDZA 2GFFA 4ELUA 2IDEA 3I5CA 2P9KA 3MCPA 2MQNA 3RMDA 1RXOB 4EK2A 2VBYA 3P45B 4X2BA 2PBDA 3RGIA 3MCMA 4AHUA 3QT5A 1YG0A 5K8NA 3AH6A 4EO6A 3AVJA 1WEZA 4KGVB 3CJQA 1ZPVA 4Y0FA 3KMSA 2G2YA 4C3KA 3OHAA 5AQQA 4IH6A 3TA0A 2HHWA 1RT1B 3OR1B 4ECQA 2QWQA 3RU0A 4OYOA 3FJ2A 1GH8A 2IYIA 4KHNA 5CYQA 3NF9A 3SK3A 2J8SA 1WELA 2XM3A 3DRYA 2BW7A 2PD1A 2DH9A 3EKUA 2A2DA 1PKUA 4DUYJ 4N41A 3MAAA 2F4FA 4E98A 1QD1A 1NZAA 3KLFB 1MDUB 3R27A 2LQJA 2V0NA 1JLFA 4IG0A 2XY6A 1Q7LB 1IVZA 4NLYA 5HJXA 1JIHA 3EXCX 4LF5J 4MH8A 1GMVA 3SFUA 1KD1O 2XYGB 2XWYA 3SAGA 2CQIA 3MN9A 2YNGA 2BJ7A 3R5AA 5KG1A 2E6LA 5I3PA 3AVGA 3NGSA 2GVDB 4Q8FA 4ZPDA 3HULA 4CK2A 1F5CA 4MLEA 1R0BG 1LXJA 4YR3A 1YWXA 3CUNA 4F04B 4R79A 3D28A 5KFCA 1IG9A 5AQTA 2QL9B 1VQ9S 4OGEA 1WC4A 2GV9A 3CB4A 1JJ2M 3LW5C 2ASDA 5F8IA 3CC2N 2N7CA 2ALZA 2JOQA 4IRCA 3VGVA 4YY3K 3QGGA 4ZVSB 1RT6B 1A9NB 3O6WA 1HI1A 4JV5K 1QS4A 1UETA 1TKDA 4YHHJ 3GG1A 1BISA 3J7YP 4IOCQ 3MCSA 3IG1A 3OYIA 3V1OA 4CJTA 1OO0B 4RW8B 4OLPA 5AZJA 3OW2M 4FP9A 2QIFA 2J9EA 3O8WA 1RHUB 1JXLA 2V4JA 5HROB 2HRTA 1FWKA 1HWJA 2XMAA 1F1BB 3KKRA 3KJVA 1AT1B 1UEVA 2DGXA 3LGHA 3AVLA 2CJKA 4HDGA 4H4KA 2V34A 4G65A 3NAIA 2DNKA 5GAHU 2G8KA 1SBRA 3MM8B 4NXNF 1K73O 3D6TB 1NLVA 1H98A 4M45A 2F8MA 3QEXA 4J9SA 3D2WA 4E8UA 1RWUA 2RH3A 4NB4A 3D3CJ 2W42A 2HBRB 3GIRA 5B0BA 3LDOA 1TL5A 1VQ5S 1FX2A 3CCQS 5FRMA 2FGOA 3MMJA 5SUHA 3ZZRA 2J7WA 4H5NA 2MHNA 5B0GA 4F67A 2RAQA 1JLEA 4RWTA 1U2FA 2FHKA 3D3BJ 1WC3A 2DISA 1PGZA 1VRUB 4IOAL 4D3HA 5KFHA 3MEDB 1T9YA 4G1PA 5IT4A 4OZ5A 3DGVA 2H1YA 4RPFA 4NCGA 2H9ZA 3FDSA 1XTZA 4DU7A 4QQBA 3ILJA 2J6SA 3FCHA 3HZGA 3E9PA 3C15A 4OIXA 1RWWB 4YDUA 2ASLA 1F6TA 2OGUA 4CT8A 3UDEA 2IFXA 4M3YA 1R6VA 3AB4B 2FSNA 3FUYA 3MXHP 4DV4K 5AR0A 3D6HB 2QL7B 4BC2A 2KW4A 4I6YA 3AGKA 4QR1A 4EFAC 3G82A 4ZVPB 4YB1P 3T5KA 3LZIA 4H4MB 3G4SN 5CCMA 3OSNA 1P1TA 3BQ2A 1VOMA 2GO9A 2AZ1A 1IR2A 2XYHB 2I7NA 4CGDA 3M2RA 1W97L 1OH8A 2VQFK 4U8YA 1H72C 1QJHA 4P6QA 1I6JA 1CC7A 1NM1A 5FRNA 1VQ4S 1RAAB 2OFGX 2NXCA 2AEMA 1WEYA 1X5SA 3PIPQ 5DDRC 1R3NA 3CF5Q 2UV8G 2YHWA 1C0FA 3AVMA 4ZKAA 4FJMA 1JJHA 2H4YB 1KAZA 3FBCA 2DTUA 2CDQA 3A5LC 2J8AA 2V8VA 3AD9C 1Z2LA 4HUFA 2EWHA 3RRHA 2HHQA 2B4PA 3KHHA 5SZTA 1QVGM 1UFLA 4DF8A 1X5TA 1FRIA 3BY5A 5CA5A 1S5ZA 2WVCA 3FNNA 1VQ9N 2R2SA 1NMDA 4Y2IA 5HK4A 2B9XA 2QM1A 5M1FA 1KXPA 4LF8J 1N36F 3H2LA 5M2UA 2V8PA 1LW0B 4B9UA 3FMWA 2CGJA 1FK9B 2BUNA 4K8RA 2B51A 3U1LA 1S22A 3MMBB 3HSJA 4N8NA 1GLBG 4HUGA 4FM2A 2B0GA 2Q31A 2EFPA 3H98A 4U8VA 2J4RA 1YZ6A 5HBMA 5EDWA 2OPQB 5KTQA 1Q53A 4X4NA 3U6FA 2CQ0A 3VHQA 2ZGZA 5M1KA 1S6PB 1RBRA 1EETA 3MI7X 3KYLA 4Y65A 4MAKA 5D0RA 4FWPA 1RHRB 2OD4A 5AJ3K 4EMDA 3QESA 3O9RA 4CJ5A 1JB0C 3BP8A 1CXQA 1WDDA 3QZ7A 4DUYF 3QMQA 3PW2A 3ZFVA 4DEZA 3THYA 4JYAK 1HNVA 3ENWA 2RDIA 1SIWB 1VQ5N 3CCQN 2OKQA 4B3RF 4IJAA 3Q22A 2D0BA 3IWXA 3L3UA 3DXMB 2DGSA 4WQ4C 4GVLA 2QJ3A 3K0JA 2GMLA 4JBCA 4LF5F 3VGSA 4EBDA 2AJ1A 4B1ZA 5LJVA 2VC1A 1X3MA 3OR2B 4JLHA 4Z94A 4I2QB 2QKKA 1UJ6A 2IC3A 2RQKA 3HVRA 2W24A 4ZVQB 3V4IB 5LSLA 3GYGA 1JNRB 2OEKA 2CPFA 2WUSA 5GAEU 3CJTA 4H4OB 1RADB 2DITA 3DM2B 2V7ZA 2AJ4A 4LF9K 1VMBA 3QGHA 5GMDA 5GAGI 1JXEA 1BY9A 4XH1A 4DZDA 1G6BA 3VENA 1ZAXA 4TY9A 2LEBA 4Z7CA 1IKXB 1MW7A 3OXLA 1WUUA 5A8WA 9RUBA 4ETZA 1U1NA 2QA1A 4RL1A 4XH4A 2DEIA 4BRKA 1K0TA 3W2VA 2IVPA 3V9WA 2HMPA 1K0VA 4PG7A 4YHHF 3PR5B 3GILA 1HL6A 4OLBA 3CFOA 5BRDA 2MHEA 4WFYA 3PXGa 2M2BA 1S1WB 3TRGA 3NDKA 4ZPVR 4TXSA 4KC5A 4IOCL 1JJ2R 3UNYA 4X4VA 2QA4G 4ISFA 1Q1KA 4WKRA 3O5BA 3J7AP 2JEJA 4DQPA 1JLAB 4I67A 4CJKA 1B4SA 1Q8KA 3TEGA 2YKOA 3OTOJ 3IFRA 2G1HA 5KG7A 2D9OA 3EPGA 1W7AA 2VPWB 1FRMA 4CH7A 3H08A 1EP4A 3MXMA 5CYMA 2YNFB 3MTKA 2KYXA 1BXNA 1VQSA 1OPZA 2PFDA 3RWUA 4YEAA 3THWB 4TYAA 2IAJB 5FJ4A 1U0SA 5CCLA 1S97A 2HRUA 2DVIA 3P5BP 4NXMJ 2E88A 3MFIA 1M5OC 4GKJK 2XMWA 4ZCMA 4O4RA 1WTFA 1KD1T 2RNEA 3AAWB 1YXQA 4DXLA 4PKDB 5C7PA 4B8AB 3PW7A 2O8CA 3MR6A 4FNIA 2RT3A 4ANDA 3DOMA 1TR0A 4C9DA 1ATSA 1GX6A 2DXEA 4BR4A 4LBPA 2DR9A 1NAQA 5E84A 6FD1A 2MSSA 4ECWA 2FLNA 4CIFA 2XSJB 1PAUB 1KLMB 1RDUA 3CG7A 1VJQA 2OPPA 3ZZTA 3HFKA 3M32A 3VR1A 4H5WA 2LEPA 4Q44A 5I3UB 3A1YG 4KHMA 4KFBA 3S8SA 1SC6A 2W41A 3UVJB 3PJ9A 2VU5A 2FHJA 2JJ4D 2W9BB 3AODA 2W4CA 4AT1B 4A47A 3UR0A 2AJ2A 5M2RA 1RBLA 3K17A 2KFYA 4BVOA 2VODA 1HPZB 4FK0A 3GL1A 5HMYA 4DQRA 3IDHA 9ATCB 1D9DA 3SUNA 3ZTSA 2X6SA 3Q23A 2W01A 2L41A 4Z0UA 1NGEA 3ITHA 4AH9A 1SJQA 2HGNA 2KHDA 5FPEA 1REVB 4DV1J 3KUHA 2EBGA 1RYSA 5JICA 2P5OA 2Y0BB 3QGIA 3U27A 1EX4A 4CJSA 1HMVA 3CE8A 2VFTA 4K2JA 4UZCA 1RWVB 3SQ1A 4WFAQ 2CPXA 3HDSA 3BSOA 4FYDA 4AL7A 3PZPA 1SAZA 3I9V9 3K5NA 3PIPL 1J54A 2L3MA 2DEJA 2NXEA 3CF5L 1RDBA 4OV6A 4WFNQ 1RE1B 4FZVA 3B6PA 4RWWA 1LAVA 4WK3A 1C0MA 1WBDA 3NNAA 4CZHA 5J2PB 5U47A 3D6FB 2AYGA 4CP5A 4DDFA 3EM1A 1WG1A 1H7WA 2KN4A 3R5BA 3ZSYA 4PQUA 2BA9A 2IRXA 4LF8F 2CPYA 3AVIA 1T3VA 4FNHA 3BKUA 5LL6Z 2WONA 3O5TB 4RNOA 1WWHA 3MM7B 2Z56B 4ZTFA 1S10A 3FMBA 2GJ2A 3OYDA 4FM0A 1RCOB 3QNNA 3PV8A 4WP9A 4AD6A 2YKMB 1AB8A 2PIIA 2GJFA 3DAWA 3PACA 5AQLA 4CH1A 3AA3A 4A57A 1HI0P 3QYYA 2MJUA 4BLGA 4CVNE 4IFYB 4NLUA 2E7VA 2YX7A 2A3JA 1QQOA 1S6QB 1NGDA 4M3TA 2HBYB 2DYAA 4G1QA 2CPJA 1J5EJ 2G8UA 2RPIA 1NOZA 3ULHA 4CHNA 4EYIB 3P49B 4CLKA 1B9FA 2RRBA 3MM9B 3QQCD 4Y2KA 4PABA 4RW6B 3R6LB 2E5IA 3NP5A 4FDFA 5CY4A 4C6AA 4EZ9A 1K8KA 5GAHI 4X84A 4OYAA 5IC6B 3IM8A 1CQNA 1RAHB 1N0VC 3VEWA 1SJFA 4K4XA 4MO5A 1EHWA 3D1QA 3T5LA 3N6MA 4ZVTB 1C1BB 2IM2A 3A3OB 3OYHA 4TN2A 4M7YA 2OO4A 1R31A 2AW0A 3BDPA 2D1KA 2DHAA 2Z2MA 3V6JA 1U7LA 2BEFA 4HTLA 3AD8C 4K5SA 1TKZB 3T5JA 4CNYA 4JI8K 4ANCA 4J8FA 1AUSL 3RMAA 3MCAB 5LMUJ 1ZETA 4V19X 2HFSA 4RTFD 4LFAJ 3VGKA 4DFPA 3EZ5A 1MMDA 4YNQA 4LSNA 3TR8A 4KTQA 5AZIA 2FXUA 1FFSB 1TL7B 3VMFB 4A62A 3CO0P 2P9SB 3SJJA 2RF2A 1JLGB 3BF3A 4NOHA 3FZMA 1UOCA 4OFZA 2C28A 4ZPCA 3TZWA 3AA4A 2DK2A 4EP4A 3E01B 2O1PA 4KSEB 3FEYB 2GZOA 3SDEB 5HQLA 4JI3K 3PLAA 1WORA 4USIA 4ZLPA 3MOJB 1ZA2B 3ET6B 1XK8A 4CO2A 2LCWA 4P2FA 4ANEA 3KG4A 4PYAA 1PIEA 1OH6A 3EPIA 2OD6A 1XQSC 1LFPA 4DR1J 4C8KA 3R3TA 4ID8A 3V6HA 1BHNA 2CZ9A 1PG5B 2ZBRA 2H5IB 3OTOF 2F7TA 3RAQA 2E2PA 3CVKA 4Z4IA 1UA0A 3GIIA 3RRKA 3FQLA 1ZA1B 3CD5A 3Q8QB 4QAGA 2RHSB 2YKAA 2AKWB 3C6TB 1PCAA 2OTLS 3M8PB 2ILZA 3AJ1A 1CJUB 3OBIA 1U49A 3U02A 2VFUA 2NRVA 5DG9A 3ZETA 4NXMF 1ICEB 3CFPA 3S7RA 3OLBA 1HRHA 4E0DA 3EXYA 4AF1A 1KNZA 1T03A 3OBWA 4DV2K 5C25A 3UE5A 5AQZA 2QXFA 4W92B 2DRBA 3ZTPA 3OV7A 2DR7A 4OX8A 1VSIA 4IFVB 5FLXY 4CLYA 1IM4A 1URNA 1BQMB 5KFTA 3WC2A 4WYWA 3VF6A 3V9ZA 1TVRB 3Q8UA 1C1CB 1NCLA 2ZWPA 3HVTA 3LP1A 3VGMA 1VQPS 2X74A 5AQWA 2QLJB 2KG0A 3KHLA 1T3NA 3ZTQA 2QTDA 2YKNA 1Q9YA 3IBFB 3O1WA 3OVAA 4JHDB 4KGZB 4ZVHA 2O8DA 1NB7A 3IRXA 1I3OB 1LCUA 4JI7K 1PSDA 4FWNA 3SMZA 3CT9A 1M1HA 1RWMB 4ZJLA 3M2UB 3T6JA 4CLPA 4ECZA 4PG4A 4YOVA 3CFRA 4YOEA 1XC9A 5KT5A 4ERDA 3VQ4A 4KO0B 2QXLA 3BYRA 2QV6A 1PJ6A 4NYFA 1GT8A 4DV1F 4KB1A 1Y64A 3RVCA 4WKYA 1JQGA 2W2OP 5H9EK 4A8XA 2VFSA 2J9DA 4DHYA 5GIPA 4I2PA 4B3MK 4IZ9A 3J7Z5 4EFHA 1T8EA 2MKCA 4ZTJA 2JGUA 2VGMA 1RT1A 3OR1A 4DR3J 3TZXA 5EX5A 4X66J 3FBEA 1S9EA 1XN9A 2HURA 2FJDB 3O6QA 4L73A 1HWIA 2B7CB 2YHBA 5CH7B 1SKRA 2YPZA 4WFAL 4CF8A 3IWNC 4TVAB 2HVEA 2B8QA 2VQEK 3MPVA 2YV0X 1TAQA 4WU3A 3PCOB 2Y0SD 4WFNL 4UTGA 5D77A 4XAKA 3KLFA 1HLWA 3RR8A 3VEZA 2VDIA 1LOUA 2Z1IA 1TL3B 2X3GA 4CFCA 4IEEA 4WFBQ 3K9JA 2O8FB 1Y3KA 2FQQB 4PG5A 3CJSA 1QZ6A 4OZ0A 4DCOB 2IRUA 4E2FB 2WSCC 3QPIA 3DI6B 1U2CA 4QIGA 5IM0B 3VAMA 2DRDA 2BE2B 3GQCA 3LGNA 1ASWA 1HNWJ 2D74B 5E33A 4DX6A 1F0XA 3QIOA 3D0GE 3W7BA 3F73A 4FJ8A 3MXJA 1M90T 1XNQK 5BR8J 2P9LB 4U7BA 3TNVA 1RT7A 4J9OA 1J5EF 3G9CA 1LQ9A 2G8VA 1YBAA 3VESA 4MKBA 4RZRA 1L3KA 1A7GE 1S79A 2X1AA 4YR2A 4Y0WA 1KONA 2DO0A 1F9EB 4USJC 3B82A 4HHUA 1RT6A 3BGFA 2B5JB 2A1SA 2YBVA 1ZM4A 3D9BA 2ITMA 2CNLB 4ECTA 2M4MA 2YKQA 1ZH5A 4RW8A 5D4LA 5D0EA 5JMVA 4C0OC 3B6OA 2OTLN 3MGJA 2IDOA 3PIOQ 3I0SB 3R9PA 1DRZA 3ALYA 5HROA 1IN0A 2B9YA 5HVGA 2HVZA 4J7CA 5FPMA 1YKWA 3CJ0A 3HD1A 1H7XA 4FWLA 1PBAA 3ZZZA 4MQ3A 2C3MA 2HPUA 1JL2A 2ZVSA 3M9OB 4YY3J 1DQAA 3VGUA 5LMUF 3MM8A 4BWJA 3G86A 1T05B 3GV5B 3M6UA 2GIQA 4LFAF 2G13A 3R97A 1VAZA 3QFHA 3VQ5A 1I51B 3ETOA 1VC5A 3OL9A 2Z2LA 5FDLB 3EE8A 2I0XA 1U0HB 5L8RC 3H8YA 3RAMA 1Q7YT 3HI0A 3G8QA 3POTB 5E3PA 1VQPN 3VQ9A 4CEEA 3VQSA 1S99A 1VRUA 1TFWA 3MEDA 3A5NC 3QATA 2D41A 4DL2A 1R59O 4TY8B 4WPAA 1IQZA 4BBYA 3N6LA 2FBVA 4HTUA 3IGNA 2XI2A 1QQCA 5J1NA 2ZC3A 1YJNN 3EDQB 3KLIB 2VIHA 2ZJRQ 1NH8A 2DO4A 4KY3A 2BRLA 3Q89A 4ALZA 2JLFA 3ZNUA 4DR1F 4L8RB 4ATNA 2PC6A 3I4PA 4DV5K 4OI6A 2B9EA 1IKYB 3PEHA 1FRHA 5KQDA 2E9ZA 2HFVA 1Q16B 3SV3A 3VPZA 2R4FA 4OLOA 1NJXA 4H4MA 3UD3P 4P7TA 1V9OA 2GUPA 3VGTA 4CO5A 2L9WA 3QWPA 4CLWA 3Q8RB 5CZ2A 2HF4A 1GTEA 3CQXA 5A2QU 4TQRA 5KT7A 4JKAA 4EHTA 4NYZA 5BYRA 3DU6A 1OVQA 1RAIB 2YWFA 2UP1A 3HJFA 1RFQA 5DRKA 1N5SA 4MIAA 2N7YA 1HBMB 2GX8A 3JTOA 4RW7B 3HSDA 3KUEA 3SCLE 3HP6A 2BR0A 2VL1A 3L2QA 1F3VA 4C4WA 4BRPA 2YH0A 2XO6A 3ULDA 3CCES 3VWSA 3TX0A 3SXLA 4IO9Q 5CYJA 3VZHA 2QC3A 1S1TB 4G1IA 3PKYA 3TU5A 4K4YA 3CMES 4DV0F 2HLUA 5J2QB 2ZITA 1CLFA 2KZMA 4TU8A 2QMUB 4OJ3A 1TMMA 3NS6A 1LW0A 4C3LA 1CQMA 4DTJA 4IRKA 1CC8A 1X4AA 4GMJB 1FK9A 3DXBA 3SAHA 3HPOA 1P90A 3MMBA 5F0XA 3ZSOA 3P5JA 2BE9B 4B3SJ 4FF4A 2RD5C 3G8TA 2UUWA 3AXKA 2MZQA 3OS1A 4NI2B 2V9KA 2XBPA 2OPQA 4QIFA 3W5XA 4NXNK 3BJYA 1JLQB 4I6MB 3HO1A 1D8YA 1S6PA 2GJIA 4DR3F 3JSMB 1VBZA 4X66F 2G2OA 3C2PA 4NMXA 3HHDA 4DFMA 2B56A 1QSYA 3CCZA 2OUGA 3PNIA 1RAFB 1B0VA 2EFOA 3CJ4A 1CULB 5AQGA 1K9MT 2W2QP 1ASVA 3QGPA 1HI8A 4NA3A 2CUYA 4G3IA 2RS2A 5C12A 2DRAA 3CJ9A 4LUBA 3EDRB 1Q4RA 3MX2A 2W7OA 3O9TA 2IM0A 4WQ4A 4FSVA 3CCWA 3DXMA 2RHQB 5EWGA 3EICA 2F9DA 2HRYA 3K5PA 2CXEA 5DZ7A 3TTCA 1T95A 4HACB 2HQDA 3VAGA 2K3KA 4OHYA 1TUVA 3KZBA 2HBQB 2LQ5A 3TOQA 4WFBL 1VFJA 3OR2A 2WCXA 1S4EA 2J9CA 3VQTA 1FJGJ 1RSCA 1RGIA 4LRFA 3TA1A 4I2QA 2ZH7A 1HNWF 4FPRA 1H2VZ 3H5XA 1MWZA 3V4IA 3IM9A 4KPYA 4O3SA 2DIUA 3KHRA 5ITHA 3ZTRA 2KQ2A 3PY8A 2F9JA 1X4DA 4CF9A 5B09A 4CIOA 4H4OA 3M30B 4GVEA 2CQ4A 3DM2A 4IG3B 5BR8F 1UVIA 3VQDA 3FSXA 1KEKA 3LUYA 4CLLA 2RE1A 4OZ1A 3HKZD 1N33J 3DDIA 5KFEA 4LR7A 4Z4HA 3JSBA 2Q36A 3S3OA 2L48A 1RT2B 1KLNA 1TGOA 1XEZA 1NHUA 2CFXA 5KFQA 2RRAA 3GE1A 3NGKA 3D1OA 4J2EA 2A10A 1RTDB 2M70A 4IOBA 4FWKA 3PRVA 1S1WA 1HD0A 2CWXA 3OHRA 1WSRA 4V19J 1MROB 1NO8A 4E7KA 1GOBA 3N9UC 5D15A 1M5VC 3B6BA 3RBEA 2LQBA 2V2KA 1EB0A 3PYFA 1UVMA 3I56S 1UZDA 3OTDA 2ROGA 1GLLO 4PG8A 4ZVEA 2R8GA 5B0FA 1JLAA 2LDIA 1MWYA 2HWHA 4B9QA 3J7YU 3GIMA 4E1JA 3ZNJ1 4I7FB 4Q8EA 1RHJB 3AHPA 2NQPA 4LC9B 3D4JA 1DBDA 1KVIA 3CCJS 2YNFA 4CM0A 3R2CJ 1FRXA 4PKIA 3BV8A 4NZ6A 1N36K 4PAAA 3CCEN 4GV9A 4C1NI 4TU9A 4IUFA 3THWA 1S9GB 3GV8B 3H46O 4KHPJ 3HYFA 2BKNA 4BGBA 4OYIA 4TLRA 3WNGA 2RDDA 4QIWD 3EVOA