3DRRA

Hiv reverse transcriptase y181c mutant in complex with inhibitor r8e
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 148
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drrA05
3DYAB 1WNSA 4RNNA 1LAVA 4CHNA 3DLKA 5DG9A 3RR8A 3QLHA 4CF2A 2J6TA 4I2PA 3ZSOA 1ASVA 1KLMA 5EWGA 1IKYA 2OZMA 3HK2A 1JLGA 4ICLB 2CJQA 3OHBA 3NH1A 1L3SA 4Q8FA 4ZHRA 5I3UB 3GILA 5KFRA 5KFCA 4KO0A 4MQ3A 5F8JA 3ITHB 1JLEB 3V9UA 3NKYA 3JSMB 4NRUA 3KK1A 1L3VA 1YVUA 3HHKA 1S1VA 3V4IA 4YR0A 3AVIA 3OYHA 2ZKUA 1WSIA 2C22A 4Z4FA 2YNFB 4IG3A 4KI4A 5KFUA 2WONA 2UVVA 3ZCMA 4K50A 4ZPDA 2OYQA 3UQSA 3CM6A 4TLRA 4XIUA 2FBXA 4ECTA 3IGNA 3VQPA 3UPFA 5KFXA 1JKHA 1S9GB 4FS1A 1LW0A 3AVBA 3DRSA 1QAIA 1I3AA 3QIPB 3BQ0A 4DSKA 3QZ8A 3VN5A 2FLNA 3L2QA 5KFEA 3VQ9A 3QO9B 4URSA 4B9LA 2A1SA 5KFBA 2R8IA 1YTAA 4NCGA 4I9LA 4DTNA 4KHNA 1RT3B 5FRMA 2KZZA 4IG0B 3OL9A 3T19A 4C8OA 2DPIA 3PJWA 4PQUB 4O3PA 3KLGA 1CLQA 4J9PA 3QERA 1IKVB 1RTIA 4E7KA 1HNIB 4FVMA 1RT4A 4HUEA 2ZD1B 4DL2A 2ETJA 4KHWA 4MFBB 3NE6A 2PYLA 4F3OA 1Z26A 2FBVA 2BRLA 2KFNA 3RMBA 5KFQA 1IM4A 3E01A 4RW9B 1T8EA 2AWZA 1JLFA 2G8IA 4NLPA 3I5AA 2RF2B 4PUOB 1RT1A 1U48A 4IRDA 3CJ0A 4NRTA 4N76A 2HHUA 5CYMA 4XPCA 4IFVB 5F8MA 3CFOA 1IG9A 4MIBA 4CJ3A 3H40A 2F96A 4YR3A 4CJSA 4J9KA 3PW4A 2E9ZA 3GV7B 4CK1A 1D9FA 4U7CA 4H8KA 1T05B 4B9TA 3UIQA 1EETA 4PY5A 2HHTA 5KFNA 4MKBA 4IFYB 3CIZA 4M95A 3TAEA 3PW5A 2VG6B 1X1PA 3TAMB 4CHZA 3HT3A 5KFYA 4B9UA 2W7OA 4FS2A 1HNVB 4M3UA 2FVRA 5J2QB 3MFIA 2VWKA 4ZVFA 2WTFA 5J2PA 1JXLA 2WOMA 1BIZA 1S6PA 3OYLA 3OSPA 2E9TA 4RW4B 4EEYA 4TY8B 3H5XA 4CJ5A 4CJ4A 3SUPA 4FK4A 3KLEB 1YT3A 4FZXC 4RU9A 4RUCA 1NJWA 1T03A 1GOBA 3HPOA 1FK9B 4I2QA 1NKEA 5CZ2A 3T1AA 3GV8B 1QE1B 3NH2A 4ZPBA 2IBKA 1S97A 1S49A 1RA7A 2ASJA 4F4YA 4NLOA 4EZ9A 1J5OB 2D0CA 3ISNC 1C1AA 5KG1A 3T5JA 4FJGA 4BWMA 4QWCA 1RT7B 1Z4UA 4BACA 4BE0A 1S6QA 4KAIA 1NNDA 3UR0A 3OYIA 4F8RA 3Q8PB 3HL8A 3AO4A 2KFZA 3ZT3A 3GIMA 2FJXA 2FC0A 4K4SA 3SQ4A 3BSCA 3MR2A 1WN7A 1RNHA 3HVWA 3BGRB 4Q43A 4E7HA 4W5NA 4FJIA 5I42A 2V4RA 4M3YA 5KFAA 5KFSA 1LWFA 4WZQA 2IS3A 5KFOA 2XCPA 1K1SA 1SKSA 4B3OB 3A2FA 3K57A 4LSLB 1TAQA 2HWIA 5DLGA 1ZTTA 3NBPA 3O3HA 1TV6A 4O55A 4XO0A 5L9XA 4ECVA 4KV8A 1DLOB 5HLFA 3H4BA 2BR0A 4KB0A 4ED0A 3NAIA 1RTDB 1S1WB 1S1UA 5CYQA 1BQNB 4KFBB 5KGWA 4DU1A 2I1RA 3ZSRA 1S9EB 5KT2A 1NOYA 3GIJA 3CM5A 1NHUA 2HHQA 2I5JB 2G8KA 4Y3CA 2R8KA 4NLGA 3KKRA 2P1JA 4EBEA 3SPZA 4F2SA 2HHSA 4U6PA 5KT5A 2KQ2A 3H08A 2G8WA 1ZYQA 1LW2A 3OVNA 3MXJA 4W5OA 4CJRA 3KJVA 1UA1A 1FKOA 2HW3A 4FJLA 2D0BA 3BSAA 3ZSYA 4OKEA 3PX0A 4FJKA 5HBMB 2UUTA 4K4ZA 4KREA 4QWDA 5C25B 4Y2CA 4CK3A 3DDKA 3NGIA 3LZJA 3V6KA 4FLYA 1HMVB 3DOKB 2XHBA 5FDLA 4DSJA 3ALYA 1TKTA 4OKKA 1RT5A 2YKMB 1XHXA 3MECB 4H4MA 2OPRA 1BL3A 4DFPA 4JRQA 4RW8A 3QEIA 3KK3B 3LP2B 2RDIA 5KG3A 1LWCB 4ED6A 4ED8A 3NHGA 5J2NB 1JLCB 4FLVA 4IH6A 4B9SA 4JRPA 1TK8A 4IH7A 3FSIA 3FDSA 4XPEA 1JXEA 3AO5A 4CF8A 3RB3A 2W9BB 5J2MA 4ECRA 5CY4A 4CJWA 1TKXA 4LQ9A 5FRNA 5HRSA 1RT6B 3V81B 4ECZA 1QSSA 4E89A 1C1BB 2FBTA 2W8LA 1NK7A 3WNGA 3OYJA 1Q9XA 1TP7A 1KHVA 4NLYA 4DU4A 1ZBUA 1YVFA 4K4VA 4M3RA 4CGIA 5HRRA 1WSJA 3D45A 4CE9A 4FBTA 1D1UA 3EZ5A 4DS4A 1VRUA 3C6TB 3VA0A 2R7YA 2IOCA 5T14A 1JLQB 4GC7A 3O4NA 3KNAA 4NYNA 4FJJA 1RBVA 3MEDB 2OPPB 4KKOB 5EU7A 4FLZA 3ISND 3PZPA 4J2EA 4R0EA 3HSTB 1RA6A 3LPTA 3M8PB 1SV5B 4FW2A 3VQCA 2C2DA 3DMJA 4M42A 4CF9A 1S0NA 3I0RB 1NJYA 2XWYA 2IM2A 3KLHA 3MR3A 1XI1A 3DLGB 4TQSA 3AO3A 5DMRA 1EX4A 3KD5E 4LH4A 4RG8A 3SV4A 5KFMA 2HMIB 5J1EB 1FXXA 3PW0A 4KB1A 4IDKA 4CEBA 1DTQB 4NLUA 1HJRA 3I5BA 4F2RA 4MKAA 3B6OA 3DI6B 4DL7A 1C1BA 4HYKA 4O44A 3FFIA 3KKSA 4R8UB 4WFYA 2R2UA 1RDAA 4Z4HA 1BISA 1VRTB 2W9CB 2B6AA 4F3TA 3FQKA 3D5MA 1L5UA 5L1IA 4QAGA 3RMAA 2FLLA 4MK8A 3DOLA 1WSGA 4DTRA 4KKOA 1L3UA 4CGDA 1SH0A 4E0DA 4W5QA 3RAXA 3O4QA 1LV5A 3NCIA 1BI4A 1HRHA 2Q3SA 2C2EA 1KVAA 4O4RA 4MK9A 1QHTA 3GYNA 3DLKB 4QWAA 4R5PA 4Z4GA 1ZBIA 3QLHB 3HJFA 4I2PB 4CHYA 1KLMB 3PO5A 3VQSA 4RUAA 1IKYB 3MEEA 2QKBA 4QPXA 1JLGB 3LZIA 4HCBA 3VQQA 4ZHRB 1NK5A 1SL1A 2R2TA 3OL6A 3P83D 2DFHA 2HAIA 2O4GA 4DS5A 4CHPA 3ZSQA 1WSFA 1S1VB 3V4IB 3OS0A 1SH3A 1HARA 4MH8A 5EWFA 3AVNA 1J53A 4HKQA 4JV2A 4CHOA 3OYBA 2A1RA 1UOCA 4KSEB 4FJNA 2EHGA 2W42A 4FJ7A 2FBYA 4OLBA 4CESA 2JEGA 1JKHB 3NH0A 1LW0B 4QW9A 3DRSB 5JS1A 2QXFA 4K4UA 2IDOA 4WE1A 3NGYA 3BJYA 1Q8IA 1VSJA 5KG0A 3V9SA 3V6HA 4TXSA 4ZVGA 4OGCA 4FK2A 4GC6A 4NCGB 1S5JA 4DQQA 1TL1A 4DL4A 4G3IA 4I9QA 1CXUA 2V9WA 1VSEA 1Z25A 1GOAA 2XGQA 4DEZA 3KLGB 3VQEA 1RTIB 4Q8EA 1BCOA 5JS2A 3V6JA 2IM0A 4RW6B 4NYZA 4TQRA 1RT4B 3H59A 4AH9A 2OPSA 2B4JA 3CYMA 2VG7A 3OJUA 1XR6A 1B92A 2ITGA 5KG7A 1TVRA 3E01B 3CVKA 3BSOA 1JLFB 1ASUA 2GIRA 1IKWA 1C2PA 1RT1B 5CYMB 1S1XA 4DQSA 3WNHA 4BDPA 1J54A 2AGOA 4OJRA 5KFZA 2Z1JA 4AHUA 3SUOA 1S48A 3T3FA 4Z4CA 4DSLA 1S1TA 3FRZA 1EETB 4YR2A 3SYZA 4IKFA 1QSYA 1TGOA 2DY4A 4B8AB 3GIKA 3JYTA 1KLNA 2E6MA 3V1OA 3OY9A 4CCHA 3M8QA 1NK9A 1RDRA 4WYWA 3AVHA 4MK7A 2J6UA 4O3QA 3K5NA 3AVFA 2WB4A 3RMCA 2BDPA 4AHTA 5J2PB 3CFRA 2GV9A 2WOMB 1S6PB 3RRGA 3F9KA 2D0AA 2R8GA 4E19A 4RW6A 4M3XA 1VK0A 4E7LA 2IGIA 3MTKA 5HROA 4FW1A 3RRHA 3NFAA 1X9MA 1O1WA 4LY7A 4K4TA 4DQRA 1T03B 2HHXA 3QNNA 2AX0A 3CFPA 2O4IA 2DTUA 1T94A 4LH5A 4CFCA 3MEGA 3VQDA 2FJWA 2R2RA 3KMSA 4I2QB 4RW7A 3CO9A 1DTTA 1W25A 4NCBA 2VG5A 4DQPA 4KHRA 3VQ8A 4TYAA 2X6SA 4H54A 1RTJA 4ELTA 1BQMA 3QIOA 4HTUA 3NF8A 1NKCA 1D9DA 1SUQA 3SFUA 3DRPA 4CEDA 1N6QA 4F4ZA 2IA6A 3KIOA 1S6QB 2VWJA 3VA3A 3SFGA 5JUMA 4FM2A 4WYLA 3U3GA 3ZSXA 1RDBA 1BIUA 3OJSA 3MR5A 1ASWA 3CDWA 5DG7A 5DK5A 5K14A 4ZMMA 1RCHA 3TAQA 3MXMA 1HYVA 2GIQA 5I42B 1LWEA 5KFHA 5DGBA 4OPJA 1LWFB 4DL5A 3TI0A 2O5DA 4ZTJA 4NZ0A 3DLBA 3M9MB 3KMQA 3NBPB 2B43A 1TV6B 1S4FA 4YP3A 1XWLA 3HVTA 3PW7A 3SI8A 4KV8B 3ICLA 5HLFB 4EYIB 3K2PA 3LWLA 4FJ8A 3PO4A 2FVPA 2HHWA 2Z1IA 1S1UB 3AVJA 5CYQB 1U45A 3KTQA 4FM1A 2E9RX 4QCLA 3QESA 3VQ6A 1KVCA 3IN5A 1NK6A 4FJXA 1VSDA 1RBRA 3G86A 3M8SA 4O4GA 3U6FA 4W5RA 2GUIA 4CEEA 3LP1A 1RTHA 2JC0A 1LW2B 3IS9A 3KJVB 4ZVHA 3PW2A 2R8HA 1FKOB 4WFXA 3IAYA 4DLEA 3TAGA 4Q45A 3TARA 4J9QA 1EXQA 1RT2A 2YKNA 1UWBA 2GC8A 1C0UA 3LP0A 3QEXA 3SUNA 3ZSZA 3TABA 3T5LA 1CXQA 4M3WA 2GBZA 1C1CA 4KTWA 3G6VA 5FDLB 4ECXA 3NF9A 1TKTB 2HNZA 4ID1A 2G8VA 1RT5B 3ZT1A 3KD1E 4K8ZA 1NK4A 3BDPA 5EUHA 4H4MB 2OPRB 4WFZA 1SKRA 2HNYA 4RW8B 5F8HA 3L3UA 4CGGA 4DF8A 1TKDA 3K5OA 3OYMA 1NK0A 2YNHA 4AHCA 3H98A 2BE2A 1RBSA 4DTPA 1KCFA 2LSNA 3QGIA 4KHUA 2E6LA 5KFLA 4OKJA 1VSIA 2HNDB 5KFGA 4M3ZA 4K4WA 4FLWA 1N48A 5HRPA 4KRFA 3K5LA 3IRXA 5J2MB 3I8DA 3N6LA 4DQIA 1TKXB 2YNIA 4IR9A 4DTOA 5HP1A 1LAWA 1BCMA 3NL0A 4GW6A 4I7FA 4DG1A 2IC3A 2X74A 4FLUA 2WHOA 3M9NB 4N47A 4NLVA 4CHQA 4FLXA 4ECSA 4FJHA 3ZSWA 1T7PA 3GIIA 3L3VA 3KLVA 2D5RA 1KRPA 1D8YA 4DFJA 1JLBA 1WAJA 4O0JA 1VRUB 3AA5X 1JXBA 4DSFA 1ZETA 4FZYA 5CZ1A 1GX5A 3I0SA 2IAJA 3OSNA 4CECA 2OA8A 2RKIA 4FJ9A 4JS5A 2AGPA 4AHSA 1KSPA 4F50A 1VSKA 1QUVA 3DM2A 1FKPA 3DMJB 4JV1A 4N41A 3SPYA 1IKXA 3KLHB 1REVA 2XY8A 4C8LA 2YNGA 2W8KA 2Y1IA 2ILZA 1KHWA 1RYRA 5KGXA 3TQ1A 2HNDA 4HUGA 2P5GA 1QAJA 5L1KA 3BR9A 1U49A 5F8IA 1TK5A 4IDKB 3V6DA 3OYDA 4M3TA 3HPHA 3EPGA 2RN2A 4KHQA 4O44B 3FFIB 4NLSA 2VA3A 4DL3A 1KVBA 2PYJA 1XC9A 2IJNA 4DFMA 1QQCA 2JEJA 1RYSA 1GOCA 2B6AB 3KHRA 1D0EA 1UAXA 3HXMA 4FLTA 2G8UA 4ID5A 3DOLB 2CKWA 1RILA 1WLJA 3HO1A 2KTQA 5KFIA 3BREA 1BI4B 1TAUA 3KK2A 5KFWA 2E4LA 3TWHA 1ZBHA 4JLHA 4UQGA 4O3OA 2BQ3A 3L2VA 1NOZA 4ECYA 3SQ0A 3OL7A 1TL3A 3AA4A 4R5PB 4BE2A 3MFHA 1TKZA 4Z0UA 4BE1A 2RPIA 4FXDA 1R0AA 3MEEB 4CK2A 3WNEA 4CJQA 2IMWP 2UVUA 4OVLA 3T5KA 1U09A 4J9MA 4L8RB 3AA2A 1CSJA 3SCXA 1IH7A 4M45A 4Q44A 3OLAA 4JV0A 1Y97A 3PY8A 2G8HA 3OS1A 4DTMA 4RZRA 3TANA 3E51A 3DRRA 5D3GA 1I6JA 4HUFA 1RAJA 2OZSA 4G1QB 2JEIA 4KHMA 3ULDA 1S10A 4OGEA 4LD0A 3HP9A 4EO8A 4J2AA 2FJVA 4E1NA 1OS5A 1RBTA 1UA0A 3NAEA 3OYNA 1G15A 5HRNA 3RBDA 1CZ9A 4ECQA 1BGXT 3V1RA 2F8TA 4K4YA 4WE1B 1QSLA 2UVRA 4J2DA 3HYFA 1S9FA 4ZTFA 4K8XA 1HQEA 1MU2A 2BANA 2P5OA 3CDEA 3VQ5A 1XR5A 3G6YA 4M94A 3QETA 3KLFA 1TL1B 4YNQA 4ELUA 1W0HA 4FK0A 1B9FA 1JL2A 4B9NA 3CJ5A 1JLAA 5KRTA 1JL1A 1I39A 2G8FA 4ZPCA 2BGGA 2B5JA 4F4WA 4Y1DA 2OPSB 1NJXA 5KFJA 2VG7B 5KT3A 2J6SA 3O3FA 2FVQA 4G1QA 2OPQA 1TVRB 3N6MA 3NGDA 2XRIA 2R2SA 3S3NA 4ZPAA 5KFPA 1IKWB 2ATQA 3DLEA 1S1XB 4B9MA 4QWBA 4CEZA 3QINA 4KPYA 2Z1GA 3OYCA 4URGA 4CIFA 3T5HA 2UUWA 2V0NA 5L1JA 1S1TB 3PVXA 1A5WA 4EBDA 3LAKA 3QGGA 3AV9A 3JYTB 5DQHA 4WZMA 4Y34A 1EP4A 3C94A 4CF1A 3KLIA 1ZBLA 3M8QB 4KAZA 5KG5A 4PWDA 4YMEA 3I5CA 1YTUA 2IJFA 4DMNA 4IRCA 4B8CA 4FJ5A 2ZQBA 4OPKA 3SUQA 4NLRA 1WAFA 2HB5A 4Q0BB 4FCYA 3OYEA 4HCCA 3NDKA 3OYGA 5HROB 3ZT2A 3K58A 4JS4A 3CQ8A 1HYSA 3SZ2A 2WK4A 1U47A 3MEGB 4QOZB 4RW7B 1L3TA 1DTTB 2VG5B 5C24A 4CEAA 3IG1A 4ZP6A 4RNMA 2JEFA 2RDJA 3THVA 2PY5A 3QEWA 4B9VA 2Z1HA 1J9AA 3AO2A 2HVIA 5KG2A 2XO7A 4LSNA 1RTJB 5F9NA 3SQ1A 1SKWA 4NLWA 4KTZA 1BQMB 2D7SA 2PZSA 4CJKA 3N6NA 1HPZA 3QNOA 1SUQB 3DRPB 2QKKA 4O3NA 4AHRA 1N6QB 3LPUA 4YFUA 3HVAA 1N5YA 3C6UA 1JX4A 4FZZA 4O0IA 2W7PA 4ED2A 4ZP8A 1C0TA 3QGHA 4TYBA 1QTMA 3Q8RB 2HHVA 3PV8A 2AGQA 2KZMA 5K14B 3G10A 3EZUA 3OHAA 1LWEB 2D41A 2WRMA 3DYAA 4Q0BA 4Z4EA 4FYDA 1NJZA 3AVKA 4NLDA 5DQGA 1D5AA 3DLHA 2IM3A 4EP4A 4WXWA 3BSNA 3AVCA 3RMDA 3HVTB 4CERA 4ICLA 5I3UA 5KG4A 4RNHA 2YV0X 3ITHA 1VSMA 4Q5VA 3SNNA 1NK8A 1JLEA 5KFTA 1RBUA 3JSMA 4KE5A 4M41A 3V9ZA 5SZTA 3EYZA 4IR1A 4DTJA 5DG8A 2JLEA 2YNFA 3L2WA 4EO6A 3NF7A 4DTXA 3KHHA 1VSFA 4O4GB 4KI6A 4CJUA 2NUBA 3LP1B 1RTHB 3D28A 1BHLA 5E41A 4Z4IA 2F8SA 3V9WA 4ED3A 1S9GA 3IS9B 4LQ3A 3QIPA 4CJVA 4H4OB 2XI2A 3C95A 4EZ6A 5KRSA 3QO9A 4CIEA 1RT2B 3QEVA 2YKNB 1NHVA 1UWBB 4EBCA 1C0UB 3LP0B 4GMJB 1K1QA 4K4XA 5EWEA 4IRKA 1B9DA 3NMAA 5KI6A 3Q8SB 4RNFA 3G6XA 1C1CB 1RT3A 1WSHA 4IG0A 2HNZB 2ZE2B 4PQUA 4ECUA 1QS4A 2P51A 4CJTA 3VQBA 1SL0A 1IKVA 3LAMA 2HNYB 1HNIA 4IQXA 3AVGA 2YNHB 3V1QA 4DTSA 2ZD1A 2R8JA 3LWMA 2C28A 2BE2B 4C8MA 4MFBA 2QK9A 4C8KA 4J2BA 4KB7A 1C0MA 3H5UA 4FJMA 4RW9A 5T7BA 4J9OA 3LP3A 4AHVA 1EKEA 4DSIA 2RF2A 4PUOA 1VSLA 3HVRA 3IGVA 3OS2A 5C42B 1JIHA 4IFVA 5DGAA 3IRXB 3SJJA 2YNIB 4ELVA 5HP1B 4FBUA 2EX3A 4I7FB 4DG1B 4KHSA 1TQLA 2IC3B 4KBIA 1T05A 3P5JA 3OYAA 4H4OA 3H2LA 5KTQA 3BQ2A 2AX1A 2ILYA 2JC1A 4EP5A 4IFYA 5KT7A 4CJLA 4F4KA 2VG6A 3ZT4A 3TAMA 4IH5A 1JLBB 2YHAA 4BDYA 3QZ7A 2XI3A 1HNVA 4E7IA 3HKWA 5F9LA 2XCAA 5KG6A 3I0SB 2IAJB 5J2QA 4O5BA 2F8EX 2ZE2A 4CEQA 4J9RA 1NKBA 2KW4A 2RKIB 3RWUA 1GX6A 3CJ2A 4CGJA 2D3UA 3WNFA 3L2UA 4RW4A 4E3SA 4TY8A 4CJFA 4CIGA 3DM2B 4HHTA 1Q9YA 1FKPB 1XR7A 3KLEA 1CZBA 1KTQA 1RDDA 4CGFA 2FLPA 3LDSA 1IKXB 2FVCA 1REVB 2YNGB 1X9SA 1FK9A 3TR8A 4ED1A 4J9LA 1QE1A 5C42A 4NLQA 3V6DB 2ATLA 1K6YA 1J5OA 3G0ZA 3AVLA 4O3RA 4WXOA 2AU0A 1W9HA 3VQ4A 1RT7A 4KTQA 3K59A 3EPIA 4E7JA 3AVAA 4B08A 3HPGA 3L2RA 4N5SA 3QIDA 2BRKA 4DL6A 2ALZA 3M8RA 3MXIA 3NAHA 3PHEA 4J9NA 3QYYA 3O3GA 3KOAA 4ID5B 2ASDA 3M9OB 2QV6A 3BGRA 2Y1JA 3L8BA 3CWJA 3S3MA 4DU3A 4ZP7A 3KK2B 4ED7A 1KFDA 3S9HA 1U4BA 2XGPA 4B3OA 2AQ4A 3RB6A 4LSLA 3LANA 5KFFA 4DWIA 1TL3B 4GVMA 4BWJA 1TKZB 3FQLA 3ZT0A 1DLOA 1R0AB 4IOBA 4X2BA 2XY7A 1RTDA 1X9WA 1MMLA 1S1WA 3DLRA 1S0MA 2V4QA 1BQNA 4KFBA 1S9EA 3H4DA 4HVJA 2I5JA 5EDWA 4J9SA 4CFDA 2VA2A 4E1MA 3DRRB 5D3GB 4CJPA 3V9XA 1WSEA 3UDLA 1HYZA 4ZP9A 3PR5B 5JXSA 4DTUA 3BQ1A 2X6NA 3OYFA 1KFSA 5L1LA 4KHYA 3SV3A 3SQ2A 3K5MA 1TK0A 5F8NA 2HWHA 4N56A 3TVKA 4CGHA 3MF5A 3AA3A 3B6PA 2DFFA 2D3ZA 3Q8QB 2XY6A 5HBMA 1SH2A 4DLGA 5C25A 5F8LA 2DFEA 5KT6A 1HMVA 1HQEB 1MU2B 2BANB 3DOKA 3PR4A 3RB0A 3KLFB 2YKMA 3MECA 4AILC 4DF4A 3AVMA 4TY9A 5DLFA 3MR6A 5F8GA 3KK3A 3LP2A 1LWCA 1JLAB 4CJEA 4OLAA 4NLTA 3PUFA 5J2NA 1T3NA 3AO1A 2B5JB 3OL8A 3VQAA 1JLCA 5DQIA 2DPJA 1C6VA 1HQUB 3OYKA 4DSEA 4CEOA 3CJ3A 5KFVA 3NF6A 2BQUA 3GQCA 2YHBA 2OPQB 1ZTWA 4PA1A 1N4LA 4C8NA 3RR7A 2W9BA 4NYFA 2X78A 1RDCA 2QE5A 4OL8A 1RT6A 3DLEB 4RNOA 4F4XA 4TSXA 3V81A 2JGUA 4CFBA 2UVWA 3LALA 2EC0A 3F73A 3D0PA 4NLXA 1F21A 4MIAA 3VQ7A 4CF0A 3GV5B 3TAFA 3EY1A 3NGZA 3C6TA 5KFKA 1JLQA 4EYHB 3QEPA 4YQWA 1EP4B 3KLIB 1WNEA 3MEDA 2OPPA 3ZSVA 4FM0A 4PWDB 4BDZA 3H5SA 2OH2A 1U04A 5KFDA 3HP6A 4W5TA 3M8PA 1SV5A 2FVSA 3KHGA 5FROA 3RBEA 1ZBFA 1VSHA 3U3YA 4O3SA 1A5VA 5KT4A 3I0RA 1HQUA 2BQRA 5SWMA 3TAPA 5C5JA 4TN2A 3DLGA 3ASMA 3PX4A 4CFAA 3PJXA 1HYSB 4Y2AA 2HMIA 4Y1CA 3HM9A 5J1EA 4JUZA 1IO2A 4URQU 5C24B 3IG1B 4QW8A 3PX6A 4NCAA 1DTQA 1SL2A 4KO0B 2IM1A 2XC9A 2W9AA 3MAQA 3DI6A 4DFKA 3KK1B 4ECWA 2HVHA 4LSNB 4R8UA 3H5YA 4CEFA 1HPZB 3CDUA 2C2RA 3OLBA 4IG3B 1XHZA 1VRTA 1ITGA 3RTVA 3RAQA 1N56A 2WONB 2W9CA 3SI6A 1S0OA 3KHLA 1N5YB 3C6UB 4IKAA 2WCXA 4ZVEA 1C0TB 3S3OA 3CG7A 4IBNA 2AJQA 3P1GA 2XY5A 1A5XA 3RB4A 4QWEA 3CJ4A 2ASLA
chains in the Genus database with same CATH superfamily
2Q0UA 1LAVA 4OI6A 1WWHA 2DNNA 2J6TA 4RWTA 3M2RA 3M8ZA 1R0BG 3I4PA 2FQQB 3HK2A 3S6EA 1S6OA 3OW2R 3OHBA 1L3SA 3SEOA 1EZZB 5KFRA 3PKYA 3CJ7A 5AR0A 4KO0A 1VQ5N 3W5XA 2VD3A 4DR4J 2XMVA 3MPWA 2UUCK 1GLFO 3CJ1A 3MTJA 4CQ1A 3OYHA 5IXUA 5KFUA 5AJ3F 2GQCA 4QR0A 4PWUA 1TU0B 2X3GA 4WU3A 2EFVA 2OYQA 3CM6A 3VEZA 3G6ES 1CVJA 4WFNQ 2QWPA 2E5LF 2FBXA 4V1Ak 1JKHA 2H4YB 4A61A 1LW0A 2I9SA 1I3AA 4DZ6A 3HMJG 5GAHI 1NGJA 3VQ9A 3AAQA 3MMAA 2QA4N 1QDUB 2OEJA 5B0BA 3F2KA 4JI3K 1HBOB 3S8SA 1REGX 1VK8A 1IQZA 5IM0B 4EUVA 4DV7J 3MOJB 3EXCX 4M63C 4I9LA 1RT3B 2UUAK 3N4WA 4IG0B 1U1PA 2MKYA 3T19A 2UU9F 3PJWA 3G8SA 2V8DA 4CZHA 1VIXA 1YI2N 3CC2S 4J9PA 2VQEF 3KJQB 4F0HA 4DUTA 4OYMA 2GTDA 1FJ7A 1RT4A 5SUHA 1P8GA 2BUPA 2H5EA 4DL2A 3DHXA 4DV3K 3HHDA 2ETJA 4KHWA 3NE6A 4F3OA 3C6HA 1EX8A 1LEOA 4IO1A 3E01A 4U96A 1JLFA 2GMHA 4DV5J 3I5AA 4BRMA 3H3OB 1SIWB 2BZ2A 4JBCA 1Z6RA 5M2PA 3M3ZA 4N77A 1CS4A 4YR3A 2F96A 3PW4A 4CK1A 2E9ZA 4ITSA 2HQGA 2HHTA 3CIZA 5AQSA 3TAEA 1KAZA 3GFHA 1RK8A 2NNWA 3TAMB 3HT3A 5KFYA 2CWXA 4AQYF 3G9CA 3HZ6A 4I6MA 1HWJA 2BKNA 4QIVA 1OY9A 5J2QB 4BR4A 2VWKA 4ZVFA 2QMWA 2R7TA 3FZHA 4JI6J 5ADZA 4X64F 2WOMA 1BIZA 3WIVA 2JLFA 1A9NB 2Z58B 3H5XA 3RU0A 4CJ4A 3SUPA 4B3RK 3KLEB 1YT3A 4LFBF 4FZXC 4EHTA 3BN7A 3PRBA 4R25A 4PKDB 5A0YB 4I2QA 3T1AA 2YJEA 2OTJN 3ZTRA 3NH2A 4ZPBA 1VHIA 5IWAK 3UE5A 4RWWA 3CC4S 3J7AN 3CCUN 1N5QA 4FL9A 3ZZRA 1J5OB 4C4WA 3T1YK 3ISNC 1C1AA 1RWKB 5KPRA 1OKJA 3T5JA 1B0TA 2LA6A 3US5A 1S59A 4QWCA 3A5NC 4BACA 2VYPA 2CDQA 4DPTA 1NNEA 5BRDA 4OX8A 1ZXOA 2Q97A 3OYIA 3TA0A 5GAGI 3HL8A 4PXBA 4FYYB 3ZT3A 1DJ0A 1YRXA 2YX7A 8AT1B 3MMCA 4DPWA 3BSCA 2D9PA 3MR2A 3GCXP 3C8YA 2AT1B 3BGRB 3HVWA 1HPMA 4W5NA 3O1LA 5I42A 5KFAA 3LDPA 5B0AA 4A8SA 3D2FA 3DCAA 2IVOA 3CCWA 1SKSA 3GG4A 3K57A 5DLGA 1UAWA 2GV1A 4NXNJ 3O3HA 3TSPA 2F4FA 3BR8A 3CULA 1ZAVA 1B70B 5CD4H 3QQCD 3MPUB 4N8NA 4G6VB 3ISZA 2CNNB 1GNKA 1BQNB 3VR1A 2I1RA 3ZSRA 4DL0C 1NOYA 3ZEUB 3TUIC 4ZCIA 2B51A 4Y3CA 3EE8A 3KKFA 4MKYA 2KN4A 1F3FA 1Y10A 2QL5B 3OTOJ 2B4VA 5KT5A 2BE7D 3JSRA 2B8QA 3H08A 2G8WA 1V3SA 4CVNE 4W5OA 3ATVA 1UP1A 2YJFA 1FKOA 1S0VA 3BSAA 2CUYA 2PD1A 2FYXA 3H1VX 3BH7B 4ZVRB 5LMNJ 5HBMB 5AFUA 4TNOA 2R7VA 4CK3A 3LZJA 1HMVB 1OQ6A 4FWPA 1JJHA 2ZUAA 1HA1A 1RT5A 3H1QA 3MECB 2XYGB 4YUDA 1JNRB 3LA0A 3QEIA 3KK3B 3B6BA 4CTAB 1UFLA 1RACB 3ADAC 1VQYA 3EZWA 2ZHAA 1XQIA 4FLVA 4KY3A 4JRPA 4HL9A 4USUA 1GLLO 3BPSP 4IH7A 2K2PA 4A8WA 1P1TA 4HHHA 3VGTA 3QJPA 3M2UA 5L38A 3NXZA 2W9BB 3RB3A 4ECRA 5CY4A 2MZTA 4X4NA 5AQKA 5AZJA 1NDPA 4Z7CA 1B0VA 2GJ2A 4MJKA 4X4TA 3FBBA 5LXYA 1WJ9A 6FDRA 4DU4A 1R8PA 1P90A 4CE9A 4N8OA 1VJQA 3SBGA 2PFFB 3EZ5A 1VQMN 1HLWA 3HI0A 2R7YA 2DHXA 4UOHA 1VQPN 4FJJA 2ZH6A 2Y1LB 4EFAC 2ZJRQ 5BREA 3PZPA 4J2EA 3HSTB 1RA6A 4WIIA 4YOWA 2QJ3A 3GYGA 5BPNA 4I0WA 1G1XA 3VQCA 4DR1K 1C4CA 1VQ6S 2ADCA 1S0NA 5GINA 2E5GA 4DV1K 3DLGB 4TQSA 3PYEA 4RG8A 2ZGZA 2HS0A 4RL1A 1KKHA 4DI6A 4IDKA 3P8BB 1SPBP 1IXKA 3DXKA 4BRKA 4F2RA 3W9JA 4HYKA 1YJWS 2M70A 4LJMA 4R8UB 3KKSA 2R2UA 1RDAA 3D2WA 4Z4HA 5LOQA 2QL9B 2B6AA 4B9QA 4BVOA 5DO2A 2FLLA 3CCTA 1O51A 3OPKA 3PDNA 1OPZA 3THPA 1K0VA 4E0DA 2ATCB 8ATCB 3PRDA 2P8IA 5LSRA 3K9JA 1FWLA 3TSQA 3MXHP 3NCIA 3M2VA 1HRHA 2ZC4A 3UI3A 1ZA2B 2MQLA 3JS6A 4KH5A 4WFNL 3TJAA 4QWAA 1RDUA 2RMLA 1B64A 3QLHB 3O6QA 4HT5A 4I2PB 1X0FA 1SJ4P 3VQSA 3UFCX 4QPXA 2QKBA 3G71S 2E1MC 1FDNA 1M1KT 4C11B 3LZIA 5ETNA 2QYCA 2QLXA 1RQ0A 2R2TA 3MM6B 2OJ3A 2ZFHA 4ENOA 1Q78A 4X66K 3LDLA 1LXNA 1BHNA 1S1VB 3OS0A 1RISA 1SH3A 4G1IA 1J53A 5EX5A 4HKQA 4JV2A 4GKJK 2M3DA 3R3TA 5CHIA 2QEXN 1HKAA 2W42A 3PLAA 3T7ZA 1UVNA 2BJ7A 2QXFA 1DQ8A 2ZJPQ 2NUHA 2YXLA 1WC1A 2QO3A 4WE1A 1NDKA 5E26A 4FVCA 1Q8IA 1VSJA 2R42A 3AJDA 5IT0A 3V6HA 3CERA 4DR6J 4ZITA 3OVBA 4OGCA 1S5JA 4C23A 2MKSA 3ULEA 4FWQA 4O8KA 2QWOA 2E88A 5FPEA 2MY8A 2XLKA 4NZ6A 1RTIB 3SQOP 3UD4P 1BCOA 2RUSA 1RTZA 4P75A 5AE3A 2X7IA 4CZGA 1XIQA 4AH9A 2B4JA 4TU8A 3A1YG 1IR1A 2VG7A 3LM9A 5GMDA 2RRNA 3VHQA 4W90B 1HNZK 2Q2RA 1U2RA 1XR6A 2ITGA 3O9TA 1TVRA 1NPKA 2F1FA 1IKWA 1C2PA 3D6TB 1RT1B 2FC8A 5FLXO 1S1XA 2JFDA 2PA3A 3WNHA 3M30A 1MN9A 4ATNA 5EX0A 2A2DA 3ZYYX 2FC9A 2Z1JA 1VQ9N 3WEEA 3T3FA 2CQ2A 5ETTA 2V51B 4DSLA 1S1TA 1NZ8A 2E2NA 3U27A 1QSYA 3GIKA 1ZM4A 3M8QA 2JH3A 1FHTA 4JD2A 2ZH1A 2WB4A 2EG2A 1YZ7A 1R0CB 2CQPA 3CMEN 4AT1B 3PHTA 3CFRA 3O8MA 2ABYA 5HI7A 3IAM9 3RRHA 4ILHA 1VC0A 1VGYA 4DQRA 1T03B 3LM2A 2AX0A 2DTUA 4Z7YA 3KMSA 5AQUA 2VG5A 1V3ZA 4C6AA 2OD6A 3GIRA 2KG1A 2HRUA 2RHQB 3MM8B 3J81Y 1VQNN 3HFZB 2X6SA 4RO0A 4U67Q 4XH1A 2MLZA 1IJJA 3FEXB 2ZH3A 1RWNB 5AJ3J 4UUXA 3DRPA 4IEEA 3MN6A 1N6QA 4ZVOB 5A8KA 3CC7N 5JJBA 5LL6d 4R0JA 4H0XB 2QLFB 5LT5A 4DV6F 2MYFA 3CDWA 1NGDA 1YAGA 1HYVA 2GIQA 2JWNA 1LWEA 4LF7K 4Y2KA 4ZTJA 4NZ0A 4DR2J 3NBPB 2FHKA 1XWLA 3AHPA 4M7XA 2WAQD 4OYOA 3LWLA 2Z1IA 2P9LB 2FF3B 1RE1B 2EWHA 1ZBSA 2ZBPA 3QESA 4ZIWA 3G87A 1N52B 5AXMA 2XYHB 3GE9A 3G86A 3M8SA 1N34J 3HI9A 1X0PA 1LW2B 3EGWB 2IA0A 3IS9A 3TPQA 3NVKA 3I56S 4WFXA 3IAYA 1GLBG 1G3OA 4DLEA 4TKTA 2XNRA 4OPAA 1N88A 1UWBA 3MWBA 1C0UA 3LP0A 4WQ4C 2AF6A 4AQYJ 3QEXA 3SUNA 3TABA 3BO4A 4RKUC 4X4QA 2WVFA 1FW6A 2QA2A 5A2QO 2X1AA 3JAMY 4KTWA 4ECXA 2XEXA 5E3RA 3AJ1A 5IZHA 3ZT1A 4ZJLA 3RUBL 4K8ZA 2VQFK 4FF2A 2HNYA 5CA5A 2G2OA 3K5OA 2R7UA 2YKQA 2YNHA 1ZAXA 4LFBJ 1RBSA 2XSJA 3VTHA 4KHUA 5LMUJ 1OVQA 2GVDA 3C3LA 1WI8A 5C10A 1VSIA 4M3ZA 5B0DA 3I8DA 3VZIA 1BDGA 4B3MF 2YNIA 4IR9A 2PI4A 1QVFR 3QSIA 2HFSA 4CLZA 4B3TK 1PAUB 3ZZZA 1W26A 1WF2A 5THWA 4C0HA 4YHHF 4ECSA 4ZPTR 3ZSWA 2O8BB 4B1WB 2D5RA 1XJWB 5AZIB 2QGFB 4HI2A 5F1XA 2Q3PA 1JLBA 1HI8A 1X5SA 3OT9A 3S7RA 5AQMA 2I38A 3TP2A 1P9YA 5L9NA 1DZ5A 4FJ9A 4AHSA 2O3DA 1KSPA 4F50A 3E3XA 2WVBA 4ILJA 4LR9A 2PFDA 2QMXA 1REVA 2XY8A 2Y1IA 3QWPA 4RCHA 2ILZA 1KHWA 5KGXA 4HUGA 1M5VC 5DJBA 4CRJA 2VC0A 2WW4A 3PIPQ 5CHCB 4RPFA 3EPGA 1XMOJ 3HHLB 1SC1B 2VWBA 3M5RA 3NLCA 2YQ3A 4DL3A 1KVBA 4DFMA 4OJ3A 2NREA 3BZQA 4A48A 1HKGA 4M5MA 2F3JA 3WT0A 2ROGA 2QRRA 4LF4F 2B7BB 3KHRA 2OI2A 2QFJA 3OVAA 4ID5A 3DOLB 2CKWA 3MWPA 3TUPA 3C6AA 4LIRA 4YOTA 3U02A 1VQ4N 2KTQA 5IT9O 1BI4B 3GMGA 2IVMA 4PXEA 4O3OA 4P71A 4BHQA 2LQJA 1TL3A 4R5PB 1UWAA 1N32K 3UNGC 4FXDA 1R0AA 2ZJPL 4JI7J 4CK2A 4DUYF 4CJQA 5B0EA 2UVUA 3A8IA 4I6WA 3IBCB 4LFCF 4J9MA 3VMFB 2MGZB 3THYB 3CJ8A 3SCXA 1IH7A 4JKCA 2VF3A 4WQ4A 3OLAA 4JV0A 4F26A 1PBAA 4NLBA 4C7QA 4RZRA 3TANA 1RGIA 4JYAK 2XNQA 1Y00A 1OWXA 3H42A 4RLEA 2JEIA 4ZJQA 3VGSA 3AA9A 2QN6B 4DCJB 2EBGA 1EQ0A 3HP9A 3ET6B 5BYQA 3O9QA 3R1HA 2IDEA 2EK1A 1CULA 5HRNA 3NGKA 4BC7A 4IQMA 1Q86O 2MSTA 1HW8A 2UVRA 3JXOA 2F7VA 1MU2A 2BANA 2CQIA 3FC9A 3BDEA 3CJKB 4A5BA 3ZTPA 2F9WA 1TL1B 1FE4A 4CLSA 4YNQA 3LTOA 1U0HA 1JL2A 2IPOB 2ZM6K 3M6VA 3IA0A 4YOEA 4NXMF 4RUHA 4Y1DA 3BKUA 2FIUA 1BD6A 2FF6A 5KFJA 2YPYA 3AODA 3PXGa 3NGDA 2XRIA 1DY3A 3P45B 1YJ7A 3HOSA 3GE1A 2HEKA 2H54B 3JQKA 3QATA 1HL6A 3GR1A 2HZVA 2MTLA 4LF6K 2Z1GA 4A62A 2CQGA 2UUAF 3T5HA 2GS8A 1HNXJ 4WZMA 2KXNB 3M1VA 3LH2S 4WQ5C 1ZBLA 1H0HB 4DV3F 4U67L 2E5HA 2AW0A 1D09B 2MY7A 2YH0A 4NL5A 1FDDA 3R6LB 2IYIA 2BABA 4FCYA 4O5FA 3NDKA 1I51B 3SJHA 3OYGA 4C3MA 3VTIA 1NRKA 4JS4A 2EFOA 3W2VB 3CQ8A 3SZ2A 1YBAA 1DGKN 1U47A 3UVJA 4CEAA 1AB8A 4RNMA 2JEFA 5AQIA 2RDJA 1YJNN 3K2YA 2NXCA 4KTZA 2D7SA 3L7UA 1SUQB 2YY3A 5AQQA 2KYZA 3C6UA 5IV4A 3PIOQ 2Y8WA 4FZZA 2GVZA 2XMKA 3MGJA 1UJ6A 3QGHA 3TW0A 4B3RF 2OGUA 3VAMA 1DFDA 1RBOB 3LPYA 2KVIA 2KZMA 1V6HA 3O9RA 1NEEA 4JI2K 4FVUA 2WRMA 1WB9A 1NJZA 3AVKA 1YJTA 1GLCG 3T1YF 4K59A 1P8ZA 1D5AA 3W2VA 1OH6A 4CERA 3KYLA 4UUWA 4ICLA 5MLCQ 3WC0A 5I3UA 4RNHA 5KQDA 2CJ9A 4ANCA 2YV0X 1ZM3A 5KFTA 4M41A 3TA1A 2H9ZA 5SZTA 2YWWA 2JLEA 2YNFA 4I67A 1H1VA 3DOMA 3CF5Q 5D0HA 1T95A 1FJCA 3MUVP 3KHHA 4NYOA 1XQSC 4FWOA 2NUBA 1ZS6A 3AGRA 4E1JA 4Z4IA 1XNQJ 2IRXA 3OBYA 3TZWA 4Q7AA 1S9GA 2CAJA 1WKJA 4LQ3A 4OHYA 3QIPA 3JXUA 4CJVA 3W8GA 3VWSA 4EZ6A 5KRSA 4RTFD 4CIEA 1RABB 1NHVA 3PSFA 3FBEA 5EWEA 5E3QA 2WBRA 3W1YC 3AB2B 3A5MC 3R6MA 5KI6A 5BRHA 1KD1O 4RNFA 2KFYA 3H25A 2XWXA 4CJTA 3VQBA 5A8WA 1SL0A 2AYEA 3DU6A 3G2XA 1X7VA 4L3NA 3DU5A 3GB0A 4DX8H 4C8MA 2AIRB 2FY1A 2KLAA 2XMUA 4C8KA 3ZETB 2HSEB 4WQ5A 5BXIA 1BU6O 1W2BM 2FSKA 3LP3A 4FWMA 3TZZA 3HVRA 1FESA 3KG4A 3L7OA 5C42B 4IFVA 3TUZC 1HNWK 2V2ZA 2NXJA 2WVEA 2EX3A 2CQDA 4DG1B 4KHSA 1TQLA 4YB7A 4H0OA 3NMRA 4KBIA 2YX4A 3P5JA 2AEMA 5KTQA 1FVSA 2AX1A 4QS9A 2F63A 2ILYA 4ZVUB 3NVMA 4CJLA 5GAEU 2VG6A 2BA9A 2MZJA 4BDYA 5ADXH 4KC5A 1S22A 2XI3A 3LF0A 4E7IA 1FKAF 4P2MA 1QD1A 3E2EA 2XCAA 1BY9A 5KG6A 4O5BA 2F8EX 4IOCQ 3CJ2A 1RP5A 4WBFA 2UXDJ 3O3LA 3C0BA 4JI0K 2X51A 4RW4A 5JMVA 1FKPB 3OXLA 4PG5A 1OVYA 2YHWA 4CGFA 3TSUA 5GAEI 2YWGA 4HH0A 4J9LA 1F0XA 1QE1A 3ZZUA 2W4CA 4K2XA 2HBKA 5C42A 5ETSA 4JI1K 3V6DB 3VEVA 1J5EK 3CGIA 2QA4G 4CZCA 2N3OA 4B08A 3CCLS 3NGRA 3QIDA 4XDDA 4LRBA 4OFZA 4DL6A 4M7YA 5AXLA 1M5PC 1KVKA 1UVJA 4DR1F 1WDTA 3QYYA 4DV1F 4IO9Q 4EAHD 1AROP 1AXQA 3S3MA 1BWFO 1RKJA 4ZP7A 4R79A 2HFUA 4ED7A 3CCQS 3OR2B 3IC1A 2AQ4A 3RB6A 4LSLA 4DWIA 1SQKA 1LK5A 2EC2A 4J9UE 2LEBA 1RAFB 4GVMA 1TKZB 3ZT0A 4X62K 3SSRA 1IBKK 2ZBIA 4IOBA 3TX8A 2J7WA 1RTDA 3J81U 1MMLA 1HUXA 3DLRA 3EEQA 1S0MA 2UUBJ 5DETA 1UFWA 4JK9A 2V2VA 2OSQA 2D0PA 2HHHJ 1VQ6N 2OD4A 1WEZA 1H73A 3LUYA 1TL7A 1OIAA 2QG9B 3PR5B 2I7PA 3BF4A 5LSOA 2ZWHA 1TUVA 5T7LB 1KFSA 2ZNYA 4FWSA 2P9UA 1BO5O 4JNEA 3SV3A 3FMBA 1TK0A 4HDGA 4N56A 4YHHJ 3W2WB 4F3QA 4CGHA 3NEKA 1G6BA 2NRVA 4D3GA 2G9OA 2DFFA 3A5LC 2CNLB 1SH2A 2QL7B 4B1ZA 1WKLA 1YJ9N 1ZM9A 1SQGA 3OXFA 3UE2A 4ILLA 3DOKA 4Y6IA 1MNEA 2V7YA 2LQBA 1FD2A 1YRTA 3KLFB 2POKA 4X66F 4DF4A 1FWKA 1ATRA 4TY9A 5DLFA 4OHWA 2RU3A 1LWCA 1S3XA 5E2QA 1VQSA 4OLAA 4FF1A 4A8QA 3PUFA 1T3NA 3VQAA 2AYBA 1C6VA 2DCLA 3GBTA 9ATCB 5KFVA 1RBAA 2Q36A 3GQCA 1JWWA 2YHBA 2OPQB 3GDQA 3G71N 3M6UA 1N4LA 1RDCA 4ZLPA 2NPIA 3ID8A 4P6QA 2MZRA 1RT6A 3EKUA 1URNA 4OLOA 3DXMB 3KK7A 3RG6A 1V3RA 2JGUA 1TYQA 2V52B 3SMPA 4CF0A 2O8CA 2RHKA 4WCEL 2GJIA 1HR0K 3CI5A 5GMEA 4WP3A 5KFKA 4LRDA 4DCPB 2OPPA 4A59A 4BDZA 1NH7A 2P9PA 1FNXH 1IM6A 1HNZF 2CJAA 2C3MA 4W5TA 3HT0A 3PIOL 3CTRA 1KEKA 3VGMA 3ZX2A 1A5VA 1ZC6A 5H9EJ 3MM5B 3I0RA 4C1NI 2GA7A 2BQRA 5SWMA 2DCUB 4JHDA 5C5JA 3D2EB 3ASMA 1Y9OA 2VHGA 4K43A 3CXCM 4JI8J 2DR9A 4CFAA 1R59O 4Y2AA 1WHYA 5EHHA 4USMA 4JUZA 1YHQS 4LREA 4QW8A 1F5CA 2IM1A 2K7JA 3DI6A 2WSFC 2GQ2A 2HK2A 3H5YA 2B9EA 1HPZB 1VRTA 5AT1B 4DU7A 3MHYA 2W9CA 1XNRF 3KHLA 4P9SA 1F9FA 3CMQA 3E9OA 4KHPK 4CT9A 4BRDA 2WCXA 3WQPA 2W40A 3I55N 4WFBQ 4IBNA 2BJEA 4A2BA 2XY5A 2QWLA 1CQMA 3FLCO 3Q0AA 5BR8K 1K8AT 3DLKA 2P9NB 2UUCJ 3ENHA 1SIZA 2C2ZB 1EWRA 4U7UK 3ZSOA 3D2EA 3CNQP 1IKYA 4AXIA 2L41A 1VOMA 3SXLA 3CD6N 2LDIA 2E1CA 2CJQA 1FXLA 4ZHRA 3ENQA 1MW7A 3NWRA 1IJEB 1LCUA 1MN7A 5F8JA 4IO8A 1JLEB 3V9UA 1RWUA 3WUHA 1Q18A 4AF1A 3S1TA 4YR0A 3AVIA 2CQ3A 3VAKA 5FLXY 4Z4FA 4KI4A 3QJJA 4JI3J 2UVVA 2ZH7A 4LF7F 5D0GA 1GTEA 4XIUA 4P10A 4ECTA 2UUAJ 2MSSA 3IGNA 3CCVS 5KFXA 5T41A 4I1TA 4FS1A 2ADBA 3AVBA 3DRSA 3HKZD 2MEWA 4DSKA 3HSZA 6AT1B 2ZOFA 2RE1A 3VN5A 2FLNA 2EFNA 3L2QA 3GOIA 2KO1A 1EHWA 3QO9B 1EIYB 3KWGA 2A1SA 4DV3J 5KFBA 4AL6A 3ENOA 4DTNA 5H1SQ 1I5OB 1UL3A 2Q66A 2KRBA 5AQXA 3KLGA 2LP4A 1DHMA 3QERA 2QWNA 1NM2A 4AXJA 1HNIB 3ULHA 2A0FB 2FD2A 5FPMA 3POTB 4P2SA 5BN9A 4HUEA 2UXBK 5HMYA 2ZD1B 3IKMA 1MWZA 4P74A 1T9WA 2PYLA 1Q8BA 1R43A 2BM1A 5KFQA 1IM4A 1Q81T 1C0FA 4OYXA 1T8EA 1PC5A 4IOCL 1OYDA 5CAAA 2G8IA 4NLPA 4PUOB 4IRDA 3CJ0A 2ZH2A 3AGKA 5CYMA 2PEHA 4ILGB 2MKJA 1IG9A 1YX2A 1UJ4A 4OJGA 4IYQA 4U7CA 2E2OA 1T05B 1WG1A 1T6DA 1R89A 2VQFF 1EETA 5D6GA 2Q31A 2FTRA 4MKBA 4PPZA 4IFYB 4PL8A 3KWMA 5AE1A 2QLWA 3RGIA 2WB1D 4OIXA 3VAGA 4B3RJ 1MWKA 2O8FA 4M3UA 2FVRA 4PRFA 4J37A 3MFIA 4GKKK 4ES3A 4M1KA 5BYRA 1JXLA 2HMPA 1SZ2A 5IWAJ 1K8KB 3OSPA 2E9TA 3RYLA 2E5LK 3T1YJ 2D74B 4P7TA 3J7YI 4RU9A 4B3TF 2NXUA 4IO9L 2ZNZA 3HPOA 2O8DA 2VFSA 2CPYA 3SK3A 1NKEA 3GV8B 2ZDOA 2C2MB 4X84A 2IBKA 4CJ7A 3MM7A 4EZ9A 3BO3A 3ETMA 3CCEN 3IAS9 2ZH9A 1Y11A 2UU9K 4BWMA 3OA9A 3CO0P 2VQEK 4BE0A 2Z0GA 1S6QA 3EWGA 1NNDA 3UR0A 4F8RA 4HDHA 1SJFA 2EW9A 2NR0A 5L8RC 1PCAA 2KFZA 4A8KA 3ZTOA 2CYYA 2FC0A 3FZKA 2QTWA 3VGVA 2F40A 4X4UA 5KFSA 1LWFA 2N7CA 1Z2LA 2B9WA 1N33J 4WZQA 5KFOA 2XCPA 3G4SN 1K1SA 2OIHA 4B3OB 1V9OA 3G82A 2HWIA 3PCOB 1ZTTA 1P1LA 2EEYA 2ZF5O 4BR7A 5AQFA 2RU9A 4ECVA 4BBYA 4LRFA 1DLOB 4CH1A 5HLFA 2F7TA 4KB0A 1H98A 2PEBA 4ED0A 3NAIA 1S1UA 1FEHA 5CYQA 1NSAA 4KFBB 3HFKA 5KGWA 3SAHA 3GIJA 3CM5A 3Q83A 2R8KA 3QFPA 5I9EB 4F2SA 2E1YA 1HQ2A 3KJNB 3I4HX 4NLCA 3MXJA 1WF0A 3KJVA 2EI5A 2HW3A 4IXCA 4FJLA 3ZZPA 4PG7A 4DZDA 3BY5A 2L48A 3W0LA 2XULA 4FJKA 1RWMB 4V19X 4Y0FA 4KREA 2CZ4A 1AUDA 4Y2CA 4BGAA 3DDKA 2VH7A 1Q16B 3V6KA 4FLYA 1XN9A 2XHBA 1WC0A 2VZ9A 1OMSA 5FDLA 2VU5A 2RQKA 3ALYA 1TKTA 1VQLS 1XHXA 1NBEB 4H4MA 4DFPA 4JYAF 3LW5C 2J0XA 3C2PA 3LP2B 5KG3A 3GLJA 1VMBA 2DXDA 1Q5YA 4PAAA 1JLCB 2LEAA 4IH6A 1S7IA 3BBBA 3BYPA 3ATUA 2AZ3A 1F5BA 2PMZD 2OTLN 5HQ8A 2BH1A 4CO5A 3WDOA 4I6AA 5J2MA 1Q82O 1TKXA 1JB0C 3VEYA 5FRNA 2K1RA 2P9SA 5HRSA 3V81B 1CJUA 3C19A 1C1BB 1NK7A 2XMMA 1TP7A 1YVFA 4M3RA 3MMVA 1RSCA 4LF1A 3G96A 1D1UA 4F9OA 2ZM6F 4DS4A 1VRUA 3C6TB 3VA0A 1FFWB 4G9ZA 5T14A 1JLQB 2HLTA 3CD5A 2AKWB 4DV1J 3KNAA 2HVEA 1URRA 3MEDB 2RE2A 4KKOB 2BJ1A 5IT9Y 3NY0A 3DJCA 3TRGA 1UFKA 3RSEB 1SV5B 5M1NA 3MMBA 1AFJA 5DS7A 3UN5A 3F5TA 2CH5A 3MAAB 3OR1B 2BACA 3EO3A 4LF6F 1NLKL 3M32A 1XI1A 3GJSB 4F7VA 5DMRA 2MJUA 3KD5E 3DGPB 4LH4A 2HMIB 1Q7YT 2CGLA 4KB1A 2APOA 4HHUA 4NLUA 2CDRB 6FD1A 3I5BA 5C2DA 3HHLD 1C1BA 2D1KA 3QT6A 4O44A 4WFYA 1BISA 2FZCB 3R5AA 2IVNA 4F3TA 4UW2A 3FQKA 1UW9A 1L5UA 5L1IA 3JQMA 4ZCMA 4MK8A 5H9FK 1WSGA 4KKOA 2IHR1 2XMWA 4JKFA 3RAXA 3O4QA 3ZFVA 2E1PA 3TWZA 4LF2A 2UXCK 1SJ3P 1S72S 5IQ6A 2C2EA 1KVAA 3KXDA 4MK9A 4EU0A 2PMWA 1N36F 2BJ3A 4X66J 3VAHA 4Z4GA 1ZBIA 4CHYA 1KLMB 3D7EO 3PO5A 4RUAA 1YTYA 3MEEA 3BO2A 4GKJJ 1JLGB 1BA0A 2G1HA 1SL1A 1JJ2R 4I69A 3ZZYA 2HAIA 2FLOA 2VBZA 3C14B 4ZJOA 4CHPA 4DR3F 1WTFA 3V4IB 5B08A 2F9JA 3IRWP 3IR6B 5EWFA 4NZ7A 4CHOA 3MCMA 3OYBA 2A1RA 4JI2F 2FHJD 4M5JA 2KT2A 4I68A 2YKPA 4KSEB 2HRYA 2MZ1A 2G4BA 4OLBA 2JEGA 3NH0A 1MWQA 2OANA 2QT7A 5ETKA 2IDOA 3U1NA 2KXHA 3OFHA 3NGYA 3BJYA 5ELZA 3QFUA 2HSTA 1WDDA 2R3VA 4KPCA 2VBXA 1TFYA 5HSPA 3V9SA 5D78A 3P4IA 3TJ9A 2PSZA 3VAJA 4TXSA 3D0GE 4ZVGA 4CI6A 4FK2A 2UV8G 5LJ3Y 1U1OA 4BR9A 4NCGB 5G4DA 1HNZJ 4G3IA 2DYAA 1JCEA 1FJGK 1GOAA 1BUPA 3TVZA 5BPLA 5CH7B 3V6JA 3H46O 2ZVSA 3AXMA 4KH4A 5U47A 2OPSA 5AQWA 1D8ZA 4OX9K 3CMAS 1F2GA 4PXDA 1B92A 5KG7A 3I31A 3CVKA 1ASUA 2ZWOA 2GIRA 4DQSA 3WBZA 1LXJA 2KJWA 1DQ9A 4QZVB 3PJ9A 4BDPA 3V4MA 3HM8A 3H2UB 5KFZA 2ZDPA 3FJ2A 2JFKA 1X5TA 4IKFA 4YR2A 1M1KO 2J7UA 2Q6CA 3D7SB 1KOOA 3GFXA 2BJDA 1KLNA 2Y3YA 4DV2K 2BTFA 3THWB 2J6UA 4O3QA 3K5NA 3VGKA 1NPPA 3ETOA 3RMCA 4UOFA 1CJTB 4K25A 4AHTA 5J2PB 3M6WA 4YOUA 1NPRA 3OBWA 1S6PB 2R8GA 4E19A 3SQGA 3EICA 1WC4A 4L73A 4YN3B 3CJRA 5D15A 1GLEG 5G0RB 4FW1A 4DV7K 3J7ZO 5TKWA 1X9MA 4C97A 3CFPA 1T94A 4LH5A 3MEGA 3VQDA 2ZHBA 4RW7A 3CO9A 1Z05A 2HWTA 4KHRA 3VQ8A 4CI0B 2MDAA 4WFAL 3BF1A 3U7JA 4QBUA 4OYIA 2MB0B 1WOPA 4Y28C 3BKFA 1W2IA 3QIOA 4HTUA 3NF8A 1D9DA 2C1EB 2SXLA 4F4ZA 3BGFA 3KIOA 3VA3A 1E6YA 4JI0F 5JUMA 2GX8A 4FM2A 3ZSXA 3OJSA 4PR6A 3EGNA 3F0NA 1WOSA 5DG7A 4O8UA 5DK5A 2E7WA 5K14A 4ZMMA 4MDBA 2B0GA 5DGBA 3MM9B 4DL5A 2O5DA 4JI1F 4W98A 3DC2A 3KMQA 3UKUB 2B43A 1WUAA 2DNKA 2M0GB 1TV6B 4WK1A 3PW7A 4KV8B 3WQUA 3U9DA 2FVPA 4C3LA 4ZIVA 3OTEA 3KJFB 2VODA 2V67A 2H3GX 2KHDA 2RUGA 3FBCA 3KTQA 4IWVA 2E9RX 3B54A 3R5BA 4FWLA 2YWEA 1VSDA 4WJBA 1Q95G 5AFUH 1RBRA 2QIFA 3GFYA 2JDJA 1M1GA 4O4GA 1FDBA 4LT6A 1N0VC 3BEXA 4CBWA 2GX9A 2GUIA 4CEEA 3LP1A 4F67A 1RTHA 3CCSS 3T1HF 4ZVHA 2GELA 1WC3A 1H2VZ 5AXKA 2VQFJ 4X62F 1EXQA 3R6GB 1RT2A 1Q53A 2YKNA 3MM9A 1KAYA 4KGZB 4NI2A 1M5KC 3LOUA 2CPDA 3HZGA 4OHXA 3QBXA 2G8VA 4DR5J 3KD1E 2OPRB 2AA4A 4WFZA 1HWKA 4A8YA 5F8HA 4RW8B 3AFGA 2ZH8A 1NK0A 5IT4A 5TKYA 3KNGA 7FD1A 1KXPA 2BE2A 4MMOA 3I82A 4DV6K 4B3TJ 4OHZA 1FERA 4YDDB 3EGZA 2LQ9A 5FLXU 3FCHA 3QGIA 1OYEA 2E6LA 3C15B 5KFLA 4OKJA 3W7BA 2OMLA 1QVGM 1HKCA 2HNDB 5KFGA 5CCMA 4FLWA 2R7WA 2HPUA 5HRPA 3IRXA 4DQIA 1GLAG 5HP1A 3ZNUA 2XBPA 1NGHA 2X74A 2WHOA 1YF5L 4NLVA 4LF9K 3CDAA 4F0KA 5F0WA 1RAAB 2DEJA 3KLVA 3PACA 4OYBA 4DFJA 4O0JA 1PYTA 4QIGA 3AA5X 4KRWA 5LJVA 4DSFA 1ZETA 1YIJN 1GX5A 2IAJA 2VIHA 4NB4A 2GHPA 1DURA 3EX7B 4CBUA 2J9DA 2OAUA 1VSKA 5J1NA 1VBYA 2E2QA 2DH8A 3DM2A 1GLJO 3DMJB 4JV1A 4HH1A 4LRAA 1VDHA 3KLHB 2YNGA 1HHTP 2W8KA 3MX5A 2WZ1A 3N79A 4USWA 1HBUB 2HNDA 5K5MA 2DNPA 4BC5A 1MSWD 5L1KA 3BR9A 1TK5A 1HR0F 3AJ2A 5KOWA 2P9IB 1UTAA 2WTUA 1YJVA 3A3NB 5CQGA 4M3TA 2DHGA 4FPBA 4FO0A 3AOAA 4KHQA 3FFIB 3VGUA 3TJ8A 2P9KA 2J0SD 3F44A 2VKRA 2HF4A 1RYSA 1GOCA 4JKAA 2M8HA 5IFMA 3W9IA 1HWLA 3H8YA 3CDBA 4FLTA 1N32J 4K2JA 2NYIA 4A4JA 2PGCA 1W97L 3BBFA 1RILA 1FNMA 4NMLA 3VV2B 3TWHA 1S79A 4B3MK 1CZAN 5JVGQ 2BQ3A 2E29A 3L2VA 4ECYA 2XZTB 3MFHA 2AP1A 3FCWA 2RDDA 1GH8A 4Z0UA 2WVCA 4BE1A 4JYAJ 3MCOA 2BBEA 3NNHA 1WC6A 3HHNB 1I94K 2IMWP 3T5KA 2CQBA 1U09A 4L8RB 2DGQA 2VGMA 4KHPF 3TEGA 3Q86A 3PY8A 3OS1A 3DRRA 5D3GA 1I6JA 4FNHA 4PHTX 1VC5A 4CP5A 4CIOA 4BRAA 3V5RA 1XMBA 4DV4K 4NA2A 3R5CA 2H65B 1T3VA 4LFAF 1TFWA 1S10A 3DAWA 1SB6A 4LD0A 1N8RO 2HQ3A 4J2AA 2FJVA 1UA0A 4K5RA 3C7NB 3NAEA 2LXIA 2YX6A 2V5HG 3V1RA 4OZ5A 2ASOA 5GAHP 2ZM6J 1QSLA 1MA9B 3B4MA 1IBCB 2DJWA 2XHCA 1S9FA 4MO5A 1Y64A 3CDEA 4BRCA 3VQ5A 4D3HA 3WC2A 4M94A 2QLBB 4GVBB 3IFEA 4UY8T 4ELUA 4FK0A 2BKOA 1B9FA 1VFJA 4B9NA 1T6CA 3JTOA 3GSDA 1JL1A 2RJZA 1NDCA 4ZPCA 2BGGA 4LF6J 2LQ8A 2AHOB 5KT3A 1AZSB 5LXRA 2J6SA 1RKIA 3O3FA 5DDRC 2FVQA 1YJRA 1VRQC 1JJ4A 1VISA 3NS5A 2K7KA 2ATQA 3E9LA 1XC3A 2BOAA 3QINA 3OYCA 1K9MO 1HBMA 1U02A 2E20A 5A8RB 2UUWA 3QB0A 1CJVA 4LFCK 3C66A 4EBDA 1SCJB 3EXYA 3QGGA 3JYTB 4C2MA 2FB0A 5DQHA 3SMSA 2YX1A 1VQKN 4UOCA 1AUSL 4Y34A 1EP4A 4BRNA 3KLIA 4JKBA 4KAZA 3IBWA 5KG5A 4PWDA 4YMEA 4YY3F 2AJ0A 2Z2MA 4DMNA 4B8CA 4PYDA 4CYUB 1DEJA 3SUQA 1WAFA 4Q0BB 4H4KC 2J5AA 3LDOA 5HROB 2HBJA 4OO1J 2AYMA 4CZLA 2O8EA 3U9ZA 4MYUA 4EWTA 4MT1A 4M5HA 4QIFA 2D69A 4OJHA 1DTTB 2XTJP 4ZP6A 5GAHU 3TNVA 2Z1HA 1J9AA 2BEFA 1NLVA 4LSNA 1RTJB 4ZS6A 1BQMB 4ZN3A 5A8RA 4CJKA 3N6NA 3QNOA 4GKKF 2V8PA 1H3DA 4O3NA 1Y4ZB 4JI2J 3LPUA 4YFUA 1RCXB 1N5YA 1JX4A 3HD1A 2GFFA 2BYCA 3C16B 4NXMK 4ED2A 4ZP8A 5GAGP 1V5IB 3VAIA 5IT9U 1WC5A 2YHYA 4NX9A 1Q0NA 2FPHX 3NWGA 4TYBA 5IC4B 4C0OC 1FTRA 2HHVA 3ZX3A 4DUZF 3EDQB 1U1QA 3G10A 4AUKA 4AL7A 3EZUA 4ZLLA 3O9UA 2FZKB 2P9GA 2D41A 1CJKB 4Q0BA 1VQ5S 4FYDA 2YKOA 4NLDA 1XMQF 3ZC4A 3DLHA 1N5SA 2IM3A 4WXWA 3HVTB 3T9NA 2ZJQL 3W9HA 1ROFA 2J0QD 3CCJN 4LRCA 2M8DB 1VSMA 1RBUA 2BJ8A 4KE5A 2F9TA 3EYZA 4IR1A 2DRAA 3L2WA 2IY5B 4EO6A 2QA4S 4DTXA 4EMDA 1R31A 3T6BA 4DPUA 1WSVA 3O08A 2C3YA 2L9NA 3D28A 3L95X 5E41A 3FR0A 2F8SA 1RLDA 3D4JA 4ED3A 3OVSA 1EO1A 5D4LA 1IBMF 3KVGA 3C95A 1YI2S 1ESVA 5DRKA 3W3SA 1HBOA 4JB8B 3QEVA 3Q24A 3M6XA 2O01C 5IM0A 3MK6A 3Q8SB 3G6XA 1C1CB 1UCNA 1RT3A 4IG0A 2HNZB 5GVQA 3G8QA 3GL1A 1NO8A 4ECUA 3DRYA 3AAPA 3AOCA 1FTCA 2HBZB 2A2CA 3AVGA 1HNWJ 1ZZNA 1R6YA 2VDIA 3O1WA 4ZKAA 5GAGU 3DFEA 4YB6A 4J2BA 3W8PA 5I3PA 1KN6A 1RAIB 4KBOA 1E6VB 1H2TZ 3NGUA 4B1YB 5T7BA 1ATSA 4J9OA 1EKEA 4OZJA 1W2BR 1NSKL 1UVKA 4OYPA 5HQLA 4CZJA 4JN4A 2YQ0A 5CABA 5DGAA 5HJXA 4ELVA 2DGOA 4X65J 4WP9A 4I7FB 2IC3B 2HBMA 3J7A1 4JI4F 4H4KA 1TZ0A 1X4DA 1YITN 1S57A 2DH9A 3H2LA 2MKKA 4FF3A 5GADP 4JI0J 2JZ5A 4F4KA 1QAYA 3OXGA 3TAMA 4IH5A 5B8HA 3SAFA 3IXQA 3KG0A 4KGMA 2P5VA 4BG9A 2U1AA 5K8PA 1LK7A 1U0SA 4JK7A 4DN0A 3I0SB 5J2QA 4J9RA 2ROPA 1NKBA 2RKIB 1HIYA 1HHSA 2NZTA 3CCUS 3P5BP 1J5EJ 5CZVA 4CIGA 5CZXA 3NNAA 1Q9YA 4NEYA 3KLEA 1TUGB 1CZBA 3MMJA 3HZEA 4E2FB 1RDDA 2FLPA 3LDSA 1IKXB 2JHEA 3D6FB 4E8UA 1U2FA 4DQ8A 5A0YA 3TR8A 4DN9A 1GEHA 1F6TA 2DXEA 1WHVA 3HCXA 1R7IA 3MI7X 2ATLA 5JVGL 1J5OA 2A10A 1B7FA 3MR7A 4O3RA 3P4UB 4M63A 3OTBA 4KTQA 3K59A 3AVAA 5LMUK 4N5SA 1X4EA 2D9OA 3EJMA 2N82B 3M8RA 3NAHA 3L09A 4GRSA 2UYTA 4X62J 2ZBRA 1IBKJ 3M9OB 3FGVA 2NLXA 3L3CA 2DR7A 2QV6A 3BGRA 3R5GA 2Y1JA 2MJNA 3KK2B 3S9HA 5D4NA 2XGPA 2NRRA 4YOYA 5KFFA 1QTNB 4UT4A 3BB5A 3KUEA 1I1GA 2CRLA 3VGLA 2DIUA 2H5JB 1X9WA 1JJCB 4ES1A 5GADU 2YQ1A 1S7HA 4FPRA 2RIJA 2V4QA 4YOVA 2HLUA 4QIWD 1BQNA 1IG8A 1PO6A 3ZEUA 1F3VA 5HMXA 4J9SA 3DXBA 4F36A 1WSEA 2UXCF 1HYZA 1QAXA 3NOCA 4QYZK 1U6ZA 1Q5VA 2W25A 2WSEC 3K5MA 2QW9A 1TUWA 1SQFA 1NWKA 3MF5A 3MCNA 5GADI 4MAKA 1CBKA 5HBMA 5F8LA 1PYOB 4WKRA 4CNYA 5KT6A 1HMVA 1HQEB 3RB0A 3CQXA 3MECA 5B09A 1A6LA 2CPEA 3NG8A 4MKVA 4PWWA 3KK3A 5AQYA 4CTAA 1JLAB 3AO1A 1RHRB 2B5JB 1OY6A 2MZSA 3THXB 1QQOA 4F3MA 4KQZA 2LECA 2AV5A 3OQ2A 1WACA 5C15A 2I0XA 2FJAB 1HR0J 3RR7A 4PA1A 5HAOA 4C8NA 2W9BA 1VQMS 3LDNA 2YWHA 4OL8A 1YG0A 3DLEB 1VQPS 4EGLA 4RNOA 4F4XA 4TSXA 1WSRA 3RBZA 4FKXA 3BZKA 1FJGF 3I6PA 3AA8A 5DZ7A 2Z4PA 5HVFA 1R3NA 1ULRA 3NGZA 4EI2A 1VI7A 2Q79A 3D1HA 4YQWA 2B4PA 2V7ZA 4RBUA 3QNWB 1A7GE 2CJBA 4OX9F 2NYHA 1U04A 2MKCA 3RVCA 2FVSA 3KHGA 4UZCA 5C2CA 1FA0A 1ZBFA 1YSJA 4LUBA 5B7WA 2OLWA 2GGPB 4LBHA 2OEMA 1HKBA 3PRVA 3DLGA 3RJMB 3QDKA 1UVIA 3PJXA 4CW7B 1HYSB 3CXCR 2CPHA 4Y1CA 2ZEJA 1PBUA 4ZVTB 1JJ2M 4KHPJ 1NGCA 5C24B 3IG1B 3LGHA 4NCAA 2VBWA 1FRHA 4DV2F 4FYVB 2XS7A 3CJSA 1YQHA 3IUCA 3KK1B 1MMNA 2YWKA 2M7SA 4R8UA 4CEFA 1XHZA 1ITGA 5BR8J 3RTVA 1S0OA 4IKAA 2VOOA 3PTWA 2V4JB 1G2EA 1C0TB 4YORA 3PM9A 4DV7F 2ZWPA 2WFBA 1PJ6A 4FP9A 1RJJA 2DR5A 2AJQA 4H5VA 3P1GA 2IBOA 4PYAA 1HWIA 4RU2A 2GMLA 3CJ4A 1NGEA 2ASLA 1HNXK 5A76A 3DYAB 5D8HB 5DG9A 3QLHA 4PKGA 4I2PA 2W4DA 5EWGA 2QWRA 2OZMA 4C11A 1WELA 1CG2A 4Q8FA 2IIRA 2QEXS 3MM6A 4MQ3A 2U2FA 3ITHB 2QFIA 3NKYA 3JSMB 3KK1A 1L3VA 1YVUA 3HHKA 1S1VA 2N7YA 3AQOA 3VEOA 2ZKUA 4LIWA 3JB9k 4F25A 3P49B 3SDEB 2XS5A 1VBZA 3UQSA 4CLYA 4CZFA 3FZLA 3A0IX 1AW0A 1L3KA 4OI2A 3VQPA 4ILRA 5C12A 8RUCA 1U1NA 4GV9A 3QZ8A 2JOQA 2QLJB 3ZZOA 5KFEA 3R97A 4ZPVR 3U4LA 2J7KA 4JI6F 1VQON 2UXBJ 4B9LA 2HVZA 4CO1A 3BH6B 2R8IA 1YTAA 2CJYB 5FRMA 2BW2A 3CHWA 4PG4A 3OL9A 1VQ7N 3L4BC 3H0PA 4C8OA 1FNOA 2DPIA 4PQUB 3VVUA 5B0GA 3EVOA 1CLQA 1XNRK 1HW9A 1IKVB 5HANA 1O13A 1RTIA 2QX0A 1ACMB 3H3NO 4A2AA 4GV6A 2AJ1A 3J7AP 4HACB 1YBTA 4MFBB 2IDLA 1VQ9S 1UKUA 3M7VA 2KFNA 3RMBA 2FJDB 4RW9B 1R6VA 2RF2B 2VB6A 3UB5A 1RT1A 1NJIT 4NRTA 5F3ZA 5F8MA 3CFOA 1FRKA 4MIBA 1KVIA 2A6MA 2RS2A 3FSYA 2GUPA 1XBWA 1D9FA 4J9KA 4CJSA 3GV7B 3WZ0A 2PAVA 1W7WA 1S99A 1X5PA 4B9TA 2V8GA 3CMES 3PFEA 2HFVA 5KFNA 1Z2ZA 4BRGA 1MROB 2GIFA 4M95A 3PW5A 2E5LJ 1X1PA 1HX1A 4KGKA 3CPEA 3CCZA 4B9UA 4FS2A 1HNVB 3CCSN 3SBMA 1FRMA 1RHKB 4UOGA 4HI1A 5KAKA 4KGXB 2X1BA 2HBLA 4Q2MA 3M6GA 3SBTA 1VQNS 1RI7A 3R8EA 4LBIA 4EEYA 2FGCA 1RFQA 4TY8B 4CJ5A 3OUYB 2UU9J 4RUCA 1NJWA 1T03A 1NGBA 4LF9F 2VQEJ 1KC8O 2CXEA 3ZLJA 3CC7S 1FK9B 5CZ2A 3GWCA 2QSFA 3I87A 3MM8A 2XMTA 2Q6BA 1S97A 2ASJA 4NLOA 2MLXA 3MZIA 1JNZB 2MQMA 4FJGA 1RHMB 2CPJA 1RT7B 3AD8C 3J80Y 1Z4UA 2ZZNA 4M5DB 4KAIA 4P72A 3M8YA 3Q8PB 2YI1A 3E8OA 3AO4A 1VK3A 3GIMA 4A8FA 2FJXA 1IBLK 3SQ4A 4MDAA 3LO3A 3OFEA 4NMXA 3L4IA 1WN7A 1RNHA 3LPEA 4Q43A 4FJIA 3WXLA 4M3YA 2IS3A 3D3BJ 4TLQA 3HHLC 1NHKL 4CM2A 4FWKA 1TAQA 2LFVA 3NBPA 3VAFA 4XO0A 1UEVA 4K41A 4QPTA 4F0MA 4X64J 3EE9A 3H4BA 3TZXA 4AYBD 2RT3A 2P9LA 3GJRB 1S1WB 3NOGA 1K73O 1NGAA 4PXCA 2E1ZA 4U9RA 4O23A 4HTLA 1BWEA 4DU1A 1S9EB 2HHQA 2I5JB 2C2NA 1H72C 2G8KA 4NLGA 1EJ7L 3KKRA 2JVRA 2VFTA 2ZJRL 4EBEA 2P6SA 2HHSA 4U6PA 2KQ2A 1JMTA 3WXIA 3JSYA 2HVDA 4XTTA 3L9ZA 1ZYQA 1LW2A 3OVNA 3EMTA 4FSVA 1CEZA 1UA1A 1RU1A 2BMBA 1VQ8S 2DGTA 3ZSYA 3PX0A 3WXMB 2HHPA 2LKZA 2HURA 1I94F 2UUTA 4K4ZA 4QWDA 5C25B 2BW7A 2R7RA 4QOTA 2WUSA 3PKMA 2YKMB 3VEXA 1BL3A 4JKGB 2QA1A 4C3KA 4DV4F 2AEJA 3MUMP 3TTFA 4ED8A 4QIEA 2J9CA 3NHGA 5J2NB 3TZYA 2QYGA 3AD7C 2PIIA 2XYPB 1WUUA 1IR0A 3FSIA 2BX6A 1B7YB 4S0MA 4XPEA 1JXEA 4CF8A 4C8ZA 4CJWA 2XG8A 2YVSA 1U2VB 4TVAB 4MLEA 4BREA 3RAMA 1QSSA 2DKOB 2A1BA 3RW6A 2W8LA 2HHHK 3WNGA 3OYJA 4NLYA 2O8BA 4K4VA 5AZIA 5HRRA 4JKEA 1WSJA 3D45A 2DNYA 2VJUA 2B9YA 3JQJA 1NM1A 4ISFA 1UEUA 1AFIA 2P6TA 4U95A 2YCHA 1G99A 4GC7A 4NYNA 4UZBA 4AM7A 4FLZA 2B9XA 2VFUA 2KDOA 2UP1A 3OFFA 1H38A 5ETPA 1U1MA 2VPXB 2Z30B 4R0EA 2HIYA 3LPTA 3M8PB 4H0TB 4B17A 1NDLA 1SVDA 2C2DA 4USVA 4M8LA 4CF9A 5LY3A 1NJYA 2DGWA 3MR3A 2WW8A 1BUXA 3AO3A 3CD0A 1EX4A 1ZH5A 1VBXA 3SV4A 2DNMA 5J1EB 3AY9A 3PW0A 1DTQB 1XEZA 5H9FJ 5E3PA 1HJRA 2DR8A 3HHLA 3B6OA 5EY4A 1AA1B 2Z56B 3R5JB 1TMJA 3QBCA 2UXCJ 3HRGA 4MO4A 1VQ4S 4BRHA 1B3TA 3DKDA 3DLLQ 2M88A 1UMJA 3D5MA 3UKRB 3RMAA 5FPNA 3DOLA 4DTRA 3EDRB 4QU6A 1L3UA 1D9AA 1SH0A 4W5QA 1BI4A 1U26A 2BXJA 3EVWA 1KAXA 4O4RA 2NPFA 1QHTA 4R5PA 1H6KX 3M2RB 2VFRA 2J8SA 3RW7A 3UO0A 2AEFA 2MGZA 3THYA 4GVEA 4FWNA 3PG9A 1NK5A 3OL6A 3P83D 5LJ5Y 3LL3A 2KHOA 5AQVA 5E0OA 5GMKa 4ZOSA 3NCRA 5M2RA 4JI8K 1Y5LB 1NUEA 4EIAA 3WX8A 2RS8A 4YEAA 4BRFA 2FHJA 1BMQB 1M90O 2F4VK 4FJNA 3ET6A 2FBYA 1VBKA 5AQZA 2IJRA 3NCPA 4MYTA 5ETLA 2GO8A 1JKHB 1FJGJ 1LW0B 2Z2LA 5JS1A 2FGOA 2Q1LA 1QHAA 2P2CB 3MMAB 2G2ZA 3R7BB 3QICA 1Q7YO 2GMJA 3G6EN 2VPWB 3CJKA 4U8YA 4DQQA 1TL1A 3Q2SC 4OX9J 4DL4A 1VCTA 4I9QA 1CXUA 1VSEA 1Z25A 3VPZA 2XGQA 4DEZA 3VQEA 1KR4A 4OZ1A 3TO8A 5JS2A 4I64A 4K8RA 4NYPA 1T11A 2J76E 2EPIA 2IM0A 2C2KB 4P73A 1RT4B 4ZDNA 4C9DA 2RAQA 4BY9C 1X4BA 2PBDA 1S6UA 4PKIA 2FZGB 2CA9A 3E01B 1XTZA 3BSOA 1JLFB 1WOOA 3CC2N 1NGGA 4DV2J 1X3NA 3T41A 1N36K 1Q4RA 5ETMA 4DDFA 4EFHA 2KYXA 1CS4B 2BUNA 3DHWC 4IZ9A 1J54A 3UDEA 2AGOA 4OJRA 4LBPA 2MHNA 1S48A 3FRZA 4CLUA 3GG0A 3SYZA 1YK9A 4L76A 4B8AB 1LQ9A 2VOPA 2NLWA 5M1QA 2E6MA 5ITHA 3V1OA 4UY85 4DR3K 1NK9A 4I6MB 2A41A 2ZZTA 1IUJA 4MK7A 3T6JA 4BVPA 3AVFA 4DR2F 3OV7A 4KJIA 1KVJA 2BDPA 1GLDG 4DX7A 5AQRA 2GV9A 2WOMB 1WG5A 3F9KA 1BLUA 2D0AA 1YJNS 2OKQA 2F8HA 1VK0A 4E7LA 2IGIA 4P2XA 3NFAA 3A3PB 4U7BA 1O1WA 3B4DA 4K4TA 1HBNB 1IN0A 2O4IA 4DXLA 5GAEP 4ZA1A 2R2RA 4I2QB 2NRZA 4NCBA 4DQPA 1A0OB 3CT9A 5E3AA 2ZH4A 3NMUA 1N34F 3QAEA 3FSXA 4TYAA 3UNYA 2LVWA 3NGTA 4H54A 4EHUA 4LF5K 4RX6A 1NKCA 3FNNA 1SUQA 3PYGA 2W7AA 3BGLA 3HBTA 4CEDA 3N5FA 3FBFA 2D1CA 3ENBA 2IA6A 2VWJA 2IVFB 3CC4N 4WYLA 5F3TA 3U3GA 3IO1A 1QZ5A 3MMCB 2W6KA 2EWSA 1GXLA 1RCHA 1RAHB 3MXMA 4X4RA 2R7SA 4J7CA 5I42B 1O8BA 4OPJA 3D2FB 2CPFA 4OI1A 3TYTA 1MG7A 5EOYA 3M9MB 3R1XA 2IFXA 3GJQB 1CPZA 1FO1A 3MN9A 1HBNA 1S4FA 2VCPA 4YP3A 3AD9C 3P3DA 3SI8A 3CPWM 4EYIB 3K2PA 5LMUF 3MCSA 3PO4A 3I32A 3CCMS 4IEIA 3KWIA 4OZLA 3VQ6A 1KVCA 3IN5A 1NK6A 4FJXA 2I7NA 4KIAA 3IBFB 3HFVA 4FWRA 4USIA 1SJ1A 3I9V9 4DOZA 2JC0A 3QAUA 1SC6A 5HK4A 4ILMA 2LDYA 2CQ0A 2R8HA 1FKOB 4V19J 3HULA 1JK9B 1NAQA 3R7NB 4ISGA 3EM1A 2JNJA 1ATNA 2DT9A 2XMAA 3VF6A 2COLA 1ZBTA 2XLIA 4HLBA 1Q82T 2GC8A 1EB0A 3ZSZA 3T5LA 4DV6J 2OUGA 2HIQA 4M3WA 3PIPL 4CDIA 3NF9A 2KKHA 4ID1A 1RT5B 4K5SA 1UETA 3VALA 4WP8A 3QSYB 1SKRA 1RBLA 3L3UA 1HHQA 3OYMA 1NU4A 2E8AA 2DHAA 3FKBA 1N33K 4K7QA 1CQNA 5BJRA 2HGMA 4LF9J 1ZAWA 3ZETA 1XMOF 2ASPA 1N48A 3M2UB 1QVGR 3K5LA 2AD9A 3N6LA 1LAWA 3CIPA 1BCMA 3NL0A 4DG1A 4JI5K 5AZJB 4FLUA 3M9NB 3DN9A 4PPDA 2HKEA 3PEJA 2RQMA 1OQ3A 4FLXA 4FJHA 1T7PA 4DHYA 2CQ4A 4LF8K 1X4AA 1GMUA 3CIMA 1V4TA 2RRBA 3SIPB 5CZ1A 3FVYA 3OSNA 3BN4A 2HGNA 1ZM2A 2JLGA 1RHJB 1MDUB 1R8BA 4JI7F 1FX4A 2RRAA 3T1HK 3DLLL 3HX9A 2HFOA 1FKPA 2QC3A 4H5NA 3CSKA 2Z8QA 4C8LA 5JVHQ 2XZWA 3B82A 1RYRA 3L0QA 2NRXA 2DHHA 4L75A 2P5GA 1QAJA 4JK8A 2G0IA 2C3PA 5F8IA 1IWAA 4IDKB 3V6DA 3DXKB 2NZ4A 1RAGB 2RN2A 4NLSA 2DIVA 1LFWA 2VA3A 1VAZA 2PYJA 1QQCA 2JEJA 4B3MJ 2B6AB 4A47A 5C7PA 2E2PA 3QRQA 3D66A 1H2UX 2G8UA 3W5YA 3EZOA 1YJWN 1WLJA 1RWVB 4OV1A 5EN1A 1I94J 3HO1A 3BREA 3M2VB 3ONQA 4UQGA 4JLHA 3OR2A 1ZOTA 2V63A 3OL7A 3AA4A 1TKZA 3D67A 2WBNA 1SJRA 1PILA 4DV4J 1F1BB 2VGNA 4H0PA 2CG8A 3AA2A 2H51B 4M45A 2AJ2A 4BG8A 1RB0A 2Y9HA 2G8HA 4DTMA 1RWPB 3J80U 2W2QP 3T69A 1BQXA 1RAJA 3MD3A 4G1QB 1YJ9S 4GVLA 4KHMA 5T7LA 1HNXF 5MAOA 1FRLA 5AQHA 4EO8A 4E1NA 4NOHA 3IR7B 3QPIA 4JAXA 3V2UC 3W2WA 3ZXWA 4CBXA 1G15A 3RBDA 1CZ9A 3SLCA 3EKSA 4ANDA 4ECQA 1BGXT 2W1BA 2F8TA 4K4YA 5IOLA 4WE1B 4LF4J 3PNIA 1VHXA 3MWTA 4J2DA 4WU2A 4ZTFA 4IFEA 4ZVQB 3UDCA 2P5OA 5AQGA 4CM0A 1UPPA 1QZ6A 4TU7A 1XR5A 3QETA 3KLFA 2CZ9A 1RWXB 3ULEB 1S76D 1W0HA 1K0TA 1YJUA 5KRTA 4C98A 1I39A