3DRRA

Hiv reverse transcriptase y181c mutant in complex with inhibitor r8e
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
558
structure length
558
Chain Sequence
SPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-{5-[(6-Amino-1H-pyrazolo[3,4-b]pyridine-3-yl)methoxy]-2-chlorophenoxy}-5-chlorobenzonitrile (MK-4965): A Potent, Orally Bioavailable HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitor with Improved Potency against Key Mutant Viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 148
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3drrA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3drrA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3drrA05
4DTUA 3V6KA 1DTQB 2D3UA 1LW2B 4FS2A 2FVCA 4G3IA 1CLQA 4IG0A 4J9LA 1JL1A 4DG1B 2DY4A 3NF7A 4M41A 1S9GB 3SPZA 4XIUA 2R2UA 1X9WA 4FZZA 4FYDA 3KNAA 4IKFA 1S0NA 4FZXC 4M94A 2E9ZA 2BQUA 4CEDA 1G15A 5FDLB 4DMNA 2VA2A 3MR2A 5DGAA 1BIUA 3QO9B 4IRDA 2AQ4A 4XPEA 4LQ3A 1YVUA 4O5BA 4I7FA 3KLHB 2OPRB 3C6TB 4QAGA 1C0MA 1T94A 1KRPA 3NL0A 3M8PB 2C22A 3QYYA 2FLNA 4K4TA 1JXLA 3L2QA 2XI2A 5C25B 4CF9A 4ZPDA 3ZT3A 3NF9A 3KK1B 2FJVA 1TGOA 2IJFA 4RW9A 1ZBHA 5JUMA 4CJUA 3SUQA 2RF2B 3T19A 1TKXB 3KOAA 2FBYA 1JKHA 4ID5A 5KG5A 4NYZA 4KB1A 1KFDA 4F4WA 3WNFA 4FJLA 4HCCA 2AGQA 5CY4A 1BQMB 1JLQA 4ED7A 3BR9A 1CXUA 4ZPCA 4FS1A 4ED2A 3WNGA 3QO9A 2G8VA 1ITGA 1JLBB 2W9BA 3ZSQA 3DRSA 4RU9A 4IR9A 4K4YA 4DEZA 3BGRA 1QS4A 3LANA 4RW4A 3MXIA 1LW0B 2BRLA 4Q8EA 3OS2A 4FJNA 2B43A 3KK1A 4Q5VA 4ICLA 3CM5A 1HYVA 4CJQA 4Z4GA 4M3WA 2RF2A 3MF5A 3DRPB 3RBDA 2E9RX 3HL8A 4F2RA 4KHMA 3V6JA 1T05A 4J9KA 3LAKA 3M8QB 4ICLB 3EPIA 3HVTB 3QESA 4RW8B 4KPYA 3P83D 3AA4A 2BANB 5HRNA 2W9BB 3MEEA 4WZQA 3PY8A 2YKMB 4JLHA 2HHSA 4OGCA 4OL8A 5KFHA 3NGYA 3ZCMA 1XC9A 3DRRA 5HLFA 2UVVA 4CK3A 4EYHB 4RNOA 1Q9YA 3VQDA 4Y2AA 3DLEB 3RBEA 3DM2A 2EX3A 1L5UA 3T3FA 4AILC 5KFSA 3HK2A 3N6MA 2IBKA 3AVJA 3PHEA 1J9AA 1Z25A 1EP4B 1RTDB 2CJQA 5HLFB 2D41A 3KMQA 1S1TB 1B9DA 1DLOA 3AA2A 3OL7A 4E7HA 4URSA 4E7IA 4DSEA 4O3OA 4FK4A 2W8LA 4AHUA 4FJMA 1LAWA 3HYFA 4TY9A 3FSIA 5T14A 1RT1A 4CF8A 4CCHA 2HHVA 3QIDA 1KTQA 1FKPA 4E89A 3GQCA 4Z4HA 4PQUB 1J54A 4KI4A 4FJXA 3HPOA 4HTUA 3TI0A 4MQ3A 4FLZA 1FKOB 3I0RB 2RDJA 4CESA 4DLEA 4N47A 4ECVA 2HAIA 5DLGA 3M9OB 4OPJA 4RW7B 1GOAA 3DLGB 4ECXA 2DTUA 5F8HA 4I9QA 4J2DA 4CJKA 4IG3B 1N6QB 1LWCA 2ETJA 1TK0A 3RAXA 4J9QA 1U47A 3SQ2A 2F8SA 1FXXA 3OS1A 4BACA 4OLBA 5KG1A 4NLTA 4WE1B 1NK7A 3L3UA 2VG7A 2XCPA 3OSNA 1NKEA 1D5AA 4HUGA 2I5JB 2ZE2B 1XWLA 3NBPA 4ECUA 5KT5A 1A5WA 1UWBB 3KLEB 3IGVA 3BDPA 3OHAA 3SPYA 1TV6B 2XC9A 1LWFA 4BWMA 1D1UA 2IAJA 3TAQA 4ZTJA 4FXDA 4RW6A 1ZBLA 3KK3A 3TAPA 2C2DA 3RR7A 1ZYQA 4IH7A 1K6YA 4DFMA 1HQUA 3LP2B 1C2PA 3PW0A 3L8BA 1XHXA 4BE1A 3SQ4A 1S10A 4EO6A 5DG9A 3NH2A 4RUCA 1TKTB 2IC3A 1QE1B 2D5RA 4HUFA 5F9NA 2OPSB 1RT5A 1VSJA 1ASVA 4TSXA 3V1RA 4ZMMA 2PYLA 1U4BA 1RBRA 4AH9A 4E19A 4E1MA 3AVIA 3KK2B 5KRSA 2JC0A 3V4IB 4B3OA 2R8JA 3OJUA 3ZT4A 4KE5A 2BQRA 2RKIA 5FRNA 1NJYA 2HHUA 4YP3A 1VSFA 4CFAA 1X1PA 2KW4A 1EXQA 1TL3A 3KLVA 3ALYA 4DQPA 2DPJA 1HNIA 2ILZA 5DG8A 3QGIA 1MU2A 1Z4UA 3LZIA 3RRGA 5KFNA 4CIEA 3UIQA 4IFYA 4KKOA 4W5QA 1L3UA 2QV6A 3RB6A 3DOLA 3ZT2A 4FLVA 4O4GA 4R8UB 3BJYA 1JLFA 3CVKA 4JUZA 4FW2A 4FK0A 3TAFA 5KT3A 2WTFA 4W5RA 3I5CA 1KHVA 4AHCA 2G8WA 4JV0A 1JIHA 1NHUA 5C5JA 5KT2A 4BDPA 3DOLB 4F3TA 3NAEA 1UAXA 4CHQA 3S3MA 4CEZA 1N5YB 1MMLA 2RKIB 4CJVA 4CGDA 4FLUA 3HVAA 4CFBA 1NHVA 1RTJB 4Y34A 3QEWA 1C6VA 2PYJA 2QE5A 1IKWA 3JSMA 3G6YA 3PJWA 1JKHB 2YNGA 4OKKA 4DLGA 3PJXA 2HMIB 1SUQB 2IOCA 4ZP9A 2Z1JA 3CYMA 4PUOB 3QIPA 2G8UA 5J2QA 2FVSA 1ZTTA 4DL3A 3CQ8A 3KIOA 3KLGA 1YVFA 3P5JA 3THVA 1SH2A 3NAIA 4ECRA 4B08A 4W5TA 3OSPA 1DTTB 5J2NA 1HYZA 4NLYA 4RNNA 2V4RA 1RT3B 3V81B 4R5PA 5JS1A 4MIAA 1WN7A 2P1JA 3OYBA 3D45A 3HSTB 3OYAA 1RILA 2HWHA 2Q3SA 2O4IA 2IJNA 1JX4A 1D9DA 4NCBA 4F3OA 2GIRA 4NLSA 4GMJB 2J6UA 4TQRA 3D0PA 1D9FA 1RT6A 4C8KA 4NLXA 4KB7A 5DLFA 3LWLA 4WYWA 1S1XA 3BQ0A 2OPQA 1EKEA 1SH3A 3H5YA 2OYQA 1JLCA 3VQ9A 1FK9B 4NLVA 4H4MB 1HNVA 3N6LA 3NFAA 3AVHA 3MXJA 2KQ2A 3H4DA 3LP0A 3K5MA 1K1QA 4ELVA 4CE9A 2JEGA 3NE6A 4FK2A 3NDKA 4C8LA 3PW5A 2JC1A 3DLBA 3ZSXA 3V9WA 4ECSA 3QNOA 1JLQB 4CGJA 3SV4A 1BL3A 3OS0A 1RCHA 3RB4A 1JLAB 1XR5A 1W9HA 4PY5A 1B9FA 2IMWP 3VQ6A 3DMJA 2JEIA 4CF2A 3BQ1A 3KD1E 2Y1IA 3PVXA 3OLBA 2YHAA 4DFPA 2EC0A 2Y1JA 2W9AA 1RTDA 1XI1A 3ZSYA 2Z1IA 4U7CA 1BI4A 1JLGA 1BHLA 4N41A 3AVLA 2XY6A 3QZ7A 2ASLA 5CZ2A 1RDBA 4R0EA 3HO1A 3AO5A 1C0UA 3CDUA 2P5GA 1N48A 4CJFA 2F96A 4ECTA 3O3GA 2AGPA 4H4OA 4I2PB 5HROA 5KG4A 1CZ9A 4DSJA 1IG9A 3U6FA 3DI6B 1WSHA 4NLGA 2D0BA 4MH8A 4MFBA 5F9LA 4FJ5A 5HRPA 1S48A 3DDKA 5KFZA 2XGPA 2BANA 1N6QA 4MK8A 4X2BA 2YKMA 3G10A 4J9SA 4DTRA 3QGHA 1KVCA 1WSJA 2BQ3A 4EO8A 4ZHRB 1R0AA 2GC8A 2ZD1A 3QEIA 3IAYA 3RWUA 4E3SA 1WNEA 4Q8FA 2QKBA 4ZVEA 2X74A 4ZPAA 3DM2B 4ELTA 2YNIB 3KJVA 3N6NA 1BCOA 1S0MA 4IR1A 1EP4A 4B9NA 3BGRB 1S97A 4QOZB 4PWDB 2G8KA 4DTMA 5FDLA 4B9UA 2IM1A 4FLTA 4FJGA 4KTWA 3V9XA 1SV5A 3QETA 3Q8PB 3ZSOA 3C6TA 3PR5B 4OKJA 3KJVB 3QGGA 4WFZA 2KZMA 4FJKA 3OYGA 4PWDA 4GW6A 4FZYA 1HJRA 4CJPA 4KV8A 4FVMA 3I0RA 5F8MA 4WXOA 4RG8A 1RBSA 4ZHRA 3OYLA 1HARA 3HM9A 3M8QA 3NGZA 3DLKB 3L2WA 1CXQA 3P1GA 4IG3A 4ZP7A 3PZPA 4TY8B 1LWEA 1QHTA 2C28A 4KHYA 1A5VA 3SFGA 3SJJA 2IDOA 3PUFA 3VQBA 2AU0A 3B6OA 4H54A 4OGEA 4CGIA 3SI6A 5L1KA 4O55A 4BWJA 1RT4B 2JEFA 1XR6A 4TY8A 1QSYA 4IH5A 4M95A 4CK1A 3NH0A 4B9LA 3NF6A 4JV1A 1CZBA 4AHSA 4TQSA 2YNFA 4EBCA 4KHRA 4J2AA 1S6PB 1RA7A 3SV3A 3AO2A 4CJ3A 1LW0A 3RMBA 2R2TA 2KZZA 4AHRA 1HQUB 1QAIA 1ZBFA 1I3AA 4N5SA 1KLMA 4QWEA 4Z0UA 4HUEA 3KTQA 4Z4CA 1VRUA 2WOMB 2HNZA 3CJ0A 2J6SA 4B9SA 5KFEA 4DTJA 1RTIA 4JS4A 3M8SA 1BIZA 3ZSWA 5I42B 4LSNB 3OL8A 3QEPA 1RDDA 2FBTA 3PX6A 1S5JA 2UUTA 4CECA 3HVTA 4I9LA 5KFAA 4IBNA 3TARA 1NKBA 4YR2A 3LP3A 1A5XA 2XWYA 5KFCA 4K4SA 3SQ0A 3ISNC 3WNHA 3GIKA 1SL0A 5J1EA 1D8YA 1DTTA 3HVWA 4NCAA 3QLHB 1L3SA 4F2SA 3CFPA 1RT7A 3I8DA 1J53A 2B5JB 4MKBA 3M9NB 3D5MA 4O3RA 1HPZB 4F8RA 3IRXB 3KLIB 3NKYA 3NBPB 4I2QB 4DTOA 4N76A 1RDCA 3LDSA 1LWFB 2OPPA 1HRHA 4EP5A 4IDKB 2F8TA 4F4YA 4DQIA 3TAMA 2O5DA 3HP6A 3Q8SB 1NOZA 3MEGB 3M9MB 3VQEA 3KD5E 2O4GA 1C1CA 1U45A 4CF0A 5F8IA 1YTUA 3EYZA 4DU4A 3LAMA 3AVGA 2FLLA 4IRCA 3E51A 5KG6A 3JYTB 2JLEA 1WNSA 2BR0A 4CFDA 2OPSA 1IKXA 1ASUA 1XR7A 3ISND 3VQQA 2R8HA 4NRTA 3LPUA 1JXEA 4DL5A 2ATLA 4HHTA 2WCXA 2HMIA 3V4IA 4B3OB 4RW7A 1IM4A 2B5JA 3KLGB 4H8KA 2XGQA 4M3YA 3HVRA 1QSSA 4TYBA 2UVWA 3E01A 5KFGA 3DMJB 1C0TB 2B4JA 3BSCA 4NLRA 3AO3A 3IN5A 3F73A 4CIGA 3VA3A 4WYLA 1T3NA 3VA0A 4RNFA 2VG5B 3OVNA 4DTXA 4O4GB 4K8XA 4CHPA 3HJFA 2FBXA 1S1UA 3ICLA 1ZBIA 1TV6A 4JV2A 3C6UB 3KHRA 1IKXB 3TWHA 4DSLA 1WSFA 3AO1A 4H4OB 4I2PA 4CEBA 4B9TA 1JLCB 3A2FA 2F8EX 3LALA 3KK3B 1S0OA 3FFIA 4Q0BB 3VQ5A 3V9SA 3T5JA 1RYRA 2OA8A 4DTPA 1NJWA 4DG1A 1JXBA 3VQPA 1RTJA 3HPHA 2HNYB 1GX5A 1C0TA 4CF1A 4MIBA 5J2MB 3QINA 3MR6A 2WK4A 2HWIA 4GC6A 2XY5A 1SUQA 5C25A 2PY5A 4Z4EA 4O44A 1NK8A 2XCAA 2VG5A 4XPCA 4ED8A 3CO9A 3IS9B 3IGNA 4RW9B 2WONA 5HRRA 1HNIB 1BGXT 1VSDA 4K4WA 4KHQA 1MU2B 1HMVB 4ZTFA 4ID5B 4AHVA 4KHWA 1LW2A 1J5OB 2VG6A 4LD0A 1WAFA 3HP9A 2BE2A 1BI4B 3L2VA 2PZSA 3K5OA 3IS9A 4CJLA 4K4UA 3OYHA 4DS4A 4CJ5A 4FLXA 4E7JA 4DL2A 2VG6B 5J2MA 4RW4B 1QUVA 3DOKB 2VWJA 2V0NA 4K4VA 4NCGA 2RDIA 4J9NA 2Z1HA 4MK9A 4E0DA 3AVKA 2FVRA 1BCMA 4DSKA 4NYFA 4FJ7A 4QCLA 4O0JA 4KHNA 1S9GA 1KFSA 2KFZA 2GIQA 4B9MA 1D0EA 3AVCA 4ZP6A 4F4XA 3L2UA 4DFKA 3SUNA 1R0AB 2AJQA 4CERA 2DFEA 4RZRA 5KFDA 4RNHA 5E41A 1RT4A 1JLAA 4W5OA 1TKXA 1TKZB 5EWEA 1VSKA 3MFHA 5KFFA 3AA3A 1RNHA 1O1WA 1REVB 1T03A 1B92A 4BE0A 4M42A 3KHHA 4OKEA 4NCGB 3AVNA 3GIJA 4NZ0A 5FRMA 1WAJA 2HHXA 2QXFA 1YT3A 4DL7A 1TKZA 3OY9A 5HRSA 1S1VA 1TKDA 1SKSA 3SZ2A 2V4QA 2OPQB 1NK6A 2C2EA 3DYAA 4KAIA 3K5NA 3NCIA 2QK9A 1ZBUA 3SI8A 3DI6A 3SYZA 3AO4A 3DRRB 3O4NA 3PW4A 1TP7A 2E9TA 4EZ9A 1N4LA 3H59A 2HVHA 4FM2A 4K8ZA 3AVBA 5EWFA 2ZQBA 3DLEA 4ID1A 4KSEB 5KFYA 2UVUA 3RMAA 2KTQA 1HQEB 4Q45A 3DYAB 3CG7A 2IM0A 1TL1B 1T05B 4KRFA 3GV5B 1VSIA 4ZPBA 1KLNA 4FW1A 4IFVB 3RB3A 4CGHA 3NF8A 3CJ3A 1RBUA 3NAHA 4FLYA 2YNIA 5HP1B 5CZ1A 4NLQA 4ZVGA 2NUBA 2FVQA 3MTKA 4F4KA 1UA0A 5J2PA 5EDWA 5T7BA 5KG0A 3PO5A 3CFRA 5SZTA 3AA5X 2B6AA 3H5XA 5KRTA 2R8IA 1Q8IA 3PX0A 3WNEA 1KLMB 5KFRA 3GYNA 4BE2A 4DL6A 3OLAA 4K4XA 3DLRA 3JYTA 4TYAA 3MEEB 3RMCA 4QWAA 3LWMA 5CYMB 3OL9A 3ZT1A 4ZP8A 4OJRA 2DPIA 4J2BA 1TK5A 4M3RA 5C42B 2OZSA 3IG1B 3NGDA 3CM6A 1IH7A 1ASWA 2FBVA 3ZT0A 4DQQA 1C1BA 1YTAA 4NLWA 2I5JA 1S9EA 2ITGA 5DQGA 1GOCA 1TKTA 1S9FA 5DG7A 4DTNA 2VA3A 5L9XA 1FKOA 3LZJA 1EETB 4TXSA 3K58A 3S9HA 4RW6B 2X6SA 3CDEA 2GV9A 2B6AB 3U3GA 4M3UA 4B8AB 4K4ZA 3LP2A 3D28A 4KREA 3BSOA 4Y2CA 3OHBA 5KFPA 2OPPB 4BDYA 2XHBA 4LSLB 2D0CA 2HHTA 3CJ4A 1Q9XA 1JLEA 1IKVA 4J9RA 3KHGA 3H2LA 4IFYB 1L3TA 1X9SA 2IS3A 3K59A 4NLDA 3CWJA 2G8HA 4FCYA 5KFTA 4J9PA 4O3NA 5L1IA 4CGGA 5KFVA 4YR0A 2IGIA 1C1BB 2W8KA 1WSEA 2YKNB 5KG3A 1S9EB 3V1QA 4FJJA 4UQGA 3Q8QB 1LV5A 1LWCB 1IO2A 2IAJB 1VSHA 2YHBA 4DL4A 1VSMA 3RR8A 2HHQA 4IH6A 3ITHA 2X6NA 2G8FA 1NK5A 4CEQA 1RTHB 2DFFA 1QSLA 2EHGA 2YKNA 3GILA 1K1SA 1S6QB 2ZE2A 4TN2A 2E6MA 5DQHA 5KFJA 3NGIA 3KLEA 3CJ2A 4KHUA 3SFUA 4IKAA 3JSMB 5CYQA 3C94A 3K57A 3EZUA 3FQKA 3Q8RB 3MR5A 3QLHA 5KFWA 3BREA 1KVAA 2AGOA 4C8OA 3T5KA 3G6VA 2C2RA 1NJZA 1TQLA 1UOCA 4Y1CA 2AWZA 3V9UA 1N5YA 4GVMA 3F9KA 3K2PA 1NK0A 3OYMA 2FC0A 4IRKA 5D3GA 1NK9A 4KTZA 1IKYB 4KO0B 3FFIB 2R2SA 2HVIA 3BSNA 3KK2A 3AVFA 4DF8A 2UVRA 2XY8A 5C24A 4FM0A 3NHGA 1S6QA 1RT6B 5HBMA 1QQCA 3O3FA 4HKQA 3PR4A 1SL1A 5KFKA 1WSGA 1S1XB 2OZMA 5KT4A 1RTIB 3TANA 4N56A 4KO0A 4LSNA 1NJXA 4ECZA 1DTQA 4Q43A 4R5PB 5KFIA 4LH4A 3KLFB 1ZETA 1BQMA 5C24B 5KGWA 5FROA 3RRHA 4CHZA 3OYFA 1RAJA 3GIMA 1NKCA 2JEJA 4DTSA 2X78A 4DU1A 4OVLA 3QERA 1TAUA 4ED1A 3ZSZA 4FJ8A 1JLBA 4RUAA 4J9OA 3DRSB 5D3GB 5L1LA 4CJEA 4HVJA 2ZKUA 4CGFA 3OYKA 3OYNA 1Z26A 5EU7A 3I5BA 1HYSB 4C8MA 2BE2B 1F21A 5F8NA 3QIPB 2JGUA 5J2QB 2V9WA 1KVBA 3GV8B 1QTMA 3IRXA 4E7KA 4KBIA 3HKWA 3SNNA 5HBMB 1HNVB 3EPGA 3KLHA 4URGA 1BQNA 4KHSA 4O3PA 4YMEA 1S1VB 1GOBA 3C95A 1IKWB 3S3OA 4ELUA 3HHKA 5I3UA 4KFBA 3DOKA 4Q0BA 3EZ5A 4QW8A 3VQAA 3T1AA 3BSAA 3GV7B 1C0UB 4IQXA 4NLUA 4TLRA 3S3NA 3H40A 4PA1A 3PX4A 5KFMA 2QKKA 4OPKA 3K5LA 3MAQA 1L3VA 2GUIA 1FK9A 3GIIA 5EUHA 3TQ1A 3QNNA 1HYSA 5K14A 3KKSA 2W7PA 4G1QB 4QWBA 4L8RB 2ASJA 3OJSA 3H98A 4IFVA 2XO7A 4O3QA 1S1WB 4KAZA 1T8EA 4JRPA 3TR8A 1GX6A 4ZVHA 3PV8A 1J5OA 1T03B 5I3UB 2D0AA 1DLOB 4EP4A 3LP1A 3G6XA 4DQSA 5KT6A 4O4RA 5KG7A 4WZMA 3HPGA 5KI6A 1U04A 4H4MA 4B9VA 3VQ4A 2XRIA 3VQCA 1TVRA 1S1WA 4WFYA 4QPXA 3EY1A 4I7FB 1WLJA 2LSNA 3LP0B 4W5NA 1FKPB 4HYKA 4PQUA 4E7LA 4LY7A 3TAGA 4DQRA 4M3XA 3M8PA 3QEXA 1U49A 3LP1B 2P5OA 3MEDB 4GC7A 5K14B 4CEOA 5KTQA 5KFOA 2R8GA 4ECQA 4FM1A 3IG1A 1TVRB 2FJXA 2XI3A 4NLPA 4K50A 2ZD1B 4EBEA 3RB0A 2IM3A 4DU3A 1VRTA 2HNYA 4J9MA 5EWGA 4M3ZA 4F4ZA 1HQEA 1VSEA 4CFCA 2BGGA 3SQ1A 2D7SA 4ED0A 1EETA 1TL1A 4O44B 4CIFA 1JLGB 4QWCA 3OYDA 3V9ZA 4WE1A 4Y1DA 3V1OA 4FLWA 2WRMA 3VQ8A 4CHYA 1C1AA 4DFJA 2G8IA 4FBUA 2A1RA 1VRTB 3FQLA 1LWEB 1HMVA 1RYSA 3G86A 1KCFA 5HROB 4KB0A 3RAQA 3MEDA 4QW9A 3ULDA 2RN2A 2HW3A 4Z4FA 5JS2A 3FDSA 5KG2A 4DSIA 2BDPA 2FVPA 5KFXA 3LPTA 2OPRA 4QWDA 3H5SA 3DRPA 1I6JA 1RT2A 1RT5B 3VQSA 3ASMA 1TAQA 5CYMA 1QAJA 3UDLA 2E6LA 2IA6A 3MR3A 5KGXA 3TAEA 3TVKA 3QIOA 2WB4A 4ED3A 4CK2A 3I5AA 1T7PA 2R7YA 3DLGA 1Y97A 4NRUA 2BRKA 1S49A 1U09A 4YQWA 4RW8A 4YNQA 3O4QA 3VQ7A 2IM2A 4KV8B 2R2RA 2ASDA 3HT3A 5F8GA 2YNFB 1I39A 3MXMA 1RBVA 3SUPA 4YR3A 4WXWA 3KKRA 1SV5B 3SUOA 1CSJA 5L1JA 3H08A 4EEYA 2ILYA 3QZ8A 5HP1A 4B8CA 1VRUB 2WOMA 4CJ4A 3UPFA 5KFUA 1RT2B 1REVA 4EBDA 4HCBA 1S1TA 4U6PA 4FJHA 2I1RA 4FBTA 4LH5A 2YNHB 1JLEB 3PW2A 1IKVB 4DF4A 2J6TA 3ZSRA 5J2PB 3SCXA 1RT7B 5I42A 3H4BA 1SKWA 1NOYA 1LAVA 3M8RA 4OLAA 3DLKA 3V6DA 2AX1A 2IC3B 1W0HA 2HNDA 3QEVA 2UUWA 3DLHA 5KFBA 3I0SA 5KFQA 4JS5A 3ITHB 3MECA 4O3SA 5C42A 5DMRA 2W7OA 5DGBA 1RTHA 1ZTWA 4ZVFA 5F8LA 3ZSVA 4CJRA 1X9MA 2HNDB 2OH2A 3KMSA 4DWIA 2W42A 3H5UA 5F8JA 2CKWA 1WSIA 4FJ9A 3CFOA 3OYEA 2GBZA 4JRQA 4DS5A 3MECB 2KFNA 1S6PA 2YNHA 4IDKA 4URQU 3TAMB 2VG7B 1VSLA 3MEGA 4KTQA 1N56A 3V6DB 1W25A 4NLOA 3RMDA 3B6PA 1BISA 2HNZB 1BQNB 4C8NA 3O3HA 1UA1A 4FJIA 2HB5A 1EX4A 4CEFA 3I0SB 3L3VA 5DK5A 4CHNA 4BDZA 1IKYA 4DSFA 2FLPA 1RDRA 1RT1B 2FJWA 3T5HA 4WFXA 2AX0A 1U48A 3VN5A 1RBTA 3G0ZA 3NH1A 4CEEA 2YV0X 1RDAA 4F50A 3FRZA 3AVAA 4E1NA 1QE1A 3OYCA 3L2RA 5J1EB 3PO4A 1KSPA 1SH0A 2YNGB 3RTVA 3KLFA 3OYIA 5SWMA 1KHWA 3AV9A 2ALZA 3CJ5A 4PUOA 2ATQA 3OYJA 4CEAA 4G1QA 1HPZA 4CJWA 2W9CA 4RNMA 3KLIA 3NMAA 1S1UB 4I2QA 3V6HA 1TK8A 4CJSA 2E4LA 2A1SA 5KT7A 1TL3B 5J2NB 5CYQB 3C6UA 4AHTA 4MKAA 1RT3A 3V81A 4LQ9A 4ED6A 5JXSA 4CHOA 1SL2A 3TABA 1SKRA 2D3ZA 2Z1GA 4KKOB 2VWKA 2R8KA 1VK0A 4IG0B 4M45A 4EYIB 3CDWA 1C1CB 4R8UA 4Q44A 2W9CB 1XHZA 3HXMA 3T5LA 3UQSA 1JLFB 1S4FA 1UWBA 4M3TA 5DQIA 3OL6A 2RPIA 4ECYA 4IOBA 4O0IA 2DFHA 2HHWA 4Z4IA 4NYNA 4LSLA 1OS5A 3MFIA 3UR0A 3PW7A 4ECWA 1RA6A 4KFBB 5KFLA 2WHOA 4XO0A 1JL2A 4CJTA 4MFBB 4Y3CA 1NK4A 4YFUA 3CIZA 2P51A 1NNDA 3U3YA 4MK7A 3KHLA 4KI6A 3BQ2A 2XY7A 3E01B 4J2EA 2WONB 4EZ6A 3AVMA
chains in the Genus database with same CATH superfamily
3J7ZO 2JJ4D 2YPZA 4IWVA 4KGZB 4CO5A 3PYFA 5DM7Q 3KXDA 5K8OA 4DUZJ 1U1MA 2QTDA 2DY4A 1FO1A 4M41A 3BBBA 1IBMF 4IO8A 1X9WA 4FYDA 4IKFA 5C10A 2XM3A 2NRVA 1S0NA 5CAAA 4M94A 5BYRA 1HBMA 5JMVA 3ID6A 3TR5A 1MN9A 1LCUA 1QDUB 4O5BA 2P9NB 2OPRB 3M8ZA 3C6TB 1HBNA 1C0MA 3VEOA 3Q8YA 1IUJA 3KUHA 2FLNA 2J9CA 5LXYA 3CCRS 1JXLA 4LF9J 2YJFA 4FWPA 5C25B 4ANDA 3FEYB 9RUBA 4AUKA 1B7YB 2UXBJ 1TGOA 2IJFA 2XO6A 3BV8A 2N7YA 2ADBA 3NMRA 1UP1A 3MM7A 4NYZA 2VPYB 2AGQA 4OO1J 2DEJA 1JLQA 2E1PA 4NLCA 1ZAVA 4ZPCA 3B8AX 4AQYF 2C2OB 5H9FK 3NNAA 1JLBB 2MXYA 4ZCKA 4RU9A 1A9NB 1QS4A 4LF7J 3D6TB 1LW0B 2AIRB 2BRLA 5CZXA 4Q8EA 1WC1A 3OS2A 4FJNA 3HDSA 2J0QD 5A2QY 4ZVRB 4Q5VA 3AY9A 3CM5A 1L3KA 4DV1K 1KQKA 4Z4GA 2QLXA 2AHOB 3PNIA 2E5LF 1NCLA 3DRPB 2Q31A 2E9RX 3HL8A 5TKYA 2LDYA 3L4IA 4F0HA 3DAWA 4KHMA 3C19A 4PG8A 4H5RA 4KYZA 5LL6d 2W4PA 1T05A 2P9EA 1XMQF 4DR6K 4DV3K 4AXIA 4JV5K 2NXEA 4B3MF 2BANB 4DI6A 2W9BB 2HIQA 2ZJQQ 2R42A 5F1XA 3O1LA 5KFHA 2DVIA 1XC9A 1W97L 3ZCMA 1EWQA 1GTHA 3AAPA 4GKJF 2J0XA 4EYHB 1V3SA 1BY9A 3DM2A 2P9SA 3T3FA 3FSXA 1YIJS 4AILC 1JNZB 3QFWA 2IBKA 5AQKA 3JQJA 1Z25A 3PHTA 1GMWD 1SC3B 2L9DA 2W8LA 5IS2A 1WC4A 1PYSB 1LAWA 1S12A 4TY9A 3FSIA 4JI3K 3VF4A 1RT1A 4FKXA 3G71S 2DH7A 1X3NA 4CF8A 2HHVA 4UOCA 1KTQA 2B8QA 3UCGA 4JI1K 4CM2A 4QR0A 2ZZNA 2E5IA 4IJAA 4FJXA 3GG0A 1TMJA 2WVFA 3BKTA 2B7BB 3NVMA 3I0RB 4CESA 2I0XA 4E2FB 4GVEA 1K9MT 1B0VA 3BKUA 2M52A 3BS9A 4L75A 1XUPO 1WSRA 2F8SA 3CGIA 1FRJA 1FXRA 2PE8A 4K42A 5HJYA 3L3UA 4AF1A 3J7ZT 4DV0K 1VQ8N 1D5AA 4Z7CA 2EXUA 4PXBA 1N8RO 2ZE2B 3NBPA 5K9FA 5ETSA 3W2VB 5F0XA 3DGPB 3HT0A 1LWFA 3UN2A 3MN9A 4ZTJA 2I7NA 1IJJA 2C2DA 4KH0B 1NDLA 4IH7A 3CDBA 4DFMA 1OYDA 3M1VA 3LP2B 1M5PC 4OZNA 3SQ4A 1S10A 3NH2A 5DG9A 4RUCA 4DR2F 2IC3A 1QE1B 4CLWA 2BKPA 2ZC3A 5AQIA 4KH4A 4GVBA 4ZMMA 2MKYA 3M2UB 1U4BA 5IT0A 4E19A 4W4MA 4E1MA 4BC2A 3AVIA 1VQOS 1RHRB 4X66J 4UY85 3OJUA 3M1VB 1TZ0A 1RACB 3ZT4A 1U1OA 2YH0A 1SVDA 4TKTA 3UDCA 5DO2A 3I6PA 4OIXA 3LZIA 1BWVA 4IFYA 2QG9B 1L3UA 2QV6A 2XMKA 3RB6A 3DOLA 3WQUA 3BJYA 1JLFA 3H45C 2PI5A 1RBOB 3DGVA 3R8EA 4WFNL 2ZITA 3N4QA 1AUSL 3FZBA 3CJKA 3J81U 2E2NA 4AHCA 4GVBB 1RBAA 1WJ9A 3UD5A 1SJRA 2FD2A 1HL6A 4DV6J 2Z0GA 2X3DA 2O8FB 3AOCA 5GAGU 4DR7K 1N5YB 1MMLA 1HPMA 1NHVA 1B0PA 2ZHOA 4I6YA 1H7WA 3PJWA 3FZMA 4OI1A 1SPBP 4ZS6A 2L9NA 1IVZA 2V8HA 2IOCA 1SUQB 2Z1JA 4GO7X 1CQNA 3QIPA 2G8UA 2WB1D 3ZTSA 1DURA 3UE5A 3CQ8A 2QWPA 3KLGA 1EB0A 2GHWA 2AD9A 1UFWA 3HSGA 1HUXA 1HYZA 3Q2TC 1T44A 2QWOA 4NLYA 1RT3B 2YBVA 3PCOB 3AQPA 4MIAA 4X84A 1WN7A 5IT9U 3OYBA 4FWLA 1SCJB 4EGLA 3HHLB 5FIIA 5BYSA 1JX4A 5EX3A 2M0GB 4JB8B 2GIRA 3D0PA 1KP6A 4NLXA 1KDNA 4KB7A 2HBRB 3A13A 3IMXA 1WKKA 3LWLA 5DDQC 1ELOA 3SSQA 2OPQA 1UL3A 4WIIA 1HNXK 3VQ9A 1FK9B 1RHKB 1IBCB 3C66A 1I94F 3QJJA 1SXLA 2V2QA 2GO8A 2ASPA 1K1QA 3NE6A 2JEGA 3NDKA 4QU6A 1WC0A 2QT7A 2B4OA 4BLGA 2VPZB 4LFAJ 1U8WA 3ZSXA 3SSSA 4F4AA 3QNOA 2GMLA 1FWKA 1MWQA 3PIPQ 2M4MA 1JLAB 3H20A 1B9FA 2MZSA 2OP5A 1OO0B 1URRA 4FNHA 3BQ1A 3KD1E 2Y1IA 1QHAA 1CPZA 4M5LA 2JLGA 2DGOA 4M5GA 4PAAA 4J5OA 2W9AA 2ZEJA 1RTDA 4OHVA 3ZSYA 4U7CA 1BHLA 2B51A 1LKZA 2XY6A 4KHPK 4OYOA 4DU7A 3QZ7A 2HF3A 4BR2A 3EXCX 3HO1A 4H0TB 3CDUA 3DKDA 5AZJA 2DGQA 3CCVN 3HD1A 4ECTA 2VOOA 2W2QP 2GQ2A 2P9PB 1CZ9A 2NR0A 1IG9A 2VBYA 4WTOB 2KYZA 4JN4A 2J76E 2D0BA 4MH8A 3WXKA 3IFEA 1S57A 1S48A 5FPEA 2D0OA 3WBZA 3CDAA 3OUYB 4PZVA 2UUAK 2XGPA 1CJTA 2ZH4A 3V4MA 2E88A 4EAHD 1RAAB 4BC5A 1BO5O 4X2BA 3J7AP 2YKMA 2CWKA 3MXHP 4J9SA 5BXIA 2ZD1A 4NX9A 3W5YA 3QEIA 1U7LA 1KEKA 1REGX 1WNEA 4Q8FA 4YB1P 4WCEL 4ZPAA 3JTPA 2Z2ZA 3KJVA 3LF0A 1M90T 1U2RA 4B3RJ 1S0MA 2WBRA 4IR1A 1EP4A 2UUAF 1VJWA 1U1NA 4QOZB 2ZJQL 4DTMA 1YRTA 4YY3J 4EIAA 5BPNA 4P74A 1RP5A 1H74A 4DX6A 4FJGA 3V9XA 1WDTA 3EE9A 1VQ4N 4WFZA 2HQFA 5LSLA 5D0HA 1YHQS 4JI7J 4DV4J 4FZYA 1HJRA 2WFBA 3J8AA 4CJPA 1KTVA 3K8VA 2UUCJ 1YBAA 3C46A 1RBSA 4UUXA 5AJ3K 1F9FA 3NGZA 3DU5A 3DLKB 4DX7A 1M5SA 1HJOA 7AT1B 4IG3A 1G3OA 1OQ6A 2AJ1A 3OTDA 1LWEA 3AH6A 3AA8A 3CUNA 4KHYA 3CMAS 1RKIA 5E3QA 2ZBCA 3GFZA 3T1HF 2QO3A 3WXMB 2PBDA 3PUFA 2AU0A 1GMWA 1Y10A 4BWJA 1RT4B 2JEFA 2HHPA 4V19X 3CCQS 1QSYA 3MN5A 2XG8A 1FE0A 3RAMA 4KGXB 3N79A 4CK1A 4DUYK 3K89A 4AHSA 4TQSA 2YNFA 1RWUA 2KXFA 1VFJA 1S6PB 5KQDA 4CJ3A 2R2TA 4DL0C 2GQQA 3LL3A 4AHRA 2D69A 2FTRA 1QAIA 4N5SA 3A0IX 4NMXA 4LBPA 4HUEA 2DGVA 4OX9J 3ZTPA 4B9SA 5AQWA 1G99A 3QRPA 1RTIA 1WBDA 1BIZA 1AZSB 2Q43A 5I42B 1GXTA 4YS2A 1CEZA 3QEPA 2LQ9A 2DKOB 3G96A 4FF4A 3CPWM 4UW2A 4I9LA 5KFAA 2CPDA 4ZCLA 5GIPA 2MGZB 3OFGA 3AXMA 3TX8A 5J1EA 4H5NA 1UZDA 1DTTA 2PSZA 1Q7YO 4NCAA 2K1RB 4F2SA 3CFPA 1UFLA 2GJ2A 4MAKA 1P8ZA 4J90A 3D5MA 3T9ZA 3RRKA 2OUGA 3NKYA 4G65A 4I2QB 3TTCA 3ULEA 2F8MA 4DTOA 1RDCA 4OHYA 1JXVA 1WOQA 4ER8A 3A5OC 2OPPA 4X62K 5E33A 5BR8K 5E5NA 1FJ7A 1WUAA 4C0BA 4F4YA 5ETLA 2W4DA 2BACA 1NGIA 3Q8SB 2KI2A 4DPOA 2MZQA 2O4GA 1C1CA 1U45A 2K06A 4DR7J 1Q5VA 2IHR1 3L0QA 3OFEA 3ULEB 3MM6B 1ASUA 2GIFA 4NRTA 2ZJRL 1JXEA 2ALYB 2ZBIA 4PR6A 4DL5A 4P7TA 2ATLA 3IM9A 4LFBK 3BEXA 4OI6A 2XGQA 3A5MC 4M3YA 4TYBA 2NXNA 3OBWA 1C0TB 2R7VA 1RLCL 3BSCA 3R5DA 2YX1A 4NLRA 3AO3A 3ETMA 3F73A 4EK2A 3M32A 4WP3A 2B0GA 5IFMA 4B3MK 3VZHA 3J81O 4DTXA 2LKZA 3ICLA 3LUYA 2IMOA 3BGOP 1H98A 4E98A 1RI7A 3K5PA 1U24A 5AZJB 3EE8A 4A8KA 2AJFE 2RD5C 2ZH8A 1KAYA 1NMDA 3CJKB 1LFPA 4CEBA 3ENWA 1V5IB 2F8EX 3KK3B 5C2CA 5HMZA 3HFVA 1TUVA 2OA8A 1HBOB 1MSWD 3MEKA 3OXGA 2DPNA 1C0TA 3UW1A 3R9LA 3QINA 2HWIA 1HWIA 3CQXA 4BG8A 3PYEA 4UZBA 2VG5A 3VGMA 4XPCA 3LA0A 3POTB 2ZVSA 3OHRA 3GR0A 3CCVS 5E84A 1H72C 3SCJE 2DRAA 1YJVA 1F1BB 3QDKA 1LXJA 5M1OA 1VSDA 4KHQA 1IV0A 6FD1A 5AQRA 3MM7B 4KHWA 1LW2A 1BXNA 1J5OB 4YOVA 3G8SA 1WAFA 2BE2A 1BI4B 3BZQA 3L2VA 3GYXB 1B7FA 3GTYX 2QMWA 1HBOA 1TL5A 1GH8A 1GMUA 4KR0B 2AYBA 3H6EA 3FE1A 4LF9F 1ZXOA 1CLFA 2LQ5A 3MAAA 2FF3B 3PRVA 2DITA 3GE1A 2Y8WA 4MK9A 2PO4A 3SBTA 4E0DA 3HSJA 1NDPA 1IXKA 2FVRA 2HFZA 4CLFA 2XMUA 3QAUA 2DGSA 2Y9HA 3CI5A 1JCEA 4M7XA 2KFZA 3ILOA 4DR6J 1VHXA 3EDQB 1S6OA 2WBNA 1PJ5A 2VQFF 3F44A 1J27A 1CC7A 2ROEA 3G82A 4OZLA 2DFEA 3HFZB 1NGEA 3G6EN 5AQQA 5EWEA 1X0FA 1VSKA 5AQOA 4OHXA 5B0FA 5KFFA 2RVJA 3VAKA 4B1YB 3W9IA 2K3IA 2V52B 1REVB 1VQ8S 4WQ4C 4O23A 4GVLA 4NCGB 2HHXA 3CC7N 3L95X 2CQPA 4MIWA 1LEOA 3DRXA 4WP8A 4DL7A 1X4EA 5HRSA 1TKDA 1SKSA 3QSYB 3DLJA 3SZ2A 2NLWA 1PIEA 3CCWA 2A5XA 1GLCG 4PG5A 3L7PA 2BMBA 1SAZA 3OA9A 4KGVB 1TP7A 5B0GA 4ZITA 2EPIA 1N4LA 3H59A 3P5TL 1KXPA 3EM1A 5EWFA 2ZQBA 3DLEA 2QX0A 2BX6A 2QW9A 4KSEB 3NNCA 1X7VA 4FZVA 4BROA 3TZXA 2E8AA 1AROP 3AD7C 1TL1B 4KRFA 2K1RA 1FW6A 3PXGa 1WHWA 4LR9A 4IFVB 5HMWA 4JKHA 3NAHA 4FLYA 2YNIA 1F9HA 1VQ9N 4NLQA 4A48A 4B3TF 3BO3A 5EDWA 4FWKA 1KNZA 1VLYA 5T7BA 3CFRA 3AA5X 3OR2A 5KRTA 2R8IA 3V2UC 1KLMB 2DJWA 3MMAB 5AQPA 2VC0A 4DL6A 3OLAA 1U2VB 3FGVA 3VAMA 3JYTA 4TYAA 3MEEB 3IXQA 4I6WA 5CYMB 2GW8A 3OL9A 3ZT1A 1KONA 1Y0HA 4OJRA 4M3RA 2OZSA 2NPIA 3NGDA 1GLEG 4DQQA 2CGLA 3VQTA 3OXLA 2EG1A 5L9NA 1YLXA 2CIMA 1VK3A 3K58A 2YWWA 2X6SA 2I9SA 3CDEA 3M32B 3MDFA 2GV9A 2C3UA 2B6AB 2EBEA 4M3UA 2QWLA 3EE3A 3EGZA 1X60A 2QM1A 5JLFA 1VDHA 1HWUA 3T1HK 1GLLO 3T69A 2HHTA 4Y6IA 1JLEA 3WDOA 1IKVA 4CRJA 4OYWA 3KHGA 3K59A 4JKGB 3CWJA 2CDRB 2G8HA 4FCYA 1FX4A 1OY8A 2MKCA 4O3NA 2KH9A 4JKAA 1C1BB 1WSEA 1S9EB 4RL1A 1LV5A 3QBXA 3JQMA 3AQOA 1MWKA 4LF4K 1APSA 2YHBA 3FZFA 3CPWR 3CCRN 4JI3F 4YB5A 5IWAK 1NSKL 1RTHB 1NGJA 4BC4A 2YX4A 3QT5A 3CJ2A 4HACA 4IKAA 4X4VA 3VCDA 1HLUA 1ZAXA 3Q8RB 1HWLA 4NE9C 5KFWA 3QGPA 3R5GA 3G6VA 1NJZA 4J8FA 3TSQA 5TKWA 1H38A 2FHMA 1E6YB 1OIAA 5EX0A 3CC2S 1YIJN 2HMPA 1N5YA 3P3DA 4OZ3A 1BQXA 1K47A 3K2PA 3OYMA 1ATSA 1QAYA 4G1IA 4I0WA 4X64F 4KTZA 2UUCF 1IKYB 2HURA 4KO0B 2Y0SD 2UXDF 3FFIB 1KOHA 4DF8A 3AVFA 1WSVA 2COLA 3AHPA 5C24A 2KJVA 2FGCA 3O3FA 4HKQA 3DDIA 3CC7S 3CCZA 2KHOA 4BR9A 1QQMA 1AZSA 4Q43A 1M5HA 3VETA 4DV5F 1BQMA 4LF8F 2V2VA 3O1WA 4H0PA 4KHPF 3DFEA 2JEJA 4DTSA 2HSTA 4OVLA 4ED1A 3DRSB 3O6QA 4JAXA 3L09A 1U1KA 2U1AA 1FD2A 3K9JA 1Z26A 5EU7A 3MM5A 4BRMA 1UEKA 4AQYK 3M6VA 2GO9A 5JLHA 1XMQK 2AMCB 4OZ2A 1HNVB 1IG8A 1NGHA 4Z7YA 4OX9F 4URGA 1BQNA 2FC9A 1M1KO 4YMEA 3CC4N 1GOBA 3C95A 2DEIA 3R2CJ 4IOAQ 3O5TB 1DQ8A 3VGVA 1UVNA 3WC0A 2FY1A 4QW8A 5LL6Z 3T1AA 3BSAA 2DBBA 3PEHA 1F3FA 4NLUA 1B99A 4EWTA 5B8HA 4JI0K 1GMVA 3H40A 1N5QA 4CIOA 2GUIA 3GFHA 5EUHA 4HI2A 3TZZA 4DR1J 3TQ1A 2HVZA 3D7SB 4UY8T 2DGUA 2RRAA 1P9QC 4G1QB 4I67A 2WAQD 2R7XA 4Y2IA 2RE1A 1GX6A 3ENBA 2FJEB 2DR5A 3KJQB 4ZVHA 3AFGA 4W98A 5AQZA 1T03B 1KOOA 2D0AA 3LP1A 3RU0A 4DQSA 3ILIA 2BJ8A 3GG1A 4F7VA 1S1WA 3QMLA 1OSCA 1PAUB 2HAFA 2F4VK 2LSNA 3ENHA 4W5NA 1CJTB 1FKPB 3CJQA 4LF6F 4OJGA 4PQUA 4E7LA 3TAGA 4DPUA 1NDKA 2WSFC 3MAAB 2F9DA 1WG1A 3MCNA 2FJXA 4G6VB 2RRNA 1PC5A 3RUBL 3RB0A 2WUSA 4OMFG 1HIYA 4IEEA 3H0PA 4ES1A 2HNYA 3MI7X 4F4ZA 1AB8A 1VSEA 4KBOA 2OMLA 3SQ1A 2D7SA 4DPYA 1X4HA 2HZCA 3WT0A 1SJFA 3VQ8A 1Z6RA 3AGRA 4BVOA 1KAZA 1LWEB 1N88A 2J0SD 1RYSA 1KCFA 5DJBA 2CQ4A 4L72B 1VISA 3RAQA 2UP1A 3MEDA 3I87A 4Z4FA 3FDSA 3NRBA 5CD4H 2VONA 5KFXA 3K7RA 2VZ9A 3MCOA 1KQGB 4QWDA 3TRGA 5BN9A 1N34J 3DRPA 2G1DA 1I6JA 5THWA 4CO2A 3W9JA 2MYFA 4CZHA 2DNQA 3GMGA 2KB2A 2PI4A 5KGXA 3TAEA 4H5VA 4ED3A 3D0GE 3PJ9A 3T1YJ 4NRUA 3OTCA 4BG9A 4QU7A 3OXFA 2C3YA 2ASDA 1ATNA 2YNFB 4RBVA 5A0YA 1I39A 1V6HA 1HR0J 3MXMA 3U9ZA 4YR3A 4WYBA 4GMKA 3OTOF 3FNNA 4WXWA 3KKRA 1SV5B 4NZ6A 3H08A 3P31A 1FRXA 3QZ8A 5HP1A 2DD8S 2F3JA 4CJ4A 3CHWA 1XQIA 1REVA 3CJ7A 4U6PA 2I1RA 2ZOFA 2DR6A 2P9KA 2M9KA 5I42A 3ATUA 1NOYA 1LXNA 3V6DA 1KVKA 3CJ9A 3LW5C 5D15A 2AEFA 1X5PA 2FC8A 1NEEA 4AFFA 2UUWA 1UPMB 2V8DA 5KFBA 3DLHA 1T3VA 5KFQA 3ITHB 3CNQP 3MECA 4JI5K 3GFXA 2UV8A 2FSKA 4YN3B 3ZLJA 5DMRA 4JBCA 4NXNJ 3VTHA 1PKUA 2ZWPA 4LF8K 3QJLA 1WG4A 3GJTB 1PBUA 2BW2A 4DWIA 3KMSA 3EWGA 1OQ3A 3CTRA 1ZS6A 4NXMF 3EO3A 5H9EJ 4DS5A 3MECB 2YPYA 4ES3A 4URQU 4DJBA 4Z2XA 4KTQA 3UFCX 2CGJA 5AQJA 4NXNF 3B6PA 3IWXA 4ZOSA 3WXIA 4PWWA 2EK6A 5EN1A 2OFGX 3THTA 1CJUA 2O3DA 1ZH5A 3I0SB 3L3VA 5DK5A 3NOCA 4YOXA 2UU9J 1BA1A 1VQLS 4WFBL 2EG2A 2KVIA 3N4WA 1UVKA 1U8SA 3VN5A 2YV0X 1YI2S 1JWWA 3FRZA 1QE1A 3OYCA 4FN5A 1ZPVA 4B1WB 2VH7A 3C6AA 2YNGB 1YJUA 3CD6S 4Q2MA 3I4PA 2OIHA 4JYAJ 2ALZA 3R7BB 2ZJPQ 3IR5B 3D2WA 1HPZA 4CJWA 2W9CA 3KLIA 3Q7CA 2WVDA 2YKOA 1SIWB 3TOQA 4ILJA 3V6HA 4GNIA 4DV2F 3MK6A 2E4LA 2A1SA 4P7VA 2VHGA 4AHTA 4LQ9A 4F67A 2LQJA 3LM2A 4IG0B 3M5RA 3TQEA 2W9CB 1JLFB 1UWBA 1IBMJ 5A8KA 5AQNA 2DFHA 3MFIA 4QYRA 3PW7A 2KXNB 4DCJB 5FLXO 4MFBB 2P51A 3TA1A 4KI6A 4W90B 2RSQA 1I94J 3E01B 3BEGB 1FJCA 1R0BG 2V4JB 5GAGP 1DTQB 2D3UA 4CH0S 4OV6A 1VQ9S 2LXIA 4G3IA 4YB7A 1CLQA 2YX6A 4C7QA 2KXHA 3CCQN 5GVQA 2O01C 2NREA 6AT1B 3D2EA 3M6WA 1NM2A 3KNAA 4MJKA 2JWLA 2XYPB 4U8YA 4UQTA 3HHLA 4CEDA 4N7TA 4DMNA 3MR2A 5DGAA 4ED5A 2EEYA 4XPEA 3R5JB 2WBMA 1RADB 4QAGA 2XMJA 3EL2A 2NXCA 3K9KA 1F2HA 2QL7B 3EVMA 3LO3A 4C97A 3M8PB 2C22A 5EOYA 1H1VA 2GMJA 3MPDA 1E6VA 1D8ZA 2NRRA 2XI2A 1FJGF 1D4XA 4YDUC 4PL8A 3KK1B 2VPWB 4BRKA 4OI0A 5JUMA 4CJUA 2BJ1A 1TKXB 4OI4A 1Y5NB 4OZ1A 1JKHA 1H73A 3B4DA 1EIYB 4ID5A 3U1LA 2HBQB 4FJLA 1BQMB 4ED7A 4FS1A 4MLEA 3G6ES 3QNWB 3QWPA 2MHEA 4PXDA 3ZSQA 4YOWA 4OJHA 3BGRA 3SK3A 2FF6A 2B43A 3KK1A 5A2QU 4CJQA 2RS2A 2A0FB 4M3WA 4XTTA 1PC4A 1S99A 4DR1K 4GV3A 1IWGA 2P9PA 4TU8A 4FF3A 2OKQA 5CE3A 4J9KA 1RWWB 8AT1B 2GWKA 3HVTB 3QESA 3DN9A 5JJBA 1RJJA 1FTRA 5B0CA 2VWBA 3U02A 4WZQA 4ZJQA 1IBLF 2YKMB 3JXUA 5L46A 3HLUA 4OGCA 4OL8A 4WFBQ 4X65K 3NS7B 5HLFA 2UVVA 4CZGA 4CK3A 1YGYA 4ZPWR 2Z2MA 2IFXA 1Q9YA 4BR7A 4Y2AA 1FFSB 3N6MA 1QQNA 5M1NA 1Q1KA 3PHEA 1EP4B 5GINA 5HLFB 1GNKA 4E7HA 4E7IA 4F26A 4DSEA 1X4BA 4AHUA 4P6QA 2P9CA 5K8NA 5T14A 3RBXA 3WUHA 3IAM9 1FKPA 3GQCA 2NZCA 4KI4A 3HPOA 1Q7LB 4HTUA 4GKJJ 1W7AA 1D9AA 3TI0A 3EXYA 4NI2B 3MM9A 5HOOA 1SI9A 4DLEA 2PGCA 3MCMA 1ZA1B 5G4DA 5AE2A 2V94A 4RW7B 2DTUA 2F7TA 5GAGI 4I9QA 4J2DA 4CJKA 2VQFK 4IG3B 1LWCA 4DV2J 4YUDA 4J9QA 1U47A 4PEOA 1FXXA 4BACA 4BRCA 2VBZA 5KG1A 3VAJA 1DRZA 1UJ4A 4WE1B 4LIRA 2W24A 2VG7A 2HQCA 3FZ2A 4HUGA 2I5JB 2H5JB 2LXFA 5IOLA 3ZETB 2RH3A 2D9PA 3IGVA 1YBUA 3BDPA 2H65B 1WOPA 2AJ0A 3OR1A 3JAMO 1O5JA 2XC9A 5M1FA 3NS5A 1ZBLA 4CBWA 3ZEUB 1DJ0A 2XMAA 5D4PA 2DHHA 3F9MA 4G1PA 4C3KA 1HQUA 4H5WA 1A6LA 3L8BA 1XHXA 3D1HA 4NLBA 3OR1B 1TKTB 4UTGA 2Z56B 4QYZJ 3M2VA 1RHJB 3TTFA 3ULHA 3CT9A 3GCXP 1RBRA 2I7PA 3UD4P 4RKUC 2GELA 3SBMA 1G7CB 2OEMA 3KK2B 2JC0A 4WF9Q 3V4IB 1Q5YA 1I94K 3R6MA 2G2ZA 2R8JA 4R79A 2ZDOA 2NXUA 1CC8A 4NYOA 2RKIA 2G4BA 1HNWK 1YKWA 2HHUA 4A8SA 1SS6A 1X1PA 2KW4A 3M2VB 1FJGJ 1EXQA 1TL3A 3KLVA 2ILZA 2HFNA 4BGBA 1Z4UA 2UYTA 1XIQA 3UIQA 5HN0A 3D6MB 1RHUB 5AE3A 1NRKA 4X4SA 3ZT2A 4CH1A 1KC8T 2NXJA 3CVKA 3W3SA 1VQON 5GADI 5KT3A 2WTFA 3M2RA 2G8WA 1F0XA 1U25A 4P75A 4JV0A 1JIHA 5AR0A 4ITSA 1SQEA 2HPUA 3EX7B 4F3TA 1AFJA 1RWKB 1FEHA 3FEZA 2AT1B 3S3MA 4CEZA 3OT9A 2RKIB 1ZM3A 4CJVA 4CGDA 3R6GB 3HVAA 4L3KA 4CFBA 3C7NB 1C6VA 3Q8VA 1HNWJ 3JSMA 3G6YA 3W5XA 1WEZA 1R8BA 3H1VX 1AT1B 2CAJA 3QT6A 4FWSA 2CYYA 2D1KA 1RKJA 4PUOB 5J2QA 1RFQA 3O4WA 1K8KB 2GAHC 2LCWA 1VC5A 1ZTTA 2WVBA 2X3GA 1YVFA 4CZKA 3WXLA 1SH2A 4USUA 4B08A 3EKSA 5E3PA 3VGKA 3HOSA 3M2RB 2JWNA 3R5BA 2V4RA 4R5PA 5JS1A 4CM0A 2P1JA 3D45A 3HSTB 3B8HA 3OYAA 2Q3SA 2MZ1A 2O4IA 2W2PP 4QIVA 1NO8A 2A42A 4NLSA 1D9FA 4H5TA 3N5BA 3BH6B 1S1XA 3BQ0A 2OO4A 1FNOA 4JEPA 2C3PA 3CULA 3DC2A 3U9DA 3H5YA 2OYQA 2XMTA 1X5OA 3NY0A 5HL7L 4OLPA 1OPZA 3J81Y 5AFUA 3N6LA 4BQLA 3AVHA 3CCSN 2KQ2A 3H4DA 1OVQA 1FHTA 5HK4A 3PW5A 2BJEA 3B82A 3A8IA 2W41A 1JLQB 5LMNK 1RCHA 3CC4S 3RB4A 5AZIB 1XR5A 1GTEA 2IMWP 3VQ6A 3DMJA 1O6XA 2JEIA 5HMYA 3OLBA 3HZEA 4DFPA 3TVZA 2HBMA 1HW8A 2Y1JA 1R7IA 2G2YA 7FD1A 3UD3P 3N9UC 4RX6A 4QYZK 2PN6A 2X7IA 4N41A 2J4RA 2MZTA 2HZVA 1YJ9N 2UV8G 1VBXA 4R0EA 1N48A 3O3GA 2AGPA 3VEWA 4H4OA 4I2PB 5HROA 2E1AA 1NGBA 4DSJA 5H9EK 2XLIA 4MFBA 5F9LA 4FJ5A 4A2BA 5HRPA 3RGIA 1VOMA 3DDKA 2R7UA 3C16A 5DM6L 4Y2MA 4MK8A 2F5GA 1DGKN 3VVUA 5U47A 4X4RA 3G10A 3CMEN 2RQ4A 5MLCV 1XTZA 4H0XB 4DTRA 1WSJA 1NGCA 2BQ3A 2GC8A 2LDIA 2CNLB 3RWUA 5BR8J 2P9UA 1NH8A 3R1XA 4ELTA 2ZBPA 2VD3A 3N6NA 4A61A 2M8HA 1VC6A 4QBUA 3VTIA 3BGRB 3ZZYA 1S97A 4OX7A 2VKRA 4NXMK 4MKYA 3CD6N 2MEWA 4F3QA 1WACA 4B9UA 3CJCA 1TFYA 3P38A 4PQAA 2HZAA 4KTWA 2MLYA 1VQKN 2EFQA 2CJXB 1SV5A 3CMAN 1GT8A 4OKJA 4UOHA 2D1CA 1YG0A 5I3PA 4BRQA 5K8PA 3OYGA 1N33F 2QGFB 4C0OC 2UXDJ 4KV8A 3I0RA 4JI4F 1RSCA 4KQZA 1RE1B 2IRXA 3OYLA 5LJ3Y 4MDAA 3CF5Q 1WWHA 1KD1O 2O1PA 2DTJA 3P1GA 1MG7A 3UWTA 4TY8B 3A3OB 1QHTA 2C28A 3H46O 2WVEA 2VC1A 1RBLA 1Q0NA 3L7OA 3SJJA 2MKJA 3TZYA 4OLOA 4QJVA 3TEGA 4CGIA 3K8WA 1QZ5A 2XMVA 5IQQA 5L1KA 2DGTA 1JJ4A 4FWRA 1XR6A 1W2BM 2FJBB 3C14A 4PPZA 3AB4B 1FXLA 2A6AA 4DUYJ 4M95A 2K3KA 4B9LA 4HLBA 4EBCA 1TL7A 4J2AA 1OVYA 3LPEA 4OV1A 2I38A 4K5RA 2Z58B 2MQLA 1KLMA 3PLAA 4Z0UA 3VGLA 2MDAA 2R7RA 2QL5B 4C1NI 2DXFA 1HD1A 1MWZA 3TWZA 2NRWA 3ZSWA 2ACMA 3OL8A 1RDDA 3PX6A 1S5JA 3R3LA 2UUTA 4DOZA 4K25A 3IR7B 1BLUA 5BJRA 1K8AO 3TARA 2QTWA 1A5XA 2XWYA 3ISNC 1CJVA 3GIKA 3U7JA 1Q86O 1D8YA 2HBJA 4HTJA 3HVWA 1CG2A 3GJRB 2DXDA 4LVOP 1L3SA 2CQ1A 2FJDB 1FI4A 3JAMU 4NA3A 1RWNB 3M9NB 4O3RA 1RWOB 2G0JA 1BE4A 3OPKA 2PMZD 3SCLE 2YQ1A 3S7RA 5CH7B 5A76A 1HWJA 3VEXA 2A1BA 5I9EB 4EP5A 5D4OA 1HHTP 4DQIA 3SMZA 2QEXS 2R7TA 2A6OA 4CF0A 2PMWA 4DU4A 5FJ4A 3AVGA 4P73A 2FLLA 4IRCA 2X51A 1KQFB 2FJAB 3FMWA 3THWB 3OBIA 1WNSA 5MAOA 1E3MA 1RCOB 2AEMA 1IKXA 1XR7A 3ISND 4DR1F 1FFGB 1XQSC 3G4SN 5BPLA 2JL9A 3O9RA 2LXUA 4U67L 3CCES 2HMIA 1N8RT 3V4IA 5BRDA 4RW7A 1S0VA 2B5JA 2CJKA 3EZWA 3KLGB 3D1OA 3J7YI 1HR0F 4HACB 2UVWA 4LF1A 3FEXB 4NEZA 3DMJB 2NQPA 3ZZ0A 1BU6O 2B4JA 1TU0B 2GHPA 1MDUB 4CIGA 3QJPA 3BN4A 1T3NA 4RNFA 2QYCA 2YVSA 4DUZK 2JZ5A 2ZBQA 3JSYA 2RUGA 1S1UA 1KVIA 1ZBIA 1G1XA 2E2PA 3J7AN 1WSFA 3AO1A 4H4OB 4I2PA 3VOVA 4B9TA 1DT9A 2AA4A 3FFIA 3VQ5A 5LMNF 4NOHA 4J7CA 4DTPA 3VPZA 1NJWA 2BKNA 3VEYA 2CQ0A 1H6KX 3VQPA 4DUYF 2NLXA 3HPHA 1GX5A 2RILA 4MIBA 3UKRB 5AT1B 3HSZA 5J2MB 2JDJA 3SCIE 3VAHA 3KWMA 3FMBA 2Z57B 2PMHA 1XNQF 4OX9K 3CJTA 4Z4EA 2ADCA 3IWLA 2CFXA 2V8VA 5IT9O 2AEJA 5F0WA 1NAQA 3IGNA 5DETA 1X31C 4K4WA 1MU2B 1HMVB 2JSXA 3KG4A 3I56S 3FKBA 2VG6A 1OH8A 2K2PA 2PZSA 1HI8A 1QY7A 4Y0WA 2ZFHA 3OYHA 3CCTA 4ZDNA 4CJ5A 4ILRA 2CJ9A 4FWOA 1LQ9A 2QRRA 2QWQA 4DV2K 4E7JA 4LF9K 2XQCA 2F9WA 5L39A 5J2MA 1N34K 1Y7PA 1IQZA 4RW4B 1QUVA 4LF6J 2ZOGA 5JMNA 2RDIA 1HD0A 2H5EA 2Z1HA 2E1YA 3AVKA 4DSKA 1BCMA 4NYFA 1GAOA 4FJ7A 1B3TA 4QCLA 2AP6A 1YVNA 4O0JA 3OQ2A 3L3CA 1S9GA 2UUCK 1NH7A 2NNWA 4CI0B 4DFKA 3T7ZA 2DXEA 1RAFB 5A6WA 3WX4A 4CERA 3PFEA 5I4MA 3A4TA 2FGOA 1UW4A 5EXWA 3F41A 1Q53A 2XNRA 5E3AA 1TKZB 5BREA 2MTLA 2OEKA 1N33J 4JI5J 4L76A 2GVZA 1O1WA 3PIOL 2DGXA 1T03A 4LRFA 4M42A 4DR4J 2KN4A 4NZ7A 3A5LC 1YT3A 1FJEB 1TKZA 3ZTQA 1S1VA 1IBKK 2C2MB 3ZC4A 4G9ZA 1NK6A 1URNA 4A62A 2N4DA 4A4JA 4KAIA 3K5NA 1SQKA 2QK9A 1U1QA 3DRRB 5LMUK 3O2IA 3PW4A 3LH2S 4BRIA 4EZ9A 3GDQA 4K8ZA 3AVBA 5AQXA 2CJAA 3IBCB 4BRGA 3KG0A 3RMAA 2KTQA 4PXCA 1QAXA 1HQEB 1N0UA 3DYAB 3ETOA 2OSQA 4ILHA 1T3OA 1K0TA 3GV5B 1VSIA 3GE9A 1ZPWX 4ZPBA 2KM8C 2Q66A 1GLBG 3FZKA 1KLNA 2MLZA 2O8BB 4KHPJ 3E66A 1NUEA 1CBKA 3CJ3A 2B9WA 4M5KA 2NUBA 5IT4A 3MTKA 4J37A 2E5LK 5IT9Y 3GB0A 4B02A 4ILMA 4B3RF 1UA0A 1NZ8A 4WU3A 3PO5A 5SZTA 4ISFA 1W26A 3PX0A 3WNEA 5KFRA 3GYNA 3ZETA 4BE2A 4X62J 2O8DB 4CLYA 4K4XA 2ZBRA 1SJ4P 1H3DA 3RMCA 3LWMA 1O51A 2BYCA 2V8GA 4ZP8A 2ACYA 2P9IB 2F65A 2DPIA 1K0VA 2YWKA 2AV5A 2W2MP 3SCKE 4LC9B 3VHQA 3IG1B 2P9LB 1FESA 1F5AA 4E1JA 1ASWA 3ZT0A 1PBAA 1OWXA 4NLWA 1M90O 4O8UA 1OH6A 3UDVA 1Q4RA 5DQGA 1TKTA 2B4UA 1YBTA 4A5AA 4CLSA 3D0HE 2VA3A 1FKOA 3CSKA 3H3OB 4AT1B 1P1TA 4RPFA 2LEPA 1Q8LA 2V34A 2XMMA 5HVFA 4RW6B 3ZEUA 3CERA 5GIOA 4Z37A 5M1KA 4B8AB 5D0GA 4K4ZA 4OZJA 5HSPA 3P4UB 4Y65A 4YDXA 1D3WA 1E4GT 1YJWN 4KREA 3BSOA 2VGMA 4Y2CA 4BDYA 1JJCB 2XHBA 3P49B 1Q9XA 1YSJA 3H2LA 5GAEU 1X4GA 1QM9A 5KFTA 4DR2J 1HKAA 1LFWA 5HMXA 4CGGA 2ZH9A 4YR0A 3NGRA 2W8KA 1TUYA 4UQGA 1VQMS 1U1PA 1FD8A 1U2CA 3DGPA 1IBMK 3KDNA 5LSOA 5HANA 4FL9A 1X4FA 1UMJA 4IH6A 2V68A 3ITHA 4N77A 1RWPB 4DBQA 3FR0A 2DFFA 2RAQA 1FDDA 4J91A 4TN2A 4K41A 2E6MA 5DQHA 3P45B 4KHUA 4HT5A 3SFUA 2IRUA 3JSMB 3M2UA 4RR5A 3J80U 2RB7A 3UN3A 2XYGB 3BREA 1XMOJ 1KVAA 3T5KA 2C2RA 5D4NA 4U95A 2HBLA 1KQSR 4I64A 3DHXA 2AWZA 3V9UA 1HBUA 2GV1A 1IJFB 3F9KA 4JI7K 4USKA 4BRNA 1UJ6A 2VV5A 1OH5A 3GSDA 1OMSA 2QA4G 3F0NA 3MCSA 4WP9A 5E3RA 4M63A 3DLLL 5JICA 2EKYA 2UVRA 1O13A 2VBWA 1FVQA 1S6QA 2F8HA 5HBMA 5ADXH 1QQCA 4V19S 5FPDA 3M30A 1S1XB 1R3NA 3PKYA 3NMUA 4N56A 2O8EA 2OEJA 4R5PB 4LH4A 3KLFB 1QVGR 2F4VF 3HHLC 1WC3A 5SUHA 3G87A 5KGWA 3VF2A 4CWBA 3RRHA 1HBUB 4DMZA 3A12A 1TAUA 4FJ8A 4ZVTB 1JLBA 4RUAA 4J9OA 5D3GB 4CJEA 2PT0A 3I5BA 4C8MA 2VL1A 1T95A 2AW0A 2BE2B 4HH1A 3PSIA 3CPEA 2WC9A 3IRXA 4E7KA 2JOQA 3HKWA 4HR2A 1VQ5N 4JI6J 5A8KB 5DDPC 2OD6A 2CNKB 4KHSA 6FDRA 2KYXA 1S59A 4DR3K 3S3OA 3MGJA 5I3UA 3DXKB 4CZIA 2QA1A 4HHUA 3DOKA 2R7QA 2A40A 2Y1LB 2VJVA 3VQAA 4BR5A 1NGDA 4QS8A 3QB0A 5E7OB 3BP8A 1M0SA 5BRHA 4HT7A 1VQ5S 3Q24A 5KFMA 2NYIA 1FK9A 2C2ZB 4YHHK 5K14A 1H2VZ 3R7SB 1ZC6A 2W7PA 2XMWA 3VERA 2XEXA 4DV6F 3BM7A 3BGUA 3R8YA 4UUWA 5G0RB 5EVZA 7FDRA 3O80A 1VQ7N 4O8KA 2JHEA 4KAZA 1WF0A 4JRPA 2YI1A 3TR8A 2DNMA 3T1YF 4PKHA 1SC1B 3QATA 3NCQA 2BOAA 5EY4A 1FTCA 5AJ3F 4WPAA 5KG7A 3HPGA 1HWKA 1UVMA 4H4MA 1R43A 4B9VA 4YHHF 3F5TA 1TVRA 1AYEA 3VMFB 3C16B 3KFWX 3IM8A 2QLWA 1PCAA 3U1NA 3KKFA 3QEXA 4USMA 4B1UB 1NLVA 3HJVA 4C0HA 1X8DA 4M8LA 4RWTA 3SSRA 2QJ3A 2R8GA 4ECQA 2D9OA 3IG1A 1TVRB 2YWHA 3D6FB 4NLPA 4K50A 3F2KA 3MWTA 5M1QA 5GMDA 4NWBA 3CC2N 4J9MA 5EWGA 2E1CA 2CRLA 4CFCA 4CZLA 1N5SA 4M5NA 1NBEB 4MO5A 2EW9A 1VS3A 4DV4K 4A2AA 4QWCA 3W1YC 2Z2LA 2V63A 2BZ2A 2C1EB 1TYQB 5LXRA 1C1AA 4DFJA 2B7CB 2G8IA 1UPPA 4FBUA 1VRTB 2ZGYA 2XTJP 2KFYA 1FNXH 5B0AA 1XBWA 3VESA 1C0GA 2J5AA 3NGTA 5LJWA 3L9ZA 3QMQA 2RN2A 1ATRA 4LR8A 3MCPA 5JS2A 4F0MA 4DZ6A 2QWMA 3AA9A 3FRYA 2BKOA 3LPTA 4JD2A 4AYBD 1DAXA 4XH5A 2MLXA 3ASMA 5CYMA 1QAJA 2E7VA 3HULA 2DNKA 4GV6A 3KVGA 3MR3A 1Q8KA 5B0DA 3I5AA 2NRXA 4P72A 1Y97A 1YRUA 2IM2A 5KAKA 4Q7AA 2M8DB 3UNGC 5ITHA 1XMOF 4FOEA 2Y0BB 4C2MA 1WEXA 1Z2ZA 4OYAA 4OYMA 4EI2A 1RAEB 4FPBA 3Q8UA 3ZFVA 4XEIA 4EBDA 5JVGL 2MKKA 1SQFA 2YNHB 3OTOK 5J2PB 1RT7B 4RJVA 5A8RB 3DLKA 4TLQA 2AX1A 5K5MA 2V8PA 5IXUA 2NSCA 4FO0A 5DM6Q 2IC3B 1W0HA 4BVPA 2HNDA 1KWMA 5JVHL 1RZMA 3W61A 2LMIA 3GZ7A 2BABA 2PFUA 4UF4A 1XMQJ 4RBUA 3MM9B 1UVJA 1IWAA 5C42A 3EGVA 5A8RA 2W7OA 3TUPA 3IO1A 1RTHA 1ZTWA 2UXBF 5F8LA 4AL6A 4QR2A 3ZSVA 1X9MA 4DV0F 2CZ4A 2HNDB 4XH1A 1FT8A 2KVQE 1WSIA 4JRQA 2DCLA 2J7KA 5D0RA 2KFNA 1HKGA 2P8IA 1S6PA 2YNHA 4DV7J 3MDQA 4IOXA 4A59A 3E9OA 1VSLA 2W2OP 4D3GA 3ET6A 1PILA 3SDEB 1XC3A 2ZH1A 3O3HA 5RUBA 2CPJA 4NYPA 4CEFA 2B9EA 3EVOA 3EZOA 1TL4A 3H42A 2VJUA 1IKYA 4DR7F 1NSPA 1PG5B 1WHXA 4ATNA 1NHKL 3EVWA 3RZAA 2FLPA 2O8FA 1RDRA 2FJWA 2LU1A 2FXUA 3DXMB 1YHQN 2AX0A 2RU9A 3AVAA 1P8GA 3IFRA 3L2RA 3CD0A 3PRBA 5J1EB 4LFCJ 1S7HA 3PO4A 3RTVA 3OYIA 3DXMA 3G9CA 3DNCA 3IUCA 2ATQA 5BR9A 3VALA 5ADZA 1S1UB 3MOJB 3BY5A 4I2QA 1PGZA 5J2NB 3RBZA 2KDOA 1JCGA 1RT3A 4ED6A 1Q82O 4CYUA 4ZVUB 3P39A 4KKOB 2VWKA 1U2FA 1F9EB 1XHZA 3HXMA 3UQSA 4M3TA 3OL6A 2RPIA 4YOYA 4UOFA 4IOBA 5AFUH 3FBFA 2A3ZA 4AM6A 1U02A 4NYNA 1OS5A 5GAHI 2E1RA 4ECWA 4K0KF 4KFBB 1YDLA 2VB6A 1FE4A 4I68A 4C48A 4CJTA 1ZZNA 1XNQJ 4Y3CA 5C2GA 4B3TJ 3BPDA 4LBHA 5C0YA 3LDQA 2BV3A 1OSDA 1HNXF 1YI2N 1M5OC 5ETKA 2HGNA 4DTUA 3V6KA 3UKUA 4LIWA 2BH1A 2IIRA 3THYA 1KQSM 4FS2A 2FVCA 2EK1A 4PXEA 5AQYA 3CD5A 4J9LA 1JL1A 4DG1B 4CLTA 3UB5A 4HEA9 3NF7A 1V3RA 5A8WB 1S9GB 2WVCA 3SPZA 1X4CA 4XIUA 2R2UA 1FCAA 2JVOA 2VGNA 2MY8A 4FZXC 2E9ZA 1YX2A 4X4QA 2XYHB 2HFVA 2BQUA 2HRUA 1G15A 2VA2A 5CCMA 4RBTA 1BIUA 4JI4K 2AQ4A 1YVUA 1WB9A 4I7FA 1QQOA 3EJMA 4QZVB 5L38A 1KRPA 3NL0A 1GLFO 2YWGA 4YOTA 3QYYA 2H54B 4NEYA 3L2QA 4CF9A 3ZT3A 3NF9A 3CXCM 3DDNA 4RW9A 5IV4A 3T19A 2E7WA 4F02A 2GMHA 2FBYA 1TR0A 3SQGB 5CR4A 4NASA 5KG5A 2LECA 4KB1A 3KNGA 3WNFA 2F4FA 5M2RA 4HCCA 5CY4A 5HI7A 4QIWD 1T9WA 1B70B 3BR9A 1NJIT 4I69A 3WNGA 1A7GE 3IAS9 1ITGA 2MQQA 2W9BA 4IR9A 3AJ1A 3ILJA 4PKIA 4B17A 4K4YA 1S4EA 4M7YA 2BM1A 4DEZA 2ZVIA 2Q36A 3LANA 3BYPA 3MXIA 3SJHA 3S41A 5F3TA 3SAHA 4V1Ak 2K7KA 4CZMA 1XNQK 4NA2A 2YHWA 2ZNZA 4ICLA 2HBZB 5ETOA 1HYVA 1U6BA 4NPOA 2Y1RI 3IBWA 1YQHA 1WELA 4P52A 3DXKA 2XSJA 2HK2A 4UOGA 2QEXN 4FPIA 3ENOA 3RVCA 4ICLB 1F5CA 1MROB 2GUPA 2IVPA 4NB4A 2CXEA 4JV5J 2OANA 2VFSA 4RW8B 4KPYA 5D6GA 4W92B 3P83D 3AA4A 2QA2A 3ID8A 5C2FA 5HRNA 3PY8A 4KC5A 3AARA 4JLHA 2HHSA 2XSJB 2OAUA 3QFPA 1JK9B 4USVA 2L41A 3NGYA 2M7SA 1HNZF 2G2OA 5B0BA 2CQGA 4USTA 1CJKB 1WOSA 4DUZF 1WF2A 2GHVC 3DLEB 3RBEA 2UXCK 2EX3A 1L5UA 2E5GA 3NWRA 3TZWA 3HK2A 3NGKA 3O9UA 2OHDA 3UI3A 3EGWB 1QVGM 2GGPB 5HATA 3PEJA 1RTDB 2D41A 3AOAA 4LFCK 4KGMA 1S1TB 2QA4N 4LF7K 1B9DA 1DLOA 3AA2A 4R25A 4YOEA 2ZZTA 4URSA 4O3OA 4FK4A 4FJMA 2V7ZA 2H48B 3HYFA 2QMUB 3O3LA 3QIDA 4H03B 4E89A 1XNRF 3A8JA 2E20A 3HM8A 4Z4HA 1J54A 4I1TA 2MY7A 4A8OA 4MQ3A 1FKOB 4OPAA 2RDJA 1S3XA 3WEEB 4DPWA 1YRXA 1OJ4A 4QPTA 4N47A 3RG6A 4ECVA 4OPJA 3EDRB 4XAKA 1X3MA 4ECXA 2PA8D 2DNPA 2MQ8A 4IOAL 1YK9A 3MUVP 2AP1A 2ETJA 3SQ2A 3O44A 2KJWA 4OLBA 3R3TA 4NLTA 1TFWA 1NK7A 4JI8F 1HI1A 2XCPA 3OSNA 1HNXJ 4YHHJ 3AXKA 2P2CB 1A5WA 3MMAA 3KLEB 1ZM9A 1FKAF 2Q1NA 4K43A 2EFNA 2LU2A 3OHAA 1TV6B 4BWMA 1D1UA 1QLNA 2IAJA 3TAQA 4FXDA 3ENAA 1T9TA 3J80Y 3KK3A 3TAPA 3RR7A 3W62A 2XHCA 1MA9B 1VQNS 1VQ4S 4JD2B 2HYIB 3X3UA 3SAFA 2D5RA 1NM1A 3MM6A 1RT5A 1RWVB 1VSJA 5IZHA 3V1RA 5M2UA 3VWSA 1SB6A 3FSYA 2IRYA 4FNIA 4BRDA 2WTUA 4CLKA 1IBKF 3KWGA 2E1MC 1HW9A 2Q2RA 4BRLA 4KE5A 2BQRA 3VF0B 2B56A 3D2FB 1NJYA 1VSFA 4CFAA 1BUXA 3EEQA 1AUDA 3ALYA 3N4PA 5DZ7A 2JVRA 3BGLA 5KFNA 4CIEA 2QSFA 1MMDA 1G4CA 4O4GA 2XLKA 4FLVA 4R8UB 1EHWA 1NJIO 4X64J 2QFIA 5IV3A 4FK0A 2V69A 3TAFA 1JCFA 1FDBA 3RYLA 1KHVA 3VF6A 2C3OA 5CYJA 2UUBK 5HQLA 2N3LA 4K59A 2HF4A 1NHUA 5C5JA 5FPNA 5KT2A 1GXLA 1VGYA 3DOLB 1KD1T 2KT2A 4PABA 5CZVA 4X65J 2FHOB 4FLUA 2HFSA 4LF8J 1Y4ZB 4ISGA 1RTJB 3QEWA 2CJYB 1IKWA 4F0KA 1JQGA 2V4JA 5E0OA 4OKKA 5H1SQ 4CO0A 2HMIB 1X5SA 3CYMA 4DU8A 2MKSA 1P6TA 2FVSA 3POTA 1E6YA 4DL3A 2ASOA 3TA0A 3W64A 4FXVA 3P5JA 3HHEA 4WCEQ 4LFAK 1DTTB 5J2NA 2RDDA 3AODA 2CNNB 3IA0A 4LVNP 4AL5A 3V81B 3J81j 4RO0A 1RILA 2DNGA 2HWHA 1D9DA 4A47A 2FZKB 1EQYA 2UXDK 4GMJB 2J6UA 4TQRA 2D3OR 1OY6A 5DLFA 5BN8A 3R7NB 1BHNA 4WYWA 3I33A 1G6BA 1R8HA 2AJ2A 3WXJA 4JK8A 1SH3A 3TSPA 4OYIA 3TX0A 1YAGA 4BRHA 1SC4B 4H4MB 1HNVA 2CA9A 2H51B 3NFAA 3MXJA 4HTIA 2EWSA 2N7CA 3Q0AA 2Q3PA 4ELVA 2LQBA 1Q16B 4FK2A 2D3O1 3DLBA 3V9WA 4JKFA 4I6MA 2V5HG 4CGJA 3SV4A 1BL3A 3P8BB 1S5ZA 3KDOA 3LOUA 4USIA 3OS0A 3VVTA 1ESVA 4PY5A 2P9SB 1IBLJ 4CF2A 2YHAA 4A46A 1T9XA 4ZLJA 1NB7A 3ZZTA 1XI1A 2V2KA 2RRBA 1T9UA 2HBKA 2Z1IA 5IWAJ 2RUSA 3MAHA 2CPHA 2FLOA 1XMBA 3AVLA 2BUNA 4PL7A 1RDBA 3D1QA 4CJFA 4DZDA 2X1GA 1GEHA 2HFUA 5KG4A 3KUGA 3HFKA 4DV1J 3DI6B 1WSHA 2XZDB 4PKGA 4I6MB 2MQNA 1FERA 3RW7A 1IN0A 4LRCA 2LA6A 2ZOMA 2N4CA 1KN6A 4J9VA 3JSRA 5A6PA 1W2BR 2PFFB 2JFKA 3DXBA 3QGHA 1KVCA 2Q6BA 4P2SA 3E9PA 1WC6A 1YXQA 3IAYA 3M6XA 1RISA 4E3SA 3KG1A 2QKBA 4ZVEA 4JK7A 4B3RK 2YNIB 1T6CA 3GCWP 2OTLN 4CLZA 2G8KA 5HAOA 4DR5J 3O08A 3TSUA 1FXDA 2DR7A 3NNHA 3QETA 3C6TA 1HBNB 2Z4PA 3PR5B 3KJVB 3QGGA 4MYUA 2KZMA 4FJKA 2DR8A 2H9ZA 4U7UD 4RG8A 3PFOA 2IYIA 2BJ9A 3O8WA 4JOUA 1HARA 3HM9A 3R27A 3BGFA 3CJ1A 3CCMN 3QT7A 3UNYA 4OI3A 4JKEA 1A5VA 4JI1F 3ZX0A 3ZTRA 3SFGA 1EKRA 2HOEA 5KPZA 1RWXB 3SI6A 3FCHA 4RWXA 3W66A 3KYLA 3I8BA 1JJHA 3NLCA 3R9PA 3GONA 2WW8A 1KAXA 4IH5A 1J2VA 3NH0A 3CW2C 2GGPA 4JV1A 1CZBA 3MMCB 2H5IB 1S76D 3SV3A 1RU1A 3SIPB 1LW0A 2GX8A 3RMBA 2MSSA 2KZZA 1HQUB 1I3AA 4QWEA 4WKYA 4Z4CA 1YJ7A 2HNZA 3GOIA 3CJ0A 2J6SA 2IBOA 2GTDA 2RIJA 2Y3YA 4DTJA 3SLCA 1VC0A 4LJMA 2VOPA 2CZVC 4CBUA 2O8CB 4LSNB 5EHHA 1WI8A 4CECA 2PD1A 4IBNA 3A5NC 1NKBA 3N01A 3LP3A 1WG5A 1W2IA 4WBFA 4DR3J 3ET6B 3WNHA 4F36A 1P1LA 3J7YU 2V6AA 4LUBA 2M88A 1Z05A 2W7AA 4DV7F 3C0BA 1EO1A 3MOZA 2HSEB 3IR6B 4MKBA 4FF1A 2ZWHA 2W2NP 3NBPB 2Z8QA 4FDFA 1E4FT 4GKJK 4DV3J 1S6UA 3PDNA 2DB1A 2QLFB 5ETNA 1LWFB 5BR8F 2OTJN 1HRHA 2ZH3A 4IDKB 1NZAA 2O5DA 1NXIA 4TU7A 1Q8BA 3M9MB 3KD5E 3FLCO 5F8IA 1YTUA 3LAMA 1R59O 1U2VA 5KG6A 3JYTB 3ZNUA 4QR1A 4CFDA 5GAEP 3B78A 3VQQA 3ENQA 3MCAB 2WSEC 1RDWX 4P2FA 3BF1A 2H1YA 4HHTA 2QYGA 2WCXA 4ZCMA 4LF5J 1GLJO 1K8KA 4JI2F 3D2FA 3EICA 4H8KA 4DR5F 3HVRA 3JS6A 5KFGA 4OX8A 5KPRA 2KT5A 2FB0A 2UUBJ 3G2XA 1BUPA 1AXQA 3VA0A 2VG5B 2CQ3A 2KL8A 2Z2YB 3PRDA 4O4GB 2KU7A 5GMKa 4K8XA 4UY8O 5AQUA 4XDCA 4CHPA 2V50A 3HJFA 3BO4A 2FBXA 4NL5A 5CXTA 4B1VA 3D3CJ 3HHNB 1TV6A 3I82A 4JV2A 2M2BA 3KHRA 5F41A 3TWHA 3L4QA 4DSLA 3FUYA 4E8UA 3CEDA 2HHHK 2DNZA 4DPXA 1JLCB 3A2FA 3LALA 1S0OA 4Q0BB 2IVYA 3C3LA 5KQ8A 3V9SA 3T5JA 3UKUB 3THYB 4JKDA 2L08A 4RLEA 4DG1A 1YF5L 4FPRA 5D8HB 1JXBA 2P9NA 1R6YA 1RTJA 2QMXA 5DZ6A 2KRRA 1MWMA 2HNYB 4M5JA 2O8EB 2AYGA 4LRBA 3MR6A 2HVDA 2WK4A 5JVGQ 2C2KB 4DV0J 4GC6A 1SUQA 4DR2K 5C25A 2ASMA 2PY5A 4O44A 4ED8A 4WFAL 4A8QA 1AFIA 4M5MA 4RW9B 5LM7E 4PHTX 2HLTA 2XBPA 4KH5A 4IOCQ 1T02A 3T6JA 3SQGA 4AHVA 2DR9A 4B9QA 4LD0A 4YORA 2NZ4A 2DNRA 5DM7L 3HP9A 4FWQA 3G82B 3R2DJ 1NPPA 5F0UA 4P2XA 2QIFA 2X1AA 1XEZA 3K5OA 5LT5A 2VFUA 4Y28C 4X62F 1PO6A 2CPFA 3A8KA 4WU2A 2D4WA 5HL7Q 4FLXA 4DL2A 4B3TK 3M1FA 4LF6K 2LEBA 2VPXB 4OYXA 1C4AA 3DOKB 2VWJA 3CCJS 4K4VA 1WOOA 2V0NA 3MN7A 3UCUP 4NCGA 1NPRA 4JYAF 2IDLA 4IUFA 1ZZFA 3HBTA 3AOBA 2ZGZA 1JMTA 4JI1J 3MWBA 1X5TA 4R0JA 2A6MA 1B0TA 5M2PA 3P4IA 4B9MA 1D0EA 4ZP6A 4F4XA 2W1BA 3L2UA 1Z2LA 1R0AB 1RAIB 3VGSA 1MROA 3AB2B 2HG4A 4J9UE 4CBXA 1RT4A 1JLAA 4W5OA 1TKXA 3OFHA 4FWMA 2EI5A 4RCHA 5GAHU 3AA3A 1JJ2R 1A0OB 1RNHA 1B92A 4BE0A 1Q86T 4CT9A 1YITS 4OKEA 1PSDA 3AVNA 3GIJA 5FRMA 5D78A 1R6VA 3D3BJ 2RT3A 5KOXA 4TVAB 2FYXA 3MTJA 2QZ8A 2OPQB 1QVFR 3C6HA 1U6FA 1RXOB 2R4FA 1VQSA 1ZBUA 3AGKA 2DHXA 3SI8A 3DI6A 4IZ9A 4HDGA 4K7QA 4IXCA 2E9TA 4V19J 1WTFA 2DRBA 4CP5A 4ALZA 3MPWA 2HVHA 4FM2A 4X4TA 4ID1A 4KJIA 2EFVA 1RAGB 4QIGA 2PDAA 1ZBSA 1LWXA 4BS2A 3WEEA 2IDEA 1NG9A 3PACA 2IM0A 4OPHA 2RMLA 3RB3A 1PYTA 2JH3A 3NF8A 1RBUA 4CNZA <