1CXUA

1.42a resolution asv integrase core domain from citrate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
143
structure length
143
Chain Sequence
GPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AVIAN SARCOMA VIRUS INTEGRASE)
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Transferase
total genus 54
structure length 143
sequence length 143
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1cxuA00
1SKSA 2OPPA 4E1NA 3OS2A 2IOCA 3LP0A 3ZSRA 3DRRA 2RKIA 1RDCA 5CZ1A 3UIQA 3C6TA 3QLHA 3QESA 3I8DA 3TAFA 4KRFA 4WE1A 4KFBA 1C0UA 1LAWA 1LWCA 1YVUA 2BANA 3DRPA 4OVLA 1NK6A 2G8KA 2E6MA 3ALYA 1HNVA 4I2QA 3HP6A 1QQCA 1L5UA 4OJRA 2BDPA 4HCCA 4AHSA 1HNIA 3CQ8A 4DTJA 2BGGA 1JLBA 2QK9A 4FJHA 3V9UA 4OLAA 1QS4A 1KFDA 4AHRA 3H08A 3KD5E 3V9ZA 4CF9A 3LAKA 3O3FA 1TK0A 4HVJA 4F8RA 2O4IA 5KRSA 4RW9A 4GMJB 3MEEA 3O3HA 4B9NA 4FJGA 1CLQA 3SV3A 2YKNA 4NCBA 4M3WA 3VQ6A 4BDPA 3HPHA 4N47A 3U3YA 1S1XA 4DSLA 2VWKA 4Z4IA 4Z4EA 1RTHA 4N41A 5HBMA 3SPZA 2JGUA 2HHXA 3OJSA 2RN2A 2KTQA 2B4JA 5HRSA 3SQ2A 3C94A 1JXEA 4CERA 1WLJA 4W5NA 1S5JA 4EP4A 4B9TA 1VSDA 1YTAA 2YV0X 4ELTA 1EKEA 3KTQA 1C0TA 2IAJA 3NH1A 2QKKA 1VSFA 2F96A 4CJLA 1D5AA 3V9SA 4DS5A 3NGIA 3O3GA 3M8SA 1RT3A 1JL2A 2ATQA 3OJUA 3HXMA 3ZT2A 1WAFA 2YHBA 1K6YA 1TV6A 3LP1A 3K5LA 4AHUA 2OPSA 3CM6A 3ZSVA 4CEQA 3AVJA 1RT6A 4CJWA 4DTPA 4FJ8A 2ETJA 4O5BA 3ULDA 1KLMA 2OZMA 1RDDA 3AO2A 4C8NA 1NK4A 4I9QA 4KHUA 2F8SA 4PY5A 4OPJA 1T03A 4M45A 3T1AA 4RW6A 4CE9A 5C24A 2Z1IA 3LWMA 4FZXC 2AJQA 1TK8A 2P51A 2B5JA 4GW6A 4L8RB 4RW8A 3E01A 3VQ9A 4B9SA 4ELUA 3KK2A 1Y97A 4JS5A 4FJ5A 1NKCA 4JS4A 4FM0A 4NCGA 4KI6A 4CGIA 5JS1A 3IRXA 2E6LA 5FROA 1SL0A 4Z4GA 2DY4A 1U04A 3NH2A 4M3ZA 4OLBA 1EX4A 4EZ9A 4HUFA 2ZE2A 3TAEA 2HVIA 4M3RA 4JLHA 3TAGA 3NF8A 3JSMA 2PY5A 1LW2A 3A2FA 1VSEA 3RR7A 1LAVA 3ZSQA 2PZSA 5CYMA 1EXQA 3C6UA 4FLXA 1CXUA 1NOYA 3OYJA 3DLHA 4Y1DA 4ZHRA 3MXJA 2FBYA 4QAGA 4IKFA 2QXFA 4CFBA 4DFKA 3KIOA 4AHTA 4FJKA 3SZ2A 1TKDA 4CIFA 1C6VA 4NYFA 1RILA 1S6QA 1WSEA 4DLEA 5HRNA 1B9DA 3M8RA 1VSHA 2D5RA 3LAMA 3K5MA 1NOZA 1B92A 1X1PA 4FLYA 1UOCA 3DOKA 1EP4A 4DTUA 4KO0A 4B9UA 2HNYA 1S1TA 1HYVA 1XWLA 3DOLA 1I39A 3B6OA 3K5NA 3SQ1A 3SI6A 3QIPA 1A5XA 5SZTA 3TAQA 1U48A 1TKTA 4J2BA 2OYQA 3B6PA 4CGJA 3WNGA 1RBUA 3MEDA 4CGFA 4CHZA 3L8BA 4DQRA 3L2QA 4KPYA 3KJVA 5DMRA 4FJ9A 4BE1A 1Q9YA 1BI4B 1RDAA 1C1BA 4FW2A 4PQUA 3ZT1A 4CIGA 1N5YA 3OS1A 4HCBA 3DMJA 2IGIA 1B9FA 2HB5A 2VWJA 3S9HA 3NBPA 1QHTA 4IG3A 3CFOA 4N56A 3OYKA 4E0DA 5J1EA 3QEXA 1KVCA 2ITGA 1RT5A 3DLGA 4CEAA 2VG5A 2YKMA 1LWFA 2HHVA 1TL1A 2YNFA 3D45A 3MEGA 3K59A 3V9XA 4CJUA 1UA0A 4C8OA 3NH0A 3PX6A 1JLQA 3QEIA 4PA1A 1L3TA 3AVCA 1SL1A 1VSLA 1IKXA 1BCMA 4QOZB 3VA3A 4W5RA 3KK3A 4UQGA 2XY5A 4E7LA 3V1QA 4HTUA 1CZBA 3PUFA 4CK1A 5J2MA 4NCAA 2VG6A 4C8LA 4CJ4A 4GVMA 1KRPA 1ZBFA 4KHWA 1NJYA 3AVNA 3SCXA 1U47A 3HL8A 1S9EA 4FZYA 3RMDA 4FM2A 1RBVA 1HJRA 3NE6A 4CEEA 1XHZA 4F3OA 1ASVA 1UAXA 1QSSA 1FKPA 4YNQA 1BIUA 5HRPA 5J2NA 3LZJA 1KCFA 4CEZA 3HSTB 1VSIA 1YTUA 3AV9A 3AA2A 1FXXA 2YHAA 2IDOA 3S3OA 3P5JA 2FBTA 1WSFA 4DSKA 3MECA 1SV5A 3LPTA 3QEVA 1QE1A 4CJEA 1A5WA 3V1RA 4CEBA 4CJPA 4FLTA 3MXIA 4XIUA 3KLIA 3QEPA 4F4KA 1W0HA 3T19A 4E3SA 1RTIA 4F2RA 4CJQA 3OYHA 1Q9XA 4BWJA 5C25A 1ZBLA 4BWMA 1L3SA 4B8CA 3IS9A 2RPIA 4OKEA 3TANA 2G8FA 3V6DA 4FCYA 3RMBA 3TR8A 3U6FA 3BGRA 1BIZA 3M8QA 4M3YA 2HMIA 4CHPA 4CFAA 1EETA 1JLCA 3HPOA 4Z0UA 5FRNA 3S3NA 2ZQBA 4KHQA 4B9MA 1RT7A 2KZMA 2D0BA 3SV4A 4AILC 4M3XA 4OPKA 4KTQA 2DFHA 2DFFA 4AH9A 3SUNA 3VA0A 3LZIA 1NKEA 1X9MA 1S9GA 4H4OA 3CG7A 1T8EA 3M8PA 2QKBA 1L3VA 4DQPA 4FXDA 1HYSA 5KTQA 4H8KA 3AVFA 4ZTJA 3HM9A 1Z26A 1MU2A 2HNDA 2XY8A 1RTJA 1Z25A 4IBNA 4OKJA 3EZ5A 1BISA 2GBZA 4IFVA 5EU7A 3HK2A 2W42A 1KSPA 4M42A 3SUOA 2OA8A 2X74A 3QERA 5T7BA 1QSLA 4YFUA 4W5TA 3OYBA 4ELVA 3K58A 4CHQA 1ZBHA 1GOBA 4KI4A 1KVAA 4KREA 3ZT4A 5CYQA 2LSNA 4HUEA 1VSMA 3BDPA 1ITGA 4CCHA 4M3UA 3VQBA 4AHVA 1J5OA 4HUGA 1SKWA 2HVHA 3SQ4A 1TKXA 4BDYA 4LH5A 3MAQA 2PYLA 4Z4HA 1BQNA 2IC3A 4CEOA 1TAUA 3LPUA 3ZCMA 5HP1A 4O0IA 4M3TA 4CEDA 3TAMA 3L2RA 3K57A 1W9HA 3SUQA 1T7PA 1JLFA 3PV8A 3VQPA 4DFPA 1XI1A 3KLHA 4CJKA 3OYDA 4DS4A 1FKOA 1LV5A 3RRGA 1C1CA 4FJ7A 3MXMA 2XY6A 3HP9A 3OYEA 1UA1A 5I42A 1S6PA 3PX4A 3U3GA 5HROA 4ZTFA 4KHYA 3KKRA 4CESA 1TK5A 1I3AA 3WNFA 1BGXT 1NK7A 3OY9A 4FK2A 4I7FA 1S1WA 4CJVA 3TABA 4MFBA 2X6NA 1RBRA 2GV9A 2EHGA 4FLVA 4IG0A 1HQEA 3DLRA 1WSHA 4O4GA 4B9VA 4E7KA 2A1SA 5KRTA 1BL3A 5CY4A 4M41A 3QINA 3AVGA 3DI6A 4DQIA 4CECA 2IS3A 1BHLA 2Y1IA 1L3UA 2F8TA 2D0AA 4LH4A 1WNSA 3AO4A 3KLGA 4DFJA 4Z4CA 3ZSWA 2OZSA 3CYMA 4EZ6A 4F2SA 3OYAA 4DU4A 3NGYA 5KGWA 1NK0A 1S1UA 2YNIA 4DFMA 1JLEA 3HPGA 1YT3A 3L2UA 1KLNA 1VSKA 3QNNA 5DK5A 4FLUA 2G8HA 3AVHA 5C42A 4KHNA 1REVA 3CFPA 4Q0BA 2DTUA 1KFSA 2E4LA 2Q3SA 1U49A 4CJSA 1TL3A 3KKSA 4O44A 1LWEA 3OYNA 3F73A 2Z1HA 3OVNA 1JLGA 1UWBA 3QETA 1BQMA 4MQ3A 2G8IA 2Z1JA 1NJXA 1WAJA 3AO5A 3SYZA 4C8KA 1FK9A 5HRRA 3WNHA 3KLEA 1D8YA 3K5OA 4KB1A 4FZZA 4O0JA 4K8XA 3AVMA 4CJFA 4JRPA 2P1JA 4CF2A 4LSNA 4DQQA 2HHUA 1A5VA 4KTWA 3ZSYA 4CF0A 4W5QA 2I5JA 1CZ9A 3ZSXA 4AHCA 4B3OA 3NF7A 3SUPA 3P1GA 1RCHA 4DG1A 4CFDA 1ASWA 4DLGA 2OPRA 4DTMA 2Z1GA 3AO1A 3DLBA 2FC0A 4Y1CA 2A1RA 1WSGA 4CHOA 4LD0A 1O1WA 3DLEA 3V81A 3DLKA 2YNHA 3ITHA 1C1AA 3F9KA 4B8AB 3NCIA 3PX0A 3I0RA 2HNZA 2KQ2A 3AVKA 3LP2A 4DQSA 3EYZA 2BE2A 4EP5A 1U4BA 3NHGA 4FJMA 2B6AA 5D3GA 1DTTA 1RNHA 1RT1A 4DU3A 4W5OA 3TI0A 4FK0A 1NK5A 3HT3A 4DF4A 3PY8A 3PO5A 1VRUA 4DSIA 1Q8IA 2HW3A 1RBTA 1GOCA 3ZSOA 1HMVA 4Z4FA 2YNGA 4J2AA 3VQEA 3OYFA 4BE2A 1WN7A 4B08A 4KHSA 2XY7A 3RMCA 3VQ5A 1TAQA 1NK9A 2KFNA 1ZBUA 2JLEA 4LY7A 1J9AA 4FJXA 4RW7A 4DTXA 1HQUA 1HRHA 4DWIA 4N5SA 3D0PA 2HHSA 3L2VA 3TWHA 3O4QA 1RT4A 4OGEA 3V4IA 3WNEA 4ID1A 3KLFA 3RTVA 3AA3A 1SL2A 5E41A 4KKOA 1VSJA 4C8MA 3RRHA 2EX3A 1XHXA 3SPYA 4FVMA 1XC9A 1RBSA 1VK0A 3DRSA 5K14A 1D9DA 3L3VA 3DYAA 4DTNA 4CFCA 3LANA 4DTSA 4J2EA 2XRIA 5I3UA 4QCLA 3NDKA 4E89A 4ICLA 4E19A 4FLWA 3SNNA 3VQCA 2P5OA 3TARA 5JS2A 4CHNA 4RW4A 5J2QA 2WOMA 2P5GA 5J2PA 4FM1A 3PO4A 3V9WA 3IAYA 1TGOA 4CIEA 4OGCA 4CHYA 4FYDA 3ASMA 1JKHA 4DSJA 3NF9A 4B9LA 1G15A 1KTQA 3HYFA 4O55A 3EY1A 2OPQA 5KGXA 3G0ZA 4ID5A 3OYGA 2Y1JA 1NJWA 5KI6A 4R5PA 4DTRA 2FBVA 3OYLA 3NAEA 2G8WA 4FJJA 3OYIA 1X9SA 1X9WA 2HHTA 1IO2A 3RMAA 1WSIA 3P83D 3OYMA 3RR8A 4KB0A 2HHQA 2KFZA 4FJNA 2GUIA 5HLFA 4PUOA 1ZYQA 3LP3A 3AO3A 1NJZA 3OS0A 1NKBA 2D0CA 1RDBA 4BACA 4DSFA 4F3TA 1IH7A 4PWDA 3NFAA 3VQAA 4CJ5A 3IG1A 4Q5VA 4E7HA 2G8UA 1QSYA 3KD1E 4BDZA 4KV8A 4CGHA 4DF8A 3LDSA 3HVTA 4FW1A 3NF6A 4DTOA 2R7YA 1N6QA 2DFEA 4OKKA 1NK8A 5CZ2A 4BE0A 3ISNC 3I0SA 1RT2A 3THVA 4FJIA 2KW4A 3VQ4A 1HYZA 4E7JA 3DM2A 4CK2A 3KK1A 2WONA 3CM5A 3ZT3A 1QTMA 1C0MA 4N76A 3C95A 4KTZA 3TAPA 1U45A 1SUQA 3VQDA 1SKRA 1F21A 1BI4A 4CK3A 3L2WA 2XO7A 4JRQA 3AVBA 3AA4A 1BCOA 2PYJA 1S1VA 2X78A 3QNOA 2X6SA 1ASUA 3HO1A 3K2PA 3QEWA 4RG8A 2ZD1A 1IKWA 1HPZA 2RF2A 1GOAA 3V1OA 1IKYA 3T3FA 3VQ7A 3VQQA 4HHTA 2NUBA 1ZBIA 2O4GA 3AA5X 3L3UA 1IG9A 2G8VA 4DU1A 1CXQA 1JL1A 3LALA 3VN5A 4CEFA 1TKZA 2FBXA 4NYNA 3AVIA 3O4NA 3OYCA 3HVRA 1D9FA 4J2DA 2HHWA 1TVRA 4DMNA 1J54A 4CGGA 3CFRA 4KAZA 3LWLA 3SQ0A 4I9LA 1RTDA 4FJLA 3SJJA 1DTQA 4FK4A 3RWUA 4CF8A 3G10A 3QIOA 3HJFA 1T05A 5SWMA 3FFIA 4E7IA 4CF1A 4IDKA 4CJTA 4DSEA 1R0AA 1JXBA 1KVBA 3NGZA 3ZSZA 5FDLA 3QO9A 3AVAA 4CJ3A 2KZZA 2VG7A 4G1QA 4IFYA 1J53A 1WSJA 4LSLA 4K8ZA 4E1MA 2XHBA 1DLOA 5FRMA 3AVLA 4I2PA 4CGDA 3VQ8A 4FLZA 3S3MA 1JLAA 4H4MA 4TSXA 4CJRA 1IKVA 3JYTA 1LW0A 1VRTA 3ZT0A
chains in the Genus database with same CATH superfamily
1IBMK 1SKSA 4CD3A 3OS2A 4JYAK 3E9LA 2V7ZA 2ASPA 3QESA 4IO9L 4WE1A 1LAWA 3KVGA 3DRPA 2G8KA 1NK6A 4YDUC 1VHXA 4BQLA 2Q0RA 4OJRA 3OHRA 4AHSA 3J7ZO 3CQ8A 2BDPA 1GLJO 1HKCA 2BGGA 1ZC6A 3UKUA 4AHRA 3V9ZA 5H1SQ 5KPTA 3LAKA 2UUCK 2O4IA 4F8RA 4NCBA 1NM1A 3VQ6A 4BDPA 3HPHA 3U3YA 1N33K 1S1XA 2VWKA 3VEVA 2VQFK 3ULEB 5HBMA 2JGUA 2RN2A 2B4JA 3C94A 1S5JA 2IAJA 3A5OC 3BZKA 1FJGK 1Z05A 3V9SA 4BR5A 1RDWX 3HXMA 5DM7L 2YHBA 5ADXA 4FSVA 3G6EN 4AHUA 2OPSA 2OZMA 2FSNA 3AO2A 4I9QA 5C2DA 2F8SA 3VPZA 1T03A 1VQ9N 1HX1A 4PY5A 4M45A 4RW6A 2GWJA 4L8RB 1QVFM 3VEWA 3THWA 3E01A 1TUYA 4MO4A 4JS4A 4FM0A 4KI6A 3QFUA 1QZ5A 1X3NA 1YUWA 4M3RA 4JLHA 4BRIA 2QTDA 2QWPA 5KQ8A 3RR7A 3KZBA 4FWQA 3ZSQA 1NG9A 1EXQA 3C6UA 3QBWA 1IBLK 5KPZA 3SBTA 2FBYA 4CFBA 4AHTA 3SZ2A 1TKDA 4CIFA 3E9OA 3O4WA 3MCPA 1CZAN 3OA9A 3O9SA 1B92A 1OKJA 2GEMA 4H0OA 4KO0A 5ELZA 3AGKA 3ZETB 1KAYA 3A0IX 3K5NA 3TAQA 3B6PA 2RE2A 3MEDA 4H0YB 5LL6Z 4CHZA 3WT0A 4KPYA 3KJVA 1DEJA 2HF4A 4BE1A 1Q9YA 4GVEA 1RDAA 4FW2A 5TKWA 2ZJRL 4CIGA 4PKIA 1NGAA 4GKJK 3H1QA 4EHUA 1QHTA 4JI2K 3CJ9A 1RT5A 2YKMA 1LWFA 4JD2A 2HHVA 2YNFA 2PFUA 2W6LA 3NH0A 4IJNA 3PX6A 4FL9A 4BRCA 3AVCA 1SL1A 3SAHA 1YJNN 2P9LB 3V1QA 4HTUA 3CCUN 3PSFA 4C8LA 3AGRA 3RMDA 4FM2A 2UXCK 1UAXA 1FKPA 3PSIA 3K9JA 5HRPA 3LZJA 5TKYA 1KCFA 4CEZA 2WBNA 1YTUA 1FXXA 2YHAA 2IDOA 3S3OA 2FBTA 1WSFA 4DSKA 4A59A 4CJEA 4F4KA 3QEPA 1KQSM 4E3SA 4F2RA 1OVQA 4BWJA 4BWMA 3VGMA 3P4IA 1T3VA 3RMBA 3U6FA 1KAZA 1BIZA 1NNEA 4CHPA 1EETA 3HPOA 3S3NA 2ZQBA 3DJCA 2D0BA 4BREA 2ASOA 4M3XA 4OPKA 2DFHA 4K25A 4H0VB 3LZIA 4H4OA 4LF8K 2W6KA 3RSEB 2QKBA 1HYSA 4JI0K 4ZTJA 2HHWA 1V4TA 2HNDA 4A57A 4OKJA 1KSPA 2X74A 4EFHA 4CHQA 1GOBA 4KI4A 3CC7N 2O8BA 4BGAA 2P9IA 5FPMA 2ZM6K 1VSMA 1QHAA 4M3UA 4AHVA 1J5OA 5M1FA 3OBWA 5AQSA 3SQ4A 5AZIB 1TKXA 3J7YP 1BQNA 2IC3A 4CEOA 3PV8A 1YI2N 3OYDA 4DS4A 5GINA 5AQXA 1N34K 4FWOA 4I7FA 4IXCA 3O9RA 4JHDB 2X6NA 4LF7K 3PLAA 5HOOA 1NGIA 3OW2M 2HHHK 5EXWA 4DQIA 2IS3A 1LCUA 5AQIA 4ILHA 1L3UA 2F8TA 3OYAA 4DU4A 3NGYA 1NK0A 1S1UA 2YNIA 3CMAN 1VSKA 4KHNA 3AVHA 5C42A 4JI3K 3CMEN 3CFPA 2QM1A 2QA4N 2P9PB 3KKSA 5AR0A 1LWEA 1JLGA 4ILJA 4KH4A 1BQMA 5JICA 1NJXA 3A5NC 2EWSA 3WEEA 3D7EO 4JRPA 4B3SK 5GAHP 2HHUA 1A5VA 4KTWA 5KPRA 1CZ9A 3AY9A 4B3OA 1E4GT 3NF7A 3D2EA 3TTFA 4DR6K 2V52B 4BR7A 1VQLN 2O8FB 4JKAA 4Y1CA 2AA4A 2A1RA 1O1WA 2GTDA 4B8AB 3PX0A 1Y64A 5AQGA 2HNZA 4DQ8A 3AVKA 4DQSA 1NGJA 3BZCA 2IVNA 3NHGA 1GLDG 5D3GA 2I7PA 4U7BA 4DU3A 3MN6A 5AQRA 1NK5A 4LF6K 3HT3A 3PY8A 4BRGA 4DSIA 2YNGA 3OYFA 4KHSA 4BE2A 4B08A 3T1HK 5AZJB 2JLEA 4DTXA 1HQUA 3IUCA 3VGKA 1J6ZA 2UXDK 4FWPA 4BQZA 2QWMA 3TSPA 3D0PA 3LM2A 1RT4A 3LM9A 3O4QA 3V4IA 1Q81O 3RTVA 1SL2A 3RRHA 1XHXA 1XMOK 1Q86O 1X3MA 1D9DA 3DYAA 5I3UA 1OVYA 4H5WA 4E19A 3R9PA 3VQCA 5KQDA 4ILGB 4CHNA 3CC2N 3OTOK 2WOMA 5J2PA 3PO4A 5F2RA 3V9WA 3ZX0A 4CHYA 5AFUA 1MWMA 3ASMA 3VEYA 5KGXA 3OYGA 2Y1JA 2FBVA 1W7AA 3OYLA 2G8WA 1GLBG 3OYIA 4CZJA 4YOXA 3OYMA 5FPEA 4FJNA 1YJ9N 2GUIA 3LP3A 3OS0A 3CCJN 3M6GA 4DSFA 3IG1A 4KV8A 2KKZA 3HVTA 2O8DB 2VWBA 3DAWA 2DFEA 1HJOA 3ISNC 5BPNA 2AP1A 3VQ4A 4CK2A 1QTMA 5BR8K 4WQ5C 1SUQA 5IT9O 2PYJA 2X6SA 3HO1A 4M7YA 3T69A 1ATNA 1HPZA 1VAZA 2RF2A 2A41A 3V1OA 3VQ7A 3VQQA 1Z6RA 1IG9A 2BTFA 3LALA 4YOYA 2FBXA 3O4NA 1IBKK 3LWLA 3SJJA 1DTQA 4CF8A 5SWMA 4MLHA 2OTLN 4H0XB 1R0AA 1KVBA 5FDLA 4UY8O 3G71N 2P9UA 4CJ3A 3EKSA 4PKGA 1J53A 4LSLA 1QZ6A 1XUPO 3P39A 4IEEA 3CQYA 4I2PA 3CJCA 4H4MA 4BG8A 3WXIA 3JYTA 1LW0A 2Q0UA 3DRRA 4YHHK 2RKIA 3BF3A 3UIQA 3QLHA 3TAFA 4KRFA 1LWCA 3LDPA 2BANA 3CCQN 2WUSA 3F2KA 2E6MA 3ALYA 1L5UA 4HCCA 1HNIA 5E84A 1JLBA 3ENHA 2NZTA 2QK9A 3V9UA 1QS4A 3EZWA 3KD5E 4O5FA 3ID8A 4GMJB 3MEEA 3O3HA 3MX5A 4FJGA 1ATSA 1VQ4N 4DSLA 3O9QA 4Z4IA 1QQNA 2QWNA 1RTHA 4N41A 3UB5A 2HHXA 3OJSA 4BR4A 3W0LA 4EP4A 4B9TA 3D2FB 5FPNA 1C0TA 2F96A 3GDQA 4CJLA 1D5AA 3O3GA 3M8SA 5CE3A 3ZT2A 1K6YA 1TV6A 3ZSVA 4FJ8A 4PL7A 3H3NO 1NK4A 1ZBSA 4CE9A 3LWMA 5C24A 2Z1IA 1TK8A 4FPAA 3VQ9A 4ELUA 2UYTA 3KK2A 4FJ5A 3HRGA 1TYQA 4NCGA 4CGIA 5FROA 3HOTA 4Z4GA 1SL0A 1U04A 4M3ZA 1WUAA 3NF8A 4DR7K 3A2FA 3WXMB 1VSEA 2PZSA 4FLXA 3OYJA 4QAGA 5JVHL 4DUZK 4FJKA 3GG4A 1RILA 1S6QA 3M8RA 3FZHA 1VSHA 2D5RA 3L0QA 1X1PA 4CZHA 5C12A 4DV7K 4DR4K 3DOKA 1S1TA 1XWLA 2YX6A 3DOLA 3B6OA 3SQ1A 3VGLA 4I6MB 2QWQA 3D6RA 1TKTA 4CGJA 4JI5K 3L8BA 4CGFA 3L2QA 3L4QA 2P9NB 5ADXH 4HCBA 2VWJA 3NBPA 4X64K 4JKGA 5BR9A 1JCEA 2VG5A 3P31A 2NRWA 3D45A 1UA0A 3O8MA 3QEIA 1L3TA 4B1ZA 2CGKA 4QOZB 3VA3A 3O08A 3KK3A 2XY5A 4UQGA 1CZBA 4CK1A 4CJ4A 4GVMA 1ZBFA 3AVNA 2H3GX 1QQOA 1QSSA 2QXLA 5J2NA 3CF5L 3HSTB 1VSIA 3ZYYX 2HBMA 4RTFD 1YITN 1QE1A 3VMFB 4BRQA 1A5WA 3MXIA 4FLTA 4XIUA 2GX9A 3KLIA 4WCEL 1W0HA 1J5EK 3T19A 2O8CA 4CJQA 3OYHA 2ZGZA 2G8FA 3V6DA 3L4IA 3UKUB 3TR8A 3M8QA 4M3YA 4DV3K 4CFAA 1JLCA 5MLCQ 5FRNA 3SBGA 1K8KB 4KTQA 3VA0A 2UUBK 1E4FT 1L3VA 1W2BM 4H8KA 1RTJA 2ZF5O 4IBNA 3HK2A 4A2BA 3AAPA 4M42A 3QERA 4YORA 4ELVA 1NBWA 1LOTB 4B9QA 4HUEA 1P8ZA 4RWTA 1ITGA 3KHYA 4CCHA 3VQBA 4BVOA 3HZ6A 4B1YB 3CETA 1SKWA 3DXMA 5BPMA 3MAQA 3VF4A 3LPUA 3K0SA 1VQPN 4CEDA 3K57A 4OO1J 2D4WA 2ITMA 3FR0A 3VQPA 4CJKA 3KLHA 5LMUK 4DFPA 3THWB 1LV5A 1C1CA 3RRGA 4WQ4A 4B3TK 5I42A 1S6PA 4ZTFA 3U3GA 5HROA 3KKRA 2ZGYA 4H03B 3OY9A 1S1WA 4CJVA 3TABA 1HUXA 4IG0A 1HQEA 1U6ZA 4FVUA 4CJ7A 2A1SA 5KRTA 2CGJA 4EIAA 4E7KA 1C0GA 4M41A 3MWPA 3QINA 2OTJN 3AVGA 3H6EA 3ZX2A 3FZMA 3JXUA 1GLCG 3U4LA 2OZSA 4DFJA 3KLGA 4PUOA 4Z4CA 3ZSWA 3O80A 4BG9A 1P90A 5C10A 3P38A 3GL1A 2G8HA 1REVA 4Q0BA 1Q82O 2Q3SA 1HNZK 4MQ3A 3C6AA 4DCHA 4C8KA 5AQJA 5IWAK 4BROA 2E1ZA 3IDHA 4QS9A 4CJFA 4X62K 3THYA 5CR4A 1ESVA 2I5JA 3ZSXA 3BF1A 1K8AO 4DR1K 3SUPA 1RCHA 2OPRA 1S22A 4LF5K 4B1XB 1OH8A 5F1XA 3R1XA 4CHOA 3V81A 2IIRA 3DLEA 3SJHA 4YOUA 3NCIA 4JD2B 2ASMA 2KQ2A 4EP5A 3LDNA 1U4BA 4DV4K 3CQXA 3TSUA 3N4QA 4JI7K 2HSTA 4BY9C 2HW3A 3J8AA 4KHPK 1Q8IA 1RBTA 3FFKB 3VQEA 2XY7A 4J8FA 5AQOA 3CPEA 4FJXA 3NMUA 3R3LA 3LL3A 2E8AA 3GE1A 3L2VA 3EN9A 4OGEA 3IKMA 5I9EB 3KLFA 1NJIO 4KKOA 4GV9A 1ZXOA 4AQYK 3CI5A 2OANA 3DRSA 2GUPA 4J2EA 4DTSA 2Q2RA 5BPLA 3NDKA 3ZX3A 1BOTO 4HTLA 3C7NA 2P5GA 4A62A 4NXNK 4PHTX 1TGOA 4O8UA 3CCMN 3HOSA 4FYDA 1JKHA 3U9DA 4B9LA 4XH5A 1G15A 1KTQA 3HYFA 2OPQA 3MDQA 1NJWA 4FJJA 1X9WA 4BRFA 3I55N 4IFEA 4BRKA 3LDQA 3UKRA 2E20A 5GIPA 3ZEUA 1ZYQA 1Q7YO 3MN9A 4DHYA 1SZ2A 1BWFO 4F3TA 3JAMO 4JHDA 4CJ5A 4E7HA 1T6CA 2W40A 4BDZA 4CGHA 2O8BB 5AQMA 2PAVA 3NF6A 2P9IB 4FW1A 3VENA 2P9KA 4OKKA 3I0SA 1T6DA 2KW4A 3KK1A 3CJAA 1WBDA 4IOAL 3C95A 1JCGA 4KTZA 1KC8O 1U45A 1SKRA 3VQDA 1BI4A 2P9SA 4BC4A 4IOCL 4BVPA 2XO7A 1NGGA 2X78A 3DXKB 3QNOA 3H46O 3QEWA 4CZGA 3C6HA 2ZD1A 1GOAA 4WFNL 1IKYA 3CC4N 4AF1A 4DV2K 1N32K 4IOXA 5HL7L 1CXQA 1JL1A 3VN5A 1OH5A 1VQMN 1TKZA 1D9FA 3AVIA 4J2DA 1TVRA 4DMNA 4KAZA 2D0PA 3SQ0A 4I9LA 3QBXA 4CD1A 3E9PA 3QIOA 3HJFA 3FFIA 4E7IA 4CF1A 4IDKA 3TTDA 3ZSZA 4EAHD 3QO9A 5AFUH 4BRHA 3AVAA 2NRZA 5AQHA 3N4PA 1WSJA 4K8ZA 4DV0K 4JI8K 1DLOA 5FRMA 4CGDA 3A5LC 3WUHA 4CJRA 5J2QA 4MDBA 1WOQA 4M3WA 4E1NA 3WXJA 3LP0A 3CD6N 2J4RA 1RDCA 4FWSA 3WEEB 3C6TA 4WFAL 2FF6A 4KFBA 1C0UA 1YVUA 1YXQA 1HNVA 4I2QA 3HP6A 3D2EB 1IV0A 1QQCA 4DTJA 4FJHA 4OLAA 3H08A 4ISFA 3QB0A 5KRSA 4B9NA 3U8XA 1CLQA 3SV3A 2YKNA 4BC5A 4N47A 3I33A 2KTQA 3SQ2A 4W5NA 1WLJA 3G25A 3JS6A 3E66A 3KTQA 3NH1A 1YHQN 5JLFA 2HF3A 1VSFA 2A40A 4DS5A 3NGIA 3UE5A 1RT3A 1JL2A 3OJUA 3VTIA 3O5BA 2YHYA 3K5LA 4DTPA 3CM6A 4CJWA 1MDUB 1RT6A 1NGDA 5GIOA 3ENOA 4O5BA 3ULDA 5AQKA 1KLMA 1RDDA 4CBXA 5C2FA 3T1AA 4IWVA 4FZXC 2AJQA 4RW8A 4B9SA 1BA1A 5JS1A 4IO8A 2DY4A 2E6LA 2JWKA 4OPAA 3NH2A 1EX4A 4EZ9A 2ZE2A 3TAEA 1XMQK 3TAGA 1EWQA 4F9OA 3JSMA 5DM6L 2F7TA 5AQNA 1LAVA 2GELA 1VQ5N 4HWIA 3DLHA 4Y1DA 4ZHRA 3MXJA 1DT9A 3O1WA 2I7NA 1C6VA 4NYFA 4JKBA 1WSEA 4DLEA 1B9DA 3KWGA 3LAMA 3K5MA 1NOZA 2BH1A 3SAGA 4B3RK 1MWKA 1UOCA 4BGBA 4DTUA 4H0TB 4BRAA 4B9UA 2HNYA 3ID6A 4QS7A 4C23A 1A5XA 5SZTA 1NGEA 5M1KA 4J2BA 3MK6A 3WNGA 1RBUA 3PIOL 4LF4K 1VQON 2OCEA 4PQUA 3ZT1A 1C0FA 1N5YA 2NLXA 2FSKA 3MX2A 4JKCA 4A5AA 1IJJA 4IG3A 3CFOA 3M1FA 3OYKA 3THXA 1YVNA 3QEXA 1KVCA 2ITGA 3DLGA 4DR5K 1ATRA 2FSJA 4A5BA 4C8OA 3MEGA 3K59A 3V9XA 1U2VB 3KK7A 1IKXA 3U9ZA 4E7LA 5J2MA 4BRDA 2VG6A 1KRPA 2NRRA 2VCPA 2P9UB 3SCXA 4IZ9A 3HL8A 4FZYA 1VQNN 2O8EB 1RBVA 4FWLA 1ASVA 3CERA 4NXMK 1BIUA 1D4XA 3SLCA 2YJEA 3QEVA 4CZEA 3LDOA 4CW7B 3FZFA 4FPBA 4GY2B 1Q9XA 1ZBLA 4IJAA 3S41A 4MO5A 1L3SA 3IS9A 1R59O 2RPIA 1S3XA 4OKEA 2GWKA 3CCVN 5BRDA 3BGRA 3J7AP 4Z0UA 3CXCM 1RT7A 4IDHA 2KZMA 2DFFA 4AH9A 1NKEA 3QDKA 3CG7A 1T8EA 3M8PA 4YDUA 3TSQA 4DQPA 4FXDA 5KTQA 2BUPA 3AVFA 3HM9A 3EL2A 2NRXA 4KHUA 2XY8A 3EO3A 4IFVA 2FLOA 4WF9L 2W42A 4LFAK 5CHIA 3MCAB 3SUOA 2OA8A 5AQUA 5EOYA 4KREA 1KVAA 3ZT4A 1XNQK 3CIPA 1HKGA 4KH5A 4HUGA 4BDYA 4LH5A 4JEPA 2PYLA 1TAUA 4M3TA 4O0IA 3TAMA 1T7PA 1W9HA 4LF9K 3CJ1A 3WQUA 4K42A 4FWMA 1FKOA 1E3MA 4FJ7A 3MXMA 3HP9A 3OYEA 3Q7CA 1TYQB 1UA1A 3CCEN 2QW9A 4GV3A 3NVMA 5AQZA 4CESA 1OH7A 1TK5A 1I3AA 2A3ZA 1BGXT 4JV5K 4MFBA 3ATUA 5AJ3K 2EHGA 4C1NK 3DLRA 1VQKN 1FW6A 5LY3A 1BL3A 5CY4A 3E1YA 4CECA 2E2PA 4PKHA 5AQWA 1BHLA 4JNEA 5AQYA 2D0AA 4LH4A 3AO4A 4EZ6A 3CYMA 5KGWA 4DFMA 3C65A 1JLEA 1YT3A 1M1KO 5DK5A 5AQFA 2DTUA 2E4LA 3VEOA 5FLXO 1TL3A 4O44A 3QETA 3SK3A 2G8IA 2Z1JA 3SYZA 3AO5A 1FK9A 3WNHA 3KLEA 5JLHA 3K5OA 4DKWA 4FZZA 4DV5K 2P1JA 4LSNA 4DQQA 2Q36A 4CF0A 4QS8A 4JKFA 3BEXA 1ASWA 5M1NA 4DUYK 4DTMA 2Z1GA 2UU9K 3GBTA 4FOIA 3AO1A 3DLBA 4JKGB 2YNHA 3ITHA 3O6WA 2NRTA 3I0RA 3LP2A 2QWLA 4FO0A 3EYZA 1GLLO 2BE2A 1NMDA 1OH6A 3ULEA 4FJMA 2B6AA 1DTTA 1RT1A 3TI0A 4W5OA 1HLUA 1VRUA 4M63C 1GOCA 3ZSOA 1HMVA 4Z4FA 1WN7A 2V51B 2VGNA 1TAQA 1NK9A 3KWIA 4RW7A 1NWKA 4K41A 4H5RA 4CI6A 1K8KA 3IFRA 4N5SA 3TWHA 5LJWA 5EY4A 4KH6A 3WNEA 3QICA 4CZMA 4ID1A 3CCRN 2D0OA 5E41A 1VSJA 2EX3A 3VEZA 4FVMA 4EHTA 2O8CB 4Y0WA 1RBSA 5K14A 1NGBA 3L3VA 4CFCA 3LANA 2UXBK 4QCLA 1SS6A 2YJFA 4FLWA 3SNNA 2P5OA 3TARA 5JS2A 4JI6K 3QMLA 2ZWHA 4YOWA 4CIEA 1SQKA 5F0XA 3NF9A 4O55A 2NNWA 4JKDA 3VTHA 3EY1A 4ID5A 5KI6A 4DTRA 3NAEA 1X9SA 2HHTA 1IO2A 3P83D 4KB0A 2HHQA 2KFZA 3FZLA 5HLFA 4XEIA 1NJZA 2DPNA 4PWDA 3NFAA 3VQAA 2G8UA 1QSYA 4WFBL 1EWRA 3LDSA 2R7YA 3M5RA 2KLAA 3ZETA 2WC9A 3DXMB 3THVA 4FJIA 1HYZA 4E7JA 2WONA 3CM5A 4N76A 1C0MA 2QWOA 1KD1O 1M90O 4H5NA 4CK3A 3L2WA 2WTUA 3VETA 4LFCK 1ASUA 5M1PA 3K2PA 4RG8A 3O9TA 3FE1A 3DWLA 2D1KA 3T3FA 2NUBA 1ZBIA 1X9JA 3AA5X 1NLVA 3WXLA 4CEFA 3OYCA 3HVRA 3W3DA 1J54A 4FOEA 1K9MO 1RTDA 4FJLA 4FK4A 3RWUA 3MN5A 3H1VX 5GAGP 2P9LA 2VGMA 3A8YA 4CJTA 4DSEA 5M1QA 1JXBA 2E2NA 2VG7A 4G1QA 3SMPA 4IEIA 4RCHA 5A2QO 1BG3A 3VOVA 2XHBA 3AVLA 3S3MA 1XQSC 3T1YK 4AM6A 1RFQA 4GNIA 2HBLA 2HBKA 1BISA 2OPPA 1HR0K 2IOCA 3ZSRA 2JWLA 3BY5A 4FWNA 1JJ2M 4JK9A 3EE9A 5CZ1A 3THYB 1NGHA 3I8DA 4ISGA 4OVLA 2YHXA 2UUAK 4ISEA 5BN9A 1K73O 1KFDA 4X66K 4CF9A 4GV6A 2HOEA 3O3FA 1TK0A 4HVJA 4RW9A 4Z4EA 4JI4K 5EX5A 2E1YA 3SPZA 3RSEA 5GAEP 3CJBA 5HRSA 1JXEA 4CERA 4R79A 1VSDA 1YTAA 2YV0X 4ELTA 3NVKA 1HNXK 1EKEA 1NMNA 4B1WB 1KXPA 2QKKA 2ZJPL 4GKKK 4WQ4C 5LJVA 2ATQA 1Q18A 1WAFA 2IVPA 3LP1A 4CEQA 3AVJA 5JMVA 5AZIA 2ETJA 2QEXN 4C8NA 4JKHA 4OPJA 2Q97A 1YF5L 2B5JA 2P51A 4GW6A 4BC3A 1Y97A 4JS5A 1NKCA 1MA9B 1IG8A 1I94K 3IRXA 3CHWA 3TTCA 4BC2A 4OLBA 3C7NB 2CH6A 4HUFA 3FLCO 4X65K 2HVIA 2NRVA 2PY5A 1LW2A 4H5VA 5AQLA 3LDLA 5CYMA 4YOTA 1CXUA 1NOYA 4IKFA 2QXFA 5AQPA 3BP8A 3HBTA 4DFKA 3KIOA 2PBDA 3UKRB 3DXKA 3ZEUB 5HRNA 3CJ7A 2P9PA 4FLYA 3MN7A 2ZJQL 1EP4A 3QFPA 3ATVA 1GLEG 4BR2A 1DKGD 1G99A 1N36K 2P9KB 1HYVA 1I39A 2F4VK 3FZKA 1WBBA 3SI6A 3QIPA 1U48A 2Q1NA 4BRLA 2OYQA 1QQMA 4DQRA 1HPMA 5DMRA 4FJ9A 1BI4B 2P9SB 1C1BA 4XH4A 3OS1A 3DMJA 2IGIA 1B9FA 2HB5A 3S9HA 2O8FA 2FXUA 4N56A 4E0DA 5J1EA 4NB4A 4OPHA 3HSCA 4CEAA 2W41A 4B3MK 1TL1A 3WQTA 2QWRA 4DV1K 4YY3K 4CJUA 4NLCA 3B8AX 4DB3A 1JLQA 5BRHA 2Q31A 4PA1A 3R6MA 1VSLA 4WQ5A 2RHKA 4WYBA 1BCMA 4E1JA 3VEXA 4W5RA 4NLBA 3PUFA 4NCAA 3L6QA 1O13A 4KHWA 5AZJA 1NJYA 1U47A 3K9KA 1S9EA 3F5TA 4F3OA 1XHZA 3G4SN 1HJRA 3NE6A 4CEEA 4YNQA 4JI1K 1SAZA 3Q7BA 4FWKA 5BREA 3AV9A 3AA2A 5C0YA 3P5JA 1DGKN 3MECA 1SV5A 3LPTA 4A2AA 4CJPA 3V1RA 4CEBA 4JK7A 3CCLN 3ZLJA 1ILYA 1RTIA 5C25A 4CZFA 4B8CA 3TANA 1VQ8N 1BUPA 4FCYA 2HMIA 3M3ZA 4KHQA 4B9MA 1YJWN 3SV4A 4AILC 1BU6O 3WXKA 4JAXA 3SUNA 4CZIA 5FPDA 1X9MA 1S9GA 4PL8A 3EE8A 4CBUA 4BR9A 1MU2A 1Z26A 1Z25A 3EZ5A 4CZLA 5EU7A 2GBZA 3FGUA 1VQ6N 4G9ZA 2YI1A 1GLAG 3F9MA 5EVZA 5T7BA 3PIPL 4DV6K 1NGCA 1QSLA 4YFUA 4W5TA 3OYBA 3K58A 1ZBHA 2NRHA 1EQYA 5CYQA 2LSNA 2O8DA 4DR2K 3BDPA 1JCFA 3C0BA 4FWRA 1V4SA 2HVHA 1QVGM 4Z4HA 4K0KK 4BR0A 3ZCMA 5HP1A 3L2RA 3SUQA 1GLFO 4LC9B 1JLFA 4DR3K 1XI1A 2XY6A 4CZKA 5M1OA 3PX4A 4YOVA 4KHYA 5BN8A 3VESA 2E88A 3WNFA 1NK7A 4FK2A 1KAXA 1XC3A 3ENBA 1RBRA 3I8BA 2GV9A 4FLVA 1WSHA 4O4GA 4B9VA 3DI6A 4L3QA 4JK8A 3CPWM 2Y1IA 1WNSA 4F2SA 2A5XA 3HPGA 3L2UA 5AQTA 1KLNA 4H0PA 3QNNA 1BA0A 4FLUA 1KFSA 4MDAA 1U49A 4CJSA 1BDGA 3F73A 3OYNA 2Z1HA 3OVNA 1UWBA 4KBOA 1WB9A 4XH1A 1WAJA 5HRRA 1D8YA 2FF3B 1U2VA 4KB1A 4BRNA 4O0JA 3I56N 4K8XA 3AVMA 4CF2A 3ZSYA 4W5QA 3AARA 2HMPA 4AHCA 2KHOA 3P1GA 4DG1A 2O8EA 4CFDA 4DLGA 4BRPA 3A5MC 2CGLA 3RVCA 3VERA 3SAFA 2FC0A 1WSGA 4LD0A 5C15A 3THXB 2VQEK 1VQ7N 3DLKA 1C1AA 3F9KA 3TU5A 4B1VA 1HKBA 2F9WA 2VYPA 1S72N 4OX9K 1RNHA 4H5TA 1H1VA 4FK0A 4MLEA 4A61A 4DF4A 3PO5A 2HBJA 3D2FA 4J2AA 3J81O 4K43A 1RDUA 3RMCA 3VQ5A 4V19S 2E5LK 2KFNA 1ZBUA 4LY7A 1J9AA 2A6AA 1HRHA 4DWIA 3SMSA 5BRFA 2HHSA 2E2OA 3AA3A 4LFBK 2CH5A 4C8MA 3TPQA 1NU0A 3SPYA 3HM8A 1XC9A 2E2QA 1VK0A 2A42A 3T7ZA 1TUUA 4DTNA 1YAGA 2XRIA 5LMNK 4ICLA 1N8RO 4NO7A 3EKUA 1YIJN 4RW4A 4BRMA 3R8EA 4FM1A 3VF6A 3IAYA 2WFBA 4OGCA 3MWTA 4DSJA 3G0ZA 3MMVA 1W97L 4R5PA 4CBWA 4JN4A 3GOIA 3RMAA 3RR8A 1WSIA 3O1BA 2QI2A 3AO3A 1NKBA 1EO1A 2D0CA 1RDBA 3DLLL 4BACA 1IH7A 5GADP 4Q5VA 3KD1E 2IVOA 4DF8A 1N6QA 4DTOA 1NK8A 5CZ2A 4AM7A 4BE0A 3AAQA 3BUZB 1NGFA 4M7XA 1RT2A 4I6MA 3VF2A 3IMXA 3DM2A 3CCSN 3EEQA 3ZT3A 2V7YA 1XNRK 3TAPA 1F21A 2P9NA 4JRQA 3AVBA 3AA4A 1BCOA 1S1VA 3HI0A 4U67L 3J80O 4CVNE 4Z94A 1IKWA 1HNWK 4HHTA 5E26A 5AQQA 2O4GA 3L3UA 2G8VA 3O9UA 4DU1A 4E89A 5B8HA 4NYNA 1T44A 2F9TA 1BO5O 3CFRA 4CGGA 3G10A 4B1UB 1T05A 3HTVA 2YCHA 3NGZA 5JVGL 2KZZA 4IFYA 4JKEA 4E1MA 4FLZA 3VQ8A 1RGIA 2YHWA 3H45C 4O8KA 4C1NI 1JLAA 4TSXA 3H3OB 1IKVA 3OBYA 5AQVA 1VRTA 3ZT0A
chains in the Genus database with same CATH topology
1SKSA 2OPPA 4E1NA 3OS2A 2IOCA 3LP0A 3ZSRA 3DRRA 2RKIA 1RDCA 5CZ1A 3UIQA 3C6TA 3QLHA 3QESA 3I8DA 3TAFA 4KRFA 4WE1A 4KFBA 1C0UA 1LAWA 1LWCA 1YVUA 2BANA 3DRPA 4OVLA 1NK6A 2G8KA 2E6MA 3ALYA 1HNVA 4I2QA 3HP6A 1QQCA 1L5UA 4OJRA 2BDPA 4HCCA 4AHSA 1HNIA 3CQ8A 4DTJA 2BGGA 1JLBA 2QK9A 4FJHA 3V9UA 4OLAA 1QS4A 1KFDA 4AHRA 3H08A 3KD5E 3V9ZA 4CF9A 3LAKA 3O3FA 1TK0A 4HVJA 4F8RA 2O4IA 5KRSA 4RW9A 4GMJB 3MEEA 3O3HA 4B9NA 4FJGA 1CLQA 3SV3A 2YKNA 4NCBA 4M3WA 3VQ6A 4BDPA 3HPHA 4N47A 3U3YA 1S1XA 4DSLA 2VWKA 4Z4IA 4Z4EA 1RTHA 4N41A 5HBMA 3SPZA 2JGUA 2HHXA 3OJSA 2RN2A 2KTQA 2B4JA 5HRSA 3SQ2A 3C94A 1JXEA 4CERA 1WLJA 4W5NA 1S5JA 4EP4A 4B9TA 1VSDA 1YTAA 2YV0X 4ELTA 1EKEA 3KTQA 1C0TA 2IAJA 3NH1A 2QKKA 1VSFA 2F96A 4CJLA 1D5AA 3V9SA 4DS5A 3NGIA 3O3GA 3M8SA 1RT3A 1JL2A 2ATQA 3OJUA 3HXMA 3ZT2A 1WAFA 2YHBA 1K6YA 1TV6A 3LP1A 3K5LA 4AHUA 2OPSA 3CM6A 3ZSVA 4CEQA 3AVJA 1RT6A 4CJWA 4DTPA 4FJ8A 2ETJA 4O5BA 3ULDA 1KLMA 2OZMA 1RDDA 3AO2A 4C8NA 1NK4A 4I9QA 4KHUA 2F8SA 4PY5A 4OPJA 1T03A 4M45A 3T1AA 4RW6A 4CE9A 5C24A 2Z1IA 3LWMA 4FZXC 2AJQA 1TK8A 2P51A 2B5JA 4GW6A 4L8RB 4RW8A 3E01A 3VQ9A 4B9SA 4ELUA 3KK2A 1Y97A 4JS5A 4FJ5A 1NKCA 4JS4A 4FM0A 4NCGA 4KI6A 4CGIA 5JS1A 3IRXA 2E6LA 5FROA 1SL0A 4Z4GA 2DY4A 1U04A 3NH2A 4M3ZA 4OLBA 1EX4A 4EZ9A 4HUFA 2ZE2A 3TAEA 2HVIA 4M3RA 4JLHA 3TAGA 3NF8A 3JSMA 2PY5A 1LW2A 3A2FA 1VSEA 3RR7A 1LAVA 3ZSQA 2PZSA 5CYMA 1EXQA 3C6UA 4FLXA 1CXUA 1NOYA 3OYJA 3DLHA 4Y1DA 4ZHRA 3MXJA 2FBYA 4QAGA 4IKFA 2QXFA 4CFBA 4DFKA 3KIOA 4AHTA 4FJKA 3SZ2A 1TKDA 4CIFA 1C6VA 4NYFA 1RILA 1S6QA 1WSEA 4DLEA 5HRNA 1B9DA 3M8RA 1VSHA 2D5RA 3LAMA 3K5MA 1NOZA 1B92A 1X1PA 4FLYA 1UOCA 3DOKA 1EP4A 4DTUA 4KO0A 4B9UA 2HNYA 1S1TA 1HYVA 1XWLA 3DOLA 1I39A 3B6OA 3K5NA 3SQ1A 3SI6A 3QIPA 1A5XA 5SZTA 3TAQA 1U48A 1TKTA 4J2BA 2OYQA 3B6PA 4CGJA 3WNGA 1RBUA 3MEDA 4CGFA 4CHZA 3L8BA 4DQRA 3L2QA 4KPYA 3KJVA 5DMRA 4FJ9A 4BE1A 1Q9YA 1BI4B 1RDAA 1C1BA 4FW2A 4PQUA 3ZT1A 4CIGA 1N5YA 3OS1A 4HCBA 3DMJA 2IGIA 1B9FA 2HB5A 2VWJA 3S9HA 3NBPA 1QHTA 4IG3A 3CFOA 4N56A 3OYKA 4E0DA 5J1EA 3QEXA 1KVCA 2ITGA 1RT5A 3DLGA 4CEAA 2VG5A 2YKMA 1LWFA 2HHVA 1TL1A 2YNFA 3D45A 3MEGA 3K59A 3V9XA 4CJUA 1UA0A 4C8OA 3NH0A 3PX6A 1JLQA 3QEIA 4PA1A 1L3TA 3AVCA 1SL1A 1VSLA 1IKXA 1BCMA 4QOZB 3VA3A 4W5RA 3KK3A 4UQGA 2XY5A 4E7LA 3V1QA 4HTUA 1CZBA 3PUFA 4CK1A 5J2MA 4NCAA 2VG6A 4C8LA 4CJ4A 4GVMA 1KRPA 1ZBFA 4KHWA 1NJYA 3AVNA 3SCXA 1U47A 3HL8A 1S9EA 4FZYA 3RMDA 4FM2A 1RBVA 1HJRA 3NE6A 4CEEA 1XHZA 4F3OA 1ASVA 1UAXA 1QSSA 1FKPA 4YNQA 1BIUA 5HRPA 5J2NA 3LZJA 1KCFA 4CEZA 3HSTB 1VSIA 1YTUA 3AV9A 3AA2A 1FXXA 2YHAA 2IDOA 3S3OA 3P5JA 2FBTA 1WSFA 4DSKA 3MECA 1SV5A 3LPTA 3QEVA 1QE1A 4CJEA 1A5WA 3V1RA 4CEBA 4CJPA 4FLTA 3MXIA 4XIUA 3KLIA 3QEPA 4F4KA 1W0HA 3T19A 4E3SA 1RTIA 4F2RA 4CJQA 3OYHA 1Q9XA 4BWJA 5C25A 1ZBLA 4BWMA 1L3SA 4B8CA 3IS9A 2RPIA 4OKEA 3TANA 2G8FA 3V6DA 4FCYA 3RMBA 3TR8A 3U6FA 3BGRA 1BIZA 3M8QA 4M3YA 2HMIA 4CHPA 4CFAA 1EETA 1JLCA 3HPOA 4Z0UA 5FRNA 3S3NA 2ZQBA 4KHQA 4B9MA 1RT7A 2KZMA 2D0BA 3SV4A 4AILC 4M3XA 4OPKA 4KTQA 2DFHA 2DFFA 4AH9A 3SUNA 3VA0A 3LZIA 1NKEA 1X9MA 1S9GA 4H4OA 3CG7A 1T8EA 3M8PA 2QKBA 1L3VA 4DQPA 4FXDA 1HYSA 5KTQA 4H8KA 3AVFA 4ZTJA 3HM9A 1Z26A 1MU2A 2HNDA 2XY8A 1RTJA 1Z25A 4IBNA 4OKJA 3EZ5A 1BISA 2GBZA 4IFVA 5EU7A 3HK2A 2W42A 1KSPA 4M42A 3SUOA 2OA8A 2X74A 3QERA 5T7BA 1QSLA 4YFUA 4W5TA 3OYBA 4ELVA 3K58A 4CHQA 1ZBHA 1GOBA 4KI4A 1KVAA 4KREA 3ZT4A 5CYQA 2LSNA 4HUEA 1VSMA 3BDPA 1ITGA 4CCHA 4M3UA 3VQBA 4AHVA 1J5OA 4HUGA 1SKWA 2HVHA 3SQ4A 1TKXA 4BDYA 4LH5A 3MAQA 2PYLA 4Z4HA 1BQNA 2IC3A 4CEOA 1TAUA 3LPUA 3ZCMA 5HP1A 4O0IA 4M3TA 4CEDA 3TAMA 3L2RA 3K57A 1W9HA 3SUQA 1T7PA 1JLFA 3PV8A 3VQPA 4DFPA 1XI1A 3KLHA 4CJKA 3OYDA 4DS4A 1FKOA 1LV5A 3RRGA 1C1CA 4FJ7A 3MXMA 2XY6A 3HP9A 3OYEA 1UA1A 5I42A 1S6PA 3PX4A 3U3GA 5HROA 4ZTFA 4KHYA 3KKRA 4CESA 1TK5A 1I3AA 3WNFA 1BGXT 1NK7A 3OY9A 4FK2A 4I7FA 1S1WA 4CJVA 3TABA 4MFBA 2X6NA 1RBRA 2GV9A 2EHGA 4FLVA 4IG0A 1HQEA 3DLRA 1WSHA 4O4GA 4B9VA 4E7KA 2A1SA 5KRTA 1BL3A 5CY4A 4M41A 3QINA 3AVGA 3DI6A 4DQIA 4CECA 2IS3A 1BHLA 2Y1IA 1L3UA 2F8TA 2D0AA 4LH4A 1WNSA 3AO4A 3KLGA 4DFJA 4Z4CA 3ZSWA 2OZSA 3CYMA 4EZ6A 4F2SA 3OYAA 4DU4A 3NGYA 5KGWA 1NK0A 1S1UA 2YNIA 4DFMA 1JLEA 3HPGA 1YT3A 3L2UA 1KLNA 1VSKA 3QNNA 5DK5A 4FLUA 2G8HA 3AVHA 5C42A 4KHNA 1REVA 3CFPA 4Q0BA 2DTUA 1KFSA 2E4LA 2Q3SA 1U49A 4CJSA 1TL3A 3KKSA 4O44A 1LWEA 3OYNA 3F73A 2Z1HA 3OVNA 1JLGA 1UWBA 3QETA 1BQMA 4MQ3A 2G8IA 2Z1JA 1NJXA 1WAJA 3AO5A 3SYZA 4C8KA 1FK9A 5HRRA 3WNHA 3KLEA 1D8YA 3K5OA 4KB1A 4FZZA 4O0JA 4K8XA 3AVMA 4CJFA 4JRPA 2P1JA 4CF2A 4LSNA 4DQQA 2HHUA 1A5VA 4KTWA 3ZSYA 4CF0A 4W5QA 2I5JA 1CZ9A 3ZSXA 4AHCA 4B3OA 3NF7A 3SUPA 3P1GA 1RCHA 4DG1A 4CFDA 1ASWA 4DLGA 2OPRA 4DTMA 2Z1GA 3AO1A 3DLBA 2FC0A 4Y1CA 2A1RA 1WSGA 4CHOA 4LD0A 1O1WA 3DLEA 3V81A 3DLKA 2YNHA 3ITHA 1C1AA 3F9KA 4B8AB 3NCIA 3PX0A 3I0RA 2HNZA 2KQ2A 3AVKA 3LP2A 4DQSA 3EYZA 2BE2A 4EP5A 1U4BA 3NHGA 4FJMA 2B6AA 5D3GA 1DTTA 1RNHA 1RT1A 4DU3A 4W5OA 3TI0A 4FK0A 1NK5A 3HT3A 4DF4A 3PY8A 3PO5A 1VRUA 4DSIA 1Q8IA 2HW3A 1RBTA 1GOCA 3ZSOA 1HMVA 4Z4FA 2YNGA 4J2AA 3VQEA 3OYFA 4BE2A 1WN7A 4B08A 4KHSA 2XY7A 3RMCA 3VQ5A 1TAQA 1NK9A 2KFNA 1ZBUA 2JLEA 4LY7A 1J9AA 4FJXA 4RW7A 4DTXA 1HQUA 1HRHA 4DWIA 4N5SA 3D0PA 2HHSA 3L2VA 3TWHA 3O4QA 1RT4A 4OGEA 3V4IA 3WNEA 4ID1A 3KLFA 3RTVA 3AA3A 1SL2A 5E41A 4KKOA 1VSJA 4C8MA 3RRHA 2EX3A 1XHXA 3SPYA 4FVMA 1XC9A 1RBSA 1VK0A 3DRSA 5K14A 1D9DA 3L3VA 3DYAA 4DTNA 4CFCA 3LANA 4DTSA 4J2EA 2XRIA 5I3UA 4QCLA 3NDKA 4E89A 4ICLA 4E19A 4FLWA 3SNNA 3VQCA 2P5OA 3TARA 5JS2A 4CHNA 4RW4A 5J2QA 2WOMA 2P5GA 5J2PA 4FM1A 3PO4A 3V9WA 3IAYA 1TGOA 4CIEA 4OGCA 4CHYA 4FYDA 3ASMA 1JKHA 4DSJA 3NF9A 4B9LA 1G15A 1KTQA 3HYFA 4O55A 3EY1A 2OPQA 5KGXA 3G0ZA 4ID5A 3OYGA 2Y1JA 1NJWA 5KI6A 4R5PA 4DTRA 2FBVA 3OYLA 3NAEA 2G8WA 4FJJA 3OYIA 1X9SA 1X9WA 2HHTA 1IO2A 3RMAA 1WSIA 3P83D 3OYMA 3RR8A 4KB0A 2HHQA 2KFZA 4FJNA 2GUIA 5HLFA 4PUOA 1ZYQA 3LP3A 3AO3A 1NJZA 3OS0A 1NKBA 2D0CA 1RDBA 4BACA 4DSFA 4F3TA 1IH7A 4PWDA 3NFAA 3VQAA 4CJ5A 3IG1A 4Q5VA 4E7HA 2G8UA 1QSYA 3KD1E 4BDZA 4KV8A 4CGHA 4DF8A 3LDSA 3HVTA 4FW1A 3NF6A 4DTOA 2R7YA 1N6QA 2DFEA 4OKKA 1NK8A 5CZ2A 4BE0A 3ISNC 3I0SA 1RT2A 3THVA 4FJIA 2KW4A 3VQ4A 1HYZA 4E7JA 3DM2A 4CK2A 3KK1A 2WONA 3CM5A 3ZT3A 1QTMA 1C0MA 4N76A 3C95A 4KTZA 3TAPA 1U45A 1SUQA 3VQDA 1SKRA 1F21A 1BI4A 4CK3A 3L2WA 2XO7A 4JRQA 3AVBA 3AA4A 1BCOA 2PYJA 1S1VA 2X78A 3QNOA 2X6SA 1ASUA 3HO1A 3K2PA 3QEWA 4RG8A 2ZD1A 1IKWA 1HPZA 2RF2A 1GOAA 3V1OA 1IKYA 3T3FA 3VQ7A 3VQQA 4HHTA 2NUBA 1ZBIA 2O4GA 3AA5X 3L3UA 1IG9A 2G8VA 4DU1A 1CXQA 1JL1A 3LALA 3VN5A 4CEFA 1TKZA 2FBXA 4NYNA 3AVIA 3O4NA 3OYCA 3HVRA 1D9FA 4J2DA 2HHWA 1TVRA 4DMNA 1J54A 4CGGA 3CFRA 4KAZA 3LWLA 3SQ0A 4I9LA 1RTDA 4FJLA 3SJJA 1DTQA 4FK4A 3RWUA 4CF8A 3G10A 3QIOA 3HJFA 1T05A 5SWMA 3FFIA 4E7IA 4CF1A 4IDKA 4CJTA 4DSEA 1R0AA 1JXBA 1KVBA 3NGZA 3ZSZA 5FDLA 3QO9A 3AVAA 4CJ3A 2KZZA 2VG7A 4G1QA 4IFYA 1J53A 1WSJA 4LSLA 4K8ZA 4E1MA 2XHBA 1DLOA 5FRMA 3AVLA 4I2PA 4CGDA 3VQ8A 4FLZA 3S3MA 1JLAA 4H4MA 4TSXA 4CJRA 1IKVA 3JYTA 1LW0A 1VRTA 3ZT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SKS A;  2OPP A;  4E1N A;  3OS2 A;  2IOC A;  3LP0 A;  3ZSR A;  3DRR A;  2RKI A;  1RDC A;  5CZ1 A;  3UIQ A;  3C6T A;  3QLH A;  3QES A;  3I8D A;  3TAF A;  4KRF A;  4WE1 A;  4KFB A;  1C0U A;  1LAW A;  1LWC A;  1YVU A;  2BAN A;  3DRP A;  4OVL A;  1NK6 A;  2G8K A;  2E6M A;  3ALY A;  1HNV A;  4I2Q A;  3HP6 A;  1QQC A;  1L5U A;  4OJR A;  2BDP A;  4HCC A;  4AHS A;  1HNI A;  3CQ8 A;  4DTJ A;  2BGG A;  1JLB A;  2QK9 A;  4FJH A;  3V9U A;  4OLA A;  1QS4 A;  1KFD A;  4AHR A;  3H08 A;  3KD5 E;  3V9Z A;  4CF9 A;  3LAK A;  3O3F A;  1TK0 A;  4HVJ A;  4F8R A;  2O4I A;  5KRS A;  4RW9 A;  4GMJ B;  3MEE A;  3O3H A;  4B9N A;  4FJG A;  1CLQ A;  3SV3 A;  2YKN A;  4NCB A;  4M3W A;  3VQ6 A;  4BDP A;  3HPH A;  4N47 A;  3U3Y A;  1S1X A;  4DSL A;  2VWK A;  4Z4I A;  4Z4E A;  1RTH A;  4N41 A;  5HBM A;  3SPZ A;  2JGU A;  2HHX A;  3OJS A;  2RN2 A;  2KTQ A;  2B4J A;  5HRS A;  3SQ2 A;  3C94 A;  1JXE A;  4CER A;  1WLJ A;  4W5N A;  1S5J A;  4EP4 A;  4B9T A;  1VSD A;  1YTA A;  2YV0 X;  4ELT A;  1EKE A;  3KTQ A;  1C0T A;  2IAJ A;  3NH1 A;  2QKK A;  1VSF A;  2F96 A;  4CJL A;  1D5A A;  3V9S A;  4DS5 A;  3NGI A;  3O3G A;  3M8S A;  1RT3 A;  1JL2 A;  2ATQ A;  3OJU A;  3HXM A;  3ZT2 A;  1WAF A;  2YHB A;  1K6Y A;  1TV6 A;  3LP1 A;  3K5L A;  4AHU A;  2OPS A;  3CM6 A;  3ZSV A;  4CEQ A;  3AVJ A;  1RT6 A;  4CJW A;  4DTP A;  4FJ8 A;  2ETJ A;  4O5B A;  3ULD A;  1KLM A;  2OZM A;  1RDD A;  3AO2 A;  4C8N A;  1NK4 A;  4I9Q A;  4KHU A;  2F8S A;  4PY5 A;  4OPJ A;  1T03 A;  4M45 A;  3T1A A;  4RW6 A;  4CE9 A;  5C24 A;  2Z1I A;  3LWM A;  4FZX C;  2AJQ A;  1TK8 A;  2P51 A;  2B5J A;  4GW6 A;  4L8R B;  4RW8 A;  3E01 A;  3VQ9 A;  4B9S A;  4ELU A;  3KK2 A;  1Y97 A;  4JS5 A;  4FJ5 A;  1NKC A;  4JS4 A;  4FM0 A;  4NCG A;  4KI6 A;  4CGI A;  5JS1 A;  3IRX A;  2E6L A;  5FRO A;  1SL0 A;  4Z4G A;  2DY4 A;  1U04 A;  3NH2 A;  4M3Z A;  4OLB A;  1EX4 A;  4EZ9 A;  4HUF A;  2ZE2 A;  3TAE A;  2HVI A;  4M3R A;  4JLH A;  3TAG A;  3NF8 A;  3JSM A;  2PY5 A;  1LW2 A;  3A2F A;  1VSE A;  3RR7 A;  1LAV A;  3ZSQ A;  2PZS A;  5CYM A;  1EXQ A;  3C6U A;  4FLX A;  1CXU A;  1NOY A;  3OYJ A;  3DLH A;  4Y1D A;  4ZHR A;  3MXJ A;  2FBY A;  4QAG A;  4IKF A;  2QXF A;  4CFB A;  4DFK A;  3KIO A;  4AHT A;  4FJK A;  3SZ2 A;  1TKD A;  4CIF A;  1C6V A;  4NYF A;  1RIL A;  1S6Q A;  1WSE A;  4DLE A;  5HRN A;  1B9D A;  3M8R A;  1VSH A;  2D5R A;  3LAM A;  3K5M A;  1NOZ A;  1B92 A;  1X1P A;  4FLY A;  1UOC A;  3DOK A;  1EP4 A;  4DTU A;  4KO0 A;  4B9U A;  2HNY A;  1S1T A;  1HYV A;  1XWL A;  3DOL A;  1I39 A;  3B6O A;  3K5N A;  3SQ1 A;  3SI6 A;  3QIP A;  1A5X A;  5SZT A;  3TAQ A;  1U48 A;  1TKT A;  4J2B A;  2OYQ A;  3B6P A;  4CGJ A;  3WNG A;  1RBU A;  3MED A;  4CGF A;  4CHZ A;  3L8B A;  4DQR A;  3L2Q A;  4KPY A;  3KJV A;  5DMR A;  4FJ9 A;  4BE1 A;  1Q9Y A;  1BI4 B;  1RDA A;  1C1B A;  4FW2 A;  4PQU A;  3ZT1 A;  4CIG A;  1N5Y A;  3OS1 A;  4HCB A;  3DMJ A;  2IGI A;  1B9F A;  2HB5 A;  2VWJ A;  3S9H A;  3NBP A;  1QHT A;  4IG3 A;  3CFO A;  4N56 A;  3OYK A;  4E0D A;  5J1E A;  3QEX A;  1KVC A;  2ITG A;  1RT5 A;  3DLG A;  4CEA A;  2VG5 A;  2YKM A;  1LWF A;  2HHV A;  1TL1 A;  2YNF A;  3D45 A;  3MEG A;  3K59 A;  3V9X A;  4CJU A;  1UA0 A;  4C8O A;  3NH0 A;  3PX6 A;  1JLQ A;  3QEI A;  4PA1 A;  1L3T A;  3AVC A;  1SL1 A;  1VSL A;  1IKX A;  1BCM A;  4QOZ B;  3VA3 A;  4W5R A;  3KK3 A;  4UQG A;  2XY5 A;  4E7L A;  3V1Q A;  4HTU A;  1CZB A;  3PUF A;  4CK1 A;  5J2M A;  4NCA A;  2VG6 A;  4C8L A;  4CJ4 A;  4GVM A;  1KRP A;  1ZBF A;  4KHW A;  1NJY A;  3AVN A;  3SCX A;  1U47 A;  3HL8 A;  1S9E A;  4FZY A;  3RMD A;  4FM2 A;  1RBV A;  1HJR A;  3NE6 A;  4CEE A;  1XHZ A;  4F3O A;  1ASV A;  1UAX A;  1QSS A;  1FKP A;  4YNQ A;  1BIU A;  5HRP A;  5J2N A;  3LZJ A;  1KCF A;  4CEZ A;  3HST B;  1VSI A;  1YTU A;  3AV9 A;  3AA2 A;  1FXX A;  2YHA A;  2IDO A;  3S3O A;  3P5J A;  2FBT A;  1WSF A;  4DSK A;  3MEC A;  1SV5 A;  3LPT A;  3QEV A;  1QE1 A;  4CJE A;  1A5W A;  3V1R A;  4CEB A;  4CJP A;  4FLT A;  3MXI A;  4XIU A;  3KLI A;  3QEP A;  4F4K A;  1W0H A;  3T19 A;  4E3S A;  1RTI A;  4F2R A;  4CJQ A;  3OYH A;  1Q9X A;  4BWJ A;  5C25 A;  1ZBL A;  4BWM A;  1L3S A;  4B8C A;  3IS9 A;  2RPI A;  4OKE A;  3TAN A;  2G8F A;  3V6D A;  4FCY A;  3RMB A;  3TR8 A;  3U6F A;  3BGR A;  1BIZ A;  3M8Q A;  4M3Y A;  2HMI A;  4CHP A;  4CFA A;  1EET A;  1JLC A;  3HPO A;  4Z0U A;  5FRN A;  3S3N A;  2ZQB A;  4KHQ A;  4B9M A;  1RT7 A;  2KZM A;  2D0B A;  3SV4 A;  4AIL C;  4M3X A;  4OPK A;  4KTQ A;  2DFH A;  2DFF A;  4AH9 A;  3SUN A;  3VA0 A;  3LZI A;  1NKE A;  1X9M A;  1S9G A;  4H4O A;  3CG7 A;  1T8E A;  3M8P A;  2QKB A;  1L3V A;  4DQP A;  4FXD A;  1HYS A;  5KTQ A;  4H8K A;  3AVF A;  4ZTJ A;  3HM9 A;  1Z26 A;  1MU2 A;  2HND A;  2XY8 A;  1RTJ A;  1Z25 A;  4IBN A;  4OKJ A;  3EZ5 A;  1BIS A;  2GBZ A;  4IFV A;  5EU7 A;  3HK2 A;  2W42 A;  1KSP A;  4M42 A;  3SUO A;  2OA8 A;  2X74 A;  3QER A;  5T7B A;  1QSL A;  4YFU A;  4W5T A;  3OYB A;  4ELV A;  3K58 A;  4CHQ A;  1ZBH A;  1GOB A;  4KI4 A;  1KVA A;  4KRE A;  3ZT4 A;  5CYQ A;  2LSN A;  4HUE A;  1VSM A;  3BDP A;  1ITG A;  4CCH A;  4M3U A;  3VQB A;  4AHV A;  1J5O A;  4HUG A;  1SKW A;  2HVH A;  3SQ4 A;  1TKX A;  4BDY A;  4LH5 A;  3MAQ A;  2PYL A;  4Z4H A;  1BQN A;  2IC3 A;  4CEO A;  1TAU A;  3LPU A;  3ZCM A;  5HP1 A;  4O0I A;  4M3T A;  4CED A;  3TAM A;  3L2R A;  3K57 A;  1W9H A;  3SUQ A;  1T7P A;  1JLF A;  3PV8 A;  3VQP A;  4DFP A;  1XI1 A;  3KLH A;  4CJK A;  3OYD A;  4DS4 A;  1FKO A;  1LV5 A;  3RRG A;  1C1C A;  4FJ7 A;  3MXM A;  2XY6 A;  3HP9 A;  3OYE A;  1UA1 A;  5I42 A;  1S6P A;  3PX4 A;  3U3G A;  5HRO A;  4ZTF A;  4KHY A;  3KKR A;  4CES A;  1TK5 A;  1I3A A;  3WNF A;  1BGX T;  1NK7 A;  3OY9 A;  4FK2 A;  4I7F A;  1S1W A;  4CJV A;  3TAB A;  4MFB A;  2X6N A;  1RBR A;  2GV9 A;  2EHG A;  4FLV A;  4IG0 A;  1HQE A;  3DLR A;  1WSH A;  4O4G A;  4B9V A;  4E7K A;  2A1S A;  5KRT A;  1BL3 A;  5CY4 A;  4M41 A;  3QIN A;  3AVG A;  3DI6 A;  4DQI A;  4CEC A;  2IS3 A;  1BHL A;  2Y1I A;  1L3U A;  2F8T A;  2D0A A;  4LH4 A;  1WNS A;  3AO4 A;  3KLG A;  4DFJ A;  4Z4C A;  3ZSW A;  2OZS A;  3CYM A;  4EZ6 A;  4F2S A;  3OYA A;  4DU4 A;  3NGY A;  5KGW A;  1NK0 A;  1S1U A;  2YNI A;  4DFM A;  1JLE A;  3HPG A;  1YT3 A;  3L2U A;  1KLN A;  1VSK A;  3QNN A;  5DK5 A;  4FLU A;  2G8H A;  3AVH A;  5C42 A;  4KHN A;  1REV A;  3CFP A;  4Q0B A;  2DTU A;  1KFS A;  2E4L A;  2Q3S A;  1U49 A;  4CJS A;  1TL3 A;  3KKS A;  4O44 A;  1LWE A;  3OYN A;  3F73 A;  2Z1H A;  3OVN A;  1JLG A;  1UWB A;  3QET A;  1BQM A;  4MQ3 A;  2G8I A;  2Z1J A;  1NJX A;  1WAJ A;  3AO5 A;  3SYZ A;  4C8K A;  1FK9 A;  5HRR A;  3WNH A;  3KLE A;  1D8Y A;  3K5O A;  4KB1 A;  4FZZ A;  4O0J A;  4K8X A;  3AVM A;  4CJF A;  4JRP A;  2P1J A;  4CF2 A;  4LSN A;  4DQQ A;  2HHU A;  1A5V A;  4KTW A;  3ZSY A;  4CF0 A;  4W5Q A;  2I5J A;  1CZ9 A;  3ZSX A;  4AHC A;  4B3O A;  3NF7 A;  3SUP A;  3P1G A;  1RCH A;  4DG1 A;  4CFD A;  1ASW A;  4DLG A;  2OPR A;  4DTM A;  2Z1G A;  3AO1 A;  3DLB A;  2FC0 A;  4Y1C A;  2A1R A;  1WSG A;  4CHO A;  4LD0 A;  1O1W A;  3DLE A;  3V81 A;  3DLK A;  2YNH A;  3ITH A;  1C1A A;  3F9K A;  4B8A B;  3NCI A;  3PX0 A;  3I0R A;  2HNZ A;  2KQ2 A;  3AVK A;  3LP2 A;  4DQS A;  3EYZ A;  2BE2 A;  4EP5 A;  1U4B A;  3NHG A;  4FJM A;  2B6A A;  5D3G A;  1DTT A;  1RNH A;  1RT1 A;  4DU3 A;  4W5O A;  3TI0 A;  4FK0 A;  1NK5 A;  3HT3 A;  4DF4 A;  3PY8 A;  3PO5 A;  1VRU A;  4DSI A;  1Q8I A;  2HW3 A;  1RBT A;  1GOC A;  3ZSO A;  1HMV A;  4Z4F A;  2YNG A;  4J2A A;  3VQE A;  3OYF A;  4BE2 A;  1WN7 A;  4B08 A;  4KHS A;  2XY7 A;  3RMC A;  3VQ5 A;  1TAQ A;  1NK9 A;  2KFN A;  1ZBU A;  2JLE A;  4LY7 A;  1J9A A;  4FJX A;  4RW7 A;  4DTX A;  1HQU A;  1HRH A;  4DWI A;  4N5S A;  3D0P A;  2HHS A;  3L2V A;  3TWH A;  3O4Q A;  1RT4 A;  4OGE A;  3V4I A;  3WNE A;  4ID1 A;  3KLF A;  3RTV A;  3AA3 A;  1SL2 A;  5E41 A;  4KKO A;  1VSJ A;  4C8M A;  3RRH A;  2EX3 A;  1XHX A;  3SPY A;  4FVM A;  1XC9 A;  1RBS A;  1VK0 A;  3DRS A;  5K14 A;  1D9D A;  3L3V A;  3DYA A;  4DTN A;  4CFC A;  3LAN A;  4DTS A;  4J2E A;  2XRI A;  5I3U A;  4QCL A;  3NDK A;  4E89 A;  4ICL A;  4E19 A;  4FLW A;  3SNN A;  3VQC A;  2P5O A;  3TAR A;  5JS2 A;  4CHN A;  4RW4 A;  5J2Q A;  2WOM A;  2P5G A;  5J2P A;  4FM1 A;  3PO4 A;  3V9W A;  3IAY A;  1TGO A;  4CIE A;  4OGC A;  4CHY A;  4FYD A;  3ASM A;  1JKH A;  4DSJ A;  3NF9 A;  4B9L A;  1G15 A;  1KTQ A;  3HYF A;  4O55 A;  3EY1 A;  2OPQ A;  5KGX A;  3G0Z A;  4ID5 A;  3OYG A;  2Y1J A;  1NJW A;  5KI6 A;  4R5P A;  4DTR A;  2FBV A;  3OYL A;  3NAE A;  2G8W A;  4FJJ A;  3OYI A;  1X9S A;  1X9W A;  2HHT A;  1IO2 A;  3RMA A;  1WSI A;  3P83 D;  3OYM A;  3RR8 A;  4KB0 A;  2HHQ A;  2KFZ A;  4FJN A;  2GUI A;  5HLF A;  4PUO A;  1ZYQ A;  3LP3 A;  3AO3 A;  1NJZ A;  3OS0 A;  1NKB A;  2D0C A;  1RDB A;  4BAC A;  4DSF A;  4F3T A;  1IH7 A;  4PWD A;  3NFA A;  3VQA A;  4CJ5 A;  3IG1 A;  4Q5V A;  4E7H A;  2G8U A;  1QSY A;  3KD1 E;  4BDZ A;  4KV8 A;  4CGH A;  4DF8 A;  3LDS A;  3HVT A;  4FW1 A;  3NF6 A;  4DTO A;  2R7Y A;  1N6Q A;  2DFE A;  4OKK A;  1NK8 A;  5CZ2 A;  4BE0 A;  3ISN C;  3I0S A;  1RT2 A;  3THV A;  4FJI A;  2KW4 A;  3VQ4 A;  1HYZ A;  4E7J A;  3DM2 A;  4CK2 A;  3KK1 A;  2WON A;  3CM5 A;  3ZT3 A;  1QTM A;  1C0M A;  4N76 A;  3C95 A;  4KTZ A;  3TAP A;  1U45 A;  1SUQ A;  3VQD A;  1SKR A;  1F21 A;  1BI4 A;  4CK3 A;  3L2W A;  2XO7 A;  4JRQ A;  3AVB A;  3AA4 A;  1BCO A;  2PYJ A;  1S1V A;  2X78 A;  3QNO A;  2X6S A;  1ASU A;  3HO1 A;  3K2P A;  3QEW A;  4RG8 A;  2ZD1 A;  1IKW A;  1HPZ A;  2RF2 A;  1GOA A;  3V1O A;  1IKY A;  3T3F A;  3VQ7 A;  3VQQ A;  4HHT A;  2NUB A;  1ZBI A;  2O4G A;  3AA5 X;  3L3U A;  1IG9 A;  2G8V A;  4DU1 A;  1CXQ A;  1JL1 A;  3LAL A;  3VN5 A;  4CEF A;  1TKZ A;  2FBX A;  4NYN A;  3AVI A;  3O4N A;  3OYC A;  3HVR A;  1D9F A;  4J2D A;  2HHW A;  1TVR A;  4DMN A;  1J54 A;  4CGG A;  3CFR A;  4KAZ A;  3LWL A;  3SQ0 A;  4I9L A;  1RTD A;  4FJL A;  3SJJ A;  1DTQ A;  4FK4 A;  3RWU A;  4CF8 A;  3G10 A;  3QIO A;  3HJF A;  1T05 A;  5SWM A;  3FFI A;  4E7I A;  4CF1 A;  4IDK A;  4CJT A;  4DSE A;  1R0A A;  1JXB A;  1KVB A;  3NGZ A;  3ZSZ A;  5FDL A;  3QO9 A;  3AVA A;  4CJ3 A;  2KZZ A;  2VG7 A;  4G1Q A;  4IFY A;  1J53 A;  1WSJ A;  4LSL A;  4K8Z A;  4E1M A;  2XHB A;  1DLO A;  5FRM A;  3AVL A;  4I2P A;  4CGD A;  3VQ8 A;  4FLZ A;  3S3M A;  1JLA A;  4H4M A;  4TSX A;  4CJR A;  1IKV A;  3JYT A;  1LW0 A;  1VRT A;  3ZT0 A; 
#chains in the Genus database with same CATH topology
 1IBM K;  1SKS A;  4CD3 A;  3OS2 A;  4JYA K;  3E9L A;  2V7Z A;  2ASP A;  3QES A;  4IO9 L;  4WE1 A;  1LAW A;  3KVG A;  3DRP A;  2G8K A;  1NK6 A;  4YDU C;  1VHX A;  4BQL A;  2Q0R A;  4OJR A;  3OHR A;  4AHS A;  3J7Z O;  3CQ8 A;  2BDP A;  1GLJ O;  1HKC A;  2BGG A;  1ZC6 A;  3UKU A;  4AHR A;  3V9Z A;  5H1S Q;  5KPT A;  3LAK A;  2UUC K;  2O4I A;  4F8R A;  4NCB A;  1NM1 A;  3VQ6 A;  4BDP A;  3HPH A;  3U3Y A;  1N33 K;  1S1X A;  2VWK A;  3VEV A;  2VQF K;  3ULE B;  5HBM A;  2JGU A;  2RN2 A;  2B4J A;  3C94 A;  1S5J A;  2IAJ A;  3A5O C;  3BZK A;  1FJG K;  1Z05 A;  3V9S A;  4BR5 A;  1RDW X;  3HXM A;  5DM7 L;  2YHB A;  5ADX A;  4FSV A;  3G6E N;  4AHU A;  2OPS A;  2OZM A;  2FSN A;  3AO2 A;  4I9Q A;  5C2D A;  2F8S A;  3VPZ A;  1T03 A;  1VQ9 N;  1HX1 A;  4PY5 A;  4M45 A;  4RW6 A;  2GWJ A;  4L8R B;  1QVF M;  3VEW A;  3THW A;  3E01 A;  1TUY A;  4MO4 A;  4JS4 A;  4FM0 A;  4KI6 A;  3QFU A;  1QZ5 A;  1X3N A;  1YUW A;  4M3R A;  4JLH A;  4BRI A;  2QTD A;  2QWP A;  5KQ8 A;  3RR7 A;  3KZB A;  4FWQ A;  3ZSQ A;  1NG9 A;  1EXQ A;  3C6U A;  3QBW A;  1IBL K;  5KPZ A;  3SBT A;  2FBY A;  4CFB A;  4AHT A;  3SZ2 A;  1TKD A;  4CIF A;  3E9O A;  3O4W A;  3MCP A;  1CZA N;  3OA9 A;  3O9S A;  1B92 A;  1OKJ A;  2GEM A;  4H0O A;  4KO0 A;  5ELZ A;  3AGK A;  3ZET B;  1KAY A;  3A0I X;  3K5N A;  3TAQ A;  3B6P A;  2RE2 A;  3MED A;  4H0Y B;  5LL6 Z;  4CHZ A;  3WT0 A;  4KPY A;  3KJV A;  1DEJ A;  2HF4 A;  4BE1 A;  1Q9Y A;  4GVE A;  1RDA A;  4FW2 A;  5TKW A;  2ZJR L;  4CIG A;  4PKI A;  1NGA A;  4GKJ K;  3H1Q A;  4EHU A;  1QHT A;  4JI2 K;  3CJ9 A;  1RT5 A;  2YKM A;  1LWF A;  4JD2 A;  2HHV A;  2YNF A;  2PFU A;  2W6L A;  3NH0 A;  4IJN A;  3PX6 A;  4FL9 A;  4BRC A;  3AVC A;  1SL1 A;  3SAH A;  1YJN N;  2P9L B;  3V1Q A;  4HTU A;  3CCU N;  3PSF A;  4C8L A;  3AGR A;  3RMD A;  4FM2 A;  2UXC K;  1UAX A;  1FKP A;  3PSI A;  3K9J A;  5HRP A;  3LZJ A;  5TKY A;  1KCF A;  4CEZ A;  2WBN A;  1YTU A;  1FXX A;  2YHA A;  2IDO A;  3S3O A;  2FBT A;  1WSF A;  4DSK A;  4A59 A;  4CJE A;  4F4K A;  3QEP A;  1KQS M;  4E3S A;  4F2R A;  1OVQ A;  4BWJ A;  4BWM A;  3VGM A;  3P4I A;  1T3V A;  3RMB A;  3U6F A;  1KAZ A;  1BIZ A;  1NNE A;  4CHP A;  1EET A;  3HPO A;  3S3N A;  2ZQB A;  3DJC A;  2D0B A;  4BRE A;  2ASO A;  4M3X A;  4OPK A;  2DFH A;  4K25 A;  4H0V B;  3LZI A;  4H4O A;  4LF8 K;  2W6K A;  3RSE B;  2QKB A;  1HYS A;  4JI0 K;  4ZTJ A;  2HHW A;  1V4T A;  2HND A;  4A57 A;  4OKJ A;  1KSP A;  2X74 A;  4EFH A;  4CHQ A;  1GOB A;  4KI4 A;  3CC7 N;  2O8B A;  4BGA A;  2P9I A;  5FPM A;  2ZM6 K;  1VSM A;  1QHA A;  4M3U A;  4AHV A;  1J5O A;  5M1F A;  3OBW A;  5AQS A;  3SQ4 A;  5AZI B;  1TKX A;  3J7Y P;  1BQN A;  2IC3 A;  4CEO A;  3PV8 A;  1YI2 N;  3OYD A;  4DS4 A;  5GIN A;  5AQX A;  1N34 K;  4FWO A;  4I7F A;  4IXC A;  3O9R A;  4JHD B;  2X6N A;  4LF7 K;  3PLA A;  5HOO A;  1NGI A;  3OW2 M;  2HHH K;  5EXW A;  4DQI A;  2IS3 A;  1LCU A;  5AQI A;  4ILH A;  1L3U A;  2F8T A;  3OYA A;  4DU4 A;  3NGY A;  1NK0 A;  1S1U A;  2YNI A;  3CMA N;  1VSK A;  4KHN A;  3AVH A;  5C42 A;  4JI3 K;  3CME N;  3CFP A;  2QM1 A;  2QA4 N;  2P9P B;  3KKS A;  5AR0 A;  1LWE A;  1JLG A;  4ILJ A;  4KH4 A;  1BQM A;  5JIC A;  1NJX A;  3A5N C;  2EWS A;  3WEE A;  3D7E O;  4JRP A;  4B3S K;  5GAH P;  2HHU A;  1A5V A;  4KTW A;  5KPR A;  1CZ9 A;  3AY9 A;  4B3O A;  1E4G T;  3NF7 A;  3D2E A;  3TTF A;  4DR6 K;  2V52 B;  4BR7 A;  1VQL N;  2O8F B;  4JKA A;  4Y1C A;  2AA4 A;  2A1R A;  1O1W A;  2GTD A;  4B8A B;  3PX0 A;  1Y64 A;  5AQG A;  2HNZ A;  4DQ8 A;  3AVK A;  4DQS A;  1NGJ A;  3BZC A;  2IVN A;  3NHG A;  1GLD G;  5D3G A;  2I7P A;  4U7B A;  4DU3 A;  3MN6 A;  5AQR A;  1NK5 A;  4LF6 K;  3HT3 A;  3PY8 A;  4BRG A;  4DSI A;  2YNG A;  3OYF A;  4KHS A;  4BE2 A;  4B08 A;  3T1H K;  5AZJ B;  2JLE A;  4DTX A;  1HQU A;  3IUC A;  3VGK A;  1J6Z A;  2UXD K;  4FWP A;  4BQZ A;  2QWM A;  3TSP A;  3D0P A;  3LM2 A;  1RT4 A;  3LM9 A;  3O4Q A;  3V4I A;  1Q81 O;  3RTV A;  1SL2 A;  3RRH A;  1XHX A;  1XMO K;  1Q86 O;  1X3M A;  1D9D A;  3DYA A;  5I3U A;  1OVY A;  4H5W A;  4E19 A;  3R9P A;  3VQC A;  5KQD A;  4ILG B;  4CHN A;  3CC2 N;  3OTO K;  2WOM A;  5J2P A;  3PO4 A;  5F2R A;  3V9W A;  3ZX0 A;  4CHY A;  5AFU A;  1MWM A;  3ASM A;  3VEY A;  5KGX A;  3OYG A;  2Y1J A;  2FBV A;  1W7A A;  3OYL A;  2G8W A;  1GLB G;  3OYI A;  4CZJ A;  4YOX A;  3OYM A;  5FPE A;  4FJN A;  1YJ9 N;  2GUI A;  3LP3 A;  3OS0 A;  3CCJ N;  3M6G A;  4DSF A;  3IG1 A;  4KV8 A;  2KKZ A;  3HVT A;  2O8D B;  2VWB A;  3DAW A;  2DFE A;  1HJO A;  3ISN C;  5BPN A;  2AP1 A;  3VQ4 A;  4CK2 A;  1QTM A;  5BR8 K;  4WQ5 C;  1SUQ A;  5IT9 O;  2PYJ A;  2X6S A;  3HO1 A;  4M7Y A;  3T69 A;  1ATN A;  1HPZ A;  1VAZ A;  2RF2 A;  2A41 A;  3V1O A;  3VQ7 A;  3VQQ A;  1Z6R A;  1IG9 A;  2BTF A;  3LAL A;  4YOY A;  2FBX A;  3O4N A;  1IBK K;  3LWL A;  3SJJ A;  1DTQ A;  4CF8 A;  5SWM A;  4MLH A;  2OTL N;  4H0X B;  1R0A A;  1KVB A;  5FDL A;  4UY8 O;  3G71 N;  2P9U A;  4CJ3 A;  3EKS A;  4PKG A;  1J53 A;  4LSL A;  1QZ6 A;  1XUP O;  3P39 A;  4IEE A;  3CQY A;  4I2P A;  3CJC A;  4H4M A;  4BG8 A;  3WXI A;  3JYT A;  1LW0 A;  2Q0U A;  3DRR A;  4YHH K;  2RKI A;  3BF3 A;  3UIQ A;  3QLH A;  3TAF A;  4KRF A;  1LWC A;  3LDP A;  2BAN A;  3CCQ N;  2WUS A;  3F2K A;  2E6M A;  3ALY A;  1L5U A;  4HCC A;  1HNI A;  5E84 A;  1JLB A;  3ENH A;  2NZT A;  2QK9 A;  3V9U A;  1QS4 A;  3EZW A;  3KD5 E;  4O5F A;  3ID8 A;  4GMJ B;  3MEE A;  3O3H A;  3MX5 A;  4FJG A;  1ATS A;  1VQ4 N;  4DSL A;  3O9Q A;  4Z4I A;  1QQN A;  2QWN A;  1RTH A;  4N41 A;  3UB5 A;  2HHX A;  3OJS A;  4BR4 A;  3W0L A;  4EP4 A;  4B9T A;  3D2F B;  5FPN A;  1C0T A;  2F96 A;  3GDQ A;  4CJL A;  1D5A A;  3O3G A;  3M8S A;  5CE3 A;  3ZT2 A;  1K6Y A;  1TV6 A;  3ZSV A;  4FJ8 A;  4PL7 A;  3H3N O;  1NK4 A;  1ZBS A;  4CE9 A;  3LWM A;  5C24 A;  2Z1I A;  1TK8 A;  4FPA A;  3VQ9 A;  4ELU A;  2UYT A;  3KK2 A;  4FJ5 A;  3HRG A;  1TYQ A;  4NCG A;  4CGI A;  5FRO A;  3HOT A;  4Z4G A;  1SL0 A;  1U04 A;  4M3Z A;  1WUA A;  3NF8 A;  4DR7 K;  3A2F A;  3WXM B;  1VSE A;  2PZS A;  4FLX A;  3OYJ A;  4QAG A;  5JVH L;  4DUZ K;  4FJK A;  3GG4 A;  1RIL A;  1S6Q A;  3M8R A;  3FZH A;  1VSH A;  2D5R A;  3L0Q A;  1X1P A;  4CZH A;  5C12 A;  4DV7 K;  4DR4 K;  3DOK A;  1S1T A;  1XWL A;  2YX6 A;  3DOL A;  3B6O A;  3SQ1 A;  3VGL A;  4I6M B;  2QWQ A;  3D6R A;  1TKT A;  4CGJ A;  4JI5 K;  3L8B A;  4CGF A;  3L2Q A;  3L4Q A;  2P9N B;  5ADX H;  4HCB A;  2VWJ A;  3NBP A;  4X64 K;  4JKG A;  5BR9 A;  1JCE A;  2VG5 A;  3P31 A;  2NRW A;  3D45 A;  1UA0 A;  3O8M A;  3QEI A;  1L3T A;  4B1Z A;  2CGK A;  4QOZ B;  3VA3 A;  3O08 A;  3KK3 A;  2XY5 A;  4UQG A;  1CZB A;  4CK1 A;  4CJ4 A;  4GVM A;  1ZBF A;  3AVN A;  2H3G X;  1QQO A;  1QSS A;  2QXL A;  5J2N A;  3CF5 L;  3HST B;  1VSI A;  3ZYY X;  2HBM A;  4RTF D;  1YIT N;  1QE1 A;  3VMF B;  4BRQ A;  1A5W A;  3MXI A;  4FLT A;  4XIU A;  2GX9 A;  3KLI A;  4WCE L;  1W0H A;  1J5E K;  3T19 A;  2O8C A;  4CJQ A;  3OYH A;  2ZGZ A;  2G8F A;  3V6D A;  3L4I A;  3UKU B;  3TR8 A;  3M8Q A;  4M3Y A;  4DV3 K;  4CFA A;  1JLC A;  5MLC Q;  5FRN A;  3SBG A;  1K8K B;  4KTQ A;  3VA0 A;  2UUB K;  1E4F T;  1L3V A;  1W2B M;  4H8K A;  1RTJ A;  2ZF5 O;  4IBN A;  3HK2 A;  4A2B A;  3AAP A;  4M42 A;  3QER A;  4YOR A;  4ELV A;  1NBW A;  1LOT B;  4B9Q A;  4HUE A;  1P8Z A;  4RWT A;  1ITG A;  3KHY A;  4CCH A;  3VQB A;  4BVO A;  3HZ6 A;  4B1Y B;  3CET A;  1SKW A;  3DXM A;  5BPM A;  3MAQ A;  3VF4 A;  3LPU A;  3K0S A;  1VQP N;  4CED A;  3K57 A;  4OO1 J;  2D4W A;  2ITM A;  3FR0 A;  3VQP A;  4CJK A;  3KLH A;  5LMU K;  4DFP A;  3THW B;  1LV5 A;  1C1C A;  3RRG A;  4WQ4 A;  4B3T K;  5I42 A;  1S6P A;  4ZTF A;  3U3G A;  5HRO A;  3KKR A;  2ZGY A;  4H03 B;  3OY9 A;  1S1W A;  4CJV A;  3TAB A;  1HUX A;  4IG0 A;  1HQE A;  1U6Z A;  4FVU A;  4CJ7 A;  2A1S A;  5KRT A;  2CGJ A;  4EIA A;  4E7K A;  1C0G A;  4M41 A;  3MWP A;  3QIN A;  2OTJ N;  3AVG A;  3H6E A;  3ZX2 A;  3FZM A;  3JXU A;  1GLC G;  3U4L A;  2OZS A;  4DFJ A;  3KLG A;  4PUO A;  4Z4C A;  3ZSW A;  3O80 A;  4BG9 A;  1P90 A;  5C10 A;  3P38 A;  3GL1 A;  2G8H A;  1REV A;  4Q0B A;  1Q82 O;  2Q3S A;  1HNZ K;  4MQ3 A;  3C6A A;  4DCH A;  4C8K A;  5AQJ A;  5IWA K;  4BRO A;  2E1Z A;  3IDH A;  4QS9 A;  4CJF A;  4X62 K;  3THY A;  5CR4 A;  1ESV A;  2I5J A;  3ZSX A;  3BF1 A;  1K8A O;  4DR1 K;  3SUP A;  1RCH A;  2OPR A;  1S22 A;  4LF5 K;  4B1X B;  1OH8 A;  5F1X A;  3R1X A;  4CHO A;  3V81 A;  2IIR A;  3DLE A;  3SJH A;  4YOU A;  3NCI A;  4JD2 B;  2ASM A;  2KQ2 A;  4EP5 A;  3LDN A;  1U4B A;  4DV4 K;  3CQX A;  3TSU A;  3N4Q A;  4JI7 K;  2HST A;  4BY9 C;  2HW3 A;  3J8A A;  4KHP K;  1Q8I A;  1RBT A;  3FFK B;  3VQE A;  2XY7 A;  4J8F A;  5AQO A;  3CPE A;  4FJX A;  3NMU A;  3R3L A;  3LL3 A;  2E8A A;  3GE1 A;  3L2V A;  3EN9 A;  4OGE A;  3IKM A;  5I9E B;  3KLF A;  1NJI O;  4KKO A;  4GV9 A;  1ZXO A;  4AQY K;  3CI5 A;  2OAN A;  3DRS A;  2GUP A;  4J2E A;  4DTS A;  2Q2R A;  5BPL A;  3NDK A;  3ZX3 A;  1BOT O;  4HTL A;  3C7N A;  2P5G A;  4A62 A;  4NXN K;  4PHT X;  1TGO A;  4O8U A;  3CCM N;  3HOS A;  4FYD A;  1JKH A;  3U9D A;  4B9L A;  4XH5 A;  1G15 A;  1KTQ A;  3HYF A;  2OPQ A;  3MDQ A;  1NJW A;  4FJJ A;  1X9W A;  4BRF A;  3I55 N;  4IFE A;  4BRK A;  3LDQ A;  3UKR A;  2E20 A;  5GIP A;  3ZEU A;  1ZYQ A;  1Q7Y O;  3MN9 A;  4DHY A;  1SZ2 A;  1BWF O;  4F3T A;  3JAM O;  4JHD A;  4CJ5 A;  4E7H A;  1T6C A;  2W40 A;  4BDZ A;  4CGH A;  2O8B B;  5AQM A;  2PAV A;  3NF6 A;  2P9I B;  4FW1 A;  3VEN A;  2P9K A;  4OKK A;  3I0S A;  1T6D A;  2KW4 A;  3KK1 A;  3CJA A;  1WBD A;  4IOA L;  3C95 A;  1JCG A;  4KTZ A;  1KC8 O;  1U45 A;  1SKR A;  3VQD A;  1BI4 A;  2P9S A;  4BC4 A;  4IOC L;  4BVP A;  2XO7 A;  1NGG A;  2X78 A;  3DXK B;  3QNO A;  3H46 O;  3QEW A;  4CZG A;  3C6H A;  2ZD1 A;  1GOA A;  4WFN L;  1IKY A;  3CC4 N;  4AF1 A;  4DV2 K;  1N32 K;  4IOX A;  5HL7 L;  1CXQ A;  1JL1 A;  3VN5 A;  1OH5 A;  1VQM N;  1TKZ A;  1D9F A;  3AVI A;  4J2D A;  1TVR A;  4DMN A;  4KAZ A;  2D0P A;  3SQ0 A;  4I9L A;  3QBX A;  4CD1 A;  3E9P A;  3QIO A;  3HJF A;  3FFI A;  4E7I A;  4CF1 A;  4IDK A;  3TTD A;  3ZSZ A;  4EAH D;  3QO9 A;  5AFU H;  4BRH A;  3AVA A;  2NRZ A;  5AQH A;  3N4P A;  1WSJ A;  4K8Z A;  4DV0 K;  4JI8 K;  1DLO A;  5FRM A;  4CGD A;  3A5L C;  3WUH A;  4CJR A;  5J2Q A;  4MDB A;  1WOQ A;  4M3W A;  4E1N A;  3WXJ A;  3LP0 A;  3CD6 N;  2J4R A;  1RDC A;  4FWS A;  3WEE B;  3C6T A;  4WFA L;  2FF6 A;  4KFB A;  1C0U A;  1YVU A;  1YXQ A;  1HNV A;  4I2Q A;  3HP6 A;  3D2E B;  1IV0 A;  1QQC A;  4DTJ A;  4FJH A;  4OLA A;  3H08 A;  4ISF A;  3QB0 A;  5KRS A;  4B9N A;  3U8X A;  1CLQ A;  3SV3 A;  2YKN A;  4BC5 A;  4N47 A;  3I33 A;  2KTQ A;  3SQ2 A;  4W5N A;  1WLJ A;  3G25 A;  3JS6 A;  3E66 A;  3KTQ A;  3NH1 A;  1YHQ N;  5JLF A;  2HF3 A;  1VSF A;  2A40 A;  4DS5 A;  3NGI A;  3UE5 A;  1RT3 A;  1JL2 A;  3OJU A;  3VTI A;  3O5B A;  2YHY A;  3K5L A;  4DTP A;  3CM6 A;  4CJW A;  1MDU B;  1RT6 A;  1NGD A;  5GIO A;  3ENO A;  4O5B A;  3ULD A;  5AQK A;  1KLM A;  1RDD A;  4CBX A;  5C2F A;  3T1A A;  4IWV A;  4FZX C;  2AJQ A;  4RW8 A;  4B9S A;  1BA1 A;  5JS1 A;  4IO8 A;  2DY4 A;  2E6L A;  2JWK A;  4OPA A;  3NH2 A;  1EX4 A;  4EZ9 A;  2ZE2 A;  3TAE A;  1XMQ K;  3TAG A;  1EWQ A;  4F9O A;  3JSM A;  5DM6 L;  2F7T A;  5AQN A;  1LAV A;  2GEL A;  1VQ5 N;  4HWI A;  3DLH A;  4Y1D A;  4ZHR A;  3MXJ A;  1DT9 A;  3O1W A;  2I7N A;  1C6V A;  4NYF A;  4JKB A;  1WSE A;  4DLE A;  1B9D A;  3KWG A;  3LAM A;  3K5M A;  1NOZ A;  2BH1 A;  3SAG A;  4B3R K;  1MWK A;  1UOC A;  4BGB A;  4DTU A;  4H0T B;  4BRA A;  4B9U A;  2HNY A;  3ID6 A;  4QS7 A;  4C23 A;  1A5X A;  5SZT A;  1NGE A;  5M1K A;  4J2B A;  3MK6 A;  3WNG A;  1RBU A;  3PIO L;  4LF4 K;  1VQO N;  2OCE A;  4PQU A;  3ZT1 A;  1C0F A;  1N5Y A;  2NLX A;  2FSK A;  3MX2 A;  4JKC A;  4A5A A;  1IJJ A;  4IG3 A;  3CFO A;  3M1F A;  3OYK A;  3THX A;  1YVN A;  3QEX A;  1KVC A;  2ITG A;  3DLG A;  4DR5 K;  1ATR A;  2FSJ A;  4A5B A;  4C8O A;  3MEG A;  3K59 A;  3V9X A;  1U2V B;  3KK7 A;  1IKX A;  3U9Z A;  4E7L A;  5J2M A;  4BRD A;  2VG6 A;  1KRP A;  2NRR A;  2VCP A;  2P9U B;  3SCX A;  4IZ9 A;  3HL8 A;  4FZY A;  1VQN N;  2O8E B;  1RBV A;  4FWL A;  1ASV A;  3CER A;  4NXM K;  1BIU A;  1D4X A;  3SLC A;  2YJE A;  3QEV A;  4CZE A;  3LDO A;  4CW7 B;  3FZF A;  4FPB A;  4GY2 B;  1Q9X A;  1ZBL A;  4IJA A;  3S41 A;  4MO5 A;  1L3S A;  3IS9 A;  1R59 O;  2RPI A;  1S3X A;  4OKE A;  2GWK A;  3CCV N;  5BRD A;  3BGR A;  3J7A P;  4Z0U A;  3CXC M;  1RT7 A;  4IDH A;  2KZM A;  2DFF A;  4AH9 A;  1NKE A;  3QDK A;  3CG7 A;  1T8E A;  3M8P A;  4YDU A;  3TSQ A;  4DQP A;  4FXD A;  5KTQ A;  2BUP A;  3AVF A;  3HM9 A;  3EL2 A;  2NRX A;  4KHU A;  2XY8 A;  3EO3 A;  4IFV A;  2FLO A;  4WF9 L;  2W42 A;  4LFA K;  5CHI A;  3MCA B;  3SUO A;  2OA8 A;  5AQU A;  5EOY A;  4KRE A;  1KVA A;  3ZT4 A;  1XNQ K;  3CIP A;  1HKG A;  4KH5 A;  4HUG A;  4BDY A;  4LH5 A;  4JEP A;  2PYL A;  1TAU A;  4M3T A;  4O0I A;  3TAM A;  1T7P A;  1W9H A;  4LF9 K;  3CJ1 A;  3WQU A;  4K42 A;  4FWM A;  1FKO A;  1E3M A;  4FJ7 A;  3MXM A;  3HP9 A;  3OYE A;  3Q7C A;  1TYQ B;  1UA1 A;  3CCE N;  2QW9 A;  4GV3 A;  3NVM A;  5AQZ A;  4CES A;  1OH7 A;  1TK5 A;  1I3A A;  2A3Z A;  1BGX T;  4JV5 K;  4MFB A;  3ATU A;  5AJ3 K;  2EHG A;  4C1N K;  3DLR A;  1VQK N;  1FW6 A;  5LY3 A;  1BL3 A;  5CY4 A;  3E1Y A;  4CEC A;  2E2P A;  4PKH A;  5AQW A;  1BHL A;  4JNE A;  5AQY A;  2D0A A;  4LH4 A;  3AO4 A;  4EZ6 A;  3CYM A;  5KGW A;  4DFM A;  3C65 A;  1JLE A;  1YT3 A;  1M1K O;  5DK5 A;  5AQF A;  2DTU A;  2E4L A;  3VEO A;  5FLX O;  1TL3 A;  4O44 A;  3QET A;  3SK3 A;  2G8I A;  2Z1J A;  3SYZ A;  3AO5 A;  1FK9 A;  3WNH A;  3KLE A;  5JLH A;  3K5O A;  4DKW A;  4FZZ A;  4DV5 K;  2P1J A;  4LSN A;  4DQQ A;  2Q36 A;  4CF0 A;  4QS8 A;  4JKF A;  3BEX A;  1ASW A;  5M1N A;  4DUY K;  4DTM A;  2Z1G A;  2UU9 K;  3GBT A;  4FOI A;  3AO1 A;  3DLB A;  4JKG B;  2YNH A;  3ITH A;  3O6W A;  2NRT A;  3I0R A;  3LP2 A;  2QWL A;  4FO0 A;  3EYZ A;  1GLL O;  2BE2 A;  1NMD A;  1OH6 A;  3ULE A;  4FJM A;  2B6A A;  1DTT A;  1RT1 A;  3TI0 A;  4W5O A;  1HLU A;  1VRU A;  4M63 C;  1GOC A;  3ZSO A;  1HMV A;  4Z4F A;  1WN7 A;  2V51 B;  2VGN A;  1TAQ A;  1NK9 A;  3KWI A;  4RW7 A;  1NWK A;  4K41 A;  4H5R A;  4CI6 A;  1K8K A;  3IFR A;  4N5S A;  3TWH A;  5LJW A;  5EY4 A;  4KH6 A;  3WNE A;  3QIC A;  4CZM A;  4ID1 A;  3CCR N;  2D0O A;  5E41 A;  1VSJ A;  2EX3 A;  3VEZ A;  4FVM A;  4EHT A;  2O8C B;  4Y0W A;  1RBS A;  5K14 A;  1NGB A;  3L3V A;  4CFC A;  3LAN A;  2UXB K;  4QCL A;  1SS6 A;  2YJF A;  4FLW A;  3SNN A;  2P5O A;  3TAR A;  5JS2 A;  4JI6 K;  3QML A;  2ZWH A;  4YOW A;  4CIE A;  1SQK A;  5F0X A;  3NF9 A;  4O55 A;  2NNW A;  4JKD A;  3VTH A;  3EY1 A;  4ID5 A;  5KI6 A;  4DTR A;  3NAE A;  1X9S A;  2HHT A;  1IO2 A;  3P83 D;  4KB0 A;  2HHQ A;  2KFZ A;  3FZL A;  5HLF A;  4XEI A;  1NJZ A;  2DPN A;  4PWD A;  3NFA A;  3VQA A;  2G8U A;  1QSY A;  4WFB L;  1EWR A;  3LDS A;  2R7Y A;  3M5R A;  2KLA A;  3ZET A;  2WC9 A;  3DXM B;  3THV A;  4FJI A;  1HYZ A;  4E7J A;  2WON A;  3CM5 A;  4N76 A;  1C0M A;  2QWO A;  1KD1 O;  1M90 O;  4H5N A;  4CK3 A;  3L2W A;  2WTU A;  3VET A;  4LFC K;  1ASU A;  5M1P A;  3K2P A;  4RG8 A;  3O9T A;  3FE1 A;  3DWL A;  2D1K A;  3T3F A;  2NUB A;  1ZBI A;  1X9J A;  3AA5 X;  1NLV A;  3WXL A;  4CEF A;  3OYC A;  3HVR A;  3W3D A;  1J54 A;  4FOE A;  1K9M O;  1RTD A;  4FJL A;  4FK4 A;  3RWU A;  3MN5 A;  3H1V X;  5GAG P;  2P9L A;  2VGM A;  3A8Y A;  4CJT A;  4DSE A;  5M1Q A;  1JXB A;  2E2N A;  2VG7 A;  4G1Q A;  3SMP A;  4IEI A;  4RCH A;  5A2Q O;  1BG3 A;  3VOV A;  2XHB A;  3AVL A;  3S3M A;  1XQS C;  3T1Y K;  4AM6 A;  1RFQ A;  4GNI A;  2HBL A;  2HBK A;  1BIS A;  2OPP A;  1HR0 K;  2IOC A;  3ZSR A;  2JWL A;  3BY5 A;  4FWN A;  1JJ2 M;  4JK9 A;  3EE9 A;  5CZ1 A;  3THY B;  1NGH A;  3I8D A;  4ISG A;  4OVL A;  2YHX A;  2UUA K;  4ISE A;  5BN9 A;  1K73 O;  1KFD A;  4X66 K;  4CF9 A;  4GV6 A;  2HOE A;  3O3F A;  1TK0 A;  4HVJ A;  4RW9 A;  4Z4E A;  4JI4 K;  5EX5 A;  2E1Y A;  3SPZ A;  3RSE A;  5GAE P;  3CJB A;  5HRS A;  1JXE A;  4CER A;  4R79 A;  1VSD A;  1YTA A;  2YV0 X;  4ELT A;  3NVK A;  1HNX K;  1EKE A;  1NMN A;  4B1W B;  1KXP A;  2QKK A;  2ZJP L;  4GKK K;  4WQ4 C;  5LJV A;  2ATQ A;  1Q18 A;  1WAF A;  2IVP A;  3LP1 A;  4CEQ A;  3AVJ A;  5JMV A;  5AZI A;  2ETJ A;  2QEX N;  4C8N A;  4JKH A;  4OPJ A;  2Q97 A;  1YF5 L;  2B5J A;  2P51 A;  4GW6 A;  4BC3 A;  1Y97 A;  4JS5 A;  1NKC A;  1MA9 B;  1IG8 A;  1I94 K;  3IRX A;  3CHW A;  3TTC A;  4BC2 A;  4OLB A;  3C7N B;  2CH6 A;  4HUF A;  3FLC O;  4X65 K;  2HVI A;  2NRV A;  2PY5 A;  1LW2 A;  4H5V A;  5AQL A;  3LDL A;  5CYM A;  4YOT A;  1CXU A;  1NOY A;  4IKF A;  2QXF A;  5AQP A;  3BP8 A;  3HBT A;  4DFK A;  3KIO A;  2PBD A;  3UKR B;  3DXK A;  3ZEU B;  5HRN A;  3CJ7 A;  2P9P A;  4FLY A;  3MN7 A;  2ZJQ L;  1EP4 A;  3QFP A;  3ATV A;  1GLE G;  4BR2 A;  1DKG D;  1G99 A;  1N36 K;  2P9K B;  1HYV A;  1I39 A;  2F4V K;  3FZK A;  1WBB A;  3SI6 A;  3QIP A;  1U48 A;  2Q1N A;  4BRL A;  2OYQ A;  1QQM A;  4DQR A;  1HPM A;  5DMR A;  4FJ9 A;  1BI4 B;  2P9S B;  1C1B A;  4XH4 A;  3OS1 A;  3DMJ A;  2IGI A;  1B9F A;  2HB5 A;  3S9H A;  2O8F A;  2FXU A;  4N56 A;  4E0D A;  5J1E A;  4NB4 A;  4OPH A;  3HSC A;  4CEA A;  2W41 A;  4B3M K;  1TL1 A;  3WQT A;  2QWR A;  4DV1 K;  4YY3 K;  4CJU A;  4NLC A;  3B8A X;  4DB3 A;  1JLQ A;  5BRH A;  2Q31 A;  4PA1 A;  3R6M A;  1VSL A;  4WQ5 A;  2RHK A;  4WYB A;  1BCM A;  4E1J A;  3VEX A;  4W5R A;  4NLB A;  3PUF A;  4NCA A;  3L6Q A;  1O13 A;  4KHW A;  5AZJ A;  1NJY A;  1U47 A;  3K9K A;  1S9E A;  3F5T A;  4F3O A;  1XHZ A;  3G4S N;  1HJR A;  3NE6 A;  4CEE A;  4YNQ A;  4JI1 K;  1SAZ A;  3Q7B A;  4FWK A;  5BRE A;  3AV9 A;  3AA2 A;  5C0Y A;  3P5J A;  1DGK N;  3MEC A;  1SV5 A;  3LPT A;  4A2A A;  4CJP A;  3V1R A;  4CEB A;  4JK7 A;  3CCL N;  3ZLJ A;  1ILY A;  1RTI A;  5C25 A;  4CZF A;  4B8C A;  3TAN A;  1VQ8 N;  1BUP A;  4FCY A;  2HMI A;  3M3Z A;  4KHQ A;  4B9M A;  1YJW N;  3SV4 A;  4AIL C;  1BU6 O;  3WXK A;  4JAX A;  3SUN A;  4CZI A;  5FPD A;  1X9M A;  1S9G A;  4PL8 A;  3EE8 A;  4CBU A;  4BR9 A;  1MU2 A;  1Z26 A;  1Z25 A;  3EZ5 A;  4CZL A;  5EU7 A;  2GBZ A;  3FGU A;  1VQ6 N;  4G9Z A;  2YI1 A;  1GLA G;  3F9M A;  5EVZ A;  5T7B A;  3PIP L;  4DV6 K;  1NGC A;  1QSL A;  4YFU A;  4W5T A;  3OYB A;  3K58 A;  1ZBH A;  2NRH A;  1EQY A;  5CYQ A;  2LSN A;  2O8D A;  4DR2 K;  3BDP A;  1JCF A;  3C0B A;  4FWR A;  1V4S A;  2HVH A;  1QVG M;  4Z4H A;  4K0K K;  4BR0 A;  3ZCM A;  5HP1 A;  3L2R A;  3SUQ A;  1GLF O;  4LC9 B;  1JLF A;  4DR3 K;  1XI1 A;  2XY6 A;  4CZK A;  5M1O A;  3PX4 A;  4YOV A;  4KHY A;  5BN8 A;  3VES A;  2E88 A;  3WNF A;  1NK7 A;  4FK2 A;  1KAX A;  1XC3 A;  3ENB A;  1RBR A;  3I8B A;  2GV9 A;  4FLV A;  1WSH A;  4O4G A;  4B9V A;  3DI6 A;  4L3Q A;  4JK8 A;  3CPW M;  2Y1I A;  1WNS A;  4F2S A;  2A5X A;  3HPG A;  3L2U A;  5AQT A;  1KLN A;  4H0P A;  3QNN A;  1BA0 A;  4FLU A;  1KFS A;  4MDA A;  1U49 A;  4CJS A;  1BDG A;  3F73 A;  3OYN A;  2Z1H A;  3OVN A;  1UWB A;  4KBO A;  1WB9 A;  4XH1 A;  1WAJ A;  5HRR A;  1D8Y A;  2FF3 B;  1U2V A;  4KB1 A;  4BRN A;  4O0J A;  3I56 N;  4K8X A;  3AVM A;  4CF2 A;  3ZSY A;  4W5Q A;  3AAR A;  2HMP A;  4AHC A;  2KHO A;  3P1G A;  4DG1 A;  2O8E A;  4CFD A;  4DLG A;  4BRP A;  3A5M C;  2CGL A;  3RVC A;  3VER A;  3SAF A;  2FC0 A;  1WSG A;  4LD0 A;  5C15 A;  3THX B;  2VQE K;  1VQ7 N;  3DLK A;  1C1A A;  3F9K A;  3TU5 A;  4B1V A;  1HKB A;  2F9W A;  2VYP A;  1S72 N;  4OX9 K;  1RNH A;  4H5T A;  1H1V A;  4FK0 A;  4MLE A;  4A61 A;  4DF4 A;  3PO5 A;  2HBJ A;  3D2F A;  4J2A A;  3J81 O;  4K43 A;  1RDU A;  3RMC A;  3VQ5 A;  4V19 S;  2E5L K;  2KFN A;  1ZBU A;  4LY7 A;  1J9A A;  2A6A A;  1HRH A;  4DWI A;  3SMS A;  5BRF A;  2HHS A;  2E2O A;  3AA3 A;  4LFB K;  2CH5 A;  4C8M A;  3TPQ A;  1NU0 A;  3SPY A;  3HM8 A;  1XC9 A;  2E2Q A;  1VK0 A;  2A42 A;  3T7Z A;  1TUU A;  4DTN A;  1YAG A;  2XRI A;  5LMN K;  4ICL A;  1N8R O;  4NO7 A;  3EKU A;  1YIJ N;  4RW4 A;  4BRM A;  3R8E A;  4FM1 A;  3VF6 A;  3IAY A;  2WFB A;  4OGC A;  3MWT A;  4DSJ A;  3G0Z A;  3MMV A;  1W97 L;  4R5P A;  4CBW A;  4JN4 A;  3GOI A;  3RMA A;  3RR8 A;  1WSI A;  3O1B A;  2QI2 A;  3AO3 A;  1NKB A;  1EO1 A;  2D0C A;  1RDB A;  3DLL L;  4BAC A;  1IH7 A;  5GAD P;  4Q5V A;  3KD1 E;  2IVO A;  4DF8 A;  1N6Q A;  4DTO A;  1NK8 A;  5CZ2 A;  4AM7 A;  4BE0 A;  3AAQ A;  3BUZ B;  1NGF A;  4M7X A;  1RT2 A;  4I6M A;  3VF2 A;  3IMX A;  3DM2 A;  3CCS N;  3EEQ A;  3ZT3 A;  2V7Y A;  1XNR K;  3TAP A;  1F21 A;  2P9N A;  4JRQ A;  3AVB A;  3AA4 A;  1BCO A;  1S1V A;  3HI0 A;  4U67 L;  3J80 O;  4CVN E;  4Z94 A;  1IKW A;  1HNW K;  4HHT A;  5E26 A;  5AQQ A;  2O4G A;  3L3U A;  2G8V A;  3O9U A;  4DU1 A;  4E89 A;  5B8H A;  4NYN A;  1T44 A;  2F9T A;  1BO5 O;  3CFR A;  4CGG A;  3G10 A;  4B1U B;  1T05 A;  3HTV A;  2YCH A;  3NGZ A;  5JVG L;  2KZZ A;  4IFY A;  4JKE A;  4E1M A;  4FLZ A;  3VQ8 A;  1RGI A;  2YHW A;  3H45 C;  4O8K A;  4C1N I;  1JLA A;  4TSX A;  3H3O B;  1IKV A;  3OBY A;  5AQV A;  1VRT A;  3ZT0 A; 
#chains in the Genus database with same CATH homology
 1SKS A;  2OPP A;  4E1N A;  3OS2 A;  2IOC A;  3LP0 A;  3ZSR A;  3DRR A;  2RKI A;  1RDC A;  5CZ1 A;  3UIQ A;  3C6T A;  3QLH A;  3QES A;  3I8D A;  3TAF A;  4KRF A;  4WE1 A;  4KFB A;  1C0U A;  1LAW A;  1LWC A;  1YVU A;  2BAN A;  3DRP A;  4OVL A;  1NK6 A;  2G8K A;  2E6M A;  3ALY A;  1HNV A;  4I2Q A;  3HP6 A;  1QQC A;  1L5U A;  4OJR A;  2BDP A;  4HCC A;  4AHS A;  1HNI A;  3CQ8 A;  4DTJ A;  2BGG A;  1JLB A;  2QK9 A;  4FJH A;  3V9U A;  4OLA A;  1QS4 A;  1KFD A;  4AHR A;  3H08 A;  3KD5 E;  3V9Z A;  4CF9 A;  3LAK A;  3O3F A;  1TK0 A;  4HVJ A;  4F8R A;  2O4I A;  5KRS A;  4RW9 A;  4GMJ B;  3MEE A;  3O3H A;  4B9N A;  4FJG A;  1CLQ A;  3SV3 A;  2YKN A;  4NCB A;  4M3W A;  3VQ6 A;  4BDP A;  3HPH A;  4N47 A;  3U3Y A;  1S1X A;  4DSL A;  2VWK A;  4Z4I A;  4Z4E A;  1RTH A;  4N41 A;  5HBM A;  3SPZ A;  2JGU A;  2HHX A;  3OJS A;  2RN2 A;  2KTQ A;  2B4J A;  5HRS A;  3SQ2 A;  3C94 A;  1JXE A;  4CER A;  1WLJ A;  4W5N A;  1S5J A;  4EP4 A;  4B9T A;  1VSD A;  1YTA A;  2YV0 X;  4ELT A;  1EKE A;  3KTQ A;  1C0T A;  2IAJ A;  3NH1 A;  2QKK A;  1VSF A;  2F96 A;  4CJL A;  1D5A A;  3V9S A;  4DS5 A;  3NGI A;  3O3G A;  3M8S A;  1RT3 A;  1JL2 A;  2ATQ A;  3OJU A;  3HXM A;  3ZT2 A;  1WAF A;  2YHB A;  1K6Y A;  1TV6 A;  3LP1 A;  3K5L A;  4AHU A;  2OPS A;  3CM6 A;  3ZSV A;  4CEQ A;  3AVJ A;  1RT6 A;  4CJW A;  4DTP A;  4FJ8 A;  2ETJ A;  4O5B A;  3ULD A;  1KLM A;  2OZM A;  1RDD A;  3AO2 A;  4C8N A;  1NK4 A;  4I9Q A;  4KHU A;  2F8S A;  4PY5 A;  4OPJ A;  1T03 A;  4M45 A;  3T1A A;  4RW6 A;  4CE9 A;  5C24 A;  2Z1I A;  3LWM A;  4FZX C;  2AJQ A;  1TK8 A;  2P51 A;  2B5J A;  4GW6 A;  4L8R B;  4RW8 A;  3E01 A;  3VQ9 A;  4B9S A;  4ELU A;  3KK2 A;  1Y97 A;  4JS5 A;  4FJ5 A;  1NKC A;  4JS4 A;  4FM0 A;  4NCG A;  4KI6 A;  4CGI A;  5JS1 A;  3IRX A;  2E6L A;  5FRO A;  1SL0 A;  4Z4G A;  2DY4 A;  1U04 A;  3NH2 A;  4M3Z A;  4OLB A;  1EX4 A;  4EZ9 A;  4HUF A;  2ZE2 A;  3TAE A;  2HVI A;  4M3R A;  4JLH A;  3TAG A;  3NF8 A;  3JSM A;  2PY5 A;  1LW2 A;  3A2F A;  1VSE A;  3RR7 A;  1LAV A;  3ZSQ A;  2PZS A;  5CYM A;  1EXQ A;  3C6U A;  4FLX A;  1CXU A;  1NOY A;  3OYJ A;  3DLH A;  4Y1D A;  4ZHR A;  3MXJ A;  2FBY A;  4QAG A;  4IKF A;  2QXF A;  4CFB A;  4DFK A;  3KIO A;  4AHT A;  4FJK A;  3SZ2 A;  1TKD A;  4CIF A;  1C6V A;  4NYF A;  1RIL A;  1S6Q A;  1WSE A;  4DLE A;  5HRN A;  1B9D A;  3M8R A;  1VSH A;  2D5R A;  3LAM A;  3K5M A;  1NOZ A;  1B92 A;  1X1P A;  4FLY A;  1UOC A;  3DOK A;  1EP4 A;  4DTU A;  4KO0 A;  4B9U A;  2HNY A;  1S1T A;  1HYV A;  1XWL A;  3DOL A;  1I39 A;  3B6O A;  3K5N A;  3SQ1 A;  3SI6 A;  3QIP A;  1A5X A;  5SZT A;  3TAQ A;  1U48 A;  1TKT A;  4J2B A;  2OYQ A;  3B6P A;  4CGJ A;  3WNG A;  1RBU A;  3MED A;  4CGF A;  4CHZ A;  3L8B A;  4DQR A;  3L2Q A;  4KPY A;  3KJV A;  5DMR A;  4FJ9 A;  4BE1 A;  1Q9Y A;  1BI4 B;  1RDA A;  1C1B A;  4FW2 A;  4PQU A;  3ZT1 A;  4CIG A;  1N5Y A;  3OS1 A;  4HCB A;  3DMJ A;  2IGI A;  1B9F A;  2HB5 A;  2VWJ A;  3S9H A;  3NBP A;  1QHT A;  4IG3 A;  3CFO A;  4N56 A;  3OYK A;  4E0D A;  5J1E A;  3QEX A;  1KVC A;  2ITG A;  1RT5 A;  3DLG A;  4CEA A;  2VG5 A;  2YKM A;  1LWF A;  2HHV A;  1TL1 A;  2YNF A;  3D45 A;  3MEG A;  3K59 A;  3V9X A;  4CJU A;  1UA0 A;  4C8O A;  3NH0 A;  3PX6 A;  1JLQ A;  3QEI A;  4PA1 A;  1L3T A;  3AVC A;  1SL1 A;  1VSL A;  1IKX A;  1BCM A;  4QOZ B;  3VA3 A;  4W5R A;  3KK3 A;  4UQG A;  2XY5 A;  4E7L A;  3V1Q A;  4HTU A;  1CZB A;  3PUF A;  4CK1 A;  5J2M A;  4NCA A;  2VG6 A;  4C8L A;  4CJ4 A;  4GVM A;  1KRP A;  1ZBF A;  4KHW A;  1NJY A;  3AVN A;  3SCX A;  1U47 A;  3HL8 A;  1S9E A;  4FZY A;  3RMD A;  4FM2 A;  1RBV A;  1HJR A;  3NE6 A;  4CEE A;  1XHZ A;  4F3O A;  1ASV A;  1UAX A;  1QSS A;  1FKP A;  4YNQ A;  1BIU A;  5HRP A;  5J2N A;  3LZJ A;  1KCF A;  4CEZ A;  3HST B;  1VSI A;  1YTU A;  3AV9 A;  3AA2 A;  1FXX A;  2YHA A;  2IDO A;  3S3O A;  3P5J A;  2FBT A;  1WSF A;  4DSK A;  3MEC A;  1SV5 A;  3LPT A;  3QEV A;  1QE1 A;  4CJE A;  1A5W A;  3V1R A;  4CEB A;  4CJP A;  4FLT A;  3MXI A;  4XIU A;  3KLI A;  3QEP A;  4F4K A;  1W0H A;  3T19 A;  4E3S A;  1RTI A;  4F2R A;  4CJQ A;  3OYH A;  1Q9X A;  4BWJ A;  5C25 A;  1ZBL A;  4BWM A;  1L3S A;  4B8C A;  3IS9 A;  2RPI A;  4OKE A;  3TAN A;  2G8F A;  3V6D A;  4FCY A;  3RMB A;  3TR8 A;  3U6F A;  3BGR A;  1BIZ A;  3M8Q A;  4M3Y A;  2HMI A;  4CHP A;  4CFA A;  1EET A;  1JLC A;  3HPO A;  4Z0U A;  5FRN A;  3S3N A;  2ZQB A;  4KHQ A;  4B9M A;  1RT7 A;  2KZM A;  2D0B A;  3SV4 A;  4AIL C;  4M3X A;  4OPK A;  4KTQ A;  2DFH A;  2DFF A;  4AH9 A;  3SUN A;  3VA0 A;  3LZI A;  1NKE A;  1X9M A;  1S9G A;  4H4O A;  3CG7 A;  1T8E A;  3M8P A;  2QKB A;  1L3V A;  4DQP A;  4FXD A;  1HYS A;  5KTQ A;  4H8K A;  3AVF A;  4ZTJ A;  3HM9 A;  1Z26 A;  1MU2 A;  2HND A;  2XY8 A;  1RTJ A;  1Z25 A;  4IBN A;  4OKJ A;  3EZ5 A;  1BIS A;  2GBZ A;  4IFV A;  5EU7 A;  3HK2 A;  2W42 A;  1KSP A;  4M42 A;  3SUO A;  2OA8 A;  2X74 A;  3QER A;  5T7B A;  1QSL A;  4YFU A;  4W5T A;  3OYB A;  4ELV A;  3K58 A;  4CHQ A;  1ZBH A;  1GOB A;  4KI4 A;  1KVA A;  4KRE A;  3ZT4 A;  5CYQ A;  2LSN A;  4HUE A;  1VSM A;  3BDP A;  1ITG A;  4CCH A;  4M3U A;  3VQB A;  4AHV A;  1J5O A;  4HUG A;  1SKW A;  2HVH A;  3SQ4 A;  1TKX A;  4BDY A;  4LH5 A;  3MAQ A;  2PYL A;  4Z4H A;  1BQN A;  2IC3 A;  4CEO A;  1TAU A;  3LPU A;  3ZCM A;  5HP1 A;  4O0I A;  4M3T A;  4CED A;  3TAM A;  3L2R A;  3K57 A;  1W9H A;  3SUQ A;  1T7P A;  1JLF A;  3PV8 A;  3VQP A;  4DFP A;  1XI1 A;  3KLH A;  4CJK A;  3OYD A;  4DS4 A;  1FKO A;  1LV5 A;  3RRG A;  1C1C A;  4FJ7 A;  3MXM A;  2XY6 A;  3HP9 A;  3OYE A;  1UA1 A;  5I42 A;  1S6P A;  3PX4 A;  3U3G A;  5HRO A;  4ZTF A;  4KHY A;  3KKR A;  4CES A;  1TK5 A;  1I3A A;  3WNF A;  1BGX T;  1NK7 A;  3OY9 A;  4FK2 A;  4I7F A;  1S1W A;  4CJV A;  3TAB A;  4MFB A;  2X6N A;  1RBR A;  2GV9 A;  2EHG A;  4FLV A;  4IG0 A;  1HQE A;  3DLR A;  1WSH A;  4O4G A;  4B9V A;  4E7K A;  2A1S A;  5KRT A;  1BL3 A;  5CY4 A;  4M41 A;  3QIN A;  3AVG A;  3DI6 A;  4DQI A;  4CEC A;  2IS3 A;  1BHL A;  2Y1I A;  1L3U A;  2F8T A;  2D0A A;  4LH4 A;  1WNS A;  3AO4 A;  3KLG A;  4DFJ A;  4Z4C A;  3ZSW A;  2OZS A;  3CYM A;  4EZ6 A;  4F2S A;  3OYA A;  4DU4 A;  3NGY A;  5KGW A;  1NK0 A;  1S1U A;  2YNI A;  4DFM A;  1JLE A;  3HPG A;  1YT3 A;  3L2U A;  1KLN A;  1VSK A;  3QNN A;  5DK5 A;  4FLU A;  2G8H A;  3AVH A;  5C42 A;  4KHN A;  1REV A;  3CFP A;  4Q0B A;  2DTU A;  1KFS A;  2E4L A;  2Q3S A;  1U49 A;  4CJS A;  1TL3 A;  3KKS A;  4O44 A;  1LWE A;  3OYN A;  3F73 A;  2Z1H A;  3OVN A;  1JLG A;  1UWB A;  3QET A;  1BQM A;  4MQ3 A;  2G8I A;  2Z1J A;  1NJX A;  1WAJ A;  3AO5 A;  3SYZ A;  4C8K A;  1FK9 A;  5HRR A;  3WNH A;  3KLE A;  1D8Y A;  3K5O A;  4KB1 A;  4FZZ A;  4O0J A;  4K8X A;  3AVM A;  4CJF A;  4JRP A;  2P1J A;  4CF2 A;  4LSN A;  4DQQ A;  2HHU A;  1A5V A;  4KTW A;  3ZSY A;  4CF0 A;  4W5Q A;  2I5J A;  1CZ9 A;  3ZSX A;  4AHC A;  4B3O A;  3NF7 A;  3SUP A;  3P1G A;  1RCH A;  4DG1 A;  4CFD A;  1ASW A;  4DLG A;  2OPR A;  4DTM A;  2Z1G A;  3AO1 A;  3DLB A;  2FC0 A;  4Y1C A;  2A1R A;  1WSG A;  4CHO A;  4LD0 A;  1O1W A;  3DLE A;  3V81 A;  3DLK A;  2YNH A;  3ITH A;  1C1A A;  3F9K A;  4B8A B;  3NCI A;  3PX0 A;  3I0R A;  2HNZ A;  2KQ2 A;  3AVK A;  3LP2 A;  4DQS A;  3EYZ A;  2BE2 A;  4EP5 A;  1U4B A;  3NHG A;  4FJM A;  2B6A A;  5D3G A;  1DTT A;  1RNH A;  1RT1 A;  4DU3 A;  4W5O A;  3TI0 A;  4FK0 A;  1NK5 A;  3HT3 A;  4DF4 A;  3PY8 A;  3PO5 A;  1VRU A;  4DSI A;  1Q8I A;  2HW3 A;  1RBT A;  1GOC A;  3ZSO A;  1HMV A;  4Z4F A;  2YNG A;  4J2A A;  3VQE A;  3OYF A;  4BE2 A;  1WN7 A;  4B08 A;  4KHS A;  2XY7 A;  3RMC A;  3VQ5 A;  1TAQ A;  1NK9 A;  2KFN A;  1ZBU A;  2JLE A;  4LY7 A;  1J9A A;  4FJX A;  4RW7 A;  4DTX A;  1HQU A;  1HRH A;  4DWI A;  4N5S A;  3D0P A;  2HHS A;  3L2V A;  3TWH A;  3O4Q A;  1RT4 A;  4OGE A;  3V4I A;  3WNE A;  4ID1 A;  3KLF A;  3RTV A;  3AA3 A;  1SL2 A;  5E41 A;  4KKO A;  1VSJ A;  4C8M A;  3RRH A;  2EX3 A;  1XHX A;  3SPY A;  4FVM A;  1XC9 A;  1RBS A;  1VK0 A;  3DRS A;  5K14 A;  1D9D A;  3L3V A;  3DYA A;  4DTN A;  4CFC A;  3LAN A;  4DTS A;  4J2E A;  2XRI A;  5I3U A;  4QCL A;  3NDK A;  4E89 A;  4ICL A;  4E19 A;  4FLW A;  3SNN A;  3VQC A;  2P5O A;  3TAR A;  5JS2 A;  4CHN A;  4RW4 A;  5J2Q A;  2WOM A;  2P5G A;  5J2P A;  4FM1 A;  3PO4 A;  3V9W A;  3IAY A;  1TGO A;  4CIE A;  4OGC A;  4CHY A;  4FYD A;  3ASM A;  1JKH A;  4DSJ A;  3NF9 A;  4B9L A;  1G15 A;  1KTQ A;  3HYF A;  4O55 A;  3EY1 A;  2OPQ A;  5KGX A;  3G0Z A;  4ID5 A;  3OYG A;  2Y1J A;  1NJW A;  5KI6 A;  4R5P A;  4DTR A;  2FBV A;  3OYL A;  3NAE A;  2G8W A;  4FJJ A;  3OYI A;  1X9S A;  1X9W A;  2HHT A;  1IO2 A;  3RMA A;  1WSI A;  3P83 D;  3OYM A;  3RR8 A;  4KB0 A;  2HHQ A;  2KFZ A;  4FJN A;  2GUI A;  5HLF A;  4PUO A;  1ZYQ A;  3LP3 A;  3AO3 A;  1NJZ A;  3OS0 A;  1NKB A;  2D0C A;  1RDB A;  4BAC A;  4DSF A;  4F3T A;  1IH7 A;  4PWD A;  3NFA A;  3VQA A;  4CJ5 A;  3IG1 A;  4Q5V A;  4E7H A;  2G8U A;  1QSY A;  3KD1 E;  4BDZ A;  4KV8 A;  4CGH A;  4DF8 A;  3LDS A;  3HVT A;  4FW1 A;  3NF6 A;  4DTO A;  2R7Y A;  1N6Q A;  2DFE A;  4OKK A;  1NK8 A;  5CZ2 A;  4BE0 A;  3ISN C;  3I0S A;  1RT2 A;  3THV A;  4FJI A;  2KW4 A;  3VQ4 A;  1HYZ A;  4E7J A;  3DM2 A;  4CK2 A;  3KK1 A;  2WON A;  3CM5 A;  3ZT3 A;  1QTM A;  1C0M A;  4N76 A;  3C95 A;  4KTZ A;  3TAP A;  1U45 A;  1SUQ A;  3VQD A;  1SKR A;  1F21 A;  1BI4 A;  4CK3 A;  3L2W A;  2XO7 A;  4JRQ A;  3AVB A;  3AA4 A;  1BCO A;  2PYJ A;  1S1V A;  2X78 A;  3QNO A;  2X6S A;  1ASU A;  3HO1 A;  3K2P A;  3QEW A;  4RG8 A;  2ZD1 A;  1IKW A;  1HPZ A;  2RF2 A;  1GOA A;  3V1O A;  1IKY A;  3T3F A;  3VQ7 A;  3VQQ A;  4HHT A;  2NUB A;  1ZBI A;  2O4G A;  3AA5 X;  3L3U A;  1IG9 A;  2G8V A;  4DU1 A;  1CXQ A;  1JL1 A;  3LAL A;  3VN5 A;  4CEF A;  1TKZ A;  2FBX A;  4NYN A;  3AVI A;  3O4N A;  3OYC A;  3HVR A;  1D9F A;  4J2D A;  2HHW A;  1TVR A;  4DMN A;  1J54 A;  4CGG A;  3CFR A;  4KAZ A;  3LWL A;  3SQ0 A;  4I9L A;  1RTD A;  4FJL A;  3SJJ A;  1DTQ A;  4FK4 A;  3RWU A;  4CF8 A;  3G10 A;  3QIO A;  3HJF A;  1T05 A;  5SWM A;  3FFI A;  4E7I A;  4CF1 A;  4IDK A;  4CJT A;  4DSE A;  1R0A A;  1JXB A;  1KVB A;  3NGZ A;  3ZSZ A;  5FDL A;  3QO9 A;  3AVA A;  4CJ3 A;  2KZZ A;  2VG7 A;  4G1Q A;  4IFY A;  1J53 A;  1WSJ A;  4LSL A;  4K8Z A;  4E1M A;  2XHB A;  1DLO A;  5FRM A;  3AVL A;  4I2P A;  4CGD A;  3VQ8 A;  4FLZ A;  3S3M A;  1JLA A;  4H4M A;  4TSX A;  4CJR A;  1IKV A;  3JYT A;  1LW0 A;  1VRT A;  3ZT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...