1CXUA

1.42a resolution asv integrase core domain from citrate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
143
structure length
143
Chain Sequence
b'GPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (AVIAN SARCOMA VIRUS INTEGRASE)
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Transferase
total genus 54
structure length 143
sequence length 143
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1cxuA00
3DRPA 3IRXA 3HM9A 1U49A 1X9SA 1VSKA 3TAMA 4OLBA 1RTHA 5HP1A 4CJUA 4UQGA 4J2DA 1EXQA 4LY7A 4M3XA 2EHGA 3F9KA 1BHLA 1KVBA 4H4OA 4CK2A 2YNGA 2VWJA 4FLUA 4NCBA 4CHOA 3RMDA 3VN5A 4CEDA 1NJWA 4Z0UA 4CEOA 1VSJA 3OS0A 3U3YA 4N76A 2XY6A 4E3SA 3CYMA 3NGYA 1NJYA 1KCFA 4F8RA 4CHPA 1NK4A 1RT5A 3IAYA 5CYQA 2FBXA 1LAWA 3ZSYA 4OJRA 3OYHA 1D9DA 5J2MA 1VRTA 1C1AA 4AHRA 3ZSQA 1IKXA 1IO2A 1FXXA 2WOMA 2XY8A 3TANA 2VG7A 1L3VA 3PY8A 1S6PA 4CJRA 1JLEA 4ELVA 1YVUA 1WSGA 3CFPA 1W0HA 3LDSA 4ELUA 2FBVA 3OS2A 1KVAA 3QO9A 4GMJB 3G10A 5K14A 1TKXA 4EZ6A 1BCMA 4FJHA 3HSTB 1HQEA 1QE1A 3V1OA 1RT7A 4E7LA 5I42A 4B9UA 3AVHA 4LD0A 2VWKA 3JSMA 1LAVA 4DTJA 2RPIA 2RN2A 4DS4A 5DK5A 2VG5A 4Z4GA 1QHTA 4FJXA 5SZTA 4CIGA 1B9DA 3OJSA 3QEWA 4CEFA 3V4IA 1WSEA 2Z1IA 3HVTA 3OYNA 3K58A 2G8HA 1TL3A 1S1WA 4NYFA 3AVMA 1RBVA 4KI4A 4M3ZA 4CECA 3AO2A 1SL1A 3L2WA 2Z1GA 3SYZA 3QETA 2BE2A 5CY4A 4CGDA 3AVGA 3HVRA 1RTJA 4F3OA 1MU2A 1DTQA 1HNVA 3HPHA 5CYMA 2D5RA 4B9TA 2AJQA 4FLWA 3AA3A 3KLGA 3IG1A 1JLGA 4DFJA 1RDCA 4FJMA 3LP1A 4CJTA 2XY5A 2YNFA 4AHUA 1J53A 3OYEA 3TARA 3DLEA 2HHWA 1EETA 2OPRA 4AHCA 3PX6A 1ITGA 1I39A 3SQ4A 1L3UA 1S1XA 4CEQA 3PO4A 3AV9A 4FVMA 1JXEA 4IFYA 3OYGA 4DMNA 4C8NA 2HVIA 3TWHA 1IKWA 1JKHA 1RNHA 3DLHA 1RILA 1VSIA 2Z1HA 2BGGA 1JLAA 1RDDA 2DFFA 2IDOA 2GV9A 3NH1A 4DSIA 5KI6A 2HHXA 3PUFA 4XIUA 2LSNA 4KHSA 3DLKA 4E7IA 2Y1JA 4M45A 4JLHA 4H4MA 1RDAA 1N5YA 3U3GA 3OYKA 4KHUA 1RBSA 1W9HA 2F8TA 3O3FA 1VSDA 4PQUA 2DFHA 3NFAA 4M3RA 3P83D 4WE1A 2ZQBA 3HJFA 2YKMA 3EYZA 4DLGA 1F21A 3NAEA 3U6FA 1ZBHA 4KV8A 4CK3A 3IS9A 3DYAA 3DRSA 1ASUA 3JYTA 1NK8A 1TKDA 4OGCA 3AVKA 1C0MA 1EX4A 2IOCA 1IH7A 5C25A 2JLEA 3KLIA 1IKYA 3ZT4A 3V1QA 5JS2A 2DY4A 3DMJA 4DQRA 4CJVA 4DFMA 4CJ4A 3NF7A 4Z4IA 2D0BA 3NHGA 4DQQA 1ZBIA 4Q0BA 4ZTJA 4FJ9A 3M8PA 4B08A 4HUGA 1WNSA 1JLCA 2HNYA 5HRPA 3VQPA 4F4KA 4DS5A 3NH2A 4CERA 1CXUA 3MAQA 3LAKA 3L8BA 4IKFA 5CZ2A 5J1EA 1GOBA 1RBRA 1JLQA 1HJRA 1NKBA 1L3TA 4HCBA 3RMCA 4HUFA 4I2QA 2ITGA 2NUBA 1BIZA 3QNOA 4M3WA 1S9GA 3ZCMA 4B9SA 2OPQA 4CGHA 1ASWA 3OS1A 3VQDA 3RRGA 4LH5A 4Z4EA 2W42A 4OVLA 1O1WA 4IG0A 2G8KA 2HHVA 3O4QA 3LP3A 4I2PA 4YFUA 3SCXA 1WAJA 1A5XA 1BI4A 4DFKA 3QEIA 4FYDA 3LWMA 5HROA 5KRTA 1RTDA 2HB5A 1KLNA 5FDLA 1QQCA 4MQ3A 1XC9A 4B3OA 1BCOA 4CEEA 5HRSA 3OYFA 1ASVA 2GBZA 4I9QA 3CG7A 4CJSA 1CZ9A 1TVRA 4DTXA 2PZSA 1T7PA 5FRMA 3ZT2A 1SKSA 2KTQA 4CHZA 1JL2A 3KJVA 2G8FA 2OPSA 3HP6A 1VSMA 1S6QA 1WLJA 2B4JA 1HQUA 1VSHA 4C8MA 3QINA 1T05A 2IC3A 2YV0X 1A5VA 4CFBA 2IAJA 3F73A 2OZSA 4B9LA 3KD1E 4O44A 2BANA 5C24A 3THVA 1ZBUA 2ATQA 1HYVA 2G8IA 4ZTFA 1SL2A 3NBPA 3ZSVA 1HNIA 1L3SA 4KB1A 3TR8A 1B9FA 4OPJA 1S1VA 1JLFA 3ZSWA 5HRNA 4M3UA 3LAMA 2WONA 1TAQA 4DQSA 4FXDA 3K5NA 1QSYA 1B92A 3QERA 1NKEA 4DSJA 1LWFA 2DTUA 3S3OA 3QEPA 4R5PA 2RF2A 4CGGA 1XHZA 3TAPA 1JXBA 3L3UA 4DTSA 4CGIA 4Y1CA 1KRPA 5KGXA 1HMVA 3I0RA 1TK0A 3AVNA 3OYJA 3CFRA 1X9WA 4PWDA 4ID5A 4CJQA 1HPZA 1UAXA 3DLRA 3DLGA 4KTWA 4Z4HA 1A5WA 3LZIA 4B8CA 3RMBA 1CXQA 3ALYA 4HVJA 4N5SA 3NE6A 1TK5A 3NH0A 2DFEA 2E4LA 4FJJA 4Z4CA 2G8WA 3DOLA 3SNNA 4AHSA 3P5JA 3SPYA 1NOZA 4F3TA 3ZT1A 4CHYA 4PY5A 1J9AA 4CCHA 3PX4A 1QSLA 2IGIA 3C95A 2P51A 3DRRA 4AHTA 3VQAA 4FCYA 3M8RA 3T1AA 4DQPA 3NGIA 4FJ8A 3V6DA 1XI1A 4FK4A 1S1TA 1EP4A 4I7FA 1UWBA 4DU4A 4DF8A 4HCCA 4L8RB 1C0TA 1Z25A 3VQQA 1TK8A 2D0AA 2HMIA 1BGXT 3VQ8A 4Z4FA 2IS3A 3AO1A 4RW8A 2YKNA 4FM2A 1QSSA 1SKRA 4KTQA 1WSHA 3G0ZA 3CM6A 3HYFA 4PA1A 3HXMA 4J2AA 1VSLA 1TAUA 1D9FA 4Q5VA 2PY5A 2E6LA 4LSNA 2VG6A 1RT3A 3LP2A 3OYDA 3DM2A 1LV5A 3DLBA 4K8ZA 3B6OA 1T03A 3AA5X 3CFOA 4IDKA 2KQ2A 3HT3A 3FFIA 1VRUA 3HL8A 3SV3A 4CF1A 3DOKA 4CJKA 3SUQA 3QIOA 4DTOA 4OPKA 2QXFA 1EKEA 4CJFA 4BACA 1TKZA 4DFPA 4QAGA 3SZ2A 1RT1A 4BWJA 3VQ6A 4CEZA 4FJ5A 3KK2A 1NJZA 4KFBA 4O0IA 1KSPA 4BE1A 4FJIA 4E1MA 1LW0A 3D45A 4B9NA 4C8KA 3RWUA 1RT2A 4CJPA 4CHNA 4GVMA 4FZYA 2KFNA 4H8KA 3S3MA 4N47A 5SWMA 4O55A 3VQCA 3BDPA 2ETJA 3LWLA 4CEBA 1L5UA 4LSLA 3HK2A 4EP5A 1Z26A 5E41A 4Y1DA 4CJ3A 3MEDA 4KHQA 2OA8A 4KHYA 3KIOA 4IFVA 3QESA 4NCAA 3K5OA 1JL1A 4FJNA 3WNEA 4AH9A 3L2RA 3KKRA 1TKTA 4RW6A 4JS4A 4HHTA 3KD5E 3NGZA 4FM0A 1TGOA 3AO3A 4RW4A 3VQ4A 3WNGA 1RTIA 4CF0A 1YTUA 3KLHA 4JRPA 4BDPA 4FLVA 5C42A 4O4GA 3MXJA 3NF8A 3AVBA 4E7KA 1NK5A 4BDZA 3SQ1A 4FLZA 4DTMA 2F96A 5HBMA 5D3GA 1TL1A 4RW9A 4JS5A 4DSFA 1XWLA 2G8VA 2OPPA 2PYLA 4FW2A 3QEXA 4ELTA 3VQ9A 3OYIA 4MFBA 1IKVA 3PO5A 4W5TA 4J2EA 3V9XA 1NJXA 1C1CA 2E6MA 3ASMA 4J2BA 2B6AA 1BL3A 3A2FA 1U45A 4G1QA 2YNHA 4CE9A 4FLYA 3TI0A 1U48A 3AO4A 4CF9A 1K6YA 2KW4A 3KLEA 3KTQA 2QK9A 3V9WA 3HPGA 4OLAA 3OYCA 1WAFA 2KZZA 4I9LA 1HYSA 4N41A 1Y97A 1IG9A 1CLQA 4OKKA 3OY9A 3LPTA 2R7YA 1LWCA 3OJUA 4C8LA 4DF4A 5KRSA 4QOZB 1WSIA 4HUEA 2HW3A 3OYAA 4FJKA 3WNHA 3ZT3A 4CFCA 3K57A 3EZ5A 2P5GA 4FJ7A 4GW6A 4DSEA 4E19A 5KTQA 2Z1JA 2O4GA 3RTVA 3VQBA 1NK7A 4PUOA 4FW1A 3AVLA 4CF8A 3LP0A 4ZHRA 4DWIA 4FK2A 5FRNA 4KKOA 3V1RA 1NK6A 3BGRA 1VK0A 3OVNA 4TSXA 4HTUA 3MXIA 2ZE2A 3V9ZA 4KI6A 4N56A 1BISA 4AILC 4M42A 1D5AA 3SUNA 1CZBA 4B9MA 1U04A 3KLFA 2XO7A 3VQEA 4W5QA 2B5JA 1RT4A 3K2PA 1S1UA 2OZMA 3ISNC 1BI4B 1FKPA 4ICLA 3T3FA 4FJLA 1TV6A 1S5JA 3AVFA 4DU1A 3L3VA 4CIFA 3HPOA 3D0PA 4OKEA 4QCLA 1X9MA 4FZXC 3AA2A 4E7HA 1J54A 1RBTA 1GOAA 4M41A 3T19A 3K59A 3NCIA 3S3NA 2XHBA 1NOYA 3ZT0A 1FK9A 4E89A 3WNFA 4DU3A 4KRFA 1Q9YA 3SUPA 1DLOA 4AHVA 2JGUA 4IG3A 2A1RA 4BE0A 1G15A 4W5NA 1HRHA 1Q8IA 1I3AA 3CQ8A 2X78A 4E0DA 4KO0A 5FROA 3VA3A 3AVJA 1ZYQA 3TAQA 4KB0A 4FZZA 2X74A 3TAGA 1KVCA 1T8EA 4E1NA 1UOCA 3HO1A 2ZD1A 4C8OA 4CK1A 3LALA 3TABA 2HHSA 1LW2A 4KHWA 2Q3SA 3SUOA 1SL0A 4CJWA 5T7BA 3KK3A 3AO5A 3SPZA 2RKIA 4FLXA 5KGWA 3SV4A 3QIPA 3VA0A 5J2PA 3EY1A 1UA1A 4M3YA 3SJJA 1KTQA 3V9UA 5HLFA 4F2RA 2O4IA 4O5BA 4YNQA 4CEAA 2FBTA 5I3UA 1R0AA 1YTAA 3MEEA 5J2NA 5HRRA 2FBYA 3NF6A 4DTPA 4BWMA 4CHQA 1RDBA 2XRIA 4DQIA 2BDPA 4K8XA 4LH4A 5JS1A 3O3GA 1BQMA 4CFDA 4DTNA 2HHQA 3VQ7A 2I5JA 3P1GA 4RG8A 3ZSOA 3RR8A 5CZ1A 4KREA 4F2SA 1REVA 4FJGA 5EU7A 1U4BA 2P1JA 3MECA 3I8DA 3ITHA 1KLMA 3S9HA 1BQNA 3O3HA 2OYQA 3PV8A 1WSJA 4OGEA 1VSEA 3NF9A 3TAEA 1RCHA 3RRHA 4KHNA 4NYNA 2GUIA 1BIUA 2FC0A 4IBNA 3V81A 2QKBA 3OYBA 4B9VA 2A1SA 1C0UA 1U47A 3NDKA 4FM1A 1J5OA 3KK1A 1QTMA 1KFSA 1SUQA 3CM5A 2P5OA 4DG1A 1C6VA 3RMAA 4W5OA 1WSFA 1S9EA 1YT3A 2EX3A 4CFAA 1NK9A 3MEGA 3OYLA 4CF2A 4DTUA 2G8UA 2KZMA 2Y1IA 3LPUA 2X6NA 1C1BA 2HNZA 2YHBA 4KAZA 5DMRA 1GOCA 3RR7A 3C6TA 3QEVA 4ID1A 4O0JA 4EZ9A 1RBUA 3M8SA 4CIEA 3L2UA 2HHUA 3TAFA 3K5LA 2KFZA 2HHTA 3ZSZA 1ZBLA 1XHXA 3I0SA 1RT6A 1NKCA 4EP4A 4KTZA 3AVIA 4W5RA 3K5MA 4DSKA 2YNIA 1UA0A 3V9SA 3PX0A 1X1PA 3QLHA 5J2QA 2D0CA 3O4NA 1JLBA 3OYMA 1FKOA 3LANA 1WN7A 4BE2A 3E01A 4FLTA 4KPYA 1KFDA 2PYJA 3KKSA 1HYZA 4CJEA 2HNDA 4B8AB 1SV5A 3HP9A 4DLEA 1NK0A 3AVCA 3ZSXA 1DTTA 2HVHA 3SI6A 4CGFA 3QNNA 4DSLA 3SQ0A 3ULDA 1D8YA 3C94A 2X6SA 3SQ2A 2YHAA 3H08A 2F8SA 3ZSRA 1N6QA 4CJ5A 3L2QA 3AA4A 3M8QA 4JRQA 4NCGA 4OKJA 3DI6A 1LWEA 4CESA 3B6PA 3AVAA 4CGJA 4BDYA 4RW7A 2QKKA 3MXMA 3C6UA 4DTRA 1SKWA 1QS4A 3VQ5A 4E7JA 3UIQA 1Q9XA 3LZJA 2XY7A 4FK0A 1ZBFA 3L2VA 1VSFA 4M3TA 4CJLA
chains in the Genus database with same CATH superfamily
1X9SA 1OH8A 4OLBA 1BDGA 5DM7L 5HP1A 4LY7A 4M3XA 2EHGA 3F9KA 1KVBA 2GWJA 4CK2A 2YNGA 4XH4A 4NCBA 1DT9A 4DV7K 4CHOA 4CEDA 1T6CA 4JI8K 3JXUA 3NGYA 5DM6L 4CZLA 2QA4N 5J2MA 3M1FA 4AHRA 1U2VA 1IKXA 1IO2A 2VG7A 3PY8A 4LFCK 5EY4A 1WSGA 4EAHD 1W0HA 3LDSA 1TKXA 4FJHA 3HSTB 3VGKA 2P9PB 3R8EA 3LDOA 2RN2A 1KC8O 4DS4A 3LM2A 2VG5A 4CIGA 1B9DA 3R9PA 4CEFA 1S1WA 4NYFA 1BWFO 1RBVA 2YHXA 1SL1A 3L2WA 2Z1GA 3CIPA 3QETA 4CGDA 3AVGA 3T1YK 4F3OA 4FL9A 3GG4A 2AJQA 1HNVA 1HX1A 2D5RA 5BR9A 3THYB 4CJTA 3KZBA 2YNFA 1EETA 3PX6A 4H5VA 4AHCA 1I39A 3G25A 5JICA 1VQON 3PO4A 3BUZB 3D2FB 4JI6K 4UY8O 3MN5A 1RNHA 2O8BA 5KI6A 3PUFA 4XIUA 2ZJQL 3ZLJA 4DR2K 3OYKA 1DGKN 4C1NI 1JCFA 2E1YA 4PQUA 4JKBA 4WE1A 1RDUA 3EYZA 1NGCA 1ATNA 3ID6A 1IH7A 5C25A 2JLEA 3KLIA 1BU6O 3V1QA 2DY4A 3ZYYX 2YI1A 4DFMA 3OBYA 3NF7A 4JKCA 4ZTJA 4O8KA 3M8PA 4B08A 2NRZA 5HRPA 1IV0A 4WFAL 4F4KA 1CXUA 4IKFA 3LAKA 5J1EA 1GOBA 1RBRA 1NKBA 3UB5A 1L3TA 4A57A 4BQZA 3LDLA 4HUFA 2ITGA 4M3WA 1S9GA 2FSNA 2NRVA 2QW9A 1VQ8N 3HRGA 3VQDA 4DV4K 3MWTA 3RRGA 4RCHA 1YJNN 4JKEA 2G8KA 4NXNK 3VEVA 3O1WA 3SCXA 3QEIA 3CXCM 1P90A 4JKGB 1RTDA 1XC9A 4MQ3A 1W97L 1ASVA 1Z6RA 2E5LK 5FRMA 3ZT2A 5B8HA 3HP6A 1VSMA 2B4JA 4JKFA 2YV0X 1A5VA 3H3NO 3SK3A 3FZKA 4B9LA 2BANA 5C24A 1ZBUA 4B1YB 4ILJA 3CCMN 4BRAA 2YCHA 1HNIA 1S1VA 1QVGM 3ZSWA 3PIPL 4FXDA 3K5NA 1NKEA 1YVNA 5JLHA 3QEPA 2RF2A 1SS6A 4IZ9A 4MLEA 5C0YA 3SAFA 3EL2A 2KKZA 3AVNA 3AY9A 3OA9A 4PWDA 4CJQA 4KTWA 1A5WA 4B8CA 5AQHA 1QZ6A 3CC7N 3ALYA 4HVJA 3THYA 2W40A 3R1XA 3CI5A 3NH0A 2E4LA 4JI1K 4BROA 3T69A 4AHSA 3P5JA 3SPYA 1NOZA 1J9AA 3A5MC 1IJJA 4LF8K 3S41A 1HKGA 3VQAA 4FCYA 4NLBA 5H1SQ 4MDBA 4I7FA 1Z25A 3SJHA 4WFNL 1TK8A 1VQ6N 2HMIA 1BGXT 1I94K 4KTQA 2YHYA 3H45C 4PA1A 1Z05A 4DR6K 3C0BA 4Q5VA 3W0LA 1RT3A 2QEXN 3OYDA 3AA5X 3CFOA 2KQ2A 2CH5A 3FFIA 1VRUA 3HL8A 3SV3A 4CF1A 3CC2N 3DOKA 3JS6A 4IJNA 2ZJPL 3SUQA 1HR0K 4DFPA 3FGUA 4IWVA 4CEZA 3N4PA 3KK2A 4BRDA 3CHWA 1FW6A 4B9NA 1X3MA 2KFNA 3HM8A 1CZAN 4IDHA 3VPZA 3S3MA 4N47A 3BEXA 3LWLA 4AM6A 1YITN 1L5UA 2JWKA 4FPAA 1Z26A 3QESA 2I7NA 1NMDA 4AH9A 4CZGA 3NGZA 4PL8A 3UKUB 3VQ4A 3WEEB 4BDPA 3BZCA 5C42A 3MXJA 3NF8A 4E7KA 2F96A 5HBMA 1TL1A 4RW9A 2PYLA 2G8VA 4ELTA 3VQ9A 1C0FA 1IKVA 3PO5A 4MDAA 2E6MA 3ASMA 5M1OA 2B6AA 4FWLA 2YNHA 4CE9A 2V7YA 5AZJB 3AO4A 3WXKA 2WBNA 3HOTA 4OLAA 3EEQA 3HPGA 1WAFA 1Q18A 4JKHA 4OKKA 1LWCA 3OJUA 3OHRA 1WSIA 4HUEA 4BRMA 1VQ9N 3ZT3A 4FJ7A 1NGEA 3RTVA 2O4GA 3KK7A 4JI5K 3ATVA 4CF8A 2E2QA 5FRNA 3V1RA 3BGRA 4HTUA 4MLHA 5KPTA 3CCEN 4G9ZA 4B9MA 5E26A 1U04A 3T1HK 3VQEA 3L4QA 2B5JA 3P38A 1RGIA 3T3FA 4ICLA 1TV6A 3CF5L 3SLCA 3DXKA 1VQPN 3AA2A 1J54A 1RBTA 4V19S 1NGDA 4IEEA 3NCIA 2XHBA 4FWQA 1Q9YA 3SUPA 1N32K 4BR9A 1XMOK 1HRHA 3J81O 4E0DA 4KO0A 1ZYQA 4A2BA 4FZZA 5AQQA 1T8EA 1UOCA 2ASMA 3LALA 3M3ZA 1SL0A 3E9OA 1QQMA 5KGWA 3BZKA 3SV4A 4FVUA 5LY3A 1KTQA 2O4IA 1GLEG 4YNQA 2FBTA 5I3UA 1YTAA 4B9SA 4PKGA 3SMPA 4DTPA 2UUAK 3SAGA 2QWRA 2ZJRL 4DTNA 2I5JA 2V7ZA 3C6HA 4KREA 3CJ7A 2HHHK 2O8CA 4BRHA 1U4BA 2P1JA 4FOIA 2HSTA 2UXDK 3P4IA 3MN9A 1NJIO 1RCHA 3RRHA 4XH1A 4GKJK 3NDKA 5AQLA 3RMAA 1WSFA 2YX6A 3L4IA 2EX3A 4CFAA 4FOEA 4CF2A 2Y1IA 3LPUA 3MX5A 3R6MA 1GOCA 1QQNA 3C6TA 2HHUA 4EZ9A 1RBUA 3L2UA 4BR4A 3TAFA 4LC9B 5C2FA 3EN9A 1ZBLA 3C65A 3K9JA 2A6AA 2O8EA 3DLLL 1X1PA 3QLHA 1OH6A 1JLBA 3OYMA 1FKOA 3MN7A 5AZJA 3LDQA 5JMVA 2PYJA 4IEIA 3AVCA 1WOQA 3R3LA 1KAZA 4JI7K 4IO9L 5AFUH 3AA4A 3B6PA 3AVAA 1S3XA 4GVEA 4K42A 1QS4A 5GADP 3LZJA 4MO4A 2XY7A 3L2VA 4J2BA 4M3TA 3HM9A 4LF6K 1U49A 3EE9A 3M6GA 3H1QA 1EXQA 4JHDA 3SAHA 3O80A 3HTVA 3RMDA 1NJWA 4Z0UA 3SMSA 2CGKA 4E3SA 3A5LC 4CHPA 1NK4A 2OTJN 2EWSA 3IAYA 5CYQA 2FBXA 1D9DA 4LFAK 3CD6N 3D2EB 3PSFA 5C2DA 5GIOA 1V4SA 2XY8A 4CJRA 1OVYA 4J8FA 1YVUA 2E2NA 2E88A 1ZXOA 3QO9A 4GMJB 3G10A 4DV1K 1QE1A 5I42A 1RT7A 4B9UA 3AVHA 4LD0A 2VWKA 4DTJA 5AQZA 5BRHA 4CVNE 2A40A 4DUYK 3VEXA 3OJSA 2FSJA 3V4IA 2Z1IA 3HVTA 4O8UA 4KI4A 3AO2A 2QXLA 2WFBA 2GX9A 3SYZA 4GKKK 2BE2A 5BPLA 3HVRA 5CYMA 1MU2A 3HPHA 5I9EB 4FWKA 3THXB 4MO5A 3AA3A 1T44A 1JLGA 4BRCA 4JD2B 4FWMA 1BG3A 5KPZA 1VHXA 2HHWA 3PLAA 4I6MB 4BRQA 2VWBA 1Q82O 1JXEA 4IFYA 5BN8A 3Q7BA 3MK6A 3ZEUA 3TWHA 1IKWA 1K8KB 1Q86O 2BGGA 2IDOA 3MDQA 1WBBA 1OH7A 2VCPA 4GV3A 2HHXA 5KPRA 4BR2A 3IUCA 2Y1JA 4M45A 3ID8A 4JLHA 4AF1A 1W9HA 2F8TA 4CZKA 2ZGYA 3O3FA 4GY2B 3O8MA 1TYQB 2A42A 3NFAA 3RSEA 3J7ZO 3HJFA 5AQFA 1WUAA 4KV8A 5LL6Z 4CK3A 3DYAA 1VQ5N 3JYTA 4YOTA 1EX4A 3CJ9A 4ILGB 4ILHA 5JS2A 2O8FB 3DMJA 4DQRA 4Q0BA 4FJ9A 4HUGA 2P9KB 3MX2A 4KH6A 2NLXA 2FSKA 3ZETB 3L8BA 5CZ2A 4I2QA 5BREA 3L6QA 2NUBA 4JI0K 3QNOA 3DAWA 4WQ5A 4CGHA 1O13A 2F7TA 4A62A 2ASOA 4Z4EA 1O1WA 4YFUA 1WAJA 5AZIB 2RE2A 4H5TA 1BI4A 4FYDA 4JI3K 3U9DA 3WT0A 1BCOA 5HRSA 5AQMA 4BRKA 4CJSA 1CZ9A 2VYPA 5EX5A 3VF4A 2PZSA 3TSQA 1SKSA 4CHZA 3OTOK 1S6QA 4IO8A 1YJ9N 1QHAA 1VSHA 2IC3A 3F73A 2OZSA 1QQOA 4H0YB 2ATQA 3T7ZA 2QWLA 3UE5A 4ZTFA 4LFBK 4OPAA 1M90O 3NBPA 1XNRK 3TR8A 1JLFA 5HRNA 1TAQA 4CZMA 3ZX0A 3QERA 1QSYA 4DKWA 3H6EA 1JXBA 2AA4A 3HI0A 1YUWA 4XEIA 5KGXA 3OYJA 3CFRA 5F1XA 3LZIA 4QS8A 4BC3A 4FWPA 4JD2A 4WQ5C 4BR7A 3WQUA 4H5WA 5JVGL 2J4RA 3ZT1A 2P51A 2ASPA 4DQ8A 4BRFA 4DQPA 4LF9K 4FJ8A 4FK4A 3NGIA 4OPHA 1XI1A 1EP4A 4DU4A 4DF8A 1K8KA 4GNIA 3VQQA 2HOEA 2P9LA 3CQXA 4Z4FA 4RW8A 3SBTA 4FM2A 1SKRA 2PY5A 3LP2A 3CMAN 2OCEA 1RDWX 1TYQA 3IMXA 2GELA 4YDUC 3QIOA 4BACA 1TKZA 4YY3K 4PL7A 1T6DA 3VQ6A 4IFEA 4KFBA 4CJ7A 4O0IA 1V4TA 4BE1A 4FJIA 2E2OA 3RWUA 2P9NB 4C23A 4O55A 3BDPA 3EZWA 5LJWA 2D1KA 4CEBA 4LSLA 3B8AX 5E41A 3EKUA 4H5RA 2I7PA 2HF4A 3H3OB 3MEDA 4NCAA 4IFVA 3K0SA 3ZETA 1IG8A 3KD5E 1TGOA 4RW4A 3WNGA 5KQ8A 5IWAK 1RTIA 4NO7A 4BQLA 4FLVA 4O4GA 5A2QO 3AVBA 1NK5A 4DTMA 4DSFA 1XWLA 2OPPA 4B3MK 4MFBA 3MMVA 4J2EA 5AZIA 5TKYA 2FXUA 1NJXA 3A5NC 3A2FA 5M1KA 3TI0A 4CF9A 3KTQA 2QK9A 2GWKA 4U7BA 3OYCA 4JNEA 4N41A 1Y97A 1IG9A 5AQVA 4IOCL 4DF4A 2HW3A 3I33A 3E1YA 1NGBA 3K57A 2P5GA 3C7NB 5FPEA 4DSEA 3FR0A 1NK7A 1N33K 4FW1A 4DWIA 1SAZA 1NK6A 3FE1A 1VK0A 3OVNA 4KI6A 2P9PA 4XH5A 3V9ZA 2A5XA 3VF6A 1D5AA 3Q7CA 4DR5K 4AM7A 3KLFA 5ADXH 3AARA 4BVPA 2Q36A 1K8AO 4IOXA 2AP1A 4DU1A 1NBWA 3CCRN 3QICA 1GLLO 1VQ4N 5AQOA 2Q0UA 1X9MA 4FZXC 2Q31A 1GOAA 4M41A 3VOVA 4EFHA 3CCJN 1ILYA 3ZT0A 4DU3A 3WNFA 1DLOA 3AGRA 3OBWA 2A1RA 4BE0A 1G15A 4W5NA 2QWPA 1I3AA 4X62K 1BA0A 2X78A 4BC5A 4KB0A 1KVCA 3HO1A 2D0OA 2ZD1A 4C8OA 1LW2A 2RKIA 3D2FA 3VA0A 3QIPA 5J2PA 1UA1A 3V9UA 3O9TA 1R0AA 3GBTA 3TTFA 4CHQA 4K8XA 4LH4A 2QWOA 4EHTA 4RG8A 4FWSA 3DWLA 1OKJA 1J5EK 4DV5K 4FWNA 1D4XA 3I8DA 4RTFD 3ITHA 2UU9K 3O6WA 2ZF5O 2OYQA 4L3QA 1VSEA 5LJVA 2GUIA 5LMNK 3V81A 2BH1A 3SBGA 2QKBA 2A1SA 2QTDA 4FM1A 1J5OA 1KFSA 5AQSA 4A5BA 5FLXO 1K73O 2KZMA 4DTUA 1C1BA 3CERA 4BVOA 3QEVA 4ID1A 4IJAA 3K5LA 1XHXA 4B9QA 1RT6A 4DSKA 3V9SA 3PX0A 5FPDA 4FLTA 1MWKA 4CJEA 2HNDA 4B8AB 1R59O 1SV5A 3HP9A 4JKGA 1NK0A 2NRTA 3ZSXA 2P9IB 1DTTA 3SI6A 4DSLA 3SQ0A 1D8YA 4C1NK 1C0GA 2OANA 2YHAA 3H08A 3VTIA 2F8SA 4F9OA 1N6QA 1EWQA 4NB4A 4OKJA 1LWEA 1NGFA 4CGJA 3BF1A 4BDYA 4RW7A 3MXMA 4NXMK 3C6UA 1SKWA 3UIQA 3VQ5A 3NVKA 5IT9O 4B1UB 1VSFA 4FSVA 4CJLA 1VSKA 4YOYA 2V52B 1MWMA 5TKWA 2VWJA 3VN5A 3QBWA 1HPMA 3OS0A 2IIRA 3CYMA 1NJYA 4F8RA 1KCFA 1RT5A 2F9TA 2BUPA 3ZSYA 4OJRA 1VRTA 2O8DB 1C1AA 3CPWM 3ZSQA 1FXXA 3TANA 2CH6A 2WOMA 4ISEA 3DXMB 2WUSA 1S6PA 2KHOA 4ELVA 3CFPA 2V51B 4ELUA 2FBVA 3ULEB 3OS2A 1BCMA 5M1PA 4E7LA 4BRGA 5JLFA 1YIJN 1LAVA 4Z4GA 4FJXA 5AQKA 1E3MA 2Q2RA 3QEWA 1TL3A 2NNWA 5CR4A 1J6ZA 2NRWA 1NMNA 2W41A 3CPEA 2YJFA 1NGGA 1ATSA 1RTJA 1DTQA 4B9TA 3FFKB 1ZBSA 1K9MO 2P9UB 4DFJA 1RDCA 3EO3A 4FJMA 3J8AA 2XY5A 3DLEA 1L3UA 1S1XA 4CEQA 3AV9A 4FVMA 5BR8K 3OYGA 4DMNA 4CD3A 1QVFM 5F0XA 4C8NA 3N4QA 1JLAA 1RDDA 2GV9A 2OTLN 4DSIA 3VENA 4B3SK 4DB3A 3I55N 1FJGK 2LSNA 4RWTA 3DLKA 4E7IA 1NLVA 1N5YA 3U3GA 3MCPA 4B1XB 2H3GX 3UKUA 4KHUA 3WEEA 2DFHA 4M3RA 3P83D 2WTUA 2YKMA 4JI4K 1NGAA 1F21A 3NAEA 3U6FA 4LF5K 4A2AA 1KAYA 3DRSA 4OGCA 1C0MA 2IOCA 4U67L 4QS9A 1IKYA 1EO1A 5AQPA 3VERA 3QBXA 4Z4IA 3NHGA 2PFUA 3CJBA 1KD1O 2HNYA 2A41A 3VQPA 4B1WB 4DS5A 3NH2A 1HJRA 4HCBA 1HLUA 2HBMA 3KWGA 3ZCMA 1HJOA 4WF9L 3OS1A 5AQTA 4LH5A 2W42A 4OVLA 4BRNA 4IG0A 5AQNA 4X65K 4I2PA 4DV2K 1A5XA 2VQEK 4ISFA 3LWMA 5HROA 2HB5A 1KLNA 4JEPA 4B3OA 1HKCA 4CEEA 3CG7A 3J7YP 1TVRA 4JK7A 4DTXA 5M1QA 4H0VB 2KTQA 1JL2A 3KJVA 2OPSA 4C8MA 3QINA 4WQ4C 4CFBA 3KD1E 1HNWK 3THVA 2NRHA 2G8IA 1SL2A 2FF3B 3ZX3A 3ZSVA 1L3SA 4KB1A 5AQRA 5BRFA 3VETA 1W7AA 2WONA 4DQSA 4R5PA 4CGGA 4BRLA 3TAPA 3IFRA 3L3UA 3C6AA 4DTSA 4CGIA 4Y1CA 3QFUA 1KRPA 1TK0A 1HMVA 2PBDA 4ID5A 1HPZA 1UAXA 4BY9C 3RMBA 1CXQA 4N5SA 2QWMA 3A0IX 2DFEA 4DHYA 2E2PA 4FJJA 4Z4CA 2G8WA 3TU5A 3DOLA 5GIPA 3SNNA 5GAHP 3CC4N 2ZGZA 1SZ2A 4H0XB 4CHYA 4PY5A 2IGIA 3C95A 3DRRA 1VAZA 4BGAA 3M8RA 4HCCA 4L8RB 1UWBA 1C0TA 1NGIA 2NZTA 3AAPA 2IS3A 2YKNA 3FZLA 1WSHA 2VGMA 3CM6A 2CGLA 3HXMA 1TAUA 1VSLA 5FPNA 4HWIA 4AQYK 3DM2A 1LV5A 3HOSA 3G71N 4K8ZA 4IDKA 1GLCG 4CJKA 4OPKA 2QXFA 1EKEA 4CJFA 1W2BM 4QAGA 1RT1A 4FJ5A 2UXBK 1KSPA 3GOIA 4C8KA 1YHQN 1RT2A 3HSCA 4FZYA 4CZEA 4H8KA 1VQMN 2FF6A 2ETJA 4IXCA 1RFQA 1XNQK 4EP5A 2BTFA 2QWQA 5MLCQ 4HTLA 4KHQA 2OA8A 4FJNA 3L2RA 4HHTA 2D4WA 1JCGA 1Y64A 3CCLN 2W6KA 3AO3A 3BY5A 3KLHA 3FZHA 4FLZA 5D3GA 1KAXA 4OO1J 5AQJA 1ATRA 1U45A 2IVNA 4G1QA 1X3NA 4BG9A 1K6YA 3HBTA 4CBXA 3O5BA 1NGHA 2KZZA 1KXPA 1HUXA 4I9LA 1HYSA 3KHYA 1CLQA 4WFBL 4JK8A 1N34K 2R7YA 3LPTA 3CJ1A 4KH5A 3D2EA 5KRSA 4QOZB 1OH5A 4CFCA 5AR0A 4GW6A 5KTQA 2Z1JA 4PUOA 3VQBA 1YJWN 3LDNA 3AVLA 3LP0A 4ZHRA 4O5FA 4K0KK 4TSXA 3MXIA 1U6ZA 2ZE2A 4AILC 1BISA 4M42A 1CZBA 1KQSM 1HNZK 3WQTA 4W5QA 2OZMA 1RT4A 2UXCK 1IBMK 4YDUA 4BC2A 3WXMB 1FKPA 4M7XA 4FJLA 5C15A 4YOWA 4OKEA 3D6RA 4QCLA 3T19A 1NOYA 4KRFA 1FK9A 4PKHA 2GUPA 3THXA 4AHVA 4EHUA 2JGUA 4IG3A 3QB0A 3G6EN 1Q8IA 3CQ8A 3U9ZA 1SQKA 5FROA 3MN6A 3VA3A 2HBKA 1OVQA 3TAQA 2X74A 3KWIA 3TAGA 3TSUA 4I6MA 4E1NA 4CK1A 3TABA 1E4FT 1M1KO 4KHWA 4CJWA 5T7BA 3KK3A 3AO5A 3EY1A 3A5OC 4M3YA 3SJJA 5HLFA 4O5BA 5HOOA 4CEAA 4BREA 3MEEA 5J2NA 5HRRA 3NF6A 5JS1A 1RDBA 2XRIA 4DQIA 2BDPA 4H5NA 1BQMA 4CFDA 4DR3K 3P1GA 3ZSOA 3RR8A 4K25A 5CZ1A 3U8XA 5M1FA 4F2SA 4JN4A 3BP8A 1XUPO 1KLMA 1BQNA 3EE8A 4OGEA 3NF9A 3TAEA 2JWLA 4FO0A 4NYNA 1BIUA 4A5AA 3VGLA 4B9VA 1U47A 3VTHA 1QTMA 4KBOA 1SUQA 3CM5A 2P5OA 4DG1A 1HKBA 2O8FA 3CCQN 1C6VA 1T3VA 1TUYA 2ZM6K 1YT3A 3LDPA 1DEJA 2CGJA 4OX9K 2X6NA 1YI2N 2HNZA 2P9KA 3WXLA 4O0JA 3M8SA 4CIEA 3U4LA 3FZFA 4DV6K 2HHTA 3ZSZA 3A8YA 5C12A 3I0SA 4EP4A 4W5RA 3K5MA 3NMUA 1ESVA 1NGJA 5J2QA 1N8RO 2D0CA 3LM9A 3O4NA 1QZ5A 4BE2A 3JAMO 4KPYA 1WN7A 1KFDA 2QI2A 3KKSA 1HYZA 2VQFK 2FLOA 4KHPK 1YAGA 2UYTA 2WC9A 4JAXA 4BG8A 2HVHA 1LOTB 3ULDA 3C94A 2X6SA 3SQ2A 4X66K 3W3DA 2IVPA 3L2QA 3M8QA 3GDQA 4NCGA 3DI6A 3ENHA 3GE1A 4DTRA 2F4VK 1S72N 4FK0A 1G99A 3DRPA 3IRXA 2HBJA 3TAMA 3E9PA 1RTHA 1VQNN 4CJUA 4UQGA 4B1ZA 4BRIA 4J2DA 1MA9B 4H4OA 1BHLA 1NG9A 4FLUA 4DUZK 3P31A 4H03B 2Q97A 4QS7A 4CEOA 1VSJA 3AGKA 3U3YA 2UUCK 2XY6A 4N76A 5JVHL 1LAWA 4EIAA 3OYHA 1VQ7N 3VMFB 4BR5A 4A59A 3TSPA 1L3VA 4A61A 1JLEA 3G4SN 3ZX2A 5AFUA 1KVAA 5K14A 4EZ6A 2QM1A 1HQEA 3V1OA 4H0TB 1IBLK 3JSMA 2RPIA 5DK5A 1ZC6A 1QHTA 5SZTA 5AQGA 1WSEA 3OYNA 3K58A 2G8HA 1Q81O 4DR7K 3AVMA 3DXKB 5AQUA 4M3ZA 4CECA 5AJ3K 1LCUA 3M5RA 5CY4A 1BA1A 1DKGD 4FLWA 2NRRA 3KLGA 3IG1A 5BPMA 3LP1A 5M1NA 1NU0A 4AHUA 1J53A 3F5TA 3OYEA 3TARA 5C10A 2OPRA 1ITGA 3SQ4A 3VF2A 2P9NA 3THWB 4Z94A 3TTCA 3P39A 4BRPA 1JKHA 3DLHA 1RILA 1VSIA 2Z1HA 1HNXK 2DFFA 4FPBA 3NH1A 5EVZA 4NLCA 4KHSA 1GLJO 4H4MA 1RDAA 1RBSA 2O8CB 1VSDA 2E1ZA 4JK9A 2A3ZA 2ZQBA 3ATUA 4DLGA 1ZBHA 3IS9A 4YOVA 1ASUA 1NK8A 1N36K 1TKDA 3AVKA 3ZT4A 4DR4K 3CJCA 4CJVA 4CJ4A 2D0BA 4R79A 4DQQA 1ZBIA 4YORA 1WNSA 1JLCA 4CZHA 4CERA 3C7NA 3MAQA 5GINA 1JLQA 3RMCA 2O8EB 1BIZA 1X9JA 3O1BA 1GLAG 2OPQA 4YHHK 1ASWA 1NNEA 3VESA 2HHVA 3O4QA 3LP3A 3FZMA 4DFKA 5GAEP 3EKSA 5KRTA 5FDLA 1QQCA 2F9WA 1VQLN 3OYFA 2GBZA 4I9QA 3CJAA 1T7PA 2G8FA 3I8BA 1WLJA 2KLAA 1T05A 1HQUA 1XC3A 4YOXA 4YOUA 2IAJA 1BOTO 5AQIA 4O44A 1HYVA 3OW2M 3NVMA 1B9FA 4OPJA 4JHDB 4M3UA 3ENOA 3LAMA 2YHWA 3UKRB 1B92A 2D0PA 4DSJA 1LWFA 2DTUA 3S3OA 3WXJA 2GTDA 3F2KA 1XHZA 4GV6A 4BC4A 3CETA 3DJCA 3I0RA 1X9WA 4DCHA 3DLRA 3DLGA 4Z4HA 4KH4A 5FPMA 3NE6A 1TK5A 3GL1A 4WCEL 4F3TA 4CCHA 2NRXA 3CQYA 3PX4A 1QSLA 3THWA 4AHTA 3T1AA 3V6DA 1S1TA 3O4WA 2D0AA 2ITMA 3VQ8A 3AO1A 1QSSA 3G0ZA 3HYFA 4J2AA 4JV5K 4IOAL 1D9FA 2E6LA 3PIOL 1BUPA 4LSNA 2UUBK 2VG6A 3DLBA 3FLCO 3B6OA 1T03A 3HT3A 3VEWA 3CCUN 4DTOA 4BGBA 3CCVN 3SZ2A 4BWJA 1NJZA 1E4GT 2HBLA 3QMLA 4E1MA 1LW0A 3D45A 4CJPA 4CHNA 4GVMA 4PHTX 3CCSN 4WQ4A 3O08A 5SWMA 3VQCA 3ZEUB 4B3TK 2GEMA 3LL3A 3H46O 2P9SB 2P9IA 3MCAB 5F2RA 4CD1A 3HK2A 4Y1DA 4CJ3A 3J80O 4KHYA 3KIOA 3K5OA 3TPQA 1JL1A 5BN9A 3WNEA 3KKRA 1TKTA 2Q0RA 4RW6A 4JS4A 4M63C 4FM0A 4CF0A 1NM1A 1YTUA 4JRPA 3RSEB 4BDZA 3SQ1A 4E1JA 1H1VA 4JS5A 5EXWA 4FW2A 3QEXA 3OYIA 2IVOA 4W5TA 3V9XA 5GAGP 1C1CA 1BL3A 3IDHA 5AQWA 4FLYA 5KQDA 2W6LA 1U48A 3AAQA 2KW4A 3KLEA 3WXIA 3V9WA 3O9SA 3O9UA 3OY9A 2ZWHA 5BPNA 4C8LA 1MDUB 2O8DA 2HMPA 1NWKA 3BF3A 4CBWA 3OYAA 3WNHA 4FJKA 2RHKA 3DXMA 3EZ5A 4E19A 3ULEA 1YF5L 5BRDA 4FK2A 4KKOA 5EOYA 4N56A 4FWOA 5AQXA 2YJEA 3SUNA 3UKRA 4CZJA 4K41A 2XO7A 4CZFA 2DPNA 3K2PA 1S1UA 4FWRA 3QFPA 3ISNC 1BI4B 1VQKN 1S5JA 3AVFA 3L3VA 4CIFA 3HPOA 3D0PA 3VEYA 3MWPA 4E7HA 3O9RA 5CHIA 3CMEN 3K59A 1EQYA 3S3NA 2E8AA 3F9MA 4E89A 5HL7L 4X64K 2E20A 1U2VB 3PSIA 2P9UA 4ISGA 3WUHA 2PAVA 2VGNA 5ELZA 3AVJA 2Q1NA 2HHSA 5E84A 1GLFO 2Q3SA 4JKAA 3SUOA 3SPZA 1GLDG 4FLXA 3O9QA 1BO5O 3J7AP 1WBDA 4F2RA 2HF3A 1P8ZA 5ADXA 3E66A 2FBYA 4WYBA 4BWMA 1EWRA 3O3GA 2HHQA 3VQ7A 4LF4K 1REVA 4FJGA 1YXQA 3ENBA 5EU7A 1WB9A 3MECA 3S9HA 4CBUA 3O3HA 3PV8A 1WSJA 3H1VX 4KHNA 4DR1K 1XQSC 2FC0A 4IBNA 5CE3A 3OYBA 1C0UA 3VGMA 3KK1A 2P9SA 3QDKA 2P9LB 3TTDA 4CI6A 1IBKK 1JJ2M 4W5OA 1S9EA 1NK9A 2O8BB 2G8UA 3MEGA 3OYLA 2YHBA 4KAZA 5DMRA 4B1VA 3RR7A 4M7YA 4LF7K 4B3RK 3I56N 2KFZA 1JCEA 1NKCA 4KTZA 3AVIA 4CW7B 2YNIA 3L0QA 1UA0A 4PKIA 4CZIA 3K9KA 4H0PA 1TUUA 2HVIA 3LANA 4BR0A 3E01A 1XMQK 4K43A 4DV3K 1S22A 3KVGA 4DLEA 3HZ6A 4Y0WA 4JKDA 3D7EO 4CGFA 3QNNA 3IKMA 5AQYA 1GLBG 4JYAK 3VEOA 3ZSRA 4GV9A 3RVCA 4CJ5A 4JRQA 4DV0K 4CESA 3VEZA 5LMUK 2QKKA 1Q7YO 4E7JA 1Q9XA 4H0OA 4JI2K 1ZBFA 2QWNA 3E9LA
chains in the Genus database with same CATH topology
3DRPA 3IRXA 3HM9A 1U49A 1X9SA 1VSKA 3TAMA 4OLBA 1RTHA 5HP1A 4CJUA 4UQGA 4J2DA 1EXQA 4LY7A 4M3XA 2EHGA 3F9KA 1BHLA 1KVBA 4H4OA 4CK2A 2YNGA 2VWJA 4FLUA 4NCBA 4CHOA 3RMDA 3VN5A 4CEDA 1NJWA 4Z0UA 4CEOA 1VSJA 3OS0A 3U3YA 4N76A 2XY6A 4E3SA 3CYMA 3NGYA 1NJYA 1KCFA 4F8RA 4CHPA 1NK4A 1RT5A 3IAYA 5CYQA 2FBXA 1LAWA 3ZSYA 4OJRA 3OYHA 1D9DA 5J2MA 1VRTA 1C1AA 4AHRA 3ZSQA 1IKXA 1IO2A 1FXXA 2WOMA 2XY8A 3TANA 2VG7A 1L3VA 3PY8A 1S6PA 4CJRA 1JLEA 4ELVA 1YVUA 1WSGA 3CFPA 1W0HA 3LDSA 4ELUA 2FBVA 3OS2A 1KVAA 3QO9A 4GMJB 3G10A 5K14A 1TKXA 4EZ6A 1BCMA 4FJHA 3HSTB 1HQEA 1QE1A 3V1OA 1RT7A 4E7LA 5I42A 4B9UA 3AVHA 4LD0A 2VWKA 3JSMA 1LAVA 4DTJA 2RPIA 2RN2A 4DS4A 5DK5A 2VG5A 4Z4GA 1QHTA 4FJXA 5SZTA 4CIGA 1B9DA 3OJSA 3QEWA 4CEFA 3V4IA 1WSEA 2Z1IA 3HVTA 3OYNA 3K58A 2G8HA 1TL3A 1S1WA 4NYFA 3AVMA 1RBVA 4KI4A 4M3ZA 4CECA 3AO2A 1SL1A 3L2WA 2Z1GA 3SYZA 3QETA 2BE2A 5CY4A 4CGDA 3AVGA 3HVRA 1RTJA 4F3OA 1MU2A 1DTQA 1HNVA 3HPHA 5CYMA 2D5RA 4B9TA 2AJQA 4FLWA 3AA3A 3KLGA 3IG1A 1JLGA 4DFJA 1RDCA 4FJMA 3LP1A 4CJTA 2XY5A 2YNFA 4AHUA 1J53A 3OYEA 3TARA 3DLEA 2HHWA 1EETA 2OPRA 4AHCA 3PX6A 1ITGA 1I39A 3SQ4A 1L3UA 1S1XA 4CEQA 3PO4A 3AV9A 4FVMA 1JXEA 4IFYA 3OYGA 4DMNA 4C8NA 2HVIA 3TWHA 1IKWA 1JKHA 1RNHA 3DLHA 1RILA 1VSIA 2Z1HA 2BGGA 1JLAA 1RDDA 2DFFA 2IDOA 2GV9A 3NH1A 4DSIA 5KI6A 2HHXA 3PUFA 4XIUA 2LSNA 4KHSA 3DLKA 4E7IA 2Y1JA 4M45A 4JLHA 4H4MA 1RDAA 1N5YA 3U3GA 3OYKA 4KHUA 1RBSA 1W9HA 2F8TA 3O3FA 1VSDA 4PQUA 2DFHA 3NFAA 4M3RA 3P83D 4WE1A 2ZQBA 3HJFA 2YKMA 3EYZA 4DLGA 1F21A 3NAEA 3U6FA 1ZBHA 4KV8A 4CK3A 3IS9A 3DYAA 3DRSA 1ASUA 3JYTA 1NK8A 1TKDA 4OGCA 3AVKA 1C0MA 1EX4A 2IOCA 1IH7A 5C25A 2JLEA 3KLIA 1IKYA 3ZT4A 3V1QA 5JS2A 2DY4A 3DMJA 4DQRA 4CJVA 4DFMA 4CJ4A 3NF7A 4Z4IA 2D0BA 3NHGA 4DQQA 1ZBIA 4Q0BA 4ZTJA 4FJ9A 3M8PA 4B08A 4HUGA 1WNSA 1JLCA 2HNYA 5HRPA 3VQPA 4F4KA 4DS5A 3NH2A 4CERA 1CXUA 3MAQA 3LAKA 3L8BA 4IKFA 5CZ2A 5J1EA 1GOBA 1RBRA 1JLQA 1HJRA 1NKBA 1L3TA 4HCBA 3RMCA 4HUFA 4I2QA 2ITGA 2NUBA 1BIZA 3QNOA 4M3WA 1S9GA 3ZCMA 4B9SA 2OPQA 4CGHA 1ASWA 3OS1A 3VQDA 3RRGA 4LH5A 4Z4EA 2W42A 4OVLA 1O1WA 4IG0A 2G8KA 2HHVA 3O4QA 3LP3A 4I2PA 4YFUA 3SCXA 1WAJA 1A5XA 1BI4A 4DFKA 3QEIA 4FYDA 3LWMA 5HROA 5KRTA 1RTDA 2HB5A 1KLNA 5FDLA 1QQCA 4MQ3A 1XC9A 4B3OA 1BCOA 4CEEA 5HRSA 3OYFA 1ASVA 2GBZA 4I9QA 3CG7A 4CJSA 1CZ9A 1TVRA 4DTXA 2PZSA 1T7PA 5FRMA 3ZT2A 1SKSA 2KTQA 4CHZA 1JL2A 3KJVA 2G8FA 2OPSA 3HP6A 1VSMA 1S6QA 1WLJA 2B4JA 1HQUA 1VSHA 4C8MA 3QINA 1T05A 2IC3A 2YV0X 1A5VA 4CFBA 2IAJA 3F73A 2OZSA 4B9LA 3KD1E 4O44A 2BANA 5C24A 3THVA 1ZBUA 2ATQA 1HYVA 2G8IA 4ZTFA 1SL2A 3NBPA 3ZSVA 1HNIA 1L3SA 4KB1A 3TR8A 1B9FA 4OPJA 1S1VA 1JLFA 3ZSWA 5HRNA 4M3UA 3LAMA 2WONA 1TAQA 4DQSA 4FXDA 3K5NA 1QSYA 1B92A 3QERA 1NKEA 4DSJA 1LWFA 2DTUA 3S3OA 3QEPA 4R5PA 2RF2A 4CGGA 1XHZA 3TAPA 1JXBA 3L3UA 4DTSA 4CGIA 4Y1CA 1KRPA 5KGXA 1HMVA 3I0RA 1TK0A 3AVNA 3OYJA 3CFRA 1X9WA 4PWDA 4ID5A 4CJQA 1HPZA 1UAXA 3DLRA 3DLGA 4KTWA 4Z4HA 1A5WA 3LZIA 4B8CA 3RMBA 1CXQA 3ALYA 4HVJA 4N5SA 3NE6A 1TK5A 3NH0A 2DFEA 2E4LA 4FJJA 4Z4CA 2G8WA 3DOLA 3SNNA 4AHSA 3P5JA 3SPYA 1NOZA 4F3TA 3ZT1A 4CHYA 4PY5A 1J9AA 4CCHA 3PX4A 1QSLA 2IGIA 3C95A 2P51A 3DRRA 4AHTA 3VQAA 4FCYA 3M8RA 3T1AA 4DQPA 3NGIA 4FJ8A 3V6DA 1XI1A 4FK4A 1S1TA 1EP4A 4I7FA 1UWBA 4DU4A 4DF8A 4HCCA 4L8RB 1C0TA 1Z25A 3VQQA 1TK8A 2D0AA 2HMIA 1BGXT 3VQ8A 4Z4FA 2IS3A 3AO1A 4RW8A 2YKNA 4FM2A 1QSSA 1SKRA 4KTQA 1WSHA 3G0ZA 3CM6A 3HYFA 4PA1A 3HXMA 4J2AA 1VSLA 1TAUA 1D9FA 4Q5VA 2PY5A 2E6LA 4LSNA 2VG6A 1RT3A 3LP2A 3OYDA 3DM2A 1LV5A 3DLBA 4K8ZA 3B6OA 1T03A 3AA5X 3CFOA 4IDKA 2KQ2A 3HT3A 3FFIA 1VRUA 3HL8A 3SV3A 4CF1A 3DOKA 4CJKA 3SUQA 3QIOA 4DTOA 4OPKA 2QXFA 1EKEA 4CJFA 4BACA 1TKZA 4DFPA 4QAGA 3SZ2A 1RT1A 4BWJA 3VQ6A 4CEZA 4FJ5A 3KK2A 1NJZA 4KFBA 4O0IA 1KSPA 4BE1A 4FJIA 4E1MA 1LW0A 3D45A 4B9NA 4C8KA 3RWUA 1RT2A 4CJPA 4CHNA 4GVMA 4FZYA 2KFNA 4H8KA 3S3MA 4N47A 5SWMA 4O55A 3VQCA 3BDPA 2ETJA 3LWLA 4CEBA 1L5UA 4LSLA 3HK2A 4EP5A 1Z26A 5E41A 4Y1DA 4CJ3A 3MEDA 4KHQA 2OA8A 4KHYA 3KIOA 4IFVA 3QESA 4NCAA 3K5OA 1JL1A 4FJNA 3WNEA 4AH9A 3L2RA 3KKRA 1TKTA 4RW6A 4JS4A 4HHTA 3KD5E 3NGZA 4FM0A 1TGOA 3AO3A 4RW4A 3VQ4A 3WNGA 1RTIA 4CF0A 1YTUA 3KLHA 4JRPA 4BDPA 4FLVA 5C42A 4O4GA 3MXJA 3NF8A 3AVBA 4E7KA 1NK5A 4BDZA 3SQ1A 4FLZA 4DTMA 2F96A 5HBMA 5D3GA 1TL1A 4RW9A 4JS5A 4DSFA 1XWLA 2G8VA 2OPPA 2PYLA 4FW2A 3QEXA 4ELTA 3VQ9A 3OYIA 4MFBA 1IKVA 3PO5A 4W5TA 4J2EA 3V9XA 1NJXA 1C1CA 2E6MA 3ASMA 4J2BA 2B6AA 1BL3A 3A2FA 1U45A 4G1QA 2YNHA 4CE9A 4FLYA 3TI0A 1U48A 3AO4A 4CF9A 1K6YA 2KW4A 3KLEA 3KTQA 2QK9A 3V9WA 3HPGA 4OLAA 3OYCA 1WAFA 2KZZA 4I9LA 1HYSA 4N41A 1Y97A 1IG9A 1CLQA 4OKKA 3OY9A 3LPTA 2R7YA 1LWCA 3OJUA 4C8LA 4DF4A 5KRSA 4QOZB 1WSIA 4HUEA 2HW3A 3OYAA 4FJKA 3WNHA 3ZT3A 4CFCA 3K57A 3EZ5A 2P5GA 4FJ7A 4GW6A 4DSEA 4E19A 5KTQA 2Z1JA 2O4GA 3RTVA 3VQBA 1NK7A 4PUOA 4FW1A 3AVLA 4CF8A 3LP0A 4ZHRA 4DWIA 4FK2A 5FRNA 4KKOA 3V1RA 1NK6A 3BGRA 1VK0A 3OVNA 4TSXA 4HTUA 3MXIA 2ZE2A 3V9ZA 4KI6A 4N56A 1BISA 4AILC 4M42A 1D5AA 3SUNA 1CZBA 4B9MA 1U04A 3KLFA 2XO7A 3VQEA 4W5QA 2B5JA 1RT4A 3K2PA 1S1UA 2OZMA 3ISNC 1BI4B 1FKPA 4ICLA 3T3FA 4FJLA 1TV6A 1S5JA 3AVFA 4DU1A 3L3VA 4CIFA 3HPOA 3D0PA 4OKEA 4QCLA 1X9MA 4FZXC 3AA2A 4E7HA 1J54A 1RBTA 1GOAA 4M41A 3T19A 3K59A 3NCIA 3S3NA 2XHBA 1NOYA 3ZT0A 1FK9A 4E89A 3WNFA 4DU3A 4KRFA 1Q9YA 3SUPA 1DLOA 4AHVA 2JGUA 4IG3A 2A1RA 4BE0A 1G15A 4W5NA 1HRHA 1Q8IA 1I3AA 3CQ8A 2X78A 4E0DA 4KO0A 5FROA 3VA3A 3AVJA 1ZYQA 3TAQA 4KB0A 4FZZA 2X74A 3TAGA 1KVCA 1T8EA 4E1NA 1UOCA 3HO1A 2ZD1A 4C8OA 4CK1A 3LALA 3TABA 2HHSA 1LW2A 4KHWA 2Q3SA 3SUOA 1SL0A 4CJWA 5T7BA 3KK3A 3AO5A 3SPZA 2RKIA 4FLXA 5KGWA 3SV4A 3QIPA 3VA0A 5J2PA 3EY1A 1UA1A 4M3YA 3SJJA 1KTQA 3V9UA 5HLFA 4F2RA 2O4IA 4O5BA 4YNQA 4CEAA 2FBTA 5I3UA 1R0AA 1YTAA 3MEEA 5J2NA 5HRRA 2FBYA 3NF6A 4DTPA 4BWMA 4CHQA 1RDBA 2XRIA 4DQIA 2BDPA 4K8XA 4LH4A 5JS1A 3O3GA 1BQMA 4CFDA 4DTNA 2HHQA 3VQ7A 2I5JA 3P1GA 4RG8A 3ZSOA 3RR8A 5CZ1A 4KREA 4F2SA 1REVA 4FJGA 5EU7A 1U4BA 2P1JA 3MECA 3I8DA 3ITHA 1KLMA 3S9HA 1BQNA 3O3HA 2OYQA 3PV8A 1WSJA 4OGEA 1VSEA 3NF9A 3TAEA 1RCHA 3RRHA 4KHNA 4NYNA 2GUIA 1BIUA 2FC0A 4IBNA 3V81A 2QKBA 3OYBA 4B9VA 2A1SA 1C0UA 1U47A 3NDKA 4FM1A 1J5OA 3KK1A 1QTMA 1KFSA 1SUQA 3CM5A 2P5OA 4DG1A 1C6VA 3RMAA 4W5OA 1WSFA 1S9EA 1YT3A 2EX3A 4CFAA 1NK9A 3MEGA 3OYLA 4CF2A 4DTUA 2G8UA 2KZMA 2Y1IA 3LPUA 2X6NA 1C1BA 2HNZA 2YHBA 4KAZA 5DMRA 1GOCA 3RR7A 3C6TA 3QEVA 4ID1A 4O0JA 4EZ9A 1RBUA 3M8SA 4CIEA 3L2UA 2HHUA 3TAFA 3K5LA 2KFZA 2HHTA 3ZSZA 1ZBLA 1XHXA 3I0SA 1RT6A 1NKCA 4EP4A 4KTZA 3AVIA 4W5RA 3K5MA 4DSKA 2YNIA 1UA0A 3V9SA 3PX0A 1X1PA 3QLHA 5J2QA 2D0CA 3O4NA 1JLBA 3OYMA 1FKOA 3LANA 1WN7A 4BE2A 3E01A 4FLTA 4KPYA 1KFDA 2PYJA 3KKSA 1HYZA 4CJEA 2HNDA 4B8AB 1SV5A 3HP9A 4DLEA 1NK0A 3AVCA 3ZSXA 1DTTA 2HVHA 3SI6A 4CGFA 3QNNA 4DSLA 3SQ0A 3ULDA 1D8YA 3C94A 2X6SA 3SQ2A 2YHAA 3H08A 2F8SA 3ZSRA 1N6QA 4CJ5A 3L2QA 3AA4A 3M8QA 4JRQA 4NCGA 4OKJA 3DI6A 1LWEA 4CESA 3B6PA 3AVAA 4CGJA 4BDYA 4RW7A 2QKKA 3MXMA 3C6UA 4DTRA 1SKWA 1QS4A 3VQ5A 4E7JA 3UIQA 1Q9XA 3LZJA 2XY7A 4FK0A 1ZBFA 3L2VA 1VSFA 4M3TA 4CJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DRP A;  3IRX A;  3HM9 A;  1U49 A;  1X9S A;  1VSK A;  3TAM A;  4OLB A;  1RTH A;  5HP1 A;  4CJU A;  4UQG A;  4J2D A;  1EXQ A;  4LY7 A;  4M3X A;  2EHG A;  3F9K A;  1BHL A;  1KVB A;  4H4O A;  4CK2 A;  2YNG A;  2VWJ A;  4FLU A;  4NCB A;  4CHO A;  3RMD A;  3VN5 A;  4CED A;  1NJW A;  4Z0U A;  4CEO A;  1VSJ A;  3OS0 A;  3U3Y A;  4N76 A;  2XY6 A;  4E3S A;  3CYM A;  3NGY A;  1NJY A;  1KCF A;  4F8R A;  4CHP A;  1NK4 A;  1RT5 A;  3IAY A;  5CYQ A;  2FBX A;  1LAW A;  3ZSY A;  4OJR A;  3OYH A;  1D9D A;  5J2M A;  1VRT A;  1C1A A;  4AHR A;  3ZSQ A;  1IKX A;  1IO2 A;  1FXX A;  2WOM A;  2XY8 A;  3TAN A;  2VG7 A;  1L3V A;  3PY8 A;  1S6P A;  4CJR A;  1JLE A;  4ELV A;  1YVU A;  1WSG A;  3CFP A;  1W0H A;  3LDS A;  4ELU A;  2FBV A;  3OS2 A;  1KVA A;  3QO9 A;  4GMJ B;  3G10 A;  5K14 A;  1TKX A;  4EZ6 A;  1BCM A;  4FJH A;  3HST B;  1HQE A;  1QE1 A;  3V1O A;  1RT7 A;  4E7L A;  5I42 A;  4B9U A;  3AVH A;  4LD0 A;  2VWK A;  3JSM A;  1LAV A;  4DTJ A;  2RPI A;  2RN2 A;  4DS4 A;  5DK5 A;  2VG5 A;  4Z4G A;  1QHT A;  4FJX A;  5SZT A;  4CIG A;  1B9D A;  3OJS A;  3QEW A;  4CEF A;  3V4I A;  1WSE A;  2Z1I A;  3HVT A;  3OYN A;  3K58 A;  2G8H A;  1TL3 A;  1S1W A;  4NYF A;  3AVM A;  1RBV A;  4KI4 A;  4M3Z A;  4CEC A;  3AO2 A;  1SL1 A;  3L2W A;  2Z1G A;  3SYZ A;  3QET A;  2BE2 A;  5CY4 A;  4CGD A;  3AVG A;  3HVR A;  1RTJ A;  4F3O A;  1MU2 A;  1DTQ A;  1HNV A;  3HPH A;  5CYM A;  2D5R A;  4B9T A;  2AJQ A;  4FLW A;  3AA3 A;  3KLG A;  3IG1 A;  1JLG A;  4DFJ A;  1RDC A;  4FJM A;  3LP1 A;  4CJT A;  2XY5 A;  2YNF A;  4AHU A;  1J53 A;  3OYE A;  3TAR A;  3DLE A;  2HHW A;  1EET A;  2OPR A;  4AHC A;  3PX6 A;  1ITG A;  1I39 A;  3SQ4 A;  1L3U A;  1S1X A;  4CEQ A;  3PO4 A;  3AV9 A;  4FVM A;  1JXE A;  4IFY A;  3OYG A;  4DMN A;  4C8N A;  2HVI A;  3TWH A;  1IKW A;  1JKH A;  1RNH A;  3DLH A;  1RIL A;  1VSI A;  2Z1H A;  2BGG A;  1JLA A;  1RDD A;  2DFF A;  2IDO A;  2GV9 A;  3NH1 A;  4DSI A;  5KI6 A;  2HHX A;  3PUF A;  4XIU A;  2LSN A;  4KHS A;  3DLK A;  4E7I A;  2Y1J A;  4M45 A;  4JLH A;  4H4M A;  1RDA A;  1N5Y A;  3U3G A;  3OYK A;  4KHU A;  1RBS A;  1W9H A;  2F8T A;  3O3F A;  1VSD A;  4PQU A;  2DFH A;  3NFA A;  4M3R A;  3P83 D;  4WE1 A;  2ZQB A;  3HJF A;  2YKM A;  3EYZ A;  4DLG A;  1F21 A;  3NAE A;  3U6F A;  1ZBH A;  4KV8 A;  4CK3 A;  3IS9 A;  3DYA A;  3DRS A;  1ASU A;  3JYT A;  1NK8 A;  1TKD A;  4OGC A;  3AVK A;  1C0M A;  1EX4 A;  2IOC A;  1IH7 A;  5C25 A;  2JLE A;  3KLI A;  1IKY A;  3ZT4 A;  3V1Q A;  5JS2 A;  2DY4 A;  3DMJ A;  4DQR A;  4CJV A;  4DFM A;  4CJ4 A;  3NF7 A;  4Z4I A;  2D0B A;  3NHG A;  4DQQ A;  1ZBI A;  4Q0B A;  4ZTJ A;  4FJ9 A;  3M8P A;  4B08 A;  4HUG A;  1WNS A;  1JLC A;  2HNY A;  5HRP A;  3VQP A;  4F4K A;  4DS5 A;  3NH2 A;  4CER A;  1CXU A;  3MAQ A;  3LAK A;  3L8B A;  4IKF A;  5CZ2 A;  5J1E A;  1GOB A;  1RBR A;  1JLQ A;  1HJR A;  1NKB A;  1L3T A;  4HCB A;  3RMC A;  4HUF A;  4I2Q A;  2ITG A;  2NUB A;  1BIZ A;  3QNO A;  4M3W A;  1S9G A;  3ZCM A;  4B9S A;  2OPQ A;  4CGH A;  1ASW A;  3OS1 A;  3VQD A;  3RRG A;  4LH5 A;  4Z4E A;  2W42 A;  4OVL A;  1O1W A;  4IG0 A;  2G8K A;  2HHV A;  3O4Q A;  3LP3 A;  4I2P A;  4YFU A;  3SCX A;  1WAJ A;  1A5X A;  1BI4 A;  4DFK A;  3QEI A;  4FYD A;  3LWM A;  5HRO A;  5KRT A;  1RTD A;  2HB5 A;  1KLN A;  5FDL A;  1QQC A;  4MQ3 A;  1XC9 A;  4B3O A;  1BCO A;  4CEE A;  5HRS A;  3OYF A;  1ASV A;  2GBZ A;  4I9Q A;  3CG7 A;  4CJS A;  1CZ9 A;  1TVR A;  4DTX A;  2PZS A;  1T7P A;  5FRM A;  3ZT2 A;  1SKS A;  2KTQ A;  4CHZ A;  1JL2 A;  3KJV A;  2G8F A;  2OPS A;  3HP6 A;  1VSM A;  1S6Q A;  1WLJ A;  2B4J A;  1HQU A;  1VSH A;  4C8M A;  3QIN A;  1T05 A;  2IC3 A;  2YV0 X;  1A5V A;  4CFB A;  2IAJ A;  3F73 A;  2OZS A;  4B9L A;  3KD1 E;  4O44 A;  2BAN A;  5C24 A;  3THV A;  1ZBU A;  2ATQ A;  1HYV A;  2G8I A;  4ZTF A;  1SL2 A;  3NBP A;  3ZSV A;  1HNI A;  1L3S A;  4KB1 A;  3TR8 A;  1B9F A;  4OPJ A;  1S1V A;  1JLF A;  3ZSW A;  5HRN A;  4M3U A;  3LAM A;  2WON A;  1TAQ A;  4DQS A;  4FXD A;  3K5N A;  1QSY A;  1B92 A;  3QER A;  1NKE A;  4DSJ A;  1LWF A;  2DTU A;  3S3O A;  3QEP A;  4R5P A;  2RF2 A;  4CGG A;  1XHZ A;  3TAP A;  1JXB A;  3L3U A;  4DTS A;  4CGI A;  4Y1C A;  1KRP A;  5KGX A;  1HMV A;  3I0R A;  1TK0 A;  3AVN A;  3OYJ A;  3CFR A;  1X9W A;  4PWD A;  4ID5 A;  4CJQ A;  1HPZ A;  1UAX A;  3DLR A;  3DLG A;  4KTW A;  4Z4H A;  1A5W A;  3LZI A;  4B8C A;  3RMB A;  1CXQ A;  3ALY A;  4HVJ A;  4N5S A;  3NE6 A;  1TK5 A;  3NH0 A;  2DFE A;  2E4L A;  4FJJ A;  4Z4C A;  2G8W A;  3DOL A;  3SNN A;  4AHS A;  3P5J A;  3SPY A;  1NOZ A;  4F3T A;  3ZT1 A;  4CHY A;  4PY5 A;  1J9A A;  4CCH A;  3PX4 A;  1QSL A;  2IGI A;  3C95 A;  2P51 A;  3DRR A;  4AHT A;  3VQA A;  4FCY A;  3M8R A;  3T1A A;  4DQP A;  3NGI A;  4FJ8 A;  3V6D A;  1XI1 A;  4FK4 A;  1S1T A;  1EP4 A;  4I7F A;  1UWB A;  4DU4 A;  4DF8 A;  4HCC A;  4L8R B;  1C0T A;  1Z25 A;  3VQQ A;  1TK8 A;  2D0A A;  2HMI A;  1BGX T;  3VQ8 A;  4Z4F A;  2IS3 A;  3AO1 A;  4RW8 A;  2YKN A;  4FM2 A;  1QSS A;  1SKR A;  4KTQ A;  1WSH A;  3G0Z A;  3CM6 A;  3HYF A;  4PA1 A;  3HXM A;  4J2A A;  1VSL A;  1TAU A;  1D9F A;  4Q5V A;  2PY5 A;  2E6L A;  4LSN A;  2VG6 A;  1RT3 A;  3LP2 A;  3OYD A;  3DM2 A;  1LV5 A;  3DLB A;  4K8Z A;  3B6O A;  1T03 A;  3AA5 X;  3CFO A;  4IDK A;  2KQ2 A;  3HT3 A;  3FFI A;  1VRU A;  3HL8 A;  3SV3 A;  4CF1 A;  3DOK A;  4CJK A;  3SUQ A;  3QIO A;  4DTO A;  4OPK A;  2QXF A;  1EKE A;  4CJF A;  4BAC A;  1TKZ A;  4DFP A;  4QAG A;  3SZ2 A;  1RT1 A;  4BWJ A;  3VQ6 A;  4CEZ A;  4FJ5 A;  3KK2 A;  1NJZ A;  4KFB A;  4O0I A;  1KSP A;  4BE1 A;  4FJI A;  4E1M A;  1LW0 A;  3D45 A;  4B9N A;  4C8K A;  3RWU A;  1RT2 A;  4CJP A;  4CHN A;  4GVM A;  4FZY A;  2KFN A;  4H8K A;  3S3M A;  4N47 A;  5SWM A;  4O55 A;  3VQC A;  3BDP A;  2ETJ A;  3LWL A;  4CEB A;  1L5U A;  4LSL A;  3HK2 A;  4EP5 A;  1Z26 A;  5E41 A;  4Y1D A;  4CJ3 A;  3MED A;  4KHQ A;  2OA8 A;  4KHY A;  3KIO A;  4IFV A;  3QES A;  4NCA A;  3K5O A;  1JL1 A;  4FJN A;  3WNE A;  4AH9 A;  3L2R A;  3KKR A;  1TKT A;  4RW6 A;  4JS4 A;  4HHT A;  3KD5 E;  3NGZ A;  4FM0 A;  1TGO A;  3AO3 A;  4RW4 A;  3VQ4 A;  3WNG A;  1RTI A;  4CF0 A;  1YTU A;  3KLH A;  4JRP A;  4BDP A;  4FLV A;  5C42 A;  4O4G A;  3MXJ A;  3NF8 A;  3AVB A;  4E7K A;  1NK5 A;  4BDZ A;  3SQ1 A;  4FLZ A;  4DTM A;  2F96 A;  5HBM A;  5D3G A;  1TL1 A;  4RW9 A;  4JS5 A;  4DSF A;  1XWL A;  2G8V A;  2OPP A;  2PYL A;  4FW2 A;  3QEX A;  4ELT A;  3VQ9 A;  3OYI A;  4MFB A;  1IKV A;  3PO5 A;  4W5T A;  4J2E A;  3V9X A;  1NJX A;  1C1C A;  2E6M A;  3ASM A;  4J2B A;  2B6A A;  1BL3 A;  3A2F A;  1U45 A;  4G1Q A;  2YNH A;  4CE9 A;  4FLY A;  3TI0 A;  1U48 A;  3AO4 A;  4CF9 A;  1K6Y A;  2KW4 A;  3KLE A;  3KTQ A;  2QK9 A;  3V9W A;  3HPG A;  4OLA A;  3OYC A;  1WAF A;  2KZZ A;  4I9L A;  1HYS A;  4N41 A;  1Y97 A;  1IG9 A;  1CLQ A;  4OKK A;  3OY9 A;  3LPT A;  2R7Y A;  1LWC A;  3OJU A;  4C8L A;  4DF4 A;  5KRS A;  4QOZ B;  1WSI A;  4HUE A;  2HW3 A;  3OYA A;  4FJK A;  3WNH A;  3ZT3 A;  4CFC A;  3K57 A;  3EZ5 A;  2P5G A;  4FJ7 A;  4GW6 A;  4DSE A;  4E19 A;  5KTQ A;  2Z1J A;  2O4G A;  3RTV A;  3VQB A;  1NK7 A;  4PUO A;  4FW1 A;  3AVL A;  4CF8 A;  3LP0 A;  4ZHR A;  4DWI A;  4FK2 A;  5FRN A;  4KKO A;  3V1R A;  1NK6 A;  3BGR A;  1VK0 A;  3OVN A;  4TSX A;  4HTU A;  3MXI A;  2ZE2 A;  3V9Z A;  4KI6 A;  4N56 A;  1BIS A;  4AIL C;  4M42 A;  1D5A A;  3SUN A;  1CZB A;  4B9M A;  1U04 A;  3KLF A;  2XO7 A;  3VQE A;  4W5Q A;  2B5J A;  1RT4 A;  3K2P A;  1S1U A;  2OZM A;  3ISN C;  1BI4 B;  1FKP A;  4ICL A;  3T3F A;  4FJL A;  1TV6 A;  1S5J A;  3AVF A;  4DU1 A;  3L3V A;  4CIF A;  3HPO A;  3D0P A;  4OKE A;  4QCL A;  1X9M A;  4FZX C;  3AA2 A;  4E7H A;  1J54 A;  1RBT A;  1GOA A;  4M41 A;  3T19 A;  3K59 A;  3NCI A;  3S3N A;  2XHB A;  1NOY A;  3ZT0 A;  1FK9 A;  4E89 A;  3WNF A;  4DU3 A;  4KRF A;  1Q9Y A;  3SUP A;  1DLO A;  4AHV A;  2JGU A;  4IG3 A;  2A1R A;  4BE0 A;  1G15 A;  4W5N A;  1HRH A;  1Q8I A;  1I3A A;  3CQ8 A;  2X78 A;  4E0D A;  4KO0 A;  5FRO A;  3VA3 A;  3AVJ A;  1ZYQ A;  3TAQ A;  4KB0 A;  4FZZ A;  2X74 A;  3TAG A;  1KVC A;  1T8E A;  4E1N A;  1UOC A;  3HO1 A;  2ZD1 A;  4C8O A;  4CK1 A;  3LAL A;  3TAB A;  2HHS A;  1LW2 A;  4KHW A;  2Q3S A;  3SUO A;  1SL0 A;  4CJW A;  5T7B A;  3KK3 A;  3AO5 A;  3SPZ A;  2RKI A;  4FLX A;  5KGW A;  3SV4 A;  3QIP A;  3VA0 A;  5J2P A;  3EY1 A;  1UA1 A;  4M3Y A;  3SJJ A;  1KTQ A;  3V9U A;  5HLF A;  4F2R A;  2O4I A;  4O5B A;  4YNQ A;  4CEA A;  2FBT A;  5I3U A;  1R0A A;  1YTA A;  3MEE A;  5J2N A;  5HRR A;  2FBY A;  3NF6 A;  4DTP A;  4BWM A;  4CHQ A;  1RDB A;  2XRI A;  4DQI A;  2BDP A;  4K8X A;  4LH4 A;  5JS1 A;  3O3G A;  1BQM A;  4CFD A;  4DTN A;  2HHQ A;  3VQ7 A;  2I5J A;  3P1G A;  4RG8 A;  3ZSO A;  3RR8 A;  5CZ1 A;  4KRE A;  4F2S A;  1REV A;  4FJG A;  5EU7 A;  1U4B A;  2P1J A;  3MEC A;  3I8D A;  3ITH A;  1KLM A;  3S9H A;  1BQN A;  3O3H A;  2OYQ A;  3PV8 A;  1WSJ A;  4OGE A;  1VSE A;  3NF9 A;  3TAE A;  1RCH A;  3RRH A;  4KHN A;  4NYN A;  2GUI A;  1BIU A;  2FC0 A;  4IBN A;  3V81 A;  2QKB A;  3OYB A;  4B9V A;  2A1S A;  1C0U A;  1U47 A;  3NDK A;  4FM1 A;  1J5O A;  3KK1 A;  1QTM A;  1KFS A;  1SUQ A;  3CM5 A;  2P5O A;  4DG1 A;  1C6V A;  3RMA A;  4W5O A;  1WSF A;  1S9E A;  1YT3 A;  2EX3 A;  4CFA A;  1NK9 A;  3MEG A;  3OYL A;  4CF2 A;  4DTU A;  2G8U A;  2KZM A;  2Y1I A;  3LPU A;  2X6N A;  1C1B A;  2HNZ A;  2YHB A;  4KAZ A;  5DMR A;  1GOC A;  3RR7 A;  3C6T A;  3QEV A;  4ID1 A;  4O0J A;  4EZ9 A;  1RBU A;  3M8S A;  4CIE A;  3L2U A;  2HHU A;  3TAF A;  3K5L A;  2KFZ A;  2HHT A;  3ZSZ A;  1ZBL A;  1XHX A;  3I0S A;  1RT6 A;  1NKC A;  4EP4 A;  4KTZ A;  3AVI A;  4W5R A;  3K5M A;  4DSK A;  2YNI A;  1UA0 A;  3V9S A;  3PX0 A;  1X1P A;  3QLH A;  5J2Q A;  2D0C A;  3O4N A;  1JLB A;  3OYM A;  1FKO A;  3LAN A;  1WN7 A;  4BE2 A;  3E01 A;  4FLT A;  4KPY A;  1KFD A;  2PYJ A;  3KKS A;  1HYZ A;  4CJE A;  2HND A;  4B8A B;  1SV5 A;  3HP9 A;  4DLE A;  1NK0 A;  3AVC A;  3ZSX A;  1DTT A;  2HVH A;  3SI6 A;  4CGF A;  3QNN A;  4DSL A;  3SQ0 A;  3ULD A;  1D8Y A;  3C94 A;  2X6S A;  3SQ2 A;  2YHA A;  3H08 A;  2F8S A;  3ZSR A;  1N6Q A;  4CJ5 A;  3L2Q A;  3AA4 A;  3M8Q A;  4JRQ A;  4NCG A;  4OKJ A;  3DI6 A;  1LWE A;  4CES A;  3B6P A;  3AVA A;  4CGJ A;  4BDY A;  4RW7 A;  2QKK A;  3MXM A;  3C6U A;  4DTR A;  1SKW A;  1QS4 A;  3VQ5 A;  4E7J A;  3UIQ A;  1Q9X A;  3LZJ A;  2XY7 A;  4FK0 A;  1ZBF A;  3L2V A;  1VSF A;  4M3T A;  4CJL A; 
#chains in the Genus database with same CATH topology
 1X9S A;  1OH8 A;  4OLB A;  1BDG A;  5DM7 L;  5HP1 A;  4LY7 A;  4M3X A;  2EHG A;  3F9K A;  1KVB A;  2GWJ A;  4CK2 A;  2YNG A;  4XH4 A;  4NCB A;  1DT9 A;  4DV7 K;  4CHO A;  4CED A;  1T6C A;  4JI8 K;  3JXU A;  3NGY A;  5DM6 L;  4CZL A;  2QA4 N;  5J2M A;  3M1F A;  4AHR A;  1U2V A;  1IKX A;  1IO2 A;  2VG7 A;  3PY8 A;  4LFC K;  5EY4 A;  1WSG A;  4EAH D;  1W0H A;  3LDS A;  1TKX A;  4FJH A;  3HST B;  3VGK A;  2P9P B;  3R8E A;  3LDO A;  2RN2 A;  1KC8 O;  4DS4 A;  3LM2 A;  2VG5 A;  4CIG A;  1B9D A;  3R9P A;  4CEF A;  1S1W A;  4NYF A;  1BWF O;  1RBV A;  2YHX A;  1SL1 A;  3L2W A;  2Z1G A;  3CIP A;  3QET A;  4CGD A;  3AVG A;  3T1Y K;  4F3O A;  4FL9 A;  3GG4 A;  2AJQ A;  1HNV A;  1HX1 A;  2D5R A;  5BR9 A;  3THY B;  4CJT A;  3KZB A;  2YNF A;  1EET A;  3PX6 A;  4H5V A;  4AHC A;  1I39 A;  3G25 A;  5JIC A;  1VQO N;  3PO4 A;  3BUZ B;  3D2F B;  4JI6 K;  4UY8 O;  3MN5 A;  1RNH A;  2O8B A;  5KI6 A;  3PUF A;  4XIU A;  2ZJQ L;  3ZLJ A;  4DR2 K;  3OYK A;  1DGK N;  4C1N I;  1JCF A;  2E1Y A;  4PQU A;  4JKB A;  4WE1 A;  1RDU A;  3EYZ A;  1NGC A;  1ATN A;  3ID6 A;  1IH7 A;  5C25 A;  2JLE A;  3KLI A;  1BU6 O;  3V1Q A;  2DY4 A;  3ZYY X;  2YI1 A;  4DFM A;  3OBY A;  3NF7 A;  4JKC A;  4ZTJ A;  4O8K A;  3M8P A;  4B08 A;  2NRZ A;  5HRP A;  1IV0 A;  4WFA L;  4F4K A;  1CXU A;  4IKF A;  3LAK A;  5J1E A;  1GOB A;  1RBR A;  1NKB A;  3UB5 A;  1L3T A;  4A57 A;  4BQZ A;  3LDL A;  4HUF A;  2ITG A;  4M3W A;  1S9G A;  2FSN A;  2NRV A;  2QW9 A;  1VQ8 N;  3HRG A;  3VQD A;  4DV4 K;  3MWT A;  3RRG A;  4RCH A;  1YJN N;  4JKE A;  2G8K A;  4NXN K;  3VEV A;  3O1W A;  3SCX A;  3QEI A;  3CXC M;  1P90 A;  4JKG B;  1RTD A;  1XC9 A;  4MQ3 A;  1W97 L;  1ASV A;  1Z6R A;  2E5L K;  5FRM A;  3ZT2 A;  5B8H A;  3HP6 A;  1VSM A;  2B4J A;  4JKF A;  2YV0 X;  1A5V A;  3H3N O;  3SK3 A;  3FZK A;  4B9L A;  2BAN A;  5C24 A;  1ZBU A;  4B1Y B;  4ILJ A;  3CCM N;  4BRA A;  2YCH A;  1HNI A;  1S1V A;  1QVG M;  3ZSW A;  3PIP L;  4FXD A;  3K5N A;  1NKE A;  1YVN A;  5JLH A;  3QEP A;  2RF2 A;  1SS6 A;  4IZ9 A;  4MLE A;  5C0Y A;  3SAF A;  3EL2 A;  2KKZ A;  3AVN A;  3AY9 A;  3OA9 A;  4PWD A;  4CJQ A;  4KTW A;  1A5W A;  4B8C A;  5AQH A;  1QZ6 A;  3CC7 N;  3ALY A;  4HVJ A;  3THY A;  2W40 A;  3R1X A;  3CI5 A;  3NH0 A;  2E4L A;  4JI1 K;  4BRO A;  3T69 A;  4AHS A;  3P5J A;  3SPY A;  1NOZ A;  1J9A A;  3A5M C;  1IJJ A;  4LF8 K;  3S41 A;  1HKG A;  3VQA A;  4FCY A;  4NLB A;  5H1S Q;  4MDB A;  4I7F A;  1Z25 A;  3SJH A;  4WFN L;  1TK8 A;  1VQ6 N;  2HMI A;  1BGX T;  1I94 K;  4KTQ A;  2YHY A;  3H45 C;  4PA1 A;  1Z05 A;  4DR6 K;  3C0B A;  4Q5V A;  3W0L A;  1RT3 A;  2QEX N;  3OYD A;  3AA5 X;  3CFO A;  2KQ2 A;  2CH5 A;  3FFI A;  1VRU A;  3HL8 A;  3SV3 A;  4CF1 A;  3CC2 N;  3DOK A;  3JS6 A;  4IJN A;  2ZJP L;  3SUQ A;  1HR0 K;  4DFP A;  3FGU A;  4IWV A;  4CEZ A;  3N4P A;  3KK2 A;  4BRD A;  3CHW A;  1FW6 A;  4B9N A;  1X3M A;  2KFN A;  3HM8 A;  1CZA N;  4IDH A;  3VPZ A;  3S3M A;  4N47 A;  3BEX A;  3LWL A;  4AM6 A;  1YIT N;  1L5U A;  2JWK A;  4FPA A;  1Z26 A;  3QES A;  2I7N A;  1NMD A;  4AH9 A;  4CZG A;  3NGZ A;  4PL8 A;  3UKU B;  3VQ4 A;  3WEE B;  4BDP A;  3BZC A;  5C42 A;  3MXJ A;  3NF8 A;  4E7K A;  2F96 A;  5HBM A;  1TL1 A;  4RW9 A;  2PYL A;  2G8V A;  4ELT A;  3VQ9 A;  1C0F A;  1IKV A;  3PO5 A;  4MDA A;  2E6M A;  3ASM A;  5M1O A;  2B6A A;  4FWL A;  2YNH A;  4CE9 A;  2V7Y A;  5AZJ B;  3AO4 A;  3WXK A;  2WBN A;  3HOT A;  4OLA A;  3EEQ A;  3HPG A;  1WAF A;  1Q18 A;  4JKH A;  4OKK A;  1LWC A;  3OJU A;  3OHR A;  1WSI A;  4HUE A;  4BRM A;  1VQ9 N;  3ZT3 A;  4FJ7 A;  1NGE A;  3RTV A;  2O4G A;  3KK7 A;  4JI5 K;  3ATV A;  4CF8 A;  2E2Q A;  5FRN A;  3V1R A;  3BGR A;  4HTU A;  4MLH A;  5KPT A;  3CCE N;  4G9Z A;  4B9M A;  5E26 A;  1U04 A;  3T1H K;  3VQE A;  3L4Q A;  2B5J A;  3P38 A;  1RGI A;  3T3F A;  4ICL A;  1TV6 A;  3CF5 L;  3SLC A;  3DXK A;  1VQP N;  3AA2 A;  1J54 A;  1RBT A;  4V19 S;  1NGD A;  4IEE A;  3NCI A;  2XHB A;  4FWQ A;  1Q9Y A;  3SUP A;  1N32 K;  4BR9 A;  1XMO K;  1HRH A;  3J81 O;  4E0D A;  4KO0 A;  1ZYQ A;  4A2B A;  4FZZ A;  5AQQ A;  1T8E A;  1UOC A;  2ASM A;  3LAL A;  3M3Z A;  1SL0 A;  3E9O A;  1QQM A;  5KGW A;  3BZK A;  3SV4 A;  4FVU A;  5LY3 A;  1KTQ A;  2O4I A;  1GLE G;  4YNQ A;  2FBT A;  5I3U A;  1YTA A;  4B9S A;  4PKG A;  3SMP A;  4DTP A;  2UUA K;  3SAG A;  2QWR A;  2ZJR L;  4DTN A;  2I5J A;  2V7Z A;  3C6H A;  4KRE A;  3CJ7 A;  2HHH K;  2O8C A;  4BRH A;  1U4B A;  2P1J A;  4FOI A;  2HST A;  2UXD K;  3P4I A;  3MN9 A;  1NJI O;  1RCH A;  3RRH A;  4XH1 A;  4GKJ K;  3NDK A;  5AQL A;  3RMA A;  1WSF A;  2YX6 A;  3L4I A;  2EX3 A;  4CFA A;  4FOE A;  4CF2 A;  2Y1I A;  3LPU A;  3MX5 A;  3R6M A;  1GOC A;  1QQN A;  3C6T A;  2HHU A;  4EZ9 A;  1RBU A;  3L2U A;  4BR4 A;  3TAF A;  4LC9 B;  5C2F A;  3EN9 A;  1ZBL A;  3C65 A;  3K9J A;  2A6A A;  2O8E A;  3DLL L;  1X1P A;  3QLH A;  1OH6 A;  1JLB A;  3OYM A;  1FKO A;  3MN7 A;  5AZJ A;  3LDQ A;  5JMV A;  2PYJ A;  4IEI A;  3AVC A;  1WOQ A;  3R3L A;  1KAZ A;  4JI7 K;  4IO9 L;  5AFU H;  3AA4 A;  3B6P A;  3AVA A;  1S3X A;  4GVE A;  4K42 A;  1QS4 A;  5GAD P;  3LZJ A;  4MO4 A;  2XY7 A;  3L2V A;  4J2B A;  4M3T A;  3HM9 A;  4LF6 K;  1U49 A;  3EE9 A;  3M6G A;  3H1Q A;  1EXQ A;  4JHD A;  3SAH A;  3O80 A;  3HTV A;  3RMD A;  1NJW A;  4Z0U A;  3SMS A;  2CGK A;  4E3S A;  3A5L C;  4CHP A;  1NK4 A;  2OTJ N;  2EWS A;  3IAY A;  5CYQ A;  2FBX A;  1D9D A;  4LFA K;  3CD6 N;  3D2E B;  3PSF A;  5C2D A;  5GIO A;  1V4S A;  2XY8 A;  4CJR A;  1OVY A;  4J8F A;  1YVU A;  2E2N A;  2E88 A;  1ZXO A;  3QO9 A;  4GMJ B;  3G10 A;  4DV1 K;  1QE1 A;  5I42 A;  1RT7 A;  4B9U A;  3AVH A;  4LD0 A;  2VWK A;  4DTJ A;  5AQZ A;  5BRH A;  4CVN E;  2A40 A;  4DUY K;  3VEX A;  3OJS A;  2FSJ A;  3V4I A;  2Z1I A;  3HVT A;  4O8U A;  4KI4 A;  3AO2 A;  2QXL A;  2WFB A;  2GX9 A;  3SYZ A;  4GKK K;  2BE2 A;  5BPL A;  3HVR A;  5CYM A;  1MU2 A;  3HPH A;  5I9E B;  4FWK A;  3THX B;  4MO5 A;  3AA3 A;  1T44 A;  1JLG A;  4BRC A;  4JD2 B;  4FWM A;  1BG3 A;  5KPZ A;  1VHX A;  2HHW A;  3PLA A;  4I6M B;  4BRQ A;  2VWB A;  1Q82 O;  1JXE A;  4IFY A;  5BN8 A;  3Q7B A;  3MK6 A;  3ZEU A;  3TWH A;  1IKW A;  1K8K B;  1Q86 O;  2BGG A;  2IDO A;  3MDQ A;  1WBB A;  1OH7 A;  2VCP A;  4GV3 A;  2HHX A;  5KPR A;  4BR2 A;  3IUC A;  2Y1J A;  4M45 A;  3ID8 A;  4JLH A;  4AF1 A;  1W9H A;  2F8T A;  4CZK A;  2ZGY A;  3O3F A;  4GY2 B;  3O8M A;  1TYQ B;  2A42 A;  3NFA A;  3RSE A;  3J7Z O;  3HJF A;  5AQF A;  1WUA A;  4KV8 A;  5LL6 Z;  4CK3 A;  3DYA A;  1VQ5 N;  3JYT A;  4YOT A;  1EX4 A;  3CJ9 A;  4ILG B;  4ILH A;  5JS2 A;  2O8F B;  3DMJ A;  4DQR A;  4Q0B A;  4FJ9 A;  4HUG A;  2P9K B;  3MX2 A;  4KH6 A;  2NLX A;  2FSK A;  3ZET B;  3L8B A;  5CZ2 A;  4I2Q A;  5BRE A;  3L6Q A;  2NUB A;  4JI0 K;  3QNO A;  3DAW A;  4WQ5 A;  4CGH A;  1O13 A;  2F7T A;  4A62 A;  2ASO A;  4Z4E A;  1O1W A;  4YFU A;  1WAJ A;  5AZI B;  2RE2 A;  4H5T A;  1BI4 A;  4FYD A;  4JI3 K;  3U9D A;  3WT0 A;  1BCO A;  5HRS A;  5AQM A;  4BRK A;  4CJS A;  1CZ9 A;  2VYP A;  5EX5 A;  3VF4 A;  2PZS A;  3TSQ A;  1SKS A;  4CHZ A;  3OTO K;  1S6Q A;  4IO8 A;  1YJ9 N;  1QHA A;  1VSH A;  2IC3 A;  3F73 A;  2OZS A;  1QQO A;  4H0Y B;  2ATQ A;  3T7Z A;  2QWL A;  3UE5 A;  4ZTF A;  4LFB K;  4OPA A;  1M90 O;  3NBP A;  1XNR K;  3TR8 A;  1JLF A;  5HRN A;  1TAQ A;  4CZM A;  3ZX0 A;  3QER A;  1QSY A;  4DKW A;  3H6E A;  1JXB A;  2AA4 A;  3HI0 A;  1YUW A;  4XEI A;  5KGX A;  3OYJ A;  3CFR A;  5F1X A;  3LZI A;  4QS8 A;  4BC3 A;  4FWP A;  4JD2 A;  4WQ5 C;  4BR7 A;  3WQU A;  4H5W A;  5JVG L;  2J4R A;  3ZT1 A;  2P51 A;  2ASP A;  4DQ8 A;  4BRF A;  4DQP A;  4LF9 K;  4FJ8 A;  4FK4 A;  3NGI A;  4OPH A;  1XI1 A;  1EP4 A;  4DU4 A;  4DF8 A;  1K8K A;  4GNI A;  3VQQ A;  2HOE A;  2P9L A;  3CQX A;  4Z4F A;  4RW8 A;  3SBT A;  4FM2 A;  1SKR A;  2PY5 A;  3LP2 A;  3CMA N;  2OCE A;  1RDW X;  1TYQ A;  3IMX A;  2GEL A;  4YDU C;  3QIO A;  4BAC A;  1TKZ A;  4YY3 K;  4PL7 A;  1T6D A;  3VQ6 A;  4IFE A;  4KFB A;  4CJ7 A;  4O0I A;  1V4T A;  4BE1 A;  4FJI A;  2E2O A;  3RWU A;  2P9N B;  4C23 A;  4O55 A;  3BDP A;  3EZW A;  5LJW A;  2D1K A;  4CEB A;  4LSL A;  3B8A X;  5E41 A;  3EKU A;  4H5R A;  2I7P A;  2HF4 A;  3H3O B;  3MED A;  4NCA A;  4IFV A;  3K0S A;  3ZET A;  1IG8 A;  3KD5 E;  1TGO A;  4RW4 A;  3WNG A;  5KQ8 A;  5IWA K;  1RTI A;  4NO7 A;  4BQL A;  4FLV A;  4O4G A;  5A2Q O;  3AVB A;  1NK5 A;  4DTM A;  4DSF A;  1XWL A;  2OPP A;  4B3M K;  4MFB A;  3MMV A;  4J2E A;  5AZI A;  5TKY A;  2FXU A;  1NJX A;  3A5N C;  3A2F A;  5M1K A;  3TI0 A;  4CF9 A;  3KTQ A;  2QK9 A;  2GWK A;  4U7B A;  3OYC A;  4JNE A;  4N41 A;  1Y97 A;  1IG9 A;  5AQV A;  4IOC L;  4DF4 A;  2HW3 A;  3I33 A;  3E1Y A;  1NGB A;  3K57 A;  2P5G A;  3C7N B;  5FPE A;  4DSE A;  3FR0 A;  1NK7 A;  1N33 K;  4FW1 A;  4DWI A;  1SAZ A;  1NK6 A;  3FE1 A;  1VK0 A;  3OVN A;  4KI6 A;  2P9P A;  4XH5 A;  3V9Z A;  2A5X A;  3VF6 A;  1D5A A;  3Q7C A;  4DR5 K;  4AM7 A;  3KLF A;  5ADX H;  3AAR A;  4BVP A;  2Q36 A;  1K8A O;  4IOX A;  2AP1 A;  4DU1 A;  1NBW A;  3CCR N;  3QIC A;  1GLL O;  1VQ4 N;  5AQO A;  2Q0U A;  1X9M A;  4FZX C;  2Q31 A;  1GOA A;  4M41 A;  3VOV A;  4EFH A;  3CCJ N;  1ILY A;  3ZT0 A;  4DU3 A;  3WNF A;  1DLO A;  3AGR A;  3OBW A;  2A1R A;  4BE0 A;  1G15 A;  4W5N A;  2QWP A;  1I3A A;  4X62 K;  1BA0 A;  2X78 A;  4BC5 A;  4KB0 A;  1KVC A;  3HO1 A;  2D0O A;  2ZD1 A;  4C8O A;  1LW2 A;  2RKI A;  3D2F A;  3VA0 A;  3QIP A;  5J2P A;  1UA1 A;  3V9U A;  3O9T A;  1R0A A;  3GBT A;  3TTF A;  4CHQ A;  4K8X A;  4LH4 A;  2QWO A;  4EHT A;  4RG8 A;  4FWS A;  3DWL A;  1OKJ A;  1J5E K;  4DV5 K;  4FWN A;  1D4X A;  3I8D A;  4RTF D;  3ITH A;  2UU9 K;  3O6W A;  2ZF5 O;  2OYQ A;  4L3Q A;  1VSE A;  5LJV A;  2GUI A;  5LMN K;  3V81 A;  2BH1 A;  3SBG A;  2QKB A;  2A1S A;  2QTD A;  4FM1 A;  1J5O A;  1KFS A;  5AQS A;  4A5B A;  5FLX O;  1K73 O;  2KZM A;  4DTU A;  1C1B A;  3CER A;  4BVO A;  3QEV A;  4ID1 A;  4IJA A;  3K5L A;  1XHX A;  4B9Q A;  1RT6 A;  4DSK A;  3V9S A;  3PX0 A;  5FPD A;  4FLT A;  1MWK A;  4CJE A;  2HND A;  4B8A B;  1R59 O;  1SV5 A;  3HP9 A;  4JKG A;  1NK0 A;  2NRT A;  3ZSX A;  2P9I B;  1DTT A;  3SI6 A;  4DSL A;  3SQ0 A;  1D8Y A;  4C1N K;  1C0G A;  2OAN A;  2YHA A;  3H08 A;  3VTI A;  2F8S A;  4F9O A;  1N6Q A;  1EWQ A;  4NB4 A;  4OKJ A;  1LWE A;  1NGF A;  4CGJ A;  3BF1 A;  4BDY A;  4RW7 A;  3MXM A;  4NXM K;  3C6U A;  1SKW A;  3UIQ A;  3VQ5 A;  3NVK A;  5IT9 O;  4B1U B;  1VSF A;  4FSV A;  4CJL A;  1VSK A;  4YOY A;  2V52 B;  1MWM A;  5TKW A;  2VWJ A;  3VN5 A;  3QBW A;  1HPM A;  3OS0 A;  2IIR A;  3CYM A;  1NJY A;  4F8R A;  1KCF A;  1RT5 A;  2F9T A;  2BUP A;  3ZSY A;  4OJR A;  1VRT A;  2O8D B;  1C1A A;  3CPW M;  3ZSQ A;  1FXX A;  3TAN A;  2CH6 A;  2WOM A;  4ISE A;  3DXM B;  2WUS A;  1S6P A;  2KHO A;  4ELV A;  3CFP A;  2V51 B;  4ELU A;  2FBV A;  3ULE B;  3OS2 A;  1BCM A;  5M1P A;  4E7L A;  4BRG A;  5JLF A;  1YIJ N;  1LAV A;  4Z4G A;  4FJX A;  5AQK A;  1E3M A;  2Q2R A;  3QEW A;  1TL3 A;  2NNW A;  5CR4 A;  1J6Z A;  2NRW A;  1NMN A;  2W41 A;  3CPE A;  2YJF A;  1NGG A;  1ATS A;  1RTJ A;  1DTQ A;  4B9T A;  3FFK B;  1ZBS A;  1K9M O;  2P9U B;  4DFJ A;  1RDC A;  3EO3 A;  4FJM A;  3J8A A;  2XY5 A;  3DLE A;  1L3U A;  1S1X A;  4CEQ A;  3AV9 A;  4FVM A;  5BR8 K;  3OYG A;  4DMN A;  4CD3 A;  1QVF M;  5F0X A;  4C8N A;  3N4Q A;  1JLA A;  1RDD A;  2GV9 A;  2OTL N;  4DSI A;  3VEN A;  4B3S K;  4DB3 A;  3I55 N;  1FJG K;  2LSN A;  4RWT A;  3DLK A;  4E7I A;  1NLV A;  1N5Y A;  3U3G A;  3MCP A;  4B1X B;  2H3G X;  3UKU A;  4KHU A;  3WEE A;  2DFH A;  4M3R A;  3P83 D;  2WTU A;  2YKM A;  4JI4 K;  1NGA A;  1F21 A;  3NAE A;  3U6F A;  4LF5 K;  4A2A A;  1KAY A;  3DRS A;  4OGC A;  1C0M A;  2IOC A;  4U67 L;  4QS9 A;  1IKY A;  1EO1 A;  5AQP A;  3VER A;  3QBX A;  4Z4I A;  3NHG A;  2PFU A;  3CJB A;  1KD1 O;  2HNY A;  2A41 A;  3VQP A;  4B1W B;  4DS5 A;  3NH2 A;  1HJR A;  4HCB A;  1HLU A;  2HBM A;  3KWG A;  3ZCM A;  1HJO A;  4WF9 L;  3OS1 A;  5AQT A;  4LH5 A;  2W42 A;  4OVL A;  4BRN A;  4IG0 A;  5AQN A;  4X65 K;  4I2P A;  4DV2 K;  1A5X A;  2VQE K;  4ISF A;  3LWM A;  5HRO A;  2HB5 A;  1KLN A;  4JEP A;  4B3O A;  1HKC A;  4CEE A;  3CG7 A;  3J7Y P;  1TVR A;  4JK7 A;  4DTX A;  5M1Q A;  4H0V B;  2KTQ A;  1JL2 A;  3KJV A;  2OPS A;  4C8M A;  3QIN A;  4WQ4 C;  4CFB A;  3KD1 E;  1HNW K;  3THV A;  2NRH A;  2G8I A;  1SL2 A;  2FF3 B;  3ZX3 A;  3ZSV A;  1L3S A;  4KB1 A;  5AQR A;  5BRF A;  3VET A;  1W7A A;  2WON A;  4DQS A;  4R5P A;  4CGG A;  4BRL A;  3TAP A;  3IFR A;  3L3U A;  3C6A A;  4DTS A;  4CGI A;  4Y1C A;  3QFU A;  1KRP A;  1TK0 A;  1HMV A;  2PBD A;  4ID5 A;  1HPZ A;  1UAX A;  4BY9 C;  3RMB A;  1CXQ A;  4N5S A;  2QWM A;  3A0I X;  2DFE A;  4DHY A;  2E2P A;  4FJJ A;  4Z4C A;  2G8W A;  3TU5 A;  3DOL A;  5GIP A;  3SNN A;  5GAH P;  3CC4 N;  2ZGZ A;  1SZ2 A;  4H0X B;  4CHY A;  4PY5 A;  2IGI A;  3C95 A;  3DRR A;  1VAZ A;  4BGA A;  3M8R A;  4HCC A;  4L8R B;  1UWB A;  1C0T A;  1NGI A;  2NZT A;  3AAP A;  2IS3 A;  2YKN A;  3FZL A;  1WSH A;  2VGM A;  3CM6 A;  2CGL A;  3HXM A;  1TAU A;  1VSL A;  5FPN A;  4HWI A;  4AQY K;  3DM2 A;  1LV5 A;  3HOS A;  3G71 N;  4K8Z A;  4IDK A;  1GLC G;  4CJK A;  4OPK A;  2QXF A;  1EKE A;  4CJF A;  1W2B M;  4QAG A;  1RT1 A;  4FJ5 A;  2UXB K;  1KSP A;  3GOI A;  4C8K A;  1YHQ N;  1RT2 A;  3HSC A;  4FZY A;  4CZE A;  4H8K A;  1VQM N;  2FF6 A;  2ETJ A;  4IXC A;  1RFQ A;  1XNQ K;  4EP5 A;  2BTF A;  2QWQ A;  5MLC Q;  4HTL A;  4KHQ A;  2OA8 A;  4FJN A;  3L2R A;  4HHT A;  2D4W A;  1JCG A;  1Y64 A;  3CCL N;  2W6K A;  3AO3 A;  3BY5 A;  3KLH A;  3FZH A;  4FLZ A;  5D3G A;  1KAX A;  4OO1 J;  5AQJ A;  1ATR A;  1U45 A;  2IVN A;  4G1Q A;  1X3N A;  4BG9 A;  1K6Y A;  3HBT A;  4CBX A;  3O5B A;  1NGH A;  2KZZ A;  1KXP A;  1HUX A;  4I9L A;  1HYS A;  3KHY A;  1CLQ A;  4WFB L;  4JK8 A;  1N34 K;  2R7Y A;  3LPT A;  3CJ1 A;  4KH5 A;  3D2E A;  5KRS A;  4QOZ B;  1OH5 A;  4CFC A;  5AR0 A;  4GW6 A;  5KTQ A;  2Z1J A;  4PUO A;  3VQB A;  1YJW N;  3LDN A;  3AVL A;  3LP0 A;  4ZHR A;  4O5F A;  4K0K K;  4TSX A;  3MXI A;  1U6Z A;  2ZE2 A;  4AIL C;  1BIS A;  4M42 A;  1CZB A;  1KQS M;  1HNZ K;  3WQT A;  4W5Q A;  2OZM A;  1RT4 A;  2UXC K;  1IBM K;  4YDU A;  4BC2 A;  3WXM B;  1FKP A;  4M7X A;  4FJL A;  5C15 A;  4YOW A;  4OKE A;  3D6R A;  4QCL A;  3T19 A;  1NOY A;  4KRF A;  1FK9 A;  4PKH A;  2GUP A;  3THX A;  4AHV A;  4EHU A;  2JGU A;  4IG3 A;  3QB0 A;  3G6E N;  1Q8I A;  3CQ8 A;  3U9Z A;  1SQK A;  5FRO A;  3MN6 A;  3VA3 A;  2HBK A;  1OVQ A;  3TAQ A;  2X74 A;  3KWI A;  3TAG A;  3TSU A;  4I6M A;  4E1N A;  4CK1 A;  3TAB A;  1E4F T;  1M1K O;  4KHW A;  4CJW A;  5T7B A;  3KK3 A;  3AO5 A;  3EY1 A;  3A5O C;  4M3Y A;  3SJJ A;  5HLF A;  4O5B A;  5HOO A;  4CEA A;  4BRE A;  3MEE A;  5J2N A;  5HRR A;  3NF6 A;  5JS1 A;  1RDB A;  2XRI A;  4DQI A;  2BDP A;  4H5N A;  1BQM A;  4CFD A;  4DR3 K;  3P1G A;  3ZSO A;  3RR8 A;  4K25 A;  5CZ1 A;  3U8X A;  5M1F A;  4F2S A;  4JN4 A;  3BP8 A;  1XUP O;  1KLM A;  1BQN A;  3EE8 A;  4OGE A;  3NF9 A;  3TAE A;  2JWL A;  4FO0 A;  4NYN A;  1BIU A;  4A5A A;  3VGL A;  4B9V A;  1U47 A;  3VTH A;  1QTM A;  4KBO A;  1SUQ A;  3CM5 A;  2P5O A;  4DG1 A;  1HKB A;  2O8F A;  3CCQ N;  1C6V A;  1T3V A;  1TUY A;  2ZM6 K;  1YT3 A;  3LDP A;  1DEJ A;  2CGJ A;  4OX9 K;  2X6N A;  1YI2 N;  2HNZ A;  2P9K A;  3WXL A;  4O0J A;  3M8S A;  4CIE A;  3U4L A;  3FZF A;  4DV6 K;  2HHT A;  3ZSZ A;  3A8Y A;  5C12 A;  3I0S A;  4EP4 A;  4W5R A;  3K5M A;  3NMU A;  1ESV A;  1NGJ A;  5J2Q A;  1N8R O;  2D0C A;  3LM9 A;  3O4N A;  1QZ5 A;  4BE2 A;  3JAM O;  4KPY A;  1WN7 A;  1KFD A;  2QI2 A;  3KKS A;  1HYZ A;  2VQF K;  2FLO A;  4KHP K;  1YAG A;  2UYT A;  2WC9 A;  4JAX A;  4BG8 A;  2HVH A;  1LOT B;  3ULD A;  3C94 A;  2X6S A;  3SQ2 A;  4X66 K;  3W3D A;  2IVP A;  3L2Q A;  3M8Q A;  3GDQ A;  4NCG A;  3DI6 A;  3ENH A;  3GE1 A;  4DTR A;  2F4V K;  1S72 N;  4FK0 A;  1G99 A;  3DRP A;  3IRX A;  2HBJ A;  3TAM A;  3E9P A;  1RTH A;  1VQN N;  4CJU A;  4UQG A;  4B1Z A;  4BRI A;  4J2D A;  1MA9 B;  4H4O A;  1BHL A;  1NG9 A;  4FLU A;  4DUZ K;  3P31 A;  4H03 B;  2Q97 A;  4QS7 A;  4CEO A;  1VSJ A;  3AGK A;  3U3Y A;  2UUC K;  2XY6 A;  4N76 A;  5JVH L;  1LAW A;  4EIA A;  3OYH A;  1VQ7 N;  3VMF B;  4BR5 A;  4A59 A;  3TSP A;  1L3V A;  4A61 A;  1JLE A;  3G4S N;  3ZX2 A;  5AFU A;  1KVA A;  5K14 A;  4EZ6 A;  2QM1 A;  1HQE A;  3V1O A;  4H0T B;  1IBL K;  3JSM A;  2RPI A;  5DK5 A;  1ZC6 A;  1QHT A;  5SZT A;  5AQG A;  1WSE A;  3OYN A;  3K58 A;  2G8H A;  1Q81 O;  4DR7 K;  3AVM A;  3DXK B;  5AQU A;  4M3Z A;  4CEC A;  5AJ3 K;  1LCU A;  3M5R A;  5CY4 A;  1BA1 A;  1DKG D;  4FLW A;  2NRR A;  3KLG A;  3IG1 A;  5BPM A;  3LP1 A;  5M1N A;  1NU0 A;  4AHU A;  1J53 A;  3F5T A;  3OYE A;  3TAR A;  5C10 A;  2OPR A;  1ITG A;  3SQ4 A;  3VF2 A;  2P9N A;  3THW B;  4Z94 A;  3TTC A;  3P39 A;  4BRP A;  1JKH A;  3DLH A;  1RIL A;  1VSI A;  2Z1H A;  1HNX K;  2DFF A;  4FPB A;  3NH1 A;  5EVZ A;  4NLC A;  4KHS A;  1GLJ O;  4H4M A;  1RDA A;  1RBS A;  2O8C B;  1VSD A;  2E1Z A;  4JK9 A;  2A3Z A;  2ZQB A;  3ATU A;  4DLG A;  1ZBH A;  3IS9 A;  4YOV A;  1ASU A;  1NK8 A;  1N36 K;  1TKD A;  3AVK A;  3ZT4 A;  4DR4 K;  3CJC A;  4CJV A;  4CJ4 A;  2D0B A;  4R79 A;  4DQQ A;  1ZBI A;  4YOR A;  1WNS A;  1JLC A;  4CZH A;  4CER A;  3C7N A;  3MAQ A;  5GIN A;  1JLQ A;  3RMC A;  2O8E B;  1BIZ A;  1X9J A;  3O1B A;  1GLA G;  2OPQ A;  4YHH K;  1ASW A;  1NNE A;  3VES A;  2HHV A;  3O4Q A;  3LP3 A;  3FZM A;  4DFK A;  5GAE P;  3EKS A;  5KRT A;  5FDL A;  1QQC A;  2F9W A;  1VQL N;  3OYF A;  2GBZ A;  4I9Q A;  3CJA A;  1T7P A;  2G8F A;  3I8B A;  1WLJ A;  2KLA A;  1T05 A;  1HQU A;  1XC3 A;  4YOX A;  4YOU A;  2IAJ A;  1BOT O;  5AQI A;  4O44 A;  1HYV A;  3OW2 M;  3NVM A;  1B9F A;  4OPJ A;  4JHD B;  4M3U A;  3ENO A;  3LAM A;  2YHW A;  3UKR B;  1B92 A;  2D0P A;  4DSJ A;  1LWF A;  2DTU A;  3S3O A;  3WXJ A;  2GTD A;  3F2K A;  1XHZ A;  4GV6 A;  4BC4 A;  3CET A;  3DJC A;  3I0R A;  1X9W A;  4DCH A;  3DLR A;  3DLG A;  4Z4H A;  4KH4 A;  5FPM A;  3NE6 A;  1TK5 A;  3GL1 A;  4WCE L;  4F3T A;  4CCH A;  2NRX A;  3CQY A;  3PX4 A;  1QSL A;  3THW A;  4AHT A;  3T1A A;  3V6D A;  1S1T A;  3O4W A;  2D0A A;  2ITM A;  3VQ8 A;  3AO1 A;  1QSS A;  3G0Z A;  3HYF A;  4J2A A;  4JV5 K;  4IOA L;  1D9F A;  2E6L A;  3PIO L;  1BUP A;  4LSN A;  2UUB K;  2VG6 A;  3DLB A;  3FLC O;  3B6O A;  1T03 A;  3HT3 A;  3VEW A;  3CCU N;  4DTO A;  4BGB A;  3CCV N;  3SZ2 A;  4BWJ A;  1NJZ A;  1E4G T;  2HBL A;  3QML A;  4E1M A;  1LW0 A;  3D45 A;  4CJP A;  4CHN A;  4GVM A;  4PHT X;  3CCS N;  4WQ4 A;  3O08 A;  5SWM A;  3VQC A;  3ZEU B;  4B3T K;  2GEM A;  3LL3 A;  3H46 O;  2P9S B;  2P9I A;  3MCA B;  5F2R A;  4CD1 A;  3HK2 A;  4Y1D A;  4CJ3 A;  3J80 O;  4KHY A;  3KIO A;  3K5O A;  3TPQ A;  1JL1 A;  5BN9 A;  3WNE A;  3KKR A;  1TKT A;  2Q0R A;  4RW6 A;  4JS4 A;  4M63 C;  4FM0 A;  4CF0 A;  1NM1 A;  1YTU A;  4JRP A;  3RSE B;  4BDZ A;  3SQ1 A;  4E1J A;  1H1V A;  4JS5 A;  5EXW A;  4FW2 A;  3QEX A;  3OYI A;  2IVO A;  4W5T A;  3V9X A;  5GAG P;  1C1C A;  1BL3 A;  3IDH A;  5AQW A;  4FLY A;  5KQD A;  2W6L A;  1U48 A;  3AAQ A;  2KW4 A;  3KLE A;  3WXI A;  3V9W A;  3O9S A;  3O9U A;  3OY9 A;  2ZWH A;  5BPN A;  4C8L A;  1MDU B;  2O8D A;  2HMP A;  1NWK A;  3BF3 A;  4CBW A;  3OYA A;  3WNH A;  4FJK A;  2RHK A;  3DXM A;  3EZ5 A;  4E19 A;  3ULE A;  1YF5 L;  5BRD A;  4FK2 A;  4KKO A;  5EOY A;  4N56 A;  4FWO A;  5AQX A;  2YJE A;  3SUN A;  3UKR A;  4CZJ A;  4K41 A;  2XO7 A;  4CZF A;  2DPN A;  3K2P A;  1S1U A;  4FWR A;  3QFP A;  3ISN C;  1BI4 B;  1VQK N;  1S5J A;  3AVF A;  3L3V A;  4CIF A;  3HPO A;  3D0P A;  3VEY A;  3MWP A;  4E7H A;  3O9R A;  5CHI A;  3CME N;  3K59 A;  1EQY A;  3S3N A;  2E8A A;  3F9M A;  4E89 A;  5HL7 L;  4X64 K;  2E20 A;  1U2V B;  3PSI A;  2P9U A;  4ISG A;  3WUH A;  2PAV A;  2VGN A;  5ELZ A;  3AVJ A;  2Q1N A;  2HHS A;  5E84 A;  1GLF O;  2Q3S A;  4JKA A;  3SUO A;  3SPZ A;  1GLD G;  4FLX A;  3O9Q A;  1BO5 O;  3J7A P;  1WBD A;  4F2R A;  2HF3 A;  1P8Z A;  5ADX A;  3E66 A;  2FBY A;  4WYB A;  4BWM A;  1EWR A;  3O3G A;  2HHQ A;  3VQ7 A;  4LF4 K;  1REV A;  4FJG A;  1YXQ A;  3ENB A;  5EU7 A;  1WB9 A;  3MEC A;  3S9H A;  4CBU A;  3O3H A;  3PV8 A;  1WSJ A;  3H1V X;  4KHN A;  4DR1 K;  1XQS C;  2FC0 A;  4IBN A;  5CE3 A;  3OYB A;  1C0U A;  3VGM A;  3KK1 A;  2P9S A;  3QDK A;  2P9L B;  3TTD A;  4CI6 A;  1IBK K;  1JJ2 M;  4W5O A;  1S9E A;  1NK9 A;  2O8B B;  2G8U A;  3MEG A;  3OYL A;  2YHB A;  4KAZ A;  5DMR A;  4B1V A;  3RR7 A;  4M7Y A;  4LF7 K;  4B3R K;  3I56 N;  2KFZ A;  1JCE A;  1NKC A;  4KTZ A;  3AVI A;  4CW7 B;  2YNI A;  3L0Q A;  1UA0 A;  4PKI A;  4CZI A;  3K9K A;  4H0P A;  1TUU A;  2HVI A;  3LAN A;  4BR0 A;  3E01 A;  1XMQ K;  4K43 A;  4DV3 K;  1S22 A;  3KVG A;  4DLE A;  3HZ6 A;  4Y0W A;  4JKD A;  3D7E O;  4CGF A;  3QNN A;  3IKM A;  5AQY A;  1GLB G;  4JYA K;  3VEO A;  3ZSR A;  4GV9 A;  3RVC A;  4CJ5 A;  4JRQ A;  4DV0 K;  4CES A;  3VEZ A;  5LMU K;  2QKK A;  1Q7Y O;  4E7J A;  1Q9X A;  4H0O A;  4JI2 K;  1ZBF A;  2QWN A;  3E9L A; 
#chains in the Genus database with same CATH homology
 3DRP A;  3IRX A;  3HM9 A;  1U49 A;  1X9S A;  1VSK A;  3TAM A;  4OLB A;  1RTH A;  5HP1 A;  4CJU A;  4UQG A;  4J2D A;  1EXQ A;  4LY7 A;  4M3X A;  2EHG A;  3F9K A;  1BHL A;  1KVB A;  4H4O A;  4CK2 A;  2YNG A;  2VWJ A;  4FLU A;  4NCB A;  4CHO A;  3RMD A;  3VN5 A;  4CED A;  1NJW A;  4Z0U A;  4CEO A;  1VSJ A;  3OS0 A;  3U3Y A;  4N76 A;  2XY6 A;  4E3S A;  3CYM A;  3NGY A;  1NJY A;  1KCF A;  4F8R A;  4CHP A;  1NK4 A;  1RT5 A;  3IAY A;  5CYQ A;  2FBX A;  1LAW A;  3ZSY A;  4OJR A;  3OYH A;  1D9D A;  5J2M A;  1VRT A;  1C1A A;  4AHR A;  3ZSQ A;  1IKX A;  1IO2 A;  1FXX A;  2WOM A;  2XY8 A;  3TAN A;  2VG7 A;  1L3V A;  3PY8 A;  1S6P A;  4CJR A;  1JLE A;  4ELV A;  1YVU A;  1WSG A;  3CFP A;  1W0H A;  3LDS A;  4ELU A;  2FBV A;  3OS2 A;  1KVA A;  3QO9 A;  4GMJ B;  3G10 A;  5K14 A;  1TKX A;  4EZ6 A;  1BCM A;  4FJH A;  3HST B;  1HQE A;  1QE1 A;  3V1O A;  1RT7 A;  4E7L A;  5I42 A;  4B9U A;  3AVH A;  4LD0 A;  2VWK A;  3JSM A;  1LAV A;  4DTJ A;  2RPI A;  2RN2 A;  4DS4 A;  5DK5 A;  2VG5 A;  4Z4G A;  1QHT A;  4FJX A;  5SZT A;  4CIG A;  1B9D A;  3OJS A;  3QEW A;  4CEF A;  3V4I A;  1WSE A;  2Z1I A;  3HVT A;  3OYN A;  3K58 A;  2G8H A;  1TL3 A;  1S1W A;  4NYF A;  3AVM A;  1RBV A;  4KI4 A;  4M3Z A;  4CEC A;  3AO2 A;  1SL1 A;  3L2W A;  2Z1G A;  3SYZ A;  3QET A;  2BE2 A;  5CY4 A;  4CGD A;  3AVG A;  3HVR A;  1RTJ A;  4F3O A;  1MU2 A;  1DTQ A;  1HNV A;  3HPH A;  5CYM A;  2D5R A;  4B9T A;  2AJQ A;  4FLW A;  3AA3 A;  3KLG A;  3IG1 A;  1JLG A;  4DFJ A;  1RDC A;  4FJM A;  3LP1 A;  4CJT A;  2XY5 A;  2YNF A;  4AHU A;  1J53 A;  3OYE A;  3TAR A;  3DLE A;  2HHW A;  1EET A;  2OPR A;  4AHC A;  3PX6 A;  1ITG A;  1I39 A;  3SQ4 A;  1L3U A;  1S1X A;  4CEQ A;  3PO4 A;  3AV9 A;  4FVM A;  1JXE A;  4IFY A;  3OYG A;  4DMN A;  4C8N A;  2HVI A;  3TWH A;  1IKW A;  1JKH A;  1RNH A;  3DLH A;  1RIL A;  1VSI A;  2Z1H A;  2BGG A;  1JLA A;  1RDD A;  2DFF A;  2IDO A;  2GV9 A;  3NH1 A;  4DSI A;  5KI6 A;  2HHX A;  3PUF A;  4XIU A;  2LSN A;  4KHS A;  3DLK A;  4E7I A;  2Y1J A;  4M45 A;  4JLH A;  4H4M A;  1RDA A;  1N5Y A;  3U3G A;  3OYK A;  4KHU A;  1RBS A;  1W9H A;  2F8T A;  3O3F A;  1VSD A;  4PQU A;  2DFH A;  3NFA A;  4M3R A;  3P83 D;  4WE1 A;  2ZQB A;  3HJF A;  2YKM A;  3EYZ A;  4DLG A;  1F21 A;  3NAE A;  3U6F A;  1ZBH A;  4KV8 A;  4CK3 A;  3IS9 A;  3DYA A;  3DRS A;  1ASU A;  3JYT A;  1NK8 A;  1TKD A;  4OGC A;  3AVK A;  1C0M A;  1EX4 A;  2IOC A;  1IH7 A;  5C25 A;  2JLE A;  3KLI A;  1IKY A;  3ZT4 A;  3V1Q A;  5JS2 A;  2DY4 A;  3DMJ A;  4DQR A;  4CJV A;  4DFM A;  4CJ4 A;  3NF7 A;  4Z4I A;  2D0B A;  3NHG A;  4DQQ A;  1ZBI A;  4Q0B A;  4ZTJ A;  4FJ9 A;  3M8P A;  4B08 A;  4HUG A;  1WNS A;  1JLC A;  2HNY A;  5HRP A;  3VQP A;  4F4K A;  4DS5 A;  3NH2 A;  4CER A;  1CXU A;  3MAQ A;  3LAK A;  3L8B A;  4IKF A;  5CZ2 A;  5J1E A;  1GOB A;  1RBR A;  1JLQ A;  1HJR A;  1NKB A;  1L3T A;  4HCB A;  3RMC A;  4HUF A;  4I2Q A;  2ITG A;  2NUB A;  1BIZ A;  3QNO A;  4M3W A;  1S9G A;  3ZCM A;  4B9S A;  2OPQ A;  4CGH A;  1ASW A;  3OS1 A;  3VQD A;  3RRG A;  4LH5 A;  4Z4E A;  2W42 A;  4OVL A;  1O1W A;  4IG0 A;  2G8K A;  2HHV A;  3O4Q A;  3LP3 A;  4I2P A;  4YFU A;  3SCX A;  1WAJ A;  1A5X A;  1BI4 A;  4DFK A;  3QEI A;  4FYD A;  3LWM A;  5HRO A;  5KRT A;  1RTD A;  2HB5 A;  1KLN A;  5FDL A;  1QQC A;  4MQ3 A;  1XC9 A;  4B3O A;  1BCO A;  4CEE A;  5HRS A;  3OYF A;  1ASV A;  2GBZ A;  4I9Q A;  3CG7 A;  4CJS A;  1CZ9 A;  1TVR A;  4DTX A;  2PZS A;  1T7P A;  5FRM A;  3ZT2 A;  1SKS A;  2KTQ A;  4CHZ A;  1JL2 A;  3KJV A;  2G8F A;  2OPS A;  3HP6 A;  1VSM A;  1S6Q A;  1WLJ A;  2B4J A;  1HQU A;  1VSH A;  4C8M A;  3QIN A;  1T05 A;  2IC3 A;  2YV0 X;  1A5V A;  4CFB A;  2IAJ A;  3F73 A;  2OZS A;  4B9L A;  3KD1 E;  4O44 A;  2BAN A;  5C24 A;  3THV A;  1ZBU A;  2ATQ A;  1HYV A;  2G8I A;  4ZTF A;  1SL2 A;  3NBP A;  3ZSV A;  1HNI A;  1L3S A;  4KB1 A;  3TR8 A;  1B9F A;  4OPJ A;  1S1V A;  1JLF A;  3ZSW A;  5HRN A;  4M3U A;  3LAM A;  2WON A;  1TAQ A;  4DQS A;  4FXD A;  3K5N A;  1QSY A;  1B92 A;  3QER A;  1NKE A;  4DSJ A;  1LWF A;  2DTU A;  3S3O A;  3QEP A;  4R5P A;  2RF2 A;  4CGG A;  1XHZ A;  3TAP A;  1JXB A;  3L3U A;  4DTS A;  4CGI A;  4Y1C A;  1KRP A;  5KGX A;  1HMV A;  3I0R A;  1TK0 A;  3AVN A;  3OYJ A;  3CFR A;  1X9W A;  4PWD A;  4ID5 A;  4CJQ A;  1HPZ A;  1UAX A;  3DLR A;  3DLG A;  4KTW A;  4Z4H A;  1A5W A;  3LZI A;  4B8C A;  3RMB A;  1CXQ A;  3ALY A;  4HVJ A;  4N5S A;  3NE6 A;  1TK5 A;  3NH0 A;  2DFE A;  2E4L A;  4FJJ A;  4Z4C A;  2G8W A;  3DOL A;  3SNN A;  4AHS A;  3P5J A;  3SPY A;  1NOZ A;  4F3T A;  3ZT1 A;  4CHY A;  4PY5 A;  1J9A A;  4CCH A;  3PX4 A;  1QSL A;  2IGI A;  3C95 A;  2P51 A;  3DRR A;  4AHT A;  3VQA A;  4FCY A;  3M8R A;  3T1A A;  4DQP A;  3NGI A;  4FJ8 A;  3V6D A;  1XI1 A;  4FK4 A;  1S1T A;  1EP4 A;  4I7F A;  1UWB A;  4DU4 A;  4DF8 A;  4HCC A;  4L8R B;  1C0T A;  1Z25 A;  3VQQ A;  1TK8 A;  2D0A A;  2HMI A;  1BGX T;  3VQ8 A;  4Z4F A;  2IS3 A;  3AO1 A;  4RW8 A;  2YKN A;  4FM2 A;  1QSS A;  1SKR A;  4KTQ A;  1WSH A;  3G0Z A;  3CM6 A;  3HYF A;  4PA1 A;  3HXM A;  4J2A A;  1VSL A;  1TAU A;  1D9F A;  4Q5V A;  2PY5 A;  2E6L A;  4LSN A;  2VG6 A;  1RT3 A;  3LP2 A;  3OYD A;  3DM2 A;  1LV5 A;  3DLB A;  4K8Z A;  3B6O A;  1T03 A;  3AA5 X;  3CFO A;  4IDK A;  2KQ2 A;  3HT3 A;  3FFI A;  1VRU A;  3HL8 A;  3SV3 A;  4CF1 A;  3DOK A;  4CJK A;  3SUQ A;  3QIO A;  4DTO A;  4OPK A;  2QXF A;  1EKE A;  4CJF A;  4BAC A;  1TKZ A;  4DFP A;  4QAG A;  3SZ2 A;  1RT1 A;  4BWJ A;  3VQ6 A;  4CEZ A;  4FJ5 A;  3KK2 A;  1NJZ A;  4KFB A;  4O0I A;  1KSP A;  4BE1 A;  4FJI A;  4E1M A;  1LW0 A;  3D45 A;  4B9N A;  4C8K A;  3RWU A;  1RT2 A;  4CJP A;  4CHN A;  4GVM A;  4FZY A;  2KFN A;  4H8K A;  3S3M A;  4N47 A;  5SWM A;  4O55 A;  3VQC A;  3BDP A;  2ETJ A;  3LWL A;  4CEB A;  1L5U A;  4LSL A;  3HK2 A;  4EP5 A;  1Z26 A;  5E41 A;  4Y1D A;  4CJ3 A;  3MED A;  4KHQ A;  2OA8 A;  4KHY A;  3KIO A;  4IFV A;  3QES A;  4NCA A;  3K5O A;  1JL1 A;  4FJN A;  3WNE A;  4AH9 A;  3L2R A;  3KKR A;  1TKT A;  4RW6 A;  4JS4 A;  4HHT A;  3KD5 E;  3NGZ A;  4FM0 A;  1TGO A;  3AO3 A;  4RW4 A;  3VQ4 A;  3WNG A;  1RTI A;  4CF0 A;  1YTU A;  3KLH A;  4JRP A;  4BDP A;  4FLV A;  5C42 A;  4O4G A;  3MXJ A;  3NF8 A;  3AVB A;  4E7K A;  1NK5 A;  4BDZ A;  3SQ1 A;  4FLZ A;  4DTM A;  2F96 A;  5HBM A;  5D3G A;  1TL1 A;  4RW9 A;  4JS5 A;  4DSF A;  1XWL A;  2G8V A;  2OPP A;  2PYL A;  4FW2 A;  3QEX A;  4ELT A;  3VQ9 A;  3OYI A;  4MFB A;  1IKV A;  3PO5 A;  4W5T A;  4J2E A;  3V9X A;  1NJX A;  1C1C A;  2E6M A;  3ASM A;  4J2B A;  2B6A A;  1BL3 A;  3A2F A;  1U45 A;  4G1Q A;  2YNH A;  4CE9 A;  4FLY A;  3TI0 A;  1U48 A;  3AO4 A;  4CF9 A;  1K6Y A;  2KW4 A;  3KLE A;  3KTQ A;  2QK9 A;  3V9W A;  3HPG A;  4OLA A;  3OYC A;  1WAF A;  2KZZ A;  4I9L A;  1HYS A;  4N41 A;  1Y97 A;  1IG9 A;  1CLQ A;  4OKK A;  3OY9 A;  3LPT A;  2R7Y A;  1LWC A;  3OJU A;  4C8L A;  4DF4 A;  5KRS A;  4QOZ B;  1WSI A;  4HUE A;  2HW3 A;  3OYA A;  4FJK A;  3WNH A;  3ZT3 A;  4CFC A;  3K57 A;  3EZ5 A;  2P5G A;  4FJ7 A;  4GW6 A;  4DSE A;  4E19 A;  5KTQ A;  2Z1J A;  2O4G A;  3RTV A;  3VQB A;  1NK7 A;  4PUO A;  4FW1 A;  3AVL A;  4CF8 A;  3LP0 A;  4ZHR A;  4DWI A;  4FK2 A;  5FRN A;  4KKO A;  3V1R A;  1NK6 A;  3BGR A;  1VK0 A;  3OVN A;  4TSX A;  4HTU A;  3MXI A;  2ZE2 A;  3V9Z A;  4KI6 A;  4N56 A;  1BIS A;  4AIL C;  4M42 A;  1D5A A;  3SUN A;  1CZB A;  4B9M A;  1U04 A;  3KLF A;  2XO7 A;  3VQE A;  4W5Q A;  2B5J A;  1RT4 A;  3K2P A;  1S1U A;  2OZM A;  3ISN C;  1BI4 B;  1FKP A;  4ICL A;  3T3F A;  4FJL A;  1TV6 A;  1S5J A;  3AVF A;  4DU1 A;  3L3V A;  4CIF A;  3HPO A;  3D0P A;  4OKE A;  4QCL A;  1X9M A;  4FZX C;  3AA2 A;  4E7H A;  1J54 A;  1RBT A;  1GOA A;  4M41 A;  3T19 A;  3K59 A;  3NCI A;  3S3N A;  2XHB A;  1NOY A;  3ZT0 A;  1FK9 A;  4E89 A;  3WNF A;  4DU3 A;  4KRF A;  1Q9Y A;  3SUP A;  1DLO A;  4AHV A;  2JGU A;  4IG3 A;  2A1R A;  4BE0 A;  1G15 A;  4W5N A;  1HRH A;  1Q8I A;  1I3A A;  3CQ8 A;  2X78 A;  4E0D A;  4KO0 A;  5FRO A;  3VA3 A;  3AVJ A;  1ZYQ A;  3TAQ A;  4KB0 A;  4FZZ A;  2X74 A;  3TAG A;  1KVC A;  1T8E A;  4E1N A;  1UOC A;  3HO1 A;  2ZD1 A;  4C8O A;  4CK1 A;  3LAL A;  3TAB A;  2HHS A;  1LW2 A;  4KHW A;  2Q3S A;  3SUO A;  1SL0 A;  4CJW A;  5T7B A;  3KK3 A;  3AO5 A;  3SPZ A;  2RKI A;  4FLX A;  5KGW A;  3SV4 A;  3QIP A;  3VA0 A;  5J2P A;  3EY1 A;  1UA1 A;  4M3Y A;  3SJJ A;  1KTQ A;  3V9U A;  5HLF A;  4F2R A;  2O4I A;  4O5B A;  4YNQ A;  4CEA A;  2FBT A;  5I3U A;  1R0A A;  1YTA A;  3MEE A;  5J2N A;  5HRR A;  2FBY A;  3NF6 A;  4DTP A;  4BWM A;  4CHQ A;  1RDB A;  2XRI A;  4DQI A;  2BDP A;  4K8X A;  4LH4 A;  5JS1 A;  3O3G A;  1BQM A;  4CFD A;  4DTN A;  2HHQ A;  3VQ7 A;  2I5J A;  3P1G A;  4RG8 A;  3ZSO A;  3RR8 A;  5CZ1 A;  4KRE A;  4F2S A;  1REV A;  4FJG A;  5EU7 A;  1U4B A;  2P1J A;  3MEC A;  3I8D A;  3ITH A;  1KLM A;  3S9H A;  1BQN A;  3O3H A;  2OYQ A;  3PV8 A;  1WSJ A;  4OGE A;  1VSE A;  3NF9 A;  3TAE A;  1RCH A;  3RRH A;  4KHN A;  4NYN A;  2GUI A;  1BIU A;  2FC0 A;  4IBN A;  3V81 A;  2QKB A;  3OYB A;  4B9V A;  2A1S A;  1C0U A;  1U47 A;  3NDK A;  4FM1 A;  1J5O A;  3KK1 A;  1QTM A;  1KFS A;  1SUQ A;  3CM5 A;  2P5O A;  4DG1 A;  1C6V A;  3RMA A;  4W5O A;  1WSF A;  1S9E A;  1YT3 A;  2EX3 A;  4CFA A;  1NK9 A;  3MEG A;  3OYL A;  4CF2 A;  4DTU A;  2G8U A;  2KZM A;  2Y1I A;  3LPU A;  2X6N A;  1C1B A;  2HNZ A;  2YHB A;  4KAZ A;  5DMR A;  1GOC A;  3RR7 A;  3C6T A;  3QEV A;  4ID1 A;  4O0J A;  4EZ9 A;  1RBU A;  3M8S A;  4CIE A;  3L2U A;  2HHU A;  3TAF A;  3K5L A;  2KFZ A;  2HHT A;  3ZSZ A;  1ZBL A;  1XHX A;  3I0S A;  1RT6 A;  1NKC A;  4EP4 A;  4KTZ A;  3AVI A;  4W5R A;  3K5M A;  4DSK A;  2YNI A;  1UA0 A;  3V9S A;  3PX0 A;  1X1P A;  3QLH A;  5J2Q A;  2D0C A;  3O4N A;  1JLB A;  3OYM A;  1FKO A;  3LAN A;  1WN7 A;  4BE2 A;  3E01 A;  4FLT A;  4KPY A;  1KFD A;  2PYJ A;  3KKS A;  1HYZ A;  4CJE A;  2HND A;  4B8A B;  1SV5 A;  3HP9 A;  4DLE A;  1NK0 A;  3AVC A;  3ZSX A;  1DTT A;  2HVH A;  3SI6 A;  4CGF A;  3QNN A;  4DSL A;  3SQ0 A;  3ULD A;  1D8Y A;  3C94 A;  2X6S A;  3SQ2 A;  2YHA A;  3H08 A;  2F8S A;  3ZSR A;  1N6Q A;  4CJ5 A;  3L2Q A;  3AA4 A;  3M8Q A;  4JRQ A;  4NCG A;  4OKJ A;  3DI6 A;  1LWE A;  4CES A;  3B6P A;  3AVA A;  4CGJ A;  4BDY A;  4RW7 A;  2QKK A;  3MXM A;  3C6U A;  4DTR A;  1SKW A;  1QS4 A;  3VQ5 A;  4E7J A;  3UIQ A;  1Q9X A;  3LZJ A;  2XY7 A;  4FK0 A;  1ZBF A;  3L2V A;  1VSF A;  4M3T A;  4CJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...