1CXUA

1.42a resolution asv integrase core domain from citrate
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
143
structure length
143
Chain Sequence
GPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (AVIAN SARCOMA VIRUS INTEGRASE)
publication title Atomic resolution structures of the core domain of avian sarcoma virus integrase and its D64N mutant.
pubmed doi rcsb
source organism Avian sarcoma virus
total genus 54
structure length 143
sequence length 143
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1cxuA00
4CEDA 3M8SA 3ZSWA 3C6TA 1LAVA 4M3ZA 4E1MA 1L5UA 4B9TA 4C8OA 1KTQA 2HB5A 1XC9A 1NK6A 3NF7A 2DTUA 4Z4GA 1NJXA 4CEAA 2Z1HA 3JSMA 2P5OA 4L8RB 1JLQA 1BIUA 1KLNA 1TK8A 4FJXA 3OYNA 5HRRA 4EZ6A 1QTMA 1NOYA 4FK0A 4DSEA 1KRPA 2XY6A 2BGGA 4CHOA 1YT3A 1TGOA 2X6NA 1B9FA 2VG6A 3KLGA 5C24A 1ASUA 4LH5A 4KHUA 3DLEA 4KHWA 4E7KA 3QEVA 3SI6A 1JLFA 4DTUA 3LZJA 4KHQA 1D8YA 4PY5A 1SKSA 3HO1A 4IDKA 5EU7A 4CFBA 2Y1IA 2G8VA 4FLVA 2HHSA 1RBSA 3ZT3A 3H08A 1WAFA 3NF6A 1GOCA 3QIPA 1KCFA 1RDBA 3VQ5A 3OYAA 4DTMA 1WSGA 4Z4EA 4R5PA 2OPQA 1LWFA 3U3GA 3V9SA 1TKDA 3L2QA 4LD0A 1VSMA 3DRPA 3ALYA 3L3VA 1HQEA 1JXEA 4CK2A 1HRHA 2F96A 1GOBA 3BGRA 3DLKA 3KD5E 3L2WA 3CFOA 3IG1A 4BDZA 3QEIA 3B6OA 5HROA 3LANA 4B9LA 1Q9YA 4OJRA 4FJJA 1WAJA 4O0IA 3WNFA 4FLWA 3KLFA 1HYZA 3VQAA 4W5OA 1BI4A 3PV8A 1KVAA 3SYZA 3TAFA 2EX3A 2ETJA 4G1QA 5CZ1A 5CYMA 5J2MA 4DQRA 2DFHA 1NJWA 1VSEA 3OYGA 4AHRA 3G10A 4IKFA 1CXUA 5E41A 5I42A 1Q9XA 3KTQA 2HVHA 4FZXC 2QKBA 3LZIA 4CF0A 1RBRA 3KLEA 3VQEA 3NBPA 4CGGA 1C6VA 3LPUA 4HUFA 1I39A 4CEFA 2Y1JA 4CJQA 3OS1A 2G8KA 1WN7A 1LW2A 4FW2A 3DMJA 4OKEA 3ISNC 4DU4A 3TAQA 3THVA 1RBTA 4PQUA 4KI6A 5KRTA 3K5MA 1BL3A 4ICLA 2Z1IA 4DTRA 3EY1A 1D9FA 3AVFA 1RT7A 1VSJA 1EP4A 4OLAA 4FZYA 3QETA 2YNFA 3CM5A 2QKKA 1S1XA 1S1VA 1HNVA 2VWKA 3SPYA 1QSYA 3AO3A 4F4KA 4NCGA 1JXBA 1VSHA 2XO7A 3S9HA 1JLBA 3AVNA 4CJKA 4ZTJA 4F3TA 4B8CA 1TVRA 3T3FA 4CEZA 3AVLA 4W5RA 3TANA 1CZ9A 3AVJA 3KKRA 4GMJB 2DFEA 1NJYA 3K57A 2F8SA 4O44A 4FJNA 1RT1A 3HL8A 5J2QA 2D0BA 3QO9A 3NF8A 4GW6A 4N47A 3T19A 1W0HA 1R0AA 2HW3A 3F73A 4HCBA 1XHZA 1JL2A 1Z26A 3SNNA 4CHNA 4ELVA 2WONA 1NK9A 3EYZA 4ID1A 3V9XA 5HRSA 3M8RA 1J5OA 1X9WA 4O55A 4KI4A 4LSLA 3SUNA 3MEEA 1KFDA 4XIUA 3A2FA 4J2EA 4N76A 4M3UA 1JL1A 2EHGA 4BE0A 3U6FA 1TAUA 3K5OA 1FK9A 3AVMA 2OPSA 4Z4IA 2HNZA 2RKIA 3D0PA 1RT4A 1VSKA 2ZQBA 2RF2A 4CGDA 3BDPA 4M41A 1UA0A 4KRFA 4CJPA 3VQ4A 1GOAA 4CK1A 2QXFA 3IRXA 1T03A 2HHWA 4ELTA 1IH7A 3RTVA 3HYFA 3RR7A 4FJ8A 1A5WA 3M8QA 3LP2A 5FDLA 4DSJA 4DTJA 1VK0A 3QLHA 4KB0A 3JYTA 4I9LA 2VG7A 4GVMA 1EKEA 5C25A 4W5NA 3L2RA 4DTXA 4AILC 3NE6A 4E7HA 4F2RA 1CLQA 1IO2A 3CQ8A 4M3WA 3ZCMA 3RWUA 1RTHA 4DTSA 2FBVA 3G0ZA 4FJ7A 1BISA 3VQQA 1BCMA 4DS5A 2P1JA 4E3SA 3AV9A 2YV0X 3L2VA 3MXMA 2KFZA 2OZSA 2B5JA 1UOCA 3E01A 4HTUA 4DS4A 4FJ9A 3D45A 3KK2A 1VRUA 3V9ZA 4CJVA 4M3YA 3AVGA 4MQ3A 2VWJA 2P51A 1VSIA 5DMRA 4K8ZA 2F8TA 4CK3A 3OYDA 4JS4A 2FBTA 3DLRA 1U45A 4FK4A 1Z25A 3S3NA 1DTQA 4FJLA 4KPYA 3IS9A 3O3HA 1HNIA 1RNHA 2YHAA 3VQBA 4CEEA 4CJTA 1JLGA 1JLCA 1RT2A 3LPTA 3VA0A 4F3OA 4FM1A 4E7JA 4BACA 4AHSA 2DFFA 5D3GA 3KIOA 3L3UA 4EZ9A 1XHXA 4BDPA 1D5AA 4LH4A 3SV3A 1BGXT 3NH1A 3AVCA 4I7FA 3AO1A 4CF2A 2G8IA 4KFBA 1LWCA 1RILA 1JLEA 4DQSA 1BI4B 3LP0A 2BANA 2ATQA 1KVBA 1CXQA 4B8AB 3NGYA 3K59A 2NUBA 5HRNA 3QESA 1G15A 3CM6A 1U49A 3TAEA 3AVHA 2GBZA 3O4QA 4W5TA 5JS1A 1QSLA 1WSEA 2ZD1A 2O4IA 3AVBA 2YNIA 3KD1E 3VQ6A 3ASMA 1S1WA 5KI6A 3AO4A 3RR8A 1K6YA 2OPRA 1RBVA 3C94A 4Y1CA 4EP4A 4I9QA 4FK2A 3VQ8A 1X9SA 1J54A 1JKHA 1X1PA 1RTIA 3V81A 4KTQA 4M3RA 2RN2A 4DFPA 3SCXA 4DQQA 2YNGA 3MEGA 3OYEA 4FJMA 3DYAA 3KK3A 1KVCA 3RMDA 3SZ2A 1RCHA 4DSFA 3QNNA 5C42A 3HM9A 4FLXA 3MECA 4FZZA 2I5JA 4KHSA 3AA4A 4C8MA 1NK4A 4BWJA 3CFRA 3O4NA 2X6SA 3SQ0A 4KAZA 1JLAA 4NCAA 4CJ4A 4CJWA 4LY7A 1X9MA 1A5VA 1HYVA 4OGCA 2OA8A 3OYLA 3HVTA 3VA3A 5KTQA 3S3MA 1TK0A 1Y97A 2PYLA 3OJSA 4B9UA 4ELUA 3HJFA 5KRSA 3QEPA 4QOZB 1SL0A 3PUFA 4DMNA 1T8EA 1ITGA 2IDOA 2X78A 3FFIA 3LAKA 4AHCA 3SUPA 4PUOA 2ZE2A 4KHNA 5K14A 5T7BA 3AA5X 3KLHA 3V9WA 2OZMA 4O4GA 1L3VA 4M42A 4KHYA 2HHXA 2HHQA 4WE1A 4CEBA 4AHTA 4QCLA 1S1UA 4M45A 4FYDA 4OLBA 3NHGA 4AHVA 3ZSZA 3V6DA 4OVLA 2VG5A 4CFAA 3TARA 5HLFA 4IFYA 4O5BA 1HQUA 3NH2A 3LALA 1QE1A 4B9VA 2HHUA 2HNYA 2LSNA 1TKZA 2YKNA 1RDDA 3DLGA 4RG8A 4OKKA 4RW4A 3OS0A 3LAMA 4JRPA 4HUEA 3OVNA 4CGIA 2WOMA 1IKWA 3MXIA 3HVRA 1HYSA 4DG1A 3PY8A 1FKPA 1ZYQA 1QS4A 3MEDA 3OY9A 2IGIA 5J2NA 3ZT4A 4RW6A 1UA1A 2G8FA 5SWMA 1NKCA 3VQ7A 2B4JA 1DLOA 5J1EA 4CECA 3RMCA 2O4GA 1QQCA 4B9SA 4F2SA 3PX0A 4FJKA 2HVIA 1KLMA 3KLIA 4PWDA 2W42A 2OYQA 3UIQA 4DLGA 3RMBA 1YTUA 4IG0A 2RPIA 3RMAA 1EX4A 1ZBFA 3HT3A 1KSPA 4C8NA 3WNHA 4DQIA 2BDPA 4OPJA 3PO4A 4FXDA 3DLHA 4W5QA 1TKTA 1NOZA 3NGIA 3U3YA 5JS2A 2PY5A 1IKXA 3OYCA 3HPHA 4CJ3A 3VQPA 3KJVA 4N41A 1NKBA 2PYJA 4H8KA 5HBMA 2Q3SA 1TK5A 4E0DA 4DTNA 4FLZA 4M3TA 3OYBA 2XY8A 1YVUA 3DRRA 4JLHA 1W9HA 4N5SA 3AO5A 3V1QA 4DQPA 1TV6A 3WNEA 4Z0UA 3KKSA 3IAYA 1S5JA 1TL3A 5FRMA 1I3AA 1RT3A 4UQGA 4CERA 3DLBA 3RRHA 2E6MA 3SQ2A 3VQCA 1C1AA 4MFBA 1ZBHA 4CEOA 2Z1JA 5HP1A 2G8UA 2AJQA 1TAQA 3DOLA 3HPGA 4I2PA 3C95A 4JRQA 1C0UA 1Q8IA 1T05A 3PX6A 2D0AA 2HNDA 1NJZA 1O1WA 4CFCA 3CYMA 4CJFA 2P5GA 4TSXA 4O0JA 3QNOA 2JLEA 4CEQA 1C1CA 1WSJA 4HCCA 3K2PA 4LSNA 3WNGA 1QSSA 2KFNA 1MU2A 1VRTA 1XWLA 4C8LA 1BHLA 2ITGA 4KB1A 1D9DA 3ZSQA 1F21A 2D0CA 4JS5A 4FJHA 3NAEA 2Z1GA 5HRPA 3SQ4A 3I0SA 1SKRA 2JGUA 5I3UA 4FCYA 3ZT2A 3RRGA 1RDAA 2IAJA 3ITHA 4J2AA 1HPZA 4RW7A 3AA2A 3V1OA 3OYFA 1U47A 3NH0A 4FM2A 5KGXA 3F9KA 1C1BA 3DI6A 2YHBA 3ZSOA 1L3SA 1WSIA 1LW0A 3O3GA 3LWLA 1ZBLA 1VSFA 3SUOA 1NK0A 2IOCA 3C6UA 4E89A 2G8HA 4CE9A 4CHQA 2FC0A 2E4LA 2YNHA 4DFKA 1U48A 2D5RA 4KREA 4N56A 4H4MA 3I8DA 4Y1DA 5FROA 3VQDA 4ZHRA 4DSLA 1S9GA 1J9AA 3AO2A 3ZT1A 1C0TA 3KK1A 4KV8A 4NYFA 4CGFA 4CESA 3P1GA 4OPKA 3TR8A 1NKEA 4Q5VA 4CJSA 1VSDA 4I2QA 4FLYA 4FLUA 4DF8A 3PO5A 2DY4A 3O3FA 3L2UA 4NCBA 4DU3A 3K5NA 4FM0A 3EZ5A 4CCHA 1IKYA 4KTWA 4B08A 4KTZA 4DSIA 4OKJA 1WNSA 3CG7A 4IBNA 4DSKA 1FXXA 1RDCA 3V1RA 3M8PA 4IFVA 4RW9A 3ZSXA 1S1TA 3HSTB 4YNQA 1EETA 2IC3A 4CF8A 4E7IA 1N6QA 1IG9A 4FJ5A 4IG3A 1RTDA 1LAWA 3HK2A 2KZMA 3HXMA 5SZTA 4NYNA 4CIGA 5CZ2A 4HUGA 2B6AA 3TAMA 4DWIA 1S6QA 2E6LA 1L3TA 3MAQA 3ZSYA 4CJRA 3CFPA 3QERA 2IS3A 4BWMA 5FRNA 2A1RA 4CGHA 4CIFA 1XI1A 4CHPA 4Q0BA 3VQ9A 4CGJA 3ZSVA 1SL2A 2G8WA 2OPPA 1SUQA 1HMVA 1BCOA 1RTJA 1RT6A 1RT5A 2GUIA 2XRIA 3OYHA 1NK5A 3PX4A 1S9EA 5J2PA 2HHVA 3I0RA 1ASWA 4J2DA 3ULDA 1WLJA 4B9NA 3OYKA 2R7YA 3DOKA 1HJRA 3V9UA 4EP5A 2XY5A 4FVMA 4CIEA 4CF9A 3SJJA 4HVJA 4DTOA 2PZSA 4J2BA 4CHZA 1IKVA 3LP3A 4CJ5A 2FBYA 3OS2A 3HP9A 3LDSA 4HHTA 1TL1A 4KKOA 2KQ2A 4ZTFA 3SV4A 1J53A 3SQ1A 3S3OA 1DTTA 4YFUA 4DFMA 3AA3A 1YTAA 4FW1A 4CJLA 2HMIA 2BE2A 3P5JA 4B9MA 4K8XA 1EXQA 1REVA 1UAXA 3TABA 1BQNA 3P83D 3QIOA 5KGWA 3ZSRA 4Z4FA 3NF9A 2KZZA 1C0MA 4BDYA 3NDKA 3K5LA 4CF1A 1KFSA 1BQMA 1ZBIA 1L3UA 3TI0A 2GV9A 4Z4CA 3AVKA 1ASVA 2YKMA 3NGZA 3VN5A 2A1SA 3B6PA 4AH9A 2XY7A 2QK9A 3T1AA 1N5YA 3MXJA 4FJGA 4F8RA 4Z4HA 2XHBA 1QHTA 4AHUA 3TAPA 3OYMA 3QEXA 4C8KA 4E7LA 2HHTA 4RW8A 5CYQA 4FJIA 1LWEA 3LP1A 1FKOA 4ID5A 3OJUA 1B9DA 1TKXA 4CFDA 1SKWA 3AVAA 1U04A 1CZBA 4CJEA 4E1NA 1WSHA 3SPZA 3NCIA 1WSFA 1SV5A 1B92A 3DM2A 5DK5A 1ZBUA 4H4OA 1UWBA 4PA1A 3SUQA 4E19A 1NK7A 3AVIA 3TAGA 1LV5A 3K58A 3HP6A 2KTQA 4DTPA 1SL1A 5CY4A 3LWMA 3QEWA 3ZT0A 4KO0A 4QAGA 3V4IA 4FLTA 1T7PA 3OYIA 3TWHA 2FBXA 3HPOA 4BE2A 4B3OA 1BIZA 3NFAA 4DU1A 4OGEA 1S6PA 3OYJA 2X74A 3L8BA 1U4BA 4DLEA 4CHYA 4M3XA 3DRSA 2KW4A 4DFJA 1A5XA 4CJUA 1RBUA 1NK8A 4DF4A 4BE1A 3QINA 1VSLA
chains in the Genus database with same CATH superfamily
5E26A 2HB5A 1NK6A 1VQ7N 2ZWHA 1YJNN 2UUCK 5ADXA 1JLQA 1KLNA 3ID6A 4EZ6A 4DV3K 1KAXA 4CHOA 3ENBA 4CVNE 4KHWA 3QEVA 1KAZA 1D4XA 4PY5A 4GKKK 4IDKA 4JI4K 4AM7A 5KPRA 2G8VA 4FLVA 2HHSA 3ZT3A 5M1OA 3VQ5A 3CCVN 1WSGA 4Z4EA 1W97L 2OPQA 1LWFA 3DWLA 3DRPA 3L3VA 4CK2A 4A2AA 1N34K 4JYAK 2F96A 5FLXO 2AP1A 3L2WA 4BDZA 5AQKA 3BF1A 5HROA 3LANA 1BOTO 4FJJA 1WAJA 2OCEA 3VQAA 2F9WA 1VQ9N 3CD6N 3TAFA 1RFQA 2ETJA 1EWRA 5J2MA 5C10A 4OPAA 3SBTA 3VEXA 1Q9XA 4GV9A 4PL7A 1RBRA 5BRFA 4KH5A 3FZFA 1C6VA 3J7YP 4CJQA 1V4TA 4OKEA 1NM1A 4DU4A 5AQWA 3VEWA 3THVA 1RBTA 4KI6A 4WQ4C 5EVZA 3K5MA 2Z1IA 1D9FA 3AVFA 1EP4A 4MLHA 4FZYA 2YNFA 2P9PB 2QKKA 4O8UA 2E2OA 3AO3A 4YORA 3S9HA 3AVNA 4BRGA 4CJKA 4F3TA 4B8CA 2ASPA 2F8SA 4O44A 4B1XB 4FJNA 4YDUA 2CGLA 2HW3A 1XHZA 4FVUA 3HBTA 4CZKA 1NK9A 1X9WA 2NLXA 4LSLA 1KFDA 5M1FA 4M3UA 5KQDA 2EHGA 3TU5A 1TAUA 3GOIA 3K5OA 3VGMA 2OPSA 3D0PA 2RF2A 2I7NA 3QDKA 1Q81O 3OA9A 3ZYYX 3MN5A 1VK0A 3QLHA 3O9SA 4I9LA 1IBLK 5C25A 5LL6Z 3O9QA 3F2KA 3G0ZA 1EO1A 1NG9A 4E3SA 2FSKA 4FWKA 4C23A 3CCQN 2KFZA 4DS4A 4BRAA 4LF7K 1VRUA 4CJVA 4MQ3A 4XEIA 2P51A 2CGJA 4CK3A 3OYDA 4JS4A 2FBTA 5AQZA 3VF4A 1U45A 3OW2M 2HF4A 4KPYA 5F0XA 1RGIA 3ZX0A 3J80O 3LPTA 3BEXA 4IZ9A 4F3OA 4BACA 4AHSA 5KQ8A 3KIOA 2NRVA 1YF5L 3NH1A 3AVCA 3J7AP 2ZF5O 4I7FA 3AO1A 5DM7L 1WOQA 4KFBA 4RWTA 2Q97A 4DV7K 5JS1A 3AVHA 4BR7A 2ZD1A 4NLBA 5AR0A 4U7BA 3FLCO 1MWKA 3BUZB 1VHXA 4EP4A 3QBXA 3VQ8A 3V81A 1RTIA 1YTUA 4DFPA 4DQQA 2YNGA 1KVCA 5AQMA 1RCHA 3QNNA 3MDQA 3LL3A 3MECA 3CFRA 3CC4N 3T7ZA 4CJ4A 1E4FT 4LY7A 3LDOA 4XH5A 2P9SB 4B9UA 3VA3A 5KTQA 2PYLA 3G71N 2VGMA 4DMNA 1T8EA 3LAKA 4AHCA 2QWRA 4KHNA 3AA5X 3V9WA 3EL2A 4AHTA 3LM2A 5AQYA 4OLBA 3O9RA 4CFAA 4IFYA 3A8YA 4XH4A 3U4LA 4O5BA 1HQUA 2HNYA 3OS0A 4RG8A 3WEEB 3LAMA 3R9PA 4IEEA 4K43A 2WOMA 4BRCA 3MXIA 3GDQA 4BRDA 3ATVA 2E20A 4KBOA 1S3XA 1NU0A 5SWMA 2OANA 3RMCA 1KLMA 3KLIA 4PWDA 4IOXA 4DR2K 4DLGA 3F9MA 1XNRK 1ZBFA 3CQYA 3O1WA 3WNHA 5GAGP 2BDPA 4W5QA 3GG4A 1TKTA 4A5BA 3Q7BA 5JS2A 2QA4N 1IKXA 4CJ3A 5BRHA 4JKDA 4H8KA 4GV6A 4M3TA 3DRRA 4JLHA 1W9HA 3V1QA 5AFUH 3J7ZO 1S5JA 1RT3A 2BH1A 3KZBA 3RRHA 1YUWA 1NGHA 2FF3B 4MFBA 2AJQA 2G8UA 4BVPA 3HPGA 3EN9A 3C95A 1KD1O 4G9ZA 2HNDA 4JHDA 4CFCA 4CJFA 4JK9A 4TSXA 2JLEA 3THYB 3K2PA 2NZTA 4LSNA 1QSSA 3P31A 1XWLA 2OTLN 4KB1A 3HRGA 3ZSQA 1F21A 2Z1GA 3C7NB 4DR4K 3SQ4A 2JGUA 5I3UA 4FCYA 1BA1A 2IAJA 3AA2A 3CJBA 1U47A 3DI6A 4BRMA 3T69A 3IDHA 2HBJA 3O3GA 4JN4A 4E89A 2G8HA 4CHQA 4JI0K 2E4LA 2YNHA 1U48A 2D5RA 4O5FA 3O5BA 4N56A 3BF3A 5FROA 4DSLA 3QMLA 3ZT1A 3KK1A 1QZ6A 5EXWA 4CGFA 4CESA 4PKGA 3TR8A 4LFCK 3TSPA 4Q5VA 4DF8A 1QVGM 3CCMN 4DU3A 1MWMA 4LF5K 1SZ2A 4B08A 4DSIA 3CG7A 3B8AX 1XC3A 2HF3A 4CF8A 2IC3A 5F1XA 4AQYK 1IG9A 1IBMK 3L4QA 3HK2A 2KZMA 3EEQA 4NYNA 1BA0A 5CZ2A 4DWIA 5TKYA 1S22A 5EY4A 1L3TA 2P9UB 4CJRA 1BDGA 2A1RA 5AZIA 3ZETB 2Q31A 4XH1A 3HOSA 5BRDA 1NK5A 5I9EB 3PX4A 1S9EA 2UXDK 1FJGK 4DV5K 3FR0A 5GINA 3E66A 1QVFM 4HWIA 2R7YA 3THXA 3V9UA 4GY2B 4EP5A 4FVMA 3H1QA 4HVJA 2D1KA 1IKVA 4CJ5A 3QFUA 1TL1A 4ZTFA 1J53A 3SQ1A 1YTAA 4BR0A 4K8XA 3TABA 1NGBA 3ZSRA 3NF9A 4Z4FA 1T3VA 2FF6A 5EOYA 4DV1K 1ZBIA 4IWVA 2H3GX 4KH6A 1ASVA 2XY7A 2A1SA 3B6PA 4CD1A 3MX2A 4F8RA 1W2BM 3OYMA 5CYQA 4B3TK 1KQSM 2W40A 4JI1K 4YOXA 4DV2K 5JLFA 5JICA 1OH6A 4H4OA 3SUQA 3AVIA 1LV5A 3O6WA 3WXIA 3QEWA 3FZKA 4KO0A 1J6ZA 4FLTA 1T7PA 3OYIA 1GLCG 3HPOA 1ATSA 1BIZA 2QTDA 5FPDA 4JNEA 4X62K 5M1KA 4M3XA 4DFJA 3UE5A 4CJUA 1TUYA 1XUPO 4YOUA 4IOAL 4CEDA 3M8SA 3ZSWA 1X3MA 3C6TA 4M3ZA 4IOCL 4NXMK 2Z1HA 3CQXA 2Q1NA 3JSMA 1BIUA 2XY6A 2NNWA 3D2EB 1B9FA 3QB0A 5TKWA 4FWSA 4LH5A 3SLCA 4OO1J 3SI6A 4DTUA 4DCHA 1SKSA 2Y1IA 2UU9K 4GV3A 4BRLA 1RBSA 3H08A 1WAFA 4JKBA 4LFAK 1K8KA 4R5PA 3V9SA 3L2QA 5BPMA 4LD0A 3PIPL 4EFHA 3CCUN 1GOBA 5AFUA 3CFOA 4C1NI 3J81O 1HNZK 4OJRA 4A62A 4FLWA 1HYZA 2YI1A 4W5OA 1KVAA 2EX3A 5CZ1A 1MA9B 1VSEA 3FZLA 3M5RA 2GELA 5F2RA 1XMOK 3LZIA 3NBPA 4JKGB 2O8DB 2PAVA 3LPUA 1I39A 2Y1JA 3OS1A 1C0FA 1TYQA 4J8FA 5JLHA 3ISNC 5KRTA 4DKWA 1BL3A 4ICLA 5AQNA 1VSJA 4M7YA 3CM5A 4IJAA 4BC5A 1S1VA 1HNVA 2A3ZA 2VGNA 3O08A 3DXMB 1QSYA 4CD3A 4NCGA 1JXBA 1VSHA 4ZTJA 2W6LA 3CPWM 3T3FA 1TVRA 3TANA 4CEZA 4W5RA 2P9UA 3AGRA 3AVJA 4DR1K 2E1YA 3ZETA 3HL8A 5J2QA 2D0BA 3T19A 4QS8A 1W0HA 1R0AA 3F73A 2P9IB 2WBNA 3SNNA 3EYZA 3V9XA 1J5OA 2QI2A 1X3NA 4YOVA 1CZAN 4BQZA 3SUNA 1JL1A 2HHHK 4BE0A 3U6FA 1G99A 3CMAN 3AVMA 4DV6K 2RKIA 1RT4A 2ZQBA 2GWJA 3VQ4A 2HHWA 2ZGYA 3LDPA 4WQ5C 4A59A 4ELTA 1IH7A 3C6HA 3HYFA 1A5WA 3M8QA 4DSJA 4BGAA 3R3LA 4K25A 2W41A 1ATNA 4DB3A 4W5NA 1HKGA 1CLQA 1ZBSA 4M3WA 3NMUA 2UXCK 2HMPA 3L4IA 4DTSA 4FJ7A 1BISA 1BCMA 3IUCA 3SAGA 2YV0X 3MXMA 1N8RO 4I6MB 2B5JA 4HTUA 3MWTA 4JI6K 4K8ZA 2O8CB 2O8BB 5LMNK 4CEEA 4CJTA 1JLGA 1JLCA 1ATRA 3EKUA 1RT2A 3A5MC 2DFFA 2F9TA 4CZIA 3SV3A 3VF2A 2IVOA 3H6EA 2GX9A 1RILA 1BI4B 3LP0A 3BY5A 2VYPA 3K59A 1K73O 2NUBA 3P4IA 1G15A 1U49A 2GBZA 2O4IA 4H03B 4O8KA 3AVBA 3ASMA 1S1WA 2D4WA 2OPRA 2CH5A 4FK2A 3LDNA 1J54A 4KTQA 3SCXA 4LFBK 3KK3A 3RMDA 1OH7A 4DSFA 3WT0A 4FLXA 2I5JA 3GE1A 5EX5A 1KC8O 1YAGA 3O4NA 1T6DA 1X9MA 3RSEA 5HOOA 3HVTA 3JAMO 1MDUB 4JD2B 4ELUA 1XQSC 3QEPA 2O8FB 1R59O 2RHKA 1VQKN 1ITGA 2IDOA 2X78A 3FFIA 4FPBA 4JKEA 5DM6L 2OZMA 2F4VK 2YJFA 1P90A 4K0KK 4M42A 2HHXA 2HHQA 4WE1A 3I33A 4DR6K 1S1UA 3VEYA 3NHGA 4AHVA 3V6DA 4WFBL 4CI6A 5HLFA 1QQOA 3NH2A 3LALA 3E9LA 2LSNA 1TKZA 2YKNA 4DTNA 4HUEA 1P8ZA 3H3NO 3OVNA 4RTFD 1IKWA 3P39A 3EZWA 4FOIA 5IT9O 1ZYQA 1QS4A 3OY9A 4YOWA 4CZJA 2YCHA 3O80A 3K9JA 3UB5A 3MX5A 1NKCA 3JS6A 3VQ7A 4CECA 1QQCA 4CZHA 5AQVA 4F2SA 3PX0A 2HVIA 2W42A 3UKRA 3THWA 2RPIA 3RMAA 2O8EA 3PO4A 3DLHA 2P9LA 2QWOA 2PY5A 1H1VA 1NGJA 2JWKA 3KJVA 3N4PA 1NKBA 2PYJA 2Q3SA 1OH8A 3ULEB 4DQPA 1TV6A 3WNEA 3KKSA 3IAYA 2QEXN 1TL3A 5BREA 5FRMA 1I3AA 4ISEA 3VQCA 4NB4A 1C1AA 1TAQA 4AF1A 4QS7A 1OKJA 1T05A 3PX6A 2D0AA 2V52B 3LDLA 4O0JA 5AQPA 2KFNA 1MU2A 5AZJA 4C8LA 1BHLA 1K9MO 5H1SQ 4JS5A 3I56N 3NAEA 5HRPA 1YXQA 3I0SA 3PSIA 1SKRA 1TUUA 5BR8K 3RRGA 1E4GT 1NMNA 5BPNA 3ITHA 3F9KA 1WSIA 3LWLA 1ZBLA 1VSFA 2E2PA 1SAZA 3SUOA 1NK0A 1JCFA 4BR9A 2FC0A 4K41A 4BRKA 4H4MA 3VQDA 4ZHRA 1J9AA 3AO2A 4WFNL 4ISGA 2VCPA 4KV8A 4NYFA 1VQ6N 3P1GA 2O8BA 1NKEA 3O8MA 4FLUA 1VSDA 2DY4A 3L2UA 4NCBA 1Q86O 3K5NA 3C65A 3PIOL 4KTWA 2OTJN 4KTZA 4JI7K 4MDAA 3V1RA 5AQXA 2P9NB 4IFVA 3CCRN 3E9OA 3HSTB 4B3SK 1N6QA 2E1ZA 4FJ5A 1LAWA 3HXMA 3TAMA 2B6AA 4PL8A 4B3RK 1S6QA 2E6LA 2ASOA 1OVQA 1BG3A 4BWMA 4CZFA 4IXCA 1HLUA 1LOTB 2NRXA 4KH4A 1N36K 1SL2A 3ID8A 1SUQA 1HMVA 5C12A 3I0RA 1ASWA 4J2DA 4B9NA 3KWGA 4WQ5A 3SJJA 2PZSA 4J2BA 4CHZA 3LP3A 4JI5K 4FPAA 2FBYA 3OS2A 1EWQA 4KKOA 2KQ2A 1N33K 3S3OA 3PSFA 4M7XA 2FSJA 3A5NC 3AA3A 4CJLA 2O8FA 3EKSA 1EXQA 1REVA 1UAXA 5KGWA 2P9PA 1HUXA 3MCAB 4CZGA 3CERA 1BQMA 4FJKA 3TI0A 2GEMA 2GV9A 4Z4CA 1S72N 4DHYA 3VN5A 2A5XA 3T1AA 4Z4HA 1QHTA 4AHUA 3TAPA 3CJ7A 2QWMA 3KWIA 2HHTA 1LWEA 2Q0UA 1FKOA 4ILGB 4CFDA 1SKWA 3TPQA 3AVAA 1CZBA 4E1NA 3SPZA 1Q18A 5M1PA 1B92A 3DM2A 1ZBUA 4NXNK 3DXKB 3UKUB 3TAGA 4JI3K 3W0LA 3K58A 2V7YA 3G4SN 3LWMA 4H5NA 3ZT0A 3ATUA 4NO7A 4B3OA 4OGEA 4BR5A 3WXKA 2ZJRL 1A5XA 1NK8A 1Z6RA 3CJ9A 1NGCA 4H5VA 3AAPA 1WUAA 4FWQA 4IFEA 1HKBA 4C8OA 1BO5O 5MLCQ 2DTUA 3NF7A 4PKHA 4Z4GA 4CEAA 4L8RB 2P5OA 2QW9A 3R1XA 3IMXA 4FJXA 3OYNA 4FK0A 1QTMA 1NOYA 2KLAA 2BGGA 3ULEA 1TGOA 2DPNA 3ZX2A 4CZLA 1WB9A 5C24A 1ASUA 4BQLA 4KHUA 5C2FA 3I8BA 4ISFA 4WQ4A 1FW6A 1BWFO 3NF6A 1GOCA 4LF4K 1KCFA 3VEVA 1W7AA 4DTMA 2NRTA 3D2FB 1TKDA 4BC3A 5HL7L 3ALYA 2PBDA 3CXCM 4WFAL 1YITN 3KD5E 3BGRA 3T1YK 3IG1A 1VQ8N 2P9KB 3QEIA 4PKIA 4O0IA 3WNFA 1VQ4N 3KLFA 1I94K 2GWKA 3ENOA 3SYZA 5LJVA 3G10A 4IKFA 3TTDA 5I42A 3KTQA 2QWLA 4DV0K 4FZXC 1ZXOA 2QKBA 3ENHA 2HVHA 1M90O 3KLEA 4JKFA 4EAHD 4CGGA 4HUFA 4CEFA 2G8KA 1WN7A 4DR3K 1LW2A 4FW2A 3DMJA 3FGUA 1GLDG 4EHUA 1YJ9N 4GVEA 1DEJA 4DTRA 3EY1A 3VF6A 1RT7A 4OLAA 1S1XA 2VWKA 1IV0A 2P9SA 3SPYA 2CGKA 2ZJQL 5A2QO 4CBUA 3HSCA 1JJ2M 4F4KA 5AQSA 2XO7A 4GKJK 2ITMA 1NLVA 3HTVA 3KKRA 2DFEA 4JV5K 1NJYA 3K57A 4N47A 3QO9A 3NF8A 4BG9A 1JL2A 4LF8K 2WONA 5CHIA 4ID1A 5HRSA 4O55A 4J2EA 4XIUA 3A2FA 4N76A 2QXLA 3WEEA 1RDUA 3P38A 4FWMA 3D6RA 1FK9A 2NRZA 2WUSA 3H46O 4Z4IA 1VSKA 1VQ5N 5M1QA 4M41A 1UA0A 4KRFA 4CJPA 1ILYA 1GOAA 4CK1A 2QXFA 3IRXA 1T03A 3VEZA 3RTVA 3RR7A 3LP2A 3HZ6A 3W3DA 3R6MA 3NVKA 3JYTA 3VETA 1X9JA 1HPMA 4AILC 4F2RA 4E7HA 1IJJA 3VGLA 3CQ8A 3RWUA 2FBVA 2P1JA 3I55N 3AV9A 1OVYA 3O4WA 2OZSA 3E01A 5BN8A 3KK2A 3VEOA 1Z05A 3AVGA 5M1NA 2VWJA 1VSIA 3UKUA 1VQNN 5DMRA 2F8TA 4A57A 3DLRA 1Z25A 1DTQA 3IS9A 1HNIA 1RNHA 4FWOA 3K0SA 4FWPA 4H0VB 5C0YA 3VA0A 3A5LC 3CC2N 5D3GA 4BDPA 1D5AA 1YHQN 1BGXT 1LWCA 2BTFA 4DQSA 3THYA 2BANA 2ATQA 4B8AB 3NGYA 4CBXA 3VGKA 1KXPA 5HRNA 1LCUA 4JK8A 3CM6A 3QESA 4W5TA 3C7NA 1QSLA 3VESA 1WSEA 2YNIA 3KD1E 5AJ3K 3L6QA 1K8AO 5KI6A 2YHXA 1K6YA 1NGGA 4Y1CA 1RBVA 1YVNA 3C94A 3FZMA 4ILJA 3RR8A 4MO4A 1HNWK 4H5WA 1X1PA 4KHPK 4M3RA 2RN2A 3ZLJA 4FJMA 1GLLO 3SZ2A 3U8XA 5C42A 3HM9A 4KHSA 4BWJA 3SQ0A 4KAZA 1JLAA 4CJWA 1A5VA 1HYVA 3FE1A 4OGCA 3MN6A 1XNQK 3CJ1A 3HJFA 1HKCA 4LC9B 3OJSA 2YJEA 5KRSA 2ZE2A 2P9KA 5K14A 1L3VA 1M1KO 4KHYA 4BRFA 4CEBA 4M45A 4A2BA 2VG5A 1NBWA 1U6ZA 2HHUA 3HOTA 4YOTA 1EQYA 4JKAA 4JRPA 4BREA 4CGIA 1HYSA 3HVRA 4DG1A 3HM8A 3OBWA 5GIPA 2IGIA 3ZT4A 4RW6A 3WXMB 3SAHA 3LM9A 2AA4A 2B4JA 1DLOA 5J1EA 2V7ZA 1NNEA 2O4GA 4DV4K 4AM6A 2OYQA 3UIQA 1OH5A 2FLOA 3O9TA 1KSPA 4C8NA 4DQIA 4OPJA 3NGIA 1NOZA 3U3YA 3JXUA 1NJIO 3WQTA 3OYCA 3HPHA 4N41A 2QWPA 3QBWA 5HBMA 4FOEA 1TK5A 1IBKK 4E0DA 1DT9A 3OYBA 2XY8A 1YVUA 3C6AA 3M3ZA 4JKHA 4N5SA 1U2VB 3MK6A 4Z0UA 2A42A 2IVNA 4UQGA 4CERA 3SQ2A 5GAEP 1ZBHA 4CEOA 5HP1A 1VQON 1NGDA 3VENA 3DOLA 2E88A 3MN9A 4I2PA 4B9QA 1NJZA 4BVOA 3QNOA 4HCCA 4CEQA 3CCJN 2D0OA 3WNGA 5AQHA 1C0GA 1D9DA 2D0CA 4B1ZA 2CH6A 3M6GA 3WUHA 5JMVA 3OHRA 3TSUA 1GLBG 3V1OA 3TSQA 4FM2A 5KGXA 1Q7YO 1L3SA 2YHBA 4X66K 1LW0A 2A40A 3CI5A 3E1YA 2IOCA 3SAFA 5ELZA 1N32K 4UY8O 4KREA 3EE9A 3MMVA 3O9UA 4Y1DA 4MLEA 3D2EA 4MDBA 1C0TA 4JAXA 3L0QA 4PHTX 3WXLA 4CJSA 4FLYA 2Q2RA 3O3FA 3G6EN 4CCHA 4IBNA 4DSKA 1RDCA 4EZ9A 4RW9A 4IO8A 3ZSXA 4E7IA 4YNQA 3C0BA 2GUPA 1RTDA 4CIGA 4HUGA 3F5TA 4M63C 3ZSYA 4BY9C 3CFPA 5FPNA 2WFBA 5FRNA 2ZJPL 4LF6K 4CGHA 3LDQA 1XI1A 4CHPA 4Q0BA 1Q82O 3FZHA 4CGJA 3ZSVA 2G8WA 2OPPA 1BCOA 1RT5A 3OYHA 3H1VX 5J2PA 4BG8A 2ASMA 3SMPA 3N4QA 5BR9A 3ULDA 1WLJA 3PLAA 4JKGA 3OYKA 2O8DA 1HJRA 4CF9A 4DTOA 5AQFA 3HP9A 4HHTA 5GADP 3SV4A 4DFMA 1YJWN 2HMIA 4FW1A 4B9MA 4FWNA 3CJAA 3O1BA 3QIOA 4MO5A 4BRIA 3CMEN 3D7EO 2KZZA 1C0MA 4BDYA 4CF1A 2YHYA 1L3UA 3NGZA 3AVKA 2YKMA 3DXMA 3KVGA 1IG8A 4AH9A 2IVPA 4FJGA 2XHBA 2HBLA 4H0TB 3QEXA 3DJCA 4RW8A 3A5OC 3LP1A 1HR0K 5AQJA 3CF5L 3CIPA 4OPHA 3NCIA 2P9IA 1UWBA 1VQMN 2D0PA 2KTQA 4A5AA 4DTPA 4JHDB 1SL1A 2GTDA 5CY4A 3CCEN 3KK7A 4QAGA 4BE2A 2RE2A 3CJCA 1VQLN 4DU1A 4JKCA 3OYJA 2X74A 2E2NA 4DLEA 3EO3A 4U67L 3DRSA 4WCEL 2KW4A 3T1HK 3Q7CA 4DF4A 3AARA 4BRHA 1LAVA 4E1MA 1DGKN 1L5UA 4B9TA 1KTQA 1XC9A 2UUBK 1NJXA 5GIOA 1TK8A 4EIAA 5HRRA 3IKMA 3H3OB 4DSEA 1KRPA 1YT3A 1NGFA 2X6NA 2VG6A 1U2VA 3KLGA 3DLLL 3DLEA 4E7KA 1JLFA 4I6MA 3LZJA 4KHQA 1D8YA 3HO1A 5EU7A 4CFBA 4YY3K 1NMDA 2QM1A 4R79A 3QIPA 2O8CA 1RDBA 3OBYA 3OYAA 4GNIA 2UYTA 3U3GA 1VSMA 1HQEA 1JXEA 1HRHA 3DLKA 3WQUA 3B6OA 4B9LA 1Q9YA 5AZIB 1VSLA 1BI4A 3PV8A 4G1QA 5CYMA 4YOYA 4DQRA 2DFHA 1NJWA 3OYGA 3MN7A 4AHRA 1GLFO 1CXUA 5E41A 4CF0A 3VQEA 3FFKB 5LMUK 3THXB 1YIJN 2J4RA 4F9OA 3WXJA 1XMQK 4H0XB 3TAQA 4PQUA 3A0IX 4BRNA 3QETA 5AQLA 4FL9A 4L3QA 4BR2A 3MCPA 4EHTA 4JD2A 1T44A 5LY3A 1JLBA 3GL1A 3AVLA 1CZ9A 4GMJB 1RT1A 1VAZA 4GW6A 1WBBA 2JWLA 2UUAK 4IDHA 4HCBA 4BRQA 2I7PA 4CJ7A 5CE3A 1Z26A 1NWKA 4CHNA 2IIRA 1GLAG 4ELVA 3M8RA 5JVHL 4KI4A 5B8HA 3MEEA 4CBWA 4JI2K 4BRPA 2HNZA 2QWNA 1GLEG 3U9DA 2EWSA 4CGDA 3BDPA 3IFRA 1NGAA 4E1JA 4FJ8A 1JCEA 1NGIA 3H45C 5FDLA 4BR4A 1SS6A 4DTJA 3SMSA 4KB0A 4DQ8A 2VG7A 4GVMA 1EKEA 3L2RA 3BZKA 3K9KA 5IWAK 3NE6A 4DTXA 1IO2A 3ZCMA 1RTHA 2HBMA 4WYBA 3VQQA 2VQEK 4DS5A 2BUPA 1SQKA 4BC2A 5BPLA 4LF9K 3L2VA 1E3MA 4FJ9A 1UOCA 1YI2N 4DUYK 3CC7N 3D45A 1BUPA 3V9ZA 4M3YA 4B1YB 2WTUA 2ZM6K 4FK4A 4RCHA 4DR7K 4H5RA 3S3NA 4FJLA 1K8KB 2A41A 3QICA 3EE8A 3O3HA 2YHAA 3VQBA 1Y64A 4BROA 3ZEUB 4FSVA 4FM1A 4E7JA 4IJNA 4IEIA 3L3UA 3E9PA 1XHXA 5KPZA 4LH4A 4X64K 2E8AA 5BN9A 4CF2A 4YHHK 3AGKA 2G8IA 1JLEA 3VPZA 1KVBA 1CXQA 3SJHA 2A6AA 2WC9A 3TAEA 3O4QA 2KHOA 4B1WB 5AQQA 3VQ6A 3DAWA 4I9QA 3AO4A 5AQIA 1X9SA 1JKHA 1TYQB 3MEGA 5C2DA 3SK3A 3OYEA 1WBDA 3DYAA 2VWBA 4OX9K 4FZZA 3QFPA 3AA4A 1QZ5A 4C8MA 5GAHP 1NK4A 5AQUA 2X6SA 4B1VA 4NCAA 4C1NK 2UXBK 2OA8A 3VERA 3OYLA 3S3MA 1TK0A 1Y97A 3R8EA 3J8AA 4QOZB 1SL0A 3PUFA 3SUPA 4JK7A 1V4SA 4PUOA 5T7BA 2P9NA 3KLHA 2Q36A 4O4GA 1ZC6A 5FPEA 4QCLA 4FYDA 3ZSZA 2W6KA 5KPTA 4OVLA 3KHYA 3TARA 5E84A 3CHWA 3U9ZA 2VQFK 5LJWA 1QE1A 5C15A 2QWQA 4B9VA 1BU6O 3DLGA 1RDDA 1JCGA 4RW4A 3CETA 4OKKA 4QS9A 4CZEA 3PY8A 1FKPA 4HTLA 3CCLN 3MEDA 3RVCA 5J2NA 4A61A 1UA1A 2G8FA 4B1UB 5ADXH 1GLJO 3M1FA 2YHWA 4B9SA 1ESVA 2FXUA 3RMBA 4IG0A 3S41A 2YX6A 1EX4A 3HT3A 4H5TA 3AAQA 1KAYA 4FXDA 3VMFB 4K42A 2HOEA 3VQPA 2KKZA 5AQRA 5AQGA 4FLZA 3AO5A 2PFUA 5CR4A 4YDUC 4H0PA 3DLBA 2E6MA 3GBTA 2Z1JA 3DXKA 4JRQA 3AY9A 1C0UA 4B3MK 1Q8IA 1O1WA 3CYMA 4CW7B 2P5GA 3VTHA 1C1CA 1WSJA 4DUZK 5JVGL 1VRTA 2ITGA 1T6CA 4FJHA 3NVMA 4ILHA 3ZT2A 1QHAA 4IO9L 1QQNA 1RDAA 4J2AA 1HPZA 4RW7A 2NRRA 3MWPA 1NGEA 3NH0A 2NRWA 3OYFA 1C1BA 3ZSOA 5AQTA 3C6UA 1J5EK 2Q0RA 4CE9A 4DFKA 3I8DA 5AQOA 1QQMA 1S9GA 4FO0A 2E5LK 4JI8K 3VOVA 3RSEB 4OPKA 2ZGZA 4I2QA 3TTCA 3PO5A 4FM0A 3EZ5A 3ZEUA 1IKYA 4OKJA 1WNSA 1FXXA 2F7TA 3M8PA 4V19S 1S1TA 1EETA 3D2FA 4IG3A 5SZTA 3OTOK 2E2QA 1RDWX 3MAQA 3QERA 2IS3A 4BC4A 4CIFA 3BZCA 3VQ9A 4NLCA 3CCSN 4FJIA 1RTJA 1RT6A 2V51B 2GUIA 2XRIA 4FWRA 2HHVA 1O13A 3G25A 1HX1A 4Y0WA 3DOKA 4WF9L 2XY5A 4CIEA 4Z94A 3LDSA 3UKRB 4H0YB 3THWB 1DTTA 4YFUA 2BE2A 3P5JA 2O8EB 4FWLA 1BQNA 3P83D 2P9LB 1DKGD 2HBKA 3K5LA 3NDKA 2NRHA 1KFSA 2QK9A 3TTFA 1N5YA 3MXJA 4DR5K 4C8KA 4E7LA 3SBGA 2HSTA 4ID5A 3OJUA 1B9DA 1TKXA 1U04A 4CZMA 2FSNA 4H0OA 4CJEA 1WSHA 4BGBA 1WSFA 1HNXK 1SV5A 5DK5A 4PA1A 4E19A 1NK7A 5FPMA 3HP6A 4JEPA 3CPEA 3V4IA 3HI0A 3TWHA 2FBXA 1HJOA 5AZJB 1VQPN 1S6PA 4X65K 3BP8A 3L8BA 1U4BA 4CHYA 3ZX3A 1RBUA 3VTIA 4BE1A 3QINA 3NFAA
chains in the Genus database with same CATH topology
4CEDA 3M8SA 3ZSWA 3C6TA 1LAVA 4M3ZA 4E1MA 1L5UA 4B9TA 4C8OA 1KTQA 2HB5A 1XC9A 1NK6A 3NF7A 2DTUA 4Z4GA 1NJXA 4CEAA 2Z1HA 3JSMA 2P5OA 4L8RB 1JLQA 1BIUA 1KLNA 1TK8A 4FJXA 3OYNA 5HRRA 4EZ6A 1QTMA 1NOYA 4FK0A 4DSEA 1KRPA 2XY6A 2BGGA 4CHOA 1YT3A 1TGOA 2X6NA 1B9FA 2VG6A 3KLGA 5C24A 1ASUA 4LH5A 4KHUA 3DLEA 4KHWA 4E7KA 3QEVA 3SI6A 1JLFA 4DTUA 3LZJA 4KHQA 1D8YA 4PY5A 1SKSA 3HO1A 4IDKA 5EU7A 4CFBA 2Y1IA 2G8VA 4FLVA 2HHSA 1RBSA 3ZT3A 3H08A 1WAFA 3NF6A 1GOCA 3QIPA 1KCFA 1RDBA 3VQ5A 3OYAA 4DTMA 1WSGA 4Z4EA 4R5PA 2OPQA 1LWFA 3U3GA 3V9SA 1TKDA 3L2QA 4LD0A 1VSMA 3DRPA 3ALYA 3L3VA 1HQEA 1JXEA 4CK2A 1HRHA 2F96A 1GOBA 3BGRA 3DLKA 3KD5E 3L2WA 3CFOA 3IG1A 4BDZA 3QEIA 3B6OA 5HROA 3LANA 4B9LA 1Q9YA 4OJRA 4FJJA 1WAJA 4O0IA 3WNFA 4FLWA 3KLFA 1HYZA 3VQAA 4W5OA 1BI4A 3PV8A 1KVAA 3SYZA 3TAFA 2EX3A 2ETJA 4G1QA 5CZ1A 5CYMA 5J2MA 4DQRA 2DFHA 1NJWA 1VSEA 3OYGA 4AHRA 3G10A 4IKFA 1CXUA 5E41A 5I42A 1Q9XA 3KTQA 2HVHA 4FZXC 2QKBA 3LZIA 4CF0A 1RBRA 3KLEA 3VQEA 3NBPA 4CGGA 1C6VA 3LPUA 4HUFA 1I39A 4CEFA 2Y1JA 4CJQA 3OS1A 2G8KA 1WN7A 1LW2A 4FW2A 3DMJA 4OKEA 3ISNC 4DU4A 3TAQA 3THVA 1RBTA 4PQUA 4KI6A 5KRTA 3K5MA 1BL3A 4ICLA 2Z1IA 4DTRA 3EY1A 1D9FA 3AVFA 1RT7A 1VSJA 1EP4A 4OLAA 4FZYA 3QETA 2YNFA 3CM5A 2QKKA 1S1XA 1S1VA 1HNVA 2VWKA 3SPYA 1QSYA 3AO3A 4F4KA 4NCGA 1JXBA 1VSHA 2XO7A 3S9HA 1JLBA 3AVNA 4CJKA 4ZTJA 4F3TA 4B8CA 1TVRA 3T3FA 4CEZA 3AVLA 4W5RA 3TANA 1CZ9A 3AVJA 3KKRA 4GMJB 2DFEA 1NJYA 3K57A 2F8SA 4O44A 4FJNA 1RT1A 3HL8A 5J2QA 2D0BA 3QO9A 3NF8A 4GW6A 4N47A 3T19A 1W0HA 1R0AA 2HW3A 3F73A 4HCBA 1XHZA 1JL2A 1Z26A 3SNNA 4CHNA 4ELVA 2WONA 1NK9A 3EYZA 4ID1A 3V9XA 5HRSA 3M8RA 1J5OA 1X9WA 4O55A 4KI4A 4LSLA 3SUNA 3MEEA 1KFDA 4XIUA 3A2FA 4J2EA 4N76A 4M3UA 1JL1A 2EHGA 4BE0A 3U6FA 1TAUA 3K5OA 1FK9A 3AVMA 2OPSA 4Z4IA 2HNZA 2RKIA 3D0PA 1RT4A 1VSKA 2ZQBA 2RF2A 4CGDA 3BDPA 4M41A 1UA0A 4KRFA 4CJPA 3VQ4A 1GOAA 4CK1A 2QXFA 3IRXA 1T03A 2HHWA 4ELTA 1IH7A 3RTVA 3HYFA 3RR7A 4FJ8A 1A5WA 3M8QA 3LP2A 5FDLA 4DSJA 4DTJA 1VK0A 3QLHA 4KB0A 3JYTA 4I9LA 2VG7A 4GVMA 1EKEA 5C25A 4W5NA 3L2RA 4DTXA 4AILC 3NE6A 4E7HA 4F2RA 1CLQA 1IO2A 3CQ8A 4M3WA 3ZCMA 3RWUA 1RTHA 4DTSA 2FBVA 3G0ZA 4FJ7A 1BISA 3VQQA 1BCMA 4DS5A 2P1JA 4E3SA 3AV9A 2YV0X 3L2VA 3MXMA 2KFZA 2OZSA 2B5JA 1UOCA 3E01A 4HTUA 4DS4A 4FJ9A 3D45A 3KK2A 1VRUA 3V9ZA 4CJVA 4M3YA 3AVGA 4MQ3A 2VWJA 2P51A 1VSIA 5DMRA 4K8ZA 2F8TA 4CK3A 3OYDA 4JS4A 2FBTA 3DLRA 1U45A 4FK4A 1Z25A 3S3NA 1DTQA 4FJLA 4KPYA 3IS9A 3O3HA 1HNIA 1RNHA 2YHAA 3VQBA 4CEEA 4CJTA 1JLGA 1JLCA 1RT2A 3LPTA 3VA0A 4F3OA 4FM1A 4E7JA 4BACA 4AHSA 2DFFA 5D3GA 3KIOA 3L3UA 4EZ9A 1XHXA 4BDPA 1D5AA 4LH4A 3SV3A 1BGXT 3NH1A 3AVCA 4I7FA 3AO1A 4CF2A 2G8IA 4KFBA 1LWCA 1RILA 1JLEA 4DQSA 1BI4B 3LP0A 2BANA 2ATQA 1KVBA 1CXQA 4B8AB 3NGYA 3K59A 2NUBA 5HRNA 3QESA 1G15A 3CM6A 1U49A 3TAEA 3AVHA 2GBZA 3O4QA 4W5TA 5JS1A 1QSLA 1WSEA 2ZD1A 2O4IA 3AVBA 2YNIA 3KD1E 3VQ6A 3ASMA 1S1WA 5KI6A 3AO4A 3RR8A 1K6YA 2OPRA 1RBVA 3C94A 4Y1CA 4EP4A 4I9QA 4FK2A 3VQ8A 1X9SA 1J54A 1JKHA 1X1PA 1RTIA 3V81A 4KTQA 4M3RA 2RN2A 4DFPA 3SCXA 4DQQA 2YNGA 3MEGA 3OYEA 4FJMA 3DYAA 3KK3A 1KVCA 3RMDA 3SZ2A 1RCHA 4DSFA 3QNNA 5C42A 3HM9A 4FLXA 3MECA 4FZZA 2I5JA 4KHSA 3AA4A 4C8MA 1NK4A 4BWJA 3CFRA 3O4NA 2X6SA 3SQ0A 4KAZA 1JLAA 4NCAA 4CJ4A 4CJWA 4LY7A 1X9MA 1A5VA 1HYVA 4OGCA 2OA8A 3OYLA 3HVTA 3VA3A 5KTQA 3S3MA 1TK0A 1Y97A 2PYLA 3OJSA 4B9UA 4ELUA 3HJFA 5KRSA 3QEPA 4QOZB 1SL0A 3PUFA 4DMNA 1T8EA 1ITGA 2IDOA 2X78A 3FFIA 3LAKA 4AHCA 3SUPA 4PUOA 2ZE2A 4KHNA 5K14A 5T7BA 3AA5X 3KLHA 3V9WA 2OZMA 4O4GA 1L3VA 4M42A 4KHYA 2HHXA 2HHQA 4WE1A 4CEBA 4AHTA 4QCLA 1S1UA 4M45A 4FYDA 4OLBA 3NHGA 4AHVA 3ZSZA 3V6DA 4OVLA 2VG5A 4CFAA 3TARA 5HLFA 4IFYA 4O5BA 1HQUA 3NH2A 3LALA 1QE1A 4B9VA 2HHUA 2HNYA 2LSNA 1TKZA 2YKNA 1RDDA 3DLGA 4RG8A 4OKKA 4RW4A 3OS0A 3LAMA 4JRPA 4HUEA 3OVNA 4CGIA 2WOMA 1IKWA 3MXIA 3HVRA 1HYSA 4DG1A 3PY8A 1FKPA 1ZYQA 1QS4A 3MEDA 3OY9A 2IGIA 5J2NA 3ZT4A 4RW6A 1UA1A 2G8FA 5SWMA 1NKCA 3VQ7A 2B4JA 1DLOA 5J1EA 4CECA 3RMCA 2O4GA 1QQCA 4B9SA 4F2SA 3PX0A 4FJKA 2HVIA 1KLMA 3KLIA 4PWDA 2W42A 2OYQA 3UIQA 4DLGA 3RMBA 1YTUA 4IG0A 2RPIA 3RMAA 1EX4A 1ZBFA 3HT3A 1KSPA 4C8NA 3WNHA 4DQIA 2BDPA 4OPJA 3PO4A 4FXDA 3DLHA 4W5QA 1TKTA 1NOZA 3NGIA 3U3YA 5JS2A 2PY5A 1IKXA 3OYCA 3HPHA 4CJ3A 3VQPA 3KJVA 4N41A 1NKBA 2PYJA 4H8KA 5HBMA 2Q3SA 1TK5A 4E0DA 4DTNA 4FLZA 4M3TA 3OYBA 2XY8A 1YVUA 3DRRA 4JLHA 1W9HA 4N5SA 3AO5A 3V1QA 4DQPA 1TV6A 3WNEA 4Z0UA 3KKSA 3IAYA 1S5JA 1TL3A 5FRMA 1I3AA 1RT3A 4UQGA 4CERA 3DLBA 3RRHA 2E6MA 3SQ2A 3VQCA 1C1AA 4MFBA 1ZBHA 4CEOA 2Z1JA 5HP1A 2G8UA 2AJQA 1TAQA 3DOLA 3HPGA 4I2PA 3C95A 4JRQA 1C0UA 1Q8IA 1T05A 3PX6A 2D0AA 2HNDA 1NJZA 1O1WA 4CFCA 3CYMA 4CJFA 2P5GA 4TSXA 4O0JA 3QNOA 2JLEA 4CEQA 1C1CA 1WSJA 4HCCA 3K2PA 4LSNA 3WNGA 1QSSA 2KFNA 1MU2A 1VRTA 1XWLA 4C8LA 1BHLA 2ITGA 4KB1A 1D9DA 3ZSQA 1F21A 2D0CA 4JS5A 4FJHA 3NAEA 2Z1GA 5HRPA 3SQ4A 3I0SA 1SKRA 2JGUA 5I3UA 4FCYA 3ZT2A 3RRGA 1RDAA 2IAJA 3ITHA 4J2AA 1HPZA 4RW7A 3AA2A 3V1OA 3OYFA 1U47A 3NH0A 4FM2A 5KGXA 3F9KA 1C1BA 3DI6A 2YHBA 3ZSOA 1L3SA 1WSIA 1LW0A 3O3GA 3LWLA 1ZBLA 1VSFA 3SUOA 1NK0A 2IOCA 3C6UA 4E89A 2G8HA 4CE9A 4CHQA 2FC0A 2E4LA 2YNHA 4DFKA 1U48A 2D5RA 4KREA 4N56A 4H4MA 3I8DA 4Y1DA 5FROA 3VQDA 4ZHRA 4DSLA 1S9GA 1J9AA 3AO2A 3ZT1A 1C0TA 3KK1A 4KV8A 4NYFA 4CGFA 4CESA 3P1GA 4OPKA 3TR8A 1NKEA 4Q5VA 4CJSA 1VSDA 4I2QA 4FLYA 4FLUA 4DF8A 3PO5A 2DY4A 3O3FA 3L2UA 4NCBA 4DU3A 3K5NA 4FM0A 3EZ5A 4CCHA 1IKYA 4KTWA 4B08A 4KTZA 4DSIA 4OKJA 1WNSA 3CG7A 4IBNA 4DSKA 1FXXA 1RDCA 3V1RA 3M8PA 4IFVA 4RW9A 3ZSXA 1S1TA 3HSTB 4YNQA 1EETA 2IC3A 4CF8A 4E7IA 1N6QA 1IG9A 4FJ5A 4IG3A 1RTDA 1LAWA 3HK2A 2KZMA 3HXMA 5SZTA 4NYNA 4CIGA 5CZ2A 4HUGA 2B6AA 3TAMA 4DWIA 1S6QA 2E6LA 1L3TA 3MAQA 3ZSYA 4CJRA 3CFPA 3QERA 2IS3A 4BWMA 5FRNA 2A1RA 4CGHA 4CIFA 1XI1A 4CHPA 4Q0BA 3VQ9A 4CGJA 3ZSVA 1SL2A 2G8WA 2OPPA 1SUQA 1HMVA 1BCOA 1RTJA 1RT6A 1RT5A 2GUIA 2XRIA 3OYHA 1NK5A 3PX4A 1S9EA 5J2PA 2HHVA 3I0RA 1ASWA 4J2DA 3ULDA 1WLJA 4B9NA 3OYKA 2R7YA 3DOKA 1HJRA 3V9UA 4EP5A 2XY5A 4FVMA 4CIEA 4CF9A 3SJJA 4HVJA 4DTOA 2PZSA 4J2BA 4CHZA 1IKVA 3LP3A 4CJ5A 2FBYA 3OS2A 3HP9A 3LDSA 4HHTA 1TL1A 4KKOA 2KQ2A 4ZTFA 3SV4A 1J53A 3SQ1A 3S3OA 1DTTA 4YFUA 4DFMA 3AA3A 1YTAA 4FW1A 4CJLA 2HMIA 2BE2A 3P5JA 4B9MA 4K8XA 1EXQA 1REVA 1UAXA 3TABA 1BQNA 3P83D 3QIOA 5KGWA 3ZSRA 4Z4FA 3NF9A 2KZZA 1C0MA 4BDYA 3NDKA 3K5LA 4CF1A 1KFSA 1BQMA 1ZBIA 1L3UA 3TI0A 2GV9A 4Z4CA 3AVKA 1ASVA 2YKMA 3NGZA 3VN5A 2A1SA 3B6PA 4AH9A 2XY7A 2QK9A 3T1AA 1N5YA 3MXJA 4FJGA 4F8RA 4Z4HA 2XHBA 1QHTA 4AHUA 3TAPA 3OYMA 3QEXA 4C8KA 4E7LA 2HHTA 4RW8A 5CYQA 4FJIA 1LWEA 3LP1A 1FKOA 4ID5A 3OJUA 1B9DA 1TKXA 4CFDA 1SKWA 3AVAA 1U04A 1CZBA 4CJEA 4E1NA 1WSHA 3SPZA 3NCIA 1WSFA 1SV5A 1B92A 3DM2A 5DK5A 1ZBUA 4H4OA 1UWBA 4PA1A 3SUQA 4E19A 1NK7A 3AVIA 3TAGA 1LV5A 3K58A 3HP6A 2KTQA 4DTPA 1SL1A 5CY4A 3LWMA 3QEWA 3ZT0A 4KO0A 4QAGA 3V4IA 4FLTA 1T7PA 3OYIA 3TWHA 2FBXA 3HPOA 4BE2A 4B3OA 1BIZA 3NFAA 4DU1A 4OGEA 1S6PA 3OYJA 2X74A 3L8BA 1U4BA 4DLEA 4CHYA 4M3XA 3DRSA 2KW4A 4DFJA 1A5XA 4CJUA 1RBUA 1NK8A 4DF4A 4BE1A 3QINA 1VSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CED A;  3M8S A;  3ZSW A;  3C6T A;  1LAV A;  4M3Z A;  4E1M A;  1L5U A;  4B9T A;  4C8O A;  1KTQ A;  2HB5 A;  1XC9 A;  1NK6 A;  3NF7 A;  2DTU A;  4Z4G A;  1NJX A;  4CEA A;  2Z1H A;  3JSM A;  2P5O A;  4L8R B;  1JLQ A;  1BIU A;  1KLN A;  1TK8 A;  4FJX A;  3OYN A;  5HRR A;  4EZ6 A;  1QTM A;  1NOY A;  4FK0 A;  4DSE A;  1KRP A;  2XY6 A;  2BGG A;  4CHO A;  1YT3 A;  1TGO A;  2X6N A;  1B9F A;  2VG6 A;  3KLG A;  5C24 A;  1ASU A;  4LH5 A;  4KHU A;  3DLE A;  4KHW A;  4E7K A;  3QEV A;  3SI6 A;  1JLF A;  4DTU A;  3LZJ A;  4KHQ A;  1D8Y A;  4PY5 A;  1SKS A;  3HO1 A;  4IDK A;  5EU7 A;  4CFB A;  2Y1I A;  2G8V A;  4FLV A;  2HHS A;  1RBS A;  3ZT3 A;  3H08 A;  1WAF A;  3NF6 A;  1GOC A;  3QIP A;  1KCF A;  1RDB A;  3VQ5 A;  3OYA A;  4DTM A;  1WSG A;  4Z4E A;  4R5P A;  2OPQ A;  1LWF A;  3U3G A;  3V9S A;  1TKD A;  3L2Q A;  4LD0 A;  1VSM A;  3DRP A;  3ALY A;  3L3V A;  1HQE A;  1JXE A;  4CK2 A;  1HRH A;  2F96 A;  1GOB A;  3BGR A;  3DLK A;  3KD5 E;  3L2W A;  3CFO A;  3IG1 A;  4BDZ A;  3QEI A;  3B6O A;  5HRO A;  3LAN A;  4B9L A;  1Q9Y A;  4OJR A;  4FJJ A;  1WAJ A;  4O0I A;  3WNF A;  4FLW A;  3KLF A;  1HYZ A;  3VQA A;  4W5O A;  1BI4 A;  3PV8 A;  1KVA A;  3SYZ A;  3TAF A;  2EX3 A;  2ETJ A;  4G1Q A;  5CZ1 A;  5CYM A;  5J2M A;  4DQR A;  2DFH A;  1NJW A;  1VSE A;  3OYG A;  4AHR A;  3G10 A;  4IKF A;  1CXU A;  5E41 A;  5I42 A;  1Q9X A;  3KTQ A;  2HVH A;  4FZX C;  2QKB A;  3LZI A;  4CF0 A;  1RBR A;  3KLE A;  3VQE A;  3NBP A;  4CGG A;  1C6V A;  3LPU A;  4HUF A;  1I39 A;  4CEF A;  2Y1J A;  4CJQ A;  3OS1 A;  2G8K A;  1WN7 A;  1LW2 A;  4FW2 A;  3DMJ A;  4OKE A;  3ISN C;  4DU4 A;  3TAQ A;  3THV A;  1RBT A;  4PQU A;  4KI6 A;  5KRT A;  3K5M A;  1BL3 A;  4ICL A;  2Z1I A;  4DTR A;  3EY1 A;  1D9F A;  3AVF A;  1RT7 A;  1VSJ A;  1EP4 A;  4OLA A;  4FZY A;  3QET A;  2YNF A;  3CM5 A;  2QKK A;  1S1X A;  1S1V A;  1HNV A;  2VWK A;  3SPY A;  1QSY A;  3AO3 A;  4F4K A;  4NCG A;  1JXB A;  1VSH A;  2XO7 A;  3S9H A;  1JLB A;  3AVN A;  4CJK A;  4ZTJ A;  4F3T A;  4B8C A;  1TVR A;  3T3F A;  4CEZ A;  3AVL A;  4W5R A;  3TAN A;  1CZ9 A;  3AVJ A;  3KKR A;  4GMJ B;  2DFE A;  1NJY A;  3K57 A;  2F8S A;  4O44 A;  4FJN A;  1RT1 A;  3HL8 A;  5J2Q A;  2D0B A;  3QO9 A;  3NF8 A;  4GW6 A;  4N47 A;  3T19 A;  1W0H A;  1R0A A;  2HW3 A;  3F73 A;  4HCB A;  1XHZ A;  1JL2 A;  1Z26 A;  3SNN A;  4CHN A;  4ELV A;  2WON A;  1NK9 A;  3EYZ A;  4ID1 A;  3V9X A;  5HRS A;  3M8R A;  1J5O A;  1X9W A;  4O55 A;  4KI4 A;  4LSL A;  3SUN A;  3MEE A;  1KFD A;  4XIU A;  3A2F A;  4J2E A;  4N76 A;  4M3U A;  1JL1 A;  2EHG A;  4BE0 A;  3U6F A;  1TAU A;  3K5O A;  1FK9 A;  3AVM A;  2OPS A;  4Z4I A;  2HNZ A;  2RKI A;  3D0P A;  1RT4 A;  1VSK A;  2ZQB A;  2RF2 A;  4CGD A;  3BDP A;  4M41 A;  1UA0 A;  4KRF A;  4CJP A;  3VQ4 A;  1GOA A;  4CK1 A;  2QXF A;  3IRX A;  1T03 A;  2HHW A;  4ELT A;  1IH7 A;  3RTV A;  3HYF A;  3RR7 A;  4FJ8 A;  1A5W A;  3M8Q A;  3LP2 A;  5FDL A;  4DSJ A;  4DTJ A;  1VK0 A;  3QLH A;  4KB0 A;  3JYT A;  4I9L A;  2VG7 A;  4GVM A;  1EKE A;  5C25 A;  4W5N A;  3L2R A;  4DTX A;  4AIL C;  3NE6 A;  4E7H A;  4F2R A;  1CLQ A;  1IO2 A;  3CQ8 A;  4M3W A;  3ZCM A;  3RWU A;  1RTH A;  4DTS A;  2FBV A;  3G0Z A;  4FJ7 A;  1BIS A;  3VQQ A;  1BCM A;  4DS5 A;  2P1J A;  4E3S A;  3AV9 A;  2YV0 X;  3L2V A;  3MXM A;  2KFZ A;  2OZS A;  2B5J A;  1UOC A;  3E01 A;  4HTU A;  4DS4 A;  4FJ9 A;  3D45 A;  3KK2 A;  1VRU A;  3V9Z A;  4CJV A;  4M3Y A;  3AVG A;  4MQ3 A;  2VWJ A;  2P51 A;  1VSI A;  5DMR A;  4K8Z A;  2F8T A;  4CK3 A;  3OYD A;  4JS4 A;  2FBT A;  3DLR A;  1U45 A;  4FK4 A;  1Z25 A;  3S3N A;  1DTQ A;  4FJL A;  4KPY A;  3IS9 A;  3O3H A;  1HNI A;  1RNH A;  2YHA A;  3VQB A;  4CEE A;  4CJT A;  1JLG A;  1JLC A;  1RT2 A;  3LPT A;  3VA0 A;  4F3O A;  4FM1 A;  4E7J A;  4BAC A;  4AHS A;  2DFF A;  5D3G A;  3KIO A;  3L3U A;  4EZ9 A;  1XHX A;  4BDP A;  1D5A A;  4LH4 A;  3SV3 A;  1BGX T;  3NH1 A;  3AVC A;  4I7F A;  3AO1 A;  4CF2 A;  2G8I A;  4KFB A;  1LWC A;  1RIL A;  1JLE A;  4DQS A;  1BI4 B;  3LP0 A;  2BAN A;  2ATQ A;  1KVB A;  1CXQ A;  4B8A B;  3NGY A;  3K59 A;  2NUB A;  5HRN A;  3QES A;  1G15 A;  3CM6 A;  1U49 A;  3TAE A;  3AVH A;  2GBZ A;  3O4Q A;  4W5T A;  5JS1 A;  1QSL A;  1WSE A;  2ZD1 A;  2O4I A;  3AVB A;  2YNI A;  3KD1 E;  3VQ6 A;  3ASM A;  1S1W A;  5KI6 A;  3AO4 A;  3RR8 A;  1K6Y A;  2OPR A;  1RBV A;  3C94 A;  4Y1C A;  4EP4 A;  4I9Q A;  4FK2 A;  3VQ8 A;  1X9S A;  1J54 A;  1JKH A;  1X1P A;  1RTI A;  3V81 A;  4KTQ A;  4M3R A;  2RN2 A;  4DFP A;  3SCX A;  4DQQ A;  2YNG A;  3MEG A;  3OYE A;  4FJM A;  3DYA A;  3KK3 A;  1KVC A;  3RMD A;  3SZ2 A;  1RCH A;  4DSF A;  3QNN A;  5C42 A;  3HM9 A;  4FLX A;  3MEC A;  4FZZ A;  2I5J A;  4KHS A;  3AA4 A;  4C8M A;  1NK4 A;  4BWJ A;  3CFR A;  3O4N A;  2X6S A;  3SQ0 A;  4KAZ A;  1JLA A;  4NCA A;  4CJ4 A;  4CJW A;  4LY7 A;  1X9M A;  1A5V A;  1HYV A;  4OGC A;  2OA8 A;  3OYL A;  3HVT A;  3VA3 A;  5KTQ A;  3S3M A;  1TK0 A;  1Y97 A;  2PYL A;  3OJS A;  4B9U A;  4ELU A;  3HJF A;  5KRS A;  3QEP A;  4QOZ B;  1SL0 A;  3PUF A;  4DMN A;  1T8E A;  1ITG A;  2IDO A;  2X78 A;  3FFI A;  3LAK A;  4AHC A;  3SUP A;  4PUO A;  2ZE2 A;  4KHN A;  5K14 A;  5T7B A;  3AA5 X;  3KLH A;  3V9W A;  2OZM A;  4O4G A;  1L3V A;  4M42 A;  4KHY A;  2HHX A;  2HHQ A;  4WE1 A;  4CEB A;  4AHT A;  4QCL A;  1S1U A;  4M45 A;  4FYD A;  4OLB A;  3NHG A;  4AHV A;  3ZSZ A;  3V6D A;  4OVL A;  2VG5 A;  4CFA A;  3TAR A;  5HLF A;  4IFY A;  4O5B A;  1HQU A;  3NH2 A;  3LAL A;  1QE1 A;  4B9V A;  2HHU A;  2HNY A;  2LSN A;  1TKZ A;  2YKN A;  1RDD A;  3DLG A;  4RG8 A;  4OKK A;  4RW4 A;  3OS0 A;  3LAM A;  4JRP A;  4HUE A;  3OVN A;  4CGI A;  2WOM A;  1IKW A;  3MXI A;  3HVR A;  1HYS A;  4DG1 A;  3PY8 A;  1FKP A;  1ZYQ A;  1QS4 A;  3MED A;  3OY9 A;  2IGI A;  5J2N A;  3ZT4 A;  4RW6 A;  1UA1 A;  2G8F A;  5SWM A;  1NKC A;  3VQ7 A;  2B4J A;  1DLO A;  5J1E A;  4CEC A;  3RMC A;  2O4G A;  1QQC A;  4B9S A;  4F2S A;  3PX0 A;  4FJK A;  2HVI A;  1KLM A;  3KLI A;  4PWD A;  2W42 A;  2OYQ A;  3UIQ A;  4DLG A;  3RMB A;  1YTU A;  4IG0 A;  2RPI A;  3RMA A;  1EX4 A;  1ZBF A;  3HT3 A;  1KSP A;  4C8N A;  3WNH A;  4DQI A;  2BDP A;  4OPJ A;  3PO4 A;  4FXD A;  3DLH A;  4W5Q A;  1TKT A;  1NOZ A;  3NGI A;  3U3Y A;  5JS2 A;  2PY5 A;  1IKX A;  3OYC A;  3HPH A;  4CJ3 A;  3VQP A;  3KJV A;  4N41 A;  1NKB A;  2PYJ A;  4H8K A;  5HBM A;  2Q3S A;  1TK5 A;  4E0D A;  4DTN A;  4FLZ A;  4M3T A;  3OYB A;  2XY8 A;  1YVU A;  3DRR A;  4JLH A;  1W9H A;  4N5S A;  3AO5 A;  3V1Q A;  4DQP A;  1TV6 A;  3WNE A;  4Z0U A;  3KKS A;  3IAY A;  1S5J A;  1TL3 A;  5FRM A;  1I3A A;  1RT3 A;  4UQG A;  4CER A;  3DLB A;  3RRH A;  2E6M A;  3SQ2 A;  3VQC A;  1C1A A;  4MFB A;  1ZBH A;  4CEO A;  2Z1J A;  5HP1 A;  2G8U A;  2AJQ A;  1TAQ A;  3DOL A;  3HPG A;  4I2P A;  3C95 A;  4JRQ A;  1C0U A;  1Q8I A;  1T05 A;  3PX6 A;  2D0A A;  2HND A;  1NJZ A;  1O1W A;  4CFC A;  3CYM A;  4CJF A;  2P5G A;  4TSX A;  4O0J A;  3QNO A;  2JLE A;  4CEQ A;  1C1C A;  1WSJ A;  4HCC A;  3K2P A;  4LSN A;  3WNG A;  1QSS A;  2KFN A;  1MU2 A;  1VRT A;  1XWL A;  4C8L A;  1BHL A;  2ITG A;  4KB1 A;  1D9D A;  3ZSQ A;  1F21 A;  2D0C A;  4JS5 A;  4FJH A;  3NAE A;  2Z1G A;  5HRP A;  3SQ4 A;  3I0S A;  1SKR A;  2JGU A;  5I3U A;  4FCY A;  3ZT2 A;  3RRG A;  1RDA A;  2IAJ A;  3ITH A;  4J2A A;  1HPZ A;  4RW7 A;  3AA2 A;  3V1O A;  3OYF A;  1U47 A;  3NH0 A;  4FM2 A;  5KGX A;  3F9K A;  1C1B A;  3DI6 A;  2YHB A;  3ZSO A;  1L3S A;  1WSI A;  1LW0 A;  3O3G A;  3LWL A;  1ZBL A;  1VSF A;  3SUO A;  1NK0 A;  2IOC A;  3C6U A;  4E89 A;  2G8H A;  4CE9 A;  4CHQ A;  2FC0 A;  2E4L A;  2YNH A;  4DFK A;  1U48 A;  2D5R A;  4KRE A;  4N56 A;  4H4M A;  3I8D A;  4Y1D A;  5FRO A;  3VQD A;  4ZHR A;  4DSL A;  1S9G A;  1J9A A;  3AO2 A;  3ZT1 A;  1C0T A;  3KK1 A;  4KV8 A;  4NYF A;  4CGF A;  4CES A;  3P1G A;  4OPK A;  3TR8 A;  1NKE A;  4Q5V A;  4CJS A;  1VSD A;  4I2Q A;  4FLY A;  4FLU A;  4DF8 A;  3PO5 A;  2DY4 A;  3O3F A;  3L2U A;  4NCB A;  4DU3 A;  3K5N A;  4FM0 A;  3EZ5 A;  4CCH A;  1IKY A;  4KTW A;  4B08 A;  4KTZ A;  4DSI A;  4OKJ A;  1WNS A;  3CG7 A;  4IBN A;  4DSK A;  1FXX A;  1RDC A;  3V1R A;  3M8P A;  4IFV A;  4RW9 A;  3ZSX A;  1S1T A;  3HST B;  4YNQ A;  1EET A;  2IC3 A;  4CF8 A;  4E7I A;  1N6Q A;  1IG9 A;  4FJ5 A;  4IG3 A;  1RTD A;  1LAW A;  3HK2 A;  2KZM A;  3HXM A;  5SZT A;  4NYN A;  4CIG A;  5CZ2 A;  4HUG A;  2B6A A;  3TAM A;  4DWI A;  1S6Q A;  2E6L A;  1L3T A;  3MAQ A;  3ZSY A;  4CJR A;  3CFP A;  3QER A;  2IS3 A;  4BWM A;  5FRN A;  2A1R A;  4CGH A;  4CIF A;  1XI1 A;  4CHP A;  4Q0B A;  3VQ9 A;  4CGJ A;  3ZSV A;  1SL2 A;  2G8W A;  2OPP A;  1SUQ A;  1HMV A;  1BCO A;  1RTJ A;  1RT6 A;  1RT5 A;  2GUI A;  2XRI A;  3OYH A;  1NK5 A;  3PX4 A;  1S9E A;  5J2P A;  2HHV A;  3I0R A;  1ASW A;  4J2D A;  3ULD A;  1WLJ A;  4B9N A;  3OYK A;  2R7Y A;  3DOK A;  1HJR A;  3V9U A;  4EP5 A;  2XY5 A;  4FVM A;  4CIE A;  4CF9 A;  3SJJ A;  4HVJ A;  4DTO A;  2PZS A;  4J2B A;  4CHZ A;  1IKV A;  3LP3 A;  4CJ5 A;  2FBY A;  3OS2 A;  3HP9 A;  3LDS A;  4HHT A;  1TL1 A;  4KKO A;  2KQ2 A;  4ZTF A;  3SV4 A;  1J53 A;  3SQ1 A;  3S3O A;  1DTT A;  4YFU A;  4DFM A;  3AA3 A;  1YTA A;  4FW1 A;  4CJL A;  2HMI A;  2BE2 A;  3P5J A;  4B9M A;  4K8X A;  1EXQ A;  1REV A;  1UAX A;  3TAB A;  1BQN A;  3P83 D;  3QIO A;  5KGW A;  3ZSR A;  4Z4F A;  3NF9 A;  2KZZ A;  1C0M A;  4BDY A;  3NDK A;  3K5L A;  4CF1 A;  1KFS A;  1BQM A;  1ZBI A;  1L3U A;  3TI0 A;  2GV9 A;  4Z4C A;  3AVK A;  1ASV A;  2YKM A;  3NGZ A;  3VN5 A;  2A1S A;  3B6P A;  4AH9 A;  2XY7 A;  2QK9 A;  3T1A A;  1N5Y A;  3MXJ A;  4FJG A;  4F8R A;  4Z4H A;  2XHB A;  1QHT A;  4AHU A;  3TAP A;  3OYM A;  3QEX A;  4C8K A;  4E7L A;  2HHT A;  4RW8 A;  5CYQ A;  4FJI A;  1LWE A;  3LP1 A;  1FKO A;  4ID5 A;  3OJU A;  1B9D A;  1TKX A;  4CFD A;  1SKW A;  3AVA A;  1U04 A;  1CZB A;  4CJE A;  4E1N A;  1WSH A;  3SPZ A;  3NCI A;  1WSF A;  1SV5 A;  1B92 A;  3DM2 A;  5DK5 A;  1ZBU A;  4H4O A;  1UWB A;  4PA1 A;  3SUQ A;  4E19 A;  1NK7 A;  3AVI A;  3TAG A;  1LV5 A;  3K58 A;  3HP6 A;  2KTQ A;  4DTP A;  1SL1 A;  5CY4 A;  3LWM A;  3QEW A;  3ZT0 A;  4KO0 A;  4QAG A;  3V4I A;  4FLT A;  1T7P A;  3OYI A;  3TWH A;  2FBX A;  3HPO A;  4BE2 A;  4B3O A;  1BIZ A;  3NFA A;  4DU1 A;  4OGE A;  1S6P A;  3OYJ A;  2X74 A;  3L8B A;  1U4B A;  4DLE A;  4CHY A;  4M3X A;  3DRS A;  2KW4 A;  4DFJ A;  1A5X A;  4CJU A;  1RBU A;  1NK8 A;  4DF4 A;  4BE1 A;  3QIN A;  1VSL A; 
#chains in the Genus database with same CATH topology
 5E26 A;  2HB5 A;  1NK6 A;  1VQ7 N;  2ZWH A;  1YJN N;  2UUC K;  5ADX A;  1JLQ A;  1KLN A;  3ID6 A;  4EZ6 A;  4DV3 K;  1KAX A;  4CHO A;  3ENB A;  4CVN E;  4KHW A;  3QEV A;  1KAZ A;  1D4X A;  4PY5 A;  4GKK K;  4IDK A;  4JI4 K;  4AM7 A;  5KPR A;  2G8V A;  4FLV A;  2HHS A;  3ZT3 A;  5M1O A;  3VQ5 A;  3CCV N;  1WSG A;  4Z4E A;  1W97 L;  2OPQ A;  1LWF A;  3DWL A;  3DRP A;  3L3V A;  4CK2 A;  4A2A A;  1N34 K;  4JYA K;  2F96 A;  5FLX O;  2AP1 A;  3L2W A;  4BDZ A;  5AQK A;  3BF1 A;  5HRO A;  3LAN A;  1BOT O;  4FJJ A;  1WAJ A;  2OCE A;  3VQA A;  2F9W A;  1VQ9 N;  3CD6 N;  3TAF A;  1RFQ A;  2ETJ A;  1EWR A;  5J2M A;  5C10 A;  4OPA A;  3SBT A;  3VEX A;  1Q9X A;  4GV9 A;  4PL7 A;  1RBR A;  5BRF A;  4KH5 A;  3FZF A;  1C6V A;  3J7Y P;  4CJQ A;  1V4T A;  4OKE A;  1NM1 A;  4DU4 A;  5AQW A;  3VEW A;  3THV A;  1RBT A;  4KI6 A;  4WQ4 C;  5EVZ A;  3K5M A;  2Z1I A;  1D9F A;  3AVF A;  1EP4 A;  4MLH A;  4FZY A;  2YNF A;  2P9P B;  2QKK A;  4O8U A;  2E2O A;  3AO3 A;  4YOR A;  3S9H A;  3AVN A;  4BRG A;  4CJK A;  4F3T A;  4B8C A;  2ASP A;  2F8S A;  4O44 A;  4B1X B;  4FJN A;  4YDU A;  2CGL A;  2HW3 A;  1XHZ A;  4FVU A;  3HBT A;  4CZK A;  1NK9 A;  1X9W A;  2NLX A;  4LSL A;  1KFD A;  5M1F A;  4M3U A;  5KQD A;  2EHG A;  3TU5 A;  1TAU A;  3GOI A;  3K5O A;  3VGM A;  2OPS A;  3D0P A;  2RF2 A;  2I7N A;  3QDK A;  1Q81 O;  3OA9 A;  3ZYY X;  3MN5 A;  1VK0 A;  3QLH A;  3O9S A;  4I9L A;  1IBL K;  5C25 A;  5LL6 Z;  3O9Q A;  3F2K A;  3G0Z A;  1EO1 A;  1NG9 A;  4E3S A;  2FSK A;  4FWK A;  4C23 A;  3CCQ N;  2KFZ A;  4DS4 A;  4BRA A;  4LF7 K;  1VRU A;  4CJV A;  4MQ3 A;  4XEI A;  2P51 A;  2CGJ A;  4CK3 A;  3OYD A;  4JS4 A;  2FBT A;  5AQZ A;  3VF4 A;  1U45 A;  3OW2 M;  2HF4 A;  4KPY A;  5F0X A;  1RGI A;  3ZX0 A;  3J80 O;  3LPT A;  3BEX A;  4IZ9 A;  4F3O A;  4BAC A;  4AHS A;  5KQ8 A;  3KIO A;  2NRV A;  1YF5 L;  3NH1 A;  3AVC A;  3J7A P;  2ZF5 O;  4I7F A;  3AO1 A;  5DM7 L;  1WOQ A;  4KFB A;  4RWT A;  2Q97 A;  4DV7 K;  5JS1 A;  3AVH A;  4BR7 A;  2ZD1 A;  4NLB A;  5AR0 A;  4U7B A;  3FLC O;  1MWK A;  3BUZ B;  1VHX A;  4EP4 A;  3QBX A;  3VQ8 A;  3V81 A;  1RTI A;  1YTU A;  4DFP A;  4DQQ A;  2YNG A;  1KVC A;  5AQM A;  1RCH A;  3QNN A;  3MDQ A;  3LL3 A;  3MEC A;  3CFR A;  3CC4 N;  3T7Z A;  4CJ4 A;  1E4F T;  4LY7 A;  3LDO A;  4XH5 A;  2P9S B;  4B9U A;  3VA3 A;  5KTQ A;  2PYL A;  3G71 N;  2VGM A;  4DMN A;  1T8E A;  3LAK A;  4AHC A;  2QWR A;  4KHN A;  3AA5 X;  3V9W A;  3EL2 A;  4AHT A;  3LM2 A;  5AQY A;  4OLB A;  3O9R A;  4CFA A;  4IFY A;  3A8Y A;  4XH4 A;  3U4L A;  4O5B A;  1HQU A;  2HNY A;  3OS0 A;  4RG8 A;  3WEE B;  3LAM A;  3R9P A;  4IEE A;  4K43 A;  2WOM A;  4BRC A;  3MXI A;  3GDQ A;  4BRD A;  3ATV A;  2E20 A;  4KBO A;  1S3X A;  1NU0 A;  5SWM A;  2OAN A;  3RMC A;  1KLM A;  3KLI A;  4PWD A;  4IOX A;  4DR2 K;  4DLG A;  3F9M A;  1XNR K;  1ZBF A;  3CQY A;  3O1W A;  3WNH A;  5GAG P;  2BDP A;  4W5Q A;  3GG4 A;  1TKT A;  4A5B A;  3Q7B A;  5JS2 A;  2QA4 N;  1IKX A;  4CJ3 A;  5BRH A;  4JKD A;  4H8K A;  4GV6 A;  4M3T A;  3DRR A;  4JLH A;  1W9H A;  3V1Q A;  5AFU H;  3J7Z O;  1S5J A;  1RT3 A;  2BH1 A;  3KZB A;  3RRH A;  1YUW A;  1NGH A;  2FF3 B;  4MFB A;  2AJQ A;  2G8U A;  4BVP A;  3HPG A;  3EN9 A;  3C95 A;  1KD1 O;  4G9Z A;  2HND A;  4JHD A;  4CFC A;  4CJF A;  4JK9 A;  4TSX A;  2JLE A;  3THY B;  3K2P A;  2NZT A;  4LSN A;  1QSS A;  3P31 A;  1XWL A;  2OTL N;  4KB1 A;  3HRG A;  3ZSQ A;  1F21 A;  2Z1G A;  3C7N B;  4DR4 K;  3SQ4 A;  2JGU A;  5I3U A;  4FCY A;  1BA1 A;  2IAJ A;  3AA2 A;  3CJB A;  1U47 A;  3DI6 A;  4BRM A;  3T69 A;  3IDH A;  2HBJ A;  3O3G A;  4JN4 A;  4E89 A;  2G8H A;  4CHQ A;  4JI0 K;  2E4L A;  2YNH A;  1U48 A;  2D5R A;  4O5F A;  3O5B A;  4N56 A;  3BF3 A;  5FRO A;  4DSL A;  3QML A;  3ZT1 A;  3KK1 A;  1QZ6 A;  5EXW A;  4CGF A;  4CES A;  4PKG A;  3TR8 A;  4LFC K;  3TSP A;  4Q5V A;  4DF8 A;  1QVG M;  3CCM N;  4DU3 A;  1MWM A;  4LF5 K;  1SZ2 A;  4B08 A;  4DSI A;  3CG7 A;  3B8A X;  1XC3 A;  2HF3 A;  4CF8 A;  2IC3 A;  5F1X A;  4AQY K;  1IG9 A;  1IBM K;  3L4Q A;  3HK2 A;  2KZM A;  3EEQ A;  4NYN A;  1BA0 A;  5CZ2 A;  4DWI A;  5TKY A;  1S22 A;  5EY4 A;  1L3T A;  2P9U B;  4CJR A;  1BDG A;  2A1R A;  5AZI A;  3ZET B;  2Q31 A;  4XH1 A;  3HOS A;  5BRD A;  1NK5 A;  5I9E B;  3PX4 A;  1S9E A;  2UXD K;  1FJG K;  4DV5 K;  3FR0 A;  5GIN A;  3E66 A;  1QVF M;  4HWI A;  2R7Y A;  3THX A;  3V9U A;  4GY2 B;  4EP5 A;  4FVM A;  3H1Q A;  4HVJ A;  2D1K A;  1IKV A;  4CJ5 A;  3QFU A;  1TL1 A;  4ZTF A;  1J53 A;  3SQ1 A;  1YTA A;  4BR0 A;  4K8X A;  3TAB A;  1NGB A;  3ZSR A;  3NF9 A;  4Z4F A;  1T3V A;  2FF6 A;  5EOY A;  4DV1 K;  1ZBI A;  4IWV A;  2H3G X;  4KH6 A;  1ASV A;  2XY7 A;  2A1S A;  3B6P A;  4CD1 A;  3MX2 A;  4F8R A;  1W2B M;  3OYM A;  5CYQ A;  4B3T K;  1KQS M;  2W40 A;  4JI1 K;  4YOX A;  4DV2 K;  5JLF A;  5JIC A;  1OH6 A;  4H4O A;  3SUQ A;  3AVI A;  1LV5 A;  3O6W A;  3WXI A;  3QEW A;  3FZK A;  4KO0 A;  1J6Z A;  4FLT A;  1T7P A;  3OYI A;  1GLC G;  3HPO A;  1ATS A;  1BIZ A;  2QTD A;  5FPD A;  4JNE A;  4X62 K;  5M1K A;  4M3X A;  4DFJ A;  3UE5 A;  4CJU A;  1TUY A;  1XUP O;  4YOU A;  4IOA L;  4CED A;  3M8S A;  3ZSW A;  1X3M A;  3C6T A;  4M3Z A;  4IOC L;  4NXM K;  2Z1H A;  3CQX A;  2Q1N A;  3JSM A;  1BIU A;  2XY6 A;  2NNW A;  3D2E B;  1B9F A;  3QB0 A;  5TKW A;  4FWS A;  4LH5 A;  3SLC A;  4OO1 J;  3SI6 A;  4DTU A;  4DCH A;  1SKS A;  2Y1I A;  2UU9 K;  4GV3 A;  4BRL A;  1RBS A;  3H08 A;  1WAF A;  4JKB A;  4LFA K;  1K8K A;  4R5P A;  3V9S A;  3L2Q A;  5BPM A;  4LD0 A;  3PIP L;  4EFH A;  3CCU N;  1GOB A;  5AFU A;  3CFO A;  4C1N I;  3J81 O;  1HNZ K;  4OJR A;  4A62 A;  4FLW A;  1HYZ A;  2YI1 A;  4W5O A;  1KVA A;  2EX3 A;  5CZ1 A;  1MA9 B;  1VSE A;  3FZL A;  3M5R A;  2GEL A;  5F2R A;  1XMO K;  3LZI A;  3NBP A;  4JKG B;  2O8D B;  2PAV A;  3LPU A;  1I39 A;  2Y1J A;  3OS1 A;  1C0F A;  1TYQ A;  4J8F A;  5JLH A;  3ISN C;  5KRT A;  4DKW A;  1BL3 A;  4ICL A;  5AQN A;  1VSJ A;  4M7Y A;  3CM5 A;  4IJA A;  4BC5 A;  1S1V A;  1HNV A;  2A3Z A;  2VGN A;  3O08 A;  3DXM B;  1QSY A;  4CD3 A;  4NCG A;  1JXB A;  1VSH A;  4ZTJ A;  2W6L A;  3CPW M;  3T3F A;  1TVR A;  3TAN A;  4CEZ A;  4W5R A;  2P9U A;  3AGR A;  3AVJ A;  4DR1 K;  2E1Y A;  3ZET A;  3HL8 A;  5J2Q A;  2D0B A;  3T19 A;  4QS8 A;  1W0H A;  1R0A A;  3F73 A;  2P9I B;  2WBN A;  3SNN A;  3EYZ A;  3V9X A;  1J5O A;  2QI2 A;  1X3N A;  4YOV A;  1CZA N;  4BQZ A;  3SUN A;  1JL1 A;  2HHH K;  4BE0 A;  3U6F A;  1G99 A;  3CMA N;  3AVM A;  4DV6 K;  2RKI A;  1RT4 A;  2ZQB A;  2GWJ A;  3VQ4 A;  2HHW A;  2ZGY A;  3LDP A;  4WQ5 C;  4A59 A;  4ELT A;  1IH7 A;  3C6H A;  3HYF A;  1A5W A;  3M8Q A;  4DSJ A;  4BGA A;  3R3L A;  4K25 A;  2W41 A;  1ATN A;  4DB3 A;  4W5N A;  1HKG A;  1CLQ A;  1ZBS A;  4M3W A;  3NMU A;  2UXC K;  2HMP A;  3L4I A;  4DTS A;  4FJ7 A;  1BIS A;  1BCM A;  3IUC A;  3SAG A;  2YV0 X;  3MXM A;  1N8R O;  4I6M B;  2B5J A;  4HTU A;  3MWT A;  4JI6 K;  4K8Z A;  2O8C B;  2O8B B;  5LMN K;  4CEE A;  4CJT A;  1JLG A;  1JLC A;  1ATR A;  3EKU A;  1RT2 A;  3A5M C;  2DFF A;  2F9T A;  4CZI A;  3SV3 A;  3VF2 A;  2IVO A;  3H6E A;  2GX9 A;  1RIL A;  1BI4 B;  3LP0 A;  3BY5 A;  2VYP A;  3K59 A;  1K73 O;  2NUB A;  3P4I A;  1G15 A;  1U49 A;  2GBZ A;  2O4I A;  4H03 B;  4O8K A;  3AVB A;  3ASM A;  1S1W A;  2D4W A;  2OPR A;  2CH5 A;  4FK2 A;  3LDN A;  1J54 A;  4KTQ A;  3SCX A;  4LFB K;  3KK3 A;  3RMD A;  1OH7 A;  4DSF A;  3WT0 A;  4FLX A;  2I5J A;  3GE1 A;  5EX5 A;  1KC8 O;  1YAG A;  3O4N A;  1T6D A;  1X9M A;  3RSE A;  5HOO A;  3HVT A;  3JAM O;  1MDU B;  4JD2 B;  4ELU A;  1XQS C;  3QEP A;  2O8F B;  1R59 O;  2RHK A;  1VQK N;  1ITG A;  2IDO A;  2X78 A;  3FFI A;  4FPB A;  4JKE A;  5DM6 L;  2OZM A;  2F4V K;  2YJF A;  1P90 A;  4K0K K;  4M42 A;  2HHX A;  2HHQ A;  4WE1 A;  3I33 A;  4DR6 K;  1S1U A;  3VEY A;  3NHG A;  4AHV A;  3V6D A;  4WFB L;  4CI6 A;  5HLF A;  1QQO A;  3NH2 A;  3LAL A;  3E9L A;  2LSN A;  1TKZ A;  2YKN A;  4DTN A;  4HUE A;  1P8Z A;  3H3N O;  3OVN A;  4RTF D;  1IKW A;  3P39 A;  3EZW A;  4FOI A;  5IT9 O;  1ZYQ A;  1QS4 A;  3OY9 A;  4YOW A;  4CZJ A;  2YCH A;  3O80 A;  3K9J A;  3UB5 A;  3MX5 A;  1NKC A;  3JS6 A;  3VQ7 A;  4CEC A;  1QQC A;  4CZH A;  5AQV A;  4F2S A;  3PX0 A;  2HVI A;  2W42 A;  3UKR A;  3THW A;  2RPI A;  3RMA A;  2O8E A;  3PO4 A;  3DLH A;  2P9L A;  2QWO A;  2PY5 A;  1H1V A;  1NGJ A;  2JWK A;  3KJV A;  3N4P A;  1NKB A;  2PYJ A;  2Q3S A;  1OH8 A;  3ULE B;  4DQP A;  1TV6 A;  3WNE A;  3KKS A;  3IAY A;  2QEX N;  1TL3 A;  5BRE A;  5FRM A;  1I3A A;  4ISE A;  3VQC A;  4NB4 A;  1C1A A;  1TAQ A;  4AF1 A;  4QS7 A;  1OKJ A;  1T05 A;  3PX6 A;  2D0A A;  2V52 B;  3LDL A;  4O0J A;  5AQP A;  2KFN A;  1MU2 A;  5AZJ A;  4C8L A;  1BHL A;  1K9M O;  5H1S Q;  4JS5 A;  3I56 N;  3NAE A;  5HRP A;  1YXQ A;  3I0S A;  3PSI A;  1SKR A;  1TUU A;  5BR8 K;  3RRG A;  1E4G T;  1NMN A;  5BPN A;  3ITH A;  3F9K A;  1WSI A;  3LWL A;  1ZBL A;  1VSF A;  2E2P A;  1SAZ A;  3SUO A;  1NK0 A;  1JCF A;  4BR9 A;  2FC0 A;  4K41 A;  4BRK A;  4H4M A;  3VQD A;  4ZHR A;  1J9A A;  3AO2 A;  4WFN L;  4ISG A;  2VCP A;  4KV8 A;  4NYF A;  1VQ6 N;  3P1G A;  2O8B A;  1NKE A;  3O8M A;  4FLU A;  1VSD A;  2DY4 A;  3L2U A;  4NCB A;  1Q86 O;  3K5N A;  3C65 A;  3PIO L;  4KTW A;  2OTJ N;  4KTZ A;  4JI7 K;  4MDA A;  3V1R A;  5AQX A;  2P9N B;  4IFV A;  3CCR N;  3E9O A;  3HST B;  4B3S K;  1N6Q A;  2E1Z A;  4FJ5 A;  1LAW A;  3HXM A;  3TAM A;  2B6A A;  4PL8 A;  4B3R K;  1S6Q A;  2E6L A;  2ASO A;  1OVQ A;  1BG3 A;  4BWM A;  4CZF A;  4IXC A;  1HLU A;  1LOT B;  2NRX A;  4KH4 A;  1N36 K;  1SL2 A;  3ID8 A;  1SUQ A;  1HMV A;  5C12 A;  3I0R A;  1ASW A;  4J2D A;  4B9N A;  3KWG A;  4WQ5 A;  3SJJ A;  2PZS A;  4J2B A;  4CHZ A;  3LP3 A;  4JI5 K;  4FPA A;  2FBY A;  3OS2 A;  1EWQ A;  4KKO A;  2KQ2 A;  1N33 K;  3S3O A;  3PSF A;  4M7X A;  2FSJ A;  3A5N C;  3AA3 A;  4CJL A;  2O8F A;  3EKS A;  1EXQ A;  1REV A;  1UAX A;  5KGW A;  2P9P A;  1HUX A;  3MCA B;  4CZG A;  3CER A;  1BQM A;  4FJK A;  3TI0 A;  2GEM A;  2GV9 A;  4Z4C A;  1S72 N;  4DHY A;  3VN5 A;  2A5X A;  3T1A A;  4Z4H A;  1QHT A;  4AHU A;  3TAP A;  3CJ7 A;  2QWM A;  3KWI A;  2HHT A;  1LWE A;  2Q0U A;  1FKO A;  4ILG B;  4CFD A;  1SKW A;  3TPQ A;  3AVA A;  1CZB A;  4E1N A;  3SPZ A;  1Q18 A;  5M1P A;  1B92 A;  3DM2 A;  1ZBU A;  4NXN K;  3DXK B;  3UKU B;  3TAG A;  4JI3 K;  3W0L A;  3K58 A;  2V7Y A;  3G4S N;  3LWM A;  4H5N A;  3ZT0 A;  3ATU A;  4NO7 A;  4B3O A;  4OGE A;  4BR5 A;  3WXK A;  2ZJR L;  1A5X A;  1NK8 A;  1Z6R A;  3CJ9 A;  1NGC A;  4H5V A;  3AAP A;  1WUA A;  4FWQ A;  4IFE A;  1HKB A;  4C8O A;  1BO5 O;  5MLC Q;  2DTU A;  3NF7 A;  4PKH A;  4Z4G A;  4CEA A;  4L8R B;  2P5O A;  2QW9 A;  3R1X A;  3IMX A;  4FJX A;  3OYN A;  4FK0 A;  1QTM A;  1NOY A;  2KLA A;  2BGG A;  3ULE A;  1TGO A;  2DPN A;  3ZX2 A;  4CZL A;  1WB9 A;  5C24 A;  1ASU A;  4BQL A;  4KHU A;  5C2F A;  3I8B A;  4ISF A;  4WQ4 A;  1FW6 A;  1BWF O;  3NF6 A;  1GOC A;  4LF4 K;  1KCF A;  3VEV A;  1W7A A;  4DTM A;  2NRT A;  3D2F B;  1TKD A;  4BC3 A;  5HL7 L;  3ALY A;  2PBD A;  3CXC M;  4WFA L;  1YIT N;  3KD5 E;  3BGR A;  3T1Y K;  3IG1 A;  1VQ8 N;  2P9K B;  3QEI A;  4PKI A;  4O0I A;  3WNF A;  1VQ4 N;  3KLF A;  1I94 K;  2GWK A;  3ENO A;  3SYZ A;  5LJV A;  3G10 A;  4IKF A;  3TTD A;  5I42 A;  3KTQ A;  2QWL A;  4DV0 K;  4FZX C;  1ZXO A;  2QKB A;  3ENH A;  2HVH A;  1M90 O;  3KLE A;  4JKF A;  4EAH D;  4CGG A;  4HUF A;  4CEF A;  2G8K A;  1WN7 A;  4DR3 K;  1LW2 A;  4FW2 A;  3DMJ A;  3FGU A;  1GLD G;  4EHU A;  1YJ9 N;  4GVE A;  1DEJ A;  4DTR A;  3EY1 A;  3VF6 A;  1RT7 A;  4OLA A;  1S1X A;  2VWK A;  1IV0 A;  2P9S A;  3SPY A;  2CGK A;  2ZJQ L;  5A2Q O;  4CBU A;  3HSC A;  1JJ2 M;  4F4K A;  5AQS A;  2XO7 A;  4GKJ K;  2ITM A;  1NLV A;  3HTV A;  3KKR A;  2DFE A;  4JV5 K;  1NJY A;  3K57 A;  4N47 A;  3QO9 A;  3NF8 A;  4BG9 A;  1JL2 A;  4LF8 K;  2WON A;  5CHI A;  4ID1 A;  5HRS A;  4O55 A;  4J2E A;  4XIU A;  3A2F A;  4N76 A;  2QXL A;  3WEE A;  1RDU A;  3P38 A;  4FWM A;  3D6R A;  1FK9 A;  2NRZ A;  2WUS A;  3H46 O;  4Z4I A;  1VSK A;  1VQ5 N;  5M1Q A;  4M41 A;  1UA0 A;  4KRF A;  4CJP A;  1ILY A;  1GOA A;  4CK1 A;  2QXF A;  3IRX A;  1T03 A;  3VEZ A;  3RTV A;  3RR7 A;  3LP2 A;  3HZ6 A;  3W3D A;  3R6M A;  3NVK A;  3JYT A;  3VET A;  1X9J A;  1HPM A;  4AIL C;  4F2R A;  4E7H A;  1IJJ A;  3VGL A;  3CQ8 A;  3RWU A;  2FBV A;  2P1J A;  3I55 N;  3AV9 A;  1OVY A;  3O4W A;  2OZS A;  3E01 A;  5BN8 A;  3KK2 A;  3VEO A;  1Z05 A;  3AVG A;  5M1N A;  2VWJ A;  1VSI A;  3UKU A;  1VQN N;  5DMR A;  2F8T A;  4A57 A;  3DLR A;  1Z25 A;  1DTQ A;  3IS9 A;  1HNI A;  1RNH A;  4FWO A;  3K0S A;  4FWP A;  4H0V B;  5C0Y A;  3VA0 A;  3A5L C;  3CC2 N;  5D3G A;  4BDP A;  1D5A A;  1YHQ N;  1BGX T;  1LWC A;  2BTF A;  4DQS A;  3THY A;  2BAN A;  2ATQ A;  4B8A B;  3NGY A;  4CBX A;  3VGK A;  1KXP A;  5HRN A;  1LCU A;  4JK8 A;  3CM6 A;  3QES A;  4W5T A;  3C7N A;  1QSL A;  3VES A;  1WSE A;  2YNI A;  3KD1 E;  5AJ3 K;  3L6Q A;  1K8A O;  5KI6 A;  2YHX A;  1K6Y A;  1NGG A;  4Y1C A;  1RBV A;  1YVN A;  3C94 A;  3FZM A;  4ILJ A;  3RR8 A;  4MO4 A;  1HNW K;  4H5W A;  1X1P A;  4KHP K;  4M3R A;  2RN2 A;  3ZLJ A;  4FJM A;  1GLL O;  3SZ2 A;  3U8X A;  5C42 A;  3HM9 A;  4KHS A;  4BWJ A;  3SQ0 A;  4KAZ A;  1JLA A;  4CJW A;  1A5V A;  1HYV A;  3FE1 A;  4OGC A;  3MN6 A;  1XNQ K;  3CJ1 A;  3HJF A;  1HKC A;  4LC9 B;  3OJS A;  2YJE A;  5KRS A;  2ZE2 A;  2P9K A;  5K14 A;  1L3V A;  1M1K O;  4KHY A;  4BRF A;  4CEB A;  4M45 A;  4A2B A;  2VG5 A;  1NBW A;  1U6Z A;  2HHU A;  3HOT A;  4YOT A;  1EQY A;  4JKA A;  4JRP A;  4BRE A;  4CGI A;  1HYS A;  3HVR A;  4DG1 A;  3HM8 A;  3OBW A;  5GIP A;  2IGI A;  3ZT4 A;  4RW6 A;  3WXM B;  3SAH A;  3LM9 A;  2AA4 A;  2B4J A;  1DLO A;  5J1E A;  2V7Z A;  1NNE A;  2O4G A;  4DV4 K;  4AM6 A;  2OYQ A;  3UIQ A;  1OH5 A;  2FLO A;  3O9T A;  1KSP A;  4C8N A;  4DQI A;  4OPJ A;  3NGI A;  1NOZ A;  3U3Y A;  3JXU A;  1NJI O;  3WQT A;  3OYC A;  3HPH A;  4N41 A;  2QWP A;  3QBW A;  5HBM A;  4FOE A;  1TK5 A;  1IBK K;  4E0D A;  1DT9 A;  3OYB A;  2XY8 A;  1YVU A;  3C6A A;  3M3Z A;  4JKH A;  4N5S A;  1U2V B;  3MK6 A;  4Z0U A;  2A42 A;  2IVN A;  4UQG A;  4CER A;  3SQ2 A;  5GAE P;  1ZBH A;  4CEO A;  5HP1 A;  1VQO N;  1NGD A;  3VEN A;  3DOL A;  2E88 A;  3MN9 A;  4I2P A;  4B9Q A;  1NJZ A;  4BVO A;  3QNO A;  4HCC A;  4CEQ A;  3CCJ N;  2D0O A;  3WNG A;  5AQH A;  1C0G A;  1D9D A;  2D0C A;  4B1Z A;  2CH6 A;  3M6G A;  3WUH A;  5JMV A;  3OHR A;  3TSU A;  1GLB G;  3V1O A;  3TSQ A;  4FM2 A;  5KGX A;  1Q7Y O;  1L3S A;  2YHB A;  4X66 K;  1LW0 A;  2A40 A;  3CI5 A;  3E1Y A;  2IOC A;  3SAF A;  5ELZ A;  1N32 K;  4UY8 O;  4KRE A;  3EE9 A;  3MMV A;  3O9U A;  4Y1D A;  4MLE A;  3D2E A;  4MDB A;  1C0T A;  4JAX A;  3L0Q A;  4PHT X;  3WXL A;  4CJS A;  4FLY A;  2Q2R A;  3O3F A;  3G6E N;  4CCH A;  4IBN A;  4DSK A;  1RDC A;  4EZ9 A;  4RW9 A;  4IO8 A;  3ZSX A;  4E7I A;  4YNQ A;  3C0B A;  2GUP A;  1RTD A;  4CIG A;  4HUG A;  3F5T A;  4M63 C;  3ZSY A;  4BY9 C;  3CFP A;  5FPN A;  2WFB A;  5FRN A;  2ZJP L;  4LF6 K;  4CGH A;  3LDQ A;  1XI1 A;  4CHP A;  4Q0B A;  1Q82 O;  3FZH A;  4CGJ A;  3ZSV A;  2G8W A;  2OPP A;  1BCO A;  1RT5 A;  3OYH A;  3H1V X;  5J2P A;  4BG8 A;  2ASM A;  3SMP A;  3N4Q A;  5BR9 A;  3ULD A;  1WLJ A;  3PLA A;  4JKG A;  3OYK A;  2O8D A;  1HJR A;  4CF9 A;  4DTO A;  5AQF A;  3HP9 A;  4HHT A;  5GAD P;  3SV4 A;  4DFM A;  1YJW N;  2HMI A;  4FW1 A;  4B9M A;  4FWN A;  3CJA A;  3O1B A;  3QIO A;  4MO5 A;  4BRI A;  3CME N;  3D7E O;  2KZZ A;  1C0M A;  4BDY A;  4CF1 A;  2YHY A;  1L3U A;  3NGZ A;  3AVK A;  2YKM A;  3DXM A;  3KVG A;  1IG8 A;  4AH9 A;  2IVP A;  4FJG A;  2XHB A;  2HBL A;  4H0T B;  3QEX A;  3DJC A;  4RW8 A;  3A5O C;  3LP1 A;  1HR0 K;  5AQJ A;  3CF5 L;  3CIP A;  4OPH A;  3NCI A;  2P9I A;  1UWB A;  1VQM N;  2D0P A;  2KTQ A;  4A5A A;  4DTP A;  4JHD B;  1SL1 A;  2GTD A;  5CY4 A;  3CCE N;  3KK7 A;  4QAG A;  4BE2 A;  2RE2 A;  3CJC A;  1VQL N;  4DU1 A;  4JKC A;  3OYJ A;  2X74 A;  2E2N A;  4DLE A;  3EO3 A;  4U67 L;  3DRS A;  4WCE L;  2KW4 A;  3T1H K;  3Q7C A;  4DF4 A;  3AAR A;  4BRH A;  1LAV A;  4E1M A;  1DGK N;  1L5U A;  4B9T A;  1KTQ A;  1XC9 A;  2UUB K;  1NJX A;  5GIO A;  1TK8 A;  4EIA A;  5HRR A;  3IKM A;  3H3O B;  4DSE A;  1KRP A;  1YT3 A;  1NGF A;  2X6N A;  2VG6 A;  1U2V A;  3KLG A;  3DLL L;  3DLE A;  4E7K A;  1JLF A;  4I6M A;  3LZJ A;  4KHQ A;  1D8Y A;  3HO1 A;  5EU7 A;  4CFB A;  4YY3 K;  1NMD A;  2QM1 A;  4R79 A;  3QIP A;  2O8C A;  1RDB A;  3OBY A;  3OYA A;  4GNI A;  2UYT A;  3U3G A;  1VSM A;  1HQE A;  1JXE A;  1HRH A;  3DLK A;  3WQU A;  3B6O A;  4B9L A;  1Q9Y A;  5AZI B;  1VSL A;  1BI4 A;  3PV8 A;  4G1Q A;  5CYM A;  4YOY A;  4DQR A;  2DFH A;  1NJW A;  3OYG A;  3MN7 A;  4AHR A;  1GLF O;  1CXU A;  5E41 A;  4CF0 A;  3VQE A;  3FFK B;  5LMU K;  3THX B;  1YIJ N;  2J4R A;  4F9O A;  3WXJ A;  1XMQ K;  4H0X B;  3TAQ A;  4PQU A;  3A0I X;  4BRN A;  3QET A;  5AQL A;  4FL9 A;  4L3Q A;  4BR2 A;  3MCP A;  4EHT A;  4JD2 A;  1T44 A;  5LY3 A;  1JLB A;  3GL1 A;  3AVL A;  1CZ9 A;  4GMJ B;  1RT1 A;  1VAZ A;  4GW6 A;  1WBB A;  2JWL A;  2UUA K;  4IDH A;  4HCB A;  4BRQ A;  2I7P A;  4CJ7 A;  5CE3 A;  1Z26 A;  1NWK A;  4CHN A;  2IIR A;  1GLA G;  4ELV A;  3M8R A;  5JVH L;  4KI4 A;  5B8H A;  3MEE A;  4CBW A;  4JI2 K;  4BRP A;  2HNZ A;  2QWN A;  1GLE G;  3U9D A;  2EWS A;  4CGD A;  3BDP A;  3IFR A;  1NGA A;  4E1J A;  4FJ8 A;  1JCE A;  1NGI A;  3H45 C;  5FDL A;  4BR4 A;  1SS6 A;  4DTJ A;  3SMS A;  4KB0 A;  4DQ8 A;  2VG7 A;  4GVM A;  1EKE A;  3L2R A;  3BZK A;  3K9K A;  5IWA K;  3NE6 A;  4DTX A;  1IO2 A;  3ZCM A;  1RTH A;  2HBM A;  4WYB A;  3VQQ A;  2VQE K;  4DS5 A;  2BUP A;  1SQK A;  4BC2 A;  5BPL A;  4LF9 K;  3L2V A;  1E3M A;  4FJ9 A;  1UOC A;  1YI2 N;  4DUY K;  3CC7 N;  3D45 A;  1BUP A;  3V9Z A;  4M3Y A;  4B1Y B;  2WTU A;  2ZM6 K;  4FK4 A;  4RCH A;  4DR7 K;  4H5R A;  3S3N A;  4FJL A;  1K8K B;  2A41 A;  3QIC A;  3EE8 A;  3O3H A;  2YHA A;  3VQB A;  1Y64 A;  4BRO A;  3ZEU B;  4FSV A;  4FM1 A;  4E7J A;  4IJN A;  4IEI A;  3L3U A;  3E9P A;  1XHX A;  5KPZ A;  4LH4 A;  4X64 K;  2E8A A;  5BN9 A;  4CF2 A;  4YHH K;  3AGK A;  2G8I A;  1JLE A;  3VPZ A;  1KVB A;  1CXQ A;  3SJH A;  2A6A A;  2WC9 A;  3TAE A;  3O4Q A;  2KHO A;  4B1W B;  5AQQ A;  3VQ6 A;  3DAW A;  4I9Q A;  3AO4 A;  5AQI A;  1X9S A;  1JKH A;  1TYQ B;  3MEG A;  5C2D A;  3SK3 A;  3OYE A;  1WBD A;  3DYA A;  2VWB A;  4OX9 K;  4FZZ A;  3QFP A;  3AA4 A;  1QZ5 A;  4C8M A;  5GAH P;  1NK4 A;  5AQU A;  2X6S A;  4B1V A;  4NCA A;  4C1N K;  2UXB K;  2OA8 A;  3VER A;  3OYL A;  3S3M A;  1TK0 A;  1Y97 A;  3R8E A;  3J8A A;  4QOZ B;  1SL0 A;  3PUF A;  3SUP A;  4JK7 A;  1V4S A;  4PUO A;  5T7B A;  2P9N A;  3KLH A;  2Q36 A;  4O4G A;  1ZC6 A;  5FPE A;  4QCL A;  4FYD A;  3ZSZ A;  2W6K A;  5KPT A;  4OVL A;  3KHY A;  3TAR A;  5E84 A;  3CHW A;  3U9Z A;  2VQF K;  5LJW A;  1QE1 A;  5C15 A;  2QWQ A;  4B9V A;  1BU6 O;  3DLG A;  1RDD A;  1JCG A;  4RW4 A;  3CET A;  4OKK A;  4QS9 A;  4CZE A;  3PY8 A;  1FKP A;  4HTL A;  3CCL N;  3MED A;  3RVC A;  5J2N A;  4A61 A;  1UA1 A;  2G8F A;  4B1U B;  5ADX H;  1GLJ O;  3M1F A;  2YHW A;  4B9S A;  1ESV A;  2FXU A;  3RMB A;  4IG0 A;  3S41 A;  2YX6 A;  1EX4 A;  3HT3 A;  4H5T A;  3AAQ A;  1KAY A;  4FXD A;  3VMF B;  4K42 A;  2HOE A;  3VQP A;  2KKZ A;  5AQR A;  5AQG A;  4FLZ A;  3AO5 A;  2PFU A;  5CR4 A;  4YDU C;  4H0P A;  3DLB A;  2E6M A;  3GBT A;  2Z1J A;  3DXK A;  4JRQ A;  3AY9 A;  1C0U A;  4B3M K;  1Q8I A;  1O1W A;  3CYM A;  4CW7 B;  2P5G A;  3VTH A;  1C1C A;  1WSJ A;  4DUZ K;  5JVG L;  1VRT A;  2ITG A;  1T6C A;  4FJH A;  3NVM A;  4ILH A;  3ZT2 A;  1QHA A;  4IO9 L;  1QQN A;  1RDA A;  4J2A A;  1HPZ A;  4RW7 A;  2NRR A;  3MWP A;  1NGE A;  3NH0 A;  2NRW A;  3OYF A;  1C1B A;  3ZSO A;  5AQT A;  3C6U A;  1J5E K;  2Q0R A;  4CE9 A;  4DFK A;  3I8D A;  5AQO A;  1QQM A;  1S9G A;  4FO0 A;  2E5L K;  4JI8 K;  3VOV A;  3RSE B;  4OPK A;  2ZGZ A;  4I2Q A;  3TTC A;  3PO5 A;  4FM0 A;  3EZ5 A;  3ZEU A;  1IKY A;  4OKJ A;  1WNS A;  1FXX A;  2F7T A;  3M8P A;  4V19 S;  1S1T A;  1EET A;  3D2F A;  4IG3 A;  5SZT A;  3OTO K;  2E2Q A;  1RDW X;  3MAQ A;  3QER A;  2IS3 A;  4BC4 A;  4CIF A;  3BZC A;  3VQ9 A;  4NLC A;  3CCS N;  4FJI A;  1RTJ A;  1RT6 A;  2V51 B;  2GUI A;  2XRI A;  4FWR A;  2HHV A;  1O13 A;  3G25 A;  1HX1 A;  4Y0W A;  3DOK A;  4WF9 L;  2XY5 A;  4CIE A;  4Z94 A;  3LDS A;  3UKR B;  4H0Y B;  3THW B;  1DTT A;  4YFU A;  2BE2 A;  3P5J A;  2O8E B;  4FWL A;  1BQN A;  3P83 D;  2P9L B;  1DKG D;  2HBK A;  3K5L A;  3NDK A;  2NRH A;  1KFS A;  2QK9 A;  3TTF A;  1N5Y A;  3MXJ A;  4DR5 K;  4C8K A;  4E7L A;  3SBG A;  2HST A;  4ID5 A;  3OJU A;  1B9D A;  1TKX A;  1U04 A;  4CZM A;  2FSN A;  4H0O A;  4CJE A;  1WSH A;  4BGB A;  1WSF A;  1HNX K;  1SV5 A;  5DK5 A;  4PA1 A;  4E19 A;  1NK7 A;  5FPM A;  3HP6 A;  4JEP A;  3CPE A;  3V4I A;  3HI0 A;  3TWH A;  2FBX A;  1HJO A;  5AZJ B;  1VQP N;  1S6P A;  4X65 K;  3BP8 A;  3L8B A;  1U4B A;  4CHY A;  3ZX3 A;  1RBU A;  3VTI A;  4BE1 A;  3QIN A;  3NFA A; 
#chains in the Genus database with same CATH homology
 4CED A;  3M8S A;  3ZSW A;  3C6T A;  1LAV A;  4M3Z A;  4E1M A;  1L5U A;  4B9T A;  4C8O A;  1KTQ A;  2HB5 A;  1XC9 A;  1NK6 A;  3NF7 A;  2DTU A;  4Z4G A;  1NJX A;  4CEA A;  2Z1H A;  3JSM A;  2P5O A;  4L8R B;  1JLQ A;  1BIU A;  1KLN A;  1TK8 A;  4FJX A;  3OYN A;  5HRR A;  4EZ6 A;  1QTM A;  1NOY A;  4FK0 A;  4DSE A;  1KRP A;  2XY6 A;  2BGG A;  4CHO A;  1YT3 A;  1TGO A;  2X6N A;  1B9F A;  2VG6 A;  3KLG A;  5C24 A;  1ASU A;  4LH5 A;  4KHU A;  3DLE A;  4KHW A;  4E7K A;  3QEV A;  3SI6 A;  1JLF A;  4DTU A;  3LZJ A;  4KHQ A;  1D8Y A;  4PY5 A;  1SKS A;  3HO1 A;  4IDK A;  5EU7 A;  4CFB A;  2Y1I A;  2G8V A;  4FLV A;  2HHS A;  1RBS A;  3ZT3 A;  3H08 A;  1WAF A;  3NF6 A;  1GOC A;  3QIP A;  1KCF A;  1RDB A;  3VQ5 A;  3OYA A;  4DTM A;  1WSG A;  4Z4E A;  4R5P A;  2OPQ A;  1LWF A;  3U3G A;  3V9S A;  1TKD A;  3L2Q A;  4LD0 A;  1VSM A;  3DRP A;  3ALY A;  3L3V A;  1HQE A;  1JXE A;  4CK2 A;  1HRH A;  2F96 A;  1GOB A;  3BGR A;  3DLK A;  3KD5 E;  3L2W A;  3CFO A;  3IG1 A;  4BDZ A;  3QEI A;  3B6O A;  5HRO A;  3LAN A;  4B9L A;  1Q9Y A;  4OJR A;  4FJJ A;  1WAJ A;  4O0I A;  3WNF A;  4FLW A;  3KLF A;  1HYZ A;  3VQA A;  4W5O A;  1BI4 A;  3PV8 A;  1KVA A;  3SYZ A;  3TAF A;  2EX3 A;  2ETJ A;  4G1Q A;  5CZ1 A;  5CYM A;  5J2M A;  4DQR A;  2DFH A;  1NJW A;  1VSE A;  3OYG A;  4AHR A;  3G10 A;  4IKF A;  1CXU A;  5E41 A;  5I42 A;  1Q9X A;  3KTQ A;  2HVH A;  4FZX C;  2QKB A;  3LZI A;  4CF0 A;  1RBR A;  3KLE A;  3VQE A;  3NBP A;  4CGG A;  1C6V A;  3LPU A;  4HUF A;  1I39 A;  4CEF A;  2Y1J A;  4CJQ A;  3OS1 A;  2G8K A;  1WN7 A;  1LW2 A;  4FW2 A;  3DMJ A;  4OKE A;  3ISN C;  4DU4 A;  3TAQ A;  3THV A;  1RBT A;  4PQU A;  4KI6 A;  5KRT A;  3K5M A;  1BL3 A;  4ICL A;  2Z1I A;  4DTR A;  3EY1 A;  1D9F A;  3AVF A;  1RT7 A;  1VSJ A;  1EP4 A;  4OLA A;  4FZY A;  3QET A;  2YNF A;  3CM5 A;  2QKK A;  1S1X A;  1S1V A;  1HNV A;  2VWK A;  3SPY A;  1QSY A;  3AO3 A;  4F4K A;  4NCG A;  1JXB A;  1VSH A;  2XO7 A;  3S9H A;  1JLB A;  3AVN A;  4CJK A;  4ZTJ A;  4F3T A;  4B8C A;  1TVR A;  3T3F A;  4CEZ A;  3AVL A;  4W5R A;  3TAN A;  1CZ9 A;  3AVJ A;  3KKR A;  4GMJ B;  2DFE A;  1NJY A;  3K57 A;  2F8S A;  4O44 A;  4FJN A;  1RT1 A;  3HL8 A;  5J2Q A;  2D0B A;  3QO9 A;  3NF8 A;  4GW6 A;  4N47 A;  3T19 A;  1W0H A;  1R0A A;  2HW3 A;  3F73 A;  4HCB A;  1XHZ A;  1JL2 A;  1Z26 A;  3SNN A;  4CHN A;  4ELV A;  2WON A;  1NK9 A;  3EYZ A;  4ID1 A;  3V9X A;  5HRS A;  3M8R A;  1J5O A;  1X9W A;  4O55 A;  4KI4 A;  4LSL A;  3SUN A;  3MEE A;  1KFD A;  4XIU A;  3A2F A;  4J2E A;  4N76 A;  4M3U A;  1JL1 A;  2EHG A;  4BE0 A;  3U6F A;  1TAU A;  3K5O A;  1FK9 A;  3AVM A;  2OPS A;  4Z4I A;  2HNZ A;  2RKI A;  3D0P A;  1RT4 A;  1VSK A;  2ZQB A;  2RF2 A;  4CGD A;  3BDP A;  4M41 A;  1UA0 A;  4KRF A;  4CJP A;  3VQ4 A;  1GOA A;  4CK1 A;  2QXF A;  3IRX A;  1T03 A;  2HHW A;  4ELT A;  1IH7 A;  3RTV A;  3HYF A;  3RR7 A;  4FJ8 A;  1A5W A;  3M8Q A;  3LP2 A;  5FDL A;  4DSJ A;  4DTJ A;  1VK0 A;  3QLH A;  4KB0 A;  3JYT A;  4I9L A;  2VG7 A;  4GVM A;  1EKE A;  5C25 A;  4W5N A;  3L2R A;  4DTX A;  4AIL C;  3NE6 A;  4E7H A;  4F2R A;  1CLQ A;  1IO2 A;  3CQ8 A;  4M3W A;  3ZCM A;  3RWU A;  1RTH A;  4DTS A;  2FBV A;  3G0Z A;  4FJ7 A;  1BIS A;  3VQQ A;  1BCM A;  4DS5 A;  2P1J A;  4E3S A;  3AV9 A;  2YV0 X;  3L2V A;  3MXM A;  2KFZ A;  2OZS A;  2B5J A;  1UOC A;  3E01 A;  4HTU A;  4DS4 A;  4FJ9 A;  3D45 A;  3KK2 A;  1VRU A;  3V9Z A;  4CJV A;  4M3Y A;  3AVG A;  4MQ3 A;  2VWJ A;  2P51 A;  1VSI A;  5DMR A;  4K8Z A;  2F8T A;  4CK3 A;  3OYD A;  4JS4 A;  2FBT A;  3DLR A;  1U45 A;  4FK4 A;  1Z25 A;  3S3N A;  1DTQ A;  4FJL A;  4KPY A;  3IS9 A;  3O3H A;  1HNI A;  1RNH A;  2YHA A;  3VQB A;  4CEE A;  4CJT A;  1JLG A;  1JLC A;  1RT2 A;  3LPT A;  3VA0 A;  4F3O A;  4FM1 A;  4E7J A;  4BAC A;  4AHS A;  2DFF A;  5D3G A;  3KIO A;  3L3U A;  4EZ9 A;  1XHX A;  4BDP A;  1D5A A;  4LH4 A;  3SV3 A;  1BGX T;  3NH1 A;  3AVC A;  4I7F A;  3AO1 A;  4CF2 A;  2G8I A;  4KFB A;  1LWC A;  1RIL A;  1JLE A;  4DQS A;  1BI4 B;  3LP0 A;  2BAN A;  2ATQ A;  1KVB A;  1CXQ A;  4B8A B;  3NGY A;  3K59 A;  2NUB A;  5HRN A;  3QES A;  1G15 A;  3CM6 A;  1U49 A;  3TAE A;  3AVH A;  2GBZ A;  3O4Q A;  4W5T A;  5JS1 A;  1QSL A;  1WSE A;  2ZD1 A;  2O4I A;  3AVB A;  2YNI A;  3KD1 E;  3VQ6 A;  3ASM A;  1S1W A;  5KI6 A;  3AO4 A;  3RR8 A;  1K6Y A;  2OPR A;  1RBV A;  3C94 A;  4Y1C A;  4EP4 A;  4I9Q A;  4FK2 A;  3VQ8 A;  1X9S A;  1J54 A;  1JKH A;  1X1P A;  1RTI A;  3V81 A;  4KTQ A;  4M3R A;  2RN2 A;  4DFP A;  3SCX A;  4DQQ A;  2YNG A;  3MEG A;  3OYE A;  4FJM A;  3DYA A;  3KK3 A;  1KVC A;  3RMD A;  3SZ2 A;  1RCH A;  4DSF A;  3QNN A;  5C42 A;  3HM9 A;  4FLX A;  3MEC A;  4FZZ A;  2I5J A;  4KHS A;  3AA4 A;  4C8M A;  1NK4 A;  4BWJ A;  3CFR A;  3O4N A;  2X6S A;  3SQ0 A;  4KAZ A;  1JLA A;  4NCA A;  4CJ4 A;  4CJW A;  4LY7 A;  1X9M A;  1A5V A;  1HYV A;  4OGC A;  2OA8 A;  3OYL A;  3HVT A;  3VA3 A;  5KTQ A;  3S3M A;  1TK0 A;  1Y97 A;  2PYL A;  3OJS A;  4B9U A;  4ELU A;  3HJF A;  5KRS A;  3QEP A;  4QOZ B;  1SL0 A;  3PUF A;  4DMN A;  1T8E A;  1ITG A;  2IDO A;  2X78 A;  3FFI A;  3LAK A;  4AHC A;  3SUP A;  4PUO A;  2ZE2 A;  4KHN A;  5K14 A;  5T7B A;  3AA5 X;  3KLH A;  3V9W A;  2OZM A;  4O4G A;  1L3V A;  4M42 A;  4KHY A;  2HHX A;  2HHQ A;  4WE1 A;  4CEB A;  4AHT A;  4QCL A;  1S1U A;  4M45 A;  4FYD A;  4OLB A;  3NHG A;  4AHV A;  3ZSZ A;  3V6D A;  4OVL A;  2VG5 A;  4CFA A;  3TAR A;  5HLF A;  4IFY A;  4O5B A;  1HQU A;  3NH2 A;  3LAL A;  1QE1 A;  4B9V A;  2HHU A;  2HNY A;  2LSN A;  1TKZ A;  2YKN A;  1RDD A;  3DLG A;  4RG8 A;  4OKK A;  4RW4 A;  3OS0 A;  3LAM A;  4JRP A;  4HUE A;  3OVN A;  4CGI A;  2WOM A;  1IKW A;  3MXI A;  3HVR A;  1HYS A;  4DG1 A;  3PY8 A;  1FKP A;  1ZYQ A;  1QS4 A;  3MED A;  3OY9 A;  2IGI A;  5J2N A;  3ZT4 A;  4RW6 A;  1UA1 A;  2G8F A;  5SWM A;  1NKC A;  3VQ7 A;  2B4J A;  1DLO A;  5J1E A;  4CEC A;  3RMC A;  2O4G A;  1QQC A;  4B9S A;  4F2S A;  3PX0 A;  4FJK A;  2HVI A;  1KLM A;  3KLI A;  4PWD A;  2W42 A;  2OYQ A;  3UIQ A;  4DLG A;  3RMB A;  1YTU A;  4IG0 A;  2RPI A;  3RMA A;  1EX4 A;  1ZBF A;  3HT3 A;  1KSP A;  4C8N A;  3WNH A;  4DQI A;  2BDP A;  4OPJ A;  3PO4 A;  4FXD A;  3DLH A;  4W5Q A;  1TKT A;  1NOZ A;  3NGI A;  3U3Y A;  5JS2 A;  2PY5 A;  1IKX A;  3OYC A;  3HPH A;  4CJ3 A;  3VQP A;  3KJV A;  4N41 A;  1NKB A;  2PYJ A;  4H8K A;  5HBM A;  2Q3S A;  1TK5 A;  4E0D A;  4DTN A;  4FLZ A;  4M3T A;  3OYB A;  2XY8 A;  1YVU A;  3DRR A;  4JLH A;  1W9H A;  4N5S A;  3AO5 A;  3V1Q A;  4DQP A;  1TV6 A;  3WNE A;  4Z0U A;  3KKS A;  3IAY A;  1S5J A;  1TL3 A;  5FRM A;  1I3A A;  1RT3 A;  4UQG A;  4CER A;  3DLB A;  3RRH A;  2E6M A;  3SQ2 A;  3VQC A;  1C1A A;  4MFB A;  1ZBH A;  4CEO A;  2Z1J A;  5HP1 A;  2G8U A;  2AJQ A;  1TAQ A;  3DOL A;  3HPG A;  4I2P A;  3C95 A;  4JRQ A;  1C0U A;  1Q8I A;  1T05 A;  3PX6 A;  2D0A A;  2HND A;  1NJZ A;  1O1W A;  4CFC A;  3CYM A;  4CJF A;  2P5G A;  4TSX A;  4O0J A;  3QNO A;  2JLE A;  4CEQ A;  1C1C A;  1WSJ A;  4HCC A;  3K2P A;  4LSN A;  3WNG A;  1QSS A;  2KFN A;  1MU2 A;  1VRT A;  1XWL A;  4C8L A;  1BHL A;  2ITG A;  4KB1 A;  1D9D A;  3ZSQ A;  1F21 A;  2D0C A;  4JS5 A;  4FJH A;  3NAE A;  2Z1G A;  5HRP A;  3SQ4 A;  3I0S A;  1SKR A;  2JGU A;  5I3U A;  4FCY A;  3ZT2 A;  3RRG A;  1RDA A;  2IAJ A;  3ITH A;  4J2A A;  1HPZ A;  4RW7 A;  3AA2 A;  3V1O A;  3OYF A;  1U47 A;  3NH0 A;  4FM2 A;  5KGX A;  3F9K A;  1C1B A;  3DI6 A;  2YHB A;  3ZSO A;  1L3S A;  1WSI A;  1LW0 A;  3O3G A;  3LWL A;  1ZBL A;  1VSF A;  3SUO A;  1NK0 A;  2IOC A;  3C6U A;  4E89 A;  2G8H A;  4CE9 A;  4CHQ A;  2FC0 A;  2E4L A;  2YNH A;  4DFK A;  1U48 A;  2D5R A;  4KRE A;  4N56 A;  4H4M A;  3I8D A;  4Y1D A;  5FRO A;  3VQD A;  4ZHR A;  4DSL A;  1S9G A;  1J9A A;  3AO2 A;  3ZT1 A;  1C0T A;  3KK1 A;  4KV8 A;  4NYF A;  4CGF A;  4CES A;  3P1G A;  4OPK A;  3TR8 A;  1NKE A;  4Q5V A;  4CJS A;  1VSD A;  4I2Q A;  4FLY A;  4FLU A;  4DF8 A;  3PO5 A;  2DY4 A;  3O3F A;  3L2U A;  4NCB A;  4DU3 A;  3K5N A;  4FM0 A;  3EZ5 A;  4CCH A;  1IKY A;  4KTW A;  4B08 A;  4KTZ A;  4DSI A;  4OKJ A;  1WNS A;  3CG7 A;  4IBN A;  4DSK A;  1FXX A;  1RDC A;  3V1R A;  3M8P A;  4IFV A;  4RW9 A;  3ZSX A;  1S1T A;  3HST B;  4YNQ A;  1EET A;  2IC3 A;  4CF8 A;  4E7I A;  1N6Q A;  1IG9 A;  4FJ5 A;  4IG3 A;  1RTD A;  1LAW A;  3HK2 A;  2KZM A;  3HXM A;  5SZT A;  4NYN A;  4CIG A;  5CZ2 A;  4HUG A;  2B6A A;  3TAM A;  4DWI A;  1S6Q A;  2E6L A;  1L3T A;  3MAQ A;  3ZSY A;  4CJR A;  3CFP A;  3QER A;  2IS3 A;  4BWM A;  5FRN A;  2A1R A;  4CGH A;  4CIF A;  1XI1 A;  4CHP A;  4Q0B A;  3VQ9 A;  4CGJ A;  3ZSV A;  1SL2 A;  2G8W A;  2OPP A;  1SUQ A;  1HMV A;  1BCO A;  1RTJ A;  1RT6 A;  1RT5 A;  2GUI A;  2XRI A;  3OYH A;  1NK5 A;  3PX4 A;  1S9E A;  5J2P A;  2HHV A;  3I0R A;  1ASW A;  4J2D A;  3ULD A;  1WLJ A;  4B9N A;  3OYK A;  2R7Y A;  3DOK A;  1HJR A;  3V9U A;  4EP5 A;  2XY5 A;  4FVM A;  4CIE A;  4CF9 A;  3SJJ A;  4HVJ A;  4DTO A;  2PZS A;  4J2B A;  4CHZ A;  1IKV A;  3LP3 A;  4CJ5 A;  2FBY A;  3OS2 A;  3HP9 A;  3LDS A;  4HHT A;  1TL1 A;  4KKO A;  2KQ2 A;  4ZTF A;  3SV4 A;  1J53 A;  3SQ1 A;  3S3O A;  1DTT A;  4YFU A;  4DFM A;  3AA3 A;  1YTA A;  4FW1 A;  4CJL A;  2HMI A;  2BE2 A;  3P5J A;  4B9M A;  4K8X A;  1EXQ A;  1REV A;  1UAX A;  3TAB A;  1BQN A;  3P83 D;  3QIO A;  5KGW A;  3ZSR A;  4Z4F A;  3NF9 A;  2KZZ A;  1C0M A;  4BDY A;  3NDK A;  3K5L A;  4CF1 A;  1KFS A;  1BQM A;  1ZBI A;  1L3U A;  3TI0 A;  2GV9 A;  4Z4C A;  3AVK A;  1ASV A;  2YKM A;  3NGZ A;  3VN5 A;  2A1S A;  3B6P A;  4AH9 A;  2XY7 A;  2QK9 A;  3T1A A;  1N5Y A;  3MXJ A;  4FJG A;  4F8R A;  4Z4H A;  2XHB A;  1QHT A;  4AHU A;  3TAP A;  3OYM A;  3QEX A;  4C8K A;  4E7L A;  2HHT A;  4RW8 A;  5CYQ A;  4FJI A;  1LWE A;  3LP1 A;  1FKO A;  4ID5 A;  3OJU A;  1B9D A;  1TKX A;  4CFD A;  1SKW A;  3AVA A;  1U04 A;  1CZB A;  4CJE A;  4E1N A;  1WSH A;  3SPZ A;  3NCI A;  1WSF A;  1SV5 A;  1B92 A;  3DM2 A;  5DK5 A;  1ZBU A;  4H4O A;  1UWB A;  4PA1 A;  3SUQ A;  4E19 A;  1NK7 A;  3AVI A;  3TAG A;  1LV5 A;  3K58 A;  3HP6 A;  2KTQ A;  4DTP A;  1SL1 A;  5CY4 A;  3LWM A;  3QEW A;  3ZT0 A;  4KO0 A;  4QAG A;  3V4I A;  4FLT A;  1T7P A;  3OYI A;  3TWH A;  2FBX A;  3HPO A;  4BE2 A;  4B3O A;  1BIZ A;  3NFA A;  4DU1 A;  4OGE A;  1S6P A;  3OYJ A;  2X74 A;  3L8B A;  1U4B A;  4DLE A;  4CHY A;  4M3X A;  3DRS A;  2KW4 A;  4DFJ A;  1A5X A;  4CJU A;  1RBU A;  1NK8 A;  4DF4 A;  4BE1 A;  3QIN A;  1VSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...