1LWCA

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
506
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
total genus 146
structure length 506
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwcA05
4FXDA 1UA0A 1JLFB 4NRTA 1IKXB 4J9SA 4TY9A 2WOMB 1KFSA 4O3OA 2HNZA 3BQ2A 3TQ1A 4JUZA 1RTJB 1S6PA 5C42A 2F8SA 4DL7A 5C24A 4IFVB 4MKBA 4ECSA 4URSA 4J9LA 2XGPA 3G6YA 3ZSQA 4H4OA 5KFHA 4C8KA 1MU2A 4O0JA 5J2MB 5KRSA 3GIIA 3N6LA 1BGXT 3E01B 2F96A 5J2NA 4IG0B 2W9BA 1T3NA 4YNQA 3TAEA 1ZBHA 2DPIA 3QIDA 4FLXA 3V6KA 2PZSA 4OPJA 2FJWA 4CF2A 3HPOA 3H2LA 4F8RA 3NH2A 3CDUA 3EPIA 1S10A 3HVTA 4RUAA 1BCMA 3HK2A 1Q8IA 1HJRA 4WZMA 3ZT0A 1K6YA 4B3OB 3QESA 2IAJA 4Q8EA 1S4FA 4QW8A 4E0DA 1FK9A 4FS1A 5F8GA 3E51A 4RW8A 1ASVA 1U45A 3HVWA 4IH6A 4NLPA 2FBYA 1S9GB 3NBPB 5DQGA 3MEEA 4FJLA 4XIUA 4DEZA 3MFHA 4UQGA 1SKRA 4C8LA 5CYMA 1J54A 2X74A 1CZBA 3HSTB 5J2MA 3AVJA 3VQAA 4CFAA 4ECRA 2V4QA 1B92A 3G6VA 4KHMA 1C1AA 2UVUA 1JL2A 4FJ8A 2RKIB 3L2WA 1YTAA 4XO0A 4NLVA 1VSFA 4KI6A 1C0MA 3BSCA 1KRPA 3VQCA 2PYJA 3HYFA 2RDJA 4ED7A 3FSIA 2BRLA 3BSNA 3LPTA 4K4XA 1Z26A 4CF1A 1EETB 1EP4B 3P83D 1BQNA 3BJYA 4RNOA 1RTHA 3OVNA 3RRGA 1VSDA 1UAXA 2O4IA 2P5GA 5K14B 2Y1IA 3QYYA 4FM0A 2ALZA 3OY9A 3HXMA 3MXJA 4FCYA 3KMQA 3PO5A 4TQSA 2VG7A 5KFXA 3NF7A 1TKZA 2E6MA 1OS5A 4EYHB 4ELVA 4MFBB 3M8RA 1S1UA 3ICLA 2GBZA 2XCAA 2VG7B 2BRKA 4ED2A 5SZTA 3EZUA 3RB4A 4Z0UA 3OYLA 4G1QA 4EP4A 2G8HA 4YR0A 2IS3A 1NK8A 1FKOA 3DRPB 3F73A 3KTQA 3NH0A 5KGXA 4CIGA 4CESA 1SL0A 3V1RA 3NMAA 1RBVA 4N5SA 1S6QB 4ED8A 1RT2B 4KFBA 3MEEB 5E41A 4LSLA 4B9SA 4DFJA 1KFDA 4B9NA 5L1JA 3L3UA 5L1KA 4CHZA 4OKEA 2R2TA 2V4RA 2JEFA 2R8KA 4CGFA 3HHKA 1U09A 4URGA 2X78A 2FVRA 1QHTA 1NK9A 4KSEB 4F4XA 3QINA 2W8LA 2A1RA 4B8CA 4MIAA 3M8QB 3QERA 1W0HA 1QSYA 1L3SA 3VQ7A 3ZSZA 4JRQA 4Q0BA 2V0NA 2D3UA 4KBIA 4CJQA 3AVCA 1IKYA 2I1RA 4FLWA 1KLNA 4I2PA 1NOZA 3I5AA 4QAGA 1T7PA 5EUHA 2XC9A 3CFPA 4IG3A 3PJXA 1RT4B 1ZETA 2DFEA 3C6UA 2QE5A 4E19A 4KE5A 4IQXA 1VRUB 1JXEA 4DSEA 2BR0A 5F9LA 3M9MB 1QAJA 4JRPA 1DLOB 1KHWA 2D3ZA 2XY7A 4Y34A 4CIFA 5HRNA 4CJSA 4RW8B 1LW0A 3CJ2A 3K5NA 3AO1A 2JEJA 2R7YA 5I3UA 3DYAB 5KFRA 4EBDA 3IRXB 2OYQA 3P1GA 3CFOA 4GC7A 5D3GA 2IM2A 4DTPA 1GOCA 4ZHRA 3JYTB 4BE2A 2C2RA 3V9WA 3LZIA 1RT2A 4DTOA 3QEPA 1HQUB 1S1XA 2VWJA 3PW0A 3O4NA 3I0SA 4IFYA 2ILZA 3K58A 4EZ9A 2RN2A 5KFIA 4AILC 4K4YA 1IG9A 1YTUA 3DRPA 1XR5A 3T5JA 1SV5B 4DTUA 5KG3A 3KLIB 4M3UA 5KT4A 2DPJA 3BSAA 2BE2A 2YKMA 4XPEA 1BIZA 3LWLA 2B6AB 4DL6A 3FQKA 4KB0A 4C8MA 3EPGA 2HNYA 3D0PA 3QLHA 3N6MA 3LP1A 3OYFA 4TLRA 3SQ1A 4J9RA 3H4BA 3NGZA 3L8BA 4JV2A 4FJMA 3M8PB 1I3AA 5KFCA 3AVIA 4HCCA 5DLFA 2HHWA 1ZBUA 1X9WA 4FZZA 4Q8FA 4KV8B 3V9SA 5KFDA 1RAJA 4ED1A 1JLAA 4CEDA 1W25A 3OYHA 3K5OA 4ZP6A 1JKHA 3RAXA 5I42B 2E9ZA 4DTJA 1T03A 3S9HA 4ED0A 1RT1A 1XHXA 2YNHA 3OL8A 3TVKA 3RMAA 3NCIA 4YMEA 1A5VA 2YNGB 5DGBA 4KB7A 4ZPCA 3DRRB 4FW2A 4KHWA 3SQ2A 4ZPDA 4OPKA 1JIHA 4BE1A 3TAQA 4TY8B 4CJVA 3VQBA 1JX4A 3HPHA 3G10A 2C28A 2C2EA 3K59A 3NF6A 3RMCA 4CJTA 3ISND 2AGQA 3AVHA 5KTQA 1I39A 4FJHA 1QE1A 3AVKA 3BGRA 5F9NA 4LQ9A 2HVHA 1WSJA 4EBCA 2OPPB 4DF4A 1CXQA 3WNHA 3LALA 3B6OA 3D5MA 5D3GB 4DTXA 3PY8A 4NRUA 2CJQA 3V81B 4IG3B 2UVWA 4CF9A 4ECUA 3SUPA 1UA1A 3HJFA 4FJNA 1S1TA 2IM3A 1MMLA 1GOBA 1NOYA 3RWUA 3QGHA 5DG8A 4LH4A 4ZPBA 4RW7B 1QS4A 3NFAA 3PZPA 1RYRA 3AO2A 3OS0A 4J9KA 2F8TA 4QCLA 3OL9A 1KSPA 1B9DA 4ELUA 3OYAA 4F50A 1A5WA 5HRRA 4CFCA 5DQHA 3H5UA 3RB6A 2FVCA 5HP1B 3DOLA 2OH2A 1XR6A 1VSIA 3IN5A 1EKEA 3KK1B 5JS1A 5HBMB 3I5CA 5KFQA 3V6DA 4J9NA 4FVMA 3K2PA 4DS4A 4F4WA 4RNFA 4AHUA 2HNZB 1S0OA 4K50A 3PW7A 3KK2A 3SUOA 3MEGA 2JC0A 3ZT2A 2IJFA 2XI2A 3H5XA 4RNNA 3L3VA 1RTIB 4E7IA 2AX0A 3VQQA 4FJ9A 2W42A 3CIZA 4KHUA 4G1QB 1RTJA 1JLAB 3G86A 3SV4A 1QQCA 4CK2A 3TABA 4KV8A 4ECYA 3KLHB 3DLRA 3LP2B 4Z4HA 4CERA 1XHZA 5KFVA 4DS5A 3H5YA 3QO9B 1U48A 3QNOA 4E1MA 3VN5A 4EO6A 1U47A 3DM2B 2Y1JA 1SUQB 3ALYA 2RF2A 4F4ZA 4DSFA 3K57A 1EP4A 1CLQA 3FRZA 3MR2A 4B08A 1BISA 2WRMA 4ID5B 1TL1B 4CJUA 5JUMA 3PX6A 4ZHRB 1TKDA 4OGEA 4K8ZA 1LV5A 2BE2B 4RW6B 3HP6A 4R5PB 3ZSYA 5KFLA 2G8IA 2ILYA 3OLAA 4DQRA 1X9MA 1LWCB 3T5LA 1N5YB 4ECTA 3D45A 3SPYA 2YNIB 2R2SA 1RT7B 3TAFA 4CJKA 1J5OA 3U6FA 4M45A 1RDRA 1T8EA 3OS1A 1ZTTA 4WE1A 2GUIA 3PW2A 3TAGA 2RKIA 4O44A 2VA3A 4KHNA 2OPQB 2R8HA 1VK0A 3H5SA 3JSMA 4FJ7A 4RNHA 3I8DA 4B3OA 1N4LA 4J2DA 1GX5A 3AVNA 1NKCA 4M42A 5F8HA 3OYCA 2B5JB 3IGVA 1U49A 1CZ9A 2FBTA 1UWBB 5KFEA 3C94A 4LSNA 4KI4A 2V9WA 4N47A 3BSOA 2JEIA 3VQ8A 5J2NB 1RT6A 2JC1A 4CEBA 4NLYA 2YNHB 1IKYB 4F3OA 2IC3A 1TQLA 1O1WA 3MXMA 5I42A 3VQPA 1S6PB 4CK1A 1KLMA 2D41A 3SFGA 1S6QA 3V1QA 1ASUA 1D8YA 1JL1A 3V4IB 1K1SA 2D0AA 5DG7A 1N48A 3NH1A 2WONB 5KFMA 2GIQA 4R5PA 3QZ7A 3CDWA 1JKHB 3TARA 4O44B 4BDYA 4TXSA 3QEXA 4CK3A 2ATLA 1NKBA 4IFVA 4RUCA 2HHXA 5KG5A 4BACA 4FK2A 1S1UB 1TL1A 4OL8A 4KTWA 4J9MA 1QSLA 2Z1GA 2D7SA 5EWGA 4ZVHA 2DY4A 4G3IA 3ASMA 2XO7A 5KT5A 3OYJA 3RB0A 4QWBA 3CM5A 1FKPA 2BANA 2OPRA 1HARA 2YKNB 5KFKA 2AGOA 4CJWA 1HMVB 2UVVA 3M8SA 1NHUA 4LD0A 1IH7A 3CG7A 4U6PA 2UVRA 1BL3A 4BWMA 4NLXA 4DSKA 1HNIB 4OLBA 4OKJA 4J2BA 4DSLA 3TI0A 4I2QA 4Q44A 4CECA 4KAIA 3C6TB 4NLOA 1SH2A 1JLBA 3DI6B 2WCXA 2G8VA 2FJXA 5C25B 1LW2A 3I0SB 3QZ8A 3LP0B 4O0IA 4NLDA 4RW7A 1C0TA 4NLGA 4O3QA 3KK1A 3SZ2A 1Q9YA 1N56A 2A1SA 4KKOA 4KHYA 4DQIA 1LWEA 1DTQA 4M3WA 3SI6A 3CJ0A 4CEAA 3LWMA 4BDPA 3KHGA 4GMJB 4DF8A 3QGIA 5KFJA 3BDPA 4M3TA 2WONA 3TANA 2UUTA 3MEDA 3KLFB 1R0AA 3LP3A 2FVPA 1DTTB 4E3SA 1KVCA 2E9TA 2IGIA 2D0BA 4F3TA 1DLOA 4FLTA 4M95A 2XI3A 2IBKA 2HMIA 4H54A 3MXIA 4DL3A 3PJWA 2B5JA 1T94A 3H98A 3OYIA 1S1WA 4JLHA 5L1LA 1S1VB 1JLCB 2E6LA 3T5HA 5CY4A 2HMIB 3V1OA 3NKYA 1C1BB 5J1EA 3VQSA 1VRUA 1S9EA 5KFSA 4FLUA 4M3RA 3AO3A 4FJJA 3NDKA 4E7KA 1NJWA 1TK8A 1RYSA 4TQRA 3BQ1A 1S9EB 1RCHA 4LSNB 3CJ5A 4B9TA 3F9KA 4CF8A 4J9OA 2PYLA 1RDBA 3M8QA 2B43A 3SUQA 2HW3A 2YNFA 1RA6A 4TYAA 3DLBA 4QWDA 4DQQA 2WOMA 1NK6A 3H08A 4FZYA 1KTQA 4FS2A 4K4UA 1IKWA 1RT5B 4I7FB 3DI6A 4WE1B 1YVUA 5DG9A 1SL1A 1RDDA 3PW4A 5C24B 1Z4UA 5KFTA 3DLKA 4RNMA 4K4TA 3QEIA 5KFOA 4B9VA 3KNAA 1HYZA 3QNNA 3NAEA 1YT3A 3UR0A 2B6AA 2WK4A 4K4VA 3ITHB 5L9XA 4ICLB 4DU3A 3BR9A 3AA5X 3S3NA 5KG4A 4ECVA 4KTZA 1FKPB 2OPRB 4RW4B 3ISNC 3VQ5A 4EEYA 5F8JA 5CZ2A 4HKQA 1B9FA 3S3MA 3C6TA 1L3UA 2HWIA 3ZT4A 4HCBA 3SQ0A 3I5BA 1BHLA 1NJZA 1HNIA 3OYMA 4PWDB 3MR5A 1HQUA 1S1XB 4NLUA 4DL2A 4ED3A 3KLVA 5EWEA 4PUOA 2ZQBA 1TVRB 5KFBA 4XPCA 2EC0A 5K14A 3FFIB 4FJKA 4M3YA 2YKMB 4Z4FA 4KPYA 4HHTA 3D28A 2KZZA 3G6XA 3OYGA 1HQEB 4O3RA 1SV5A 4C8OA 2W9CB 3DOKA 1F21A 3V6DB 1NJYA 4NLQA 3QLHB 4Y2CA 3KKRA 3KLHA 3RRHA 3RR8A 2WB4A 2EHGA 2KFZA 3V9ZA 3AA4A 4QPXA 3WNEA 4FJXA 1JLEA 1Y97A 4DTSA 4OJRA 4Z4EA 3P5JA 2Q3SA 5DGAA 4I7FA 3IRXA 3MEGB 4CIEA 1FK9B 3Q8SB 5FRMA 2J6UA 5CYMB 1ASWA 3HP9A 2CKWA 1CXUA 3RBDA 4CJFA 1BIUA 5DQIA 3KLGB 1S9GA 3DLHA 1WNEA 2YNFB 3CVKA 1TAUA 4IR1A 1JXBA 1HNVA 3DLEB 2FVSA 4Q45A 2WTFA 4HYKA 1T05B 3DLGA 1C0UA 2X6SA 3K5LA 3M9OB 1R0AB 2R2RA 2J6TA 2W9BB 3V81A 3MECB 5F8IA 2VG6B 2VWKA 5KFYA 3NGDA 1T05A 3HVTB 3H4DA 3TWHA 2ZE2A 4AHVA 4DTNA 4DSJA 1QE1B 3OHBA 3HL8A 4CEFA 4IH7A 2IM0A 2YNIA 2BQ3A 3BGRB 1WAJA 2Z1HA 3LP0A 4TY8A 5KFAA 1YVFA 4CGIA 3PV8A 3E01A 2AJQA 3IS9B 5KFNA 1MU2B 3KLFA 4W5QA 3AV9A 1S9FA 4HUFA 2HB5A 1GOAA 2QK9A 4HUGA 4QWEA 1JLGA 3ZSRA 4N41A 3ZSVA 1RBUA 3CO9A 5KFWA 2OPSB 1LWEB 4PY5A 5HROA 3NGYA 1DTQB 5KFZA 4IRKA 4FLZA 2AWZA 3SV3A 3VQ9A 2FJVA 3T5KA 3NHGA 4WXWA 3G0ZA 5JS2A 2W9AA 3IG1A 4IDKA 1JLFA 5DK5A 4CJ3A 5KGWA 4YQWA 1FKOB 4J9QA 1LWFA 4B9LA 1IM4A 1S49A 4KREA 2ATQA 5FROA 1XWLA 4GW6A 4PUOB 4PWDA 2XCPA 3DRSB 4YP3A 3O4QA 2QKKA 1XR7A 1NK7A 4ZVEA 3UQSA 1WSEA 1KCFA 3WNGA 4CHPA 3HT3A 3V9XA 4CFDA 4ECQA 5KRTA 2XGQA 3NAHA 3OYDA 3VQDA 5T14A 4ZVGA 3AVAA 5KG1A 4ECXA 4FBTA 3N6NA 4O3SA 3OJSA 3TR8A 4F4YA 4ZTFA 2RPIA 4WFZA 2HHTA 4Y1CA 4DL4A 1ZTWA 2FC0A 1RT3A 2EX3A 2IC3B 3U3GA 4Z4IA 4DTRA 1TL3B 1LAVA 4PQUA 4IKAA 1TKTB 3JYTA 3GV7B 2ITGA 1D1UA 3NGIA 2JGUA 3Q8RB 1BQNB 2Z1JA 1HPZA 4MKAA 1CSJA 4ZP9A 1KLMB 1TKXB 4J9PA 1ITGA 1RDAA 4DMNA 1VSLA 5KG7A 5HROB 4F4KA 1RT4A 4H4MA 4IRCA 2E4LA 2VG6A 2OPQA 3MECA 4NCGB 1VSEA 4ELTA 5HLFB 2BQUA 4FK4A 3SYZA 4H4MB 4MK8A 5L1IA 5CYQA 2XRIA 5KFFA 4FZXC 1HNVB 3DLEA 2W8KA 5FDLB 2RDIA 4RW9A 2GIRA 3V6JA 3H40A 2XWYA 1TV6B 4FJ5A 4ZTJA 1LWCA 4QWAA 1RTDB 4NLTA 2P1JA 1IKVA 3KKSA 3OHAA 4E7HA 4EO8A 1A5XA 4YR2A 5KFPA 4RW6A 1TAQA 4DFPA 4CHYA 1Q9XA 4KO0A 3HO1A 5F8MA 3EY1A 1G15A 3ZCMA 4NYZA 2HHUA 2ASDA 4YFUA 2QKBA 4K4WA 5JXSA 4CJ5A 3SI8A 1SH0A 2IDOA 2IOCA 3KK3A 3AVMA 2G8WA 3OL6A 3KHRA 1VSMA 5KG2A 1WSGA 4Q43A 2YNGA 1SUQA 4GVMA 1HMVA 1NK5A 2YKNA 4K4ZA 3L2RA 4YR3A 4NLWA 3VA3A 4NZ0A 3LAMA 3AVGA 4NLSA 4CE9A 4I2QB 3NF8A 3KD1E 3DMJA 2XHBA 4O4RA 5CZ1A 3GILA 2AQ4A 2ETJA 1BQMB 3SCXA 1W9HA 4Y2AA 3PR5B 2BANB 2E9RX 1TP7A 4ID1A 4JS4A 4CGDA 3H59A 2P5OA 3RR7A 2FBVA 3EZ5A 4WYWA 2HHSA 3T19A 1RBSA 2O4GA 4OLAA 3MAQA 3RB3A 4NCBA 4DQSA 3Q8PB 2IMWP 3SJJA 1JLQB 3NF9A 2D0CA 3DRSA 4FJGA 4ZP8A 4Z4CA 2HNYB 2PY5A 4KAZA 1I6JA 4O3NA 4EBEA 4CGGA 5KI6A 1S97A 3DOLB 3GYNA 3CFRA 1D0EA 4CEZA 3L2UA 1WSIA 3KLEA 1RTHB 1JLGB 1XC9A 4H8KA 1IKWB 1RT5A 3KLIA 3ZSWA 2YHBA 1WSFA 1TK0A 1C1BA 5J1EB 1BI4B 1IKVB 4WZQA 2R2UA 3V4IA 4CGHA 1LW0B 4IKFA 4DG1A 4IFYB 4W5TA 4E7JA 4CHQA 4CGJA 4HTUA 3SFUA 1TV6A 4I9LA 3L2QA 4IRDA 4LY7A 4M3XA 1VSHA 5FDLA 1N6QB 4F2SA 4WFXA 1TGOA 4KO0B 3ULDA 4MH8A 3AO5A 4NCGA 4N56A 1LAWA 2IM1A 4RG8A 4E89A 3OYNA 2G8KA 2HAIA 1WNSA 3AA2A 2QV6A 3T1AA 3QIOA 2XY6A 1RTDA 1JLCA 4NCAA 2OZMA 1TKXA 1VRTB 3K5MA 1TK5A 3DDKA 3QGGA 1BI4A 4MQ3A 3L2VA 4QWCA 4WFYA 4OGCA 1Z25A 4FJIA 5KFUA 1GX6A 3CYMA 4CJRA 4M94A 4RU9A 2QXFA 1C1CB 2OZSA 1TKTA 2HNDB 3EYZA 4E7LA 3BQ0A 1S1VA 3SPZA 3UPFA 1NJXA 4N76A 4K8XA 3PUFA 4DG1B 4FYDA 3ZSXA 3AVBA 4EZ6A 4IG0A 3V9UA 3C95A 1VSKA 3PVXA 1LW2B 5KFGA 1S0NA 2W9CA 2DFHA 4AHSA 1J53A 4URQU 3LDSA 3TAMA 1TVRA 4BDZA 3WNFA 3AVLA 4W5RA 2BQRA 4DLGA 3CWJA 3O3GA 4MFBA 5J2PB 4ID5A 1BCOA 4KFBB 4Y3CA 4W5OA 4O5BA 3OS2A 4BWJA 3FQLA 1HQEA 3DM2A 3BREA 1S5JA 3RMDA 3B6PA 2ZD1A 3T3FA 5FRNA 3FFIA 3IGNA 2OA8A 4HVJA 4FM1A 1RTIA 4EYIB 3RBEA 4Q5VA 3RMBA 4DWIA 4ICLA 2ZD1B 4CEOA 4ECWA 3IG1B 4IDKB 3LP2A 3HPGA 4JV0A 2LSNA 1BQMA 2R8GA 3AA3A 2BDPA 1IO2A 3KK3B 3GV5B 5KT2A 3LZJA 3PX4A 3ZT1A 4FLVA 3MTKA 3I0RB 2BGGA 4ED6A 2HHVA 1QTMA 2HHQA 3Q8QB 3HM9A 2FLLA 1QUVA 4R8UA 4K4SA 3CQ8A 3VQ6A 2OPSA 1WLJA 5HP1A 3PR4A 1X9SA 2FLNA 3SQ4A 5I3UB 4CJ4A 1EETA 4O4GB 4NLRA 4QW9A 4CFBA 5DLGA 1U04A 4JS5A 3QEVA 1EXQA 1ZYQA 2IA6A 3NBPA 4ZMMA 4C8NA 4DU4A 2ZKUA 4KHRA 2C2DA 4CJEA 4ZVFA 3S3OA 2XY5A 5DMRA 3KIOA 4J2EA 3HKWA 4DU1A 3NAIA 2W7PA 1RT6B 3QIPA 3NL0A 1C1CA 5F8NA 4I2PB 1QSSA 4M41A 3IS9A 1C0UB 2JEGA 4AHCA 3M9NB 1RT7A 1UWBA 4KHQA 4RW9B 1VRTA 4F2RA 3KJVB 4FK0A 3MF5A 1HPZB 4IBNA 1ZBFA 4O4GA 2ZE2B 1EX4A 1L3TA 1ZBLA 3KD5E 3C6UB 3GIKA 3JSMB 4LH5A 2VA2A 4ZPAA 5HRPA 4KB1A 1REVA 2GC8A 3TAPA 4OVLA 3LAKA 1J5OB 3DLGB 3AVFA 1S1WB 2R8JA 4OKKA 2P51A 2DFFA 4LQ3A 1C2PA 1N6QA 1WN7A 3CJ3A 1J9AA 4B9UA 2KZMA 1NNDA 2WHOA 4KHSA 3CDEA 1NHVA 2VG5A 1N5YA 3ZT3A 3DRRA 3KLGA 1JXLA 1VSJA 2X6NA 3OYKA 1NK4A 1WAFA 4W5NA 1KHVA 1RT1B 3HVAA 3KLEB 1RILA 4RZRA 3OL7A 3LPUA 2F8EX 1D9FA 5C5JA 5EU7A 1TL3A 5KG0A 2YV0X 1NKEA 1JLBB 1RT3B 4I9QA 1RNHA 4CJPA 2C22A 5KG6A 5EDWA 1K1QA 5C42B 3LANA 4DLEA 1C6VA 2I5JB 2W7OA 1NK0A 2AU0A 5C25A 4IR9A 3M8PA 3KHLA 3RTVA 4TN2A 1RBRA 2KTQA 3NE6A 1S0MA 4TSXA 4JV1A 3GIMA 3CJ4A 2RF2B 1SL2A 3PW5A 4KRFA 4CEEA 1LWFB 2DTUA 4RW4A 3OSNA 3THVA 1HYSB 3LP1B 4AH9A 3ITHA 1QAIA 3U3YA 1XI1A 5J2PA 5SWMA 1X1PA 4EP5A 1HYSA 5KT3A 2KQ2A 4TYBA 1SKWA 5F8LA 3DLKB 3PHEA 2HNDA 2R8IA 2Z1IA 4U7CA 3TAMB 2KFNA 3KOAA 3V6HA 3PX0A 3GQCA 3OLBA 2AGPA 3A2FA 3KK2B 3DYAA 1WSHA 4DTMA 5KT6A 1L3VA 5J2QA 3MR6A 5HBMA 3ZSOA 2VG5B 4CCHA 2HVIA 4IOBA 5CYQB 1HRHA 4E1NA 2FVQA 4NYNA 2IJNA 1SKSA 4NYFA 1SH3A 3VA0A 2OPPA 2J6SA 1RBTA 4Y1DA 4FM2A 4WYLA 4HUEA 1D9DA 2GV9A 2G8FA 3GIJA 4QOZB 5T7BA 4AHTA 4X2BA 4BE0A 1REVB 2XY8A 4MK9A 1DTTA 4CHOA 2AX1A 1RDCA 5HLFA 4B8AB 2IAJB 4MIBA 2ASJA 3SUNA 5HRSA 3MEDB 1D5AA 4ZP7A 3KMSA 3UDLA 3MR3A 1UOCA 1T03B 4Q0BB 3VQEA 3KJVA 4DFKA 2FBXA 4KKOB 4DL5A 2YHAA 1U4BA 3O3FA 1KVAA 3QETA 3OSPA 4M3ZA 5J2QB 4CEQA 4CF0A 1C0TB 3IAYA 2NUBA 4J2AA 4DFMA 1S1TB 2O5DA 3QIPB 4B9MA 4FW1A 3OYBA 2KW4A 3OJUA 3RAQA 2G8UA 4FBUA 4WXOA 4PQUB 2UUWA 4H4OB 1HYVA 4CJLA 2D5RA 4R8UB 3FDSA 2HWHA 4MK7A 4AHRA 1JLEB 3UIQA 3KHHA 4GC6A 4LSLB 4FLYA 3I0RA 1S48A 4R0EA 1FXXA 1L5UA 1RA7A 3QEWA 1IKXA 3DMJB 4O3PA 1TKZB 5KT7A 3DOKB 3HVRA 2B4JA 3CM6A 3PO4A 3OYEA 4DSIA 3GV8B 3QO9A 3SNNA 4O55A 4Z4GA 1KVBA 2I5JA 3VQ4A 2JLEA 4IH5A 4ECZA 1JLQA 4L8RB 4DQPA 3O3HA 1ZBIA 5EWFA 2FLPA 4CHNA 4PA1A 4KTQA 3MFIA 3AO4A 2ASLA
chains in the Genus database with same CATH superfamily
4O0NA 4YY3J 4FXDA 1UA0A 2VICA 1JLFB 1RAEB 2CH6A 4B3TK 1T9TA 2ZJPQ 1MN9A 3VENA 4DX7A 4O3OA 4B1ZA 3CJ1A 3OW2R 4JUZA 4U7UD 5C42A 1XTZA 3FEZA 1X0FA 4MKBA 4FWRA 4URSA 1W2BR 3PNIA 3MWTA 1XMQK 2HQGA 5B08A 2V2KA 1E6VB 2UV8A 2VFVA 2YWHA 4YNQA 1M1HA 4XH5A 4L76A 3H7HB 3V6KA 2PI4A 4CTAB 4OPJA 1BWFO 3HPOA 1ICEB 1TL5A 2YBVA 2XZTB 1RWNB 3D0GE 3HK2A 3QBCA 3BZKA 2CZ9A 1S4FA 4QW8A 4KHPJ 1FK9A 3BO4A 4B3RF 1O13A 1ASVA 3HVWA 2FSKA 2AA4A 4NLPA 2F1FA 4DR7J 3ZLJA 3NBPB 3R3TA 4FXVA 2E7XA 2OTJN 1SKRA 2AV5A 3SCKE 2DNYA 3HSTB 4WYBA 2JWNA 4CFAA 1XNQF 1B92A 2DYAA 4W90B 5GVQA 2RKIB 3L2WA 2VGNA 2B0GA 1E4GT 4BR0A 2Z2YB 1C0MA 1GLCG 4JI4F 1B7FA 1HL6A 2V7ZA 3BSCA 2BVZA 2PFFB 1KRPA 4ED7A 3UD5A 3AGRA 4RCHA 4K4XA 1Z26A 5HQLA 4KGXB 3ZZPA 1RTHA 3RRGA 1VSDA 4MLHA 3ZNJ1 2Y1IA 2VQFK 2GQQA 2W24A 5C12A 4FCYA 5AQFA 5KFXA 2DTJA 1U1NA 1TKZA 2AP6A 2HQIA 2GBZA 2XCAA 4AM6A 4DN0A 2A18A 2AMCB 4Z0UA 3OVSA 4DR1J 4G1QA 4YR0A 1YLXA 1TFYA 4NXNK 4K5SA 1UZDA 5KGXA 3V1RA 3NMAA 1S6QB 1X60A 2AZ1A 4FWKA 4KIAA 3L3UA 5L39A 3ENOA 1Q7YT 4CHZA 1SCJB 3E3XA 4PL7A 3EXYA 3MN5A 2PEHA 4QU6A 2Q66A 4RKUC 4URGA 1QHTA 1NK9A 4PAAA 2W8LA 4M5MA 5AFUA 1N5SA 1JNZB 1F3FA 1MG7A 4RBTA 3M8QB 3GFZA 5A8RB 3MK6A 2NUUG 4W92B 4JRQA 4FVUA 2V0NA 2QA4S 2EC2A 1IKYA 3J7AP 1NZAA 1KLNA 5LMNK 4I2PA 4BRCA 3BKFA 2RT3A 3VV2B 2KU7A 4USHA 1UW4A 2DFEA 3TTFA 2I7NA 3J7ZT 2KN4A 3VPZA 2RIJA 3M9MB 3DHXA 1GLEG 3R8EA 3QT6A 2D3ZA 1HKGA 5F0WA 4Y34A 4UQTA 3HSCA 2ZH8A 3K5NA 3IM8A 3NNAA 2AKWB 1BMQB 3IRXB 2HS4A 3HJVA 3CNQP 4GC7A 3QBXA 4DTPA 1T95A 3TRGA 2AEFA 4ZHRA 4L6V3 4BE2A 2H1YA 4DPWA 2YWKA 3UO0A 4OHVA 1P9QC 1HQUB 4DL0C 4ILHA 2VWJA 2ILZA 1QY7A 1TYQA 2RN2A 1QD1A 3RYLA 3T5JA 1UCNA 2M4MA 1WBBA 1Y7PA 2UXDF 3KNGA 2BE2A 3CCJS 4F3QA 4UUWA 4DR7F 3ZTRA 1GMWA 2X51A 1NGBA 2B6AB 4F0HA 4DL6A 1VQ7S 2HVEA 2HNYA 5CR4A 1WDTA 3D0PA 3QLHA 2W4CA 2D9PA 1VQ6N 2KXNB 2E5HA 4B3SJ 4OZ5A 3E9OA 1SS6A 2CQ1A 1EZZB 3H4BA 1YJNS 2XYPB 4DV4F 4DR4J 1I3AA 3A5LC 3AVIA 4YOYA 5AE2A 3N5BA 3PEHA 1ZBUA 1CJUB 3WT0A 4FZZA 4Q8FA 4G1IA 2YTCA 3OYHA 3K5OA 4ZP6A 1NGJA 3RAXA 3D7EO 2E9ZA 4DTJA 1GLAG 3S9HA 3CERA 4BRLA 2QMXA 1X5SA 5C2FA 2E1AA 2YNGB 5DGBA 4KB7A 5DS7A 3DRRB 4K25A 2W2MP 4FW2A 1GXLA 4BE1A 2LQBA 3ULEB 4TY8B 3SDEA 2VASA 1IJJA 3VQBA 4CJVA 2MHNA 1JX4A 4PG7A 2B4VA 3VERA 3PKMA 1CQNA 3AVHA 1I39A 1VIXA 5F9NA 4LQ9A 1N33K 3VGMA 4X64K 1VQ7N 3D3BJ 3MAAA 4DF4A 1S79A 5F2RA 3WEEA 3AOBA 2MQ8A 3CCWA 3JTNA 3B6OA 1OY8A 1LXJA 1BA1A 1Q7LB 4FJNA 1S1TA 3Q2SC 1S76D 3D4JA 2OJ3A 3R5CA 3SBTA 2P9UA 3BB5A 4PXBA 3ZX0A 4Y00A 2IFXA 4BRGA 1NOYA 3NNCA 3QGHA 3A4TA 4B1YB 2BJ9A 4RW7B 3CPWM 4X4SA 3QNWB 3CC4N 3BF1A 4LFCJ 4QCLA 2EBGA 4H5RA 5HQ8A 3OL9A 5HRRA 1A5WA 3MN7A 5IV4A 3RB6A 4MKVA 2BMBA 4JOUA 2B51A 2OH2A 4A8MP 4F3MA 3IN5A 5KQDA 1EKEA 3KK1B 2IBOA 5KFQA 2DRAA 4DS4A 3SBMA 3HF5A 2BJ8A 2CQ4A 1RXOB 4CZMA 3PW7A 3SUOA 3MEGA 4X4OA 3H5XA 3M8ZA 3WBZA 4C98A 5I3QA 2QYCA 1RTIB 2QX0A 4B3MK 3HOTA 2VGMA 3ATUA 2CPYA 2Q6BA 5AQSA 1K73O 4CK2A 1I94K 2K06A 4KV8A 4ECYA 4KHPK 1CS4B 3LP2B 3V5RA 4CZLA 4CERA 4UOCA 2LXFA 4ZN1A 1U48A 2FJBB 3LUYA 5A2QU 3VN5A 1RLCL 4EO6A 3DM2B 2KM8C 3PIPQ 2X7IA 1X4EA 3MMCB 2V50A 3K17A 1JJ2M 1CLQA 2FZGB 3B8AX 5AQTA 4B08A 3IAM9 1Y5NB 4AM7A 2WRMA 2VKZG 4CJUA 2D74B 1BO5O 4ZHRB 4FWMA 1R27B 1WJ9A 2HIYA 2HVZA 2OIHA 2RQKA 4B3SK 3HP6A 5KFLA 1UWAA 1P90A 2ILYA 3OLAA 2DGVA 2IIHA 3V2UC 3VAIA 4LFCK 2B8PA 1X9MA 3W60A 2ZVSA 5BR8F 2Z2MA 3M1FA 2RQMA 1RT7B 2Y1RI 3TAFA 3UDCA 3U6FA 4QBUA 3EL2A 4BC7A 3TAGA 3CC4S 4O44A 2OANA 3P4UB 2XNQA 1Y64A 5LJWA 2YCHA 2HRUA 1NGEA 2FPHX 4E8UA 1GX5A 4A5AA 1NKCA 1KVKA 3W62A 3QMQA 2E1PA 4WQ5A 3EE3A 2E2QA 1CZ9A 3DOMB 1UWBB 1JWWA 4LSNA 3BF4A 3AJ1A 3LO3A 3NOCA 2JEIA 4HACB 5J2NB 1PJ5A 4P72A 4CEBA 1PBUA 2DH8A 3WDOA 2GQCA 3Q22A 2H3EB 1IKYB 4F3OA 2AYMA 3N01A 4CO1A 1S6PB 5DM6Q 2D41A 3CHWA 2E1RA 1S6QA 1ZAVA 3V1QA 2HFOA 4QZVB 2O8EA 1U8SA 2D0AA 1TUUA 5GAEU 4AT1B 2V2ZA 3FSYA 2DY1A 3CF5L 2GIQA 3EN9A 3CDWA 3MM7B 4P2SA 2V4JB 2HAFA 3M8YA 3SCLE 1R6YA 3VOVA 2ATLA 1NKBA 4IFVA 4RUCA 2GJ2A 4L74A 2V6AA 2HHHF 1TL1A 4RO0A 1XJWB 4FPAA 2OCEA 2HWTA 5KAKA 2QWQA 4OL8A 4J9MA 4P75A 2QM1A 2Q3PA 3ASMA 2V9KA 3ZEUB 5KT5A 3RB0A 4JV5K 3G87A 4QWBA 2DR7A 3X3UA 1HMVB 4K5RA 2XMVA 3H0PA 2NSBA 2UVVA 1Y4ZB 5GAEP 3SK3A 2CVEA 3T1YF 3M8SA 4OPHA 3CG7A 4U6PA 3AGKA 1BL3A 4BWMA 4D3GA 1APSA 2ZZMA 1WUAA 4OKJA 3TQEA 3OR2A 4JI2K 4X65K 4I2QA 2R4FA 4KAIA 3C6TB 5LL6d 3K9KA 1WB9A 2ZHOA 3TUIC 2VDIA 2Q0UA 3AT1B 2FJXA 4ZK7M 4YHHJ 1LW2A 1VCTA 2M0GB 3QZ8A 4LF6K 3LP0B 3CCSS 1SBRA 4NLGA 3AD7C 1IQZA 2ZUGA 4O3QA 1WF0A 2BJEA 2MQQA 3HBTA 4M3WA 3CJ0A 4EAHD 4H5TA 2ZJPL 5KFJA 4FNIA 2WONA 3VEXA 2RRBA 4HACA 3LP3A 2U1AA 2NYHA 2O8FB 4E3SA 1KVCA 4CNYA 2E9TA 3M6VA 2PFDA 4Z7CA 2PMZD 2HHPA 2YX6A 4PG5A 1LK7A 2LQ9A 3PJWA 1T94A 3H98A 1IJFB 3SMZA 3JSRA 4DCJB 2J7UA 1W7AA 4PKIA 4M7YA 3VQSA 2HZCA 3EZWA 1S9EA 3IBCB 4FLUA 2UUCJ 5ITHA 1U1QA 4TQRA 4JI6K 5M2PA 3BGFA 1NZ8A 2HPUA 4K0KF 3W2WA 4N8NA 2ZHBA 2HW3A 1RA6A 4CBXA 2UXDK 2M88A 4OHWA 4DQQA 5LJ5Y 2W41A 2OTLS 2VCPA 4FZYA 2GVDB 3U9DA 1CG2A 4K4UA 4LFAK 1RAIB 3G4SS 4I7FB 5GADP 2BOPA 4U67Q 1YVUA 5LM7E 1XMBA 1RDDA 1UPMB 5KFTA 1M5SA 4XH4A 3QEIA 2MTLA 3KNAA 4CD1A 2ACMA 4JI6J 3OFGA 3UR0A 1YT3A 2WK4A 5LJ3Y 5L9XA 2P9LA 1FWKA 4BREA 4JI8J 2VPWB 3OXFA 3PRDA 5KG4A 1P1TA 3S3NA 1FKPB 1B9FA 5FPMA 3S3MA 3C6TA 2B3TB 4LC9B 5DO2A 4LBIA 1QVGR 2A10A 2W2NP 3AJ2A 3SQ0A 1ATNA 1BHLA 4LF4J 1DQ8A 1QAXA 1S1XB 2AZ3A 5EWEA 4PUOA 5KFBA 3JXOA 2YKMB 3NS5A 3AJDA 5LMNJ 3I8BA 2JLFA 2FGOA 5M2RA 1YHQN 3CCEN 4AF1A 1F21A 3V6DB 3J7YU 1T3OA 3KKRA 1UW9A 4UZBA 2L9DA 3IMXA 2MY8A 3V9ZA 2FJDB 1CLFA 4OJRA 9ATCB 4F7VA 3SAFA 5HJXA 3PIOQ 3MEGB 3HP9A 2ZOGA 3GIRA 3T1YJ 3RBDA 1BIUA 2FGCA 3G25A 1S9GA 2MZJA 1RGIA 1EX8A 3OPKA 3UNGC 1LNQA 3VF6A 3DLEB 4Q45A 2HZVA 3VAHA 1W7WA 1MLAA 2R2RA 4CYUA 2AYBA 5F8IA 2V34A 2Z30B 4M5KA 3NGDA 2CQDA 1YWXA 2SXLA 4DV6K 3HX9A 1SQFA 3ILJA 5EX3A 4GNIA 4IWVA 3OTCA 4WP9A 1D09B 3HL8A 5FLXY 2IM0A 3MN9A 5B0AA 3JQJA 2VKRA 3ENBA 3PV8A 5KFAA 4CGIA 1VQ8N 5AQKA 5LMUK 1MU2B 4W5QA 5IM0A 4HUFA 2F4FA 2E7WA 2QK9A 3W2VB 4QWEA 1JLGA 3ZSRA 2CPJA 1RBUA 2DD8S 1DTQB 1FNXH 4WJBA 2OGUA 5GAEI 4CM0A 1VQKS 3O4WA 1EWQA 4F26A 4FLZA 3SV3A 4DBQA 2P5VA 3JTOA 3P45B 4FSVA 1JLFA 4CJ3A 3S41A 2KKHA 2HURA 3UB5A 1LWFA 2FHMA 1UKUA 1XWLA 4DR2K 4PUOB 2QKKA 1LCUA 2AEMA 2P9KB 1R8CA 2EFOA 2UZAA 3GJTB 5E3RA 1DQAA 4P71A 4CFDA 2DNQA 2LKZA 3OYDA 5T14A 1MROB 4FBTA 3N6NA 2LP4A 2DGXA 5HQMA 3TR8A 4F4YA 3CCZA 1NEEA 2VBXA 4ZTFA 2CXEA 4J91A 4JI6F 3OFFA 3ZZZA 2WVFA 2CUYA 2IC3B 1EWRA 3DCAA 4Z4IA 3Q89A 4BC4A 3W7BA 1TL3B 4AXJA 4NPOA 1CULA 2CNKB 1X4DA 1LAVA 2G2YA 2V8GA 2ITGA 1D1UA 1O0PA 5ELZA 3Q8RB 1XMOJ 4KY3A 3AD8C 3SMSA 3J80U 1CSJA 4ZP9A 5DDRC 2VBZA 4B1XB 3TYTA 2QYGA 1TKXB 2QG9B 3S8SA 5KG7A 4PEOA 4NZ7A 5LMNF 2IPOB 4X4RA 2DB1A 4DV1K 1VSEA 4LR7A 4RUHA 2UUAJ 3K8WA 3SAGA 5IQQA 5HLFB 2BQUA 1U1KA 4CO2A 4FK4A 1A0OB 3J81j 2CQIA 3CPWR 2UUAF 5AE1A 2PMHA 1OVQA 3DLEA 3DLJA 3I56N 1HUXA 1SXLA 1RJJA 2H5EA 4FJ5A 3HHLA 2YVSA 1RTDB 1HLUA 1S4EA 2P6TA 3WC2A 4MT1A 2ROEA 1A5XA 4GY2B 4RW6A 1TAQA 4XAKA 3HO1A 4BLGA 1VBZA 1IV0A 2EK6A 5H9EJ 4NYZA 4YB6A 1FD2A 1SH0A 3WXMB 4JV5F 3KK3A 3OL6A 4CZIA 1BQXA 4ALZA 1VSMA 5KG2A 3J7A1 2YNGA 4OYAA 1HMVA 3M6WA 4YR3A 3R27A 1Q81T 4CI0B 3M6GA 4LT6A 2LEBA 2E7VA 4HI1A 4CE9A 3RBXA 4C97A 4CIOA 3NF8A 4JI5J 1DAXA 1WI8A 3A5MC 4JBCA 1WDDA 1KQSR 1S6OA 2ETJA 1FO1A 2WVCA 4FF1A 3T6BA 1RAFB 4BROA 2BANB 8RUCA 5AQWA 3GCWP 2HS0A 4C0HA 4AQYF 4JKEA 4ID1A 4CGDA 4ZOSA 3H59A 3R7BB 2K1RA 3RR7A 4WYWA 3VAJA 2HHSA 3T19A 4OYPA 3RB3A 4ILLA 1PAUB 2UXBF 4DQSA 4IEIA 3Q8PB 3SJJA 2D1CA 3PSFA 1JLQB 2D0CA 3DRSA 4ZP8A 1YF5L 4RLEA 2PY5A 4JI7K 1I6JA 4CGGA 4K42A 4MAKA 1NMDA 3KXDA 1S97A 3IO1A 1YBUA 2R7SA 1RSCA 4CEZA 4NL5A 3KLEA 3CCJN 5K20B 3A8JA 4H8KA 3KLIA 5CCLA 4BC5A 1WSFA 1FDDA 2K3KA 1IKVB 2JZ5A 1NJIT 2F63A 3EICA 4CLWA 1KKHA 3GP9A 4IKFA 4DG1A 4IFYB 1K9MO 4W5TA 1XIQA 4CHQA 3UKRB 1RDWX 1TV6A 3L2QA 4M3XA 3QFWA 3I9V9 3TP2A 2JRSA 2QFIA 4A8SA 4UY85 4QOTA 2WSCC 2MEWA 3MI7X 1K73T 2GGPB 4GV3A 1Q0NA 3WHIA 3HRGA 2IM1A 4HDGA 2G8KA 2HAIA 4IO9L 2GNKA 3QIOA 2XY6A 1VGYA 5J1PA 1RTDA 1VMBA 1G7CB 2ASYA 1VQNN 2OZMA 4CLFA 3L7UA 3QGGA 1KC8O 1WG1A 2F4VK 1VQ4N 5D15A 1Z25A 4FJIA 3RSEB 4RU9A 2CQ3A 1XMOF 1JJCB 4IJAA 4JP8A 1U2VB 3ZZUA 3BQ0A 1T9XA 4Z2XA 1RWUA 3LL3A 4BG9A 3MR7A 3AVBA 5LMUJ 3V9UA 3FEXB 3C95A 2G13A 1LW2B 2OFHX 3D67A 2CZ4A 2DFHA 1OH5A 3M30B 5AJ3K 5AQGA 4YUDA 2IYIA 1RU2A 4BDZA 1U1RA 3L6QA 2GWKA 4B17A 4W5RA 2BQRA 1B3TA 4JHDB 4LREA 5J2PB 4Y3CA 4W5OA 2HKEA 4O5BA 2KHDA 3OS2A 5AQVA 4BWJA 1UZHA 1HQEA 3DM2A 4K59A 4V1Ak 1YDLA 4IOXA 5FRNA 3MN6A 1F9HA 1RTIA 4DPXA 4Q5VA 4DWIA 3RMBA 3EVMA 3ZTQA 4ECWA 2IJRA 3LP2A 4NYOA 1KTVA 2FF3B 4P74A 4FLVA 3MTKA 4ED6A 2CFXA 3MM9B 2OPSA 2PA8D 1WLJA 5HP1A 3PR4A 1F3VA 2UUBJ 5C7PA 5E3PA 4EGLA 4JN4A 1RE1B 2B7BB 4OJHA 3A5NC 4NLRA 1HHSA 5DLGA 5FLXO 1U04A 3TTDA 1ZYQA 4ZMMA 4DPYA 3D2FB 4KHRA 4F9OA 1PKUA 4CJEA 3FLCO 4ZVFA 1BA0A 4CD3A 2HF4A 4LF4F 3FGUA 2LCWA 4QYZK 2JJ4D 1WC0A 1GMVA 3F9MA 1C1CA 5F8NA 2LA4A 4JYAJ 1QDUB 4EHTA 3P96A 2DXDA 3T41A 1C0UB 4ZJLA 4AHCA 3TZYA 1UWBA 2NRRA 1IBMF 2A5XA 5IT4A 4WK1A 1VRTA 1I5OB 2CQBA 1V4TA 3RG6A 1WKKA 4Z7YA 5J1NA 2NREA 2ZE2B 1FWPA 1EX4A 1ZBLA 4HTJA 1ZM4A 4FWNA 2B56A 2WBRA 1Z1ZA 3O9UA 4LH5A 1WSVA 5IC4B 4UY8T 3LAKA 2OMOA 3MPYA 2F7TA 4Y0WA 1J5OB 3DLGB 3AVFA 1S1WB 1WN7A 3EZOA 3CJ3A 4B9UA 1KC8T 2DEJA 1N5YA 3ZT3A 3KLGA 1JXLA 3ID8A 4BRQA 3OYKA 1BDGA 1KHVA 3HVAA 3CE8A 3JTPA 1H73A 1RKIA 2HBZB 1RILA 3OL7A 3LPUA 2I8EA 1D9FA 5C5JA 5EU7A 1WBDA 3DWLA 1TL3A 4I9QA 4CJPA 2C22A 1EHWA 1VQMS 5C42B 1DGKN 1HR0F 5E7OB 4LFAF 2CQCA 2RHQB 3M8PA 1Q5YA 3RTVA 2P9SA 3M4XA 3NE6A 1AB8A 1U25A 3CJ4A 2RF2B 4EHUA 3DGPB 4KRFA 4CEEA 3FZLA 2L48A 1FVSA 1CEZA 3CPEA 4RW4A 5BR8K 1RKJA 4ID8A 1BUPA 3B78A 4AH9A 3ITHA 1QAIA 4KBOA 2B8QA 3U3YA 3B8HA 2BACA 1HYSA 4LFBK 3B4DA 2XS5A 4H0XB 2LECA 5F8LA 2R8IA 2R7QA 2Z1IA 4ZPWR 2ZM6F 2W1BA 2Z56B 2KFNA 5B0DA 3JAMO 1RAHB 3PX0A 4GMKA 3CCVN 3OLBA 1NMNA 2E44A 4LF6J 1VK8A 1IWAA 4M5DA 5K8OA 3KK2B 3DYAA 1WSHA 3WZ0A 2F9DA 5J2QA 2VG5B 2GMJA 4C1NI 3ILLA 4IOBA 4OV1A 2XHWA 4DV3F 3TSQA 4E1NA 3CTRA 2CPIA 4A8WA 3LH2S 3M2RB 5AQYA 2C3MA 2NPIA 4NYNA 4H4KA 4NYFA 2FSJA 1SJRA 1K44A 4C2MA 5AR0A 3EMTA 2OPPA 3C16A 3JS9A 4ER8A 3QJPA 4JI3J 2YQ0A 4USJC 5AE3A 2IVNA 3KDOA 4NLBA 3MMJA 2CZVC 4FVCA 4BE0A 1REVB 3IKMA 4LJMA 2MQMA 4X62J 3HI0A 4LRCA 2XY8A 5F3ZA 2AX1A 4B8AB 3N5FA 4UT4A 2IVPA 4KGVB 2PC6A 4X62F 3KMSA 1RB0A 1T03B 4OO1J 2CYYA 3CXCM 3QATA 4PKDB 3O8WA 2XZDB 1DY3A 2DJWA 4M3ZA 2EK1A 3QT8A 4ITSA 4FO0A 1S1TB 4FW1A 5FPEA 2G8UA 2KVQE 2O8BA 4CLPA 2RU9A 2E1MC 2UUWA 4H4OB 3EGVA 4R8UB 4CQ1A 2VJVA 1JQGA 4AHRA 3IR5B 1JLEB 3R5JB 1N36K 3R9LA 3KHHA 4FLYA 3I32A 4A8KA 2YPYA 3UN5A 2LQ5A 3E9LA 1FXXA 5CD4A 1ROFA 3FCVA 4JI3F 2N82B 1IKXA 1TKZB 3HVRA 4ZLPA 2XYHB 1KQSM 3PO4A 3OYEA 1TL7B 3X1LB 3QFHA 4X66F 5MAOA 1YJWN 4JI4K 1IBKK 2MPUA 3L4BC 1TUYA 4MYUA 5GADI 4Z4GA 4OYIA 1JLQA 1RAAB 1Q1KA 4CHNA 3C19A 4KTQA 4CRJA 1N34K 2XZWA 3A8YA 4DV1J 2IVOA 2ASLA 4X65J 4JI2J 2G0JA 4BVOA 3ZYYX 4LF9F 4NRTA 3U1MA 4J9SA 1NSAA 3UN3A 4B3RK 2HNZA 5CE3A 1NNEA 1S6PA 3VESA 3OHRA 4EFHA 2VF3A 1OO0B 5JVHQ 3G6YA 3ZSQA 4MO5A 1NU0A 4CP5A 4H4OA 3LQVA 1YUWA 4C8KA 5C2DA 4P52A 3GIIA 1V3SA 3N6LA 1FF2A 5J2NA 2HBQB 1ZBHA 4BC2A 3QIDA 3NMRA 2GUPA 2V68A 4CF2A 3BYRA 3NH2A 3CDUA 1WC6A 3D6FB 3O9QA 5JVGL 2AJ2A 2GZOA 3HVTA 1ATRA 3W63A 1OPIA 1X5TA 3OA9A 1K6YA 2QWLA 1YBTA 5C15A 2HFUA 3QESA 2FC9A 1FTCA 2H9ZA 4RW8A 1U45A 3W5XA 4IH6A 5M1PA 4B3TF 3SSRA 3JS6A 4XIUA 3E2EA 4CBWA 1U1PA 4UQGA 3G6EN 3D68A 4C8LA 1TELA 2X74A 3C8YA 2W25A 3IR6B 3P5BP 5A6PA 5L8RC 2V4QA 3TPQA 5GMEA 3G6VA 1LFWA 3GLJA 4FJ8A 3TX8A 2AJ4A 1HWLA 2R7VA 1VSFA 2VBYA 1S12A 4FPRA 4EFAC 3CCSN 1HBMB 2HBKA 2V8HA 2IRYA 1ELOA 2Z58B 3BSNA 4BRPA 1HW8A 3VMFB 4ISGA 1EAYC 4TLQA 3OVNA 4PQAA 1UAXA 2AW0A 1XNRK 2O4IA 1SC1B 1NG9A 1PCAA 1N32K 4CO3A 5K14B 1CULB 4YY3F 1GMWD 3BY5A 2EW9A 5HANA 3QFUA 5HVGA 3GMGA 4TQSA 2YJEA 2VG7A 4BR5A 1UVKA 3BGUA 2E6MA 4EYHB 2RVJA 4ANCA 3D54A 3V4MA 1RADB 1DQ9A 4ED2A 2AHOB 3A3NB 2YWFA 4UOHA 2KH9A 2G8HA 3R1XA 4ZPTR 3KTQA 2ZUAA 3OFHA 4CIGA 4CESA 3ENWA 2KJVA 4DI6A 1RBVA 3NEKA 2ZC4A 2NZ4A 1U1MA 3AOAA 3CCLN 4KFBA 3MEEB 1R3NA 4AUKA 4DFJA 3IRWP 4B9NA 5IT0A 4W4MA 5GAGU 1ESVA 2JEFA 4CGFA 5FLXU 4BC3A 2MZRA 3VGLA 2KHOA 2A1RA 1ZBTA 3GL1A 1S7IA 3AB4B 5F41A 2P9UB 4KBIA 4DR6F 4CJQA 3AVCA 2MLXA 4DR3K 4FLWA 3LDOA 2PFUA 3VF2A 1KWMA 2C2NA 1HR0K 2BEFA 2W6KA 2MXYA 3O3LA 1ZETA 2V8DA 2PAVA 2JLGA 1VRUB 1AZSA 1M1KO 4DSEA 1B0VA 1JXVA 2RS8A 2XY7A 2GMHA 4DXLA 1O6XA 1OY6A 1LW0A 1VBKA 2JEJA 4X64F 5I3UA 3WQUA 1KN6A 2J0WA 5KFRA 3OR1B 3P1GA 3CFOA 5D3GA 2W2QP 3SCJE 3UWTA 4WTOB 3CCES 3VCDA 3ET6A 2RAQA 2ZHAA 2C2RA 3V9WA 4CZCA 4DTOA 3M6XA 1YIJN 3PW0A 1X4BA 3I0SA 3WXKA 5KFIA 4AILC 4EU0A 1P6TA 3PACA 1HNZK 5KT4A 3IFRA 3GG1A 3S01A 2DPJA 4WWSA 3OVAA 3Q24A 2YKMA 4XPEA 4NXMF 3ATVA 3LWLA 2F8HA 4F0KA 4KB0A 3CCLS 1TFWA 4X4NA 3OYFA 4Y6IA 3MUTP 4TLRA 1AW0A 1FVQA 3K7RA 4Q2MA 2F9WA 4CLTA 2H54B 1I51B 4JV2A 5KFCA 3QAEA 2F5GA 2LXIA 1HI8A 2P6SA 3BKTA 2FHJD 3V9SA 5HK4A 4ED1A 2Y8WA 2V51B 1JKHA 2GO9A 5I42B 4OI1A 2PSZA 1T03A 2MHEA 4ED0A 3OL8A 3N9UC 4LVNP 3NCIA 2J9EA 2LDIA 4JI8K 3NMUA 2Z4PA 1Q8LA 3TAQA 1SQGA 3K2YA 1ATSA 3G10A 3K59A 2C28A 4JK8A 3ISND 3MD3A 2VUGA 2UUBK 5KTQA 3OD2A 2HVHA 2GHPA 3KJFB 4DV3K 1HWJA 2DY9A 3CJRA 1CXQA 1YZ6A 2P9NB 5HMYA 4WF9Q 1B0PA 3EXCX 2UVWA 4CF9A 4LR9A 5IV3A 4NXNJ 2RB7A 1U0HA 4NXNF 1XNRJ 5DG8A 1QS4A 2F8MA 4BQLA 3PZPA 3AO2A 3THWB 3MCAB 5D0RA 4J9KA 2DNHA 3MD1A 2HF3A 3MMAB 1CJVB 2GGPA 1KSPA 4ELUA 2WUSA 3HHDA 4J90A 4F50A 3OYAA 5DQHA 3H5UA 3DU6A 1CJTA 1XK8A 2MQLA 4OX7A 1MMDA 4C8ZA 3WUHA 1ZAWA 2Y0BB 3TA0A 1ZM3A 5HBMB 4FVMA 3MM6A 4RNFA 1ZAXA 2HNZB 1S0OA 2FTRA 2XHCA 3KK2A 2APOA 1S72S 1AFJA 1FXRA 2GA7A 4G65A 1T0TV 2W42A 1Y0HA 4DV0K 1KVIA 2P9IB 1NCLA 4KHUA 4G1QB 2ZH4A 2QGFB 1QQOA 1VLYA 3SV4A 3KLHB 3GFYA 1CQMA 2ZH5A 1M0SA 3MOZA 4Z4HA 2CGKA 1YRUA 4ILJA 2LYVA 1XHZA 4DS5A 4C3LA 3P31A 3KK7A 1RBAA 3LPYA 4UTGA 1SUQB 3ALYA 2UXCF 4F4ZA 4KGKA 2XMAA 1QVFM 3DHWC 2ADBA 1EP4A 3FRZA 4DV4K 5ETQA 4I68A 1UVIA 1VQ9S 4ZS6A 4ID5B 2LEAA 1NUEA 2BKOA 1BU6O 4K8ZA 1ZA1B 4C0OC 3SQOP 3AOCA 2O8BB 4HR2A 1P27B 4RJVA 4NXMJ 1TMMA 3H45C 5T7LA 3DLLL 3BF3A 4DQRA 3HHNB 1N5YB 4ECTA 4ZCKA 1GMUA 2CJAA 3OTBA 3T7ZA 1U8WA 2Z2ZA 5CH7B 5BYRA 1U0HB 1RDRA 2NRHA 4JKGA 4DB3A 1ZTTA 1KEKA 3PW2A 1IUJA 4OLOA 2RKIA 4KHNA 2B4UA 2OPQB 3GYXB 3GE1A 4JI0K 3R1LA 3AVNA 1F9EB 4K7QA 1XMQJ 4M42A 2B5JB 2ZJQL 1Y3KA 2FBTA 5KFEA 4DUTA 3FC9A 2V9WA 1HBNA 3MCPA 3FSXA 2Z57B 2MZSA 2JC1A 3CCUN 2M2BA 3SCIE 4A47A 5KPTA 4LR8A 2IC3A 4GO5X 1TQLA 3M2RA 1OVYA 3MXMA 5I42A 2GAGC 5H1SV 1IR0A 5L9NA 3TEHB 3SFGA 2LU2A 2NYIA 3U1NA 2R7UA 2MQNA 5H9FK 1ASUA 1WC5A 1D8YA 1JL1A 2DRDA 3V4IB 2QLFB 5DG7A 1N48A 3B82A 1BG3A 2CQGA 5KFMA 3FCHA 4L73A 2DXFA 3QZ7A 4AL5A 1T6CA 4LIWA 4O44B 5E3QA 4I1TA 2HGMA 5JICA 3QEXA 1QHAA 1GNKA 5HMXA 1K0TA 4NASA 4UOGA 1M1KT 4X84A 4P2XA 4LRAA 3AHPA 1NPRA 1SJ4P 1QSLA 2NR0A 3ONQA 3F44A 1HI1A 2G1DA 1NGGA 2HG4A 4PXDA 2NSCA 2EBEA 2R7OA 5AXLA 3TEGA 4GKJK 1HARA 3DGPA 2VFRA 2B9WA 4L72B 4Y2IA 2OKQA 5LXYA 4DKWA 2QA4N 5CXTA 1HNIB 2XSJB 4OLBA 2CJBA 3TI0A 4Q44A 1SH2A 4ZCMA 2QJ3A 4DV5K 4F0MA 1QAYA 3ZZRA 4QR0A 2G8VA 3U7JA 3C0BA 1WC4A 5HL7Q 2RJZA 4NLDA 4O0IA 1T3VA 4AFFA 1YSJA 3KK1A 3BGOP 2ZH1A 2V94A 3M2VA 4M63C 4KHYA 4DQIA 4A2BA 4WU3A 4QR1A 3LWMA 4BDPA 4DF8A 5CA5A 2WVBA 3BDPA 1WKJA 3VQTA 4NMXA 4H5WA 3MEDA 5IM0B 1DTTB 2D0BA 2XI3A 4A4JA 2IBKA 1OY9A 4H54A 4CZJA 3MXIA 3UCGA 5DDOC 5ETTA 4LUBA 4JLHA 5L1LA 1JLCB 2V69A 3T5HA 2CJYB 2HMIB 3EE8A 5CHIA 3NKYA 2XMKA 3AD9C 2YWGA 3UR3C 2KT5A 4DV7F 5CQGA 3TZZA 4PKHA 4X4QA 2ZH6A 3HSGA 4O23A 4FJJA 3NDKA 4CLYA 5LSLA 1RCHA 2DEIA 3D2EA 3F9KA 4CF8A 1DRZA 1S5ZA 1VIOA 1RDBA 2B43A 2YI1A 4PHTX 3OTEA 3PYFA 4U96A 4ZPVR 1O51A 4C3KA 2GVZA 4JD2B 2J9DE 3FZBA 3LF0A 3IWXA 4YB1P 3OTOF 3H08A 3WXIA 1KTQA 1IKWA 1Q5VA 1CZAN 3OTOJ 3FRYA 3VAKA 1YRTA 2Q0RA 2WW8A 3VEWA 3K5PA 3U8XA 5C24B 1PC4A 4RNMA 1VQLS 1LXNA 5KFOA 5E2QA 3K0JA 4PXCA 1O5JA 3M2UB 2B6AA 4X4PA 4CZHA 2AP1A 1KD1O 3M1VA 3D0HE 1MNEA 3ISNC 1NM1A 3WXLA 5F8JA 5CZ2A 4HKQA 1Y5LB 1YJUA 4M63A 1L3UA 4LFAJ 1J6ZA 2HBJA 5AJ3J 1WTBA 2P9PB 3UI3A 4CT9A 4HCBA 2CAJA 2NRTA 3I5BA 1GTHA 1HNIA 3TZWA 5CAAA 1NDKA 3NCPA 1RWVB 4PWDB 4X62K 1FKAF 1HQUA 4NLUA 2HRYA 2V63A 4ED3A 5CHCB 3LGMA 2ZQBA 3CCMN 2OEJA 3K8VA 1N34J 4M3YA 4MJKA 2WB1D 4CH1A 1EKSA 1PYOB 2KZZA 3OYGA 1W26A 3M30A 2MSTA 4O3RA 3GG4A 1SV5A 4C8OA 3ADAC 2W9CB 3DOKA 4OX9K 3KLHA 3RRHA 4OJ3A 4DV1F 2WB4A 2EHGA 1BLUA 2QN6B 2MB0B 2XBPA 2LU1A 3SEOA 1FJCA 3AA4A 4QPXA 3WNEA 3I55N 4DTSA 5A0YA 3CF5Q 5ADXA 2MJNA 2WZ1A 3TSPA 4PCQA 3A0IX 1GXTA 3IRXA 2H3GX 5FRMA 2D3OR 1BE4A 5CYMB 1ASWA 3HLUA 3M32A 5DQIA 1RFQA 1D8ZA 4L3QA 2YKAA 3TJ9A 4YOWA 2YNFB 1PILA 2CNOB 1MDUB 3W2WB 4IR1A 1HNVA 2FVSA 4IUFA 4IOAL 1U2VA 4ZKAA 1T05B 2X6SA 4I6YA 1R0AB 3DRXA 1HKCA 3V81A 1C0FA 5KFYA 3NVMA 3GONA 3VGTA 2ZEJA 1FRKA 4AHVA 1RBOB 5A0YB 4MIWA 5JMVA 5B0FA 1KONA 3OHBA 4CEFA 2LXUA 1FI4A 2NRZA 2FYXA 3G8SA 2YNIA 3BGRB 4Z37A 1YVFA 2GIFA 3UKUB 3IS9B 2KM8B 1JJ2R 2CPHA 1IBLJ 1JCFA 4N41A 4FF3A 4ZVPB 3NGYA 4MMOA 3NWGA 1ULRA 3JSYA 3GG0A 2ZBQA 4IRKA 4YEAA 2B7CB 2FJVA 2PO4A 3T5KA 4LMZA 2M7SA 3OXGA 3NHGA 4WXWA 4DV7J 5JS2A 3H3NO 3MMCA 4LVOP 4JYAF 2P9PA 2L08A 4JI5K 1RHKB 1FKOB 4XTTA 5IQ6A 2XLJA 1NGAA 3TJAA 2ATQA 1ZZNA 1HD1A 4GW6A 4BRNA 3LDPA 1HNZF 1NK7A 4ZVEA 1Q18A 4DDFA 3UQSA 1WSEA 3O5BA 2O8CB 4DR3F 5HMZA 1BXNA 2DXEA 1RCOB 3Q2TC 4HVZA 3BZQA 1TTHB 3M1VB 3VQDA 3AVAA 5KG1A 4ECXA 4DUYK 3H2VE 4BRDA 3MPVA 2RPIA 2MLYA 4JI0J 4Y1CA 4DL4A 4AQYK 2QSFA 1ILYA 3U3GA 3HDSA 3ZTOA 4DTRA 2ZBRA 4JV5J 1WF1A 3SLCA 4PQUA 3GV7B 3VVTA 3TU5A 5AQQA 2F9JA 4OMFG 1NDLA 1BQNB 1HKAA 1KAZA 1EJ7L 2Z1JA 1R6VA 3DOMA 2C3YA 3EDRB 2HFNA 5EY4A 2YY3A 3FZHA 2V2QA 3QQCD 4J9PA 4A8XA 2N3LA 5HROB 3R97A 1UVNA 2EFPA 4H4MA 4IRCA 2E4LA 2VG6A 3J7Z5 4NCGB 4CO4A 3PYGA 3CJTA 1HBOB 2V67A 4MK8A 1NGFA 1IM6A 1H2VZ 2XRIA 4FZXC 1HNVB 2RQ4A 4RW9A 2XMUA 3MM5B 1UJ5A 3M2VB 4MYTA 5JJBA 1LWCA 4DX5A 1OJ4A 2ITMA 1VJQA 1X4AA 1WWHA 1B99A 2EI5A 1IVZA 1VQOS 1M5KC 3ZCMA 1N36F 1PGZA 2HHUA 2EG2A 4K4WA 3SI8A 2IDOA 1CJUA 3QT7A 1AA1B 2J7WA 4PR6A 4DR2J 1NK5A 2HMPA 3L2RA 4QYZJ 5BR8J 3VA3A 3OT9A 5KOXA 5IFMA 2QT7A 2J0XA 3CCQN 1WUUA 3DXMB 2XSJA 3RBZA 1RHQB 5CZ1A 3GILA 2X3GA 4I4BA 2W2PP 4L3KA 3UD4P 3PR5B 2PMWA 3UE5A 3A1YG 4DJBA 1TP7A 4I0WA 1YITN 1FRHA 2PEBA 2RSQA 2ZJRL 4OLAA 1NLVA 1XQSC 2A0FB 3NF9A 1K8AT 1J5EF 1HBUB 2VBWA 3CD0A 5IWAJ 1XMQF 5ETMA 4RWWA 4EBEA 2LQJA 5HI7A 2NRVA 1HA1A 3AAPA 2RH3A 1RWMB 3CFRA 1WD6A 3N79A 1WSIA 4OHYA 3D7SB 1HWIA 4NI2A 3PM9A 1JLGB 1IKWB 1CJKA 3ZSWA 2R7RA 1TK0A 1WG4A 3V4IA 1LW0B 2QZ8A 3TOQA 3F5TA 4CGJA 4JKHA 3SFUA 4I9LA 4LY7A 4ISEA 3ULDA 3I9ZA 1VLOA 3VHQA 1UFWA 3G82B 3MWBA 4U8VA 3L95X 1X4HA 2GW8A 2J76E 2QC3A 3BN7A 3AA2A 2QV6A 2HBMA 4USUA 3EUNA 5DETA 2UXBK 5BPNA 5ETRA 5ADZA 5ETPA 1JLCA 2M5YA 4ZDNA 1NPPA 3TVYA 1VRTB 4USWA 2XLKA 2D9OA 5D0GA 3JXUA 1BI4A 2RRNA 3P4IA 5AZIB 4WFYA 2F40A 1YI2S 3CYMA 1C1CB 4N77A 2C3PA 3L09A 2OZSA 2VFUA 3EYZA 2CWKA 4E7LA 4BGBA 1TUGB 3SPZA 3EGWB 3UPFA 5F1XA 2I38A 4FYDA 4EZ6A 4JI5F 2XMJA 2GEMA 1H2TZ 5T7LB 1CC7A 4KH1B 2O3DA 4LF7K 1YHQS 1TVRA 3W9HA 2GS8A 1U2RA 2R7WA 1BCOA 2R9LA 2CPXA 4NOHA 4RBUA 5B0EA 3FQLA 4JI3K 1S5JA 1Q8BA 3B6PA 3GBTA 2ZD1A 1HFEL 2G4BA 2K1RB 1GAOA 3AY9A 3QBWA 3IGNA 2RRAA 4HVJA 1YI2N 4NEZA 4DR4F 2HSEB 4JI1K 1NSQA 2DNGA 4KPCA 3Q86A 1WEXA 5KT2A 4KH5A 3DC2A 2HQ3A 2W6LA 2BGGA 1YTYA 4FF2A 2HHQA 3U9ZA 2J9DA 2FLLA 4R8UA 1PO6A 2HOEA 4YN3B 2MSSA 3CMQA 3J80Y 1G1XA 3JQKA 3KG4A 3B4MA 3C7NB 4EK2A 3MM6B 4BG8A 4CFBA 2BZ2A 1EIYB 4JS5A 2QI2A 3NG8A 5CYJA 4WFAL 4I69A 4DU4A 4NO7A 3S3OA 2XY5A 2JNJA 3BBCA 5AQMA 3NNHA 1SVDA 5BYSA 2KRBA 1QSSA 2W7AA 4M41A 2MKSA 2GHVC 1TMJA 2M3DA 2NPFA 4EIAA 5F0XA 3M9NB 4JI8F 2N7YA 1GXUA 2GWJA 3ZZ0A 4RW9B 1R31A 4U9RA 4F2RA 2XG8A 3GU0A 3ZNUA 4JI7J 1N5TA 1WACA 4IBNA 1ZBFA 2VPZB 2R7TA 1L3TA 3O9RA 3TO8A 4C48A 3JSMB 6AT1B 2VA2A 4ZPAA 1RAOA 1SB6A 1UP1A 2GC8A 3O80A 4OZ2A 1ZH5A 1OYEA 1FRJA 2P51A 2DGUA 4LQ3A 2XULA 1C2PA 4E98A 1J9AA 4L75A 2LVWA 3CDEA 3VGSA 2VG5A 4BR9A 2FLOA 3PCOB 2QXLA 2X6NA 1KD1T 1WAFA 3W1YC 3BS9A 3IMQJ 1RT1B 1U6ZA 3KLEB 4KHPF 2XQCA 2F8EX 2QRRA 5KG0A 5D6GA 2YV0X 1NKEA 2ZH9A 2ZJQQ 3ULHA 2YHXA 5EDWA 2DKOB 1NRKA 3LANA 1EQYA 1S99A 2W7OA 4PWWA 4WIIA 4IR9A 4M5DB 2KTQA 3GTYX 4FWOA 3PJ9A 4TSXA 4H03B 4QS8A 1SL2A 3PW5A 1LWFB 1S72N 3BH7B 3LTOA 2QW9A 4WTYA 3OSNA 1RTZA 3T69A 3LP1B 1VQYA 1PG5B 1JCEA 1RHRB 2UUCF 3THXA 3CJBA 2VJUA 5SWMA 1X1PA 5KT3A 4TYBA 2IMOA 4JI1J 4OZ1A 3GSDA 2JFKA 4HH1A 3I87A 3KOAA 3GQCA 4ZVUB 3T9NA 3D6TB 2NCKL 4DTMA 2UXCK 5KT6A 2DCLA 4LF7F 2HVDA 2A42A 3H46O 1WC3A 4BQZA 3SSSA 4DR1F 5CYQB 1HRHA 3J7YP 2FVQA 1SJ1A 2I9SA 2QTWA 3OR1A 1SH3A 3THTA 2G2OA 2ZZTA 3WEEB 2J6SA 4DV4J 1RBTA 4Y1DA 3DJCA 4A61A 1Y11A 4CTAA 2GV9A 3WQPA 3H1QA 3GIJA 4GV9A 5T7BA 1RU1A 1XC3A 5K9FA 3IAS9 1VC6A 4MK9A 1DTTA 3W3SA 4MIBA 2CGJA 4ZP7A 3MR3A 5AFUH 1UOCA 3LA0A 4Q0BB 3W65A 2Y8YA 3GPAA 1YVNA 4DFKA 2E29A 4UW2A 2V8PA 1OH6A 4KKOB 4DL5A 4DV0J 3O3FA 3QETA 1YJTA 3OSPA 4HDHA 4QU7A 5J2QB 2VQEJ 4CEQA 1C0TB 3IAYA 1XNQK 1WELA 4PPDA 3QIPB 4B9MA 3OJUA 4CZFA 2GELA 3RAQA 1EB0A 5A8KA 1J5EK 3FDSA 2QWPA 2HWHA 4HL9A 1P8ZA 4MK7A 4M5NA 1R0BG 4GC6A 4W98A 3A8EA 2AJ1A 3I0RA 4OI3A 1S48A 3CO0P 3LGNA 1K47A 2M70A 3CMES 1T9WA 2MY7A 4FPBA 5FPNA 4O3PA 3CIMA 3DXMA 1V3ZA 1FTRA 3N0VA 2B4JA 2F4VF 1HNXF 5K8MA 1VBYA 5IT9Y 3CIPA 4CZKA 1G6BA 2OELA 4JK7A 3BZCA 3A3PB 2GMLA 1BY9A 3N4QA 2H65B 4LRFA 3GJRB 1SC4B 1FCAA 5EXWA 2WC9A 4CH7A 4DV2K 5AJ3F 3MM8A 4DQPA 1HLWA 2DNRA 3O3HA 1YJVA 4XDDA 4FPIA 4YS2A 4J5OA 2O01C 3KWGA 4ANEA 3MFIA 5IXUA 3O6WA 5GAHI 1RZMA 1PYTA 4DR2F 4TY9A 3LDQA 1KFSA 2CPEA 4NYPA 3BQ2A 2E5LK 3TQ1A 5KOWA 1WF2A 1HBMA 3I6PA 3W61A 4BRKA 1RQ0A 2MZ1A 4QR2A 5C24A 4ECSA 2G0CA 3CGIA 3PDNA 5MLCV 4DPOA 5KFHA 1MU2A 5J2MB 2C2MB 1GLFO 4MO4A 5KRSA 1BGXT 3E01B 3TA1A 4IG0B 3Q8UA 2FC8A 2W9BA 1T3NA 3TAEA 2DPIA 4KH0B 4NXMK 4LF8K 3R5AA 5B7WA 4YY3K 2DNMA 2RNEA 2FJWA 2RUSA 3H2LA 3UE2A 3C66A 3SXLA 1Z05A 1BD6A 3POTB 1HJRA 3J7YI 4XEIA 4NE9C 2VC1A 3ZT0A 1V5VA 2DITA 4QYRA 4B3OB 4HHJA 2IAJA 1F6TA 4Q8EA 2ZF5O 3G4SN 2UP1A 3Q83A 1HBNB 5I3PA 4FS1A 5F8GA 3E51A 2O8DA 2DGTA 1IR2A 2N3OA 4OYWA 1S9GB 4FJLA 1YG0A 4DEZA 3MFHA 4ILMA 3O1WA 2VV5A 1J54A 3UVJA 4XH1A 2XMWA 4LF4K 3VQAA 1C0GA 4N7TA 5BPMA 2QTDA 3DXKB 4KHMA 2UVUA 1Q79A 4ZLLA 2WAQD 1YTAA 4XO0A 2YKPA 1UJ4A 3D0IE 5AZJB 4KI6A 4OYMA 2PYJA 3HYFA 2BA9A 4HT5A 2IVYA 2BRLA 4OX6A 3LPTA 2IY5B 1EP4B 1M90O 3P83D 1Y3JA 4ZVTB 4CWBA 5IWAF 1BQNA 3BJYA 2V8VA 4FM0A 1X8DA 1FJGJ 5JMNA 3MXJA 3C15B 2G2ZA 3BH6B 1RP5A 1NMEB 8AT1B 1OS5A 4ELVA 4MFBB 4BR4A 3DXBA 3M8RA 3CJ8A 1S1UA 1M5VC 2ROPA 3ICLA 3EZUA 5AZJA 2ERRA 4DZ6A 3RB4A 3OYLA 4JNEA 4KC5A 1B70B 3RW6A 1FKOA 4LF8J 3DRPB 3F73A 1ZM9A 3VGVA 3VAGA 2O8EB 5I9EB 3FZFA 1OH8A 4JKAA 1RT2B 5E41A 4J8FA 4B9SA 8ATCB 3W5ZA 4M7XA 5L1KA 2Q31A 1VI7A 2R2TA 2V4RA 4WK3A 2R8KA 2MLZA 1WC1A 4USKA 3MMAA 4OX9J 4DCHA 4KH4A 2UUCK 4KSEB 5DRKA 3FR0A 4LRBA 4B8CA 4MIAA 3QERA 3B54A 1QSYA 4YB5A 3VQ7A 3J81O 2D3UA 3W8PA 3EWGA 1NOZA 2KDOA 3IA0A 1T7PA 2XC9A 2E5LF 4LBHA 1S59A 1WOOA 2QE5A 4KE5A 2HBRB 3OFEA 2DGQA 2YX7A 3THYB 2BR0A 1SAZA 1DLOB 1KHWA 4BBYA 1DT9A 2DGOA 3CJCA 5HRNA 4RW8B 3AO1A 3QMLA 3DYAB 4S0MA 2BOAA 2BV3A 4EBDA 2OYQA 1R8AA 4ES2A 3HZ6A 4EMDA 4KQZA 2AT1B 2IM2A 1FA0A 1GOCA 1UPPA 4OX9F 5D4NA 5E33A 3CETA 3LZIA 1RT2A 3PFEA 4IFYA 3K58A 4EZ9A 2KT2A 2ASOA 2D4WA 1FT8A 1IG9A 3DRPA 5AQLA 1XR5A 3GSIA 1SV5B 5KG3A 3KLIB 4OZLA 1RWKB 1AXQA 3BSAA 3NY0A 3CCRS 4CI6A 1NAQA 1BIZA 4FP9A 3IDHA 1N8RO 3FQKA 4C8MA 3EPGA 4IOAQ 4IO9Q 1Q4RA 2V52B 3N6MA 1W2IA 1S77D 2MKHA 4A48A 4ANDA 2M52A 4DR5K 3RZAA 3GWCA 3VWSA 4J9RA 1ZXOA 2EXUA 3O2IA 3M8PB 3GB0A 3NS7B 1NH7A 3W3DA 3PLAA 3TTCA 4B3MF 1FW6A 1X9WA 1EQ0A 2YQ1A 4KV8B 2F3JA 3DGVA 5KFDA 1JLAA 4YDXA 5G0RA 3CC2S 3N4WA 3FGVA 3TNVA 4X4VA 4JK9A 4LFBF 3PG9A 2YNHA 3QRPA 1VQ5N 2A3JA 5M1FA 3KWIA 5CZXA 4YMEA 1A5VA 1VQPS 1UVLA 4KHWA 3SQ2A 4ZPDA 1JIHA 1IBKF 4FNHA 3HPHA 3RMCA 4OJ1A 2UYTA 5EN1A 2MDAA 4FJHA 3AVKA 3UNYA 1U2FA 4DR1K 1CJTB 3WNHA 3LALA 3D5MA 5D3GB 1GLLO 4DTXA 3PY8A 4NRUA 1GEHA 4IG3B 2DRBA 3CT9A 4YDUC 4ECUA 1UA1A 3SUPA 3C2PA 2WBMA 3J81Y 4E1JA 4KYZA 3HTVA 1H6KX 3TUPA 3O08A 3HOSA 1FESA 3TZXA 3CJKB 1MWQA 3HHLB 1GOBA 4LH4A 4ZPBA 4DR5F 2VOPA 4WBFA 3H20A 3NFAA 2QEXS 2AJFE 2VHGA 3Q8VA 1RYRA 2CPFA 2F8TA 4KGMA 4OJGA 2OEMA 5HP1B 2HIQA 1D3WA 4DUYF 2E5IA 1XR6A 1SJ3P 1VSIA 1T44A 2JDJA 4NB4A 3MM9A 5JS1A 3V6DA 3K2PA 4F4WA 3ZO7A 2JC0A 3ZT2A 2IJFA 2XI2A 2KRRA 1SQKA 2E1YA 3L3VA 1RISA 5ETKA 4NLCA 3BV8A 4FYYB 4GV6A 4DUZK 4DOZA 1MW7A 4LFCF 4X4TA 1JLAB 3G86A 2OD4A 2AF6A 2V5HG 1QQCA 3KWMA 2GCFA 2H5IB 2PDAA 4U95A 4IEEA 1S7HA 3DLRA 3DDNA 4CNZA 3QO9B 1RDUA 1VQ4S 1LQ9A 4E1MA 3MX2A 4LRDA 1U47A 2Y1JA 1YJWS 1CBKA 5EX5A 2RF2A 1RWPB 3JAMU 6FD1A 5FIIA 1KAXA 1KQKA 1E4FT 3MR2A 4JHDA 4YOUA 3QRRA 3O44A 2GTDA 5D78A 5JUMA 1OIAA 2XM3A 3PX6A 1TKDA 2BABA 1HNWJ 3R1HA 1H74A 2BW2A 1PIEA 4HI2A 4P9SA 4KH6A 2BE2B 4IYQA 3PRVA 1S3XA 2G8IA 4BRHA 5JVGQ 1HNXJ 1SC3B 2PIIA 3P5TL 1VQON 1LWCB 3T5LA 3C6AA 2D0PA 3G96A 3NGRA 4M5GA 1XNRF 2YNIB 4YOTA 2ZNZA 5LL6Z 1DFDA 4DQ8A 1T8EA 3PKYA 2DH9A 2GUIA 1U7LA 1FNMA 2E1CA 2VA3A 2HS3A 4FYVB 1VK0A 4I64A 4FJ7A 4RNHA 2PI5A 6FDRA 1N4LA 4J2DA 1YQHA 1AFIA 2DR8A 5F8HA 3TX0A 1D4XA 2ASPA 3BKUA 3IGVA 4X64J 1SJQA 2KHCA 1PAEX 4KGZB 4KI4A 4N47A 3GE9A 3BSOA 3SMPA 1N52B 3VQ8A 1RT6A 3O1LA 5TKWA 2F4VJ 5AQPA 1UEUA 3QT5A 2YNHB 2MJUA 1JMTA 2PD1A 3SQGB 2VQFF 3VQPA 2YX4A 3HCXA 4CK1A 2BYCA 1UMJA 1Z2ZA 5A8WA 2C3OA 3ZZYA 5LMUF 1K1SA 3VF0B 2NZTA 3L4QA 3K0SA 3NH1A 5D0HA 2WONB 1CPZA 2FZKB 2F7VA 4R5PA 2CG4A 4WPAA 4ED5A 4CK3A 5M2UA 1NXIA 1WOQA 3CC7S 2BJ1A 5KG5A 3UCZP 4AE5A 1S1UB 3G2XA 4TU8A 2DR6A 2IHR1 3N28A 3THXB 2Z1GA 3HSJA 2HQCA 5EWGA 3ISZA 2DY4A 1YITS 2Q1LA 4G3IA 4BVPA 3W9IA 2HSTA 1FERA 2ZZNA 2UXBJ 3CD7A 5KFKA 2OPRA 2BANA 4CJWA 1PC5A 2QO3A 4CZGA 3EO3A 1T02A 4PPZA 4LD0A 1VC0A 1IH7A 1SPBP 4NLXA 2QL7B 4DSKA 2YXLA 3JB9k 2P2CB 4J2BA 4DSLA 4TNOA 4CECA 2HFZA 4R79A 1X7VA 1JLBA 1CJVA 1FXLA 3DI6B 1VYAA 2WCXA 3UVJB 3C14A 3IM9A 2A3ZA 5GAGI 1RK8A 2FHJA 3JQMA 2BJ3A 1N56A 1LWEA 1FJGK 3AXMA 3Q7BA 1HJOA 1N0VC 2P9IA 4CEAA 4WQ5C 4Y0FA 3KHGA 1Y9OA 3QGIA 1VHFA 3TANA 3DXKA 3IXQA 1R0AA 2FVPA 4H4KC 5A2QO 2E5JA 2R42A 1DLOA 4M95A 3QDKA 3NGKA 1W97L 3H42A 3J81U 1VOMA 4DL3A 2DNKA 1FDAA 5E26A 2BKNA 1S1VB 3W9JA 5CY4A 3C16B 4GVEA 5KFSA 4ES1A 2HFVA 2ZNYA 3BUZB 4E7KA 1NJWA 3AQOA 1TK8A 1RYSA 3BQ1A 1S9EB 1GFWB 4LSNB 3CJ5A 4H0PA 1J2VA 2DIVA 4J9OA 2CJ9A 2COLA 3RUBL 3M8QA 3SUQA 2YNFA 4TYAA 4QWDA 2VONA 2UV8G 2QLXA 1G2EA 1YBAA 3AB2B 3CSKA 1RT5B 2B4OA 2HLTA 3M8WA 3DI6A 4O8KA 4FYWB 2KB2A 1SL1A 1KQGB 3PW4A 1Z4UA 2BX6A 1VAZA 3G9CA 3OR2B 1DKGD 4K4TA 2D69A 1V4SA 4WQ4C 4B9VA 2ZBIA 1GLBG 1HYZA 5LT5A 2P9KA 3GYGA 5BJRA 3CD6S 2NLXA 2U2FA 3ITHB 4ICLB 5BR9A 4F02A 2NQPA 4DU3A 3AA5X 4ECVA 4KTZA 3BBFA 1F2GA 4E2FB 4RW4B 2J0SD 4WQ4A 2FZCB 3VQ5A 1WHYA 5AQRA 4C11A 2CQ0A 2MKCA 5ETSA 1UVMA 2P9GA 4DR6J 3MR5A 3PYDA 3M5RA 4DL2A 3HD2A 4ILRA 1TVRB 4XPCA 4RBVA 2EC0A 2J4RA 4OV6A 3FFIB 1N33F 2KKZA 4KPYA 4XK8C 4HHTA 2W2OP 3G6XA 2VDHA 3NRBA 1TUWA 2AD9A 1NJYA 4G9ZA 3M2UA 3OQ2A 4Y2CA 4FWLA 2CH5A 1YRXA 1SIWB 4AD6A 3BO3A 4RU2A 4FJXA 2K2PA 1JLEA 1Y97A 4Z4EA 2Q3SA 5DGAA 1LOTB 2GJIA 1FK9B 4CIEA 3Q8SB 1FXDA 4WIQA 3M6UA 3O5TB 3TSUA 4U7BA 3SBGA 2GVZB 3KLGB 4ETXA 1WNEA 2WVDA 2Z2LA 3RGIA 5AQOA 1TAUA 3CJKA 2KG0A 1VQ9N 3BP8A 3MTJA 2WTFA 4HYKA 2Q97A 1FDNA 3AARA 3DLGA 1C0UA 5DJBA 4NX9A 2VFSA 2W9BB 2DO0A 3MECB 2VG6B 1WSRA 2VWKA 1BWEA 1R59O 4DHYA 1M5PC 2VQEK 3CUNA 1G3OA 3H4DA 2B9XA 2ZE2A 4DSJA 3CULA 2VYPA 3F41A 3HT0A 4BY9C 3MPUB 3G8TA 4IH7A 2A40A 5CD4H 2D1KA 4QIGA 1HI0P 1M5OC 3DNCA 1Y00A 2ADCA 2Z1HA 4TY8A 9RUBA 3CD6N 4MDBA 3E01A 3S7RA 4O8UA 1E6VA 3KLFA 2IYGA 3NOGA 4OI0A 3FMWA 4FKYA 4WP3A 2HB5A 1QVFR 4HUGA 4OZJA 3QWUA 3R8YA 3ZSVA 3MCNA 2OPSB 4FOEA 1GLDG 4PY5A 3W64A 3MDFA 3GJSB 3IR7B 5KFZA 2AIRB 2XNRA 3VQ9A 5D4LA 2NNWA 2CWXA 3EGNA 3PHTA 1H7WA 2XMMA 5MLCQ 3UW1A 4IDKA 3SJHA 2ZWPA 5DK5A 2NXJA 1FX4A 3GDQA 2BW7A 5KGWA 1IBCB 4LF1A 4IQMA 1IM4A 1NO8A