1LWCA

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
506
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 146
structure length 506
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwcA05
3KK1B 4Y2CA 5KT5A 4DS4A 4BDYA 3AVGA 3KHRA 4FLVA 4IRCA 3MEEA 1TK0A 2PZSA 4ECYA 4NRUA 3H5UA 1A5VA 4G1QA 3RWUA 4JRPA 1TL1A 3KK1A 3NAEA 2G8WA 2GV9A 1QSLA 3HYFA 4AHSA 4B9SA 2IA6A 4CE9A 4I2PB 4H4OB 1TP7A 4E7HA 4ZPDA 4FK0A 4IFYB 3HPOA 1UA0A 1GX6A 1N5YB 3BJYA 4E89A 2XWYA 4E7LA 4C8LA 4CK2A 2OPQA 2WHOA 2P1JA 2OA8A 3S3OA 1NHVA 3VQDA 1CXQA 1JLGB 4I2PA 4H4OA 3NH0A 4FJ8A 3IG1B 1VSMA 3U6FA 2VG7B 4IFYA 1SH3A 5F9NA 4Q44A 3ZT1A 1CSJA 5F8GA 4CEZA 1VSHA 3MTKA 1JLGA 4HUGA 4DTPA 2VG7A 3K5MA 4ZP8A 3LPUA 4Z4EA 3V9XA 1S1WB 3KLEB 1NK0A 3T3FA 3HP6A 4HHTA 3VA3A 3HVAA 3DOLB 3PW2A 3DLRA 3OYKA 1KFSA 3KLHB 3ZT3A 2IOCA 3IGVA 3SFGA 3V81B 4CERA 3PR5B 4EEYA 2ZQBA 2XI2A 3OJSA 4ED1A 4DQPA 4RNNA 1T7PA 3KLHA 1QAIA 3E51A 2HHUA 4M3RA 5FDLA 3I0RA 4FJ9A 1BGXT 3LALA 3RB3A 4ELUA 1TKDA 4QPXA 4ED2A 2FJWA 3M8PA 1NKEA 3FFIB 1TKXB 1IKYA 3KJVA 4CHOA 1X1PA 3V9ZA 4K4XA 3QEIA 1T3NA 3SNNA 3OSPA 1QS4A 4DTMA 2PYJA 1UWBA 3V6DB 3PX6A 3MXJA 5KGWA 3TWHA 1U45A 3JSMB 3NHGA 4KHYA 4J2EA 4GC7A 3FFIA 3D45A 1UA1A 1TK5A 3AO4A 4N47A 4C8OA 3SPYA 4Z4CA 3KLIB 2DY4A 2IAJB 3H4BA 3FRZA 3SZ2A 5EWEA 4W5OA 4FLWA 4EZ6A 3JSMA 4O3PA 5T7BA 4FZZA 3QNNA 2FVQA 1NOZA 1D1UA 1TVRB 3IAYA 3T5LA 3QIPB 4FBUA 5KFDA 3MR3A 1JXBA 3KLIA 1IH7A 4K4YA 4WZQA 3K5NA 1NJYA 4Z4FA 3DI6B 3TAQA 4XPEA 3UDLA 1TL3B 1KLMB 5JUMA 4KTZA 3TAFA 4I7FA 2DPJA 2XGPA 3GV5B 1RBUA 2W7PA 3CM6A 1EETB 1S1VB 4ZVFA 3QETA 4F4YA 3DI6A 3DRRB 2F96A 4N56A 3I5BA 1TL3A 1KLMA 3WNEA 1D0EA 3OL7A 3CM5A 4H8KA 1BL3A 4Y34A 1GOCA 4FJ5A 1XWLA 3CFPA 3NMAA 1EETA 1S1VA 5KFQA 3KMQA 3TVKA 5KFSA 3VN5A 3PO4A 1NNDA 4Q0BB 2DTUA 3DRRA 4CHNA 3T1AA 4YR3A 3GIKA 3UPFA 4JLHA 1DTTA 2GIQA 2XY8A 2HHXA 2VG6B 3TAPA 5CYMB 2W8LA 3AVIA 2X74A 3DMJB 4Z4GA 3CJ4A 3N6NA 3ASMA 4IG3B 4DSIA 1FKOB 4DEZA 1TV6B 3DOKB 2HMIB 4TQSA 1C0TA 2VWKA 5CYMA 1QAJA 4B9UA 1BQNB 3NGDA 3DM2A 4NYZA 5L1KA 4IG3A 3KK2B 5DG8A 3VQ4A 4DG1B 5F8MA 4GW6A 2JGUA 4F4WA 4ED6A 3KTQA 3DOKA 3HVWA 2HMIA 3UQSA 4KSEB 3BSNA 4Y1CA 4EP5A 2AX0A 2R8KA 3LAMA 2W8KA 1ZYQA 2W9BB 4O3SA 4KTWA 1NK7A 3AA3A 4DG1A 4LH5A 1FK9B 3L2VA 3B6PA 4EYIB 4QW9A 3DLBA 2JEJA 1TGOA 4M45A 3SQ2A 4B3OB 2J6UA 1YTUA 2ILYA 1RT3B 4IRKA 1FK9A 5KFTA 3L2WA 4DQRA 2ATLA 2F8SA 3ZSOA 2XY5A 5KFPA 1L3TA 3N6MA 1JXEA 1ZBIA 4R8UB 5CYQB 4B3OA 1SKWA 1RT3A 4CJEA 3OYHA 4DTUA 2HHQA 4I2QB 1ZBLA 3MXIA 4DLEA 1D8YA 4R8UA 4C8MA 2RF2A 5JS2A 5CYQA 1QHTA 4B9TA 1SUQA 2OZMA 2P5GA 2AWZA 5FROA 5C25A 3QGGA 4I2QA 4NCBA 4IG0A 3DRSA 3F9KA 3NL0A 4M3TA 3MR5A 2E9RX 1TAUA 2ILZA 3S3MA 3BGRB 4K4ZA 1U09A 3VQSA 1RNHA 3V4IB 4B9VA 2JEFA 4H4MA 3SQ0A 1UOCA 3AV9A 2BE2A 5JS1A 4WZMA 1NK6A 3PO5A 2OH2A 3BGRA 4ECQA 3LP0A 3GQCA 3V4IA 3NAHA 2IMWP 2YKMB 3MEGB 3DLGB 4J9SA 3OYBA 1RTHB 3H08A 2VG5B 4CEEA 3RMCA 3O4NA 2HVHA 4ZHRB 3QLHB 3IGNA 4WYLA 4GMJB 1VSJA 2A1SA 2EX3A 4O4RA 4OGCA 4HYKA 1SL2A 4FW2A 4DF8A 4CJTA 3OYJA 1RTHA 3BREA 4KTQA 3SYZA 2RDIA 3HKWA 1U49A 4KAZA 1JLCB 4DTNA 3KHHA 1S6QB 5KFXA 2XI3A 1XR5A 2F8EX 4CGFA 4KO0B 4DTOA 4FBTA 5KFYA 5KTQA 3AVFA 2Y1JA 3ZT4A 3OYNA 3ULDA 1JLCA 3GYNA 4EO8A 4ZPAA 1VSIA 1JLAB 1XHZA 4B9LA 1S6QA 1BI4A 3V1QA 4CJPA 4MIBA 3NH1A 2B43A 4KO0A 3DYAA 3KLVA 2FLPA 5KG4A 1J53A 1Q8IA 4KHWA 4EZ9A 1BHLA 1JLAA 1X9MA 4O3OA 1S9EA 4G3IA 3K5OA 1S6PB 3KK3B 3SQ1A 1D9DA 3AO5A 1JLQA 1L3UA 4NLRA 3QGIA 3C94A 4JS4A 1RTIB 5DG7A 3GIMA 1QSSA 4KPYA 2B6AB 3WNHA 1S1UA 4TYAA 3KK3A 3QIOA 3RTVA 2HWIA 1Z25A 3M9MB 4E3SA 4ICLB 1C1CA 2G8HA 4RNMA 1RTIA 2B5JB 4CGGA 2IM2A 1XI1A 4BACA 2VA2A 2B6AA 4WE1B 5J2PA 2DFEA 3PW4A 2QK9A 4ECWA 4CHYA 4MFBB 2E6LA 1NJXA 3AVCA 1ZBHA 5KG1A 4CECA 2B5JA 1SKSA 3G0ZA 2R2SA 4DQIA 4DFMA 5J1EA 2GBZA 3ZSZA 3HJFA 4MFBA 1RT2B 4MKBA 3P5JA 4FZYA 3H59A 4KB1A 3KD5E 3EPIA 5KFMA 1CLQA 4FK2A 3PVXA 1TKZB 1RT2A 2DFFA 3C95A 1EKEA 1J9AA 2XCAA 4LD0A 4PUOB 3MEEB 2D0AA 1T94A 4CEQA 5F9LA 2QKKA 1S1XA 3ZSVA 2BRLA 4G1QB 3P1GA 1TL1B 5KFJA 5KRSA 1TKZA 3Q8QB 4FJXA 3DLEB 2WRMA 4AHUA 4DS5A 4PUOA 2CJQA 1IKVA 4N41A 1U48A 3O3FA 3OJUA 4F3TA 4C8KA 4F4ZA 1KVCA 1RILA 4IQXA 4NLTA 3VQ8A 4CGDA 2OPQB 2UVRA 3DLEA 3VQPA 4KHNA 2UVUA 4CJ3A 4E1NA 2UUTA 1HPZA 1BCOA 4UQGA 3D0PA 4PWDA 1RAJA 3RRHA 3OS0A 5KGXA 2YNIA 2D5RA 4O4GB 3WNGA 4EBCA 4Q43A 1ZTTA 1X9SA 2EHGA 1HYSA 3TQ1A 2RN2A 4BE1A 1D5AA 1QTMA 4YP3A 4O4GA 4W5TA 3NH2A 3AA4A 3HM9A 4KAIA 4ID5A 4NYNA 1LAVA 4F4XA 1Q9XA 4NYFA 4CJLA 3CJ0A 3RB0A 3C6TA 1JX4A 1IKWB 3AVMA 4DSLA 2D41A 2WK4A 4U6PA 4FLUA 2BQ3A 4CF0A 3OL9A 2D0BA 3CDEA 4RW7B 1RBTA 2ITGA 1NKCA 3M8QA 2A1RA 3PV8A 3MEDB 3KD1E 4HTUA 1IKWA 4C8NA 3VQCA 4ECZA 4FK4A 4JV1A 5F8JA 2WCXA 4FXDA 2LSNA 1R0AB 5KFNA 2AQ4A 3SFUA 2IC3B 5FDLB 4RW7A 3I0RB 4K8XA 4LY7A 4J9QA 1S49A 3MEDA 1C2PA 4FJIA 3KLFB 1J54A 4DFJA 3NGYA 2QKBA 2YNFA 2QXFA 2R7YA 3C6UB 1WLJA 1S10A 4HKQA 1R0AA 4PA1A 2IC3A 4KBIA 1SL1A 3MR2A 4RUCA 5KT6A 2R8IA 5KFZA 3M8PB 3FSIA 1IKYB 4KHQA 3KLFA 3KJVB 4FS2A 2QV6A 3C6UA 4QCLA 4OPKA 2R8HA 1S97A 5F8LA 1UWBB 4NLVA 1VSDA 5HRPA 2BRKA 2ASLA 2HNZB 4F50A 3L2QA 4TXSA 2RDJA 3OYDA 2KW4A 1S0NA 1JLFB 4QW8A 2F8TA 1XR6A 4AHCA 2ZE2B 3QIDA 3CIZA 3MF5A 2IJFA 1WNSA 3ITHB 3AO1A 2V4QA 3TAGA 2HAIA 2BQRA 2HNZA 2OPRB 5HROA 1KSPA 2HNDB 1FKPB 4QAGA 1JLFA 2UUWA 5L9XA 1S0MA 5T14A 5DLFA 1XC9A 2ZE2A 1B9DA 3ITHA 1TAQA 4ECUA 1KCFA 4DSFA 2FVRA 2OPRA 4OVLA 2HNDA 4CJSA 2IM3A 3GILA 1FKPA 4Z4IA 4NLSA 3KNAA 4U7CA 4LSNB 4I7FB 4IR9A 3CJ3A 3I0SA 4IKFA 4URGA 4Y3CA 4TLRA 2YNGA 2FJXA 3HO1A 1NJWA 2OPSA 1T03A 1XR7A 4H54A 4DL6A 3AVNA 4FZXC 1LW2B 2KFNA 1BISA 1ZBFA 2HHTA 4LSNA 1U4BA 5KT4A 5KG7A 4JV2A 3QEWA 3NCIA 2GC8A 3V1RA 2HW3A 1IG9A 2GUIA 4DU4A 2R2RA 4CEFA 4OLBA 1LW2A 4K4TA 4N5SA 4IRDA 2W7OA 5CZ2A 1JIHA 1HNIA 1DTTB 4YQWA 3LZIA 3RR8A 3AVJA 4NLWA 4K8ZA 3CYMA 3NBPB 4QWAA 4AHTA 4DU3A 3PY8A 5HBMA 4MH8A 3K59A 3TABA 4K4VA 3M9NB 3PUFA 4CCHA 1IM4A 4CJQA 4CJWA 3H5XA 1C0TB 2RPIA 2XY7A 3NBPA 4IFVA 3HPHA 1K1QA 4AHVA 3DM2B 4M42A 4TQRA 4RW9A 1RDCA 3CO9A 3V6JA 3G86A 1QE1A 3RMBA 3TR8A 1QUVA 4DL3A 4EBEA 3V1OA 4E7KA 2KQ2A 5KFCA 3S9HA 4O44A 1N6QA 5KFAA 4CF8A 5KT7A 5KFHA 3OYIA 4CEAA 4KB7A 5C24B 1EX4A 2ETJA 4K4UA 4DWIA 5KG3A 3QO9B 4J9PA 4PY5A 3OYCA 4YMEA 4CEOA 1ZETA 5C24A 1S0OA 4RUAA 1RT4B 1W25A 1TK8A 4DF4A 3H2LA 4J9RA 4F8RA 4W5RA 5KFIA 1DTQA 4JV0A 3QO9A 2Z1JA 1RBSA 4IOBA 3NF7A 5K14A 1HYVA 4BDPA 3E01A 3O4QA 3PHEA 4LSLA 4J9MA 1RT4A 5KG0A 2RF2B 4CJ5A 4OLAA 3H98A 1SUQB 1VRUB 1RBVA 5KG6A 3ZSYA 2AJQA 5KI6A 1MMLA 5C25B 2C28A 3KHGA 2C2RA 5I42A 4IH5A 4YNQA 5HRSA 4IG0B 3DRSB 3OHBA 3BQ1A 1KVAA 3RMAA 1Z26A 4I9QA 1QQCA 1VRUA 2RKIB 2AGQA 3AVAA 4O0JA 4F4KA 4H4MB 3EYZA 2HHWA 2HWHA 1LAWA 2ZD1A 5J2MB 4FLTA 1XHXA 4ZVEA 1OS5A 3QGHA 2V9WA 4B8CA 2BE2B 4TN2A 2O5DA 4ED7A 3VA0A 3LP0B 4NLQA 3PW7A 1NK5A 4RNFA 2RKIA 4ECVA 2W9CB 4O5BA 4XPCA 4NLDA 4NLUA 4FS1A 3L2UA 2BGGA 5J2MA 1ASUA 2IS3A 3N6LA 4CIGA 4CGIA 1L3VA 5I3UB 4ELVA 3GIJA 4DLGA 3EZ5A 2Z1GA 4JS5A 3TANA 3ZSRA 2W9CA 4FJHA 4NLYA 1BIZA 3SPZA 1C1BB 4ECXA 4ECSA 5I3UA 4M94A 3BDPA 2AU0A 3HVRA 3LP3A 4W5QA 3JYTB 4WFZA 1VSFA 4ZVGA 1C1BA 5CZ1A 4CHPA 3H4DA 3ISNC 4FM1A 5DQGA 1WSIA 3LZJA 5DQIA 3B6OA 4BWMA 3BSAA 4FJ7A 3JYTA 2FBTA 4ZTFA 1BI4B 4Q8FA 3NE6A 4FYDA 5KFKA 3AVBA 3VQAA 2R2TA 3CFOA 3DLKA 3NKYA 1C0UB 3DYAB 5L1IA 1S5JA 4CF2A 2W9AA 4F2SA 2Z1HA 4RW6B 4Q45A 3PX0A 4EP4A 5KRTA 5E41A 5SZTA 2HNYB 4Q5VA 1RTJB 4CF9A 1S9EB 3LP2A 3VQ5A 3K57A 3H5YA 1NK8A 2CKWA 1C0UA 3A2FA 1JLQB 4CHZA 1VSKA 1RT1B 4RW6A 4E7JA 4CGJA 3M9OB 4XIUA 2HNYA 1RTJA 4CJKA 1S1UB 5KFEA 3RAXA 4JUZA 5EWFA 4YR2A 1KFDA 2X6SA 4ID1A 1RA6A 1C1CB 1RT1A 2Y1IA 5F8IA 2E9ZA 2OYQA 2KTQA 4R5PB 4O3NA 5DG9A 5J2PB 4IDKB 3CFRA 4CESA 3LAKA 5HRNA 1SL0A 4DTJA 5J2QA 2FLLA 1VRTB 2KZZA 3KIOA 5F8HA 1YVFA 1IKXB 4R5PA 4J9KA 2YKNA 5J1EB 4IDKA 2JC1A 3EY1A 3T5KA 3T19A 3QEVA 5HRRA 3LWLA 1VRTA 1TQLA 3T5JA 1I3AA 1UAXA 4FJGA 1K6YA 3TI0A 4DSKA 1CXUA 1IKXA 3RR7A 1BQMA 1ASVA 2YHAA 4DL4A 4BWJA 3AA2A 3DDKA 2BANA 4DFKA 1C1AA 2Q3SA 3L2RA 3OS2A 1RT6A 3RRGA 1G15A 1JL2A 4OKEA 4NZ0A 3BSCA 2HB5A 4ECRA 4RG8A 4LQ9A 3CWJA 2KFZA 4M3ZA 1S1XB 2DPIA 4URQU 1D9FA 5FRMA 4M3YA 2PYLA 1VSEA 3K2PA 3OYMA 5J2NB 1LWCA 1N4LA 3HK2A 3EZUA 4CJ4A 1IKVB 2C2EA 1X9WA 4KFBA 3RMDA 3OHAA 5J2NA 3TARA 1B92A 3CJ2A 2G8IA 4MK7A 1HPZB 1NK9A 4DSJA 1VK0A 2EC0A 4PWDB 1KLNA 1Z4UA 2YNIB 3Q8SB 1JKHB 2WONB 2YNHB 4DTSA 4QWBA 3WNFA 2P51A 2HHVA 5EU7A 1HYSB 4URSA 4DTXA 4OPJA 4Z4HA 4TY8B 1C6VA 3AVLA 1JKHA 2WONA 2YNHA 4CEDA 3SUOA 4J2DA 1KVBA 4ID5B 3PJWA 3QYYA 3V9WA 4WYWA 4WFYA 3C6TB 1YT3A 1S48A 4CIEA 3PW0A 3U3YA 3IRXB 4TY8A 1RDDA 4FM2A 3I5AA 1FXXA 1S9FA 3NGIA 3CG7A 3M8QB 2J6SA 2FC0A 5KFGA 1SH0A 3MR6A 4ZPBA 4FLYA 1N5YA 3HP9A 3IRXA 1YVUA 3CJ5A 4J9LA 2JEIA 1WNEA 2G8FA 3MXMA 4KI4A 3VQBA 1S1TB 1BIUA 1IO2A 4B9MA 4O3QA 2FBXA 3SQ4A 3HT3A 3QERA 2BR0A 3QEPA 3IG1A 3M8SA 3AA5X 2YNFB 1S4FA 3UR0A 4ED8A 3OLAA 4KB0A 2WTFA 4J9NA 1S1TA 3OY9A 2UVVA 3IN5A 4OL8A 3KKSA 5KT2A 1SV5B 1WSEA 4MK9A 4XO0A 2O4GA 4TYBA 2IGIA 4MK8A 4J9OA 1EP4B 4JRQA 1S1WA 5HP1B 3KLEA 4QWDA 4AILC 1F21A 1SV5A 4X2BA 4HVJA 2C22A 1L5UA 1L3SA 2HVIA 1O1WA 3FDSA 2E6MA 3DOLA 2D0CA 4ZP7A 1EP4A 4NLGA 2R8GA 1MU2B 5HP1A 3G6VA 5HROB 4DL5A 1LWEB 2P5OA 3V81A 4ZVHA 3OL6A 3EPGA 1RBRA 1T8EA 3GIIA 4RW8B 4QWCA 3V6HA 2IM1A 1N56A 4NLOA 3NDKA 1J5OB 3S3NA 1W0HA 1MU2A 2DFHA 1B9FA 1LWEA 4J2BA 4KHUA 4Z0UA 4FW1A 3NGZA 4RW8A 5C5JA 3O3GA 3OYFA 5JXSA 2XGQA 2W42A 4FLZA 1J5OA 3I0SB 3DRPB 2YNGB 2XRIA 2D3ZA 2OPSB 1T03B 1GOAA 1RT7B 2YHBA 2VWJA 3QESA 3DLHA 4CFBA 4TY9A 1TKXA 2FVPA 3HHKA 4EO6A 5DGBA 4FJMA 3DRPA 4KHSA 1RDAA 4NCGB 2JEGA 1A5WA 3ZSQA 1RT7A 3V6DA 3NF9A 2O4IA 3VQ7A 1U47A 4RU9A 4FJNA 3LP1B 2R8JA 1KRPA 2D7SA 2IBKA 4NLXA 4FCYA 3QINA 5KFBA 1HNIB 3AVKA 4GVMA 2IAJA 4IKAA 4NCGA 3L8BA 3AO3A 4HUEA 4AH9A 3LP1A 2WB4A 3CQ8A 3SUPA 5HBMB 1TVRA 3QIPA 5DGAA 5KT3A 3RB4A 1GX5A 3D28A 3RB6A 4EYHB 2G8KA 5FRNA 4IFVB 4Q8EA 4O3RA 2V0NA 3NF8A 4KI6A 5EUHA 1RYRA 4K4WA 4RNOA 2VA3A 4NLPA 1NOYA 4RW9B 2J6TA 2BDPA 1QE1B 3NF6A 3PJXA 4CJVA 2YV0X 4ZPCA 3FQKA 4O44B 1N6QB 2C2DA 3OYEA 1LW0B 3I8DA 3MECB 3QZ7A 1KHWA 1ZTWA 3L3UA 4CFCA 4HUFA 2Z1IA 1C0MA 4RNHA 2AGPA 1S9GB 5D3GB 3FQLA 2X6NA 3P83D 4Q0BA 1LW0A 2ALZA 3V9UA 3MECA 4Y2AA 5CY4A 4KE5A 1SH2A 1EXQA 2XY6A 4IH6A 2D3UA 4M41A 2XO7A 4CHQA 1HYZA 1S9GA 2VG6A 5D3GA 3QEXA 2AGOA 4CGHA 5KFVA 1DTQB 3V6KA 1JLBB 3DMJA 5KG2A 1HJRA 1FKOA 1HNVB 5K14B 4M3UA 4O0IA 1RT5B 4LQ3A 3E01B 4LSLB 1TV6A 2HHSA 3RAQA 1HARA 3BQ2A 4OKJA 3LPTA 4GC6A 5SWMA 4YFUA 4QOZB 1WAFA 1T05B 3Q8RB 1BQNA 1JLBA 3KK2A 5I42B 4ED3A 4M3XA 3BQ0A 1HNVA 3LWMA 3QZ8A 2WOMB 1RT5A 2XHBA 3LANA 3NAIA 3HSTB 3M8RA 4MKAA 3G10A 1WN7A 4NCAA 1A5XA 1T05A 1NJZA 3ZCMA 1I39A 2W9BA 4KHMA 2ZD1B 2E9TA 2WOMA 2FJVA 3ALYA 3TAMB 3VQ6A 1GOBA 5KFOA 2PY5A 3BR9A 4DSEA 4CJFA 3THVA 1I6JA 3SV3A 4ZTJA 3AO2A 1RTDB 3HXMA 3CDUA 1CZBA 3V9SA 3TAMA 4N76A 4Y1DA 1HMVB 3TAEA 4CF1A 3PX4A 4QWEA 5HLFB 1WAJA 1ITGA 3PW5A 4E19A 2OZSA 1REVB 3VQ9A 1KTQA 3RBDA 4NRTA 1RTDA 4CFDA 4IR1A 5KFWA 4KHRA 1WSJA 3ZT0A 5KFRA 4FM0A 2X78A 1HMVA 3CDWA 3MAQA 5HLFA 1JL1A 3IS9B 4DL7A 1Y97A 4HCBA 1REVA 3ZSXA 4CFAA 5KFUA 3AVHA 1TKTB 1KHVA 4KREA 3ZT2A 5DMRA 3KLGB 4KKOB 4L8RB 4J2AA 2ZKUA 4DFPA 4IH7A 3SI8A 4W5NA 3RBEA 4B08A 1VSLA 3HPGA 3IS9A 5KFLA 4PQUB 4M3WA 3ISND 5DLGA 4RZRA 4FJJA 4F2RA 5EWGA 1TKTA 3KLGA 4KKOA 3K5LA 3SUNA 3OLBA 3MFIA 5KFFA 4I9LA 3DLKB 2UVWA 4PQUA 4MQ3A 2FLNA 4ZP9A 2FBYA 3G6YA 4OGEA 2ATQA 2YKMA 4B9NA 3MEGA 4HCCA 3LP2B 4WFXA 3DLGA 4BDZA 5KG5A 2VG5A 4OKKA 2E4LA 4DMNA 4ED0A 1HQEB 4ZHRA 5EDWA 3QLHA 4LH4A 2KZMA 2GIRA 1DLOB 3H5SA 1W9HA 1NKBA 4KRFA 2NUBA 4FJKA 3OYGA 3D5MA 4K50A 3GV7B 1HQEA 4MIAA 1LV5A 1DLOA 1WSHA 2FBVA 4E0DA 5F8NA 2FVCA 3OYAA 4FJLA 2ASDA 4DQSA 4CIFA 3T5HA 4B8AB 3MFHA 3I5CA 1YTAA 3GV8B 5J2QB 3OYLA 3HVTB 1K1SA 4FLXA 5L1JA 3NFAA 4BE0A 1RYSA 2G8UA 3K58A 4ZP6A 2YKNB 4KV8B 4R0EA 4DL2A 3HVTA 2I5JB 4ECTA 2G8VA 5DK5A 4M95A 2IJNA 5C42B 1BQMB 3OVNA 3BSOA 4K4SA 3KOAA 2BANB 4KV8A 1WSGA 1RDRA 1N48A 1S6PA 3UIQA 3ZSWA 3CVKA 1RT6B 3QNOA 2I5JA 3PZPA 3G6XA 1ASWA 1RDBA 5C42A 1HRHA 4IBNA 4CK3A 1NK4A 2BQUA 2OPPB 2B4JA 2XC9A 3ICLA 1NHUA 1SKRA 4AHRA 2AX1A 2I1RA 4BE2A 1ZBUA 4DU1A 4E7IA 3PR4A 4OJRA 3OL8A 4CEBA 3VQEA 3SJJA 4ICLA 1RCHA 1LWCB 1RA7A 3SUQA 1JLEB 2OPPA 2JLEA 1JXLA 5DQHA 1CZ9A 4WE1A 1WSFA 4TSXA 3F73A 4KFBB 4ZMMA 4O55A 3H40A 3KMSA 3OSNA 5L1LA 1LWFB 1BCMA 3U3GA 3KKRA 3SI6A 1Q9YA 2XCPA 4YR0A 3VQQA 3KHLA 4F3OA 3O3HA 1JLEA 2ASJA 4DTRA 2IDOA 4RW4B 1HQUB 4E1MA 2R2UA 4CJRA 4DQQA 4EBDA 1LWFA 3Q8PB 2V4RA 4WXOA 3SV4A 3HL8A 3OS1A 4FVMA 4CJUA 3L3VA 4ELTA 2FVSA 2JC0A 2IM0A 3SCXA 4RW4A 1HQUA 4WXWA 4CK1A 1QSYA 2QE5A 3LDSA 1U04A
chains in the Genus database with same CATH superfamily
4DS4A 1KWMA 1WHWA 2PE8A 3AVGA 1F3FA 3N0VA 3MEEA 1HHQA 1WOSA 2OEJA 2CQDA 5AZJB 3RWUA 4F0MA 4ZN3A 3D6TB 3KK1A 2G8WA 3QBWA 2GV9A 4DV1K 4B9SA 1AB8A 3HYFA 1NB7A 1WKLA 1KP6A 4X64J 1UA0A 1N5YB 3BJYA 1I5OB 1PJ7A 1N33J 4E7LA 3WXLA 4HT5A 5HVGA 2HLUA 2JFDA 3BBBA 4MO4A 4OPHA 1CXQA 4FJ8A 2UXCK 4B1WB 2KYXA 2HFUA 1X4CA 3G4SN 2G2ZA 3ZTPA 3QRQA 4L75A 4CEZA 4F04B 4P73A 1FWLA 2RQCA 2DYAA 1I94F 2K2PA 2VPZB 1S59A 4A8FA 1NSAA 4HT7A 2XWXA 4JI0J 3K5MA 4ZP8A 3QICA 5AQFA 1HD0A 1NJIO 3D6HB 4BR2A 2XZWA 3T3FA 3O80A 4WWSA 4HHHA 3VA3A 2A40A 1SQGA 2VFRA 3HVAA 3C2PA 4AM7A 1YTYA 4BRFA 5AFUH 4LF5J 4CLYA 3KLHB 3LW5C 4IOAL 4JI5J 2ZDPA 4CO5A 3M1VA 2ZBRA 5IS2A 2Q0UA 3BZQA 4M63A 4RNNA 1T7PA 1B64A 1QAIA 4EK2A 3UDEA 3ZZZA 3R8YA 4C3KA 5FDLA 1BWEA 3I0RA 3VEYA 1BGXT 3IM8A 2GTDA 1N54B 3O08A 6AT1B 3J8AA 3UCUP 3LALA 4X4SA 1H7WA 2X1FA 4C0HA 1RAGB 1U2RA 1X9JA 1XNQK 4U8VA 2DT9A 2HAFA 4GKKJ 2FJWA 2YPYA 1NKEA 3FFIB 4LRCA 1B3TA 4DR7J 4CH7A 4ZVTB 4MDBA 4DTMA 3U8XA 1CEZA 3MXJA 3TWHA 2AMCB 4KHYA 1RSCA 3AFGA 4GKJK 3ENOA 3SBGA 1TK5A 1HWJA 2IAJB 1TL5A 3BZKA 1VISA 4JI7J 4JEPA 3GB0A 3J80U 3QNNA 2M0GB 3IAYA 3T5LA 1JXBA 1SQKA 2QL9B 2A3ZA 3TZZA 3O9TA 3ENAA 4CI6A 2R7XA 1U2FA 3WEEA 1LXNA 1IR1A 2VQFF 4B3TJ 1IH7A 4I56A 1NJYA 4XPEA 4M5GA 1TYQA 1YITN 4B02A 5JUMA 2ZH9A 2DPJA 2GQQA 4PL7A 1RBUA 4F9OA 1G2EA 3NS7B 4X65J 5GADP 3QBXA 2F96A 3H0PA 1TL3A 1KLMA 1D0EA 3CM5A 3DWLA 1GOCA 3EE8A 4EGLA 1S1VA 1UW9A 4KH1B 4U7UK 3DRRA 4CHNA 3R5BA 1CJVB 2DGTA 3CMAN 1TZ0A 1K8KB 2FHJA 2GIQA 2XY8A 4YEAA 4LRDA 5CYMB 4ZVQB 2AJ0A 1W2BR 3DMJB 4C3MA 4D3GA 1BDGA 2A5XA 4DU7A 2NXUA 1APSA 1E3MA 1W26A 4NPOA 4CO1A 1EKRA 1YWXA 3Q22A 4JV5J 4UTGA 3DOKB 4TQSA 1C0TA 4PXCA 4B9UA 2Q79A 3DM2A 4NYZA 5F2RA 4IG3A 3KK2B 5DG8A 4V19S 1YHQN 2JGUA 2XMWA 5LJWA 3VVUA 8AT1B 2QZ8A 2J8AA 2MY7A 2DNPA 2R8KA 1VQ5S 1JJCB 4OX6A 2ZHOA 1X0FA 1RISA 4LH5A 4DG1A 1P90A 2BW2A 2J9DA 3FEYB 3MM7B 2AP1A 4PKGA 2A2DA 2U2FA 2GVDB 2J9EA 1VJQA 3L2VA 4RR5A 3B6PA 3GR0A 4QW9A 3GG4A 1LXJA 3DLBA 1HWUA 1OMSA 4M45A 5MLCV 1PJ6A 1M0SA 2BJ3A 3FCVA 3I55S 1NNEA 1RT3B 4JKFA 1FRMA 2IPOB 3ZTSA 3QT6A 4KHPF 2ATLA 3OXFA 1ZBIA 1L3TA 4IJNA 2DRBA 2FB0A 1ZXOA 4DV2K 5K8NA 2W2QP 4CJEA 3OYHA 2PEBA 5C7PA 4NA1A 2J7UA 2JNJA 2V4JA 1Q4RA 2C2MB 2NNWA 3WC0A 1C4AA 2QA4G 1I94J 3QGGA 1NHKL 4IG0A 1Y5IB 1B0PA 2Y8YA 4M3TA 1YQHA 2E9RX 4X4TA 4BROA 2ILZA 5T41A 4B17A 3CPWR 5H9FK 4FWRA 4PKHA 3HRGA 5F1XA 2RE2A 3P3DA 4QJVA 1U6FA 3CCES 2IBOA 3HHDA 3PFOA 5JS1A 1P8ZA 3GQCA 4RUHA 3NAHA 3THYA 2JFKA 1NPPA 3FSXA 3N79A 4P7VA 3OYBA 3HD1A 1ZAXA 4OI4A 2RU9A 4BR5A 1WF2A 5D78A 5FD1A 3CJ7A 1FD2A 2ZFHA 4A46A 3UD4P 3TUIC 1SL2A 3OYJA 1RTHA 3BREA 3SYZA 5IZHA 1N5SA 1U49A 3VAFA 1VBKA 3IWXA 1JLCB 4CP5A 1N8RO 1NGAA 4AL7A 2F8EX 1S6UA 2BABA 2SXLA 2DNOA 4IUFA 2DXDA 5KFYA 3AVFA 2Y1JA 3ULDA 2LEAA 3EE9A 3TX8A 2LKZA 1WB9A 1BI4A 1Q1KA 2V8PA 4MIBA 3NH1A 4FPBA 3KLVA 1OH5A 1N5VA 1BHLA 1WEXA 1X4GA 2P9LA 1M90T 1K8AO 4OX9K 3K5OA 4L3QA 1S6PB 2VICA 2R7SA 1KQKA 5B0EA 1D9DA 3RJMB 4AL5A 4PHTX 1JLQA 3POTA 3V2UC 3QGIA 1Y7PA 3JB9k 2FY1A 5D4OA 4KPYA 2AJ4A 3OXGA 3MUMP 3RTVA 3G6EN 2HWIA 3TZYA 4I6MB 4CZHA 1NGCA 2IVOA 3VGUA 4K59A 2XMJA 2B5JB 1F9FA 1LWXA 3FNNA 1XI1A 4BACA 3WXMB 4HI2A 3FBCA 1NJXA 3QPIA 1RJJA 3L6QA 3O9QA 3HKZD 1SKSA 4JI6K 1BOTO 5A0YB 3G0ZA 4DQIA 5J1EA 2GBZA 2I6WA 3D4JA 1OH8A 3HJFA 1MNEA 5CYJA 1AFIA 4MJKA 5LJ3Y 1WKKA 2H5JB 1N52B 3FUYA 2UXDJ 3OTCA 3A8IA 3THWA 1URNA 3AJDA 3CERA 2ZBQA 2QWMA 4H0VB 1RT2A 1TL7A 2DFFA 2IDLA 3C95A 2XCAA 4WQ4A 3UR3C 3MEEB 2OGUA 2F4FA 5E26A 1GMWD 4OI6A 5ETQA 2BRLA 2E1RA 1NZ8A 3FZBA 1TKZA 2HYIB 4FJXA 4QR2A 3DNCA 4ANDA 1IBKF 3NS5A 2WRMA 4DS5A 1IV0A 3EZWA 2CJQA 4U9RA 1FX4A 4Z2XA 1U48A 1R8AA 3O3FA 3OJUA 4F4ZA 1HJOA 4BRGA 4NLTA 3VQ8A 1F2HA 3QT7A 2MJNA 4PRFA 2UVRA 2EWSA 3DLEA 3VQPA 4ZPVR 2WSCC 2I2YA 3OUYA 3VTHA 3W2VA 1HPZA 4RKUC 4JV5K 4UQGA 2FSKA 3TUJC 2YNIA 4C1NK 2D5RA 4O4GB 3KVGA 3J81O 3WNGA 4EBCA 2DITA 3HHLD 3W5YA 3N4QA 2BM0A 4YDUA 3SAHA 3J81Y 1HYSA 1PYTA 2PT0A 5B0CA 3HHLC 3HLUA 3AGRA 1TUGB 2D69A 5KPZA 3HI9A 1BA1A 4BQZA 3K5PA 5H9EJ 4H5TA 2F9DA 4NYNA 2CPXA 4F4XA 1Q9XA 4CJLA 2UYTA 5T7LB 1J27A 4DPWA 1G7CB 3TWZA 4W92B 2KN4A 1TELA 4JKBA 2A1RA 3AT1B 3WIVA 1IKWA 2CQCA 2ZJPL 3O5TB 1MN9A 2M70A 2MZSA 5AXLA 2CG8A 4ECZA 4JV1A 2WCXA 4FXDA 5LMUJ 1R0AB 1R0CB 2V34A 2IC3B 5FDLB 4RW7A 3I0RB 4FJIA 1J54A 3HSCA 2UV8A 1HKCA 2GAHC 1OY6A 3DLLL 2QKBA 3C6UB 2XMUA 4BY9C 3A8JA 2CQ4A 1WLJA 4A5AA 1I94K 2UXBJ 5CABA 4FNHA 4A2AA 3MR2A 4U96A 3FSIA 2QTDA 5GAGI 5I4MA 5AR0A 1TUVA 3HCXA 3CQXA 1HR0F 4OPKA 3HOTA 1S97A 3F2KA 2RUGA 2CPYA 2VUGA 3DCAA 3RBZA 1ACMB 3IA0A 2PBDA 2RDJA 3OYDA 2GEMA 4RCHA 2ZE2B 3QIDA 1U6BA 3CIZA 2ZBCA 1REGX 3TAGA 2HAIA 2BQRA 2OPRB 1K47A 1X3MA 2E1CA 1U8WA 4DR4J 1FKPB 3P8BB 3R2CJ 1JLFA 2UUWA 1X31C 4LBHA 3A5LC 4CIOA 5AQJA 3A3PB 4ECUA 3FMWA 4FWMA 4OVLA 1WWHA 3LDNA 1AZSA 3TOQA 4WKYA 2GGPA 4LSNB 3F5TA 4IKFA 1VCTA 4URGA 4OX8A 3HO1A 2F7VA 2OPSA 2CXEA 3JQMA 4FPAA 1XK8A 2NRRA 4G65A 4PWUA 2GO8A 4NOHA 5AE2A 1U4BA 5CH7B 5KG7A 1NGEA 1K73T 2HS3A 3MM5A 2WVDA 4DU4A 3O5BA 2R2RA 5FPNA 1W7AA 5CZ2A 4GRSA 4X4VA 3EUNA 3SAGA 3U27A 2ZH4A 3CYMA 2XYHB 4QWAA 4ZCIA 4K7QA 1IM4A 1DQAA 2VQFK 3H5XA 4FPRA 1C0TB 3HZEA 4DV4J 3E9OA 2W24A 4JB8B 4M7XA 2GAGC 3ENWA 3DM2B 2X3GA 3PRBA 5AQMA 1JMTA 5KPRA 2VJVA 3IM9A 4DR3F 3V1OA 1GLLO 1N6QA 3EICA 5KFAA 1UW4A 1RHQB 3L7UA 4DX7A 1PAUB 3C15A 4ZIVA 5CZXA 4JI4F 4F3QA 1IBKJ 2RJZA 1Q95G 1EX4A 4WTYA 5IV4A 1FEHA 2VJUA 3QSYB 4J9PA 5D0RA 4YMEA 2O8FB 1RT4B 2CZ4A 3CC2N 4W5RA 2UV8G 3J7AP 4WU2A 3NF7A 2V4JB 3PHEA 2CA9A 7FD1A 3BO4A 3US5A 4O5FA 5KI6A 2L3MA 3KHGA 1VQKS 2ZZMA 5I42A 3BH6B 1JXVA 4IG0B 5B7WA 2QGFB 2XSJB 1H3DA 2G4BA 2EFOA 2PFFB 1KVAA 1RBAA 4I9QA 1QQCA 3UE2A 5LJVA 1UWAA 2AGQA 5AQTA 5FPDA 3P96A 4CLKA 2HWHA 4QR0A 3OPKA 3GLJA 2V9WA 3MZIA 1JWWA 3R8EA 4A5BA 4BR7A 2E2NA 4NLQA 3PW7A 2RKIA 4K43A 4EUVA 2F1FA 4KHPK 3L2UA 2BGGA 3OW2R 2HRTA 3N6LA 3ULEB 4CGIA 3GIJA 5C12A 2Z1GA 4JS5A 5K20B 2LXIA 3TANA 1SQFA 3H8YA 3ZSRA 4NLYA 1ITPA 1QVFM 3MUTP 2O8BA 3ENHA 1RI7A 5A6WA 3FZMA 5GADI 5H9EK 2DXFA 4JYAJ 3VESA 3LP3A 1TL4A 1SI9A 3NGTA 5AXNA 1VSFA 3S8SA 1CJUA 1HR0J 2YKQA 3JQKA 1YJWS 5LL6Z 2RRAA 2MHEA 3B6OA 3R1HA 4I64A 3BSAA 3JYTA 2FBTA 4UY8T 2ZJRL 3EJMA 4FYDA 1BI4B 1YJNS 1MWYA 1IBCB 5LMUK 3IAM9 3A5MC 3CFOA 2HBQB 3DLKA 3CC4N 1PC5A 3NKYA 2YCHA 3D7EO 3NP5A 2VCPA 1ZC6A 2P9LB 4Q5VA 3AD8C 1WD6A 3J80O 1UEKA 1IWGA 4JKCA 1V6HA 2X51A 1JLQB 3J80Y 2LEPA 1FJEB 2GJFA 3M9OB 3SBMA 4C3LA 2QEXN 2E5LF 4PPDA 3F9MA 4GY2B 2N3LA 3PXGa 2YWHA 5IT0A 2BYCA 1RT1A 2RNEA 3NCRA 2NUHA 2Y1IA 5F8IA 2OYQA 4ZVPB 4O3NA 3BEXA 3CXCM 1KDNA 5DG9A 3OFHA 4J8FA 4O0NA 5E3AA 2C2OB 3LAKA 3J7Z5 5LMNJ 4O8KA 1H1VA 4LF1A 3DHXA 3HHLB 2GJ2A 4UF4A 2OJ3A 2K3KA 4J9KA 2QFJA 5J1EB 1D09B 1NDKA 3NOGA 4F4AA 4LRBA 5ADZA 3T5KA 3QEVA 5HRRA 4GNIA 1VRTA 1C0GA 4DSKA 1CXUA 4DQ8A 1IKXA 3K2YA 1QLNA 1F2GA 2PFUA 2YHAA 4DUYF 2EG2A 5DM6Q 3HHNB 2F8MA 2BANA 2UU9F 4CVNE 1C1AA 1TL7B 2GMHA 4CLLA 3RRGA 1G15A 3EN9A 2UUAJ 3BSCA 2BW7A 5BRFA 4ECRA 4LQ9A 2KFZA 4M3ZA 1NB2A 1VSEA 4M8LA 3JTNA 3QB0A 2CDQA 4CJ4A 1NAQA 2C2EA 2VDHA 4ZIWA 3W9JA 2E8AA 5IOLA 1I1GA 2CWXA 3RMDA 4JI4J 2VBWA 3H1VX 3VGSA 3TARA 3VAMA 3CJ2A 4JNEA 1NDLA 3VVTA 3VZIA 3OUYB 3W2VB 1HPZB 1VQMS 2A6MA 1V3ZA 2OSQA 3ISZA 4MKYA 1KLNA 3CD6S 1FE4A 2YNIB 3BO2A 2OLWA 3M32B 1JKHB 3K7RA 1ULRA 1X5SA 4DV3F 1WOOA 1HYSB 2ACMA 2YX6A 5JVHQ 3G96A 2FQQB 1HWLA 3M6GA 1C6VA 3AVLA 2WONA 2YNHA 4CEDA 4EAHD 4J2DA 4IJAA 2LMIA 1HKGA 1KVBA 2FHKA 1S7IA 3BYRA 5E0OA 5AQLA 1YT3A 2LCWA 1RKIA 3IRXB 3NOCA 4TY8A 4JI8F 1IBKK 1RU2A 2P5VA 2NZTA 1P9YA 2XTJP 3CJ9A 3P45B 2DRDA 1SH0A 3J7A1 3MR6A 2I38A 1YVUA 4J9LA 2JEIA 1YJTA 3DHWC 4O3QA 5JLFA 2FBXA 4AL6A 3WX8A 3HT3A 3GOIA 5DDPC 2V8HA 3MK6A 3M8SA 2KLAA 3T7ZA 4CD1A 4ZOSA 4ED8A 2M8HA 2UVVA 3VGKA 2G2OA 3Q24A 1OSDA 3PIPQ 4OYBA 4TYBA 3K9KA 4MK8A 4J9OA 3KLEA 1UPPA 2KU7A 2NZCA 2OKQA 4PKDB 1IWAA 2NYHA 3O6QA 3GCXP 4CO3A 4X2BA 1S79A 3W64A 2Z8QA 1L5UA 1OVQA 3T1HJ 3DOLA 1WSVA 2D0CA 4BHQA 4ZP7A 1B0TA 1EP4A 2KXNB 4R79A 3VZHA 2DHXA 2KI2A 1MW7A 3G6VA 2JWKA 2CQ3A 3EPGA 4JKEA 1VQLS 2J4RA 2VYPA 3DLJA 2LQ9A 1RAOA 1J5OB 3CD7A 2OD6A 5LJ5Y 1RDUA 2BX6A 1B9FA 5ETVA 4TLQA 4J2BA 4BC2A 1AZSB 4RW8A 4I69A 3F44A 5C5JA 3OYFA 1GMUA 3EGZA 2GGPB 2XGQA 5BN8A 2CPEA 1DY3A 4BRAA 4G1PA 2XRIA 3FKBA 2OPSB 1RT7B 3SCIE 4CFBA 1TKXA 5BJRA 1EIYB 1HR0K 4EO6A 2CH5A 2OELA 2E5GA 2E5LJ 1R8CA 5EGYA 3MM5B 4BRLA 1U1KA 1U47A 1QD1A 4Q7AA 4FJNA 4X66J 1KRPA 3CDBA 3BZCA 2P9KB 3JTPA 3L8BA 4QIGA 4LF7J 2CQ2A 4AH9A 1HBUB 3LP1A 2AJFE 3MPUB 3CMQA 4DR5F 3FVYA 1TVRA 4YB1P 2HQDA 3QIPA 3TA0A 4I68A 4FWQA 5KT3A 5GMEA 2ZBIA 3D28A 4OHYA 1QY7A 3JSBA 4QS8A 2EW9A 1R59O 1NGHA 3CCWA 3GONA 2K3IA 4CBXA 4RX6A 1RHJB 3TW0A 3PJXA 2YV0X 3QBCA 5E33A 3CCUN 2XHCA 3MCOA 4ZPCA 1YRXA 3FQKA 1N6QB 3OYEA 2QA2A 4H0YB 3S41A 2Q1NA 5IQ6A 5AQNA 1ZTWA 4Y2IA 1FTCA 3CCRS 4FF3A 4HUFA 4BLGA 3UW1A 2VWBA 2JHEA 2DIVA 1LW0A 3MECA 1VQ9N 4Y2AA 4KE5A 3PYGA 4HTJA 1FWKA 2YX4A 2D3UA 4M41A 2XO7A 4CZGA 2F3JA 2XNQA 4QS9A 4WPAA 3LTOA 3DJCA 1HYZA 2VG6A 5A8RB 5KFVA 1FF2A 5EX3A 2PMHA 5DZ6A 2CQPA 4HH1A 4H03B 4CLPA 2XZDB 2CZVC 1FKOA 1HNVB 4O0IA 1RT5B 4LQ3A 3C66A 1E4FT 5ADXH 4OKJA 3LPTA 2O01C 2Q97A 1R8PA 4LFAF 5I42B 4DR3K 3QZ8A 2Y0SD 3CCLS 1UKUA 3NAIA 3HSTB 5E84A 2RHKA 5IT9Y 3ULHA 2YH1A 3D2FA 3KWGA 5TKWA 1I39A 1LOTB 1U1NA 3JXUA 3ZX2A 3O1LA 1RWOB 4Z7CA 2OCEA 4JI4K 1M5SA 4JI8J 3VQ6A 2NRHA 4PCQA 1I6JA 2EG1A 4ZTJA 3VERA 3RW7A 3HTVA 2BOAA 1RTDB 3AY0A 5AQYA 3MEKA 3DC2A 2VU5A 2PSZA 3TAMA 3V5RA 2QLBB 1VAZA 4CF1A 3TAEA 3O8MA 1WAJA 4UW2A 1ITGA 3KUHA 2QMWA 3RBDA 3SDEA 2J0WA 4IR1A 4FM0A 4FXWA 2D3O1 3NVKA 5AJ3F 2X78A 2LDYA 3MAQA 3IDHA 4JD2A 4JKAA 1JL1A 3IS9B 4OQJA 4KH0B 3MMBA 1REVA 4G1IA 2P9PA 3ZSXA 3ZT2A 2HK3A 1CJUB 4B1UB 2M8DB 3D67A 1YX2A 1QZ5A 3VENA 4FJJA 1PIEA 3MM9A 1TFYA 3MCMA 1VQON 1F6TA 2DCUB 1W2BM 3GCWP 3DLKB 4WFBQ 5I3QA 2K06A 3R5AA 2E88A 5I9EB 4OGEA 2YKMA 1Q78A 4BC5A 1ATRA 2Z2ZA 2BV3A 2YQ3A 1OQ6A 2MKCA 2YXLA 2E4LA 4A47A 4KGVB 3H5SA 2VBXA 4JI1F 4I6YA 4DN0A 2ROPA 3BGLA 5M1QA 1X5TA 1HW9A 2XSFA 1G3OA 1HQEA 3NY0A 1DLOA 1J5EJ 3OYAA 1ZM3A 4DQSA 4B8AB 3BP8A 4R25A 3GE9A 4ILHA 4N8OA 1YZ6A 1K1SA 4FLXA 1BLUA 1RWUA 1ESVA 5L1JA 4KGXB 2B56A 3NFAA 2H54B 4AQYJ 4R0EA 5BPNA 4DL2A 3VF0B 3MMVA 3IC1A 2XB2D 5DK5A 4A4JA 2IJNA 2IYIA 1FTRA 5C42B 3MPDA 2DNYA 3I82A 3I6PA 5ETRA 3OVNA 1TUWA 2BANB 3ZNUA 1WSGA 4M5MA 1RDRA 2B51A 3RSEA 3JTOA 3UIQA 2G0CA 3M30B 1KN6A 2WSFC 1HBOA 2I5JA 3HHEA 1RDBA 1U0SA 3W9IA 1IQZA 2R7WA 2BQUA 3SCLE 2E5LK 4JK7A 3GJTB 3UI3A 3CPWM 3HX9A 3VHQA 1H72C 3VQEA 4ICLA 4OZ3A 4X66K 1X4FA 3MM8B 3TUPA 4J9VA 3RRKA 2JLEA 3DDNA 1WSFA 2DGXA 3M2RA 2C1EB 4O55A 4LF7K 3KKRA 1J2VA 3KHLA 2JRSA 1HKBA 3VWSA 1P1TA 1VQ4S 4EBDA 3C7NA 1N34F 2Z2MA 4FVMA 1XMQJ 4ELTA 4DUYK 2UU9K 2BJEA 4RW4A 1YRTA 2V8VA 4KC5A 4DR6J 3SLCA 4BVOA 3FJ2A 4CBWA 4Y2CA 2HHHF 3G4SS 1GLDG 1MDUB 4IRCA 3BKFA 4NRUA 3HJVA 3KDNA 2DGVA 1VQ7S 3HBTA 2OHDA 2KVQE 1QSLA 1VQ8N 4AHSA 4IO9Q 1O6XA 4NA2A 2HGMA 3MN6A 4I2PB 3LGNA 3Q7CA 4ZPDA 3HPOA 3AQPA 3KJFB 2BZ2A 4PABA 3N01A 4NXNF 2P1JA 3HM8A 1HX1A 3B78A 3KDOA 3W5ZA 3CCJN 4H0XB 1NHVA 3VQDA 3O1WA 4H4OA 2ZVIA 4AXIA 1LKZA 5D0GA 1VSMA 4IFYA 5F9NA 2DR7A 2HBMA 4LF4F 2GQCA 4K0KJ 4DV3K 3TZXA 5F8GA 1X8DA 5IWAF 1JLGA 1KAYA 2R7OA 4HUGA 1OWXA 3H2UB 2VG7A 3U9DA 3CSKA 2FHOB 1VQPN 1P1LA 4X84A 5AJ3J 3N5FA 3V9XA 3KLEB 1WUAA 2J7KA 2VPXB 3HP6A 4HHTA 2CQHA 3LH2S 3M2UA 2KDOA 4Q2LA 4JI8K 3MAAA 3DOLB 2VF3A 1FFWB 2PIIA 2OI2A 2MKHA 3IGVA 3NWRA 3SFGA 3MD1A 2GCFA 1S7HA 3PR5B 2A6OA 5FIIA 3FZLA 2XI2A 4ED1A 4DQPA 3D3CJ 5AQWA 3GSIA 4CNYA 4DX6A 2EFNA 2HHUA 3AXKA 2AT1B 4C11A 4CRJA 4OYPA 5M1PA 2KB2A 4ZITA 1WHXA 5K8OA 3C65A 4DOZA 3U1LA 1N88A 3Q8VA 1NRKA 1TKDA 1IR2A 4ED2A 3O3LA 3M8PA 4ZCMA 1TKXB 3G8TA 1IKYA 5M1KA 1NGBA 3KJVA 3MN7A 3IO1A 4CHOA 1X1PA 1WHVA 2QYCA 2F8HA 1UWBA 2FJDB 1U2CA 1U45A 2EBEA 4GC7A 1S72N 4FWKA 2FGCA 4DV0F 5E3RA 5A2QY 4CLSA 4N47A 2HF3A 3SPYA 1S12A 5IM0B 4Z4CA 3KLIB 3CC7N 2DY4A 4LF6J 3SZ2A 3AODA 4CYUB 1FFGB 5ETPA 3JSMA 1DARA 4LIWA 4FZZA 1NOZA 4A8QA 1D1UA 1TVRB 3QIPB 3MR3A 4AM6A 3KJNB 3CMAS 4GO5X 2WUSA 3GBTA 3EZOA 4CD3A 4K4YA 4WZQA 1X4AA 4Z4FA 3DI6B 2ZDOA 2MTLA 5BR8J 4F25A 2OTJN 4KTZA 3TAFA 4RBUA 4I7FA 1IM6A 3CM6A 1OVYA 2V7ZA 3BY5A 1R8HA 3QETA 4BR9A 4F4YA 2W6LA 3UDCA 4N56A 4ES1A 5D15A 4H8KA 1BL3A 4EIAA 1YHQS 4FJ5A 1YBAA 1EETA 4WCEQ 2ZH1A 2ZJQL 5KFQA 3TVKA 5KFSA 2DTUA 1LNQA 2A3JA 2ASYA 4DPUA 4YR3A 3AOBA 1X60A 3KXDA 2VG6B 4DR5K 1VQ6N 3AVIA 4P74A 4YS2A 3D1QA 4H0OA 4OJGA 3CJ4A 3ASMA 1VLYA 3UNGC 1Q5VA 3DXMA 4PXDA 1FKOB 3UFCX 4DEZA 1DFDA 4FYWB 2V50A 1EKSA 4MMOA 4OMFG 3NGDA 2QTWA 4DCPB 1Y5NB 4C2MA 3IFRA 4GW6A 9ATCB 2J0QD 1NZAA 2HMIA 3UQSA 3PACA 2V94A 4EP5A 1B0VA 1ZYQA 3BF3A 4WP8A 2YKAA 1Y0HA 1NK7A 1FK9B 1F3VA 3MI7X 3B82A 2KH9A 4WFAQ 4DPOA 1TGOA 1CZAN 2IA0A 1BY9A 4X62F 2ILYA 1O8BA 1NLVA 4OZ0A 1M1KT 3UN2A 2XY5A 2EFGA 1CPZA 1CC7A 3IBWA 5CYQB 4B3OA 5IC4B 1RHRB 2FLOA 2ZC4A 1JNZB 3SDEB 2QW9A 2W2OP 3MXIA 3A8EA 2DIUA 1RHKB 1LQ9A 4R8UA 1D8YA 2ZWHA 4C8MA 4NI2A 2MZQA 5JS2A 5IWAJ 1QHTA 2VBYA 1S77D 3MMBB 3UVJB 5JICA 2AWZA 5FROA 3O8WA 4I2QA 5LT5A 1HBMA 3MR5A 2GQ2A 3S3MA 1U09A 3MWPA 3OBIA 2J76E 2JEFA 1HNWF 3NCQA 4JKHA 3ET6A 4PG8A 4QIWD 4WZMA 1CS4A 2OH2A 2IY5B 3BGRA 4HR2A 3V4IA 2RE1A 2IMWP 2GO9A 2YKMB 4BRNA 3W2WB 2AHOB 1HI0P 4CM0A 4M5NA 4HDHA 3CW2C 2CUYA 3O4NA 4NLCA 2RMLA 3FMBA 5C10A 1VSJA 2EX3A 1ZZNA 2K1RA 4O4RA 5AJ3K 2RDDA 2X1GA 1WELA 4DF8A 1Q82O 3L0QA 2CJYB 5E3QA 2KT3A 1U1PA 1S5ZA 1UVKA 1JNRB 1YZ7A 4BS2A 4LFBF 5LY3A 1GLAG 1ZPWX 1Y00A 3KHHA 4DV6F 4B3MF 1S6QB 1U1LA 4KO0B 3G6ES 4FBTA 4B3RF 3W62A 4CLTA 2YKOA 3OYNA 4EO8A 1JLAB 2PA8D 2WVEA 4CJPA 3KWMA 1WBBA 2FGOA 3VOVA 2OO4A 4J90A 2FLPA 3G71N 1Q82T 1X9MA 3F41A 1S9EA 4OV6A 4H4KA 1AFJA 4B3SJ 3SQ1A 2D9PA 2GS8A 3QFWA 3C94A 5I3PA 1RTIB 4JI1K 2YWFA 1QSSA 1R27B 3WNHA 2C2ZB 3D3BJ 3KK3A 2BKPA 1Z25A 3A4TA 4ICLB 5A8KB 2Z56B 4OIXA 2H4YB 2UUCF 4AT1B 2M4MA 4AE5A 4QU6A 2IM2A 4PYAA 4HACA 3A1YG 2B6AA 5AZIB 1B70B 3GSDA 4MFBB 4CECA 3OW2M 1A0OB 2P9IB 3MPVA 2YHWA 1WG4A 4DFMA 1YBTA 3CF5L 3C7NB 1UMJA 2VKZG 4E1JA 2WW4A 3P5JA 3H42A 4ZVOB 1WI6A 4F0KA 4FZYA 4CWBA 5BR8K 2RS2A 4HVZA 1CLQA 3DAWA 2CNKB 1UTAA 2MMYA 2QX0A 2JL9A 5U47A 1J9AA 3PIOQ 2VQEJ 4PUOB 2L41A 2IRXA 4CEQA 3ZSVA 4XH1A 4USIA 5ITHA 2DD8S 3ENQA 5KFJA 5KRSA 2V6AA 3C16B 3Q8QB 1HUXA 2I7PA 1NSQA 2UP1A 3N4WA 4USVA 2QWNA 3U1NA 1IKVA 2CIMA 3EGVA 4HWIA 4DL0C 4IQXA 3FLCO 1VI7A 2PMWA 2NPFA 4ILRA 4FOEA 2QMXA 4X62J 4KHNA 2QWLA 4A8YA 2V67A 2FSJA 4RBTA 4BRDA 3D0PA 3OS0A 5KGXA 2M52A 1W7WA 5F41A 4QIFA 4GV9A 1RHUB 5M1FA 1LEOA 4BRIA 4BE1A 2HHHK 1F9EB 1Q18A 4OZ5A 1KTVA 4FNIA 2DR8A 1NPKA 3AA4A 3HM9A 4UT4A 4KAIA 3NNAA 2WSEC 3FZKA 3AJ2A 2AEJA 3MAAB 3JSYA 2D41A 1IR0A 2WK4A 2BQ3A 1NMNA 3GJSB 4A8XA 3MXHP 2ITGA 1NKCA 2DNGA 2J7WA 2ZOFA 3MEDB 5HK4A 3KD1E 4NA3A 2EPIA 3OTOF 1AW0A 3HSDA 2LFVA 5F8JA 1GXUA 2VD3A 1GFWB 2RSQA 3SFUA 2O8DA 3OD2A 2DNHA 5HJYA 3D2WA 3A12A 1TUUA 4LY7A 4J9QA 2MKIA 3L95X 4LF4K 2IVFB 2V63A 4OYWA 2QXFA 4ZPTR 5IWAK 2HLTA 3VAJA 1SL1A 3TSUA 2CVEA 3M8PB 1KQFB 2MYFA 1IKYB 3KLFA 3KJVB 2QLJB 3DXSX 4X4PA 4IDHA 4BC4A 5F8LA 1UWBB 4NLVA 5HRPA 2HNZB 3TA2A 4TXSA 4DV6J 4B3MJ 3G82B 2KW4A 1UEUA 1XR6A 2G2YA 1E6YA 2HRUA 2IJFA 3ITHB 3AO1A 3PHTA 2HURA 3MMAB 2HGLA 2V4QA 4ERDA 2IVPA 5HROA 1KSPA 2HNDB 2XO6A 2CPFA 4DCHA 1MA9B 5DLFA 4UY85 2ZZNA 4RO0A 3KKFA 4WQ5A 4AYBD 3ZZTA 1KC8O 4P7TA 2FVRA 5H1SV 4CJSA 3GILA 4Z4IA 4B9QA 2IYGA 3IXQA 4I7FB 2NXJA 4Y3CA 1FRKA 1NJWA 3CNQP 1WDDA 2MZRA 1XR7A 2Q1LA 4F02A 3ZZUA 4FZXC 4DPTA 1LW2B 2MPUA 2KG0A 1XBWA 4JBCA 1KQGB 5KT4A 1VK8A 3NCIA 5KAKA 4I0WA 1H7XA 3V1RA 2UUCJ 4TKTA 2KJVA 1IG9A 4DV0K 4CEFA 3VPZA 1ZM9A 4N5SA 1GLEG 1XJWB 3TA1A 3BYPA 3SQGB 1CJTA 3WIUA 4HDGA 2N7CA 1QVGR 1FDNA 4ZS6A 3I56S 2M3DA 4MH8A 2DJWA 3TABA 3DXMB 3M9NB 3K9JA 1VC5A 2N4CA 2UUBJ 2FF6A 2XY7A 3NBPA 1RBOB 3M05A 1KOHA 4X4RA 4M42A 3CC2S 3GFHA 1KVKA 4RW9A 1RDCA 4HHUA 3R7SB 2XLKA 3IWLA 4DL3A 4EBEA 4KH4A 2MQOA 4O44A 2EFQA 4DV1J 2NXEA 1IG8A 3OBWA 4RWWA 2HVDA 5KFHA 1MROB 3MPWA 1SXLA 3OYIA 2ASMA 4CEAA 5BYQA 4IWVA 4JI2F 4WJBA 1ZA2B 2YJFA 4P2SA 4USHA 3PDNA 3T6JA 5J1NA 4DWIA 1T0TV 4PY5A 3CCTA 3DGPB 2W40A 2K7JA 1ZETA 3EKSA 2MXYA 3ZTOA 5C24A 4RUAA 1TK8A 3H2LA 4J9RA 3TUZC 3QO9A 1U25A 5D0HA 4IOBA 1HYVA 2DY9A 3E01A 3O4QA 2XEXA 4IOCL 2ZM6F 4CJ5A 2JVRA 1GLFO 5KG6A 3ZSYA 4DR2F 2AYMA 5CCMA 4IH5A 4PPZA 1Z1ZA 4JOUA 4NWBA 2CQ0A 3R7NB 2DHSA 3THXA 4CZJA 5C2FA 3LPYA 3RMAA 1VRUA 3QQCD 3CT9A 3EYZA 3EGNA 1LAWA 5J2MB 4RLEA 3NMUA 2XMTA 1XHXA 1OS5A 3BF1A 1KAZA 1DT9A 3OQ2A 4X62K 4DN9A 2O5DA 4I6AA 1CS4B 2HIYA 3OTEA 3IBCB 3JQJA 4O5BA 2W9CB 4MO5A 4PXBA 3B6BA 4IOAQ 2VGNA 1L3VA 4ELVA 3RYLA 4H5RA 4NMXA 3CC4S 2QLXA 3MPYA 4PG4A 2QFIA 2ADBA 1XNQJ 1YAGA 1BIZA 1C1BB 1SS6A 3NMRA 5I3UA 3DU5A 5AE1A 3L09A 2E2QA 3PEHA 1ZBSA 2G9OA 2NREA 1EQ0A 1YIJN 2CPZA 4GKJJ 4PG5A 1XERA 4FM1A 2QEXS 2E7VA 1Q16B 5DQIA 1HNWK 4BWMA 4FJ7A 2D4WA 4N7TA 3CCEN 2AV5A 3NE6A 3LGHA 9RUBA 1EX8A 5MAOA 3AVBA 2R2TA 5AE3A 2B8PA 4G6VB 3QJLA 1K0VA 4BRPA 3AD7C 2ZOMA 2LDIA 3PX0A 4U67L 5ETKA 2HNYB 1RTJB 1S9EB 3AAQA 4K25A 3T69A 3VQ5A 1AUSL 1NK8A 4YOWA 3O9SA 2ACYA 3BV8A 1C0UA 2CQIA 2CZ9A 5E5NA 2N82B 4RW6A 2QSFA 3TZWA 1OSCA 4XIUA 5L8RC 2BMBA 4JUZA 5EWFA 2MLXA 4YR2A 4ID1A 5F0WA 2YHXA 4LFBK 4DV6K 4B3MK 4F36A 2E9ZA 2KTQA 4R5PB 4HACB 4A57A 1RWKB 2ZEJA 3TVYA 3ENVA 4B3RK 2QLFB 5HRNA 3OBYA 4DTJA 5B0DA 1WJ9A 2KKZA 3EXYA 2ZNZA 1Q7YT 4IEEA 4IDKA 2JC1A 4C7QA 3T19A 2G0IA 3MMCA 3LWLA 4FJGA 1K6YA 3TI0A 4RTFD 1BO5O 4C0OC 3RR7A 4BWJA 2DNKA 4TVAB 3AA2A 3DDKA 4CM2A 2HSEB 4PAAA 4BBYA 1Z6RA 1WC5A 1OJ4A 3KHYA 4LSZB 4NZ0A 2R3VA 3NS6A 2V5HG 4YDDB 1RZMA 1UVJA 1D9FA 2UUCK 4CZCA 3NEKA 5J2NB 3N28A 2R7UA 2QYGA 1LWCA 3U02A 3EZUA 1IKVB 2OMOA 2DVIA 4IZ9A 4GVBA 4MYUA 4JI2J 2DR6A 3UB5A 3OHAA 1OPIA 2DHAA 2MEWA 1B92A 3C19A 3N5BA 4DV2J 1T6CA 5HMXA 4DSJA 2HGNA 1VK0A 1DZ5A 2MY8A 2B4OA 2MLYA 1DGKN 2NR0A 1WDTA 2P9NA 3WNFA 2P51A 2HHVA 1OY9A 4LMZA 3AGKA 2XYGB 2PDAA 4DTXA 3MCPA 4LC9B 3H45C 4Z4HA 1FJCA 2LU1A 3ZZPA 4YB7A 3R9LA 2DPNA 5BPLA 5JMNA 3V9WA 4WFYA 1EQYA 5H9FJ 2O8EA 3U3YA 2HEKA 2ZNYA 5DDOC 3NGSA 2OTLN 4DUTA 2LVWA 3I5AA 5G4DA 1UVMA 2AF6A 1RU1A 4U8YA 1S9FA 1KD1O 4A2BA 2J6SA 2HBRB 3W61A 3GG0A 3E8OA 1FO1A 5KFGA 1WNEA 3MXMA 2B7CB 1NPRA 4ZJQA 1S1TB 1NM2A 4UZCA 3SQ4A 1WOPA 2RH3A 3H2VE 2IHR1 2NSCA 3EDRB 3QEPA 3GP9A 3IG1A 1NH8A 3AA5X 4EMDA 2E2OA 1S4FA 4C9DA 4LBIA 3OLAA 1T9XA 4RPFA 1FJGF 4JP8A 1X4HA 3IN5A 4OL8A 1SV5B 4MK9A 2P9SB 3MX2A 4BRHA 4P75A 4CTAA 4NZ7A 1HI1A 4JRQA 2MQPA 3W1YC 1F21A 3D0IE 4FKXA 1QHAA 1HNZJ 3GL1A 1VYAA 3FDSA 2E6MA 4UOHA 4GV3A 3SAFA 5HP1A 2W2NP 1FHTA 3NGUA 5HROB 4DL5A 1LWEB 2P5OA 2GMJA 4ZVHA 4DUZF 4DR1F 2MZJA 3IR6B 1T8EA 1RBRA 3OTOK 2NPIA 4OI3A 1NJIT 3X1LB 1H73A 1N56A 4H0TB 5HMYA 3NDKA 4OX9J 4ZJOA 1W0HA 1MU2A 2F5GA 5M1OA 2PEHA 5HSPA 3NGZA 3UWTA 5JXSA 5KPTA 3Q89A 3VEVA 3HFKA 2YY3A 2AJ1A 2VWJA 3QESA 2E2PA 2O8CB 4HEA9 2FVPA 2ZH6A 3HHKA 3LDOA 2UZAA 1UEVA 4DZDA 3DRPA 3I9V9 2AIRB 2IMOA 3PCOB 2JEGA 1A5WA 5DRKA 3PYFA 2R8JA 2D7SA 4Y28C 1N32F 4NLXA 4OI1A 4JI6J 4E2FB 4OYMA 4OHWA 5EX0A 1T3OA 4NCGA 3AO3A 3CD5A 1BWFO 3QRRA 2WB4A 3CQ8A 4KH6A 5HATA 4FYXB 2WVFA 4P72A 2R7TA 1Z2LA 5FRNA 3TPQA 3TQEA 4CO2A 4ZA1A 5TKYA 4O3RA 4KI6A 4M63C 1ZS6A 1U1MA 3CJ1A 4NLPA 4J7CA 1Y4ZB 3CB4A 4RW9B 3R3TA 3PSIA 1NOYA 4ZJLA 3I33A 3NF6A 2P9UA 3RAMA 1SC3B 1HHSA 1YJ7A 4K2JA 2FXUA 4O44B 3MURP 3QRPA 3QZ7A 1KNZA 4CFCA 2KXFA 4L73A 2Z1IA 1BG3A 4CI0B 3H46O 1S9GB 5D3GB 3KFWX 3FQLA 2X6NA 4Q0BA 2ALZA 3V9UA 3R7BB 3DXKA 5CY4A 1EXQA 2XY6A 4IH6A 2Q6BA 2OFGX 1MWZA 4CHQA 2AZ3A 4OFZA 2KHDA 2AGOA 4CGHA 1BHNA 5KG2A 1JQGA 1HJRA 1XQIA 2R7RA 4WF9L 2U1AA 1YJUA 3E01B 1PAEX 4OI2A 3RAQA 3OTBA 4A8OA 4E98A 3BQ2A 5FJ4A 3C14A 3P38A 5SWMA 4YFUA 1WAFA 1BQNA 1IN0A 1JLBA 2D0PA 1UVLA 3D6MB 3VALA 4M3XA 3BQ0A 3M8RA 1TR0A 3KJQB 1YLXA 2FJEB 3KK7A 3KG4A 3OR1A 1YF5L 1T05A 1FRJA 2F7TA 4KHMA 2Q36A 3R6LB 2W2MP 4JI2K 2C3MA 2WOMA 1RWPB 1S99A 4DX8H 5AQPA 4NEZA 1UZDA 4RWTA 2QM1A 3ALYA 1NU0A 5KFOA 1NDPA 3BR9A 5AXKA 3MGJA 4QYRA 3AO2A 4G9ZA 3BKTA 3BR8A 3HXMA 4LJMA 4CZIA 2FHJD 1VQOS 4ZDNA 5A8WA 4N76A 4Y1DA 4BR4A 2ZJPQ 5HLFB 2P9EA 3PW5A 3UD3P 4E19A 2OZSA 1VJWA 3WUHA 4NRTA 5LOQA 2AJ2A 3ILJA 1WSJA 3OR2A 1VHXA 2ZM6K 1HMVA 3CDWA 1WG1A 2YWKA 5CA5A 4DR2K 4P71A 3DLLQ 1TTHB 2FC8A 2MQMA 3QAEA 1TKTB 1KHVA 4ALZA 4I4BA 5DMRA 3S01A 2WC9A 2GHVC 3FGUA 4BCAA 2KKHA 4YHHF 1VSLA 3GPAA 4PQUB 4M3WA 1NM1A 3ISND 3BN7A 2J8SA 5EWGA 2MGZA 3K0SA 1HBNA 3KLGA 4KKOA 3K5LA 1GT8A 5DM7L 3NCPA 1SBRA 3PYEA 1XNRF 1HIYA 1TU0B 2IRUA 3M6UA 4CBUA 3IWNC 1R6VA 4ZP9A 3GMGA 1H2UX 4K2XA 4OYXA 3WXIA 3PM9A 3CCQN 4B9NA 4C0BA 2CADA 3D7SB 4ILLA 2F65A 3D68A 3DLGA 3J81j 4OPAA 1JB0C 4BDZA 2AYEA 4OKKA 1YKWA 4ZHRA 1WHYA 4GVEA 3PRVA 2KZMA 2GIRA 5HOOA 4BR0A 3H20A 2D74B 2CJ9A 3TJAA 3WQPA 7FDRA 2Y3YA 2B4PA 4ENOA 4FJKA 3OYGA 2IRYA 4DZ6A 4K50A 4Y2KA 1X0PA 4MIAA 1HNZK 3L9ZA 4Z94A 4PZVA 1LV5A 4E0DA 1BA0A 2HVEA 2ASDA 1R6YA 1YJWN 5K9FA 3T5HA 4OLOA 3TSQA 3I5CA 5D77A 3HVTB 2VC1A 5B0AA 5F3ZA 4FXVA 2JOQA 1RHMB 2E1AA 1LCUA 4ANEA 2G8VA 2VQFJ 2I8EA 1N8RT 4RBVA 5ETNA 5F0XA 3R5CA 4CH1A 1ZH5A 3VF6A 4KV8A 2ZHBA 4LRAA 2ZITA 4FF1A 1EQMA 4IO1A 4BRCA 1N5QA 3OFGA 4IBNA 1HRHA 4CK3A 1SVDA 1NXIA 2OPPB 5DZ7A 4NB4A 1NHUA 2OP5A 4AHRA 3DOMA 2I1RA 3IKMA 4BE2A 4DU1A 2M5YA 1T9VA 3PR4A 3SJJA 1RCHA 2ZHAA 1LWCB 2QXLA 1K8AT 3SUQA 5L39A 1JLEB 2CYYA 4A8WA 4WE1A 4GVBB 4ZMMA 3H40A 1LWFB 1BCMA 3U3GA 3SI6A 1Q9YA 2XCPA 4FWOA 1F5CA 4F3OA 1VQ8S 3O3HA 2VFVA 2V2VA 3P31A 2B9YA 3NXZA 1YJ9N 3V4MA 1ROFA 3Q2TC 2M88A 2R2UA 4DQQA 4CJRA 1R7IA 4KGKA 3Q8PB 3THTA 4WXOA 2MZ1A 2FVSA 1RACB 2P9NB 1VS3A 1MN7A 3CCJS 2C2NA 4QOTA 4MLEA 1HQUA 4WXWA 1QSYA 2VIHA 3PG9A 3G8SA 2M2BA 2XLJA 3SBTA 3KK1B 1FD8A 5GAGU 5KT5A 1A6LA 3LOUA 1SJFA 3KHRA 4FLVA 3VEWA 1TK0A 2V2ZA 4ECYA 3H5UA 1A5VA 2QJ3A 1VQPS 4JRPA 1TL1A 3BEGB 4OJ3A 1VQNN 1SZ2A 2IA6A 4CE9A 2PC6A 1S3XA 1UAWA 3VETA 4IXCA 1NO8A 2JLGA 1TP7A 4E7HA 1GX6A 2A10A 4KHPJ 5AZJA 2XWYA 4KT0C 2HQFA 1ZAWA 4C8LA 1WC4A 2OPQA 2WHOA 2RU3A 1RK8A 3S3OA 2ROEA 2L08A 4XDCA 3MOJB 3JXOA 3D6FB 3UKUA 3IG1B 3VAKA 1FDAA 1SH3A 4WIIA 2K7KA 4KBOA 1GMVA 3MTKA 4DTPA 5GAEU 2X1BA 2ZWOA 2FIUA 3O44A 5KOWA 3C3LA 4C1NI 4Z37A 2MB0B 3UN5A 3M1VB 3DLRA 3OYKA 4WQ4C 1DBDA 1X5OA 4YHHJ 3ZT3A 2IOCA 4CZKA 4DHVA 4FWSA 2ZQBA 4BGAA 1S72S 3AA9A 1WKJA 1K9MO 1XNRJ 3Q23A 2ZJRQ 3KLHA 2DH8A 2E5JA 3E51A 3J7ZO 2BKNA 3MCAB 3PYDA 3UCGA 3UKRA 4OZNA 3K0JA 4XTTA 2LA6A 2OEKA 4F67A 5EX5A 1FJGK 2KL8A 1KVIA 1HI8A 1ATSA 4UOFA 4QPXA 3CCVS 4JK9A 4OYOA 5HL7L 2PMZD 4YDUC 2OTJS 4KRWA 4K4XA 3ZFVA 1T3NA 1RGIA 3VAHA 1QS4A 2PYJA 1OH7A 2VPYB 3NHGA 4J2EA 2DCLA 1YBUA 1ZM4A 3FFIA 1K9MT 4F3MA 4NZ6A 3DDIA 2N4DA 1Q86O 2D1CA 3J7ZT 2YQ0A 3AO4A 4C8OA 3W65A 3H4BA 3FRZA 4DUZK 4DR1K 5EWEA 1S0VA 3WEEB 2F4VF 4FLWA 5T7BA 3CIPA 5ETTA 2VPWB 2FVQA 4LF8F 4FBUA 5KFDA 1TYQB 4TU8A 3QSIA 1FX2A 2CJKA 4WP9A 3K5NA 1O0PA 1FW6A 3UDLA 3M3ZA 1TL3B 1KLMB 2V7YA 5DDQC 2P9UB 2JZ5A 1URRA 2XGPA 2W7PA 3D54A 1S1VB 3M8YA 4DV7F 2CJAA 4NASA 3DRRB 3I5BA 4P6QA 3WNEA 1KKHA 3OL7A 4Y34A 3L3CA 1YJVA 2K8GA 1N0UA 3R5GA 3VN5A 1NNDA 4WU3A 4Q0BB 2HFNA 2OIHA 2EC2A 3W9HA 3DXKB 3T1AA 3GIKA 2W1BA 1KQSR 4JLHA 1DTTA 2HHXA 3TAPA 2KHCA 4S0MA 2W8LA 2X74A 4Z4GA 1WC0A 3CCSS 4IG3B 4DSIA 2QIFA 1K8KA 1YI2N 3ZZYA 1VIXA 5CYMA 3ZZRA 5GADU 1YSJA 1BQNB 5AQKA 6FD1A 3VQ4A 4DG1B 1BXNA 4F4WA 5HANA 2QG9B 4ED6A 5EXWA 3DOKA 3HVWA 2W41A 1PSDA 3BSNA 2KXHA 4NEYA 1Y9OA 2AX0A 2W8KA 4ZVSB 3ZO7A 3AA3A 2ZC3A 4EYIB 3CO0P 2JEJA 3SQ2A 3IUCA 2YHYA 2MSSA 2O1PA 1EB0A 3WXKA 3TR5A 3MM7A 4A8SA 4DQRA 4X64F 2GVDA 2F8SA 1NGGA 3BN4A 3ZSOA 5KFPA 1N33F 2GVZA 3Q83A 2QL7B 2KYZA 1SKWA 4YOTA 1RT3A 1PG5B 4UOCA 2NSBA 1ZBLA 3VR1A 4DLEA 2J9CA 4USKA 4WFNL 2RF2A 4B9TA 2YBVA 4C97A 1SUQA 2XBPA 2OZMA 2JX2A 5C25A 3PEJA 1DQ9A 1MLAA 2I9SA 4JI0F 3TEHB 1TAUA 4ILGB 3CIMA 1RNHA 4B9VA 2MGZB 1WTBA 3THYB 3OFFA 4H4MA 3SQ0A 1QVGM 3AV9A 4LF5F 3NRBA 2BE2A 1NK6A 1FXDA 2FHMA 4UQTA 3PO5A 4JI5F 4ECQA 5E3PA 1LK5A 3EX7B 1T02A 2P6SA 5K8MA 1FVQA 3DLGB 4J9SA 1RTHB 4I1TA 4CEEA 5BXIA 1OYDA 3FEZA 4ZHRB 4WYLA 3SIPB 2FC9A 2CQGA 3G71S 2VOPA 4KYZA 3RG6A 4OGCA 3H7HB 4HYKA 4FW2A 3QNWB 4CJTA 4P2FA 4KTQA 3G25A 3R6MA 2RDIA 3HKWA 4GKKF 4DTNA 1IQTA 2I0XA 1FERA 4DR7F 2A6AA 5KFXA 4NE9C 4YHHK 2XI3A 3GYGA 4DPXA 2B9XA 4CGFA 1XQSC 4NYPA 4DTOA 5KTQA 1X3NA 3ZC4A 5JVGL 1JLCA 2Q6CA 3GYNA 1VBXA 1FT8A 4ZPAA 1AXQA 1VSIA 1XHZA 1N0VC 4B9LA 1EO1A 2XMVA 1XNRK 2OFHX 2RVJA 1RCXB 4FYVB 2BJ1A 2J5AA 2V8DA 3G9CA 3NGRA 2F4VJ 1EZZB 3B4MA 3POTB 5KG4A 4JI7F 1J53A 4EZ9A 1NDCA 4E8UA 3ZEUA 4G3IA 3BDEA 2IJRA 2Z30B 2R7VA 2MHNA 3PKMA 3Q7BA 5L38A 1L3UA 4NLRA 4B3TF 4JS4A 2IIRA 1HLUA 3IBFB 1F60B 3M7VA 1GXLA 4TYAA 3QIOA 3M9MB 5IT4A 4DV7J 2G8HA 4X65F 4CGGA 1T3VA 2VA2A 4WE1B 5J2PA 2DFEA 1PGZA 2HFVA 3PW4A 2QK9A 4ECWA 2RHQB 4YB5A 2E6LA 1FVSA 5GAGP 3HI0A 3R6GB 1YK9A 5KG1A 4LBPA 2B5JA 2XMKA 2RHSB 3HT0A 4KGMA 3THWB 1RWNB 2R2SA 1CVJA 3R1XA 2XHWA 4PKIA 1DKGD 3ZSZA 2EFVA 1RT2B 4MKBA 2ZGYA 4BG8A 2F9WA 3CUNA 3KD5E 1NUEA 2E5IA 5A0YA 3MN9A 3LDPA 1QQOA 5KFMA 5F0UA 4ILJA 4CZMA 3GIRA 4LR8A 4JV5F 4FK2A 4DR3J 5M1NA 1TKZB 4ANCA 3W8GA 1EKEA 3SK3A 2X7IA 4ILMA 2PI4A 2BM1A 2D9OA 2QKKA 2QSWA 1NGDA 3P1GA 1TL1B 2GJIA 3N9UC 3WC2A 2MSTA 3TP2A 3DLEB 1SJ4P 3IMQJ 3UE5A 5GAEP 3PLAA 4F3TA 4C8KA 1RILA 3P4IA 4GVLA 4CGDA 4BRMA 2OPQB 1FESA 4YOVA 5BN9A 4CJ3A 4E1NA 4W98A 1VQ4N 2KRBA 3X3UA 2UUTA 2HBJA 3UKUB 1BCOA 2KJWA 5HQMA 4PWDA 1RAJA 1NG9A 2CPDA 4MLHA 2VV5A 4V1Ak 1HW8A 1Q53A 4Q43A 3OVSA 1M1GA 3SQOP 1T44A 1XIQA 2RN2A 2D3OR 1D5AA 5D0EA 5AFUA 4YP3A 4O4GA 3AH6A 4W5TA 3U7JA 1VLOA 2MKKA 4ID5A 2ZWPA 1RXOB 4C4WA 1VQ7N 4ISFA 3RB0A 1AT1B 1JX4A 1IKWB 3AVMA 4WYBA 3BGFA 4DSLA 3HULA 2LQ5A 2EKNA 3TO8A 4U6PA 4FLUA 4CF0A 2D0BA 4LF9F 1S22A 5DJBA 4RW7B 1RBTA 3GJQB 3L4IA 3W3DA 3FE1A 5T7LA 4HTUA 3SCKE 4FK4A 5MLCQ 3FK4A 5KFNA 2AQ4A 2DXEA 1GK8A 3UKRB 2DH9A 4ER8A 1C2PA 2E44A 1KR4A 3NGYA 2R7YA 1S10A 1R0AA 4PA1A 2IC3A 5KT6A 5THWA 2B8QA 4KHQA 4XAKA 1SC1B 1UETA 3C6UA 2R8HA 1VSDA 2M9KA 1JLFB 4QW8A 2F8TA 1UFLA 4AHCA 1A9NB 1WNSA 5D4LA 5DS7A 4F26A 4WTOB 3J7YU 3KZBA 5L9XA 1S0MA 1IBLF 1XC9A 2ZE2A 4UUWA 1B9DA 4X4NA 2ZH7A 2E1MC 1K0TA 4HL9A 2OPRA 1J6ZA 5HQ8A 1FKPA 1WC3A 4U7CA 3R3LA 2QC3A 4QU7A 3RU0A 3SSQA 3CJ3A 3I0SA 4ISGA 1VFJA 1E6VA 2YNGA 4Y0FA 2FY8A 5ETOA 1ZA1B 1T03A 1SB6A 4H54A 3AVNA 2NRTA 2KFNA 3VMFB 1BISA 1ZBFA 2GHPA 2CGKA 4LSNA 1Q8BA 4QPTA 2GC8A 1RDWX 2OMLA 1U1QA 2GUIA 4OLBA 2LLZA 4K4TA 4BRKA 4IRDA 2NXNA 2MDAA 2W7OA 2AD9A 1JIHA 2JVOA 2Z2YB 4KY3A 1HNIA 1DTTB 1U02A 4YQWA 1IBMF 2F4VK 1X5PA 1HA1A 4LF8K 4K8ZA 2NYIA 4DU3A 4DUYJ 2UU9J 5IV3A 3PUFA 2DTJA 4CJQA 2ROGA 4XH5A 2QN6B 4YOYA 3RVCA 2LECA 2E66A 5AT1B 1UP1A 2CFXA 2UXDF 3TTDA 3HPHA 1K1QA 4AHVA 4RUBA 1QAXA 3RBXA 4TQRA 1GTHA 3CO9A 3V6JA 3G86A 3KG0A 3TR8A 3C15B 1QUVA 4DV7K 5LM7E 3JSRA 2NRZA 3S9HA 2QO3A 3TU5A 4CF8A 2WVCA 3VTIA 5KT7A 2WAQD 4KB7A 4D3HA 2QLWA 1RAEB 3K8VA 2ETJA 3R27A 2DR9A 1PBUA 3FCHA 3OYCA 4CEOA 2GVZB 1S0OA 4JHDA 3C0BA 2FPHX 4DV3J 4DF4A 4F8RA 3C8YA 4BVPA 1DTQA 3SCJE 2Z1JA 2EXUA 1RBSA 5K14A 1RB0A 1SKUB 4BDPA 2BBEA 2O8FA 4LSLA 4J9MA 1RT4A 3W0LA 2RF2B 4OLAA 1GLCG 3H98A 1SUQB 1RBVA 3ENBA 4EHUA 5C25B 2XLIA 2C28A 1CG2A 5HRSA 4FZVA 3BQ1A 2BA9A 1Z26A 1SQEA 2V68A 4NYOA 2RKIB 3MN5A 3AVAA 4O0JA 5KQDA 4F4KA 1WF1A 4LREA 4H4MB 2HHWA 2GA7A 4FLTA 2ZD1A 4CLFA 1YIJS 4ZVEA 2MKSA 3QGHA 2XSJA 1KVJA 2BE2B 4TN2A 4LF9J 2O67A 1Z05A 1NH7A 4ED7A 3VA0A 4CNZA 1RADB 4ECVA 3ZETA 1B7FA 4X64K 5EVZA 2RUSA 3TJ8A 3CJ8A 1JCGA 1N33K 2O8BB 5HQLA 3LGMA 3EZ5A 5LMUF 2MLZA 4A59A 1D4XA 1RBLA 3SPZA 1VQSA 3ULEA 3NNHA 3D0GE 4M94A 1EWQA 2AU0A 2UXBF 4USUA 3HVRA 4FKYA 2N7YA 4W5QA 3AY9A 1V5IB 3P39A 3JYTB 4WFZA 4JI0K 4ZVGA 3R2DJ 3O1BA 5JMVA 3QT5A 4MDAA 1M90O 3LZJA 1KAXA 1C4CA 5CCLA 4Q8FA 4LF5K 4BG9A 5KFKA 4FWNA 1SJRA 4JI5K 2CG4A 2GX8A 2RD5C 2CJBA 5L1IA 4R0JA 2ZH3A 4CF2A 1B99A 2HQ3A 4Q45A 4DR4F 4DMZA 2ADCA 3WT0A 4EP4A 2HKEA 1R43A 1IBLJ 4CF9A 3ZEUB 2G1DA 3H5YA 1V3RA 2RAQA 2BXJA 3S1TA 4CHZA 1RT1B 3DN9A 1NBEB 1O13A 4BC9A 1GNKA 4CGJA 4GMKA 5KFEA 1H74A 4MYTA 2A18A 3RAXA 3LDQA 3VF2A 1GMWA 1QTNB 3DFEA 3OT9A 1KFDA 4GKKK 1X4BA 4YOUA 5IFMA 3MDQA 4CLUA 2F9JA 4DR7K 5HN0A 1IXKA 5BREA 1W2IA