1LWCA

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
506
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 146
structure length 506
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwcA05
2ZQBA 2B6AB 4GC6A 1CXUA 5FDLB 4F3TA 2OH2A 2UVUA 3NF7A 1X9WA 1HMVA 4MKBA 2O5DA 1UOCA 3C6TA 3AVNA 4FW1A 1U47A 3PZPA 4EZ6A 4RNOA 3DLHA 1RTDA 3T5JA 1NK8A 4CEAA 3PV8A 4IR1A 2FVCA 2FJXA 4J9RA 5DGAA 3Q8QB 1KFSA 3EPIA 1TL1B 2W9AA 3OY9A 1RT2B 3PW5A 1RBRA 4CGHA 3KLFA 3TANA 2KFZA 2D0AA 2Q3SA 2ALZA 1TK0A 3BGRA 1F21A 3MXJA 3LWMA 1RTJB 3NFAA 4IFYB 2A1RA 1JXLA 4TLRA 2W7PA 2XC9A 3U3YA 1W9HA 4RUAA 2HHSA 2ZD1B 4CEEA 1U04A 4B3OA 2UUTA 4JUZA 2A1SA 3WNFA 5KI6A 3OYDA 4DTJA 4H54A 3V9ZA 3OYKA 3CM6A 4Q44A 5KFGA 4CF1A 3T19A 2C22A 1T7PA 1S1VB 4ZTJA 4CJFA 1Z4UA 3VQ8A 4Z4HA 1EP4A 1JLGA 1BI4B 4CJVA 1UA0A 1RT4B 1TKXA 4FLZA 2DFEA 4K4VA 1U09A 1IKYA 1RT3B 1NK5A 3NE6A 3OYFA 2HNYA 1X9MA 5D3GB 4NCAA 2G8KA 4CHQA 3HVRA 4NLTA 3CFOA 2XWYA 1QS4A 1NKEA 3S3OA 1VRUA 4JV1A 4RW4B 3K5OA 3TVKA 3BSOA 3L2VA 3K5MA 3HP6A 1VSKA 4O0IA 3PX6A 3KLHA 5C42B 3HT3A 3ZT0A 2WONA 2BE2B 4JS5A 3RMBA 1T05A 4CJPA 4DFPA 4QWEA 1FKPB 1S0MA 4BE2A 3QEIA 5HBMA 1CLQA 1HQUB 3MEGB 1N6QB 4TQSA 4CHZA 1KCFA 1S9GB 1VSFA 4K4ZA 3MTKA 4W5NA 1RTHA 5J1EB 3ZSOA 3DLKA 4K4YA 1VSLA 2VG5B 4R5PA 1DTQB 3DM2A 3HP9A 4OKJA 5KT2A 1RBSA 4W5OA 3PW4A 4EEYA 4I2PB 3HVAA 2WB4A 3SQ4A 2XCAA 4ELUA 5KG4A 5KFVA 4CFCA 5KFUA 5JS1A 1NK0A 2ZE2A 1C0UB 5KRSA 1NK9A 2R2RA 2Z1GA 5KG2A 3CJ2A 2X6SA 3E01B 4ICLB 4Q5VA 2YNGA 1REVB 3PR4A 2HWIA 2I1RA 3MAQA 3H4DA 2G8FA 3HK2A 3ULDA 4M3WA 4EP5A 2HNDA 4CFAA 4DL5A 4IR9A 3NKYA 1CXQA 3WNEA 3HPHA 3AVGA 3KLIA 1KLNA 3L2WA 3AV9A 4RW9A 3H5XA 2VWJA 1KRPA 4MKAA 3GV5B 5F8JA 3VQDA 1L3UA 3PR5B 2IOCA 4ZP9A 3OHAA 4KAZA 3OYIA 3TABA 2P5GA 4FZYA 3RAXA 2FBXA 5C24B 2XY5A 4IDKA 2IM1A 4RW6B 2BRKA 4O3OA 4QPXA 2HHQA 5F8HA 1LAVA 1KSPA 3HO1A 5J2NA 1RT1B 3AVCA 3L2QA 1KLMB 3MR2A 1JLFA 3KHLA 1BQNB 2YNFA 3OYAA 2DFFA 4O4GA 3HXMA 2DY4A 4DF4A 5F8IA 4ECSA 1ZTWA 2JEIA 1RCHA 4DFKA 5J2MB 1NOYA 5KFQA 1ASUA 3QLHB 2W9CA 2QK9A 1WSJA 1SUQB 1RT2A 4BWJA 5KFWA 3CJ3A 4M41A 4RG8A 4NLVA 1S9FA 2YKNB 3QESA 1TKZA 1RT6B 4FJKA 1JLBB 4B9UA 4B9LA 2KZMA 5KGXA 3C6UA 4F2SA 3FFIA 3O3GA 4J9PA 4G1QB 3IGNA 2RKIB 4G3IA 3V6DA 1LW0A 3G0ZA 3VN5A 4QCLA 4NLYA 3SJJA 2ZD1A 1CSJA 4URQU 4TSXA 1IKVA 1C6VA 3HVTB 1L5UA 2WTFA 3CJ5A 3TI0A 2FVSA 2ITGA 2P5OA 2VWKA 3WNHA 2R2TA 2W9BB 1LV5A 3SUQA 4J9NA 4C8NA 4E7IA 3RBDA 2FJVA 3M8QB 4ZPDA 2GUIA 1W25A 1SH2A 3CFPA 4OJRA 3CWJA 3NL0A 3AO1A 3V6KA 1JLQA 4FJXA 3ISND 4CEFA 4IQXA 1VSIA 5E41A 3IS9B 3DYAA 4OPKA 4ZP6A 1A5XA 2FVQA 3F9KA 4ZHRB 1TAUA 2JEFA 4B9SA 3OYMA 5KFTA 4NYFA 2XI2A 1L3TA 3AVHA 2R8JA 4KHWA 3LDSA 1RTIB 4DEZA 1LWFB 3SYZA 1C0TB 4QAGA 5L1JA 3AA5X 2AU0A 1SL0A 3RR8A 4CGGA 2IAJB 1KVAA 3LP0A 4JRQA 4O3NA 2V4RA 2R8KA 3OVNA 4E0DA 4DSIA 5KFKA 4YNQA 1HARA 4DSFA 3MEGA 4BE0A 3M8SA 4O44B 1T03B 3G6YA 1W0HA 1MU2A 3ZSWA 1S1UB 4RW8B 1VSHA 3M9MB 1S97A 5J1EA 4GVMA 1UWBA 4Z4CA 2VG5A 2BQRA 3P83D 1I6JA 3SFUA 4KB0A 5KG5A 4FJIA 4EYHB 5C25A 2JC1A 3M8PB 5KRTA 3DI6A 3K5LA 2B5JA 3MECB 2BQ3A 4NLRA 5I42B 4EYIB 5KG7A 4ED8A 3VA3A 4KFBA 4RNNA 5K14A 3FDSA 4CFBA 4RU9A 1HYSB 4DL6A 4LY7A 2DPJA 2AJQA 4ED0A 3KLEA 2HNZA 3SNNA 4KHQA 2IC3B 1VRTA 2KQ2A 1SH0A 3QGGA 5T7BA 3ZSYA 3T3FA 2HMIB 4DQRA 3B6PA 4EP4A 5KFSA 1JIHA 4F8RA 1TL3A 2B43A 1MMLA 4MFBB 1GOCA 4CEQA 1RBVA 2IDOA 1K6YA 1WN7A 3Q8RB 1B92A 2XHBA 1QE1A 1S48A 1C1CA 4IRCA 4ZMMA 1HPZA 4B8AB 4M3ZA 3KHHA 1NOZA 3LAKA 4RW6A 4CJUA 4H4OB 2VG7A 3A2FA 1S6PB 3KK1B 1LWEB 3PJWA 5KT3A 4KAIA 1VK0A 4FBTA 4FJHA 4I7FA 3K2PA 5I3UA 4CJKA 4ED1A 2FBTA 1HRHA 3K57A 4Q0BA 1TGOA 2FLPA 2WK4A 4ZPCA 1ZBLA 4I2QA 5HRSA 1HQEB 3KK2B 1EX4A 4FJ5A 3DDKA 2NUBA 3K59A 1HNIB 2QE5A 2W8LA 3EYZA 4YR0A 4BE1A 3ZSQA 1N5YA 3O3HA 1S6QA 4OPJA 3D45A 4PWDA 4R8UB 3KD1E 3V1OA 2ZKUA 5EWGA 2D3UA 3AVLA 2PY5A 4PUOA 1J5OA 4CEBA 4CJ5A 1RT5A 3KJVB 3KLVA 3MFIA 4J2EA 4KHRA 4AHCA 2UUWA 3V81A 1C1BB 2Z1HA 2WOMB 2C2RA 1ZETA 1HJRA 2YNIB 1IKXA 3DOKB 3H59A 2D7SA 3TAMB 2QV6A 4CGIA 4LSLB 4J9LA 4JV0A 1IM4A 2F96A 4OKKA 4ECZA 2PZSA 2D41A 4Q43A 3AO2A 4YP3A 1S5JA 2RF2B 3MEEA 3HJFA 2D3ZA 4KTZA 5KFBA 2OYQA 5CYMB 3HHKA 4FZXC 4L8RB 3M8QA 4ID1A 3DOLB 2FBYA 3S3NA 1C1AA 4MQ3A 4TY8B 4O4RA 4Z4EA 2E6LA 1YT3A 2E9ZA 4NCGB 5F8GA 5KFHA 3LP3A 3CJ0A 4ZHRA 2AGPA 3L2UA 3I8DA 3TAFA 1JKHB 5KTQA 2LSNA 3TWHA 1S1WB 4GW6A 4C8KA 4KSEB 1T3NA 4QWBA 1QUVA 3DMJB 1XR6A 1S0NA 4PQUB 1SV5A 2E9RX 3BDPA 1GX6A 1JL1A 4DQPA 1JLCA 4IFVB 1VSDA 3SPZA 4KHNA 4XPCA 3NAEA 3QINA 3SCXA 3AVBA 4N76A 3NAIA 3ISNC 4CIFA 4IKFA 4FYDA 2DPIA 4DSKA 3BSAA 3ZCMA 2OPQA 1BHLA 3EZ5A 4EBEA 4LSNB 1KHWA 2XY6A 3MEDA 4M3UA 2OPSA 5KFIA 2HHUA 3PX0A 3I0RA 4O3SA 3ITHA 4HUGA 2VA2A 4CEDA 4QWDA 3QEPA 3QEXA 4CJTA 1FK9A 4IH5A 2XGPA 3NGYA 2BGGA 1ZYQA 1DTTB 3MR5A 4GC7A 5KT6A 4FW2A 2C2DA 2VA3A 2OPPB 4ZVGA 4FVMA 2OZMA 3NBPB 4C8LA 5DG8A 3UDLA 3THVA 3BQ1A 4N56A 1TKTA 4AILC 1TVRA 1RT7A 4U6PA 2WHOA 4EZ9A 4WYLA 2D0BA 4NLWA 5KFLA 1S1XA 1QQCA 3MF5A 1R0AA 4HYKA 1VSEA 5F9NA 3OYNA 3B6OA 4H4MA 1YTAA 2V4QA 4TXSA 5EDWA 4DLGA 5HROB 1J9AA 4CGDA 3PO4A 2BANB 4AHTA 4IH7A 2Y1JA 4M3XA 1XR5A 3NGIA 4FJJA 3QIPA 4F50A 4DS5A 4ECQA 5DLFA 3GIJA 4RW7B 4TYBA 3L3VA 4CGFA 3RMCA 3PVXA 4KV8A 1KVCA 5L1IA 4YFUA 4BDYA 3V4IB 4RNFA 1XC9A 3I0SB 1DLOA 3DLEB 3L8BA 4XIUA 1A5VA 2OPRA 3Q8SB 2YKMA 2XCPA 1I3AA 1U4BA 3HPGA 4O0JA 3JSMB 4KTWA 3UR0A 3NMAA 4E19A 4FLWA 1Y97A 1EETB 1JXBA 3S9HA 1YTUA 1LW2B 3IRXB 4DLEA 4NLPA 2FBVA 2GV9A 5DMRA 3FQKA 3HKWA 2KFNA 3KK3B 4URGA 3SUNA 1RAJA 2QXFA 1Q8IA 3EY1A 3V9XA 3PW2A 2O4IA 4CF0A 3FSIA 1I39A 2KTQA 2AX0A 1BQMA 3DRPA 5L1LA 5KFPA 4M42A 4BDZA 3D0PA 3KMSA 3KLGB 3CJ4A 5HP1A 4IRDA 3F73A 4K4XA 3T5HA 1TAQA 4OLBA 3ZSRA 1TQLA 5HLFA 4B08A 2FVPA 2KZZA 3AVIA 1RYSA 5J2PB 3DRRA 2YNHB 3GYNA 4J2BA 1NJXA 3PY8A 1S4FA 3OYJA 4NLXA 3OYHA 3ICLA 5JS2A 1QAIA 3VQ4A 4CERA 4ID5A 3QNOA 4CJSA 4FLVA 3LP1A 3G86A 2VG6B 4PA1A 4HTUA 2D0CA 3OS1A 5JXSA 4CIEA 2QKKA 1LWCB 3SI6A 1TKDA 5DLGA 3ASMA 2J6TA 4F4ZA 3N6NA 4ELVA 1NHVA 3KIOA 2B6AA 4K4SA 5FDLA 1K1QA 3TR8A 3H5YA 4FJ9A 3OS2A 3NCIA 4NRTA 3UQSA 1NK6A 3V6HA 2XO7A 5KFRA 3KHRA 4NLOA 4AHRA 3CG7A 4IG0B 4WE1B 4UQGA 2JGUA 3QEVA 2HHTA 3DRSB 4DQSA 3LPUA 4JS4A 3QO9B 2R7YA 1OS5A 1BCMA 1TL1A 4Q8FA 1TV6B 1SKRA 3RMDA 4TYAA 1BIUA 1QSLA 2Z1IA 2FVRA 4K4WA 5DK5A 3RRHA 4MK8A 3SQ1A 4Y1DA 4FS2A 4KO0B 3OLAA 1JLAB 2JC0A 3O3FA 4Z4IA 1RTJA 4IFYA 3RB3A 3DLGB 1RBTA 1B9DA 4XO0A 2HW3A 5CYQB 4FJNA 4QWAA 4MIAA 1HNVB 3RBEA 1U45A 2BRLA 4BDPA 2XI3A 3KNAA 3JYTB 4CHOA 1BL3A 1TP7A 1T94A 4DTUA 1YVFA 1FKOB 1S49A 3RMAA 1S1VA 1TK5A 3BQ0A 2ASDA 3V6JA 4KHMA 1BI4A 4DQIA 4HKQA 4N5SA 1RT4A 3V9WA 3P5JA 1RT3A 1ZBIA 3HPOA 2DFHA 5D3GA 2R8GA 3RWUA 1VSMA 4RW7A 3MR6A 3QIDA 2IM2A 1WSFA 4Y2AA 3IG1B 4BACA 4RW4A 1X1PA 2RN2A 4FXDA 3LP2B 4ED6A 2F8SA 4IKAA 5C42A 2J6SA 1VSJA 2BE2A 1FKPA 2BQUA 4M3TA 4B9TA 1HQUA 1N6QA 4J9OA 4E7KA 1S9GA 4FJ7A 4EBDA 1HMVB 1EXQA 3SV3A 1NHUA 3GILA 4MK7A 2F8TA 3C6TB 2P1JA 1DTQA 2EC0A 1RTDB 1RDCA 3LPTA 1RDBA 2I5JB 4CHYA 4F4WA 2AX1A 4I2PA 5KFOA 4M3RA 3AA3A 4DWIA 4X2BA 5KFMA 1QTMA 1QAJA 4Y34A 5KFXA 1JXEA 2QKBA 1QSYA 4JLHA 3TAEA 3KMQA 3KLFB 1C0UA 2W7OA 4CK2A 1HYVA 4F4XA 3ZT4A 3E01A 3BGRB 5DQHA 3SZ2A 3V1QA 2J6UA 4E7HA 3KLGA 4HCBA 4ICLA 1REVA 1SKSA 4W5QA 4R0EA 1J54A 1QHTA 3OYBA 2IM3A 1SL1A 4ECXA 3H2LA 3OYEA 3H08A 4LH4A 4HUFA 3DLRA 2ASLA 3HVWA 3QZ7A 4DFMA 4FK2A 2WCXA 4B9VA 2E6MA 3SQ0A 1EP4B 1JLGB 3OL8A 4ECVA 4CEZA 3OSPA 5C24A 1SKWA 5EWFA 4Q8EA 3ZSVA 4ECRA 3LZIA 1JL2A 1IKYB 1RA6A 1KVBA 1TK8A 1RT1A 3H4BA 4ZP8A 2RDIA 4K4TA 2UVWA 4RZRA 3CQ8A 1KLMA 1CZ9A 3TAQA 1BQNA 4ZPBA 3H5UA 3AO3A 1ASWA 2GIQA 4C8OA 4B8CA 3V9UA 4HCCA 3T1AA 5J2MA 3VQQA 3QLHA 4ED3A 1RDAA 4WXWA 3BR9A 3QO9A 3KLHB 1SUQA 2G8WA 2BR0A 2WONB 1T05B 1XI1A 2YKNA 1RT6A 3MXMA 4FJLA 1NNDA 1JLBA 5KT4A 4DU4A 5EWEA 1YVUA 4I9LA 1CZBA 4ZVFA 2XY8A 1RNHA 4G1QA 2GBZA 1XHZA 3G10A 3U6FA 3PO5A 2RKIA 1RTHB 1FXXA 4HVJA 3DLKB 4ECYA 4R5PB 3DM2B 4DQQA 4KBIA 5CYQA 3NGZA 3QGHA 3HVTA 3CO9A 4CF8A 1D1UA 2JLEA 3CVKA 2R2SA 2W9BA 3ZT3A 2ZE2B 3EZUA 3OHBA 3VQSA 3NH2A 4QW8A 3CFRA 4AHUA 5HRNA 4WYWA 2XGQA 4B9NA 4RUCA 4WXOA 1WAFA 4DTOA 1B9FA 3CDUA 1GX5A 2YNGB 4J9SA 1K1SA 5KT7A 1XWLA 3IS9A 1O1WA 2HWHA 2HNDB 2E9TA 4WFZA 5KFFA 4U7CA 2W42A 3NF9A 4F4KA 4EBCA 3C94A 3KLIB 4YR3A 1EKEA 4Z4GA 4RW9B 5KG1A 3GIKA 1RTIA 1LWFA 4OGCA 2DTUA 1C0TA 2CJQA 3CIZA 3BQ2A 4NYNA 2CKWA 1N48A 2IAJA 1NK4A 3EPGA 4IDKB 4Y1CA 2IS3A 2BDPA 4FS1A 2G8HA 3CM5A 5J2NB 4KB1A 2XY7A 1IO2A 1WLJA 5KFDA 3BSNA 3AA4A 4O44A 3U3GA 1T03A 2YHBA 1JLFB 1U49A 1S1UA 4O3QA 2YNFB 4RW8A 4I9QA 4O4GB 4CFDA 4W5RA 4ZVHA 3P1GA 5KGWA 5KG0A 3LZJA 2I5JA 3M8PA 3CYMA 4Y3CA 3MECA 2W9CB 5I42A 4AHSA 3SUOA 3NDKA 3MXIA 4QOZB 3GV7B 3UIQA 3T5LA 1TKZB 4KB7A 2RPIA 1T8EA 4ECUA 1RDDA 3BJYA 3C6UB 4B9MA 3FFIB 1HYSA 1UA1A 1LAWA 2HAIA 2HHWA 3KOAA 3VQ7A 4DTRA 3M9OB 2IC3A 3UPFA 3V6DB 1LW0B 3RRGA 5CZ2A 3FRZA 4KRFA 4K8XA 2HMIA 4LQ9A 3N6MA 1S9EB 1A5WA 1IKVB 2YV0X 4J9MA 4K4UA 4MFBA 4ZP7A 4MIBA 4CK3A 3TARA 1D9FA 3QIOA 3HYFA 4ED2A 1BCOA 3QERA 3OSNA 3TAPA 1WNEA 4JRPA 4CESA 4H4OA 1KHVA 2HB5A 1S6PA 3KK1A 1LWEA 4CJQA 2HVHA 1JLQB 4DL3A 4ED7A 4WZMA 5DQIA 3DYAB 4ECWA 2Z1JA 4WZQA 4FBUA 4FLTA 4YMEA 1HQEA 3KK2A 2HVIA 1HNIA 4DG1B 3ALYA 3H98A 3VQ9A 4CF9A 3V9SA 2X74A 4ZTFA 5EUHA 4CIGA 4NYZA 3LP0B 4R8UA 4CJLA 2OZSA 5KFNA 4CJRA 2WRMA 5J2QB 3QZ8A 3IN5A 3KJVA 3QETA 3G6XA 5L1KA 4E1NA 1MU2B 1C1BA 2WOMA 4MH8A 4CJ4A 1D8YA 2YNIA 4ZVEA 3GV8B 2HHVA 3DOKA 4JV2A 3CDWA 4KKOB 3TAMA 3D5MA 3PW7A 1UWBB 4LSLA 3BSCA 4DTPA 3TQ1A 4CEOA 1NJZA 1RA7A 4FM0A 5KFYA 3AVMA 4NLGA 5C25B 5KFCA 5EU7A 2IMWP 3DI6B 5KFZA 2B5JB 3G6VA 2RF2A 4F2RA 1NKCA 4FJ8A 5SWMA 4FCYA 5KG6A 5CYMA 1IH7A 4OGEA 4KFBB 1N56A 2KW4A 3KKRA 5K14B 3M9NB 2IM0A 4C8MA 3KLEB 2HNZB 3DOLA 4IH6A 1VRTB 1IKWB 5CY4A 4BWMA 4O5BA 4TY8A 2G8VA 4Z4FA 3H5SA 1ZTTA 4E7JA 5FRNA 3RAQA 3I5AA 1JLEB 4FLYA 4NCGA 4DU1A 4K8ZA 1Q9XA 1TL3B 2R2UA 3NH0A 4TN2A 3DLBA 1JKHA 1S1WA 3O4QA 3D28A 1KTQA 4N47A 4E7LA 5FRMA 2AGOA 1S1TB 3NAHA 1C0MA 4KHSA 1QE1B 3GQCA 5F8NA 3DMJA 2R8HA 4FK0A 1C1CB 3LAMA 1WSHA 1HPZB 1ZBHA 4PQUA 3HSTB 2VG7B 4IFVA 2AWZA 4I7FB 1RDRA 1JX4A 5I3UB 2ATLA 4Z0UA 3HL8A 4H8KA 3NHGA 2R8IA 3K58A 4J9QA 2AGQA 4CECA 5SZTA 4J9KA 4Q0BB 2W8KA 4LD0A 5L9XA 4CJ3A 4LSNA 3AVJA 3FQLA 4OLAA 4I2QB 3RTVA 4NZ0A 5CZ1A 3AA2A 4DSJA 3NGDA 1G15A 4M45A 1N5YB 4NCBA 1S6QB 2FLLA 4E3SA 2Y1IA 3CDEA 4J2DA 4PWDB 3OYCA 2D5RA 4FK4A 1DTTA 3HM9A 1GOAA 4ZPAA 4E1MA 1RILA 1XR7A 3RB0A 2B4JA 4CJEA 3RB4A 4PUOB 1J5OB 2OPPA 2ATQA 1RT5B 3S3MA 3NBPA 3SUPA 4QW9A 1X9SA 3V81B 4QWCA 3LALA 1IKXB 3OL9A 3ZSZA 4CK1A 4O3RA 5KFAA 2ASJA 1S9EA 1U48A 5FROA 4DMNA 4IG3B 4O3PA 3O4NA 5HRRA 5HROA 4E89A 2UVVA 2O4GA 2EHGA 4KPYA 4CGJA 3MEEB 3PW0A 3V1RA 2BANA 1L3VA 3GIMA 2OA8A 5T14A 1C2PA 4FM1A 3QGIA 4NRUA 3NF8A 4DFJA 1WAJA 1WNSA 3OL6A 4TY9A 3VQAA 1D0EA 1SL2A 4WFYA 4DS4A 1S10A 4FJGA 4CJWA 3NH1A 3SI8A 3V4IA 4OL8A 3AO4A 1ZBFA 3ZSXA 5KFEA 4FLXA 3MR3A 2X78A 3I0SA 3DLEA 3SV4A 4ELTA 3SFGA 2X6NA 5DG9A 3PHEA 3PUFA 3JSMA 5KT5A 3H40A 2YHAA 4CE9A 3T5KA 1EETA 4DG1A 4PY5A 4OVLA 4YR2A 3AO5A 1LW2A 3IRXA 2G8UA 1SV5B 1RBUA 3VQEA 5F9LA 5DQGA 3M8RA 4CF2A 4M94A 4N41A 1JLCB 4CHNA 4CHPA 1J53A 2XRIA 3SQ2A 3SPYA 3I5CA 4F3OA 4OKEA 3KK3A 5J2QA 3PX4A 2UVRA 4FJMA 2FJWA 3VQBA 2OPQB 3AVFA 3MEDB 3KHGA 4DTNA 2OPSB 4TQRA 4MK9A 4KKOA 5DGBA 4F4YA 3I5BA 3I0RB 5F8LA 1NJWA 2C2EA 3ITHB 4DSEA 4FZZA 3VQ6A 4NLQA 4DL4A 4EO6A 4IBNA 1FK9B 4GMJB 1NK7A 3NF6A 4WFXA 4AH9A 4KREA 5J2PA 5KFJA 4B3OB 4Y2CA 2YNHA 2RDJA 2V9WA 4O55A 2HHXA 1TKTB 1TVRB 1RT7B 3OYLA 4KI6A 4CCHA 3OYGA 1IKWA 3VQPA 3RB6A 2C28A 1S1XB 2FLNA 1R0AB 1JLEA 2JEGA 2VG6A 4H4MB 1TKXB 3LANA 3N6LA 1GOBA 2AQ4A 4NLSA 2PYLA 1LWCA 2IJNA 3Q8PB 2HNYB 1S1TA 2FC0A 4KI4A 3QIPB 3OL7A 2IGIA 1ASVA 1S0OA 4NLUA 3L2RA 3IAYA 1WSGA 4DSLA 1RYRA 3TAGA 3K5NA 3RR7A 1VRUB 3L3UA 4KV8B 2E4LA 2JEJA 2GC8A 4EO8A 4M3YA 3AVAA 4IG0A 4WE1A 3OLBA 1IG9A 4LQ3A 3KKSA 2F8EX 1BIZA 1DLOB 3DRSA 1BISA 4NLDA 4KE5A 3BREA 2OPRB 4IOBA 4URSA 2V0NA 5C5JA 3VQ5A 4FLUA 2YKMB 3MFHA 3OS0A 1TV6A 2ETJA 4RNHA 4W5TA 1Q9YA 5HBMB 3KTQA 5F8MA 3ZT2A 4RNMA 1WSEA 4K50A 1D5AA 4KO0A 1JLAA 1WSIA 4DL2A 1HYZA 3WNGA 1UAXA 4LH5A 3E51A 4ECTA 1Z26A 4DTMA 1ITGA 3KD5E 4IRKA 3DLGA 4Q45A 3VA0A 3ZT1A 4HHTA 3OJUA 3IGVA 3QEWA 1HNVA 5DG7A 1KFDA 5JUMA 3JYTA 4DTXA 4KHYA 4DF8A 2IJFA 1SH3A 4YQWA 3AVKA 1NJYA 4M95A 3LWLA 1FKOA 3OJSA 3VQCA 2PYJA 1BQMB 2G8IA 3DRPB 5HRPA 4IG3A 5HP1B 1N4LA 1XHXA 5HLFB 2ILYA 3GIIA 1NKBA 1ZBUA 4DL7A 4DTSA 3DRRB 1Z25A 4DU3A 2ILZA 1D9DA 2P51A 3PJXA 1L3SA 4KTQA 1BGXT 3C95A 3IG1A 4FM2A 1QSSA 4XPEA 2IBKA 4ID5B 5KG3A 3QYYA 3LP1B 2GIRA 4AHVA 3LP2A 3QNNA 2IA6A 4J2AA 4KHUA 4HUEA 2EX3A
chains in the Genus database with same CATH superfamily
3N79A 2ZQBA 2LA4A 1WTFA 3NF7A 1YVNA 2P9PA 2KL8A 3C6TA 3P6YC 1U6ZA 4FW1A 1U47A 1WC0A 1T9XA 4UOGA 1SJFA 5ETMA 1IV0A 4U95A 4J9RA 5DGAA 3C6AA 3FGVA 2QN6B 2LYVA 2W2PP 2W9AA 1RT2B 4BCAA 3K17A 4WIIA 3TANA 5FIIA 4DR1F 4QOTA 2FHJA 4JI7J 2Q3SA 1FVSA 3BYRA 3QBXA 3HSCA 3W5ZA 3BGRA 4RKUC 2KJWA 3MM6B 3P39A 1RTJB 4JI4F 4TLRA 2RRAA 2XC9A 1UPPA 3CJBA 1HBUA 1W2IA 1X7VA 3OXGA 3WNFA 2ZBRA 5KI6A 5ETNA 2V8DA 4DTJA 1AA1B 2MQLA 2QLFB 2H65B 2HS0A 2GV1A 3OYKA 5KFGA 4CF1A 4ISFA 1K47A 4IJAA 2KO1A 4CJFA 4H4KA 1C4AA 2F9WA 2W01A 4ZPWR 4K4VA 1RHMB 2MZTA 4B1UB 3D6MB 5A0YA 2MQPA 3JAMO 3M8WA 1XIQA 1FDAA 3B82A 2IJRA 2P9NB 3UDVA 4JV5K 1S5ZA 4KGZB 2ZH3A 1VRUA 3FZKA 3N0VA 3MEKA 1V6HA 1WB9A 2EFQA 3DXSX 1JCEA 1FNOA 3K5MA 3VEZA 5ETVA 2DR7A 1WDTA 2V6AA 3K9JA 3FK4A 2AEJA 3CCQN 2YKPA 3L7PA 3SQOP 2BE2B 3RMBA 4ISGA 4CJPA 1ZA2B 2QL5B 1K8KA 1YJ9N 1CLQA 1HQUB 4CHZA 2ZGYA 1S9GB 3GP9A 3D2EB 1VSFA 4LF8F 2C42A 2VBYA 2UP1A 5J1EB 5IV4A 4E1JA 3T7ZA 4OKJA 1RBSA 2O8CA 4JKGA 2C2KB 4W5OA 3PW4A 4I2PB 2XHCA 2WB4A 4X4QA 4JKCA 2B3TB 3EN9A 4ELUA 1ILYA 5JS1A 3GJRB 4OX8A 4DV2F 3BY5A 2O67A 1JJHA 2Z1GA 3NNCA 3E01B 5AZJA 8ATCB 1OY6A 3MAQA 4BHQA 3W0LA 4M3WA 2ZNYA 1VLYA 4WFAL 4IR9A 4P73A 4YEAA 4ERDA 5DZ7A 1IJFB 1GTEA 1KRPA 2PFUA 1U0HA 4BC5A 4KAZA 1CBKA 4FZYA 5C24B 1B3TA 1XN9A 1KSPA 1P6TA 4C0BA 4Y2KA 4D3GA 4WK1A 4QR0A 1OYEA 3AVCA 5AQLA 4AYBD 1LOTB 1KOHA 2HRYA 3W9HA 4G1IA 1BQNB 1C0FA 4FKYA 2QT7A 2GAHC 4DF4A 2ATCB 2FY1A 2NPFA 2VUGA 3MM9A 1YTYA 2D1KA 4ILJA 2QK9A 5D0RA 2CPIA 5GMKa 5KFWA 3CJ3A 2ZH7A 4DV7K 4RG8A 2W24A 2YKNB 3CCMN 2R7SA 4B9UA 5KGXA 2CFXA 4F2SA 3W3SA 3IGNA 2CJ9A 3V6DA 1JWWA 4DR5K 4K25A 2P9LA 2ZD1A 4URQU 2AJ4A 2QXLA 2CQPA 1T44A 1L5UA 2J5AA 1IUJA 1NMNA 3J8AA 2FVSA 1RI7A 4V19J 4I69A 2P5OA 2VWKA 4OZ5A 3WNHA 5DM7L 4KH4A 2DGSA 1VR6A 4ZPDA 1CZAN 4DUYF 1ZC6A 1W25A 1BO5O 3NL0A 4XDCA 4X66K 3SCLE 1JLQA 2XMAA 4IQXA 5E41A 1CEZA 1ULRA 3U27A 3D68A 4UT4A 4ZHRB 5DM7Q 1TAUA 2YHXA 1WG5A 5HL7Q 1K73O 1L3TA 4DR7K 1JJ4A 1RTIB 1LWFB 2KH9A 2UXDK 1H3DA 5C7PA 5L1JA 2AU0A 2OANA 1KDNA 1KVAA 5JVHL 5KFKA 4YNQA 3MOJB 2GO9A 4DV6K 1OH7A 3MEGA 3MCSA 1RCOB 3JB9k 1FF2A 4RW8B 3TP2A 1FXDA 1UWBA 4KR0B 4WQ5C 2VG5A 2GVDA 4NWBA 1AFJA 4JV5J 2ZGZA 4KH6A 5JVHQ 4LF6F 1FHTA 1I5OB 2DNRA 2MHNA 3K5LA 4UOFA 1CPZA 2CNOB 1VQLN 2IVYA 3LPYA 3P5BP 4JI3F 3O3LA 3UKUB 5E3AA 4MYUA 4X64K 3BF1A 3FDSA 1WUAA 4K0KK 1OO0B 1MWZA 4NXMK 4GV9A 2LVWA 4EAHD 2AJQA 3KLEA 2HNZA 1NLVA 3SNNA 2WBRA 2NYHA 3UDEA 2XYHB 5BJRA 4ZCMA 2CQDA 3T3FA 3LDOA 1HW9A 4DQRA 3A8KA 2CG4A 2XS5A 4EP4A 5ADXA 5KFSA 3P49B 1FXRA 3SQGA 2IDOA 3B8HA 1WN7A 1VK8A 4XAKA 3ZLJA 1QE1A 1WG1A 2ZDPA 1CJUA 1ZXOA 2HMPA 2WBMA 2QLWA 1HPZA 4B8AB 3VGUA 4FNHA 4GKKF 3CERA 3LAKA 3BDEA 4H4OB 1XNRJ 3BPDA 4BC7A 3A2FA 1VK0A 3QWPA 1VQOS 1FRIA 4BR4A 4BRCA 1WHYA 1HRHA 4Q0BA 3CB4A 4ZPCA 5HSPA 3LUYA 2RU3A 5IV3A 4USJC 1ZBLA 2HS3A 3JAMY 3LA0A 1EX4A 4FO0A 3DDKA 3IP0A 3ZYYX 2QE5A 3HD1A 3Q86A 3ZSQA 1N5YA 1HI8A 2CQ1A 3O3HA 1RBOB 2GFFA 4OPJA 1Y5IB 4USUA 1V9OA 1H7WA 4U7BA 1U2VA 1NMEB 2ZKUA 4DX5A 5EWGA 2UUBK 3AVLA 1NSAA 3AJDA 3G4SN 1J5OA 2O8FA 4CEBA 1RT5A 3KJVB 3KLVA 4AHCA 1Q82T 2Z1HA 1ZETA 5BR8K 2D7SA 2QV6A 2YKAA 4J9LA 3P3DA 1Y9OA 3GYGA 1FNMA 2CJAA 3A8EA 3ILOA 4DOZA 5HMXA 2B9WA 3MEEA 3HJFA 4M7YA 5KFBA 3I55N 2HBLA 3D6FB 2EG1A 3KYLA 2HQCA 4YDUA 4C8ZA 4DV7J 2N3LA 1VHIA 1UTAA 2G1HA 4BLGA 5GAEP 5GAEU 4X4SA 3I6PA 2CYYA 2R7VA 2ZH9A 1URRA 1VC6A 2R3VA 4B3RF 2E6LA 3TJ9A 4NCGB 3C6HA 4DQ8A 4IOAL 3DHWC 3OUYB 2WSFC 3L2UA 3TAFA 2F1FA 2FSKA 3MMBB 1SIWB 1S1WB 3GBTA 4X62K 1T3NA 2VKZG 1GLAG 4OX7A 4EHUA 2IVNA 4PQUB 1HUXA 1SJQA 1V3ZA 4ED5A 1JLCA 1VSDA 3SPZA 1KC8T 3C14A 3EE9A 4OX9K 1WSRA 3TRGA 4PPDA 4JHDA 2DITA 4N76A 4X66J 4DSKA 2XMUA 1RFQA 4LBHA 1WF1A 1KHWA 2XY6A 3M6VA 4OI1A 1VQ8N 2A6MA 2BX6A 3HHNB 1VQYA 2B4PA 4DR7J 4HUGA 3L4IA 4LR9A 3HFKA 3IRWP 2UXDJ 2BGGA 1YJTA 1DTTB 3U4LA 4JKHA 4IZ9A 4P7TA 5DG8A 3UDLA 4DV6J 3THVA 3WQPA 5FPNA 2F3JA 4OZ1A 1RT7A 4U6PA 3ZC4A 3P45B 4EZ9A 2D0BA 1NGCA 2QIFA 3MF5A 1R0AA 5F9NA 1KD1T 4NB4A 3CCEN 2HSTA 5A8WB 1LEOA 4G6VB 1LK5A 1FRKA 3EDQB 5CD4H 2DT9A 4IH7A 2Y1JA 4M3XA 1HQ2A 1WELA 4FJJA 3VAKA 2CIMA 4QYRA 2YWKA 4F50A 4ECQA 1PBAA 4TYBA 4OX6A 3VGTA 4X64J 5T7LB 4K0KJ 4NXMJ 1ZM4A 2B56A 1QDUB 3B6BA 5I4MA 3NGRA 2ZC3A 2JH3A 3DLEB 5A2QU 1WI6A 2YKMA 1DBDA 1UEVA 4CZMA 1EETB 2IMOA 2ZZMA 1JXBA 4QIVA 1VS3A 1LW2B 2RB7A 5HQMA 4CI6A 3R97A 3OBYA 4DV3K 3UO0A 2AIRB 3TZYA 4CTAB 1RAJA 2RAQA 4FWKA 3CCVS 2E2PA 3PW2A 1UVNA 2O4IA 1YDLA 2AYBA 5CA5A 1EAYC 4F0KA 1BQMA 5AE1A 5MAOA 4TU7A 3KMSA 2YXLA 5HP1A 1I94K 2H9ZA 5HLFA 1IN0A 2KZZA 3CIPA 1T9YA 5J2PB 4K2JA 2R7OA 2YNHB 1R59O 4PEOA 2UUBJ 1MNEA 2IYIA 4J2BA 2OFGX 4PHTX 3ICLA 2JFDA 3VQ4A 5BR8J 1YKWA 2HQGA 2UV8G 2NZCA 1NG9A 1RUSA 3FBBA 4OLOA 2QKKA 1LWCB 5HATA 1TKDA 1QVGM 3ASMA 2QYGA 2J6TA 4F4ZA 3MM5B 4ELVA 2C1EB 1YIJN 2BOPA 3H5YA 4EMDA 2UUCK 4YOWA 4YHHJ 3FEYB 5F41A 3ZO7A 4CO1A 3KHRA 3E66A 1GXTA 4LF4K 2XMMA 3ZZYA 1FKAF 4ZVTB 2RRBA 4Y65A 3QEVA 2HHTA 3CEDA 1TUYA 2FSJA 3QO9B 1F2HA 1BCMA 4NEYA 3UDCA 4Q8FA 2XS2A 1SKRA 1ATRA 2GVZA 1F5BA 2EFVA 3RRHA 4DCPB 5J1NA 1S79A 5DDRC 3OLAA 3JSBA 1JLAB 1XQSC 2W7AA 3UWTA 3FKBA 4YORA 4F9OA 4Z4IA 1CQMA 4IFYA 3H45C 3EUNA 3RB3A 2J8AA 3G8QA 3OVBA 2HW3A 4QWAA 3A13A 2I6WA 3RBEA 3IR6B 2XI3A 4CHOA 1BL3A 2LU2A 1BMQB 1NDKA 1FKOB 3MUVP 2ASDA 4E8UA 3TA0A 4BR2A 2AF6A 4FKXA 3GE9A 4A8XA 1BG3A 2JZ5A 1NPKA 4K5RA 1N88A 2CUYA 3HHDA 2EI5A 1YSJA 3UVJB 2NRVA 4ZA1A 4RWWA 2KXFA 5E7OB 1VSMA 2AYMA 5DETA 4BACA 2IPOB 4RW4A 1VFJA 2XG8A 5KPTA 2DNYA 2CG8A 3LP2B 3W2WA 4IKAA 1X4BA 3ENBA 2M2BA 1VSJA 3POTB 5L39A 5B0DA 3M4XA 1FKPA 2BQUA 4OJGA 4M3TA 4GVBA 4EBDA 1NHUA 2HFNA 3GILA 2MLYA 3Q83A 2ALYB 3EZOA 4LRCA 4FXVA 1DTQA 1RTDB 2BJ3A 5E33A 2RUGA 3FBCA 4F02A 2E1CA 1U6BA 1H73A 1WG4A 4JKBA 4CHYA 3MUMP 4QU7A 1HJOA 1F3FA 5KFXA 3TAEA 2D3OR 4J37A 2GW8A 2W7OA 2CH5A 4OQJA 2E7VA 1IQZA 5DQHA 4KIAA 2J6UA 4ICLA 1NGAA 3ET6A 3PHTA 1GAOA 3TUPA 4ECXA 4CRJA 3J81j 3R3LA 1PG5B 1UJ5A 3H2LA 4DV3J 3TJAA 3CPWR 2OFHX 2G2ZA 2K3KA 3ZZPA 4LH4A 3F2KA 2MQMA 2FSNA 5HOOA 3QZ7A 3AGRA 4DFMA 2H54B 2E6MA 3TNVA 1RHUB 3IWNC 1FRMA 3OL8A 1ICEB 3MGJA 4A8WA 2XS7A 3ADAC 2QW9A 5EWFA 4Q8EA 2AMCB 3ZSVA 4AUKA 2HFOA 1HKAA 2W40A 1TL7A 2V67A 1FWKA 1I94J 1U24A 1IBKK 1YJWN 3ZZOA 4OZLA 3CQ8A 3HI0A 4RWTA 3H5UA 1HNXF 3W65A 3DWLA 3AO3A 2GIQA 3PG9A 3V9UA 4CBUA 2NRXA 2FHJD 4YY3K 2HG4A 1Q0NA 5L38A 5J2MA 7AT1B 4LF1A 3VAJA 3VQQA 4ED3A 3DXBA 1NDCA 4WXWA 3BR9A 3KLHB 3EE3A 2BR0A 2WONB 3FCWA 1S72N 1S7IA 1XI1A 2DYAA 2MZRA 5AZIB 3IR5B 5KT4A 3D6HB 2N82B 5EWEA 4CNYA 3DOMB 1UVJA 4CZFA 2DHXA 2MJNA 3CQYA 2Z56B 4OPAA 3PO5A 1V5VA 2E7WA 1F2GA 2KT5A 3L3CA 4ECYA 4R5PB 2UUCJ 1OQ3A 3DM2B 3BUZB 1N33F 3OQ2A 4FOIA 4YB5A 4LF4J 3JQJA 4OZNA 3ILJA 2FD2A 1Q86O 5FLXO 4QS9A 3CO9A 2YY3A 4CF8A 1R27B 5AQGA 4EUVA 3OHBA 1HBOA 3VQSA 4I6MA 4USTA 3NH2A 2XGQA 2VGNA 5LOQA 2VQEK 3CDUA 3FSYA 2YNGB 5B0AA 4J9SA 1K1SA 1RHJB 1XWLA 4WFNL 4JP8A 1KQSM 2E9TA 4O8KA 1ATSA 3TO8A 2QM1A 1SCJB 4U7CA 2QA4S 3MMAA 2HIYA 3VAHA 2GJIA 4EU0A 4F4KA 3QFUA 3KLIB 5HAOA 4RW9B 1S99A 4OGCA 3CETA 1C0TA 3X1LB 1MDUB 5H9FK 1N48A 1NK4A 3Q24A 1YXQA 1MROA 1IBMF 2G8HA 4DPXA 3CM5A 2XY7A 3BZKA 1IO2A 4CLTA 1YBTA 1TUUA 1H1VA 1WTBA 4OHWA 1DQ8A 4WFBQ 4JI6K 2CQ3A 1PILA 5CHCB 3TW0A 2YHBA 1UETA 4ZKAA 1S1UA 2YNFB 1U1MA 4CFDA 1JNRB 4ZVHA 3AD8C 3P1GA 3R5DA 2DIUA 1B70B 4WCEL 3OW2M 5LMNF 1VQPN 3CYMA 2PFDA 5FPDA 5I42A 4OLPA 3RYLA 2E29A 1TKZB 1RTZA 4E98A 3VGMA 3C6UB 3MCAB 1F5AA 5GAEI 1BWVA 3OTBA 3FFIB 1UA1A 4JK7A 3KOAA 4WCEQ 4DTRA 2CNNB 1P27B 3K5PA 1LW0B 3RRGA 1RLCL 3FRZA 4K8XA 3KJFB 3CSKA 4JI8K 2QLJB 3QT6A 2HRUA 1S7HA 4I56A 4MFBA 3TSQA 1R43A 2HEKA 4FVUA 1F1BB 3LF0A 3PRBA 3DHXA 1D9FA 1O51A 4RPFA 1BCOA 3OSNA 5F3TA 1E4GT 1UW4A 3GFXA 2FHMA 2MMYA 4M5JA 4O23A 4WZMA 2ACMA 3M30B 1UMJA 5AT1B 4WZQA 2JWLA 1YBAA 2DB1A 3WXMB 3D9BA 4FLTA 4H0TB 2E7XA 4RWXA 2HFZA 4YMEA 1HQEA 1MMNA 1BWEA 4DG1B 3VQ9A 5GIPA 1GLDG 2BTFA 1FVQA 4L3QA 3NWGA 4CJLA 1ATNA 5KFNA 3OR2B 4CJRA 2KYXA 2DXFA 1CJVB 3IN5A 3PM9A 3O5BA 1C1BA 3BO3A 1IBKJ 4ZVEA 2HHVA 3DOKA 2JL9A 3L0QA 3P96A 4KKOB 3TAMA 4BY9C 1W2BM 4LSLA 3WXKA 4JV5F 1NJZA 4RL1A 1KQKA 4BRDA 3FC9A 5C25B 5EU7A 4NA2A 5C12A 1D09B 3DI6B 5KFZA 3THYA 2B5JB 2K7JA 4YY3J 5SWMA 3CPEA 4FCYA 1IH7A 2A6AA 4KFBB 2ZNZA 4CLUA 2MZ1A 3ZNUA 1P9QC 4C8MA 4L6V3 5DJBA 4JK8A 3TUJC 1OSDA 4YN3B 1MWYA 3O9TA 4O5BA 2E1MC 3R7SB 5FPMA 1ZTTA 1WHWA 3RAQA 1JLEB 2ZHAA 4DU1A 4K8ZA 4RR5A 1L3KA 4TN2A 3AQOA 2A40A 2VJUA 4NO7A 3SMZA 4XDDA 3D28A 1R31A 1JQGA 4C97A 3DGPA 4F36A 4CBXA 1C0MA 1YQHA 1BUXA 1C1CB 3LAMA 1Q1KA 2XO6A 1WSHA 1RK8A 4O5FA 1KVIA 2VG7B 4IFVA 3OTOF 3C2PA 1RDRA 3VCDA 2ASPA 2GA7A 3CC2S 3BKUA 2ATLA 2HZAA 3NHGA 3E2EA 2MGZA 4LD0A 5L9XA 1UKUA 5IC6B 3RG6A 4LSNA 3AVJA 4I2QB 2G0JA 1MSWD 4NZ0A 3AA2A 4M5KA 1YHQS 4NCBA 4E3SA 2Y1IA 5AQHA 2VPWB 2RHKA 4J2DA 1SC6A 2AEFA 4B3SK 4CJEA 3RB4A 1FEHA 1FRJA 4PUOB 3AOAA 4DV1F 2YKQA 3SUPA 1SQEA 4H5TA 2CVEA 4QWCA 1IKXB 5IS2A 4JI6J 4CK1A 1VAZA 3V2UC 4I67A 4O3RA 5AQYA 2QC3A 5KFAA 2VFTA 2KHOA 4CBWA 4DV0K 4CW7B 4H0YB 3PRDA 3VZHA 1OPIA 4DMNA 1AFIA 2O4GA 1M1HA 2EXUA 4A61A 3OV7A 3F0NA 2MQQA 2MLXA 1C2PA 4FM1A 3QGIA 1G6BA 3LDQA 3SCKE 1SL2A 4WFYA 3BF3A 1K9MO 3NH1A 3SI8A 1VQMN 4W92B 3V4IA 4XH4A 1D4XA 5GIOA 2MZJA 4DR5F 4JI8J 3PHEA 3J81O 3JSMA 1SQFA 4OJ3A 3BR8A 5KT5A 3IAS9 4CE9A 2K06A 2Q79A 2HF3A 2ZUAA 1CJKB 2G8UA 1RBUA 3VQEA 3M8RA 1U1NA 3RZAA 4N41A 4CHPA 1J53A 3VMFB 3I5CA 3PCOB 1NMDA 4X4RA 5J2QA 1QQOA 4FJMA 2FJWA 1NGEA 3NEKA 5HMZA 3S1TA 5LY3A 2OPSB 4TQRA 1NJWA 7FDRA 4DSEA 1KXPA 4DR7F 4FZZA 5BPLA 1VQ6N 4IFEA 5LM7E 4U8VA 2FQQB 4JKAA 2DNQA 4BRKA 2CPZA 2VBWA 4AH9A 1IBLJ 4KREA 3US5A 2RDJA 1UPMB 3OTDA 3CF5L 2RQCA 1LKZA 1QM9A 4DV6F 4USVA 3A5LC 4PXDA 1EX8A 2XLKA 1A9NB 2R4FA 3RB6A 1S1XB 3HHLA 1OWXA 3MWPA 2EC2A 2VG6A 3G8SA 3OVSA 1GOBA 2VD3A 3W63A 1HKGA 3CF5Q 2IJNA 3Q8PB 3N5FA 3Q7BA 5AFUA 4ETXA 3QIPB 2Q1NA 1ASVA 2BOAA 5M1KA 2DR6A 3QGPA 5AQOA 1VRUB 4KV8B 2M7SA 3ZETB 1GLJO 4EO8A 3JAMU 4NXMF 2YKOA 4WE1A 5DRKA 1H2UX 4H0XB 4WTOB 4JYAK 1DLOB 3IR7B 1BIZA 3MM7B 3BREA 4HT7A 1B7YB 2V0NA 3VQ5A 2IRXA 2H5IB 4RNHA 4Y2IA 1Q9YA 3JQMA 1GK8A 1N32K 3WUHA 3P31A 1VBZA 3HZGA 4K50A 4BGAA 1S22A 1HYZA 4MDAA 4QIWD 2VJVA 4DTMA 1ITGA 1R6YA 4Q45A 4C11A 4KGMA 3G6ES 3IDHA 2QFJA 2VICA 4HHTA 2V7ZA 4JKGB 3O1WA 2VOOA 3TSUA 4FXWA 1RLDA 3I96A 3AARA 3ATUA 4G65A 2VDHA 4L72B 3M1VA 3X3UA 1P90A 4M95A 3O9RA 3I56N 1VOMA 2XZTB 3DRPB 1VQ4S 2VODA 2P9CA 1RBLA 5AQJA 3QT7A 3DXKB 4IEEA 3CJQA 4IG3A 3VV2B 2KYZA 4A8FA 1N4LA 2PA3A 1XHXA 3UD5A 4Y6IA 4IWVA 5EHHA 2LQBA 2ILYA 2XMVA 5KPZA 3GIIA 3NLCA 1ZBUA 4GO5X 3DRRB 5AQFA 4B3SJ 4DU3A 2YWGA 1WORA 4KTQA 1NPPA 3C95A 5BYQA 3IG1A 4KGVB 2PEHA 5BR8F 1XNQF 2DBBA 4ZJOA 2GIFA 4DV0J 3GONA 5C2FA 3NNAA 4DXLA 3M6WA 3AODA 5GAGP 1Y3JA 4HUEA 3MMCA 5AXKA 4GKJF 4DI6A 2DHAA 2B6AB 4HACB 4GC6A 2O8EA 1CXUA 5FDLB 4NEZA 4M5DB 1HMVA 4JI4K 5GINA 1YITN 1RU1A 4RNOA 3HI9A 3T5JA 2HFSA 1RKIA 3QMLA 1FE4A 2FJXA 2FVCA 4J9UE 3EXYA 4CI0B 3BF4A 3Q8QB 1KFSA 1TL1B 1F60B 3H3NO 3PW5A 3TEGA 1QQNA 3CXCM 2DH8A 2QFIA 4CLLA 2DPNA 4CGHA 3SDEB 2KFZA 3HSGA 2GZOA 2CQGA 2D0AA 5E26A 4X62F 1CC8A 2ALZA 4W90B 3LWMA 1R6VA 1Q81T 2P9LB 1VQLS 2C2MB 1U02A 2ZD1B 5G0RB 4C9DA 2UUTA 4JUZA 2FLOA 2A1SA 1UZHA 2R42A 3CCZA 2OELA 4NI2B 2PI4A 4BGBA 4OX9F 3A3OB 3V9ZA 4L73A 4Q44A 2C22A 1IVZA 1S1VB 4K41A 4ZTJA 1EP4A 1JLGA 3PEHA 1BI4B 2Q1LA 3CCUN 1RT4B 2FF3B 2DFEA 3QRRA 2J9CA 1IKYA 1RT3B 2GMJA 1NK5A 1X0PA 3G82B 3NE6A 3OYFA 4LF8K 4ZVSB 4ED4A 4QBUA 3BS9A 2YX6A 4J8FA 2V69A 3VVTA 3CFOA 1NKEA 4LRFA 2Q31A 3DXMB 2V7YA 5K8OA 4JV1A 4I1TA 3FEXB 3TVKA 2OCEA 1ZPWX 3SIPB 4O0IA 1S57A 4DV2K 5C42B 3HT3A 3QNWB 3ZT0A 2MLZA 4JS5A 2QMXA 2Q66A 2F4FA 2BJEA 1ZAVA 2QYCA 4QWEA 3W3DA 5HBMA 2UU9F 3MEGB 1N6QB 1BWFO 1PO6A 2DGXA 4C8YA 3J81Y 2H4YB 4DB3A 3PJ9A 2XMWA 1RTHA 3ZSOA 3DLKA 4K4YA 1VQ5N 2VG5B 3U8XA 2Z30B 4YOUA 1ELOA 3FFKB 3GDQA 3KDNA 1Y11A 2NLXA 5HANA 2ZUGA 2AP6A 4JYAJ 5KFVA 3GJTB 4L76A 1NK0A 1GMUA 5KRSA 1NK9A 2OTJN 2U2FA 2X6SA 4BROA 2P9GA 4G1PA 1REVB 3UKRB 3CGIA 3QB0A 2HWIA 3ZX2A 1CS4A 4DR3F 3HK2A 3ULDA 2HNDA 1RHRB 3WXLA 3NKYA 2C2NA 2Y8YA 4DV3F 4LVNP 1PCAA 5ETLA 2A0FB 4BRFA 3H5XA 2VWJA 4MKAA 5F8JA 4C4WA 3CJSA 2IOCA 4ZP9A 2CNLB 1RZMA 5E5NA 3OYIA 2P5GA 4QIFA 4CO0A 2IIHA 2QMUB 1YJRA 1G1XA 2KKZA 5J2NA 3Q7CA 3PIPL 5LJ5Y 1NLKL 1RT1B 4A62A 3MAAB 2NREA 3MM8B 1O13A 1WJ9A 4DV5F 3FZHA 1KLMB 3MR2A 1JLFA 1HA1A 1LWXA 2MY7A 2DFFA 4O4GA 2DY4A 2XTJP 4FSVA 2EFGA 1EHWA 3ETMA 1ZTWA 3JQKA 1ITPA 1YJVA 2JEIA 3GFZA 1RCHA 2M3DA 4JOUA 3PIPQ 3QLHB 2W9CA 4WQ5A 1SUQB 2OTLN 4DHYA 3KG1A 1S4EA 4IYQA 4YS2A 1RT6B 4FJKA 3R3TA 4B9LA 2PA8D 1RAAB 3NWRA 3MXHP 3O3GA 1WOPA 2A6OA 4PZVA 2RKIB 4JI4J 3CCLN 1GNKA 4LF4F 5KQDA 4FPBA 3AT1B 5D0GA 3HVTB 4EFAC 2WTFA 3CJ5A 4X4VA 1YX2A 1LV5A 2P9SB 5E3CA 4E7IA 1T3OA 1DQAA 3K7RA 4LSZB 2C2ZB 1YWXA 2BKOA 1CVJA 2QWPA 1VSIA 4C7QA 2NXNA 3IS9B 2KHDA 2LEAA 3DYAA 2CPJA 1TUWA 3F9KA 3IBFB 3QPIA 1BA1A 1M1GA 4Z94A 2BM0A 4B9SA 3U9ZA 4LF6K 5KFTA 2V2ZA 4V1Ak 3AOCA 3NRBA 4QAGA 3AA5X 3QDKA 4JI3K 4CGGA 4Y0FA 2IAJB 5IXUA 3LP0A 2D74B 1TUGB 2E2OA 2JOQA 3FEZA 2RQMA 4O44B 1O8BA 4R25A 4DCJB 2RILA 4ZVRB 1W0HA 3ZSWA 4B17A 4LF8J 3M9MB 4H5VA 4Z4CA 4AL6A 5AXMA 1NU4A 4DR2F 1DZ5A 2F4VF 2NQPA 4FJIA 4FWQA 3OT9A 2HQDA 4EYHB 2R7TA 3M8PB 1LCUA 3NS5A 5HVHA 3MECB 2BQ3A 5KG7A 1T02A 3HD2A 5B08A 1K0TA 4ED8A 5MLCV 1FCAA 4DV2J 4MT1A 4DX8H 2OSQA 4RU9A 4LY7A 4ED0A 4WU3A 4KHQA 1VRTA 1EB0A 3H6EA 1NZAA 3QGGA 3ZSYA 4OI6A 1N0UA 3GTYX 5B8HA 3B6PA 2OD4A 3VEVA 2MKJA 2H1YA 1MMLA 1DQ9A 4MYTA 5M1QA 1QD1A 3MDFA 4PG7A 4P75A 4NLBA 2XHBA 3PKYA 1M1KT 1S48A 1YLXA 1NOZA 3R27A 4RW6A 2GMLA 3AQPA 1YRXA 4FBTA 4RLEA 2KRBA 2VYPA 1F9HA 1IR2A 1BY9A 4IO1A 4LJMA 1FRLA 3VAMA 5IM0B 3KK2B 1QQMA 1N54B 3K59A 2NUBA 1HNIB 4QR2A 3R8EA 4OYMA 1WKJA 3U1LA 4EIAA 4A8OA 3D45A 4R8UB 3UFCX 3LQVA 5BXIA 2CPYA 4HWIA 1RJJA 5AQMA 5HJYA 2B51A 3KUEA 3C15B 3MFIA 4KHRA 4QYZK 4IO9L 4NMLA 1VQNN 3V81A 2WOMB 2C2RA 3R1LA 4B3RK 2NRTA 2G13A 2ZJQL 3JTPA 1NSKL 4JV0A 2F96A 4ECZA 2XYPB 3VF0B 5DO2A 2FB0A 3CJCA 3JS9A 3WBZA 2QWMA 4YP3A 3MMJA 2RF2B 4IO9Q 1S5JA 1Q82O 2D3ZA 4KTZA 3A3PB 5CYMB 2DNKA 2KVQE 2ZJQQ 3MK6A 3HHKA 4FZXC 1YG0A 2K3IA 2DGUA 3M8QA 1Y64A 1XBWA 1C1AA 4MQ3A 2WVEA 1RACB 3C16A 2LKZA 3UN3A 5KFHA 1Q8LA 5BRDA 1HI0P 1KQFB 2LSNA 2W4DA 3QFWA 3CC7N 4QWBA 3P5TL 4DPTA 4FDFA 1QUVA 2W25A 1S0NA 1EARA 5D4PA 1SB6A 1AUSL 1SV5A 2E9RX 3O9QA 4CZKA 3FUYA 4N8OA 2ZH5A 4KHNA 2YHYA 4XPCA 2VQEF 1ZH5A 2L9WA 4AFFA 1NGIA 3NAIA 4CIFA 4FYDA 2B4OA 2QA4G 3MEDA 2BV3A 4LF5F 3I0RA 4OV1A 2M0GB 5BYRA 2BEFA 1UAWA 2I8EA 4AM6A 4LF6J 1KC8O 4IOCQ 3ITHA 2EG2A 3ZX3A 4PG5A 4CEDA 3AJ2A 2MSSA 1FK9A 1QTNB 2XGPA 1ZYQA 3QMQA 4GC7A 4JI3J 4DZ6A 3M05A 2D9OA 5AQRA 2QTWA 2VA3A 2OPPB 4ZJQA 4FVMA 5BREA 2OZMA 4C8LA 1S6OA 1FJGK 1TKTA 3KWGA 5LXYA 3W8GA 1MA9B 1ZZFA 2WHOA 2Q97A 4JI6F 4NLWA 4OFZA 5KFLA 4WKYA 1QQCA 2ROEA 2MB0B 3ZTPA 2PSZA 1NU0A 1UFKA 3B6OA 2V4QA 4PKIA 2XSJB 4DLGA 5HROB 1J9AA 5GAGI 4K59A 1QVGR 2RH3A 2B9YA 3NGIA 4PG4A 3W61A 3GIJA 1KD1O 3L3VA 4NZ6A 4S0MA 3PVXA 1MN7A 3WQUA 3W1YC 1KVCA 1H2VZ 3CDBA 4RNFA 1YJWS 3L8BA 3W2WB 2OPRA 3IBWA 2DGQA 2RSQA 2FZKB 1E6YB 3W9JA 3C7NA 3HPGA 3ZNJ1 1RWOB 2YX4A 3UR0A 5HK4A 3NMAA 3RRKA 2V5HG 5G4DA 2CA9A 3S9HA 1R0BG 3BH7B 3ULEB 3O44A 3VEWA 2ROGA 2RE1A 4NYPA 2HHHF 2FY8A 3HKWA 2XNQA 1S72S 2KFNA 4URGA 1NJIT 3KVGA 3SUNA 2AW0A 3ENOA 1Q8IA 3FJ2A 4PG8A 3QQCD 3NGUA 2AX0A 5D6GA 2DRAA 5DM6L 1FESA 5AQQA 1FD8A 2N4CA 4CYUB 3HJVA 3GZ7A 3D0PA 1C4CA 4V19X 3CJ4A 3ET6B 3T5HA 3ZSRA 1TQLA 4OZJA 2VC1A 4OYWA 2ADCA 3M2UA 1T9WA 1RYSA 4WJBA 3TR5A 3KJNB 5IFMA 2V8VA 3SAGA 2DHGA 3HZ6A 5HQLA 4H4KC 5DM6Q 3KKFA 2WTUA 4PCQA 3PY8A 5D77A 4QYZJ 1QAIA 2HVEA 5LJVA 4B3RJ 2O8DA 4CERA 4ID5A 4B3MF 4CJSA 4FZVA 3LP1A 5GVQA 1N34F 3L6QA 4PA1A 2D0CA 3OS1A 4CIEA 4JBCA 3THXA 3U7JA 2DXDA 3SI6A 2RQKA 1SXLA 3IWLA 3KIOA 3TR8A 4CP5A 3QFHA 5RUBA 1ZAWA 5M1NA 3V6HA 5BN8A 5KFRA 2GELA 2MKHA 4MO5A 3FGUA 3CG7A 4IG0B 2KM8B 4UQGA 2JGUA 4E2FB 2J4RA 3CCJN 2Q0RA 5EOYA 3LPUA 3ZTSA 4JS4A 2BYCA 1TV6B 5AQXA 1K44A 3RMDA 2CGJA 3MWBA 4TYAA 1BIUA 1VQ9N 3J7ZT 3D54A 4Z7CA 1QSLA 4YB1P 4WU2A 5DK5A 1SS6A 4X4NA 3SQ1A 1PYTA 4KO0B 3ATVA 3N01A 4OI4A 3ZZZA 3MM6A 3GR1A 1RTJA 5CQGA 4BRLA 4AL5A 1RBTA 1B9DA 2HBMA 4XO0A 1N5VA 1BHNA 4NL5A 1AW0A 3VTHA 1YUWA 1U45A 2BRLA 4BDPA 2HQFA 3EGVA 3JYTB 1NZ8A 3CMQA 1T94A 2YCHA 2MSTA 2V51B 1WHVA 4GNIA 1ZBSA 3RMAA 1TK5A 2W2NP 4KHMA 2E5IA 1YI2N 1H72C 3V9WA 4OYOA 1J27A 3W66A 3QFPA 2AV5A 1ZBIA 2HK2A 2DFHA 5ADXH 1TL5A 1YJNN 3RWUA 2P9NA 2LLZA 1WSFA 3L9ZA 2RN2A 4C98A 3D2FB 4FXDA 2YBVA 3FR0A 1WC6A 4WKRA 4C3KA 4DV0F 4FWOA 3W64A 2GGPB 2J6SA 2BE2A 4OYAA 4NMXA 2E5GA 1RWUA 3FBFA 1HD1A 1AYEA 4FWNA 2Q6BA 1HQUA 3MN9A 1OY8A 5LJWA 2VBXA 4CH0S 1S9GA 4KRWA 3ENAA 2WAQD 3D2EA 1EXQA 1HNZK 5JJBA 3BB5A 2NRRA 3SBGA 1X4EA 4XH5A 5E3PA 1RABB 2VFUA 2YWFA 4MKVA 2P1JA 2EC0A 3OFGA 3AD7C 4LR7A 1UP1A 4I2PA 2FDNA 5KFOA 4NLCA 3AA3A 2RUSA 4C2MA 1EJ7L 1QAJA 1RE1B 1JXEA 3ONQA 3J7YI 1K8AO 3NOCA 3MD1A 3KMQA 3KLFB 3CJ9A 3AA8A 1HYVA 2WSEC 3E01A 3TWZA 4E7HA 1DHMA 3V1QA 1SKSA 5EN1A 2IM3A 1SL1A 1X3MA 3FLCO 1HNXK 1IWAA 2WW4A 3P8BB 2PEBA 1M5OC 3TA2A 3VESA 3Q8YA 1YJ7A 2ASLA 2QO3A 2QSWA 2L3MA 4HH1A 2ASYA 3SQ0A 3C66A 4CEZA 2EEYA 2ZHOA 4EK2A 5C24A 1X5TA 1OH8A 4UW2A 4FP9A 1JL2A 1EKRA 4CLWA 1RA6A 3NGTA 3H4BA 3FZLA 5D4LA 4K4TA 4RZRA 4BC2A 2NZTA 2VQFF 1CZ9A 1WOSA 3HMJG 1GLCG 1BQNA 1N33K 2F9DA 2NNWA 3DLJA 2XMKA 4C8OA 2XWXA 4BC9A 3B4MA 2HZVA 2CPHA 2MQ8A 2HK3A 3OW2R 3RUBL 1T05B 2YKNA 4FJLA 4CO2A 4D3HA 2W2QP 2YHWA 1CZBA 2QZ8A 2GBZA 4DR6F 2LP4A 2WVCA 5JVGQ 2E44A 5CYQA 2LECA 3QGHA 1KR4A 4CM2A 4W4MA 4MIWA 2V8GA 2XM3A 3MD3A 3TEHB 2VV5A 1X3NA 1D1UA 3F41A 2QSFA 1G99A 2OEJA 2ZE2B 2DR5A 2J8SA 4CVNE 1IBMK 4CO5A 1Q16B 4WYWA 4B9NA 3I32A 1WAFA 3BGFA 2KG1A 1B9FA 2W6LA 1N32F 1GX5A 5HVGA 3DN9A 2IHR1 2VPZB 3WT0A 1HWLA 4ES1A 2XLIA 2HWHA 2QJ3A 2OJ3A 2A1BA 1UVMA 2L48A 3NF9A 4XEIA 4YR3A 5TKYA 2O66A 5LMNK 1LOUA 3MR7A 4Z4GA 3G25A 3GIKA 1VQMS 1RTIA 1LWFA 5IOLA 3ENQA 3SK3A 3CIZA 4NYNA 1FO1A 4A57A 2HGMA 3EPGA 4IDKB 2UXCK 2GEMA 4PXEA 3W2VB 4CWBA 1VI7A 1BQXA 3U02A 3TUIC 2HBJA 2DNOA 1R8AA 3QT8A 4HL9A 1U49A 4O3QA 3TPQA 4RW8A 5I3PA 4I9QA 3WIVA 4Q7AA 2POKA 2GHVC 5KGWA 3AXMA 4CM0A 1G4CA 2KJVA 2K8GA 3R7NB 2I5JA 4F0HA 3CD0A 2HVDA 1BXNA 5EXWA 3NDKA 3SUOA 1UJ4A 4OJ1A 3T5LA 5M1OA 5ETRA 4L75A 2RPIA 3UKUA 1TFWA 4ECUA 3A8IA 1DT9A 2OKQA 3CTRA 1O6XA 1LAWA 2HHWA 1R8CA 4ZN3A 1VQ6S 3UPFA 4LFBK 2AZ3A 1KWMA 1FD2A 1VQKN 4X4OA 2AT1B 4LQ9A 1WOOA 3LOUA 1IKVB 3CJTA 4CZEA 4ILRA 2SXLA 5BN9A 4ED2A 2IRUA 2OD6A 2XYGB 2FJEB 4CESA 2ZOMA 4H4OA 2HVHA 1V4SA 4KY3A 4DL3A 1N8RT 5HMYA 4ECWA 2EVZA 4NXNK 4QPTA 5F1XA 1AROP 3IFRA 2XMTA 2R7WA 1HNXJ 3AAQA 1OH5A 1GFWB 2IIRA 2AJ1A 3ALYA 4CF9A 5ETOA 4PQAA 2X74A 4ZTFA 4M63C 2CDRB 2Z2YB 4OZ2A 3J81U 1SC1B 2DY1A 1AZSB 4WIQA 2QG9B 3Q2SC 1FWPA 2WRMA 5J2QB 3KJVA 1U2RA 3QETA 5L1KA 1MU2B 4MH8A 4CJ4A 1D8YA 3U9DA 1RXOB 3HZEA 1N33J 2FTRA 1RA7A 4FM0A 3AVMA 5DZ6A 5KFCA 3RW6A 3V5RA 4ER8A 4LRAA 4F2RA 4FJ8A 4WQ4A 5KG6A 2M5YA 3IO1A 1N56A 3WX8A 5K14B 3D1QA 4LR8A 1BOTO 3OTOK 2V9KA 4DU8A 2B9XA 3R7BB 3FSXA 4BWMA 3H5SA 4CO4A 3HHLB 4NCGA 4C3LA 1Q9XA 3HTVA 1TL3B 1XMQF 2R2UA 3OUYA 3DLBA 3MMBA 1E6VB 1S1WA 1YRUA 3AOBA 5FRMA 3PDNA 1GEHA 2PFFB 4KHSA 3CJRA 4FK0A 4BREA 2LQ8A 4PQUA 2JLFA 2DHSA 1IBMJ 3VWSA 4DV1K 4ILLA 4I7FB 4UOCA 1JX4A 5I3UB 2GO8A 2YQ0A 4H8KA 3K58A 4J9QA 1U0SA 5SZTA 2W8KA 3UNGC 4QS7A 1PBUA 1YITS 1YAGA 2E88A 3VAIA 4HVZA 4LFCF 1KKHA 3NGDA 5LMNJ 3TOQA 1S6QB 1AUDA 4DJBA 4PWDB 1WDDA 4XTTA 4FK4A 1DTTA 2W2MP 2ZWHA 1I3OB 2XZDB 1SJ1A 4OYBA 4CLFA 3MAHA 3GR0A 2UXCJ 1F6TA 1PJ6A 3S3MA 2AEMA 4QW9A 1XMOK 5CCLA 2EFNA 3LALA 4A8YA 1CLFA 5HN0A 2CJXB 2ASJA 2M8HA 3QICA 3CULA 5A8WA 4IG3B 4OIXA 5HRRA 4KPYA 2P9UB 2QWNA 2QTDA 2IDEA 2DCUB 3GIMA 2GWKA 2PE8A 3D3CJ 4LF9K 1WAJA 1A6LA 3VQAA 5HL7L 1D0EA 1QAYA 3E3XA 1T95A 1RP5A 3NOGA 4FJGA 4JI2F 1ZBFA 4Y0WA 4LFBJ 3DLEA 4MLHA 1GMVA 1OSCA 3HM8A 5ITHA 5F0XA 4DN9A 4BC4A 2H3EB 3WEEB 3A1YG 1EETA 2NRHA 2CPXA 4TU9A 1LW2A 4A8KA 1HWKA 2MYFA 4CF2A 1WKLA 2ZDOA 1B0VA 1JCGA 5AQVA 2XRIA 3VR1A 3K2YA 1CJTB 2KDOA 4CTAA 4YOVA 3PX4A 2UVRA 3VQBA 3E9PA 3CMAN 2OPQB 3EVWA 4DU7A 3KHGA 4F4YA 1VQ5S 4AE5A 1DJ0A 3CD6N 2A18A 5L8RC 4EO6A 2GX9A 1KONA 4WFXA 3MPWA 1JNZB 1M5VC 2VDIA 1HNWK 5J2PA 2EWSA 2YNHA 1HHSA 3FMWA 3RSEB 4JKEA 4O55A 2VKRA 3A5NC 1TVRB 2ACYA 3VAFA 3O6QA 3SMPA 4AQYK 2C28A 3W62A 5AQWA 4UTGA 1HBNB 4H4MB 3N6LA 5B0CA 1LWCA 1VLOA 4G9ZA 3MM5A 1S1TA 2FC0A 3VTIA 1S0OA 2DO4A 3FZBA 3IAYA 4DSLA 1RYRA 3TAGA 5DDPC 1DEJA 1M0SA 3L3UA 4ILMA 2JEJA 4OYXA 3OTOJ 4DMZA 3OLBA 1IG9A 2VWBA 4KE5A 2KFYA 5MLCQ 2JNJA 4FLUA 5A6WA 3OS0A 2YWHA 1NBWA 1G3OA 2ZH6A 4IJNA 3HFZB 1U1PA 3VERA 3CXCR 2MZSA 4CZIA 3CJ7A 5HBMB 3LM9A 4JN4A 2J0SD 3ZT2A 3EE8A 2Z57B 3S8SA 2WB1D 1JLAA 1D8ZA 3WNGA 1UAXA 4LH5A 4ECTA 2J0WA 2NPIA 1J5EF 4CD1A 4P2MA 4IRKA 3IWXA 4DV1J 3MX5A 5LT5A 2M8DB 1YF5L 4DTXA 4C1NK 4JI5K 2MKYA 2Q0UA 3CJAA 2X3GA 2P5VA 4YQWA 4WK3A 1X9JA 4BQZA 3AVKA 1XNQK 4OZ3A 3LWLA 1FKOA 4B1XB 3OJSA 3AGKA 5CHIA 4DUZK 2PYJA 3CCLS 2G8IA 1H98A 5I3QA 4AL7A 3D6RA 3PYEA 4GKJK 2B4UA 4B1ZA 1HFEL 1U1OA 2DHHA 1VC5A 3KWMA 3UVJA 4DTSA 1OJ4A 4WBFA 1Z25A 3GU0A 2OEKA 2FPHX 2FIUA 2VF3A 1L3SA 2W1BA 5AJ3F 2V2KA 1QSSA 4JEPA 2CQHA 1XMOJ 3Q2TC 1YJUA 2D9PA 3W5YA 2GIRA 3LP2A 2J7WA 4DR5J 3Q0AA 2IA6A 1UEUA 3CJ1A 1TYQB 3VF4A 4J2AA 5E3QA 2VASA 2EX3A 3PRVA 1Q78A 4F3TA 3TTFA 2OH2A 2UVUA 2KM8C 1X9WA 1FX4A 4EGLA 1UOCA 3VVUA 1PC4A 1RTDA 3NVKA 2F5GA 4IR1A 1NH7A 4MJKA 1ZBTA 2V34A 1Z2ZA 4LF2A 3OY9A 4LRBA 3ZEUB 3CJKB 2OIHA 2RS2A 3I8BA 1TK0A 1F21A 2DJWA 2ZWOA 3HOTA 1W9HA 4RUAA 2HHSA 4B3OA 3FMBA 3W60A 2K1RB 3CM6A 4CDIA 4JD2B 1T7PA 1Z4UA 2DGWA 3VQ8A 4Z4HA 3TSPA 4CJVA 1UA0A 3AB2B 1TKXA 2ZBPA 1SVDA 2UU9K 1U09A 1RDUA 3T6JA 1X9MA 5D3GB 1TELA 2G8KA 4GY2B 3HVRA 3J7A1 4NLTA 4DCHA 1HNWJ 1RKJA 2XWYA 1CQNA 3S3OA 2JHEA 3HCXA 1FJGF 1AB8A 5KOXA 3D4JA 4LIRA 3UN2A 2LEPA 4HDGA 4AQYJ 2KG0A 4LREA 3PX6A 2MTLA 2Z8QA 3KLHA 1SQGA 2WONA 3R6GB 1UCNA 3AJ1A 5AZIA 3WXIA 1S0MA 3QEIA 1HHQA 3FZMA 4TQSA 2UUAF 5F2RA 3DOMA 2QRRA 2HHPA 4K4ZA 3MTKA 4DR3K 4H0OA 4W5NA 1OVYA 2GHPA 4R5PA 3SCIE 3DM2A 1EQYA 3HP9A 2MQNA 1P1TA 5B09A 3UB5A 5KT2A 3CQXA 4JK9A 3WC2A 2OGUA 2X1FA 2G2YA 2ZM6F 5A8KB 2W4PA 1UWAA 4EEYA 3QJPA 3HVAA 4WPAA 1VQNS 2F63A 1RB0A 4CFCA 3K0SA 5KFUA 3UW1A 2B7CB 1C0UB 4ILHA 5LMUK 2R2RA 4TVAB 3BBCA 2M70A 5KG2A 4LRDA 1JJCB 4Q5VA 2YNGA 3PR4A 2W2OP 4DV5K 3H4DA 2G8FA 5EY4A 4EP5A 1OQ6A 4DL5A 1R89A 4P9SA 1CXQA 3VGKA 3WNEA 3HPHA 3N5BA 3KLIA 3QRPA 3L2WA 2PBDA 3AV9A 4RW9A 4JI5J 3GV5B 1GXLA 1XNQJ 4P2FA 1GLFO 4LBPA 3OHAA 3ZTQA 3TABA 2HVZA 3RAXA 4OMFG 4DUZJ 2XY5A 3OR1B 4RW6B 3M2VB 2BRKA 4O3OA 5B0BA 4QPXA 2VONA 2HHQA 2YJEA 4EFHA 1LAVA 4OHVA 3IFEA 4GKJJ 4RO0A 2B7BB 4I68A 3O1LA 3D1HA 4I6WA 2M52A 3H1VX 2YNFA 3OYAA 3AFGA 1UJ6A 5EX5A 2G1DA 4PKGA 3I87A 1EIYB 1FDBA 4ECSA 1OKJA 2KKHA 1NOYA 5KFQA 1RISA 4H5WA 1R3NA 1WSJA 1F9FA 4M41A 3OFFA 4NLVA 2XBPA 1S9FA 3MUTP 1TKZA 3BKFA 3HBTA 1JLBB 4PPZA 3C6UA 2F9TA 2CVIA 1WC4A 3FFIA 4FF1A 4X62J 4WP8A 4J9PA 4G1QB 1FW6A 2QX0A 3J80O 2ZBQA 4G3IA 1LW0A 3C65A 4O8UA 3VN5A 3THWB 4QCLA 1Y0HA 1R0CB 4NPOA 5JLFA 5M1FA 2MJUA 2Z0GA 3KHYA 4OX9J 3M7VA 2ITGA 2V52B 1PAEX 1VBYA 2R2TA 2W9BB 3SUQA 2AYGA 4J9NA 2QA4N 2A3JA 3LO3A 2I9SA 2FJVA 3M8QB 1HL6A 2GUIA 1RGIA 3CFPA 3AO1A 3V6KA 1U1LA 4CEFA 5AQPA 3RVCA 1KQGB 3M30A 4ZP6A 4ZPVR 2FVQA 2P2CB 3PYGA 4CZJA 3NNHA 2JEFA 3Q22A 4DR2K 2F4VK 3DFEA 3OYMA 1RWWB 5AFUH 3AVHA 2R8JA 1GLLO 3AAPA 3LDSA 4KHWA 1NRKA 3SYZA 2EFPA 4AXIA 3QT5A 5LJ3Y 1PAUB 1SL0A 3RR8A 5K9FA 1ZOTA 4O3NA 2V4RA 3BEGB 4USWA 4E0DA 3OR2A 4DSIA 3QSYB 3QSIA 1CJVA 3D7EO 2UU9J 1TMJA 3GJQB 4BE0A 3M8SA 2VH7A 2GWJA 1T03B 2CPEA 3IM9A 2CXEA 1Y3KA 1S97A 2YVSA 2EBGA 3T9NA 3P83D 4KB0A 5KG5A 5C25A 5KRTA 3GJSB 2IA0A 2DGOA 3DI6A 2B5JA 4GV3A 3T9ZA 1Q5YA 4ZVUB 3OFEA 3VGSA 3MI7X 4KFBA 2QWRA 4CFBA 1AXQA 1HYSB 2E5HA 2DPJA 1P8ZA 3ZZUA 2IC3B 1IR0A 3DC2A 2F9JA 1HNZF 4DR3J 2HMIB 1VYAA 4F8RA 3NP5A 2B43A 1PGZA 2NRWA 3SSSA 1GOCA 1RBVA 1ZA1B 2Y3YA 3KUGA 1B92A 3I9ZA 5M2UA 1C1CA 4IRCA 4ZMMA 2DNNA 1X0FA 4M3ZA 1Q95G 5LMUJ 2RHQB 2P9KB 2D0PA 2VG7A 1S6PB 3KK1B 1LWEB 3PJWA 3TA1A 5KT3A 4CLYA 4FJHA 3K2PA 1X8DA 2AYEA 4ED1A 5BPNA 4DV5J 1M1KO 3K57A 3PYDA 1O0PA 1TGOA 5F0UA 2WK4A 3N4QA 4LF7F 1LFWA 4I2QA 1FDDA 2B9EA 1T9UA 2EPIA 2OUGA 4FJ5A 4XK8C 4YR0A 4F25A 4BE1A 2W6KA 4GMKA 1SC3B 5AQSA 4RCHA 2E5LF 3V1OA 2D3UA 4BRAA 2PY5A 1NWKA 4PUOA 4UY8T 4HHHA 1HBMB 2EBEA 2PMWA 3PKMA 1WHXA 3HT0A 2YNIB 1IKXA 2ZZNA 1NGBA 2Y0BB 3BBFA 1IM4A 2HBKA 4OKKA 2LA6A 2C3YA 2O8BB 2PZSA 2D41A 2CH6A 3AH6A 3VPZA 3IKMA 2WW8A 1X4HA 1ZZNA 5D15A 2CQBA 3HHLC 2OO4A 1YI2S 3DOLB 4FN5A 3F44A 4TY8B 4O4RA 3O9UA 3N9UC 2DIVA 4ZITA 2E9ZA 3LPEA 4CLPA 5J1PA 6AT1B 3FCVA 4QU6A 3CJ0A 3LP3A 1YJNS 4LT6A 3L7OA 4FWRA 4LF5K 2GJ2A 1JKHB 2AJFE 2LDIA 4DV4F 2YWEA 2BJ7A 4C8KA 3CC2N 1XQIA 4WFBL 1E3MA 4CLSA 3ISZA 4ZLNA 4B9QA 3PIOL 1OPZA 3FE1A 4PL8A 5KAKA 3DMJB 1HI1A 1XR6A 3MMVA 1CJKA 2UXBF 4M5HA 5A8RB 1FJ7A 3LM2A 2FF6A 4U8YA 4DQPA 4BRIA 1VBKA 3JTNA 2YQ3A 5K20B 2DNLA 3SBMA 1HWJA 1YHQN 1IWGA 4IKFA 1VQ7S 3BSAA 3PIOQ 2P8IA 3EZ5A 3OHRA 1FFSB 2OPSA 5KFIA 2HHUA 3PX0A 3OBIA 4DR2J 2F4VJ 4O3SA 3P38A 2FZGB 3BPSP 1RAHB 3QATA 2CNKB 2VA2A 4QWDA 3QWUA 3QEXA 4IH5A 3NGYA 3MR5A 3DNCA 3I9V9 1YZ7A 2J0XA 2UXCF 3CHWA 4RJVA 3E9OA 1VQSA 4R79A 3NBPB 3DU5A 3K9KA 2KXNB 5IT9Y 3BQ1A 3M1FA 1MLAA 4AILC 3L4QA 2COLA 1DFDA 4WYLA 1S1XA 5CABA 4UQTA 3BO2A 1VSEA 3KWIA 3MZIA 4AD6A 3J80Y 3OYNA 1YTAA 5CYJA 3BZCA 2HBZB 4TXSA 4CNZA 2BUPA 3HSJA 3JXUA 3PO4A 2BANB 3EVMA 3QIPA 2HHHK 3DDIA 3DKDA 1EKSA 3O2IA 4CGFA 4BRMA 3J7Z5 4KV8A 3ZETA 4YFUA 3EJMA 5DS7A 4IEIA 1XC9A 4LFBF 3I0SB 2CQCA 2NSBA 1DLOA 1WBBA 1A5VA 2GX8A 3MM7A 4DPUA 1X4FA 2B8QA 1ZAXA 2RQ4A 2XCPA 1I3AA 3M3ZA 4AF1A 5IQ6A 5K5MA 1F9EB 4E19A 4FLWA 1QAXA 2GTDA 2M4MA 2A3ZA 3IRXB 4DLEA 4NLPA 2FBVA 1CULB 2E2NA 3FQKA 3P4UB 1U25A 1EWRA 4HEA9 3KK3B 3WX4A 2QEXN 1XC3A 2KRRA 4XH1A 2QXFA 3BP8A 2P9IB 3V9XA 2WZ1A 4B3MK 4NXNF 1I39A 1VBXA 1N34K 3DRPA 5M2PA 3L4BC 5KFPA 3B78A 1EQ0A 1XNRK 4CLZA 3DXKA 1NJIO 2N4DA 4K4XA 1TAQA 4B08A 2FVPA 1F3VA 3CC4N 3AVIA 4WYBA 5IWAK 4KHPK 3DRRA 2DO0A 2BZ2A 3CUNA 3J7AN 4Z7YA 1NJXA 4ZLJA 4FWPA 3CD5A 3TYTA 1S4FA 3OYJA 1Y5NB 4UF4A 3OYHA 5F0WA 1MG7A 3CCRN 3THTA 1NPRA 1M5KC 3TTDA 3M32B 4OHYA 4JKDA 4BRQA 1VMBA 4ISEA 1Q18A 4WFAQ 2E2QA 2FGOA 5JXSA 2FHOB 4BR5A 4GO7X 2DNGA 2DNZA 2B6AA 4HACA 4K4SA 5FDLA 2CWKA 1K1QA 4FJ9A 4M5DA 4YOEA 4M5IA 2WBNA 3UQSA 4NLOA 4H5RA 1URNA 4AHRA 1FEEA 5E3RA 3DRXA 2MEWA 3T1YF 2VQEJ 4WTYA 3S7RA 3TJ8A 3ILLA 3DRSB 5AXLA 1OS5A 4ZLPA 4FYXB 1TL1A 1HD0A 3G6EN 2R9LA 3HHEA 4HHUA 1LXNA 2Z1IA 2AKWB 2FUG9 2FVRA 4LF5J 3SDEA 1SZ2A 3MDQA 1W7AA 1VC0A 2G9OA 3H8YA 5H1SQ 4RU2A 4PYDA 2ZF5O 3FNNA 2DRBA 2X1GA 3ENHA 4CD3A 3SEOA 2A2CA 1NAQA 4ES2A 2CPDA 2V8HA 3DLGB 4Q2MA 1T6DA 1SBRA 5H9FJ 1VQ4N 5CYQB 3J7ZO 5G0RA 1HNVB 3LGHA 1QY7A 1WF2A 1NM2A 4K8RA 4NI2A 1G7CB 2V4JB 3OA9A 4DTUA 4UZCA 1S49A 1S1VA 3MWTA 4PKDB 1VQKS 2ZH2A 1Z05A 3V6JA 2NXJA 3JS6A 1FT8A 4DQIA 1BI4A 1J6ZA 1RT4A 1LXJA 1RT3A 1B4SA 3G82A 1B64A 1FDNA 2E20A 2EK1A 1U2CA 2DD8S 3MN6A 1D9AA 1B7FA 4RW7A 3MR6A 5ETTA 2QWQA 3CCTA 2IM2A 4ITSA 3DXMA 1GMWD 2NXCA 4Y2AA 1PYOB 2I38A 3BBBA 1XMOF 1PC5A 1XEZA 4M5GA 5C42A 1X5SA 2OHDA 3GG1A 3RU0A 1TU0B 1N6QA 4J9OA 4TKTA 1RU2A 4E7KA 1SKUB 3F56A 4FJ7A 3SV3A 2HHHJ 2P9PB 1KAXA 2F8TA 3CCQS 4LF9F 1RSCA 3C6TB 3VEXA 2VZ9A 1N36F 1GH8A 2PGCA 4X65F 3GG0A 1YBUA 2I5JB 2BJ8A 1YJ9S 4F4WA 3AHPA 4X2BA 5KFMA 1QSYA 2ZFHA 1UL3A 5D78A 3R8YA 2VCPA 4PKHA 1M5SA 8AT1B 4BQLA 2G2OA 4CK2A 4F4XA 3R1XA 2NR0A 2Z2MA 3BGRB 3KLGA 1REVA 3NY0A 3UKRA 4W5QA 4R0EA 3T1HF 3AB4B 1J54A 1QHTA 1XTZA 3GSDA 2VQFK 4FF2A 1HBUB 2FC8A 4JAXA 4Z2XA 3KG0A 4LFAK 2Q6CA 3HX9A 1F5CA 1VK3A 2R7QA 5FJ4A 3DLRA 3HVWA 2CZ4A 4RX6A 2APOA 4B9VA 4BRNA 1A7GE 1NBEB 2F40A 1QVFR 4B3MJ 5ETQA 3OSPA 1N34J 2A10A 3AY9A 1LNQA 4ECRA 4DHVA 1KVBA 1RT1A 4KH5A 4ZP8A 5A0YB 4DR6K 3MAAA 4FWMA 1FWLA 3ZTRA 3TUZC 3O8MA 2UVWA 3MM8A 1Z2LA 1JB0C 1KLMA 5IWAJ 3TAQA 2OMOA 4B1VA 1CC7A 1HNWF 4KHPJ 4ZPBA 5LL6Z 1NB2A 1ASWA 1XMBA 2RRNA 4B8CA 1VIXA 4LMZA 1NHKL 2GMHA 4A8SA 4ZIVA 3T1AA 2XMJA 1U1QA 3QLHA 4AQYF 1RDAA