1LWCA

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
506
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 146
structure length 506
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwcA05
4CHZA 4DSJA 1HQEA 1S1TB 4PWDA 4W5RA 4ED7A 4CEZA 2X6NA 4B8AB 3IS9B 3CJ3A 4MK7A 4DU4A 2VG5A 3AO2A 1ZYQA 3L2VA 4ZP8A 2BR0A 2W7PA 1KLMA 3DOKB 2XI3A 2IDOA 1SH2A 2BE2A 3KHHA 3U3GA 3CM5A 2F8TA 1X9WA 1JLFA 4R5PB 5FRNA 1KHWA 3FDSA 4FLZA 4QPXA 4ZVFA 1TVRB 4Z4CA 3P1GA 2I5JB 4EP5A 4H8KA 3VQAA 4DLEA 3TAQA 4IFYB 2W42A 4KO0A 5DLFA 4NLSA 3ASMA 4RW4A 1I6JA 4I2QB 4WE1B 4FJHA 4BE2A 4R8UA 4CIFA 4I9LA 4B08A 4QWDA 5KG3A 3OYNA 2ZD1A 4ZP6A 3ISND 2WOMB 1YVFA 1SL0A 3IN5A 1N6QB 1JL2A 1Y97A 4DSEA 4NLDA 3NF8A 4CEOA 1C1AA 1RDDA 3SPYA 4IG3A 3NBPA 3T19A 5KT6A 1JXEA 2FC0A 4GMJB 4ECYA 4HUFA 2BDPA 4E7IA 2OZSA 2R7YA 4U7CA 3KJVB 5KGWA 1W25A 3BGRB 5EUHA 3C6TB 1L3SA 1LWCA 1NOZA 1RT7B 4QW8A 3OLAA 2E9ZA 1UWBB 4E7JA 5K14B 4LSLA 4XO0A 2C2DA 2QE5A 1TAQA 3FFIA 4I2PB 4ZVEA 3AVLA 3SFGA 2XY6A 3NBPB 4NLOA 1A5WA 3EYZA 3CM6A 3HT3A 1CSJA 3P5JA 5HRPA 3C6UA 1S9EB 4DTNA 2FJWA 5DK5A 4O3QA 4NYZA 3MR2A 4UQGA 5J2QB 3L3UA 4OLAA 3NCIA 4HYKA 2OPPA 4ZTFA 3CDWA 3F73A 1C1BB 1JXLA 1RBSA 5CYQA 1GOBA 3PW2A 2ASLA 1WNEA 3HP6A 4CJUA 5J2MA 4KHNA 3QEWA 3SQ1A 2YNFA 4DFJA 1IKWB 3KLEA 2IOCA 4CJEA 5KT5A 1DLOA 1ZBIA 2OPRA 3RRHA 3V4IA 1NK5A 3V9WA 4MFBA 3QGGA 3HHKA 3V1RA 4C8MA 1NK0A 4YMEA 1B92A 1RDRA 2HWIA 2JEJA 1NJXA 1RDBA 3AO5A 3AVFA 4TY8A 5C42B 1BL3A 2HB5A 4F8RA 2IM2A 1QS4A 4FXDA 3AVMA 1B9FA 3MEEA 3I5CA 3RMCA 3QEPA 3OSPA 4KHWA 2E6MA 4HUEA 4RNOA 3QYYA 1XHXA 1HRHA 4FCYA 1RYSA 4RW9B 4CJPA 1C1CB 1CZ9A 1W9HA 4NCBA 2B5JA 4O3SA 3ZSQA 3MEGB 4PUOB 3KD1E 5KFSA 1GOAA 2E9TA 3MEEB 3VN5A 3PUFA 4CJ5A 3JYTA 4OKEA 1S6PA 4ECUA 4NCAA 5C25A 3SNNA 5KFXA 3RRGA 4Z4EA 3PVXA 4J9PA 4EZ6A 3KK1B 3PJWA 3PO5A 1SKWA 3NGYA 2HWHA 2DFEA 4URSA 5CYMA 5FDLA 4NYFA 3LALA 3RBDA 3SQ0A 5EDWA 4QWCA 1CZBA 4IFVB 3PR4A 2FLNA 4FM0A 3OY9A 1HYSB 4CEAA 4C8KA 4FJ8A 4JUZA 2XGQA 3VQ4A 3OVNA 3JSMA 1RTIB 1R0AB 1JLBB 3NKYA 3PY8A 4LQ9A 3OYGA 4CESA 4JS4A 4K4VA 1RTDB 2UVVA 2IM1A 5F8NA 3OLBA 3VQBA 1JXBA 3RMBA 1RT3A 3I8DA 4BDPA 1S1XB 4BWJA 3V6HA 4F3OA 4Q0BB 2R8HA 3NH0A 4CHNA 4WFYA 2J6SA 4OL8A 1RT1A 4IH6A 3I0SB 5DQGA 1NKCA 2XCAA 1RNHA 2IAJB 3H4BA 3NH1A 3K2PA 3WNEA 2HNDA 3HXMA 4M3WA 1TL3B 5HLFA 4WFXA 4NCGB 2C28A 2WONA 4ZHRB 2RDJA 2HVIA 1K1SA 4KB7A 1S1VB 2F8EX 1JKHB 2QV6A 3MR5A 2FLPA 1C6VA 1ZBLA 1NJYA 5D3GA 4FJJA 1KFSA 1T94A 4EBCA 2HNYB 1D5AA 4IFVA 4JV0A 1TKTA 2UUTA 3Q8SB 2F96A 2GIRA 1RA7A 1RT2A 1LWFB 2ATLA 2JEIA 3ZSYA 4KTWA 2NUBA 2HHUA 4OPJA 5J2PB 5KT2A 2PY5A 2W9BA 3D28A 3HVTB 3LPUA 4FLXA 4CGDA 2KQ2A 4CK3A 4FJNA 3QEVA 4DL6A 4GC7A 2WCXA 1NK4A 4N47A 1T7PA 5KFWA 2C22A 1X9SA 4E7LA 4EYIB 4LD0A 3V9UA 4H4MA 1BI4A 3MFHA 1K6YA 1JLCA 1TKXB 4KFBB 4F4XA 5KT7A 3IGVA 4KRFA 3K59A 4ZHRA 5HROB 4AHVA 4NLTA 4FJKA 4JRPA 3VQ5A 2D0BA 1IH7A 3DRRB 1B9DA 4IDKB 3QIPB 2GC8A 3VQCA 3L2RA 4DQRA 3WNGA 5KFPA 1N48A 3LANA 1QUVA 1N56A 4PWDB 5KFUA 1Z26A 3VQ7A 2ZKUA 4CEEA 5DG7A 1HQEB 1S1TA 4CFCA 3PJXA 3G10A 3MTKA 4X2BA 4FJ5A 3RB3A 1HPZA 2HMIB 1QE1A 4OKKA 4CEQA 4KHYA 2DPIA 4Q8EA 1VRTB 3TAMA 4Q44A 2YKNA 4FLWA 4WYLA 5KFOA 3OYAA 3O3GA 2VG7A 5KGXA 1TKZA 3LP3A 3OL8A 3H5SA 1ZTTA 3GV5B 3KLGA 3RAQA 3BSCA 3H2LA 1C1BA 2B43A 3N6LA 4NLRA 3NFAA 1S0MA 4YR0A 3DLEB 3RAXA 5EU7A 2YNIB 4KHMA 3F9KA 5J2QA 4OGEA 5KFQA 1F21A 3MECB 3NGIA 4AHSA 3M8RA 3DLHA 1L3UA 3HKWA 2IJFA 4FK0A 3DYAB 1KCFA 3IRXB 4ZP9A 4F4YA 4IH5A 2O5DA 3L2UA 4ECQA 1VSMA 1QQCA 4FJXA 4IR1A 4TXSA 5JS2A 3VQSA 4DTMA 1HQUA 4OVLA 4NYNA 1FKPB 3KLHB 1RA6A 1N5YB 3M9MB 4DS4A 4AHUA 4KHQA 1JLBA 4LQ3A 2YNHB 1D0EA 1SL2A 4ID5B 5KFJA 3HJFA 4RW9A 2BRKA 1BQNA 1RBUA 5J1EB 3KJVA 4EZ9A 3BJYA 1QE1B 1U45A 4EO6A 4K4SA 3G86A 1KVCA 4TY8B 3MEDA 2O4GA 1LWEB 3M8QA 1TK8A 3SPZA 4Q45A 3OYJA 2GIQA 4QCLA 5L9XA 2OPSA 4DTUA 1REVA 2R2TA 1X1PA 4DF8A 1U47A 2DY4A 2JEFA 1IKWA 4KV8A 2ETJA 3DDKA 4E1NA 2VWKA 3VQQA 4PQUA 4K4TA 4Q43A 2AQ4A 3ZSOA 3QNOA 2G8UA 1YVUA 2ASJA 5SZTA 3IG1A 3PZPA 4KO0B 4B9MA 4NRUA 5HROA 3HPOA 1NKBA 1N4LA 5HP1A 2A1RA 1FK9A 3AVNA 2KFNA 3OJUA 4ICLA 3FRZA 4CJFA 1T03B 3VQ8A 2DFFA 1NK7A 1EETB 1EP4A 4RNNA 1Z4UA 3V6KA 3UR0A 3CVKA 2FVQA 1CXUA 5F9LA 4Z4FA 4Y1CA 2W9CA 3LP2B 1REVB 2ATQA 3SZ2A 5J2PA 3TABA 4F4ZA 3D45A 2OPRB 2Y1IA 1FKOB 4CJ3A 4EO8A 4I2PA 4CFDA 3V6DB 3T5JA 3T1AA 4DL3A 1UWBA 2FJXA 3KK3B 4LY7A 4OJRA 2BQRA 3M9OB 4CGJA 3BQ1A 2E6LA 1L5UA 1JKHA 1T03A 4WFZA 2AGOA 2W9AA 3FQKA 4ID5A 1VSDA 3NE6A 4ELTA 5KFFA 3H5UA 4HCCA 3GV7B 3U6FA 2AX0A 3RBEA 4M94A 3L2QA 5HP1B 1J54A 4J2AA 1QHTA 1MU2A 3DI6A 3I5BA 2W9CB 3GQCA 5EWFA 4ED6A 4PQUB 3NF6A 1TV6B 3SQ2A 1JLGB 4G1QB 1YT3A 3LPTA 4CECA 4H4OB 1EP4B 3SUQA 3DI6B 4FZXC 1RTDA 4RNHA 4RUAA 5C5JA 5KFVA 1EX4A 4FLTA 3AVKA 2VG6A 4JRQA 3LP1B 3MXMA 4RW8B 1LWEA 3M8QB 2QK9A 3MEDB 4FJ9A 1OS5A 1RYRA 3KHRA 2R8GA 4Y2CA 1UOCA 2BANA 4HCBA 4N56A 3H5XA 3HYFA 4MKAA 4CJSA 5L1JA 1RBTA 1KLMB 3D5MA 3AA3A 1J5OA 3MXJA 4B9LA 3ZSZA 4IKAA 4J2DA 2QKKA 4CHYA 4ECTA 1IG9A 1FKPA 4ZTJA 3U3YA 1IM4A 4F2SA 4FVMA 1SV5B 4DQIA 3OYDA 4AILC 4IG3B 3EPIA 2DFHA 4N76A 2J6TA 3TQ1A 4E89A 1N6QA 1IKVB 3DMJA 3TI0A 2XHBA 3G6XA 2EHGA 4RU9A 3TAEA 1IKYA 3NAHA 2B6AA 1C0MA 3VQDA 4IRDA 1NJWA 3HPGA 2D7SA 3S3OA 4J9SA 1EXQA 1RTHB 3PX4A 4YFUA 4CK2A 3ZT4A 2D41A 3EPGA 3M8SA 2GBZA 4XIUA 4K8ZA 1S1UB 4TQRA 2OH2A 3I0RA 2G8VA 4FS2A 3GIMA 1UA0A 2CJQA 3KLHA 4DG1B 3QZ7A 3WNHA 5C42A 1ZBUA 3TANA 2JEGA 3S9HA 5FRMA 3QNNA 5KFZA 3TARA 3S3MA 3CJ5A 4AHCA 4B3OB 1U04A 3QIOA 3KHLA 2CKWA 3AO4A 1RBVA 1L3TA 1GX5A 2UVRA 3AA2A 4KI4A 4YR3A 5KFRA 5J2NA 1CLQA 4LSNB 3L3VA 2YNIA 2FBVA 3IGNA 3QESA 1WLJA 3AVHA 2FVCA 4W5OA 3EY1A 3DLGB 4LH4A 4HTUA 2VG7B 5KRSA 2V9WA 2D3UA 1Q9YA 2Z1IA 1S1VA 1S1WA 3CJ4A 2YKNB 2G8WA 4DMNA 3HL8A 1KLNA 3OYCA 4JS5A 5HBMB 4W5QA 3Q8RB 4HVJA 1BIZA 1RDCA 4CGGA 3M8PA 4URQU 1LW0A 1J9AA 1HNIB 4CJLA 3OSNA 4H4MB 3DM2B 3CO9A 2X6SA 4DWIA 4BDYA 4KAZA 3KLIA 4CHOA 3SV4A 4G1QA 4KHUA 3KLVA 1JLAA 3DM2A 3KOAA 3QIPA 3DRRA 5KG7A 2IMWP 4DU1A 1JLEA 3ZCMA 5KI6A 4TYBA 1NHUA 1RT7A 4G3IA 1S0NA 1SL1A 4N41A 1KHVA 4QW9A 3DRSA 4B9SA 2F8SA 3E51A 1BIUA 4W5TA 4NLWA 1HYZA 5D3GB 3CQ8A 4MIBA 4KTZA 2XRIA 5FDLB 3PW0A 2RKIA 1RCHA 4K4UA 3MR3A 4K4YA 4B8CA 3LWMA 5CZ1A 3V6DA 2KW4A 4M3UA 4TYAA 4O3PA 2BGGA 2KZMA 2P1JA 4ZPAA 2O4IA 1LWFA 4WXWA 3O3HA 3KTQA 3PW7A 4K8XA 4CIEA 4FLVA 1K1QA 3KNAA 3M8PB 1TVRA 4IR9A 1VSHA 4DFKA 4CF2A 1TKDA 4F3TA 2XWYA 2B5JB 3G6YA 1DTQA 4HUGA 1NKEA 3CWJA 4ICLB 1DTQB 2BE2B 3DOKA 4J9OA 5FROA 4CJ4A 4WZQA 1SKSA 4CERA 3SI8A 2V0NA 4J9RA 3ITHA 1TK0A 2W8LA 3TR8A 4FW1A 4GVMA 2C2EA 3G0ZA 5KFMA 5F9NA 4Q0BA 1VSKA 4O0JA 4KV8B 3VA3A 2P51A 4DQQA 4ED0A 4DL4A 3ISNC 4DL7A 2RDIA 2YNFB 5KFDA 4KKOA 5C24B 2G8HA 4DTSA 1A5VA 2B4JA 2BQUA 2XI2A 2A1SA 3LZIA 4KREA 3ITHB 1NNDA 1U4BA 3KK2A 3BQ2A 4BDZA 2G8IA 3VQEA 2XO7A 4YR2A 4O4RA 2R8JA 3HVWA 4IG0B 4K4XA 4WXOA 1QSYA 5DG8A 1BQNB 1QAIA 1XR7A 3D0PA 4CGIA 1RAJA 4FJ7A 1S1UA 4HHTA 5CYMB 2PYJA 3OYIA 4ZPCA 3T3FA 5HLFB 4J9KA 1WSFA 4H4OA 3T5LA 5DQIA 2WHOA 5JXSA 4DQPA 2E4LA 3KD5E 1JLGA 3I0SA 4WYWA 4ECWA 2KFZA 4KAIA 3ULDA 3KMQA 4C8OA 5C25B 3IRXA 5KG5A 1SUQA 4FJLA 3ALYA 4TN2A 5L1IA 4DEZA 3NF9A 4K4WA 4GC6A 1RT5A 4FZZA 2VA2A 1BGXT 1LWCB 2WRMA 3PV8A 3AO1A 5J2MB 1XC9A 2BANB 3AVAA 3HO1A 4FLUA 4EEYA 2HNZA 1I3AA 4CGHA 1WAFA 1RT6A 1HJRA 2G8KA 3TVKA 2UUWA 3OYEA 1VSFA 4DTOA 4RG8A 4FW2A 3LP0B 1VSIA 4Z0UA 4W5NA 4EBDA 4DL2A 3H5YA 4I9QA 3MFIA 4F4KA 3C95A 3PW5A 3NAEA 1JLQB 4Y3CA 3KLEB 5KT4A 5DQHA 4U6PA 4ED2A 1WSJA 3BDPA 3C6UB 1TV6A 2P5GA 4RW4B 1S6QB 4IQXA 1NK6A 4ECVA 5JUMA 3Q8QB 3RWUA 1X9MA 1WAJA 2D0AA 4M3RA 3PO4A 5JS1A 1HNIA 1LAVA 2XY5A 4J2BA 4MK8A 4MK9A 4B9UA 4XPEA 1UAXA 3AVCA 3B6PA 3H40A 2WTFA 1WSEA 1FK9B 3OYBA 3E01B 3I0RB 1I39A 4KE5A 4LH5A 2OPPB 4FZYA 3PR5B 1U09A 1TAUA 3IG1B 5DLGA 3ZSWA 2VWJA 5KFYA 3G6VA 4QAGA 3KK3A 1LW2A 2B6AB 3BREA 1LAWA 4CEBA 3DMJB 2KZZA 2QXFA 3LP2A 3H08A 3HSTB 3QGHA 2IA6A 4BACA 4TSXA 5I3UB 1YTAA 2LSNA 5EWGA 2IC3A 3M9NB 2W9BB 1BCOA 4KHRA 2OYQA 4R8UB 4B3OA 1DTTB 2DTUA 1ASWA 1LV5A 1SKRA 4ELUA 5SWMA 4DTRA 1TKTB 1VSEA 2I5JA 2YHAA 3BQ0A 3VA0A 5I42B 1Z25A 1W0HA 4CJKA 4E7KA 3RR7A 2AJQA 2YKMA 4KBIA 4NLQA 1BQMB 2RF2A 4DTPA 5HRSA 3FQLA 3DOLA 1VSLA 2G8FA 5DGAA 4R0EA 4DU3A 3NGDA 1TGOA 5L1LA 5KG0A 5DMRA 4IH7A 1RT1B 1XR5A 3WNFA 4I2QA 3ZT2A 3HP9A 1NK9A 3CFRA 3CJ0A 3SYZA 4DSLA 1GOCA 2WB4A 3O4NA 4DSIA 4FJGA 4LSLB 2HAIA 2YKMB 2HNZB 3N6MA 3K5LA 2Y1JA 5L1KA 4ID1A 4KB1A 4KTQA 1C0UB 2ZE2A 4RNMA 4QWBA 5KTQA 2XY7A 2PZSA 4ZVGA 2VA3A 4RW7B 2ASDA 1ASVA 3MF5A 1TK5A 1VRTA 4M41A 3TAMB 5KFAA 3DRPB 4YP3A 2Z1GA 5DGBA 3TAPA 2GV9A 5CZ2A 1NHVA 3RB6A 1QSLA 3S3NA 1N5YA 1JX4A 4Q5VA 3UIQA 2PYLA 3CDEA 2GUIA 3GV8B 5KRTA 3GIJA 4Q8FA 2C2RA 4XPCA 3VQ6A 3BSAA 3TAFA 4Z4GA 2ZD1B 1ZBFA 2D5RA 3OHAA 4ED8A 5KFKA 3OYKA 3UDLA 4OKJA 3HM9A 3B6OA 3EZUA 4O44A 4KPYA 4ZMMA 3BR9A 5KG6A 4J2EA 3NF7A 1D9DA 3JYTB 1U48A 4DG1A 4M3XA 1SH3A 3AVBA 4IBNA 1KTQA 4CHQA 3KLGB 4RW6B 1FXXA 1RILA 1JLCB 1QAJA 1D9FA 1TKZB 3CIZA 1VSJA 4CJWA 1IKXB 4O44B 4PY5A 1S6QA 3GIKA 3DLKA 2HHWA 4O0IA 4KKOB 3OYMA 5F8GA 4FJMA 4J9LA 3NGZA 3V9SA 1QSSA 4NRTA 4K4ZA 3KKSA 4TLRA 3SFUA 2EC0A 1VK0A 1IKVA 4ZVHA 3AO3A 4MFBB 1XR6A 3GIIA 4RNFA 3OHBA 2I1RA 1RT2B 3KLFB 4HKQA 4OLBA 4FM1A 1HNVB 1XHZA 3RR8A 3AV9A 4TY9A 2BRLA 4QWEA 1RTJA 3V1OA 4ELVA 5F8HA 1IKXA 4ZPDA 2D0CA 4FBTA 2XY8A 3ZT0A 1C0UA 2ZE2B 3NHGA 1D8YA 4NCGA 1ZTWA 3O4QA 2R2RA 1TL3A 4CCHA 4QWAA 2ILZA 4TQSA 3ZT3A 1HQUB 5F8LA 4RW8A 4PA1A 2FJVA 2VG6B 1S9GB 4DSFA 4B9TA 5KFIA 4DFMA 4KSEB 1S4FA 3SUOA 4O5BA 1S9EA 1JLQA 5EWEA 1RDAA 4M3YA 1U49A 3ICLA 3LAKA 1T05B 3CYMA 4DS5A 2RKIB 3DOLB 3JSMB 3KMSA 3AVGA 1BQMA 2RF2B 2W8KA 4MQ3A 4FK2A 3C94A 2IBKA 3HVAA 1NJZA 4DF4A 1XWLA 4BWMA 3DRSB 3ZSXA 5J1EA 2HHSA 3KK2B 4RW7A 2FVPA 4C8LA 4ECZA 3QLHA 4RZRA 1WSIA 5KG4A 4F50A 2YNHA 2WONB 2HHQA 3KKRA 1TL1A 1BCMA 3AA5X 1T05A 1RT5B 3OYLA 4ZP7A 2IC3B 3ZSVA 4CF9A 3OS2A 4O3OA 3PX6A 4NLVA 4ED3A 4RUCA 1JLAB 4C8NA 3PHEA 3OL9A 4I7FB 1C0TB 4FK4A 1TP7A 3V81A 5KFCA 4JV1A 1RT3B 1D1UA 4AHRA 3MECA 4F4WA 3T5HA 1LW0B 1EKEA 4IDKA 3MEGA 3GILA 3DLRA 2R2UA 5HRRA 4DSKA 4E7HA 3K5NA 3NDKA 5KG1A 1KSPA 3DLBA 4O4GA 5KFTA 1S1WB 3E01A 4KFBA 2AU0A 5I42A 4CK1A 1JLFB 4R5PA 1S5JA 2AGQA 2QKBA 4CF1A 1BI4B 4GW6A 4H54A 3H4DA 3MAQA 3KLFA 2HMIA 3BSNA 4J9NA 4M3TA 3V4IB 5T14A 4L8RB 1MMLA 3HVTA 1T8EA 5KFBA 4DLGA 4JV2A 1RT4B 2YV0X 4NZ0A 3OL6A 3AVJA 2IM3A 1RT6B 4IRCA 5E41A 3ZSRA 2XC9A 1VRUB 1ZETA 4IRKA 1LW2B 1NK8A 5KFHA 1Q9XA 4ECRA 3K5MA 5KFGA 3HPHA 4MKBA 4O4GB 2YNGA 1YTUA 4FBUA 4CJTA 3AVIA 1JLEB 2IGIA 2UVWA 4M42A 2W7OA 3P83D 4NLUA 1HMVA 2IAJA 4J9QA 1O1WA 2RPIA 3V81B 3KLIB 4N5SA 3L2WA 4CJQA 4EYHB 4Y2AA 2Z1HA 4O3RA 2R8IA 3OS0A 4BE0A 4DTXA 1UA1A 3SCXA 4DL5A 1DLOB 4QOZB 4MH8A 3Q8PB 2V4QA 1HARA 5KT3A 3FFIB 1T3NA 4URGA 3LP0A 2R2SA 3QEIA 3SUNA 3RMAA 3AA4A 3DRPA 1RTIA 2YNGB 1R0AA 2WK4A 3CFOA 3VQ9A 1S9FA 3V6JA 3QLHB 2ITGA 1G15A 2HHVA 4CFAA 1BISA 4CF0A 2HNYA 4Y1DA 4CHPA 2YHBA 5CY4A 1JIHA 1S49A 3QO9B 5F8MA 3NL0A 4FJIA 3THVA 1L3VA 1WNSA 1S0OA 2J6UA 4E3SA 5J2NB 2R8KA 1RT4A 4OPKA 2HW3A 5F8IA 2HNDB 4NLGA 3MXIA 3K58A 2WOMA 3QGIA 3KK1A 5KFEA 3CDUA 2HVHA 2JC0A 2X74A 4JLHA 1SUQB 2FLLA 4ECXA 3NAIA 3LZJA 3NMAA 4CEDA 1S10A 4CJVA 3KHGA 4IFYA 2ALZA 4FYDA 1BHLA 1WN7A 4YQWA 2OA8A 3PW4A 1KFDA 3V9ZA 2JC1A 1WSHA 3OYHA 4KI6A 1TL1B 4MIAA 5KFNA 1SH0A 1XI1A 3OJSA 1C1CA 2FBYA 2OPQB 1TQLA 2FBTA 3EZ5A 3UQSA 1RTHA 1A5XA 2HHTA 1TKXA 1HYSA 4YNQA 3K5OA 3DLGA 3RB4A 3SJJA 2AGPA 4AH9A 3IAYA 3OS1A 3IS9A 1ASUA 2UVUA 4ECSA 4OGCA 3SQ4A 1C0TA 1SV5A 4O3NA 3VQPA 3SUPA 2BQ3A 1WSGA 3L8BA 4F2RA 4WE1A 4CJRA 5DG9A 3CG7A 4EBEA 1EETA 4ED1A 4O55A 4B9NA 1QTMA 1S9GA 2HHXA 1S6PB 2FVSA 2RN2A 3HVRA 5CYQB 4IOBA 4BE1A 3PX0A 4PUOA 5KG2A 3SV3A 4RW6A 4M45A 3QETA 2OPQA 1IO2A 4DFPA 3LP1A 4CF8A 3RMDA 3TWHA 2IS3A 1S48A 2JLEA 4ZPBA 2Q3SA 3CJ2A 4FM2A 4CEFA 2EX3A 4Z4IA 3QEXA 4NLYA 1HNVA 2VG5B 3V1QA 3TAGA 1ITGA 2D3ZA 4FLYA 3O3FA 4AHTA 3LDSA 1S1XA 2OPSB 2IM0A 4I7FA 1MU2B 4Y34A 2FBXA 3KIOA 3K57A 1KVAA 3OYFA 3N6NA 4E0DA 4M3ZA 5HBMA 4CIGA 3DLKB 2AWZA 3HK2A 4WZMA 1J5OB 3LAMA 2ZQBA 3GYNA 3C6TA 3QO9A 2ILYA 2IJNA 3SI6A 3BGRA 1GX6A 4B9VA 4CE9A 4E19A 4KB0A 4DQSA 1KRPA 1Q8IA 3RTVA 4FS1A 4E1MA 1RBRA 3LWLA 1HYVA 3QZ8A 3UPFA 4NLPA 4IKFA 4LSNA 3T5KA 4J9MA 4CFBA 2XGPA 5KFLA 5F8JA 1ZBHA 3DYAA 3A2FA 5HRNA 1C2PA 4DTJA 3H59A 3RB0A 2P5OA 1J53A 1JL1A 4M95A 3MR6A 3QERA 4EP4A 3DLEA 4Z4HA 1HMVB 3BSOA 2V4RA 4IG0A 5K14A 1CXQA 2DPJA 1KVBA 2KTQA 3NH2A 4KHSA 2E9RX 2FVRA 5T7BA 2AX1A 4NLXA 2OZMA 3QINA 3FSIA 4K50A 3QIDA 3OL7A 2XCPA 1NOYA 1RTJB 2X78A 3V9XA 1DTTA 4CGFA 3ZT1A 1VRUA 1HPZB 1IKYB 5C24A 1S97A 3CFPA 2JGUA 1FKOA 2Z1JA 5I3UA 3I5AA 3H98A
chains in the Genus database with same CATH superfamily
3OUYB 4DSJA 1S1TB 4PWDA 1NCLA 3VVUA 4B8AB 2F3JA 4IQMA 3J80Y 3AO2A 1BLUA 2KDOA 4P10A 1YRXA 3DOKB 2IDOA 3MUMP 1XMQK 2GWKA 4Z7YA 3BV8A 5AQFA 3U3GA 3H42A 4R5PB 1VQ7S 4AL5A 1KHWA 3CXCR 4Z4CA 4CM0A 1XNQK 4IFYB 2XLJA 1M1KO 4NLSA 4TU9A 2OANA 5AQKA 1G99A 4FJHA 4CJ7A 2VASA 2YTCA 4I9LA 1UEVA 1V4TA 3DXSX 4QWDA 3MCAB 4QIEA 4FPRA 2PA8D 4RUBA 2YKOA 2WOMB 3WIVA 1U8SA 3QDKA 1G4CA 3IN5A 1JL2A 3MAAA 5BXIA 3FZBA 4CEOA 4IG3A 3NBPA 4LFCK 3FZLA 2HFOA 1JXEA 3LDLA 1FJ7A 1N36F 3NY0A 2FC0A 1XJWB 2KVIA 4CLTA 5KPTA 2BDPA 2I8EA 4E7IA 2OZSA 1RAGB 2NZ4A 4BG9A 4U7CA 2PD1A 4DV1K 5CABA 5LY3A 3KJVB 5KGWA 2RDDA 3QFWA 1YQHA 1RP5A 1Y11A 3PXGa 1CBKA 2P9IA 4QW8A 1JJ4A 2AYEA 4N8NA 2F9DA 1UWBB 1IQZA 3J7AN 2RS2A 4XO0A 2QE5A 2RRAA 3FFIA 3N5BA 1FE4A 2XY6A 4CLYA 4NLOA 1A5WA 4BRAA 3HT3A 1S9EB 4MAKA 2H5JB 2DCUB 2CVEA 2VFRA 1YHQN 3MR2A 4UQGA 2I2YA 2CJKA 3OXGA 3G71N 4KHPJ 4DR3J 4FO0A 2MKIA 3DGPB 2LP4A 1FE0A 3UD3P 1JXLA 3KG0A 2HBYB 4CWBA 2OAUA 1DGKN 2YWFA 1GOBA 3W2VA 1WNEA 3HP6A 2E7VA 3MM5A 2HPUA 2QT7A 1XTZA 5ETKA 2NUHA 5D78A 1VISA 2CPZA 5IV3A 3SQ1A 2ZJRL 4DFJA 1IKWB 3IO1A 2BXJA 4WIIA 5KT5A 4NWBA 1DLOA 2QMWA 3RRHA 5GAHI 2QWMA 3V4IA 3SDEA 2ZC4A 4C8MA 1NK0A 4LF9F 1RDRA 2JEJA 4E98A 4BR5A 4JI8F 5C42B 1BL3A 1GLDG 3GCXP 1VLYA 1BDGA 2DITA 2FJDB 3ZTQA 4RNOA 2DGQA 1XHXA 4FCYA 2V5HG 2PSZA 1CZ9A 2GMJA 4YOVA 5ELZA 3ZSQA 1R59O 4RUHA 4X4PA 3JYTA 4BS2A 5AQIA 2VJUA 4NCAA 3E9OA 1DY3A 4WQ5C 4JI4K 2ZUGA 1FRIA 3PVXA 3MUVP 3E9PA 2N3LA 2P9EA 3PO5A 3R2DJ 3PIPL 2GA7A 1RXOB 3NGYA 3M8WA 2J5AA 1NBWA 1RWNB 5C2GA 3DFEA 2NZTA 1X3MA 4NYFA 4FYWB 3SQ0A 2A10A 1CZBA 4JKFA 4IFVB 4H5RA 2NYHA 3IR5B 3EN9A 1R0BG 4CEAA 4FJ8A 3ZX3A 4JUZA 3M6VA 2HFVA 4V1Ak 1VBZA 1RTIB 5GAEP 3TA0A 3I4PA 5EX3A 4K0KK 4CT8A 4DV7J 2UZAA 4BWJA 3C16B 4RO0A 4CHNA 3RYLA 3IR6B 3I96A 3VGTA 3I0SB 1MWYA 2BUNA 3NH1A 2X1GA 3D6TB 5AJ3F 1YI2S 3M1FA 2VICA 4M3WA 3EXCX 5HLFA 2XZWA 1VQ9S 2BJ1A 3G96A 3CERA 3SSRA 1KAXA 5AQVA 4JOUA 3PG9A 3MR5A 2FLPA 1C6VA 3VERA 1RBAA 1GXLA 2M8HA 4JV0A 1E4FT 4LJMA 2F96A 4P2FA 2QLXA 1KONA 1YJUA 1RT2A 2QEXS 4CO0A 2ATLA 3ZSYA 2DHXA 4OPJA 3TTDA 4C3LA 3TX0A 3D28A 2AT1B 4WFAL 3TJAA 5GAEI 4DL6A 1TUUA 3AA8A 1NK4A 3JXOA 1WEYA 1X9SA 5CQGA 4HT7A 4E7LA 4LD0A 3V9UA 2UU9J 1BI4A 3MFHA 1ZBTA 1JLCA 5HOOA 2LXFA 3LH2S 1KQKA 2HK2A 4KRFA 3TVYA 5HROB 4OQJA 4AHVA 3TSPA 3MX5A 1IH7A 1GTHA 4OHZA 4BR4A 4CZJA 3P4UB 4IDKB 2OEMA 2P8IA 3L2RA 1T9TA 4JK8A 5KFPA 2GVZB 3LANA 3K9JA 4CBUA 2ZKUA 4CEEA 4PHTX 1DHMA 1S1TA 5HQLA 1HNZF 3THPA 4FZVA 4BRPA 4X2BA 1Q5YA 2AJ0A 4B1VA 4OI3A 2DPIA 3G71S 2VQFF 4RLEA 2YKNA 4R0JA 4DPOA 5CD4H 3LDQA 4WYLA 4KH6A 3OYAA 5KGXA 3HFVA 2JLFA 4YOEA 1J2VA 3OL8A 3H5SA 5E7OB 3RAQA 3BSCA 5C12A 2CJAA 2E1MC 1IBKF 1QQOA 4CLLA 4NLRA 1YI2N 1S0MA 3N4WA 3DLEB 2QYGA 3L7UA 3VGVA 2KXNB 3F9KA 5J2QA 2P9LB 1X0FA 3WQUA 3DLHA 5GMKa 1L3UA 3GJSB 1KCFA 3IRXB 3GG4A 1TU0B 3DN9A 4AQYF 2O5DA 4ECQA 1QQCA 3OPKA 4P73A 4FJXA 4PEOA 3VQSA 3ZNJ1 1HQUA 4DTMA 2A0FB 3KLHB 3M9MB 3OFGA 1JLBA 2DGXA 2MPUA 1S7IA 1WHVA 3DHWC 1SL2A 4ID5B 4RW9A 1T9UA 4DR4F 4DX8H 1RBUA 1NGJA 1K9MO 1DKGD 1R8AA 5K20B 2XSJB 2UXCK 1U45A 4PL8A 1IJEB 3B4MA 2UV8A 3DRXA 2XS2A 3MEDA 4CZEA 3FK4A 1LWEB 2XO6A 2CQGA 3TJ8A 3AGRA 3PSIA 4P72A 1W7AA 2OPSA 3VQTA 2VDIA 4GO5X 1HL6A 2CQBA 1N88A 4K4TA 3ILIA 5AXLA 5T41A 1RWWB 5BR8J 1YVUA 2ASJA 5SZTA 4NRUA 1QVGR 3CIPA 1FVQA 1N4LA 5HP1A 1NJIO 3T1YF 3HTVA 3HSGA 1RCXB 3FRZA 1HFEL 2DISA 4YY3J 2ZNZA 1T03B 1IBLF 3VQ8A 1UVKA 4P7TA 1EP4A 1Z4UA 1WC3A 3D0IE 3D9BA 2GX9A 5IQ6A 3SSSA 4H0YB 3BPSP 1WORA 1CXUA 5F9LA 4UT4A 2W9CA 4K42A 4Y1CA 2ATQA 2DD8S 3HFKA 5ETPA 3L7OA 1MWQA 3FLCO 2OPRB 2Y1IA 1BUPA 4CJ3A 4I2PA 4CFDA 3T1AA 4PXCA 4ZN3A 4ES2A 4DL3A 3H6EA 1DQ9A 4KH0B 1RHJB 2X1AA 2BQRA 3P4IA 4CGJA 3UDCA 2CJ9A 3LW5C 2AGOA 1WUUA 5ETOA 4ATNA 4WP3A 3GV7B 4FL9A 3L2QA 1QHTA 4DDFA 5FJ4A 3MMJA 3DWLA 2W9CB 1N54B 3CCVN 4DV3F 1YT3A 4DCJB 1HWIA 3AODA 3EXYA 3OBYA 4CECA 2OSQA 2Z2YB 4IOXA 1PAUB 3DGVA 5KFVA 4U8VA 4CYUA 1OVQA 3MXMA 3LP1B 3ZZZA 4RW8B 5IM0A 2KM8C 3CCUS 1LWEA 2MTLA 1VQMS 2FJAB 2X1FA 4A8XA 3KUGA 3KHRA 3AD9C 4ID8A 1EARA 3GL1A 3O8WA 2GQCA 4N56A 2RB7A 4CJSA 3KUEA 1RBTA 3MXJA 1OO0B 2LMIA 4F3QA 1IG9A 4JI2J 4RKUC 1GLCG 3AJ1A 3U3YA 4F2SA 3JSBA 1Q0NA 4DV3J 1YJRA 4CM2A 4IG3B 4AILC 1U25A 1UP1A 1S72N 1NSQA 1IKVB 2A2CA 3TI0A 2XHBA 4QYZK 3RW6A 3ZZTA 1DQ8A 4J9UE 2B6AA 4CLUA 4V19S 3CDBA 5MLCV 1NPRA 1OYEA 1CC7A 4PYAA 1D4XA 3S3OA 2FC9A 1EXQA 4CK2A 4PG4A 1RI7A 4BC4A 2NYIA 3M8SA 4K8ZA 1S1UB 2GHWA 2VWBA 2XMVA 3SCJE 4A2BA 3KLHA 1MG7A 1PKUA 1HNZK 2MJUA 2CGKA 3QZ7A 3WNHA 4CO4A 5HQ8A 5FRMA 3A3NB 2EK6A 5KFZA 2ZZNA 2B9YA 4AHCA 4B3OB 3QIOA 3KHLA 2QWOA 2HF4A 1Y9OA 2JWLA 1F1BB 3VMFB 3AA2A 1FD2A 1XNRK 2Q1NA 3U4LA 4CD1A 4KI4A 4YR3A 3AB2B 5KFRA 1CLQA 1O5JA 3EL2A 4LSNB 2HG4A 2C2OB 1OQ3A 4B1YB 3IGNA 1XNQJ 3QESA 2CPFA 3NGKA 2ZJQQ 1LK5A 2Y1LB 5IT0A 2EG2A 2VG7B 2V9WA 3MMAB 1S1WA 4YHHJ 4DMNA 2CQ1A 3MN5A 5HBMB 1W7WA 3JSRA 4WU2A 2CFXA 1XERA 3ET6B 2GFFA 1J9AA 4H4MB 4NOHA 4DV2K 3VR1A 3N9UC 3OTDA 1JJCB 4P2MA 2KYZA 4YORA 3SV4A 1VQPS 1OVYA 4KHUA 1YJNN 2VOPA 3BPDA 4Q2MA 5AFUH 3QIPA 5AQLA 1PYSB 2ZH9A 4QYZJ 5KG7A 5KI6A 4TYBA 4CO1A 3ENBA 1KHVA 2DYAA 4ZPVR 3DRSA 2NZCA 4B9SA 4LR9A 2F8SA 4W5TA 4R25A 4M63C 1OSDA 4FYVB 1W26A 3PW0A 2F9WA 4LF7J 1CC8A 4L73A 3O9QA 1YJWS 1BU6O 2AJFE 4O3PA 3QBXA 5A6WA 4WXWA 4GKJJ 5AQHA 3O3HA 3KTQA 4OZLA 1VQKN 3ZFVA 2RMLA 2MSTA 2FY8A 4IR9A 1VSHA 4DFKA 3JQMA 1TKDA 4F3TA 4Z37A 2B5JB 3THWB 4F0MA 3ULEA 2KFYA 3CWJA 2M2BA 3BM7A 2BE2B 4NXMF 3DOKA 5D0RA 3GP9A 4HHJA 1VQLS 3SI8A 5EY4A 4J9RA 1TUYA 2EG1A 3ZEUA 1TK0A 4FW1A 1T9YA 3FGVA 3G0ZA 4BBYA 2YKAA 4KV8B 3VA3A 5EX5A 4ED0A 4DL4A 4YDXA 1T0TV 4LFAJ 3ISNC 4FPAA 5A8RA 3PRVA 4KKOA 1A5VA 2B4JA 2M52A 3ONQA 2BQUA 5GIPA 5AXNA 1S5ZA 1Q81T 1NNDA 4KREA 4H0XB 3GFHA 4RWWA 1NEEA 2ZH8A 4O4RA 5CCMA 1T6CA 2WZ1A 4LF4J 2UUBF 1BQNB 2ZC3A 4FJ7A 1RAJA 4Y6IA 5LMUF 3ULEB 1RAHB 2PYJA 4X4UA 4NMXA 2FJEB 4LFBF 1BC6A 5F0WA 2LXUA 4OZ1A 4O23A 3T5LA 1FDNA 2QW9A 5A8WA 2WHOA 5RUBA 4AXIA 4WYWA 3VEZA 4EFAC 2YHWA 1HI1A 1RAEB 5C25B 5KG5A 5ADXH 2VQEK 4HACB 3ALYA 4TN2A 2QA4S 5GAEU 3NF9A 3J81O 1WBDA 2J7WA 1K0TA 2CNLB 4DU8A 3QICA 3QT8A 1BGXT 4G1PA 3VGUA 3R5DA 1HLUA 1XC9A 2YWGA 2BANB 4OI4A 3AVAA 1Q8KA 1RCOB 4FLUA 1A0OB 4B3MF 2HNZA 1EKSA 1HJRA 1VSFA 2BW7A 4DTOA 1EWRA 4OX9K 1VSIA 3WXJA 4F4KA 3NAEA 3PFEA 3J81Y 2UXDF 2JWNA 2FZGB 4DR6K 3O6WA 1WF1A 1SC6A 4IQXA 2LQ9A 5D8HB 4ECVA 4YOUA 5JUMA 3RWUA 3VWSA 4M3RA 3MPVA 1LAVA 2Z2MA 2OJ3A 1KOOA 4LF1A 1FK9B 1P1TA 4A61A 4KE5A 2V67A 2DBBA 2UUBJ 4TVAB 5DLGA 1NB2A 3BN4A 2VWJA 3A8YA 2BA9A 3KK3A 3TEGA 4M7YA 3BREA 1BXNA 2KZZA 4LF9J 2QXFA 4USVA 4BACA 3BYPA 4TSXA 2UUAF 4UUWA 2XMMA 4FPIA 3VEYA 3TVZA 2ZDOA 2DTUA 1ASWA 2RQ4A 4PRFA 5SWMA 3S7RA 4F9OA 1TKTB 1VSEA 2VBZA 2WC9A 5I42B 2IPOB 4KBIA 1UZDA 1NGEA 3AOBA 3FQLA 4A57A 2DXDA 1UPMB 5FPNA 1TL7B 3KKFA 3RAMA 4DCPB 1NGIA 3T69A 1W2BM 1OMSA 3UE2A 2FF6A 4USIA 1KAYA 5KG0A 4IH7A 3ZT2A 2P6SA 1U1LA 1AT1B 3ZETB 4OHXA 3OR2A 3LM9A 2AJ1A 1N52B 4JKHA 2V8DA 4DSIA 4FJGA 2HAIA 2YKMB 3N6MA 5HMWA 2Y1JA 5L1KA 2A2DA 3CEDA 4ID1A 1NDKA 4OYBA 1C0UB 4RNMA 1FRXA 2MZTA 4DCHA 5E3QA 3SIPB 2F8MA 2CG4A 2IBOA 2VA3A 1ASVA 3MF5A 2O01C 2V69A 2ZBQA 5DGBA 5CZ2A 1NHVA 3RB6A 3KHYA 4DPUA 2PI5A 1JX4A 3CI5A 3BF1A 1GH8A 2GUIA 3MWPA 1FJGJ 3R9PA 5SUHA 4Q8FA 4FWLA 4XPCA 1DJ0A 1ZBFA 4C6AA 1N34K 3E3XA 5A8WB 3OHAA 4ED8A 4NXNK 1QD1A 4X64J 1HBNB 4OKJA 5DM6Q 4EI2A 4O44A 3R6LB 5DM7Q 5AFUA 1SJFA 3NGSA 1U48A 4DV6F 4I56A 2HYIB 3KLGB 2GCFA 5HL7L 4YY3K 3VF2A 2CADA 2ACYA 4LF8J 1VSJA 3C46A 3PIPQ 2OSRA 3EGZA 1GLFO 4IDHA 4KKOB 4FJMA 5H9EJ 3V9SA 1Q79A 2EC0A 4H5VA 4FPBA 1VK0A 4K43A 4PWUA 3BS9A 3OHBA 3KLFB 5LMUK 2ASMA 2PAVA 3OXFA 3MOZA 3ZEUB 4BREA 1XHZA 4TY9A 4H5WA 1RTJA 3V1OA 4L72B 4ZPDA 2D0CA 4FBTA 3SCIE 3ZT0A 2ZE2B 4OYPA 3QRPA 1D8YA 4NCGA 1ZM2A 1VRQC 2RILA 3O4QA 1P8ZA 4ZVTB 3VF4A 3LUYA 4PA1A 3ULHA 2VG6B 3AXMA 4WFBL 3MM9B 3UD5A 4ZLJA 4DSFA 4B9TA 3W1YC 1SI9A 3BB5A 5KFIA 4DFMA 4KSEB 1PG5B 2XMTA 4JK9A 3SUOA 4O5BA 2ZNYA 1U49A 3AFGA 2PEBA 4A5BA 3NS7B 4NLBA 4ZVRB 5A2QY 2RF2B 2OTJN 1MN9A 2IBKA 2QC3A 1YJ9N 4QZVB 2O8CB 2ZBPA 2R7TA 1VC0A 1WSIA 5KG4A 1PC4A 4KC5A 2B8QA 2C42A 2EK1A 3AOCA 3AA5X 2ZWHA 5T7LA 1ZZFA 3OYLA 2K2PA 1XNRF 3HD2A 2R7VA 3KG4A 3VAIA 3GG1A 2IC3B 1JQGA 5K8OA 3PX6A 4ED3A 1JLAB 4C8NA 4M5NA 3R5AA 1NGAA 4F36A 2C2KB 1TP7A 2ZGZA 1RT3B 3H1QA 1UL3A 3MECA 3IFEA 1GAOA 1O0PA 2I9SA 1S77D 2I7NA 3GILA 1K8KA 3MM6A 3C6HA 1U1NA 3HRGA 3K5NA 1NH7A 4JK7A 2OO4A 2EVZA 4I69A 4B17A 1F3VA 2F7TA 3QWUA 4R5PA 2AGQA 2C2NA 1YITN 4ITSA 2CPEA 4H54A 1X0PA 2GVDB 2HMIA 3C15B 2LECA 4M3TA 2MEWA 5T14A 4L8RB 1Y5LB 3ILOA 1VQ6S 3HHDA 1ZZNA 1T8EA 3RVCA 2BW2A 2F8HA 1IWAA 4DLGA 4JV2A 3CJ1A 2RH3A 1UJ6A 5HATA 2YV0X 4A48A 4NZ0A 2R42A 3NOCA 3CUNA 5BJRA 2IM3A 3VGKA 4IRCA 5E41A 2LFVA 1ZETA 1LW2B 4B3RF 2DGVA 5KFHA 1WTBA 1Q9XA 4ECRA 2YKQA 3MCPA 1X5TA 3K5MA 3OW2R 3HPHA 4QU7A 4MKBA 4O4GB 3DXMA 2YNGA 2NPFA 4MLHA 1YTUA 1HWJA 5EN1A 3AVIA 4FNIA 1X4HA 4PG7A 4M42A 3V4MA 5LSOA 3HFZB 5IV4A 2J9DE 4CO5A 1IBKK 2JFDA 3CJ7A 5A6PA 5HSPA 3CC4N 4N5SA 1WDTA 2Q79A 4WQ4A 2JH3A 3CE8A 4DTXA 1FVSA 4RWXA 4DL5A 1HKGA 2DNGA 3FFIB 1N5SA 2OMLA 2NCKL 2KJVA 1HX1A 3CFOA 4HL9A 4K0KJ 5C15A 1G15A 1CJTB 2LVWA 4ILJA 4CF0A 1KN6A 1XK8A 4C0HA 5ETMA 3DLJA 3BEXA 5D4PA 3GJTB 3TZZA 1RABB 4FJIA 1U1QA 1CQMA 4B3MJ 1F0XA 5DS7A 5J2NB 1RB0A 3NGUA 4OPKA 2HW3A 1NG9A 2FDNA 5F8IA 3MXIA 5EX0A 3HD1A 5KFEA 4BVOA 2E1PA 2HVHA 2JC0A 2X74A 1SUQB 2M5YA 2FLLA 1N33J 2HEKA 3NMAA 2RIJA 1SS6A 3TW0A 4UOFA 1BG3A 2HSEB 4LF5F 1WN7A 4YQWA 2OA8A 4YHHK 2VPZB 1KFDA 3VAKA 4LR7A 4AL6A 4WP8A 2JC1A 4MIAA 4ILLA 5AJ3J 1SH0A 5GIOA 3TTCA 1XI1A 3FZKA 1C1CA 1NDLA 3W62A 3UQSA 1RTHA 3VOVA 4BLGA 1TKXA 3RB4A 3SJJA 5HK4A 1NJIT 2XMWA 4HHUA 4PPZA 4UZCA 4DKWA 1TMMA 3OW2M 1HI0P 4LFBK 4XH5A 5BPMA 4OGCA 3FZ2A 2W2OP 2P9PB 3CC7N 4LF6J 3VQPA 2PMHA 5CYJA 4JI5J 1EAYC 1WOPA 4RBUA 4EBEA 3CJBA 1WACA 2D1CA 4O55A 1S9GA 1S6PB 3HZEA 1NPPA 5CYQB 1V4SA 3AJDA 4IOBA 2AZ1A 4BE1A 2C2ZB 1VQ4N 5KG2A 4RW6A 3EDRB 1RWMB 1X7VA 3M30A 3NGRA 4DFPA 3LP1A 3R1HA 5AR0A 2BJDA 3PFOA 1FHTA 3IBFB 1IQTA 4C8YA 3A1YG 2M4MA 2HRTA 3CJ2A 4CEFA 3CJ9A 4Z4IA 3QEXA 4NLYA 1PILA 1YZ6A 3MCOA 2HMPA 2V50A 1F3FA 5L39A 1T9WA 2R7XA 3J81j 2OPSB 1MU2B 2EPIA 4DR7J 4KGVB 3K57A 2EWSA 3N6NA 4U67Q 4GV9A 4E0DA 1HNXF 5HBMA 4JI2F 2ZBIA 1VQ9N 3G82A 3DLKB 4WZMA 4P7VA 4OX7A 3LAMA 2ZQBA 5E3RA 3QO9A 2LQBA 3CNQP 5BYSA 3SI6A 5KOWA 3KJFB 4JI4F 4BRIA 1SQFA 4DN0A 4CH0S 3G82B 4DQSA 3UB5A 1Q8IA 2HURA 3RTVA 4FS1A 3DGPA 4E1MA 4PABA 2WAQD 3GONA 4OZ0A 1HYVA 5DZ7A 4J9MA 2XGPA 1JCFA 4DL0C 2FHJA 3DYAA 1C2PA 4DTJA 2M70A 3S01A 4UZBA 4RCHA 3RB0A 1H2VZ 1J53A 5ETTA 4WK1A 4P6QA 2LU1A 5BREA 4QQBA 4UY8O 1Y00A 3MR6A 3QERA 2FHJD 4Z4HA 1DZ5A 2VF3A 1UEUA 4IG0A 1CXQA 2DKOB 5MAOA 3NH2A 4FYYB 4QR2A 2AX1A 3OXLA 1SC3B 3QFUA 3QIDA 4AQYK 1HLWA 1VRUA 4XTTA 2WSFC 4BRLA 1NSAA 1HBUA 1N5TA 2JGUA 4FVCA 2DGOA 2KT2A 1HQEA 3FZMA 2YX4A 4W5RA 2X6NA 4WQ5A 3CJ3A 3NVKA 2PMZD 2O8FB 1WOOA 3GE1A 2I38A 2F1FA 6FD1A 4FYXB 2LQJA 3CXCM 1KLMA 5THWA 1WOQA 4X65J 5JMNA 3C7NA 2H5EA 2RQKA 4AYBD 3A5OC 2F8TA 5BR8K 4QPXA 4ZVFA 4TNOA 4FWOA 1KD1O 3CMEN 3AD7C 2PT0A 2IHR1 2ROEA 4KJIA 4AUKA 2D4WA 4RW4A 1I6JA 3JXUA 2VB6A 4I2QB 4RL1A 4BE2A 4R8UA 4CIFA 3OYNA 3UVJA 1U0HA 4ZP6A 5BPNA 1SL0A 2QGFB 1N6QB 1WG1A 3NF8A 3SPYA 2B9XA 2GHPA 2VCPA 2L08A 2CDQA 4HWIA 3OTOJ 1C0FA 2DNLA 1Y5NB 2MJNA 5LT5A 3CC2N 1W25A 3IWNC 2L48A 2EFNA 2MLXA 1F2GA 4MIWA 2DO0A 1NOZA 1RT7B 1LOUA 2NRWA 3JAMU 3I6PA 4LSLA 3SQOP 1EZZB 1DT9A 1RGVA 3W3DA 2NRVA 2VFVA 4X64F 1CSJA 3MZIA 5HRPA 2QA1A 3C6UA 4CRJA 1WG4A 2EEYA 3I9ZA 4DTNA 3SAHA 1SJ3P 2J4RA 3TUIC 3OVAA 1QVFM 4YOXA 2AHOB 1WHYA 3PEHA 5E2QA 3G8SA 3L3UA 3GDQA 3NP5A 3NCIA 4HYKA 4ZTFA 5B08A 3F73A 1C1BB 1RGIA 1TL4A 3ATUA 5CYQA 4OYOA 4WFNQ 3Q86A 2ASLA 3NNHA 2CQ3A 4K41A 2GO9A 1J5EK 3QEWA 2ZITA 4DX6A 4ILRA 2YNFA 1EB0A 2IOCA 3ZLJA 4CJEA 5AQYA 4GKKJ 2EWHA 1R27B 2OPRA 5C2CA 1H98A 4P75A 1NK5A 3V9WA 4MFBA 3HHKA 3WZ0A 1CS4B 1TYQA 4YMEA 1B92A 2HWIA 1FWKA 4M5GA 2KHCA 5JVGL 3BO3A 4TY8A 4IO9Q 1RKIA 4F8RA 2HB5A 3J7AP 4BVPA 3AVMA 3I5CA 3RMCA 3OSPA 4KHWA 2E6MA 3A0IX 1UVNA 1HRHA 3D6FB 2V2KA 1YITS 1RYSA 2WUSA 2ZDPA 2UYTA 1ESVA 2LXIA 2OEJA 2BKOA 4ZPWR 3I33A 3R27A 4NCBA 3MEGB 4PUOB 2J0XA 5KFSA 2NPIA 4CJ5A 1E6YB 4KH5A 3UKUB 2UUCK 1WKKA 3TQEA 4ECUA 4USKA 3KWIA 3L4IA 3T1HJ 2ZH3A 5KFXA 1U2RA 3S8SA 3M4XA 2UUAJ 4LRFA 1N8RT 4IYQA 1FWLA 2V8PA 3GE9A 4FOIA 2B51A 4MDBA 3DKDA 1JK9B 2R7WA 2MQQA 5FDLA 3LALA 4LT6A 2HZAA 5EDWA 2AZ3A 2FHOB 2FLNA 2DTJA 3Q2SC 3OY9A 1HYSB 4C8KA 4OO1J 1NMDA 1CJTA 2PFUA 3VQ4A 3JSMA 1R0AB 1JLBB 2KYXA 3NKYA 3D6MB 3PY8A 1CULA 2B9WA 4JS4A 3QB0A 2UVVA 3RGIA 1S57A 3OLBA 3VQBA 1VQMN 4OZJA 1IBCB 3I8DA 4BDPA 2AIRB 4F3OA 1VOMA 4Q0BB 2R8HA 3DU5A 4WFYA 4MO5A 3D66A 2J6SA 1RT1A 3NS5A 1B7FA 1NKCA 3Q8VA 3W0LA 2LQ8A 2IAJB 4HI1A 3MN6A 3K2PA 3WNEA 1Q7YT 2J8SA 2MYFA 2C28A 2RDJA 4FWMA 4AM6A 3MMBB 2F4FA 1JKHB 4EMDA 2G0IA 4FJJA 2HQFA 1OY8A 1T94A 2HNYB 2F4VF 4CVNE 1VBYA 4DR6F 1ACMB 3Q8SB 2C3UA 2GIRA 3C14A 1LWFB 4CLPA 2XHCA 3HHLC 2HHUA 2NUBA 5J2PB 1B70B 3BGFA 3NXZA 2PY5A 2XBPA 3T1HK 3HVTB 2M88A 4DU7A 3LPUA 4CGDA 4FLXA 2KQ2A 2ACMA 2WVBA 3J81U 2BJ9A 1IBMJ 4N47A 3QFPA 3HZ6A 2VGMA 2GGPA 4EYIB 1RHRB 4H4MA 1K6YA 4KFBB 2D9PA 4PG5A 3LM2A 1ILYA 4F4XA 5KT7A 2QWPA 3K59A 5AE3A 4WP9A 3CTRA 4JRPA 3OD2A 2VGNA 1KC8T 2D0BA 2HLUA 2E5LJ 1K8KB 2AYBA 3K8WA 3QIPB 1YRTA 2Q1LA 4DQRA 1TELA 1YDLA 5HL7Q 1NM2A 2FSJA 2RAQA 2YWWA 2GELA 1N48A 4UOHA 3LO3A 1QUVA 3TRGA 5KFUA 1Z26A 2DGWA 5DG7A 1HQEB 1U02A 4CFCA 3PJXA 3G10A 3MTKA 2JDJA 4M5KA 2JRSA 1UVMA 2NS1B 5DDPC 3SBTA 3KDOA 3RB3A 1HPZA 3DXBA 2QYCA 5JJBA 2J0SD 2Y8YA 1VRTB 2FXUA 2MZ1A 2VKZG 1I5OB 4B3TF 3D3BJ 2DH9A 5K9FA 2VG7A 3O3GA 2QN6B 1I1GA 4FVUA 5E3AA 3KLGA 3H2LA 1C1BA 4F02A 1FXRA 2CYYA 2D9OA 3NFAA 2J0QD 3D68A 3IRWP 3KXDA 4EFHA 4KHMA 4YDUA 1Z2LA 4JB8B 8ATCB 3O44A 5KFQA 1F21A 3MECB 4J7CA 2H3GX 5ETQA 3HKWA 4FK0A 4A47A 2BM0A 1K9MT 3FZFA 1PSDA 2WW4A 4Y0WA 3MURP 3ELHA 1VJQA 3MAHA 1VSMA 3T1YK 4V19J 4OVLA 4B3TJ 4NYNA 4DCOB 3ADAC 4AHUA 2QTWA 3HJFA 4NA3A 4YDUC 1BQNA 4KHPF 2VQEF 5J1EB 3CW2C 1H6KX 4EZ9A 4DV7F 2DRAA 2O4GA 1QUPA 2CZ4A 3WEEA 2ZZMA 4Q45A 2P2CB 5AQMA 2WSCC 4DTUA 4OHWA 3MR7A 2JX2A 1X1PA 1XQIA 5A2QO 4DUZK 1IKWA 2GVZA 2VBYA 3J7YI 4KV8A 3U1LA 4E1NA 3VQQA 1WOSA 2ZUAA 2VIHA 2ZVSA 2O8BA 3ZSOA 3CB4A 2L9NA 2A3JA 1FDAA 3PZPA 2RUGA 5HROA 5D77A 2J7KA 1YVNA 2RD5C 1YX2A 3ATVA 4I64A 2PGCA 3B82A 3AVNA 3IC1A 5FPMA 4OI6A 1X3NA 4CQ1A 5B0CA 1RADB 3MPUB 3DOMA 5M2UA 3EUNA 2KXHA 5HJYA 4DR7F 3S1TA 3CVKA 2OELA 5B8HA 1GLLO 1XEZA 1IBMF 1K44A 5AZIA 2Q6BA 5D6GA 4F4ZA 3D45A 1N34J 3W65A 4EO8A 3V6DB 3EKSA 2YWEA 1Z05A 5HJXA 3AB4B 2FJXA 4NLCA 4LY7A 4OJRA 4G1IA 3IBWA 4V19X 1T03A 2KB2A 4RBVA 1WUAA 1RDUA 1JNRB 4J9VA 1VAZA 2VFUA 5KFFA 1QDUB 4M94A 4OV1A 1J54A 3E1YA 2APOA 1VQPN 1X5SA 1HNZJ 3HHLB 3KZBA 3EDQB 3C65A 2IMOA 3GQCA 3VEXA 2HBZB 5EWFA 4ED6A 2XQCA 1GMUA 3SQ2A 2EBEA 1JLGB 1ZM4A 3A8IA 4CH1A 5D4LA 4H4OB 1EP4B 1RZMA 3TNVA 4FZXC 1RTDA 4RNHA 1WJ9A 4DUYJ 3PYDA 2EC2A 3WDOA 2QK9A 3MN9A 4ZVSB 5KOXA 4FJ9A 1RYRA 1RWKB 1TUGB 4K5RA 1UOCA 5AQZA 3M6GA 2BANA 1WF2A 3THXA 3HYFA 1M5HA 5L1JA 3UD4P 1DQAA 4QS8A 3Q23A 1KLMB 4O8UA 4B9LA 4IKAA 4J2DA 2QKKA 3WX8A 1YJ7A 1KDNA 4P9SA 1AXQA 1FKPA 3PIOL 5B0DA 4PPDA 4JBCA 4DQIA 3EPIA 5CA5A 2DFHA 4C0BA 4IO9L 3ETMA 4C98A 3MWBA 3G6XA 2EHGA 4K25A 4WK3A 1KD1T 1IKYA 1RAOA 3VQDA 1FFWB 3FVYA 5JMVA 2FGOA 3LTOA 2OTLN 2K1RB 1PC5A 3EPGA 2UU9F 2OH2A 2G8VA 5I3PA 4BGBA 5AXMA 3GIMA 4FS2A 1Q8BA 4DV2J 4DG1B 4YOWA 4XH1A 4IEIA 4JKGA 1ZBUA 1N0VC 2YH1A 2JEGA 3QNNA 2BACA 2IVFB 3CJ5A 2OP5A 2P9NA 2F9JA 4K0KF 1F2HA 2CKWA 4YB7A 1NNEA 1VC5A 1NZAA 4CZLA 3DNCA 5J2NA 3CCRS 3G9CA 3D1HA 3OFFA 2W2NP 3FR0A 2C3OA 1FJEB 4EUVA 4QIGA 3P6YC 3DC2A 4W5OA 2PO4A 3CCLS 3GCWP 3TA2A 4HDHA 2D3UA 1S1VA 2JNJA 4L3QA 3CJ4A 2YKNB 2G8WA 2CRLA 3R3TA 3GJQB 2VKRA 3IA0A 4JS5A 2B8PA 2G0CA 2YKPA 4W5QA 1BIZA 1LW0A 1HNIB 3DM2B 4YHHF 2Q97A 4HACA 4DWIA 1TZ0A 1UFLA 1B0VA 4KAZA 2BJ8A 4LFAF 4CHOA 4G1QA 1FCAA 5K8PA 1ZXOA 3KLVA 3WQPA 3DM2A 3KOAA 4M5MA 1SIZA 4ZLNA 3WXIA 3DRRA 5AQNA 1JLEA 2A3ZA 2RU9A 2P9IB 3G25A 5D0HA 1FERA 1SL1A 3PTWA 1BIUA 3QRQA 2IYGA 3CQ8A 3EJMA 1ZC6A 4HHHA 4DV4F 2XRIA 5A0YA 2RKIA 3H45C 2QIFA 4K4UA 3MR3A 1VJWA 4B3SK 1F9HA 2H51B 3D67A 2BGGA 4I67A 4ZPAA 3Q8UA 3BF4A 4CZCA 1WBBA 1X8DA 2F40A 4K8XA 3M8PB 3NOGA 2NXJA 4CF2A 1S0VA 2VONA 2HRYA 2Q6CA 3EVWA 1YG0A 3QJPA 3OA9A 2BJEA 3HHEA 2XM3A 4J9OA 1SKSA 4CERA 3SQGA 1JJ2M 5BRFA 4DUTA 5H1SQ 4CD3A 2C2EA 5F9NA 1WF0A 5L9NA 5H9EK 4YOTA 1Q78A 4DL7A 4LMZA 3UWTA 5KFDA 3D4JA 1FRHA 3D7SB 2G8HA 3WUHA 2HKEA 3C15A 3LGHA 2WSEC 4DV5F 2XI2A 2A1SA 2YX6A 2DGSA 3ENOA 5IT9O 3BH7B 4ERDA 1GLBG 3R5JB 4YR2A 2R8JA 3HVWA 1EX8A 1QSYA 5DG8A 1QAIA 5LXYA 1H73A 1S1UA 3UNYA 4HHTA 2ZH1A 3ZNUA 3OYIA 2FHKA 1VIOA 2QG9B 2HBQB 1URRA 1X4EA 4H4OA 4CT9A 2FHMA 2YBVA 3L4QA 5JXSA 3W66A 4CZKA 2Y1RI 3I0SA 2XMKA 1Q86T 2ZF5O 1RHKB 1CZAN 4JV5F 1ZS6A 3IMQJ 1VS3A 3IRXA 1SUQA 1NBEB 1FESA 1FJGK 3LPYA 3ZTOA 2E7WA 2O8DA 4K4WA 3MD3A 1B64A 1RT5A 4ES3A 2YWKA 4C1NK 2R3VA 1SIWB 3AO1A 4M5IA 4UY8T 3CCSS 3EMTA 3HO1A 1QZ5A 4EEYA 2GQQA 4GV3A 4CLZA 1I3AA 4CGHA 3BR8A 3HX9A 2DXFA 4M7XA 4UUXA 2G8KA 3TVKA 3DAWA 2VPXB 1PCAA 1E6VB 3CQXA 3OYEA 1U1RA 2VBXA 4FW2A 4W5NA 2CZ9A 4EBDA 2UUCJ 7FD1A 3PW5A 1HPMA 1JLQB 3KLEB 2QL9B 3R5GA 5KT4A 4U6PA 2O66A 3BDPA 1TV6A 4U67L 4RW4B 4NZ7A 3Q8QB 4IJNA 1YRUA 3PO4A 5JS1A 3NCRA 1HNIA 3ISZA 3SEOA 4MK9A 2RHQB 1UAXA 3AVCA 3H40A 4OJ1A 2CG8A 1NPKA 3TTFA 4FZYA 4QPTA 3GPAA 1ZPVA 4UW2A 3HJVA 5KFYA 3J80O 1U1KA 4F67A 1ZAXA 1OY6A 1RAIB 2KO1A 3M7VA 2YPZA 1S4EA 2FZKB 3DMJB 1WSVA 2ERRA 3J80U 2GEMA 2GIFA 2OTLS 4DV2F 1IR2A 3H08A 4DR5J 4FKYA 1YTAA 4WPAA 1HBUB 2W9BB 4IO1A 4X84A 5J1PA 2LQ5A 1LV5A 4K2XA 1SKRA 4Y2MA 3MM5B 4ELUA 4WKRA 3CJAA 5L38A 3MCMA 2CQPA 2WVEA 3Q0AA 5H1SV 1W0HA 4CJKA 1B7YB 2V8HA 2IDLA 4NLQA 2RF2A 2G2ZA 2ZH4A 1TTHB 4I6MB 1X4AA 4JI1K 5E26A 3C7NB 3EGVA 1VSLA 1A6LA 4DU3A 2P9SA 1FRKA 3W3SA 5AZJB 4Y2IA 1KOHA 2EXUA 2MKCA 2EKNA 4DR5F 5L1LA 2FZCB 1ZH5A 2MKKA 3WNFA 4RPFA 3I82A 3HP9A 5GADP 4AD6A 1D09B 1YIJS 3MMVA 3CJ0A 4ISGA 4KQZA 3SLCA 1H2UX 2OD4A 2DNPA 3TUPA 3K5LA 2R7SA 5IZHA 5AJ3K 2DY1A 5KTQA 2XY7A 4AM7A 4RW7B 1OY9A 3I31A 4M41A 4YP3A 2GV9A 3S3NA 2O8EA 1F5BA 3PSFA 4Q5VA 2QO3A 2PYLA 5JVHL 4UOCA 4J37A 3GIJA 2C2RA 2N7YA 3MEKA 5H9FK 2J9EA 1E4GT 2D5RA 3FC9A 3U27A 2HGMA 2K3IA 1SJRA 3PKMA 2QWLA 1ZPWX 2HFNA 2BMBA 1EQ0A 4OYIA 3NS6A 4DG1A 2F4VJ 3NMUA 2RT3A 3LDNA 4IBNA 1A7GE 4CHQA 1EQYA 5F1XA 1N8RO 3GSDA 1UW9A 3LQVA 4E8UA 1D9FA 2QXLA 3CIZA 5E3PA 2D74B 3VHQA 3K5PA 2UXBJ 2KKZA 3GIKA 2H4YB 1VC6A 2ZZTA 3SJHA 4ES1A 2IJRA 5G0RA 3VAJA 4DV1F 3OYMA 1X4CA 3NGZA 2K3KA 1QSSA 2Q36A 4K4ZA 3KKSA 2QLBB 4TLRA 3O3LA 5F3ZA 2G2OA 3TU5A 3AO3A 4MFBB 5KAKA 1I94F 2WVDA 3WIUA 1PBUA 1V3SA 1LK7A 1RT2B 4FM1A 1HNVB 4OX6A 4ZN1A 3CCQN 4OPHA 3CMAS 2BRLA 2M8DB 4FXWA 4G65A 4ELVA 3PIOQ 5F8HA 2ZM6K 1FNOA 5KQDA 2BKPA 3RUBL 2RQCA 5BR9A 1ZTWA 1JCGA 2ALYB 2HS4A 1HQUB 4L74A 2FJVA 4YB6A 1FX4A 5AQTA 1NMEB 3C2PA 1PAEX 4G6VB 1S9EA 5DETA 3LDPA 4O5FA 3KVGA 4FP9A 4W4MA 1T05B 3CYMA 9ATCB 4LR8A 1JXVA 2RKIB 1QAXA 3G4SS 4IOAL 3JSMB 2C3YA 2AP6A 1MMDA 3E66A 1GLJO 1BQMA 2W8KA 4MQ3A 4FK2A 2V8GA 3C94A 3EE8A 1MROA 3VVTA 3MHYA 4U7UK 3DRSB 4LVOP 2OD6A 4DR1F 4ECZA 1SJ4P 2A6MA 1D3WA 2HFUA 1YF5L 3U02A 2YNHA 2WONB 4ENOA 2HHQA 1NXIA 2W2PP 3KKRA 3UR3C 3PJ9A 2CJYB 1T05A 1RT5B 3U7JA 2XB2D 2G2YA 4JI3J 3ZC4A 2D3OR 4CF9A 4RUCA 2YHYA 2C3MA 3PHEA 4LRCA 1C0TB 5EGYA 3HSDA 1W2IA 4RR5A 4A59A 3SXLA 5L8RC 3V81A 3BZKA 4HDGA 1DAXA 2F7VA 4ZCIA 1X9JA 4F4WA 2A1BA 1EKEA 3CC4S 3BF3A 4IDKA 4DR4K 3MPDA 2ZWOA 4BQLA 1S79A 3CF5Q 5KG1A 1NU0A 1KSPA 3DLBA 4DPYA 5KFTA 3WBZA 2FSKA 3E01A 1BHNA 2LLZA 5I42A 1S5JA 8AT1B 3TP2A 2VD3A 4GW6A 3NLCA 3H4DA 5C2DA 2NRXA 4LFAK 4H5TA 2KJWA 1Q82O 5DM6L 1V6HA 1HD0A 4HT5A 3HVTA 2O67A 5GAGP 1M1GA 3R6MA 3Q8YA 3H1VX 3CCZA 2C1EB 2ITMA 1KVIA 3OL6A 3RBXA 2MZSA 4MMOA 1RT6B 1QY7A 3ZSRA 1VRUB 2RE2A 2HVEA 1NK8A 1SBRA 1HD1A 2IIHA 3CD5A 1N36J 1O13A 4NZ6A 4LREA 1JLEB 3MM6B 3E9LA 2W7OA 5GADI 3O8MA 1VQNS 3W60A 3AY9A 2G9OA 5JLHA 3L2WA 4CJQA 1RE1B 2E5JA 5DM7L 3EZOA 2ZJPQ 1O8BA 3EX7B 1XQSC 1UPPA 2MQ8A 3HM8A 1T3NA 3LP0A 2MZRA 2O3DA 3SUNA 5G4DA 3CDAA 2YNGB 5B0GA 2KVQE 1VHIA 4LF5J 4H4KA 2ITGA 2IVNA 2G13A 3ZTRA 1QJHA 4CHPA 1U26A 4FOEA 3NL0A 3THVA 3HSCA 3K9KA 1S0OA 2P9KB 2GWJA 4L3NA 5M1PA 4WJBA 5B7WA 4YS2A 1E3MA 1IJJA 4NLGA 3QWPA 3KK1A 2NLXA 2HHHK 4JI0F 4JLHA 1KEKA 3KDNA 1CQNA 1S10A 4CJVA 1FNMA 4FYDA 5ETNA 1QLNA 3PW4A 5HMXA 2W4DA 2E5HA 3DDNA 4BC7A 3OYHA 4KI6A 4USWA 3OJSA 2OPQB 1IUJA 1NAQA 4XDCA 4I0WA 1KQSM 2JJ4D 3EKUA 1NH8A 3K5OA 2W4PA 1IWGA 4AH9A 3GLJA 3WXKA 3LDOA 4YUDA 5ADZA 3ZZ0A 3GFXA 5HVFA 3OVBA 3G8QA 3IAYA 3OS1A 2UVUA 1C0TA 4BQZA 2PFFB 2XLIA 2FY1A 1AFIA 1SJQA 1YJ9S 2P9GA 2PMWA 3SUPA 2BQ3A 1VQ8S 1WI6A 4DV0K 3CG7A 1VQLN 1EETA 4ED1A 2ZVIA 4B9NA 2HHXA 2GMHA 1WD6A 3NNAA 3OTEA 2FVSA 2RN2A 4EK2A 4WBFA 2LYVA 4ED5A 2DR8A 4ED4A 4UQTA 4BR0A 1FW6A 2L3MA 4DX5A 2UXBK 5HMYA 3RMDA 2IS3A 2VBWA 4ZPBA 2Q3SA 2Q2RA 4CI0B 2EX3A 3IAM9 4ZS6A 3ZX0A 4WIQA 1SZ2A 2VG5B 2YY3A 3V1QA 3TAGA 5HQMA 1ITGA 4JNEA 5GAHU 2B3TB 4AHTA 3LDSA 4OHYA 4JHDA 2YWHA 1E6VA 3KIOA 3OYFA 5F0XA 1FKAF 3T7ZA 3HK2A 2UV8G 5LM7E 4KY3A 1GQEA 1J5OB 3P49B 3M2VB 1YK9A 4RJVA 3OT9A 4DMZA 1YJNS 4B9VA 4CE9A 2CJBA 4NXNF 3K7RA 3F0NA 3B8AX 4PWWA 4BRQA 1KRPA 2NXEA 4RWTA 1PJ6A 1RBRA 2EFGA 4NLPA 3R5CA 4LSNA 3BUZB 4BRHA 2HWTA 5F8JA 1ZBHA 4M5LA 4OX9J 5HRNA 4YEAA 2P5OA 2ZOMA 3P5BP 4M95A 4X4TA 1F5AA 4EP4A 2ZH5A 3CPWR 1IN0A 4DPTA 5CE3A 1VK8A 4ILGB 3MD1A 4KHSA 2DHSA 4JEPA 1WC4A 5ETRA 3VEWA 3E8OA 3A8JA 4K59A 1LOTB 2DR5A 2OZMA 3QINA 4LC9B 1DFDA 3OL7A 2KT5A 3IDHA 3IKMA 2DNMA 2V34A 1H3DA 2CPYA 3ZT1A 1HPZB 1L3KA 2VQEJ 5C24A 1S97A 2BV3A 4U7UD 2OTJS 2Z1JA 1T6DA 4A8KA 4CHZA 4CEZA 4C1NI 3W64A 4BRGA 4LF8K 1TFYA 2GX8A 1ZYQA 3L2VA 2X51A 4ZP8A 4KGXB 1R43A 4AF1A 2XSJA 2A41A 2POKA 1SH2A 4JI3K 2BE2A 2F63A 3T9NA 4GO7X 2XMAA 2YCHA 4X64K 1JLFA 2CA9A 1BY9A 3THWA 4WWSA 2E8AA 5FRNA 3FDSA 4DPXA 3BZCA 1YXQA 3SCKE 3VAHA 4FDFA 3VQAA 4DLEA 3GG0A 4X4SA 4CLSA 1P27B 5DLFA 4PKIA 1S72S 2DR7A 2Z58B 2ZD1A 1RISA 2KL8A 3ISND 1YVFA 1Y97A 4NLDA 1C1AA 3US5A 1RDDA 5KT6A 1UEKA 2Q0UA 4FF4A 4C0OC 5CXTA 4GMJB 1OWXA 3GYGA 2FF3B 4ECYA 4HUFA 2CPHA 2R7YA 2AYGA 1RACB 3ZZRA 4M5DA 2NLWA 5CR4A 3BGRB 5EUHA 2GNKA 1L3SA 1LWCA 4E7JA 3HHNB 5K14B 2C2DA 4ANDA 1TAQA 1HNXK 3TEHB 4ZVEA 2O8DB 3AVLA 3SFGA 3T1HF 3NBPB 3PDNA 3EYZA 3CM6A 4JI1J 2V2ZA 2AKWB 4DR3F 3QJLA 4DV6J 2FJWA 1ZAVA 3QMQA 5DK5A 4PKDB 2CZVC 3QT7A 2LCWA 5J2QB 4NXNJ 4ZITA 1PGZA 4CLWA 3OTCA 1F6TA 2OPPA 2B4PA 3CDWA 4DUYF 3ID8A 2OGUA 4JD2B 1YZ7A 3H0PA 4OLOA 3FEYB 2EW9A 3GB0A 1FRMA 4ZVQB 4BC9A 3B4DA 4KHNA 1OPZA 2JLGA 2KRRA 4OX8A 3KLEA 2C2MB 1ZBIA 1JJ2R 2ZJQL 3OTBA 3BGUA 1M1KT 2F9TA 3FSXA 3M6UA 3CCUN 1R0CB 3K0SA 3NVMA 1GLEG 1P1LA 1RDBA 3AO5A 1VFJA 2IM2A 1QS4A 4FXDA 2UP1A 2G0JA 2DCLA 4A8YA 2P9UB 4WYBA 3G6ES 3OTOF 4HUEA 2VUGA 1Y64A 1WB9A 4CJPA 4LF6F 4KIAA 1M90T 4EHTA 4OJGA 4O3SA 4DR6J 2MQNA 2WVCA 2GZOA 1GOAA 2E9TA 3MEEB 4X4VA 3LA0A 2DJWA 4OKEA 4OLPA 3CJSA 5AQJA 3R6GB 5C25A 1I51B 4WCEL 1WSRA 4Z4EA 4J9PA 3PJWA 3MMCB 2HZCA 1UVIA 1AW0A 3O6QA 2QWRA 2HWHA 4URSA 1YGYA 2N4DA 3AGKA 5CYMA 1AUSL 4X66F 3FUYA 2O8CA 2K7KA 1PYOB 4FM0A 2HAFA 3W8PA 3S41A 4M1KA 1S76D 2XGQA 1J6ZA 4IJAA 2E88A 4PKHA 4JYAK 3MCNA 4LQ9A 3NEKA 4K4VA 3UW1A 5F8NA 2XNRA 3RMBA 1RT3A 2HQGA 4OZ2A 1S1XB 3V6HA 3NCPA 3RJMB 3QAUA 4U9RA 2LEPA 2Z0GA 3D0HE 5DQGA 4KH1B 3WC2A 2XCAA 4ANCA 1RNHA 3UNGC 3H4BA 3C0BA 2EKYA 5I4MA 3LOUA 1HR0K 1FI4A 2ZH6A 1G1XA 3UCUP 3W9JA 5ITHA 1Q82T 5HMZA 4B9QA 4A2AA 4ZHRB 4KH4A 2VFTA 4PXEA 1S1VB 2F8EX 4NX9A 2QV6A 4DV1J 1H1VA 1ZBLA 1NJYA 5D3GA 4NEZA 4EBCA 2OIHA 4DN9A 2N82B 5E0OA 4IFVA 1TKTA 4USTA 3TZWA 4ZLPA 4NA1A 2YQ3A 3OQ2A 5C7PA 4UF4A 4D3GA 4ZVOB 1AUDA 4L76A 3DXKA 1T9VA 4FJNA 1Q81O 3O9TA 1V9OA 1APSA 1FJGF 4LIWA 5KFWA 1I94J 2C22A 1P6TA 3VGMA 4QBUA 3D2FA 4KPCA 2DHAA 2HQ3A 1EHWA 4DXLA 3CD6N 1N32K 3H25A 4ZHRA 3PYFA 1HW9A 4X62J 2XTJP 4ZJQA 3QMLA 2MHEA 3I9V9 4ZCKA 3AAPA 3VQCA 3WNGA 1WHXA 3CJ8A 4D3HA 1NLVA 4LBPA 2ASOA 3VV2B 2ASYA 2YX1A 1N56A 4IFEA 3MK6A 4PWDB 1GXTA 1F5CA 3KUHA 5GAHP 2HHHJ 5ETVA 4ZA1A 3HI9A 4BC5A 1U24A 4FJ5A 3UFCX 5AQQA 2NXUA 3CO0P 4AQYJ 5IS2A 5BRHA 1QE1A 4KHYA 4Q8EA 3TAMA 1MW7A 4FLWA 3HZGA 5KFOA 3LP3A 1M1HA 1ZTTA 4F4AA 4ZKAA 3N6LA 2PBDA 3MMBA 4OYAA 4C8ZA 4YR0A 2W41A 1OJ4A 5HAOA 2FPHX 1GTEA 4A8FA 2DEJA 1K8AO 3NGIA 3M8RA 3O9SA 2JZ5A 2IJFA 3DYAB 2QJ3A 4F4YA 1AZSB 2RHKA 3MM9A 4Q7AA 1C0GA 1FKPB 4X4OA 1N5YB 3BKFA 4GKJK 4DS4A 4Y0FA 4KHQA 1F9FA 4LQ3A 1SPBP 4JI6F 2BRKA 4RU2A 5GVQA 3TPQA 1UW4A 3M5RA 4MJKA 2BKNA 1XNRJ 4K4SA 4B1XB 1KVCA 5LSLA 2M3DA 1M5PC 3M8QA 2L41A 1TK8A 3CIMA 5AQGA 3OYJA 5IC4B 1T11A 2GIQA 4QCLA 2N7CA 1N5VA 2HQIA 4ZVPB 1REVA 3B6BA 1SXLA 1U47A 2ZM6F 4B1WB 1YAGA 2QLWA 2DY4A 3I8BA 4FWKA 3M32A 2Q3PA 2E2OA 2AQ4A 2HHPA 2GS8A 3GOIA 2CQCA 3IG1A 4YY3F 4KO0B 3CC7S 4B9MA 1I3OB 1HBOB 1NKBA 1U1MA 2SXLA 3HBTA 2A1RA 2FJBB 2KKHA 4KR0B 5CD4A 3UKRB 1RSCA 4QYRA 2E5IA 5M1NA 3OJUA 4M63A 4ICLA 1R3NA 5D0GA 4CJFA 3ENQA 1VQOS 4JKDA 3I56S 2HS0A 2GUPA 4TLQA 2DFFA 3A5MC 1NK7A 1EETB 1SQGA 4RNNA 3L7PA 3V6KA 3UR0A 3P5TL 4I4BA 2KH9A 3O1BA 4XDDA 3DLLL 2FVQA 3SMPA 1RFQA 1PBAA 4Z4FA 4BGAA 3LP2B 3SZ2A 2UXBF 3CC2S 5J2PA 3TABA 5EVZA 5BPLA 1FKOB 3EEQA 3AOAA 3T5JA 5LMNJ 1ZA2B 3B54A 3FE1A 4WFAQ 2H9ZA 4JV5J 3KK3B 3M9OB 2E2PA 4WFZA 1UWAA 2W9AA 2NUUG 3FQKA 2G1DA 7FDRA 4ELTA 4LF4K 1MWZA 4IO8A 3H2UB 2V7ZA 1WHWA 2AX0A 3ILLA 3G2XA 2QWQA 5GINA 5HP1B 4J2AA 2CXEA 1OYDA 3K0JA 4JI4J 2QFIA 2QI2A 3OV7A 1MU2A 2K8GA 5ETLA 5M1OA 3I5BA 4CO2A 4PQUB 4J91A 3NF6A 1TV6B 1RWVB 2RVJA 5M1QA 3CCJN 1FD8A 2BEFA 1JNZB 2P9SB 3TUZC 4NI2B 4Y2KA 4RUAA 5C5JA 2VG6A 2PE8A 1TUVA 4N8OA 2H54B 3M8QB 1VIXA 3RW7A 1OS5A 4WFBQ 3NWGA 4Y2CA 1FNXH 1TMJA 1UVJA 4OI0A 4Q2LA 3D5MA 3AA3A 1Q8LA 3ZSZA 4CHYA 2ZJPL 1X60A 4ZJOA 2VHGA 1SV5B 1S59A 2KRBA 1B0PA 3LGNA 4GRSA 2XULA 2J6TA 3NMRA 3TQ1A 2HBKA 3ETOA 3DMJA 1ZM9A 4USMA 3DU6A 3NAHA 1Q1KA 4HI2A 3HPGA 4J9SA 2ZJRQ 1RTHB 3PX4A 4YFUA 3ZT4A 2DNKA 2GBZA 2J76E 3J8AA 1LFWA 1JMTA 1UA0A 2W4CA 4QIWD 1FA0A 5C42A 2E1CA 5IOLA 1JCEA 1FEEA 3M1VA 3ENHA 1QVGM 3JB9k 1RTZA 1L3TA 2UVRA 3EGWB 1KWMA 1YIJN 1CJUB 2OUGA 3L3VA 2YNIA 1M0SA 3J7Z5 1WKJA 2NXCA 2FBVA 3AJ2A 1CJVB 1TFWA 3EY1A 3EZWA 2CQDA 2OCEA 2P9CA 4LH4A 4HTUA 1HNWK 4ZIWA 3GWCA 2Z1IA 1ZA1B 1M5KC 3HL8A 1KLNA 4BC2A 1MA9B 2D0OA 1RU1A 3Q8RB 4HVJA 3PKYA 4CGGA 1VBKA 4CJLA 5AE1A 1EIYB 3CO9A 2X6SA 4KT0C 2X7IA 3IP0A 3AY0A 3EVMA 4GKKK 4BDYA 3P8BB 3KLIA 1H0HB 3POTB 1JLAA 3CCTA 3BYRA 3M6XA 2IFXA 3THYA 5T7LB 2IMWP 1Z1ZA 3LPEA 5IFMA 1RT7A 1G2EA 4G3IA 3QBCA 2EFVA 1X4DA 3IXQA 4AE5A 4A8SA 1Q86O 3DDIA 1XMOJ 3TYTA 3E51A 1YTYA 1NUEA 2NXNA 2QLJB 2LDIA 1IM6A 3VTIA 4MIBA 3N5FA 4FWRA 1YBTA 4KTZA 2Z2LA 5FDLB 3DLLQ 1D8ZA 2V4JA 5KQ8A 3FEXB 3THYB 3HLUA 1RHMB 3MAAB 4B8CA 5A8RB 5CZ1A 5EHHA 1S12A 2BYCA 2KW4A 2DVIA 5LXRA 2P1JA 5AQOA 2IY5B 4DR1K 2CH6A 1MMNA 2ZHAA 1LWFA 2DIVA 1ATNA 1UTAA 3PW7A 3IUCA 1FWPA 4FLVA 1K1QA 2W7AA 4MKVA 3KNAA 3PYGA 4CNZA 1CLFA 3WT0A 5LL6d 3FEZA 3G6YA 1AFJA 1K73T 4DV6K 1C4AA 1NKEA 4H4KC 4HTJA 1DTQB 3JTNA 5HANA 3Q22A 2NREA 1X31C 4MT1A 4WZQA 5FROA 2RUSA 3L0QA 2D0PA 2NSCA 2Q0RA 5F41A 3ITHA 4IWVA 2W8LA 2MZQA 4DR7K 3R3LA 4GVMA 3M8ZA 2BJ3A 5KFMA 4C4WA 4H0VB 3ZX2A 4WF9L 3T6JA 3SSQA 4USHA 1VQKS 1IV0A 4GVEA 2RDIA 2YNFB 2VQFJ 4DTSA 2IVYA 5M1KA 1M90O 3O4WA 1G6BA 1U0SA 2A6AA 3RBZA 1S22A 3LZIA 3LL3A 4QU6A 3KJQB 3ITHB 3AH6A 3BQ2A 2HQCA 4F7VA 4N7TA 2G8IA 3MCSA 4MTPA 3W5XA 1IR1A 4BG8A 4WXOA 4K4XA 4JD2A 1KKHA 1XR7A 3D0PA 4CGIA 4ZDNA 2GMLA 1NLKL 4JKCA 3T3FA 4NE9C 4DI6A 4J9KA 5C0YA 3H46O 4DX7A 3ZZPA 3SK3A 5ETSA 4DQPA 3Q2TC 2E4LA 3KD5E 1JLGA 2VPYB 4JI6K 4KAIA 2B9EA 2VFSA 5JVHQ 2E1ZA 1RWUA 3KMQA 5HN0A 1KR4A 5L1IA 3M2UA 2HFZA 3BBBA 3SAFA 4GC6A 3K2YA 1NSPA 2P9LA 4ZJLA 4FZZA 2V4JB 2VA2A 4HH0A 2DR6A 3VALA 5J2MB 4G9ZA 1TR0A 3W2VB 2BH1A 4WTOB 1H7WA 1EJ7L 1WAFA 2JWKA 2UUAK 4X4QA 3UI3A 3F9MA 2UUWA 3FKBA 3B78A 3PACA 2AJ4A 4TU8A 4M5HA 2MQOA 1N33K 2JL9A 3DHXA 4Z0UA 4DL2A 3MFIA 2BE7D 1KVJA 3WXLA 1WSJA 1F60B 3C6UB 1R89A 2GVDA 2P5GA 1NK6A