1LWCA

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
506
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 146
structure length 506
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwcA05
1A5WA 3IRXB 4EZ6A 2IDOA 2HHWA 2BRLA 5KFSA 3M8PB 3CFOA 4E3SA 1JLGB 1NOYA 3H5SA 1JIHA 1Q8IA 3OL6A 2VG6A 3VQDA 1XWLA 3DI6A 1VRUB 5J2NB 4PUOB 4EO8A 2DFFA 3BGRB 3LAMA 1U04A 2W7PA 2IBKA 4Q44A 1TKZA 4H4OB 3GQCA 4KO0B 5I42B 4IH6A 3FQKA 2R7YA 4FLWA 4Q0BA 1XI1A 3L2WA 2PZSA 4N41A 2B6AB 1R0AA 1VK0A 2NUBA 1XHXA 1RDBA 4NLGA 3HVRA 3KK1B 4W5TA 4F4YA 2LSNA 1DTTA 4NYNA 1DTQB 1ZTTA 5DMRA 4NLQA 4CEOA 4HUFA 2D0AA 3G86A 1BIUA 1RT7A 3TARA 4CJWA 1NKCA 4CGDA 3CJ3A 4FBUA 4JUZA 4FLZA 3M9MB 3HPGA 4R8UB 3V6KA 2G8FA 1IKWB 2C2RA 1S9EB 3NBPA 4I7FB 1I6JA 1S97A 4E89A 2WRMA 1KLMB 3SPYA 4TLRA 3O3FA 4KE5A 2RF2B 3VQEA 4U6PA 1KHVA 2W7OA 2BQRA 5C25B 3QZ8A 1HQUA 1S6PA 2OPQA 1RA6A 4TN2A 4RNHA 3NGIA 1SV5A 4BE2A 4AH9A 5KFEA 2BR0A 1B9FA 3NAEA 3LP2B 2JLEA 4RZRA 4DSIA 5FDLB 3I5BA 1MMLA 3K57A 3TAFA 3MXMA 1L3VA 3T3FA 4JV0A 2VG5B 4ZHRA 3L2UA 2FLPA 3DOKB 3H5XA 2KTQA 3ZT1A 5C24A 1VRTA 3OJUA 3JSMA 5I3UA 1WN7A 4WFYA 4BWMA 3BJYA 3AVHA 3TAMA 2EX3A 4EBDA 1SKSA 3AA3A 4K4UA 4DEZA 4QWEA 1QHTA 4H8KA 4CGHA 3TR8A 3ZT4A 5HRRA 1ZYQA 3G6YA 3MFIA 4RNFA 3HKWA 4Q8EA 2XWYA 1IH7A 3LP0A 1NK8A 3PJWA 3DRSB 3DLKA 2OZMA 1L5UA 1C1AA 4DFKA 3AVIA 2KW4A 5F8JA 4O3RA 1NJXA 4KHSA 4NCGB 1BQNB 4ZPDA 4M3ZA 3PW0A 4FW1A 2AX0A 2AQ4A 2RKIA 3M8QB 3QERA 3KMQA 1BCOA 4KAIA 3T5KA 4J9OA 2E4LA 4OKJA 2ASLA 2W9CB 2HB5A 4IBNA 5D3GA 4O3OA 5J1EA 3HYFA 5CZ1A 2F8EX 4IG0B 2DFEA 4DL3A 3QO9B 3ZSQA 2R2UA 4DTMA 1LWCA 4KHWA 1IKXA 3T5HA 4KV8B 3QIDA 3CQ8A 5KFCA 4CIGA 2YKNB 4E7LA 4TQSA 1LWEA 1S0OA 4O3NA 4CGJA 1ZTWA 4HCCA 1N6QA 4YR0A 5FRNA 1RT4B 1RTIB 1YT3A 3AO2A 4TYAA 2GUIA 1RT1B 3PW7A 2HNYB 4AHCA 2FJXA 3CJ4A 4LSNB 4CJ5A 5KG2A 4NCAA 1QSLA 4QCLA 3MEDA 4IG3A 3BQ1A 2BANA 3CWJA 1J5OB 1S1TB 3NAHA 5DG7A 3OYCA 5CYMA 2XI3A 1KHWA 1D5AA 1S1VA 5DG9A 3KLEA 4O3PA 4I2QB 5HROA 1N5YB 1NK0A 5KG6A 1NHUA 2JEGA 4K4SA 1VSKA 1ZETA 4DSJA 4RW9B 3OL7A 3QIOA 4CEDA 4KI4A 3V9WA 3V6DB 2DY4A 4J2EA 4TYBA 4QWBA 4GVMA 5KFHA 3FFIA 4DL4A 1O1WA 3ZSYA 2ZD1B 3TANA 4WFXA 4DTJA 1LW0B 3HP9A 4GMJB 4CFAA 3IG1B 1C2PA 4L8RB 3RWUA 3G6VA 4KHUA 3VQSA 4TXSA 2YNIA 4QAGA 4B9LA 3LALA 2KFNA 1C1BA 2WB4A 3D5MA 1KVAA 5EWFA 1WSJA 4DQRA 2B5JB 1EETA 2VG6B 3K5MA 4CJ3A 4ZP6A 2V9WA 3ZSXA 4OL8A 4FJNA 4LQ3A 4DU1A 2GBZA 4QW9A 1LV5A 2QKKA 4KFBA 3HK2A 3S3MA 1I3AA 1WNSA 4DU3A 4NLTA 4ECQA 1JL2A 3TWHA 4IDKA 2VWJA 3IN5A 4E7IA 1REVA 5HRPA 3BQ0A 1LW2A 3AO5A 3DYAA 2ZE2A 1J53A 1UA1A 4F4KA 5KG7A 3N6NA 4CFBA 3DRRA 4B9VA 3QEPA 2IM2A 2KZMA 3CYMA 2D3UA 5J2QB 2VWKA 3KLFA 3LP1A 3MR5A 3KLHA 2I1RA 3I0SA 4RW4A 1SH0A 2DPJA 3QESA 3QGHA 1T05B 1S4FA 4KTZA 5HLFB 4CHYA 3HO1A 1S1UA 2IGIA 1D1UA 3KJVA 4MFBB 3M9NB 1EP4B 3EPGA 3KKSA 4KKOB 2F96A 5CY4A 4CK2A 5K14A 1BIZA 2FVSA 3G6XA 3S3OA 1QQCA 3NBPB 2IAJB 4HCBA 4DMNA 4FM1A 4BDPA 2IA6A 2D7SA 4KAZA 3UR0A 3P1GA 1NOZA 4EYIB 5HP1B 4FK4A 4NLXA 1MU2B 4WE1B 4M3YA 4ED0A 3RB3A 2OPQB 4W5QA 2XGPA 3H98A 5F8GA 1JLFA 3G0ZA 4YMEA 3SCXA 3NDKA 2HHQA 2AJQA 5CYQA 4ZP7A 1D0EA 1BI4B 3KLGA 3ISNC 2A1SA 4KB0A 3WNGA 2OPSA 4DSFA 3AO1A 5J2MA 3OYBA 4DL5A 1KSPA 4Z4GA 2ZQBA 4ED8A 4J9QA 4XO0A 4C8KA 3QETA 4ZVGA 2O4GA 4KTWA 1JX4A 1WLJA 1RTJA 2FVRA 4RNNA 5C24B 4O3SA 4NLPA 2BDPA 3LZIA 1TKDA 3CO9A 1WSEA 4KHRA 4H4MA 3ZSZA 3L2VA 4J9KA 4O44B 4Y2AA 4NLVA 2C22A 4K8XA 3TAMB 4PQUA 1GOAA 3ZSOA 1QTMA 2DPIA 2BQ3A 2JEFA 5SWMA 3RR7A 1U09A 4G1QA 1S6QA 1RBSA 3V9ZA 4BE1A 3GIIA 3T19A 3LP0B 3ICLA 3GIJA 1IG9A 3HSTB 1Z25A 2XY7A 1NK6A 4J9SA 4JV2A 2HNZA 3VQ4A 4CJPA 3OYGA 3THVA 1TKTA 4DTPA 4FYDA 3DLEB 5KFKA 3GV8B 4WXWA 2YNFB 3T5LA 4CESA 4CF0A 3OS2A 2KZZA 4KB7A 1EKEA 1RT5A 1KLNA 4B3OA 4MKBA 3V4IB 4OPKA 4B9NA 3AVJA 4CF8A 1RDAA 3HHKA 1JLBA 1RBUA 4NCBA 4KHYA 1HNVA 2J6UA 1LWFA 3MR3A 3PW2A 3DM2A 1RBTA 1IKXB 2HNDA 3SUNA 2BGGA 3NL0A 3RB6A 1QSSA 2JEJA 3C95A 4MQ3A 2YNHB 3PV8A 3AVCA 3QINA 3ISND 5KFYA 2WOMB 1DLOA 1IKYA 3AO4A 5C5JA 3GILA 1Z4UA 4O3QA 4E1MA 4DWIA 5FRMA 4NLOA 1CSJA 4Y34A 4FJGA 1RT6B 1T03A 4TY8B 2QKBA 3EZ5A 3ITHA 3LZJA 3L3UA 3IGVA 1HNIA 5KFVA 4ELTA 3KD5E 3H2LA 4CHOA 1TK5A 1BQMA 3KK2B 4DFJA 4LSLB 4Z4IA 3QLHA 1UWBB 3G10A 4OJRA 5DQIA 4N56A 4O0IA 4Z0UA 4ZPAA 3IAYA 4F8RA 4NRTA 4DSKA 1CLQA 4OGCA 4M3UA 3OYAA 5KFTA 2JC1A 2E9ZA 3V6HA 4OVLA 3Q8SB 5DLFA 3EPIA 1C1CA 3BQ2A 1RBVA 3H40A 2X74A 3DLRA 3LAKA 1J9AA 1HQEA 2WCXA 1C1BB 4J2BA 1RA7A 4CJVA 5KT2A 1QAIA 3RBEA 4ICLA 3H59A 3LANA 3H4BA 1EETB 4Q5VA 3HPOA 1GX6A 1KCFA 4FZZA 3KLVA 4EO6A 4CJ4A 1J54A 2GIQA 4U7CA 4Y1DA 2VG7A 4ZVEA 3C6TA 4Q8FA 3VQ9A 2V4QA 5KFOA 4TQRA 1TK0A 4CJSA 4B8CA 2X78A 3OYIA 4ZVFA 4I2PA 5KG3A 4CF2A 1FKOB 2IOCA 2GV9A 1LW2B 1S1WB 4TY9A 4DQQA 2ZE2B 1SH2A 4M3WA 5JXSA 3DRRB 1RT3A 2IMWP 4B08A 4FJJA 3V81A 4CJKA 1C0UB 5DGBA 3LP1B 4ID5A 5F9LA 3OYEA 2ILYA 2ATLA 3V9XA 1S1XA 2FBVA 3T1AA 2AX1A 2FBTA 2WONA 4E7HA 4K4WA 3RR8A 4FS1A 4M94A 3MXIA 1WAFA 4E7KA 1RAJA 4RW7A 4KREA 2R2SA 3GV5B 3AA2A 5DG8A 4FCYA 1IKVA 4GC7A 5HBMA 2R8GA 4WZQA 1JLAA 3CIZA 4BWJA 3QZ7A 3VQPA 5JS2A 4RW8A 3V1RA 1JL1A 3M8SA 1TK8A 1UAXA 4Z4HA 4FJLA 1SUQA 3BSCA 2AGOA 3VA3A 3TABA 3I0RB 3KLIB 4FK0A 4E19A 1JLCA 5T14A 5HRNA 4F3TA 4DTSA 1TL3A 3B6OA 1A5VA 3VQ6A 3ULDA 1Y97A 3OS1A 4ECUA 4B9UA 3B6PA 4QWCA 3OY9A 4E7JA 2I5JA 3Q8PB 5C42B 1XR7A 4JV1A 3U3GA 2PYJA 1HPZA 4WYLA 4O5BA 3LPTA 3MXJA 2HHVA 4E1NA 4J9NA 2PYLA 2OZSA 1WNEA 3RBDA 5CYQB 1JLQA 1SL0A 2HHUA 4ECXA 2P5OA 3DLGB 4EP4A 4ECSA 4FW2A 1WAJA 3CVKA 1KTQA 4BDZA 5KFAA 2WTFA 3VQBA 3OJSA 3KHGA 3HVTA 1VSLA 4FM2A 3TAQA 2UVUA 3E01A 3A2FA 2FJWA 2GC8A 5KFRA 1HMVA 4FLXA 2IJNA 2P51A 4OLAA 5HRSA 3NH0A 3K59A 1TKXA 1NNDA 1FXXA 3QEWA 4NLWA 4H4MB 4IQXA 4WFZA 1N48A 3AA4A 4J9RA 2OH2A 1XR6A 1S0NA 3DOLB 4N47A 1WSHA 3ZCMA 4G3IA 4RUCA 4G1QB 3EZUA 1NK9A 1S6QB 4CIFA 2OPPA 1BCMA 4F2RA 5J2PA 1KRPA 4R5PB 1FK9A 3SV4A 5F8LA 3C6UA 3NFAA 2R8HA 2FBXA 3MAQA 4MKAA 5DQGA 2HMIA 5CZ2A 2W9BA 2FVCA 4DSLA 4W5RA 3TI0A 2OPRA 3BSNA 3OYMA 1JKHB 4DTNA 3T5JA 1QAJA 5KGXA 1VSIA 1UOCA 1ZBHA 1EXQA 5DQHA 1JLEA 1QE1B 1S48A 3AVBA 4EZ9A 4DF8A 3D45A 3MTKA 1S0MA 3MEGA 1X1PA 4Y1CA 2HNDB 3CM5A 3OL9A 2BE2A 2YKMA 3KK3A 1SL2A 2HHTA 3IRXA 3L8BA 1NKBA 4KHQA 3QIPA 3SPZA 3GYNA 1T8EA 3SUQA 3DMJA 1XC9A 4B9TA 3M8PA 4K4ZA 2YNGB 3K58A 1RTHA 3LWMA 1LAVA 4NLDA 3IS9B 4MIBA 1QUVA 4JRPA 1S9GB 3MEEA 1DLOB 4CF1A 5J2NA 3CDWA 2ITGA 4PUOA 4CIEA 1RYSA 3V1OA 3BGRA 4M42A 3NF7A 1T03B 4H4OA 3ITHB 4KO0A 5I42A 4CEEA 4CCHA 3PHEA 1HNIB 3DLHA 1NK4A 4IOBA 4DTXA 2UUWA 5EDWA 2W42A 4I9LA 5KI6A 2UUTA 2HAIA 1BQMB 3K5OA 2V4RA 2DTUA 3DI6B 4DG1A 3EYZA 3QLHB 4CHQA 1VSHA 5KTQA 3HVWA 1HJRA 3BR9A 3VQ7A 3KK1A 1CXUA 1WSIA 2P5GA 2HVIA 3SYZA 3AVNA 4NZ0A 1TKZB 3RRHA 4EBCA 1T7PA 2Z1GA 1G15A 1W0HA 3JYTA 1A5XA 1YVUA 1VSDA 3AO3A 4Q0BB 2E9TA 4LH5A 5L1IA 4ZP9A 3ZSRA 4C8MA 4CJFA 4Q45A 1U48A 3VQ8A 1R0AB 4M45A 3NGZA 4CK1A 1XHZA 2WHOA 4BE0A 1HQEB 4R8UA 5KFPA 1IKWA 3PX6A 3MR2A 4I7FA 1QSYA 2OYQA 2BQUA 1DTTB 1K1QA 2O5DA 5L1LA 1KLMA 2YHBA 4NRUA 4QOZB 2YV0X 2E9RX 4OLBA 4MK9A 3CFPA 4RNMA 2RF2A 4BACA 1RT7B 1BISA 1WSGA 5C25A 4ED7A 3C6TB 2XCAA 3TAPA 1L3TA 4N76A 5KFGA 1IO2A 5KFUA 2IM3A 4NLRA 3GIMA 2O4IA 3CJ5A 4URSA 2FC0A 4I2PB 4FJIA 3O3HA 4ED2A 3NH1A 3SQ2A 4WXOA 3ZSVA 3PUFA 3AVFA 3VN5A 3I5CA 4H54A 3CDUA 4WZMA 4J2DA 1HQUB 1S6PB 3V81B 2JEIA 1SV5B 5KRSA 3DOKA 5KRTA 1S1XB 4ECYA 2XC9A 4NYFA 4AILC 4FJ9A 4ECZA 2WONB 1RTDA 3Q8QB 4DLGA 4CHZA 4JRQA 4CEAA 3U3YA 4J2AA 4DTUA 3FDSA 3SJJA 4K4XA 2FBYA 3PY8A 4K50A 5KT5A 1RNHA 4X2BA 4KHNA 3O3GA 3QGGA 4ZHRB 2FLLA 4ZTFA 2IM1A 3VQCA 4RW8B 1N4LA 1VRTB 3F73A 3JSMB 4O4GA 4RUAA 5I3UB 1JLCB 3DRSA 4E0DA 4CF9A 1TL3B 3TAEA 3TQ1A 4DS5A 4ZPBA 3RTVA 3S9HA 2UVRA 1BQNA 2HHXA 1YTUA 4LH4A 1C0TA 4NLUA 3SNNA 2FLNA 4LD0A 4YFUA 4M41A 3M8QA 4NLSA 4DTOA 3QGIA 1TQLA 4Y2CA 1JLQB 3GIKA 5DK5A 2F8SA 4DS4A 1NJZA 4MK7A 1NJWA 3QEVA 1TAUA 4IG0A 2F8TA 5KGWA 3TVKA 3DLKB 4F4WA 3QO9A 4OKKA 5SZTA 2XI2A 3HVTB 4FJXA 4KV8A 4FJ8A 4DL7A 3NH2A 2YKNA 4F2SA 1C6VA 1F21A 4ED1A 4MIAA 3HM9A 2RKIB 1RT4A 1RTIA 3VA0A 4JLHA 4DQPA 1RT1A 5D3GB 5J1EB 4DF4A 2KQ2A 2R2RA 3ZT2A 4LSNA 3V6JA 3QEXA 1LWCB 2JGUA 5KFIA 4PWDA 4W5OA 3BSOA 3BSAA 3KIOA 1X9SA 1D8YA 3RB0A 3TAGA 1LWEB 1FK9B 3VQAA 2D41A 1NHVA 1N6QB 1GX5A 4I2QA 3CDEA 3HL8A 3HPHA 3WNEA 1N5YA 4HHTA 2CJQA 3NAIA 2XHBA 2AGQA 4IRCA 3OLBA 2HMIB 4DQSA 2QK9A 5EUHA 4RW9A 5JS1A 4FJKA 2OPRB 3SUOA 2Y1JA 4CGIA 3V6DA 3MEDB 4IG3B 1TVRA 2BANB 2W9AA 5KG4A 5CYMB 3OYLA 3OYHA 4DFPA 1OS5A 4WYWA 3UIQA 1S1VB 2ZD1A 1ZBFA 2PY5A 2Z1HA 4J9PA 4Z4FA 4ECWA 3KLEB 3OSPA 1LW0A 4FBTA 5HROB 3PX0A 3MEGB 2J6TA 1VSEA 2G8IA 2YHAA 3MECA 3KNAA 4KHMA 2W8KA 1YVFA 3D0PA 2BE2B 2YKMB 5DGAA 5L1JA 3N6MA 4I9QA 3QIPB 1Q9YA 1BHLA 3DMJB 5DLGA 4ZPCA 3FFIB 1RTHB 2JC0A 3PO5A 4ECVA 2B5JA 3VQ5A 3P83D 1FKPA 4OPJA 2RPIA 3MEEB 4HVJA 2Y1IA 1ITGA 1TL1A 4URGA 4F4ZA 2YNIB 2XRIA 3NKYA 4TSXA 3VQQA 4FZYA 2J6SA 4OGEA 3L2QA 4Y3CA 4QPXA 5EWGA 5KFZA 4K4TA 3NF8A 1I39A 3CM6A 3PO4A 2B4JA 4DG1B 1SKWA 4URQU 3NF9A 4AHSA 2ZKUA 5J2QA 3O4QA 3KMSA 4KFBB 4RW6A 3AA5X 2KFZA 2IC3A 4IDKB 3JYTB 4DLEA 3NGDA 1NK7A 1SKRA 1L3SA 2G8UA 3FQLA 3DLBA 4FXDA 1REVB 1U47A 4PA1A 3KKRA 1T05A 5HLFA 3GV7B 3PVXA 3PR4A 4OKEA 3AV9A 3DYAB 4M3RA 3FSIA 4MFBA 1EP4A 4FVMA 1RT2A 3PW4A 4Z4EA 2X6NA 4KKOA 3OL8A 4EP5A 1T3NA 4CHNA 3H5YA 2UVVA 3KLFB 3OVNA 2AGPA 3KLHB 3CJ2A 1BGXT 3I0SB 4RW4B 4ZVHA 3OHBA 4NYZA 2WK4A 2IAJA 4Q43A 3UPFA 5HP1A 2G8KA 4XPEA 1MU2A 1S1UB 4WE1A 3PR5B 4ECRA 2ETJA 3KJVB 1X9MA 3PZPA 3OHAA 4ZMMA 3OLAA 1LAWA 3U6FA 5K14B 4ZTJA 4ED6A 3NF6A 3KHLA 1QS4A 1D9FA 1BI4A 2BRKA 4ELVA 4B9MA 1N56A 2EC0A 1BL3A 4B9SA 1TGOA 4ELUA 3K5LA 3AVAA 2XO7A 5F8MA 1B92A 3V9SA 3PJXA 2P1JA 1Z26A 1TV6A 4ECTA 3DRPA 1YTAA 1GOBA 3QNOA 4RU9A 3S3NA 1JLFB 1CXQA 4J9LA 3K5NA 2XY5A 3QNNA 1RTDB 5KFLA 3KLGB 5KFQA 4HUGA 2FJVA 4IFYA 4ED3A 2OPSB 4O44A 1ASUA 2EHGA 3FRZA 1KVCA 3CJ0A 1K1SA 5KG0A 5J2MB 2A1RA 4YR3A 2D5RA 1RBRA 4RNOA 4CJEA 1ZBIA 1RTJB 4FJMA 4O55A 4F3OA 4IFVA 4O4GB 2HWIA 2D0CA 3LP3A 3UDLA 3DLEA 1ASWA 3HT3A 4RG8A 4CEFA 4FZXC 4CGGA 2ILZA 3OYFA 3D28A 2YNFA 3HVAA 4DL2A 4C8NA 4PQUB 4CK3A 4FJHA 2VA3A 3PX4A 3BREA 2QE5A 4CJTA 1TAQA 1C0TB 3BDPA 1NK5A 1JXEA 2IS3A 3H5UA 3V4IA 3P5JA 1L3UA 4EEYA 2W8LA 2HNZB 1NJYA 3C94A 1JXLA 1TKTB 1XR5A 1S10A 5E41A 1HYSA 2G8HA 1Q9XA 3SQ4A 5KFBA 4GW6A 4CHPA 1RT5B 3SFGA 3V1QA 4B3OB 3AVKA 1JXBA 3QYYA 2YNHA 3K2PA 1JLBB 3SUPA 1IM4A 1HNVB 2WOMA 2ASJA 1LWFB 3PW5A 4ID1A 3DM2B 4IH7A 2UVWA 3WNHA 5KT7A 4IKAA 4GC6A 4PWDB 1GOCA 2XCPA 5KT4A 5KFJA 3OYKA 3L3VA 1RT6A 3NE6A 4TY8A 1CZ9A 1S9FA 1U49A 3DDKA 4KI6A 3SI6A 5KFXA 4IH5A 3RAXA 5L9XA 1U45A 3KHHA 2C2DA 2X6SA 1NKEA 4M3XA 1JLGA 4QWAA 2R8KA 3CFRA 3KK2A 4O0JA 4UQGA 3NGYA 3CG7A 4LSLA 5F9NA 1IKYB 3I5AA 2C28A 4F4XA 1VRUA 3LPUA 4CEQA 3KTQA 1UWBA 1TVRB 3KOAA 2AWZA 4CJQA 3QEIA 2FVQA 4FLVA 4PY5A 4XPCA 4XIUA 3RAQA 4M95A 4DL6A 3E51A 1RILA 4YP3A 2ALZA 1UA0A 2RDIA 3IGNA 2B6AA 3MECB 4FK2A 4CJUA 2HW3A 2G8VA 2CKWA 4FJ7A 4JS5A 1RCHA 3N6LA 3ZT0A 2RN2A 2ATQA 5EU7A 1S49A 2Z1IA 4YR2A 2XY6A 1DTQA 1FKPB 5F8HA 2R2TA 4QWDA 1C1CB 2GIRA 3MR6A 4Z4CA 1TL1B 2XGQA 3RB4A 2C2EA 4KBIA 3OS0A 4IKFA 2IJFA 2XY8A 4YQWA 3SQ1A 3SQ0A 1SH3A 1S5JA 3WNFA 4YNQA 4K8ZA 3L2RA 4KRFA 4J9MA 1S9EA 2IM0A 4ICLB 4LQ9A 1FKOA 4IR1A 4AHTA 1S1WA 4HYKA 5F8NA 2VG7B 1C0UA 1HARA 3LDSA 4RW6B 2IC3B 2R8JA 3I8DA 4HUEA 1RDDA 4CJRA 1W9HA 1C0MA 3LP2A 4EYHB 1HYZA 5FDLA 4O4RA 3O4NA 1RT2B 2E6MA 2VA2A 1U4BA 2VG5A 4JS4A 1RT3B 4KSEB 3M8RA 4AHUA 3ASMA 1WSFA 4KPYA 4ID5B 4DU4A 3Q8RB 5KT3A 4K4VA 5KFWA 3I0RA 3KLIA 3KD1E 5KT6A 3NHGA 4AHVA 3RMDA 1EX4A 3H08A 1VSJA 4AHRA 3SFUA 5C42A 4RW7B 5KFNA 2Z1JA 1IKVB 4C8OA 5HBMB 3OSNA 1JLAB 1CZBA 2D3ZA 3RMCA 1SUQB 3UQSA 3DLGA 4FJ5A 1KFSA 2QV6A 4LY7A 4QW8A 3RMAA 2QXFA 3RRGA 1W25A 2HHSA 4B8AB 4DQIA 4MK8A 1TV6B 4DTRA 3AVMA 3DRPB 2I5JB 4NLYA 4NCGA 1HRHA 4IRKA 1HPZB 1ZBLA 5FROA 4CFCA 1HYVA 5KFMA 1T94A 1SL1A 2AU0A 3NCIA 4HTUA 3RMBA 3H4DA 1TP7A 3M9OB 4IFYB 2W9CA 5L1KA 4HKQA 3DOLA 2HVHA 4FS2A 4ZP8A 3LWLA 4FM0A 4KB1A 3ALYA 4DSEA 3E01B 4K4YA 3EY1A 3V9UA 3HP6A 1RDRA 4N5SA 1HMVB 4CJLA 4R5PA 1ZBUA 4F50A 2RDJA 3KHRA 5T7BA 3OYJA 3OYNA 2FVPA 2E6LA 4IFVB 1TKXB 3SI8A 3ZSWA 4IRDA 4IR9A 4CECA 4CGFA 3MFHA 2HNYA 1KVBA 1RYRA 4CFDA 2ASDA 5KG5A 1RDCA 1ASVA 4CE9A 5F8IA 5JUMA 1JKHA 2V0NA 4CEZA 2OA8A 4C8LA 5KG1A 3ZT3A 3NMAA 3HXMA 5KFDA 4MH8A 1J5OA 2OPPB 2DFHA 1S1TA 1KFDA 1VSMA 4CEBA 3SZ2A 4DFMA 4FLTA 5J2PB 1QE1A 5KFFA 1B9DA 4CERA 3C6UB 5EWEA 2G8WA 4EBEA 3MF5A 1HYSB 3AVGA 2W9BB 4FLYA 3SV3A 1D9DA 3OYDA 3HJFA 2R8IA 4W5NA 1K6YA 2YNGA 3F9KA 4FLUA 1JLEB 2HWHA 3IS9A 4M3TA 4BDYA 4R0EA 2Q3SA 1VSFA 2B43A 3IG1A 1S9GA 1X9WA 4KTQA 2D0BA 3KK3B 3AVLA
chains in the Genus database with same CATH superfamily
3IRXB 1BXNA 1N8RT 3U4LA 1GTHA 3EXCX 1VQ4S 4E3SA 3K9JA 3RBXA 3SMZA 2V94A 3OBWA 3L7OA 3CJAA 2PMWA 5DRKA 1Y3JA 4QZVB 1MWZA 3TA1A 4KO0B 5I42B 2W7AA 1VQ6S 4FLWA 2QMXA 2Y8WA 2E7WA 2LEBA 2B6AB 3W7BA 4C1NI 3VAIA 3CCEN 2X3GA 2ABYA 1M5OC 5GAGU 2ZHAA 4GVBA 4WKYA 3VQTA 1S5ZA 2VQFF 1FF2A 2LSNA 2OKQA 1ZTTA 3GG1A 4NLQA 5E3QA 2D0AA 2F9DA 1P9QC 4YOTA 2XZTB 1NKCA 4V19X 1H2UX 3M9MB 4OZNA 3HPGA 3O9UA 2LDIA 4CYUB 2R7RA 1IKWB 4LF6K 5AQHA 1Q7YT 4WJBA 1S97A 2RUGA 3J7Z5 3SPYA 4BR7A 2P9IB 3MM8B 1FA0A 2CQ1A 3BKTA 1HNXF 2BQRA 2OPQA 5LXYA 4AH9A 3FCHA 1QD1A 4C2MA 1WTBA 1FVQA 4DSIA 5FDLB 1MMLA 3MAAB 5GINA 4DR2K 2VGMA 5AQIA 1IR0A 4CZFA 1L3VA 2V8PA 5C15A 2DD8S 5E3AA 1J5EK 3AOBA 3IM8A 4ZHRA 4W92B 2IFXA 2FLPA 3DOKB 2BZ2A 1CEZA 3P8BB 1VRTA 4FYYB 3SIPB 3G71S 2QLWA 2VQFJ 1M1KT 1GFWB 4ZK7M 1WN7A 1X4AA 3C16B 4K4UA 3BBFA 4C1NK 1HLUA 2HFSA 2YVSA 4QWEA 2KDOA 3TR8A 1ZYQA 1LEOA 4LRDA 3MFIA 4OYBA 2FLOA 1SPBP 3LP0A 3KJQB 1B70B 2Z30B 2CPJA 2AIRB 2JWNA 3IR5B 4YDXA 3SQGA 4QIWD 3L09A 3H25A 1FO1A 5C12A 1RKJA 1AROP 4ZCKA 4M3ZA 3IMQJ 3QSIA 3PW0A 3CCQS 1HNXJ 2VL1A 4YHHK 2AQ4A 3M8QB 4KAIA 2GAHC 3FVYA 2E4LA 2DGSA 3DOMA 4MDAA 2HB5A 5D3GA 5J1EA 3PIOQ 1H74A 2A0FB 2F8EX 4H5TA 2ZBIA 3LF0A 2DFEA 3ZSQA 2VQEF 3G6ES 2R2UA 5HATA 3ZX2A 4KV8B 2RH3A 3QIDA 2J0SD 4P71A 3CQ8A 1O13A 2NCKL 1LWEA 4CGJA 3C7NB 3UKRA 1N6QA 3AO2A 4AUKA 5AE3A 2FY8A 4CJ5A 1SQKA 4F3QA 3CCUN 2ZH7A 4CZHA 3BQ1A 4PL8A 2EW9A 4BREA 1S1TB 3NAHA 2YX1A 5DG7A 1U2VA 4DV1F 3CCLS 3GE9A 3KJNB 3TJ8A 5HROA 5KG6A 2RE2A 1RWXB 2M70A 2Q43A 3V6DB 1N0UA 5KFHA 2ASPA 3FFIA 1QDUB 4DL4A 3TANA 1E6YA 1LW0B 4GMJB 5AQQA 2QA4G 3B8AX 1O6XA 1G99A 2VPXB 2RHSB 4KHUA 4CO1A 4XH1A 3EXYA 3VQSA 4TXSA 4UZCA 2VQEJ 3LALA 5K8MA 1MROB 3ILLA 2MDAA 3S6EA 1WSJA 1U0SA 3A1YG 4DQRA 4BR5A 3NCQA 2RU3A 4PG6A 4JKBA 2LQ8A 4CJ3A 3HULA 3V2UC 4DZ6A 1KQSM 4LQ3A 3DDNA 4Y0FA 5LMUJ 2GBZA 1LV5A 4LREA 4JOUA 4KFBA 2PFFB 4QYZK 3S3MA 4DU3A 4NLTA 3GSIA 3O6QA 2QYGA 5HRPA 4AFFA 2FDNA 4DV1J 3MWPA 3AO5A 1UA1A 4UF4A 2DXDA 3AGRA 1IR1A 4IEIA 3DXSX 1WG1A 1PG5B 2IM2A 2KZMA 3S1TA 5J2QB 2HGNA 3KWIA 3MR5A 2I1RA 4RW4A 2OSQA 4OZLA 2RS8A 1MN7A 2NS1B 4ES2A 3QGHA 5KOXA 1CJVA 4AQYK 1S4FA 4KTZA 3HO1A 2YBVA 4CO5A 3VGVA 1QTNB 1P9YA 1KD1T 1IBMK 4CK2A 2MQQA 2DHXA 4FF2A 1WC0A 1AFIA 4AM6A 5H9FJ 3F2KA 2IAJB 3DN9A 1G3OA 4BDPA 4DMNA 3J80U 2CJ9A 2DNLA 5HP1B 1MU2B 2HHPA 2O66A 3RB3A 4XAKA 4HLBA 3H98A 5GADI 3AODA 1JLFA 3G0ZA 4YMEA 3MI7X 3NDKA 4MMOA 4LF6F 3QAEA 4IDHA 4X62K 1NHKL 5CYQA 4ZP7A 2L08A 3FBFA 2HMPA 3SK3A 3OYBA 4ZS6A 3J7AP 4K43A 2ZQBA 1RI7A 4B1VA 2KH9A 4DU8A 3FGVA 4HI2A 1ZZFA 1TKDA 1WSEA 4A8QA 1VJQA 1RLCL 4O44B 4Y2AA 2QL7B 3TAMB 1BY9A 1VFJA 4DR2F 2YCHA 1QTMA 3QSYB 3VVTA 1J5EF 2FHOB 4G1QA 1MMDA 4F3MA 3V9ZA 2UUCK 3GIIA 3SCKE 3ICLA 3HZGA 2G2ZA 4NX9A 1NK6A 4J9SA 4JV2A 3OYGA 3WXKA 3THVA 1H98A 4FYDA 4BRDA 1WB9A 3J7ZT 2E2OA 1J2VA 2MYFA 1HHSA 4ETXA 2BBEA 3Q2SC 1I94K 4ZOSA 1F5AA 4MKBA 4B3TK 1CJUA 4NCBA 4CLTA 3OR2A 5IT4A 2E5LK 2J6UA 1A6LA 3MR3A 1HI8A 1VLYA 1IKXB 1FEHA 5H9EK 4BRGA 3NL0A 3RB6A 2Y8YA 3QBXA 2D9OA 2DH7A 5B0AA 4YHHF 3VGUA 3BYRA 2R7XA 1YI2N 2VFSA 2ASMA 3PV8A 1E4GT 3AVCA 5LM7E 2QX0A 3CIMA 3FBBA 5KFYA 4IOCL 4BRLA 3QT5A 3FBCA 4A57A 1B0VA 4O3QA 4DR2J 4XEIA 4DWIA 3K2YA 4NLOA 1CSJA 4Y34A 3ZZPA 1RT6B 1J5EJ 5BR8K 2XYGB 3ITHA 3IGVA 3AAWB 5DM6L 4ELTA 4HI1A 1W7WA 3D3CJ 2F3JA 1NNEA 2AJ2A 3KK2B 1UETA 3MN9A 3VOVA 4KGZB 1M5SA 3GR0A 4NI2A 1R8HA 4C3LA 4HACB 1DHMA 1EJ7L 2XULA 1CLQA 4CZGA 3GB0A 4OJ3A 3CHWA 1OIAA 1FXRA 4MO5A 2X74A 3DLRA 3FRYA 5HN0A 1PYTA 1JJ2R 4FYVB 2D3OR 5KT2A 1QAIA 2K1RB 1LNQA 4JKAA 1EETB 3CJ8A 2O01C 3DLLQ 4C11B 1KBRA 1KCFA 5A8KB 3KLVA 3D68A 4CJ4A 1YJNS 4ZVEA 4JI7K 1YTYA 2CJKA 1TK0A 5IXUA 2GMJA 4CJSA 2X78A 3OYIA 2BE9B 1YDLA 5KG3A 3TZZA 4WCEL 1T02A 3GE1A 2ATCB 4C48A 4JI5F 4FJJA 5AZIB 2PAVA 1C0UB 1KKHA 5F9LA 1RWPB 2ATLA 1S1XA 2AX1A 3O9TA 2KJVA 3RR8A 3ZETA 4M94A 1EARA 4J8FA 4JYAK 4JI8K 3GG4A 4E7KA 1WKKA 2WAQD 2EG2A 1IKVA 5HBMA 5AQMA 2WVFA 2YJEA 3V1RA 4MJKA 4Z4HA 4USVA 2AEMA 5HL7Q 5T14A 5HRNA 3QFHA 4AQYF 3MR7A 4DTSA 3AHPA 1QQOA 3ULDA 3OS1A 2PIIA 4RUBA 3QPIA 3ZZ0A 1K0VA 3M30A 5C42B 3BH7B 3TUZC 4DDFA 2VJUA 4WYLA 4O5BA 4GO7X 4H0TB 4USIA 3RBZA 4J9NA 2PYLA 3O5TB 1BA0A 4ZVUB 4WU3A 1JLQA 4E98A 3SMSA 2YWEA 1WAJA 5IT9O 2DHGA 3ET6B 2M5YA 1IBCB 2UVUA 2C3PA 2HOEA 2EWHA 4FLXA 2IJNA 5HMYA 5HRSA 2FHKA 4JI5J 3OV7A 3R3LA 4X62F 1NNDA 1FXXA 4QYZJ 3P5TL 4CP5A 4WFZA 5C0YA 5ETOA 4X4RA 3DOLB 5DO2A 4N47A 1WSHA 3ZCMA 4G3IA 2YPZA 2H9ZA 1S6QB 3BYPA 5AQTA 2OPPA 4ZJLA 3D67A 4WYBA 4R5PB 3MOJB 1R89A 3TJ9A 3WXLA 2LP4A 2FBXA 4JEPA 3UD5A 3H3OB 1FXDA 1TTHB 4OYZA 4DSLA 4W5RA 3JSBA 4AQYJ 2AJFE 3T9ZA 1JKHB 3ZZOA 2VICA 3H1QA 1QAJA 2HIQA 1UOCA 2UUCF 4G1IA 1EXQA 1VDHA 5K9FA 2CPHA 2JLFA 1WF2A 2DGQA 1D8ZA 3D45A 3M2RA 3CF5L 3HT0A 3C8YA 1X1PA 1T44A 1U1MA 3D2EA 2HNDB 5CZVA 2BE2A 2N3OA 2V2VA 2HGLA 2HHTA 4H5VA 1I94F 3D1HA 2E2QA 3QIPA 3GJQB 4JB8B 4B3TF 2LFVA 3O9SA 3M8PA 4K4ZA 3K58A 3I56S 1LAVA 3IS9B 2Q0UA 2L9NA 2DEIA 1QUVA 4X62J 1S9GB 1DLOB 4QIEA 4F0HA 3NP5A 5J2NA 2CYYA 2ITGA 2VFVA 1ESVA 1NMEB 1QHAA 3HBTA 4ZPVR 3KWGA 3EEQA 4BRPA 2N4CA 2NRWA 4CEEA 2CQ3A 1NK4A 2HRYA 4IOBA 3VEZA 2UUWA 1B3TA 5EDWA 2W42A 4DPOA 4RWTA 2UUTA 2HAIA 4X4PA 3CDBA 3K5OA 4CZMA 3OFHA 4OZ3A 4PPDA 2DTUA 4JP8A 3BM7A 4TVAB 3QLHB 2LU1A 2MQ8A 5KTQA 1WI8A 1KVKA 2F65A 1SJFA 2P5GA 3MM5B 5BR8F 4BC2A 1R8PA 3CCRN 4NZ0A 2CH5A 1T7PA 1SC6A 2AF6A 1W0HA 2UUCJ 1H6KX 4LH5A 5L1IA 4LF5K 3ZSRA 3CXCM 4C8MA 3W9HA 3ZTRA 4Q45A 1U48A 3VQ8A 1R0AB 1B7YB 2HQGA 2LVWA 3S8SA 3PDNA 4BE0A 3D54A 4H5NA 2QLJB 4U8YA 2R7OA 5KFPA 4BC4A 4KYZA 3KHYA 1F0XA 3W8PA 4OYXA 1I94J 3VETA 4EFAC 3CJ1A 5L1LA 4B3TJ 1I1GA 1UVLA 5IWAK 2BYCA 3OUYB 4RNMA 4BACA 1BISA 1WSGA 3BZCA 1F9FA 2AYEA 5C25A 3C6TB 2XCAA 1DZ5A 1L3TA 2RE1A 2UV8G 2EKYA 2KG0A 5KFGA 1KC8T 3C19A 4UT4A 5KFUA 3DFEA 3TX8A 1ZOTA 3KYLA 4I2PB 2GWJA 4ED2A 3NH1A 2XLJA 4WQ5C 3VN5A 1RGIA 3UO0A 2F4VK 1KNZA 3LGHA 4BRQA 3J81Y 4WZMA 1ZM4A 4JI7F 1S6PB 1CZAN 3NGTA 1SV5B 2QSWA 4A8XA 5KRSA 1JCGA 2XC9A 2HBLA 7AT1B 1RTDA 2ZBPA 4DLGA 2IVYA 4CHZA 5BR8J 4CEAA 4JRQA 1NG9A 3PKYA 2CQCA 5M1KA 2AD9A 2W01A 1E3MA 4W4MA 3I55N 4X2BA 1CG2A 4KHNA 3O3GA 2XLIA 1VQ8N 2FLLA 4CLYA 1UPPA 3VQCA 2NREA 1QAYA 5I3UB 4JYAF 1RACB 4JI8F 3KKFA 4AT1B 1N34J 3UDEA 3RTVA 3S9HA 4DR7J 4RLEA 2GGPA 1YTUA 2IDEA 4LH4A 4WF9L 4NLUA 3SNNA 4NLSA 1R59O 1LFPA 4DTOA 4Y2CA 2GMHA 2F8SA 5ETMA 2VDIA 4I56A 1SC1B 1NJZA 1XC3A 4MK7A 2F8TA 3Q24A 3DLKB 4F4WA 4DV0K 3QO9A 3M5RA 1S57A 2GO9A 2XI2A 2V5HG 1EWRA 3W9JA 2HWTA 4JI7J 4UY8T 1RTIA 2FF6A 2HEKA 1RT1A 5GADU 1B64A 4JBCA 2CGKA 2CFXA 2I2YA 2QA4S 4OYWA 5BYSA 4EHUA 3W64A 4MO4A 2V63A 5KFIA 2IIHA 2V8DA 2I7PA 3M32A 4P2SA 2YQ1A 2RD5C 6FDRA 2FUG9 2YTCA 4CLFA 2OO4A 4KGXB 2D41A 3TTFA 4I2QA 1MWQA 1YZ7A 3ATUA 3NAIA 2XHBA 1JXVA 2D1KA 2HMIB 2QK9A 5EUHA 3MUMP 4NO7A 3TX0A 2AYMA 2Y1JA 2B56A 4CGIA 4JYAJ 1IG8A 4JI8J 2OEJA 3MEDB 5CCMA 1CJKB 5KG4A 3AH6A 3OYHA 1YJUA 3HJVA 2ZD1A 1ZBFA 2BOAA 3ZZTA 4ECWA 3KLEB 4FBTA 1VQKS 1HBNA 1RWNB 3MMCA 3MEGB 2YQ0A 2R7UA 2GQCA 2KXHA 3KNAA 4CI6A 4KHMA 2Z4PA 2ERRA 5L1JA 3P39A 1Q53A 1Q9YA 1WUUA 2MGZB 3DMJB 4ZPCA 5AQFA 1RTHB 1VK3A 2JC0A 2GUPA 1O8BA 4ECVA 3CETA 2B5JA 1P1LA 2HBRB 4OPJA 2BOPA 2QLXA 4HDHA 3MEEB 2DVIA 4HVJA 4JD2B 2Y1IA 4CT9A 4Z94A 4QS8A 2XMJA 2XRIA 2ZJPL 3NKYA 3EKUA 2DGTA 2G2OA 1VQPN 3PFOA 2VHGA 3HSCA 3VAGA 4DV4K 2QM1A 3L2QA 1VCTA 1YQHA 2X1GA 3N79A 1JNZB 3NF8A 3CM6A 3PO4A 3AAQA 3FEXB 3B8HA 1SKWA 4AHSA 4CH1A 3G4SN 3V5RA 3O4QA 5BN9A 1NB2A 3VF6A 2PI4A 1VQOS 3ZXWA 5DJBA 3JYTB 3IFEA 3L95X 1KN6A 2M8DB 1Q82O 2V4JA 1U47A 3N5FA 5HLFA 1GXUA 2I38A 2GELA 4Y2MA 3FSIA 4MFBA 5I9EB 4Z4EA 4KKOA 2YX6A 1T3NA 4CBUA 4BR9A 2JZ5A 1FDDA 2DNMA 2UVVA 3KLFB 3O9QA 3KLHB 1BGXT 2LEAA 3M6XA 4BRCA 3SDEA 4CLLA 4NWBA 3JB9k 4LF5F 2DNGA 2G8KA 2DO0A 2NXEA 4WE1A 1UVKA 2CPDA 3GMGA 2ETJA 3KJVB 1TUGB 4RBUA 3PZPA 1S59A 3DHWC 3MM7A 1XBWA 4NB4A 1BUXA 3R9PA 1KQGB 2VJVA 3CCMS 4CBXA 2KI2A 3KHLA 1QS4A 3LDQA 5CZXA 2XWXA 2EC0A 1Q7LB 1Q0NA 1TGOA 4ELUA 1Q86O 2HK3A 5IWAF 2DCLA 3IM9A 4ZVSB 3M1VB 3W3DA 4D3HA 4F67A 3IAM9 2Q97A 5HMZA 4WP9A 1SIWB 3Q8UA 1Z26A 1FFGB 1GOBA 3S3NA 3LUYA 4DX5A 3WQPA 3K5NA 4J9LA 4WP8A 1X0PA 4TLQA 2IYIA 1UVMA 3DAWA 4QR1A 2LMIA 5E84A 5KFLA 3EL2A 4WWSA 3PIPL 3THXB 4PEOA 4YR3A 2F4VF 2WSEC 5L46A 1RBRA 3CC7N 4OZJA 2I0XA 2LXIA 1CJTA 2V52B 4CJEA 3MMAA 1RTJB 3SMPA 4BGBA 3JS9A 4PG7A 4O55A 2ZHBA 2Q31A 2HWIA 5BPMA 4CIOA 3O5BA 4CGGA 2DH9A 2ILZA 1W2BR 2GW8A 1R0CB 2YNFA 5GADP 2JX2A 5G0RA 4LF5J 1EQ0A 2R9LA 3BDPA 1C0TB 1Q78A 3S01A 2G0IA 3CTRA 3H5UA 1Q81O 3P5JA 3JAMY 4QR0A 4JKDA 2P9NB 2P8IA 1HX1A 2DGOA 1HW8A 1XNQK 4BRIA 2HNZB 1G6BA 2DBBA 4RBVA 3C94A 1TKTB 2XHWA 3W2WA 2A42A 1HYSA 1KDNA 1UL3A 2G8HA 1HIYA 5T41A 3RJMB 4NLBA 1Q9XA 3V4MA 5IWAJ 5KFBA 3OR1A 4GW6A 4CHPA 1UZDA 2PA8D 2EXUA 3NNHA 3ENWA 3AVKA 2YNHA 3K2PA 3CC2N 4MKYA 4QJVA 2D69A 3VGKA 1HNVB 2QYCA 1LWFB 4DV0F 3PW5A 1S7HA 1RWMB 3CCTA 5KT7A 4IKAA 4PWDB 2MKHA 2XCPA 2BM0A 4ID8A 1IJEB 3D2FA 3OYKA 4PZVA 2F4VJ 5K20B 3NE6A 3B82A 4O23A 4IOCQ 1CZ9A 3EO3A 4OYMA 3SI6A 4IH5A 3KHHA 4M3XA 2K2PA 1WACA 2R8KA 4ZJQA 2KHCA 4O0JA 2KO1A 3OQ2A 4LSLA 4OX8A 5AXKA 1UWBA 5E7OB 1K73O 3MOZA 1TVRB 5DM6Q 3D0GE 2QTDA 1EO1A 4H0YB 3AJ2A 4CO2A 5ELZA 4M95A 3LGMA 1YSJA 1X3NA 3E51A 1Q5VA 4BVOA 1NDCA 2B6AA 2FGOA 4FK2A 4RU2A 4KJIA 2G8VA 2QL5B 5IFMA 1RCHA 1CS4B 3ZT0A 4BBYA 1BD6A 2EFOA 2VB6A 3AFGA 1UVNA 4EFHA 1S49A 3UCUP 2HQCA 3TU5A 2XY6A 3HHLB 3FCWA 5F8HA 2XLKA 3X1LB 1FWKA 2QMWA 1OWXA 1QQMA 1TL1B 2C2EA 3HZ6A 4DV0J 3OS0A 4IKFA 1VS3A 3UCZP 2R3VA 1NGFA 4CYUA 1V4TA 1S5JA 2P9LB 4PQAA 4K8ZA 4KRFA 4J9MA 2H48B 3T9NA 4F36A 2NRRA 1SVDA 4I67A 3BF4A 1VK8A 2MKYA 4FNHA 3UVJA 2XMVA 3QBCA 3UB5A 4DMZA 5TKWA 3GPAA 1YITS 3J7YI 2VGNA 2HSEB 3WT0A 4DV4F 4HUEA 1RDDA 2MLZA 1C0MA 1HYZA 4CLUA 5FDLA 3MAAA 1RT2B 2DJWA 2DKOB 4L73A 3TJAA 3M8RA 5CQGA 4USHA 4AHUA 4KQZA 3R8EA 6FD1A 1FDNA 5KT3A 1BMQB 3H7HB 2CVIA 2NR0A 4O8UA 2WBRA 5KFWA 2QW9A 3IWXA 1WBDA 5KT6A 2NZCA 3VAKA 2RNEA 1VSJA 3D1QA 3MHYA 5EXWA 5DETA 3ZTPA 4H03B 4CH7A 1G2EA 4CQ1A 4FJ5A 1KFSA 1NRKA 2QV6A 4H0VB 3U1NA 1NJIO 1TUVA 2ROEA 2EI5A 3ZFVA 2HHSA 1XQIA 3W2VB 3ILOA 2CG8A 3DRPB 2E5GA 2C1EB 1GQEA 1OSDA 1X4BA 1HYVA 3MCMA 3HOSA 3BPDA 3O80A 4ZDNA 4CM0A 3H4DA 3VEYA 3G8TA 3TSPA 3WEEB 4DR3F 2W2QP 4DV4J 3EZWA 4F02A 5C7PA 4FM0A 1HNWJ 3ALYA 1F6TA 3EY1A 3K17A 1PKUA 2DRAA 2P9GA 2YKQA 3GYGA 1T6CA 3C7NA 3EGWB 2UXBK 1X31C 3VTIA 4F04B 3PFEA 1DAXA 2ASDA 3CCWA 1ASVA 5F8IA 4CE9A 3UD4P 4R0JA 2E1AA 4C8LA 5AQOA 3BS9A 5KFDA 1S1TA 3SZ2A 2MHEA 5BJRA 3D4JA 4JHDB 3C6UB 1YJTA 2L48A 3EDRB 2RRNA 3MF5A 1V5IB 5HMWA 5ADZA 3WX8A 3N4WA 3ATVA 4LSZB 5I4MA 4FLYA 1D9DA 4USKA 3BDEA 3HJFA 1OY9A 3CF5Q 1FEEA 2DO4A 5B0CA 1XNQF 2B4UA 3U7JA 3VAHA 1VSFA 4GVLA 4IJAA 1N52B 1JWWA 2M9KA 4DR3J 1UVIA 3KVGA 3AVLA 1A5WA 1UJ6A 2WSCC 4EZ6A 4KH0B 4DKWA 1ZPVA 5AQRA 4FWMA 3RUBL 3CFOA 4OX9K 3HD2A 5EX0A 3W63A 5F0XA 4NASA 1Q8IA 4BRMA 2MQNA 3OL6A 4RBTA 1VQNN 4PUOB 5AT1B 3QAUA 2VC0A 4EO8A 1JJ4A 2DFFA 3BGRB 2GJ2A 1U04A 2W7PA 2UUBK 2KFYA 4H4OB 1CQMA 2DTJA 4Q0BA 4PL7A 4NE9C 1UW4A 4AL6A 3L2WA 5EVZA 3D3BJ 2MQOA 2NUBA 2VKRA 2FXUA 2KJWA 1XHXA 4N7TA 3CJCA 2HZCA 4P6QA 1T9UA 5LL6Z 3NGSA 4Y2IA 5AZJB 1P90A 4DPXA 1XNQJ 3TARA 1GEHA 4CJWA 1SCJB 4CGDA 2NSCA 3BH6B 3KUGA 5L8RC 2N3LA 4JUZA 2O8DA 4CW7B 4FLZA 2NUHA 1H7WA 4MIWA 1ZM3A 1QVFR 1I6JA 4LRBA 3QATA 3MCAB 1RAEB 2WRMA 3OTBA 4M8LA 1U2RA 4CZIA 1D4XA 2QWLA 3DU5A 4TLRA 4DV7K 3O3FA 3R6LB 4KGKA 4KE5A 2RF2B 4U6PA 1O0PA 2W7OA 3R7BB 4TN2A 4RNHA 3R1HA 4BE2A 3I96A 3HMJG 4EGLA 4ZCMA 4WP3A 3LP2B 4YOXA 1RBOB 2HBMA 3LO3A 3K57A 2ZH3A 4OZ2A 3T3FA 4JV0A 4RCHA 2VG5B 5ETTA 4DXLA 1VQ9N 4NA1A 1MWYA 4ERDA 3IMXA 4YOUA 3HI0A 1CC7A 3OJUA 2W2NP 4C0HA 3JSMA 5E2QA 1CLFA 2ZF5O 2PSZA 3DGPB 4WFYA 3WXJA 4BWMA 3BJYA 3TAMA 2EX3A 4EBDA 3MMBB 1QHTA 5ETKA 4QR2A 4CGHA 3ZT4A 1OQ6A 1KXPA 4ILHA 3HKWA 2OFGX 1IH7A 4OX6A 3GJRB 2LQBA 3FZKA 4LFBJ 1B99A 4E8UA 4WF9Q 4OYIA 1H2TZ 3M2VA 3M05A 3THWA 2DNOA 5AJ3F 4DFKA 4H5WA 4U7UK 5CAAA 3M4XA 3AVIA 2B4PA 3R1LA 1NJXA 3BY5A 1BQNB 4FW1A 2YH1A 2AX0A 2GIFA 1NDLA 3I9ZA 2RKIA 3TTCA 5D0EA 1BCOA 4DPTA 3DXMA 1PC4A 1UCNA 2HPUA 4OKJA 1VI7A 5D4PA 4CBWA 1WHYA 2W9CB 4O3OA 5CZ1A 4BR2A 3TR5A 3Q7BA 4IG0B 1S12A 5B7WA 5IQ6A 4DL3A 2M0GB 2HRUA 1IKXA 1YUWA 3T5HA 3W5YA 2X1AA 5KFCA 4CIGA 4E7LA 1N0VC 3RG6A 1S0OA 1ZTWA 3NXZA 1RT4B 3GG0A 5DDQC 2P9PA 4TYAA 4M5JA 5AQWA 1EIYB 2IHR1 4F0MA 2B9YA 4GKKK 1QSLA 3THTA 3QRQA 3O08A 3POTB 1TYQA 4IG3A 3AD9C 3SSQA 1OJ4A 3CWJA 1J5OB 3OYCA 1KHWA 3TA2A 3RZAA 1D5AA 2HQIA 1S1VA 5DG9A 2BJ9A 5IT9Y 2UXBF 3W5ZA 1NHUA 2PEHA 4UQTA 2FJEB 3CCES 2E8AA 4QYRA 1TL7B 3OL7A 5BPLA 3MM9A 5AJ3J 2ACMA 4XH4A 2DR7A 1M5VC 4TYBA 1DARA 4HACA 4KH5A 4EU0A 4IEEA 3ZSYA 3IRWP 4A5BA 2P9SA 3IG1B 3G25A 1OVYA 3OTCA 1NGJA 1U1RA 3RWUA 2J7WA 2PMHA 4QAGA 5EGYA 4U7BA 4DUYK 2QEXN 2WB4A 2J9DE 1M90T 4OJHA 1JJ2M 1EETA 2HFNA 1IWAA 2ZJPQ 3W1YC 1TFWA 2VG6B 3K5MA 4ZP6A 1BWVA 2LA4A 4FJNA 1YF5L 1N5SA 1S99A 2QKKA 3P31A 5LJ3Y 1WNSA 2V2QA 3TWHA 4IDKA 2VWJA 4OX9F 3IN5A 1REVA 4NXMK 3BQ0A 4LRCA 2UU9K 2V8VA 2U1AA 3DYAA 4QS7A 1J53A 1VBYA 2UXBJ 5KG7A 2GV1A 4CFBA 3IKMA 3QEPA 2COLA 3GCXP 2D3UA 3CYMA 3J80O 5AZIA 4A8YA 2VWKA 3VAJA 2UUBF 2FZGB 3I0SA 1PGZA 1SH0A 4L6V3 2H5EA 4A2AA 2DPJA 3QESA 2BX6A 2MQMA 1KVIA 3R3TA 2CGJA 4JI1K 4CHYA 1S1UA 2A3JA 3SBMA 1T9YA 3OXLA 1EP4B 2J76E 1PIEA 4U95A 2GHVC 4LF8K 3RGIA 5J1PA 3CJ9A 2FVSA 2MB0B 3MPDA 1XERA 1IBLK 1QQCA 3FGUA 2RQCA 1U6ZA 4HTIA 2MLXA 4KAZA 3UR0A 3P1GA 2C3MA 4NZ7A 2O67A 4FK4A 2RRBA 4M3YA 1HFEL 2QG9B 2UYTA 1FHTA 3C2PA 4P72A 1M5KC 3T41A 4BHQA 5CABA 2HHQA 1QAXA 3KLGA 2A1SA 4KB0A 2OPSA 5EN1A 4OX9J 4DV7F 1F2GA 5IV3A 2W41A 1KSPA 1R27B 4Z4GA 3ET6A 4J9QA 1FWLA 4XO0A 3PIPQ 4B3RK 1WBBA 2FYXA 4KTWA 1JX4A 2EFPA 2XMMA 3VPZA 5C24B 3D7EO 1T0TV 2GVDB 1HKAA 2UUBJ 1KP6A 2BKNA 4J9KA 3O44A 5F2RA 4PQUA 3J7YU 5LJWA 3CCUS 1AYEA 1CPZA 3PTWA 4YDDB 1S6QA 1RBSA 4BE1A 3T19A 1DFDA 4OI0A 1IG9A 2RJZA 3HSTB 1Z25A 3VQ4A 1HBMA 4CJPA 3HTVA 3Q83A 3C65A 4ISFA 1Q1KA 2F9TA 4WXWA 3T5LA 3DCAA 3HF5A 5AQSA 4KB7A 3M2UA 1GAOA 4B3OA 3V4IB 1O5JA 5THWA 4USTA 1U26A 2H3GX 1WD6A 1K8AT 2K3KA 5LMNK 1WF1A 3PW2A 2V7ZA 2MHNA 1R43A 4MTPA 2HNDA 1ZBTA 2MZRA 3SUNA 2BGGA 4DV7J 1K8KA 4O0NA 1QSSA 4BRHA 2F7TA 2F4FA 2C2OB 2B0GA 3Q2TC 4ZVQB 3C95A 1OQ3A 3PM9A 4RWXA 3QINA 2J0WA 2NLXA 2WOMB 1DLOA 1AW0A 1IKYA 5KQDA 2OP5A 1JNRB 4C0BA 2GAGC 4P75A 4I6WA 4TY8B 2QKBA 4U9RA 1WEYA 2W6KA 4CHOA 1TK5A 2W2OP 4DFJA 3TRGA 4GKKF 1B4SA 2QLBB 1VBXA 2QLFB 3QLHA 3G10A 5JJBA 4AYBD 3UE5A 2ZJQL 4O0IA 4ZPAA 3MM5A 4DCPB 3HM8A 1PBUA 3NLCA 2JC1A 5D6GA 2E9ZA 4OVLA 3Q8SB 3EPIA 2I7NA 1WTFA 2F7VA 4PXEA 4X4QA 1ATSA 3CERA 1C1BB 2WW4A 2C2NA 1RA7A 2O8EB 1H0HB 5BYRA 2JJ4D 1GLEG 1FVSA 1XTZA 4DV6J 2ITMA 3VGLA 4EO6A 2HHHK 3IR6B 4U7CA 3IP0A 4Y1DA 2VG7A 3C6TA 4DUYF 1Z05A 2YJFA 2V4QA 5KFOA 1FESA 5B09A 5MLCQ 2DNPA 2HFVA 3J7A1 2NXUA 1BG3A 3HHDA 4I2PA 2IOCA 1LW2B 4TY9A 5JICA 4BQZA 3P3DA 3JXUA 1SH2A 4Q7AA 4M3WA 4M7YA 2IMWP 3TTDA 4B08A 5D78A 2JVRA 4GKKJ 3UKUA 1TMJA 4FKXA 3OYEA 3T1AA 1YJ7A 4LR8A 1QZ5A 4DUZK 3F5TA 1MWKA 4NXMF 1AXQA 5KAKA 4FS1A 1WKLA 2UU9F 2IBOA 2ZH5A 3MXIA 1U6FA 1WAFA 5C10A 1RP5A 3CPWR 3WHIA 2R2SA 2AHOB 2QWPA 3AA2A 2CQGA 5KQ8A 2BKOA 4PR6A 5M1FA 1JLAA 4B3MK 3M8SA 3A4TA 4HVZA 1SUQA 2AGOA 2HF3A 5H1SQ 3TABA 3EVWA 3KLIB 1YRTA 5F3TA 2MQPA 4E19A 4F3TA 4JI1F 1RU2A 3VQ6A 3MURP 5CHIA 4B9UA 2D74B 4QWCA 2I5JA 3J7YP 3U3GA 2PYJA 2C42A 4LF8F 3MXJA 2HHVA 2JVOA 1IBLF 1EB0A 5DDRC 1BWEA 1HKCA 2HHUA 4ECXA 4DUYJ 2A6OA 2UV8A 2LDYA 5K8OA 2BJDA 4P2FA 5HK4A 1P6TA 5A8WA 3MDQA 1VSLA 4NXNK 2XM3A 2GC8A 5KFRA 2P51A 4OLAA 5AQJA 4X65K 1YI2S 1TELA 1TKXA 3W62A 4NLWA 4H4MB 1N48A 3AA4A 2KT2A 1BOTO 2OH2A 1XR6A 4NXMJ 5B0BA 2AJ0A 2UU9J 1YK9A 3C15B 4RUCA 4DOZA 3R2CJ 1NK9A 4B3RF 2EFNA 3CDAA 5J2PA 3SV4A 5F8LA 4C3MA 3LA0A 2R8HA 2GWKA 3SSSA 3W60A 2HMIA 5CZ2A 2FSJA 2W9BA 3FZLA 2FVCA 4GNIA 4PXBA 3TI0A 5AQZA 3BSNA 4JI1J 3OYMA 4DTNA 5KGXA 2C3OA 3K0SA 5DQHA 1JLEA 2DXEA 2MSTA 3QJPA 2ZBQA 1YLXA 3AVBA 4EZ9A 3CCSN 3ENHA 4DF8A 3J7AN 4TNOA 3OHRA 2O8CA 3MEGA 3HSGA 3ELHA 2IVNA 3L0QA 3OL9A 3OW2R 1H3DA 4ZITA 4KHQA 3GYNA 1T8EA 3CD5A 2RDDA 2MGZA 3DMJA 1NSKL 4LVOP 4OPHA 4ILLA 2YNGB 4HR2A 2C3YA 1RTHA 2W4CA 3LWMA 4PKHA 2VBXA 4MIBA 5LMNF 1YBUA 3MEEA 4CF1A 4BRAA 4JD2A 3CDWA 3O8MA 4DUTA 1SC3B 4LF4K 3G96A 3V1OA 4M42A 3B54A 2FIUA 1T03B 1GLLO 2KM8B 4G65A 2E2PA 4ZN1A 4B3RJ 3TP2A 3ENVA 1BQMB 4IZ9A 2ZZTA 1ZBSA 4YB5A 5HQ8A 2E1YA 1AZSA 1U25A 3GR1A 3HVWA 1HJRA 1KQFB 5CHCB 3KK1A 3H0PA 2HVIA 2NRTA 3DXKA 3SYZA 3EN9A 3S41A 3IC1A 1HPMA 2ZOMA 4FDFA 3RRHA 3JYTA 1C4AA 1A5XA 1VSDA 3AO3A 4YUDA 4Y0WA 2CA9A 5JMNA 1N33K 1NDKA 5CD4A 3LL3A 4M45A 5ETQA 1XHZA 2HSTA 4PABA 3NS5A 2J9EA 4UOHA 2E2NA 2GEMA 3WZ0A 4I1TA 4R8UA 2R7VA 1VQ7N 5ETRA 4GVBB 2IIRA 3CE8A 3MR2A 4I7FA 1K1QA 1KLMA 2RB7A 4NRUA 3HCXA 2YV0X 2E9RX 4JKGA 3CFPA 4JAXA 4TU7A 5LMNJ 1RWVB 2KHOA 4ED7A 3TAPA 3R6MA 1XJWB 1ATNA 4H0XB 1IO2A 2IM3A 4M1KA 3SXLA 3GIMA 3J81j 4I6YA 3CJ5A 4URSA 2FC0A 1GH8A 4FJIA 2M2BA 3BGFA 3QFPA 3ZSVA 1DY3A 2XMTA 2HHHF 1HW9A 3B6BA 3AVFA 4ILMA 3HX9A 3I5CA 2Y3YA 2DCUB 1YJNN 4QU6A 1SQFA 3V81B 3PJ9A 2JEIA 3RSEB 2YWKA 2C2KB 2K06A 1X9JA 3GJTB 2Y0SD 4V1Ak 2WONB 5JVHL 3Q8QB 3MX2A 2EBGA 2CADA 4DTUA 4JI0K 3FZBA 4K4XA 2AZ1A 3I33A 4K2XA 1Y9OA 4K50A 2N7CA 4CNZA 5KT5A 1RNHA 2P6SA 3ZNJ1 4ZHRB 3IBCB 4ISEA 4ZTFA 4M5DA 3CC4S 2AJ1A 4RW8B 5GAHI 2A3ZA 4DUZF 2VDHA 1VRTB 3E3XA 3F73A 4OJGA 1JLCB 3DRSA 2VBZA 3GONA 2QI2A 4CF9A 1TL3B 3TAEA 1M90O 4M5HA 3TQ1A 4ZPBA 2PMZD 1XEZA 3RYLA 1W2BM 1C0TA 5DDPC 2IRYA 2OEMA 2MTLA 3X3UA 1XMOK 4B3MF 3GIKA 3ZX3A 2P9NA 2B7BB 2RRAA 2IY5B 3ONQA 3I6PA 2BTFA 4OKKA 5SZTA 3TUPA 3HVTB 3SQGB 4FJXA 4FJ8A 3NH2A 2YKNA 2HHHJ 1C6VA 4ED1A 2G0CA 4JI4K 2D1CA 3AY0A 3VA0A 4DQPA 5IS2A 3DOMB 1OH5A 2VD3A 5D3GB 5J1EB 4DF4A 2HQ3A 4LSNA 3CEDA 2H1YA 2MQLA 3EDQB 2FJAB 2AV5A 3B4DA 4JKEA 3QEXA 3C6AA 4NXNF 3Q8VA 4PWDA 5CA5A 4MLEA 1M1HA 3BSAA 3KIOA 1X9SA 3ULEA 3RB0A 3TAGA 1LWEB 4X65F 3ID8A 1FK9B 3UKRB 2MKSA 1N6QB 2GFFA 4HHTA 1N5YA 2CJQA 2AGQA 4TKTA 3OLBA 5DZ6A 4RW9A 5GIPA 5JS1A 3OTOK 2OPRB 1TVRA 1X8DA 2FHJD 3SSRA 2W9AA 4HHJA 4OI1A 2DR8A 3CCRS 3MN6A 1U2VB 2M88A 4Z4FA 1X4DA 4PHTX 3CQYA 3OSPA 2ZITA 5HROB 2B9EA 1RTZA 4ZIWA 2KYXA 2HBZB 2YHAA 3NOGA 8RUCA 3JSYA 4C98A 3D0PA 2XG8A 5DGAA 3CT9A 3N6MA 1CS4A 4I9QA 2D0OA 1BHLA 2NXCA 3FFIB 4M5KA 2HS3A 3PO5A 2L41A 2NLWA 3H3NO 3VQ5A 1E6YB 3P83D 1IV0A 1WHVA 2RPIA 5BREA 4WFAL 2EPIA 1TL1A 3CJ7A 4KH4A 2IRXA 4GKJK 2CPEA 3E9LA 4NXNJ 4H0OA 3VQQA 2P9LA 5LJ5Y 3SAFA 4V19S 4OGEA 2YHYA 2W25A 4X65J 4QPXA 5EWGA 2NXJA 4YN3B 4P10A 2B4JA 3GSDA 3KUHA 1MDUB 3TA0A 5I3QA 1LXNA 3ETMA 1YHQN 4LF4F 1REGX 3KMSA 4KFBB 5KPRA 1RHJB 3BR8A 2CZ4A 3OD2A 1SKRA 1L3SA 2G8UA 4FXDA 2V69A 2L9DA 3R2DJ 3LDOA 3KKRA 1T05A 1LFWA 3GV7B 1K8AO 4OIXA 1RT2A 2X6NA 4EP5A 3R7NB 4HHHA 1VQ8S 2ZH2A 3PSIA 3OVNA 4FZVA 2KG1A 4RW4B 3ETOA 1JK9B 4ZVHA 2WK4A 2ZDPA 3CJKA 3CJSA 1N33F 4XPEA 1HKGA 4XK8C 1AT1B 2QA2A 3LDNA 1NZAA 2ALYB 2AW0A 4WFNL 1X9MA 5E0OA 1GMUA 3W66A 2OAUA 3OFEA 1SI9A 4Z7YA 1WHWA 4ZJOA 3L4BC 1BI4A 2BRKA 4B9MA 3FZFA 3JAMO 2FF3B 3M6UA 1BL3A 4B9SA 5BRFA 1CULB 2G0JA 1HUXA 2WVDA 3WDOA 1GLCG 3VZHA 1OPZA 1XK8A 4P7VA 3W2VA 2P1JA 5IZHA 7FDRA 3DRPA 2HZAA 1RXOB 4RU9A 3ZNUA 3H45C 1JLFB 1VMBA 1CXQA 5AQPA 5C2GA 4FO0A 1T95A 5HAOA 4LF4J 1SQGA 4KC5A 3MM6B 3F9MA 2QT7A 4C4WA 3NS6A 3BEXA 1GNKA 1FTCA 1ASUA 2EK1A 1NLKL 1VBKA 2A1RA 3KWMA 2PDAA 5ETPA 2QRRA 4A8OA 3MUVP 2B4VA 1UMJA 2D0CA 3LP3A 2UXDK 5D8HB 1VQ5N 3DLEA 1ASWA 4FZXC 4JI0F 4CEFA 4BQLA 2VFRA 4DL2A 3W3SA 4CK3A 4FJHA 4USMA 1N33J 3PX4A 2Z56B 2QE5A 1TAQA 1O51A 1NK5A 1JXEA 1YIJN 1ILYA 1HWKA 2PFUA 2KHDA 2AYBA 1SKUB 1FRLA 4CLWA 1JB0C 2E66A 3PRDA 3Q86A 1L3UA 2IVMA 1YZ6A 2FZKB 2CWKA 1EQMA 2W8LA 3LH2S 4NYOA 2IJRA 2NRHA 1NJYA 1JXLA 5AQNA 1XR5A 2J8AA 4K2JA 5CYJA 2ADCA 1K9MO 1R7IA 1XMOF 3QYYA 3LPYA 1ZM9A 3HI9A 3R5BA 1CJUB 2YWGA 3ZO7A 1DURA 2Q1NA 1WORA 4QPTA 2VBYA 2EC2A 5KT4A 2ZBCA 2VWBA 5KFJA 3N4QA 3L3VA 3TO8A 4ANCA 4JI4F 1UVJA 4JK7A 1U49A 1LOTB 4KI6A 2YKOA 2YHWA 2HQFA 2NRXA 3UCGA 3GFZA 1C4CA 5C2CA 3CG7A 3EGVA 3I5AA 4F4XA 1Y5NB 4ZN3A 3G4SS 3UNYA 3KDOA 3KOAA 4CJQA 2O8FA 3QEIA 4HTJA 4PY5A 2QWRA 1YJ9N 4AE5A 4CWBA 4XIUA 3RAQA 2ZFHA 5E33A 5DDOC 2A2CA 1YG0A 2ALZA 1KAYA 4IOAL 5FD1A 5IC6B 2ZJQQ 1HD0A 1SZ2A 4CJUA 2HW3A 3FK4A 3OTOF 2CKWA 1P1TA 2PGCA 4FJ7A 3HHNB 3DRXA 3CO0P 2JFDA 3UE2A 1FRJA 2XYHB 5GAGP 3PEHA 1YAGA 4J9UE 1XMOJ 1FKPB 4DZDA 3IWNC 1WC6A 3GDQA 4Z4CA 5T7LB 1PBAA 3MX5A 3Q22A 3HHLD 2IJFA 2XY8A 1NEEA 4YQWA 1SH3A 3WNFA 3GLJA 3D6FB 3FJ2A 4JI4J 3NNAA 1FKOA 2YH0A 2IDLA 1S1WA 1QVFM 2D0PA 1QJHA 5M1QA 5F8NA 4K41A 4GKJF 4LBHA 1ITPA 2FSNA 1RISA 2BXJA 3GWCA 5A2QO 2CQ4A 1ZM2A 2IC3B 2W2PP 2R8JA 3I8DA 4KIAA 4CJRA 1VGYA 3LP2A 2HFZA 2F5GA 5F41A 2E1RA 3VF2A 1RFQA 2E6MA 4F25A 2VA2A 2VG5A 1YVNA 2FD2A 4KSEB 3WUHA 3CC7S 2ASOA 1Q79A 5F0UA 1BU6O 1WSFA 4KPYA 3OTOJ 1BO5O 3HHEA 1MWMA 4GV3A 4CZCA 4K4VA 2GMLA 1S0VA 3I0RA 3BZQA 3NHGA 3ZETB 3DGPA 3C46A 2CRLA 1NM1A 4ZPTR 2V2KA 1YRUA 3QFUA 5GMKa 2F63A 1IKVB 4C8OA 5HBMB 1VQLN 3NCPA 5A8RA 3BBBA 2XS7A 1DGKN 1HWUA 3R8YA 1VQMN 3DLGA 3PHTA 3ENBA 4LY7A 4QW8A 1YWXA 1NCLA 1K0TA 3J80Y 2DIVA 3M30B 1WOPA 2DR6A 1HRHA 4IRKA 1ZBLA 4DCJB 1ULRA 1T94A 3I4PA 4GKJJ 1M5HA 3ZEUA 3CC2S 3PG9A 4A4JA 4IFYB 1RABB 2W9CA 5D0RA 4LUBA 4ZP8A 3LWLA 3VAFA 1YBAA 4K4YA 1T11A 5GVQA 3HP6A 1Q18A 1RDRA 2ZUAA 1RAGB 3OYJA 3OYNA 1V9OA 4IFVB 4K0KK 3SI8A 4IR9A 3MFHA 4CZLA 4FNIA 5GMEA 5GMDA 1KVBA 1RDCA 2H65B 2V0NA 2H5JB 4PKDB 3POTA 2NZTA 2CPFA 1QLNA 1Z2ZA 3UD3P 3HXMA 1J5OA 2GX9A 3ZTSA 2OPPB 2DFHA 4CEBA 4FLTA 1QE1A 5KFFA 2B51A 1HR0K 2UXDF 2G8WA 4LF6J 4EBEA 2AYGA 3O1LA 3R6GB 4MYTA 5GAHU 3DWLA 3NCRA 3U8XA 1RAFB 1MN9A 2P9KA 1W26A 3OYDA 4RL1A 1UP1A 1K6YA 2PI5A 3F9KA 4FLUA 4M3TA 4BDYA 4R0EA 1F3FA 1H38A 1XMBA 3IG1A 3M2RB 4WBFA 1JCFA 3D2EB 2DR9A 4KTQA 3N28A 1EWQA 2D4WA 2DY1A 2C3UA 1M1GA 2HHWA 5KFSA 2CJYB 3M8PB 5ETVA 4DX6A 2CPXA 1JLGB 2HGMA 4WK3A 3H5SA 2KRBA 3KJFB 2VG6A 3VQDA 3OXGA 3DI6A 5LSLA 5J2NB 1CQNA 2F8MA 4DI6A 1HI0P 3LAMA 2KRRA 5M1NA 1U1KA 2IBKA 1FD2A 4Q44A 1TKZA 3GQCA 2OELA 4IH6A 4MKVA 4MT1A 2R7YA 3BN4A 3VEOA 4YORA 1BLUA 2Z2MA 5EHHA 3ENQA 4N41A 8ATCB 1VK0A 1EQYA 1SJQA 2YX7A 5IV4A 5J1NA 4QQBA 5AXNA 3BO3A 3HVRA 2RS2A 4PG4A 4F4YA 1EHWA 4QOTA 2ZEJA 1MG7A 4YHHJ 2ZZNA 1DTTA 2NQPA 1DTQB 3GU0A 2CIMA 5DMRA 4HUFA 5D15A 1OY6A 4NPOA 3G86A 5A6WA 1BIUA 1RT7A 3MCSA 5LXRA 4GRSA 4YOYA 3KG4A 4BRNA 3CJ3A 2HLUA 4BG8A 2ZWOA 4HTLA 3VMFB 2G8FA 2R7SA 1TU0B 4OO1J 1C0GA 1SAZA 1S9EB 2AA4A 1T9VA 1R31A 3M8WA 1YRXA 4CTAA 2UP1A 2J0QD 1HLWA 2E44A 3VQEA 4UOCA 2GCFA 3AB2B 1T3VA 5MLCV 5C25B 1HQUA 4UY85 1RA6A 3H2VE 2F9JA 3NGIA 2GVZA 2BR0A 1GMWA 3G82A 1B9FA 4CO0A 4WIIA 2MZTA 2HZVA 4RZRA 2KVQE 3MXMA 2A1BA 2QN6B 2WSFC 5JVHQ 1K47A 3PRBA 5A0YB 3H5XA 3ZT1A 1N8RO 5C24A 4KH1B 5D4LA 2DK2A 1FDBA 1N88A 1ATRA 3AVHA 1SKSA 2Z2LA 1SB6A 2R7TA 3GYXB 4DEZA 4H8KA 2G1DA 1RAAB 2SXLA 2XYPB 1IBMF 1Y10A 3CIPA 5H1SV 4FXWA 4C97A 4I6MB 2MKCA 3A5MC 1Y0HA 5E5NA 4UOGA 2POKA 4Q8EA 2XWYA 3U9DA 1LXJA 3EE3A 1NK8A 3D7SB 4ZVOB 3W5XA 2OZMA 2J9DA 2ZVSA 4DBQA 2P6TA 2KW4A 1NGDA 4O3RA 1GLFO 2G13A 4KHSA 2OIHA 2M3DA 4NCGB 1AA1B 4ZPDA 4OZ5A 3QERA 2CJAA 4WQ5A 1CC8A 2J0XA 1Y11A 3T5KA 4J9OA 4FF3A 2ASLA 4IBNA 5IM0A 3TVZA 2LKZA 3N4PA 3RW6A 3QO9B 2VC1A 3EVOA 4DTMA 1LWCA 4KHWA 5D0HA 5GAHP 4JKHA 4R79A 3MCNA 2BJ7A 2E20A 4RO0A 2GJFA 1Y3KA 2CUYA 4FKYA 1RTIB 1YT3A 1NGCA 4BC9A 1G4CA 1RT1B 2KVIA 4MDBA 1Q7YO 2HNYB 2FJXA 1DQAA 2QFIA 2DNZA 5KG2A 4NCAA 2KT5A 1VQNS 1UEKA 4QCLA 4BS2A 3S7RA 2WW8A 4ILJA 2BANA 4JKFA 4KH6A 2A5XA 5CYMA 4S0MA 1IBMJ 5HVHA 4LBPA 1FW6A 4K0KF 4I0WA 4O3PA 4I2QB 3VF0B 1NK0A 2JEGA 5K5MA 2W2MP 2J4RA 1UKUA 1ZETA 5GAEI 4DSJA 4CEDA 2BUNA 5EX5A 4J2EA 2P2CB 9ATCB 1JJHA 4QWBA 5AE2A 4GVMA 2QO3A 5AFUH 2ZD1B 1HR0F 2E5LF 2XSJA 3HP9A 5FLXU 2FPHX 4CFAA 1HBNB 1C2PA 3P4IA 3K9KA 3CMEN 4PWWA 1M1KO 2ZHOA 3G6VA 3PYGA 3H1VX 4FWPA 1H1VA 1XNRK 2YNIA 2NUUG 4B9LA 1C1BA 4DR5K 2P5VA 1KVAA 3MWTA 5EWFA 4PRFA 4ED4A 4WFAQ 2Q3PA 1Q95G 4W98A 2B5JB 1IJJA 1Q8BA 4FPAA 2V9WA 4AXIA 1WDTA 4QW9A 3ZYYX 1UFLA 4FWSA 4C23A 1VISA 1JL2A 4AM7A 3D6RA 4KR0B 1R8AA 4C8YA 4JN4A 5EOYA 2ZGYA 4LFCK 4K0KJ 4M5LA 2DEJA 1LW2A 5HOOA 4F4KA 3N6NA 2OTJS 2LQJA 2AJ4A 1VQ9S 3CJRA 1OO0B 4A5AA 4BR0A 1NH8A 4OI2A 2OD4A 2LYVA 4PPZA 2NRVA 2V4JB 5HLFB 4NA3A 1HR0J 1D1UA 4BLGA 1AFJA 2E5LJ 1OMSA 1IUJA 4MFBB 3M9NB 5DM7L 3KKSA 4KKOB 2R7WA 2F96A 3QMLA 5CY4A 5K14A 5H9EJ 3CPWM 1BIZA 2BVZA 1RWKB 3NBPB 4OX7A 3SDEB 4WFNQ 1URRA 4FM1A 2AZ3A 2D7SA 3TOQA 1RBLA 4EYIB 2MJUA 5EY4A 4WE1B 2Z57B 2HYIB 3WIVA 3UDVA 2XGPA 3MM7B 2J7KA 2CPZA 2IA0A 4Y6IA 2AJQA 4FWRA 3UR3C 2VCPA 4B1ZA 4DSFA 3AO1A 5J2MA 3E1YA 4EMDA 3BF3A 2E1ZA 1GMWD 4ED8A 3UDCA 1GLAG 4OFZA 4C8KA 3QETA 4ZVGA 2O4GA 3BP8A 1WLJA 3JXOA 4NLPA 4CZKA 4J37A 3CO9A 4KHRA 4H4MA 3ZSZA 3L2VA 5FIIA 5HANA 2Z2YB 2VKZG 4NLVA 2P9UB 4K8XA 1TUWA 3AAPA 4JV5K 1GOAA 3ZSOA 5LMUK 4BRKA 4OQJA 1T9XA 1U0HA 4JKCA 5SWMA 3RR7A 4B02A 1ZZNA 1FRKA 3MMAB 1FXLA 5FPEA 4A8WA 1NSPA 2OLWA 2XY7A 5JLFA 4FOIA 4K8RA 3P38A 5BN8A 2YNFB 2OI2A 3US5A 5G0RB 3OS2A 3LDPA 5LY3A 1RT5A 2YWHA 1NU0A 2GJIA 5E3PA 2EFQA 1NH7A 4CF8A 2A10A 3HHKA 1JLBA 3DRYA 3O1WA 1S76D 4KHYA 3IBWA 4OJ1A 3I9V9 1X60A 3DM2A 1RBTA 3NRBA 3OT9A 2CQPA 5L38A 3OR1B 1S4EA 2YI1A 3AQOA 5H9FK 1Q5YA 3OW2M 1KD1O 2QEXS 1JCEA 2YNHB 1WC5A 3GZ7A 1Q16B 3UFCX 1NB7A 3OFFA 4Y65A 1FTRA 3AO4A 4QS9A 2JLGA 4E1MA 2OTLN 4ILRA 3N0VA 2QTWA 1MSWD 3D2FB 4FJGA 1T03A 1U1PA 3L3UA 3I8BA 5IT0A 3GFXA 1XMQK 3CJTA 3KD5E 4OI3A 3WBZA 1VAZA 1BQMA 2EBEA 4RJVA 1KOOA 3VESA 4LSLB 3CD6N 4YDUC 1UWBB 1I51B 4N56A 2F40A 2AMCB 4IOAQ 4NRTA 1AUDA 3FR0A 2W6LA 4B1YB 3IR7B 4M3UA 5L39A 3OYAA 3H2UB 1Q4RA 3V6HA 3SJHA 1C1CA 2B7CB 4IO9L 1ZA2B 3BQ2A 3D6HB 3WQUA 4X4UA 2ZC3A 4C7QA 2E29A 3H40A 1H73A 3LAKA 1J9AA 1WOQA 2VYPA 4CLSA 4QIVA 2CZ9A 3ZZUA 1TL4A 2WVEA 3RBEA 4ICLA 2DHHA 1GX6A 4FZZA 3BV8A 3R9LA 2KB2A 1XNRF 1J54A 3J7ZO 2GIQA 1YBTA 4Q8FA 2N4DA 3VQ9A 5FPDA 1RKIA 4DR5F 4N77A 1NGAA 4OYAA 3O8WA 3ZZYA 3KUEA 4B8CA 4U8VA 4DR4K 1KAXA 4ZVFA 4CF2A 4CZEA 3ADAC 1RU1A 2GV9A 2I8EA 1RDWX 2ZE2B 1RZMA 3CULA 2B4OA 2NNWA 4BC3A 3DRRB 1RT3A 2IVPA 3UVJB 3V81A 1VQYA 3RSEA 3LP1B 2K3IA 3JTOA 4ID5A 2OGUA 1W2IA 4L72B 3SAGA 2WONA 1FNMA 2P9CA 5HJYA 2CZVC 4E7HA 2HS0A 4K4WA 2Q0RA 4LFCF 1X5OA 3L7PA 5MAOA 2XMAA 5GIOA 1S22A 2XMWA 1RAJA 4CZJA 1PYSB 3TQEA 1X7VA 4RW7A 4KREA 1M5PC 3GV5B 5DG8A 2R8GA 3TW0A 4WZQA 1LKZA 3CIZA 5JS2A 4RW8A 3I4HX 1UAXA 4Y28C 3BSCA 1F3VA 1V3SA 2NZ4A 4HH0A 2WBMA 3A5OC 1JLCA 4ZVPB 4NEZA 3VEVA 1TL3A 1A5VA 1Y97A 4ECUA 1J6ZA 1XR7A 4L3NA 4OLOA 1HPZA 5LL6d 3O9RA 2WBNA 4LFAK 1XNRJ 4PXDA 1HBUA 4P2XA 1SL0A 4DR5J 1E4FT 4ZCLA 4FW2A 3CVKA 4P2MA 3LGNA 4BDZA 5KFAA 2WTFA 3VQBA 3OJSA 1NPPA 3HVTA 3QT7A 4ZLNA 3E01A 3A2FA 2FJWA 4CM2A 4DHVA 2GNKA 1HMVA 2OJ3A 4BY9C 3NH0A 3K59A 3Q89A 3QEWA 2IPOB 1N54B 1FD8A 3ENOA 4J9RA 2KM8C 3AY9A 1S0NA 1F9HA 3LW5C 3TEGA 4LFCJ 5CE3A 4CIFA 1BCMA 1KRPA 1FK9A 1R3NA 4YY3K 3CCJN 3MAQA 4MKAA 2XZDB 5DQGA 2H54B 2MXYA 4JV5F 5LMUF 4BR4A 4CVNE 5JLHA 2OPRA 1LWXA 2MMYA 1XIQA 3T5JA 2QZ8A 1VSIA 1LK5A 4CLZA 2GQQA 3THYA 1YJRA 1TFYA 2BUPA 3PLAA 3MEKA 1S0MA 2RU9A 4Y1CA 3KK3A 3DGVA 1SL2A 2V9KA 3IRXA 1NKBA 3A5LC 3KZBA 5F1XA 4OZ0A 4B9TA 2UXCK 3MN5A 4J5OA 3SEOA 3T6BA 1RB0A 3BGLA 3OTDA 3QDKA 3VF4A 3NF7A 4RPFA 2JHEA 2MEWA 4KO0A 5I42A 4CCHA 3PHEA 1HNIB 1R8CA 3RRKA 4BGAA 5HQLA 1T9TA 2ZWPA 2E1PA 2DISA 4CHQA 1VSHA 4JV5J 4JI5K 3BR9A 4OZ1A 1U8WA 1CXUA 2HIYA 3AVNA 4EI2A 3AA9A 2Z1GA 1G15A 4QU7A 2F8HA 1XMQF 1YVUA 2GS8A 4Q0BB 2HF4A 2E9TA 4ZP9A 4CJFA 1DEJA 3NGZA 2MZSA 4CK1A 2WHOA 1HQEB 3A8JA 1ZS6A 2H4WB 5GAEU 1IKWA 3M3ZA 2IYGA 2CNOB 2R7QA 4N8NA 4ANDA 1QSYA 2BQUA 2O5DA 2YHBA 4O5FA 2GA7A 4QOZB 2DHAA 2P9IA 3MM8A 1ZC6A 2QGFB 4CLPA 1NGIA 4ITSA 4N76A 2O8DB 1BUPA 1IR2A 4WCEQ 2R42A 3FBEA 3QQCD 2FTRA 3SAHA 4XH5A 4L75A 1CULA 3AOCA 3SQ2A 2DNRA 4WXOA 4F0KA 3PUFA 2OFHX 4HDGA 5M1PA 5AQLA 4PG8A 3CDUA 5HVGA 1S7IA 1QZ6A 3CD0A 3DXBA 3D0IE 1B7FA 4J2DA 3QGPA 3D6TB 3N5BA 5JMVA 3DOKA 4ECYA 4AILC 4NYFA 2HAFA 4FJ9A 4ECZA 2VU5A 1VHIA 4DR4F 3MM6A 1IJFB 2OMOA 3L7UA 3SJJA 2XO6A 1XMQJ 3C16A 1DBDA 3PY8A 1PC5A 2QWMA 1P8ZA 4P73A 1I3OB 3HSJA 3THPA 3U9ZA