1LWCA

Crystal structure of m184v mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
534
structure length
506
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 146
structure length 506
sequence length 534
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lwcA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lwcA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lwcA05
2B5JB 3VA3A 3KJVB 1KHVA 3OVNA 1X9MA 1JXLA 2W9BA 1B9DA 1JKHA 4RW7B 4KTZA 3HO1A 4QPXA 2IGIA 4H4OA 5T14A 3DOLB 2XI3A 4O4GB 3DI6B 4NYFA 4KAZA 4HKQA 4NYZA 4DTOA 4PUOB 1QSLA 3MEEA 3O3HA 2V4RA 3BSCA 3RWUA 4WXWA 4Y2AA 3KLIB 3OJUA 1S1TB 4CEFA 2P5GA 3GILA 2YNIB 1WAFA 2UVUA 4J9KA 4ED6A 3Q8RB 3M9NB 1IKYB 2VA3A 1QSYA 5FDLA 2HVHA 3QERA 4IFVB 1TKXB 4M3ZA 3MR5A 2IS3A 2HWIA 4RUCA 4B08A 2R8IA 4OLAA 1NK9A 1LAVA 1XHXA 3HJFA 2B5JA 4YNQA 5KFZA 3VQ6A 4F4XA 3ALYA 4Z4HA 1NKEA 3OYCA 4JS5A 3VA0A 3KD1E 3FSIA 2IJFA 3P83D 3P1GA 1WSIA 2BQUA 4I9QA 4FBUA 1G15A 3BDPA 4FJ7A 3NF6A 1TAQA 4HCCA 4W5QA 5I42A 1J5OB 3RR8A 1S6QB 4C8LA 2RKIA 3TR8A 1TP7A 3QLHB 3VQ8A 3KK1A 2G8UA 2E6MA 3Q8SB 4CHOA 4DU4A 4CE9A 4FLTA 5K14A 2ILYA 3KLGB 1UWBA 5C42B 1S49A 5KFHA 3DLKB 1HQEA 5KFPA 1YVUA 4FJLA 5CY4A 3NCIA 3AVLA 2GIQA 5DG9A 4HVJA 3H59A 1CXQA 1HPZA 3KHGA 4CEAA 4PA1A 3CFRA 1B9FA 5J2PB 2KTQA 4U6PA 4ICLB 2IM1A 3T1AA 3LPTA 4RNOA 1XWLA 2D7SA 4OJRA 3E01A 4BDZA 5KFNA 2VWKA 2UVRA 5KGXA 2AU0A 4MK9A 4PWDB 4ECXA 4B8AB 4TY8B 3M8QB 2D0AA 1C0TA 1XR6A 1TV6B 3I5AA 4NYNA 3SPYA 4B9TA 3RMCA 2XY7A 5J2QB 3RMDA 4HHTA 4I2PB 1DLOA 2ZD1A 3EY1A 1QHTA 4DL4A 3VQAA 2R2RA 3MR3A 2X74A 3HM9A 2E9ZA 1TKDA 1S1WA 4ECYA 4FLZA 1KVAA 1DTTB 5J1EB 4MKAA 1UWBB 4BE0A 3AO2A 4ECQA 3OS0A 5F8NA 4IH7A 2JLEA 3V9UA 4FJGA 2XGPA 4CF9A 1HYSB 2FVPA 4OKEA 3PR4A 1JL2A 1TL3B 3KHLA 4J9OA 5F8JA 2KZMA 1RTIA 3FQKA 3TAEA 4DTSA 3AA5X 5F8MA 1KFDA 4MK7A 4W5RA 5CZ2A 1SH0A 5KFBA 4BACA 4NLDA 4Y34A 4BWMA 4FM0A 3OLAA 4M3WA 4ED8A 4IG0B 2GC8A 1NOZA 4OKKA 4OGEA 1IKWB 3NDKA 4TSXA 2C22A 2JGUA 4IQXA 4E7HA 1NJZA 5KFYA 2W9AA 3CM5A 3NBPA 3K5LA 1YTUA 2HHWA 4TYBA 3RRGA 1S5JA 4F4KA 1TK8A 3V1RA 3U6FA 4K4ZA 2BANB 5I3UA 4CHQA 2WOMB 4ZTFA 3M9MB 1RILA 3ZT3A 4B3OB 3BR9A 3AVNA 3WNHA 1X9WA 3BQ0A 3DRPA 4KSEB 2E4LA 3CO9A 3ZCMA 3NF9A 3V81A 4TYAA 4CJEA 1TAUA 3V6DB 4NLSA 4AHSA 3L2QA 4FJXA 4Z4FA 2G8WA 3FFIB 3UPFA 4R8UA 5F8HA 1S1UA 1R0AA 3VQ9A 1VSFA 3HPOA 4E7JA 2JC1A 3PHEA 4J9MA 1UA0A 1RAJA 5KFDA 1NOYA 3UIQA 1VRTA 1S1TA 3MXIA 3SZ2A 4KHYA 1JIHA 1NK8A 3K59A 5KTQA 4EP5A 1HMVA 2WK4A 4KREA 3D28A 3T5LA 1EX4A 3MTKA 1NK0A 4KKOB 4B9LA 2HMIA 1JLGA 3TAPA 1D0EA 5F9LA 1WSGA 1RT2B 2VG7B 1HYVA 4CJVA 4JRQA 3S3OA 2R2TA 4CGGA 1WSHA 1N4LA 3DLHA 1JLFB 1REVB 4DQPA 3KKSA 1QAIA 1IKXB 3DRRA 4DL2A 3PX6A 2BE2B 1JLAA 4KI4A 3MFIA 3UDLA 4ID1A 1JLCB 4DTMA 4LSLB 2OPPB 1SV5A 4FLYA 1VSIA 4BE2A 3B6PA 2HWHA 2XY6A 4CHPA 5EUHA 2XCPA 3MEGB 3V1QA 4KO0A 1BIZA 1D8YA 5JXSA 1Q9YA 1U48A 5SZTA 2WOMA 3HPHA 3AO5A 1LWCB 3HHKA 1W0HA 2DFEA 2FVSA 1K1SA 5HROA 4RW6B 5HLFA 4CERA 3TAGA 3C95A 2FBVA 3H4DA 4NLUA 2D3ZA 4DEZA 3HT3A 4DL6A 3AVJA 3PV8A 3KNAA 4CJLA 1BQMA 2RF2B 4DTPA 3PW2A 3IS9A 3V9ZA 2RDIA 3H40A 3OL9A 2HW3A 1RTDB 5HP1A 1EP4B 5KFLA 4K4VA 3LDSA 5HBMB 3GIJA 1Y97A 4B9NA 3DLGA 4K4UA 2V9WA 2RPIA 3H5YA 2R8KA 4AHRA 3NGIA 5KG7A 1T8EA 4EO8A 5KT6A 3HKWA 3OS2A 2VWJA 4G3IA 4ZPAA 3I0SB 1FKPA 1GX6A 3F73A 4ICLA 4YQWA 4ELTA 4CFAA 5KFOA 2AGQA 1C1CB 3SUOA 3DMJA 4F4YA 4KI6A 1HNIA 1HPZB 4DQRA 1SKRA 4RG8A 2OYQA 3HPGA 2QV6A 4ED3A 4E7KA 3MF5A 5E41A 4FJ9A 1HQUA 2IM2A 1LWEB 3QESA 3I8DA 4L8RB 1W25A 3H4BA 3LP0A 2YV0X 4CF8A 3L2UA 4FJNA 4ZVFA 1KVCA 3K5MA 4DQSA 2G8IA 5HROB 2A1SA 3TI0A 2DPJA 4LQ9A 3OYFA 4M94A 4KHNA 3NFAA 3CDUA 5KG3A 4U7CA 3A2FA 4H54A 3VQQA 2UUWA 4E0DA 3KLEB 4KO0B 5KFXA 3GV8B 3ITHA 3I0SA 4Y3CA 5KT4A 2WTFA 4FLXA 4JUZA 1R0AB 3QGIA 2FBYA 3LP3A 1NK6A 4B9MA 1T3NA 2D41A 5EWFA 3L8BA 4E7LA 4CF2A 2HHUA 3BGRA 4OLBA 3DYAA 4ZMMA 2C28A 4TQRA 3BQ1A 2Q3SA 3KLVA 1F21A 3KIOA 3DRPB 3T5JA 5DMRA 1IKYA 1JXBA 2YNGA 1EP4A 1LW2A 2XWYA 4EBEA 1JLGB 4B3OA 1U04A 3TVKA 2W7PA 4AHVA 1QSSA 1RT5A 4H4MB 1UAXA 3KLIA 2Y1JA 3KTQA 1U47A 3L3VA 4DU3A 3MEEB 2BRKA 4WE1A 5KFCA 3G0ZA 3VQCA 3BSAA 2VG5A 4QWDA 3NAEA 4W5OA 3RBEA 3RB6A 3TQ1A 4FK4A 3S3MA 2OPRB 3VQ4A 3I5CA 1K1QA 1JLBB 2HNYB 2DFFA 1FKOA 4ZVHA 3LP2A 3KKRA 4QOZB 1RDDA 2IA6A 4DSIA 4BWJA 1SH2A 4ED1A 5KFIA 1QQCA 2HHQA 1NKBA 2C2DA 4CGIA 5KFQA 3DOKA 1X9SA 4CGJA 4J2BA 4IH6A 4NLYA 2A1RA 1S6PA 3V9WA 3CJ2A 3NH0A 4M42A 2VG7A 1JLBA 4O44A 3M8PB 1J53A 2W7OA 4FXDA 2VG6B 4CJPA 1TL3A 4CJKA 2ATQA 2XI2A 2R8GA 4B9UA 1RT7A 2XY5A 1C0UB 2IC3B 1HMVB 4KHSA 3GIIA 4J2DA 3M8RA 3LAMA 5CYQA 4NLOA 3JYTA 3RMBA 3NKYA 1JLQA 4XIUA 4URGA 1A5VA 4IRCA 4FLWA 4M3YA 4CCHA 4NLWA 1LW2B 4MIAA 4IOBA 1WNEA 1JKHB 3QNOA 3SI6A 4N56A 4NLRA 4LH5A 1BL3A 3DMJB 4IFYB 4OPKA 3TAQA 4K8ZA 1TV6A 3WNFA 3FFIA 2D0CA 5KFFA 1I6JA 3KMQA 3GQCA 3QYYA 5KT5A 5DGAA 1ZBUA 3TANA 3DLRA 4FJIA 3KMSA 4RNHA 2AGPA 4MQ3A 1ZTTA 3ITHB 4DQQA 1Z4UA 3RAQA 1TK5A 2R8JA 4MFBA 4DSLA 3L3UA 4ECTA 3KHRA 4PQUA 4NLXA 1C0MA 3OYNA 3LZJA 3DLEA 1YVFA 3BSNA 4HTUA 2UVWA 4BDYA 4K4SA 4E89A 3IS9B 1LW0B 4J9SA 3GV7B 3HVTB 3D45A 3KK2A 4K4TA 1J9AA 4RW4B 4R5PA 3NAHA 4RUAA 4ECWA 3AVCA 2XO7A 3OL6A 4CIGA 5F8LA 4O3SA 3NGYA 3SPZA 4I2PA 4AHUA 5CYMB 2HHSA 5KGWA 4PQUB 3L2WA 3CIZA 2QE5A 2PZSA 1Q8IA 1S6QA 1RT3B 1ZBLA 4FJKA 4NLVA 4KRFA 3ZSYA 1KCFA 2OPSA 3QNNA 1DTQB 4ELVA 4Y1CA 2BE2A 3AVHA 1C1BB 1ZBHA 1RCHA 3QEVA 3QO9B 4F50A 2B43A 4DSJA 2R2SA 2XY8A 1S9GB 2HHVA 3TABA 4FZXC 5HP1B 1VSJA 4RW4A 4R5PB 4KB7A 4ZHRB 3QETA 2RF2A 3MEDB 3FRZA 5C42A 2X78A 1U09A 2GIRA 1VSMA 5KG1A 4KHRA 3AVKA 1NKCA 1LWFA 3ZSZA 2Z1GA 3KK1B 4CEZA 3VQ5A 3VN5A 4GW6A 3MR6A 1UOCA 4Q0BB 4NLQA 3NH1A 2FJWA 3SQ4A 4TY8A 4F2RA 4GVMA 2O5DA 1U4BA 4ZP9A 2KFZA 2UVVA 4C8OA 4EBCA 3QGGA 1IO2A 4X2BA 3CG7A 1FK9B 1VSKA 4QWBA 5JS2A 4QWCA 4O55A 3QIOA 2B6AA 5C25A 1WAJA 1VSDA 3D0PA 2OA8A 4CGFA 2AJQA 2W9CB 4YP3A 4OKJA 5J2NB 4KKOA 1HQEB 3T5HA 2YNIA 2W8LA 4YFUA 3V4IB 4AILC 4WYWA 3EPGA 1SL1A 4BDPA 3KK3A 4FLUA 4GC6A 3RRHA 3QIDA 4CJSA 3V4IA 4FM1A 4LSNA 4ZHRA 2JC0A 3LALA 3IGVA 2WCXA 3PW5A 1XI1A 3WNGA 4CFBA 4E7IA 3O4QA 2I5JB 4KB1A 2W9BB 4GMJB 5KFTA 3NGZA 1D9FA 1RTHB 3OHBA 5KRSA 1T7PA 2FC0A 4OGCA 3H5SA 3ZSRA 3PVXA 1NJYA 2HVIA 3H5UA 3SUQA 1GOAA 4HUGA 1BCMA 3HK2A 2RN2A 5F9NA 1DTQA 4HYKA 5FDLB 3AA3A 4O3RA 4Q0BA 2OPRA 1QE1A 1RT3A 3ZT0A 1RBTA 3P5JA 4QCLA 4O0JA 2IAJA 4ECUA 2YHAA 4ELUA 3E51A 4IBNA 4Q43A 3OYLA 4DMNA 1S0OA 1FXXA 1SUQB 3G6YA 2HNDB 4NZ0A 4CEDA 5CZ1A 2FBXA 4DF4A 1EETA 4DQIA 1S10A 1IG9A 4F2SA 1HQUB 1QUVA 4WYLA 3Q8QB 3N6MA 4ZP8A 4DTJA 3HSTB 4I9LA 5HRSA 2KFNA 1ASWA 3DM2A 1C0TB 2G8KA 4KHQA 2V4QA 2D0BA 4DTRA 2YKNA 3VQSA 3B6OA 2QKKA 1RDCA 1ASUA 1A5WA 1J54A 5D3GA 4Y1DA 5DG7A 5FRNA 1N48A 2OPQB 3PUFA 2OPSB 3SFGA 3GV5B 5L1KA 3D5MA 4Z4CA 4WZMA 3S3NA 4JV1A 3CQ8A 1GOCA 1HYSA 1BQNA 2IJNA 4Q8FA 5CYMA 1GOBA 2JEJA 1RTDA 5KFKA 1HNVA 1S1XB 3LP0B 2AX1A 3OHAA 4ID5A 3MEDA 2C2RA 1OS5A 2XHBA 2O4GA 1HNVB 1D5AA 4ECSA 1YT3A 4TQSA 1C0UA 2IC3A 3C6TA 1S48A 4LY7A 1HNIB 3DLBA 5KFEA 3TAMB 1RDBA 1Z26A 2FLLA 5SWMA 3SFUA 1VSLA 3AVGA 3OYBA 3HXMA 4CJQA 4FK0A 4JLHA 4PY5A 4XPEA 4DSEA 4CK1A 2QKBA 1A5XA 3DRRB 4ECZA 1CXUA 2ZQBA 3DM2B 1WN7A 3LZIA 2G8HA 3NH2A 4FLVA 3T3FA 4I7FB 5EDWA 3IAYA 4IFVA 1O1WA 4YR2A 5HBMA 4EYHB 1N5YA 3C6UB 4M41A 1CLQA 4FJ8A 4C8MA 4K50A 5C24B 3OL7A 4DS5A 4HUFA 2G8FA 4KPYA 4KV8B 2KW4A 4NRTA 2NUBA 1JLEA 1RDAA 3IGNA 5CYQB 2HNZA 2FLNA 4DTUA 2WB4A 1KTQA 3PX4A 1SH3A 5DLFA 4C8NA 5HLFB 4Q8EA 5KFJA 4CEBA 3DLEB 1JXEA 2W42A 2Z1JA 1RBRA 4DS4A 3IG1A 4CIFA 4IKFA 4IDKB 1VRTB 1GX5A 1WSEA 2YNFA 3EPIA 3OLBA 2ASDA 4JV0A 3QIPB 2AWZA 3GIKA 3TAFA 4UQGA 3EZUA 4ZPCA 3KLFA 4O4RA 1FK9A 1NHUA 1Z25A 3HP6A 4Z4GA 2P51A 3K2PA 1L3TA 1NK5A 4ZP6A 2ASLA 3HP9A 1REVA 4DG1A 3BREA 3O3FA 4IFYA 1RTHA 4O0IA 4NCAA 1RT6B 3LP2B 4Z4IA 1K6YA 4IR1A 1U45A 2I5JA 4O3QA 3AVAA 3ASMA 3CJ4A 2YNFB 4CJ4A 2VG5B 3VQBA 2QXFA 4IH5A 2AX0A 3VQ7A 4TY9A 3EYZA 3UR0A 3TARA 2F8SA 2OZMA 4KB0A 1TKZA 1B92A 2FBTA 2PYJA 3ICLA 3NBPB 1JLEB 5KFGA 3ZSWA 2B4JA 3OYKA 4FS2A 1RYRA 5C24A 2D5RA 2OZSA 3AVFA 4CK3A 4ECRA 4E1MA 2B6AB 3FDSA 4DTXA 5KT2A 3L2RA 5KG5A 3DOKB 3AA4A 2BR0A 1CZBA 4G1QA 4KTQA 1IM4A 5DG8A 4NCGB 4TXSA 3NGDA 1BIUA 1SKSA 1RTIB 1IKVA 1RTJA 4CFDA 1FKOB 1RNHA 1TK0A 1C1AA 1VSEA 3CDWA 1MU2A 2IDOA 4IDKA 2WRMA 4CJUA 3VQDA 1NK7A 4CECA 1TQLA 4Q45A 3G6XA 2BGGA 1BQMB 3GYNA 1DTTA 5J1EA 3PZPA 3ULDA 4ID5B 3HVTA 4ZVGA 3BSOA 4Q5VA 2YKMA 3THVA 1NJXA 2VA2A 3BJYA 4MKBA 3N6NA 1C2PA 1RA7A 3OS1A 3S9HA 4B9SA 5J2QA 1NHVA 5J2MA 3AO4A 3H2LA 2ALZA 4FJJA 4CJTA 1ASVA 2DY4A 4I7FA 3NL0A 1S4FA 4I2QA 4CEOA 4FM2A 3BGRB 1RT4A 2FLPA 3PJXA 2HHXA 4LQ3A 4CF1A 1XR7A 4PWDA 3KD5E 5D3GB 1ZBFA 3ISND 5HRRA 1RBSA 3OYJA 3SYZA 1IKXA 3V1OA 2YNHA 3V6KA 1S9FA 4MH8A 4KHMA 1WLJA 3MAQA 3O4NA 3KLHB 3C6TB 1RT2A 1NJWA 3C94A 4NCBA 4J9NA 2G8VA 2E9RX 3DLKA 2KZZA 3IRXA 1L5UA 2V0NA 1S1WB 2PYLA 1LAWA 1LWEA 5KG0A 3NE6A 1WSFA 4AHCA 2JEGA 2ASJA 3WNEA 4FJ5A 1RT7B 3KLHA 4K4YA 2ITGA 1RT1A 2VG6A 3AVIA 1MMLA 4K8XA 3OL8A 4RW8A 5HRNA 1XC9A 4IR9A 2OPPA 3OYHA 4YR3A 4IG3B 4ZP7A 5JUMA 1T03B 1JLAB 3CFPA 4G1QB 3L2VA 5EU7A 3RAXA 4M95A 2EHGA 1JLFA 1ZYQA 5KFRA 2DTUA 4E3SA 3UQSA 2JEIA 1TVRA 1C6VA 1RBUA 4WFXA 3AVMA 3OYDA 3Q8PB 4FZYA 1JLQB 3OSNA 2HNDA 3NHGA 3OJSA 4RW9A 4KFBB 4FBTA 1L3SA 2BQRA 4ED0A 4IRDA 4FW1A 4ED7A 1HRHA 4ZPBA 4DU1A 1RT5B 4H4MA 3RB0A 4N47A 5FRMA 1SL0A 3LWMA 2WHOA 4CIEA 4Z0UA 3QGHA 1TVRB 1QE1B 3DOLA 4OPJA 5DQIA 3M8PA 2IMWP 2EC0A 3H98A 4CHNA 1IH7A 4QWEA 4DL7A 4CJ5A 3AV9A 4J9LA 1BI4A 1S1UB 4R8UB 2FJVA 4KHUA 4DG1B 4DF8A 3HVWA 1BI4B 2E9TA 4WFYA 4HUEA 3RMAA 1XR5A 4RNMA 2XC9A 3SCXA 3ZT2A 3PY8A 2HMIB 2X6SA 4LH4A 1S0MA 2IOCA 4LSNB 1LWFB 4NLTA 3KOAA 5L1JA 1TKZB 4MIBA 3KK3B 4CHYA 1S0NA 3JSMA 4RW9B 2R8HA 2E6LA 2HNZB 4W5NA 2QK9A 3V6JA 4B9VA 3OYEA 3CYMA 1NK4A 4J9PA 2FVQA 2I1RA 1EKEA 2O4IA 4W5TA 1IKWA 5F8IA 2F96A 1N5YB 1S9GA 1NNDA 1RT6A 1SL2A 5L9XA 4IG0A 2DFHA 3HL8A 5KRTA 1L3VA 1KLMB 2WONA 2C2EA 1FKPB 2GV9A 1LV5A 1I3AA 4DFMA 1L3UA 3ZSQA 4CGHA 4FS1A 3M9OB 4N76A 2J6TA 5KG2A 3AO3A 3AA2A 3SNNA 4NRUA 3PR5B 4J9RA 4QWAA 3KLEA 2ZE2B 4FZZA 4TN2A 2HB5A 2J6SA 4K4WA 4F3TA 3F9KA 2AQ4A 1TKTB 3AO1A 4N41A 4IRKA 4DSFA 3VQPA 4QAGA 3CJ5A 4JS4A 3MECA 4EYIB 2YKMB 1ZETA 3SV4A 4FJHA 1ITGA 4H8KA 3ISNC 2GBZA 4Y2CA 1ZBIA 3V9SA 4JRPA 3KLGA 4RNFA 4FJMA 3MECB 4B8CA 2R7YA 3CM6A 1DLOB 2ZD1B 4RW6A 3CFOA 4LD0A 3PW4A 1TKTA 2RKIB 3I0RB 4MFBB 4DWIA 3H5XA 1BGXT 2ZE2A 5KG6A 2YNHB 1ZTWA 1C1BA 3OYAA 5L1IA 2PY5A 3K58A 1SV5B 4LSLA 1TL1A 2ATLA 4CGDA 5C5JA 1VRUA 3K5NA 1YTAA 2FVRA 3HVRA 3E01B 3MXMA 1KLMA 2WONB 4CESA 4O3OA 3SUNA 2BDPA 3U3YA 1RDRA 5KG4A 2Z1IA 4M3TA 1RT1B 3PJWA 4NLGA 3BQ2A 1JX4A 1T05B 4DFKA 3RR7A 4F8RA 2Z1HA 2EX3A 1BHLA 2XCAA 4Q44A 5KFVA 1SUQA 1VK0A 1D9DA 3IRXB 5DQGA 2F8TA 1XHZA 3JSMB 4URQU 4M3RA 4YMEA 1I39A 5K14B 3OYMA 4EZ6A 4EEYA 5T7BA 3K57A 3EZ5A 3ZSXA 2IAJB 1UA1A 1TGOA 4YR0A 5KT7A 3KHHA 4H4OB 1N56A 1WNSA 3MEGA 4O44B 3M8QA 3O3GA 4FYDA 3KJVA 3PO4A 2P5OA 4URSA 3ZT1A 3NAIA 3V6DA 4J9QA 3DRSB 4O3PA 2CKWA 2Y1IA 3QINA 1Q9XA 5J2PA 3V81B 3SQ0A 1TKXA 3QEWA 3KLFB 3G6VA 1N6QA 4KE5A 5KI6A 3LWLA 2HNYA 2XGQA 1BCOA 4HCBA 4XPCA 4WFZA 5KFSA 2UUTA 3RB4A 2KQ2A 3IG1B 3GIMA 4N5SA 3JYTB 4XO0A 1T94A 4RZRA 3PW7A 3TWHA 4KBIA 1KSPA 1X1PA 4ED2A 1U49A 4CEEA 3CWJA 2IBKA 1BISA 4KFBA 5DLGA 3FQLA 4PUOA 4FK2A 4ZVEA 4CFCA 2XRIA 1KFSA 4CK2A 4KTWA 4IKAA 3QLHA 5J2NA 3V6HA 3H08A 4M3UA 1MU2B 4WXOA 3QZ8A 4CJ3A 3LANA 4CF0A 4RW7A 3C6UA 1EXQA 3ZSOA 4DLEA 1RTJB 4FW2A 3PW0A 1D1UA 3DRSA 3SQ1A 3DDKA 5DQHA 3T5KA 3ZSVA 4E1NA 2FJXA 5KFUA 1CZ9A 3AVBA 1QTMA 2AGOA 4O3NA 3V9XA 4CJRA 3U3GA 2DPIA 3NF8A 4JV2A 4E19A 3N6LA 2D3UA 3QIPA 3RB3A 2BRLA 2RDJA 3SV3A 2BANA 5I3UB 3OYGA 4O5BA 4C8KA 5F8GA 4WE1B 1S9EB 4CJFA 4BE1A 3SJJA 4ZPDA 2GUIA 4K4XA 5L1LA 3PO5A 3G86A 2LSNA 3OSPA 2ILZA 1KVBA 1HYZA 3RBDA 4EBDA 3DI6A 4O4GA 2FVCA 4M3XA 4KV8A 2W9CA 2HHTA 3M8SA 2YNGB 3CDEA 4DTNA 1T05A 1RYSA 1KHWA 4Z4EA 5C25B 4R0EA 4EZ9A 4AH9A 3DYAB 1C1CA 4OL8A 3NF7A 4EO6A 1S1VA 4FCYA 1CSJA 2ZKUA 3T19A 4M45A 4EP4A 1VRUB 1T03A 4IG3A 3LP1A 3QEXA 4WZQA 2CJQA 4RW8B 5EWEA 1RT4B 4CHZA 3TAMA 3CVKA 4KAIA 3QZ7A 3I0RA 1WSJA 5EWGA 3DLGB 2R2UA 2IM0A 3MR2A 3IN5A 3NMAA 4RNNA 3RTVA 3CJ3A 5HRPA 1RBVA 4DL5A 1EETB 3HVAA 4CEQA 3LPUA 4F4ZA 3KK2B 5JS1A 5KT3A 1QS4A 4MK8A 1S1XA 4DL3A 2HAIA 4J2AA 1S9EA 5FROA 3HYFA 2YHBA 2X6NA 4DSKA 4DFJA 3QO9A 5I42B 1J5OA 1QAJA 2J6UA 1S97A 4OVLA 3K5OA 1KRPA 2OPQA 1W9HA 4NCGA 3SUPA 1RA6A 1KLNA 2JEFA 1TL1B 4QW8A 4CJWA 1S1VB 5DK5A 3QEPA 4F4WA 4I2QB 1HJRA 2IM3A 4J2EA 2P1JA 3OYIA 5J2MB 4TLRA 4RU9A 4ECVA 4FVMA 3I5BA 3LAKA 5KFMA 3ZT4A 4GC7A 5KFAA 4ZTJA 1LW0A 2BQ3A 1VSHA 4DFPA 1JL1A 3MFHA 3SQ2A 4QW9A 1LWCA 1BQNB 4F3OA 4AHTA 2F8EX 3G10A 1SKWA 3SI8A 5DGBA 4NLPA 2W8KA 4KHWA 2ETJA 1N6QB 1IKVB 3LP1B 3OY9A 1JLCA 1S6PB 4DLGA 3QEIA 1HARA 3VQEA 2YKNB 3CJ0A 2OH2A 3MXJA 5KFWA 3PX0A
chains in the Genus database with same CATH superfamily
2B5JB 2P9IA 3KJVB 1LEOA 1RHJB 5D4NA 3HO1A 2Q31A 4RW7B 4BRMA 4QPXA 3BN4A 3O9UA 5L8RC 5LL6Z 3ZFVA 2LKZA 4GKJF 4CLYA 4JI0F 2VBZA 4DTOA 1RAAB 2L3MA 1OSCA 2MQOA 4RCHA 5HVHA 4EGLA 2UUBF 2V4RA 2MKKA 3RWUA 4EMDA 5HL7L 4WXWA 3AOCA 3KLIB 3O9TA 2P5GA 1NHKL 2YNIB 2VU5A 4ATNA 1DJ0A 4X4NA 2W4CA 1QZ5A 3LQVA 1KOOA 1QSYA 1I94K 1S12A 3QERA 3PTWA 2Q3PA 4X65F 3VEWA 3QMQA 3MR5A 2HWIA 4RUCA 5CD4H 3UW1A 1CJTB 4GKKF 1LAVA 3W9HA 3IM9A 4Z4HA 1DQ9A 3FSIA 2DNLA 4ED5A 1FDDA 2IJFA 4WQ4A 3MM6B 1WSIA 5A8RB 2BQUA 4I9QA 4UUXA 1GT8A 3K2YA 4W5QA 1S6QB 4C8LA 4JI1J 4Y65A 4ZIWA 3QLHB 2G8UA 3Q8SB 1IM6A 2GNKA 1I94F 1EQ0A 1BA0A 2VASA 1AUDA 3A4TA 3BPSP 2W2PP 1HQEA 2HBJA 4FJLA 4CNYA 3NCIA 1M1KT 2W2OP 3KFWX 5DG9A 4YOEA 4IZ9A 4OYZA 5D4LA 1CXQA 4OYAA 3KHGA 3R6MA 4PA1A 1B9FA 2KTQA 4U6PA 3BB5A 4ICLB 1O5JA 1X5SA 3M32A 4JI8J 2V8DA 3QPIA 2FXUA 4HVZA 4YDDB 2UU9F 5EXWA 3CSKA 4DUYJ 4MK9A 4B8AB 4TY8B 4XAKA 1BC6A 1XR6A 2FZGB 3I5AA 2CADA 3ENVA 4B9TA 1TUWA 3UCZP 4HHTA 2CRLA 1DLOA 3J7YU 3MM5B 1XNRF 4FLZA 1KVAA 1DTTB 2HSEB 3OR2A 3Q22A 3VETA 3FNNA 5F8NA 3OS0A 4RBTA 2VDHA 2DCUB 4QOTA 2XGPA 4LF6F 1DKGD 2HURA 3RBZA 3M7VA 3A0IX 1FNOA 3P4IA 3KHLA 2LQ9A 4MLEA 1V3RA 1F1BB 3ZZUA 2KZMA 2DGUA 2YKOA 1V5VA 3NGKA 2MZ1A 2VQFK 5IWAF 1ZM4A 3PIPL 2K1RB 2VQEJ 4M3WA 2QZ8A 2AF6A 1DRZA 3ZYYX 1NOZA 3TSUA 1S76D 4P7TA 2HHPA 4NXMF 3NDKA 3MUMP 4TSXA 4IQXA 1SC6A 3O1BA 2YPYA 4JI6J 1YJVA 4NXNK 1KP6A 1S79A 5I3PA 1S5JA 1FJGJ 2QTDA 3IAM9 4DUZF 2O66A 4C9DA 3V1RA 5I3UA 2DIVA 1TUYA 1AW0A 4ZTFA 1GLDG 3ZT3A 4B3OB 4JYAF 3CJKB 1V5IB 1DQAA 1GMUA 4ZLPA 4AM6A 3DRPA 1PJ7A 3CD6S 2KHDA 2W1BA 5F1XA 2X1FA 4NLSA 4IO9L 4DCJB 3CI5A 1RBAA 3Q86A 1XNQK 3DN9A 5F8HA 1S1UA 1ATNA 1U25A 1RZMA 3H6EA 4E7JA 2BZ2A 9RUBA 5JVHL 1Q86T 1H3DA 2H4YB 1UA0A 1RAJA 5KFDA 1R7IA 1TUGB 3BM7A 4HT7A 2B4VA 3SZ2A 4AM7A 4WWSA 3K59A 5IS2A 1EWQA 4LF8J 1S5ZA 3FZLA 1OY9A 3WIVA 2CIMA 4H4KA 3RG6A 2YX6A 4B9LA 3I4PA 4TNOA 2DXFA 3V5RA 2OI2A 1K8KB 1D0EA 3H46O 1RBLA 2P9GA 3OFHA 3BF3A 4JRQA 4JI5K 3ZTSA 4I56A 4CGGA 3L7UA 5LT5A 1N4LA 1E4FT 3DLHA 3MPDA 1YBTA 5D78A 3KKSA 3DRRA 2RHKA 2BE2B 4CW7B 3UDLA 4DTMA 1OIAA 1VQYA 4OPHA 2ZEJA 2OPPB 1SV5A 3B6PA 3V1QA 1H2UX 2KHCA 1WC4A 2JH3A 3HHKA 2DFEA 4C11A 5HLFA 4CERA 3BDEA 3MXHP 1HBUA 3EKSA 1WC6A 3MMCB 2AYMA 2VKRA 3PV8A 3P4UB 3KNAA 2RF2B 5KPRA 3IR6B 2RB7A 5KFLA 5LJWA 4K7QA 1Y97A 3BYPA 2RPIA 2A6OA 2HGLA 3JQJA 1X4GA 3OS2A 1R0CB 3P5TL 2UXBJ 1GX6A 4I6YA 4ICLA 4FF2A 1C1CB 3ISZA 2NZ4A 3NCPA 2QWMA 2QV6A 3W3DA 1CLFA 5C2GA 5E41A 4FJ9A 1HQUA 4EAHD 3GIRA 2QWQA 1LWEB 4U9RA 3QESA 2NSCA 3UKRA 1HNWJ 3KHYA 2QLJB 3M6XA 3H4BA 3KWIA 2XULA 4CF8A 2BKPA 5LSRA 4I68A 4DQSA 2G8IA 5HROB 3TI0A 3OYFA 1EIYB 3NFAA 3VQQA 1K73O 4E0DA 2UYTA 2Q79A 3KLEB 4KO0B 5KFXA 1TL4A 3GV8B 4WFBL 3HZGA 4BRPA 2WTFA 5F41A 3HFVA 2FBYA 2VC1A 1VK3A 5M1PA 2OJ3A 3H1QA 2Q66A 4QS8A 4E7LA 2GELA 1RXOB 2GV1A 3MM7B 3ZTPA 2C28A 2N3OA 1YJRA 3H3NO 4NA2A 2VOPA 2F4VF 1LW2A 1TL5A 4PAAA 3OXGA 2W7PA 1RT5A 1UAXA 3KLIA 2J7UA 3MWTA 3MEEB 1RQ0A 5ADZA 2HZCA 3G0ZA 3VQCA 3BSAA 1U6FA 2VG5A 2ZZTA 4W5OA 3RBEA 2ZDOA 3RB6A 3TQ1A 4ZA1A 4K25A 1K1QA 1JLBB 1U0HA 1FKOA 4B3MJ 5GMKa 4QOZB 3TEGA 2DXEA 3C19A 1UVLA 3IDHA 4ED1A 1N52B 5KFIA 2HHQA 2C2DA 4CGIA 3DOKA 4CGJA 2NRVA 4ES2A 4PABA 2C42A 3D6HB 3WX4A 4LF7K 5M1OA 4M42A 3W3SA 5HMXA 4C1NI 1RISA 5H1SV 4CJPA 2HFZA 2XI2A 3A13A 2YTCA 3FJ2A 1C0UB 3NGSA 4KGXB 4KHSA 5SUHA 3D2EA 1Y10A 3W61A 3LAMA 1HI1A 3TO8A 3S8SA 1A5VA 4FLWA 4NLWA 4MIAA 1QQNA 1N0UA 1WNEA 3SBTA 2KYXA 1BL3A 3TAQA 1TZ0A 4YORA 2R4FA 5KFFA 1I6JA 2W2NP 2IVYA 2HFUA 3DLRA 3ENWA 3EM1A 3ITHB 2QWLA 1S7HA 1I94J 2O8DB 3RAQA 1Y5IB 2B56A 2R8JA 1BWVA 1HHQA 3CJ8A 4K4SA 2JHEA 4B3SJ 1LW0B 3GV7B 4KGVB 3D45A 1XNQJ 2XMKA 3S01A 3BGLA 2O8FB 1RKJA 4PWWA 1VJWA 1J9AA 4RW4B 2PMZD 4ECWA 2CQ3A 3VMFB 2XO7A 5B8HA 5F8LA 3VAFA 2RE2A 3E9PA 4JKEA 1T9YA 3DDNA 2CJYB 2E5LJ 2VONA 3DRYA 2XS5A 2F4FA 5B0DA 2OPSA 5ETQA 5HAOA 3BYRA 2CDRB 5HO4A 4ZCLA 4X4PA 3I32A 2RS8A 1U2VA 1HD1A 2W25A 3GCWP 5B08A 2GVZA 1ZBHA 1Z1ZA 3UD5A 4HLBA 5AQWA 2AJ1A 5GAHI 3QO9B 4F50A 2B43A 1FW6A 3FVYA 1AZSB 4FZXC 1E6YB 4FF4A 5HP1B 4E1JA 4RW4A 2JLGA 3F9MA 1VQ8N 4KHRA 2HQCA 4DXLA 1X31C 3ZSZA 2Z1GA 3AB2B 5B0BA 3VQ5A 5KPTA 3GFXA 1FO1A 5M1FA 4Q0BB 3CJ1A 2O8CA 1BY9A 3FGVA 3A3PB 3L95X 2LA6A 4F2RA 2RD5C 3VENA 3NRBA 2CDQA 2CJKA 2KFZA 1HR0K 2CG4A 5CA5A 4C8OA 2EFVA 4ZVUB 3CG7A 1X4BA 2R7VA 3QBCA 5IV3A 4USUA 4DPOA 4HH0A 4LF4K 5DDPC 3D0PA 2HS0A 1Y4ZB 4YDXA 2CUYA 3EMTA 3IAS9 4BQZA 4AILC 3CIPA 3OQ2A 5BJRA 4PXCA 1VBYA 2P2CB 3UO0A 3KK3A 2MEWA 4FLUA 3RRHA 4X65J 4CJSA 3V4IA 4D3GA 4LSNA 1E6VA 1CVJA 2JC0A 1H2VZ 2J9EA 1XI1A 4C6AA 4LRAA 2I5JB 4KB1A 5KFTA 2PFDA 1NZ8A 3UKUA 2G13A 4DR7F 1S72S 4OGCA 3ZSRA 4JV5F 1OH6A 4A8YA 2MKSA 1VRQC 2XMAA 1UZDA 1QQMA 2CNOB 3H5UA 3SUQA 5F0UA 5GAEP 4ED4A 4HUGA 4GKJJ 4DZ6A 1GAOA 4DR6J 3L3CA 1KVJA 3LDOA 3CXCR 4Q0BA 1QE1A 1S77D 1YVNA 1FWLA 3SXLA 3MHYA 4NA1A 4HACA 3VV2B 4ELUA 3E51A 1YUWA 4HEA9 3D3BJ 2BW7A 3G6YA 2HNDB 4NZ0A 3G71N 5CZ1A 3WXKA 2A41A 4DF4A 4DQIA 3RJMB 1HQUB 1VC0A 3CD5A 4WYLA 1NM2A 1YRUA 2F7VA 3I55N 2EW9A 4BS2A 3HSTB 4I9LA 2KFNA 1B4SA 1FWPA 4KHQA 2G8KA 4DTRA 2HVEA 2QL7B 1AFJA 4CLKA 2QKKA 2RHQB 1UEKA 4Y1DA 1N48A 2OPQB 5A0YA 4QQBA 5LY3A 2AYEA 2BH1A 3D5MA 1RWVB 1D8ZA 3CMEN 3CQ8A 3FR0A 2IJNA 2E2PA 3MAAB 3IKMA 5KFKA 1RU2A 1RWPB 1JWWA 3CMQA 3EICA 4ES1A 3C16B 2AX1A 1WI8A 3OHAA 2C2RA 3BV8A 5CD4A 1MWKA 2V8GA 2VD3A 3F0NA 2ROPA 4ECSA 3C6AA 2MB0B 1S48A 3ZTQA 3H90A 2BJ9A 1UKUA 1N5QA 2M8DB 2X1GA 1OH8A 3NS7B 3SFUA 2AA4A 3OYBA 2E5JA 2VGMA 4U67L 2BOAA 3M1VA 1DAXA 3HOTA 1FDBA 3NH2A 4FLVA 2KI2A 4I7FB 1HIYA 4ANEA 4CIOA 3IAYA 2KFYA 1B0TA 2E8AA 1YWXA 2WUSA 5C24B 3MCAB 3KJQB 5AFUA 2BM0A 3X3UA 2DYAA 3IGNA 2V4JB 5CYQB 4K0KJ 3PX4A 5BPMA 4FWLA 2BJ3A 1YIJS 5KFJA 4CEBA 1UW4A 3J80U 4JD2B 1UZHA 1NCLA 2KXFA 5CAAA 4IDKB 4CIFA 2O1PA 1WSEA 3EPIA 2HK3A 2PFFB 3GIKA 3TAFA 6AT1B 2FZKB 4C0HA 2N82B 4DX7A 4ILRA 3G71S 2NREA 1MA9B 1FK9A 2YQ1A 1Z25A 3MGJA 1FESA 1EQYA 5C12A 4IOAL 1BU6O 1NDKA 4O23A 1YAGA 3ZZRA 2DO4A 1Q1KA 2GCFA 1U1QA 3ASMA 1WBDA 4CJ4A 3CCSN 2LQ8A 1HA1A 2VG5B 2MQNA 5KQ8A 2IVMA 3TQEA 5K8MA 3C2PA 3QWUA 2AX0A 1LXJA 3UR0A 2F8SA 1FT8A 1TKZA 4H4KC 3ICLA 2D69A 3M2VB 3U9ZA 3UKRB 3NBPB 1IJEB 1JLEB 2B4JA 1VQLS 3ILJA 1NGIA 1SJ1A 2IPOB 4P7VA 2MZQA 2YX1A 2KG1A 2OZSA 2MLZA 4CP5A 1VS3A 4Z7CA 2CPXA 3FGUA 3FDSA 1ZOTA 4DTXA 5AR0A 1A0OB 3KG4A 5KG5A 2CGKA 1YGYA 4GVBA 4MLHA 4G1QA 4JI6F 4KTQA 5AQVA 5HMYA 5DG8A 1BIUA 5EY4A 2YKAA 2B0GA 4HI1A 1FKOB 1RNHA 4GMKA 2EBGA 1TK0A 4GV3A 1HW8A 2D3O1 2IVPA 3JTOA 2IDOA 1YJNN 2I0XA 1NUEA 3QFUA 3LDLA 5F0WA 3L7OA 1GTEA 4ETXA 4LIRA 2OEJA 1WC5A 1QAYA 1DTTA 3PZPA 2XQCA 2W7AA 1Z2LA 3TX8A 2VA2A 5BPLA 1C2PA 2CA9A 1RA7A 3T7ZA 3OS1A 2PBDA 2BMBA 4B9SA 5BRDA 3AO4A 5LXYA 4FJJA 2FLPA 3UVJA 1H38A 3HD2A 1XR7A 4PWDA 5D3GB 3WXJA 1VQ6S 5DM7L 3TUPA 4DV5J 1B3TA 3OYJA 3SYZA 3M32B 3NMUA 4A8SA 3HT0A 4KY3A 3V6KA 1HWIA 2YY3A 5LMNK 5IV4A 4MH8A 2YWFA 3MAQA 1XNQF 3KLHB 1Q16B 2DNPA 1NJWA 1NU0A 1U8WA 3UD4P 2QL9B 1F0XA 1OPIA 3CMAS 1KVIA 1EHWA 1UVIA 1X5PA 1QUPA 3MMCA 1S1WB 1LAWA 1LWEA 5KG0A 1K73T 4ILJA 3NE6A 2M8HA 5MAOA 4AHCA 1DURA 2ASJA 1DGKN 2V63A 3HI9A 4YS2A 2UUBK 4K4YA 3EKUA 5AXLA 4K41A 4K8XA 3TA1A 3PEJA 2R7TA 5K8NA 5HRNA 5E5NA 2WSCC 4NLBA 4LRCA 4WFNQ 3OYHA 2H51B 1PYSB 4IG3B 1T03B 1P27B 2V2VA 1BOTO 1R59O 1GMVA 3TUIC 3CFPA 4G1QB 3QNWB 1R3NA 2MQPA 4CTAA 2EHGA 1ZYQA 1WHWA 5BN8A 2M88A 1ZBSA 1YHQN 3FZMA 3KYLA 4LFAJ 4CLLA 1VLYA 2R7WA 4DR2F 3LGHA 2JEIA 4K5SA 5GADU 2W41A 3CJKA 3OYDA 3CCRN 4FZYA 4UY8O 2VQEF 3D0HE 3DU5A 2ACMA 1X5TA 3DAWA 4RW9A 3VGUA 4Q7AA 1FRIA 5K8OA 4FWRA 1WSRA 2F8HA 4DHVA 4DU1A 4N47A 3BO3A 4EHTA 4KH4A 4Z0UA 3LH2S 1O13A 3M8PA 3D1QA 3MN5A 4KH0B 1IH7A 2L9WA 3P45B 3AV9A 3DCAA 4MDAA 4NA3A 1BI4A 3MWPA 4R8UB 4DG1B 4PG6A 2K1RA 3UE2A 4DF8A 2VUGA 4BR9A 1XMOJ 2E9TA 3W5ZA 1HLUA 4BRKA 1FVQA 2QWPA 2XC9A 3HFKA 2H4WB 4KH1B 4C8ZA 3PY8A 5ETRA 4G65A 5FJ4A 2Y1RI 4NI2A 1I51B 3TPQA 4A57A 1IBCB 1ZA1B 5LMUF 3KOAA 4MIBA 3CW2C 4CHYA 5HOOA 3PSIA 1S0NA 1N54B 4W5NA 4YHHF 4OLOA 1NB7A 3V6JA 4B3MF 2ZM6J 2YWWA 4KHPJ 4CWBA 1XNRK 2CQBA 2FPHX 2CNKB 2UV8G 3CJTA 1UCNA 5A2QY 5KRTA 4JI0K 5K8PA 3HBTA 1FKPB 2C2MB 4OI2A 3ZSQA 1X5OA 2J6TA 5HATA 5KG2A 4GO5X 1YG0A 3OTOK 2E1ZA 2VF3A 3AA2A 4J9RA 4EIAA 2KO1A 1YDLA 4NWBA 3WUHA 4K4WA 4DR4J 2HIQA 3ENQA 4ZN3A 1YF5L 4OHYA 3M6GA 5GIOA 4QAGA 4UW2A 4JS4A 1YZ6A 4CO4A 1C4AA 1ITGA 2E5LF 2KN4A 1HNXK 2V67A 3EVWA 3V9SA 3C16A 4OPAA 3CPEA 4FJMA 2J0XA 1LKZA 3D1OA 3CM6A 4RW6A 4RJVA 3EE9A 2Z30B 4LD0A 3PW4A 4DR1F 2X1AA 5EX5A 3VAJA 2FD2A 4MFBB 1BGXT 2P9UA 2VFTA 2C2NA 2IY5B 4FWQA 4CGDA 2GVDB 1VQ9S 3E01B 2OHDA 3PKMA 4YOWA 5IT4A 2BBEA 3MXMA 3UVJB 1KLMA 3L4BC 4CESA 2BX6A 3SUNA 2GQCA 3U3YA 4ANDA 1RDRA 1LK5A 1H74A 4QYRA 3SAGA 3E9LA 4I64A 1JX4A 2W2QP 1T05B 2B7CB 2W2MP 3RR7A 2GO8A 2WVBA 2XCAA 1H1VA 2YHXA 3ZX3A 1XHZA 3JSMB 3I8BA 3OYMA 4ZOSA 4X84A 4EEYA 3C8YA 2YHYA 3EZ5A 2VGNA 4PG7A 3J7AP 2KT2A 4PG4A 2WVFA 3H3OB 3E1YA 2DRBA 3NVMA 2R7SA 1N56A 1WNSA 5G0RB 1FCAA 1B0PA 2UUAF 4BRNA 1YHQS 3PO4A 3GFHA 2CQHA 4L3NA 2OMOA 3CMAN 4GVBB 3V6DA 4BR0A 3R5AA 2Y1IA 1Q9XA 2EVZA 3CHWA 3QEWA 3KLFB 3G6VA 4KE5A 3IM8A 5KI6A 4DV2J 1RE1B 4DUZK 4XPCA 1PYTA 4IWVA 1UMJA 1M5HA 3WEEB 2L08A 2KQ2A 3RB4A 2IDLA 3GIMA 4YOVA 1T94A 3N9UC 2CGJA 2E66A 3D7EO 1KSPA 1X1PA 3MCOA 2IBKA 1BISA 4KFBA 4JKCA 4ZCMA 3QAEA 3E66A 4I6MA 4X66K 4CFCA 1OH5A 4KTWA 4IKAA 1MDUB 5J2NA 3V2UC 4JN4A 3QZ8A 2QM1A 3EGWB 2JRSA 1OQ6A 1RTJB 2EFOA 5IZHA 2GGPB 3LF0A 4BCAA 4DR6F 3PACA 4FW2A 4TLQA 5FPEA 5DQHA 4A62A 3T5KA 3PIOL 1XEZA 4UQTA 2X51A 1ZC6A 3MDFA 4O3NA 3OTEA 3UKUB 1Q18A 3D0IE 3K7RA 3CJBA 3U3GA 2BTFA 3R8YA 4JV2A 3EGVA 4E19A 2WBRA 3AQPA 4JI2J 1SQKA 3RB3A 3VTIA 1XERA 2BRLA 5AXKA 4BHQA 3SV3A 1RU1A 3DXMB 4BE1A 2J76E 4ZPDA 2GUIA 1RHRB 4DMZA 5L1LA 3CQXA 4OX9K 3PO5A 1FA0A 2CAJA 2LSNA 4DN9A 2ILZA 5D0EA 3RBDA 3ETOA 4O4GA 4KV8A 5GIPA 2HHTA 3M8SA 1NG9A 2YNGB 1CJKA 3VGMA 1KHWA 3DGPB 4R0EA 4AH9A 3DYAB 2G0CA 3NF7A 4OZ5A 2CPYA 3QFHA 3P3DA 4TU9A 4EP4A 3R9LA 3TUJC 1KVKA 2Q0UA 3PM9A 2M3DA 1KQSM 1CZAN 3CVKA 3RUBL 4M5DB 1MN7A 2CH6A 2IM0A 4CZCA 2F40A 4JI3F 1FJ7A 3RTVA 3CJ3A 4QR0A 1RB0A 3IA0A 2EG1A 4A61A 1VQLN 3MCSA 4P2XA 2EFQA 3LPUA 1UFKA 5JS1A 5KT3A 2ERRA 2BJ7A 3F2KA 1X0PA 4DL3A 5LJ3Y 3A5NC 3I9V9 4FPBA 3UCGA 4MT1A 2YHBA 1VDHA 3QO9A 1QAJA 3NOCA 3CJAA 4OVLA 3K5OA 2OPQA 4OJ1A 1VQNN 3SUPA 3DWLA 1RA6A 1RGVA 1KLNA 4ERDA 3HSZA 2O8BA 4QW8A 2ABYA 5DK5A 3QEPA 4F4WA 4I2QB 2IM3A 3DGPA 5GMDA 5AQMA 4QBUA 2P1JA 2OSRA 5J2MB 4TLRA 3GSDA 1URNA 2VFRA 3N79A 1ZPVA 1AB8A 2D0PA 4B3RF 4EWTA 4IEIA 3G6EN 1XUPO 3D6TB 5KFAA 4ZTJA 1LW0A 2BQ3A 1SQEA 1UVKA 3KDNA 3MFHA 4QW9A 1LWCA 4JI4J 4F3OA 1UEUA 4AHTA 2FHJD 4YY3F 3R1XA 3G10A 3DNCA 2J9CA 4NLPA 4E98A 2A18A 1RTZA 2U1AA 1VQ9N 1IKVB 3SQGA 5DETA 3J8AA 2Z0GA 2F4VK 1JLCA 4FOEA 3ENBA 3B78A 3E2EA 1VQ5N 1KKHA 4NXNJ 3MXJA 3PX0A 2QW9A 2EXUA 1GXUA 3CMES 1KHVA 1J6ZA 1X9MA 2OGUA 4JAXA 4M63C 2XI3A 4O4GB 3DI6B 2P8IA 1GLBG 3HF5A 1QD1A 4H03B 4NYFA 3BR8A 4KAZA 3J81j 3K0SA 3BO2A 3VF6A 1HL6A 1QSLA 3MEEA 2CPZA 1Q79A 3D2EB 1RKIA 3SIPB 4C8YA 1S1TB 3ZTOA 3GILA 2DT9A 4RWWA 5E3RA 1UPMB 4J9KA 2HQ3A 4ED6A 4DV7K 2VC0A 3BN7A 3RW6A 1WOOA 3CCVS 2J0WA 2MJNA 2KLAA 3GCXP 1XHXA 3JTNA 3HJFA 4YNQA 1ESVA 2RRAA 2QWRA 3M1FA 1M0SA 3ALYA 1NKEA 3VA0A 4JS5A 3KD1E 2VV5A 2HFOA 1XN9A 3P83D 2QI2A 4PXDA 3R1LA 2IIRA 4FBUA 4WFAL 1TAQA 2ZNYA 3TZXA 3R7SB 2RKIA 2WC9A 5DZ6A 2XSJA 2HBYB 3VQ8A 2E6MA 3N4WA 4PL8A 2FLOA 1GEHA 3MCMA 3W65A 2QO3A 4NMLA 4WIIA 1UP1A 1UWBA 5C42B 1PYOB 1S49A 2UZAA 1IBMK 4NYOA 5ETNA 4LFAF 1IQZA 1N36K 5KFPA 3J80O 5CY4A 4LF7F 2GEMA 4DUZJ 2GIQA 2J0SD 2DNZA 3BPDA 4CLWA 3LPTA 1XWLA 3TUZC 3E01A 5KFNA 2VWKA 4QR2A 2YX7A 5KGXA 2PI5A 3R3LA 2LDIA 3UFCX 1C0TA 3B54A 2DRDA 2OKQA 1N36F 2HZVA 2JWNA 2ZKTA 2XY7A 4LUBA 3TZZA 1K8AO 4AXJA 2BXJA 2VB6A 3VQAA 4DL4A 1NPKA 4F4AA 2X3DA 3GU0A 2X74A 2KT3A 1TKDA 2DCLA 3UDEA 2R7QA 2KB2A 1M5OC 3CCRS 1P9QC 3WZ0A 2UUCF 5BR8F 1GLAG 4F67A 3V9UA 4WCEQ 2IYGA 1HYSB 1G1XA 3EZOA 3HOSA 5LMUJ 3PR4A 1JL2A 1TL3B 4L3KA 3GONA 4A2AA 1BLUA 3WIUA 3L0QA 3TAEA 1KFDA 2DNGA 5CZ2A 1IBMJ 5KFBA 4BACA 2A5XA 4Y34A 2HBQB 3NVKA 1SPBP 3OLAA 4ED8A 2GGPA 5MLCV 4OKKA 3S7RA 2JGUA 4O8KA 3N01A 3PYGA 1YTUA 1WEXA 4I6MB 4TYBA 1FXLA 3VF2A 2ROGA 4F4KA 1TK8A 5FLXU 2CPFA 4UOGA 4JKBA 4CHQA 5B0GA 2XWXA 3AVNA 1UW9A 3WNHA 1X9WA 3IC1A 3EDQB 5LMUK 2AZ1A 4W4MA 2VBYA 1QM9A 2C3OA 4KIAA 2ZBRA 2LLZA 3ZCMA 4F02A 3NF9A 2MKIA 4MIWA 2W6KA 4QPTA 2QA4S 2DITA 2MZSA 5AQYA 3FFIB 3H7HB 3I87A 4R8UA 3MUTP 3HHLD 1R0AA 4L6V3 1VIOA 3HSGA 3T41A 3GWCA 3VQ9A 4KR0B 1VSFA 2H5IB 1VCTA 2XS2A 2NXJA 2EPIA 4RO0A 5LSLA 4J9MA 1IR2A 2XO6A 1KAZA 3UIQA 4FWPA 3G8QA 3VGLA 2Y8WA 2XZDB 2Q43A 1K9MO 2QGFB 1NK8A 2X3GA 4EP5A 3W2WB 4NZ6A 2WK4A 4YDUA 4A8MP 3T5LA 3MTKA 1NK0A 4KKOB 1VQ6N 2H48B 4P2FA 2FHMA 1JLGA 3TAPA 2B7BB 1RT2B 2XLIA 2A1BA 3HLUA 4CZIA 1WSHA 4MYTA 1V6HA 1JLFB 1QAIA 3O6WA 3BKTA 3T1HF 3B6BA 5AE3A 1Y9OA 3I6PA 2NLWA 3AA9A 4FLYA 1VSIA 4BE2A 1XMQJ 2XY6A 1SJRA 3D2WA 3MEGB 4KO0A 1D8YA 4I67A 2LU2A 4OHZA 5HMWA 1U6ZA 3QSYB 4CZEA 1NDCA 1W0HA 1VQ5S 2FVSA 1JNRB 1K1SA 5HROA 2ZM6F 4OZ2A 3CNQP 3PEHA 3U9DA 3TAGA 3NLCA 1XMOK 2FBVA 1HBMB 3GG4A 8ATCB 1KD1O 4C1NK 4J7CA 1RABB 2QWNA 4BRIA 3ZZOA 3V9ZA 5KQDA 4ID8A 5GAEU 3DHWC 1RTDB 5FD1A 4K4VA 4HHHA 1Q78A 1APSA 1RSCA 4B9NA 4P52A 4K4UA 4P74A 2QL5B 2XS7A 2QXLA 3H5YA 2G2ZA 3VZHA 2BYCA 3FFKB 5KG7A 5GADP 1T8EA 4EO8A 1RK8A 2H9ZA 5KT6A 3HKWA 2O8EA 2O8EB 4M1KA 2F3JA 4G3IA 4QIGA 4LFCJ 3TRGA 4PXBA 1F2GA 4YQWA 3DMJA 4U8YA 3OFFA 4OZ3A 1Q8LA 2M7SA 2OYQA 4ED3A 5AT1B 3MF5A 2V5HG 2C2ZB 2IM2A 1N32J 1PILA 3FZFA 3OR2B 2LFVA 4ZVQB 1T0TV 3MTJA 2DHAA 5M1NA 1JXVA 3K5MA 2KJWA 1HNZK 2A1SA 3R9PA 2DPJA 1ICEB 2UUAJ 1BWEA 1YSJA 5KG3A 1RAIB 4H54A 1ZXOA 5E7OB 5AZIB 2UUWA 3QAUA 2YH0A 3NOGA 5KT4A 4FLXA 5E33A 2W24A 1R0AB 3QGIA 5JVGQ 4OI0A 3LP3A 2XLJA 4B9MA 1T3NA 2D41A 2HHUA 4CF2A 3BGRA 1VQON 5AQOA 3ZTRA 4OLBA 4X4UA 2Q3SA 1F21A 1IR1A 3UN3A 1DQ8A 4QYZK 2XWYA 3AY0A 1JLGB 4B3OA 4DV6J 3CCWA 1U04A 2P9SB 4AHVA 4QIWD 4H4MB 4YB6A 2DY9A 3KTQA 1HBMA 2MZTA 4MKYA 3R7NB 2AYGA 3L3VA 4I6AA 4DU3A 3OXLA 3U7JA 3M6VA 4FPIA 2YHWA 2OTLS 5DS7A 2KHOA 2HRTA 4L73A 4OJ3A 3FE1A 3VQ4A 4ZVHA 1SC4B 4IOCL 2F9TA 2IA6A 4DSIA 2A2DA 2CQ1A 1KWMA 1XMBA 2GMJA 1SH2A 1V9OA 5D77A 1QQCA 4OYXA 1VQOS 2QA2A 4NLYA 1HNZF 3DOMB 1S6PA 4DR1J 5CE3A 1F3VA 5JMNA 3M2UB 1JB0C 4MAKA 1LXNA 4O44A 3M8PB 3HCXA 2Y8YA 2VG6B 1TL3A 4CJKA 3NG8A 2R8GA 2A6AA 4B9UA 4MKVA 1XTZA 2XY5A 3IXQA 2FHOB 3GIIA 2HHHK 3JS6A 3VPZA 3M8RA 2OO4A 1SC3B 3CCSS 5CYQA 3VF4A 1T3OA 1EKSA 1PG5B 1V4TA 3VEXA 4CCHA 4BC2A 1VQNS 1J2VA 1SIZA 3I56S 2KKHA 4IOBA 2MMYA 3SJHA 2KT5A 3QNOA 4WKYA 3I31A 4YOUA 4N56A 1U1MA 2HBMA 3DMJB 4IFYB 1VQSA 5CCMA 3A5OC 2C2OB 3WNFA 3FFIA 4CTAB 4X66J 2NXCA 4Z2XA 3QYYA 3C0BA 3ENAA 5DGAA 1ZTTA 2R42A 2NZCA 5GAGU 4HHUA 4ZIVA 1TK5A 2PA8D 4Y0FA 4OZJA 4ECTA 2FUG9 1Z6RA 3KHRA 4PQUA 4ALZA 1GNKA 5IQ6A 5C0YA 4QS7A 1Q81T 3IS9B 3NMRA 4J9SA 3VF0B 4YY3K 1HNWK 3EVOA 2VL1A 4R5PA 3NAHA 3ID6A 3OL6A 2FGCA 4O3SA 2R7XA 3NGYA 1KDNA 3SPZA 1TMMA 1TR0A 3ZXWA 4PCQA 1REGX 1NMNA 4DR3F 1FFSB 2QE5A 1K9MT 1F9FA 1S6QA 2LEBA 1ZBLA 2HPUA 3D6FB 3SQOP 5KOWA 1KCFA 2LXIA 4ELVA 3KXDA 4RU2A 1EAYC 4IQMA 2Q36A 4Y1CA 2LVWA 4NL5A 2NRZA 2HIYA 2D9PA 4GNIA 2YQ0A 3PHTA 2DHHA 1C1BB 1K44A 3QEVA 2MY8A 5GAEI 2NYHA 1TFYA 3HI0A 1S9GB 1EQMA 2ZUAA 3VTHA 1X4CA 1T9XA 1LFPA 4UZBA 5AQSA 5C42A 2OAUA 5DDOC 1W97L 5DM6L 1ZAWA 2GIRA 2N3LA 2HF4A 4CO3A 5KG1A 4XDCA 4L74A 2ZH3A 4ZJLA 3OBYA 2UU9K 1PKUA 3EO3A 1UOCA 4WU3A 5IWAJ 4B9QA 3SQ4A 4TY8A 2RIJA 2F9JA 2PD1A 2O5DA 1YXQA 2P9IB 4H5WA 1U2RA 4OZNA 3TJ8A 2FJDB 4R0JA 1NGDA 1IO2A 3EUNA 3D54A 1FK9B 1HBOB 1NSAA 4V1Ak 5JS2A 2Y3YA 4JI5J 5GMEA 2B6AA 3ILIA 2OA8A 4P10A 2W9CB 4YP3A 1BUXA 4OKJA 4ENOA 3EE8A 4P73A 2J5AA 3T5HA 2YNIA 4YFUA 3V4IB 7AT1B 2A40A 2EFNA 2CPJA 3TJAA 2JDJA 4JI2F 4DR2J 5ETKA 4XDDA 2WCXA 1FNMA 2IRXA 4DN0A 2YWGA 2BW2A 1XNRJ 4U67Q 1NDPA 2DB1A 3C65A 5D0RA 1S72N 3QATA 1SQGA 1CEZA 5BRFA 4AXIA 2LMIA 3AT1B 2GHWA 3FCVA 1GOAA 4OIXA 1DTQA 3W64A 3AA3A 2KXHA 1Q5VA 3MPYA 1IWGA 4X4QA 4O3RA 4FN5A 2OPRA 3P5JA 2IYIA 2QMUB 3P49B 4LF1A 4MJKA 4OYMA 4O0JA 2IAJA 1HNWF 4ECUA 2YHAA 2CQ2A 4IBNA 4WP9A 4DMNA 1FXXA 4ZPWR 5B0EA 2M0GB 1SUQB 4ZLNA 1R8CA 1ZS6A 2K2PA 1EETA 1S10A 1IG9A 3ADAC 1QUVA 4NE9C 3N6MA 3AODA 2RQCA 3AAPA 2V8HA 2HFSA 3K9KA 5C2DA 3FKBA 1ASWA 3GMGA 2V4QA 3BP8A 1FRLA 3VQSA 1QLNA 1DZ5A 2OEKA 4JI1F 4L3QA 1ASUA 1A5WA 5JJBA 2DGQA 1J54A 4LF5J 5ETPA 4H0PA 3SCLE 3PUFA 2OPSB 1WSVA 3OFGA 3SFGA 2DGOA 2C3PA 2BKNA 4Z4CA 2EFGA 3M8WA 4OX6A 4JV1A 2XMWA 3QJJA 1XQIA 1BQNA 3TA2A 4DQ8A 5HI7A 5CYMA 5LMNJ 1GOBA 2JEJA 1WUUA 4DU7A 2KRBA 3LP0B 2CFXA 3D6MB 4H5RA 1OS5A 3M8YA 2F7TA 1AFIA 1C0UA 4CD3A 4LFBJ 2WBNA 2DNKA 2C3YA 2HBZB 3TAMB 1RDBA 1GLJO 3CULA 2UUBJ 2O8DA 1Z26A 2FLLA 4JKAA 3RW7A 3A8KA 1RWXB 5ETVA 2Z8QA 2DH8A 4K59A 2XZWA 3DLLL 3AXMA 2AEJA 2DXDA 3O1LA 2W40A 4BGAA 4PY5A 2QKBA 1A5XA 2ZQBA 1HLWA 2G8HA 2YCHA 2IJRA 3T3FA 3D2FA 3HKZD 4IFVA 5C2CA 4YR2A 5HBMA 2HEKA 5H1SQ 4C8MA 4USTA 3AGKA 4FJ8A 4KPYA 3QDKA 4KV8B 2MGZA 4NRTA 2NUBA 1IN0A 1UVNA 4Y00A 1M5SA 3OVAA 2HNZA 3VGTA 2FLNA 1UFLA 2WB4A 4MTPA 1SH3A 4JI8F 2QRRA 3BF4A 1A6LA 5BREA 2CJBA 3MCNA 1RBRA 3R8EA 3IG1A 1I1GA 1VRTB 2FZCB 4DPYA 1YKWA 1T02A 4JV0A 1JJCB 2AWZA 5M2PA 4LFAK 1FRJA 3M30A 1V4SA 3KLFA 3RAMA 4DZDA 4DR7K 3R5JB 3HP6A 4Z4GA 2P51A 2ZWOA 3WC0A 1L3TA 2XHCA 3HP9A 2ASLA 1JCGA 1F3FA 1REVA 1IV0A 3O3FA 3GPAA 4NCAA 4LIWA 5LL6d 2V52B 2V2QA 3FC9A 2O8CB 2GQ2A 2POKA 4JP8A 4YOTA 3SDEB 1FXDA 1S6OA 3BEGB 4Z7YA 4BRCA 2UUAK 2QXFA 5AZJB 3TOQA 5MLCQ 3W9IA 1SS6A 4OLPA 4IH5A 2MY7A 1X9JA 3EYZA 1NDLA 3CPWR 2WTUA 4EFAC 1YZ7A 3OYKA 4MDBA 2NPIA 3PG9A 3CF5L 3FCHA 1VIXA 2D5RA 3R5GA 2EKYA 2NQPA 4BG8A 1W2BR 3D68A 4ECRA 4E1MA 2B6AB 3C14B 1P8ZA 2MLXA 2C2KB 1N33K 3ID8A 2VICA 4USMA 3L2RA 3TR5A 3DOKB 3VGSA 4B1XB 1CZBA 1Q7YO 1XK8A 2RRNA 3VAMA 4TXSA 1WC3A 3NGDA 1Z05A 1RTJA 1FJGF 2ZITA 5E26A 4Q2MA 1VSEA 3CDWA 3MPVA 3TU5A 4HTLA 4X62J 2SXLA 1NWKA 5T7LA 2DNHA 1UETA 4YN3B 5DM6Q 4NEZA 5AQHA 1NK7A 4CJUA 3TZWA 1NGEA 4Q45A 1EWRA 1MWYA 4JYAK 4FWOA 2E2OA 3L09A 1KNZA 4ID5B 1BXNA 3DGVA 3WHIA 1HWJA 3CC7S 3Q89A 5J2QA 2XZTB 5J2MA 4ITSA 2HF3A 4HDGA 2K3IA 2E2NA 2ALZA 4BR5A 4CJTA 1PBAA 3D2FB 1B64A 1T11A 1F9HA 1U0SA 3QT7A 3HJVA 4EFHA 4ILMA 1N32F 1KC8T 2HWTA 3GR0A 2YNHA 4ZCKA 4W92B 2Y1LB 1WDDA 1GLEG 2HQFA 2GJIA 4JI4K 3C6TB 3BO4A 3NNHA 3H2VE 1WC1A 1RJJA 3PYFA 1WOPA 2KZZA 3IRXA 1U1LA 2PYLA 4K0KK 2CPDA 4C11B 4OX8A 4FJ5A 2DHXA 4NI2B 4M5DA 1RT1A 1EARA 3KUHA 1DT9A 2VG6A 1AA1B 2R7UA 3OL8A 1XC9A 4JI4F 2OPPA 4ZP7A 4CZJA 4IOCQ 1VHXA 3ELHA 1CULB 3L2VA 2F9DA 3RAXA 2GS8A 4NPOA 4ZCIA 1WORA 5AQFA 1MWZA 4OX9F 3UQSA 2JX2A 2ZOMA 3JSRA 5E2QA 4A5BA 1SIWB 4WFXA 2DNMA 4IJAA 3OSNA 3NHGA 1HHTP 4V19X 4OI6A 4U7UD 4ED0A 4IRDA 4FW1A 5IFMA 4ED7A 4H4MA 3RB0A 5FRMA 4UOFA 4M5IA 4DHYA 2JWLA 5IWAK 2QEXS 2WHOA 3WEEA 1CQNA 5H9EK 4DPXA 4HTIA 4QS9A 1D9AA 3DOLA 5A2QO 3MMBB 3TVZA 2GX9A 4CJ5A 1S1UB 3AAQA 2FJVA 2QIFA 3DU6A 3JS9A 3DDIA 5L9NA 2AT1B 3HVWA 3IWLA 3KJFB 2I2YA 1YIJN 2UXCK 1BI4B 2AEMA 4Q2LA 3THPA 4RNMA 1Y3JA 1KXPA 8AT1B 3ZT2A 3OUYA 3MOJB 4WJBA 3GR1A 2FGOA 4BC3A 4USHA 1WTBA 1LWFB 2EEYA 3D3CJ 5L1JA 1RWOB 4GO7X 4RW9B 2E6LA 3OR1A 2ZGZA 1N5TA 3GJTB 2JZ5A 2DH9A 1HKBA 5JMVA 2PIIA 1RCOB 4J9PA 2I1RA 1EKEA 3CCEN 3F56A 1FRMA 1YJUA 4DR4K 5F8IA 2F96A 1Y5LB 1S9GA 1NNDA 1RT6A 5L9XA 1UVJA 3WDOA 1KLMB 2C2EA 4CH0S 3BGUA 1M90T 1LV5A 4DFMA 3M9OB 4N76A 3SEOA 4BLGA 4OX9J 1RI7A 4JKFA 5A8WA 2VFUA 3SNNA 4NRUA 2ZZNA 4QWAA 3KLEA 2ZE2B 5CZXA 2HB5A 2DNYA 2J6SA 2LECA 4F3TA 1BUPA 3RRKA 3F9KA 1SCJB 3F5TA 4BY9C 3W60A 4DSFA 4RR5A 1VI7A 2IFXA 2HS3A 2B9XA 1SJFA 4LBPA 3ISNC 4RNFA 2R7YA 4B8CA 2WVEA 3O8WA 1DLOB 4CLTA 2R7OA 3NWGA 4C3LA 4CBXA 2Z4PA 4B17A 1Q82T 4CLFA 1CC8A 3I0RB 4DWIA 4OMFG 2ZE2A 1DEJA 3GG1A 3W9JA 4JEPA 2AYBA 1TL1A 3MX5A 3CCQN 2RU9A 1YTAA 2FVRA 1YX2A 3GL1A 2QX0A 1KQSR 2CQGA 4FYWB 1OJ4A 3H0PA 3U1NA 2HZAA 4CNZA 2Z1IA 4QJVA 2K06A 4F0MA 3BQ2A 3GYGA 2P5VA 1JNZB 2KXNB 4F8RA 3AQOA 1HNZJ 2Z1HA 2EX3A 1BHLA 2ZBIA 2FDNA 3BZQA 5GVQA 4ZVSB 3MM5A 2QYCA 4M3RA 5E3AA 4YMEA 3Q7CA 3A5LC 4EZ6A 4WIQA 3K57A 3CCJN 1YQHA 1FFWB 1UA1A 2XEXA 1TGOA 3VQTA 5KT7A 4CLUA 3M05A 3KHHA 1W2IA 4H4OB 3FMWA 3MEGA 4RX6A 1HFEL 3O3GA 4JI5F 3KJVA 2NXUA 3ZT1A 3TEHB 4BRLA 5AQTA 5GAHP 1BA1A 3DRSB 2FSNA 1S0VA 3CQYA 4DV6K 5J2PA 3PKYA 3VCDA 1F9EB 1P90A 2HNYA 3MMBA 2JFKA 4IYQA 3TYTA 3VAIA 4LBIA 5KFSA 3K8VA 4XO0A 1Q4RA 3PW7A 4OHVA 4KBIA 4DV5K 2GWJA 4CEEA 2F4VJ 3CWJA 1ZBTA 4FK2A 4ZVEA 1KFSA 3QLHA 3W66A 1H7XA 4WP8A 2MQQA 3V6HA 3H08A 3R6LB 3C6HA 1WBBA 4NB4A 2XMUA 2V2KA 3LANA 4DLEA 4RW7A 3ZSOA 1HW9A 4AL7A 1R0BG 3ZLJA 1RHKB 3MM9B 1D1UA 3DRSA 3SQ1A 3ZSVA 3Q23A 3M3ZA 4E1NA 2FJXA 3T9ZA 5KFUA 5AQJA 5L46A 4X62F 1Y64A 1X4HA 1YBAA 2DNQA 4FYVB 2QSFA 2LEPA 4CO1A 4CLPA 2DPIA 3UNGC 3NXZA 4A8KA 2D3UA 2E7XA 2LCWA 1ZM2A 2DTJA 2XB2D 5I3UB 4CZFA 4O5BA 4A8XA 5IOLA 1S9EB 3N4PA 4CJFA 4A8OA 4CI6A 1HNXJ 3OSPA 3GB0A 8RUCA 4EBDA 2A10A 5F2RA 3MI7X 4OFZA 3CDEA 4DTNA 3POTA 2W4DA 3B4MA 4Z4EA 3A8EA 3L9ZA 1YJ9S 3G82A 5BYSA 1S1VA 3L4IA 1CJVB 2ZKUA 3T19A 3DLJA 2E5GA 2CWKA 2V34A 1VRUB 4IG3A 2PDAA 3CCVN 3LP1A 3QEXA 2XYPB 3T6BA 2CJQA 2YXLA 3ULEA 5EWEA 3LPYA 5AQUA 1AROP 1VQMN 4KAIA 3JAMY 3I0RA 2HFNA 5EWGA 3DLGB 4FKXA 1MWQA 4JI7J 4NYPA 4J37A 4RNNA 2ZH5A 4DL5A 3EZWA 3HVAA 4J9UE 4CVNE 3GSIA 3ETMA 1E3MA 2NUHA 5KAKA 2MQLA 3ATUA 2D3OR 1QS4A 4MK8A 1S1XA 2HAIA 1F6TA 4J2AA 4UZCA 1VQPS 2GX8A 5FROA 5KPZA 3HYFA 3TZYA 2X6NA 4DSKA 2ZNZA 4NX9A 2J6UA 3UDVA 2XBPA 2MPUA 5A8RA 3GE1A 2WVDA 4K43A 1TL1B 1VQKN 2IVOA 4F36A 1URRA 1RADB 3KWGA 1I3OB 4M5MA 1TL7B 2VODA 4J2EA 3OYIA 2VFVA 5FPNA 1WF0A 2O01C 4RU9A 4ZN1A 3LAKA 1KEKA 5DRKA 3M2RB 4GC7A 3W2WA 4GY2B 3J81U 4DR5J 4DFPA 3ZNJ1 1WELA 3SQ2A 3E8OA 3UD3P 2XSJB 5M1KA 2F8EX 3SDEA 2EWSA 1RACB 3SI8A 1QAXA 5DGBA 2OLWA 4Y0WA 2VZ9A 3MZIA 3NS6A 3DHXA 3CCMN 3OY9A 1VJQA 2QA4G 5BN9A 3MN6A 1WUAA 2WFBA 2YWEA 5M2RA 2B9WA 2DKOB 3VA3A 1WJ9A 4DR7J 4QU6A 3OVNA 1JXLA 4KTZA 2BVZA 4C98A 3DOLB 4UUWA 2VJUA 2HVZA 5HL7Q 3ET6B 4F0HA 4NYZA 4PUOB 3RVCA 3D4JA 1U1PA 3O3HA 5AQGA 4CQ1A 1H6KX 4LRFA 3BSCA 3GFYA 1BHNA 1FJGK 2WSEC 4CEFA 1WAFA 2DJWA 1TYQB 3D1HA 2QLXA 4G9ZA 3AARA 3OUYB 2HOEA 2VA3A 5FDLA 3T1YK 1F5AA 4IFVB 1WB9A 4WTYA 3CDAA 4M3ZA 5DM7Q 4L76A 4B08A 2R8IA 2DPNA 4OLAA 3O44A 2B5JA 3O3LA 2HFVA 3MOZA 5KFZA 4F4XA 4OZ0A 2DEJA 4CH1A 3P1GA 4WK3A 5I3QA 1YJNS 1JJHA 3G4SN 3BDPA 4FJ7A 3NF6A 3PYDA 3RR8A 1OWXA 6FDRA 1TP7A 3KK1A 3EX7B 2ZC3A 4IUFA 4CHOA 4DU4A 4CE9A 2HYIB 4FLTA 4DR5F 5K14A 2ILYA 4GRSA 3KLGB 4U95A 5KFHA 1HWKA 1BWFO 5BR8K 3DLKB 4YY3J 3Q2SC 3J7AN 1Y00A 3AVLA 4AYBD 1R27B 1DHMA 4FL9A 2CZVC 4LJMA 4HVJA 2KU7A 1HPZA 4CEAA 3CJRA 4EI2A 3CFRA 2I8EA 3ZZTA 2IM1A 3T1AA 3ZZZA 4RNOA 2D7SA 2DR9A 4OJRA 1X8DA 1VK8A 4UY8T 2IVFB 5A8KA 2AU0A 3D9BA 1OVQA 1GLCG 3M8QB 1TV6B 3FSXA 3RMCA 4N7TA 3THYB 4YOYA 5J2QB 4P9SA 4NOHA 5J1PA 2ZD1A 3EY1A 2R2RA 1FRHA 4PRFA 3HM9A 4PKIA 2ASOA 2ALYB 5J1EB 2RILA 4PYAA 4QU7A 1UWBB 4DV3J 4BE0A 1NMEB 5AQRA 3WT0A 3AO2A 4ECQA 2JLEA 4FJGA 4CF9A 2FVPA 3VEZA 1M1KO 3U27A 4K8RA 5FIIA 3SSQA 3JSYA 4J9OA 4U7BA 1RTIA 1VC5A 3AA5X 5F8MA 3BBCA 4W5RA 1SH0A 1T3VA 4NLDA 2VDIA 2AIRB 1KAYA 1NSQA 4X66F 2OCEA 4F9OA 3HSCA 4FM0A 1SB6A 4OJGA 4RLEA 4IG0B 3LW5C 1OO0B 5CHIA 2AP1A 2C22A 1FFGB 3A1YG 5KFYA 3THXA 1BE4A 3K5LA 4B1UB 2HHWA 3K8WA 2BEFA 1WHYA 4WQ5C 4K4ZA 2BANB 1JJ4A 3M9MB 3BR9A 5I4MA 3F41A 5ITHA 1G7CB 4K42A 1NNEA 2E4LA 3CO9A 5A6WA 1P8GA 4TYAA 3ZETA 2MKHA 3MM7A 4CJEA 1TAUA 3J7A1 3V6DB 2BJ8A 2M70A 4AHSA 4FJXA 4Z4FA 1NGHA 1X0FA 4B1YB 2AJ2A 3EXCX 3HPOA 2Z2MA 2JC1A 4JI3J 3IR7B 3PHEA 3QICA 5D15A 2KJVA 4JI1K 4LRDA 3L7PA 5FPDA 4WKRA 4CZHA 4QZVB 1S1TA 4KHYA 1U2FA 2GJFA 1JIHA 1EJ7L 1U6BA 1UTAA 5KTQA 2IDEA 2ZFHA 3D28A 1HHSA 2HMIA 5AXMA 4O5FA 1N33J 2FF3B 1WSGA 1MN9A 2IRYA 2HGNA 1HYVA 3S3OA 1Q8BA 2R2TA 2LXFA 1NGBA 1CQMA 1S57A 1S22A 2VPXB 1REVB 2H65B 4DL2A 2PMWA 4WTOB 2CPIA 1JLAA 3FBEA 4KI4A 3Q2TC 1K0TA 2EI5A 4ID1A 2VJVA 1R8PA 1FRXA 2HWHA 1U0HB 4HDHA 2XCPA 3KVGA 5JXSA 3FUYA 1Q9YA 3Q8UA 3TW0A 1R6VA 1U48A 5SZTA 2WOMA 3HPHA 3AO5A 3VHQA 1GMWA 1LWCB 1ZM9A 2A0FB 2I7PA 5TKYA 4X4OA 4EUVA 4RW6B 1SBRA 3C95A 2CH5A 2DD8S 1PC5A 2DNOA 4ZVOB 2D3ZA 3HT3A 4CZGA 3M2RA 3AVJA 3O80A 4ZKAA 1BQMA 2DVIA 4DTPA 2CPEA 1ZH5A 3IS9A 4JHDA 3OL9A 2HW3A 5HP1A 2BM1A 1MG7A 3LDSA 5HBMB 3CTRA 3U8XA 3GIJA 3HFZB 3DLGA 2DK2A 2R8KA 1AYEA 1O8BA 3NGIA 3UN5A 3L6QA 5E3QA 4CI0B 2PFUA 2GVDA 2VQFJ 2HQIA 4JI7F 4I4BA 1FKPA 3HTVA 2RSQA 4R25A 3F73A 4ELTA 2MYFA 4CFAA 5KFOA 4GVLA 4PYDA 2AGQA 1HNIA 3IR5B 4DQRA 1SKRA 4CJ7A 3UCUP 3POTB 4E7KA 2NS1B 5CR4A 4LRBA 4BC5A 1X4DA 3MM8B 2B4PA 3I8DA 4L8RB 1W25A 2YV0X 1J27A 2Z57B 2GMHA 1KVCA 4ZVFA 4PPDA 2YJEA 4LQ9A 1X7VA 4K2JA 3LO3A 5M2UA 4KHNA 3CDUA 2VBWA 4N8NA 2NXEA 3DXKA 3FBBA 2JVRA 2XM3A 1L3KA 1VQ8S 3ITHA 3I0SA 1HKCA 4H5NA 3OBIA 3M2UA 2FSJA 2F8MA 4JUZA 4IOAQ 3J80Y 5GAHU 3Q83A 5EWFA 3L8BA 1CJVA 3VAGA 3QJPA 1RBOB 2AP6A 5J1NA 3DYAA 4ZMMA 3KLVA 3KIOA 3DRPB 3T5JA 1IKYA 1JXBA 2YNGA 1SAZA 1T6DA 1EP4A 4ZDNA 1RAGB 4DI6A 1UJ6A 1K8KA 1NH7A 1RLDA 2RVJA 4PKHA 1BG3A 4J91A 2MJUA 5LMNF 1FTCA 4ANCA 2BRKA 3W0LA 2J7WA 4QWDA 5HANA 4DV5F 3HX9A 4M5JA 2VH7A 3S3MA 2OPRB 1JMTA 1R8AA 2IIHA 4H0VB 2HNYB 3QMLA 2MTLA 3LP2A 2ZOFA 4DV0K 4ILGB 4P71A 2DISA 2G2YA 1P9YA 1NKBA 5KFQA 1X9SA 3AD8C 2HS4A 4J2BA 4IH6A 1RWWB 2G2OA 3QRQA 3V9WA 3GJSB 5L39A 1VMBA 4KPCA 2W7OA 1J53A 2ATQA 1ZA2B 2CG8A 4FNHA 2J8AA 4DR5K 1VC6A 3MURP 2IC3B 1S99A 1IBLF 4CT9A 1HMVB 3WXMB 2GO9A 2MZRA 4F3QA 4W98A 3K9JA 3BUZB 4CO5A 3RMBA 3NKYA 4DV1J 2G0IA 4XIUA 4URGA 2P9KB 3J7YP 1M5VC 2AZ3A 1LW2B 2EK6A 5IT9O 1JKHB 3CD7A 3SI6A 4NLRA 2NSBA 1QVGM 1WEZA 1IR0A 5LJ5Y 4Z94A 4OPKA 4K8ZA 4AL5A 4DCOB 3US5A 3HHLA 2P9EA 4LR8A 2D0CA 3GQCA 1U1NA 1ZBUA 3M8ZA 5EGYA 3KMSA 4RNHA 2AGPA 5DJBA 4I0WA 4DQQA 2ZH6A 1NJIT 5HN0A 1YJWS 1QVFM 4CZMA 4PWUA 1YK9A 4MFBA 3IWNC 1OQ3A 1VBZA 4LVOP 3EL2A 2DNRA 4BC9A 4YEAA 4NLXA 3OYNA 3LDQA 3DLEA 4HTUA 2OMLA 4BDYA 4H5TA 4E89A 4AT1B 3HVTB 3KK2A 4K4TA 1A7GE 4RUAA 3AVCA 3C7NA 4I2PA 4X4SA 4DV4K 3EWGA 4H0YB 5KGWA 4PQUB 1SI9A 3L2WA 3HSJA 3CIZA 1WOQA 2HBKA 2PZSA 1Q8IA 3CIMA 5IM0A 1RT3B 4ZPTR 2LEAA 2OTJS 1FJEB 4FPAA 1YI2N 2E2QA 5ADXA 4U7UK 2MSSA 5FPMA 3AVHA 1IBKK 3CCUS 1HNXF 2FB0A 4DSJA 2XY8A 3CGIA 4GKKJ 2L9DA 1F60B 2VCPA 1VSJA 2P9LB 1KD1T 4CM2A 3KKFA 4ZHRB 2RF2A 4H0OA 3IP0A 4XH5A 3MEDB 2X78A 1MROA 3SBMA 1VSMA 1QDUB 1PAEX 1BO5O 1LWFA 1P1LA 4LT6A 3BH7B 1WF1A 3ILLA 4USJC 4JKDA 2P9NB 4IXCA 1YJWN 1U1KA 3MR6A 4GVMA 2AJFE 1U4BA 4A47A 3IFRA 4EBCA 3QGGA 4X2BA 4B3TJ 1VSKA 4QWBA 1JJ2M 3MMJA 4QWCA 1PJ6A 5AJ3J 3QIOA 3J81O 5C25A 3IBWA 1VSDA 2Q2RA 4GKKK 3O5TB 1ZZFA 4KKOA 1HQEB 1HD0A 1GXLA 3TX0A 3H2UB 4WYWA 1HR0J 2V4JA 2XYGB 3JQKA 3LALA 3IGVA 2DGTA 3GLJA 4CYUA 4E7IA 3O4QA 2UXCF 1HPMA 4GMJB 2ASYA 1D9FA 3R2CJ 5IQQA 4BC4A 2ROEA 2H1YA 1RDUA 1T7PA 4WPAA 2KVIA 2Q1NA 3DOMA 3FZKA 1WG5A 3PVXA 1NJYA 1NB2A 2HVIA 2CYYA 3D67A 3I55S 1FE0A 2UXDJ 4IO9Q 1ILYA 5F9NA 3LPEA 2FQQB 2V8PA 1Q95G 4PR6A 5D8HB 3DXKB 4OYPA 1FKAF 3CJ9A 1RBTA 3ZT0A 2YKPA 1Y11A 5IT0A 4RBUA 2Z2YB 5HVFA 3MX2A 3NGTA 4Q43A 2ZUGA 2XYHB 5D6GA 3MDQA 4DV4F 1R89A 2FBXA 1MSWD 3AGRA 4LFBK 1F5BA 4Z37A 3V4MA 2B4OA 3Q8QB 1Q0NA 2ASPA 3ZX2A 3AH6A 1C0TB 2YKNA 3CE8A 3MD1A 3B6OA 5AQQA 1T9TA 5FRNA 3QRPA 2GUPA 3BBFA 4ILHA 3GV5B 5L1KA 4PXEA 1FEHA 4WZMA 3S3NA 2PE8A 1GOCA 2VWBA 1HYSA 5AQIA 2ZJPQ 4Q8FA 4C2MA 2AJ4A 5D0HA 5H9FJ 3ZZPA 3ZO7A 3CCZA 1CS4B 1HNVA 3ULHA 5JICA 4WP3A 4ID5A 3KNGA 4DV7F 1QHAA 5BYQA 2O4GA 4G1PA 2L9NA 1D5AA 3MMAA 4FPRA 4TQSA 3C6TA 3I9ZA 5HJXA 2E1AA 3SMZA 4LY7A 2UU9J 4M5KA 1HNIB 3DLBA 5KFEA 4KT0C 5M1QA 4KHPF 4DDFA 5ELZA 3AVGA 4X64K 1XMQK 4CJQA 2ZBCA 3T1YF 1W7WA 4DSEA 4CK1A 3H45C 2R9LA 1KAXA 1GFWB 3PYEA 1N5YA 4M41A 1CLQA 2APOA 4K50A 3PIOQ 2V50A 3FBCA 5ETMA 1RDAA 4DR4F 3IMQJ 4PL7A 2PT0A 4DTUA 1U1RA 5DLFA 5IXUA 1Q82O 1JXEA 2W6LA 2W42A 4DS4A 3FZ2A 4IKFA 3AHPA 2ASDA 3QIPB 3W2VA 4ISEA 1IVZA 1CG2A 3I4HX 3OW2R 3FEXB 1FWKA 1AT1B 1N36J 5ETOA 3WQTA 1Q7YT 4DV3K 4O4RA 2DHGA 4JOUA 2B4UA 1B7YB 3QBXA 2HK2A 2LQ5A 3K2PA 1NK5A 5JVGL 3QGPA 2BE9B 3LGNA 3BY5A 1RTHA 2B3TB 3TSQA 1K6YA 4IR1A 1U45A 2CQIA 3ENOA 3M30B