2B4JA

Structural basis for the recognition between hiv-1 integrase and ledgf/p75
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
153
structure length
135
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, recombination
molecule keywords Integrase (IN)
publication title Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 47
structure length 135
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b4jA00
4JRPA 3DMJA 3DRRA 4HVJA 3OYCA 3V9XA 2RPIA 2ITGA 4CHOA 4DQQA 4FZXC 4W5NA 2HNZA 3SJJA 1Z25A 4M45A 4CGIA 4DLEA 4GVMA 2XHBA 4CCHA 2RN2A 3V1RA 2VG7A 2RF2A 4B8AB 2ETJA 2FBVA 3LZIA 3LDSA 3A2FA 1BI4A 3AA4A 1KVAA 4N41A 4GW6A 3SQ4A 3L2VA 1QQCA 1WN7A 3M8SA 3F73A 4CJKA 1F21A 3DYAA 3KLGA 2G8IA 4E7IA 4DTSA 1WSIA 3HT3A 3OYGA 2G8VA 4B9TA 4NCBA 3VQ7A 1NK4A 5SZTA 1C1AA 4O0IA 1S1UA 1K6YA 4HUFA 1LW2A 2LSNA 4HCCA 4H8KA 4CK1A 4FJHA 1KLNA 4KHSA 4M42A 1IKYA 5FRMA 4ELTA 3VQ4A 4DS5A 4KHQA 4M3YA 1HQEA 3C6UA 2YNIA 1JLCA 3C94A 4N47A 4FJ9A 1LWFA 3M8RA 3V4IA 4FJLA 3SCXA 4E1NA 1TAUA 4OJRA 2OPQA 1BGXT 1UOCA 1NK7A 3MEGA 3L2RA 4M3WA 1NJYA 2DFEA 2IDOA 4ZHRA 1D5AA 1O1WA 3ZT3A 2HHUA 1GOCA 5KRSA 4BDYA 1S9GA 2HNYA 1BIUA 4FZYA 2YNFA 4O0JA 4BWJA 1DTQA 3C6TA 2XY8A 1S1VA 3VQ9A 3SV3A 2Z1GA 4CIEA 4JRQA 3HPGA 1D8YA 4EZ9A 2HHVA 1ZBHA 3S3NA 3NFAA 1DTTA 3ZT1A 3SYZA 1KVCA 3AVAA 4DMNA 3OYMA 1RCHA 1JL1A 3SQ1A 1X9WA 4FLTA 4KHWA 2QKKA 4F3TA 2D5RA 2FC0A 1L3SA 5FDLA 2OA8A 4BDPA 3OJUA 2GBZA 2XY7A 4FK4A 4QCLA 1TKTA 1VK0A 4J2BA 3V9WA 4K8XA 4FK2A 3VQ8A 4DLGA 4BWMA 3RRHA 3VQ5A 3LP2A 3NH1A 3PX4A 4B9SA 4Z4IA 2VG5A 1S9EA 1S1XA 3DOKA 3RRGA 3DLHA 3LP0A 1RT3A 4AHUA 2F8SA 1VSKA 4B9UA 1C0TA 1CXUA 4OLBA 4CJWA 5CZ1A 4B08A 3LPUA 1QTMA 1QSYA 3HK2A 1VSFA 4KFBA 2YV0X 3DLGA 3VN5A 3D0PA 1TGOA 2OPRA 3B6OA 1NK5A 4CF9A 1NK9A 4L8RB 4MFBA 3NF7A 3ZSOA 4RW8A 2EHGA 4NCGA 1TK0A 1FK9A 2KW4A 3SQ0A 4DTMA 1RDBA 3U3GA 4F8RA 1UWBA 3OYEA 1S1TA 1Y97A 3TAQA 4DTXA 2YNGA 2P51A 3SZ2A 3S9HA 3NHGA 3OY9A 3TR8A 3WNFA 4J2EA 1UA1A 4M3TA 3OYBA 3AO4A 3CFOA 3THVA 4LD0A 4CJ4A 3QESA 1VSLA 3QNNA 3TARA 4CJ5A 1NK6A 3VQQA 2VWJA 1B9FA 3L3VA 1SKSA 4O4GA 1TL1A 3L2QA 4IG3A 4F3OA 4HCBA 2PZSA 4I2QA 2B4JA 4JS4A 3H08A 3P1GA 3IRXA 2XRIA 3KLHA 2E4LA 3HYFA 3AVLA 5HP1A 4HTUA 4M3UA 4OKEA 2HNDA 4BE0A 3TAEA 1SV5A 1WLJA 3KD5E 2P1JA 4C8LA 2HHQA 4KKOA 4RW7A 5E41A 5JS1A 1I3AA 4KTQA 1U49A 3KLIA 4DU3A 1RILA 4CJFA 4CF8A 4CJSA 4N56A 3OYAA 4DSEA 1U47A 1NKEA 4Q0BA 4KHYA 3PUFA 3ZSRA 1KFSA 2DTUA 4FJXA 3D45A 3K5OA 4N76A 3K57A 1IKVA 1ASWA 4DSKA 5DK5A 2E6MA 3SUPA 3DLKA 3KD1E 1LAWA 1S1WA 5HLFA 3K58A 3DI6A 3C95A 3VA0A 4B9LA 2BANA 1RBVA 4DG1A 1X9SA 4KHNA 1J5OA 3HVTA 1T7PA 2KFNA 1KFDA 1SUQA 3K5MA 4C8KA 4ID5A 4IKFA 1TK5A 4CFBA 4CJUA 4ICLA 3VA3A 4J2AA 1SL1A 3ULDA 1HYSA 1HYVA 3AO2A 3I0RA 3RTVA 4DFJA 4ZTJA 4H4OA 2BE2A 3EYZA 3RMDA 3NGYA 4OKKA 4M41A 3SNNA 4AHVA 3PO5A 1L3UA 4I9QA 1C0UA 3DM2A 3FFIA 3HP6A 4W5TA 4HHTA 3QERA 3I8DA 3K5LA 3NH2A 4Y1DA 4FJGA 4YFUA 4BACA 3VQAA 3HO1A 1CLQA 4Z0UA 4CFCA 3AO3A 4CEFA 5I3UA 2QK9A 2PYLA 2KZZA 1J9AA 4CJRA 4DFPA 3RMAA 3OYHA 2P5GA 4YNQA 4CERA 1G15A 3VQBA 3L2WA 3BGRA 3RWUA 1A5WA 1C6VA 1W9HA 1VRUA 4OVLA 3QLHA 1D9DA 1VSEA 1BISA 4M3RA 3T1AA 2IGIA 2Z1HA 3TWHA 3V81A 2JLEA 2XO7A 3PY8A 4DSLA 1S6PA 3V1OA 2DFHA 4KPYA 4FM1A 2VWKA 4FVMA 5SWMA 3V9ZA 3RR7A 4FJKA 1ZBIA 4Z4HA 3SV4A 3QEVA 4E0DA 2KFZA 1QE1A 4Q5VA 5KTQA 4E1MA 2ZQBA 1TV6A 3IG1A 2QXFA 4B9NA 1RDAA 2ZD1A 4IBNA 1I39A 3ALYA 1HYZA 3AVMA 4KO0A 1QS4A 3QEWA 2Y1IA 3SI6A 5C42A 1NKCA 4FJ7A 2HHSA 4I7FA 4ID1A 3T3FA 4IG0A 4FJNA 1ZBLA 5C25A 3M8PA 4RG8A 3ZCMA 5HRSA 3ZSZA 4CHPA 1Q9XA 1C0MA 4CIFA 4CEDA 3TABA 3AV9A 3CG7A 2XY6A 4DS4A 1RNHA 3AVHA 3ZT2A 5HRNA 1ITGA 1YT3A 1HNVA 2D0CA 3T19A 2GV9A 4CF0A 4CGGA 4BE1A 4OPJA 1C1CA 1BQNA 4O5BA 5J2MA 1JLQA 1BQMA 1EKEA 3LPTA 3ZSYA 3ZSQA 1WSHA 2G8HA 4QOZB 4EP5A 3K59A 3U3YA 3EZ5A 2HHTA 4FLWA 3S3OA 1U04A 1U48A 4B9MA 2OZMA 1C1BA 3E01A 3LP3A 4DTNA 1XI1A 4FK0A 4AHSA 4CGDA 3DRPA 3DLRA 3SPZA 4IFVA 3PX6A 1U4BA 1B9DA 4NCAA 1T05A 1N6QA 1QHTA 2HB5A 3CFPA 3DLEA 5FROA 3NGIA 4R5PA 1EETA 2ATQA 1ZYQA 1RTDA 3S3MA 3HJFA 3HPHA 1SKRA 3MECA 3AA3A 4DTOA 3PX0A 5CYMA 4KB0A 3MXJA 1VSJA 1RBTA 4OLAA 3M8QA 1NJZA 4PWDA 4DFMA 3AVJA 2HVHA 3LWLA 4KB1A 4CESA 4KTWA 4E7KA 4DQPA 2YKNA 1IKWA 4CJLA 3LANA 3OS1A 1L3TA 1JLEA 1WSGA 3WNGA 1S5JA 1TKXA 2A1RA 2F96A 2WONA 4BE2A 1NK8A 2HHXA 1RDCA 2YKMA 4CJ3A 2HMIA 2EX3A 2X74A 1CZBA 4CEBA 1KTQA 2X6NA 1XHXA 4FLXA 1QSSA 2B5JA 3KLFA 4FJ8A 1BIZA 5D3GA 3NF8A 1ZBFA 1WSEA 3LAKA 3KK1A 4DQSA 2G8UA 5KGXA 3OS0A 4FM2A 1A5XA 4AHTA 2X78A 3ISNC 4CHYA 5J2PA 2IOCA 4OPKA 3DOLA 3HXMA 1XC9A 4HUGA 4FJIA 3HSTB 1FKPA 3ASMA 5HBMA 3CYMA 3AO5A 1HMVA 2Z1IA 5J2NA 3OYJA 3KJVA 2AJQA 2D0AA 1CZ9A 1NOZA 4FYDA 4DF4A 1TAQA 3L3UA 3NE6A 5FRNA 1MU2A 1BI4B 1JKHA 4C8NA 4KHUA 2NUBA 3AVIA 1X1PA 3OYFA 4H4MA 4CE9A 5KRTA 1HPZA 4FCYA 1TL3A 1WSFA 1XWLA 5J1EA 1TVRA 3OYNA 1R0AA 1TKDA 1SL0A 1HQUA 4CFAA 4PY5A 3HPOA 3KK3A 2A1SA 5T7BA 3PO4A 2PY5A 3PV8A 4JS5A 4CHNA 2B6AA 2Z1JA 1XHZA 4J2DA 4M3XA 1LWEA 3DRSA 3V9SA 4Y1CA 3DLBA 3AVBA 1ASUA 4KI4A 4M3ZA 4KV8A 4ELVA 3HL8A 4CJPA 4OGCA 3TAFA 4WE1A 3G0ZA 5CY4A 3JSMA 2PYJA 3O3HA 4CEEA 3SQ2A 1IG9A 2QKBA 4PQUA 4FZZA 3O4NA 3V1QA 3AA2A 2VG6A 3OYLA 4DU4A 1RBSA 4FW1A 3V6DA 1W0HA 1KLMA 1ZBUA 4N5SA 3AVNA 2Q3SA 4KREA 3ZSWA 4CJQA 3B6PA 4CJVA 3AA5X 4HUEA 1QSLA 1Z26A 3TAGA 3NH0A 1BL3A 1B92A 1UAXA 3WNEA 4DFKA 4RW4A 1KSPA 3QO9A 3MXIA 4O55A 4DTPA 4F2RA 4FJJA 4MQ3A 1KVBA 3O3FA 3OS2A 4CEAA 1SKWA 4B9VA 4DSIA 2F8TA 3LZJA 4CHQA 4PA1A 3CM6A 4NYFA 1HRHA 4AHCA 2R7YA 4E7LA 4CF2A 5CZ2A 4CGFA 4E19A 2X6SA 4W5OA 1RT6A 2FBYA 1RTHA 5CYQA 1JLBA 4I2PA 4GMJB 5DMRA 3O3GA 4F2SA 4PUOA 4B3OA 2DY4A 1GOAA 2O4IA 1GOBA 2YHBA 4DTUA 1WNSA 2G8KA 4I9LA 3VQEA 4RW9A 4E89A 3K2PA 3KK2A 1SL2A 1EXQA 4DU1A 1LWCA 2FBXA 3LWMA 4B8CA 3U6FA 4NYNA 4FJ5A 4AH9A 3ZSVA 1N5YA 1HNIA 1FKOA 5HRRA 3LP1A 3IS9A 4KTZA 4CGHA 2G8WA 3ZSXA 4BDZA 3P5JA 4C8OA 2GUIA 2Y1JA 4CHZA 3P83D 5JS2A 4ZTFA 4OGEA 4XIUA 1U45A 4K8ZA 3OYIA 4CF1A 4CJTA 1RT5A 3MAQA 3HP9A 3NAEA 3MXMA 2BGGA 3TAMA 1DLOA 1VSHA 1BHLA 1TKZA 3MEEA 1S6QA 2W42A 4F4KA 5C24A 4AHRA 2OZSA 2HW3A 1IKXA 1IO2A 3MEDA 3IAYA 3G10A 4UQGA 2BDPA 1RBUA 2P5OA 1EX4A 3VQPA 1JXBA 3TI0A 4CEOA 1YTAA 4CFDA 4E7HA 3NCIA 3NBPA 1YVUA 1T8EA 1RT1A 2KTQA 1JXEA 1JLFA 3QETA 4KRFA 2YHAA 4DQRA 4ELUA 2I5JA 4EP4A 1RDDA 3NF6A 4QAGA 4E7JA 4CK3A 2OYQA 4C8MA 5HROA 1RBRA 3KIOA 3QEIA 1LV5A 3KTQA 2IAJA 4LY7A 4DSFA 2HVIA 1HJRA 4CGJA 1REVA 4AILC 4LSNA 4Z4GA 3AVFA 3SUOA 4FM0A 4FLUA 3K5NA 3KLEA 1A5VA 3AVGA 5EU7A 4FJMA 1VSDA 4DWIA 3CM5A 2RKIA 4DF8A 4DSJA 1J54A 3I0SA 1LAVA 3SUNA 4IFYA 4Z4FA 4O44A 5HRPA 4G1QA 3AO1A 3SUQA 4CEQA 3KKSA 3VQDA 3EY1A 1EP4A 1JLGA 3OVNA 2E6LA 5KGWA 3WNHA 3QINA 4RW6A 4W5RA 1WAJA 1FXXA 3QIOA 3RMCA 4CECA 4FXDA 1RT2A 4LH5A 4OKJA 2DFFA 3NF9A 1CXQA 4IDKA 3CQ8A 1L5UA 3VQ6A 5KI6A 1TK8A 1WSJA 4FW2A 3TANA 1JLAA 3VQCA 2IS3A 2JGUA 4KI6A 4Z4EA 4CK2A 2IC3A 4E3SA 3JYTA 4EZ6A 4LSLA 3NGZA 3OJSA 1ASVA 5J2QA 2XY5A 4DQIA 3QIPA 4JLHA 1BCOA 3ZT4A 4CJEA 1RT4A 1KCFA 1D9FA 1RTJA 4DTRA 3RMBA 4DTJA 4FLYA 1NJXA 3LAMA 1IH7A 4FLVA 1NJWA 2HHWA 2WOMA 1NK0A 4LH4A 3ITHA 3LALA 1X9MA 1VSIA 3O4QA 1VSMA 1UA0A 4KAZA 3L8BA 2YNHA 1NKBA 2O4GA 1Q8IA 1RT7A 4W5QA 3UIQA 3SPYA 3HM9A 3TAPA 3NDKA 3RR8A 3KKRA 3OYDA 4CIGA 3L2UA 1WAFA 4TSXA 4Z4CA 3QEXA 1L3VA 1NOYA 2D0BA 3ZT0A 2KQ2A 3AVKA 4CEZA 3BDPA 2KZMA 1YTUA 5K14A 1BCMA 1J53A 1JL2A 1RTIA 1KRPA 2G8FA 1LW0A 3AVCA 3OYKA 3F9KA 3QNOA 2FBTA 2OPPA 3HVRA 3CFRA 3QEPA 1T03A 1VRTA 1Q9YA 2OPSA 5I42A 3V9UA 2ZE2A 4FLZA
chains in the Genus database with same CATH superfamily
1VQ9N 5GAEP 4DQQA 3SJJA 3HBTA 4CGIA 4JNEA 1Q7YO 3LZIA 3SQ4A 5M1OA 1WN7A 4NB4A 2G8IA 1NGEA 5AZIB 4BG9A 4DTSA 2G8VA 3HT3A 3OYGA 1H1VA 2UU9K 4O0IA 4LFAK 1OH7A 1K6YA 2NRRA 4H0TB 2WFBA 5FRMA 1KLNA 3A5OC 3H3NO 1JCEA 3C94A 4FJ9A 4FJLA 4JHDA 3SCXA 3VEZA 2OPQA 1NK7A 5FLXO 2DFEA 2IDOA 3G25A 2WTUA 4JKGA 5AQXA 3D2FB 4BG8A 2HBKA 5M1QA 4CZHA 3SV3A 4CIEA 5I9EB 3CD6N 4BC2A 2HHVA 1KVCA 2BH1A 3AVAA 5AFUH 3OYMA 5KPZA 5JICA 3SQ1A 3VTHA 4JAXA 4F3TA 2VQEK 4FK4A 2GBZA 1G99A 5E84A 1TKTA 1W7AA 1VK0A 1VQPN 4MO5A 3BF1A 5HL7L 1ESVA 1JJ2M 2VGNA 3R8EA 3DLHA 3MK6A 3WXLA 3TSPA 5CZ1A 3S41A 3LPUA 2P9IA 4KFBA 1NK9A 1NK5A 3B6OA 1GLCG 3ZSOA 4NXMK 4RW8A 1U2VB 4DTMA 1RDBA 3KWGA 3DJCA 3OYEA 3ULEA 1Y97A 3TAQA 1J5EK 4FVUA 3CPEA 2YNGA 3WNFA 3OYBA 3CI5A 4WQ4A 4CJ4A 1NK6A 1B9FA 4BRLA 2Q2RA 3IRXA 2P9KA 4OKEA 1MDUB 5AQIA 5EY4A 3TAEA 1SV5A 3UKRB 2P1JA 3WXJA 4LF7K 1NNEA 1NGHA 3C65A 4KTQA 2CGKA 3KLIA 4DU3A 4H0OA 4CJFA 3ZEUA 4CJSA 4N56A 3E1YA 3EEQA 1EWRA 3K5OA 1IKVA 2FF3B 2ZGYA 3L0QA 3MX5A 3KD1E 2E6MA 3GDQA 4YY3K 3CCVN 3SUPA 1EQYA 5HLFA 3K58A 2KLAA 3DI6A 3CCSN 3TSUA 2BANA 2KFNA 2WUSA 1TK5A 1HPMA 4CFBA 5IT9O 1DKGD 3ULDA 3W3DA 4DFJA 1GLFO 4H4OA 5FRNA 3QERA 3DXMB 3NMUA 3AAQA 1T44A 3NH2A 3THWB 4Y1DA 3AO3A 2PYLA 2O8FA 3L2WA 2A40A 1W9HA 1KAYA 4M3RA 3O1WA 3V81A 4B3RK 3G71N 3O1BA 4B9QA 1MA9B 5A2QO 3SV4A 1V4TA 4E0DA 4E1MA 2O8BB 3ZX2A 1RDAA 2ZD1A 5AZIA 1DGKN 1I39A 4KO0A 1HYZA 3PIOL 3CC4N 4FJ7A 3QDKA 3MWPA 1OH5A 2HHSA 1ZBLA 2FXUA 2QXLA 3M8PA 3ZCMA 5HRSA 1NGBA 3CG7A 4IXCA 1NG9A 4JKHA 2E2PA 3F5TA 5HRNA 1MWMA 1J6ZA 4E1JA 1NGDA 4JYAK 3KWIA 4KHPK 1EKEA 3LPTA 3BUZB 5B8HA 3ZSQA 2G8HA 2I7NA 2P9NB 4B1VA 3K9KA 3FLCO 1U48A 4B9MA 2OZMA 3DRPA 3DLRA 4B1WB 3PX6A 1B9DA 2V7ZA 4NCAA 4BREA 2O8CB 1QHTA 2HB5A 1BG3A 2OANA 4PKIA 5LJWA 3NGIA 2ASOA 1ZYQA 4M7XA 3HJFA 3MECA 1KQSM 3FZFA 3MXJA 4OLAA 4WFNL 4K0KK 4QS7A 5EVZA 4CESA 4E7KA 1E4FT 3N4QA 1L3TA 3WNGA 4FWSA 1S5JA 4BE2A 2YKMA 1HNXK 1HR0K 2X74A 1KTQA 4CBWA 2B5JA 4HTLA 3C7NA 3KLFA 1BIZA 2D0PA 3O9RA 1A5XA 4H5RA 4CHYA 1VQ4N 4OPKA 4HUGA 1GLEG 2NLXA 2Z1IA 2AJQA 1CZ9A 1QVGM 2HSTA 1T3VA 3L3UA 4A61A 4KH5A 3OYFA 1HPZA 4FCYA 4G9ZA 1YUWA 2ZGZA 5AQQA 3P31A 3HPOA 3KK3A 3O6WA 1Z05A 1FJGK 1XHZA 4M3XA 4Y1CA 2BTFA 1K8KA 3UKRA 4XH5A 3G0ZA 5CY4A 1IG9A 3CCQN 3SBGA 5GINA 4FZZA 4WQ5C 3UE5A 2AA4A 3GG4A 4FW1A 5GAHP 1W0HA 3V6DA 1VQKN 4FWMA 4JK7A 4A57A 1M90O 2VYPA 5AQZA 3B6PA 5GADP 4HUEA 1QSLA 3TAGA 5FPDA 1B92A 1UAXA 4DFKA 5ADXA 3QO9A 4DTPA 4MQ3A 3A5LC 4CEAA 4DSIA 1KXPA 3LZJA 2F8TA 4PA1A 1HRHA 4CGFA 3WT0A 2X6SA 2D1KA 4W5OA 3DXMA 5CYQA 4PUOA 3THWA 2YHBA 4DTUA 2G8KA 3KK2A 4DR2K 1EXQA 1LWCA 2FBXA 4K42A 4GVEA 1IBMK 3VEWA 1N5YA 1HNIA 4CZFA 3B8AX 5BPNA 3P5JA 1NBWA 4JKDA 1ZXOA 3OYIA 4CJTA 3WEEA 2BGGA 4YDUA 3TAMA 2O8BA 1BHLA 1TKZA 2KKZA 5AQGA 2UXDK 1W2BM 4F4KA 5C24A 3F2KA 2GWKA 2Q0UA 1IO2A 3EE8A 1EX4A 3TI0A 2ZF5O 3WXIA 4CEOA 3O80A 3FR0A 1RT1A 1JXEA 3QETA 1YVNA 1RDDA 2A41A 2FSNA 1LV5A 3KTQA 2IAJA 2EWSA 4LY7A 4DSFA 2HVIA 1HJRA 1REVA 4Z4GA 3AVFA 2GUPA 1X9JA 4FLUA 4FJMA 5EU7A 4DV3K 1VSDA 4JKFA 5ADXH 4DF8A 4JI4K 4CVNE 3I0SA 1LAVA 4IFYA 4G1QA 3U8XA 4LF5K 4PKGA 3CERA 3LDLA 1EP4A 3OVNA 1FXXA 4DR4K 3HSCA 2HHHK 1M1KO 4IDKA 1TK8A 5KQ8A 2VWBA 2QI2A 3JYTA 3OJSA 3CHWA 3QIPA 3M6GA 4A2BA 3ZT4A 5KQDA 3RMBA 4DTJA 1HKBA 1IH7A 2HHWA 4DUYK 2WOMA 4DV4K 4LH4A 4BRMA 3MCPA 5FPNA 4YOVA 3AAPA 2YNHA 3H1QA 3RR8A 1BDGA 5GIOA 3OYDA 3QEXA 4TSXA 1XC3A 1NGIA 2KQ2A 3BDPA 1BWFO 1YTUA 5K14A 1BCMA 1J53A 2G8FA 2FLOA 5AQUA 4CBUA 1T6CA 5GAGP 3VEXA 3DLLL 5H1SQ 1VRTA 1KAZA 4BY9C 2Z1HA 4JRPA 3DMJA 3DRRA 2OTJN 3WXKA 2O8EA 4FOEA 4CHOA 2HNZA 2YJEA 4JKGB 2ZJRL 3FE1A 4CCHA 2RN2A 2CGLA 3V1RA 2VG7A 2RF2A 1KVAA 4N41A 1QQCA 5JMVA 3M8SA 3F73A 4JI0K 3KLGA 4JKCA 1WSIA 2F7TA 3VQ7A 4EHTA 5SZTA 4DHYA 4HUFA 4A5AA 1XNQK 4H8KA 4KHSA 4BRGA 4NXNK 4ELTA 1QHAA 4KHQA 1HQEA 4BRAA 4X65K 4N47A 4DR1K 3M8RA 3FFKB 3IMXA 3L2RA 2UXBK 3MN5A 2HHUA 5KRSA 2CGJA 2HNYA 3J7ZO 4O0JA 1RGIA 4O8KA 1DTQA 3QBWA 4AF1A 2HBLA 2Z1GA 3F9MA 3EL2A 3R6MA 5JVGL 3PSIA 3A8YA 2P9IB 3HPGA 3MMVA 4EZ9A 1ZBHA 3NFAA 3LDNA 3ZT1A 3SYZA 4BRKA 1RCHA 1JL1A 3OW2M 3IDHA 1RDWX 3ULEB 2UUBK 2FC0A 4BDPA 4J2BA 3V9WA 3VQ8A 4CBXA 1QZ5A 3LP2A 3NH1A 3CC2N 3PX4A 2VG5A 1S9EA 4OPHA 4A2AA 4JKAA 1NGCA 5AQKA 3EN9A 3T1YK 1O13A 1C0TA 1SZ2A 2RE2A 5AZJB 4CJWA 1QTMA 1VSFA 4CF9A 4WFAL 3MX2A 4L8RB 4JK9A 3CCJN 2EHGA 1P90A 4DKWA 1S1TA 3ZEUB 3SZ2A 4DV7K 3C6AA 3OA9A 3THVA 4LD0A 1VSLA 2HF4A 4CJ5A 3L3VA 4BVOA 1TL1A 3CJCA 3L2QA 4F3OA 2PZSA 4CJ7A 1OH6A 1JCFA 4JS4A 3KLHA 4HTUA 3BZCA 4AM6A 2W41A 3KD5E 4FO0A 2P9LB 1HNZK 5M1FA 4KKOA 4OPAA 4BQLA 1U49A 4CF8A 3OYAA 4Q0BA 4H0XB 4KHYA 2A3ZA 3ZSRA 4DB3A 2DTUA 3D45A 5TKWA 4MLEA 3K57A 5C15A 4B3MK 5DK5A 1LAWA 1S1WA 4BQZA 1Q82O 3VA0A 4B9LA 4DG1A 4KHNA 1SUQA 1IJJA 4CJUA 4J2AA 3EO3A 3O9QA 3KK7A 3FZMA 4I9QA 1L3UA 4BRQA 3DM2A 4B1XB 3K5LA 3HO1A 4LFCK 1EO1A 4Z0UA 5C10A 4CEFA 2NRWA 2QK9A 3U9ZA 5AQOA 5AQMA 4DFPA 3VF4A 3OYHA 1G15A 3RWUA 1A5WA 5C2DA 3U4LA 3ENHA 4FWPA 1VSEA 3T1AA 2IGIA 4DSLA 3PY8A 4IWVA 1WUAA 4FJKA 2IVPA 3LL3A 1CZAN 2E1YA 4X64K 3QEVA 4Q5VA 5KTQA 3CIPA 3IKMA 4BR2A 3LDPA 3ZLJA 3T1HK 4FJNA 4RG8A 3ZSZA 1K73O 1Q9XA 2FF6A 2A42A 4CEDA 3TABA 1N33K 4AM7A 4DS4A 4RTFD 3AVHA 4DCHA 3P4IA 4OPJA 1C1CA 3MN7A 1BQNA 4O5BA 1JLQA 4NLBA 3VF6A 4EP5A 1VQ7N 3EZ5A 3C7NB 3E01A 2YHYA 4DTNA 4AHSA 3SPZA 4IFVA 5KPRA 2E2NA 3FZHA 5FROA 5MLCQ 3CJ9A 5LJVA 4EIAA 4DTOA 3CC7N 4ILJA 5CYMA 3CJAA 4KB0A 1RBTA 2QWMA 4BR0A 3M8QA 4DR3K 3HI0A 4BR7A 4YOYA 3P38A 4JI5K 4WQ4C 1IKWA 4CJLA 3SAHA 1JLEA 1TKXA 2A1RA 1RFQA 3G6EN 1RDCA 1CZBA 5AZJA 4BRDA 2FSKA 3R9PA 3QICA 2P9PB 3BZKA 3NF8A 3LAKA 1K8KB 4JI2K 4JD2B 2X78A 3ISNC 5J2PA 3HXMA 1FKPA 5HBMA 4DV1K 3AO5A 3LM9A 4X62K 5J2NA 3KJVA 4FYDA 1NOZA 4DF4A 4X66K 4BRNA 1BI4B 1JKHA 3AVIA 1X1PA 1IV0A 5KRTA 1WSFA 1XWLA 1YI2N 1TVRA 1TKDA 1SL0A 5JLFA 1HQUA 3ID8A 1RDUA 3D7EO 3PV8A 3SMPA 1TUYA 3QBXA 3DRSA 4GV9A 1Q86O 2P9LA 3HL8A 4CJPA 4OGCA 3TAFA 2QWLA 4CEEA 2QKBA 3O4NA 1NMDA 2VG6A 3AA2A 1C0FA 4IJAA 4K41A 1RBSA 1KLMA 1ZBUA 4ISGA 4N5SA 4M7YA 3AA5X 2F9WA 3T7ZA 3ID6A 1KSPA 3WEEB 3MXIA 1N8RO 1Q81O 3O3FA 3OS2A 1SKWA 4YHHK 1OH8A 4CHQA 4E7LA 3CM6A 2PBDA 4CZJA 4CF2A 3THXB 1XMQK 5FPMA 3A5MC 3BF3A 1Q18A 4I2PA 3OBWA 1GOAA 1GOBA 1ATNA 2YX6A 3K2PA 5BRDA 2WC9A 5C2FA 2UUAK 3IS9A 2G8WA 3ZSXA 3THYB 5AQLA 3VEVA 5F1XA 2GUIA 4ZTFA 1U45A 4XIUA 4BR5A 4YORA 3H45C 3NAEA 3MXMA 2YCHA 1S22A 1DLOA 4L3QA 3MEEA 2GEMA 3O9SA 2VCPA 4DQ8A 4B1UB 3U9DA 4K43A 1BU6O 1IKXA 4GV3A 4UQGA 1VQNN 1RBUA 1ILYA 5AQFA 3NCIA 3NBPA 1YVUA 1T8EA 2KTQA 3CJBA 2YHAA 3WQTA 4ELUA 2I5JA 1NWKA 3NF6A 4QAGA 4E7JA 1QQNA 4CK3A 4C8MA 1RBRA 4KBOA 3JS6A 4A62A 4AILC 4LSNA 2ZJPL 3AGKA 3MDQA 3K5NA 4UY8O 1A5VA 2F9TA 3CM5A 2RKIA 4GNIA 1J54A 3SUNA 3GOIA 5HRPA 3VQDA 4WF9L 1HKGA 2WBNA 2E6LA 4BR9A 5DM6L 1RT2A 4LH5A 2DFFA 3NF9A 1CXQA 1WSJA 4CD3A 1R59O 4FW2A 3TANA 1JLAA 2QWOA 1ZC6A 4KI6A 1NGGA 2O8EB 4CK2A 5AQRA 4QS9A 5J2QA 3W0LA 4JLHA 4CJEA 1RT4A 2A6AA 4NLCA 1RTJA 2JWLA 4FLYA 2NRHA 1NK0A 3EKUA 1VSIA 3O4QA 1VSMA 3L8BA 1NKBA 2O4GA 1RT7A 2UUCK 3WUHA 3SPYA 3HM9A 3TAPA 4K25A 5BREA 4CIGA 4JKEA 1NOYA 2D0BA 3ZT0A 2P9PA 3AY9A 3AVCA 3UKUA 1N32K 4PKHA 2E1ZA 3KHYA 3HVRA 4JD2A 2QWQA 2OPSA 2E8AA 2ZE2A 3NVKA 4H0YB 3PLAA 4HVJA 4F9OA 3OYCA 3V9XA 2RPIA 2ITGA 1VAZA 4FSVA 4FZXC 1VQLN 4DLEA 3EZWA 2XHBA 1HUXA 1BUPA 3OBYA 1BI4A 4GW6A 3ZX0A 4O5FA 3ENOA 1F21A 4CJKA 3D6RA 4E7IA 4B9TA 1EWQA 1NK4A 1C1AA 2LSNA 4O8UA 4FJHA 4CK1A 4M42A 2ZJQL 5BPLA 4DS5A 3C6UA 2YNIA 1JLCA 1LWFA 3LDQA 4IO8A 2VQFK 4V19S 1BGXT 1UOCA 4RWTA 4M3WA 4ZHRA 1D5AA 2NRXA 1O1WA 3ZT3A 3L4QA 1BIUA 2YNFA 2XY8A 3VQ9A 4JRQA 2NRTA 2F4VK 1DTTA 1NMNA 3QFPA 1X9WA 4YDUC 4KHWA 3THXA 5FDLA 3CCRN 3O5BA 3OJUA 4QCLA 5CHIA 3PSFA 3LDOA 4JI6K 2P9UA 4K8XA 1BOTO 3RRHA 1DEJA 4B9SA 5AQSA 4WFBL 3RRGA 3KVGA 3LP0A 1RT3A 4AHUA 3N4PA 1GLDG 4BRCA 5AJ3K 1FW6A 1VSKA 4B9UA 3THYA 3VESA 1QSYA 3VN5A 3E9PA 1TGOA 3QMLA 4MFBA 1NGJA 3VEYA 4NCGA 3U3GA 5EX5A 2UYTA 4JV5K 4DTXA 3S9HA 3NHGA 4PL7A 5JVHL 3OY9A 3SBTA 5AQNA 4J2EA 1UA1A 3AO4A 3TSQA 4JN4A 3TARA 2UXCK 3VQQA 1SKSA 4O4GA 2OCEA 3MN6A 4B3TK 3VERA 1VQON 4HCBA 2B4JA 5LL6Z 3H08A 3P1GA 3SJHA 2E4LA 3AVLA 4H5VA 4M3UA 5M1PA 2HHQA 3I8BA 4RW7A 4BGAA 1I3AA 4BC5A 2E5LK 3OTOK 4DSEA 2ASPA 3PUFA 4FJXA 2PAVA 3CJ7A 1ASWA 1NU0A 4DUZK 1HLUA 1NGAA 3C95A 2KHOA 3HVTA 3K5MA 4IKFA 4ID5A 2YHXA 3VA3A 1HYSA 1HYVA 3AO2A 1NGFA 3I0RA 3RTVA 3EYZA 2BE2A 3SNNA 4OKKA 1XNRK 5GIPA 3FFIA 1MWKA 1QQMA 3UB5A 4W5TA 3I8DA 4KH4A 5IWAK 4DV0K 5EOYA 5E26A 1NJIO 3HRGA 4FJGA 4YFUA 4BACA 1XUPO 1CLQA 5I3UA 2KZZA 1J9AA 2BUPA 4CJRA 2P5GA 4CERA 4MDBA 1YJWN 1TUUA 3ZYYX 4OVLA 4DV5K 1W97L 1S6PA 3V1OA 4KPYA 2VWKA 4FVMA 3RR7A 3V9ZA 1YIJN 1ZBIA 4Z4HA 1LOTB 3TTFA 2ZQBA 2QXFA 4B9NA 5ELZA 3AVMA 3CQYA 3LM2A 2Y1IA 1NKCA 5C42A 2Q36A 3CPWM 5M1NA 4I7FA 4IG0A 2J4RA 4H5WA 4YOTA 5AQWA 4CIFA 3SK3A 3AV9A 2XY6A 1QQOA 1RNHA 3ZT2A 1ITGA 1YT3A 5AQYA 1HNVA 4JEPA 4FWNA 4CF0A 2GV9A 4CGGA 4BE1A 1V4SA 3ATUA 5J2MA 4C1NK 3ZSYA 3K59A 3U3YA 1KC8O 4FLWA 3O08A 4ILHA 3BP8A 4WYBA 5AQVA 3D2EA 1XI1A 3G4SN 4CGDA 3Q7BA 1T05A 4FWLA 3RVCA 1N6QA 3O9UA 3CFPA 3DLEA 1EETA 2ATQA 4B3SK 1RTDA 3R3LA 1N36K 3HPHA 1SKRA 3PX0A 1VSJA 5LMNK 3BY5A 3L4IA 1NJZA 4DFMA 3AVJA 2HVHA 4KB1A 4KTWA 1SQKA 2QEXN 3OS1A 1I94K 3NVMA 4BRIA 3C0BA 1Z6RA 1ZBSA 1NK8A 2HHXA 4CJ3A 2X6NA 1XHXA 4FLXA 1DT9A 3VGLA 5BN8A 4DQSA 5KGXA 4AHTA 4DR6K 3VGKA 2GWJA 3M5RA 3DOLA 5AQTA 3CYMA 4FPAA 2D0AA 3CQXA 3SAFA 1TAQA 3NE6A 2A5XA 3E9OA 1MU2A 2NUBA 4H4MA 1T6DA 4CZIA 4CI6A 5J1EA 4H5NA 2OTLN 4CFAA 3R1XA 4PY5A 5LMUK 3PO4A 2A1SA 5T7BA 4JI7K 2V51B 2GTDA 4CHNA 3I33A 1LWEA 3DXKB 3V9SA 4NO7A 4DR5K 4H0VB 4MO4A 4KV8A 4ELVA 4WE1A 3CCMN 2JWKA 3O3HA 4PQUA 2YJFA 4KREA 4IEEA 3ZSWA 3VEOA 1C0GA 1Z26A 4CW7B 1BL3A 3J7YP 4IO9L 2QM1A 4RW4A 4O55A 4F2RA 4FJJA 1KVBA 2ITMA 4B9VA 2GX9A 4OO1J 4NYFA 5CZ2A 5DMRA 2FBYA 1RTHA 1JLBA 4RCHA 4GMJB 3O3GA 2DY4A 4IDHA 2O4IA 4I9LA 4E89A 4IOAL 4DU1A 3LWMA 4B8CA 3U6FA 4FJ5A 4AH9A 5F2RA 3LP1A 3JAMO 4KTZA 4CGHA 3H1VX 4BDZA 2Y1JA 3HZ6A 3P83D 5JS2A 4FWOA 4K8ZA 4CF1A 5F0XA 3MAQA 4MDAA 3HP9A 4IOCL 4EFHA 4H0PA 3L6QA 4CZEA 1VSHA 3MCAB 3I56N 4AQYK 2OZSA 2HW3A 1QZ6A 3MEDA 2P5OA 2V52B 3GE1A 1YTAA 4CFDA 4R79A 4JI8K 4ISFA 1JLFA 2HMPA 4KRFA 1KAXA 3J80O 2QWPA 4EP4A 4LF6K 2H3GX 2Q31A 2NRVA 3H3OB 3KIOA 5HROA 4H5TA 5BRFA 1TYQB 1JCGA 4FL9A 3SUOA 3TTDA 3KLEA 3A0IX 3AVGA 4DSJA 3JXUA 2PFUA 4O44A 4Z4FA 4YOXA 1GLJO 3HM8A 4CEQA 3KKSA 3EY1A 4J8FA 3ZETA 4FWRA 1JLGA 5KGWA 4RW6A 3UKUB 1WAJA 4FXDA 2NZTA 4DR7K 3H6EA 1L5UA 4IZ9A 3VQCA 4E3SA 2IC3A 3EKSA 4EZ6A 3VMFB 3NGZA 2XY5A 1ASVA 1HKCA 4DQIA 4LFBK 3SMSA 1KCFA 4C23A 1D9FA 4DTRA 4BRHA 1NJXA 3LAMA 1VQMN 2O8DA 1X9MA 1Q8IA 2E2QA 4W5QA 2I7PA 4QS8A 1WAFA 3H46O 3AVKA 2KZMA 1JL2A 1LW0A 3OYKA 4U67L 2HBMA 3DLBA 2FBTA 3QEPA 1Q9YA 4OX9K 3V9UA 2QW9A 4FLZA 4ILGB 4W5NA 1Z25A 4M45A 4GVMA 4B8AB 2ETJA 2FBVA 4C1NI 4CD1A 3LDSA 3A2FA 3AA4A 3L2VA 3DYAA 4NCBA 1S1UA 1LW2A 1OVYA 4HCCA 2QWRA 1NLVA 1IKYA 3DXKA 3VQ4A 4M3YA 3CJ1A 3TPQA 3CF5L 1TAUA 3V4IA 4E1NA 4OJRA 1N34K 1E4GT 2P9UB 3VTIA 3MEGA 3RSEA 1NJYA 5BRHA 2QA4N 4XH4A 1GOCA 4JKBA 4BDYA 1S9GA 4WCEL 2YHWA 3O9TA 4FZYA 3VPZA 4BWJA 4GY2B 3PIPL 3C6TA 1S1VA 3E9LA 1WB9A 3VGMA 1BA0A 1D8YA 4JK8A 3S3NA 4DMNA 4FPBA 4B1ZA 2RHKA 4PHTX 4FLTA 2QKKA 2NNWA 2D5RA 1L3SA 4CZGA 4U7BA 2OA8A 2XY7A 3IFRA 4FK2A 4DLGA 1OKJA 4BWMA 1YJ9N 3VQ5A 3CMEN 4Z4IA 1S1XA 3DOKA 3FZLA 3D2FA 2F8SA 3OHRA 1CXUA 3SLCA 4OLBA 1S3XA 3HTVA 4B08A 4GV6A 4IOXA 5M1KA 3HK2A 4KH6A 2Q97A 2YV0X 3DLGA 3D0PA 2OPRA 2E88A 1GLBG 3NF7A 1TK0A 1FK9A 2KW4A 3CCEN 3SQ0A 2E2OA 4H03B 4F8RA 1UWBA 2P51A 1VQ6N 3TR8A 3GL1A 4M3TA 3C6HA 1VQ8N 1XQSC 3CFOA 3QESA 3QNNA 2VWJA 4XH1A 4IG3A 4I2QA 1TYQA 2NRZA 2XRIA 4EHUA 3HYFA 3DAWA 5HP1A 4I6MB 3M3ZA 2HNDA 4BE0A 4BGBA 1WLJA 1YITN 4JI3K 4Z94A 1SAZA 4C8LA 1U2VA 2IVNA 1BO5O 5E41A 5JS1A 1RILA 3E66A 1NKEA 1U47A 5BN9A 1KFSA 3I55N 3TTCA 4N76A 4GKKK 4DSKA 3DLKA 3FZKA 3WXMB 5BR9A 1RBVA 1X9SA 1J5OA 1T7PA 1KFDA 4C8KA 4ICLA 1SL1A 2AP1A 1IBLK 4ZTJA 3KZBA 5JLHA 3RMDA 3NGYA 4M41A 3PO5A 2QWNA 4AHVA 1C0UA 4HHTA 3HP6A 4FOIA 1LCUA 1WOQA 4WQ5A 1S72N 3VQAA 4CFCA 3DWLA 4IEIA 3RMAA 4YNQA 3VQBA 3BGRA 1C6VA 1BA1A 1VRUA 1D9DA 3J8AA 3QLHA 4LF9K 3TWHA 1BISA 3IUCA 4Y0WA 2DPNA 4FWKA 2JLEA 2XO7A 4ISEA 2IVOA 2DFHA 1X3NA 4FM1A 5SWMA 2VGMA 4A5BA 2V7YA 2KFZA 1QE1A 1TV6A 3IG1A 1YXQA 3J7AP 2E20A 1GLLO 1NM1A 5AQHA 3D2EB 3BEXA 3CCUN 4IBNA 3QEWA 3ALYA 3O8MA 1QS4A 3SI6A 3T3FA 4ID1A 5C25A 4CHPA 1C0MA 1GLAG 4CZKA 3ATVA 3O4WA 5AR0A 2D0CA 3T19A 3Q7CA 3QFUA 1BQMA 1WSHA 3T69A 4QOZB 2GELA 2HHTA 3S3OA 3SAGA 1U04A 4LC9B 3CXCM 1C1BA 2W6KA 3LP3A 4DV2K 4FK0A 3WQUA 1U4BA 4YOUA 4LF4K 2P9SB 5AQJA 4IFEA 3ZX3A 5DM7L 4R5PA 3S3MA 3AA3A 5C0YA 5LY3A 2ZM6K 4PWDA 3LWLA 4DQPA 2YKNA 3LANA 1WSGA 2F96A 2WONA 3VF2A 1HX1A 2EX3A 4CEBA 4CZLA 2HMIA 2P9NA 2W6LA 1QSSA 4FJ8A 3CMAN 5D3GA 1ZBFA 1WSEA 3KK1A 2G8UA 3OS0A 5HOOA 4FM2A 2O8CA 2IOCA 2D4WA 4FJIA 1XC9A 3HSTB 1ATRA 3ASMA 1HMVA 4BR4A 4B1YB 3OYJA 2HF3A 1QVFM 1VQ5N 2W40A 4C8NA 4KHUA 4CE9A 5KPTA 1TL3A 1YHQN 3OYNA 1R0AA 2PY5A 4JS5A 2B6AA 2HOEA 2Z1JA 1SS6A 4I6MA 3CCLN 4J2DA 3AVBA 1ASUA 1X3MA 4HWIA 4KI4A 1U6ZA 4M3ZA 4JHDB 2PYJA 3JSMA 3SQ2A 3ENBA 3V1QA 3OYLA 4DU4A 3AVNA 1K8AO 5C12A 2Q3SA 4CJQA 4BC4A 1IG8A 4CJVA 2QTDA 3NH0A 4GKJK 5CR4A 4A59A 3WNEA 2ZWHA 1YF5L 4YOWA 2Q0RA 2R7YA 2CH6A 4AHCA 4XEIA 4E19A 3K0SA 4BRPA 5BR8K 1IBKK 4FWQA 1RT6A 1KD1O 4F2SA 4B3OA 5AQPA 5CE3A 1WNSA 3VQEA 4RW9A 1SL2A 1OVQA 5BPMA 4NYNA 3AGRA 3ZSVA 1FKOA 3VOVA 5HRRA 3VENA 3QB0A 2CH5A 4C8OA 1D4XA 3M1FA 4CHZA 1E3MA 1YAGA 4OGEA 5TKYA 3A5NC 4MLHA 1RT5A 1P8ZA 4CZMA 1YJNN 2W42A 1S6QA 4AHRA 1WBDA 4PL8A 3ZETB 3CETA 3IAYA 3G10A 2BDPA 3VQPA 1JXBA 3MN9A 4IJNA 1ATSA 4E7HA 3GBTA 4DV6K 4DQRA 2FSJA 2OYQA 4M63C 3QEIA 3FGUA 4CGJA 3MWTA 4EAHD 4FM0A 2O8DB 2P9KB 4DWIA 1HJOA 3AO1A 3SUQA 3J81O 2YI1A 3VETA 4BC3A 3WNHA 3QINA 4W5RA 3QIOA 3RMCA 4CECA 3TU5A 4OKJA 5FPEA 2P9SA 3CQ8A 3VQ6A 5KI6A 3EE9A 1Y64A 2D0OA 1WBBA 3AARA 3P39A 4Z4EA 2IS3A 2JGUA 1XMOK 4LSLA 5EXWA 2Q1NA 1BCOA 4JI1K 3HOSA 4LF8K 4FLVA 1NJWA 2ASMA 4KAZA 3ITHA 3LALA 1VHXA 1K9MO 1UA0A 1HNWK 3UIQA 4BVPA 3NDKA 3KKRA 5AFUA 1L3VA 3L2UA 4Z4CA 4CEZA 3HOTA 1RTIA 1KRPA 2O8FB 4BRFA 2HBJA 4BROA 3F9KA 2IIRA 3QNOA 2OPPA 3CFRA 1T03A 5I42A 3K9JA 3RSEB
chains in the Genus database with same CATH topology
4JRPA 3DMJA 3DRRA 4HVJA 3OYCA 3V9XA 2RPIA 2ITGA 4CHOA 4DQQA 4FZXC 4W5NA 2HNZA 3SJJA 1Z25A 4M45A 4CGIA 4DLEA 4GVMA 2XHBA 4CCHA 2RN2A 3V1RA 2VG7A 2RF2A 4B8AB 2ETJA 2FBVA 3LZIA 3LDSA 3A2FA 1BI4A 3AA4A 1KVAA 4N41A 4GW6A 3SQ4A 3L2VA 1QQCA 1WN7A 3M8SA 3F73A 4CJKA 1F21A 3DYAA 3KLGA 2G8IA 4E7IA 4DTSA 1WSIA 3HT3A 3OYGA 2G8VA 4B9TA 4NCBA 3VQ7A 1NK4A 5SZTA 1C1AA 4O0IA 1S1UA 1K6YA 4HUFA 1LW2A 2LSNA 4HCCA 4H8KA 4CK1A 4FJHA 1KLNA 4KHSA 4M42A 1IKYA 5FRMA 4ELTA 3VQ4A 4DS5A 4KHQA 4M3YA 1HQEA 3C6UA 2YNIA 1JLCA 3C94A 4N47A 4FJ9A 1LWFA 3M8RA 3V4IA 4FJLA 3SCXA 4E1NA 1TAUA 4OJRA 2OPQA 1BGXT 1UOCA 1NK7A 3MEGA 3L2RA 4M3WA 1NJYA 2DFEA 2IDOA 4ZHRA 1D5AA 1O1WA 3ZT3A 2HHUA 1GOCA 5KRSA 4BDYA 1S9GA 2HNYA 1BIUA 4FZYA 2YNFA 4O0JA 4BWJA 1DTQA 3C6TA 2XY8A 1S1VA 3VQ9A 3SV3A 2Z1GA 4CIEA 4JRQA 3HPGA 1D8YA 4EZ9A 2HHVA 1ZBHA 3S3NA 3NFAA 1DTTA 3ZT1A 3SYZA 1KVCA 3AVAA 4DMNA 3OYMA 1RCHA 1JL1A 3SQ1A 1X9WA 4FLTA 4KHWA 2QKKA 4F3TA 2D5RA 2FC0A 1L3SA 5FDLA 2OA8A 4BDPA 3OJUA 2GBZA 2XY7A 4FK4A 4QCLA 1TKTA 1VK0A 4J2BA 3V9WA 4K8XA 4FK2A 3VQ8A 4DLGA 4BWMA 3RRHA 3VQ5A 3LP2A 3NH1A 3PX4A 4B9SA 4Z4IA 2VG5A 1S9EA 1S1XA 3DOKA 3RRGA 3DLHA 3LP0A 1RT3A 4AHUA 2F8SA 1VSKA 4B9UA 1C0TA 1CXUA 4OLBA 4CJWA 5CZ1A 4B08A 3LPUA 1QTMA 1QSYA 3HK2A 1VSFA 4KFBA 2YV0X 3DLGA 3VN5A 3D0PA 1TGOA 2OPRA 3B6OA 1NK5A 4CF9A 1NK9A 4L8RB 4MFBA 3NF7A 3ZSOA 4RW8A 2EHGA 4NCGA 1TK0A 1FK9A 2KW4A 3SQ0A 4DTMA 1RDBA 3U3GA 4F8RA 1UWBA 3OYEA 1S1TA 1Y97A 3TAQA 4DTXA 2YNGA 2P51A 3SZ2A 3S9HA 3NHGA 3OY9A 3TR8A 3WNFA 4J2EA 1UA1A 4M3TA 3OYBA 3AO4A 3CFOA 3THVA 4LD0A 4CJ4A 3QESA 1VSLA 3QNNA 3TARA 4CJ5A 1NK6A 3VQQA 2VWJA 1B9FA 3L3VA 1SKSA 4O4GA 1TL1A 3L2QA 4IG3A 4F3OA 4HCBA 2PZSA 4I2QA 2B4JA 4JS4A 3H08A 3P1GA 3IRXA 2XRIA 3KLHA 2E4LA 3HYFA 3AVLA 5HP1A 4HTUA 4M3UA 4OKEA 2HNDA 4BE0A 3TAEA 1SV5A 1WLJA 3KD5E 2P1JA 4C8LA 2HHQA 4KKOA 4RW7A 5E41A 5JS1A 1I3AA 4KTQA 1U49A 3KLIA 4DU3A 1RILA 4CJFA 4CF8A 4CJSA 4N56A 3OYAA 4DSEA 1U47A 1NKEA 4Q0BA 4KHYA 3PUFA 3ZSRA 1KFSA 2DTUA 4FJXA 3D45A 3K5OA 4N76A 3K57A 1IKVA 1ASWA 4DSKA 5DK5A 2E6MA 3SUPA 3DLKA 3KD1E 1LAWA 1S1WA 5HLFA 3K58A 3DI6A 3C95A 3VA0A 4B9LA 2BANA 1RBVA 4DG1A 1X9SA 4KHNA 1J5OA 3HVTA 1T7PA 2KFNA 1KFDA 1SUQA 3K5MA 4C8KA 4ID5A 4IKFA 1TK5A 4CFBA 4CJUA 4ICLA 3VA3A 4J2AA 1SL1A 3ULDA 1HYSA 1HYVA 3AO2A 3I0RA 3RTVA 4DFJA 4ZTJA 4H4OA 2BE2A 3EYZA 3RMDA 3NGYA 4OKKA 4M41A 3SNNA 4AHVA 3PO5A 1L3UA 4I9QA 1C0UA 3DM2A 3FFIA 3HP6A 4W5TA 4HHTA 3QERA 3I8DA 3K5LA 3NH2A 4Y1DA 4FJGA 4YFUA 4BACA 3VQAA 3HO1A 1CLQA 4Z0UA 4CFCA 3AO3A 4CEFA 5I3UA 2QK9A 2PYLA 2KZZA 1J9AA 4CJRA 4DFPA 3RMAA 3OYHA 2P5GA 4YNQA 4CERA 1G15A 3VQBA 3L2WA 3BGRA 3RWUA 1A5WA 1C6VA 1W9HA 1VRUA 4OVLA 3QLHA 1D9DA 1VSEA 1BISA 4M3RA 3T1AA 2IGIA 2Z1HA 3TWHA 3V81A 2JLEA 2XO7A 3PY8A 4DSLA 1S6PA 3V1OA 2DFHA 4KPYA 4FM1A 2VWKA 4FVMA 5SWMA 3V9ZA 3RR7A 4FJKA 1ZBIA 4Z4HA 3SV4A 3QEVA 4E0DA 2KFZA 1QE1A 4Q5VA 5KTQA 4E1MA 2ZQBA 1TV6A 3IG1A 2QXFA 4B9NA 1RDAA 2ZD1A 4IBNA 1I39A 3ALYA 1HYZA 3AVMA 4KO0A 1QS4A 3QEWA 2Y1IA 3SI6A 5C42A 1NKCA 4FJ7A 2HHSA 4I7FA 4ID1A 3T3FA 4IG0A 4FJNA 1ZBLA 5C25A 3M8PA 4RG8A 3ZCMA 5HRSA 3ZSZA 4CHPA 1Q9XA 1C0MA 4CIFA 4CEDA 3TABA 3AV9A 3CG7A 2XY6A 4DS4A 1RNHA 3AVHA 3ZT2A 5HRNA 1ITGA 1YT3A 1HNVA 2D0CA 3T19A 2GV9A 4CF0A 4CGGA 4BE1A 4OPJA 1C1CA 1BQNA 4O5BA 5J2MA 1JLQA 1BQMA 1EKEA 3LPTA 3ZSYA 3ZSQA 1WSHA 2G8HA 4QOZB 4EP5A 3K59A 3U3YA 3EZ5A 2HHTA 4FLWA 3S3OA 1U04A 1U48A 4B9MA 2OZMA 1C1BA 3E01A 3LP3A 4DTNA 1XI1A 4FK0A 4AHSA 4CGDA 3DRPA 3DLRA 3SPZA 4IFVA 3PX6A 1U4BA 1B9DA 4NCAA 1T05A 1N6QA 1QHTA 2HB5A 3CFPA 3DLEA 5FROA 3NGIA 4R5PA 1EETA 2ATQA 1ZYQA 1RTDA 3S3MA 3HJFA 3HPHA 1SKRA 3MECA 3AA3A 4DTOA 3PX0A 5CYMA 4KB0A 3MXJA 1VSJA 1RBTA 4OLAA 3M8QA 1NJZA 4PWDA 4DFMA 3AVJA 2HVHA 3LWLA 4KB1A 4CESA 4KTWA 4E7KA 4DQPA 2YKNA 1IKWA 4CJLA 3LANA 3OS1A 1L3TA 1JLEA 1WSGA 3WNGA 1S5JA 1TKXA 2A1RA 2F96A 2WONA 4BE2A 1NK8A 2HHXA 1RDCA 2YKMA 4CJ3A 2HMIA 2EX3A 2X74A 1CZBA 4CEBA 1KTQA 2X6NA 1XHXA 4FLXA 1QSSA 2B5JA 3KLFA 4FJ8A 1BIZA 5D3GA 3NF8A 1ZBFA 1WSEA 3LAKA 3KK1A 4DQSA 2G8UA 5KGXA 3OS0A 4FM2A 1A5XA 4AHTA 2X78A 3ISNC 4CHYA 5J2PA 2IOCA 4OPKA 3DOLA 3HXMA 1XC9A 4HUGA 4FJIA 3HSTB 1FKPA 3ASMA 5HBMA 3CYMA 3AO5A 1HMVA 2Z1IA 5J2NA 3OYJA 3KJVA 2AJQA 2D0AA 1CZ9A 1NOZA 4FYDA 4DF4A 1TAQA 3L3UA 3NE6A 5FRNA 1MU2A 1BI4B 1JKHA 4C8NA 4KHUA 2NUBA 3AVIA 1X1PA 3OYFA 4H4MA 4CE9A 5KRTA 1HPZA 4FCYA 1TL3A 1WSFA 1XWLA 5J1EA 1TVRA 3OYNA 1R0AA 1TKDA 1SL0A 1HQUA 4CFAA 4PY5A 3HPOA 3KK3A 2A1SA 5T7BA 3PO4A 2PY5A 3PV8A 4JS5A 4CHNA 2B6AA 2Z1JA 1XHZA 4J2DA 4M3XA 1LWEA 3DRSA 3V9SA 4Y1CA 3DLBA 3AVBA 1ASUA 4KI4A 4M3ZA 4KV8A 4ELVA 3HL8A 4CJPA 4OGCA 3TAFA 4WE1A 3G0ZA 5CY4A 3JSMA 2PYJA 3O3HA 4CEEA 3SQ2A 1IG9A 2QKBA 4PQUA 4FZZA 3O4NA 3V1QA 3AA2A 2VG6A 3OYLA 4DU4A 1RBSA 4FW1A 3V6DA 1W0HA 1KLMA 1ZBUA 4N5SA 3AVNA 2Q3SA 4KREA 3ZSWA 4CJQA 3B6PA 4CJVA 3AA5X 4HUEA 1QSLA 1Z26A 3TAGA 3NH0A 1BL3A 1B92A 1UAXA 3WNEA 4DFKA 4RW4A 1KSPA 3QO9A 3MXIA 4O55A 4DTPA 4F2RA 4FJJA 4MQ3A 1KVBA 3O3FA 3OS2A 4CEAA 1SKWA 4B9VA 4DSIA 2F8TA 3LZJA 4CHQA 4PA1A 3CM6A 4NYFA 1HRHA 4AHCA 2R7YA 4E7LA 4CF2A 5CZ2A 4CGFA 4E19A 2X6SA 4W5OA 1RT6A 2FBYA 1RTHA 5CYQA 1JLBA 4I2PA 4GMJB 5DMRA 3O3GA 4F2SA 4PUOA 4B3OA 2DY4A 1GOAA 2O4IA 1GOBA 2YHBA 4DTUA 1WNSA 2G8KA 4I9LA 3VQEA 4RW9A 4E89A 3K2PA 3KK2A 1SL2A 1EXQA 4DU1A 1LWCA 2FBXA 3LWMA 4B8CA 3U6FA 4NYNA 4FJ5A 4AH9A 3ZSVA 1N5YA 1HNIA 1FKOA 5HRRA 3LP1A 3IS9A 4KTZA 4CGHA 2G8WA 3ZSXA 4BDZA 3P5JA 4C8OA 2GUIA 2Y1JA 4CHZA 3P83D 5JS2A 4ZTFA 4OGEA 4XIUA 1U45A 4K8ZA 3OYIA 4CF1A 4CJTA 1RT5A 3MAQA 3HP9A 3NAEA 3MXMA 2BGGA 3TAMA 1DLOA 1VSHA 1BHLA 1TKZA 3MEEA 1S6QA 2W42A 4F4KA 5C24A 4AHRA 2OZSA 2HW3A 1IKXA 1IO2A 3MEDA 3IAYA 3G10A 4UQGA 2BDPA 1RBUA 2P5OA 1EX4A 3VQPA 1JXBA 3TI0A 4CEOA 1YTAA 4CFDA 4E7HA 3NCIA 3NBPA 1YVUA 1T8EA 1RT1A 2KTQA 1JXEA 1JLFA 3QETA 4KRFA 2YHAA 4DQRA 4ELUA 2I5JA 4EP4A 1RDDA 3NF6A 4QAGA 4E7JA 4CK3A 2OYQA 4C8MA 5HROA 1RBRA 3KIOA 3QEIA 1LV5A 3KTQA 2IAJA 4LY7A 4DSFA 2HVIA 1HJRA 4CGJA 1REVA 4AILC 4LSNA 4Z4GA 3AVFA 3SUOA 4FM0A 4FLUA 3K5NA 3KLEA 1A5VA 3AVGA 5EU7A 4FJMA 1VSDA 4DWIA 3CM5A 2RKIA 4DF8A 4DSJA 1J54A 3I0SA 1LAVA 3SUNA 4IFYA 4Z4FA 4O44A 5HRPA 4G1QA 3AO1A 3SUQA 4CEQA 3KKSA 3VQDA 3EY1A 1EP4A 1JLGA 3OVNA 2E6LA 5KGWA 3WNHA 3QINA 4RW6A 4W5RA 1WAJA 1FXXA 3QIOA 3RMCA 4CECA 4FXDA 1RT2A 4LH5A 4OKJA 2DFFA 3NF9A 1CXQA 4IDKA 3CQ8A 1L5UA 3VQ6A 5KI6A 1TK8A 1WSJA 4FW2A 3TANA 1JLAA 3VQCA 2IS3A 2JGUA 4KI6A 4Z4EA 4CK2A 2IC3A 4E3SA 3JYTA 4EZ6A 4LSLA 3NGZA 3OJSA 1ASVA 5J2QA 2XY5A 4DQIA 3QIPA 4JLHA 1BCOA 3ZT4A 4CJEA 1RT4A 1KCFA 1D9FA 1RTJA 4DTRA 3RMBA 4DTJA 4FLYA 1NJXA 3LAMA 1IH7A 4FLVA 1NJWA 2HHWA 2WOMA 1NK0A 4LH4A 3ITHA 3LALA 1X9MA 1VSIA 3O4QA 1VSMA 1UA0A 4KAZA 3L8BA 2YNHA 1NKBA 2O4GA 1Q8IA 1RT7A 4W5QA 3UIQA 3SPYA 3HM9A 3TAPA 3NDKA 3RR8A 3KKRA 3OYDA 4CIGA 3L2UA 1WAFA 4TSXA 4Z4CA 3QEXA 1L3VA 1NOYA 2D0BA 3ZT0A 2KQ2A 3AVKA 4CEZA 3BDPA 2KZMA 1YTUA 5K14A 1BCMA 1J53A 1JL2A 1RTIA 1KRPA 2G8FA 1LW0A 3AVCA 3OYKA 3F9KA 3QNOA 2FBTA 2OPPA 3HVRA 3CFRA 3QEPA 1T03A 1VRTA 1Q9YA 2OPSA 5I42A 3V9UA 2ZE2A 4FLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRP A;  3DMJ A;  3DRR A;  4HVJ A;  3OYC A;  3V9X A;  2RPI A;  2ITG A;  4CHO A;  4DQQ A;  4FZX C;  4W5N A;  2HNZ A;  3SJJ A;  1Z25 A;  4M45 A;  4CGI A;  4DLE A;  4GVM A;  2XHB A;  4CCH A;  2RN2 A;  3V1R A;  2VG7 A;  2RF2 A;  4B8A B;  2ETJ A;  2FBV A;  3LZI A;  3LDS A;  3A2F A;  1BI4 A;  3AA4 A;  1KVA A;  4N41 A;  4GW6 A;  3SQ4 A;  3L2V A;  1QQC A;  1WN7 A;  3M8S A;  3F73 A;  4CJK A;  1F21 A;  3DYA A;  3KLG A;  2G8I A;  4E7I A;  4DTS A;  1WSI A;  3HT3 A;  3OYG A;  2G8V A;  4B9T A;  4NCB A;  3VQ7 A;  1NK4 A;  5SZT A;  1C1A A;  4O0I A;  1S1U A;  1K6Y A;  4HUF A;  1LW2 A;  2LSN A;  4HCC A;  4H8K A;  4CK1 A;  4FJH A;  1KLN A;  4KHS A;  4M42 A;  1IKY A;  5FRM A;  4ELT A;  3VQ4 A;  4DS5 A;  4KHQ A;  4M3Y A;  1HQE A;  3C6U A;  2YNI A;  1JLC A;  3C94 A;  4N47 A;  4FJ9 A;  1LWF A;  3M8R A;  3V4I A;  4FJL A;  3SCX A;  4E1N A;  1TAU A;  4OJR A;  2OPQ A;  1BGX T;  1UOC A;  1NK7 A;  3MEG A;  3L2R A;  4M3W A;  1NJY A;  2DFE A;  2IDO A;  4ZHR A;  1D5A A;  1O1W A;  3ZT3 A;  2HHU A;  1GOC A;  5KRS A;  4BDY A;  1S9G A;  2HNY A;  1BIU A;  4FZY A;  2YNF A;  4O0J A;  4BWJ A;  1DTQ A;  3C6T A;  2XY8 A;  1S1V A;  3VQ9 A;  3SV3 A;  2Z1G A;  4CIE A;  4JRQ A;  3HPG A;  1D8Y A;  4EZ9 A;  2HHV A;  1ZBH A;  3S3N A;  3NFA A;  1DTT A;  3ZT1 A;  3SYZ A;  1KVC A;  3AVA A;  4DMN A;  3OYM A;  1RCH A;  1JL1 A;  3SQ1 A;  1X9W A;  4FLT A;  4KHW A;  2QKK A;  4F3T A;  2D5R A;  2FC0 A;  1L3S A;  5FDL A;  2OA8 A;  4BDP A;  3OJU A;  2GBZ A;  2XY7 A;  4FK4 A;  4QCL A;  1TKT A;  1VK0 A;  4J2B A;  3V9W A;  4K8X A;  4FK2 A;  3VQ8 A;  4DLG A;  4BWM A;  3RRH A;  3VQ5 A;  3LP2 A;  3NH1 A;  3PX4 A;  4B9S A;  4Z4I A;  2VG5 A;  1S9E A;  1S1X A;  3DOK A;  3RRG A;  3DLH A;  3LP0 A;  1RT3 A;  4AHU A;  2F8S A;  1VSK A;  4B9U A;  1C0T A;  1CXU A;  4OLB A;  4CJW A;  5CZ1 A;  4B08 A;  3LPU A;  1QTM A;  1QSY A;  3HK2 A;  1VSF A;  4KFB A;  2YV0 X;  3DLG A;  3VN5 A;  3D0P A;  1TGO A;  2OPR A;  3B6O A;  1NK5 A;  4CF9 A;  1NK9 A;  4L8R B;  4MFB A;  3NF7 A;  3ZSO A;  4RW8 A;  2EHG A;  4NCG A;  1TK0 A;  1FK9 A;  2KW4 A;  3SQ0 A;  4DTM A;  1RDB A;  3U3G A;  4F8R A;  1UWB A;  3OYE A;  1S1T A;  1Y97 A;  3TAQ A;  4DTX A;  2YNG A;  2P51 A;  3SZ2 A;  3S9H A;  3NHG A;  3OY9 A;  3TR8 A;  3WNF A;  4J2E A;  1UA1 A;  4M3T A;  3OYB A;  3AO4 A;  3CFO A;  3THV A;  4LD0 A;  4CJ4 A;  3QES A;  1VSL A;  3QNN A;  3TAR A;  4CJ5 A;  1NK6 A;  3VQQ A;  2VWJ A;  1B9F A;  3L3V A;  1SKS A;  4O4G A;  1TL1 A;  3L2Q A;  4IG3 A;  4F3O A;  4HCB A;  2PZS A;  4I2Q A;  2B4J A;  4JS4 A;  3H08 A;  3P1G A;  3IRX A;  2XRI A;  3KLH A;  2E4L A;  3HYF A;  3AVL A;  5HP1 A;  4HTU A;  4M3U A;  4OKE A;  2HND A;  4BE0 A;  3TAE A;  1SV5 A;  1WLJ A;  3KD5 E;  2P1J A;  4C8L A;  2HHQ A;  4KKO A;  4RW7 A;  5E41 A;  5JS1 A;  1I3A A;  4KTQ A;  1U49 A;  3KLI A;  4DU3 A;  1RIL A;  4CJF A;  4CF8 A;  4CJS A;  4N56 A;  3OYA A;  4DSE A;  1U47 A;  1NKE A;  4Q0B A;  4KHY A;  3PUF A;  3ZSR A;  1KFS A;  2DTU A;  4FJX A;  3D45 A;  3K5O A;  4N76 A;  3K57 A;  1IKV A;  1ASW A;  4DSK A;  5DK5 A;  2E6M A;  3SUP A;  3DLK A;  3KD1 E;  1LAW A;  1S1W A;  5HLF A;  3K58 A;  3DI6 A;  3C95 A;  3VA0 A;  4B9L A;  2BAN A;  1RBV A;  4DG1 A;  1X9S A;  4KHN A;  1J5O A;  3HVT A;  1T7P A;  2KFN A;  1KFD A;  1SUQ A;  3K5M A;  4C8K A;  4ID5 A;  4IKF A;  1TK5 A;  4CFB A;  4CJU A;  4ICL A;  3VA3 A;  4J2A A;  1SL1 A;  3ULD A;  1HYS A;  1HYV A;  3AO2 A;  3I0R A;  3RTV A;  4DFJ A;  4ZTJ A;  4H4O A;  2BE2 A;  3EYZ A;  3RMD A;  3NGY A;  4OKK A;  4M41 A;  3SNN A;  4AHV A;  3PO5 A;  1L3U A;  4I9Q A;  1C0U A;  3DM2 A;  3FFI A;  3HP6 A;  4W5T A;  4HHT A;  3QER A;  3I8D A;  3K5L A;  3NH2 A;  4Y1D A;  4FJG A;  4YFU A;  4BAC A;  3VQA A;  3HO1 A;  1CLQ A;  4Z0U A;  4CFC A;  3AO3 A;  4CEF A;  5I3U A;  2QK9 A;  2PYL A;  2KZZ A;  1J9A A;  4CJR A;  4DFP A;  3RMA A;  3OYH A;  2P5G A;  4YNQ A;  4CER A;  1G15 A;  3VQB A;  3L2W A;  3BGR A;  3RWU A;  1A5W A;  1C6V A;  1W9H A;  1VRU A;  4OVL A;  3QLH A;  1D9D A;  1VSE A;  1BIS A;  4M3R A;  3T1A A;  2IGI A;  2Z1H A;  3TWH A;  3V81 A;  2JLE A;  2XO7 A;  3PY8 A;  4DSL A;  1S6P A;  3V1O A;  2DFH A;  4KPY A;  4FM1 A;  2VWK A;  4FVM A;  5SWM A;  3V9Z A;  3RR7 A;  4FJK A;  1ZBI A;  4Z4H A;  3SV4 A;  3QEV A;  4E0D A;  2KFZ A;  1QE1 A;  4Q5V A;  5KTQ A;  4E1M A;  2ZQB A;  1TV6 A;  3IG1 A;  2QXF A;  4B9N A;  1RDA A;  2ZD1 A;  4IBN A;  1I39 A;  3ALY A;  1HYZ A;  3AVM A;  4KO0 A;  1QS4 A;  3QEW A;  2Y1I A;  3SI6 A;  5C42 A;  1NKC A;  4FJ7 A;  2HHS A;  4I7F A;  4ID1 A;  3T3F A;  4IG0 A;  4FJN A;  1ZBL A;  5C25 A;  3M8P A;  4RG8 A;  3ZCM A;  5HRS A;  3ZSZ A;  4CHP A;  1Q9X A;  1C0M A;  4CIF A;  4CED A;  3TAB A;  3AV9 A;  3CG7 A;  2XY6 A;  4DS4 A;  1RNH A;  3AVH A;  3ZT2 A;  5HRN A;  1ITG A;  1YT3 A;  1HNV A;  2D0C A;  3T19 A;  2GV9 A;  4CF0 A;  4CGG A;  4BE1 A;  4OPJ A;  1C1C A;  1BQN A;  4O5B A;  5J2M A;  1JLQ A;  1BQM A;  1EKE A;  3LPT A;  3ZSY A;  3ZSQ A;  1WSH A;  2G8H A;  4QOZ B;  4EP5 A;  3K59 A;  3U3Y A;  3EZ5 A;  2HHT A;  4FLW A;  3S3O A;  1U04 A;  1U48 A;  4B9M A;  2OZM A;  1C1B A;  3E01 A;  3LP3 A;  4DTN A;  1XI1 A;  4FK0 A;  4AHS A;  4CGD A;  3DRP A;  3DLR A;  3SPZ A;  4IFV A;  3PX6 A;  1U4B A;  1B9D A;  4NCA A;  1T05 A;  1N6Q A;  1QHT A;  2HB5 A;  3CFP A;  3DLE A;  5FRO A;  3NGI A;  4R5P A;  1EET A;  2ATQ A;  1ZYQ A;  1RTD A;  3S3M A;  3HJF A;  3HPH A;  1SKR A;  3MEC A;  3AA3 A;  4DTO A;  3PX0 A;  5CYM A;  4KB0 A;  3MXJ A;  1VSJ A;  1RBT A;  4OLA A;  3M8Q A;  1NJZ A;  4PWD A;  4DFM A;  3AVJ A;  2HVH A;  3LWL A;  4KB1 A;  4CES A;  4KTW A;  4E7K A;  4DQP A;  2YKN A;  1IKW A;  4CJL A;  3LAN A;  3OS1 A;  1L3T A;  1JLE A;  1WSG A;  3WNG A;  1S5J A;  1TKX A;  2A1R A;  2F96 A;  2WON A;  4BE2 A;  1NK8 A;  2HHX A;  1RDC A;  2YKM A;  4CJ3 A;  2HMI A;  2EX3 A;  2X74 A;  1CZB A;  4CEB A;  1KTQ A;  2X6N A;  1XHX A;  4FLX A;  1QSS A;  2B5J A;  3KLF A;  4FJ8 A;  1BIZ A;  5D3G A;  3NF8 A;  1ZBF A;  1WSE A;  3LAK A;  3KK1 A;  4DQS A;  2G8U A;  5KGX A;  3OS0 A;  4FM2 A;  1A5X A;  4AHT A;  2X78 A;  3ISN C;  4CHY A;  5J2P A;  2IOC A;  4OPK A;  3DOL A;  3HXM A;  1XC9 A;  4HUG A;  4FJI A;  3HST B;  1FKP A;  3ASM A;  5HBM A;  3CYM A;  3AO5 A;  1HMV A;  2Z1I A;  5J2N A;  3OYJ A;  3KJV A;  2AJQ A;  2D0A A;  1CZ9 A;  1NOZ A;  4FYD A;  4DF4 A;  1TAQ A;  3L3U A;  3NE6 A;  5FRN A;  1MU2 A;  1BI4 B;  1JKH A;  4C8N A;  4KHU A;  2NUB A;  3AVI A;  1X1P A;  3OYF A;  4H4M A;  4CE9 A;  5KRT A;  1HPZ A;  4FCY A;  1TL3 A;  1WSF A;  1XWL A;  5J1E A;  1TVR A;  3OYN A;  1R0A A;  1TKD A;  1SL0 A;  1HQU A;  4CFA A;  4PY5 A;  3HPO A;  3KK3 A;  2A1S A;  5T7B A;  3PO4 A;  2PY5 A;  3PV8 A;  4JS5 A;  4CHN A;  2B6A A;  2Z1J A;  1XHZ A;  4J2D A;  4M3X A;  1LWE A;  3DRS A;  3V9S A;  4Y1C A;  3DLB A;  3AVB A;  1ASU A;  4KI4 A;  4M3Z A;  4KV8 A;  4ELV A;  3HL8 A;  4CJP A;  4OGC A;  3TAF A;  4WE1 A;  3G0Z A;  5CY4 A;  3JSM A;  2PYJ A;  3O3H A;  4CEE A;  3SQ2 A;  1IG9 A;  2QKB A;  4PQU A;  4FZZ A;  3O4N A;  3V1Q A;  3AA2 A;  2VG6 A;  3OYL A;  4DU4 A;  1RBS A;  4FW1 A;  3V6D A;  1W0H A;  1KLM A;  1ZBU A;  4N5S A;  3AVN A;  2Q3S A;  4KRE A;  3ZSW A;  4CJQ A;  3B6P A;  4CJV A;  3AA5 X;  4HUE A;  1QSL A;  1Z26 A;  3TAG A;  3NH0 A;  1BL3 A;  1B92 A;  1UAX A;  3WNE A;  4DFK A;  4RW4 A;  1KSP A;  3QO9 A;  3MXI A;  4O55 A;  4DTP A;  4F2R A;  4FJJ A;  4MQ3 A;  1KVB A;  3O3F A;  3OS2 A;  4CEA A;  1SKW A;  4B9V A;  4DSI A;  2F8T A;  3LZJ A;  4CHQ A;  4PA1 A;  3CM6 A;  4NYF A;  1HRH A;  4AHC A;  2R7Y A;  4E7L A;  4CF2 A;  5CZ2 A;  4CGF A;  4E19 A;  2X6S A;  4W5O A;  1RT6 A;  2FBY A;  1RTH A;  5CYQ A;  1JLB A;  4I2P A;  4GMJ B;  5DMR A;  3O3G A;  4F2S A;  4PUO A;  4B3O A;  2DY4 A;  1GOA A;  2O4I A;  1GOB A;  2YHB A;  4DTU A;  1WNS A;  2G8K A;  4I9L A;  3VQE A;  4RW9 A;  4E89 A;  3K2P A;  3KK2 A;  1SL2 A;  1EXQ A;  4DU1 A;  1LWC A;  2FBX A;  3LWM A;  4B8C A;  3U6F A;  4NYN A;  4FJ5 A;  4AH9 A;  3ZSV A;  1N5Y A;  1HNI A;  1FKO A;  5HRR A;  3LP1 A;  3IS9 A;  4KTZ A;  4CGH A;  2G8W A;  3ZSX A;  4BDZ A;  3P5J A;  4C8O A;  2GUI A;  2Y1J A;  4CHZ A;  3P83 D;  5JS2 A;  4ZTF A;  4OGE A;  4XIU A;  1U45 A;  4K8Z A;  3OYI A;  4CF1 A;  4CJT A;  1RT5 A;  3MAQ A;  3HP9 A;  3NAE A;  3MXM A;  2BGG A;  3TAM A;  1DLO A;  1VSH A;  1BHL A;  1TKZ A;  3MEE A;  1S6Q A;  2W42 A;  4F4K A;  5C24 A;  4AHR A;  2OZS A;  2HW3 A;  1IKX A;  1IO2 A;  3MED A;  3IAY A;  3G10 A;  4UQG A;  2BDP A;  1RBU A;  2P5O A;  1EX4 A;  3VQP A;  1JXB A;  3TI0 A;  4CEO A;  1YTA A;  4CFD A;  4E7H A;  3NCI A;  3NBP A;  1YVU A;  1T8E A;  1RT1 A;  2KTQ A;  1JXE A;  1JLF A;  3QET A;  4KRF A;  2YHA A;  4DQR A;  4ELU A;  2I5J A;  4EP4 A;  1RDD A;  3NF6 A;  4QAG A;  4E7J A;  4CK3 A;  2OYQ A;  4C8M A;  5HRO A;  1RBR A;  3KIO A;  3QEI A;  1LV5 A;  3KTQ A;  2IAJ A;  4LY7 A;  4DSF A;  2HVI A;  1HJR A;  4CGJ A;  1REV A;  4AIL C;  4LSN A;  4Z4G A;  3AVF A;  3SUO A;  4FM0 A;  4FLU A;  3K5N A;  3KLE A;  1A5V A;  3AVG A;  5EU7 A;  4FJM A;  1VSD A;  4DWI A;  3CM5 A;  2RKI A;  4DF8 A;  4DSJ A;  1J54 A;  3I0S A;  1LAV A;  3SUN A;  4IFY A;  4Z4F A;  4O44 A;  5HRP A;  4G1Q A;  3AO1 A;  3SUQ A;  4CEQ A;  3KKS A;  3VQD A;  3EY1 A;  1EP4 A;  1JLG A;  3OVN A;  2E6L A;  5KGW A;  3WNH A;  3QIN A;  4RW6 A;  4W5R A;  1WAJ A;  1FXX A;  3QIO A;  3RMC A;  4CEC A;  4FXD A;  1RT2 A;  4LH5 A;  4OKJ A;  2DFF A;  3NF9 A;  1CXQ A;  4IDK A;  3CQ8 A;  1L5U A;  3VQ6 A;  5KI6 A;  1TK8 A;  1WSJ A;  4FW2 A;  3TAN A;  1JLA A;  3VQC A;  2IS3 A;  2JGU A;  4KI6 A;  4Z4E A;  4CK2 A;  2IC3 A;  4E3S A;  3JYT A;  4EZ6 A;  4LSL A;  3NGZ A;  3OJS A;  1ASV A;  5J2Q A;  2XY5 A;  4DQI A;  3QIP A;  4JLH A;  1BCO A;  3ZT4 A;  4CJE A;  1RT4 A;  1KCF A;  1D9F A;  1RTJ A;  4DTR A;  3RMB A;  4DTJ A;  4FLY A;  1NJX A;  3LAM A;  1IH7 A;  4FLV A;  1NJW A;  2HHW A;  2WOM A;  1NK0 A;  4LH4 A;  3ITH A;  3LAL A;  1X9M A;  1VSI A;  3O4Q A;  1VSM A;  1UA0 A;  4KAZ A;  3L8B A;  2YNH A;  1NKB A;  2O4G A;  1Q8I A;  1RT7 A;  4W5Q A;  3UIQ A;  3SPY A;  3HM9 A;  3TAP A;  3NDK A;  3RR8 A;  3KKR A;  3OYD A;  4CIG A;  3L2U A;  1WAF A;  4TSX A;  4Z4C A;  3QEX A;  1L3V A;  1NOY A;  2D0B A;  3ZT0 A;  2KQ2 A;  3AVK A;  4CEZ A;  3BDP A;  2KZM A;  1YTU A;  5K14 A;  1BCM A;  1J53 A;  1JL2 A;  1RTI A;  1KRP A;  2G8F A;  1LW0 A;  3AVC A;  3OYK A;  3F9K A;  3QNO A;  2FBT A;  2OPP A;  3HVR A;  3CFR A;  3QEP A;  1T03 A;  1VRT A;  1Q9Y A;  2OPS A;  5I42 A;  3V9U A;  2ZE2 A;  4FLZ A; 
#chains in the Genus database with same CATH topology
 1VQ9 N;  5GAE P;  4DQQ A;  3SJJ A;  3HBT A;  4CGI A;  4JNE A;  1Q7Y O;  3LZI A;  3SQ4 A;  5M1O A;  1WN7 A;  4NB4 A;  2G8I A;  1NGE A;  5AZI B;  4BG9 A;  4DTS A;  2G8V A;  3HT3 A;  3OYG A;  1H1V A;  2UU9 K;  4O0I A;  4LFA K;  1OH7 A;  1K6Y A;  2NRR A;  4H0T B;  2WFB A;  5FRM A;  1KLN A;  3A5O C;  3H3N O;  1JCE A;  3C94 A;  4FJ9 A;  4FJL A;  4JHD A;  3SCX A;  3VEZ A;  2OPQ A;  1NK7 A;  5FLX O;  2DFE A;  2IDO A;  3G25 A;  2WTU A;  4JKG A;  5AQX A;  3D2F B;  4BG8 A;  2HBK A;  5M1Q A;  4CZH A;  3SV3 A;  4CIE A;  5I9E B;  3CD6 N;  4BC2 A;  2HHV A;  1KVC A;  2BH1 A;  3AVA A;  5AFU H;  3OYM A;  5KPZ A;  5JIC A;  3SQ1 A;  3VTH A;  4JAX A;  4F3T A;  2VQE K;  4FK4 A;  2GBZ A;  1G99 A;  5E84 A;  1TKT A;  1W7A A;  1VK0 A;  1VQP N;  4MO5 A;  3BF1 A;  5HL7 L;  1ESV A;  1JJ2 M;  2VGN A;  3R8E A;  3DLH A;  3MK6 A;  3WXL A;  3TSP A;  5CZ1 A;  3S41 A;  3LPU A;  2P9I A;  4KFB A;  1NK9 A;  1NK5 A;  3B6O A;  1GLC G;  3ZSO A;  4NXM K;  4RW8 A;  1U2V B;  4DTM A;  1RDB A;  3KWG A;  3DJC A;  3OYE A;  3ULE A;  1Y97 A;  3TAQ A;  1J5E K;  4FVU A;  3CPE A;  2YNG A;  3WNF A;  3OYB A;  3CI5 A;  4WQ4 A;  4CJ4 A;  1NK6 A;  1B9F A;  4BRL A;  2Q2R A;  3IRX A;  2P9K A;  4OKE A;  1MDU B;  5AQI A;  5EY4 A;  3TAE A;  1SV5 A;  3UKR B;  2P1J A;  3WXJ A;  4LF7 K;  1NNE A;  1NGH A;  3C65 A;  4KTQ A;  2CGK A;  3KLI A;  4DU3 A;  4H0O A;  4CJF A;  3ZEU A;  4CJS A;  4N56 A;  3E1Y A;  3EEQ A;  1EWR A;  3K5O A;  1IKV A;  2FF3 B;  2ZGY A;  3L0Q A;  3MX5 A;  3KD1 E;  2E6M A;  3GDQ A;  4YY3 K;  3CCV N;  3SUP A;  1EQY A;  5HLF A;  3K58 A;  2KLA A;  3DI6 A;  3CCS N;  3TSU A;  2BAN A;  2KFN A;  2WUS A;  1TK5 A;  1HPM A;  4CFB A;  5IT9 O;  1DKG D;  3ULD A;  3W3D A;  4DFJ A;  1GLF O;  4H4O A;  5FRN A;  3QER A;  3DXM B;  3NMU A;  3AAQ A;  1T44 A;  3NH2 A;  3THW B;  4Y1D A;  3AO3 A;  2PYL A;  2O8F A;  3L2W A;  2A40 A;  1W9H A;  1KAY A;  4M3R A;  3O1W A;  3V81 A;  4B3R K;  3G71 N;  3O1B A;  4B9Q A;  1MA9 B;  5A2Q O;  3SV4 A;  1V4T A;  4E0D A;  4E1M A;  2O8B B;  3ZX2 A;  1RDA A;  2ZD1 A;  5AZI A;  1DGK N;  1I39 A;  4KO0 A;  1HYZ A;  3PIO L;  3CC4 N;  4FJ7 A;  3QDK A;  3MWP A;  1OH5 A;  2HHS A;  1ZBL A;  2FXU A;  2QXL A;  3M8P A;  3ZCM A;  5HRS A;  1NGB A;  3CG7 A;  4IXC A;  1NG9 A;  4JKH A;  2E2P A;  3F5T A;  5HRN A;  1MWM A;  1J6Z A;  4E1J A;  1NGD A;  4JYA K;  3KWI A;  4KHP K;  1EKE A;  3LPT A;  3BUZ B;  5B8H A;  3ZSQ A;  2G8H A;  2I7N A;  2P9N B;  4B1V A;  3K9K A;  3FLC O;  1U48 A;  4B9M A;  2OZM A;  3DRP A;  3DLR A;  4B1W B;  3PX6 A;  1B9D A;  2V7Z A;  4NCA A;  4BRE A;  2O8C B;  1QHT A;  2HB5 A;  1BG3 A;  2OAN A;  4PKI A;  5LJW A;  3NGI A;  2ASO A;  1ZYQ A;  4M7X A;  3HJF A;  3MEC A;  1KQS M;  3FZF A;  3MXJ A;  4OLA A;  4WFN L;  4K0K K;  4QS7 A;  5EVZ A;  4CES A;  4E7K A;  1E4F T;  3N4Q A;  1L3T A;  3WNG A;  4FWS A;  1S5J A;  4BE2 A;  2YKM A;  1HNX K;  1HR0 K;  2X74 A;  1KTQ A;  4CBW A;  2B5J A;  4HTL A;  3C7N A;  3KLF A;  1BIZ A;  2D0P A;  3O9R A;  1A5X A;  4H5R A;  4CHY A;  1VQ4 N;  4OPK A;  4HUG A;  1GLE G;  2NLX A;  2Z1I A;  2AJQ A;  1CZ9 A;  1QVG M;  2HST A;  1T3V A;  3L3U A;  4A61 A;  4KH5 A;  3OYF A;  1HPZ A;  4FCY A;  4G9Z A;  1YUW A;  2ZGZ A;  5AQQ A;  3P31 A;  3HPO A;  3KK3 A;  3O6W A;  1Z05 A;  1FJG K;  1XHZ A;  4M3X A;  4Y1C A;  2BTF A;  1K8K A;  3UKR A;  4XH5 A;  3G0Z A;  5CY4 A;  1IG9 A;  3CCQ N;  3SBG A;  5GIN A;  4FZZ A;  4WQ5 C;  3UE5 A;  2AA4 A;  3GG4 A;  4FW1 A;  5GAH P;  1W0H A;  3V6D A;  1VQK N;  4FWM A;  4JK7 A;  4A57 A;  1M90 O;  2VYP A;  5AQZ A;  3B6P A;  5GAD P;  4HUE A;  1QSL A;  3TAG A;  5FPD A;  1B92 A;  1UAX A;  4DFK A;  5ADX A;  3QO9 A;  4DTP A;  4MQ3 A;  3A5L C;  4CEA A;  4DSI A;  1KXP A;  3LZJ A;  2F8T A;  4PA1 A;  1HRH A;  4CGF A;  3WT0 A;  2X6S A;  2D1K A;  4W5O A;  3DXM A;  5CYQ A;  4PUO A;  3THW A;  2YHB A;  4DTU A;  2G8K A;  3KK2 A;  4DR2 K;  1EXQ A;  1LWC A;  2FBX A;  4K42 A;  4GVE A;  1IBM K;  3VEW A;  1N5Y A;  1HNI A;  4CZF A;  3B8A X;  5BPN A;  3P5J A;  1NBW A;  4JKD A;  1ZXO A;  3OYI A;  4CJT A;  3WEE A;  2BGG A;  4YDU A;  3TAM A;  2O8B A;  1BHL A;  1TKZ A;  2KKZ A;  5AQG A;  2UXD K;  1W2B M;  4F4K A;  5C24 A;  3F2K A;  2GWK A;  2Q0U A;  1IO2 A;  3EE8 A;  1EX4 A;  3TI0 A;  2ZF5 O;  3WXI A;  4CEO A;  3O80 A;  3FR0 A;  1RT1 A;  1JXE A;  3QET A;  1YVN A;  1RDD A;  2A41 A;  2FSN A;  1LV5 A;  3KTQ A;  2IAJ A;  2EWS A;  4LY7 A;  4DSF A;  2HVI A;  1HJR A;  1REV A;  4Z4G A;  3AVF A;  2GUP A;  1X9J A;  4FLU A;  4FJM A;  5EU7 A;  4DV3 K;  1VSD A;  4JKF A;  5ADX H;  4DF8 A;  4JI4 K;  4CVN E;  3I0S A;  1LAV A;  4IFY A;  4G1Q A;  3U8X A;  4LF5 K;  4PKG A;  3CER A;  3LDL A;  1EP4 A;  3OVN A;  1FXX A;  4DR4 K;  3HSC A;  2HHH K;  1M1K O;  4IDK A;  1TK8 A;  5KQ8 A;  2VWB A;  2QI2 A;  3JYT A;  3OJS A;  3CHW A;  3QIP A;  3M6G A;  4A2B A;  3ZT4 A;  5KQD A;  3RMB A;  4DTJ A;  1HKB A;  1IH7 A;  2HHW A;  4DUY K;  2WOM A;  4DV4 K;  4LH4 A;  4BRM A;  3MCP A;  5FPN A;  4YOV A;  3AAP A;  2YNH A;  3H1Q A;  3RR8 A;  1BDG A;  5GIO A;  3OYD A;  3QEX A;  4TSX A;  1XC3 A;  1NGI A;  2KQ2 A;  3BDP A;  1BWF O;  1YTU A;  5K14 A;  1BCM A;  1J53 A;  2G8F A;  2FLO A;  5AQU A;  4CBU A;  1T6C A;  5GAG P;  3VEX A;  3DLL L;  5H1S Q;  1VRT A;  1KAZ A;  4BY9 C;  2Z1H A;  4JRP A;  3DMJ A;  3DRR A;  2OTJ N;  3WXK A;  2O8E A;  4FOE A;  4CHO A;  2HNZ A;  2YJE A;  4JKG B;  2ZJR L;  3FE1 A;  4CCH A;  2RN2 A;  2CGL A;  3V1R A;  2VG7 A;  2RF2 A;  1KVA A;  4N41 A;  1QQC A;  5JMV A;  3M8S A;  3F73 A;  4JI0 K;  3KLG A;  4JKC A;  1WSI A;  2F7T A;  3VQ7 A;  4EHT A;  5SZT A;  4DHY A;  4HUF A;  4A5A A;  1XNQ K;  4H8K A;  4KHS A;  4BRG A;  4NXN K;  4ELT A;  1QHA A;  4KHQ A;  1HQE A;  4BRA A;  4X65 K;  4N47 A;  4DR1 K;  3M8R A;  3FFK B;  3IMX A;  3L2R A;  2UXB K;  3MN5 A;  2HHU A;  5KRS A;  2CGJ A;  2HNY A;  3J7Z O;  4O0J A;  1RGI A;  4O8K A;  1DTQ A;  3QBW A;  4AF1 A;  2HBL A;  2Z1G A;  3F9M A;  3EL2 A;  3R6M A;  5JVG L;  3PSI A;  3A8Y A;  2P9I B;  3HPG A;  3MMV A;  4EZ9 A;  1ZBH A;  3NFA A;  3LDN A;  3ZT1 A;  3SYZ A;  4BRK A;  1RCH A;  1JL1 A;  3OW2 M;  3IDH A;  1RDW X;  3ULE B;  2UUB K;  2FC0 A;  4BDP A;  4J2B A;  3V9W A;  3VQ8 A;  4CBX A;  1QZ5 A;  3LP2 A;  3NH1 A;  3CC2 N;  3PX4 A;  2VG5 A;  1S9E A;  4OPH A;  4A2A A;  4JKA A;  1NGC A;  5AQK A;  3EN9 A;  3T1Y K;  1O13 A;  1C0T A;  1SZ2 A;  2RE2 A;  5AZJ B;  4CJW A;  1QTM A;  1VSF A;  4CF9 A;  4WFA L;  3MX2 A;  4L8R B;  4JK9 A;  3CCJ N;  2EHG A;  1P90 A;  4DKW A;  1S1T A;  3ZEU B;  3SZ2 A;  4DV7 K;  3C6A A;  3OA9 A;  3THV A;  4LD0 A;  1VSL A;  2HF4 A;  4CJ5 A;  3L3V A;  4BVO A;  1TL1 A;  3CJC A;  3L2Q A;  4F3O A;  2PZS A;  4CJ7 A;  1OH6 A;  1JCF A;  4JS4 A;  3KLH A;  4HTU A;  3BZC A;  4AM6 A;  2W41 A;  3KD5 E;  4FO0 A;  2P9L B;  1HNZ K;  5M1F A;  4KKO A;  4OPA A;  4BQL A;  1U49 A;  4CF8 A;  3OYA A;  4Q0B A;  4H0X B;  4KHY A;  2A3Z A;  3ZSR A;  4DB3 A;  2DTU A;  3D45 A;  5TKW A;  4MLE A;  3K57 A;  5C15 A;  4B3M K;  5DK5 A;  1LAW A;  1S1W A;  4BQZ A;  1Q82 O;  3VA0 A;  4B9L A;  4DG1 A;  4KHN A;  1SUQ A;  1IJJ A;  4CJU A;  4J2A A;  3EO3 A;  3O9Q A;  3KK7 A;  3FZM A;  4I9Q A;  1L3U A;  4BRQ A;  3DM2 A;  4B1X B;  3K5L A;  3HO1 A;  4LFC K;  1EO1 A;  4Z0U A;  5C10 A;  4CEF A;  2NRW A;  2QK9 A;  3U9Z A;  5AQO A;  5AQM A;  4DFP A;  3VF4 A;  3OYH A;  1G15 A;  3RWU A;  1A5W A;  5C2D A;  3U4L A;  3ENH A;  4FWP A;  1VSE A;  3T1A A;  2IGI A;  4DSL A;  3PY8 A;  4IWV A;  1WUA A;  4FJK A;  2IVP A;  3LL3 A;  1CZA N;  2E1Y A;  4X64 K;  3QEV A;  4Q5V A;  5KTQ A;  3CIP A;  3IKM A;  4BR2 A;  3LDP A;  3ZLJ A;  3T1H K;  4FJN A;  4RG8 A;  3ZSZ A;  1K73 O;  1Q9X A;  2FF6 A;  2A42 A;  4CED A;  3TAB A;  1N33 K;  4AM7 A;  4DS4 A;  4RTF D;  3AVH A;  4DCH A;  3P4I A;  4OPJ A;  1C1C A;  3MN7 A;  1BQN A;  4O5B A;  1JLQ A;  4NLB A;  3VF6 A;  4EP5 A;  1VQ7 N;  3EZ5 A;  3C7N B;  3E01 A;  2YHY A;  4DTN A;  4AHS A;  3SPZ A;  4IFV A;  5KPR A;  2E2N A;  3FZH A;  5FRO A;  5MLC Q;  3CJ9 A;  5LJV A;  4EIA A;  4DTO A;  3CC7 N;  4ILJ A;  5CYM A;  3CJA A;  4KB0 A;  1RBT A;  2QWM A;  4BR0 A;  3M8Q A;  4DR3 K;  3HI0 A;  4BR7 A;  4YOY A;  3P38 A;  4JI5 K;  4WQ4 C;  1IKW A;  4CJL A;  3SAH A;  1JLE A;  1TKX A;  2A1R A;  1RFQ A;  3G6E N;  1RDC A;  1CZB A;  5AZJ A;  4BRD A;  2FSK A;  3R9P A;  3QIC A;  2P9P B;  3BZK A;  3NF8 A;  3LAK A;  1K8K B;  4JI2 K;  4JD2 B;  2X78 A;  3ISN C;  5J2P A;  3HXM A;  1FKP A;  5HBM A;  4DV1 K;  3AO5 A;  3LM9 A;  4X62 K;  5J2N A;  3KJV A;  4FYD A;  1NOZ A;  4DF4 A;  4X66 K;  4BRN A;  1BI4 B;  1JKH A;  3AVI A;  1X1P A;  1IV0 A;  5KRT A;  1WSF A;  1XWL A;  1YI2 N;  1TVR A;  1TKD A;  1SL0 A;  5JLF A;  1HQU A;  3ID8 A;  1RDU A;  3D7E O;  3PV8 A;  3SMP A;  1TUY A;  3QBX A;  3DRS A;  4GV9 A;  1Q86 O;  2P9L A;  3HL8 A;  4CJP A;  4OGC A;  3TAF A;  2QWL A;  4CEE A;  2QKB A;  3O4N A;  1NMD A;  2VG6 A;  3AA2 A;  1C0F A;  4IJA A;  4K41 A;  1RBS A;  1KLM A;  1ZBU A;  4ISG A;  4N5S A;  4M7Y A;  3AA5 X;  2F9W A;  3T7Z A;  3ID6 A;  1KSP A;  3WEE B;  3MXI A;  1N8R O;  1Q81 O;  3O3F A;  3OS2 A;  1SKW A;  4YHH K;  1OH8 A;  4CHQ A;  4E7L A;  3CM6 A;  2PBD A;  4CZJ A;  4CF2 A;  3THX B;  1XMQ K;  5FPM A;  3A5M C;  3BF3 A;  1Q18 A;  4I2P A;  3OBW A;  1GOA A;  1GOB A;  1ATN A;  2YX6 A;  3K2P A;  5BRD A;  2WC9 A;  5C2F A;  2UUA K;  3IS9 A;  2G8W A;  3ZSX A;  3THY B;  5AQL A;  3VEV A;  5F1X A;  2GUI A;  4ZTF A;  1U45 A;  4XIU A;  4BR5 A;  4YOR A;  3H45 C;  3NAE A;  3MXM A;  2YCH A;  1S22 A;  1DLO A;  4L3Q A;  3MEE A;  2GEM A;  3O9S A;  2VCP A;  4DQ8 A;  4B1U B;  3U9D A;  4K43 A;  1BU6 O;  1IKX A;  4GV3 A;  4UQG A;  1VQN N;  1RBU A;  1ILY A;  5AQF A;  3NCI A;  3NBP A;  1YVU A;  1T8E A;  2KTQ A;  3CJB A;  2YHA A;  3WQT A;  4ELU A;  2I5J A;  1NWK A;  3NF6 A;  4QAG A;  4E7J A;  1QQN A;  4CK3 A;  4C8M A;  1RBR A;  4KBO A;  3JS6 A;  4A62 A;  4AIL C;  4LSN A;  2ZJP L;  3AGK A;  3MDQ A;  3K5N A;  4UY8 O;  1A5V A;  2F9T A;  3CM5 A;  2RKI A;  4GNI A;  1J54 A;  3SUN A;  3GOI A;  5HRP A;  3VQD A;  4WF9 L;  1HKG A;  2WBN A;  2E6L A;  4BR9 A;  5DM6 L;  1RT2 A;  4LH5 A;  2DFF A;  3NF9 A;  1CXQ A;  1WSJ A;  4CD3 A;  1R59 O;  4FW2 A;  3TAN A;  1JLA A;  2QWO A;  1ZC6 A;  4KI6 A;  1NGG A;  2O8E B;  4CK2 A;  5AQR A;  4QS9 A;  5J2Q A;  3W0L A;  4JLH A;  4CJE A;  1RT4 A;  2A6A A;  4NLC A;  1RTJ A;  2JWL A;  4FLY A;  2NRH A;  1NK0 A;  3EKU A;  1VSI A;  3O4Q A;  1VSM A;  3L8B A;  1NKB A;  2O4G A;  1RT7 A;  2UUC K;  3WUH A;  3SPY A;  3HM9 A;  3TAP A;  4K25 A;  5BRE A;  4CIG A;  4JKE A;  1NOY A;  2D0B A;  3ZT0 A;  2P9P A;  3AY9 A;  3AVC A;  3UKU A;  1N32 K;  4PKH A;  2E1Z A;  3KHY A;  3HVR A;  4JD2 A;  2QWQ A;  2OPS A;  2E8A A;  2ZE2 A;  3NVK A;  4H0Y B;  3PLA A;  4HVJ A;  4F9O A;  3OYC A;  3V9X A;  2RPI A;  2ITG A;  1VAZ A;  4FSV A;  4FZX C;  1VQL N;  4DLE A;  3EZW A;  2XHB A;  1HUX A;  1BUP A;  3OBY A;  1BI4 A;  4GW6 A;  3ZX0 A;  4O5F A;  3ENO A;  1F21 A;  4CJK A;  3D6R A;  4E7I A;  4B9T A;  1EWQ A;  1NK4 A;  1C1A A;  2LSN A;  4O8U A;  4FJH A;  4CK1 A;  4M42 A;  2ZJQ L;  5BPL A;  4DS5 A;  3C6U A;  2YNI A;  1JLC A;  1LWF A;  3LDQ A;  4IO8 A;  2VQF K;  4V19 S;  1BGX T;  1UOC A;  4RWT A;  4M3W A;  4ZHR A;  1D5A A;  2NRX A;  1O1W A;  3ZT3 A;  3L4Q A;  1BIU A;  2YNF A;  2XY8 A;  3VQ9 A;  4JRQ A;  2NRT A;  2F4V K;  1DTT A;  1NMN A;  3QFP A;  1X9W A;  4YDU C;  4KHW A;  3THX A;  5FDL A;  3CCR N;  3O5B A;  3OJU A;  4QCL A;  5CHI A;  3PSF A;  3LDO A;  4JI6 K;  2P9U A;  4K8X A;  1BOT O;  3RRH A;  1DEJ A;  4B9S A;  5AQS A;  4WFB L;  3RRG A;  3KVG A;  3LP0 A;  1RT3 A;  4AHU A;  3N4P A;  1GLD G;  4BRC A;  5AJ3 K;  1FW6 A;  1VSK A;  4B9U A;  3THY A;  3VES A;  1QSY A;  3VN5 A;  3E9P A;  1TGO A;  3QML A;  4MFB A;  1NGJ A;  3VEY A;  4NCG A;  3U3G A;  5EX5 A;  2UYT A;  4JV5 K;  4DTX A;  3S9H A;  3NHG A;  4PL7 A;  5JVH L;  3OY9 A;  3SBT A;  5AQN A;  4J2E A;  1UA1 A;  3AO4 A;  3TSQ A;  4JN4 A;  3TAR A;  2UXC K;  3VQQ A;  1SKS A;  4O4G A;  2OCE A;  3MN6 A;  4B3T K;  3VER A;  1VQO N;  4HCB A;  2B4J A;  5LL6 Z;  3H08 A;  3P1G A;  3SJH A;  2E4L A;  3AVL A;  4H5V A;  4M3U A;  5M1P A;  2HHQ A;  3I8B A;  4RW7 A;  4BGA A;  1I3A A;  4BC5 A;  2E5L K;  3OTO K;  4DSE A;  2ASP A;  3PUF A;  4FJX A;  2PAV A;  3CJ7 A;  1ASW A;  1NU0 A;  4DUZ K;  1HLU A;  1NGA A;  3C95 A;  2KHO A;  3HVT A;  3K5M A;  4IKF A;  4ID5 A;  2YHX A;  3VA3 A;  1HYS A;  1HYV A;  3AO2 A;  1NGF A;  3I0R A;  3RTV A;  3EYZ A;  2BE2 A;  3SNN A;  4OKK A;  1XNR K;  5GIP A;  3FFI A;  1MWK A;  1QQM A;  3UB5 A;  4W5T A;  3I8D A;  4KH4 A;  5IWA K;  4DV0 K;  5EOY A;  5E26 A;  1NJI O;  3HRG A;  4FJG A;  4YFU A;  4BAC A;  1XUP O;  1CLQ A;  5I3U A;  2KZZ A;  1J9A A;  2BUP A;  4CJR A;  2P5G A;  4CER A;  4MDB A;  1YJW N;  1TUU A;  3ZYY X;  4OVL A;  4DV5 K;  1W97 L;  1S6P A;  3V1O A;  4KPY A;  2VWK A;  4FVM A;  3RR7 A;  3V9Z A;  1YIJ N;  1ZBI A;  4Z4H A;  1LOT B;  3TTF A;  2ZQB A;  2QXF A;  4B9N A;  5ELZ A;  3AVM A;  3CQY A;  3LM2 A;  2Y1I A;  1NKC A;  5C42 A;  2Q36 A;  3CPW M;  5M1N A;  4I7F A;  4IG0 A;  2J4R A;  4H5W A;  4YOT A;  5AQW A;  4CIF A;  3SK3 A;  3AV9 A;  2XY6 A;  1QQO A;  1RNH A;  3ZT2 A;  1ITG A;  1YT3 A;  5AQY A;  1HNV A;  4JEP A;  4FWN A;  4CF0 A;  2GV9 A;  4CGG A;  4BE1 A;  1V4S A;  3ATU A;  5J2M A;  4C1N K;  3ZSY A;  3K59 A;  3U3Y A;  1KC8 O;  4FLW A;  3O08 A;  4ILH A;  3BP8 A;  4WYB A;  5AQV A;  3D2E A;  1XI1 A;  3G4S N;  4CGD A;  3Q7B A;  1T05 A;  4FWL A;  3RVC A;  1N6Q A;  3O9U A;  3CFP A;  3DLE A;  1EET A;  2ATQ A;  4B3S K;  1RTD A;  3R3L A;  1N36 K;  3HPH A;  1SKR A;  3PX0 A;  1VSJ A;  5LMN K;  3BY5 A;  3L4I A;  1NJZ A;  4DFM A;  3AVJ A;  2HVH A;  4KB1 A;  4KTW A;  1SQK A;  2QEX N;  3OS1 A;  1I94 K;  3NVM A;  4BRI A;  3C0B A;  1Z6R A;  1ZBS A;  1NK8 A;  2HHX A;  4CJ3 A;  2X6N A;  1XHX A;  4FLX A;  1DT9 A;  3VGL A;  5BN8 A;  4DQS A;  5KGX A;  4AHT A;  4DR6 K;  3VGK A;  2GWJ A;  3M5R A;  3DOL A;  5AQT A;  3CYM A;  4FPA A;  2D0A A;  3CQX A;  3SAF A;  1TAQ A;  3NE6 A;  2A5X A;  3E9O A;  1MU2 A;  2NUB A;  4H4M A;  1T6D A;  4CZI A;  4CI6 A;  5J1E A;  4H5N A;  2OTL N;  4CFA A;  3R1X A;  4PY5 A;  5LMU K;  3PO4 A;  2A1S A;  5T7B A;  4JI7 K;  2V51 B;  2GTD A;  4CHN A;  3I33 A;  1LWE A;  3DXK B;  3V9S A;  4NO7 A;  4DR5 K;  4H0V B;  4MO4 A;  4KV8 A;  4ELV A;  4WE1 A;  3CCM N;  2JWK A;  3O3H A;  4PQU A;  2YJF A;  4KRE A;  4IEE A;  3ZSW A;  3VEO A;  1C0G A;  1Z26 A;  4CW7 B;  1BL3 A;  3J7Y P;  4IO9 L;  2QM1 A;  4RW4 A;  4O55 A;  4F2R A;  4FJJ A;  1KVB A;  2ITM A;  4B9V A;  2GX9 A;  4OO1 J;  4NYF A;  5CZ2 A;  5DMR A;  2FBY A;  1RTH A;  1JLB A;  4RCH A;  4GMJ B;  3O3G A;  2DY4 A;  4IDH A;  2O4I A;  4I9L A;  4E89 A;  4IOA L;  4DU1 A;  3LWM A;  4B8C A;  3U6F A;  4FJ5 A;  4AH9 A;  5F2R A;  3LP1 A;  3JAM O;  4KTZ A;  4CGH A;  3H1V X;  4BDZ A;  2Y1J A;  3HZ6 A;  3P83 D;  5JS2 A;  4FWO A;  4K8Z A;  4CF1 A;  5F0X A;  3MAQ A;  4MDA A;  3HP9 A;  4IOC L;  4EFH A;  4H0P A;  3L6Q A;  4CZE A;  1VSH A;  3MCA B;  3I56 N;  4AQY K;  2OZS A;  2HW3 A;  1QZ6 A;  3MED A;  2P5O A;  2V52 B;  3GE1 A;  1YTA A;  4CFD A;  4R79 A;  4JI8 K;  4ISF A;  1JLF A;  2HMP A;  4KRF A;  1KAX A;  3J80 O;  2QWP A;  4EP4 A;  4LF6 K;  2H3G X;  2Q31 A;  2NRV A;  3H3O B;  3KIO A;  5HRO A;  4H5T A;  5BRF A;  1TYQ B;  1JCG A;  4FL9 A;  3SUO A;  3TTD A;  3KLE A;  3A0I X;  3AVG A;  4DSJ A;  3JXU A;  2PFU A;  4O44 A;  4Z4F A;  4YOX A;  1GLJ O;  3HM8 A;  4CEQ A;  3KKS A;  3EY1 A;  4J8F A;  3ZET A;  4FWR A;  1JLG A;  5KGW A;  4RW6 A;  3UKU B;  1WAJ A;  4FXD A;  2NZT A;  4DR7 K;  3H6E A;  1L5U A;  4IZ9 A;  3VQC A;  4E3S A;  2IC3 A;  3EKS A;  4EZ6 A;  3VMF B;  3NGZ A;  2XY5 A;  1ASV A;  1HKC A;  4DQI A;  4LFB K;  3SMS A;  1KCF A;  4C23 A;  1D9F A;  4DTR A;  4BRH A;  1NJX A;  3LAM A;  1VQM N;  2O8D A;  1X9M A;  1Q8I A;  2E2Q A;  4W5Q A;  2I7P A;  4QS8 A;  1WAF A;  3H46 O;  3AVK A;  2KZM A;  1JL2 A;  1LW0 A;  3OYK A;  4U67 L;  2HBM A;  3DLB A;  2FBT A;  3QEP A;  1Q9Y A;  4OX9 K;  3V9U A;  2QW9 A;  4FLZ A;  4ILG B;  4W5N A;  1Z25 A;  4M45 A;  4GVM A;  4B8A B;  2ETJ A;  2FBV A;  4C1N I;  4CD1 A;  3LDS A;  3A2F A;  3AA4 A;  3L2V A;  3DYA A;  4NCB A;  1S1U A;  1LW2 A;  1OVY A;  4HCC A;  2QWR A;  1NLV A;  1IKY A;  3DXK A;  3VQ4 A;  4M3Y A;  3CJ1 A;  3TPQ A;  3CF5 L;  1TAU A;  3V4I A;  4E1N A;  4OJR A;  1N34 K;  1E4G T;  2P9U B;  3VTI A;  3MEG A;  3RSE A;  1NJY A;  5BRH A;  2QA4 N;  4XH4 A;  1GOC A;  4JKB A;  4BDY A;  1S9G A;  4WCE L;  2YHW A;  3O9T A;  4FZY A;  3VPZ A;  4BWJ A;  4GY2 B;  3PIP L;  3C6T A;  1S1V A;  3E9L A;  1WB9 A;  3VGM A;  1BA0 A;  1D8Y A;  4JK8 A;  3S3N A;  4DMN A;  4FPB A;  4B1Z A;  2RHK A;  4PHT X;  4FLT A;  2QKK A;  2NNW A;  2D5R A;  1L3S A;  4CZG A;  4U7B A;  2OA8 A;  2XY7 A;  3IFR A;  4FK2 A;  4DLG A;  1OKJ A;  4BWM A;  1YJ9 N;  3VQ5 A;  3CME N;  4Z4I A;  1S1X A;  3DOK A;  3FZL A;  3D2F A;  2F8S A;  3OHR A;  1CXU A;  3SLC A;  4OLB A;  1S3X A;  3HTV A;  4B08 A;  4GV6 A;  4IOX A;  5M1K A;  3HK2 A;  4KH6 A;  2Q97 A;  2YV0 X;  3DLG A;  3D0P A;  2OPR A;  2E88 A;  1GLB G;  3NF7 A;  1TK0 A;  1FK9 A;  2KW4 A;  3CCE N;  3SQ0 A;  2E2O A;  4H03 B;  4F8R A;  1UWB A;  2P51 A;  1VQ6 N;  3TR8 A;  3GL1 A;  4M3T A;  3C6H A;  1VQ8 N;  1XQS C;  3CFO A;  3QES A;  3QNN A;  2VWJ A;  4XH1 A;  4IG3 A;  4I2Q A;  1TYQ A;  2NRZ A;  2XRI A;  4EHU A;  3HYF A;  3DAW A;  5HP1 A;  4I6M B;  3M3Z A;  2HND A;  4BE0 A;  4BGB A;  1WLJ A;  1YIT N;  4JI3 K;  4Z94 A;  1SAZ A;  4C8L A;  1U2V A;  2IVN A;  1BO5 O;  5E41 A;  5JS1 A;  1RIL A;  3E66 A;  1NKE A;  1U47 A;  5BN9 A;  1KFS A;  3I55 N;  3TTC A;  4N76 A;  4GKK K;  4DSK A;  3DLK A;  3FZK A;  3WXM B;  5BR9 A;  1RBV A;  1X9S A;  1J5O A;  1T7P A;  1KFD A;  4C8K A;  4ICL A;  1SL1 A;  2AP1 A;  1IBL K;  4ZTJ A;  3KZB A;  5JLH A;  3RMD A;  3NGY A;  4M41 A;  3PO5 A;  2QWN A;  4AHV A;  1C0U A;  4HHT A;  3HP6 A;  4FOI A;  1LCU A;  1WOQ A;  4WQ5 A;  1S72 N;  3VQA A;  4CFC A;  3DWL A;  4IEI A;  3RMA A;  4YNQ A;  3VQB A;  3BGR A;  1C6V A;  1BA1 A;  1VRU A;  1D9D A;  3J8A A;  3QLH A;  4LF9 K;  3TWH A;  1BIS A;  3IUC A;  4Y0W A;  2DPN A;  4FWK A;  2JLE A;  2XO7 A;  4ISE A;  2IVO A;  2DFH A;  1X3N A;  4FM1 A;  5SWM A;  2VGM A;  4A5B A;  2V7Y A;  2KFZ A;  1QE1 A;  1TV6 A;  3IG1 A;  1YXQ A;  3J7A P;  2E20 A;  1GLL O;  1NM1 A;  5AQH A;  3D2E B;  3BEX A;  3CCU N;  4IBN A;  3QEW A;  3ALY A;  3O8M A;  1QS4 A;  3SI6 A;  3T3F A;  4ID1 A;  5C25 A;  4CHP A;  1C0M A;  1GLA G;  4CZK A;  3ATV A;  3O4W A;  5AR0 A;  2D0C A;  3T19 A;  3Q7C A;  3QFU A;  1BQM A;  1WSH A;  3T69 A;  4QOZ B;  2GEL A;  2HHT A;  3S3O A;  3SAG A;  1U04 A;  4LC9 B;  3CXC M;  1C1B A;  2W6K A;  3LP3 A;  4DV2 K;  4FK0 A;  3WQU A;  1U4B A;  4YOU A;  4LF4 K;  2P9S B;  5AQJ A;  4IFE A;  3ZX3 A;  5DM7 L;  4R5P A;  3S3M A;  3AA3 A;  5C0Y A;  5LY3 A;  2ZM6 K;  4PWD A;  3LWL A;  4DQP A;  2YKN A;  3LAN A;  1WSG A;  2F96 A;  2WON A;  3VF2 A;  1HX1 A;  2EX3 A;  4CEB A;  4CZL A;  2HMI A;  2P9N A;  2W6L A;  1QSS A;  4FJ8 A;  3CMA N;  5D3G A;  1ZBF A;  1WSE A;  3KK1 A;  2G8U A;  3OS0 A;  5HOO A;  4FM2 A;  2O8C A;  2IOC A;  2D4W A;  4FJI A;  1XC9 A;  3HST B;  1ATR A;  3ASM A;  1HMV A;  4BR4 A;  4B1Y B;  3OYJ A;  2HF3 A;  1QVF M;  1VQ5 N;  2W40 A;  4C8N A;  4KHU A;  4CE9 A;  5KPT A;  1TL3 A;  1YHQ N;  3OYN A;  1R0A A;  2PY5 A;  4JS5 A;  2B6A A;  2HOE A;  2Z1J A;  1SS6 A;  4I6M A;  3CCL N;  4J2D A;  3AVB A;  1ASU A;  1X3M A;  4HWI A;  4KI4 A;  1U6Z A;  4M3Z A;  4JHD B;  2PYJ A;  3JSM A;  3SQ2 A;  3ENB A;  3V1Q A;  3OYL A;  4DU4 A;  3AVN A;  1K8A O;  5C12 A;  2Q3S A;  4CJQ A;  4BC4 A;  1IG8 A;  4CJV A;  2QTD A;  3NH0 A;  4GKJ K;  5CR4 A;  4A59 A;  3WNE A;  2ZWH A;  1YF5 L;  4YOW A;  2Q0R A;  2R7Y A;  2CH6 A;  4AHC A;  4XEI A;  4E19 A;  3K0S A;  4BRP A;  5BR8 K;  1IBK K;  4FWQ A;  1RT6 A;  1KD1 O;  4F2S A;  4B3O A;  5AQP A;  5CE3 A;  1WNS A;  3VQE A;  4RW9 A;  1SL2 A;  1OVQ A;  5BPM A;  4NYN A;  3AGR A;  3ZSV A;  1FKO A;  3VOV A;  5HRR A;  3VEN A;  3QB0 A;  2CH5 A;  4C8O A;  1D4X A;  3M1F A;  4CHZ A;  1E3M A;  1YAG A;  4OGE A;  5TKY A;  3A5N C;  4MLH A;  1RT5 A;  1P8Z A;  4CZM A;  1YJN N;  2W42 A;  1S6Q A;  4AHR A;  1WBD A;  4PL8 A;  3ZET B;  3CET A;  3IAY A;  3G10 A;  2BDP A;  3VQP A;  1JXB A;  3MN9 A;  4IJN A;  1ATS A;  4E7H A;  3GBT A;  4DV6 K;  4DQR A;  2FSJ A;  2OYQ A;  4M63 C;  3QEI A;  3FGU A;  4CGJ A;  3MWT A;  4EAH D;  4FM0 A;  2O8D B;  2P9K B;  4DWI A;  1HJO A;  3AO1 A;  3SUQ A;  3J81 O;  2YI1 A;  3VET A;  4BC3 A;  3WNH A;  3QIN A;  4W5R A;  3QIO A;  3RMC A;  4CEC A;  3TU5 A;  4OKJ A;  5FPE A;  2P9S A;  3CQ8 A;  3VQ6 A;  5KI6 A;  3EE9 A;  1Y64 A;  2D0O A;  1WBB A;  3AAR A;  3P39 A;  4Z4E A;  2IS3 A;  2JGU A;  1XMO K;  4LSL A;  5EXW A;  2Q1N A;  1BCO A;  4JI1 K;  3HOS A;  4LF8 K;  4FLV A;  1NJW A;  2ASM A;  4KAZ A;  3ITH A;  3LAL A;  1VHX A;  1K9M O;  1UA0 A;  1HNW K;  3UIQ A;  4BVP A;  3NDK A;  3KKR A;  5AFU A;  1L3V A;  3L2U A;  4Z4C A;  4CEZ A;  3HOT A;  1RTI A;  1KRP A;  2O8F B;  4BRF A;  2HBJ A;  4BRO A;  3F9K A;  2IIR A;  3QNO A;  2OPP A;  3CFR A;  1T03 A;  5I42 A;  3K9J A;  3RSE B; 
#chains in the Genus database with same CATH homology
 4JRP A;  3DMJ A;  3DRR A;  4HVJ A;  3OYC A;  3V9X A;  2RPI A;  2ITG A;  4CHO A;  4DQQ A;  4FZX C;  4W5N A;  2HNZ A;  3SJJ A;  1Z25 A;  4M45 A;  4CGI A;  4DLE A;  4GVM A;  2XHB A;  4CCH A;  2RN2 A;  3V1R A;  2VG7 A;  2RF2 A;  4B8A B;  2ETJ A;  2FBV A;  3LZI A;  3LDS A;  3A2F A;  1BI4 A;  3AA4 A;  1KVA A;  4N41 A;  4GW6 A;  3SQ4 A;  3L2V A;  1QQC A;  1WN7 A;  3M8S A;  3F73 A;  4CJK A;  1F21 A;  3DYA A;  3KLG A;  2G8I A;  4E7I A;  4DTS A;  1WSI A;  3HT3 A;  3OYG A;  2G8V A;  4B9T A;  4NCB A;  3VQ7 A;  1NK4 A;  5SZT A;  1C1A A;  4O0I A;  1S1U A;  1K6Y A;  4HUF A;  1LW2 A;  2LSN A;  4HCC A;  4H8K A;  4CK1 A;  4FJH A;  1KLN A;  4KHS A;  4M42 A;  1IKY A;  5FRM A;  4ELT A;  3VQ4 A;  4DS5 A;  4KHQ A;  4M3Y A;  1HQE A;  3C6U A;  2YNI A;  1JLC A;  3C94 A;  4N47 A;  4FJ9 A;  1LWF A;  3M8R A;  3V4I A;  4FJL A;  3SCX A;  4E1N A;  1TAU A;  4OJR A;  2OPQ A;  1BGX T;  1UOC A;  1NK7 A;  3MEG A;  3L2R A;  4M3W A;  1NJY A;  2DFE A;  2IDO A;  4ZHR A;  1D5A A;  1O1W A;  3ZT3 A;  2HHU A;  1GOC A;  5KRS A;  4BDY A;  1S9G A;  2HNY A;  1BIU A;  4FZY A;  2YNF A;  4O0J A;  4BWJ A;  1DTQ A;  3C6T A;  2XY8 A;  1S1V A;  3VQ9 A;  3SV3 A;  2Z1G A;  4CIE A;  4JRQ A;  3HPG A;  1D8Y A;  4EZ9 A;  2HHV A;  1ZBH A;  3S3N A;  3NFA A;  1DTT A;  3ZT1 A;  3SYZ A;  1KVC A;  3AVA A;  4DMN A;  3OYM A;  1RCH A;  1JL1 A;  3SQ1 A;  1X9W A;  4FLT A;  4KHW A;  2QKK A;  4F3T A;  2D5R A;  2FC0 A;  1L3S A;  5FDL A;  2OA8 A;  4BDP A;  3OJU A;  2GBZ A;  2XY7 A;  4FK4 A;  4QCL A;  1TKT A;  1VK0 A;  4J2B A;  3V9W A;  4K8X A;  4FK2 A;  3VQ8 A;  4DLG A;  4BWM A;  3RRH A;  3VQ5 A;  3LP2 A;  3NH1 A;  3PX4 A;  4B9S A;  4Z4I A;  2VG5 A;  1S9E A;  1S1X A;  3DOK A;  3RRG A;  3DLH A;  3LP0 A;  1RT3 A;  4AHU A;  2F8S A;  1VSK A;  4B9U A;  1C0T A;  1CXU A;  4OLB A;  4CJW A;  5CZ1 A;  4B08 A;  3LPU A;  1QTM A;  1QSY A;  3HK2 A;  1VSF A;  4KFB A;  2YV0 X;  3DLG A;  3VN5 A;  3D0P A;  1TGO A;  2OPR A;  3B6O A;  1NK5 A;  4CF9 A;  1NK9 A;  4L8R B;  4MFB A;  3NF7 A;  3ZSO A;  4RW8 A;  2EHG A;  4NCG A;  1TK0 A;  1FK9 A;  2KW4 A;  3SQ0 A;  4DTM A;  1RDB A;  3U3G A;  4F8R A;  1UWB A;  3OYE A;  1S1T A;  1Y97 A;  3TAQ A;  4DTX A;  2YNG A;  2P51 A;  3SZ2 A;  3S9H A;  3NHG A;  3OY9 A;  3TR8 A;  3WNF A;  4J2E A;  1UA1 A;  4M3T A;  3OYB A;  3AO4 A;  3CFO A;  3THV A;  4LD0 A;  4CJ4 A;  3QES A;  1VSL A;  3QNN A;  3TAR A;  4CJ5 A;  1NK6 A;  3VQQ A;  2VWJ A;  1B9F A;  3L3V A;  1SKS A;  4O4G A;  1TL1 A;  3L2Q A;  4IG3 A;  4F3O A;  4HCB A;  2PZS A;  4I2Q A;  2B4J A;  4JS4 A;  3H08 A;  3P1G A;  3IRX A;  2XRI A;  3KLH A;  2E4L A;  3HYF A;  3AVL A;  5HP1 A;  4HTU A;  4M3U A;  4OKE A;  2HND A;  4BE0 A;  3TAE A;  1SV5 A;  1WLJ A;  3KD5 E;  2P1J A;  4C8L A;  2HHQ A;  4KKO A;  4RW7 A;  5E41 A;  5JS1 A;  1I3A A;  4KTQ A;  1U49 A;  3KLI A;  4DU3 A;  1RIL A;  4CJF A;  4CF8 A;  4CJS A;  4N56 A;  3OYA A;  4DSE A;  1U47 A;  1NKE A;  4Q0B A;  4KHY A;  3PUF A;  3ZSR A;  1KFS A;  2DTU A;  4FJX A;  3D45 A;  3K5O A;  4N76 A;  3K57 A;  1IKV A;  1ASW A;  4DSK A;  5DK5 A;  2E6M A;  3SUP A;  3DLK A;  3KD1 E;  1LAW A;  1S1W A;  5HLF A;  3K58 A;  3DI6 A;  3C95 A;  3VA0 A;  4B9L A;  2BAN A;  1RBV A;  4DG1 A;  1X9S A;  4KHN A;  1J5O A;  3HVT A;  1T7P A;  2KFN A;  1KFD A;  1SUQ A;  3K5M A;  4C8K A;  4ID5 A;  4IKF A;  1TK5 A;  4CFB A;  4CJU A;  4ICL A;  3VA3 A;  4J2A A;  1SL1 A;  3ULD A;  1HYS A;  1HYV A;  3AO2 A;  3I0R A;  3RTV A;  4DFJ A;  4ZTJ A;  4H4O A;  2BE2 A;  3EYZ A;  3RMD A;  3NGY A;  4OKK A;  4M41 A;  3SNN A;  4AHV A;  3PO5 A;  1L3U A;  4I9Q A;  1C0U A;  3DM2 A;  3FFI A;  3HP6 A;  4W5T A;  4HHT A;  3QER A;  3I8D A;  3K5L A;  3NH2 A;  4Y1D A;  4FJG A;  4YFU A;  4BAC A;  3VQA A;  3HO1 A;  1CLQ A;  4Z0U A;  4CFC A;  3AO3 A;  4CEF A;  5I3U A;  2QK9 A;  2PYL A;  2KZZ A;  1J9A A;  4CJR A;  4DFP A;  3RMA A;  3OYH A;  2P5G A;  4YNQ A;  4CER A;  1G15 A;  3VQB A;  3L2W A;  3BGR A;  3RWU A;  1A5W A;  1C6V A;  1W9H A;  1VRU A;  4OVL A;  3QLH A;  1D9D A;  1VSE A;  1BIS A;  4M3R A;  3T1A A;  2IGI A;  2Z1H A;  3TWH A;  3V81 A;  2JLE A;  2XO7 A;  3PY8 A;  4DSL A;  1S6P A;  3V1O A;  2DFH A;  4KPY A;  4FM1 A;  2VWK A;  4FVM A;  5SWM A;  3V9Z A;  3RR7 A;  4FJK A;  1ZBI A;  4Z4H A;  3SV4 A;  3QEV A;  4E0D A;  2KFZ A;  1QE1 A;  4Q5V A;  5KTQ A;  4E1M A;  2ZQB A;  1TV6 A;  3IG1 A;  2QXF A;  4B9N A;  1RDA A;  2ZD1 A;  4IBN A;  1I39 A;  3ALY A;  1HYZ A;  3AVM A;  4KO0 A;  1QS4 A;  3QEW A;  2Y1I A;  3SI6 A;  5C42 A;  1NKC A;  4FJ7 A;  2HHS A;  4I7F A;  4ID1 A;  3T3F A;  4IG0 A;  4FJN A;  1ZBL A;  5C25 A;  3M8P A;  4RG8 A;  3ZCM A;  5HRS A;  3ZSZ A;  4CHP A;  1Q9X A;  1C0M A;  4CIF A;  4CED A;  3TAB A;  3AV9 A;  3CG7 A;  2XY6 A;  4DS4 A;  1RNH A;  3AVH A;  3ZT2 A;  5HRN A;  1ITG A;  1YT3 A;  1HNV A;  2D0C A;  3T19 A;  2GV9 A;  4CF0 A;  4CGG A;  4BE1 A;  4OPJ A;  1C1C A;  1BQN A;  4O5B A;  5J2M A;  1JLQ A;  1BQM A;  1EKE A;  3LPT A;  3ZSY A;  3ZSQ A;  1WSH A;  2G8H A;  4QOZ B;  4EP5 A;  3K59 A;  3U3Y A;  3EZ5 A;  2HHT A;  4FLW A;  3S3O A;  1U04 A;  1U48 A;  4B9M A;  2OZM A;  1C1B A;  3E01 A;  3LP3 A;  4DTN A;  1XI1 A;  4FK0 A;  4AHS A;  4CGD A;  3DRP A;  3DLR A;  3SPZ A;  4IFV A;  3PX6 A;  1U4B A;  1B9D A;  4NCA A;  1T05 A;  1N6Q A;  1QHT A;  2HB5 A;  3CFP A;  3DLE A;  5FRO A;  3NGI A;  4R5P A;  1EET A;  2ATQ A;  1ZYQ A;  1RTD A;  3S3M A;  3HJF A;  3HPH A;  1SKR A;  3MEC A;  3AA3 A;  4DTO A;  3PX0 A;  5CYM A;  4KB0 A;  3MXJ A;  1VSJ A;  1RBT A;  4OLA A;  3M8Q A;  1NJZ A;  4PWD A;  4DFM A;  3AVJ A;  2HVH A;  3LWL A;  4KB1 A;  4CES A;  4KTW A;  4E7K A;  4DQP A;  2YKN A;  1IKW A;  4CJL A;  3LAN A;  3OS1 A;  1L3T A;  1JLE A;  1WSG A;  3WNG A;  1S5J A;  1TKX A;  2A1R A;  2F96 A;  2WON A;  4BE2 A;  1NK8 A;  2HHX A;  1RDC A;  2YKM A;  4CJ3 A;  2HMI A;  2EX3 A;  2X74 A;  1CZB A;  4CEB A;  1KTQ A;  2X6N A;  1XHX A;  4FLX A;  1QSS A;  2B5J A;  3KLF A;  4FJ8 A;  1BIZ A;  5D3G A;  3NF8 A;  1ZBF A;  1WSE A;  3LAK A;  3KK1 A;  4DQS A;  2G8U A;  5KGX A;  3OS0 A;  4FM2 A;  1A5X A;  4AHT A;  2X78 A;  3ISN C;  4CHY A;  5J2P A;  2IOC A;  4OPK A;  3DOL A;  3HXM A;  1XC9 A;  4HUG A;  4FJI A;  3HST B;  1FKP A;  3ASM A;  5HBM A;  3CYM A;  3AO5 A;  1HMV A;  2Z1I A;  5J2N A;  3OYJ A;  3KJV A;  2AJQ A;  2D0A A;  1CZ9 A;  1NOZ A;  4FYD A;  4DF4 A;  1TAQ A;  3L3U A;  3NE6 A;  5FRN A;  1MU2 A;  1BI4 B;  1JKH A;  4C8N A;  4KHU A;  2NUB A;  3AVI A;  1X1P A;  3OYF A;  4H4M A;  4CE9 A;  5KRT A;  1HPZ A;  4FCY A;  1TL3 A;  1WSF A;  1XWL A;  5J1E A;  1TVR A;  3OYN A;  1R0A A;  1TKD A;  1SL0 A;  1HQU A;  4CFA A;  4PY5 A;  3HPO A;  3KK3 A;  2A1S A;  5T7B A;  3PO4 A;  2PY5 A;  3PV8 A;  4JS5 A;  4CHN A;  2B6A A;  2Z1J A;  1XHZ A;  4J2D A;  4M3X A;  1LWE A;  3DRS A;  3V9S A;  4Y1C A;  3DLB A;  3AVB A;  1ASU A;  4KI4 A;  4M3Z A;  4KV8 A;  4ELV A;  3HL8 A;  4CJP A;  4OGC A;  3TAF A;  4WE1 A;  3G0Z A;  5CY4 A;  3JSM A;  2PYJ A;  3O3H A;  4CEE A;  3SQ2 A;  1IG9 A;  2QKB A;  4PQU A;  4FZZ A;  3O4N A;  3V1Q A;  3AA2 A;  2VG6 A;  3OYL A;  4DU4 A;  1RBS A;  4FW1 A;  3V6D A;  1W0H A;  1KLM A;  1ZBU A;  4N5S A;  3AVN A;  2Q3S A;  4KRE A;  3ZSW A;  4CJQ A;  3B6P A;  4CJV A;  3AA5 X;  4HUE A;  1QSL A;  1Z26 A;  3TAG A;  3NH0 A;  1BL3 A;  1B92 A;  1UAX A;  3WNE A;  4DFK A;  4RW4 A;  1KSP A;  3QO9 A;  3MXI A;  4O55 A;  4DTP A;  4F2R A;  4FJJ A;  4MQ3 A;  1KVB A;  3O3F A;  3OS2 A;  4CEA A;  1SKW A;  4B9V A;  4DSI A;  2F8T A;  3LZJ A;  4CHQ A;  4PA1 A;  3CM6 A;  4NYF A;  1HRH A;  4AHC A;  2R7Y A;  4E7L A;  4CF2 A;  5CZ2 A;  4CGF A;  4E19 A;  2X6S A;  4W5O A;  1RT6 A;  2FBY A;  1RTH A;  5CYQ A;  1JLB A;  4I2P A;  4GMJ B;  5DMR A;  3O3G A;  4F2S A;  4PUO A;  4B3O A;  2DY4 A;  1GOA A;  2O4I A;  1GOB A;  2YHB A;  4DTU A;  1WNS A;  2G8K A;  4I9L A;  3VQE A;  4RW9 A;  4E89 A;  3K2P A;  3KK2 A;  1SL2 A;  1EXQ A;  4DU1 A;  1LWC A;  2FBX A;  3LWM A;  4B8C A;  3U6F A;  4NYN A;  4FJ5 A;  4AH9 A;  3ZSV A;  1N5Y A;  1HNI A;  1FKO A;  5HRR A;  3LP1 A;  3IS9 A;  4KTZ A;  4CGH A;  2G8W A;  3ZSX A;  4BDZ A;  3P5J A;  4C8O A;  2GUI A;  2Y1J A;  4CHZ A;  3P83 D;  5JS2 A;  4ZTF A;  4OGE A;  4XIU A;  1U45 A;  4K8Z A;  3OYI A;  4CF1 A;  4CJT A;  1RT5 A;  3MAQ A;  3HP9 A;  3NAE A;  3MXM A;  2BGG A;  3TAM A;  1DLO A;  1VSH A;  1BHL A;  1TKZ A;  3MEE A;  1S6Q A;  2W42 A;  4F4K A;  5C24 A;  4AHR A;  2OZS A;  2HW3 A;  1IKX A;  1IO2 A;  3MED A;  3IAY A;  3G10 A;  4UQG A;  2BDP A;  1RBU A;  2P5O A;  1EX4 A;  3VQP A;  1JXB A;  3TI0 A;  4CEO A;  1YTA A;  4CFD A;  4E7H A;  3NCI A;  3NBP A;  1YVU A;  1T8E A;  1RT1 A;  2KTQ A;  1JXE A;  1JLF A;  3QET A;  4KRF A;  2YHA A;  4DQR A;  4ELU A;  2I5J A;  4EP4 A;  1RDD A;  3NF6 A;  4QAG A;  4E7J A;  4CK3 A;  2OYQ A;  4C8M A;  5HRO A;  1RBR A;  3KIO A;  3QEI A;  1LV5 A;  3KTQ A;  2IAJ A;  4LY7 A;  4DSF A;  2HVI A;  1HJR A;  4CGJ A;  1REV A;  4AIL C;  4LSN A;  4Z4G A;  3AVF A;  3SUO A;  4FM0 A;  4FLU A;  3K5N A;  3KLE A;  1A5V A;  3AVG A;  5EU7 A;  4FJM A;  1VSD A;  4DWI A;  3CM5 A;  2RKI A;  4DF8 A;  4DSJ A;  1J54 A;  3I0S A;  1LAV A;  3SUN A;  4IFY A;  4Z4F A;  4O44 A;  5HRP A;  4G1Q A;  3AO1 A;  3SUQ A;  4CEQ A;  3KKS A;  3VQD A;  3EY1 A;  1EP4 A;  1JLG A;  3OVN A;  2E6L A;  5KGW A;  3WNH A;  3QIN A;  4RW6 A;  4W5R A;  1WAJ A;  1FXX A;  3QIO A;  3RMC A;  4CEC A;  4FXD A;  1RT2 A;  4LH5 A;  4OKJ A;  2DFF A;  3NF9 A;  1CXQ A;  4IDK A;  3CQ8 A;  1L5U A;  3VQ6 A;  5KI6 A;  1TK8 A;  1WSJ A;  4FW2 A;  3TAN A;  1JLA A;  3VQC A;  2IS3 A;  2JGU A;  4KI6 A;  4Z4E A;  4CK2 A;  2IC3 A;  4E3S A;  3JYT A;  4EZ6 A;  4LSL A;  3NGZ A;  3OJS A;  1ASV A;  5J2Q A;  2XY5 A;  4DQI A;  3QIP A;  4JLH A;  1BCO A;  3ZT4 A;  4CJE A;  1RT4 A;  1KCF A;  1D9F A;  1RTJ A;  4DTR A;  3RMB A;  4DTJ A;  4FLY A;  1NJX A;  3LAM A;  1IH7 A;  4FLV A;  1NJW A;  2HHW A;  2WOM A;  1NK0 A;  4LH4 A;  3ITH A;  3LAL A;  1X9M A;  1VSI A;  3O4Q A;  1VSM A;  1UA0 A;  4KAZ A;  3L8B A;  2YNH A;  1NKB A;  2O4G A;  1Q8I A;  1RT7 A;  4W5Q A;  3UIQ A;  3SPY A;  3HM9 A;  3TAP A;  3NDK A;  3RR8 A;  3KKR A;  3OYD A;  4CIG A;  3L2U A;  1WAF A;  4TSX A;  4Z4C A;  3QEX A;  1L3V A;  1NOY A;  2D0B A;  3ZT0 A;  2KQ2 A;  3AVK A;  4CEZ A;  3BDP A;  2KZM A;  1YTU A;  5K14 A;  1BCM A;  1J53 A;  1JL2 A;  1RTI A;  1KRP A;  2G8F A;  1LW0 A;  3AVC A;  3OYK A;  3F9K A;  3QNO A;  2FBT A;  2OPP A;  3HVR A;  3CFR A;  3QEP A;  1T03 A;  1VRT A;  1Q9Y A;  2OPS A;  5I42 A;  3V9U A;  2ZE2 A;  4FLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...