2B4JA

Structural basis for the recognition between hiv-1 integrase and ledgf/p75
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
153
structure length
135
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase (IN)
publication title Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, recombination
total genus 47
structure length 135
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b4jA00
3KIOA 2IC3A 3L3VA 3O3HA 1DTQA 4BE2A 4DSFA 3RRGA 4FJGA 4CGDA 4CEQA 4DTNA 2E6LA 5HBMA 3NGIA 3CYMA 4DTRA 4EZ9A 1BHLA 3ZCMA 2W42A 4FLWA 4DSJA 3S9HA 1RDAA 1ZBHA 3AA2A 2ZQBA 4J2AA 4YNQA 3NF7A 2PYJA 3RMDA 3PO5A 4KI6A 2DY4A 1UAXA 1ASUA 1TAQA 3H08A 3EZ5A 4Z4FA 2VG5A 4DTXA 2EHGA 3CM5A 1TVRA 3VQ4A 2OPSA 4HUFA 1CZBA 2JGUA 3DYAA 4GW6A 4O0JA 4BWMA 4KTQA 3LAKA 4PWDA 1WSIA 4FLZA 1C0MA 3O3FA 2Q3SA 3OJUA 4B9TA 3LWMA 2F8TA 4KAZA 3LDSA 4FVMA 1TK5A 4FJMA 2D0CA 1NKCA 3DRRA 1RT4A 3M8PA 1NJYA 3PX4A 2VG7A 4B9VA 4LSLA 2XY7A 4NYNA 1VSJA 3MEDA 1WSJA 3AO4A 4JLHA 4N5SA 4CIEA 3SYZA 3L2QA 1RT1A 1B9DA 1VK0A 3IG1A 4OKEA 4B8CA 3KLHA 5J2MA 5I42A 3TANA 3S3NA 4ICLA 2OYQA 3HJFA 2KZZA 3LALA 4FJ8A 2X6NA 3PV8A 4B9NA 2P5GA 2HW3A 2ZD1A 1IKYA 3M8QA 4CJ3A 2HNDA 4GVMA 3HVRA 2HMIA 2G8VA 4H4MA 3OYNA 1WSHA 2RN2A 4FM0A 5HROA 3ITHA 2IS3A 1FXXA 3ZSXA 4DTPA 3TARA 1JLQA 4CEEA 2Y1IA 1EETA 4LSNA 4B8AB 3NH1A 3TAGA 2KW4A 1IO2A 3F9KA 1SL0A 1D8YA 3AVKA 2BGGA 4FLXA 1UA0A 3K57A 3SQ2A 4KHWA 3SUNA 1TAUA 4OVLA 1SL2A 4FM1A 3HVTA 5J1EA 4KHQA 2IDOA 3PX0A 3MEEA 4ZHRA 1K6YA 4FLTA 4PY5A 3KLGA 3RTVA 3TAEA 1U45A 1UWBA 1S9EA 4KKOA 4KI4A 1XHZA 3DLHA 3NH0A 3VQCA 1IH7A 4CJPA 2AJQA 5KI6A 5C42A 3KJVA 4KTZA 1NK9A 1MU2A 4CGJA 4N41A 4DSLA 3AA3A 3CFOA 3LWLA 1RT2A 1BIZA 1W0HA 3NGYA 3LPUA 4M45A 5KGXA 3OYAA 4PQUA 2IGIA 4RW6A 2G8IA 4CFCA 2YNHA 3BDPA 4Q5VA 1A5WA 4MFBA 4CJ5A 4B9UA 4OGCA 2XY6A 3VQ7A 1TL3A 4HCCA 1RT5A 3V9SA 1C0TA 3HPGA 3AVLA 4PUOA 4K8ZA 3NHGA 4DFJA 1RNHA 2NUBA 4W5RA 4FZZA 3AA5X 1X9WA 2KTQA 3ZSVA 1BI4A 3ZT2A 2FBXA 4CK1A 3HP6A 4BWJA 4CF8A 5J2PA 3WNGA 1T8EA 1NK0A 4ELTA 3LP3A 1LAVA 3VQ5A 3P83D 3QETA 3DM2A 1NK5A 5CZ2A 3OYBA 4M3TA 1GOCA 2QXFA 3DI6A 4FYDA 1X9SA 4CJLA 1NK6A 1C0UA 3VQ9A 1U04A 2YNIA 3BGRA 3ASMA 2VG6A 3MECA 3SPYA 1D9FA 2PY5A 4B3OA 4CF9A 1EXQA 3L2UA 4IG0A 3K5NA 2FBVA 2YHBA 1RBVA 2B4JA 3P1GA 3VN5A 1DTTA 1QE1A 1WNSA 1LV5A 4Y1DA 3KK3A 1IG9A 3IAYA 3KTQA 3V9XA 3K5LA 3S3MA 2QKBA 4RW8A 3I0RA 4LH4A 5J2QA 5HP1A 1S6PA 3MAQA 2HHUA 2D0BA 3K5MA 1QSSA 4FM2A 1D5AA 3SQ0A 4NCBA 4CJEA 2G8HA 4OJRA 1RBTA 3HL8A 4E89A 4E7JA 4FJHA 3OYDA 1FKOA 4FJNA 4IFYA 3AVMA 4E7KA 3QEPA 1NJXA 2B6AA 3SNNA 4C8MA 3SZ2A 4KHYA 1CZ9A 3DMJA 1LWEA 2E4LA 1KFDA 4CHYA 2HB5A 1WSGA 2LSNA 1IKVA 3SI6A 3DLBA 4Z4IA 3LP0A 4F3TA 1WSFA 1VSFA 4JS4A 1JLEA 3QIPA 1SV5A 5SZTA 3NCIA 4CHNA 2Z1GA 4DU3A 2KFZA 3SCXA 4HVJA 3RMBA 4B9SA 4AHTA 5FROA 2BDPA 4CF0A 4CJVA 3DLRA 4AHRA 3V1QA 4M42A 3IS9A 3QERA 5HRNA 4NCGA 1W9HA 1L3VA 3IRXA 1TL1A 2WOMA 3NF8A 4O5BA 3VA3A 1RT6A 4EZ6A 4LD0A 3DOKA 1O1WA 3ZSYA 3RRHA 1J5OA 3NF6A 1KLMA 4FJ7A 2DFFA 3QEXA 4FXDA 1BQMA 1RTHA 4IKFA 3ALYA 4BDYA 1XI1A 4DTJA 3AVFA 4F3OA 3ZSWA 3TAQA 4LH5A 2ITGA 1C1BA 4KREA 1Y97A 3F73A 2HVHA 1ZBLA 1RBUA 3U3GA 1EP4A 1RBRA 1Q9XA 4FJ5A 1BCMA 2RPIA 3L2WA 4M3YA 4DQIA 4E1NA 4DQQA 4DU1A 1YTAA 3NDKA 3V9UA 4CEBA 4ZTJA 1TGOA 4KV8A 1HYVA 2B5JA 5J2NA 3HK2A 3HM9A 2PYLA 1WAJA 2OZSA 4I7FA 2XO7A 1QHTA 1QS4A 1U49A 1T05A 1D9DA 3NF9A 2QK9A 1Z26A 3ZSRA 1SKSA 4KTWA 1RCHA 4DSIA 4KHSA 5KGWA 4W5NA 5HLFA 4DF4A 4N76A 5D3GA 1ASWA 3HSTB 4CJUA 1JKHA 4ID1A 1C1CA 3OS1A 3WNFA 3C6UA 2X78A 5DMRA 4CESA 3K59A 3OYHA 3K2PA 1VSLA 2YKNA 4FW2A 3V1OA 3WNHA 4CFBA 4FLYA 3VQDA 3K58A 1XC9A 2DFHA 1HYSA 4NYFA 2HHTA 1KVAA 3V9WA 1NK4A 1C6VA 5DK5A 3U3YA 4F4KA 4C8NA 3V4IA 3KD1E 4J2EA 4FJXA 1WSEA 1Q9YA 2HNZA 3O4NA 4M3WA 1IKWA 1BI4B 1A5VA 2I5JA 1IKXA 4PA1A 4CK2A 2D5RA 3QNNA 4FJ9A 4E1MA 4JRPA 4RG8A 4RW7A 3DLEA 2O4GA 3OYMA 3RMAA 4HCBA 1Q8IA 3VQAA 4NCAA 1B9FA 1KVBA 4BE0A 1HQEA 4CF1A 3QNOA 1VSHA 4FLUA 4I9LA 4DQPA 3D0PA 1SKWA 2OA8A 2F8SA 3KK2A 1JLBA 2ETJA 3AVGA 3DRSA 3HP9A 4DTMA 3VQBA 1LWCA 3NGZA 3EYZA 3MXMA 1JXEA 1KTQA 1LW0A 4M3UA 1LWFA 4CEOA 4Q0BA 4QAGA 3SV3A 4OPKA 1JLAA 3NAEA 3CQ8A 1KCFA 3AVNA 3NFAA 4RW4A 3OY9A 3C95A 3KLFA 1JXBA 5EU7A 2E6MA 3L3UA 1VRTA 1G15A 3KKSA 1TKDA 4CJ4A 2P51A 2QKKA 4L8RB 4QOZB 4HUEA 3CG7A 4R5PA 3QEVA 4KHUA 1S9GA 1GOBA 5JS1A 2OPQA 5HRRA 3SUOA 4J2DA 4BACA 2BE2A 3ZSOA 4OKJA 4Y1CA 2WONA 4HUGA 3ULDA 4BDZA 1NJWA 3RWUA 4F2SA 2Z1IA 1QSYA 1WN7A 2YKMA 4HHTA 4M3RA 3L2RA 2XHBA 1JL1A 3VQEA 2RKIA 4Z4HA 1ZYQA 4WE1A 3SV4A 2G8KA 1ZBIA 4IFVA 4TSXA 4CFDA 4AH9A 3B6PA 4CHOA 3V6DA 1I39A 4G1QA 4E0DA 3LP2A 3AV9A 2G8UA 2G8FA 2ZE2A 4CGFA 4CK3A 3KLIA 5HRPA 1EX4A 4O44A 4DTSA 1U4BA 2FBTA 4DFKA 3LANA 2F96A 3OVNA 4Z0UA 5HRSA 3PUFA 3KK1A 4KFBA 1TV6A 3OYLA 4J2BA 2Z1HA 1RDCA 3I8DA 3SPZA 1NK7A 2G8WA 3M8RA 2ATQA 3MXIA 3P5JA 4AILC 2VWKA 4C8OA 3ZT1A 3OYKA 3V9ZA 2OZMA 4CIGA 3LPTA 4EP4A 3MEGA 4DS4A 1L3UA 2GUIA 3LAMA 3QEIA 4OLAA 1RBSA 3LZJA 4DU4A 1RDBA 5FDLA 1VSKA 3T3FA 3S3OA 4FZXC 4DWIA 2XRIA 1S1VA 2GBZA 4DTOA 1KRPA 1CLQA 1HPZA 4CCHA 3ZSZA 3OYFA 1J54A 2HVIA 4F8RA 4EP5A 3V1RA 4OLBA 4CERA 1RTIA 4K8XA 4IG3A 4YFUA 4MQ3A 1JLGA 1VSDA 1EKEA 2DFEA 5E41A 3HYFA 4DQRA 4ZTFA 1C1AA 4CECA 1UA1A 4CJSA 3AVHA 2IAJA 1KSPA 2JLEA 2A1SA 2KQ2A 4KPYA 4E7IA 2O4IA 4FJKA 3T19A 4CHZA 4XIUA 3AVJA 3G0ZA 4CHQA 4M41A 3NE6A 3PX6A 4AHCA 4CJKA 1QSLA 1S1TA 4FK0A 4ELVA 3NBPA 2KZMA 4ELUA 3ZT4A 3ZSQA 3VA0A 1JLFA 3ZT0A 1N6QA 4UQGA 1CXQA 1RT3A 5T7BA 3OYJA 1U47A 1VSIA 4FZYA 4AHVA 1HRHA 4CEFA 1YT3A 1TKZA 4KO0A 1VSMA 2P5OA 4CGIA 4I2QA 1REVA 1LW2A 2P1JA 3AVCA 4C8LA 5FRNA 3RR7A 1DLOA 1LAWA 3JYTA 1S5JA 1B92A 1CXUA 1HQUA 1J9AA 4N47A 5JS2A 4CJQA 3M8SA 3TI0A 3QESA 3UIQA 2YV0X 3QIOA 5C24A 2GV9A 2FBYA 3VQ8A 4CJRA 1N5YA 1BIUA 1J53A 1VSEA 4ID5A 4OKKA 3QO9A 1S6QA 3LP1A 3TR8A 4DLGA 5KTQA 3SJJA 2HHWA 4FLVA 1WAFA 1VRUA 3JSMA 3LZIA 1BGXT 1KVCA 1X1PA 3ISNC 3HPOA 4HTUA 4DQSA 3PO4A 1NKBA 2HHSA 3O4QA 2HHXA 5FRMA 3HT3A 4KB0A 1JLCA 2VWJA 5CYQA 2KFNA 2D0AA 1T7PA 3OS0A 3VQ6A 3RR8A 1HNVA 3DLGA 4H8KA 2XY5A 3KKRA 2PZSA 2DTUA 3AVBA 2BANA 3G10A 2Y1JA 2HHQA 3PY8A 4E3SA 3KLEA 2YNFA 4M3ZA 2IOCA 4DTUA 2A1RA 3AVAA 4E7LA 1HYZA 4DG1A 1BISA 4W5TA 3QINA 4I2PA 1ZBFA 1A5XA 3NH2A 3EY1A 3CFPA 1L5UA 1QTMA 1F21A 1HNIA 3I0SA 4CJFA 4N56A 3KD5E 1TKXA 4BDPA 4KRFA 3OYIA 4CFAA 4CJWA 4H4OA 4DF8A 3SQ4A 1XHXA 4CE9A 3OS2A 1FK9A 5SWMA 1T03A 3E01A 1ZBUA 1R0AA 1I3AA 1U48A 4CEZA 4RW9A 2HNYA 4AHSA 1BQNA 5CYMA 3WNEA 3AO3A 3FFIA 1TKTA 1RILA 4CJTA 1QQCA 1X9MA 4O4GA 3DRPA 1S1UA 4BE1A 3OYGA 3MXJA 2Z1JA 1ASVA 1WLJA 1FKPA 4DS5A 4M3XA 3U6FA 4E19A 4CHPA 2X6SA 3SQ1A 4DLEA 4C8KA 1RDDA 3QLHA 4GMJB 3TABA 3DOLA 1NOZA 2R7YA 4AHUA 3D45A 4CF2A 5I3UA 1NJZA 3T1AA 1S1XA 1ITGA 3DLKA 2EX3A 4CIFA 3THVA 1BCOA 1RTDA 4JRQA 2HHVA 1YVUA 3VQPA 3L8BA 3VQQA 4B9LA 4FJLA 5KRSA 3HPHA 3AVIA 3AA4A 1RTJA 1TK0A 1NKEA 4DSEA 3CM6A 2XY8A 1RT7A 5KRTA 1SL1A 3TAFA 4QCLA 3A2FA 1YTUA 1XWLA 2X74A 1NK8A 4DSKA 1HJRA 5CY4A 5K14A 3K5OA 2YNGA 4O55A 4CEAA 1JL2A 4JS5A 4Z4CA 3TWHA 3RMCA 3SUPA 2YHAA 2RF2A 2OPPA 4W5QA 3V81A 4KB1A 3AO2A 3C94A 3B6OA 1L3TA 3TAMA 4IDKA 4OGEA 1SKRA 1NOYA 1KLNA 4B9MA 3QEWA 4I9QA 3HO1A 4CGHA 4W5OA 3C6TA 4O0IA 4E7HA 4FW1A 1HMVA 4OPJA 4Z4EA 4KHNA 4FK4A 4FJJA 4DFMA 1GOAA 4DMNA 1SUQA 1UOCA 4IBNA 3HXMA 3L2VA 5CZ1A 1KFSA 4FJIA 4FCYA 2OPRA 3AO5A 4B08A 4CEDA 5C25A 4DFPA 4FK2A 1BL3A 4LY7A 3OYCA 3AO1A 4F2RA 1S1WA 4Z4GA 3SUQA 1L3SA 3O3GA 3CFRA 3OJSA 3ZT3A 4CGGA 3OYEA 3TAPA 1Z25A 2FC0A 1TK8A
chains in the Genus database with same CATH superfamily
4J8FA 3L3VA 3R1XA 4BE2A 3RRGA 4DTNA 5M1NA 2E6LA 2ZM6K 3NGIA 4DTRA 1MA9B 2QWPA 4JK7A 1HKBA 1VQ9N 2W42A 1VQ6N 3G6EN 1RDAA 1ZBHA 1W7AA 4J2AA 4YNQA 4KI6A 3EZ5A 3ZEUB 3T1HK 1U2VA 4JI3K 3QB0A 2YJEA 2JGUA 4KTQA 1P90A 4O0JA 4PWDA 1C0MA 3OJUA 5TKWA 1ZC6A 5GAEP 1ZXOA 1TK5A 4DUYK 4OPAA 1NKCA 3W0LA 1RT4A 4JI4K 4BVPA 4LSLA 2XY7A 4NYNA 4B3RK 5CR4A 3MEDA 4JLHA 4CIEA 5J2MA 1B9DA 3IG1A 2BTFA 2X6NA 4B9NA 3P4IA 2ZD1A 1IKYA 4CJ3A 3MN6A 3HVRA 2G8VA 3OYNA 2RN2A 5KQ8A 4YOWA 1Q86O 4AM7A 4EHTA 1IO2A 2BGGA 1UA0A 3SQ2A 2E2NA 4KHWA 1VQ7N 3L4IA 3HVTA 5J1EA 2IDOA 4PY5A 3RTVA 3CMAN 1U45A 4KKOA 3MK6A 5GADP 3NH0A 3VQCA 1IH7A 5KI6A 3KJVA 3L6QA 4DSLA 3CFOA 3LWLA 4WCEL 1BIZA 3NGYA 3LPUA 4BR2A 4RW6A 4Q5VA 1A5WA 4JD2B 4CJ5A 4BRPA 1IBKK 3HPGA 4YY3K 4K8ZA 4DFJA 2NUBA 4W5RA 1X9WA 2KTQA 3ZSVA 1YJNN 4CF8A 3VEYA 3DM2A 1NK5A 5CZ2A 1GOCA 3H3NO 3DI6A 1YVNA 1C0UA 3VQ9A 2YNIA 4GKKK 3L2UA 1EXQA 1NG9A 1O13A 5M1KA 1QE1A 3MWPA 3DWLA 1VQON 3CD6N 4RW8A 3MAQA 2HHUA 2D0BA 2F9TA 1J6ZA 4BG9A 1QSSA 4CJEA 4OJRA 4JV5K 3HL8A 4FJHA 3OYDA 3SK3A 2NRRA 1QHAA 3PIPL 3AVMA 3ZETA 1Q7YO 4KHYA 1CZ9A 1LWEA 2ZF5O 1WSGA 2LSNA 1IKVA 2KKZA 3DLBA 3LP0A 1IV0A 3M6GA 5JLHA 3SCXA 4HVJA 3G4SN 3IKMA 4AHTA 2BDPA 1Q81O 4NXNK 1ATSA 4AHRA 3V1QA 4NCGA 1L3VA 4CZJA 3HI0A 3DOKA 5AJ3K 3RRHA 3H1VX 3CERA 3THWA 4I6MB 1KLMA 3TU5A 3BF1A 4HWIA 4QS8A 3GE1A 4IKFA 1P8ZA 3AVFA 4CBXA 4F3OA 3PSFA 5DM7L 3WXMB 1C1BA 2NRTA 4B1WB 1RBUA 3KZBA 1RBRA 1Q9XA 3L2WA 3OHRA 4DQQA 4DR6K 2NRHA 1NBWA 1HYVA 4M7XA 5AQNA 3HK2A 2OZSA 4I7FA 4EHUA 2P9NA 1QS4A 1U49A 1T05A 1CZAN 4YHHK 3NF9A 3GDQA 4DSIA 1TUYA 4N76A 4IOXA 5D3GA 2OCEA 3C7NA 1JKHA 3C6UA 5DMRA 3V1OA 4CFBA 3K58A 2DFHA 2VGMA 4E1JA 5DK5A 4F4KA 4C8NA 3KD1E 4J2EA 4B3SK 5JICA 2YCHA 3OTOK 1Q9YA 2D5RA 4RG8A 4K0KK 4U67L 1VQKN 1ATNA 1KVBA 4BE0A 4CF1A 3QNOA 1VSHA 2P9KB 4DQPA 3O6WA 1DKGD 3AVGA 4JKCA 4JYAK 1LW0A 4PL8A 2FF6A 3CQ8A 3NFAA 3OY9A 4B1UB 3C95A 3KLFA 3LL3A 4GKJK 2QKKA 3QEVA 4KHUA 1S9GA 2QI2A 3AGRA 5LY3A 2OPQA 4K43A 4BACA 2BE2A 3ZSOA 4Y1CA 3RWUA 4F2SA 4BRDA 4CZIA 4IEEA 4A2BA 2RKIA 1ZYQA 1E4FT 4TSXA 4CFDA 3FFKB 3BF3A 3F9MA 3CXCM 4UY8O 1V4SA 3PUFA 4C23A 4KFBA 4H0VB 1HKGA 1RDCA 1NK7A 3M8RA 2ATQA 2A5XA 3P5JA 4AILC 2OZMA 2O8EA 3MEGA 1L3UA 3VTHA 1RDBA 3T3FA 1T6DA 4DWIA 4JI0K 1S1VA 2A42A 2V52B 4DTOA 4BR5A 3ZSZA 2QWQA 1J54A 4LF7K 1N32K 4JI2K 2O8CB 1RTIA 2Q0RA 4IG3A 4MQ3A 5E41A 2NNWA 3CF5L 4DQRA 1UA1A 3UKRA 3AVHA 3LM2A 1IG8A 1EQYA 1SAZA 3EEQA 1M90O 4ELVA 2W6LA 3C0BA 3TSPA 5EVZA 3HM8A 3ZT0A 2FXUA 3FZKA 4IJNA 1N6QA 4XH1A 4FZYA 5T7BA 1VSIA 1HRHA 4KO0A 4CW7B 4I2QA 1LW2A 2IVOA 2E88A 4FWLA 2WUSA 3JYTA 1HQUA 2YHYA 3D2FB 3GBTA 2GELA 1MDUB 5C24A 2GV9A 4CJRA 4ELUA 1BIUA 1VSEA 4ID5A 3SJJA 1S6QA 3LP1A 3A5MC 1WAFA 3PO4A 1NGHA 2HHSA 1WOQA 3M5RA 3O4QA 1XQSC 3HT3A 2P9IA 1QZ5A 3D6RA 4ISEA 2VWJA 1I94K 3LM9A 2D0AA 5BRFA 2W40A 3WXKA 2XY5A 3O9QA 4RWTA 4JI5K 2DTUA 2BANA 3O8MA 2VGNA 5HL7L 2HHQA 1W97L 1OH8A 3KWGA 4WYBA 3CFPA 1QTMA 2PBDA 1HNIA 3I0SA 3E9OA 3CQXA 4CFAA 4CJWA 3OYIA 3SQ4A 2ITMA 3H1QA 1M1KO 5GIOA 5AQFA 3E01A 1I3AA 1BQNA 4DKWA 3WEEB 3WQTA 2E1ZA 4BE1A 4DR1K 1QZ6A 2I7PA 2A3ZA 1GLBG 4DV2K 4M3XA 4E19A 3QLHA 4GMJB 2RE2A 1NJZA 5I3UA 3T1AA 1ITGA 5ELZA 4DR5K 2CGKA 1RTDA 3DJCA 1BCOA 4JRQA 3HPHA 3AVIA 5AQOA 3TTDA 3R8EA 4BRNA 1JCEA 1YTUA 4KB1A 3V81A 1BOTO 3C94A 1YF5L 3B6OA 3OA9A 3TAMA 1BO5O 3ATVA 1KLNA 4B9MA 3C6TA 4FW1A 4QS7A 1RDUA 4KHNA 2VCPA 4CZEA 4DQ8A 1YUWA 4FJIA 4FCYA 3E9PA 2JWKA 3AO1A 4IDHA 1S1WA 4Z4GA 2V51B 3CFRA 5FLXO 4WFBL 3WT0A 3ZT3A 3J7ZO 3OYEA 4BR0A 2E20A 2FC0A 2F4VK 4BRFA 1DTQA 3ENOA 3F5TA 4IO8A 3H46O 4EZ9A 1N34K 2A41A 4FLWA 3A5LC 3PO5A 1ASUA 1TAQA 3VQ4A 1XC3A 1CZBA 3DYAA 4GW6A 5EOYA 4O8KA 3AARA 3LAKA 4H5NA 4GV9A 3O3FA 4DHYA 2YX6A 3LWMA 4FVMA 2D0CA 3U4LA 3M8PA 1YITN 1N8RO 4HTLA 4CZMA 1VSJA 1WSJA 3AO4A 5I42A 3KLHA 4ILHA 2NRXA 2OYQA 3TANA 2KZZA 1VQLN 2P5GA 4CZGA 3TSQA 4GVMA 5AQSA 5HROA 4Z94A 3CC4N 3ZSXA 2Q36A 1JLQA 4X66K 2Y1IA 4B8AB 4LSNA 2FLOA 3NH1A 3ATUA 2KW4A 3AVKA 3K57A 1JCFA 3SUNA 3EKUA 1SL2A 2ZGZA 3E1YA 1HNZK 4ZHRA 1K6YA 1KC8O 3TAEA 4FWRA 1MWMA 4DV0K 1XHZA 3DLHA 4CJPA 2VQFK 1NK9A 4CGJA 3MMVA 1X9JA 3C6HA 3HZ6A 4YDUC 1NGAA 4PKIA 3I56N 3I8BA 4CFCA 2YNHA 4MFBA 3DXKB 4FWQA 1RT5A 5LJWA 1EWRA 4WQ5C 5CHIA 2UXCK 3NHGA 2E2PA 2QWLA 4BWJA 5J2PA 3WNGA 1NK0A 2HHHK 3KK7A 4M3TA 2QXFA 4FYDA 1X9SA 5M1FA 3SPYA 2VG6A 3K5NA 4JKDA 2YHBA 3TTCA 2OANA 1T44A 3KK3A 2UXDK 2QWRA 3K5LA 2QKBA 5HP1A 1NGDA 1DEJA 3OBWA 1S6PA 4FM2A 5BR9A 4DR3K 2W6KA 1QQNA 4E89A 3T69A 4IFYA 3QEPA 3VEZA 3DMJA 2E4LA 1K73O 1KFDA 4BRQA 4CHYA 1NMDA 4CD1A 3QICA 2HB5A 4BR9A 1VQNN 3H45C 3GOIA 1OH7A 3QIPA 1SV5A 4CHNA 4H0XB 2V7YA 4B9SA 5JVHL 4CF0A 4CJVA 2VYPA 3J81O 5HOOA 1GLJO 4CZFA 5F1XA 1TL1A 2WOMA 4O5BA 4BGAA 2NZTA 5AQWA 2DFFA 3QEXA 3D2EB 5AQXA 4JNEA 1HNXK 2GEMA 4DTJA 3OBYA 3BEXA 3ZSWA 4JKGA 3A0IX 2P9SB 1Y97A 1ZBLA 3U3GA 1EP4A 1BCMA 4MO5A 4Y0WA 4CD3A 1N36K 4JKAA 3NDKA 4YOXA 3QDKA 4CEBA 2B5JA 4IXCA 4L3QA 2FSJA 4WF9L 2PYLA 2P9LB 1VAZA 4KTWA 5ADXH 4O5FA 5HLFA 1ASWA 1LOTB 2CH5A 3ULEB 3K2PA 1VSLA 4FLYA 2HHTA 3VQDA 1XC9A 1HYSA 3VESA 1NK4A 1C6VA 2W41A 4K25A 4FJXA 3RVCA 4M3WA 1IKWA 1BI4B 3I55N 2I5JA 4FWSA 3SAHA 4CK2A 2O8FA 3EN9A 2O4GA 3ENBA 2WTUA 1HR0K 1QQMA 3JAMO 4I9LA 2NLXA 2OA8A 3SBGA 3F2KA 3HP9A 4DTMA 2QM1A 3NGZA 1LWCA 4QS9A 4B1YB 4ILGB 4CEOA 4QAGA 4OPKA 3NAEA 1T3VA 4DR7K 5MLCQ 1NGFA 2V7ZA 5EU7A 3L3UA 5E84A 5AQVA 1TKDA 2ASOA 4L8RB 3VERA 4R5PA 3E66A 5JS1A 1FW6A 3ID6A 3ULDA 3R9PA 2YKMA 2XHBA 4IZ9A 1JL1A 1ZBIA 5EX5A 1I39A 3LP2A 4CGFA 3KLIA 1EX4A 3IMXA 2FBTA 3LANA 1BUPA 2F96A 3OVNA 4DR4K 4FWOA 1TV6A 3I33A 3I8DA 2G8WA 1RGIA 4NB4A 3MXIA 2VWKA 1NGIA 4C8OA 3OYKA 3V9ZA 3LDNA 1GLLO 4EP4A 1GLEG 5AQPA 3S3OA 5FDLA 1VSKA 4FZXC 4BRCA 2GBZA 1YHQN 3OYFA 4AM6A 4JAXA 4YORA 1HNWK 4YFUA 1JLGA 1VSDA 3TPQA 4R79A 1C1AA 4H0PA 2IAJA 1NGBA 2KQ2A 5JLFA 4E7IA 3BZCA 4M41A 1VQMN 1S1TA 3CJCA 4IEIA 3SLCA 1WBBA 4FK0A 2KZMA 2Q31A 2ZGYA 3JS6A 2A6AA 4BROA 1TUUA 4UQGA 3OYJA 2E2OA 1TKZA 2P1JA 1ATRA 4IO9L 1OKJA 4LF5K 1DLOA 2J4RA 5JS2A 1B92A 4N47A 3M8SA 1J9AA 3QESA 4JEPA 4FWNA 2UXBK 3JSMA 3LZIA 1KVCA 3ZEUA 5AQLA 1NKBA 3C6AA 3CCQN 3MN5A 4KB0A 4AQYK 3DAWA 2KFNA 1T7PA 3VQ6A 3C65A 3U9DA 3D7EO 2OTLN 1JJ2M 3AVBA 3G10A 4CBUA 1C0FA 5GAGP 2CH6A 4DG1A 4W5TA 3UE5A 1ZBFA 1OH5A 4KRFA 4CJFA 2A40A 1S22A 2P9LA 1GLDG 3OS2A 1FK9A 1S3XA 1R0AA 1U48A 3AAPA 4RW9A 4N41A 3AO3A 4KBOA 1X9MA 1VHXA 4CJTA 4WQ4A 1S1UA 5KPRA 1JCGA 3ZX3A 1FKPA 4JKBA 2X6SA 4B1XB 3CCUN 3DOLA 4LC9B 3D45A 4M63C 1S1XA 3Q7BA 4O8UA 2ASPA 4LF8K 3DLKA 5AQQA 3HRGA 4A57A 1YVUA 3L8BA 4B9LA 5KRSA 1RTJA 4JD2A 4DSEA 3NMUA 1SL1A 3TAFA 4LFAK 2QWOA 4DSKA 1HJRA 2YNGA 4OX9K 4W5QA 2Q0UA 4K42A 4OO1J 1YIJN 4H0OA 5KQDA 4IDKA 2DPNA 3CCJN 4H5WA 3QEWA 2QW9A 4CGHA 4W5OA 3CPEA 5AZIB 2HBMA 1NWKA 4OPJA 4BREA 5AQIA 4FK4A 3CQYA 3N4QA 4DMNA 3L2VA 5FPNA 4BR7A 2OPRA 1XNRK 2ZWHA 4FK2A 3OYCA 4BC4A 3SUQA 2VWBA 1L3SA 3O3GA 5IT9O 1NJIO 3OJSA 5BN9A 4LF6K 4B1VA 4KH4A 3O3HA 2Q2RA 5BPLA 4FJGA 1HPMA 4CGDA 3A5OC 3CIPA 4JK9A 3CCVN 1BHLA 3S9HA 1K9MO 2QXLA 3NF7A 2DY4A 1V4TA 1UAXA 2VG5A 5BPNA 4A5AA 4BRAA 2ASMA 4LFCK 4HUFA 3UKUB 4BWMA 1WSIA 4B9TA 1X3NA 4MLEA 3LDSA 4BVOA 3SMPA 4CZKA 1NJYA 3PX4A 5C2FA 4N5SA 1RT1A 4A5BA 4OKEA 4A62A 3HJFA 4I6MA 2HMIA 4H4MA 4FM0A 2F7TA 3ITHA 1OH6A 1FXXA 3MWTA 2NRWA 4DTPA 3TARA 1VQPN 1SL0A 3TAGA 1D8YA 3G25A 3F9KA 1HJOA 3M3ZA 4H5TA 4OVLA 4FM1A 4KHQA 4CVNE 3PX0A 3MEEA 3VOVA 4FLTA 4CZLA 4FSVA 1UWBA 1S9EA 4KI4A 2Q1NA 1XMQK 2AJQA 4KTZA 3CC7N 5C0YA 5AQHA 4BR4A 2WC9A 3OYAA 5KGXA 2GX9A 4PQUA 4OGCA 3O9RA 3VQ7A 4V19S 3V9SA 1C0TA 3AVLA 4PUOA 5DM6L 4X62K 5FPEA 3AA5X 1LCUA 2Q97A 3ZT2A 2FBXA 3HP6A 1T8EA 3U9ZA 3QETA 1LAVA 4OPHA 1H1VA 3MECA 1D9FA 2PY5A 4B3OA 2FBVA 3VTIA 2P9KA 2B4JA 3P1GA 3VN5A 1WNSA 1DTTA 1LV5A 3AY9A 4Y1DA 4FPBA 3KTQA 3S3MA 2HF3A 3I0RA 4PKHA 5J2QA 4WFNL 3K5MA 2HBKA 3QBWA 3VMFB 1D5AA 5I9EB 3SQ0A 4NCBA 2G8HA 1KXPA 4MLHA 4H0YB 3PIOL 1RBTA 4E7JA 3J7YP 4FJNA 3A5NC 5BREA 3SNNA 4C8MA 3SZ2A 5F2RA 1ILYA 4G9ZA 2QTDA 4Z4IA 2NRZA 2HF4A 1VSFA 4JS4A 4DB3A 1JLEA 3O4WA 5SZTA 4DU3A 3BP8A 3RMBA 1HUXA 1RFQA 3HTVA 2D4WA 4IJAA 1NU0A 5HRNA 3QERA 1NM1A 1W9HA 3IRXA 3NF8A 5AQGA 1RDWX 3VA3A 1RT6A 2IVPA 4LD0A 3ZSYA 3NF6A 4PL7A 4FXDA 2O8BB 1BQMA 3ALYA 3KWIA 2FSKA 3TAQA 4LH5A 4DR2K 2O8CA 2HSTA 1KD1O 4FJ5A 2RPIA 3K9KA 4M3YA 4B1ZA 4DQIA 2HOEA 4E1NA 1YTAA 4ZTJA 3V9UA 5AQRA 2HW3A 5J2NA 4B3TK 3BY5A 2XO7A 1WB9A 1QHTA 3T1YK 1D9DA 3THXB 3ZSRA 1SKSA 1RCHA 4KHSA 4DF4A 3HSTB 4ID1A 5ADXA 3WNFA 3K59A 2X78A 3WNHA 3ZLJA 4NYFA 3N4PA 3V9WA 4LF9K 1J5EK 3ZX0A 5LJVA 3DXMB 2HNZA 3O4NA 3UKUA 4M7YA 3THYB 1A5VA 2HBJA 2AA4A 1IKXA 4FVUA 3QNNA 2D1KA 4FJ9A 4JRPA 1YI2N 3DLEA 3D2FA 3OYMA 4X65K 3RMAA 1Q8IA 2JWLA 1B9FA 5BN8A 4BC5A 5C10A 2D0OA 4FPAA 1JLBA 2ETJA 3VEVA 3WQUA 4KH6A 3OW2M 4PKGA 1JXEA 1KTQA 4Q0BA 4JK8A 1KCFA 3AVNA 3FR0A 1JXBA 4NLBA 2E6MA 1R59O 5LMUK 1VRTA 4JKHA 4NO7A 4BRHA 3QMLA 1G15A 4CJ4A 2P51A 4QOZB 4DV7K 3SUOA 5HRRA 5JMVA 4OKJA 2WONA 4HUGA 1D4XA 4HHTA 2E1YA 4Z4HA 4IFVA 3CJ9A 4AH9A 3B6PA 4CHOA 4CZHA 4G1QA 3V6DA 2O8DB 1HLUA 2G8UA 2G8FA 2ZJRL 3WEEA 4O44A 5HRSA 4H0TB 1U6ZA 3OYLA 4J2BA 1IBMK 3SPZA 5M1OA 3VEXA 3ZT1A 4MDAA 5FPMA 3LPTA 1QQOA 5C2DA 2GUIA 4JI6K 4IOAL 1SS6A 3LZJA 4DU4A 4GNIA 3J80O 5AFUH 2GTDA 1HPZA 3FZFA 2AP1A 4F8RA 3V1RA 4GV3A 3IUCA 4K8XA 3HYFA 4CECA 4CJSA 2JLEA 4BC3A 1Y64A 4X64K 2P9NB 4B3MK 4CHZA 4CHQA 3CJ7A 5M1QA 4CJKA 1QSLA 3MN7A 3C7NB 5C15A 3SAFA 2FF3B 3VA0A 3VGMA 1JLFA 3CCRN 3CCLN 3B8AX 1CXQA 1RT3A 4AHVA 4CEFA 3O5BA 4DUZK 1REVA 3AVCA 3VEOA 3WXJA 3LDLA 3RR7A 4A61A 1S5JA 4CJQA 3TI0A 4YOTA 3UIQA 4MDBA 4BRGA 2YV0X 3CCEN 2FBYA 3L0QA 1J53A 3TR8A 4OKKA 3QO9A 4CI6A 5B8HA 2IVNA 4HTUA 1BGXT 1X1PA 3ISNC 2HHXA 5FRMA 2O8BA 1JLCA 1IJJA 3J7AP 3G71N 3RR8A 1HNVA 2OTJN 1N33K 4H8KA 3KKRA 2PZSA 1FJGK 4DV4K 2WBNA 3VETA 2Y1JA 3IFRA 3CCMN 3PLAA 3KLEA 2NRVA 2YNFA 4M3ZA 3WUHA 4DTUA 4E7LA 3O1BA 3A8YA 4I2PA 4JI7K 3NH2A 3EY1A 1L5UA 1F21A 3KD5E 4N56A 4H4OA 4GY2B 4NXMK 5AR0A 1Z6RA 3THXA 5SWMA 1ZBUA 3U8XA 1YXQA 2HNYA 4AHSA 2BH1A 3FFIA 1QQCA 4ISFA 5E26A 3DRPA 3VF6A 1WLJA 3U6FA 1EWQA 4CHPA 2O8EB 3DXMA 5AZJB 3SQ1A 4DLEA 3THYA 3TABA 1NOZA 4AHUA 2QA4N 4NLCA 3LDQA 1DT9A 4IOCL 2EX3A 2HHVA 4DV5K 3NVMA 3VQQA 1W2BM 3FZHA 1TK0A 3DXKA 3RSEB 2XY8A 5LMNK 4H5RA 1RT7A 5EY4A 3A2FA 4CEAA 5K14A 3TWHA 4O55A 3SUPA 4K41A 1JL2A 3BZKA 5AQYA 3KVGA 3RMCA 2YHAA 2OPPA 3AO2A 3UKRB 4FO0A 4DCHA 2QEXN 4OGEA 4FWPA 5BRHA 4DV6K 1NOYA 2UUAK 4O0IA 3GG4A 4XH5A 4Z4EA 4FJJA 1GOAA 1UOCA 2RHKA 2YI1A 3HXMA 3AO5A 4B08A 5C25A 4CEDA 5A2QO 4DFPA 1BL3A 4LY7A 4F2RA 4XH4A 5GINA 1G99A 3FLCO 4CGGA 4FWKA 1GLFO 3VQ5A 3CPWM 1TK8A 3KIOA 4KH5A 2IC3A 2O8DA 4DSFA 4F9OA 4CEQA 5HBMA 5AQUA 3CYMA 3SMSA 3O9UA 3ZCMA 3DLLL 3LDPA 4DSJA 4EIAA 3AA2A 2ZQBA 4B9QA 3RMDA 2PYJA 3H08A 4RCHA 4Z4FA 4DTXA 2EHGA 3CM5A 1TVRA 2ZJQL 3CJAA 1VQ5N 4BGBA 2YHWA 1GLCG 2OPSA 3NVKA 1K8KB 2P9IB 4FLZA 2Q3SA 2F8TA 4KAZA 2PFUA 4FJMA 1OVQA 3DRRA 2VG7A 4BRIA 1NNEA 4B9VA 4DV3K 2GWJA 3E9LA 5FPDA 4MO4A 3SYZA 3L2QA 1VK0A 5BRDA 4B8CA 2KLAA 1ZBSA 3S3NA 1YAGA 4ICLA 1Q18A 3LALA 4FJ8A 3PV8A 3D2EA 5AQJA 2E5LK 4GV6A 3M8QA 2HNDA 1WSHA 3FGUA 2IS3A 2E2QA 2P9SA 3CC2N 1KAXA 4CEEA 1EETA 1NGEA 3K9JA 5C12A 4FLXA 1ESVA 1TAUA 4YOYA 3KLGA 3ID8A 3P31A 4BQLA 3T7ZA 5C42A 4XEIA 1MU2A 4A59A 3AA3A 2WFBA 4BRLA 1RT2A 1W0HA 2UYTA 4M45A 3CI5A 3SAGA 2IGIA 5AQTA 3EE9A 3ULEA 2G8IA 3BDPA 4B9UA 5AQKA 2XY6A 4HCCA 1TL3A 2H3GX 4C1NK 3EE8A 1SZ2A 5TKYA 1RNHA 4FZZA 1XMOK 3O08A 1BI4A 4CK1A 4ELTA 5F0XA 2HMPA 3MN9A 3LP3A 1NMNA 1BG3A 3P83D 1BU6O 3GL1A 3OYBA 1NK6A 4CJLA 1U04A 3BGRA 3ASMA 3TSUA 4CF9A 3HOTA 4IG0A 5BPMA 1RBVA 1IG9A 1MWKA 1Q82O 3IAYA 3VGLA 3V9XA 4LH4A 1K8AO 3ZX2A 1WBDA 4IFEA 4EFHA 1FKOA 1XUPO 1YJWN 3IDHA 1NJXA 4E7KA 2B6AA 4FWMA 4YOVA 1TYQB 4JI8K 1T6CA 3K0SA 2UUBK 2KHOA 3Q7CA 5AZJA 3HOSA 3SI6A 4F3TA 1WSFA 3EL2A 5M1PA 3NCIA 2Z1GA 2KFZA 3TTFA 1X3MA 3VEWA 5FROA 3DLRA 2HBLA 1VQ4N 3RSEA 3IS9A 1BWFO 1DGKN 4EZ6A 2P9UB 1C0GA 1O1WA 2YHXA 1J5OA 3EO3A 1VQ8N 4FJ7A 1RTHA 1XI1A 4BDYA 3UB5A 4JHDB 5KPTA 2PAVA 2ITGA 3O80A 3F73A 2HVHA 3QFPA 3P38A 5BR8K 4DV1K 1OVYA 5H1SQ 2YJFA 4DU1A 3L4QA 4KREA 1TGOA 4KV8A 3HM9A 3S41A 1WAJA 1BA0A 4JI1K 1NLVA 4LF4K 4BC2A 2QK9A 1Z26A 5KGWA 4WQ4C 3H3OB 4W5NA 3JXUA 1QVGM 4CJUA 2CGLA 1C1CA 2P9PB 3OS1A 1BDGA 4RTFD 4M42A 4CESA 3OYHA 4FW2A 2YKNA 2GUPA 1KVAA 3U3YA 3V4IA 4ISGA 1WSEA 1K8KA 2BUPA 2GWKA 1NGCA 4PA1A 1XNQK 2E8AA 4E1MA 3H6EA 4RW7A 4ILJA 2QWNA 3CHWA 4HCBA 3VQAA 4NCAA 3O9SA 3CJBA 1HQEA 4FLUA 1E4GT 3D0PA 1SKWA 2F8SA 4BRKA 3KK2A 3DRSA 3FE1A 3VQBA 3EYZA 3MXMA 4M3UA 4H5VA 1LWFA 3AAQA 4BY9C 3SV3A 1JLAA 2ZJPL 3SBTA 4RW4A 4LFBK 4JKFA 3KKSA 4HUEA 3CG7A 3O9TA 4YOUA 1GOBA 4PHTX 4J2DA 4EAHD 4BDZA 1NJWA 2Z1IA 1QSYA 1WN7A 4M3RA 3L2RA 3CJ1A 3VQEA 2I7NA 4WE1A 3FZLA 3SV4A 2G8KA 4H03B 2EWSA 2QWMA 4E0DA 3AV9A 2ZE2A 2FSNA 4IWVA 4CK3A 5HRPA 4DTSA 1U4BA 4DFKA 4Z0UA 3BUZB 4YDUA 3WXIA 3KK1A 2VQEK 2Z1HA 3SJHA 3FZMA 4WQ5A 3R3LA 4CIGA 4DS4A 1U2VB 3LAMA 3QEIA 4OLAA 1RBSA 3MX5A 4U7BA 3MX2A 5GAHP 2XRIA 3VGKA 1CLQA 1NGGA 1KRPA 4JKGB 3ENHA 4CCHA 3MCPA 2HVIA 4EP5A 5AFUA 1KAZA 4CERA 3KHYA 3HSCA 1EKEA 2DFEA 4WFAL 3MDQA 4ZTFA 4GVEA 1KSPA 4BRMA 2A1SA 4KPYA 2IIRA 2O4IA 4FJKA 3T19A 4XIUA 3AVJA 3G0ZA 3NE6A 3PX6A 5LL6Z 5AZIA 3HBTA 4FOIA 4BQZA 4AHCA 4JN4A 1TYQA 3CETA 3NBPA 5CE3A 3ZT4A 1QVFM 3EZWA 3ZSQA 3CCSN 1SQKA 5AQMA 1U47A 1YT3A 3CMEN 1VSMA 2P5OA 4CGIA 1E3MA 3VENA 4C8LA 3M1FA 2O8FB 5FRNA 5KPZA 1LAWA 5GIPA 4KHPK 1CXUA 1HX1A 3EKSA 3QIOA 3VQ8A 3W3DA 4DLGA 2P9UA 5KTQA 2HHWA 4FLVA 1VRUA 3HPOA 4DQSA 2UU9K 5CYQA 3OS0A 4JKEA 4JHDA 3DLGA 1KAYA 2D0PA 3PY8A 4E3SA 3ZYYX 2IOCA 2A1RA 3AVAA 1HYZA 3AGKA 1BISA 3QINA 3O1WA 1A5XA 3QFUA 1TKXA 4BDPA 1WUAA 3LDOA 4DF8A 3R6MA 1XHXA 4CE9A 1T03A 1HKCA 4A2AA 1KQSM 4CEZA 1N5YA 5CYMA 3WNEA 1TKTA 1RILA 2P9PA 1IBLK 4O4GA 3ZETB 5AQZA 3WXLA 3OYGA 3MXJA 2Z1JA 1ASVA 4DS5A 3VF4A 4AF1A 1GLAG 4C8KA 1RDDA 2R7YA 4CF2A 1BA1A 1S72N 2CGJA 2UUCK 4CIFA 3VF2A 3THVA 3VQPA 3PSIA 4FJLA 4C1NI 4CBWA 3AA4A 1NKEA 3CM6A 5KRTA 4QCLA 5JVGL 5EXWA 1XWLA 2X74A 1NK8A 5CY4A 3K5OA 1Z05A 4JS5A 5IWAK 4Z4CA 4OLBA 2RF2A 4BG8A 4FOEA 1NGJA 3VPZA 1L3TA 3THWB 4FL9A 1SKRA 2F9WA 1YJ9N 4I9QA 3P39A 3HO1A 4CJ7A 4E7HA 1HMVA 3J8AA 4DFMA 1SUQA 4IBNA 5CZ1A 1KFSA 1EO1A 3QBXA 3TAPA 3MCAB 1Z25A
chains in the Genus database with same CATH topology
3KIOA 2IC3A 3L3VA 3O3HA 1DTQA 4BE2A 4DSFA 3RRGA 4FJGA 4CGDA 4CEQA 4DTNA 2E6LA 5HBMA 3NGIA 3CYMA 4DTRA 4EZ9A 1BHLA 3ZCMA 2W42A 4FLWA 4DSJA 3S9HA 1RDAA 1ZBHA 3AA2A 2ZQBA 4J2AA 4YNQA 3NF7A 2PYJA 3RMDA 3PO5A 4KI6A 2DY4A 1UAXA 1ASUA 1TAQA 3H08A 3EZ5A 4Z4FA 2VG5A 4DTXA 2EHGA 3CM5A 1TVRA 3VQ4A 2OPSA 4HUFA 1CZBA 2JGUA 3DYAA 4GW6A 4O0JA 4BWMA 4KTQA 3LAKA 4PWDA 1WSIA 4FLZA 1C0MA 3O3FA 2Q3SA 3OJUA 4B9TA 3LWMA 2F8TA 4KAZA 3LDSA 4FVMA 1TK5A 4FJMA 2D0CA 1NKCA 3DRRA 1RT4A 3M8PA 1NJYA 3PX4A 2VG7A 4B9VA 4LSLA 2XY7A 4NYNA 1VSJA 3MEDA 1WSJA 3AO4A 4JLHA 4N5SA 4CIEA 3SYZA 3L2QA 1RT1A 1B9DA 1VK0A 3IG1A 4OKEA 4B8CA 3KLHA 5J2MA 5I42A 3TANA 3S3NA 4ICLA 2OYQA 3HJFA 2KZZA 3LALA 4FJ8A 2X6NA 3PV8A 4B9NA 2P5GA 2HW3A 2ZD1A 1IKYA 3M8QA 4CJ3A 2HNDA 4GVMA 3HVRA 2HMIA 2G8VA 4H4MA 3OYNA 1WSHA 2RN2A 4FM0A 5HROA 3ITHA 2IS3A 1FXXA 3ZSXA 4DTPA 3TARA 1JLQA 4CEEA 2Y1IA 1EETA 4LSNA 4B8AB 3NH1A 3TAGA 2KW4A 1IO2A 3F9KA 1SL0A 1D8YA 3AVKA 2BGGA 4FLXA 1UA0A 3K57A 3SQ2A 4KHWA 3SUNA 1TAUA 4OVLA 1SL2A 4FM1A 3HVTA 5J1EA 4KHQA 2IDOA 3PX0A 3MEEA 4ZHRA 1K6YA 4FLTA 4PY5A 3KLGA 3RTVA 3TAEA 1U45A 1UWBA 1S9EA 4KKOA 4KI4A 1XHZA 3DLHA 3NH0A 3VQCA 1IH7A 4CJPA 2AJQA 5KI6A 5C42A 3KJVA 4KTZA 1NK9A 1MU2A 4CGJA 4N41A 4DSLA 3AA3A 3CFOA 3LWLA 1RT2A 1BIZA 1W0HA 3NGYA 3LPUA 4M45A 5KGXA 3OYAA 4PQUA 2IGIA 4RW6A 2G8IA 4CFCA 2YNHA 3BDPA 4Q5VA 1A5WA 4MFBA 4CJ5A 4B9UA 4OGCA 2XY6A 3VQ7A 1TL3A 4HCCA 1RT5A 3V9SA 1C0TA 3HPGA 3AVLA 4PUOA 4K8ZA 3NHGA 4DFJA 1RNHA 2NUBA 4W5RA 4FZZA 3AA5X 1X9WA 2KTQA 3ZSVA 1BI4A 3ZT2A 2FBXA 4CK1A 3HP6A 4BWJA 4CF8A 5J2PA 3WNGA 1T8EA 1NK0A 4ELTA 3LP3A 1LAVA 3VQ5A 3P83D 3QETA 3DM2A 1NK5A 5CZ2A 3OYBA 4M3TA 1GOCA 2QXFA 3DI6A 4FYDA 1X9SA 4CJLA 1NK6A 1C0UA 3VQ9A 1U04A 2YNIA 3BGRA 3ASMA 2VG6A 3MECA 3SPYA 1D9FA 2PY5A 4B3OA 4CF9A 1EXQA 3L2UA 4IG0A 3K5NA 2FBVA 2YHBA 1RBVA 2B4JA 3P1GA 3VN5A 1DTTA 1QE1A 1WNSA 1LV5A 4Y1DA 3KK3A 1IG9A 3IAYA 3KTQA 3V9XA 3K5LA 3S3MA 2QKBA 4RW8A 3I0RA 4LH4A 5J2QA 5HP1A 1S6PA 3MAQA 2HHUA 2D0BA 3K5MA 1QSSA 4FM2A 1D5AA 3SQ0A 4NCBA 4CJEA 2G8HA 4OJRA 1RBTA 3HL8A 4E89A 4E7JA 4FJHA 3OYDA 1FKOA 4FJNA 4IFYA 3AVMA 4E7KA 3QEPA 1NJXA 2B6AA 3SNNA 4C8MA 3SZ2A 4KHYA 1CZ9A 3DMJA 1LWEA 2E4LA 1KFDA 4CHYA 2HB5A 1WSGA 2LSNA 1IKVA 3SI6A 3DLBA 4Z4IA 3LP0A 4F3TA 1WSFA 1VSFA 4JS4A 1JLEA 3QIPA 1SV5A 5SZTA 3NCIA 4CHNA 2Z1GA 4DU3A 2KFZA 3SCXA 4HVJA 3RMBA 4B9SA 4AHTA 5FROA 2BDPA 4CF0A 4CJVA 3DLRA 4AHRA 3V1QA 4M42A 3IS9A 3QERA 5HRNA 4NCGA 1W9HA 1L3VA 3IRXA 1TL1A 2WOMA 3NF8A 4O5BA 3VA3A 1RT6A 4EZ6A 4LD0A 3DOKA 1O1WA 3ZSYA 3RRHA 1J5OA 3NF6A 1KLMA 4FJ7A 2DFFA 3QEXA 4FXDA 1BQMA 1RTHA 4IKFA 3ALYA 4BDYA 1XI1A 4DTJA 3AVFA 4F3OA 3ZSWA 3TAQA 4LH5A 2ITGA 1C1BA 4KREA 1Y97A 3F73A 2HVHA 1ZBLA 1RBUA 3U3GA 1EP4A 1RBRA 1Q9XA 4FJ5A 1BCMA 2RPIA 3L2WA 4M3YA 4DQIA 4E1NA 4DQQA 4DU1A 1YTAA 3NDKA 3V9UA 4CEBA 4ZTJA 1TGOA 4KV8A 1HYVA 2B5JA 5J2NA 3HK2A 3HM9A 2PYLA 1WAJA 2OZSA 4I7FA 2XO7A 1QHTA 1QS4A 1U49A 1T05A 1D9DA 3NF9A 2QK9A 1Z26A 3ZSRA 1SKSA 4KTWA 1RCHA 4DSIA 4KHSA 5KGWA 4W5NA 5HLFA 4DF4A 4N76A 5D3GA 1ASWA 3HSTB 4CJUA 1JKHA 4ID1A 1C1CA 3OS1A 3WNFA 3C6UA 2X78A 5DMRA 4CESA 3K59A 3OYHA 3K2PA 1VSLA 2YKNA 4FW2A 3V1OA 3WNHA 4CFBA 4FLYA 3VQDA 3K58A 1XC9A 2DFHA 1HYSA 4NYFA 2HHTA 1KVAA 3V9WA 1NK4A 1C6VA 5DK5A 3U3YA 4F4KA 4C8NA 3V4IA 3KD1E 4J2EA 4FJXA 1WSEA 1Q9YA 2HNZA 3O4NA 4M3WA 1IKWA 1BI4B 1A5VA 2I5JA 1IKXA 4PA1A 4CK2A 2D5RA 3QNNA 4FJ9A 4E1MA 4JRPA 4RG8A 4RW7A 3DLEA 2O4GA 3OYMA 3RMAA 4HCBA 1Q8IA 3VQAA 4NCAA 1B9FA 1KVBA 4BE0A 1HQEA 4CF1A 3QNOA 1VSHA 4FLUA 4I9LA 4DQPA 3D0PA 1SKWA 2OA8A 2F8SA 3KK2A 1JLBA 2ETJA 3AVGA 3DRSA 3HP9A 4DTMA 3VQBA 1LWCA 3NGZA 3EYZA 3MXMA 1JXEA 1KTQA 1LW0A 4M3UA 1LWFA 4CEOA 4Q0BA 4QAGA 3SV3A 4OPKA 1JLAA 3NAEA 3CQ8A 1KCFA 3AVNA 3NFAA 4RW4A 3OY9A 3C95A 3KLFA 1JXBA 5EU7A 2E6MA 3L3UA 1VRTA 1G15A 3KKSA 1TKDA 4CJ4A 2P51A 2QKKA 4L8RB 4QOZB 4HUEA 3CG7A 4R5PA 3QEVA 4KHUA 1S9GA 1GOBA 5JS1A 2OPQA 5HRRA 3SUOA 4J2DA 4BACA 2BE2A 3ZSOA 4OKJA 4Y1CA 2WONA 4HUGA 3ULDA 4BDZA 1NJWA 3RWUA 4F2SA 2Z1IA 1QSYA 1WN7A 2YKMA 4HHTA 4M3RA 3L2RA 2XHBA 1JL1A 3VQEA 2RKIA 4Z4HA 1ZYQA 4WE1A 3SV4A 2G8KA 1ZBIA 4IFVA 4TSXA 4CFDA 4AH9A 3B6PA 4CHOA 3V6DA 1I39A 4G1QA 4E0DA 3LP2A 3AV9A 2G8UA 2G8FA 2ZE2A 4CGFA 4CK3A 3KLIA 5HRPA 1EX4A 4O44A 4DTSA 1U4BA 2FBTA 4DFKA 3LANA 2F96A 3OVNA 4Z0UA 5HRSA 3PUFA 3KK1A 4KFBA 1TV6A 3OYLA 4J2BA 2Z1HA 1RDCA 3I8DA 3SPZA 1NK7A 2G8WA 3M8RA 2ATQA 3MXIA 3P5JA 4AILC 2VWKA 4C8OA 3ZT1A 3OYKA 3V9ZA 2OZMA 4CIGA 3LPTA 4EP4A 3MEGA 4DS4A 1L3UA 2GUIA 3LAMA 3QEIA 4OLAA 1RBSA 3LZJA 4DU4A 1RDBA 5FDLA 1VSKA 3T3FA 3S3OA 4FZXC 4DWIA 2XRIA 1S1VA 2GBZA 4DTOA 1KRPA 1CLQA 1HPZA 4CCHA 3ZSZA 3OYFA 1J54A 2HVIA 4F8RA 4EP5A 3V1RA 4OLBA 4CERA 1RTIA 4K8XA 4IG3A 4YFUA 4MQ3A 1JLGA 1VSDA 1EKEA 2DFEA 5E41A 3HYFA 4DQRA 4ZTFA 1C1AA 4CECA 1UA1A 4CJSA 3AVHA 2IAJA 1KSPA 2JLEA 2A1SA 2KQ2A 4KPYA 4E7IA 2O4IA 4FJKA 3T19A 4CHZA 4XIUA 3AVJA 3G0ZA 4CHQA 4M41A 3NE6A 3PX6A 4AHCA 4CJKA 1QSLA 1S1TA 4FK0A 4ELVA 3NBPA 2KZMA 4ELUA 3ZT4A 3ZSQA 3VA0A 1JLFA 3ZT0A 1N6QA 4UQGA 1CXQA 1RT3A 5T7BA 3OYJA 1U47A 1VSIA 4FZYA 4AHVA 1HRHA 4CEFA 1YT3A 1TKZA 4KO0A 1VSMA 2P5OA 4CGIA 4I2QA 1REVA 1LW2A 2P1JA 3AVCA 4C8LA 5FRNA 3RR7A 1DLOA 1LAWA 3JYTA 1S5JA 1B92A 1CXUA 1HQUA 1J9AA 4N47A 5JS2A 4CJQA 3M8SA 3TI0A 3QESA 3UIQA 2YV0X 3QIOA 5C24A 2GV9A 2FBYA 3VQ8A 4CJRA 1N5YA 1BIUA 1J53A 1VSEA 4ID5A 4OKKA 3QO9A 1S6QA 3LP1A 3TR8A 4DLGA 5KTQA 3SJJA 2HHWA 4FLVA 1WAFA 1VRUA 3JSMA 3LZIA 1BGXT 1KVCA 1X1PA 3ISNC 3HPOA 4HTUA 4DQSA 3PO4A 1NKBA 2HHSA 3O4QA 2HHXA 5FRMA 3HT3A 4KB0A 1JLCA 2VWJA 5CYQA 2KFNA 2D0AA 1T7PA 3OS0A 3VQ6A 3RR8A 1HNVA 3DLGA 4H8KA 2XY5A 3KKRA 2PZSA 2DTUA 3AVBA 2BANA 3G10A 2Y1JA 2HHQA 3PY8A 4E3SA 3KLEA 2YNFA 4M3ZA 2IOCA 4DTUA 2A1RA 3AVAA 4E7LA 1HYZA 4DG1A 1BISA 4W5TA 3QINA 4I2PA 1ZBFA 1A5XA 3NH2A 3EY1A 3CFPA 1L5UA 1QTMA 1F21A 1HNIA 3I0SA 4CJFA 4N56A 3KD5E 1TKXA 4BDPA 4KRFA 3OYIA 4CFAA 4CJWA 4H4OA 4DF8A 3SQ4A 1XHXA 4CE9A 3OS2A 1FK9A 5SWMA 1T03A 3E01A 1ZBUA 1R0AA 1I3AA 1U48A 4CEZA 4RW9A 2HNYA 4AHSA 1BQNA 5CYMA 3WNEA 3AO3A 3FFIA 1TKTA 1RILA 4CJTA 1QQCA 1X9MA 4O4GA 3DRPA 1S1UA 4BE1A 3OYGA 3MXJA 2Z1JA 1ASVA 1WLJA 1FKPA 4DS5A 4M3XA 3U6FA 4E19A 4CHPA 2X6SA 3SQ1A 4DLEA 4C8KA 1RDDA 3QLHA 4GMJB 3TABA 3DOLA 1NOZA 2R7YA 4AHUA 3D45A 4CF2A 5I3UA 1NJZA 3T1AA 1S1XA 1ITGA 3DLKA 2EX3A 4CIFA 3THVA 1BCOA 1RTDA 4JRQA 2HHVA 1YVUA 3VQPA 3L8BA 3VQQA 4B9LA 4FJLA 5KRSA 3HPHA 3AVIA 3AA4A 1RTJA 1TK0A 1NKEA 4DSEA 3CM6A 2XY8A 1RT7A 5KRTA 1SL1A 3TAFA 4QCLA 3A2FA 1YTUA 1XWLA 2X74A 1NK8A 4DSKA 1HJRA 5CY4A 5K14A 3K5OA 2YNGA 4O55A 4CEAA 1JL2A 4JS5A 4Z4CA 3TWHA 3RMCA 3SUPA 2YHAA 2RF2A 2OPPA 4W5QA 3V81A 4KB1A 3AO2A 3C94A 3B6OA 1L3TA 3TAMA 4IDKA 4OGEA 1SKRA 1NOYA 1KLNA 4B9MA 3QEWA 4I9QA 3HO1A 4CGHA 4W5OA 3C6TA 4O0IA 4E7HA 4FW1A 1HMVA 4OPJA 4Z4EA 4KHNA 4FK4A 4FJJA 4DFMA 1GOAA 4DMNA 1SUQA 1UOCA 4IBNA 3HXMA 3L2VA 5CZ1A 1KFSA 4FJIA 4FCYA 2OPRA 3AO5A 4B08A 4CEDA 5C25A 4DFPA 4FK2A 1BL3A 4LY7A 3OYCA 3AO1A 4F2RA 1S1WA 4Z4GA 3SUQA 1L3SA 3O3GA 3CFRA 3OJSA 3ZT3A 4CGGA 3OYEA 3TAPA 1Z25A 2FC0A 1TK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIO A;  2IC3 A;  3L3V A;  3O3H A;  1DTQ A;  4BE2 A;  4DSF A;  3RRG A;  4FJG A;  4CGD A;  4CEQ A;  4DTN A;  2E6L A;  5HBM A;  3NGI A;  3CYM A;  4DTR A;  4EZ9 A;  1BHL A;  3ZCM A;  2W42 A;  4FLW A;  4DSJ A;  3S9H A;  1RDA A;  1ZBH A;  3AA2 A;  2ZQB A;  4J2A A;  4YNQ A;  3NF7 A;  2PYJ A;  3RMD A;  3PO5 A;  4KI6 A;  2DY4 A;  1UAX A;  1ASU A;  1TAQ A;  3H08 A;  3EZ5 A;  4Z4F A;  2VG5 A;  4DTX A;  2EHG A;  3CM5 A;  1TVR A;  3VQ4 A;  2OPS A;  4HUF A;  1CZB A;  2JGU A;  3DYA A;  4GW6 A;  4O0J A;  4BWM A;  4KTQ A;  3LAK A;  4PWD A;  1WSI A;  4FLZ A;  1C0M A;  3O3F A;  2Q3S A;  3OJU A;  4B9T A;  3LWM A;  2F8T A;  4KAZ A;  3LDS A;  4FVM A;  1TK5 A;  4FJM A;  2D0C A;  1NKC A;  3DRR A;  1RT4 A;  3M8P A;  1NJY A;  3PX4 A;  2VG7 A;  4B9V A;  4LSL A;  2XY7 A;  4NYN A;  1VSJ A;  3MED A;  1WSJ A;  3AO4 A;  4JLH A;  4N5S A;  4CIE A;  3SYZ A;  3L2Q A;  1RT1 A;  1B9D A;  1VK0 A;  3IG1 A;  4OKE A;  4B8C A;  3KLH A;  5J2M A;  5I42 A;  3TAN A;  3S3N A;  4ICL A;  2OYQ A;  3HJF A;  2KZZ A;  3LAL A;  4FJ8 A;  2X6N A;  3PV8 A;  4B9N A;  2P5G A;  2HW3 A;  2ZD1 A;  1IKY A;  3M8Q A;  4CJ3 A;  2HND A;  4GVM A;  3HVR A;  2HMI A;  2G8V A;  4H4M A;  3OYN A;  1WSH A;  2RN2 A;  4FM0 A;  5HRO A;  3ITH A;  2IS3 A;  1FXX A;  3ZSX A;  4DTP A;  3TAR A;  1JLQ A;  4CEE A;  2Y1I A;  1EET A;  4LSN A;  4B8A B;  3NH1 A;  3TAG A;  2KW4 A;  1IO2 A;  3F9K A;  1SL0 A;  1D8Y A;  3AVK A;  2BGG A;  4FLX A;  1UA0 A;  3K57 A;  3SQ2 A;  4KHW A;  3SUN A;  1TAU A;  4OVL A;  1SL2 A;  4FM1 A;  3HVT A;  5J1E A;  4KHQ A;  2IDO A;  3PX0 A;  3MEE A;  4ZHR A;  1K6Y A;  4FLT A;  4PY5 A;  3KLG A;  3RTV A;  3TAE A;  1U45 A;  1UWB A;  1S9E A;  4KKO A;  4KI4 A;  1XHZ A;  3DLH A;  3NH0 A;  3VQC A;  1IH7 A;  4CJP A;  2AJQ A;  5KI6 A;  5C42 A;  3KJV A;  4KTZ A;  1NK9 A;  1MU2 A;  4CGJ A;  4N41 A;  4DSL A;  3AA3 A;  3CFO A;  3LWL A;  1RT2 A;  1BIZ A;  1W0H A;  3NGY A;  3LPU A;  4M45 A;  5KGX A;  3OYA A;  4PQU A;  2IGI A;  4RW6 A;  2G8I A;  4CFC A;  2YNH A;  3BDP A;  4Q5V A;  1A5W A;  4MFB A;  4CJ5 A;  4B9U A;  4OGC A;  2XY6 A;  3VQ7 A;  1TL3 A;  4HCC A;  1RT5 A;  3V9S A;  1C0T A;  3HPG A;  3AVL A;  4PUO A;  4K8Z A;  3NHG A;  4DFJ A;  1RNH A;  2NUB A;  4W5R A;  4FZZ A;  3AA5 X;  1X9W A;  2KTQ A;  3ZSV A;  1BI4 A;  3ZT2 A;  2FBX A;  4CK1 A;  3HP6 A;  4BWJ A;  4CF8 A;  5J2P A;  3WNG A;  1T8E A;  1NK0 A;  4ELT A;  3LP3 A;  1LAV A;  3VQ5 A;  3P83 D;  3QET A;  3DM2 A;  1NK5 A;  5CZ2 A;  3OYB A;  4M3T A;  1GOC A;  2QXF A;  3DI6 A;  4FYD A;  1X9S A;  4CJL A;  1NK6 A;  1C0U A;  3VQ9 A;  1U04 A;  2YNI A;  3BGR A;  3ASM A;  2VG6 A;  3MEC A;  3SPY A;  1D9F A;  2PY5 A;  4B3O A;  4CF9 A;  1EXQ A;  3L2U A;  4IG0 A;  3K5N A;  2FBV A;  2YHB A;  1RBV A;  2B4J A;  3P1G A;  3VN5 A;  1DTT A;  1QE1 A;  1WNS A;  1LV5 A;  4Y1D A;  3KK3 A;  1IG9 A;  3IAY A;  3KTQ A;  3V9X A;  3K5L A;  3S3M A;  2QKB A;  4RW8 A;  3I0R A;  4LH4 A;  5J2Q A;  5HP1 A;  1S6P A;  3MAQ A;  2HHU A;  2D0B A;  3K5M A;  1QSS A;  4FM2 A;  1D5A A;  3SQ0 A;  4NCB A;  4CJE A;  2G8H A;  4OJR A;  1RBT A;  3HL8 A;  4E89 A;  4E7J A;  4FJH A;  3OYD A;  1FKO A;  4FJN A;  4IFY A;  3AVM A;  4E7K A;  3QEP A;  1NJX A;  2B6A A;  3SNN A;  4C8M A;  3SZ2 A;  4KHY A;  1CZ9 A;  3DMJ A;  1LWE A;  2E4L A;  1KFD A;  4CHY A;  2HB5 A;  1WSG A;  2LSN A;  1IKV A;  3SI6 A;  3DLB A;  4Z4I A;  3LP0 A;  4F3T A;  1WSF A;  1VSF A;  4JS4 A;  1JLE A;  3QIP A;  1SV5 A;  5SZT A;  3NCI A;  4CHN A;  2Z1G A;  4DU3 A;  2KFZ A;  3SCX A;  4HVJ A;  3RMB A;  4B9S A;  4AHT A;  5FRO A;  2BDP A;  4CF0 A;  4CJV A;  3DLR A;  4AHR A;  3V1Q A;  4M42 A;  3IS9 A;  3QER A;  5HRN A;  4NCG A;  1W9H A;  1L3V A;  3IRX A;  1TL1 A;  2WOM A;  3NF8 A;  4O5B A;  3VA3 A;  1RT6 A;  4EZ6 A;  4LD0 A;  3DOK A;  1O1W A;  3ZSY A;  3RRH A;  1J5O A;  3NF6 A;  1KLM A;  4FJ7 A;  2DFF A;  3QEX A;  4FXD A;  1BQM A;  1RTH A;  4IKF A;  3ALY A;  4BDY A;  1XI1 A;  4DTJ A;  3AVF A;  4F3O A;  3ZSW A;  3TAQ A;  4LH5 A;  2ITG A;  1C1B A;  4KRE A;  1Y97 A;  3F73 A;  2HVH A;  1ZBL A;  1RBU A;  3U3G A;  1EP4 A;  1RBR A;  1Q9X A;  4FJ5 A;  1BCM A;  2RPI A;  3L2W A;  4M3Y A;  4DQI A;  4E1N A;  4DQQ A;  4DU1 A;  1YTA A;  3NDK A;  3V9U A;  4CEB A;  4ZTJ A;  1TGO A;  4KV8 A;  1HYV A;  2B5J A;  5J2N A;  3HK2 A;  3HM9 A;  2PYL A;  1WAJ A;  2OZS A;  4I7F A;  2XO7 A;  1QHT A;  1QS4 A;  1U49 A;  1T05 A;  1D9D A;  3NF9 A;  2QK9 A;  1Z26 A;  3ZSR A;  1SKS A;  4KTW A;  1RCH A;  4DSI A;  4KHS A;  5KGW A;  4W5N A;  5HLF A;  4DF4 A;  4N76 A;  5D3G A;  1ASW A;  3HST B;  4CJU A;  1JKH A;  4ID1 A;  1C1C A;  3OS1 A;  3WNF A;  3C6U A;  2X78 A;  5DMR A;  4CES A;  3K59 A;  3OYH A;  3K2P A;  1VSL A;  2YKN A;  4FW2 A;  3V1O A;  3WNH A;  4CFB A;  4FLY A;  3VQD A;  3K58 A;  1XC9 A;  2DFH A;  1HYS A;  4NYF A;  2HHT A;  1KVA A;  3V9W A;  1NK4 A;  1C6V A;  5DK5 A;  3U3Y A;  4F4K A;  4C8N A;  3V4I A;  3KD1 E;  4J2E A;  4FJX A;  1WSE A;  1Q9Y A;  2HNZ A;  3O4N A;  4M3W A;  1IKW A;  1BI4 B;  1A5V A;  2I5J A;  1IKX A;  4PA1 A;  4CK2 A;  2D5R A;  3QNN A;  4FJ9 A;  4E1M A;  4JRP A;  4RG8 A;  4RW7 A;  3DLE A;  2O4G A;  3OYM A;  3RMA A;  4HCB A;  1Q8I A;  3VQA A;  4NCA A;  1B9F A;  1KVB A;  4BE0 A;  1HQE A;  4CF1 A;  3QNO A;  1VSH A;  4FLU A;  4I9L A;  4DQP A;  3D0P A;  1SKW A;  2OA8 A;  2F8S A;  3KK2 A;  1JLB A;  2ETJ A;  3AVG A;  3DRS A;  3HP9 A;  4DTM A;  3VQB A;  1LWC A;  3NGZ A;  3EYZ A;  3MXM A;  1JXE A;  1KTQ A;  1LW0 A;  4M3U A;  1LWF A;  4CEO A;  4Q0B A;  4QAG A;  3SV3 A;  4OPK A;  1JLA A;  3NAE A;  3CQ8 A;  1KCF A;  3AVN A;  3NFA A;  4RW4 A;  3OY9 A;  3C95 A;  3KLF A;  1JXB A;  5EU7 A;  2E6M A;  3L3U A;  1VRT A;  1G15 A;  3KKS A;  1TKD A;  4CJ4 A;  2P51 A;  2QKK A;  4L8R B;  4QOZ B;  4HUE A;  3CG7 A;  4R5P A;  3QEV A;  4KHU A;  1S9G A;  1GOB A;  5JS1 A;  2OPQ A;  5HRR A;  3SUO A;  4J2D A;  4BAC A;  2BE2 A;  3ZSO A;  4OKJ A;  4Y1C A;  2WON A;  4HUG A;  3ULD A;  4BDZ A;  1NJW A;  3RWU A;  4F2S A;  2Z1I A;  1QSY A;  1WN7 A;  2YKM A;  4HHT A;  4M3R A;  3L2R A;  2XHB A;  1JL1 A;  3VQE A;  2RKI A;  4Z4H A;  1ZYQ A;  4WE1 A;  3SV4 A;  2G8K A;  1ZBI A;  4IFV A;  4TSX A;  4CFD A;  4AH9 A;  3B6P A;  4CHO A;  3V6D A;  1I39 A;  4G1Q A;  4E0D A;  3LP2 A;  3AV9 A;  2G8U A;  2G8F A;  2ZE2 A;  4CGF A;  4CK3 A;  3KLI A;  5HRP A;  1EX4 A;  4O44 A;  4DTS A;  1U4B A;  2FBT A;  4DFK A;  3LAN A;  2F96 A;  3OVN A;  4Z0U A;  5HRS A;  3PUF A;  3KK1 A;  4KFB A;  1TV6 A;  3OYL A;  4J2B A;  2Z1H A;  1RDC A;  3I8D A;  3SPZ A;  1NK7 A;  2G8W A;  3M8R A;  2ATQ A;  3MXI A;  3P5J A;  4AIL C;  2VWK A;  4C8O A;  3ZT1 A;  3OYK A;  3V9Z A;  2OZM A;  4CIG A;  3LPT A;  4EP4 A;  3MEG A;  4DS4 A;  1L3U A;  2GUI A;  3LAM A;  3QEI A;  4OLA A;  1RBS A;  3LZJ A;  4DU4 A;  1RDB A;  5FDL A;  1VSK A;  3T3F A;  3S3O A;  4FZX C;  4DWI A;  2XRI A;  1S1V A;  2GBZ A;  4DTO A;  1KRP A;  1CLQ A;  1HPZ A;  4CCH A;  3ZSZ A;  3OYF A;  1J54 A;  2HVI A;  4F8R A;  4EP5 A;  3V1R A;  4OLB A;  4CER A;  1RTI A;  4K8X A;  4IG3 A;  4YFU A;  4MQ3 A;  1JLG A;  1VSD A;  1EKE A;  2DFE A;  5E41 A;  3HYF A;  4DQR A;  4ZTF A;  1C1A A;  4CEC A;  1UA1 A;  4CJS A;  3AVH A;  2IAJ A;  1KSP A;  2JLE A;  2A1S A;  2KQ2 A;  4KPY A;  4E7I A;  2O4I A;  4FJK A;  3T19 A;  4CHZ A;  4XIU A;  3AVJ A;  3G0Z A;  4CHQ A;  4M41 A;  3NE6 A;  3PX6 A;  4AHC A;  4CJK A;  1QSL A;  1S1T A;  4FK0 A;  4ELV A;  3NBP A;  2KZM A;  4ELU A;  3ZT4 A;  3ZSQ A;  3VA0 A;  1JLF A;  3ZT0 A;  1N6Q A;  4UQG A;  1CXQ A;  1RT3 A;  5T7B A;  3OYJ A;  1U47 A;  1VSI A;  4FZY A;  4AHV A;  1HRH A;  4CEF A;  1YT3 A;  1TKZ A;  4KO0 A;  1VSM A;  2P5O A;  4CGI A;  4I2Q A;  1REV A;  1LW2 A;  2P1J A;  3AVC A;  4C8L A;  5FRN A;  3RR7 A;  1DLO A;  1LAW A;  3JYT A;  1S5J A;  1B92 A;  1CXU A;  1HQU A;  1J9A A;  4N47 A;  5JS2 A;  4CJQ A;  3M8S A;  3TI0 A;  3QES A;  3UIQ A;  2YV0 X;  3QIO A;  5C24 A;  2GV9 A;  2FBY A;  3VQ8 A;  4CJR A;  1N5Y A;  1BIU A;  1J53 A;  1VSE A;  4ID5 A;  4OKK A;  3QO9 A;  1S6Q A;  3LP1 A;  3TR8 A;  4DLG A;  5KTQ A;  3SJJ A;  2HHW A;  4FLV A;  1WAF A;  1VRU A;  3JSM A;  3LZI A;  1BGX T;  1KVC A;  1X1P A;  3ISN C;  3HPO A;  4HTU A;  4DQS A;  3PO4 A;  1NKB A;  2HHS A;  3O4Q A;  2HHX A;  5FRM A;  3HT3 A;  4KB0 A;  1JLC A;  2VWJ A;  5CYQ A;  2KFN A;  2D0A A;  1T7P A;  3OS0 A;  3VQ6 A;  3RR8 A;  1HNV A;  3DLG A;  4H8K A;  2XY5 A;  3KKR A;  2PZS A;  2DTU A;  3AVB A;  2BAN A;  3G10 A;  2Y1J A;  2HHQ A;  3PY8 A;  4E3S A;  3KLE A;  2YNF A;  4M3Z A;  2IOC A;  4DTU A;  2A1R A;  3AVA A;  4E7L A;  1HYZ A;  4DG1 A;  1BIS A;  4W5T A;  3QIN A;  4I2P A;  1ZBF A;  1A5X A;  3NH2 A;  3EY1 A;  3CFP A;  1L5U A;  1QTM A;  1F21 A;  1HNI A;  3I0S A;  4CJF A;  4N56 A;  3KD5 E;  1TKX A;  4BDP A;  4KRF A;  3OYI A;  4CFA A;  4CJW A;  4H4O A;  4DF8 A;  3SQ4 A;  1XHX A;  4CE9 A;  3OS2 A;  1FK9 A;  5SWM A;  1T03 A;  3E01 A;  1ZBU A;  1R0A A;  1I3A A;  1U48 A;  4CEZ A;  4RW9 A;  2HNY A;  4AHS A;  1BQN A;  5CYM A;  3WNE A;  3AO3 A;  3FFI A;  1TKT A;  1RIL A;  4CJT A;  1QQC A;  1X9M A;  4O4G A;  3DRP A;  1S1U A;  4BE1 A;  3OYG A;  3MXJ A;  2Z1J A;  1ASV A;  1WLJ A;  1FKP A;  4DS5 A;  4M3X A;  3U6F A;  4E19 A;  4CHP A;  2X6S A;  3SQ1 A;  4DLE A;  4C8K A;  1RDD A;  3QLH A;  4GMJ B;  3TAB A;  3DOL A;  1NOZ A;  2R7Y A;  4AHU A;  3D45 A;  4CF2 A;  5I3U A;  1NJZ A;  3T1A A;  1S1X A;  1ITG A;  3DLK A;  2EX3 A;  4CIF A;  3THV A;  1BCO A;  1RTD A;  4JRQ A;  2HHV A;  1YVU A;  3VQP A;  3L8B A;  3VQQ A;  4B9L A;  4FJL A;  5KRS A;  3HPH A;  3AVI A;  3AA4 A;  1RTJ A;  1TK0 A;  1NKE A;  4DSE A;  3CM6 A;  2XY8 A;  1RT7 A;  5KRT A;  1SL1 A;  3TAF A;  4QCL A;  3A2F A;  1YTU A;  1XWL A;  2X74 A;  1NK8 A;  4DSK A;  1HJR A;  5CY4 A;  5K14 A;  3K5O A;  2YNG A;  4O55 A;  4CEA A;  1JL2 A;  4JS5 A;  4Z4C A;  3TWH A;  3RMC A;  3SUP A;  2YHA A;  2RF2 A;  2OPP A;  4W5Q A;  3V81 A;  4KB1 A;  3AO2 A;  3C94 A;  3B6O A;  1L3T A;  3TAM A;  4IDK A;  4OGE A;  1SKR A;  1NOY A;  1KLN A;  4B9M A;  3QEW A;  4I9Q A;  3HO1 A;  4CGH A;  4W5O A;  3C6T A;  4O0I A;  4E7H A;  4FW1 A;  1HMV A;  4OPJ A;  4Z4E A;  4KHN A;  4FK4 A;  4FJJ A;  4DFM A;  1GOA A;  4DMN A;  1SUQ A;  1UOC A;  4IBN A;  3HXM A;  3L2V A;  5CZ1 A;  1KFS A;  4FJI A;  4FCY A;  2OPR A;  3AO5 A;  4B08 A;  4CED A;  5C25 A;  4DFP A;  4FK2 A;  1BL3 A;  4LY7 A;  3OYC A;  3AO1 A;  4F2R A;  1S1W A;  4Z4G A;  3SUQ A;  1L3S A;  3O3G A;  3CFR A;  3OJS A;  3ZT3 A;  4CGG A;  3OYE A;  3TAP A;  1Z25 A;  2FC0 A;  1TK8 A; 
#chains in the Genus database with same CATH topology
 4J8F A;  3L3V A;  3R1X A;  4BE2 A;  3RRG A;  4DTN A;  5M1N A;  2E6L A;  2ZM6 K;  3NGI A;  4DTR A;  1MA9 B;  2QWP A;  4JK7 A;  1HKB A;  1VQ9 N;  2W42 A;  1VQ6 N;  3G6E N;  1RDA A;  1ZBH A;  1W7A A;  4J2A A;  4YNQ A;  4KI6 A;  3EZ5 A;  3ZEU B;  3T1H K;  1U2V A;  4JI3 K;  3QB0 A;  2YJE A;  2JGU A;  4KTQ A;  1P90 A;  4O0J A;  4PWD A;  1C0M A;  3OJU A;  5TKW A;  1ZC6 A;  5GAE P;  1ZXO A;  1TK5 A;  4DUY K;  4OPA A;  1NKC A;  3W0L A;  1RT4 A;  4JI4 K;  4BVP A;  4LSL A;  2XY7 A;  4NYN A;  4B3R K;  5CR4 A;  3MED A;  4JLH A;  4CIE A;  5J2M A;  1B9D A;  3IG1 A;  2BTF A;  2X6N A;  4B9N A;  3P4I A;  2ZD1 A;  1IKY A;  4CJ3 A;  3MN6 A;  3HVR A;  2G8V A;  3OYN A;  2RN2 A;  5KQ8 A;  4YOW A;  1Q86 O;  4AM7 A;  4EHT A;  1IO2 A;  2BGG A;  1UA0 A;  3SQ2 A;  2E2N A;  4KHW A;  1VQ7 N;  3L4I A;  3HVT A;  5J1E A;  2IDO A;  4PY5 A;  3RTV A;  3CMA N;  1U45 A;  4KKO A;  3MK6 A;  5GAD P;  3NH0 A;  3VQC A;  1IH7 A;  5KI6 A;  3KJV A;  3L6Q A;  4DSL A;  3CFO A;  3LWL A;  4WCE L;  1BIZ A;  3NGY A;  3LPU A;  4BR2 A;  4RW6 A;  4Q5V A;  1A5W A;  4JD2 B;  4CJ5 A;  4BRP A;  1IBK K;  3HPG A;  4YY3 K;  4K8Z A;  4DFJ A;  2NUB A;  4W5R A;  1X9W A;  2KTQ A;  3ZSV A;  1YJN N;  4CF8 A;  3VEY A;  3DM2 A;  1NK5 A;  5CZ2 A;  1GOC A;  3H3N O;  3DI6 A;  1YVN A;  1C0U A;  3VQ9 A;  2YNI A;  4GKK K;  3L2U A;  1EXQ A;  1NG9 A;  1O13 A;  5M1K A;  1QE1 A;  3MWP A;  3DWL A;  1VQO N;  3CD6 N;  4RW8 A;  3MAQ A;  2HHU A;  2D0B A;  2F9T A;  1J6Z A;  4BG9 A;  1QSS A;  4CJE A;  4OJR A;  4JV5 K;  3HL8 A;  4FJH A;  3OYD A;  3SK3 A;  2NRR A;  1QHA A;  3PIP L;  3AVM A;  3ZET A;  1Q7Y O;  4KHY A;  1CZ9 A;  1LWE A;  2ZF5 O;  1WSG A;  2LSN A;  1IKV A;  2KKZ A;  3DLB A;  3LP0 A;  1IV0 A;  3M6G A;  5JLH A;  3SCX A;  4HVJ A;  3G4S N;  3IKM A;  4AHT A;  2BDP A;  1Q81 O;  4NXN K;  1ATS A;  4AHR A;  3V1Q A;  4NCG A;  1L3V A;  4CZJ A;  3HI0 A;  3DOK A;  5AJ3 K;  3RRH A;  3H1V X;  3CER A;  3THW A;  4I6M B;  1KLM A;  3TU5 A;  3BF1 A;  4HWI A;  4QS8 A;  3GE1 A;  4IKF A;  1P8Z A;  3AVF A;  4CBX A;  4F3O A;  3PSF A;  5DM7 L;  3WXM B;  1C1B A;  2NRT A;  4B1W B;  1RBU A;  3KZB A;  1RBR A;  1Q9X A;  3L2W A;  3OHR A;  4DQQ A;  4DR6 K;  2NRH A;  1NBW A;  1HYV A;  4M7X A;  5AQN A;  3HK2 A;  2OZS A;  4I7F A;  4EHU A;  2P9N A;  1QS4 A;  1U49 A;  1T05 A;  1CZA N;  4YHH K;  3NF9 A;  3GDQ A;  4DSI A;  1TUY A;  4N76 A;  4IOX A;  5D3G A;  2OCE A;  3C7N A;  1JKH A;  3C6U A;  5DMR A;  3V1O A;  4CFB A;  3K58 A;  2DFH A;  2VGM A;  4E1J A;  5DK5 A;  4F4K A;  4C8N A;  3KD1 E;  4J2E A;  4B3S K;  5JIC A;  2YCH A;  3OTO K;  1Q9Y A;  2D5R A;  4RG8 A;  4K0K K;  4U67 L;  1VQK N;  1ATN A;  1KVB A;  4BE0 A;  4CF1 A;  3QNO A;  1VSH A;  2P9K B;  4DQP A;  3O6W A;  1DKG D;  3AVG A;  4JKC A;  4JYA K;  1LW0 A;  4PL8 A;  2FF6 A;  3CQ8 A;  3NFA A;  3OY9 A;  4B1U B;  3C95 A;  3KLF A;  3LL3 A;  4GKJ K;  2QKK A;  3QEV A;  4KHU A;  1S9G A;  2QI2 A;  3AGR A;  5LY3 A;  2OPQ A;  4K43 A;  4BAC A;  2BE2 A;  3ZSO A;  4Y1C A;  3RWU A;  4F2S A;  4BRD A;  4CZI A;  4IEE A;  4A2B A;  2RKI A;  1ZYQ A;  1E4F T;  4TSX A;  4CFD A;  3FFK B;  3BF3 A;  3F9M A;  3CXC M;  4UY8 O;  1V4S A;  3PUF A;  4C23 A;  4KFB A;  4H0V B;  1HKG A;  1RDC A;  1NK7 A;  3M8R A;  2ATQ A;  2A5X A;  3P5J A;  4AIL C;  2OZM A;  2O8E A;  3MEG A;  1L3U A;  3VTH A;  1RDB A;  3T3F A;  1T6D A;  4DWI A;  4JI0 K;  1S1V A;  2A42 A;  2V52 B;  4DTO A;  4BR5 A;  3ZSZ A;  2QWQ A;  1J54 A;  4LF7 K;  1N32 K;  4JI2 K;  2O8C B;  1RTI A;  2Q0R A;  4IG3 A;  4MQ3 A;  5E41 A;  2NNW A;  3CF5 L;  4DQR A;  1UA1 A;  3UKR A;  3AVH A;  3LM2 A;  1IG8 A;  1EQY A;  1SAZ A;  3EEQ A;  1M90 O;  4ELV A;  2W6L A;  3C0B A;  3TSP A;  5EVZ A;  3HM8 A;  3ZT0 A;  2FXU A;  3FZK A;  4IJN A;  1N6Q A;  4XH1 A;  4FZY A;  5T7B A;  1VSI A;  1HRH A;  4KO0 A;  4CW7 B;  4I2Q A;  1LW2 A;  2IVO A;  2E88 A;  4FWL A;  2WUS A;  3JYT A;  1HQU A;  2YHY A;  3D2F B;  3GBT A;  2GEL A;  1MDU B;  5C24 A;  2GV9 A;  4CJR A;  4ELU A;  1BIU A;  1VSE A;  4ID5 A;  3SJJ A;  1S6Q A;  3LP1 A;  3A5M C;  1WAF A;  3PO4 A;  1NGH A;  2HHS A;  1WOQ A;  3M5R A;  3O4Q A;  1XQS C;  3HT3 A;  2P9I A;  1QZ5 A;  3D6R A;  4ISE A;  2VWJ A;  1I94 K;  3LM9 A;  2D0A A;  5BRF A;  2W40 A;  3WXK A;  2XY5 A;  3O9Q A;  4RWT A;  4JI5 K;  2DTU A;  2BAN A;  3O8M A;  2VGN A;  5HL7 L;  2HHQ A;  1W97 L;  1OH8 A;  3KWG A;  4WYB A;  3CFP A;  1QTM A;  2PBD A;  1HNI A;  3I0S A;  3E9O A;  3CQX A;  4CFA A;  4CJW A;  3OYI A;  3SQ4 A;  2ITM A;  3H1Q A;  1M1K O;  5GIO A;  5AQF A;  3E01 A;  1I3A A;  1BQN A;  4DKW A;  3WEE B;  3WQT A;  2E1Z A;  4BE1 A;  4DR1 K;  1QZ6 A;  2I7P A;  2A3Z A;  1GLB G;  4DV2 K;  4M3X A;  4E19 A;  3QLH A;  4GMJ B;  2RE2 A;  1NJZ A;  5I3U A;  3T1A A;  1ITG A;  5ELZ A;  4DR5 K;  2CGK A;  1RTD A;  3DJC A;  1BCO A;  4JRQ A;  3HPH A;  3AVI A;  5AQO A;  3TTD A;  3R8E A;  4BRN A;  1JCE A;  1YTU A;  4KB1 A;  3V81 A;  1BOT O;  3C94 A;  1YF5 L;  3B6O A;  3OA9 A;  3TAM A;  1BO5 O;  3ATV A;  1KLN A;  4B9M A;  3C6T A;  4FW1 A;  4QS7 A;  1RDU A;  4KHN A;  2VCP A;  4CZE A;  4DQ8 A;  1YUW A;  4FJI A;  4FCY A;  3E9P A;  2JWK A;  3AO1 A;  4IDH A;  1S1W A;  4Z4G A;  2V51 B;  3CFR A;  5FLX O;  4WFB L;  3WT0 A;  3ZT3 A;  3J7Z O;  3OYE A;  4BR0 A;  2E20 A;  2FC0 A;  2F4V K;  4BRF A;  1DTQ A;  3ENO A;  3F5T A;  4IO8 A;  3H46 O;  4EZ9 A;  1N34 K;  2A41 A;  4FLW A;  3A5L C;  3PO5 A;  1ASU A;  1TAQ A;  3VQ4 A;  1XC3 A;  1CZB A;  3DYA A;  4GW6 A;  5EOY A;  4O8K A;  3AAR A;  3LAK A;  4H5N A;  4GV9 A;  3O3F A;  4DHY A;  2YX6 A;  3LWM A;  4FVM A;  2D0C A;  3U4L A;  3M8P A;  1YIT N;  1N8R O;  4HTL A;  4CZM A;  1VSJ A;  1WSJ A;  3AO4 A;  5I42 A;  3KLH A;  4ILH A;  2NRX A;  2OYQ A;  3TAN A;  2KZZ A;  1VQL N;  2P5G A;  4CZG A;  3TSQ A;  4GVM A;  5AQS A;  5HRO A;  4Z94 A;  3CC4 N;  3ZSX A;  2Q36 A;  1JLQ A;  4X66 K;  2Y1I A;  4B8A B;  4LSN A;  2FLO A;  3NH1 A;  3ATU A;  2KW4 A;  3AVK A;  3K57 A;  1JCF A;  3SUN A;  3EKU A;  1SL2 A;  2ZGZ A;  3E1Y A;  1HNZ K;  4ZHR A;  1K6Y A;  1KC8 O;  3TAE A;  4FWR A;  1MWM A;  4DV0 K;  1XHZ A;  3DLH A;  4CJP A;  2VQF K;  1NK9 A;  4CGJ A;  3MMV A;  1X9J A;  3C6H A;  3HZ6 A;  4YDU C;  1NGA A;  4PKI A;  3I56 N;  3I8B A;  4CFC A;  2YNH A;  4MFB A;  3DXK B;  4FWQ A;  1RT5 A;  5LJW A;  1EWR A;  4WQ5 C;  5CHI A;  2UXC K;  3NHG A;  2E2P A;  2QWL A;  4BWJ A;  5J2P A;  3WNG A;  1NK0 A;  2HHH K;  3KK7 A;  4M3T A;  2QXF A;  4FYD A;  1X9S A;  5M1F A;  3SPY A;  2VG6 A;  3K5N A;  4JKD A;  2YHB A;  3TTC A;  2OAN A;  1T44 A;  3KK3 A;  2UXD K;  2QWR A;  3K5L A;  2QKB A;  5HP1 A;  1NGD A;  1DEJ A;  3OBW A;  1S6P A;  4FM2 A;  5BR9 A;  4DR3 K;  2W6K A;  1QQN A;  4E89 A;  3T69 A;  4IFY A;  3QEP A;  3VEZ A;  3DMJ A;  2E4L A;  1K73 O;  1KFD A;  4BRQ A;  4CHY A;  1NMD A;  4CD1 A;  3QIC A;  2HB5 A;  4BR9 A;  1VQN N;  3H45 C;  3GOI A;  1OH7 A;  3QIP A;  1SV5 A;  4CHN A;  4H0X B;  2V7Y A;  4B9S A;  5JVH L;  4CF0 A;  4CJV A;  2VYP A;  3J81 O;  5HOO A;  1GLJ O;  4CZF A;  5F1X A;  1TL1 A;  2WOM A;  4O5B A;  4BGA A;  2NZT A;  5AQW A;  2DFF A;  3QEX A;  3D2E B;  5AQX A;  4JNE A;  1HNX K;  2GEM A;  4DTJ A;  3OBY A;  3BEX A;  3ZSW A;  4JKG A;  3A0I X;  2P9S B;  1Y97 A;  1ZBL A;  3U3G A;  1EP4 A;  1BCM A;  4MO5 A;  4Y0W A;  4CD3 A;  1N36 K;  4JKA A;  3NDK A;  4YOX A;  3QDK A;  4CEB A;  2B5J A;  4IXC A;  4L3Q A;  2FSJ A;  4WF9 L;  2PYL A;  2P9L B;  1VAZ A;  4KTW A;  5ADX H;  4O5F A;  5HLF A;  1ASW A;  1LOT B;  2CH5 A;  3ULE B;  3K2P A;  1VSL A;  4FLY A;  2HHT A;  3VQD A;  1XC9 A;  1HYS A;  3VES A;  1NK4 A;  1C6V A;  2W41 A;  4K25 A;  4FJX A;  3RVC A;  4M3W A;  1IKW A;  1BI4 B;  3I55 N;  2I5J A;  4FWS A;  3SAH A;  4CK2 A;  2O8F A;  3EN9 A;  2O4G A;  3ENB A;  2WTU A;  1HR0 K;  1QQM A;  3JAM O;  4I9L A;  2NLX A;  2OA8 A;  3SBG A;  3F2K A;  3HP9 A;  4DTM A;  2QM1 A;  3NGZ A;  1LWC A;  4QS9 A;  4B1Y B;  4ILG B;  4CEO A;  4QAG A;  4OPK A;  3NAE A;  1T3V A;  4DR7 K;  5MLC Q;  1NGF A;  2V7Z A;  5EU7 A;  3L3U A;  5E84 A;  5AQV A;  1TKD A;  2ASO A;  4L8R B;  3VER A;  4R5P A;  3E66 A;  5JS1 A;  1FW6 A;  3ID6 A;  3ULD A;  3R9P A;  2YKM A;  2XHB A;  4IZ9 A;  1JL1 A;  1ZBI A;  5EX5 A;  1I39 A;  3LP2 A;  4CGF A;  3KLI A;  1EX4 A;  3IMX A;  2FBT A;  3LAN A;  1BUP A;  2F96 A;  3OVN A;  4DR4 K;  4FWO A;  1TV6 A;  3I33 A;  3I8D A;  2G8W A;  1RGI A;  4NB4 A;  3MXI A;  2VWK A;  1NGI A;  4C8O A;  3OYK A;  3V9Z A;  3LDN A;  1GLL O;  4EP4 A;  1GLE G;  5AQP A;  3S3O A;  5FDL A;  1VSK A;  4FZX C;  4BRC A;  2GBZ A;  1YHQ N;  3OYF A;  4AM6 A;  4JAX A;  4YOR A;  1HNW K;  4YFU A;  1JLG A;  1VSD A;  3TPQ A;  4R79 A;  1C1A A;  4H0P A;  2IAJ A;  1NGB A;  2KQ2 A;  5JLF A;  4E7I A;  3BZC A;  4M41 A;  1VQM N;  1S1T A;  3CJC A;  4IEI A;  3SLC A;  1WBB A;  4FK0 A;  2KZM A;  2Q31 A;  2ZGY A;  3JS6 A;  2A6A A;  4BRO A;  1TUU A;  4UQG A;  3OYJ A;  2E2O A;  1TKZ A;  2P1J A;  1ATR A;  4IO9 L;  1OKJ A;  4LF5 K;  1DLO A;  2J4R A;  5JS2 A;  1B92 A;  4N47 A;  3M8S A;  1J9A A;  3QES A;  4JEP A;  4FWN A;  2UXB K;  3JSM A;  3LZI A;  1KVC A;  3ZEU A;  5AQL A;  1NKB A;  3C6A A;  3CCQ N;  3MN5 A;  4KB0 A;  4AQY K;  3DAW A;  2KFN A;  1T7P A;  3VQ6 A;  3C65 A;  3U9D A;  3D7E O;  2OTL N;  1JJ2 M;  3AVB A;  3G10 A;  4CBU A;  1C0F A;  5GAG P;  2CH6 A;  4DG1 A;  4W5T A;  3UE5 A;  1ZBF A;  1OH5 A;  4KRF A;  4CJF A;  2A40 A;  1S22 A;  2P9L A;  1GLD G;  3OS2 A;  1FK9 A;  1S3X A;  1R0A A;  1U48 A;  3AAP A;  4RW9 A;  4N41 A;  3AO3 A;  4KBO A;  1X9M A;  1VHX A;  4CJT A;  4WQ4 A;  1S1U A;  5KPR A;  1JCG A;  3ZX3 A;  1FKP A;  4JKB A;  2X6S A;  4B1X B;  3CCU N;  3DOL A;  4LC9 B;  3D45 A;  4M63 C;  1S1X A;  3Q7B A;  4O8U A;  2ASP A;  4LF8 K;  3DLK A;  5AQQ A;  3HRG A;  4A57 A;  1YVU A;  3L8B A;  4B9L A;  5KRS A;  1RTJ A;  4JD2 A;  4DSE A;  3NMU A;  1SL1 A;  3TAF A;  4LFA K;  2QWO A;  4DSK A;  1HJR A;  2YNG A;  4OX9 K;  4W5Q A;  2Q0U A;  4K42 A;  4OO1 J;  1YIJ N;  4H0O A;  5KQD A;  4IDK A;  2DPN A;  3CCJ N;  4H5W A;  3QEW A;  2QW9 A;  4CGH A;  4W5O A;  3CPE A;  5AZI B;  2HBM A;  1NWK A;  4OPJ A;  4BRE A;  5AQI A;  4FK4 A;  3CQY A;  3N4Q A;  4DMN A;  3L2V A;  5FPN A;  4BR7 A;  2OPR A;  1XNR K;  2ZWH A;  4FK2 A;  3OYC A;  4BC4 A;  3SUQ A;  2VWB A;  1L3S A;  3O3G A;  5IT9 O;  1NJI O;  3OJS A;  5BN9 A;  4LF6 K;  4B1V A;  4KH4 A;  3O3H A;  2Q2R A;  5BPL A;  4FJG A;  1HPM A;  4CGD A;  3A5O C;  3CIP A;  4JK9 A;  3CCV N;  1BHL A;  3S9H A;  1K9M O;  2QXL A;  3NF7 A;  2DY4 A;  1V4T A;  1UAX A;  2VG5 A;  5BPN A;  4A5A A;  4BRA A;  2ASM A;  4LFC K;  4HUF A;  3UKU B;  4BWM A;  1WSI A;  4B9T A;  1X3N A;  4MLE A;  3LDS A;  4BVO A;  3SMP A;  4CZK A;  1NJY A;  3PX4 A;  5C2F A;  4N5S A;  1RT1 A;  4A5B A;  4OKE A;  4A62 A;  3HJF A;  4I6M A;  2HMI A;  4H4M A;  4FM0 A;  2F7T A;  3ITH A;  1OH6 A;  1FXX A;  3MWT A;  2NRW A;  4DTP A;  3TAR A;  1VQP N;  1SL0 A;  3TAG A;  1D8Y A;  3G25 A;  3F9K A;  1HJO A;  3M3Z A;  4H5T A;  4OVL A;  4FM1 A;  4KHQ A;  4CVN E;  3PX0 A;  3MEE A;  3VOV A;  4FLT A;  4CZL A;  4FSV A;  1UWB A;  1S9E A;  4KI4 A;  2Q1N A;  1XMQ K;  2AJQ A;  4KTZ A;  3CC7 N;  5C0Y A;  5AQH A;  4BR4 A;  2WC9 A;  3OYA A;  5KGX A;  2GX9 A;  4PQU A;  4OGC A;  3O9R A;  3VQ7 A;  4V19 S;  3V9S A;  1C0T A;  3AVL A;  4PUO A;  5DM6 L;  4X62 K;  5FPE A;  3AA5 X;  1LCU A;  2Q97 A;  3ZT2 A;  2FBX A;  3HP6 A;  1T8E A;  3U9Z A;  3QET A;  1LAV A;  4OPH A;  1H1V A;  3MEC A;  1D9F A;  2PY5 A;  4B3O A;  2FBV A;  3VTI A;  2P9K A;  2B4J A;  3P1G A;  3VN5 A;  1WNS A;  1DTT A;  1LV5 A;  3AY9 A;  4Y1D A;  4FPB A;  3KTQ A;  3S3M A;  2HF3 A;  3I0R A;  4PKH A;  5J2Q A;  4WFN L;  3K5M A;  2HBK A;  3QBW A;  3VMF B;  1D5A A;  5I9E B;  3SQ0 A;  4NCB A;  2G8H A;  1KXP A;  4MLH A;  4H0Y B;  3PIO L;  1RBT A;  4E7J A;  3J7Y P;  4FJN A;  3A5N C;  5BRE A;  3SNN A;  4C8M A;  3SZ2 A;  5F2R A;  1ILY A;  4G9Z A;  2QTD A;  4Z4I A;  2NRZ A;  2HF4 A;  1VSF A;  4JS4 A;  4DB3 A;  1JLE A;  3O4W A;  5SZT A;  4DU3 A;  3BP8 A;  3RMB A;  1HUX A;  1RFQ A;  3HTV A;  2D4W A;  4IJA A;  1NU0 A;  5HRN A;  3QER A;  1NM1 A;  1W9H A;  3IRX A;  3NF8 A;  5AQG A;  1RDW X;  3VA3 A;  1RT6 A;  2IVP A;  4LD0 A;  3ZSY A;  3NF6 A;  4PL7 A;  4FXD A;  2O8B B;  1BQM A;  3ALY A;  3KWI A;  2FSK A;  3TAQ A;  4LH5 A;  4DR2 K;  2O8C A;  2HST A;  1KD1 O;  4FJ5 A;  2RPI A;  3K9K A;  4M3Y A;  4B1Z A;  4DQI A;  2HOE A;  4E1N A;  1YTA A;  4ZTJ A;  3V9U A;  5AQR A;  2HW3 A;  5J2N A;  4B3T K;  3BY5 A;  2XO7 A;  1WB9 A;  1QHT A;  3T1Y K;  1D9D A;  3THX B;  3ZSR A;  1SKS A;  1RCH A;  4KHS A;  4DF4 A;  3HST B;  4ID1 A;  5ADX A;  3WNF A;  3K59 A;  2X78 A;  3WNH A;  3ZLJ A;  4NYF A;  3N4P A;  3V9W A;  4LF9 K;  1J5E K;  3ZX0 A;  5LJV A;  3DXM B;  2HNZ A;  3O4N A;  3UKU A;  4M7Y A;  3THY B;  1A5V A;  2HBJ A;  2AA4 A;  1IKX A;  4FVU A;  3QNN A;  2D1K A;  4FJ9 A;  4JRP A;  1YI2 N;  3DLE A;  3D2F A;  3OYM A;  4X65 K;  3RMA A;  1Q8I A;  2JWL A;  1B9F A;  5BN8 A;  4BC5 A;  5C10 A;  2D0O A;  4FPA A;  1JLB A;  2ETJ A;  3VEV A;  3WQU A;  4KH6 A;  3OW2 M;  4PKG A;  1JXE A;  1KTQ A;  4Q0B A;  4JK8 A;  1KCF A;  3AVN A;  3FR0 A;  1JXB A;  4NLB A;  2E6M A;  1R59 O;  5LMU K;  1VRT A;  4JKH A;  4NO7 A;  4BRH A;  3QML A;  1G15 A;  4CJ4 A;  2P51 A;  4QOZ B;  4DV7 K;  3SUO A;  5HRR A;  5JMV A;  4OKJ A;  2WON A;  4HUG A;  1D4X A;  4HHT A;  2E1Y A;  4Z4H A;  4IFV A;  3CJ9 A;  4AH9 A;  3B6P A;  4CHO A;  4CZH A;  4G1Q A;  3V6D A;  2O8D B;  1HLU A;  2G8U A;  2G8F A;  2ZJR L;  3WEE A;  4O44 A;  5HRS A;  4H0T B;  1U6Z A;  3OYL A;  4J2B A;  1IBM K;  3SPZ A;  5M1O A;  3VEX A;  3ZT1 A;  4MDA A;  5FPM A;  3LPT A;  1QQO A;  5C2D A;  2GUI A;  4JI6 K;  4IOA L;  1SS6 A;  3LZJ A;  4DU4 A;  4GNI A;  3J80 O;  5AFU H;  2GTD A;  1HPZ A;  3FZF A;  2AP1 A;  4F8R A;  3V1R A;  4GV3 A;  3IUC A;  4K8X A;  3HYF A;  4CEC A;  4CJS A;  2JLE A;  4BC3 A;  1Y64 A;  4X64 K;  2P9N B;  4B3M K;  4CHZ A;  4CHQ A;  3CJ7 A;  5M1Q A;  4CJK A;  1QSL A;  3MN7 A;  3C7N B;  5C15 A;  3SAF A;  2FF3 B;  3VA0 A;  3VGM A;  1JLF A;  3CCR N;  3CCL N;  3B8A X;  1CXQ A;  1RT3 A;  4AHV A;  4CEF A;  3O5B A;  4DUZ K;  1REV A;  3AVC A;  3VEO A;  3WXJ A;  3LDL A;  3RR7 A;  4A61 A;  1S5J A;  4CJQ A;  3TI0 A;  4YOT A;  3UIQ A;  4MDB A;  4BRG A;  2YV0 X;  3CCE N;  2FBY A;  3L0Q A;  1J53 A;  3TR8 A;  4OKK A;  3QO9 A;  4CI6 A;  5B8H A;  2IVN A;  4HTU A;  1BGX T;  1X1P A;  3ISN C;  2HHX A;  5FRM A;  2O8B A;  1JLC A;  1IJJ A;  3J7A P;  3G71 N;  3RR8 A;  1HNV A;  2OTJ N;  1N33 K;  4H8K A;  3KKR A;  2PZS A;  1FJG K;  4DV4 K;  2WBN A;  3VET A;  2Y1J A;  3IFR A;  3CCM N;  3PLA A;  3KLE A;  2NRV A;  2YNF A;  4M3Z A;  3WUH A;  4DTU A;  4E7L A;  3O1B A;  3A8Y A;  4I2P A;  4JI7 K;  3NH2 A;  3EY1 A;  1L5U A;  1F21 A;  3KD5 E;  4N56 A;  4H4O A;  4GY2 B;  4NXM K;  5AR0 A;  1Z6R A;  3THX A;  5SWM A;  1ZBU A;  3U8X A;  1YXQ A;  2HNY A;  4AHS A;  2BH1 A;  3FFI A;  1QQC A;  4ISF A;  5E26 A;  3DRP A;  3VF6 A;  1WLJ A;  3U6F A;  1EWQ A;  4CHP A;  2O8E B;  3DXM A;  5AZJ B;  3SQ1 A;  4DLE A;  3THY A;  3TAB A;  1NOZ A;  4AHU A;  2QA4 N;  4NLC A;  3LDQ A;  1DT9 A;  4IOC L;  2EX3 A;  2HHV A;  4DV5 K;  3NVM A;  3VQQ A;  1W2B M;  3FZH A;  1TK0 A;  3DXK A;  3RSE B;  2XY8 A;  5LMN K;  4H5R A;  1RT7 A;  5EY4 A;  3A2F A;  4CEA A;  5K14 A;  3TWH A;  4O55 A;  3SUP A;  4K41 A;  1JL2 A;  3BZK A;  5AQY A;  3KVG A;  3RMC A;  2YHA A;  2OPP A;  3AO2 A;  3UKR B;  4FO0 A;  4DCH A;  2QEX N;  4OGE A;  4FWP A;  5BRH A;  4DV6 K;  1NOY A;  2UUA K;  4O0I A;  3GG4 A;  4XH5 A;  4Z4E A;  4FJJ A;  1GOA A;  1UOC A;  2RHK A;  2YI1 A;  3HXM A;  3AO5 A;  4B08 A;  5C25 A;  4CED A;  5A2Q O;  4DFP A;  1BL3 A;  4LY7 A;  4F2R A;  4XH4 A;  5GIN A;  1G99 A;  3FLC O;  4CGG A;  4FWK A;  1GLF O;  3VQ5 A;  3CPW M;  1TK8 A;  3KIO A;  4KH5 A;  2IC3 A;  2O8D A;  4DSF A;  4F9O A;  4CEQ A;  5HBM A;  5AQU A;  3CYM A;  3SMS A;  3O9U A;  3ZCM A;  3DLL L;  3LDP A;  4DSJ A;  4EIA A;  3AA2 A;  2ZQB A;  4B9Q A;  3RMD A;  2PYJ A;  3H08 A;  4RCH A;  4Z4F A;  4DTX A;  2EHG A;  3CM5 A;  1TVR A;  2ZJQ L;  3CJA A;  1VQ5 N;  4BGB A;  2YHW A;  1GLC G;  2OPS A;  3NVK A;  1K8K B;  2P9I B;  4FLZ A;  2Q3S A;  2F8T A;  4KAZ A;  2PFU A;  4FJM A;  1OVQ A;  3DRR A;  2VG7 A;  4BRI A;  1NNE A;  4B9V A;  4DV3 K;  2GWJ A;  3E9L A;  5FPD A;  4MO4 A;  3SYZ A;  3L2Q A;  1VK0 A;  5BRD A;  4B8C A;  2KLA A;  1ZBS A;  3S3N A;  1YAG A;  4ICL A;  1Q18 A;  3LAL A;  4FJ8 A;  3PV8 A;  3D2E A;  5AQJ A;  2E5L K;  4GV6 A;  3M8Q A;  2HND A;  1WSH A;  3FGU A;  2IS3 A;  2E2Q A;  2P9S A;  3CC2 N;  1KAX A;  4CEE A;  1EET A;  1NGE A;  3K9J A;  5C12 A;  4FLX A;  1ESV A;  1TAU A;  4YOY A;  3KLG A;  3ID8 A;  3P31 A;  4BQL A;  3T7Z A;  5C42 A;  4XEI A;  1MU2 A;  4A59 A;  3AA3 A;  2WFB A;  4BRL A;  1RT2 A;  1W0H A;  2UYT A;  4M45 A;  3CI5 A;  3SAG A;  2IGI A;  5AQT A;  3EE9 A;  3ULE A;  2G8I A;  3BDP A;  4B9U A;  5AQK A;  2XY6 A;  4HCC A;  1TL3 A;  2H3G X;  4C1N K;  3EE8 A;  1SZ2 A;  5TKY A;  1RNH A;  4FZZ A;  1XMO K;  3O08 A;  1BI4 A;  4CK1 A;  4ELT A;  5F0X A;  2HMP A;  3MN9 A;  3LP3 A;  1NMN A;  1BG3 A;  3P83 D;  1BU6 O;  3GL1 A;  3OYB A;  1NK6 A;  4CJL A;  1U04 A;  3BGR A;  3ASM A;  3TSU A;  4CF9 A;  3HOT A;  4IG0 A;  5BPM A;  1RBV A;  1IG9 A;  1MWK A;  1Q82 O;  3IAY A;  3VGL A;  3V9X A;  4LH4 A;  1K8A O;  3ZX2 A;  1WBD A;  4IFE A;  4EFH A;  1FKO A;  1XUP O;  1YJW N;  3IDH A;  1NJX A;  4E7K A;  2B6A A;  4FWM A;  4YOV A;  1TYQ B;  4JI8 K;  1T6C A;  3K0S A;  2UUB K;  2KHO A;  3Q7C A;  5AZJ A;  3HOS A;  3SI6 A;  4F3T A;  1WSF A;  3EL2 A;  5M1P A;  3NCI A;  2Z1G A;  2KFZ A;  3TTF A;  1X3M A;  3VEW A;  5FRO A;  3DLR A;  2HBL A;  1VQ4 N;  3RSE A;  3IS9 A;  1BWF O;  1DGK N;  4EZ6 A;  2P9U B;  1C0G A;  1O1W A;  2YHX A;  1J5O A;  3EO3 A;  1VQ8 N;  4FJ7 A;  1RTH A;  1XI1 A;  4BDY A;  3UB5 A;  4JHD B;  5KPT A;  2PAV A;  2ITG A;  3O80 A;  3F73 A;  2HVH A;  3QFP A;  3P38 A;  5BR8 K;  4DV1 K;  1OVY A;  5H1S Q;  2YJF A;  4DU1 A;  3L4Q A;  4KRE A;  1TGO A;  4KV8 A;  3HM9 A;  3S41 A;  1WAJ A;  1BA0 A;  4JI1 K;  1NLV A;  4LF4 K;  4BC2 A;  2QK9 A;  1Z26 A;  5KGW A;  4WQ4 C;  3H3O B;  4W5N A;  3JXU A;  1QVG M;  4CJU A;  2CGL A;  1C1C A;  2P9P B;  3OS1 A;  1BDG A;  4RTF D;  4M42 A;  4CES A;  3OYH A;  4FW2 A;  2YKN A;  2GUP A;  1KVA A;  3U3Y A;  3V4I A;  4ISG A;  1WSE A;  1K8K A;  2BUP A;  2GWK A;  1NGC A;  4PA1 A;  1XNQ K;  2E8A A;  4E1M A;  3H6E A;  4RW7 A;  4ILJ A;  2QWN A;  3CHW A;  4HCB A;  3VQA A;  4NCA A;  3O9S A;  3CJB A;  1HQE A;  4FLU A;  1E4G T;  3D0P A;  1SKW A;  2F8S A;  4BRK A;  3KK2 A;  3DRS A;  3FE1 A;  3VQB A;  3EYZ A;  3MXM A;  4M3U A;  4H5V A;  1LWF A;  3AAQ A;  4BY9 C;  3SV3 A;  1JLA A;  2ZJP L;  3SBT A;  4RW4 A;  4LFB K;  4JKF A;  3KKS A;  4HUE A;  3CG7 A;  3O9T A;  4YOU A;  1GOB A;  4PHT X;  4J2D A;  4EAH D;  4BDZ A;  1NJW A;  2Z1I A;  1QSY A;  1WN7 A;  4M3R A;  3L2R A;  3CJ1 A;  3VQE A;  2I7N A;  4WE1 A;  3FZL A;  3SV4 A;  2G8K A;  4H03 B;  2EWS A;  2QWM A;  4E0D A;  3AV9 A;  2ZE2 A;  2FSN A;  4IWV A;  4CK3 A;  5HRP A;  4DTS A;  1U4B A;  4DFK A;  4Z0U A;  3BUZ B;  4YDU A;  3WXI A;  3KK1 A;  2VQE K;  2Z1H A;  3SJH A;  3FZM A;  4WQ5 A;  3R3L A;  4CIG A;  4DS4 A;  1U2V B;  3LAM A;  3QEI A;  4OLA A;  1RBS A;  3MX5 A;  4U7B A;  3MX2 A;  5GAH P;  2XRI A;  3VGK A;  1CLQ A;  1NGG A;  1KRP A;  4JKG B;  3ENH A;  4CCH A;  3MCP A;  2HVI A;  4EP5 A;  5AFU A;  1KAZ A;  4CER A;  3KHY A;  3HSC A;  1EKE A;  2DFE A;  4WFA L;  3MDQ A;  4ZTF A;  4GVE A;  1KSP A;  4BRM A;  2A1S A;  4KPY A;  2IIR A;  2O4I A;  4FJK A;  3T19 A;  4XIU A;  3AVJ A;  3G0Z A;  3NE6 A;  3PX6 A;  5LL6 Z;  5AZI A;  3HBT A;  4FOI A;  4BQZ A;  4AHC A;  4JN4 A;  1TYQ A;  3CET A;  3NBP A;  5CE3 A;  3ZT4 A;  1QVF M;  3EZW A;  3ZSQ A;  3CCS N;  1SQK A;  5AQM A;  1U47 A;  1YT3 A;  3CME N;  1VSM A;  2P5O A;  4CGI A;  1E3M A;  3VEN A;  4C8L A;  3M1F A;  2O8F B;  5FRN A;  5KPZ A;  1LAW A;  5GIP A;  4KHP K;  1CXU A;  1HX1 A;  3EKS A;  3QIO A;  3VQ8 A;  3W3D A;  4DLG A;  2P9U A;  5KTQ A;  2HHW A;  4FLV A;  1VRU A;  3HPO A;  4DQS A;  2UU9 K;  5CYQ A;  3OS0 A;  4JKE A;  4JHD A;  3DLG A;  1KAY A;  2D0P A;  3PY8 A;  4E3S A;  3ZYY X;  2IOC A;  2A1R A;  3AVA A;  1HYZ A;  3AGK A;  1BIS A;  3QIN A;  3O1W A;  1A5X A;  3QFU A;  1TKX A;  4BDP A;  1WUA A;  3LDO A;  4DF8 A;  3R6M A;  1XHX A;  4CE9 A;  1T03 A;  1HKC A;  4A2A A;  1KQS M;  4CEZ A;  1N5Y A;  5CYM A;  3WNE A;  1TKT A;  1RIL A;  2P9P A;  1IBL K;  4O4G A;  3ZET B;  5AQZ A;  3WXL A;  3OYG A;  3MXJ A;  2Z1J A;  1ASV A;  4DS5 A;  3VF4 A;  4AF1 A;  1GLA G;  4C8K A;  1RDD A;  2R7Y A;  4CF2 A;  1BA1 A;  1S72 N;  2CGJ A;  2UUC K;  4CIF A;  3VF2 A;  3THV A;  3VQP A;  3PSI A;  4FJL A;  4C1N I;  4CBW A;  3AA4 A;  1NKE A;  3CM6 A;  5KRT A;  4QCL A;  5JVG L;  5EXW A;  1XWL A;  2X74 A;  1NK8 A;  5CY4 A;  3K5O A;  1Z05 A;  4JS5 A;  5IWA K;  4Z4C A;  4OLB A;  2RF2 A;  4BG8 A;  4FOE A;  1NGJ A;  3VPZ A;  1L3T A;  3THW B;  4FL9 A;  1SKR A;  2F9W A;  1YJ9 N;  4I9Q A;  3P39 A;  3HO1 A;  4CJ7 A;  4E7H A;  1HMV A;  3J8A A;  4DFM A;  1SUQ A;  4IBN A;  5CZ1 A;  1KFS A;  1EO1 A;  3QBX A;  3TAP A;  3MCA B;  1Z25 A; 
#chains in the Genus database with same CATH homology
 3KIO A;  2IC3 A;  3L3V A;  3O3H A;  1DTQ A;  4BE2 A;  4DSF A;  3RRG A;  4FJG A;  4CGD A;  4CEQ A;  4DTN A;  2E6L A;  5HBM A;  3NGI A;  3CYM A;  4DTR A;  4EZ9 A;  1BHL A;  3ZCM A;  2W42 A;  4FLW A;  4DSJ A;  3S9H A;  1RDA A;  1ZBH A;  3AA2 A;  2ZQB A;  4J2A A;  4YNQ A;  3NF7 A;  2PYJ A;  3RMD A;  3PO5 A;  4KI6 A;  2DY4 A;  1UAX A;  1ASU A;  1TAQ A;  3H08 A;  3EZ5 A;  4Z4F A;  2VG5 A;  4DTX A;  2EHG A;  3CM5 A;  1TVR A;  3VQ4 A;  2OPS A;  4HUF A;  1CZB A;  2JGU A;  3DYA A;  4GW6 A;  4O0J A;  4BWM A;  4KTQ A;  3LAK A;  4PWD A;  1WSI A;  4FLZ A;  1C0M A;  3O3F A;  2Q3S A;  3OJU A;  4B9T A;  3LWM A;  2F8T A;  4KAZ A;  3LDS A;  4FVM A;  1TK5 A;  4FJM A;  2D0C A;  1NKC A;  3DRR A;  1RT4 A;  3M8P A;  1NJY A;  3PX4 A;  2VG7 A;  4B9V A;  4LSL A;  2XY7 A;  4NYN A;  1VSJ A;  3MED A;  1WSJ A;  3AO4 A;  4JLH A;  4N5S A;  4CIE A;  3SYZ A;  3L2Q A;  1RT1 A;  1B9D A;  1VK0 A;  3IG1 A;  4OKE A;  4B8C A;  3KLH A;  5J2M A;  5I42 A;  3TAN A;  3S3N A;  4ICL A;  2OYQ A;  3HJF A;  2KZZ A;  3LAL A;  4FJ8 A;  2X6N A;  3PV8 A;  4B9N A;  2P5G A;  2HW3 A;  2ZD1 A;  1IKY A;  3M8Q A;  4CJ3 A;  2HND A;  4GVM A;  3HVR A;  2HMI A;  2G8V A;  4H4M A;  3OYN A;  1WSH A;  2RN2 A;  4FM0 A;  5HRO A;  3ITH A;  2IS3 A;  1FXX A;  3ZSX A;  4DTP A;  3TAR A;  1JLQ A;  4CEE A;  2Y1I A;  1EET A;  4LSN A;  4B8A B;  3NH1 A;  3TAG A;  2KW4 A;  1IO2 A;  3F9K A;  1SL0 A;  1D8Y A;  3AVK A;  2BGG A;  4FLX A;  1UA0 A;  3K57 A;  3SQ2 A;  4KHW A;  3SUN A;  1TAU A;  4OVL A;  1SL2 A;  4FM1 A;  3HVT A;  5J1E A;  4KHQ A;  2IDO A;  3PX0 A;  3MEE A;  4ZHR A;  1K6Y A;  4FLT A;  4PY5 A;  3KLG A;  3RTV A;  3TAE A;  1U45 A;  1UWB A;  1S9E A;  4KKO A;  4KI4 A;  1XHZ A;  3DLH A;  3NH0 A;  3VQC A;  1IH7 A;  4CJP A;  2AJQ A;  5KI6 A;  5C42 A;  3KJV A;  4KTZ A;  1NK9 A;  1MU2 A;  4CGJ A;  4N41 A;  4DSL A;  3AA3 A;  3CFO A;  3LWL A;  1RT2 A;  1BIZ A;  1W0H A;  3NGY A;  3LPU A;  4M45 A;  5KGX A;  3OYA A;  4PQU A;  2IGI A;  4RW6 A;  2G8I A;  4CFC A;  2YNH A;  3BDP A;  4Q5V A;  1A5W A;  4MFB A;  4CJ5 A;  4B9U A;  4OGC A;  2XY6 A;  3VQ7 A;  1TL3 A;  4HCC A;  1RT5 A;  3V9S A;  1C0T A;  3HPG A;  3AVL A;  4PUO A;  4K8Z A;  3NHG A;  4DFJ A;  1RNH A;  2NUB A;  4W5R A;  4FZZ A;  3AA5 X;  1X9W A;  2KTQ A;  3ZSV A;  1BI4 A;  3ZT2 A;  2FBX A;  4CK1 A;  3HP6 A;  4BWJ A;  4CF8 A;  5J2P A;  3WNG A;  1T8E A;  1NK0 A;  4ELT A;  3LP3 A;  1LAV A;  3VQ5 A;  3P83 D;  3QET A;  3DM2 A;  1NK5 A;  5CZ2 A;  3OYB A;  4M3T A;  1GOC A;  2QXF A;  3DI6 A;  4FYD A;  1X9S A;  4CJL A;  1NK6 A;  1C0U A;  3VQ9 A;  1U04 A;  2YNI A;  3BGR A;  3ASM A;  2VG6 A;  3MEC A;  3SPY A;  1D9F A;  2PY5 A;  4B3O A;  4CF9 A;  1EXQ A;  3L2U A;  4IG0 A;  3K5N A;  2FBV A;  2YHB A;  1RBV A;  2B4J A;  3P1G A;  3VN5 A;  1DTT A;  1QE1 A;  1WNS A;  1LV5 A;  4Y1D A;  3KK3 A;  1IG9 A;  3IAY A;  3KTQ A;  3V9X A;  3K5L A;  3S3M A;  2QKB A;  4RW8 A;  3I0R A;  4LH4 A;  5J2Q A;  5HP1 A;  1S6P A;  3MAQ A;  2HHU A;  2D0B A;  3K5M A;  1QSS A;  4FM2 A;  1D5A A;  3SQ0 A;  4NCB A;  4CJE A;  2G8H A;  4OJR A;  1RBT A;  3HL8 A;  4E89 A;  4E7J A;  4FJH A;  3OYD A;  1FKO A;  4FJN A;  4IFY A;  3AVM A;  4E7K A;  3QEP A;  1NJX A;  2B6A A;  3SNN A;  4C8M A;  3SZ2 A;  4KHY A;  1CZ9 A;  3DMJ A;  1LWE A;  2E4L A;  1KFD A;  4CHY A;  2HB5 A;  1WSG A;  2LSN A;  1IKV A;  3SI6 A;  3DLB A;  4Z4I A;  3LP0 A;  4F3T A;  1WSF A;  1VSF A;  4JS4 A;  1JLE A;  3QIP A;  1SV5 A;  5SZT A;  3NCI A;  4CHN A;  2Z1G A;  4DU3 A;  2KFZ A;  3SCX A;  4HVJ A;  3RMB A;  4B9S A;  4AHT A;  5FRO A;  2BDP A;  4CF0 A;  4CJV A;  3DLR A;  4AHR A;  3V1Q A;  4M42 A;  3IS9 A;  3QER A;  5HRN A;  4NCG A;  1W9H A;  1L3V A;  3IRX A;  1TL1 A;  2WOM A;  3NF8 A;  4O5B A;  3VA3 A;  1RT6 A;  4EZ6 A;  4LD0 A;  3DOK A;  1O1W A;  3ZSY A;  3RRH A;  1J5O A;  3NF6 A;  1KLM A;  4FJ7 A;  2DFF A;  3QEX A;  4FXD A;  1BQM A;  1RTH A;  4IKF A;  3ALY A;  4BDY A;  1XI1 A;  4DTJ A;  3AVF A;  4F3O A;  3ZSW A;  3TAQ A;  4LH5 A;  2ITG A;  1C1B A;  4KRE A;  1Y97 A;  3F73 A;  2HVH A;  1ZBL A;  1RBU A;  3U3G A;  1EP4 A;  1RBR A;  1Q9X A;  4FJ5 A;  1BCM A;  2RPI A;  3L2W A;  4M3Y A;  4DQI A;  4E1N A;  4DQQ A;  4DU1 A;  1YTA A;  3NDK A;  3V9U A;  4CEB A;  4ZTJ A;  1TGO A;  4KV8 A;  1HYV A;  2B5J A;  5J2N A;  3HK2 A;  3HM9 A;  2PYL A;  1WAJ A;  2OZS A;  4I7F A;  2XO7 A;  1QHT A;  1QS4 A;  1U49 A;  1T05 A;  1D9D A;  3NF9 A;  2QK9 A;  1Z26 A;  3ZSR A;  1SKS A;  4KTW A;  1RCH A;  4DSI A;  4KHS A;  5KGW A;  4W5N A;  5HLF A;  4DF4 A;  4N76 A;  5D3G A;  1ASW A;  3HST B;  4CJU A;  1JKH A;  4ID1 A;  1C1C A;  3OS1 A;  3WNF A;  3C6U A;  2X78 A;  5DMR A;  4CES A;  3K59 A;  3OYH A;  3K2P A;  1VSL A;  2YKN A;  4FW2 A;  3V1O A;  3WNH A;  4CFB A;  4FLY A;  3VQD A;  3K58 A;  1XC9 A;  2DFH A;  1HYS A;  4NYF A;  2HHT A;  1KVA A;  3V9W A;  1NK4 A;  1C6V A;  5DK5 A;  3U3Y A;  4F4K A;  4C8N A;  3V4I A;  3KD1 E;  4J2E A;  4FJX A;  1WSE A;  1Q9Y A;  2HNZ A;  3O4N A;  4M3W A;  1IKW A;  1BI4 B;  1A5V A;  2I5J A;  1IKX A;  4PA1 A;  4CK2 A;  2D5R A;  3QNN A;  4FJ9 A;  4E1M A;  4JRP A;  4RG8 A;  4RW7 A;  3DLE A;  2O4G A;  3OYM A;  3RMA A;  4HCB A;  1Q8I A;  3VQA A;  4NCA A;  1B9F A;  1KVB A;  4BE0 A;  1HQE A;  4CF1 A;  3QNO A;  1VSH A;  4FLU A;  4I9L A;  4DQP A;  3D0P A;  1SKW A;  2OA8 A;  2F8S A;  3KK2 A;  1JLB A;  2ETJ A;  3AVG A;  3DRS A;  3HP9 A;  4DTM A;  3VQB A;  1LWC A;  3NGZ A;  3EYZ A;  3MXM A;  1JXE A;  1KTQ A;  1LW0 A;  4M3U A;  1LWF A;  4CEO A;  4Q0B A;  4QAG A;  3SV3 A;  4OPK A;  1JLA A;  3NAE A;  3CQ8 A;  1KCF A;  3AVN A;  3NFA A;  4RW4 A;  3OY9 A;  3C95 A;  3KLF A;  1JXB A;  5EU7 A;  2E6M A;  3L3U A;  1VRT A;  1G15 A;  3KKS A;  1TKD A;  4CJ4 A;  2P51 A;  2QKK A;  4L8R B;  4QOZ B;  4HUE A;  3CG7 A;  4R5P A;  3QEV A;  4KHU A;  1S9G A;  1GOB A;  5JS1 A;  2OPQ A;  5HRR A;  3SUO A;  4J2D A;  4BAC A;  2BE2 A;  3ZSO A;  4OKJ A;  4Y1C A;  2WON A;  4HUG A;  3ULD A;  4BDZ A;  1NJW A;  3RWU A;  4F2S A;  2Z1I A;  1QSY A;  1WN7 A;  2YKM A;  4HHT A;  4M3R A;  3L2R A;  2XHB A;  1JL1 A;  3VQE A;  2RKI A;  4Z4H A;  1ZYQ A;  4WE1 A;  3SV4 A;  2G8K A;  1ZBI A;  4IFV A;  4TSX A;  4CFD A;  4AH9 A;  3B6P A;  4CHO A;  3V6D A;  1I39 A;  4G1Q A;  4E0D A;  3LP2 A;  3AV9 A;  2G8U A;  2G8F A;  2ZE2 A;  4CGF A;  4CK3 A;  3KLI A;  5HRP A;  1EX4 A;  4O44 A;  4DTS A;  1U4B A;  2FBT A;  4DFK A;  3LAN A;  2F96 A;  3OVN A;  4Z0U A;  5HRS A;  3PUF A;  3KK1 A;  4KFB A;  1TV6 A;  3OYL A;  4J2B A;  2Z1H A;  1RDC A;  3I8D A;  3SPZ A;  1NK7 A;  2G8W A;  3M8R A;  2ATQ A;  3MXI A;  3P5J A;  4AIL C;  2VWK A;  4C8O A;  3ZT1 A;  3OYK A;  3V9Z A;  2OZM A;  4CIG A;  3LPT A;  4EP4 A;  3MEG A;  4DS4 A;  1L3U A;  2GUI A;  3LAM A;  3QEI A;  4OLA A;  1RBS A;  3LZJ A;  4DU4 A;  1RDB A;  5FDL A;  1VSK A;  3T3F A;  3S3O A;  4FZX C;  4DWI A;  2XRI A;  1S1V A;  2GBZ A;  4DTO A;  1KRP A;  1CLQ A;  1HPZ A;  4CCH A;  3ZSZ A;  3OYF A;  1J54 A;  2HVI A;  4F8R A;  4EP5 A;  3V1R A;  4OLB A;  4CER A;  1RTI A;  4K8X A;  4IG3 A;  4YFU A;  4MQ3 A;  1JLG A;  1VSD A;  1EKE A;  2DFE A;  5E41 A;  3HYF A;  4DQR A;  4ZTF A;  1C1A A;  4CEC A;  1UA1 A;  4CJS A;  3AVH A;  2IAJ A;  1KSP A;  2JLE A;  2A1S A;  2KQ2 A;  4KPY A;  4E7I A;  2O4I A;  4FJK A;  3T19 A;  4CHZ A;  4XIU A;  3AVJ A;  3G0Z A;  4CHQ A;  4M41 A;  3NE6 A;  3PX6 A;  4AHC A;  4CJK A;  1QSL A;  1S1T A;  4FK0 A;  4ELV A;  3NBP A;  2KZM A;  4ELU A;  3ZT4 A;  3ZSQ A;  3VA0 A;  1JLF A;  3ZT0 A;  1N6Q A;  4UQG A;  1CXQ A;  1RT3 A;  5T7B A;  3OYJ A;  1U47 A;  1VSI A;  4FZY A;  4AHV A;  1HRH A;  4CEF A;  1YT3 A;  1TKZ A;  4KO0 A;  1VSM A;  2P5O A;  4CGI A;  4I2Q A;  1REV A;  1LW2 A;  2P1J A;  3AVC A;  4C8L A;  5FRN A;  3RR7 A;  1DLO A;  1LAW A;  3JYT A;  1S5J A;  1B92 A;  1CXU A;  1HQU A;  1J9A A;  4N47 A;  5JS2 A;  4CJQ A;  3M8S A;  3TI0 A;  3QES A;  3UIQ A;  2YV0 X;  3QIO A;  5C24 A;  2GV9 A;  2FBY A;  3VQ8 A;  4CJR A;  1N5Y A;  1BIU A;  1J53 A;  1VSE A;  4ID5 A;  4OKK A;  3QO9 A;  1S6Q A;  3LP1 A;  3TR8 A;  4DLG A;  5KTQ A;  3SJJ A;  2HHW A;  4FLV A;  1WAF A;  1VRU A;  3JSM A;  3LZI A;  1BGX T;  1KVC A;  1X1P A;  3ISN C;  3HPO A;  4HTU A;  4DQS A;  3PO4 A;  1NKB A;  2HHS A;  3O4Q A;  2HHX A;  5FRM A;  3HT3 A;  4KB0 A;  1JLC A;  2VWJ A;  5CYQ A;  2KFN A;  2D0A A;  1T7P A;  3OS0 A;  3VQ6 A;  3RR8 A;  1HNV A;  3DLG A;  4H8K A;  2XY5 A;  3KKR A;  2PZS A;  2DTU A;  3AVB A;  2BAN A;  3G10 A;  2Y1J A;  2HHQ A;  3PY8 A;  4E3S A;  3KLE A;  2YNF A;  4M3Z A;  2IOC A;  4DTU A;  2A1R A;  3AVA A;  4E7L A;  1HYZ A;  4DG1 A;  1BIS A;  4W5T A;  3QIN A;  4I2P A;  1ZBF A;  1A5X A;  3NH2 A;  3EY1 A;  3CFP A;  1L5U A;  1QTM A;  1F21 A;  1HNI A;  3I0S A;  4CJF A;  4N56 A;  3KD5 E;  1TKX A;  4BDP A;  4KRF A;  3OYI A;  4CFA A;  4CJW A;  4H4O A;  4DF8 A;  3SQ4 A;  1XHX A;  4CE9 A;  3OS2 A;  1FK9 A;  5SWM A;  1T03 A;  3E01 A;  1ZBU A;  1R0A A;  1I3A A;  1U48 A;  4CEZ A;  4RW9 A;  2HNY A;  4AHS A;  1BQN A;  5CYM A;  3WNE A;  3AO3 A;  3FFI A;  1TKT A;  1RIL A;  4CJT A;  1QQC A;  1X9M A;  4O4G A;  3DRP A;  1S1U A;  4BE1 A;  3OYG A;  3MXJ A;  2Z1J A;  1ASV A;  1WLJ A;  1FKP A;  4DS5 A;  4M3X A;  3U6F A;  4E19 A;  4CHP A;  2X6S A;  3SQ1 A;  4DLE A;  4C8K A;  1RDD A;  3QLH A;  4GMJ B;  3TAB A;  3DOL A;  1NOZ A;  2R7Y A;  4AHU A;  3D45 A;  4CF2 A;  5I3U A;  1NJZ A;  3T1A A;  1S1X A;  1ITG A;  3DLK A;  2EX3 A;  4CIF A;  3THV A;  1BCO A;  1RTD A;  4JRQ A;  2HHV A;  1YVU A;  3VQP A;  3L8B A;  3VQQ A;  4B9L A;  4FJL A;  5KRS A;  3HPH A;  3AVI A;  3AA4 A;  1RTJ A;  1TK0 A;  1NKE A;  4DSE A;  3CM6 A;  2XY8 A;  1RT7 A;  5KRT A;  1SL1 A;  3TAF A;  4QCL A;  3A2F A;  1YTU A;  1XWL A;  2X74 A;  1NK8 A;  4DSK A;  1HJR A;  5CY4 A;  5K14 A;  3K5O A;  2YNG A;  4O55 A;  4CEA A;  1JL2 A;  4JS5 A;  4Z4C A;  3TWH A;  3RMC A;  3SUP A;  2YHA A;  2RF2 A;  2OPP A;  4W5Q A;  3V81 A;  4KB1 A;  3AO2 A;  3C94 A;  3B6O A;  1L3T A;  3TAM A;  4IDK A;  4OGE A;  1SKR A;  1NOY A;  1KLN A;  4B9M A;  3QEW A;  4I9Q A;  3HO1 A;  4CGH A;  4W5O A;  3C6T A;  4O0I A;  4E7H A;  4FW1 A;  1HMV A;  4OPJ A;  4Z4E A;  4KHN A;  4FK4 A;  4FJJ A;  4DFM A;  1GOA A;  4DMN A;  1SUQ A;  1UOC A;  4IBN A;  3HXM A;  3L2V A;  5CZ1 A;  1KFS A;  4FJI A;  4FCY A;  2OPR A;  3AO5 A;  4B08 A;  4CED A;  5C25 A;  4DFP A;  4FK2 A;  1BL3 A;  4LY7 A;  3OYC A;  3AO1 A;  4F2R A;  1S1W A;  4Z4G A;  3SUQ A;  1L3S A;  3O3G A;  3CFR A;  3OJS A;  3ZT3 A;  4CGG A;  3OYE A;  3TAP A;  1Z25 A;  2FC0 A;  1TK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...