2B4JA

Structural basis for the recognition between hiv-1 integrase and ledgf/p75
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
153
structure length
135
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase (IN)
publication title Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, recombination
total genus 47
structure length 135
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b4jA00
3SQ0A 2FBVA 4CJPA 4G1QA 5HLFA 1TL1A 3DRPA 4M3UA 4N56A 1W9HA 4IKFA 2HHUA 4Z4GA 4DFPA 4QCLA 3MXIA 3KD1E 1U48A 3ZT4A 2G8UA 1KVAA 4KV8A 3AVJA 4DTNA 1U45A 4O55A 1VRTA 4DTUA 3NFAA 3KLGA 4FJHA 3HPHA 3HXMA 1YTAA 2OYQA 4AHCA 4W5QA 1S6QA 3KKRA 3ZSVA 4H4MA 3PY8A 3DI6A 1X1PA 4NCAA 1ASVA 2X74A 4LH4A 3WNEA 4DSFA 1QS4A 2XO7A 1XHZA 3JSMA 3TARA 1NJYA 2F96A 1D9DA 4BE1A 2G8WA 2KZMA 1ZBHA 4CJEA 4RW6A 4AHUA 4DU4A 4CEDA 1JLEA 1TK0A 3KK1A 2OPPA 4M3ZA 2HHXA 4CJSA 3V1RA 1HMVA 4IDKA 2Z1GA 4F2RA 4FLYA 3HJFA 1TVRA 1REVA 1NJXA 3MEGA 1VSKA 3DRSA 1RT6A 4J2BA 1UA0A 1T7PA 2HW3A 3LPUA 1C0UA 3AVBA 3U3GA 1IKVA 4JRPA 1WSGA 2HB5A 3RWUA 3B6OA 3V1QA 1GOCA 2DFFA 4JS4A 3AVAA 1NK5A 3K2PA 4CHZA 4DTRA 1HQUA 1RILA 4LSNA 3I0SA 3LP1A 4E19A 2XRIA 2B4JA 4RW9A 2E6MA 4FW2A 1C1BA 3VQ4A 3OYEA 3SV4A 4ELTA 2ZQBA 4OKEA 2RN2A 4FJGA 4CK3A 1NKBA 3VQDA 3MXJA 3RTVA 1QHTA 4KHYA 3OYFA 4CJWA 1SL0A 3EZ5A 2F8TA 3VQ5A 4JRQA 2HHTA 1C1CA 4NCGA 4CF8A 3SUOA 3SPYA 1BHLA 4E7KA 3DLBA 3HK2A 3OYGA 3V9UA 3C6UA 1UWBA 4QAGA 4Q5VA 4RW4A 4KB1A 4KPYA 3M8PA 4CEBA 2ITGA 1QQCA 1WAFA 3T19A 4CEAA 4RW7A 1L3VA 2KZZA 2IAJA 4NCBA 1TKXA 4ICLA 1S5JA 4B8AB 3SQ4A 3ZSRA 1RT2A 4MFBA 3NHGA 3QINA 3L8BA 1BI4A 1RDDA 3T1AA 4N76A 4KFBA 4CGJA 3SNNA 2IOCA 4PWDA 1CZ9A 3QEVA 2X6SA 2Q3SA 4O5BA 1RDBA 4OLAA 2DTUA 1XWLA 3LWMA 3QERA 2HVHA 3HVRA 3V4IA 1RT1A 3SJJA 1D9FA 4FM1A 4HUEA 4Q0BA 2YKMA 4CEEA 1NOZA 3ASMA 2YV0X 4CGHA 1BL3A 1JLBA 3SQ2A 4O0JA 4FK0A 1CLQA 1FKPA 1JXBA 3G10A 5HRRA 4E7LA 1BISA 1IG9A 3EY1A 4KKOA 2VG5A 4B08A 4CK1A 5I3UA 4UQGA 3NGYA 1RBSA 1G15A 1A5XA 3DOLA 4Z4HA 4OJRA 2JLEA 3AVKA 4KHQA 3S3MA 4J2DA 3F73A 2HHQA 3NF6A 4CJ4A 4FCYA 4CF9A 1QE1A 3PO5A 1VSJA 3LZIA 4KRFA 1WAJA 4C8KA 2GV9A 3DLKA 3P1GA 1QSLA 1T05A 4KHNA 4FK4A 4OGCA 1F21A 3QNOA 4FLZA 4CIGA 1L3UA 4OVLA 3L2VA 3RRGA 4I2PA 3HL8A 4ELVA 3DM2A 4I2QA 1VSFA 4HCCA 1EKEA 3CM6A 3DYAA 3ZCMA 1S9GA 3KJVA 2E6LA 3AVHA 4DS5A 1KRPA 1YVUA 3DOKA 3VQQA 4CHPA 1B9FA 1A5WA 1JLAA 1RT5A 4CHQA 3OYAA 5DMRA 3HT3A 3TABA 1NKEA 1DLOA 4TSXA 4RW8A 2KQ2A 4N47A 4M42A 2JGUA 2XHBA 3SUPA 1JLFA 4DSEA 5HP1A 3ALYA 2BGGA 4ZTJA 3SQ1A 3TAMA 1J54A 2R7YA 4DFKA 3G0ZA 3LZJA 3V9XA 3QEXA 3SUQA 3SPZA 1HNIA 1R0AA 2FBYA 3KLFA 3SYZA 3RR7A 5HRSA 3OS1A 3OYHA 2W42A 1JXEA 4KTZA 2P51A 1NJZA 2QKKA 4FJ9A 2KW4A 4I9LA 4AILC 3K5LA 4DU1A 2G8FA 3NCIA 1RDCA 5DK5A 3TWHA 4E0DA 1UAXA 1LWFA 3SZ2A 1ASUA 3KIOA 4CE9A 1SKSA 4W5RA 3KKSA 1VSIA 1BQMA 2EHGA 3NH0A 1ITGA 1ZBUA 3VQBA 4CFDA 3NH2A 3DLGA 2Z1JA 1L3TA 2IDOA 3AVNA 3C94A 5CY4A 3RRHA 3TI0A 1RTDA 4CGDA 1WSJA 4FM0A 1U47A 2ATQA 1SUQA 4YNQA 4DLEA 3QIPA 4Z4EA 5JS2A 4ZTFA 1EP4A 4HTUA 4FJNA 2HHWA 3DLEA 1LAWA 3THVA 3RR8A 4Y1CA 2QK9A 2PYLA 4DG1A 1HYSA 1LW0A 3AV9A 1TAUA 4M45A 3OYIA 1TAQA 3OYJA 1IKXA 1NK8A 1X9WA 4OKKA 3OY9A 4W5TA 4AHRA 1WSIA 4Y1DA 4B9MA 2XY8A 4DSKA 2P5GA 3HO1A 3LP3A 3OS0A 3D45A 3HSTB 1HRHA 4B9LA 5J2MA 2F8SA 1J53A 1GOAA 4HCBA 4DFJA 4I7FA 4I9QA 3V9ZA 4DQSA 3ZSYA 3OYKA 4M3WA 1S1XA 3LAKA 4GW6A 2Y1IA 4FXDA 4B9SA 1K6YA 2HNYA 1NK7A 4FJKA 2HVIA 5HRNA 1VSLA 4DWIA 2HNDA 2VG6A 4IFVA 4B8CA 4MQ3A 2PZSA 3KD5E 4CJQA 4F2SA 1CXUA 1Z25A 1X9MA 4BDZA 4B9VA 3LP2A 2I5JA 3AO3A 1SKWA 1TGOA 1RBTA 4KHUA 1S1TA 2HNZA 5CYMA 3ZT1A 4NYNA 3QEWA 2FC0A 1RBUA 3K57A 2GUIA 3LDSA 3SCXA 3IAYA 3KLEA 5J2PA 4DQIA 4Z4FA 4QOZB 4ID1A 5E41A 3K58A 3TANA 1U4BA 1NK6A 1NK9A 1IKYA 3VA0A 1TK8A 5HRPA 5J1EA 3AVLA 3DMJA 4M3YA 1C0MA 1JL2A 4LH5A 2P1JA 2Z1IA 3QIOA 4OPKA 2RPIA 1NKCA 1WNSA 4YFUA 3S3OA 3O4QA 4BWMA 2ZD1A 3K5NA 3QESA 5KGXA 1C6VA 4E7JA 4CJ3A 4ZHRA 1RBRA 3ISNC 1B92A 2B5JA 4CF1A 1RNHA 3V9WA 1BCMA 4BDYA 4N41A 4CERA 3ZSQA 4CJ5A 3VQCA 3T3FA 1VRUA 3VN5A 5SWMA 4XIUA 1B9DA 3IRXA 4KREA 2D0CA 3TAEA 1WN7A 4DSLA 5CZ1A 3VQ7A 1QTMA 3SUNA 1IO2A 1LAVA 2EX3A 5CZ2A 1C0TA 4EZ9A 2OPQA 4KHSA 4W5NA 3NF8A 1KVBA 4DF4A 5FRMA 1S1WA 4CJTA 1XHXA 4E7HA 2X78A 4CIFA 3CFPA 1TV6A 2DFHA 3RMCA 5C42A 5EU7A 4CHOA 1UOCA 1XI1A 1KFSA 1S9EA 1HYZA 2DFEA 4CECA 2VWJA 3QLHA 4AH9A 4N5SA 3O3GA 4F3OA 4ID5A 4C8LA 1IH7A 2KFNA 4BDPA 3CM5A 3RMBA 3FFIA 4BWJA 5KTQA 1SL1A 1O1WA 3QO9A 4BE0A 3K5OA 1LV5A 3ZT2A 3S3NA 4KB0A 4KAZA 1S6PA 4OGEA 1UA1A 4FJ5A 2QXFA 3S9HA 3CFOA 4CJUA 1FXXA 2OA8A 3KTQA 1VSMA 2G8IA 4B3OA 2PYJA 3HVTA 2E4LA 1HYVA 3QEPA 4K8ZA 4KI6A 3O3FA 2Y1JA 1JLQA 4O0IA 4O4GA 4FJJA 3NF9A 1MU2A 3ZT3A 4KO0A 4DSJA 4DTPA 2YHAA 3P83D 3KLHA 3K59A 3CYMA 1LWCA 1LW2A 4CJLA 3JYTA 4AHSA 4CFCA 4CEOA 4E1MA 3ZSWA 3BGRA 3AVGA 3SV3A 2AJQA 3F9KA 3C95A 3KLIA 4FLWA 3AO1A 1L5UA 4PY5A 2G8VA 1RTIA 3PO4A 4CIEA 3NGIA 3PV8A 4BACA 4CFAA 2ETJA 4K8XA 4DFMA 3VQAA 4DQPA 3CG7A 4CHNA 1Q9YA 1HNVA 4E89A 3HPGA 4GVMA 1RT4A 5K14A 4C8OA 2HHSA 3LALA 2DY4A 4EP4A 1N6QA 3E01A 1BIZA 3V1OA 3WNGA 2IS3A 5SZTA 3H08A 4DTOA 2XY5A 1XC9A 1BIUA 3KK3A 1WLJA 3AVIA 2YNHA 3HYFA 3VQPA 4DS4A 1NOYA 2LSNA 2OZMA 4FK2A 3IS9A 3KK2A 3PUFA 1BCOA 3AA4A 1Q8IA 3PX4A 2G8HA 4CGGA 5KRTA 4DQRA 2A1SA 3TAGA 4CJRA 2IC3A 2HHVA 3HP6A 3K5MA 4JS5A 5KI6A 1RTJA 3L3UA 4DLGA 4FLUA 1KLMA 1ZBFA 2KTQA 2D0AA 1U04A 3PX0A 1VK0A 3L2UA 4FZZA 2OPSA 1CZBA 2QKBA 2O4IA 1YTUA 3ULDA 4FJXA 3SI6A 3ZSXA 3AA5X 1BQNA 2YNFA 3OYBA 1TKZA 1I3AA 4FVMA 3L2WA 5C24A 3OS2A 3NGZA 4FZYA 4E3SA 3AVMA 4RG8A 1ZBIA 2D0BA 1VSDA 3P5JA 1CXQA 2KFZA 3A2FA 3RMDA 1HJRA 3VQ6A 3AO2A 3CQ8A 3OYMA 4C8NA 1YT3A 1T03A 3VQ8A 1WSHA 3ZSOA 5C25A 1KCFA 4DMNA 3ITHA 1EX4A 3M8RA 1DTQA 5JS1A 5FRNA 4CCHA 4DU3A 1TK5A 2Z1HA 3C6TA 2VG7A 4CESA 4HUFA 4DTSA 3QEIA 3PX6A 4ELUA 3LAMA 3AA3A 3DLRA 4R5PA 1SL2A 3TAQA 3MAQA 1JLGA 4CF2A 5D3GA 4B9UA 1HQEA 3I0RA 1RT3A 2WONA 4H4OA 4Z0UA 4HHTA 2X6NA 3CFRA 2O4GA 4L8RB 3NDKA 3V6DA 4E7IA 4CJKA 3VA3A 1ZYQA 3OYNA 3TAPA 3L2QA 3QETA 1X9SA 3AA2A 2FBXA 3AVFA 1DTTA 3OVNA 3I8DA 4B9TA 2BE2A 4FJ8A 4F3TA 1I39A 4OPJA 2ZE2A 4GMJB 4LY7A 3MECA 2WOMA 2RKIA 2B6AA 4BE2A 1FKOA 1TKTA 4JLHA 1ZBLA 2BANA 4M3RA 3MEEA 1D5AA 2YNIA 2YHBA 3NE6A 1SV5A 1WSFA 4IFYA 4FLXA 1KSPA 2XY6A 3QNNA 4PUOA 4OLBA 1JLCA 4KI4A 4FJIA 1S1VA 3VQEA 1JL1A 5J2QA 3BDPA 5CYQA 3B6PA 3DRRA 3O3HA 1TKDA 4KHWA 1RTHA 3ZSZA 3AO4A 1VSEA 4PA1A 4CJFA 3V9SA 1VSHA 5HBMA 4DTJA 3U3YA 4DF8A 4FZXC 4IG3A 4HVJA 3HP9A 3IG1A 1KTQA 3D0PA 3OJUA 3WNFA 1U49A 3OYLA 4KTWA 4WE1A 1HPZA 5FDLA 5T7BA 3OJSA 3LWLA 1C1AA 4J2EA 4Z4IA 4PQUA 1T8EA 1NK0A 1J9AA 1WSEA 4C8MA 4AHTA 5HROA 3WNHA 2YNGA 1BGXT 1N5YA 2HMIA 4E1NA 2RF2A 1Y97A 3V81A 3OYCA 4CEZA 4EZ6A 1L3SA 3LP0A 4CJVA 1S1UA 2G8KA 4FJMA 1Q9XA 1KVCA 4O44A 1RCHA 4CF0A 1Z26A 4KTQA 4IBNA 1BI4B 1EETA 4M3TA 3LPTA 2P5OA 3ZT0A 4CK2A 3RMAA 4DTXA 3U6FA 1W0HA 1KFDA 3HPOA 4B9NA 3UIQA 3L3VA 4IG0A 4LD0A 2OZSA 4CGIA 4HUGA 3NF7A 4W5OA 4F4KA 2GBZA 3LANA 4DTMA 4DQQA 5I42A 3EYZA 1GOBA 4OKJA 4M41A 4LSLA 3MEDA 1TL3A 4FW1A 4FJLA 5FROA 4EP5A 3VQ9A 4NYFA 1RBVA 3NH1A 3OYDA 2PY5A 1ASWA 4Z4CA 3MXMA 4J2AA 3L2RA 1RDAA 1JKHA 4CHYA 4FLTA 4FJ7A 1QSYA 4FM2A 2IGIA 1KLNA 1LWEA 3AO5A 3NAEA 4FYDA 3TR8A 3AVCA 2A1RA 1A5VA 2NUBA 3HM9A 3DLHA 3O4NA 1NJWA 4H8KA 3TAFA 4AHVA 1D8YA 4M3XA 2BDPA 1FK9A 1EXQA 5J2NA 4CEFA 2FBTA 5KRSA 1SKRA 1RT7A 5KGWA 4CEQA 4DSIA 4CGFA 1J5OA 2VWKA 1IKWA 3NBPA 2YKNA 4CFBA 3M8QA 3M8SA 4FLVA 2XY7A 2D5RA 1NK4A 4F8RA 1QSSA 2OPRA
chains in the Genus database with same CATH superfamily
2FBVA 4IEEA 4IKFA 3O08A 2HBJA 4QCLA 3A5LC 3MXIA 4FVUA 3AVJA 4M7YA 2P9LB 4YOUA 4AHCA 1S6QA 1SZ2A 4H4MA 4BE1A 2G8WA 3CQXA 4CJEA 4PL7A 3KK1A 1OH5A 1LOTB 4LFCK 1GLDG 1NJIO 1TVRA 1REVA 1NGEA 3DRSA 2PFUA 3HM8A 5FLXO 4J2BA 1UA0A 1GLFO 3LDOA 3SMPA 1T7PA 4DB3A 2DPNA 2GWJA 4JRPA 1WSGA 3RWUA 1GOCA 3NVMA 3E9OA 5DM6L 1VQLN 3LP1A 4RW9A 4DUZK 3SV4A 4ELTA 4CK3A 2F8TA 1Q18A 4C1NI 2VGMA 4E7KA 1E4GT 4BRIA 3V9UA 3C6UA 1UWBA 1V4TA 4FWRA 3M8PA 4CEBA 1QQCA 3T19A 4AQYK 4OPHA 4NCBA 1TKXA 3Q7CA 4ICLA 2Q97A 3ZSRA 4MFBA 3NHGA 5AZIA 4JI5K 2GX9A 4N76A 3QBXA 5AQNA 2IOCA 1WB9A 3M6GA 4H0VB 2Q3SA 5BRDA 3G6EN 4OLAA 2HVHA 1RT1A 1BA1A 3T7ZA 3THXB 2P9UB 4FM1A 3CJ1A 2YKMA 1YHQN 2Q36A 1BL3A 3GDQA 4JKDA 3G10A 1QZ5A 4UQGA 3NGYA 5AQUA 3FE1A 4A57A 1HR0K 3J81O 5TKWA 3NF6A 4FCYA 3PO5A 4A5BA 4IZ9A 3ZX3A 1WAJA 4FK4A 3TTFA 4OGCA 4PKHA 4FLZA 3CCQN 2P9PB 4OVLA 3L2VA 4I2PA 4ELVA 4HCCA 1EKEA 3CM6A 3ZCMA 4WFBL 2E6LA 3AVHA 2VWBA 3CPWM 3D2EA 3CETA 4N47A 2QA4N 1JLFA 1KAXA 3HBTA 1K8AO 1J54A 3LZJA 1Y64A 4BQLA 3KLFA 3SYZA 3RR7A 5HRSA 4DCHA 3OS1A 1JXEA 4KTZA 1NJZA 2D1KA 2KW4A 4FJ9A 4DV4K 1UAXA 1XMOK 1ASUA 4CE9A 1BQMA 2Q2RA 2JWLA 3DLGA 3NMUA 1RTDA 4FM0A 4DLEA 3R8EA 1EP4A 4B1XB 4HTUA 3DLEA 3RR8A 2QK9A 5JLHA 1HYSA 1TAUA 4M45A 3HRGA 3CJ7A 1NMDA 1QQOA 3U9DA 2YHXA 5CE3A 4BR0A 1NGFA 5AQVA 4DSKA 3C6AA 3MX2A 4B9LA 4JI1K 4BRLA 1GOAA 4HCBA 3V9ZA 3OYKA 4X64K 4E1JA 4B9SA 2HVIA 4DWIA 3H1QA 4MQ3A 2PZSA 4F2SA 1Z25A 1HJOA 4JD2B 3IAYA 3LDSA 4BRAA 1H1VA 3TANA 1U4BA 3QFUA 5AQPA 3VA0A 1TK8A 5J1EA 2ZGYA 3AVLA 3DMJA 1C0MA 4FWSA 3CF5L 2RPIA 4K0KK 3A8YA 3O4QA 4BWMA 4GKKK 5KGXA 1C6VA 4E7JA 3THXA 2P9UA 4FOIA 2B5JA 2W6KA 1BWFO 3J80O 4CERA 3ZSQA 2BH1A 1VRUA 5SWMA 1B9DA 4KREA 4DSLA 4EZ9A 5CZ2A 2OPQA 3NF8A 3KWGA 3ZETB 3C7NB 1S1WA 1RFQA 1XHXA 2X78A 1TV6A 3T69A 3AAQA 2VWJA 2P9PA 4N5SA 3O3GA 4F3OA 4QS7A 3JS6A 4AM7A 4A2AA 5I9EB 3U4LA 3RMBA 4BR5A 1SL1A 3QO9A 1VQ5N 3K5OA 1LV5A 2UUAK 1S6PA 3SAHA 4OO1J 4FJ5A 4WF9L 3S9HA 2OA8A 1FXXA 4B3OA 3KWIA 4ISEA 3O3FA 2Y1JA 4JAXA 1KAZA 4O0IA 5AQZA 5BRHA 2D4WA 4CJLA 4E1MA 3ZSWA 3DXKA 3KLIA 3FLCO 5EOYA 1R59O 2G8VA 2QWLA 4CFAA 3G25A 4K8XA 2P9IA 4CZMA 1IBLK 3DJCA 4E89A 1HX1A 3LALA 1QVFM 1N36K 1BIZA 2XY5A 2E1YA 4RCHA 4BRDA 4WQ4C 3VQPA 4H5RA 3PUFA 3AA4A 3PX4A 4CGGA 2A1SA 3L4QA 3CCEN 4CJRA 1ATSA 5KI6A 1RTJA 1ZBFA 4B1WB 1X3NA 4FZZA 3P38A 2O4IA 3ULDA 2YJFA 4O8UA 3ZSXA 1K73O 1I3AA 5BR9A 3HTVA 2HSTA 4FZYA 2D0PA 3CXCM 3RMDA 4JK9A 4BC2A 4JD2A 4NLCA 3OYMA 5AQKA 2A3ZA 4CD3A 3PLAA 1KCFA 1EX4A 4KI6A 3I8BA 3QEIA 4ELUA 3AA3A 4M7XA 5D3GA 3MAQA 3FR0A 3I0RA 4H4OA 2WONA 3SUQA 3V6DA 4CJKA 5AQJA 2ASPA 1XNRK 3TAPA 2QXLA 3AA2A 3CC2N 3EL2A 1DT9A 4LY7A 2NRHA 3MECA 1OH6A 4BR9A 4BE2A 2B6AA 4K25A 2O8CB 3ZETA 2YNIA 5KQDA 5KQ8A 2YHBA 1KSPA 2XY6A 1HLUA 5J2QA 1BA0A 5CYQA 2E2OA 4PA1A 4DTJA 4IG3A 1U49A 2RHKA 4KTWA 1K9MO 3P4IA 1HPZA 1SAZA 3LWLA 4Z4IA 4PQUA 3WXJA 3ENHA 3W0LA 1BGXT 2HMIA 4CEZA 1NGHA 1S1UA 3H3OB 3MCAB 1JCGA 4M63C 5EVZA 4FWMA 3RMAA 3UIQA 3O9UA 3ATUA 5JVGL 4CGIA 2GBZA 4PKIA 4DQQA 3EYZA 4CBXA 4OKJA 2O8FA 4LSLA 4X65K 1Q7YO 1TL3A 1GLCG 4EP5A 4NYFA 3NH1A 1ASWA 4J2AA 5BN9A 3UKRB 1TUYA 3SK3A 3CCRN 5AZJB 2ZGZA 2E2QA 5IT9O 1A5VA 2NUBA 1EXQA 5J2NA 1ZC6A 3MDQA 3FZMA 1IG8A 1RT7A 3T1HK 5BREA 2XY7A 5LMNK 2V7ZA 2HOEA 2O8DB 4U7BA 4CJPA 4DR7K 1TL1A 1W9HA 3JAMO 4DFPA 3KD1E 1U48A 4DR3K 1KVAA 3RSEA 4DTNA 3I33A 1GLBG 4DTUA 3KLGA 3MWPA 3HXMA 2OYQA 3J7YP 1NJYA 3WNEA 1QS4A 3CIPA 2XO7A 4IEIA 3TARA 5KPZA 3VEXA 1ZBHA 4RW6A 4AHUA 4DU4A 4BRMA 4CEDA 3THWA 3DLLL 2YHWA 1HMVA 1N33K 3HJFA 3TSPA 1NJXA 4RTFD 1VSKA 4KH4A 1IKVA 4DV5K 4B3MK 2PAVA 4JI8K 3V1QA 1NK5A 4DV7K 2V7YA 2O8CA 1RILA 2QWOA 4E19A 3VF6A 5AQHA 2ZQBA 1NKBA 4XEIA 1NMNA 5AJ3K 3FGUA 3EZ5A 2HHTA 4CF8A 3SUOA 5E26A 1BHLA 4H03B 1RDUA 4KB1A 4LF5K 3THYA 3WXLA 3UKUB 4CEAA 5F1XA 1X9JA 4RW7A 3ZYYX 1E4FT 1XMQK 4B8AB 3SQ4A 1RT2A 1XNQK 3SLCA 4BREA 3T1AA 4WQ5A 4KFBA 4MO4A 3SNNA 4PWDA 3A5OC 2DTUA 2HF3A 4JKCA 4CEEA 1NOZA 4CGHA 1JLBA 4FK0A 3U9ZA 4E7LA 1IG9A 3EY1A 4O5FA 3UKRA 1G15A 4Z4HA 2WC9A 4OJRA 4BVOA 3S3MA 1NGAA 2HHQA 4H0TB 4CF9A 3LZIA 4C8KA 3DLKA 4H5TA 4KHNA 1L3UA 3RRGA 4F9OA 5HL7L 2O8DA 1YJ9N 1YVUA 3DOKA 3VQQA 1JLAA 1RT5A 2ZJRL 5DMRA 1DLOA 3J7ZO 2WBNA 2JGUA 2XHBA 3SUPA 5MLCQ 2BGGA 3SQ1A 2V51B 3TAMA 3G0ZA 3SPZA 3V9XA 3QEXA 1HNIA 3D2EB 3DXMB 2FBYA 1R0AA 4X62K 3OYHA 3ZLJA 4LF7K 2NRVA 4IO8A 3GL1A 1IBMK 3K5LA 4FPAA 3NCIA 1RDCA 5DK5A 5AQWA 3TWHA 2G8FA 4LF8K 3SZ2A 4W5RA 3KKSA 1VSIA 1ITGA 3VQBA 3NH2A 2Z1JA 3TI0A 4B1UB 1S22A 4H0PA 1U47A 4YNQA 1SQKA 4GY2B 3K0SA 4FJNA 3AV9A 3AARA 3OYIA 3CCJN 1HKCA 4XH4A 3CCMN 4CZGA 2Q31A 3OY9A 2ZWHA 2PBDA 3ZEUA 3ID6A 3VGMA 4B9MA 2XY8A 3HO1A 3J8AA 3LP3A 4FL9A 5J2MA 3CI5A 4I7FA 4CBUA 5M1QA 4DQSA 2Y1IA 3OA9A 4FXDA 1K6YA 2HNYA 1NK7A 4FJKA 5HRNA 1VSLA 3SMSA 4IFVA 1BUPA 5AQTA 3NVKA 3UKUA 1X9MA 2I5JA 3AO3A 2GUPA 1TGOA 1RBTA 4KHUA 5CYMA 3FZFA 2FC0A 1V4SA 4JI0K 4Z4FA 4ID1A 3K58A 4JI4K 3MN5A 1BG3A 1VQPN 4M3YA 4LH5A 1YI2N 1NBWA 2P1JA 2Z1IA 3N4PA 1NKCA 4YFUA 4WQ5C 3QESA 3PSIA 4JI7K 2HMPA 4ZHRA 1RBRA 3ISNC 3AY9A 4CF1A 1RNHA 3QBWA 4DV6K 1BCMA 3WXIA 4CJ5A 3T3FA 4XIUA 2D0CA 3KVGA 3TAEA 1WN7A 4F2RA 1OVYA 5CZ1A 3SUNA 4ILHA 4OPAA 3CFPA 5AQYA 3K9KA 5C42A 4CHOA 1W7AA 4CECA 2P9SB 4DKWA 1GLJO 4PL8A 3S3NA 1UA1A 4FYDA 1BU6O 4HWIA 3KTQA 3WXMB 3CC7N 3VTHA 3RVCA 1OKJA 3MWTA 1JLQA 4O4GA 4XH1A 2YCHA 3DXMA 3KZBA 3ZT3A 3PIPL 1YJNN 1QVGM 4KBOA 3K59A 3KLHA 4AHSA 2AJQA 3BGRA 5GAGP 3EE9A 1L5UA 1RTIA 2NRRA 4CIEA 4X66K 3NGIA 3PV8A 3DXKB 5EY4A 3CG7A 4CHNA 1EQYA 4GVMA 5KPTA 3G71N 4YOTA 3E01A 3V1OA 3EKUA 1BIUA 1Z6RA 4BR2A 3KK3A 3AVIA 2P9IB 3HP6A 3TTCA 2YX6A 3O9RA 4FLUA 4DLGA 1KLMA 3FZKA 1HNXK 1VK0A 2OPSA 2QKBA 1QZ6A 1GLAG 3SJHA 3TTDA 1BQNA 2YNFA 4FVMA 3EKSA 5C24A 4WFNL 4RG8A 1NU0A 4IJAA 1HNZK 3P5JA 4JKHA 3C0BA 4CZLA 3AO2A 1YT3A 4JI6K 4DMNA 4NXMK 2UXBK 1DTQA 2Z1HA 4HUFA 1J5EK 5LMUK 3TAQA 4CF2A 1HQEA 4BG9A 4L8RB 5H1SQ 3CFRA 4E7IA 3VA3A 3LM9A 5AQMA 1X9SA 4YORA 2FBXA 3AVFA 4B9TA 5BPNA 4CZKA 4OPJA 2ZE2A 4GMJB 1VAZA 1IJJA 1FKOA 1TKTA 1TYQB 4JLHA 5B8HA 1ZBLA 2BANA 4M3RA 3MEEA 1D5AA 1SV5A 1WSFA 4FLXA 3QNNA 4OLBA 1Q81O 4FJIA 1S1VA 3OW2M 1XQSC 5ELZA 2P9SA 3DRRA 1RTHA 3V9SA 4CJFA 1VSHA 5HBMA 3U3YA 4DF8A 1IBKK 4BC5A 3IG1A 1KTQA 3OYLA 5T7BA 5AQQA 1RDWX 4J2EA 1C1AA 5AQOA 2UXCK 1WSEA 4AHTA 2YNGA 4E1NA 2F9TA 2QTDA 1NGIA 3V81A 1L3SA 3LP0A 2CH5A 4JKFA 4CF0A 1RCHA 4KTQA 4DQ8A 1M90O 1EETA 2IVPA 2FSNA 1YF5L 2F7TA 4J8FA 4CD1A 3VESA 1NGBA 1O13A 5HOOA 1W0HA 3OBYA 3L3VA 4IG0A 3H46O 3NF7A 4F4KA 3M3ZA 4YHHK 5I42A 1GOBA 4M41A 3EZWA 3MEDA 2NLXA 4FJLA 3AGKA 1RBVA 3H45C 5C2DA 4Z4CA 1RDAA 3WEEB 3A5NC 4A2BA 5AQXA 1YUWA 3CQYA 3O6WA 1KLNA 3AO5A 2UXDK 5M1NA 2O8FB 3AVCA 2RE2A 3L6QA 3SBGA 3O4NA 2I7NA 2BDPA 4H0YB 1GLLO 1SKRA 2CH6A 2FF3B 5KGWA 4CEQA 4CZIA 4DSIA 4CGFA 1J5OA 3M8SA 2YKNA 4CFBA 3M8QA 2FLOA 1NK4A 4F8RA 1QQNA 2A40A 3F5TA 2OPRA 4DSEA 2Q1NA 1G99A 4G1QA 5HLFA 2HHUA 3GBTA 5BPLA 3L4IA 4MLHA 1JJ2M 3ZT4A 2G8UA 3L0QA 4KV8A 1U45A 1W2BM 3NFAA 5AQIA 4W5QA 4YDUA 3GG4A 3ZSVA 3PY8A 3DI6A 4NCAA 1VQ9N 1XHZA 4DSFA 3JSMA 2F96A 1D9DA 3RSEB 4CZFA 2KZMA 3CC4N 3BZKA 3BY5A 1JLEA 2OPPA 4CJSA 3V1RA 4BROA 3MN7A 4IDKA 1GLEG 2Z1GA 3CHWA 4FLYA 5C10A 1RT6A 5F2RA 3THWB 1E3MA 3AVBA 3U3GA 5CHIA 3B6OA 1TYQA 1N32K 3K2PA 4CHZA 5AR0A 4EHTA 4IOCL 3I0SA 2YHYA 2E6MA 1C1BA 3OYEA 3WQTA 4OKEA 4FJGA 2RN2A 3ATVA 3PSFA 1VHXA 3MXJA 1QHTA 4KHYA 4CJWA 3SBTA 4IOAL 1C1CA 4NCGA 1NGCA 2NRXA 4C1NK 3DLBA 4FO0A 3HK2A 4QAGA 4DHYA 4Q5VA 5BN8A 4RW4A 4KPYA 2ITGA 1NG9A 2AP1A 1L3VA 2KZZA 2IAJA 3BF1A 3O4WA 5LJWA 3HOSA 3L8BA 3THYB 4LF4K 3AGRA 2E20A 3D7EO 3QEVA 4C23A 1RDBA 1YIJN 1XWLA 4RWTA 4IJNA 3QERA 3HVRA 3SJJA 4JI3K 4Q0BA 3ASMA 3Q7BA 4H0XB 1FKPA 1JXBA 5HRRA 1NGJA 1MA9B 4KKOA 2VG5A 4CK1A 3WEEA 1RBSA 1A5XA 3TU5A 4B3TK 4J2DA 1ATNA 4NLBA 3FZHA 1QE1A 3S41A 1VSJA 5A2QO 1QSLA 2YJEA 4CIGA 2VQFK 5M1OA 2P9NB 3CERA 1VSFA 3PIOL 4BGAA 3VEVA 3IKMA 1KRPA 2QWRA 1A5WA 4CHQA 3OYAA 3HT3A 4TSXA 3HSCA 3GOIA 4M42A 4CBWA 3GE1A 4DR1K 2OCEA 3ALYA 4ZTJA 4BRKA 2P9KB 2A6AA 1FJGK 4YDUC 4I9LA 1HNWK 4AILC 4U67L 5AQGA 3CD6N 4E0DA 1YITN 2BTFA 4B9QA 1LWFA 1NGGA 4UY8O 3NH0A 1L3TA 2IDOA 1T6DA 2GELA 3AVNA 3C94A 3RRHA 5C2FA 1WSJA 5BRFA 4OX9K 2ATQA 1SUQA 3LDPA 4DR6K 3R6MA 4FOEA 5JS2A 4ZTFA 3JXUA 1LAWA 4Y1CA 4DG1A 1LW0A 4B1VA 4EIAA 3OYJA 3E1YA 1X9WA 1JCFA 4OKKA 4B3SK 3I55N 4AHRA 4Y1DA 4ILJA 3OS0A 3HSTB 4B1YB 1OVQA 4JKBA 1J53A 2E2NA 4I9QA 4M3WA 2GWKA 4I6MB 1S1XA 3ZEUB 2HNDA 1MWMA 4MDAA 4JKEA 3KD5E 4CJQA 1CXUA 1YJWN 1QQMA 4BDZA 4B9VA 1VQKN 3LP2A 3VERA 2QW9A 2HNZA 1C0GA 3ZT1A 1RBUA 3DAWA 3K57A 3KLEA 5J2PA 4QOZB 4BRCA 1NK9A 3VOVA 4G9ZA 5HRPA 4IFEA 1JL2A 1K8KA 3QIOA 3D2FA 4Y0WA 5FPEA 3CJ9A 3S3OA 2ZD1A 2ZF5O 3WQUA 3IDHA 4CVNE 4DV1K 5M1KA 4WFAL 2UUCK 4FSVA 4BR4A 3IRXA 4JEPA 1QTMA 2ASMA 1IO2A 2EX3A 1C0TA 3WT0A 3BF3A 4BQZA 1KVBA 3CPEA 1TUUA 4E7HA 2DFHA 1KFSA 5EU7A 1UOCA 1S9EA 2IVNA 3HI0A 3QLHA 3SAFA 2P9NA 1IH7A 2KFNA 4PHTX 4JN4A 4BDPA 3FFIA 5KTQA 3HZ6A 1O1WA 4BGBA 3ZT2A 4YOWA 2QXFA 3A0IX 2G8IA 4FWOA 4NB4A 3HOTA 2PYJA 2CGJA 4K8ZA 4BRFA 4FJJA 3NF9A 2P9KA 1MU2A 4KH6A 4KO0A 4DTPA 2GEMA 1NM1A 3P83D 2VGNA 3CYMA 3JYTA 1LW2A 4CFCA 3MCPA 3MMVA 4K43A 4CEOA 3SV3A 3F9KA 3C95A 2UU9K 4PY5A 4FWKA 3CJAA 3QDKA 2ETJA 3VQAA 4DQPA 3D6RA 2ITMA 3IUCA 1HNVA 5LJVA 2HHSA 5K14A 2DY4A 4C8OA 4DTOA 4A62A 2UUBK 4FK2A 4DS4A 2OZMA 4ISGA 3IS9A 3MN9A 3KK2A 1JCEA 1BCOA 4A5AA 5KRTA 3TAGA 2IC3A 5FPDA 3BEXA 3K5MA 3L3UA 5AQLA 3R9PA 2HBKA 2KTQA 1U04A 3T1YK 4FJXA 4I6MA 3SI6A 3AA5X 4DUYK 1TKZA 4CZJA 3L2WA 3NGZA 3AVMA 3E9LA 4JHDB 1EWQA 2CGKA 2KFZA 3A2FA 3CCLN 4LF9K 3CQ8A 1T03A 4C8NA 3VQ8A 1WSHA 3P39A 3M8RA 4MDBA 2E1ZA 3ITHA 1DEJA 5JS1A 5FRNA 4DU3A 1TK5A 4CESA 4DV3K 4DTSA 3PX6A 1CZAN 3LAMA 1BDGA 5GIOA 2WTUA 4R5PA 4L3QA 4B9UA 1RT3A 2GTDA 4Z0UA 4HHTA 3C6HA 2X6NA 2O4GA 5EXWA 3NDKA 4JKGA 4BRHA 3QETA 3I8DA 1DTTA 3OVNA 1ESVA 2BE2A 3O8MA 4FJ8A 1Q82O 2RKIA 2JWKA 2V52B 3J7AP 4LC9B 4IFYA 1LCUA 1JLCA 3I56N 2ZJQL 1JL1A 3BDPA 3TPQA 3O3HA 3B6PA 1VSEA 2O8EB 3ENBA 4FZXC 4HVJA 2FSKA 2EWSA 3D0PA 3OJUA 5GAHP 1WUAA 3EE8A 1T8EA 4K42A 2YI1A 4DR2K 3QICA 3WNHA 3LL3A 3E9PA 3QMLA 4BVPA 4CJVA 2G8KA 3QB0A 1KVCA 2VYPA 4IO9L 1Z26A 1WBDA 4HTLA 1BI4B 2VCPA 4M3TA 2P5OA 4CK2A 4DTXA 3U6FA 3HPOA 3F9MA 1J6ZA 2OZSA 4HUGA 3ZX2A 4DTMA 4FWQA 1NWKA 1HKGA 4CZHA 5FROA 3E66A 3OYDA 2PY5A 3L2RA 4CHYA 4NXNK 4FJ7A 1QSYA 1LWEA 3TR8A 5GINA 2A1RA 3TSQA 3HM9A 3CCVN 4H8KA 4DV2K 1D8YA 3R3LA 4M3XA 1FK9A 4BRGA 4CEFA 2FBTA 5KRSA 1ATRA 3N4QA 4JYAK 2W40A 4FLVA 2D5RA 4H5NA 2P9LA 3SQ0A 3DRPA 4M3UA 4N56A 4Z4GA 3CCUN 4JHDA 4O55A 1VRTA 4AF1A 4FJHA 2QWQA 3HPHA 5AFUH 1YTAA 2HBMA 3KKRA 1X1PA 2BUPA 1KC8O 1ASVA 2KKZA 1VQON 2X74A 4LH4A 5JVHL 3KHYA 5JLFA 2QWMA 4EHUA 5AQRA 3FZLA 4WQ4A 1TK0A 4M3ZA 2HHXA 2E5LK 4BRQA 3R1XA 5AFUA 4ISFA 4A61A 3MEGA 3O1WA 4GKJK 3O9TA 4DR5K 3UE5A 2HW3A 3LPUA 1VQNN 1C0UA 4JKAA 1WOQA 5TKYA 5GIPA 2HB5A 1S3XA 3O5BA 2DFFA 4JS4A 3AVAA 1EWRA 1S72N 1ZBSA 4BG8A 4DTRA 4DR4K 1HQUA 4LSNA 4QS9A 2XRIA 2B4JA 4FW2A 3VQ4A 3VQDA 3RTVA 2OTJN 2UYTA 3ID8A 3OYFA 1SL0A 1MWKA 2O8EA 3VQ5A 4JRQA 3K9JA 1M1KO 2HF4A 3SPYA 4WCEL 2QM1A 3H6EA 3OYGA 4DV0K 4LFAK 1WAFA 3CCSN 2FF6A 5LL6Z 1KD1O 3SAGA 1S5JA 3EEQA 2VQEK 3OTOK 3QINA 4GV9A 4BY9C 5ADXH 3AAPA 1BI4A 1RDDA 4IXCA 4BC3A 5EX5A 4CGJA 1CZ9A 1N34K 2X6SA 4O5BA 4XH5A 3VEYA 3B8AX 2W41A 3LWMA 4CI6A 3V4IA 3LDLA 1D9FA 4HUEA 3DWLA 3ENOA 4H0OA 2YV0X 3SQ2A 1U6ZA 2NNWA 4O0JA 1CLQA 5ADXA 2NRTA 5C15A 2F9WA 1BISA 3C65A 1XUPO 1W97L 2KLAA 4B08A 5I3UA 3DOLA 4QS8A 2JLEA 3AVKA 4KHQA 3F73A 3MX5A 3OHRA 4CJ4A 3VEWA 1WBBA 5FPMA 1VQ4N 4KRFA 2NRWA 5C0YA 2GV9A 1BOTO 3P1GA 1T05A 4H5VA 1F21A 4JK7A 3QNOA 2HHHK 3HL8A 4FPBA 3DM2A 4I2QA 3DYAA 3MK6A 4LFBK 2E88A 1S9GA 3KJVA 4DS5A 3O80A 1D4XA 4CHPA 1B9FA 1VQ7N 5C12A 3TABA 1NKEA 4RW8A 2KQ2A 1Q86O 5HP1A 3CMEN 4BRNA 1P8ZA 2R7YA 4DFKA 2IIRA 4R79A 2W42A 2ASOA 2P51A 2QKKA 4DU1A 5GAEP 4NO7A 1SKSA 3KIOA 3O9QA 2EHGA 3EN9A 1ZBUA 4CFDA 4FWPA 1VQ8N 2I7PA 5CY4A 5GADP 4CGDA 4KHPK 3VENA 2NRZA 3QIPA 4Z4EA 1HUXA 4Z94A 2HHWA 1EO1A 3THVA 1RGIA 2PYLA 3IFRA 3P31A 3VEOA 1TAQA 1NK8A 1IKXA 1I94K 5E84A 4WYBA 4W5TA 2ZJPL 1WSIA 2QI2A 1ILYA 3KK7A 4BRPA 3BUZB 2P5GA 3WUHA 1HKBA 1VQMN 3F2KA 3D45A 1HRHA 4IDHA 2F8SA 1T6CA 5JMVA 3VEZA 4DFJA 3ZSYA 4GNIA 3LAKA 4GW6A 3CJBA 1OH7A 2NZTA 1NLVA 4EFHA 2VG6A 3UB5A 4B8CA 2IVOA 3VPZA 1SKWA 1S1TA 1VQ6N 3QEWA 1XC3A 4NYNA 3TSUA 3SCXA 4O8KA 4DQIA 2GUIA 1QHAA 5E41A 1NK6A 2AA4A 1IKYA 4AM6A 3VF2A 4OPKA 3U8XA 1WNSA 4CW7B 3K5NA 2ZM6K 4CJ3A 3ULEB 3FFKB 1B92A 2A5XA 3CJCA 5AQSA 3V9WA 2E8AA 1K8KB 2QWNA 3C7NA 4BDYA 3D2FB 4N41A 1DGKN 3VQCA 3VN5A 4GVEA 3VQ7A 2KHOA 1LAVA 4KHSA 4W5NA 4DF4A 5FRMA 4CJTA 4IWVA 3RMCA 4CIFA 4YOXA 1XI1A 2HBLA 2DFEA 1HYZA 4LF6K 4V19S 4AH9A 4ID5A 4C8LA 3CM5A 1DKGD 4BWJA 4H5WA 4BE0A 1KAYA 2J4RA 4PKGA 4KB0A 4KAZA 4OGEA 2O8BB 3CFOA 4CJUA 1VSMA 4IOXA 1N8RO 2Q0UA 2A42A 3HVTA 2E4LA 4FWLA 1HYVA 3QEPA 3VETA 4A59A 2QWPA 4DSJA 3VGKA 4CJ7A 2YHAA 1Z05A 3IMXA 1LWCA 3W3DA 3AVGA 4YY3K 4FLWA 3AO1A 2WUSA 3EO3A 3OBWA 3PO4A 4BACA 4DFMA 3LM2A 4YOYA 4MO5A 1IV0A 1Q9YA 3HPGA 1RT4A 4EP4A 1N6QA 1XC9A 3WNGA 2IS3A 5SZTA 3H08A 2OTLN 3VF4A 1WLJA 3HYFA 2YNHA 1NOYA 2LSNA 5FPNA 1Q8IA 2G8HA 1U2VB 4DQRA 2CGLA 2HHVA 2F4VK 4JS5A 3O1BA 4YOVA 2D0AA 3PX0A 5LY3A 3L2UA 4JK8A 1CZBA 1YTUA 5F0XA 3M5RA 5M1FA 3A5MC 5AQFA 3LDNA 3OYBA 3OS2A 5IWAK 5BPMA 4E3SA 1ZBIA 2D0BA 1VSDA 3MN6A 4KH5A 4GV6A 1CXQA 2FXUA 1HJRA 3VQ6A 1HPMA 2FSJA 1YXQA 3ZSOA 5C25A 4CCHA 3C6TA 2VG7A 5JICA 1YAGA 3QFPA 3DLRA 3H1VX 1SL2A 1JLGA 4JNEA 3ULEA 1ZYQA 3OYNA 3L2QA 1KXPA 4GV3A 4F3TA 1I39A 1KQSM 2WOMA 4JKGB 3BZCA 3M1FA 3G4SN 1SS6A 2H3GX 3NE6A 1X3MA 2WFBA 3LDQA 4PUOA 4B3RK 3BP8A 2QEXN 4KI4A 3VQEA 3CMAN 1NGDA 4KHWA 1TKDA 3ZSZA 3AO4A 2E2PA 1ZXOA 3HP9A 3O9SA 3WNFA 4WE1A 3H3NO 5FDLA 3OJSA 2O8BA 2A41A 1NK0A 1J9AA 3VGLA 4C8MA 3VMFB 4K41A 1C0FA 1P90A 5HROA 5DM7L 1N5YA 5CR4A 2RF2A 1Y97A 3OYCA 2D0OA 4EZ6A 4FJMA 4JI2K 1Q9XA 4O44A 4B1ZA 1FW6A 5AZIB 1T44A 4IBNA 3VTIA 4BR7A 4CZEA 3LPTA 3ZT0A 4FWNA 1KFDA 4B9NA 4BC4A 4LD0A 4W5OA 3LANA 5AZJA 1BO5O 4JV5K 4FW1A 2Q0RA 1YVNA 3VQ9A 3WXKA 3MXMA 1OH8A 1JKHA 4FLTA 1MDUB 4FM2A 2IGIA 3NAEA 2W6LA 3DLHA 1NJWA 4ILGB 3TAFA 4AHVA 1T3VA 1U2VA 5BR8K 3ZX0A 2OANA 1NNEA 5M1PA 2VWKA 1IKWA 3NBPA 5KPRA 1QSSA 4MLEA 4EAHD
chains in the Genus database with same CATH topology
3SQ0A 2FBVA 4CJPA 4G1QA 5HLFA 1TL1A 3DRPA 4M3UA 4N56A 1W9HA 4IKFA 2HHUA 4Z4GA 4DFPA 4QCLA 3MXIA 3KD1E 1U48A 3ZT4A 2G8UA 1KVAA 4KV8A 3AVJA 4DTNA 1U45A 4O55A 1VRTA 4DTUA 3NFAA 3KLGA 4FJHA 3HPHA 3HXMA 1YTAA 2OYQA 4AHCA 4W5QA 1S6QA 3KKRA 3ZSVA 4H4MA 3PY8A 3DI6A 1X1PA 4NCAA 1ASVA 2X74A 4LH4A 3WNEA 4DSFA 1QS4A 2XO7A 1XHZA 3JSMA 3TARA 1NJYA 2F96A 1D9DA 4BE1A 2G8WA 2KZMA 1ZBHA 4CJEA 4RW6A 4AHUA 4DU4A 4CEDA 1JLEA 1TK0A 3KK1A 2OPPA 4M3ZA 2HHXA 4CJSA 3V1RA 1HMVA 4IDKA 2Z1GA 4F2RA 4FLYA 3HJFA 1TVRA 1REVA 1NJXA 3MEGA 1VSKA 3DRSA 1RT6A 4J2BA 1UA0A 1T7PA 2HW3A 3LPUA 1C0UA 3AVBA 3U3GA 1IKVA 4JRPA 1WSGA 2HB5A 3RWUA 3B6OA 3V1QA 1GOCA 2DFFA 4JS4A 3AVAA 1NK5A 3K2PA 4CHZA 4DTRA 1HQUA 1RILA 4LSNA 3I0SA 3LP1A 4E19A 2XRIA 2B4JA 4RW9A 2E6MA 4FW2A 1C1BA 3VQ4A 3OYEA 3SV4A 4ELTA 2ZQBA 4OKEA 2RN2A 4FJGA 4CK3A 1NKBA 3VQDA 3MXJA 3RTVA 1QHTA 4KHYA 3OYFA 4CJWA 1SL0A 3EZ5A 2F8TA 3VQ5A 4JRQA 2HHTA 1C1CA 4NCGA 4CF8A 3SUOA 3SPYA 1BHLA 4E7KA 3DLBA 3HK2A 3OYGA 3V9UA 3C6UA 1UWBA 4QAGA 4Q5VA 4RW4A 4KB1A 4KPYA 3M8PA 4CEBA 2ITGA 1QQCA 1WAFA 3T19A 4CEAA 4RW7A 1L3VA 2KZZA 2IAJA 4NCBA 1TKXA 4ICLA 1S5JA 4B8AB 3SQ4A 3ZSRA 1RT2A 4MFBA 3NHGA 3QINA 3L8BA 1BI4A 1RDDA 3T1AA 4N76A 4KFBA 4CGJA 3SNNA 2IOCA 4PWDA 1CZ9A 3QEVA 2X6SA 2Q3SA 4O5BA 1RDBA 4OLAA 2DTUA 1XWLA 3LWMA 3QERA 2HVHA 3HVRA 3V4IA 1RT1A 3SJJA 1D9FA 4FM1A 4HUEA 4Q0BA 2YKMA 4CEEA 1NOZA 3ASMA 2YV0X 4CGHA 1BL3A 1JLBA 3SQ2A 4O0JA 4FK0A 1CLQA 1FKPA 1JXBA 3G10A 5HRRA 4E7LA 1BISA 1IG9A 3EY1A 4KKOA 2VG5A 4B08A 4CK1A 5I3UA 4UQGA 3NGYA 1RBSA 1G15A 1A5XA 3DOLA 4Z4HA 4OJRA 2JLEA 3AVKA 4KHQA 3S3MA 4J2DA 3F73A 2HHQA 3NF6A 4CJ4A 4FCYA 4CF9A 1QE1A 3PO5A 1VSJA 3LZIA 4KRFA 1WAJA 4C8KA 2GV9A 3DLKA 3P1GA 1QSLA 1T05A 4KHNA 4FK4A 4OGCA 1F21A 3QNOA 4FLZA 4CIGA 1L3UA 4OVLA 3L2VA 3RRGA 4I2PA 3HL8A 4ELVA 3DM2A 4I2QA 1VSFA 4HCCA 1EKEA 3CM6A 3DYAA 3ZCMA 1S9GA 3KJVA 2E6LA 3AVHA 4DS5A 1KRPA 1YVUA 3DOKA 3VQQA 4CHPA 1B9FA 1A5WA 1JLAA 1RT5A 4CHQA 3OYAA 5DMRA 3HT3A 3TABA 1NKEA 1DLOA 4TSXA 4RW8A 2KQ2A 4N47A 4M42A 2JGUA 2XHBA 3SUPA 1JLFA 4DSEA 5HP1A 3ALYA 2BGGA 4ZTJA 3SQ1A 3TAMA 1J54A 2R7YA 4DFKA 3G0ZA 3LZJA 3V9XA 3QEXA 3SUQA 3SPZA 1HNIA 1R0AA 2FBYA 3KLFA 3SYZA 3RR7A 5HRSA 3OS1A 3OYHA 2W42A 1JXEA 4KTZA 2P51A 1NJZA 2QKKA 4FJ9A 2KW4A 4I9LA 4AILC 3K5LA 4DU1A 2G8FA 3NCIA 1RDCA 5DK5A 3TWHA 4E0DA 1UAXA 1LWFA 3SZ2A 1ASUA 3KIOA 4CE9A 1SKSA 4W5RA 3KKSA 1VSIA 1BQMA 2EHGA 3NH0A 1ITGA 1ZBUA 3VQBA 4CFDA 3NH2A 3DLGA 2Z1JA 1L3TA 2IDOA 3AVNA 3C94A 5CY4A 3RRHA 3TI0A 1RTDA 4CGDA 1WSJA 4FM0A 1U47A 2ATQA 1SUQA 4YNQA 4DLEA 3QIPA 4Z4EA 5JS2A 4ZTFA 1EP4A 4HTUA 4FJNA 2HHWA 3DLEA 1LAWA 3THVA 3RR8A 4Y1CA 2QK9A 2PYLA 4DG1A 1HYSA 1LW0A 3AV9A 1TAUA 4M45A 3OYIA 1TAQA 3OYJA 1IKXA 1NK8A 1X9WA 4OKKA 3OY9A 4W5TA 4AHRA 1WSIA 4Y1DA 4B9MA 2XY8A 4DSKA 2P5GA 3HO1A 3LP3A 3OS0A 3D45A 3HSTB 1HRHA 4B9LA 5J2MA 2F8SA 1J53A 1GOAA 4HCBA 4DFJA 4I7FA 4I9QA 3V9ZA 4DQSA 3ZSYA 3OYKA 4M3WA 1S1XA 3LAKA 4GW6A 2Y1IA 4FXDA 4B9SA 1K6YA 2HNYA 1NK7A 4FJKA 2HVIA 5HRNA 1VSLA 4DWIA 2HNDA 2VG6A 4IFVA 4B8CA 4MQ3A 2PZSA 3KD5E 4CJQA 4F2SA 1CXUA 1Z25A 1X9MA 4BDZA 4B9VA 3LP2A 2I5JA 3AO3A 1SKWA 1TGOA 1RBTA 4KHUA 1S1TA 2HNZA 5CYMA 3ZT1A 4NYNA 3QEWA 2FC0A 1RBUA 3K57A 2GUIA 3LDSA 3SCXA 3IAYA 3KLEA 5J2PA 4DQIA 4Z4FA 4QOZB 4ID1A 5E41A 3K58A 3TANA 1U4BA 1NK6A 1NK9A 1IKYA 3VA0A 1TK8A 5HRPA 5J1EA 3AVLA 3DMJA 4M3YA 1C0MA 1JL2A 4LH5A 2P1JA 2Z1IA 3QIOA 4OPKA 2RPIA 1NKCA 1WNSA 4YFUA 3S3OA 3O4QA 4BWMA 2ZD1A 3K5NA 3QESA 5KGXA 1C6VA 4E7JA 4CJ3A 4ZHRA 1RBRA 3ISNC 1B92A 2B5JA 4CF1A 1RNHA 3V9WA 1BCMA 4BDYA 4N41A 4CERA 3ZSQA 4CJ5A 3VQCA 3T3FA 1VRUA 3VN5A 5SWMA 4XIUA 1B9DA 3IRXA 4KREA 2D0CA 3TAEA 1WN7A 4DSLA 5CZ1A 3VQ7A 1QTMA 3SUNA 1IO2A 1LAVA 2EX3A 5CZ2A 1C0TA 4EZ9A 2OPQA 4KHSA 4W5NA 3NF8A 1KVBA 4DF4A 5FRMA 1S1WA 4CJTA 1XHXA 4E7HA 2X78A 4CIFA 3CFPA 1TV6A 2DFHA 3RMCA 5C42A 5EU7A 4CHOA 1UOCA 1XI1A 1KFSA 1S9EA 1HYZA 2DFEA 4CECA 2VWJA 3QLHA 4AH9A 4N5SA 3O3GA 4F3OA 4ID5A 4C8LA 1IH7A 2KFNA 4BDPA 3CM5A 3RMBA 3FFIA 4BWJA 5KTQA 1SL1A 1O1WA 3QO9A 4BE0A 3K5OA 1LV5A 3ZT2A 3S3NA 4KB0A 4KAZA 1S6PA 4OGEA 1UA1A 4FJ5A 2QXFA 3S9HA 3CFOA 4CJUA 1FXXA 2OA8A 3KTQA 1VSMA 2G8IA 4B3OA 2PYJA 3HVTA 2E4LA 1HYVA 3QEPA 4K8ZA 4KI6A 3O3FA 2Y1JA 1JLQA 4O0IA 4O4GA 4FJJA 3NF9A 1MU2A 3ZT3A 4KO0A 4DSJA 4DTPA 2YHAA 3P83D 3KLHA 3K59A 3CYMA 1LWCA 1LW2A 4CJLA 3JYTA 4AHSA 4CFCA 4CEOA 4E1MA 3ZSWA 3BGRA 3AVGA 3SV3A 2AJQA 3F9KA 3C95A 3KLIA 4FLWA 3AO1A 1L5UA 4PY5A 2G8VA 1RTIA 3PO4A 4CIEA 3NGIA 3PV8A 4BACA 4CFAA 2ETJA 4K8XA 4DFMA 3VQAA 4DQPA 3CG7A 4CHNA 1Q9YA 1HNVA 4E89A 3HPGA 4GVMA 1RT4A 5K14A 4C8OA 2HHSA 3LALA 2DY4A 4EP4A 1N6QA 3E01A 1BIZA 3V1OA 3WNGA 2IS3A 5SZTA 3H08A 4DTOA 2XY5A 1XC9A 1BIUA 3KK3A 1WLJA 3AVIA 2YNHA 3HYFA 3VQPA 4DS4A 1NOYA 2LSNA 2OZMA 4FK2A 3IS9A 3KK2A 3PUFA 1BCOA 3AA4A 1Q8IA 3PX4A 2G8HA 4CGGA 5KRTA 4DQRA 2A1SA 3TAGA 4CJRA 2IC3A 2HHVA 3HP6A 3K5MA 4JS5A 5KI6A 1RTJA 3L3UA 4DLGA 4FLUA 1KLMA 1ZBFA 2KTQA 2D0AA 1U04A 3PX0A 1VK0A 3L2UA 4FZZA 2OPSA 1CZBA 2QKBA 2O4IA 1YTUA 3ULDA 4FJXA 3SI6A 3ZSXA 3AA5X 1BQNA 2YNFA 3OYBA 1TKZA 1I3AA 4FVMA 3L2WA 5C24A 3OS2A 3NGZA 4FZYA 4E3SA 3AVMA 4RG8A 1ZBIA 2D0BA 1VSDA 3P5JA 1CXQA 2KFZA 3A2FA 3RMDA 1HJRA 3VQ6A 3AO2A 3CQ8A 3OYMA 4C8NA 1YT3A 1T03A 3VQ8A 1WSHA 3ZSOA 5C25A 1KCFA 4DMNA 3ITHA 1EX4A 3M8RA 1DTQA 5JS1A 5FRNA 4CCHA 4DU3A 1TK5A 2Z1HA 3C6TA 2VG7A 4CESA 4HUFA 4DTSA 3QEIA 3PX6A 4ELUA 3LAMA 3AA3A 3DLRA 4R5PA 1SL2A 3TAQA 3MAQA 1JLGA 4CF2A 5D3GA 4B9UA 1HQEA 3I0RA 1RT3A 2WONA 4H4OA 4Z0UA 4HHTA 2X6NA 3CFRA 2O4GA 4L8RB 3NDKA 3V6DA 4E7IA 4CJKA 3VA3A 1ZYQA 3OYNA 3TAPA 3L2QA 3QETA 1X9SA 3AA2A 2FBXA 3AVFA 1DTTA 3OVNA 3I8DA 4B9TA 2BE2A 4FJ8A 4F3TA 1I39A 4OPJA 2ZE2A 4GMJB 4LY7A 3MECA 2WOMA 2RKIA 2B6AA 4BE2A 1FKOA 1TKTA 4JLHA 1ZBLA 2BANA 4M3RA 3MEEA 1D5AA 2YNIA 2YHBA 3NE6A 1SV5A 1WSFA 4IFYA 4FLXA 1KSPA 2XY6A 3QNNA 4PUOA 4OLBA 1JLCA 4KI4A 4FJIA 1S1VA 3VQEA 1JL1A 5J2QA 3BDPA 5CYQA 3B6PA 3DRRA 3O3HA 1TKDA 4KHWA 1RTHA 3ZSZA 3AO4A 1VSEA 4PA1A 4CJFA 3V9SA 1VSHA 5HBMA 4DTJA 3U3YA 4DF8A 4FZXC 4IG3A 4HVJA 3HP9A 3IG1A 1KTQA 3D0PA 3OJUA 3WNFA 1U49A 3OYLA 4KTWA 4WE1A 1HPZA 5FDLA 5T7BA 3OJSA 3LWLA 1C1AA 4J2EA 4Z4IA 4PQUA 1T8EA 1NK0A 1J9AA 1WSEA 4C8MA 4AHTA 5HROA 3WNHA 2YNGA 1BGXT 1N5YA 2HMIA 4E1NA 2RF2A 1Y97A 3V81A 3OYCA 4CEZA 4EZ6A 1L3SA 3LP0A 4CJVA 1S1UA 2G8KA 4FJMA 1Q9XA 1KVCA 4O44A 1RCHA 4CF0A 1Z26A 4KTQA 4IBNA 1BI4B 1EETA 4M3TA 3LPTA 2P5OA 3ZT0A 4CK2A 3RMAA 4DTXA 3U6FA 1W0HA 1KFDA 3HPOA 4B9NA 3UIQA 3L3VA 4IG0A 4LD0A 2OZSA 4CGIA 4HUGA 3NF7A 4W5OA 4F4KA 2GBZA 3LANA 4DTMA 4DQQA 5I42A 3EYZA 1GOBA 4OKJA 4M41A 4LSLA 3MEDA 1TL3A 4FW1A 4FJLA 5FROA 4EP5A 3VQ9A 4NYFA 1RBVA 3NH1A 3OYDA 2PY5A 1ASWA 4Z4CA 3MXMA 4J2AA 3L2RA 1RDAA 1JKHA 4CHYA 4FLTA 4FJ7A 1QSYA 4FM2A 2IGIA 1KLNA 1LWEA 3AO5A 3NAEA 4FYDA 3TR8A 3AVCA 2A1RA 1A5VA 2NUBA 3HM9A 3DLHA 3O4NA 1NJWA 4H8KA 3TAFA 4AHVA 1D8YA 4M3XA 2BDPA 1FK9A 1EXQA 5J2NA 4CEFA 2FBTA 5KRSA 1SKRA 1RT7A 5KGWA 4CEQA 4DSIA 4CGFA 1J5OA 2VWKA 1IKWA 3NBPA 2YKNA 4CFBA 3M8QA 3M8SA 4FLVA 2XY7A 2D5RA 1NK4A 4F8RA 1QSSA 2OPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQ0 A;  2FBV A;  4CJP A;  4G1Q A;  5HLF A;  1TL1 A;  3DRP A;  4M3U A;  4N56 A;  1W9H A;  4IKF A;  2HHU A;  4Z4G A;  4DFP A;  4QCL A;  3MXI A;  3KD1 E;  1U48 A;  3ZT4 A;  2G8U A;  1KVA A;  4KV8 A;  3AVJ A;  4DTN A;  1U45 A;  4O55 A;  1VRT A;  4DTU A;  3NFA A;  3KLG A;  4FJH A;  3HPH A;  3HXM A;  1YTA A;  2OYQ A;  4AHC A;  4W5Q A;  1S6Q A;  3KKR A;  3ZSV A;  4H4M A;  3PY8 A;  3DI6 A;  1X1P A;  4NCA A;  1ASV A;  2X74 A;  4LH4 A;  3WNE A;  4DSF A;  1QS4 A;  2XO7 A;  1XHZ A;  3JSM A;  3TAR A;  1NJY A;  2F96 A;  1D9D A;  4BE1 A;  2G8W A;  2KZM A;  1ZBH A;  4CJE A;  4RW6 A;  4AHU A;  4DU4 A;  4CED A;  1JLE A;  1TK0 A;  3KK1 A;  2OPP A;  4M3Z A;  2HHX A;  4CJS A;  3V1R A;  1HMV A;  4IDK A;  2Z1G A;  4F2R A;  4FLY A;  3HJF A;  1TVR A;  1REV A;  1NJX A;  3MEG A;  1VSK A;  3DRS A;  1RT6 A;  4J2B A;  1UA0 A;  1T7P A;  2HW3 A;  3LPU A;  1C0U A;  3AVB A;  3U3G A;  1IKV A;  4JRP A;  1WSG A;  2HB5 A;  3RWU A;  3B6O A;  3V1Q A;  1GOC A;  2DFF A;  4JS4 A;  3AVA A;  1NK5 A;  3K2P A;  4CHZ A;  4DTR A;  1HQU A;  1RIL A;  4LSN A;  3I0S A;  3LP1 A;  4E19 A;  2XRI A;  2B4J A;  4RW9 A;  2E6M A;  4FW2 A;  1C1B A;  3VQ4 A;  3OYE A;  3SV4 A;  4ELT A;  2ZQB A;  4OKE A;  2RN2 A;  4FJG A;  4CK3 A;  1NKB A;  3VQD A;  3MXJ A;  3RTV A;  1QHT A;  4KHY A;  3OYF A;  4CJW A;  1SL0 A;  3EZ5 A;  2F8T A;  3VQ5 A;  4JRQ A;  2HHT A;  1C1C A;  4NCG A;  4CF8 A;  3SUO A;  3SPY A;  1BHL A;  4E7K A;  3DLB A;  3HK2 A;  3OYG A;  3V9U A;  3C6U A;  1UWB A;  4QAG A;  4Q5V A;  4RW4 A;  4KB1 A;  4KPY A;  3M8P A;  4CEB A;  2ITG A;  1QQC A;  1WAF A;  3T19 A;  4CEA A;  4RW7 A;  1L3V A;  2KZZ A;  2IAJ A;  4NCB A;  1TKX A;  4ICL A;  1S5J A;  4B8A B;  3SQ4 A;  3ZSR A;  1RT2 A;  4MFB A;  3NHG A;  3QIN A;  3L8B A;  1BI4 A;  1RDD A;  3T1A A;  4N76 A;  4KFB A;  4CGJ A;  3SNN A;  2IOC A;  4PWD A;  1CZ9 A;  3QEV A;  2X6S A;  2Q3S A;  4O5B A;  1RDB A;  4OLA A;  2DTU A;  1XWL A;  3LWM A;  3QER A;  2HVH A;  3HVR A;  3V4I A;  1RT1 A;  3SJJ A;  1D9F A;  4FM1 A;  4HUE A;  4Q0B A;  2YKM A;  4CEE A;  1NOZ A;  3ASM A;  2YV0 X;  4CGH A;  1BL3 A;  1JLB A;  3SQ2 A;  4O0J A;  4FK0 A;  1CLQ A;  1FKP A;  1JXB A;  3G10 A;  5HRR A;  4E7L A;  1BIS A;  1IG9 A;  3EY1 A;  4KKO A;  2VG5 A;  4B08 A;  4CK1 A;  5I3U A;  4UQG A;  3NGY A;  1RBS A;  1G15 A;  1A5X A;  3DOL A;  4Z4H A;  4OJR A;  2JLE A;  3AVK A;  4KHQ A;  3S3M A;  4J2D A;  3F73 A;  2HHQ A;  3NF6 A;  4CJ4 A;  4FCY A;  4CF9 A;  1QE1 A;  3PO5 A;  1VSJ A;  3LZI A;  4KRF A;  1WAJ A;  4C8K A;  2GV9 A;  3DLK A;  3P1G A;  1QSL A;  1T05 A;  4KHN A;  4FK4 A;  4OGC A;  1F21 A;  3QNO A;  4FLZ A;  4CIG A;  1L3U A;  4OVL A;  3L2V A;  3RRG A;  4I2P A;  3HL8 A;  4ELV A;  3DM2 A;  4I2Q A;  1VSF A;  4HCC A;  1EKE A;  3CM6 A;  3DYA A;  3ZCM A;  1S9G A;  3KJV A;  2E6L A;  3AVH A;  4DS5 A;  1KRP A;  1YVU A;  3DOK A;  3VQQ A;  4CHP A;  1B9F A;  1A5W A;  1JLA A;  1RT5 A;  4CHQ A;  3OYA A;  5DMR A;  3HT3 A;  3TAB A;  1NKE A;  1DLO A;  4TSX A;  4RW8 A;  2KQ2 A;  4N47 A;  4M42 A;  2JGU A;  2XHB A;  3SUP A;  1JLF A;  4DSE A;  5HP1 A;  3ALY A;  2BGG A;  4ZTJ A;  3SQ1 A;  3TAM A;  1J54 A;  2R7Y A;  4DFK A;  3G0Z A;  3LZJ A;  3V9X A;  3QEX A;  3SUQ A;  3SPZ A;  1HNI A;  1R0A A;  2FBY A;  3KLF A;  3SYZ A;  3RR7 A;  5HRS A;  3OS1 A;  3OYH A;  2W42 A;  1JXE A;  4KTZ A;  2P51 A;  1NJZ A;  2QKK A;  4FJ9 A;  2KW4 A;  4I9L A;  4AIL C;  3K5L A;  4DU1 A;  2G8F A;  3NCI A;  1RDC A;  5DK5 A;  3TWH A;  4E0D A;  1UAX A;  1LWF A;  3SZ2 A;  1ASU A;  3KIO A;  4CE9 A;  1SKS A;  4W5R A;  3KKS A;  1VSI A;  1BQM A;  2EHG A;  3NH0 A;  1ITG A;  1ZBU A;  3VQB A;  4CFD A;  3NH2 A;  3DLG A;  2Z1J A;  1L3T A;  2IDO A;  3AVN A;  3C94 A;  5CY4 A;  3RRH A;  3TI0 A;  1RTD A;  4CGD A;  1WSJ A;  4FM0 A;  1U47 A;  2ATQ A;  1SUQ A;  4YNQ A;  4DLE A;  3QIP A;  4Z4E A;  5JS2 A;  4ZTF A;  1EP4 A;  4HTU A;  4FJN A;  2HHW A;  3DLE A;  1LAW A;  3THV A;  3RR8 A;  4Y1C A;  2QK9 A;  2PYL A;  4DG1 A;  1HYS A;  1LW0 A;  3AV9 A;  1TAU A;  4M45 A;  3OYI A;  1TAQ A;  3OYJ A;  1IKX A;  1NK8 A;  1X9W A;  4OKK A;  3OY9 A;  4W5T A;  4AHR A;  1WSI A;  4Y1D A;  4B9M A;  2XY8 A;  4DSK A;  2P5G A;  3HO1 A;  3LP3 A;  3OS0 A;  3D45 A;  3HST B;  1HRH A;  4B9L A;  5J2M A;  2F8S A;  1J53 A;  1GOA A;  4HCB A;  4DFJ A;  4I7F A;  4I9Q A;  3V9Z A;  4DQS A;  3ZSY A;  3OYK A;  4M3W A;  1S1X A;  3LAK A;  4GW6 A;  2Y1I A;  4FXD A;  4B9S A;  1K6Y A;  2HNY A;  1NK7 A;  4FJK A;  2HVI A;  5HRN A;  1VSL A;  4DWI A;  2HND A;  2VG6 A;  4IFV A;  4B8C A;  4MQ3 A;  2PZS A;  3KD5 E;  4CJQ A;  4F2S A;  1CXU A;  1Z25 A;  1X9M A;  4BDZ A;  4B9V A;  3LP2 A;  2I5J A;  3AO3 A;  1SKW A;  1TGO A;  1RBT A;  4KHU A;  1S1T A;  2HNZ A;  5CYM A;  3ZT1 A;  4NYN A;  3QEW A;  2FC0 A;  1RBU A;  3K57 A;  2GUI A;  3LDS A;  3SCX A;  3IAY A;  3KLE A;  5J2P A;  4DQI A;  4Z4F A;  4QOZ B;  4ID1 A;  5E41 A;  3K58 A;  3TAN A;  1U4B A;  1NK6 A;  1NK9 A;  1IKY A;  3VA0 A;  1TK8 A;  5HRP A;  5J1E A;  3AVL A;  3DMJ A;  4M3Y A;  1C0M A;  1JL2 A;  4LH5 A;  2P1J A;  2Z1I A;  3QIO A;  4OPK A;  2RPI A;  1NKC A;  1WNS A;  4YFU A;  3S3O A;  3O4Q A;  4BWM A;  2ZD1 A;  3K5N A;  3QES A;  5KGX A;  1C6V A;  4E7J A;  4CJ3 A;  4ZHR A;  1RBR A;  3ISN C;  1B92 A;  2B5J A;  4CF1 A;  1RNH A;  3V9W A;  1BCM A;  4BDY A;  4N41 A;  4CER A;  3ZSQ A;  4CJ5 A;  3VQC A;  3T3F A;  1VRU A;  3VN5 A;  5SWM A;  4XIU A;  1B9D A;  3IRX A;  4KRE A;  2D0C A;  3TAE A;  1WN7 A;  4DSL A;  5CZ1 A;  3VQ7 A;  1QTM A;  3SUN A;  1IO2 A;  1LAV A;  2EX3 A;  5CZ2 A;  1C0T A;  4EZ9 A;  2OPQ A;  4KHS A;  4W5N A;  3NF8 A;  1KVB A;  4DF4 A;  5FRM A;  1S1W A;  4CJT A;  1XHX A;  4E7H A;  2X78 A;  4CIF A;  3CFP A;  1TV6 A;  2DFH A;  3RMC A;  5C42 A;  5EU7 A;  4CHO A;  1UOC A;  1XI1 A;  1KFS A;  1S9E A;  1HYZ A;  2DFE A;  4CEC A;  2VWJ A;  3QLH A;  4AH9 A;  4N5S A;  3O3G A;  4F3O A;  4ID5 A;  4C8L A;  1IH7 A;  2KFN A;  4BDP A;  3CM5 A;  3RMB A;  3FFI A;  4BWJ A;  5KTQ A;  1SL1 A;  1O1W A;  3QO9 A;  4BE0 A;  3K5O A;  1LV5 A;  3ZT2 A;  3S3N A;  4KB0 A;  4KAZ A;  1S6P A;  4OGE A;  1UA1 A;  4FJ5 A;  2QXF A;  3S9H A;  3CFO A;  4CJU A;  1FXX A;  2OA8 A;  3KTQ A;  1VSM A;  2G8I A;  4B3O A;  2PYJ A;  3HVT A;  2E4L A;  1HYV A;  3QEP A;  4K8Z A;  4KI6 A;  3O3F A;  2Y1J A;  1JLQ A;  4O0I A;  4O4G A;  4FJJ A;  3NF9 A;  1MU2 A;  3ZT3 A;  4KO0 A;  4DSJ A;  4DTP A;  2YHA A;  3P83 D;  3KLH A;  3K59 A;  3CYM A;  1LWC A;  1LW2 A;  4CJL A;  3JYT A;  4AHS A;  4CFC A;  4CEO A;  4E1M A;  3ZSW A;  3BGR A;  3AVG A;  3SV3 A;  2AJQ A;  3F9K A;  3C95 A;  3KLI A;  4FLW A;  3AO1 A;  1L5U A;  4PY5 A;  2G8V A;  1RTI A;  3PO4 A;  4CIE A;  3NGI A;  3PV8 A;  4BAC A;  4CFA A;  2ETJ A;  4K8X A;  4DFM A;  3VQA A;  4DQP A;  3CG7 A;  4CHN A;  1Q9Y A;  1HNV A;  4E89 A;  3HPG A;  4GVM A;  1RT4 A;  5K14 A;  4C8O A;  2HHS A;  3LAL A;  2DY4 A;  4EP4 A;  1N6Q A;  3E01 A;  1BIZ A;  3V1O A;  3WNG A;  2IS3 A;  5SZT A;  3H08 A;  4DTO A;  2XY5 A;  1XC9 A;  1BIU A;  3KK3 A;  1WLJ A;  3AVI A;  2YNH A;  3HYF A;  3VQP A;  4DS4 A;  1NOY A;  2LSN A;  2OZM A;  4FK2 A;  3IS9 A;  3KK2 A;  3PUF A;  1BCO A;  3AA4 A;  1Q8I A;  3PX4 A;  2G8H A;  4CGG A;  5KRT A;  4DQR A;  2A1S A;  3TAG A;  4CJR A;  2IC3 A;  2HHV A;  3HP6 A;  3K5M A;  4JS5 A;  5KI6 A;  1RTJ A;  3L3U A;  4DLG A;  4FLU A;  1KLM A;  1ZBF A;  2KTQ A;  2D0A A;  1U04 A;  3PX0 A;  1VK0 A;  3L2U A;  4FZZ A;  2OPS A;  1CZB A;  2QKB A;  2O4I A;  1YTU A;  3ULD A;  4FJX A;  3SI6 A;  3ZSX A;  3AA5 X;  1BQN A;  2YNF A;  3OYB A;  1TKZ A;  1I3A A;  4FVM A;  3L2W A;  5C24 A;  3OS2 A;  3NGZ A;  4FZY A;  4E3S A;  3AVM A;  4RG8 A;  1ZBI A;  2D0B A;  1VSD A;  3P5J A;  1CXQ A;  2KFZ A;  3A2F A;  3RMD A;  1HJR A;  3VQ6 A;  3AO2 A;  3CQ8 A;  3OYM A;  4C8N A;  1YT3 A;  1T03 A;  3VQ8 A;  1WSH A;  3ZSO A;  5C25 A;  1KCF A;  4DMN A;  3ITH A;  1EX4 A;  3M8R A;  1DTQ A;  5JS1 A;  5FRN A;  4CCH A;  4DU3 A;  1TK5 A;  2Z1H A;  3C6T A;  2VG7 A;  4CES A;  4HUF A;  4DTS A;  3QEI A;  3PX6 A;  4ELU A;  3LAM A;  3AA3 A;  3DLR A;  4R5P A;  1SL2 A;  3TAQ A;  3MAQ A;  1JLG A;  4CF2 A;  5D3G A;  4B9U A;  1HQE A;  3I0R A;  1RT3 A;  2WON A;  4H4O A;  4Z0U A;  4HHT A;  2X6N A;  3CFR A;  2O4G A;  4L8R B;  3NDK A;  3V6D A;  4E7I A;  4CJK A;  3VA3 A;  1ZYQ A;  3OYN A;  3TAP A;  3L2Q A;  3QET A;  1X9S A;  3AA2 A;  2FBX A;  3AVF A;  1DTT A;  3OVN A;  3I8D A;  4B9T A;  2BE2 A;  4FJ8 A;  4F3T A;  1I39 A;  4OPJ A;  2ZE2 A;  4GMJ B;  4LY7 A;  3MEC A;  2WOM A;  2RKI A;  2B6A A;  4BE2 A;  1FKO A;  1TKT A;  4JLH A;  1ZBL A;  2BAN A;  4M3R A;  3MEE A;  1D5A A;  2YNI A;  2YHB A;  3NE6 A;  1SV5 A;  1WSF A;  4IFY A;  4FLX A;  1KSP A;  2XY6 A;  3QNN A;  4PUO A;  4OLB A;  1JLC A;  4KI4 A;  4FJI A;  1S1V A;  3VQE A;  1JL1 A;  5J2Q A;  3BDP A;  5CYQ A;  3B6P A;  3DRR A;  3O3H A;  1TKD A;  4KHW A;  1RTH A;  3ZSZ A;  3AO4 A;  1VSE A;  4PA1 A;  4CJF A;  3V9S A;  1VSH A;  5HBM A;  4DTJ A;  3U3Y A;  4DF8 A;  4FZX C;  4IG3 A;  4HVJ A;  3HP9 A;  3IG1 A;  1KTQ A;  3D0P A;  3OJU A;  3WNF A;  1U49 A;  3OYL A;  4KTW A;  4WE1 A;  1HPZ A;  5FDL A;  5T7B A;  3OJS A;  3LWL A;  1C1A A;  4J2E A;  4Z4I A;  4PQU A;  1T8E A;  1NK0 A;  1J9A A;  1WSE A;  4C8M A;  4AHT A;  5HRO A;  3WNH A;  2YNG A;  1BGX T;  1N5Y A;  2HMI A;  4E1N A;  2RF2 A;  1Y97 A;  3V81 A;  3OYC A;  4CEZ A;  4EZ6 A;  1L3S A;  3LP0 A;  4CJV A;  1S1U A;  2G8K A;  4FJM A;  1Q9X A;  1KVC A;  4O44 A;  1RCH A;  4CF0 A;  1Z26 A;  4KTQ A;  4IBN A;  1BI4 B;  1EET A;  4M3T A;  3LPT A;  2P5O A;  3ZT0 A;  4CK2 A;  3RMA A;  4DTX A;  3U6F A;  1W0H A;  1KFD A;  3HPO A;  4B9N A;  3UIQ A;  3L3V A;  4IG0 A;  4LD0 A;  2OZS A;  4CGI A;  4HUG A;  3NF7 A;  4W5O A;  4F4K A;  2GBZ A;  3LAN A;  4DTM A;  4DQQ A;  5I42 A;  3EYZ A;  1GOB A;  4OKJ A;  4M41 A;  4LSL A;  3MED A;  1TL3 A;  4FW1 A;  4FJL A;  5FRO A;  4EP5 A;  3VQ9 A;  4NYF A;  1RBV A;  3NH1 A;  3OYD A;  2PY5 A;  1ASW A;  4Z4C A;  3MXM A;  4J2A A;  3L2R A;  1RDA A;  1JKH A;  4CHY A;  4FLT A;  4FJ7 A;  1QSY A;  4FM2 A;  2IGI A;  1KLN A;  1LWE A;  3AO5 A;  3NAE A;  4FYD A;  3TR8 A;  3AVC A;  2A1R A;  1A5V A;  2NUB A;  3HM9 A;  3DLH A;  3O4N A;  1NJW A;  4H8K A;  3TAF A;  4AHV A;  1D8Y A;  4M3X A;  2BDP A;  1FK9 A;  1EXQ A;  5J2N A;  4CEF A;  2FBT A;  5KRS A;  1SKR A;  1RT7 A;  5KGW A;  4CEQ A;  4DSI A;  4CGF A;  1J5O A;  2VWK A;  1IKW A;  3NBP A;  2YKN A;  4CFB A;  3M8Q A;  3M8S A;  4FLV A;  2XY7 A;  2D5R A;  1NK4 A;  4F8R A;  1QSS A;  2OPR A; 
#chains in the Genus database with same CATH topology
 2FBV A;  4IEE A;  4IKF A;  3O08 A;  2HBJ A;  4QCL A;  3A5L C;  3MXI A;  4FVU A;  3AVJ A;  4M7Y A;  2P9L B;  4YOU A;  4AHC A;  1S6Q A;  1SZ2 A;  4H4M A;  4BE1 A;  2G8W A;  3CQX A;  4CJE A;  4PL7 A;  3KK1 A;  1OH5 A;  1LOT B;  4LFC K;  1GLD G;  1NJI O;  1TVR A;  1REV A;  1NGE A;  3DRS A;  2PFU A;  3HM8 A;  5FLX O;  4J2B A;  1UA0 A;  1GLF O;  3LDO A;  3SMP A;  1T7P A;  4DB3 A;  2DPN A;  2GWJ A;  4JRP A;  1WSG A;  3RWU A;  1GOC A;  3NVM A;  3E9O A;  5DM6 L;  1VQL N;  3LP1 A;  4RW9 A;  4DUZ K;  3SV4 A;  4ELT A;  4CK3 A;  2F8T A;  1Q18 A;  4C1N I;  2VGM A;  4E7K A;  1E4G T;  4BRI A;  3V9U A;  3C6U A;  1UWB A;  1V4T A;  4FWR A;  3M8P A;  4CEB A;  1QQC A;  3T19 A;  4AQY K;  4OPH A;  4NCB A;  1TKX A;  3Q7C A;  4ICL A;  2Q97 A;  3ZSR A;  4MFB A;  3NHG A;  5AZI A;  4JI5 K;  2GX9 A;  4N76 A;  3QBX A;  5AQN A;  2IOC A;  1WB9 A;  3M6G A;  4H0V B;  2Q3S A;  5BRD A;  3G6E N;  4OLA A;  2HVH A;  1RT1 A;  1BA1 A;  3T7Z A;  3THX B;  2P9U B;  4FM1 A;  3CJ1 A;  2YKM A;  1YHQ N;  2Q36 A;  1BL3 A;  3GDQ A;  4JKD A;  3G10 A;  1QZ5 A;  4UQG A;  3NGY A;  5AQU A;  3FE1 A;  4A57 A;  1HR0 K;  3J81 O;  5TKW A;  3NF6 A;  4FCY A;  3PO5 A;  4A5B A;  4IZ9 A;  3ZX3 A;  1WAJ A;  4FK4 A;  3TTF A;  4OGC A;  4PKH A;  4FLZ A;  3CCQ N;  2P9P B;  4OVL A;  3L2V A;  4I2P A;  4ELV A;  4HCC A;  1EKE A;  3CM6 A;  3ZCM A;  4WFB L;  2E6L A;  3AVH A;  2VWB A;  3CPW M;  3D2E A;  3CET A;  4N47 A;  2QA4 N;  1JLF A;  1KAX A;  3HBT A;  1K8A O;  1J54 A;  3LZJ A;  1Y64 A;  4BQL A;  3KLF A;  3SYZ A;  3RR7 A;  5HRS A;  4DCH A;  3OS1 A;  1JXE A;  4KTZ A;  1NJZ A;  2D1K A;  2KW4 A;  4FJ9 A;  4DV4 K;  1UAX A;  1XMO K;  1ASU A;  4CE9 A;  1BQM A;  2Q2R A;  2JWL A;  3DLG A;  3NMU A;  1RTD A;  4FM0 A;  4DLE A;  3R8E A;  1EP4 A;  4B1X B;  4HTU A;  3DLE A;  3RR8 A;  2QK9 A;  5JLH A;  1HYS A;  1TAU A;  4M45 A;  3HRG A;  3CJ7 A;  1NMD A;  1QQO A;  3U9D A;  2YHX A;  5CE3 A;  4BR0 A;  1NGF A;  5AQV A;  4DSK A;  3C6A A;  3MX2 A;  4B9L A;  4JI1 K;  4BRL A;  1GOA A;  4HCB A;  3V9Z A;  3OYK A;  4X64 K;  4E1J A;  4B9S A;  2HVI A;  4DWI A;  3H1Q A;  4MQ3 A;  2PZS A;  4F2S A;  1Z25 A;  1HJO A;  4JD2 B;  3IAY A;  3LDS A;  4BRA A;  1H1V A;  3TAN A;  1U4B A;  3QFU A;  5AQP A;  3VA0 A;  1TK8 A;  5J1E A;  2ZGY A;  3AVL A;  3DMJ A;  1C0M A;  4FWS A;  3CF5 L;  2RPI A;  4K0K K;  3A8Y A;  3O4Q A;  4BWM A;  4GKK K;  5KGX A;  1C6V A;  4E7J A;  3THX A;  2P9U A;  4FOI A;  2B5J A;  2W6K A;  1BWF O;  3J80 O;  4CER A;  3ZSQ A;  2BH1 A;  1VRU A;  5SWM A;  1B9D A;  4KRE A;  4DSL A;  4EZ9 A;  5CZ2 A;  2OPQ A;  3NF8 A;  3KWG A;  3ZET B;  3C7N B;  1S1W A;  1RFQ A;  1XHX A;  2X78 A;  1TV6 A;  3T69 A;  3AAQ A;  2VWJ A;  2P9P A;  4N5S A;  3O3G A;  4F3O A;  4QS7 A;  3JS6 A;  4AM7 A;  4A2A A;  5I9E B;  3U4L A;  3RMB A;  4BR5 A;  1SL1 A;  3QO9 A;  1VQ5 N;  3K5O A;  1LV5 A;  2UUA K;  1S6P A;  3SAH A;  4OO1 J;  4FJ5 A;  4WF9 L;  3S9H A;  2OA8 A;  1FXX A;  4B3O A;  3KWI A;  4ISE A;  3O3F A;  2Y1J A;  4JAX A;  1KAZ A;  4O0I A;  5AQZ A;  5BRH A;  2D4W A;  4CJL A;  4E1M A;  3ZSW A;  3DXK A;  3KLI A;  3FLC O;  5EOY A;  1R59 O;  2G8V A;  2QWL A;  4CFA A;  3G25 A;  4K8X A;  2P9I A;  4CZM A;  1IBL K;  3DJC A;  4E89 A;  1HX1 A;  3LAL A;  1QVF M;  1N36 K;  1BIZ A;  2XY5 A;  2E1Y A;  4RCH A;  4BRD A;  4WQ4 C;  3VQP A;  4H5R A;  3PUF A;  3AA4 A;  3PX4 A;  4CGG A;  2A1S A;  3L4Q A;  3CCE N;  4CJR A;  1ATS A;  5KI6 A;  1RTJ A;  1ZBF A;  4B1W B;  1X3N A;  4FZZ A;  3P38 A;  2O4I A;  3ULD A;  2YJF A;  4O8U A;  3ZSX A;  1K73 O;  1I3A A;  5BR9 A;  3HTV A;  2HST A;  4FZY A;  2D0P A;  3CXC M;  3RMD A;  4JK9 A;  4BC2 A;  4JD2 A;  4NLC A;  3OYM A;  5AQK A;  2A3Z A;  4CD3 A;  3PLA A;  1KCF A;  1EX4 A;  4KI6 A;  3I8B A;  3QEI A;  4ELU A;  3AA3 A;  4M7X A;  5D3G A;  3MAQ A;  3FR0 A;  3I0R A;  4H4O A;  2WON A;  3SUQ A;  3V6D A;  4CJK A;  5AQJ A;  2ASP A;  1XNR K;  3TAP A;  2QXL A;  3AA2 A;  3CC2 N;  3EL2 A;  1DT9 A;  4LY7 A;  2NRH A;  3MEC A;  1OH6 A;  4BR9 A;  4BE2 A;  2B6A A;  4K25 A;  2O8C B;  3ZET A;  2YNI A;  5KQD A;  5KQ8 A;  2YHB A;  1KSP A;  2XY6 A;  1HLU A;  5J2Q A;  1BA0 A;  5CYQ A;  2E2O A;  4PA1 A;  4DTJ A;  4IG3 A;  1U49 A;  2RHK A;  4KTW A;  1K9M O;  3P4I A;  1HPZ A;  1SAZ A;  3LWL A;  4Z4I A;  4PQU A;  3WXJ A;  3ENH A;  3W0L A;  1BGX T;  2HMI A;  4CEZ A;  1NGH A;  1S1U A;  3H3O B;  3MCA B;  1JCG A;  4M63 C;  5EVZ A;  4FWM A;  3RMA A;  3UIQ A;  3O9U A;  3ATU A;  5JVG L;  4CGI A;  2GBZ A;  4PKI A;  4DQQ A;  3EYZ A;  4CBX A;  4OKJ A;  2O8F A;  4LSL A;  4X65 K;  1Q7Y O;  1TL3 A;  1GLC G;  4EP5 A;  4NYF A;  3NH1 A;  1ASW A;  4J2A A;  5BN9 A;  3UKR B;  1TUY A;  3SK3 A;  3CCR N;  5AZJ B;  2ZGZ A;  2E2Q A;  5IT9 O;  1A5V A;  2NUB A;  1EXQ A;  5J2N A;  1ZC6 A;  3MDQ A;  3FZM A;  1IG8 A;  1RT7 A;  3T1H K;  5BRE A;  2XY7 A;  5LMN K;  2V7Z A;  2HOE A;  2O8D B;  4U7B A;  4CJP A;  4DR7 K;  1TL1 A;  1W9H A;  3JAM O;  4DFP A;  3KD1 E;  1U48 A;  4DR3 K;  1KVA A;  3RSE A;  4DTN A;  3I33 A;  1GLB G;  4DTU A;  3KLG A;  3MWP A;  3HXM A;  2OYQ A;  3J7Y P;  1NJY A;  3WNE A;  1QS4 A;  3CIP A;  2XO7 A;  4IEI A;  3TAR A;  5KPZ A;  3VEX A;  1ZBH A;  4RW6 A;  4AHU A;  4DU4 A;  4BRM A;  4CED A;  3THW A;  3DLL L;  2YHW A;  1HMV A;  1N33 K;  3HJF A;  3TSP A;  1NJX A;  4RTF D;  1VSK A;  4KH4 A;  1IKV A;  4DV5 K;  4B3M K;  2PAV A;  4JI8 K;  3V1Q A;  1NK5 A;  4DV7 K;  2V7Y A;  2O8C A;  1RIL A;  2QWO A;  4E19 A;  3VF6 A;  5AQH A;  2ZQB A;  1NKB A;  4XEI A;  1NMN A;  5AJ3 K;  3FGU A;  3EZ5 A;  2HHT A;  4CF8 A;  3SUO A;  5E26 A;  1BHL A;  4H03 B;  1RDU A;  4KB1 A;  4LF5 K;  3THY A;  3WXL A;  3UKU B;  4CEA A;  5F1X A;  1X9J A;  4RW7 A;  3ZYY X;  1E4F T;  1XMQ K;  4B8A B;  3SQ4 A;  1RT2 A;  1XNQ K;  3SLC A;  4BRE A;  3T1A A;  4WQ5 A;  4KFB A;  4MO4 A;  3SNN A;  4PWD A;  3A5O C;  2DTU A;  2HF3 A;  4JKC A;  4CEE A;  1NOZ A;  4CGH A;  1JLB A;  4FK0 A;  3U9Z A;  4E7L A;  1IG9 A;  3EY1 A;  4O5F A;  3UKR A;  1G15 A;  4Z4H A;  2WC9 A;  4OJR A;  4BVO A;  3S3M A;  1NGA A;  2HHQ A;  4H0T B;  4CF9 A;  3LZI A;  4C8K A;  3DLK A;  4H5T A;  4KHN A;  1L3U A;  3RRG A;  4F9O A;  5HL7 L;  2O8D A;  1YJ9 N;  1YVU A;  3DOK A;  3VQQ A;  1JLA A;  1RT5 A;  2ZJR L;  5DMR A;  1DLO A;  3J7Z O;  2WBN A;  2JGU A;  2XHB A;  3SUP A;  5MLC Q;  2BGG A;  3SQ1 A;  2V51 B;  3TAM A;  3G0Z A;  3SPZ A;  3V9X A;  3QEX A;  1HNI A;  3D2E B;  3DXM B;  2FBY A;  1R0A A;  4X62 K;  3OYH A;  3ZLJ A;  4LF7 K;  2NRV A;  4IO8 A;  3GL1 A;  1IBM K;  3K5L A;  4FPA A;  3NCI A;  1RDC A;  5DK5 A;  5AQW A;  3TWH A;  2G8F A;  4LF8 K;  3SZ2 A;  4W5R A;  3KKS A;  1VSI A;  1ITG A;  3VQB A;  3NH2 A;  2Z1J A;  3TI0 A;  4B1U B;  1S22 A;  4H0P A;  1U47 A;  4YNQ A;  1SQK A;  4GY2 B;  3K0S A;  4FJN A;  3AV9 A;  3AAR A;  3OYI A;  3CCJ N;  1HKC A;  4XH4 A;  3CCM N;  4CZG A;  2Q31 A;  3OY9 A;  2ZWH A;  2PBD A;  3ZEU A;  3ID6 A;  3VGM A;  4B9M A;  2XY8 A;  3HO1 A;  3J8A A;  3LP3 A;  4FL9 A;  5J2M A;  3CI5 A;  4I7F A;  4CBU A;  5M1Q A;  4DQS A;  2Y1I A;  3OA9 A;  4FXD A;  1K6Y A;  2HNY A;  1NK7 A;  4FJK A;  5HRN A;  1VSL A;  3SMS A;  4IFV A;  1BUP A;  5AQT A;  3NVK A;  3UKU A;  1X9M A;  2I5J A;  3AO3 A;  2GUP A;  1TGO A;  1RBT A;  4KHU A;  5CYM A;  3FZF A;  2FC0 A;  1V4S A;  4JI0 K;  4Z4F A;  4ID1 A;  3K58 A;  4JI4 K;  3MN5 A;  1BG3 A;  1VQP N;  4M3Y A;  4LH5 A;  1YI2 N;  1NBW A;  2P1J A;  2Z1I A;  3N4P A;  1NKC A;  4YFU A;  4WQ5 C;  3QES A;  3PSI A;  4JI7 K;  2HMP A;  4ZHR A;  1RBR A;  3ISN C;  3AY9 A;  4CF1 A;  1RNH A;  3QBW A;  4DV6 K;  1BCM A;  3WXI A;  4CJ5 A;  3T3F A;  4XIU A;  2D0C A;  3KVG A;  3TAE A;  1WN7 A;  4F2R A;  1OVY A;  5CZ1 A;  3SUN A;  4ILH A;  4OPA A;  3CFP A;  5AQY A;  3K9K A;  5C42 A;  4CHO A;  1W7A A;  4CEC A;  2P9S B;  4DKW A;  1GLJ O;  4PL8 A;  3S3N A;  1UA1 A;  4FYD A;  1BU6 O;  4HWI A;  3KTQ A;  3WXM B;  3CC7 N;  3VTH A;  3RVC A;  1OKJ A;  3MWT A;  1JLQ A;  4O4G A;  4XH1 A;  2YCH A;  3DXM A;  3KZB A;  3ZT3 A;  3PIP L;  1YJN N;  1QVG M;  4KBO A;  3K59 A;  3KLH A;  4AHS A;  2AJQ A;  3BGR A;  5GAG P;  3EE9 A;  1L5U A;  1RTI A;  2NRR A;  4CIE A;  4X66 K;  3NGI A;  3PV8 A;  3DXK B;  5EY4 A;  3CG7 A;  4CHN A;  1EQY A;  4GVM A;  5KPT A;  3G71 N;  4YOT A;  3E01 A;  3V1O A;  3EKU A;  1BIU A;  1Z6R A;  4BR2 A;  3KK3 A;  3AVI A;  2P9I B;  3HP6 A;  3TTC A;  2YX6 A;  3O9R A;  4FLU A;  4DLG A;  1KLM A;  3FZK A;  1HNX K;  1VK0 A;  2OPS A;  2QKB A;  1QZ6 A;  1GLA G;  3SJH A;  3TTD A;  1BQN A;  2YNF A;  4FVM A;  3EKS A;  5C24 A;  4WFN L;  4RG8 A;  1NU0 A;  4IJA A;  1HNZ K;  3P5J A;  4JKH A;  3C0B A;  4CZL A;  3AO2 A;  1YT3 A;  4JI6 K;  4DMN A;  4NXM K;  2UXB K;  1DTQ A;  2Z1H A;  4HUF A;  1J5E K;  5LMU K;  3TAQ A;  4CF2 A;  1HQE A;  4BG9 A;  4L8R B;  5H1S Q;  3CFR A;  4E7I A;  3VA3 A;  3LM9 A;  5AQM A;  1X9S A;  4YOR A;  2FBX A;  3AVF A;  4B9T A;  5BPN A;  4CZK A;  4OPJ A;  2ZE2 A;  4GMJ B;  1VAZ A;  1IJJ A;  1FKO A;  1TKT A;  1TYQ B;  4JLH A;  5B8H A;  1ZBL A;  2BAN A;  4M3R A;  3MEE A;  1D5A A;  1SV5 A;  1WSF A;  4FLX A;  3QNN A;  4OLB A;  1Q81 O;  4FJI A;  1S1V A;  3OW2 M;  1XQS C;  5ELZ A;  2P9S A;  3DRR A;  1RTH A;  3V9S A;  4CJF A;  1VSH A;  5HBM A;  3U3Y A;  4DF8 A;  1IBK K;  4BC5 A;  3IG1 A;  1KTQ A;  3OYL A;  5T7B A;  5AQQ A;  1RDW X;  4J2E A;  1C1A A;  5AQO A;  2UXC K;  1WSE A;  4AHT A;  2YNG A;  4E1N A;  2F9T A;  2QTD A;  1NGI A;  3V81 A;  1L3S A;  3LP0 A;  2CH5 A;  4JKF A;  4CF0 A;  1RCH A;  4KTQ A;  4DQ8 A;  1M90 O;  1EET A;  2IVP A;  2FSN A;  1YF5 L;  2F7T A;  4J8F A;  4CD1 A;  3VES A;  1NGB A;  1O13 A;  5HOO A;  1W0H A;  3OBY A;  3L3V A;  4IG0 A;  3H46 O;  3NF7 A;  4F4K A;  3M3Z A;  4YHH K;  5I42 A;  1GOB A;  4M41 A;  3EZW A;  3MED A;  2NLX A;  4FJL A;  3AGK A;  1RBV A;  3H45 C;  5C2D A;  4Z4C A;  1RDA A;  3WEE B;  3A5N C;  4A2B A;  5AQX A;  1YUW A;  3CQY A;  3O6W A;  1KLN A;  3AO5 A;  2UXD K;  5M1N A;  2O8F B;  3AVC A;  2RE2 A;  3L6Q A;  3SBG A;  3O4N A;  2I7N A;  2BDP A;  4H0Y B;  1GLL O;  1SKR A;  2CH6 A;  2FF3 B;  5KGW A;  4CEQ A;  4CZI A;  4DSI A;  4CGF A;  1J5O A;  3M8S A;  2YKN A;  4CFB A;  3M8Q A;  2FLO A;  1NK4 A;  4F8R A;  1QQN A;  2A40 A;  3F5T A;  2OPR A;  4DSE A;  2Q1N A;  1G99 A;  4G1Q A;  5HLF A;  2HHU A;  3GBT A;  5BPL A;  3L4I A;  4MLH A;  1JJ2 M;  3ZT4 A;  2G8U A;  3L0Q A;  4KV8 A;  1U45 A;  1W2B M;  3NFA A;  5AQI A;  4W5Q A;  4YDU A;  3GG4 A;  3ZSV A;  3PY8 A;  3DI6 A;  4NCA A;  1VQ9 N;  1XHZ A;  4DSF A;  3JSM A;  2F96 A;  1D9D A;  3RSE B;  4CZF A;  2KZM A;  3CC4 N;  3BZK A;  3BY5 A;  1JLE A;  2OPP A;  4CJS A;  3V1R A;  4BRO A;  3MN7 A;  4IDK A;  1GLE G;  2Z1G A;  3CHW A;  4FLY A;  5C10 A;  1RT6 A;  5F2R A;  3THW B;  1E3M A;  3AVB A;  3U3G A;  5CHI A;  3B6O A;  1TYQ A;  1N32 K;  3K2P A;  4CHZ A;  5AR0 A;  4EHT A;  4IOC L;  3I0S A;  2YHY A;  2E6M A;  1C1B A;  3OYE A;  3WQT A;  4OKE A;  4FJG A;  2RN2 A;  3ATV A;  3PSF A;  1VHX A;  3MXJ A;  1QHT A;  4KHY A;  4CJW A;  3SBT A;  4IOA L;  1C1C A;  4NCG A;  1NGC A;  2NRX A;  4C1N K;  3DLB A;  4FO0 A;  3HK2 A;  4QAG A;  4DHY A;  4Q5V A;  5BN8 A;  4RW4 A;  4KPY A;  2ITG A;  1NG9 A;  2AP1 A;  1L3V A;  2KZZ A;  2IAJ A;  3BF1 A;  3O4W A;  5LJW A;  3HOS A;  3L8B A;  3THY B;  4LF4 K;  3AGR A;  2E20 A;  3D7E O;  3QEV A;  4C23 A;  1RDB A;  1YIJ N;  1XWL A;  4RWT A;  4IJN A;  3QER A;  3HVR A;  3SJJ A;  4JI3 K;  4Q0B A;  3ASM A;  3Q7B A;  4H0X B;  1FKP A;  1JXB A;  5HRR A;  1NGJ A;  1MA9 B;  4KKO A;  2VG5 A;  4CK1 A;  3WEE A;  1RBS A;  1A5X A;  3TU5 A;  4B3T K;  4J2D A;  1ATN A;  4NLB A;  3FZH A;  1QE1 A;  3S41 A;  1VSJ A;  5A2Q O;  1QSL A;  2YJE A;  4CIG A;  2VQF K;  5M1O A;  2P9N B;  3CER A;  1VSF A;  3PIO L;  4BGA A;  3VEV A;  3IKM A;  1KRP A;  2QWR A;  1A5W A;  4CHQ A;  3OYA A;  3HT3 A;  4TSX A;  3HSC A;  3GOI A;  4M42 A;  4CBW A;  3GE1 A;  4DR1 K;  2OCE A;  3ALY A;  4ZTJ A;  4BRK A;  2P9K B;  2A6A A;  1FJG K;  4YDU C;  4I9L A;  1HNW K;  4AIL C;  4U67 L;  5AQG A;  3CD6 N;  4E0D A;  1YIT N;  2BTF A;  4B9Q A;  1LWF A;  1NGG A;  4UY8 O;  3NH0 A;  1L3T A;  2IDO A;  1T6D A;  2GEL A;  3AVN A;  3C94 A;  3RRH A;  5C2F A;  1WSJ A;  5BRF A;  4OX9 K;  2ATQ A;  1SUQ A;  3LDP A;  4DR6 K;  3R6M A;  4FOE A;  5JS2 A;  4ZTF A;  3JXU A;  1LAW A;  4Y1C A;  4DG1 A;  1LW0 A;  4B1V A;  4EIA A;  3OYJ A;  3E1Y A;  1X9W A;  1JCF A;  4OKK A;  4B3S K;  3I55 N;  4AHR A;  4Y1D A;  4ILJ A;  3OS0 A;  3HST B;  4B1Y B;  1OVQ A;  4JKB A;  1J53 A;  2E2N A;  4I9Q A;  4M3W A;  2GWK A;  4I6M B;  1S1X A;  3ZEU B;  2HND A;  1MWM A;  4MDA A;  4JKE A;  3KD5 E;  4CJQ A;  1CXU A;  1YJW N;  1QQM A;  4BDZ A;  4B9V A;  1VQK N;  3LP2 A;  3VER A;  2QW9 A;  2HNZ A;  1C0G A;  3ZT1 A;  1RBU A;  3DAW A;  3K57 A;  3KLE A;  5J2P A;  4QOZ B;  4BRC A;  1NK9 A;  3VOV A;  4G9Z A;  5HRP A;  4IFE A;  1JL2 A;  1K8K A;  3QIO A;  3D2F A;  4Y0W A;  5FPE A;  3CJ9 A;  3S3O A;  2ZD1 A;  2ZF5 O;  3WQU A;  3IDH A;  4CVN E;  4DV1 K;  5M1K A;  4WFA L;  2UUC K;  4FSV A;  4BR4 A;  3IRX A;  4JEP A;  1QTM A;  2ASM A;  1IO2 A;  2EX3 A;  1C0T A;  3WT0 A;  3BF3 A;  4BQZ A;  1KVB A;  3CPE A;  1TUU A;  4E7H A;  2DFH A;  1KFS A;  5EU7 A;  1UOC A;  1S9E A;  2IVN A;  3HI0 A;  3QLH A;  3SAF A;  2P9N A;  1IH7 A;  2KFN A;  4PHT X;  4JN4 A;  4BDP A;  3FFI A;  5KTQ A;  3HZ6 A;  1O1W A;  4BGB A;  3ZT2 A;  4YOW A;  2QXF A;  3A0I X;  2G8I A;  4FWO A;  4NB4 A;  3HOT A;  2PYJ A;  2CGJ A;  4K8Z A;  4BRF A;  4FJJ A;  3NF9 A;  2P9K A;  1MU2 A;  4KH6 A;  4KO0 A;  4DTP A;  2GEM A;  1NM1 A;  3P83 D;  2VGN A;  3CYM A;  3JYT A;  1LW2 A;  4CFC A;  3MCP A;  3MMV A;  4K43 A;  4CEO A;  3SV3 A;  3F9K A;  3C95 A;  2UU9 K;  4PY5 A;  4FWK A;  3CJA A;  3QDK A;  2ETJ A;  3VQA A;  4DQP A;  3D6R A;  2ITM A;  3IUC A;  1HNV A;  5LJV A;  2HHS A;  5K14 A;  2DY4 A;  4C8O A;  4DTO A;  4A62 A;  2UUB K;  4FK2 A;  4DS4 A;  2OZM A;  4ISG A;  3IS9 A;  3MN9 A;  3KK2 A;  1JCE A;  1BCO A;  4A5A A;  5KRT A;  3TAG A;  2IC3 A;  5FPD A;  3BEX A;  3K5M A;  3L3U A;  5AQL A;  3R9P A;  2HBK A;  2KTQ A;  1U04 A;  3T1Y K;  4FJX A;  4I6M A;  3SI6 A;  3AA5 X;  4DUY K;  1TKZ A;  4CZJ A;  3L2W A;  3NGZ A;  3AVM A;  3E9L A;  4JHD B;  1EWQ A;  2CGK A;  2KFZ A;  3A2F A;  3CCL N;  4LF9 K;  3CQ8 A;  1T03 A;  4C8N A;  3VQ8 A;  1WSH A;  3P39 A;  3M8R A;  4MDB A;  2E1Z A;  3ITH A;  1DEJ A;  5JS1 A;  5FRN A;  4DU3 A;  1TK5 A;  4CES A;  4DV3 K;  4DTS A;  3PX6 A;  1CZA N;  3LAM A;  1BDG A;  5GIO A;  2WTU A;  4R5P A;  4L3Q A;  4B9U A;  1RT3 A;  2GTD A;  4Z0U A;  4HHT A;  3C6H A;  2X6N A;  2O4G A;  5EXW A;  3NDK A;  4JKG A;  4BRH A;  3QET A;  3I8D A;  1DTT A;  3OVN A;  1ESV A;  2BE2 A;  3O8M A;  4FJ8 A;  1Q82 O;  2RKI A;  2JWK A;  2V52 B;  3J7A P;  4LC9 B;  4IFY A;  1LCU A;  1JLC A;  3I56 N;  2ZJQ L;  1JL1 A;  3BDP A;  3TPQ A;  3O3H A;  3B6P A;  1VSE A;  2O8E B;  3ENB A;  4FZX C;  4HVJ A;  2FSK A;  2EWS A;  3D0P A;  3OJU A;  5GAH P;  1WUA A;  3EE8 A;  1T8E A;  4K42 A;  2YI1 A;  4DR2 K;  3QIC A;  3WNH A;  3LL3 A;  3E9P A;  3QML A;  4BVP A;  4CJV A;  2G8K A;  3QB0 A;  1KVC A;  2VYP A;  4IO9 L;  1Z26 A;  1WBD A;  4HTL A;  1BI4 B;  2VCP A;  4M3T A;  2P5O A;  4CK2 A;  4DTX A;  3U6F A;  3HPO A;  3F9M A;  1J6Z A;  2OZS A;  4HUG A;  3ZX2 A;  4DTM A;  4FWQ A;  1NWK A;  1HKG A;  4CZH A;  5FRO A;  3E66 A;  3OYD A;  2PY5 A;  3L2R A;  4CHY A;  4NXN K;  4FJ7 A;  1QSY A;  1LWE A;  3TR8 A;  5GIN A;  2A1R A;  3TSQ A;  3HM9 A;  3CCV N;  4H8K A;  4DV2 K;  1D8Y A;  3R3L A;  4M3X A;  1FK9 A;  4BRG A;  4CEF A;  2FBT A;  5KRS A;  1ATR A;  3N4Q A;  4JYA K;  2W40 A;  4FLV A;  2D5R A;  4H5N A;  2P9L A;  3SQ0 A;  3DRP A;  4M3U A;  4N56 A;  4Z4G A;  3CCU N;  4JHD A;  4O55 A;  1VRT A;  4AF1 A;  4FJH A;  2QWQ A;  3HPH A;  5AFU H;  1YTA A;  2HBM A;  3KKR A;  1X1P A;  2BUP A;  1KC8 O;  1ASV A;  2KKZ A;  1VQO N;  2X74 A;  4LH4 A;  5JVH L;  3KHY A;  5JLF A;  2QWM A;  4EHU A;  5AQR A;  3FZL A;  4WQ4 A;  1TK0 A;  4M3Z A;  2HHX A;  2E5L K;  4BRQ A;  3R1X A;  5AFU A;  4ISF A;  4A61 A;  3MEG A;  3O1W A;  4GKJ K;  3O9T A;  4DR5 K;  3UE5 A;  2HW3 A;  3LPU A;  1VQN N;  1C0U A;  4JKA A;  1WOQ A;  5TKY A;  5GIP A;  2HB5 A;  1S3X A;  3O5B A;  2DFF A;  4JS4 A;  3AVA A;  1EWR A;  1S72 N;  1ZBS A;  4BG8 A;  4DTR A;  4DR4 K;  1HQU A;  4LSN A;  4QS9 A;  2XRI A;  2B4J A;  4FW2 A;  3VQ4 A;  3VQD A;  3RTV A;  2OTJ N;  2UYT A;  3ID8 A;  3OYF A;  1SL0 A;  1MWK A;  2O8E A;  3VQ5 A;  4JRQ A;  3K9J A;  1M1K O;  2HF4 A;  3SPY A;  4WCE L;  2QM1 A;  3H6E A;  3OYG A;  4DV0 K;  4LFA K;  1WAF A;  3CCS N;  2FF6 A;  5LL6 Z;  1KD1 O;  3SAG A;  1S5J A;  3EEQ A;  2VQE K;  3OTO K;  3QIN A;  4GV9 A;  4BY9 C;  5ADX H;  3AAP A;  1BI4 A;  1RDD A;  4IXC A;  4BC3 A;  5EX5 A;  4CGJ A;  1CZ9 A;  1N34 K;  2X6S A;  4O5B A;  4XH5 A;  3VEY A;  3B8A X;  2W41 A;  3LWM A;  4CI6 A;  3V4I A;  3LDL A;  1D9F A;  4HUE A;  3DWL A;  3ENO A;  4H0O A;  2YV0 X;  3SQ2 A;  1U6Z A;  2NNW A;  4O0J A;  1CLQ A;  5ADX A;  2NRT A;  5C15 A;  2F9W A;  1BIS A;  3C65 A;  1XUP O;  1W97 L;  2KLA A;  4B08 A;  5I3U A;  3DOL A;  4QS8 A;  2JLE A;  3AVK A;  4KHQ A;  3F73 A;  3MX5 A;  3OHR A;  4CJ4 A;  3VEW A;  1WBB A;  5FPM A;  1VQ4 N;  4KRF A;  2NRW A;  5C0Y A;  2GV9 A;  1BOT O;  3P1G A;  1T05 A;  4H5V A;  1F21 A;  4JK7 A;  3QNO A;  2HHH K;  3HL8 A;  4FPB A;  3DM2 A;  4I2Q A;  3DYA A;  3MK6 A;  4LFB K;  2E88 A;  1S9G A;  3KJV A;  4DS5 A;  3O80 A;  1D4X A;  4CHP A;  1B9F A;  1VQ7 N;  5C12 A;  3TAB A;  1NKE A;  4RW8 A;  2KQ2 A;  1Q86 O;  5HP1 A;  3CME N;  4BRN A;  1P8Z A;  2R7Y A;  4DFK A;  2IIR A;  4R79 A;  2W42 A;  2ASO A;  2P51 A;  2QKK A;  4DU1 A;  5GAE P;  4NO7 A;  1SKS A;  3KIO A;  3O9Q A;  2EHG A;  3EN9 A;  1ZBU A;  4CFD A;  4FWP A;  1VQ8 N;  2I7P A;  5CY4 A;  5GAD P;  4CGD A;  4KHP K;  3VEN A;  2NRZ A;  3QIP A;  4Z4E A;  1HUX A;  4Z94 A;  2HHW A;  1EO1 A;  3THV A;  1RGI A;  2PYL A;  3IFR A;  3P31 A;  3VEO A;  1TAQ A;  1NK8 A;  1IKX A;  1I94 K;  5E84 A;  4WYB A;  4W5T A;  2ZJP L;  1WSI A;  2QI2 A;  1ILY A;  3KK7 A;  4BRP A;  3BUZ B;  2P5G A;  3WUH A;  1HKB A;  1VQM N;  3F2K A;  3D45 A;  1HRH A;  4IDH A;  2F8S A;  1T6C A;  5JMV A;  3VEZ A;  4DFJ A;  3ZSY A;  4GNI A;  3LAK A;  4GW6 A;  3CJB A;  1OH7 A;  2NZT A;  1NLV A;  4EFH A;  2VG6 A;  3UB5 A;  4B8C A;  2IVO A;  3VPZ A;  1SKW A;  1S1T A;  1VQ6 N;  3QEW A;  1XC3 A;  4NYN A;  3TSU A;  3SCX A;  4O8K A;  4DQI A;  2GUI A;  1QHA A;  5E41 A;  1NK6 A;  2AA4 A;  1IKY A;  4AM6 A;  3VF2 A;  4OPK A;  3U8X A;  1WNS A;  4CW7 B;  3K5N A;  2ZM6 K;  4CJ3 A;  3ULE B;  3FFK B;  1B92 A;  2A5X A;  3CJC A;  5AQS A;  3V9W A;  2E8A A;  1K8K B;  2QWN A;  3C7N A;  4BDY A;  3D2F B;  4N41 A;  1DGK N;  3VQC A;  3VN5 A;  4GVE A;  3VQ7 A;  2KHO A;  1LAV A;  4KHS A;  4W5N A;  4DF4 A;  5FRM A;  4CJT A;  4IWV A;  3RMC A;  4CIF A;  4YOX A;  1XI1 A;  2HBL A;  2DFE A;  1HYZ A;  4LF6 K;  4V19 S;  4AH9 A;  4ID5 A;  4C8L A;  3CM5 A;  1DKG D;  4BWJ A;  4H5W A;  4BE0 A;  1KAY A;  2J4R A;  4PKG A;  4KB0 A;  4KAZ A;  4OGE A;  2O8B B;  3CFO A;  4CJU A;  1VSM A;  4IOX A;  1N8R O;  2Q0U A;  2A42 A;  3HVT A;  2E4L A;  4FWL A;  1HYV A;  3QEP A;  3VET A;  4A59 A;  2QWP A;  4DSJ A;  3VGK A;  4CJ7 A;  2YHA A;  1Z05 A;  3IMX A;  1LWC A;  3W3D A;  3AVG A;  4YY3 K;  4FLW A;  3AO1 A;  2WUS A;  3EO3 A;  3OBW A;  3PO4 A;  4BAC A;  4DFM A;  3LM2 A;  4YOY A;  4MO5 A;  1IV0 A;  1Q9Y A;  3HPG A;  1RT4 A;  4EP4 A;  1N6Q A;  1XC9 A;  3WNG A;  2IS3 A;  5SZT A;  3H08 A;  2OTL N;  3VF4 A;  1WLJ A;  3HYF A;  2YNH A;  1NOY A;  2LSN A;  5FPN A;  1Q8I A;  2G8H A;  1U2V B;  4DQR A;  2CGL A;  2HHV A;  2F4V K;  4JS5 A;  3O1B A;  4YOV A;  2D0A A;  3PX0 A;  5LY3 A;  3L2U A;  4JK8 A;  1CZB A;  1YTU A;  5F0X A;  3M5R A;  5M1F A;  3A5M C;  5AQF A;  3LDN A;  3OYB A;  3OS2 A;  5IWA K;  5BPM A;  4E3S A;  1ZBI A;  2D0B A;  1VSD A;  3MN6 A;  4KH5 A;  4GV6 A;  1CXQ A;  2FXU A;  1HJR A;  3VQ6 A;  1HPM A;  2FSJ A;  1YXQ A;  3ZSO A;  5C25 A;  4CCH A;  3C6T A;  2VG7 A;  5JIC A;  1YAG A;  3QFP A;  3DLR A;  3H1V X;  1SL2 A;  1JLG A;  4JNE A;  3ULE A;  1ZYQ A;  3OYN A;  3L2Q A;  1KXP A;  4GV3 A;  4F3T A;  1I39 A;  1KQS M;  2WOM A;  4JKG B;  3BZC A;  3M1F A;  3G4S N;  1SS6 A;  2H3G X;  3NE6 A;  1X3M A;  2WFB A;  3LDQ A;  4PUO A;  4B3R K;  3BP8 A;  2QEX N;  4KI4 A;  3VQE A;  3CMA N;  1NGD A;  4KHW A;  1TKD A;  3ZSZ A;  3AO4 A;  2E2P A;  1ZXO A;  3HP9 A;  3O9S A;  3WNF A;  4WE1 A;  3H3N O;  5FDL A;  3OJS A;  2O8B A;  2A41 A;  1NK0 A;  1J9A A;  3VGL A;  4C8M A;  3VMF B;  4K41 A;  1C0F A;  1P90 A;  5HRO A;  5DM7 L;  1N5Y A;  5CR4 A;  2RF2 A;  1Y97 A;  3OYC A;  2D0O A;  4EZ6 A;  4FJM A;  4JI2 K;  1Q9X A;  4O44 A;  4B1Z A;  1FW6 A;  5AZI B;  1T44 A;  4IBN A;  3VTI A;  4BR7 A;  4CZE A;  3LPT A;  3ZT0 A;  4FWN A;  1KFD A;  4B9N A;  4BC4 A;  4LD0 A;  4W5O A;  3LAN A;  5AZJ A;  1BO5 O;  4JV5 K;  4FW1 A;  2Q0R A;  1YVN A;  3VQ9 A;  3WXK A;  3MXM A;  1OH8 A;  1JKH A;  4FLT A;  1MDU B;  4FM2 A;  2IGI A;  3NAE A;  2W6L A;  3DLH A;  1NJW A;  4ILG B;  3TAF A;  4AHV A;  1T3V A;  1U2V A;  5BR8 K;  3ZX0 A;  2OAN A;  1NNE A;  5M1P A;  2VWK A;  1IKW A;  3NBP A;  5KPR A;  1QSS A;  4MLE A;  4EAH D; 
#chains in the Genus database with same CATH homology
 3SQ0 A;  2FBV A;  4CJP A;  4G1Q A;  5HLF A;  1TL1 A;  3DRP A;  4M3U A;  4N56 A;  1W9H A;  4IKF A;  2HHU A;  4Z4G A;  4DFP A;  4QCL A;  3MXI A;  3KD1 E;  1U48 A;  3ZT4 A;  2G8U A;  1KVA A;  4KV8 A;  3AVJ A;  4DTN A;  1U45 A;  4O55 A;  1VRT A;  4DTU A;  3NFA A;  3KLG A;  4FJH A;  3HPH A;  3HXM A;  1YTA A;  2OYQ A;  4AHC A;  4W5Q A;  1S6Q A;  3KKR A;  3ZSV A;  4H4M A;  3PY8 A;  3DI6 A;  1X1P A;  4NCA A;  1ASV A;  2X74 A;  4LH4 A;  3WNE A;  4DSF A;  1QS4 A;  2XO7 A;  1XHZ A;  3JSM A;  3TAR A;  1NJY A;  2F96 A;  1D9D A;  4BE1 A;  2G8W A;  2KZM A;  1ZBH A;  4CJE A;  4RW6 A;  4AHU A;  4DU4 A;  4CED A;  1JLE A;  1TK0 A;  3KK1 A;  2OPP A;  4M3Z A;  2HHX A;  4CJS A;  3V1R A;  1HMV A;  4IDK A;  2Z1G A;  4F2R A;  4FLY A;  3HJF A;  1TVR A;  1REV A;  1NJX A;  3MEG A;  1VSK A;  3DRS A;  1RT6 A;  4J2B A;  1UA0 A;  1T7P A;  2HW3 A;  3LPU A;  1C0U A;  3AVB A;  3U3G A;  1IKV A;  4JRP A;  1WSG A;  2HB5 A;  3RWU A;  3B6O A;  3V1Q A;  1GOC A;  2DFF A;  4JS4 A;  3AVA A;  1NK5 A;  3K2P A;  4CHZ A;  4DTR A;  1HQU A;  1RIL A;  4LSN A;  3I0S A;  3LP1 A;  4E19 A;  2XRI A;  2B4J A;  4RW9 A;  2E6M A;  4FW2 A;  1C1B A;  3VQ4 A;  3OYE A;  3SV4 A;  4ELT A;  2ZQB A;  4OKE A;  2RN2 A;  4FJG A;  4CK3 A;  1NKB A;  3VQD A;  3MXJ A;  3RTV A;  1QHT A;  4KHY A;  3OYF A;  4CJW A;  1SL0 A;  3EZ5 A;  2F8T A;  3VQ5 A;  4JRQ A;  2HHT A;  1C1C A;  4NCG A;  4CF8 A;  3SUO A;  3SPY A;  1BHL A;  4E7K A;  3DLB A;  3HK2 A;  3OYG A;  3V9U A;  3C6U A;  1UWB A;  4QAG A;  4Q5V A;  4RW4 A;  4KB1 A;  4KPY A;  3M8P A;  4CEB A;  2ITG A;  1QQC A;  1WAF A;  3T19 A;  4CEA A;  4RW7 A;  1L3V A;  2KZZ A;  2IAJ A;  4NCB A;  1TKX A;  4ICL A;  1S5J A;  4B8A B;  3SQ4 A;  3ZSR A;  1RT2 A;  4MFB A;  3NHG A;  3QIN A;  3L8B A;  1BI4 A;  1RDD A;  3T1A A;  4N76 A;  4KFB A;  4CGJ A;  3SNN A;  2IOC A;  4PWD A;  1CZ9 A;  3QEV A;  2X6S A;  2Q3S A;  4O5B A;  1RDB A;  4OLA A;  2DTU A;  1XWL A;  3LWM A;  3QER A;  2HVH A;  3HVR A;  3V4I A;  1RT1 A;  3SJJ A;  1D9F A;  4FM1 A;  4HUE A;  4Q0B A;  2YKM A;  4CEE A;  1NOZ A;  3ASM A;  2YV0 X;  4CGH A;  1BL3 A;  1JLB A;  3SQ2 A;  4O0J A;  4FK0 A;  1CLQ A;  1FKP A;  1JXB A;  3G10 A;  5HRR A;  4E7L A;  1BIS A;  1IG9 A;  3EY1 A;  4KKO A;  2VG5 A;  4B08 A;  4CK1 A;  5I3U A;  4UQG A;  3NGY A;  1RBS A;  1G15 A;  1A5X A;  3DOL A;  4Z4H A;  4OJR A;  2JLE A;  3AVK A;  4KHQ A;  3S3M A;  4J2D A;  3F73 A;  2HHQ A;  3NF6 A;  4CJ4 A;  4FCY A;  4CF9 A;  1QE1 A;  3PO5 A;  1VSJ A;  3LZI A;  4KRF A;  1WAJ A;  4C8K A;  2GV9 A;  3DLK A;  3P1G A;  1QSL A;  1T05 A;  4KHN A;  4FK4 A;  4OGC A;  1F21 A;  3QNO A;  4FLZ A;  4CIG A;  1L3U A;  4OVL A;  3L2V A;  3RRG A;  4I2P A;  3HL8 A;  4ELV A;  3DM2 A;  4I2Q A;  1VSF A;  4HCC A;  1EKE A;  3CM6 A;  3DYA A;  3ZCM A;  1S9G A;  3KJV A;  2E6L A;  3AVH A;  4DS5 A;  1KRP A;  1YVU A;  3DOK A;  3VQQ A;  4CHP A;  1B9F A;  1A5W A;  1JLA A;  1RT5 A;  4CHQ A;  3OYA A;  5DMR A;  3HT3 A;  3TAB A;  1NKE A;  1DLO A;  4TSX A;  4RW8 A;  2KQ2 A;  4N47 A;  4M42 A;  2JGU A;  2XHB A;  3SUP A;  1JLF A;  4DSE A;  5HP1 A;  3ALY A;  2BGG A;  4ZTJ A;  3SQ1 A;  3TAM A;  1J54 A;  2R7Y A;  4DFK A;  3G0Z A;  3LZJ A;  3V9X A;  3QEX A;  3SUQ A;  3SPZ A;  1HNI A;  1R0A A;  2FBY A;  3KLF A;  3SYZ A;  3RR7 A;  5HRS A;  3OS1 A;  3OYH A;  2W42 A;  1JXE A;  4KTZ A;  2P51 A;  1NJZ A;  2QKK A;  4FJ9 A;  2KW4 A;  4I9L A;  4AIL C;  3K5L A;  4DU1 A;  2G8F A;  3NCI A;  1RDC A;  5DK5 A;  3TWH A;  4E0D A;  1UAX A;  1LWF A;  3SZ2 A;  1ASU A;  3KIO A;  4CE9 A;  1SKS A;  4W5R A;  3KKS A;  1VSI A;  1BQM A;  2EHG A;  3NH0 A;  1ITG A;  1ZBU A;  3VQB A;  4CFD A;  3NH2 A;  3DLG A;  2Z1J A;  1L3T A;  2IDO A;  3AVN A;  3C94 A;  5CY4 A;  3RRH A;  3TI0 A;  1RTD A;  4CGD A;  1WSJ A;  4FM0 A;  1U47 A;  2ATQ A;  1SUQ A;  4YNQ A;  4DLE A;  3QIP A;  4Z4E A;  5JS2 A;  4ZTF A;  1EP4 A;  4HTU A;  4FJN A;  2HHW A;  3DLE A;  1LAW A;  3THV A;  3RR8 A;  4Y1C A;  2QK9 A;  2PYL A;  4DG1 A;  1HYS A;  1LW0 A;  3AV9 A;  1TAU A;  4M45 A;  3OYI A;  1TAQ A;  3OYJ A;  1IKX A;  1NK8 A;  1X9W A;  4OKK A;  3OY9 A;  4W5T A;  4AHR A;  1WSI A;  4Y1D A;  4B9M A;  2XY8 A;  4DSK A;  2P5G A;  3HO1 A;  3LP3 A;  3OS0 A;  3D45 A;  3HST B;  1HRH A;  4B9L A;  5J2M A;  2F8S A;  1J53 A;  1GOA A;  4HCB A;  4DFJ A;  4I7F A;  4I9Q A;  3V9Z A;  4DQS A;  3ZSY A;  3OYK A;  4M3W A;  1S1X A;  3LAK A;  4GW6 A;  2Y1I A;  4FXD A;  4B9S A;  1K6Y A;  2HNY A;  1NK7 A;  4FJK A;  2HVI A;  5HRN A;  1VSL A;  4DWI A;  2HND A;  2VG6 A;  4IFV A;  4B8C A;  4MQ3 A;  2PZS A;  3KD5 E;  4CJQ A;  4F2S A;  1CXU A;  1Z25 A;  1X9M A;  4BDZ A;  4B9V A;  3LP2 A;  2I5J A;  3AO3 A;  1SKW A;  1TGO A;  1RBT A;  4KHU A;  1S1T A;  2HNZ A;  5CYM A;  3ZT1 A;  4NYN A;  3QEW A;  2FC0 A;  1RBU A;  3K57 A;  2GUI A;  3LDS A;  3SCX A;  3IAY A;  3KLE A;  5J2P A;  4DQI A;  4Z4F A;  4QOZ B;  4ID1 A;  5E41 A;  3K58 A;  3TAN A;  1U4B A;  1NK6 A;  1NK9 A;  1IKY A;  3VA0 A;  1TK8 A;  5HRP A;  5J1E A;  3AVL A;  3DMJ A;  4M3Y A;  1C0M A;  1JL2 A;  4LH5 A;  2P1J A;  2Z1I A;  3QIO A;  4OPK A;  2RPI A;  1NKC A;  1WNS A;  4YFU A;  3S3O A;  3O4Q A;  4BWM A;  2ZD1 A;  3K5N A;  3QES A;  5KGX A;  1C6V A;  4E7J A;  4CJ3 A;  4ZHR A;  1RBR A;  3ISN C;  1B92 A;  2B5J A;  4CF1 A;  1RNH A;  3V9W A;  1BCM A;  4BDY A;  4N41 A;  4CER A;  3ZSQ A;  4CJ5 A;  3VQC A;  3T3F A;  1VRU A;  3VN5 A;  5SWM A;  4XIU A;  1B9D A;  3IRX A;  4KRE A;  2D0C A;  3TAE A;  1WN7 A;  4DSL A;  5CZ1 A;  3VQ7 A;  1QTM A;  3SUN A;  1IO2 A;  1LAV A;  2EX3 A;  5CZ2 A;  1C0T A;  4EZ9 A;  2OPQ A;  4KHS A;  4W5N A;  3NF8 A;  1KVB A;  4DF4 A;  5FRM A;  1S1W A;  4CJT A;  1XHX A;  4E7H A;  2X78 A;  4CIF A;  3CFP A;  1TV6 A;  2DFH A;  3RMC A;  5C42 A;  5EU7 A;  4CHO A;  1UOC A;  1XI1 A;  1KFS A;  1S9E A;  1HYZ A;  2DFE A;  4CEC A;  2VWJ A;  3QLH A;  4AH9 A;  4N5S A;  3O3G A;  4F3O A;  4ID5 A;  4C8L A;  1IH7 A;  2KFN A;  4BDP A;  3CM5 A;  3RMB A;  3FFI A;  4BWJ A;  5KTQ A;  1SL1 A;  1O1W A;  3QO9 A;  4BE0 A;  3K5O A;  1LV5 A;  3ZT2 A;  3S3N A;  4KB0 A;  4KAZ A;  1S6P A;  4OGE A;  1UA1 A;  4FJ5 A;  2QXF A;  3S9H A;  3CFO A;  4CJU A;  1FXX A;  2OA8 A;  3KTQ A;  1VSM A;  2G8I A;  4B3O A;  2PYJ A;  3HVT A;  2E4L A;  1HYV A;  3QEP A;  4K8Z A;  4KI6 A;  3O3F A;  2Y1J A;  1JLQ A;  4O0I A;  4O4G A;  4FJJ A;  3NF9 A;  1MU2 A;  3ZT3 A;  4KO0 A;  4DSJ A;  4DTP A;  2YHA A;  3P83 D;  3KLH A;  3K59 A;  3CYM A;  1LWC A;  1LW2 A;  4CJL A;  3JYT A;  4AHS A;  4CFC A;  4CEO A;  4E1M A;  3ZSW A;  3BGR A;  3AVG A;  3SV3 A;  2AJQ A;  3F9K A;  3C95 A;  3KLI A;  4FLW A;  3AO1 A;  1L5U A;  4PY5 A;  2G8V A;  1RTI A;  3PO4 A;  4CIE A;  3NGI A;  3PV8 A;  4BAC A;  4CFA A;  2ETJ A;  4K8X A;  4DFM A;  3VQA A;  4DQP A;  3CG7 A;  4CHN A;  1Q9Y A;  1HNV A;  4E89 A;  3HPG A;  4GVM A;  1RT4 A;  5K14 A;  4C8O A;  2HHS A;  3LAL A;  2DY4 A;  4EP4 A;  1N6Q A;  3E01 A;  1BIZ A;  3V1O A;  3WNG A;  2IS3 A;  5SZT A;  3H08 A;  4DTO A;  2XY5 A;  1XC9 A;  1BIU A;  3KK3 A;  1WLJ A;  3AVI A;  2YNH A;  3HYF A;  3VQP A;  4DS4 A;  1NOY A;  2LSN A;  2OZM A;  4FK2 A;  3IS9 A;  3KK2 A;  3PUF A;  1BCO A;  3AA4 A;  1Q8I A;  3PX4 A;  2G8H A;  4CGG A;  5KRT A;  4DQR A;  2A1S A;  3TAG A;  4CJR A;  2IC3 A;  2HHV A;  3HP6 A;  3K5M A;  4JS5 A;  5KI6 A;  1RTJ A;  3L3U A;  4DLG A;  4FLU A;  1KLM A;  1ZBF A;  2KTQ A;  2D0A A;  1U04 A;  3PX0 A;  1VK0 A;  3L2U A;  4FZZ A;  2OPS A;  1CZB A;  2QKB A;  2O4I A;  1YTU A;  3ULD A;  4FJX A;  3SI6 A;  3ZSX A;  3AA5 X;  1BQN A;  2YNF A;  3OYB A;  1TKZ A;  1I3A A;  4FVM A;  3L2W A;  5C24 A;  3OS2 A;  3NGZ A;  4FZY A;  4E3S A;  3AVM A;  4RG8 A;  1ZBI A;  2D0B A;  1VSD A;  3P5J A;  1CXQ A;  2KFZ A;  3A2F A;  3RMD A;  1HJR A;  3VQ6 A;  3AO2 A;  3CQ8 A;  3OYM A;  4C8N A;  1YT3 A;  1T03 A;  3VQ8 A;  1WSH A;  3ZSO A;  5C25 A;  1KCF A;  4DMN A;  3ITH A;  1EX4 A;  3M8R A;  1DTQ A;  5JS1 A;  5FRN A;  4CCH A;  4DU3 A;  1TK5 A;  2Z1H A;  3C6T A;  2VG7 A;  4CES A;  4HUF A;  4DTS A;  3QEI A;  3PX6 A;  4ELU A;  3LAM A;  3AA3 A;  3DLR A;  4R5P A;  1SL2 A;  3TAQ A;  3MAQ A;  1JLG A;  4CF2 A;  5D3G A;  4B9U A;  1HQE A;  3I0R A;  1RT3 A;  2WON A;  4H4O A;  4Z0U A;  4HHT A;  2X6N A;  3CFR A;  2O4G A;  4L8R B;  3NDK A;  3V6D A;  4E7I A;  4CJK A;  3VA3 A;  1ZYQ A;  3OYN A;  3TAP A;  3L2Q A;  3QET A;  1X9S A;  3AA2 A;  2FBX A;  3AVF A;  1DTT A;  3OVN A;  3I8D A;  4B9T A;  2BE2 A;  4FJ8 A;  4F3T A;  1I39 A;  4OPJ A;  2ZE2 A;  4GMJ B;  4LY7 A;  3MEC A;  2WOM A;  2RKI A;  2B6A A;  4BE2 A;  1FKO A;  1TKT A;  4JLH A;  1ZBL A;  2BAN A;  4M3R A;  3MEE A;  1D5A A;  2YNI A;  2YHB A;  3NE6 A;  1SV5 A;  1WSF A;  4IFY A;  4FLX A;  1KSP A;  2XY6 A;  3QNN A;  4PUO A;  4OLB A;  1JLC A;  4KI4 A;  4FJI A;  1S1V A;  3VQE A;  1JL1 A;  5J2Q A;  3BDP A;  5CYQ A;  3B6P A;  3DRR A;  3O3H A;  1TKD A;  4KHW A;  1RTH A;  3ZSZ A;  3AO4 A;  1VSE A;  4PA1 A;  4CJF A;  3V9S A;  1VSH A;  5HBM A;  4DTJ A;  3U3Y A;  4DF8 A;  4FZX C;  4IG3 A;  4HVJ A;  3HP9 A;  3IG1 A;  1KTQ A;  3D0P A;  3OJU A;  3WNF A;  1U49 A;  3OYL A;  4KTW A;  4WE1 A;  1HPZ A;  5FDL A;  5T7B A;  3OJS A;  3LWL A;  1C1A A;  4J2E A;  4Z4I A;  4PQU A;  1T8E A;  1NK0 A;  1J9A A;  1WSE A;  4C8M A;  4AHT A;  5HRO A;  3WNH A;  2YNG A;  1BGX T;  1N5Y A;  2HMI A;  4E1N A;  2RF2 A;  1Y97 A;  3V81 A;  3OYC A;  4CEZ A;  4EZ6 A;  1L3S A;  3LP0 A;  4CJV A;  1S1U A;  2G8K A;  4FJM A;  1Q9X A;  1KVC A;  4O44 A;  1RCH A;  4CF0 A;  1Z26 A;  4KTQ A;  4IBN A;  1BI4 B;  1EET A;  4M3T A;  3LPT A;  2P5O A;  3ZT0 A;  4CK2 A;  3RMA A;  4DTX A;  3U6F A;  1W0H A;  1KFD A;  3HPO A;  4B9N A;  3UIQ A;  3L3V A;  4IG0 A;  4LD0 A;  2OZS A;  4CGI A;  4HUG A;  3NF7 A;  4W5O A;  4F4K A;  2GBZ A;  3LAN A;  4DTM A;  4DQQ A;  5I42 A;  3EYZ A;  1GOB A;  4OKJ A;  4M41 A;  4LSL A;  3MED A;  1TL3 A;  4FW1 A;  4FJL A;  5FRO A;  4EP5 A;  3VQ9 A;  4NYF A;  1RBV A;  3NH1 A;  3OYD A;  2PY5 A;  1ASW A;  4Z4C A;  3MXM A;  4J2A A;  3L2R A;  1RDA A;  1JKH A;  4CHY A;  4FLT A;  4FJ7 A;  1QSY A;  4FM2 A;  2IGI A;  1KLN A;  1LWE A;  3AO5 A;  3NAE A;  4FYD A;  3TR8 A;  3AVC A;  2A1R A;  1A5V A;  2NUB A;  3HM9 A;  3DLH A;  3O4N A;  1NJW A;  4H8K A;  3TAF A;  4AHV A;  1D8Y A;  4M3X A;  2BDP A;  1FK9 A;  1EXQ A;  5J2N A;  4CEF A;  2FBT A;  5KRS A;  1SKR A;  1RT7 A;  5KGW A;  4CEQ A;  4DSI A;  4CGF A;  1J5O A;  2VWK A;  1IKW A;  3NBP A;  2YKN A;  4CFB A;  3M8Q A;  3M8S A;  4FLV A;  2XY7 A;  2D5R A;  1NK4 A;  4F8R A;  1QSS A;  2OPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...