2B4JA

Structural basis for the recognition between hiv-1 integrase and ledgf/p75
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
153
structure length
135
Chain Sequence
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein, recombination
molecule keywords Integrase (IN)
total genus 47
structure length 135
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b4jA00
2YHBA 3RMCA 3BDPA 3O3FA 5DMRA 3KD5E 4EZ6A 4FYDA 1WN7A 4IFYA 1RDBA 4CECA 2HW3A 3AVNA 3BGRA 4CERA 2XY6A 1VSJA 2D5RA 2ETJA 1YT3A 3M8QA 3SCXA 4OGEA 2G8FA 2EHGA 3LAKA 2G8VA 4M3WA 4CGFA 4DTNA 1RT7A 1TKXA 2PZSA 4Y1CA 3VQDA 4DSJA 4E1MA 3ZT1A 3PUFA 1NKCA 2OZSA 4HUEA 1X9WA 3VQ8A 3QIPA 2Z1IA 3MEDA 3DLBA 3SV3A 1UOCA 3VQBA 3TAQA 2HB5A 4CEZA 3LALA 5D3GA 1YTUA 4EZ9A 2Y1JA 2HHXA 2BE2A 2KTQA 4DTPA 1RT2A 4CJEA 1BCMA 1VK0A 3AV9A 3V1RA 4DU3A 3AA5X 3V1QA 3VQAA 2HHTA 2HHWA 3VQQA 3ZCMA 1CXQA 4KV8A 4B9SA 3L2RA 3OS1A 4KHNA 3ZSQA 3CYMA 3HP6A 1S1UA 4C8OA 2O4GA 2X6SA 1RCHA 4PA1A 1ASWA 3HP9A 2VG6A 2Q3SA 5DK5A 5HBMA 3V9ZA 3HK2A 1BGXT 1K6YA 3NAEA 3AVLA 4DWIA 4M3TA 1ASUA 1RTDA 2QKKA 4BWJA 3B6OA 3ITHA 1B9FA 3K5NA 4BDYA 5J2NA 1BQMA 2BGGA 1MU2A 4UQGA 2KW4A 2DY4A 1HPZA 4O44A 4DMNA 3RRGA 3VQ6A 4ICLA 3AO4A 4KTQA 4I9QA 4IG3A 1WSGA 3OY9A 5HRPA 4FJXA 4FJ8A 4DQPA 4RW6A 3NF8A 4PY5A 4CJPA 1UA1A 3LZJA 3WNHA 1Z25A 4EP4A 5J2PA 3KD1E 1WSFA 1CLQA 1NKEA 4C8LA 3K5OA 3RWUA 1WSHA 5J2QA 2ZD1A 4FW2A 1HJRA 2D0AA 4LD0A 3WNEA 4CGHA 4RG8A 3L2VA 4E19A 1TKDA 1HQEA 4OPKA 4K8XA 1NOZA 1JLQA 3NF7A 4FLWA 4OLAA 1ZBIA 3LPUA 1A5XA 1I39A 4CJTA 4KI6A 3OYGA 3ZSXA 4DLGA 3OYHA 1TK5A 4EP5A 1W9HA 4O0IA 3MAQA 4DTUA 4FK4A 4IDKA 3F73A 4FXDA 4CGIA 1VSIA 3T1AA 2EX3A 2HNYA 4KFBA 2P5OA 1FK9A 1RBSA 3P83D 5C42A 4KHWA 4CFBA 1REVA 1GOBA 4Z4GA 4J2AA 3ZT2A 4FJ5A 3M8PA 3AVBA 2HNZA 3S3OA 2XY8A 4BDZA 2IAJA 4CEFA 1B9DA 4CEAA 3EY1A 3TI0A 1KTQA 1C0MA 1T03A 2DFHA 4DSEA 4DU4A 3SQ1A 4OLBA 2OPPA 4CJLA 1SL1A 3ZT4A 5E41A 2HVHA 3HO1A 4JS5A 4AILC 3RMDA 4BACA 4B9MA 1N6QA 1TL3A 4FJKA 4FLXA 4DSIA 4AHTA 4F8RA 3K2PA 3VQ7A 1WNSA 4AHSA 3CFPA 4Z0UA 3SJJA 3S9HA 4CJUA 1ZYQA 2A1RA 4DFMA 1KFDA 1IKWA 4W5RA 3HL8A 5HROA 1NK4A 1T8EA 4NCAA 1JLEA 3AVKA 4CJRA 3EZ5A 2RF2A 1JLCA 1A5WA 3LP2A 3MEEA 4CFDA 3K59A 3HXMA 1VRUA 3QNOA 4B3OA 3LZIA 3LWLA 4FVMA 4KAZA 3PX6A 2G8KA 4N76A 4FM1A 4MFBA 3KKSA 4CHQA 4OKEA 4ELVA 2OPSA 1RBVA 4M3XA 1VSFA 4NCGA 1HYSA 2OYQA 4DTRA 3DM2A 4CEDA 1U4BA 3DLRA 3OYMA 4E7IA 3G0ZA 4CGDA 3SPZA 2YKMA 4C8NA 3NH2A 4BDPA 1FKPA 3A2FA 2P5GA 1S1VA 3G10A 4HHTA 1S9EA 3P5JA 1JLAA 3DRSA 2B6AA 4CF1A 4NYFA 4YNQA 1NKBA 2HHSA 3CG7A 3OVNA 3OYEA 3KJVA 2P1JA 4M41A 3VQCA 4FCYA 3RR8A 3DYAA 1X9SA 1EKEA 4LSNA 5FRMA 3LWMA 1QQCA 5J2MA 1HYVA 1KVBA 1KRPA 4DTJA 1S1TA 3AA2A 3CM6A 3C6UA 3NGIA 4H8KA 4LSLA 2PYJA 1IKXA 1GOAA 1VSDA 4DSLA 4FM0A 2YNGA 3KIOA 4W5NA 2XO7A 2HHVA 3KLFA 3V9UA 4HUGA 3RMAA 3SQ0A 1D9FA 4E89A 1C0TA 1G15A 5HP1A 2ITGA 1C1CA 2JGUA 5SZTA 3HVTA 3OYAA 3ZSZA 2KFNA 3PY8A 1NJXA 4Z4HA 3NCIA 4F3TA 3AVHA 2D0BA 4N41A 1J53A 3PO4A 2IDOA 1A5VA 2D0CA 2WOMA 3AVFA 4DFKA 1TK0A 3KLEA 4BE0A 3NFAA 4B08A 4KB1A 4YFUA 1JKHA 4B9TA 4R5PA 2IGIA 4RW9A 1FKOA 4I2QA 4CIGA 3HSTB 4N56A 1RTJA 4RW7A 1L3TA 4FJGA 2KQ2A 4NCBA 1SL2A 3OJUA 4QOZB 3OYJA 4LH4A 3AO1A 1ZBFA 2P51A 3O4NA 4CK3A 3TARA 4HCCA 1NK9A 4G1QA 2F8SA 1IH7A 4CE9A 4B8AB 4DS4A 3SUNA 3AA4A 4M3ZA 4ZTFA 3CM5A 1WSEA 2HMIA 1D9DA 1ASVA 4B9VA 4Q5VA 4M3YA 4FW1A 4RW4A 3VA3A 3SQ2A 3LP0A 1RT5A 1NOYA 3NE6A 1SL0A 2XHBA 4FZZA 1U47A 1QSYA 3WNGA 4CF9A 3IAYA 3NBPA 4QCLA 1KLMA 3VQPA 4FJHA 5CZ2A 4H4MA 4FJMA 3NGZA 4OKJA 3PV8A 3AVCA 3LANA 4W5TA 3S3NA 2PY5A 3MXMA 3QLHA 1Z26A 3HM9A 3T3FA 3KLHA 4KHYA 1VSMA 1XI1A 4Z4IA 3OYKA 2IS3A 5HRRA 3ASMA 4LH5A 3DRPA 1ITGA 5KTQA 4B9NA 3DLKA 1HRHA 3CFOA 2FBYA 3VQ9A 4F4KA 2HHUA 1BISA 4CJQA 1UAXA 3DRRA 4CJ5A 1KVAA 2JLEA 4CJWA 2RN2A 3TR8A 4M42A 2YHAA 3MEGA 3HVRA 1WSJA 2F96A 5HRSA 3E01A 1JXEA 4CF0A 3K58A 4DQQA 3ULDA 1HNIA 2OPRA 1TK8A 3HJFA 3OYNA 1HNVA 2YNFA 3AVAA 1RDAA 3VQEA 3KK2A 3CFRA 3SUQA 1VSHA 2Z1GA 4AHCA 1S5JA 2E6LA 3ZT3A 1KCFA 1RT3A 1LWEA 4CHOA 3M8RA 4HTUA 3SYZA 3AO5A 3RR7A 3K5MA 3MECA 3IS9A 3OJSA 1S9GA 3KLIA 4E1NA 3OS2A 1J54A 3LP3A 4HUFA 1TVRA 1NJZA 3U3GA 3QINA 4KHSA 3OYDA 5JS2A 3HPGA 3QIOA 4AHRA 4XIUA 3KK3A 3V6DA 4E7LA 1Q9XA 1VSLA 4CJSA 1U04A 1WAFA 2XRIA 3C94A 4O4GA 1DTQA 3SZ2A 4Z4CA 1ZBLA 4CHZA 3NDKA 4C8KA 1TAUA 1BI4B 2PYLA 1KLNA 2DTUA 4BWMA 1FXXA 1HQUA 1VRTA 2OA8A 1XWLA 3O4QA 4DS5A 3NH1A 3B6PA 1SKSA 3QO9A 3RMBA 4IKFA 1Y97A 2F8TA 3ZSWA 3QETA 4J2BA 4E7HA 4FLUA 3TAFA 1X9MA 2E4LA 4JRPA 2KZZA 3ALYA 4AHVA 3V81A 4FLZA 3TAGA 5FDLA 2VG5A 5C25A 2QKBA 3MXJA 4BE2A 1LWFA 4AHUA 3OYLA 1RNHA 2DFFA 3M8SA 3QNNA 3TANA 4FK0A 4CESA 1SKWA 2HHQA 4CEBA 3ZSRA 3V1OA 1IKYA 3L2WA 4FZXC 1I3AA 3U6FA 4M3RA 3O3GA 3L2UA 1LV5A 2W42A 4CF8A 5SWMA 4DLEA 3QEPA 3TWHA 4GW6A 1BIUA 3FFIA 4TSXA 5CYMA 1LW0A 3NHGA 3P1GA 1KSPA 4F3OA 4OJRA 4B8CA 2VWJA 1XHXA 4CHPA 4E3SA 2HNDA 4N5SA 4Z4EA 4E7JA 4LY7A 1IO2A 4MQ3A 4Y1DA 3D0PA 5KI6A 1XC9A 3SUOA 3JYTA 4W5OA 2OZMA 1LAVA 4CGJA 1JXBA 3QEWA 4B9UA 1NJWA 1NJYA 2X74A 3DLHA 4H4OA 2NUBA 1ZBHA 3KTQA 2YNIA 1SUQA 3C95A 3IG1A 3HPOA 1L3SA 4DQIA 1U48A 4PWDA 1JL2A 5C24A 4FZYA 3PX4A 3O3HA 2WONA 2IC3A 2IOCA 1RT1A 4IBNA 2BANA 2B4JA 4O55A 4DF8A 2KFZA 4O0JA 4DFJA 1R0AA 4CF2A 4CJ4A 1NK7A 2G8UA 1C0UA 4ID1A 2O4IA 2GV9A 3ZT0A 4CK1A 1W0HA 3L3UA 1JLFA 3RTVA 3OS0A 4KKOA 3MXIA 4CIEA 5FRNA 3OYCA 3V9XA 2G8WA 3QESA 1WAJA 5KRTA 1C1BA 2RKIA 3ISNC 1YTAA 3AVMA 3AA3A 1RTIA 4M3UA 1ZBUA 3K57A 2GBZA 1L5UA 4DFPA 2X6NA 1D8YA 3TAEA 4FLTA 4FLYA 3OYFA 5I3UA 3UIQA 2RPIA 4M45A 3SPYA 1KVCA 1C6VA 5T7BA 3QERA 2A1SA 1HYZA 3NF9A 3SUPA 4ZTJA 4ELTA 4HCBA 1L3VA 4OKKA 5CZ1A 4JRQA 3AO3A 4E7KA 4PQUA 2Z1HA 4CEEA 4CJFA 4KTZA 2G8HA 1TL1A 5KGXA 4CCHA 4RW8A 1B92A 1VSKA 3JSMA 3L8BA 1RT6A 4CFCA 5HLFA 4F2SA 4FJ7A 3C6TA 3I0RA 1TGOA 3SNNA 1EETA 3NGYA 3VQ4A 1UA0A 2LSNA 1QS4A 3PO5A 1TAQA 1YVUA 1S6QA 3H08A 5FROA 4C8MA 2VG7A 4CK2A 3S3MA 4I7FA 1NK0A 1SKRA 3TABA 5K14A 4KTWA 4N47A 3V9WA 4KB0A 4FJ9A 4DQSA 1S6PA 2YNHA 4DQRA 5J1EA 2KZMA 1JLBA 1J5OA 4KI4A 1BHLA 1RDDA 3F9KA 3QEXA 1CZBA 4QAGA 1CZ9A 3I8DA 5KRSA 1X1PA 1LAWA 2ZQBA 3LP1A 3AO2A 3LPTA 3QEIA 2G8IA 1DTTA 5KGWA 1Q8IA 1TKZA 2GUIA 4IFVA 3VA0A 2E6MA 4FLVA 3DLEA 5EU7A 3V4IA 3DOKA 1UWBA 3ZSOA 4CHYA 1BQNA 4DTMA 2FC0A 4GVMA 3THVA 1WSIA 1IG9A 1VSEA 1RTHA 1QTMA 1RDCA 2I5JA 4PUOA 4DSKA 1QSLA 2B5JA 4CFAA 3CQ8A 4ELUA 4OVLA 1CXUA 3WNFA 1XHZA 3QEVA 4FK2A 3AVJA 4WE1A 1IKVA 2Y1IA 1EXQA 1RT4A 1JL1A 4CJKA 1TV6A 1C1AA 2DFEA 4FM2A 1O1WA 4GMJB 2QXFA 2XY5A 3SI6A 1LWCA 1U45A 1Q9YA 4FJJA 4KHQA 4Z4FA 1RBTA 1KFSA 4KHUA 1BIZA 3T19A 4IG0A 1BCOA 1RBRA 3ZSVA 4KREA 4CHNA 4CEQA 3VN5A 4KO0A 1WLJA 3I0SA 1F21A 3D45A 3LAMA 4ID5A 3HYFA 2OPQA 4O5BA 3TAMA 3L3VA 4L8RB 1N5YA 2VWKA 1NK5A 3K5LA 2FBTA 1D5AA 1S1XA 3HT3A 1T05A 3EYZA 1U49A 1NK6A 4B9LA 2BDPA 3V9SA 4NYNA 3KK1A 1BI4A 2ATQA 3DLGA 3DMJA 5HRNA 3KLGA 2R7YA 1QSSA 2AJQA 3DOLA 2ZE2A 3PX0A 3NH0A 4K8ZA 4F2RA 4OPJA 3HPHA 3AVGA 4KPYA 4Q0BA 3SV4A 3TAPA 3KKRA 1SV5A 5JS1A 3NF6A 1J9AA 2YKNA 4W5QA 4DTXA 4I2PA 1TKTA 4CJ3A 2FBVA 1RBUA 5CYQA 4DU1A 3SQ4A 1QHTA 3IRXA 4I9LA 1L3UA 1NK8A 2X78A 3OYBA 1RILA 2FBXA 4FJLA 1EP4A 3LDSA 1QE1A 2HVIA 4ZHRA 4J2EA 4J2DA 1LW2A 1BL3A 1DLOA 4JLHA 4DF4A 4OGCA 4DSFA 4JS4A 4HVJA 4AH9A 3U3YA 1EX4A 3VQ5A 4CEOA 1JLGA 2Z1JA 1S1WA 2QK9A 3ZSYA 1HMVA 3OYIA 4DTOA 3RRHA 4FJNA 3L2QA 2YV0X 3DI6A 5I42A 4CGGA 4KRFA 4DTSA 5CY4A 4E0DA 4BE1A 4DG1A 4CJVA 4FJIA 1T7PA 3AVIA 4CIFA 2XY7A 1GOCA
chains in the Genus database with same CATH superfamily
3J7AP 2YHBA 3RMCA 3BDPA 3DXMB 1YIJN 2FF3B 1WN7A 3VF2A 4CECA 3AVNA 3OW2M 4LF9K 2XY6A 1YT3A 2RE2A 4FO0A 2W40A 4XH5A 2G8FA 5C0YA 3VGMA 3E1YA 1HNXK 4JKEA 1VQ9N 1TKXA 4Y1CA 2V7ZA 3ZT1A 3PUFA 3I56N 2OZSA 4HUEA 3TTFA 3CCEN 3SV3A 3ZEUA 4B1VA 5AQMA 2YCHA 3RSEA 4BRLA 3C6HA 3LALA 1YTUA 2HHXA 2BE2A 3DJCA 3AV9A 3V1RA 2OTJN 2HHTA 3I8BA 2HHWA 4G9ZA 1GLBG 3IFRA 2O4GA 5HBMA 3HP9A 3HK2A 1BGXT 3WEEA 4BRNA 3AVLA 3CD6N 4M3TA 1RTDA 2QKKA 4BDYA 2BGGA 2DY4A 3U9DA 3VENA 1HPZA 2P9LB 2ZJPL 3AY9A 5M1FA 4HTLA 4FJ8A 1WSGA 4FJXA 5HRPA 4DQPA 3SBTA 3DXKA 4JHDB 4CJPA 1X9JA 4DHYA 1UA1A 1Z25A 5J2PA 4YOXA 1BU6O 5J2QA 4FW2A 1TKDA 1G99A 5FRMA 3L2VA 4E19A 3LDLA 4OPKA 1JJ2M 4A5AA 2O8CA 1JLQA 4FLWA 3F5TA 5F0XA 1U6ZA 4CJTA 4DLGA 1TK5A 5TKYA 1W9HA 2KKZA 4O0IA 3FZLA 4FWKA 3T1AA 5KPZA 2UXDK 4KFBA 4CD1A 1RBSA 3O5BA 2FXUA 5AQIA 4Z4GA 3UKUB 4J2AA 1MDUB 2XY8A 2IAJA 2ASOA 4CD3A 4BRDA 3TI0A 4NLCA 1C0MA 1S72N 1ILYA 1SL1A 4JS5A 2P9IB 1YUWA 4B9MA 1N6QA 4FJKA 2V51B 4AHTA 1S22A 4F8RA 1JCGA 4AHSA 3CFPA 4JI5K 4CJUA 3UE5A 1XNQK 2CH5A 1ZYQA 2A1RA 1NK4A 1KFDA 4QS8A 5ADXA 3ATVA 1JLEA 4NCAA 5JVGL 3AVKA 2RF2A 2ZGZA 1XMOK 4K42A 5BRDA 5FPDA 2G8KA 4N76A 4MFBA 4FWQA 5KPTA 1HYSA 2E2OA 3T1YK 4LF8K 3ZLJA 3THXA 4E7IA 5JLFA 3DWLA 3MX2A 5KQDA 3G10A 4GKKK 1OH8A 2B6AA 1VQ8N 3OVNA 4M41A 4FCYA 5AQKA 4B1ZA 1KVBA 4DTJA 5M1PA 1R59O 3P4IA 4IEIA 2PYJA 4BRIA 2HBMA 4YDUC 3V9UA 3RMAA 4E89A 1C0TA 1G15A 1U2VA 5HP1A 3OTOK 3OYAA 4B1YB 2KFNA 4Z4HA 4F3TA 3W0LA 4BR9A 1K9MO 4F9OA 2IDOA 3AVFA 3NFAA 3T69A 4YFUA 1JKHA 2IGIA 4GY2B 4IJAA 3ATUA 3HSTB 3PIOL 2NRHA 4RW7A 4FJGA 3TTCA 3OJUA 4LFCK 2KHOA 2KLAA 2FSJA 2F8SA 5TKWA 3IUCA 1NK9A 4G1QA 4CE9A 3CM5A 2ZF5O 5AQHA 4OX9K 4B9VA 4M3YA 3A5NC 3SQ2A 3LP0A 3NBPA 4QCLA 4XEIA 3UKUA 1HLUA 3S3NA 2PY5A 1BOTO 3QLHA 3KVGA 5GAEP 3O9UA 4BR2A 5HRRA 1OVYA 3I33A 5KTQA 4B9NA 3VQ9A 5AZIB 3R9PA 3LDNA 1IBLK 1KVAA 2RN2A 3TR8A 3NVKA 4M42A 2YHAA 2F96A 4DCHA 4PL7A 1TK8A 2A40A 3VQEA 1T6DA 3TPQA 4V19S 4JK7A 4RWTA 4JHDA 3JAMO 1XNRK 5C2DA 3M8RA 4HTUA 1XQSC 4LF7K 3KHYA 3U3GA 3QINA 4KHSA 3OYDA 4XIUA 2W6LA 4JK8A 5AFUH 4WQ5A 1EQYA 1WAFA 1ZBLA 3C94A 4CHZA 3WEEB 1RDWX 2UUBK 1KLNA 2DTUA 3ENOA 3GL1A 4BRGA 1XWLA 3O4QA 1HKBA 3RSEB 3M5RA 4BRKA 2F8TA 4JK9A 2IIRA 3BF1A 2A3ZA 4E7HA 3TAFA 4JRPA 2KZZA 3V81A 3ZEUB 4JV5K 1HUXA 3M8SA 1RNHA 5AQOA 1OVQA 4FZXC 3U6FA 5SWMA 4DLEA 4BRHA 5LMNK 5LL6Z 4F3OA 4IFEA 4B8CA 3CCLN 4E3SA 1VHXA 2NLXA 4RCHA 5FLXO 3ULEB 3DXMA 5KI6A 1K8AO 1LAVA 4BROA 3BEXA 3H6EA 4E1JA 2X74A 3DLHA 4H4OA 1SUQA 4JI6K 1NGFA 1Q82O 5C24A 2PBDA 4FZYA 5GIPA 4IOCL 3CQXA 4H0OA 4DF8A 4DFJA 1R0AA 3QB0A 2O4IA 1EO1A 2GV9A 3MN5A 4BC5A 5H1SQ 4CK1A 5EOYA 4GV3A 5FRNA 3OYCA 3D2FB 1WAJA 1C1BA 3ISNC 1C0FA 3K57A 1GLAG 1OH6A 3TAEA 3UIQA 3CC7N 3SPYA 3Q7CA 1HYZA 3NF9A 1NGIA 3O08A 1L3VA 4OKKA 5CZ1A 4PQUA 4C1NK 3JXUA 2QWLA 1O13A 2E20A 3VEVA 1WOQA 5ELZA 4RW8A 1B92A 4FJ7A 3AGRA 4CFCA 4WYBA 3C6TA 4PKGA 3O1BA 3NGYA 2E1YA 1YVUA 2VGNA 1HPMA 2VQEK 5IT9O 3WT0A 4DQSA 1JLBA 4KI4A 1RDDA 4QAGA 3CIPA 1IG8A 4JI2K 3R6MA 1LAWA 2ZQBA 3G25A 3SMPA 4K43A 2G8IA 1QHAA 4IFVA 3V4IA 3ZSOA 1BG3A 4JEPA 3P39A 1CZAN 3KWIA 5AQLA 2B5JA 1CXUA 4WE1A 1IKVA 5C15A 1RT4A 5HL7L 4FM2A 1C1AA 2XY5A 4FJJA 4PY5A 3BF3A 5ADXH 4KHQA 2D0OA 3VF4A 4PL8A 3EKSA 3EEQA 4H0PA 1RFQA 4CEQA 4KO0A 4ID5A 4O5BA 1F21A 3HYFA 2OPQA 3PSIA 2VWKA 3K5LA 3HT3A 4B1UB 1T05A 3FFKB 3EKUA 2BDPA 3DMJA 4L3QA 2R7YA 2AJQA 4K8ZA 4F2RA 3HPHA 3AVGA 3SV4A 1T6CA 4JI7K 3WXJA 2VQFK 5JS1A 2YKNA 4DTXA 1N32K 4I2PA 3GOIA 4C1NI 2FBVA 3P38A 1QHTA 1J5EK 3IRXA 4I9LA 5CE3A 1EP4A 3WXIA 3B8AX 4JD2A 4J2DA 2QA4N 4DSFA 4HVJA 4CEOA 2Z1JA 4PHTX 3ZX3A 1TYQB 3PLAA 5I42A 4CGGA 4KRFA 3K9KA 3THWA 3WXKA 1E4FT 2FSNA 3AVIA 4CIFA 4FJIA 1ATNA 3G6EN 3E66A 4FYDA 3HI0A 1RDBA 3IMXA 4IFYA 3ZETB 2O8BA 4CERA 4CZGA 3M8QA 4OGEA 2P9IA 4M3WA 3E9LA 3SAHA 3ZX0A 3I55N 1VQ7N 3VQ8A 2Z1IA 3MEDA 4BREA 3VQBA 5D3GA 5M1OA 1N33K 2OTLN 5AQGA 3ZCMA 4BVPA 3CYMA 1YVNA 4C8OA 5DK5A 2O8CB 3VTIA 2Q3SA 3NAEA 3B6OA 3ITHA 3K5NA 4BG9A 1MU2A 3RRGA 4JKGA 4ICLA 4DR4K 4IOAL 3QBWA 3KZBA 1VQMN 1NGBA 2ZJRL 3BZKA 4CVNE 1SZ2A 1XUPO 2E5LK 4C8LA 3K5OA 3RWUA 1WSHA 2UUAK 2ZD1A 2D0AA 4CGHA 3NF7A 1SQKA 5CR4A 4KI6A 4JAXA 3WXLA 1EWQA 4FK4A 4CGIA 1FK9A 5C42A 1REVA 1GOBA 3M8PA 3EE8A 3AVBA 1YXQA 4BDZA 4WFBL 4CEFA 1B9DA 3ENHA 3VPZA 2DFHA 4BC2A 3SQ1A 4JI3K 4OLBA 5AQPA 3ZT4A 5E41A 2HVHA 4AILC 3C7NA 3RMDA 4BACA 4YHHK 3O9TA 1TL3A 4FLXA 1GLEG 4DSIA 2P9NB 1WNSA 2CH6A 4FWPA 3EZ5A 3K59A 4DV6K 2W6KA 3LWLA 1HX1A 2I7PA 4FVMA 4YORA 4KAZA 5BRHA 4FM1A 3CMAN 5MLCQ 2CGLA 2DPNA 1YITN 3U4LA 2Q1NA 3OYMA 2ZJQL 4GVEA 3NH2A 4BDPA 1FKPA 1S1VA 4LC9B 1JLAA 3DRSA 4CF1A 2Q0UA 1NKBA 1V4SA 2D0PA 3CG7A 3H45C 4DR2K 4O8UA 1X9SA 1QQCA 3N4QA 1KRPA 3HM8A 4CZLA 1IJJA 2ZM6K 3NGIA 3CC2N 2Q2RA 4IEEA 4FM0A 2D1KA 2YNGA 3KIOA 2XO7A 3KLFA 4HUGA 4LF4K 4EAHD 2JGUA 3HVTA 3ZSZA 1NJXA 2NRWA 2VCPA 3AVHA 5AZIA 3ID8A 3UKRA 1DGKN 1A5VA 2WOMA 1TK0A 1ATRA 3MK6A 3KLEA 4BE0A 3O9SA 5BPLA 4RW9A 4MLEA 1HR0K 3QFPA 1K8KA 3M3ZA 2KQ2A 3FZFA 2O8EB 4BRCA 2O8EA 2NRXA 3O4NA 2VGMA 1K8KB 4K0KK 4DQ8A 4B8AB 4M3ZA 4ZTFA 2F9WA 4CBUA 3U8XA 4FW1A 3VA3A 1RDUA 3WNGA 5F1XA 1KLMA 5CZ2A 4FJMA 1YJNN 4H5TA 3MXMA 3T3FA 4Z4IA 2P9SA 4DUZK 2IS3A 1D4XA 1ITGA 4FSVA 3DLKA 5FPEA 3MDQA 4FPAA 4CJ5A 4K41A 1W2BM 2BTFA 3R3LA 4JKHA 4BR7A 3HVRA 4CBWA 1JXEA 4DQQA 1HNIA 2OPRA 3HJFA 1HNVA 4CW7B 4JD2B 1VSHA 2Z1GA 4AHCA 1S5JA 1FW6A 5AQNA 2E6LA 1E4GT 1ZBSA 1LWEA 3AO5A 4FWSA 1QQNA 3VEXA 1S9GA 4ISGA 3OS2A 2W41A 3FZMA 2E8AA 4HUFA 1TVRA 4AHRA 3V6DA 1TAUA 4Z4CA 2A42A 4BWMA 5DM7L 1FXXA 1VRTA 2QWRA 4WFAL 2JWKA 2QM1A 4IKFA 1Y97A 3D6RA 3GDQA 4UY8O 3C7NB 3QETA 4J2BA 3MCAB 5EVZA 1X9MA 3OA9A 3ALYA 4AHVA 3TAGA 2VG5A 5C25A 2QKBA 3MXJA 2QWMA 4DV4K 4BE2A 1ESVA 4AHUA 3OYLA 5AQXA 4FK0A 4CESA 1SKWA 1WBBA 3A8YA 4FWMA 3L2UA 3A5LC 1WBDA 3QEPA 3FFIA 5CYMA 3NHGA 1LW0A 1WUAA 1XHXA 2GEMA 2HNDA 2H3GX 3L0QA 2ZWHA 3VEWA 3SAGA 2O8FA 2HMPA 1IO2A 3ENBA 4W5OA 2OZMA 4EHTA 1W97L 1NJWA 1IV0A 1NJYA 3SAFA 5AQWA 3ZYYX 2GTDA 2NUBA 1ZBHA 3IG1A 4DQIA 5BRFA 1U48A 1GLJO 3PX4A 2WONA 2IOCA 3K9JA 4WF9L 2BANA 2B4JA 4JKGB 2FSKA 4CF2A 4ID1A 4YOYA 4JKFA 5AFUA 1W0HA 4I6MA 4CIEA 3V9XA 5C10A 1QZ6A 3VOVA 3QMLA 3DXKB 4FWRA 3Q7BA 1ZBUA 1L5UA 1IBKK 1NU0A 1N34K 5I3UA 3QERA 1OH7A 4CJ7A 4HCBA 4JRQA 4E7KA 4CEEA 4CJFA 1QZ5A 1TL1A 4CCHA 4AF1A 4DV1K 1QVFM 5HLFA 3JSMA 3PIPL 5AQSA 1QS4A 3S3MA 5FROA 1SKRA 5LMUK 4KTWA 3V9WA 4MDAA 2YNHA 2KZMA 5J1EA 1BHLA 1BUPA 2V52B 4B9QA 1CZ9A 3I8DA 1XMQK 2WBNA 3W3DA 2VWBA 3LP1A 3AO2A 3LPTA 3QEIA 2NZTA 5KGWA 4YOUA 4FVUA 1Q8IA 3VA0A 4FLVA 3DLEA 3DOKA 3THVA 2HF4A 4JI1K 2FC0A 3CJ9A 1VSEA 1RTHA 2IVNA 1QTMA 1NGHA 5DM6L 4PUOA 4DSKA 1QSLA 3CQ8A 4CFAA 4ELUA 4OVLA 1ZC6A 2E1ZA 1BA0A 5CHIA 4GKJK 1OH5A 4M3XA 1U45A 1LWCA 3CPWM 4KHUA 1BIZA 5AZJA 3VN5A 5AQJA 1WLJA 4O5FA 3CJBA 1D5AA 1S1XA 5GAGP 2YHWA 3CJ7A 4IOXA 3KK1A 3DLGA 3J80O 3MWPA 3L6QA 3PX0A 3NH0A 1NGGA 4JKBA 2GX9A 3KKRA 3GBTA 1SV5A 1T44A 4X62K 1J9AA 4W5QA 2IVOA 1RBUA 5CYQA 3SQ4A 4DR1K 1L3UA 1YI2N 4HWIA 3OYBA 1RILA 5IWAK 4FJLA 1KD1O 4ZHRA 3OHRA 1DLOA 2HBJA 3WXMB 4AH9A 1S1WA 1ZXOA 3ZSYA 3OYIA 3DI6A 4B3TK 3O8MA 5CY4A 4BE1A 4CJVA 4KPYA 4B3SK 2HOEA 2HW3A 3BGRA 1H1VA 1VSJA 2D5RA 4NLBA 3QDKA 3QBXA 3AGKA 2G8VA 3FR0A 4DTNA 2UYTA 2PZSA 3VQDA 4DSJA 1Q81O 3TU5A 4LF5K 1NKCA 3QIPA 2HF3A 3DLBA 1UOCA 3A5OC 3TAQA 4CEZA 4EZ9A 2Y1JA 1VQ6N 2KTQA 4U67L 1RT2A 1BCMA 1VK0A 4DU3A 4IXCA 4XH4A 3AA5X 3V1QA 3VQAA 4EIAA 1VQ5N 1CXQA 4KV8A 4H0YB 3L2RA 4KHNA 4RTFD 3ZSQA 3HP6A 3N4PA 4HCCA 1RCHA 4A5BA 1ASWA 4BR0A 1NNEA 2E2QA 1MWMA 2YI1A 1Z05A 4DWIA 4B1XB 1ASUA 1B9FA 1Y64A 5J2NA 1BQMA 3CJ1A 2KW4A 1P8ZA 3KK7A 4CZMA 3AO4A 3O1WA 4KTQA 4I9QA 2JWLA 1BA1A 4IG3A 4RW6A 3MX5A 1VQLN 1NGCA 3LZJA 3WNHA 3DLLL 1WSFA 4A2AA 1CLQA 2ZGYA 1SS6A 4FWOA 3PO4A 4LD0A 3WNEA 4K8XA 1NOZA 3MN9A 3SBGA 4OLAA 1ZBIA 3LPUA 3ULEA 1A5XA 2QEXN 1I39A 3OYHA 1TUUA 3THXB 4EP5A 3LL3A 1KAYA 3EO3A 4YOTA 4DTUA 1VSIA 2EX3A 5GAHP 3P83D 4FJ5A 4A59A 3S3OA 3E9PA 3O4WA 3CERA 2QI2A 3EL2A 3EY1A 1T03A 4DU4A 3CC4N 2UXCK 4DV3K 4CJLA 4JNEA 3SJJA 3S9HA 1NLVA 2CGKA 5HROA 3HL8A 3VERA 3OBWA 1JLCA 3LP2A 1VRUA 3LZIA 1LOTB 2UXBK 3PX6A 4CHQA 4DR3K 4JI4K 1VSFA 3MWTA 4BRMA 1U4BA 4DB3A 2NRRA 3THYB 3G0ZA 4CGDA 3SPZA 4NB4A 4C8NA 4BC3A 4KBOA 4HHTA 4BVOA 3P5JA 1Q18A 4YNQA 4ILHA 4NYFA 2V7YA 3RR8A 2P1JA 4FL9A 3VQCA 2P9UB 4WQ5C 3MN6A 2NNWA 3CJAA 1C0GA 3K0SA 3O9RA 1HYVA 3THYA 1NGEA 1S1TA 2P9UA 1QQOA 4DV5K 3ZX2A 3AA2A 3VETA 4LSLA 1VSDA 1GOAA 3R8EA 4KH4A 3J7ZO 3SQ0A 5BR8K 5KPRA 3PY8A 2F7TA 4N41A 5GADP 1J53A 1YJ9N 2D0CA 4DFKA 4H03B 4B08A 2O8FB 4B9TA 4R5PA 1J6ZA 1FKOA 2HBLA 4CIGA 1HKGA 2QWPA 4NCBA 1SL2A 2F9TA 3CETA 3OYJA 2HBKA 4LH4A 2D4WA 1ZBFA 3WUHA 1IH7A 3SUNA 1X3NA 2O8BB 3AA4A 2QWNA 4IWVA 1WSEA 2HMIA 2BUPA 5FPNA 1RT5A 1NOYA 3NE6A 1SL0A 2XHBA 4FZZA 1U47A 4FOIA 4CF9A 5BN8A 4WQ4A 3VQPA 1Q86O 1TYQA 2QXLA 5EXWA 2AP1A 4W5TA 1XI1A 3OYKA 5AJ3K 2YHXA 5AQUA 4LFBK 4EHUA 1HRHA 2FBYA 4F4KA 1HNWK 2HHUA 1BISA 1UAXA 4IJNA 3IKMA 2E2NA 5AQQA 3IDHA 3K58A 1WSJA 3D2EB 4CF0A 4EFHA 3ULDA 3OYNA 1RDAA 3KK2A 3CFRA 3SUQA 3AAQA 3EN9A 4JKCA 4H5WA 3WQTA 1RT3A 4BC4A 4CHOA 3RR7A 3K5MA 3IS9A 3OJSA 3T7ZA 4B3MK 3LP3A 2NRTA 1NJZA 3QIOA 3BUZB 4E7LA 1VSLA 2EWSA 4B3RK 4CJSA 4O4GA 1BI4B 2PYLA 1HQUA 4M7YA 1VQNN 4IZ9A 2P9SB 4DS5A 3NH1A 3B6PA 1SKSA 3QO9A 3RMBA 1GLCG 4FLUA 4Y0WA 4CZJA 4FLZA 1LWFA 3QNNA 3TANA 3FE1A 1HJOA 3ZSRA 3V1OA 1IKYA 3M6GA 3O3GA 2HSTA 4CF8A 3GG4A 3TWHA 4MLHA 3O9QA 1KSPA 2I7NA 4OJRA 2VWJA 4CHPA 4H5NA 4BRAA 4JI8K 4N5SA 1NMNA 5JLHA 4E7JA 5FPMA 3DAWA 4LY7A 4PKHA 4MQ3A 4Y1DA 5E84A 4Z94A 4WFNL 1VQKN 4JKDA 3LM9A 4CGJA 3QEWA 2YNIA 1L3SA 3HPOA 4PWDA 1JL2A 3CI5A 1VAZA 3O3HA 1RT1A 4IDHA 4O0JA 1KQSM 4CJ4A 1NK7A 3D2FA 1C0UA 3ID6A 3VEOA 3HTVA 1JLFA 3MN7A 3RTVA 5M1QA 4YOWA 3QESA 5KRTA 2RKIA 4C23A 1YTAA 3AVMA 1RTIA 2GBZA 2X6NA 3D2EA 4FLTA 1KAXA 4BY9C 4FLYA 4M45A 4YY3K 5T7BA 3SUPA 4KH6A 2GWJA 3SLCA 2GELA 4KTZA 3O6WA 3L8BA 1RT6A 4ISEA 5GIOA 1TGOA 1EETA 5B8HA 1UA0A 5AR0A 2LSNA 3PO5A 1TAQA 3H08A 2G8UA 4A61A 4CK2A 4C8MA 4I7FA 4K25A 2E2PA 3TABA 5K14A 4N47A 4FJ9A 1BWFO 5KQ8A 4DQRA 3L4IA 3UB5A 3F9KA 3QEXA 4DR6K 2Q36A 2UUCK 3TSUA 3HOTA 2WFBA 4A57A 2Q31A 1UWBA 4CHYA 2RHKA 4DTMA 1IG9A 1V4TA 4WCEL 4FK2A 2P9PB 3QEVA 2OANA 1JL1A 1TV6A 4ILGB 2DFEA 1O1WA 4GMJB 1Q9YA 4H0TB 1KFSA 3T19A 2P9KB 1RBRA 1T3VA 3ZSVA 4CHNA 4O8KA 4KREA 4OPHA 1S3XA 1JCEA 3I0SA 3D45A 3LAMA 4QS7A 4L8RB 3TAMA 3L3VA 1NK5A 3EYZA 1U49A 1NK6A 4BGBA 1M90O 4NYNA 2YJEA 4J8FA 2YJFA 2QWQA 1QSSA 2ZE2A 1NBWA 4Q0BA 3CCSN 3TAPA 3CJCA 4R79A 5M1KA 1TKTA 4CJ3A 1M1KO 4GNIA 2BH1A 5AQFA 2X78A 3GE1A 2FBXA 3LDSA 1EWRA 1LW2A 4JLHA 3U3YA 1EX4A 2QK9A 4PKIA 3L2QA 2YV0X 5BR9A 2GWKA 1LCUA 3VF6A 4DTSA 3VGKA 4E0DA 1N8RO 1NM1A 4DG1A 5BPMA 2P9KA 1RGIA 2XY7A 5AQZA 4CBXA 3O3FA 3OBYA 5DMRA 3TTDA 3KD5E 4EZ6A 3VEZA 3SCXA 2ETJA 2EHGA 4BRQA 3LAKA 4DKWA 4BR5A 4CGFA 1RT7A 1VQ4N 5AQRA 3C6AA 2IVPA 4E1MA 3VESA 5JMVA 1X9WA 2Q0RA 3LDQA 4BGAA 1IBMK 2HB5A 3F2KA 3LM2A 2O8DB 4FPBA 4DTPA 4DV2K 4CJEA 1NWKA 4A62A 2QWOA 3G4SN 3H3NO 3VQQA 4B9SA 4BG8A 2Q97A 4CZHA 3OS1A 3EE9A 1S1UA 3H1VX 2X6SA 4PA1A 2VG6A 3V9ZA 2CGJA 1K6YA 2VYPA 3BZCA 4MDBA 4BWJA 4FWLA 4UQGA 5BREA 4H5VA 4O44A 4DMNA 3VQ6A 4QS9A 3CHWA 3OY9A 4MO4A 1NJIO 3NF8A 3KWGA 1HKCA 4EP4A 3KD1E 4BRFA 1NKEA 3G71N 4F2SA 1HJRA 3A5MC 4RG8A 3AARA 1HQEA 3VEYA 4BR4A 1GLDG 3SJHA 2PFUA 3OYGA 3ZSXA 5GINA 3MAQA 4IDKA 3F73A 4FXDA 3C65A 2HNYA 3H3OB 2P5OA 4KHWA 4CFBA 3ZT2A 2HNZA 4NXNK 4JYAK 4CEAA 1KTQA 4CZEA 4DSEA 2OPPA 3CMEN 3HO1A 4NXMK 3K2PA 3VQ7A 2YHYA 1WB9A 4Z0UA 3NVMA 3E9OA 4DFMA 4W5RA 1IKWA 1T8EA 4CJRA 3MEEA 1A5WA 3A0IX 4CFDA 3HXMA 2WTUA 5LY3A 3QNOA 4B3OA 5AQVA 4CZFA 2WC9A 1SAZA 3SMSA 5C12A 3KKSA 4OKEA 4ELVA 2OPSA 1RBVA 3UKRB 5I9EB 4NCGA 3CCUN 2OYQA 4DTRA 3DM2A 4CEDA 5JVHL 3DLRA 3F9MA 3J7YP 4LF6K 2YKMA 2P5GA 3A2FA 4ILJA 1S9EA 3QICA 3HBTA 2A41A 2HHSA 3OYEA 3KJVA 1K73O 2NRZA 1E3MA 3DYAA 1EKEA 4LSNA 2FF6A 3LWMA 4AM7A 3VGLA 5J2MA 2ASPA 3O80A 4BRPA 1ATSA 2AA4A 3C6UA 3CM6A 4H8KA 1IKXA 1VQON 1TUYA 4W5NA 2HHVA 2A6AA 3TSQA 1D9FA 2ITGA 1C1CA 5SZTA 1YJWN 2QW9A 3NCIA 4B1WB 2D0BA 1XC3A 2QTDA 3HZ6A 1BDGA 3QFUA 4X64K 3MMVA 4KB1A 4DV7K 2WUSA 4M63C 2P9NA 4I2QA 4N56A 1RTJA 3R1XA 1L3TA 3VMFB 4QOZB 1Z6RA 3AO1A 2O8DA 3CF5L 3TARA 2P51A 4CK3A 4DS4A 5EY4A 1D9DA 2FLOA 1ASVA 4Q5VA 3FLCO 3J81O 4RW4A 1I94K 1DT9A 1QSYA 3IAYA 4FJHA 4H4MA 3NGZA 4OKJA 3PV8A 2F4VK 3AVCA 3LANA 4KHYA 1Z26A 3HM9A 3KLHA 1VSMA 4X65K 4XH1A 3ASMA 4LH5A 3DRPA 2ITMA 1MWKA 3CFOA 1N36K 4OPAA 4IO8A 3AAPA 3C0BA 3CXCM 5HOOA 4CJQA 2ASMA 3DRRA 1KC8O 2JLEA 3H1QA 4FWNA 4CJWA 3T1HK 4JI0K 3MEGA 5HRSA 3E01A 1GLFO 3AVAA 2YNFA 4KHPK 4JKAA 2J4RA 3ZT3A 1KCFA 4I6MB 3SYZA 5M1NA 3MECA 3KLIA 4E1NA 1J54A 5JS2A 3HPGA 3KK3A 1Q9XA 4CZKA 5E26A 2A5XA 4A2BA 2HHHK 1U04A 2XRIA 3SZ2A 1DTQA 4C8KA 3NDKA 2OA8A 3PSFA 1KXPA 3ZSWA 1FJGK 1GLLO 2OCEA 3BY5A 4X66K 2E4LA 3CPEA 5FDLA 3D7EO 2DFFA 3M1FA 2HHQA 4CEBA 3L2WA 5LJWA 1I3AA 4H5RA 4M3RA 1LV5A 1MA9B 4OO1J 2W42A 1DEJA 4DV0K 2PAVA 5AQYA 4GW6A 1BIUA 3TSPA 4TSXA 2YX6A 3P1GA 3LDOA 3ZETA 4Z4EA 3S41A 3SK3A 3HOSA 1P90A 4FOEA 3D0PA 1NGDA 1XC9A 3HRGA 3SUOA 3JYTA 4U7BA 1JXBA 4B9UA 3THWB 1NMDA 1U2VB 3KTQA 3C95A 3CCJN 4H0VB 1KAZA 2IC3A 4IBNA 4O55A 2KFZA 3ZT0A 3L3UA 3OS0A 4KKOA 3MXIA 2UU9K 2G8WA 5AZJB 1VQPN 5F2RA 3AA3A 4M3UA 3FZHA 1W7AA 4DFPA 3JS6A 4DUYK 1D8YA 3OYFA 2RPIA 1KVCA 1C6VA 1DKGD 2A1SA 4BQLA 4ZTJA 1NGJA 4ELTA 3AO3A 2Z1HA 1QQMA 3HSCA 2G8HA 5KGXA 1VSKA 4IO9L 3I0RA 3SNNA 3LDPA 4M7XA 3VQ4A 1S6QA 2VG7A 1NK0A 4KB0A 5JICA 1S6PA 3P31A 1J5OA 4JN4A 4AQYK 1CZBA 4CI6A 3CCRN 5KRSA 1X1PA 1DTTA 2GUIA 1TKZA 4CZIA 4YOVA 2E6MA 5EU7A 3CCMN 1BQNA 4GVMA 1WSIA 1YF5L 4AM6A 1RDCA 2I5JA 3FGUA 1HNZK 3BP8A 4ISFA 1NGAA 1YAGA 3WNFA 3CCVN 3WQUA 3EZWA 3AVJA 1XHZA 4LFAK 2Y1IA 1EXQA 4MO5A 4CJKA 4DSLA 3SI6A 2QXFA 5EX5A 4Z4FA 3MCPA 3CCQN 1RBTA 3CQYA 4DR7K 4YDUA 1Q7YO 4NO7A 4GV6A 4IG0A 1BCOA 5BPNA 5AQTA 2GUPA 4H0XB 1N5YA 2FBTA 1YHQN 4B9LA 3V9SA 1BI4A 2ATQA 3RVCA 5HRNA 3KLGA 5BN9A 3DOLA 5A2QO 3FZKA 4OPJA 3U9ZA 4KH5A 2P9LA 3NF6A 1OKJA 4DU1A 3H46O 2E88A 1BO5O 1NK8A 4GV9A 5LJVA 1QE1A 1NG9A 2HVIA 3NMUA 1QVGM 4J2EA 3L4QA 1BL3A 4DR5K 4WQ4C 4OGCA 4DF4A 4JS4A 4BQZA 2P9PA 3VQ5A 1JLGA 1HMVA 4DTOA 3RRHA 4FJNA 2NRVA 3J8AA 1X3MA 5C2FA 1JCFA 3VTHA 1T7PA 1GOCA
chains in the Genus database with same CATH topology
2YHBA 3RMCA 3BDPA 3O3FA 5DMRA 3KD5E 4EZ6A 4FYDA 1WN7A 4IFYA 1RDBA 4CECA 2HW3A 3AVNA 3BGRA 4CERA 2XY6A 1VSJA 2D5RA 2ETJA 1YT3A 3M8QA 3SCXA 4OGEA 2G8FA 2EHGA 3LAKA 2G8VA 4M3WA 4CGFA 4DTNA 1RT7A 1TKXA 2PZSA 4Y1CA 3VQDA 4DSJA 4E1MA 3ZT1A 3PUFA 1NKCA 2OZSA 4HUEA 1X9WA 3VQ8A 3QIPA 2Z1IA 3MEDA 3DLBA 3SV3A 1UOCA 3VQBA 3TAQA 2HB5A 4CEZA 3LALA 5D3GA 1YTUA 4EZ9A 2Y1JA 2HHXA 2BE2A 2KTQA 4DTPA 1RT2A 4CJEA 1BCMA 1VK0A 3AV9A 3V1RA 4DU3A 3AA5X 3V1QA 3VQAA 2HHTA 2HHWA 3VQQA 3ZCMA 1CXQA 4KV8A 4B9SA 3L2RA 3OS1A 4KHNA 3ZSQA 3CYMA 3HP6A 1S1UA 4C8OA 2O4GA 2X6SA 1RCHA 4PA1A 1ASWA 3HP9A 2VG6A 2Q3SA 5DK5A 5HBMA 3V9ZA 3HK2A 1BGXT 1K6YA 3NAEA 3AVLA 4DWIA 4M3TA 1ASUA 1RTDA 2QKKA 4BWJA 3B6OA 3ITHA 1B9FA 3K5NA 4BDYA 5J2NA 1BQMA 2BGGA 1MU2A 4UQGA 2KW4A 2DY4A 1HPZA 4O44A 4DMNA 3RRGA 3VQ6A 4ICLA 3AO4A 4KTQA 4I9QA 4IG3A 1WSGA 3OY9A 5HRPA 4FJXA 4FJ8A 4DQPA 4RW6A 3NF8A 4PY5A 4CJPA 1UA1A 3LZJA 3WNHA 1Z25A 4EP4A 5J2PA 3KD1E 1WSFA 1CLQA 1NKEA 4C8LA 3K5OA 3RWUA 1WSHA 5J2QA 2ZD1A 4FW2A 1HJRA 2D0AA 4LD0A 3WNEA 4CGHA 4RG8A 3L2VA 4E19A 1TKDA 1HQEA 4OPKA 4K8XA 1NOZA 1JLQA 3NF7A 4FLWA 4OLAA 1ZBIA 3LPUA 1A5XA 1I39A 4CJTA 4KI6A 3OYGA 3ZSXA 4DLGA 3OYHA 1TK5A 4EP5A 1W9HA 4O0IA 3MAQA 4DTUA 4FK4A 4IDKA 3F73A 4FXDA 4CGIA 1VSIA 3T1AA 2EX3A 2HNYA 4KFBA 2P5OA 1FK9A 1RBSA 3P83D 5C42A 4KHWA 4CFBA 1REVA 1GOBA 4Z4GA 4J2AA 3ZT2A 4FJ5A 3M8PA 3AVBA 2HNZA 3S3OA 2XY8A 4BDZA 2IAJA 4CEFA 1B9DA 4CEAA 3EY1A 3TI0A 1KTQA 1C0MA 1T03A 2DFHA 4DSEA 4DU4A 3SQ1A 4OLBA 2OPPA 4CJLA 1SL1A 3ZT4A 5E41A 2HVHA 3HO1A 4JS5A 4AILC 3RMDA 4BACA 4B9MA 1N6QA 1TL3A 4FJKA 4FLXA 4DSIA 4AHTA 4F8RA 3K2PA 3VQ7A 1WNSA 4AHSA 3CFPA 4Z0UA 3SJJA 3S9HA 4CJUA 1ZYQA 2A1RA 4DFMA 1KFDA 1IKWA 4W5RA 3HL8A 5HROA 1NK4A 1T8EA 4NCAA 1JLEA 3AVKA 4CJRA 3EZ5A 2RF2A 1JLCA 1A5WA 3LP2A 3MEEA 4CFDA 3K59A 3HXMA 1VRUA 3QNOA 4B3OA 3LZIA 3LWLA 4FVMA 4KAZA 3PX6A 2G8KA 4N76A 4FM1A 4MFBA 3KKSA 4CHQA 4OKEA 4ELVA 2OPSA 1RBVA 4M3XA 1VSFA 4NCGA 1HYSA 2OYQA 4DTRA 3DM2A 4CEDA 1U4BA 3DLRA 3OYMA 4E7IA 3G0ZA 4CGDA 3SPZA 2YKMA 4C8NA 3NH2A 4BDPA 1FKPA 3A2FA 2P5GA 1S1VA 3G10A 4HHTA 1S9EA 3P5JA 1JLAA 3DRSA 2B6AA 4CF1A 4NYFA 4YNQA 1NKBA 2HHSA 3CG7A 3OVNA 3OYEA 3KJVA 2P1JA 4M41A 3VQCA 4FCYA 3RR8A 3DYAA 1X9SA 1EKEA 4LSNA 5FRMA 3LWMA 1QQCA 5J2MA 1HYVA 1KVBA 1KRPA 4DTJA 1S1TA 3AA2A 3CM6A 3C6UA 3NGIA 4H8KA 4LSLA 2PYJA 1IKXA 1GOAA 1VSDA 4DSLA 4FM0A 2YNGA 3KIOA 4W5NA 2XO7A 2HHVA 3KLFA 3V9UA 4HUGA 3RMAA 3SQ0A 1D9FA 4E89A 1C0TA 1G15A 5HP1A 2ITGA 1C1CA 2JGUA 5SZTA 3HVTA 3OYAA 3ZSZA 2KFNA 3PY8A 1NJXA 4Z4HA 3NCIA 4F3TA 3AVHA 2D0BA 4N41A 1J53A 3PO4A 2IDOA 1A5VA 2D0CA 2WOMA 3AVFA 4DFKA 1TK0A 3KLEA 4BE0A 3NFAA 4B08A 4KB1A 4YFUA 1JKHA 4B9TA 4R5PA 2IGIA 4RW9A 1FKOA 4I2QA 4CIGA 3HSTB 4N56A 1RTJA 4RW7A 1L3TA 4FJGA 2KQ2A 4NCBA 1SL2A 3OJUA 4QOZB 3OYJA 4LH4A 3AO1A 1ZBFA 2P51A 3O4NA 4CK3A 3TARA 4HCCA 1NK9A 4G1QA 2F8SA 1IH7A 4CE9A 4B8AB 4DS4A 3SUNA 3AA4A 4M3ZA 4ZTFA 3CM5A 1WSEA 2HMIA 1D9DA 1ASVA 4B9VA 4Q5VA 4M3YA 4FW1A 4RW4A 3VA3A 3SQ2A 3LP0A 1RT5A 1NOYA 3NE6A 1SL0A 2XHBA 4FZZA 1U47A 1QSYA 3WNGA 4CF9A 3IAYA 3NBPA 4QCLA 1KLMA 3VQPA 4FJHA 5CZ2A 4H4MA 4FJMA 3NGZA 4OKJA 3PV8A 3AVCA 3LANA 4W5TA 3S3NA 2PY5A 3MXMA 3QLHA 1Z26A 3HM9A 3T3FA 3KLHA 4KHYA 1VSMA 1XI1A 4Z4IA 3OYKA 2IS3A 5HRRA 3ASMA 4LH5A 3DRPA 1ITGA 5KTQA 4B9NA 3DLKA 1HRHA 3CFOA 2FBYA 3VQ9A 4F4KA 2HHUA 1BISA 4CJQA 1UAXA 3DRRA 4CJ5A 1KVAA 2JLEA 4CJWA 2RN2A 3TR8A 4M42A 2YHAA 3MEGA 3HVRA 1WSJA 2F96A 5HRSA 3E01A 1JXEA 4CF0A 3K58A 4DQQA 3ULDA 1HNIA 2OPRA 1TK8A 3HJFA 3OYNA 1HNVA 2YNFA 3AVAA 1RDAA 3VQEA 3KK2A 3CFRA 3SUQA 1VSHA 2Z1GA 4AHCA 1S5JA 2E6LA 3ZT3A 1KCFA 1RT3A 1LWEA 4CHOA 3M8RA 4HTUA 3SYZA 3AO5A 3RR7A 3K5MA 3MECA 3IS9A 3OJSA 1S9GA 3KLIA 4E1NA 3OS2A 1J54A 3LP3A 4HUFA 1TVRA 1NJZA 3U3GA 3QINA 4KHSA 3OYDA 5JS2A 3HPGA 3QIOA 4AHRA 4XIUA 3KK3A 3V6DA 4E7LA 1Q9XA 1VSLA 4CJSA 1U04A 1WAFA 2XRIA 3C94A 4O4GA 1DTQA 3SZ2A 4Z4CA 1ZBLA 4CHZA 3NDKA 4C8KA 1TAUA 1BI4B 2PYLA 1KLNA 2DTUA 4BWMA 1FXXA 1HQUA 1VRTA 2OA8A 1XWLA 3O4QA 4DS5A 3NH1A 3B6PA 1SKSA 3QO9A 3RMBA 4IKFA 1Y97A 2F8TA 3ZSWA 3QETA 4J2BA 4E7HA 4FLUA 3TAFA 1X9MA 2E4LA 4JRPA 2KZZA 3ALYA 4AHVA 3V81A 4FLZA 3TAGA 5FDLA 2VG5A 5C25A 2QKBA 3MXJA 4BE2A 1LWFA 4AHUA 3OYLA 1RNHA 2DFFA 3M8SA 3QNNA 3TANA 4FK0A 4CESA 1SKWA 2HHQA 4CEBA 3ZSRA 3V1OA 1IKYA 3L2WA 4FZXC 1I3AA 3U6FA 4M3RA 3O3GA 3L2UA 1LV5A 2W42A 4CF8A 5SWMA 4DLEA 3QEPA 3TWHA 4GW6A 1BIUA 3FFIA 4TSXA 5CYMA 1LW0A 3NHGA 3P1GA 1KSPA 4F3OA 4OJRA 4B8CA 2VWJA 1XHXA 4CHPA 4E3SA 2HNDA 4N5SA 4Z4EA 4E7JA 4LY7A 1IO2A 4MQ3A 4Y1DA 3D0PA 5KI6A 1XC9A 3SUOA 3JYTA 4W5OA 2OZMA 1LAVA 4CGJA 1JXBA 3QEWA 4B9UA 1NJWA 1NJYA 2X74A 3DLHA 4H4OA 2NUBA 1ZBHA 3KTQA 2YNIA 1SUQA 3C95A 3IG1A 3HPOA 1L3SA 4DQIA 1U48A 4PWDA 1JL2A 5C24A 4FZYA 3PX4A 3O3HA 2WONA 2IC3A 2IOCA 1RT1A 4IBNA 2BANA 2B4JA 4O55A 4DF8A 2KFZA 4O0JA 4DFJA 1R0AA 4CF2A 4CJ4A 1NK7A 2G8UA 1C0UA 4ID1A 2O4IA 2GV9A 3ZT0A 4CK1A 1W0HA 3L3UA 1JLFA 3RTVA 3OS0A 4KKOA 3MXIA 4CIEA 5FRNA 3OYCA 3V9XA 2G8WA 3QESA 1WAJA 5KRTA 1C1BA 2RKIA 3ISNC 1YTAA 3AVMA 3AA3A 1RTIA 4M3UA 1ZBUA 3K57A 2GBZA 1L5UA 4DFPA 2X6NA 1D8YA 3TAEA 4FLTA 4FLYA 3OYFA 5I3UA 3UIQA 2RPIA 4M45A 3SPYA 1KVCA 1C6VA 5T7BA 3QERA 2A1SA 1HYZA 3NF9A 3SUPA 4ZTJA 4ELTA 4HCBA 1L3VA 4OKKA 5CZ1A 4JRQA 3AO3A 4E7KA 4PQUA 2Z1HA 4CEEA 4CJFA 4KTZA 2G8HA 1TL1A 5KGXA 4CCHA 4RW8A 1B92A 1VSKA 3JSMA 3L8BA 1RT6A 4CFCA 5HLFA 4F2SA 4FJ7A 3C6TA 3I0RA 1TGOA 3SNNA 1EETA 3NGYA 3VQ4A 1UA0A 2LSNA 1QS4A 3PO5A 1TAQA 1YVUA 1S6QA 3H08A 5FROA 4C8MA 2VG7A 4CK2A 3S3MA 4I7FA 1NK0A 1SKRA 3TABA 5K14A 4KTWA 4N47A 3V9WA 4KB0A 4FJ9A 4DQSA 1S6PA 2YNHA 4DQRA 5J1EA 2KZMA 1JLBA 1J5OA 4KI4A 1BHLA 1RDDA 3F9KA 3QEXA 1CZBA 4QAGA 1CZ9A 3I8DA 5KRSA 1X1PA 1LAWA 2ZQBA 3LP1A 3AO2A 3LPTA 3QEIA 2G8IA 1DTTA 5KGWA 1Q8IA 1TKZA 2GUIA 4IFVA 3VA0A 2E6MA 4FLVA 3DLEA 5EU7A 3V4IA 3DOKA 1UWBA 3ZSOA 4CHYA 1BQNA 4DTMA 2FC0A 4GVMA 3THVA 1WSIA 1IG9A 1VSEA 1RTHA 1QTMA 1RDCA 2I5JA 4PUOA 4DSKA 1QSLA 2B5JA 4CFAA 3CQ8A 4ELUA 4OVLA 1CXUA 3WNFA 1XHZA 3QEVA 4FK2A 3AVJA 4WE1A 1IKVA 2Y1IA 1EXQA 1RT4A 1JL1A 4CJKA 1TV6A 1C1AA 2DFEA 4FM2A 1O1WA 4GMJB 2QXFA 2XY5A 3SI6A 1LWCA 1U45A 1Q9YA 4FJJA 4KHQA 4Z4FA 1RBTA 1KFSA 4KHUA 1BIZA 3T19A 4IG0A 1BCOA 1RBRA 3ZSVA 4KREA 4CHNA 4CEQA 3VN5A 4KO0A 1WLJA 3I0SA 1F21A 3D45A 3LAMA 4ID5A 3HYFA 2OPQA 4O5BA 3TAMA 3L3VA 4L8RB 1N5YA 2VWKA 1NK5A 3K5LA 2FBTA 1D5AA 1S1XA 3HT3A 1T05A 3EYZA 1U49A 1NK6A 4B9LA 2BDPA 3V9SA 4NYNA 3KK1A 1BI4A 2ATQA 3DLGA 3DMJA 5HRNA 3KLGA 2R7YA 1QSSA 2AJQA 3DOLA 2ZE2A 3PX0A 3NH0A 4K8ZA 4F2RA 4OPJA 3HPHA 3AVGA 4KPYA 4Q0BA 3SV4A 3TAPA 3KKRA 1SV5A 5JS1A 3NF6A 1J9AA 2YKNA 4W5QA 4DTXA 4I2PA 1TKTA 4CJ3A 2FBVA 1RBUA 5CYQA 4DU1A 3SQ4A 1QHTA 3IRXA 4I9LA 1L3UA 1NK8A 2X78A 3OYBA 1RILA 2FBXA 4FJLA 1EP4A 3LDSA 1QE1A 2HVIA 4ZHRA 4J2EA 4J2DA 1LW2A 1BL3A 1DLOA 4JLHA 4DF4A 4OGCA 4DSFA 4JS4A 4HVJA 4AH9A 3U3YA 1EX4A 3VQ5A 4CEOA 1JLGA 2Z1JA 1S1WA 2QK9A 3ZSYA 1HMVA 3OYIA 4DTOA 3RRHA 4FJNA 3L2QA 2YV0X 3DI6A 5I42A 4CGGA 4KRFA 4DTSA 5CY4A 4E0DA 4BE1A 4DG1A 4CJVA 4FJIA 1T7PA 3AVIA 4CIFA 2XY7A 1GOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHB A;  3RMC A;  3BDP A;  3O3F A;  5DMR A;  3KD5 E;  4EZ6 A;  4FYD A;  1WN7 A;  4IFY A;  1RDB A;  4CEC A;  2HW3 A;  3AVN A;  3BGR A;  4CER A;  2XY6 A;  1VSJ A;  2D5R A;  2ETJ A;  1YT3 A;  3M8Q A;  3SCX A;  4OGE A;  2G8F A;  2EHG A;  3LAK A;  2G8V A;  4M3W A;  4CGF A;  4DTN A;  1RT7 A;  1TKX A;  2PZS A;  4Y1C A;  3VQD A;  4DSJ A;  4E1M A;  3ZT1 A;  3PUF A;  1NKC A;  2OZS A;  4HUE A;  1X9W A;  3VQ8 A;  3QIP A;  2Z1I A;  3MED A;  3DLB A;  3SV3 A;  1UOC A;  3VQB A;  3TAQ A;  2HB5 A;  4CEZ A;  3LAL A;  5D3G A;  1YTU A;  4EZ9 A;  2Y1J A;  2HHX A;  2BE2 A;  2KTQ A;  4DTP A;  1RT2 A;  4CJE A;  1BCM A;  1VK0 A;  3AV9 A;  3V1R A;  4DU3 A;  3AA5 X;  3V1Q A;  3VQA A;  2HHT A;  2HHW A;  3VQQ A;  3ZCM A;  1CXQ A;  4KV8 A;  4B9S A;  3L2R A;  3OS1 A;  4KHN A;  3ZSQ A;  3CYM A;  3HP6 A;  1S1U A;  4C8O A;  2O4G A;  2X6S A;  1RCH A;  4PA1 A;  1ASW A;  3HP9 A;  2VG6 A;  2Q3S A;  5DK5 A;  5HBM A;  3V9Z A;  3HK2 A;  1BGX T;  1K6Y A;  3NAE A;  3AVL A;  4DWI A;  4M3T A;  1ASU A;  1RTD A;  2QKK A;  4BWJ A;  3B6O A;  3ITH A;  1B9F A;  3K5N A;  4BDY A;  5J2N A;  1BQM A;  2BGG A;  1MU2 A;  4UQG A;  2KW4 A;  2DY4 A;  1HPZ A;  4O44 A;  4DMN A;  3RRG A;  3VQ6 A;  4ICL A;  3AO4 A;  4KTQ A;  4I9Q A;  4IG3 A;  1WSG A;  3OY9 A;  5HRP A;  4FJX A;  4FJ8 A;  4DQP A;  4RW6 A;  3NF8 A;  4PY5 A;  4CJP A;  1UA1 A;  3LZJ A;  3WNH A;  1Z25 A;  4EP4 A;  5J2P A;  3KD1 E;  1WSF A;  1CLQ A;  1NKE A;  4C8L A;  3K5O A;  3RWU A;  1WSH A;  5J2Q A;  2ZD1 A;  4FW2 A;  1HJR A;  2D0A A;  4LD0 A;  3WNE A;  4CGH A;  4RG8 A;  3L2V A;  4E19 A;  1TKD A;  1HQE A;  4OPK A;  4K8X A;  1NOZ A;  1JLQ A;  3NF7 A;  4FLW A;  4OLA A;  1ZBI A;  3LPU A;  1A5X A;  1I39 A;  4CJT A;  4KI6 A;  3OYG A;  3ZSX A;  4DLG A;  3OYH A;  1TK5 A;  4EP5 A;  1W9H A;  4O0I A;  3MAQ A;  4DTU A;  4FK4 A;  4IDK A;  3F73 A;  4FXD A;  4CGI A;  1VSI A;  3T1A A;  2EX3 A;  2HNY A;  4KFB A;  2P5O A;  1FK9 A;  1RBS A;  3P83 D;  5C42 A;  4KHW A;  4CFB A;  1REV A;  1GOB A;  4Z4G A;  4J2A A;  3ZT2 A;  4FJ5 A;  3M8P A;  3AVB A;  2HNZ A;  3S3O A;  2XY8 A;  4BDZ A;  2IAJ A;  4CEF A;  1B9D A;  4CEA A;  3EY1 A;  3TI0 A;  1KTQ A;  1C0M A;  1T03 A;  2DFH A;  4DSE A;  4DU4 A;  3SQ1 A;  4OLB A;  2OPP A;  4CJL A;  1SL1 A;  3ZT4 A;  5E41 A;  2HVH A;  3HO1 A;  4JS5 A;  4AIL C;  3RMD A;  4BAC A;  4B9M A;  1N6Q A;  1TL3 A;  4FJK A;  4FLX A;  4DSI A;  4AHT A;  4F8R A;  3K2P A;  3VQ7 A;  1WNS A;  4AHS A;  3CFP A;  4Z0U A;  3SJJ A;  3S9H A;  4CJU A;  1ZYQ A;  2A1R A;  4DFM A;  1KFD A;  1IKW A;  4W5R A;  3HL8 A;  5HRO A;  1NK4 A;  1T8E A;  4NCA A;  1JLE A;  3AVK A;  4CJR A;  3EZ5 A;  2RF2 A;  1JLC A;  1A5W A;  3LP2 A;  3MEE A;  4CFD A;  3K59 A;  3HXM A;  1VRU A;  3QNO A;  4B3O A;  3LZI A;  3LWL A;  4FVM A;  4KAZ A;  3PX6 A;  2G8K A;  4N76 A;  4FM1 A;  4MFB A;  3KKS A;  4CHQ A;  4OKE A;  4ELV A;  2OPS A;  1RBV A;  4M3X A;  1VSF A;  4NCG A;  1HYS A;  2OYQ A;  4DTR A;  3DM2 A;  4CED A;  1U4B A;  3DLR A;  3OYM A;  4E7I A;  3G0Z A;  4CGD A;  3SPZ A;  2YKM A;  4C8N A;  3NH2 A;  4BDP A;  1FKP A;  3A2F A;  2P5G A;  1S1V A;  3G10 A;  4HHT A;  1S9E A;  3P5J A;  1JLA A;  3DRS A;  2B6A A;  4CF1 A;  4NYF A;  4YNQ A;  1NKB A;  2HHS A;  3CG7 A;  3OVN A;  3OYE A;  3KJV A;  2P1J A;  4M41 A;  3VQC A;  4FCY A;  3RR8 A;  3DYA A;  1X9S A;  1EKE A;  4LSN A;  5FRM A;  3LWM A;  1QQC A;  5J2M A;  1HYV A;  1KVB A;  1KRP A;  4DTJ A;  1S1T A;  3AA2 A;  3CM6 A;  3C6U A;  3NGI A;  4H8K A;  4LSL A;  2PYJ A;  1IKX A;  1GOA A;  1VSD A;  4DSL A;  4FM0 A;  2YNG A;  3KIO A;  4W5N A;  2XO7 A;  2HHV A;  3KLF A;  3V9U A;  4HUG A;  3RMA A;  3SQ0 A;  1D9F A;  4E89 A;  1C0T A;  1G15 A;  5HP1 A;  2ITG A;  1C1C A;  2JGU A;  5SZT A;  3HVT A;  3OYA A;  3ZSZ A;  2KFN A;  3PY8 A;  1NJX A;  4Z4H A;  3NCI A;  4F3T A;  3AVH A;  2D0B A;  4N41 A;  1J53 A;  3PO4 A;  2IDO A;  1A5V A;  2D0C A;  2WOM A;  3AVF A;  4DFK A;  1TK0 A;  3KLE A;  4BE0 A;  3NFA A;  4B08 A;  4KB1 A;  4YFU A;  1JKH A;  4B9T A;  4R5P A;  2IGI A;  4RW9 A;  1FKO A;  4I2Q A;  4CIG A;  3HST B;  4N56 A;  1RTJ A;  4RW7 A;  1L3T A;  4FJG A;  2KQ2 A;  4NCB A;  1SL2 A;  3OJU A;  4QOZ B;  3OYJ A;  4LH4 A;  3AO1 A;  1ZBF A;  2P51 A;  3O4N A;  4CK3 A;  3TAR A;  4HCC A;  1NK9 A;  4G1Q A;  2F8S A;  1IH7 A;  4CE9 A;  4B8A B;  4DS4 A;  3SUN A;  3AA4 A;  4M3Z A;  4ZTF A;  3CM5 A;  1WSE A;  2HMI A;  1D9D A;  1ASV A;  4B9V A;  4Q5V A;  4M3Y A;  4FW1 A;  4RW4 A;  3VA3 A;  3SQ2 A;  3LP0 A;  1RT5 A;  1NOY A;  3NE6 A;  1SL0 A;  2XHB A;  4FZZ A;  1U47 A;  1QSY A;  3WNG A;  4CF9 A;  3IAY A;  3NBP A;  4QCL A;  1KLM A;  3VQP A;  4FJH A;  5CZ2 A;  4H4M A;  4FJM A;  3NGZ A;  4OKJ A;  3PV8 A;  3AVC A;  3LAN A;  4W5T A;  3S3N A;  2PY5 A;  3MXM A;  3QLH A;  1Z26 A;  3HM9 A;  3T3F A;  3KLH A;  4KHY A;  1VSM A;  1XI1 A;  4Z4I A;  3OYK A;  2IS3 A;  5HRR A;  3ASM A;  4LH5 A;  3DRP A;  1ITG A;  5KTQ A;  4B9N A;  3DLK A;  1HRH A;  3CFO A;  2FBY A;  3VQ9 A;  4F4K A;  2HHU A;  1BIS A;  4CJQ A;  1UAX A;  3DRR A;  4CJ5 A;  1KVA A;  2JLE A;  4CJW A;  2RN2 A;  3TR8 A;  4M42 A;  2YHA A;  3MEG A;  3HVR A;  1WSJ A;  2F96 A;  5HRS A;  3E01 A;  1JXE A;  4CF0 A;  3K58 A;  4DQQ A;  3ULD A;  1HNI A;  2OPR A;  1TK8 A;  3HJF A;  3OYN A;  1HNV A;  2YNF A;  3AVA A;  1RDA A;  3VQE A;  3KK2 A;  3CFR A;  3SUQ A;  1VSH A;  2Z1G A;  4AHC A;  1S5J A;  2E6L A;  3ZT3 A;  1KCF A;  1RT3 A;  1LWE A;  4CHO A;  3M8R A;  4HTU A;  3SYZ A;  3AO5 A;  3RR7 A;  3K5M A;  3MEC A;  3IS9 A;  3OJS A;  1S9G A;  3KLI A;  4E1N A;  3OS2 A;  1J54 A;  3LP3 A;  4HUF A;  1TVR A;  1NJZ A;  3U3G A;  3QIN A;  4KHS A;  3OYD A;  5JS2 A;  3HPG A;  3QIO A;  4AHR A;  4XIU A;  3KK3 A;  3V6D A;  4E7L A;  1Q9X A;  1VSL A;  4CJS A;  1U04 A;  1WAF A;  2XRI A;  3C94 A;  4O4G A;  1DTQ A;  3SZ2 A;  4Z4C A;  1ZBL A;  4CHZ A;  3NDK A;  4C8K A;  1TAU A;  1BI4 B;  2PYL A;  1KLN A;  2DTU A;  4BWM A;  1FXX A;  1HQU A;  1VRT A;  2OA8 A;  1XWL A;  3O4Q A;  4DS5 A;  3NH1 A;  3B6P A;  1SKS A;  3QO9 A;  3RMB A;  4IKF A;  1Y97 A;  2F8T A;  3ZSW A;  3QET A;  4J2B A;  4E7H A;  4FLU A;  3TAF A;  1X9M A;  2E4L A;  4JRP A;  2KZZ A;  3ALY A;  4AHV A;  3V81 A;  4FLZ A;  3TAG A;  5FDL A;  2VG5 A;  5C25 A;  2QKB A;  3MXJ A;  4BE2 A;  1LWF A;  4AHU A;  3OYL A;  1RNH A;  2DFF A;  3M8S A;  3QNN A;  3TAN A;  4FK0 A;  4CES A;  1SKW A;  2HHQ A;  4CEB A;  3ZSR A;  3V1O A;  1IKY A;  3L2W A;  4FZX C;  1I3A A;  3U6F A;  4M3R A;  3O3G A;  3L2U A;  1LV5 A;  2W42 A;  4CF8 A;  5SWM A;  4DLE A;  3QEP A;  3TWH A;  4GW6 A;  1BIU A;  3FFI A;  4TSX A;  5CYM A;  1LW0 A;  3NHG A;  3P1G A;  1KSP A;  4F3O A;  4OJR A;  4B8C A;  2VWJ A;  1XHX A;  4CHP A;  4E3S A;  2HND A;  4N5S A;  4Z4E A;  4E7J A;  4LY7 A;  1IO2 A;  4MQ3 A;  4Y1D A;  3D0P A;  5KI6 A;  1XC9 A;  3SUO A;  3JYT A;  4W5O A;  2OZM A;  1LAV A;  4CGJ A;  1JXB A;  3QEW A;  4B9U A;  1NJW A;  1NJY A;  2X74 A;  3DLH A;  4H4O A;  2NUB A;  1ZBH A;  3KTQ A;  2YNI A;  1SUQ A;  3C95 A;  3IG1 A;  3HPO A;  1L3S A;  4DQI A;  1U48 A;  4PWD A;  1JL2 A;  5C24 A;  4FZY A;  3PX4 A;  3O3H A;  2WON A;  2IC3 A;  2IOC A;  1RT1 A;  4IBN A;  2BAN A;  2B4J A;  4O55 A;  4DF8 A;  2KFZ A;  4O0J A;  4DFJ A;  1R0A A;  4CF2 A;  4CJ4 A;  1NK7 A;  2G8U A;  1C0U A;  4ID1 A;  2O4I A;  2GV9 A;  3ZT0 A;  4CK1 A;  1W0H A;  3L3U A;  1JLF A;  3RTV A;  3OS0 A;  4KKO A;  3MXI A;  4CIE A;  5FRN A;  3OYC A;  3V9X A;  2G8W A;  3QES A;  1WAJ A;  5KRT A;  1C1B A;  2RKI A;  3ISN C;  1YTA A;  3AVM A;  3AA3 A;  1RTI A;  4M3U A;  1ZBU A;  3K57 A;  2GBZ A;  1L5U A;  4DFP A;  2X6N A;  1D8Y A;  3TAE A;  4FLT A;  4FLY A;  3OYF A;  5I3U A;  3UIQ A;  2RPI A;  4M45 A;  3SPY A;  1KVC A;  1C6V A;  5T7B A;  3QER A;  2A1S A;  1HYZ A;  3NF9 A;  3SUP A;  4ZTJ A;  4ELT A;  4HCB A;  1L3V A;  4OKK A;  5CZ1 A;  4JRQ A;  3AO3 A;  4E7K A;  4PQU A;  2Z1H A;  4CEE A;  4CJF A;  4KTZ A;  2G8H A;  1TL1 A;  5KGX A;  4CCH A;  4RW8 A;  1B92 A;  1VSK A;  3JSM A;  3L8B A;  1RT6 A;  4CFC A;  5HLF A;  4F2S A;  4FJ7 A;  3C6T A;  3I0R A;  1TGO A;  3SNN A;  1EET A;  3NGY A;  3VQ4 A;  1UA0 A;  2LSN A;  1QS4 A;  3PO5 A;  1TAQ A;  1YVU A;  1S6Q A;  3H08 A;  5FRO A;  4C8M A;  2VG7 A;  4CK2 A;  3S3M A;  4I7F A;  1NK0 A;  1SKR A;  3TAB A;  5K14 A;  4KTW A;  4N47 A;  3V9W A;  4KB0 A;  4FJ9 A;  4DQS A;  1S6P A;  2YNH A;  4DQR A;  5J1E A;  2KZM A;  1JLB A;  1J5O A;  4KI4 A;  1BHL A;  1RDD A;  3F9K A;  3QEX A;  1CZB A;  4QAG A;  1CZ9 A;  3I8D A;  5KRS A;  1X1P A;  1LAW A;  2ZQB A;  3LP1 A;  3AO2 A;  3LPT A;  3QEI A;  2G8I A;  1DTT A;  5KGW A;  1Q8I A;  1TKZ A;  2GUI A;  4IFV A;  3VA0 A;  2E6M A;  4FLV A;  3DLE A;  5EU7 A;  3V4I A;  3DOK A;  1UWB A;  3ZSO A;  4CHY A;  1BQN A;  4DTM A;  2FC0 A;  4GVM A;  3THV A;  1WSI A;  1IG9 A;  1VSE A;  1RTH A;  1QTM A;  1RDC A;  2I5J A;  4PUO A;  4DSK A;  1QSL A;  2B5J A;  4CFA A;  3CQ8 A;  4ELU A;  4OVL A;  1CXU A;  3WNF A;  1XHZ A;  3QEV A;  4FK2 A;  3AVJ A;  4WE1 A;  1IKV A;  2Y1I A;  1EXQ A;  1RT4 A;  1JL1 A;  4CJK A;  1TV6 A;  1C1A A;  2DFE A;  4FM2 A;  1O1W A;  4GMJ B;  2QXF A;  2XY5 A;  3SI6 A;  1LWC A;  1U45 A;  1Q9Y A;  4FJJ A;  4KHQ A;  4Z4F A;  1RBT A;  1KFS A;  4KHU A;  1BIZ A;  3T19 A;  4IG0 A;  1BCO A;  1RBR A;  3ZSV A;  4KRE A;  4CHN A;  4CEQ A;  3VN5 A;  4KO0 A;  1WLJ A;  3I0S A;  1F21 A;  3D45 A;  3LAM A;  4ID5 A;  3HYF A;  2OPQ A;  4O5B A;  3TAM A;  3L3V A;  4L8R B;  1N5Y A;  2VWK A;  1NK5 A;  3K5L A;  2FBT A;  1D5A A;  1S1X A;  3HT3 A;  1T05 A;  3EYZ A;  1U49 A;  1NK6 A;  4B9L A;  2BDP A;  3V9S A;  4NYN A;  3KK1 A;  1BI4 A;  2ATQ A;  3DLG A;  3DMJ A;  5HRN A;  3KLG A;  2R7Y A;  1QSS A;  2AJQ A;  3DOL A;  2ZE2 A;  3PX0 A;  3NH0 A;  4K8Z A;  4F2R A;  4OPJ A;  3HPH A;  3AVG A;  4KPY A;  4Q0B A;  3SV4 A;  3TAP A;  3KKR A;  1SV5 A;  5JS1 A;  3NF6 A;  1J9A A;  2YKN A;  4W5Q A;  4DTX A;  4I2P A;  1TKT A;  4CJ3 A;  2FBV A;  1RBU A;  5CYQ A;  4DU1 A;  3SQ4 A;  1QHT A;  3IRX A;  4I9L A;  1L3U A;  1NK8 A;  2X78 A;  3OYB A;  1RIL A;  2FBX A;  4FJL A;  1EP4 A;  3LDS A;  1QE1 A;  2HVI A;  4ZHR A;  4J2E A;  4J2D A;  1LW2 A;  1BL3 A;  1DLO A;  4JLH A;  4DF4 A;  4OGC A;  4DSF A;  4JS4 A;  4HVJ A;  4AH9 A;  3U3Y A;  1EX4 A;  3VQ5 A;  4CEO A;  1JLG A;  2Z1J A;  1S1W A;  2QK9 A;  3ZSY A;  1HMV A;  3OYI A;  4DTO A;  3RRH A;  4FJN A;  3L2Q A;  2YV0 X;  3DI6 A;  5I42 A;  4CGG A;  4KRF A;  4DTS A;  5CY4 A;  4E0D A;  4BE1 A;  4DG1 A;  4CJV A;  4FJI A;  1T7P A;  3AVI A;  4CIF A;  2XY7 A;  1GOC A; 
#chains in the Genus database with same CATH topology
 3J7A P;  2YHB A;  3RMC A;  3BDP A;  3DXM B;  1YIJ N;  2FF3 B;  1WN7 A;  3VF2 A;  4CEC A;  3AVN A;  3OW2 M;  4LF9 K;  2XY6 A;  1YT3 A;  2RE2 A;  4FO0 A;  2W40 A;  4XH5 A;  2G8F A;  5C0Y A;  3VGM A;  3E1Y A;  1HNX K;  4JKE A;  1VQ9 N;  1TKX A;  4Y1C A;  2V7Z A;  3ZT1 A;  3PUF A;  3I56 N;  2OZS A;  4HUE A;  3TTF A;  3CCE N;  3SV3 A;  3ZEU A;  4B1V A;  5AQM A;  2YCH A;  3RSE A;  4BRL A;  3C6H A;  3LAL A;  1YTU A;  2HHX A;  2BE2 A;  3DJC A;  3AV9 A;  3V1R A;  2OTJ N;  2HHT A;  3I8B A;  2HHW A;  4G9Z A;  1GLB G;  3IFR A;  2O4G A;  5HBM A;  3HP9 A;  3HK2 A;  1BGX T;  3WEE A;  4BRN A;  3AVL A;  3CD6 N;  4M3T A;  1RTD A;  2QKK A;  4BDY A;  2BGG A;  2DY4 A;  3U9D A;  3VEN A;  1HPZ A;  2P9L B;  2ZJP L;  3AY9 A;  5M1F A;  4HTL A;  4FJ8 A;  1WSG A;  4FJX A;  5HRP A;  4DQP A;  3SBT A;  3DXK A;  4JHD B;  4CJP A;  1X9J A;  4DHY A;  1UA1 A;  1Z25 A;  5J2P A;  4YOX A;  1BU6 O;  5J2Q A;  4FW2 A;  1TKD A;  1G99 A;  5FRM A;  3L2V A;  4E19 A;  3LDL A;  4OPK A;  1JJ2 M;  4A5A A;  2O8C A;  1JLQ A;  4FLW A;  3F5T A;  5F0X A;  1U6Z A;  4CJT A;  4DLG A;  1TK5 A;  5TKY A;  1W9H A;  2KKZ A;  4O0I A;  3FZL A;  4FWK A;  3T1A A;  5KPZ A;  2UXD K;  4KFB A;  4CD1 A;  1RBS A;  3O5B A;  2FXU A;  5AQI A;  4Z4G A;  3UKU B;  4J2A A;  1MDU B;  2XY8 A;  2IAJ A;  2ASO A;  4CD3 A;  4BRD A;  3TI0 A;  4NLC A;  1C0M A;  1S72 N;  1ILY A;  1SL1 A;  4JS5 A;  2P9I B;  1YUW A;  4B9M A;  1N6Q A;  4FJK A;  2V51 B;  4AHT A;  1S22 A;  4F8R A;  1JCG A;  4AHS A;  3CFP A;  4JI5 K;  4CJU A;  3UE5 A;  1XNQ K;  2CH5 A;  1ZYQ A;  2A1R A;  1NK4 A;  1KFD A;  4QS8 A;  5ADX A;  3ATV A;  1JLE A;  4NCA A;  5JVG L;  3AVK A;  2RF2 A;  2ZGZ A;  1XMO K;  4K42 A;  5BRD A;  5FPD A;  2G8K A;  4N76 A;  4MFB A;  4FWQ A;  5KPT A;  1HYS A;  2E2O A;  3T1Y K;  4LF8 K;  3ZLJ A;  3THX A;  4E7I A;  5JLF A;  3DWL A;  3MX2 A;  5KQD A;  3G10 A;  4GKK K;  1OH8 A;  2B6A A;  1VQ8 N;  3OVN A;  4M41 A;  4FCY A;  5AQK A;  4B1Z A;  1KVB A;  4DTJ A;  5M1P A;  1R59 O;  3P4I A;  4IEI A;  2PYJ A;  4BRI A;  2HBM A;  4YDU C;  3V9U A;  3RMA A;  4E89 A;  1C0T A;  1G15 A;  1U2V A;  5HP1 A;  3OTO K;  3OYA A;  4B1Y B;  2KFN A;  4Z4H A;  4F3T A;  3W0L A;  4BR9 A;  1K9M O;  4F9O A;  2IDO A;  3AVF A;  3NFA A;  3T69 A;  4YFU A;  1JKH A;  2IGI A;  4GY2 B;  4IJA A;  3ATU A;  3HST B;  3PIO L;  2NRH A;  4RW7 A;  4FJG A;  3TTC A;  3OJU A;  4LFC K;  2KHO A;  2KLA A;  2FSJ A;  2F8S A;  5TKW A;  3IUC A;  1NK9 A;  4G1Q A;  4CE9 A;  3CM5 A;  2ZF5 O;  5AQH A;  4OX9 K;  4B9V A;  4M3Y A;  3A5N C;  3SQ2 A;  3LP0 A;  3NBP A;  4QCL A;  4XEI A;  3UKU A;  1HLU A;  3S3N A;  2PY5 A;  1BOT O;  3QLH A;  3KVG A;  5GAE P;  3O9U A;  4BR2 A;  5HRR A;  1OVY A;  3I33 A;  5KTQ A;  4B9N A;  3VQ9 A;  5AZI B;  3R9P A;  3LDN A;  1IBL K;  1KVA A;  2RN2 A;  3TR8 A;  3NVK A;  4M42 A;  2YHA A;  2F96 A;  4DCH A;  4PL7 A;  1TK8 A;  2A40 A;  3VQE A;  1T6D A;  3TPQ A;  4V19 S;  4JK7 A;  4RWT A;  4JHD A;  3JAM O;  1XNR K;  5C2D A;  3M8R A;  4HTU A;  1XQS C;  4LF7 K;  3KHY A;  3U3G A;  3QIN A;  4KHS A;  3OYD A;  4XIU A;  2W6L A;  4JK8 A;  5AFU H;  4WQ5 A;  1EQY A;  1WAF A;  1ZBL A;  3C94 A;  4CHZ A;  3WEE B;  1RDW X;  2UUB K;  1KLN A;  2DTU A;  3ENO A;  3GL1 A;  4BRG A;  1XWL A;  3O4Q A;  1HKB A;  3RSE B;  3M5R A;  4BRK A;  2F8T A;  4JK9 A;  2IIR A;  3BF1 A;  2A3Z A;  4E7H A;  3TAF A;  4JRP A;  2KZZ A;  3V81 A;  3ZEU B;  4JV5 K;  1HUX A;  3M8S A;  1RNH A;  5AQO A;  1OVQ A;  4FZX C;  3U6F A;  5SWM A;  4DLE A;  4BRH A;  5LMN K;  5LL6 Z;  4F3O A;  4IFE A;  4B8C A;  3CCL N;  4E3S A;  1VHX A;  2NLX A;  4RCH A;  5FLX O;  3ULE B;  3DXM A;  5KI6 A;  1K8A O;  1LAV A;  4BRO A;  3BEX A;  3H6E A;  4E1J A;  2X74 A;  3DLH A;  4H4O A;  1SUQ A;  4JI6 K;  1NGF A;  1Q82 O;  5C24 A;  2PBD A;  4FZY A;  5GIP A;  4IOC L;  3CQX A;  4H0O A;  4DF8 A;  4DFJ A;  1R0A A;  3QB0 A;  2O4I A;  1EO1 A;  2GV9 A;  3MN5 A;  4BC5 A;  5H1S Q;  4CK1 A;  5EOY A;  4GV3 A;  5FRN A;  3OYC A;  3D2F B;  1WAJ A;  1C1B A;  3ISN C;  1C0F A;  3K57 A;  1GLA G;  1OH6 A;  3TAE A;  3UIQ A;  3CC7 N;  3SPY A;  3Q7C A;  1HYZ A;  3NF9 A;  1NGI A;  3O08 A;  1L3V A;  4OKK A;  5CZ1 A;  4PQU A;  4C1N K;  3JXU A;  2QWL A;  1O13 A;  2E20 A;  3VEV A;  1WOQ A;  5ELZ A;  4RW8 A;  1B92 A;  4FJ7 A;  3AGR A;  4CFC A;  4WYB A;  3C6T A;  4PKG A;  3O1B A;  3NGY A;  2E1Y A;  1YVU A;  2VGN A;  1HPM A;  2VQE K;  5IT9 O;  3WT0 A;  4DQS A;  1JLB A;  4KI4 A;  1RDD A;  4QAG A;  3CIP A;  1IG8 A;  4JI2 K;  3R6M A;  1LAW A;  2ZQB A;  3G25 A;  3SMP A;  4K43 A;  2G8I A;  1QHA A;  4IFV A;  3V4I A;  3ZSO A;  1BG3 A;  4JEP A;  3P39 A;  1CZA N;  3KWI A;  5AQL A;  2B5J A;  1CXU A;  4WE1 A;  1IKV A;  5C15 A;  1RT4 A;  5HL7 L;  4FM2 A;  1C1A A;  2XY5 A;  4FJJ A;  4PY5 A;  3BF3 A;  5ADX H;  4KHQ A;  2D0O A;  3VF4 A;  4PL8 A;  3EKS A;  3EEQ A;  4H0P A;  1RFQ A;  4CEQ A;  4KO0 A;  4ID5 A;  4O5B A;  1F21 A;  3HYF A;  2OPQ A;  3PSI A;  2VWK A;  3K5L A;  3HT3 A;  4B1U B;  1T05 A;  3FFK B;  3EKU A;  2BDP A;  3DMJ A;  4L3Q A;  2R7Y A;  2AJQ A;  4K8Z A;  4F2R A;  3HPH A;  3AVG A;  3SV4 A;  1T6C A;  4JI7 K;  3WXJ A;  2VQF K;  5JS1 A;  2YKN A;  4DTX A;  1N32 K;  4I2P A;  3GOI A;  4C1N I;  2FBV A;  3P38 A;  1QHT A;  1J5E K;  3IRX A;  4I9L A;  5CE3 A;  1EP4 A;  3WXI A;  3B8A X;  4JD2 A;  4J2D A;  2QA4 N;  4DSF A;  4HVJ A;  4CEO A;  2Z1J A;  4PHT X;  3ZX3 A;  1TYQ B;  3PLA A;  5I42 A;  4CGG A;  4KRF A;  3K9K A;  3THW A;  3WXK A;  1E4F T;  2FSN A;  3AVI A;  4CIF A;  4FJI A;  1ATN A;  3G6E N;  3E66 A;  4FYD A;  3HI0 A;  1RDB A;  3IMX A;  4IFY A;  3ZET B;  2O8B A;  4CER A;  4CZG A;  3M8Q A;  4OGE A;  2P9I A;  4M3W A;  3E9L A;  3SAH A;  3ZX0 A;  3I55 N;  1VQ7 N;  3VQ8 A;  2Z1I A;  3MED A;  4BRE A;  3VQB A;  5D3G A;  5M1O A;  1N33 K;  2OTL N;  5AQG A;  3ZCM A;  4BVP A;  3CYM A;  1YVN A;  4C8O A;  5DK5 A;  2O8C B;  3VTI A;  2Q3S A;  3NAE A;  3B6O A;  3ITH A;  3K5N A;  4BG9 A;  1MU2 A;  3RRG A;  4JKG A;  4ICL A;  4DR4 K;  4IOA L;  3QBW A;  3KZB A;  1VQM N;  1NGB A;  2ZJR L;  3BZK A;  4CVN E;  1SZ2 A;  1XUP O;  2E5L K;  4C8L A;  3K5O A;  3RWU A;  1WSH A;  2UUA K;  2ZD1 A;  2D0A A;  4CGH A;  3NF7 A;  1SQK A;  5CR4 A;  4KI6 A;  4JAX A;  3WXL A;  1EWQ A;  4FK4 A;  4CGI A;  1FK9 A;  5C42 A;  1REV A;  1GOB A;  3M8P A;  3EE8 A;  3AVB A;  1YXQ A;  4BDZ A;  4WFB L;  4CEF A;  1B9D A;  3ENH A;  3VPZ A;  2DFH A;  4BC2 A;  3SQ1 A;  4JI3 K;  4OLB A;  5AQP A;  3ZT4 A;  5E41 A;  2HVH A;  4AIL C;  3C7N A;  3RMD A;  4BAC A;  4YHH K;  3O9T A;  1TL3 A;  4FLX A;  1GLE G;  4DSI A;  2P9N B;  1WNS A;  2CH6 A;  4FWP A;  3EZ5 A;  3K59 A;  4DV6 K;  2W6K A;  3LWL A;  1HX1 A;  2I7P A;  4FVM A;  4YOR A;  4KAZ A;  5BRH A;  4FM1 A;  3CMA N;  5MLC Q;  2CGL A;  2DPN A;  1YIT N;  3U4L A;  2Q1N A;  3OYM A;  2ZJQ L;  4GVE A;  3NH2 A;  4BDP A;  1FKP A;  1S1V A;  4LC9 B;  1JLA A;  3DRS A;  4CF1 A;  2Q0U A;  1NKB A;  1V4S A;  2D0P A;  3CG7 A;  3H45 C;  4DR2 K;  4O8U A;  1X9S A;  1QQC A;  3N4Q A;  1KRP A;  3HM8 A;  4CZL A;  1IJJ A;  2ZM6 K;  3NGI A;  3CC2 N;  2Q2R A;  4IEE A;  4FM0 A;  2D1K A;  2YNG A;  3KIO A;  2XO7 A;  3KLF A;  4HUG A;  4LF4 K;  4EAH D;  2JGU A;  3HVT A;  3ZSZ A;  1NJX A;  2NRW A;  2VCP A;  3AVH A;  5AZI A;  3ID8 A;  3UKR A;  1DGK N;  1A5V A;  2WOM A;  1TK0 A;  1ATR A;  3MK6 A;  3KLE A;  4BE0 A;  3O9S A;  5BPL A;  4RW9 A;  4MLE A;  1HR0 K;  3QFP A;  1K8K A;  3M3Z A;  2KQ2 A;  3FZF A;  2O8E B;  4BRC A;  2O8E A;  2NRX A;  3O4N A;  2VGM A;  1K8K B;  4K0K K;  4DQ8 A;  4B8A B;  4M3Z A;  4ZTF A;  2F9W A;  4CBU A;  3U8X A;  4FW1 A;  3VA3 A;  1RDU A;  3WNG A;  5F1X A;  1KLM A;  5CZ2 A;  4FJM A;  1YJN N;  4H5T A;  3MXM A;  3T3F A;  4Z4I A;  2P9S A;  4DUZ K;  2IS3 A;  1D4X A;  1ITG A;  4FSV A;  3DLK A;  5FPE A;  3MDQ A;  4FPA A;  4CJ5 A;  4K41 A;  1W2B M;  2BTF A;  3R3L A;  4JKH A;  4BR7 A;  3HVR A;  4CBW A;  1JXE A;  4DQQ A;  1HNI A;  2OPR A;  3HJF A;  1HNV A;  4CW7 B;  4JD2 B;  1VSH A;  2Z1G A;  4AHC A;  1S5J A;  1FW6 A;  5AQN A;  2E6L A;  1E4G T;  1ZBS A;  1LWE A;  3AO5 A;  4FWS A;  1QQN A;  3VEX A;  1S9G A;  4ISG A;  3OS2 A;  2W41 A;  3FZM A;  2E8A A;  4HUF A;  1TVR A;  4AHR A;  3V6D A;  1TAU A;  4Z4C A;  2A42 A;  4BWM A;  5DM7 L;  1FXX A;  1VRT A;  2QWR A;  4WFA L;  2JWK A;  2QM1 A;  4IKF A;  1Y97 A;  3D6R A;  3GDQ A;  4UY8 O;  3C7N B;  3QET A;  4J2B A;  3MCA B;  5EVZ A;  1X9M A;  3OA9 A;  3ALY A;  4AHV A;  3TAG A;  2VG5 A;  5C25 A;  2QKB A;  3MXJ A;  2QWM A;  4DV4 K;  4BE2 A;  1ESV A;  4AHU A;  3OYL A;  5AQX A;  4FK0 A;  4CES A;  1SKW A;  1WBB A;  3A8Y A;  4FWM A;  3L2U A;  3A5L C;  1WBD A;  3QEP A;  3FFI A;  5CYM A;  3NHG A;  1LW0 A;  1WUA A;  1XHX A;  2GEM A;  2HND A;  2H3G X;  3L0Q A;  2ZWH A;  3VEW A;  3SAG A;  2O8F A;  2HMP A;  1IO2 A;  3ENB A;  4W5O A;  2OZM A;  4EHT A;  1W97 L;  1NJW A;  1IV0 A;  1NJY A;  3SAF A;  5AQW A;  3ZYY X;  2GTD A;  2NUB A;  1ZBH A;  3IG1 A;  4DQI A;  5BRF A;  1U48 A;  1GLJ O;  3PX4 A;  2WON A;  2IOC A;  3K9J A;  4WF9 L;  2BAN A;  2B4J A;  4JKG B;  2FSK A;  4CF2 A;  4ID1 A;  4YOY A;  4JKF A;  5AFU A;  1W0H A;  4I6M A;  4CIE A;  3V9X A;  5C10 A;  1QZ6 A;  3VOV A;  3QML A;  3DXK B;  4FWR A;  3Q7B A;  1ZBU A;  1L5U A;  1IBK K;  1NU0 A;  1N34 K;  5I3U A;  3QER A;  1OH7 A;  4CJ7 A;  4HCB A;  4JRQ A;  4E7K A;  4CEE A;  4CJF A;  1QZ5 A;  1TL1 A;  4CCH A;  4AF1 A;  4DV1 K;  1QVF M;  5HLF A;  3JSM A;  3PIP L;  5AQS A;  1QS4 A;  3S3M A;  5FRO A;  1SKR A;  5LMU K;  4KTW A;  3V9W A;  4MDA A;  2YNH A;  2KZM A;  5J1E A;  1BHL A;  1BUP A;  2V52 B;  4B9Q A;  1CZ9 A;  3I8D A;  1XMQ K;  2WBN A;  3W3D A;  2VWB A;  3LP1 A;  3AO2 A;  3LPT A;  3QEI A;  2NZT A;  5KGW A;  4YOU A;  4FVU A;  1Q8I A;  3VA0 A;  4FLV A;  3DLE A;  3DOK A;  3THV A;  2HF4 A;  4JI1 K;  2FC0 A;  3CJ9 A;  1VSE A;  1RTH A;  2IVN A;  1QTM A;  1NGH A;  5DM6 L;  4PUO A;  4DSK A;  1QSL A;  3CQ8 A;  4CFA A;  4ELU A;  4OVL A;  1ZC6 A;  2E1Z A;  1BA0 A;  5CHI A;  4GKJ K;  1OH5 A;  4M3X A;  1U45 A;  1LWC A;  3CPW M;  4KHU A;  1BIZ A;  5AZJ A;  3VN5 A;  5AQJ A;  1WLJ A;  4O5F A;  3CJB A;  1D5A A;  1S1X A;  5GAG P;  2YHW A;  3CJ7 A;  4IOX A;  3KK1 A;  3DLG A;  3J80 O;  3MWP A;  3L6Q A;  3PX0 A;  3NH0 A;  1NGG A;  4JKB A;  2GX9 A;  3KKR A;  3GBT A;  1SV5 A;  1T44 A;  4X62 K;  1J9A A;  4W5Q A;  2IVO A;  1RBU A;  5CYQ A;  3SQ4 A;  4DR1 K;  1L3U A;  1YI2 N;  4HWI A;  3OYB A;  1RIL A;  5IWA K;  4FJL A;  1KD1 O;  4ZHR A;  3OHR A;  1DLO A;  2HBJ A;  3WXM B;  4AH9 A;  1S1W A;  1ZXO A;  3ZSY A;  3OYI A;  3DI6 A;  4B3T K;  3O8M A;  5CY4 A;  4BE1 A;  4CJV A;  4KPY A;  4B3S K;  2HOE A;  2HW3 A;  3BGR A;  1H1V A;  1VSJ A;  2D5R A;  4NLB A;  3QDK A;  3QBX A;  3AGK A;  2G8V A;  3FR0 A;  4DTN A;  2UYT A;  2PZS A;  3VQD A;  4DSJ A;  1Q81 O;  3TU5 A;  4LF5 K;  1NKC A;  3QIP A;  2HF3 A;  3DLB A;  1UOC A;  3A5O C;  3TAQ A;  4CEZ A;  4EZ9 A;  2Y1J A;  1VQ6 N;  2KTQ A;  4U67 L;  1RT2 A;  1BCM A;  1VK0 A;  4DU3 A;  4IXC A;  4XH4 A;  3AA5 X;  3V1Q A;  3VQA A;  4EIA A;  1VQ5 N;  1CXQ A;  4KV8 A;  4H0Y B;  3L2R A;  4KHN A;  4RTF D;  3ZSQ A;  3HP6 A;  3N4P A;  4HCC A;  1RCH A;  4A5B A;  1ASW A;  4BR0 A;  1NNE A;  2E2Q A;  1MWM A;  2YI1 A;  1Z05 A;  4DWI A;  4B1X B;  1ASU A;  1B9F A;  1Y64 A;  5J2N A;  1BQM A;  3CJ1 A;  2KW4 A;  1P8Z A;  3KK7 A;  4CZM A;  3AO4 A;  3O1W A;  4KTQ A;  4I9Q A;  2JWL A;  1BA1 A;  4IG3 A;  4RW6 A;  3MX5 A;  1VQL N;  1NGC A;  3LZJ A;  3WNH A;  3DLL L;  1WSF A;  4A2A A;  1CLQ A;  2ZGY A;  1SS6 A;  4FWO A;  3PO4 A;  4LD0 A;  3WNE A;  4K8X A;  1NOZ A;  3MN9 A;  3SBG A;  4OLA A;  1ZBI A;  3LPU A;  3ULE A;  1A5X A;  2QEX N;  1I39 A;  3OYH A;  1TUU A;  3THX B;  4EP5 A;  3LL3 A;  1KAY A;  3EO3 A;  4YOT A;  4DTU A;  1VSI A;  2EX3 A;  5GAH P;  3P83 D;  4FJ5 A;  4A59 A;  3S3O A;  3E9P A;  3O4W A;  3CER A;  2QI2 A;  3EL2 A;  3EY1 A;  1T03 A;  4DU4 A;  3CC4 N;  2UXC K;  4DV3 K;  4CJL A;  4JNE A;  3SJJ A;  3S9H A;  1NLV A;  2CGK A;  5HRO A;  3HL8 A;  3VER A;  3OBW A;  1JLC A;  3LP2 A;  1VRU A;  3LZI A;  1LOT B;  2UXB K;  3PX6 A;  4CHQ A;  4DR3 K;  4JI4 K;  1VSF A;  3MWT A;  4BRM A;  1U4B A;  4DB3 A;  2NRR A;  3THY B;  3G0Z A;  4CGD A;  3SPZ A;  4NB4 A;  4C8N A;  4BC3 A;  4KBO A;  4HHT A;  4BVO A;  3P5J A;  1Q18 A;  4YNQ A;  4ILH A;  4NYF A;  2V7Y A;  3RR8 A;  2P1J A;  4FL9 A;  3VQC A;  2P9U B;  4WQ5 C;  3MN6 A;  2NNW A;  3CJA A;  1C0G A;  3K0S A;  3O9R A;  1HYV A;  3THY A;  1NGE A;  1S1T A;  2P9U A;  1QQO A;  4DV5 K;  3ZX2 A;  3AA2 A;  3VET A;  4LSL A;  1VSD A;  1GOA A;  3R8E A;  4KH4 A;  3J7Z O;  3SQ0 A;  5BR8 K;  5KPR A;  3PY8 A;  2F7T A;  4N41 A;  5GAD P;  1J53 A;  1YJ9 N;  2D0C A;  4DFK A;  4H03 B;  4B08 A;  2O8F B;  4B9T A;  4R5P A;  1J6Z A;  1FKO A;  2HBL A;  4CIG A;  1HKG A;  2QWP A;  4NCB A;  1SL2 A;  2F9T A;  3CET A;  3OYJ A;  2HBK A;  4LH4 A;  2D4W A;  1ZBF A;  3WUH A;  1IH7 A;  3SUN A;  1X3N A;  2O8B B;  3AA4 A;  2QWN A;  4IWV A;  1WSE A;  2HMI A;  2BUP A;  5FPN A;  1RT5 A;  1NOY A;  3NE6 A;  1SL0 A;  2XHB A;  4FZZ A;  1U47 A;  4FOI A;  4CF9 A;  5BN8 A;  4WQ4 A;  3VQP A;  1Q86 O;  1TYQ A;  2QXL A;  5EXW A;  2AP1 A;  4W5T A;  1XI1 A;  3OYK A;  5AJ3 K;  2YHX A;  5AQU A;  4LFB K;  4EHU A;  1HRH A;  2FBY A;  4F4K A;  1HNW K;  2HHU A;  1BIS A;  1UAX A;  4IJN A;  3IKM A;  2E2N A;  5AQQ A;  3IDH A;  3K58 A;  1WSJ A;  3D2E B;  4CF0 A;  4EFH A;  3ULD A;  3OYN A;  1RDA A;  3KK2 A;  3CFR A;  3SUQ A;  3AAQ A;  3EN9 A;  4JKC A;  4H5W A;  3WQT A;  1RT3 A;  4BC4 A;  4CHO A;  3RR7 A;  3K5M A;  3IS9 A;  3OJS A;  3T7Z A;  4B3M K;  3LP3 A;  2NRT A;  1NJZ A;  3QIO A;  3BUZ B;  4E7L A;  1VSL A;  2EWS A;  4B3R K;  4CJS A;  4O4G A;  1BI4 B;  2PYL A;  1HQU A;  4M7Y A;  1VQN N;  4IZ9 A;  2P9S B;  4DS5 A;  3NH1 A;  3B6P A;  1SKS A;  3QO9 A;  3RMB A;  1GLC G;  4FLU A;  4Y0W A;  4CZJ A;  4FLZ A;  1LWF A;  3QNN A;  3TAN A;  3FE1 A;  1HJO A;  3ZSR A;  3V1O A;  1IKY A;  3M6G A;  3O3G A;  2HST A;  4CF8 A;  3GG4 A;  3TWH A;  4MLH A;  3O9Q A;  1KSP A;  2I7N A;  4OJR A;  2VWJ A;  4CHP A;  4H5N A;  4BRA A;  4JI8 K;  4N5S A;  1NMN A;  5JLH A;  4E7J A;  5FPM A;  3DAW A;  4LY7 A;  4PKH A;  4MQ3 A;  4Y1D A;  5E84 A;  4Z94 A;  4WFN L;  1VQK N;  4JKD A;  3LM9 A;  4CGJ A;  3QEW A;  2YNI A;  1L3S A;  3HPO A;  4PWD A;  1JL2 A;  3CI5 A;  1VAZ A;  3O3H A;  1RT1 A;  4IDH A;  4O0J A;  1KQS M;  4CJ4 A;  1NK7 A;  3D2F A;  1C0U A;  3ID6 A;  3VEO A;  3HTV A;  1JLF A;  3MN7 A;  3RTV A;  5M1Q A;  4YOW A;  3QES A;  5KRT A;  2RKI A;  4C23 A;  1YTA A;  3AVM A;  1RTI A;  2GBZ A;  2X6N A;  3D2E A;  4FLT A;  1KAX A;  4BY9 C;  4FLY A;  4M45 A;  4YY3 K;  5T7B A;  3SUP A;  4KH6 A;  2GWJ A;  3SLC A;  2GEL A;  4KTZ A;  3O6W A;  3L8B A;  1RT6 A;  4ISE A;  5GIO A;  1TGO A;  1EET A;  5B8H A;  1UA0 A;  5AR0 A;  2LSN A;  3PO5 A;  1TAQ A;  3H08 A;  2G8U A;  4A61 A;  4CK2 A;  4C8M A;  4I7F A;  4K25 A;  2E2P A;  3TAB A;  5K14 A;  4N47 A;  4FJ9 A;  1BWF O;  5KQ8 A;  4DQR A;  3L4I A;  3UB5 A;  3F9K A;  3QEX A;  4DR6 K;  2Q36 A;  2UUC K;  3TSU A;  3HOT A;  2WFB A;  4A57 A;  2Q31 A;  1UWB A;  4CHY A;  2RHK A;  4DTM A;  1IG9 A;  1V4T A;  4WCE L;  4FK2 A;  2P9P B;  3QEV A;  2OAN A;  1JL1 A;  1TV6 A;  4ILG B;  2DFE A;  1O1W A;  4GMJ B;  1Q9Y A;  4H0T B;  1KFS A;  3T19 A;  2P9K B;  1RBR A;  1T3V A;  3ZSV A;  4CHN A;  4O8K A;  4KRE A;  4OPH A;  1S3X A;  1JCE A;  3I0S A;  3D45 A;  3LAM A;  4QS7 A;  4L8R B;  3TAM A;  3L3V A;  1NK5 A;  3EYZ A;  1U49 A;  1NK6 A;  4BGB A;  1M90 O;  4NYN A;  2YJE A;  4J8F A;  2YJF A;  2QWQ A;  1QSS A;  2ZE2 A;  1NBW A;  4Q0B A;  3CCS N;  3TAP A;  3CJC A;  4R79 A;  5M1K A;  1TKT A;  4CJ3 A;  1M1K O;  4GNI A;  2BH1 A;  5AQF A;  2X78 A;  3GE1 A;  2FBX A;  3LDS A;  1EWR A;  1LW2 A;  4JLH A;  3U3Y A;  1EX4 A;  2QK9 A;  4PKI A;  3L2Q A;  2YV0 X;  5BR9 A;  2GWK A;  1LCU A;  3VF6 A;  4DTS A;  3VGK A;  4E0D A;  1N8R O;  1NM1 A;  4DG1 A;  5BPM A;  2P9K A;  1RGI A;  2XY7 A;  5AQZ A;  4CBX A;  3O3F A;  3OBY A;  5DMR A;  3TTD A;  3KD5 E;  4EZ6 A;  3VEZ A;  3SCX A;  2ETJ A;  2EHG A;  4BRQ A;  3LAK A;  4DKW A;  4BR5 A;  4CGF A;  1RT7 A;  1VQ4 N;  5AQR A;  3C6A A;  2IVP A;  4E1M A;  3VES A;  5JMV A;  1X9W A;  2Q0R A;  3LDQ A;  4BGA A;  1IBM K;  2HB5 A;  3F2K A;  3LM2 A;  2O8D B;  4FPB A;  4DTP A;  4DV2 K;  4CJE A;  1NWK A;  4A62 A;  2QWO A;  3G4S N;  3H3N O;  3VQQ A;  4B9S A;  4BG8 A;  2Q97 A;  4CZH A;  3OS1 A;  3EE9 A;  1S1U A;  3H1V X;  2X6S A;  4PA1 A;  2VG6 A;  3V9Z A;  2CGJ A;  1K6Y A;  2VYP A;  3BZC A;  4MDB A;  4BWJ A;  4FWL A;  4UQG A;  5BRE A;  4H5V A;  4O44 A;  4DMN A;  3VQ6 A;  4QS9 A;  3CHW A;  3OY9 A;  4MO4 A;  1NJI O;  3NF8 A;  3KWG A;  1HKC A;  4EP4 A;  3KD1 E;  4BRF A;  1NKE A;  3G71 N;  4F2S A;  1HJR A;  3A5M C;  4RG8 A;  3AAR A;  1HQE A;  3VEY A;  4BR4 A;  1GLD G;  3SJH A;  2PFU A;  3OYG A;  3ZSX A;  5GIN A;  3MAQ A;  4IDK A;  3F73 A;  4FXD A;  3C65 A;  2HNY A;  3H3O B;  2P5O A;  4KHW A;  4CFB A;  3ZT2 A;  2HNZ A;  4NXN K;  4JYA K;  4CEA A;  1KTQ A;  4CZE A;  4DSE A;  2OPP A;  3CME N;  3HO1 A;  4NXM K;  3K2P A;  3VQ7 A;  2YHY A;  1WB9 A;  4Z0U A;  3NVM A;  3E9O A;  4DFM A;  4W5R A;  1IKW A;  1T8E A;  4CJR A;  3MEE A;  1A5W A;  3A0I X;  4CFD A;  3HXM A;  2WTU A;  5LY3 A;  3QNO A;  4B3O A;  5AQV A;  4CZF A;  2WC9 A;  1SAZ A;  3SMS A;  5C12 A;  3KKS A;  4OKE A;  4ELV A;  2OPS A;  1RBV A;  3UKR B;  5I9E B;  4NCG A;  3CCU N;  2OYQ A;  4DTR A;  3DM2 A;  4CED A;  5JVH L;  3DLR A;  3F9M A;  3J7Y P;  4LF6 K;  2YKM A;  2P5G A;  3A2F A;  4ILJ A;  1S9E A;  3QIC A;  3HBT A;  2A41 A;  2HHS A;  3OYE A;  3KJV A;  1K73 O;  2NRZ A;  1E3M A;  3DYA A;  1EKE A;  4LSN A;  2FF6 A;  3LWM A;  4AM7 A;  3VGL A;  5J2M A;  2ASP A;  3O80 A;  4BRP A;  1ATS A;  2AA4 A;  3C6U A;  3CM6 A;  4H8K A;  1IKX A;  1VQO N;  1TUY A;  4W5N A;  2HHV A;  2A6A A;  3TSQ A;  1D9F A;  2ITG A;  1C1C A;  5SZT A;  1YJW N;  2QW9 A;  3NCI A;  4B1W B;  2D0B A;  1XC3 A;  2QTD A;  3HZ6 A;  1BDG A;  3QFU A;  4X64 K;  3MMV A;  4KB1 A;  4DV7 K;  2WUS A;  4M63 C;  2P9N A;  4I2Q A;  4N56 A;  1RTJ A;  3R1X A;  1L3T A;  3VMF B;  4QOZ B;  1Z6R A;  3AO1 A;  2O8D A;  3CF5 L;  3TAR A;  2P51 A;  4CK3 A;  4DS4 A;  5EY4 A;  1D9D A;  2FLO A;  1ASV A;  4Q5V A;  3FLC O;  3J81 O;  4RW4 A;  1I94 K;  1DT9 A;  1QSY A;  3IAY A;  4FJH A;  4H4M A;  3NGZ A;  4OKJ A;  3PV8 A;  2F4V K;  3AVC A;  3LAN A;  4KHY A;  1Z26 A;  3HM9 A;  3KLH A;  1VSM A;  4X65 K;  4XH1 A;  3ASM A;  4LH5 A;  3DRP A;  2ITM A;  1MWK A;  3CFO A;  1N36 K;  4OPA A;  4IO8 A;  3AAP A;  3C0B A;  3CXC M;  5HOO A;  4CJQ A;  2ASM A;  3DRR A;  1KC8 O;  2JLE A;  3H1Q A;  4FWN A;  4CJW A;  3T1H K;  4JI0 K;  3MEG A;  5HRS A;  3E01 A;  1GLF O;  3AVA A;  2YNF A;  4KHP K;  4JKA A;  2J4R A;  3ZT3 A;  1KCF A;  4I6M B;  3SYZ A;  5M1N A;  3MEC A;  3KLI A;  4E1N A;  1J54 A;  5JS2 A;  3HPG A;  3KK3 A;  1Q9X A;  4CZK A;  5E26 A;  2A5X A;  4A2B A;  2HHH K;  1U04 A;  2XRI A;  3SZ2 A;  1DTQ A;  4C8K A;  3NDK A;  2OA8 A;  3PSF A;  1KXP A;  3ZSW A;  1FJG K;  1GLL O;  2OCE A;  3BY5 A;  4X66 K;  2E4L A;  3CPE A;  5FDL A;  3D7E O;  2DFF A;  3M1F A;  2HHQ A;  4CEB A;  3L2W A;  5LJW A;  1I3A A;  4H5R A;  4M3R A;  1LV5 A;  1MA9 B;  4OO1 J;  2W42 A;  1DEJ A;  4DV0 K;  2PAV A;  5AQY A;  4GW6 A;  1BIU A;  3TSP A;  4TSX A;  2YX6 A;  3P1G A;  3LDO A;  3ZET A;  4Z4E A;  3S41 A;  3SK3 A;  3HOS A;  1P90 A;  4FOE A;  3D0P A;  1NGD A;  1XC9 A;  3HRG A;  3SUO A;  3JYT A;  4U7B A;  1JXB A;  4B9U A;  3THW B;  1NMD A;  1U2V B;  3KTQ A;  3C95 A;  3CCJ N;  4H0V B;  1KAZ A;  2IC3 A;  4IBN A;  4O55 A;  2KFZ A;  3ZT0 A;  3L3U A;  3OS0 A;  4KKO A;  3MXI A;  2UU9 K;  2G8W A;  5AZJ B;  1VQP N;  5F2R A;  3AA3 A;  4M3U A;  3FZH A;  1W7A A;  4DFP A;  3JS6 A;  4DUY K;  1D8Y A;  3OYF A;  2RPI A;  1KVC A;  1C6V A;  1DKG D;  2A1S A;  4BQL A;  4ZTJ A;  1NGJ A;  4ELT A;  3AO3 A;  2Z1H A;  1QQM A;  3HSC A;  2G8H A;  5KGX A;  1VSK A;  4IO9 L;  3I0R A;  3SNN A;  3LDP A;  4M7X A;  3VQ4 A;  1S6Q A;  2VG7 A;  1NK0 A;  4KB0 A;  5JIC A;  1S6P A;  3P31 A;  1J5O A;  4JN4 A;  4AQY K;  1CZB A;  4CI6 A;  3CCR N;  5KRS A;  1X1P A;  1DTT A;  2GUI A;  1TKZ A;  4CZI A;  4YOV A;  2E6M A;  5EU7 A;  3CCM N;  1BQN A;  4GVM A;  1WSI A;  1YF5 L;  4AM6 A;  1RDC A;  2I5J A;  3FGU A;  1HNZ K;  3BP8 A;  4ISF A;  1NGA A;  1YAG A;  3WNF A;  3CCV N;  3WQU A;  3EZW A;  3AVJ A;  1XHZ A;  4LFA K;  2Y1I A;  1EXQ A;  4MO5 A;  4CJK A;  4DSL A;  3SI6 A;  2QXF A;  5EX5 A;  4Z4F A;  3MCP A;  3CCQ N;  1RBT A;  3CQY A;  4DR7 K;  4YDU A;  1Q7Y O;  4NO7 A;  4GV6 A;  4IG0 A;  1BCO A;  5BPN A;  5AQT A;  2GUP A;  4H0X B;  1N5Y A;  2FBT A;  1YHQ N;  4B9L A;  3V9S A;  1BI4 A;  2ATQ A;  3RVC A;  5HRN A;  3KLG A;  5BN9 A;  3DOL A;  5A2Q O;  3FZK A;  4OPJ A;  3U9Z A;  4KH5 A;  2P9L A;  3NF6 A;  1OKJ A;  4DU1 A;  3H46 O;  2E88 A;  1BO5 O;  1NK8 A;  4GV9 A;  5LJV A;  1QE1 A;  1NG9 A;  2HVI A;  3NMU A;  1QVG M;  4J2E A;  3L4Q A;  1BL3 A;  4DR5 K;  4WQ4 C;  4OGC A;  4DF4 A;  4JS4 A;  4BQZ A;  2P9P A;  3VQ5 A;  1JLG A;  1HMV A;  4DTO A;  3RRH A;  4FJN A;  2NRV A;  3J8A A;  1X3M A;  5C2F A;  1JCF A;  3VTH A;  1T7P A;  1GOC A; 
#chains in the Genus database with same CATH homology
 2YHB A;  3RMC A;  3BDP A;  3O3F A;  5DMR A;  3KD5 E;  4EZ6 A;  4FYD A;  1WN7 A;  4IFY A;  1RDB A;  4CEC A;  2HW3 A;  3AVN A;  3BGR A;  4CER A;  2XY6 A;  1VSJ A;  2D5R A;  2ETJ A;  1YT3 A;  3M8Q A;  3SCX A;  4OGE A;  2G8F A;  2EHG A;  3LAK A;  2G8V A;  4M3W A;  4CGF A;  4DTN A;  1RT7 A;  1TKX A;  2PZS A;  4Y1C A;  3VQD A;  4DSJ A;  4E1M A;  3ZT1 A;  3PUF A;  1NKC A;  2OZS A;  4HUE A;  1X9W A;  3VQ8 A;  3QIP A;  2Z1I A;  3MED A;  3DLB A;  3SV3 A;  1UOC A;  3VQB A;  3TAQ A;  2HB5 A;  4CEZ A;  3LAL A;  5D3G A;  1YTU A;  4EZ9 A;  2Y1J A;  2HHX A;  2BE2 A;  2KTQ A;  4DTP A;  1RT2 A;  4CJE A;  1BCM A;  1VK0 A;  3AV9 A;  3V1R A;  4DU3 A;  3AA5 X;  3V1Q A;  3VQA A;  2HHT A;  2HHW A;  3VQQ A;  3ZCM A;  1CXQ A;  4KV8 A;  4B9S A;  3L2R A;  3OS1 A;  4KHN A;  3ZSQ A;  3CYM A;  3HP6 A;  1S1U A;  4C8O A;  2O4G A;  2X6S A;  1RCH A;  4PA1 A;  1ASW A;  3HP9 A;  2VG6 A;  2Q3S A;  5DK5 A;  5HBM A;  3V9Z A;  3HK2 A;  1BGX T;  1K6Y A;  3NAE A;  3AVL A;  4DWI A;  4M3T A;  1ASU A;  1RTD A;  2QKK A;  4BWJ A;  3B6O A;  3ITH A;  1B9F A;  3K5N A;  4BDY A;  5J2N A;  1BQM A;  2BGG A;  1MU2 A;  4UQG A;  2KW4 A;  2DY4 A;  1HPZ A;  4O44 A;  4DMN A;  3RRG A;  3VQ6 A;  4ICL A;  3AO4 A;  4KTQ A;  4I9Q A;  4IG3 A;  1WSG A;  3OY9 A;  5HRP A;  4FJX A;  4FJ8 A;  4DQP A;  4RW6 A;  3NF8 A;  4PY5 A;  4CJP A;  1UA1 A;  3LZJ A;  3WNH A;  1Z25 A;  4EP4 A;  5J2P A;  3KD1 E;  1WSF A;  1CLQ A;  1NKE A;  4C8L A;  3K5O A;  3RWU A;  1WSH A;  5J2Q A;  2ZD1 A;  4FW2 A;  1HJR A;  2D0A A;  4LD0 A;  3WNE A;  4CGH A;  4RG8 A;  3L2V A;  4E19 A;  1TKD A;  1HQE A;  4OPK A;  4K8X A;  1NOZ A;  1JLQ A;  3NF7 A;  4FLW A;  4OLA A;  1ZBI A;  3LPU A;  1A5X A;  1I39 A;  4CJT A;  4KI6 A;  3OYG A;  3ZSX A;  4DLG A;  3OYH A;  1TK5 A;  4EP5 A;  1W9H A;  4O0I A;  3MAQ A;  4DTU A;  4FK4 A;  4IDK A;  3F73 A;  4FXD A;  4CGI A;  1VSI A;  3T1A A;  2EX3 A;  2HNY A;  4KFB A;  2P5O A;  1FK9 A;  1RBS A;  3P83 D;  5C42 A;  4KHW A;  4CFB A;  1REV A;  1GOB A;  4Z4G A;  4J2A A;  3ZT2 A;  4FJ5 A;  3M8P A;  3AVB A;  2HNZ A;  3S3O A;  2XY8 A;  4BDZ A;  2IAJ A;  4CEF A;  1B9D A;  4CEA A;  3EY1 A;  3TI0 A;  1KTQ A;  1C0M A;  1T03 A;  2DFH A;  4DSE A;  4DU4 A;  3SQ1 A;  4OLB A;  2OPP A;  4CJL A;  1SL1 A;  3ZT4 A;  5E41 A;  2HVH A;  3HO1 A;  4JS5 A;  4AIL C;  3RMD A;  4BAC A;  4B9M A;  1N6Q A;  1TL3 A;  4FJK A;  4FLX A;  4DSI A;  4AHT A;  4F8R A;  3K2P A;  3VQ7 A;  1WNS A;  4AHS A;  3CFP A;  4Z0U A;  3SJJ A;  3S9H A;  4CJU A;  1ZYQ A;  2A1R A;  4DFM A;  1KFD A;  1IKW A;  4W5R A;  3HL8 A;  5HRO A;  1NK4 A;  1T8E A;  4NCA A;  1JLE A;  3AVK A;  4CJR A;  3EZ5 A;  2RF2 A;  1JLC A;  1A5W A;  3LP2 A;  3MEE A;  4CFD A;  3K59 A;  3HXM A;  1VRU A;  3QNO A;  4B3O A;  3LZI A;  3LWL A;  4FVM A;  4KAZ A;  3PX6 A;  2G8K A;  4N76 A;  4FM1 A;  4MFB A;  3KKS A;  4CHQ A;  4OKE A;  4ELV A;  2OPS A;  1RBV A;  4M3X A;  1VSF A;  4NCG A;  1HYS A;  2OYQ A;  4DTR A;  3DM2 A;  4CED A;  1U4B A;  3DLR A;  3OYM A;  4E7I A;  3G0Z A;  4CGD A;  3SPZ A;  2YKM A;  4C8N A;  3NH2 A;  4BDP A;  1FKP A;  3A2F A;  2P5G A;  1S1V A;  3G10 A;  4HHT A;  1S9E A;  3P5J A;  1JLA A;  3DRS A;  2B6A A;  4CF1 A;  4NYF A;  4YNQ A;  1NKB A;  2HHS A;  3CG7 A;  3OVN A;  3OYE A;  3KJV A;  2P1J A;  4M41 A;  3VQC A;  4FCY A;  3RR8 A;  3DYA A;  1X9S A;  1EKE A;  4LSN A;  5FRM A;  3LWM A;  1QQC A;  5J2M A;  1HYV A;  1KVB A;  1KRP A;  4DTJ A;  1S1T A;  3AA2 A;  3CM6 A;  3C6U A;  3NGI A;  4H8K A;  4LSL A;  2PYJ A;  1IKX A;  1GOA A;  1VSD A;  4DSL A;  4FM0 A;  2YNG A;  3KIO A;  4W5N A;  2XO7 A;  2HHV A;  3KLF A;  3V9U A;  4HUG A;  3RMA A;  3SQ0 A;  1D9F A;  4E89 A;  1C0T A;  1G15 A;  5HP1 A;  2ITG A;  1C1C A;  2JGU A;  5SZT A;  3HVT A;  3OYA A;  3ZSZ A;  2KFN A;  3PY8 A;  1NJX A;  4Z4H A;  3NCI A;  4F3T A;  3AVH A;  2D0B A;  4N41 A;  1J53 A;  3PO4 A;  2IDO A;  1A5V A;  2D0C A;  2WOM A;  3AVF A;  4DFK A;  1TK0 A;  3KLE A;  4BE0 A;  3NFA A;  4B08 A;  4KB1 A;  4YFU A;  1JKH A;  4B9T A;  4R5P A;  2IGI A;  4RW9 A;  1FKO A;  4I2Q A;  4CIG A;  3HST B;  4N56 A;  1RTJ A;  4RW7 A;  1L3T A;  4FJG A;  2KQ2 A;  4NCB A;  1SL2 A;  3OJU A;  4QOZ B;  3OYJ A;  4LH4 A;  3AO1 A;  1ZBF A;  2P51 A;  3O4N A;  4CK3 A;  3TAR A;  4HCC A;  1NK9 A;  4G1Q A;  2F8S A;  1IH7 A;  4CE9 A;  4B8A B;  4DS4 A;  3SUN A;  3AA4 A;  4M3Z A;  4ZTF A;  3CM5 A;  1WSE A;  2HMI A;  1D9D A;  1ASV A;  4B9V A;  4Q5V A;  4M3Y A;  4FW1 A;  4RW4 A;  3VA3 A;  3SQ2 A;  3LP0 A;  1RT5 A;  1NOY A;  3NE6 A;  1SL0 A;  2XHB A;  4FZZ A;  1U47 A;  1QSY A;  3WNG A;  4CF9 A;  3IAY A;  3NBP A;  4QCL A;  1KLM A;  3VQP A;  4FJH A;  5CZ2 A;  4H4M A;  4FJM A;  3NGZ A;  4OKJ A;  3PV8 A;  3AVC A;  3LAN A;  4W5T A;  3S3N A;  2PY5 A;  3MXM A;  3QLH A;  1Z26 A;  3HM9 A;  3T3F A;  3KLH A;  4KHY A;  1VSM A;  1XI1 A;  4Z4I A;  3OYK A;  2IS3 A;  5HRR A;  3ASM A;  4LH5 A;  3DRP A;  1ITG A;  5KTQ A;  4B9N A;  3DLK A;  1HRH A;  3CFO A;  2FBY A;  3VQ9 A;  4F4K A;  2HHU A;  1BIS A;  4CJQ A;  1UAX A;  3DRR A;  4CJ5 A;  1KVA A;  2JLE A;  4CJW A;  2RN2 A;  3TR8 A;  4M42 A;  2YHA A;  3MEG A;  3HVR A;  1WSJ A;  2F96 A;  5HRS A;  3E01 A;  1JXE A;  4CF0 A;  3K58 A;  4DQQ A;  3ULD A;  1HNI A;  2OPR A;  1TK8 A;  3HJF A;  3OYN A;  1HNV A;  2YNF A;  3AVA A;  1RDA A;  3VQE A;  3KK2 A;  3CFR A;  3SUQ A;  1VSH A;  2Z1G A;  4AHC A;  1S5J A;  2E6L A;  3ZT3 A;  1KCF A;  1RT3 A;  1LWE A;  4CHO A;  3M8R A;  4HTU A;  3SYZ A;  3AO5 A;  3RR7 A;  3K5M A;  3MEC A;  3IS9 A;  3OJS A;  1S9G A;  3KLI A;  4E1N A;  3OS2 A;  1J54 A;  3LP3 A;  4HUF A;  1TVR A;  1NJZ A;  3U3G A;  3QIN A;  4KHS A;  3OYD A;  5JS2 A;  3HPG A;  3QIO A;  4AHR A;  4XIU A;  3KK3 A;  3V6D A;  4E7L A;  1Q9X A;  1VSL A;  4CJS A;  1U04 A;  1WAF A;  2XRI A;  3C94 A;  4O4G A;  1DTQ A;  3SZ2 A;  4Z4C A;  1ZBL A;  4CHZ A;  3NDK A;  4C8K A;  1TAU A;  1BI4 B;  2PYL A;  1KLN A;  2DTU A;  4BWM A;  1FXX A;  1HQU A;  1VRT A;  2OA8 A;  1XWL A;  3O4Q A;  4DS5 A;  3NH1 A;  3B6P A;  1SKS A;  3QO9 A;  3RMB A;  4IKF A;  1Y97 A;  2F8T A;  3ZSW A;  3QET A;  4J2B A;  4E7H A;  4FLU A;  3TAF A;  1X9M A;  2E4L A;  4JRP A;  2KZZ A;  3ALY A;  4AHV A;  3V81 A;  4FLZ A;  3TAG A;  5FDL A;  2VG5 A;  5C25 A;  2QKB A;  3MXJ A;  4BE2 A;  1LWF A;  4AHU A;  3OYL A;  1RNH A;  2DFF A;  3M8S A;  3QNN A;  3TAN A;  4FK0 A;  4CES A;  1SKW A;  2HHQ A;  4CEB A;  3ZSR A;  3V1O A;  1IKY A;  3L2W A;  4FZX C;  1I3A A;  3U6F A;  4M3R A;  3O3G A;  3L2U A;  1LV5 A;  2W42 A;  4CF8 A;  5SWM A;  4DLE A;  3QEP A;  3TWH A;  4GW6 A;  1BIU A;  3FFI A;  4TSX A;  5CYM A;  1LW0 A;  3NHG A;  3P1G A;  1KSP A;  4F3O A;  4OJR A;  4B8C A;  2VWJ A;  1XHX A;  4CHP A;  4E3S A;  2HND A;  4N5S A;  4Z4E A;  4E7J A;  4LY7 A;  1IO2 A;  4MQ3 A;  4Y1D A;  3D0P A;  5KI6 A;  1XC9 A;  3SUO A;  3JYT A;  4W5O A;  2OZM A;  1LAV A;  4CGJ A;  1JXB A;  3QEW A;  4B9U A;  1NJW A;  1NJY A;  2X74 A;  3DLH A;  4H4O A;  2NUB A;  1ZBH A;  3KTQ A;  2YNI A;  1SUQ A;  3C95 A;  3IG1 A;  3HPO A;  1L3S A;  4DQI A;  1U48 A;  4PWD A;  1JL2 A;  5C24 A;  4FZY A;  3PX4 A;  3O3H A;  2WON A;  2IC3 A;  2IOC A;  1RT1 A;  4IBN A;  2BAN A;  2B4J A;  4O55 A;  4DF8 A;  2KFZ A;  4O0J A;  4DFJ A;  1R0A A;  4CF2 A;  4CJ4 A;  1NK7 A;  2G8U A;  1C0U A;  4ID1 A;  2O4I A;  2GV9 A;  3ZT0 A;  4CK1 A;  1W0H A;  3L3U A;  1JLF A;  3RTV A;  3OS0 A;  4KKO A;  3MXI A;  4CIE A;  5FRN A;  3OYC A;  3V9X A;  2G8W A;  3QES A;  1WAJ A;  5KRT A;  1C1B A;  2RKI A;  3ISN C;  1YTA A;  3AVM A;  3AA3 A;  1RTI A;  4M3U A;  1ZBU A;  3K57 A;  2GBZ A;  1L5U A;  4DFP A;  2X6N A;  1D8Y A;  3TAE A;  4FLT A;  4FLY A;  3OYF A;  5I3U A;  3UIQ A;  2RPI A;  4M45 A;  3SPY A;  1KVC A;  1C6V A;  5T7B A;  3QER A;  2A1S A;  1HYZ A;  3NF9 A;  3SUP A;  4ZTJ A;  4ELT A;  4HCB A;  1L3V A;  4OKK A;  5CZ1 A;  4JRQ A;  3AO3 A;  4E7K A;  4PQU A;  2Z1H A;  4CEE A;  4CJF A;  4KTZ A;  2G8H A;  1TL1 A;  5KGX A;  4CCH A;  4RW8 A;  1B92 A;  1VSK A;  3JSM A;  3L8B A;  1RT6 A;  4CFC A;  5HLF A;  4F2S A;  4FJ7 A;  3C6T A;  3I0R A;  1TGO A;  3SNN A;  1EET A;  3NGY A;  3VQ4 A;  1UA0 A;  2LSN A;  1QS4 A;  3PO5 A;  1TAQ A;  1YVU A;  1S6Q A;  3H08 A;  5FRO A;  4C8M A;  2VG7 A;  4CK2 A;  3S3M A;  4I7F A;  1NK0 A;  1SKR A;  3TAB A;  5K14 A;  4KTW A;  4N47 A;  3V9W A;  4KB0 A;  4FJ9 A;  4DQS A;  1S6P A;  2YNH A;  4DQR A;  5J1E A;  2KZM A;  1JLB A;  1J5O A;  4KI4 A;  1BHL A;  1RDD A;  3F9K A;  3QEX A;  1CZB A;  4QAG A;  1CZ9 A;  3I8D A;  5KRS A;  1X1P A;  1LAW A;  2ZQB A;  3LP1 A;  3AO2 A;  3LPT A;  3QEI A;  2G8I A;  1DTT A;  5KGW A;  1Q8I A;  1TKZ A;  2GUI A;  4IFV A;  3VA0 A;  2E6M A;  4FLV A;  3DLE A;  5EU7 A;  3V4I A;  3DOK A;  1UWB A;  3ZSO A;  4CHY A;  1BQN A;  4DTM A;  2FC0 A;  4GVM A;  3THV A;  1WSI A;  1IG9 A;  1VSE A;  1RTH A;  1QTM A;  1RDC A;  2I5J A;  4PUO A;  4DSK A;  1QSL A;  2B5J A;  4CFA A;  3CQ8 A;  4ELU A;  4OVL A;  1CXU A;  3WNF A;  1XHZ A;  3QEV A;  4FK2 A;  3AVJ A;  4WE1 A;  1IKV A;  2Y1I A;  1EXQ A;  1RT4 A;  1JL1 A;  4CJK A;  1TV6 A;  1C1A A;  2DFE A;  4FM2 A;  1O1W A;  4GMJ B;  2QXF A;  2XY5 A;  3SI6 A;  1LWC A;  1U45 A;  1Q9Y A;  4FJJ A;  4KHQ A;  4Z4F A;  1RBT A;  1KFS A;  4KHU A;  1BIZ A;  3T19 A;  4IG0 A;  1BCO A;  1RBR A;  3ZSV A;  4KRE A;  4CHN A;  4CEQ A;  3VN5 A;  4KO0 A;  1WLJ A;  3I0S A;  1F21 A;  3D45 A;  3LAM A;  4ID5 A;  3HYF A;  2OPQ A;  4O5B A;  3TAM A;  3L3V A;  4L8R B;  1N5Y A;  2VWK A;  1NK5 A;  3K5L A;  2FBT A;  1D5A A;  1S1X A;  3HT3 A;  1T05 A;  3EYZ A;  1U49 A;  1NK6 A;  4B9L A;  2BDP A;  3V9S A;  4NYN A;  3KK1 A;  1BI4 A;  2ATQ A;  3DLG A;  3DMJ A;  5HRN A;  3KLG A;  2R7Y A;  1QSS A;  2AJQ A;  3DOL A;  2ZE2 A;  3PX0 A;  3NH0 A;  4K8Z A;  4F2R A;  4OPJ A;  3HPH A;  3AVG A;  4KPY A;  4Q0B A;  3SV4 A;  3TAP A;  3KKR A;  1SV5 A;  5JS1 A;  3NF6 A;  1J9A A;  2YKN A;  4W5Q A;  4DTX A;  4I2P A;  1TKT A;  4CJ3 A;  2FBV A;  1RBU A;  5CYQ A;  4DU1 A;  3SQ4 A;  1QHT A;  3IRX A;  4I9L A;  1L3U A;  1NK8 A;  2X78 A;  3OYB A;  1RIL A;  2FBX A;  4FJL A;  1EP4 A;  3LDS A;  1QE1 A;  2HVI A;  4ZHR A;  4J2E A;  4J2D A;  1LW2 A;  1BL3 A;  1DLO A;  4JLH A;  4DF4 A;  4OGC A;  4DSF A;  4JS4 A;  4HVJ A;  4AH9 A;  3U3Y A;  1EX4 A;  3VQ5 A;  4CEO A;  1JLG A;  2Z1J A;  1S1W A;  2QK9 A;  3ZSY A;  1HMV A;  3OYI A;  4DTO A;  3RRH A;  4FJN A;  3L2Q A;  2YV0 X;  3DI6 A;  5I42 A;  4CGG A;  4KRF A;  4DTS A;  5CY4 A;  4E0D A;  4BE1 A;  4DG1 A;  4CJV A;  4FJI A;  1T7P A;  3AVI A;  4CIF A;  2XY7 A;  1GOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...