4CIEA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
152
structure length
146
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
molecule tags Transferase
source organism Human immunodeficiency virus 1
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
total genus 54
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cieA00
4N5SA 4E7IA 3K59A 1FKPA 2OPPA 3VQDA 3P1GA 3MECA 2OPQA 3DLGA 1NOYA 3V9UA 4YNQA 3DMJA 1NJWA 2P5GA 3EY1A 3ULDA 3OY9A 3HVTA 4AHVA 2A1SA 1JKHA 4DS4A 3V81A 3B6OA 2BE2A 3AO5A 3LAMA 5CY4A 4H8KA 4PQUA 3O4NA 4N41A 4M3TA 2PZSA 4AHUA 4G1QA 3OYEA 4O5BA 3LPUA 4FYDA 4IFYA 2X6SA 2BANA 2X78A 4DU1A 4FZYA 4FJ9A 5JS1A 4DFPA 3ZSRA 4OPJA 3M8PA 4DSKA 4R5PA 3T19A 1NK9A 1GOBA 4DU4A 1FXXA 1JLQA 3S9HA 1RBRA 4CGFA 3AA4A 4M3RA 1L3VA 1KCFA 2HB5A 4J2BA 2HHTA 1EX4A 3HPHA 2QKBA 4FLTA 1N5YA 3BDPA 4CJUA 1QHTA 4FK0A 4B8CA 5HRSA 3M8SA 1T7PA 4C8MA 4I9LA 4H4MA 1KSPA 1RT1A 5J2NA 3OYLA 3T3FA 3DLHA 2D0AA 4RW9A 5HRRA 2OZMA 3H08A 2VG5A 1NK5A 4M3UA 4H4OA 3L2QA 5KRSA 3G10A 4Y1DA 4B9VA 3C94A 4DTMA 2OPSA 4QOZB 1TAUA 3ZSWA 4PUOA 3ASMA 3CM5A 4FVMA 3JYTA 3U3GA 3LDSA 1Q9XA 4CJ4A 4W5RA 3SJJA 3OYBA 4DU3A 1TK0A 4DQSA 3SQ4A 3SNNA 4CJQA 3TAQA 4CE9A 4CJLA 4CIEA 4FCYA 2HHWA 1A5XA 1LAVA 3TR8A 1S1WA 3PX0A 1RILA 3OYDA 3P83D 2Y1IA 2RPIA 1DTQA 3I0RA 2HHSA 3QEXA 4E7LA 4F4KA 1LWEA 4BDZA 1KLNA 1G15A 1UA1A 4PWDA 4CHQA 4CGGA 4CK1A 3HT3A 5FRMA 4F8RA 1NJZA 3PUFA 3KD1E 2B6AA 3V4IA 5HLFA 1Q9YA 3TAFA 3SUQA 3ZSZA 4FJLA 1VRTA 3O3FA 3HXMA 3BGRA 4CK2A 1I3AA 1Y97A 4DWIA 4ELUA 1LWFA 4HCBA 5KGXA 1HYZA 3LP1A 3HK2A 2ETJA 3NH0A 1ZBLA 4FLYA 4CF9A 4KHQA 3O3GA 4AILC 3LZJA 4NCGA 1RBTA 4KHWA 2G8FA 2DFEA 3SV4A 1WSIA 4RG8A 3G0ZA 1B9DA 2IDOA 4FW1A 1LW2A 2XO7A 4CJSA 1RTJA 3HJFA 4C8NA 4FLVA 2F96A 4OPKA 3QERA 1U49A 3DRRA 1ZBFA 1DTTA 2P5OA 1WSEA 3NH1A 4FJXA 1RTIA 4CJ3A 3HL8A 3OYIA 3QLHA 1WSHA 1N6QA 3K58A 4DTPA 1S1TA 2HMIA 3AVNA 4UQGA 1XHZA 4B9TA 4DSIA 1VSMA 2ZQBA 1BCOA 1IO2A 3CM6A 4QAGA 4OKEA 3V9SA 2BGGA 1BI4B 3LALA 4FLUA 3RMAA 1RDCA 4CJKA 3K5LA 4JRQA 3V9ZA 2G8VA 4EZ9A 4F3OA 3DI6A 4KRFA 1BCMA 4IG0A 1NK7A 1QE1A 2HW3A 4OGCA 5HRNA 3ZT1A 3IAYA 1CZBA 1QS4A 4HUEA 3NGIA 4OLBA 3AVFA 4ELVA 4DF4A 3S3MA 2JLEA 3PY8A 2FBTA 4ID1A 3DOLA 4DTSA 4F2SA 1C1CA 1RT6A 1QSYA 1YTUA 4RW6A 5KGWA 3KJVA 1EKEA 4DTJA 3VQPA 4AHCA 4KAZA 1T8EA 1LV5A 4ZHRA 2E6MA 5D3GA 4ZTJA 1RTHA 1RT3A 4EP5A 3NCIA 3RRHA 1J9AA 1S1VA 4CIFA 1ASWA 1JLFA 2IAJA 4AH9A 2ZD1A 4CF8A 3LP0A 2WOMA 4CGHA 4CFBA 2X6NA 2O4GA 2YNFA 4I7FA 4KHUA 3WNGA 3HO1A 1XWLA 4PY5A 1RCHA 2OA8A 2DTUA 1NK6A 3TABA 4DLEA 4KTQA 3LAKA 1WLJA 2VWJA 2O4IA 1D9FA 2HVIA 1HYVA 1BGXT 1ZYQA 2RN2A 2KFNA 3V1QA 2YNGA 3PX6A 3O3HA 1O1WA 4ID5A 4CHOA 4KREA 4L8RB 3CYMA 1BHLA 5CZ1A 4C8LA 1ASVA 1X1PA 3NBPA 3AVCA 1WSFA 3TANA 4FJ8A 4J2DA 3QIOA 4DQPA 3AV9A 4DG1A 4FZZA 1DLOA 3LANA 1J54A 3LWMA 4B3OA 3DRPA 4O55A 3ZSOA 4ELTA 1CXUA 1QSSA 4LY7A 2Y1JA 3I8DA 1BIZA 4M42A 3L8BA 4KV8A 3O4QA 5J2QA 2AJQA 2FBYA 4CFCA 4Z4HA 2HNDA 3OYJA 3DLKA 4HUFA 1J5OA 3KKSA 4CCHA 4OJRA 1TKDA 4N76A 3AVMA 4KI6A 1KFDA 3V1RA 5C24A 3ISNC 3LP3A 4O4GA 1WAJA 3OVNA 2E6LA 3ZSQA 4W5OA 1SL0A 1A5VA 3VQ7A 2D5RA 4B9SA 1UAXA 4CGIA 4DF8A 1W0HA 1D5AA 3D45A 4AHTA 2P1JA 4CJFA 3RWUA 1U04A 3VQCA 3ZSXA 3L3UA 4IFVA 1WSGA 3OYNA 3K5NA 3CFPA 4KB1A 4CESA 1C0TA 4M41A 4B9LA 2Z1JA 3DLBA 3RRGA 1IKYA 4DMNA 3KIOA 4F3TA 1KLMA 4CEQA 1RTDA 3AO4A 3KTQA 3LPTA 1TL3A 3TAMA 5HRPA 2IS3A 2P51A 2LSNA 3AVBA 2XHBA 4DTXA 4B8AB 3M8RA 2GV9A 3TAEA 1IKVA 2HHUA 1NK8A 2GUIA 4DFJA 2DFHA 4KTWA 4FJJA 3HPGA 1JLEA 4Q5VA 3KLGA 3F73A 4PA1A 3SPZA 1NJYA 3KD5E 4DFMA 3SI6A 4NCAA 4OGEA 3DYAA 1Z26A 3PO5A 1BQMA 3B6PA 5J2MA 3PX4A 4DSJA 4LH4A 4B9MA 4YFUA 1L5UA 3RMDA 1UOCA 5DMRA 4EP4A 3DRSA 4Z0UA 3AO2A 3DM2A 4E3SA 1S9GA 2G8WA 4FJMA 4W5NA 1U45A 4GW6A 4FXDA 1VSHA 4DLGA 3VA3A 4GVMA 1LAWA 4CGDA 1JLBA 1EP4A 1CLQA 1T03A 1S1XA 1CXQA 1KTQA 3QINA 1IKWA 5EU7A 1TK8A 2G8HA 1I39A 4CGJA 3L2WA 2F8TA 3KK2A 2HHXA 3AVHA 1WNSA 4Y1CA 5CZ2A 2HVHA 2ITGA 2YHBA 3MXIA 1NJXA 4C8OA 1GOAA 5SZTA 3OS2A 1TL1A 3ZT4A 4B08A 1XC9A 1TKZA 2KQ2A 4HVJA 3SZ2A 3OYFA 2A1RA 1D8YA 1RBVA 2ZE2A 3NFAA 4BE2A 4DQIA 4I9QA 3RMCA 4E7KA 1VSLA 3NAEA 3HPOA 3NE6A 1ZBIA 1TKXA 4CEBA 4KHSA 4Z4CA 1RDBA 5I3UA 3RMBA 3KK3A 2XRIA 1BQNA 4RW4A 4CHYA 1QQCA 3SYZA 5KRTA 1A5WA 4M3WA 2HNYA 1YTAA 4OKKA 2ATQA 4CF0A 5CYQA 3ZT0A 4OLAA 4CJVA 2QK9A 1LWCA 3SQ0A 3I0SA 1NK0A 4K8XA 3CFOA 3FFIA 3IS9A 3WNHA 4CK3A 4XIUA 1GOCA 5I42A 2PY5A 4BWMA 1NK4A 4BACA 3LWLA 4N56A 4FW2A 3OYCA 3MEGA 4CJRA 3LZIA 1EETA 2VWKA 5FROA 4CEZA 4DFKA 4BWJA 1UWBA 1HNIA 3TARA 3OYAA 4WE1A 2FBVA 4B9NA 1JL2A 4DTOA 3ZSVA 1RBSA 3HP9A 4CHPA 3NF7A 4O0JA 4OVLA 3OYMA 2G8UA 4FJHA 1VSDA 4J2EA 3NGYA 3NHGA 1KFSA 4IKFA 2G8KA 2Z1HA 2YNIA 1HYSA 4HTUA 4LD0A 4DTRA 4CHZA 3QEPA 3EZ5A 4FK4A 2EHGA 5KI6A 3S3OA 3KLHA 4FLWA 3KKRA 3EYZA 3ZT2A 3VQ8A 1NKEA 2VG6A 3AVKA 1RT2A 4AHSA 3NDKA 3AVGA 1SKWA 3C6UA 1RDDA 4BE0A 2BDPA 2QKKA 1TK5A 3OYHA 1VSIA 3VQ6A 1RDAA 5HP1A 3VQQA 1NKCA 4CERA 1X9WA 3VN5A 3WNEA 1XI1A 1RT4A 4HUGA 4ICLA 3RR7A 4Q0BA 4CJEA 4Z4GA 2IOCA 4M45A 4CEDA 3SV3A 4EZ6A 3K5OA 3ALYA 4MFBA 4Z4EA 3KLEA 1K6YA 4C8KA 1SL1A 4DTNA 4DSLA 3VQ4A 1S5JA 4FZXC 3AVJA 1TAQA 3RR8A 4IBNA 3PO4A 3K57A 2XY7A 4CHNA 3K5MA 3OYKA 1JLCA 3KK1A 1W9HA 3D0PA 3TWHA 2XY6A 4B9UA 3UIQA 1HQUA 2G8IA 3IRXA 4E7HA 5C42A 1CZ9A 3M8QA 1S6QA 3HVRA 4BE1A 5FRNA 3L2VA 3V6DA 1JLGA 3LP2A 4FJ5A 4NCBA 3OYGA 1VK0A 3QETA 4JS4A 4CIGA 2E4LA 3KLFA 3TAGA 2EX3A 1QTMA 4DQRA 4N47A 1T05A 4FJGA 4FJNA 4MQ3A 2NUBA 1REVA 2HHQA 2KZZA 1JL1A 3C6TA 3ITHA 4LH5A 4KKOA 1RT5A 3L3VA 4FLXA 3NF6A 3SQ2A 4E89A 1HNVA 1U4BA 1WN7A 3VQ5A 1JLAA 3AVAA 4DQQA 2KZMA 1B92A 1NOZA 3TAPA 4CFAA 4E7JA 1RNHA 3P5JA 1BI4A 1JXEA 3QO9A 5E41A 3SQ1A 1C1AA 1S1UA 3OJUA 2KFZA 4OKJA 1BL3A 1FK9A 2GBZA 4KPYA 1VSEA 1U48A 4W5TA 4CJTA 4FJKA 4FM0A 4HHTA 2D0CA 4W5QA 4NYFA 3PV8A 1C1BA 1TV6A 1IG9A 3MEDA 4LSNA 4O0IA 4TSXA 4KB0A 4ZTFA 5T7BA 2R7YA 2OYQA 3MAQA 3AA5X 2YKMA 1SUQA 3KLIA 1J53A 1KVBA 2KW4A 2B4JA 4RW8A 3CG7A 3QEVA 4CJPA 4KI4A 3RTVA 1X9SA 5J1EA 3VQAA 4CJWA 3HSTB 4E19A 4Z4IA 2RF2A 4O44A 4CF2A 1RT7A 4M3XA 1U47A 2OPRA 3F9KA 2WONA 5HROA 1HRHA 1NKBA 4E0DA 4FM1A 4JS5A 4IDKA 1EXQA 5KTQA 4M3YA 3SCXA 1HPZA 3QEIA 1HMVA 3SPYA 3JSMA 3V9WA 4CEAA 1Z25A 3QIPA 3DLEA 4DSFA 4HCCA 1SKRA 3HYFA 3NF8A 4DS5A 1B9FA 1RBUA 1SKSA 4IG3A 3L2RA 3VA0A 2RKIA 4JRPA 1BIUA 3AVIA 4CFDA 1ITGA 1XHXA 2YV0X 3QNOA 2OZSA 1Q8IA 4CEEA 1D9DA 3AA2A 3AVLA 4I2QA 5K14A 2FBXA 3NF9A 4Z4FA 2KTQA 2QXFA 2YNHA 3ZCMA 1BISA 2Z1GA 3NGZA 3S3NA 4E1MA 4KFBA 2XY8A 2HHVA 3WNFA 2B5JA 4RW7A 1C0MA 1IH7A 1VSKA 1VSJA 3CFRA 1QSLA 3ZT3A 4QCLA 3AO1A 3SUOA 4E1NA 2PYLA 1L3UA 5FDLA 4CECA 4KTZA 5J2PA 3DLRA 4BDPA 2D0BA 1HJRA 4JLHA 3OS0A 3MXJA 3QESA 1YT3A 1ASUA 3HM9A 5DK5A 3AO3A 4CF1A 4CJ5A 3ZSYA 1ZBUA 4CEFA 4F2RA 2YHAA 3V1OA 4FLZA 1TGOA 3A2FA 4I2PA 4FJIA 5CYMA 3THVA 1MU2A 2Q3SA 2YKNA 3OJSA 2JGUA 2F8SA 4K8ZA 3VQ9A 4M3ZA 1X9MA 1S6PA 3T1AA 1WSJA 1R0AA 1SL2A 3E01A 3NH2A 4KO0A 1WAFA 2FC0A 2IGIA 2W42A 2XY5A 1YVUA 4J2AA 3SUNA 5C25A 1VRUA 3U3YA 4FM2A 1LW0A 3V9XA 3HP6A 1C0UA 2VG7A 3K2PA 4NYNA 1FKOA 2IC3A 1SV5A 4DSEA 1L3SA 1KRPA 2DFFA 1L3TA 5JS2A 4KHNA 5SWMA 1IKXA 4AHRA 3SUPA 4CEOA 1S9EA 3VQBA 1UA0A 2PYJA 1C6VA 3TI0A 3AA3A 3CQ8A 2Z1IA 3C95A 1KVAA 4BDYA 2HNZA 3MXMA 3OS1A 5HBMA 1ZBHA 4GMJB 3U6FA 2X74A 3IG1A 2I5JA 4LSLA 3L2UA 3DOKA 3QEWA 1HQEA 1JXBA 1VSFA 4DTUA 1KVCA 2DY4A 4FJ7A 4FK2A 1TKTA 3MEEA 4KHYA 3VQEA 3QNNA 1TVRA 1F21A
chains in the Genus database with same CATH superfamily
2ASMA 3SAGA 3WEEB 3VQDA 3O08A 3DLGA 4H0YB 5JICA 1Y64A 3V9UA 4YNQA 3UE5A 2P5GA 2Q31A 3B6OA 4BRNA 3WXLA 4H8KA 2PZSA 2QWQA 3LPUA 4BRPA 2X6SA 4FZYA 4A2BA 4DFPA 4R5PA 3T19A 1NK9A 4XEIA 1FXXA 2I7PA 1U6ZA 3CCRN 1KCFA 2HB5A 2HHTA 4BC5A 5AQPA 4FLTA 1BOTO 4CJUA 4KBOA 5HRSA 3M8SA 2A41A 5HRRA 2OZMA 3CCUN 4H4OA 3EZWA 3L2QA 5C2DA 5KRSA 4Y1DA 4B9VA 3PLAA 4DTMA 1QQMA 3ZSWA 4PUOA 3ASMA 3W0LA 3LDSA 1Q9XA 2E5LK 1T44A 4DQSA 4CJQA 4CJLA 4CIEA 2I7NA 1S1WA 3P83D 5JVGL 1VQMN 1DTQA 4FL9A 1LWEA 2ZGZA 3A5MC 1UA1A 4PWDA 3ZLJA 5LL6Z 3C6AA 4H0PA 4BC2A 1Q9YA 3THYA 3ZSZA 3O3FA 2YHWA 3BGRA 4CK2A 3J81O 4ELUA 4HCBA 3BF1A 3CCMN 4OX9K 1EO1A 4FLYA 4KHQA 1XC3A 3O3GA 4FWPA 2FXUA 1RBTA 3CJBA 2HHHK 3SV4A 1WSIA 4FW1A 3ZX3A 2IDOA 1NGBA 1LW2A 3HJFA 1RTJA 2VGMA 4FLVA 2F96A 4OPKA 3VGKA 4FWRA 4WCEL 2QW9A 3QLHA 1BG3A 4IXCA 1DEJA 5F0XA 4UQGA 1BDGA 2QWOA 4A61A 4B1XB 3CM6A 3M5RA 1BI4B 3LALA 4HTLA 4IOXA 4BR0A 1CZBA 4HUEA 4OLBA 1T6CA 3D6RA 3PY8A 1YTUA 1NJIO 3KJVA 1ZXOA 4JD2B 2O8BA 2NRRA 3P39A 4GV3A 4FOEA 3L4QA 1HKCA 4CIFA 2IAJA 4AH9A 4O8UA 5EXWA 4CGHA 3C7NB 5AZIB 3J8AA 4PY5A 4BGAA 2P9UB 4KTQA 4DV3K 1D9FA 4B3RK 1BGXT 2GX9A 3V1QA 2ZWHA 2V51B 2P9IA 3CYMA 1BHLA 5CZ1A 3NBPA 1HUXA 4B1YB 3MN6A 2ZJPL 3VEXA 3LANA 1J54A 1ATRA 3DRPA 1QZ6A 1BIZA 5J2QA 3P38A 3ENBA 2FBYA 2HNDA 3DLKA 3DXMB 4LFAK 4N76A 1KFDA 5C24A 3ISNC 3LP3A 4W5OA 3OVNA 1A5VA 5F2RA 2HBLA 2HBMA 4CGIA 2NZTA 3K5NA 3VGMA 2V52B 3OYNA 3TTFA 3L0QA 3FZFA 3GL1A 4H5TA 4BQLA 1KD1O 2Q97A 3L4IA 2E2NA 3VEWA 3AO4A 5EY4A 4JNEA 2QA4N 3LDPA 2P51A 3LM2A 3AVBA 1IBLK 4B8AB 3TAEA 4DV2K 2GUIA 4DFJA 4FJJA 3ZX0A 3T1HK 4J2BA 3O8MA 3KD5E 2UXBK 4NCAA 4H5WA 3DYAA 1Z26A 3Q7BA 4LH4A 5GINA 3M3ZA 3O6WA 1L5UA 4EAHD 4EP4A 1IBKK 1U45A 4DLGA 4GVMA 4CGDA 5LY3A 1JLBA 1EP4A 1S1XA 4H5NA 4GV6A 1KTQA 3QINA 1IKWA 1KXPA 2O8CA 4CZKA 2HHXA 4WFAL 2W6LA 5SZTA 3RVCA 3D2EB 3CPEA 4B1UB 4B08A 1XC9A 5AQLA 1TKZA 4HVJA 3UKUB 3MCAB 4I9QA 1VSLA 4OPHA 3NE6A 4JHDA 4F9OA 4Z4CA 1RDBA 2XRIA 1BQNA 4RW4A 5A2QO 3SYZA 5KRTA 3IDHA 3O1BA 2UUAK 2ATQA 4BREA 2A6AA 3S41A 3SLCA 2O8DA 4FO0A 4CJVA 1N36K 4K8XA 3CFOA 5MLCQ 5I42A 1NGGA 4JI2K 4CEZA 1MDUB 1HNIA 5AQRA 4WE1A 3OYAA 4JI5K 4X65K 1RBSA 4O0JA 4H0OA 3OYMA 1KFSA 2G8KA 2YNIA 5AFUH 4AF1A 4X66K 3OTOK 2EHGA 4B9QA 2O8DB 3ZT2A 2P9SB 4YOUA 3R6MA 3EE9A 1TK5A 3VQQA 1X9WA 3WNEA 4Q0BA 5C2FA 2YHXA 3K5OA 4MFBA 1K6YA 4DTNA 3K9KA 3EKSA 3O9UA 3ID8A 1C0FA 3CJ1A 4CHNA 2O8FA 2NRZA 2G8IA 3IRXA 1FJGK 3M8QA 3HVRA 3THXB 3V6DA 2ASPA 4AM6A 4DUZK 3QDKA 2E4LA 2EX3A 5AZJB 3THXA 1VAZA 2FSKA 2Q0RA 3HI0A 4CZHA 4MLHA 3N4QA 2A40A 4WF9L 5BR8K 3FZLA 5AZIA 1U4BA 1W7AA 1WN7A 3TAPA 4E7JA 1YJ9N 5AQUA 3TU5A 3H3OB 1S1UA 4DR6K 4OKJA 4B1ZA 1VSEA 4FJKA 1NGAA 3PV8A 1IG9A 4ZTFA 3MAQA 3JXUA 1SUQA 3KLIA 1KVBA 5HL7L 2CH5A 4CJPA 3RTVA 5JMVA 4YOVA 4KI4A 1ZBSA 1FW6A 2RF2A 4H5RA 2Q36A 4C23A 2WTUA 2OPRA 3CJ7A 2WONA 4E0DA 4FM1A 1J5EK 4JS5A 3VETA 1EXQA 3SCXA 1HPZA 3DLEA 3HYFA 4IG3A 3VA0A 2RKIA 5ADXA 4CFDA 3QBWA 3SMPA 3NF9A 4Z4FA 4JEPA 3CETA 3WNFA 4RW7A 1EWQA 1HJOA 1QSLA 1L3UA 5BPMA 4KTZA 3DLRA 1HJRA 2YCHA 1YT3A 3ZYYX 4BC3A 4CJ5A 3CCEN 3ZSYA 1ZBUA 4CEFA 1ATSA 3ATUA 1TGOA 4JKCA 2Q3SA 3U4LA 3OJSA 1KC8O 1NU0A 4EIAA 3VENA 3E01A 1SL2A 3CCQN 1YVUA 3SBTA 1VQNN 2A42A 5C25A 1VRUA 3U3YA 4GV9A 2O8CB 5C0YA 1VQ4N 4DSEA 1X3NA 3ENOA 2DFFA 4MO4A 3SUPA 4DUYK 1S9EA 4H0XB 3VQBA 1UA0A 3QFUA 5BPNA 5M1FA 2GWKA 3CQ8A 2Z1IA 3H46O 1KVAA 3MXMA 2HNZA 3OS1A 4GMJB 1WUAA 2X74A 3DOKA 2FF6A 3SK3A 2DY4A 3MWTA 1ATNA 1TVRA 1F21A 4E7IA 3ZEUB 3FZMA 2OPPA 3P1GA 3MECA 2OPQA 4YOTA 5C12A 1NOYA 3VMFB 3DMJA 5TKWA 3ULDA 3OY9A 3HTVA 4AHVA 3R8EA 3LAMA 4PQUA 3O4NA 4JI0K 4N41A 4BRHA 5AQJA 5AFUA 1T3VA 4ILGB 4O5BA 5LMUK 5JS1A 2X78A 3RSEA 4FOIA 1GOBA 2BH1A 1JLQA 3S9HA 1RBRA 1OVYA 5F1XA 2W6KA 5FPDA 1EX4A 2F9TA 3HPHA 3ULEA 3WUHA 3QFPA 3KZBA 1S3XA 4C8MA 1RT1A 3H1QA 3DLHA 2D0AA 1NGFA 4I6MA 4M3UA 3W3DA 2Q1NA 3G10A 3C94A 3CCJN 3JYTA 3U3GA 4W5RA 1GLFO 3SJJA 4DU3A 1TK0A 2HHWA 3SNNA 2ITMA 1LAVA 3OYDA 4NO7A 3QEXA 4E7LA 4F4KA 4BDZA 1G15A 3E1YA 3KHYA 5BPLA 4CK1A 3HT3A 1NJZA 3KD1E 5EOYA 1GLLO 4B3SK 3SUQA 2VQEK 1I3AA 2UUBK 1HYZA 3MX5A 1ZBLA 3QMLA 4CF9A 5AQVA 4JKBA 4KHWA 2G8FA 3I56N 3G0ZA 2XO7A 4CJSA 3WEEA 4FWMA 4BVOA 1XUPO 1U49A 2P5OA 1Q82O 4FJXA 3OYIA 1Q86O 1HNWK 5AQNA 1S1TA 2HMIA 4B9TA 3B8AX 4OKEA 3RMAA 3V9ZA 2G8VA 3DI6A 1VQ8N 4V19S 1QE1A 3IAYA 1YF5L 3CPWM 5IT9O 2JLEA 4JKDA 2UXDK 4ID1A 4DTSA 4JKHA 1MA9B 3SJHA 5D3GA 4H5VA 1RT3A 3NCIA 2NLXA 1J9AA 3FZHA 4YOXA 4Z94A 4CF8A 3LP0A 3G6EN 4I7FA 3WNGA 5BRFA 2OA8A 1NK6A 3TABA 4IWVA 3LAKA 1WLJA 2O4IA 2HVIA 2KFNA 2RN2A 1O1WA 4ID5A 4BRQA 2KHOA 4C8LA 3OBYA 1S72N 3PIPL 1WSFA 4BVPA 5M1QA 4DG1A 3LWMA 3KVGA 3E9LA 3O9RA 1NGJA 2QI2A 4M42A 3O4QA 4B3MK 4Z4HA 4WFNL 3DXKB 3OYJA 2ASOA 4HWIA 3KKSA 3D2FA 3ZSQA 2E6LA 3VQ7A 3CJ9A 2D5RA 4B9SA 4DF8A 2P9LA 1D5AA 4CJFA 3RWUA 2UYTA 1U04A 3VQCA 4CJ7A 4CESA 4M41A 4DR2K 3RRGA 5EX5A 1RTDA 4BR9A 2VYPA 2IS3A 2LSNA 3VERA 3AAQA 2GV9A 5BN8A 1NK8A 2DFHA 4KTWA 3UB5A 1JLEA 2E20A 3F73A 4B1VA 3SPZA 3SI6A 2ZGYA 3ULEB 4B9MA 4YFUA 3CMAN 3DRSA 4Z0UA 1OH6A 1YI2N 1S9GA 4FJMA 4MO5A 1VSHA 4DR4K 3DXMA 3BZCA 2E88A 3O9SA 4JD2A 3THWB 1CLQA 2CGLA 1T03A 4XH1A 4MDBA 1WNSA 4Y1CA 1YJWN 4IJNA 4CZIA 4OO1J 1DT9A 1YIJN 1RBVA 3MX2A 4DV6K 4E7KA 3RMCA 3NAEA 3WXKA 1VQLN 5AQFA 3LDNA 4BRDA 4IDHA 1NBWA 5I3UA 3RMBA 4CHYA 1J6ZA 1A5WA 3VEVA 2HNYA 2E1YA 4CF0A 1YVNA 5CYQA 4OLAA 1NG9A 4DCHA 1NMDA 3I0SA 3WNHA 4CK3A 2O8BB 1XNRK 5AQIA 4FW2A 1G99A 3OYCA 3MEGA 4DV4K 3C0BA 4WQ4C 4BWJA 1UWBA 2FBVA 3JAMO 3UKRB 2VCPA 4CHPA 4GNIA 2Z1HA 3D2EA 4ILHA 4HTUA 3P4IA 5GIPA 4BR2A 3LL3A 4CZLA 3EZ5A 4FK4A 2OTLN 4WQ5A 5KI6A 1YJNN 1SKWA 4AHSA 3TSQA 1BA0A 1RDDA 4LF9K 1YHQN 2QWRA 5BREA 1NKCA 4YOYA 4R79A 3EL2A 3RR7A 4BR5A 4CJEA 2GEMA 2HBKA 2IOCA 4M45A 4CEDA 4EZ6A 4Z4GA 1C0GA 4Z4EA 4BRMA 3IMXA 1WB9A 4FZXC 2A5XA 1H1VA 3O9TA 5AQTA 4BRIA 5BRDA 4IBNA 3H6EA 4LF6K 1W9HA 2RE2A 2XY6A 4B9UA 1VQ6N 4BG9A 5C42A 1CZ9A 5FRNA 1KAZA 1JLGA 3CHWA 1VQ5N 4NCBA 4JAXA 3DJCA 5M1KA 1CZAN 3SMSA 1HLUA 1W2BM 2YHYA 4JI6K 4A57A 4FJNA 2QWLA 2KZZA 3GG4A 3EO3A 4FLXA 3NF6A 2VWBA 1JLAA 1B92A 1BO5O 2ZF5O 4JYAK 3QO9A 3F9MA 4KPYA 1BL3A 4W5TA 4CJTA 4DR1K 4HHTA 2D0CA 4W5QA 4NYFA 4JKGA 4FM0A 1TV6A 2HF4A 3MEDA 2P9NB 4KB0A 3PIOL 2OYQA 2W40A 3AA5X 2QWNA 1TYQB 4CI6A 2QTDA 4MLEA 1NGCA 3QEVA 5J1EA 4IOAL 3O5BA 5CR4A 4LFCK 4CF2A 2E2OA 5HROA 1NKBA 1NMNA 1HRHA 4LF4K 3TSUA 5KTQA 3SPYA 3QEIA 3CQYA 3JSMA 4BRGA 3NMUA 4DSFA 4O8KA 3NF8A 4KH4A 3QNOA 3HSCA 3VEYA 4A5AA 3VEZA 2ZJRL 4I2QA 5K14A 4LF7K 2Z1GA 2VGNA 2HHVA 1C0MA 3M1FA 1VSJA 4QCLA 3SUOA 5FDLA 4DKWA 4JLHA 3R9PA 2EWSA 4FWQA 3MXJA 4CZFA 4CF1A 4F2RA 2YHAA 4FLZA 1OKJA 3A2FA 3ZETB 1MU2A 2YKNA 2NRWA 2JGUA 2F8SA 4BG8A 3NVMA 4A62A 1TYQA 5H1SQ 4NXNK 2D0PA 1IV0A 2GELA 4I6MB 1WSJA 3MN5A 3NH2A 1WAFA 2IGIA 2XY5A 5C15A 2VG7A 3K2PA 2WC9A 4FWLA 1L3SA 2AA4A 1L3TA 3J7YP 5SWMA 4XH5A 4CEOA 1C6VA 3TI0A 3C95A 3SBGA 3E9PA 3U6FA 1NGIA 1RDUA 4DQ8A 4FJ5A 4M63C 3QEWA 3FFKB 4IO8A 1KVCA 3VOVA 1JCGA 3K59A 4QS8A 1NJWA 4LF5K 3CQXA 3HVTA 2A1SA 1JKHA 4DS4A 1VQKN 3V81A 2HMPA 5CY4A 4B3TK 4M3TA 2WUSA 4AHUA 2YI1A 4DU1A 3ZSRA 3M8PA 4C1NK 3K9JA 4E1JA 1NWKA 4C1NI 4DU4A 3CCLN 3LDOA 4CZMA 1QQNA 1N34K 4IJAA 2QKBA 4RCHA 3BDPA 3AAPA 3OW2M 3AGKA 1T7PA 4ISGA 2NNWA 1KSPA 3A0IX 3OYLA 4RW9A 3H08A 2VG5A 1NK5A 2BTFA 4QOZB 2OPSA 4GY2B 1TAUA 4CJ4A 3I8BA 3QB0A 3CC4N 3SQ4A 4DR3K 4CE9A 1A5XA 2GUPA 4FPAA 3PX0A 1RILA 1SS6A 4GVEA 4DR7K 2Y1IA 2RPIA 2HHSA 4KHPK 4CHQA 4CGGA 5FRMA 4F8RA 4M7XA 3PUFA 3GDQA 2B6AA 3UKUA 2ZJQL 3V4IA 5HLFA 4CD1A 3L6QA 3HXMA 4JHDB 3MK6A 4DWIA 1LWFA 1GLCG 1TUYA 5KGXA 3LP1A 4JKGB 1R59O 2ETJA 3LZJA 4NCGA 3G71N 1JJ2M 2DFEA 4RG8A 3ZEUA 3P31A 3DRRA 1ZBFA 3LDQA 1WSEA 3NH1A 1RTIA 4CJ3A 5FPMA 2D1KA 1N6QA 3O1WA 3K58A 4DTPA 2DPNA 3HBTA 1VSMA 3MMVA 1BCOA 4QAGA 3V9SA 2BGGA 4G9ZA 1QZ5A 3K5LA 4CZGA 4KH5A 1HNZK 5BR9A 1BCMA 4IG0A 2QEXN 2HW3A 3ZT1A 4DV1K 1QS4A 3NGIA 3AVFA 4ELVA 3OBWA 4DF4A 2FBTA 4WYBA 1YITN 1VQON 4RW6A 5KGWA 4YY3K 4DTJA 4JN4A 2P9IB 3VQPA 4KAZA 3EE8A 2E6MA 3VESA 4ZTJA 1RTHA 4EP5A 1S1VA 3SAFA 2ZD1A 4ISFA 2HBJA 2WOMA 4CFBA 4X64K 2YNFA 4KHUA 2P9KA 4WQ5C 1XWLA 1RCHA 1NLVA 2HSTA 2DTUA 2FLOA 4DLEA 2VWJA 1HYVA 5E26A 2GWJA 1HPMA 3PX6A 4L8RB 4K43A 3AVCA 3TANA 4FJ8A 3CMEN 4DQPA 3AV9A 4FZZA 4B3OA 1XMQK 4O55A 1HX1A 3ZSOA 3MCPA 1CXUA 4LY7A 4U67L 3I8DA 5AQYA 4CZEA 3L8BA 2AJQA 3FGUA 1GLAG 4FWKA 4HUFA 1J5OA 3CJAA 4CCHA 1TKDA 1KQSM 3AVMA 4O4GA 1WAJA 1SL0A 3VF2A 4IOCL 1UAXA 3D45A 2UUCK 5EVZA 3CFPA 4EHUA 3L3UA 4IFVA 1WSGA 2O8EA 4KB1A 1C0TA 2Z1JA 1KAXA 1IKYA 1NM1A 4CBWA 4DMNA 4F3TA 1KLMA 4CEQA 3KWGA 3BUZB 3KTQA 3GE1A 3LPTA 4YORA 5AQHA 3MN7A 2XHBA 4DTXA 3M8RA 1IKVA 2V7ZA 4Q5VA 3KLGA 3VEOA 1NJYA 2F9WA 5M1OA 3PO5A 1K73O 1BQMA 3B6PA 3PX4A 4IEIA 3RMDA 5DMRA 2OANA 2HOEA 3AO2A 3DM2A 4E3SA 1JCFA 5CHIA 4W5NA 1WBDA 3BZKA 1OH5A 2E2QA 1LAWA 3ZX2A 1T6DA 1CXQA 4GKKK 4LF8K 4BY9C 4CGJA 1NNEA 1U2VB 3L2WA 2F8TA 3BP8A 3AVHA 5CZ2A 2HVHA 3MXIA 2YHBA 1NJXA 4C8OA 1GOAA 2A3ZA 3BY5A 1M1KO 2RHKA 3ZT4A 3D7EO 4JI1K 3H45C 3SZ2A 3BF3A 2A1RA 2F4VK 1D8YA 2ZE2A 3NFAA 1V4TA 4YHHK 4BRLA 3CC7N 4BR4A 2O8EB 1TKXA 4KHSA 3KK3A 4ILJA 1YUWA 2P9KB 4M3WA 3VF4A 4K25A 2NRVA 4OKKA 1KAYA 2D0OA 3JS6A 2QK9A 3SQ0A 1NK0A 4J8FA 3FFIA 2CH6A 1GOCA 5GAEP 4BWMA 4BACA 1K8KA 5AQMA 4IZ9A 3OHRA 4DFKA 4RWTA 3PSIA 2PFUA 3TARA 4FSVA 4DTOA 2P9LB 3HP9A 4DHYA 4OVLA 1EWRA 1VSDA 3NGYA 4IFEA 5KQ8A 1TUUA 4CHZA 3QEPA 1MWMA 3S3OA 4FLWA 3KKRA 3EYZA 3VQ8A 1NKEA 2VG6A 3AVKA 1RT2A 3AVGA 3C6UA 4BE0A 2QKKA 1VSIA 5HP1A 3O9QA 4CERA 2PBDA 3VN5A 1XI1A 4HUGA 4ICLA 5IWAK 3FR0A 3SV3A 3ALYA 1GLDG 3VGLA 4DSLA 3A5LC 1S5JA 1ZC6A 3AVJA 5ADXH 3PO4A 3K57A 4PKGA 3K5MA 3OYKA 1JLCA 3A5OC 1BWFO 4M7YA 1HQUA 2P9SA 4BQZA 1S6QA 3I55N 4BE1A 3IUCA 3L2VA 1K8KB 3LP2A 3OYGA 3QETA 5AQGA 3MWPA 3KLFA 5M1NA 1QTMA 4IEEA 3FE1A 1T05A 1RGIA 2P9PA 2HHQA 1ILYA 3L3VA 2CGKA 3QICA 4E89A 2O8FB 1HNVA 3VQ5A 3AVAA 2KZMA 4DQQA 4CFAA 5AQOA 1BI4A 1JXEA 4DB3A 3SQ1A 1C1AA 4CW7B 3LDLA 1FK9A 1U48A 5KPRA 1YXQA 4LSNA 4O0IA 5T7BA 2YKMA 4JKFA 4RW8A 2IVPA 5KPZA 1Z05A 3VQAA 4Z4IA 3HSTB 4O44A 3IFRA 1RT7A 3HRGA 3F9KA 1IJJA 5FPEA 1Q18A 1E4FT 1DGKN 2QWMA 3V9WA 4CEAA 1Z25A 3QIPA 4HCCA 1SKRA 4MDAA 4BROA 1B9FA 1RBUA 3G4SN 3L2RA 1GLEG 4JRPA 1BIUA 3OA9A 3WXIA 4NB4A 3AVIA 3CD6N 2YV0X 4K41A 5E84A 3TTDA 1D9DA 3AA2A 1NGDA 2NRXA 2KTQA 2FBXA 2P9PB 3A8YA 2YX6A 2YNHA 4FWNA 1BISA 3ZCMA 4NLBA 4E1MA 4KFBA 2XY8A 1N33K 4BRKA 3CFRA 3ZT3A 3AO1A 3O80A 4U7BA 1I94K 4E1NA 5JLHA 4CECA 5J2PA 3AY9A 4BDPA 2AP1A 3OS0A 3QESA 3I33A 5LJVA 3HM9A 5DK5A 4JKEA 4JKAA 1SZ2A 1JCEA 4FJIA 5CYMA 3THVA 4AM7A 4BRAA 3VQ9A 4M3ZA 5LJWA 4LFBK 1SAZA 1S6PA 3T1AA 3QBXA 2W42A 2FC0A 3EEQA 4FM2A 1LW0A 3HP6A 2IC3A 1SV5A 4LC9B 2Q0UA 1S22A 4KHNA 3THYB 1IKXA 4AHRA 3HOTA 1ZBHA 3IG1A 4LSLA 2I5JA 3E66A 3L2UA 1JXBA 4JI4K 4FJ7A 4FK2A 2P9NA 3MEEA 3AGRA 3VQEA 3TSPA 3D0PA 3QNNA 4N5SA 4JI7K 5HOOA 3CJCA 1FKPA 3G25A 4UY8O 1SQKA 3EY1A 4PKHA 3VF6A 3D2FB 1N32K 2KKZA 5AQWA 4QS9A 2BE2A 3AO5A 4DR5K 1VQ7N 4G1QA 5B8HA 3TTCA 3OYEA 4FYDA 4IFYA 2BANA 4FJ9A 1RDWX 4OPJA 3H3NO 4DSKA 4GKJK 1VQPN 1D4XA 5AJ3K 4CGFA 3AA4A 4M3RA 1L3VA 1GLBG 4X62K 1IBMK 4DV7K 5JVHL 1N5YA 1QHTA 4EFHA 4FK0A 4B8CA 4NXMK 3CC2N 4I9LA 4H4MA 5J2NA 3C65A 3T3FA 4YOWA 3EKUA 2VQFK 5FLXO 3RSEB 2CGJA 3CM5A 4FVMA 3U8XA 4H0VB 2E2PA 3OYBA 3TAQA 2IVNA 1VHXA 2YJFA 4FCYA 3TR8A 2FSJA 1NGHA 3I0RA 1KLNA 4B1WB 3GBTA 4PKIA 2OTJN 1MWKA 4L3QA 4CD3A 5AR0A 3TAFA 4FJLA 1VRTA 2ZM6K 3CF5L 1Q81O 1Y97A 3H1VX 5GAHP 1V4SA 3HK2A 3NH0A 5AQZA 1W97L 4AILC 4AQYK 4YDUC 4KH6A 1B9DA 4H03B 4C8NA 3QERA 1LOTB 3T7ZA 3C6HA 1DTTA 3BEXA 3HL8A 3ID6A 3WXMB 1WSHA 3AVNA 1XHZA 3EN9A 5TKYA 4DSIA 2ZQBA 1IO2A 1BU6O 4FLUA 4EZ9A 1RDCA 4CJKA 4JRQA 4F3OA 2UU9K 3PSFA 4KRFA 3CXCM 1NK7A 1HKGA 4OGCA 5HRNA 4JI3K 1NGEA 1BA1A 1WBBA 5BN9A 3S3MA 1EQYA 4YDUA 3DOLA 3IKMA 3KWIA 4O5FA 1VQ9N 4F2SA 1C1CA 1RT6A 1QSYA 1EKEA 3J80O 4AHCA 2D4WA 1T8EA 1LV5A 5GAGP 4ZHRA 1OH7A 4A59A 1GLJO 4QS7A 4A5BA 3WQUA 3RRHA 1ASWA 1JLFA 3R3LA 5DM7L 2X6NA 2O4GA 3HO1A 5BRHA 3CIPA 3U9ZA 1ZYQA 2YNGA 3O3HA 1XQSC 4CHOA 4H0TB 4KREA 3DAWA 2W41A 1ASVA 1X1PA 4PL8A 4J2DA 3QIOA 1RFQA 3HZ6A 4RTFD 1DLOA 2J4RA 4ELTA 1QSSA 3E9OA 3CCVN 2Y1JA 4CVNE 4CBXA 4BRCA 1X9JA 2UXCK 4KV8A 4CFCA 3J7AP 5AQSA 5AQXA 4OJRA 3ATVA 2JWLA 4KI6A 3CI5A 4Y0WA 3V1RA 5M1PA 1W0HA 4AHTA 5GIOA 2P1JA 2Q2RA 4WFBL 3ZSXA 3MN9A 4B9LA 3DLBA 3KIOA 5C10A 1O13A 4ISEA 1TL3A 2FSNA 3TAMA 5HRPA 2QXLA 2KLAA 1ESVA 2HHUA 1Z6RA 4BC4A 3HPGA 3M6GA 4PA1A 3TPQA 4DFMA 3T1YK 5LMNK 4OGEA 4DSJA 5J2MA 1HKBA 4K42A 1UOCA 4PHTX 2G8WA 3SAHA 2H3GX 4CBUA 4GW6A 4FXDA 3VA3A 2P9UA 4DV0K 1QVGM 5EU7A 1TK8A 2G8HA 1I39A 3R1XA 3KK2A 1DKGD 2ITGA 1HNXK 3OS2A 1TL1A 4FWOA 2KQ2A 3OYFA 3ZETA 4DQIA 4BE2A 2F7TA 3HPOA 1ZBIA 4CEBA 4JV5K 5JLFA 1QQCA 4OPAA 3VPZA 3FZKA 1YTAA 2E8AA 3U9DA 2BUPA 3ZT0A 1E4GT 1K8AO 1LWCA 3CCSN 3IS9A 3LM9A 1P8ZA 4XIUA 3K0SA 2PY5A 1NK4A 3LWLA 5DM6L 4N56A 2PAVA 4CJRA 3LZIA 1EETA 1P90A 2VWKA 5FROA 4B9NA 1JL2A 4JK7A 3ENHA 3HM8A 3WQTA 3ZSVA 1Q7YO 3F5TA 2GTDA 3NF7A 5I9EB 4FJHA 2G8UA 4J2EA 3NHGA 4IKFA 1K9MO 1HYSA 4BRFA 4LD0A 1QHAA 4DTRA 2V7YA 3KLHA 3NDKA 3AARA 2BDPA 1OVQA 2WBNA 3OYHA 3VQ6A 2WFBA 1RDAA 3VTIA 1RT4A 5AQQA 1LCUA 1E3MA 2IIRA 3UKRA 2FF3B 3KLEA 4C8KA 4K0KK 1SL1A 3HOSA 3VQ4A 5GADP 1TAQA 3RR8A 1XMOK 2XY7A 1QQOA 2JWKA 3TWHA 5KQDA 3KK1A 1XNQK 3UIQA 4BGBA 4JK8A 3GOIA 4E7HA 4WQ4A 2QM1A 3KK7A 1N8RO 3WXJA 4FVUA 1VK0A 4JS4A 4CIGA 3A5NC 3TAGA 3DLLL 4DQRA 4JK9A 4N47A 4FJGA 4MQ3A 3T69A 3F2KA 2NUBA 1REVA 1JL1A 4LH5A 3C6TA 3ITHA 4KKOA 1RT5A 4DV5K 3DWLA 3SQ2A 3WT0A 3FLCO 1U2VA 2NRHA 1NOZA 1BUPA 1RNHA 3P5JA 5E41A 3OJUA 2KFZA 2GBZA 1HR0K 1X3MA 1C1BA 4TSXA 2R7YA 4FPBA 1J53A 2KW4A 2B4JA 5FPNA 3CG7A 1X9SA 4CJWA 4E19A 4M3XA 1U47A 4IDKA 4M3YA 3Q7CA 1HMVA 2YJEA 4DS5A 3NVKA 1SKSA 3MDQA 4CZJA 1OH8A 4IO9L 1ITGA 1XHXA 2OZSA 1Q8IA 4CEEA 2NRTA 1WOQA 3AVLA 3O4WA 2QXFA 3NGZA 3S3NA 2B5JA 1IH7A 1VSKA 4BR7A 2PYLA 1M90O 2D0BA 4JI8K 1QVFM 1ASUA 5AZJA 2HF3A 3AO3A 1IG8A 4NLCA 3V1OA 3DXKA 3C7NA 2OCEA 4I2PA 5KPTA 4K8ZA 2QWPA 3THWA 1X9MA 1YAGA 1R0AA 4KO0A 3CERA 2E1ZA 4J2AA 3SUNA 3V9XA 4FWSA 1C0UA 4PL7A 4NYNA 1FKOA 1KRPA 5JS2A 5ELZA 5CE3A 4EHTA 2PYJA 3AA3A 3J7ZO 4BDYA 5AQKA 3VTHA 5HBMA 4XH4A 1HQEA 1VSFA 4DTUA 2IVOA 3N4PA 1TKTA 4KHYA 4A2AA
chains in the Genus database with same CATH topology
4N5SA 4E7IA 3K59A 1FKPA 2OPPA 3VQDA 3P1GA 3MECA 2OPQA 3DLGA 1NOYA 3V9UA 4YNQA 3DMJA 1NJWA 2P5GA 3EY1A 3ULDA 3OY9A 3HVTA 4AHVA 2A1SA 1JKHA 4DS4A 3V81A 3B6OA 2BE2A 3AO5A 3LAMA 5CY4A 4H8KA 4PQUA 3O4NA 4N41A 4M3TA 2PZSA 4AHUA 4G1QA 3OYEA 4O5BA 3LPUA 4FYDA 4IFYA 2X6SA 2BANA 2X78A 4DU1A 4FZYA 4FJ9A 5JS1A 4DFPA 3ZSRA 4OPJA 3M8PA 4DSKA 4R5PA 3T19A 1NK9A 1GOBA 4DU4A 1FXXA 1JLQA 3S9HA 1RBRA 4CGFA 3AA4A 4M3RA 1L3VA 1KCFA 2HB5A 4J2BA 2HHTA 1EX4A 3HPHA 2QKBA 4FLTA 1N5YA 3BDPA 4CJUA 1QHTA 4FK0A 4B8CA 5HRSA 3M8SA 1T7PA 4C8MA 4I9LA 4H4MA 1KSPA 1RT1A 5J2NA 3OYLA 3T3FA 3DLHA 2D0AA 4RW9A 5HRRA 2OZMA 3H08A 2VG5A 1NK5A 4M3UA 4H4OA 3L2QA 5KRSA 3G10A 4Y1DA 4B9VA 3C94A 4DTMA 2OPSA 4QOZB 1TAUA 3ZSWA 4PUOA 3ASMA 3CM5A 4FVMA 3JYTA 3U3GA 3LDSA 1Q9XA 4CJ4A 4W5RA 3SJJA 3OYBA 4DU3A 1TK0A 4DQSA 3SQ4A 3SNNA 4CJQA 3TAQA 4CE9A 4CJLA 4CIEA 4FCYA 2HHWA 1A5XA 1LAVA 3TR8A 1S1WA 3PX0A 1RILA 3OYDA 3P83D 2Y1IA 2RPIA 1DTQA 3I0RA 2HHSA 3QEXA 4E7LA 4F4KA 1LWEA 4BDZA 1KLNA 1G15A 1UA1A 4PWDA 4CHQA 4CGGA 4CK1A 3HT3A 5FRMA 4F8RA 1NJZA 3PUFA 3KD1E 2B6AA 3V4IA 5HLFA 1Q9YA 3TAFA 3SUQA 3ZSZA 4FJLA 1VRTA 3O3FA 3HXMA 3BGRA 4CK2A 1I3AA 1Y97A 4DWIA 4ELUA 1LWFA 4HCBA 5KGXA 1HYZA 3LP1A 3HK2A 2ETJA 3NH0A 1ZBLA 4FLYA 4CF9A 4KHQA 3O3GA 4AILC 3LZJA 4NCGA 1RBTA 4KHWA 2G8FA 2DFEA 3SV4A 1WSIA 4RG8A 3G0ZA 1B9DA 2IDOA 4FW1A 1LW2A 2XO7A 4CJSA 1RTJA 3HJFA 4C8NA 4FLVA 2F96A 4OPKA 3QERA 1U49A 3DRRA 1ZBFA 1DTTA 2P5OA 1WSEA 3NH1A 4FJXA 1RTIA 4CJ3A 3HL8A 3OYIA 3QLHA 1WSHA 1N6QA 3K58A 4DTPA 1S1TA 2HMIA 3AVNA 4UQGA 1XHZA 4B9TA 4DSIA 1VSMA 2ZQBA 1BCOA 1IO2A 3CM6A 4QAGA 4OKEA 3V9SA 2BGGA 1BI4B 3LALA 4FLUA 3RMAA 1RDCA 4CJKA 3K5LA 4JRQA 3V9ZA 2G8VA 4EZ9A 4F3OA 3DI6A 4KRFA 1BCMA 4IG0A 1NK7A 1QE1A 2HW3A 4OGCA 5HRNA 3ZT1A 3IAYA 1CZBA 1QS4A 4HUEA 3NGIA 4OLBA 3AVFA 4ELVA 4DF4A 3S3MA 2JLEA 3PY8A 2FBTA 4ID1A 3DOLA 4DTSA 4F2SA 1C1CA 1RT6A 1QSYA 1YTUA 4RW6A 5KGWA 3KJVA 1EKEA 4DTJA 3VQPA 4AHCA 4KAZA 1T8EA 1LV5A 4ZHRA 2E6MA 5D3GA 4ZTJA 1RTHA 1RT3A 4EP5A 3NCIA 3RRHA 1J9AA 1S1VA 4CIFA 1ASWA 1JLFA 2IAJA 4AH9A 2ZD1A 4CF8A 3LP0A 2WOMA 4CGHA 4CFBA 2X6NA 2O4GA 2YNFA 4I7FA 4KHUA 3WNGA 3HO1A 1XWLA 4PY5A 1RCHA 2OA8A 2DTUA 1NK6A 3TABA 4DLEA 4KTQA 3LAKA 1WLJA 2VWJA 2O4IA 1D9FA 2HVIA 1HYVA 1BGXT 1ZYQA 2RN2A 2KFNA 3V1QA 2YNGA 3PX6A 3O3HA 1O1WA 4ID5A 4CHOA 4KREA 4L8RB 3CYMA 1BHLA 5CZ1A 4C8LA 1ASVA 1X1PA 3NBPA 3AVCA 1WSFA 3TANA 4FJ8A 4J2DA 3QIOA 4DQPA 3AV9A 4DG1A 4FZZA 1DLOA 3LANA 1J54A 3LWMA 4B3OA 3DRPA 4O55A 3ZSOA 4ELTA 1CXUA 1QSSA 4LY7A 2Y1JA 3I8DA 1BIZA 4M42A 3L8BA 4KV8A 3O4QA 5J2QA 2AJQA 2FBYA 4CFCA 4Z4HA 2HNDA 3OYJA 3DLKA 4HUFA 1J5OA 3KKSA 4CCHA 4OJRA 1TKDA 4N76A 3AVMA 4KI6A 1KFDA 3V1RA 5C24A 3ISNC 3LP3A 4O4GA 1WAJA 3OVNA 2E6LA 3ZSQA 4W5OA 1SL0A 1A5VA 3VQ7A 2D5RA 4B9SA 1UAXA 4CGIA 4DF8A 1W0HA 1D5AA 3D45A 4AHTA 2P1JA 4CJFA 3RWUA 1U04A 3VQCA 3ZSXA 3L3UA 4IFVA 1WSGA 3OYNA 3K5NA 3CFPA 4KB1A 4CESA 1C0TA 4M41A 4B9LA 2Z1JA 3DLBA 3RRGA 1IKYA 4DMNA 3KIOA 4F3TA 1KLMA 4CEQA 1RTDA 3AO4A 3KTQA 3LPTA 1TL3A 3TAMA 5HRPA 2IS3A 2P51A 2LSNA 3AVBA 2XHBA 4DTXA 4B8AB 3M8RA 2GV9A 3TAEA 1IKVA 2HHUA 1NK8A 2GUIA 4DFJA 2DFHA 4KTWA 4FJJA 3HPGA 1JLEA 4Q5VA 3KLGA 3F73A 4PA1A 3SPZA 1NJYA 3KD5E 4DFMA 3SI6A 4NCAA 4OGEA 3DYAA 1Z26A 3PO5A 1BQMA 3B6PA 5J2MA 3PX4A 4DSJA 4LH4A 4B9MA 4YFUA 1L5UA 3RMDA 1UOCA 5DMRA 4EP4A 3DRSA 4Z0UA 3AO2A 3DM2A 4E3SA 1S9GA 2G8WA 4FJMA 4W5NA 1U45A 4GW6A 4FXDA 1VSHA 4DLGA 3VA3A 4GVMA 1LAWA 4CGDA 1JLBA 1EP4A 1CLQA 1T03A 1S1XA 1CXQA 1KTQA 3QINA 1IKWA 5EU7A 1TK8A 2G8HA 1I39A 4CGJA 3L2WA 2F8TA 3KK2A 2HHXA 3AVHA 1WNSA 4Y1CA 5CZ2A 2HVHA 2ITGA 2YHBA 3MXIA 1NJXA 4C8OA 1GOAA 5SZTA 3OS2A 1TL1A 3ZT4A 4B08A 1XC9A 1TKZA 2KQ2A 4HVJA 3SZ2A 3OYFA 2A1RA 1D8YA 1RBVA 2ZE2A 3NFAA 4BE2A 4DQIA 4I9QA 3RMCA 4E7KA 1VSLA 3NAEA 3HPOA 3NE6A 1ZBIA 1TKXA 4CEBA 4KHSA 4Z4CA 1RDBA 5I3UA 3RMBA 3KK3A 2XRIA 1BQNA 4RW4A 4CHYA 1QQCA 3SYZA 5KRTA 1A5WA 4M3WA 2HNYA 1YTAA 4OKKA 2ATQA 4CF0A 5CYQA 3ZT0A 4OLAA 4CJVA 2QK9A 1LWCA 3SQ0A 3I0SA 1NK0A 4K8XA 3CFOA 3FFIA 3IS9A 3WNHA 4CK3A 4XIUA 1GOCA 5I42A 2PY5A 4BWMA 1NK4A 4BACA 3LWLA 4N56A 4FW2A 3OYCA 3MEGA 4CJRA 3LZIA 1EETA 2VWKA 5FROA 4CEZA 4DFKA 4BWJA 1UWBA 1HNIA 3TARA 3OYAA 4WE1A 2FBVA 4B9NA 1JL2A 4DTOA 3ZSVA 1RBSA 3HP9A 4CHPA 3NF7A 4O0JA 4OVLA 3OYMA 2G8UA 4FJHA 1VSDA 4J2EA 3NGYA 3NHGA 1KFSA 4IKFA 2G8KA 2Z1HA 2YNIA 1HYSA 4HTUA 4LD0A 4DTRA 4CHZA 3QEPA 3EZ5A 4FK4A 2EHGA 5KI6A 3S3OA 3KLHA 4FLWA 3KKRA 3EYZA 3ZT2A 3VQ8A 1NKEA 2VG6A 3AVKA 1RT2A 4AHSA 3NDKA 3AVGA 1SKWA 3C6UA 1RDDA 4BE0A 2BDPA 2QKKA 1TK5A 3OYHA 1VSIA 3VQ6A 1RDAA 5HP1A 3VQQA 1NKCA 4CERA 1X9WA 3VN5A 3WNEA 1XI1A 1RT4A 4HUGA 4ICLA 3RR7A 4Q0BA 4CJEA 4Z4GA 2IOCA 4M45A 4CEDA 3SV3A 4EZ6A 3K5OA 3ALYA 4MFBA 4Z4EA 3KLEA 1K6YA 4C8KA 1SL1A 4DTNA 4DSLA 3VQ4A 1S5JA 4FZXC 3AVJA 1TAQA 3RR8A 4IBNA 3PO4A 3K57A 2XY7A 4CHNA 3K5MA 3OYKA 1JLCA 3KK1A 1W9HA 3D0PA 3TWHA 2XY6A 4B9UA 3UIQA 1HQUA 2G8IA 3IRXA 4E7HA 5C42A 1CZ9A 3M8QA 1S6QA 3HVRA 4BE1A 5FRNA 3L2VA 3V6DA 1JLGA 3LP2A 4FJ5A 4NCBA 3OYGA 1VK0A 3QETA 4JS4A 4CIGA 2E4LA 3KLFA 3TAGA 2EX3A 1QTMA 4DQRA 4N47A 1T05A 4FJGA 4FJNA 4MQ3A 2NUBA 1REVA 2HHQA 2KZZA 1JL1A 3C6TA 3ITHA 4LH5A 4KKOA 1RT5A 3L3VA 4FLXA 3NF6A 3SQ2A 4E89A 1HNVA 1U4BA 1WN7A 3VQ5A 1JLAA 3AVAA 4DQQA 2KZMA 1B92A 1NOZA 3TAPA 4CFAA 4E7JA 1RNHA 3P5JA 1BI4A 1JXEA 3QO9A 5E41A 3SQ1A 1C1AA 1S1UA 3OJUA 2KFZA 4OKJA 1BL3A 1FK9A 2GBZA 4KPYA 1VSEA 1U48A 4W5TA 4CJTA 4FJKA 4FM0A 4HHTA 2D0CA 4W5QA 4NYFA 3PV8A 1C1BA 1TV6A 1IG9A 3MEDA 4LSNA 4O0IA 4TSXA 4KB0A 4ZTFA 5T7BA 2R7YA 2OYQA 3MAQA 3AA5X 2YKMA 1SUQA 3KLIA 1J53A 1KVBA 2KW4A 2B4JA 4RW8A 3CG7A 3QEVA 4CJPA 4KI4A 3RTVA 1X9SA 5J1EA 3VQAA 4CJWA 3HSTB 4E19A 4Z4IA 2RF2A 4O44A 4CF2A 1RT7A 4M3XA 1U47A 2OPRA 3F9KA 2WONA 5HROA 1HRHA 1NKBA 4E0DA 4FM1A 4JS5A 4IDKA 1EXQA 5KTQA 4M3YA 3SCXA 1HPZA 3QEIA 1HMVA 3SPYA 3JSMA 3V9WA 4CEAA 1Z25A 3QIPA 3DLEA 4DSFA 4HCCA 1SKRA 3HYFA 3NF8A 4DS5A 1B9FA 1RBUA 1SKSA 4IG3A 3L2RA 3VA0A 2RKIA 4JRPA 1BIUA 3AVIA 4CFDA 1ITGA 1XHXA 2YV0X 3QNOA 2OZSA 1Q8IA 4CEEA 1D9DA 3AA2A 3AVLA 4I2QA 5K14A 2FBXA 3NF9A 4Z4FA 2KTQA 2QXFA 2YNHA 3ZCMA 1BISA 2Z1GA 3NGZA 3S3NA 4E1MA 4KFBA 2XY8A 2HHVA 3WNFA 2B5JA 4RW7A 1C0MA 1IH7A 1VSKA 1VSJA 3CFRA 1QSLA 3ZT3A 4QCLA 3AO1A 3SUOA 4E1NA 2PYLA 1L3UA 5FDLA 4CECA 4KTZA 5J2PA 3DLRA 4BDPA 2D0BA 1HJRA 4JLHA 3OS0A 3MXJA 3QESA 1YT3A 1ASUA 3HM9A 5DK5A 3AO3A 4CF1A 4CJ5A 3ZSYA 1ZBUA 4CEFA 4F2RA 2YHAA 3V1OA 4FLZA 1TGOA 3A2FA 4I2PA 4FJIA 5CYMA 3THVA 1MU2A 2Q3SA 2YKNA 3OJSA 2JGUA 2F8SA 4K8ZA 3VQ9A 4M3ZA 1X9MA 1S6PA 3T1AA 1WSJA 1R0AA 1SL2A 3E01A 3NH2A 4KO0A 1WAFA 2FC0A 2IGIA 2W42A 2XY5A 1YVUA 4J2AA 3SUNA 5C25A 1VRUA 3U3YA 4FM2A 1LW0A 3V9XA 3HP6A 1C0UA 2VG7A 3K2PA 4NYNA 1FKOA 2IC3A 1SV5A 4DSEA 1L3SA 1KRPA 2DFFA 1L3TA 5JS2A 4KHNA 5SWMA 1IKXA 4AHRA 3SUPA 4CEOA 1S9EA 3VQBA 1UA0A 2PYJA 1C6VA 3TI0A 3AA3A 3CQ8A 2Z1IA 3C95A 1KVAA 4BDYA 2HNZA 3MXMA 3OS1A 5HBMA 1ZBHA 4GMJB 3U6FA 2X74A 3IG1A 2I5JA 4LSLA 3L2UA 3DOKA 3QEWA 1HQEA 1JXBA 1VSFA 4DTUA 1KVCA 2DY4A 4FJ7A 4FK2A 1TKTA 3MEEA 4KHYA 3VQEA 3QNNA 1TVRA 1F21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N5S A;  4E7I A;  3K59 A;  1FKP A;  2OPP A;  3VQD A;  3P1G A;  3MEC A;  2OPQ A;  3DLG A;  1NOY A;  3V9U A;  4YNQ A;  3DMJ A;  1NJW A;  2P5G A;  3EY1 A;  3ULD A;  3OY9 A;  3HVT A;  4AHV A;  2A1S A;  1JKH A;  4DS4 A;  3V81 A;  3B6O A;  2BE2 A;  3AO5 A;  3LAM A;  5CY4 A;  4H8K A;  4PQU A;  3O4N A;  4N41 A;  4M3T A;  2PZS A;  4AHU A;  4G1Q A;  3OYE A;  4O5B A;  3LPU A;  4FYD A;  4IFY A;  2X6S A;  2BAN A;  2X78 A;  4DU1 A;  4FZY A;  4FJ9 A;  5JS1 A;  4DFP A;  3ZSR A;  4OPJ A;  3M8P A;  4DSK A;  4R5P A;  3T19 A;  1NK9 A;  1GOB A;  4DU4 A;  1FXX A;  1JLQ A;  3S9H A;  1RBR A;  4CGF A;  3AA4 A;  4M3R A;  1L3V A;  1KCF A;  2HB5 A;  4J2B A;  2HHT A;  1EX4 A;  3HPH A;  2QKB A;  4FLT A;  1N5Y A;  3BDP A;  4CJU A;  1QHT A;  4FK0 A;  4B8C A;  5HRS A;  3M8S A;  1T7P A;  4C8M A;  4I9L A;  4H4M A;  1KSP A;  1RT1 A;  5J2N A;  3OYL A;  3T3F A;  3DLH A;  2D0A A;  4RW9 A;  5HRR A;  2OZM A;  3H08 A;  2VG5 A;  1NK5 A;  4M3U A;  4H4O A;  3L2Q A;  5KRS A;  3G10 A;  4Y1D A;  4B9V A;  3C94 A;  4DTM A;  2OPS A;  4QOZ B;  1TAU A;  3ZSW A;  4PUO A;  3ASM A;  3CM5 A;  4FVM A;  3JYT A;  3U3G A;  3LDS A;  1Q9X A;  4CJ4 A;  4W5R A;  3SJJ A;  3OYB A;  4DU3 A;  1TK0 A;  4DQS A;  3SQ4 A;  3SNN A;  4CJQ A;  3TAQ A;  4CE9 A;  4CJL A;  4CIE A;  4FCY A;  2HHW A;  1A5X A;  1LAV A;  3TR8 A;  1S1W A;  3PX0 A;  1RIL A;  3OYD A;  3P83 D;  2Y1I A;  2RPI A;  1DTQ A;  3I0R A;  2HHS A;  3QEX A;  4E7L A;  4F4K A;  1LWE A;  4BDZ A;  1KLN A;  1G15 A;  1UA1 A;  4PWD A;  4CHQ A;  4CGG A;  4CK1 A;  3HT3 A;  5FRM A;  4F8R A;  1NJZ A;  3PUF A;  3KD1 E;  2B6A A;  3V4I A;  5HLF A;  1Q9Y A;  3TAF A;  3SUQ A;  3ZSZ A;  4FJL A;  1VRT A;  3O3F A;  3HXM A;  3BGR A;  4CK2 A;  1I3A A;  1Y97 A;  4DWI A;  4ELU A;  1LWF A;  4HCB A;  5KGX A;  1HYZ A;  3LP1 A;  3HK2 A;  2ETJ A;  3NH0 A;  1ZBL A;  4FLY A;  4CF9 A;  4KHQ A;  3O3G A;  4AIL C;  3LZJ A;  4NCG A;  1RBT A;  4KHW A;  2G8F A;  2DFE A;  3SV4 A;  1WSI A;  4RG8 A;  3G0Z A;  1B9D A;  2IDO A;  4FW1 A;  1LW2 A;  2XO7 A;  4CJS A;  1RTJ A;  3HJF A;  4C8N A;  4FLV A;  2F96 A;  4OPK A;  3QER A;  1U49 A;  3DRR A;  1ZBF A;  1DTT A;  2P5O A;  1WSE A;  3NH1 A;  4FJX A;  1RTI A;  4CJ3 A;  3HL8 A;  3OYI A;  3QLH A;  1WSH A;  1N6Q A;  3K58 A;  4DTP A;  1S1T A;  2HMI A;  3AVN A;  4UQG A;  1XHZ A;  4B9T A;  4DSI A;  1VSM A;  2ZQB A;  1BCO A;  1IO2 A;  3CM6 A;  4QAG A;  4OKE A;  3V9S A;  2BGG A;  1BI4 B;  3LAL A;  4FLU A;  3RMA A;  1RDC A;  4CJK A;  3K5L A;  4JRQ A;  3V9Z A;  2G8V A;  4EZ9 A;  4F3O A;  3DI6 A;  4KRF A;  1BCM A;  4IG0 A;  1NK7 A;  1QE1 A;  2HW3 A;  4OGC A;  5HRN A;  3ZT1 A;  3IAY A;  1CZB A;  1QS4 A;  4HUE A;  3NGI A;  4OLB A;  3AVF A;  4ELV A;  4DF4 A;  3S3M A;  2JLE A;  3PY8 A;  2FBT A;  4ID1 A;  3DOL A;  4DTS A;  4F2S A;  1C1C A;  1RT6 A;  1QSY A;  1YTU A;  4RW6 A;  5KGW A;  3KJV A;  1EKE A;  4DTJ A;  3VQP A;  4AHC A;  4KAZ A;  1T8E A;  1LV5 A;  4ZHR A;  2E6M A;  5D3G A;  4ZTJ A;  1RTH A;  1RT3 A;  4EP5 A;  3NCI A;  3RRH A;  1J9A A;  1S1V A;  4CIF A;  1ASW A;  1JLF A;  2IAJ A;  4AH9 A;  2ZD1 A;  4CF8 A;  3LP0 A;  2WOM A;  4CGH A;  4CFB A;  2X6N A;  2O4G A;  2YNF A;  4I7F A;  4KHU A;  3WNG A;  3HO1 A;  1XWL A;  4PY5 A;  1RCH A;  2OA8 A;  2DTU A;  1NK6 A;  3TAB A;  4DLE A;  4KTQ A;  3LAK A;  1WLJ A;  2VWJ A;  2O4I A;  1D9F A;  2HVI A;  1HYV A;  1BGX T;  1ZYQ A;  2RN2 A;  2KFN A;  3V1Q A;  2YNG A;  3PX6 A;  3O3H A;  1O1W A;  4ID5 A;  4CHO A;  4KRE A;  4L8R B;  3CYM A;  1BHL A;  5CZ1 A;  4C8L A;  1ASV A;  1X1P A;  3NBP A;  3AVC A;  1WSF A;  3TAN A;  4FJ8 A;  4J2D A;  3QIO A;  4DQP A;  3AV9 A;  4DG1 A;  4FZZ A;  1DLO A;  3LAN A;  1J54 A;  3LWM A;  4B3O A;  3DRP A;  4O55 A;  3ZSO A;  4ELT A;  1CXU A;  1QSS A;  4LY7 A;  2Y1J A;  3I8D A;  1BIZ A;  4M42 A;  3L8B A;  4KV8 A;  3O4Q A;  5J2Q A;  2AJQ A;  2FBY A;  4CFC A;  4Z4H A;  2HND A;  3OYJ A;  3DLK A;  4HUF A;  1J5O A;  3KKS A;  4CCH A;  4OJR A;  1TKD A;  4N76 A;  3AVM A;  4KI6 A;  1KFD A;  3V1R A;  5C24 A;  3ISN C;  3LP3 A;  4O4G A;  1WAJ A;  3OVN A;  2E6L A;  3ZSQ A;  4W5O A;  1SL0 A;  1A5V A;  3VQ7 A;  2D5R A;  4B9S A;  1UAX A;  4CGI A;  4DF8 A;  1W0H A;  1D5A A;  3D45 A;  4AHT A;  2P1J A;  4CJF A;  3RWU A;  1U04 A;  3VQC A;  3ZSX A;  3L3U A;  4IFV A;  1WSG A;  3OYN A;  3K5N A;  3CFP A;  4KB1 A;  4CES A;  1C0T A;  4M41 A;  4B9L A;  2Z1J A;  3DLB A;  3RRG A;  1IKY A;  4DMN A;  3KIO A;  4F3T A;  1KLM A;  4CEQ A;  1RTD A;  3AO4 A;  3KTQ A;  3LPT A;  1TL3 A;  3TAM A;  5HRP A;  2IS3 A;  2P51 A;  2LSN A;  3AVB A;  2XHB A;  4DTX A;  4B8A B;  3M8R A;  2GV9 A;  3TAE A;  1IKV A;  2HHU A;  1NK8 A;  2GUI A;  4DFJ A;  2DFH A;  4KTW A;  4FJJ A;  3HPG A;  1JLE A;  4Q5V A;  3KLG A;  3F73 A;  4PA1 A;  3SPZ A;  1NJY A;  3KD5 E;  4DFM A;  3SI6 A;  4NCA A;  4OGE A;  3DYA A;  1Z26 A;  3PO5 A;  1BQM A;  3B6P A;  5J2M A;  3PX4 A;  4DSJ A;  4LH4 A;  4B9M A;  4YFU A;  1L5U A;  3RMD A;  1UOC A;  5DMR A;  4EP4 A;  3DRS A;  4Z0U A;  3AO2 A;  3DM2 A;  4E3S A;  1S9G A;  2G8W A;  4FJM A;  4W5N A;  1U45 A;  4GW6 A;  4FXD A;  1VSH A;  4DLG A;  3VA3 A;  4GVM A;  1LAW A;  4CGD A;  1JLB A;  1EP4 A;  1CLQ A;  1T03 A;  1S1X A;  1CXQ A;  1KTQ A;  3QIN A;  1IKW A;  5EU7 A;  1TK8 A;  2G8H A;  1I39 A;  4CGJ A;  3L2W A;  2F8T A;  3KK2 A;  2HHX A;  3AVH A;  1WNS A;  4Y1C A;  5CZ2 A;  2HVH A;  2ITG A;  2YHB A;  3MXI A;  1NJX A;  4C8O A;  1GOA A;  5SZT A;  3OS2 A;  1TL1 A;  3ZT4 A;  4B08 A;  1XC9 A;  1TKZ A;  2KQ2 A;  4HVJ A;  3SZ2 A;  3OYF A;  2A1R A;  1D8Y A;  1RBV A;  2ZE2 A;  3NFA A;  4BE2 A;  4DQI A;  4I9Q A;  3RMC A;  4E7K A;  1VSL A;  3NAE A;  3HPO A;  3NE6 A;  1ZBI A;  1TKX A;  4CEB A;  4KHS A;  4Z4C A;  1RDB A;  5I3U A;  3RMB A;  3KK3 A;  2XRI A;  1BQN A;  4RW4 A;  4CHY A;  1QQC A;  3SYZ A;  5KRT A;  1A5W A;  4M3W A;  2HNY A;  1YTA A;  4OKK A;  2ATQ A;  4CF0 A;  5CYQ A;  3ZT0 A;  4OLA A;  4CJV A;  2QK9 A;  1LWC A;  3SQ0 A;  3I0S A;  1NK0 A;  4K8X A;  3CFO A;  3FFI A;  3IS9 A;  3WNH A;  4CK3 A;  4XIU A;  1GOC A;  5I42 A;  2PY5 A;  4BWM A;  1NK4 A;  4BAC A;  3LWL A;  4N56 A;  4FW2 A;  3OYC A;  3MEG A;  4CJR A;  3LZI A;  1EET A;  2VWK A;  5FRO A;  4CEZ A;  4DFK A;  4BWJ A;  1UWB A;  1HNI A;  3TAR A;  3OYA A;  4WE1 A;  2FBV A;  4B9N A;  1JL2 A;  4DTO A;  3ZSV A;  1RBS A;  3HP9 A;  4CHP A;  3NF7 A;  4O0J A;  4OVL A;  3OYM A;  2G8U A;  4FJH A;  1VSD A;  4J2E A;  3NGY A;  3NHG A;  1KFS A;  4IKF A;  2G8K A;  2Z1H A;  2YNI A;  1HYS A;  4HTU A;  4LD0 A;  4DTR A;  4CHZ A;  3QEP A;  3EZ5 A;  4FK4 A;  2EHG A;  5KI6 A;  3S3O A;  3KLH A;  4FLW A;  3KKR A;  3EYZ A;  3ZT2 A;  3VQ8 A;  1NKE A;  2VG6 A;  3AVK A;  1RT2 A;  4AHS A;  3NDK A;  3AVG A;  1SKW A;  3C6U A;  1RDD A;  4BE0 A;  2BDP A;  2QKK A;  1TK5 A;  3OYH A;  1VSI A;  3VQ6 A;  1RDA A;  5HP1 A;  3VQQ A;  1NKC A;  4CER A;  1X9W A;  3VN5 A;  3WNE A;  1XI1 A;  1RT4 A;  4HUG A;  4ICL A;  3RR7 A;  4Q0B A;  4CJE A;  4Z4G A;  2IOC A;  4M45 A;  4CED A;  3SV3 A;  4EZ6 A;  3K5O A;  3ALY A;  4MFB A;  4Z4E A;  3KLE A;  1K6Y A;  4C8K A;  1SL1 A;  4DTN A;  4DSL A;  3VQ4 A;  1S5J A;  4FZX C;  3AVJ A;  1TAQ A;  3RR8 A;  4IBN A;  3PO4 A;  3K57 A;  2XY7 A;  4CHN A;  3K5M A;  3OYK A;  1JLC A;  3KK1 A;  1W9H A;  3D0P A;  3TWH A;  2XY6 A;  4B9U A;  3UIQ A;  1HQU A;  2G8I A;  3IRX A;  4E7H A;  5C42 A;  1CZ9 A;  3M8Q A;  1S6Q A;  3HVR A;  4BE1 A;  5FRN A;  3L2V A;  3V6D A;  1JLG A;  3LP2 A;  4FJ5 A;  4NCB A;  3OYG A;  1VK0 A;  3QET A;  4JS4 A;  4CIG A;  2E4L A;  3KLF A;  3TAG A;  2EX3 A;  1QTM A;  4DQR A;  4N47 A;  1T05 A;  4FJG A;  4FJN A;  4MQ3 A;  2NUB A;  1REV A;  2HHQ A;  2KZZ A;  1JL1 A;  3C6T A;  3ITH A;  4LH5 A;  4KKO A;  1RT5 A;  3L3V A;  4FLX A;  3NF6 A;  3SQ2 A;  4E89 A;  1HNV A;  1U4B A;  1WN7 A;  3VQ5 A;  1JLA A;  3AVA A;  4DQQ A;  2KZM A;  1B92 A;  1NOZ A;  3TAP A;  4CFA A;  4E7J A;  1RNH A;  3P5J A;  1BI4 A;  1JXE A;  3QO9 A;  5E41 A;  3SQ1 A;  1C1A A;  1S1U A;  3OJU A;  2KFZ A;  4OKJ A;  1BL3 A;  1FK9 A;  2GBZ A;  4KPY A;  1VSE A;  1U48 A;  4W5T A;  4CJT A;  4FJK A;  4FM0 A;  4HHT A;  2D0C A;  4W5Q A;  4NYF A;  3PV8 A;  1C1B A;  1TV6 A;  1IG9 A;  3MED A;  4LSN A;  4O0I A;  4TSX A;  4KB0 A;  4ZTF A;  5T7B A;  2R7Y A;  2OYQ A;  3MAQ A;  3AA5 X;  2YKM A;  1SUQ A;  3KLI A;  1J53 A;  1KVB A;  2KW4 A;  2B4J A;  4RW8 A;  3CG7 A;  3QEV A;  4CJP A;  4KI4 A;  3RTV A;  1X9S A;  5J1E A;  3VQA A;  4CJW A;  3HST B;  4E19 A;  4Z4I A;  2RF2 A;  4O44 A;  4CF2 A;  1RT7 A;  4M3X A;  1U47 A;  2OPR A;  3F9K A;  2WON A;  5HRO A;  1HRH A;  1NKB A;  4E0D A;  4FM1 A;  4JS5 A;  4IDK A;  1EXQ A;  5KTQ A;  4M3Y A;  3SCX A;  1HPZ A;  3QEI A;  1HMV A;  3SPY A;  3JSM A;  3V9W A;  4CEA A;  1Z25 A;  3QIP A;  3DLE A;  4DSF A;  4HCC A;  1SKR A;  3HYF A;  3NF8 A;  4DS5 A;  1B9F A;  1RBU A;  1SKS A;  4IG3 A;  3L2R A;  3VA0 A;  2RKI A;  4JRP A;  1BIU A;  3AVI A;  4CFD A;  1ITG A;  1XHX A;  2YV0 X;  3QNO A;  2OZS A;  1Q8I A;  4CEE A;  1D9D A;  3AA2 A;  3AVL A;  4I2Q A;  5K14 A;  2FBX A;  3NF9 A;  4Z4F A;  2KTQ A;  2QXF A;  2YNH A;  3ZCM A;  1BIS A;  2Z1G A;  3NGZ A;  3S3N A;  4E1M A;  4KFB A;  2XY8 A;  2HHV A;  3WNF A;  2B5J A;  4RW7 A;  1C0M A;  1IH7 A;  1VSK A;  1VSJ A;  3CFR A;  1QSL A;  3ZT3 A;  4QCL A;  3AO1 A;  3SUO A;  4E1N A;  2PYL A;  1L3U A;  5FDL A;  4CEC A;  4KTZ A;  5J2P A;  3DLR A;  4BDP A;  2D0B A;  1HJR A;  4JLH A;  3OS0 A;  3MXJ A;  3QES A;  1YT3 A;  1ASU A;  3HM9 A;  5DK5 A;  3AO3 A;  4CF1 A;  4CJ5 A;  3ZSY A;  1ZBU A;  4CEF A;  4F2R A;  2YHA A;  3V1O A;  4FLZ A;  1TGO A;  3A2F A;  4I2P A;  4FJI A;  5CYM A;  3THV A;  1MU2 A;  2Q3S A;  2YKN A;  3OJS A;  2JGU A;  2F8S A;  4K8Z A;  3VQ9 A;  4M3Z A;  1X9M A;  1S6P A;  3T1A A;  1WSJ A;  1R0A A;  1SL2 A;  3E01 A;  3NH2 A;  4KO0 A;  1WAF A;  2FC0 A;  2IGI A;  2W42 A;  2XY5 A;  1YVU A;  4J2A A;  3SUN A;  5C25 A;  1VRU A;  3U3Y A;  4FM2 A;  1LW0 A;  3V9X A;  3HP6 A;  1C0U A;  2VG7 A;  3K2P A;  4NYN A;  1FKO A;  2IC3 A;  1SV5 A;  4DSE A;  1L3S A;  1KRP A;  2DFF A;  1L3T A;  5JS2 A;  4KHN A;  5SWM A;  1IKX A;  4AHR A;  3SUP A;  4CEO A;  1S9E A;  3VQB A;  1UA0 A;  2PYJ A;  1C6V A;  3TI0 A;  3AA3 A;  3CQ8 A;  2Z1I A;  3C95 A;  1KVA A;  4BDY A;  2HNZ A;  3MXM A;  3OS1 A;  5HBM A;  1ZBH A;  4GMJ B;  3U6F A;  2X74 A;  3IG1 A;  2I5J A;  4LSL A;  3L2U A;  3DOK A;  3QEW A;  1HQE A;  1JXB A;  1VSF A;  4DTU A;  1KVC A;  2DY4 A;  4FJ7 A;  4FK2 A;  1TKT A;  3MEE A;  4KHY A;  3VQE A;  3QNN A;  1TVR A;  1F21 A; 
#chains in the Genus database with same CATH topology
 2ASM A;  3SAG A;  3WEE B;  3VQD A;  3O08 A;  3DLG A;  4H0Y B;  5JIC A;  1Y64 A;  3V9U A;  4YNQ A;  3UE5 A;  2P5G A;  2Q31 A;  3B6O A;  4BRN A;  3WXL A;  4H8K A;  2PZS A;  2QWQ A;  3LPU A;  4BRP A;  2X6S A;  4FZY A;  4A2B A;  4DFP A;  4R5P A;  3T19 A;  1NK9 A;  4XEI A;  1FXX A;  2I7P A;  1U6Z A;  3CCR N;  1KCF A;  2HB5 A;  2HHT A;  4BC5 A;  5AQP A;  4FLT A;  1BOT O;  4CJU A;  4KBO A;  5HRS A;  3M8S A;  2A41 A;  5HRR A;  2OZM A;  3CCU N;  4H4O A;  3EZW A;  3L2Q A;  5C2D A;  5KRS A;  4Y1D A;  4B9V A;  3PLA A;  4DTM A;  1QQM A;  3ZSW A;  4PUO A;  3ASM A;  3W0L A;  3LDS A;  1Q9X A;  2E5L K;  1T44 A;  4DQS A;  4CJQ A;  4CJL A;  4CIE A;  2I7N A;  1S1W A;  3P83 D;  5JVG L;  1VQM N;  1DTQ A;  4FL9 A;  1LWE A;  2ZGZ A;  3A5M C;  1UA1 A;  4PWD A;  3ZLJ A;  5LL6 Z;  3C6A A;  4H0P A;  4BC2 A;  1Q9Y A;  3THY A;  3ZSZ A;  3O3F A;  2YHW A;  3BGR A;  4CK2 A;  3J81 O;  4ELU A;  4HCB A;  3BF1 A;  3CCM N;  4OX9 K;  1EO1 A;  4FLY A;  4KHQ A;  1XC3 A;  3O3G A;  4FWP A;  2FXU A;  1RBT A;  3CJB A;  2HHH K;  3SV4 A;  1WSI A;  4FW1 A;  3ZX3 A;  2IDO A;  1NGB A;  1LW2 A;  3HJF A;  1RTJ A;  2VGM A;  4FLV A;  2F96 A;  4OPK A;  3VGK A;  4FWR A;  4WCE L;  2QW9 A;  3QLH A;  1BG3 A;  4IXC A;  1DEJ A;  5F0X A;  4UQG A;  1BDG A;  2QWO A;  4A61 A;  4B1X B;  3CM6 A;  3M5R A;  1BI4 B;  3LAL A;  4HTL A;  4IOX A;  4BR0 A;  1CZB A;  4HUE A;  4OLB A;  1T6C A;  3D6R A;  3PY8 A;  1YTU A;  1NJI O;  3KJV A;  1ZXO A;  4JD2 B;  2O8B A;  2NRR A;  3P39 A;  4GV3 A;  4FOE A;  3L4Q A;  1HKC A;  4CIF A;  2IAJ A;  4AH9 A;  4O8U A;  5EXW A;  4CGH A;  3C7N B;  5AZI B;  3J8A A;  4PY5 A;  4BGA A;  2P9U B;  4KTQ A;  4DV3 K;  1D9F A;  4B3R K;  1BGX T;  2GX9 A;  3V1Q A;  2ZWH A;  2V51 B;  2P9I A;  3CYM A;  1BHL A;  5CZ1 A;  3NBP A;  1HUX A;  4B1Y B;  3MN6 A;  2ZJP L;  3VEX A;  3LAN A;  1J54 A;  1ATR A;  3DRP A;  1QZ6 A;  1BIZ A;  5J2Q A;  3P38 A;  3ENB A;  2FBY A;  2HND A;  3DLK A;  3DXM B;  4LFA K;  4N76 A;  1KFD A;  5C24 A;  3ISN C;  3LP3 A;  4W5O A;  3OVN A;  1A5V A;  5F2R A;  2HBL A;  2HBM A;  4CGI A;  2NZT A;  3K5N A;  3VGM A;  2V52 B;  3OYN A;  3TTF A;  3L0Q A;  3FZF A;  3GL1 A;  4H5T A;  4BQL A;  1KD1 O;  2Q97 A;  3L4I A;  2E2N A;  3VEW A;  3AO4 A;  5EY4 A;  4JNE A;  2QA4 N;  3LDP A;  2P51 A;  3LM2 A;  3AVB A;  1IBL K;  4B8A B;  3TAE A;  4DV2 K;  2GUI A;  4DFJ A;  4FJJ A;  3ZX0 A;  3T1H K;  4J2B A;  3O8M A;  3KD5 E;  2UXB K;  4NCA A;  4H5W A;  3DYA A;  1Z26 A;  3Q7B A;  4LH4 A;  5GIN A;  3M3Z A;  3O6W A;  1L5U A;  4EAH D;  4EP4 A;  1IBK K;  1U45 A;  4DLG A;  4GVM A;  4CGD A;  5LY3 A;  1JLB A;  1EP4 A;  1S1X A;  4H5N A;  4GV6 A;  1KTQ A;  3QIN A;  1IKW A;  1KXP A;  2O8C A;  4CZK A;  2HHX A;  4WFA L;  2W6L A;  5SZT A;  3RVC A;  3D2E B;  3CPE A;  4B1U B;  4B08 A;  1XC9 A;  5AQL A;  1TKZ A;  4HVJ A;  3UKU B;  3MCA B;  4I9Q A;  1VSL A;  4OPH A;  3NE6 A;  4JHD A;  4F9O A;  4Z4C A;  1RDB A;  2XRI A;  1BQN A;  4RW4 A;  5A2Q O;  3SYZ A;  5KRT A;  3IDH A;  3O1B A;  2UUA K;  2ATQ A;  4BRE A;  2A6A A;  3S41 A;  3SLC A;  2O8D A;  4FO0 A;  4CJV A;  1N36 K;  4K8X A;  3CFO A;  5MLC Q;  5I42 A;  1NGG A;  4JI2 K;  4CEZ A;  1MDU B;  1HNI A;  5AQR A;  4WE1 A;  3OYA A;  4JI5 K;  4X65 K;  1RBS A;  4O0J A;  4H0O A;  3OYM A;  1KFS A;  2G8K A;  2YNI A;  5AFU H;  4AF1 A;  4X66 K;  3OTO K;  2EHG A;  4B9Q A;  2O8D B;  3ZT2 A;  2P9S B;  4YOU A;  3R6M A;  3EE9 A;  1TK5 A;  3VQQ A;  1X9W A;  3WNE A;  4Q0B A;  5C2F A;  2YHX A;  3K5O A;  4MFB A;  1K6Y A;  4DTN A;  3K9K A;  3EKS A;  3O9U A;  3ID8 A;  1C0F A;  3CJ1 A;  4CHN A;  2O8F A;  2NRZ A;  2G8I A;  3IRX A;  1FJG K;  3M8Q A;  3HVR A;  3THX B;  3V6D A;  2ASP A;  4AM6 A;  4DUZ K;  3QDK A;  2E4L A;  2EX3 A;  5AZJ B;  3THX A;  1VAZ A;  2FSK A;  2Q0R A;  3HI0 A;  4CZH A;  4MLH A;  3N4Q A;  2A40 A;  4WF9 L;  5BR8 K;  3FZL A;  5AZI A;  1U4B A;  1W7A A;  1WN7 A;  3TAP A;  4E7J A;  1YJ9 N;  5AQU A;  3TU5 A;  3H3O B;  1S1U A;  4DR6 K;  4OKJ A;  4B1Z A;  1VSE A;  4FJK A;  1NGA A;  3PV8 A;  1IG9 A;  4ZTF A;  3MAQ A;  3JXU A;  1SUQ A;  3KLI A;  1KVB A;  5HL7 L;  2CH5 A;  4CJP A;  3RTV A;  5JMV A;  4YOV A;  4KI4 A;  1ZBS A;  1FW6 A;  2RF2 A;  4H5R A;  2Q36 A;  4C23 A;  2WTU A;  2OPR A;  3CJ7 A;  2WON A;  4E0D A;  4FM1 A;  1J5E K;  4JS5 A;  3VET A;  1EXQ A;  3SCX A;  1HPZ A;  3DLE A;  3HYF A;  4IG3 A;  3VA0 A;  2RKI A;  5ADX A;  4CFD A;  3QBW A;  3SMP A;  3NF9 A;  4Z4F A;  4JEP A;  3CET A;  3WNF A;  4RW7 A;  1EWQ A;  1HJO A;  1QSL A;  1L3U A;  5BPM A;  4KTZ A;  3DLR A;  1HJR A;  2YCH A;  1YT3 A;  3ZYY X;  4BC3 A;  4CJ5 A;  3CCE N;  3ZSY A;  1ZBU A;  4CEF A;  1ATS A;  3ATU A;  1TGO A;  4JKC A;  2Q3S A;  3U4L A;  3OJS A;  1KC8 O;  1NU0 A;  4EIA A;  3VEN A;  3E01 A;  1SL2 A;  3CCQ N;  1YVU A;  3SBT A;  1VQN N;  2A42 A;  5C25 A;  1VRU A;  3U3Y A;  4GV9 A;  2O8C B;  5C0Y A;  1VQ4 N;  4DSE A;  1X3N A;  3ENO A;  2DFF A;  4MO4 A;  3SUP A;  4DUY K;  1S9E A;  4H0X B;  3VQB A;  1UA0 A;  3QFU A;  5BPN A;  5M1F A;  2GWK A;  3CQ8 A;  2Z1I A;  3H46 O;  1KVA A;  3MXM A;  2HNZ A;  3OS1 A;  4GMJ B;  1WUA A;  2X74 A;  3DOK A;  2FF6 A;  3SK3 A;  2DY4 A;  3MWT A;  1ATN A;  1TVR A;  1F21 A;  4E7I A;  3ZEU B;  3FZM A;  2OPP A;  3P1G A;  3MEC A;  2OPQ A;  4YOT A;  5C12 A;  1NOY A;  3VMF B;  3DMJ A;  5TKW A;  3ULD A;  3OY9 A;  3HTV A;  4AHV A;  3R8E A;  3LAM A;  4PQU A;  3O4N A;  4JI0 K;  4N41 A;  4BRH A;  5AQJ A;  5AFU A;  1T3V A;  4ILG B;  4O5B A;  5LMU K;  5JS1 A;  2X78 A;  3RSE A;  4FOI A;  1GOB A;  2BH1 A;  1JLQ A;  3S9H A;  1RBR A;  1OVY A;  5F1X A;  2W6K A;  5FPD A;  1EX4 A;  2F9T A;  3HPH A;  3ULE A;  3WUH A;  3QFP A;  3KZB A;  1S3X A;  4C8M A;  1RT1 A;  3H1Q A;  3DLH A;  2D0A A;  1NGF A;  4I6M A;  4M3U A;  3W3D A;  2Q1N A;  3G10 A;  3C94 A;  3CCJ N;  3JYT A;  3U3G A;  4W5R A;  1GLF O;  3SJJ A;  4DU3 A;  1TK0 A;  2HHW A;  3SNN A;  2ITM A;  1LAV A;  3OYD A;  4NO7 A;  3QEX A;  4E7L A;  4F4K A;  4BDZ A;  1G15 A;  3E1Y A;  3KHY A;  5BPL A;  4CK1 A;  3HT3 A;  1NJZ A;  3KD1 E;  5EOY A;  1GLL O;  4B3S K;  3SUQ A;  2VQE K;  1I3A A;  2UUB K;  1HYZ A;  3MX5 A;  1ZBL A;  3QML A;  4CF9 A;  5AQV A;  4JKB A;  4KHW A;  2G8F A;  3I56 N;  3G0Z A;  2XO7 A;  4CJS A;  3WEE A;  4FWM A;  4BVO A;  1XUP O;  1U49 A;  2P5O A;  1Q82 O;  4FJX A;  3OYI A;  1Q86 O;  1HNW K;  5AQN A;  1S1T A;  2HMI A;  4B9T A;  3B8A X;  4OKE A;  3RMA A;  3V9Z A;  2G8V A;  3DI6 A;  1VQ8 N;  4V19 S;  1QE1 A;  3IAY A;  1YF5 L;  3CPW M;  5IT9 O;  2JLE A;  4JKD A;  2UXD K;  4ID1 A;  4DTS A;  4JKH A;  1MA9 B;  3SJH A;  5D3G A;  4H5V A;  1RT3 A;  3NCI A;  2NLX A;  1J9A A;  3FZH A;  4YOX A;  4Z94 A;  4CF8 A;  3LP0 A;  3G6E N;  4I7F A;  3WNG A;  5BRF A;  2OA8 A;  1NK6 A;  3TAB A;  4IWV A;  3LAK A;  1WLJ A;  2O4I A;  2HVI A;  2KFN A;  2RN2 A;  1O1W A;  4ID5 A;  4BRQ A;  2KHO A;  4C8L A;  3OBY A;  1S72 N;  3PIP L;  1WSF A;  4BVP A;  5M1Q A;  4DG1 A;  3LWM A;  3KVG A;  3E9L A;  3O9R A;  1NGJ A;  2QI2 A;  4M42 A;  3O4Q A;  4B3M K;  4Z4H A;  4WFN L;  3DXK B;  3OYJ A;  2ASO A;  4HWI A;  3KKS A;  3D2F A;  3ZSQ A;  2E6L A;  3VQ7 A;  3CJ9 A;  2D5R A;  4B9S A;  4DF8 A;  2P9L A;  1D5A A;  4CJF A;  3RWU A;  2UYT A;  1U04 A;  3VQC A;  4CJ7 A;  4CES A;  4M41 A;  4DR2 K;  3RRG A;  5EX5 A;  1RTD A;  4BR9 A;  2VYP A;  2IS3 A;  2LSN A;  3VER A;  3AAQ A;  2GV9 A;  5BN8 A;  1NK8 A;  2DFH A;  4KTW A;  3UB5 A;  1JLE A;  2E20 A;  3F73 A;  4B1V A;  3SPZ A;  3SI6 A;  2ZGY A;  3ULE B;  4B9M A;  4YFU A;  3CMA N;  3DRS A;  4Z0U A;  1OH6 A;  1YI2 N;  1S9G A;  4FJM A;  4MO5 A;  1VSH A;  4DR4 K;  3DXM A;  3BZC A;  2E88 A;  3O9S A;  4JD2 A;  3THW B;  1CLQ A;  2CGL A;  1T03 A;  4XH1 A;  4MDB A;  1WNS A;  4Y1C A;  1YJW N;  4IJN A;  4CZI A;  4OO1 J;  1DT9 A;  1YIJ N;  1RBV A;  3MX2 A;  4DV6 K;  4E7K A;  3RMC A;  3NAE A;  3WXK A;  1VQL N;  5AQF A;  3LDN A;  4BRD A;  4IDH A;  1NBW A;  5I3U A;  3RMB A;  4CHY A;  1J6Z A;  1A5W A;  3VEV A;  2HNY A;  2E1Y A;  4CF0 A;  1YVN A;  5CYQ A;  4OLA A;  1NG9 A;  4DCH A;  1NMD A;  3I0S A;  3WNH A;  4CK3 A;  2O8B B;  1XNR K;  5AQI A;  4FW2 A;  1G99 A;  3OYC A;  3MEG A;  4DV4 K;  3C0B A;  4WQ4 C;  4BWJ A;  1UWB A;  2FBV A;  3JAM O;  3UKR B;  2VCP A;  4CHP A;  4GNI A;  2Z1H A;  3D2E A;  4ILH A;  4HTU A;  3P4I A;  5GIP A;  4BR2 A;  3LL3 A;  4CZL A;  3EZ5 A;  4FK4 A;  2OTL N;  4WQ5 A;  5KI6 A;  1YJN N;  1SKW A;  4AHS A;  3TSQ A;  1BA0 A;  1RDD A;  4LF9 K;  1YHQ N;  2QWR A;  5BRE A;  1NKC A;  4YOY A;  4R79 A;  3EL2 A;  3RR7 A;  4BR5 A;  4CJE A;  2GEM A;  2HBK A;  2IOC A;  4M45 A;  4CED A;  4EZ6 A;  4Z4G A;  1C0G A;  4Z4E A;  4BRM A;  3IMX A;  1WB9 A;  4FZX C;  2A5X A;  1H1V A;  3O9T A;  5AQT A;  4BRI A;  5BRD A;  4IBN A;  3H6E A;  4LF6 K;  1W9H A;  2RE2 A;  2XY6 A;  4B9U A;  1VQ6 N;  4BG9 A;  5C42 A;  1CZ9 A;  5FRN A;  1KAZ A;  1JLG A;  3CHW A;  1VQ5 N;  4NCB A;  4JAX A;  3DJC A;  5M1K A;  1CZA N;  3SMS A;  1HLU A;  1W2B M;  2YHY A;  4JI6 K;  4A57 A;  4FJN A;  2QWL A;  2KZZ A;  3GG4 A;  3EO3 A;  4FLX A;  3NF6 A;  2VWB A;  1JLA A;  1B92 A;  1BO5 O;  2ZF5 O;  4JYA K;  3QO9 A;  3F9M A;  4KPY A;  1BL3 A;  4W5T A;  4CJT A;  4DR1 K;  4HHT A;  2D0C A;  4W5Q A;  4NYF A;  4JKG A;  4FM0 A;  1TV6 A;  2HF4 A;  3MED A;  2P9N B;  4KB0 A;  3PIO L;  2OYQ A;  2W40 A;  3AA5 X;  2QWN A;  1TYQ B;  4CI6 A;  2QTD A;  4MLE A;  1NGC A;  3QEV A;  5J1E A;  4IOA L;  3O5B A;  5CR4 A;  4LFC K;  4CF2 A;  2E2O A;  5HRO A;  1NKB A;  1NMN A;  1HRH A;  4LF4 K;  3TSU A;  5KTQ A;  3SPY A;  3QEI A;  3CQY A;  3JSM A;  4BRG A;  3NMU A;  4DSF A;  4O8K A;  3NF8 A;  4KH4 A;  3QNO A;  3HSC A;  3VEY A;  4A5A A;  3VEZ A;  2ZJR L;  4I2Q A;  5K14 A;  4LF7 K;  2Z1G A;  2VGN A;  2HHV A;  1C0M A;  3M1F A;  1VSJ A;  4QCL A;  3SUO A;  5FDL A;  4DKW A;  4JLH A;  3R9P A;  2EWS A;  4FWQ A;  3MXJ A;  4CZF A;  4CF1 A;  4F2R A;  2YHA A;  4FLZ A;  1OKJ A;  3A2F A;  3ZET B;  1MU2 A;  2YKN A;  2NRW A;  2JGU A;  2F8S A;  4BG8 A;  3NVM A;  4A62 A;  1TYQ A;  5H1S Q;  4NXN K;  2D0P A;  1IV0 A;  2GEL A;  4I6M B;  1WSJ A;  3MN5 A;  3NH2 A;  1WAF A;  2IGI A;  2XY5 A;  5C15 A;  2VG7 A;  3K2P A;  2WC9 A;  4FWL A;  1L3S A;  2AA4 A;  1L3T A;  3J7Y P;  5SWM A;  4XH5 A;  4CEO A;  1C6V A;  3TI0 A;  3C95 A;  3SBG A;  3E9P A;  3U6F A;  1NGI A;  1RDU A;  4DQ8 A;  4FJ5 A;  4M63 C;  3QEW A;  3FFK B;  4IO8 A;  1KVC A;  3VOV A;  1JCG A;  3K59 A;  4QS8 A;  1NJW A;  4LF5 K;  3CQX A;  3HVT A;  2A1S A;  1JKH A;  4DS4 A;  1VQK N;  3V81 A;  2HMP A;  5CY4 A;  4B3T K;  4M3T A;  2WUS A;  4AHU A;  2YI1 A;  4DU1 A;  3ZSR A;  3M8P A;  4C1N K;  3K9J A;  4E1J A;  1NWK A;  4C1N I;  4DU4 A;  3CCL N;  3LDO A;  4CZM A;  1QQN A;  1N34 K;  4IJA A;  2QKB A;  4RCH A;  3BDP A;  3AAP A;  3OW2 M;  3AGK A;  1T7P A;  4ISG A;  2NNW A;  1KSP A;  3A0I X;  3OYL A;  4RW9 A;  3H08 A;  2VG5 A;  1NK5 A;  2BTF A;  4QOZ B;  2OPS A;  4GY2 B;  1TAU A;  4CJ4 A;  3I8B A;  3QB0 A;  3CC4 N;  3SQ4 A;  4DR3 K;  4CE9 A;  1A5X A;  2GUP A;  4FPA A;  3PX0 A;  1RIL A;  1SS6 A;  4GVE A;  4DR7 K;  2Y1I A;  2RPI A;  2HHS A;  4KHP K;  4CHQ A;  4CGG A;  5FRM A;  4F8R A;  4M7X A;  3PUF A;  3GDQ A;  2B6A A;  3UKU A;  2ZJQ L;  3V4I A;  5HLF A;  4CD1 A;  3L6Q A;  3HXM A;  4JHD B;  3MK6 A;  4DWI A;  1LWF A;  1GLC G;  1TUY A;  5KGX A;  3LP1 A;  4JKG B;  1R59 O;  2ETJ A;  3LZJ A;  4NCG A;  3G71 N;  1JJ2 M;  2DFE A;  4RG8 A;  3ZEU A;  3P31 A;  3DRR A;  1ZBF A;  3LDQ A;  1WSE A;  3NH1 A;  1RTI A;  4CJ3 A;  5FPM A;  2D1K A;  1N6Q A;  3O1W A;  3K58 A;  4DTP A;  2DPN A;  3HBT A;  1VSM A;  3MMV A;  1BCO A;  4QAG A;  3V9S A;  2BGG A;  4G9Z A;  1QZ5 A;  3K5L A;  4CZG A;  4KH5 A;  1HNZ K;  5BR9 A;  1BCM A;  4IG0 A;  2QEX N;  2HW3 A;  3ZT1 A;  4DV1 K;  1QS4 A;  3NGI A;  3AVF A;  4ELV A;  3OBW A;  4DF4 A;  2FBT A;  4WYB A;  1YIT N;  1VQO N;  4RW6 A;  5KGW A;  4YY3 K;  4DTJ A;  4JN4 A;  2P9I B;  3VQP A;  4KAZ A;  3EE8 A;  2E6M A;  3VES A;  4ZTJ A;  1RTH A;  4EP5 A;  1S1V A;  3SAF A;  2ZD1 A;  4ISF A;  2HBJ A;  2WOM A;  4CFB A;  4X64 K;  2YNF A;  4KHU A;  2P9K A;  4WQ5 C;  1XWL A;  1RCH A;  1NLV A;  2HST A;  2DTU A;  2FLO A;  4DLE A;  2VWJ A;  1HYV A;  5E26 A;  2GWJ A;  1HPM A;  3PX6 A;  4L8R B;  4K43 A;  3AVC A;  3TAN A;  4FJ8 A;  3CME N;  4DQP A;  3AV9 A;  4FZZ A;  4B3O A;  1XMQ K;  4O55 A;  1HX1 A;  3ZSO A;  3MCP A;  1CXU A;  4LY7 A;  4U67 L;  3I8D A;  5AQY A;  4CZE A;  3L8B A;  2AJQ A;  3FGU A;  1GLA G;  4FWK A;  4HUF A;  1J5O A;  3CJA A;  4CCH A;  1TKD A;  1KQS M;  3AVM A;  4O4G A;  1WAJ A;  1SL0 A;  3VF2 A;  4IOC L;  1UAX A;  3D45 A;  2UUC K;  5EVZ A;  3CFP A;  4EHU A;  3L3U A;  4IFV A;  1WSG A;  2O8E A;  4KB1 A;  1C0T A;  2Z1J A;  1KAX A;  1IKY A;  1NM1 A;  4CBW A;  4DMN A;  4F3T A;  1KLM A;  4CEQ A;  3KWG A;  3BUZ B;  3KTQ A;  3GE1 A;  3LPT A;  4YOR A;  5AQH A;  3MN7 A;  2XHB A;  4DTX A;  3M8R A;  1IKV A;  2V7Z A;  4Q5V A;  3KLG A;  3VEO A;  1NJY A;  2F9W A;  5M1O A;  3PO5 A;  1K73 O;  1BQM A;  3B6P A;  3PX4 A;  4IEI A;  3RMD A;  5DMR A;  2OAN A;  2HOE A;  3AO2 A;  3DM2 A;  4E3S A;  1JCF A;  5CHI A;  4W5N A;  1WBD A;  3BZK A;  1OH5 A;  2E2Q A;  1LAW A;  3ZX2 A;  1T6D A;  1CXQ A;  4GKK K;  4LF8 K;  4BY9 C;  4CGJ A;  1NNE A;  1U2V B;  3L2W A;  2F8T A;  3BP8 A;  3AVH A;  5CZ2 A;  2HVH A;  3MXI A;  2YHB A;  1NJX A;  4C8O A;  1GOA A;  2A3Z A;  3BY5 A;  1M1K O;  2RHK A;  3ZT4 A;  3D7E O;  4JI1 K;  3H45 C;  3SZ2 A;  3BF3 A;  2A1R A;  2F4V K;  1D8Y A;  2ZE2 A;  3NFA A;  1V4T A;  4YHH K;  4BRL A;  3CC7 N;  4BR4 A;  2O8E B;  1TKX A;  4KHS A;  3KK3 A;  4ILJ A;  1YUW A;  2P9K B;  4M3W A;  3VF4 A;  4K25 A;  2NRV A;  4OKK A;  1KAY A;  2D0O A;  3JS6 A;  2QK9 A;  3SQ0 A;  1NK0 A;  4J8F A;  3FFI A;  2CH6 A;  1GOC A;  5GAE P;  4BWM A;  4BAC A;  1K8K A;  5AQM A;  4IZ9 A;  3OHR A;  4DFK A;  4RWT A;  3PSI A;  2PFU A;  3TAR A;  4FSV A;  4DTO A;  2P9L B;  3HP9 A;  4DHY A;  4OVL A;  1EWR A;  1VSD A;  3NGY A;  4IFE A;  5KQ8 A;  1TUU A;  4CHZ A;  3QEP A;  1MWM A;  3S3O A;  4FLW A;  3KKR A;  3EYZ A;  3VQ8 A;  1NKE A;  2VG6 A;  3AVK A;  1RT2 A;  3AVG A;  3C6U A;  4BE0 A;  2QKK A;  1VSI A;  5HP1 A;  3O9Q A;  4CER A;  2PBD A;  3VN5 A;  1XI1 A;  4HUG A;  4ICL A;  5IWA K;  3FR0 A;  3SV3 A;  3ALY A;  1GLD G;  3VGL A;  4DSL A;  3A5L C;  1S5J A;  1ZC6 A;  3AVJ A;  5ADX H;  3PO4 A;  3K57 A;  4PKG A;  3K5M A;  3OYK A;  1JLC A;  3A5O C;  1BWF O;  4M7Y A;  1HQU A;  2P9S A;  4BQZ A;  1S6Q A;  3I55 N;  4BE1 A;  3IUC A;  3L2V A;  1K8K B;  3LP2 A;  3OYG A;  3QET A;  5AQG A;  3MWP A;  3KLF A;  5M1N A;  1QTM A;  4IEE A;  3FE1 A;  1T05 A;  1RGI A;  2P9P A;  2HHQ A;  1ILY A;  3L3V A;  2CGK A;  3QIC A;  4E89 A;  2O8F B;  1HNV A;  3VQ5 A;  3AVA A;  2KZM A;  4DQQ A;  4CFA A;  5AQO A;  1BI4 A;  1JXE A;  4DB3 A;  3SQ1 A;  1C1A A;  4CW7 B;  3LDL A;  1FK9 A;  1U48 A;  5KPR A;  1YXQ A;  4LSN A;  4O0I A;  5T7B A;  2YKM A;  4JKF A;  4RW8 A;  2IVP A;  5KPZ A;  1Z05 A;  3VQA A;  4Z4I A;  3HST B;  4O44 A;  3IFR A;  1RT7 A;  3HRG A;  3F9K A;  1IJJ A;  5FPE A;  1Q18 A;  1E4F T;  1DGK N;  2QWM A;  3V9W A;  4CEA A;  1Z25 A;  3QIP A;  4HCC A;  1SKR A;  4MDA A;  4BRO A;  1B9F A;  1RBU A;  3G4S N;  3L2R A;  1GLE G;  4JRP A;  1BIU A;  3OA9 A;  3WXI A;  4NB4 A;  3AVI A;  3CD6 N;  2YV0 X;  4K41 A;  5E84 A;  3TTD A;  1D9D A;  3AA2 A;  1NGD A;  2NRX A;  2KTQ A;  2FBX A;  2P9P B;  3A8Y A;  2YX6 A;  2YNH A;  4FWN A;  1BIS A;  3ZCM A;  4NLB A;  4E1M A;  4KFB A;  2XY8 A;  1N33 K;  4BRK A;  3CFR A;  3ZT3 A;  3AO1 A;  3O80 A;  4U7B A;  1I94 K;  4E1N A;  5JLH A;  4CEC A;  5J2P A;  3AY9 A;  4BDP A;  2AP1 A;  3OS0 A;  3QES A;  3I33 A;  5LJV A;  3HM9 A;  5DK5 A;  4JKE A;  4JKA A;  1SZ2 A;  1JCE A;  4FJI A;  5CYM A;  3THV A;  4AM7 A;  4BRA A;  3VQ9 A;  4M3Z A;  5LJW A;  4LFB K;  1SAZ A;  1S6P A;  3T1A A;  3QBX A;  2W42 A;  2FC0 A;  3EEQ A;  4FM2 A;  1LW0 A;  3HP6 A;  2IC3 A;  1SV5 A;  4LC9 B;  2Q0U A;  1S22 A;  4KHN A;  3THY B;  1IKX A;  4AHR A;  3HOT A;  1ZBH A;  3IG1 A;  4LSL A;  2I5J A;  3E66 A;  3L2U A;  1JXB A;  4JI4 K;  4FJ7 A;  4FK2 A;  2P9N A;  3MEE A;  3AGR A;  3VQE A;  3TSP A;  3D0P A;  3QNN A;  4N5S A;  4JI7 K;  5HOO A;  3CJC A;  1FKP A;  3G25 A;  4UY8 O;  1SQK A;  3EY1 A;  4PKH A;  3VF6 A;  3D2F B;  1N32 K;  2KKZ A;  5AQW A;  4QS9 A;  2BE2 A;  3AO5 A;  4DR5 K;  1VQ7 N;  4G1Q A;  5B8H A;  3TTC A;  3OYE A;  4FYD A;  4IFY A;  2BAN A;  4FJ9 A;  1RDW X;  4OPJ A;  3H3N O;  4DSK A;  4GKJ K;  1VQP N;  1D4X A;  5AJ3 K;  4CGF A;  3AA4 A;  4M3R A;  1L3V A;  1GLB G;  4X62 K;  1IBM K;  4DV7 K;  5JVH L;  1N5Y A;  1QHT A;  4EFH A;  4FK0 A;  4B8C A;  4NXM K;  3CC2 N;  4I9L A;  4H4M A;  5J2N A;  3C65 A;  3T3F A;  4YOW A;  3EKU A;  2VQF K;  5FLX O;  3RSE B;  2CGJ A;  3CM5 A;  4FVM A;  3U8X A;  4H0V B;  2E2P A;  3OYB A;  3TAQ A;  2IVN A;  1VHX A;  2YJF A;  4FCY A;  3TR8 A;  2FSJ A;  1NGH A;  3I0R A;  1KLN A;  4B1W B;  3GBT A;  4PKI A;  2OTJ N;  1MWK A;  4L3Q A;  4CD3 A;  5AR0 A;  3TAF A;  4FJL A;  1VRT A;  2ZM6 K;  3CF5 L;  1Q81 O;  1Y97 A;  3H1V X;  5GAH P;  1V4S A;  3HK2 A;  3NH0 A;  5AQZ A;  1W97 L;  4AIL C;  4AQY K;  4YDU C;  4KH6 A;  1B9D A;  4H03 B;  4C8N A;  3QER A;  1LOT B;  3T7Z A;  3C6H A;  1DTT A;  3BEX A;  3HL8 A;  3ID6 A;  3WXM B;  1WSH A;  3AVN A;  1XHZ A;  3EN9 A;  5TKY A;  4DSI A;  2ZQB A;  1IO2 A;  1BU6 O;  4FLU A;  4EZ9 A;  1RDC A;  4CJK A;  4JRQ A;  4F3O A;  2UU9 K;  3PSF A;  4KRF A;  3CXC M;  1NK7 A;  1HKG A;  4OGC A;  5HRN A;  4JI3 K;  1NGE A;  1BA1 A;  1WBB A;  5BN9 A;  3S3M A;  1EQY A;  4YDU A;  3DOL A;  3IKM A;  3KWI A;  4O5F A;  1VQ9 N;  4F2S A;  1C1C A;  1RT6 A;  1QSY A;  1EKE A;  3J80 O;  4AHC A;  2D4W A;  1T8E A;  1LV5 A;  5GAG P;  4ZHR A;  1OH7 A;  4A59 A;  1GLJ O;  4QS7 A;  4A5B A;  3WQU A;  3RRH A;  1ASW A;  1JLF A;  3R3L A;  5DM7 L;  2X6N A;  2O4G A;  3HO1 A;  5BRH A;  3CIP A;  3U9Z A;  1ZYQ A;  2YNG A;  3O3H A;  1XQS C;  4CHO A;  4H0T B;  4KRE A;  3DAW A;  2W41 A;  1ASV A;  1X1P A;  4PL8 A;  4J2D A;  3QIO A;  1RFQ A;  3HZ6 A;  4RTF D;  1DLO A;  2J4R A;  4ELT A;  1QSS A;  3E9O A;  3CCV N;  2Y1J A;  4CVN E;  4CBX A;  4BRC A;  1X9J A;  2UXC K;  4KV8 A;  4CFC A;  3J7A P;  5AQS A;  5AQX A;  4OJR A;  3ATV A;  2JWL A;  4KI6 A;  3CI5 A;  4Y0W A;  3V1R A;  5M1P A;  1W0H A;  4AHT A;  5GIO A;  2P1J A;  2Q2R A;  4WFB L;  3ZSX A;  3MN9 A;  4B9L A;  3DLB A;  3KIO A;  5C10 A;  1O13 A;  4ISE A;  1TL3 A;  2FSN A;  3TAM A;  5HRP A;  2QXL A;  2KLA A;  1ESV A;  2HHU A;  1Z6R A;  4BC4 A;  3HPG A;  3M6G A;  4PA1 A;  3TPQ A;  4DFM A;  3T1Y K;  5LMN K;  4OGE A;  4DSJ A;  5J2M A;  1HKB A;  4K42 A;  1UOC A;  4PHT X;  2G8W A;  3SAH A;  2H3G X;  4CBU A;  4GW6 A;  4FXD A;  3VA3 A;  2P9U A;  4DV0 K;  1QVG M;  5EU7 A;  1TK8 A;  2G8H A;  1I39 A;  3R1X A;  3KK2 A;  1DKG D;  2ITG A;  1HNX K;  3OS2 A;  1TL1 A;  4FWO A;  2KQ2 A;  3OYF A;  3ZET A;  4DQI A;  4BE2 A;  2F7T A;  3HPO A;  1ZBI A;  4CEB A;  4JV5 K;  5JLF A;  1QQC A;  4OPA A;  3VPZ A;  3FZK A;  1YTA A;  2E8A A;  3U9D A;  2BUP A;  3ZT0 A;  1E4G T;  1K8A O;  1LWC A;  3CCS N;  3IS9 A;  3LM9 A;  1P8Z A;  4XIU A;  3K0S A;  2PY5 A;  1NK4 A;  3LWL A;  5DM6 L;  4N56 A;  2PAV A;  4CJR A;  3LZI A;  1EET A;  1P90 A;  2VWK A;  5FRO A;  4B9N A;  1JL2 A;  4JK7 A;  3ENH A;  3HM8 A;  3WQT A;  3ZSV A;  1Q7Y O;  3F5T A;  2GTD A;  3NF7 A;  5I9E B;  4FJH A;  2G8U A;  4J2E A;  3NHG A;  4IKF A;  1K9M O;  1HYS A;  4BRF A;  4LD0 A;  1QHA A;  4DTR A;  2V7Y A;  3KLH A;  3NDK A;  3AAR A;  2BDP A;  1OVQ A;  2WBN A;  3OYH A;  3VQ6 A;  2WFB A;  1RDA A;  3VTI A;  1RT4 A;  5AQQ A;  1LCU A;  1E3M A;  2IIR A;  3UKR A;  2FF3 B;  3KLE A;  4C8K A;  4K0K K;  1SL1 A;  3HOS A;  3VQ4 A;  5GAD P;  1TAQ A;  3RR8 A;  1XMO K;  2XY7 A;  1QQO A;  2JWK A;  3TWH A;  5KQD A;  3KK1 A;  1XNQ K;  3UIQ A;  4BGB A;  4JK8 A;  3GOI A;  4E7H A;  4WQ4 A;  2QM1 A;  3KK7 A;  1N8R O;  3WXJ A;  4FVU A;  1VK0 A;  4JS4 A;  4CIG A;  3A5N C;  3TAG A;  3DLL L;  4DQR A;  4JK9 A;  4N47 A;  4FJG A;  4MQ3 A;  3T69 A;  3F2K A;  2NUB A;  1REV A;  1JL1 A;  4LH5 A;  3C6T A;  3ITH A;  4KKO A;  1RT5 A;  4DV5 K;  3DWL A;  3SQ2 A;  3WT0 A;  3FLC O;  1U2V A;  2NRH A;  1NOZ A;  1BUP A;  1RNH A;  3P5J A;  5E41 A;  3OJU A;  2KFZ A;  2GBZ A;  1HR0 K;  1X3M A;  1C1B A;  4TSX A;  2R7Y A;  4FPB A;  1J53 A;  2KW4 A;  2B4J A;  5FPN A;  3CG7 A;  1X9S A;  4CJW A;  4E19 A;  4M3X A;  1U47 A;  4IDK A;  4M3Y A;  3Q7C A;  1HMV A;  2YJE A;  4DS5 A;  3NVK A;  1SKS A;  3MDQ A;  4CZJ A;  1OH8 A;  4IO9 L;  1ITG A;  1XHX A;  2OZS A;  1Q8I A;  4CEE A;  2NRT A;  1WOQ A;  3AVL A;  3O4W A;  2QXF A;  3NGZ A;  3S3N A;  2B5J A;  1IH7 A;  1VSK A;  4BR7 A;  2PYL A;  1M90 O;  2D0B A;  4JI8 K;  1QVF M;  1ASU A;  5AZJ A;  2HF3 A;  3AO3 A;  1IG8 A;  4NLC A;  3V1O A;  3DXK A;  3C7N A;  2OCE A;  4I2P A;  5KPT A;  4K8Z A;  2QWP A;  3THW A;  1X9M A;  1YAG A;  1R0A A;  4KO0 A;  3CER A;  2E1Z A;  4J2A A;  3SUN A;  3V9X A;  4FWS A;  1C0U A;  4PL7 A;  4NYN A;  1FKO A;  1KRP A;  5JS2 A;  5ELZ A;  5CE3 A;  4EHT A;  2PYJ A;  3AA3 A;  3J7Z O;  4BDY A;  5AQK A;  3VTH A;  5HBM A;  4XH4 A;  1HQE A;  1VSF A;  4DTU A;  2IVO A;  3N4P A;  1TKT A;  4KHY A;  4A2A A; 
#chains in the Genus database with same CATH homology
 4N5S A;  4E7I A;  3K59 A;  1FKP A;  2OPP A;  3VQD A;  3P1G A;  3MEC A;  2OPQ A;  3DLG A;  1NOY A;  3V9U A;  4YNQ A;  3DMJ A;  1NJW A;  2P5G A;  3EY1 A;  3ULD A;  3OY9 A;  3HVT A;  4AHV A;  2A1S A;  1JKH A;  4DS4 A;  3V81 A;  3B6O A;  2BE2 A;  3AO5 A;  3LAM A;  5CY4 A;  4H8K A;  4PQU A;  3O4N A;  4N41 A;  4M3T A;  2PZS A;  4AHU A;  4G1Q A;  3OYE A;  4O5B A;  3LPU A;  4FYD A;  4IFY A;  2X6S A;  2BAN A;  2X78 A;  4DU1 A;  4FZY A;  4FJ9 A;  5JS1 A;  4DFP A;  3ZSR A;  4OPJ A;  3M8P A;  4DSK A;  4R5P A;  3T19 A;  1NK9 A;  1GOB A;  4DU4 A;  1FXX A;  1JLQ A;  3S9H A;  1RBR A;  4CGF A;  3AA4 A;  4M3R A;  1L3V A;  1KCF A;  2HB5 A;  4J2B A;  2HHT A;  1EX4 A;  3HPH A;  2QKB A;  4FLT A;  1N5Y A;  3BDP A;  4CJU A;  1QHT A;  4FK0 A;  4B8C A;  5HRS A;  3M8S A;  1T7P A;  4C8M A;  4I9L A;  4H4M A;  1KSP A;  1RT1 A;  5J2N A;  3OYL A;  3T3F A;  3DLH A;  2D0A A;  4RW9 A;  5HRR A;  2OZM A;  3H08 A;  2VG5 A;  1NK5 A;  4M3U A;  4H4O A;  3L2Q A;  5KRS A;  3G10 A;  4Y1D A;  4B9V A;  3C94 A;  4DTM A;  2OPS A;  4QOZ B;  1TAU A;  3ZSW A;  4PUO A;  3ASM A;  3CM5 A;  4FVM A;  3JYT A;  3U3G A;  3LDS A;  1Q9X A;  4CJ4 A;  4W5R A;  3SJJ A;  3OYB A;  4DU3 A;  1TK0 A;  4DQS A;  3SQ4 A;  3SNN A;  4CJQ A;  3TAQ A;  4CE9 A;  4CJL A;  4CIE A;  4FCY A;  2HHW A;  1A5X A;  1LAV A;  3TR8 A;  1S1W A;  3PX0 A;  1RIL A;  3OYD A;  3P83 D;  2Y1I A;  2RPI A;  1DTQ A;  3I0R A;  2HHS A;  3QEX A;  4E7L A;  4F4K A;  1LWE A;  4BDZ A;  1KLN A;  1G15 A;  1UA1 A;  4PWD A;  4CHQ A;  4CGG A;  4CK1 A;  3HT3 A;  5FRM A;  4F8R A;  1NJZ A;  3PUF A;  3KD1 E;  2B6A A;  3V4I A;  5HLF A;  1Q9Y A;  3TAF A;  3SUQ A;  3ZSZ A;  4FJL A;  1VRT A;  3O3F A;  3HXM A;  3BGR A;  4CK2 A;  1I3A A;  1Y97 A;  4DWI A;  4ELU A;  1LWF A;  4HCB A;  5KGX A;  1HYZ A;  3LP1 A;  3HK2 A;  2ETJ A;  3NH0 A;  1ZBL A;  4FLY A;  4CF9 A;  4KHQ A;  3O3G A;  4AIL C;  3LZJ A;  4NCG A;  1RBT A;  4KHW A;  2G8F A;  2DFE A;  3SV4 A;  1WSI A;  4RG8 A;  3G0Z A;  1B9D A;  2IDO A;  4FW1 A;  1LW2 A;  2XO7 A;  4CJS A;  1RTJ A;  3HJF A;  4C8N A;  4FLV A;  2F96 A;  4OPK A;  3QER A;  1U49 A;  3DRR A;  1ZBF A;  1DTT A;  2P5O A;  1WSE A;  3NH1 A;  4FJX A;  1RTI A;  4CJ3 A;  3HL8 A;  3OYI A;  3QLH A;  1WSH A;  1N6Q A;  3K58 A;  4DTP A;  1S1T A;  2HMI A;  3AVN A;  4UQG A;  1XHZ A;  4B9T A;  4DSI A;  1VSM A;  2ZQB A;  1BCO A;  1IO2 A;  3CM6 A;  4QAG A;  4OKE A;  3V9S A;  2BGG A;  1BI4 B;  3LAL A;  4FLU A;  3RMA A;  1RDC A;  4CJK A;  3K5L A;  4JRQ A;  3V9Z A;  2G8V A;  4EZ9 A;  4F3O A;  3DI6 A;  4KRF A;  1BCM A;  4IG0 A;  1NK7 A;  1QE1 A;  2HW3 A;  4OGC A;  5HRN A;  3ZT1 A;  3IAY A;  1CZB A;  1QS4 A;  4HUE A;  3NGI A;  4OLB A;  3AVF A;  4ELV A;  4DF4 A;  3S3M A;  2JLE A;  3PY8 A;  2FBT A;  4ID1 A;  3DOL A;  4DTS A;  4F2S A;  1C1C A;  1RT6 A;  1QSY A;  1YTU A;  4RW6 A;  5KGW A;  3KJV A;  1EKE A;  4DTJ A;  3VQP A;  4AHC A;  4KAZ A;  1T8E A;  1LV5 A;  4ZHR A;  2E6M A;  5D3G A;  4ZTJ A;  1RTH A;  1RT3 A;  4EP5 A;  3NCI A;  3RRH A;  1J9A A;  1S1V A;  4CIF A;  1ASW A;  1JLF A;  2IAJ A;  4AH9 A;  2ZD1 A;  4CF8 A;  3LP0 A;  2WOM A;  4CGH A;  4CFB A;  2X6N A;  2O4G A;  2YNF A;  4I7F A;  4KHU A;  3WNG A;  3HO1 A;  1XWL A;  4PY5 A;  1RCH A;  2OA8 A;  2DTU A;  1NK6 A;  3TAB A;  4DLE A;  4KTQ A;  3LAK A;  1WLJ A;  2VWJ A;  2O4I A;  1D9F A;  2HVI A;  1HYV A;  1BGX T;  1ZYQ A;  2RN2 A;  2KFN A;  3V1Q A;  2YNG A;  3PX6 A;  3O3H A;  1O1W A;  4ID5 A;  4CHO A;  4KRE A;  4L8R B;  3CYM A;  1BHL A;  5CZ1 A;  4C8L A;  1ASV A;  1X1P A;  3NBP A;  3AVC A;  1WSF A;  3TAN A;  4FJ8 A;  4J2D A;  3QIO A;  4DQP A;  3AV9 A;  4DG1 A;  4FZZ A;  1DLO A;  3LAN A;  1J54 A;  3LWM A;  4B3O A;  3DRP A;  4O55 A;  3ZSO A;  4ELT A;  1CXU A;  1QSS A;  4LY7 A;  2Y1J A;  3I8D A;  1BIZ A;  4M42 A;  3L8B A;  4KV8 A;  3O4Q A;  5J2Q A;  2AJQ A;  2FBY A;  4CFC A;  4Z4H A;  2HND A;  3OYJ A;  3DLK A;  4HUF A;  1J5O A;  3KKS A;  4CCH A;  4OJR A;  1TKD A;  4N76 A;  3AVM A;  4KI6 A;  1KFD A;  3V1R A;  5C24 A;  3ISN C;  3LP3 A;  4O4G A;  1WAJ A;  3OVN A;  2E6L A;  3ZSQ A;  4W5O A;  1SL0 A;  1A5V A;  3VQ7 A;  2D5R A;  4B9S A;  1UAX A;  4CGI A;  4DF8 A;  1W0H A;  1D5A A;  3D45 A;  4AHT A;  2P1J A;  4CJF A;  3RWU A;  1U04 A;  3VQC A;  3ZSX A;  3L3U A;  4IFV A;  1WSG A;  3OYN A;  3K5N A;  3CFP A;  4KB1 A;  4CES A;  1C0T A;  4M41 A;  4B9L A;  2Z1J A;  3DLB A;  3RRG A;  1IKY A;  4DMN A;  3KIO A;  4F3T A;  1KLM A;  4CEQ A;  1RTD A;  3AO4 A;  3KTQ A;  3LPT A;  1TL3 A;  3TAM A;  5HRP A;  2IS3 A;  2P51 A;  2LSN A;  3AVB A;  2XHB A;  4DTX A;  4B8A B;  3M8R A;  2GV9 A;  3TAE A;  1IKV A;  2HHU A;  1NK8 A;  2GUI A;  4DFJ A;  2DFH A;  4KTW A;  4FJJ A;  3HPG A;  1JLE A;  4Q5V A;  3KLG A;  3F73 A;  4PA1 A;  3SPZ A;  1NJY A;  3KD5 E;  4DFM A;  3SI6 A;  4NCA A;  4OGE A;  3DYA A;  1Z26 A;  3PO5 A;  1BQM A;  3B6P A;  5J2M A;  3PX4 A;  4DSJ A;  4LH4 A;  4B9M A;  4YFU A;  1L5U A;  3RMD A;  1UOC A;  5DMR A;  4EP4 A;  3DRS A;  4Z0U A;  3AO2 A;  3DM2 A;  4E3S A;  1S9G A;  2G8W A;  4FJM A;  4W5N A;  1U45 A;  4GW6 A;  4FXD A;  1VSH A;  4DLG A;  3VA3 A;  4GVM A;  1LAW A;  4CGD A;  1JLB A;  1EP4 A;  1CLQ A;  1T03 A;  1S1X A;  1CXQ A;  1KTQ A;  3QIN A;  1IKW A;  5EU7 A;  1TK8 A;  2G8H A;  1I39 A;  4CGJ A;  3L2W A;  2F8T A;  3KK2 A;  2HHX A;  3AVH A;  1WNS A;  4Y1C A;  5CZ2 A;  2HVH A;  2ITG A;  2YHB A;  3MXI A;  1NJX A;  4C8O A;  1GOA A;  5SZT A;  3OS2 A;  1TL1 A;  3ZT4 A;  4B08 A;  1XC9 A;  1TKZ A;  2KQ2 A;  4HVJ A;  3SZ2 A;  3OYF A;  2A1R A;  1D8Y A;  1RBV A;  2ZE2 A;  3NFA A;  4BE2 A;  4DQI A;  4I9Q A;  3RMC A;  4E7K A;  1VSL A;  3NAE A;  3HPO A;  3NE6 A;  1ZBI A;  1TKX A;  4CEB A;  4KHS A;  4Z4C A;  1RDB A;  5I3U A;  3RMB A;  3KK3 A;  2XRI A;  1BQN A;  4RW4 A;  4CHY A;  1QQC A;  3SYZ A;  5KRT A;  1A5W A;  4M3W A;  2HNY A;  1YTA A;  4OKK A;  2ATQ A;  4CF0 A;  5CYQ A;  3ZT0 A;  4OLA A;  4CJV A;  2QK9 A;  1LWC A;  3SQ0 A;  3I0S A;  1NK0 A;  4K8X A;  3CFO A;  3FFI A;  3IS9 A;  3WNH A;  4CK3 A;  4XIU A;  1GOC A;  5I42 A;  2PY5 A;  4BWM A;  1NK4 A;  4BAC A;  3LWL A;  4N56 A;  4FW2 A;  3OYC A;  3MEG A;  4CJR A;  3LZI A;  1EET A;  2VWK A;  5FRO A;  4CEZ A;  4DFK A;  4BWJ A;  1UWB A;  1HNI A;  3TAR A;  3OYA A;  4WE1 A;  2FBV A;  4B9N A;  1JL2 A;  4DTO A;  3ZSV A;  1RBS A;  3HP9 A;  4CHP A;  3NF7 A;  4O0J A;  4OVL A;  3OYM A;  2G8U A;  4FJH A;  1VSD A;  4J2E A;  3NGY A;  3NHG A;  1KFS A;  4IKF A;  2G8K A;  2Z1H A;  2YNI A;  1HYS A;  4HTU A;  4LD0 A;  4DTR A;  4CHZ A;  3QEP A;  3EZ5 A;  4FK4 A;  2EHG A;  5KI6 A;  3S3O A;  3KLH A;  4FLW A;  3KKR A;  3EYZ A;  3ZT2 A;  3VQ8 A;  1NKE A;  2VG6 A;  3AVK A;  1RT2 A;  4AHS A;  3NDK A;  3AVG A;  1SKW A;  3C6U A;  1RDD A;  4BE0 A;  2BDP A;  2QKK A;  1TK5 A;  3OYH A;  1VSI A;  3VQ6 A;  1RDA A;  5HP1 A;  3VQQ A;  1NKC A;  4CER A;  1X9W A;  3VN5 A;  3WNE A;  1XI1 A;  1RT4 A;  4HUG A;  4ICL A;  3RR7 A;  4Q0B A;  4CJE A;  4Z4G A;  2IOC A;  4M45 A;  4CED A;  3SV3 A;  4EZ6 A;  3K5O A;  3ALY A;  4MFB A;  4Z4E A;  3KLE A;  1K6Y A;  4C8K A;  1SL1 A;  4DTN A;  4DSL A;  3VQ4 A;  1S5J A;  4FZX C;  3AVJ A;  1TAQ A;  3RR8 A;  4IBN A;  3PO4 A;  3K57 A;  2XY7 A;  4CHN A;  3K5M A;  3OYK A;  1JLC A;  3KK1 A;  1W9H A;  3D0P A;  3TWH A;  2XY6 A;  4B9U A;  3UIQ A;  1HQU A;  2G8I A;  3IRX A;  4E7H A;  5C42 A;  1CZ9 A;  3M8Q A;  1S6Q A;  3HVR A;  4BE1 A;  5FRN A;  3L2V A;  3V6D A;  1JLG A;  3LP2 A;  4FJ5 A;  4NCB A;  3OYG A;  1VK0 A;  3QET A;  4JS4 A;  4CIG A;  2E4L A;  3KLF A;  3TAG A;  2EX3 A;  1QTM A;  4DQR A;  4N47 A;  1T05 A;  4FJG A;  4FJN A;  4MQ3 A;  2NUB A;  1REV A;  2HHQ A;  2KZZ A;  1JL1 A;  3C6T A;  3ITH A;  4LH5 A;  4KKO A;  1RT5 A;  3L3V A;  4FLX A;  3NF6 A;  3SQ2 A;  4E89 A;  1HNV A;  1U4B A;  1WN7 A;  3VQ5 A;  1JLA A;  3AVA A;  4DQQ A;  2KZM A;  1B92 A;  1NOZ A;  3TAP A;  4CFA A;  4E7J A;  1RNH A;  3P5J A;  1BI4 A;  1JXE A;  3QO9 A;  5E41 A;  3SQ1 A;  1C1A A;  1S1U A;  3OJU A;  2KFZ A;  4OKJ A;  1BL3 A;  1FK9 A;  2GBZ A;  4KPY A;  1VSE A;  1U48 A;  4W5T A;  4CJT A;  4FJK A;  4FM0 A;  4HHT A;  2D0C A;  4W5Q A;  4NYF A;  3PV8 A;  1C1B A;  1TV6 A;  1IG9 A;  3MED A;  4LSN A;  4O0I A;  4TSX A;  4KB0 A;  4ZTF A;  5T7B A;  2R7Y A;  2OYQ A;  3MAQ A;  3AA5 X;  2YKM A;  1SUQ A;  3KLI A;  1J53 A;  1KVB A;  2KW4 A;  2B4J A;  4RW8 A;  3CG7 A;  3QEV A;  4CJP A;  4KI4 A;  3RTV A;  1X9S A;  5J1E A;  3VQA A;  4CJW A;  3HST B;  4E19 A;  4Z4I A;  2RF2 A;  4O44 A;  4CF2 A;  1RT7 A;  4M3X A;  1U47 A;  2OPR A;  3F9K A;  2WON A;  5HRO A;  1HRH A;  1NKB A;  4E0D A;  4FM1 A;  4JS5 A;  4IDK A;  1EXQ A;  5KTQ A;  4M3Y A;  3SCX A;  1HPZ A;  3QEI A;  1HMV A;  3SPY A;  3JSM A;  3V9W A;  4CEA A;  1Z25 A;  3QIP A;  3DLE A;  4DSF A;  4HCC A;  1SKR A;  3HYF A;  3NF8 A;  4DS5 A;  1B9F A;  1RBU A;  1SKS A;  4IG3 A;  3L2R A;  3VA0 A;  2RKI A;  4JRP A;  1BIU A;  3AVI A;  4CFD A;  1ITG A;  1XHX A;  2YV0 X;  3QNO A;  2OZS A;  1Q8I A;  4CEE A;  1D9D A;  3AA2 A;  3AVL A;  4I2Q A;  5K14 A;  2FBX A;  3NF9 A;  4Z4F A;  2KTQ A;  2QXF A;  2YNH A;  3ZCM A;  1BIS A;  2Z1G A;  3NGZ A;  3S3N A;  4E1M A;  4KFB A;  2XY8 A;  2HHV A;  3WNF A;  2B5J A;  4RW7 A;  1C0M A;  1IH7 A;  1VSK A;  1VSJ A;  3CFR A;  1QSL A;  3ZT3 A;  4QCL A;  3AO1 A;  3SUO A;  4E1N A;  2PYL A;  1L3U A;  5FDL A;  4CEC A;  4KTZ A;  5J2P A;  3DLR A;  4BDP A;  2D0B A;  1HJR A;  4JLH A;  3OS0 A;  3MXJ A;  3QES A;  1YT3 A;  1ASU A;  3HM9 A;  5DK5 A;  3AO3 A;  4CF1 A;  4CJ5 A;  3ZSY A;  1ZBU A;  4CEF A;  4F2R A;  2YHA A;  3V1O A;  4FLZ A;  1TGO A;  3A2F A;  4I2P A;  4FJI A;  5CYM A;  3THV A;  1MU2 A;  2Q3S A;  2YKN A;  3OJS A;  2JGU A;  2F8S A;  4K8Z A;  3VQ9 A;  4M3Z A;  1X9M A;  1S6P A;  3T1A A;  1WSJ A;  1R0A A;  1SL2 A;  3E01 A;  3NH2 A;  4KO0 A;  1WAF A;  2FC0 A;  2IGI A;  2W42 A;  2XY5 A;  1YVU A;  4J2A A;  3SUN A;  5C25 A;  1VRU A;  3U3Y A;  4FM2 A;  1LW0 A;  3V9X A;  3HP6 A;  1C0U A;  2VG7 A;  3K2P A;  4NYN A;  1FKO A;  2IC3 A;  1SV5 A;  4DSE A;  1L3S A;  1KRP A;  2DFF A;  1L3T A;  5JS2 A;  4KHN A;  5SWM A;  1IKX A;  4AHR A;  3SUP A;  4CEO A;  1S9E A;  3VQB A;  1UA0 A;  2PYJ A;  1C6V A;  3TI0 A;  3AA3 A;  3CQ8 A;  2Z1I A;  3C95 A;  1KVA A;  4BDY A;  2HNZ A;  3MXM A;  3OS1 A;  5HBM A;  1ZBH A;  4GMJ B;  3U6F A;  2X74 A;  3IG1 A;  2I5J A;  4LSL A;  3L2U A;  3DOK A;  3QEW A;  1HQE A;  1JXB A;  1VSF A;  4DTU A;  1KVC A;  2DY4 A;  4FJ7 A;  4FK2 A;  1TKT A;  3MEE A;  4KHY A;  3VQE A;  3QNN A;  1TVR A;  1F21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...