4CIEA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
152
structure length
146
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cieA00
4FW1A 3MEGA 4OGEA 4DFMA 3OYEA 5FROA 1S1XA 1XC9A 3KD5E 2HNDA 3AA2A 4XIUA 3L8BA 3RRGA 4BACA 1LWEA 5HRNA 4ZTFA 4QAGA 3NGIA 4E7LA 3SQ1A 4DSJA 3HPGA 1HJRA 4CGJA 1EXQA 1SL2A 1NK4A 2OA8A 1EETA 1SKSA 1W9HA 1D5AA 3CYMA 4J2BA 1S9EA 1KLMA 4MFBA 2G8VA 4BDPA 3IS9A 1NK9A 4CEOA 3DLGA 3SQ2A 2EX3A 3C94A 4B9NA 3PX6A 4J2EA 4CEQA 4NCBA 4DTUA 1TK5A 3OYDA 3AO5A 1UWBA 3SQ4A 5K14A 4I2PA 4ELTA 4IBNA 4W5OA 3SJJA 3CM5A 3DM2A 3BDPA 3ZT4A 3KJVA 1EX4A 1J9AA 4CJQA 2DTUA 4PQUA 2RKIA 2HHTA 2ZD1A 5KRTA 1RBVA 4CEZA 4E7HA 4KPYA 4N47A 3TWHA 5KGWA 4FLTA 3HP9A 3HP6A 1HYZA 1Q9XA 1RILA 2HNYA 4FLYA 2G8KA 1X1PA 1L5UA 4G1QA 1J5OA 4M3XA 1LW2A 3OYAA 1C0TA 1KTQA 3HYFA 3RMAA 4CF9A 3RMCA 1TVRA 1VSIA 2B5JA 3AVMA 4RW7A 1RDBA 4DFKA 4FJXA 4JRPA 1QTMA 1JLAA 1EKEA 3KKRA 3V9XA 4FM1A 3T19A 2P5GA 3SPZA 1O1WA 5J2PA 4R5PA 2HHSA 5C25A 3KK2A 3S3MA 1U4BA 5CZ1A 4Z4EA 2IS3A 1IKWA 1RTIA 4IFVA 3QLHA 4DMNA 3T1AA 1VSKA 1K6YA 2GBZA 4CK2A 2OPPA 3A2FA 2NUBA 3O4NA 1U04A 3V1RA 1RBTA 4C8LA 1C1CA 4HUGA 1JLQA 2DY4A 2F96A 4HCBA 1CXQA 4DTPA 2HMIA 4AILC 3QEWA 3VN5A 1QQCA 4BWMA 1WSGA 4ZTJA 2XRIA 2DFFA 4CIFA 3RTVA 1NJZA 1QSSA 1ZBFA 4CIGA 4FZXC 1WAFA 4DSEA 3LP1A 1T7PA 1YT3A 2BDPA 3NF7A 4E7KA 3FFIA 1LAVA 4FJKA 2DFHA 4CHQA 4FM0A 1VSMA 3SUPA 4PWDA 4F2RA 3M8QA 3OYGA 1RT1A 5DMRA 3HT3A 5CYQA 5KRSA 3AVKA 4B08A 2HW3A 4KHWA 1LWFA 2YKMA 3VQPA 3I0RA 1LWCA 4FJIA 2YKNA 3LP2A 4DG1A 3LDSA 2FC0A 3ZSWA 4NCAA 4B3OA 2XY5A 2HHWA 2YV0X 1WSJA 4ID5A 3PX0A 3DRPA 4ELUA 1VSJA 4F3TA 4BE1A 4C8MA 1NOYA 4FK0A 1ZBHA 3NH2A 1TV6A 1RDAA 3E01A 3ZT0A 1HQEA 4I9LA 2WONA 2IGIA 4DFPA 3SUQA 4Y1CA 3KLHA 5JS1A 2KW4A 2Z1GA 1QE1A 1HRHA 2YNHA 3ZSYA 3SV4A 4FJJA 4DLGA 1T05A 1RTJA 2FBXA 2Z1JA 3LALA 4CESA 3ZSXA 3PV8A 3WNFA 2IOCA 3RR8A 3VA3A 3TAQA 2BGGA 1JXBA 3LPUA 3NHGA 3OYCA 1Q9YA 3AVNA 1HPZA 2HNZA 4CGGA 1UA1A 5HRRA 4CHYA 4KB0A 2Q3SA 4KTQA 3SCXA 3OJSA 1JLGA 1WNSA 3DRRA 1TK0A 3NGZA 3AA4A 1Q8IA 3ZSQA 2QXFA 1RNHA 2OPRA 3M8PA 1I3AA 4W5TA 5HLFA 1C0UA 2GV9A 4FCYA 2OPSA 4CGIA 1L3VA 4CFBA 3TAMA 2GUIA 1KVAA 2X78A 4CE9A 3PY8A 3K5LA 1S9GA 4CK3A 2VG7A 4FW2A 3AVLA 3MXMA 3CG7A 1X9WA 1HQUA 3LZIA 5FRNA 5SZTA 3PO5A 4FJ9A 4KAZA 3O3FA 2OYQA 4MQ3A 1EP4A 4CHNA 2KFZA 3CQ8A 1BIZA 1JLCA 2B6AA 1BGXT 1J54A 1S1VA 3MEEA 4M45A 4CGFA 1UAXA 4CJEA 4OKEA 4N56A 1KFSA 2XO7A 4FJ7A 2G8IA 3F9KA 1SUQA 3V1QA 4FK4A 3C6UA 3KLGA 1JLEA 5KI6A 2P1JA 1T03A 3QO9A 3VQEA 3K57A 1BQNA 3VQ6A 3OYBA 3KK1A 3P1GA 4DLEA 3SQ0A 3C6TA 3AA3A 4DTJA 3TANA 1DLOA 3NBPA 3KD1E 4F4KA 2KZZA 3V6DA 4W5QA 1L3UA 4HHTA 4CJLA 4M3UA 3AVIA 4IKFA 1CXUA 4JS5A 4I9QA 3P5JA 4UQGA 2VWJA 4FLZA 3G0ZA 4GVMA 5J1EA 1HNIA 2DFEA 3NFAA 2VG5A 4FJHA 1ZBIA 1VSLA 3SUOA 4FLWA 1KSPA 1C1BA 4Z4GA 4QOZB 4CF0A 3SUNA 3K5OA 4DQRA 4N76A 2W42A 4O4GA 3DLEA 5FDLA 5DK5A 4LSLA 4M42A 1NK5A 3K5NA 2Y1IA 3PO4A 3ALYA 4W5RA 1NK8A 3V9ZA 4C8KA 1RDDA 1NJYA 1F21A 3T3FA 3L2WA 4DQIA 4OGCA 4Z0UA 4CJ5A 4M41A 4IDKA 4KO0A 4E1MA 4KHNA 3HJFA 4RG8A 2KFNA 3RR7A 4ICLA 3DOKA 1RT3A 3KLEA 4OLBA 1TKDA 1JXEA 4ZHRA 3CFOA 4I7FA 3QINA 5HRSA 4O0IA 4FM2A 1GOBA 3MECA 3WNEA 4CHZA 3DLRA 3NH1A 4CERA 3QERA 3U3YA 3OYJA 4RW4A 4FJNA 4CEDA 4RW9A 3SZ2A 1ASWA 3QEPA 1TAUA 4PY5A 3AO4A 1KVCA 4NYFA 4FJGA 4OKJA 1WSFA 1C6VA 3G10A 4FLUA 3LWMA 1ZBUA 2FBTA 1X9SA 1GOCA 4E1NA 1W0HA 3RWUA 4DSLA 3AVHA 3NDKA 4Z4IA 4PA1A 2A1SA 4BDYA 4DTXA 2XHBA 2QKKA 4CEBA 4K8XA 1IO2A 1BCMA 3TAFA 1D8YA 2E6MA 4DTMA 4F2SA 3LAMA 1JLBA 4AHRA 4F3OA 4OKKA 4CGDA 1WLJA 1RT6A 4AH9A 1CLQA 1VRTA 1IKVA 3L2RA 2D5RA 5E41A 3JSMA 3VA0A 4OPJA 1XHZA 3TR8A 3PUFA 1CZ9A 2PYLA 3VQ4A 4QCLA 4CEEA 3DOLA 3AVFA 1NOZA 3WNGA 4Z4HA 4KHSA 3JYTA 2ZE2A 3QETA 3MAQA 1A5VA 2HHUA 3HPHA 4OPKA 3AO2A 3S3OA 2F8TA 3V1OA 3TAPA 1XHXA 1U48A 2PZSA 1IKYA 3K59A 4DU4A 4B9SA 4B9VA 2I5JA 4RW8A 3IRXA 4RW6A 1T8EA 5JS2A 4B8CA 4BE2A 4TSXA 1SL1A 3DYAA 3ZSZA 2YNIA 3AO3A 2D0BA 4CFDA 3V9SA 3MXIA 3VQCA 4E3SA 1TKXA 4CJWA 1NKEA 1NK6A 4EP4A 1HNVA 3U3GA 4YNQA 1X9MA 4O5BA 5C24A 3VQ9A 5I3UA 2ZQBA 3VQAA 4IG0A 4CFAA 4OVLA 4LH5A 4CHPA 3OYLA 3QNNA 1KLNA 4AHCA 1SKWA 4DFJA 2IC3A 1N5YA 3DLHA 1NKBA 2XY8A 3TARA 1NJWA 4FYDA 1B9DA 2E4LA 2LSNA 5T7BA 3V9UA 4AHUA 1ITGA 3LAKA 1BISA 4LSNA 4M3ZA 1C1AA 3ZSVA 2QKBA 3TABA 3AVCA 4FVMA 1U49A 4CCHA 4NYNA 3KKSA 2X74A 2P5OA 2X6NA 4KFBA 3ZSRA 3ZT1A 5HRPA 2O4GA 3OYIA 4DTRA 2FBVA 3WNHA 4DQSA 3QEVA 2VWKA 3L3VA 4KKOA 4Z4CA 5EU7A 1BHLA 2X6SA 1U47A 4ELVA 3QIPA 3HVTA 4M3YA 1S6PA 1XWLA 4BWJA 2IAJA 1KVBA 3L2UA 2E6LA 3K58A 1D9FA 4HCCA 1RT5A 4PUOA 1SKRA 3HK2A 4E89A 3OJUA 4O0JA 4CJVA 3IAYA 1QS4A 3VQQA 2RPIA 2D0AA 4IFYA 3AA5X 1ASVA 1WSIA 4K8ZA 4CIEA 3SI6A 4GMJB 1J53A 4N41A 4AHTA 1S5JA 1BI4B 4DTNA 4O44A 1B92A 3U6FA 4B9TA 3NGYA 3ZT3A 3AV9A 2OPQA 1VK0A 3OYKA 3OS2A 4DTOA 3B6OA 1LV5A 3TAEA 4KHQA 2HHXA 1FXXA 4F8RA 1RCHA 4LD0A 3QNOA 1YTAA 1VSEA 1C0MA 1LAWA 3SPYA 3VQDA 3RMDA 3QEIA 1RBUA 4Q5VA 4FZZA 4B9MA 4DQPA 1BQMA 4C8NA 3NCIA 2QK9A 3UIQA 3I0SA 1TL1A 2HVIA 5D3GA 4HVJA 4H8KA 3SV3A 4LY7A 2KTQA 1WSHA 2B4JA 5SWMA 4CECA 4DQQA 3V9WA 3I8DA 2P51A 3O4QA 4HUFA 4CEAA 1NJXA 4FZYA 5J2NA 2HHQA 4FJMA 1UOCA 2JLEA 3HSTB 4N5SA 3LP0A 4O55A 4DSFA 3LANA 3CFRA 5HBMA 3RMBA 2HVHA 1KFDA 1KRPA 4E7IA 1RTHA 1Z26A 4OLAA 3OS1A 4KREA 3RRHA 3DMJA 3NF9A 1S1WA 2EHGA 4CJFA 3OYMA 5KGXA 2G8FA 4M3WA 3DLKA 3V4IA 1B9FA 1RBSA 5CY4A 2O4IA 1R0AA 1G15A 3LWLA 2XY6A 4Y1DA 2YHAA 3LPTA 3QIOA 4BDZA 4E0DA 4EZ6A 4M3TA 2HHVA 1S1UA 3AVJA 1VRUA 1RDCA 1BI4A 4CGHA 3O3HA 3TI0A 4EP5A 3IG1A 1U45A 1D9DA 4CJSA 3NAEA 4Q0BA 4KTWA 1A5WA 3OYFA 4DF4A 4KRFA 3HXMA 1RT2A 3K5MA 2OZSA 1L3SA 4DWIA 4YFUA 4HUEA 3PX4A 1JLFA 3AVBA 3NE6A 4DU1A 3VQ5A 1TKZA 4HTUA 3S3NA 2A1RA 5CZ2A 4DSKA 4KB1A 5FRMA 4JS4A 2G8HA 4FK2A 3HO1A 1VSFA 3M8SA 1NK7A 3VQ7A 4CJ4A 1RBRA 2ATQA 2YNFA 3SNNA 1IG9A 2RN2A 1RTDA 1VSDA 4CJTA 3NF8A 2OZMA 4Z4FA 1S6QA 4FXDA 3M8RA 1WN7A 1FKPA 1BIUA 1NK0A 3NH0A 3ZT2A 1TGOA 4DTSA 1WAJA 2AJQA 3HVRA 1ZBLA 1A5XA 2G8UA 4KV8A 5CYMA 2BE2A 3LP3A 3L2QA 3AO1A 3AVAA 4W5NA 4CF1A 3HM9A 5I42A 3AVGA 4J2DA 3MEDA 2RF2A 3OS0A 3OYHA 4JLHA 4OJRA 2XY7A 4KI4A 1QSLA 4CJ3A 2BANA 1DTQA 3C95A 4AHSA 3ZSOA 1YVUA 2Z1HA 4B8AB 4C8OA 3THVA 1I39A 4CK1A 2WOMA 3EYZA 4B9LA 3OVNA 1RT4A 4M3RA 4DU3A 3V81A 1NKCA 2G8WA 2PYJA 3CFPA 4EZ9A 4FJ5A 1BCOA 1SV5A 1L3TA 4FLXA 4CFCA 4KHYA 3MXJA 4CF8A 1GOAA 1IKXA 1JL2A 1FKOA 3VQ8A 1LW0A 1VSHA 1Y97A 1TKTA 4NCGA 4FLVA 4DS4A 5HROA 3H08A 1QSYA 5HP1A 3O3GA 3ISNC 1WSEA 4I2QA 1N6QA 4H4MA 4DS5A 4DF8A 3SYZA 3OY9A 3P83D 2HB5A 4CEFA 2VG6A 4E19A 4J2AA 3KTQA 3B6PA 4KHUA 1CZBA 1JL1A 5J2MA 4WE1A 4H4OA 3QEXA 1HYSA 3NF6A 1XI1A 3EY1A 2IDOA 2PY5A 1IH7A 4L8RB 2ITGA 4FJLA 3TAGA 2KZMA 1HYVA 4CHOA 4JRQA 1SL0A 3HPOA 3ULDA 1FK9A 1YTUA 2JGUA 4CF2A 1TAQA 3ZCMA 5KTQA 4CJKA 3OYNA 1Z25A 2D0CA 2R7YA 2YHBA 5C42A 4CJRA 1REVA 4GW6A 1JKHA 3KLIA 4AHVA 3DI6A 4CJUA 3KK3A 1UA0A 5J2QA 2KQ2A 4LH4A 3LZJA 3D0PA 1DTTA 2Z1IA 2FBYA 3VQBA 3KLFA 2F8SA 3L3UA 2ETJA 3KIOA 1ASUA 1S1TA 4KI6A 3K2PA 4FJ8A 1QHTA 3L2VA 3ASMA 1HMVA 1TL3A 3ITHA 3HL8A 3BGRA 3D45A 3QESA 3DRSA 2YNGA 3EZ5A 1MU2A 1ZYQA 4B9UA 3S9HA 2Y1JA 4IG3A 3CM6A 4KTZA 3F73A 1BL3A 1RT7A 4ID1A 4CJPA 3DLBA 4DSIA 1TK8A 1KCFA 4BE0A 4E7JA
chains in the Genus database with same CATH superfamily
4FW1A 2CGJA 4OGEA 3B8AX 3L8BA 4BACA 1LWEA 5HRNA 4ZTFA 3HPGA 1SL2A 5BN9A 3G25A 3CC7N 3CYMA 4GV9A 4BDPA 3UKRB 4CEOA 3PX6A 2A40A 4DTUA 1TK5A 1EO1A 3OYDA 3SQ4A 5K14A 4IBNA 5AZIB 3DM2A 3ZT4A 5TKYA 1EX4A 4PQUA 3CCMN 4E7HA 4CEZA 4DV5K 4N47A 2Q31A 2IIRA 3HP6A 1VQKN 3ATUA 4X64K 4CF9A 2QEXN 3D7EO 1RDBA 2OTLN 3K0SA 1QTMA 3THXA 1BDGA 4LFBK 1EKEA 5JLFA 3GOIA 4CZHA 1HLUA 1U4BA 2GWJA 5CZ1A 2D1KA 4Z4EA 5LMUK 3QLHA 4JI6K 1W7AA 1K6YA 4CK2A 1T6DA 5EOYA 4C8LA 1C1CA 2DY4A 1JLQA 2F96A 4HCBA 2HMIA 3VN5A 3U9DA 4ZTJA 2XRIA 4CIFA 1ZBFA 1WAFA 3UKRA 3LP1A 1IBKK 3NF7A 3HTVA 4CHQA 4FM0A 3SUPA 2HSTA 2NRZA 1RT1A 3HT3A 2HW3A 2NRTA 3KWIA 4DKWA 3KWGA 5A2QO 1LWCA 2YKNA 4DV4K 4NCAA 2RHKA 3ZSWA 2XY5A 1WSJA 3PX0A 4ELUA 2O8DB 1VSJA 4K41A 4BE1A 3VEXA 3FR0A 5IWAK 4C8MA 1NOYA 4FK0A 1ZBHA 1TV6A 1RDAA 1HQEA 3WUHA 3KLHA 5JS1A 2KW4A 2Z1GA 1NGAA 1HRHA 3M1FA 3LALA 3PV8A 1RDUA 2IOCA 3WNFA 3A5OC 5JMVA 3NHGA 4JKDA 1HPZA 2HNZA 4KB0A 4YOWA 2Q3SA 4BRPA 1WNSA 4ISEA 3AA4A 2QXFA 2OPRA 4W5TA 4XH4A 4CBUA 3IUCA 2RE2A 4PKIA 4K43A 3K5LA 1S9GA 3AVLA 3CG7A 3GE1A 3CJ1A 1BUPA 4B1WB 5SZTA 4FJ9A 4BRHA 2B6AA 1S1VA 3MEEA 4M45A 1FJGK 4OKEA 1SUQA 5F1XA 3C6UA 3MN6A 5KI6A 2VCPA 3K57A 2KKZA 3KVGA 4BRGA 2O8DA 3VQ6A 3KK1A 3SQ0A 2FSNA 5E26A 3TANA 3AA3A 4UY8O 1RFQA 3BP8A 4K0KK 4F4KA 4JKEA 5EVZA 4W5QA 4IO9L 1L3UA 5JVHL 2OTJN 5IT9O 3CMAN 3WXIA 2QXLA 1GLFO 3UKUB 1NGCA 4GVMA 5J1EA 3P31A 1GLDG 4DV1K 3JXUA 1BG3A 3AAQA 5EXWA 1VSLA 1KSPA 2VQFK 3SUNA 2IVOA 2UXCK 1TUUA 3S41A 3O8MA 1NK5A 2Y1IA 3LDOA 4W5RA 5JLHA 1F21A 3AGKA 3LM9A 4ILJA 4DQIA 4OGCA 4FL9A 1M1KO 1NMNA 4ICLA 1T6CA 1OVQA 1VQMN 3CFOA 4O0IA 5AQJA 5AQLA 4GNIA 4CHZA 3WNEA 3DLRA 2E2OA 3U3YA 3QMLA 4BRKA 4CEDA 3SZ2A 3CC2N 5LY3A 4C23A 4OKJA 1QQMA 1JCGA 1GOCA 3RWUA 4FOEA 3NDKA 2A1SA 4CEBA 4K8XA 3UKUA 4DTMA 3LAMA 4BG8A 4OKKA 1IKVA 4IOXA 3VEOA 3PUFA 2QA4N 1CZ9A 3VQ4A 4M7YA 3MAQA 2HHUA 4PKHA 3AO2A 4H03B 2HBJA 1H1VA 1IKYA 3O1WA 4DU4A 3EO3A 5JS2A 4TSXA 5CHIA 2VGMA 4CFDA 3SMSA 4E3SA 3CJBA 4EP4A 1VQ8N 4YNQA 1QVFM 4DFJA 4CBWA 1B9DA 4MO4A 3V9UA 4AHUA 4YOTA 3LAKA 3ZSVA 3TABA 1U49A 1QHAA 2A41A 2CH5A 4KFBA 3ZSRA 2QWQA 5HRPA 4DV3K 3OYIA 4DTRA 3O9RA 5GIPA 1N34K 4CZFA 4Z4CA 3SAFA 3LDPA 4CD3A 1BHLA 2X6SA 3HVTA 4BWJA 1D9FA 1RT5A 5FPNA 3HK2A 4CJVA 3OA9A 4K8ZA 4PHTX 4BR2A 2UU9K 3N4PA 1J53A 5H1SQ 4BRQA 3DLLL 4IJNA 4FWLA 3C0BA 4FPBA 4JKCA 3VOVA 4KHQA 3FZKA 1LV5A 2HHXA 1FXXA 2Q2RA 4GV6A 3EN9A 1VSEA 3E66A 2A6AA 4C8NA 4JKGA 3SBGA 2E1YA 1NJXA 3T7ZA 2HHQA 1UOCA 1IG8A 3G71N 4A5BA 1XMQK 3L6QA 4O55A 5AQRA 5HBMA 3RMBA 3K9KA 3KK7A 3R9PA 3RRHA 3MCAB 1GLCG 3CCQN 1BOTO 4M3WA 4AM6A 2XY6A 4Y1DA 3QIOA 3LPTA 5AQVA 1ZBSA 1D9DA 1RDCA 3IG1A 4CBXA 4CJSA 3M5RA 1A5WA 4KTWA 4MLHA 3OYFA 4O8KA 2P9UB 1RT2A 2OZSA 4YFUA 4YHHK 1JLFA 2QWPA 3NE6A 4DU1A 3VQ5A 3GBTA 5CZ2A 5C10A 4JAXA 3IDHA 3VQ7A 3SNNA 1YJNN 2RN2A 2F7TA 3O9TA 1RTDA 3NF8A 2HBMA 1MA9B 4L3QA 1WN7A 3ZT2A 1TGOA 4JI0K 4DTSA 4YDUA 1ZBLA 1A5XA 3LP3A 4JHDA 4B9QA 3R3LA 1IJJA 3W0LA 4JEPA 2VQEK 4J2DA 3CJCA 2RF2A 4JLHA 4BRLA 1QSLA 2BANA 1NGIA 3ZSOA 4A5AA 4C8OA 1I39A 5BPLA 3EYZA 2Q1NA 1RT4A 1NKCA 2PYJA 3A5LC 3VEYA 1GOAA 4F9OA 4LF4K 1WOQA 2E88A 5FPMA 1TKTA 4NCGA 4FLVA 5AQMA 1YHQN 1QSYA 3C6HA 2P9UA 3ISNC 1WSEA 3SYZA 2E8AA 3AY9A 3MWPA 2HB5A 4J2AA 4C1NI 3P39A 3VF6A 4H4OA 3QEXA 4BRNA 3CCEN 3EE8A 2IDOA 2PY5A 2ITGA 3ENHA 3T69A 4FWRA 1SL0A 3HPOA 2JGUA 4PL8A 1JCFA 3O4WA 4B1YB 4CJKA 3OYNA 1Z25A 2R7YA 3O9SA 1JKHA 1S22A 4XH5A 4IJAA 3ZEUB 4LH4A 4EIAA 2Z1IA 3KLFA 4EAHD 5FPEA 2ETJA 1MWMA 3KIOA 1S1TA 4BR4A 5GAHP 3K2PA 1LCUA 1HMVA 3ITHA 4LF5K 3DRSA 3EZ5A 1ZYQA 3S9HA 4IG3A 4WQ4C 4KTZA 5CR4A 3OHRA 4DFMA 3KD5E 2HNDA 4G9ZA 3FE1A 2W40A 3RRGA 4QAGA 4IWVA 3OTOK 3PIPL 3G6EN 4E7LA 3SQ1A 3CMEN 4B1XB 1EXQA 1NK4A 3I55N 1EETA 1HKCA 1D5AA 1W9HA 4J2BA 1S9EA 2G8VA 4FZZA 4BG9A 2EX3A 2P9PB 1UWBA 2NRWA 4I2PA 4W5OA 2YI1A 4MDBA 1OH8A 5MLCQ 2ZD1A 5KRTA 4KPYA 4H0OA 2WFBA 5KGWA 3TTDA 3HP9A 4WQ5C 1X1PA 1L5UA 4G1QA 1J5OA 3ZEUA 5DM7L 3RMCA 2WBNA 4RW7A 1KC8O 4DFKA 3KKRA 5AQFA 1O1WA 4CVNE 4R5PA 2HHSA 3KK2A 4IFVA 2GBZA 3A2FA 2Q0UA 3O4NA 1U04A 4AILC 3L0QA 3VERA 1T7PA 4OO1J 1YT3A 1LAVA 3SAHA 1K73O 5ELZA 1YI2N 3AVKA 1QVGM 4ISFA 4KHWA 1LWFA 4DR1K 4FJIA 3LP2A 3LDSA 3T1HK 3VPZA 2UXBK 1OH7A 2P9LA 5ADXA 3NH2A 4DFPA 3SUQA 3SV4A 1G99A 4FJJA 2AP1A 1T05A 1Q7YO 2Z1JA 2FBXA 3FZMA 3RSEB 4CESA 3N4QA 3A8YA 3LPUA 3OYCA 3AVNA 1UA1A 3SCXA 1YAGA 5EY4A 1C0GA 4HTLA 5BRDA 1NG9A 3ZX0A 4Y0WA 3R8EA 5HLFA 4OX9K 1C0UA 4FCYA 4B3MK 4CGIA 4CFBA 4EHUA 2GUIA 4DUZK 1KVAA 2X78A 2JWKA 4CK3A 4MLEA 4FW2A 4LFCK 1HQUA 3ATVA 4NO7A 3VETA 4KAZA 3VEWA 5LL6Z 1J54A 1KFSA 4FJ7A 1VQNN 2G8IA 3VEVA 1JLEA 2P1JA 3QO9A 4FWKA 3TSPA 4NXNK 3VQEA 2O8CB 2UUAK 4NLCA 1BQNA 1XQSC 3OYBA 1L3VA 2FSKA 3NBPA 3V6DA 2YJEA 4HHTA 3AVIA 3O1BA 1ATNA 1CXUA 4JS5A 5JICA 1KQSM 5M1QA 4UQGA 4FLZA 3JS6A 4H5WA 1CZAN 1IV0A 1HNIA 2DFEA 4PKGA 3SUOA 4IZ9A 4CZKA 4DQRA 4N76A 3THYB 4XEIA 1VQLN 2FF6A 1NJYA 3T3FA 4JKAA 3C6AA 4KO0A 4E1MA 4KHNA 1EQYA 2KFNA 3RR7A 3VEZA 3F2KA 3OBYA 3FLCO 1TYQA 1GOBA 3MECA 3QERA 2E20A 3AARA 4PY5A 1KVCA 1T3VA 5AQYA 1X9SA 1W0HA 4RCHA 4Z4IA 3QBXA 1T44A 2ITMA 2E6MA 1K9MO 4IO8A 4F2SA 4AHRA 4F3OA 4DB3A 3P38A 1VRTA 5CE3A 5AZIA 2D5RA 2QW9A 4OPJA 4QCLA 1U6ZA 3THYA 4CEEA 3DOLA 3AVFA 4KHSA 3QETA 4CZGA 1A5VA 1Z6RA 3S3OA 2F8TA 3TAPA 1XHXA 2ZF5O 3CXCM 3K59A 4B9SA 1HJOA 5AQQA 4RW6A 3CERA 1T8EA 4BE2A 4B8CA 3DYAA 3MMVA 3ZSZA 3AO3A 2D0BA 2WUSA 3MXIA 1TKXA 1QZ5A 4B3SK 3U3GA 1X9MA 4BR0A 3VQ9A 2ZQBA 3VQAA 3MN7A 1WBDA 1NLVA 2GTDA 3O08A 1KLNA 3SMPA 2HBLA 4FYDA 3D6RA 2DPNA 2LSNA 4LSNA 4BRCA 1C1AA 3AVCA 4FVMA 2F9WA 1D4XA 2X74A 2P5OA 4DR4K 3ZT1A 4IEIA 4H5NA 2FBVA 1U2VB 3WNHA 2YCHA 3QEVA 3L3VA 4OPAA 4FO0A 1S6PA 1XWLA 3L2UA 4HCCA 2E6LA 1X3MA 3EKSA 3IAYA 2D0AA 4N41A 2V7YA 3LL3A 3IFRA 4GVEA 4CJ7A 2QWNA 2E2QA 1B92A 4IOCL 3LDNA 2ZJRL 2P9SB 3AV9A 1VK0A 3OS2A 3TAEA 4F8RA 3QNOA 2A42A 1LAWA 3QEIA 2ASOA 4DQPA 1NGBA 2HVIA 4YORA 3SV3A 3BZCA 4LY7A 3F5TA 1WSHA 4XH1A 4CECA 4DQQA 3E9LA 3O4QA 5LJVA 1V4TA 3WEEB 4CEAA 1KAXA 2OANA 1KRPA 1U2VA 1RTHA 1Z26A 4E7IA 3NF9A 3WXKA 4JI2K 2EHGA 2GELA 1I94K 4J8FA 2G8FA 3ULEB 1B9FA 1RBSA 4H0TB 4PL7A 3LWLA 3J7ZO 4KBOA 2HHVA 3AVJA 3JAMO 4HWIA 4CGHA 4Q0BA 3E9OA 4DWIA 5C0YA 3AVBA 4BROA 1TKZA 4MDAA 4JS4A 3HO1A 3M8SA 4CJ4A 1RBRA 4LF6K 2OZMA 2YHXA 1NWKA 1BU6O 3NH0A 5AQIA 1WAJA 2AJQA 3P4IA 4KV8A 5CYMA 2NRXA 3A5NC 3L2QA 3AVAA 4W5NA 3BF3A 3MEDA 2UXDK 3C7NB 4LF8K 3OS0A 3ZETB 3C95A 1XUPO 1YVUA 2Z1HA 4B8AB 3THVA 4I6MB 2NRVA 3O80A 3OVNA 3V81A 2YHYA 2D0OA 2CGKA 1BCOA 1HKBA 5HOOA 3QFPA 5C15A 3ZLJA 1VQ9N 1J6ZA 1QZ6A 3G4SN 4I2QA 3CI5A 4H4MA 1WB9A 2O8EB 2VG6A 2FF3B 3H6EA 1O13A 1CZBA 1JL1A 2AA4A 2VGNA 3NF6A 1XI1A 4L8RB 2PBDA 1HYVA 4CHOA 1WUAA 4JRQA 4H0YB 3EEQA 1YTUA 2E2NA 5KTQA 3C65A 3QB0A 2YHBA 3RVCA 4RTFD 1REVA 4GW6A 3LDQA 3MDQA 3VTHA 3HOSA 5AJ3K 1DTTA 2H3GX 1EWQA 1ASUA 1OVYA 4JN4A 3O9UA 4H5TA 3W3DA 3U9ZA 1W97L 3HL8A 3D45A 3Q7BA 4B3TK 5AQZA 1Q18A 4JI8K 4YOVA 3MEGA 5FROA 1XC9A 3AA2A 4XIUA 3OBWA 3NGIA 4DSJA 2HF4A 3VF4A 4GKJK 3SQ2A 3DLGA 4B9NA 3C94A 5E84A 4CEQA 3AO5A 4ELTA 3SJJA 5AZJB 2DTUA 2RKIA 2HHTA 1RBVA 5DM6L 3TWHA 4FLTA 1VQ5N 4DHYA 3MCPA 2G8KA 1P8ZA 1Y64A 2Q97A 1LW2A 3OYAA 4ILGB 2W6KA 2PFUA 2B5JA 3AVMA 4JRPA 1JLAA 5FLXO 3ZYYX 3V9XA 2P5GA 5J2PA 1YJ9N 3CQYA 2IS3A 4KH5A 3H3NO 1K8KB 2NRHA 3T1AA 5KQ8A 2BH1A 1YF5L 3V1RA 5BPNA 1RBTA 1HKGA 1CXQA 4DTPA 4BWMA 1WSGA 1NM1A 4KH4A 2DFFA 3TTFA 3VENA 4CZMA 4B1VA 4FXDA 5ADXH 4DSEA 5EX5A 2GWKA 4NB4A 4BQZA 1VSMA 4F2RA 1R59O 3M8QA 3OYGA 1GLJO 5CYQA 5AZJA 3O9QA 3HZ6A 3HM8A 3PIOL 2YKMA 3VQPA 4DG1A 4B3OA 2HHWA 3J8AA 3CIPA 4BRMA 3E01A 3QICA 2FXUA 4DR6K 1GLBG 4Y1CA 3ZSYA 5AQPA 3ZSXA 1K8AO 3RR8A 3VA3A 3TAQA 2BGGA 4KHPK 4DQ8A 2QI2A 4CGGA 3DXMB 1JLGA 3DRRA 4EHTA 1Q8IA 1MDUB 1SZ2A 3WQUA 5B8HA 4BREA 2GUPA 2GV9A 4LF7K 4FWPA 4CE9A 1RGIA 1N32K 5FRNA 2KLAA 4KH6A 2F9TA 2ASPA 4MQ3A 1EP4A 1BIZA 1BGXT 4AQYK 1UAXA 1Z05A 2XO7A 4ISGA 3F9KA 4FK4A 5AFUA 3THWB 3KLGA 1T03A 3K9JA 5GAEP 3J81O 2D0PA 5M1PA 4DLEA 3C6TA 1DLOA 2NNWA 3WXJA 2NZTA 2A3ZA 3SBTA 2P9IB 3P5JA 2VWJA 4JI4K 3G0ZA 4RWTA 4DR5K 3NFAA 4FJHA 2JWLA 1ZBIA 4Z4GA 3I56N 3DXMA 4EFHA 2W42A 3J7AP 4AF1A 3NVKA 1DKGD 5FDLA 2F4VK 3O6WA 5BRFA 3V9ZA 4C8KA 1RDDA 4B1UB 3LM2A 3L2WA 4Z0UA 5BRHA 4IDKA 2V52B 3HJFA 1GLAG 1QQOA 3EKUA 1RT3A 1Q86O 3KLEA 4OLBA 1TKDA 1TUYA 3DXKB 2HF3A 3QINA 4FM2A 1JJ2M 3CD6N 4CERA 4FVUA 3THWA 3OYJA 3AGRA 5GINA 3AO4A 4FJGA 1WSFA 1C6VA 4FLUA 1ZBUA 2FBTA 3BY5A 4E1NA 2O8BB 4FWMA 4DSLA 2ZM6K 3TU5A 2IVNA 4BDYA 2P9IA 2XHBA 4DTXA 2QKKA 1IO2A 2P9PA 2P9KB 3ENBA 1RT6A 3UE5A 3L2RA 3JSMA 3VA0A 3TR8A 4DCHA 3MX2A 1KAYA 4Z4HA 5F0XA 2Q36A 2ZE2A 4DV7K 4DR7K 4BRAA 3CCJN 3HPHA 4OPKA 4JYAK 3KHYA 4DV0K 1FW6A 4RW8A 2YNIA 1BO5O 1NKEA 4CJWA 5JVGL 1HNVA 3ENOA 4O5BA 5I3UA 4CFAA 3QNNA 1E4FT 1JCEA 4H0XB 1SKWA 1ESVA 1N5YA 3DLHA 1NKBA 2XY8A 2KHOA 2QM1A 4M3ZA 1BISA 4K42A 3DJCA 4NYNA 3ID6A 2X6NA 1S3XA 4H5VA 2O4GA 3F9MA 2VWKA 4KKOA 2P9KA 3LDLA 3CCUN 1ZXOA 1YVNA 3QIPA 4M3YA 1KVBA 4PUOA 3PSFA 4E89A 2OCEA 1QS4A 3VQQA 1C0FA 2RPIA 3AA5X 5M1NA 3SI6A 4AHTA 2A5XA 3HOTA 3FZLA 2ZJQL 2OPQA 4DTOA 1NBWA 3RSEA 3MX5A 4LD0A 1YTAA 3SPYA 1LOTB 3VQDA 3RMDA 4LC9B 1RBUA 3SAGA 5BR9A 2QWRA 4YOYA 3NCIA 2E5LK 3UIQA 2I7PA 5D3GA 4HVJA 2PAVA 4IDHA 3WXLA 2KTQA 2B4JA 3V9WA 4DV2K 4HUFA 5HL7L 4FZYA 4N5SA 3LP0A 3LANA 3I8BA 3CFRA 2HVHA 1KFDA 4OLAA 3OS1A 4O8UA 4KREA 3DMJA 1N36K 5KGXA 3V4IA 5CY4A 3H45C 4JI5K 3CQXA 5LMNK 4BDZA 4E0DA 4EZ6A 1BA0A 4M3TA 1DGKN 1S1UA 5AQHA 3O3HA 1VRUA 2WC9A 3TI0A 5AQKA 4QOZB 2O8CA 4EP5A 4A2BA 4DF4A 4KRFA 3HXMA 3K5MA 1EWRA 2QWOA 1L3SA 4HUEA 4FWQA 4HTUA 2A1RA 3QDKA 3L4QA 2ATQA 1IG9A 4FSVA 5AQUA 1VQON 4CJTA 1S6QA 3M8RA 1FKPA 1BIUA 1VQPN 5AQXA 3HVRA 4BC2A 4IFEA 3EL2A 2BE2A 1E3MA 4CF1A 3HM9A 4WFNL 5I42A 4QS7A 1NGEA 3OYHA 4OJRA 4KI4A 3BF1A 1DTQA 4AHSA 4WCEL 4BR9A 3VMFB 4CK1A 1DEJA 3TSUA 5BR8K 4B9LA 4M3RA 3FZFA 4DU3A 3CFPA 4EZ9A 3CCSN 1S72N 4CF8A 1YUWA 1IKXA 1JL2A 4AM7A 1KD1O 1LW0A 1Y97A 1ILYA 5M1FA 2HHHK 4O5FA 3TSQA 1N6QA 1Q81O 3CJ7A 3P83D 4KHUA 3KTQA 3B6PA 1SAZA 5J2MA 4WE1A 1HYSA 3M3ZA 3OW2M 4FJLA 4YOUA 3ULDA 1FK9A 3ZCMA 5BREA 5C42A 4CJRA 3KLIA 4AHVA 3MWTA 4CJUA 3KK3A 5J2QA 3TPQA 3LZJA 3D0PA 1ZC6A 4WFBL 3L3UA 5GIOA 4KI6A 2J4RA 4CD1A 4JI1K 2ASMA 1HNZK 1TL3A 5KPTA 5TKWA 3VESA 2YNGA 4DR3K 4IOAL 3A5MC 1BL3A 1RT7A 4CI6A 3DLBA 4DSIA 1TK8A 5BN8A 3OYEA 1S1XA 4BVPA 3WT0A 3CCRN 4H0VB 1HJRA 4CGJA 2OA8A 1SKSA 4OPHA 1KLMA 4MFBA 3IS9A 1NK9A 4NCBA 4J2EA 3UB5A 5LJWA 4H5RA 3CM5A 3BDPA 3KJVA 1J9AA 1QQNA 3D2EB 3GL1A 4CJQA 1GLLO 2UUCK 1HYZA 1Q9XA 1RILA 2HNYA 4FLYA 4M3XA 2NRRA 1C0TA 1KTQA 3HYFA 3NVMA 3GDQA 3RMAA 3HBTA 1TVRA 1VSIA 3QBWA 3NMUA 4CZEA 4FJXA 2P9SA 4FM1A 3T19A 3SPZA 5C25A 3S3MA 1IKWA 1RTIA 1HNXK 4DMNA 1VSKA 2OPPA 2NUBA 3ZX3A 4HUGA 3CHWA 3QEWA 3EZWA 4LFAK 1QQCA 3WEEA 4Z94A 3RTVA 1NJZA 1QSSA 4CIGA 4FZXC 1HNWK 4FOIA 2BDPA 4CZJA 4FJKA 2YX6A 3FFIA 4FPAA 4E7KA 2DFHA 4PWDA 1NGDA 2I7NA 4A59A 3VGLA 2UYTA 5DMRA 4GY2B 5KRSA 3ULEA 4B08A 4U67L 3D2EA 1SS6A 3I0RA 4BRDA 2FC0A 4NXMK 3CF5L 2YV0X 4ID5A 3DRPA 4X62K 5AQNA 4F3TA 2ZWHA 4ILHA 3ZT0A 3IMXA 2FSJA 2WONA 4I9LA 2IGIA 5C2FA 2YNHA 1QE1A 3CCLN 2ZGZA 4JD2B 5M1KA 4DLGA 1RTJA 5KQDA 2P9NB 1JXBA 1Q9YA 1VAZA 5HRRA 4CHYA 4KTQA 3OJSA 1VQ6N 4JKGB 4M7XA 2W6LA 1TK0A 5AFUH 3NGZA 3H1QA 3ZSQA 4LF9K 1RNHA 3M8PA 1I3AA 1XC3A 4A57A 3SLCA 2OPSA 4M63C 3TAMA 1W2BM 3PY8A 2VG7A 3C7NA 3MXMA 1X9WA 4JI3K 2UUBK 3LZIA 3ZETA 3PO5A 1E4GT 3O3FA 2OYQA 4CHNA 2KFZA 5AQGA 3CQ8A 4I6MA 1JLCA 4CJEA 5GAGP 4CGFA 3FGUA 4N56A 1HUXA 3HI0A 3V1QA 1BWFO 4WQ4A 1DT9A 1YXQA 3FZHA 3P1GA 4DTJA 3KD1E 2KZZA 1V4SA 3CPWM 1XMOK 4CJLA 4M3UA 4IKFA 2O8EA 4YY3K 4JD2A 4I9QA 1HPMA 4JK7A 2YHWA 2E2PA 2P9NA 2VG5A 1YJWN 1SQKA 4A2AA 4FLWA 1C1BA 4CF0A 3K5OA 3CJAA 4O4GA 3HRGA 3DLEA 4M42A 5DK5A 3KZBA 4LSLA 1NGGA 3K5NA 3VTIA 3PO4A 4WQ5A 4NLBA 4BVOA 3ALYA 1NK8A 5AR0A 4JI7K 4JHDB 4CJ5A 4BC3A 4M41A 4GV3A 4RG8A 4MO5A 4A61A 3DOKA 5F2RA 1JXEA 1XNQK 4QS9A 4ZHRA 3R6MA 4I7FA 5HRSA 2GEMA 3SK3A 3CETA 3NH1A 4DR2K 4BRIA 4RW4A 3PSIA 4FJNA 4RW9A 5C2DA 3EE9A 1ASWA 3QEPA 1TAUA 4NYFA 4JNEA 3D2FB 3G10A 3MK6A 3LWMA 3AVHA 5KPRA 2CGLA 4PA1A 4BR7A 1BCMA 3TAFA 1D8YA 2ZJPL 1JLBA 4CGDA 1WLJA 4AH9A 1GLEG 1CLQA 1ATSA 4BQLA 5E41A 1XHZA 3H3OB 2PYLA 3WNGA 1NOZA 4DUYK 3JYTA 3I33A 2BTFA 3E1YA 3V1OA 1U48A 1NMDA 2PZSA 2HMPA 1KXPA 4YOXA 4B9VA 2I5JA 1VHXA 1X9JA 1OH6A 3IRXA 1SL1A 3V9SA 3CPEA 3VQCA 5BPMA 1NGHA 1NK6A 2HBKA 2EWSA 2YJFA 5GADP 5C24A 3OYLA 4IG0A 4CHPA 4OVLA 4LH5A 3SJHA 3CC4N 2IVPA 3IKMA 1K8KA 4AHCA 2IC3A 2ZGYA 4K25A 3TARA 1P90A 1NJWA 1ATRA 4CZLA 3ZX2A 2E4LA 5T7BA 1ITGA 3D2FA 3O5BA 2QKBA 4JKHA 3A0IX 4CCHA 3KKSA 3J80O 4DQSA 3VF2A 5EU7A 1XNRK 1U47A 4DV6K 4ELVA 3K58A 2IAJA 4FWNA 1SKRA 1X3NA 3WXMB 3OJUA 4O0JA 1YITN 4IFYA 1ASVA 1WSIA 4CIEA 4GMJB 1S5JA 1BI4B 4FWOA 4DTNA 4JV5K 4O44A 1MWKA 3U6FA 4B9TA 1KAZA 4BC5A 3L4IA 3NGYA 2W41A 3ZT3A 4BR5A 4H0PA 3OYKA 2D4WA 3B6OA 2HOEA 1NNEA 1M90O 1RCHA 3U4LA 1C0MA 2NLXA 4Q5VA 1VQ4N 4B9MA 1BQMA 3U8XA 2QK9A 3I0SA 1TL1A 4H8KA 3ID8A 5SWMA 4BRFA 3I8DA 2P51A 1YIJN 3VGMA 5J2NA 3BEXA 4FJMA 2JLEA 4U7BA 3HSTB 1VQ7N 1N33K 4DSFA 5KPZA 3FFKB 2WTUA 1S1WA 3QFUA 4CJFA 3J7YP 3OYMA 4JK9A 4X65K 3DLKA 2QWLA 2O4IA 4IXCA 1R0AA 4CW7B 3BZKA 1Q82O 1G15A 1RDWX 2V7ZA 2YHAA 1NU0A 4R79A 1BI4A 1U45A 4V19S 3NAEA 2O8FB 2P9LB 4A62A 3PX4A 5AQWA 2GX9A 3S3NA 4KB1A 4DSKA 2VYPA 2E1ZA 2QTDA 5FRMA 4FK2A 2G8HA 1VSFA 1NK7A 3Q7CA 2YNFA 1VSDA 4Z4FA 5AQSA 3GG4A 3TTCA 3T1YK 1NK0A 4X66K 5AQOA 1IBMK 3HSCA 2G8UA 4YDUC 1OH5A 1BA1A 4FWSA 3DAWA 3AO1A 2Q0RA 3VGKA 5M1OA 3AVGA 1J5EK 3MN9A 2XY7A 4CJ3A 4JK8A 4JKBA 3MN5A 3DXKA 1HX1A 3PLAA 3H1VX 2WOMA 5AQTA 2CH6A 5FPDA 2QWMA 2G8WA 4FJ5A 1SV5A 1L3TA 4FLXA 4CFCA 4C1NK 3MXJA 4KHYA 1FKOA 4WFAL 3VQ8A 4B3RK 1VSHA 3H46O 2O8FA 4DS4A 5C12A 3H08A 5HROA 5HP1A 4E1JA 3O3GA 2O8BA 4DS5A 4DF8A 3OY9A 4E19A 4WYBA 3BUZB 1OKJA 1NGFA 4B1ZA 4CEFA 1NGJA 4CZIA 3E9PA 4BGAA 3WQTA 4IEEA 2V51B 1NJIO 1HR0K 4BY9C 3EY1A 2KZMA 1IH7A 4JKFA 1WBBA 3TAGA 2FLOA 1IBLK 3CJ9A 4CF2A 1TAQA 2BUPA 3CCVN 3AAPA 2D0CA 3R1XA 2VWBA 3DI6A 1UA0A 2KQ2A 4BC4A 4BGBA 2FBYA 3VQBA 2F8SA 1N8RO 4GKKK 3THXB 4FJ8A 1QHTA 3L2VA 3ASMA 3BGRA 5I9EB 4QS8A 1TYQB 3QESA 1MU2A 3M6GA 4B9UA 4WF9L 2Y1JA 3CM6A 3F73A 4CJPA 4ID1A 1KCFA 4BE0A 4E7JA 3DWLA
chains in the Genus database with same CATH topology
4FW1A 3MEGA 4OGEA 4DFMA 3OYEA 5FROA 1S1XA 1XC9A 3KD5E 2HNDA 3AA2A 4XIUA 3L8BA 3RRGA 4BACA 1LWEA 5HRNA 4ZTFA 4QAGA 3NGIA 4E7LA 3SQ1A 4DSJA 3HPGA 1HJRA 4CGJA 1EXQA 1SL2A 1NK4A 2OA8A 1EETA 1SKSA 1W9HA 1D5AA 3CYMA 4J2BA 1S9EA 1KLMA 4MFBA 2G8VA 4BDPA 3IS9A 1NK9A 4CEOA 3DLGA 3SQ2A 2EX3A 3C94A 4B9NA 3PX6A 4J2EA 4CEQA 4NCBA 4DTUA 1TK5A 3OYDA 3AO5A 1UWBA 3SQ4A 5K14A 4I2PA 4ELTA 4IBNA 4W5OA 3SJJA 3CM5A 3DM2A 3BDPA 3ZT4A 3KJVA 1EX4A 1J9AA 4CJQA 2DTUA 4PQUA 2RKIA 2HHTA 2ZD1A 5KRTA 1RBVA 4CEZA 4E7HA 4KPYA 4N47A 3TWHA 5KGWA 4FLTA 3HP9A 3HP6A 1HYZA 1Q9XA 1RILA 2HNYA 4FLYA 2G8KA 1X1PA 1L5UA 4G1QA 1J5OA 4M3XA 1LW2A 3OYAA 1C0TA 1KTQA 3HYFA 3RMAA 4CF9A 3RMCA 1TVRA 1VSIA 2B5JA 3AVMA 4RW7A 1RDBA 4DFKA 4FJXA 4JRPA 1QTMA 1JLAA 1EKEA 3KKRA 3V9XA 4FM1A 3T19A 2P5GA 3SPZA 1O1WA 5J2PA 4R5PA 2HHSA 5C25A 3KK2A 3S3MA 1U4BA 5CZ1A 4Z4EA 2IS3A 1IKWA 1RTIA 4IFVA 3QLHA 4DMNA 3T1AA 1VSKA 1K6YA 2GBZA 4CK2A 2OPPA 3A2FA 2NUBA 3O4NA 1U04A 3V1RA 1RBTA 4C8LA 1C1CA 4HUGA 1JLQA 2DY4A 2F96A 4HCBA 1CXQA 4DTPA 2HMIA 4AILC 3QEWA 3VN5A 1QQCA 4BWMA 1WSGA 4ZTJA 2XRIA 2DFFA 4CIFA 3RTVA 1NJZA 1QSSA 1ZBFA 4CIGA 4FZXC 1WAFA 4DSEA 3LP1A 1T7PA 1YT3A 2BDPA 3NF7A 4E7KA 3FFIA 1LAVA 4FJKA 2DFHA 4CHQA 4FM0A 1VSMA 3SUPA 4PWDA 4F2RA 3M8QA 3OYGA 1RT1A 5DMRA 3HT3A 5CYQA 5KRSA 3AVKA 4B08A 2HW3A 4KHWA 1LWFA 2YKMA 3VQPA 3I0RA 1LWCA 4FJIA 2YKNA 3LP2A 4DG1A 3LDSA 2FC0A 3ZSWA 4NCAA 4B3OA 2XY5A 2HHWA 2YV0X 1WSJA 4ID5A 3PX0A 3DRPA 4ELUA 1VSJA 4F3TA 4BE1A 4C8MA 1NOYA 4FK0A 1ZBHA 3NH2A 1TV6A 1RDAA 3E01A 3ZT0A 1HQEA 4I9LA 2WONA 2IGIA 4DFPA 3SUQA 4Y1CA 3KLHA 5JS1A 2KW4A 2Z1GA 1QE1A 1HRHA 2YNHA 3ZSYA 3SV4A 4FJJA 4DLGA 1T05A 1RTJA 2FBXA 2Z1JA 3LALA 4CESA 3ZSXA 3PV8A 3WNFA 2IOCA 3RR8A 3VA3A 3TAQA 2BGGA 1JXBA 3LPUA 3NHGA 3OYCA 1Q9YA 3AVNA 1HPZA 2HNZA 4CGGA 1UA1A 5HRRA 4CHYA 4KB0A 2Q3SA 4KTQA 3SCXA 3OJSA 1JLGA 1WNSA 3DRRA 1TK0A 3NGZA 3AA4A 1Q8IA 3ZSQA 2QXFA 1RNHA 2OPRA 3M8PA 1I3AA 4W5TA 5HLFA 1C0UA 2GV9A 4FCYA 2OPSA 4CGIA 1L3VA 4CFBA 3TAMA 2GUIA 1KVAA 2X78A 4CE9A 3PY8A 3K5LA 1S9GA 4CK3A 2VG7A 4FW2A 3AVLA 3MXMA 3CG7A 1X9WA 1HQUA 3LZIA 5FRNA 5SZTA 3PO5A 4FJ9A 4KAZA 3O3FA 2OYQA 4MQ3A 1EP4A 4CHNA 2KFZA 3CQ8A 1BIZA 1JLCA 2B6AA 1BGXT 1J54A 1S1VA 3MEEA 4M45A 4CGFA 1UAXA 4CJEA 4OKEA 4N56A 1KFSA 2XO7A 4FJ7A 2G8IA 3F9KA 1SUQA 3V1QA 4FK4A 3C6UA 3KLGA 1JLEA 5KI6A 2P1JA 1T03A 3QO9A 3VQEA 3K57A 1BQNA 3VQ6A 3OYBA 3KK1A 3P1GA 4DLEA 3SQ0A 3C6TA 3AA3A 4DTJA 3TANA 1DLOA 3NBPA 3KD1E 4F4KA 2KZZA 3V6DA 4W5QA 1L3UA 4HHTA 4CJLA 4M3UA 3AVIA 4IKFA 1CXUA 4JS5A 4I9QA 3P5JA 4UQGA 2VWJA 4FLZA 3G0ZA 4GVMA 5J1EA 1HNIA 2DFEA 3NFAA 2VG5A 4FJHA 1ZBIA 1VSLA 3SUOA 4FLWA 1KSPA 1C1BA 4Z4GA 4QOZB 4CF0A 3SUNA 3K5OA 4DQRA 4N76A 2W42A 4O4GA 3DLEA 5FDLA 5DK5A 4LSLA 4M42A 1NK5A 3K5NA 2Y1IA 3PO4A 3ALYA 4W5RA 1NK8A 3V9ZA 4C8KA 1RDDA 1NJYA 1F21A 3T3FA 3L2WA 4DQIA 4OGCA 4Z0UA 4CJ5A 4M41A 4IDKA 4KO0A 4E1MA 4KHNA 3HJFA 4RG8A 2KFNA 3RR7A 4ICLA 3DOKA 1RT3A 3KLEA 4OLBA 1TKDA 1JXEA 4ZHRA 3CFOA 4I7FA 3QINA 5HRSA 4O0IA 4FM2A 1GOBA 3MECA 3WNEA 4CHZA 3DLRA 3NH1A 4CERA 3QERA 3U3YA 3OYJA 4RW4A 4FJNA 4CEDA 4RW9A 3SZ2A 1ASWA 3QEPA 1TAUA 4PY5A 3AO4A 1KVCA 4NYFA 4FJGA 4OKJA 1WSFA 1C6VA 3G10A 4FLUA 3LWMA 1ZBUA 2FBTA 1X9SA 1GOCA 4E1NA 1W0HA 3RWUA 4DSLA 3AVHA 3NDKA 4Z4IA 4PA1A 2A1SA 4BDYA 4DTXA 2XHBA 2QKKA 4CEBA 4K8XA 1IO2A 1BCMA 3TAFA 1D8YA 2E6MA 4DTMA 4F2SA 3LAMA 1JLBA 4AHRA 4F3OA 4OKKA 4CGDA 1WLJA 1RT6A 4AH9A 1CLQA 1VRTA 1IKVA 3L2RA 2D5RA 5E41A 3JSMA 3VA0A 4OPJA 1XHZA 3TR8A 3PUFA 1CZ9A 2PYLA 3VQ4A 4QCLA 4CEEA 3DOLA 3AVFA 1NOZA 3WNGA 4Z4HA 4KHSA 3JYTA 2ZE2A 3QETA 3MAQA 1A5VA 2HHUA 3HPHA 4OPKA 3AO2A 3S3OA 2F8TA 3V1OA 3TAPA 1XHXA 1U48A 2PZSA 1IKYA 3K59A 4DU4A 4B9SA 4B9VA 2I5JA 4RW8A 3IRXA 4RW6A 1T8EA 5JS2A 4B8CA 4BE2A 4TSXA 1SL1A 3DYAA 3ZSZA 2YNIA 3AO3A 2D0BA 4CFDA 3V9SA 3MXIA 3VQCA 4E3SA 1TKXA 4CJWA 1NKEA 1NK6A 4EP4A 1HNVA 3U3GA 4YNQA 1X9MA 4O5BA 5C24A 3VQ9A 5I3UA 2ZQBA 3VQAA 4IG0A 4CFAA 4OVLA 4LH5A 4CHPA 3OYLA 3QNNA 1KLNA 4AHCA 1SKWA 4DFJA 2IC3A 1N5YA 3DLHA 1NKBA 2XY8A 3TARA 1NJWA 4FYDA 1B9DA 2E4LA 2LSNA 5T7BA 3V9UA 4AHUA 1ITGA 3LAKA 1BISA 4LSNA 4M3ZA 1C1AA 3ZSVA 2QKBA 3TABA 3AVCA 4FVMA 1U49A 4CCHA 4NYNA 3KKSA 2X74A 2P5OA 2X6NA 4KFBA 3ZSRA 3ZT1A 5HRPA 2O4GA 3OYIA 4DTRA 2FBVA 3WNHA 4DQSA 3QEVA 2VWKA 3L3VA 4KKOA 4Z4CA 5EU7A 1BHLA 2X6SA 1U47A 4ELVA 3QIPA 3HVTA 4M3YA 1S6PA 1XWLA 4BWJA 2IAJA 1KVBA 3L2UA 2E6LA 3K58A 1D9FA 4HCCA 1RT5A 4PUOA 1SKRA 3HK2A 4E89A 3OJUA 4O0JA 4CJVA 3IAYA 1QS4A 3VQQA 2RPIA 2D0AA 4IFYA 3AA5X 1ASVA 1WSIA 4K8ZA 4CIEA 3SI6A 4GMJB 1J53A 4N41A 4AHTA 1S5JA 1BI4B 4DTNA 4O44A 1B92A 3U6FA 4B9TA 3NGYA 3ZT3A 3AV9A 2OPQA 1VK0A 3OYKA 3OS2A 4DTOA 3B6OA 1LV5A 3TAEA 4KHQA 2HHXA 1FXXA 4F8RA 1RCHA 4LD0A 3QNOA 1YTAA 1VSEA 1C0MA 1LAWA 3SPYA 3VQDA 3RMDA 3QEIA 1RBUA 4Q5VA 4FZZA 4B9MA 4DQPA 1BQMA 4C8NA 3NCIA 2QK9A 3UIQA 3I0SA 1TL1A 2HVIA 5D3GA 4HVJA 4H8KA 3SV3A 4LY7A 2KTQA 1WSHA 2B4JA 5SWMA 4CECA 4DQQA 3V9WA 3I8DA 2P51A 3O4QA 4HUFA 4CEAA 1NJXA 4FZYA 5J2NA 2HHQA 4FJMA 1UOCA 2JLEA 3HSTB 4N5SA 3LP0A 4O55A 4DSFA 3LANA 3CFRA 5HBMA 3RMBA 2HVHA 1KFDA 1KRPA 4E7IA 1RTHA 1Z26A 4OLAA 3OS1A 4KREA 3RRHA 3DMJA 3NF9A 1S1WA 2EHGA 4CJFA 3OYMA 5KGXA 2G8FA 4M3WA 3DLKA 3V4IA 1B9FA 1RBSA 5CY4A 2O4IA 1R0AA 1G15A 3LWLA 2XY6A 4Y1DA 2YHAA 3LPTA 3QIOA 4BDZA 4E0DA 4EZ6A 4M3TA 2HHVA 1S1UA 3AVJA 1VRUA 1RDCA 1BI4A 4CGHA 3O3HA 3TI0A 4EP5A 3IG1A 1U45A 1D9DA 4CJSA 3NAEA 4Q0BA 4KTWA 1A5WA 3OYFA 4DF4A 4KRFA 3HXMA 1RT2A 3K5MA 2OZSA 1L3SA 4DWIA 4YFUA 4HUEA 3PX4A 1JLFA 3AVBA 3NE6A 4DU1A 3VQ5A 1TKZA 4HTUA 3S3NA 2A1RA 5CZ2A 4DSKA 4KB1A 5FRMA 4JS4A 2G8HA 4FK2A 3HO1A 1VSFA 3M8SA 1NK7A 3VQ7A 4CJ4A 1RBRA 2ATQA 2YNFA 3SNNA 1IG9A 2RN2A 1RTDA 1VSDA 4CJTA 3NF8A 2OZMA 4Z4FA 1S6QA 4FXDA 3M8RA 1WN7A 1FKPA 1BIUA 1NK0A 3NH0A 3ZT2A 1TGOA 4DTSA 1WAJA 2AJQA 3HVRA 1ZBLA 1A5XA 2G8UA 4KV8A 5CYMA 2BE2A 3LP3A 3L2QA 3AO1A 3AVAA 4W5NA 4CF1A 3HM9A 5I42A 3AVGA 4J2DA 3MEDA 2RF2A 3OS0A 3OYHA 4JLHA 4OJRA 2XY7A 4KI4A 1QSLA 4CJ3A 2BANA 1DTQA 3C95A 4AHSA 3ZSOA 1YVUA 2Z1HA 4B8AB 4C8OA 3THVA 1I39A 4CK1A 2WOMA 3EYZA 4B9LA 3OVNA 1RT4A 4M3RA 4DU3A 3V81A 1NKCA 2G8WA 2PYJA 3CFPA 4EZ9A 4FJ5A 1BCOA 1SV5A 1L3TA 4FLXA 4CFCA 4KHYA 3MXJA 4CF8A 1GOAA 1IKXA 1JL2A 1FKOA 3VQ8A 1LW0A 1VSHA 1Y97A 1TKTA 4NCGA 4FLVA 4DS4A 5HROA 3H08A 1QSYA 5HP1A 3O3GA 3ISNC 1WSEA 4I2QA 1N6QA 4H4MA 4DS5A 4DF8A 3SYZA 3OY9A 3P83D 2HB5A 4CEFA 2VG6A 4E19A 4J2AA 3KTQA 3B6PA 4KHUA 1CZBA 1JL1A 5J2MA 4WE1A 4H4OA 3QEXA 1HYSA 3NF6A 1XI1A 3EY1A 2IDOA 2PY5A 1IH7A 4L8RB 2ITGA 4FJLA 3TAGA 2KZMA 1HYVA 4CHOA 4JRQA 1SL0A 3HPOA 3ULDA 1FK9A 1YTUA 2JGUA 4CF2A 1TAQA 3ZCMA 5KTQA 4CJKA 3OYNA 1Z25A 2D0CA 2R7YA 2YHBA 5C42A 4CJRA 1REVA 4GW6A 1JKHA 3KLIA 4AHVA 3DI6A 4CJUA 3KK3A 1UA0A 5J2QA 2KQ2A 4LH4A 3LZJA 3D0PA 1DTTA 2Z1IA 2FBYA 3VQBA 3KLFA 2F8SA 3L3UA 2ETJA 3KIOA 1ASUA 1S1TA 4KI6A 3K2PA 4FJ8A 1QHTA 3L2VA 3ASMA 1HMVA 1TL3A 3ITHA 3HL8A 3BGRA 3D45A 3QESA 3DRSA 2YNGA 3EZ5A 1MU2A 1ZYQA 4B9UA 3S9HA 2Y1JA 4IG3A 3CM6A 4KTZA 3F73A 1BL3A 1RT7A 4ID1A 4CJPA 3DLBA 4DSIA 1TK8A 1KCFA 4BE0A 4E7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FW1 A;  3MEG A;  4OGE A;  4DFM A;  3OYE A;  5FRO A;  1S1X A;  1XC9 A;  3KD5 E;  2HND A;  3AA2 A;  4XIU A;  3L8B A;  3RRG A;  4BAC A;  1LWE A;  5HRN A;  4ZTF A;  4QAG A;  3NGI A;  4E7L A;  3SQ1 A;  4DSJ A;  3HPG A;  1HJR A;  4CGJ A;  1EXQ A;  1SL2 A;  1NK4 A;  2OA8 A;  1EET A;  1SKS A;  1W9H A;  1D5A A;  3CYM A;  4J2B A;  1S9E A;  1KLM A;  4MFB A;  2G8V A;  4BDP A;  3IS9 A;  1NK9 A;  4CEO A;  3DLG A;  3SQ2 A;  2EX3 A;  3C94 A;  4B9N A;  3PX6 A;  4J2E A;  4CEQ A;  4NCB A;  4DTU A;  1TK5 A;  3OYD A;  3AO5 A;  1UWB A;  3SQ4 A;  5K14 A;  4I2P A;  4ELT A;  4IBN A;  4W5O A;  3SJJ A;  3CM5 A;  3DM2 A;  3BDP A;  3ZT4 A;  3KJV A;  1EX4 A;  1J9A A;  4CJQ A;  2DTU A;  4PQU A;  2RKI A;  2HHT A;  2ZD1 A;  5KRT A;  1RBV A;  4CEZ A;  4E7H A;  4KPY A;  4N47 A;  3TWH A;  5KGW A;  4FLT A;  3HP9 A;  3HP6 A;  1HYZ A;  1Q9X A;  1RIL A;  2HNY A;  4FLY A;  2G8K A;  1X1P A;  1L5U A;  4G1Q A;  1J5O A;  4M3X A;  1LW2 A;  3OYA A;  1C0T A;  1KTQ A;  3HYF A;  3RMA A;  4CF9 A;  3RMC A;  1TVR A;  1VSI A;  2B5J A;  3AVM A;  4RW7 A;  1RDB A;  4DFK A;  4FJX A;  4JRP A;  1QTM A;  1JLA A;  1EKE A;  3KKR A;  3V9X A;  4FM1 A;  3T19 A;  2P5G A;  3SPZ A;  1O1W A;  5J2P A;  4R5P A;  2HHS A;  5C25 A;  3KK2 A;  3S3M A;  1U4B A;  5CZ1 A;  4Z4E A;  2IS3 A;  1IKW A;  1RTI A;  4IFV A;  3QLH A;  4DMN A;  3T1A A;  1VSK A;  1K6Y A;  2GBZ A;  4CK2 A;  2OPP A;  3A2F A;  2NUB A;  3O4N A;  1U04 A;  3V1R A;  1RBT A;  4C8L A;  1C1C A;  4HUG A;  1JLQ A;  2DY4 A;  2F96 A;  4HCB A;  1CXQ A;  4DTP A;  2HMI A;  4AIL C;  3QEW A;  3VN5 A;  1QQC A;  4BWM A;  1WSG A;  4ZTJ A;  2XRI A;  2DFF A;  4CIF A;  3RTV A;  1NJZ A;  1QSS A;  1ZBF A;  4CIG A;  4FZX C;  1WAF A;  4DSE A;  3LP1 A;  1T7P A;  1YT3 A;  2BDP A;  3NF7 A;  4E7K A;  3FFI A;  1LAV A;  4FJK A;  2DFH A;  4CHQ A;  4FM0 A;  1VSM A;  3SUP A;  4PWD A;  4F2R A;  3M8Q A;  3OYG A;  1RT1 A;  5DMR A;  3HT3 A;  5CYQ A;  5KRS A;  3AVK A;  4B08 A;  2HW3 A;  4KHW A;  1LWF A;  2YKM A;  3VQP A;  3I0R A;  1LWC A;  4FJI A;  2YKN A;  3LP2 A;  4DG1 A;  3LDS A;  2FC0 A;  3ZSW A;  4NCA A;  4B3O A;  2XY5 A;  2HHW A;  2YV0 X;  1WSJ A;  4ID5 A;  3PX0 A;  3DRP A;  4ELU A;  1VSJ A;  4F3T A;  4BE1 A;  4C8M A;  1NOY A;  4FK0 A;  1ZBH A;  3NH2 A;  1TV6 A;  1RDA A;  3E01 A;  3ZT0 A;  1HQE A;  4I9L A;  2WON A;  2IGI A;  4DFP A;  3SUQ A;  4Y1C A;  3KLH A;  5JS1 A;  2KW4 A;  2Z1G A;  1QE1 A;  1HRH A;  2YNH A;  3ZSY A;  3SV4 A;  4FJJ A;  4DLG A;  1T05 A;  1RTJ A;  2FBX A;  2Z1J A;  3LAL A;  4CES A;  3ZSX A;  3PV8 A;  3WNF A;  2IOC A;  3RR8 A;  3VA3 A;  3TAQ A;  2BGG A;  1JXB A;  3LPU A;  3NHG A;  3OYC A;  1Q9Y A;  3AVN A;  1HPZ A;  2HNZ A;  4CGG A;  1UA1 A;  5HRR A;  4CHY A;  4KB0 A;  2Q3S A;  4KTQ A;  3SCX A;  3OJS A;  1JLG A;  1WNS A;  3DRR A;  1TK0 A;  3NGZ A;  3AA4 A;  1Q8I A;  3ZSQ A;  2QXF A;  1RNH A;  2OPR A;  3M8P A;  1I3A A;  4W5T A;  5HLF A;  1C0U A;  2GV9 A;  4FCY A;  2OPS A;  4CGI A;  1L3V A;  4CFB A;  3TAM A;  2GUI A;  1KVA A;  2X78 A;  4CE9 A;  3PY8 A;  3K5L A;  1S9G A;  4CK3 A;  2VG7 A;  4FW2 A;  3AVL A;  3MXM A;  3CG7 A;  1X9W A;  1HQU A;  3LZI A;  5FRN A;  5SZT A;  3PO5 A;  4FJ9 A;  4KAZ A;  3O3F A;  2OYQ A;  4MQ3 A;  1EP4 A;  4CHN A;  2KFZ A;  3CQ8 A;  1BIZ A;  1JLC A;  2B6A A;  1BGX T;  1J54 A;  1S1V A;  3MEE A;  4M45 A;  4CGF A;  1UAX A;  4CJE A;  4OKE A;  4N56 A;  1KFS A;  2XO7 A;  4FJ7 A;  2G8I A;  3F9K A;  1SUQ A;  3V1Q A;  4FK4 A;  3C6U A;  3KLG A;  1JLE A;  5KI6 A;  2P1J A;  1T03 A;  3QO9 A;  3VQE A;  3K57 A;  1BQN A;  3VQ6 A;  3OYB A;  3KK1 A;  3P1G A;  4DLE A;  3SQ0 A;  3C6T A;  3AA3 A;  4DTJ A;  3TAN A;  1DLO A;  3NBP A;  3KD1 E;  4F4K A;  2KZZ A;  3V6D A;  4W5Q A;  1L3U A;  4HHT A;  4CJL A;  4M3U A;  3AVI A;  4IKF A;  1CXU A;  4JS5 A;  4I9Q A;  3P5J A;  4UQG A;  2VWJ A;  4FLZ A;  3G0Z A;  4GVM A;  5J1E A;  1HNI A;  2DFE A;  3NFA A;  2VG5 A;  4FJH A;  1ZBI A;  1VSL A;  3SUO A;  4FLW A;  1KSP A;  1C1B A;  4Z4G A;  4QOZ B;  4CF0 A;  3SUN A;  3K5O A;  4DQR A;  4N76 A;  2W42 A;  4O4G A;  3DLE A;  5FDL A;  5DK5 A;  4LSL A;  4M42 A;  1NK5 A;  3K5N A;  2Y1I A;  3PO4 A;  3ALY A;  4W5R A;  1NK8 A;  3V9Z A;  4C8K A;  1RDD A;  1NJY A;  1F21 A;  3T3F A;  3L2W A;  4DQI A;  4OGC A;  4Z0U A;  4CJ5 A;  4M41 A;  4IDK A;  4KO0 A;  4E1M A;  4KHN A;  3HJF A;  4RG8 A;  2KFN A;  3RR7 A;  4ICL A;  3DOK A;  1RT3 A;  3KLE A;  4OLB A;  1TKD A;  1JXE A;  4ZHR A;  3CFO A;  4I7F A;  3QIN A;  5HRS A;  4O0I A;  4FM2 A;  1GOB A;  3MEC A;  3WNE A;  4CHZ A;  3DLR A;  3NH1 A;  4CER A;  3QER A;  3U3Y A;  3OYJ A;  4RW4 A;  4FJN A;  4CED A;  4RW9 A;  3SZ2 A;  1ASW A;  3QEP A;  1TAU A;  4PY5 A;  3AO4 A;  1KVC A;  4NYF A;  4FJG A;  4OKJ A;  1WSF A;  1C6V A;  3G10 A;  4FLU A;  3LWM A;  1ZBU A;  2FBT A;  1X9S A;  1GOC A;  4E1N A;  1W0H A;  3RWU A;  4DSL A;  3AVH A;  3NDK A;  4Z4I A;  4PA1 A;  2A1S A;  4BDY A;  4DTX A;  2XHB A;  2QKK A;  4CEB A;  4K8X A;  1IO2 A;  1BCM A;  3TAF A;  1D8Y A;  2E6M A;  4DTM A;  4F2S A;  3LAM A;  1JLB A;  4AHR A;  4F3O A;  4OKK A;  4CGD A;  1WLJ A;  1RT6 A;  4AH9 A;  1CLQ A;  1VRT A;  1IKV A;  3L2R A;  2D5R A;  5E41 A;  3JSM A;  3VA0 A;  4OPJ A;  1XHZ A;  3TR8 A;  3PUF A;  1CZ9 A;  2PYL A;  3VQ4 A;  4QCL A;  4CEE A;  3DOL A;  3AVF A;  1NOZ A;  3WNG A;  4Z4H A;  4KHS A;  3JYT A;  2ZE2 A;  3QET A;  3MAQ A;  1A5V A;  2HHU A;  3HPH A;  4OPK A;  3AO2 A;  3S3O A;  2F8T A;  3V1O A;  3TAP A;  1XHX A;  1U48 A;  2PZS A;  1IKY A;  3K59 A;  4DU4 A;  4B9S A;  4B9V A;  2I5J A;  4RW8 A;  3IRX A;  4RW6 A;  1T8E A;  5JS2 A;  4B8C A;  4BE2 A;  4TSX A;  1SL1 A;  3DYA A;  3ZSZ A;  2YNI A;  3AO3 A;  2D0B A;  4CFD A;  3V9S A;  3MXI A;  3VQC A;  4E3S A;  1TKX A;  4CJW A;  1NKE A;  1NK6 A;  4EP4 A;  1HNV A;  3U3G A;  4YNQ A;  1X9M A;  4O5B A;  5C24 A;  3VQ9 A;  5I3U A;  2ZQB A;  3VQA A;  4IG0 A;  4CFA A;  4OVL A;  4LH5 A;  4CHP A;  3OYL A;  3QNN A;  1KLN A;  4AHC A;  1SKW A;  4DFJ A;  2IC3 A;  1N5Y A;  3DLH A;  1NKB A;  2XY8 A;  3TAR A;  1NJW A;  4FYD A;  1B9D A;  2E4L A;  2LSN A;  5T7B A;  3V9U A;  4AHU A;  1ITG A;  3LAK A;  1BIS A;  4LSN A;  4M3Z A;  1C1A A;  3ZSV A;  2QKB A;  3TAB A;  3AVC A;  4FVM A;  1U49 A;  4CCH A;  4NYN A;  3KKS A;  2X74 A;  2P5O A;  2X6N A;  4KFB A;  3ZSR A;  3ZT1 A;  5HRP A;  2O4G A;  3OYI A;  4DTR A;  2FBV A;  3WNH A;  4DQS A;  3QEV A;  2VWK A;  3L3V A;  4KKO A;  4Z4C A;  5EU7 A;  1BHL A;  2X6S A;  1U47 A;  4ELV A;  3QIP A;  3HVT A;  4M3Y A;  1S6P A;  1XWL A;  4BWJ A;  2IAJ A;  1KVB A;  3L2U A;  2E6L A;  3K58 A;  1D9F A;  4HCC A;  1RT5 A;  4PUO A;  1SKR A;  3HK2 A;  4E89 A;  3OJU A;  4O0J A;  4CJV A;  3IAY A;  1QS4 A;  3VQQ A;  2RPI A;  2D0A A;  4IFY A;  3AA5 X;  1ASV A;  1WSI A;  4K8Z A;  4CIE A;  3SI6 A;  4GMJ B;  1J53 A;  4N41 A;  4AHT A;  1S5J A;  1BI4 B;  4DTN A;  4O44 A;  1B92 A;  3U6F A;  4B9T A;  3NGY A;  3ZT3 A;  3AV9 A;  2OPQ A;  1VK0 A;  3OYK A;  3OS2 A;  4DTO A;  3B6O A;  1LV5 A;  3TAE A;  4KHQ A;  2HHX A;  1FXX A;  4F8R A;  1RCH A;  4LD0 A;  3QNO A;  1YTA A;  1VSE A;  1C0M A;  1LAW A;  3SPY A;  3VQD A;  3RMD A;  3QEI A;  1RBU A;  4Q5V A;  4FZZ A;  4B9M A;  4DQP A;  1BQM A;  4C8N A;  3NCI A;  2QK9 A;  3UIQ A;  3I0S A;  1TL1 A;  2HVI A;  5D3G A;  4HVJ A;  4H8K A;  3SV3 A;  4LY7 A;  2KTQ A;  1WSH A;  2B4J A;  5SWM A;  4CEC A;  4DQQ A;  3V9W A;  3I8D A;  2P51 A;  3O4Q A;  4HUF A;  4CEA A;  1NJX A;  4FZY A;  5J2N A;  2HHQ A;  4FJM A;  1UOC A;  2JLE A;  3HST B;  4N5S A;  3LP0 A;  4O55 A;  4DSF A;  3LAN A;  3CFR A;  5HBM A;  3RMB A;  2HVH A;  1KFD A;  1KRP A;  4E7I A;  1RTH A;  1Z26 A;  4OLA A;  3OS1 A;  4KRE A;  3RRH A;  3DMJ A;  3NF9 A;  1S1W A;  2EHG A;  4CJF A;  3OYM A;  5KGX A;  2G8F A;  4M3W A;  3DLK A;  3V4I A;  1B9F A;  1RBS A;  5CY4 A;  2O4I A;  1R0A A;  1G15 A;  3LWL A;  2XY6 A;  4Y1D A;  2YHA A;  3LPT A;  3QIO A;  4BDZ A;  4E0D A;  4EZ6 A;  4M3T A;  2HHV A;  1S1U A;  3AVJ A;  1VRU A;  1RDC A;  1BI4 A;  4CGH A;  3O3H A;  3TI0 A;  4EP5 A;  3IG1 A;  1U45 A;  1D9D A;  4CJS A;  3NAE A;  4Q0B A;  4KTW A;  1A5W A;  3OYF A;  4DF4 A;  4KRF A;  3HXM A;  1RT2 A;  3K5M A;  2OZS A;  1L3S A;  4DWI A;  4YFU A;  4HUE A;  3PX4 A;  1JLF A;  3AVB A;  3NE6 A;  4DU1 A;  3VQ5 A;  1TKZ A;  4HTU A;  3S3N A;  2A1R A;  5CZ2 A;  4DSK A;  4KB1 A;  5FRM A;  4JS4 A;  2G8H A;  4FK2 A;  3HO1 A;  1VSF A;  3M8S A;  1NK7 A;  3VQ7 A;  4CJ4 A;  1RBR A;  2ATQ A;  2YNF A;  3SNN A;  1IG9 A;  2RN2 A;  1RTD A;  1VSD A;  4CJT A;  3NF8 A;  2OZM A;  4Z4F A;  1S6Q A;  4FXD A;  3M8R A;  1WN7 A;  1FKP A;  1BIU A;  1NK0 A;  3NH0 A;  3ZT2 A;  1TGO A;  4DTS A;  1WAJ A;  2AJQ A;  3HVR A;  1ZBL A;  1A5X A;  2G8U A;  4KV8 A;  5CYM A;  2BE2 A;  3LP3 A;  3L2Q A;  3AO1 A;  3AVA A;  4W5N A;  4CF1 A;  3HM9 A;  5I42 A;  3AVG A;  4J2D A;  3MED A;  2RF2 A;  3OS0 A;  3OYH A;  4JLH A;  4OJR A;  2XY7 A;  4KI4 A;  1QSL A;  4CJ3 A;  2BAN A;  1DTQ A;  3C95 A;  4AHS A;  3ZSO A;  1YVU A;  2Z1H A;  4B8A B;  4C8O A;  3THV A;  1I39 A;  4CK1 A;  2WOM A;  3EYZ A;  4B9L A;  3OVN A;  1RT4 A;  4M3R A;  4DU3 A;  3V81 A;  1NKC A;  2G8W A;  2PYJ A;  3CFP A;  4EZ9 A;  4FJ5 A;  1BCO A;  1SV5 A;  1L3T A;  4FLX A;  4CFC A;  4KHY A;  3MXJ A;  4CF8 A;  1GOA A;  1IKX A;  1JL2 A;  1FKO A;  3VQ8 A;  1LW0 A;  1VSH A;  1Y97 A;  1TKT A;  4NCG A;  4FLV A;  4DS4 A;  5HRO A;  3H08 A;  1QSY A;  5HP1 A;  3O3G A;  3ISN C;  1WSE A;  4I2Q A;  1N6Q A;  4H4M A;  4DS5 A;  4DF8 A;  3SYZ A;  3OY9 A;  3P83 D;  2HB5 A;  4CEF A;  2VG6 A;  4E19 A;  4J2A A;  3KTQ A;  3B6P A;  4KHU A;  1CZB A;  1JL1 A;  5J2M A;  4WE1 A;  4H4O A;  3QEX A;  1HYS A;  3NF6 A;  1XI1 A;  3EY1 A;  2IDO A;  2PY5 A;  1IH7 A;  4L8R B;  2ITG A;  4FJL A;  3TAG A;  2KZM A;  1HYV A;  4CHO A;  4JRQ A;  1SL0 A;  3HPO A;  3ULD A;  1FK9 A;  1YTU A;  2JGU A;  4CF2 A;  1TAQ A;  3ZCM A;  5KTQ A;  4CJK A;  3OYN A;  1Z25 A;  2D0C A;  2R7Y A;  2YHB A;  5C42 A;  4CJR A;  1REV A;  4GW6 A;  1JKH A;  3KLI A;  4AHV A;  3DI6 A;  4CJU A;  3KK3 A;  1UA0 A;  5J2Q A;  2KQ2 A;  4LH4 A;  3LZJ A;  3D0P A;  1DTT A;  2Z1I A;  2FBY A;  3VQB A;  3KLF A;  2F8S A;  3L3U A;  2ETJ A;  3KIO A;  1ASU A;  1S1T A;  4KI6 A;  3K2P A;  4FJ8 A;  1QHT A;  3L2V A;  3ASM A;  1HMV A;  1TL3 A;  3ITH A;  3HL8 A;  3BGR A;  3D45 A;  3QES A;  3DRS A;  2YNG A;  3EZ5 A;  1MU2 A;  1ZYQ A;  4B9U A;  3S9H A;  2Y1J A;  4IG3 A;  3CM6 A;  4KTZ A;  3F73 A;  1BL3 A;  1RT7 A;  4ID1 A;  4CJP A;  3DLB A;  4DSI A;  1TK8 A;  1KCF A;  4BE0 A;  4E7J A; 
#chains in the Genus database with same CATH topology
 4FW1 A;  2CGJ A;  4OGE A;  3B8A X;  3L8B A;  4BAC A;  1LWE A;  5HRN A;  4ZTF A;  3HPG A;  1SL2 A;  5BN9 A;  3G25 A;  3CC7 N;  3CYM A;  4GV9 A;  4BDP A;  3UKR B;  4CEO A;  3PX6 A;  2A40 A;  4DTU A;  1TK5 A;  1EO1 A;  3OYD A;  3SQ4 A;  5K14 A;  4IBN A;  5AZI B;  3DM2 A;  3ZT4 A;  5TKY A;  1EX4 A;  4PQU A;  3CCM N;  4E7H A;  4CEZ A;  4DV5 K;  4N47 A;  2Q31 A;  2IIR A;  3HP6 A;  1VQK N;  3ATU A;  4X64 K;  4CF9 A;  2QEX N;  3D7E O;  1RDB A;  2OTL N;  3K0S A;  1QTM A;  3THX A;  1BDG A;  4LFB K;  1EKE A;  5JLF A;  3GOI A;  4CZH A;  1HLU A;  1U4B A;  2GWJ A;  5CZ1 A;  2D1K A;  4Z4E A;  5LMU K;  3QLH A;  4JI6 K;  1W7A A;  1K6Y A;  4CK2 A;  1T6D A;  5EOY A;  4C8L A;  1C1C A;  2DY4 A;  1JLQ A;  2F96 A;  4HCB A;  2HMI A;  3VN5 A;  3U9D A;  4ZTJ A;  2XRI A;  4CIF A;  1ZBF A;  1WAF A;  3UKR A;  3LP1 A;  1IBK K;  3NF7 A;  3HTV A;  4CHQ A;  4FM0 A;  3SUP A;  2HST A;  2NRZ A;  1RT1 A;  3HT3 A;  2HW3 A;  2NRT A;  3KWI A;  4DKW A;  3KWG A;  5A2Q O;  1LWC A;  2YKN A;  4DV4 K;  4NCA A;  2RHK A;  3ZSW A;  2XY5 A;  1WSJ A;  3PX0 A;  4ELU A;  2O8D B;  1VSJ A;  4K41 A;  4BE1 A;  3VEX A;  3FR0 A;  5IWA K;  4C8M A;  1NOY A;  4FK0 A;  1ZBH A;  1TV6 A;  1RDA A;  1HQE A;  3WUH A;  3KLH A;  5JS1 A;  2KW4 A;  2Z1G A;  1NGA A;  1HRH A;  3M1F A;  3LAL A;  3PV8 A;  1RDU A;  2IOC A;  3WNF A;  3A5O C;  5JMV A;  3NHG A;  4JKD A;  1HPZ A;  2HNZ A;  4KB0 A;  4YOW A;  2Q3S A;  4BRP A;  1WNS A;  4ISE A;  3AA4 A;  2QXF A;  2OPR A;  4W5T A;  4XH4 A;  4CBU A;  3IUC A;  2RE2 A;  4PKI A;  4K43 A;  3K5L A;  1S9G A;  3AVL A;  3CG7 A;  3GE1 A;  3CJ1 A;  1BUP A;  4B1W B;  5SZT A;  4FJ9 A;  4BRH A;  2B6A A;  1S1V A;  3MEE A;  4M45 A;  1FJG K;  4OKE A;  1SUQ A;  5F1X A;  3C6U A;  3MN6 A;  5KI6 A;  2VCP A;  3K57 A;  2KKZ A;  3KVG A;  4BRG A;  2O8D A;  3VQ6 A;  3KK1 A;  3SQ0 A;  2FSN A;  5E26 A;  3TAN A;  3AA3 A;  4UY8 O;  1RFQ A;  3BP8 A;  4K0K K;  4F4K A;  4JKE A;  5EVZ A;  4W5Q A;  4IO9 L;  1L3U A;  5JVH L;  2OTJ N;  5IT9 O;  3CMA N;  3WXI A;  2QXL A;  1GLF O;  3UKU B;  1NGC A;  4GVM A;  5J1E A;  3P31 A;  1GLD G;  4DV1 K;  3JXU A;  1BG3 A;  3AAQ A;  5EXW A;  1VSL A;  1KSP A;  2VQF K;  3SUN A;  2IVO A;  2UXC K;  1TUU A;  3S41 A;  3O8M A;  1NK5 A;  2Y1I A;  3LDO A;  4W5R A;  5JLH A;  1F21 A;  3AGK A;  3LM9 A;  4ILJ A;  4DQI A;  4OGC A;  4FL9 A;  1M1K O;  1NMN A;  4ICL A;  1T6C A;  1OVQ A;  1VQM N;  3CFO A;  4O0I A;  5AQJ A;  5AQL A;  4GNI A;  4CHZ A;  3WNE A;  3DLR A;  2E2O A;  3U3Y A;  3QML A;  4BRK A;  4CED A;  3SZ2 A;  3CC2 N;  5LY3 A;  4C23 A;  4OKJ A;  1QQM A;  1JCG A;  1GOC A;  3RWU A;  4FOE A;  3NDK A;  2A1S A;  4CEB A;  4K8X A;  3UKU A;  4DTM A;  3LAM A;  4BG8 A;  4OKK A;  1IKV A;  4IOX A;  3VEO A;  3PUF A;  2QA4 N;  1CZ9 A;  3VQ4 A;  4M7Y A;  3MAQ A;  2HHU A;  4PKH A;  3AO2 A;  4H03 B;  2HBJ A;  1H1V A;  1IKY A;  3O1W A;  4DU4 A;  3EO3 A;  5JS2 A;  4TSX A;  5CHI A;  2VGM A;  4CFD A;  3SMS A;  4E3S A;  3CJB A;  4EP4 A;  1VQ8 N;  4YNQ A;  1QVF M;  4DFJ A;  4CBW A;  1B9D A;  4MO4 A;  3V9U A;  4AHU A;  4YOT A;  3LAK A;  3ZSV A;  3TAB A;  1U49 A;  1QHA A;  2A41 A;  2CH5 A;  4KFB A;  3ZSR A;  2QWQ A;  5HRP A;  4DV3 K;  3OYI A;  4DTR A;  3O9R A;  5GIP A;  1N34 K;  4CZF A;  4Z4C A;  3SAF A;  3LDP A;  4CD3 A;  1BHL A;  2X6S A;  3HVT A;  4BWJ A;  1D9F A;  1RT5 A;  5FPN A;  3HK2 A;  4CJV A;  3OA9 A;  4K8Z A;  4PHT X;  4BR2 A;  2UU9 K;  3N4P A;  1J53 A;  5H1S Q;  4BRQ A;  3DLL L;  4IJN A;  4FWL A;  3C0B A;  4FPB A;  4JKC A;  3VOV A;  4KHQ A;  3FZK A;  1LV5 A;  2HHX A;  1FXX A;  2Q2R A;  4GV6 A;  3EN9 A;  1VSE A;  3E66 A;  2A6A A;  4C8N A;  4JKG A;  3SBG A;  2E1Y A;  1NJX A;  3T7Z A;  2HHQ A;  1UOC A;  1IG8 A;  3G71 N;  4A5B A;  1XMQ K;  3L6Q A;  4O55 A;  5AQR A;  5HBM A;  3RMB A;  3K9K A;  3KK7 A;  3R9P A;  3RRH A;  3MCA B;  1GLC G;  3CCQ N;  1BOT O;  4M3W A;  4AM6 A;  2XY6 A;  4Y1D A;  3QIO A;  3LPT A;  5AQV A;  1ZBS A;  1D9D A;  1RDC A;  3IG1 A;  4CBX A;  4CJS A;  3M5R A;  1A5W A;  4KTW A;  4MLH A;  3OYF A;  4O8K A;  2P9U B;  1RT2 A;  2OZS A;  4YFU A;  4YHH K;  1JLF A;  2QWP A;  3NE6 A;  4DU1 A;  3VQ5 A;  3GBT A;  5CZ2 A;  5C10 A;  4JAX A;  3IDH A;  3VQ7 A;  3SNN A;  1YJN N;  2RN2 A;  2F7T A;  3O9T A;  1RTD A;  3NF8 A;  2HBM A;  1MA9 B;  4L3Q A;  1WN7 A;  3ZT2 A;  1TGO A;  4JI0 K;  4DTS A;  4YDU A;  1ZBL A;  1A5X A;  3LP3 A;  4JHD A;  4B9Q A;  3R3L A;  1IJJ A;  3W0L A;  4JEP A;  2VQE K;  4J2D A;  3CJC A;  2RF2 A;  4JLH A;  4BRL A;  1QSL A;  2BAN A;  1NGI A;  3ZSO A;  4A5A A;  4C8O A;  1I39 A;  5BPL A;  3EYZ A;  2Q1N A;  1RT4 A;  1NKC A;  2PYJ A;  3A5L C;  3VEY A;  1GOA A;  4F9O A;  4LF4 K;  1WOQ A;  2E88 A;  5FPM A;  1TKT A;  4NCG A;  4FLV A;  5AQM A;  1YHQ N;  1QSY A;  3C6H A;  2P9U A;  3ISN C;  1WSE A;  3SYZ A;  2E8A A;  3AY9 A;  3MWP A;  2HB5 A;  4J2A A;  4C1N I;  3P39 A;  3VF6 A;  4H4O A;  3QEX A;  4BRN A;  3CCE N;  3EE8 A;  2IDO A;  2PY5 A;  2ITG A;  3ENH A;  3T69 A;  4FWR A;  1SL0 A;  3HPO A;  2JGU A;  4PL8 A;  1JCF A;  3O4W A;  4B1Y B;  4CJK A;  3OYN A;  1Z25 A;  2R7Y A;  3O9S A;  1JKH A;  1S22 A;  4XH5 A;  4IJA A;  3ZEU B;  4LH4 A;  4EIA A;  2Z1I A;  3KLF A;  4EAH D;  5FPE A;  2ETJ A;  1MWM A;  3KIO A;  1S1T A;  4BR4 A;  5GAH P;  3K2P A;  1LCU A;  1HMV A;  3ITH A;  4LF5 K;  3DRS A;  3EZ5 A;  1ZYQ A;  3S9H A;  4IG3 A;  4WQ4 C;  4KTZ A;  5CR4 A;  3OHR A;  4DFM A;  3KD5 E;  2HND A;  4G9Z A;  3FE1 A;  2W40 A;  3RRG A;  4QAG A;  4IWV A;  3OTO K;  3PIP L;  3G6E N;  4E7L A;  3SQ1 A;  3CME N;  4B1X B;  1EXQ A;  1NK4 A;  3I55 N;  1EET A;  1HKC A;  1D5A A;  1W9H A;  4J2B A;  1S9E A;  2G8V A;  4FZZ A;  4BG9 A;  2EX3 A;  2P9P B;  1UWB A;  2NRW A;  4I2P A;  4W5O A;  2YI1 A;  4MDB A;  1OH8 A;  5MLC Q;  2ZD1 A;  5KRT A;  4KPY A;  4H0O A;  2WFB A;  5KGW A;  3TTD A;  3HP9 A;  4WQ5 C;  1X1P A;  1L5U A;  4G1Q A;  1J5O A;  3ZEU A;  5DM7 L;  3RMC A;  2WBN A;  4RW7 A;  1KC8 O;  4DFK A;  3KKR A;  5AQF A;  1O1W A;  4CVN E;  4R5P A;  2HHS A;  3KK2 A;  4IFV A;  2GBZ A;  3A2F A;  2Q0U A;  3O4N A;  1U04 A;  4AIL C;  3L0Q A;  3VER A;  1T7P A;  4OO1 J;  1YT3 A;  1LAV A;  3SAH A;  1K73 O;  5ELZ A;  1YI2 N;  3AVK A;  1QVG M;  4ISF A;  4KHW A;  1LWF A;  4DR1 K;  4FJI A;  3LP2 A;  3LDS A;  3T1H K;  3VPZ A;  2UXB K;  1OH7 A;  2P9L A;  5ADX A;  3NH2 A;  4DFP A;  3SUQ A;  3SV4 A;  1G99 A;  4FJJ A;  2AP1 A;  1T05 A;  1Q7Y O;  2Z1J A;  2FBX A;  3FZM A;  3RSE B;  4CES A;  3N4Q A;  3A8Y A;  3LPU A;  3OYC A;  3AVN A;  1UA1 A;  3SCX A;  1YAG A;  5EY4 A;  1C0G A;  4HTL A;  5BRD A;  1NG9 A;  3ZX0 A;  4Y0W A;  3R8E A;  5HLF A;  4OX9 K;  1C0U A;  4FCY A;  4B3M K;  4CGI A;  4CFB A;  4EHU A;  2GUI A;  4DUZ K;  1KVA A;  2X78 A;  2JWK A;  4CK3 A;  4MLE A;  4FW2 A;  4LFC K;  1HQU A;  3ATV A;  4NO7 A;  3VET A;  4KAZ A;  3VEW A;  5LL6 Z;  1J54 A;  1KFS A;  4FJ7 A;  1VQN N;  2G8I A;  3VEV A;  1JLE A;  2P1J A;  3QO9 A;  4FWK A;  3TSP A;  4NXN K;  3VQE A;  2O8C B;  2UUA K;  4NLC A;  1BQN A;  1XQS C;  3OYB A;  1L3V A;  2FSK A;  3NBP A;  3V6D A;  2YJE A;  4HHT A;  3AVI A;  3O1B A;  1ATN A;  1CXU A;  4JS5 A;  5JIC A;  1KQS M;  5M1Q A;  4UQG A;  4FLZ A;  3JS6 A;  4H5W A;  1CZA N;  1IV0 A;  1HNI A;  2DFE A;  4PKG A;  3SUO A;  4IZ9 A;  4CZK A;  4DQR A;  4N76 A;  3THY B;  4XEI A;  1VQL N;  2FF6 A;  1NJY A;  3T3F A;  4JKA A;  3C6A A;  4KO0 A;  4E1M A;  4KHN A;  1EQY A;  2KFN A;  3RR7 A;  3VEZ A;  3F2K A;  3OBY A;  3FLC O;  1TYQ A;  1GOB A;  3MEC A;  3QER A;  2E20 A;  3AAR A;  4PY5 A;  1KVC A;  1T3V A;  5AQY A;  1X9S A;  1W0H A;  4RCH A;  4Z4I A;  3QBX A;  1T44 A;  2ITM A;  2E6M A;  1K9M O;  4IO8 A;  4F2S A;  4AHR A;  4F3O A;  4DB3 A;  3P38 A;  1VRT A;  5CE3 A;  5AZI A;  2D5R A;  2QW9 A;  4OPJ A;  4QCL A;  1U6Z A;  3THY A;  4CEE A;  3DOL A;  3AVF A;  4KHS A;  3QET A;  4CZG A;  1A5V A;  1Z6R A;  3S3O A;  2F8T A;  3TAP A;  1XHX A;  2ZF5 O;  3CXC M;  3K59 A;  4B9S A;  1HJO A;  5AQQ A;  4RW6 A;  3CER A;  1T8E A;  4BE2 A;  4B8C A;  3DYA A;  3MMV A;  3ZSZ A;  3AO3 A;  2D0B A;  2WUS A;  3MXI A;  1TKX A;  1QZ5 A;  4B3S K;  3U3G A;  1X9M A;  4BR0 A;  3VQ9 A;  2ZQB A;  3VQA A;  3MN7 A;  1WBD A;  1NLV A;  2GTD A;  3O08 A;  1KLN A;  3SMP A;  2HBL A;  4FYD A;  3D6R A;  2DPN A;  2LSN A;  4LSN A;  4BRC A;  1C1A A;  3AVC A;  4FVM A;  2F9W A;  1D4X A;  2X74 A;  2P5O A;  4DR4 K;  3ZT1 A;  4IEI A;  4H5N A;  2FBV A;  1U2V B;  3WNH A;  2YCH A;  3QEV A;  3L3V A;  4OPA A;  4FO0 A;  1S6P A;  1XWL A;  3L2U A;  4HCC A;  2E6L A;  1X3M A;  3EKS A;  3IAY A;  2D0A A;  4N41 A;  2V7Y A;  3LL3 A;  3IFR A;  4GVE A;  4CJ7 A;  2QWN A;  2E2Q A;  1B92 A;  4IOC L;  3LDN A;  2ZJR L;  2P9S B;  3AV9 A;  1VK0 A;  3OS2 A;  3TAE A;  4F8R A;  3QNO A;  2A42 A;  1LAW A;  3QEI A;  2ASO A;  4DQP A;  1NGB A;  2HVI A;  4YOR A;  3SV3 A;  3BZC A;  4LY7 A;  3F5T A;  1WSH A;  4XH1 A;  4CEC A;  4DQQ A;  3E9L A;  3O4Q A;  5LJV A;  1V4T A;  3WEE B;  4CEA A;  1KAX A;  2OAN A;  1KRP A;  1U2V A;  1RTH A;  1Z26 A;  4E7I A;  3NF9 A;  3WXK A;  4JI2 K;  2EHG A;  2GEL A;  1I94 K;  4J8F A;  2G8F A;  3ULE B;  1B9F A;  1RBS A;  4H0T B;  4PL7 A;  3LWL A;  3J7Z O;  4KBO A;  2HHV A;  3AVJ A;  3JAM O;  4HWI A;  4CGH A;  4Q0B A;  3E9O A;  4DWI A;  5C0Y A;  3AVB A;  4BRO A;  1TKZ A;  4MDA A;  4JS4 A;  3HO1 A;  3M8S A;  4CJ4 A;  1RBR A;  4LF6 K;  2OZM A;  2YHX A;  1NWK A;  1BU6 O;  3NH0 A;  5AQI A;  1WAJ A;  2AJQ A;  3P4I A;  4KV8 A;  5CYM A;  2NRX A;  3A5N C;  3L2Q A;  3AVA A;  4W5N A;  3BF3 A;  3MED A;  2UXD K;  3C7N B;  4LF8 K;  3OS0 A;  3ZET B;  3C95 A;  1XUP O;  1YVU A;  2Z1H A;  4B8A B;  3THV A;  4I6M B;  2NRV A;  3O80 A;  3OVN A;  3V81 A;  2YHY A;  2D0O A;  2CGK A;  1BCO A;  1HKB A;  5HOO A;  3QFP A;  5C15 A;  3ZLJ A;  1VQ9 N;  1J6Z A;  1QZ6 A;  3G4S N;  4I2Q A;  3CI5 A;  4H4M A;  1WB9 A;  2O8E B;  2VG6 A;  2FF3 B;  3H6E A;  1O13 A;  1CZB A;  1JL1 A;  2AA4 A;  2VGN A;  3NF6 A;  1XI1 A;  4L8R B;  2PBD A;  1HYV A;  4CHO A;  1WUA A;  4JRQ A;  4H0Y B;  3EEQ A;  1YTU A;  2E2N A;  5KTQ A;  3C65 A;  3QB0 A;  2YHB A;  3RVC A;  4RTF D;  1REV A;  4GW6 A;  3LDQ A;  3MDQ A;  3VTH A;  3HOS A;  5AJ3 K;  1DTT A;  2H3G X;  1EWQ A;  1ASU A;  1OVY A;  4JN4 A;  3O9U A;  4H5T A;  3W3D A;  3U9Z A;  1W97 L;  3HL8 A;  3D45 A;  3Q7B A;  4B3T K;  5AQZ A;  1Q18 A;  4JI8 K;  4YOV A;  3MEG A;  5FRO A;  1XC9 A;  3AA2 A;  4XIU A;  3OBW A;  3NGI A;  4DSJ A;  2HF4 A;  3VF4 A;  4GKJ K;  3SQ2 A;  3DLG A;  4B9N A;  3C94 A;  5E84 A;  4CEQ A;  3AO5 A;  4ELT A;  3SJJ A;  5AZJ B;  2DTU A;  2RKI A;  2HHT A;  1RBV A;  5DM6 L;  3TWH A;  4FLT A;  1VQ5 N;  4DHY A;  3MCP A;  2G8K A;  1P8Z A;  1Y64 A;  2Q97 A;  1LW2 A;  3OYA A;  4ILG B;  2W6K A;  2PFU A;  2B5J A;  3AVM A;  4JRP A;  1JLA A;  5FLX O;  3ZYY X;  3V9X A;  2P5G A;  5J2P A;  1YJ9 N;  3CQY A;  2IS3 A;  4KH5 A;  3H3N O;  1K8K B;  2NRH A;  3T1A A;  5KQ8 A;  2BH1 A;  1YF5 L;  3V1R A;  5BPN A;  1RBT A;  1HKG A;  1CXQ A;  4DTP A;  4BWM A;  1WSG A;  1NM1 A;  4KH4 A;  2DFF A;  3TTF A;  3VEN A;  4CZM A;  4B1V A;  4FXD A;  5ADX H;  4DSE A;  5EX5 A;  2GWK A;  4NB4 A;  4BQZ A;  1VSM A;  4F2R A;  1R59 O;  3M8Q A;  3OYG A;  1GLJ O;  5CYQ A;  5AZJ A;  3O9Q A;  3HZ6 A;  3HM8 A;  3PIO L;  2YKM A;  3VQP A;  4DG1 A;  4B3O A;  2HHW A;  3J8A A;  3CIP A;  4BRM A;  3E01 A;  3QIC A;  2FXU A;  4DR6 K;  1GLB G;  4Y1C A;  3ZSY A;  5AQP A;  3ZSX A;  1K8A O;  3RR8 A;  3VA3 A;  3TAQ A;  2BGG A;  4KHP K;  4DQ8 A;  2QI2 A;  4CGG A;  3DXM B;  1JLG A;  3DRR A;  4EHT A;  1Q8I A;  1MDU B;  1SZ2 A;  3WQU A;  5B8H A;  4BRE A;  2GUP A;  2GV9 A;  4LF7 K;  4FWP A;  4CE9 A;  1RGI A;  1N32 K;  5FRN A;  2KLA A;  4KH6 A;  2F9T A;  2ASP A;  4MQ3 A;  1EP4 A;  1BIZ A;  1BGX T;  4AQY K;  1UAX A;  1Z05 A;  2XO7 A;  4ISG A;  3F9K A;  4FK4 A;  5AFU A;  3THW B;  3KLG A;  1T03 A;  3K9J A;  5GAE P;  3J81 O;  2D0P A;  5M1P A;  4DLE A;  3C6T A;  1DLO A;  2NNW A;  3WXJ A;  2NZT A;  2A3Z A;  3SBT A;  2P9I B;  3P5J A;  2VWJ A;  4JI4 K;  3G0Z A;  4RWT A;  4DR5 K;  3NFA A;  4FJH A;  2JWL A;  1ZBI A;  4Z4G A;  3I56 N;  3DXM A;  4EFH A;  2W42 A;  3J7A P;  4AF1 A;  3NVK A;  1DKG D;  5FDL A;  2F4V K;  3O6W A;  5BRF A;  3V9Z A;  4C8K A;  1RDD A;  4B1U B;  3LM2 A;  3L2W A;  4Z0U A;  5BRH A;  4IDK A;  2V52 B;  3HJF A;  1GLA G;  1QQO A;  3EKU A;  1RT3 A;  1Q86 O;  3KLE A;  4OLB A;  1TKD A;  1TUY A;  3DXK B;  2HF3 A;  3QIN A;  4FM2 A;  1JJ2 M;  3CD6 N;  4CER A;  4FVU A;  3THW A;  3OYJ A;  3AGR A;  5GIN A;  3AO4 A;  4FJG A;  1WSF A;  1C6V A;  4FLU A;  1ZBU A;  2FBT A;  3BY5 A;  4E1N A;  2O8B B;  4FWM A;  4DSL A;  2ZM6 K;  3TU5 A;  2IVN A;  4BDY A;  2P9I A;  2XHB A;  4DTX A;  2QKK A;  1IO2 A;  2P9P A;  2P9K B;  3ENB A;  1RT6 A;  3UE5 A;  3L2R A;  3JSM A;  3VA0 A;  3TR8 A;  4DCH A;  3MX2 A;  1KAY A;  4Z4H A;  5F0X A;  2Q36 A;  2ZE2 A;  4DV7 K;  4DR7 K;  4BRA A;  3CCJ N;  3HPH A;  4OPK A;  4JYA K;  3KHY A;  4DV0 K;  1FW6 A;  4RW8 A;  2YNI A;  1BO5 O;  1NKE A;  4CJW A;  5JVG L;  1HNV A;  3ENO A;  4O5B A;  5I3U A;  4CFA A;  3QNN A;  1E4F T;  1JCE A;  4H0X B;  1SKW A;  1ESV A;  1N5Y A;  3DLH A;  1NKB A;  2XY8 A;  2KHO A;  2QM1 A;  4M3Z A;  1BIS A;  4K42 A;  3DJC A;  4NYN A;  3ID6 A;  2X6N A;  1S3X A;  4H5V A;  2O4G A;  3F9M A;  2VWK A;  4KKO A;  2P9K A;  3LDL A;  3CCU N;  1ZXO A;  1YVN A;  3QIP A;  4M3Y A;  1KVB A;  4PUO A;  3PSF A;  4E89 A;  2OCE A;  1QS4 A;  3VQQ A;  1C0F A;  2RPI A;  3AA5 X;  5M1N A;  3SI6 A;  4AHT A;  2A5X A;  3HOT A;  3FZL A;  2ZJQ L;  2OPQ A;  4DTO A;  1NBW A;  3RSE A;  3MX5 A;  4LD0 A;  1YTA A;  3SPY A;  1LOT B;  3VQD A;  3RMD A;  4LC9 B;  1RBU A;  3SAG A;  5BR9 A;  2QWR A;  4YOY A;  3NCI A;  2E5L K;  3UIQ A;  2I7P A;  5D3G A;  4HVJ A;  2PAV A;  4IDH A;  3WXL A;  2KTQ A;  2B4J A;  3V9W A;  4DV2 K;  4HUF A;  5HL7 L;  4FZY A;  4N5S A;  3LP0 A;  3LAN A;  3I8B A;  3CFR A;  2HVH A;  1KFD A;  4OLA A;  3OS1 A;  4O8U A;  4KRE A;  3DMJ A;  1N36 K;  5KGX A;  3V4I A;  5CY4 A;  3H45 C;  4JI5 K;  3CQX A;  5LMN K;  4BDZ A;  4E0D A;  4EZ6 A;  1BA0 A;  4M3T A;  1DGK N;  1S1U A;  5AQH A;  3O3H A;  1VRU A;  2WC9 A;  3TI0 A;  5AQK A;  4QOZ B;  2O8C A;  4EP5 A;  4A2B A;  4DF4 A;  4KRF A;  3HXM A;  3K5M A;  1EWR A;  2QWO A;  1L3S A;  4HUE A;  4FWQ A;  4HTU A;  2A1R A;  3QDK A;  3L4Q A;  2ATQ A;  1IG9 A;  4FSV A;  5AQU A;  1VQO N;  4CJT A;  1S6Q A;  3M8R A;  1FKP A;  1BIU A;  1VQP N;  5AQX A;  3HVR A;  4BC2 A;  4IFE A;  3EL2 A;  2BE2 A;  1E3M A;  4CF1 A;  3HM9 A;  4WFN L;  5I42 A;  4QS7 A;  1NGE A;  3OYH A;  4OJR A;  4KI4 A;  3BF1 A;  1DTQ A;  4AHS A;  4WCE L;  4BR9 A;  3VMF B;  4CK1 A;  1DEJ A;  3TSU A;  5BR8 K;  4B9L A;  4M3R A;  3FZF A;  4DU3 A;  3CFP A;  4EZ9 A;  3CCS N;  1S72 N;  4CF8 A;  1YUW A;  1IKX A;  1JL2 A;  4AM7 A;  1KD1 O;  1LW0 A;  1Y97 A;  1ILY A;  5M1F A;  2HHH K;  4O5F A;  3TSQ A;  1N6Q A;  1Q81 O;  3CJ7 A;  3P83 D;  4KHU A;  3KTQ A;  3B6P A;  1SAZ A;  5J2M A;  4WE1 A;  1HYS A;  3M3Z A;  3OW2 M;  4FJL A;  4YOU A;  3ULD A;  1FK9 A;  3ZCM A;  5BRE A;  5C42 A;  4CJR A;  3KLI A;  4AHV A;  3MWT A;  4CJU A;  3KK3 A;  5J2Q A;  3TPQ A;  3LZJ A;  3D0P A;  1ZC6 A;  4WFB L;  3L3U A;  5GIO A;  4KI6 A;  2J4R A;  4CD1 A;  4JI1 K;  2ASM A;  1HNZ K;  1TL3 A;  5KPT A;  5TKW A;  3VES A;  2YNG A;  4DR3 K;  4IOA L;  3A5M C;  1BL3 A;  1RT7 A;  4CI6 A;  3DLB A;  4DSI A;  1TK8 A;  5BN8 A;  3OYE A;  1S1X A;  4BVP A;  3WT0 A;  3CCR N;  4H0V B;  1HJR A;  4CGJ A;  2OA8 A;  1SKS A;  4OPH A;  1KLM A;  4MFB A;  3IS9 A;  1NK9 A;  4NCB A;  4J2E A;  3UB5 A;  5LJW A;  4H5R A;  3CM5 A;  3BDP A;  3KJV A;  1J9A A;  1QQN A;  3D2E B;  3GL1 A;  4CJQ A;  1GLL O;  2UUC K;  1HYZ A;  1Q9X A;  1RIL A;  2HNY A;  4FLY A;  4M3X A;  2NRR A;  1C0T A;  1KTQ A;  3HYF A;  3NVM A;  3GDQ A;  3RMA A;  3HBT A;  1TVR A;  1VSI A;  3QBW A;  3NMU A;  4CZE A;  4FJX A;  2P9S A;  4FM1 A;  3T19 A;  3SPZ A;  5C25 A;  3S3M A;  1IKW A;  1RTI A;  1HNX K;  4DMN A;  1VSK A;  2OPP A;  2NUB A;  3ZX3 A;  4HUG A;  3CHW A;  3QEW A;  3EZW A;  4LFA K;  1QQC A;  3WEE A;  4Z94 A;  3RTV A;  1NJZ A;  1QSS A;  4CIG A;  4FZX C;  1HNW K;  4FOI A;  2BDP A;  4CZJ A;  4FJK A;  2YX6 A;  3FFI A;  4FPA A;  4E7K A;  2DFH A;  4PWD A;  1NGD A;  2I7N A;  4A59 A;  3VGL A;  2UYT A;  5DMR A;  4GY2 B;  5KRS A;  3ULE A;  4B08 A;  4U67 L;  3D2E A;  1SS6 A;  3I0R A;  4BRD A;  2FC0 A;  4NXM K;  3CF5 L;  2YV0 X;  4ID5 A;  3DRP A;  4X62 K;  5AQN A;  4F3T A;  2ZWH A;  4ILH A;  3ZT0 A;  3IMX A;  2FSJ A;  2WON A;  4I9L A;  2IGI A;  5C2F A;  2YNH A;  1QE1 A;  3CCL N;  2ZGZ A;  4JD2 B;  5M1K A;  4DLG A;  1RTJ A;  5KQD A;  2P9N B;  1JXB A;  1Q9Y A;  1VAZ A;  5HRR A;  4CHY A;  4KTQ A;  3OJS A;  1VQ6 N;  4JKG B;  4M7X A;  2W6L A;  1TK0 A;  5AFU H;  3NGZ A;  3H1Q A;  3ZSQ A;  4LF9 K;  1RNH A;  3M8P A;  1I3A A;  1XC3 A;  4A57 A;  3SLC A;  2OPS A;  4M63 C;  3TAM A;  1W2B M;  3PY8 A;  2VG7 A;  3C7N A;  3MXM A;  1X9W A;  4JI3 K;  2UUB K;  3LZI A;  3ZET A;  3PO5 A;  1E4G T;  3O3F A;  2OYQ A;  4CHN A;  2KFZ A;  5AQG A;  3CQ8 A;  4I6M A;  1JLC A;  4CJE A;  5GAG P;  4CGF A;  3FGU A;  4N56 A;  1HUX A;  3HI0 A;  3V1Q A;  1BWF O;  4WQ4 A;  1DT9 A;  1YXQ A;  3FZH A;  3P1G A;  4DTJ A;  3KD1 E;  2KZZ A;  1V4S A;  3CPW M;  1XMO K;  4CJL A;  4M3U A;  4IKF A;  2O8E A;  4YY3 K;  4JD2 A;  4I9Q A;  1HPM A;  4JK7 A;  2YHW A;  2E2P A;  2P9N A;  2VG5 A;  1YJW N;  1SQK A;  4A2A A;  4FLW A;  1C1B A;  4CF0 A;  3K5O A;  3CJA A;  4O4G A;  3HRG A;  3DLE A;  4M42 A;  5DK5 A;  3KZB A;  4LSL A;  1NGG A;  3K5N A;  3VTI A;  3PO4 A;  4WQ5 A;  4NLB A;  4BVO A;  3ALY A;  1NK8 A;  5AR0 A;  4JI7 K;  4JHD B;  4CJ5 A;  4BC3 A;  4M41 A;  4GV3 A;  4RG8 A;  4MO5 A;  4A61 A;  3DOK A;  5F2R A;  1JXE A;  1XNQ K;  4QS9 A;  4ZHR A;  3R6M A;  4I7F A;  5HRS A;  2GEM A;  3SK3 A;  3CET A;  3NH1 A;  4DR2 K;  4BRI A;  4RW4 A;  3PSI A;  4FJN A;  4RW9 A;  5C2D A;  3EE9 A;  1ASW A;  3QEP A;  1TAU A;  4NYF A;  4JNE A;  3D2F B;  3G10 A;  3MK6 A;  3LWM A;  3AVH A;  5KPR A;  2CGL A;  4PA1 A;  4BR7 A;  1BCM A;  3TAF A;  1D8Y A;  2ZJP L;  1JLB A;  4CGD A;  1WLJ A;  4AH9 A;  1GLE G;  1CLQ A;  1ATS A;  4BQL A;  5E41 A;  1XHZ A;  3H3O B;  2PYL A;  3WNG A;  1NOZ A;  4DUY K;  3JYT A;  3I33 A;  2BTF A;  3E1Y A;  3V1O A;  1U48 A;  1NMD A;  2PZS A;  2HMP A;  1KXP A;  4YOX A;  4B9V A;  2I5J A;  1VHX A;  1X9J A;  1OH6 A;  3IRX A;  1SL1 A;  3V9S A;  3CPE A;  3VQC A;  5BPM A;  1NGH A;  1NK6 A;  2HBK A;  2EWS A;  2YJF A;  5GAD P;  5C24 A;  3OYL A;  4IG0 A;  4CHP A;  4OVL A;  4LH5 A;  3SJH A;  3CC4 N;  2IVP A;  3IKM A;  1K8K A;  4AHC A;  2IC3 A;  2ZGY A;  4K25 A;  3TAR A;  1P90 A;  1NJW A;  1ATR A;  4CZL A;  3ZX2 A;  2E4L A;  5T7B A;  1ITG A;  3D2F A;  3O5B A;  2QKB A;  4JKH A;  3A0I X;  4CCH A;  3KKS A;  3J80 O;  4DQS A;  3VF2 A;  5EU7 A;  1XNR K;  1U47 A;  4DV6 K;  4ELV A;  3K58 A;  2IAJ A;  4FWN A;  1SKR A;  1X3N A;  3WXM B;  3OJU A;  4O0J A;  1YIT N;  4IFY A;  1ASV A;  1WSI A;  4CIE A;  4GMJ B;  1S5J A;  1BI4 B;  4FWO A;  4DTN A;  4JV5 K;  4O44 A;  1MWK A;  3U6F A;  4B9T A;  1KAZ A;  4BC5 A;  3L4I A;  3NGY A;  2W41 A;  3ZT3 A;  4BR5 A;  4H0P A;  3OYK A;  2D4W A;  3B6O A;  2HOE A;  1NNE A;  1M90 O;  1RCH A;  3U4L A;  1C0M A;  2NLX A;  4Q5V A;  1VQ4 N;  4B9M A;  1BQM A;  3U8X A;  2QK9 A;  3I0S A;  1TL1 A;  4H8K A;  3ID8 A;  5SWM A;  4BRF A;  3I8D A;  2P51 A;  1YIJ N;  3VGM A;  5J2N A;  3BEX A;  4FJM A;  2JLE A;  4U7B A;  3HST B;  1VQ7 N;  1N33 K;  4DSF A;  5KPZ A;  3FFK B;  2WTU A;  1S1W A;  3QFU A;  4CJF A;  3J7Y P;  3OYM A;  4JK9 A;  4X65 K;  3DLK A;  2QWL A;  2O4I A;  4IXC A;  1R0A A;  4CW7 B;  3BZK A;  1Q82 O;  1G15 A;  1RDW X;  2V7Z A;  2YHA A;  1NU0 A;  4R79 A;  1BI4 A;  1U45 A;  4V19 S;  3NAE A;  2O8F B;  2P9L B;  4A62 A;  3PX4 A;  5AQW A;  2GX9 A;  3S3N A;  4KB1 A;  4DSK A;  2VYP A;  2E1Z A;  2QTD A;  5FRM A;  4FK2 A;  2G8H A;  1VSF A;  1NK7 A;  3Q7C A;  2YNF A;  1VSD A;  4Z4F A;  5AQS A;  3GG4 A;  3TTC A;  3T1Y K;  1NK0 A;  4X66 K;  5AQO A;  1IBM K;  3HSC A;  2G8U A;  4YDU C;  1OH5 A;  1BA1 A;  4FWS A;  3DAW A;  3AO1 A;  2Q0R A;  3VGK A;  5M1O A;  3AVG A;  1J5E K;  3MN9 A;  2XY7 A;  4CJ3 A;  4JK8 A;  4JKB A;  3MN5 A;  3DXK A;  1HX1 A;  3PLA A;  3H1V X;  2WOM A;  5AQT A;  2CH6 A;  5FPD A;  2QWM A;  2G8W A;  4FJ5 A;  1SV5 A;  1L3T A;  4FLX A;  4CFC A;  4C1N K;  3MXJ A;  4KHY A;  1FKO A;  4WFA L;  3VQ8 A;  4B3R K;  1VSH A;  3H46 O;  2O8F A;  4DS4 A;  5C12 A;  3H08 A;  5HRO A;  5HP1 A;  4E1J A;  3O3G A;  2O8B A;  4DS5 A;  4DF8 A;  3OY9 A;  4E19 A;  4WYB A;  3BUZ B;  1OKJ A;  1NGF A;  4B1Z A;  4CEF A;  1NGJ A;  4CZI A;  3E9P A;  4BGA A;  3WQT A;  4IEE A;  2V51 B;  1NJI O;  1HR0 K;  4BY9 C;  3EY1 A;  2KZM A;  1IH7 A;  4JKF A;  1WBB A;  3TAG A;  2FLO A;  1IBL K;  3CJ9 A;  4CF2 A;  1TAQ A;  2BUP A;  3CCV N;  3AAP A;  2D0C A;  3R1X A;  2VWB A;  3DI6 A;  1UA0 A;  2KQ2 A;  4BC4 A;  4BGB A;  2FBY A;  3VQB A;  2F8S A;  1N8R O;  4GKK K;  3THX B;  4FJ8 A;  1QHT A;  3L2V A;  3ASM A;  3BGR A;  5I9E B;  4QS8 A;  1TYQ B;  3QES A;  1MU2 A;  3M6G A;  4B9U A;  4WF9 L;  2Y1J A;  3CM6 A;  3F73 A;  4CJP A;  4ID1 A;  1KCF A;  4BE0 A;  4E7J A;  3DWL A; 
#chains in the Genus database with same CATH homology
 4FW1 A;  3MEG A;  4OGE A;  4DFM A;  3OYE A;  5FRO A;  1S1X A;  1XC9 A;  3KD5 E;  2HND A;  3AA2 A;  4XIU A;  3L8B A;  3RRG A;  4BAC A;  1LWE A;  5HRN A;  4ZTF A;  4QAG A;  3NGI A;  4E7L A;  3SQ1 A;  4DSJ A;  3HPG A;  1HJR A;  4CGJ A;  1EXQ A;  1SL2 A;  1NK4 A;  2OA8 A;  1EET A;  1SKS A;  1W9H A;  1D5A A;  3CYM A;  4J2B A;  1S9E A;  1KLM A;  4MFB A;  2G8V A;  4BDP A;  3IS9 A;  1NK9 A;  4CEO A;  3DLG A;  3SQ2 A;  2EX3 A;  3C94 A;  4B9N A;  3PX6 A;  4J2E A;  4CEQ A;  4NCB A;  4DTU A;  1TK5 A;  3OYD A;  3AO5 A;  1UWB A;  3SQ4 A;  5K14 A;  4I2P A;  4ELT A;  4IBN A;  4W5O A;  3SJJ A;  3CM5 A;  3DM2 A;  3BDP A;  3ZT4 A;  3KJV A;  1EX4 A;  1J9A A;  4CJQ A;  2DTU A;  4PQU A;  2RKI A;  2HHT A;  2ZD1 A;  5KRT A;  1RBV A;  4CEZ A;  4E7H A;  4KPY A;  4N47 A;  3TWH A;  5KGW A;  4FLT A;  3HP9 A;  3HP6 A;  1HYZ A;  1Q9X A;  1RIL A;  2HNY A;  4FLY A;  2G8K A;  1X1P A;  1L5U A;  4G1Q A;  1J5O A;  4M3X A;  1LW2 A;  3OYA A;  1C0T A;  1KTQ A;  3HYF A;  3RMA A;  4CF9 A;  3RMC A;  1TVR A;  1VSI A;  2B5J A;  3AVM A;  4RW7 A;  1RDB A;  4DFK A;  4FJX A;  4JRP A;  1QTM A;  1JLA A;  1EKE A;  3KKR A;  3V9X A;  4FM1 A;  3T19 A;  2P5G A;  3SPZ A;  1O1W A;  5J2P A;  4R5P A;  2HHS A;  5C25 A;  3KK2 A;  3S3M A;  1U4B A;  5CZ1 A;  4Z4E A;  2IS3 A;  1IKW A;  1RTI A;  4IFV A;  3QLH A;  4DMN A;  3T1A A;  1VSK A;  1K6Y A;  2GBZ A;  4CK2 A;  2OPP A;  3A2F A;  2NUB A;  3O4N A;  1U04 A;  3V1R A;  1RBT A;  4C8L A;  1C1C A;  4HUG A;  1JLQ A;  2DY4 A;  2F96 A;  4HCB A;  1CXQ A;  4DTP A;  2HMI A;  4AIL C;  3QEW A;  3VN5 A;  1QQC A;  4BWM A;  1WSG A;  4ZTJ A;  2XRI A;  2DFF A;  4CIF A;  3RTV A;  1NJZ A;  1QSS A;  1ZBF A;  4CIG A;  4FZX C;  1WAF A;  4DSE A;  3LP1 A;  1T7P A;  1YT3 A;  2BDP A;  3NF7 A;  4E7K A;  3FFI A;  1LAV A;  4FJK A;  2DFH A;  4CHQ A;  4FM0 A;  1VSM A;  3SUP A;  4PWD A;  4F2R A;  3M8Q A;  3OYG A;  1RT1 A;  5DMR A;  3HT3 A;  5CYQ A;  5KRS A;  3AVK A;  4B08 A;  2HW3 A;  4KHW A;  1LWF A;  2YKM A;  3VQP A;  3I0R A;  1LWC A;  4FJI A;  2YKN A;  3LP2 A;  4DG1 A;  3LDS A;  2FC0 A;  3ZSW A;  4NCA A;  4B3O A;  2XY5 A;  2HHW A;  2YV0 X;  1WSJ A;  4ID5 A;  3PX0 A;  3DRP A;  4ELU A;  1VSJ A;  4F3T A;  4BE1 A;  4C8M A;  1NOY A;  4FK0 A;  1ZBH A;  3NH2 A;  1TV6 A;  1RDA A;  3E01 A;  3ZT0 A;  1HQE A;  4I9L A;  2WON A;  2IGI A;  4DFP A;  3SUQ A;  4Y1C A;  3KLH A;  5JS1 A;  2KW4 A;  2Z1G A;  1QE1 A;  1HRH A;  2YNH A;  3ZSY A;  3SV4 A;  4FJJ A;  4DLG A;  1T05 A;  1RTJ A;  2FBX A;  2Z1J A;  3LAL A;  4CES A;  3ZSX A;  3PV8 A;  3WNF A;  2IOC A;  3RR8 A;  3VA3 A;  3TAQ A;  2BGG A;  1JXB A;  3LPU A;  3NHG A;  3OYC A;  1Q9Y A;  3AVN A;  1HPZ A;  2HNZ A;  4CGG A;  1UA1 A;  5HRR A;  4CHY A;  4KB0 A;  2Q3S A;  4KTQ A;  3SCX A;  3OJS A;  1JLG A;  1WNS A;  3DRR A;  1TK0 A;  3NGZ A;  3AA4 A;  1Q8I A;  3ZSQ A;  2QXF A;  1RNH A;  2OPR A;  3M8P A;  1I3A A;  4W5T A;  5HLF A;  1C0U A;  2GV9 A;  4FCY A;  2OPS A;  4CGI A;  1L3V A;  4CFB A;  3TAM A;  2GUI A;  1KVA A;  2X78 A;  4CE9 A;  3PY8 A;  3K5L A;  1S9G A;  4CK3 A;  2VG7 A;  4FW2 A;  3AVL A;  3MXM A;  3CG7 A;  1X9W A;  1HQU A;  3LZI A;  5FRN A;  5SZT A;  3PO5 A;  4FJ9 A;  4KAZ A;  3O3F A;  2OYQ A;  4MQ3 A;  1EP4 A;  4CHN A;  2KFZ A;  3CQ8 A;  1BIZ A;  1JLC A;  2B6A A;  1BGX T;  1J54 A;  1S1V A;  3MEE A;  4M45 A;  4CGF A;  1UAX A;  4CJE A;  4OKE A;  4N56 A;  1KFS A;  2XO7 A;  4FJ7 A;  2G8I A;  3F9K A;  1SUQ A;  3V1Q A;  4FK4 A;  3C6U A;  3KLG A;  1JLE A;  5KI6 A;  2P1J A;  1T03 A;  3QO9 A;  3VQE A;  3K57 A;  1BQN A;  3VQ6 A;  3OYB A;  3KK1 A;  3P1G A;  4DLE A;  3SQ0 A;  3C6T A;  3AA3 A;  4DTJ A;  3TAN A;  1DLO A;  3NBP A;  3KD1 E;  4F4K A;  2KZZ A;  3V6D A;  4W5Q A;  1L3U A;  4HHT A;  4CJL A;  4M3U A;  3AVI A;  4IKF A;  1CXU A;  4JS5 A;  4I9Q A;  3P5J A;  4UQG A;  2VWJ A;  4FLZ A;  3G0Z A;  4GVM A;  5J1E A;  1HNI A;  2DFE A;  3NFA A;  2VG5 A;  4FJH A;  1ZBI A;  1VSL A;  3SUO A;  4FLW A;  1KSP A;  1C1B A;  4Z4G A;  4QOZ B;  4CF0 A;  3SUN A;  3K5O A;  4DQR A;  4N76 A;  2W42 A;  4O4G A;  3DLE A;  5FDL A;  5DK5 A;  4LSL A;  4M42 A;  1NK5 A;  3K5N A;  2Y1I A;  3PO4 A;  3ALY A;  4W5R A;  1NK8 A;  3V9Z A;  4C8K A;  1RDD A;  1NJY A;  1F21 A;  3T3F A;  3L2W A;  4DQI A;  4OGC A;  4Z0U A;  4CJ5 A;  4M41 A;  4IDK A;  4KO0 A;  4E1M A;  4KHN A;  3HJF A;  4RG8 A;  2KFN A;  3RR7 A;  4ICL A;  3DOK A;  1RT3 A;  3KLE A;  4OLB A;  1TKD A;  1JXE A;  4ZHR A;  3CFO A;  4I7F A;  3QIN A;  5HRS A;  4O0I A;  4FM2 A;  1GOB A;  3MEC A;  3WNE A;  4CHZ A;  3DLR A;  3NH1 A;  4CER A;  3QER A;  3U3Y A;  3OYJ A;  4RW4 A;  4FJN A;  4CED A;  4RW9 A;  3SZ2 A;  1ASW A;  3QEP A;  1TAU A;  4PY5 A;  3AO4 A;  1KVC A;  4NYF A;  4FJG A;  4OKJ A;  1WSF A;  1C6V A;  3G10 A;  4FLU A;  3LWM A;  1ZBU A;  2FBT A;  1X9S A;  1GOC A;  4E1N A;  1W0H A;  3RWU A;  4DSL A;  3AVH A;  3NDK A;  4Z4I A;  4PA1 A;  2A1S A;  4BDY A;  4DTX A;  2XHB A;  2QKK A;  4CEB A;  4K8X A;  1IO2 A;  1BCM A;  3TAF A;  1D8Y A;  2E6M A;  4DTM A;  4F2S A;  3LAM A;  1JLB A;  4AHR A;  4F3O A;  4OKK A;  4CGD A;  1WLJ A;  1RT6 A;  4AH9 A;  1CLQ A;  1VRT A;  1IKV A;  3L2R A;  2D5R A;  5E41 A;  3JSM A;  3VA0 A;  4OPJ A;  1XHZ A;  3TR8 A;  3PUF A;  1CZ9 A;  2PYL A;  3VQ4 A;  4QCL A;  4CEE A;  3DOL A;  3AVF A;  1NOZ A;  3WNG A;  4Z4H A;  4KHS A;  3JYT A;  2ZE2 A;  3QET A;  3MAQ A;  1A5V A;  2HHU A;  3HPH A;  4OPK A;  3AO2 A;  3S3O A;  2F8T A;  3V1O A;  3TAP A;  1XHX A;  1U48 A;  2PZS A;  1IKY A;  3K59 A;  4DU4 A;  4B9S A;  4B9V A;  2I5J A;  4RW8 A;  3IRX A;  4RW6 A;  1T8E A;  5JS2 A;  4B8C A;  4BE2 A;  4TSX A;  1SL1 A;  3DYA A;  3ZSZ A;  2YNI A;  3AO3 A;  2D0B A;  4CFD A;  3V9S A;  3MXI A;  3VQC A;  4E3S A;  1TKX A;  4CJW A;  1NKE A;  1NK6 A;  4EP4 A;  1HNV A;  3U3G A;  4YNQ A;  1X9M A;  4O5B A;  5C24 A;  3VQ9 A;  5I3U A;  2ZQB A;  3VQA A;  4IG0 A;  4CFA A;  4OVL A;  4LH5 A;  4CHP A;  3OYL A;  3QNN A;  1KLN A;  4AHC A;  1SKW A;  4DFJ A;  2IC3 A;  1N5Y A;  3DLH A;  1NKB A;  2XY8 A;  3TAR A;  1NJW A;  4FYD A;  1B9D A;  2E4L A;  2LSN A;  5T7B A;  3V9U A;  4AHU A;  1ITG A;  3LAK A;  1BIS A;  4LSN A;  4M3Z A;  1C1A A;  3ZSV A;  2QKB A;  3TAB A;  3AVC A;  4FVM A;  1U49 A;  4CCH A;  4NYN A;  3KKS A;  2X74 A;  2P5O A;  2X6N A;  4KFB A;  3ZSR A;  3ZT1 A;  5HRP A;  2O4G A;  3OYI A;  4DTR A;  2FBV A;  3WNH A;  4DQS A;  3QEV A;  2VWK A;  3L3V A;  4KKO A;  4Z4C A;  5EU7 A;  1BHL A;  2X6S A;  1U47 A;  4ELV A;  3QIP A;  3HVT A;  4M3Y A;  1S6P A;  1XWL A;  4BWJ A;  2IAJ A;  1KVB A;  3L2U A;  2E6L A;  3K58 A;  1D9F A;  4HCC A;  1RT5 A;  4PUO A;  1SKR A;  3HK2 A;  4E89 A;  3OJU A;  4O0J A;  4CJV A;  3IAY A;  1QS4 A;  3VQQ A;  2RPI A;  2D0A A;  4IFY A;  3AA5 X;  1ASV A;  1WSI A;  4K8Z A;  4CIE A;  3SI6 A;  4GMJ B;  1J53 A;  4N41 A;  4AHT A;  1S5J A;  1BI4 B;  4DTN A;  4O44 A;  1B92 A;  3U6F A;  4B9T A;  3NGY A;  3ZT3 A;  3AV9 A;  2OPQ A;  1VK0 A;  3OYK A;  3OS2 A;  4DTO A;  3B6O A;  1LV5 A;  3TAE A;  4KHQ A;  2HHX A;  1FXX A;  4F8R A;  1RCH A;  4LD0 A;  3QNO A;  1YTA A;  1VSE A;  1C0M A;  1LAW A;  3SPY A;  3VQD A;  3RMD A;  3QEI A;  1RBU A;  4Q5V A;  4FZZ A;  4B9M A;  4DQP A;  1BQM A;  4C8N A;  3NCI A;  2QK9 A;  3UIQ A;  3I0S A;  1TL1 A;  2HVI A;  5D3G A;  4HVJ A;  4H8K A;  3SV3 A;  4LY7 A;  2KTQ A;  1WSH A;  2B4J A;  5SWM A;  4CEC A;  4DQQ A;  3V9W A;  3I8D A;  2P51 A;  3O4Q A;  4HUF A;  4CEA A;  1NJX A;  4FZY A;  5J2N A;  2HHQ A;  4FJM A;  1UOC A;  2JLE A;  3HST B;  4N5S A;  3LP0 A;  4O55 A;  4DSF A;  3LAN A;  3CFR A;  5HBM A;  3RMB A;  2HVH A;  1KFD A;  1KRP A;  4E7I A;  1RTH A;  1Z26 A;  4OLA A;  3OS1 A;  4KRE A;  3RRH A;  3DMJ A;  3NF9 A;  1S1W A;  2EHG A;  4CJF A;  3OYM A;  5KGX A;  2G8F A;  4M3W A;  3DLK A;  3V4I A;  1B9F A;  1RBS A;  5CY4 A;  2O4I A;  1R0A A;  1G15 A;  3LWL A;  2XY6 A;  4Y1D A;  2YHA A;  3LPT A;  3QIO A;  4BDZ A;  4E0D A;  4EZ6 A;  4M3T A;  2HHV A;  1S1U A;  3AVJ A;  1VRU A;  1RDC A;  1BI4 A;  4CGH A;  3O3H A;  3TI0 A;  4EP5 A;  3IG1 A;  1U45 A;  1D9D A;  4CJS A;  3NAE A;  4Q0B A;  4KTW A;  1A5W A;  3OYF A;  4DF4 A;  4KRF A;  3HXM A;  1RT2 A;  3K5M A;  2OZS A;  1L3S A;  4DWI A;  4YFU A;  4HUE A;  3PX4 A;  1JLF A;  3AVB A;  3NE6 A;  4DU1 A;  3VQ5 A;  1TKZ A;  4HTU A;  3S3N A;  2A1R A;  5CZ2 A;  4DSK A;  4KB1 A;  5FRM A;  4JS4 A;  2G8H A;  4FK2 A;  3HO1 A;  1VSF A;  3M8S A;  1NK7 A;  3VQ7 A;  4CJ4 A;  1RBR A;  2ATQ A;  2YNF A;  3SNN A;  1IG9 A;  2RN2 A;  1RTD A;  1VSD A;  4CJT A;  3NF8 A;  2OZM A;  4Z4F A;  1S6Q A;  4FXD A;  3M8R A;  1WN7 A;  1FKP A;  1BIU A;  1NK0 A;  3NH0 A;  3ZT2 A;  1TGO A;  4DTS A;  1WAJ A;  2AJQ A;  3HVR A;  1ZBL A;  1A5X A;  2G8U A;  4KV8 A;  5CYM A;  2BE2 A;  3LP3 A;  3L2Q A;  3AO1 A;  3AVA A;  4W5N A;  4CF1 A;  3HM9 A;  5I42 A;  3AVG A;  4J2D A;  3MED A;  2RF2 A;  3OS0 A;  3OYH A;  4JLH A;  4OJR A;  2XY7 A;  4KI4 A;  1QSL A;  4CJ3 A;  2BAN A;  1DTQ A;  3C95 A;  4AHS A;  3ZSO A;  1YVU A;  2Z1H A;  4B8A B;  4C8O A;  3THV A;  1I39 A;  4CK1 A;  2WOM A;  3EYZ A;  4B9L A;  3OVN A;  1RT4 A;  4M3R A;  4DU3 A;  3V81 A;  1NKC A;  2G8W A;  2PYJ A;  3CFP A;  4EZ9 A;  4FJ5 A;  1BCO A;  1SV5 A;  1L3T A;  4FLX A;  4CFC A;  4KHY A;  3MXJ A;  4CF8 A;  1GOA A;  1IKX A;  1JL2 A;  1FKO A;  3VQ8 A;  1LW0 A;  1VSH A;  1Y97 A;  1TKT A;  4NCG A;  4FLV A;  4DS4 A;  5HRO A;  3H08 A;  1QSY A;  5HP1 A;  3O3G A;  3ISN C;  1WSE A;  4I2Q A;  1N6Q A;  4H4M A;  4DS5 A;  4DF8 A;  3SYZ A;  3OY9 A;  3P83 D;  2HB5 A;  4CEF A;  2VG6 A;  4E19 A;  4J2A A;  3KTQ A;  3B6P A;  4KHU A;  1CZB A;  1JL1 A;  5J2M A;  4WE1 A;  4H4O A;  3QEX A;  1HYS A;  3NF6 A;  1XI1 A;  3EY1 A;  2IDO A;  2PY5 A;  1IH7 A;  4L8R B;  2ITG A;  4FJL A;  3TAG A;  2KZM A;  1HYV A;  4CHO A;  4JRQ A;  1SL0 A;  3HPO A;  3ULD A;  1FK9 A;  1YTU A;  2JGU A;  4CF2 A;  1TAQ A;  3ZCM A;  5KTQ A;  4CJK A;  3OYN A;  1Z25 A;  2D0C A;  2R7Y A;  2YHB A;  5C42 A;  4CJR A;  1REV A;  4GW6 A;  1JKH A;  3KLI A;  4AHV A;  3DI6 A;  4CJU A;  3KK3 A;  1UA0 A;  5J2Q A;  2KQ2 A;  4LH4 A;  3LZJ A;  3D0P A;  1DTT A;  2Z1I A;  2FBY A;  3VQB A;  3KLF A;  2F8S A;  3L3U A;  2ETJ A;  3KIO A;  1ASU A;  1S1T A;  4KI6 A;  3K2P A;  4FJ8 A;  1QHT A;  3L2V A;  3ASM A;  1HMV A;  1TL3 A;  3ITH A;  3HL8 A;  3BGR A;  3D45 A;  3QES A;  3DRS A;  2YNG A;  3EZ5 A;  1MU2 A;  1ZYQ A;  4B9U A;  3S9H A;  2Y1J A;  4IG3 A;  3CM6 A;  4KTZ A;  3F73 A;  1BL3 A;  1RT7 A;  4ID1 A;  4CJP A;  3DLB A;  4DSI A;  1TK8 A;  1KCF A;  4BE0 A;  4E7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...