4CIEA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
152
structure length
146
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cieA00
1VSKA 1XWLA 3B6OA 4HCBA 4B08A 1VSFA 3OY9A 1WSIA 2YNGA 2B6AA 3DM2A 1NK7A 3OS0A 1WAJA 4DLEA 3KTQA 4KV8A 3HK2A 3I0RA 4CK2A 3TI0A 4KKOA 1S6PA 4CIGA 3O4NA 4AHRA 3DLEA 2P5GA 3QESA 2FBXA 3MECA 1BIUA 3L2WA 4CJUA 1BIZA 3L2UA 5CY4A 3CQ8A 3AA3A 4FLZA 1T05A 5J2NA 5J1EA 4KHUA 2F8SA 1IG9A 4B9LA 2WONA 1B92A 3AA4A 4F3TA 1UA1A 3KLIA 2XY8A 3RTVA 3OYHA 3O3FA 3HVRA 3ASMA 2VG7A 4M42A 4J2DA 2X6NA 1RILA 3DRPA 3HL8A 1D9FA 4ICLA 2GV9A 4CECA 3IAYA 3AVFA 3FFIA 1LWEA 2RKIA 4IG3A 1VRTA 4H4OA 2IOCA 4FJMA 1IKWA 3ZT0A 3ZSRA 3AVIA 2JLEA 3RMAA 1REVA 3TANA 4ELUA 3CG7A 3VQQA 3SJJA 1Y97A 3AO1A 4HTUA 4FLUA 1TKDA 4M41A 4E19A 3SV4A 3SI6A 1NK0A 1J5OA 1T7PA 4LY7A 4KI6A 4PWDA 4FJ8A 4YFUA 1A5VA 3OYAA 4J2EA 3NDKA 1Q9YA 3PO5A 3NGYA 1JKHA 5FRMA 4OGCA 4QCLA 3IS9A 5CZ2A 4FYDA 3AA5X 1C0UA 5I3UA 3B6PA 4B9MA 4PA1A 4OVLA 4M45A 1BCOA 1CZ9A 1RDCA 1TL3A 4DMNA 3V9XA 4FZYA 1S9GA 4OJRA 1RDBA 3NH2A 3LP1A 4F8RA 2EHGA 1J9AA 2P5OA 3PX4A 1HYZA 1WSHA 2E4LA 2OPSA 1VSDA 3SV3A 3TABA 3QO9A 3NCIA 3SQ4A 4MQ3A 3ZT3A 4CJPA 3DLHA 4Q0BA 4M3TA 4OKEA 3LAMA 3RMCA 4CFAA 4JS5A 2YKNA 4DFMA 1LAVA 3HO1A 4IDKA 5FDLA 1EKEA 3KD1E 1NJWA 4H8KA 4JRQA 2DFEA 3KK1A 2G8FA 3L2QA 5HP1A 3LANA 3TARA 1HMVA 3TR8A 1DTTA 3HYFA 2E6LA 4RW9A 1SKSA 3ZSXA 3EZ5A 1IH7A 4BE1A 1HYSA 4FLTA 4NCBA 3QETA 1VSJA 2IC3A 4CJVA 1HQEA 4CGFA 4CEEA 2Z1HA 1X9WA 2O4GA 1NKBA 2HNDA 4M3RA 1TKTA 4O44A 4KAZA 4NCGA 4W5RA 1ZBHA 3V9ZA 4BE2A 4DWIA 4HCCA 1RT3A 4DF8A 2Y1JA 4DG1A 3ZT1A 3JYTA 3OYDA 4FLYA 3ZSZA 4CESA 3QIPA 1EETA 4IFYA 1MU2A 4AHSA 1W9HA 3KLHA 1WAFA 1BQNA 1JLCA 3HSTB 3K58A 3HJFA 3CYMA 3EY1A 3F73A 1IKVA 4O0IA 3L2RA 3PO4A 5D3GA 2R7YA 2AJQA 4KTZA 4KRFA 3NF9A 3C6UA 3DOLA 3VQAA 3KLEA 2A1RA 2OA8A 4KTQA 3LWLA 4M3YA 1CZBA 1C1CA 3V1OA 1RT2A 2G8KA 2Z1IA 3TAQA 4Z4CA 4LH5A 4F4KA 3LPUA 2GBZA 3OYBA 3RRGA 3OYEA 4JS4A 3TAFA 2DFFA 1RBTA 3VQ6A 1VSLA 4KPYA 1RBRA 3KIOA 4O0JA 4W5OA 4DTNA 1F21A 4DQRA 1WSEA 4GVMA 1K6YA 3O4QA 4KHQA 4B8CA 3SPYA 1WSFA 2I5JA 4DTMA 4EZ9A 3LDSA 1KFSA 3RRHA 3QEWA 1LV5A 3G10A 4R5PA 4CK3A 3LZIA 4FJLA 3MEEA 2OPQA 2XHBA 1BI4A 1TL1A 4CJRA 4FJXA 4C8OA 4JLHA 3O3GA 4C8LA 1NKCA 3TAMA 2FBTA 2RF2A 1FKOA 1J53A 4FJHA 4Q5VA 3P5JA 1DTQA 1KLNA 4CGHA 1YVUA 3OYIA 3V9UA 3VA0A 5J2PA 4FJKA 3ULDA 4Z4IA 2HNZA 4TSXA 4CEFA 4DS4A 2DY4A 2OYQA 3ALYA 4MFBA 5KGXA 1RTIA 3DLGA 4I9LA 1XHXA 3SNNA 3OYKA 4HVJA 2HNYA 3DLRA 1HPZA 3DLKA 2IAJA 4BWMA 5J2MA 3PX6A 3NE6A 1T8EA 3ZSVA 1L3VA 5HRNA 1D8YA 4Z4FA 2F8TA 2QKBA 2P51A 4CJQA 2VG6A 1TAQA 4CE9A 3NH0A 2YV0X 2IS3A 4G1QA 1LAWA 3WNHA 3AVBA 4Z0UA 2B4JA 3HPOA 4DTOA 4E7JA 3QEVA 1NK4A 3V9SA 2OZMA 1TV6A 4PY5A 3U6FA 2HHQA 2Z1JA 4F3OA 4B9VA 3U3GA 4RG8A 1NJZA 3NFAA 4WE1A 3SUPA 3I8DA 1RT4A 3O3HA 1Q9XA 2X78A 4FK4A 5DMRA 1ASVA 4KO0A 4O55A 1C1BA 3QIOA 5K14A 1G15A 4CIFA 3AVMA 1BHLA 1I3AA 1BCMA 2F96A 3K5LA 4B9TA 1S1WA 2ETJA 4DTPA 4DQPA 1RT7A 3OS1A 1Z25A 4LH4A 3SPZA 3DMJA 1KSPA 4FK2A 2GUIA 3SYZA 4FLXA 3D45A 3AV9A 4YNQA 3TAEA 1QS4A 4BDZA 1C1AA 4AHTA 4BACA 1NJYA 2G8UA 2HMIA 1EP4A 4CJ3A 3HPGA 2D0CA 3SUOA 4FM2A 2ITGA 5HRPA 1YTUA 3LP2A 4E3SA 3K5NA 4PQUA 3ZT4A 4CGIA 2VWKA 3DOKA 3OYCA 3KK3A 4CCHA 5SWMA 4CFCA 3M8RA 1JLQA 4KFBA 1CXUA 3T19A 4OPKA 4ID5A 1ZBFA 4L8RB 1SKRA 5DK5A 1BQMA 4RW6A 1LW2A 2OZSA 1I39A 5SZTA 3HXMA 2G8WA 3AVCA 5KI6A 4CEBA 3CM6A 3V81A 1ASUA 3TAGA 1X9MA 5T7BA 4FVMA 4J2AA 1HNVA 3LWMA 2W42A 1VSEA 4CHNA 3RMBA 4M3WA 3M8QA 3KD5E 4E1MA 4DFJA 4QAGA 4FJIA 5JS2A 1QQCA 1KTQA 1U48A 5JS1A 2HVHA 4E89A 3CFOA 1HNIA 4M3ZA 2HW3A 1U4BA 3JSMA 3SZ2A 4FM0A 3L8BA 1JLBA 2HB5A 1S9EA 3AA2A 2XO7A 3V4IA 2XY6A 1KRPA 4W5TA 3QERA 1U47A 4I2PA 2YNHA 4OLBA 3PUFA 3C94A 2BGGA 3AO4A 4C8MA 3OJSA 5KRSA 2QXFA 2FBVA 1ASWA 2YNIA 4CF9A 4BWJA 3SUNA 3SQ0A 1TK8A 3C6TA 1EXQA 1RCHA 3QINA 4ID1A 4OKKA 2PYJA 4KHYA 4O4GA 4DTJA 4OLAA 3PX0A 4FCYA 4GMJB 3MXJA 4KTWA 3U3YA 4Z4GA 5HLFA 4B9SA 3DI6A 4DQQA 3VQDA 4UQGA 3QNNA 1SKWA 3AO2A 4DTRA 1BGXT 3V1RA 4KHSA 5C25A 3CFPA 2QKKA 2G8IA 2G8VA 3VQCA 1KVBA 5E41A 2YKMA 1GOAA 4N56A 4NYNA 3NBPA 4I2QA 4RW8A 3ZSQA 4M3UA 1BL3A 3WNGA 4CEDA 1EX4A 4CF8A 4CGJA 1Z26A 4O5BA 4ELVA 3RWUA 4FXDA 4QOZB 2WOMA 1JXEA 4FW2A 2D0BA 4H4MA 4FJNA 4E1NA 2X74A 1VSHA 3QEPA 2FBYA 1DLOA 3NGIA 1TGOA 4ZHRA 4F2RA 1VSIA 2DTUA 1JLEA 3LZJA 3AVKA 2XY5A 4AH9A 2BANA 3S3OA 4IG0A 1S5JA 4CHQA 1NJXA 3IG1A 1SL0A 2Y1IA 4PUOA 3M8PA 1UAXA 4OKJA 4EP4A 3AO3A 4M3XA 1HJRA 1RT5A 3HPHA 1CXQA 3AVJA 3LAKA 1ZYQA 4DQIA 1RTJA 3EYZA 1A5XA 5I42A 4LSNA 5FROA 1L3TA 4CF2A 2ZD1A 2ATQA 1XHZA 1TAUA 1HQUA 2IGIA 4OGEA 4ELTA 2ZE2A 3CM5A 2HHTA 1KFDA 1RT1A 3K2PA 1QE1A 2G8HA 1B9DA 4FJ5A 3L3VA 3OJUA 4CJFA 4AILC 3LALA 3H08A 1CLQA 5CZ1A 1L3UA 4EZ6A 4FJ7A 1VRUA 1KVAA 4AHCA 4CEQA 4FJJA 1LWCA 5CYQA 4FJ9A 3I0SA 1LW0A 3BGRA 4FW1A 4DSJA 4KHNA 2HHVA 4FLVA 3K5MA 3SUQA 2BDPA 2ZQBA 1RBSA 2KZMA 3K5OA 4N47A 1C0TA 4DSFA 4FK0A 1S1TA 1JXBA 1L5UA 1IKXA 1UA0A 4CK1A 4BDYA 4Z4EA 3S3NA 3V6DA 4RW4A 4CHOA 4DFPA 1IO2A 2PZSA 4NCAA 3VQ9A 3NF6A 4E7LA 3VQEA 5EU7A 3T3FA 1TVRA 3VQPA 2FC0A 4E7HA 4CHZA 3PY8A 4CJEA 4K8XA 4XIUA 1RTDA 4AHVA 4CJ4A 2XY7A 4IKFA 2EX3A 2X6SA 1NK5A 3PV8A 1WN7A 4IFVA 1TK0A 1NK8A 2KFZA 3OVNA 4HUEA 4CJKA 2OPPA 4KREA 5KRTA 1RBUA 1S6QA 3VQ4A 3KLFA 1XI1A 3TWHA 4HHTA 4DSIA 3DLBA 4DS5A 4DU4A 4N41A 4KHWA 4Z4HA 2PY5A 3V1QA 1D9DA 1U45A 3ITHA 3AO5A 4NYFA 2IDOA 4DTUA 4CJLA 1C6VA 4LSLA 3THVA 3HVTA 1JLGA 4FM1A 2JGUA 3RMDA 3P1GA 2VWJA 3SCXA 1RDAA 3MXMA 1XC9A 2E6MA 4CJWA 4CEZA 4CFBA 3QNOA 3HT3A 4ZTJA 1TKXA 3IRXA 4JRPA 1WSJA 5HBMA 3VQ5A 3K57A 2NUBA 3NF7A 4C8NA 3NH1A 1X1PA 3QEXA 2PYLA 1VK0A 1LWFA 3OYFA 2KZZA 2A1SA 3NGZA 4KB0A 4CIEA 4FLWA 4E7KA 4Y1DA 1JLAA 2LSNA 3MEGA 4CJSA 3KJVA 1QTMA 4OPJA 3L3UA 3DRRA 4DU3A 2DFHA 4HUGA 3MEDA 3LP0A 4CF1A 4CERA 3NHGA 1T03A 2O4IA 1WSGA 3ISNC 5C24A 1QSYA 2P1JA 4CFDA 1U04A 3VQ8A 1TK5A 4B9NA 2HHSA 4C8KA 3KKSA 4BE0A 1GOBA 1GOCA 2HVIA 2KW4A 1NOZA 4CEOA 3S3MA 2D0AA 3RR7A 2HHUA 4E7IA 3ZSYA 3QLHA 4CJTA 3LP3A 1QHTA 4EP5A 3OYNA 4CEAA 1RBVA 3DYAA 1N6QA 4W5QA 4CHPA 1ZBIA 4DFKA 4DTSA 3M8SA 1SV5A 3WNEA 1KLMA 4DTXA 1X9SA 2HHXA 4B9UA 4GW6A 1VSMA 3OYJA 4BDPA 4E0DA 3S9HA 1J54A 3AVHA 4ZTFA 5FRNA 4DSLA 3T1AA 4KI4A 3HP9A 1N5YA 5KTQA 3OYGA 1S1VA 1UOCA 3NF8A 2BE2A 3AVLA 4CF0A 4CGGA 1NK6A 2YNFA 3UIQA 1RDDA 2VG5A 1NOYA 4W5NA 4FJGA 3BDPA 1W0HA 3P83D 2KFNA 3VQ7A 3OYLA 3ZCMA 1IKYA 1B9FA 1RTHA 1FXXA 1WNSA 3KKRA 1TKZA 1RT6A 3ZT2A 3TAPA 4FZZA 4AHUA 2XRIA 1SL1A 1NK9A 4HUFA 5HRRA 2YHAA 5CYMA 1RNHA 1ZBUA 4DSEA 4CJ5A 1KCFA 2QK9A 3F9KA 5C42A 2Z1GA 3KLGA 3ZSWA 2RN2A 1QSSA 5KGWA 3MXIA 3AVAA 4RW7A 1SUQA 3RR8A 2KQ2A 5J2QA 1A5WA 3K59A 3SQ2A 1R0AA 4N76A 3C95A 4DF4A 3AVGA 4F2SA 1QSLA 1Q8IA 3HM9A 2HHWA 1D5AA 3SQ1A 4Y1CA 3E01A 3HP6A 1KVCA 1SL2A 4DU1A 3CFRA 1HRHA 1JLFA 4IBNA 3VA3A 3QEIA 4J2BA 1UWBA 4B8AB 3VQBA 1FK9A 3VN5A 4DLGA 3G0ZA 1JL2A 2B5JA 3WNFA 4CGDA 1YTAA 1JL1A 1FKPA 1O1WA 4I7FA 3OS2A 4DQSA 5HROA 1U49A 4FZXC 3MAQA 1L3SA 3LPTA 3A2FA 3D0PA 1ZBLA 1HYVA 1ITGA 3AVNA 4N5SA 3V9WA 3OYMA 3NAEA 3DRSA 2Q3SA 4LD0A 4K8ZA 1BI4B 1NKEA 4KB1A 4CHYA 4I9QA 4B3OA 5HRSA 2D5RA 1WLJA 2KTQA 2OPRA 1BISA 1C0MA 2RPIA 2YHBA 3L2VA 1S1XA 1S1UA 4DSKA 3KK2A 3ZSOA 1YT3A
chains in the Genus database with same CATH superfamily
1VSKA 2YNGA 1NK7A 4WQ5C 4DLEA 3CC7N 4B3TK 4DV4K 3HK2A 4IXCA 1XC3A 3DLEA 1BIZA 4JD2B 1YVNA 2GELA 1T05A 4KH6A 4QS9A 5AQSA 5J1EA 4KHUA 1IG9A 1BG3A 2WONA 3MN6A 3MWPA 4R79A 1UA1A 3IMXA 4F3TA 3CCEN 4FWLA 3HVRA 1WB9A 1K73O 1D9FA 3FFIA 2IOCA 3HOTA 4FVUA 3GDQA 4ELUA 2W40A 4H5NA 3SJJA 3AO1A 1NK0A 4HTUA 4E19A 1J5OA 1WUAA 3UKRA 2UU9K 1T7PA 3B8AX 4LY7A 2NRXA 4PWDA 3CIPA 1V4SA 1KD1O 5AQJA 3AGRA 4J2EA 3LM2A 3NDKA 1Q9YA 3THWB 4DR4K 5CZ2A 3AA5X 4PA1A 2P9UB 2PAVA 4OVLA 4DMNA 1TL3A 4AM6A 3HBTA 2NRVA 3LP1A 2P5OA 2WUSA 1W97L 1T6DA 3ZT3A 4CJPA 3DLHA 5ADXH 3CMEN 4Q0BA 3MN5A 3UKUB 1C0GA 2YKNA 3QDKA 4IDKA 4GNIA 3RSEA 4H8KA 4JRQA 1DT9A 2NRHA 4F9OA 3L2QA 1DTTA 3P31A 1IH7A 1HYSA 4NCBA 3QETA 1VSJA 3C0BA 4M7XA 1HQEA 4CJVA 5GAGP 2Z1HA 4A5AA 3J81O 2HNDA 3ZX0A 4O44A 2HBLA 2QW9A 4DQ8A 1YUWA 2UUCK 4YY3K 1YITN 1VQ5N 3ZT1A 3O9QA 2E88A 4CESA 2E2OA 2QXLA 1W9HA 3HSTB 3HJFA 1IKVA 3L2RA 2GX9A 4H5VA 4I6MB 3NF9A 2A1RA 4KTQA 1CZBA 1JCFA 2GBZA 3SK3A 5F0XA 1DKGD 3OYEA 4JS4A 3VQ6A 4JHDB 1N8RO 3UE5A 4H5WA 1WSEA 3IDHA 2I5JA 3CJAA 3CXCM 4DTMA 3RRHA 4K42A 5GIOA 1P8ZA 3FZFA 3G10A 1LV5A 4CK3A 4JI5K 2FSNA 1Q86O 3E9PA 1QQNA 1WBDA 4JLHA 4C8LA 3CMAN 5C2FA 3TAMA 1NKCA 1FKOA 1YAGA 3U9DA 4H0VB 3TTCA 4Z4IA 3VA0A 1HPMA 2HNZA 4TSXA 4DS4A 4WYBA 2OYQA 3T69A 2IVPA 5KGXA 1RTIA 3DLGA 4I9LA 1XHXA 3EZWA 4A61A 2HNYA 1HPZA 2V51B 2QKBA 3NE6A 1D8YA 1KAZA 4CJQA 2VG6A 1TAQA 3NH0A 2IS3A 3U6FA 2Z1JA 4RG8A 5AQOA 4WE1A 2X78A 3BF1A 5K14A 1GLFO 4EHUA 1BHLA 5IWAK 3K5LA 1FJGK 4B9TA 1S1WA 2ETJA 4DQPA 5AQKA 1J6ZA 4FK2A 4LH4A 3H6EA 2A40A 3SYZA 5JMVA 4YNQA 3TAEA 4AHTA 4BACA 5KPTA 3OW2M 5M1PA 4FM2A 1CZAN 4KHPK 4PQUA 1MA9B 2YI1A 3ZT4A 3HRGA 1SKRA 1I39A 3HXMA 4A62A 2G8WA 3AVCA 3TAGA 5T7BA 4FVMA 2W42A 5H1SQ 1HKCA 2UUAK 3R6MA 5JS2A 1KTQA 4E89A 3CFOA 2HW3A 3SZ2A 2Q1NA 2HB5A 2XY6A 4W5TA 3QERA 4OLBA 3AY9A 4FOEA 5KRSA 1C0FA 3SQ0A 1ASWA 1Y64A 4JYAK 4ID1A 4JKDA 4KHYA 4JK8A 4DTJA 4Z4GA 4B9QA 4DQQA 2E20A 2ASMA 3VQDA 3AO2A 3H1QA 3O1BA 3CJCA 3THXB 2QWQA 2V52B 2JWKA 2G8IA 1KVBA 2YKMA 1GOAA 3KHYA 4IOCL 2ZF5O 4NYNA 4I2QA 4RW8A 3GG4A 1BL3A 3WNGA 5FLXO 4QOZB 3RWUA 4FWOA 4H4MA 3VEYA 2OANA 1K8AO 4E1NA 1VSHA 1GLDG 2FBYA 4F2RA 1MDUB 2J4RA 5KQDA 4FWPA 4CHQA 2Y1IA 4PUOA 3M8PA 3AO3A 5DM7L 3FR0A 4IEIA 1ZYQA 3CQXA 1A5XA 4BREA 5FROA 4FWNA 4ISFA 4DUYK 3ZEUB 2ATQA 2IGIA 5JICA 3C65A 1QE1A 1B9DA 3H46O 3L3VA 3H08A 3C7NB 1E4GT 3TTDA 5KPZA 4DSJA 2HHVA 2ZQBA 1RBSA 4N47A 2HBMA 5FPEA 1JXBA 4A57A 1UA0A 4LFCK 3S3NA 4GKJK 4DFPA 1IO2A 3NF6A 3VQEA 4BRCA 4CZMA 5LMNK 4B1UB 1XUPO 1S22A 1RTDA 2GUPA 2XY7A 2X6SA 1NK8A 2KFZA 1BDGA 1HNWK 4JKBA 4KREA 5KRTA 1XI1A 1EQYA 4DU4A 2PY5A 3V1QA 4MO5A 3BZCA 5AQHA 3AO5A 1QHAA 4FOIA 3SAFA 3U8XA 4NXMK 3SMSA 1C6VA 3WT0A 3RMDA 2JGUA 1RDAA 1XC9A 4CFBA 4DKWA 3HT3A 4DV5K 1TKXA 4JRPA 4ILJA 4C8NA 5AQUA 3G71N 4KB0A 3R9PA 1RGIA 3J7YP 5AQZA 3LP0A 1JCGA 4JNEA 1QSYA 2P1JA 1TK5A 4B9NA 2WC9A 3KKSA 4JV5K 1NOZA 3RR7A 2HHUA 4EP5A 1HNXK 3LP3A 5LL6Z 1RBVA 3DYAA 1E3MA 4DCHA 4DFKA 4DTSA 3M8SA 1SV5A 2HBKA 2HHXA 1NGHA 1RDWX 4PKIA 1VSMA 2QEXN 3SLCA 2V7ZA 2FSKA 4X66K 3UB5A 1GLBG 4WQ4A 2HF3A 4CBUA 1NK6A 2YNFA 3WXLA 1IV0A 3UIQA 1VQ9N 3P4IA 4H0OA 4BRNA 3VQ7A 3OYLA 1NGFA 3OBYA 1RTHA 2ZJPL 1FXXA 3VOVA 5EX5A 3ZT2A 2IVOA 5E26A 4BR5A 4ILHA 1SL1A 4FO0A 1W2BM 4JI7K 1QVFM 5CYMA 2OCEA 3G4SN 3F9KA 4BRIA 2Z1GA 5C42A 3ZSWA 1QSSA 4IDHA 4PL7A 1SUQA 3RR8A 2KQ2A 4DV2K 3SBGA 4WF9L 1WBBA 5AQFA 3AGKA 1Q8IA 3O9TA 3HM9A 4Y1CA 3E01A 3HP6A 2BTFA 1X3NA 1FK9A 4JI6K 2B5JA 4CGDA 3CCQN 2D0PA 4I7FA 4DHYA 3O8MA 1ITGA 3AVNA 3V9WA 4FWSA 2Q3SA 2WBNA 4K8ZA 1NGCA 4KH4A 1BWFO 1C0MA 1OVYA 1XQSC 4KBOA 3L2VA 1S1XA 1S1UA 4DSKA 3ZSOA 5AQGA 2F9WA 5LMUK 4B08A 3OY9A 1Q82O 1JJ2M 3SMPA 2B6AA 4XH5A 4MLEA 4Y0WA 3HI0A 4CK2A 5C10A 1S6PA 5BPLA 4AHRA 1Q18A 2NRWA 1BIUA 2P9SA 1NGGA 5FPDA 1M90O 3AA3A 1TUUA 1EWRA 3JXUA 1NWKA 3ENBA 3ZX2A 4B9LA 3AA4A 4BR0A 2FXUA 3O3FA 4WFNL 2X6NA 5AZJB 4DR1K 4CECA 3KWGA 4HWIA 5LJVA 1ESVA 3AVFA 3IAYA 4IG3A 1VRTA 3WQTA 4FJMA 1IKWA 3FE1A 3ZSRA 4YOVA 2JLEA 3RMAA 3TANA 3VQQA 1Y97A 1TKDA 4M41A 3SI6A 4YOYA 4WQ5A 3FZKA 1BOTO 2ASOA 2KLAA 5C15A 4X65K 3NGYA 5FRMA 3IS9A 2VWBA 3B6PA 3ENHA 4B9MA 2CH5A 4M45A 1CZ9A 3V9XA 1S9GA 3NH2A 3LDPA 2OPSA 3SV3A 2O8DA 1NGEA 3QBWA 4JI1K 4OKEA 1QZ5A 2GWJA 5JVGL 3MX5A 2EWSA 4A2BA 4DFMA 3DXKB 1LAVA 3HO1A 3VF4A 3MN9A 1N33K 2DFEA 3TARA 1HMVA 2V7YA 3M3ZA 3TR8A 4DR5K 2E6LA 4RW9A 2CH6A 1T6CA 2F9TA 4FLTA 3D7EO 4CEEA 2O4GA 2HBJA 5GAHP 3FFKB 1TKTA 4KAZA 1ZBHA 3CI5A 4JKAA 2WTUA 4YDUC 1RT3A 4DF8A 4DG1A 4GY2B 3QB0A 4JI2K 3QIPA 1WAFA 3CJ1A 5D3GA 3PO4A 4KTZA 1NGBA 3VQAA 2H3GX 4JI8K 1C1CA 1NM1A 1RT2A 1HNZK 2Z1IA 2G8KA 3JS6A 1IJJA 3VERA 4YOXA 3TAFA 4KPYA 1RBRA 3E1YA 3KIOA 4O0JA 2WFBA 4DTNA 1F21A 4DQRA 1K6YA 2I7PA 3BZKA 4YOUA 4B8CA 4EZ9A 3CC2N 3MK6A 2YX6A 4CZEA 4DR6K 4FJLA 2XHBA 1BI4A 1RDUA 3GOIA 1S72N 4CJRA 4C8OA 3E9OA 3O3GA 2RF2A 1J53A 4QS8A 3P5JA 1DTQA 4FJKA 2DY4A 3HOSA 1FW6A 3ATUA 3SNNA 4BWMA 3DLRA 3SAHA 1VQMN 1L3VA 4Z4FA 2IIRA 5HRNA 3MN7A 2AA4A 3CJ9A 1LAWA 2OZMA 4PY5A 3V9SA 1TV6A 3U3GA 4CD3A 3SUPA 3ID6A 2QWRA 3MCPA 5AQWA 2Q0RA 2NLXA 1G15A 4CIFA 2P9NB 2F96A 2UUBK 1RT7A 1KC8O 2GUIA 3D45A 1C1AA 4BVOA 3M6GA 3SJHA 1X3MA 3SUOA 1X9JA 1YTUA 1MWKA 2OTLN 4CCHA 4KFBA 1CXUA 3T19A 4L8RB 5DK5A 1BQMA 2OZSA 1LW2A 5SZTA 5KI6A 4WFAL 4C1NK 1ASUA 3V81A 3VEXA 1HNVA 1NNEA 4CHNA 3RMBA 4M3WA 2KKZA 4QAGA 5JS1A 4M3ZA 1U4BA 4FM0A 1JLBA 3V4IA 4BRKA 1DEJA 2BGGA 2O8DB 3PUFA 3C94A 4OO1J 4WCEL 2FBVA 4JKGB 1KAYA 4BWJA 3SUNA 1RCHA 3QINA 2PYJA 4O4GA 4OLAA 3VTHA 4GMJB 4CBWA 5JLFA 4UQGA 4AF1A 1SKWA 4CZIA 1BGXT 5C25A 3CFPA 3IKMA 2O8CA 5E41A 3FLCO 1HR0K 3NBPA 4CEDA 1JXEA 2D0BA 1VQ8N 4FJNA 2X74A 4DR2K 3QEPA 2YJFA 3NGIA 4ZHRA 3WEEA 1VSIA 4CD1A 1JLEA 3LZJA 3AVKA 3CPEA 4AQYK 2XY5A 4AH9A 4IG0A 1NJXA 3OHRA 2FLOA 3AVJA 3I55N 3EYZA 2QWLA 4XEIA 4CF2A 1HQUA 4PKGA 1NU0A 4H0TB 4OGEA 4ELTA 5LY3A 3CM5A 2HHTA 1KFDA 1U2VA 2G8HA 4K43A 5IT9O 3FGUA 3LALA 1CLQA 4EZ6A 2Q0UA 4FJ7A 1KVAA 4FJJA 1QZ6A 4BG9A 3BGRA 1TYQA 4KHNA 5BREA 3K5MA 3SUQA 2BDPA 3K5OA 1OH7A 1NBWA 4CK1A 4BDYA 4BRQA 3V6DA 4DB3A 1YJWN 2PZSA 2IVNA 3VQ9A 2A42A 4EIAA 3PLAA 1TVRA 3PY8A 4CHZA 4XIUA 3K0SA 3NMUA 4AHVA 2RE2A 3U9ZA 4IKFA 1NK5A 2OPPA 1RBUA 3TWHA 1IBMK 4HHTA 4DSIA 3DLBA 4DS5A 4N41A 4KHWA 2D1KA 1XMOK 1D9DA 5AFUH 3TSUA 5BRDA 3ITHA 4H0XB 2ASPA 3CJ7A 5BN8A 3VEZA 4CJLA 3HVTA 5A2QO 4FM1A 2VWJA 4CEZA 2VYPA 1T3VA 3UKRB 4ISEA 4ZTJA 3O9UA 3E9LA 5HBMA 3NF7A 5BRHA 1LWFA 2A1SA 2A5XA 4CIEA 4FLWA 4GKKK 1JLAA 4JI4K 3MEGA 3TPQA 4OPJA 3L3UA 4DU3A 3EKSA 2DFHA 3MEDA 4BROA 4CF1A 4CERA 3NHGA 1T03A 4NB4A 5EVZA 3EL2A 4H0YB 3AARA 3ZX3A 1D4XA 4LF7K 1GOBA 1GOCA 3ZETA 2KW4A 4BR7A 4LF8K 2HVIA 4CEOA 1VQPN 3ZSYA 3QLHA 4CJTA 1QHTA 3WUHA 4CEAA 5JLHA 4EAHD 4CHPA 3K9KA 4BRGA 1X9SA 4B9UA 3OYJA 3RSEB 3S9HA 4IEEA 4DSLA 1Q81O 3L4IA 5KTQA 4IO9L 4PKHA 3OYGA 2BE2A 4CF0A 4B3MK 4CGGA 3MDQA 4K25A 4W5NA 3BDPA 5BPNA 2QI2A 2KFNA 1K9MO 3ZCMA 1IKYA 2JWLA 4BGBA 1RT6A 4CZHA 4FPBA 1NK9A 2O8CB 2E2NA 5C0YA 3G25A 2YHAA 3D2FA 1ZBUA 1Q7YO 4CJ5A 3MMVA 1KCFA 3LM9A 4FPAA 3KLGA 1KAXA 3CF5L 4RW7A 5KPRA 3AAQA 3F2KA 2E5LK 4K41A 3CCVN 3K59A 3CPWM 3SQ2A 1R0AA 4N76A 3C95A 3AVGA 2P9PA 3WEEB 4CJ7A 3ZYYX 4EFHA 2E2PA 4BG8A 1JLFA 4J2BA 2A3ZA 3QMLA 4B8AB 4FSVA 4DLGA 3WNFA 2E8AA 4AM7A 4FZXC 1FKPA 1O1WA 4X64K 1U49A 3MAQA 3LPTA 3A2FA 3VF6A 4N5SA 1TUYA 4KB1A 2D5RA 1U2VB 1JCEA 2KTQA 2QWOA 2RPIA 2YHBA 2D4WA 3KK2A 2ITMA 3B6OA 2GTDA 4HCBA 3CCLN 1VSFA 1WSIA 2ZJQL 1TYQB 3DM2A 2O8BA 4KV8A 2E2QA 4B1VA 3I0RA 4BC4A 4CIGA 2P5GA 3O4NA 3QESA 2FBXA 3MECA 3VGLA 3THYA 4CJUA 4WFBL 4B3RK 3L2UA 5CY4A 1OH6A 3J80O 3LDOA 5J2NA 1N34K 2F8SA 5C2DA 3OTOK 2XY8A 4JK9A 3ASMA 2VG7A 1IBKK 4J2DA 1EWQA 1RILA 1LOTB 3DRPA 3HL8A 3O80A 4MDBA 1E4FT 1LWEA 1YF5L 3PIPL 4H03B 2CGKA 1REVA 3SV4A 1K8KA 1BA0A 4KI6A 4FJ8A 4YFUA 1A5VA 3OYAA 2NNWA 4JKFA 4BRAA 5M1FA 3WXMB 4OGCA 4QCLA 3AAPA 3PSFA 1U6ZA 5I3UA 4IJAA 1BCOA 1RDCA 2KHOA 4FZYA 1N36K 2NRZA 4OJRA 4NO7A 3PX4A 4B1YB 3ZETB 3TABA 4PL8A 3NCIA 2Q2RA 2VGNA 3LAMA 4CZGA 1J5EK 1VQKN 4CFAA 4JS5A 1EKEA 1NMDA 1RFQA 3O5BA 1NJWA 3KD1E 2NZTA 3KK1A 2G8FA 3HYFA 4BC5A 1SKSA 3A8YA 3ZSXA 2ZM6K 4CGFA 4O8KA 3V9ZA 4HCCA 4OPAA 2F7TA 2NRTA 4YORA 1IG8A 1MU2A 4AHSA 1JLCA 4CZJA 5C12A 2QWMA 1P90A 2R7YA 2AJQA 3D2FB 5GINA 2OA8A 2ZWHA 3C6UA 3DOLA 2RHKA 3LWLA 2OTJN 1VQ4N 4Z4CA 4LH5A 3CCJN 3OYBA 3RRGA 1T44A 2DFFA 1RBTA 4BGAA 3WQUA 4DV7K 4W5OA 3BEXA 5BR9A 3GBTA 3O4QA 3VGKA 1KFSA 4YDUA 3QEWA 4R5PA 3S41A 1SZ2A 3HZ6A 4GVEA 3MEEA 2OPQA 1TL1A 3QICA 4FJXA 3HSCA 2UYTA 2FBTA 5HL7L 4A5BA 3R8EA 3CHWA 3ATVA 2F8TA 3OYIA 3V9UA 1Z05A 3ULDA 3QBXA 4DV3K 3ALYA 2YHXA 2FF6A 4MFBA 2GWKA 3D6RA 3OYKA 4C1NI 2IAJA 3VF2A 2YV0X 4G1QA 3WNHA 3AVBA 3QEVA 2B4JA 3O1WA 3HPOA 4E7JA 4DTOA 1NK4A 2HHQA 4B9VA 3NFAA 3A5OC 5B8HA 3RVCA 1RT4A 3O3HA 1Q9XA 5DMRA 4KO0A 5M1OA 1C1BA 4M7YA 3QIOA 1YJ9N 5ADXA 3AVMA 1BCMA 3F9MA 4DV0K 4CZFA 3BF3A 3SPZA 1OKJA 5F2RA 3AV9A 3Q7CA 1QS4A 4BDZA 1NJYA 1EP4A 1YIJN 4CJ3A 2D0CA 5EXWA 3GL1A 3LP2A 2Q31A 4E3SA 3KK3A 2VWKA 1K8KB 3DOKA 5M1QA 4B1ZA 5SWMA 4CFCA 3M8RA 3WXIA 1ZBFA 3A0IX 3THWA 2QM1A 1X9MA 3DLLL 5FPMA 3PSIA 3LWMA 1VSEA 2AP1A 4E1MA 3KD5E 1QQCA 1U48A 1HNIA 4PHTX 4MLHA 3L8BA 2XO7A 3AA2A 1S9EA 3THXA 1KRPA 3CCRN 1U47A 4I2PA 3P39A 4JN4A 4B3SK 4C8MA 3OJSA 2QXFA 5GADP 5JVHL 1TK8A 2NRRA 5M1KA 3KZBA 1EXQA 5GAEP 1GLJO 2I7NA 3EE9A 3PX0A 4HTLA 4O5FA 3EN9A 3MXJA 3R3LA 4H5TA 5KQ8A 3U3YA 3DI6A 5AQPA 3QNNA 4DTRA 1MWMA 3V1RA 3H45C 3TSQA 2G8VA 3VQCA 4GV3A 3ZLJA 1BO5O 4N56A 4M3UA 4CF8A 1EX4A 1Z26A 1NG9A 4ELVA 3SBTA 2WOMA 2FF3B 3TTFA 5AZIA 2DTUA 3S3OA 1S5JA 3IG1A 3VMFB 1NGAA 1UAXA 4EP4A 1KQSM 3LL3A 3HPHA 2QA4N 3LAKA 3SAGA 4JHDA 1L3TA 1TAUA 4IWVA 2P9IA 1RT1A 3L0QA 3OJUA 4AILC 2HMPA 5CZ1A 1HKGA 4EHTA 4AHCA 4CEQA 1LWCA 4FJ9A 1ATSA 1LW0A 2HSTA 4FW1A 4FLVA 2F4VK 2KZMA 3ID8A 4IOXA 4CBXA 1C0TA 4DSFA 3BY5A 1S1TA 1L5UA 4RW4A 4A59A 3T3FA 4J8FA 1EO1A 3IUCA 2P9SB 4DR3K 2EX3A 1TK0A 1WN7A 4HUEA 4CJKA 3C6HA 3VQ4A 5AR0A 3KLFA 2CGLA 3VENA 4BC3A 4V19S 4BRPA 2ZGZA 2GEMA 1HKBA 1U45A 5AQIA 4NYFA 3FZHA 2IDOA 4DTUA 3G6EN 3THVA 5CR4A 4LFBK 2D0OA 3O08A 3MXMA 2E6MA 4NLBA 1HJOA 3QNOA 4M63C 1NJIO 3IRXA 3QEXA 2PYLA 3NH1A 3OYFA 2E1YA 1QTMA 3DRRA 3QFUA 4HUGA 3WXJA 2O4IA 1WSGA 3ISNC 5C24A 3VQ8A 4A2AA 3VETA 4KH5A 3VEWA 4BE0A 1GLAG 2YJEA 3BP8A 3A5NC 1GLEG 1NGJA 1O13A 1ATNA 4OX9K 3KWIA 4W5QA 1YXQA 1KXPA 1KLMA 4GW6A 4BDPA 4E0DA 1J54A 4MDAA 4ZTFA 5AQLA 3T1AA 1GLCG 3DAWA 1N5YA 1SQKA 1S1VA 1UOCA 3NF8A 2YHYA 5ELZA 1RDDA 1WOQA 4FJGA 2VQFK 1W0HA 1B9FA 1WNSA 2YHWA 4H0PA 4IO8A 3FZLA 1XNRK 3VEVA 1G99A 3AVAA 4BVPA 2HF4A 5AZIB 3ULEA 4DF4A 4F2SA 4XH4A 1QSLA 2HHWA 1D5AA 3L6QA 1KVCA 1SL2A 1HRHA 4IBNA 3QEIA 4BRLA 1UWBA 2A41A 3HM8A 1JL2A 4BC2A 2A6AA 4RTFD 5HROA 3LDQA 5TKWA 4DQSA 3ZEUA 3MWTA 4UY8O 1BA1A 3D0PA 4BRMA 1VHXA 3DRSA 4LD0A 1BI4B 2P9IB 4I9QA 1WLJA 5I9EB 2OPRA 3C7NA 1BISA 4FL9A 2UXDK 3NVKA 1YI2N 5BPMA 1YT3A 2W6KA 1XWLA 3FZMA 3P38A 3ENOA 3CCMN 3OS0A 1WAJA 3KTQA 3TI0A 2P9KA 4KKOA 5AJ3K 5TKYA 3L2WA 3CQ8A 3K9JA 4FLZA 3H1VX 1B92A 3KLIA 4IFEA 3RTVA 3OYHA 5EY4A 4M42A 3EEQA 3LDNA 1NGIA 4ICLA 2GV9A 5AQRA 2RKIA 4YOTA 4H4OA 3O9SA 1NLVA 3ZT0A 3AVIA 3CG7A 4FWQA 4FLUA 3A5MC 5AQMA 3PO5A 4IZ9A 1JKHA 4XH1A 4FWRA 4FYDA 1C0UA 3MX2A 1SS6A 2O8FA 4JI3K 2O8EA 1RDBA 4F8RA 1H1VA 2EHGA 1J9AA 4C23A 4JEPA 1HYZA 1WSHA 2E4LA 5EOYA 1VSDA 4BY9C 3QO9A 1OVQA 3SQ4A 1VQNN 4MQ3A 4M3TA 4DV1K 2P9LA 5LJWA 4CZKA 3RMCA 4BR9A 5FDLA 3W0LA 5HP1A 3LANA 3EZ5A 4BE1A 4K0KK 2IC3A 1ZXOA 2QTDA 1X9WA 1NKBA 4H5RA 4M3RA 4NCGA 4W5RA 4GV9A 4BE2A 5BRFA 4DWIA 3T1HK 2QWNA 2Y1JA 3JYTA 3OYDA 4FLYA 3ZSZA 3WXKA 1EETA 4IFYA 3PIOL 3KLHA 1N32K 1BQNA 1QVGM 4LC9B 3K58A 3CYMA 3EY1A 3F73A 4O0IA 3QFPA 1S3XA 4KRFA 1OH8A 3KLEA 5AQYA 4M3YA 3V1OA 3TAQA 4F4KA 3LPUA 3ULEB 1VAZA 1VSLA 3DXMA 1HX1A 1QQOA 4GVMA 1ILYA 2ZJRL 4KHQA 2W6LA 5M1NA 3SPYA 1WSFA 3TSPA 3LDSA 4LF5K 1YJNN 3LZIA 3U4LA 4B1XB 4JKCA 4FJHA 4Q5VA 3LDLA 1W7AA 1KLNA 4CGHA 1YVUA 2KZZA 5J2PA 2VQEK 4CEFA 1BU6O 2PFUA 3PX6A 4HVJA 3DLKA 2BUPA 3VGMA 1T8EA 3DWLA 5J2MA 3ZSVA 2P51A 4CE9A 4G9ZA 4Z0UA 2P9KB 3JAMO 5AQTA 4F3OA 5BN9A 4JK7A 1NJZA 1IBLK 3I8DA 2BH1A 4FK4A 3CJBA 1ASVA 4O55A 3H3NO 1NGDA 3DJCA 3H3OB 1I3AA 3O6WA 4FWMA 5AZJA 4DTPA 3OS1A 1Z25A 1KSPA 3DMJA 3EKUA 2UXBK 4FLXA 5AQVA 2G8UA 2HMIA 3HPGA 3J7ZO 1V4TA 2ITGA 5HRPA 3K5NA 4OPHA 4CGIA 3OYCA 4NLCA 5BR8K 3Q7BA 3CD6N 1JLQA 1DGKN 4OPKA 4ID5A 5F1XA 4LFAK 1VQ6N 4RW6A 4CEBA 4LF6K 3CM6A 2HHHK 4J2AA 4RCHA 3M8QA 4DFJA 4FJIA 2O8FB 2Q36A 2HVHA 2O8EB 3JSMA 2Q97A 3O4WA 4B1WB 2YNHA 3I56N 1XMQK 4ISGA 3AO4A 3DXKA 3OA9A 1QQMA 2P9LB 2YNIA 4CF9A 4OKKA 3C6TA 2PBDA 4FCYA 4KTWA 5HLFA 4B9SA 5E84A 1NMNA 4BRHA 4LF9K 4KHSA 3MCAB 3VEOA 2QKKA 4QS7A 4JI0K 1VQ7N 2FSJA 3ZSQA 4MO4A 4IJNA 1BUPA 4CGJA 4JKEA 4O5BA 4FXDA 4YOWA 3IFRA 4FW2A 3T7ZA 3TU5A 3O9RA 1DLOA 1TGOA 4BQZA 1I94K 2BANA 2P9PB 3VESA 2HOEA 1SL0A 4OKJA 2DPNA 1HUXA 4M3XA 1HJRA 1RT5A 1CXQA 4DQIA 1RTJA 5I42A 2VCPA 4LSNA 4O8UA 1ZC6A 2ZD1A 4CW7B 3DXMB 3HTVA 3M1FA 3CCUN 2ZE2A 3VPZA 3EO3A 3K2PA 4BRDA 4FJ5A 4CJFA 4NXNK 2YCHA 3D2EA 1L3UA 1VRUA 4BR4A 1Z6RA 5CYQA 1VQLN 3W3DA 3I0SA 4CI6A 3L4QA 4FK0A 2O8BB 1IKXA 4U7BA 4JKHA 4Z4EA 4CHOA 3EE8A 4NCAA 4E7LA 1R59O 4JD2A 4JAXA 5EU7A 4ILGB 3VQPA 4Z94A 2FC0A 4E7HA 5FPNA 3THYB 4CJEA 4K8XA 3N4PA 4CJ4A 3E66A 5HOOA 4CZLA 1ATRA 3VTIA 4IFVA 3PV8A 3OVNA 3I33A 1S6QA 4DUZK 5CE3A 4Z4HA 4BRFA 4L3QA 3OBWA 3KVGA 1VQON 2P9NA 2W41A 4LSLA 1JLGA 2QWPA 3SCXA 3P1GA 3NVMA 4CJWA 5CHIA 3CERA 1WSJA 3VQ5A 3K57A 2NUBA 1X1PA 4WQ4C 5GIPA 1VK0A 3T1YK 3J7AP 3NGZA 4E7KA 4Y1DA 2LSNA 3KJVA 4CJSA 4DV6K 5AQNA 2P9UA 1M1KO 4CFDA 1U04A 4IOAL 2HHSA 4C8KA 1HLUA 3I8BA 3S3MA 2D0AA 4E7IA 3OYNA 3UKUA 4BR2A 1N6QA 1SAZA 3CC4N 1ZBIA 3CCSN 4DTXA 3F5TA 3WNEA 2VGMA 1YHQN 3AVHA 4GV6A 5FRNA 3A5LC 1XNQK 4JKGA 4KI4A 3HP9A 1GLLO 3AVLA 5AQXA 4FWKA 3N4QA 2VG5A 4RWTA 1NOYA 2CGJA 3P83D 3KKRA 1TKZA 3TAPA 4FZZA 4AHUA 1OH5A 2XRIA 4X62K 4HUFA 5HRRA 4DSEA 1RNHA 3KK7A 4I6MA 2QK9A 2RN2A 2E1ZA 4E1JA 3CQYA 5KGWA 3MXIA 5J2QA 1A5WA 2ZGYA 1LCUA 3R1XA 4BQLA 5AQQA 5MLCQ 3SQ1A 3GE1A 3CETA 4U67L 4DU1A 3CFRA 3VA3A 3VQBA 1ZBSA 3VN5A 1XHZA 3G0ZA 3BUZB 1YTAA 1JL1A 3OS2A 3C6AA 1L3SA 5DM6L 1ZBLA 1HYVA 3J8AA 5AFUA 3OYMA 3NAEA 1NKEA 4LF4K 4CHYA 4B3OA 5HRSA 4YHHK 3M5RA 4DR7K 3D2EB 2UXCK 4CVNE
chains in the Genus database with same CATH topology
1VSKA 1XWLA 3B6OA 4HCBA 4B08A 1VSFA 3OY9A 1WSIA 2YNGA 2B6AA 3DM2A 1NK7A 3OS0A 1WAJA 4DLEA 3KTQA 4KV8A 3HK2A 3I0RA 4CK2A 3TI0A 4KKOA 1S6PA 4CIGA 3O4NA 4AHRA 3DLEA 2P5GA 3QESA 2FBXA 3MECA 1BIUA 3L2WA 4CJUA 1BIZA 3L2UA 5CY4A 3CQ8A 3AA3A 4FLZA 1T05A 5J2NA 5J1EA 4KHUA 2F8SA 1IG9A 4B9LA 2WONA 1B92A 3AA4A 4F3TA 1UA1A 3KLIA 2XY8A 3RTVA 3OYHA 3O3FA 3HVRA 3ASMA 2VG7A 4M42A 4J2DA 2X6NA 1RILA 3DRPA 3HL8A 1D9FA 4ICLA 2GV9A 4CECA 3IAYA 3AVFA 3FFIA 1LWEA 2RKIA 4IG3A 1VRTA 4H4OA 2IOCA 4FJMA 1IKWA 3ZT0A 3ZSRA 3AVIA 2JLEA 3RMAA 1REVA 3TANA 4ELUA 3CG7A 3VQQA 3SJJA 1Y97A 3AO1A 4HTUA 4FLUA 1TKDA 4M41A 4E19A 3SV4A 3SI6A 1NK0A 1J5OA 1T7PA 4LY7A 4KI6A 4PWDA 4FJ8A 4YFUA 1A5VA 3OYAA 4J2EA 3NDKA 1Q9YA 3PO5A 3NGYA 1JKHA 5FRMA 4OGCA 4QCLA 3IS9A 5CZ2A 4FYDA 3AA5X 1C0UA 5I3UA 3B6PA 4B9MA 4PA1A 4OVLA 4M45A 1BCOA 1CZ9A 1RDCA 1TL3A 4DMNA 3V9XA 4FZYA 1S9GA 4OJRA 1RDBA 3NH2A 3LP1A 4F8RA 2EHGA 1J9AA 2P5OA 3PX4A 1HYZA 1WSHA 2E4LA 2OPSA 1VSDA 3SV3A 3TABA 3QO9A 3NCIA 3SQ4A 4MQ3A 3ZT3A 4CJPA 3DLHA 4Q0BA 4M3TA 4OKEA 3LAMA 3RMCA 4CFAA 4JS5A 2YKNA 4DFMA 1LAVA 3HO1A 4IDKA 5FDLA 1EKEA 3KD1E 1NJWA 4H8KA 4JRQA 2DFEA 3KK1A 2G8FA 3L2QA 5HP1A 3LANA 3TARA 1HMVA 3TR8A 1DTTA 3HYFA 2E6LA 4RW9A 1SKSA 3ZSXA 3EZ5A 1IH7A 4BE1A 1HYSA 4FLTA 4NCBA 3QETA 1VSJA 2IC3A 4CJVA 1HQEA 4CGFA 4CEEA 2Z1HA 1X9WA 2O4GA 1NKBA 2HNDA 4M3RA 1TKTA 4O44A 4KAZA 4NCGA 4W5RA 1ZBHA 3V9ZA 4BE2A 4DWIA 4HCCA 1RT3A 4DF8A 2Y1JA 4DG1A 3ZT1A 3JYTA 3OYDA 4FLYA 3ZSZA 4CESA 3QIPA 1EETA 4IFYA 1MU2A 4AHSA 1W9HA 3KLHA 1WAFA 1BQNA 1JLCA 3HSTB 3K58A 3HJFA 3CYMA 3EY1A 3F73A 1IKVA 4O0IA 3L2RA 3PO4A 5D3GA 2R7YA 2AJQA 4KTZA 4KRFA 3NF9A 3C6UA 3DOLA 3VQAA 3KLEA 2A1RA 2OA8A 4KTQA 3LWLA 4M3YA 1CZBA 1C1CA 3V1OA 1RT2A 2G8KA 2Z1IA 3TAQA 4Z4CA 4LH5A 4F4KA 3LPUA 2GBZA 3OYBA 3RRGA 3OYEA 4JS4A 3TAFA 2DFFA 1RBTA 3VQ6A 1VSLA 4KPYA 1RBRA 3KIOA 4O0JA 4W5OA 4DTNA 1F21A 4DQRA 1WSEA 4GVMA 1K6YA 3O4QA 4KHQA 4B8CA 3SPYA 1WSFA 2I5JA 4DTMA 4EZ9A 3LDSA 1KFSA 3RRHA 3QEWA 1LV5A 3G10A 4R5PA 4CK3A 3LZIA 4FJLA 3MEEA 2OPQA 2XHBA 1BI4A 1TL1A 4CJRA 4FJXA 4C8OA 4JLHA 3O3GA 4C8LA 1NKCA 3TAMA 2FBTA 2RF2A 1FKOA 1J53A 4FJHA 4Q5VA 3P5JA 1DTQA 1KLNA 4CGHA 1YVUA 3OYIA 3V9UA 3VA0A 5J2PA 4FJKA 3ULDA 4Z4IA 2HNZA 4TSXA 4CEFA 4DS4A 2DY4A 2OYQA 3ALYA 4MFBA 5KGXA 1RTIA 3DLGA 4I9LA 1XHXA 3SNNA 3OYKA 4HVJA 2HNYA 3DLRA 1HPZA 3DLKA 2IAJA 4BWMA 5J2MA 3PX6A 3NE6A 1T8EA 3ZSVA 1L3VA 5HRNA 1D8YA 4Z4FA 2F8TA 2QKBA 2P51A 4CJQA 2VG6A 1TAQA 4CE9A 3NH0A 2YV0X 2IS3A 4G1QA 1LAWA 3WNHA 3AVBA 4Z0UA 2B4JA 3HPOA 4DTOA 4E7JA 3QEVA 1NK4A 3V9SA 2OZMA 1TV6A 4PY5A 3U6FA 2HHQA 2Z1JA 4F3OA 4B9VA 3U3GA 4RG8A 1NJZA 3NFAA 4WE1A 3SUPA 3I8DA 1RT4A 3O3HA 1Q9XA 2X78A 4FK4A 5DMRA 1ASVA 4KO0A 4O55A 1C1BA 3QIOA 5K14A 1G15A 4CIFA 3AVMA 1BHLA 1I3AA 1BCMA 2F96A 3K5LA 4B9TA 1S1WA 2ETJA 4DTPA 4DQPA 1RT7A 3OS1A 1Z25A 4LH4A 3SPZA 3DMJA 1KSPA 4FK2A 2GUIA 3SYZA 4FLXA 3D45A 3AV9A 4YNQA 3TAEA 1QS4A 4BDZA 1C1AA 4AHTA 4BACA 1NJYA 2G8UA 2HMIA 1EP4A 4CJ3A 3HPGA 2D0CA 3SUOA 4FM2A 2ITGA 5HRPA 1YTUA 3LP2A 4E3SA 3K5NA 4PQUA 3ZT4A 4CGIA 2VWKA 3DOKA 3OYCA 3KK3A 4CCHA 5SWMA 4CFCA 3M8RA 1JLQA 4KFBA 1CXUA 3T19A 4OPKA 4ID5A 1ZBFA 4L8RB 1SKRA 5DK5A 1BQMA 4RW6A 1LW2A 2OZSA 1I39A 5SZTA 3HXMA 2G8WA 3AVCA 5KI6A 4CEBA 3CM6A 3V81A 1ASUA 3TAGA 1X9MA 5T7BA 4FVMA 4J2AA 1HNVA 3LWMA 2W42A 1VSEA 4CHNA 3RMBA 4M3WA 3M8QA 3KD5E 4E1MA 4DFJA 4QAGA 4FJIA 5JS2A 1QQCA 1KTQA 1U48A 5JS1A 2HVHA 4E89A 3CFOA 1HNIA 4M3ZA 2HW3A 1U4BA 3JSMA 3SZ2A 4FM0A 3L8BA 1JLBA 2HB5A 1S9EA 3AA2A 2XO7A 3V4IA 2XY6A 1KRPA 4W5TA 3QERA 1U47A 4I2PA 2YNHA 4OLBA 3PUFA 3C94A 2BGGA 3AO4A 4C8MA 3OJSA 5KRSA 2QXFA 2FBVA 1ASWA 2YNIA 4CF9A 4BWJA 3SUNA 3SQ0A 1TK8A 3C6TA 1EXQA 1RCHA 3QINA 4ID1A 4OKKA 2PYJA 4KHYA 4O4GA 4DTJA 4OLAA 3PX0A 4FCYA 4GMJB 3MXJA 4KTWA 3U3YA 4Z4GA 5HLFA 4B9SA 3DI6A 4DQQA 3VQDA 4UQGA 3QNNA 1SKWA 3AO2A 4DTRA 1BGXT 3V1RA 4KHSA 5C25A 3CFPA 2QKKA 2G8IA 2G8VA 3VQCA 1KVBA 5E41A 2YKMA 1GOAA 4N56A 4NYNA 3NBPA 4I2QA 4RW8A 3ZSQA 4M3UA 1BL3A 3WNGA 4CEDA 1EX4A 4CF8A 4CGJA 1Z26A 4O5BA 4ELVA 3RWUA 4FXDA 4QOZB 2WOMA 1JXEA 4FW2A 2D0BA 4H4MA 4FJNA 4E1NA 2X74A 1VSHA 3QEPA 2FBYA 1DLOA 3NGIA 1TGOA 4ZHRA 4F2RA 1VSIA 2DTUA 1JLEA 3LZJA 3AVKA 2XY5A 4AH9A 2BANA 3S3OA 4IG0A 1S5JA 4CHQA 1NJXA 3IG1A 1SL0A 2Y1IA 4PUOA 3M8PA 1UAXA 4OKJA 4EP4A 3AO3A 4M3XA 1HJRA 1RT5A 3HPHA 1CXQA 3AVJA 3LAKA 1ZYQA 4DQIA 1RTJA 3EYZA 1A5XA 5I42A 4LSNA 5FROA 1L3TA 4CF2A 2ZD1A 2ATQA 1XHZA 1TAUA 1HQUA 2IGIA 4OGEA 4ELTA 2ZE2A 3CM5A 2HHTA 1KFDA 1RT1A 3K2PA 1QE1A 2G8HA 1B9DA 4FJ5A 3L3VA 3OJUA 4CJFA 4AILC 3LALA 3H08A 1CLQA 5CZ1A 1L3UA 4EZ6A 4FJ7A 1VRUA 1KVAA 4AHCA 4CEQA 4FJJA 1LWCA 5CYQA 4FJ9A 3I0SA 1LW0A 3BGRA 4FW1A 4DSJA 4KHNA 2HHVA 4FLVA 3K5MA 3SUQA 2BDPA 2ZQBA 1RBSA 2KZMA 3K5OA 4N47A 1C0TA 4DSFA 4FK0A 1S1TA 1JXBA 1L5UA 1IKXA 1UA0A 4CK1A 4BDYA 4Z4EA 3S3NA 3V6DA 4RW4A 4CHOA 4DFPA 1IO2A 2PZSA 4NCAA 3VQ9A 3NF6A 4E7LA 3VQEA 5EU7A 3T3FA 1TVRA 3VQPA 2FC0A 4E7HA 4CHZA 3PY8A 4CJEA 4K8XA 4XIUA 1RTDA 4AHVA 4CJ4A 2XY7A 4IKFA 2EX3A 2X6SA 1NK5A 3PV8A 1WN7A 4IFVA 1TK0A 1NK8A 2KFZA 3OVNA 4HUEA 4CJKA 2OPPA 4KREA 5KRTA 1RBUA 1S6QA 3VQ4A 3KLFA 1XI1A 3TWHA 4HHTA 4DSIA 3DLBA 4DS5A 4DU4A 4N41A 4KHWA 4Z4HA 2PY5A 3V1QA 1D9DA 1U45A 3ITHA 3AO5A 4NYFA 2IDOA 4DTUA 4CJLA 1C6VA 4LSLA 3THVA 3HVTA 1JLGA 4FM1A 2JGUA 3RMDA 3P1GA 2VWJA 3SCXA 1RDAA 3MXMA 1XC9A 2E6MA 4CJWA 4CEZA 4CFBA 3QNOA 3HT3A 4ZTJA 1TKXA 3IRXA 4JRPA 1WSJA 5HBMA 3VQ5A 3K57A 2NUBA 3NF7A 4C8NA 3NH1A 1X1PA 3QEXA 2PYLA 1VK0A 1LWFA 3OYFA 2KZZA 2A1SA 3NGZA 4KB0A 4CIEA 4FLWA 4E7KA 4Y1DA 1JLAA 2LSNA 3MEGA 4CJSA 3KJVA 1QTMA 4OPJA 3L3UA 3DRRA 4DU3A 2DFHA 4HUGA 3MEDA 3LP0A 4CF1A 4CERA 3NHGA 1T03A 2O4IA 1WSGA 3ISNC 5C24A 1QSYA 2P1JA 4CFDA 1U04A 3VQ8A 1TK5A 4B9NA 2HHSA 4C8KA 3KKSA 4BE0A 1GOBA 1GOCA 2HVIA 2KW4A 1NOZA 4CEOA 3S3MA 2D0AA 3RR7A 2HHUA 4E7IA 3ZSYA 3QLHA 4CJTA 3LP3A 1QHTA 4EP5A 3OYNA 4CEAA 1RBVA 3DYAA 1N6QA 4W5QA 4CHPA 1ZBIA 4DFKA 4DTSA 3M8SA 1SV5A 3WNEA 1KLMA 4DTXA 1X9SA 2HHXA 4B9UA 4GW6A 1VSMA 3OYJA 4BDPA 4E0DA 3S9HA 1J54A 3AVHA 4ZTFA 5FRNA 4DSLA 3T1AA 4KI4A 3HP9A 1N5YA 5KTQA 3OYGA 1S1VA 1UOCA 3NF8A 2BE2A 3AVLA 4CF0A 4CGGA 1NK6A 2YNFA 3UIQA 1RDDA 2VG5A 1NOYA 4W5NA 4FJGA 3BDPA 1W0HA 3P83D 2KFNA 3VQ7A 3OYLA 3ZCMA 1IKYA 1B9FA 1RTHA 1FXXA 1WNSA 3KKRA 1TKZA 1RT6A 3ZT2A 3TAPA 4FZZA 4AHUA 2XRIA 1SL1A 1NK9A 4HUFA 5HRRA 2YHAA 5CYMA 1RNHA 1ZBUA 4DSEA 4CJ5A 1KCFA 2QK9A 3F9KA 5C42A 2Z1GA 3KLGA 3ZSWA 2RN2A 1QSSA 5KGWA 3MXIA 3AVAA 4RW7A 1SUQA 3RR8A 2KQ2A 5J2QA 1A5WA 3K59A 3SQ2A 1R0AA 4N76A 3C95A 4DF4A 3AVGA 4F2SA 1QSLA 1Q8IA 3HM9A 2HHWA 1D5AA 3SQ1A 4Y1CA 3E01A 3HP6A 1KVCA 1SL2A 4DU1A 3CFRA 1HRHA 1JLFA 4IBNA 3VA3A 3QEIA 4J2BA 1UWBA 4B8AB 3VQBA 1FK9A 3VN5A 4DLGA 3G0ZA 1JL2A 2B5JA 3WNFA 4CGDA 1YTAA 1JL1A 1FKPA 1O1WA 4I7FA 3OS2A 4DQSA 5HROA 1U49A 4FZXC 3MAQA 1L3SA 3LPTA 3A2FA 3D0PA 1ZBLA 1HYVA 1ITGA 3AVNA 4N5SA 3V9WA 3OYMA 3NAEA 3DRSA 2Q3SA 4LD0A 4K8ZA 1BI4B 1NKEA 4KB1A 4CHYA 4I9QA 4B3OA 5HRSA 2D5RA 1WLJA 2KTQA 2OPRA 1BISA 1C0MA 2RPIA 2YHBA 3L2VA 1S1XA 1S1UA 4DSKA 3KK2A 3ZSOA 1YT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VSK A;  1XWL A;  3B6O A;  4HCB A;  4B08 A;  1VSF A;  3OY9 A;  1WSI A;  2YNG A;  2B6A A;  3DM2 A;  1NK7 A;  3OS0 A;  1WAJ A;  4DLE A;  3KTQ A;  4KV8 A;  3HK2 A;  3I0R A;  4CK2 A;  3TI0 A;  4KKO A;  1S6P A;  4CIG A;  3O4N A;  4AHR A;  3DLE A;  2P5G A;  3QES A;  2FBX A;  3MEC A;  1BIU A;  3L2W A;  4CJU A;  1BIZ A;  3L2U A;  5CY4 A;  3CQ8 A;  3AA3 A;  4FLZ A;  1T05 A;  5J2N A;  5J1E A;  4KHU A;  2F8S A;  1IG9 A;  4B9L A;  2WON A;  1B92 A;  3AA4 A;  4F3T A;  1UA1 A;  3KLI A;  2XY8 A;  3RTV A;  3OYH A;  3O3F A;  3HVR A;  3ASM A;  2VG7 A;  4M42 A;  4J2D A;  2X6N A;  1RIL A;  3DRP A;  3HL8 A;  1D9F A;  4ICL A;  2GV9 A;  4CEC A;  3IAY A;  3AVF A;  3FFI A;  1LWE A;  2RKI A;  4IG3 A;  1VRT A;  4H4O A;  2IOC A;  4FJM A;  1IKW A;  3ZT0 A;  3ZSR A;  3AVI A;  2JLE A;  3RMA A;  1REV A;  3TAN A;  4ELU A;  3CG7 A;  3VQQ A;  3SJJ A;  1Y97 A;  3AO1 A;  4HTU A;  4FLU A;  1TKD A;  4M41 A;  4E19 A;  3SV4 A;  3SI6 A;  1NK0 A;  1J5O A;  1T7P A;  4LY7 A;  4KI6 A;  4PWD A;  4FJ8 A;  4YFU A;  1A5V A;  3OYA A;  4J2E A;  3NDK A;  1Q9Y A;  3PO5 A;  3NGY A;  1JKH A;  5FRM A;  4OGC A;  4QCL A;  3IS9 A;  5CZ2 A;  4FYD A;  3AA5 X;  1C0U A;  5I3U A;  3B6P A;  4B9M A;  4PA1 A;  4OVL A;  4M45 A;  1BCO A;  1CZ9 A;  1RDC A;  1TL3 A;  4DMN A;  3V9X A;  4FZY A;  1S9G A;  4OJR A;  1RDB A;  3NH2 A;  3LP1 A;  4F8R A;  2EHG A;  1J9A A;  2P5O A;  3PX4 A;  1HYZ A;  1WSH A;  2E4L A;  2OPS A;  1VSD A;  3SV3 A;  3TAB A;  3QO9 A;  3NCI A;  3SQ4 A;  4MQ3 A;  3ZT3 A;  4CJP A;  3DLH A;  4Q0B A;  4M3T A;  4OKE A;  3LAM A;  3RMC A;  4CFA A;  4JS5 A;  2YKN A;  4DFM A;  1LAV A;  3HO1 A;  4IDK A;  5FDL A;  1EKE A;  3KD1 E;  1NJW A;  4H8K A;  4JRQ A;  2DFE A;  3KK1 A;  2G8F A;  3L2Q A;  5HP1 A;  3LAN A;  3TAR A;  1HMV A;  3TR8 A;  1DTT A;  3HYF A;  2E6L A;  4RW9 A;  1SKS A;  3ZSX A;  3EZ5 A;  1IH7 A;  4BE1 A;  1HYS A;  4FLT A;  4NCB A;  3QET A;  1VSJ A;  2IC3 A;  4CJV A;  1HQE A;  4CGF A;  4CEE A;  2Z1H A;  1X9W A;  2O4G A;  1NKB A;  2HND A;  4M3R A;  1TKT A;  4O44 A;  4KAZ A;  4NCG A;  4W5R A;  1ZBH A;  3V9Z A;  4BE2 A;  4DWI A;  4HCC A;  1RT3 A;  4DF8 A;  2Y1J A;  4DG1 A;  3ZT1 A;  3JYT A;  3OYD A;  4FLY A;  3ZSZ A;  4CES A;  3QIP A;  1EET A;  4IFY A;  1MU2 A;  4AHS A;  1W9H A;  3KLH A;  1WAF A;  1BQN A;  1JLC A;  3HST B;  3K58 A;  3HJF A;  3CYM A;  3EY1 A;  3F73 A;  1IKV A;  4O0I A;  3L2R A;  3PO4 A;  5D3G A;  2R7Y A;  2AJQ A;  4KTZ A;  4KRF A;  3NF9 A;  3C6U A;  3DOL A;  3VQA A;  3KLE A;  2A1R A;  2OA8 A;  4KTQ A;  3LWL A;  4M3Y A;  1CZB A;  1C1C A;  3V1O A;  1RT2 A;  2G8K A;  2Z1I A;  3TAQ A;  4Z4C A;  4LH5 A;  4F4K A;  3LPU A;  2GBZ A;  3OYB A;  3RRG A;  3OYE A;  4JS4 A;  3TAF A;  2DFF A;  1RBT A;  3VQ6 A;  1VSL A;  4KPY A;  1RBR A;  3KIO A;  4O0J A;  4W5O A;  4DTN A;  1F21 A;  4DQR A;  1WSE A;  4GVM A;  1K6Y A;  3O4Q A;  4KHQ A;  4B8C A;  3SPY A;  1WSF A;  2I5J A;  4DTM A;  4EZ9 A;  3LDS A;  1KFS A;  3RRH A;  3QEW A;  1LV5 A;  3G10 A;  4R5P A;  4CK3 A;  3LZI A;  4FJL A;  3MEE A;  2OPQ A;  2XHB A;  1BI4 A;  1TL1 A;  4CJR A;  4FJX A;  4C8O A;  4JLH A;  3O3G A;  4C8L A;  1NKC A;  3TAM A;  2FBT A;  2RF2 A;  1FKO A;  1J53 A;  4FJH A;  4Q5V A;  3P5J A;  1DTQ A;  1KLN A;  4CGH A;  1YVU A;  3OYI A;  3V9U A;  3VA0 A;  5J2P A;  4FJK A;  3ULD A;  4Z4I A;  2HNZ A;  4TSX A;  4CEF A;  4DS4 A;  2DY4 A;  2OYQ A;  3ALY A;  4MFB A;  5KGX A;  1RTI A;  3DLG A;  4I9L A;  1XHX A;  3SNN A;  3OYK A;  4HVJ A;  2HNY A;  3DLR A;  1HPZ A;  3DLK A;  2IAJ A;  4BWM A;  5J2M A;  3PX6 A;  3NE6 A;  1T8E A;  3ZSV A;  1L3V A;  5HRN A;  1D8Y A;  4Z4F A;  2F8T A;  2QKB A;  2P51 A;  4CJQ A;  2VG6 A;  1TAQ A;  4CE9 A;  3NH0 A;  2YV0 X;  2IS3 A;  4G1Q A;  1LAW A;  3WNH A;  3AVB A;  4Z0U A;  2B4J A;  3HPO A;  4DTO A;  4E7J A;  3QEV A;  1NK4 A;  3V9S A;  2OZM A;  1TV6 A;  4PY5 A;  3U6F A;  2HHQ A;  2Z1J A;  4F3O A;  4B9V A;  3U3G A;  4RG8 A;  1NJZ A;  3NFA A;  4WE1 A;  3SUP A;  3I8D A;  1RT4 A;  3O3H A;  1Q9X A;  2X78 A;  4FK4 A;  5DMR A;  1ASV A;  4KO0 A;  4O55 A;  1C1B A;  3QIO A;  5K14 A;  1G15 A;  4CIF A;  3AVM A;  1BHL A;  1I3A A;  1BCM A;  2F96 A;  3K5L A;  4B9T A;  1S1W A;  2ETJ A;  4DTP A;  4DQP A;  1RT7 A;  3OS1 A;  1Z25 A;  4LH4 A;  3SPZ A;  3DMJ A;  1KSP A;  4FK2 A;  2GUI A;  3SYZ A;  4FLX A;  3D45 A;  3AV9 A;  4YNQ A;  3TAE A;  1QS4 A;  4BDZ A;  1C1A A;  4AHT A;  4BAC A;  1NJY A;  2G8U A;  2HMI A;  1EP4 A;  4CJ3 A;  3HPG A;  2D0C A;  3SUO A;  4FM2 A;  2ITG A;  5HRP A;  1YTU A;  3LP2 A;  4E3S A;  3K5N A;  4PQU A;  3ZT4 A;  4CGI A;  2VWK A;  3DOK A;  3OYC A;  3KK3 A;  4CCH A;  5SWM A;  4CFC A;  3M8R A;  1JLQ A;  4KFB A;  1CXU A;  3T19 A;  4OPK A;  4ID5 A;  1ZBF A;  4L8R B;  1SKR A;  5DK5 A;  1BQM A;  4RW6 A;  1LW2 A;  2OZS A;  1I39 A;  5SZT A;  3HXM A;  2G8W A;  3AVC A;  5KI6 A;  4CEB A;  3CM6 A;  3V81 A;  1ASU A;  3TAG A;  1X9M A;  5T7B A;  4FVM A;  4J2A A;  1HNV A;  3LWM A;  2W42 A;  1VSE A;  4CHN A;  3RMB A;  4M3W A;  3M8Q A;  3KD5 E;  4E1M A;  4DFJ A;  4QAG A;  4FJI A;  5JS2 A;  1QQC A;  1KTQ A;  1U48 A;  5JS1 A;  2HVH A;  4E89 A;  3CFO A;  1HNI A;  4M3Z A;  2HW3 A;  1U4B A;  3JSM A;  3SZ2 A;  4FM0 A;  3L8B A;  1JLB A;  2HB5 A;  1S9E A;  3AA2 A;  2XO7 A;  3V4I A;  2XY6 A;  1KRP A;  4W5T A;  3QER A;  1U47 A;  4I2P A;  2YNH A;  4OLB A;  3PUF A;  3C94 A;  2BGG A;  3AO4 A;  4C8M A;  3OJS A;  5KRS A;  2QXF A;  2FBV A;  1ASW A;  2YNI A;  4CF9 A;  4BWJ A;  3SUN A;  3SQ0 A;  1TK8 A;  3C6T A;  1EXQ A;  1RCH A;  3QIN A;  4ID1 A;  4OKK A;  2PYJ A;  4KHY A;  4O4G A;  4DTJ A;  4OLA A;  3PX0 A;  4FCY A;  4GMJ B;  3MXJ A;  4KTW A;  3U3Y A;  4Z4G A;  5HLF A;  4B9S A;  3DI6 A;  4DQQ A;  3VQD A;  4UQG A;  3QNN A;  1SKW A;  3AO2 A;  4DTR A;  1BGX T;  3V1R A;  4KHS A;  5C25 A;  3CFP A;  2QKK A;  2G8I A;  2G8V A;  3VQC A;  1KVB A;  5E41 A;  2YKM A;  1GOA A;  4N56 A;  4NYN A;  3NBP A;  4I2Q A;  4RW8 A;  3ZSQ A;  4M3U A;  1BL3 A;  3WNG A;  4CED A;  1EX4 A;  4CF8 A;  4CGJ A;  1Z26 A;  4O5B A;  4ELV A;  3RWU A;  4FXD A;  4QOZ B;  2WOM A;  1JXE A;  4FW2 A;  2D0B A;  4H4M A;  4FJN A;  4E1N A;  2X74 A;  1VSH A;  3QEP A;  2FBY A;  1DLO A;  3NGI A;  1TGO A;  4ZHR A;  4F2R A;  1VSI A;  2DTU A;  1JLE A;  3LZJ A;  3AVK A;  2XY5 A;  4AH9 A;  2BAN A;  3S3O A;  4IG0 A;  1S5J A;  4CHQ A;  1NJX A;  3IG1 A;  1SL0 A;  2Y1I A;  4PUO A;  3M8P A;  1UAX A;  4OKJ A;  4EP4 A;  3AO3 A;  4M3X A;  1HJR A;  1RT5 A;  3HPH A;  1CXQ A;  3AVJ A;  3LAK A;  1ZYQ A;  4DQI A;  1RTJ A;  3EYZ A;  1A5X A;  5I42 A;  4LSN A;  5FRO A;  1L3T A;  4CF2 A;  2ZD1 A;  2ATQ A;  1XHZ A;  1TAU A;  1HQU A;  2IGI A;  4OGE A;  4ELT A;  2ZE2 A;  3CM5 A;  2HHT A;  1KFD A;  1RT1 A;  3K2P A;  1QE1 A;  2G8H A;  1B9D A;  4FJ5 A;  3L3V A;  3OJU A;  4CJF A;  4AIL C;  3LAL A;  3H08 A;  1CLQ A;  5CZ1 A;  1L3U A;  4EZ6 A;  4FJ7 A;  1VRU A;  1KVA A;  4AHC A;  4CEQ A;  4FJJ A;  1LWC A;  5CYQ A;  4FJ9 A;  3I0S A;  1LW0 A;  3BGR A;  4FW1 A;  4DSJ A;  4KHN A;  2HHV A;  4FLV A;  3K5M A;  3SUQ A;  2BDP A;  2ZQB A;  1RBS A;  2KZM A;  3K5O A;  4N47 A;  1C0T A;  4DSF A;  4FK0 A;  1S1T A;  1JXB A;  1L5U A;  1IKX A;  1UA0 A;  4CK1 A;  4BDY A;  4Z4E A;  3S3N A;  3V6D A;  4RW4 A;  4CHO A;  4DFP A;  1IO2 A;  2PZS A;  4NCA A;  3VQ9 A;  3NF6 A;  4E7L A;  3VQE A;  5EU7 A;  3T3F A;  1TVR A;  3VQP A;  2FC0 A;  4E7H A;  4CHZ A;  3PY8 A;  4CJE A;  4K8X A;  4XIU A;  1RTD A;  4AHV A;  4CJ4 A;  2XY7 A;  4IKF A;  2EX3 A;  2X6S A;  1NK5 A;  3PV8 A;  1WN7 A;  4IFV A;  1TK0 A;  1NK8 A;  2KFZ A;  3OVN A;  4HUE A;  4CJK A;  2OPP A;  4KRE A;  5KRT A;  1RBU A;  1S6Q A;  3VQ4 A;  3KLF A;  1XI1 A;  3TWH A;  4HHT A;  4DSI A;  3DLB A;  4DS5 A;  4DU4 A;  4N41 A;  4KHW A;  4Z4H A;  2PY5 A;  3V1Q A;  1D9D A;  1U45 A;  3ITH A;  3AO5 A;  4NYF A;  2IDO A;  4DTU A;  4CJL A;  1C6V A;  4LSL A;  3THV A;  3HVT A;  1JLG A;  4FM1 A;  2JGU A;  3RMD A;  3P1G A;  2VWJ A;  3SCX A;  1RDA A;  3MXM A;  1XC9 A;  2E6M A;  4CJW A;  4CEZ A;  4CFB A;  3QNO A;  3HT3 A;  4ZTJ A;  1TKX A;  3IRX A;  4JRP A;  1WSJ A;  5HBM A;  3VQ5 A;  3K57 A;  2NUB A;  3NF7 A;  4C8N A;  3NH1 A;  1X1P A;  3QEX A;  2PYL A;  1VK0 A;  1LWF A;  3OYF A;  2KZZ A;  2A1S A;  3NGZ A;  4KB0 A;  4CIE A;  4FLW A;  4E7K A;  4Y1D A;  1JLA A;  2LSN A;  3MEG A;  4CJS A;  3KJV A;  1QTM A;  4OPJ A;  3L3U A;  3DRR A;  4DU3 A;  2DFH A;  4HUG A;  3MED A;  3LP0 A;  4CF1 A;  4CER A;  3NHG A;  1T03 A;  2O4I A;  1WSG A;  3ISN C;  5C24 A;  1QSY A;  2P1J A;  4CFD A;  1U04 A;  3VQ8 A;  1TK5 A;  4B9N A;  2HHS A;  4C8K A;  3KKS A;  4BE0 A;  1GOB A;  1GOC A;  2HVI A;  2KW4 A;  1NOZ A;  4CEO A;  3S3M A;  2D0A A;  3RR7 A;  2HHU A;  4E7I A;  3ZSY A;  3QLH A;  4CJT A;  3LP3 A;  1QHT A;  4EP5 A;  3OYN A;  4CEA A;  1RBV A;  3DYA A;  1N6Q A;  4W5Q A;  4CHP A;  1ZBI A;  4DFK A;  4DTS A;  3M8S A;  1SV5 A;  3WNE A;  1KLM A;  4DTX A;  1X9S A;  2HHX A;  4B9U A;  4GW6 A;  1VSM A;  3OYJ A;  4BDP A;  4E0D A;  3S9H A;  1J54 A;  3AVH A;  4ZTF A;  5FRN A;  4DSL A;  3T1A A;  4KI4 A;  3HP9 A;  1N5Y A;  5KTQ A;  3OYG A;  1S1V A;  1UOC A;  3NF8 A;  2BE2 A;  3AVL A;  4CF0 A;  4CGG A;  1NK6 A;  2YNF A;  3UIQ A;  1RDD A;  2VG5 A;  1NOY A;  4W5N A;  4FJG A;  3BDP A;  1W0H A;  3P83 D;  2KFN A;  3VQ7 A;  3OYL A;  3ZCM A;  1IKY A;  1B9F A;  1RTH A;  1FXX A;  1WNS A;  3KKR A;  1TKZ A;  1RT6 A;  3ZT2 A;  3TAP A;  4FZZ A;  4AHU A;  2XRI A;  1SL1 A;  1NK9 A;  4HUF A;  5HRR A;  2YHA A;  5CYM A;  1RNH A;  1ZBU A;  4DSE A;  4CJ5 A;  1KCF A;  2QK9 A;  3F9K A;  5C42 A;  2Z1G A;  3KLG A;  3ZSW A;  2RN2 A;  1QSS A;  5KGW A;  3MXI A;  3AVA A;  4RW7 A;  1SUQ A;  3RR8 A;  2KQ2 A;  5J2Q A;  1A5W A;  3K59 A;  3SQ2 A;  1R0A A;  4N76 A;  3C95 A;  4DF4 A;  3AVG A;  4F2S A;  1QSL A;  1Q8I A;  3HM9 A;  2HHW A;  1D5A A;  3SQ1 A;  4Y1C A;  3E01 A;  3HP6 A;  1KVC A;  1SL2 A;  4DU1 A;  3CFR A;  1HRH A;  1JLF A;  4IBN A;  3VA3 A;  3QEI A;  4J2B A;  1UWB A;  4B8A B;  3VQB A;  1FK9 A;  3VN5 A;  4DLG A;  3G0Z A;  1JL2 A;  2B5J A;  3WNF A;  4CGD A;  1YTA A;  1JL1 A;  1FKP A;  1O1W A;  4I7F A;  3OS2 A;  4DQS A;  5HRO A;  1U49 A;  4FZX C;  3MAQ A;  1L3S A;  3LPT A;  3A2F A;  3D0P A;  1ZBL A;  1HYV A;  1ITG A;  3AVN A;  4N5S A;  3V9W A;  3OYM A;  3NAE A;  3DRS A;  2Q3S A;  4LD0 A;  4K8Z A;  1BI4 B;  1NKE A;  4KB1 A;  4CHY A;  4I9Q A;  4B3O A;  5HRS A;  2D5R A;  1WLJ A;  2KTQ A;  2OPR A;  1BIS A;  1C0M A;  2RPI A;  2YHB A;  3L2V A;  1S1X A;  1S1U A;  4DSK A;  3KK2 A;  3ZSO A;  1YT3 A; 
#chains in the Genus database with same CATH topology
 1VSK A;  2YNG A;  1NK7 A;  4WQ5 C;  4DLE A;  3CC7 N;  4B3T K;  4DV4 K;  3HK2 A;  4IXC A;  1XC3 A;  3DLE A;  1BIZ A;  4JD2 B;  1YVN A;  2GEL A;  1T05 A;  4KH6 A;  4QS9 A;  5AQS A;  5J1E A;  4KHU A;  1IG9 A;  1BG3 A;  2WON A;  3MN6 A;  3MWP A;  4R79 A;  1UA1 A;  3IMX A;  4F3T A;  3CCE N;  4FWL A;  3HVR A;  1WB9 A;  1K73 O;  1D9F A;  3FFI A;  2IOC A;  3HOT A;  4FVU A;  3GDQ A;  4ELU A;  2W40 A;  4H5N A;  3SJJ A;  3AO1 A;  1NK0 A;  4HTU A;  4E19 A;  1J5O A;  1WUA A;  3UKR A;  2UU9 K;  1T7P A;  3B8A X;  4LY7 A;  2NRX A;  4PWD A;  3CIP A;  1V4S A;  1KD1 O;  5AQJ A;  3AGR A;  4J2E A;  3LM2 A;  3NDK A;  1Q9Y A;  3THW B;  4DR4 K;  5CZ2 A;  3AA5 X;  4PA1 A;  2P9U B;  2PAV A;  4OVL A;  4DMN A;  1TL3 A;  4AM6 A;  3HBT A;  2NRV A;  3LP1 A;  2P5O A;  2WUS A;  1W97 L;  1T6D A;  3ZT3 A;  4CJP A;  3DLH A;  5ADX H;  3CME N;  4Q0B A;  3MN5 A;  3UKU B;  1C0G A;  2YKN A;  3QDK A;  4IDK A;  4GNI A;  3RSE A;  4H8K A;  4JRQ A;  1DT9 A;  2NRH A;  4F9O A;  3L2Q A;  1DTT A;  3P31 A;  1IH7 A;  1HYS A;  4NCB A;  3QET A;  1VSJ A;  3C0B A;  4M7X A;  1HQE A;  4CJV A;  5GAG P;  2Z1H A;  4A5A A;  3J81 O;  2HND A;  3ZX0 A;  4O44 A;  2HBL A;  2QW9 A;  4DQ8 A;  1YUW A;  2UUC K;  4YY3 K;  1YIT N;  1VQ5 N;  3ZT1 A;  3O9Q A;  2E88 A;  4CES A;  2E2O A;  2QXL A;  1W9H A;  3HST B;  3HJF A;  1IKV A;  3L2R A;  2GX9 A;  4H5V A;  4I6M B;  3NF9 A;  2A1R A;  4KTQ A;  1CZB A;  1JCF A;  2GBZ A;  3SK3 A;  5F0X A;  1DKG D;  3OYE A;  4JS4 A;  3VQ6 A;  4JHD B;  1N8R O;  3UE5 A;  4H5W A;  1WSE A;  3IDH A;  2I5J A;  3CJA A;  3CXC M;  4DTM A;  3RRH A;  4K42 A;  5GIO A;  1P8Z A;  3FZF A;  3G10 A;  1LV5 A;  4CK3 A;  4JI5 K;  2FSN A;  1Q86 O;  3E9P A;  1QQN A;  1WBD A;  4JLH A;  4C8L A;  3CMA N;  5C2F A;  3TAM A;  1NKC A;  1FKO A;  1YAG A;  3U9D A;  4H0V B;  3TTC A;  4Z4I A;  3VA0 A;  1HPM A;  2HNZ A;  4TSX A;  4DS4 A;  4WYB A;  2OYQ A;  3T69 A;  2IVP A;  5KGX A;  1RTI A;  3DLG A;  4I9L A;  1XHX A;  3EZW A;  4A61 A;  2HNY A;  1HPZ A;  2V51 B;  2QKB A;  3NE6 A;  1D8Y A;  1KAZ A;  4CJQ A;  2VG6 A;  1TAQ A;  3NH0 A;  2IS3 A;  3U6F A;  2Z1J A;  4RG8 A;  5AQO A;  4WE1 A;  2X78 A;  3BF1 A;  5K14 A;  1GLF O;  4EHU A;  1BHL A;  5IWA K;  3K5L A;  1FJG K;  4B9T A;  1S1W A;  2ETJ A;  4DQP A;  5AQK A;  1J6Z A;  4FK2 A;  4LH4 A;  3H6E A;  2A40 A;  3SYZ A;  5JMV A;  4YNQ A;  3TAE A;  4AHT A;  4BAC A;  5KPT A;  3OW2 M;  5M1P A;  4FM2 A;  1CZA N;  4KHP K;  4PQU A;  1MA9 B;  2YI1 A;  3ZT4 A;  3HRG A;  1SKR A;  1I39 A;  3HXM A;  4A62 A;  2G8W A;  3AVC A;  3TAG A;  5T7B A;  4FVM A;  2W42 A;  5H1S Q;  1HKC A;  2UUA K;  3R6M A;  5JS2 A;  1KTQ A;  4E89 A;  3CFO A;  2HW3 A;  3SZ2 A;  2Q1N A;  2HB5 A;  2XY6 A;  4W5T A;  3QER A;  4OLB A;  3AY9 A;  4FOE A;  5KRS A;  1C0F A;  3SQ0 A;  1ASW A;  1Y64 A;  4JYA K;  4ID1 A;  4JKD A;  4KHY A;  4JK8 A;  4DTJ A;  4Z4G A;  4B9Q A;  4DQQ A;  2E20 A;  2ASM A;  3VQD A;  3AO2 A;  3H1Q A;  3O1B A;  3CJC A;  3THX B;  2QWQ A;  2V52 B;  2JWK A;  2G8I A;  1KVB A;  2YKM A;  1GOA A;  3KHY A;  4IOC L;  2ZF5 O;  4NYN A;  4I2Q A;  4RW8 A;  3GG4 A;  1BL3 A;  3WNG A;  5FLX O;  4QOZ B;  3RWU A;  4FWO A;  4H4M A;  3VEY A;  2OAN A;  1K8A O;  4E1N A;  1VSH A;  1GLD G;  2FBY A;  4F2R A;  1MDU B;  2J4R A;  5KQD A;  4FWP A;  4CHQ A;  2Y1I A;  4PUO A;  3M8P A;  3AO3 A;  5DM7 L;  3FR0 A;  4IEI A;  1ZYQ A;  3CQX A;  1A5X A;  4BRE A;  5FRO A;  4FWN A;  4ISF A;  4DUY K;  3ZEU B;  2ATQ A;  2IGI A;  5JIC A;  3C65 A;  1QE1 A;  1B9D A;  3H46 O;  3L3V A;  3H08 A;  3C7N B;  1E4G T;  3TTD A;  5KPZ A;  4DSJ A;  2HHV A;  2ZQB A;  1RBS A;  4N47 A;  2HBM A;  5FPE A;  1JXB A;  4A57 A;  1UA0 A;  4LFC K;  3S3N A;  4GKJ K;  4DFP A;  1IO2 A;  3NF6 A;  3VQE A;  4BRC A;  4CZM A;  5LMN K;  4B1U B;  1XUP O;  1S22 A;  1RTD A;  2GUP A;  2XY7 A;  2X6S A;  1NK8 A;  2KFZ A;  1BDG A;  1HNW K;  4JKB A;  4KRE A;  5KRT A;  1XI1 A;  1EQY A;  4DU4 A;  2PY5 A;  3V1Q A;  4MO5 A;  3BZC A;  5AQH A;  3AO5 A;  1QHA A;  4FOI A;  3SAF A;  3U8X A;  4NXM K;  3SMS A;  1C6V A;  3WT0 A;  3RMD A;  2JGU A;  1RDA A;  1XC9 A;  4CFB A;  4DKW A;  3HT3 A;  4DV5 K;  1TKX A;  4JRP A;  4ILJ A;  4C8N A;  5AQU A;  3G71 N;  4KB0 A;  3R9P A;  1RGI A;  3J7Y P;  5AQZ A;  3LP0 A;  1JCG A;  4JNE A;  1QSY A;  2P1J A;  1TK5 A;  4B9N A;  2WC9 A;  3KKS A;  4JV5 K;  1NOZ A;  3RR7 A;  2HHU A;  4EP5 A;  1HNX K;  3LP3 A;  5LL6 Z;  1RBV A;  3DYA A;  1E3M A;  4DCH A;  4DFK A;  4DTS A;  3M8S A;  1SV5 A;  2HBK A;  2HHX A;  1NGH A;  1RDW X;  4PKI A;  1VSM A;  2QEX N;  3SLC A;  2V7Z A;  2FSK A;  4X66 K;  3UB5 A;  1GLB G;  4WQ4 A;  2HF3 A;  4CBU A;  1NK6 A;  2YNF A;  3WXL A;  1IV0 A;  3UIQ A;  1VQ9 N;  3P4I A;  4H0O A;  4BRN A;  3VQ7 A;  3OYL A;  1NGF A;  3OBY A;  1RTH A;  2ZJP L;  1FXX A;  3VOV A;  5EX5 A;  3ZT2 A;  2IVO A;  5E26 A;  4BR5 A;  4ILH A;  1SL1 A;  4FO0 A;  1W2B M;  4JI7 K;  1QVF M;  5CYM A;  2OCE A;  3G4S N;  3F9K A;  4BRI A;  2Z1G A;  5C42 A;  3ZSW A;  1QSS A;  4IDH A;  4PL7 A;  1SUQ A;  3RR8 A;  2KQ2 A;  4DV2 K;  3SBG A;  4WF9 L;  1WBB A;  5AQF A;  3AGK A;  1Q8I A;  3O9T A;  3HM9 A;  4Y1C A;  3E01 A;  3HP6 A;  2BTF A;  1X3N A;  1FK9 A;  4JI6 K;  2B5J A;  4CGD A;  3CCQ N;  2D0P A;  4I7F A;  4DHY A;  3O8M A;  1ITG A;  3AVN A;  3V9W A;  4FWS A;  2Q3S A;  2WBN A;  4K8Z A;  1NGC A;  4KH4 A;  1BWF O;  1C0M A;  1OVY A;  1XQS C;  4KBO A;  3L2V A;  1S1X A;  1S1U A;  4DSK A;  3ZSO A;  5AQG A;  2F9W A;  5LMU K;  4B08 A;  3OY9 A;  1Q82 O;  1JJ2 M;  3SMP A;  2B6A A;  4XH5 A;  4MLE A;  4Y0W A;  3HI0 A;  4CK2 A;  5C10 A;  1S6P A;  5BPL A;  4AHR A;  1Q18 A;  2NRW A;  1BIU A;  2P9S A;  1NGG A;  5FPD A;  1M90 O;  3AA3 A;  1TUU A;  1EWR A;  3JXU A;  1NWK A;  3ENB A;  3ZX2 A;  4B9L A;  3AA4 A;  4BR0 A;  2FXU A;  3O3F A;  4WFN L;  2X6N A;  5AZJ B;  4DR1 K;  4CEC A;  3KWG A;  4HWI A;  5LJV A;  1ESV A;  3AVF A;  3IAY A;  4IG3 A;  1VRT A;  3WQT A;  4FJM A;  1IKW A;  3FE1 A;  3ZSR A;  4YOV A;  2JLE A;  3RMA A;  3TAN A;  3VQQ A;  1Y97 A;  1TKD A;  4M41 A;  3SI6 A;  4YOY A;  4WQ5 A;  3FZK A;  1BOT O;  2ASO A;  2KLA A;  5C15 A;  4X65 K;  3NGY A;  5FRM A;  3IS9 A;  2VWB A;  3B6P A;  3ENH A;  4B9M A;  2CH5 A;  4M45 A;  1CZ9 A;  3V9X A;  1S9G A;  3NH2 A;  3LDP A;  2OPS A;  3SV3 A;  2O8D A;  1NGE A;  3QBW A;  4JI1 K;  4OKE A;  1QZ5 A;  2GWJ A;  5JVG L;  3MX5 A;  2EWS A;  4A2B A;  4DFM A;  3DXK B;  1LAV A;  3HO1 A;  3VF4 A;  3MN9 A;  1N33 K;  2DFE A;  3TAR A;  1HMV A;  2V7Y A;  3M3Z A;  3TR8 A;  4DR5 K;  2E6L A;  4RW9 A;  2CH6 A;  1T6C A;  2F9T A;  4FLT A;  3D7E O;  4CEE A;  2O4G A;  2HBJ A;  5GAH P;  3FFK B;  1TKT A;  4KAZ A;  1ZBH A;  3CI5 A;  4JKA A;  2WTU A;  4YDU C;  1RT3 A;  4DF8 A;  4DG1 A;  4GY2 B;  3QB0 A;  4JI2 K;  3QIP A;  1WAF A;  3CJ1 A;  5D3G A;  3PO4 A;  4KTZ A;  1NGB A;  3VQA A;  2H3G X;  4JI8 K;  1C1C A;  1NM1 A;  1RT2 A;  1HNZ K;  2Z1I A;  2G8K A;  3JS6 A;  1IJJ A;  3VER A;  4YOX A;  3TAF A;  4KPY A;  1RBR A;  3E1Y A;  3KIO A;  4O0J A;  2WFB A;  4DTN A;  1F21 A;  4DQR A;  1K6Y A;  2I7P A;  3BZK A;  4YOU A;  4B8C A;  4EZ9 A;  3CC2 N;  3MK6 A;  2YX6 A;  4CZE A;  4DR6 K;  4FJL A;  2XHB A;  1BI4 A;  1RDU A;  3GOI A;  1S72 N;  4CJR A;  4C8O A;  3E9O A;  3O3G A;  2RF2 A;  1J53 A;  4QS8 A;  3P5J A;  1DTQ A;  4FJK A;  2DY4 A;  3HOS A;  1FW6 A;  3ATU A;  3SNN A;  4BWM A;  3DLR A;  3SAH A;  1VQM N;  1L3V A;  4Z4F A;  2IIR A;  5HRN A;  3MN7 A;  2AA4 A;  3CJ9 A;  1LAW A;  2OZM A;  4PY5 A;  3V9S A;  1TV6 A;  3U3G A;  4CD3 A;  3SUP A;  3ID6 A;  2QWR A;  3MCP A;  5AQW A;  2Q0R A;  2NLX A;  1G15 A;  4CIF A;  2P9N B;  2F96 A;  2UUB K;  1RT7 A;  1KC8 O;  2GUI A;  3D45 A;  1C1A A;  4BVO A;  3M6G A;  3SJH A;  1X3M A;  3SUO A;  1X9J A;  1YTU A;  1MWK A;  2OTL N;  4CCH A;  4KFB A;  1CXU A;  3T19 A;  4L8R B;  5DK5 A;  1BQM A;  2OZS A;  1LW2 A;  5SZT A;  5KI6 A;  4WFA L;  4C1N K;  1ASU A;  3V81 A;  3VEX A;  1HNV A;  1NNE A;  4CHN A;  3RMB A;  4M3W A;  2KKZ A;  4QAG A;  5JS1 A;  4M3Z A;  1U4B A;  4FM0 A;  1JLB A;  3V4I A;  4BRK A;  1DEJ A;  2BGG A;  2O8D B;  3PUF A;  3C94 A;  4OO1 J;  4WCE L;  2FBV A;  4JKG B;  1KAY A;  4BWJ A;  3SUN A;  1RCH A;  3QIN A;  2PYJ A;  4O4G A;  4OLA A;  3VTH A;  4GMJ B;  4CBW A;  5JLF A;  4UQG A;  4AF1 A;  1SKW A;  4CZI A;  1BGX T;  5C25 A;  3CFP A;  3IKM A;  2O8C A;  5E41 A;  3FLC O;  1HR0 K;  3NBP A;  4CED A;  1JXE A;  2D0B A;  1VQ8 N;  4FJN A;  2X74 A;  4DR2 K;  3QEP A;  2YJF A;  3NGI A;  4ZHR A;  3WEE A;  1VSI A;  4CD1 A;  1JLE A;  3LZJ A;  3AVK A;  3CPE A;  4AQY K;  2XY5 A;  4AH9 A;  4IG0 A;  1NJX A;  3OHR A;  2FLO A;  3AVJ A;  3I55 N;  3EYZ A;  2QWL A;  4XEI A;  4CF2 A;  1HQU A;  4PKG A;  1NU0 A;  4H0T B;  4OGE A;  4ELT A;  5LY3 A;  3CM5 A;  2HHT A;  1KFD A;  1U2V A;  2G8H A;  4K43 A;  5IT9 O;  3FGU A;  3LAL A;  1CLQ A;  4EZ6 A;  2Q0U A;  4FJ7 A;  1KVA A;  4FJJ A;  1QZ6 A;  4BG9 A;  3BGR A;  1TYQ A;  4KHN A;  5BRE A;  3K5M A;  3SUQ A;  2BDP A;  3K5O A;  1OH7 A;  1NBW A;  4CK1 A;  4BDY A;  4BRQ A;  3V6D A;  4DB3 A;  1YJW N;  2PZS A;  2IVN A;  3VQ9 A;  2A42 A;  4EIA A;  3PLA A;  1TVR A;  3PY8 A;  4CHZ A;  4XIU A;  3K0S A;  3NMU A;  4AHV A;  2RE2 A;  3U9Z A;  4IKF A;  1NK5 A;  2OPP A;  1RBU A;  3TWH A;  1IBM K;  4HHT A;  4DSI A;  3DLB A;  4DS5 A;  4N41 A;  4KHW A;  2D1K A;  1XMO K;  1D9D A;  5AFU H;  3TSU A;  5BRD A;  3ITH A;  4H0X B;  2ASP A;  3CJ7 A;  5BN8 A;  3VEZ A;  4CJL A;  3HVT A;  5A2Q O;  4FM1 A;  2VWJ A;  4CEZ A;  2VYP A;  1T3V A;  3UKR B;  4ISE A;  4ZTJ A;  3O9U A;  3E9L A;  5HBM A;  3NF7 A;  5BRH A;  1LWF A;  2A1S A;  2A5X A;  4CIE A;  4FLW A;  4GKK K;  1JLA A;  4JI4 K;  3MEG A;  3TPQ A;  4OPJ A;  3L3U A;  4DU3 A;  3EKS A;  2DFH A;  3MED A;  4BRO A;  4CF1 A;  4CER A;  3NHG A;  1T03 A;  4NB4 A;  5EVZ A;  3EL2 A;  4H0Y B;  3AAR A;  3ZX3 A;  1D4X A;  4LF7 K;  1GOB A;  1GOC A;  3ZET A;  2KW4 A;  4BR7 A;  4LF8 K;  2HVI A;  4CEO A;  1VQP N;  3ZSY A;  3QLH A;  4CJT A;  1QHT A;  3WUH A;  4CEA A;  5JLH A;  4EAH D;  4CHP A;  3K9K A;  4BRG A;  1X9S A;  4B9U A;  3OYJ A;  3RSE B;  3S9H A;  4IEE A;  4DSL A;  1Q81 O;  3L4I A;  5KTQ A;  4IO9 L;  4PKH A;  3OYG A;  2BE2 A;  4CF0 A;  4B3M K;  4CGG A;  3MDQ A;  4K25 A;  4W5N A;  3BDP A;  5BPN A;  2QI2 A;  2KFN A;  1K9M O;  3ZCM A;  1IKY A;  2JWL A;  4BGB A;  1RT6 A;  4CZH A;  4FPB A;  1NK9 A;  2O8C B;  2E2N A;  5C0Y A;  3G25 A;  2YHA A;  3D2F A;  1ZBU A;  1Q7Y O;  4CJ5 A;  3MMV A;  1KCF A;  3LM9 A;  4FPA A;  3KLG A;  1KAX A;  3CF5 L;  4RW7 A;  5KPR A;  3AAQ A;  3F2K A;  2E5L K;  4K41 A;  3CCV N;  3K59 A;  3CPW M;  3SQ2 A;  1R0A A;  4N76 A;  3C95 A;  3AVG A;  2P9P A;  3WEE B;  4CJ7 A;  3ZYY X;  4EFH A;  2E2P A;  4BG8 A;  1JLF A;  4J2B A;  2A3Z A;  3QML A;  4B8A B;  4FSV A;  4DLG A;  3WNF A;  2E8A A;  4AM7 A;  4FZX C;  1FKP A;  1O1W A;  4X64 K;  1U49 A;  3MAQ A;  3LPT A;  3A2F A;  3VF6 A;  4N5S A;  1TUY A;  4KB1 A;  2D5R A;  1U2V B;  1JCE A;  2KTQ A;  2QWO A;  2RPI A;  2YHB A;  2D4W A;  3KK2 A;  2ITM A;  3B6O A;  2GTD A;  4HCB A;  3CCL N;  1VSF A;  1WSI A;  2ZJQ L;  1TYQ B;  3DM2 A;  2O8B A;  4KV8 A;  2E2Q A;  4B1V A;  3I0R A;  4BC4 A;  4CIG A;  2P5G A;  3O4N A;  3QES A;  2FBX A;  3MEC A;  3VGL A;  3THY A;  4CJU A;  4WFB L;  4B3R K;  3L2U A;  5CY4 A;  1OH6 A;  3J80 O;  3LDO A;  5J2N A;  1N34 K;  2F8S A;  5C2D A;  3OTO K;  2XY8 A;  4JK9 A;  3ASM A;  2VG7 A;  1IBK K;  4J2D A;  1EWQ A;  1RIL A;  1LOT B;  3DRP A;  3HL8 A;  3O80 A;  4MDB A;  1E4F T;  1LWE A;  1YF5 L;  3PIP L;  4H03 B;  2CGK A;  1REV A;  3SV4 A;  1K8K A;  1BA0 A;  4KI6 A;  4FJ8 A;  4YFU A;  1A5V A;  3OYA A;  2NNW A;  4JKF A;  4BRA A;  5M1F A;  3WXM B;  4OGC A;  4QCL A;  3AAP A;  3PSF A;  1U6Z A;  5I3U A;  4IJA A;  1BCO A;  1RDC A;  2KHO A;  4FZY A;  1N36 K;  2NRZ A;  4OJR A;  4NO7 A;  3PX4 A;  4B1Y B;  3ZET B;  3TAB A;  4PL8 A;  3NCI A;  2Q2R A;  2VGN A;  3LAM A;  4CZG A;  1J5E K;  1VQK N;  4CFA A;  4JS5 A;  1EKE A;  1NMD A;  1RFQ A;  3O5B A;  1NJW A;  3KD1 E;  2NZT A;  3KK1 A;  2G8F A;  3HYF A;  4BC5 A;  1SKS A;  3A8Y A;  3ZSX A;  2ZM6 K;  4CGF A;  4O8K A;  3V9Z A;  4HCC A;  4OPA A;  2F7T A;  2NRT A;  4YOR A;  1IG8 A;  1MU2 A;  4AHS A;  1JLC A;  4CZJ A;  5C12 A;  2QWM A;  1P90 A;  2R7Y A;  2AJQ A;  3D2F B;  5GIN A;  2OA8 A;  2ZWH A;  3C6U A;  3DOL A;  2RHK A;  3LWL A;  2OTJ N;  1VQ4 N;  4Z4C A;  4LH5 A;  3CCJ N;  3OYB A;  3RRG A;  1T44 A;  2DFF A;  1RBT A;  4BGA A;  3WQU A;  4DV7 K;  4W5O A;  3BEX A;  5BR9 A;  3GBT A;  3O4Q A;  3VGK A;  1KFS A;  4YDU A;  3QEW A;  4R5P A;  3S41 A;  1SZ2 A;  3HZ6 A;  4GVE A;  3MEE A;  2OPQ A;  1TL1 A;  3QIC A;  4FJX A;  3HSC A;  2UYT A;  2FBT A;  5HL7 L;  4A5B A;  3R8E A;  3CHW A;  3ATV A;  2F8T A;  3OYI A;  3V9U A;  1Z05 A;  3ULD A;  3QBX A;  4DV3 K;  3ALY A;  2YHX A;  2FF6 A;  4MFB A;  2GWK A;  3D6R A;  3OYK A;  4C1N I;  2IAJ A;  3VF2 A;  2YV0 X;  4G1Q A;  3WNH A;  3AVB A;  3QEV A;  2B4J A;  3O1W A;  3HPO A;  4E7J A;  4DTO A;  1NK4 A;  2HHQ A;  4B9V A;  3NFA A;  3A5O C;  5B8H A;  3RVC A;  1RT4 A;  3O3H A;  1Q9X A;  5DMR A;  4KO0 A;  5M1O A;  1C1B A;  4M7Y A;  3QIO A;  1YJ9 N;  5ADX A;  3AVM A;  1BCM A;  3F9M A;  4DV0 K;  4CZF A;  3BF3 A;  3SPZ A;  1OKJ A;  5F2R A;  3AV9 A;  3Q7C A;  1QS4 A;  4BDZ A;  1NJY A;  1EP4 A;  1YIJ N;  4CJ3 A;  2D0C A;  5EXW A;  3GL1 A;  3LP2 A;  2Q31 A;  4E3S A;  3KK3 A;  2VWK A;  1K8K B;  3DOK A;  5M1Q A;  4B1Z A;  5SWM A;  4CFC A;  3M8R A;  3WXI A;  1ZBF A;  3A0I X;  3THW A;  2QM1 A;  1X9M A;  3DLL L;  5FPM A;  3PSI A;  3LWM A;  1VSE A;  2AP1 A;  4E1M A;  3KD5 E;  1QQC A;  1U48 A;  1HNI A;  4PHT X;  4MLH A;  3L8B A;  2XO7 A;  3AA2 A;  1S9E A;  3THX A;  1KRP A;  3CCR N;  1U47 A;  4I2P A;  3P39 A;  4JN4 A;  4B3S K;  4C8M A;  3OJS A;  2QXF A;  5GAD P;  5JVH L;  1TK8 A;  2NRR A;  5M1K A;  3KZB A;  1EXQ A;  5GAE P;  1GLJ O;  2I7N A;  3EE9 A;  3PX0 A;  4HTL A;  4O5F A;  3EN9 A;  3MXJ A;  3R3L A;  4H5T A;  5KQ8 A;  3U3Y A;  3DI6 A;  5AQP A;  3QNN A;  4DTR A;  1MWM A;  3V1R A;  3H45 C;  3TSQ A;  2G8V A;  3VQC A;  4GV3 A;  3ZLJ A;  1BO5 O;  4N56 A;  4M3U A;  4CF8 A;  1EX4 A;  1Z26 A;  1NG9 A;  4ELV A;  3SBT A;  2WOM A;  2FF3 B;  3TTF A;  5AZI A;  2DTU A;  3S3O A;  1S5J A;  3IG1 A;  3VMF B;  1NGA A;  1UAX A;  4EP4 A;  1KQS M;  3LL3 A;  3HPH A;  2QA4 N;  3LAK A;  3SAG A;  4JHD A;  1L3T A;  1TAU A;  4IWV A;  2P9I A;  1RT1 A;  3L0Q A;  3OJU A;  4AIL C;  2HMP A;  5CZ1 A;  1HKG A;  4EHT A;  4AHC A;  4CEQ A;  1LWC A;  4FJ9 A;  1ATS A;  1LW0 A;  2HST A;  4FW1 A;  4FLV A;  2F4V K;  2KZM A;  3ID8 A;  4IOX A;  4CBX A;  1C0T A;  4DSF A;  3BY5 A;  1S1T A;  1L5U A;  4RW4 A;  4A59 A;  3T3F A;  4J8F A;  1EO1 A;  3IUC A;  2P9S B;  4DR3 K;  2EX3 A;  1TK0 A;  1WN7 A;  4HUE A;  4CJK A;  3C6H A;  3VQ4 A;  5AR0 A;  3KLF A;  2CGL A;  3VEN A;  4BC3 A;  4V19 S;  4BRP A;  2ZGZ A;  2GEM A;  1HKB A;  1U45 A;  5AQI A;  4NYF A;  3FZH A;  2IDO A;  4DTU A;  3G6E N;  3THV A;  5CR4 A;  4LFB K;  2D0O A;  3O08 A;  3MXM A;  2E6M A;  4NLB A;  1HJO A;  3QNO A;  4M63 C;  1NJI O;  3IRX A;  3QEX A;  2PYL A;  3NH1 A;  3OYF A;  2E1Y A;  1QTM A;  3DRR A;  3QFU A;  4HUG A;  3WXJ A;  2O4I A;  1WSG A;  3ISN C;  5C24 A;  3VQ8 A;  4A2A A;  3VET A;  4KH5 A;  3VEW A;  4BE0 A;  1GLA G;  2YJE A;  3BP8 A;  3A5N C;  1GLE G;  1NGJ A;  1O13 A;  1ATN A;  4OX9 K;  3KWI A;  4W5Q A;  1YXQ A;  1KXP A;  1KLM A;  4GW6 A;  4BDP A;  4E0D A;  1J54 A;  4MDA A;  4ZTF A;  5AQL A;  3T1A A;  1GLC G;  3DAW A;  1N5Y A;  1SQK A;  1S1V A;  1UOC A;  3NF8 A;  2YHY A;  5ELZ A;  1RDD A;  1WOQ A;  4FJG A;  2VQF K;  1W0H A;  1B9F A;  1WNS A;  2YHW A;  4H0P A;  4IO8 A;  3FZL A;  1XNR K;  3VEV A;  1G99 A;  3AVA A;  4BVP A;  2HF4 A;  5AZI B;  3ULE A;  4DF4 A;  4F2S A;  4XH4 A;  1QSL A;  2HHW A;  1D5A A;  3L6Q A;  1KVC A;  1SL2 A;  1HRH A;  4IBN A;  3QEI A;  4BRL A;  1UWB A;  2A41 A;  3HM8 A;  1JL2 A;  4BC2 A;  2A6A A;  4RTF D;  5HRO A;  3LDQ A;  5TKW A;  4DQS A;  3ZEU A;  3MWT A;  4UY8 O;  1BA1 A;  3D0P A;  4BRM A;  1VHX A;  3DRS A;  4LD0 A;  1BI4 B;  2P9I B;  4I9Q A;  1WLJ A;  5I9E B;  2OPR A;  3C7N A;  1BIS A;  4FL9 A;  2UXD K;  3NVK A;  1YI2 N;  5BPM A;  1YT3 A;  2W6K A;  1XWL A;  3FZM A;  3P38 A;  3ENO A;  3CCM N;  3OS0 A;  1WAJ A;  3KTQ A;  3TI0 A;  2P9K A;  4KKO A;  5AJ3 K;  5TKY A;  3L2W A;  3CQ8 A;  3K9J A;  4FLZ A;  3H1V X;  1B92 A;  3KLI A;  4IFE A;  3RTV A;  3OYH A;  5EY4 A;  4M42 A;  3EEQ A;  3LDN A;  1NGI A;  4ICL A;  2GV9 A;  5AQR A;  2RKI A;  4YOT A;  4H4O A;  3O9S A;  1NLV A;  3ZT0 A;  3AVI A;  3CG7 A;  4FWQ A;  4FLU A;  3A5M C;  5AQM A;  3PO5 A;  4IZ9 A;  1JKH A;  4XH1 A;  4FWR A;  4FYD A;  1C0U A;  3MX2 A;  1SS6 A;  2O8F A;  4JI3 K;  2O8E A;  1RDB A;  4F8R A;  1H1V A;  2EHG A;  1J9A A;  4C23 A;  4JEP A;  1HYZ A;  1WSH A;  2E4L A;  5EOY A;  1VSD A;  4BY9 C;  3QO9 A;  1OVQ A;  3SQ4 A;  1VQN N;  4MQ3 A;  4M3T A;  4DV1 K;  2P9L A;  5LJW A;  4CZK A;  3RMC A;  4BR9 A;  5FDL A;  3W0L A;  5HP1 A;  3LAN A;  3EZ5 A;  4BE1 A;  4K0K K;  2IC3 A;  1ZXO A;  2QTD A;  1X9W A;  1NKB A;  4H5R A;  4M3R A;  4NCG A;  4W5R A;  4GV9 A;  4BE2 A;  5BRF A;  4DWI A;  3T1H K;  2QWN A;  2Y1J A;  3JYT A;  3OYD A;  4FLY A;  3ZSZ A;  3WXK A;  1EET A;  4IFY A;  3PIO L;  3KLH A;  1N32 K;  1BQN A;  1QVG M;  4LC9 B;  3K58 A;  3CYM A;  3EY1 A;  3F73 A;  4O0I A;  3QFP A;  1S3X A;  4KRF A;  1OH8 A;  3KLE A;  5AQY A;  4M3Y A;  3V1O A;  3TAQ A;  4F4K A;  3LPU A;  3ULE B;  1VAZ A;  1VSL A;  3DXM A;  1HX1 A;  1QQO A;  4GVM A;  1ILY A;  2ZJR L;  4KHQ A;  2W6L A;  5M1N A;  3SPY A;  1WSF A;  3TSP A;  3LDS A;  4LF5 K;  1YJN N;  3LZI A;  3U4L A;  4B1X B;  4JKC A;  4FJH A;  4Q5V A;  3LDL A;  1W7A A;  1KLN A;  4CGH A;  1YVU A;  2KZZ A;  5J2P A;  2VQE K;  4CEF A;  1BU6 O;  2PFU A;  3PX6 A;  4HVJ A;  3DLK A;  2BUP A;  3VGM A;  1T8E A;  3DWL A;  5J2M A;  3ZSV A;  2P51 A;  4CE9 A;  4G9Z A;  4Z0U A;  2P9K B;  3JAM O;  5AQT A;  4F3O A;  5BN9 A;  4JK7 A;  1NJZ A;  1IBL K;  3I8D A;  2BH1 A;  4FK4 A;  3CJB A;  1ASV A;  4O55 A;  3H3N O;  1NGD A;  3DJC A;  3H3O B;  1I3A A;  3O6W A;  4FWM A;  5AZJ A;  4DTP A;  3OS1 A;  1Z25 A;  1KSP A;  3DMJ A;  3EKU A;  2UXB K;  4FLX A;  5AQV A;  2G8U A;  2HMI A;  3HPG A;  3J7Z O;  1V4T A;  2ITG A;  5HRP A;  3K5N A;  4OPH A;  4CGI A;  3OYC A;  4NLC A;  5BR8 K;  3Q7B A;  3CD6 N;  1JLQ A;  1DGK N;  4OPK A;  4ID5 A;  5F1X A;  4LFA K;  1VQ6 N;  4RW6 A;  4CEB A;  4LF6 K;  3CM6 A;  2HHH K;  4J2A A;  4RCH A;  3M8Q A;  4DFJ A;  4FJI A;  2O8F B;  2Q36 A;  2HVH A;  2O8E B;  3JSM A;  2Q97 A;  3O4W A;  4B1W B;  2YNH A;  3I56 N;  1XMQ K;  4ISG A;  3AO4 A;  3DXK A;  3OA9 A;  1QQM A;  2P9L B;  2YNI A;  4CF9 A;  4OKK A;  3C6T A;  2PBD A;  4FCY A;  4KTW A;  5HLF A;  4B9S A;  5E84 A;  1NMN A;  4BRH A;  4LF9 K;  4KHS A;  3MCA B;  3VEO A;  2QKK A;  4QS7 A;  4JI0 K;  1VQ7 N;  2FSJ A;  3ZSQ A;  4MO4 A;  4IJN A;  1BUP A;  4CGJ A;  4JKE A;  4O5B A;  4FXD A;  4YOW A;  3IFR A;  4FW2 A;  3T7Z A;  3TU5 A;  3O9R A;  1DLO A;  1TGO A;  4BQZ A;  1I94 K;  2BAN A;  2P9P B;  3VES A;  2HOE A;  1SL0 A;  4OKJ A;  2DPN A;  1HUX A;  4M3X A;  1HJR A;  1RT5 A;  1CXQ A;  4DQI A;  1RTJ A;  5I42 A;  2VCP A;  4LSN A;  4O8U A;  1ZC6 A;  2ZD1 A;  4CW7 B;  3DXM B;  3HTV A;  3M1F A;  3CCU N;  2ZE2 A;  3VPZ A;  3EO3 A;  3K2P A;  4BRD A;  4FJ5 A;  4CJF A;  4NXN K;  2YCH A;  3D2E A;  1L3U A;  1VRU A;  4BR4 A;  1Z6R A;  5CYQ A;  1VQL N;  3W3D A;  3I0S A;  4CI6 A;  3L4Q A;  4FK0 A;  2O8B B;  1IKX A;  4U7B A;  4JKH A;  4Z4E A;  4CHO A;  3EE8 A;  4NCA A;  4E7L A;  1R59 O;  4JD2 A;  4JAX A;  5EU7 A;  4ILG B;  3VQP A;  4Z94 A;  2FC0 A;  4E7H A;  5FPN A;  3THY B;  4CJE A;  4K8X A;  3N4P A;  4CJ4 A;  3E66 A;  5HOO A;  4CZL A;  1ATR A;  3VTI A;  4IFV A;  3PV8 A;  3OVN A;  3I33 A;  1S6Q A;  4DUZ K;  5CE3 A;  4Z4H A;  4BRF A;  4L3Q A;  3OBW A;  3KVG A;  1VQO N;  2P9N A;  2W41 A;  4LSL A;  1JLG A;  2QWP A;  3SCX A;  3P1G A;  3NVM A;  4CJW A;  5CHI A;  3CER A;  1WSJ A;  3VQ5 A;  3K57 A;  2NUB A;  1X1P A;  4WQ4 C;  5GIP A;  1VK0 A;  3T1Y K;  3J7A P;  3NGZ A;  4E7K A;  4Y1D A;  2LSN A;  3KJV A;  4CJS A;  4DV6 K;  5AQN A;  2P9U A;  1M1K O;  4CFD A;  1U04 A;  4IOA L;  2HHS A;  4C8K A;  1HLU A;  3I8B A;  3S3M A;  2D0A A;  4E7I A;  3OYN A;  3UKU A;  4BR2 A;  1N6Q A;  1SAZ A;  3CC4 N;  1ZBI A;  3CCS N;  4DTX A;  3F5T A;  3WNE A;  2VGM A;  1YHQ N;  3AVH A;  4GV6 A;  5FRN A;  3A5L C;  1XNQ K;  4JKG A;  4KI4 A;  3HP9 A;  1GLL O;  3AVL A;  5AQX A;  4FWK A;  3N4Q A;  2VG5 A;  4RWT A;  1NOY A;  2CGJ A;  3P83 D;  3KKR A;  1TKZ A;  3TAP A;  4FZZ A;  4AHU A;  1OH5 A;  2XRI A;  4X62 K;  4HUF A;  5HRR A;  4DSE A;  1RNH A;  3KK7 A;  4I6M A;  2QK9 A;  2RN2 A;  2E1Z A;  4E1J A;  3CQY A;  5KGW A;  3MXI A;  5J2Q A;  1A5W A;  2ZGY A;  1LCU A;  3R1X A;  4BQL A;  5AQQ A;  5MLC Q;  3SQ1 A;  3GE1 A;  3CET A;  4U67 L;  4DU1 A;  3CFR A;  3VA3 A;  3VQB A;  1ZBS A;  3VN5 A;  1XHZ A;  3G0Z A;  3BUZ B;  1YTA A;  1JL1 A;  3OS2 A;  3C6A A;  1L3S A;  5DM6 L;  1ZBL A;  1HYV A;  3J8A A;  5AFU A;  3OYM A;  3NAE A;  1NKE A;  4LF4 K;  4CHY A;  4B3O A;  5HRS A;  4YHH K;  3M5R A;  4DR7 K;  3D2E B;  2UXC K;  4CVN E; 
#chains in the Genus database with same CATH homology
 1VSK A;  1XWL A;  3B6O A;  4HCB A;  4B08 A;  1VSF A;  3OY9 A;  1WSI A;  2YNG A;  2B6A A;  3DM2 A;  1NK7 A;  3OS0 A;  1WAJ A;  4DLE A;  3KTQ A;  4KV8 A;  3HK2 A;  3I0R A;  4CK2 A;  3TI0 A;  4KKO A;  1S6P A;  4CIG A;  3O4N A;  4AHR A;  3DLE A;  2P5G A;  3QES A;  2FBX A;  3MEC A;  1BIU A;  3L2W A;  4CJU A;  1BIZ A;  3L2U A;  5CY4 A;  3CQ8 A;  3AA3 A;  4FLZ A;  1T05 A;  5J2N A;  5J1E A;  4KHU A;  2F8S A;  1IG9 A;  4B9L A;  2WON A;  1B92 A;  3AA4 A;  4F3T A;  1UA1 A;  3KLI A;  2XY8 A;  3RTV A;  3OYH A;  3O3F A;  3HVR A;  3ASM A;  2VG7 A;  4M42 A;  4J2D A;  2X6N A;  1RIL A;  3DRP A;  3HL8 A;  1D9F A;  4ICL A;  2GV9 A;  4CEC A;  3IAY A;  3AVF A;  3FFI A;  1LWE A;  2RKI A;  4IG3 A;  1VRT A;  4H4O A;  2IOC A;  4FJM A;  1IKW A;  3ZT0 A;  3ZSR A;  3AVI A;  2JLE A;  3RMA A;  1REV A;  3TAN A;  4ELU A;  3CG7 A;  3VQQ A;  3SJJ A;  1Y97 A;  3AO1 A;  4HTU A;  4FLU A;  1TKD A;  4M41 A;  4E19 A;  3SV4 A;  3SI6 A;  1NK0 A;  1J5O A;  1T7P A;  4LY7 A;  4KI6 A;  4PWD A;  4FJ8 A;  4YFU A;  1A5V A;  3OYA A;  4J2E A;  3NDK A;  1Q9Y A;  3PO5 A;  3NGY A;  1JKH A;  5FRM A;  4OGC A;  4QCL A;  3IS9 A;  5CZ2 A;  4FYD A;  3AA5 X;  1C0U A;  5I3U A;  3B6P A;  4B9M A;  4PA1 A;  4OVL A;  4M45 A;  1BCO A;  1CZ9 A;  1RDC A;  1TL3 A;  4DMN A;  3V9X A;  4FZY A;  1S9G A;  4OJR A;  1RDB A;  3NH2 A;  3LP1 A;  4F8R A;  2EHG A;  1J9A A;  2P5O A;  3PX4 A;  1HYZ A;  1WSH A;  2E4L A;  2OPS A;  1VSD A;  3SV3 A;  3TAB A;  3QO9 A;  3NCI A;  3SQ4 A;  4MQ3 A;  3ZT3 A;  4CJP A;  3DLH A;  4Q0B A;  4M3T A;  4OKE A;  3LAM A;  3RMC A;  4CFA A;  4JS5 A;  2YKN A;  4DFM A;  1LAV A;  3HO1 A;  4IDK A;  5FDL A;  1EKE A;  3KD1 E;  1NJW A;  4H8K A;  4JRQ A;  2DFE A;  3KK1 A;  2G8F A;  3L2Q A;  5HP1 A;  3LAN A;  3TAR A;  1HMV A;  3TR8 A;  1DTT A;  3HYF A;  2E6L A;  4RW9 A;  1SKS A;  3ZSX A;  3EZ5 A;  1IH7 A;  4BE1 A;  1HYS A;  4FLT A;  4NCB A;  3QET A;  1VSJ A;  2IC3 A;  4CJV A;  1HQE A;  4CGF A;  4CEE A;  2Z1H A;  1X9W A;  2O4G A;  1NKB A;  2HND A;  4M3R A;  1TKT A;  4O44 A;  4KAZ A;  4NCG A;  4W5R A;  1ZBH A;  3V9Z A;  4BE2 A;  4DWI A;  4HCC A;  1RT3 A;  4DF8 A;  2Y1J A;  4DG1 A;  3ZT1 A;  3JYT A;  3OYD A;  4FLY A;  3ZSZ A;  4CES A;  3QIP A;  1EET A;  4IFY A;  1MU2 A;  4AHS A;  1W9H A;  3KLH A;  1WAF A;  1BQN A;  1JLC A;  3HST B;  3K58 A;  3HJF A;  3CYM A;  3EY1 A;  3F73 A;  1IKV A;  4O0I A;  3L2R A;  3PO4 A;  5D3G A;  2R7Y A;  2AJQ A;  4KTZ A;  4KRF A;  3NF9 A;  3C6U A;  3DOL A;  3VQA A;  3KLE A;  2A1R A;  2OA8 A;  4KTQ A;  3LWL A;  4M3Y A;  1CZB A;  1C1C A;  3V1O A;  1RT2 A;  2G8K A;  2Z1I A;  3TAQ A;  4Z4C A;  4LH5 A;  4F4K A;  3LPU A;  2GBZ A;  3OYB A;  3RRG A;  3OYE A;  4JS4 A;  3TAF A;  2DFF A;  1RBT A;  3VQ6 A;  1VSL A;  4KPY A;  1RBR A;  3KIO A;  4O0J A;  4W5O A;  4DTN A;  1F21 A;  4DQR A;  1WSE A;  4GVM A;  1K6Y A;  3O4Q A;  4KHQ A;  4B8C A;  3SPY A;  1WSF A;  2I5J A;  4DTM A;  4EZ9 A;  3LDS A;  1KFS A;  3RRH A;  3QEW A;  1LV5 A;  3G10 A;  4R5P A;  4CK3 A;  3LZI A;  4FJL A;  3MEE A;  2OPQ A;  2XHB A;  1BI4 A;  1TL1 A;  4CJR A;  4FJX A;  4C8O A;  4JLH A;  3O3G A;  4C8L A;  1NKC A;  3TAM A;  2FBT A;  2RF2 A;  1FKO A;  1J53 A;  4FJH A;  4Q5V A;  3P5J A;  1DTQ A;  1KLN A;  4CGH A;  1YVU A;  3OYI A;  3V9U A;  3VA0 A;  5J2P A;  4FJK A;  3ULD A;  4Z4I A;  2HNZ A;  4TSX A;  4CEF A;  4DS4 A;  2DY4 A;  2OYQ A;  3ALY A;  4MFB A;  5KGX A;  1RTI A;  3DLG A;  4I9L A;  1XHX A;  3SNN A;  3OYK A;  4HVJ A;  2HNY A;  3DLR A;  1HPZ A;  3DLK A;  2IAJ A;  4BWM A;  5J2M A;  3PX6 A;  3NE6 A;  1T8E A;  3ZSV A;  1L3V A;  5HRN A;  1D8Y A;  4Z4F A;  2F8T A;  2QKB A;  2P51 A;  4CJQ A;  2VG6 A;  1TAQ A;  4CE9 A;  3NH0 A;  2YV0 X;  2IS3 A;  4G1Q A;  1LAW A;  3WNH A;  3AVB A;  4Z0U A;  2B4J A;  3HPO A;  4DTO A;  4E7J A;  3QEV A;  1NK4 A;  3V9S A;  2OZM A;  1TV6 A;  4PY5 A;  3U6F A;  2HHQ A;  2Z1J A;  4F3O A;  4B9V A;  3U3G A;  4RG8 A;  1NJZ A;  3NFA A;  4WE1 A;  3SUP A;  3I8D A;  1RT4 A;  3O3H A;  1Q9X A;  2X78 A;  4FK4 A;  5DMR A;  1ASV A;  4KO0 A;  4O55 A;  1C1B A;  3QIO A;  5K14 A;  1G15 A;  4CIF A;  3AVM A;  1BHL A;  1I3A A;  1BCM A;  2F96 A;  3K5L A;  4B9T A;  1S1W A;  2ETJ A;  4DTP A;  4DQP A;  1RT7 A;  3OS1 A;  1Z25 A;  4LH4 A;  3SPZ A;  3DMJ A;  1KSP A;  4FK2 A;  2GUI A;  3SYZ A;  4FLX A;  3D45 A;  3AV9 A;  4YNQ A;  3TAE A;  1QS4 A;  4BDZ A;  1C1A A;  4AHT A;  4BAC A;  1NJY A;  2G8U A;  2HMI A;  1EP4 A;  4CJ3 A;  3HPG A;  2D0C A;  3SUO A;  4FM2 A;  2ITG A;  5HRP A;  1YTU A;  3LP2 A;  4E3S A;  3K5N A;  4PQU A;  3ZT4 A;  4CGI A;  2VWK A;  3DOK A;  3OYC A;  3KK3 A;  4CCH A;  5SWM A;  4CFC A;  3M8R A;  1JLQ A;  4KFB A;  1CXU A;  3T19 A;  4OPK A;  4ID5 A;  1ZBF A;  4L8R B;  1SKR A;  5DK5 A;  1BQM A;  4RW6 A;  1LW2 A;  2OZS A;  1I39 A;  5SZT A;  3HXM A;  2G8W A;  3AVC A;  5KI6 A;  4CEB A;  3CM6 A;  3V81 A;  1ASU A;  3TAG A;  1X9M A;  5T7B A;  4FVM A;  4J2A A;  1HNV A;  3LWM A;  2W42 A;  1VSE A;  4CHN A;  3RMB A;  4M3W A;  3M8Q A;  3KD5 E;  4E1M A;  4DFJ A;  4QAG A;  4FJI A;  5JS2 A;  1QQC A;  1KTQ A;  1U48 A;  5JS1 A;  2HVH A;  4E89 A;  3CFO A;  1HNI A;  4M3Z A;  2HW3 A;  1U4B A;  3JSM A;  3SZ2 A;  4FM0 A;  3L8B A;  1JLB A;  2HB5 A;  1S9E A;  3AA2 A;  2XO7 A;  3V4I A;  2XY6 A;  1KRP A;  4W5T A;  3QER A;  1U47 A;  4I2P A;  2YNH A;  4OLB A;  3PUF A;  3C94 A;  2BGG A;  3AO4 A;  4C8M A;  3OJS A;  5KRS A;  2QXF A;  2FBV A;  1ASW A;  2YNI A;  4CF9 A;  4BWJ A;  3SUN A;  3SQ0 A;  1TK8 A;  3C6T A;  1EXQ A;  1RCH A;  3QIN A;  4ID1 A;  4OKK A;  2PYJ A;  4KHY A;  4O4G A;  4DTJ A;  4OLA A;  3PX0 A;  4FCY A;  4GMJ B;  3MXJ A;  4KTW A;  3U3Y A;  4Z4G A;  5HLF A;  4B9S A;  3DI6 A;  4DQQ A;  3VQD A;  4UQG A;  3QNN A;  1SKW A;  3AO2 A;  4DTR A;  1BGX T;  3V1R A;  4KHS A;  5C25 A;  3CFP A;  2QKK A;  2G8I A;  2G8V A;  3VQC A;  1KVB A;  5E41 A;  2YKM A;  1GOA A;  4N56 A;  4NYN A;  3NBP A;  4I2Q A;  4RW8 A;  3ZSQ A;  4M3U A;  1BL3 A;  3WNG A;  4CED A;  1EX4 A;  4CF8 A;  4CGJ A;  1Z26 A;  4O5B A;  4ELV A;  3RWU A;  4FXD A;  4QOZ B;  2WOM A;  1JXE A;  4FW2 A;  2D0B A;  4H4M A;  4FJN A;  4E1N A;  2X74 A;  1VSH A;  3QEP A;  2FBY A;  1DLO A;  3NGI A;  1TGO A;  4ZHR A;  4F2R A;  1VSI A;  2DTU A;  1JLE A;  3LZJ A;  3AVK A;  2XY5 A;  4AH9 A;  2BAN A;  3S3O A;  4IG0 A;  1S5J A;  4CHQ A;  1NJX A;  3IG1 A;  1SL0 A;  2Y1I A;  4PUO A;  3M8P A;  1UAX A;  4OKJ A;  4EP4 A;  3AO3 A;  4M3X A;  1HJR A;  1RT5 A;  3HPH A;  1CXQ A;  3AVJ A;  3LAK A;  1ZYQ A;  4DQI A;  1RTJ A;  3EYZ A;  1A5X A;  5I42 A;  4LSN A;  5FRO A;  1L3T A;  4CF2 A;  2ZD1 A;  2ATQ A;  1XHZ A;  1TAU A;  1HQU A;  2IGI A;  4OGE A;  4ELT A;  2ZE2 A;  3CM5 A;  2HHT A;  1KFD A;  1RT1 A;  3K2P A;  1QE1 A;  2G8H A;  1B9D A;  4FJ5 A;  3L3V A;  3OJU A;  4CJF A;  4AIL C;  3LAL A;  3H08 A;  1CLQ A;  5CZ1 A;  1L3U A;  4EZ6 A;  4FJ7 A;  1VRU A;  1KVA A;  4AHC A;  4CEQ A;  4FJJ A;  1LWC A;  5CYQ A;  4FJ9 A;  3I0S A;  1LW0 A;  3BGR A;  4FW1 A;  4DSJ A;  4KHN A;  2HHV A;  4FLV A;  3K5M A;  3SUQ A;  2BDP A;  2ZQB A;  1RBS A;  2KZM A;  3K5O A;  4N47 A;  1C0T A;  4DSF A;  4FK0 A;  1S1T A;  1JXB A;  1L5U A;  1IKX A;  1UA0 A;  4CK1 A;  4BDY A;  4Z4E A;  3S3N A;  3V6D A;  4RW4 A;  4CHO A;  4DFP A;  1IO2 A;  2PZS A;  4NCA A;  3VQ9 A;  3NF6 A;  4E7L A;  3VQE A;  5EU7 A;  3T3F A;  1TVR A;  3VQP A;  2FC0 A;  4E7H A;  4CHZ A;  3PY8 A;  4CJE A;  4K8X A;  4XIU A;  1RTD A;  4AHV A;  4CJ4 A;  2XY7 A;  4IKF A;  2EX3 A;  2X6S A;  1NK5 A;  3PV8 A;  1WN7 A;  4IFV A;  1TK0 A;  1NK8 A;  2KFZ A;  3OVN A;  4HUE A;  4CJK A;  2OPP A;  4KRE A;  5KRT A;  1RBU A;  1S6Q A;  3VQ4 A;  3KLF A;  1XI1 A;  3TWH A;  4HHT A;  4DSI A;  3DLB A;  4DS5 A;  4DU4 A;  4N41 A;  4KHW A;  4Z4H A;  2PY5 A;  3V1Q A;  1D9D A;  1U45 A;  3ITH A;  3AO5 A;  4NYF A;  2IDO A;  4DTU A;  4CJL A;  1C6V A;  4LSL A;  3THV A;  3HVT A;  1JLG A;  4FM1 A;  2JGU A;  3RMD A;  3P1G A;  2VWJ A;  3SCX A;  1RDA A;  3MXM A;  1XC9 A;  2E6M A;  4CJW A;  4CEZ A;  4CFB A;  3QNO A;  3HT3 A;  4ZTJ A;  1TKX A;  3IRX A;  4JRP A;  1WSJ A;  5HBM A;  3VQ5 A;  3K57 A;  2NUB A;  3NF7 A;  4C8N A;  3NH1 A;  1X1P A;  3QEX A;  2PYL A;  1VK0 A;  1LWF A;  3OYF A;  2KZZ A;  2A1S A;  3NGZ A;  4KB0 A;  4CIE A;  4FLW A;  4E7K A;  4Y1D A;  1JLA A;  2LSN A;  3MEG A;  4CJS A;  3KJV A;  1QTM A;  4OPJ A;  3L3U A;  3DRR A;  4DU3 A;  2DFH A;  4HUG A;  3MED A;  3LP0 A;  4CF1 A;  4CER A;  3NHG A;  1T03 A;  2O4I A;  1WSG A;  3ISN C;  5C24 A;  1QSY A;  2P1J A;  4CFD A;  1U04 A;  3VQ8 A;  1TK5 A;  4B9N A;  2HHS A;  4C8K A;  3KKS A;  4BE0 A;  1GOB A;  1GOC A;  2HVI A;  2KW4 A;  1NOZ A;  4CEO A;  3S3M A;  2D0A A;  3RR7 A;  2HHU A;  4E7I A;  3ZSY A;  3QLH A;  4CJT A;  3LP3 A;  1QHT A;  4EP5 A;  3OYN A;  4CEA A;  1RBV A;  3DYA A;  1N6Q A;  4W5Q A;  4CHP A;  1ZBI A;  4DFK A;  4DTS A;  3M8S A;  1SV5 A;  3WNE A;  1KLM A;  4DTX A;  1X9S A;  2HHX A;  4B9U A;  4GW6 A;  1VSM A;  3OYJ A;  4BDP A;  4E0D A;  3S9H A;  1J54 A;  3AVH A;  4ZTF A;  5FRN A;  4DSL A;  3T1A A;  4KI4 A;  3HP9 A;  1N5Y A;  5KTQ A;  3OYG A;  1S1V A;  1UOC A;  3NF8 A;  2BE2 A;  3AVL A;  4CF0 A;  4CGG A;  1NK6 A;  2YNF A;  3UIQ A;  1RDD A;  2VG5 A;  1NOY A;  4W5N A;  4FJG A;  3BDP A;  1W0H A;  3P83 D;  2KFN A;  3VQ7 A;  3OYL A;  3ZCM A;  1IKY A;  1B9F A;  1RTH A;  1FXX A;  1WNS A;  3KKR A;  1TKZ A;  1RT6 A;  3ZT2 A;  3TAP A;  4FZZ A;  4AHU A;  2XRI A;  1SL1 A;  1NK9 A;  4HUF A;  5HRR A;  2YHA A;  5CYM A;  1RNH A;  1ZBU A;  4DSE A;  4CJ5 A;  1KCF A;  2QK9 A;  3F9K A;  5C42 A;  2Z1G A;  3KLG A;  3ZSW A;  2RN2 A;  1QSS A;  5KGW A;  3MXI A;  3AVA A;  4RW7 A;  1SUQ A;  3RR8 A;  2KQ2 A;  5J2Q A;  1A5W A;  3K59 A;  3SQ2 A;  1R0A A;  4N76 A;  3C95 A;  4DF4 A;  3AVG A;  4F2S A;  1QSL A;  1Q8I A;  3HM9 A;  2HHW A;  1D5A A;  3SQ1 A;  4Y1C A;  3E01 A;  3HP6 A;  1KVC A;  1SL2 A;  4DU1 A;  3CFR A;  1HRH A;  1JLF A;  4IBN A;  3VA3 A;  3QEI A;  4J2B A;  1UWB A;  4B8A B;  3VQB A;  1FK9 A;  3VN5 A;  4DLG A;  3G0Z A;  1JL2 A;  2B5J A;  3WNF A;  4CGD A;  1YTA A;  1JL1 A;  1FKP A;  1O1W A;  4I7F A;  3OS2 A;  4DQS A;  5HRO A;  1U49 A;  4FZX C;  3MAQ A;  1L3S A;  3LPT A;  3A2F A;  3D0P A;  1ZBL A;  1HYV A;  1ITG A;  3AVN A;  4N5S A;  3V9W A;  3OYM A;  3NAE A;  3DRS A;  2Q3S A;  4LD0 A;  4K8Z A;  1BI4 B;  1NKE A;  4KB1 A;  4CHY A;  4I9Q A;  4B3O A;  5HRS A;  2D5R A;  1WLJ A;  2KTQ A;  2OPR A;  1BIS A;  1C0M A;  2RPI A;  2YHB A;  3L2V A;  1S1X A;  1S1U A;  4DSK A;  3KK2 A;  3ZSO A;  1YT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...