4CIEA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
152
structure length
146
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 146
sequence length 152
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cieA00
1ZBHA 3L2QA 1NJZA 4RG8A 3DRSA 3AO2A 4FW1A 3RRGA 4KREA 1VRTA 5J2NA 2E4LA 3KD5E 3AO4A 2HHSA 3OYBA 3D0PA 4FM1A 4B9TA 1C0MA 3VQ8A 3PX6A 4FYDA 1S5JA 4CJ4A 1SUQA 3AVIA 3OS1A 2ZQBA 3AA3A 3LP1A 2P1JA 3OYGA 3QNNA 1Q9YA 1JL2A 4W5NA 1BISA 2X78A 3O4NA 1X1PA 3VQ5A 3ASMA 2NUBA 3A2FA 4E1NA 3NDKA 2HNZA 2WONA 3WNFA 4CJQA 4CJTA 3DRRA 4AHRA 3SUQA 2I5JA 1NKBA 1J54A 2ZE2A 4PA1A 4M3UA 2YNGA 2P51A 1WSGA 1GOCA 3NCIA 4M3XA 4DTRA 3OYFA 4FJLA 5JS1A 3NH2A 1LW0A 3DLEA 3F9KA 5DK5A 3D45A 3QEVA 2HB5A 5K14A 3TAGA 1T8EA 4KTQA 2P5GA 4FK0A 1IH7A 1FK9A 3RR8A 2KQ2A 2YHAA 1O1WA 4CHOA 4CJKA 5FROA 4FCYA 4FJIA 1DTQA 4CJLA 4DTJA 3U3YA 3T19A 4DSKA 4PQUA 3ITHA 4ELUA 4KV8A 3AVHA 4RW4A 4QOZB 2OPSA 4J2AA 1D8YA 1RTJA 3HYFA 3AO1A 3L8BA 4I9QA 4NCGA 3DM2A 1TK8A 4B9MA 1D5AA 4IKFA 4GVMA 1B92A 3PO5A 4C8NA 5CY4A 1HMVA 5CZ2A 4FJKA 1NK0A 4UQGA 5EU7A 1JXBA 4I7FA 4ICLA 4DFPA 4DQQA 4BDYA 3RWUA 2HHTA 3VQPA 3SYZA 3DLKA 4W5QA 4HUGA 3I8DA 4Z4IA 1CZBA 3BGRA 3KLGA 3S3NA 1YT3A 4AHCA 3K58A 4E7LA 1N5YA 1S1UA 3KK2A 4DWIA 4B9LA 4N47A 3HO1A 5HP1A 2BGGA 1LWEA 2F8TA 3KK1A 1QTMA 4DSEA 3QLHA 3ZSXA 1S9EA 1HYSA 3CM5A 2VG7A 4B8AB 1HPZA 3V4IA 1CLQA 3LWLA 2KZMA 3MEEA 3KK3A 4AILC 4FJGA 1JL1A 4CEEA 3IS9A 1B9DA 1RT7A 1BQMA 4E7IA 4BDPA 2Y1JA 2O4IA 4DTPA 2EX3A 2G8UA 3JYTA 3IG1A 1CZ9A 2YKNA 4FJ5A 2AJQA 4CF1A 4DTMA 4CECA 1NK9A 4Q5VA 3OYNA 3LZJA 1NK8A 1JLBA 3ISNC 2HVIA 2GUIA 2DTUA 4K8XA 3V1OA 4HCBA 3DYAA 3SUPA 1SL2A 4RW9A 3TAMA 3QERA 1BHLA 1VSLA 5E41A 3LPTA 1S1VA 3AVCA 3IRXA 4CJFA 4FJHA 2JLEA 1HJRA 4Y1CA 1VSFA 3LP3A 4CESA 3P83D 4MFBA 3NH1A 4B9VA 1XI1A 3U6FA 2B5JA 4NCAA 1NK7A 1C0UA 1RNHA 4CFAA 4DF4A 1BCOA 3G10A 1EP4A 4ELTA 3MECA 3L3VA 2KTQA 4JS4A 1U47A 3CFRA 1BCMA 1VSMA 1L3VA 1X9SA 1VSKA 1RT6A 1REVA 1VRUA 5C24A 3WNEA 4CK1A 3F73A 1S6QA 3QEWA 2VWKA 1U45A 3OYEA 3CG7A 3VQ4A 1A5VA 4DLGA 2VG6A 1WSIA 4Z4FA 1W0HA 3OYAA 4CGFA 2E6MA 5JS2A 1UA0A 3P1GA 3LAKA 1KSPA 3KLFA 1WSJA 3V1QA 2B6AA 4DSIA 5HRRA 1BL3A 5CYMA 5SWMA 2IGIA 4FZZA 1HQEA 1XWLA 2Y1IA 1KRPA 4CEAA 4FK2A 1BI4A 2EHGA 3HPGA 1RTIA 1Q9XA 4M3RA 3K5MA 1D9FA 1LW2A 3PX0A 3MXMA 1LAVA 2ITGA 1WSEA 3JSMA 2DY4A 4L8RB 5HBMA 2Z1IA 3QINA 1QE1A 4CHZA 3P5JA 1N6QA 4B08A 1L3SA 4KHNA 1JXEA 1RBTA 3MXJA 1KVCA 1RTDA 4FLUA 4B9SA 3NF9A 2F8SA 1KVAA 3ZSZA 2PY5A 3K5OA 3HVRA 2PYLA 4B3OA 1FXXA 4Y1DA 2O4GA 1BQNA 4Z4CA 1L3UA 1J5OA 4DQIA 4OLAA 3BDPA 4KRFA 3DLGA 4ZHRA 4FLXA 4H4MA 2YNHA 1BGXT 4KHQA 1JKHA 1NKCA 1X9MA 3TAFA 2VWJA 4F3OA 4E1MA 4KI4A 1HNVA 2KFNA 2BANA 4LSNA 3CQ8A 1Z26A 3ZSWA 2XHBA 3VQCA 2P5OA 3ZSYA 1SKSA 1KLNA 3KD1E 3HM9A 4Z0UA 4FZYA 4IDKA 1NJYA 1QSYA 4BE2A 4C8LA 4DS5A 5KGXA 1HYZA 3AVBA 5C42A 2FBXA 3NH0A 3V1RA 2ATQA 3VA3A 3I0SA 2YNFA 3AVKA 1SKWA 3AV9A 4IBNA 3KKSA 1GOBA 3C94A 3ALYA 2OA8A 1RT4A 1QSSA 1ASUA 1HNIA 4OLBA 1BI4B 2LSNA 1I3AA 4KPYA 3PO4A 1U49A 1QS4A 3NF6A 3S9HA 3SV4A 1QSLA 3HL8A 2DFEA 2RN2A 4F2RA 4NYNA 5KGWA 4OGEA 4F2SA 4FJJA 3ZSVA 1ZYQA 1ZBIA 3TARA 3V9WA 1RDBA 3QNOA 1UWBA 4OKJA 1K6YA 5J2MA 1ZBUA 4CGJA 3OYJA 4H4OA 3S3OA 1TAUA 1SV5A 3NAEA 4DTXA 3VQ9A 4LSLA 3MXIA 1NKEA 3O4QA 2OZSA 4EP5A 1U04A 4YFUA 5CYQA 1KLMA 4N5SA 3VQBA 3K2PA 2XY8A 1LWCA 4CE9A 4HUEA 4EZ6A 5HRSA 4M3ZA 5J2PA 4DLEA 3KJVA 4CJWA 3SQ1A 4OVLA 1IKYA 3TANA 2IC3A 5HLFA 1J9AA 4OGCA 3HP6A 4F3TA 3SUNA 1F21A 4ELVA 1EKEA 3VQDA 1ZBFA 1VSIA 1MU2A 1IKWA 4CFBA 3QEIA 4CF2A 2OPQA 3VQQA 3L2RA 1S6PA 1SL0A 4CEZA 4FLWA 3LAMA 3MEGA 1EETA 2G8IA 4CF0A 4O0IA 4BWJA 3TI0A 4Z4GA 1WAFA 3M8SA 4KHSA 1YTUA 4CGGA 2DFHA 4FLYA 2KZZA 1VSJA 4DMNA 4LY7A 2Z1HA 3SQ0A 4B8CA 3SPZA 4FJMA 4CJRA 4BE1A 5HRNA 4J2EA 3OY9A 1RTHA 4E0DA 4F8RA 1WSFA 3L2WA 4FJNA 1B9FA 1LWFA 1RDDA 2BE2A 4IFVA 4J2DA 1T03A 1D9DA 4O5BA 4CHNA 3E01A 4OKEA 4CIGA 4E7JA 2GV9A 2YHBA 1X9WA 3NBPA 4RW6A 1ASVA 1YTAA 3EZ5A 4CIFA 2R7YA 4F4KA 4KFBA 5KRTA 1FKOA 4FXDA 1RT5A 4HUFA 4FM0A 1I39A 5I42A 1KFSA 4KHYA 3LPUA 1RBRA 2IAJA 3OJSA 4DQPA 1WSHA 3AVAA 2WOMA 5J2QA 4AH9A 5KRSA 3K57A 2RKIA 2OPRA 3O3GA 2RF2A 4DQSA 3SQ2A 3QEXA 1U48A 3S3MA 2DFFA 3DRPA 3WNHA 2IS3A 1RILA 2XY6A 1RBVA 4CK2A 3KIOA 2X74A 3VQEA 4FW2A 1FKPA 1HQUA 1KCFA 5D3GA 4PY5A 5KI6A 3AVFA 3LALA 1Q8IA 4HVJA 3DLRA 3SCXA 3CFOA 3HXMA 3TR8A 4CHPA 4OPKA 3NFAA 3IAYA 1TV6A 5HRPA 3L2VA 2W42A 4W5TA 3M8RA 3SJJA 1VSDA 1ASWA 2HHQA 3B6OA 3DOKA 4CEFA 4W5RA 3NF7A 1VSHA 1T05A 2G8FA 2D0BA 4Z4EA 1QQCA 3VQAA 3NGYA 4KO0A 3NE6A 4AHVA 4CJUA 3THVA 4M3TA 1HYVA 1KVBA 1L5UA 4M3YA 1KTQA 1S1XA 4NCBA 2HHXA 2RPIA 4FJ7A 1NJWA 1C6VA 4NYFA 4DSFA 4CF9A 3OYKA 1ITGA 4BWMA 4DG1A 3AO3A 4JRPA 3AA5X 3SI6A 4B9UA 3ZT0A 3M8PA 2XRIA 2YV0X 4E3SA 4CIEA 2HNDA 2XY7A 3LZIA 3V9SA 3ZCMA 2A1RA 1LAWA 3B6PA 3I0RA 3M8QA 2FBVA 3T1AA 1IG9A 4FM2A 3HK2A 1JLFA 3PX4A 4M45A 3MAQA 4FZXC 4CJVA 4LH4A 4LH5A 2HVHA 2OPPA 4TSXA 4ZTJA 4E7HA 2Z1GA 4O4GA 2D5RA 5J1EA 3RRHA 1R0AA 2G8WA 3HT3A 5CZ1A 4RW7A 3DOLA 4C8MA 3ZSQA 3ZT3A 3C6TA 3RTVA 3U3GA 3QEPA 3SNNA 1UAXA 1VK0A 2A1SA 3KLEA 4FLTA 3V6DA 2PZSA 4DSJA 1BIZA 4DF8A 1UA1A 3HPHA 4K8ZA 4KKOA 1T7PA 2G8VA 4FK4A 3QESA 4HCCA 1IO2A 1WLJA 2Z1JA 1ZBLA 1BIUA 2X6SA 4OJRA 3RR7A 2QKKA 4AHTA 3HVTA 3CFPA 3HJFA 3RMDA 1TK5A 2KW4A 4KHWA 3LP2A 3NGIA 3AO5A 4CF8A 3TABA 3RMAA 4M3WA 3NGZA 5FRMA 3KKRA 2XO7A 3SZ2A 5I3UA 3DI6A 1NJXA 3T3FA 4ZTFA 4BE0A 4BDZA 1JLQA 4JS5A 4HHTA 4FJ9A 4N76A 1EX4A 4DFMA 3AA2A 4CGHA 4YNQA 1GOAA 3ULDA 3QIOA 5KTQA 3OS0A 2F96A 1DTTA 1S1WA 1TKZA 2FC0A 2ETJA 4KTZA 4EP4A 4I2QA 4MQ3A 4CEOA 3PY8A 3L3UA 3LANA 1QHTA 1RCHA 1CXUA 4DTUA 3CYMA 3KTQA 1RT1A 2OZMA 4KI6A 4PWDA 3OYDA 4IG0A 4HTUA 3CM6A 1L3TA 2HHWA 4KB0A 1TK0A 5FRNA 1S9GA 3SUOA 3UIQA 2FBYA 2IDOA 4JLHA 3LWMA 4FVMA 1TAQA 3H08A 2QXFA 1TL3A 4I9LA 1TKTA 1RBUA 1A5XA 3V9XA 3WNGA 2FBTA 5DMRA 3SQ4A 3HP9A 3QO9A 3QIPA 4B9NA 4DFJA 4IFYA 3OYLA 4CJEA 1HRHA 4PUOA 2B4JA 4KTWA 3EY1A 2HW3A 1RDAA 4E19A 3TAEA 3PV8A 3VN5A 3RMCA 4C8OA 4FJXA 4CJSA 2QK9A 4E7KA 4CGIA 4GMJB 4DU3A 1XC9A 1DLOA 3TWHA 1TKXA 1W9HA 3ZSRA 2PYJA 1C1BA 1JLAA 4WE1A 4CJPA 3OYMA 3AVLA 4M41A 4DTNA 2HHVA 3V9UA 2HHUA 4XIUA 3AVNA 1TKDA 2HNYA 3TAPA 1TGOA 1WN7A 3PUFA 4KAZA 4W5OA 4O0JA 1Y97A 5T7BA 1NK4A 1XHXA 3VA0A 1U4BA 4O44A 3NF8A 2D0AA 4CEDA 3L2UA 2YKMA 4CEBA 2QKBA 1JLEA 3FFIA 1C1CA 1RT3A 4E89A 1VSEA 3K59A 2GBZA 1NK5A 1C1AA 4ID5A 3OVNA 3NHGA 4RW8A 1S1TA 3EYZA 4DU1A 1NK6A 4KB1A 3OS2A 4DQRA 3HPOA 2Q3SA 4CERA 2OYQA 3OYIA 4CFCA 2IOCA 4OKKA 3DLHA 1UOCA 4C8KA 4N41A 1KFDA 1SKRA 3LP0A 1SL1A 3ZT4A 3G0ZA 4QAGA 4CHYA 2E6LA 3V9ZA 4CFDA 3KLHA 1IKXA 3DMJA 4ID1A 3VQ7A 1RBSA 3AVGA 2ZD1A 4BACA 4N56A 4FLZA 2XY5A 3RMBA 1JLGA 4GW6A 2D0CA 3AVMA 3ZT1A 4EZ9A 2G8HA 3AVJA 2JGUA 2HMIA 1LV5A 3C6UA 3O3FA 4J2BA 3TAQA 3OJUA 3OYHA 4FLVA 1C0TA 3C95A 3ZSOA 4DTSA 3LDSA 4CCHA 5HROA 3K5LA 4G1QA 4DFKA 4DSLA 1NOYA 4Q0BA 2KFZA 1WAJA 3KLIA 3OYCA 4AHSA 5C25A 1G15A 1JLCA 4O55A 3K5NA 1A5WA 1RDCA 4IG3A 4M42A 3HSTB 1EXQA 1WNSA 1Z25A 4LD0A 3ZT2A 4DU4A 4R5PA 4CGDA 2BDPA 4KHUA 2G8KA 1NOZA 2X6NA 5FDLA 4CJ3A 4JRQA 4DTOA 1TVRA 4CJ5A 3V81A 2VG5A 3SPYA 3DLBA 4Z4HA 4DS4A 5SZTA 4QCLA 2YNIA 1TL1A 4I2PA 4FJ8A 3MEDA 1IKVA 1XHZA 3SV3A 1RT2A 3VQ6A 4CHQA 3QETA 4OPJA 4CK3A 4CEQA 1YVUA 3O3HA 1CXQA 4AHUA 4H8KA 1J53A 3AA4A
chains in the Genus database with same CATH superfamily
3BEXA 5GAHP 1ZBHA 1NJZA 4FW1A 3RRGA 1VRTA 2WBNA 3IMXA 2A3ZA 3KD5E 2HHSA 3OYBA 1C0MA 3Q7CA 3PX6A 4FYDA 1SUQA 3AA3A 3LP1A 3CCEN 4GNIA 4DV6K 3TTDA 3NDKA 2NUBA 3GL1A 1XMOK 5AQQA 3ZLJA 2FSNA 3DRRA 2PFUA 5AQPA 1NKBA 4BY9C 2QM1A 3L4QA 4PA1A 3THWB 3AY9A 4B3SK 3OYFA 1LOTB 1VQON 2UUCK 3TAGA 4IJNA 2P5GA 4YOUA 2YHAA 1O1WA 1DTQA 4DTJA 4DSKA 1T6CA 4ELUA 1TYQB 1BOTO 5BREA 4QOZB 4GVEA 3MWTA 2QTDA 3L8BA 2NRZA 4PL8A 3OBWA 1D5AA 1VQ6N 4IKFA 1B92A 1JCEA 3A5OC 3THYA 4UQGA 1M1KO 4ICLA 4YHHK 4BDYA 1DGKN 3VQPA 4HUGA 4IO8A 1HUXA 3KLGA 1MWKA 1WOQA 1S1UA 3P4IA 2NRRA 3FLCO 5HP1A 2F8TA 3C7NA 1QTMA 4DSEA 1E3MA 4IWVA 3ZYYX 1S3XA 3CM5A 4C23A 3MEEA 3KK3A 4AILC 2YHYA 4FJGA 3R8EA 2FSJA 2O4IA 3G25A 5EY4A 1CZ9A 2HMPA 2YKNA 4FJ5A 2AJQA 2P9LA 1NK9A 3C0BA 2RHKA 3HOTA 2DTUA 4JI2K 3RSEA 4K8XA 4FWSA 3PIPL 2CH5A 4DR1K 4RW9A 3TAMA 4CI6A 5AQOA 1S1VA 3EE9A 3IRXA 4A5BA 3TSUA 4BC3A 2NRWA 3CPWM 4CESA 3MDQA 3P83D 2QWRA 4YOVA 4B9VA 1XI1A 3U6FA 3BF1A 1RNHA 3G6EN 4FWKA 1BCOA 2ZF5O 1EP4A 3L3VA 1L3VA 4BRGA 1REVA 1VRUA 5C24A 3WNEA 4CK1A 4FWPA 2NRXA 2VGNA 2GWJA 3BF3A 3CG7A 2ZGYA 1A5VA 3MMVA 1W0HA 4YOWA 1UA0A 4IOXA 1KSPA 1WSJA 3VEOA 4DSIA 5HRRA 1YJWN 4PHTX 4BRHA 5CYMA 4CZMA 4JKFA 2O8EA 2EHGA 1ZBSA 3K5MA 1D9FA 4Y0WA 4DV7K 2E8AA 1VQMN 3GOIA 4L8RB 3TU5A 2WTUA 1QE1A 4B08A 3MXJA 4LFBK 3ULEB 2F8SA 4JI0K 2PY5A 2CH6A 1KXPA 4LFCK 2E2PA 5M1FA 4H4MA 4FWOA 3TAFA 4KI4A 1T3VA 3MWPA 3ZSWA 1R59O 3CMEN 4KH6A 4Z0UA 4FWQA 1NJYA 3J81O 1QZ5A 2ATQA 2OCEA 4BG9A 3ALYA 1RDWX 2A5XA 1Z6RA 2LSNA 3PO4A 1QSLA 4F2SA 2DFEA 4NYNA 1ZBIA 3QNOA 1RGIA 4WQ4A 4JI6K 4JI3K 1TAUA 1SV5A 4DTXA 3VQ9A 4EP5A 4XH4A 4K25A 3CCVN 2FSKA 3VQBA 3K2PA 4CE9A 2P9PB 4M3ZA 4DLEA 4CJWA 5H1SQ 4OVLA 3TANA 2IC3A 1WB9A 4OGCA 4X65K 1EKEA 2P9IB 3CJAA 2PAVA 4CF2A 1WBBA 2OPQA 5EX5A 2HBLA 1SL0A 3KVGA 4CEZA 4FLWA 3LAMA 2G8IA 3MCPA 4CF0A 4O0IA 3AARA 4HWIA 5M1NA 3SAGA 1Z05A 3M8SA 4CGGA 1KAYA 4DMNA 3SPZA 3WEEB 5C15A 4CJRA 3OY9A 5BRHA 1B9FA 4CD3A 4IFVA 4O5BA 1EWQA 3E01A 4YDUA 4J8FA 4BG8A 4DCHA 4E7JA 3VGLA 4CIFA 3ZEUB 5BR8K 4FWMA 4HUFA 1I39A 5I42A 4OPAA 1GLBG 4BRIA 1BWFO 1OH7A 3AVAA 1LCUA 2WOMA 3D2EA 3G4SN 3O3GA 1SQKA 4DV1K 3QEXA 3SQ2A 4H5NA 3DRPA 3WNHA 1RILA 3UKUA 5AQTA 4FW2A 1FKPA 2RE2A 3O08A 3ZX3A 1OH8A 3TR8A 4DR7K 3IAYA 1Q82O 3N4PA 4AQYK 4DR6K 3NE6A 2E5LK 4CJUA 1HYVA 4BR5A 2GELA 3PLAA 1NJWA 3L0QA 1ITGA 4H5RA 3AA5X 4B1WB 5C2DA 3SI6A 2Q0RA 2XRIA 4FPBA 4E3SA 3V9SA 1FW6A 3B6PA 2UYTA 3HBTA 1P8ZA 3T1AA 1IG9A 3IDHA 3PX4A 4M45A 4FSVA 4LH4A 2HVHA 4GV3A 4JNEA 3RRHA 3O5BA 3EZWA 3WXJA 3RTVA 3U3GA 3OA9A 2PZSA 3G71N 3CC4N 4XEIA 2UXBK 4QS7A 4B1ZA 2YJFA 3TTFA 4KKOA 3ATUA 3VESA 4HCCA 2UUAK 2Z1JA 1BIUA 2X6SA 3RR7A 2I7PA 3HVTA 3CFPA 5BPMA 4KHWA 3AO5A 4CF8A 1N34K 2XO7A 1NJXA 3T3FA 4BE0A 1IG8A 4BDZA 3LM9A 3E1YA 4DR4K 4DFMA 3AA2A 4YNQA 3ULDA 3OS0A 2F96A 1TKZA 2FC0A 2O8BA 4KTZA 4EP4A 4I2QA 2W40A 4YORA 1QHTA 1BUPA 2QW9A 3VGMA 1RT1A 2HBJA 4KI6A 4IG0A 3CM6A 1NJIO 1TYQA 4KB0A 4BQZA 3UIQA 2IDOA 3FGUA 4IZ9A 3H08A 2QXFA 1TL3A 1A5XA 4DUZK 2JWLA 2P9NB 4M63C 4B9NA 4H5TA 2B4JA 2HW3A 4JKCA 1XNRK 2O8EB 4C8OA 4CJSA 4ISGA 3VETA 4E7KA 1W2BM 3ZX0A 3TWHA 4WQ5A 4M41A 3FZMA 2HHUA 4XIUA 3JXUA 1JJ2M 5AQLA 1XHXA 3KWIA 1U4BA 4O44A 4CEDA 4EFHA 2QKBA 1JLEA 1C1CA 4E89A 4DHYA 4NLCA 4CERA 1HJOA 4C8KA 1ILYA 1SKRA 1SL1A 3ZT4A 4ILJA 1VQ7N 4CFDA 3O9TA 5AQGA 3DMJA 3F2KA 3CCJN 2ZD1A 2XY5A 3KK7A 5BN8A 3AVMA 3AVJA 1LV5A 3O3FA 1O13A 3OYHA 4WYBA 4DTSA 1VQKN 2OTLN 1NGBA 3E9PA 2UXCK 3OYCA 4AHSA 4L3QA 5GADP 4LD0A 4DU4A 3ZT2A 3HTVA 4CJ5A 3D2FA 4DS4A 2YNIA 1XHZA 4CEQA 1ZC6A 1YVUA 2QWQA 5AQMA 3ZETA 4B1XB 1CXQA 4AHUA 4H8KA 1J53A 4CF9A 4RWTA 4A61A 3L2QA 4RG8A 3AO2A 1VQNN 2E4LA 2P9IA 4B9TA 4H0PA 3VQ8A 4CJ4A 5AQYA 2P1JA 3OYGA 3I56N 3VQ5A 1X1PA 3ULEA 4FZYA 4Z4GA 4CJTA 4AHRA 2I5JA 1J54A 2AP1A 1GOCA 3CJ7A 1EWRA 5JS1A 5BPNA 3QEVA 2HB5A 5C12A 4I6MA 1CZAN 1FK9A 3H1QA 3ZEUA 4CHOA 2QXLA 4A57A 5FROA 4FCYA 4CJLA 3T19A 3IFRA 4A2AA 2YI1A 4RW4A 4O8UA 4QS9A 1K8KB 2OPSA 1SAZA 2P9KA 2D0PA 1RTJA 1D8YA 4J2AA 1NG9A 3PO5A 3P38A 1NK0A 2O8CA 4DFPA 2E1ZA 4WFAL 3DLKA 1NGFA 4W5QA 4WCEL 3I8DA 1CZBA 3BGRA 3VF4A 4AHCA 4JI4K 4DWIA 1Q81O 3HO1A 2ZGZA 1W97L 2VG7A 4GY2B 4ILHA 2UXDK 1HPZA 3WXMB 3V4IA 1CLQA 2KZMA 1VQPN 2GTDA 4CEEA 4BDPA 1B9DA 1ZXOA 2G8UA 4BRAA 3JYTA 4A5AA 3SK3A 3QBWA 4CECA 3LZJA 4JKGB 3D6RA 4JKBA 4HCBA 4DV4K 3DYAA 3QERA 3LPTA 4CJFA 2JLEA 3WEEA 1U2VA 1VSFA 4X64K 1C0UA 5AQXA 4DF4A 3G10A 4MO5A 1WUAA 3MECA 4JHDB 1U47A 2E2NA 1VSKA 3F73A 1S6QA 1J6ZA 3FZHA 3VQ4A 3L6QA 2VG6A 4Z4FA 4U67L 3OYAA 1Q7YO 1VQLN 5I9EB 2PBDA 1BDGA 3NMUA 3LAKA 3V1QA 4CZGA 1VQ4N 3DXMB 4FOIA 5SWMA 3D2FB 1N33K 2Y1IA 1XWLA 1KRPA 3EE8A 3GDQA 1Q9XA 1LW2A 1LAVA 4LC9B 5KQDA 2GUPA 5HBMA 1YJ9N 1N6QA 3P5JA 1RBTA 4LF5K 1OH5A 2O8FA 1TUYA 4BGAA 5CE3A 2PYLA 4OLAA 1BQNA 4Z4CA 4GV6A 3DLGA 3F5TA 5FPMA 1IV0A 4CZHA 1BGXT 4KHQA 1NKCA 5TKWA 1X9MA 4B1UB 4NXMK 2KFNA 5KQ8A 5HOOA 3CQ8A 1Z26A 2XHBA 3P39A 3ZSYA 5C10A 1KLNA 3KD1E 3LDNA 4WF9L 1N36K 3MN7A 5ADXA 4IDKA 4LF7K 4CBXA 5KGXA 3AVBA 3NH0A 2FBXA 1C0GA 3V1RA 3I0SA 1S72N 4JKHA 1SKWA 3AV9A 4IBNA 1GLDG 2NZTA 3KKSA 3SAHA 1QSSA 1X9JA 3THYB 4BRDA 3S9HA 4BRKA 4F2RA 2RN2A 4JK8A 2QA4N 4OGEA 4U7BA 4LF9K 3V9WA 2NNWA 1GLJO 5J2MA 1NGDA 4CGJA 3OYJA 4H4OA 3S3OA 3NAEA 1NKEA 3C6AA 2DPNA 5AQFA 3WQTA 4O5FA 3VEYA 5F0XA 3J7YP 4N5SA 2XY8A 5HRSA 5J2PA 2GWKA 1T44A 3GE1A 3UKUB 3HP6A 4PKHA 3U4LA 4F3TA 3LDLA 3VQDA 1ZBFA 3QEIA 2P9SB 3AGRA 1EETA 2YHWA 3EKUA 4BR4A 3CC2N 1YTUA 2KZZA 4BVPA 3CQXA 4K42A 2Z1HA 4BE1A 5HRNA 4F8RA 3L2WA 2VWBA 4J2DA 1T03A 2V7YA 3BZKA 1D9DA 4CIGA 1KAZA 1VAZA 3NBPA 4IO9L 1RT5A 2HOEA 5LL6Z 1NGIA 2IAJA 3OJSA 1GLCG 3WXIA 3VERA 1BO5O 2OPRA 2RF2A 4K41A 4WFNL 4MDAA 3S3MA 4JK7A 3H3NO 4WQ5C 1RBVA 4CK2A 2X74A 1TUUA 1MDUB 1HQUA 1KCFA 5AQKA 3O1BA 5KI6A 3SCXA 4HVJA 3HXMA 4CJ7A 4CHPA 5JLFA 3NFAA 1TV6A 2Q2RA 2W42A 3M8RA 2HHQA 4W5RA 2ZM6K 3NF7A 1VSHA 1OKJA 3NGYA 4KO0A 3PSIA 1Q18A 3DXMA 3THVA 3ATVA 1KVBA 1L5UA 4M3YA 1HKBA 1KTQA 1S1XA 4ISFA 2RPIA 2F9TA 1S22A 5LMUK 4IOAL 3M8PA 3FR0A 4C1NK 2XY7A 4CIEA 2HNDA 2A1RA 3SJHA 3ZCMA 3M8QA 3QFPA 2VCPA 2O8BB 3ENOA 2Q0UA 3HK2A 1JLFA 4CZLA 2NLXA 3PSFA 4LH5A 4ZTJA 4E7HA 1KD1O 4O4GA 3HT3A 5LJWA 4RW7A 3QEPA 3SNNA 3CJ1A 3ZETB 3KLEA 4FLTA 4DF8A 1UA1A 3HPHA 2ZWHA 1GLFO 3E9OA 5FPNA 4FK4A 3QESA 1IO2A 1WLJA 2QKKA 4AHTA 3DJCA 5AFUH 3RMDA 5FRMA 3NGZA 5I3UA 4A59A 1JLQA 3CJ9A 1YVNA 3I33A 2P9PA 5AFUA 3SMSA 3NVMA 1DTTA 4JHDA 5KPZA 3IUCA 4DUYK 4MQ3A 3L3UA 1RCHA 1CXUA 3KTQA 4PWDA 2W41A 3LM2A 2HHHK 1S9GA 4BRPA 1K8KA 2FBYA 2P9KB 3R6MA 3LWMA 1TAQA 5LMNK 3I8BA 4I9LA 3SQ4A 2FBTA 5DMRA 5JVGL 2E20A 1HRHA 4PUOA 1RDAA 4E19A 1QQOA 3VN5A 4FJXA 5BRDA 3ZSRA 1NM1A 4BR0A 4DTNA 3V9UA 4B3RK 2HNYA 3TAPA 1DEJA 3CPEA 4O0JA 3VA0A 3L2UA 1RT3A 1FJGK 3K59A 2QWNA 2A40A 3E9LA 2GBZA 3VGKA 1NK6A 3EYZA 1S1TA 4KB1A 3BP8A 3HPOA 1J5EK 2Q3SA 4LFAK 4X62K 4OKKA 4N41A 1UOCA 2BUPA 4FWLA 3LP0A 4PKIA 1OH6A 3V9ZA 1IKXA 4ID1A 1V4TA 3E66A 3BZCA 4NLBA 3AVGA 3LDPA 2FXUA 3R3LA 4CCHA 3ZSOA 1JCGA 4JD2A 2A42A 5HROA 4G1QA 1M90O 4JEPA 1ATNA 4BVOA 2FLOA 1G15A 4IG3A 3HSTB 1WNSA 2BDPA 4R5PA 4KHUA 5LJVA 2G8KA 2X6NA 4DTOA 3CMAN 3SPYA 2HBMA 5BPLA 2GEMA 4BC2A 2F4VK 4QCLA 1GLAG 3HSCA 3SV3A 3LDOA 4EIAA 4OPJA 2F7TA 3O3HA 5KPRA 4AM6A 1YTAA 5BN9A 3HM8A 3DRSA 4KREA 5J2NA 3O9RA 4IXCA 3J80O 3D0PA 2O8CB 1YUWA 3EL2A 3QNNA 1Q9YA 5AQJA 1JL2A 4W5NA 1BISA 1NGJA 3O4NA 1ESVA 3ASMA 3SUQA 2HNZA 2WONA 2ZE2A 4JI5K 4M3UA 2YNGA 2P51A 1WSGA 5AQHA 3NCIA 4FJLA 3MN5A 1LW0A 5DK5A 3F9KA 3D45A 3Q7BA 5K14A 1T8EA 4KTQA 4FK0A 2KHOA 1IH7A 2KQ2A 4CJKA 3VF6A 3U3YA 3ITHA 2QWPA 5AZJA 3HYFA 3AO1A 4H0VB 1OVQA 3DM2A 5C2FA 4B9MA 4C8NA 1N8RO 4Z94A 5CY4A 1E4FT 1HMVA 5CZ2A 4WFBL 1KQSM 1JXBA 3RWUA 2HHTA 1N32K 4BRQA 3I55N 3S3NA 3K58A 4K43A 1N5YA 3NVKA 3KK2A 4N47A 1XC3A 2BGGA 4YOXA 1NGGA 4FPAA 1MWMA 3ZSXA 2QWMA 4B8AB 3LWLA 4NXNK 4FWNA 5AQZA 1JL1A 4E7IA 3IS9A 1BQMA 4BGBA 2CGJA 3DLLL 4B1YB 4LF8K 4DTPA 1MA9B 3ENHA 4DTMA 3O6WA 3U9DA 4Q5VA 4CBWA 3OYNA 2ASPA 3ISNC 5AQWA 3M1FA 3VEZA 1RFQA 1SL2A 1ATSA 1BHLA 4A62A 4NO7A 2J4RA 4YOYA 1HJRA 3H3OB 4MFBA 3NH1A 1NWKA 2UUBK 1NK7A 4CFAA 2AA4A 1BCMA 1VSMA 3HRGA 3CXCM 2VWKA 3OYEA 3DWLA 3O9QA 2E6MA 5JS2A 4DB3A 3P1GA 2ZJRL 2B6AA 1OVYA 3GBTA 1BL3A 1EO1A 2IGIA 4FZZA 3MN6A 4H0XB 1BI4A 1VQ8N 1RTIA 4M3RA 3PX0A 3MXMA 3K9JA 3JSMA 1WSEA 5F1XA 3AAPA 1JXEA 1RTDA 4H0OA 1RDUA 1KVAA 1U2VB 3ZSZA 1NLVA 1FXXA 1HX1A 4DQIA 3FZFA 1J5OA 1ATRA 3BDPA 4KRFA 4FLXA 3TSPA 2YNHA 3O80A 1JKHA 4F3OA 2VWJA 1BG3A 4I6MB 1HNVA 1SS6A 2P5OA 3VQCA 1SKSA 3CHWA 4XH5A 3ID6A 1QSYA 4BE2A 4C8LA 4DS5A 1X3NA 2D4WA 3O8MA 3AVKA 1GOBA 3C94A 1RT4A 1ASUA 1HNIA 3ID8A 5AQNA 1I3AA 4KPYA 2ZJQL 3VOVA 3MK6A 5KGWA 4FJJA 1UWBA 1K6YA 3T1HK 1ZBUA 2Q97A 3SBGA 3CIPA 4EHTA 2IVPA 4LSLA 3O4QA 4ISEA 2IIRA 1P90A 2ASMA 1LWCA 4HUEA 4EZ6A 1K9MO 3KJVA 1IKYA 4NB4A 1VHXA 4CZKA 2ZJPL 2F9WA 1J9AA 3C7NB 1F21A 1NMDA 1QVFM 1VSIA 1IKWA 4CFBA 2IVNA 1X3MA 3VQQA 1S6PA 4PKGA 4B1VA 3MEGA 3VTHA 4UY8O 4BWJA 4KHSA 2DFHA 2P9UA 4LY7A 3SQ0A 4FJMA 3CCRN 4J2EA 4CVNE 1WSFA 4FJNA 1C0FA 1RDDA 2W6KA 4JKDA 1D4XA 5EVZA 2YHBA 3LL3A 1DKGD 4RW6A 4JK9A 1ASVA 3EZ5A 4C1NI 2R7YA 4F4KA 5KRTA 4FXDA 4FM0A 1XUPO 1XQSC 4KHYA 4M7XA 4DQPA 5J2QA 1XNQK 3THWA 3BY5A 3K57A 2RKIA 4DQSA 1QVGM 3M3ZA 1U48A 3DAWA 2IS3A 3A0IX 2XY6A 1NGAA 3KIOA 3VQEA 1YAGA 4PY5A 3AVFA 1Q8IA 3DXKA 4EHUA 3H45C 4EAHD 5HRPA 1YXQA 4W5TA 1VSDA 3B6OA 3DOKA 4CEFA 2G8FA 2D0BA 4DR3K 3VQAA 1H1VA 2O8DA 3FFKB 1YITN 5ELZA 1K8AO 4NCBA 2HHXA 4FJ7A 4BRNA 4NYFA 4DSFA 3OYKA 4DG1A 4BWMA 4B9UA 3AO3A 3ZT0A 2YV0X 4DV5K 3UB5A 2FBVA 4R79A 3EEQA 3JAMO 4KBOA 5CR4A 4IOCL 3J8AA 4FZXC 3CD6N 4CJVA 2OPPA 5J1EA 4X66K 1R0AA 2G8WA 3CQYA 3M5RA 3DOLA 3ZSQA 3C6TA 4FOEA 2DY4A 2A1SA 5BRFA 3GG4A 2OANA 1NMNA 2HF3A 2HF4A 3WXKA 1T7PA 2BH1A 4OJRA 5AJ3K 4F9OA 1TK5A 2KW4A 2FF3B 4H0YB 3NGIA 3TABA 4M3WA 3WXLA 5GAEP 3SZ2A 3DI6A 1HNXK 3VENA 4PL7A 1HNWK 4HHTA 4AF1A 4FJ9A 1EX4A 4CGHA 5HL7L 1GOAA 5KTQA 2VQFK 3VPZA 4CEOA 3LANA 4B3TK 3CYMA 4BC5A 4BC4A 2OZMA 4DR2K 4CD1A 3HOSA 3OYDA 1W7AA 4HTUA 1DT9A 3U9ZA 1L3TA 3SMPA 5FRNA 3SUOA 4A2BA 3W0LA 4OO1J 4FVMA 4CW7B 5EOYA 1YHQN 1TKTA 1IBLK 3QO9A 3J7ZO 4ILGB 3OYLA 3EY1A 1EQYA 3QMLA 2QK9A 1QQNA 1TKXA 1HKCA 3WUHA 4CJPA 2HHVA 3O9UA 3AVNA 2VQEK 3BUZB 5JVHL 3CI5A 2KLAA 1WN7A 4KAZA 4W5OA 1NK4A 1GLEG 4JI7K 2Q31A 3A5LC 4CEBA 4CZIA 3OHRA 1VSEA 3H6EA 4CZJA 3OVNA 4RW8A 5KPTA 1HKGA 3OS2A 4DQRA 2OYQA 4CFCA 5AZIB 3DLHA 4YDUC 3CJCA 1KFDA 1NU0A 3G0ZA 4CHYA 2E6LA 3D2EB 3KLHA 2E1YA 3VQ7A 4DKWA 1RBSA 4FLZA 1JLGA 2D0CA 3A5MC 4EZ9A 3CJBA 2JGUA 2HMIA 4KHPK 3C6UA 4J2BA 3LDSA 5AQUA 4DSLA 5LY3A 2WC9A 3MX2A 3KLIA 5C25A 2IVOA 4O55A 3SBTA 4CBUA 1A5WA 3K5NA 3OTOK 1EXQA 1Z25A 4IEIA 5JICA 1NOZA 4CJ3A 2EWSA 2VG5A 4Z4HA 1V4SA 5SZTA 3UE5A 3MEDA 4H5VA 5ADXH 1IKVA 4KH4A 3VEWA 5JMVA 5AQIA 3AA4A 2YJEA 4YFUA 4FLUA 4IDHA 2HBKA 2HSTA 3VTIA 2O8FB 5F2RA 3EO3A 4QS8A 1HLUA 3AO4A 4FM1A 1S5JA 3AVIA 3OS1A 2ZQBA 5GIPA 4RCHA 2X78A 5IT9O 1JCFA 3A2FA 4E1NA 4FJIA 3WNFA 4CJQA 1YF5L 4BREA 5DM7L 4M3XA 4DTRA 2Q36A 3NH2A 3DLEA 4GV9A 3RR8A 3P31A 3CCQN 1G99A 4PQUA 4KV8A 3AVHA 4YOTA 3MCAB 2P9LB 4I9QA 4NCGA 1TK8A 5A2QO 4GVMA 4DR5K 3RVCA 1NGEA 4FJKA 5EU7A 4I7FA 2V51B 1IBKK 4DQQA 3T7ZA 3SYZA 1XMQK 3F9MA 4Z4IA 1YT3A 4E7LA 1E4GT 4B9LA 2ASOA 3EKSA 2O8DB 1T6DA 1LWEA 3HZ6A 3KK1A 3QLHA 1S9EA 1HYSA 3K0SA 1QZ6A 3QFUA 4V19S 4DV0K 3OW2M 1RT7A 3THXA 2Y1JA 2EX3A 1WBDA 3IG1A 3U8XA 4CF1A 4JI8K 1NK8A 1JLBA 2HVIA 2GUIA 4K0KK 3V1OA 3SUPA 4JAXA 5GAGP 1VSLA 5E41A 1NBWA 2D1KA 3AVCA 4FJHA 2QEXN 4Y1CA 3LP3A 4NCAA 2B5JA 2FF6A 4HTLA 3SAFA 2BTFA 4DV2K 4ELTA 2KTQA 4JS4A 3VMFB 1HR0K 3CFRA 1X9SA 4BRCA 2A6AA 1YI2N 1RT6A 3VEXA 3QEWA 1U45A 5AR0A 4FVUA 2NRHA 4DLGA 1WSIA 3KHYA 4CGFA 2KKZA 4BR2A 3H46O 3KLFA 3MN9A 5AQSA 5M1PA 5IWAK 1HQEA 4CEAA 1VQ9N 4FK2A 3HPGA 2ITGA 3S41A 4CZFA 1Y64A 4CHZA 2Z1IA 3QINA 5JLHA 1L3SA 4KHNA 1KVCA 1NGCA 3FZKA 3NF9A 4B9SA 4DQ8A 3K5OA 4FL9A 3HVRA 4B3OA 4Y1DA 2O4GA 1L3UA 3T1YK 4ZHRA 3HI0A 3CERA 3SLCA 3FZLA 3AAQA 1U6ZA 4OPHA 3A5NC 4E1MA 3OBYA 5MLCQ 3J7AP 1NNEA 2BANA 4LSNA 1YIJN 3IKMA 4O8KA 3HM9A 3CF5L 4BRMA 5AZJB 1HYZA 5C42A 3VA3A 2YNFA 5GIOA 4H03B 2OA8A 4YY3K 4JD2B 4OLBA 2P9UB 1BI4B 2UU9K 2CGLA 1U49A 1QS4A 3NF6A 3SV4A 3HL8A 3CCSN 3ZSVA 1ZYQA 3TARA 1RDBA 4OKJA 4JKAA 3CETA 5E84A 3PIOL 3MXIA 4KH5A 2YHXA 2OZSA 1U04A 5CYQA 1KLMA 5AQVA 4FO0A 2E2OA 4MO4A 2ITMA 1BA1A 3SQ1A 3WT0A 5HLFA 4BRFA 3SUNA 4ELVA 1MU2A 3AGKA 3L2RA 3JS6A 2QI2A 4XH1A 3TI0A 1WAFA 1IBMK 2NRTA 4FLYA 1VSJA 4M7YA 2W6LA 4B8CA 1RTHA 4E0DA 3N4QA 1LWFA 2BE2A 3KZBA 5M1OA 4JKGA 5M1QA 3QB0A 3TSQA 4CHNA 4OKEA 2GV9A 1X9WA 3ENBA 4KFBA 3UKRA 1FKOA 4BR9A 1GLLO 1KFSA 3LPUA 1RBRA 5BR9A 1WSHA 3QBXA 2WUSA 4AH9A 4IFEA 5KRSA 4BROA 3TTCA 5AQRA 2DFFA 4B9QA 2JWKA 4JYAK 5AZIA 3VEVA 4CZEA 5D3GA 4E1JA 3A8YA 3LALA 4LF6K 3DLRA 2WFBA 3CFOA 5M1KA 4OPKA 3L2VA 5FPEA 3SJJA 5EXWA 1ASWA 2V7ZA 1T05A 3W3DA 4Z4EA 1QQCA 2OTJN 4FWRA 3C65A 4AHVA 3CC7N 4M3TA 2GX9A 3FE1A 2Q1NA 1HPMA 4WQ4C 1C6VA 3T69A 3KWGA 4JRPA 3LZIA 4BR7A 4H0TB 1LAWA 3I0RA 4FM2A 5E26A 3MAQA 4H5WA 1K73O 4DV3K 4TSXA 2Z1GA 2D5RA 3R1XA 1BA0A 5CZ1A 3ZT3A 4C8MA 1UAXA 1VK0A 3CCMN 3V6DA 4DSJA 3K9KA 1BIZA 4K8ZA 2P9NA 1Q86O 5FLXO 2G8VA 2E88A 1ZBLA 1HNZK 2VGMA 4G9ZA 5FPDA 3HJFA 3LDQA 3LP2A 3RMAA 3H1VX 2NRVA 3KKRA 4ZTFA 4JKEA 4JS5A 5CHIA 4N76A 2E2QA 2YCHA 3QIOA 4GKKK 3D7EO 3ZX2A 2YX6A 1S1WA 2ETJA 3O1WA 3PY8A 4MLEA 3TPQA 3L4IA 3QDKA 4DTUA 2HHWA 4MDBA 1TK0A 5GINA 1IJJA 1QHAA 4JLHA 4MLHA 4AM7A 1RBUA 3V9XA 3WNGA 3HP9A 3CCUN 2H3GX 3QIPA 4B3MK 4DFJA 4IFYA 4CJEA 2VYPA 5C0YA 4KTWA 3TAEA 3PV8A 4BQLA 3RMCA 4CGIA 4GMJB 2P9SA 4DU3A 1XC9A 1DLOA 1VQ5N 4LF4K 1W9HA 2PYJA 1C1BA 1JLAA 4WE1A 3OYMA 4RTFD 3AVLA 3WQUA 3O9SA 1TKDA 4JV5K 4IJAA 1TGOA 3PUFA 1Y97A 5T7BA 4JI1K 3B8AX 3NF8A 2D0AA 2YKMA 1KC8O 2A41A 3FFIA 3QICA 4BRLA 1KAXA 1NK5A 1C1AA 4ID5A 3NHGA 4DU1A 3RSEB 1NGHA 2QWOA 1I94K 3OYIA 2IOCA 3THXB 3UKRB 1YJNN 3DXKB 4QAGA 1BU6O 5TKYA 5B8HA 2V52B 4BACA 2CGKA 4N56A 3RMBA 4GW6A 3ZT1A 2G8HA 4OX9K 2I7NA 3M6GA 1SZ2A 3TAQA 3OJUA 4FLVA 1C0TA 3C95A 3EN9A 3K5LA 4DFKA 1NOYA 4Q0BA 2KFZA 1WAJA 1JLCA 1RDCA 3CCLN 4M42A 3C6HA 3MX5A 4CGDA 2QWLA 5FDLA 4JRQA 1TVRA 3VF2A 3V81A 3DLBA 3O4WA 4IEEA 1TL1A 4I2PA 4JN4A 4FJ8A 1RT2A 3VQ6A 4CHQA 3QETA 4GKJK 4CK3A 3R9PA 5DM6L 2D0OA 1QQMA
chains in the Genus database with same CATH topology
1ZBHA 3L2QA 1NJZA 4RG8A 3DRSA 3AO2A 4FW1A 3RRGA 4KREA 1VRTA 5J2NA 2E4LA 3KD5E 3AO4A 2HHSA 3OYBA 3D0PA 4FM1A 4B9TA 1C0MA 3VQ8A 3PX6A 4FYDA 1S5JA 4CJ4A 1SUQA 3AVIA 3OS1A 2ZQBA 3AA3A 3LP1A 2P1JA 3OYGA 3QNNA 1Q9YA 1JL2A 4W5NA 1BISA 2X78A 3O4NA 1X1PA 3VQ5A 3ASMA 2NUBA 3A2FA 4E1NA 3NDKA 2HNZA 2WONA 3WNFA 4CJQA 4CJTA 3DRRA 4AHRA 3SUQA 2I5JA 1NKBA 1J54A 2ZE2A 4PA1A 4M3UA 2YNGA 2P51A 1WSGA 1GOCA 3NCIA 4M3XA 4DTRA 3OYFA 4FJLA 5JS1A 3NH2A 1LW0A 3DLEA 3F9KA 5DK5A 3D45A 3QEVA 2HB5A 5K14A 3TAGA 1T8EA 4KTQA 2P5GA 4FK0A 1IH7A 1FK9A 3RR8A 2KQ2A 2YHAA 1O1WA 4CHOA 4CJKA 5FROA 4FCYA 4FJIA 1DTQA 4CJLA 4DTJA 3U3YA 3T19A 4DSKA 4PQUA 3ITHA 4ELUA 4KV8A 3AVHA 4RW4A 4QOZB 2OPSA 4J2AA 1D8YA 1RTJA 3HYFA 3AO1A 3L8BA 4I9QA 4NCGA 3DM2A 1TK8A 4B9MA 1D5AA 4IKFA 4GVMA 1B92A 3PO5A 4C8NA 5CY4A 1HMVA 5CZ2A 4FJKA 1NK0A 4UQGA 5EU7A 1JXBA 4I7FA 4ICLA 4DFPA 4DQQA 4BDYA 3RWUA 2HHTA 3VQPA 3SYZA 3DLKA 4W5QA 4HUGA 3I8DA 4Z4IA 1CZBA 3BGRA 3KLGA 3S3NA 1YT3A 4AHCA 3K58A 4E7LA 1N5YA 1S1UA 3KK2A 4DWIA 4B9LA 4N47A 3HO1A 5HP1A 2BGGA 1LWEA 2F8TA 3KK1A 1QTMA 4DSEA 3QLHA 3ZSXA 1S9EA 1HYSA 3CM5A 2VG7A 4B8AB 1HPZA 3V4IA 1CLQA 3LWLA 2KZMA 3MEEA 3KK3A 4AILC 4FJGA 1JL1A 4CEEA 3IS9A 1B9DA 1RT7A 1BQMA 4E7IA 4BDPA 2Y1JA 2O4IA 4DTPA 2EX3A 2G8UA 3JYTA 3IG1A 1CZ9A 2YKNA 4FJ5A 2AJQA 4CF1A 4DTMA 4CECA 1NK9A 4Q5VA 3OYNA 3LZJA 1NK8A 1JLBA 3ISNC 2HVIA 2GUIA 2DTUA 4K8XA 3V1OA 4HCBA 3DYAA 3SUPA 1SL2A 4RW9A 3TAMA 3QERA 1BHLA 1VSLA 5E41A 3LPTA 1S1VA 3AVCA 3IRXA 4CJFA 4FJHA 2JLEA 1HJRA 4Y1CA 1VSFA 3LP3A 4CESA 3P83D 4MFBA 3NH1A 4B9VA 1XI1A 3U6FA 2B5JA 4NCAA 1NK7A 1C0UA 1RNHA 4CFAA 4DF4A 1BCOA 3G10A 1EP4A 4ELTA 3MECA 3L3VA 2KTQA 4JS4A 1U47A 3CFRA 1BCMA 1VSMA 1L3VA 1X9SA 1VSKA 1RT6A 1REVA 1VRUA 5C24A 3WNEA 4CK1A 3F73A 1S6QA 3QEWA 2VWKA 1U45A 3OYEA 3CG7A 3VQ4A 1A5VA 4DLGA 2VG6A 1WSIA 4Z4FA 1W0HA 3OYAA 4CGFA 2E6MA 5JS2A 1UA0A 3P1GA 3LAKA 1KSPA 3KLFA 1WSJA 3V1QA 2B6AA 4DSIA 5HRRA 1BL3A 5CYMA 5SWMA 2IGIA 4FZZA 1HQEA 1XWLA 2Y1IA 1KRPA 4CEAA 4FK2A 1BI4A 2EHGA 3HPGA 1RTIA 1Q9XA 4M3RA 3K5MA 1D9FA 1LW2A 3PX0A 3MXMA 1LAVA 2ITGA 1WSEA 3JSMA 2DY4A 4L8RB 5HBMA 2Z1IA 3QINA 1QE1A 4CHZA 3P5JA 1N6QA 4B08A 1L3SA 4KHNA 1JXEA 1RBTA 3MXJA 1KVCA 1RTDA 4FLUA 4B9SA 3NF9A 2F8SA 1KVAA 3ZSZA 2PY5A 3K5OA 3HVRA 2PYLA 4B3OA 1FXXA 4Y1DA 2O4GA 1BQNA 4Z4CA 1L3UA 1J5OA 4DQIA 4OLAA 3BDPA 4KRFA 3DLGA 4ZHRA 4FLXA 4H4MA 2YNHA 1BGXT 4KHQA 1JKHA 1NKCA 1X9MA 3TAFA 2VWJA 4F3OA 4E1MA 4KI4A 1HNVA 2KFNA 2BANA 4LSNA 3CQ8A 1Z26A 3ZSWA 2XHBA 3VQCA 2P5OA 3ZSYA 1SKSA 1KLNA 3KD1E 3HM9A 4Z0UA 4FZYA 4IDKA 1NJYA 1QSYA 4BE2A 4C8LA 4DS5A 5KGXA 1HYZA 3AVBA 5C42A 2FBXA 3NH0A 3V1RA 2ATQA 3VA3A 3I0SA 2YNFA 3AVKA 1SKWA 3AV9A 4IBNA 3KKSA 1GOBA 3C94A 3ALYA 2OA8A 1RT4A 1QSSA 1ASUA 1HNIA 4OLBA 1BI4B 2LSNA 1I3AA 4KPYA 3PO4A 1U49A 1QS4A 3NF6A 3S9HA 3SV4A 1QSLA 3HL8A 2DFEA 2RN2A 4F2RA 4NYNA 5KGWA 4OGEA 4F2SA 4FJJA 3ZSVA 1ZYQA 1ZBIA 3TARA 3V9WA 1RDBA 3QNOA 1UWBA 4OKJA 1K6YA 5J2MA 1ZBUA 4CGJA 3OYJA 4H4OA 3S3OA 1TAUA 1SV5A 3NAEA 4DTXA 3VQ9A 4LSLA 3MXIA 1NKEA 3O4QA 2OZSA 4EP5A 1U04A 4YFUA 5CYQA 1KLMA 4N5SA 3VQBA 3K2PA 2XY8A 1LWCA 4CE9A 4HUEA 4EZ6A 5HRSA 4M3ZA 5J2PA 4DLEA 3KJVA 4CJWA 3SQ1A 4OVLA 1IKYA 3TANA 2IC3A 5HLFA 1J9AA 4OGCA 3HP6A 4F3TA 3SUNA 1F21A 4ELVA 1EKEA 3VQDA 1ZBFA 1VSIA 1MU2A 1IKWA 4CFBA 3QEIA 4CF2A 2OPQA 3VQQA 3L2RA 1S6PA 1SL0A 4CEZA 4FLWA 3LAMA 3MEGA 1EETA 2G8IA 4CF0A 4O0IA 4BWJA 3TI0A 4Z4GA 1WAFA 3M8SA 4KHSA 1YTUA 4CGGA 2DFHA 4FLYA 2KZZA 1VSJA 4DMNA 4LY7A 2Z1HA 3SQ0A 4B8CA 3SPZA 4FJMA 4CJRA 4BE1A 5HRNA 4J2EA 3OY9A 1RTHA 4E0DA 4F8RA 1WSFA 3L2WA 4FJNA 1B9FA 1LWFA 1RDDA 2BE2A 4IFVA 4J2DA 1T03A 1D9DA 4O5BA 4CHNA 3E01A 4OKEA 4CIGA 4E7JA 2GV9A 2YHBA 1X9WA 3NBPA 4RW6A 1ASVA 1YTAA 3EZ5A 4CIFA 2R7YA 4F4KA 4KFBA 5KRTA 1FKOA 4FXDA 1RT5A 4HUFA 4FM0A 1I39A 5I42A 1KFSA 4KHYA 3LPUA 1RBRA 2IAJA 3OJSA 4DQPA 1WSHA 3AVAA 2WOMA 5J2QA 4AH9A 5KRSA 3K57A 2RKIA 2OPRA 3O3GA 2RF2A 4DQSA 3SQ2A 3QEXA 1U48A 3S3MA 2DFFA 3DRPA 3WNHA 2IS3A 1RILA 2XY6A 1RBVA 4CK2A 3KIOA 2X74A 3VQEA 4FW2A 1FKPA 1HQUA 1KCFA 5D3GA 4PY5A 5KI6A 3AVFA 3LALA 1Q8IA 4HVJA 3DLRA 3SCXA 3CFOA 3HXMA 3TR8A 4CHPA 4OPKA 3NFAA 3IAYA 1TV6A 5HRPA 3L2VA 2W42A 4W5TA 3M8RA 3SJJA 1VSDA 1ASWA 2HHQA 3B6OA 3DOKA 4CEFA 4W5RA 3NF7A 1VSHA 1T05A 2G8FA 2D0BA 4Z4EA 1QQCA 3VQAA 3NGYA 4KO0A 3NE6A 4AHVA 4CJUA 3THVA 4M3TA 1HYVA 1KVBA 1L5UA 4M3YA 1KTQA 1S1XA 4NCBA 2HHXA 2RPIA 4FJ7A 1NJWA 1C6VA 4NYFA 4DSFA 4CF9A 3OYKA 1ITGA 4BWMA 4DG1A 3AO3A 4JRPA 3AA5X 3SI6A 4B9UA 3ZT0A 3M8PA 2XRIA 2YV0X 4E3SA 4CIEA 2HNDA 2XY7A 3LZIA 3V9SA 3ZCMA 2A1RA 1LAWA 3B6PA 3I0RA 3M8QA 2FBVA 3T1AA 1IG9A 4FM2A 3HK2A 1JLFA 3PX4A 4M45A 3MAQA 4FZXC 4CJVA 4LH4A 4LH5A 2HVHA 2OPPA 4TSXA 4ZTJA 4E7HA 2Z1GA 4O4GA 2D5RA 5J1EA 3RRHA 1R0AA 2G8WA 3HT3A 5CZ1A 4RW7A 3DOLA 4C8MA 3ZSQA 3ZT3A 3C6TA 3RTVA 3U3GA 3QEPA 3SNNA 1UAXA 1VK0A 2A1SA 3KLEA 4FLTA 3V6DA 2PZSA 4DSJA 1BIZA 4DF8A 1UA1A 3HPHA 4K8ZA 4KKOA 1T7PA 2G8VA 4FK4A 3QESA 4HCCA 1IO2A 1WLJA 2Z1JA 1ZBLA 1BIUA 2X6SA 4OJRA 3RR7A 2QKKA 4AHTA 3HVTA 3CFPA 3HJFA 3RMDA 1TK5A 2KW4A 4KHWA 3LP2A 3NGIA 3AO5A 4CF8A 3TABA 3RMAA 4M3WA 3NGZA 5FRMA 3KKRA 2XO7A 3SZ2A 5I3UA 3DI6A 1NJXA 3T3FA 4ZTFA 4BE0A 4BDZA 1JLQA 4JS5A 4HHTA 4FJ9A 4N76A 1EX4A 4DFMA 3AA2A 4CGHA 4YNQA 1GOAA 3ULDA 3QIOA 5KTQA 3OS0A 2F96A 1DTTA 1S1WA 1TKZA 2FC0A 2ETJA 4KTZA 4EP4A 4I2QA 4MQ3A 4CEOA 3PY8A 3L3UA 3LANA 1QHTA 1RCHA 1CXUA 4DTUA 3CYMA 3KTQA 1RT1A 2OZMA 4KI6A 4PWDA 3OYDA 4IG0A 4HTUA 3CM6A 1L3TA 2HHWA 4KB0A 1TK0A 5FRNA 1S9GA 3SUOA 3UIQA 2FBYA 2IDOA 4JLHA 3LWMA 4FVMA 1TAQA 3H08A 2QXFA 1TL3A 4I9LA 1TKTA 1RBUA 1A5XA 3V9XA 3WNGA 2FBTA 5DMRA 3SQ4A 3HP9A 3QO9A 3QIPA 4B9NA 4DFJA 4IFYA 3OYLA 4CJEA 1HRHA 4PUOA 2B4JA 4KTWA 3EY1A 2HW3A 1RDAA 4E19A 3TAEA 3PV8A 3VN5A 3RMCA 4C8OA 4FJXA 4CJSA 2QK9A 4E7KA 4CGIA 4GMJB 4DU3A 1XC9A 1DLOA 3TWHA 1TKXA 1W9HA 3ZSRA 2PYJA 1C1BA 1JLAA 4WE1A 4CJPA 3OYMA 3AVLA 4M41A 4DTNA 2HHVA 3V9UA 2HHUA 4XIUA 3AVNA 1TKDA 2HNYA 3TAPA 1TGOA 1WN7A 3PUFA 4KAZA 4W5OA 4O0JA 1Y97A 5T7BA 1NK4A 1XHXA 3VA0A 1U4BA 4O44A 3NF8A 2D0AA 4CEDA 3L2UA 2YKMA 4CEBA 2QKBA 1JLEA 3FFIA 1C1CA 1RT3A 4E89A 1VSEA 3K59A 2GBZA 1NK5A 1C1AA 4ID5A 3OVNA 3NHGA 4RW8A 1S1TA 3EYZA 4DU1A 1NK6A 4KB1A 3OS2A 4DQRA 3HPOA 2Q3SA 4CERA 2OYQA 3OYIA 4CFCA 2IOCA 4OKKA 3DLHA 1UOCA 4C8KA 4N41A 1KFDA 1SKRA 3LP0A 1SL1A 3ZT4A 3G0ZA 4QAGA 4CHYA 2E6LA 3V9ZA 4CFDA 3KLHA 1IKXA 3DMJA 4ID1A 3VQ7A 1RBSA 3AVGA 2ZD1A 4BACA 4N56A 4FLZA 2XY5A 3RMBA 1JLGA 4GW6A 2D0CA 3AVMA 3ZT1A 4EZ9A 2G8HA 3AVJA 2JGUA 2HMIA 1LV5A 3C6UA 3O3FA 4J2BA 3TAQA 3OJUA 3OYHA 4FLVA 1C0TA 3C95A 3ZSOA 4DTSA 3LDSA 4CCHA 5HROA 3K5LA 4G1QA 4DFKA 4DSLA 1NOYA 4Q0BA 2KFZA 1WAJA 3KLIA 3OYCA 4AHSA 5C25A 1G15A 1JLCA 4O55A 3K5NA 1A5WA 1RDCA 4IG3A 4M42A 3HSTB 1EXQA 1WNSA 1Z25A 4LD0A 3ZT2A 4DU4A 4R5PA 4CGDA 2BDPA 4KHUA 2G8KA 1NOZA 2X6NA 5FDLA 4CJ3A 4JRQA 4DTOA 1TVRA 4CJ5A 3V81A 2VG5A 3SPYA 3DLBA 4Z4HA 4DS4A 5SZTA 4QCLA 2YNIA 1TL1A 4I2PA 4FJ8A 3MEDA 1IKVA 1XHZA 3SV3A 1RT2A 3VQ6A 4CHQA 3QETA 4OPJA 4CK3A 4CEQA 1YVUA 3O3HA 1CXQA 4AHUA 4H8KA 1J53A 3AA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBH A;  3L2Q A;  1NJZ A;  4RG8 A;  3DRS A;  3AO2 A;  4FW1 A;  3RRG A;  4KRE A;  1VRT A;  5J2N A;  2E4L A;  3KD5 E;  3AO4 A;  2HHS A;  3OYB A;  3D0P A;  4FM1 A;  4B9T A;  1C0M A;  3VQ8 A;  3PX6 A;  4FYD A;  1S5J A;  4CJ4 A;  1SUQ A;  3AVI A;  3OS1 A;  2ZQB A;  3AA3 A;  3LP1 A;  2P1J A;  3OYG A;  3QNN A;  1Q9Y A;  1JL2 A;  4W5N A;  1BIS A;  2X78 A;  3O4N A;  1X1P A;  3VQ5 A;  3ASM A;  2NUB A;  3A2F A;  4E1N A;  3NDK A;  2HNZ A;  2WON A;  3WNF A;  4CJQ A;  4CJT A;  3DRR A;  4AHR A;  3SUQ A;  2I5J A;  1NKB A;  1J54 A;  2ZE2 A;  4PA1 A;  4M3U A;  2YNG A;  2P51 A;  1WSG A;  1GOC A;  3NCI A;  4M3X A;  4DTR A;  3OYF A;  4FJL A;  5JS1 A;  3NH2 A;  1LW0 A;  3DLE A;  3F9K A;  5DK5 A;  3D45 A;  3QEV A;  2HB5 A;  5K14 A;  3TAG A;  1T8E A;  4KTQ A;  2P5G A;  4FK0 A;  1IH7 A;  1FK9 A;  3RR8 A;  2KQ2 A;  2YHA A;  1O1W A;  4CHO A;  4CJK A;  5FRO A;  4FCY A;  4FJI A;  1DTQ A;  4CJL A;  4DTJ A;  3U3Y A;  3T19 A;  4DSK A;  4PQU A;  3ITH A;  4ELU A;  4KV8 A;  3AVH A;  4RW4 A;  4QOZ B;  2OPS A;  4J2A A;  1D8Y A;  1RTJ A;  3HYF A;  3AO1 A;  3L8B A;  4I9Q A;  4NCG A;  3DM2 A;  1TK8 A;  4B9M A;  1D5A A;  4IKF A;  4GVM A;  1B92 A;  3PO5 A;  4C8N A;  5CY4 A;  1HMV A;  5CZ2 A;  4FJK A;  1NK0 A;  4UQG A;  5EU7 A;  1JXB A;  4I7F A;  4ICL A;  4DFP A;  4DQQ A;  4BDY A;  3RWU A;  2HHT A;  3VQP A;  3SYZ A;  3DLK A;  4W5Q A;  4HUG A;  3I8D A;  4Z4I A;  1CZB A;  3BGR A;  3KLG A;  3S3N A;  1YT3 A;  4AHC A;  3K58 A;  4E7L A;  1N5Y A;  1S1U A;  3KK2 A;  4DWI A;  4B9L A;  4N47 A;  3HO1 A;  5HP1 A;  2BGG A;  1LWE A;  2F8T A;  3KK1 A;  1QTM A;  4DSE A;  3QLH A;  3ZSX A;  1S9E A;  1HYS A;  3CM5 A;  2VG7 A;  4B8A B;  1HPZ A;  3V4I A;  1CLQ A;  3LWL A;  2KZM A;  3MEE A;  3KK3 A;  4AIL C;  4FJG A;  1JL1 A;  4CEE A;  3IS9 A;  1B9D A;  1RT7 A;  1BQM A;  4E7I A;  4BDP A;  2Y1J A;  2O4I A;  4DTP A;  2EX3 A;  2G8U A;  3JYT A;  3IG1 A;  1CZ9 A;  2YKN A;  4FJ5 A;  2AJQ A;  4CF1 A;  4DTM A;  4CEC A;  1NK9 A;  4Q5V A;  3OYN A;  3LZJ A;  1NK8 A;  1JLB A;  3ISN C;  2HVI A;  2GUI A;  2DTU A;  4K8X A;  3V1O A;  4HCB A;  3DYA A;  3SUP A;  1SL2 A;  4RW9 A;  3TAM A;  3QER A;  1BHL A;  1VSL A;  5E41 A;  3LPT A;  1S1V A;  3AVC A;  3IRX A;  4CJF A;  4FJH A;  2JLE A;  1HJR A;  4Y1C A;  1VSF A;  3LP3 A;  4CES A;  3P83 D;  4MFB A;  3NH1 A;  4B9V A;  1XI1 A;  3U6F A;  2B5J A;  4NCA A;  1NK7 A;  1C0U A;  1RNH A;  4CFA A;  4DF4 A;  1BCO A;  3G10 A;  1EP4 A;  4ELT A;  3MEC A;  3L3V A;  2KTQ A;  4JS4 A;  1U47 A;  3CFR A;  1BCM A;  1VSM A;  1L3V A;  1X9S A;  1VSK A;  1RT6 A;  1REV A;  1VRU A;  5C24 A;  3WNE A;  4CK1 A;  3F73 A;  1S6Q A;  3QEW A;  2VWK A;  1U45 A;  3OYE A;  3CG7 A;  3VQ4 A;  1A5V A;  4DLG A;  2VG6 A;  1WSI A;  4Z4F A;  1W0H A;  3OYA A;  4CGF A;  2E6M A;  5JS2 A;  1UA0 A;  3P1G A;  3LAK A;  1KSP A;  3KLF A;  1WSJ A;  3V1Q A;  2B6A A;  4DSI A;  5HRR A;  1BL3 A;  5CYM A;  5SWM A;  2IGI A;  4FZZ A;  1HQE A;  1XWL A;  2Y1I A;  1KRP A;  4CEA A;  4FK2 A;  1BI4 A;  2EHG A;  3HPG A;  1RTI A;  1Q9X A;  4M3R A;  3K5M A;  1D9F A;  1LW2 A;  3PX0 A;  3MXM A;  1LAV A;  2ITG A;  1WSE A;  3JSM A;  2DY4 A;  4L8R B;  5HBM A;  2Z1I A;  3QIN A;  1QE1 A;  4CHZ A;  3P5J A;  1N6Q A;  4B08 A;  1L3S A;  4KHN A;  1JXE A;  1RBT A;  3MXJ A;  1KVC A;  1RTD A;  4FLU A;  4B9S A;  3NF9 A;  2F8S A;  1KVA A;  3ZSZ A;  2PY5 A;  3K5O A;  3HVR A;  2PYL A;  4B3O A;  1FXX A;  4Y1D A;  2O4G A;  1BQN A;  4Z4C A;  1L3U A;  1J5O A;  4DQI A;  4OLA A;  3BDP A;  4KRF A;  3DLG A;  4ZHR A;  4FLX A;  4H4M A;  2YNH A;  1BGX T;  4KHQ A;  1JKH A;  1NKC A;  1X9M A;  3TAF A;  2VWJ A;  4F3O A;  4E1M A;  4KI4 A;  1HNV A;  2KFN A;  2BAN A;  4LSN A;  3CQ8 A;  1Z26 A;  3ZSW A;  2XHB A;  3VQC A;  2P5O A;  3ZSY A;  1SKS A;  1KLN A;  3KD1 E;  3HM9 A;  4Z0U A;  4FZY A;  4IDK A;  1NJY A;  1QSY A;  4BE2 A;  4C8L A;  4DS5 A;  5KGX A;  1HYZ A;  3AVB A;  5C42 A;  2FBX A;  3NH0 A;  3V1R A;  2ATQ A;  3VA3 A;  3I0S A;  2YNF A;  3AVK A;  1SKW A;  3AV9 A;  4IBN A;  3KKS A;  1GOB A;  3C94 A;  3ALY A;  2OA8 A;  1RT4 A;  1QSS A;  1ASU A;  1HNI A;  4OLB A;  1BI4 B;  2LSN A;  1I3A A;  4KPY A;  3PO4 A;  1U49 A;  1QS4 A;  3NF6 A;  3S9H A;  3SV4 A;  1QSL A;  3HL8 A;  2DFE A;  2RN2 A;  4F2R A;  4NYN A;  5KGW A;  4OGE A;  4F2S A;  4FJJ A;  3ZSV A;  1ZYQ A;  1ZBI A;  3TAR A;  3V9W A;  1RDB A;  3QNO A;  1UWB A;  4OKJ A;  1K6Y A;  5J2M A;  1ZBU A;  4CGJ A;  3OYJ A;  4H4O A;  3S3O A;  1TAU A;  1SV5 A;  3NAE A;  4DTX A;  3VQ9 A;  4LSL A;  3MXI A;  1NKE A;  3O4Q A;  2OZS A;  4EP5 A;  1U04 A;  4YFU A;  5CYQ A;  1KLM A;  4N5S A;  3VQB A;  3K2P A;  2XY8 A;  1LWC A;  4CE9 A;  4HUE A;  4EZ6 A;  5HRS A;  4M3Z A;  5J2P A;  4DLE A;  3KJV A;  4CJW A;  3SQ1 A;  4OVL A;  1IKY A;  3TAN A;  2IC3 A;  5HLF A;  1J9A A;  4OGC A;  3HP6 A;  4F3T A;  3SUN A;  1F21 A;  4ELV A;  1EKE A;  3VQD A;  1ZBF A;  1VSI A;  1MU2 A;  1IKW A;  4CFB A;  3QEI A;  4CF2 A;  2OPQ A;  3VQQ A;  3L2R A;  1S6P A;  1SL0 A;  4CEZ A;  4FLW A;  3LAM A;  3MEG A;  1EET A;  2G8I A;  4CF0 A;  4O0I A;  4BWJ A;  3TI0 A;  4Z4G A;  1WAF A;  3M8S A;  4KHS A;  1YTU A;  4CGG A;  2DFH A;  4FLY A;  2KZZ A;  1VSJ A;  4DMN A;  4LY7 A;  2Z1H A;  3SQ0 A;  4B8C A;  3SPZ A;  4FJM A;  4CJR A;  4BE1 A;  5HRN A;  4J2E A;  3OY9 A;  1RTH A;  4E0D A;  4F8R A;  1WSF A;  3L2W A;  4FJN A;  1B9F A;  1LWF A;  1RDD A;  2BE2 A;  4IFV A;  4J2D A;  1T03 A;  1D9D A;  4O5B A;  4CHN A;  3E01 A;  4OKE A;  4CIG A;  4E7J A;  2GV9 A;  2YHB A;  1X9W A;  3NBP A;  4RW6 A;  1ASV A;  1YTA A;  3EZ5 A;  4CIF A;  2R7Y A;  4F4K A;  4KFB A;  5KRT A;  1FKO A;  4FXD A;  1RT5 A;  4HUF A;  4FM0 A;  1I39 A;  5I42 A;  1KFS A;  4KHY A;  3LPU A;  1RBR A;  2IAJ A;  3OJS A;  4DQP A;  1WSH A;  3AVA A;  2WOM A;  5J2Q A;  4AH9 A;  5KRS A;  3K57 A;  2RKI A;  2OPR A;  3O3G A;  2RF2 A;  4DQS A;  3SQ2 A;  3QEX A;  1U48 A;  3S3M A;  2DFF A;  3DRP A;  3WNH A;  2IS3 A;  1RIL A;  2XY6 A;  1RBV A;  4CK2 A;  3KIO A;  2X74 A;  3VQE A;  4FW2 A;  1FKP A;  1HQU A;  1KCF A;  5D3G A;  4PY5 A;  5KI6 A;  3AVF A;  3LAL A;  1Q8I A;  4HVJ A;  3DLR A;  3SCX A;  3CFO A;  3HXM A;  3TR8 A;  4CHP A;  4OPK A;  3NFA A;  3IAY A;  1TV6 A;  5HRP A;  3L2V A;  2W42 A;  4W5T A;  3M8R A;  3SJJ A;  1VSD A;  1ASW A;  2HHQ A;  3B6O A;  3DOK A;  4CEF A;  4W5R A;  3NF7 A;  1VSH A;  1T05 A;  2G8F A;  2D0B A;  4Z4E A;  1QQC A;  3VQA A;  3NGY A;  4KO0 A;  3NE6 A;  4AHV A;  4CJU A;  3THV A;  4M3T A;  1HYV A;  1KVB A;  1L5U A;  4M3Y A;  1KTQ A;  1S1X A;  4NCB A;  2HHX A;  2RPI A;  4FJ7 A;  1NJW A;  1C6V A;  4NYF A;  4DSF A;  4CF9 A;  3OYK A;  1ITG A;  4BWM A;  4DG1 A;  3AO3 A;  4JRP A;  3AA5 X;  3SI6 A;  4B9U A;  3ZT0 A;  3M8P A;  2XRI A;  2YV0 X;  4E3S A;  4CIE A;  2HND A;  2XY7 A;  3LZI A;  3V9S A;  3ZCM A;  2A1R A;  1LAW A;  3B6P A;  3I0R A;  3M8Q A;  2FBV A;  3T1A A;  1IG9 A;  4FM2 A;  3HK2 A;  1JLF A;  3PX4 A;  4M45 A;  3MAQ A;  4FZX C;  4CJV A;  4LH4 A;  4LH5 A;  2HVH A;  2OPP A;  4TSX A;  4ZTJ A;  4E7H A;  2Z1G A;  4O4G A;  2D5R A;  5J1E A;  3RRH A;  1R0A A;  2G8W A;  3HT3 A;  5CZ1 A;  4RW7 A;  3DOL A;  4C8M A;  3ZSQ A;  3ZT3 A;  3C6T A;  3RTV A;  3U3G A;  3QEP A;  3SNN A;  1UAX A;  1VK0 A;  2A1S A;  3KLE A;  4FLT A;  3V6D A;  2PZS A;  4DSJ A;  1BIZ A;  4DF8 A;  1UA1 A;  3HPH A;  4K8Z A;  4KKO A;  1T7P A;  2G8V A;  4FK4 A;  3QES A;  4HCC A;  1IO2 A;  1WLJ A;  2Z1J A;  1ZBL A;  1BIU A;  2X6S A;  4OJR A;  3RR7 A;  2QKK A;  4AHT A;  3HVT A;  3CFP A;  3HJF A;  3RMD A;  1TK5 A;  2KW4 A;  4KHW A;  3LP2 A;  3NGI A;  3AO5 A;  4CF8 A;  3TAB A;  3RMA A;  4M3W A;  3NGZ A;  5FRM A;  3KKR A;  2XO7 A;  3SZ2 A;  5I3U A;  3DI6 A;  1NJX A;  3T3F A;  4ZTF A;  4BE0 A;  4BDZ A;  1JLQ A;  4JS5 A;  4HHT A;  4FJ9 A;  4N76 A;  1EX4 A;  4DFM A;  3AA2 A;  4CGH A;  4YNQ A;  1GOA A;  3ULD A;  3QIO A;  5KTQ A;  3OS0 A;  2F96 A;  1DTT A;  1S1W A;  1TKZ A;  2FC0 A;  2ETJ A;  4KTZ A;  4EP4 A;  4I2Q A;  4MQ3 A;  4CEO A;  3PY8 A;  3L3U A;  3LAN A;  1QHT A;  1RCH A;  1CXU A;  4DTU A;  3CYM A;  3KTQ A;  1RT1 A;  2OZM A;  4KI6 A;  4PWD A;  3OYD A;  4IG0 A;  4HTU A;  3CM6 A;  1L3T A;  2HHW A;  4KB0 A;  1TK0 A;  5FRN A;  1S9G A;  3SUO A;  3UIQ A;  2FBY A;  2IDO A;  4JLH A;  3LWM A;  4FVM A;  1TAQ A;  3H08 A;  2QXF A;  1TL3 A;  4I9L A;  1TKT A;  1RBU A;  1A5X A;  3V9X A;  3WNG A;  2FBT A;  5DMR A;  3SQ4 A;  3HP9 A;  3QO9 A;  3QIP A;  4B9N A;  4DFJ A;  4IFY A;  3OYL A;  4CJE A;  1HRH A;  4PUO A;  2B4J A;  4KTW A;  3EY1 A;  2HW3 A;  1RDA A;  4E19 A;  3TAE A;  3PV8 A;  3VN5 A;  3RMC A;  4C8O A;  4FJX A;  4CJS A;  2QK9 A;  4E7K A;  4CGI A;  4GMJ B;  4DU3 A;  1XC9 A;  1DLO A;  3TWH A;  1TKX A;  1W9H A;  3ZSR A;  2PYJ A;  1C1B A;  1JLA A;  4WE1 A;  4CJP A;  3OYM A;  3AVL A;  4M41 A;  4DTN A;  2HHV A;  3V9U A;  2HHU A;  4XIU A;  3AVN A;  1TKD A;  2HNY A;  3TAP A;  1TGO A;  1WN7 A;  3PUF A;  4KAZ A;  4W5O A;  4O0J A;  1Y97 A;  5T7B A;  1NK4 A;  1XHX A;  3VA0 A;  1U4B A;  4O44 A;  3NF8 A;  2D0A A;  4CED A;  3L2U A;  2YKM A;  4CEB A;  2QKB A;  1JLE A;  3FFI A;  1C1C A;  1RT3 A;  4E89 A;  1VSE A;  3K59 A;  2GBZ A;  1NK5 A;  1C1A A;  4ID5 A;  3OVN A;  3NHG A;  4RW8 A;  1S1T A;  3EYZ A;  4DU1 A;  1NK6 A;  4KB1 A;  3OS2 A;  4DQR A;  3HPO A;  2Q3S A;  4CER A;  2OYQ A;  3OYI A;  4CFC A;  2IOC A;  4OKK A;  3DLH A;  1UOC A;  4C8K A;  4N41 A;  1KFD A;  1SKR A;  3LP0 A;  1SL1 A;  3ZT4 A;  3G0Z A;  4QAG A;  4CHY A;  2E6L A;  3V9Z A;  4CFD A;  3KLH A;  1IKX A;  3DMJ A;  4ID1 A;  3VQ7 A;  1RBS A;  3AVG A;  2ZD1 A;  4BAC A;  4N56 A;  4FLZ A;  2XY5 A;  3RMB A;  1JLG A;  4GW6 A;  2D0C A;  3AVM A;  3ZT1 A;  4EZ9 A;  2G8H A;  3AVJ A;  2JGU A;  2HMI A;  1LV5 A;  3C6U A;  3O3F A;  4J2B A;  3TAQ A;  3OJU A;  3OYH A;  4FLV A;  1C0T A;  3C95 A;  3ZSO A;  4DTS A;  3LDS A;  4CCH A;  5HRO A;  3K5L A;  4G1Q A;  4DFK A;  4DSL A;  1NOY A;  4Q0B A;  2KFZ A;  1WAJ A;  3KLI A;  3OYC A;  4AHS A;  5C25 A;  1G15 A;  1JLC A;  4O55 A;  3K5N A;  1A5W A;  1RDC A;  4IG3 A;  4M42 A;  3HST B;  1EXQ A;  1WNS A;  1Z25 A;  4LD0 A;  3ZT2 A;  4DU4 A;  4R5P A;  4CGD A;  2BDP A;  4KHU A;  2G8K A;  1NOZ A;  2X6N A;  5FDL A;  4CJ3 A;  4JRQ A;  4DTO A;  1TVR A;  4CJ5 A;  3V81 A;  2VG5 A;  3SPY A;  3DLB A;  4Z4H A;  4DS4 A;  5SZT A;  4QCL A;  2YNI A;  1TL1 A;  4I2P A;  4FJ8 A;  3MED A;  1IKV A;  1XHZ A;  3SV3 A;  1RT2 A;  3VQ6 A;  4CHQ A;  3QET A;  4OPJ A;  4CK3 A;  4CEQ A;  1YVU A;  3O3H A;  1CXQ A;  4AHU A;  4H8K A;  1J53 A;  3AA4 A; 
#chains in the Genus database with same CATH topology
 3BEX A;  5GAH P;  1ZBH A;  1NJZ A;  4FW1 A;  3RRG A;  1VRT A;  2WBN A;  3IMX A;  2A3Z A;  3KD5 E;  2HHS A;  3OYB A;  1C0M A;  3Q7C A;  3PX6 A;  4FYD A;  1SUQ A;  3AA3 A;  3LP1 A;  3CCE N;  4GNI A;  4DV6 K;  3TTD A;  3NDK A;  2NUB A;  3GL1 A;  1XMO K;  5AQQ A;  3ZLJ A;  2FSN A;  3DRR A;  2PFU A;  5AQP A;  1NKB A;  4BY9 C;  2QM1 A;  3L4Q A;  4PA1 A;  3THW B;  3AY9 A;  4B3S K;  3OYF A;  1LOT B;  1VQO N;  2UUC K;  3TAG A;  4IJN A;  2P5G A;  4YOU A;  2YHA A;  1O1W A;  1DTQ A;  4DTJ A;  4DSK A;  1T6C A;  4ELU A;  1TYQ B;  1BOT O;  5BRE A;  4QOZ B;  4GVE A;  3MWT A;  2QTD A;  3L8B A;  2NRZ A;  4PL8 A;  3OBW A;  1D5A A;  1VQ6 N;  4IKF A;  1B92 A;  1JCE A;  3A5O C;  3THY A;  4UQG A;  1M1K O;  4ICL A;  4YHH K;  4BDY A;  1DGK N;  3VQP A;  4HUG A;  4IO8 A;  1HUX A;  3KLG A;  1MWK A;  1WOQ A;  1S1U A;  3P4I A;  2NRR A;  3FLC O;  5HP1 A;  2F8T A;  3C7N A;  1QTM A;  4DSE A;  1E3M A;  4IWV A;  3ZYY X;  1S3X A;  3CM5 A;  4C23 A;  3MEE A;  3KK3 A;  4AIL C;  2YHY A;  4FJG A;  3R8E A;  2FSJ A;  2O4I A;  3G25 A;  5EY4 A;  1CZ9 A;  2HMP A;  2YKN A;  4FJ5 A;  2AJQ A;  2P9L A;  1NK9 A;  3C0B A;  2RHK A;  3HOT A;  2DTU A;  4JI2 K;  3RSE A;  4K8X A;  4FWS A;  3PIP L;  2CH5 A;  4DR1 K;  4RW9 A;  3TAM A;  4CI6 A;  5AQO A;  1S1V A;  3EE9 A;  3IRX A;  4A5B A;  3TSU A;  4BC3 A;  2NRW A;  3CPW M;  4CES A;  3MDQ A;  3P83 D;  2QWR A;  4YOV A;  4B9V A;  1XI1 A;  3U6F A;  3BF1 A;  1RNH A;  3G6E N;  4FWK A;  1BCO A;  2ZF5 O;  1EP4 A;  3L3V A;  1L3V A;  4BRG A;  1REV A;  1VRU A;  5C24 A;  3WNE A;  4CK1 A;  4FWP A;  2NRX A;  2VGN A;  2GWJ A;  3BF3 A;  3CG7 A;  2ZGY A;  1A5V A;  3MMV A;  1W0H A;  4YOW A;  1UA0 A;  4IOX A;  1KSP A;  1WSJ A;  3VEO A;  4DSI A;  5HRR A;  1YJW N;  4PHT X;  4BRH A;  5CYM A;  4CZM A;  4JKF A;  2O8E A;  2EHG A;  1ZBS A;  3K5M A;  1D9F A;  4Y0W A;  4DV7 K;  2E8A A;  1VQM N;  3GOI A;  4L8R B;  3TU5 A;  2WTU A;  1QE1 A;  4B08 A;  3MXJ A;  4LFB K;  3ULE B;  2F8S A;  4JI0 K;  2PY5 A;  2CH6 A;  1KXP A;  4LFC K;  2E2P A;  5M1F A;  4H4M A;  4FWO A;  3TAF A;  4KI4 A;  1T3V A;  3MWP A;  3ZSW A;  1R59 O;  3CME N;  4KH6 A;  4Z0U A;  4FWQ A;  1NJY A;  3J81 O;  1QZ5 A;  2ATQ A;  2OCE A;  4BG9 A;  3ALY A;  1RDW X;  2A5X A;  1Z6R A;  2LSN A;  3PO4 A;  1QSL A;  4F2S A;  2DFE A;  4NYN A;  1ZBI A;  3QNO A;  1RGI A;  4WQ4 A;  4JI6 K;  4JI3 K;  1TAU A;  1SV5 A;  4DTX A;  3VQ9 A;  4EP5 A;  4XH4 A;  4K25 A;  3CCV N;  2FSK A;  3VQB A;  3K2P A;  4CE9 A;  2P9P B;  4M3Z A;  4DLE A;  4CJW A;  5H1S Q;  4OVL A;  3TAN A;  2IC3 A;  1WB9 A;  4OGC A;  4X65 K;  1EKE A;  2P9I B;  3CJA A;  2PAV A;  4CF2 A;  1WBB A;  2OPQ A;  5EX5 A;  2HBL A;  1SL0 A;  3KVG A;  4CEZ A;  4FLW A;  3LAM A;  2G8I A;  3MCP A;  4CF0 A;  4O0I A;  3AAR A;  4HWI A;  5M1N A;  3SAG A;  1Z05 A;  3M8S A;  4CGG A;  1KAY A;  4DMN A;  3SPZ A;  3WEE B;  5C15 A;  4CJR A;  3OY9 A;  5BRH A;  1B9F A;  4CD3 A;  4IFV A;  4O5B A;  1EWQ A;  3E01 A;  4YDU A;  4J8F A;  4BG8 A;  4DCH A;  4E7J A;  3VGL A;  4CIF A;  3ZEU B;  5BR8 K;  4FWM A;  4HUF A;  1I39 A;  5I42 A;  4OPA A;  1GLB G;  4BRI A;  1BWF O;  1OH7 A;  3AVA A;  1LCU A;  2WOM A;  3D2E A;  3G4S N;  3O3G A;  1SQK A;  4DV1 K;  3QEX A;  3SQ2 A;  4H5N A;  3DRP A;  3WNH A;  1RIL A;  3UKU A;  5AQT A;  4FW2 A;  1FKP A;  2RE2 A;  3O08 A;  3ZX3 A;  1OH8 A;  3TR8 A;  4DR7 K;  3IAY A;  1Q82 O;  3N4P A;  4AQY K;  4DR6 K;  3NE6 A;  2E5L K;  4CJU A;  1HYV A;  4BR5 A;  2GEL A;  3PLA A;  1NJW A;  3L0Q A;  1ITG A;  4H5R A;  3AA5 X;  4B1W B;  5C2D A;  3SI6 A;  2Q0R A;  2XRI A;  4FPB A;  4E3S A;  3V9S A;  1FW6 A;  3B6P A;  2UYT A;  3HBT A;  1P8Z A;  3T1A A;  1IG9 A;  3IDH A;  3PX4 A;  4M45 A;  4FSV A;  4LH4 A;  2HVH A;  4GV3 A;  4JNE A;  3RRH A;  3O5B A;  3EZW A;  3WXJ A;  3RTV A;  3U3G A;  3OA9 A;  2PZS A;  3G71 N;  3CC4 N;  4XEI A;  2UXB K;  4QS7 A;  4B1Z A;  2YJF A;  3TTF A;  4KKO A;  3ATU A;  3VES A;  4HCC A;  2UUA K;  2Z1J A;  1BIU A;  2X6S A;  3RR7 A;  2I7P A;  3HVT A;  3CFP A;  5BPM A;  4KHW A;  3AO5 A;  4CF8 A;  1N34 K;  2XO7 A;  1NJX A;  3T3F A;  4BE0 A;  1IG8 A;  4BDZ A;  3LM9 A;  3E1Y A;  4DR4 K;  4DFM A;  3AA2 A;  4YNQ A;  3ULD A;  3OS0 A;  2F96 A;  1TKZ A;  2FC0 A;  2O8B A;  4KTZ A;  4EP4 A;  4I2Q A;  2W40 A;  4YOR A;  1QHT A;  1BUP A;  2QW9 A;  3VGM A;  1RT1 A;  2HBJ A;  4KI6 A;  4IG0 A;  3CM6 A;  1NJI O;  1TYQ A;  4KB0 A;  4BQZ A;  3UIQ A;  2IDO A;  3FGU A;  4IZ9 A;  3H08 A;  2QXF A;  1TL3 A;  1A5X A;  4DUZ K;  2JWL A;  2P9N B;  4M63 C;  4B9N A;  4H5T A;  2B4J A;  2HW3 A;  4JKC A;  1XNR K;  2O8E B;  4C8O A;  4CJS A;  4ISG A;  3VET A;  4E7K A;  1W2B M;  3ZX0 A;  3TWH A;  4WQ5 A;  4M41 A;  3FZM A;  2HHU A;  4XIU A;  3JXU A;  1JJ2 M;  5AQL A;  1XHX A;  3KWI A;  1U4B A;  4O44 A;  4CED A;  4EFH A;  2QKB A;  1JLE A;  1C1C A;  4E89 A;  4DHY A;  4NLC A;  4CER A;  1HJO A;  4C8K A;  1ILY A;  1SKR A;  1SL1 A;  3ZT4 A;  4ILJ A;  1VQ7 N;  4CFD A;  3O9T A;  5AQG A;  3DMJ A;  3F2K A;  3CCJ N;  2ZD1 A;  2XY5 A;  3KK7 A;  5BN8 A;  3AVM A;  3AVJ A;  1LV5 A;  3O3F A;  1O13 A;  3OYH A;  4WYB A;  4DTS A;  1VQK N;  2OTL N;  1NGB A;  3E9P A;  2UXC K;  3OYC A;  4AHS A;  4L3Q A;  5GAD P;  4LD0 A;  4DU4 A;  3ZT2 A;  3HTV A;  4CJ5 A;  3D2F A;  4DS4 A;  2YNI A;  1XHZ A;  4CEQ A;  1ZC6 A;  1YVU A;  2QWQ A;  5AQM A;  3ZET A;  4B1X B;  1CXQ A;  4AHU A;  4H8K A;  1J53 A;  4CF9 A;  4RWT A;  4A61 A;  3L2Q A;  4RG8 A;  3AO2 A;  1VQN N;  2E4L A;  2P9I A;  4B9T A;  4H0P A;  3VQ8 A;  4CJ4 A;  5AQY A;  2P1J A;  3OYG A;  3I56 N;  3VQ5 A;  1X1P A;  3ULE A;  4FZY A;  4Z4G A;  4CJT A;  4AHR A;  2I5J A;  1J54 A;  2AP1 A;  1GOC A;  3CJ7 A;  1EWR A;  5JS1 A;  5BPN A;  3QEV A;  2HB5 A;  5C12 A;  4I6M A;  1CZA N;  1FK9 A;  3H1Q A;  3ZEU A;  4CHO A;  2QXL A;  4A57 A;  5FRO A;  4FCY A;  4CJL A;  3T19 A;  3IFR A;  4A2A A;  2YI1 A;  4RW4 A;  4O8U A;  4QS9 A;  1K8K B;  2OPS A;  1SAZ A;  2P9K A;  2D0P A;  1RTJ A;  1D8Y A;  4J2A A;  1NG9 A;  3PO5 A;  3P38 A;  1NK0 A;  2O8C A;  4DFP A;  2E1Z A;  4WFA L;  3DLK A;  1NGF A;  4W5Q A;  4WCE L;  3I8D A;  1CZB A;  3BGR A;  3VF4 A;  4AHC A;  4JI4 K;  4DWI A;  1Q81 O;  3HO1 A;  2ZGZ A;  1W97 L;  2VG7 A;  4GY2 B;  4ILH A;  2UXD K;  1HPZ A;  3WXM B;  3V4I A;  1CLQ A;  2KZM A;  1VQP N;  2GTD A;  4CEE A;  4BDP A;  1B9D A;  1ZXO A;  2G8U A;  4BRA A;  3JYT A;  4A5A A;  3SK3 A;  3QBW A;  4CEC A;  3LZJ A;  4JKG B;  3D6R A;  4JKB A;  4HCB A;  4DV4 K;  3DYA A;  3QER A;  3LPT A;  4CJF A;  2JLE A;  3WEE A;  1U2V A;  1VSF A;  4X64 K;  1C0U A;  5AQX A;  4DF4 A;  3G10 A;  4MO5 A;  1WUA A;  3MEC A;  4JHD B;  1U47 A;  2E2N A;  1VSK A;  3F73 A;  1S6Q A;  1J6Z A;  3FZH A;  3VQ4 A;  3L6Q A;  2VG6 A;  4Z4F A;  4U67 L;  3OYA A;  1Q7Y O;  1VQL N;  5I9E B;  2PBD A;  1BDG A;  3NMU A;  3LAK A;  3V1Q A;  4CZG A;  1VQ4 N;  3DXM B;  4FOI A;  5SWM A;  3D2F B;  1N33 K;  2Y1I A;  1XWL A;  1KRP A;  3EE8 A;  3GDQ A;  1Q9X A;  1LW2 A;  1LAV A;  4LC9 B;  5KQD A;  2GUP A;  5HBM A;  1YJ9 N;  1N6Q A;  3P5J A;  1RBT A;  4LF5 K;  1OH5 A;  2O8F A;  1TUY A;  4BGA A;  5CE3 A;  2PYL A;  4OLA A;  1BQN A;  4Z4C A;  4GV6 A;  3DLG A;  3F5T A;  5FPM A;  1IV0 A;  4CZH A;  1BGX T;  4KHQ A;  1NKC A;  5TKW A;  1X9M A;  4B1U B;  4NXM K;  2KFN A;  5KQ8 A;  5HOO A;  3CQ8 A;  1Z26 A;  2XHB A;  3P39 A;  3ZSY A;  5C10 A;  1KLN A;  3KD1 E;  3LDN A;  4WF9 L;  1N36 K;  3MN7 A;  5ADX A;  4IDK A;  4LF7 K;  4CBX A;  5KGX A;  3AVB A;  3NH0 A;  2FBX A;  1C0G A;  3V1R A;  3I0S A;  1S72 N;  4JKH A;  1SKW A;  3AV9 A;  4IBN A;  1GLD G;  2NZT A;  3KKS A;  3SAH A;  1QSS A;  1X9J A;  3THY B;  4BRD A;  3S9H A;  4BRK A;  4F2R A;  2RN2 A;  4JK8 A;  2QA4 N;  4OGE A;  4U7B A;  4LF9 K;  3V9W A;  2NNW A;  1GLJ O;  5J2M A;  1NGD A;  4CGJ A;  3OYJ A;  4H4O A;  3S3O A;  3NAE A;  1NKE A;  3C6A A;  2DPN A;  5AQF A;  3WQT A;  4O5F A;  3VEY A;  5F0X A;  3J7Y P;  4N5S A;  2XY8 A;  5HRS A;  5J2P A;  2GWK A;  1T44 A;  3GE1 A;  3UKU B;  3HP6 A;  4PKH A;  3U4L A;  4F3T A;  3LDL A;  3VQD A;  1ZBF A;  3QEI A;  2P9S B;  3AGR A;  1EET A;  2YHW A;  3EKU A;  4BR4 A;  3CC2 N;  1YTU A;  2KZZ A;  4BVP A;  3CQX A;  4K42 A;  2Z1H A;  4BE1 A;  5HRN A;  4F8R A;  3L2W A;  2VWB A;  4J2D A;  1T03 A;  2V7Y A;  3BZK A;  1D9D A;  4CIG A;  1KAZ A;  1VAZ A;  3NBP A;  4IO9 L;  1RT5 A;  2HOE A;  5LL6 Z;  1NGI A;  2IAJ A;  3OJS A;  1GLC G;  3WXI A;  3VER A;  1BO5 O;  2OPR A;  2RF2 A;  4K41 A;  4WFN L;  4MDA A;  3S3M A;  4JK7 A;  3H3N O;  4WQ5 C;  1RBV A;  4CK2 A;  2X74 A;  1TUU A;  1MDU B;  1HQU A;  1KCF A;  5AQK A;  3O1B A;  5KI6 A;  3SCX A;  4HVJ A;  3HXM A;  4CJ7 A;  4CHP A;  5JLF A;  3NFA A;  1TV6 A;  2Q2R A;  2W42 A;  3M8R A;  2HHQ A;  4W5R A;  2ZM6 K;  3NF7 A;  1VSH A;  1OKJ A;  3NGY A;  4KO0 A;  3PSI A;  1Q18 A;  3DXM A;  3THV A;  3ATV A;  1KVB A;  1L5U A;  4M3Y A;  1HKB A;  1KTQ A;  1S1X A;  4ISF A;  2RPI A;  2F9T A;  1S22 A;  5LMU K;  4IOA L;  3M8P A;  3FR0 A;  4C1N K;  2XY7 A;  4CIE A;  2HND A;  2A1R A;  3SJH A;  3ZCM A;  3M8Q A;  3QFP A;  2VCP A;  2O8B B;  3ENO A;  2Q0U A;  3HK2 A;  1JLF A;  4CZL A;  2NLX A;  3PSF A;  4LH5 A;  4ZTJ A;  4E7H A;  1KD1 O;  4O4G A;  3HT3 A;  5LJW A;  4RW7 A;  3QEP A;  3SNN A;  3CJ1 A;  3ZET B;  3KLE A;  4FLT A;  4DF8 A;  1UA1 A;  3HPH A;  2ZWH A;  1GLF O;  3E9O A;  5FPN A;  4FK4 A;  3QES A;  1IO2 A;  1WLJ A;  2QKK A;  4AHT A;  3DJC A;  5AFU H;  3RMD A;  5FRM A;  3NGZ A;  5I3U A;  4A59 A;  1JLQ A;  3CJ9 A;  1YVN A;  3I33 A;  2P9P A;  5AFU A;  3SMS A;  3NVM A;  1DTT A;  4JHD A;  5KPZ A;  3IUC A;  4DUY K;  4MQ3 A;  3L3U A;  1RCH A;  1CXU A;  3KTQ A;  4PWD A;  2W41 A;  3LM2 A;  2HHH K;  1S9G A;  4BRP A;  1K8K A;  2FBY A;  2P9K B;  3R6M A;  3LWM A;  1TAQ A;  5LMN K;  3I8B A;  4I9L A;  3SQ4 A;  2FBT A;  5DMR A;  5JVG L;  2E20 A;  1HRH A;  4PUO A;  1RDA A;  4E19 A;  1QQO A;  3VN5 A;  4FJX A;  5BRD A;  3ZSR A;  1NM1 A;  4BR0 A;  4DTN A;  3V9U A;  4B3R K;  2HNY A;  3TAP A;  1DEJ A;  3CPE A;  4O0J A;  3VA0 A;  3L2U A;  1RT3 A;  1FJG K;  3K59 A;  2QWN A;  2A40 A;  3E9L A;  2GBZ A;  3VGK A;  1NK6 A;  3EYZ A;  1S1T A;  4KB1 A;  3BP8 A;  3HPO A;  1J5E K;  2Q3S A;  4LFA K;  4X62 K;  4OKK A;  4N41 A;  1UOC A;  2BUP A;  4FWL A;  3LP0 A;  4PKI A;  1OH6 A;  3V9Z A;  1IKX A;  4ID1 A;  1V4T A;  3E66 A;  3BZC A;  4NLB A;  3AVG A;  3LDP A;  2FXU A;  3R3L A;  4CCH A;  3ZSO A;  1JCG A;  4JD2 A;  2A42 A;  5HRO A;  4G1Q A;  1M90 O;  4JEP A;  1ATN A;  4BVO A;  2FLO A;  1G15 A;  4IG3 A;  3HST B;  1WNS A;  2BDP A;  4R5P A;  4KHU A;  5LJV A;  2G8K A;  2X6N A;  4DTO A;  3CMA N;  3SPY A;  2HBM A;  5BPL A;  2GEM A;  4BC2 A;  2F4V K;  4QCL A;  1GLA G;  3HSC A;  3SV3 A;  3LDO A;  4EIA A;  4OPJ A;  2F7T A;  3O3H A;  5KPR A;  4AM6 A;  1YTA A;  5BN9 A;  3HM8 A;  3DRS A;  4KRE A;  5J2N A;  3O9R A;  4IXC A;  3J80 O;  3D0P A;  2O8C B;  1YUW A;  3EL2 A;  3QNN A;  1Q9Y A;  5AQJ A;  1JL2 A;  4W5N A;  1BIS A;  1NGJ A;  3O4N A;  1ESV A;  3ASM A;  3SUQ A;  2HNZ A;  2WON A;  2ZE2 A;  4JI5 K;  4M3U A;  2YNG A;  2P51 A;  1WSG A;  5AQH A;  3NCI A;  4FJL A;  3MN5 A;  1LW0 A;  5DK5 A;  3F9K A;  3D45 A;  3Q7B A;  5K14 A;  1T8E A;  4KTQ A;  4FK0 A;  2KHO A;  1IH7 A;  2KQ2 A;  4CJK A;  3VF6 A;  3U3Y A;  3ITH A;  2QWP A;  5AZJ A;  3HYF A;  3AO1 A;  4H0V B;  1OVQ A;  3DM2 A;  5C2F A;  4B9M A;  4C8N A;  1N8R O;  4Z94 A;  5CY4 A;  1E4F T;  1HMV A;  5CZ2 A;  4WFB L;  1KQS M;  1JXB A;  3RWU A;  2HHT A;  1N32 K;  4BRQ A;  3I55 N;  3S3N A;  3K58 A;  4K43 A;  1N5Y A;  3NVK A;  3KK2 A;  4N47 A;  1XC3 A;  2BGG A;  4YOX A;  1NGG A;  4FPA A;  1MWM A;  3ZSX A;  2QWM A;  4B8A B;  3LWL A;  4NXN K;  4FWN A;  5AQZ A;  1JL1 A;  4E7I A;  3IS9 A;  1BQM A;  4BGB A;  2CGJ A;  3DLL L;  4B1Y B;  4LF8 K;  4DTP A;  1MA9 B;  3ENH A;  4DTM A;  3O6W A;  3U9D A;  4Q5V A;  4CBW A;  3OYN A;  2ASP A;  3ISN C;  5AQW A;  3M1F A;  3VEZ A;  1RFQ A;  1SL2 A;  1ATS A;  1BHL A;  4A62 A;  4NO7 A;  2J4R A;  4YOY A;  1HJR A;  3H3O B;  4MFB A;  3NH1 A;  1NWK A;  2UUB K;  1NK7 A;  4CFA A;  2AA4 A;  1BCM A;  1VSM A;  3HRG A;  3CXC M;  2VWK A;  3OYE A;  3DWL A;  3O9Q A;  2E6M A;  5JS2 A;  4DB3 A;  3P1G A;  2ZJR L;  2B6A A;  1OVY A;  3GBT A;  1BL3 A;  1EO1 A;  2IGI A;  4FZZ A;  3MN6 A;  4H0X B;  1BI4 A;  1VQ8 N;  1RTI A;  4M3R A;  3PX0 A;  3MXM A;  3K9J A;  3JSM A;  1WSE A;  5F1X A;  3AAP A;  1JXE A;  1RTD A;  4H0O A;  1RDU A;  1KVA A;  1U2V B;  3ZSZ A;  1NLV A;  1FXX A;  1HX1 A;  4DQI A;  3FZF A;  1J5O A;  1ATR A;  3BDP A;  4KRF A;  4FLX A;  3TSP A;  2YNH A;  3O80 A;  1JKH A;  4F3O A;  2VWJ A;  1BG3 A;  4I6M B;  1HNV A;  1SS6 A;  2P5O A;  3VQC A;  1SKS A;  3CHW A;  4XH5 A;  3ID6 A;  1QSY A;  4BE2 A;  4C8L A;  4DS5 A;  1X3N A;  2D4W A;  3O8M A;  3AVK A;  1GOB A;  3C94 A;  1RT4 A;  1ASU A;  1HNI A;  3ID8 A;  5AQN A;  1I3A A;  4KPY A;  2ZJQ L;  3VOV A;  3MK6 A;  5KGW A;  4FJJ A;  1UWB A;  1K6Y A;  3T1H K;  1ZBU A;  2Q97 A;  3SBG A;  3CIP A;  4EHT A;  2IVP A;  4LSL A;  3O4Q A;  4ISE A;  2IIR A;  1P90 A;  2ASM A;  1LWC A;  4HUE A;  4EZ6 A;  1K9M O;  3KJV A;  1IKY A;  4NB4 A;  1VHX A;  4CZK A;  2ZJP L;  2F9W A;  1J9A A;  3C7N B;  1F21 A;  1NMD A;  1QVF M;  1VSI A;  1IKW A;  4CFB A;  2IVN A;  1X3M A;  3VQQ A;  1S6P A;  4PKG A;  4B1V A;  3MEG A;  3VTH A;  4UY8 O;  4BWJ A;  4KHS A;  2DFH A;  2P9U A;  4LY7 A;  3SQ0 A;  4FJM A;  3CCR N;  4J2E A;  4CVN E;  1WSF A;  4FJN A;  1C0F A;  1RDD A;  2W6K A;  4JKD A;  1D4X A;  5EVZ A;  2YHB A;  3LL3 A;  1DKG D;  4RW6 A;  4JK9 A;  1ASV A;  3EZ5 A;  4C1N I;  2R7Y A;  4F4K A;  5KRT A;  4FXD A;  4FM0 A;  1XUP O;  1XQS C;  4KHY A;  4M7X A;  4DQP A;  5J2Q A;  1XNQ K;  3THW A;  3BY5 A;  3K57 A;  2RKI A;  4DQS A;  1QVG M;  3M3Z A;  1U48 A;  3DAW A;  2IS3 A;  3A0I X;  2XY6 A;  1NGA A;  3KIO A;  3VQE A;  1YAG A;  4PY5 A;  3AVF A;  1Q8I A;  3DXK A;  4EHU A;  3H45 C;  4EAH D;  5HRP A;  1YXQ A;  4W5T A;  1VSD A;  3B6O A;  3DOK A;  4CEF A;  2G8F A;  2D0B A;  4DR3 K;  3VQA A;  1H1V A;  2O8D A;  3FFK B;  1YIT N;  5ELZ A;  1K8A O;  4NCB A;  2HHX A;  4FJ7 A;  4BRN A;  4NYF A;  4DSF A;  3OYK A;  4DG1 A;  4BWM A;  4B9U A;  3AO3 A;  3ZT0 A;  2YV0 X;  4DV5 K;  3UB5 A;  2FBV A;  4R79 A;  3EEQ A;  3JAM O;  4KBO A;  5CR4 A;  4IOC L;  3J8A A;  4FZX C;  3CD6 N;  4CJV A;  2OPP A;  5J1E A;  4X66 K;  1R0A A;  2G8W A;  3CQY A;  3M5R A;  3DOL A;  3ZSQ A;  3C6T A;  4FOE A;  2DY4 A;  2A1S A;  5BRF A;  3GG4 A;  2OAN A;  1NMN A;  2HF3 A;  2HF4 A;  3WXK A;  1T7P A;  2BH1 A;  4OJR A;  5AJ3 K;  4F9O A;  1TK5 A;  2KW4 A;  2FF3 B;  4H0Y B;  3NGI A;  3TAB A;  4M3W A;  3WXL A;  5GAE P;  3SZ2 A;  3DI6 A;  1HNX K;  3VEN A;  4PL7 A;  1HNW K;  4HHT A;  4AF1 A;  4FJ9 A;  1EX4 A;  4CGH A;  5HL7 L;  1GOA A;  5KTQ A;  2VQF K;  3VPZ A;  4CEO A;  3LAN A;  4B3T K;  3CYM A;  4BC5 A;  4BC4 A;  2OZM A;  4DR2 K;  4CD1 A;  3HOS A;  3OYD A;  1W7A A;  4HTU A;  1DT9 A;  3U9Z A;  1L3T A;  3SMP A;  5FRN A;  3SUO A;  4A2B A;  3W0L A;  4OO1 J;  4FVM A;  4CW7 B;  5EOY A;  1YHQ N;  1TKT A;  1IBL K;  3QO9 A;  3J7Z O;  4ILG B;  3OYL A;  3EY1 A;  1EQY A;  3QML A;  2QK9 A;  1QQN A;  1TKX A;  1HKC A;  3WUH A;  4CJP A;  2HHV A;  3O9U A;  3AVN A;  2VQE K;  3BUZ B;  5JVH L;  3CI5 A;  2KLA A;  1WN7 A;  4KAZ A;  4W5O A;  1NK4 A;  1GLE G;  4JI7 K;  2Q31 A;  3A5L C;  4CEB A;  4CZI A;  3OHR A;  1VSE A;  3H6E A;  4CZJ A;  3OVN A;  4RW8 A;  5KPT A;  1HKG A;  3OS2 A;  4DQR A;  2OYQ A;  4CFC A;  5AZI B;  3DLH A;  4YDU C;  3CJC A;  1KFD A;  1NU0 A;  3G0Z A;  4CHY A;  2E6L A;  3D2E B;  3KLH A;  2E1Y A;  3VQ7 A;  4DKW A;  1RBS A;  4FLZ A;  1JLG A;  2D0C A;  3A5M C;  4EZ9 A;  3CJB A;  2JGU A;  2HMI A;  4KHP K;  3C6U A;  4J2B A;  3LDS A;  5AQU A;  4DSL A;  5LY3 A;  2WC9 A;  3MX2 A;  3KLI A;  5C25 A;  2IVO A;  4O55 A;  3SBT A;  4CBU A;  1A5W A;  3K5N A;  3OTO K;  1EXQ A;  1Z25 A;  4IEI A;  5JIC A;  1NOZ A;  4CJ3 A;  2EWS A;  2VG5 A;  4Z4H A;  1V4S A;  5SZT A;  3UE5 A;  3MED A;  4H5V A;  5ADX H;  1IKV A;  4KH4 A;  3VEW A;  5JMV A;  5AQI A;  3AA4 A;  2YJE A;  4YFU A;  4FLU A;  4IDH A;  2HBK A;  2HST A;  3VTI A;  2O8F B;  5F2R A;  3EO3 A;  4QS8 A;  1HLU A;  3AO4 A;  4FM1 A;  1S5J A;  3AVI A;  3OS1 A;  2ZQB A;  5GIP A;  4RCH A;  2X78 A;  5IT9 O;  1JCF A;  3A2F A;  4E1N A;  4FJI A;  3WNF A;  4CJQ A;  1YF5 L;  4BRE A;  5DM7 L;  4M3X A;  4DTR A;  2Q36 A;  3NH2 A;  3DLE A;  4GV9 A;  3RR8 A;  3P31 A;  3CCQ N;  1G99 A;  4PQU A;  4KV8 A;  3AVH A;  4YOT A;  3MCA B;  2P9L B;  4I9Q A;  4NCG A;  1TK8 A;  5A2Q O;  4GVM A;  4DR5 K;  3RVC A;  1NGE A;  4FJK A;  5EU7 A;  4I7F A;  2V51 B;  1IBK K;  4DQQ A;  3T7Z A;  3SYZ A;  1XMQ K;  3F9M A;  4Z4I A;  1YT3 A;  4E7L A;  1E4G T;  4B9L A;  2ASO A;  3EKS A;  2O8D B;  1T6D A;  1LWE A;  3HZ6 A;  3KK1 A;  3QLH A;  1S9E A;  1HYS A;  3K0S A;  1QZ6 A;  3QFU A;  4V19 S;  4DV0 K;  3OW2 M;  1RT7 A;  3THX A;  2Y1J A;  2EX3 A;  1WBD A;  3IG1 A;  3U8X A;  4CF1 A;  4JI8 K;  1NK8 A;  1JLB A;  2HVI A;  2GUI A;  4K0K K;  3V1O A;  3SUP A;  4JAX A;  5GAG P;  1VSL A;  5E41 A;  1NBW A;  2D1K A;  3AVC A;  4FJH A;  2QEX N;  4Y1C A;  3LP3 A;  4NCA A;  2B5J A;  2FF6 A;  4HTL A;  3SAF A;  2BTF A;  4DV2 K;  4ELT A;  2KTQ A;  4JS4 A;  3VMF B;  1HR0 K;  3CFR A;  1X9S A;  4BRC A;  2A6A A;  1YI2 N;  1RT6 A;  3VEX A;  3QEW A;  1U45 A;  5AR0 A;  4FVU A;  2NRH A;  4DLG A;  1WSI A;  3KHY A;  4CGF A;  2KKZ A;  4BR2 A;  3H46 O;  3KLF A;  3MN9 A;  5AQS A;  5M1P A;  5IWA K;  1HQE A;  4CEA A;  1VQ9 N;  4FK2 A;  3HPG A;  2ITG A;  3S41 A;  4CZF A;  1Y64 A;  4CHZ A;  2Z1I A;  3QIN A;  5JLH A;  1L3S A;  4KHN A;  1KVC A;  1NGC A;  3FZK A;  3NF9 A;  4B9S A;  4DQ8 A;  3K5O A;  4FL9 A;  3HVR A;  4B3O A;  4Y1D A;  2O4G A;  1L3U A;  3T1Y K;  4ZHR A;  3HI0 A;  3CER A;  3SLC A;  3FZL A;  3AAQ A;  1U6Z A;  4OPH A;  3A5N C;  4E1M A;  3OBY A;  5MLC Q;  3J7A P;  1NNE A;  2BAN A;  4LSN A;  1YIJ N;  3IKM A;  4O8K A;  3HM9 A;  3CF5 L;  4BRM A;  5AZJ B;  1HYZ A;  5C42 A;  3VA3 A;  2YNF A;  5GIO A;  4H03 B;  2OA8 A;  4YY3 K;  4JD2 B;  4OLB A;  2P9U B;  1BI4 B;  2UU9 K;  2CGL A;  1U49 A;  1QS4 A;  3NF6 A;  3SV4 A;  3HL8 A;  3CCS N;  3ZSV A;  1ZYQ A;  3TAR A;  1RDB A;  4OKJ A;  4JKA A;  3CET A;  5E84 A;  3PIO L;  3MXI A;  4KH5 A;  2YHX A;  2OZS A;  1U04 A;  5CYQ A;  1KLM A;  5AQV A;  4FO0 A;  2E2O A;  4MO4 A;  2ITM A;  1BA1 A;  3SQ1 A;  3WT0 A;  5HLF A;  4BRF A;  3SUN A;  4ELV A;  1MU2 A;  3AGK A;  3L2R A;  3JS6 A;  2QI2 A;  4XH1 A;  3TI0 A;  1WAF A;  1IBM K;  2NRT A;  4FLY A;  1VSJ A;  4M7Y A;  2W6L A;  4B8C A;  1RTH A;  4E0D A;  3N4Q A;  1LWF A;  2BE2 A;  3KZB A;  5M1O A;  4JKG A;  5M1Q A;  3QB0 A;  3TSQ A;  4CHN A;  4OKE A;  2GV9 A;  1X9W A;  3ENB A;  4KFB A;  3UKR A;  1FKO A;  4BR9 A;  1GLL O;  1KFS A;  3LPU A;  1RBR A;  5BR9 A;  1WSH A;  3QBX A;  2WUS A;  4AH9 A;  4IFE A;  5KRS A;  4BRO A;  3TTC A;  5AQR A;  2DFF A;  4B9Q A;  2JWK A;  4JYA K;  5AZI A;  3VEV A;  4CZE A;  5D3G A;  4E1J A;  3A8Y A;  3LAL A;  4LF6 K;  3DLR A;  2WFB A;  3CFO A;  5M1K A;  4OPK A;  3L2V A;  5FPE A;  3SJJ A;  5EXW A;  1ASW A;  2V7Z A;  1T05 A;  3W3D A;  4Z4E A;  1QQC A;  2OTJ N;  4FWR A;  3C65 A;  4AHV A;  3CC7 N;  4M3T A;  2GX9 A;  3FE1 A;  2Q1N A;  1HPM A;  4WQ4 C;  1C6V A;  3T69 A;  3KWG A;  4JRP A;  3LZI A;  4BR7 A;  4H0T B;  1LAW A;  3I0R A;  4FM2 A;  5E26 A;  3MAQ A;  4H5W A;  1K73 O;  4DV3 K;  4TSX A;  2Z1G A;  2D5R A;  3R1X A;  1BA0 A;  5CZ1 A;  3ZT3 A;  4C8M A;  1UAX A;  1VK0 A;  3CCM N;  3V6D A;  4DSJ A;  3K9K A;  1BIZ A;  4K8Z A;  2P9N A;  1Q86 O;  5FLX O;  2G8V A;  2E88 A;  1ZBL A;  1HNZ K;  2VGM A;  4G9Z A;  5FPD A;  3HJF A;  3LDQ A;  3LP2 A;  3RMA A;  3H1V X;  2NRV A;  3KKR A;  4ZTF A;  4JKE A;  4JS5 A;  5CHI A;  4N76 A;  2E2Q A;  2YCH A;  3QIO A;  4GKK K;  3D7E O;  3ZX2 A;  2YX6 A;  1S1W A;  2ETJ A;  3O1W A;  3PY8 A;  4MLE A;  3TPQ A;  3L4I A;  3QDK A;  4DTU A;  2HHW A;  4MDB A;  1TK0 A;  5GIN A;  1IJJ A;  1QHA A;  4JLH A;  4MLH A;  4AM7 A;  1RBU A;  3V9X A;  3WNG A;  3HP9 A;  3CCU N;  2H3G X;  3QIP A;  4B3M K;  4DFJ A;  4IFY A;  4CJE A;  2VYP A;  5C0Y A;  4KTW A;  3TAE A;  3PV8 A;  4BQL A;  3RMC A;  4CGI A;  4GMJ B;  2P9S A;  4DU3 A;  1XC9 A;  1DLO A;  1VQ5 N;  4LF4 K;  1W9H A;  2PYJ A;  1C1B A;  1JLA A;  4WE1 A;  3OYM A;  4RTF D;  3AVL A;  3WQU A;  3O9S A;  1TKD A;  4JV5 K;  4IJA A;  1TGO A;  3PUF A;  1Y97 A;  5T7B A;  4JI1 K;  3B8A X;  3NF8 A;  2D0A A;  2YKM A;  1KC8 O;  2A41 A;  3FFI A;  3QIC A;  4BRL A;  1KAX A;  1NK5 A;  1C1A A;  4ID5 A;  3NHG A;  4DU1 A;  3RSE B;  1NGH A;  2QWO A;  1I94 K;  3OYI A;  2IOC A;  3THX B;  3UKR B;  1YJN N;  3DXK B;  4QAG A;  1BU6 O;  5TKY A;  5B8H A;  2V52 B;  4BAC A;  2CGK A;  4N56 A;  3RMB A;  4GW6 A;  3ZT1 A;  2G8H A;  4OX9 K;  2I7N A;  3M6G A;  1SZ2 A;  3TAQ A;  3OJU A;  4FLV A;  1C0T A;  3C95 A;  3EN9 A;  3K5L A;  4DFK A;  1NOY A;  4Q0B A;  2KFZ A;  1WAJ A;  1JLC A;  1RDC A;  3CCL N;  4M42 A;  3C6H A;  3MX5 A;  4CGD A;  2QWL A;  5FDL A;  4JRQ A;  1TVR A;  3VF2 A;  3V81 A;  3DLB A;  3O4W A;  4IEE A;  1TL1 A;  4I2P A;  4JN4 A;  4FJ8 A;  1RT2 A;  3VQ6 A;  4CHQ A;  3QET A;  4GKJ K;  4CK3 A;  3R9P A;  5DM6 L;  2D0O A;  1QQM A; 
#chains in the Genus database with same CATH homology
 1ZBH A;  3L2Q A;  1NJZ A;  4RG8 A;  3DRS A;  3AO2 A;  4FW1 A;  3RRG A;  4KRE A;  1VRT A;  5J2N A;  2E4L A;  3KD5 E;  3AO4 A;  2HHS A;  3OYB A;  3D0P A;  4FM1 A;  4B9T A;  1C0M A;  3VQ8 A;  3PX6 A;  4FYD A;  1S5J A;  4CJ4 A;  1SUQ A;  3AVI A;  3OS1 A;  2ZQB A;  3AA3 A;  3LP1 A;  2P1J A;  3OYG A;  3QNN A;  1Q9Y A;  1JL2 A;  4W5N A;  1BIS A;  2X78 A;  3O4N A;  1X1P A;  3VQ5 A;  3ASM A;  2NUB A;  3A2F A;  4E1N A;  3NDK A;  2HNZ A;  2WON A;  3WNF A;  4CJQ A;  4CJT A;  3DRR A;  4AHR A;  3SUQ A;  2I5J A;  1NKB A;  1J54 A;  2ZE2 A;  4PA1 A;  4M3U A;  2YNG A;  2P51 A;  1WSG A;  1GOC A;  3NCI A;  4M3X A;  4DTR A;  3OYF A;  4FJL A;  5JS1 A;  3NH2 A;  1LW0 A;  3DLE A;  3F9K A;  5DK5 A;  3D45 A;  3QEV A;  2HB5 A;  5K14 A;  3TAG A;  1T8E A;  4KTQ A;  2P5G A;  4FK0 A;  1IH7 A;  1FK9 A;  3RR8 A;  2KQ2 A;  2YHA A;  1O1W A;  4CHO A;  4CJK A;  5FRO A;  4FCY A;  4FJI A;  1DTQ A;  4CJL A;  4DTJ A;  3U3Y A;  3T19 A;  4DSK A;  4PQU A;  3ITH A;  4ELU A;  4KV8 A;  3AVH A;  4RW4 A;  4QOZ B;  2OPS A;  4J2A A;  1D8Y A;  1RTJ A;  3HYF A;  3AO1 A;  3L8B A;  4I9Q A;  4NCG A;  3DM2 A;  1TK8 A;  4B9M A;  1D5A A;  4IKF A;  4GVM A;  1B92 A;  3PO5 A;  4C8N A;  5CY4 A;  1HMV A;  5CZ2 A;  4FJK A;  1NK0 A;  4UQG A;  5EU7 A;  1JXB A;  4I7F A;  4ICL A;  4DFP A;  4DQQ A;  4BDY A;  3RWU A;  2HHT A;  3VQP A;  3SYZ A;  3DLK A;  4W5Q A;  4HUG A;  3I8D A;  4Z4I A;  1CZB A;  3BGR A;  3KLG A;  3S3N A;  1YT3 A;  4AHC A;  3K58 A;  4E7L A;  1N5Y A;  1S1U A;  3KK2 A;  4DWI A;  4B9L A;  4N47 A;  3HO1 A;  5HP1 A;  2BGG A;  1LWE A;  2F8T A;  3KK1 A;  1QTM A;  4DSE A;  3QLH A;  3ZSX A;  1S9E A;  1HYS A;  3CM5 A;  2VG7 A;  4B8A B;  1HPZ A;  3V4I A;  1CLQ A;  3LWL A;  2KZM A;  3MEE A;  3KK3 A;  4AIL C;  4FJG A;  1JL1 A;  4CEE A;  3IS9 A;  1B9D A;  1RT7 A;  1BQM A;  4E7I A;  4BDP A;  2Y1J A;  2O4I A;  4DTP A;  2EX3 A;  2G8U A;  3JYT A;  3IG1 A;  1CZ9 A;  2YKN A;  4FJ5 A;  2AJQ A;  4CF1 A;  4DTM A;  4CEC A;  1NK9 A;  4Q5V A;  3OYN A;  3LZJ A;  1NK8 A;  1JLB A;  3ISN C;  2HVI A;  2GUI A;  2DTU A;  4K8X A;  3V1O A;  4HCB A;  3DYA A;  3SUP A;  1SL2 A;  4RW9 A;  3TAM A;  3QER A;  1BHL A;  1VSL A;  5E41 A;  3LPT A;  1S1V A;  3AVC A;  3IRX A;  4CJF A;  4FJH A;  2JLE A;  1HJR A;  4Y1C A;  1VSF A;  3LP3 A;  4CES A;  3P83 D;  4MFB A;  3NH1 A;  4B9V A;  1XI1 A;  3U6F A;  2B5J A;  4NCA A;  1NK7 A;  1C0U A;  1RNH A;  4CFA A;  4DF4 A;  1BCO A;  3G10 A;  1EP4 A;  4ELT A;  3MEC A;  3L3V A;  2KTQ A;  4JS4 A;  1U47 A;  3CFR A;  1BCM A;  1VSM A;  1L3V A;  1X9S A;  1VSK A;  1RT6 A;  1REV A;  1VRU A;  5C24 A;  3WNE A;  4CK1 A;  3F73 A;  1S6Q A;  3QEW A;  2VWK A;  1U45 A;  3OYE A;  3CG7 A;  3VQ4 A;  1A5V A;  4DLG A;  2VG6 A;  1WSI A;  4Z4F A;  1W0H A;  3OYA A;  4CGF A;  2E6M A;  5JS2 A;  1UA0 A;  3P1G A;  3LAK A;  1KSP A;  3KLF A;  1WSJ A;  3V1Q A;  2B6A A;  4DSI A;  5HRR A;  1BL3 A;  5CYM A;  5SWM A;  2IGI A;  4FZZ A;  1HQE A;  1XWL A;  2Y1I A;  1KRP A;  4CEA A;  4FK2 A;  1BI4 A;  2EHG A;  3HPG A;  1RTI A;  1Q9X A;  4M3R A;  3K5M A;  1D9F A;  1LW2 A;  3PX0 A;  3MXM A;  1LAV A;  2ITG A;  1WSE A;  3JSM A;  2DY4 A;  4L8R B;  5HBM A;  2Z1I A;  3QIN A;  1QE1 A;  4CHZ A;  3P5J A;  1N6Q A;  4B08 A;  1L3S A;  4KHN A;  1JXE A;  1RBT A;  3MXJ A;  1KVC A;  1RTD A;  4FLU A;  4B9S A;  3NF9 A;  2F8S A;  1KVA A;  3ZSZ A;  2PY5 A;  3K5O A;  3HVR A;  2PYL A;  4B3O A;  1FXX A;  4Y1D A;  2O4G A;  1BQN A;  4Z4C A;  1L3U A;  1J5O A;  4DQI A;  4OLA A;  3BDP A;  4KRF A;  3DLG A;  4ZHR A;  4FLX A;  4H4M A;  2YNH A;  1BGX T;  4KHQ A;  1JKH A;  1NKC A;  1X9M A;  3TAF A;  2VWJ A;  4F3O A;  4E1M A;  4KI4 A;  1HNV A;  2KFN A;  2BAN A;  4LSN A;  3CQ8 A;  1Z26 A;  3ZSW A;  2XHB A;  3VQC A;  2P5O A;  3ZSY A;  1SKS A;  1KLN A;  3KD1 E;  3HM9 A;  4Z0U A;  4FZY A;  4IDK A;  1NJY A;  1QSY A;  4BE2 A;  4C8L A;  4DS5 A;  5KGX A;  1HYZ A;  3AVB A;  5C42 A;  2FBX A;  3NH0 A;  3V1R A;  2ATQ A;  3VA3 A;  3I0S A;  2YNF A;  3AVK A;  1SKW A;  3AV9 A;  4IBN A;  3KKS A;  1GOB A;  3C94 A;  3ALY A;  2OA8 A;  1RT4 A;  1QSS A;  1ASU A;  1HNI A;  4OLB A;  1BI4 B;  2LSN A;  1I3A A;  4KPY A;  3PO4 A;  1U49 A;  1QS4 A;  3NF6 A;  3S9H A;  3SV4 A;  1QSL A;  3HL8 A;  2DFE A;  2RN2 A;  4F2R A;  4NYN A;  5KGW A;  4OGE A;  4F2S A;  4FJJ A;  3ZSV A;  1ZYQ A;  1ZBI A;  3TAR A;  3V9W A;  1RDB A;  3QNO A;  1UWB A;  4OKJ A;  1K6Y A;  5J2M A;  1ZBU A;  4CGJ A;  3OYJ A;  4H4O A;  3S3O A;  1TAU A;  1SV5 A;  3NAE A;  4DTX A;  3VQ9 A;  4LSL A;  3MXI A;  1NKE A;  3O4Q A;  2OZS A;  4EP5 A;  1U04 A;  4YFU A;  5CYQ A;  1KLM A;  4N5S A;  3VQB A;  3K2P A;  2XY8 A;  1LWC A;  4CE9 A;  4HUE A;  4EZ6 A;  5HRS A;  4M3Z A;  5J2P A;  4DLE A;  3KJV A;  4CJW A;  3SQ1 A;  4OVL A;  1IKY A;  3TAN A;  2IC3 A;  5HLF A;  1J9A A;  4OGC A;  3HP6 A;  4F3T A;  3SUN A;  1F21 A;  4ELV A;  1EKE A;  3VQD A;  1ZBF A;  1VSI A;  1MU2 A;  1IKW A;  4CFB A;  3QEI A;  4CF2 A;  2OPQ A;  3VQQ A;  3L2R A;  1S6P A;  1SL0 A;  4CEZ A;  4FLW A;  3LAM A;  3MEG A;  1EET A;  2G8I A;  4CF0 A;  4O0I A;  4BWJ A;  3TI0 A;  4Z4G A;  1WAF A;  3M8S A;  4KHS A;  1YTU A;  4CGG A;  2DFH A;  4FLY A;  2KZZ A;  1VSJ A;  4DMN A;  4LY7 A;  2Z1H A;  3SQ0 A;  4B8C A;  3SPZ A;  4FJM A;  4CJR A;  4BE1 A;  5HRN A;  4J2E A;  3OY9 A;  1RTH A;  4E0D A;  4F8R A;  1WSF A;  3L2W A;  4FJN A;  1B9F A;  1LWF A;  1RDD A;  2BE2 A;  4IFV A;  4J2D A;  1T03 A;  1D9D A;  4O5B A;  4CHN A;  3E01 A;  4OKE A;  4CIG A;  4E7J A;  2GV9 A;  2YHB A;  1X9W A;  3NBP A;  4RW6 A;  1ASV A;  1YTA A;  3EZ5 A;  4CIF A;  2R7Y A;  4F4K A;  4KFB A;  5KRT A;  1FKO A;  4FXD A;  1RT5 A;  4HUF A;  4FM0 A;  1I39 A;  5I42 A;  1KFS A;  4KHY A;  3LPU A;  1RBR A;  2IAJ A;  3OJS A;  4DQP A;  1WSH A;  3AVA A;  2WOM A;  5J2Q A;  4AH9 A;  5KRS A;  3K57 A;  2RKI A;  2OPR A;  3O3G A;  2RF2 A;  4DQS A;  3SQ2 A;  3QEX A;  1U48 A;  3S3M A;  2DFF A;  3DRP A;  3WNH A;  2IS3 A;  1RIL A;  2XY6 A;  1RBV A;  4CK2 A;  3KIO A;  2X74 A;  3VQE A;  4FW2 A;  1FKP A;  1HQU A;  1KCF A;  5D3G A;  4PY5 A;  5KI6 A;  3AVF A;  3LAL A;  1Q8I A;  4HVJ A;  3DLR A;  3SCX A;  3CFO A;  3HXM A;  3TR8 A;  4CHP A;  4OPK A;  3NFA A;  3IAY A;  1TV6 A;  5HRP A;  3L2V A;  2W42 A;  4W5T A;  3M8R A;  3SJJ A;  1VSD A;  1ASW A;  2HHQ A;  3B6O A;  3DOK A;  4CEF A;  4W5R A;  3NF7 A;  1VSH A;  1T05 A;  2G8F A;  2D0B A;  4Z4E A;  1QQC A;  3VQA A;  3NGY A;  4KO0 A;  3NE6 A;  4AHV A;  4CJU A;  3THV A;  4M3T A;  1HYV A;  1KVB A;  1L5U A;  4M3Y A;  1KTQ A;  1S1X A;  4NCB A;  2HHX A;  2RPI A;  4FJ7 A;  1NJW A;  1C6V A;  4NYF A;  4DSF A;  4CF9 A;  3OYK A;  1ITG A;  4BWM A;  4DG1 A;  3AO3 A;  4JRP A;  3AA5 X;  3SI6 A;  4B9U A;  3ZT0 A;  3M8P A;  2XRI A;  2YV0 X;  4E3S A;  4CIE A;  2HND A;  2XY7 A;  3LZI A;  3V9S A;  3ZCM A;  2A1R A;  1LAW A;  3B6P A;  3I0R A;  3M8Q A;  2FBV A;  3T1A A;  1IG9 A;  4FM2 A;  3HK2 A;  1JLF A;  3PX4 A;  4M45 A;  3MAQ A;  4FZX C;  4CJV A;  4LH4 A;  4LH5 A;  2HVH A;  2OPP A;  4TSX A;  4ZTJ A;  4E7H A;  2Z1G A;  4O4G A;  2D5R A;  5J1E A;  3RRH A;  1R0A A;  2G8W A;  3HT3 A;  5CZ1 A;  4RW7 A;  3DOL A;  4C8M A;  3ZSQ A;  3ZT3 A;  3C6T A;  3RTV A;  3U3G A;  3QEP A;  3SNN A;  1UAX A;  1VK0 A;  2A1S A;  3KLE A;  4FLT A;  3V6D A;  2PZS A;  4DSJ A;  1BIZ A;  4DF8 A;  1UA1 A;  3HPH A;  4K8Z A;  4KKO A;  1T7P A;  2G8V A;  4FK4 A;  3QES A;  4HCC A;  1IO2 A;  1WLJ A;  2Z1J A;  1ZBL A;  1BIU A;  2X6S A;  4OJR A;  3RR7 A;  2QKK A;  4AHT A;  3HVT A;  3CFP A;  3HJF A;  3RMD A;  1TK5 A;  2KW4 A;  4KHW A;  3LP2 A;  3NGI A;  3AO5 A;  4CF8 A;  3TAB A;  3RMA A;  4M3W A;  3NGZ A;  5FRM A;  3KKR A;  2XO7 A;  3SZ2 A;  5I3U A;  3DI6 A;  1NJX A;  3T3F A;  4ZTF A;  4BE0 A;  4BDZ A;  1JLQ A;  4JS5 A;  4HHT A;  4FJ9 A;  4N76 A;  1EX4 A;  4DFM A;  3AA2 A;  4CGH A;  4YNQ A;  1GOA A;  3ULD A;  3QIO A;  5KTQ A;  3OS0 A;  2F96 A;  1DTT A;  1S1W A;  1TKZ A;  2FC0 A;  2ETJ A;  4KTZ A;  4EP4 A;  4I2Q A;  4MQ3 A;  4CEO A;  3PY8 A;  3L3U A;  3LAN A;  1QHT A;  1RCH A;  1CXU A;  4DTU A;  3CYM A;  3KTQ A;  1RT1 A;  2OZM A;  4KI6 A;  4PWD A;  3OYD A;  4IG0 A;  4HTU A;  3CM6 A;  1L3T A;  2HHW A;  4KB0 A;  1TK0 A;  5FRN A;  1S9G A;  3SUO A;  3UIQ A;  2FBY A;  2IDO A;  4JLH A;  3LWM A;  4FVM A;  1TAQ A;  3H08 A;  2QXF A;  1TL3 A;  4I9L A;  1TKT A;  1RBU A;  1A5X A;  3V9X A;  3WNG A;  2FBT A;  5DMR A;  3SQ4 A;  3HP9 A;  3QO9 A;  3QIP A;  4B9N A;  4DFJ A;  4IFY A;  3OYL A;  4CJE A;  1HRH A;  4PUO A;  2B4J A;  4KTW A;  3EY1 A;  2HW3 A;  1RDA A;  4E19 A;  3TAE A;  3PV8 A;  3VN5 A;  3RMC A;  4C8O A;  4FJX A;  4CJS A;  2QK9 A;  4E7K A;  4CGI A;  4GMJ B;  4DU3 A;  1XC9 A;  1DLO A;  3TWH A;  1TKX A;  1W9H A;  3ZSR A;  2PYJ A;  1C1B A;  1JLA A;  4WE1 A;  4CJP A;  3OYM A;  3AVL A;  4M41 A;  4DTN A;  2HHV A;  3V9U A;  2HHU A;  4XIU A;  3AVN A;  1TKD A;  2HNY A;  3TAP A;  1TGO A;  1WN7 A;  3PUF A;  4KAZ A;  4W5O A;  4O0J A;  1Y97 A;  5T7B A;  1NK4 A;  1XHX A;  3VA0 A;  1U4B A;  4O44 A;  3NF8 A;  2D0A A;  4CED A;  3L2U A;  2YKM A;  4CEB A;  2QKB A;  1JLE A;  3FFI A;  1C1C A;  1RT3 A;  4E89 A;  1VSE A;  3K59 A;  2GBZ A;  1NK5 A;  1C1A A;  4ID5 A;  3OVN A;  3NHG A;  4RW8 A;  1S1T A;  3EYZ A;  4DU1 A;  1NK6 A;  4KB1 A;  3OS2 A;  4DQR A;  3HPO A;  2Q3S A;  4CER A;  2OYQ A;  3OYI A;  4CFC A;  2IOC A;  4OKK A;  3DLH A;  1UOC A;  4C8K A;  4N41 A;  1KFD A;  1SKR A;  3LP0 A;  1SL1 A;  3ZT4 A;  3G0Z A;  4QAG A;  4CHY A;  2E6L A;  3V9Z A;  4CFD A;  3KLH A;  1IKX A;  3DMJ A;  4ID1 A;  3VQ7 A;  1RBS A;  3AVG A;  2ZD1 A;  4BAC A;  4N56 A;  4FLZ A;  2XY5 A;  3RMB A;  1JLG A;  4GW6 A;  2D0C A;  3AVM A;  3ZT1 A;  4EZ9 A;  2G8H A;  3AVJ A;  2JGU A;  2HMI A;  1LV5 A;  3C6U A;  3O3F A;  4J2B A;  3TAQ A;  3OJU A;  3OYH A;  4FLV A;  1C0T A;  3C95 A;  3ZSO A;  4DTS A;  3LDS A;  4CCH A;  5HRO A;  3K5L A;  4G1Q A;  4DFK A;  4DSL A;  1NOY A;  4Q0B A;  2KFZ A;  1WAJ A;  3KLI A;  3OYC A;  4AHS A;  5C25 A;  1G15 A;  1JLC A;  4O55 A;  3K5N A;  1A5W A;  1RDC A;  4IG3 A;  4M42 A;  3HST B;  1EXQ A;  1WNS A;  1Z25 A;  4LD0 A;  3ZT2 A;  4DU4 A;  4R5P A;  4CGD A;  2BDP A;  4KHU A;  2G8K A;  1NOZ A;  2X6N A;  5FDL A;  4CJ3 A;  4JRQ A;  4DTO A;  1TVR A;  4CJ5 A;  3V81 A;  2VG5 A;  3SPY A;  3DLB A;  4Z4H A;  4DS4 A;  5SZT A;  4QCL A;  2YNI A;  1TL1 A;  4I2P A;  4FJ8 A;  3MED A;  1IKV A;  1XHZ A;  3SV3 A;  1RT2 A;  3VQ6 A;  4CHQ A;  3QET A;  4OPJ A;  4CK3 A;  4CEQ A;  1YVU A;  3O3H A;  1CXQ A;  4AHU A;  4H8K A;  1J53 A;  3AA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...