3N4PA

Human cytomegalovirus terminase nuclease domain
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
246
structure length
216
Chain Sequence
LITDQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAGTGVAAVGAYRHQFLIYGLEHFFLSESSEVAIAECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTLIRVLFYHTPDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQIQNLHRSDDLIIAVIMATYLCDDIHAIRFRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Terminase subunit UL89 protein
publication title Structure and inhibition of herpesvirus DNA packaging terminase nuclease domain.
pubmed doi rcsb
source organism Human herpesvirus 5
total genus 73
structure length 216
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.320 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3n4pA00
4IOXA 3N4QA 3N4PA
chains in the Genus database with same CATH superfamily
4GKJK 3ZT0A 4DR1K 1VAZA 4I9LA 1XUPO 2QKKA 1QQCA 4CGDA 4NCAA 4KH6A 4BR9A 4B3OA 3AVLA 2YNGA 1T3VA 3DLLL 4CFCA 3I33A 3VEYA 4IG0A 1IG8A 1EXQA 1U2VA 1CXUA 3C6TA 2V7YA 4B1WB 1BHLA 4I6MB 5H1SQ 3TARA 4Z4HA 4BC3A 1TAUA 3D2EA 5LJWA 3TAFA 4FWLA 5BR9A 1REVA 2F8SA 3MCPA 2Y1JA 3DLGA 4FL9A 1S5JA 4DU3A 3VGKA 1Q86O 2VQEK 3HSCA 3AVJA 1C1AA 5HLFA 4MO5A 2HHWA 3LDSA 1N8RO 4LFCK 4CJLA 1C6VA 3CMEN 1IKYA 3KLHA 3HOTA 1FJGK 2O8EB 2OPSA 3E66A 1KAXA 2P9UA 3O08A 1SZ2A 4J2EA 1BI4B 2QW9A 4PY5A 3CCJN 1ATSA 3LM9A 4XEIA 3CC7N 5KI6A 3F9KA 5F1XA 3H46O 4EHUA 3OA9A 1YAGA 4H8KA 1ZBUA 4KH4A 2G8VA 2GUPA 4CEAA 3OW2M 4DTMA 1GLJO 1HRHA 3WT0A 1GLBG 2G8FA 3ZETA 4CD3A 3HTVA 3G25A 1W97L 1WSHA 1X3NA 4YOXA 4KHUA 2HHSA 2AJQA 1C0GA 1G15A 3VQQA 3AVCA 4DHYA 3RSEB 1O13A 3KVGA 5DMRA 3ISNC 1B9FA 1BQNA 3CCVN 4LF5K 5AQZA 3LDQA 2P9PB 4CF2A 5CYQA 3HM9A 4DQIA 2XY6A 3SBGA 3P1GA 4FJNA 3QNOA 4B1ZA 1C0FA 3SAHA 1VQLN 2A5XA 4QCLA 1YT3A 1YXQA 1S22A 3C0BA 5A2QO 1YI2N 4FWKA 5KPZA 1ESVA 4A5BA 4LFBK 4BACA 4YHHK 4R5PA 3DAWA 3H3OB 3SQ4A 4EIAA 4FCYA 2GX9A 1HUXA 4IFYA 3LWLA 2Q97A 2IIRA 4HWIA 3JYTA 3J7ZO 3NDKA 2PZSA 3NF7A 1W0HA 4ISGA 5AQRA 2PY5A 4KFBA 2E1ZA 1SKSA 2D0PA 3OTOK 1KFSA 1Y64A 3M8PA 2GV9A 4LF8K 4BREA 1HNIA 1J5EK 2P51A 4CF1A 3K2PA 1N34K 1HX1A 1TAQA 4M3UA 3OYBA 3P4IA 3EY1A 2UUBK 3UKRA 4CJSA 4CF9A 5F0XA 4ZTFA 4DTXA 1UAXA 4CJ7A 5CZ2A 4OVLA 1QQMA 4DV3K 3NF9A 1NK9A 2P9LB 3KK1A 4Z4CA 3TSUA 3IRXA 3DRPA 4OKKA 3CQYA 3KZBA 1QTMA 3B6OA 1R0AA 5M1OA 3O4QA 4DF8A 1MWMA 1KLMA 3AVMA 4BR7A 2ZM6K 3TWHA 2F9TA 3K5OA 3SMPA 1VQPN 4C8NA 2O4IA 4NO7A 3ULEB 2Y1IA 2OPPA 3CM5A 2XY5A 3HOSA 4DTPA 3NVKA 4JKDA 3L2RA 5M1FA 2P5OA 4LSLA 1IKXA 2P9SB 1TYQB 2YJEA 1D9FA 4DR4K 4B08A 4FK0A 3QIOA 2VG7A 2Q36A 4FM0A 4ELTA 3NF6A 3BF3A 3ULDA 1BQMA 1JLGA 2VGNA 2WC9A 4WQ5A 3DRRA 4DF4A 1K8AO 3LDLA 3VOVA 1XQSC 3V1RA 4CHNA 2XHBA 4C8LA 4JI3K 2GELA 2I7NA 3A2FA 4E7LA 2YHAA 1IKWA 4DFMA 1YJNN 2KW4A 4JS5A 3M6GA 3LDOA 4PQUA 1CZ9A 4O55A 1Z26A 4IDKA 2A41A 3FFKB 3C95A 3MX2A 4A2BA 4M7XA 3THXA 1VRTA 4DSEA 3G71N 1K73O 2OANA 2V52B 1KQSM 5AQSA 3R8EA 3WQTA 3AVGA 5C42A 3H1VX 1J54A 2RF2A 4AHUA 4YNQA 5AQHA 2IVNA 1I3AA 3NGZA 4BG9A 1VQ6N 2Q3SA 2E5LK 1M1KO 2YCHA 3HJFA 5J2QA 1GLAG 1IBMK 3ZSVA 4CFAA 4O0JA 2E88A 3ZX0A 4CJRA 1U48A 3EEQA 1IBLK 4LF4K 2HNZA 4BC2A 3K5LA 3V9ZA 1NGHA 2HHUA 2VWBA 3TANA 3BP8A 3VF6A 3PSIA 4FK4A 3MN5A 4PA1A 5M1NA 5MLCQ 1S1WA 4F8RA 4CGGA 2ATQA 4FJXA 2YNFA 2P9NA 3SQ0A 1OH5A 3WNEA 4NCBA 5AQQA 5I3UA 1BUPA 4X65K 2NUBA 3MXJA 4IG3A 5AZJA 1T7PA 5HRPA 3F2KA 5AQLA 4WQ5C 1BIUA 2YHWA 4H4OA 3T7ZA 3QMLA 2QKBA 4PHTX 4CZJA 3J7YP 4G9ZA 3HT3A 2UXBK 2O8FA 1WB9A 1DGKN 5LL6Z 3VMFB 5BREA 1NMDA 1Q7YO 2UYTA 2BUPA 3GL1A 3CXCM 2NRRA 1N5YA 1U4BA 4DTOA 4DR6K 4JN4A 1WAFA 4HUFA 1Z25A 4O44A 3RR7A 1P8ZA 1U47A 1VSIA 4WQ4C 4LSNA 4BC5A 4KV8A 2HBLA 4FLVA 4DQRA 3DRSA 1SUQA 5C2DA 3SUQA 4FJMA 4GV3A 4C8MA 1RGIA 2HSTA 2JLEA 1HKCA 3PX6A 1KVAA 2P9IB 1CZAN 1NJWA 3O80A 1S6QA 4PL8A 5SZTA 1QSYA 2D0OA 3NH0A 4LD0A 5GIPA 1CXQA 3U8XA 2O8BB 4A59A 2PFUA 5IWAK 1WBBA 3IFRA 3IUCA 5ELZA 4CJUA 3O8MA 1QQNA 1ASVA 4CJ4A 3SJHA 1NU0A 4CHQA 3OYLA 1WSEA 4FJJA 4PUOA 4CBUA 1S3XA 2A40A 1J9AA 1GOBA 2KQ2A 3LPTA 2FSNA 1TUUA 4H0OA 1RDWX 4CIEA 4M42A 1SQKA 2F8TA 5C10A 5J2PA 2FC0A 1SL0A 5AZIB 4AF1A 2O8BA 3CFPA 1TUYA 4WFAL 4JKAA 4JKGB 4RCHA 5E41A 3THWA 5BPLA 5FROA 1NGCA 2QXLA 4UQGA 3TAPA 2A1RA 5AQMA 1GOAA 2D5RA 4Q5VA 1VQ5N 5I42A 1GLEG 4H5RA 5CHIA 3E9LA 5JLFA 1NGEA 3MWPA 4B9VA 4L8RB 1T44A 3CJ9A 2VG6A 3U4LA 1QQOA 3ENOA 1T6DA 2UUAK 3D2FB 4CBXA 3HBTA 5C15A 3DXKB 2X6NA 5FPDA 5EU7A 4PKGA 1ZXOA 2W41A 1TK0A 3A0IX 3IG1A 2CGLA 4JAXA 4B3MK 4A57A 2E20A 3D7EO 2E6LA 1BOTO 3G4SN 4ILJA 4M3WA 4ISFA 3I55N 4DV2K 2NZTA 4CE9A 1FKPA 1EETA 4PKHA 3TTDA 3VEZA 1J6ZA 4FXDA 5JLHA 3PO5A 4AHTA 4H0XB 1NKEA 3KK3A 3DXKA 1HR0K 1UA1A 3HM8A 4DFJA 1YHQN 3JS6A 3SUOA 3I0SA 2DY4A 4JK8A 3OJSA 1RBTA 3EKUA 4DTNA 4KHNA 3GBTA 3VERA 3UIQA 4FJHA 4B9LA 1TKZA 4A62A 5AQNA 4I2PA 3VF2A 3ZLJA 1VQ7N 1S1VA 4NYNA 5KRTA 4KHYA 3FGUA 4CW7B 1HJOA 5SWMA 1XWLA 3PUFA 4KH5A 3DLBA 1GLCG 1K8KA 3BZCA 1JL2A 4ID5A 3VGMA 4FLUA 3G0ZA 5KQDA 1NG9A 2HF4A 4J2AA 1QE1A 4MDBA 5CY4A 4H5NA 3NH1A 3MX5A 1VSMA 2ASPA 3H45C 1Q82O 4BG8A 2RHKA 5DM6L 3G10A 4WYBA 2VYPA 1XMOK 3OYHA 3ALYA 1Q9YA 1TGOA 3W3DA 4M3YA 3OYKA 4H5TA 1RT4A 3MEEA 3CPEA 4CK3A 3L3UA 3O3FA 4IFEA 1S1UA 4N5SA 3CFRA 3EL2A 5GAEP 2HHVA 2NRTA 4FOEA 1U2VB 2NRZA 3LANA 3D2EB 4AQYK 4F3TA 4AHCA 2CGJA 1JLAA 4NLBA 1E3MA 2FSJA 3VEWA 4KPYA 3LAKA 4DR7K 4A61A 3M1FA 5HP1A 3BDPA 4DUZK 1YTAA 3H08A 2F96A 1F21A 3BGRA 1T03A 2FBTA 1RTDA 5CE3A 2O8DA 4FLTA 1U04A 3CFOA 2GEMA 4U7BA 5FRMA 4DSIA 3C6UA 1YVNA 4JV5K 1DTTA 2PAVA 4CEBA 3TAGA 3ZX2A 1SKWA 3AVAA 4CVNE 3QEWA 4Z4IA 3WNGA 2P9UB 4AM7A 4O0IA 1RDUA 3ZSQA 2GTDA 1RT3A 4DTUA 3PO4A 2HNDA 3K5MA 1C1CA 2HOEA 1MU2A 2E2OA 2IS3A 4IEEA 3HPOA 4FK2A 4H03B 4FJGA 2ZJPL 4BY9C 3KKRA 1W2BM 2H3GX 4I9QA 4CEEA 3OYDA 2IOCA 3U9DA 3ZETB 1WSIA 3ZYYX 4B9TA 1X3MA 2AA4A 5IT9O 3QEIA 4FZZA 5HROA 2UXCK 1BO5O 4FWQA 2BH1A 1TK5A 5LJVA 3WXIA 2HVHA 1DT9A 3FR0A 3THYB 3NAEA 4N56A 1NOZA 4DSJA 1NNEA 4CZLA 4JNEA 4CECA 2VWJA 1BIZA 4DSFA 2Z1IA 4DV0K 1D4XA 1WBDA 1YTUA 5EY4A 4E7HA 2OCEA 2BGGA 3H3NO 3AY9A 2Q1NA 4E7KA 2CH6A 1HKGA 3MEGA 3OBWA 4CGIA 1KTQA 1JXBA 5F2RA 4CZFA 4AHVA 2X78A 4O5BA 3KLGA 4JKBA 3THYA 3D6RA 2ITGA 2G8KA 3M5RA 4FLWA 1NJXA 3W0LA 3KLFA 3MK6A 3I0RA 3TSPA 4BROA 3SLCA 3I8BA 2HBJA 4WE1A 2VQFK 2YNHA 2D0BA 4CJFA 3RVCA 5AQJA 3IKMA 4KI6A 1P90A 4Y1CA 1HKBA 3A5MC 4CZHA 3J81O 3L8BA 3UKRB 4BGBA 3AA5X 2OPRA 5ADXH 4B9MA 4W5RA 1NGIA 3O3HA 3J80O 2IAJA 4DSLA 2JWKA 1OVYA 1BA1A 4AILC 3SJJA 3K58A 3MCAB 1L3UA 2NRHA 3CC4N 1RDBA 1SKRA 5HRNA 2D4WA 3CC2N 2G8IA 1ZBIA 1EKEA 4BQZA 3U3GA 1SS6A 3CMAN 1KVBA 3AVBA 3J7AP 4CEQA 1U6ZA 2KZMA 2FBXA 4DTRA 4HCBA 1NGJA 3RMBA 1KC8O 3NGYA 4MFBA 5JVGL 3P38A 3QLHA 4FOIA 4M45A 4KKOA 3LPUA 2WONA 5GADP 3CG7A 1S72N 2RKIA 3QICA 3VQDA 4E3SA 4Y1DA 5EX5A 1ILYA 2QA4N 1FK9A 3MN7A 3NMUA 2KLAA 1HNWK 1OH7A 2OTLN 3FZFA 4GY2B 3ZSRA 3V9UA 3MN6A 5C2FA 2PYJA 2ETJA 1HJRA 3L0QA 3O3GA 3O1BA 4J2BA 4AHSA 4DG1A 1KAZA 1YIJN 3LZJA 3ITHA 5FLXO 3GOIA 4XH1A 2BDPA 4O4GA 4CJQA 3S3OA 3JXUA 3THXB 1NLVA 3CQ8A 4DS5A 3RMDA 4NYFA 2BTFA 4IJNA 4LH5A 3A5OC 4FWSA 4U67L 2D0CA 2A1SA 3FZKA 4BR0A 4LF6K 2HHXA 3FLCO 3DLKA 4BRLA 4F4KA 1BDGA 4DV6K 1YVUA 4KI4A 4IFVA 1VSFA 3NE6A 3AVFA 3P83D 3RR8A 3OYIA 2GUIA 2P5GA 4JI8K 2QTDA 3OHRA 4BC4A 1KVCA 2IDOA 4WFBL 1N32K 3SPZA 4B8AB 4HUEA 1NK4A 1BISA 4WQ4A 3KLEA 1ZYQA 3CD6N 4KB1A 4Z94A 3NF8A 4DWIA 3UB5A 1RBRA 1LV5A 3Q7CA 2Z1JA 4DS4A 5GIOA 1ZBLA 3ENBA 4FZYA 3PSFA 3CHWA 4DQSA 1KAYA 1WOQA 1YUWA 4DB3A 3QETA 1KSPA 1NWKA 3NVMA 4ID1A 3HVRA 3SV4A 3TABA 3ZCMA 5EXWA 2P9NB 1JLBA 4CJKA 1NBWA 2O8CB 1JKHA 3HVTA 3S41A 1QSSA 2W6LA 5AZJB 2ASOA 4H0VB 2JWLA 3ENHA 1QZ6A 3C7NA 4IJAA 4KHPK 4EP4A 4WF9L 3E01A 4B3SK 1XNRK 2O8FB 4FZXC 5D3GA 4FJLA 1VK0A 4BRHA 4AHRA 3CCRN 1S9EA 4FW1A 4CI6A 3NCIA 1Z05A 4C23A 2O8CA 5AQOA 4OGCA 1JCFA 1HLUA 4C8OA 4CBWA 2B5JA 3MEDA 3VEXA 3VENA 3I8DA 1N33K 3EO3A 1Q9XA 3KKSA 4BRGA 5AQFA 3WNFA 1WUAA 3PY8A 1YF5L 1U49A 1OVQA 5CZ1A 3L3VA 5AQXA 3PIOL 1UOCA 1VQKN 1JL1A 3WXKA 3C65A 4FWRA 4FWPA 3LP3A 1N6QA 1RDAA 4BRAA 2OYQA 4GV9A 3AO1A 3VF4A 5BRHA 2YNIA 4FLYA 1RDCA 4OX9K 4Z4EA 3ZX3A 2B4JA 1TV6A 2DPNA 3LL3A 1K9MO 1L3TA 3CPWM 1JLFA 1HNVA 3LDPA 4DQQA 4DFKA 2KHOA 2IC3A 2E6MA 5K14A 3SYZA 4Q0BA 3A5NC 3OYCA 3N4QA 4DQ8A 5I9EB 2KTQA 1TVRA 2ZGYA 4M3ZA 3CCSN 1C0UA 2HW3A 2E2PA 3AVNA 4ISEA 4H0TB 3HYFA 1KRPA 2D0AA 1Q81O 5TKYA 1HQUA 1CZBA 1ITGA 4KBOA 3WNHA 2OPQA 2I7PA 1RT2A 2FXUA 3F73A 4KRFA 1DEJA 3LDNA 3L2VA 4CEZA 2AP1A 2ZQBA 2F4VK 3HK2A 4K8ZA 4DLGA 3C6HA 3THWB 3S3NA 4JHDB 5DK5A 4JEPA 4NCGA 4DV5K 4M63C 4YOVA 2I5JA 2WOMA 3R6MA 4CGJA 4IXCA 1RTIA 3OS2A 4YOUA 3RRGA 1XNQK 3HPGA 4CJ5A 3MWTA 4EZ6A 2DFEA 3CJ7A 4IEIA 2R7YA 1X9SA 3R1XA 3MXMA 3RTVA 2W40A 4CJTA 4W5TA 4KREA 3HPHA 1J53A 2YKNA 3K57A 2RPIA 1RFQA 1TL1A 1T05A 4CJPA 4BRNA 4JHDA 1LWCA 4BRDA 4FJ5A 3KWGA 3VQPA 1BU6O 1EQYA 4R79A 2QM1A 4YOYA 1GOCA 2G8HA 1RTHA 4C1NI 1X9MA 1CLQA 1IJJA 5E26A 4B1UB 3SAFA 4K42A 3VQCA 3M8QA 4B1VA 1S6PA 1G99A 4CIGA 4ICLA 4BRCA 1JLCA 4FYDA 1E4GT 4JI0K 4CK1A 3VEOA 2E4LA 2ZJRL 4H4MA 5ADXA 1VQ9N 1WSFA 2QK9A 1BWFO 1NK7A 4C1NK 3MECA 5FPMA 3V6DA 3ZEUB 2VCPA 1EO1A 4FVUA 3QNNA 4CGFA 4AM6A 1JJ2M 3V1OA 4DLEA 4FWMA 4DUYK 1KD1O 4RW6A 5FPEA 3THVA 3ASMA 1WLJA 3QFUA 4GKKK 3BZKA 3V9XA 1KFDA 1VSJA 3ZSYA 2WTUA 4JI5K 3VGLA 1KCFA 4FW2A 4OGEA 1NK0A 5E84A 4CJWA 4HTUA 3E1YA 3GG4A 3RWUA 4BR2A 4FJ8A 1NK5A 5LMUK 4KTZA 2DFFA 3CJAA 4GVEA 3ZEUA 1RBSA 4YY3K 3T3FA 4NLCA 4E19A 1IG9A 1K8KB 1Q18A 4DQPA 4F3OA 4OPAA 3ID8A 4J2DA 3AA2A 4JLHA 4E7JA 2DTUA 3A8YA 2HHTA 4CESA 5CR4A 4G1QA 4IZ9A 1JLEA 1VSKA 3IDHA 3EYZA 1WSJA 4IBNA 1HMVA 2WFBA 2Z1HA 3O5BA 4BRFA 4B9NA 3OJUA 3AA4A 3R3LA 1UWBA 2XRIA 3N4PA 4IDHA 3EKSA 2ITMA 2HHQA 4F2RA 3QINA 2YHYA 4K25A 1H1VA 2QWNA 2UXDK 4GMJB 3ATUA 5JS2A 2DFHA 2W42A 4LH4A 3VQ8A 1JLQA 3UKUA 4CHZA 4RWTA 1LWFA 3QBWA 4AH9A 3ZT2A 4QS7A 3F9MA 1KXPA 3AA3A 1OH6A 3NGIA 4KHWA 3ZT1A 4M3XA 4DTJA 1C0MA 1I39A 3WEEA 4DFPA 3UE5A 3L2WA 3CQXA 2FBVA 4PL7A 1XI1A 4OO1J 4CHPA 2O8DB 4YOWA 4O8KA 1WN7A 3LZIA 4K43A 4RW9A 4IOXA 3U9ZA 2NNWA 4CGHA 1ZBFA 3AGRA 4B9SA 2ZD1A 3EE9A 3T1YK 2KZZA 3OBYA 4HCCA 3LAMA 1QZ5A 3V4IA 4BRPA 2HB5A 5AQTA 1D9DA 3HO1A 4K8XA 5KPRA 5AFUA 4MLHA 5JICA 4KO0A 3AVHA 1EWQA 5C24A 3VQ5A 3F5TA 4L3QA 4CZGA 1ZBHA 3U3YA 4FJ7A 4JK9A 1NGFA 4CF0A 3NH2A 2WUSA 2NRVA 4JKFA 2QXFA 4K41A 5HRRA 1N36K 3DXMB 4CEFA 1T8EA 2IVPA 3SCXA 3PLAA 3OYEA 5FRNA 4DR2K 3E9OA 3PX0A 4FJKA 3J8AA 3Q7BA 2KKZA 1VHXA 4JD2A 2P9KA 4GV6A 3SV3A 3ZSXA 1J5OA 4FM2A 4BRMA 2ZGZA 2LSNA 1VQON 1RNHA 1W9HA 3K9JA 3HL8A 3WXMB 4DMNA 1QHTA 5AQIA 3VTIA 3JAMO 3KHYA 3DXMA 3BEXA 4E0DA 1VRUA 3QO9A 4E1JA 4XH5A 3C6AA 1VSDA 2E2NA 1V4TA 1D5AA 2NRXA 4CZKA 3QEXA 4XH4A 2FSKA 4JI4K 4OPHA 3DWLA 4ELVA 1RT5A 2YJFA 5BRFA 4I6MA 4J8FA 1GLDG 1LW2A 4JS4A 1QS4A 1ASUA 4BVOA 1TKDA 1B92A 3SQ2A 3DJCA 2QWLA 3VA3A 2HMPA 3M3ZA 4N41A 3SBTA 3CJCA 4HUGA 4EZ9A 4KAZA 2VWKA 5AQGA 5M1QA 5C12A 2UU9K 3AV9A 5EVZA 2G8WA 2YI1A 4I7FA 1TK8A 2IVOA 4H5VA 3OYNA 3QIPA 3L6QA 5M1PA 3HSTB 3L4QA 3CCUN 3M8RA 1HPZA 2O8EA 2EWSA 4CEDA 4JRQA 1U45A 2ZWHA 1K6YA 4JKEA 3K5NA 4CIFA 3TTCA 4FWOA 4ILGB 1X9JA 3K0SA 3D45A 1BI4A 1S9GA 4OLBA 1X1PA 3KWIA 3TAEA 5KGWA 2B6AA 4LF7K 3TAQA 4H0YB 4BRKA 3P31A 4Z0UA 4EFHA 1YJ9N 5B8HA 3SMSA 2OA8A 3B6PA 4DR3K 1HNXK 3DLHA 5KRSA 1E4FT 2FBYA 4WCEL 1M90O 3SZ2A 4CHOA 3KLIA 4CK2A 3V81A 3B8AX 4LF9K 4ILHA 3RSEA 1QHAA 3R9PA 3CYMA 4BGAA 4BE2A 4BR5A 1LW0A 2EHGA 2P9PA 4LFAK 1XHXA 4KTWA 3JSMA 1QVGM 4CJ3A 2GWKA 3PV8A 3AVKA 3SNNA 1NGGA 5M1KA 4QOZB 4O5FA 3PX4A 4DSKA 3SQ1A 4HTLA 4QS9A 5BN8A 2ZE2A 3TSQA 3WXJA 3T1AA 5T7BA 4MO4A 3D0PA 4A5AA 4W5NA 1DKGD 3AO2A 3AARA 3SK3A 3RMAA 1HYVA 1JCEA 3MDQA 2FF6A 4NXMK 4RW7A 1S1TA 4LC9B 5HOOA 2V51B 4QAGA 3ZSWA 3VQEA 3SI6A 1QSLA 2QWMA 5HL7L 3KD1E 3LP0A 4V19S 1V4SA 4DR5K 3TI0A 3VESA 3P5JA 4DCHA 2X74A 5FPNA 3QESA 4OKEA 2BANA 4M3TA 1ATRA 1VSHA 2YHXA 2FLOA 1IBKK 3WXLA 5HBMA 4X62K 2A3ZA 1LCUA 2QI2A 4ELUA 2PYLA 1HYZA 1Y97A 4MDAA 5AQPA 4YORA 2QWOA 3KIOA 1TL3A 2P9LA 2VGMA 4OKJA 5BR8K 4MQ3A 3DM2A 3DOLA 1O1WA 3SAGA 2P1JA 1TKTA 4QS8A 5J2MA 1HYSA 5CYMA 3M8SA 4B9QA 3VEVA 4ZTJA 1LOTB 4BQLA 1YITN 1NJZA 3ULEA 1BA0A 4BWMA 3VN5A 5C25A 2YV0X 5C0YA 2RN2A 2OZMA 3IAYA 3LP1A 3SUPA 1NJYA 1A5XA 1RDDA 3LWMA 1BL3A 2VG5A 1EP4A 3HRGA 2FF3B 5AFUH 5AQUA 3C7NB 3WQUA 3U6FA 1NK6A 1WNSA 2P9SA 1RBVA 1BG3A 1TYQA 2QEXN 4W5OA 2QWQA 4TSXA 3O4WA 4DKWA 4JK7A 3OYMA 4CD1A 3CM6A 1MA9B 4Y0WA 1GLFO 3GDQA 4H0PA 4RG8A 2HBMA 4DV4K 1Q8IA 4CZIA 5AQWA 1FW6A 2NRWA 2CGKA 4EHTA 5BPNA 5EOYA 1C1BA 2HBKA 4UY8O 2RE2A 4YDUA 4F9OA 1RBUA 1C0TA 1B9DA 4FJ9A 4KHSA 3O1WA 3FE1A 4OJRA 2A6AA 5LMNK 4CCHA 1VSLA 2F9WA 4CJVA 1W7AA 3EN9A 4Z4GA 3EZ5A 3G6EN 3OS1A 3QDKA 2V7ZA 3FZLA 1RILA 1RCHA 1D8YA 2W6KA 3K59A 1EWRA 1L3SA 2OZSA 3K9KA 1HNZK 3RMCA 1VQNN 5AQKA 3LP2A 2ZJQL 3CERA 2ZF5O 3QFPA 3QEPA 4X64K 3KK2A 1XHZA 3BF1A 4BVPA 4BDZA 3PIPL 4B9UA 4FVMA 4JKHA 3CF5L 1NOYA 2JGUA 3AAPA 3VQ4A 4WFNL 1XC3A 4KHQA 1OH8A 5FDLA 1XMQK 5BPMA 5J1EA 4E1NA 4XIUA 3TTFA 3VA0A 3QEVA 4MLEA 3TU5A 1NKBA 3O4NA 2A42A 4FO0A 1A5WA 3CCEN 4E1MA 4BR4A 3QBXA 3HZ6A 4PWDA 3O6WA 4B1XB 4CFDA 3T69A 1SL2A 3AO3A 3KD5E 1IH7A 3LM2A 4IWVA 4N76A 4OLAA 3T19A 3ZT3A 3CCLN 4FJIA 1ZBSA 3SPYA 2EX3A 1YJWN 5KQ8A 2NLXA 1DTQA 4H5WA 4EP5A 3VQ9A 2KFZA 2BE2A 5BRDA 2HNYA 3CJ1A 4O8UA 1TKXA 5GINA 3L2UA 3TAMA 4JI6K 3DLRA 5HRSA 4IOAL 3O9RA 4F2SA 4B1YB 3HP6A 3VQAA 1VQMN 3OYFA 1VQ8N 5KTQA 3VQ7A 3MMVA 2PBDA 2GBZA 2X6SA 1NM1A 4YDUC 3P39A 2F7TA 2Q0RA 2CH5A 3ATVA 4CHYA 1ASWA 4DV1K 1RT6A 3O9QA 4JRPA 1LWEA 2G8UA 1A5VA 1GLLO 3VQ6A 3CJBA 3HI0A 1JCGA 3AGKA 3H1QA 3VPZA 4DTSA 2D1KA 1S1XA 4BDPA 4M3RA 3CIPA 2YKMA 3VTHA 1MWKA 3OS0A 4BWJA 4IKFA 4M41A 4CZEA 2Q0UA 3O9UA 4KTQA 4CF8A 4FLXA 1WSGA 1IV0A 3VETA 4N47A 4BRIA 3NBPA 2XY7A 4C8KA 2GWJA 4GNIA 3TR8A 2P9IA 4DV7K 1LAVA 3ZT4A 3OYGA 4BE1A 3KJVA 4GW6A 4HVJA 1WAJA 3TPQA 1X9WA 4B3RK 2OTJN 3ZSOA 4A2AA 4FWNA 3V9SA 1BCOA 3DOKA 2HF3A 3MN9A 4KB0A 1FXXA 3MAQA 4JI1K 1L5UA 2HMIA 4K0KK 4BE0A 4HHTA 4CEOA 3EZWA 2E1YA 4FM1A 3KK7A 2HVIA 1SL1A 5LY3A 3NHGA 3EE8A 3BUZB 1NMNA 1HPMA 3OVNA 4RTFD 3AVIA 1ZC6A 3VQBA 4PKIA 4OPJA 3V9WA 1BGXT 3MXIA 4DU4A 5AZIA 4M7YA 3L4IA 4JKGA 3AO5A 4B8CA 1IKVA 3E9PA 3T1HK 4CERA 1XC9A 3OYAA 4B3TK 5AQVA 3DYAA 3NFAA 4LY7A 1KLNA 4CZMA 1SAZA 3CCQN 1VQ4N 1DLOA 5DM7L 2O4GA 4NXNK 1FKOA 3WUHA 4E89A 2Q2RA 3LALA 2XO7A 1QVFM 1EX4A 3UKUB 5JS1A 1ATNA 5J2NA 1BCMA 4CFBA 4JI2K 4FLZA 3CETA 3HP9A 2WBNA 5KGXA 2XY8A 5GAHP 4RW4A 3WEEB 3D2FA 2YX6A 2KFNA 3V1QA 1LAWA 3AAQA 3S3MA 3C94A 4YOTA 2UUCK 1T6CA 2Q31A 1RT1A 4I2QA 3FFIA 3A5LC 3HXMA 2E8AA 4IO8A 2Z1GA 1SV5A 1UA0A 1RTJA 4YFUA 3L2QA 3FZHA 3OYJA 1RT7A 1NJIO 4FPBA 4X66K 2QWPA 4ZHRA 1NGDA 3AO4A 3DLEA 2E2QA 1MDUB 3RRHA 2HHHK 3OY9A 2J4RA 1HQEA 4JKCA 4BRQA 4RW8A 4W5QA 3CI5A 5AJ3K 4FSVA 4NB4A 3S9HA 3BY5A 3O9SA 4E7IA 5KPTA 4IOCL 4BDYA 1L3VA 1OKJA 4CJEA 5GAGP 5TKWA 5JMVA 5AR0A 3GE1A 3QB0A 3QERA 4GVMA 3I56N 4IO9L 4FPAA 1Z6RA 3O9TA 4EAHD 2ASMA 4Z4FA 4JYAK 5AQYA 1JXEA 4DU1A 2YHBA 5JVHL 1NKCA 1IO2A 1R59O 3KTQA 3IMXA 4JD2B 4OPKA 3H6EA 2P9KB 3ZSZA 3DMJA 1NGBA 1I94K 3DI6A 5BN9A 3CCMN 3IS9A 2QWRA 1VSEA 2IGIA 3FZMA 1NK8A 3SUNA 3ID6A 4JI7K 1NGAA
chains in the Genus database with same CATH topology
4C23A 5AQOA 4H5RA 5CHIA 1JCFA 3E9LA 4HTLA 1HLUA 1NGEA 1VAZA 4QS9A 3MWPA 4CBWA 5BN8A 3TSQA 3WXJA 1XUPO 3VEXA 3VENA 1T44A 4KH6A 4BR9A 4MO4A 3CJ9A 3EO3A 3U4LA 5AQFA 4A5AA 4BRGA 1T3VA 1DKGD 1QQOA 3AARA 1WUAA 3ENOA 3I33A 1T6DA 1IG8A 1YF5L 1JCEA 1U2VA 3SK3A 3VEYA 2V7YA 3MDQA 2FF6A 3D2FB 4I6MB 3HBTA 5AQXA 4B1WB 4CBXA 5C15A 5H1SQ 4BC3A 3PIOL 3DXKB 3WXKA 1VQKN 3C65A 3D2EA 4LC9B 5FPDA 4FWRA 2V51B 4FWPA 5LJWA 5HOOA 4FWLA 5BR9A 4PKGA 2QWMA 1ZXOA 2W41A 5HL7L 4BRAA 3A0IX 4GV9A 2CGLA 4JAXA 3VF4A 4A57A 5BRHA 2E20A 1V4SA 3D7EO 3MCPA 3VESA 4DCHA 1BOTO 4FL9A 4ILJA 3G4SN 3ZX3A 5FPNA 3VGKA 4ISFA 3I55N 1Q86O 2DPNA 3LL3A 1K9MO 2NZTA 3HSCA 1ATRA 2YHXA 4PKHA 2FLOA 3TTDA 3VEZA 3CPWM 1J6ZA 3WXLA 4MO5A 5JLHA 2A3ZA 1LCUA 2QI2A 1N8RO 3LDPA 4H0XB 3DXKA 3CMEN 2KHOA 4MDAA 5AQPA 3HOTA 4YORA 2QWOA 3HM8A 3A5NC 3E66A 2P9LA 3N4QA 4DQ8A 2VGMA 1YHQN 5I9EB 1KAXA 3JS6A 2P9UA 3O08A 1SZ2A 2ZGYA 3CCSN 2QW9A 4JK8A 3CCJN 3EKUA 1ATSA 3LM9A 4XEIA 2E2PA 3CC7N 3SAGA 3GBTA 5F1XA 4ISEA 4QS8A 4H0TB 3VERA 3H46O 4EHUA 3OA9A 4A62A 1YAGA 5AQNA 1Q81O 5TKYA 3VF2A 4B9QA 4KH4A 3VEVA 1VQ7N 1LOTB 2GUPA 4KBOA 3OW2M 4BQLA 1YITN 3ULEA 1BA0A 1GLJO 3FGUA 3WT0A 1HJOA 1GLBG 5JLFA 3ZETA 5C0YA 4CD3A 2I7PA 3G25A 3HTVA 1W97L 4YOXA 1X3NA 2FXUA 4KH5A 1GLCG 1K8KA 3VGMA 1C0GA 1DEJA 3LDNA 2HF4A 5KQDA 2AP1A 4DHYA 3RSEB 4MDBA 1QVGM 5AFUH 1O13A 3HRGA 2FF3B 3WQUA 5AQUA 3C7NB 4H5NA 3C6HA 3KVGA 2P9SA 3MX5A 4JHDB 1BG3A 2ASPA 1TYQA 3H45C 4JEPA 4BG8A 3CCVN 1Q82O 2RHKA 2QWQA 5DM6L 2QEXN 5AQZA 3LDQA 2P9PB 3O4WA 4M63C 4WYBA 3R6MA 4JK7A 4DKWA 4YOVA 3SBGA 2VYPA 4CD1A 1MA9B 4IXCA 4Y0WA 1GLFO 3GDQA 4H0PA 2HBMA 4YOUA 4CZIA 3MWTA 4B1ZA 3CJ7A 4IEIA 1C0FA 5AQWA 3W3DA 2NRWA 3SAHA 3R1XA 2A5XA 2CGKA 3CPEA 1YXQA 4H5TA 4EHTA 1VQLN 1S22A 2W40A 5EOYA 3C0BA 5BPNA 1YI2N 2HBKA 4FWKA 4IFEA 5KPZA 4UY8O 1ESVA 2RE2A 4A5BA 4YDUA 4F9OA 3EL2A 3DAWA 3H3OB 3O1WA 3FE1A 5GAEP 1RFQA 2NRTA 4FOEA 1U2VB 2NRZA 2A6AA 4EIAA 4BRNA 2GX9A 4JHDA 1HUXA 4BRDA 3KWGA 2F9WA 2IIRA 1BU6O 2Q97A 1EQYA 3D2EB 3EN9A 4HWIA 4R79A 2QM1A 4YOYA 2CGJA 4NLBA 3G6EN 3J7ZO 2FSJA 3VEWA 3QDKA 4C1NI 4ISGA 5AQRA 1IJJA 2V7ZA 3FZLA 5E26A 2E1ZA 4A61A 4B1UB 3M1FA 3SAFA 4K42A 2D0PA 4B1VA 1Y64A 3K9KA 1VQNN 4BREA 5AQKA 1G99A 5CE3A 4BRCA 2ZJQL 3CERA 1E4GT 2GEMA 4U7BA 2ZF5O 3QFPA 1YVNA 1HX1A 3VEOA 2ZJRL 3BF1A 5ADXA 4BVPA 1VQ9N 3PIPL 1BWFO 4JKHA 3CF5L 2PAVA 3P4IA 3AAPA 4C1NK 4WFNL 1XC3A 5FPMA 3UKRA 5F0XA 3ZX2A 3ZEUB 2VCPA 5BPMA 1EO1A 4FVUA 4CJ7A 3TTFA 4AM6A 1QQMA 1JJ2M 2P9LB 4MLEA 4FWMA 2P9UB 3TU5A 4FO0A 2A42A 1RDUA 4AM7A 3TSUA 2GTDA 3CCEN 3CQYA 3KZBA 4BR4A 3DLLL 1KD1O 5M1OA 3QBXA 2HOEA 5FPEA 1MWMA 2E2OA 3QFUA 3HZ6A 3O6WA 4IEEA 4B1XB 3T69A 4BR7A 4H03B 2ZJPL 3VGLA 3LM2A 4BY9C 4IWVA 1W2BM 2H3GX 2F9TA 5E84A 3E1YA 3SMPA 1VQPN 3CCLN 4NO7A 1ZBSA 3GG4A 3ULEB 4BR2A 1YJWN 3U9DA 5KQ8A 2NLXA 3ZETB 3CJAA 4GVEA 3ZEUA 3HOSA 4H5WA 4NLCA 3ZYYX 1X3MA 1K8KB 2AA4A 1Q18A 3NVKA 4JKDA 4OPAA 5M1FA 1BO5O 3ID8A 5BRDA 3CJ1A 4FWQA 4O8UA 5GINA 2P9SB 3A8YA 2BH1A 5LJVA 3WXIA 1TYQB 3O9RA 4IOAL 2YJEA 5CR4A 1DT9A 3FR0A 4IZ9A 4B1YB 2Q36A 1VQMN 1VQ8N 3IDHA 4CZLA 3BF3A 4JNEA 2WFBA 3O5BA 4BRFA 3R3LA 3MMVA 2PBDA 2VGNA 2WC9A 1D4XA 4WQ5A 1NM1A 3N4PA 4YDUC 4IDHA 3EKSA 3P39A 2ITMA 1K8AO 2F7TA 5EY4A 2Q0RA 3LDLA 3VOVA 1XQSC 2CH5A 2GELA 2YHYA 2I7NA 3AY9A 3H3NO 2Q1NA 1H1VA 2QWNA 4K25A 3ATVA 3ATUA 2CH6A 3O9QA 1HKGA 3OBWA 1YJNN 5F2RA 4CZFA 3M6GA 3LDOA 3UKUA 4RWTA 3QBWA 4QS7A 3F9MA 1KXPA 1GLLO 3CJBA 4JKBA 3HI0A 2A41A 3FFKB 1JCGA 3AGKA 3H1QA 3MX2A 4A2BA 3D6RA 4M7XA 3VPZA 2D1KA 3G71N 1K73O 2OANA 2V52B 3WEEA 3M5RA 1KQSM 3CIPA 5AQSA 3R8EA 3UE5A 3W0LA 3WQTA 3MK6A 3CQXA 3VTHA 3TSPA 1MWKA 4BROA 4PL7A 3SLCA 3I8BA 2HBJA 3H1VX 4CZEA 2Q0UA 3O9UA 4OO1J 4YOWA 4O8KA 3RVCA 5AQHA 5AQJA 4K43A 2IVNA 4IOXA 3VETA 3U9ZA 2NNWA 4BG9A 4BRIA 1VQ6N 3IKMA 3AGRA 1P90A 2GWJA 4GNIA 1HKBA 3A5MC 2P9IA 3EE9A 4CZHA 1M1KO 3OBYA 3UKRB 4BGBA 2YCHA 5ADXH 1QZ5A 1NGIA 1GLAG 4BRPA 2JWKA 5AQTA 1OVYA 1BA1A 2E88A 3ZX0A 5KPRA 5AFUA 3MCAB 3TPQA 4MLHA 2OTJN 5JICA 4A2AA 2NRHA 3CC4N 4FWNA 4BC2A 2HF3A 3MN9A 1NGHA 2VWBA 2D4WA 3CC2N 3F5TA 3BP8A 4L3QA 4CZGA 3VF6A 4JK9A 1NGFA 2WUSA 4BQZA 2NRVA 1SS6A 3MN5A 4JKFA 3CMAN 4K41A 5M1NA 3DXMB 2IVPA 1U6ZA 5MLCQ 3EZWA 3PLAA 2E1YA 2P9NA 3KK7A 3E9OA 5LY3A 3EE8A 1NGJA 3BUZB 5AQQA 1KC8O 1HPMA 5JVGL 1BUPA 3J8AA 3P38A 4RTFD 3Q7BA 1ZC6A 2KKZA 4FOIA 4PKIA 5AZJA 4JD2A 5GADP 1S72N 2P9KA 4GV6A 3QICA 5AZIA 4M7YA 3F2KA 3L4IA 5AQLA 5EX5A 4WQ5C 1ILYA 4JKGA 4BRMA 2ZGZA 2QA4N 2YHWA 3T7ZA 3QMLA 1VQON 3MN7A 3E9PA 3K9JA 4CZJA 4PHTX 3NMUA 3WXMB 5AQVA 2KLAA 4G9ZA 2OTLN 3FZFA 4GY2B 4CZMA 1SAZA 5AQIA 3VTIA 3CCQN 1VQ4N 3KHYA 3MN6A 5C2FA 3DXMA 1DGKN 3BEXA 5DM7L 3L0QA 3O1BA 3WUHA 2Q2RA 4E1JA 3VMFB 4XH5A 5BREA 1KAZA 1QVFM 1YIJN 3UKUB 1NMDA 1Q7YO 2UYTA 1ATNA 2BUPA 3C6AA 3GOIA 2E2NA 3GL1A 1V4TA 4XH1A 2NRXA 3CXCM 2NRRA 4CZKA 4XH4A 3JXUA 2FSKA 1NLVA 4OPHA 3CETA 3DWLA 2WBNA 5BRFA 2YJFA 5GAHP 4JN4A 3WEEB 3D2FA 4I6MA 4J8FA 1GLDG 2BTFA 2YX6A 4IJNA 3AAQA 3A5OC 1P8ZA 4WQ4C 4FWSA 4YOTA 4U67L 4BVOA 1T6CA 2Q31A 4BC5A 3DJCA 3FZKA 2QWLA 2HBLA 4BR0A 4WFAL 2HMPA 3M3ZA 3A5LC 3SBTA 3CJCA 5C2DA 2E8AA 4IO8A 4GV3A 3FLCO 1RGIA 2HSTA 5AQGA 1HKCA 3FZHA 5M1QA 4BRLA 1BDGA 2P9IB 5C12A 4FPBA 1NJIO 1CZAN 2QWPA 5EVZA 2YI1A 3O80A 1NGDA 4PL8A 2IVOA 4H5VA 2E2QA 1MDUB 2QTDA 3OHRA 3L6QA 2D0OA 2J4RA 3L4QA 4JKCA 5M1PA 4BC4A 3CCUN 4BRQA 5GIPA 3CI5A 2EWSA 4FSVA 4NB4A 4WFBL 3O9SA 2ZWHA 4JKEA 3U8XA 5KPTA 4IOCL 1OKJA 3TTCA 4A59A 4FWOA 2PFUA 4ILGB 5TKWA 5GAGP 5JMVA 1X9JA 3IFRA 3IUCA 5AR0A 3GE1A 3QB0A 3O8MA 4WQ4A 5ELZA 1QQNA 3I56N 3CD6N 4Z94A 3KWIA 4IO9L 3SJHA 4FPAA 3UB5A 3Q7CA 4CBUA 1Z6RA 5GIOA 3ENBA 1S3XA 2A40A 3O9TA 3CHWA 1KAYA 1WOQA 1YUWA 4DB3A 4H0YB 4BRKA 1NWKA 4EAHD 3NVMA 3P31A 2FSNA 1TUUA 4H0OA 5EXWA 1RDWX 2ASMA 2P9NB 4EFHA 1YJ9N 5B8HA 3SMSA 1NBWA 1SQKA 5AQYA 3S41A 1E4FT 5JVHL 5C10A 4WCEL 1M90O 1R59O 5AZJB 3IMXA 4JD2B 3H6EA 2P9KB 5AZIB 4AF1A 2ASOA 4H0VB 3B8AX 1TUYA 4ILHA 1NGBA 4JKAA 3RSEA 2JWLA 1QHAA 4JKGB 3ENHA 4RCHA 1QZ6A 3C7NA 3R9PA 4BGAA 4IJAA 4BR5A 5BPLA 5BN9A 4WF9L 3CCMN 1NGCA 2P9PA 2QXLA 2QWRA 5AQMA 2GWKA 3FZMA 4BRHA 1VQ5N 1NGGA 3CCRN 5M1KA 4CI6A 1GLEG 1Z05A 4O5FA 3ID6A 1NGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOX A;  3N4Q A;  3N4P A; 
#chains in the Genus database with same CATH topology
 4GKJ K;  3ZT0 A;  4DR1 K;  1VAZ A;  4I9L A;  1XUP O;  2QKK A;  1QQC A;  4CGD A;  4NCA A;  4KH6 A;  4BR9 A;  4B3O A;  3AVL A;  2YNG A;  1T3V A;  3DLL L;  4CFC A;  3I33 A;  3VEY A;  4IG0 A;  1IG8 A;  1EXQ A;  1U2V A;  1CXU A;  3C6T A;  2V7Y A;  4B1W B;  1BHL A;  4I6M B;  5H1S Q;  3TAR A;  4Z4H A;  4BC3 A;  1TAU A;  3D2E A;  5LJW A;  3TAF A;  4FWL A;  5BR9 A;  1REV A;  2F8S A;  3MCP A;  2Y1J A;  3DLG A;  4FL9 A;  1S5J A;  4DU3 A;  3VGK A;  1Q86 O;  2VQE K;  3HSC A;  3AVJ A;  1C1A A;  5HLF A;  4MO5 A;  2HHW A;  3LDS A;  1N8R O;  4LFC K;  4CJL A;  1C6V A;  3CME N;  1IKY A;  3KLH A;  3HOT A;  1FJG K;  2O8E B;  2OPS A;  3E66 A;  1KAX A;  2P9U A;  3O08 A;  1SZ2 A;  4J2E A;  1BI4 B;  2QW9 A;  4PY5 A;  3CCJ N;  1ATS A;  3LM9 A;  4XEI A;  3CC7 N;  5KI6 A;  3F9K A;  5F1X A;  3H46 O;  4EHU A;  3OA9 A;  1YAG A;  4H8K A;  1ZBU A;  4KH4 A;  2G8V A;  2GUP A;  4CEA A;  3OW2 M;  4DTM A;  1GLJ O;  1HRH A;  3WT0 A;  1GLB G;  2G8F A;  3ZET A;  4CD3 A;  3HTV A;  3G25 A;  1W97 L;  1WSH A;  1X3N A;  4YOX A;  4KHU A;  2HHS A;  2AJQ A;  1C0G A;  1G15 A;  3VQQ A;  3AVC A;  4DHY A;  3RSE B;  1O13 A;  3KVG A;  5DMR A;  3ISN C;  1B9F A;  1BQN A;  3CCV N;  4LF5 K;  5AQZ A;  3LDQ A;  2P9P B;  4CF2 A;  5CYQ A;  3HM9 A;  4DQI A;  2XY6 A;  3SBG A;  3P1G A;  4FJN A;  3QNO A;  4B1Z A;  1C0F A;  3SAH A;  1VQL N;  2A5X A;  4QCL A;  1YT3 A;  1YXQ A;  1S22 A;  3C0B A;  5A2Q O;  1YI2 N;  4FWK A;  5KPZ A;  1ESV A;  4A5B A;  4LFB K;  4BAC A;  4YHH K;  4R5P A;  3DAW A;  3H3O B;  3SQ4 A;  4EIA A;  4FCY A;  2GX9 A;  1HUX A;  4IFY A;  3LWL A;  2Q97 A;  2IIR A;  4HWI A;  3JYT A;  3J7Z O;  3NDK A;  2PZS A;  3NF7 A;  1W0H A;  4ISG A;  5AQR A;  2PY5 A;  4KFB A;  2E1Z A;  1SKS A;  2D0P A;  3OTO K;  1KFS A;  1Y64 A;  3M8P A;  2GV9 A;  4LF8 K;  4BRE A;  1HNI A;  1J5E K;  2P51 A;  4CF1 A;  3K2P A;  1N34 K;  1HX1 A;  1TAQ A;  4M3U A;  3OYB A;  3P4I A;  3EY1 A;  2UUB K;  3UKR A;  4CJS A;  4CF9 A;  5F0X A;  4ZTF A;  4DTX A;  1UAX A;  4CJ7 A;  5CZ2 A;  4OVL A;  1QQM A;  4DV3 K;  3NF9 A;  1NK9 A;  2P9L B;  3KK1 A;  4Z4C A;  3TSU A;  3IRX A;  3DRP A;  4OKK A;  3CQY A;  3KZB A;  1QTM A;  3B6O A;  1R0A A;  5M1O A;  3O4Q A;  4DF8 A;  1MWM A;  1KLM A;  3AVM A;  4BR7 A;  2ZM6 K;  3TWH A;  2F9T A;  3K5O A;  3SMP A;  1VQP N;  4C8N A;  2O4I A;  4NO7 A;  3ULE B;  2Y1I A;  2OPP A;  3CM5 A;  2XY5 A;  3HOS A;  4DTP A;  3NVK A;  4JKD A;  3L2R A;  5M1F A;  2P5O A;  4LSL A;  1IKX A;  2P9S B;  1TYQ B;  2YJE A;  1D9F A;  4DR4 K;  4B08 A;  4FK0 A;  3QIO A;  2VG7 A;  2Q36 A;  4FM0 A;  4ELT A;  3NF6 A;  3BF3 A;  3ULD A;  1BQM A;  1JLG A;  2VGN A;  2WC9 A;  4WQ5 A;  3DRR A;  4DF4 A;  1K8A O;  3LDL A;  3VOV A;  1XQS C;  3V1R A;  4CHN A;  2XHB A;  4C8L A;  4JI3 K;  2GEL A;  2I7N A;  3A2F A;  4E7L A;  2YHA A;  1IKW A;  4DFM A;  1YJN N;  2KW4 A;  4JS5 A;  3M6G A;  3LDO A;  4PQU A;  1CZ9 A;  4O55 A;  1Z26 A;  4IDK A;  2A41 A;  3FFK B;  3C95 A;  3MX2 A;  4A2B A;  4M7X A;  3THX A;  1VRT A;  4DSE A;  3G71 N;  1K73 O;  2OAN A;  2V52 B;  1KQS M;  5AQS A;  3R8E A;  3WQT A;  3AVG A;  5C42 A;  3H1V X;  1J54 A;  2RF2 A;  4AHU A;  4YNQ A;  5AQH A;  2IVN A;  1I3A A;  3NGZ A;  4BG9 A;  1VQ6 N;  2Q3S A;  2E5L K;  1M1K O;  2YCH A;  3HJF A;  5J2Q A;  1GLA G;  1IBM K;  3ZSV A;  4CFA A;  4O0J A;  2E88 A;  3ZX0 A;  4CJR A;  1U48 A;  3EEQ A;  1IBL K;  4LF4 K;  2HNZ A;  4BC2 A;  3K5L A;  3V9Z A;  1NGH A;  2HHU A;  2VWB A;  3TAN A;  3BP8 A;  3VF6 A;  3PSI A;  4FK4 A;  3MN5 A;  4PA1 A;  5M1N A;  5MLC Q;  1S1W A;  4F8R A;  4CGG A;  2ATQ A;  4FJX A;  2YNF A;  2P9N A;  3SQ0 A;  1OH5 A;  3WNE A;  4NCB A;  5AQQ A;  5I3U A;  1BUP A;  4X65 K;  2NUB A;  3MXJ A;  4IG3 A;  5AZJ A;  1T7P A;  5HRP A;  3F2K A;  5AQL A;  4WQ5 C;  1BIU A;  2YHW A;  4H4O A;  3T7Z A;  3QML A;  2QKB A;  4PHT X;  4CZJ A;  3J7Y P;  4G9Z A;  3HT3 A;  2UXB K;  2O8F A;  1WB9 A;  1DGK N;  5LL6 Z;  3VMF B;  5BRE A;  1NMD A;  1Q7Y O;  2UYT A;  2BUP A;  3GL1 A;  3CXC M;  2NRR A;  1N5Y A;  1U4B A;  4DTO A;  4DR6 K;  4JN4 A;  1WAF A;  4HUF A;  1Z25 A;  4O44 A;  3RR7 A;  1P8Z A;  1U47 A;  1VSI A;  4WQ4 C;  4LSN A;  4BC5 A;  4KV8 A;  2HBL A;  4FLV A;  4DQR A;  3DRS A;  1SUQ A;  5C2D A;  3SUQ A;  4FJM A;  4GV3 A;  4C8M A;  1RGI A;  2HST A;  2JLE A;  1HKC A;  3PX6 A;  1KVA A;  2P9I B;  1CZA N;  1NJW A;  3O80 A;  1S6Q A;  4PL8 A;  5SZT A;  1QSY A;  2D0O A;  3NH0 A;  4LD0 A;  5GIP A;  1CXQ A;  3U8X A;  2O8B B;  4A59 A;  2PFU A;  5IWA K;  1WBB A;  3IFR A;  3IUC A;  5ELZ A;  4CJU A;  3O8M A;  1QQN A;  1ASV A;  4CJ4 A;  3SJH A;  1NU0 A;  4CHQ A;  3OYL A;  1WSE A;  4FJJ A;  4PUO A;  4CBU A;  1S3X A;  2A40 A;  1J9A A;  1GOB A;  2KQ2 A;  3LPT A;  2FSN A;  1TUU A;  4H0O A;  1RDW X;  4CIE A;  4M42 A;  1SQK A;  2F8T A;  5C10 A;  5J2P A;  2FC0 A;  1SL0 A;  5AZI B;  4AF1 A;  2O8B A;  3CFP A;  1TUY A;  4WFA L;  4JKA A;  4JKG B;  4RCH A;  5E41 A;  3THW A;  5BPL A;  5FRO A;  1NGC A;  2QXL A;  4UQG A;  3TAP A;  2A1R A;  5AQM A;  1GOA A;  2D5R A;  4Q5V A;  1VQ5 N;  5I42 A;  1GLE G;  4H5R A;  5CHI A;  3E9L A;  5JLF A;  1NGE A;  3MWP A;  4B9V A;  4L8R B;  1T44 A;  3CJ9 A;  2VG6 A;  3U4L A;  1QQO A;  3ENO A;  1T6D A;  2UUA K;  3D2F B;  4CBX A;  3HBT A;  5C15 A;  3DXK B;  2X6N A;  5FPD A;  5EU7 A;  4PKG A;  1ZXO A;  2W41 A;  1TK0 A;  3A0I X;  3IG1 A;  2CGL A;  4JAX A;  4B3M K;  4A57 A;  2E20 A;  3D7E O;  2E6L A;  1BOT O;  3G4S N;  4ILJ A;  4M3W A;  4ISF A;  3I55 N;  4DV2 K;  2NZT A;  4CE9 A;  1FKP A;  1EET A;  4PKH A;  3TTD A;  3VEZ A;  1J6Z A;  4FXD A;  5JLH A;  3PO5 A;  4AHT A;  4H0X B;  1NKE A;  3KK3 A;  3DXK A;  1HR0 K;  1UA1 A;  3HM8 A;  4DFJ A;  1YHQ N;  3JS6 A;  3SUO A;  3I0S A;  2DY4 A;  4JK8 A;  3OJS A;  1RBT A;  3EKU A;  4DTN A;  4KHN A;  3GBT A;  3VER A;  3UIQ A;  4FJH A;  4B9L A;  1TKZ A;  4A62 A;  5AQN A;  4I2P A;  3VF2 A;  3ZLJ A;  1VQ7 N;  1S1V A;  4NYN A;  5KRT A;  4KHY A;  3FGU A;  4CW7 B;  1HJO A;  5SWM A;  1XWL A;  3PUF A;  4KH5 A;  3DLB A;  1GLC G;  1K8K A;  3BZC A;  1JL2 A;  4ID5 A;  3VGM A;  4FLU A;  3G0Z A;  5KQD A;  1NG9 A;  2HF4 A;  4J2A A;  1QE1 A;  4MDB A;  5CY4 A;  4H5N A;  3NH1 A;  3MX5 A;  1VSM A;  2ASP A;  3H45 C;  1Q82 O;  4BG8 A;  2RHK A;  5DM6 L;  3G10 A;  4WYB A;  2VYP A;  1XMO K;  3OYH A;  3ALY A;  1Q9Y A;  1TGO A;  3W3D A;  4M3Y A;  3OYK A;  4H5T A;  1RT4 A;  3MEE A;  3CPE A;  4CK3 A;  3L3U A;  3O3F A;  4IFE A;  1S1U A;  4N5S A;  3CFR A;  3EL2 A;  5GAE P;  2HHV A;  2NRT A;  4FOE A;  1U2V B;  2NRZ A;  3LAN A;  3D2E B;  4AQY K;  4F3T A;  4AHC A;  2CGJ A;  1JLA A;  4NLB A;  1E3M A;  2FSJ A;  3VEW A;  4KPY A;  3LAK A;  4DR7 K;  4A61 A;  3M1F A;  5HP1 A;  3BDP A;  4DUZ K;  1YTA A;  3H08 A;  2F96 A;  1F21 A;  3BGR A;  1T03 A;  2FBT A;  1RTD A;  5CE3 A;  2O8D A;  4FLT A;  1U04 A;  3CFO A;  2GEM A;  4U7B A;  5FRM A;  4DSI A;  3C6U A;  1YVN A;  4JV5 K;  1DTT A;  2PAV A;  4CEB A;  3TAG A;  3ZX2 A;  1SKW A;  3AVA A;  4CVN E;  3QEW A;  4Z4I A;  3WNG A;  2P9U B;  4AM7 A;  4O0I A;  1RDU A;  3ZSQ A;  2GTD A;  1RT3 A;  4DTU A;  3PO4 A;  2HND A;  3K5M A;  1C1C A;  2HOE A;  1MU2 A;  2E2O A;  2IS3 A;  4IEE A;  3HPO A;  4FK2 A;  4H03 B;  4FJG A;  2ZJP L;  4BY9 C;  3KKR A;  1W2B M;  2H3G X;  4I9Q A;  4CEE A;  3OYD A;  2IOC A;  3U9D A;  3ZET B;  1WSI A;  3ZYY X;  4B9T A;  1X3M A;  2AA4 A;  5IT9 O;  3QEI A;  4FZZ A;  5HRO A;  2UXC K;  1BO5 O;  4FWQ A;  2BH1 A;  1TK5 A;  5LJV A;  3WXI A;  2HVH A;  1DT9 A;  3FR0 A;  3THY B;  3NAE A;  4N56 A;  1NOZ A;  4DSJ A;  1NNE A;  4CZL A;  4JNE A;  4CEC A;  2VWJ A;  1BIZ A;  4DSF A;  2Z1I A;  4DV0 K;  1D4X A;  1WBD A;  1YTU A;  5EY4 A;  4E7H A;  2OCE A;  2BGG A;  3H3N O;  3AY9 A;  2Q1N A;  4E7K A;  2CH6 A;  1HKG A;  3MEG A;  3OBW A;  4CGI A;  1KTQ A;  1JXB A;  5F2R A;  4CZF A;  4AHV A;  2X78 A;  4O5B A;  3KLG A;  4JKB A;  3THY A;  3D6R A;  2ITG A;  2G8K A;  3M5R A;  4FLW A;  1NJX A;  3W0L A;  3KLF A;  3MK6 A;  3I0R A;  3TSP A;  4BRO A;  3SLC A;  3I8B A;  2HBJ A;  4WE1 A;  2VQF K;  2YNH A;  2D0B A;  4CJF A;  3RVC A;  5AQJ A;  3IKM A;  4KI6 A;  1P90 A;  4Y1C A;  1HKB A;  3A5M C;  4CZH A;  3J81 O;  3L8B A;  3UKR B;  4BGB A;  3AA5 X;  2OPR A;  5ADX H;  4B9M A;  4W5R A;  1NGI A;  3O3H A;  3J80 O;  2IAJ A;  4DSL A;  2JWK A;  1OVY A;  1BA1 A;  4AIL C;  3SJJ A;  3K58 A;  3MCA B;  1L3U A;  2NRH A;  3CC4 N;  1RDB A;  1SKR A;  5HRN A;  2D4W A;  3CC2 N;  2G8I A;  1ZBI A;  1EKE A;  4BQZ A;  3U3G A;  1SS6 A;  3CMA N;  1KVB A;  3AVB A;  3J7A P;  4CEQ A;  1U6Z A;  2KZM A;  2FBX A;  4DTR A;  4HCB A;  1NGJ A;  3RMB A;  1KC8 O;  3NGY A;  4MFB A;  5JVG L;  3P38 A;  3QLH A;  4FOI A;  4M45 A;  4KKO A;  3LPU A;  2WON A;  5GAD P;  3CG7 A;  1S72 N;  2RKI A;  3QIC A;  3VQD A;  4E3S A;  4Y1D A;  5EX5 A;  1ILY A;  2QA4 N;  1FK9 A;  3MN7 A;  3NMU A;  2KLA A;  1HNW K;  1OH7 A;  2OTL N;  3FZF A;  4GY2 B;  3ZSR A;  3V9U A;  3MN6 A;  5C2F A;  2PYJ A;  2ETJ A;  1HJR A;  3L0Q A;  3O3G A;  3O1B A;  4J2B A;  4AHS A;  4DG1 A;  1KAZ A;  1YIJ N;  3LZJ A;  3ITH A;  5FLX O;  3GOI A;  4XH1 A;  2BDP A;  4O4G A;  4CJQ A;  3S3O A;  3JXU A;  3THX B;  1NLV A;  3CQ8 A;  4DS5 A;  3RMD A;  4NYF A;  2BTF A;  4IJN A;  4LH5 A;  3A5O C;  4FWS A;  4U67 L;  2D0C A;  2A1S A;  3FZK A;  4BR0 A;  4LF6 K;  2HHX A;  3FLC O;  3DLK A;  4BRL A;  4F4K A;  1BDG A;  4DV6 K;  1YVU A;  4KI4 A;  4IFV A;  1VSF A;  3NE6 A;  3AVF A;  3P83 D;  3RR8 A;  3OYI A;  2GUI A;  2P5G A;  4JI8 K;  2QTD A;  3OHR A;  4BC4 A;  1KVC A;  2IDO A;  4WFB L;  1N32 K;  3SPZ A;  4B8A B;  4HUE A;  1NK4 A;  1BIS A;  4WQ4 A;  3KLE A;  1ZYQ A;  3CD6 N;  4KB1 A;  4Z94 A;  3NF8 A;  4DWI A;  3UB5 A;  1RBR A;  1LV5 A;  3Q7C A;  2Z1J A;  4DS4 A;  5GIO A;  1ZBL A;  3ENB A;  4FZY A;  3PSF A;  3CHW A;  4DQS A;  1KAY A;  1WOQ A;  1YUW A;  4DB3 A;  3QET A;  1KSP A;  1NWK A;  3NVM A;  4ID1 A;  3HVR A;  3SV4 A;  3TAB A;  3ZCM A;  5EXW A;  2P9N B;  1JLB A;  4CJK A;  1NBW A;  2O8C B;  1JKH A;  3HVT A;  3S41 A;  1QSS A;  2W6L A;  5AZJ B;  2ASO A;  4H0V B;  2JWL A;  3ENH A;  1QZ6 A;  3C7N A;  4IJA A;  4KHP K;  4EP4 A;  4WF9 L;  3E01 A;  4B3S K;  1XNR K;  2O8F B;  4FZX C;  5D3G A;  4FJL A;  1VK0 A;  4BRH A;  4AHR A;  3CCR N;  1S9E A;  4FW1 A;  4CI6 A;  3NCI A;  1Z05 A;  4C23 A;  2O8C A;  5AQO A;  4OGC A;  1JCF A;  1HLU A;  4C8O A;  4CBW A;  2B5J A;  3MED A;  3VEX A;  3VEN A;  3I8D A;  1N33 K;  3EO3 A;  1Q9X A;  3KKS A;  4BRG A;  5AQF A;  3WNF A;  1WUA A;  3PY8 A;  1YF5 L;  1U49 A;  1OVQ A;  5CZ1 A;  3L3V A;  5AQX A;  3PIO L;  1UOC A;  1VQK N;  1JL1 A;  3WXK A;  3C65 A;  4FWR A;  4FWP A;  3LP3 A;  1N6Q A;  1RDA A;  4BRA A;  2OYQ A;  4GV9 A;  3AO1 A;  3VF4 A;  5BRH A;  2YNI A;  4FLY A;  1RDC A;  4OX9 K;  4Z4E A;  3ZX3 A;  2B4J A;  1TV6 A;  2DPN A;  3LL3 A;  1K9M O;  1L3T A;  3CPW M;  1JLF A;  1HNV A;  3LDP A;  4DQQ A;  4DFK A;  2KHO A;  2IC3 A;  2E6M A;  5K14 A;  3SYZ A;  4Q0B A;  3A5N C;  3OYC A;  3N4Q A;  4DQ8 A;  5I9E B;  2KTQ A;  1TVR A;  2ZGY A;  4M3Z A;  3CCS N;  1C0U A;  2HW3 A;  2E2P A;  3AVN A;  4ISE A;  4H0T B;  3HYF A;  1KRP A;  2D0A A;  1Q81 O;  5TKY A;  1HQU A;  1CZB A;  1ITG A;  4KBO A;  3WNH A;  2OPQ A;  2I7P A;  1RT2 A;  2FXU A;  3F73 A;  4KRF A;  1DEJ A;  3LDN A;  3L2V A;  4CEZ A;  2AP1 A;  2ZQB A;  2F4V K;  3HK2 A;  4K8Z A;  4DLG A;  3C6H A;  3THW B;  3S3N A;  4JHD B;  5DK5 A;  4JEP A;  4NCG A;  4DV5 K;  4M63 C;  4YOV A;  2I5J A;  2WOM A;  3R6M A;  4CGJ A;  4IXC A;  1RTI A;  3OS2 A;  4YOU A;  3RRG A;  1XNQ K;  3HPG A;  4CJ5 A;  3MWT A;  4EZ6 A;  2DFE A;  3CJ7 A;  4IEI A;  2R7Y A;  1X9S A;  3R1X A;  3MXM A;  3RTV A;  2W40 A;  4CJT A;  4W5T A;  4KRE A;  3HPH A;  1J53 A;  2YKN A;  3K57 A;  2RPI A;  1RFQ A;  1TL1 A;  1T05 A;  4CJP A;  4BRN A;  4JHD A;  1LWC A;  4BRD A;  4FJ5 A;  3KWG A;  3VQP A;  1BU6 O;  1EQY A;  4R79 A;  2QM1 A;  4YOY A;  1GOC A;  2G8H A;  1RTH A;  4C1N I;  1X9M A;  1CLQ A;  1IJJ A;  5E26 A;  4B1U B;  3SAF A;  4K42 A;  3VQC A;  3M8Q A;  4B1V A;  1S6P A;  1G99 A;  4CIG A;  4ICL A;  4BRC A;  1JLC A;  4FYD A;  1E4G T;  4JI0 K;  4CK1 A;  3VEO A;  2E4L A;  2ZJR L;  4H4M A;  5ADX A;  1VQ9 N;  1WSF A;  2QK9 A;  1BWF O;  1NK7 A;  4C1N K;  3MEC A;  5FPM A;  3V6D A;  3ZEU B;  2VCP A;  1EO1 A;  4FVU A;  3QNN A;  4CGF A;  4AM6 A;  1JJ2 M;  3V1O A;  4DLE A;  4FWM A;  4DUY K;  1KD1 O;  4RW6 A;  5FPE A;  3THV A;  3ASM A;  1WLJ A;  3QFU A;  4GKK K;  3BZK A;  3V9X A;  1KFD A;  1VSJ A;  3ZSY A;  2WTU A;  4JI5 K;  3VGL A;  1KCF A;  4FW2 A;  4OGE A;  1NK0 A;  5E84 A;  4CJW A;  4HTU A;  3E1Y A;  3GG4 A;  3RWU A;  4BR2 A;  4FJ8 A;  1NK5 A;  5LMU K;  4KTZ A;  2DFF A;  3CJA A;  4GVE A;  3ZEU A;  1RBS A;  4YY3 K;  3T3F A;  4NLC A;  4E19 A;  1IG9 A;  1K8K B;  1Q18 A;  4DQP A;  4F3O A;  4OPA A;  3ID8 A;  4J2D A;  3AA2 A;  4JLH A;  4E7J A;  2DTU A;  3A8Y A;  2HHT A;  4CES A;  5CR4 A;  4G1Q A;  4IZ9 A;  1JLE A;  1VSK A;  3IDH A;  3EYZ A;  1WSJ A;  4IBN A;  1HMV A;  2WFB A;  2Z1H A;  3O5B A;  4BRF A;  4B9N A;  3OJU A;  3AA4 A;  3R3L A;  1UWB A;  2XRI A;  3N4P A;  4IDH A;  3EKS A;  2ITM A;  2HHQ A;  4F2R A;  3QIN A;  2YHY A;  4K25 A;  1H1V A;  2QWN A;  2UXD K;  4GMJ B;  3ATU A;  5JS2 A;  2DFH A;  2W42 A;  4LH4 A;  3VQ8 A;  1JLQ A;  3UKU A;  4CHZ A;  4RWT A;  1LWF A;  3QBW A;  4AH9 A;  3ZT2 A;  4QS7 A;  3F9M A;  1KXP A;  3AA3 A;  1OH6 A;  3NGI A;  4KHW A;  3ZT1 A;  4M3X A;  4DTJ A;  1C0M A;  1I39 A;  3WEE A;  4DFP A;  3UE5 A;  3L2W A;  3CQX A;  2FBV A;  4PL7 A;  1XI1 A;  4OO1 J;  4CHP A;  2O8D B;  4YOW A;  4O8K A;  1WN7 A;  3LZI A;  4K43 A;  4RW9 A;  4IOX A;  3U9Z A;  2NNW A;  4CGH A;  1ZBF A;  3AGR A;  4B9S A;  2ZD1 A;  3EE9 A;  3T1Y K;  2KZZ A;  3OBY A;  4HCC A;  3LAM A;  1QZ5 A;  3V4I A;  4BRP A;  2HB5 A;  5AQT A;  1D9D A;  3HO1 A;  4K8X A;  5KPR A;  5AFU A;  4MLH A;  5JIC A;  4KO0 A;  3AVH A;  1EWQ A;  5C24 A;  3VQ5 A;  3F5T A;  4L3Q A;  4CZG A;  1ZBH A;  3U3Y A;  4FJ7 A;  4JK9 A;  1NGF A;  4CF0 A;  3NH2 A;  2WUS A;  2NRV A;  4JKF A;  2QXF A;  4K41 A;  5HRR A;  1N36 K;  3DXM B;  4CEF A;  1T8E A;  2IVP A;  3SCX A;  3PLA A;  3OYE A;  5FRN A;  4DR2 K;  3E9O A;  3PX0 A;  4FJK A;  3J8A A;  3Q7B A;  2KKZ A;  1VHX A;  4JD2 A;  2P9K A;  4GV6 A;  3SV3 A;  3ZSX A;  1J5O A;  4FM2 A;  4BRM A;  2ZGZ A;  2LSN A;  1VQO N;  1RNH A;  1W9H A;  3K9J A;  3HL8 A;  3WXM B;  4DMN A;  1QHT A;  5AQI A;  3VTI A;  3JAM O;  3KHY A;  3DXM A;  3BEX A;  4E0D A;  1VRU A;  3QO9 A;  4E1J A;  4XH5 A;  3C6A A;  1VSD A;  2E2N A;  1V4T A;  1D5A A;  2NRX A;  4CZK A;  3QEX A;  4XH4 A;  2FSK A;  4JI4 K;  4OPH A;  3DWL A;  4ELV A;  1RT5 A;  2YJF A;  5BRF A;  4I6M A;  4J8F A;  1GLD G;  1LW2 A;  4JS4 A;  1QS4 A;  1ASU A;  4BVO A;  1TKD A;  1B92 A;  3SQ2 A;  3DJC A;  2QWL A;  3VA3 A;  2HMP A;  3M3Z A;  4N41 A;  3SBT A;  3CJC A;  4HUG A;  4EZ9 A;  4KAZ A;  2VWK A;  5AQG A;  5M1Q A;  5C12 A;  2UU9 K;  3AV9 A;  5EVZ A;  2G8W A;  2YI1 A;  4I7F A;  1TK8 A;  2IVO A;  4H5V A;  3OYN A;  3QIP A;  3L6Q A;  5M1P A;  3HST B;  3L4Q A;  3CCU N;  3M8R A;  1HPZ A;  2O8E A;  2EWS A;  4CED A;  4JRQ A;  1U45 A;  2ZWH A;  1K6Y A;  4JKE A;  3K5N A;  4CIF A;  3TTC A;  4FWO A;  4ILG B;  1X9J A;  3K0S A;  3D45 A;  1BI4 A;  1S9G A;  4OLB A;  1X1P A;  3KWI A;  3TAE A;  5KGW A;  2B6A A;  4LF7 K;  3TAQ A;  4H0Y B;  4BRK A;  3P31 A;  4Z0U A;  4EFH A;  1YJ9 N;  5B8H A;  3SMS A;  2OA8 A;  3B6P A;  4DR3 K;  1HNX K;  3DLH A;  5KRS A;  1E4F T;  2FBY A;  4WCE L;  1M90 O;  3SZ2 A;  4CHO A;  3KLI A;  4CK2 A;  3V81 A;  3B8A X;  4LF9 K;  4ILH A;  3RSE A;  1QHA A;  3R9P A;  3CYM A;  4BGA A;  4BE2 A;  4BR5 A;  1LW0 A;  2EHG A;  2P9P A;  4LFA K;  1XHX A;  4KTW A;  3JSM A;  1QVG M;  4CJ3 A;  2GWK A;  3PV8 A;  3AVK A;  3SNN A;  1NGG A;  5M1K A;  4QOZ B;  4O5F A;  3PX4 A;  4DSK A;  3SQ1 A;  4HTL A;  4QS9 A;  5BN8 A;  2ZE2 A;  3TSQ A;  3WXJ A;  3T1A A;  5T7B A;  4MO4 A;  3D0P A;  4A5A A;  4W5N A;  1DKG D;  3AO2 A;  3AAR A;  3SK3 A;  3RMA A;  1HYV A;  1JCE A;  3MDQ A;  2FF6 A;  4NXM K;  4RW7 A;  1S1T A;  4LC9 B;  5HOO A;  2V51 B;  4QAG A;  3ZSW A;  3VQE A;  3SI6 A;  1QSL A;  2QWM A;  5HL7 L;  3KD1 E;  3LP0 A;  4V19 S;  1V4S A;  4DR5 K;  3TI0 A;  3VES A;  3P5J A;  4DCH A;  2X74 A;  5FPN A;  3QES A;  4OKE A;  2BAN A;  4M3T A;  1ATR A;  1VSH A;  2YHX A;  2FLO A;  1IBK K;  3WXL A;  5HBM A;  4X62 K;  2A3Z A;  1LCU A;  2QI2 A;  4ELU A;  2PYL A;  1HYZ A;  1Y97 A;  4MDA A;  5AQP A;  4YOR A;  2QWO A;  3KIO A;  1TL3 A;  2P9L A;  2VGM A;  4OKJ A;  5BR8 K;  4MQ3 A;  3DM2 A;  3DOL A;  1O1W A;  3SAG A;  2P1J A;  1TKT A;  4QS8 A;  5J2M A;  1HYS A;  5CYM A;  3M8S A;  4B9Q A;  3VEV A;  4ZTJ A;  1LOT B;  4BQL A;  1YIT N;  1NJZ A;  3ULE A;  1BA0 A;  4BWM A;  3VN5 A;  5C25 A;  2YV0 X;  5C0Y A;  2RN2 A;  2OZM A;  3IAY A;  3LP1 A;  3SUP A;  1NJY A;  1A5X A;  1RDD A;  3LWM A;  1BL3 A;  2VG5 A;  1EP4 A;  3HRG A;  2FF3 B;  5AFU H;  5AQU A;  3C7N B;  3WQU A;  3U6F A;  1NK6 A;  1WNS A;  2P9S A;  1RBV A;  1BG3 A;  1TYQ A;  2QEX N;  4W5O A;  2QWQ A;  4TSX A;  3O4W A;  4DKW A;  4JK7 A;  3OYM A;  4CD1 A;  3CM6 A;  1MA9 B;  4Y0W A;  1GLF O;  3GDQ A;  4H0P A;  4RG8 A;  2HBM A;  4DV4 K;  1Q8I A;  4CZI A;  5AQW A;  1FW6 A;  2NRW A;  2CGK A;  4EHT A;  5BPN A;  5EOY A;  1C1B A;  2HBK A;  4UY8 O;  2RE2 A;  4YDU A;  4F9O A;  1RBU A;  1C0T A;  1B9D A;  4FJ9 A;  4KHS A;  3O1W A;  3FE1 A;  4OJR A;  2A6A A;  5LMN K;  4CCH A;  1VSL A;  2F9W A;  4CJV A;  1W7A A;  3EN9 A;  4Z4G A;  3EZ5 A;  3G6E N;  3OS1 A;  3QDK A;  2V7Z A;  3FZL A;  1RIL A;  1RCH A;  1D8Y A;  2W6K A;  3K59 A;  1EWR A;  1L3S A;  2OZS A;  3K9K A;  1HNZ K;  3RMC A;  1VQN N;  5AQK A;  3LP2 A;  2ZJQ L;  3CER A;  2ZF5 O;  3QFP A;  3QEP A;  4X64 K;  3KK2 A;  1XHZ A;  3BF1 A;  4BVP A;  4BDZ A;  3PIP L;  4B9U A;  4FVM A;  4JKH A;  3CF5 L;  1NOY A;  2JGU A;  3AAP A;  3VQ4 A;  4WFN L;  1XC3 A;  4KHQ A;  1OH8 A;  5FDL A;  1XMQ K;  5BPM A;  5J1E A;  4E1N A;  4XIU A;  3TTF A;  3VA0 A;  3QEV A;  4MLE A;  3TU5 A;  1NKB A;  3O4N A;  2A42 A;  4FO0 A;  1A5W A;  3CCE N;  4E1M A;  4BR4 A;  3QBX A;  3HZ6 A;  4PWD A;  3O6W A;  4B1X B;  4CFD A;  3T69 A;  1SL2 A;  3AO3 A;  3KD5 E;  1IH7 A;  3LM2 A;  4IWV A;  4N76 A;  4OLA A;  3T19 A;  3ZT3 A;  3CCL N;  4FJI A;  1ZBS A;  3SPY A;  2EX3 A;  1YJW N;  5KQ8 A;  2NLX A;  1DTQ A;  4H5W A;  4EP5 A;  3VQ9 A;  2KFZ A;  2BE2 A;  5BRD A;  2HNY A;  3CJ1 A;  4O8U A;  1TKX A;  5GIN A;  3L2U A;  3TAM A;  4JI6 K;  3DLR A;  5HRS A;  4IOA L;  3O9R A;  4F2S A;  4B1Y B;  3HP6 A;  3VQA A;  1VQM N;  3OYF A;  1VQ8 N;  5KTQ A;  3VQ7 A;  3MMV A;  2PBD A;  2GBZ A;  2X6S A;  1NM1 A;  4YDU C;  3P39 A;  2F7T A;  2Q0R A;  2CH5 A;  3ATV A;  4CHY A;  1ASW A;  4DV1 K;  1RT6 A;  3O9Q A;  4JRP A;  1LWE A;  2G8U A;  1A5V A;  1GLL O;  3VQ6 A;  3CJB A;  3HI0 A;  1JCG A;  3AGK A;  3H1Q A;  3VPZ A;  4DTS A;  2D1K A;  1S1X A;  4BDP A;  4M3R A;  3CIP A;  2YKM A;  3VTH A;  1MWK A;  3OS0 A;  4BWJ A;  4IKF A;  4M41 A;  4CZE A;  2Q0U A;  3O9U A;  4KTQ A;  4CF8 A;  4FLX A;  1WSG A;  1IV0 A;  3VET A;  4N47 A;  4BRI A;  3NBP A;  2XY7 A;  4C8K A;  2GWJ A;  4GNI A;  3TR8 A;  2P9I A;  4DV7 K;  1LAV A;  3ZT4 A;  3OYG A;  4BE1 A;  3KJV A;  4GW6 A;  4HVJ A;  1WAJ A;  3TPQ A;  1X9W A;  4B3R K;  2OTJ N;  3ZSO A;  4A2A A;  4FWN A;  3V9S A;  1BCO A;  3DOK A;  2HF3 A;  3MN9 A;  4KB0 A;  1FXX A;  3MAQ A;  4JI1 K;  1L5U A;  2HMI A;  4K0K K;  4BE0 A;  4HHT A;  4CEO A;  3EZW A;  2E1Y A;  4FM1 A;  3KK7 A;  2HVI A;  1SL1 A;  5LY3 A;  3NHG A;  3EE8 A;  3BUZ B;  1NMN A;  1HPM A;  3OVN A;  4RTF D;  3AVI A;  1ZC6 A;  3VQB A;  4PKI A;  4OPJ A;  3V9W A;  1BGX T;  3MXI A;  4DU4 A;  5AZI A;  4M7Y A;  3L4I A;  4JKG A;  3AO5 A;  4B8C A;  1IKV A;  3E9P A;  3T1H K;  4CER A;  1XC9 A;  3OYA A;  4B3T K;  5AQV A;  3DYA A;  3NFA A;  4LY7 A;  1KLN A;  4CZM A;  1SAZ A;  3CCQ N;  1VQ4 N;  1DLO A;  5DM7 L;  2O4G A;  4NXN K;  1FKO A;  3WUH A;  4E89 A;  2Q2R A;  3LAL A;  2XO7 A;  1QVF M;  1EX4 A;  3UKU B;  5JS1 A;  1ATN A;  5J2N A;  1BCM A;  4CFB A;  4JI2 K;  4FLZ A;  3CET A;  3HP9 A;  2WBN A;  5KGX A;  2XY8 A;  5GAH P;  4RW4 A;  3WEE B;  3D2F A;  2YX6 A;  2KFN A;  3V1Q A;  1LAW A;  3AAQ A;  3S3M A;  3C94 A;  4YOT A;  2UUC K;  1T6C A;  2Q31 A;  1RT1 A;  4I2Q A;  3FFI A;  3A5L C;  3HXM A;  2E8A A;  4IO8 A;  2Z1G A;  1SV5 A;  1UA0 A;  1RTJ A;  4YFU A;  3L2Q A;  3FZH A;  3OYJ A;  1RT7 A;  1NJI O;  4FPB A;  4X66 K;  2QWP A;  4ZHR A;  1NGD A;  3AO4 A;  3DLE A;  2E2Q A;  1MDU B;  3RRH A;  2HHH K;  3OY9 A;  2J4R A;  1HQE A;  4JKC A;  4BRQ A;  4RW8 A;  4W5Q A;  3CI5 A;  5AJ3 K;  4FSV A;  4NB4 A;  3S9H A;  3BY5 A;  3O9S A;  4E7I A;  5KPT A;  4IOC L;  4BDY A;  1L3V A;  1OKJ A;  4CJE A;  5GAG P;  5TKW A;  5JMV A;  5AR0 A;  3GE1 A;  3QB0 A;  3QER A;  4GVM A;  3I56 N;  4IO9 L;  4FPA A;  1Z6R A;  3O9T A;  4EAH D;  2ASM A;  4Z4F A;  4JYA K;  5AQY A;  1JXE A;  4DU1 A;  2YHB A;  5JVH L;  1NKC A;  1IO2 A;  1R59 O;  3KTQ A;  3IMX A;  4JD2 B;  4OPK A;  3H6E A;  2P9K B;  3ZSZ A;  3DMJ A;  1NGB A;  1I94 K;  3DI6 A;  5BN9 A;  3CCM N;  3IS9 A;  2QWR A;  1VSE A;  2IGI A;  3FZM A;  1NK8 A;  3SUN A;  3ID6 A;  4JI7 K;  1NGA A; 
#chains in the Genus database with same CATH homology
 4C23 A;  5AQO A;  4H5R A;  5CHI A;  1JCF A;  3E9L A;  4HTL A;  1HLU A;  1NGE A;  1VAZ A;  4QS9 A;  3MWP A;  4CBW A;  5BN8 A;  3TSQ A;  3WXJ A;  1XUP O;  3VEX A;  3VEN A;  1T44 A;  4KH6 A;  4BR9 A;  4MO4 A;  3CJ9 A;  3EO3 A;  3U4L A;  5AQF A;  4A5A A;  4BRG A;  1T3V A;  1DKG D;  1QQO A;  3AAR A;  1WUA A;  3ENO A;  3I33 A;  1T6D A;  1IG8 A;  1YF5 L;  1JCE A;  1U2V A;  3SK3 A;  3VEY A;  2V7Y A;  3MDQ A;  2FF6 A;  3D2F B;  4I6M B;  3HBT A;  5AQX A;  4B1W B;  4CBX A;  5C15 A;  5H1S Q;  4BC3 A;  3PIO L;  3DXK B;  3WXK A;  1VQK N;  3C65 A;  3D2E A;  4LC9 B;  5FPD A;  4FWR A;  2V51 B;  4FWP A;  5LJW A;  5HOO A;  4FWL A;  5BR9 A;  4PKG A;  2QWM A;  1ZXO A;  2W41 A;  5HL7 L;  4BRA A;  3A0I X;  4GV9 A;  2CGL A;  4JAX A;  3VF4 A;  4A57 A;  5BRH A;  2E20 A;  1V4S A;  3D7E O;  3MCP A;  3VES A;  4DCH A;  1BOT O;  4FL9 A;  4ILJ A;  3G4S N;  3ZX3 A;  5FPN A;  3VGK A;  4ISF A;  3I55 N;  1Q86 O;  2DPN A;  3LL3 A;  1K9M O;  2NZT A;  3HSC A;  1ATR A;  2YHX A;  4PKH A;  2FLO A;  3TTD A;  3VEZ A;  3CPW M;  1J6Z A;  3WXL A;  4MO5 A;  5JLH A;  2A3Z A;  1LCU A;  2QI2 A;  1N8R O;  3LDP A;  4H0X B;  3DXK A;  3CME N;  2KHO A;  4MDA A;  5AQP A;  3HOT A;  4YOR A;  2QWO A;  3HM8 A;  3A5N C;  3E66 A;  2P9L A;  3N4Q A;  4DQ8 A;  2VGM A;  1YHQ N;  5I9E B;  1KAX A;  3JS6 A;  2P9U A;  3O08 A;  1SZ2 A;  2ZGY A;  3CCS N;  2QW9 A;  4JK8 A;  3CCJ N;  3EKU A;  1ATS A;  3LM9 A;  4XEI A;  2E2P A;  3CC7 N;  3SAG A;  3GBT A;  5F1X A;  4ISE A;  4QS8 A;  4H0T B;  3VER A;  3H46 O;  4EHU A;  3OA9 A;  4A62 A;  1YAG A;  5AQN A;  1Q81 O;  5TKY A;  3VF2 A;  4B9Q A;  4KH4 A;  3VEV A;  1VQ7 N;  1LOT B;  2GUP A;  4KBO A;  3OW2 M;  4BQL A;  1YIT N;  3ULE A;  1BA0 A;  1GLJ O;  3FGU A;  3WT0 A;  1HJO A;  1GLB G;  5JLF A;  3ZET A;  5C0Y A;  4CD3 A;  2I7P A;  3G25 A;  3HTV A;  1W97 L;  4YOX A;  1X3N A;  2FXU A;  4KH5 A;  1GLC G;  1K8K A;  3VGM A;  1C0G A;  1DEJ A;  3LDN A;  2HF4 A;  5KQD A;  2AP1 A;  4DHY A;  3RSE B;  4MDB A;  1QVG M;  5AFU H;  1O13 A;  3HRG A;  2FF3 B;  3WQU A;  5AQU A;  3C7N B;  4H5N A;  3C6H A;  3KVG A;  2P9S A;  3MX5 A;  4JHD B;  1BG3 A;  2ASP A;  1TYQ A;  3H45 C;  4JEP A;  4BG8 A;  3CCV N;  1Q82 O;  2RHK A;  2QWQ A;  5DM6 L;  2QEX N;  5AQZ A;  3LDQ A;  2P9P B;  3O4W A;  4M63 C;  4WYB A;  3R6M A;  4JK7 A;  4DKW A;  4YOV A;  3SBG A;  2VYP A;  4CD1 A;  1MA9 B;  4IXC A;  4Y0W A;  1GLF O;  3GDQ A;  4H0P A;  2HBM A;  4YOU A;  4CZI A;  3MWT A;  4B1Z A;  3CJ7 A;  4IEI A;  1C0F A;  5AQW A;  3W3D A;  2NRW A;  3SAH A;  3R1X A;  2A5X A;  2CGK A;  3CPE A;  1YXQ A;  4H5T A;  4EHT A;  1VQL N;  1S22 A;  2W40 A;  5EOY A;  3C0B A;  5BPN A;  1YI2 N;  2HBK A;  4FWK A;  4IFE A;  5KPZ A;  4UY8 O;  1ESV A;  2RE2 A;  4A5B A;  4YDU A;  4F9O A;  3EL2 A;  3DAW A;  3H3O B;  3O1W A;  3FE1 A;  5GAE P;  1RFQ A;  2NRT A;  4FOE A;  1U2V B;  2NRZ A;  2A6A A;  4EIA A;  4BRN A;  2GX9 A;  4JHD A;  1HUX A;  4BRD A;  3KWG A;  2F9W A;  2IIR A;  1BU6 O;  2Q97 A;  1EQY A;  3D2E B;  3EN9 A;  4HWI A;  4R79 A;  2QM1 A;  4YOY A;  2CGJ A;  4NLB A;  3G6E N;  3J7Z O;  2FSJ A;  3VEW A;  3QDK A;  4C1N I;  4ISG A;  5AQR A;  1IJJ A;  2V7Z A;  3FZL A;  5E26 A;  2E1Z A;  4A61 A;  4B1U B;  3M1F A;  3SAF A;  4K42 A;  2D0P A;  4B1V A;  1Y64 A;  3K9K A;  1VQN N;  4BRE A;  5AQK A;  1G99 A;  5CE3 A;  4BRC A;  2ZJQ L;  3CER A;  1E4G T;  2GEM A;  4U7B A;  2ZF5 O;  3QFP A;  1YVN A;  1HX1 A;  3VEO A;  2ZJR L;  3BF1 A;  5ADX A;  4BVP A;  1VQ9 N;  3PIP L;  1BWF O;  4JKH A;  3CF5 L;  2PAV A;  3P4I A;  3AAP A;  4C1N K;  4WFN L;  1XC3 A;  5FPM A;  3UKR A;  5F0X A;  3ZX2 A;  3ZEU B;  2VCP A;  5BPM A;  1EO1 A;  4FVU A;  4CJ7 A;  3TTF A;  4AM6 A;  1QQM A;  1JJ2 M;  2P9L B;  4MLE A;  4FWM A;  2P9U B;  3TU5 A;  4FO0 A;  2A42 A;  1RDU A;  4AM7 A;  3TSU A;  2GTD A;  3CCE N;  3CQY A;  3KZB A;  4BR4 A;  3DLL L;  1KD1 O;  5M1O A;  3QBX A;  2HOE A;  5FPE A;  1MWM A;  2E2O A;  3QFU A;  3HZ6 A;  3O6W A;  4IEE A;  4B1X B;  3T69 A;  4BR7 A;  4H03 B;  2ZJP L;  3VGL A;  3LM2 A;  4BY9 C;  4IWV A;  1W2B M;  2H3G X;  2F9T A;  5E84 A;  3E1Y A;  3SMP A;  1VQP N;  3CCL N;  4NO7 A;  1ZBS A;  3GG4 A;  3ULE B;  4BR2 A;  1YJW N;  3U9D A;  5KQ8 A;  2NLX A;  3ZET B;  3CJA A;  4GVE A;  3ZEU A;  3HOS A;  4H5W A;  4NLC A;  3ZYY X;  1X3M A;  1K8K B;  2AA4 A;  1Q18 A;  3NVK A;  4JKD A;  4OPA A;  5M1F A;  1BO5 O;  3ID8 A;  5BRD A;  3CJ1 A;  4FWQ A;  4O8U A;  5GIN A;  2P9S B;  3A8Y A;  2BH1 A;  5LJV A;  3WXI A;  1TYQ B;  3O9R A;  4IOA L;  2YJE A;  5CR4 A;  1DT9 A;  3FR0 A;  4IZ9 A;  4B1Y B;  2Q36 A;  1VQM N;  1VQ8 N;  3IDH A;  4CZL A;  3BF3 A;  4JNE A;  2WFB A;  3O5B A;  4BRF A;  3R3L A;  3MMV A;  2PBD A;  2VGN A;  2WC9 A;  1D4X A;  4WQ5 A;  1NM1 A;  3N4P A;  4YDU C;  4IDH A;  3EKS A;  3P39 A;  2ITM A;  1K8A O;  2F7T A;  5EY4 A;  2Q0R A;  3LDL A;  3VOV A;  1XQS C;  2CH5 A;  2GEL A;  2YHY A;  2I7N A;  3AY9 A;  3H3N O;  2Q1N A;  1H1V A;  2QWN A;  4K25 A;  3ATV A;  3ATU A;  2CH6 A;  3O9Q A;  1HKG A;  3OBW A;  1YJN N;  5F2R A;  4CZF A;  3M6G A;  3LDO A;  3UKU A;  4RWT A;  3QBW A;  4QS7 A;  3F9M A;  1KXP A;  1GLL O;  3CJB A;  4JKB A;  3HI0 A;  2A41 A;  3FFK B;  1JCG A;  3AGK A;  3H1Q A;  3MX2 A;  4A2B A;  3D6R A;  4M7X A;  3VPZ A;  2D1K A;  3G71 N;  1K73 O;  2OAN A;  2V52 B;  3WEE A;  3M5R A;  1KQS M;  3CIP A;  5AQS A;  3R8E A;  3UE5 A;  3W0L A;  3WQT A;  3MK6 A;  3CQX A;  3VTH A;  3TSP A;  1MWK A;  4BRO A;  4PL7 A;  3SLC A;  3I8B A;  2HBJ A;  3H1V X;  4CZE A;  2Q0U A;  3O9U A;  4OO1 J;  4YOW A;  4O8K A;  3RVC A;  5AQH A;  5AQJ A;  4K43 A;  2IVN A;  4IOX A;  3VET A;  3U9Z A;  2NNW A;  4BG9 A;  4BRI A;  1VQ6 N;  3IKM A;  3AGR A;  1P90 A;  2GWJ A;  4GNI A;  1HKB A;  3A5M C;  2P9I A;  3EE9 A;  4CZH A;  1M1K O;  3OBY A;  3UKR B;  4BGB A;  2YCH A;  5ADX H;  1QZ5 A;  1NGI A;  1GLA G;  4BRP A;  2JWK A;  5AQT A;  1OVY A;  1BA1 A;  2E88 A;  3ZX0 A;  5KPR A;  5AFU A;  3MCA B;  3TPQ A;  4MLH A;  2OTJ N;  5JIC A;  4A2A A;  2NRH A;  3CC4 N;  4FWN A;  4BC2 A;  2HF3 A;  3MN9 A;  1NGH A;  2VWB A;  2D4W A;  3CC2 N;  3F5T A;  3BP8 A;  4L3Q A;  4CZG A;  3VF6 A;  4JK9 A;  1NGF A;  2WUS A;  4BQZ A;  2NRV A;  1SS6 A;  3MN5 A;  4JKF A;  3CMA N;  4K41 A;  5M1N A;  3DXM B;  2IVP A;  1U6Z A;  5MLC Q;  3EZW A;  3PLA A;  2E1Y A;  2P9N A;  3KK7 A;  3E9O A;  5LY3 A;  3EE8 A;  1NGJ A;  3BUZ B;  5AQQ A;  1KC8 O;  1HPM A;  5JVG L;  1BUP A;  3J8A A;  3P38 A;  4RTF D;  3Q7B A;  1ZC6 A;  2KKZ A;  4FOI A;  4PKI A;  5AZJ A;  4JD2 A;  5GAD P;  1S72 N;  2P9K A;  4GV6 A;  3QIC A;  5AZI A;  4M7Y A;  3F2K A;  3L4I A;  5AQL A;  5EX5 A;  4WQ5 C;  1ILY A;  4JKG A;  4BRM A;  2ZGZ A;  2QA4 N;  2YHW A;  3T7Z A;  3QML A;  1VQO N;  3MN7 A;  3E9P A;  3K9J A;  4CZJ A;  4PHT X;  3NMU A;  3WXM B;  5AQV A;  2KLA A;  4G9Z A;  2OTL N;  3FZF A;  4GY2 B;  4CZM A;  1SAZ A;  5AQI A;  3VTI A;  3CCQ N;  1VQ4 N;  3KHY A;  3MN6 A;  5C2F A;  3DXM A;  1DGK N;  3BEX A;  5DM7 L;  3L0Q A;  3O1B A;  3WUH A;  2Q2R A;  4E1J A;  3VMF B;  4XH5 A;  5BRE A;  1KAZ A;  1QVF M;  1YIJ N;  3UKU B;  1NMD A;  1Q7Y O;  2UYT A;  1ATN A;  2BUP A;  3C6A A;  3GOI A;  2E2N A;  3GL1 A;  1V4T A;  4XH1 A;  2NRX A;  3CXC M;  2NRR A;  4CZK A;  4XH4 A;  3JXU A;  2FSK A;  1NLV A;  4OPH A;  3CET A;  3DWL A;  2WBN A;  5BRF A;  2YJF A;  5GAH P;  4JN4 A;  3WEE B;  3D2F A;  4I6M A;  4J8F A;  1GLD G;  2BTF A;  2YX6 A;  4IJN A;  3AAQ A;  3A5O C;  1P8Z A;  4WQ4 C;  4FWS A;  4YOT A;  4U67 L;  4BVO A;  1T6C A;  2Q31 A;  4BC5 A;  3DJC A;  3FZK A;  2QWL A;  2HBL A;  4BR0 A;  4WFA L;  2HMP A;  3M3Z A;  3A5L C;  3SBT A;  3CJC A;  5C2D A;  2E8A A;  4IO8 A;  4GV3 A;  3FLC O;  1RGI A;  2HST A;  5AQG A;  1HKC A;  3FZH A;  5M1Q A;  4BRL A;  1BDG A;  2P9I B;  5C12 A;  4FPB A;  1NJI O;  1CZA N;  2QWP A;  5EVZ A;  2YI1 A;  3O80 A;  1NGD A;  4PL8 A;  2IVO A;  4H5V A;  2E2Q A;  1MDU B;  2QTD A;  3OHR A;  3L6Q A;  2D0O A;  2J4R A;  3L4Q A;  4JKC A;  5M1P A;  4BC4 A;  3CCU N;  4BRQ A;  5GIP A;  3CI5 A;  2EWS A;  4FSV A;  4NB4 A;  4WFB L;  3O9S A;  2ZWH A;  4JKE A;  3U8X A;  5KPT A;  4IOC L;  1OKJ A;  3TTC A;  4A59 A;  4FWO A;  2PFU A;  4ILG B;  5TKW A;  5GAG P;  5JMV A;  1X9J A;  3IFR A;  3IUC A;  5AR0 A;  3GE1 A;  3QB0 A;  3O8M A;  4WQ4 A;  5ELZ A;  1QQN A;  3I56 N;  3CD6 N;  4Z94 A;  3KWI A;  4IO9 L;  3SJH A;  4FPA A;  3UB5 A;  3Q7C A;  4CBU A;  1Z6R A;  5GIO A;  3ENB A;  1S3X A;  2A40 A;  3O9T A;  3CHW A;  1KAY A;  1WOQ A;  1YUW A;  4DB3 A;  4H0Y B;  4BRK A;  1NWK A;  4EAH D;  3NVM A;  3P31 A;  2FSN A;  1TUU A;  4H0O A;  5EXW A;  1RDW X;  2ASM A;  2P9N B;  4EFH A;  1YJ9 N;  5B8H A;  3SMS A;  1NBW A;  1SQK A;  5AQY A;  3S41 A;  1E4F T;  5JVH L;  5C10 A;  4WCE L;  1M90 O;  1R59 O;  5AZJ B;  3IMX A;  4JD2 B;  3H6E A;  2P9K B;  5AZI B;  4AF1 A;  2ASO A;  4H0V B;  3B8A X;  1TUY A;  4ILH A;  1NGB A;  4JKA A;  3RSE A;  2JWL A;  1QHA A;  4JKG B;  3ENH A;  4RCH A;  1QZ6 A;  3C7N A;  3R9P A;  4BGA A;  4IJA A;  4BR5 A;  5BPL A;  5BN9 A;  4WF9 L;  3CCM N;  1NGC A;  2P9P A;  2QXL A;  2QWR A;  5AQM A;  2GWK A;  3FZM A;  4BRH A;  1VQ5 N;  1NGG A;  3CCR N;  5M1K A;  4CI6 A;  1GLE G;  1Z05 A;  4O5F A;  3ID6 A;  1NGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...