3N4PA

Human cytomegalovirus terminase nuclease domain
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
246
structure length
216
Chain Sequence
b'LITDQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAGTGVAAVGAYRHQFLIYGLEHFFLSESSEVAIAECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTLIRVLFYHTPDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQIQNLHRSDDLIIAVIMATYLCDDIHAIRFRVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Terminase subunit UL89 protein
publication title Structure and inhibition of herpesvirus DNA packaging terminase nuclease domain.
pubmed doi rcsb
source organism Human herpesvirus 5
molecule tags Dna binding protein
total genus 73
structure length 216
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.320 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3n4pA00
4IOXA 3N4QA 3N4PA
chains in the Genus database with same CATH superfamily
3LWLA 2W42A 3RRHA 3CCEN 3DLBA 3ZYYX 5AZIB 3UKRB 4B3TK 2GELA 2AJQA 1NG9A 5LMNK 1E3MA 3CJ7A 4JKHA 4ICLA 1UA0A 2YCHA 3SUOA 4KI6A 4BE0A 2NRTA 2YNGA 3A5NC 4DB3A 4FM2A 2O8CA 4E7JA 3RSEA 4FJHA 3ID6A 1EKEA 4DQ8A 3HI0A 4NLBA 4CI6A 4JI6K 3FZMA 4IXCA 3SQ1A 3ZSYA 3EY1A 4CJRA 3VQQA 1U49A 3ZLJA 5FRNA 2UUCK 2KHOA 1VSMA 3K5MA 3PSIA 4JK9A 2Q0RA 1GOAA 1SV5A 3QBWA 3M8PA 2WUSA 4BRPA 4LF9K 3QIOA 4CIGA 1B9DA 1DEJA 4O4GA 5C42A 1Z6RA 4FM1A 3MMVA 1NJIO 5HOOA 2LSNA 2IVPA 5J1EA 4BRNA 1NGEA 4JKEA 3L3UA 3EZ5A 5GINA 2YNFA 3CM6A 1KLNA 2IGIA 4CGIA 3SQ4A 4BR0A 5ADXH 4CVNE 3NH1A 2P9LB 3KD5E 3KHYA 3K9KA 3CXCM 4WF9L 1KVBA 3HRGA 3G6EN 1D8YA 4EP5A 3VQAA 4CJ4A 1Z25A 1NGFA 4Z4CA 2OANA 1U6ZA 4CJ3A 3LP3A 1YI2N 3G25A 4JKBA 3HP9A 2GUPA 5H1SQ 4DFKA 4KAZA 4FK4A 3NGZA 4BC3A 1VSDA 1J6ZA 1BI4B 1BO5O 1C0TA 1WSGA 4BY9C 1XHZA 4CK1A 3QINA 2HOEA 1NWKA 1BWFO 4H0VB 1U04A 3N4PA 4Z4HA 4IFYA 3Q7BA 3MEDA 5T7BA 4C8NA 3CIPA 5HRRA 2VGMA 2B6AA 2E20A 1IG8A 2XHBA 3RTVA 1VQNN 3B6OA 4BROA 1G15A 2F9TA 3CC7N 3QDKA 3F73A 3H46O 3Q7CA 4Y0WA 3VGKA 3VETA 4F9OA 2ZJPL 3SUNA 3HTVA 3DAWA 4BGBA 1L5UA 3CFRA 2RF2A 2YKMA 3C0BA 2O8FA 1Q86O 3ZT0A 4JK8A 4FM0A 1Y64A 3ID8A 3BY5A 1ZBHA 3EE8A 5BPMA 1EP4A 1KFDA 5EY4A 2ZJQL 4CW7B 5AQKA 2UXCK 3OS0A 1RT3A 4JKGB 3CMAN 2HHWA 2P9KB 1NGCA 3FGUA 4CGHA 3QBXA 4AM6A 3ASMA 4CFCA 1VQ4N 2ASMA 3SLCA 4C1NK 1O13A 3H6EA 3EL2A 1XC9A 1ZBIA 2A42A 4I9LA 4MFBA 3BGRA 1Q8IA 3T1HK 4CJ5A 1YVNA 3T1YK 1BG3A 3CG7A 3VQ5A 3EYZA 3CCVN 1NK6A 2XY7A 1IKXA 4LF5K 3WNHA 1KC8O 5D3GA 3K0SA 4J2BA 2Q3SA 1QVFM 3VEYA 4CFDA 5I42A 1U2VB 4BREA 3P1GA 3T1AA 4H0PA 4DTRA 3FFIA 4KO0A 4WFBL 4F2RA 2I7NA 3PIOL 4A2AA 4KPYA 4A5AA 4CF0A 3CHWA 4I9QA 4B9MA 3DM2A 3SBTA 2I5JA 5FPDA 1LAWA 2A41A 1NGBA 4FK2A 1NK9A 4BRQA 3AA5X 4JYAK 3AAPA 4DTPA 4DV0K 2YX6A 3ZT3A 1U45A 2BE2A 4LY7A 2O8CB 3B8AX 1BIUA 1BQNA 3MCAB 3ULEA 4EHUA 4UY8O 1KSPA 2A6AA 2ZD1A 4OGCA 3HT3A 4DSEA 1C0MA 3DI6A 1K8AO 4BVPA 2ITMA 4OLAA 1NGHA 3NHGA 3IRXA 3ZSRA 1JL2A 5B8HA 4NYFA 3D7EO 1N36K 1IBMK 1TAQA 3OBYA 3BUZB 4CJEA 3THWB 4X64K 3C7NA 1NJYA 4JI1K 4QS9A 3E66A 1D4XA 1IH7A 4W5TA 4F4KA 1KLMA 3R6MA 4BVOA 2JGUA 3U9ZA 4QAGA 1NGIA 1R59O 5JVHL 4E89A 4A2BA 3CQXA 3CCRN 3WXMB 1T05A 1LWCA 4H5TA 4EHTA 2YHYA 5LJVA 1OVQA 2VWJA 3AY9A 4DR6K 2W6LA 1RDCA 4OGEA 4Q0BA 5AQXA 4NYNA 5AQQA 5HRPA 4CCHA 5KQ8A 1JLFA 2QKKA 3BF1A 3OJUA 1Q81O 1RDDA 3GOIA 3HM9A 1TYQA 4FJKA 2VGNA 3PIPL 3CPWM 2D0AA 5ADXA 4AHSA 3NH2A 4JEPA 4PUOA 3P83D 4NO7A 5KGXA 4BWMA 3VQ6A 2YKNA 4AQYK 2PYJA 1VQON 2YHXA 1IKWA 4K41A 2HSTA 3M5RA 1HJRA 5AQOA 4O55A 1BA1A 4M63C 3I8DA 4MO4A 5GIPA 2XRIA 4C23A 4MLEA 5CHIA 3VQ9A 4FLWA 3TANA 3A5MC 1M1KO 3TAGA 3THXA 4DTNA 4FLUA 3FLCO 1VQMN 3LDOA 3RMAA 1SZ2A 4M3WA 4JHDA 3KKRA 4G1QA 2HF3A 4U7BA 2Q0UA 5I9EB 2X6SA 1RT1A 2AA4A 1NLVA 3KLIA 2E6MA 2WC9A 2P1JA 3ZSOA 5BREA 4HHTA 3MXIA 3O6WA 1ITGA 4HTUA 1J9AA 2R7YA 4BQZA 4CERA 4CZIA 1X9MA 1Q82O 4RW8A 3T7ZA 4AHCA 3O9QA 4KB1A 2GV9A 3LDLA 4B8CA 3TI0A 1VQ5N 4BWJA 1Z05A 4KBOA 3RR7A 3JSMA 1RFQA 4FLVA 3DWLA 3P39A 2NNWA 3WNGA 5AQPA 4JI4K 4BRMA 3LL3A 1S6PA 3W0LA 1JJ2M 2BDPA 3NF8A 2IOCA 4DR5K 1GLAG 3SUQA 2A1SA 4O0IA 1JLAA 2EWSA 3KD1E 3JAMO 5LMUK 1FJGK 3A0IX 1NMNA 3ZX2A 3LM9A 3V4IA 4Z0UA 3CERA 2NRZA 1VSJA 3VQEA 1FKPA 5HP1A 3H08A 4B9NA 1RBUA 4M3YA 4BC4A 4R79A 2V7ZA 1NJWA 3VQ4A 1T03A 4O5BA 1HR0K 1BUPA 4PL8A 1RCHA 5E41A 2UUBK 3CPEA 3SPYA 3C6TA 5AR0A 3O3FA 1HRHA 3IUCA 4DS4A 4I7FA 2JWKA 1YF5L 2CH5A 2W6KA 4FWMA 4KH6A 4W5QA 4A59A 2QWQA 3KJVA 3G71N 4CHZA 4KB0A 1CXUA 3PUFA 4TSXA 2NRWA 3H1QA 3OBWA 4BRAA 4CBWA 1WOQA 1S1XA 1HJOA 3HSTB 1QSYA 1KXPA 4U67L 4NXMK 4F3OA 2P5GA 2F96A 2IDOA 1NKEA 5GAEP 1IBLK 3NH0A 1VQKN 3TAQA 3NE6A 4JRQA 4QS7A 3A2FA 3WXKA 2QWNA 1SQKA 4OPHA 3U3GA 4DQQA 4IDHA 3IAYA 3MN5A 3A5OC 4BC2A 3MDQA 3D2EB 1OH8A 5BR8K 2P9LA 3O5BA 1EXQA 3AVBA 5KPZA 3EE9A 2O8EB 1HQUA 3HYFA 4E3SA 3ULEB 1RNHA 3P5JA 2ZQBA 3PV8A 1RILA 1A5VA 4KHUA 3CD6N 4B1YB 2HMPA 3TTDA 2QWLA 4JKCA 4ILHA 4HTLA 4EIAA 4C8MA 3NAEA 4FPBA 4KHWA 4ZTJA 2EHGA 4N5SA 1BI4A 2RN2A 2HBMA 1SKWA 4FOIA 3OYJA 2OZMA 4FZZA 1RT4A 4BG9A 4B1XB 2DTUA 2UXBK 3OJSA 1N8RO 2VG7A 1S72N 3C94A 2Q97A 2JWLA 3U9DA 1YXQA 2P5OA 4M45A 4CK2A 2QM1A 1S3XA 3EKUA 4H5WA 1NK5A 4CZFA 4BRKA 3VTIA 1GOBA 1M90O 2DFFA 3VN5A 2VQFK 1BGXT 1JLBA 2HHHK 3VERA 3DLLL 4EZ9A 1SKSA 1MWMA 2A1RA 2F8TA 3AO5A 1N32K 3MECA 2O8BB 4OJRA 2WONA 3ATUA 1BISA 1I94K 3LPTA 2KW4A 4KHYA 2FF3B 3G10A 1HKCA 4EZ6A 4WYBA 3P31A 4FJIA 3OYDA 4MO5A 1NU0A 4KTWA 4DCHA 3O9RA 4JKGA 2HHVA 3IFRA 1HNXK 5BPNA 4L8RB 5C12A 1TKZA 3LDQA 1BOTO 4YFUA 3RMBA 1JL1A 1BL3A 1QHTA 3SQ0A 4DR7K 2KLAA 3KK7A 3LANA 1T6DA 3ATVA 4AHVA 4IO9L 2ASOA 3HVRA 1KFSA 3MX5A 4QCLA 3QEVA 1QQCA 4H0OA 4B8AB 3EO3A 3LPUA 3CCUN 4DF8A 2P51A 2QA4N 3SJJA 1IKYA 3N4QA 5AQHA 2KQ2A 3M8RA 3K58A 1U2VA 5M1PA 1XMQK 1V4TA 4BE1A 4QOZB 3MXMA 3G0ZA 4BACA 4GV6A 4JI8K 4CZJA 1OH5A 3KK3A 4Y1CA 4LF8K 3IDHA 1FXXA 3T19A 1RTHA 3O08A 3NF9A 3QFPA 3ZT1A 3LWMA 2GBZA 3S3MA 3OTOK 4DTOA 4JD2A 2A5XA 1LW2A 1TKDA 4NB4A 5HROA 1C1BA 1HX1A 4DSIA 1TL1A 1X9JA 4J2EA 4FWOA 4E7HA 3D2FB 1RDBA 2V7YA 3TTCA 3O1WA 5BN9A 1TUUA 3MN6A 4ISEA 3THYA 1VSHA 4H5RA 3THWA 4H03B 1XMOK 2P9SB 4JS4A 1NKBA 1O1WA 1LCUA 3VMFB 4E19A 3E9OA 3SV3A 3VTHA 3AA4A 2NUBA 4L3QA 4Q5VA 3O3GA 1HKGA 1DLOA 3L2QA 1YUWA 1JXEA 1RBTA 2VG6A 2HNYA 4BRCA 4BRDA 2P9UB 5DK5A 5AJ3K 3TR8A 3VF4A 5AQUA 2HNZA 3KIOA 4DV1K 3AVGA 3IG1A 4JKFA 1Y97A 3UB5A 4LSLA 4PA1A 4JN4A 4CIEA 4KTZA 2RKIA 5LL6Z 1NMDA 3E9PA 1YJWN 4Z4IA 3OYHA 4DSLA 4FWPA 4MLHA 5F2RA 3CCSN 4CJUA 5KPRA 3LDSA 2OPPA 4KH5A 3OYEA 2FC0A 2VWBA 2NRRA 2HHSA 3HPGA 3S3OA 4M41A 3NGIA 3EEQA 5CE3A 3VQBA 3O1BA 3AVFA 3QESA 1WSIA 2O4GA 3BDPA 5C2DA 4M3UA 3S9HA 3HPOA 4FJNA 3A8YA 3WNFA 2YI1A 4BC5A 4FLTA 2HHTA 1WB9A 2CGKA 3TAPA 1QSLA 4AM7A 3HVTA 5BN8A 3P4IA 3MEGA 4OPAA 4V19S 3FFKB 5E26A 1JLCA 4AILC 1YT3A 3SCXA 1WSFA 1VRTA 1ZBFA 1ZXOA 3VEXA 1OH6A 2DY4A 2KZZA 4H0YB 3L8BA 3CJ1A 2PAVA 4I2QA 4BR5A 1VQ9N 1QE1A 5BPLA 4CHQA 4K8XA 4IWVA 4IEIA 2FLOA 4B9SA 4JV5K 1D9DA 1QZ5A 1JCGA 3LZIA 4CJKA 3HPHA 1TGOA 3OYNA 1C0GA 1QQOA 1S1VA 4CHNA 2Y1JA 2G8IA 1H1VA 1N33K 1S6QA 1QVGM 5AQTA 4LFCK 3SK3A 2BANA 2E8AA 2YNHA 4CJ7A 5BRFA 4CESA 4JI0K 4JRPA 3C6HA 4GKJK 1NOYA 3ITHA 3L4IA 4B3RK 4FZXC 1ZBUA 4CEOA 1VQ7N 4RCHA 5AQMA 1P90A 2Q31A 3HXMA 3CJBA 5AQIA 3C65A 1HNIA 3V9WA 4HCCA 3DLRA 2FXUA 5J2QA 2HBLA 4XH1A 3AO4A 1XWLA 5EVZA 3WEEB 4ZHRA 1XNQK 2KTQA 1LWFA 1MDUB 4E7IA 1BCOA 4BRHA 3SAFA 2P9NB 4CGFA 3NF7A 3SAHA 3HO1A 4PY5A 4IOXA 3AVKA 4QS8A 3HP6A 4OKJA 3R3LA 3VA3A 1VSKA 3OYCA 3VGMA 4CJSA 5JVGL 4IKFA 4DU4A 1N34K 2QWPA 4AHRA 1RT5A 3EN9A 4WQ4C 4B1WB 3OY9A 2CGJA 1C0FA 1ZBLA 1HPZA 3DRRA 4HUGA 3RWUA 4Z94A 1JCEA 4C8LA 4DHYA 1DTTA 4KI4A 3D2EA 4IO8A 3EKSA 4DTJA 4JD2B 4CZKA 5K14A 1P8ZA 4YDUA 2G8VA 1MWKA 2O8EA 4CJLA 4IEEA 1ATRA 2B5JA 4ILJA 4W5RA 1TKTA 1RTDA 1W9HA 4AH9A 1J54A 1X3MA 4GY2B 2P9IB 5AQWA 3THYB 3MN7A 3VENA 1IV0A 4FLZA 3WXLA 3ZX0A 1FK9A 3DLGA 4OVLA 4DG1A 2DFEA 1QHAA 1GLFO 4KFBA 1S9EA 3L2UA 3FE1A 4FWLA 2NRVA 3NMUA 4GKKK 2NLXA 5CR4A 3AA3A 2OTLN 4CF1A 4CZHA 1SKRA 3QEPA 4CGDA 2HNDA 4JAXA 4FWQA 1K9MO 1NK4A 4IJAA 1XUPO 1TK8A 1Q9XA 3HSCA 5C24A 4B9UA 4IFEA 5F1XA 3OYIA 3I56N 4F8RA 3ZSQA 4CGGA 2QTDA 3O9SA 3KVGA 5DM7L 3TARA 2ASPA 3CCJN 4HCBA 3S41A 4NLCA 4DV4K 3KK1A 3WQTA 4WE1A 1QZ6A 1KAYA 4KHPK 4RW4A 2O8BA 1YVUA 1YJ9N 1T3VA 1LV5A 2PY5A 4LC9B 1KAZA 3J80O 1BIZA 4HUFA 4PL7A 3KWGA 1WBDA 1RDAA 5CYQA 3KLEA 3TPQA 2IAJA 1DGKN 2HW3A 4FPAA 4DF4A 3TAEA 1OVYA 1S22A 2G8FA 3DXMB 4FLYA 4CZGA 1NJZA 4WFAL 4DTUA 4GVEA 2OCEA 1UAXA 5FPEA 2OZSA 3OYAA 3OYGA 1RTIA 4CEZA 4ZTFA 4KHQA 1SAZA 3RMCA 2OA8A 5C15A 4ELUA 2E1YA 3NDKA 4CEAA 1ASUA 2NRXA 4FJXA 4CHOA 3LAKA 1OKJA 4CFBA 5MLCQ 4DR1K 1LWEA 3KLFA 3WUHA 2G8HA 4CEEA 1ESVA 4JKAA 3SI6A 4FJ7A 3KLGA 3NGYA 4ILGB 4OO1J 3ULDA 1LOTB 3O8MA 3R9PA 4CJPA 3S3NA 4N41A 2KKZA 2UUAK 1KQSM 2FSKA 2YHAA 1WUAA 4M42A 3W3DA 1TV6A 1CXQA 2NZTA 2OPRA 3LDPA 1QTMA 5ELZA 4BQLA 3AVHA 2VG5A 3F5TA 3K5NA 5E84A 1QS4A 1RT2A 3DLEA 4RW7A 4BR4A 5HRSA 4WFNL 3VQPA 1NK8A 3VGLA 3O9TA 4B3SK 3D2FA 4FO0A 3LP2A 4PKHA 1OH7A 4E1NA 2UYTA 2GX9A 2OPSA 3V1OA 1YAGA 3ZETB 5DMRA 5FPMA 2P9SA 2FF6A 4DU3A 3TAMA 3TWHA 2QK9A 2QXFA 3U4LA 4CK3A 4LF7K 4FCYA 1T8EA 4J2AA 3ENOA 3L2WA 3MX2A 2BH1A 4DTSA 4CBUA 3AVMA 1GOCA 4EFHA 1XI1A 4DSFA 4BGAA 1C6VA 1BCMA 3O4NA 2CGLA 4IZ9A 3AA2A 5C2FA 3L2RA 4ID1A 1WSJA 3HM8A 2WBNA 4ISFA 2P9UA 2GUIA 4H4OA 4LH4A 2O8DB 1D5AA 4JLHA 4GV3A 1KAXA 4LH5A 3QFUA 4MDAA 3GE1A 1CLQA 4YHHK 1BU6O 3IMXA 1XHXA 4LF4K 1C1AA 3V9ZA 1BHLA 3QERA 1EX4A 3DYAA 5DM6L 1CZAN 4YOUA 1SL0A 3HJFA 1K8KB 4XH5A 4FJ8A 1W0HA 4ID5A 4K8ZA 4DTMA 1ASWA 3J7AP 5AQZA 2Q2RA 2ZWHA 4WQ4A 2YJFA 4GVMA 4DMNA 5LJWA 3NFAA 4O5FA 3AGKA 3PX4A 3VESA 2D0BA 3F9KA 1A5WA 1HMVA 2BTFA 2IIRA 3LP1A 3TAFA 3TSUA 3VEWA 2FSNA 3C6UA 3SNNA 5KQDA 4OKEA 1VQLN 3G4SN 2E4LA 5F0XA 4PKIA 3SMSA 3GL1A 3P38A 2J4RA 3CM5A 4DSJA 4DSKA 3D0PA 1EO1A 1HNVA 1NGGA 4CEFA 4B3MK 3CCLN 1X1PA 2ETJA 1MU2A 4ELTA 4IJNA 3V6DA 4IBNA 3KTQA 1BDGA 1NJXA 4DV6K 4Y1DA 5FDLA 3CJAA 3VPZA 1VK0A 4DV2K 4LD0A 5JICA 2V51B 4KHSA 2XY6A 3OYLA 5C10A 3ZT4A 3SAGA 3TABA 5KGWA 3OS1A 4FJLA 1TUYA 5JMVA 4B9VA 2ZF5O 1YTUA 3L2VA 2E2NA 2FBXA 4FLXA 2BGGA 2HMIA 3OYBA 4RTFD 4FJJA 3ZCMA 1QQMA 4CGJA 1BA0A 1MA9B 2FBYA 1HNWK 3FZLA 2G8WA 1C1CA 2XO7A 5AQSA 3MN9A 2G8UA 3QLHA 3VF2A 4WQ5C 3SYZA 3WEEA 5AQRA 3R1XA 4B9QA 4DKWA 2KFZA 1Z26A 4OPJA 3HL8A 3TU5A 3VQDA 4OKKA 5AQYA 1EQYA 5AQFA 5CZ2A 3UIQA 1GLBG 4YDUC 2P9NA 2QWOA 1L3VA 5CYMA 2HHXA 2W41A 1TVRA 4K42A 2YJEA 4E7KA 4FJGA 2KFNA 3OA9A 5EOYA 5J2MA 4JI5K 4DR4K 1KD1O 3SJHA 2PYLA 1S5JA 3DOKA 5AQVA 3RVCA 4G9ZA 1J53A 3MWTA 3M3ZA 1VQ6N 3DXKB 4KKOA 3V81A 1ZYQA 1KVCA 4EAHD 4BG8A 5GAHP 3DLKA 1VRUA 3U6FA 4N56A 4YORA 3IKMA 5C0YA 2P9IA 4KRFA 2IVNA 1I39A 1ATNA 5AQLA 5EX5A 4B1ZA 4DUYK 4C8OA 3AVLA 2I7PA 4CJWA 4KTQA 2E2PA 4DQPA 3BF3A 3MEEA 4FVUA 3I8BA 4LSNA 3PSFA 4B08A 5GAGP 1HQEA 3LDNA 1NBWA 5SZTA 2B4JA 3CC2N 4CHYA 4ISGA 5GIOA 4AHTA 4GV9A 3JXUA 1REVA 3J81O 1QQNA 2E5LK 3BZCA 4OX9K 2HHUA 1LW0A 4NCAA 2PZSA 4BR7A 4BRGA 2D5RA 3VQ8A 1YTAA 1RT7A 3MK6A 4AHUA 3HZ6A 1U47A 4O8UA 5JS2A 1T6CA 3U8XA 1E4GT 3VF6A 1VQ8N 3QICA 5FRMA 3F2KA 2ZGYA 1WSHA 5M1NA 1LAVA 1GLDG 3OYMA 3DRPA 3FR0A 5KPTA 3K5OA 1ZC6A 3HOTA 3AVAA 1S1WA 5HLFA 1TK0A 3DRSA 3C6AA 1RBRA 3H1VX 4CJQA 3PLAA 3ENBA 4XH4A 2PFUA 3DXMA 4PQUA 1ZBSA 4JI3K 2Z1HA 4BDPA 5AQGA 4FZYA 4LFAK 3PX6A 4BRFA 1TK5A 3ZSZA 1YIJN 2GTDA 4M7XA 4CJVA 2Y1IA 3ZEUB 3B6PA 3GBTA 3LM2A 3R8EA 1HKBA 4DFMA 4J8FA 3J7YP 5IT9O 4FOEA 3E9LA 4UQGA 3K57A 4Z4FA 1KTQA 3KKSA 2WFBA 5TKWA 3WXIA 4CZMA 3ZT2A 1UA1A 5CZ1A 2ZJRL 2A3ZA 2X6NA 5HRNA 4PHTX 5HBMA 2QW9A 3H45C 4DWIA 4DV7K 2E2OA 4FSVA 2H3GX 4H0XB 2OYQA 1RDWX 3JYTA 1L3SA 3AVIA 4CBXA 4A62A 3AVCA 3J8AA 4M3TA 4H8KA 1S1UA 3HK2A 3ZSVA 5AZJB 2YHBA 1NGDA 3V9XA 1HYSA 5AQJA 1CZ9A 3AAQA 3K9JA 3AVJA 1EETA 4YNQA 1YJNN 2QKBA 3ZETA 4NCGA 5M1FA 1VAZA 4X62K 2ATQA 4HVJA 5AFUA 2ITGA 2D1KA 4H0TB 1XQSC 4E0DA 1XNRK 3V9SA 1GLEG 3VQCA 4BRIA 2YHWA 2XY5A 1VHXA 3ISNC 4CHPA 1N5YA 3D45A 5SWMA 3RMDA 3KZBA 3LZJA 4A5BA 3CFOA 3T3FA 1RT6A 2P9PB 1JCFA 3O4WA 1SUQA 1E4FT 4I6MB 2QWRA 2V52B 2E1ZA 1HNZK 3QO9A 2YV0X 4DLEA 3H3NO 1FKOA 2JLEA 1VSFA 2O8DA 1EWQA 3D6RA 3AO2A 2F7TA 4DQIA 4CF9A 4FL9A 4DR3K 4H4MA 4WQ5A 3LP0A 4F3TA 4N47A 4E7LA 3VOVA 1T7PA 4DLGA 1HUXA 3ALYA 5J2NA 1IO2A 4DQRA 3SBGA 1WLJA 3PX0A 4DV5K 2RHKA 3SMPA 2F9WA 4DFPA 3PO4A 3KLHA 4J2DA 4CF8A 5A2QO 4FK0A 1K8KA 1K73O 5I3UA 3UKUA 3V1QA 4NXNK 4B1UB 3CC4N 2FBTA 3SQ2A 4Z4EA 2QEXN 2QWMA 4CD3A 1W2BM 4IDKA 4CECA 3K5LA 4HUEA 3RSEB 1D9FA 2CH6A 4DS5A 3CJ9A 2UU9K 3KWIA 1A5XA 4BRLA 4W5NA 2PBDA 4CD1A 2ZE2A 3CJCA 4O8KA 2HHQA 5GADP 4MDBA 4RG8A 3I0SA 3F9MA 3OHRA 4NCBA 1HLUA 4JI7K 3OS2A 3MCPA 4IFVA 3QNOA 4H5NA 3OW2M 4DV3K 3BZKA 1UWBA 4FW1A 5FPNA 1KRPA 1TL3A 1T44A 3DLHA 2F4VK 3MAQA 1RDUA 1FW6A 1JKHA 1WBBA 2OTJN 3QIPA 1VSIA 5M1KA 2G8KA 4R5PA 4DFJA 4CZLA 2WOMA 1S9GA 3WT0A 3CMEN 3CCQN 1TAUA 3MWPA 4K0KK 2W40A 3WNEA 2IS3A 1SL1A 3CQ8A 4F2SA 4B9TA 2VYPA 1NGJA 4KREA 3CETA 4OLBA 5KTQA 3DOLA 4BDZA 5CY4A 4C8KA 2Z1GA 4H5VA 4C1NI 4BR9A 3IS9A 4MQ3A 4W5OA 1X9WA 1NKCA 1JXBA 4IG3A 3E01A 4Z4GA 3QEXA 4YOYA 3UE5A 4YY3K 1W97L 1X9SA 3O3HA 3I55N 4FWSA 1DKGD 2BUPA 1GLJO 1JLEA 3TSPA 5M1QA 1IJJA 2X74A 3SZ2A 3L0QA 4JI2K 4M3RA 3J7ZO 1B92A 3FZKA 4FW2A 1R0AA 3SPZA 3FZFA 5EXWA 4IOCL 4M7YA 4GW6A 1NM1A 4FYDA 5KI6A 1W7AA 2AP1A 4KHNA 3QMLA 2Q1NA 4K43A 3L4QA 4CEBA 3KK2A 3E1YA 5IWAK 4CF2A 3DJCA 5EU7A 4FWKA 3QNNA 4RW6A 3DXKA 4DTXA 3M1FA 5BRDA 4YOXA 2D0CA 3C95A 4E1MA 5AZIA 4M3ZA 4A61A 5JS1A 3ZSWA 3UKRA 1ASVA 3RRGA 2X78A 3L3VA 1U4BA 2EX3A 3ENHA 5J2PA 4YOWA 1I3AA 1SS6A 2O8FB 1DTQA 4CE9A 2DPNA 1ILYA 2GWJA 2QI2A 4YOTA 3CFPA 4EP4A 3QEWA 3O4QA 3OVNA 4O0JA 4ELVA 3U3YA 2Z1JA 3AVNA 4CEQA 4CEDA 2DFHA 2HF4A 4CJFA 1J5OA 4DUZK 1RTJA 4I2PA 5JLFA 1HPMA 4DR2K 3VEOA 4CFAA 1K6YA 1WNSA 2E2QA 3M8QA 3L6QA 4JNEA 3CCMN 2IC3A 3TSQA 2O4IA 1J5EK 1VSLA 5M1OA 3SUPA 1Q18A 3AARA 1GLCG 3H3OB 2RPIA 4FWNA 1S1TA 4CJTA 4PWDA 1C0UA 1Q7YO 1YHQN 2VQEK 2HB5A 5LY3A 3CYMA 3MXJA 2XY8A 4FJMA 1NK7A 1NGAA 4YOVA 3QB0A 3OYKA 3RR8A 1BQMA 3M6GA 4XIUA 3ZX3A 1WSEA 4WCEL 3UKUB 4IOAL 4XEIA 2HBJA 1KVAA 2A40A 1YITN 4JK7A 1V4SA 4BE2A 4K25A 3PY8A 5FROA 2E88A 1CZBA 4FWRA 3WQUA 4X65K 4JS5A 3NF6A 3AO1A 4FXDA 3FZHA 3QEIA 3QETA 1IG9A 2WTUA 1DT9A 3HOSA 1X3NA 4M3XA 3VEVA 3NBPA 5FLXO 3K59A 3M8SA 1B9FA 4E1JA 1SL2A 4PKGA 3I33A 1NK0A 3DMJA 3I0RA 3ZEUA 1NNEA 3C7NB 1WAFA 3A5LC 1HYVA 3O9UA 3SV4A 4DQSA 2OPQA 1VSEA 3NVKA 4GMJB 2D0OA 2RE2A 4HWIA 3NCIA 1WN7A 3BEXA 4CZEA 2HBKA 1F21A 3HBTA 2F8SA 4JKDA 4FJ9A 1RBVA 2FSJA 5BRHA 1VQPN 2HVIA 2YNIA 1UOCA 2NRHA 5TKYA 1L3UA 4KH4A 4CIFA 3VA0A 4N76A 1TYQB 4IG0A 2GEMA 3CQYA 1JLGA 3BP8A 3WXJA 2Z1IA 3LAMA 2E6LA 4LFBK 2UXDK 5AZJA 3CI5A 2D0PA 3O80A 3LALA 4AF1A 2ZM6K 3V9UA 3THVA 4DU1A 2Q36A 4B1VA 1N6QA 5AQNA 4FJ5A 2VCPA 1WAJA 1JLQA 2IVOA 5JLHA 3GDQA 1RGIA 4BDYA 2ZGZA 3THXB 4BR2A 4B3OA 1IBKK 3EZWA 5AFUH 3JS6A 1U48A 4JHDB 2P9KA 1QSSA 3CF5L 5KRSA 4OPKA 4X66K 1EWRA 2HVHA 3AV9A 1XC3A 2FBVA 1L3TA 4GNIA 1KCFA 3AO3A 2P9PA 4O44A 4RW9A 3TTFA 4I6MA 1HYZA 3ZSXA 4RWTA 3T69A 3PO5A 3OYFA 1RBSA 1ATSA 3V1RA 3VQ7A 3GG4A 3NVMA 5C25A 2D4WA 1G99A 3K2PA 4B9LA 2KZMA 2GWKA 4A57A 4KV8A 4FVMA 5BR9A 1Q9YA 3AGRA 3VEZA 1TKXA 1NOZA 2QXLA 1GLLO 5HL7L 4LF6K 1IKVA 5KRTA 2VWKA
chains in the Genus database with same CATH topology
2E2OA 4FSVA 2H3GX 2ASPA 4H0XB 1RDWX 4QS7A 3S41A 3CCJN 3WXKA 2QWNA 1SQKA 4NLCA 3CCEN 3WQTA 4OPHA 1QZ6A 4IDHA 1KAYA 5AZIB 3ZYYX 4CBXA 3MN5A 4A62A 3J8AA 3A5OC 3UKRB 2GELA 4BC2A 3MDQA 3D2EB 2P9LA 1YJ9N 3O5BA 1T3VA 5KPZA 4LC9B 3EE9A 5AZJB 1KAZA 3CJ7A 4JKHA 1NGDA 4PL7A 3KWGA 3ULEB 5AQJA 2YCHA 3TPQA 3AAQA 3K9JA 1DGKN 2NRTA 5DM7L 3A5NC 4FPAA 4DB3A 3CD6N 3RSEA 4B1YB 2HMPA 3TTDA 1YJNN 2QWLA 4JKCA 1OVYA 3ID6A 4ILHA 4HTLA 3ZETA 1S22A 4EIAA 5M1FA 3DXMB 4DQ8A 4FPBA 4CZGA 1VAZA 3HI0A 4WFAL 4NLBA 4GVEA 5AFUA 4H0TB 2D1KA 1XQSC 5FPEA 4CI6A 2HBMA 4FOIA 1GLEG 3FZMA 4IXCA 4BRIA 2YHWA 4BG9A 4B1XB 1SAZA 5C15A 2E1YA 1S72N 1N8RO 3KZBA 2KHOA 2Q97A 4A5BA 2JWLA 4JK9A 3U9DA 2P9PB 1JCFA 3O4WA 2NRXA 1YXQA 2Q0RA 1E4FT 3QBWA 4I6MB 2QWRA 1OKJA 2V52B 5MLCQ 2E1ZA 3WUHA 2WUSA 4BRPA 2QM1A 3H3NO 1S3XA 3EKUA 4H5WA 1ESVA 3D6RA 4JKAA 4CZFA 4BRKA 1DEJA 2F7TA 4ILGB 4OO1J 3VTIA 1Z6RA 4FL9A 4WQ5A 1M90O 1LOTB 3O8MA 3R9PA 3MMVA 1NJIO 3VOVA 2KKZA 1KQSM 5HOOA 1HUXA 2FSKA 2IVPA 3VERA 1NGEA 4JKEA 4BRNA 3DLLL 3SBGA 1WUAA 5GINA 3W3DA 1MWMA 2NZTA 2RHKA 3SMPA 3LDPA 2F9WA 5ELZA 4BR0A 4BQLA 3F5TA 5ADXH 1K8KA 5E84A 2P9LB 1K73O 3ATUA 3UKUA 3KHYA 3K9KA 4BR4A 4WFNL 4WF9L 3CXCM 3VGLA 4B1UB 3O9TA 3D2FA 3HRGA 3G6EN 2FF3B 4FO0A 1HKCA 4PKHA 3CC4N 4WYBA 3P31A 2UYTA 1NGFA 2QEXN 2GX9A 2QWMA 2OANA 1U6ZA 4MO5A 4CD3A 4DCHA 3O9RA 4JKGA 1W2BM 1YAGA 3IFRA 1YI2N 3G25A 4JKBA 3RSEB 2CH6A 2GUPA 3CJ9A 3ZETB 5FPMA 5H1SQ 2P9SA 5BPNA 2FF6A 3KWIA 4BRLA 5C12A 2PBDA 4CD1A 3LDQA 3CJCA 1BOTO 4O8KA 4BC3A 1J6ZA 3U4LA 1BO5O 4BY9C 5GADP 3ENOA 3MX2A 2BH1A 4MDBA 4CBUA 2HOEA 4EFHA 2KLAA 4BGAA 3KK7A 1NWKA 1T6DA 3ATVA 4IO9L 2ASOA 2CGLA 3MX5A 3F9MA 3OHRA 4IZ9A 4H0OA 3EO3A 1BWFO 3CCUN 2QA4N 4H0VB 1HLUA 3N4PA 3N4QA 5C2FA 3Q7BA 5AQHA 3MCPA 4H5NA 3HM8A 3OW2M 2WBNA 4ISFA 1U2VA 2P9UA 5M1PA 5FPNA 3CIPA 1V4TA 2VGMA 1T44A 1IG8A 2E20A 4GV3A 4GV6A 1VQNN 1KAXA 1RDUA 4CZJA 4BROA 2F9TA 3IDHA 3CC7N 3QFUA 3QDKA 4MDAA 3GE1A 3H46O 3Q7CA 3O08A 4Y0WA 2OTJN 5M1KA 3VGKA 3VETA 4F9OA 2ZJPL 1BU6O 3HTVA 3IMXA 3DAWA 4BGBA 4CZLA 3CMEN 3WT0A 3QFPA 3CCQN 3MWPA 3C0BA 2W40A 1Q86O 4JD2A 5DM6L 1CZAN 2A5XA 4YOUA 4JK8A 1K8KB 4NB4A 1HX1A 4XH5A 1Y64A 3ID8A 1X9JA 2VYPA 1NGJA 3EE8A 5BPMA 3CETA 4FWOA 3D2FB 5EY4A 5AQZA 2ZJQL 2V7YA 2Q2RA 3TTCA 3O1WA 2ZWHA 4WQ4A 2YJFA 5BN9A 1TUUA 3MN6A 4ISEA 5AQKA 5LJWA 4O5FA 3CMAN 3AGKA 4H5VA 4JKGB 4BR9A 4C1NI 4H5RA 3VESA 2P9KB 1NGCA 2BTFA 3FGUA 4H03B 2IIRA 3QBXA 2P9SB 4AM6A 4YOYA 3UE5A 1W97L 1VQ4N 2ASMA 1LCUA 3SLCA 3VMFB 1O13A 4C1NK 3TSUA 3VEWA 2FSNA 3E9OA 3H6EA 3I55N 3EL2A 4FWSA 2A42A 5KQDA 1DKGD 2BUPA 1GLJO 1VQLN 3G4SN 3TSPA 5M1QA 1IJJA 1YVNA 3VTHA 5F0XA 3L0QA 1BG3A 4PKIA 3SMSA 4L3QA 3J7ZO 3CCVN 1HKGA 3FZKA 3GL1A 1YUWA 3P38A 1KC8O 2J4RA 3FZFA 5EXWA 4IOCL 4M7YA 4BRDA 4BRCA 1NM1A 1EO1A 1QVFM 3VEYA 1NGGA 3CCLN 1U2VB 2P9UB 2AP1A 4BREA 3QMLA 4IJNA 3VF4A 2Q1NA 4K43A 3L4QA 5AQUA 4H0PA 4JKFA 3E1YA 4WFBL 3UB5A 1BDGA 3CC2N 2I7NA 3CJAA 3DJCA 3PIOL 4FWKA 3VPZA 4A2AA 4A5AA 4JN4A 3CHWA 3DXKA 3M1FA 5BRDA 2V51B 3SBTA 5JICA 4YOXA 1NMDA 3E9PA 5FPDA 1YJWN 2A41A 5AZIA 4A61A 1NGBA 3UKRA 4FWPA 4BRQA 5C10A 3AAPA 3SAGA 4MLHA 2YX6A 3ENHA 5F2RA 4YOWA 3CCSN 1TUYA 1SS6A 5JMVA 2ZF5O 5KPRA 2DPNA 1ILYA 2E2NA 2GWJA 3B8AX 2QI2A 4KH5A 4YOTA 3MCAB 3ULEA 4EHUA 2VWBA 2NRRA 4RTFD 4UY8O 2A6AA 1QQMA 5CE3A 2HF4A 1K8AO 4BVPA 1BA0A 2ITMA 3O1BA 1NGHA 5JLFA 1MA9B 5B8HA 3D7EO 3FZLA 1HPMA 3OBYA 5AQSA 5C2DA 3MN9A 3BUZB 3VEOA 3VF2A 4WQ5C 3C7NA 2E2QA 3A8YA 4QS9A 3E66A 2YI1A 3WEEA 3L6QA 1D4XA 5AQRA 3R1XA 4BC5A 4B9QA 4DKWA 3R6MA 4JNEA 3TU5A 4BVOA 5AQYA 3U9ZA 1EQYA 2CGKA 5AQFA 3CCMN 1GLBG 1NGIA 1R59O 5JVHL 4A2BA 3CQXA 4YDUC 2P9NA 3TSQA 4AM7A 2QWOA 3CCRN 3WXMB 5BN8A 3P4IA 4H5TA 5M1OA 4EHTA 2YHYA 2W41A 5LJVA 1Q18A 3AARA 1GLCG 3AY9A 4OPAA 3H3OB 4K42A 4FWNA 5AQXA 2YJEA 3FFKB 5E26A 5AQQA 1Q7YO 1YHQN 5KQ8A 5LY3A 3BF1A 1Q81O 3OA9A 5EOYA 1ZXOA 3VEXA 1NGAA 3GOIA 1KD1O 4YOVA 3QB0A 1TYQA 3SJHA 4H0YB 3CJ1A 2PAVA 2VGNA 5AQVA 4BR5A 3PIPL 3CPWM 5BPLA 5ADXA 1VQ9N 3M6GA 4IWVA 4JEPA 4IEIA 2FLOA 3RVCA 4NO7A 4G9ZA 3MWTA 3M3ZA 3ZX3A 1VQ6N 3DXKB 1VQON 4WCEL 2YHXA 1QZ5A 4EAHD 3UKUB 4K41A 2HSTA 4IOAL 4XEIA 3M5RA 2HBJA 1JCGA 4BG8A 5GAHP 1YITN 2A40A 4JK7A 1V4SA 5AQOA 4K25A 1BA1A 1C0GA 1QQOA 4M63C 4YORA 2E88A 3IKMA 5C0YA 2P9IA 2IVNA 4MO4A 4FWRA 1ATNA 5AQLA 1H1VA 5EX5A 3WQUA 4B1ZA 5GIPA 1QVGM 5AQTA 4C23A 4MLEA 5CHIA 3SK3A 2E8AA 3FZHA 3A5MC 1M1KO 4CJ7A 1DT9A 5BRFA 2I7PA 1X3NA 3HOSA 3VEVA 3FLCO 2E2PA 3LDOA 1VQMN 3C6HA 1SZ2A 3BF3A 4FVUA 3I8BA 3L4IA 4JHDA 5GAGP 2HF3A 1NBWA 3LDNA 2Q0UA 3I33A 4PKGA 4E1JA 5I9EB 2AA4A 4U7BA 4RCHA 1VQ7N 1NLVA 4ISGA 3ZEUA 5AQMA 1P90A 5GIOA 2Q31A 3CJBA 5AQIA 3C65A 2WC9A 4GV9A 3JXUA 2FXUA 5BREA 3O6WA 3C7NB 2HBLA 3A5LC 4XH1A 3O9UA 1QQNA 5EVZA 3WEEB 4BQZA 4CZIA 1Q82O 3NVKA 1MDUB 3T7ZA 3O9QA 2D0OA 4BRHA 2RE2A 4HWIA 3SAFA 3LDLA 2P9NB 1VQ5N 4CZEA 3BEXA 3SAHA 2HBKA 1Z05A 4BR7A 4IOXA 3HBTA 4KBOA 4BRGA 1RFQA 4QS8A 4JKDA 2FSJA 3DWLA 3MK6A 3P39A 2NNWA 3R3LA 5BRHA 3VGMA 3HZ6A 1VQPN 4O8UA 1T6CA 3U8XA 5AQPA 5JVGL 1E4GT 2NRHA 3VF6A 4BRMA 5TKYA 2QWPA 3LL3A 1VQ8N 3QICA 3W0LA 4KH4A 3F2KA 3EN9A 4WQ4C 4B1WB 1JJ2M 2CGJA 1C0FA 2ZGYA 1GLAG 1TYQB 1JCEA 4Z94A 4DHYA 2GEMA 3CQYA 2EWSA 5M1NA 1GLDG 3D2EA 4IO8A 3BP8A 3WXJA 3EKSA 4JD2B 3A0IX 4CZKA 5AZJA 3FR0A 1P8ZA 2D0PA 3CI5A 3O80A 4YDUA 5KPTA 1MWKA 3ZX2A 4IEEA 4AF1A 1ZC6A 3HOTA 1ATRA 3LM9A 4ILJA 2Q36A 3CERA 4B1VA 4RWTA 2NRZA 5AQNA 3C6AA 2VCPA 3H1VX 5JLHA 1X3MA 2IVOA 4GY2B 2P9IB 3PLAA 3ENBA 4XH4A 2PFUA 5AQWA 4BC4A 4R79A 3DXMA 2V7ZA 3GDQA 3MN7A 3VENA 3WXLA 3ZX0A 1RGIA 1BUPA 1ZBSA 4PL8A 2ZGZA 4BR2A 3CPEA 5AQGA 5AR0A 1QHAA 1GLFO 3EZWA 3IUCA 5AFUH 4BRFA 3JS6A 1YIJN 2GTDA 2JWKA 1YF5L 4JHDB 3FE1A 2P9KA 4M7XA 2CH5A 3CF5L 4FWLA 2NRVA 4FWMA 4KH6A 4A59A 3ZEUB 1XC3A 2QWQA 3GBTA 3LM2A 3NMUA 3R8EA 2NLXA 1HKBA 4GNIA 3G71N 5CR4A 2P9PA 2NRWA 2OTLN 3H1QA 4I6MA 4J8FA 3OBWA 4FOEA 3T69A 3TTFA 1WOQA 4BRAA 4CBWA 4CZHA 1ATSA 3E9LA 3GG4A 1HJOA 3NVMA 4JAXA 2D4WA 1G99A 1KXPA 2WFBA 4FWQA 5TKWA 3WXIA 4U67L 1K9MO 4CZMA 2GWKA 4IJAA 4A57A 2ZJRL 1XUPO 2A3ZA 5BR9A 3HSCA 4IFEA 3AGRA 3VEZA 5GAEP 4PHTX 1VQKN 2QW9A 5F1XA 3I56N 2QXLA 1GLLO 3H45C 2QTDA 5HL7L 3O9SA 3KVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOX A;  3N4Q A;  3N4P A; 
#chains in the Genus database with same CATH topology
 3LWL A;  2W42 A;  3RRH A;  3CCE N;  3DLB A;  3ZYY X;  5AZI B;  3UKR B;  4B3T K;  2GEL A;  2AJQ A;  1NG9 A;  5LMN K;  1E3M A;  3CJ7 A;  4JKH A;  4ICL A;  1UA0 A;  2YCH A;  3SUO A;  4KI6 A;  4BE0 A;  2NRT A;  2YNG A;  3A5N C;  4DB3 A;  4FM2 A;  2O8C A;  4E7J A;  3RSE A;  4FJH A;  3ID6 A;  1EKE A;  4DQ8 A;  3HI0 A;  4NLB A;  4CI6 A;  4JI6 K;  3FZM A;  4IXC A;  3SQ1 A;  3ZSY A;  3EY1 A;  4CJR A;  3VQQ A;  1U49 A;  3ZLJ A;  5FRN A;  2UUC K;  2KHO A;  1VSM A;  3K5M A;  3PSI A;  4JK9 A;  2Q0R A;  1GOA A;  1SV5 A;  3QBW A;  3M8P A;  2WUS A;  4BRP A;  4LF9 K;  3QIO A;  4CIG A;  1B9D A;  1DEJ A;  4O4G A;  5C42 A;  1Z6R A;  4FM1 A;  3MMV A;  1NJI O;  5HOO A;  2LSN A;  2IVP A;  5J1E A;  4BRN A;  1NGE A;  4JKE A;  3L3U A;  3EZ5 A;  5GIN A;  2YNF A;  3CM6 A;  1KLN A;  2IGI A;  4CGI A;  3SQ4 A;  4BR0 A;  5ADX H;  4CVN E;  3NH1 A;  2P9L B;  3KD5 E;  3KHY A;  3K9K A;  3CXC M;  4WF9 L;  1KVB A;  3HRG A;  3G6E N;  1D8Y A;  4EP5 A;  3VQA A;  4CJ4 A;  1Z25 A;  1NGF A;  4Z4C A;  2OAN A;  1U6Z A;  4CJ3 A;  3LP3 A;  1YI2 N;  3G25 A;  4JKB A;  3HP9 A;  2GUP A;  5H1S Q;  4DFK A;  4KAZ A;  4FK4 A;  3NGZ A;  4BC3 A;  1VSD A;  1J6Z A;  1BI4 B;  1BO5 O;  1C0T A;  1WSG A;  4BY9 C;  1XHZ A;  4CK1 A;  3QIN A;  2HOE A;  1NWK A;  1BWF O;  4H0V B;  1U04 A;  3N4P A;  4Z4H A;  4IFY A;  3Q7B A;  3MED A;  5T7B A;  4C8N A;  3CIP A;  5HRR A;  2VGM A;  2B6A A;  2E20 A;  1IG8 A;  2XHB A;  3RTV A;  1VQN N;  3B6O A;  4BRO A;  1G15 A;  2F9T A;  3CC7 N;  3QDK A;  3F73 A;  3H46 O;  3Q7C A;  4Y0W A;  3VGK A;  3VET A;  4F9O A;  2ZJP L;  3SUN A;  3HTV A;  3DAW A;  4BGB A;  1L5U A;  3CFR A;  2RF2 A;  2YKM A;  3C0B A;  2O8F A;  1Q86 O;  3ZT0 A;  4JK8 A;  4FM0 A;  1Y64 A;  3ID8 A;  3BY5 A;  1ZBH A;  3EE8 A;  5BPM A;  1EP4 A;  1KFD A;  5EY4 A;  2ZJQ L;  4CW7 B;  5AQK A;  2UXC K;  3OS0 A;  1RT3 A;  4JKG B;  3CMA N;  2HHW A;  2P9K B;  1NGC A;  3FGU A;  4CGH A;  3QBX A;  4AM6 A;  3ASM A;  4CFC A;  1VQ4 N;  2ASM A;  3SLC A;  4C1N K;  1O13 A;  3H6E A;  3EL2 A;  1XC9 A;  1ZBI A;  2A42 A;  4I9L A;  4MFB A;  3BGR A;  1Q8I A;  3T1H K;  4CJ5 A;  1YVN A;  3T1Y K;  1BG3 A;  3CG7 A;  3VQ5 A;  3EYZ A;  3CCV N;  1NK6 A;  2XY7 A;  1IKX A;  4LF5 K;  3WNH A;  1KC8 O;  5D3G A;  3K0S A;  4J2B A;  2Q3S A;  1QVF M;  3VEY A;  4CFD A;  5I42 A;  1U2V B;  4BRE A;  3P1G A;  3T1A A;  4H0P A;  4DTR A;  3FFI A;  4KO0 A;  4WFB L;  4F2R A;  2I7N A;  3PIO L;  4A2A A;  4KPY A;  4A5A A;  4CF0 A;  3CHW A;  4I9Q A;  4B9M A;  3DM2 A;  3SBT A;  2I5J A;  5FPD A;  1LAW A;  2A41 A;  1NGB A;  4FK2 A;  1NK9 A;  4BRQ A;  3AA5 X;  4JYA K;  3AAP A;  4DTP A;  4DV0 K;  2YX6 A;  3ZT3 A;  1U45 A;  2BE2 A;  4LY7 A;  2O8C B;  3B8A X;  1BIU A;  1BQN A;  3MCA B;  3ULE A;  4EHU A;  4UY8 O;  1KSP A;  2A6A A;  2ZD1 A;  4OGC A;  3HT3 A;  4DSE A;  1C0M A;  3DI6 A;  1K8A O;  4BVP A;  2ITM A;  4OLA A;  1NGH A;  3NHG A;  3IRX A;  3ZSR A;  1JL2 A;  5B8H A;  4NYF A;  3D7E O;  1N36 K;  1IBM K;  1TAQ A;  3OBY A;  3BUZ B;  4CJE A;  3THW B;  4X64 K;  3C7N A;  1NJY A;  4JI1 K;  4QS9 A;  3E66 A;  1D4X A;  1IH7 A;  4W5T A;  4F4K A;  1KLM A;  3R6M A;  4BVO A;  2JGU A;  3U9Z A;  4QAG A;  1NGI A;  1R59 O;  5JVH L;  4E89 A;  4A2B A;  3CQX A;  3CCR N;  3WXM B;  1T05 A;  1LWC A;  4H5T A;  4EHT A;  2YHY A;  5LJV A;  1OVQ A;  2VWJ A;  3AY9 A;  4DR6 K;  2W6L A;  1RDC A;  4OGE A;  4Q0B A;  5AQX A;  4NYN A;  5AQQ A;  5HRP A;  4CCH A;  5KQ8 A;  1JLF A;  2QKK A;  3BF1 A;  3OJU A;  1Q81 O;  1RDD A;  3GOI A;  3HM9 A;  1TYQ A;  4FJK A;  2VGN A;  3PIP L;  3CPW M;  2D0A A;  5ADX A;  4AHS A;  3NH2 A;  4JEP A;  4PUO A;  3P83 D;  4NO7 A;  5KGX A;  4BWM A;  3VQ6 A;  2YKN A;  4AQY K;  2PYJ A;  1VQO N;  2YHX A;  1IKW A;  4K41 A;  2HST A;  3M5R A;  1HJR A;  5AQO A;  4O55 A;  1BA1 A;  4M63 C;  3I8D A;  4MO4 A;  5GIP A;  2XRI A;  4C23 A;  4MLE A;  5CHI A;  3VQ9 A;  4FLW A;  3TAN A;  3A5M C;  1M1K O;  3TAG A;  3THX A;  4DTN A;  4FLU A;  3FLC O;  1VQM N;  3LDO A;  3RMA A;  1SZ2 A;  4M3W A;  4JHD A;  3KKR A;  4G1Q A;  2HF3 A;  4U7B A;  2Q0U A;  5I9E B;  2X6S A;  1RT1 A;  2AA4 A;  1NLV A;  3KLI A;  2E6M A;  2WC9 A;  2P1J A;  3ZSO A;  5BRE A;  4HHT A;  3MXI A;  3O6W A;  1ITG A;  4HTU A;  1J9A A;  2R7Y A;  4BQZ A;  4CER A;  4CZI A;  1X9M A;  1Q82 O;  4RW8 A;  3T7Z A;  4AHC A;  3O9Q A;  4KB1 A;  2GV9 A;  3LDL A;  4B8C A;  3TI0 A;  1VQ5 N;  4BWJ A;  1Z05 A;  4KBO A;  3RR7 A;  3JSM A;  1RFQ A;  4FLV A;  3DWL A;  3P39 A;  2NNW A;  3WNG A;  5AQP A;  4JI4 K;  4BRM A;  3LL3 A;  1S6P A;  3W0L A;  1JJ2 M;  2BDP A;  3NF8 A;  2IOC A;  4DR5 K;  1GLA G;  3SUQ A;  2A1S A;  4O0I A;  1JLA A;  2EWS A;  3KD1 E;  3JAM O;  5LMU K;  1FJG K;  3A0I X;  1NMN A;  3ZX2 A;  3LM9 A;  3V4I A;  4Z0U A;  3CER A;  2NRZ A;  1VSJ A;  3VQE A;  1FKP A;  5HP1 A;  3H08 A;  4B9N A;  1RBU A;  4M3Y A;  4BC4 A;  4R79 A;  2V7Z A;  1NJW A;  3VQ4 A;  1T03 A;  4O5B A;  1HR0 K;  1BUP A;  4PL8 A;  1RCH A;  5E41 A;  2UUB K;  3CPE A;  3SPY A;  3C6T A;  5AR0 A;  3O3F A;  1HRH A;  3IUC A;  4DS4 A;  4I7F A;  2JWK A;  1YF5 L;  2CH5 A;  2W6K A;  4FWM A;  4KH6 A;  4W5Q A;  4A59 A;  2QWQ A;  3KJV A;  3G71 N;  4CHZ A;  4KB0 A;  1CXU A;  3PUF A;  4TSX A;  2NRW A;  3H1Q A;  3OBW A;  4BRA A;  4CBW A;  1WOQ A;  1S1X A;  1HJO A;  3HST B;  1QSY A;  1KXP A;  4U67 L;  4NXM K;  4F3O A;  2P5G A;  2F96 A;  2IDO A;  1NKE A;  5GAE P;  1IBL K;  3NH0 A;  1VQK N;  3TAQ A;  3NE6 A;  4JRQ A;  4QS7 A;  3A2F A;  3WXK A;  2QWN A;  1SQK A;  4OPH A;  3U3G A;  4DQQ A;  4IDH A;  3IAY A;  3MN5 A;  3A5O C;  4BC2 A;  3MDQ A;  3D2E B;  1OH8 A;  5BR8 K;  2P9L A;  3O5B A;  1EXQ A;  3AVB A;  5KPZ A;  3EE9 A;  2O8E B;  1HQU A;  3HYF A;  4E3S A;  3ULE B;  1RNH A;  3P5J A;  2ZQB A;  3PV8 A;  1RIL A;  1A5V A;  4KHU A;  3CD6 N;  4B1Y B;  2HMP A;  3TTD A;  2QWL A;  4JKC A;  4ILH A;  4HTL A;  4EIA A;  4C8M A;  3NAE A;  4FPB A;  4KHW A;  4ZTJ A;  2EHG A;  4N5S A;  1BI4 A;  2RN2 A;  2HBM A;  1SKW A;  4FOI A;  3OYJ A;  2OZM A;  4FZZ A;  1RT4 A;  4BG9 A;  4B1X B;  2DTU A;  2UXB K;  3OJS A;  1N8R O;  2VG7 A;  1S72 N;  3C94 A;  2Q97 A;  2JWL A;  3U9D A;  1YXQ A;  2P5O A;  4M45 A;  4CK2 A;  2QM1 A;  1S3X A;  3EKU A;  4H5W A;  1NK5 A;  4CZF A;  4BRK A;  3VTI A;  1GOB A;  1M90 O;  2DFF A;  3VN5 A;  2VQF K;  1BGX T;  1JLB A;  2HHH K;  3VER A;  3DLL L;  4EZ9 A;  1SKS A;  1MWM A;  2A1R A;  2F8T A;  3AO5 A;  1N32 K;  3MEC A;  2O8B B;  4OJR A;  2WON A;  3ATU A;  1BIS A;  1I94 K;  3LPT A;  2KW4 A;  4KHY A;  2FF3 B;  3G10 A;  1HKC A;  4EZ6 A;  4WYB A;  3P31 A;  4FJI A;  3OYD A;  4MO5 A;  1NU0 A;  4KTW A;  4DCH A;  3O9R A;  4JKG A;  2HHV A;  3IFR A;  1HNX K;  5BPN A;  4L8R B;  5C12 A;  1TKZ A;  3LDQ A;  1BOT O;  4YFU A;  3RMB A;  1JL1 A;  1BL3 A;  1QHT A;  3SQ0 A;  4DR7 K;  2KLA A;  3KK7 A;  3LAN A;  1T6D A;  3ATV A;  4AHV A;  4IO9 L;  2ASO A;  3HVR A;  1KFS A;  3MX5 A;  4QCL A;  3QEV A;  1QQC A;  4H0O A;  4B8A B;  3EO3 A;  3LPU A;  3CCU N;  4DF8 A;  2P51 A;  2QA4 N;  3SJJ A;  1IKY A;  3N4Q A;  5AQH A;  2KQ2 A;  3M8R A;  3K58 A;  1U2V A;  5M1P A;  1XMQ K;  1V4T A;  4BE1 A;  4QOZ B;  3MXM A;  3G0Z A;  4BAC A;  4GV6 A;  4JI8 K;  4CZJ A;  1OH5 A;  3KK3 A;  4Y1C A;  4LF8 K;  3IDH A;  1FXX A;  3T19 A;  1RTH A;  3O08 A;  3NF9 A;  3QFP A;  3ZT1 A;  3LWM A;  2GBZ A;  3S3M A;  3OTO K;  4DTO A;  4JD2 A;  2A5X A;  1LW2 A;  1TKD A;  4NB4 A;  5HRO A;  1C1B A;  1HX1 A;  4DSI A;  1TL1 A;  1X9J A;  4J2E A;  4FWO A;  4E7H A;  3D2F B;  1RDB A;  2V7Y A;  3TTC A;  3O1W A;  5BN9 A;  1TUU A;  3MN6 A;  4ISE A;  3THY A;  1VSH A;  4H5R A;  3THW A;  4H03 B;  1XMO K;  2P9S B;  4JS4 A;  1NKB A;  1O1W A;  1LCU A;  3VMF B;  4E19 A;  3E9O A;  3SV3 A;  3VTH A;  3AA4 A;  2NUB A;  4L3Q A;  4Q5V A;  3O3G A;  1HKG A;  1DLO A;  3L2Q A;  1YUW A;  1JXE A;  1RBT A;  2VG6 A;  2HNY A;  4BRC A;  4BRD A;  2P9U B;  5DK5 A;  5AJ3 K;  3TR8 A;  3VF4 A;  5AQU A;  2HNZ A;  3KIO A;  4DV1 K;  3AVG A;  3IG1 A;  4JKF A;  1Y97 A;  3UB5 A;  4LSL A;  4PA1 A;  4JN4 A;  4CIE A;  4KTZ A;  2RKI A;  5LL6 Z;  1NMD A;  3E9P A;  1YJW N;  4Z4I A;  3OYH A;  4DSL A;  4FWP A;  4MLH A;  5F2R A;  3CCS N;  4CJU A;  5KPR A;  3LDS A;  2OPP A;  4KH5 A;  3OYE A;  2FC0 A;  2VWB A;  2NRR A;  2HHS A;  3HPG A;  3S3O A;  4M41 A;  3NGI A;  3EEQ A;  5CE3 A;  3VQB A;  3O1B A;  3AVF A;  3QES A;  1WSI A;  2O4G A;  3BDP A;  5C2D A;  4M3U A;  3S9H A;  3HPO A;  4FJN A;  3A8Y A;  3WNF A;  2YI1 A;  4BC5 A;  4FLT A;  2HHT A;  1WB9 A;  2CGK A;  3TAP A;  1QSL A;  4AM7 A;  3HVT A;  5BN8 A;  3P4I A;  3MEG A;  4OPA A;  4V19 S;  3FFK B;  5E26 A;  1JLC A;  4AIL C;  1YT3 A;  3SCX A;  1WSF A;  1VRT A;  1ZBF A;  1ZXO A;  3VEX A;  1OH6 A;  2DY4 A;  2KZZ A;  4H0Y B;  3L8B A;  3CJ1 A;  2PAV A;  4I2Q A;  4BR5 A;  1VQ9 N;  1QE1 A;  5BPL A;  4CHQ A;  4K8X A;  4IWV A;  4IEI A;  2FLO A;  4B9S A;  4JV5 K;  1D9D A;  1QZ5 A;  1JCG A;  3LZI A;  4CJK A;  3HPH A;  1TGO A;  3OYN A;  1C0G A;  1QQO A;  1S1V A;  4CHN A;  2Y1J A;  2G8I A;  1H1V A;  1N33 K;  1S6Q A;  1QVG M;  5AQT A;  4LFC K;  3SK3 A;  2BAN A;  2E8A A;  2YNH A;  4CJ7 A;  5BRF A;  4CES A;  4JI0 K;  4JRP A;  3C6H A;  4GKJ K;  1NOY A;  3ITH A;  3L4I A;  4B3R K;  4FZX C;  1ZBU A;  4CEO A;  1VQ7 N;  4RCH A;  5AQM A;  1P90 A;  2Q31 A;  3HXM A;  3CJB A;  5AQI A;  3C65 A;  1HNI A;  3V9W A;  4HCC A;  3DLR A;  2FXU A;  5J2Q A;  2HBL A;  4XH1 A;  3AO4 A;  1XWL A;  5EVZ A;  3WEE B;  4ZHR A;  1XNQ K;  2KTQ A;  1LWF A;  1MDU B;  4E7I A;  1BCO A;  4BRH A;  3SAF A;  2P9N B;  4CGF A;  3NF7 A;  3SAH A;  3HO1 A;  4PY5 A;  4IOX A;  3AVK A;  4QS8 A;  3HP6 A;  4OKJ A;  3R3L A;  3VA3 A;  1VSK A;  3OYC A;  3VGM A;  4CJS A;  5JVG L;  4IKF A;  4DU4 A;  1N34 K;  2QWP A;  4AHR A;  1RT5 A;  3EN9 A;  4WQ4 C;  4B1W B;  3OY9 A;  2CGJ A;  1C0F A;  1ZBL A;  1HPZ A;  3DRR A;  4HUG A;  3RWU A;  4Z94 A;  1JCE A;  4C8L A;  4DHY A;  1DTT A;  4KI4 A;  3D2E A;  4IO8 A;  3EKS A;  4DTJ A;  4JD2 B;  4CZK A;  5K14 A;  1P8Z A;  4YDU A;  2G8V A;  1MWK A;  2O8E A;  4CJL A;  4IEE A;  1ATR A;  2B5J A;  4ILJ A;  4W5R A;  1TKT A;  1RTD A;  1W9H A;  4AH9 A;  1J54 A;  1X3M A;  4GY2 B;  2P9I B;  5AQW A;  3THY B;  3MN7 A;  3VEN A;  1IV0 A;  4FLZ A;  3WXL A;  3ZX0 A;  1FK9 A;  3DLG A;  4OVL A;  4DG1 A;  2DFE A;  1QHA A;  1GLF O;  4KFB A;  1S9E A;  3L2U A;  3FE1 A;  4FWL A;  2NRV A;  3NMU A;  4GKK K;  2NLX A;  5CR4 A;  3AA3 A;  2OTL N;  4CF1 A;  4CZH A;  1SKR A;  3QEP A;  4CGD A;  2HND A;  4JAX A;  4FWQ A;  1K9M O;  1NK4 A;  4IJA A;  1XUP O;  1TK8 A;  1Q9X A;  3HSC A;  5C24 A;  4B9U A;  4IFE A;  5F1X A;  3OYI A;  3I56 N;  4F8R A;  3ZSQ A;  4CGG A;  2QTD A;  3O9S A;  3KVG A;  5DM7 L;  3TAR A;  2ASP A;  3CCJ N;  4HCB A;  3S41 A;  4NLC A;  4DV4 K;  3KK1 A;  3WQT A;  4WE1 A;  1QZ6 A;  1KAY A;  4KHP K;  4RW4 A;  2O8B A;  1YVU A;  1YJ9 N;  1T3V A;  1LV5 A;  2PY5 A;  4LC9 B;  1KAZ A;  3J80 O;  1BIZ A;  4HUF A;  4PL7 A;  3KWG A;  1WBD A;  1RDA A;  5CYQ A;  3KLE A;  3TPQ A;  2IAJ A;  1DGK N;  2HW3 A;  4FPA A;  4DF4 A;  3TAE A;  1OVY A;  1S22 A;  2G8F A;  3DXM B;  4FLY A;  4CZG A;  1NJZ A;  4WFA L;  4DTU A;  4GVE A;  2OCE A;  1UAX A;  5FPE A;  2OZS A;  3OYA A;  3OYG A;  1RTI A;  4CEZ A;  4ZTF A;  4KHQ A;  1SAZ A;  3RMC A;  2OA8 A;  5C15 A;  4ELU A;  2E1Y A;  3NDK A;  4CEA A;  1ASU A;  2NRX A;  4FJX A;  4CHO A;  3LAK A;  1OKJ A;  4CFB A;  5MLC Q;  4DR1 K;  1LWE A;  3KLF A;  3WUH A;  2G8H A;  4CEE A;  1ESV A;  4JKA A;  3SI6 A;  4FJ7 A;  3KLG A;  3NGY A;  4ILG B;  4OO1 J;  3ULD A;  1LOT B;  3O8M A;  3R9P A;  4CJP A;  3S3N A;  4N41 A;  2KKZ A;  2UUA K;  1KQS M;  2FSK A;  2YHA A;  1WUA A;  4M42 A;  3W3D A;  1TV6 A;  1CXQ A;  2NZT A;  2OPR A;  3LDP A;  1QTM A;  5ELZ A;  4BQL A;  3AVH A;  2VG5 A;  3F5T A;  3K5N A;  5E84 A;  1QS4 A;  1RT2 A;  3DLE A;  4RW7 A;  4BR4 A;  5HRS A;  4WFN L;  3VQP A;  1NK8 A;  3VGL A;  3O9T A;  4B3S K;  3D2F A;  4FO0 A;  3LP2 A;  4PKH A;  1OH7 A;  4E1N A;  2UYT A;  2GX9 A;  2OPS A;  3V1O A;  1YAG A;  3ZET B;  5DMR A;  5FPM A;  2P9S A;  2FF6 A;  4DU3 A;  3TAM A;  3TWH A;  2QK9 A;  2QXF A;  3U4L A;  4CK3 A;  4LF7 K;  4FCY A;  1T8E A;  4J2A A;  3ENO A;  3L2W A;  3MX2 A;  2BH1 A;  4DTS A;  4CBU A;  3AVM A;  1GOC A;  4EFH A;  1XI1 A;  4DSF A;  4BGA A;  1C6V A;  1BCM A;  3O4N A;  2CGL A;  4IZ9 A;  3AA2 A;  5C2F A;  3L2R A;  4ID1 A;  1WSJ A;  3HM8 A;  2WBN A;  4ISF A;  2P9U A;  2GUI A;  4H4O A;  4LH4 A;  2O8D B;  1D5A A;  4JLH A;  4GV3 A;  1KAX A;  4LH5 A;  3QFU A;  4MDA A;  3GE1 A;  1CLQ A;  4YHH K;  1BU6 O;  3IMX A;  1XHX A;  4LF4 K;  1C1A A;  3V9Z A;  1BHL A;  3QER A;  1EX4 A;  3DYA A;  5DM6 L;  1CZA N;  4YOU A;  1SL0 A;  3HJF A;  1K8K B;  4XH5 A;  4FJ8 A;  1W0H A;  4ID5 A;  4K8Z A;  4DTM A;  1ASW A;  3J7A P;  5AQZ A;  2Q2R A;  2ZWH A;  4WQ4 A;  2YJF A;  4GVM A;  4DMN A;  5LJW A;  3NFA A;  4O5F A;  3AGK A;  3PX4 A;  3VES A;  2D0B A;  3F9K A;  1A5W A;  1HMV A;  2BTF A;  2IIR A;  3LP1 A;  3TAF A;  3TSU A;  3VEW A;  2FSN A;  3C6U A;  3SNN A;  5KQD A;  4OKE A;  1VQL N;  3G4S N;  2E4L A;  5F0X A;  4PKI A;  3SMS A;  3GL1 A;  3P38 A;  2J4R A;  3CM5 A;  4DSJ A;  4DSK A;  3D0P A;  1EO1 A;  1HNV A;  1NGG A;  4CEF A;  4B3M K;  3CCL N;  1X1P A;  2ETJ A;  1MU2 A;  4ELT A;  4IJN A;  3V6D A;  4IBN A;  3KTQ A;  1BDG A;  1NJX A;  4DV6 K;  4Y1D A;  5FDL A;  3CJA A;  3VPZ A;  1VK0 A;  4DV2 K;  4LD0 A;  5JIC A;  2V51 B;  4KHS A;  2XY6 A;  3OYL A;  5C10 A;  3ZT4 A;  3SAG A;  3TAB A;  5KGW A;  3OS1 A;  4FJL A;  1TUY A;  5JMV A;  4B9V A;  2ZF5 O;  1YTU A;  3L2V A;  2E2N A;  2FBX A;  4FLX A;  2BGG A;  2HMI A;  3OYB A;  4RTF D;  4FJJ A;  3ZCM A;  1QQM A;  4CGJ A;  1BA0 A;  1MA9 B;  2FBY A;  1HNW K;  3FZL A;  2G8W A;  1C1C A;  2XO7 A;  5AQS A;  3MN9 A;  2G8U A;  3QLH A;  3VF2 A;  4WQ5 C;  3SYZ A;  3WEE A;  5AQR A;  3R1X A;  4B9Q A;  4DKW A;  2KFZ A;  1Z26 A;  4OPJ A;  3HL8 A;  3TU5 A;  3VQD A;  4OKK A;  5AQY A;  1EQY A;  5AQF A;  5CZ2 A;  3UIQ A;  1GLB G;  4YDU C;  2P9N A;  2QWO A;  1L3V A;  5CYM A;  2HHX A;  2W41 A;  1TVR A;  4K42 A;  2YJE A;  4E7K A;  4FJG A;  2KFN A;  3OA9 A;  5EOY A;  5J2M A;  4JI5 K;  4DR4 K;  1KD1 O;  3SJH A;  2PYL A;  1S5J A;  3DOK A;  5AQV A;  3RVC A;  4G9Z A;  1J53 A;  3MWT A;  3M3Z A;  1VQ6 N;  3DXK B;  4KKO A;  3V81 A;  1ZYQ A;  1KVC A;  4EAH D;  4BG8 A;  5GAH P;  3DLK A;  1VRU A;  3U6F A;  4N56 A;  4YOR A;  3IKM A;  5C0Y A;  2P9I A;  4KRF A;  2IVN A;  1I39 A;  1ATN A;  5AQL A;  5EX5 A;  4B1Z A;  4DUY K;  4C8O A;  3AVL A;  2I7P A;  4CJW A;  4KTQ A;  2E2P A;  4DQP A;  3BF3 A;  3MEE A;  4FVU A;  3I8B A;  4LSN A;  3PSF A;  4B08 A;  5GAG P;  1HQE A;  3LDN A;  1NBW A;  5SZT A;  2B4J A;  3CC2 N;  4CHY A;  4ISG A;  5GIO A;  4AHT A;  4GV9 A;  3JXU A;  1REV A;  3J81 O;  1QQN A;  2E5L K;  3BZC A;  4OX9 K;  2HHU A;  1LW0 A;  4NCA A;  2PZS A;  4BR7 A;  4BRG A;  2D5R A;  3VQ8 A;  1YTA A;  1RT7 A;  3MK6 A;  4AHU A;  3HZ6 A;  1U47 A;  4O8U A;  5JS2 A;  1T6C A;  3U8X A;  1E4G T;  3VF6 A;  1VQ8 N;  3QIC A;  5FRM A;  3F2K A;  2ZGY A;  1WSH A;  5M1N A;  1LAV A;  1GLD G;  3OYM A;  3DRP A;  3FR0 A;  5KPT A;  3K5O A;  1ZC6 A;  3HOT A;  3AVA A;  1S1W A;  5HLF A;  1TK0 A;  3DRS A;  3C6A A;  1RBR A;  3H1V X;  4CJQ A;  3PLA A;  3ENB A;  4XH4 A;  2PFU A;  3DXM A;  4PQU A;  1ZBS A;  4JI3 K;  2Z1H A;  4BDP A;  5AQG A;  4FZY A;  4LFA K;  3PX6 A;  4BRF A;  1TK5 A;  3ZSZ A;  1YIJ N;  2GTD A;  4M7X A;  4CJV A;  2Y1I A;  3ZEU B;  3B6P A;  3GBT A;  3LM2 A;  3R8E A;  1HKB A;  4DFM A;  4J8F A;  3J7Y P;  5IT9 O;  4FOE A;  3E9L A;  4UQG A;  3K57 A;  4Z4F A;  1KTQ A;  3KKS A;  2WFB A;  5TKW A;  3WXI A;  4CZM A;  3ZT2 A;  1UA1 A;  5CZ1 A;  2ZJR L;  2A3Z A;  2X6N A;  5HRN A;  4PHT X;  5HBM A;  2QW9 A;  3H45 C;  4DWI A;  4DV7 K;  2E2O A;  4FSV A;  2H3G X;  4H0X B;  2OYQ A;  1RDW X;  3JYT A;  1L3S A;  3AVI A;  4CBX A;  4A62 A;  3AVC A;  3J8A A;  4M3T A;  4H8K A;  1S1U A;  3HK2 A;  3ZSV A;  5AZJ B;  2YHB A;  1NGD A;  3V9X A;  1HYS A;  5AQJ A;  1CZ9 A;  3AAQ A;  3K9J A;  3AVJ A;  1EET A;  4YNQ A;  1YJN N;  2QKB A;  3ZET A;  4NCG A;  5M1F A;  1VAZ A;  4X62 K;  2ATQ A;  4HVJ A;  5AFU A;  2ITG A;  2D1K A;  4H0T B;  1XQS C;  4E0D A;  1XNR K;  3V9S A;  1GLE G;  3VQC A;  4BRI A;  2YHW A;  2XY5 A;  1VHX A;  3ISN C;  4CHP A;  1N5Y A;  3D45 A;  5SWM A;  3RMD A;  3KZB A;  3LZJ A;  4A5B A;  3CFO A;  3T3F A;  1RT6 A;  2P9P B;  1JCF A;  3O4W A;  1SUQ A;  1E4F T;  4I6M B;  2QWR A;  2V52 B;  2E1Z A;  1HNZ K;  3QO9 A;  2YV0 X;  4DLE A;  3H3N O;  1FKO A;  2JLE A;  1VSF A;  2O8D A;  1EWQ A;  3D6R A;  3AO2 A;  2F7T A;  4DQI A;  4CF9 A;  4FL9 A;  4DR3 K;  4H4M A;  4WQ5 A;  3LP0 A;  4F3T A;  4N47 A;  4E7L A;  3VOV A;  1T7P A;  4DLG A;  1HUX A;  3ALY A;  5J2N A;  1IO2 A;  4DQR A;  3SBG A;  1WLJ A;  3PX0 A;  4DV5 K;  2RHK A;  3SMP A;  2F9W A;  4DFP A;  3PO4 A;  3KLH A;  4J2D A;  4CF8 A;  5A2Q O;  4FK0 A;  1K8K A;  1K73 O;  5I3U A;  3UKU A;  3V1Q A;  4NXN K;  4B1U B;  3CC4 N;  2FBT A;  3SQ2 A;  4Z4E A;  2QEX N;  2QWM A;  4CD3 A;  1W2B M;  4IDK A;  4CEC A;  3K5L A;  4HUE A;  3RSE B;  1D9F A;  2CH6 A;  4DS5 A;  3CJ9 A;  2UU9 K;  3KWI A;  1A5X A;  4BRL A;  4W5N A;  2PBD A;  4CD1 A;  2ZE2 A;  3CJC A;  4O8K A;  2HHQ A;  5GAD P;  4MDB A;  4RG8 A;  3I0S A;  3F9M A;  3OHR A;  4NCB A;  1HLU A;  4JI7 K;  3OS2 A;  3MCP A;  4IFV A;  3QNO A;  4H5N A;  3OW2 M;  4DV3 K;  3BZK A;  1UWB A;  4FW1 A;  5FPN A;  1KRP A;  1TL3 A;  1T44 A;  3DLH A;  2F4V K;  3MAQ A;  1RDU A;  1FW6 A;  1JKH A;  1WBB A;  2OTJ N;  3QIP A;  1VSI A;  5M1K A;  2G8K A;  4R5P A;  4DFJ A;  4CZL A;  2WOM A;  1S9G A;  3WT0 A;  3CME N;  3CCQ N;  1TAU A;  3MWP A;  4K0K K;  2W40 A;  3WNE A;  2IS3 A;  1SL1 A;  3CQ8 A;  4F2S A;  4B9T A;  2VYP A;  1NGJ A;  4KRE A;  3CET A;  4OLB A;  5KTQ A;  3DOL A;  4BDZ A;  5CY4 A;  4C8K A;  2Z1G A;  4H5V A;  4C1N I;  4BR9 A;  3IS9 A;  4MQ3 A;  4W5O A;  1X9W A;  1NKC A;  1JXB A;  4IG3 A;  3E01 A;  4Z4G A;  3QEX A;  4YOY A;  3UE5 A;  4YY3 K;  1W97 L;  1X9S A;  3O3H A;  3I55 N;  4FWS A;  1DKG D;  2BUP A;  1GLJ O;  1JLE A;  3TSP A;  5M1Q A;  1IJJ A;  2X74 A;  3SZ2 A;  3L0Q A;  4JI2 K;  4M3R A;  3J7Z O;  1B92 A;  3FZK A;  4FW2 A;  1R0A A;  3SPZ A;  3FZF A;  5EXW A;  4IOC L;  4M7Y A;  4GW6 A;  1NM1 A;  4FYD A;  5KI6 A;  1W7A A;  2AP1 A;  4KHN A;  3QML A;  2Q1N A;  4K43 A;  3L4Q A;  4CEB A;  3KK2 A;  3E1Y A;  5IWA K;  4CF2 A;  3DJC A;  5EU7 A;  4FWK A;  3QNN A;  4RW6 A;  3DXK A;  4DTX A;  3M1F A;  5BRD A;  4YOX A;  2D0C A;  3C95 A;  4E1M A;  5AZI A;  4M3Z A;  4A61 A;  5JS1 A;  3ZSW A;  3UKR A;  1ASV A;  3RRG A;  2X78 A;  3L3V A;  1U4B A;  2EX3 A;  3ENH A;  5J2P A;  4YOW A;  1I3A A;  1SS6 A;  2O8F B;  1DTQ A;  4CE9 A;  2DPN A;  1ILY A;  2GWJ A;  2QI2 A;  4YOT A;  3CFP A;  4EP4 A;  3QEW A;  3O4Q A;  3OVN A;  4O0J A;  4ELV A;  3U3Y A;  2Z1J A;  3AVN A;  4CEQ A;  4CED A;  2DFH A;  2HF4 A;  4CJF A;  1J5O A;  4DUZ K;  1RTJ A;  4I2P A;  5JLF A;  1HPM A;  4DR2 K;  3VEO A;  4CFA A;  1K6Y A;  1WNS A;  2E2Q A;  3M8Q A;  3L6Q A;  4JNE A;  3CCM N;  2IC3 A;  3TSQ A;  2O4I A;  1J5E K;  1VSL A;  5M1O A;  3SUP A;  1Q18 A;  3AAR A;  1GLC G;  3H3O B;  2RPI A;  4FWN A;  1S1T A;  4CJT A;  4PWD A;  1C0U A;  1Q7Y O;  1YHQ N;  2VQE K;  2HB5 A;  5LY3 A;  3CYM A;  3MXJ A;  2XY8 A;  4FJM A;  1NK7 A;  1NGA A;  4YOV A;  3QB0 A;  3OYK A;  3RR8 A;  1BQM A;  3M6G A;  4XIU A;  3ZX3 A;  1WSE A;  4WCE L;  3UKU B;  4IOA L;  4XEI A;  2HBJ A;  1KVA A;  2A40 A;  1YIT N;  4JK7 A;  1V4S A;  4BE2 A;  4K25 A;  3PY8 A;  5FRO A;  2E88 A;  1CZB A;  4FWR A;  3WQU A;  4X65 K;  4JS5 A;  3NF6 A;  3AO1 A;  4FXD A;  3FZH A;  3QEI A;  3QET A;  1IG9 A;  2WTU A;  1DT9 A;  3HOS A;  1X3N A;  4M3X A;  3VEV A;  3NBP A;  5FLX O;  3K59 A;  3M8S A;  1B9F A;  4E1J A;  1SL2 A;  4PKG A;  3I33 A;  1NK0 A;  3DMJ A;  3I0R A;  3ZEU A;  1NNE A;  3C7N B;  1WAF A;  3A5L C;  1HYV A;  3O9U A;  3SV4 A;  4DQS A;  2OPQ A;  1VSE A;  3NVK A;  4GMJ B;  2D0O A;  2RE2 A;  4HWI A;  3NCI A;  1WN7 A;  3BEX A;  4CZE A;  2HBK A;  1F21 A;  3HBT A;  2F8S A;  4JKD A;  4FJ9 A;  1RBV A;  2FSJ A;  5BRH A;  1VQP N;  2HVI A;  2YNI A;  1UOC A;  2NRH A;  5TKY A;  1L3U A;  4KH4 A;  4CIF A;  3VA0 A;  4N76 A;  1TYQ B;  4IG0 A;  2GEM A;  3CQY A;  1JLG A;  3BP8 A;  3WXJ A;  2Z1I A;  3LAM A;  2E6L A;  4LFB K;  2UXD K;  5AZJ A;  3CI5 A;  2D0P A;  3O80 A;  3LAL A;  4AF1 A;  2ZM6 K;  3V9U A;  3THV A;  4DU1 A;  2Q36 A;  4B1V A;  1N6Q A;  5AQN A;  4FJ5 A;  2VCP A;  1WAJ A;  1JLQ A;  2IVO A;  5JLH A;  3GDQ A;  1RGI A;  4BDY A;  2ZGZ A;  3THX B;  4BR2 A;  4B3O A;  1IBK K;  3EZW A;  5AFU H;  3JS6 A;  1U48 A;  4JHD B;  2P9K A;  1QSS A;  3CF5 L;  5KRS A;  4OPK A;  4X66 K;  1EWR A;  2HVH A;  3AV9 A;  1XC3 A;  2FBV A;  1L3T A;  4GNI A;  1KCF A;  3AO3 A;  2P9P A;  4O44 A;  4RW9 A;  3TTF A;  4I6M A;  1HYZ A;  3ZSX A;  4RWT A;  3T69 A;  3PO5 A;  3OYF A;  1RBS A;  1ATS A;  3V1R A;  3VQ7 A;  3GG4 A;  3NVM A;  5C25 A;  2D4W A;  1G99 A;  3K2P A;  4B9L A;  2KZM A;  2GWK A;  4A57 A;  4KV8 A;  4FVM A;  5BR9 A;  1Q9Y A;  3AGR A;  3VEZ A;  1TKX A;  1NOZ A;  2QXL A;  1GLL O;  5HL7 L;  4LF6 K;  1IKV A;  5KRT A;  2VWK A; 
#chains in the Genus database with same CATH homology
 2E2O A;  4FSV A;  2H3G X;  2ASP A;  4H0X B;  1RDW X;  4QS7 A;  3S41 A;  3CCJ N;  3WXK A;  2QWN A;  1SQK A;  4NLC A;  3CCE N;  3WQT A;  4OPH A;  1QZ6 A;  4IDH A;  1KAY A;  5AZI B;  3ZYY X;  4CBX A;  3MN5 A;  4A62 A;  3J8A A;  3A5O C;  3UKR B;  2GEL A;  4BC2 A;  3MDQ A;  3D2E B;  2P9L A;  1YJ9 N;  3O5B A;  1T3V A;  5KPZ A;  4LC9 B;  3EE9 A;  5AZJ B;  1KAZ A;  3CJ7 A;  4JKH A;  1NGD A;  4PL7 A;  3KWG A;  3ULE B;  5AQJ A;  2YCH A;  3TPQ A;  3AAQ A;  3K9J A;  1DGK N;  2NRT A;  5DM7 L;  3A5N C;  4FPA A;  4DB3 A;  3CD6 N;  3RSE A;  4B1Y B;  2HMP A;  3TTD A;  1YJN N;  2QWL A;  4JKC A;  1OVY A;  3ID6 A;  4ILH A;  4HTL A;  3ZET A;  1S22 A;  4EIA A;  5M1F A;  3DXM B;  4DQ8 A;  4FPB A;  4CZG A;  1VAZ A;  3HI0 A;  4WFA L;  4NLB A;  4GVE A;  5AFU A;  4H0T B;  2D1K A;  1XQS C;  5FPE A;  4CI6 A;  2HBM A;  4FOI A;  1GLE G;  3FZM A;  4IXC A;  4BRI A;  2YHW A;  4BG9 A;  4B1X B;  1SAZ A;  5C15 A;  2E1Y A;  1S72 N;  1N8R O;  3KZB A;  2KHO A;  2Q97 A;  4A5B A;  2JWL A;  4JK9 A;  3U9D A;  2P9P B;  1JCF A;  3O4W A;  2NRX A;  1YXQ A;  2Q0R A;  1E4F T;  3QBW A;  4I6M B;  2QWR A;  1OKJ A;  2V52 B;  5MLC Q;  2E1Z A;  3WUH A;  2WUS A;  4BRP A;  2QM1 A;  3H3N O;  1S3X A;  3EKU A;  4H5W A;  1ESV A;  3D6R A;  4JKA A;  4CZF A;  4BRK A;  1DEJ A;  2F7T A;  4ILG B;  4OO1 J;  3VTI A;  1Z6R A;  4FL9 A;  4WQ5 A;  1M90 O;  1LOT B;  3O8M A;  3R9P A;  3MMV A;  1NJI O;  3VOV A;  2KKZ A;  1KQS M;  5HOO A;  1HUX A;  2FSK A;  2IVP A;  3VER A;  1NGE A;  4JKE A;  4BRN A;  3DLL L;  3SBG A;  1WUA A;  5GIN A;  3W3D A;  1MWM A;  2NZT A;  2RHK A;  3SMP A;  3LDP A;  2F9W A;  5ELZ A;  4BR0 A;  4BQL A;  3F5T A;  5ADX H;  1K8K A;  5E84 A;  2P9L B;  1K73 O;  3ATU A;  3UKU A;  3KHY A;  3K9K A;  4BR4 A;  4WFN L;  4WF9 L;  3CXC M;  3VGL A;  4B1U B;  3O9T A;  3D2F A;  3HRG A;  3G6E N;  2FF3 B;  4FO0 A;  1HKC A;  4PKH A;  3CC4 N;  4WYB A;  3P31 A;  2UYT A;  1NGF A;  2QEX N;  2GX9 A;  2QWM A;  2OAN A;  1U6Z A;  4MO5 A;  4CD3 A;  4DCH A;  3O9R A;  4JKG A;  1W2B M;  1YAG A;  3IFR A;  1YI2 N;  3G25 A;  4JKB A;  3RSE B;  2CH6 A;  2GUP A;  3CJ9 A;  3ZET B;  5FPM A;  5H1S Q;  2P9S A;  5BPN A;  2FF6 A;  3KWI A;  4BRL A;  5C12 A;  2PBD A;  4CD1 A;  3LDQ A;  3CJC A;  1BOT O;  4O8K A;  4BC3 A;  1J6Z A;  3U4L A;  1BO5 O;  4BY9 C;  5GAD P;  3ENO A;  3MX2 A;  2BH1 A;  4MDB A;  4CBU A;  2HOE A;  4EFH A;  2KLA A;  4BGA A;  3KK7 A;  1NWK A;  1T6D A;  3ATV A;  4IO9 L;  2ASO A;  2CGL A;  3MX5 A;  3F9M A;  3OHR A;  4IZ9 A;  4H0O A;  3EO3 A;  1BWF O;  3CCU N;  2QA4 N;  4H0V B;  1HLU A;  3N4P A;  3N4Q A;  5C2F A;  3Q7B A;  5AQH A;  3MCP A;  4H5N A;  3HM8 A;  3OW2 M;  2WBN A;  4ISF A;  1U2V A;  2P9U A;  5M1P A;  5FPN A;  3CIP A;  1V4T A;  2VGM A;  1T44 A;  1IG8 A;  2E20 A;  4GV3 A;  4GV6 A;  1VQN N;  1KAX A;  1RDU A;  4CZJ A;  4BRO A;  2F9T A;  3IDH A;  3CC7 N;  3QFU A;  3QDK A;  4MDA A;  3GE1 A;  3H46 O;  3Q7C A;  3O08 A;  4Y0W A;  2OTJ N;  5M1K A;  3VGK A;  3VET A;  4F9O A;  2ZJP L;  1BU6 O;  3HTV A;  3IMX A;  3DAW A;  4BGB A;  4CZL A;  3CME N;  3WT0 A;  3QFP A;  3CCQ N;  3MWP A;  3C0B A;  2W40 A;  1Q86 O;  4JD2 A;  5DM6 L;  1CZA N;  2A5X A;  4YOU A;  4JK8 A;  1K8K B;  4NB4 A;  1HX1 A;  4XH5 A;  1Y64 A;  3ID8 A;  1X9J A;  2VYP A;  1NGJ A;  3EE8 A;  5BPM A;  3CET A;  4FWO A;  3D2F B;  5EY4 A;  5AQZ A;  2ZJQ L;  2V7Y A;  2Q2R A;  3TTC A;  3O1W A;  2ZWH A;  4WQ4 A;  2YJF A;  5BN9 A;  1TUU A;  3MN6 A;  4ISE A;  5AQK A;  5LJW A;  4O5F A;  3CMA N;  3AGK A;  4H5V A;  4JKG B;  4BR9 A;  4C1N I;  4H5R A;  3VES A;  2P9K B;  1NGC A;  2BTF A;  3FGU A;  4H03 B;  2IIR A;  3QBX A;  2P9S B;  4AM6 A;  4YOY A;  3UE5 A;  1W97 L;  1VQ4 N;  2ASM A;  1LCU A;  3SLC A;  3VMF B;  1O13 A;  4C1N K;  3TSU A;  3VEW A;  2FSN A;  3E9O A;  3H6E A;  3I55 N;  3EL2 A;  4FWS A;  2A42 A;  5KQD A;  1DKG D;  2BUP A;  1GLJ O;  1VQL N;  3G4S N;  3TSP A;  5M1Q A;  1IJJ A;  1YVN A;  3VTH A;  5F0X A;  3L0Q A;  1BG3 A;  4PKI A;  3SMS A;  4L3Q A;  3J7Z O;  3CCV N;  1HKG A;  3FZK A;  3GL1 A;  1YUW A;  3P38 A;  1KC8 O;  2J4R A;  3FZF A;  5EXW A;  4IOC L;  4M7Y A;  4BRD A;  4BRC A;  1NM1 A;  1EO1 A;  1QVF M;  3VEY A;  1NGG A;  3CCL N;  1U2V B;  2P9U B;  2AP1 A;  4BRE A;  3QML A;  4IJN A;  3VF4 A;  2Q1N A;  4K43 A;  3L4Q A;  5AQU A;  4H0P A;  4JKF A;  3E1Y A;  4WFB L;  3UB5 A;  1BDG A;  3CC2 N;  2I7N A;  3CJA A;  3DJC A;  3PIO L;  4FWK A;  3VPZ A;  4A2A A;  4A5A A;  4JN4 A;  3CHW A;  3DXK A;  3M1F A;  5BRD A;  2V51 B;  3SBT A;  5JIC A;  4YOX A;  1NMD A;  3E9P A;  5FPD A;  1YJW N;  2A41 A;  5AZI A;  4A61 A;  1NGB A;  3UKR A;  4FWP A;  4BRQ A;  5C10 A;  3AAP A;  3SAG A;  4MLH A;  2YX6 A;  3ENH A;  5F2R A;  4YOW A;  3CCS N;  1TUY A;  1SS6 A;  5JMV A;  2ZF5 O;  5KPR A;  2DPN A;  1ILY A;  2E2N A;  2GWJ A;  3B8A X;  2QI2 A;  4KH5 A;  4YOT A;  3MCA B;  3ULE A;  4EHU A;  2VWB A;  2NRR A;  4RTF D;  4UY8 O;  2A6A A;  1QQM A;  5CE3 A;  2HF4 A;  1K8A O;  4BVP A;  1BA0 A;  2ITM A;  3O1B A;  1NGH A;  5JLF A;  1MA9 B;  5B8H A;  3D7E O;  3FZL A;  1HPM A;  3OBY A;  5AQS A;  5C2D A;  3MN9 A;  3BUZ B;  3VEO A;  3VF2 A;  4WQ5 C;  3C7N A;  2E2Q A;  3A8Y A;  4QS9 A;  3E66 A;  2YI1 A;  3WEE A;  3L6Q A;  1D4X A;  5AQR A;  3R1X A;  4BC5 A;  4B9Q A;  4DKW A;  3R6M A;  4JNE A;  3TU5 A;  4BVO A;  5AQY A;  3U9Z A;  1EQY A;  2CGK A;  5AQF A;  3CCM N;  1GLB G;  1NGI A;  1R59 O;  5JVH L;  4A2B A;  3CQX A;  4YDU C;  2P9N A;  3TSQ A;  4AM7 A;  2QWO A;  3CCR N;  3WXM B;  5BN8 A;  3P4I A;  4H5T A;  5M1O A;  4EHT A;  2YHY A;  2W41 A;  5LJV A;  1Q18 A;  3AAR A;  1GLC G;  3AY9 A;  4OPA A;  3H3O B;  4K42 A;  4FWN A;  5AQX A;  2YJE A;  3FFK B;  5E26 A;  5AQQ A;  1Q7Y O;  1YHQ N;  5KQ8 A;  5LY3 A;  3BF1 A;  1Q81 O;  3OA9 A;  5EOY A;  1ZXO A;  3VEX A;  1NGA A;  3GOI A;  1KD1 O;  4YOV A;  3QB0 A;  1TYQ A;  3SJH A;  4H0Y B;  3CJ1 A;  2PAV A;  2VGN A;  5AQV A;  4BR5 A;  3PIP L;  3CPW M;  5BPL A;  5ADX A;  1VQ9 N;  3M6G A;  4IWV A;  4JEP A;  4IEI A;  2FLO A;  3RVC A;  4NO7 A;  4G9Z A;  3MWT A;  3M3Z A;  3ZX3 A;  1VQ6 N;  3DXK B;  1VQO N;  4WCE L;  2YHX A;  1QZ5 A;  4EAH D;  3UKU B;  4K41 A;  2HST A;  4IOA L;  4XEI A;  3M5R A;  2HBJ A;  1JCG A;  4BG8 A;  5GAH P;  1YIT N;  2A40 A;  4JK7 A;  1V4S A;  5AQO A;  4K25 A;  1BA1 A;  1C0G A;  1QQO A;  4M63 C;  4YOR A;  2E88 A;  3IKM A;  5C0Y A;  2P9I A;  2IVN A;  4MO4 A;  4FWR A;  1ATN A;  5AQL A;  1H1V A;  5EX5 A;  3WQU A;  4B1Z A;  5GIP A;  1QVG M;  5AQT A;  4C23 A;  4MLE A;  5CHI A;  3SK3 A;  2E8A A;  3FZH A;  3A5M C;  1M1K O;  4CJ7 A;  1DT9 A;  5BRF A;  2I7P A;  1X3N A;  3HOS A;  3VEV A;  3FLC O;  2E2P A;  3LDO A;  1VQM N;  3C6H A;  1SZ2 A;  3BF3 A;  4FVU A;  3I8B A;  3L4I A;  4JHD A;  5GAG P;  2HF3 A;  1NBW A;  3LDN A;  2Q0U A;  3I33 A;  4PKG A;  4E1J A;  5I9E B;  2AA4 A;  4U7B A;  4RCH A;  1VQ7 N;  1NLV A;  4ISG A;  3ZEU A;  5AQM A;  1P90 A;  5GIO A;  2Q31 A;  3CJB A;  5AQI A;  3C65 A;  2WC9 A;  4GV9 A;  3JXU A;  2FXU A;  5BRE A;  3O6W A;  3C7N B;  2HBL A;  3A5L C;  4XH1 A;  3O9U A;  1QQN A;  5EVZ A;  3WEE B;  4BQZ A;  4CZI A;  1Q82 O;  3NVK A;  1MDU B;  3T7Z A;  3O9Q A;  2D0O A;  4BRH A;  2RE2 A;  4HWI A;  3SAF A;  3LDL A;  2P9N B;  1VQ5 N;  4CZE A;  3BEX A;  3SAH A;  2HBK A;  1Z05 A;  4BR7 A;  4IOX A;  3HBT A;  4KBO A;  4BRG A;  1RFQ A;  4QS8 A;  4JKD A;  2FSJ A;  3DWL A;  3MK6 A;  3P39 A;  2NNW A;  3R3L A;  5BRH A;  3VGM A;  3HZ6 A;  1VQP N;  4O8U A;  1T6C A;  3U8X A;  5AQP A;  5JVG L;  1E4G T;  2NRH A;  3VF6 A;  4BRM A;  5TKY A;  2QWP A;  3LL3 A;  1VQ8 N;  3QIC A;  3W0L A;  4KH4 A;  3F2K A;  3EN9 A;  4WQ4 C;  4B1W B;  1JJ2 M;  2CGJ A;  1C0F A;  2ZGY A;  1GLA G;  1TYQ B;  1JCE A;  4Z94 A;  4DHY A;  2GEM A;  3CQY A;  2EWS A;  5M1N A;  1GLD G;  3D2E A;  4IO8 A;  3BP8 A;  3WXJ A;  3EKS A;  4JD2 B;  3A0I X;  4CZK A;  5AZJ A;  3FR0 A;  1P8Z A;  2D0P A;  3CI5 A;  3O80 A;  4YDU A;  5KPT A;  1MWK A;  3ZX2 A;  4IEE A;  4AF1 A;  1ZC6 A;  3HOT A;  1ATR A;  3LM9 A;  4ILJ A;  2Q36 A;  3CER A;  4B1V A;  4RWT A;  2NRZ A;  5AQN A;  3C6A A;  2VCP A;  3H1V X;  5JLH A;  1X3M A;  2IVO A;  4GY2 B;  2P9I B;  3PLA A;  3ENB A;  4XH4 A;  2PFU A;  5AQW A;  4BC4 A;  4R79 A;  3DXM A;  2V7Z A;  3GDQ A;  3MN7 A;  3VEN A;  3WXL A;  3ZX0 A;  1RGI A;  1BUP A;  1ZBS A;  4PL8 A;  2ZGZ A;  4BR2 A;  3CPE A;  5AQG A;  5AR0 A;  1QHA A;  1GLF O;  3EZW A;  3IUC A;  5AFU H;  4BRF A;  3JS6 A;  1YIJ N;  2GTD A;  2JWK A;  1YF5 L;  4JHD B;  3FE1 A;  2P9K A;  4M7X A;  2CH5 A;  3CF5 L;  4FWL A;  2NRV A;  4FWM A;  4KH6 A;  4A59 A;  3ZEU B;  1XC3 A;  2QWQ A;  3GBT A;  3LM2 A;  3NMU A;  3R8E A;  2NLX A;  1HKB A;  4GNI A;  3G71 N;  5CR4 A;  2P9P A;  2NRW A;  2OTL N;  3H1Q A;  4I6M A;  4J8F A;  3OBW A;  4FOE A;  3T69 A;  3TTF A;  1WOQ A;  4BRA A;  4CBW A;  4CZH A;  1ATS A;  3E9L A;  3GG4 A;  1HJO A;  3NVM A;  4JAX A;  2D4W A;  1G99 A;  1KXP A;  2WFB A;  4FWQ A;  5TKW A;  3WXI A;  4U67 L;  1K9M O;  4CZM A;  2GWK A;  4IJA A;  4A57 A;  2ZJR L;  1XUP O;  2A3Z A;  5BR9 A;  3HSC A;  4IFE A;  3AGR A;  3VEZ A;  5GAE P;  4PHT X;  1VQK N;  2QW9 A;  5F1X A;  3I56 N;  2QXL A;  1GLL O;  3H45 C;  2QTD A;  5HL7 L;  3O9S A;  3KVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...