3N4PA

Human cytomegalovirus terminase nuclease domain
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
246
structure length
216
Chain Sequence
LITDQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAGTGVAAVGAYRHQFLIYGLEHFFLSESSEVAIAECAAHMIISVLSLHPYLDELRIAVEGNTNQAAAVRIACLIRQSVQSSTLIRVLFYHTPDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIKASQELVSYTIKLSHDPIEYLLEQIQNLHRSDDLIIAVIMATYLCDDIHAIRFRVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Terminase subunit UL89 protein
publication title Structure and inhibition of herpesvirus DNA packaging terminase nuclease domain.
pubmed doi rcsb
source organism Human herpesvirus 5
molecule tags Dna binding protein
total genus 73
structure length 216
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.320 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3n4pA00
4IOXA 3N4PA 3N4QA
chains in the Genus database with same CATH superfamily
4E1JA 5LL6Z 2E2QA 1OVQA 5FROA 3TAQA 3LAKA 2HW3A 3P31A 5KPZA 5CHIA 1IKYA 4CGFA 3FLCO 3R3LA 3ZYYX 4FLXA 4M45A 3KK1A 4ID5A 1HMVA 1REVA 3SPZA 3I33A 3SNNA 4CZMA 4DTSA 4A59A 2BANA 3HOSA 4CGIA 2I7NA 2Q31A 2OPSA 4FWLA 4FWOA 4RW9A 4WYBA 2B5JA 2F4VK 3KWGA 4CESA 1CLQA 3FFIA 1NJXA 3AAQA 3AVMA 3U6FA 4H0XB 4WQ4C 4CZLA 5TKWA 3AVNA 2G8KA 3T1AA 4ELTA 4ISGA 3OYMA 2OTJN 3P38A 1IO2A 3KD5E 5C10A 3VQ4A 3O3HA 3VGKA 4CJSA 4FJ9A 3FGUA 1Y64A 3PIOL 1NGEA 1F21A 3C6HA 1B9DA 2P9SA 2HHWA 5KPRA 5GADP 1C0TA 1NGJA 1WSEA 2HB5A 1EETA 1ZBFA 3O1WA 4Q5VA 3GL1A 4EP4A 5HROA 4BR9A 3HL8A 3MK6A 1TAQA 3TU5A 1GLLO 3I8DA 3MN5A 2FF6A 1JJ2M 5J2NA 1NM1A 4ILJA 1FK9A 4B08A 1RT3A 2V7YA 1N34K 1IG8A 2E1YA 3SJHA 1WLJA 3O4WA 1VQLN 1MU2A 3ZEUB 5GINA 3NHGA 1GLJO 5HRRA 3D7EO 4JI1K 4NXNK 4BE1A 5LJVA 5E26A 2IAJA 2KLAA 5AQHA 2D0AA 1HNXK 4QS9A 3HXMA 2E88A 4GV9A 2DPNA 4IJNA 1KXPA 1BIZA 2F8TA 2HHUA 2O4IA 4PKGA 5DK5A 1RDDA 3CJAA 3HP9A 1KFSA 3D0PA 1RTHA 5AQNA 4N5SA 2RN2A 1DLOA 4JKBA 3DLEA 4EP5A 3J8AA 5HRPA 3K5NA 4ISFA 4JYAK 4YORA 3G10A 3CQ8A 4YHHK 3AVJA 2O8EA 1C1CA 2NRXA 2GUPA 4DCHA 1EXQA 1HKBA 1NGAA 3HK2A 4I7FA 1NGFA 3P5JA 4J2EA 1S3XA 3BZKA 4CZEA 3DI6A 4BR5A 4H5TA 3G6EN 4KB1A 4FK4A 5AQYA 1JLGA 1RDWX 4Z4HA 3RRHA 4PA1A 1VRUA 1U47A 1GOCA 4AHSA 4C1NK 2DTUA 3GBTA 4CGJA 1JL1A 3U3YA 2HF3A 3OS1A 3ALYA 3ULEB 4DV4K 3SYZA 4AH9A 3LZJA 2AA4A 4OJRA 4FVUA 3EZ5A 5BPLA 4F2RA 4BR4A 3ULEA 4DU3A 4FJKA 1ZBSA 4AHVA 2Z1JA 1S1UA 4HHTA 5E84A 2W40A 2GBZA 3MDQA 3HPOA 3V1RA 1YT3A 4XH5A 4E3SA 1T3VA 3I8BA 3S3NA 4IG3A 4DUYK 1VSFA 4OPJA 1RDAA 1TAUA 3WXKA 3QO9A 4H5WA 2NRHA 3CQYA 3SAFA 1T7PA 1ASWA 3E9OA 4F8RA 4PY5A 3QERA 4IO9L 3OYJA 3BZCA 1T03A 5CYQA 2UXDK 1BU6O 3AO1A 4BY9C 1D5AA 4FPBA 4W5OA 2NRTA 4OKKA 1LV5A 3O4QA 4LH4A 1I94K 5M1FA 3ZT2A 1YVNA 1GLEG 4CEOA 4OVLA 1RDUA 4JNEA 4DUZK 1IBMK 1NGBA 1VQ7N 2Q1NA 3M8RA 1HNVA 4R79A 3OBYA 2IC3A 3WNHA 5DM6L 1HLUA 4BDZA 1ATSA 3EN9A 5BRHA 2NUBA 4G9ZA 3BF3A 1QZ5A 3IS9A 1JL2A 4BQZA 4B9SA 4H0OA 4KV8A 4CEEA 2YNIA 3PX6A 3NVKA 4XIUA 4CJQA 1ESVA 3GE1A 4CE9A 5AQRA 4CJWA 4BR0A 1OKJA 3WNFA 2KFZA 4X65K 1VQPN 5JICA 3S3MA 3LAMA 3A5MC 3VEVA 1JKHA 1XHXA 4TSXA 4KRFA 2AP1A 3L4IA 3UIQA 4B9QA 4CHYA 1QSYA 3E66A 2X6SA 4LY7A 1MWMA 3CJBA 2KKZA 3CFPA 1BWFO 2ZM6K 1NGDA 4K41A 2E5LK 3SPYA 4ILHA 3SUNA 2GUIA 4JKAA 4C8KA 3TABA 4DV5K 1NOYA 3DWLA 2G8FA 4F4KA 2D4WA 3ITHA 4WQ5C 4CJTA 4FJIA 5EOYA 4DR2K 1BUPA 4FXDA 5C2FA 3OTOK 1JCFA 3MAQA 3P1GA 3QIPA 2GTDA 3O9QA 3VGLA 4QOZB 2WBNA 2DFEA 5MLCQ 2OPPA 3AO5A 5D3GA 1W0HA 2BTFA 4ZTJA 1LAWA 4M3WA 5J2PA 3ATVA 2ZQBA 4DB3A 4BRMA 3DLBA 2P9KB 1NWKA 4U67L 4KAZA 2XY7A 4DQRA 4B1VA 3AVIA 1VSIA 3WEEA 1WAFA 3FZFA 5AR0A 1A5XA 3CXCM 1YIJN 2P9KA 1YHQN 3AVFA 3OS0A 4JEPA 2Q3SA 4V19S 3MXJA 4CECA 4O44A 1EP4A 5C0YA 3V6DA 4FK2A 1YI2N 3DOLA 3L3VA 4JKGB 3OBWA 4M63C 3A5LC 3VA3A 2IGIA 3MCPA 5KRTA 1KD1O 3SLCA 4JKGA 3D45A 4LF7K 2YHBA 2JWKA 3E9LA 4BRIA 1CZ9A 1TV6A 1Z6RA 3SQ1A 1U4BA 2YX6A 3OYBA 2BE2A 4CZGA 4FL9A 4LC9B 4JI4K 3J7ZO 3VQBA 2V51B 4JKDA 3O9UA 3E1YA 4BRCA 4IG0A 4WF9L 2ATQA 3CM5A 2OPRA 4KH4A 2IVOA 4FWNA 2A3ZA 3LP1A 3DLLL 1K73O 4HUEA 1S9EA 2B4JA 2Q36A 3I55N 3NVMA 3O8MA 1KVBA 5H1SQ 3CFRA 1LW0A 4IXCA 2Z1GA 1NNEA 2FBTA 4O5BA 4DV2K 3L4QA 3IAYA 1Y97A 2D5RA 2HHXA 1V4SA 2FXUA 4BRDA 3F5TA 1SZ2A 2KZMA 4CHOA 1EO1A 3RSEB 4CK3A 1J5OA 3V9SA 3S9HA 4M3XA 4BR7A 4B3SK 1YJWN 5FLXO 3RSEA 3CCEN 1N33K 4KHPK 1JLEA 3K5LA 2O8CB 2Q97A 4GV6A 4JKCA 4K42A 4KHYA 4BACA 1K6YA 4CHPA 4A2AA 1QHTA 2DFHA 1NJWA 2P9UB 4AHCA 3J7YP 1TUYA 4CIEA 4CJFA 5C2DA 1KLNA 1KTQA 1YVUA 1EQYA 3QB0A 2P9UA 1JXBA 3SAGA 4YDUC 3IUCA 1D9DA 4CI6A 1EX4A 1NBWA 4CVNE 2Y1IA 2GV9A 4AHTA 3HO1A 3QLHA 4IWVA 4BG8A 3QEPA 5I42A 4RG8A 4ZHRA 4Z4FA 5AQWA 4BDPA 3CD6N 4L3QA 1NOZA 1TKTA 4LSLA 3L8BA 4CHZA 4B9NA 4FOIA 2VGNA 1L3VA 4J8FA 2FBVA 5AQXA 3TAEA 2UYTA 5BRFA 1ZBUA 4AHUA 1QQNA 4YOWA 2O8BB 3VQ6A 4HTLA 4H0PA 4GY2B 4BRHA 4KO0A 1E3MA 5TKYA 1QVFM 4C8OA 4JI0K 2OCEA 2E2PA 3AO3A 2D0CA 4A2BA 2XY6A 4KH6A 3NDKA 3I56N 4B9UA 1KCFA 1S1VA 3AA4A 2YKNA 4CERA 4O4GA 4NLCA 3ZX0A 3CC4N 2KFNA 4OX9K 4JI3K 1M90O 3OY9A 1HKGA 3K5OA 4GVMA 4N56A 2QM1A 3A8YA 5AZIB 4QS7A 4AHRA 3BGRA 2A41A 1JLCA 4JHDB 1ATNA 3NMUA 3OYIA 3CCVN 5AZIA 2RKIA 3F73A 4K25A 4DSIA 4JHDA 2OTLN 2IVPA 2QWLA 3EL2A 1VQON 3BUZB 2P9LB 3FZMA 1TUUA 2G8HA 3O5BA 3MX2A 4FJXA 1C0MA 3MWTA 1S1TA 4A57A 2G8WA 4FK0A 4FJGA 3SQ4A 2P9LA 2PBDA 3FE1A 3HTVA 4DTNA 3O80A 5KI6A 4EFHA 4DV6K 3EO3A 2I5JA 4B1ZA 2OZSA 3AY9A 5LMUK 2YHAA 2B6AA 4DTOA 1KLMA 3U9DA 5I9EB 1ZBIA 3A0IX 4OPAA 4YNQA 2QWPA 1Q9YA 3LM2A 3U4LA 3PY8A 4DTXA 1NGGA 4CHQA 2YNHA 1KAXA 1W9HA 2QWMA 2NLXA 4NLBA 2CH5A 2CGJA 2JWLA 5JVHL 1S5JA 1NK8A 5M1OA 4IJAA 2YNFA 3B6OA 2VYPA 4DV1K 2X6NA 3DLKA 4BC2A 4CW7B 3KK3A 1B9FA 3C6TA 5BREA 3MXIA 4FLVA 1SS6A 1DTTA 1JCGA 3ULDA 2RPIA 1CXUA 2F8SA 1SL0A 2WFBA 1BA0A 4M42A 3L3UA 4NXMK 4ICLA 4DQ8A 1VSDA 1KSPA 3SAHA 3LP2A 1VQ4N 1SV5A 3M6GA 3CERA 4BC5A 4JI7K 1KAYA 3MWPA 1LCUA 3O3GA 3LDSA 3DRPA 1TKDA 1WN7A 4W5NA 1P90A 5HRSA 1Q82O 1H1VA 5LMNK 1L3SA 1EKEA 1QVGM 1GLFO 3WXMB 1XNQK 4BGBA 4I2QA 4JI5K 1HJRA 4LSNA 3M1FA 2ASOA 4Y0WA 2ZWHA 4WFAL 3DRSA 2XHBA 4KREA 1NJIO 3QEWA 1VQNN 2VWKA 1UA0A 3QBWA 3DLRA 3DYAA 4DV0K 3VQEA 3CF5L 4WFBL 5LJWA 1ZYQA 1HR0K 3KLGA 4B3TK 4DTRA 3T7ZA 2HHQA 2P1JA 1JCEA 5CR4A 1QTMA 3U8XA 1VQKN 3NAEA 3T1YK 2UUBK 4DSLA 3KKRA 5AQUA 3RR8A 4KHWA 3QINA 1RBUA 3SUQA 4JI2K 3NE6A 3LDPA 1IG9A 2E20A 3ZSZA 1WSJA 3UKRB 3ZEUA 4EHTA 1BO5O 4H0VB 3R9PA 1N5YA 5ELZA 3RR7A 3KLEA 3O6WA 2WONA 2E2OA 1HQEA 3MN6A 1NK9A 4BROA 2QWNA 3WQUA 4MLHA 1GOBA 1TL3A 3KD1E 4O0JA 4PQUA 1YJ9N 3RWUA 3TR8A 3L2WA 4E7KA 3VQ8A 3VTHA 1NGIA 4AM7A 1Q86O 3WNEA 3K59A 3ENOA 1BI4B 3H08A 3OYHA 4E7LA 1VSEA 5F1XA 1LAVA 2F9WA 1VHXA 3KHYA 4BG9A 1BI4A 3DXMB 2OANA 1G99A 2HVHA 2PYJA 4M3RA 5JVGL 3PX4A 4OGEA 3HBTA 3N4PA 3OYEA 4B9TA 3OYGA 4E7IA 3QEIA 1UWBA 5DMRA 2WC9A 3MN9A 3OVNA 1NG9A 4LF5K 5AQGA 1NLVA 2OA8A 4JKFA 3FZLA 4CF2A 2G8UA 2ETJA 4NCAA 3H3NO 4OPHA 1J9AA 1UOCA 4Z0UA 4GKKK 3CJ1A 4GKJK 1C1BA 2WUSA 3I0RA 2YNGA 3D2FB 1Q9XA 4LFCK 2D1KA 3C94A 4CJ7A 4WE1A 4IZ9A 3FZHA 1T6CA 2W6LA 1KVAA 3WUHA 4KFBA 3HM8A 1NGHA 3QDKA 1U49A 3M8PA 3ZT3A 1XNRK 1Z25A 4CD3A 3ZX3A 4B1XB 3AA5X 4LF4K 3THXB 1BIUA 2G8VA 1YTAA 4JRPA 2W42A 1RGIA 3VQ5A 4G1QA 4HTUA 1IBLK 3G4SN 1NKEA 3F9KA 2Z1IA 4NYFA 1JLBA 4PL8A 4CJRA 2DFFA 3P4IA 3E9PA 4CF0A 1FJGK 3SQ0A 5KPTA 1BOTO 4XEIA 3NBPA 4IKFA 4DV7K 3NCIA 2UUCK 1GLAG 4CJVA 2BGGA 3OA9A 4N76A 5C24A 3QEVA 2JLEA 4K43A 1Z05A 1ASUA 3EKUA 4PWDA 2VWBA 2Z1HA 1FKOA 2UXBK 3LDNA 1M1KO 3O1BA 1K9MO 5CY4A 4BE2A 4DFPA 1HNWK 2E6LA 4CBUA 2O8DB 5FDLA 3QEXA 5AQQA 3RMAA 1BQMA 3I0SA 3L2QA 1NKBA 1HYSA 4CEBA 3HSCA 1X3NA 4IFEA 4B9LA 1HPZA 4CBXA 1X9WA 2I7PA 2O8DA 2UUAK 4O55A 1GLCG 4EZ9A 2LSNA 4K8ZA 1NKCA 4LF6K 1SL2A 5JLFA 4WQ4A 3J7AP 3TSPA 3LANA 3RTVA 3VQ7A 5BN9A 3PX0A 2X78A 1W97L 1BHLA 3H45C 4XH4A 1C6VA 4K8XA 2XY5A 1WBDA 3JSMA 3A5NC 3CPEA 4FWKA 4UQGA 2FSJA 4FZYA 4BRPA 4B9MA 3M8QA 4IBNA 1U45A 4CGGA 4E1NA 3TAPA 4PKIA 3VPZA 5BPMA 1DTQA 2V52B 5C25A 1RDCA 3FFKB 1KQSM 1WUAA 3OYAA 5GAHP 4FLTA 4DR7K 4RW7A 4DFKA 2W41A 1D9FA 3NGYA 1NK4A 4QAGA 4CD1A 3ID8A 5SZTA 3UE5A 1E4GT 3V9XA 4ILGB 2NRRA 2Q2RA 2ZGZA 4B1YB 3H46O 4NB4A 5C15A 3CETA 3VF2A 3TTDA 4OO1J 3O9RA 3JAMO 4GW6A 3L2VA 2QKKA 1NU0A 3S3OA 4JKEA 4M3UA 3ISNC 5FRMA 4CBWA 3NF7A 1T44A 4DSFA 1RT7A 1ATRA 4M3ZA 3SJJA 4BRAA 3LP0A 2HNZA 2P5GA 3LDLA 4DR5K 4DHYA 5EX5A 5AQVA 4C8LA 4M7XA 5AQKA 2P9IB 3K9KA 4FM2A 1ASVA 2KTQA 1QE1A 3PUFA 4WCEL 3W0LA 4DWIA 3J80O 2P9IA 1Q7YO 4JS5A 5HP1A 1WSGA 4PKHA 3MEGA 4JS4A 2O4GA 5KQDA 5HOOA 5AQSA 1S9GA 2QXLA 3VQAA 4CF9A 3VF4A 3LM9A 1XWLA 2E1ZA 2QW9A 3D6RA 3CJ7A 4XH1A 1VQ9N 3KLIA 2FF3B 1NK0A 5M1KA 3H1VX 1ZBHA 1D8YA 5GIPA 3MMVA 3V1QA 4CF1A 4CEQA 5HL7L 2ZJPL 1WBBA 3DOKA 1WNSA 4CZHA 4NCBA 5CZ1A 3NF6A 1U6ZA 5AQFA 4BRKA 4Z4CA 4U7BA 3KZBA 2ASMA 1I39A 4CJLA 4Z4GA 1ZC6A 4KB0A 1KC8O 4BE0A 3M3ZA 3M8SA 4CJKA 3AARA 4KH5A 3OYNA 5DM7L 4GV3A 3VOVA 3VA0A 1S72N 1K8KB 1VQ8N 2F7TA 4MQ3A 3VENA 3WXLA 3QNNA 4HVJA 3KWIA 3CCMN 1HUXA 3NH2A 4X62K 4CJUA 1K8KA 2XO7A 5I3UA 1HX1A 3CFOA 3NF9A 3CHWA 3LDOA 1GLBG 5E41A 1QZ6A 4I9LA 4NCGA 3KVGA 5AQTA 1FW6A 3CIPA 4LF8K 4KHSA 3EE8A 4OKEA 4B8CA 2VGMA 5C12A 2OYQA 3ASMA 4DU4A 1N36K 4H03B 4FYDA 2O8CA 4AILC 4BWJA 3VQPA 3O9SA 3VEYA 2HHTA 1HKCA 3HVRA 4CZIA 1J6ZA 1BDGA 3VERA 4BRFA 4DSKA 4B8AB 5CZ2A 3ZSXA 1T05A 4IFYA 4O8KA 2QWRA 3ZSQA 3NH0A 1W2BM 3K0SA 3B6PA 2RF2A 3OJUA 3ZETB 1X3MA 1U04A 2BH1A 3SUPA 1HJOA 4FJ5A 3ZETA 1CXQA 2QWQA 4BR2A 3ZT4A 3VESA 4AQYK 4LH5A 2GELA 2A42A 4FWQA 4H0YB 4CIFA 2FLOA 4HWIA 3CPWM 3THVA 1ZXOA 3T19A 1XC3A 3JS6A 4KTQA 1TGOA 4O8UA 4NO7A 1NK7A 2ITGA 3QESA 4EIAA 3SV4A 4CGHA 3ATUA 1N6QA 4CGDA 1FXXA 1HNIA 3O9TA 4DLEA 2O8BA 2A1SA 4IEIA 1QQOA 3V81A 4C8NA 5J2QA 4MFBA 2ZD1A 4JKHA 5IWAK 4Z4IA 1Q18A 2UXCK 3TAFA 1QQCA 5F2RA 4CHNA 1GLDG 2J4RA 4DQPA 1TL1A 4JAXA 1NMNA 1X9MA 2IOCA 3LWLA 4FZXC 3G0ZA 1YJNN 1RFQA 1SQKA 2QK9A 1TYQB 4YOVA 4WQ5A 2ZF5O 1DGKN 4O5FA 4RTFD 3PSFA 5FPMA 4E89A 4BVPA 1Q81O 1RBTA 4JV5K 1TYQA 2D0BA 2DY4A 2D0OA 2CGKA 5AZJB 4CEAA 4FO0A 3OYDA 5KTQA 4JLHA 1N8RO 1U48A 2P5OA 3DLGA 4KI6A 1XC9A 3VN5A 1L3TA 3CC2N 1JLQA 1RT1A 1DKGD 3OHRA 3IKMA 3QETA 3SZ2A 4CFDA 2E6MA 4E7JA 1C1AA 2A5XA 3TWHA 3VEXA 1J5EK 4E19A 3ZSYA 4B9VA 4DFMA 1IJJA 2A6AA 3SBTA 3RVCA 1ILYA 1OH6A 1LOTB 2NRWA 3Q7BA 4CFCA 3TANA 3A2FA 5M1PA 2HMPA 3HVTA 1TK5A 4L8RB 4FW1A 4C23A 2YI1A 3IG1A 4DG1A 3CMAN 2PYLA 5JLHA 4FLWA 5FRNA 3ZT1A 5EU7A 2VG5A 3ZSRA 2D0PA 1WSHA 4LFAK 4OPKA 1VSHA 2IVNA 3BF1A 5HBMA 4IDKA 3UKUB 1Z26A 5T7BA 3CJCA 3PSIA 4ELVA 1YF5L 1KRPA 3AA3A 4FWPA 1VSMA 4HUFA 2ITMA 1BQNA 3WNGA 3UKUA 4FOEA 1Q8IA 1D4XA 1BISA 3SQ2A 4PUOA 3IFRA 2V7ZA 3QNOA 2GWKA 3V1OA 1RDBA 4OGCA 4IFVA 3AGKA 4YY3K 4CK1A 1QSLA 3AVKA 1NJZA 1NMDA 4UY8O 2IS3A 3VQQA 4MDBA 3AV9A 4RW6A 4C8MA 2HBKA 4FJNA 3EYZA 3PLAA 4CJ4A 4FLUA 4B3RK 4HCBA 4H5RA 1IH7A 2GX9A 1S1XA 2HBLA 5ADXH 3EE9A 3WT0A 1YAGA 4AM6A 4BREA 5JS2A 2P9SB 4MDAA 4DTUA 3L2UA 4FW2A 3IMXA 1VRTA 1RILA 3CCJN 5C42A 3LP3A 3IRXA 3QFPA 4I2PA 5KGWA 4AF1A 1JLAA 3DJCA 3MN7A 2VWJA 5HLFA 4ID1A 4DSJA 2ZE2A 3IDHA 3HI0A 4YDUA 4Y1DA 4H4MA 4CFBA 5ADXA 1QQMA 4IOAL 2QWOA 1NJYA 1G15A 2HNYA 3PO4A 3RMDA 1C0GA 1RTJA 4RW8A 4KHQA 1LWCA 4W5TA 2FC0A 5A2QO 2Q0UA 2YHYA 3FR0A 4CEDA 4RCHA 3UKRA 3PIPL 3U9ZA 1BCOA 1RTIA 1BL3A 3CMEN 3KIOA 3DMJA 3HSTB 3L6QA 4FJHA 2A40A 4KHUA 2PFUA 4BC3A 3OYCA 4JD2B 1C0UA 3AVCA 4FLZA 4DMNA 1YXQA 3ENBA 4ISEA 4YOUA 4BRQA 3TI0A 3OYFA 4DSEA 3SMPA 3DAWA 4JD2A 4DR4K 1EWQA 3HT3A 5KRSA 4FVMA 5AFUH 1DT9A 4QS8A 5FPDA 5FPEA 4JK9A 1HYZA 3T3FA 3CM6A 4LF9K 3DXKB 2O8EB 2X74A 3EZWA 1K8AO 1LWFA 3VGMA 3DXMA 1E4FT 1YUWA 5AQIA 1QSSA 3DXKA 3VEOA 1NK5A 3EEQA 2ZJRL 2YHWA 3C95A 3NGZA 1DEJA 2HNDA 3PV8A 5AFUA 3KLFA 3OW2M 1UA1A 3ZSOA 2KHOA 4DR6K 1WSIA 4CEFA 4KKOA 3T69A 4ZTFA 5GIOA 3HM9A 1VSKA 4FM0A 3N4QA 2JGUA 3D2EB 3SBGA 3D2FA 3F9MA 3LALA 4KI4A 3MCAB 3T1HK 3CJ9A 4DKWA 1RBVA 2FSKA 3KTQA 1IKXA 2CGLA 1HYVA 3D2EA 4J2AA 4A61A 4W5QA 4J2BA 4A5BA 1TKXA 1IKWA 2W6KA 3K57A 1WB9A 1TK8A 1HRHA 3CQXA 1IKVA 3EKSA 1N32K 1CZBA 3THXA 1RT5A 3ZX2A 3THWB 1VSJA 1XQSC 1X1PA 4MLEA 3MEDA 5JS1A 3O08A 3THWA 3C7NB 5AQOA 2H3GX 2NNWA 4M3TA 3VETA 1JXEA 4DTMA 3M5RA 4Y1CA 3C7NA 3JYTA 4DR3K 3HJFA 4DF8A 2A1RA 3AAPA 4A62A 2BUPA 4BDYA 4JI8K 5J1EA 2IIRA 4OLAA 1VQMN 4BRNA 1LW2A 1QS4A 3O3FA 3JXUA 3GDQA 4O0IA 4OLBA 4EHUA 2OZMA 4FM1A 4CF8A 4YOXA 3UB5A 1A5WA 1TKZA 3TAGA 3VF6A 5CE3A 3OYKA 3AGRA 1S6QA 4X66K 3VQCA 3GOIA 4R5PA 2HF4A 4CZFA 4CJPA 4F3OA 1SKWA 2VG6A 4FWRA 2KQ2A 4FCYA 3AO4A 3AVHA 4I9QA 3AA2A 5BR9A 3K5MA 3KK7A 3NF8A 2QA4N 2WTUA 4Z4EA 4DR1K 2G8IA 4FZZA 4FJJA 4BRGA 3QBXA 2QXFA 3C6UA 3HZ6A 3ENHA 2P9NB 4E1MA 3NFAA 4W5RA 3F2KA 4JN4A 1U2VB 2P9NA 1WOQA 3QFUA 3W3DA 4CZJA 4BQLA 1P8ZA 4JK7A 1L3UA 2QKBA 1U2VA 4OKJA 3QMLA 4BWMA 5BPNA 1VAZA 3TTCA 3SI6A 1SUQA 1T6DA 4M3YA 1RNHA 3HP6A 4C1NI 4H8KA 1IBKK 3K58A 1BA1A 1V4TA 2YV0X 4KTZA 4H4OA 1KFDA 2ZGYA 1YTUA 4FJ8A 4A5AA 1HPMA 5SWMA 2KZZA 4DTPA 2R7YA 4GNIA 5KGXA 5B8HA 1X9SA 1MA9B 3OJSA 4BRLA 4CZKA 1YITN 4DFJA 1IV0A 4LFBK 1BCMA 2FBXA 1XHZA 4BGAA 4CJ3A 3O4NA 4FLYA 1OVYA 1LWEA 4M7YA 3WXJA 1VQ5N 1XUPO 2CH6A 3P83D 3R1XA 3ID6A 1MWKA 3HPGA 4BC4A 3V4IA 2RHKA 2PAVA 4WFNL 4DQIA 3LPTA 1BG3A 3ZLJA 2EWSA 3C0BA 3HOTA 1RBSA 3LDQA 4H5NA 5M1NA 1J53A 1FKPA 3SCXA 4N47A 4YOYA 4CJEA 2YKMA 3C6AA 1EWRA 2QI2A 5JMVA 4DQSA 1SKSA 3VEWA 3WEEB 4IOCL 3L0QA 3KLHA 3RMCA 4KBOA 1NGCA 4B1UB 5AJ3K 2WOMA 5BRDA 3HRGA 4HUGA 3Q7CA 3V9UA 2F9TA 4DTJA 3ZSWA 1ITGA 3U3GA 2XY8A 3CCRN 4FJ7A 5AQJA 4JK8A 2OPQA 3OYLA 2Q0RA 1S1WA 1GOAA 2YJEA 5AQLA 4RW4A 4CJ5A 3FZKA 2HBMA 2NZTA 4YOTA 3VEZA 1SAZA 4KPYA 5GAEP 1S6PA 3QIOA 3DM2A 3OS2A 3B8AX 4HCCA 3RRGA 3ZT0A 3TTFA 3TARA 1HNZK 4F9OA 2FSNA 3TSQA 3V9WA 5GAGP 5LY3A 1OH5A 4MO4A 4CK2A 1RT6A 3S41A 2EX3A 4IOXA 1O1WA 1TVRA 4LD0A 3CCSN 1XMQK 2FBYA 1VK0A 1BGXT 2IDOA 1W7AA 1OH7A 2HBJA 3SUOA 3VQ9A 4EZ6A 2QEXN 3MECA 2VQEK 2RE2A 1KVCA 3EY1A 3BEXA 2F96A 2E8AA 4DQQA 3AVLA 3TAMA 3THYB 2HHVA 1XMOK 3E01A 3TSUA 2AJQA 2EHGA 3THYA 3BDPA 3WQTA 2PY5A 4B1WB 3TPQA 3HYFA 3H1QA 4IO8A 2NRVA 2YHXA 2ZJQL 3CI5A 4E7HA 4JRQA 4IDHA 4DS5A 5EXWA 3CYMA 4FWMA 3KK2A 4B3MK 5EY4A 2HHHK 4X64K 4DV3K 2YCHA 1TK0A 1UAXA 1S22A 2P9PB 5CYMA 3P39A 4M41A 4CEZA 3LZIA 3CG7A 1WSFA 3VQDA 2P9PA 5FPNA 3PO5A 1I3AA 1O13A 1VSLA 1OH8A 3H6EA 3CCLN 2VQFK 3CC7N 3AVGA 4H5VA 2E4LA 4FJLA 1SKRA 2HMIA 3AO2A 2HSTA 4CFAA 4CIGA 3RMBA 5BR8K 5AQMA 3ZCMA 1KAZA 1WAJA 3KKSA 3NH1A 3DLHA 3VTIA 4QCLA 4YFUA 3GG4A 5HRNA 3MEEA 2QTDA 1RCHA 3AVAA 3CCQN 5F0XA 4KHNA 3MX5A 1VQ6N 1X9JA 1T8EA 1C0FA 5BN8A 4CCHA 3VMFB 1ZBLA 2Y1JA 4Q0BA 1R59O 1CZAN 4GVEA 5AQZA 1B92A 5IT9O 4J2DA 2HVIA 4RWTA 3H3OB 2E2NA 4EAHD 3BY5A 5K14A 4F3TA 4DU1A 3R6MA 4N41A 3K9JA 2GEMA 1L5UA 3DRRA 3LL3A 5EVZA 3R8EA 3NGIA 2VG7A 2GWJA 4PHTX 3QICA 5AZJA 2YJFA 4FJMA 1HQUA 2XRIA 4KTWA 4GMJB 4I6MB 1R0AA 3SMSA 3KJVA 4F2SA 4PL7A 4E0DA 1MDUB 3G71N 5KQ8A 4FWSA 4IEEA 4I6MA 1JLFA 4DS4A 4ELUA 5AQPA 3J81O 4JI6K 3MXMA 2HHSA 1J54A 3AVBA 1NK6A 3LWMA 4BVOA 3A5OC 3HPHA 1A5VA 2HOEA 1SL1A 2O8FB 3WXIA 4K0KK 3BP8A 3SV3A 4DF4A 3LPUA 3K2PA 2VCPA 2NRZA 1RTDA 2O8FA 2PZSA 4FPAA 1RT2A 5J2MA 2BDPA 1RT4A 2ASPA 4Z94A 2P51A 3G25A 4DLGA 4B3OA 3ZSVA 4MO5A 3V9ZA 1RBRA 5M1QA 3L2RA 3CCUN 1XI1A 1QHAA 4FSVA 3SK3A 2KW4A 4H0TB 4NYNA 3C65A 2UU9K
chains in the Genus database with same CATH topology
4E1JA 1TUYA 5AFUA 2E2QA 4CD1A 3OW2M 3ID8A 5C2DA 3UE5A 2KHOA 1EQYA 3QB0A 1E4GT 2P9UA 3SAGA 4ILGB 3T69A 4YDUC 2NRRA 3IUCA 3P31A 2Q2RA 5KPZA 5CHIA 2ZGZA 4B1YB 3H46O 4NB4A 5C15A 4CI6A 3CETA 3FLCO 5GIOA 3VF2A 3TTDA 3R3LA 3ZYYX 3O9RA 4OO1J 1NBWA 3N4QA 3D2EB 4JKEA 3D2FA 3SBGA 3F9MA 3I33A 4IWVA 4BG8A 4CZMA 4CBWA 3MCAB 5AQWA 4A59A 3CJ9A 4DKWA 3HOSA 2FSKA 2CGLA 2I7NA 1T44A 2Q31A 4FWLA 3D2EA 4L3QA 3CD6N 1ATRA 4FWOA 4WYBA 4A61A 3KWGA 4BRAA 4A5BA 4FOIA 2VGNA 3AAQA 4J8FA 3LDLA 4DHYA 5EX5A 5AQVA 5AQXA 3EKSA 3CQXA 4H0XB 4WQ4C 4CZLA 4M7XA 2UYTA 5BRFA 5AQKA 5TKWA 2P9IB 3K9KA 3ZX2A 4WCEL 1QQNA 4YOWA 1XQSC 4ISGA 4HTLA 2OTJN 3P38A 4H0PA 4GY2B 4BRHA 4MLEA 3W0LA 5C10A 3VGKA 3FGUA 3O08A 2P9IA 5TKYA 1Q7YO 1Y64A 3PIOL 1NGEA 3C6HA 3C7NB 5AQOA 1QVFM 2H3GX 2NNWA 2P9SA 4PKHA 2E2PA 5KPRA 4A2BA 5GADP 3VETA 4KH6A 1NGJA 5HOOA 5KQDA 3O1WA 3I56N 3M5RA 5AQSA 3C7NA 2QXLA 3GL1A 3VF4A 3LM9A 4BR9A 3MK6A 2E1ZA 3TU5A 2QW9A 3AAPA 4NLCA 3ZX0A 3D6RA 4A62A 2BUPA 3CC4N 3CJ7A 1GLLO 4XH1A 3MN5A 1VQ9N 2IIRA 2FF3B 2FF6A 1M90O 1JJ2M 4BRNA 1VQMN 5M1KA 3H1VX 3JXUA 3GDQA 1HKGA 5GIPA 1NM1A 4EHUA 4ILJA 3MMVA 2QM1A 5HL7L 3A8YA 2ZJPL 2V7YA 3UB5A 4YOXA 4CZHA 5AZIB 4QS7A 3VF6A 5CE3A 2A41A 1IG8A 4JHDB 2E1YA 1ATNA 1U6ZA 3SJHA 3CCVN 5AQFA 3NMUA 5AZIA 3AGRA 3O4WA 3GOIA 4BRKA 2HF4A 1VQLN 3ZEUB 4U7BA 3KZBA 4CZFA 5GINA 2ASMA 4K25A 1GLJO 4JHDA 1ZC6A 2IVPA 2QWLA 3EL2A 1KC8O 3D7EO 4FWRA 3BUZB 1VQON 2OTLN 3M3ZA 2P9LB 3FZMA 3AARA 1TUUA 5LJVA 3O5BA 4KH5A 5E26A 5DM7L 5BR9A 3MX2A 2KLAA 3KK7A 4GV3A 2QA4N 3MWTA 5AQHA 3VOVA 4A57A 1S72N 1K8KB 1VQ8N 2F7TA 3VENA 3WXLA 4QS9A 4GV9A 2E88A 4BRGA 2P9LA 2PBDA 3QBXA 3FE1A 3KWIA 2DPNA 4IJNA 3HZ6A 1KXPA 3HTVA 3ENHA 3O80A 3CCMN 1HUXA 4EFHA 2P9NB 3EO3A 1K8KA 4PKGA 3CJAA 4B1ZA 3AY9A 1HX1A 3CHWA 5AQNA 3LDOA 1GLBG 3F2KA 4JN4A 3U9DA 5I9EB 1QZ6A 1U2VB 2P9NA 3A0IX 4JKBA 1WOQA 3KVGA 3QFUA 4OPAA 5AQTA 3J8AA 3CIPA 3W3DA 4ISFA 3EE8A 4CZJA 4BQLA 1P8ZA 4JK7A 2QWPA 4YORA 2VGMA 5C12A 3LM2A 3U4LA 1U2VA 3QMLA 5BPNA 1VAZA 4H03B 1NGGA 2NRXA 3TTCA 2GUPA 4DCHA 1T6DA 1HKBA 1KAXA 1NGAA 2QWMA 2NLXA 4NLBA 4C1NI 2CH5A 1NGFA 2CGJA 1BA1A 1V4TA 2JWLA 3O9SA 5JVHL 1S3XA 5M1OA 3VEYA 4CZEA 4IJAA 1HKCA 2VYPA 2ZGYA 4CZIA 1J6ZA 1BDGA 3VERA 4H5TA 4BR5A 3G6EN 4BRFA 4A5AA 1HPMA 4BC2A 5AQYA 1RDWX 4O8KA 2QWRA 4C1NK 1W2BM 5BREA 3GBTA 4GNIA 5B8HA 3ZETB 1MA9B 1SS6A 2HF3A 4BRLA 4CZKA 1JCGA 1X3MA 1YITN 2BH1A 2WFBA 1BA0A 3ULEB 1HJOA 3ZETA 2QWQA 4BGAA 4BR2A 2AA4A 1OVYA 3VESA 4M7YA 3WXJA 4DQ8A 4FVUA 1VQ5N 2GELA 5BPLA 2A42A 4FWQA 4BR4A 3SAHA 1XUPO 4H0YB 3ULEA 2CH6A 1ZBSA 2FLOA 3R1XA 1VQ4N 3ID6A 1MWKA 4HWIA 3M6GA 3CERA 4BC4A 4BC5A 1ZXOA 3CPWM 1KAYA 1XC3A 2RHKA 3MWPA 1LCUA 2PAVA 2W40A 3JS6A 5E84A 4WFNL 1BG3A 4O8UA 3MDQA 1P90A 4NO7A 2EWSA 3C0BA 3HOTA 1H1VA 1Q82O 3LDQA 4EIAA 4H5NA 5M1NA 1QVGM 1GLFO 4XH5A 1T3VA 3ATUA 3I8BA 4YOYA 3WXMB 4BGBA 3O9TA 3C6AA 2QI2A 5JMVA 4IEIA 1QQOA 3M1FA 2ASOA 3VEWA 3WEEB 4Y0WA 3WXKA 3L0QA 4IOCL 2ZWHA 4WFAL 4H5WA 4KBOA 1NGCA 2NRHA 4B1UB 1NJIO 3CQYA 4JKHA 3SAFA 3E9OA 1VQNN 1Q18A 5BRDA 3HRGA 5F2RA 3Q7CA 4IO9L 3QBWA 2F9TA 1GLDG 2J4RA 1BU6O 4BY9C 3CF5L 4JAXA 3CCRN 4WFBL 5LJWA 5AQJA 4JK8A 4FPBA 2Q0RA 2YJEA 5AQLA 3T7ZA 1YJNN 1RFQA 1SQKA 1TYQB 4YOVA 4WQ5A 2ZF5O 1DGKN 1JCEA 3FZKA 2HBMA 2NRTA 2NZTA 4O5FA 4RTFD 5CR4A 5FPMA 4YOTA 3VEZA 1SAZA 4BVPA 5GAEP 3U8XA 5M1FA 1VQKN 1Q81O 1TYQA 1YVNA 3B8AX 1GLEG 5AQUA 2D0OA 2CGKA 5AZJB 1RDUA 4JNEA 3TTFA 4FO0A 1NGBA 1VQ7N 2Q1NA 3LDPA 4F9OA 1N8RO 2E20A 2FSNA 4R79A 3OBYA 3UKRB 3TSQA 3ZEUA 5GAGP 5DM6L 4EHTA 5LY3A 1BO5O 1HLUA 4H0VB 3R9PA 4MO4A 1ATSA 3EN9A 5ELZA 3CC2N 3S41A 4IOXA 5BRHA 1DKGD 4G9ZA 3BF3A 1QZ5A 3OHRA 3O6WA 3IKMA 3CCSN 4BQZA 2E2OA 2HBJA 2A5XA 3MN6A 4H0OA 3NVKA 3VEXA 2QEXN 4BROA 2QWNA 3WQUA 4MLHA 2RE2A 1IJJA 1ESVA 2A6AA 3BEXA 3RVCA 3GE1A 3SBTA 2E8AA 1ILYA 5AQRA 1YJ9N 4BR0A 1OKJA 1LOTB 2NRWA 3VTHA 3Q7BA 1VQPN 1NGIA 4AM7A 1Q86O 5M1PA 2HMPA 3TSUA 5JICA 4C23A 2YI1A 3ENOA 3A5MC 3VEVA 3WQTA 2AP1A 3L4IA 4B9QA 5F1XA 3CMAN 2F9WA 4B1WB 3E66A 3TPQA 5JLHA 3KHYA 4BG9A 3H1QA 4IO8A 3DXMB 1MWMA 2OANA 1G99A 2NRVA 2YHXA 3CJBA 2D0PA 2KKZA 5JVGL 2ZJQL 3CI5A 3HBTA 1BWFO 1NGDA 3N4PA 4IDHA 5EXWA 4FWMA 2IVNA 3BF1A 4K41A 5EY4A 3UKUB 3CJCA 2WC9A 1YF5L 4ILHA 3MN9A 2YCHA 1S22A 2P9PB 4JKAA 5AQGA 3P39A 4FWPA 1NLVA 2ITMA 3DWLA 4JKFA 2D4WA 3FZLA 3UKUA 3H3NO 4FOEA 4OPHA 1D4XA 4WQ5C 5EOYA 1BUPA 3IFRA 5C2FA 2V7ZA 2P9PA 5FPNA 1JCFA 3CJ1A 1O13A 2WUSA 2GWKA 3D2FB 3H6EA 3CCLN 3AGKA 2D1KA 4CJ7A 2GTDA 3O9QA 3CC7N 4IZ9A 3VGLA 3FZHA 1T6CA 4H5VA 2WBNA 3WUHA 5MLCQ 3HM8A 1NGHA 3QDKA 1NMDA 4UY8O 2HSTA 4MDBA 5AQMA 1KAZA 2BTFA 2HBKA 4CD3A 3ZX3A 4B1XB 3PLAA 3ATVA 4DB3A 3VTIA 4BRMA 3GG4A 1RGIA 1NWKA 2P9KB 4U67L 2QTDA 4B1VA 3CCQN 4H5RA 5F0XA 3G4SN 2GX9A 2HBLA 5ADXH 3EE9A 3WT0A 3WEEA 1YIJN 3FZFA 1YAGA 5AR0A 4AM6A 4BREA 3MX5A 2P9KA 3CXCM 2P9SB 4PL8A 4MDAA 1X9JA 1YHQN 1VQ6N 1C0FA 3P4IA 3E9PA 4JEPA 5BN8A 3IMXA 3VMFB 5C0YA 5KPTA 1BOTO 1CZAN 1R59O 4GVEA 3CCJN 4JKGB 4XEIA 5AQZA 3OBWA 4M63C 3A5LC 1YI2N 3QFPA 4AF1A 3DJCA 3MN7A 3MCPA 1GLAG 2E2NA 3H3OB 3IDHA 4EAHD 4RWTA 3HI0A 1KD1O 3SLCA 4JKGA 3OA9A 4YDUA 2JWKA 3E9LA 4IOAL 5ADXA 1QQMA 3R6MA 3K9JA 1Z05A 2GEMA 2QWOA 3EKUA 4K43A 3LL3A 4BRIA 2VWBA 5EVZA 3R8EA 1Z6RA 3LDNA 1M1KO 3O1BA 1K9MO 2YX6A 1C0GA 2GWJA 4PHTX 3QICA 4CZGA 4FL9A 4LC9B 2YJFA 4CBUA 5AZJA 3J7ZO 5AQQA 2V51B 4JKDA 3O9UA 3E1YA 4I6MB 3HSCA 4BRCA 1X3NA 4IFEA 3SMSA 4WF9L 2Q0UA 4PL7A 2YHYA 4CBXA 4KH4A 3FR0A 2I7PA 4RCHA 3UKRA 2IVOA 1MDUB 4FWNA 3U9ZA 3PIPL 2A3ZA 3G71N 3DLLL 5KQ8A 4FWSA 1GLCG 4IEEA 1K73O 4I6MA 3CMEN 5AQPA 5JLFA 4WQ4A 2Q36A 3L6QA 3I55N 3TSPA 3NVMA 3O8MA 5BN9A 5H1SQ 2A40A 2PFUA 1W97L 4BC3A 4JD2B 4IXCA 4BVOA 3H45C 4XH4A 3A5OC 1YXQA 3ENBA 4ISEA 3A5NC 4YOUA 2HOEA 4BRQA 3CPEA 3WXIA 3L4QA 3SMPA 3DAWA 4FWKA 3BP8A 4JD2A 1V4SA 2FXUA 4BRDA 3F5TA 1SZ2A 1EO1A 3RSEB 2VCPA 5AFUH 2NRZA 1DT9A 4QS8A 4BR7A 2FSJA 5FPDA 5FPEA 4FPAA 4JK9A 2ASPA 4Z94A 4BRPA 1YJWN 3G25A 3DXKB 3RSEA 3CCEN 3EZWA 1K8AO 3VGMA 3DXMA 4PKIA 2Q97A 4GV6A 4JKCA 4K42A 1E4FT 1YUWA 4MO5A 3VPZA 2V52B 5BPMA 5AQIA 5M1QA 4A2AA 3DXKA 3VEOA 3CCUN 1QHAA 2ZJRL 4FSVA 2YHWA 3FFKB 3SK3A 1KQSM 1WUAA 2P9UB 5GAHP 4H0TB 1DEJA 2W41A 3C65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOX A;  3N4P A;  3N4Q A; 
#chains in the Genus database with same CATH topology
 4E1J A;  5LL6 Z;  2E2Q A;  1OVQ A;  5FRO A;  3TAQ A;  3LAK A;  2HW3 A;  3P31 A;  5KPZ A;  5CHI A;  1IKY A;  4CGF A;  3FLC O;  3R3L A;  3ZYY X;  4FLX A;  4M45 A;  3KK1 A;  4ID5 A;  1HMV A;  1REV A;  3SPZ A;  3I33 A;  3SNN A;  4CZM A;  4DTS A;  4A59 A;  2BAN A;  3HOS A;  4CGI A;  2I7N A;  2Q31 A;  2OPS A;  4FWL A;  4FWO A;  4RW9 A;  4WYB A;  2B5J A;  2F4V K;  3KWG A;  4CES A;  1CLQ A;  3FFI A;  1NJX A;  3AAQ A;  3AVM A;  3U6F A;  4H0X B;  4WQ4 C;  4CZL A;  5TKW A;  3AVN A;  2G8K A;  3T1A A;  4ELT A;  4ISG A;  3OYM A;  2OTJ N;  3P38 A;  1IO2 A;  3KD5 E;  5C10 A;  3VQ4 A;  3O3H A;  3VGK A;  4CJS A;  4FJ9 A;  3FGU A;  1Y64 A;  3PIO L;  1NGE A;  1F21 A;  3C6H A;  1B9D A;  2P9S A;  2HHW A;  5KPR A;  5GAD P;  1C0T A;  1NGJ A;  1WSE A;  2HB5 A;  1EET A;  1ZBF A;  3O1W A;  4Q5V A;  3GL1 A;  4EP4 A;  5HRO A;  4BR9 A;  3HL8 A;  3MK6 A;  1TAQ A;  3TU5 A;  1GLL O;  3I8D A;  3MN5 A;  2FF6 A;  1JJ2 M;  5J2N A;  1NM1 A;  4ILJ A;  1FK9 A;  4B08 A;  1RT3 A;  2V7Y A;  1N34 K;  1IG8 A;  2E1Y A;  3SJH A;  1WLJ A;  3O4W A;  1VQL N;  1MU2 A;  3ZEU B;  5GIN A;  3NHG A;  1GLJ O;  5HRR A;  3D7E O;  4JI1 K;  4NXN K;  4BE1 A;  5LJV A;  5E26 A;  2IAJ A;  2KLA A;  5AQH A;  2D0A A;  1HNX K;  4QS9 A;  3HXM A;  2E88 A;  4GV9 A;  2DPN A;  4IJN A;  1KXP A;  1BIZ A;  2F8T A;  2HHU A;  2O4I A;  4PKG A;  5DK5 A;  1RDD A;  3CJA A;  3HP9 A;  1KFS A;  3D0P A;  1RTH A;  5AQN A;  4N5S A;  2RN2 A;  1DLO A;  4JKB A;  3DLE A;  4EP5 A;  3J8A A;  5HRP A;  3K5N A;  4ISF A;  4JYA K;  4YOR A;  3G10 A;  3CQ8 A;  4YHH K;  3AVJ A;  2O8E A;  1C1C A;  2NRX A;  2GUP A;  4DCH A;  1EXQ A;  1HKB A;  1NGA A;  3HK2 A;  4I7F A;  1NGF A;  3P5J A;  4J2E A;  1S3X A;  3BZK A;  4CZE A;  3DI6 A;  4BR5 A;  4H5T A;  3G6E N;  4KB1 A;  4FK4 A;  5AQY A;  1JLG A;  1RDW X;  4Z4H A;  3RRH A;  4PA1 A;  1VRU A;  1U47 A;  1GOC A;  4AHS A;  4C1N K;  2DTU A;  3GBT A;  4CGJ A;  1JL1 A;  3U3Y A;  2HF3 A;  3OS1 A;  3ALY A;  3ULE B;  4DV4 K;  3SYZ A;  4AH9 A;  3LZJ A;  2AA4 A;  4OJR A;  4FVU A;  3EZ5 A;  5BPL A;  4F2R A;  4BR4 A;  3ULE A;  4DU3 A;  4FJK A;  1ZBS A;  4AHV A;  2Z1J A;  1S1U A;  4HHT A;  5E84 A;  2W40 A;  2GBZ A;  3MDQ A;  3HPO A;  3V1R A;  1YT3 A;  4XH5 A;  4E3S A;  1T3V A;  3I8B A;  3S3N A;  4IG3 A;  4DUY K;  1VSF A;  4OPJ A;  1RDA A;  1TAU A;  3WXK A;  3QO9 A;  4H5W A;  2NRH A;  3CQY A;  3SAF A;  1T7P A;  1ASW A;  3E9O A;  4F8R A;  4PY5 A;  3QER A;  4IO9 L;  3OYJ A;  3BZC A;  1T03 A;  5CYQ A;  2UXD K;  1BU6 O;  3AO1 A;  4BY9 C;  1D5A A;  4FPB A;  4W5O A;  2NRT A;  4OKK A;  1LV5 A;  3O4Q A;  4LH4 A;  1I94 K;  5M1F A;  3ZT2 A;  1YVN A;  1GLE G;  4CEO A;  4OVL A;  1RDU A;  4JNE A;  4DUZ K;  1IBM K;  1NGB A;  1VQ7 N;  2Q1N A;  3M8R A;  1HNV A;  4R79 A;  3OBY A;  2IC3 A;  3WNH A;  5DM6 L;  1HLU A;  4BDZ A;  1ATS A;  3EN9 A;  5BRH A;  2NUB A;  4G9Z A;  3BF3 A;  1QZ5 A;  3IS9 A;  1JL2 A;  4BQZ A;  4B9S A;  4H0O A;  4KV8 A;  4CEE A;  2YNI A;  3PX6 A;  3NVK A;  4XIU A;  4CJQ A;  1ESV A;  3GE1 A;  4CE9 A;  5AQR A;  4CJW A;  4BR0 A;  1OKJ A;  3WNF A;  2KFZ A;  4X65 K;  1VQP N;  5JIC A;  3S3M A;  3LAM A;  3A5M C;  3VEV A;  1JKH A;  1XHX A;  4TSX A;  4KRF A;  2AP1 A;  3L4I A;  3UIQ A;  4B9Q A;  4CHY A;  1QSY A;  3E66 A;  2X6S A;  4LY7 A;  1MWM A;  3CJB A;  2KKZ A;  3CFP A;  1BWF O;  2ZM6 K;  1NGD A;  4K41 A;  2E5L K;  3SPY A;  4ILH A;  3SUN A;  2GUI A;  4JKA A;  4C8K A;  3TAB A;  4DV5 K;  1NOY A;  3DWL A;  2G8F A;  4F4K A;  2D4W A;  3ITH A;  4WQ5 C;  4CJT A;  4FJI A;  5EOY A;  4DR2 K;  1BUP A;  4FXD A;  5C2F A;  3OTO K;  1JCF A;  3MAQ A;  3P1G A;  3QIP A;  2GTD A;  3O9Q A;  3VGL A;  4QOZ B;  2WBN A;  2DFE A;  5MLC Q;  2OPP A;  3AO5 A;  5D3G A;  1W0H A;  2BTF A;  4ZTJ A;  1LAW A;  4M3W A;  5J2P A;  3ATV A;  2ZQB A;  4DB3 A;  4BRM A;  3DLB A;  2P9K B;  1NWK A;  4U67 L;  4KAZ A;  2XY7 A;  4DQR A;  4B1V A;  3AVI A;  1VSI A;  3WEE A;  1WAF A;  3FZF A;  5AR0 A;  1A5X A;  3CXC M;  1YIJ N;  2P9K A;  1YHQ N;  3AVF A;  3OS0 A;  4JEP A;  2Q3S A;  4V19 S;  3MXJ A;  4CEC A;  4O44 A;  1EP4 A;  5C0Y A;  3V6D A;  4FK2 A;  1YI2 N;  3DOL A;  3L3V A;  4JKG B;  3OBW A;  4M63 C;  3A5L C;  3VA3 A;  2IGI A;  3MCP A;  5KRT A;  1KD1 O;  3SLC A;  4JKG A;  3D45 A;  4LF7 K;  2YHB A;  2JWK A;  3E9L A;  4BRI A;  1CZ9 A;  1TV6 A;  1Z6R A;  3SQ1 A;  1U4B A;  2YX6 A;  3OYB A;  2BE2 A;  4CZG A;  4FL9 A;  4LC9 B;  4JI4 K;  3J7Z O;  3VQB A;  2V51 B;  4JKD A;  3O9U A;  3E1Y A;  4BRC A;  4IG0 A;  4WF9 L;  2ATQ A;  3CM5 A;  2OPR A;  4KH4 A;  2IVO A;  4FWN A;  2A3Z A;  3LP1 A;  3DLL L;  1K73 O;  4HUE A;  1S9E A;  2B4J A;  2Q36 A;  3I55 N;  3NVM A;  3O8M A;  1KVB A;  5H1S Q;  3CFR A;  1LW0 A;  4IXC A;  2Z1G A;  1NNE A;  2FBT A;  4O5B A;  4DV2 K;  3L4Q A;  3IAY A;  1Y97 A;  2D5R A;  2HHX A;  1V4S A;  2FXU A;  4BRD A;  3F5T A;  1SZ2 A;  2KZM A;  4CHO A;  1EO1 A;  3RSE B;  4CK3 A;  1J5O A;  3V9S A;  3S9H A;  4M3X A;  4BR7 A;  4B3S K;  1YJW N;  5FLX O;  3RSE A;  3CCE N;  1N33 K;  4KHP K;  1JLE A;  3K5L A;  2O8C B;  2Q97 A;  4GV6 A;  4JKC A;  4K42 A;  4KHY A;  4BAC A;  1K6Y A;  4CHP A;  4A2A A;  1QHT A;  2DFH A;  1NJW A;  2P9U B;  4AHC A;  3J7Y P;  1TUY A;  4CIE A;  4CJF A;  5C2D A;  1KLN A;  1KTQ A;  1YVU A;  1EQY A;  3QB0 A;  2P9U A;  1JXB A;  3SAG A;  4YDU C;  3IUC A;  1D9D A;  4CI6 A;  1EX4 A;  1NBW A;  4CVN E;  2Y1I A;  2GV9 A;  4AHT A;  3HO1 A;  3QLH A;  4IWV A;  4BG8 A;  3QEP A;  5I42 A;  4RG8 A;  4ZHR A;  4Z4F A;  5AQW A;  4BDP A;  3CD6 N;  4L3Q A;  1NOZ A;  1TKT A;  4LSL A;  3L8B A;  4CHZ A;  4B9N A;  4FOI A;  2VGN A;  1L3V A;  4J8F A;  2FBV A;  5AQX A;  3TAE A;  2UYT A;  5BRF A;  1ZBU A;  4AHU A;  1QQN A;  4YOW A;  2O8B B;  3VQ6 A;  4HTL A;  4H0P A;  4GY2 B;  4BRH A;  4KO0 A;  1E3M A;  5TKY A;  1QVF M;  4C8O A;  4JI0 K;  2OCE A;  2E2P A;  3AO3 A;  2D0C A;  4A2B A;  2XY6 A;  4KH6 A;  3NDK A;  3I56 N;  4B9U A;  1KCF A;  1S1V A;  3AA4 A;  2YKN A;  4CER A;  4O4G A;  4NLC A;  3ZX0 A;  3CC4 N;  2KFN A;  4OX9 K;  4JI3 K;  1M90 O;  3OY9 A;  1HKG A;  3K5O A;  4GVM A;  4N56 A;  2QM1 A;  3A8Y A;  5AZI B;  4QS7 A;  4AHR A;  3BGR A;  2A41 A;  1JLC A;  4JHD B;  1ATN A;  3NMU A;  3OYI A;  3CCV N;  5AZI A;  2RKI A;  3F73 A;  4K25 A;  4DSI A;  4JHD A;  2OTL N;  2IVP A;  2QWL A;  3EL2 A;  1VQO N;  3BUZ B;  2P9L B;  3FZM A;  1TUU A;  2G8H A;  3O5B A;  3MX2 A;  4FJX A;  1C0M A;  3MWT A;  1S1T A;  4A57 A;  2G8W A;  4FK0 A;  4FJG A;  3SQ4 A;  2P9L A;  2PBD A;  3FE1 A;  3HTV A;  4DTN A;  3O80 A;  5KI6 A;  4EFH A;  4DV6 K;  3EO3 A;  2I5J A;  4B1Z A;  2OZS A;  3AY9 A;  5LMU K;  2YHA A;  2B6A A;  4DTO A;  1KLM A;  3U9D A;  5I9E B;  1ZBI A;  3A0I X;  4OPA A;  4YNQ A;  2QWP A;  1Q9Y A;  3LM2 A;  3U4L A;  3PY8 A;  4DTX A;  1NGG A;  4CHQ A;  2YNH A;  1KAX A;  1W9H A;  2QWM A;  2NLX A;  4NLB A;  2CH5 A;  2CGJ A;  2JWL A;  5JVH L;  1S5J A;  1NK8 A;  5M1O A;  4IJA A;  2YNF A;  3B6O A;  2VYP A;  4DV1 K;  2X6N A;  3DLK A;  4BC2 A;  4CW7 B;  3KK3 A;  1B9F A;  3C6T A;  5BRE A;  3MXI A;  4FLV A;  1SS6 A;  1DTT A;  1JCG A;  3ULD A;  2RPI A;  1CXU A;  2F8S A;  1SL0 A;  2WFB A;  1BA0 A;  4M42 A;  3L3U A;  4NXM K;  4ICL A;  4DQ8 A;  1VSD A;  1KSP A;  3SAH A;  3LP2 A;  1VQ4 N;  1SV5 A;  3M6G A;  3CER A;  4BC5 A;  4JI7 K;  1KAY A;  3MWP A;  1LCU A;  3O3G A;  3LDS A;  3DRP A;  1TKD A;  1WN7 A;  4W5N A;  1P90 A;  5HRS A;  1Q82 O;  1H1V A;  5LMN K;  1L3S A;  1EKE A;  1QVG M;  1GLF O;  3WXM B;  1XNQ K;  4BGB A;  4I2Q A;  4JI5 K;  1HJR A;  4LSN A;  3M1F A;  2ASO A;  4Y0W A;  2ZWH A;  4WFA L;  3DRS A;  2XHB A;  4KRE A;  1NJI O;  3QEW A;  1VQN N;  2VWK A;  1UA0 A;  3QBW A;  3DLR A;  3DYA A;  4DV0 K;  3VQE A;  3CF5 L;  4WFB L;  5LJW A;  1ZYQ A;  1HR0 K;  3KLG A;  4B3T K;  4DTR A;  3T7Z A;  2HHQ A;  2P1J A;  1JCE A;  5CR4 A;  1QTM A;  3U8X A;  1VQK N;  3NAE A;  3T1Y K;  2UUB K;  4DSL A;  3KKR A;  5AQU A;  3RR8 A;  4KHW A;  3QIN A;  1RBU A;  3SUQ A;  4JI2 K;  3NE6 A;  3LDP A;  1IG9 A;  2E20 A;  3ZSZ A;  1WSJ A;  3UKR B;  3ZEU A;  4EHT A;  1BO5 O;  4H0V B;  3R9P A;  1N5Y A;  5ELZ A;  3RR7 A;  3KLE A;  3O6W A;  2WON A;  2E2O A;  1HQE A;  3MN6 A;  1NK9 A;  4BRO A;  2QWN A;  3WQU A;  4MLH A;  1GOB A;  1TL3 A;  3KD1 E;  4O0J A;  4PQU A;  1YJ9 N;  3RWU A;  3TR8 A;  3L2W A;  4E7K A;  3VQ8 A;  3VTH A;  1NGI A;  4AM7 A;  1Q86 O;  3WNE A;  3K59 A;  3ENO A;  1BI4 B;  3H08 A;  3OYH A;  4E7L A;  1VSE A;  5F1X A;  1LAV A;  2F9W A;  1VHX A;  3KHY A;  4BG9 A;  1BI4 A;  3DXM B;  2OAN A;  1G99 A;  2HVH A;  2PYJ A;  4M3R A;  5JVG L;  3PX4 A;  4OGE A;  3HBT A;  3N4P A;  3OYE A;  4B9T A;  3OYG A;  4E7I A;  3QEI A;  1UWB A;  5DMR A;  2WC9 A;  3MN9 A;  3OVN A;  1NG9 A;  4LF5 K;  5AQG A;  1NLV A;  2OA8 A;  4JKF A;  3FZL A;  4CF2 A;  2G8U A;  2ETJ A;  4NCA A;  3H3N O;  4OPH A;  1J9A A;  1UOC A;  4Z0U A;  4GKK K;  3CJ1 A;  4GKJ K;  1C1B A;  2WUS A;  3I0R A;  2YNG A;  3D2F B;  1Q9X A;  4LFC K;  2D1K A;  3C94 A;  4CJ7 A;  4WE1 A;  4IZ9 A;  3FZH A;  1T6C A;  2W6L A;  1KVA A;  3WUH A;  4KFB A;  3HM8 A;  1NGH A;  3QDK A;  1U49 A;  3M8P A;  3ZT3 A;  1XNR K;  1Z25 A;  4CD3 A;  3ZX3 A;  4B1X B;  3AA5 X;  4LF4 K;  3THX B;  1BIU A;  2G8V A;  1YTA A;  4JRP A;  2W42 A;  1RGI A;  3VQ5 A;  4G1Q A;  4HTU A;  1IBL K;  3G4S N;  1NKE A;  3F9K A;  2Z1I A;  4NYF A;  1JLB A;  4PL8 A;  4CJR A;  2DFF A;  3P4I A;  3E9P A;  4CF0 A;  1FJG K;  3SQ0 A;  5KPT A;  1BOT O;  4XEI A;  3NBP A;  4IKF A;  4DV7 K;  3NCI A;  2UUC K;  1GLA G;  4CJV A;  2BGG A;  3OA9 A;  4N76 A;  5C24 A;  3QEV A;  2JLE A;  4K43 A;  1Z05 A;  1ASU A;  3EKU A;  4PWD A;  2VWB A;  2Z1H A;  1FKO A;  2UXB K;  3LDN A;  1M1K O;  3O1B A;  1K9M O;  5CY4 A;  4BE2 A;  4DFP A;  1HNW K;  2E6L A;  4CBU A;  2O8D B;  5FDL A;  3QEX A;  5AQQ A;  3RMA A;  1BQM A;  3I0S A;  3L2Q A;  1NKB A;  1HYS A;  4CEB A;  3HSC A;  1X3N A;  4IFE A;  4B9L A;  1HPZ A;  4CBX A;  1X9W A;  2I7P A;  2O8D A;  2UUA K;  4O55 A;  1GLC G;  4EZ9 A;  2LSN A;  4K8Z A;  1NKC A;  4LF6 K;  1SL2 A;  5JLF A;  4WQ4 A;  3J7A P;  3TSP A;  3LAN A;  3RTV A;  3VQ7 A;  5BN9 A;  3PX0 A;  2X78 A;  1W97 L;  1BHL A;  3H45 C;  4XH4 A;  1C6V A;  4K8X A;  2XY5 A;  1WBD A;  3JSM A;  3A5N C;  3CPE A;  4FWK A;  4UQG A;  2FSJ A;  4FZY A;  4BRP A;  4B9M A;  3M8Q A;  4IBN A;  1U45 A;  4CGG A;  4E1N A;  3TAP A;  4PKI A;  3VPZ A;  5BPM A;  1DTQ A;  2V52 B;  5C25 A;  1RDC A;  3FFK B;  1KQS M;  1WUA A;  3OYA A;  5GAH P;  4FLT A;  4DR7 K;  4RW7 A;  4DFK A;  2W41 A;  1D9F A;  3NGY A;  1NK4 A;  4QAG A;  4CD1 A;  3ID8 A;  5SZT A;  3UE5 A;  1E4G T;  3V9X A;  4ILG B;  2NRR A;  2Q2R A;  2ZGZ A;  4B1Y B;  3H46 O;  4NB4 A;  5C15 A;  3CET A;  3VF2 A;  3TTD A;  4OO1 J;  3O9R A;  3JAM O;  4GW6 A;  3L2V A;  2QKK A;  1NU0 A;  3S3O A;  4JKE A;  4M3U A;  3ISN C;  5FRM A;  4CBW A;  3NF7 A;  1T44 A;  4DSF A;  1RT7 A;  1ATR A;  4M3Z A;  3SJJ A;  4BRA A;  3LP0 A;  2HNZ A;  2P5G A;  3LDL A;  4DR5 K;  4DHY A;  5EX5 A;  5AQV A;  4C8L A;  4M7X A;  5AQK A;  2P9I B;  3K9K A;  4FM2 A;  1ASV A;  2KTQ A;  1QE1 A;  3PUF A;  4WCE L;  3W0L A;  4DWI A;  3J80 O;  2P9I A;  1Q7Y O;  4JS5 A;  5HP1 A;  1WSG A;  4PKH A;  3MEG A;  4JS4 A;  2O4G A;  5KQD A;  5HOO A;  5AQS A;  1S9G A;  2QXL A;  3VQA A;  4CF9 A;  3VF4 A;  3LM9 A;  1XWL A;  2E1Z A;  2QW9 A;  3D6R A;  3CJ7 A;  4XH1 A;  1VQ9 N;  3KLI A;  2FF3 B;  1NK0 A;  5M1K A;  3H1V X;  1ZBH A;  1D8Y A;  5GIP A;  3MMV A;  3V1Q A;  4CF1 A;  4CEQ A;  5HL7 L;  2ZJP L;  1WBB A;  3DOK A;  1WNS A;  4CZH A;  4NCB A;  5CZ1 A;  3NF6 A;  1U6Z A;  5AQF A;  4BRK A;  4Z4C A;  4U7B A;  3KZB A;  2ASM A;  1I39 A;  4CJL A;  4Z4G A;  1ZC6 A;  4KB0 A;  1KC8 O;  4BE0 A;  3M3Z A;  3M8S A;  4CJK A;  3AAR A;  4KH5 A;  3OYN A;  5DM7 L;  4GV3 A;  3VOV A;  3VA0 A;  1S72 N;  1K8K B;  1VQ8 N;  2F7T A;  4MQ3 A;  3VEN A;  3WXL A;  3QNN A;  4HVJ A;  3KWI A;  3CCM N;  1HUX A;  3NH2 A;  4X62 K;  4CJU A;  1K8K A;  2XO7 A;  5I3U A;  1HX1 A;  3CFO A;  3NF9 A;  3CHW A;  3LDO A;  1GLB G;  5E41 A;  1QZ6 A;  4I9L A;  4NCG A;  3KVG A;  5AQT A;  1FW6 A;  3CIP A;  4LF8 K;  4KHS A;  3EE8 A;  4OKE A;  4B8C A;  2VGM A;  5C12 A;  2OYQ A;  3ASM A;  4DU4 A;  1N36 K;  4H03 B;  4FYD A;  2O8C A;  4AIL C;  4BWJ A;  3VQP A;  3O9S A;  3VEY A;  2HHT A;  1HKC A;  3HVR A;  4CZI A;  1J6Z A;  1BDG A;  3VER A;  4BRF A;  4DSK A;  4B8A B;  5CZ2 A;  3ZSX A;  1T05 A;  4IFY A;  4O8K A;  2QWR A;  3ZSQ A;  3NH0 A;  1W2B M;  3K0S A;  3B6P A;  2RF2 A;  3OJU A;  3ZET B;  1X3M A;  1U04 A;  2BH1 A;  3SUP A;  1HJO A;  4FJ5 A;  3ZET A;  1CXQ A;  2QWQ A;  4BR2 A;  3ZT4 A;  3VES A;  4AQY K;  4LH5 A;  2GEL A;  2A42 A;  4FWQ A;  4H0Y B;  4CIF A;  2FLO A;  4HWI A;  3CPW M;  3THV A;  1ZXO A;  3T19 A;  1XC3 A;  3JS6 A;  4KTQ A;  1TGO A;  4O8U A;  4NO7 A;  1NK7 A;  2ITG A;  3QES A;  4EIA A;  3SV4 A;  4CGH A;  3ATU A;  1N6Q A;  4CGD A;  1FXX A;  1HNI A;  3O9T A;  4DLE A;  2O8B A;  2A1S A;  4IEI A;  1QQO A;  3V81 A;  4C8N A;  5J2Q A;  4MFB A;  2ZD1 A;  4JKH A;  5IWA K;  4Z4I A;  1Q18 A;  2UXC K;  3TAF A;  1QQC A;  5F2R A;  4CHN A;  1GLD G;  2J4R A;  4DQP A;  1TL1 A;  4JAX A;  1NMN A;  1X9M A;  2IOC A;  3LWL A;  4FZX C;  3G0Z A;  1YJN N;  1RFQ A;  1SQK A;  2QK9 A;  1TYQ B;  4YOV A;  4WQ5 A;  2ZF5 O;  1DGK N;  4O5F A;  4RTF D;  3PSF A;  5FPM A;  4E89 A;  4BVP A;  1Q81 O;  1RBT A;  4JV5 K;  1TYQ A;  2D0B A;  2DY4 A;  2D0O A;  2CGK A;  5AZJ B;  4CEA A;  4FO0 A;  3OYD A;  5KTQ A;  4JLH A;  1N8R O;  1U48 A;  2P5O A;  3DLG A;  4KI6 A;  1XC9 A;  3VN5 A;  1L3T A;  3CC2 N;  1JLQ A;  1RT1 A;  1DKG D;  3OHR A;  3IKM A;  3QET A;  3SZ2 A;  4CFD A;  2E6M A;  4E7J A;  1C1A A;  2A5X A;  3TWH A;  3VEX A;  1J5E K;  4E19 A;  3ZSY A;  4B9V A;  4DFM A;  1IJJ A;  2A6A A;  3SBT A;  3RVC A;  1ILY A;  1OH6 A;  1LOT B;  2NRW A;  3Q7B A;  4CFC A;  3TAN A;  3A2F A;  5M1P A;  2HMP A;  3HVT A;  1TK5 A;  4L8R B;  4FW1 A;  4C23 A;  2YI1 A;  3IG1 A;  4DG1 A;  3CMA N;  2PYL A;  5JLH A;  4FLW A;  5FRN A;  3ZT1 A;  5EU7 A;  2VG5 A;  3ZSR A;  2D0P A;  1WSH A;  4LFA K;  4OPK A;  1VSH A;  2IVN A;  3BF1 A;  5HBM A;  4IDK A;  3UKU B;  1Z26 A;  5T7B A;  3CJC A;  3PSI A;  4ELV A;  1YF5 L;  1KRP A;  3AA3 A;  4FWP A;  1VSM A;  4HUF A;  2ITM A;  1BQN A;  3WNG A;  3UKU A;  4FOE A;  1Q8I A;  1D4X A;  1BIS A;  3SQ2 A;  4PUO A;  3IFR A;  2V7Z A;  3QNO A;  2GWK A;  3V1O A;  1RDB A;  4OGC A;  4IFV A;  3AGK A;  4YY3 K;  4CK1 A;  1QSL A;  3AVK A;  1NJZ A;  1NMD A;  4UY8 O;  2IS3 A;  3VQQ A;  4MDB A;  3AV9 A;  4RW6 A;  4C8M A;  2HBK A;  4FJN A;  3EYZ A;  3PLA A;  4CJ4 A;  4FLU A;  4B3R K;  4HCB A;  4H5R A;  1IH7 A;  2GX9 A;  1S1X A;  2HBL A;  5ADX H;  3EE9 A;  3WT0 A;  1YAG A;  4AM6 A;  4BRE A;  5JS2 A;  2P9S B;  4MDA A;  4DTU A;  3L2U A;  4FW2 A;  3IMX A;  1VRT A;  1RIL A;  3CCJ N;  5C42 A;  3LP3 A;  3IRX A;  3QFP A;  4I2P A;  5KGW A;  4AF1 A;  1JLA A;  3DJC A;  3MN7 A;  2VWJ A;  5HLF A;  4ID1 A;  4DSJ A;  2ZE2 A;  3IDH A;  3HI0 A;  4YDU A;  4Y1D A;  4H4M A;  4CFB A;  5ADX A;  1QQM A;  4IOA L;  2QWO A;  1NJY A;  1G15 A;  2HNY A;  3PO4 A;  3RMD A;  1C0G A;  1RTJ A;  4RW8 A;  4KHQ A;  1LWC A;  4W5T A;  2FC0 A;  5A2Q O;  2Q0U A;  2YHY A;  3FR0 A;  4CED A;  4RCH A;  3UKR A;  3PIP L;  3U9Z A;  1BCO A;  1RTI A;  1BL3 A;  3CME N;  3KIO A;  3DMJ A;  3HST B;  3L6Q A;  4FJH A;  2A40 A;  4KHU A;  2PFU A;  4BC3 A;  3OYC A;  4JD2 B;  1C0U A;  3AVC A;  4FLZ A;  4DMN A;  1YXQ A;  3ENB A;  4ISE A;  4YOU A;  4BRQ A;  3TI0 A;  3OYF A;  4DSE A;  3SMP A;  3DAW A;  4JD2 A;  4DR4 K;  1EWQ A;  3HT3 A;  5KRS A;  4FVM A;  5AFU H;  1DT9 A;  4QS8 A;  5FPD A;  5FPE A;  4JK9 A;  1HYZ A;  3T3F A;  3CM6 A;  4LF9 K;  3DXK B;  2O8E B;  2X74 A;  3EZW A;  1K8A O;  1LWF A;  3VGM A;  3DXM A;  1E4F T;  1YUW A;  5AQI A;  1QSS A;  3DXK A;  3VEO A;  1NK5 A;  3EEQ A;  2ZJR L;  2YHW A;  3C95 A;  3NGZ A;  1DEJ A;  2HND A;  3PV8 A;  5AFU A;  3KLF A;  3OW2 M;  1UA1 A;  3ZSO A;  2KHO A;  4DR6 K;  1WSI A;  4CEF A;  4KKO A;  3T69 A;  4ZTF A;  5GIO A;  3HM9 A;  1VSK A;  4FM0 A;  3N4Q A;  2JGU A;  3D2E B;  3SBG A;  3D2F A;  3F9M A;  3LAL A;  4KI4 A;  3MCA B;  3T1H K;  3CJ9 A;  4DKW A;  1RBV A;  2FSK A;  3KTQ A;  1IKX A;  2CGL A;  1HYV A;  3D2E A;  4J2A A;  4A61 A;  4W5Q A;  4J2B A;  4A5B A;  1TKX A;  1IKW A;  2W6K A;  3K57 A;  1WB9 A;  1TK8 A;  1HRH A;  3CQX A;  1IKV A;  3EKS A;  1N32 K;  1CZB A;  3THX A;  1RT5 A;  3ZX2 A;  3THW B;  1VSJ A;  1XQS C;  1X1P A;  4MLE A;  3MED A;  5JS1 A;  3O08 A;  3THW A;  3C7N B;  5AQO A;  2H3G X;  2NNW A;  4M3T A;  3VET A;  1JXE A;  4DTM A;  3M5R A;  4Y1C A;  3C7N A;  3JYT A;  4DR3 K;  3HJF A;  4DF8 A;  2A1R A;  3AAP A;  4A62 A;  2BUP A;  4BDY A;  4JI8 K;  5J1E A;  2IIR A;  4OLA A;  1VQM N;  4BRN A;  1LW2 A;  1QS4 A;  3O3F A;  3JXU A;  3GDQ A;  4O0I A;  4OLB A;  4EHU A;  2OZM A;  4FM1 A;  4CF8 A;  4YOX A;  3UB5 A;  1A5W A;  1TKZ A;  3TAG A;  3VF6 A;  5CE3 A;  3OYK A;  3AGR A;  1S6Q A;  4X66 K;  3VQC A;  3GOI A;  4R5P A;  2HF4 A;  4CZF A;  4CJP A;  4F3O A;  1SKW A;  2VG6 A;  4FWR A;  2KQ2 A;  4FCY A;  3AO4 A;  3AVH A;  4I9Q A;  3AA2 A;  5BR9 A;  3K5M A;  3KK7 A;  3NF8 A;  2QA4 N;  2WTU A;  4Z4E A;  4DR1 K;  2G8I A;  4FZZ A;  4FJJ A;  4BRG A;  3QBX A;  2QXF A;  3C6U A;  3HZ6 A;  3ENH A;  2P9N B;  4E1M A;  3NFA A;  4W5R A;  3F2K A;  4JN4 A;  1U2V B;  2P9N A;  1WOQ A;  3QFU A;  3W3D A;  4CZJ A;  4BQL A;  1P8Z A;  4JK7 A;  1L3U A;  2QKB A;  1U2V A;  4OKJ A;  3QML A;  4BWM A;  5BPN A;  1VAZ A;  3TTC A;  3SI6 A;  1SUQ A;  1T6D A;  4M3Y A;  1RNH A;  3HP6 A;  4C1N I;  4H8K A;  1IBK K;  3K58 A;  1BA1 A;  1V4T A;  2YV0 X;  4KTZ A;  4H4O A;  1KFD A;  2ZGY A;  1YTU A;  4FJ8 A;  4A5A A;  1HPM A;  5SWM A;  2KZZ A;  4DTP A;  2R7Y A;  4GNI A;  5KGX A;  5B8H A;  1X9S A;  1MA9 B;  3OJS A;  4BRL A;  4CZK A;  1YIT N;  4DFJ A;  1IV0 A;  4LFB K;  1BCM A;  2FBX A;  1XHZ A;  4BGA A;  4CJ3 A;  3O4N A;  4FLY A;  1OVY A;  1LWE A;  4M7Y A;  3WXJ A;  1VQ5 N;  1XUP O;  2CH6 A;  3P83 D;  3R1X A;  3ID6 A;  1MWK A;  3HPG A;  4BC4 A;  3V4I A;  2RHK A;  2PAV A;  4WFN L;  4DQI A;  3LPT A;  1BG3 A;  3ZLJ A;  2EWS A;  3C0B A;  3HOT A;  1RBS A;  3LDQ A;  4H5N A;  5M1N A;  1J53 A;  1FKP A;  3SCX A;  4N47 A;  4YOY A;  4CJE A;  2YKM A;  3C6A A;  1EWR A;  2QI2 A;  5JMV A;  4DQS A;  1SKS A;  3VEW A;  3WEE B;  4IOC L;  3L0Q A;  3KLH A;  3RMC A;  4KBO A;  1NGC A;  4B1U B;  5AJ3 K;  2WOM A;  5BRD A;  3HRG A;  4HUG A;  3Q7C A;  3V9U A;  2F9T A;  4DTJ A;  3ZSW A;  1ITG A;  3U3G A;  2XY8 A;  3CCR N;  4FJ7 A;  5AQJ A;  4JK8 A;  2OPQ A;  3OYL A;  2Q0R A;  1S1W A;  1GOA A;  2YJE A;  5AQL A;  4RW4 A;  4CJ5 A;  3FZK A;  2HBM A;  2NZT A;  4YOT A;  3VEZ A;  1SAZ A;  4KPY A;  5GAE P;  1S6P A;  3QIO A;  3DM2 A;  3OS2 A;  3B8A X;  4HCC A;  3RRG A;  3ZT0 A;  3TTF A;  3TAR A;  1HNZ K;  4F9O A;  2FSN A;  3TSQ A;  3V9W A;  5GAG P;  5LY3 A;  1OH5 A;  4MO4 A;  4CK2 A;  1RT6 A;  3S41 A;  2EX3 A;  4IOX A;  1O1W A;  1TVR A;  4LD0 A;  3CCS N;  1XMQ K;  2FBY A;  1VK0 A;  1BGX T;  2IDO A;  1W7A A;  1OH7 A;  2HBJ A;  3SUO A;  3VQ9 A;  4EZ6 A;  2QEX N;  3MEC A;  2VQE K;  2RE2 A;  1KVC A;  3EY1 A;  3BEX A;  2F96 A;  2E8A A;  4DQQ A;  3AVL A;  3TAM A;  3THY B;  2HHV A;  1XMO K;  3E01 A;  3TSU A;  2AJQ A;  2EHG A;  3THY A;  3BDP A;  3WQT A;  2PY5 A;  4B1W B;  3TPQ A;  3HYF A;  3H1Q A;  4IO8 A;  2NRV A;  2YHX A;  2ZJQ L;  3CI5 A;  4E7H A;  4JRQ A;  4IDH A;  4DS5 A;  5EXW A;  3CYM A;  4FWM A;  3KK2 A;  4B3M K;  5EY4 A;  2HHH K;  4X64 K;  4DV3 K;  2YCH A;  1TK0 A;  1UAX A;  1S22 A;  2P9P B;  5CYM A;  3P39 A;  4M41 A;  4CEZ A;  3LZI A;  3CG7 A;  1WSF A;  3VQD A;  2P9P A;  5FPN A;  3PO5 A;  1I3A A;  1O13 A;  1VSL A;  1OH8 A;  3H6E A;  3CCL N;  2VQF K;  3CC7 N;  3AVG A;  4H5V A;  2E4L A;  4FJL A;  1SKR A;  2HMI A;  3AO2 A;  2HST A;  4CFA A;  4CIG A;  3RMB A;  5BR8 K;  5AQM A;  3ZCM A;  1KAZ A;  1WAJ A;  3KKS A;  3NH1 A;  3DLH A;  3VTI A;  4QCL A;  4YFU A;  3GG4 A;  5HRN A;  3MEE A;  2QTD A;  1RCH A;  3AVA A;  3CCQ N;  5F0X A;  4KHN A;  3MX5 A;  1VQ6 N;  1X9J A;  1T8E A;  1C0F A;  5BN8 A;  4CCH A;  3VMF B;  1ZBL A;  2Y1J A;  4Q0B A;  1R59 O;  1CZA N;  4GVE A;  5AQZ A;  1B92 A;  5IT9 O;  4J2D A;  2HVI A;  4RWT A;  3H3O B;  2E2N A;  4EAH D;  3BY5 A;  5K14 A;  4F3T A;  4DU1 A;  3R6M A;  4N41 A;  3K9J A;  2GEM A;  1L5U A;  3DRR A;  3LL3 A;  5EVZ A;  3R8E A;  3NGI A;  2VG7 A;  2GWJ A;  4PHT X;  3QIC A;  5AZJ A;  2YJF A;  4FJM A;  1HQU A;  2XRI A;  4KTW A;  4GMJ B;  4I6M B;  1R0A A;  3SMS A;  3KJV A;  4F2S A;  4PL7 A;  4E0D A;  1MDU B;  3G71 N;  5KQ8 A;  4FWS A;  4IEE A;  4I6M A;  1JLF A;  4DS4 A;  4ELU A;  5AQP A;  3J81 O;  4JI6 K;  3MXM A;  2HHS A;  1J54 A;  3AVB A;  1NK6 A;  3LWM A;  4BVO A;  3A5O C;  3HPH A;  1A5V A;  2HOE A;  1SL1 A;  2O8F B;  3WXI A;  4K0K K;  3BP8 A;  3SV3 A;  4DF4 A;  3LPU A;  3K2P A;  2VCP A;  2NRZ A;  1RTD A;  2O8F A;  2PZS A;  4FPA A;  1RT2 A;  5J2M A;  2BDP A;  1RT4 A;  2ASP A;  4Z94 A;  2P51 A;  3G25 A;  4DLG A;  4B3O A;  3ZSV A;  4MO5 A;  3V9Z A;  1RBR A;  5M1Q A;  3L2R A;  3CCU N;  1XI1 A;  1QHA A;  4FSV A;  3SK3 A;  2KW4 A;  4H0T B;  4NYN A;  3C65 A;  2UU9 K; 
#chains in the Genus database with same CATH homology
 4E1J A;  1TUY A;  5AFU A;  2E2Q A;  4CD1 A;  3OW2 M;  3ID8 A;  5C2D A;  3UE5 A;  2KHO A;  1EQY A;  3QB0 A;  1E4G T;  2P9U A;  3SAG A;  4ILG B;  3T69 A;  4YDU C;  2NRR A;  3IUC A;  3P31 A;  2Q2R A;  5KPZ A;  5CHI A;  2ZGZ A;  4B1Y B;  3H46 O;  4NB4 A;  5C15 A;  4CI6 A;  3CET A;  3FLC O;  5GIO A;  3VF2 A;  3TTD A;  3R3L A;  3ZYY X;  3O9R A;  4OO1 J;  1NBW A;  3N4Q A;  3D2E B;  4JKE A;  3D2F A;  3SBG A;  3F9M A;  3I33 A;  4IWV A;  4BG8 A;  4CZM A;  4CBW A;  3MCA B;  5AQW A;  4A59 A;  3CJ9 A;  4DKW A;  3HOS A;  2FSK A;  2CGL A;  2I7N A;  1T44 A;  2Q31 A;  4FWL A;  3D2E A;  4L3Q A;  3CD6 N;  1ATR A;  4FWO A;  4WYB A;  4A61 A;  3KWG A;  4BRA A;  4A5B A;  4FOI A;  2VGN A;  3AAQ A;  4J8F A;  3LDL A;  4DHY A;  5EX5 A;  5AQV A;  5AQX A;  3EKS A;  3CQX A;  4H0X B;  4WQ4 C;  4CZL A;  4M7X A;  2UYT A;  5BRF A;  5AQK A;  5TKW A;  2P9I B;  3K9K A;  3ZX2 A;  4WCE L;  1QQN A;  4YOW A;  1XQS C;  4ISG A;  4HTL A;  2OTJ N;  3P38 A;  4H0P A;  4GY2 B;  4BRH A;  4MLE A;  3W0L A;  5C10 A;  3VGK A;  3FGU A;  3O08 A;  2P9I A;  5TKY A;  1Q7Y O;  1Y64 A;  3PIO L;  1NGE A;  3C6H A;  3C7N B;  5AQO A;  1QVF M;  2H3G X;  2NNW A;  2P9S A;  4PKH A;  2E2P A;  5KPR A;  4A2B A;  5GAD P;  3VET A;  4KH6 A;  1NGJ A;  5HOO A;  5KQD A;  3O1W A;  3I56 N;  3M5R A;  5AQS A;  3C7N A;  2QXL A;  3GL1 A;  3VF4 A;  3LM9 A;  4BR9 A;  3MK6 A;  2E1Z A;  3TU5 A;  2QW9 A;  3AAP A;  4NLC A;  3ZX0 A;  3D6R A;  4A62 A;  2BUP A;  3CC4 N;  3CJ7 A;  1GLL O;  4XH1 A;  3MN5 A;  1VQ9 N;  2IIR A;  2FF3 B;  2FF6 A;  1M90 O;  1JJ2 M;  4BRN A;  1VQM N;  5M1K A;  3H1V X;  3JXU A;  3GDQ A;  1HKG A;  5GIP A;  1NM1 A;  4EHU A;  4ILJ A;  3MMV A;  2QM1 A;  5HL7 L;  3A8Y A;  2ZJP L;  2V7Y A;  3UB5 A;  4YOX A;  4CZH A;  5AZI B;  4QS7 A;  3VF6 A;  5CE3 A;  2A41 A;  1IG8 A;  4JHD B;  2E1Y A;  1ATN A;  1U6Z A;  3SJH A;  3CCV N;  5AQF A;  3NMU A;  5AZI A;  3AGR A;  3O4W A;  3GOI A;  4BRK A;  2HF4 A;  1VQL N;  3ZEU B;  4U7B A;  3KZB A;  4CZF A;  5GIN A;  2ASM A;  4K25 A;  1GLJ O;  4JHD A;  1ZC6 A;  2IVP A;  2QWL A;  3EL2 A;  1KC8 O;  3D7E O;  4FWR A;  3BUZ B;  1VQO N;  2OTL N;  3M3Z A;  2P9L B;  3FZM A;  3AAR A;  1TUU A;  5LJV A;  3O5B A;  4KH5 A;  5E26 A;  5DM7 L;  5BR9 A;  3MX2 A;  2KLA A;  3KK7 A;  4GV3 A;  2QA4 N;  3MWT A;  5AQH A;  3VOV A;  4A57 A;  1S72 N;  1K8K B;  1VQ8 N;  2F7T A;  3VEN A;  3WXL A;  4QS9 A;  4GV9 A;  2E88 A;  4BRG A;  2P9L A;  2PBD A;  3QBX A;  3FE1 A;  3KWI A;  2DPN A;  4IJN A;  3HZ6 A;  1KXP A;  3HTV A;  3ENH A;  3O80 A;  3CCM N;  1HUX A;  4EFH A;  2P9N B;  3EO3 A;  1K8K A;  4PKG A;  3CJA A;  4B1Z A;  3AY9 A;  1HX1 A;  3CHW A;  5AQN A;  3LDO A;  1GLB G;  3F2K A;  4JN4 A;  3U9D A;  5I9E B;  1QZ6 A;  1U2V B;  2P9N A;  3A0I X;  4JKB A;  1WOQ A;  3KVG A;  3QFU A;  4OPA A;  5AQT A;  3J8A A;  3CIP A;  3W3D A;  4ISF A;  3EE8 A;  4CZJ A;  4BQL A;  1P8Z A;  4JK7 A;  2QWP A;  4YOR A;  2VGM A;  5C12 A;  3LM2 A;  3U4L A;  1U2V A;  3QML A;  5BPN A;  1VAZ A;  4H03 B;  1NGG A;  2NRX A;  3TTC A;  2GUP A;  4DCH A;  1T6D A;  1HKB A;  1KAX A;  1NGA A;  2QWM A;  2NLX A;  4NLB A;  4C1N I;  2CH5 A;  1NGF A;  2CGJ A;  1BA1 A;  1V4T A;  2JWL A;  3O9S A;  5JVH L;  1S3X A;  5M1O A;  3VEY A;  4CZE A;  4IJA A;  1HKC A;  2VYP A;  2ZGY A;  4CZI A;  1J6Z A;  1BDG A;  3VER A;  4H5T A;  4BR5 A;  3G6E N;  4BRF A;  4A5A A;  1HPM A;  4BC2 A;  5AQY A;  1RDW X;  4O8K A;  2QWR A;  4C1N K;  1W2B M;  5BRE A;  3GBT A;  4GNI A;  5B8H A;  3ZET B;  1MA9 B;  1SS6 A;  2HF3 A;  4BRL A;  4CZK A;  1JCG A;  1X3M A;  1YIT N;  2BH1 A;  2WFB A;  1BA0 A;  3ULE B;  1HJO A;  3ZET A;  2QWQ A;  4BGA A;  4BR2 A;  2AA4 A;  1OVY A;  3VES A;  4M7Y A;  3WXJ A;  4DQ8 A;  4FVU A;  1VQ5 N;  2GEL A;  5BPL A;  2A42 A;  4FWQ A;  4BR4 A;  3SAH A;  1XUP O;  4H0Y B;  3ULE A;  2CH6 A;  1ZBS A;  2FLO A;  3R1X A;  1VQ4 N;  3ID6 A;  1MWK A;  4HWI A;  3M6G A;  3CER A;  4BC4 A;  4BC5 A;  1ZXO A;  3CPW M;  1KAY A;  1XC3 A;  2RHK A;  3MWP A;  1LCU A;  2PAV A;  2W40 A;  3JS6 A;  5E84 A;  4WFN L;  1BG3 A;  4O8U A;  3MDQ A;  1P90 A;  4NO7 A;  2EWS A;  3C0B A;  3HOT A;  1H1V A;  1Q82 O;  3LDQ A;  4EIA A;  4H5N A;  5M1N A;  1QVG M;  1GLF O;  4XH5 A;  1T3V A;  3ATU A;  3I8B A;  4YOY A;  3WXM B;  4BGB A;  3O9T A;  3C6A A;  2QI2 A;  5JMV A;  4IEI A;  1QQO A;  3M1F A;  2ASO A;  3VEW A;  3WEE B;  4Y0W A;  3WXK A;  3L0Q A;  4IOC L;  2ZWH A;  4WFA L;  4H5W A;  4KBO A;  1NGC A;  2NRH A;  4B1U B;  1NJI O;  3CQY A;  4JKH A;  3SAF A;  3E9O A;  1VQN N;  1Q18 A;  5BRD A;  3HRG A;  5F2R A;  3Q7C A;  4IO9 L;  3QBW A;  2F9T A;  1GLD G;  2J4R A;  1BU6 O;  4BY9 C;  3CF5 L;  4JAX A;  3CCR N;  4WFB L;  5LJW A;  5AQJ A;  4JK8 A;  4FPB A;  2Q0R A;  2YJE A;  5AQL A;  3T7Z A;  1YJN N;  1RFQ A;  1SQK A;  1TYQ B;  4YOV A;  4WQ5 A;  2ZF5 O;  1DGK N;  1JCE A;  3FZK A;  2HBM A;  2NRT A;  2NZT A;  4O5F A;  4RTF D;  5CR4 A;  5FPM A;  4YOT A;  3VEZ A;  1SAZ A;  4BVP A;  5GAE P;  3U8X A;  5M1F A;  1VQK N;  1Q81 O;  1TYQ A;  1YVN A;  3B8A X;  1GLE G;  5AQU A;  2D0O A;  2CGK A;  5AZJ B;  1RDU A;  4JNE A;  3TTF A;  4FO0 A;  1NGB A;  1VQ7 N;  2Q1N A;  3LDP A;  4F9O A;  1N8R O;  2E20 A;  2FSN A;  4R79 A;  3OBY A;  3UKR B;  3TSQ A;  3ZEU A;  5GAG P;  5DM6 L;  4EHT A;  5LY3 A;  1BO5 O;  1HLU A;  4H0V B;  3R9P A;  4MO4 A;  1ATS A;  3EN9 A;  5ELZ A;  3CC2 N;  3S41 A;  4IOX A;  5BRH A;  1DKG D;  4G9Z A;  3BF3 A;  1QZ5 A;  3OHR A;  3O6W A;  3IKM A;  3CCS N;  4BQZ A;  2E2O A;  2HBJ A;  2A5X A;  3MN6 A;  4H0O A;  3NVK A;  3VEX A;  2QEX N;  4BRO A;  2QWN A;  3WQU A;  4MLH A;  2RE2 A;  1IJJ A;  1ESV A;  2A6A A;  3BEX A;  3RVC A;  3GE1 A;  3SBT A;  2E8A A;  1ILY A;  5AQR A;  1YJ9 N;  4BR0 A;  1OKJ A;  1LOT B;  2NRW A;  3VTH A;  3Q7B A;  1VQP N;  1NGI A;  4AM7 A;  1Q86 O;  5M1P A;  2HMP A;  3TSU A;  5JIC A;  4C23 A;  2YI1 A;  3ENO A;  3A5M C;  3VEV A;  3WQT A;  2AP1 A;  3L4I A;  4B9Q A;  5F1X A;  3CMA N;  2F9W A;  4B1W B;  3E66 A;  3TPQ A;  5JLH A;  3KHY A;  4BG9 A;  3H1Q A;  4IO8 A;  3DXM B;  1MWM A;  2OAN A;  1G99 A;  2NRV A;  2YHX A;  3CJB A;  2D0P A;  2KKZ A;  5JVG L;  2ZJQ L;  3CI5 A;  3HBT A;  1BWF O;  1NGD A;  3N4P A;  4IDH A;  5EXW A;  4FWM A;  2IVN A;  3BF1 A;  4K41 A;  5EY4 A;  3UKU B;  3CJC A;  2WC9 A;  1YF5 L;  4ILH A;  3MN9 A;  2YCH A;  1S22 A;  2P9P B;  4JKA A;  5AQG A;  3P39 A;  4FWP A;  1NLV A;  2ITM A;  3DWL A;  4JKF A;  2D4W A;  3FZL A;  3UKU A;  3H3N O;  4FOE A;  4OPH A;  1D4X A;  4WQ5 C;  5EOY A;  1BUP A;  3IFR A;  5C2F A;  2V7Z A;  2P9P A;  5FPN A;  1JCF A;  3CJ1 A;  1O13 A;  2WUS A;  2GWK A;  3D2F B;  3H6E A;  3CCL N;  3AGK A;  2D1K A;  4CJ7 A;  2GTD A;  3O9Q A;  3CC7 N;  4IZ9 A;  3VGL A;  3FZH A;  1T6C A;  4H5V A;  2WBN A;  3WUH A;  5MLC Q;  3HM8 A;  1NGH A;  3QDK A;  1NMD A;  4UY8 O;  2HST A;  4MDB A;  5AQM A;  1KAZ A;  2BTF A;  2HBK A;  4CD3 A;  3ZX3 A;  4B1X B;  3PLA A;  3ATV A;  4DB3 A;  3VTI A;  4BRM A;  3GG4 A;  1RGI A;  1NWK A;  2P9K B;  4U67 L;  2QTD A;  4B1V A;  3CCQ N;  4H5R A;  5F0X A;  3G4S N;  2GX9 A;  2HBL A;  5ADX H;  3EE9 A;  3WT0 A;  3WEE A;  1YIJ N;  3FZF A;  1YAG A;  5AR0 A;  4AM6 A;  4BRE A;  3MX5 A;  2P9K A;  3CXC M;  2P9S B;  4PL8 A;  4MDA A;  1X9J A;  1YHQ N;  1VQ6 N;  1C0F A;  3P4I A;  3E9P A;  4JEP A;  5BN8 A;  3IMX A;  3VMF B;  5C0Y A;  5KPT A;  1BOT O;  1CZA N;  1R59 O;  4GVE A;  3CCJ N;  4JKG B;  4XEI A;  5AQZ A;  3OBW A;  4M63 C;  3A5L C;  1YI2 N;  3QFP A;  4AF1 A;  3DJC A;  3MN7 A;  3MCP A;  1GLA G;  2E2N A;  3H3O B;  3IDH A;  4EAH D;  4RWT A;  3HI0 A;  1KD1 O;  3SLC A;  4JKG A;  3OA9 A;  4YDU A;  2JWK A;  3E9L A;  4IOA L;  5ADX A;  1QQM A;  3R6M A;  3K9J A;  1Z05 A;  2GEM A;  2QWO A;  3EKU A;  4K43 A;  3LL3 A;  4BRI A;  2VWB A;  5EVZ A;  3R8E A;  1Z6R A;  3LDN A;  1M1K O;  3O1B A;  1K9M O;  2YX6 A;  1C0G A;  2GWJ A;  4PHT X;  3QIC A;  4CZG A;  4FL9 A;  4LC9 B;  2YJF A;  4CBU A;  5AZJ A;  3J7Z O;  5AQQ A;  2V51 B;  4JKD A;  3O9U A;  3E1Y A;  4I6M B;  3HSC A;  4BRC A;  1X3N A;  4IFE A;  3SMS A;  4WF9 L;  2Q0U A;  4PL7 A;  2YHY A;  4CBX A;  4KH4 A;  3FR0 A;  2I7P A;  4RCH A;  3UKR A;  2IVO A;  1MDU B;  4FWN A;  3U9Z A;  3PIP L;  2A3Z A;  3G71 N;  3DLL L;  5KQ8 A;  4FWS A;  1GLC G;  4IEE A;  1K73 O;  4I6M A;  3CME N;  5AQP A;  5JLF A;  4WQ4 A;  2Q36 A;  3L6Q A;  3I55 N;  3TSP A;  3NVM A;  3O8M A;  5BN9 A;  5H1S Q;  2A40 A;  2PFU A;  1W97 L;  4BC3 A;  4JD2 B;  4IXC A;  4BVO A;  3H45 C;  4XH4 A;  3A5O C;  1YXQ A;  3ENB A;  4ISE A;  3A5N C;  4YOU A;  2HOE A;  4BRQ A;  3CPE A;  3WXI A;  3L4Q A;  3SMP A;  3DAW A;  4FWK A;  3BP8 A;  4JD2 A;  1V4S A;  2FXU A;  4BRD A;  3F5T A;  1SZ2 A;  1EO1 A;  3RSE B;  2VCP A;  5AFU H;  2NRZ A;  1DT9 A;  4QS8 A;  4BR7 A;  2FSJ A;  5FPD A;  5FPE A;  4FPA A;  4JK9 A;  2ASP A;  4Z94 A;  4BRP A;  1YJW N;  3G25 A;  3DXK B;  3RSE A;  3CCE N;  3EZW A;  1K8A O;  3VGM A;  3DXM A;  4PKI A;  2Q97 A;  4GV6 A;  4JKC A;  4K42 A;  1E4F T;  1YUW A;  4MO5 A;  3VPZ A;  2V52 B;  5BPM A;  5AQI A;  5M1Q A;  4A2A A;  3DXK A;  3VEO A;  3CCU N;  1QHA A;  2ZJR L;  4FSV A;  2YHW A;  3FFK B;  3SK3 A;  1KQS M;  1WUA A;  2P9U B;  5GAH P;  4H0T B;  1DEJ A;  2W41 A;  3C65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...